2DMPA

Solution structure of the third homeobox domain of zinc fingers and homeoboxes protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSSGSSGAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the third homeobox domain of Zinc fingers and homeoboxes protein 2
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc fingers and homeoboxes protein 2
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmpA01
4XICA 3LSRA 4CYCA 2DA3A 2TRTA 5EG0B 1TWGJ 3OOUA 2IEKA 1JKOC 2OF7A 5GPAA 3BQZA 2YUSA 2M2EA 2JK3A 2EZIA 3JRAA 4S0HB 3HGGA 1MSEC 2DA1A 1MSFC 4FE4A 2CUEA 1VFCA 3VPRA 1FEXA 2ME0A 2L9RA 3F0CA 2X48A 5EEAA 2NVXJ 3FIWA 1XC5A 3ZQGA 3HOXJ 2HDDA 1QVTA 1RPWA 1Q1VA 2LLKA 5DTDA 2K9SA 5J1RA 3OSGA 4A3LJ 3ZQCA 1MBHA 2XB0X 4A3GJ 4FTHA 2P81A 4C3HJ 3Q0WA 5EYRA 3S2DJ 5EZGA 2JA7J 3CCYA 1AHDP 1IUFA 2XGCA 5J1UA 3BTCA 2ME6A 4X6AJ 3HGYA 3I4MJ 1IG7A 3W6VA 2K40A 3FK7A 4HNVA 1SANA 2XSDC 1RETA 4MFDA 2KDZA 3HDDA 1O4XA 1UMQA 5FKLA 2VKVA 3S15J 5IPAA 2W48A 2EZKA 1ETQA 2HOAA 1B8IA 1IGNA 4JX4A 2AHQA 2K9NA 4IHYA 3O8GA 3M4OJ 3QPLA 4NDLA 3L1PA 3K2AA 1U9OA 1HDDC 2NS7A 1E3OC 4FCYA 2H8RA 5J1YA 2K9QA 2DMQA 1IRZA 2CRGA 4LOCA 1MBJA 5EG0A 3B6CA 2CJJA 2DA4A 2IAIA 4BBSJ 2XGEA 2HQ5A 4A3BJ 2M0CA 4I6ZA 4DYQA 1H89C 4XRMA 1X2NA 3I4NJ 4IEJA 2Y9ZA 1IJWC 1BL0A 4D7NA 1IDYA 3LOCA 3BR2A 3CQZJ 3G1OA 1BA5A 1K83J 3NAUA 3BR6A 1HOMA 1ETVA 2E2JJ 1NK3P 1ETWA 3FISA 2CUFA 2L0KA 1PUFB 4M3EA 5FKOA 2MGQA 4A3MJ 1B72B 1Z0XA 2E2IJ 1EF4A 1D5YA 1MBEA 1W0UA 1HLVA 4DZPA 1OFCX 1RR7A 4BY7J 1PUFA 3HOWJ 1R9TJ 2X6OA 1HCRA 3O8HA 5EZHA 3NARA 3QPSA 4M3GA 4C2MJ 3PO2J 1I3QJ 1DU6A 3LSGA 5FKNA 2R5YA 2X9DA 3MN2A 3BT9A 2LKXA 2R0QC 5E3MA 2Y30A 4M6VA 4DYRA 5K7HA 3HOZJ 1ZK8A 1TWHJ 1Y1VJ 2LVSA 4W97A 3S1RJ 4M3DA 3HM5A 1HDPA 1MBKA 2DA7A 3JRDA 2H1KA 3IV5A 1Z77A 3TW6A 1ZQ3P 2YU9J 3LSJA 2JA6J 5EGOB 5EF6A 3PO3J 5F0HA 4L5EA 5FKMA 2HOSA 4FISA 4A3FJ 2AO9A 4B1RA 3SJMA 1JT6A 1P7IA 3HB9A 1TWFJ 4ABZA 5K7ZA 1GDTA 2WAQN 2I10A 3LSPA 1Y1WJ 3M3YJ 1JGGA 3G1LA 1JUPA 4D5CA 4A3CJ 4Y52J 2VUMJ 3GTLJ 1WH5A 4V2GA 1BJZA 3WHBA 2CU7A 4XRSA 1ETKA 2L7ZA 1UHSA 1OJLA 1APLC 2XRLA 2DA6A 2NVQJ 2VPRA 1GUUA 3Q0VA 5E3OA 3RQIA 3TP3A 1X58A 4M3BA 1GT0C 3BR5A 1HF0A 4QTRA 2R7ZJ 1NTCA 1NK2P 3BTIA 3HOYJ 5C4JJ 4QIWN 2O7OA 4A3KJ 2GM4A 1XG1A 2ID3A 5IP7J 2CQXA 3ZQHA 2R92J 4BXXJ 4MO7A 3B6AA 4AUXA 3E7LA 5FKKA 4B4CA 3TEDA 1JUSA 2R5ZB 5IYDJ 2XGDA 3BG3A 4JYKA 3H0GJ 1A6IA 5M3MJ 2EZLA 4BY1J 2E2HJ 4A3JJ 5EGOA 2M8GX 4Y7NJ 1FTTA 2EZHA 4M3FA 1RKWA 2DN0A 3RZDJ 3WHCA 5DS9A 2VKEA 5JLWA 5M3FJ 3QQAA 2FD5A 3GTOJ 2M9HA 4B3AA 3JRIA 1MH4A 1JJ6C 3GTKJ 1WH7A 1AU7A 2EQRA 1RESA 4C3JJ 4GFBA 1I6HJ 3S2HJ 1AKHA 1S7EA 5F04A 2HYJA 2JJ7A 4IHVA 2DJNA 2XPWA 3BR3A 4UUSB 1BW5A 1GV2A 2DA2A 5C4XJ 4D5FA 1H8AC 4AC0A 2XPVA 2G0EA 4MFEA 2IBDA 4IHWA 1OCTC 4X1EA 5EDNA 1B8IB 2R93J 1F43A 5M5YJ 3HKZN 5IP6A 3A02A 2DTZA 1ZR2A 5IOYA 3DEWA 1GVDA 3S1NJ 2QCOA 4MIMA 1WGXA 2RAEA 5J3LA 1LFBA 1FTZA 5C44J 4FE7A 2OPTA 1TC3C 5HODA 4BKXA 3FKIJ 1MNMC 1FIAA 3LNQA 5F08A 1LFUP 2JWTA 2NVTJ 1MBFA 3DCFA 1SFOJ 4BBRJ 3JRGA 3ZQFA 3OSFA 3TP0A 2B63J 2ID6A 4RDUA 2E19A 2NVYJ 1ZTRA 5FLVA 3S16J 1TWAJ 1VNDA 2LR8A 5FLMJ 2HOTA 3H3VK 4MLOA 3S14J 4XIDA 5M5XJ 3A01B 2LY9A 3JRHA 2Y31A 2M34A 2WB1N 2DMUA 2JN6A 5K7FA 3A01A 2L7MP 3A03A 3JREA 3BTLA 4IHXA 4XRSG 1ETXA 2Y0SN 4A69C 1ETYA 1POGA 1CQTA 2FJ1A 3ZOBA 1MBGA 4DYCA 3JRBA 3IH2A 1WPKA 4JX6A 1AKHB 3BQYA 3CMYA 1QPIA 2DMPA 1GV5A 1ZR4A 4A3IJ 3HOVJ 3HBLA 3IH4A 1ORKA 1JTYA 3S1MJ 4A3DJ 1U9NA 3C2BA 2ECBA 1ZGWA 3MKLA 5F27A 1JKRC 2DMNA 2HXOA 1IC8A 1ITYA 1UG2A 4I76A 2NOGA 1U78A 2CQQA 3D1NI 4JX5A 2JMWA 1G2HA 1XS9A 1I50J 2R5ZA 1T56A 1JT0A 1ENHA 3HEFA 3MVPA 4XK4A 1VF9A 4RBOA 2R5YB 2GBYA 1U8BA 2D5VA 5GP9A 3BG5A 1P7JA 2HI3A 2WV1A 4UUTA 5F1JA 2MG4A 2L7FP 1QRYA 3ZQLA 5F0FA 3JRFA 2O9LA 2HXIA 2LFBA 3GTPJ 3GTJJ 5BNGA 4QSHA 2FX0A 3Q3SA 4UUSA 1WCMJ 3GTGJ 3RKQA 3Q0UA 3HOUJ 4JP0A 5F0CA 1JKQC 3BR1A 5E3LA 2DMTA 2ELKA 3G1MA 3BG9A 2VI6A 1QVUA 5M5WJ 2TCTA 1JKPC 2EBIA 4A93J 1F36A 1A5JA 2QF7A 3PM1A 4J19A 2LP0A 2PMZN 2ZB9A 1JTXA 3BR0A 4AYBN 1DU0A 1RKTA 3GBGA 1W0TA 1K61A 5FJ8J 2N8GA 1WI3A 4D7MA 3K7AJ 3JR9A 2Y2ZA 3RZOJ 3SFIA 1X2MA 3S1QJ 4V2FA 1IDZA 1TWCJ 1VI0A 2DA5A 1ETOA 1H88C 5GPCA 2ECCA 4DZJA 1LE8A 3GTMJ 2JA8J 5IP9J 5C3EJ 2EH3A 2LK2A 4DW6A 2O8KA 1IV6A 3IH3A 5IOZA 1OCPA 3TW7A 5IYBJ 5E3NA 2GLOA 2Y9YA 2XPUA 2E1OA 1B72A 2JA5J 4EEFG 2COBA 3JRCA 2LD5A 2FQ4A 5JLXA 3CDLA 1LE8B 4C3IJ 1MH3A 9ANTA 1JUMA 2NS8A 3FK6A 1BW6A 3GTQJ 2LTPA 2XB5A 1JJ8C 1FIPA 4CYCB 3ZQIA 3S17J 2YS9A 5IYCJ 1T33A 1ZKGA 4G12A 2MW8A 3BTJA 3SDGA 4A3EJ 3UKGA 1FJLA 1YRNB 4W1UA 2MSYA 3OIOA 1YRNA 2KT0A
chains in the Genus database with same CATH superfamily
3H35A 4CYCA 2TRTA 3MZYA 1B6AA 1D0YA 1TWGJ 2PJRA 4C9YA 2CV0A 2JUCA 1JKOC 5FROA 4CCJA 2CS3A 1HKTA 2VE8A 4AIKA 4CZZA 4S0HB 5TISC 1MSFC 2HR3A 3TOBA 3ROUA 1FNNA 5CLSA 3PIOF 4A6DA 5HDGA 2V1NA 2YR2A 2JVHA 1FX7A 4A0ZA 1X1BA 2J5PA 3NEUA 2EIJH 2WAQA 4A2UA 1Q1VA 4EMSA 5DTDA 4RLFA 1FLIA 2HKOA 4TV7A 4A3LJ 4A3GJ 3L2RA 4FTHA 2DTRA 2VBXA 4C3HJ 4IRHA 3Q0WA 2W24A 4P55A 1RRJA 4LK1F 3S2DJ 4OU0A 2JA7J 1VQ5I 3MZHA 1VQ7I 1AHDP 2ESHA 3PQJA 4CA0A 2XGCA 4G8XA 1DPRA 1E17A 5CVUA 2BOLA 3OS1A 4BE2A 2M0MA 3I4MJ 3GFLA 3H3UA 2F5EA 1WZ2A 1SANA 2JQ7A 2KDZA 1O4XA 3CC7I 3LMMA 3RDIA 4BE0A 5FKLA 5L3CA 2Q2EB 1GXPA 5E1ZB 2R7RA 2VKVA 2HDCA 1IXRC 5D6EA 3WTTC 3I53A 3P5JA 5F1RA 2P6TA 3CCSI 5GAHJ 2DK5A 1R4NB 1QNTA 2VC0A 2CUZA 2HDWA 1IGNA 1G3SA 5CJ9A 5DM6F 4RB2C 1T0FA 4E7LA 3O8GA 2VXZA 2ZMEC 4WWCA 2EFOA 4UUVA 1LPQA 3F8FA 2Y0MA 4G94A 2NS7A 2QYOA 1HQCA 1BIBA 4FCYA 5J1YA 2DMQA 3NWSA 1IRZA 4UXNA 2A3SA 4BBSJ 2XGEA 5B1BH 4I6ZA 4JK1X 5HNHA 4GCVA 1LEAA 3R61A 1PYVA 4XRMA 4KISA 1X2NA 1Y0NA 4PUSA 1BL0A 4I7HA 1KU9A 3G1OA 2E35A 1K83J 2D1VA 4UVBA 4WF2A 3CMEI 3AKZA 2VT3A 4OIRF 1WFXA 4HAMA 1NK3P 3FISA 3QP6A 1XGNA 2MGQA 2LH9A 4ZDOA 4E6KG 2L9VA 5HVQC 4UVCA 4DZPA 1Z7LA 4D0PA 1E0EA 2FBHA 1PUFA 4ETSA 1F1ZA 4ENKA 2HGCA 2BVMA 4ZYAA 1IRFA 1S7OA 1USSA 1YW9A 3U1KA 1D1AA 3I3LA 1IUYA 3W3CA 3A2KA 3M7GA 2Y30A 4DYRA 2V9VA 1XGSA 2VONA 1D3YA 1TWHJ 3O3KA 4AVZA 3CCMI 3S1RJ 5GAEJ 3R6SA 3K4NA 3BG6A 1ZQ3P 3LSJA 2MA3A 2JA6J 1X19A 3OYCA 5F64A 2KJBA 1YW8A 2E1MC 4FISA 4A3FJ 1SAXA 1W1WE 1TWFJ 4B47A 4M6XA 4NQWB 3OS0A 2IS4A 1JHHA 1IRXA 2GA1A 2QSFX 1GDTA 2DU9A 4RLQA 4R79A 3FMRA 1F5TA 3B73A 3DPUA 5JR3A 3LSPA 1Y1WJ 1JGGA 3HPHA 3G1LA 1ERDA 4EJWA 2VLAA 4KIBA 4ZTFA 4RMNA 2RQPA 4ASNA 3GTLJ 4BQNA 4XRSA 2VOOA 3BCBA 2VBWA 1UHSA 5A2QK 3I71A 1OJLA 1TQIA 5D5WB 1T0FC 2A5WA 4RA2A 1HA8A 3BWGA 1X58A 4IF4A 1GT0C 1LB2A 3BR5A 1HF0A 2BW3B 2GOXB 3IUOA 2B0LA 1JI8A 2RN7A 5C4JJ 4QIWN 5HNFA 2GM4A 5E1XA 4KIFA 2XF7A 2R92J 4MO7A 1BI0A 4WCGA 3E7LA 4B4CA 1JUSA 2FE3A 2L4AA 3O2PE 4FHTA 4UV8A 4XLHA 4RM2A 4ZDPA 4Y3OA 2EV6A 4C2TA 5M3MJ 1OQYA 1X1DA 2EZLA 3ONQA 5EGOA 2XGXA 3CF2A 4Y7NJ 3Q9SA 4M3FA 2M3AA 2DN0A 2P5KA 3WHCA 2E36A 2K4JA 5J8FA 2M9HA 3PFYA 4KDPA 1UHWA 2X6YA 1AU7A 4C3JJ 2ZMEA 1I5ZA 5GAGJ 3KZYA 2FOKA 4IVNA 1FYMA 5LRSA 3DPLC 3KP3A 1LFPA 3KYLA 1YFHA 1SD5A 3AL0B 3BR3A 4YIRX 4AU7A 3ML6A 1BW5A 3BZKA 3EETA 2DA2A 1LEBA 4YEJA 1H8AC 2ACJA 4AC0A 4PCQA 2X1CA 1WRJA 3V7CA 4X1EA 5EDNA 1XSXA 5IP6A 5D5VB 3A02A 4ENJA 1SEUA 2LY2A 2JRTA 3IRRA 3HSFA 2QCOA 1ZELA 1SMTA 3KCCA 4F52A 5J3LA 2ELHA 2ZMEB 3WU2C 1Y39A 2A07F 2H09A 3DPTA 4F3QA 1ONVA 5KNLA 1FTZA 5TRDA 1MJAA 5HODA 3FXMA 1TZLA 4KYWA 3LNQA 4G6QA 1GXQA 2ZBKA 1UHMA 1QGPA 4IL6C 2IS2A 2MABA 4BBRJ 3ZQFA 2FMYA 4E7JA 5E8GA 3MD2A 3IWZA 2ID6A 2P6SA 3W6JB 3WE3A 5LFAA 3OYLA 2V6EA 3CP2A 4FX4A 2EJRA 1PDNC 1LNWA 4EM2A 4ENMA 4RAZA 5FLMJ 1P9QC 3D5RC 3QOPA 3V8KA 4U88A 3FKJA 2DFFA 2I8DA 3M1EA 3A01B 1ZRCA 3JRHA 2Y31A 2M34A 2HZDA 2JN6A 4AD9A 2HYGD 2R4GA 4N9HA 3U21A 2Y75A 2PX9A 1F4KA 2L7MP 1R4MB 3K6GA 3I59A 4OOIA 3ZCOA 4IHXA 2ZJPF 1O7FA 2KRHA 4B3XA 2Y0SN 2DFIA 2HPMA 3ECHA 1CQTA 2L2OA 2FJ1A 1B59A 4AYBA 3FM5A 4D1QA 2K4BA 4R8HA 1ZARA 4QPOA 4HSRA 2UV1A 1YOVB 5LLQA 1QPIA 3OYFA 3NRVA 4A3IJ 3HOVJ 2VJ5A 1TW3A 1ORKA 2GZWA 3OIOA 1YS6A 1D0XA 4AIHA 3C2BA 1ZGWA 2C6YA 1IN8A 2V79A 3OIPA 4HNTA 3N05A 2HXOA 4RS8A 4KMFA 3K4MA 1P92A 5HS9A 2RKHA 3V4GA 4GYGA 1G2HA 1J2XA 1NG6A 3A0BC 3MKZA 2R5ZA 3A4CA 1ENHA 3S2WA 3MEXA 4BXFA 3BG5A 1X3UA 5FRNA 1UB9A 4RGRA 2WV1A 3K4CA 4H4KC 4K2EA 4Q47A 4BJ5C 3GYHX 5BMZA 2MG4A 2L7FP 2BY1A 3H5AA 1WJFA 1AOYA 2K27A 1YI2I 4HX8A 5F0FA 4G6DA 3ERMA 4YFNF 2HXIA 3GTPJ 1IN4A 1UG0A 4RB0A 3RKQA 1T2KA 4RB1A 2QQAA 3LSMA 5FFZA 3BJOA 2W00A 1XPXA 1DGRM 3TKYA 4JP0A 5F0CA 1X4PA 4A0XA 4KT6A 3ESWB 1O3TA 3BR1A 5E3LA 1OCOH 1OLTA 4O5VA 1I6XA 1ZH5A 2RVCA 4ZYEA 2VI6A 1N78A 2H6BA 1HBXG 3KE2A 2P8TA 3A1YA 1F36A 1ZHFA 4ITVA 4J19A 2ZB9A 3L00A 1TQMA 3BR0A 3CCJI 4XORA 1W0TA 1G6NA 4EVIA 1SD6A 1WI3A 3K7AJ 4EJTA 2MD5A 4UY8I 2XAFA 4QWQA 4XN3A 3ZMSA 1X2MA 4V2FA 1H9GA 3LSIA 3LQRA 3BLYA 2LREA 2DYSH 5JFRA 2ECCA 4DZJA 3OY9A 5E79C 3VYUB 4LIVA 3PNTA 3MQ0A 4LD5A 2M5WA 3WGGA 3OS2A 3UR3C 2LKSA 4E7KA 1Z91A 1VQ6I 3E3VA 3SZTA 1SFKA 1UZCA 5IOZA 3VOEA 1SVMA 3IHUA 3HUGB 2W25A 2JA5J 4MNUA 4EEFG 2KKOA 3DKXA 1TL8A 2COBA 2NYXA 2JPCA 2FQ4A 3HJEA 5CVRA 1HW2A 4C3IJ 9ANTA 1YTYA 1JUMA 1O3RA 5AIPA 4G6TB 3SHFA 5AONA 3T1BA 2G7HA 2XF6A 1FIPA 3HC7A 5FLXZ 3PJRA 4CYCB 1RNLA 2Q0OA 4LFUA 3HPGA 1YO5C 5JHFA 2ZFWA 3OYJA 3HG9A 1NH3A 2LKPA 3SDGA 3OYGA 4KN7X 2MSYA 3BC8A 1TQPA 5J47A 1YRNA 2EV5A 1S9HA 2ELJA 3LSRA 2QM3A 2EK5A 1ZREA 2DA3A 4M74A 3E6BA 4AIJA 2GIVA 4DIQA 3COAC 1MIJA 2DDBA 1KGSA 4LLLA 2BV6A 2M2EA 1Z9CA 2JK3A 3KZZA 2EZIA 1Q1HA 3L2VA 3HGGA 4C30A 3SEZA 4E70A 2DA1A 4BNCA 2VBZA 2L9NA 1VFCA 3RKYA 4XBFA 2ZXIA 1R1UA 1ZGJA 1OCZH 3F0CA 1HSTA 1V54H 3K4KA 4BHPA 4N4NB 2L54A 3FIWA 1FOWA 2GAUA 3LSHA 5LD2C 1XGOA 4JBAA 2PMHA 3ZQGA 4IPAA 3OL4A 4CCKA 1VQ9I 4BE1A 1KU3A 2IGMA 2LLKA 3T8RA 2PJRB 5J1RA 3OSGA 2BY0A 3ASOH 1WJCA 5GTHC 5HS8A 2P81A 3E5UA 5H20A 5EYRA 1FZPB 1LDJA 3TQNA 1Z7UA 1D5VA 1I1SA 2KPMA 3L09A 5EZGA 5K5RA 1HKQA 2GOMA 3J7ZI 4HDUA 3SZPA 1RUNA 5J1UA 2QWWA 3CCLI 3K4BA 1IG7A 1K6YA 3W6VA 4BYYA 3FK7A 1FY7A 4MFDA 3HDDA 4L9NA 1R58A 2QA4I 1ULYA 4BQOA 5LGTA 1FC3A 3C2GA 2EIKH 2O0YA 2WADA 4P9UA 3S15J 2HOEA 1AA7A 4XKCA 2HOAA 1DQUA 3OYKA 3TDUC 3AAFA 4XMYA 2BBYA 5EEGA 2QKLB 4EM0B 3D0SA 4JX4A 2GXGA 4OMZA 3WG9A 2AHQA 1BM9A 2ZSHB 3E5XA 2HU9A 1BN5A 2PQ8A 2XC7A 2EPFA 3IAS2 1UAAA 2G9WA 3N4MA 3K2AA 5ICFA 1U9OA 1HDDC 3CUQC 2PLYA 3KEQA 4G9YA 2AQFA 3G2BA 4LITA 3OYBA 2CRGA 2H27A 3H36A 1R5ID 2B9SA 1MBJA 2HFHA 3WTYC 4I98B 2CJJA 4D9JA 2RC4A 3LWFA 3I55I 2M30A 4PK4A 5IT3A 3CCVI 1TW2A 4IHSA 4N4OB 4L0ZB 3FMQA 2XAUA 1UCRA 2R7WA 3ZMZA 1TT5B 1JGSA 4HV6A 5DCFA 1FBUA 2MFZA 4F92B 1FMVA 1IDYA 4DJAA 3LOCA 3TL4X 4IRGA 3W2WA 5L3DA 1A36A 3CQZJ 2NNNA 1P4AA 5D8KB 2XF5A 3H5NA 2E2JJ 2LRDA 1XN7A 2IVMA 3M1CA 2CUFA 2L0KA 4M3EA 5FKOA 3CJTB 5K5OA 3HRTA 2XDVA 1OFCX 1RR7A 4BY7J 3BZCA 2HVQA 3E0JB 4ZYDA 1HCRA 2NS0A 3O8HA 5EZHA 4GDFA 4C2MJ 4M3GA 2K9MA 1I3QJ 3CMAI 2OZ6A 5FKNA 2R5YA 1ZN2A 2LKXA 1V3FA 3OR1C 2F5CA 4KICA 3DTEA 1SMYF 3FF5A 4MGRA 4L0YB 4NC7A 4M6VA 3ZXSA 5K7HA 2E60A 4WXDA 2IGNA 3JRDA 2K3FA 2JTVA 1QQIA 1SD4A 3MMYB 2XRNA 1RZ4A 3OYEA 5FKMA 1KQ0A 5BPIA 3RI4A 2HOSA 1WSUA 2AO9A 3IKVA 1JT6A 5FD5A 3HB9A 3LSKA 4IOAF 5K7ZA 1QPMA 4B8XA 1R5GA 1FOYA 3WE2A 2XKOA 3QAHA 3WGHA 2IA1A 4XLAA 5LGUA 4IZZA 4BACA 2PFBA 1JUPA 2ZFUA 2DQRA 1BC8C 1U3EM 2VOPA 4MQ9F 2FUG2 5GTIC 3ZP5A 1SVLA 4LGWA 3WHBA 1ETKA 3ZR8X 2L7ZA 2JZYA 2UXXA 2QBYA 1S7AA 1Z21A 2W84A 2NVQJ 3H5RA 2XAGA 1H0MA 5J40A 4F7ZA 3H0DA 1FP2A 4U7BA 3EUHA 2R7ZJ 3RKWA 5KK1A 1NK2P 2XVCA 3BTIA 2OC6A 5H2FC 1MMSA 4LJZF 4LLGF 4PGGA 1A04A 1QZYA 4BU2A 4A3KJ 1XG1A 2CQXA 2R7DA 1U6GA 2PG4A 3ZQHA 3BOQA 3J81K 2QEXI 4BXXJ 1S29A 1OYWA 4O3MA 4OIOF 3CESA 2K5CA 2R7QA 3RPUA 3KLNA 3DFGA 4CCLA 3ZMTA 1OISA 2CH0A 2P7VB 5D4SA 3FXLA 2VKEA 5JLWA 2FD5A 1RR8C 1LDDA 3IC7A 2AQEA 4PJLA 1TLHB 3RPQA 5DCMB 1LQ1A 4GFBA 4OWRB 4NHJA 2WBMA 2O6GE 2LBFA 4Z6YA 4BL0B 1K79A 2A69F 3LFUA 1S6LA 5F04A 2HYJA 2M4GA 3LL7A 1FOKA 2OQRA 2CFOA 4CXFA 2GXAA 3CCQI 4ESJA 1GV2A 4XSZF 2X6WA 3C3WA 5FFXA 2M4KA 1OR7C 2WC2A 2M7AA 3DV8A 2XPVA 2G0EA 4MFEA 2IBDA 3QYFA 3G71I 1VQMI 1QBJA 4IHWA 4UNOA 2HQAA 3JTGA 3E97A 1F43A 3F6OA 3DEWA 1WHUA 2W82A 3B02A 2BEOA 1WGXA 1IXSB 2Z2SB 3HL2A 3L7WA 5DCMA 2OBPA 4PJNA 3K4LA 3SXYA 4XQFA 1T8IA 4KIGA 3BPVA 5C44J 3VYRB 1VQPI 3J80Z 1W7PD 2HNHA 4BKXA 1FIAA 2JWTA 2B7EA 2JRMA 3CCRI 4WK8F 4U7DA 2EFNA 1A6QA 4CSWA 4L5JA 1YIOA 3TP0A 2B63J 4GGGA 1OMIA 2D45A 3HTUA 2FNAA 2K9LA 1V5EA 5B1AH 4HOBA 1AWCA 2XUBA 1OCCH 5BQTA 5KAFC 3HSEA 3S16J 1TWAJ 3MAJA 2FQ3A 2LR8A 3LSTA 2XIGA 4LB6B 3ZGKA 3L2UA 1KQ8A 5E18F 4MLOA 5HLHA 3S14J 2X1EA 3MKYB 1K7AA 2LY9A 1R36A 4HZFA 2MC3A 2WB1N 3C7JA 3G6EI 2DMUA 1SAUA 4UVAA 2A5YB 3CZ6A 3F72A 5K7FA 3A03A 3A01A 3BTLA 3FWEA 3HYIA 2COMA 1ODDA 1SC7A 1ETXA 2GQQA 4O6JA 5DDGA 1ZG1A 4HQMA 5DV5A 2V1XA 3ZOBA 4I2OA 1XCBA 1BOBA 2F5FA 3LAJA 2WY8Q 3IH2A 2R7XA 1WPKA 4JX6A 3V8JA 2BY2A 1XSDA 1AKHB 3GXOA 2K7LA 1GV5A 5ED4A 1WKMA 1N25A 2CWEA 2MYSA 3IH4A 1KONA 3HBLA 5EEHA 3CO7C 3EUAA 1R49A 3E6MA 3F6VA 2XAQA 3BDDA 3MKLA 5F27A 2DMNA 1UG2A 2DFHA 4WXCA 3DLAA 2DLLA 3QYEA 1U78A 4Y4RA 4G7HF 2CQQA 4ENNA 2JMWA 3P9IA 1XS9A 3D5LA 3HKZA 1HKSA 4XONA 1JT0A 2R7TA 4RBOA 4CHUA 3FXRA 1VF9A 1TBXA 1B9NA 4I0BA 5J8CA 1P4WA 3G4SI 1MJBA 2WV0A 2HI3A 3RIRA 2FF4A 4BEHB 4UUTA 3KYDB 3WODF 5D8LB 2QQ9A 2KZGA 1QRYA 3FXUA 2ZC2A 3JRFA 3I59B 2DO7A 4DNCA 2DPDA 5DYMA 3FMSA 1X1CA 3GTJJ 5BNGA 4OAZA 1R00A 2ISYA 2LF7A 3GTGJ 3C1DA 4U0YA 3L2QA 2FBIA 2QSHX 2D1HA 2BHZA 5LHIA 2F4OB 4CCNA 2DMTA 2ELKA 4IO9F 1TTYA 2HTJA 3BG9A 4HX7A 2R7SA 5M5WJ 1ON1A 1JKPC 3K4JA 1NHAA 2IA2A 2QF7A 3PM1A 3MFKA 2A05A 1DU0A 1WWXA 4PFPA 2W7NA 3DXJF 2VKHA 5E20A 3J7YJ 3EYIA 3JR9A 3QP5A 1TNSA 1H9TA 3QPHA 1PUEE 4ESBA 3MWMA 3Q9VA 2LC2A 3GFIA 3GVAA 1IDZA 1TWCJ 2BVLA 1ETOA 3K2ZA 3CUQB 4LG3A 5GPCA 2DT5A 2NAZA 2UWMA 3KETA 1F9NA 3BCAA 1LE8A 4ZYGA 2EFPA 3QPTA 4BHCA 1S5LC 2KIMA 3CDIA 2HEOA 3I54A 1EH8A 3G73A 2V9PA 5C3EJ 1O3QA 3ASNH 5CYVA 2EH3A 4DW6A 2FU4A 2FNPA 4EV0A 5LHGA 3IRQA 2ZNZA 2O8KA 3IKTA 2QGUA 2CV2A 2KQRA 2YPRA 1B1BA 1M1EB 2MC4A 3LA7A 1USTA 2KJCA 3TW7A 5IYBJ 1QZEA 5HLTA 5D5UB 2IS1A 4BUPA 2E1OA 1B72A 3RYPA 3CDLA 5HDKA 2PI0A 4Y33A 3JTHA 5KAIC 4ZJZA 2NS8A 2KFDA 1BW6A 2H6CA 3CC4I 1MNEA 2LMDA 5B3SH 1I27A 2L7KA 2KIFA 3KIOA 1VQ4I 4XR6A 3EUHC 2DAOA 2ISZA 3QYBA 2MW8A 1IN7A 1YRNB 4A0YA 1FJLA 4W1UA 3BP8A 5IT9K 2KT0A 4XICA 2KLOA 1G4DA 3HXLA 4OIPF 4HF0A 5HS7A 4ON0A 1MMGA 5EG0B 4IX7A 4FT8A 5CKTA 3HTSB 2IEKA 3VYTB 2OF7A 3BQZA 4II3A 1IN6A 3JRAA 2OD5A 4HPQA 1RIOH 1K78A 2IGKA 1STZA 1YHQI 4YG2F 4FE4A 2CUEA 3AG1H 2EIMH 3HUGA 3C18A 3T5XA 3VPRA 1BR1A 2IP2A 3LFKA 1BI1A 2O03A 1L3LA 1FSEA 4BDZA 2VJJA 2NVXJ 1DGWY 5JI6A 4HDVA 1XC5A 3RYRA 1GHCA 2X85A 2V9KA 4M9XA 2HDDA 1QVTA 1RPWA 2VQCA 3WTXC 4Q5SF 2K9SA 3RKXA 3OR2C 3SDBA 2DT6A 2XB0X 3ABLH 1KU7A 3DBHB 4Y13A 2DT7B 2VQGA 2F2EA 2ICWG 2Z99A 1VTNC 2BYVE 2MLGA 1E2XA 4U87A 2VC1A 4M9ZA 1EA3A 4X0GA 1LUJB 4G7OF 2DQLA 4JQFA 4NBQA 2FRHA 3BTCA 3CP8A 2O3FA 3HGYA 4LK0F 1SVOA 2K40A 1P4XA 2XSDC 1YS7A 2X6XA 2DOFA 3QWLA 4KNYA 5IPAA 2AS5F 2EZKA 1ETQA 3CTAA 1B8IA 3IWFA 2VBYA 1S3JA 3QRFF 3VWBA 2NNYA 3HRSA 4GRIA 1ZAOA 3GMEA 4QLCU 1UFMA 1IN5A 1DP7P 3DU5A 4HA8A 3OYMA 1J75A 1T39A 3HHGA 3ELKA 4XLEA 3M4OJ 3QPLA 3V42A 4XRFA 1ZRFA 4LG0A 3F21A 3VEPA 3QODA 2H8RA 2L3DA 4BJTA 2VE9A 2QLZA 4RGUA 5EG0A 2A68F 2ZJQF 2DA4A 3R0AA 2BY3A 4F93B 3AG3H 4C2UA 2HQ5A 3Q5FA 4A3BJ 2M0CA 5L3EA 2KDOA 3K1PA 1A35A 1H89C 2O5RA 2Z5UA 3J7AY 3I4NJ 2Y9ZA 3DKYA 1IJWC 3SQNA 4D7NA 3S3NA 2DOEA 3K10A 1YYVA 1ZLKA 1BA5A 3NAUA 4YELA 2Z1DA 3BR6A 2KHMA 2V1UA 1HOMA 1S8NA 1ETWA 2CGPA 1B72B 1EF4A 4A3MJ 1Z0XA 3HOSA 2Q8KA 3ERED 1D5YA 1MBEA 1HLVA 5IY5H 1YQAA 1LDKB 3DTKA 1E3PA 1HW1A 1IRGA 1E3HA 5GADJ 2R7UA 2L02A 2X6OA 3NARA 4IQJA 1DU6A 3DKWA 5J4YA 1QZZA 4DGWB 3LSGA 2X9DA 4EQQA 3IAM2 3DF8A 4RGXA 1XTAA 1FBSA 1IAWA 2WA0A 1ZK8A 1VQOI 4KFCA 1Y1VJ 3T8TA 3V7SA 1FOXA 3DEUA 4M3DA 1HDPA 1MBKA 2DA7A 3I4PA 3PL8A 3WTWC 4EM1A 1Z77A 4P9FA 2YU9J 4AVPA 4EJOA 1WJAA 3JSOA 2QSGX 4AIDA 5EGOB 5EF6A 3CJQB 4ANJA 5F0HA 3I5UA 1YX5A 4L5EA 4HSTA 4S05A 2VIXA 1P2FA 3K1MA 1X1AA 3CLQA 4ABZA 3M9AA 4IOCF 1DDNA 1QA6A 1W36D 4XM3A 5TJJA 4XLCA 3ZQ7A 1IO2A 1CF7B 3WTUC 3WU0A 2E7WA 4F91B 3W2AA 2RNGA 1ACIA 2W57A 1MMDA 2QKMB 3H9GA 3JCUC 2P5LC 1ZGAA 4A3CJ 4Y52J 5CVVA 1IW7F 4AWXB 2VASA 2XAHA 4NC8A 4V2GA 2CU7A 2BGCA 4PJ0C 2I5UA 2DA6A 2E1MB 4R1HA 2VPRA 4CO8A 3HSRA 3KLOA 1GUUA 2BHYA 2JSPA 3NQOA 2V6CA 1XMXA 3PUFA 3K69A 3R4KA 3RQIA 3TP3A 3RJPA 6PAXA 3GZ5A 1C0WA 2OTJI 1BJAA 1EH6A 3KFWX 3PQKA 4NNJA 1PVEA 1MGTA 2EILH 1I1GA 1CF7A 2ID3A 3ZMDA 5IP7J 3OYHA 3H1CA 2MD0A 3GO5A 1K6OA 4BQAA 5IYDJ 2XGDA 3P9CA 1HSJA 3H0GJ 4BQQA 1GVJA 2GIZA 1RKWA 1UELB 2W1OA 4P1WA 3RZDJ 3WTSC 2ZXJA 3QQAA 4ESFA 3JRIA 2IRFG 4HX4A 1MH4A 1MDMA 1JJ6C 5LHHA 2HWVA 4XKVA 5LEKA 4L18B 5FD6A 3KP6A 3HRUA 2L9SA 1AKHA 5B5EC 4ZTJA 4FX0A 2WAEA 2JJ7A 2UXNA 1KQ9A 3CUOA 1Z1DA 2RREA 2QQBA 3S3OA 2XV4S 3DU6A 4QPQA 4UUSB 3HRMA 5CPRB 2Q1ZB 3CF5F 1W5TA 3VFZA 4XKBA 3F8BA 2H1LA 3KEYA 2VQHA 1OPCA 4BAYA 1OCTC 2QVOA 4YIIA 2HS5A 5M5YJ 2R7FA 2LSOA 2DK8A 4ZH4F 2M7BA 2V4JC 1GVDA 3S1NJ 4B43A 2KL4A 4MIMA 5JVTA 1PP8F 1J5YA 1LFBA 2KP6A 1D8JA 2OPTA 1TC3C 1KYZA 2KRFA 3FKIJ 4MTDA 1KYWA 3M8FA 2ZJRF 1LFUP 1ZYRF 4CCOA 2NVTJ 2LG4A 1OCRH 1MBFA 1MMAA 5DM7F 4MEXF 1N75A 2CG4A 3JRGA 2DI3A 1CGPA 3KX2A 5FB2A 2DXIA 3L2CA 2DPUA 1G3TA 2VPLA 2VT2A 2JUGA 4I99C 4HG2A 4FQGA 3JAMZ 2HOTA 3H3VK 3EDPA 4DQ2A 3AL0C 2XHKA 4XIDA 5M5XJ 4EJVA 4M71A 5DUKA 3KP5A 2P5VA 3VDXA 2V1DA 2ETHA 4WXHA 5A2QZ 1FPQA 1KU2A 3JREA 4HYEA 4CYDA 1V55H 2KIQA 2NVUB 1N77A 1IZ1A 5ILUA 5HDNA 5D5XB 1POGA 3S8PA 4BS9A 3LAPA 4N9IA 1Z05A 3ZQQA 3GX4X 5ILSA 4KN4X 3ZMUA 2XKPA 3WG7H 4KA4A 3MZ8A 3CMYA 2RDPA 2FA5A 2LF8A 3ZMVA 2DMPA 1ZR4A 3MCZA 1DUXC 3DEEA 3ZRGA 2Y69H 1JTYA 3S1MJ 1U9NA 2STWA 4A5NA 3A0HC 2ECBA 3WGIA 5ICCA 1JKRC 1IC8A 1O7LA 4I76A 2NOGA 3J80K 3AG4H 3VYSB 2P4WA 4NC6A 3W6KB 4JX5A 1I50J 1LJ9A 2A6EF 3RSNA 4KUMA 1T56A 5ICEA 4XK4A 2LYCA 1U8BA 3BJAA 2D5VA 1FSHA 3QOEA 1MZBA 4KITB 3J7AO 3FX3A 1EJ9A 2CUJA 1FBQA 4WX9A 5F1JA 2G7UA 4E4HA 4I02A 3D5SC 3ZQLA 3WTZA 2V26A 1JXSA 3F8NA 2O9LA 3FBNB 2LFBA 1HXDA 5DD8A 3H92A 4QSHA 1MJ9A 2FX0A 2LY1A 3Q3SA 4LIUA 1R5HA 4XKWA 1ZG3A 5ERIA 3Q0UA 1O3SA 1YW7A 4JOMA 5H6RA 3M07A 1JKQC 5BPDA 1X3WB 5DUIA 2LBFB 1ZLJA 2M8EA 2VODA 2WAFA 2IXSA 5H6QA 1JE8A 5HLGA 2KMUA 1A5JA 1YLFA 2F5DA 4UB6C 2LP0A 2FBKA 1JTXA 4AYBN 1RKTA 1K61A 5FJ8J 3SEQA 2FSWA 1I39A 2CO5A 4H0EA 2Y0SA 3OYAA 3RZOJ 2HVRA 3SFIA 3S1QJ 1SFXA 1VI0A 2PMUA 4HLXA 3L2WA 2DBBA 2EA4A 4XN0A 2X51A 3U1DA 1QO0D 3GZ6A 3R60A 1XX5A 3NWTA 3DP7A 2HVSA 1TNTA 4Q4ZF 4YIFA 1DPUA 2JA8J 5IP9J 3OIQA 1MW7A 1BI2A 3I0TA 4IQ4A 3RPUD 2NOJB 4BDYA 2FMLA 5HOOA 1ZG5A 4EGZA 3OV8A 1KA8A 1W5CC 2E5ZA 4J01A 5ICGA 3OYNA 3EUKL 2ZO4A 2Y9YA 3QU6A 3CD6I 2XPUA 5DEQA 2Q2EA 3PUBA 3ECOA 1G3YA 3I9V2 4PFOA 4RAFA 1FWZA 3CLOA 2ZXHA 4II2A 2O61A 4U0WA 1RUOA 3F8MA 5JLXA 1LE8B 2VJ4A 1XDUA 1XCVA 3C2HA 3PNVA 4MEYF 5K1YA 3AG2H 3GTQJ 2WY7Q 2BXZA 2LTPA 2XB5A 1Y0UA 2PJPA 5BOXA 1W4MA 1VQ8I 1HC8A 4G7ZF 3ZQIA 3WU1B 3S17J 3GLLA 5IYCJ 1T33A 3GFMA 4B09A 2VN2A 3AFHA 1Z67A 1U2WA 3P9KA 1EKEA 3ABKH 3KP2A 3GEZA 1IV8A 2E1NA 3K70D 2JT1A 1BR4A 4S04A 3VSLA 2UUZA 1T08B 1Z6RA 3TOAA 3OOUA 1LVKA 3H3ZA 2CYYA 5GPAA 2RNJA 2YUSA 2X4HA 4XNFA 4OIQF 3OOPA 2OV7A 3FHZA 2ZSIB 1MSEC 2VJIA 2YX7A 1J7KA 2PBIA 5DD4A 4L9TA 3TO7A 1A31A 3CJNA 1FEXA 2F48A 2M1BA 2ME0A 3K9TA 4EATA 2L9RA 3P7NA 3OWTA 2X48A 4AM3A 5EEAA 2NXNB 1K78B 4FETA 3R0JA 3F3XA 3CC2I 3EQLF 1Y8QB 5FGMA 5JVGF 2Z3YA 4HQEA 2Z9OA 5FRMA 3RQ4A 5L3FA 2MH2A 5J6XA 3HOXJ 1QHGA 4I09A 5D4RA 2EA2A 2ZCWA 3ZQCA 1MBHA 1WJEA 2CQ7A 3LQQA 2EFQA 5IT9Z 1XMKA 1W7PB 1Y8RB 4L5IA 1YITI 2A6HF 1MD0A 4GYIA 4Y17A 3GW2A 1OYIA 5TGTA 4LMYA 3CCYA 4E7HA 1YE9A 1D1BA 3V7RA 5LRRA 1NG7A 1R6RA 1IUFA 5E1WA 1J0RA 2VQLA 4IJAA 4PJMA 2ME6A 4X6AJ 3CMMA 2LDUA 3PSFA 1MNDA 1T38A 4UHTA 3HHHA 1R1TA 3CO6C 4HNVA 5CQGA 1RETA 4IKFA 1OYYA 1LVAA 2LOOA 3GLXA 2BW3A 1UMQA 4RB3C 2J5OA 4RGSA 3X2QH 2XAJA 1VQKI 4NB5A 2W48A 1J9IA 4P5OA 2CV1A 2STTA 1VQNI 3DBLB 5CVJA 1Y56A 4B48A 3CDHA 2K9NA 4IHYA 4OINF 4GXOA 3DBRB 3VSKA 4M6YA 1LKXA 3M8JA 2OCEA 4NDLA 3L1PA 3GFJA 1BR2A 4P96A 4ZZLA 3RTRA 3DTIA 2E1CA 2K02A 1E3OC 3CUQA 3CCUI 2K9QA 4CH7A 2FEZA 3OMYA 4LOCA 1PJRA 2BXYA 5KCMA 3B6CA 1IF1A 3S3MA 1V5FA 5KVRA 3EYYA 2IAIA 1W5SA 4GO1A 4MHGA 2M45A 2R7OA 4DYQA 3LA3A 2R7VA 2E71A 3KP4A 2L01A 4IEJA 1D8KA 1SFEA 3KPHA 2IW5A 2YX4A 2DJIA 3BR2A 1Z6TA 1BC7C 1V4RA 2TDXA 3I64A 5BS6A 2D2WA 2DYRH 3TDZC 1ETVA 4Y15A 4NUBA 2PEXA 4HLYA 1PUFB 2E2IJ 2A61A 1VZ0A 1D1CA 1RC9A 3BY6A 3EPZA 1U0JA 5ILVA 4RM3A 3S93A 2UZKA 1W0UA 2DCEA 3ZN0A 3HOWJ 2IS6A 1R9TJ 4DBRA 3ABTA 2OUMA 4BEHA 4KMUX 3QPSA 3PO2J 1X3ZB 1YG2A 5FO5A 3MN2A 3BT9A 4HEA2 4UB8C 2IJLA 2R0QC 5E3MA 4OAYA 3E6DA 3GWZA 5HLIA 3F8CA 3HOZJ 3SZGA 2MH9A 2RV8A 2LVSA 3PFIA 4W97A 3HM5A 2H1KA 1T95A 3IV5A 1G8XA 2OTLI 2OJED 1S72I 1Y6IA 1ON2A 4NQWA 3TW6A 4XSXF 4M73A 3JW4A 2CMPA 3PO3J 2M87A 3SYTA 3W2VA 4B1RA 1UJ8A 3SJMA 1P7IA 1O57A 1W7PA 3J81Z 2WAQN 1Z3XA 2I10A 4LG0B 1ZRDA 5L3BA 2ZJ2A 3KYCB 3M3YJ 4CDGA 2F4MB 4E7ZA 4BGDA 2WTEA 4PJJA 4D5CA 5CVIA 2GWRA 1XGMA 1VQLI 2OZUA 2VUMJ 2IA0A 1B9MA 1MMNA 1WH5A 1BJZA 4ZZDA 1APLC 2XRLA 1I3AA 2JVGA 3MKWB 3Q0VA 5E3OA 4KT5C 2XSJC 3KEOA 4M3BA 4PSXA 3T0YA 3TO9A 4QTRA 1YJWI 3U9GA 2DW4A 1NTCA 1RI7A 4HRIA 3FBIB 2PN6A 1JHFA 2QUFA 3H9JA 3KZIC 3HOYJ 2O7OA 2CW8A 2F6CA 1D0ZA 2O8XA 4YFXF 2HQRA 2OAZA 3FM3A 3GF2A 2F5VA 3B6AA 3V8LA 4AUXA 5FKKA 3TEDA 2OU2A 2R5ZB 1BBYA 3VODA 4F55A 3BG3A 2PMZA 3ISPA 4I01A 4JYKA 1SFUA 1A6IA 2KISA 3I58A 5B66C 5LGNA 2E2HJ 4BY1J 4A3JJ 2WB1A 2M8GX 1FTTA 5AIQA 2EZHA 1WJBA 2AXTC 4A5MA 2W4SA 3F23A 1WJDA 5DS9A 5M3FJ 3O6BB 3GTOJ 4B3AA 3GTKJ 3TBIA 1WH7A 3HOTA 2EQRA 1RESA 3K0LA 1I6HJ 2L4MA 3E5QA 3HIFA 1OKRA 2OA4A 1P6RA 3S2HJ 2KIUA 1R23A 3FZVA 3REOA 3WTVC 2A6TA 1S7EA 1TT0A 4IHVA 2DJNA 5LBQA 2BE5F 2XPWA 2JSCA 1J09A 2E5NA 2GA2A 1XMAA 1WI9A 3F9KA 3FXOA 1T6SA 1FYKA 5C4XJ 4D5FA 3S32A 1FP1D 1R1VA 4Z2YA 3KP7A 4ZYHA 1B8IB 2R93J 1L0OC 2XROA 4FASD 3HKZN 1IXCA 2DTZA 1ZR2A 1YJ9I 1J59A 1XDSA 5IOYA 2QENA 3DWLE 3PNYA 4E7SA 4A12A 4HF2A 4HBLA 3JSPA 2RAEA 4BHBA 3ABUA 3H9QA 3FDYA 3F22A 4FE7A 2JPBA 5LEJA 4CCMA 2EWNA 3PIPF 4IHTA 5E8IA 2KRCA 1MNMC 2L5QA 2E7XA 5F08A 2ZKZA 3DCFA 1OR7A 3SFZA 1SFOJ 3BG7A 3OSFA 2CFXA 4XLNF 2K86A 3TMOA 4RDUA 2DDAA 2EFWA 4EJUA 2E19A 2NVYJ 3I56I 1MKMA 5L3GA 1ZTRA 5FLVA 1VNDA 1FT9A 4M9SA 1X4OA 2AXLA 2W85A 2CQKA 4BH9A 4CGZA 3FXKA 1U5TC 4IRIA 1DP3A 2QBYB 1G59A 2OQGA 4Q48A 2IPQX 4DOZA 3LA2A 3TO6A 2K85A 2Z16A 4XLPF 1YIJI 3IP4B 4U0VA 2F4IA 4XLFA 4XRSG 3OL3A 3K1NA 2WWYA 4LLNA 4A69C 1ETYA 1GLNA 4L9JA 4IXAA 1K4TA 2FOWA 4OMYA 1QU3A 1MBGA 4XOPA 4ZC3A 1FMWA 4DYCA 3M8EA 1Z3YA 3JRBA 1PP7U 4XL9A 3TGNA 4HV5A 1G3WA 3BQYA 4HW0A 4CICA 4V19K 3OYIA 1T98A 4YFKF 3GUDA 2ZNYA 4A3DJ 2V7FA 4HF1A 2MBFA 4CUGA 2FXAA 4E7IA 1U5TA 1ITYA 2CW7A 2VKDA 1WVRA 3D1NI 2EV0A 3FXJA 2R3SA 1XSVA 2HZTA 3UNGC 3HEFA 3MVPA 2R5YB 2GBYA 5GP9A 5D6FA 4BXUA 2ZXWH 3VB2A 1P7JA 1K4SA 1BI3A 3PSIA 2NRAC 5JHUA 3FXQA 1BOAA 1R7JA 1WJ5A 4PDKA 1EH7A 2EINH 2HTSA 2VXDA 4PSWA 4UUSA 1WCMJ 3RCOA 3ABMH 3ZPLA 3HOUJ 4UV9A 2HKXA 3HZJA 4ZDLA 2DFEA 1R71A 3FHNA 3G1MA 3BPXA 3JAMK 1XB4A 3QU3A 3U2RA 4KJZA 2ESNA 2JA2A 1QVUA 2RGVA 2EB7A 2TCTA 3G3ZA 1X1PA 4EGYA 2EBIA 3ZN1A 4XOTA 3DLLF 4A93J 5KHDA 2K3PA 4RAGA 3IL2A 2PMZN 2P0WA 4B44A 3GBGA 4I0AA 2DOAA 2N8GA 4M72A 4D7MA 1YX3A 4HNUA 5EJCA 2H8WA 2OCCH 2Y2ZA 5J4VA 5FLXK 2MLKA 2YSRA 4L9VA 4CZCA 2LNBA 5E17F 2DA5A 4YRVA 3E6CC 1H88C 4DBQA 3GCMA 2YU3A 2VB6A 3GTMJ 2IT0A 4PZJA 2P7CB 2HQNA 3N97A 1R22A 2LK2A 4BJ6C 2QQ8A 2QZ8A 3CJRB 1XD7A 1BIAA 4RAYA 4LB5A 1V5GA 4PGHA 2XASA 2CSOA 5F6FA 1IV6A 3IH3A 1B4AA 2DODA 2CW0F 2GXBA 1HW5A 3BZ6A 2Y48A 1OCPA 2GLOA 5E3NA 5K5QA 3L9FA 1FYLA 3BROA 1SD7A 1TP4A 3GZNB 3K70C 2ADUA 2HPIA 2VL8A 3JRCA 2LD5A 1REPC 3BJ6A 1MH3A 2CQNA 1KZHA 3FK6A 1YJNI 2H94A 2E34A 2KZVA 4A6EA 1JJ8C 3ULQB 2Z33A 3CCEI 1QHHD 4MQVA 4J00A 3DQVC 3E1SA 1WQ2A 2HYFA 2YS9A 4MTEA 1MDMB 1EV7A 2RQQA 5CQEA 1ZKGA 3BTJA 4G12A 4A3EJ 1U8RA 3UKGA 3OYDA 4N0BA 1U5TB 2BZTA 2X0LA 2IGOA 1W36C 2X1DA
chains in the Genus database with same CATH topology
4XICA 3LSRA 4CYCA 2DA3A 2TRTA 5EG0B 1TWGJ 3OOUA 2IEKA 1JKOC 2OF7A 5GPAA 3BQZA 2YUSA 2M2EA 2JK3A 2EZIA 3JRAA 4S0HB 3HGGA 1MSEC 2DA1A 1MSFC 4FE4A 2CUEA 1VFCA 3VPRA 1FEXA 2ME0A 2L9RA 3F0CA 2X48A 5EEAA 2NVXJ 3FIWA 1XC5A 3ZQGA 3HOXJ 2HDDA 1QVTA 1RPWA 1Q1VA 2LLKA 5DTDA 2K9SA 5J1RA 3OSGA 4A3LJ 3ZQCA 1MBHA 2XB0X 4A3GJ 4FTHA 2P81A 4C3HJ 3Q0WA 5EYRA 3S2DJ 5EZGA 2JA7J 3CCYA 1AHDP 1IUFA 2XGCA 5J1UA 3BTCA 2ME6A 4X6AJ 3HGYA 3I4MJ 1IG7A 3W6VA 2K40A 3FK7A 4HNVA 1SANA 2XSDC 1RETA 4MFDA 2KDZA 3HDDA 1O4XA 1UMQA 5FKLA 2VKVA 3S15J 5IPAA 2W48A 2EZKA 1ETQA 2HOAA 1B8IA 1IGNA 4JX4A 2AHQA 2K9NA 4IHYA 3O8GA 3M4OJ 3QPLA 4NDLA 3L1PA 3K2AA 1U9OA 1HDDC 2NS7A 1E3OC 4FCYA 2H8RA 5J1YA 2K9QA 2DMQA 1IRZA 2CRGA 4LOCA 1MBJA 5EG0A 3B6CA 2CJJA 2DA4A 2IAIA 4BBSJ 2XGEA 2HQ5A 4A3BJ 2M0CA 4I6ZA 4DYQA 1H89C 4XRMA 1X2NA 3I4NJ 4IEJA 2Y9ZA 1IJWC 1BL0A 4D7NA 1IDYA 3LOCA 3BR2A 3CQZJ 3G1OA 1BA5A 1K83J 3NAUA 3BR6A 1HOMA 1ETVA 2E2JJ 1NK3P 1ETWA 3FISA 2CUFA 2L0KA 1PUFB 4M3EA 5FKOA 2MGQA 4A3MJ 1B72B 1Z0XA 2E2IJ 1EF4A 1D5YA 1MBEA 1W0UA 1HLVA 4DZPA 1OFCX 1RR7A 4BY7J 1PUFA 3HOWJ 1R9TJ 2X6OA 1HCRA 3O8HA 5EZHA 3NARA 3QPSA 4M3GA 4C2MJ 3PO2J 1I3QJ 1DU6A 3LSGA 5FKNA 2R5YA 2X9DA 3MN2A 3BT9A 2LKXA 2R0QC 5E3MA 2Y30A 4M6VA 4DYRA 5K7HA 3HOZJ 1ZK8A 1TWHJ 1Y1VJ 2LVSA 4W97A 3S1RJ 4M3DA 3HM5A 1HDPA 1MBKA 2DA7A 3JRDA 2H1KA 3IV5A 1Z77A 3TW6A 1ZQ3P 2YU9J 3LSJA 2JA6J 5EGOB 5EF6A 3PO3J 5F0HA 4L5EA 5FKMA 2HOSA 4FISA 4A3FJ 2AO9A 4B1RA 3SJMA 1JT6A 1P7IA 3HB9A 1TWFJ 4ABZA 5K7ZA 1GDTA 2WAQN 2I10A 3LSPA 1Y1WJ 3M3YJ 1JGGA 3G1LA 1JUPA 4D5CA 4A3CJ 4Y52J 2VUMJ 3GTLJ 1WH5A 4V2GA 1BJZA 3WHBA 2CU7A 4XRSA 1ETKA 2L7ZA 1UHSA 1OJLA 1APLC 2XRLA 2DA6A 2NVQJ 2VPRA 1GUUA 3Q0VA 5E3OA 3RQIA 3TP3A 1X58A 4M3BA 1GT0C 3BR5A 1HF0A 4QTRA 2R7ZJ 1NTCA 1NK2P 3BTIA 3HOYJ 5C4JJ 4QIWN 2O7OA 4A3KJ 2GM4A 1XG1A 2ID3A 5IP7J 2CQXA 3ZQHA 2R92J 4BXXJ 4MO7A 3B6AA 4AUXA 3E7LA 5FKKA 4B4CA 3TEDA 1JUSA 2R5ZB 5IYDJ 2XGDA 3BG3A 4JYKA 3H0GJ 1A6IA 5M3MJ 2EZLA 4BY1J 2E2HJ 4A3JJ 5EGOA 2M8GX 4Y7NJ 1FTTA 2EZHA 4M3FA 1RKWA 2DN0A 3RZDJ 3WHCA 5DS9A 2VKEA 5JLWA 5M3FJ 3QQAA 2FD5A 3GTOJ 2M9HA 4B3AA 3JRIA 1MH4A 1JJ6C 3GTKJ 1WH7A 1AU7A 2EQRA 1RESA 4C3JJ 4GFBA 1I6HJ 3S2HJ 1AKHA 1S7EA 5F04A 2HYJA 2JJ7A 4IHVA 2DJNA 2XPWA 3BR3A 4UUSB 1BW5A 1GV2A 2DA2A 5C4XJ 4D5FA 1H8AC 4AC0A 2XPVA 2G0EA 4MFEA 2IBDA 4IHWA 1OCTC 4X1EA 5EDNA 1B8IB 2R93J 1F43A 5M5YJ 3HKZN 5IP6A 3A02A 2DTZA 1ZR2A 5IOYA 3DEWA 1GVDA 3S1NJ 2QCOA 4MIMA 1WGXA 2RAEA 5J3LA 1LFBA 1FTZA 5C44J 4FE7A 2OPTA 1TC3C 5HODA 4BKXA 3FKIJ 1MNMC 1FIAA 3LNQA 5F08A 1LFUP 2JWTA 2NVTJ 1MBFA 3DCFA 1SFOJ 4BBRJ 3JRGA 3ZQFA 3OSFA 3TP0A 2B63J 2ID6A 4RDUA 2E19A 2NVYJ 1ZTRA 5FLVA 3S16J 1TWAJ 1VNDA 2LR8A 5FLMJ 2HOTA 3H3VK 4MLOA 3S14J 4XIDA 5M5XJ 3A01B 2LY9A 3JRHA 2Y31A 2M34A 2WB1N 2DMUA 2JN6A 5K7FA 3A01A 2L7MP 3A03A 3JREA 3BTLA 4IHXA 4XRSG 1ETXA 2Y0SN 4A69C 1ETYA 1POGA 1CQTA 2FJ1A 3ZOBA 1MBGA 4DYCA 3JRBA 3IH2A 1WPKA 4JX6A 1AKHB 3BQYA 3CMYA 1QPIA 2DMPA 1GV5A 1ZR4A 4A3IJ 3HOVJ 3HBLA 3IH4A 1ORKA 1JTYA 3S1MJ 4A3DJ 1U9NA 3C2BA 2ECBA 1ZGWA 3MKLA 5F27A 1JKRC 2DMNA 2HXOA 1IC8A 1ITYA 1UG2A 4I76A 2NOGA 1U78A 2CQQA 3D1NI 4JX5A 2JMWA 1G2HA 1XS9A 1I50J 2R5ZA 1T56A 1JT0A 1ENHA 3HEFA 3MVPA 4XK4A 1VF9A 4RBOA 2R5YB 2GBYA 1U8BA 2D5VA 5GP9A 3BG5A 1P7JA 2HI3A 2WV1A 4UUTA 5F1JA 2MG4A 2L7FP 1QRYA 3ZQLA 5F0FA 3JRFA 2O9LA 2HXIA 2LFBA 3GTPJ 3GTJJ 5BNGA 4QSHA 2FX0A 3Q3SA 4UUSA 1WCMJ 3GTGJ 3RKQA 3Q0UA 3HOUJ 4JP0A 5F0CA 1JKQC 3BR1A 5E3LA 2DMTA 2ELKA 3G1MA 3BG9A 2VI6A 1QVUA 5M5WJ 2TCTA 1JKPC 2EBIA 4A93J 1F36A 1A5JA 2QF7A 3PM1A 4J19A 2LP0A 2PMZN 2ZB9A 1JTXA 3BR0A 4AYBN 1DU0A 1RKTA 3GBGA 1W0TA 1K61A 5FJ8J 2N8GA 1WI3A 4D7MA 3K7AJ 3JR9A 2Y2ZA 3RZOJ 3SFIA 1X2MA 3S1QJ 4V2FA 1IDZA 1TWCJ 1VI0A 2DA5A 1ETOA 1H88C 5GPCA 2ECCA 4DZJA 1LE8A 3GTMJ 2JA8J 5IP9J 5C3EJ 2EH3A 2LK2A 4DW6A 2O8KA 1IV6A 3IH3A 5IOZA 1OCPA 3TW7A 5IYBJ 5E3NA 2GLOA 2Y9YA 2XPUA 2E1OA 1B72A 2JA5J 4EEFG 2COBA 3JRCA 2LD5A 2FQ4A 5JLXA 3CDLA 1LE8B 4C3IJ 1MH3A 9ANTA 1JUMA 2NS8A 3FK6A 1BW6A 3GTQJ 2LTPA 2XB5A 1JJ8C 1FIPA 4CYCB 3ZQIA 3S17J 2YS9A 5IYCJ 1T33A 1ZKGA 4G12A 2MW8A 3BTJA 3SDGA 4A3EJ 3UKGA 1FJLA 1YRNB 4W1UA 2MSYA 3OIOA 1YRNA 2KT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIC A;  3LSR A;  4CYC A;  2DA3 A;  2TRT A;  5EG0 B;  1TWG J;  3OOU A;  2IEK A;  1JKO C;  2OF7 A;  5GPA A;  3BQZ A;  2YUS A;  2M2E A;  2JK3 A;  2EZI A;  3JRA A;  4S0H B;  3HGG A;  1MSE C;  2DA1 A;  1MSF C;  4FE4 A;  2CUE A;  1VFC A;  3VPR A;  1FEX A;  2ME0 A;  2L9R A;  3F0C A;  2X48 A;  5EEA A;  2NVX J;  3FIW A;  1XC5 A;  3ZQG A;  3HOX J;  2HDD A;  1QVT A;  1RPW A;  1Q1V A;  2LLK A;  5DTD A;  2K9S A;  5J1R A;  3OSG A;  4A3L J;  3ZQC A;  1MBH A;  2XB0 X;  4A3G J;  4FTH A;  2P81 A;  4C3H J;  3Q0W A;  5EYR A;  3S2D J;  5EZG A;  2JA7 J;  3CCY A;  1AHD P;  1IUF A;  2XGC A;  5J1U A;  3BTC A;  2ME6 A;  4X6A J;  3HGY A;  3I4M J;  1IG7 A;  3W6V A;  2K40 A;  3FK7 A;  4HNV A;  1SAN A;  2XSD C;  1RET A;  4MFD A;  2KDZ A;  3HDD A;  1O4X A;  1UMQ A;  5FKL A;  2VKV A;  3S15 J;  5IPA A;  2W48 A;  2EZK A;  1ETQ A;  2HOA A;  1B8I A;  1IGN A;  4JX4 A;  2AHQ A;  2K9N A;  4IHY A;  3O8G A;  3M4O J;  3QPL A;  4NDL A;  3L1P A;  3K2A A;  1U9O A;  1HDD C;  2NS7 A;  1E3O C;  4FCY A;  2H8R A;  5J1Y A;  2K9Q A;  2DMQ A;  1IRZ A;  2CRG A;  4LOC A;  1MBJ A;  5EG0 A;  3B6C A;  2CJJ A;  2DA4 A;  2IAI A;  4BBS J;  2XGE A;  2HQ5 A;  4A3B J;  2M0C A;  4I6Z A;  4DYQ A;  1H89 C;  4XRM A;  1X2N A;  3I4N J;  4IEJ A;  2Y9Z A;  1IJW C;  1BL0 A;  4D7N A;  1IDY A;  3LOC A;  3BR2 A;  3CQZ J;  3G1O A;  1BA5 A;  1K83 J;  3NAU A;  3BR6 A;  1HOM A;  1ETV A;  2E2J J;  1NK3 P;  1ETW A;  3FIS A;  2CUF A;  2L0K A;  1PUF B;  4M3E A;  5FKO A;  2MGQ A;  4A3M J;  1B72 B;  1Z0X A;  2E2I J;  1EF4 A;  1D5Y A;  1MBE A;  1W0U A;  1HLV A;  4DZP A;  1OFC X;  1RR7 A;  4BY7 J;  1PUF A;  3HOW J;  1R9T J;  2X6O A;  1HCR A;  3O8H A;  5EZH A;  3NAR A;  3QPS A;  4M3G A;  4C2M J;  3PO2 J;  1I3Q J;  1DU6 A;  3LSG A;  5FKN A;  2R5Y A;  2X9D A;  3MN2 A;  3BT9 A;  2LKX A;  2R0Q C;  5E3M A;  2Y30 A;  4M6V A;  4DYR A;  5K7H A;  3HOZ J;  1ZK8 A;  1TWH J;  1Y1V J;  2LVS A;  4W97 A;  3S1R J;  4M3D A;  3HM5 A;  1HDP A;  1MBK A;  2DA7 A;  3JRD A;  2H1K A;  3IV5 A;  1Z77 A;  3TW6 A;  1ZQ3 P;  2YU9 J;  3LSJ A;  2JA6 J;  5EGO B;  5EF6 A;  3PO3 J;  5F0H A;  4L5E A;  5FKM A;  2HOS A;  4FIS A;  4A3F J;  2AO9 A;  4B1R A;  3SJM A;  1JT6 A;  1P7I A;  3HB9 A;  1TWF J;  4ABZ A;  5K7Z A;  1GDT A;  2WAQ N;  2I10 A;  3LSP A;  1Y1W J;  3M3Y J;  1JGG A;  3G1L A;  1JUP A;  4D5C A;  4A3C J;  4Y52 J;  2VUM J;  3GTL J;  1WH5 A;  4V2G A;  1BJZ A;  3WHB A;  2CU7 A;  4XRS A;  1ETK A;  2L7Z A;  1UHS A;  1OJL A;  1APL C;  2XRL A;  2DA6 A;  2NVQ J;  2VPR A;  1GUU A;  3Q0V A;  5E3O A;  3RQI A;  3TP3 A;  1X58 A;  4M3B A;  1GT0 C;  3BR5 A;  1HF0 A;  4QTR A;  2R7Z J;  1NTC A;  1NK2 P;  3BTI A;  3HOY J;  5C4J J;  4QIW N;  2O7O A;  4A3K J;  2GM4 A;  1XG1 A;  2ID3 A;  5IP7 J;  2CQX A;  3ZQH A;  2R92 J;  4BXX J;  4MO7 A;  3B6A A;  4AUX A;  3E7L A;  5FKK A;  4B4C A;  3TED A;  1JUS A;  2R5Z B;  5IYD J;  2XGD A;  3BG3 A;  4JYK A;  3H0G J;  1A6I A;  5M3M J;  2EZL A;  4BY1 J;  2E2H J;  4A3J J;  5EGO A;  2M8G X;  4Y7N J;  1FTT A;  2EZH A;  4M3F A;  1RKW A;  2DN0 A;  3RZD J;  3WHC A;  5DS9 A;  2VKE A;  5JLW A;  5M3F J;  3QQA A;  2FD5 A;  3GTO J;  2M9H A;  4B3A A;  3JRI A;  1MH4 A;  1JJ6 C;  3GTK J;  1WH7 A;  1AU7 A;  2EQR A;  1RES A;  4C3J J;  4GFB A;  1I6H J;  3S2H J;  1AKH A;  1S7E A;  5F04 A;  2HYJ A;  2JJ7 A;  4IHV A;  2DJN A;  2XPW A;  3BR3 A;  4UUS B;  1BW5 A;  1GV2 A;  2DA2 A;  5C4X J;  4D5F A;  1H8A C;  4AC0 A;  2XPV A;  2G0E A;  4MFE A;  2IBD A;  4IHW A;  1OCT C;  4X1E A;  5EDN A;  1B8I B;  2R93 J;  1F43 A;  5M5Y J;  3HKZ N;  5IP6 A;  3A02 A;  2DTZ A;  1ZR2 A;  5IOY A;  3DEW A;  1GVD A;  3S1N J;  2QCO A;  4MIM A;  1WGX A;  2RAE A;  5J3L A;  1LFB A;  1FTZ A;  5C44 J;  4FE7 A;  2OPT A;  1TC3 C;  5HOD A;  4BKX A;  3FKI J;  1MNM C;  1FIA A;  3LNQ A;  5F08 A;  1LFU P;  2JWT A;  2NVT J;  1MBF A;  3DCF A;  1SFO J;  4BBR J;  3JRG A;  3ZQF A;  3OSF A;  3TP0 A;  2B63 J;  2ID6 A;  4RDU A;  2E19 A;  2NVY J;  1ZTR A;  5FLV A;  3S16 J;  1TWA J;  1VND A;  2LR8 A;  5FLM J;  2HOT A;  3H3V K;  4MLO A;  3S14 J;  4XID A;  5M5X J;  3A01 B;  2LY9 A;  3JRH A;  2Y31 A;  2M34 A;  2WB1 N;  2DMU A;  2JN6 A;  5K7F A;  3A01 A;  2L7M P;  3A03 A;  3JRE A;  3BTL A;  4IHX A;  4XRS G;  1ETX A;  2Y0S N;  4A69 C;  1ETY A;  1POG A;  1CQT A;  2FJ1 A;  3ZOB A;  1MBG A;  4DYC A;  3JRB A;  3IH2 A;  1WPK A;  4JX6 A;  1AKH B;  3BQY A;  3CMY A;  1QPI A;  2DMP A;  1GV5 A;  1ZR4 A;  4A3I J;  3HOV J;  3HBL A;  3IH4 A;  1ORK A;  1JTY A;  3S1M J;  4A3D J;  1U9N A;  3C2B A;  2ECB A;  1ZGW A;  3MKL A;  5F27 A;  1JKR C;  2DMN A;  2HXO A;  1IC8 A;  1ITY A;  1UG2 A;  4I76 A;  2NOG A;  1U78 A;  2CQQ A;  3D1N I;  4JX5 A;  2JMW A;  1G2H A;  1XS9 A;  1I50 J;  2R5Z A;  1T56 A;  1JT0 A;  1ENH A;  3HEF A;  3MVP A;  4XK4 A;  1VF9 A;  4RBO A;  2R5Y B;  2GBY A;  1U8B A;  2D5V A;  5GP9 A;  3BG5 A;  1P7J A;  2HI3 A;  2WV1 A;  4UUT A;  5F1J A;  2MG4 A;  2L7F P;  1QRY A;  3ZQL A;  5F0F A;  3JRF A;  2O9L A;  2HXI A;  2LFB A;  3GTP J;  3GTJ J;  5BNG A;  4QSH A;  2FX0 A;  3Q3S A;  4UUS A;  1WCM J;  3GTG J;  3RKQ A;  3Q0U A;  3HOU J;  4JP0 A;  5F0C A;  1JKQ C;  3BR1 A;  5E3L A;  2DMT A;  2ELK A;  3G1M A;  3BG9 A;  2VI6 A;  1QVU A;  5M5W J;  2TCT A;  1JKP C;  2EBI A;  4A93 J;  1F36 A;  1A5J A;  2QF7 A;  3PM1 A;  4J19 A;  2LP0 A;  2PMZ N;  2ZB9 A;  1JTX A;  3BR0 A;  4AYB N;  1DU0 A;  1RKT A;  3GBG A;  1W0T A;  1K61 A;  5FJ8 J;  2N8G A;  1WI3 A;  4D7M A;  3K7A J;  3JR9 A;  2Y2Z A;  3RZO J;  3SFI A;  1X2M A;  3S1Q J;  4V2F A;  1IDZ A;  1TWC J;  1VI0 A;  2DA5 A;  1ETO A;  1H88 C;  5GPC A;  2ECC A;  4DZJ A;  1LE8 A;  3GTM J;  2JA8 J;  5IP9 J;  5C3E J;  2EH3 A;  2LK2 A;  4DW6 A;  2O8K A;  1IV6 A;  3IH3 A;  5IOZ A;  1OCP A;  3TW7 A;  5IYB J;  5E3N A;  2GLO A;  2Y9Y A;  2XPU A;  2E1O A;  1B72 A;  2JA5 J;  4EEF G;  2COB A;  3JRC A;  2LD5 A;  2FQ4 A;  5JLX A;  3CDL A;  1LE8 B;  4C3I J;  1MH3 A;  9ANT A;  1JUM A;  2NS8 A;  3FK6 A;  1BW6 A;  3GTQ J;  2LTP A;  2XB5 A;  1JJ8 C;  1FIP A;  4CYC B;  3ZQI A;  3S17 J;  2YS9 A;  5IYC J;  1T33 A;  1ZKG A;  4G12 A;  2MW8 A;  3BTJ A;  3SDG A;  4A3E J;  3UKG A;  1FJL A;  1YRN B;  4W1U A;  2MSY A;  3OIO A;  1YRN A;  2KT0 A; 
#chains in the Genus database with same CATH topology
 3H35 A;  4CYC A;  2TRT A;  3MZY A;  1B6A A;  1D0Y A;  1TWG J;  2PJR A;  4C9Y A;  2CV0 A;  2JUC A;  1JKO C;  5FRO A;  4CCJ A;  2CS3 A;  1HKT A;  2VE8 A;  4AIK A;  4CZZ A;  4S0H B;  5TIS C;  1MSF C;  2HR3 A;  3TOB A;  3ROU A;  1FNN A;  5CLS A;  3PIO F;  4A6D A;  5HDG A;  2V1N A;  2YR2 A;  2JVH A;  1FX7 A;  4A0Z A;  1X1B A;  2J5P A;  3NEU A;  2EIJ H;  2WAQ A;  4A2U A;  1Q1V A;  4EMS A;  5DTD A;  4RLF A;  1FLI A;  2HKO A;  4TV7 A;  4A3L J;  4A3G J;  3L2R A;  4FTH A;  2DTR A;  2VBX A;  4C3H J;  4IRH A;  3Q0W A;  2W24 A;  4P55 A;  1RRJ A;  4LK1 F;  3S2D J;  4OU0 A;  2JA7 J;  1VQ5 I;  3MZH A;  1VQ7 I;  1AHD P;  2ESH A;  3PQJ A;  4CA0 A;  2XGC A;  4G8X A;  1DPR A;  1E17 A;  5CVU A;  2BOL A;  3OS1 A;  4BE2 A;  2M0M A;  3I4M J;  3GFL A;  3H3U A;  2F5E A;  1WZ2 A;  1SAN A;  2JQ7 A;  2KDZ A;  1O4X A;  3CC7 I;  3LMM A;  3RDI A;  4BE0 A;  5FKL A;  5L3C A;  2Q2E B;  1GXP A;  5E1Z B;  2R7R A;  2VKV A;  2HDC A;  1IXR C;  5D6E A;  3WTT C;  3I53 A;  3P5J A;  5F1R A;  2P6T A;  3CCS I;  5GAH J;  2DK5 A;  1R4N B;  1QNT A;  2VC0 A;  2CUZ A;  2HDW A;  1IGN A;  1G3S A;  5CJ9 A;  5DM6 F;  4RB2 C;  1T0F A;  4E7L A;  3O8G A;  2VXZ A;  2ZME C;  4WWC A;  2EFO A;  4UUV A;  1LPQ A;  3F8F A;  2Y0M A;  4G94 A;  2NS7 A;  2QYO A;  1HQC A;  1BIB A;  4FCY A;  5J1Y A;  2DMQ A;  3NWS A;  1IRZ A;  4UXN A;  2A3S A;  4BBS J;  2XGE A;  5B1B H;  4I6Z A;  4JK1 X;  5HNH A;  4GCV A;  1LEA A;  3R61 A;  1PYV A;  4XRM A;  4KIS A;  1X2N A;  1Y0N A;  4PUS A;  1BL0 A;  4I7H A;  1KU9 A;  3G1O A;  2E35 A;  1K83 J;  2D1V A;  4UVB A;  4WF2 A;  3CME I;  3AKZ A;  2VT3 A;  4OIR F;  1WFX A;  4HAM A;  1NK3 P;  3FIS A;  3QP6 A;  1XGN A;  2MGQ A;  2LH9 A;  4ZDO A;  4E6K G;  2L9V A;  5HVQ C;  4UVC A;  4DZP A;  1Z7L A;  4D0P A;  1E0E A;  2FBH A;  1PUF A;  4ETS A;  1F1Z A;  4ENK A;  2HGC A;  2BVM A;  4ZYA A;  1IRF A;  1S7O A;  1USS A;  1YW9 A;  3U1K A;  1D1A A;  3I3L A;  1IUY A;  3W3C A;  3A2K A;  3M7G A;  2Y30 A;  4DYR A;  2V9V A;  1XGS A;  2VON A;  1D3Y A;  1TWH J;  3O3K A;  4AVZ A;  3CCM I;  3S1R J;  5GAE J;  3R6S A;  3K4N A;  3BG6 A;  1ZQ3 P;  3LSJ A;  2MA3 A;  2JA6 J;  1X19 A;  3OYC A;  5F64 A;  2KJB A;  1YW8 A;  2E1M C;  4FIS A;  4A3F J;  1SAX A;  1W1W E;  1TWF J;  4B47 A;  4M6X A;  4NQW B;  3OS0 A;  2IS4 A;  1JHH A;  1IRX A;  2GA1 A;  2QSF X;  1GDT A;  2DU9 A;  4RLQ A;  4R79 A;  3FMR A;  1F5T A;  3B73 A;  3DPU A;  5JR3 A;  3LSP A;  1Y1W J;  1JGG A;  3HPH A;  3G1L A;  1ERD A;  4EJW A;  2VLA A;  4KIB A;  4ZTF A;  4RMN A;  2RQP A;  4ASN A;  3GTL J;  4BQN A;  4XRS A;  2VOO A;  3BCB A;  2VBW A;  1UHS A;  5A2Q K;  3I71 A;  1OJL A;  1TQI A;  5D5W B;  1T0F C;  2A5W A;  4RA2 A;  1HA8 A;  3BWG A;  1X58 A;  4IF4 A;  1GT0 C;  1LB2 A;  3BR5 A;  1HF0 A;  2BW3 B;  2GOX B;  3IUO A;  2B0L A;  1JI8 A;  2RN7 A;  5C4J J;  4QIW N;  5HNF A;  2GM4 A;  5E1X A;  4KIF A;  2XF7 A;  2R92 J;  4MO7 A;  1BI0 A;  4WCG A;  3E7L A;  4B4C A;  1JUS A;  2FE3 A;  2L4A A;  3O2P E;  4FHT A;  4UV8 A;  4XLH A;  4RM2 A;  4ZDP A;  4Y3O A;  2EV6 A;  4C2T A;  5M3M J;  1OQY A;  1X1D A;  2EZL A;  3ONQ A;  5EGO A;  2XGX A;  3CF2 A;  4Y7N J;  3Q9S A;  4M3F A;  2M3A A;  2DN0 A;  2P5K A;  3WHC A;  2E36 A;  2K4J A;  5J8F A;  2M9H A;  3PFY A;  4KDP A;  1UHW A;  2X6Y A;  1AU7 A;  4C3J J;  2ZME A;  1I5Z A;  5GAG J;  3KZY A;  2FOK A;  4IVN A;  1FYM A;  5LRS A;  3DPL C;  3KP3 A;  1LFP A;  3KYL A;  1YFH A;  1SD5 A;  3AL0 B;  3BR3 A;  4YIR X;  4AU7 A;  3ML6 A;  1BW5 A;  3BZK A;  3EET A;  2DA2 A;  1LEB A;  4YEJ A;  1H8A C;  2ACJ A;  4AC0 A;  4PCQ A;  2X1C A;  1WRJ A;  3V7C A;  4X1E A;  5EDN A;  1XSX A;  5IP6 A;  5D5V B;  3A02 A;  4ENJ A;  1SEU A;  2LY2 A;  2JRT A;  3IRR A;  3HSF A;  2QCO A;  1ZEL A;  1SMT A;  3KCC A;  4F52 A;  5J3L A;  2ELH A;  2ZME B;  3WU2 C;  1Y39 A;  2A07 F;  2H09 A;  3DPT A;  4F3Q A;  1ONV A;  5KNL A;  1FTZ A;  5TRD A;  1MJA A;  5HOD A;  3FXM A;  1TZL A;  4KYW A;  3LNQ A;  4G6Q A;  1GXQ A;  2ZBK A;  1UHM A;  1QGP A;  4IL6 C;  2IS2 A;  2MAB A;  4BBR J;  3ZQF A;  2FMY A;  4E7J A;  5E8G A;  3MD2 A;  3IWZ A;  2ID6 A;  2P6S A;  3W6J B;  3WE3 A;  5LFA A;  3OYL A;  2V6E A;  3CP2 A;  4FX4 A;  2EJR A;  1PDN C;  1LNW A;  4EM2 A;  4ENM A;  4RAZ A;  5FLM J;  1P9Q C;  3D5R C;  3QOP A;  3V8K A;  4U88 A;  3FKJ A;  2DFF A;  2I8D A;  3M1E A;  3A01 B;  1ZRC A;  3JRH A;  2Y31 A;  2M34 A;  2HZD A;  2JN6 A;  4AD9 A;  2HYG D;  2R4G A;  4N9H A;  3U21 A;  2Y75 A;  2PX9 A;  1F4K A;  2L7M P;  1R4M B;  3K6G A;  3I59 A;  4OOI A;  3ZCO A;  4IHX A;  2ZJP F;  1O7F A;  2KRH A;  4B3X A;  2Y0S N;  2DFI A;  2HPM A;  3ECH A;  1CQT A;  2L2O A;  2FJ1 A;  1B59 A;  4AYB A;  3FM5 A;  4D1Q A;  2K4B A;  4R8H A;  1ZAR A;  4QPO A;  4HSR A;  2UV1 A;  1YOV B;  5LLQ A;  1QPI A;  3OYF A;  3NRV A;  4A3I J;  3HOV J;  2VJ5 A;  1TW3 A;  1ORK A;  2GZW A;  3OIO A;  1YS6 A;  1D0X A;  4AIH A;  3C2B A;  1ZGW A;  2C6Y A;  1IN8 A;  2V79 A;  3OIP A;  4HNT A;  3N05 A;  2HXO A;  4RS8 A;  4KMF A;  3K4M A;  1P92 A;  5HS9 A;  2RKH A;  3V4G A;  4GYG A;  1G2H A;  1J2X A;  1NG6 A;  3A0B C;  3MKZ A;  2R5Z A;  3A4C A;  1ENH A;  3S2W A;  3MEX A;  4BXF A;  3BG5 A;  1X3U A;  5FRN A;  1UB9 A;  4RGR A;  2WV1 A;  3K4C A;  4H4K C;  4K2E A;  4Q47 A;  4BJ5 C;  3GYH X;  5BMZ A;  2MG4 A;  2L7F P;  2BY1 A;  3H5A A;  1WJF A;  1AOY A;  2K27 A;  1YI2 I;  4HX8 A;  5F0F A;  4G6D A;  3ERM A;  4YFN F;  2HXI A;  3GTP J;  1IN4 A;  1UG0 A;  4RB0 A;  3RKQ A;  1T2K A;  4RB1 A;  2QQA A;  3LSM A;  5FFZ A;  3BJO A;  2W00 A;  1XPX A;  1DGR M;  3TKY A;  4JP0 A;  5F0C A;  1X4P A;  4A0X A;  4KT6 A;  3ESW B;  1O3T A;  3BR1 A;  5E3L A;  1OCO H;  1OLT A;  4O5V A;  1I6X A;  1ZH5 A;  2RVC A;  4ZYE A;  2VI6 A;  1N78 A;  2H6B A;  1HBX G;  3KE2 A;  2P8T A;  3A1Y A;  1F36 A;  1ZHF A;  4ITV A;  4J19 A;  2ZB9 A;  3L00 A;  1TQM A;  3BR0 A;  3CCJ I;  4XOR A;  1W0T A;  1G6N A;  4EVI A;  1SD6 A;  1WI3 A;  3K7A J;  4EJT A;  2MD5 A;  4UY8 I;  2XAF A;  4QWQ A;  4XN3 A;  3ZMS A;  1X2M A;  4V2F A;  1H9G A;  3LSI A;  3LQR A;  3BLY A;  2LRE A;  2DYS H;  5JFR A;  2ECC A;  4DZJ A;  3OY9 A;  5E79 C;  3VYU B;  4LIV A;  3PNT A;  3MQ0 A;  4LD5 A;  2M5W A;  3WGG A;  3OS2 A;  3UR3 C;  2LKS A;  4E7K A;  1Z91 A;  1VQ6 I;  3E3V A;  3SZT A;  1SFK A;  1UZC A;  5IOZ A;  3VOE A;  1SVM A;  3IHU A;  3HUG B;  2W25 A;  2JA5 J;  4MNU A;  4EEF G;  2KKO A;  3DKX A;  1TL8 A;  2COB A;  2NYX A;  2JPC A;  2FQ4 A;  3HJE A;  5CVR A;  1HW2 A;  4C3I J;  9ANT A;  1YTY A;  1JUM A;  1O3R A;  5AIP A;  4G6T B;  3SHF A;  5AON A;  3T1B A;  2G7H A;  2XF6 A;  1FIP A;  3HC7 A;  5FLX Z;  3PJR A;  4CYC B;  1RNL A;  2Q0O A;  4LFU A;  3HPG A;  1YO5 C;  5JHF A;  2ZFW A;  3OYJ A;  3HG9 A;  1NH3 A;  2LKP A;  3SDG A;  3OYG A;  4KN7 X;  2MSY A;  3BC8 A;  1TQP A;  5J47 A;  1YRN A;  2EV5 A;  1S9H A;  2ELJ A;  3LSR A;  2QM3 A;  2EK5 A;  1ZRE A;  2DA3 A;  4M74 A;  3E6B A;  4AIJ A;  2GIV A;  4DIQ A;  3COA C;  1MIJ A;  2DDB A;  1KGS A;  4LLL A;  2BV6 A;  2M2E A;  1Z9C A;  2JK3 A;  3KZZ A;  2EZI A;  1Q1H A;  3L2V A;  3HGG A;  4C30 A;  3SEZ A;  4E70 A;  2DA1 A;  4BNC A;  2VBZ A;  2L9N A;  1VFC A;  3RKY A;  4XBF A;  2ZXI A;  1R1U A;  1ZGJ A;  1OCZ H;  3F0C A;  1HST A;  1V54 H;  3K4K A;  4BHP A;  4N4N B;  2L54 A;  3FIW A;  1FOW A;  2GAU A;  3LSH A;  5LD2 C;  1XGO A;  4JBA A;  2PMH A;  3ZQG A;  4IPA A;  3OL4 A;  4CCK A;  1VQ9 I;  4BE1 A;  1KU3 A;  2IGM A;  2LLK A;  3T8R A;  2PJR B;  5J1R A;  3OSG A;  2BY0 A;  3ASO H;  1WJC A;  5GTH C;  5HS8 A;  2P81 A;  3E5U A;  5H20 A;  5EYR A;  1FZP B;  1LDJ A;  3TQN A;  1Z7U A;  1D5V A;  1I1S A;  2KPM A;  3L09 A;  5EZG A;  5K5R A;  1HKQ A;  2GOM A;  3J7Z I;  4HDU A;  3SZP A;  1RUN A;  5J1U A;  2QWW A;  3CCL I;  3K4B A;  1IG7 A;  1K6Y A;  3W6V A;  4BYY A;  3FK7 A;  1FY7 A;  4MFD A;  3HDD A;  4L9N A;  1R58 A;  2QA4 I;  1ULY A;  4BQO A;  5LGT A;  1FC3 A;  3C2G A;  2EIK H;  2O0Y A;  2WAD A;  4P9U A;  3S15 J;  2HOE A;  1AA7 A;  4XKC A;  2HOA A;  1DQU A;  3OYK A;  3TDU C;  3AAF A;  4XMY A;  2BBY A;  5EEG A;  2QKL B;  4EM0 B;  3D0S A;  4JX4 A;  2GXG A;  4OMZ A;  3WG9 A;  2AHQ A;  1BM9 A;  2ZSH B;  3E5X A;  2HU9 A;  1BN5 A;  2PQ8 A;  2XC7 A;  2EPF A;  3IAS 2;  1UAA A;  2G9W A;  3N4M A;  3K2A A;  5ICF A;  1U9O A;  1HDD C;  3CUQ C;  2PLY A;  3KEQ A;  4G9Y A;  2AQF A;  3G2B A;  4LIT A;  3OYB A;  2CRG A;  2H27 A;  3H36 A;  1R5I D;  2B9S A;  1MBJ A;  2HFH A;  3WTY C;  4I98 B;  2CJJ A;  4D9J A;  2RC4 A;  3LWF A;  3I55 I;  2M30 A;  4PK4 A;  5IT3 A;  3CCV I;  1TW2 A;  4IHS A;  4N4O B;  4L0Z B;  3FMQ A;  2XAU A;  1UCR A;  2R7W A;  3ZMZ A;  1TT5 B;  1JGS A;  4HV6 A;  5DCF A;  1FBU A;  2MFZ A;  4F92 B;  1FMV A;  1IDY A;  4DJA A;  3LOC A;  3TL4 X;  4IRG A;  3W2W A;  5L3D A;  1A36 A;  3CQZ J;  2NNN A;  1P4A A;  5D8K B;  2XF5 A;  3H5N A;  2E2J J;  2LRD A;  1XN7 A;  2IVM A;  3M1C A;  2CUF A;  2L0K A;  4M3E A;  5FKO A;  3CJT B;  5K5O A;  3HRT A;  2XDV A;  1OFC X;  1RR7 A;  4BY7 J;  3BZC A;  2HVQ A;  3E0J B;  4ZYD A;  1HCR A;  2NS0 A;  3O8H A;  5EZH A;  4GDF A;  4C2M J;  4M3G A;  2K9M A;  1I3Q J;  3CMA I;  2OZ6 A;  5FKN A;  2R5Y A;  1ZN2 A;  2LKX A;  1V3F A;  3OR1 C;  2F5C A;  4KIC A;  3DTE A;  1SMY F;  3FF5 A;  4MGR A;  4L0Y B;  4NC7 A;  4M6V A;  3ZXS A;  5K7H A;  2E60 A;  4WXD A;  2IGN A;  3JRD A;  2K3F A;  2JTV A;  1QQI A;  1SD4 A;  3MMY B;  2XRN A;  1RZ4 A;  3OYE A;  5FKM A;  1KQ0 A;  5BPI A;  3RI4 A;  2HOS A;  1WSU A;  2AO9 A;  3IKV A;  1JT6 A;  5FD5 A;  3HB9 A;  3LSK A;  4IOA F;  5K7Z A;  1QPM A;  4B8X A;  1R5G A;  1FOY A;  3WE2 A;  2XKO A;  3QAH A;  3WGH A;  2IA1 A;  4XLA A;  5LGU A;  4IZZ A;  4BAC A;  2PFB A;  1JUP A;  2ZFU A;  2DQR A;  1BC8 C;  1U3E M;  2VOP A;  4MQ9 F;  2FUG 2;  5GTI C;  3ZP5 A;  1SVL A;  4LGW A;  3WHB A;  1ETK A;  3ZR8 X;  2L7Z A;  2JZY A;  2UXX A;  2QBY A;  1S7A A;  1Z21 A;  2W84 A;  2NVQ J;  3H5R A;  2XAG A;  1H0M A;  5J40 A;  4F7Z A;  3H0D A;  1FP2 A;  4U7B A;  3EUH A;  2R7Z J;  3RKW A;  5KK1 A;  1NK2 P;  2XVC A;  3BTI A;  2OC6 A;  5H2F C;  1MMS A;  4LJZ F;  4LLG F;  4PGG A;  1A04 A;  1QZY A;  4BU2 A;  4A3K J;  1XG1 A;  2CQX A;  2R7D A;  1U6G A;  2PG4 A;  3ZQH A;  3BOQ A;  3J81 K;  2QEX I;  4BXX J;  1S29 A;  1OYW A;  4O3M A;  4OIO F;  3CES A;  2K5C A;  2R7Q A;  3RPU A;  3KLN A;  3DFG A;  4CCL A;  3ZMT A;  1OIS A;  2CH0 A;  2P7V B;  5D4S A;  3FXL A;  2VKE A;  5JLW A;  2FD5 A;  1RR8 C;  1LDD A;  3IC7 A;  2AQE A;  4PJL A;  1TLH B;  3RPQ A;  5DCM B;  1LQ1 A;  4GFB A;  4OWR B;  4NHJ A;  2WBM A;  2O6G E;  2LBF A;  4Z6Y A;  4BL0 B;  1K79 A;  2A69 F;  3LFU A;  1S6L A;  5F04 A;  2HYJ A;  2M4G A;  3LL7 A;  1FOK A;  2OQR A;  2CFO A;  4CXF A;  2GXA A;  3CCQ I;  4ESJ A;  1GV2 A;  4XSZ F;  2X6W A;  3C3W A;  5FFX A;  2M4K A;  1OR7 C;  2WC2 A;  2M7A A;  3DV8 A;  2XPV A;  2G0E A;  4MFE A;  2IBD A;  3QYF A;  3G71 I;  1VQM I;  1QBJ A;  4IHW A;  4UNO A;  2HQA A;  3JTG A;  3E97 A;  1F43 A;  3F6O A;  3DEW A;  1WHU A;  2W82 A;  3B02 A;  2BEO A;  1WGX A;  1IXS B;  2Z2S B;  3HL2 A;  3L7W A;  5DCM A;  2OBP A;  4PJN A;  3K4L A;  3SXY A;  4XQF A;  1T8I A;  4KIG A;  3BPV A;  5C44 J;  3VYR B;  1VQP I;  3J80 Z;  1W7P D;  2HNH A;  4BKX A;  1FIA A;  2JWT A;  2B7E A;  2JRM A;  3CCR I;  4WK8 F;  4U7D A;  2EFN A;  1A6Q A;  4CSW A;  4L5J A;  1YIO A;  3TP0 A;  2B63 J;  4GGG A;  1OMI A;  2D45 A;  3HTU A;  2FNA A;  2K9L A;  1V5E A;  5B1A H;  4HOB A;  1AWC A;  2XUB A;  1OCC H;  5BQT A;  5KAF C;  3HSE A;  3S16 J;  1TWA J;  3MAJ A;  2FQ3 A;  2LR8 A;  3LST A;  2XIG A;  4LB6 B;  3ZGK A;  3L2U A;  1KQ8 A;  5E18 F;  4MLO A;  5HLH A;  3S14 J;  2X1E A;  3MKY B;  1K7A A;  2LY9 A;  1R36 A;  4HZF A;  2MC3 A;  2WB1 N;  3C7J A;  3G6E I;  2DMU A;  1SAU A;  4UVA A;  2A5Y B;  3CZ6 A;  3F72 A;  5K7F A;  3A03 A;  3A01 A;  3BTL A;  3FWE A;  3HYI A;  2COM A;  1ODD A;  1SC7 A;  1ETX A;  2GQQ A;  4O6J A;  5DDG A;  1ZG1 A;  4HQM A;  5DV5 A;  2V1X A;  3ZOB A;  4I2O A;  1XCB A;  1BOB A;  2F5F A;  3LAJ A;  2WY8 Q;  3IH2 A;  2R7X A;  1WPK A;  4JX6 A;  3V8J A;  2BY2 A;  1XSD A;  1AKH B;  3GXO A;  2K7L A;  1GV5 A;  5ED4 A;  1WKM A;  1N25 A;  2CWE A;  2MYS A;  3IH4 A;  1KON A;  3HBL A;  5EEH A;  3CO7 C;  3EUA A;  1R49 A;  3E6M A;  3F6V A;  2XAQ A;  3BDD A;  3MKL A;  5F27 A;  2DMN A;  1UG2 A;  2DFH A;  4WXC A;  3DLA A;  2DLL A;  3QYE A;  1U78 A;  4Y4R A;  4G7H F;  2CQQ A;  4ENN A;  2JMW A;  3P9I A;  1XS9 A;  3D5L A;  3HKZ A;  1HKS A;  4XON A;  1JT0 A;  2R7T A;  4RBO A;  4CHU A;  3FXR A;  1VF9 A;  1TBX A;  1B9N A;  4I0B A;  5J8C A;  1P4W A;  3G4S I;  1MJB A;  2WV0 A;  2HI3 A;  3RIR A;  2FF4 A;  4BEH B;  4UUT A;  3KYD B;  3WOD F;  5D8L B;  2QQ9 A;  2KZG A;  1QRY A;  3FXU A;  2ZC2 A;  3JRF A;  3I59 B;  2DO7 A;  4DNC A;  2DPD A;  5DYM A;  3FMS A;  1X1C A;  3GTJ J;  5BNG A;  4OAZ A;  1R00 A;  2ISY A;  2LF7 A;  3GTG J;  3C1D A;  4U0Y A;  3L2Q A;  2FBI A;  2QSH X;  2D1H A;  2BHZ A;  5LHI A;  2F4O B;  4CCN A;  2DMT A;  2ELK A;  4IO9 F;  1TTY A;  2HTJ A;  3BG9 A;  4HX7 A;  2R7S A;  5M5W J;  1ON1 A;  1JKP C;  3K4J A;  1NHA A;  2IA2 A;  2QF7 A;  3PM1 A;  3MFK A;  2A05 A;  1DU0 A;  1WWX A;  4PFP A;  2W7N A;  3DXJ F;  2VKH A;  5E20 A;  3J7Y J;  3EYI A;  3JR9 A;  3QP5 A;  1TNS A;  1H9T A;  3QPH A;  1PUE E;  4ESB A;  3MWM A;  3Q9V A;  2LC2 A;  3GFI A;  3GVA A;  1IDZ A;  1TWC J;  2BVL A;  1ETO A;  3K2Z A;  3CUQ B;  4LG3 A;  5GPC A;  2DT5 A;  2NAZ A;  2UWM A;  3KET A;  1F9N A;  3BCA A;  1LE8 A;  4ZYG A;  2EFP A;  3QPT A;  4BHC A;  1S5L C;  2KIM A;  3CDI A;  2HEO A;  3I54 A;  1EH8 A;  3G73 A;  2V9P A;  5C3E J;  1O3Q A;  3ASN H;  5CYV A;  2EH3 A;  4DW6 A;  2FU4 A;  2FNP A;  4EV0 A;  5LHG A;  3IRQ A;  2ZNZ A;  2O8K A;  3IKT A;  2QGU A;  2CV2 A;  2KQR A;  2YPR A;  1B1B A;  1M1E B;  2MC4 A;  3LA7 A;  1UST A;  2KJC A;  3TW7 A;  5IYB J;  1QZE A;  5HLT A;  5D5U B;  2IS1 A;  4BUP A;  2E1O A;  1B72 A;  3RYP A;  3CDL A;  5HDK A;  2PI0 A;  4Y33 A;  3JTH A;  5KAI C;  4ZJZ A;  2NS8 A;  2KFD A;  1BW6 A;  2H6C A;  3CC4 I;  1MNE A;  2LMD A;  5B3S H;  1I27 A;  2L7K A;  2KIF A;  3KIO A;  1VQ4 I;  4XR6 A;  3EUH C;  2DAO A;  2ISZ A;  3QYB A;  2MW8 A;  1IN7 A;  1YRN B;  4A0Y A;  1FJL A;  4W1U A;  3BP8 A;  5IT9 K;  2KT0 A;  4XIC A;  2KLO A;  1G4D A;  3HXL A;  4OIP F;  4HF0 A;  5HS7 A;  4ON0 A;  1MMG A;  5EG0 B;  4IX7 A;  4FT8 A;  5CKT A;  3HTS B;  2IEK A;  3VYT B;  2OF7 A;  3BQZ A;  4II3 A;  1IN6 A;  3JRA A;  2OD5 A;  4HPQ A;  1RIO H;  1K78 A;  2IGK A;  1STZ A;  1YHQ I;  4YG2 F;  4FE4 A;  2CUE A;  3AG1 H;  2EIM H;  3HUG A;  3C18 A;  3T5X A;  3VPR A;  1BR1 A;  2IP2 A;  3LFK A;  1BI1 A;  2O03 A;  1L3L A;  1FSE A;  4BDZ A;  2VJJ A;  2NVX J;  1DGW Y;  5JI6 A;  4HDV A;  1XC5 A;  3RYR A;  1GHC A;  2X85 A;  2V9K A;  4M9X A;  2HDD A;  1QVT A;  1RPW A;  2VQC A;  3WTX C;  4Q5S F;  2K9S A;  3RKX A;  3OR2 C;  3SDB A;  2DT6 A;  2XB0 X;  3ABL H;  1KU7 A;  3DBH B;  4Y13 A;  2DT7 B;  2VQG A;  2F2E A;  2ICW G;  2Z99 A;  1VTN C;  2BYV E;  2MLG A;  1E2X A;  4U87 A;  2VC1 A;  4M9Z A;  1EA3 A;  4X0G A;  1LUJ B;  4G7O F;  2DQL A;  4JQF A;  4NBQ A;  2FRH A;  3BTC A;  3CP8 A;  2O3F A;  3HGY A;  4LK0 F;  1SVO A;  2K40 A;  1P4X A;  2XSD C;  1YS7 A;  2X6X A;  2DOF A;  3QWL A;  4KNY A;  5IPA A;  2AS5 F;  2EZK A;  1ETQ A;  3CTA A;  1B8I A;  3IWF A;  2VBY A;  1S3J A;  3QRF F;  3VWB A;  2NNY A;  3HRS A;  4GRI A;  1ZAO A;  3GME A;  4QLC U;  1UFM A;  1IN5 A;  1DP7 P;  3DU5 A;  4HA8 A;  3OYM A;  1J75 A;  1T39 A;  3HHG A;  3ELK A;  4XLE A;  3M4O J;  3QPL A;  3V42 A;  4XRF A;  1ZRF A;  4LG0 A;  3F21 A;  3VEP A;  3QOD A;  2H8R A;  2L3D A;  4BJT A;  2VE9 A;  2QLZ A;  4RGU A;  5EG0 A;  2A68 F;  2ZJQ F;  2DA4 A;  3R0A A;  2BY3 A;  4F93 B;  3AG3 H;  4C2U A;  2HQ5 A;  3Q5F A;  4A3B J;  2M0C A;  5L3E A;  2KDO A;  3K1P A;  1A35 A;  1H89 C;  2O5R A;  2Z5U A;  3J7A Y;  3I4N J;  2Y9Z A;  3DKY A;  1IJW C;  3SQN A;  4D7N A;  3S3N A;  2DOE A;  3K10 A;  1YYV A;  1ZLK A;  1BA5 A;  3NAU A;  4YEL A;  2Z1D A;  3BR6 A;  2KHM A;  2V1U A;  1HOM A;  1S8N A;  1ETW A;  2CGP A;  1B72 B;  1EF4 A;  4A3M J;  1Z0X A;  3HOS A;  2Q8K A;  3ERE D;  1D5Y A;  1MBE A;  1HLV A;  5IY5 H;  1YQA A;  1LDK B;  3DTK A;  1E3P A;  1HW1 A;  1IRG A;  1E3H A;  5GAD J;  2R7U A;  2L02 A;  2X6O A;  3NAR A;  4IQJ A;  1DU6 A;  3DKW A;  5J4Y A;  1QZZ A;  4DGW B;  3LSG A;  2X9D A;  4EQQ A;  3IAM 2;  3DF8 A;  4RGX A;  1XTA A;  1FBS A;  1IAW A;  2WA0 A;  1ZK8 A;  1VQO I;  4KFC A;  1Y1V J;  3T8T A;  3V7S A;  1FOX A;  3DEU A;  4M3D A;  1HDP A;  1MBK A;  2DA7 A;  3I4P A;  3PL8 A;  3WTW C;  4EM1 A;  1Z77 A;  4P9F A;  2YU9 J;  4AVP A;  4EJO A;  1WJA A;  3JSO A;  2QSG X;  4AID A;  5EGO B;  5EF6 A;  3CJQ B;  4ANJ A;  5F0H A;  3I5U A;  1YX5 A;  4L5E A;  4HST A;  4S05 A;  2VIX A;  1P2F A;  3K1M A;  1X1A A;  3CLQ A;  4ABZ A;  3M9A A;  4IOC F;  1DDN A;  1QA6 A;  1W36 D;  4XM3 A;  5TJJ A;  4XLC A;  3ZQ7 A;  1IO2 A;  1CF7 B;  3WTU C;  3WU0 A;  2E7W A;  4F91 B;  3W2A A;  2RNG A;  1ACI A;  2W57 A;  1MMD A;  2QKM B;  3H9G A;  3JCU C;  2P5L C;  1ZGA A;  4A3C J;  4Y52 J;  5CVV A;  1IW7 F;  4AWX B;  2VAS A;  2XAH A;  4NC8 A;  4V2G A;  2CU7 A;  2BGC A;  4PJ0 C;  2I5U A;  2DA6 A;  2E1M B;  4R1H A;  2VPR A;  4CO8 A;  3HSR A;  3KLO A;  1GUU A;  2BHY A;  2JSP A;  3NQO A;  2V6C A;  1XMX A;  3PUF A;  3K69 A;  3R4K A;  3RQI A;  3TP3 A;  3RJP A;  6PAX A;  3GZ5 A;  1C0W A;  2OTJ I;  1BJA A;  1EH6 A;  3KFW X;  3PQK A;  4NNJ A;  1PVE A;  1MGT A;  2EIL H;  1I1G A;  1CF7 A;  2ID3 A;  3ZMD A;  5IP7 J;  3OYH A;  3H1C A;  2MD0 A;  3GO5 A;  1K6O A;  4BQA A;  5IYD J;  2XGD A;  3P9C A;  1HSJ A;  3H0G J;  4BQQ A;  1GVJ A;  2GIZ A;  1RKW A;  1UEL B;  2W1O A;  4P1W A;  3RZD J;  3WTS C;  2ZXJ A;  3QQA A;  4ESF A;  3JRI A;  2IRF G;  4HX4 A;  1MH4 A;  1MDM A;  1JJ6 C;  5LHH A;  2HWV A;  4XKV A;  5LEK A;  4L18 B;  5FD6 A;  3KP6 A;  3HRU A;  2L9S A;  1AKH A;  5B5E C;  4ZTJ A;  4FX0 A;  2WAE A;  2JJ7 A;  2UXN A;  1KQ9 A;  3CUO A;  1Z1D A;  2RRE A;  2QQB A;  3S3O A;  2XV4 S;  3DU6 A;  4QPQ A;  4UUS B;  3HRM A;  5CPR B;  2Q1Z B;  3CF5 F;  1W5T A;  3VFZ A;  4XKB A;  3F8B A;  2H1L A;  3KEY A;  2VQH A;  1OPC A;  4BAY A;  1OCT C;  2QVO A;  4YII A;  2HS5 A;  5M5Y J;  2R7F A;  2LSO A;  2DK8 A;  4ZH4 F;  2M7B A;  2V4J C;  1GVD A;  3S1N J;  4B43 A;  2KL4 A;  4MIM A;  5JVT A;  1PP8 F;  1J5Y A;  1LFB A;  2KP6 A;  1D8J A;  2OPT A;  1TC3 C;  1KYZ A;  2KRF A;  3FKI J;  4MTD A;  1KYW A;  3M8F A;  2ZJR F;  1LFU P;  1ZYR F;  4CCO A;  2NVT J;  2LG4 A;  1OCR H;  1MBF A;  1MMA A;  5DM7 F;  4MEX F;  1N75 A;  2CG4 A;  3JRG A;  2DI3 A;  1CGP A;  3KX2 A;  5FB2 A;  2DXI A;  3L2C A;  2DPU A;  1G3T A;  2VPL A;  2VT2 A;  2JUG A;  4I99 C;  4HG2 A;  4FQG A;  3JAM Z;  2HOT A;  3H3V K;  3EDP A;  4DQ2 A;  3AL0 C;  2XHK A;  4XID A;  5M5X J;  4EJV A;  4M71 A;  5DUK A;  3KP5 A;  2P5V A;  3VDX A;  2V1D A;  2ETH A;  4WXH A;  5A2Q Z;  1FPQ A;  1KU2 A;  3JRE A;  4HYE A;  4CYD A;  1V55 H;  2KIQ A;  2NVU B;  1N77 A;  1IZ1 A;  5ILU A;  5HDN A;  5D5X B;  1POG A;  3S8P A;  4BS9 A;  3LAP A;  4N9I A;  1Z05 A;  3ZQQ A;  3GX4 X;  5ILS A;  4KN4 X;  3ZMU A;  2XKP A;  3WG7 H;  4KA4 A;  3MZ8 A;  3CMY A;  2RDP A;  2FA5 A;  2LF8 A;  3ZMV A;  2DMP A;  1ZR4 A;  3MCZ A;  1DUX C;  3DEE A;  3ZRG A;  2Y69 H;  1JTY A;  3S1M J;  1U9N A;  2STW A;  4A5N A;  3A0H C;  2ECB A;  3WGI A;  5ICC A;  1JKR C;  1IC8 A;  1O7L A;  4I76 A;  2NOG A;  3J80 K;  3AG4 H;  3VYS B;  2P4W A;  4NC6 A;  3W6K B;  4JX5 A;  1I50 J;  1LJ9 A;  2A6E F;  3RSN A;  4KUM A;  1T56 A;  5ICE A;  4XK4 A;  2LYC A;  1U8B A;  3BJA A;  2D5V A;  1FSH A;  3QOE A;  1MZB A;  4KIT B;  3J7A O;  3FX3 A;  1EJ9 A;  2CUJ A;  1FBQ A;  4WX9 A;  5F1J A;  2G7U A;  4E4H A;  4I02 A;  3D5S C;  3ZQL A;  3WTZ A;  2V26 A;  1JXS A;  3F8N A;  2O9L A;  3FBN B;  2LFB A;  1HXD A;  5DD8 A;  3H92 A;  4QSH A;  1MJ9 A;  2FX0 A;  2LY1 A;  3Q3S A;  4LIU A;  1R5H A;  4XKW A;  1ZG3 A;  5ERI A;  3Q0U A;  1O3S A;  1YW7 A;  4JOM A;  5H6R A;  3M07 A;  1JKQ C;  5BPD A;  1X3W B;  5DUI A;  2LBF B;  1ZLJ A;  2M8E A;  2VOD A;  2WAF A;  2IXS A;  5H6Q A;  1JE8 A;  5HLG A;  2KMU A;  1A5J A;  1YLF A;  2F5D A;  4UB6 C;  2LP0 A;  2FBK A;  1JTX A;  4AYB N;  1RKT A;  1K61 A;  5FJ8 J;  3SEQ A;  2FSW A;  1I39 A;  2CO5 A;  4H0E A;  2Y0S A;  3OYA A;  3RZO J;  2HVR A;  3SFI A;  3S1Q J;  1SFX A;  1VI0 A;  2PMU A;  4HLX A;  3L2W A;  2DBB A;  2EA4 A;  4XN0 A;  2X51 A;  3U1D A;  1QO0 D;  3GZ6 A;  3R60 A;  1XX5 A;  3NWT A;  3DP7 A;  2HVS A;  1TNT A;  4Q4Z F;  4YIF A;  1DPU A;  2JA8 J;  5IP9 J;  3OIQ A;  1MW7 A;  1BI2 A;  3I0T A;  4IQ4 A;  3RPU D;  2NOJ B;  4BDY A;  2FML A;  5HOO A;  1ZG5 A;  4EGZ A;  3OV8 A;  1KA8 A;  1W5C C;  2E5Z A;  4J01 A;  5ICG A;  3OYN A;  3EUK L;  2ZO4 A;  2Y9Y A;  3QU6 A;  3CD6 I;  2XPU A;  5DEQ A;  2Q2E A;  3PUB A;  3ECO A;  1G3Y A;  3I9V 2;  4PFO A;  4RAF A;  1FWZ A;  3CLO A;  2ZXH A;  4II2 A;  2O61 A;  4U0W A;  1RUO A;  3F8M A;  5JLX A;  1LE8 B;  2VJ4 A;  1XDU A;  1XCV A;  3C2H A;  3PNV A;  4MEY F;  5K1Y A;  3AG2 H;  3GTQ J;  2WY7 Q;  2BXZ A;  2LTP A;  2XB5 A;  1Y0U A;  2PJP A;  5BOX A;  1W4M A;  1VQ8 I;  1HC8 A;  4G7Z F;  3ZQI A;  3WU1 B;  3S17 J;  3GLL A;  5IYC J;  1T33 A;  3GFM A;  4B09 A;  2VN2 A;  3AFH A;  1Z67 A;  1U2W A;  3P9K A;  1EKE A;  3ABK H;  3KP2 A;  3GEZ A;  1IV8 A;  2E1N A;  3K70 D;  2JT1 A;  1BR4 A;  4S04 A;  3VSL A;  2UUZ A;  1T08 B;  1Z6R A;  3TOA A;  3OOU A;  1LVK A;  3H3Z A;  2CYY A;  5GPA A;  2RNJ A;  2YUS A;  2X4H A;  4XNF A;  4OIQ F;  3OOP A;  2OV7 A;  3FHZ A;  2ZSI B;  1MSE C;  2VJI A;  2YX7 A;  1J7K A;  2PBI A;  5DD4 A;  4L9T A;  3TO7 A;  1A31 A;  3CJN A;  1FEX A;  2F48 A;  2M1B A;  2ME0 A;  3K9T A;  4EAT A;  2L9R A;  3P7N A;  3OWT A;  2X48 A;  4AM3 A;  5EEA A;  2NXN B;  1K78 B;  4FET A;  3R0J A;  3F3X A;  3CC2 I;  3EQL F;  1Y8Q B;  5FGM A;  5JVG F;  2Z3Y A;  4HQE A;  2Z9O A;  5FRM A;  3RQ4 A;  5L3F A;  2MH2 A;  5J6X A;  3HOX J;  1QHG A;  4I09 A;  5D4R A;  2EA2 A;  2ZCW A;  3ZQC A;  1MBH A;  1WJE A;  2CQ7 A;  3LQQ A;  2EFQ A;  5IT9 Z;  1XMK A;  1W7P B;  1Y8R B;  4L5I A;  1YIT I;  2A6H F;  1MD0 A;  4GYI A;  4Y17 A;  3GW2 A;  1OYI A;  5TGT A;  4LMY A;  3CCY A;  4E7H A;  1YE9 A;  1D1B A;  3V7R A;  5LRR A;  1NG7 A;  1R6R A;  1IUF A;  5E1W A;  1J0R A;  2VQL A;  4IJA A;  4PJM A;  2ME6 A;  4X6A J;  3CMM A;  2LDU A;  3PSF A;  1MND A;  1T38 A;  4UHT A;  3HHH A;  1R1T A;  3CO6 C;  4HNV A;  5CQG A;  1RET A;  4IKF A;  1OYY A;  1LVA A;  2LOO A;  3GLX A;  2BW3 A;  1UMQ A;  4RB3 C;  2J5O A;  4RGS A;  3X2Q H;  2XAJ A;  1VQK I;  4NB5 A;  2W48 A;  1J9I A;  4P5O A;  2CV1 A;  2STT A;  1VQN I;  3DBL B;  5CVJ A;  1Y56 A;  4B48 A;  3CDH A;  2K9N A;  4IHY A;  4OIN F;  4GXO A;  3DBR B;  3VSK A;  4M6Y A;  1LKX A;  3M8J A;  2OCE A;  4NDL A;  3L1P A;  3GFJ A;  1BR2 A;  4P96 A;  4ZZL A;  3RTR A;  3DTI A;  2E1C A;  2K02 A;  1E3O C;  3CUQ A;  3CCU I;  2K9Q A;  4CH7 A;  2FEZ A;  3OMY A;  4LOC A;  1PJR A;  2BXY A;  5KCM A;  3B6C A;  1IF1 A;  3S3M A;  1V5F A;  5KVR A;  3EYY A;  2IAI A;  1W5S A;  4GO1 A;  4MHG A;  2M45 A;  2R7O A;  4DYQ A;  3LA3 A;  2R7V A;  2E71 A;  3KP4 A;  2L01 A;  4IEJ A;  1D8K A;  1SFE A;  3KPH A;  2IW5 A;  2YX4 A;  2DJI A;  3BR2 A;  1Z6T A;  1BC7 C;  1V4R A;  2TDX A;  3I64 A;  5BS6 A;  2D2W A;  2DYR H;  3TDZ C;  1ETV A;  4Y15 A;  4NUB A;  2PEX A;  4HLY A;  1PUF B;  2E2I J;  2A61 A;  1VZ0 A;  1D1C A;  1RC9 A;  3BY6 A;  3EPZ A;  1U0J A;  5ILV A;  4RM3 A;  3S93 A;  2UZK A;  1W0U A;  2DCE A;  3ZN0 A;  3HOW J;  2IS6 A;  1R9T J;  4DBR A;  3ABT A;  2OUM A;  4BEH A;  4KMU X;  3QPS A;  3PO2 J;  1X3Z B;  1YG2 A;  5FO5 A;  3MN2 A;  3BT9 A;  4HEA 2;  4UB8 C;  2IJL A;  2R0Q C;  5E3M A;  4OAY A;  3E6D A;  3GWZ A;  5HLI A;  3F8C A;  3HOZ J;  3SZG A;  2MH9 A;  2RV8 A;  2LVS A;  3PFI A;  4W97 A;  3HM5 A;  2H1K A;  1T95 A;  3IV5 A;  1G8X A;  2OTL I;  2OJE D;  1S72 I;  1Y6I A;  1ON2 A;  4NQW A;  3TW6 A;  4XSX F;  4M73 A;  3JW4 A;  2CMP A;  3PO3 J;  2M87 A;  3SYT A;  3W2V A;  4B1R A;  1UJ8 A;  3SJM A;  1P7I A;  1O57 A;  1W7P A;  3J81 Z;  2WAQ N;  1Z3X A;  2I10 A;  4LG0 B;  1ZRD A;  5L3B A;  2ZJ2 A;  3KYC B;  3M3Y J;  4CDG A;  2F4M B;  4E7Z A;  4BGD A;  2WTE A;  4PJJ A;  4D5C A;  5CVI A;  2GWR A;  1XGM A;  1VQL I;  2OZU A;  2VUM J;  2IA0 A;  1B9M A;  1MMN A;  1WH5 A;  1BJZ A;  4ZZD A;  1APL C;  2XRL A;  1I3A A;  2JVG A;  3MKW B;  3Q0V A;  5E3O A;  4KT5 C;  2XSJ C;  3KEO A;  4M3B A;  4PSX A;  3T0Y A;  3TO9 A;  4QTR A;  1YJW I;  3U9G A;  2DW4 A;  1NTC A;  1RI7 A;  4HRI A;  3FBI B;  2PN6 A;  1JHF A;  2QUF A;  3H9J A;  3KZI C;  3HOY J;  2O7O A;  2CW8 A;  2F6C A;  1D0Z A;  2O8X A;  4YFX F;  2HQR A;  2OAZ A;  3FM3 A;  3GF2 A;  2F5V A;  3B6A A;  3V8L A;  4AUX A;  5FKK A;  3TED A;  2OU2 A;  2R5Z B;  1BBY A;  3VOD A;  4F55 A;  3BG3 A;  2PMZ A;  3ISP A;  4I01 A;  4JYK A;  1SFU A;  1A6I A;  2KIS A;  3I58 A;  5B66 C;  5LGN A;  2E2H J;  4BY1 J;  4A3J J;  2WB1 A;  2M8G X;  1FTT A;  5AIQ A;  2EZH A;  1WJB A;  2AXT C;  4A5M A;  2W4S A;  3F23 A;  1WJD A;  5DS9 A;  5M3F J;  3O6B B;  3GTO J;  4B3A A;  3GTK J;  3TBI A;  1WH7 A;  3HOT A;  2EQR A;  1RES A;  3K0L A;  1I6H J;  2L4M A;  3E5Q A;  3HIF A;  1OKR A;  2OA4 A;  1P6R A;  3S2H J;  2KIU A;  1R23 A;  3FZV A;  3REO A;  3WTV C;  2A6T A;  1S7E A;  1TT0 A;  4IHV A;  2DJN A;  5LBQ A;  2BE5 F;  2XPW A;  2JSC A;  1J09 A;  2E5N A;  2GA2 A;  1XMA A;  1WI9 A;  3F9K A;  3FXO A;  1T6S A;  1FYK A;  5C4X J;  4D5F A;  3S32 A;  1FP1 D;  1R1V A;  4Z2Y A;  3KP7 A;  4ZYH A;  1B8I B;  2R93 J;  1L0O C;  2XRO A;  4FAS D;  3HKZ N;  1IXC A;  2DTZ A;  1ZR2 A;  1YJ9 I;  1J59 A;  1XDS A;  5IOY A;  2QEN A;  3DWL E;  3PNY A;  4E7S A;  4A12 A;  4HF2 A;  4HBL A;  3JSP A;  2RAE A;  4BHB A;  3ABU A;  3H9Q A;  3FDY A;  3F22 A;  4FE7 A;  2JPB A;  5LEJ A;  4CCM A;  2EWN A;  3PIP F;  4IHT A;  5E8I A;  2KRC A;  1MNM C;  2L5Q A;  2E7X A;  5F08 A;  2ZKZ A;  3DCF A;  1OR7 A;  3SFZ A;  1SFO J;  3BG7 A;  3OSF A;  2CFX A;  4XLN F;  2K86 A;  3TMO A;  4RDU A;  2DDA A;  2EFW A;  4EJU A;  2E19 A;  2NVY J;  3I56 I;  1MKM A;  5L3G A;  1ZTR A;  5FLV A;  1VND A;  1FT9 A;  4M9S A;  1X4O A;  2AXL A;  2W85 A;  2CQK A;  4BH9 A;  4CGZ A;  3FXK A;  1U5T C;  4IRI A;  1DP3 A;  2QBY B;  1G59 A;  2OQG A;  4Q48 A;  2IPQ X;  4DOZ A;  3LA2 A;  3TO6 A;  2K85 A;  2Z16 A;  4XLP F;  1YIJ I;  3IP4 B;  4U0V A;  2F4I A;  4XLF A;  4XRS G;  3OL3 A;  3K1N A;  2WWY A;  4LLN A;  4A69 C;  1ETY A;  1GLN A;  4L9J A;  4IXA A;  1K4T A;  2FOW A;  4OMY A;  1QU3 A;  1MBG A;  4XOP A;  4ZC3 A;  1FMW A;  4DYC A;  3M8E A;  1Z3Y A;  3JRB A;  1PP7 U;  4XL9 A;  3TGN A;  4HV5 A;  1G3W A;  3BQY A;  4HW0 A;  4CIC A;  4V19 K;  3OYI A;  1T98 A;  4YFK F;  3GUD A;  2ZNY A;  4A3D J;  2V7F A;  4HF1 A;  2MBF A;  4CUG A;  2FXA A;  4E7I A;  1U5T A;  1ITY A;  2CW7 A;  2VKD A;  1WVR A;  3D1N I;  2EV0 A;  3FXJ A;  2R3S A;  1XSV A;  2HZT A;  3UNG C;  3HEF A;  3MVP A;  2R5Y B;  2GBY A;  5GP9 A;  5D6F A;  4BXU A;  2ZXW H;  3VB2 A;  1P7J A;  1K4S A;  1BI3 A;  3PSI A;  2NRA C;  5JHU A;  3FXQ A;  1BOA A;  1R7J A;  1WJ5 A;  4PDK A;  1EH7 A;  2EIN H;  2HTS A;  2VXD A;  4PSW A;  4UUS A;  1WCM J;  3RCO A;  3ABM H;  3ZPL A;  3HOU J;  4UV9 A;  2HKX A;  3HZJ A;  4ZDL A;  2DFE A;  1R71 A;  3FHN A;  3G1M A;  3BPX A;  3JAM K;  1XB4 A;  3QU3 A;  3U2R A;  4KJZ A;  2ESN A;  2JA2 A;  1QVU A;  2RGV A;  2EB7 A;  2TCT A;  3G3Z A;  1X1P A;  4EGY A;  2EBI A;  3ZN1 A;  4XOT A;  3DLL F;  4A93 J;  5KHD A;  2K3P A;  4RAG A;  3IL2 A;  2PMZ N;  2P0W A;  4B44 A;  3GBG A;  4I0A A;  2DOA A;  2N8G A;  4M72 A;  4D7M A;  1YX3 A;  4HNU A;  5EJC A;  2H8W A;  2OCC H;  2Y2Z A;  5J4V A;  5FLX K;  2MLK A;  2YSR A;  4L9V A;  4CZC A;  2LNB A;  5E17 F;  2DA5 A;  4YRV A;  3E6C C;  1H88 C;  4DBQ A;  3GCM A;  2YU3 A;  2VB6 A;  3GTM J;  2IT0 A;  4PZJ A;  2P7C B;  2HQN A;  3N97 A;  1R22 A;  2LK2 A;  4BJ6 C;  2QQ8 A;  2QZ8 A;  3CJR B;  1XD7 A;  1BIA A;  4RAY A;  4LB5 A;  1V5G A;  4PGH A;  2XAS A;  2CSO A;  5F6F A;  1IV6 A;  3IH3 A;  1B4A A;  2DOD A;  2CW0 F;  2GXB A;  1HW5 A;  3BZ6 A;  2Y48 A;  1OCP A;  2GLO A;  5E3N A;  5K5Q A;  3L9F A;  1FYL A;  3BRO A;  1SD7 A;  1TP4 A;  3GZN B;  3K70 C;  2ADU A;  2HPI A;  2VL8 A;  3JRC A;  2LD5 A;  1REP C;  3BJ6 A;  1MH3 A;  2CQN A;  1KZH A;  3FK6 A;  1YJN I;  2H94 A;  2E34 A;  2KZV A;  4A6E A;  1JJ8 C;  3ULQ B;  2Z33 A;  3CCE I;  1QHH D;  4MQV A;  4J00 A;  3DQV C;  3E1S A;  1WQ2 A;  2HYF A;  2YS9 A;  4MTE A;  1MDM B;  1EV7 A;  2RQQ A;  5CQE A;  1ZKG A;  3BTJ A;  4G12 A;  4A3E J;  1U8R A;  3UKG A;  3OYD A;  4N0B A;  1U5T B;  2BZT A;  2X0L A;  2IGO A;  1W36 C;  2X1D A; 
#chains in the Genus database with same CATH homology
 4XIC A;  3LSR A;  4CYC A;  2DA3 A;  2TRT A;  5EG0 B;  1TWG J;  3OOU A;  2IEK A;  1JKO C;  2OF7 A;  5GPA A;  3BQZ A;  2YUS A;  2M2E A;  2JK3 A;  2EZI A;  3JRA A;  4S0H B;  3HGG A;  1MSE C;  2DA1 A;  1MSF C;  4FE4 A;  2CUE A;  1VFC A;  3VPR A;  1FEX A;  2ME0 A;  2L9R A;  3F0C A;  2X48 A;  5EEA A;  2NVX J;  3FIW A;  1XC5 A;  3ZQG A;  3HOX J;  2HDD A;  1QVT A;  1RPW A;  1Q1V A;  2LLK A;  5DTD A;  2K9S A;  5J1R A;  3OSG A;  4A3L J;  3ZQC A;  1MBH A;  2XB0 X;  4A3G J;  4FTH A;  2P81 A;  4C3H J;  3Q0W A;  5EYR A;  3S2D J;  5EZG A;  2JA7 J;  3CCY A;  1AHD P;  1IUF A;  2XGC A;  5J1U A;  3BTC A;  2ME6 A;  4X6A J;  3HGY A;  3I4M J;  1IG7 A;  3W6V A;  2K40 A;  3FK7 A;  4HNV A;  1SAN A;  2XSD C;  1RET A;  4MFD A;  2KDZ A;  3HDD A;  1O4X A;  1UMQ A;  5FKL A;  2VKV A;  3S15 J;  5IPA A;  2W48 A;  2EZK A;  1ETQ A;  2HOA A;  1B8I A;  1IGN A;  4JX4 A;  2AHQ A;  2K9N A;  4IHY A;  3O8G A;  3M4O J;  3QPL A;  4NDL A;  3L1P A;  3K2A A;  1U9O A;  1HDD C;  2NS7 A;  1E3O C;  4FCY A;  2H8R A;  5J1Y A;  2K9Q A;  2DMQ A;  1IRZ A;  2CRG A;  4LOC A;  1MBJ A;  5EG0 A;  3B6C A;  2CJJ A;  2DA4 A;  2IAI A;  4BBS J;  2XGE A;  2HQ5 A;  4A3B J;  2M0C A;  4I6Z A;  4DYQ A;  1H89 C;  4XRM A;  1X2N A;  3I4N J;  4IEJ A;  2Y9Z A;  1IJW C;  1BL0 A;  4D7N A;  1IDY A;  3LOC A;  3BR2 A;  3CQZ J;  3G1O A;  1BA5 A;  1K83 J;  3NAU A;  3BR6 A;  1HOM A;  1ETV A;  2E2J J;  1NK3 P;  1ETW A;  3FIS A;  2CUF A;  2L0K A;  1PUF B;  4M3E A;  5FKO A;  2MGQ A;  4A3M J;  1B72 B;  1Z0X A;  2E2I J;  1EF4 A;  1D5Y A;  1MBE A;  1W0U A;  1HLV A;  4DZP A;  1OFC X;  1RR7 A;  4BY7 J;  1PUF A;  3HOW J;  1R9T J;  2X6O A;  1HCR A;  3O8H A;  5EZH A;  3NAR A;  3QPS A;  4M3G A;  4C2M J;  3PO2 J;  1I3Q J;  1DU6 A;  3LSG A;  5FKN A;  2R5Y A;  2X9D A;  3MN2 A;  3BT9 A;  2LKX A;  2R0Q C;  5E3M A;  2Y30 A;  4M6V A;  4DYR A;  5K7H A;  3HOZ J;  1ZK8 A;  1TWH J;  1Y1V J;  2LVS A;  4W97 A;  3S1R J;  4M3D A;  3HM5 A;  1HDP A;  1MBK A;  2DA7 A;  3JRD A;  2H1K A;  3IV5 A;  1Z77 A;  3TW6 A;  1ZQ3 P;  2YU9 J;  3LSJ A;  2JA6 J;  5EGO B;  5EF6 A;  3PO3 J;  5F0H A;  4L5E A;  5FKM A;  2HOS A;  4FIS A;  4A3F J;  2AO9 A;  4B1R A;  3SJM A;  1JT6 A;  1P7I A;  3HB9 A;  1TWF J;  4ABZ A;  5K7Z A;  1GDT A;  2WAQ N;  2I10 A;  3LSP A;  1Y1W J;  3M3Y J;  1JGG A;  3G1L A;  1JUP A;  4D5C A;  4A3C J;  4Y52 J;  2VUM J;  3GTL J;  1WH5 A;  4V2G A;  1BJZ A;  3WHB A;  2CU7 A;  4XRS A;  1ETK A;  2L7Z A;  1UHS A;  1OJL A;  1APL C;  2XRL A;  2DA6 A;  2NVQ J;  2VPR A;  1GUU A;  3Q0V A;  5E3O A;  3RQI A;  3TP3 A;  1X58 A;  4M3B A;  1GT0 C;  3BR5 A;  1HF0 A;  4QTR A;  2R7Z J;  1NTC A;  1NK2 P;  3BTI A;  3HOY J;  5C4J J;  4QIW N;  2O7O A;  4A3K J;  2GM4 A;  1XG1 A;  2ID3 A;  5IP7 J;  2CQX A;  3ZQH A;  2R92 J;  4BXX J;  4MO7 A;  3B6A A;  4AUX A;  3E7L A;  5FKK A;  4B4C A;  3TED A;  1JUS A;  2R5Z B;  5IYD J;  2XGD A;  3BG3 A;  4JYK A;  3H0G J;  1A6I A;  5M3M J;  2EZL A;  4BY1 J;  2E2H J;  4A3J J;  5EGO A;  2M8G X;  4Y7N J;  1FTT A;  2EZH A;  4M3F A;  1RKW A;  2DN0 A;  3RZD J;  3WHC A;  5DS9 A;  2VKE A;  5JLW A;  5M3F J;  3QQA A;  2FD5 A;  3GTO J;  2M9H A;  4B3A A;  3JRI A;  1MH4 A;  1JJ6 C;  3GTK J;  1WH7 A;  1AU7 A;  2EQR A;  1RES A;  4C3J J;  4GFB A;  1I6H J;  3S2H J;  1AKH A;  1S7E A;  5F04 A;  2HYJ A;  2JJ7 A;  4IHV A;  2DJN A;  2XPW A;  3BR3 A;  4UUS B;  1BW5 A;  1GV2 A;  2DA2 A;  5C4X J;  4D5F A;  1H8A C;  4AC0 A;  2XPV A;  2G0E A;  4MFE A;  2IBD A;  4IHW A;  1OCT C;  4X1E A;  5EDN A;  1B8I B;  2R93 J;  1F43 A;  5M5Y J;  3HKZ N;  5IP6 A;  3A02 A;  2DTZ A;  1ZR2 A;  5IOY A;  3DEW A;  1GVD A;  3S1N J;  2QCO A;  4MIM A;  1WGX A;  2RAE A;  5J3L A;  1LFB A;  1FTZ A;  5C44 J;  4FE7 A;  2OPT A;  1TC3 C;  5HOD A;  4BKX A;  3FKI J;  1MNM C;  1FIA A;  3LNQ A;  5F08 A;  1LFU P;  2JWT A;  2NVT J;  1MBF A;  3DCF A;  1SFO J;  4BBR J;  3JRG A;  3ZQF A;  3OSF A;  3TP0 A;  2B63 J;  2ID6 A;  4RDU A;  2E19 A;  2NVY J;  1ZTR A;  5FLV A;  3S16 J;  1TWA J;  1VND A;  2LR8 A;  5FLM J;  2HOT A;  3H3V K;  4MLO A;  3S14 J;  4XID A;  5M5X J;  3A01 B;  2LY9 A;  3JRH A;  2Y31 A;  2M34 A;  2WB1 N;  2DMU A;  2JN6 A;  5K7F A;  3A01 A;  2L7M P;  3A03 A;  3JRE A;  3BTL A;  4IHX A;  4XRS G;  1ETX A;  2Y0S N;  4A69 C;  1ETY A;  1POG A;  1CQT A;  2FJ1 A;  3ZOB A;  1MBG A;  4DYC A;  3JRB A;  3IH2 A;  1WPK A;  4JX6 A;  1AKH B;  3BQY A;  3CMY A;  1QPI A;  2DMP A;  1GV5 A;  1ZR4 A;  4A3I J;  3HOV J;  3HBL A;  3IH4 A;  1ORK A;  1JTY A;  3S1M J;  4A3D J;  1U9N A;  3C2B A;  2ECB A;  1ZGW A;  3MKL A;  5F27 A;  1JKR C;  2DMN A;  2HXO A;  1IC8 A;  1ITY A;  1UG2 A;  4I76 A;  2NOG A;  1U78 A;  2CQQ A;  3D1N I;  4JX5 A;  2JMW A;  1G2H A;  1XS9 A;  1I50 J;  2R5Z A;  1T56 A;  1JT0 A;  1ENH A;  3HEF A;  3MVP A;  4XK4 A;  1VF9 A;  4RBO A;  2R5Y B;  2GBY A;  1U8B A;  2D5V A;  5GP9 A;  3BG5 A;  1P7J A;  2HI3 A;  2WV1 A;  4UUT A;  5F1J A;  2MG4 A;  2L7F P;  1QRY A;  3ZQL A;  5F0F A;  3JRF A;  2O9L A;  2HXI A;  2LFB A;  3GTP J;  3GTJ J;  5BNG A;  4QSH A;  2FX0 A;  3Q3S A;  4UUS A;  1WCM J;  3GTG J;  3RKQ A;  3Q0U A;  3HOU J;  4JP0 A;  5F0C A;  1JKQ C;  3BR1 A;  5E3L A;  2DMT A;  2ELK A;  3G1M A;  3BG9 A;  2VI6 A;  1QVU A;  5M5W J;  2TCT A;  1JKP C;  2EBI A;  4A93 J;  1F36 A;  1A5J A;  2QF7 A;  3PM1 A;  4J19 A;  2LP0 A;  2PMZ N;  2ZB9 A;  1JTX A;  3BR0 A;  4AYB N;  1DU0 A;  1RKT A;  3GBG A;  1W0T A;  1K61 A;  5FJ8 J;  2N8G A;  1WI3 A;  4D7M A;  3K7A J;  3JR9 A;  2Y2Z A;  3RZO J;  3SFI A;  1X2M A;  3S1Q J;  4V2F A;  1IDZ A;  1TWC J;  1VI0 A;  2DA5 A;  1ETO A;  1H88 C;  5GPC A;  2ECC A;  4DZJ A;  1LE8 A;  3GTM J;  2JA8 J;  5IP9 J;  5C3E J;  2EH3 A;  2LK2 A;  4DW6 A;  2O8K A;  1IV6 A;  3IH3 A;  5IOZ A;  1OCP A;  3TW7 A;  5IYB J;  5E3N A;  2GLO A;  2Y9Y A;  2XPU A;  2E1O A;  1B72 A;  2JA5 J;  4EEF G;  2COB A;  3JRC A;  2LD5 A;  2FQ4 A;  5JLX A;  3CDL A;  1LE8 B;  4C3I J;  1MH3 A;  9ANT A;  1JUM A;  2NS8 A;  3FK6 A;  1BW6 A;  3GTQ J;  2LTP A;  2XB5 A;  1JJ8 C;  1FIP A;  4CYC B;  3ZQI A;  3S17 J;  2YS9 A;  5IYC J;  1T33 A;  1ZKG A;  4G12 A;  2MW8 A;  3BTJ A;  3SDG A;  4A3E J;  3UKG A;  1FJL A;  1YRN B;  4W1U A;  2MSY A;  3OIO A;  1YRN A;  2KT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...