2DMPA

Solution structure of the third homeobox domain of zinc fingers and homeoboxes protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
GSSGSSGAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the third homeobox domain of Zinc fingers and homeoboxes protein 2
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Zinc fingers and homeoboxes protein 2
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmpA01
2QCOA 5K7HA 4RDUA 1GVDA 3HM5A 1LFUP 5EZHA 1IV6A 5M5YJ 1X58A 4MLOA 1AHDP 3JRCA 5F1JA 1PUFB 2D5VA 2L7FP 2LP0A 3IH2A 2K9SA 1ZR4A 4AC0A 1JUPA 5J1UA 5FLVA 1POGA 3SDGA 1T56A 2VKVA 3JR9A 5DTDA 1NK3P 3JRHA 2DA1A 4UUSB 1ITYA 5K7FA 2XPWA 4DW6A 3GTQJ 3CQZJ 4D7MA 1JKPC 3Q0WA 1AKHB 2CUEA 2Y9YA 1LFBA 3M3YJ 3QPLA 1IG7A 3FIWA 3IH4A 1U8BA 3O8HA 1RPWA 1JGGA 4A69C 2XRLA 2L0KA 2X48A 1IJWC 1JJ6C 2WB1N 2Y0SN 2R5YA 3BG9A 1XG1A 5M5WJ 2HXOA 2EZHA 4C3JJ 3D1NI 5FKMA 3A03A 2IEKA 2O9LA 3I4NJ 1WH7A 3TEDA 1DU6A 1JTXA 4D7NA 1BW6A 5FKNA 1ETKA 2DTZA 4DYQA 5E3MA 1ETXA 3RZDJ 3ZQIA 2OPTA 1BL0A 2E1OA 2YUSA 2DMPA 1A5JA 1RR7A 4QSHA 3HGYA 5EGOA 1E3OC 1ZGWA 2E19A 3K7AJ 2GBYA 4MFDA 2Y9ZA 5C3EJ 4UUSA 2E2HJ 5F04A 1VF9A 2R92J 1TWHJ 4BKXA 3NARA 5FJ8J 4C3HJ 4ABZA 3FK6A 1Q1VA 2HI3A 1JKRC 2RAEA 4B1RA 3HGGA 2XGEA 1BW5A 2ME6A 1WI3A 2KT0A 1FTTA 1W0TA 1HDDC 3HOYJ 5F27A 2L7MP 2R0QC 3CDLA 2H8RA 1MSFC 3BG5A 1P7IA 3JREA 4Y52J 2XPUA 2H1KA 1WCMJ 3TW7A 1VNDA 2DA6A 4XICA 2R5YB 1W0UA 2VUMJ 5FKOA 2B63J 3HEFA 4A3GJ 2M2EA 1OCTC 1HF0A 3C2BA 1NTCA 3RQIA 1K61A 2GM4A 3OOUA 5FLMJ 1X2MA 5EEAA 1AKHA 2XB0X 2NS8A 1YRNB 2CQQA 4DZJA 1IDYA 3O8GA 3GTLJ 1MBFA 1I50J 1I6HJ 4GFBA 3Q0UA 2JA6J 2PMZN 1WH5A 4BY7J 2ME0A 2HDDA 2JA5J 1FIPA 4AYBN 4A3JJ 4B3AA 3MVPA 2Y30A 1MNMC 2Y31A 4MO7A 2HOAA 4XIDA 4FCYA 2K9QA 1XS9A 4RBOA 2ZB9A 3LSRA 2LK2A 2ECBA 3BR6A 1JKQC 4I6ZA 2HOTA 3NAUA 1JJ8C 5EG0B 4JX4A 1TWFJ 1HDPA 2LVSA 5C44J 3BR5A 9ANTA 2EZIA 3BTLA 1MH4A 3Q0VA 5K7ZA 4W1UA 2COBA 2XPVA 1VFCA 1B8IB 1WGXA 1Z0XA 1CQTA 4I76A 3ZQHA 3E7LA 2W48A 4QTRA 2ID6A 3MKLA 5EZGA 2FD5A 4L5EA 1O4XA 5DS9A 3WHCA 4C3IJ 5BNGA 2E2IJ 2O7OA 3G1OA 2N8GA 3I4MJ 1GDTA 1ZK8A 2AHQA 3QQAA 4AUXA 3ZQGA 1FEXA 3GTGJ 1LE8B 3PO3J 1HOMA 1D5YA 2ECCA 2DA7A 3HBLA 1B72B 1FIAA 3GTJJ 3HOUJ 2WV1A 4V2FA 4QIWN 1K83J 4J19A 5GPCA 4CYCA 3BTJA 1QVTA 2YS9A 5EGOB 1AU7A 4DZPA 2GLOA 3S1MJ 3S1NJ 4A3LJ 1ETYA 3BR1A 1JUMA 1H8AC 2VPRA 2JN6A 5IPAA 1VI0A 3GTOJ 1IDZA 1R9TJ 2DMTA 5J1YA 2DMNA 2HYJA 5E3LA 4IHWA 5FKLA 3GTPJ 4FISA 1TWCJ 2E2JJ 1UG2A 2JMWA 1MH3A 1ETVA 3A01B 1ETOA 2EH3A 3FISA 3GTMJ 2I10A 2DA4A 1U9NA 2DA2A 1B72A 5J1RA 3VPRA 2XSDC 2X9DA 3OSFA 4V2GA 1MBJA 1QVUA 3BG3A 1FTZA 3S17J 4IHYA 5F0FA 5IYDJ 1F36A 2NVXJ 1Y1VJ 3HOZJ 2ID3A 3JRBA 4D5CA 2WAQN 3BTCA 4G12A 4M3EA 4S0HB 5M3MJ 4M3FA 4XRSG 2NS7A 3ZQFA 3HOXJ 2CUFA 3JRAA 5M3FJ 2AO9A 2M34A 1A6IA 1RESA 3G1LA 1PUFA 5IP9J 2X6OA 4M3GA 5F0HA 2NVQJ 3LSGA 5IP6A 3JRFA 3ZQCA 4BY1J 2K40A 5IP7J 2O8KA 2M9HA 2LD5A 3B6CA 5EF6A 3BR2A 1NK2P 5FKKA 2LTPA 2Y2ZA 1U78A 2MSYA 3BQZA 3H3VK 4A3FJ 5JLXA 1QPIA 3A01A 3ZQLA 2IAIA 2R5ZB 1UHSA 1JT6A 3LOCA 4NDLA 4A3MJ 2FX0A 2JWTA 4A3BJ 5C4XJ 2R93J 2QF7A 3W6VA 1OFCX 3Q3SA 4XRSA 1B8IA 1JUSA 3HB9A 5E3NA 3BT9A 3TP0A 3IH3A 1MBGA 4BBRJ 2LR8A 4Y7NJ 2JJ7A 4BBSJ 3PO2J 2CJJA 4A93J 3GBGA 5GP9A 4A3CJ 4JX6A 4A3IJ 3BTIA 2FQ4A 2HQ5A 4UUTA 4CYCB 3S1QJ 1ETWA 1TWAJ 2TRTA 1BA5A 1ENHA 1UMQA 4M6VA 2HOSA 3IV5A 2CRGA 2NVTJ 5GPAA 1FJLA 1SFOJ 1TC3C 1ZKGA 1MSEC 3JRIA 3S15J 1GUUA 2VKEA 4JYKA 3MN2A 4A3DJ 2EZLA 3H0GJ 2JA7J 1IUFA 2CQXA 5JLWA 2EBIA 4IHVA 1ZQ3P 1QRYA 2EZKA 2G0EA 3OIOA 2JK3A 3WHBA 1ZTRA 3DEWA 1H89C 1JT0A 3S16J 3QPSA 3GTKJ 2LKXA 2DMQA 1H88C 1ORKA 1TWGJ 1JKOC 5M5XJ 3HOWJ 3TP3A 4A3KJ 1MBEA 2MGQA 5EYRA 1XC5A 4M3BA 4B4CA 4EEFG 3BR0A 2XGCA 4JP0A 1RKTA 4XK4A 1LE8A 5J3LA 5EDNA 1Z77A 3BR3A 4MFEA 1MBKA 3F0CA 4IHXA 4BXXJ 3G1MA 2R5ZA 2LY9A 4JX5A 3JRDA 3S2HJ 5HODA 3HDDA 3L1PA 1I3QJ 5IYCJ 3ZOBA 3HOVJ 1F43A 2VI6A 1OJLA 3CCYA 2KDZA 3S14J 2LFBA 2XB5A 5IOZA 2CU7A 2DMUA 3LSPA 3A02A 3LSJA 1U9OA 3UKGA 2FJ1A 3TW6A 2L7ZA 1X2NA 4FTHA 4HNVA 3CMYA 2ELKA 5EG0A 1ETQA 2YU9J 4C2MJ 5IOYA 1GT0C 2K9NA 2R7ZJ 3LNQA 4MIMA 2IBDA 3OSGA 3M4OJ 1Y1WJ 2P81A 3SFIA 4X1EA 1RKWA 1RETA 1JTYA 2HXIA 2L9RA 1S7EA 3FKIJ 3PM1A 2NOGA 5C4JJ 4M3DA 2DA3A 2MW8A 2DN0A 4FE7A 2M0CA 1MBHA 4X6AJ 1G2HA 3BQYA 2DJNA 4W97A 3S2DJ 1HCRA 3S1RJ 2M8GX 2EQRA 1IC8A 1GV2A 1DU0A 1HLVA 1SANA 4LOCA 3FK7A 3B6AA 2XGDA 4DYRA 1APLC 3RZOJ 4FE4A 4IEJA 1EF4A 4A3EJ 1IGNA 1BJZA 5F0CA 3HKZN 1IRZA 5IYBJ 1OCPA 1YRNA 2NVYJ 5E3OA 2OF7A 3RKQA 1T33A 1ZR2A 1WPKA 3DCFA 5F08A 4XRMA 3JRGA 3SJMA 2JA8J 1P7JA 2DA5A 4D5FA 2MG4A 3K2AA 2TCTA 2LLKA 1GV5A 4DYCA
chains in the Genus database with same CATH superfamily
2ZJQF 3T8TA 2M45A 5K7HA 3BROA 4RDUA 2W57A 4MTDA 1BJAA 2DCEA 3HSEA 1WZ2A 1MMNA 3HM5A 1HXDA 2E34A 5M5YJ 1S5LC 2BHYA 3DWLE 3OYBA 3KZZA 4GYGA 4GDFA 1FP2A 3CCRI 1KYZA 4WXCA 4Q48A 2ZSHB 4BE2A 1ZR4A 2FOKA 5J1UA 5FLVA 1Z1DA 2BY1A 3OYGA 2VKVA 2GZWA 1FX7A 5E1ZB 3JRHA 3VYTB 5A2QZ 3I0TA 4FQGA 1Z6RA 5K7FA 2XPWA 5HLIA 5HOOA 2I5UA 1VQ5I 3GTQJ 4KT5C 4D7MA 1AKHB 3R60A 2M87A 1LEAA 3ABKH 3PNYA 4Y33A 3M7GA 5FGMA 2MYSA 5ED4A 2LYCA 2L0KA 2EFWA 4EM1A 2X85A 3N4MA 2DK5A 2R5YA 5M5WJ 2W24A 3D1NI 3ASNH 4MNUA 4YIRX 1YS6A 5FKMA 2O9LA 2L54A 3I4NJ 1WH7A 4CA0A 4XSZF 2QENA 1ETKA 4CCNA 3KFWX 4Y13A 2UXXA 2W85A 2VXZA 2GQQA 1WHUA 3KLNA 3GZ6A 2K02A 2YUSA 1WJEA 3PSFA 5JI6A 2GXGA 1IZ1A 2PMZA 5EEHA 2MC3A 3KEYA 1J5YA 4XOPA 3HGYA 1AA7A 4AM3A 1EH7A 5JHUA 3WGIA 3S3NA 2O61A 2BBYA 4FX0A 2CQNA 2HVQA 1Z21A 2A3SA 4IRHA 2E2HJ 1TWHJ 2GIZA 3NARA 5FJ8J 4HA8A 3LSHA 4ABZA 2MABA 3FK6A 3RKWA 1Q1VA 3GCMA 1BC7C 1BR4A 3HGGA 1BW5A 4FX4A 1Z05A 1G59A 4L9NA 1WI3A 2KT0A 2ME6A 3V4GA 2P0WA 1HDDC 2ZO4A 1U0JA 1FLIA 3CDLA 2H8RA 2HTSA 1MSFC 2M3AA 3S8PA 2R7OA 3WTXC 5FLXZ 4ZYGA 1FPQA 3OYHA 3IP4B 4CICA 1W0UA 1VQ9I 3HEFA 4A3GJ 2M2EA 3K70C 1SC7A 1I1GA 3L2CA 2HGCA 2V4JC 2EV6A 2WADA 1D3YA 3C2BA 2YR2A 5CLSA 3E5QA 3OOUA 2OV7A 1X2MA 4RB2C 1MZBA 1ULYA 1YQAA 2XB0X 3I55I 1YHQI 2BW3B 4XKCA 4HV5A 4KIFA 1IDYA 3Q5FA 5ICCA 3GTLJ 3S2WA 1MBFA 5HVQC 4FT8A 1I6HJ 2HTJA 4GFBA 2XC7A 1WH5A 2XHKA 2HDDA 3W6KB 4AYBN 1RR8C 3F3XA 3I56I 1BN5A 1RC9A 4LD5A 1A31A 4LB6B 2A05A 1MNMC 3I54A 4HNUA 4MO7A 4KIGA 4YIFA 2RQQA 3JAMK 5LHIA 4KFCA 3FM3A 4I09A 4F93B 2LK2A 1ZRDA 3HC7A 4ENNA 2VT2A 3NAUA 4JX4A 2K7LA 1R00A 2FEZA 5C44J 1M1EB 3BR5A 1S7OA 1XGSA 2BW3A 3DV8A 2FA5A 1VQ6I 1G6NA 5DD4A 4U7BA 2EA4A 4W1UA 1RIOH 2PEXA 3X2QH 1Z0XA 5A2QK 1CQTA 3E7LA 2VQLA 2W48A 4XKWA 1E3PA 1OR7C 5HLGA 5FD5A 5LLQA 2RV8A 3AG2H 3W2WA 1R5ID 4L5EA 5J47A 3F9KA 1O4XA 5FRNA 3DU5A 1BI1A 3CP8A 1MKMA 4C3IJ 4OMZA 1SD4A 1UB9A 2HNHA 4U87A 4BQNA 2G7HA 1FBQA 1KA8A 3FXQA 1HBXG 1W7PA 3ZQGA 1HOMA 2H1LA 3WU2C 1VQOI 4HSRA 2QSHX 3CMAI 1NG7A 2RN7A 2ESNA 3BG7A 3GTJJ 3O6BB 3OIPA 1ZG5A 4BQAA 1YTYA 3HOUJ 2QZ8A 1D0ZA 3DTKA 2WV1A 3R0AA 5H6RA 1SD5A 4WF2A 2DO7A 3VODA 1JE8A 1WKMA 4I7HA 5KAIC 3OL4A 1A6QA 3BR1A 1JUMA 2KZVA 2IS4A 3HJEA 4PGGA 2CW8A 4B44A 3A0BC 2E1MC 3A4CA 1IDZA 2KMUA 3I71A 2LKSA 2WAFA 3F8FA 2WAEA 1R36A 1FP1D 5J1YA 2DMNA 1TW2A 3HTSB 3GTPJ 5E1WA 1TWCJ 1OMIA 1UG2A 1R5GA 1MH3A 2DW4A 5D6EA 1O3SA 3OYDA 3A01B 2CS3A 2LY2A 2PX9A 3EUKL 3PNVA 3WU1B 1U3EM 2R7UA 2O8XA 2DA2A 3R61A 2E36A 5JVTA 1JHHA 5HDNA 2RKHA 3VSKA 2EV5A 3H9QA 4XN0A 1XGOA 1LJ9A 4NQWA 1B9NA 3LWFA 3DKWA 3L2QA 3OSFA 1MBJA 4KUMA 1EA3A 2MFZA 3DXJF 1YJWI 1Y1VJ 3HOZJ 4B43A 2E71A 3K4KA 2WAQN 3G4SI 2WBMA 4P1WA 2F5EA 3FXMA 5TISC 4L5IA 4XRSG 5AIQA 3WG9A 3NRVA 4OIPF 1UFMA 2CUFA 5LEJA 4AVPA 3JRAA 5KNLA 5M3FJ 3G1LA 3C3WA 1OISA 2MLKA 5H2FC 5F0HA 1YX5A 3KCCA 1DGRM 2A5YB 3LSGA 2NVQJ 1BIAA 3ZQCA 3TO9A 1V3FA 2YPRA 5IP7J 1ZRFA 3P9CA 2CV1A 1AWCA 2RREA 5EF6A 2L3DA 2Y2ZA 2DOFA 5BOXA 2PQ8A 3GW2A 4PJMA 3SEZA 3V8JA 1MW7A 3CUOA 4RGUA 5LEKA 2JRMA 2XV4S 3K70D 3ZQLA 3ZN0A 4PFPA 3HPGA 1JI8A 4LJZF 5EJCA 1YI2I 3CJTB 3BPXA 2F5VA 2E1CA 2JWTA 2A07F 3PQJA 1R7JA 2CQKA 3SXYA 2HPIA 3LSIA 3O2PE 5KK1A 1IN4A 1B8IA 2XKOA 1R58A 3JW4A 3OYAA 3CF5F 4KN7X 5LGTA 1XMXA 4HEA2 1MBGA 4BBRJ 2JJ7A 2FQ3A 4PJJA 4A93J 1EJ9A 2Y0MA 4I2OA 2O6GE 4M74A 2FQ4A 2HQ5A 5FFXA 4CYCB 1ETWA 2P5VA 2HS5A 1LDDA 2HYFA 1USTA 3ZMUA 2DYSH 1FJLA 1SFOJ 4CGZA 5EEGA 1SAUA 4BQOA 1TC3C 1ZKGA 2EWNA 3S15J 2VE8A 4XLPF 3PL8A 4UB8C 2CV2A 4HX8A 4RGSA 4A3DJ 3E6CC 4D9JA 4BU2A 3TDUC 1N77A 1F1ZA 4AIDA 2OCCH 1FSHA 1QRYA 2H27A 2JSCA 4CCKA 2JK3A 1ZTRA 4HZFA 1R23A 3GTKJ 5HS9A 4D1QA 2KP6A 3DLAA 2KHMA 3CC7I 1ONVA 1CF7A 2QKLB 1JKOC 3TP3A 4LG3A 3SYTA 4M3BA 5CVJA 2VKDA 2CH0A 3BR0A 5ILSA 1TP4A 2GOXB 3OYEA 2J5PA 4XK4A 4XLFA 5CPRB 1R1TA 4GXOA 1Z7UA 3ULQB 3F6OA 2K86A 1Y0NA 4A12A 2C6YA 3J7AY 1MBKA 3CO7C 2HDCA 4BXXJ 3G1MA 2R5ZA 2AS5F 2LY9A 2IGMA 3H9JA 3RI4A 1IAWA 3S2HJ 3R4KA 1YW7A 2E1NA 2O0YA 3TMOA 1I3QJ 4EJWA 4XLNF 1WJAA 3HOVJ 1GXQA 3TOBA 3IKTA 2VB6A 3J80K 3GX4X 4UVAA 2WY7Q 1KU2A 4LLLA 4ENMA 4CXFA 2DI3A 3T1BA 1UHMA 4XOTA 2JUGA 2WTEA 3ERMA 1G8XA 2VJJA 3H3ZA 4C2MJ 3E5UA 3GEZA 2VOOA 4MIMA 3IWFA 2KISA 2JA2A 1U5TC 2XVCA 4CCOA 4X1EA 1RKWA 1RETA 1JTYA 5D6FA 4BXFA 2DT6A 1S7EA 4L9TA 3PIOF 2BOLA 4HNTA 2DA3A 4ZJZA 1Q1HA 1G2HA 1BI3A 2RNGA 4UHTA 2FRHA 1PP8F 2VASA 4LK0F 2DQLA 2OD5A 2Z5UA 3H36A 3I5UA 3S2DJ 2V1XA 3QAHA 1HCRA 5DCMA 1IC8A 2XAUA 1SANA 5FLXK 2V26A 3B6AA 4DYRA 4BJ5C 1L0OC 4HF0A 4PUSA 1Z9CA 2RNJA 3HOSA 1IGNA 3EYIA 1WJFA 2WA0A 1YW8A 4NUBA 3CCJI 4WWCA 1REPC 3RKXA 1SD7A 3LSMA 3OMYA 4A0ZA 2MC4A 2R7DA 1W7PD 3RKQA 1R71A 3AL0C 1WJ5A 5F08A 3SZTA 4XRMA 4RLQA 3QYBA 3JRGA 3VEPA 1P7JA 1NH3A 2UV1A 3GO5A 2PJPA 2LLKA 1GV5A 4DYCA 4HLYA 1GVJA 1XMKA 4HDUA 1D0XA 3CMEI 1OR7A 2PMHA 4RM2A 2OBPA 1T0FC 1O3QA 4MLOA 3CCMI 2W4SA 2YSRA 1TW3A 2L4MA 3VYUB 2ZMEB 4MQVA 4XQFA 2D5VA 2L7FP 1BR1A 3HRSA 5DM7F 1S6LA 3SDGA 1T56A 2FBKA 2XDVA 3GFLA 4JOMA 2IGOA 5DTDA 1NK3P 2EFNA 3GYHX 3PJRA 1QA6A 3ZMTA 2DA1A 1DGWY 4UUSB 3DFGA 3FHZA 4MHGA 3T8RA 4B09A 1NHAA 2EPFA 4DW6A 3IRRA 1JKPC 5CYVA 3S32A 4RB1A 2XROA 2DFEA 2DT5A 3DPUA 4R79A 1KONA 2Y9YA 5HLHA 3QPLA 4CYDA 1IG7A 3JTHA 1J09A 3IH4A 2AXLA 4EM2A 1H9GA 3RQ4A 2XRNA 3HSRA 2ZFUA 2XRLA 5FROA 4JQFA 2V6EA 2X48A 3F8CA 1IJWC 2IS6A 2WB1N 4IKFA 4FHTA 1J75A 1TQMA 3L2WA 1RI7A 1GLNA 2WV0A 2DTZA 2ISZA 5E3MA 4I0AA 2Y69H 4Y3OA 4BYYA 3ZQIA 1BL0A 3CCEI 3TQNA 1UZCA 1LVKA 3OOPA 1FY7A 3CDHA 2H09A 4PSWA 2BVMA 3KP6A 4QSHA 5EGOA 2IVMA 4EJOA 4Z6YA 3QPHA 3V8LA 4MFDA 5C3EJ 5L3GA 1HSJA 1VF9A 4M9XA 1K4TA 4BHBA 5LBQA 3D5SC 4C3HJ 2HDWA 1UJ8A 1SFKA 3TDZC 4AIJA 1ZH5A 3KYDB 3VSLA 3E0JB 4I99C 4E70A 2F4OB 1FTTA 3J7AO 3HOYJ 2KIFA 3M1CA 4J00A 2NVUB 4LLNA 2R0QC 2VONA 4Y52J 3JREA 3VYSB 1OCOH 4E7HA 3BJOA 2X0LA 1XGNA 1EH8A 3F72A 1VNDA 3JAMZ 5J4YA 1MNEA 3ELKA 4OWRB 1MMSA 3SZPA 3RQIA 2GM4A 1J9IA 4OIOF 4IVNA 1F5TA 2F5CA 1YRNB 2EB7A 1G3TA 2CQQA 3JTGA 2DFFA 2L4AA 3O8GA 4ITVA 1I50J 3H5RA 3K0LA 3Q0UA 3LA2A 2JA6J 4A0YA 4F7ZA 2ME0A 3RPUD 2O03A 4U7DA 4E7JA 2LOOA 2M30A 4B3AA 1IN8A 3H92A 2XIGA 2Y30A 4DOZA 1WJDA 3IKVA 2HOAA 4PFOA 1I3AA 4IRGA 1OPCA 2K9QA 1XS9A 2PJRA 3FXLA 1VQPI 1CGPA 2ESHA 4IOCF 2P7CB 5BPDA 1B1BA 1XSVA 1Z3YA 3OYJA 3KP3A 2HOTA 1XB4A 1JJ8C 3PUFA 1CF7B 1TWFJ 2J5OA 1HDPA 3BZKA 3RPQA 2LVSA 3FXKA 2PN6A 4IQ4A 9ANTA 2CMPA 1MH4A 4DJAA 2VC0A 2OTLI 2VC1A 3Q0VA 3FX3A 5DYMA 3HRMA 4P55A 2COBA 2DJIA 2XPVA 1VFCA 1B8IB 1WGXA 1E3HA 1WJBA 4HAMA 3VYRB 1FMWA 1J59A 2RC4A 2NAZA 1KU7A 4NNJA 1T0FA 1KQ8A 3OS0A 4F91B 2D1VA 3K4BA 1DQUA 5JFRA 2X6YA 2ISYA 3K9TA 1R6RA 4IOAF 5TJJA 2EJRA 2KPMA 3WHCA 2HYGD 1FOWA 2MD0A 1STZA 3G1OA 3C2GA 2FOWA 1FEXA 4XMYA 3TO6A 2YX4A 2Q8KA 1LE8B 3PO3J 2L9VA 1T6SA 1HSTA 1FIAA 1B72B 5IT9Z 3RKYA 4BHPA 2A69F 3GF2A 2IW5A 1TQPA 2R7WA 5GAEJ 3HXLA 5D4RA 4QIWN 4EJTA 1V5FA 1K83J 2QBYB 4MQ9F 4J19A 3ML6A 4RB0A 5CQEA 1VQ8I 1QVTA 3S1MJ 1FYKA 1Z6TA 1LQ1A 4ENKA 4AIKA 2UXNA 2H6BA 4HBLA 2K27A 4AD9A 4L9VA 2H94A 2DMTA 1GXPA 3ZMZA 2PLYA 4I98B 3WODF 4M6XA 4AIHA 4BDZA 5FKLA 4IHWA 4FISA 2LC2A 4V19K 2ELHA 2ZJPF 2JMWA 2QQAA 2EK5A 2NOJB 4O5VA 2RQPA 2L9SA 3FISA 2DA4A 3D0SA 1ZLJA 3VPRA 1H0MA 2XSDC 3CJQB 3JSOA 3L9FA 3S17J 1FTZA 5IYDJ 3EYYA 4IO9F 1E0EA 3CLQA 4D5CA 3BTCA 2Z2SB 4G12A 4M3EA 3KE2A 4M3FA 2NS7A 3LMMA 4NC7A 1I6XA 1B6AA 3K4JA 3KYLA 4KN4X 5B1AH 2K4BA 4BEHB 4XN3A 2M34A 4YFNF 2MBFA 2JZYA 4BE0A 1Y8RB 1BIBA 1QZYA 1V54H 1XMAA 2W82A 4OAZA 1W36D 2F2EA 1XDUA 4M3GA 1UAAA 5IY5H 1HKQA 2P6TA 2NNYA 3N97A 5IP6A 2FNPA 2GA2A 4UUVA 2B9SA 4IQJA 2VBZA 3QOPA 4IX7A 4NQWB 1NK2P 1FWZA 3RJPA 2UZKA 1HW5A 2I8DA 3M07A 3BQZA 4C2TA 3OV8A 3H3VK 2STWA 5JLXA 4E7KA 2DBBA 3A01A 3OYFA 2R5ZB 4PJNA 1UHSA 1KU9A 1JT6A 3OY9A 3H3UA 1DUXC 2E5NA 1OCCH 2FX0A 2JTVA 3I53A 2Y75A 4R1HA 4FASD 4A3BJ 5C4XJ 3F23A 2AXTC 3I58A 3PFYA 3W6VA 5K5RA 1Y0UA 2MA3A 1OFCX 3Q3SA 4HDVA 2XSJC 1JUSA 2KKOA 3HUGA 2Z1DA 1OYWA 2YX7A 1QZZA 3MEXA 4PGHA 4HQMA 5DUKA 5HS7A 1I39A 2VJ4A 2IJLA 4EJUA 2XASA 3TP0A 1HW2A 3AL0B 4YIIA 4CHUA 1MMDA 2V9PA 4G6DA 4Y7NJ 4E7IA 3KZIC 1QBJA 1AOYA 2LMDA 3L7WA 4P9UA 3U9GA 3GBGA 4NBQA 3LL7A 4P9FA 1LEBA 3FXOA 3E3VA 4Y4RA 4A3IJ 1QGPA 3QRFF 3CMMA 1YE9A 4L5JA 3CZ6A 1OKRA 3DBHB 4DBQA 5BPIA 2HOSA 1E17A 1NG6A 3Q9SA 1ZREA 3NWTA 4Z2YA 5H20A 2V79A 3F8BA 4CSWA 2FF4A 3I3LA 4KYWA 1PYVA 1O3RA 1B4AA 4E7LA 3U1DA 1T38A 4N9IA 2IA0A 3LFUA 1GUUA 2VKEA 1T39A 2EFQA 2JUCA 2XGXA 3GFMA 1FNNA 4ESBA 1IUFA 5L3EA 4IHVA 2M4KA 1D0YA 3FMRA 1IXRC 3K4NA 3M1EA 2EZKA 1U5TA 3VB2A 3OIOA 3QPSA 3WTVC 2KQRA 3OS1A 1MIJA 3HOWJ 4AYBA 4BGDA 4UY8I 4UV9A 2XKPA 1MBEA 3S3OA 2LSOA 2XGCA 1WSUA 3LAJA 1J2XA 3FZVA 4MFEA 2L5QA 5BS6A 4IHXA 1S7AA 2WB1A 3MZ8A 1SD6A 5HNFA 4G6QA 4IXAA 4LMYA 2DYRH 4XONA 3HDDA 1RUNA 2MD5A 1I5ZA 3ZOBA 4R8HA 2VI6A 2BVLA 3CCYA 2VOPA 5E8IA 3HZJA 4AU7A 3HRUA 5GADJ 3CC2I 2BXYA 2JVGA 1Z3XA 2FSWA 2CU7A 1K6YA 3L2UA 4LFUA 2KIUA 1G3YA 3A02A 3D5RC 4HNVA 3CMYA 2ELKA 2JRTA 5EG0A 1XGMA 4UB6C 2ICWG 2YU9J 1W5TA 1HKSA 5IOYA 2VXDA 4RLFA 2K9NA 4OIRF 2UWMA 2F48A 1FOYA 2V7FA 3M4OJ 4Q4ZF 1Y1WJ 2GWRA 2OQGA 3SFIA 5KAFC 5CKTA 3DU6A 2PFBA 2R7RA 2L9RA 3IL2A 4BNCA 2IXSA 4EQQA 3PM1A 3AG1H 2BXZA 5J40A 2BY3A 4FE7A 4X6AJ 5LHHA 3BQYA 2QVOA 3NWSA 1Z91A 2DPUA 1R1UA 2Y48A 3BWGA 1XSDA 3DP7A 3WTUC 5D5UB 3ZP5A 4F3QA 1QNTA 2B7EA 3FK7A 3HPHA 3RZOJ 4FE4A 4IEJA 4PSXA 1EF4A 1BJZA 5F0CA 3DKXA 2CV0A 3HKZN 3V7RA 3LAPA 4KMFA 5IYBJ 1OQYA 1D8JA 4LGWA 1YRNA 4RAYA 3G6EI 4U0YA 2NVYJ 2HQRA 5E3OA 4ENJA 2OCEA 1TQIA 2VODA 3AFHA 5B1BH 1T33A 1DPUA 3HYIA 2P5KA 2ZXIA 2JA8J 3MAJA 2DA5A 4D5FA 1J7KA 2ZJ2A 2CQ7A 1VQLI 2QCOA 2ETHA 3NQOA 3QYFA 1YOVB 1LFUP 3L2RA 2MLGA 3COAC 4E6KG 1Y8QB 1X58A 3MCZA 1RZ4A 4JBAA 5ILUA 4OINF 3VOEA 2D45A 3N05A 2BYVE 2VIXA 1PUFB 2VQHA 3M9AA 1F9NA 2LP0A 5L3DA 4AC0A 1JUPA 5D5VB 1LUJB 5GAGJ 1RUOA 2RDPA 5B5EC 3U21A 3QU3A 1ITYA 3BPVA 4UNOA 3CQZJ 5DEQA 3Q0WA 2CUEA 2NRAC 5JVGF 3FIWA 1A35A 2EINH 1VQMI 3ECHA 3O8HA 3V42A 1RPWA 4EGZA 4A69C 4XL9A 4GYIA 4LK1F 3ESWB 3PUBA 1FBUA 3BG9A 4KICA 2HXOA 4XLCA 4BDYA 2HOEA 2DT7B 5JHFA 3TEDA 2A61A 2CYYA 1DU6A 4D7NA 3E5XA 3GFJA 1XDSA 5FKNA 3K10A 4DYQA 3ABLH 4II2A 2OUMA 2V1UA 1K4SA 3RZDJ 1SFXA 2GIVA 2OPTA 2E1OA 2EIJH 2DMPA 4LG0A 3C7JA 3GZNB 1D1BA 2NS0A 1I27A 1RR7A 1X1BA 2CUZA 1LPQA 1ZGWA 3MKWB 2RVCA 2DQRA 2Y9ZA 4UUSA 5F04A 5FO5A 2VBXA 3B02A 2IP2A 2E1MB 2KLOA 1Y56A 2DOEA 3P9KA 4XSXF 4BKXA 4D0PA 4HQEA 4G8XA 2Z9OA 1WVRA 2HI3A 3IC7A 1JKRC 2VPLA 1LFPA 2RAEA 3J81Z 1MD0A 3M8JA 1D8KA 5L3FA 1USSA 3B73A 3IAM2 5F27A 2L7MP 3BG5A 1P7IA 3BP8A 2H1KA 1P2FA 3TW7A 3S3MA 1T8IA 4XBFA 2QGUA 1X1CA 4UVCA 2CWEA 2K85A 4KISA 4XICA 4E4HA 2Y0SA 3V7SA 2VUMJ 4G9YA 5FKOA 4HOBA 3JCUC 1N75A 5HLTA 3DKYA 4YG2F 1HF0A 3OYIA 5LGNA 4UVBA 2LNBA 1Y6IA 3TO7A 2CG4A 5FLMJ 3QPTA 1T2KA 5EEAA 3GWZA 5E1XA 1X1PA 3EUHC 1BI2A 4DZJA 1FC3A 1P4WA 2R7QA 3WE3A 1LB2A 1OCZH 2NYXA 2PMZN 2QLZA 3QWLA 4BJ6C 1FIPA 1R22A 1EKEA 4KA4A 1LDKB 3OR1C 2DPDA 3E97A 3FDYA 2A68F 2OAZA 1KU3A 4OAYA 1UHWA 1P4AA 4A5NA 4XIDA 3MKYB 2PMUA 4M73A 4FCYA 3CJNA 4PJ0C 3P7NA 2KRFA 4ANJA 1R5HA 1X1AA 3BR6A 2KRHA 4KT6A 1JKQC 2HVSA 4I6ZA 1TBXA 3CCVI 5D4SA 1YG2A 1BOBA 4ESFA 2Q2EB 4F92B 3BTLA 1SVOA 3OYLA 3BJ6A 5K7ZA 2IS2A 2XAFA 2R7SA 4OIQF 2R7FA 3PQKA 4ZDOA 2FE3A 3ZMSA 4I76A 2QYOA 4M72A 2QSGX 3ZMDA 1UCRA 1V4RA 1DPRA 2ID6A 3L2VA 2QEXI 4M9ZA 1IN6A 4E7ZA 3MKLA 2O5RA 1S72I 5EZGA 3ISPA 4E7SA 2EFOA 2FD5A 2HZTA 3F8NA 1WRJA 2PJRB 4H0EA 3DBLB 1LNWA 2FUG2 5DS9A 1TNSA 1V5EA 1MMAA 3HHHA 2O7OA 4B48A 5LGUA 2HPMA 3DF8A 3I4MJ 1ZK8A 2Z16A 4I01A 1X4OA 2FNAA 2FU4A 1R1VA 4ZC3A 4P5OA 4RGXA 5AONA 3QOEA 2ECCA 2DA7A 3HBLA 1JGSA 1D1CA 4OOIA 4BS9A 2H6CA 4BXUA 4KNYA 3E6MA 4V2FA 2AQFA 3E6DA 3FXRA 2YS9A 3WTWC 3S1NJ 2M1BA 4H4KC 2Q1ZB 3GXOA 1ZYRF 2BY0A 4ZDLA 1SAXA 4O3MA 1YYVA 1H8AC 2VPRA 2AQEA 4Y17A 5IPAA 1LDJA 3GTOJ 4IHSA 4KDPA 2KJCA 4UV8A 2BE5F 3QU6A 2HYJA 1BOAA 5E3LA 1ZG1A 2E2JJ 2BEOA 3LQQA 1YITI 4G6TB 5FFZA 1ETVA 2R7VA 1ETOA 3WGGA 1JXSA 5GTHC 4IHTA 5CVIA 1HA8A 2EH3A 2LRDA 3I59B 4ASNA 3U1KA 3BOQA 5F64A 4M71A 5FD6A 4PJLA 3FF5A 5F1RA 2FMYA 4CUGA 1U8RA 2OC6A 2XAHA 4V2GA 3BG3A 3CESA 5F0FA 2ZJRF 3HKZA 3I4PA 2ID3A 2HQAA 3BCBA 3SFZA 1MGTA 2VKHA 4KJZA 5D5WB 4C2UA 2BGCA 4RAZA 3DEUA 5M3MJ 2CW0F 2K3PA 3NEUA 2ZKZA 2LH9A 2K9MA 4MEXF 5DM6F 2KRCA 2OZUA 2EFPA 4C9YA 3IAS2 3PFIA 2KFDA 3HOTA 4G7ZF 4HPQA 1I1SA 2XAQA 1PUFA 5IP9J 5DCMB 3MFKA 2DOAA 2CFOA 2XUBA 3TL4X 2WWYA 3JRFA 4BY1J 3A1YA 2M9HA 4MGRA 1N78A 3KP4A 2VBYA 1IXSB 4XR6A 2K4JA 3DPLC 2MSYA 1S8NA 4IZZA 2QQ9A 2A6TA 2JT1A 4HW0A 3T5XA 5HNHA 1U2WA 2HEOA 1FBSA 2D2WA 3R0JA 1VQ4I 2PI0A 4BACA 3EUHA 2V6CA 4A3MJ 3KZYA 3OYKA 3U2RA 2R93J 2LBFA 2DFHA 5BQTA 3BZ6A 5LFAA 2EA2A 4I0BA 2M8EA 2P4WA 4IF4A 3ZPLA 1XX5A 3GLXA 4RMNA 3HB9A 5E79C 4ZZDA 1MDMB 1G3SA 4RB3C 3A2KA 5E3NA 1S3JA 1P6RA 2K5CA 3K6GA 3LQRA 2D1HA 3P5JA 4BBSJ 2CJJA 5J6XA 1TL8A 5DUIA 3CJRB 3QODA 3ZRGA 1XD7A 2R7TA 4A3CJ 1YLFA 3S1QJ 1BA5A 2V1DA 3HIFA 4AWXB 3TBIA 1O7LA 2IA2A 4M6VA 5HDGA 2LKPA 2CRGA 2NVTJ 4RGRA 3I9V2 5GPAA 4Q5SF 3E1SA 4IPAA 1ERDA 4XKVA 2OQRA 1MSEC 1YIOA 1W1WE 3LA7A 3ZR8X 3KP5A 3J7YJ 2OTJI 4ON0A 2CSOA 2CW7A 4ESJA 3MN2A 4HRIA 4FETA 1YX3A 5L3CA 2JA7J 2CQXA 2M7AA 5IT9K 2EBIA 4WX9A 1ZQ3P 3A0HC 2G0EA 3WHBA 4JK1X 3S16J 2E5ZA 2KZGA 2LKXA 2CUJA 3SQNA 1H88C 2ZXJA 1Z67A 3ROUA 3JSPA 2JQ7A 2ZFWA 5M5XJ 3G71I 4RS8A 3FBIB 4A3KJ 2MGQA 5K5OA 4B4CA 3AG3H 4JP0A 1X3ZB 3WTTC 5J3LA 2DDAA 1Z77A 3HG9A 4YFKF 4XORA 4CCLA 2EIKH 3DTEA 5KCMA 4K2EA 2L9NA 3ZN1A 2DFIA 2GAUA 3H1CA 2P6SA 3GZ5A 2DTRA 4PZJA 2LY1A 3MMYB 3M8EA 3RSNA 2PG4A 2P7VB 2FMLA 1F43A 4TV7A 2P5LC 2DXIA 2HU9A 2QSFX 4QWQA 4DGWB 2KDZA 1WJCA 2GXBA 3S14J 2ZCWA 3L09A 2Z99A 4B8XA 3OIQA 3EDPA 1ZHFA 2A6EF 2DODA 1ZELA 3OYMA 1HW1A 3FMSA 1W36C 3ABTA 4IJAA 1VTNC 3LSJA 1U9OA 3EQLF 1TNTA 2FJ1A 2L7ZA 4N0BA 4L9JA 2UUZA 4A6EA 2G7UA 1FZPB 1UELB 1ETQA 4L0ZB 1IO2A 2FBIA 4IL6C 5TRDA 1GT0C 2R7ZJ 4XLEA 1P92A 3CUQA 4Y15A 3LNQA 2JVHA 1KGSA 2IBDA 2LDUA 3CCQI 2LF7A 4LIUA 1PDNC 3OSGA 2HWVA 2BZTA 1IN7A 1RNLA 2P81A 1ZAOA 1IRFA 1SFEA 1BR2A 4CZCA 3FKIJ 2NOGA 5C4JJ 1H9TA 1XTAA 3DBRB 1TTYA 2M0CA 4I02A 2A6HF 4G7HF 2QQBA 3G3ZA 3K1PA 4PK4A 2R3SA 2VJ5A 2V9KA 2M8GX 2EQRA 3ABUA 1GV2A 1S9HA 2X6XA 3S1RJ 1DDNA 3CLOA 1IRXA 3WG7H 1HQCA 1B9MA 2BHZA 3MZHA 4XLHA 4A3EJ 4RAFA 1VZ0A 3SHFA 1FYLA 4M6YA 4IRIA 1IRZA 1PP7U 3AKZA 1LVAA 3J81K 3I64A 3S93A 5E20A 1ZARA 1WPKA 1FMVA 1MDMA 1SMYF 2L02A 2ZXHA 1K6OA 2MG4A 1DP7P 4HV6A 4CH7A 2DDBA 2VBWA 1GVDA 5DD8A 1FT9A 3KEOA 1W4MA 3BJAA 5EZHA 3H5NA 3IWZA 1IV6A 3MQ0A 3F22A 3VDXA 2K9LA 1AHDP 1EH6A 4ZTFA 3JRCA 5F1JA 3TOAA 5E17F 4B47A 3H9GA 2HZDA 3R6SA 2ZC2A 1YFHA 1ZG3A 3IH2A 2K9SA 2CFXA 1POGA 2GA1A 4BEHA 4BE1A 4HSTA 4O6JA 3K4LA 3L00A 3JR9A 1WI9A 3OR2C 2TDXA 1B59A 1PVEA 2V1NA 2XF5A 3IRQA 4NHJA 4QPQA 3HTUA 2ZMEC 2LG4A 3DLLF 4CCMA 4GO1A 3H0DA 4M9SA 4U0VA 3KX2A 1LFBA 5B3SH 1K78B 3M3YJ 3EETA 2L7KA 2QA4I 3H35A 3OYCA 1U8BA 2X1EA 3W6JB 2VT3A 1JGGA 4HF1A 2E7WA 1W7PB 1K79A 4XM3A 3K1MA 2X4HA 1MMGA 3BDDA 1JJ6C 4G7OF 2Y0SN 1XG1A 3GLLA 2EZHA 1MJAA 4MEYF 4C3JJ 2ACJA 3A03A 4DIQA 2IEKA 3HHGA 2R7XA 3F6VA 1TT0A 1R4NB 1JTXA 2OU2A 1BW6A 1WFXA 4NB5A 3CUQB 2VL8A 3KEQA 1BI0A 1ETXA 4KMUX 2M0MA 5TGTA 4LITA 1ON1A 3LFKA 1WWXA 1D1AA 1TLHB 2CGPA 1A5JA 5LRSA 3D5LA 1XSXA 3RYRA 1FOKA 1TZLA 2EIMH 3AG4H 3FHNA 3O3KA 5K1YA 1E3OC 2P8TA 1SEUA 2H8WA 2E19A 3K7AJ 3AAFA 1VQKI 2GBYA 4YELA 4A2UA 3SDBA 1P9QC 1YO5C 2R92J 2LF8A 3C2HA 1N25A 3CO6C 3WGHA 4HX7A 3KETA 2XAGA 4BJTA 2OZ6A 4B1RA 3CD6I 2XGEA 1GHCA 4KIBA 4XKBA 4WK8F 1W0TA 5CJ9A 1HKTA 1SMTA 3KPHA 2Q0OA 1Z7LA 3GVAA 5DDGA 3ZQ7A 1ZN2A 2DK8A 1Y39A 2XPUA 1WCMJ 1FYMA 4EGYA 2DA6A 2JPBA 2ZNYA 5CQGA 2R5YB 2X6WA 2B63J 5ICGA 1YJNI 5BMZA 1O57A 2IPQX 1OCTC 2RGVA 4DQ2A 1NTCA 1K61A 2WY8Q 1JHFA 1AKHA 2KIMA 1FOXA 2NS8A 2DAOA 2ZBKA 1OYIA 1R49A 4YEJA 4BY7J 1DP3A 2JA5J 5E8GA 4LLGF 4A3JJ 3IUOA 2F4MB 3W3CA 3MVPA 4CO8A 5HDKA 3CF2A 1IW7F 2Y31A 3MD2A 5KHDA 1A04A 2F4IA 2R4GA 2LREA 3ABMH 1T98A 2X1CA 4RBOA 3WTSC 2ZB9A 3LSRA 2M4GA 3K69A 2ECBA 3BG6A 3V7CA 5ICEA 2XAJA 4HX4A 3UNGC 3F21A 3KP7A 1YJ9I 5EG0B 4GGGA 4PDKA 2IA1A 2G9WA 3K4CA 1QO0D 4ZZLA 2EZIA 3WTZA 1K78A 2GXAA 1YW9A 2GOMA 3RTRA 3RPUA 4EM0B 3GMEA 3CC4I 3PSIA 2DLLA 1K7AA 1W5SA 2K3FA 3ZQHA 5B66C 4II3A 4WXHA 1SVLA 2LBFB 4S05A 1EV7A 4QTRA 4L18B 3DTIA 4ETSA 4ZH4F 3PNTA 2HKOA 2W7NA 2YU3A 3EPZA 1ZGJA 2WC2A 2E7XA 5CVVA 4NC8A 2E2IJ 5BNGA 1E2XA 2ZSIB 1QPMA 2N8GA 3G2BA 1GDTA 4X0GA 4KITB 2AHQA 3QQAA 4AUXA 3GTGJ 3H5AA 1O7FA 3RCOA 1D5YA 4GRIA 1QU3A 1O3TA 3LSKA 3HRTA 5DV5A 2KDOA 1ZRCA 3BY6A 1SVMA 4BQQA 1OLTA 1J0RA 1X19A 1U5TB 5GPCA 4CYCA 3BTJA 5EGOB 2EV0A 1AU7A 2GLOA 4DZPA 4A3LJ 4UXNA 1ETYA 1P4XA 2HKXA 3FXJA 4U88A 4WXDA 2JN6A 1T08B 4OU0A 1MJBA 1VI0A 1KZHA 4N4NB 1R9TJ 3KLOA 3DEEA 2DU9A 3K4MA 4NC6A 1YS7A 2V9VA 2XF6A 1SFUA 2QKMB 3ZXSA 2BV6A 2QBYA 5J8CA 4ZDPA 1QZEA 1A36A 1OCRH 3MKZA 3GTMJ 5HS8A 2I10A 1U9NA 3ECOA 1B72A 4HF2A 2VN2A 3KIOA 5J1RA 2IGNA 3CTAA 3I59A 3P9IA 4G94A 2X9DA 3CUQC 1IN5A 5ICFA 2QQ8A 1QVUA 1F4KA 3W2VA 4BHCA 4IHYA 3BLYA 4YRVA 1F36A 2ADUA 2NVXJ 1IRGA 1BBYA 3FKJA 3QYEA 3JRBA 4S0HB 5L3BA 4F52A 3FBNB 1C0WA 5GTIC 3DQVC 2HFHA 3ZQFA 1IV8A 1VQ7I 3VWBA 2IGKA 4EMSA 3HOXJ 3BC8A 4CZZA 2AO9A 1A6IA 1RESA 1XCVA 1YIJI 2X6OA 1U6GA 5K5QA 2MH9A 5J8FA 5KVRA 3J80Z 3OWTA 2W25A 1W5CC 2E35A 2K40A 3TKYA 4ZYEA 2O8KA 2LD5A 2L2OA 3B6CA 3HL2A 4MTEA 1KYWA 3BR2A 3ZQQA 1QQIA 2LTPA 2VQCA 5FKKA 1U78A 3FMQA 1ON2A 2F5FA 3EUAA 2B0LA 5H6QA 4A3FJ 2Z3YA 1QPIA 3HSFA 2IAIA 3G73A 4CDGA 5ERIA 1HC8A 3LOCA 4NDLA 4CCJA 3Q9VA 3CDIA 4LIVA 1ODDA 2QF7A 3REOA 1WQ2A 5LRRA 4XRSA 2O3FA 3J7ZI 4RAGA 2MH2A 1G4DA 3VFZA 3BT9A 6PAXA 3SEQA 3PIPF 5ILVA 4ZYDA 3IH3A 3OYNA 4C30A 2LR8A 2ELJA 3PO2J 4XLAA 3KP2A 2VJIA 3CCLI 1XPXA 4XNFA 1ACIA 5AIPA 5FB2A 3WE2A 3V8KA 5GP9A 4JX6A 2IRFG 2PBIA 3BTIA 3BZCA 4UUTA 1L3LA 1TWAJ 2TRTA 3RDIA 5E18F 2ZMEA 2IT0A 1ENHA 1UMQA 3IV5A 3ZCOA 2ZXWH 3ERED 2W1OA 3CCSI 4BUPA 4XRFA 3E6BA 2NNNA 3JRIA 2JSPA 5CVRA 4A5MA 3CCUI 4JYKA 3IHUA 2VLAA 2STTA 3KYCB 1ZGAA 2EZLA 3H0GJ 2F5DA 2QM3A 5JLWA 2IS1A 1TT5B 5CVUA 2EILH 3C18A 3DPTA 3TGNA 1JT0A 5D5XB 3MZYA 3DEWA 1H89C 4B3XA 2DMQA 4L0YB 1OYYA 3LA3A 1ORKA 1TWGJ 2Q2EA 4LB5A 2WAQA 2Z33A 1S29A 1D5VA 2JPCA 5EYRA 1XC5A 4EATA 4EEFG 4WCGA 4DNCA 1RKTA 5LD2C 4GCVA 1LE8A 4QPOA 1T95A 5EDNA 2COMA 4RM3A 3BR3A 4BAYA 1IUYA 1MNDA 3F0CA 4HYEA 1X4PA 2CO5A 4ZYHA 3JRDA 4JX5A 2NXNB 3CP2A 2HR3A 4N4OB 4QLCU 4S04A 5HODA 3L1PA 3C1DA 4ZTJA 5IYCJ 4A0XA 2OA4A 3ASOH 4ZYAA 3M8FA 1OJLA 4OMYA 4Q47A 1KQ9A 2VE9A 2LFBA 2XB5A 1PJRA 2FXAA 4EV0A 3T0YA 5IOZA 2F6CA 2DMUA 3W2AA 1V5GA 4EJVA 3LSTA 3LSPA 2FBHA 2KIQA 3FWEA 5D8KB 4RA2A 3QP6A 2QUFA 2W84A 3ONQA 3UKGA 3TW6A 1X2NA 3F8MA 4FTHA 3GFIA 2HQNA 2M5WA 1FSEA 1VQNI 2X1DA 1MJ9A 4U0WA 3MWMA 1UG0A 1QHGA 4BL0B 2BY2A 2KL4A 4HG2A 4DBRA 3UR3C 2X51A 2VQGA 2HXIA 1QHHD 1IXCA 5DCFA 1X3WB 4P96A 2OJED 1R4MB 5D8LB 1G3WA 3SZGA 4M3DA 1X3UA 1KQ0A 4BH9A 2MW8A 2DN0A 1MBHA 2QWWA 1RRJA 3FM5A 1BC8C 1IF1A 2DJNA 4W97A 5J4VA 3RIRA 5JR3A 4HLXA 1LKXA 3GUDA 3OS2A 5GAHJ 1DU0A 4YFXF 1HLVA 4EVIA 5LHGA 5IT3A 4LOCA 2M7BA 2XGDA 4PCQA 1V55H 1XCBA 3K2ZA 1ZLKA 1APLC 4F55A 4A6DA 4LG0B 2XF7A 1OCPA 1XN7A 2L01A 3OL3A 3ZGKA 5FRMA 3WU0A 2KJBA 3FXUA 3BCAA 2ZNZA 5F6FA 3RYPA 2OF7A 3WTYC 3ZMVA 4J01A 3QP5A 2HVRA 1ZR2A 3DCFA 2A5WA 3SJMA 1X1DA 1BM9A 2E60A 2W00A 4AVZA 3HUGB 4N9HA 1PUEE 3K2AA 2TCTA 3K1NA
chains in the Genus database with same CATH topology
2QCOA 5K7HA 4RDUA 1GVDA 3HM5A 1LFUP 5EZHA 1IV6A 5M5YJ 1X58A 4MLOA 1AHDP 3JRCA 5F1JA 1PUFB 2D5VA 2L7FP 2LP0A 3IH2A 2K9SA 1ZR4A 4AC0A 1JUPA 5J1UA 5FLVA 1POGA 3SDGA 1T56A 2VKVA 3JR9A 5DTDA 1NK3P 3JRHA 2DA1A 4UUSB 1ITYA 5K7FA 2XPWA 4DW6A 3GTQJ 3CQZJ 4D7MA 1JKPC 3Q0WA 1AKHB 2CUEA 2Y9YA 1LFBA 3M3YJ 3QPLA 1IG7A 3FIWA 3IH4A 1U8BA 3O8HA 1RPWA 1JGGA 4A69C 2XRLA 2L0KA 2X48A 1IJWC 1JJ6C 2WB1N 2Y0SN 2R5YA 3BG9A 1XG1A 5M5WJ 2HXOA 2EZHA 4C3JJ 3D1NI 5FKMA 3A03A 2IEKA 2O9LA 3I4NJ 1WH7A 3TEDA 1DU6A 1JTXA 4D7NA 1BW6A 5FKNA 1ETKA 2DTZA 4DYQA 5E3MA 1ETXA 3RZDJ 3ZQIA 2OPTA 1BL0A 2E1OA 2YUSA 2DMPA 1A5JA 1RR7A 4QSHA 3HGYA 5EGOA 1E3OC 1ZGWA 2E19A 3K7AJ 2GBYA 4MFDA 2Y9ZA 5C3EJ 4UUSA 2E2HJ 5F04A 1VF9A 2R92J 1TWHJ 4BKXA 3NARA 5FJ8J 4C3HJ 4ABZA 3FK6A 1Q1VA 2HI3A 1JKRC 2RAEA 4B1RA 3HGGA 2XGEA 1BW5A 2ME6A 1WI3A 2KT0A 1FTTA 1W0TA 1HDDC 3HOYJ 5F27A 2L7MP 2R0QC 3CDLA 2H8RA 1MSFC 3BG5A 1P7IA 3JREA 4Y52J 2XPUA 2H1KA 1WCMJ 3TW7A 1VNDA 2DA6A 4XICA 2R5YB 1W0UA 2VUMJ 5FKOA 2B63J 3HEFA 4A3GJ 2M2EA 1OCTC 1HF0A 3C2BA 1NTCA 3RQIA 1K61A 2GM4A 3OOUA 5FLMJ 1X2MA 5EEAA 1AKHA 2XB0X 2NS8A 1YRNB 2CQQA 4DZJA 1IDYA 3O8GA 3GTLJ 1MBFA 1I50J 1I6HJ 4GFBA 3Q0UA 2JA6J 2PMZN 1WH5A 4BY7J 2ME0A 2HDDA 2JA5J 1FIPA 4AYBN 4A3JJ 4B3AA 3MVPA 2Y30A 1MNMC 2Y31A 4MO7A 2HOAA 4XIDA 4FCYA 2K9QA 1XS9A 4RBOA 2ZB9A 3LSRA 2LK2A 2ECBA 3BR6A 1JKQC 4I6ZA 2HOTA 3NAUA 1JJ8C 5EG0B 4JX4A 1TWFJ 1HDPA 2LVSA 5C44J 3BR5A 9ANTA 2EZIA 3BTLA 1MH4A 3Q0VA 5K7ZA 4W1UA 2COBA 2XPVA 1VFCA 1B8IB 1WGXA 1Z0XA 1CQTA 4I76A 3ZQHA 3E7LA 2W48A 4QTRA 2ID6A 3MKLA 5EZGA 2FD5A 4L5EA 1O4XA 5DS9A 3WHCA 4C3IJ 5BNGA 2E2IJ 2O7OA 3G1OA 2N8GA 3I4MJ 1GDTA 1ZK8A 2AHQA 3QQAA 4AUXA 3ZQGA 1FEXA 3GTGJ 1LE8B 3PO3J 1HOMA 1D5YA 2ECCA 2DA7A 3HBLA 1B72B 1FIAA 3GTJJ 3HOUJ 2WV1A 4V2FA 4QIWN 1K83J 4J19A 5GPCA 4CYCA 3BTJA 1QVTA 2YS9A 5EGOB 1AU7A 4DZPA 2GLOA 3S1MJ 3S1NJ 4A3LJ 1ETYA 3BR1A 1JUMA 1H8AC 2VPRA 2JN6A 5IPAA 1VI0A 3GTOJ 1IDZA 1R9TJ 2DMTA 5J1YA 2DMNA 2HYJA 5E3LA 4IHWA 5FKLA 3GTPJ 4FISA 1TWCJ 2E2JJ 1UG2A 2JMWA 1MH3A 1ETVA 3A01B 1ETOA 2EH3A 3FISA 3GTMJ 2I10A 2DA4A 1U9NA 2DA2A 1B72A 5J1RA 3VPRA 2XSDC 2X9DA 3OSFA 4V2GA 1MBJA 1QVUA 3BG3A 1FTZA 3S17J 4IHYA 5F0FA 5IYDJ 1F36A 2NVXJ 1Y1VJ 3HOZJ 2ID3A 3JRBA 4D5CA 2WAQN 3BTCA 4G12A 4M3EA 4S0HB 5M3MJ 4M3FA 4XRSG 2NS7A 3ZQFA 3HOXJ 2CUFA 3JRAA 5M3FJ 2AO9A 2M34A 1A6IA 1RESA 3G1LA 1PUFA 5IP9J 2X6OA 4M3GA 5F0HA 2NVQJ 3LSGA 5IP6A 3JRFA 3ZQCA 4BY1J 2K40A 5IP7J 2O8KA 2M9HA 2LD5A 3B6CA 5EF6A 3BR2A 1NK2P 5FKKA 2LTPA 2Y2ZA 1U78A 2MSYA 3BQZA 3H3VK 4A3FJ 5JLXA 1QPIA 3A01A 3ZQLA 2IAIA 2R5ZB 1UHSA 1JT6A 3LOCA 4NDLA 4A3MJ 2FX0A 2JWTA 4A3BJ 5C4XJ 2R93J 2QF7A 3W6VA 1OFCX 3Q3SA 4XRSA 1B8IA 1JUSA 3HB9A 5E3NA 3BT9A 3TP0A 3IH3A 1MBGA 4BBRJ 2LR8A 4Y7NJ 2JJ7A 4BBSJ 3PO2J 2CJJA 4A93J 3GBGA 5GP9A 4A3CJ 4JX6A 4A3IJ 3BTIA 2FQ4A 2HQ5A 4UUTA 4CYCB 3S1QJ 1ETWA 1TWAJ 2TRTA 1BA5A 1ENHA 1UMQA 4M6VA 2HOSA 3IV5A 2CRGA 2NVTJ 5GPAA 1FJLA 1SFOJ 1TC3C 1ZKGA 1MSEC 3JRIA 3S15J 1GUUA 2VKEA 4JYKA 3MN2A 4A3DJ 2EZLA 3H0GJ 2JA7J 1IUFA 2CQXA 5JLWA 2EBIA 4IHVA 1ZQ3P 1QRYA 2EZKA 2G0EA 3OIOA 2JK3A 3WHBA 1ZTRA 3DEWA 1H89C 1JT0A 3S16J 3QPSA 3GTKJ 2LKXA 2DMQA 1H88C 1ORKA 1TWGJ 1JKOC 5M5XJ 3HOWJ 3TP3A 4A3KJ 1MBEA 2MGQA 5EYRA 1XC5A 4M3BA 4B4CA 4EEFG 3BR0A 2XGCA 4JP0A 1RKTA 4XK4A 1LE8A 5J3LA 5EDNA 1Z77A 3BR3A 4MFEA 1MBKA 3F0CA 4IHXA 4BXXJ 3G1MA 2R5ZA 2LY9A 4JX5A 3JRDA 3S2HJ 5HODA 3HDDA 3L1PA 1I3QJ 5IYCJ 3ZOBA 3HOVJ 1F43A 2VI6A 1OJLA 3CCYA 2KDZA 3S14J 2LFBA 2XB5A 5IOZA 2CU7A 2DMUA 3LSPA 3A02A 3LSJA 1U9OA 3UKGA 2FJ1A 3TW6A 2L7ZA 1X2NA 4FTHA 4HNVA 3CMYA 2ELKA 5EG0A 1ETQA 2YU9J 4C2MJ 5IOYA 1GT0C 2K9NA 2R7ZJ 3LNQA 4MIMA 2IBDA 3OSGA 3M4OJ 1Y1WJ 2P81A 3SFIA 4X1EA 1RKWA 1RETA 1JTYA 2HXIA 2L9RA 1S7EA 3FKIJ 3PM1A 2NOGA 5C4JJ 4M3DA 2DA3A 2MW8A 2DN0A 4FE7A 2M0CA 1MBHA 4X6AJ 1G2HA 3BQYA 2DJNA 4W97A 3S2DJ 1HCRA 3S1RJ 2M8GX 2EQRA 1IC8A 1GV2A 1DU0A 1HLVA 1SANA 4LOCA 3FK7A 3B6AA 2XGDA 4DYRA 1APLC 3RZOJ 4FE4A 4IEJA 1EF4A 4A3EJ 1IGNA 1BJZA 5F0CA 3HKZN 1IRZA 5IYBJ 1OCPA 1YRNA 2NVYJ 5E3OA 2OF7A 3RKQA 1T33A 1ZR2A 1WPKA 3DCFA 5F08A 4XRMA 3JRGA 3SJMA 2JA8J 1P7JA 2DA5A 4D5FA 2MG4A 3K2AA 2TCTA 2LLKA 1GV5A 4DYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCO A;  5K7H A;  4RDU A;  1GVD A;  3HM5 A;  1LFU P;  5EZH A;  1IV6 A;  5M5Y J;  1X58 A;  4MLO A;  1AHD P;  3JRC A;  5F1J A;  1PUF B;  2D5V A;  2L7F P;  2LP0 A;  3IH2 A;  2K9S A;  1ZR4 A;  4AC0 A;  1JUP A;  5J1U A;  5FLV A;  1POG A;  3SDG A;  1T56 A;  2VKV A;  3JR9 A;  5DTD A;  1NK3 P;  3JRH A;  2DA1 A;  4UUS B;  1ITY A;  5K7F A;  2XPW A;  4DW6 A;  3GTQ J;  3CQZ J;  4D7M A;  1JKP C;  3Q0W A;  1AKH B;  2CUE A;  2Y9Y A;  1LFB A;  3M3Y J;  3QPL A;  1IG7 A;  3FIW A;  3IH4 A;  1U8B A;  3O8H A;  1RPW A;  1JGG A;  4A69 C;  2XRL A;  2L0K A;  2X48 A;  1IJW C;  1JJ6 C;  2WB1 N;  2Y0S N;  2R5Y A;  3BG9 A;  1XG1 A;  5M5W J;  2HXO A;  2EZH A;  4C3J J;  3D1N I;  5FKM A;  3A03 A;  2IEK A;  2O9L A;  3I4N J;  1WH7 A;  3TED A;  1DU6 A;  1JTX A;  4D7N A;  1BW6 A;  5FKN A;  1ETK A;  2DTZ A;  4DYQ A;  5E3M A;  1ETX A;  3RZD J;  3ZQI A;  2OPT A;  1BL0 A;  2E1O A;  2YUS A;  2DMP A;  1A5J A;  1RR7 A;  4QSH A;  3HGY A;  5EGO A;  1E3O C;  1ZGW A;  2E19 A;  3K7A J;  2GBY A;  4MFD A;  2Y9Z A;  5C3E J;  4UUS A;  2E2H J;  5F04 A;  1VF9 A;  2R92 J;  1TWH J;  4BKX A;  3NAR A;  5FJ8 J;  4C3H J;  4ABZ A;  3FK6 A;  1Q1V A;  2HI3 A;  1JKR C;  2RAE A;  4B1R A;  3HGG A;  2XGE A;  1BW5 A;  2ME6 A;  1WI3 A;  2KT0 A;  1FTT A;  1W0T A;  1HDD C;  3HOY J;  5F27 A;  2L7M P;  2R0Q C;  3CDL A;  2H8R A;  1MSF C;  3BG5 A;  1P7I A;  3JRE A;  4Y52 J;  2XPU A;  2H1K A;  1WCM J;  3TW7 A;  1VND A;  2DA6 A;  4XIC A;  2R5Y B;  1W0U A;  2VUM J;  5FKO A;  2B63 J;  3HEF A;  4A3G J;  2M2E A;  1OCT C;  1HF0 A;  3C2B A;  1NTC A;  3RQI A;  1K61 A;  2GM4 A;  3OOU A;  5FLM J;  1X2M A;  5EEA A;  1AKH A;  2XB0 X;  2NS8 A;  1YRN B;  2CQQ A;  4DZJ A;  1IDY A;  3O8G A;  3GTL J;  1MBF A;  1I50 J;  1I6H J;  4GFB A;  3Q0U A;  2JA6 J;  2PMZ N;  1WH5 A;  4BY7 J;  2ME0 A;  2HDD A;  2JA5 J;  1FIP A;  4AYB N;  4A3J J;  4B3A A;  3MVP A;  2Y30 A;  1MNM C;  2Y31 A;  4MO7 A;  2HOA A;  4XID A;  4FCY A;  2K9Q A;  1XS9 A;  4RBO A;  2ZB9 A;  3LSR A;  2LK2 A;  2ECB A;  3BR6 A;  1JKQ C;  4I6Z A;  2HOT A;  3NAU A;  1JJ8 C;  5EG0 B;  4JX4 A;  1TWF J;  1HDP A;  2LVS A;  5C44 J;  3BR5 A;  9ANT A;  2EZI A;  3BTL A;  1MH4 A;  3Q0V A;  5K7Z A;  4W1U A;  2COB A;  2XPV A;  1VFC A;  1B8I B;  1WGX A;  1Z0X A;  1CQT A;  4I76 A;  3ZQH A;  3E7L A;  2W48 A;  4QTR A;  2ID6 A;  3MKL A;  5EZG A;  2FD5 A;  4L5E A;  1O4X A;  5DS9 A;  3WHC A;  4C3I J;  5BNG A;  2E2I J;  2O7O A;  3G1O A;  2N8G A;  3I4M J;  1GDT A;  1ZK8 A;  2AHQ A;  3QQA A;  4AUX A;  3ZQG A;  1FEX A;  3GTG J;  1LE8 B;  3PO3 J;  1HOM A;  1D5Y A;  2ECC A;  2DA7 A;  3HBL A;  1B72 B;  1FIA A;  3GTJ J;  3HOU J;  2WV1 A;  4V2F A;  4QIW N;  1K83 J;  4J19 A;  5GPC A;  4CYC A;  3BTJ A;  1QVT A;  2YS9 A;  5EGO B;  1AU7 A;  4DZP A;  2GLO A;  3S1M J;  3S1N J;  4A3L J;  1ETY A;  3BR1 A;  1JUM A;  1H8A C;  2VPR A;  2JN6 A;  5IPA A;  1VI0 A;  3GTO J;  1IDZ A;  1R9T J;  2DMT A;  5J1Y A;  2DMN A;  2HYJ A;  5E3L A;  4IHW A;  5FKL A;  3GTP J;  4FIS A;  1TWC J;  2E2J J;  1UG2 A;  2JMW A;  1MH3 A;  1ETV A;  3A01 B;  1ETO A;  2EH3 A;  3FIS A;  3GTM J;  2I10 A;  2DA4 A;  1U9N A;  2DA2 A;  1B72 A;  5J1R A;  3VPR A;  2XSD C;  2X9D A;  3OSF A;  4V2G A;  1MBJ A;  1QVU A;  3BG3 A;  1FTZ A;  3S17 J;  4IHY A;  5F0F A;  5IYD J;  1F36 A;  2NVX J;  1Y1V J;  3HOZ J;  2ID3 A;  3JRB A;  4D5C A;  2WAQ N;  3BTC A;  4G12 A;  4M3E A;  4S0H B;  5M3M J;  4M3F A;  4XRS G;  2NS7 A;  3ZQF A;  3HOX J;  2CUF A;  3JRA A;  5M3F J;  2AO9 A;  2M34 A;  1A6I A;  1RES A;  3G1L A;  1PUF A;  5IP9 J;  2X6O A;  4M3G A;  5F0H A;  2NVQ J;  3LSG A;  5IP6 A;  3JRF A;  3ZQC A;  4BY1 J;  2K40 A;  5IP7 J;  2O8K A;  2M9H A;  2LD5 A;  3B6C A;  5EF6 A;  3BR2 A;  1NK2 P;  5FKK A;  2LTP A;  2Y2Z A;  1U78 A;  2MSY A;  3BQZ A;  3H3V K;  4A3F J;  5JLX A;  1QPI A;  3A01 A;  3ZQL A;  2IAI A;  2R5Z B;  1UHS A;  1JT6 A;  3LOC A;  4NDL A;  4A3M J;  2FX0 A;  2JWT A;  4A3B J;  5C4X J;  2R93 J;  2QF7 A;  3W6V A;  1OFC X;  3Q3S A;  4XRS A;  1B8I A;  1JUS A;  3HB9 A;  5E3N A;  3BT9 A;  3TP0 A;  3IH3 A;  1MBG A;  4BBR J;  2LR8 A;  4Y7N J;  2JJ7 A;  4BBS J;  3PO2 J;  2CJJ A;  4A93 J;  3GBG A;  5GP9 A;  4A3C J;  4JX6 A;  4A3I J;  3BTI A;  2FQ4 A;  2HQ5 A;  4UUT A;  4CYC B;  3S1Q J;  1ETW A;  1TWA J;  2TRT A;  1BA5 A;  1ENH A;  1UMQ A;  4M6V A;  2HOS A;  3IV5 A;  2CRG A;  2NVT J;  5GPA A;  1FJL A;  1SFO J;  1TC3 C;  1ZKG A;  1MSE C;  3JRI A;  3S15 J;  1GUU A;  2VKE A;  4JYK A;  3MN2 A;  4A3D J;  2EZL A;  3H0G J;  2JA7 J;  1IUF A;  2CQX A;  5JLW A;  2EBI A;  4IHV A;  1ZQ3 P;  1QRY A;  2EZK A;  2G0E A;  3OIO A;  2JK3 A;  3WHB A;  1ZTR A;  3DEW A;  1H89 C;  1JT0 A;  3S16 J;  3QPS A;  3GTK J;  2LKX A;  2DMQ A;  1H88 C;  1ORK A;  1TWG J;  1JKO C;  5M5X J;  3HOW J;  3TP3 A;  4A3K J;  1MBE A;  2MGQ A;  5EYR A;  1XC5 A;  4M3B A;  4B4C A;  4EEF G;  3BR0 A;  2XGC A;  4JP0 A;  1RKT A;  4XK4 A;  1LE8 A;  5J3L A;  5EDN A;  1Z77 A;  3BR3 A;  4MFE A;  1MBK A;  3F0C A;  4IHX A;  4BXX J;  3G1M A;  2R5Z A;  2LY9 A;  4JX5 A;  3JRD A;  3S2H J;  5HOD A;  3HDD A;  3L1P A;  1I3Q J;  5IYC J;  3ZOB A;  3HOV J;  1F43 A;  2VI6 A;  1OJL A;  3CCY A;  2KDZ A;  3S14 J;  2LFB A;  2XB5 A;  5IOZ A;  2CU7 A;  2DMU A;  3LSP A;  3A02 A;  3LSJ A;  1U9O A;  3UKG A;  2FJ1 A;  3TW6 A;  2L7Z A;  1X2N A;  4FTH A;  4HNV A;  3CMY A;  2ELK A;  5EG0 A;  1ETQ A;  2YU9 J;  4C2M J;  5IOY A;  1GT0 C;  2K9N A;  2R7Z J;  3LNQ A;  4MIM A;  2IBD A;  3OSG A;  3M4O J;  1Y1W J;  2P81 A;  3SFI A;  4X1E A;  1RKW A;  1RET A;  1JTY A;  2HXI A;  2L9R A;  1S7E A;  3FKI J;  3PM1 A;  2NOG A;  5C4J J;  4M3D A;  2DA3 A;  2MW8 A;  2DN0 A;  4FE7 A;  2M0C A;  1MBH A;  4X6A J;  1G2H A;  3BQY A;  2DJN A;  4W97 A;  3S2D J;  1HCR A;  3S1R J;  2M8G X;  2EQR A;  1IC8 A;  1GV2 A;  1DU0 A;  1HLV A;  1SAN A;  4LOC A;  3FK7 A;  3B6A A;  2XGD A;  4DYR A;  1APL C;  3RZO J;  4FE4 A;  4IEJ A;  1EF4 A;  4A3E J;  1IGN A;  1BJZ A;  5F0C A;  3HKZ N;  1IRZ A;  5IYB J;  1OCP A;  1YRN A;  2NVY J;  5E3O A;  2OF7 A;  3RKQ A;  1T33 A;  1ZR2 A;  1WPK A;  3DCF A;  5F08 A;  4XRM A;  3JRG A;  3SJM A;  2JA8 J;  1P7J A;  2DA5 A;  4D5F A;  2MG4 A;  3K2A A;  2TCT A;  2LLK A;  1GV5 A;  4DYC A; 
#chains in the Genus database with same CATH topology
 2ZJQ F;  3T8T A;  2M45 A;  5K7H A;  3BRO A;  4RDU A;  2W57 A;  4MTD A;  1BJA A;  2DCE A;  3HSE A;  1WZ2 A;  1MMN A;  3HM5 A;  1HXD A;  2E34 A;  5M5Y J;  1S5L C;  2BHY A;  3DWL E;  3OYB A;  3KZZ A;  4GYG A;  4GDF A;  1FP2 A;  3CCR I;  1KYZ A;  4WXC A;  4Q48 A;  2ZSH B;  4BE2 A;  1ZR4 A;  2FOK A;  5J1U A;  5FLV A;  1Z1D A;  2BY1 A;  3OYG A;  2VKV A;  2GZW A;  1FX7 A;  5E1Z B;  3JRH A;  3VYT B;  5A2Q Z;  3I0T A;  4FQG A;  1Z6R A;  5K7F A;  2XPW A;  5HLI A;  5HOO A;  2I5U A;  1VQ5 I;  3GTQ J;  4KT5 C;  4D7M A;  1AKH B;  3R60 A;  2M87 A;  1LEA A;  3ABK H;  3PNY A;  4Y33 A;  3M7G A;  5FGM A;  2MYS A;  5ED4 A;  2LYC A;  2L0K A;  2EFW A;  4EM1 A;  2X85 A;  3N4M A;  2DK5 A;  2R5Y A;  5M5W J;  2W24 A;  3D1N I;  3ASN H;  4MNU A;  4YIR X;  1YS6 A;  5FKM A;  2O9L A;  2L54 A;  3I4N J;  1WH7 A;  4CA0 A;  4XSZ F;  2QEN A;  1ETK A;  4CCN A;  3KFW X;  4Y13 A;  2UXX A;  2W85 A;  2VXZ A;  2GQQ A;  1WHU A;  3KLN A;  3GZ6 A;  2K02 A;  2YUS A;  1WJE A;  3PSF A;  5JI6 A;  2GXG A;  1IZ1 A;  2PMZ A;  5EEH A;  2MC3 A;  3KEY A;  1J5Y A;  4XOP A;  3HGY A;  1AA7 A;  4AM3 A;  1EH7 A;  5JHU A;  3WGI A;  3S3N A;  2O61 A;  2BBY A;  4FX0 A;  2CQN A;  2HVQ A;  1Z21 A;  2A3S A;  4IRH A;  2E2H J;  1TWH J;  2GIZ A;  3NAR A;  5FJ8 J;  4HA8 A;  3LSH A;  4ABZ A;  2MAB A;  3FK6 A;  3RKW A;  1Q1V A;  3GCM A;  1BC7 C;  1BR4 A;  3HGG A;  1BW5 A;  4FX4 A;  1Z05 A;  1G59 A;  4L9N A;  1WI3 A;  2KT0 A;  2ME6 A;  3V4G A;  2P0W A;  1HDD C;  2ZO4 A;  1U0J A;  1FLI A;  3CDL A;  2H8R A;  2HTS A;  1MSF C;  2M3A A;  3S8P A;  2R7O A;  3WTX C;  5FLX Z;  4ZYG A;  1FPQ A;  3OYH A;  3IP4 B;  4CIC A;  1W0U A;  1VQ9 I;  3HEF A;  4A3G J;  2M2E A;  3K70 C;  1SC7 A;  1I1G A;  3L2C A;  2HGC A;  2V4J C;  2EV6 A;  2WAD A;  1D3Y A;  3C2B A;  2YR2 A;  5CLS A;  3E5Q A;  3OOU A;  2OV7 A;  1X2M A;  4RB2 C;  1MZB A;  1ULY A;  1YQA A;  2XB0 X;  3I55 I;  1YHQ I;  2BW3 B;  4XKC A;  4HV5 A;  4KIF A;  1IDY A;  3Q5F A;  5ICC A;  3GTL J;  3S2W A;  1MBF A;  5HVQ C;  4FT8 A;  1I6H J;  2HTJ A;  4GFB A;  2XC7 A;  1WH5 A;  2XHK A;  2HDD A;  3W6K B;  4AYB N;  1RR8 C;  3F3X A;  3I56 I;  1BN5 A;  1RC9 A;  4LD5 A;  1A31 A;  4LB6 B;  2A05 A;  1MNM C;  3I54 A;  4HNU A;  4MO7 A;  4KIG A;  4YIF A;  2RQQ A;  3JAM K;  5LHI A;  4KFC A;  3FM3 A;  4I09 A;  4F93 B;  2LK2 A;  1ZRD A;  3HC7 A;  4ENN A;  2VT2 A;  3NAU A;  4JX4 A;  2K7L A;  1R00 A;  2FEZ A;  5C44 J;  1M1E B;  3BR5 A;  1S7O A;  1XGS A;  2BW3 A;  3DV8 A;  2FA5 A;  1VQ6 I;  1G6N A;  5DD4 A;  4U7B A;  2EA4 A;  4W1U A;  1RIO H;  2PEX A;  3X2Q H;  1Z0X A;  5A2Q K;  1CQT A;  3E7L A;  2VQL A;  2W48 A;  4XKW A;  1E3P A;  1OR7 C;  5HLG A;  5FD5 A;  5LLQ A;  2RV8 A;  3AG2 H;  3W2W A;  1R5I D;  4L5E A;  5J47 A;  3F9K A;  1O4X A;  5FRN A;  3DU5 A;  1BI1 A;  3CP8 A;  1MKM A;  4C3I J;  4OMZ A;  1SD4 A;  1UB9 A;  2HNH A;  4U87 A;  4BQN A;  2G7H A;  1FBQ A;  1KA8 A;  3FXQ A;  1HBX G;  1W7P A;  3ZQG A;  1HOM A;  2H1L A;  3WU2 C;  1VQO I;  4HSR A;  2QSH X;  3CMA I;  1NG7 A;  2RN7 A;  2ESN A;  3BG7 A;  3GTJ J;  3O6B B;  3OIP A;  1ZG5 A;  4BQA A;  1YTY A;  3HOU J;  2QZ8 A;  1D0Z A;  3DTK A;  2WV1 A;  3R0A A;  5H6R A;  1SD5 A;  4WF2 A;  2DO7 A;  3VOD A;  1JE8 A;  1WKM A;  4I7H A;  5KAI C;  3OL4 A;  1A6Q A;  3BR1 A;  1JUM A;  2KZV A;  2IS4 A;  3HJE A;  4PGG A;  2CW8 A;  4B44 A;  3A0B C;  2E1M C;  3A4C A;  1IDZ A;  2KMU A;  3I71 A;  2LKS A;  2WAF A;  3F8F A;  2WAE A;  1R36 A;  1FP1 D;  5J1Y A;  2DMN A;  1TW2 A;  3HTS B;  3GTP J;  5E1W A;  1TWC J;  1OMI A;  1UG2 A;  1R5G A;  1MH3 A;  2DW4 A;  5D6E A;  1O3S A;  3OYD A;  3A01 B;  2CS3 A;  2LY2 A;  2PX9 A;  3EUK L;  3PNV A;  3WU1 B;  1U3E M;  2R7U A;  2O8X A;  2DA2 A;  3R61 A;  2E36 A;  5JVT A;  1JHH A;  5HDN A;  2RKH A;  3VSK A;  2EV5 A;  3H9Q A;  4XN0 A;  1XGO A;  1LJ9 A;  4NQW A;  1B9N A;  3LWF A;  3DKW A;  3L2Q A;  3OSF A;  1MBJ A;  4KUM A;  1EA3 A;  2MFZ A;  3DXJ F;  1YJW I;  1Y1V J;  3HOZ J;  4B43 A;  2E71 A;  3K4K A;  2WAQ N;  3G4S I;  2WBM A;  4P1W A;  2F5E A;  3FXM A;  5TIS C;  4L5I A;  4XRS G;  5AIQ A;  3WG9 A;  3NRV A;  4OIP F;  1UFM A;  2CUF A;  5LEJ A;  4AVP A;  3JRA A;  5KNL A;  5M3F J;  3G1L A;  3C3W A;  1OIS A;  2MLK A;  5H2F C;  5F0H A;  1YX5 A;  3KCC A;  1DGR M;  2A5Y B;  3LSG A;  2NVQ J;  1BIA A;  3ZQC A;  3TO9 A;  1V3F A;  2YPR A;  5IP7 J;  1ZRF A;  3P9C A;  2CV1 A;  1AWC A;  2RRE A;  5EF6 A;  2L3D A;  2Y2Z A;  2DOF A;  5BOX A;  2PQ8 A;  3GW2 A;  4PJM A;  3SEZ A;  3V8J A;  1MW7 A;  3CUO A;  4RGU A;  5LEK A;  2JRM A;  2XV4 S;  3K70 D;  3ZQL A;  3ZN0 A;  4PFP A;  3HPG A;  1JI8 A;  4LJZ F;  5EJC A;  1YI2 I;  3CJT B;  3BPX A;  2F5V A;  2E1C A;  2JWT A;  2A07 F;  3PQJ A;  1R7J A;  2CQK A;  3SXY A;  2HPI A;  3LSI A;  3O2P E;  5KK1 A;  1IN4 A;  1B8I A;  2XKO A;  1R58 A;  3JW4 A;  3OYA A;  3CF5 F;  4KN7 X;  5LGT A;  1XMX A;  4HEA 2;  1MBG A;  4BBR J;  2JJ7 A;  2FQ3 A;  4PJJ A;  4A93 J;  1EJ9 A;  2Y0M A;  4I2O A;  2O6G E;  4M74 A;  2FQ4 A;  2HQ5 A;  5FFX A;  4CYC B;  1ETW A;  2P5V A;  2HS5 A;  1LDD A;  2HYF A;  1UST A;  3ZMU A;  2DYS H;  1FJL A;  1SFO J;  4CGZ A;  5EEG A;  1SAU A;  4BQO A;  1TC3 C;  1ZKG A;  2EWN A;  3S15 J;  2VE8 A;  4XLP F;  3PL8 A;  4UB8 C;  2CV2 A;  4HX8 A;  4RGS A;  4A3D J;  3E6C C;  4D9J A;  4BU2 A;  3TDU C;  1N77 A;  1F1Z A;  4AID A;  2OCC H;  1FSH A;  1QRY A;  2H27 A;  2JSC A;  4CCK A;  2JK3 A;  1ZTR A;  4HZF A;  1R23 A;  3GTK J;  5HS9 A;  4D1Q A;  2KP6 A;  3DLA A;  2KHM A;  3CC7 I;  1ONV A;  1CF7 A;  2QKL B;  1JKO C;  3TP3 A;  4LG3 A;  3SYT A;  4M3B A;  5CVJ A;  2VKD A;  2CH0 A;  3BR0 A;  5ILS A;  1TP4 A;  2GOX B;  3OYE A;  2J5P A;  4XK4 A;  4XLF A;  5CPR B;  1R1T A;  4GXO A;  1Z7U A;  3ULQ B;  3F6O A;  2K86 A;  1Y0N A;  4A12 A;  2C6Y A;  3J7A Y;  1MBK A;  3CO7 C;  2HDC A;  4BXX J;  3G1M A;  2R5Z A;  2AS5 F;  2LY9 A;  2IGM A;  3H9J A;  3RI4 A;  1IAW A;  3S2H J;  3R4K A;  1YW7 A;  2E1N A;  2O0Y A;  3TMO A;  1I3Q J;  4EJW A;  4XLN F;  1WJA A;  3HOV J;  1GXQ A;  3TOB A;  3IKT A;  2VB6 A;  3J80 K;  3GX4 X;  4UVA A;  2WY7 Q;  1KU2 A;  4LLL A;  4ENM A;  4CXF A;  2DI3 A;  3T1B A;  1UHM A;  4XOT A;  2JUG A;  2WTE A;  3ERM A;  1G8X A;  2VJJ A;  3H3Z A;  4C2M J;  3E5U A;  3GEZ A;  2VOO A;  4MIM A;  3IWF A;  2KIS A;  2JA2 A;  1U5T C;  2XVC A;  4CCO A;  4X1E A;  1RKW A;  1RET A;  1JTY A;  5D6F A;  4BXF A;  2DT6 A;  1S7E A;  4L9T A;  3PIO F;  2BOL A;  4HNT A;  2DA3 A;  4ZJZ A;  1Q1H A;  1G2H A;  1BI3 A;  2RNG A;  4UHT A;  2FRH A;  1PP8 F;  2VAS A;  4LK0 F;  2DQL A;  2OD5 A;  2Z5U A;  3H36 A;  3I5U A;  3S2D J;  2V1X A;  3QAH A;  1HCR A;  5DCM A;  1IC8 A;  2XAU A;  1SAN A;  5FLX K;  2V26 A;  3B6A A;  4DYR A;  4BJ5 C;  1L0O C;  4HF0 A;  4PUS A;  1Z9C A;  2RNJ A;  3HOS A;  1IGN A;  3EYI A;  1WJF A;  2WA0 A;  1YW8 A;  4NUB A;  3CCJ I;  4WWC A;  1REP C;  3RKX A;  1SD7 A;  3LSM A;  3OMY A;  4A0Z A;  2MC4 A;  2R7D A;  1W7P D;  3RKQ A;  1R71 A;  3AL0 C;  1WJ5 A;  5F08 A;  3SZT A;  4XRM A;  4RLQ A;  3QYB A;  3JRG A;  3VEP A;  1P7J A;  1NH3 A;  2UV1 A;  3GO5 A;  2PJP A;  2LLK A;  1GV5 A;  4DYC A;  4HLY A;  1GVJ A;  1XMK A;  4HDU A;  1D0X A;  3CME I;  1OR7 A;  2PMH A;  4RM2 A;  2OBP A;  1T0F C;  1O3Q A;  4MLO A;  3CCM I;  2W4S A;  2YSR A;  1TW3 A;  2L4M A;  3VYU B;  2ZME B;  4MQV A;  4XQF A;  2D5V A;  2L7F P;  1BR1 A;  3HRS A;  5DM7 F;  1S6L A;  3SDG A;  1T56 A;  2FBK A;  2XDV A;  3GFL A;  4JOM A;  2IGO A;  5DTD A;  1NK3 P;  2EFN A;  3GYH X;  3PJR A;  1QA6 A;  3ZMT A;  2DA1 A;  1DGW Y;  4UUS B;  3DFG A;  3FHZ A;  4MHG A;  3T8R A;  4B09 A;  1NHA A;  2EPF A;  4DW6 A;  3IRR A;  1JKP C;  5CYV A;  3S32 A;  4RB1 A;  2XRO A;  2DFE A;  2DT5 A;  3DPU A;  4R79 A;  1KON A;  2Y9Y A;  5HLH A;  3QPL A;  4CYD A;  1IG7 A;  3JTH A;  1J09 A;  3IH4 A;  2AXL A;  4EM2 A;  1H9G A;  3RQ4 A;  2XRN A;  3HSR A;  2ZFU A;  2XRL A;  5FRO A;  4JQF A;  2V6E A;  2X48 A;  3F8C A;  1IJW C;  2IS6 A;  2WB1 N;  4IKF A;  4FHT A;  1J75 A;  1TQM A;  3L2W A;  1RI7 A;  1GLN A;  2WV0 A;  2DTZ A;  2ISZ A;  5E3M A;  4I0A A;  2Y69 H;  4Y3O A;  4BYY A;  3ZQI A;  1BL0 A;  3CCE I;  3TQN A;  1UZC A;  1LVK A;  3OOP A;  1FY7 A;  3CDH A;  2H09 A;  4PSW A;  2BVM A;  3KP6 A;  4QSH A;  5EGO A;  2IVM A;  4EJO A;  4Z6Y A;  3QPH A;  3V8L A;  4MFD A;  5C3E J;  5L3G A;  1HSJ A;  1VF9 A;  4M9X A;  1K4T A;  4BHB A;  5LBQ A;  3D5S C;  4C3H J;  2HDW A;  1UJ8 A;  1SFK A;  3TDZ C;  4AIJ A;  1ZH5 A;  3KYD B;  3VSL A;  3E0J B;  4I99 C;  4E70 A;  2F4O B;  1FTT A;  3J7A O;  3HOY J;  2KIF A;  3M1C A;  4J00 A;  2NVU B;  4LLN A;  2R0Q C;  2VON A;  4Y52 J;  3JRE A;  3VYS B;  1OCO H;  4E7H A;  3BJO A;  2X0L A;  1XGN A;  1EH8 A;  3F72 A;  1VND A;  3JAM Z;  5J4Y A;  1MNE A;  3ELK A;  4OWR B;  1MMS A;  3SZP A;  3RQI A;  2GM4 A;  1J9I A;  4OIO F;  4IVN A;  1F5T A;  2F5C A;  1YRN B;  2EB7 A;  1G3T A;  2CQQ A;  3JTG A;  2DFF A;  2L4A A;  3O8G A;  4ITV A;  1I50 J;  3H5R A;  3K0L A;  3Q0U A;  3LA2 A;  2JA6 J;  4A0Y A;  4F7Z A;  2ME0 A;  3RPU D;  2O03 A;  4U7D A;  4E7J A;  2LOO A;  2M30 A;  4B3A A;  1IN8 A;  3H92 A;  2XIG A;  2Y30 A;  4DOZ A;  1WJD A;  3IKV A;  2HOA A;  4PFO A;  1I3A A;  4IRG A;  1OPC A;  2K9Q A;  1XS9 A;  2PJR A;  3FXL A;  1VQP I;  1CGP A;  2ESH A;  4IOC F;  2P7C B;  5BPD A;  1B1B A;  1XSV A;  1Z3Y A;  3OYJ A;  3KP3 A;  2HOT A;  1XB4 A;  1JJ8 C;  3PUF A;  1CF7 B;  1TWF J;  2J5O A;  1HDP A;  3BZK A;  3RPQ A;  2LVS A;  3FXK A;  2PN6 A;  4IQ4 A;  9ANT A;  2CMP A;  1MH4 A;  4DJA A;  2VC0 A;  2OTL I;  2VC1 A;  3Q0V A;  3FX3 A;  5DYM A;  3HRM A;  4P55 A;  2COB A;  2DJI A;  2XPV A;  1VFC A;  1B8I B;  1WGX A;  1E3H A;  1WJB A;  4HAM A;  3VYR B;  1FMW A;  1J59 A;  2RC4 A;  2NAZ A;  1KU7 A;  4NNJ A;  1T0F A;  1KQ8 A;  3OS0 A;  4F91 B;  2D1V A;  3K4B A;  1DQU A;  5JFR A;  2X6Y A;  2ISY A;  3K9T A;  1R6R A;  4IOA F;  5TJJ A;  2EJR A;  2KPM A;  3WHC A;  2HYG D;  1FOW A;  2MD0 A;  1STZ A;  3G1O A;  3C2G A;  2FOW A;  1FEX A;  4XMY A;  3TO6 A;  2YX4 A;  2Q8K A;  1LE8 B;  3PO3 J;  2L9V A;  1T6S A;  1HST A;  1FIA A;  1B72 B;  5IT9 Z;  3RKY A;  4BHP A;  2A69 F;  3GF2 A;  2IW5 A;  1TQP A;  2R7W A;  5GAE J;  3HXL A;  5D4R A;  4QIW N;  4EJT A;  1V5F A;  1K83 J;  2QBY B;  4MQ9 F;  4J19 A;  3ML6 A;  4RB0 A;  5CQE A;  1VQ8 I;  1QVT A;  3S1M J;  1FYK A;  1Z6T A;  1LQ1 A;  4ENK A;  4AIK A;  2UXN A;  2H6B A;  4HBL A;  2K27 A;  4AD9 A;  4L9V A;  2H94 A;  2DMT A;  1GXP A;  3ZMZ A;  2PLY A;  4I98 B;  3WOD F;  4M6X A;  4AIH A;  4BDZ A;  5FKL A;  4IHW A;  4FIS A;  2LC2 A;  4V19 K;  2ELH A;  2ZJP F;  2JMW A;  2QQA A;  2EK5 A;  2NOJ B;  4O5V A;  2RQP A;  2L9S A;  3FIS A;  2DA4 A;  3D0S A;  1ZLJ A;  3VPR A;  1H0M A;  2XSD C;  3CJQ B;  3JSO A;  3L9F A;  3S17 J;  1FTZ A;  5IYD J;  3EYY A;  4IO9 F;  1E0E A;  3CLQ A;  4D5C A;  3BTC A;  2Z2S B;  4G12 A;  4M3E A;  3KE2 A;  4M3F A;  2NS7 A;  3LMM A;  4NC7 A;  1I6X A;  1B6A A;  3K4J A;  3KYL A;  4KN4 X;  5B1A H;  2K4B A;  4BEH B;  4XN3 A;  2M34 A;  4YFN F;  2MBF A;  2JZY A;  4BE0 A;  1Y8R B;  1BIB A;  1QZY A;  1V54 H;  1XMA A;  2W82 A;  4OAZ A;  1W36 D;  2F2E A;  1XDU A;  4M3G A;  1UAA A;  5IY5 H;  1HKQ A;  2P6T A;  2NNY A;  3N97 A;  5IP6 A;  2FNP A;  2GA2 A;  4UUV A;  2B9S A;  4IQJ A;  2VBZ A;  3QOP A;  4IX7 A;  4NQW B;  1NK2 P;  1FWZ A;  3RJP A;  2UZK A;  1HW5 A;  2I8D A;  3M07 A;  3BQZ A;  4C2T A;  3OV8 A;  3H3V K;  2STW A;  5JLX A;  4E7K A;  2DBB A;  3A01 A;  3OYF A;  2R5Z B;  4PJN A;  1UHS A;  1KU9 A;  1JT6 A;  3OY9 A;  3H3U A;  1DUX C;  2E5N A;  1OCC H;  2FX0 A;  2JTV A;  3I53 A;  2Y75 A;  4R1H A;  4FAS D;  4A3B J;  5C4X J;  3F23 A;  2AXT C;  3I58 A;  3PFY A;  3W6V A;  5K5R A;  1Y0U A;  2MA3 A;  1OFC X;  3Q3S A;  4HDV A;  2XSJ C;  1JUS A;  2KKO A;  3HUG A;  2Z1D A;  1OYW A;  2YX7 A;  1QZZ A;  3MEX A;  4PGH A;  4HQM A;  5DUK A;  5HS7 A;  1I39 A;  2VJ4 A;  2IJL A;  4EJU A;  2XAS A;  3TP0 A;  1HW2 A;  3AL0 B;  4YII A;  4CHU A;  1MMD A;  2V9P A;  4G6D A;  4Y7N J;  4E7I A;  3KZI C;  1QBJ A;  1AOY A;  2LMD A;  3L7W A;  4P9U A;  3U9G A;  3GBG A;  4NBQ A;  3LL7 A;  4P9F A;  1LEB A;  3FXO A;  3E3V A;  4Y4R A;  4A3I J;  1QGP A;  3QRF F;  3CMM A;  1YE9 A;  4L5J A;  3CZ6 A;  1OKR A;  3DBH B;  4DBQ A;  5BPI A;  2HOS A;  1E17 A;  1NG6 A;  3Q9S A;  1ZRE A;  3NWT A;  4Z2Y A;  5H20 A;  2V79 A;  3F8B A;  4CSW A;  2FF4 A;  3I3L A;  4KYW A;  1PYV A;  1O3R A;  1B4A A;  4E7L A;  3U1D A;  1T38 A;  4N9I A;  2IA0 A;  3LFU A;  1GUU A;  2VKE A;  1T39 A;  2EFQ A;  2JUC A;  2XGX A;  3GFM A;  1FNN A;  4ESB A;  1IUF A;  5L3E A;  4IHV A;  2M4K A;  1D0Y A;  3FMR A;  1IXR C;  3K4N A;  3M1E A;  2EZK A;  1U5T A;  3VB2 A;  3OIO A;  3QPS A;  3WTV C;  2KQR A;  3OS1 A;  1MIJ A;  3HOW J;  4AYB A;  4BGD A;  4UY8 I;  4UV9 A;  2XKP A;  1MBE A;  3S3O A;  2LSO A;  2XGC A;  1WSU A;  3LAJ A;  1J2X A;  3FZV A;  4MFE A;  2L5Q A;  5BS6 A;  4IHX A;  1S7A A;  2WB1 A;  3MZ8 A;  1SD6 A;  5HNF A;  4G6Q A;  4IXA A;  4LMY A;  2DYR H;  4XON A;  3HDD A;  1RUN A;  2MD5 A;  1I5Z A;  3ZOB A;  4R8H A;  2VI6 A;  2BVL A;  3CCY A;  2VOP A;  5E8I A;  3HZJ A;  4AU7 A;  3HRU A;  5GAD J;  3CC2 I;  2BXY A;  2JVG A;  1Z3X A;  2FSW A;  2CU7 A;  1K6Y A;  3L2U A;  4LFU A;  2KIU A;  1G3Y A;  3A02 A;  3D5R C;  4HNV A;  3CMY A;  2ELK A;  2JRT A;  5EG0 A;  1XGM A;  4UB6 C;  2ICW G;  2YU9 J;  1W5T A;  1HKS A;  5IOY A;  2VXD A;  4RLF A;  2K9N A;  4OIR F;  2UWM A;  2F48 A;  1FOY A;  2V7F A;  3M4O J;  4Q4Z F;  1Y1W J;  2GWR A;  2OQG A;  3SFI A;  5KAF C;  5CKT A;  3DU6 A;  2PFB A;  2R7R A;  2L9R A;  3IL2 A;  4BNC A;  2IXS A;  4EQQ A;  3PM1 A;  3AG1 H;  2BXZ A;  5J40 A;  2BY3 A;  4FE7 A;  4X6A J;  5LHH A;  3BQY A;  2QVO A;  3NWS A;  1Z91 A;  2DPU A;  1R1U A;  2Y48 A;  3BWG A;  1XSD A;  3DP7 A;  3WTU C;  5D5U B;  3ZP5 A;  4F3Q A;  1QNT A;  2B7E A;  3FK7 A;  3HPH A;  3RZO J;  4FE4 A;  4IEJ A;  4PSX A;  1EF4 A;  1BJZ A;  5F0C A;  3DKX A;  2CV0 A;  3HKZ N;  3V7R A;  3LAP A;  4KMF A;  5IYB J;  1OQY A;  1D8J A;  4LGW A;  1YRN A;  4RAY A;  3G6E I;  4U0Y A;  2NVY J;  2HQR A;  5E3O A;  4ENJ A;  2OCE A;  1TQI A;  2VOD A;  3AFH A;  5B1B H;  1T33 A;  1DPU A;  3HYI A;  2P5K A;  2ZXI A;  2JA8 J;  3MAJ A;  2DA5 A;  4D5F A;  1J7K A;  2ZJ2 A;  2CQ7 A;  1VQL I;  2QCO A;  2ETH A;  3NQO A;  3QYF A;  1YOV B;  1LFU P;  3L2R A;  2MLG A;  3COA C;  4E6K G;  1Y8Q B;  1X58 A;  3MCZ A;  1RZ4 A;  4JBA A;  5ILU A;  4OIN F;  3VOE A;  2D45 A;  3N05 A;  2BYV E;  2VIX A;  1PUF B;  2VQH A;  3M9A A;  1F9N A;  2LP0 A;  5L3D A;  4AC0 A;  1JUP A;  5D5V B;  1LUJ B;  5GAG J;  1RUO A;  2RDP A;  5B5E C;  3U21 A;  3QU3 A;  1ITY A;  3BPV A;  4UNO A;  3CQZ J;  5DEQ A;  3Q0W A;  2CUE A;  2NRA C;  5JVG F;  3FIW A;  1A35 A;  2EIN H;  1VQM I;  3ECH A;  3O8H A;  3V42 A;  1RPW A;  4EGZ A;  4A69 C;  4XL9 A;  4GYI A;  4LK1 F;  3ESW B;  3PUB A;  1FBU A;  3BG9 A;  4KIC A;  2HXO A;  4XLC A;  4BDY A;  2HOE A;  2DT7 B;  5JHF A;  3TED A;  2A61 A;  2CYY A;  1DU6 A;  4D7N A;  3E5X A;  3GFJ A;  1XDS A;  5FKN A;  3K10 A;  4DYQ A;  3ABL H;  4II2 A;  2OUM A;  2V1U A;  1K4S A;  3RZD J;  1SFX A;  2GIV A;  2OPT A;  2E1O A;  2EIJ H;  2DMP A;  4LG0 A;  3C7J A;  3GZN B;  1D1B A;  2NS0 A;  1I27 A;  1RR7 A;  1X1B A;  2CUZ A;  1LPQ A;  1ZGW A;  3MKW B;  2RVC A;  2DQR A;  2Y9Z A;  4UUS A;  5F04 A;  5FO5 A;  2VBX A;  3B02 A;  2IP2 A;  2E1M B;  2KLO A;  1Y56 A;  2DOE A;  3P9K A;  4XSX F;  4BKX A;  4D0P A;  4HQE A;  4G8X A;  2Z9O A;  1WVR A;  2HI3 A;  3IC7 A;  1JKR C;  2VPL A;  1LFP A;  2RAE A;  3J81 Z;  1MD0 A;  3M8J A;  1D8K A;  5L3F A;  1USS A;  3B73 A;  3IAM 2;  5F27 A;  2L7M P;  3BG5 A;  1P7I A;  3BP8 A;  2H1K A;  1P2F A;  3TW7 A;  3S3M A;  1T8I A;  4XBF A;  2QGU A;  1X1C A;  4UVC A;  2CWE A;  2K85 A;  4KIS A;  4XIC A;  4E4H A;  2Y0S A;  3V7S A;  2VUM J;  4G9Y A;  5FKO A;  4HOB A;  3JCU C;  1N75 A;  5HLT A;  3DKY A;  4YG2 F;  1HF0 A;  3OYI A;  5LGN A;  4UVB A;  2LNB A;  1Y6I A;  3TO7 A;  2CG4 A;  5FLM J;  3QPT A;  1T2K A;  5EEA A;  3GWZ A;  5E1X A;  1X1P A;  3EUH C;  1BI2 A;  4DZJ A;  1FC3 A;  1P4W A;  2R7Q A;  3WE3 A;  1LB2 A;  1OCZ H;  2NYX A;  2PMZ N;  2QLZ A;  3QWL A;  4BJ6 C;  1FIP A;  1R22 A;  1EKE A;  4KA4 A;  1LDK B;  3OR1 C;  2DPD A;  3E97 A;  3FDY A;  2A68 F;  2OAZ A;  1KU3 A;  4OAY A;  1UHW A;  1P4A A;  4A5N A;  4XID A;  3MKY B;  2PMU A;  4M73 A;  4FCY A;  3CJN A;  4PJ0 C;  3P7N A;  2KRF A;  4ANJ A;  1R5H A;  1X1A A;  3BR6 A;  2KRH A;  4KT6 A;  1JKQ C;  2HVS A;  4I6Z A;  1TBX A;  3CCV I;  5D4S A;  1YG2 A;  1BOB A;  4ESF A;  2Q2E B;  4F92 B;  3BTL A;  1SVO A;  3OYL A;  3BJ6 A;  5K7Z A;  2IS2 A;  2XAF A;  2R7S A;  4OIQ F;  2R7F A;  3PQK A;  4ZDO A;  2FE3 A;  3ZMS A;  4I76 A;  2QYO A;  4M72 A;  2QSG X;  3ZMD A;  1UCR A;  1V4R A;  1DPR A;  2ID6 A;  3L2V A;  2QEX I;  4M9Z A;  1IN6 A;  4E7Z A;  3MKL A;  2O5R A;  1S72 I;  5EZG A;  3ISP A;  4E7S A;  2EFO A;  2FD5 A;  2HZT A;  3F8N A;  1WRJ A;  2PJR B;  4H0E A;  3DBL B;  1LNW A;  2FUG 2;  5DS9 A;  1TNS A;  1V5E A;  1MMA A;  3HHH A;  2O7O A;  4B48 A;  5LGU A;  2HPM A;  3DF8 A;  3I4M J;  1ZK8 A;  2Z16 A;  4I01 A;  1X4O A;  2FNA A;  2FU4 A;  1R1V A;  4ZC3 A;  4P5O A;  4RGX A;  5AON A;  3QOE A;  2ECC A;  2DA7 A;  3HBL A;  1JGS A;  1D1C A;  4OOI A;  4BS9 A;  2H6C A;  4BXU A;  4KNY A;  3E6M A;  4V2F A;  2AQF A;  3E6D A;  3FXR A;  2YS9 A;  3WTW C;  3S1N J;  2M1B A;  4H4K C;  2Q1Z B;  3GXO A;  1ZYR F;  2BY0 A;  4ZDL A;  1SAX A;  4O3M A;  1YYV A;  1H8A C;  2VPR A;  2AQE A;  4Y17 A;  5IPA A;  1LDJ A;  3GTO J;  4IHS A;  4KDP A;  2KJC A;  4UV8 A;  2BE5 F;  3QU6 A;  2HYJ A;  1BOA A;  5E3L A;  1ZG1 A;  2E2J J;  2BEO A;  3LQQ A;  1YIT I;  4G6T B;  5FFZ A;  1ETV A;  2R7V A;  1ETO A;  3WGG A;  1JXS A;  5GTH C;  4IHT A;  5CVI A;  1HA8 A;  2EH3 A;  2LRD A;  3I59 B;  4ASN A;  3U1K A;  3BOQ A;  5F64 A;  4M71 A;  5FD6 A;  4PJL A;  3FF5 A;  5F1R A;  2FMY A;  4CUG A;  1U8R A;  2OC6 A;  2XAH A;  4V2G A;  3BG3 A;  3CES A;  5F0F A;  2ZJR F;  3HKZ A;  3I4P A;  2ID3 A;  2HQA A;  3BCB A;  3SFZ A;  1MGT A;  2VKH A;  4KJZ A;  5D5W B;  4C2U A;  2BGC A;  4RAZ A;  3DEU A;  5M3M J;  2CW0 F;  2K3P A;  3NEU A;  2ZKZ A;  2LH9 A;  2K9M A;  4MEX F;  5DM6 F;  2KRC A;  2OZU A;  2EFP A;  4C9Y A;  3IAS 2;  3PFI A;  2KFD A;  3HOT A;  4G7Z F;  4HPQ A;  1I1S A;  2XAQ A;  1PUF A;  5IP9 J;  5DCM B;  3MFK A;  2DOA A;  2CFO A;  2XUB A;  3TL4 X;  2WWY A;  3JRF A;  4BY1 J;  3A1Y A;  2M9H A;  4MGR A;  1N78 A;  3KP4 A;  2VBY A;  1IXS B;  4XR6 A;  2K4J A;  3DPL C;  2MSY A;  1S8N A;  4IZZ A;  2QQ9 A;  2A6T A;  2JT1 A;  4HW0 A;  3T5X A;  5HNH A;  1U2W A;  2HEO A;  1FBS A;  2D2W A;  3R0J A;  1VQ4 I;  2PI0 A;  4BAC A;  3EUH A;  2V6C A;  4A3M J;  3KZY A;  3OYK A;  3U2R A;  2R93 J;  2LBF A;  2DFH A;  5BQT A;  3BZ6 A;  5LFA A;  2EA2 A;  4I0B A;  2M8E A;  2P4W A;  4IF4 A;  3ZPL A;  1XX5 A;  3GLX A;  4RMN A;  3HB9 A;  5E79 C;  4ZZD A;  1MDM B;  1G3S A;  4RB3 C;  3A2K A;  5E3N A;  1S3J A;  1P6R A;  2K5C A;  3K6G A;  3LQR A;  2D1H A;  3P5J A;  4BBS J;  2CJJ A;  5J6X A;  1TL8 A;  5DUI A;  3CJR B;  3QOD A;  3ZRG A;  1XD7 A;  2R7T A;  4A3C J;  1YLF A;  3S1Q J;  1BA5 A;  2V1D A;  3HIF A;  4AWX B;  3TBI A;  1O7L A;  2IA2 A;  4M6V A;  5HDG A;  2LKP A;  2CRG A;  2NVT J;  4RGR A;  3I9V 2;  5GPA A;  4Q5S F;  3E1S A;  4IPA A;  1ERD A;  4XKV A;  2OQR A;  1MSE C;  1YIO A;  1W1W E;  3LA7 A;  3ZR8 X;  3KP5 A;  3J7Y J;  2OTJ I;  4ON0 A;  2CSO A;  2CW7 A;  4ESJ A;  3MN2 A;  4HRI A;  4FET A;  1YX3 A;  5L3C A;  2JA7 J;  2CQX A;  2M7A A;  5IT9 K;  2EBI A;  4WX9 A;  1ZQ3 P;  3A0H C;  2G0E A;  3WHB A;  4JK1 X;  3S16 J;  2E5Z A;  2KZG A;  2LKX A;  2CUJ A;  3SQN A;  1H88 C;  2ZXJ A;  1Z67 A;  3ROU A;  3JSP A;  2JQ7 A;  2ZFW A;  5M5X J;  3G71 I;  4RS8 A;  3FBI B;  4A3K J;  2MGQ A;  5K5O A;  4B4C A;  3AG3 H;  4JP0 A;  1X3Z B;  3WTT C;  5J3L A;  2DDA A;  1Z77 A;  3HG9 A;  4YFK F;  4XOR A;  4CCL A;  2EIK H;  3DTE A;  5KCM A;  4K2E A;  2L9N A;  3ZN1 A;  2DFI A;  2GAU A;  3H1C A;  2P6S A;  3GZ5 A;  2DTR A;  4PZJ A;  2LY1 A;  3MMY B;  3M8E A;  3RSN A;  2PG4 A;  2P7V B;  2FML A;  1F43 A;  4TV7 A;  2P5L C;  2DXI A;  2HU9 A;  2QSF X;  4QWQ A;  4DGW B;  2KDZ A;  1WJC A;  2GXB A;  3S14 J;  2ZCW A;  3L09 A;  2Z99 A;  4B8X A;  3OIQ A;  3EDP A;  1ZHF A;  2A6E F;  2DOD A;  1ZEL A;  3OYM A;  1HW1 A;  3FMS A;  1W36 C;  3ABT A;  4IJA A;  1VTN C;  3LSJ A;  1U9O A;  3EQL F;  1TNT A;  2FJ1 A;  2L7Z A;  4N0B A;  4L9J A;  2UUZ A;  4A6E A;  2G7U A;  1FZP B;  1UEL B;  1ETQ A;  4L0Z B;  1IO2 A;  2FBI A;  4IL6 C;  5TRD A;  1GT0 C;  2R7Z J;  4XLE A;  1P92 A;  3CUQ A;  4Y15 A;  3LNQ A;  2JVH A;  1KGS A;  2IBD A;  2LDU A;  3CCQ I;  2LF7 A;  4LIU A;  1PDN C;  3OSG A;  2HWV A;  2BZT A;  1IN7 A;  1RNL A;  2P81 A;  1ZAO A;  1IRF A;  1SFE A;  1BR2 A;  4CZC A;  3FKI J;  2NOG A;  5C4J J;  1H9T A;  1XTA A;  3DBR B;  1TTY A;  2M0C A;  4I02 A;  2A6H F;  4G7H F;  2QQB A;  3G3Z A;  3K1P A;  4PK4 A;  2R3S A;  2VJ5 A;  2V9K A;  2M8G X;  2EQR A;  3ABU A;  1GV2 A;  1S9H A;  2X6X A;  3S1R J;  1DDN A;  3CLO A;  1IRX A;  3WG7 H;  1HQC A;  1B9M A;  2BHZ A;  3MZH A;  4XLH A;  4A3E J;  4RAF A;  1VZ0 A;  3SHF A;  1FYL A;  4M6Y A;  4IRI A;  1IRZ A;  1PP7 U;  3AKZ A;  1LVA A;  3J81 K;  3I64 A;  3S93 A;  5E20 A;  1ZAR A;  1WPK A;  1FMV A;  1MDM A;  1SMY F;  2L02 A;  2ZXH A;  1K6O A;  2MG4 A;  1DP7 P;  4HV6 A;  4CH7 A;  2DDB A;  2VBW A;  1GVD A;  5DD8 A;  1FT9 A;  3KEO A;  1W4M A;  3BJA A;  5EZH A;  3H5N A;  3IWZ A;  1IV6 A;  3MQ0 A;  3F22 A;  3VDX A;  2K9L A;  1AHD P;  1EH6 A;  4ZTF A;  3JRC A;  5F1J A;  3TOA A;  5E17 F;  4B47 A;  3H9G A;  2HZD A;  3R6S A;  2ZC2 A;  1YFH A;  1ZG3 A;  3IH2 A;  2K9S A;  2CFX A;  1POG A;  2GA1 A;  4BEH A;  4BE1 A;  4HST A;  4O6J A;  3K4L A;  3L00 A;  3JR9 A;  1WI9 A;  3OR2 C;  2TDX A;  1B59 A;  1PVE A;  2V1N A;  2XF5 A;  3IRQ A;  4NHJ A;  4QPQ A;  3HTU A;  2ZME C;  2LG4 A;  3DLL F;  4CCM A;  4GO1 A;  3H0D A;  4M9S A;  4U0V A;  3KX2 A;  1LFB A;  5B3S H;  1K78 B;  3M3Y J;  3EET A;  2L7K A;  2QA4 I;  3H35 A;  3OYC A;  1U8B A;  2X1E A;  3W6J B;  2VT3 A;  1JGG A;  4HF1 A;  2E7W A;  1W7P B;  1K79 A;  4XM3 A;  3K1M A;  2X4H A;  1MMG A;  3BDD A;  1JJ6 C;  4G7O F;  2Y0S N;  1XG1 A;  3GLL A;  2EZH A;  1MJA A;  4MEY F;  4C3J J;  2ACJ A;  3A03 A;  4DIQ A;  2IEK A;  3HHG A;  2R7X A;  3F6V A;  1TT0 A;  1R4N B;  1JTX A;  2OU2 A;  1BW6 A;  1WFX A;  4NB5 A;  3CUQ B;  2VL8 A;  3KEQ A;  1BI0 A;  1ETX A;  4KMU X;  2M0M A;  5TGT A;  4LIT A;  1ON1 A;  3LFK A;  1WWX A;  1D1A A;  1TLH B;  2CGP A;  1A5J A;  5LRS A;  3D5L A;  1XSX A;  3RYR A;  1FOK A;  1TZL A;  2EIM H;  3AG4 H;  3FHN A;  3O3K A;  5K1Y A;  1E3O C;  2P8T A;  1SEU A;  2H8W A;  2E19 A;  3K7A J;  3AAF A;  1VQK I;  2GBY A;  4YEL A;  4A2U A;  3SDB A;  1P9Q C;  1YO5 C;  2R92 J;  2LF8 A;  3C2H A;  1N25 A;  3CO6 C;  3WGH A;  4HX7 A;  3KET A;  2XAG A;  4BJT A;  2OZ6 A;  4B1R A;  3CD6 I;  2XGE A;  1GHC A;  4KIB A;  4XKB A;  4WK8 F;  1W0T A;  5CJ9 A;  1HKT A;  1SMT A;  3KPH A;  2Q0O A;  1Z7L A;  3GVA A;  5DDG A;  3ZQ7 A;  1ZN2 A;  2DK8 A;  1Y39 A;  2XPU A;  1WCM J;  1FYM A;  4EGY A;  2DA6 A;  2JPB A;  2ZNY A;  5CQG A;  2R5Y B;  2X6W A;  2B63 J;  5ICG A;  1YJN I;  5BMZ A;  1O57 A;  2IPQ X;  1OCT C;  2RGV A;  4DQ2 A;  1NTC A;  1K61 A;  2WY8 Q;  1JHF A;  1AKH A;  2KIM A;  1FOX A;  2NS8 A;  2DAO A;  2ZBK A;  1OYI A;  1R49 A;  4YEJ A;  4BY7 J;  1DP3 A;  2JA5 J;  5E8G A;  4LLG F;  4A3J J;  3IUO A;  2F4M B;  3W3C A;  3MVP A;  4CO8 A;  5HDK A;  3CF2 A;  1IW7 F;  2Y31 A;  3MD2 A;  5KHD A;  1A04 A;  2F4I A;  2R4G A;  2LRE A;  3ABM H;  1T98 A;  2X1C A;  4RBO A;  3WTS C;  2ZB9 A;  3LSR A;  2M4G A;  3K69 A;  2ECB A;  3BG6 A;  3V7C A;  5ICE A;  2XAJ A;  4HX4 A;  3UNG C;  3F21 A;  3KP7 A;  1YJ9 I;  5EG0 B;  4GGG A;  4PDK A;  2IA1 A;  2G9W A;  3K4C A;  1QO0 D;  4ZZL A;  2EZI A;  3WTZ A;  1K78 A;  2GXA A;  1YW9 A;  2GOM A;  3RTR A;  3RPU A;  4EM0 B;  3GME A;  3CC4 I;  3PSI A;  2DLL A;  1K7A A;  1W5S A;  2K3F A;  3ZQH A;  5B66 C;  4II3 A;  4WXH A;  1SVL A;  2LBF B;  4S05 A;  1EV7 A;  4QTR A;  4L18 B;  3DTI A;  4ETS A;  4ZH4 F;  3PNT A;  2HKO A;  2W7N A;  2YU3 A;  3EPZ A;  1ZGJ A;  2WC2 A;  2E7X A;  5CVV A;  4NC8 A;  2E2I J;  5BNG A;  1E2X A;  2ZSI B;  1QPM A;  2N8G A;  3G2B A;  1GDT A;  4X0G A;  4KIT B;  2AHQ A;  3QQA A;  4AUX A;  3GTG J;  3H5A A;  1O7F A;  3RCO A;  1D5Y A;  4GRI A;  1QU3 A;  1O3T A;  3LSK A;  3HRT A;  5DV5 A;  2KDO A;  1ZRC A;  3BY6 A;  1SVM A;  4BQQ A;  1OLT A;  1J0R A;  1X19 A;  1U5T B;  5GPC A;  4CYC A;  3BTJ A;  5EGO B;  2EV0 A;  1AU7 A;  2GLO A;  4DZP A;  4A3L J;  4UXN A;  1ETY A;  1P4X A;  2HKX A;  3FXJ A;  4U88 A;  4WXD A;  2JN6 A;  1T08 B;  4OU0 A;  1MJB A;  1VI0 A;  1KZH A;  4N4N B;  1R9T J;  3KLO A;  3DEE A;  2DU9 A;  3K4M A;  4NC6 A;  1YS7 A;  2V9V A;  2XF6 A;  1SFU A;  2QKM B;  3ZXS A;  2BV6 A;  2QBY A;  5J8C A;  4ZDP A;  1QZE A;  1A36 A;  1OCR H;  3MKZ A;  3GTM J;  5HS8 A;  2I10 A;  1U9N A;  3ECO A;  1B72 A;  4HF2 A;  2VN2 A;  3KIO A;  5J1R A;  2IGN A;  3CTA A;  3I59 A;  3P9I A;  4G94 A;  2X9D A;  3CUQ C;  1IN5 A;  5ICF A;  2QQ8 A;  1QVU A;  1F4K A;  3W2V A;  4BHC A;  4IHY A;  3BLY A;  4YRV A;  1F36 A;  2ADU A;  2NVX J;  1IRG A;  1BBY A;  3FKJ A;  3QYE A;  3JRB A;  4S0H B;  5L3B A;  4F52 A;  3FBN B;  1C0W A;  5GTI C;  3DQV C;  2HFH A;  3ZQF A;  1IV8 A;  1VQ7 I;  3VWB A;  2IGK A;  4EMS A;  3HOX J;  3BC8 A;  4CZZ A;  2AO9 A;  1A6I A;  1RES A;  1XCV A;  1YIJ I;  2X6O A;  1U6G A;  5K5Q A;  2MH9 A;  5J8F A;  5KVR A;  3J80 Z;  3OWT A;  2W25 A;  1W5C C;  2E35 A;  2K40 A;  3TKY A;  4ZYE A;  2O8K A;  2LD5 A;  2L2O A;  3B6C A;  3HL2 A;  4MTE A;  1KYW A;  3BR2 A;  3ZQQ A;  1QQI A;  2LTP A;  2VQC A;  5FKK A;  1U78 A;  3FMQ A;  1ON2 A;  2F5F A;  3EUA A;  2B0L A;  5H6Q A;  4A3F J;  2Z3Y A;  1QPI A;  3HSF A;  2IAI A;  3G73 A;  4CDG A;  5ERI A;  1HC8 A;  3LOC A;  4NDL A;  4CCJ A;  3Q9V A;  3CDI A;  4LIV A;  1ODD A;  2QF7 A;  3REO A;  1WQ2 A;  5LRR A;  4XRS A;  2O3F A;  3J7Z I;  4RAG A;  2MH2 A;  1G4D A;  3VFZ A;  3BT9 A;  6PAX A;  3SEQ A;  3PIP F;  5ILV A;  4ZYD A;  3IH3 A;  3OYN A;  4C30 A;  2LR8 A;  2ELJ A;  3PO2 J;  4XLA A;  3KP2 A;  2VJI A;  3CCL I;  1XPX A;  4XNF A;  1ACI A;  5AIP A;  5FB2 A;  3WE2 A;  3V8K A;  5GP9 A;  4JX6 A;  2IRF G;  2PBI A;  3BTI A;  3BZC A;  4UUT A;  1L3L A;  1TWA J;  2TRT A;  3RDI A;  5E18 F;  2ZME A;  2IT0 A;  1ENH A;  1UMQ A;  3IV5 A;  3ZCO A;  2ZXW H;  3ERE D;  2W1O A;  3CCS I;  4BUP A;  4XRF A;  3E6B A;  2NNN A;  3JRI A;  2JSP A;  5CVR A;  4A5M A;  3CCU I;  4JYK A;  3IHU A;  2VLA A;  2STT A;  3KYC B;  1ZGA A;  2EZL A;  3H0G J;  2F5D A;  2QM3 A;  5JLW A;  2IS1 A;  1TT5 B;  5CVU A;  2EIL H;  3C18 A;  3DPT A;  3TGN A;  1JT0 A;  5D5X B;  3MZY A;  3DEW A;  1H89 C;  4B3X A;  2DMQ A;  4L0Y B;  1OYY A;  3LA3 A;  1ORK A;  1TWG J;  2Q2E A;  4LB5 A;  2WAQ A;  2Z33 A;  1S29 A;  1D5V A;  2JPC A;  5EYR A;  1XC5 A;  4EAT A;  4EEF G;  4WCG A;  4DNC A;  1RKT A;  5LD2 C;  4GCV A;  1LE8 A;  4QPO A;  1T95 A;  5EDN A;  2COM A;  4RM3 A;  3BR3 A;  4BAY A;  1IUY A;  1MND A;  3F0C A;  4HYE A;  1X4P A;  2CO5 A;  4ZYH A;  3JRD A;  4JX5 A;  2NXN B;  3CP2 A;  2HR3 A;  4N4O B;  4QLC U;  4S04 A;  5HOD A;  3L1P A;  3C1D A;  4ZTJ A;  5IYC J;  4A0X A;  2OA4 A;  3ASO H;  4ZYA A;  3M8F A;  1OJL A;  4OMY A;  4Q47 A;  1KQ9 A;  2VE9 A;  2LFB A;  2XB5 A;  1PJR A;  2FXA A;  4EV0 A;  3T0Y A;  5IOZ A;  2F6C A;  2DMU A;  3W2A A;  1V5G A;  4EJV A;  3LST A;  3LSP A;  2FBH A;  2KIQ A;  3FWE A;  5D8K B;  4RA2 A;  3QP6 A;  2QUF A;  2W84 A;  3ONQ A;  3UKG A;  3TW6 A;  1X2N A;  3F8M A;  4FTH A;  3GFI A;  2HQN A;  2M5W A;  1FSE A;  1VQN I;  2X1D A;  1MJ9 A;  4U0W A;  3MWM A;  1UG0 A;  1QHG A;  4BL0 B;  2BY2 A;  2KL4 A;  4HG2 A;  4DBR A;  3UR3 C;  2X51 A;  2VQG A;  2HXI A;  1QHH D;  1IXC A;  5DCF A;  1X3W B;  4P96 A;  2OJE D;  1R4M B;  5D8L B;  1G3W A;  3SZG A;  4M3D A;  1X3U A;  1KQ0 A;  4BH9 A;  2MW8 A;  2DN0 A;  1MBH A;  2QWW A;  1RRJ A;  3FM5 A;  1BC8 C;  1IF1 A;  2DJN A;  4W97 A;  5J4V A;  3RIR A;  5JR3 A;  4HLX A;  1LKX A;  3GUD A;  3OS2 A;  5GAH J;  1DU0 A;  4YFX F;  1HLV A;  4EVI A;  5LHG A;  5IT3 A;  4LOC A;  2M7B A;  2XGD A;  4PCQ A;  1V55 H;  1XCB A;  3K2Z A;  1ZLK A;  1APL C;  4F55 A;  4A6D A;  4LG0 B;  2XF7 A;  1OCP A;  1XN7 A;  2L01 A;  3OL3 A;  3ZGK A;  5FRM A;  3WU0 A;  2KJB A;  3FXU A;  3BCA A;  2ZNZ A;  5F6F A;  3RYP A;  2OF7 A;  3WTY C;  3ZMV A;  4J01 A;  3QP5 A;  2HVR A;  1ZR2 A;  3DCF A;  2A5W A;  3SJM A;  1X1D A;  1BM9 A;  2E60 A;  2W00 A;  4AVZ A;  3HUG B;  4N9H A;  1PUE E;  3K2A A;  2TCT A;  3K1N A; 
#chains in the Genus database with same CATH homology
 2QCO A;  5K7H A;  4RDU A;  1GVD A;  3HM5 A;  1LFU P;  5EZH A;  1IV6 A;  5M5Y J;  1X58 A;  4MLO A;  1AHD P;  3JRC A;  5F1J A;  1PUF B;  2D5V A;  2L7F P;  2LP0 A;  3IH2 A;  2K9S A;  1ZR4 A;  4AC0 A;  1JUP A;  5J1U A;  5FLV A;  1POG A;  3SDG A;  1T56 A;  2VKV A;  3JR9 A;  5DTD A;  1NK3 P;  3JRH A;  2DA1 A;  4UUS B;  1ITY A;  5K7F A;  2XPW A;  4DW6 A;  3GTQ J;  3CQZ J;  4D7M A;  1JKP C;  3Q0W A;  1AKH B;  2CUE A;  2Y9Y A;  1LFB A;  3M3Y J;  3QPL A;  1IG7 A;  3FIW A;  3IH4 A;  1U8B A;  3O8H A;  1RPW A;  1JGG A;  4A69 C;  2XRL A;  2L0K A;  2X48 A;  1IJW C;  1JJ6 C;  2WB1 N;  2Y0S N;  2R5Y A;  3BG9 A;  1XG1 A;  5M5W J;  2HXO A;  2EZH A;  4C3J J;  3D1N I;  5FKM A;  3A03 A;  2IEK A;  2O9L A;  3I4N J;  1WH7 A;  3TED A;  1DU6 A;  1JTX A;  4D7N A;  1BW6 A;  5FKN A;  1ETK A;  2DTZ A;  4DYQ A;  5E3M A;  1ETX A;  3RZD J;  3ZQI A;  2OPT A;  1BL0 A;  2E1O A;  2YUS A;  2DMP A;  1A5J A;  1RR7 A;  4QSH A;  3HGY A;  5EGO A;  1E3O C;  1ZGW A;  2E19 A;  3K7A J;  2GBY A;  4MFD A;  2Y9Z A;  5C3E J;  4UUS A;  2E2H J;  5F04 A;  1VF9 A;  2R92 J;  1TWH J;  4BKX A;  3NAR A;  5FJ8 J;  4C3H J;  4ABZ A;  3FK6 A;  1Q1V A;  2HI3 A;  1JKR C;  2RAE A;  4B1R A;  3HGG A;  2XGE A;  1BW5 A;  2ME6 A;  1WI3 A;  2KT0 A;  1FTT A;  1W0T A;  1HDD C;  3HOY J;  5F27 A;  2L7M P;  2R0Q C;  3CDL A;  2H8R A;  1MSF C;  3BG5 A;  1P7I A;  3JRE A;  4Y52 J;  2XPU A;  2H1K A;  1WCM J;  3TW7 A;  1VND A;  2DA6 A;  4XIC A;  2R5Y B;  1W0U A;  2VUM J;  5FKO A;  2B63 J;  3HEF A;  4A3G J;  2M2E A;  1OCT C;  1HF0 A;  3C2B A;  1NTC A;  3RQI A;  1K61 A;  2GM4 A;  3OOU A;  5FLM J;  1X2M A;  5EEA A;  1AKH A;  2XB0 X;  2NS8 A;  1YRN B;  2CQQ A;  4DZJ A;  1IDY A;  3O8G A;  3GTL J;  1MBF A;  1I50 J;  1I6H J;  4GFB A;  3Q0U A;  2JA6 J;  2PMZ N;  1WH5 A;  4BY7 J;  2ME0 A;  2HDD A;  2JA5 J;  1FIP A;  4AYB N;  4A3J J;  4B3A A;  3MVP A;  2Y30 A;  1MNM C;  2Y31 A;  4MO7 A;  2HOA A;  4XID A;  4FCY A;  2K9Q A;  1XS9 A;  4RBO A;  2ZB9 A;  3LSR A;  2LK2 A;  2ECB A;  3BR6 A;  1JKQ C;  4I6Z A;  2HOT A;  3NAU A;  1JJ8 C;  5EG0 B;  4JX4 A;  1TWF J;  1HDP A;  2LVS A;  5C44 J;  3BR5 A;  9ANT A;  2EZI A;  3BTL A;  1MH4 A;  3Q0V A;  5K7Z A;  4W1U A;  2COB A;  2XPV A;  1VFC A;  1B8I B;  1WGX A;  1Z0X A;  1CQT A;  4I76 A;  3ZQH A;  3E7L A;  2W48 A;  4QTR A;  2ID6 A;  3MKL A;  5EZG A;  2FD5 A;  4L5E A;  1O4X A;  5DS9 A;  3WHC A;  4C3I J;  5BNG A;  2E2I J;  2O7O A;  3G1O A;  2N8G A;  3I4M J;  1GDT A;  1ZK8 A;  2AHQ A;  3QQA A;  4AUX A;  3ZQG A;  1FEX A;  3GTG J;  1LE8 B;  3PO3 J;  1HOM A;  1D5Y A;  2ECC A;  2DA7 A;  3HBL A;  1B72 B;  1FIA A;  3GTJ J;  3HOU J;  2WV1 A;  4V2F A;  4QIW N;  1K83 J;  4J19 A;  5GPC A;  4CYC A;  3BTJ A;  1QVT A;  2YS9 A;  5EGO B;  1AU7 A;  4DZP A;  2GLO A;  3S1M J;  3S1N J;  4A3L J;  1ETY A;  3BR1 A;  1JUM A;  1H8A C;  2VPR A;  2JN6 A;  5IPA A;  1VI0 A;  3GTO J;  1IDZ A;  1R9T J;  2DMT A;  5J1Y A;  2DMN A;  2HYJ A;  5E3L A;  4IHW A;  5FKL A;  3GTP J;  4FIS A;  1TWC J;  2E2J J;  1UG2 A;  2JMW A;  1MH3 A;  1ETV A;  3A01 B;  1ETO A;  2EH3 A;  3FIS A;  3GTM J;  2I10 A;  2DA4 A;  1U9N A;  2DA2 A;  1B72 A;  5J1R A;  3VPR A;  2XSD C;  2X9D A;  3OSF A;  4V2G A;  1MBJ A;  1QVU A;  3BG3 A;  1FTZ A;  3S17 J;  4IHY A;  5F0F A;  5IYD J;  1F36 A;  2NVX J;  1Y1V J;  3HOZ J;  2ID3 A;  3JRB A;  4D5C A;  2WAQ N;  3BTC A;  4G12 A;  4M3E A;  4S0H B;  5M3M J;  4M3F A;  4XRS G;  2NS7 A;  3ZQF A;  3HOX J;  2CUF A;  3JRA A;  5M3F J;  2AO9 A;  2M34 A;  1A6I A;  1RES A;  3G1L A;  1PUF A;  5IP9 J;  2X6O A;  4M3G A;  5F0H A;  2NVQ J;  3LSG A;  5IP6 A;  3JRF A;  3ZQC A;  4BY1 J;  2K40 A;  5IP7 J;  2O8K A;  2M9H A;  2LD5 A;  3B6C A;  5EF6 A;  3BR2 A;  1NK2 P;  5FKK A;  2LTP A;  2Y2Z A;  1U78 A;  2MSY A;  3BQZ A;  3H3V K;  4A3F J;  5JLX A;  1QPI A;  3A01 A;  3ZQL A;  2IAI A;  2R5Z B;  1UHS A;  1JT6 A;  3LOC A;  4NDL A;  4A3M J;  2FX0 A;  2JWT A;  4A3B J;  5C4X J;  2R93 J;  2QF7 A;  3W6V A;  1OFC X;  3Q3S A;  4XRS A;  1B8I A;  1JUS A;  3HB9 A;  5E3N A;  3BT9 A;  3TP0 A;  3IH3 A;  1MBG A;  4BBR J;  2LR8 A;  4Y7N J;  2JJ7 A;  4BBS J;  3PO2 J;  2CJJ A;  4A93 J;  3GBG A;  5GP9 A;  4A3C J;  4JX6 A;  4A3I J;  3BTI A;  2FQ4 A;  2HQ5 A;  4UUT A;  4CYC B;  3S1Q J;  1ETW A;  1TWA J;  2TRT A;  1BA5 A;  1ENH A;  1UMQ A;  4M6V A;  2HOS A;  3IV5 A;  2CRG A;  2NVT J;  5GPA A;  1FJL A;  1SFO J;  1TC3 C;  1ZKG A;  1MSE C;  3JRI A;  3S15 J;  1GUU A;  2VKE A;  4JYK A;  3MN2 A;  4A3D J;  2EZL A;  3H0G J;  2JA7 J;  1IUF A;  2CQX A;  5JLW A;  2EBI A;  4IHV A;  1ZQ3 P;  1QRY A;  2EZK A;  2G0E A;  3OIO A;  2JK3 A;  3WHB A;  1ZTR A;  3DEW A;  1H89 C;  1JT0 A;  3S16 J;  3QPS A;  3GTK J;  2LKX A;  2DMQ A;  1H88 C;  1ORK A;  1TWG J;  1JKO C;  5M5X J;  3HOW J;  3TP3 A;  4A3K J;  1MBE A;  2MGQ A;  5EYR A;  1XC5 A;  4M3B A;  4B4C A;  4EEF G;  3BR0 A;  2XGC A;  4JP0 A;  1RKT A;  4XK4 A;  1LE8 A;  5J3L A;  5EDN A;  1Z77 A;  3BR3 A;  4MFE A;  1MBK A;  3F0C A;  4IHX A;  4BXX J;  3G1M A;  2R5Z A;  2LY9 A;  4JX5 A;  3JRD A;  3S2H J;  5HOD A;  3HDD A;  3L1P A;  1I3Q J;  5IYC J;  3ZOB A;  3HOV J;  1F43 A;  2VI6 A;  1OJL A;  3CCY A;  2KDZ A;  3S14 J;  2LFB A;  2XB5 A;  5IOZ A;  2CU7 A;  2DMU A;  3LSP A;  3A02 A;  3LSJ A;  1U9O A;  3UKG A;  2FJ1 A;  3TW6 A;  2L7Z A;  1X2N A;  4FTH A;  4HNV A;  3CMY A;  2ELK A;  5EG0 A;  1ETQ A;  2YU9 J;  4C2M J;  5IOY A;  1GT0 C;  2K9N A;  2R7Z J;  3LNQ A;  4MIM A;  2IBD A;  3OSG A;  3M4O J;  1Y1W J;  2P81 A;  3SFI A;  4X1E A;  1RKW A;  1RET A;  1JTY A;  2HXI A;  2L9R A;  1S7E A;  3FKI J;  3PM1 A;  2NOG A;  5C4J J;  4M3D A;  2DA3 A;  2MW8 A;  2DN0 A;  4FE7 A;  2M0C A;  1MBH A;  4X6A J;  1G2H A;  3BQY A;  2DJN A;  4W97 A;  3S2D J;  1HCR A;  3S1R J;  2M8G X;  2EQR A;  1IC8 A;  1GV2 A;  1DU0 A;  1HLV A;  1SAN A;  4LOC A;  3FK7 A;  3B6A A;  2XGD A;  4DYR A;  1APL C;  3RZO J;  4FE4 A;  4IEJ A;  1EF4 A;  4A3E J;  1IGN A;  1BJZ A;  5F0C A;  3HKZ N;  1IRZ A;  5IYB J;  1OCP A;  1YRN A;  2NVY J;  5E3O A;  2OF7 A;  3RKQ A;  1T33 A;  1ZR2 A;  1WPK A;  3DCF A;  5F08 A;  4XRM A;  3JRG A;  3SJM A;  2JA8 J;  1P7J A;  2DA5 A;  4D5F A;  2MG4 A;  3K2A A;  2TCT A;  2LLK A;  1GV5 A;  4DYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...