2DMPA

Solution structure of the third homeobox domain of zinc fingers and homeoboxes protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 2
publication title Solution structure of the third homeobox domain of Zinc fingers and homeoboxes protein 2
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 16
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmpA01
1JT0A 2ME0A 2Y30A 1IJWC 3BR3A 2ECBA 1TWCJ 2DMQA 2PMZN 3S16J 2LLKA 1I6HJ 1ENHA 2VI6A 2LFBA 1T33A 5DS9A 3LSJA 4D7MA 1JTXA 1XS9A 3ZQGA 4FE4A 1K83J 5E3OA 2LR8A 1JUPA 3PO2J 2H1KA 3VPRA 2NOGA 2OPTA 2TRTA 1PUFB 3CDLA 1VNDA 3BTIA 4AUXA 1IDYA 4C2MJ 2DA2A 3C2BA 2R0QC 1U78A 1O4XA 3CCYA 1HDDC 1BJZA 1MSFC 3OSGA 3GTMJ 5C3EJ 1B72A 1ETWA 1S7EA 3IH3A 4IHXA 2VKEA 2FQ4A 4C3JJ 1QVTA 2E2IJ 2R92J 1JKRC 2E2JJ 2RAEA 3GTJJ 5EG0B 1ETOA 3HOWJ 1G2HA 2L7MP 2O8KA 4DZJA 2E1OA 4D5FA 3BG9A 4EEFG 2DMNA 3F0CA 2EZIA 2ZB9A 3A01B 3HOZJ 3FK6A 2EH3A 1A6IA 1WGXA 3S14J 3JRGA 2VPRA 5F0HA 2N8GA 2XB0X 3Q0WA 2EZHA 4XK4A 1TWHJ 3OIOA 3S2DJ 4BKXA 1ZTRA 5F0CA 3S1MJ 2DMPA 1JKOC 3S17J 3GBGA 3BT9A 4MO7A 4S0HB 2FX0A 1QVUA 1SANA 5FKOA 4DYQA 5K7HA 4QTRA 2HOSA 2DN0A 5IYDJ 4CYCB 2CU7A 2CUEA 1AKHB 1RESA 1EF4A 4A3IJ 3ZQFA 2NVTJ 4FE7A 4GFBA 2GBYA 1JJ6C 4XRSA 1WI3A 5HODA 1DU6A 3SJMA 2NVYJ 4M3EA 2LKXA 1ZK8A 1UHSA 1HCRA 3JRFA 2JA5J 4A3EJ 2EZKA 4AYBN 5IOYA 5GPCA 2VKVA 3ZQCA 1VI0A 2YUSA 2K40A 5EZGA 1YRNB 4A3MJ 2JA6J 4A3FJ 4DZPA 3HKZN 1FTZA 1X2MA 1NK3P 1Y1WJ 4D5CA 3PO3J 1IG7A 1LE8B 2IEKA 2CQXA 3B6AA 3H0GJ 4BXXJ 5M5YJ 1Z77A 2DMUA 3TW6A 1QRYA 2Y9ZA 2YU9J 4DYCA 1JJ8C 1FIAA 2G0EA 2QF7A 5IYCJ 2M9HA 2AHQA 5F27A 2DA4A 2XPUA 4A93J 4C3IJ 5F1JA 1RKTA 1IRZA 3G1OA 4A3BJ 1U9NA 3FIWA 1MBGA 4W97A 3JREA 5IP9J 1X58A 4BY1J 3I4MJ 3HEFA 4A3LJ 2DTZA 5E3NA 2ME6A 1AU7A 2QCOA 2ELKA 2P81A 3Q0VA 2EBIA 4M3DA 2M2EA 1BW5A 2JWTA 4JX4A 2DMTA 4UUSA 4JX5A 1ETXA 1MBFA 2MSYA 5F0FA 2XSDC 1IGNA 5FKLA 2XPVA 3JRDA 1DU0A 5GP9A 1OCPA 4XRMA 9ANTA 4B3AA 2M34A 1GT0C 2R5YA 3Q0UA 3S1NJ 1Y1VJ 3E7LA 2E2HJ 2IBDA 2MGQA 3FISA 2JA7J 5EGOB 4FCYA 1VF9A 2HYJA 4X6AJ 2FJ1A 5M3MJ 4M6VA 5F04A 1ORKA 1MBKA 1W0UA 5EYRA 5IP7J 1XC5A 5BNGA 1JGGA 3CQZJ 3W6VA 2R5ZA 4A3KJ 3ZQLA 5F08A 3MKLA 1Q1VA 3HGYA 3I4NJ 3PM1A 2Y0SN 2GLOA 1ZR2A 3TP3A 5JLWA 2HI3A 3GTOJ 3DEWA 1FTTA 5FLVA 3LOCA 3BQZA 3QQAA 3GTKJ 1F36A 3BTCA 3UKGA 1AHDP 4A3GJ 2NS7A 3HOVJ 4FISA 3HOYJ 1R9TJ 3DCFA 3S2HJ 1ETYA 3GTQJ 2K9QA 4QIWN 5FLMJ 2R93J 1B8IA 2DA7A 3S1QJ 1U9OA 3O8GA 2NVQJ 2DA6A 2ECCA 1IV6A 1TC3C 1RETA 5K7ZA 4IHYA 3GTPJ 2JJ7A 2XGDA 2Y2ZA 4M3BA 4QSHA 5IP6A 5GPAA 1H8AC 4BBRJ 3OOUA 5IYBJ 2L0KA 3BG3A 2X48A 3CMYA 3BR5A 2TCTA 4IEJA 4I76A 4HNVA 1HDPA 4A3DJ 1XG1A 4RBOA 3HM5A 5EEAA 1B72B 2IAIA 2GM4A 4X1EA 5J1YA 1IUFA 4MFEA 1I50J 4G12A 1MH4A 4JYKA 3BTLA 1UMQA 1P7IA 3JRIA 4I6ZA 1ZGWA 1D5YA 3JR9A 2K9SA 2LVSA 1Z0XA 2O7OA 3JRCA 3JRAA 1MSEC 1IC8A 2HXOA 2HQ5A 5J1UA 5C4XJ 2NS8A 3HBLA 3ZQIA 1RR7A 3G1LA 3O8HA 3BQYA 3BR6A 1JTYA 2EZLA 3HB9A 3MN2A 5IOZA 5C44J 1WPKA 2HOTA 2B63J 2HDDA 1HOMA 1VFCA 1PUFA 4RDUA 1MBEA 5J3LA 3WHBA 3Q3SA 1A5JA 1SFOJ 5EZHA 5E3LA 1JT6A 1MBJA 1JKQC 3M4OJ 2HOAA 4A69C 4B4CA 4BBSJ 1GV5A 1GDTA 3BR2A 1GV2A 4C3HJ 3HOUJ 3FK7A 4XICA 5EG0A 3HDDA 1MBHA 2XGCA 1CQTA 2CRGA 2E19A 3QPSA 5DTDA 2LD5A 5E3MA 2XPWA 1FJLA 3A01A 2KT0A 3NARA 3FKIJ 2W48A 4M3FA 1K61A 3ZQHA 2VUMJ 2DA3A 1IDZA 4Y52J 2LK2A 2M8GX 4MLOA 3QPLA 3WHCA 1TWGJ 1TWAJ 2WB1N 1H88C 2DA5A 1FIPA 1UG2A 2D5VA 2JA8J 2H8RA 5M3FJ 3M3YJ 2YS9A 5FKMA 2I10A 3BR1A 3A02A 1F43A 2CUFA 4CYCA 3RZOJ 1AKHA 1BA5A 3BR0A 4JX6A 1MNMC 3S1RJ 4NDLA 4DW6A 2X6OA 4Y7NJ 1GVDA 1ZR4A 2Y9YA 3LSPA 4JP0A 3TP0A 4V2GA 3SFIA 4M3GA 2MW8A 4MIMA 1OCTC 1P7JA 1FEXA 2R7ZJ 1YRNA 4D7NA 5J1RA 4XIDA 2CQQA 4B1RA 4UUSB 1LFUP 1GUUA 3LNQA 1ETQA 4LOCA 3NAUA 3MVPA 1ITYA 4UUTA 3RQIA 2Y31A 5M5XJ 2JK3A 3TEDA 2L9RA 1LE8A 2R5YB 2NVXJ 1ZKGA 1WCMJ 1I3QJ 1MH3A 1POGA 3GTGJ 2XB5A 5FKNA 2O9LA 3IV5A 3L1PA 3IH2A 3LSGA 4A3JJ 1LFBA 4ABZA 1JUMA 1NK2P 1OFCX 3IH4A 1H89C 2ID3A 3JRHA 4J19A 3GTLJ 3BG5A 2K9NA 2LTPA 4MFDA 2R5ZB 4IHVA 2AO9A 4L5EA 1TWFJ 3BTJA 2CJJA 2L7FP 1U8BA 3JRBA 4DYRA 1X2NA 2MG4A 5EDNA 3S15J 3A03A 4IHWA 2DA1A 2LP0A 3K2AA 3ZOBA 4AC0A 3H3VK 1HF0A 5IPAA 5M5WJ 3OSFA 4A3CJ 2WV1A 3RKQA 1WH5A 2ID6A 4W1UA 1NTCA 5C4JJ 3LSRA 2JMWA 1HLVA 3RZDJ 1B8IB 2WAQN 3HGGA 3K7AJ 1BW6A 5FKKA 3TW7A 1JUSA 1ETVA 1T56A 1ZQ3P 2EQRA 2OF7A 2X9DA 1W0TA 5EGOA 1E3OC 3HOXJ 5K7FA 3G1MA 4XRSG 5JLXA 2COBA 1ETKA 2KDZA 2M0CA 2HXIA 2LY9A 1OJLA 1RPWA 3B6CA 1WH7A 1JKPC 2DJNA 2L7ZA 4FTHA 1BL0A 4V2FA 1RKWA 5FJ8J 1APLC 4BY7J 2JN6A 2XRLA 3SDGA 1QPIA 2FD5A 3D1NI 2XGEA 5EF6A
chains in the Genus database with same CATH superfamily
1JT0A 1WI9A 4WXCA 2KIFA 1BR4A 1S7AA 4KT6A 2J5OA 3ZMSA 5L3FA 2PMZN 2X85A 2M4GA 4ZZLA 5B5EC 2LLKA 3IRRA 1A6QA 4CYDA 1A36A 4E4HA 3PQKA 4PK4A 3RPQA 4IXAA 1T33A 2FUG2 4YEJA 3FXQA 2LMDA 3RTRA 4PZJA 4FE4A 4OIOF 1JUPA 2PMZA 1VQ5I 2NOGA 2FOKA 2TRTA 2XAFA 1Z3YA 2OUMA 5DCFA 2MFZA 2V79A 4L9TA 2HZDA 3BTIA 3D5SC 1Z67A 1YTYA 2DA2A 3C2GA 1WJBA 3CCYA 4RLFA 1U5TC 4OIQF 5D8KB 4PGGA 2XUBA 3U1KA 4IHXA 1DPUA 4HV6A 5BMZA 4LIUA 5CYVA 1JKRC 1BI1A 4FT8A 4UVCA 2GXAA 3ROUA 4F55A 2V6EA 2L7MP 2O8KA 4ZZDA 2QENA 2EPFA 5HS9A 3CO7C 3G71I 4KUMA 2ZB9A 4XSXF 2FBIA 3A01B 4IX7A 3FK6A 2EH3A 1XMXA 3EUAA 1CGPA 3K1MA 2ZFUA 5F0HA 1UHMA 3GMEA 5JHUA 2XB0X 2EZHA 3QPHA 4BJ5C 5EJCA 5H20A 1SVMA 1ZLKA 3S2DJ 5J8FA 1QA6A 4HDVA 4BKXA 2FQ3A 3HRSA 5DV5A 3BZKA 4M6YA 3S17J 4U0WA 4MO7A 1R5ID 1D8JA 2PMUA 4BQOA 3B02A 2Z9OA 5DD8A 1QVUA 4PFPA 2DFFA 2HKXA 5FKOA 3M8FA 4QTRA 4CYCB 4TV7A 4Y33A 1J75A 1EF4A 1QZEA 2HVSA 1X1DA 1DQUA 2IGOA 5KNLA 1WI3A 1UHSA 2PG4A 4KT5C 1BR2A 4D0PA 3CF2A 3KEOA 5IOYA 3OS1A 5JR3A 2O61A 3ZQCA 3KYDB 1L3LA 2LREA 4A3MJ 2JA6J 5KK1A 3HJEA 1Y8RB 3BJ6A 2DYRH 1J5YA 1QBJA 3PJRA 2BGCA 3CTAA 2EIJH 2X1CA 3G4SI 1LE8B 5BQTA 3B6AA 4BXXJ 2QSHX 1Z77A 2DO7A 2OD5A 1QRYA 2GOXB 2EB7A 4O5VA 4GGGA 4LGWA 2VONA 1OPCA 1BN5A 2M9HA 5IYCJ 3DPUA 2MH2A 3W6JB 4IOAF 2FOWA 2R7DA 4BE2A 3OYCA 5F27A 1R00A 2XPUA 4M72A 4A93J 1SFUA 5J4VA 3OR1C 3CD6I 1YX3A 1U9NA 3ESWB 4XN0A 2IS6A 1J09A 5K5OA 2RC4A 2DOFA 4GRIA 4B47A 4IHTA 4HEA2 3ML6A 1CF7A 3OMYA 3K1PA 5CVVA 4BL0B 1DGRM 1MMNA 2V7FA 3DTKA 5E3NA 3RJPA 2EFQA 1B59A 4NUBA 3G2BA 2A5YB 4BHPA 1SAXA 2OA4A 1BW5A 2V6CA 2DMTA 4UUSA 3IL2A 4JX5A 3LL7A 4RLQA 4ENJA 2LNBA 1Q1HA 2KL4A 3GF2A 2XSDC 5CPRB 5FKLA 1D1AA 3ERMA 3JRDA 3O6BB 2VB6A 2PLYA 5GP9A 2R7VA 3OIPA 3RQ4A 1ULYA 4B3AA 4QPQA 3BCAA 3VFZA 5ICFA 3LMMA 5D8LB 3AL0B 2XROA 1F1ZA 1ODDA 3BDDA 3E7LA 3I59A 3ZCOA 5JI6A 2HR3A 3OWTA 1IN7A 1LUJB 2MGQA 4C30A 4FCYA 2HYJA 3WU2C 2CV1A 2BVLA 2QYOA 4O3MA 2HTJA 2P8TA 2IVMA 4M6VA 3V7RA 5D4SA 1MBKA 1W0UA 4PJ0C 1SD4A 4WCGA 3K10A 3K1NA 5BNGA 1JGGA 3NEUA 2NOJB 5KAIC 1Y6IA 3ZQLA 1O57A 3FXLA 3HGYA 3PM1A 3E6CC 4KIGA 2D45A 4Y17A 2DU9A 5FGMA 3OS2A 2O03A 4M73A 3BQZA 3TO9A 2KRCA 3BTCA 3UKGA 4BNCA 4FISA 1KONA 3DCFA 4XN3A 1ETYA 3GTQJ 1E3HA 4XLAA 1QZZA 3L2UA 5LFAA 4UB6C 4NNJA 4IF4A 2MBFA 4KITB 2NVQJ 1P6RA 2DA6A 1JGSA 1O7LA 4HX7A 3H36A 1LPQA 2EV0A 2W85A 2COMA 2Y2ZA 4QSHA 3KLNA 1RI7A 5GPAA 1RRJA 1N78A 2A69F 3RI4A 2E5ZA 2DDBA 4HNVA 3S8PA 1HDPA 2EFOA 2EJRA 4RGRA 2ETHA 4RBOA 3ZMZA 4IRGA 4RGSA 1R5HA 2HKOA 2IAIA 1B72B 2GM4A 3REOA 2I8DA 2R3SA 5J1YA 3K4BA 2VOPA 2ZMEB 1IUFA 1YOVB 3WGIA 4G12A 3BTLA 4L0YB 1V4RA 4KMFA 3DXJF 2HYGD 2Z16A 3JRIA 3ABLH 1XSXA 4RM2A 1XD7A 1ZGWA 1D5YA 3JR9A 2VKDA 4ENKA 2K9SA 1ZRCA 5CLSA 2I5UA 4GXOA 4PJMA 3JRCA 3NRVA 4YIIA 1IC8A 2HQ5A 4M9ZA 1MKMA 3FHZA 3D5RC 5J6XA 2NS8A 4XKCA 1YW7A 3MZYA 2ESHA 1TQMA 2MH9A 3GVAA 2NXNB 3PUFA 2IGMA 1HW2A 3BC8A 1KU7A 3RSNA 5TRDA 1X4PA 1DPRA 5BPIA 4F93B 2MLKA 3LFUA 4N4NB 2LC2A 3KP6A 2YR2A 4NQWB 2HOTA 2B63J 2HDDA 4KYWA 1TQIA 5DD4A 3PFIA 2BW3A 2V1DA 3OYJA 1YW8A 5TJJA 1MBEA 5J3LA 2R4GA 2WAFA 4AIJA 3OL4A 3RKYA 4U7DA 1TNSA 2P5VA 3FKJA 3M4OJ 3GEZA 3V7CA 1V3FA 1YFHA 4MTDA 3HIFA 3CCUI 1GDTA 1MGTA 3BR2A 5AIQA 3U2RA 4U87A 4BJ6C 4CO8A 2F5FA 1OYIA 3VB2A 2E19A 2ZSHB 3I71A 3QPSA 2IS1A 3GO5A 5H6QA 1LKXA 3IHUA 2XPWA 3DF8A 1W4MA 5CVIA 2W48A 4Y15A 2V26A 2VN2A 2EIKH 2KLOA 2WBMA 2LBFA 5J47A 3M9AA 2LK2A 2M8GX 3SZGA 3PUBA 1TWGJ 3WHCA 4EM0B 2WV0A 3KP5A 2P5LC 5EEGA 3WTTC 4AIHA 2DA5A 1UG2A 2KIQA 5AIPA 2H8RA 2JA8J 1DDNA 1KZHA 1UZCA 4G6QA 4I01A 5M3FJ 2CFXA 3QAHA 2YS9A 5FKMA 4HQEA 2HDWA 1O3QA 1HKQA 1M1EB 3BR1A 2E1MC 1IF1A 1MJAA 4E7SA 3CO6C 4I09A 4JX6A 3RKWA 2PN6A 2F6CA 2X6OA 1ZR4A 2DPUA 2ADUA 4XLEA 3SFIA 1GHCA 2BXZA 4Q48A 1XGMA 1G3YA 1R7JA 2IS4A 3HC7A 3IAM2 3SZPA 1FEXA 4Y4RA 4XOPA 4EVIA 4L9JA 2VQLA 4AIDA 3J80Z 2A6HF 2CQQA 2Y0SA 3DPTA 1A31A 1MJ9A 4ZTJA 3LNQA 2GAUA 4HBLA 4HZFA 3I0TA 2QZ8A 4ASNA 1IO2A 5CVRA 4DNCA 3RQIA 1WJ5A 3CJRB 1FOKA 3WTSC 3AG4H 2R5YB 3H9QA 4EGYA 4RAZA 1ZREA 3GTGJ 5FKNA 2O9LA 4XMYA 3RYRA 1A35A 2ISYA 3IV5A 1EA3A 4F52A 4A3JJ 4E7JA 2CWEA 1JUMA 1NK2P 1SVLA 5DYMA 2UWMA 1OR7C 3IH4A 1IRXA 4BACA 3GTLJ 5CVUA 2V9KA 3D5LA 2K9NA 2P7CB 3K9TA 2L4MA 4KJZA 3X2QH 4DOZA 4MFDA 2FMLA 3TQNA 3KE2A 2VJ4A 2NYXA 4BXFA 3BTJA 3DWLE 2L7FP 3LAPA 3MMYB 5LGUA 3WGGA 3BROA 4L5IA 2W00A 2PJPA 2W82A 3K4NA 1ZYRF 5FLXZ 3H3VK 5M5WJ 3OSFA 4A3CJ 3RKQA 3HTSB 1WH5A 2E7XA 1EKEA 1HW5A 2ID6A 2B9SA 2VPLA 1NTCA 3FXJA 2K3PA 2KZVA 5C4JJ 1KQ9A 2XVCA 4M74A 1ON1A 4LB6B 1ZG3A 2QSGX 3K7AJ 4P5OA 2C6YA 1BW6A 2IGNA 2L9VA 5FKKA 2M45A 2QGUA 3TW7A 1SMTA 2K4BA 1KA8A 2X9DA 1K78B 1E3OC 4OMYA 5K7FA 3K6GA 5JLXA 1LDKB 3TOBA 3CC7I 1ETKA 2M0CA 3S2WA 3QP6A 2HXIA 2V9VA 1OJLA 2PEXA 4XSZF 3B6CA 3E6BA 4XKVA 3F6OA 3PSIA 4B43A 1VQNI 4JBAA 4KICA 2W25A 4KIBA 2VXDA 4BY7J 2HVQA 1QHGA 1YI2I 2FBKA 3KFWX 2ICWG 2OBPA 3D1NI 3OYIA 1OISA 2VBZA 4BGDA 5LLQA 1WQ2A 1HC8A 4A0ZA 3BJOA 3TBIA 4L18B 3QU3A 2V1XA 1OR7A 2ECBA 2IS2A 4KISA 3M1CA 4IJAA 3WODF 3ZMDA 2OCEA 3KZYA 2E34A 1I6HJ 1JHHA 1IV8A 1DUXC 4MTEA 1XMKA 3F72A 2VI6A 2V1UA 4LG0B 4D7MA 1ZGAA 5LEKA 3WTVC 2ZJ2A 2XDVA 1T08B 3P9KA 1XS9A 1UFMA 4KN4X 1ACIA 3ZQGA 3SEZA 4DIQA 5E3OA 4NC6A 3VPRA 3FXOA 3EQLF 4A6DA 1PUFB 2KISA 5B1BH 2JPBA 5LGTA 1OCRH 3U9GA 4AUXA 2R0QC 2FEZA 1U78A 4EM2A 3OS0A 4IZZA 5L3EA 1HDDC 1TW2A 2A07F 1WKMA 1EJ9A 2M5WA 1VQ6I 2ZC2A 2RVCA 2MC3A 2Q1ZB 2CW7A 2Z3YA 4HQMA 1P9QC 3L2QA 2E2IJ 3P9IA 4I98B 2E2JJ 1BOAA 2CO5A 2RAEA 1MW7A 4BUPA 1BI0A 3I53A 1B1BA 2H94A 1ETOA 5K5RA 4G7ZF 1G2HA 1WZ2A 2F5VA 1TW3A 2VT3A 4Z2YA 5DM7F 3F0CA 1P4AA 1S5LC 4LMYA 2WY8Q 3ABMH 5J4YA 3OOPA 3I5UA 1WGXA 1Z6TA 2VT2A 3JRGA 2VPRA 3Q0WA 3S3MA 1FOWA 1TWHJ 2JRTA 4E70A 3OIOA 4G6DA 3PL8A 1BJAA 1ZTRA 5F0CA 1HSTA 1K6YA 2DMPA 4L5JA 4F7ZA 1JKOC 2X0LA 4FASD 1WJAA 1LVKA 2XF7A 2XAGA 3MKYB 1D1BA 3GBGA 1VQ4I 3GLXA 3BG6A 3PSFA 4CSWA 3GZ5A 3KYCB 4BE1A 1RC9A 1J0RA 2OQRA 5KVRA 3KIOA 4DYQA 5K7HA 1W7PB 2JSPA 2YU3A 2CUEA 1P2FA 5DUKA 5L3GA 3VODA 4P96A 2DFEA 2NVTJ 4FE7A 1SD5A 2GBYA 2M7BA 5DUIA 2R7XA 4M3EA 3BY6A 1A04A 1XN7A 1ZK8A 3W2WA 2ESNA 2X4HA 4ESFA 5D5VB 4AYBN 5GPCA 1VI0A 2K40A 3CCSI 4DZPA 3HKZN 1FTZA 3ZN0A 3J80K 4E7IA 2KFDA 3H35A 4CH7A 1RUNA 3PO3J 4BH9A 4U7BA 2A6TA 2X1EA 2XAJA 3CJQB 3V42A 1IG7A 2D1HA 2GIVA 3SFZA 3CUQB 3W6KB 2RKHA 4CZCA 4AYBA 5M5YJ 3CCQI 2EV5A 4PDKA 1EH8A 2HTSA 4DYCA 3QODA 4WWCA 1JJ8C 1ZG1A 2G0EA 2QF7A 2O3FA 2OJED 3HKZA 5E1ZB 3OYMA 1WJDA 1VQ9I 4A6EA 3L7WA 1JI8A 2X6WA 4C3IJ 2PFBA 1RKTA 1F4KA 3J81Z 1H9TA 4I0BA 2XKOA 3QOEA 1MBGA 1J9IA 4HF1A 2VODA 3ASOH 4A3LJ 2DTZA 2OZUA 1WHUA 2ME6A 3OYDA 4GYIA 1KYWA 4B44A 2QCOA 2P81A 3Q0VA 1V5GA 2DPDA 2QVOA 4M3DA 3SDBA 2DI3A 3KZIC 4N9IA 3RDIA 4HAMA 4P9UA 1MBFA 2BY1A 1IGNA 1SD6A 1MMAA 4WK8F 3F8NA 1C0WA 4RB0A 5FLXK 9ANTA 2HNHA 4BU2A 2HGCA 4B3XA 1FYKA 1MDMB 3VYSB 1IZ1A 1USTA 2R7TA 3Q0UA 1R23A 1Y1VJ 2E2HJ 2W57A 3BP8A 1S7OA 1B9NA 3FXKA 2A6EF 3ABUA 2FJ1A 5M3MJ 5D4RA 4J01A 1HXDA 4UHTA 5D6FA 1SFEA 5EYRA 5LBQA 2VE9A 2DW4A 1MMGA 1LNWA 2L2OA 1SMYF 3GZ6A 2R5ZA 3FM3A 2FF4A 4MEYF 5F08A 2IW5A 3SXYA 3AG3H 1Q1VA 2QUFA 1BIAA 2XAHA 2K86A 1MZBA 1R1TA 3TOAA 3GTOJ 1D0YA 1XSVA 3DEWA 1T8IA 4N9HA 3GTKJ 2D1VA 1F36A 3LSHA 4I2OA 5LD2C 1J7KA 4A3GJ 2NS7A 3HOVJ 4BEHA 2RDPA 1U0JA 3L2VA 3AL0C 2K9QA 1G3TA 4QIWN 1BI2A 2KIMA 4L9VA 1IN6A 3R61A 4CDGA 3FMQA 1IUYA 3S1QJ 1KGSA 1U9OA 1Z21A 2KP6A 1YJNI 2F2EA 4UVBA 1X3WB 4HNTA 1LDJA 4CGZA 2F4IA 2Z2SB 2QQ8A 5K7ZA 2FXAA 2LSOA 1H8AC 2CMPA 4BBRJ 3KPHA 2FU4A 4XM3A 2L0KA 3OYFA 2KZGA 2X48A 2XRNA 3GYHX 3S3NA 3H92A 3F9KA 2CUJA 2AS5F 1N75A 2R7QA 4IO9F 4EMSA 5TGTA 3HM5A 4PCQA 4X1EA 4EATA 5JFRA 3TKYA 4WF2A 1I1GA 1I50J 1T6SA 4JYKA 2IA0A 1QZYA 1UMQA 1P7IA 2M8EA 1U5TA 3F6VA 2O5RA 3LSIA 4I6ZA 2R7OA 3N97A 2KQRA 2MD0A 3CCLI 1R1UA 1TZLA 1DP7P 1WRJA 1WJFA 1Z0XA 3BWGA 2HXOA 5C4XJ 3ZP5A 3HG9A 4HDUA 2LY1A 3E6MA 2AQFA 3HBLA 1N77A 3FXUA 2ZXJA 2F5EA 2HS5A 3CCVI 2IJLA 3SEQA 3BQYA 4RMNA 1YQAA 2JTVA 5IOZA 5C44J 2DFIA 1IW7F 3KEYA 3ZQQA 2PQ8A 2Y75A 3FX3A 3WHBA 3Q3SA 3ZR8X 1A5JA 2ZMEC 1IRGA 1SFOJ 1FOXA 3MCZA 2V9PA 5DEQA 5E3LA 1MBJA 2HZTA 1T38A 5DCMA 1XDUA 3OYBA 4BBSJ 2EFNA 1QPMA 2DCEA 1GVJA 4OINF 4CICA 3HOUJ 4G6TB 3FK7A 5EG0A 4IHSA 4OMZA 2ZFWA 3KP2A 2CRGA 1CQTA 1YS7A 2RV8A 3M8JA 3H5RA 5E3MA 2K02A 2LF7A 3NARA 4M3FA 2IGKA 1K61A 2VUMJ 4CUGA 3EUKL 3C18A 1NG7A 2VJIA 2Y69H 2P4WA 3ELKA 3R4KA 4LIVA 3CMAI 4Y52J 4ZYHA 1R4NB 4M9XA 3NWSA 2WB1N 1H88C 2JT1A 3F3XA 5B66C 4C2TA 2VIXA 3I9V2 2D5VA 2FNPA 3L00A 3SZTA 2BY3A 1XCBA 3ZRGA 4P55A 5L3DA 4B48A 1O3RA 5FD6A 3CZ6A 5LRRA 3H3ZA 3SYTA 1MIJA 2GZWA 2F5CA 1REPC 1AKHA 2WB1A 1MNMC 4HRIA 4LG3A 4NDLA 1TLHB 2CH0A 1PJRA 4J00A 3JW4A 1CF7B 3J81K 3HUGA 1E2XA 3W3CA 1PVEA 3QYFA 1ZELA 3KX2A 4HLYA 4EJVA 4JK1X 4A5MA 4G8XA 1YRNA 4WXDA 3A1YA 5J1RA 1S3JA 3F8BA 4ON0A 4UUSB 1LFUP 3DEUA 2RQPA 2ELJA 5GTIC 1F5TA 1E17A 1FMVA 2EA4A 3NAUA 2CFOA 4L0ZB 1ITYA 4UUTA 3P9CA 2IP2A 3TEDA 1PYVA 4FETA 5TISC 4XRFA 2NVXJ 1WCMJ 1MH3A 3I59B 5CVJA 4YIRX 1W5CC 1YG2A 3NWTA 4EJOA 2NAZA 3LWFA 4XLPF 4HNUA 1EV7A 3IH2A 3HSFA 5FD5A 4ABZA 4EJUA 4CCMA 5DDGA 3H1CA 4U88A 3JRHA 2HQAA 4J19A 1R1VA 3BG5A 4UV9A 4CZZA 2M87A 1X1CA 3J7ZI 1DGWY 2LTPA 3BG7A 3OYGA 1H9GA 4RA2A 3C2HA 2W1OA 4L5EA 4F92B 3OYLA 3H9GA 2CJJA 3GFJA 2QM3A 1U8RA 1X2NA 2MG4A 4XORA 5GADJ 3CC2I 2OCCH 2XKPA 2KKOA 2M3AA 2EWNA 2RNJA 3QYBA 3A4CA 3HPHA 3R60A 4IRIA 1KU2A 4W1UA 2P6TA 2G7UA 2JMWA 1X3UA 4I7HA 2WAQN 1LVAA 1YX5A 1U6GA 4XLHA 1JUSA 2ZKZA 4ITVA 2NRAC 2VBXA 2EQRA 3I55I 4HF2A 2OF7A 1TP4A 1XB4A 5ICEA 4CXFA 5EGOA 4OIRF 1ZG5A 2HWVA 3HOXJ 1VZ0A 2DT7B 4XRSG 2COBA 5J8CA 1IXSB 4XQFA 2ISZA 3QYEA 2LY9A 3RCOA 2QWWA 2LG4A 1SFKA 2R7WA 1YYVA 3CJNA 1JKPC 1TT0A 2L7ZA 2JPCA 4ZYEA 3FMRA 4Z6YA 2PI0A 2O0YA 3HXLA 3CMEI 3WTWC 1BC7C 1D8KA 3V8KA 1F9NA 1LFPA 4KMUX 2FD5A 1K79A 2DJIA 1O7FA 3K4MA 3HPGA 1XDSA 2JZYA 5HLGA 2L4AA 2QKMB 3FWEA 3R0AA 1TT5B 5H6RA 4FQGA 2FNAA 3FXMA 4S05A 2ZXHA 3BR3A 3UNGC 3IRQA 1TWCJ 3V7SA 2DMQA 3JCUC 2DT5A 2CW8A 3AG1H 3U1DA 4C9YA 1ERDA 1W5TA 1ENHA 3JTHA 4BJTA 2UUZA 2Y0MA 5DS9A 4NC8A 4XKWA 3E6DA 2LDUA 1Y56A 4P9FA 3ZMUA 4YRVA 4JOMA 4GDFA 3RIRA 3PO2J 3WU0A 2OPTA 2JSCA 2BW3B 3WU1B 3IC7A 1R4MB 3CDLA 1VNDA 3MQ0A 3KCCA 2F4OB 1FOYA 1MSFC 3LA7A 1WSUA 3OSGA 2CV0A 2E5NA 3GTMJ 5C3EJ 3CJTB 1S7EA 1O3SA 2VKEA 2E36A 2FQ4A 1YE9A 1YLFA 1QVTA 4Q5SF 4AWXB 2R92J 4MQVA 4CCNA 5IT3A 1HKTA 3ZMVA 3L2WA 1T39A 2STWA 3GTJJ 4II3A 1SAUA 1R22A 2A3SA 2H1LA 4DBQA 1PP7U 3HOWJ 3HYIA 1J2XA 4O6JA 3LA2A 1G3SA 1R6RA 4DZJA 2E1OA 4I0AA 4EEFG 2DMNA 2EZIA 1V54H 3HOZJ 1WFXA 2V4JC 1T95A 4XL9A 2CYYA 1KU3A 5J40A 1YIOA 5GAEJ 2N8GA 3CDHA 4R1HA 2LBFB 4UV8A 2GA2A 1BBYA 2VC1A 2DLLA 2OZ6A 3VSKA 4CCKA 1U3EM 5E8GA 3MZHA 4PGHA 4BXUA 2MLGA 3BT9A 1LB2A 2EILH 3K4JA 1ZLJA 3GFLA 2GOMA 3TGNA 2KDOA 1VQLI 1Z9CA 1SANA 4LLNA 4XNFA 3CLOA 2HOSA 2DN0A 1YIJI 4HX8A 1IRFA 1RESA 3DTEA 4KNYA 2YPRA 2Q2EA 2E1NA 2ZNZA 3R0JA 2HPIA 2ZJRF 1RUOA 2XHKA 1JJ6C 2EK5A 2KPMA 4CCLA 1OKRA 1UAAA 1DU6A 2VKHA 3CUOA 3K0LA 3HOSA 2RN7A 1HCRA 3K2ZA 3BCBA 2JA5J 3ECOA 2VKVA 4A2UA 3MZ8A 2YUSA 2MA3A 4RAYA 4EV0A 3ZMTA 1IXRC 4WXHA 1Y1WJ 4P1WA 4D5CA 3OYHA 3G73A 4II2A 2DDAA 1K4SA 1FP1D 2CQXA 1R71A 1Z3XA 5EEHA 4LK1F 5B1AH 2L9SA 1USSA 2DMUA 1HQCA 3TW6A 1QHHD 2WADA 3T0YA 1R5GA 3CP2A 2K3FA 1LQ1A 2YX4A 1XSDA 3NQOA 2LH9A 2DA4A 4LLGF 4G7HF 5F1JA 4AD9A 3G1OA 4ZH4F 1YW9A 3H0DA 1T0FC 4D1QA 4W97A 5IP9J 1X58A 2Q8KA 1WJCA 2W7NA 4HSTA 4BY1J 1H0MA 3J7YJ 2PJRA 4NC7A 1V55H 3DBRB 2ELKA 2IXSA 2E1MB 3HTUA 2QBYA 2EBIA 1SEUA 2M2EA 4I99C 2CQNA 3CUQC 1UB9A 5FB2A 5LRSA 5F6FA 4LB5A 1W5SA 5HNHA 2MSYA 5F0FA 4FHTA 3I58A 2XSJC 2XPVA 1DU0A 5CKTA 1EH6A 1OCPA 3T8TA 1AOYA 2M34A 1GT0C 1WWXA 4AVZA 3M8EA 3S1NJ 2BBYA 3CMMA 3K70C 3DEEA 2WAEA 5CQGA 1OCZH 2IBDA 1ZGJA 3FISA 2JA7J 4LJZF 3LAJA 4BAYA 4X6AJ 3M07A 2CV2A 4Q47A 1MMDA 2LKSA 4F3QA 2H6CA 4CCJA 1PDNC 3CCJI 2DFHA 2RGVA 4GO1A 2OC6A 5IP7J 1FYLA 4NB5A 1JE8A 2HFHA 2KIUA 3CQZJ 2QA4I 2AQEA 3W6VA 3V8JA 4A3KJ 4I02A 4PFOA 1S8NA 3COAC 2GLOA 2QSFX 2CUZA 5JLWA 2HI3A 4E6KG 4LFUA 3LA3A 1KQ8A 3F21A 1I6XA 4DBRA 1R9TJ 3S2HJ 1SVOA 2QLZA 1T0FA 1L0OC 4YFXF 1B8IA 2DA7A 1KU9A 2JUGA 3JAMK 2L01A 4PJNA 4A5NA 1VQOI 3DFGA 1GXQA 1FP2A 1T98A 1TC3C 1RETA 4ANJA 3GWZA 4DGWB 4IHYA 3GTPJ 2F4MB 4ZDPA 1QNTA 2XGDA 4OOIA 3OYAA 4ZYAA 1BI3A 3ZXSA 2ZBKA 3LFKA 2DXIA 3BG3A 3DKWA 5ICGA 3CMYA 2TCTA 4IEJA 4I76A 2QQBA 2OU2A 4A3DJ 3LSKA 2LF8A 1XG1A 4ZTFA 2R7RA 2Z99A 5E18F 2OTLI 1Z7LA 1HA8A 5F64A 1FBQA 4KIFA 1OLTA 2VE8A 3R6SA 3PIPF 3WG9A 2GXBA 2NS0A 4XONA 5ILUA 2O7OA 3T5XA 5J1UA 2HOEA 4AVPA 5GAHJ 2VQHA 3ZN1A 1RR7A 3G1LA 4L9NA 3O8HA 5JVTA 2XC7A 4OWRB 1PUEE 4UUVA 2EINH 3F8MA 2X6XA 3BR6A 1JTYA 4BHBA 3CF5F 2EZLA 3HB9A 3MN2A 1WPKA 4DQ2A 5L3BA 4EGZA 1IXCA 3H5NA 1YJWI 4IKFA 4YG2F 5FO5A 1YHQI 4R8HA 1RNLA 1VFCA 1MMSA 4H4KC 3Q9VA 2W24A 4N0BA 4PUSA 2M4KA 2XIGA 2ZJPF 1R58A 5EZHA 1JT6A 4NHJA 1JKQC 2HOAA 1TTYA 2VC0A 2XAUA 4B4CA 1XCVA 3IP4B 2GXGA 3GFIA 4C3HJ 3MFKA 5A2QK 2VLAA 2VXZA 3QRFF 2XGCA 4B8XA 2K5CA 5CQEA 1STZA 2UXXA 3CCRI 3QPTA 3HSRA 1ZN2A 5DTDA 5FROA 3PFYA 2HVRA 4UXNA 1G4DA 3A01A 4UVAA 1FSEA 2Z1DA 1DP3A 3ZQHA 3E1SA 2FMYA 5ERIA 3GUDA 1IDZA 3RKXA 1B6AA 4F91B 4M9SA 4RAGA 1P92A 3A0BC 4MLOA 4PJLA 1TWAJ 5KAFC 1WJEA 4H0EA 3DKXA 4BHCA 1N25A 4M71A 1IN5A 1FIPA 3PIOF 4E7KA 3SQNA 3M3YJ 2ZXIA 2I10A 5HDNA 3VDXA 1OYWA 2DBBA 1OCCH 1Z7UA 1VQMI 4XLFA 5AONA 3TO6A 1FPQA 3IKVA 4CYCA 3RZOJ 2DK8A 3K4KA 2EV6A 3BR0A 5DM6F 1ZRFA 3CP8A 4M6XA 3WTZA 1GVDA 4V2GA 1FYMA 2MW8A 3UR3C 5FFXA 2L9NA 4BQAA 4MEXF 4MIMA 4R79A 5D5UB 1OCTC 1P7JA 2GIZA 2JQ7A 3ISPA 2ELHA 1UCRA 3OV8A 1Y0UA 4D7NA 4XIDA 4IQJA 4B1RA 3H5AA 5E17F 2QQAA 3HRMA 1HW1A 3DP7A 1OCOH 5HDGA 4LOCA 3DV8A 1FC3A 3MVPA 4OIPF 4XLCA 2UV1A 2GWRA 2JK3A 2Y31A 5M5XJ 2VOOA 1LE8A 1T2KA 1ZKGA 1HSJA 3WTUC 3I3LA 3ZPLA 1I3QJ 1POGA 1NHAA 2JA2A 2JVHA 1W7PD 3FM5A 3F8FA 1LEAA 3L1PA 2VBYA 1FWZA 3E3VA 1HBXG 3LSGA 3QOPA 5HS7A 2VL8A 2K9LA 1UJ8A 3CCEI 4ENNA 2OQGA 3OIQA 4CA0A 1ON2A 2HQRA 1OFCX 4CHUA 3DLAA 3KYLA 1H89C 3AKZA 2ID3A 4OU0A 4ZC3A 1J59A 2R5ZB 5KHDA 2O8XA 3BPVA 1FBUA 4BDYA 3F8CA 4RS8A 1YS6A 2KHMA 1XGNA 3LSTA 4DYRA 3VOEA 5BPDA 2DOAA 2VJJA 5ICCA 2AXTC 1W1WE 2DA1A 2RNGA 2MC4A 4BEHB 3ZOBA 1HF0A 2ZO4A 3MKWB 4ZYDA 1FNNA 2VJ5A 3CC4I 3LSRA 1HLVA 1B4AA 3RZDJ 2CQKA 4QLCU 3HGGA 3D0SA 4YFNF 2YX7A 2ZJQF 1G6NA 3RPUD 1GXPA 4KDPA 1T56A 3K70D 4AU7A 3MWMA 1R49A 4IPAA 2H8WA 5HDKA 3FBNB 1XTAA 3ONQA 3G1MA 1VQ8I 5HLTA 3H3UA 4DJAA 4RB3C 3L2CA 2DJNA 4AIKA 4FTHA 1ONVA 4V2FA 1RKWA 1W36C 1APLC 3EUHC 2JN6A 2FSWA 2CW0F 1UG0A 1X19A 4FX0A 4MHGA 1QPIA 2ZSIB 2XGEA 3V8LA 4S04A 4YFKF 3EDPA 5EF6A 4N4OB 2J5PA 1U5TB 2ME0A 2Y30A 4Y13A 1IJWC 5JVGF 3DBLB 1KYZA 2Q0OA 4V19K 3BOQA 1TL8A 5LEJA 3S16J 1RR8C 1IAWA 1MNDA 1BIBA 3ASNH 1X4OA 4UB8C 5HS8A 3AAFA 2PMHA 2GQQA 1XPXA 1NH3A 2LFBA 4E7ZA 3LSJA 5IT9Z 1JTXA 3S3OA 2CGPA 3JSPA 2MABA 2L7KA 3GXOA 1YJ9I 5BOXA 2EIMH 1K83J 4PJJA 2Z33A 2LR8A 1ZHFA 3H9JA 3LSMA 3N4MA 2H1KA 1D3YA 1FY7A 3WGHA 4HSRA 1UELB 1G3WA 2E35A 2Y48A 3DQVC 3PNYA 1KQ0A 3IKTA 5BS6A 1IDYA 4C2MJ 1MJBA 3C2BA 1P4WA 1R36A 3DU5A 3VEPA 2HPMA 1LJ9A 3Q9SA 1O4XA 3F23A 3CESA 1BJZA 1BC8C 1S29A 5DCMB 2A61A 4E7LA 1B72A 1ETWA 3IH3A 1FLIA 4OAYA 1I1SA 2ZMEA 1Z6RA 3TDZC 4C3JJ 3OY9A 1X1BA 1ZAOA 2F48A 3HZJA 3E97A 4B09A 5EG0B 4BS9A 2LOOA 2XF5A 5F1RA 2X6YA 2VQGA 3BG9A 4XBFA 4D5FA 2A5WA 2L54A 2VASA 5HOOA 1MD0A 3EUHA 1FSHA 3PNVA 1A6IA 3S14J 5E20A 1PP8F 4EM1A 3B73A 4ZYGA 4XK4A 3IUOA 2XF6A 4BYYA 5ED4A 2BE5F 2RREA 1XGSA 3K4CA 4NQWA 3KZZA 5HLHA 5ILSA 3TMOA 3S1MJ 3FMSA 3DTIA 4G7OF 1G8XA 2K7LA 4MNUA 1S6LA 2K4JA 3FBIB 3C3WA 2BXYA 3C7JA 2PX9A 4U0YA 3J7AO 4S0HB 1K7AA 2FX0A 4HW0A 4WX9A 2OAZA 1K4TA 1GLNA 5IYDJ 3A2KA 2CU7A 1AKHB 2CS3A 4A3IJ 2M0MA 2QEXI 2DT6A 3ZQFA 3A0HC 4GFBA 1I27A 3HRUA 2NVUB 1LDDA 1OMIA 4XRSA 5HODA 3SJMA 4PSWA 3FHNA 2NVYJ 2XASA 3HUGB 2LKXA 2CG4A 2X51A 3JRFA 3DKYA 3BZ6A 4U0VA 4A3EJ 4A0XA 1Y39A 1FZPB 1ZARA 2EZKA 1FT9A 4HLXA 4QPOA 3WG7H 4ZDOA 5EZGA 2WA0A 1YRNB 2QQ9A 4EJWA 4A3FJ 3G6EI 1WVRA 3KP3A 5LHGA 1X2MA 1XX5A 3QWLA 4HA8A 3W2AA 1NK3P 1BOBA 2V1NA 4ETSA 4UY8I 2D2WA 4PSXA 3KP4A 3HRTA 5HVQC 2IEKA 4HX4A 3H0GJ 1QO0D 1Y0NA 2WWYA 2Y9ZA 2YU9J 1YO5C 3EYYA 4XKBA 1E3PA 1FIAA 2WAQA 3JSOA 2P5KA 3ABKH 4EQQA 4XR6A 2AHQA 4JQFA 4NBQA 1K6OA 2DTRA 3GW2A 3KETA 4Y3OA 2G9WA 2RQQA 2W84A 5HNFA 1IRZA 4KA4A 4RGUA 4A3BJ 4ESJA 2IA1A 3FIWA 3KEQA 2B0LA 4OAZA 3FF5A 3CLQA 2HEOA 5FRMA 1XGOA 2BZTA 3JREA 2HDCA 3I4MJ 1BR1A 4ESBA 3HEFA 3Q5FA 2F5DA 1AU7A 3WTYC 2XGXA 2TDXA 3JAMZ 4ENMA 2NNNA 3V4GA 3BPXA 2JWTA 4JX4A 3EETA 4LITA 4XLNF 1VQKI 1ETXA 4A0YA 3VWBA 4HYEA 2BV6A 2M1BA 3MKZA 2R7SA 2BHZA 3CDIA 4XRMA 3OYKA 2M30A 2BHYA 2EA2A 2VBWA 3AG2H 2FE3A 1G59A 2R5YA 3T1BA 1ZH5A 1MNEA 5HLIA 3VYUB 2BY2A 2MD5A 4G9YA 3MAJA 3GCMA 1D0XA 3S93A 5D5XB 5EGOB 5GAGJ 4IQ4A 1VF9A 3P7NA 5CJ9A 4GYGA 3TL4X 3LQRA 3VSLA 4YIFA 2ZNYA 5F04A 1ORKA 1IN4A 4ZDLA 3E5XA 2KRFA 3ZGKA 1XC5A 3E5UA 1D1CA 3ULQB 1TBXA 5FRNA 4G94A 3MKLA 3J7AY 2XAQA 3I4NJ 2Y0SN 2L02A 1ZR2A 3P5JA 3TP3A 3WE2A 3BLYA 1TQPA 3ERED 1O3TA 1FTTA 5FLVA 3LOCA 6PAXA 3QQAA 2NNYA 2OTJI 1FX7A 1AHDP 2A68F 3HOYJ 2P7VB 3M7GA 5FLMJ 2IPQX 3PNTA 5D6EA 4X0GA 2R93J 3TDUC 5LHIA 3O8GA 3DBHB 1E0EA 2UZKA 3K4LA 1LEBA 2ECCA 4HPQA 1IV6A 5IT9K 3FDYA 1K78A 4RB2C 2JJ7A 3HHGA 1VQ7I 1D5VA 3OL3A 4M3BA 2DOEA 5IP6A 3I4PA 1QQIA 2BOLA 3OOUA 5IYBJ 5A2QZ 4E7HA 2ACJA 5B3SH 3BR5A 1JHFA 2STTA 2A05A 1W36D 1X1PA 3FXRA 4HG2A 5EEAA 3OYEA 3N05A 4MQ9F 3WTXC 4C2UA 4BQQA 3I54A 3IAS2 2YSRA 4MFEA 3QP5A 1MH4A 2OV7A 3TO7A 1QGPA 4BE0A 3EPZA 3G3ZA 1NG6A 2WTEA 3DPLC 2P6SA 3C1DA 2BEOA 2LVSA 1MSEC 2FA5A 2HYFA 3JRAA 3GFMA 2IA2A 3L2RA 3HOTA 4UNOA 3LQQA 4RAFA 2K27A 1S9HA 3ZQIA 4CCOA 4LG0A 5L3CA 1JXSA 3OYNA 3ABTA 2P0WA 3WE3A 2WY7Q 3I56I 1VTNC 3ECHA 1HOMA 2DQLA 1I3AA 2DYSH 1PUFA 2KJBA 4ZJZA 3L9FA 2VQCA 3K69A 4RDUA 3L09A 2WC2A 2IRFG 4LK0F 3O2PE 3HHHA 2QKLB 1AA7A 5ILVA 4A69C 4RB1A 4MGRA 2X1DA 4HF0A 4IRHA 2Q2EB 3HL2A 1GV5A 3U21A 2HU9A 2BVMA 3MEXA 5LHHA 1GV2A 3DLLF 4XICA 4Q4ZF 1EH7A 3IWFA 3HDDA 1MBHA 4QWQA 2LD5A 3JTGA 2PBIA 1FJLA 2MYSA 2L5QA 1P4XA 1BM9A 2KT0A 5JHFA 3FKIJ 1YITI 1D0ZA 2R7UA 2DA3A 3O3KA 5FFZA 5H2FC 4A12A 1B9MA 2ZXWH 5GTHC 2M7AA 3QPLA 3RYPA 5D5WB 3GX4X 3BJAA 5LGNA 2KMUA 4IOCF 3DU6A 1AWCA 1XMAA 2LYCA 3S32A 5KCMA 1I5ZA 3ZQ7A 1ZRDA 2E71A 2R7FA 3E0JB 3A02A 1W7PA 2K9MA 2CUFA 4HOBA 3VYRB 1F43A 3IWZA 4RM3A 5K1YA 3AFHA 3KLOA 1RIOH 1BA5A 2H09A 3S1RJ 4DW6A 3I64A 4Y7NJ 2HQNA 2Y9YA 3LSPA 5E79C 4JP0A 2KJCA 4LLLA 3TP0A 4M3GA 2B7EA 3SHFA 3M1EA 3KP7A 2O6GE 1TNTA 3EYIA 2PJRB 2R7ZJ 1SC7A 2QBYB 4RGXA 2JUCA 2ZCWA 2DQRA 1OQYA 4BQNA 3F22A 3VYTB 1GUUA 3FZVA 1ETQA 5E1XA 4AM3A 2IT0A 1SFXA 4KN7X 2L9RA 3CUQA 2DAOA 3GZNB 3GLLA 3W2VA 2XB5A 2DODA 2CQ7A 2BY0A 1U2WA 1LFBA 3RPUA 1FBSA 1HKSA 4XOTA 4EJTA 1SD7A 2EFPA 1Y8QB 1X1AA 1Z1DA 1Z91A 4K2EA 2LY2A 2DK5A 4HV5A 2H6BA 4FX4A 4IL6C 3MD2A 4IHVA 2AO9A 4LD5A 2K85A 1TWFJ 1X3ZB 1V5EA 1U8BA 1I39A 3JRBA 1QU3A 2E1CA 2BYVE 2GA1A 2W4SA 5K5QA 5EDNA 2L3DA 3A03A 3S15J 4IHWA 1IN8A 1Z05A 2LRDA 3HSEA 1UHWA 2LP0A 3E5QA 1RZ4A 4YELA 1FMWA 3K2AA 4AC0A 5IPAA 2WV1A 5E8IA 4D9JA 2H27A 1B8IB 5IY5H 4KFCA 2G7HA 2EFWA 2E7WA 1MDMA 1ETVA 2E60A 2JVGA 4IVNA 4GCVA 3CCMI 1ZQ3P 1W0TA 3PQJA 2FRHA 2AXLA 2KDZA 1S72I 5E1WA 3QU6A 2Z5UA 2UXNA 1RPWA 1WH7A 2CSOA 4BDZA 1VQPI 3OR2C 1BL0A 2FBHA 5FJ8J 3T8RA 2XRLA 2JRMA 1OYYA 3SDGA 3BZCA 1V5FA 2LKPA 2XV4S 2KRHA
chains in the Genus database with same CATH topology
1JT0A 2ME0A 2Y30A 1IJWC 3BR3A 2ECBA 1TWCJ 2DMQA 2PMZN 3S16J 2LLKA 1I6HJ 1ENHA 2VI6A 2LFBA 1T33A 5DS9A 3LSJA 4D7MA 1JTXA 1XS9A 3ZQGA 4FE4A 1K83J 5E3OA 2LR8A 1JUPA 3PO2J 2H1KA 3VPRA 2NOGA 2OPTA 2TRTA 1PUFB 3CDLA 1VNDA 3BTIA 4AUXA 1IDYA 4C2MJ 2DA2A 3C2BA 2R0QC 1U78A 1O4XA 3CCYA 1HDDC 1BJZA 1MSFC 3OSGA 3GTMJ 5C3EJ 1B72A 1ETWA 1S7EA 3IH3A 4IHXA 2VKEA 2FQ4A 4C3JJ 1QVTA 2E2IJ 2R92J 1JKRC 2E2JJ 2RAEA 3GTJJ 5EG0B 1ETOA 3HOWJ 1G2HA 2L7MP 2O8KA 4DZJA 2E1OA 4D5FA 3BG9A 4EEFG 2DMNA 3F0CA 2EZIA 2ZB9A 3A01B 3HOZJ 3FK6A 2EH3A 1A6IA 1WGXA 3S14J 3JRGA 2VPRA 5F0HA 2N8GA 2XB0X 3Q0WA 2EZHA 4XK4A 1TWHJ 3OIOA 3S2DJ 4BKXA 1ZTRA 5F0CA 3S1MJ 2DMPA 1JKOC 3S17J 3GBGA 3BT9A 4MO7A 4S0HB 2FX0A 1QVUA 1SANA 5FKOA 4DYQA 5K7HA 4QTRA 2HOSA 2DN0A 5IYDJ 4CYCB 2CU7A 2CUEA 1AKHB 1RESA 1EF4A 4A3IJ 3ZQFA 2NVTJ 4FE7A 4GFBA 2GBYA 1JJ6C 4XRSA 1WI3A 5HODA 1DU6A 3SJMA 2NVYJ 4M3EA 2LKXA 1ZK8A 1UHSA 1HCRA 3JRFA 2JA5J 4A3EJ 2EZKA 4AYBN 5IOYA 5GPCA 2VKVA 3ZQCA 1VI0A 2YUSA 2K40A 5EZGA 1YRNB 4A3MJ 2JA6J 4A3FJ 4DZPA 3HKZN 1FTZA 1X2MA 1NK3P 1Y1WJ 4D5CA 3PO3J 1IG7A 1LE8B 2IEKA 2CQXA 3B6AA 3H0GJ 4BXXJ 5M5YJ 1Z77A 2DMUA 3TW6A 1QRYA 2Y9ZA 2YU9J 4DYCA 1JJ8C 1FIAA 2G0EA 2QF7A 5IYCJ 2M9HA 2AHQA 5F27A 2DA4A 2XPUA 4A93J 4C3IJ 5F1JA 1RKTA 1IRZA 3G1OA 4A3BJ 1U9NA 3FIWA 1MBGA 4W97A 3JREA 5IP9J 1X58A 4BY1J 3I4MJ 3HEFA 4A3LJ 2DTZA 5E3NA 2ME6A 1AU7A 2QCOA 2ELKA 2P81A 3Q0VA 2EBIA 4M3DA 2M2EA 1BW5A 2JWTA 4JX4A 2DMTA 4UUSA 4JX5A 1ETXA 1MBFA 2MSYA 5F0FA 2XSDC 1IGNA 5FKLA 2XPVA 3JRDA 1DU0A 5GP9A 1OCPA 4XRMA 9ANTA 4B3AA 2M34A 1GT0C 2R5YA 3Q0UA 3S1NJ 1Y1VJ 3E7LA 2E2HJ 2IBDA 2MGQA 3FISA 2JA7J 5EGOB 4FCYA 1VF9A 2HYJA 4X6AJ 2FJ1A 5M3MJ 4M6VA 5F04A 1ORKA 1MBKA 1W0UA 5EYRA 5IP7J 1XC5A 5BNGA 1JGGA 3CQZJ 3W6VA 2R5ZA 4A3KJ 3ZQLA 5F08A 3MKLA 1Q1VA 3HGYA 3I4NJ 3PM1A 2Y0SN 2GLOA 1ZR2A 3TP3A 5JLWA 2HI3A 3GTOJ 3DEWA 1FTTA 5FLVA 3LOCA 3BQZA 3QQAA 3GTKJ 1F36A 3BTCA 3UKGA 1AHDP 4A3GJ 2NS7A 3HOVJ 4FISA 3HOYJ 1R9TJ 3DCFA 3S2HJ 1ETYA 3GTQJ 2K9QA 4QIWN 5FLMJ 2R93J 1B8IA 2DA7A 3S1QJ 1U9OA 3O8GA 2NVQJ 2DA6A 2ECCA 1IV6A 1TC3C 1RETA 5K7ZA 4IHYA 3GTPJ 2JJ7A 2XGDA 2Y2ZA 4M3BA 4QSHA 5IP6A 5GPAA 1H8AC 4BBRJ 3OOUA 5IYBJ 2L0KA 3BG3A 2X48A 3CMYA 3BR5A 2TCTA 4IEJA 4I76A 4HNVA 1HDPA 4A3DJ 1XG1A 4RBOA 3HM5A 5EEAA 1B72B 2IAIA 2GM4A 4X1EA 5J1YA 1IUFA 4MFEA 1I50J 4G12A 1MH4A 4JYKA 3BTLA 1UMQA 1P7IA 3JRIA 4I6ZA 1ZGWA 1D5YA 3JR9A 2K9SA 2LVSA 1Z0XA 2O7OA 3JRCA 3JRAA 1MSEC 1IC8A 2HXOA 2HQ5A 5J1UA 5C4XJ 2NS8A 3HBLA 3ZQIA 1RR7A 3G1LA 3O8HA 3BQYA 3BR6A 1JTYA 2EZLA 3HB9A 3MN2A 5IOZA 5C44J 1WPKA 2HOTA 2B63J 2HDDA 1HOMA 1VFCA 1PUFA 4RDUA 1MBEA 5J3LA 3WHBA 3Q3SA 1A5JA 1SFOJ 5EZHA 5E3LA 1JT6A 1MBJA 1JKQC 3M4OJ 2HOAA 4A69C 4B4CA 4BBSJ 1GV5A 1GDTA 3BR2A 1GV2A 4C3HJ 3HOUJ 3FK7A 4XICA 5EG0A 3HDDA 1MBHA 2XGCA 1CQTA 2CRGA 2E19A 3QPSA 5DTDA 2LD5A 5E3MA 2XPWA 1FJLA 3A01A 2KT0A 3NARA 3FKIJ 2W48A 4M3FA 1K61A 3ZQHA 2VUMJ 2DA3A 1IDZA 4Y52J 2LK2A 2M8GX 4MLOA 3QPLA 3WHCA 1TWGJ 1TWAJ 2WB1N 1H88C 2DA5A 1FIPA 1UG2A 2D5VA 2JA8J 2H8RA 5M3FJ 3M3YJ 2YS9A 5FKMA 2I10A 3BR1A 3A02A 1F43A 2CUFA 4CYCA 3RZOJ 1AKHA 1BA5A 3BR0A 4JX6A 1MNMC 3S1RJ 4NDLA 4DW6A 2X6OA 4Y7NJ 1GVDA 1ZR4A 2Y9YA 3LSPA 4JP0A 3TP0A 4V2GA 3SFIA 4M3GA 2MW8A 4MIMA 1OCTC 1P7JA 1FEXA 2R7ZJ 1YRNA 4D7NA 5J1RA 4XIDA 2CQQA 4B1RA 4UUSB 1LFUP 1GUUA 3LNQA 1ETQA 4LOCA 3NAUA 3MVPA 1ITYA 4UUTA 3RQIA 2Y31A 5M5XJ 2JK3A 3TEDA 2L9RA 1LE8A 2R5YB 2NVXJ 1ZKGA 1WCMJ 1I3QJ 1MH3A 1POGA 3GTGJ 2XB5A 5FKNA 2O9LA 3IV5A 3L1PA 3IH2A 3LSGA 4A3JJ 1LFBA 4ABZA 1JUMA 1NK2P 1OFCX 3IH4A 1H89C 2ID3A 3JRHA 4J19A 3GTLJ 3BG5A 2K9NA 2LTPA 4MFDA 2R5ZB 4IHVA 2AO9A 4L5EA 1TWFJ 3BTJA 2CJJA 2L7FP 1U8BA 3JRBA 4DYRA 1X2NA 2MG4A 5EDNA 3S15J 3A03A 4IHWA 2DA1A 2LP0A 3K2AA 3ZOBA 4AC0A 3H3VK 1HF0A 5IPAA 5M5WJ 3OSFA 4A3CJ 2WV1A 3RKQA 1WH5A 2ID6A 4W1UA 1NTCA 5C4JJ 3LSRA 2JMWA 1HLVA 3RZDJ 1B8IB 2WAQN 3HGGA 3K7AJ 1BW6A 5FKKA 3TW7A 1JUSA 1ETVA 1T56A 1ZQ3P 2EQRA 2OF7A 2X9DA 1W0TA 5EGOA 1E3OC 3HOXJ 5K7FA 3G1MA 4XRSG 5JLXA 2COBA 1ETKA 2KDZA 2M0CA 2HXIA 2LY9A 1OJLA 1RPWA 3B6CA 1WH7A 1JKPC 2DJNA 2L7ZA 4FTHA 1BL0A 4V2FA 1RKWA 5FJ8J 1APLC 4BY7J 2JN6A 2XRLA 3SDGA 1QPIA 2FD5A 3D1NI 2XGEA 5EF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT0 A;  2ME0 A;  2Y30 A;  1IJW C;  3BR3 A;  2ECB A;  1TWC J;  2DMQ A;  2PMZ N;  3S16 J;  2LLK A;  1I6H J;  1ENH A;  2VI6 A;  2LFB A;  1T33 A;  5DS9 A;  3LSJ A;  4D7M A;  1JTX A;  1XS9 A;  3ZQG A;  4FE4 A;  1K83 J;  5E3O A;  2LR8 A;  1JUP A;  3PO2 J;  2H1K A;  3VPR A;  2NOG A;  2OPT A;  2TRT A;  1PUF B;  3CDL A;  1VND A;  3BTI A;  4AUX A;  1IDY A;  4C2M J;  2DA2 A;  3C2B A;  2R0Q C;  1U78 A;  1O4X A;  3CCY A;  1HDD C;  1BJZ A;  1MSF C;  3OSG A;  3GTM J;  5C3E J;  1B72 A;  1ETW A;  1S7E A;  3IH3 A;  4IHX A;  2VKE A;  2FQ4 A;  4C3J J;  1QVT A;  2E2I J;  2R92 J;  1JKR C;  2E2J J;  2RAE A;  3GTJ J;  5EG0 B;  1ETO A;  3HOW J;  1G2H A;  2L7M P;  2O8K A;  4DZJ A;  2E1O A;  4D5F A;  3BG9 A;  4EEF G;  2DMN A;  3F0C A;  2EZI A;  2ZB9 A;  3A01 B;  3HOZ J;  3FK6 A;  2EH3 A;  1A6I A;  1WGX A;  3S14 J;  3JRG A;  2VPR A;  5F0H A;  2N8G A;  2XB0 X;  3Q0W A;  2EZH A;  4XK4 A;  1TWH J;  3OIO A;  3S2D J;  4BKX A;  1ZTR A;  5F0C A;  3S1M J;  2DMP A;  1JKO C;  3S17 J;  3GBG A;  3BT9 A;  4MO7 A;  4S0H B;  2FX0 A;  1QVU A;  1SAN A;  5FKO A;  4DYQ A;  5K7H A;  4QTR A;  2HOS A;  2DN0 A;  5IYD J;  4CYC B;  2CU7 A;  2CUE A;  1AKH B;  1RES A;  1EF4 A;  4A3I J;  3ZQF A;  2NVT J;  4FE7 A;  4GFB A;  2GBY A;  1JJ6 C;  4XRS A;  1WI3 A;  5HOD A;  1DU6 A;  3SJM A;  2NVY J;  4M3E A;  2LKX A;  1ZK8 A;  1UHS A;  1HCR A;  3JRF A;  2JA5 J;  4A3E J;  2EZK A;  4AYB N;  5IOY A;  5GPC A;  2VKV A;  3ZQC A;  1VI0 A;  2YUS A;  2K40 A;  5EZG A;  1YRN B;  4A3M J;  2JA6 J;  4A3F J;  4DZP A;  3HKZ N;  1FTZ A;  1X2M A;  1NK3 P;  1Y1W J;  4D5C A;  3PO3 J;  1IG7 A;  1LE8 B;  2IEK A;  2CQX A;  3B6A A;  3H0G J;  4BXX J;  5M5Y J;  1Z77 A;  2DMU A;  3TW6 A;  1QRY A;  2Y9Z A;  2YU9 J;  4DYC A;  1JJ8 C;  1FIA A;  2G0E A;  2QF7 A;  5IYC J;  2M9H A;  2AHQ A;  5F27 A;  2DA4 A;  2XPU A;  4A93 J;  4C3I J;  5F1J A;  1RKT A;  1IRZ A;  3G1O A;  4A3B J;  1U9N A;  3FIW A;  1MBG A;  4W97 A;  3JRE A;  5IP9 J;  1X58 A;  4BY1 J;  3I4M J;  3HEF A;  4A3L J;  2DTZ A;  5E3N A;  2ME6 A;  1AU7 A;  2QCO A;  2ELK A;  2P81 A;  3Q0V A;  2EBI A;  4M3D A;  2M2E A;  1BW5 A;  2JWT A;  4JX4 A;  2DMT A;  4UUS A;  4JX5 A;  1ETX A;  1MBF A;  2MSY A;  5F0F A;  2XSD C;  1IGN A;  5FKL A;  2XPV A;  3JRD A;  1DU0 A;  5GP9 A;  1OCP A;  4XRM A;  9ANT A;  4B3A A;  2M34 A;  1GT0 C;  2R5Y A;  3Q0U A;  3S1N J;  1Y1V J;  3E7L A;  2E2H J;  2IBD A;  2MGQ A;  3FIS A;  2JA7 J;  5EGO B;  4FCY A;  1VF9 A;  2HYJ A;  4X6A J;  2FJ1 A;  5M3M J;  4M6V A;  5F04 A;  1ORK A;  1MBK A;  1W0U A;  5EYR A;  5IP7 J;  1XC5 A;  5BNG A;  1JGG A;  3CQZ J;  3W6V A;  2R5Z A;  4A3K J;  3ZQL A;  5F08 A;  3MKL A;  1Q1V A;  3HGY A;  3I4N J;  3PM1 A;  2Y0S N;  2GLO A;  1ZR2 A;  3TP3 A;  5JLW A;  2HI3 A;  3GTO J;  3DEW A;  1FTT A;  5FLV A;  3LOC A;  3BQZ A;  3QQA A;  3GTK J;  1F36 A;  3BTC A;  3UKG A;  1AHD P;  4A3G J;  2NS7 A;  3HOV J;  4FIS A;  3HOY J;  1R9T J;  3DCF A;  3S2H J;  1ETY A;  3GTQ J;  2K9Q A;  4QIW N;  5FLM J;  2R93 J;  1B8I A;  2DA7 A;  3S1Q J;  1U9O A;  3O8G A;  2NVQ J;  2DA6 A;  2ECC A;  1IV6 A;  1TC3 C;  1RET A;  5K7Z A;  4IHY A;  3GTP J;  2JJ7 A;  2XGD A;  2Y2Z A;  4M3B A;  4QSH A;  5IP6 A;  5GPA A;  1H8A C;  4BBR J;  3OOU A;  5IYB J;  2L0K A;  3BG3 A;  2X48 A;  3CMY A;  3BR5 A;  2TCT A;  4IEJ A;  4I76 A;  4HNV A;  1HDP A;  4A3D J;  1XG1 A;  4RBO A;  3HM5 A;  5EEA A;  1B72 B;  2IAI A;  2GM4 A;  4X1E A;  5J1Y A;  1IUF A;  4MFE A;  1I50 J;  4G12 A;  1MH4 A;  4JYK A;  3BTL A;  1UMQ A;  1P7I A;  3JRI A;  4I6Z A;  1ZGW A;  1D5Y A;  3JR9 A;  2K9S A;  2LVS A;  1Z0X A;  2O7O A;  3JRC A;  3JRA A;  1MSE C;  1IC8 A;  2HXO A;  2HQ5 A;  5J1U A;  5C4X J;  2NS8 A;  3HBL A;  3ZQI A;  1RR7 A;  3G1L A;  3O8H A;  3BQY A;  3BR6 A;  1JTY A;  2EZL A;  3HB9 A;  3MN2 A;  5IOZ A;  5C44 J;  1WPK A;  2HOT A;  2B63 J;  2HDD A;  1HOM A;  1VFC A;  1PUF A;  4RDU A;  1MBE A;  5J3L A;  3WHB A;  3Q3S A;  1A5J A;  1SFO J;  5EZH A;  5E3L A;  1JT6 A;  1MBJ A;  1JKQ C;  3M4O J;  2HOA A;  4A69 C;  4B4C A;  4BBS J;  1GV5 A;  1GDT A;  3BR2 A;  1GV2 A;  4C3H J;  3HOU J;  3FK7 A;  4XIC A;  5EG0 A;  3HDD A;  1MBH A;  2XGC A;  1CQT A;  2CRG A;  2E19 A;  3QPS A;  5DTD A;  2LD5 A;  5E3M A;  2XPW A;  1FJL A;  3A01 A;  2KT0 A;  3NAR A;  3FKI J;  2W48 A;  4M3F A;  1K61 A;  3ZQH A;  2VUM J;  2DA3 A;  1IDZ A;  4Y52 J;  2LK2 A;  2M8G X;  4MLO A;  3QPL A;  3WHC A;  1TWG J;  1TWA J;  2WB1 N;  1H88 C;  2DA5 A;  1FIP A;  1UG2 A;  2D5V A;  2JA8 J;  2H8R A;  5M3F J;  3M3Y J;  2YS9 A;  5FKM A;  2I10 A;  3BR1 A;  3A02 A;  1F43 A;  2CUF A;  4CYC A;  3RZO J;  1AKH A;  1BA5 A;  3BR0 A;  4JX6 A;  1MNM C;  3S1R J;  4NDL A;  4DW6 A;  2X6O A;  4Y7N J;  1GVD A;  1ZR4 A;  2Y9Y A;  3LSP A;  4JP0 A;  3TP0 A;  4V2G A;  3SFI A;  4M3G A;  2MW8 A;  4MIM A;  1OCT C;  1P7J A;  1FEX A;  2R7Z J;  1YRN A;  4D7N A;  5J1R A;  4XID A;  2CQQ A;  4B1R A;  4UUS B;  1LFU P;  1GUU A;  3LNQ A;  1ETQ A;  4LOC A;  3NAU A;  3MVP A;  1ITY A;  4UUT A;  3RQI A;  2Y31 A;  5M5X J;  2JK3 A;  3TED A;  2L9R A;  1LE8 A;  2R5Y B;  2NVX J;  1ZKG A;  1WCM J;  1I3Q J;  1MH3 A;  1POG A;  3GTG J;  2XB5 A;  5FKN A;  2O9L A;  3IV5 A;  3L1P A;  3IH2 A;  3LSG A;  4A3J J;  1LFB A;  4ABZ A;  1JUM A;  1NK2 P;  1OFC X;  3IH4 A;  1H89 C;  2ID3 A;  3JRH A;  4J19 A;  3GTL J;  3BG5 A;  2K9N A;  2LTP A;  4MFD A;  2R5Z B;  4IHV A;  2AO9 A;  4L5E A;  1TWF J;  3BTJ A;  2CJJ A;  2L7F P;  1U8B A;  3JRB A;  4DYR A;  1X2N A;  2MG4 A;  5EDN A;  3S15 J;  3A03 A;  4IHW A;  2DA1 A;  2LP0 A;  3K2A A;  3ZOB A;  4AC0 A;  3H3V K;  1HF0 A;  5IPA A;  5M5W J;  3OSF A;  4A3C J;  2WV1 A;  3RKQ A;  1WH5 A;  2ID6 A;  4W1U A;  1NTC A;  5C4J J;  3LSR A;  2JMW A;  1HLV A;  3RZD J;  1B8I B;  2WAQ N;  3HGG A;  3K7A J;  1BW6 A;  5FKK A;  3TW7 A;  1JUS A;  1ETV A;  1T56 A;  1ZQ3 P;  2EQR A;  2OF7 A;  2X9D A;  1W0T A;  5EGO A;  1E3O C;  3HOX J;  5K7F A;  3G1M A;  4XRS G;  5JLX A;  2COB A;  1ETK A;  2KDZ A;  2M0C A;  2HXI A;  2LY9 A;  1OJL A;  1RPW A;  3B6C A;  1WH7 A;  1JKP C;  2DJN A;  2L7Z A;  4FTH A;  1BL0 A;  4V2F A;  1RKW A;  5FJ8 J;  1APL C;  4BY7 J;  2JN6 A;  2XRL A;  3SDG A;  1QPI A;  2FD5 A;  3D1N I;  2XGE A;  5EF6 A; 
#chains in the Genus database with same CATH topology
 1JT0 A;  1WI9 A;  4WXC A;  2KIF A;  1BR4 A;  1S7A A;  4KT6 A;  2J5O A;  3ZMS A;  5L3F A;  2PMZ N;  2X85 A;  2M4G A;  4ZZL A;  5B5E C;  2LLK A;  3IRR A;  1A6Q A;  4CYD A;  1A36 A;  4E4H A;  3PQK A;  4PK4 A;  3RPQ A;  4IXA A;  1T33 A;  2FUG 2;  4YEJ A;  3FXQ A;  2LMD A;  3RTR A;  4PZJ A;  4FE4 A;  4OIO F;  1JUP A;  2PMZ A;  1VQ5 I;  2NOG A;  2FOK A;  2TRT A;  2XAF A;  1Z3Y A;  2OUM A;  5DCF A;  2MFZ A;  2V79 A;  4L9T A;  2HZD A;  3BTI A;  3D5S C;  1Z67 A;  1YTY A;  2DA2 A;  3C2G A;  1WJB A;  3CCY A;  4RLF A;  1U5T C;  4OIQ F;  5D8K B;  4PGG A;  2XUB A;  3U1K A;  4IHX A;  1DPU A;  4HV6 A;  5BMZ A;  4LIU A;  5CYV A;  1JKR C;  1BI1 A;  4FT8 A;  4UVC A;  2GXA A;  3ROU A;  4F55 A;  2V6E A;  2L7M P;  2O8K A;  4ZZD A;  2QEN A;  2EPF A;  5HS9 A;  3CO7 C;  3G71 I;  4KUM A;  2ZB9 A;  4XSX F;  2FBI A;  3A01 B;  4IX7 A;  3FK6 A;  2EH3 A;  1XMX A;  3EUA A;  1CGP A;  3K1M A;  2ZFU A;  5F0H A;  1UHM A;  3GME A;  5JHU A;  2XB0 X;  2EZH A;  3QPH A;  4BJ5 C;  5EJC A;  5H20 A;  1SVM A;  1ZLK A;  3S2D J;  5J8F A;  1QA6 A;  4HDV A;  4BKX A;  2FQ3 A;  3HRS A;  5DV5 A;  3BZK A;  4M6Y A;  3S17 J;  4U0W A;  4MO7 A;  1R5I D;  1D8J A;  2PMU A;  4BQO A;  3B02 A;  2Z9O A;  5DD8 A;  1QVU A;  4PFP A;  2DFF A;  2HKX A;  5FKO A;  3M8F A;  4QTR A;  4CYC B;  4TV7 A;  4Y33 A;  1J75 A;  1EF4 A;  1QZE A;  2HVS A;  1X1D A;  1DQU A;  2IGO A;  5KNL A;  1WI3 A;  1UHS A;  2PG4 A;  4KT5 C;  1BR2 A;  4D0P A;  3CF2 A;  3KEO A;  5IOY A;  3OS1 A;  5JR3 A;  2O61 A;  3ZQC A;  3KYD B;  1L3L A;  2LRE A;  4A3M J;  2JA6 J;  5KK1 A;  3HJE A;  1Y8R B;  3BJ6 A;  2DYR H;  1J5Y A;  1QBJ A;  3PJR A;  2BGC A;  3CTA A;  2EIJ H;  2X1C A;  3G4S I;  1LE8 B;  5BQT A;  3B6A A;  4BXX J;  2QSH X;  1Z77 A;  2DO7 A;  2OD5 A;  1QRY A;  2GOX B;  2EB7 A;  4O5V A;  4GGG A;  4LGW A;  2VON A;  1OPC A;  1BN5 A;  2M9H A;  5IYC J;  3DPU A;  2MH2 A;  3W6J B;  4IOA F;  2FOW A;  2R7D A;  4BE2 A;  3OYC A;  5F27 A;  1R00 A;  2XPU A;  4M72 A;  4A93 J;  1SFU A;  5J4V A;  3OR1 C;  3CD6 I;  1YX3 A;  1U9N A;  3ESW B;  4XN0 A;  2IS6 A;  1J09 A;  5K5O A;  2RC4 A;  2DOF A;  4GRI A;  4B47 A;  4IHT A;  4HEA 2;  3ML6 A;  1CF7 A;  3OMY A;  3K1P A;  5CVV A;  4BL0 B;  1DGR M;  1MMN A;  2V7F A;  3DTK A;  5E3N A;  3RJP A;  2EFQ A;  1B59 A;  4NUB A;  3G2B A;  2A5Y B;  4BHP A;  1SAX A;  2OA4 A;  1BW5 A;  2V6C A;  2DMT A;  4UUS A;  3IL2 A;  4JX5 A;  3LL7 A;  4RLQ A;  4ENJ A;  2LNB A;  1Q1H A;  2KL4 A;  3GF2 A;  2XSD C;  5CPR B;  5FKL A;  1D1A A;  3ERM A;  3JRD A;  3O6B B;  2VB6 A;  2PLY A;  5GP9 A;  2R7V A;  3OIP A;  3RQ4 A;  1ULY A;  4B3A A;  4QPQ A;  3BCA A;  3VFZ A;  5ICF A;  3LMM A;  5D8L B;  3AL0 B;  2XRO A;  1F1Z A;  1ODD A;  3BDD A;  3E7L A;  3I59 A;  3ZCO A;  5JI6 A;  2HR3 A;  3OWT A;  1IN7 A;  1LUJ B;  2MGQ A;  4C30 A;  4FCY A;  2HYJ A;  3WU2 C;  2CV1 A;  2BVL A;  2QYO A;  4O3M A;  2HTJ A;  2P8T A;  2IVM A;  4M6V A;  3V7R A;  5D4S A;  1MBK A;  1W0U A;  4PJ0 C;  1SD4 A;  4WCG A;  3K10 A;  3K1N A;  5BNG A;  1JGG A;  3NEU A;  2NOJ B;  5KAI C;  1Y6I A;  3ZQL A;  1O57 A;  3FXL A;  3HGY A;  3PM1 A;  3E6C C;  4KIG A;  2D45 A;  4Y17 A;  2DU9 A;  5FGM A;  3OS2 A;  2O03 A;  4M73 A;  3BQZ A;  3TO9 A;  2KRC A;  3BTC A;  3UKG A;  4BNC A;  4FIS A;  1KON A;  3DCF A;  4XN3 A;  1ETY A;  3GTQ J;  1E3H A;  4XLA A;  1QZZ A;  3L2U A;  5LFA A;  4UB6 C;  4NNJ A;  4IF4 A;  2MBF A;  4KIT B;  2NVQ J;  1P6R A;  2DA6 A;  1JGS A;  1O7L A;  4HX7 A;  3H36 A;  1LPQ A;  2EV0 A;  2W85 A;  2COM A;  2Y2Z A;  4QSH A;  3KLN A;  1RI7 A;  5GPA A;  1RRJ A;  1N78 A;  2A69 F;  3RI4 A;  2E5Z A;  2DDB A;  4HNV A;  3S8P A;  1HDP A;  2EFO A;  2EJR A;  4RGR A;  2ETH A;  4RBO A;  3ZMZ A;  4IRG A;  4RGS A;  1R5H A;  2HKO A;  2IAI A;  1B72 B;  2GM4 A;  3REO A;  2I8D A;  2R3S A;  5J1Y A;  3K4B A;  2VOP A;  2ZME B;  1IUF A;  1YOV B;  3WGI A;  4G12 A;  3BTL A;  4L0Y B;  1V4R A;  4KMF A;  3DXJ F;  2HYG D;  2Z16 A;  3JRI A;  3ABL H;  1XSX A;  4RM2 A;  1XD7 A;  1ZGW A;  1D5Y A;  3JR9 A;  2VKD A;  4ENK A;  2K9S A;  1ZRC A;  5CLS A;  2I5U A;  4GXO A;  4PJM A;  3JRC A;  3NRV A;  4YII A;  1IC8 A;  2HQ5 A;  4M9Z A;  1MKM A;  3FHZ A;  3D5R C;  5J6X A;  2NS8 A;  4XKC A;  1YW7 A;  3MZY A;  2ESH A;  1TQM A;  2MH9 A;  3GVA A;  2NXN B;  3PUF A;  2IGM A;  1HW2 A;  3BC8 A;  1KU7 A;  3RSN A;  5TRD A;  1X4P A;  1DPR A;  5BPI A;  4F93 B;  2MLK A;  3LFU A;  4N4N B;  2LC2 A;  3KP6 A;  2YR2 A;  4NQW B;  2HOT A;  2B63 J;  2HDD A;  4KYW A;  1TQI A;  5DD4 A;  3PFI A;  2BW3 A;  2V1D A;  3OYJ A;  1YW8 A;  5TJJ A;  1MBE A;  5J3L A;  2R4G A;  2WAF A;  4AIJ A;  3OL4 A;  3RKY A;  4U7D A;  1TNS A;  2P5V A;  3FKJ A;  3M4O J;  3GEZ A;  3V7C A;  1V3F A;  1YFH A;  4MTD A;  3HIF A;  3CCU I;  1GDT A;  1MGT A;  3BR2 A;  5AIQ A;  3U2R A;  4U87 A;  4BJ6 C;  4CO8 A;  2F5F A;  1OYI A;  3VB2 A;  2E19 A;  2ZSH B;  3I71 A;  3QPS A;  2IS1 A;  3GO5 A;  5H6Q A;  1LKX A;  3IHU A;  2XPW A;  3DF8 A;  1W4M A;  5CVI A;  2W48 A;  4Y15 A;  2V26 A;  2VN2 A;  2EIK H;  2KLO A;  2WBM A;  2LBF A;  5J47 A;  3M9A A;  2LK2 A;  2M8G X;  3SZG A;  3PUB A;  1TWG J;  3WHC A;  4EM0 B;  2WV0 A;  3KP5 A;  2P5L C;  5EEG A;  3WTT C;  4AIH A;  2DA5 A;  1UG2 A;  2KIQ A;  5AIP A;  2H8R A;  2JA8 J;  1DDN A;  1KZH A;  1UZC A;  4G6Q A;  4I01 A;  5M3F J;  2CFX A;  3QAH A;  2YS9 A;  5FKM A;  4HQE A;  2HDW A;  1O3Q A;  1HKQ A;  1M1E B;  3BR1 A;  2E1M C;  1IF1 A;  1MJA A;  4E7S A;  3CO6 C;  4I09 A;  4JX6 A;  3RKW A;  2PN6 A;  2F6C A;  2X6O A;  1ZR4 A;  2DPU A;  2ADU A;  4XLE A;  3SFI A;  1GHC A;  2BXZ A;  4Q48 A;  1XGM A;  1G3Y A;  1R7J A;  2IS4 A;  3HC7 A;  3IAM 2;  3SZP A;  1FEX A;  4Y4R A;  4XOP A;  4EVI A;  4L9J A;  2VQL A;  4AID A;  3J80 Z;  2A6H F;  2CQQ A;  2Y0S A;  3DPT A;  1A31 A;  1MJ9 A;  4ZTJ A;  3LNQ A;  2GAU A;  4HBL A;  4HZF A;  3I0T A;  2QZ8 A;  4ASN A;  1IO2 A;  5CVR A;  4DNC A;  3RQI A;  1WJ5 A;  3CJR B;  1FOK A;  3WTS C;  3AG4 H;  2R5Y B;  3H9Q A;  4EGY A;  4RAZ A;  1ZRE A;  3GTG J;  5FKN A;  2O9L A;  4XMY A;  3RYR A;  1A35 A;  2ISY A;  3IV5 A;  1EA3 A;  4F52 A;  4A3J J;  4E7J A;  2CWE A;  1JUM A;  1NK2 P;  1SVL A;  5DYM A;  2UWM A;  1OR7 C;  3IH4 A;  1IRX A;  4BAC A;  3GTL J;  5CVU A;  2V9K A;  3D5L A;  2K9N A;  2P7C B;  3K9T A;  2L4M A;  4KJZ A;  3X2Q H;  4DOZ A;  4MFD A;  2FML A;  3TQN A;  3KE2 A;  2VJ4 A;  2NYX A;  4BXF A;  3BTJ A;  3DWL E;  2L7F P;  3LAP A;  3MMY B;  5LGU A;  3WGG A;  3BRO A;  4L5I A;  2W00 A;  2PJP A;  2W82 A;  3K4N A;  1ZYR F;  5FLX Z;  3H3V K;  5M5W J;  3OSF A;  4A3C J;  3RKQ A;  3HTS B;  1WH5 A;  2E7X A;  1EKE A;  1HW5 A;  2ID6 A;  2B9S A;  2VPL A;  1NTC A;  3FXJ A;  2K3P A;  2KZV A;  5C4J J;  1KQ9 A;  2XVC A;  4M74 A;  1ON1 A;  4LB6 B;  1ZG3 A;  2QSG X;  3K7A J;  4P5O A;  2C6Y A;  1BW6 A;  2IGN A;  2L9V A;  5FKK A;  2M45 A;  2QGU A;  3TW7 A;  1SMT A;  2K4B A;  1KA8 A;  2X9D A;  1K78 B;  1E3O C;  4OMY A;  5K7F A;  3K6G A;  5JLX A;  1LDK B;  3TOB A;  3CC7 I;  1ETK A;  2M0C A;  3S2W A;  3QP6 A;  2HXI A;  2V9V A;  1OJL A;  2PEX A;  4XSZ F;  3B6C A;  3E6B A;  4XKV A;  3F6O A;  3PSI A;  4B43 A;  1VQN I;  4JBA A;  4KIC A;  2W25 A;  4KIB A;  2VXD A;  4BY7 J;  2HVQ A;  1QHG A;  1YI2 I;  2FBK A;  3KFW X;  2ICW G;  2OBP A;  3D1N I;  3OYI A;  1OIS A;  2VBZ A;  4BGD A;  5LLQ A;  1WQ2 A;  1HC8 A;  4A0Z A;  3BJO A;  3TBI A;  4L18 B;  3QU3 A;  2V1X A;  1OR7 A;  2ECB A;  2IS2 A;  4KIS A;  3M1C A;  4IJA A;  3WOD F;  3ZMD A;  2OCE A;  3KZY A;  2E34 A;  1I6H J;  1JHH A;  1IV8 A;  1DUX C;  4MTE A;  1XMK A;  3F72 A;  2VI6 A;  2V1U A;  4LG0 B;  4D7M A;  1ZGA A;  5LEK A;  3WTV C;  2ZJ2 A;  2XDV A;  1T08 B;  3P9K A;  1XS9 A;  1UFM A;  4KN4 X;  1ACI A;  3ZQG A;  3SEZ A;  4DIQ A;  5E3O A;  4NC6 A;  3VPR A;  3FXO A;  3EQL F;  4A6D A;  1PUF B;  2KIS A;  5B1B H;  2JPB A;  5LGT A;  1OCR H;  3U9G A;  4AUX A;  2R0Q C;  2FEZ A;  1U78 A;  4EM2 A;  3OS0 A;  4IZZ A;  5L3E A;  1HDD C;  1TW2 A;  2A07 F;  1WKM A;  1EJ9 A;  2M5W A;  1VQ6 I;  2ZC2 A;  2RVC A;  2MC3 A;  2Q1Z B;  2CW7 A;  2Z3Y A;  4HQM A;  1P9Q C;  3L2Q A;  2E2I J;  3P9I A;  4I98 B;  2E2J J;  1BOA A;  2CO5 A;  2RAE A;  1MW7 A;  4BUP A;  1BI0 A;  3I53 A;  1B1B A;  2H94 A;  1ETO A;  5K5R A;  4G7Z F;  1G2H A;  1WZ2 A;  2F5V A;  1TW3 A;  2VT3 A;  4Z2Y A;  5DM7 F;  3F0C A;  1P4A A;  1S5L C;  4LMY A;  2WY8 Q;  3ABM H;  5J4Y A;  3OOP A;  3I5U A;  1WGX A;  1Z6T A;  2VT2 A;  3JRG A;  2VPR A;  3Q0W A;  3S3M A;  1FOW A;  1TWH J;  2JRT A;  4E70 A;  3OIO A;  4G6D A;  3PL8 A;  1BJA A;  1ZTR A;  5F0C A;  1HST A;  1K6Y A;  2DMP A;  4L5J A;  4F7Z A;  1JKO C;  2X0L A;  4FAS D;  1WJA A;  1LVK A;  2XF7 A;  2XAG A;  3MKY B;  1D1B A;  3GBG A;  1VQ4 I;  3GLX A;  3BG6 A;  3PSF A;  4CSW A;  3GZ5 A;  3KYC B;  4BE1 A;  1RC9 A;  1J0R A;  2OQR A;  5KVR A;  3KIO A;  4DYQ A;  5K7H A;  1W7P B;  2JSP A;  2YU3 A;  2CUE A;  1P2F A;  5DUK A;  5L3G A;  3VOD A;  4P96 A;  2DFE A;  2NVT J;  4FE7 A;  1SD5 A;  2GBY A;  2M7B A;  5DUI A;  2R7X A;  4M3E A;  3BY6 A;  1A04 A;  1XN7 A;  1ZK8 A;  3W2W A;  2ESN A;  2X4H A;  4ESF A;  5D5V B;  4AYB N;  5GPC A;  1VI0 A;  2K40 A;  3CCS I;  4DZP A;  3HKZ N;  1FTZ A;  3ZN0 A;  3J80 K;  4E7I A;  2KFD A;  3H35 A;  4CH7 A;  1RUN A;  3PO3 J;  4BH9 A;  4U7B A;  2A6T A;  2X1E A;  2XAJ A;  3CJQ B;  3V42 A;  1IG7 A;  2D1H A;  2GIV A;  3SFZ A;  3CUQ B;  3W6K B;  2RKH A;  4CZC A;  4AYB A;  5M5Y J;  3CCQ I;  2EV5 A;  4PDK A;  1EH8 A;  2HTS A;  4DYC A;  3QOD A;  4WWC A;  1JJ8 C;  1ZG1 A;  2G0E A;  2QF7 A;  2O3F A;  2OJE D;  3HKZ A;  5E1Z B;  3OYM A;  1WJD A;  1VQ9 I;  4A6E A;  3L7W A;  1JI8 A;  2X6W A;  4C3I J;  2PFB A;  1RKT A;  1F4K A;  3J81 Z;  1H9T A;  4I0B A;  2XKO A;  3QOE A;  1MBG A;  1J9I A;  4HF1 A;  2VOD A;  3ASO H;  4A3L J;  2DTZ A;  2OZU A;  1WHU A;  2ME6 A;  3OYD A;  4GYI A;  1KYW A;  4B44 A;  2QCO A;  2P81 A;  3Q0V A;  1V5G A;  2DPD A;  2QVO A;  4M3D A;  3SDB A;  2DI3 A;  3KZI C;  4N9I A;  3RDI A;  4HAM A;  4P9U A;  1MBF A;  2BY1 A;  1IGN A;  1SD6 A;  1MMA A;  4WK8 F;  3F8N A;  1C0W A;  4RB0 A;  5FLX K;  9ANT A;  2HNH A;  4BU2 A;  2HGC A;  4B3X A;  1FYK A;  1MDM B;  3VYS B;  1IZ1 A;  1UST A;  2R7T A;  3Q0U A;  1R23 A;  1Y1V J;  2E2H J;  2W57 A;  3BP8 A;  1S7O A;  1B9N A;  3FXK A;  2A6E F;  3ABU A;  2FJ1 A;  5M3M J;  5D4R A;  4J01 A;  1HXD A;  4UHT A;  5D6F A;  1SFE A;  5EYR A;  5LBQ A;  2VE9 A;  2DW4 A;  1MMG A;  1LNW A;  2L2O A;  1SMY F;  3GZ6 A;  2R5Z A;  3FM3 A;  2FF4 A;  4MEY F;  5F08 A;  2IW5 A;  3SXY A;  3AG3 H;  1Q1V A;  2QUF A;  1BIA A;  2XAH A;  2K86 A;  1MZB A;  1R1T A;  3TOA A;  3GTO J;  1D0Y A;  1XSV A;  3DEW A;  1T8I A;  4N9H A;  3GTK J;  2D1V A;  1F36 A;  3LSH A;  4I2O A;  5LD2 C;  1J7K A;  4A3G J;  2NS7 A;  3HOV J;  4BEH A;  2RDP A;  1U0J A;  3L2V A;  3AL0 C;  2K9Q A;  1G3T A;  4QIW N;  1BI2 A;  2KIM A;  4L9V A;  1IN6 A;  3R61 A;  4CDG A;  3FMQ A;  1IUY A;  3S1Q J;  1KGS A;  1U9O A;  1Z21 A;  2KP6 A;  1YJN I;  2F2E A;  4UVB A;  1X3W B;  4HNT A;  1LDJ A;  4CGZ A;  2F4I A;  2Z2S B;  2QQ8 A;  5K7Z A;  2FXA A;  2LSO A;  1H8A C;  2CMP A;  4BBR J;  3KPH A;  2FU4 A;  4XM3 A;  2L0K A;  3OYF A;  2KZG A;  2X48 A;  2XRN A;  3GYH X;  3S3N A;  3H92 A;  3F9K A;  2CUJ A;  2AS5 F;  1N75 A;  2R7Q A;  4IO9 F;  4EMS A;  5TGT A;  3HM5 A;  4PCQ A;  4X1E A;  4EAT A;  5JFR A;  3TKY A;  4WF2 A;  1I1G A;  1I50 J;  1T6S A;  4JYK A;  2IA0 A;  1QZY A;  1UMQ A;  1P7I A;  2M8E A;  1U5T A;  3F6V A;  2O5R A;  3LSI A;  4I6Z A;  2R7O A;  3N97 A;  2KQR A;  2MD0 A;  3CCL I;  1R1U A;  1TZL A;  1DP7 P;  1WRJ A;  1WJF A;  1Z0X A;  3BWG A;  2HXO A;  5C4X J;  3ZP5 A;  3HG9 A;  4HDU A;  2LY1 A;  3E6M A;  2AQF A;  3HBL A;  1N77 A;  3FXU A;  2ZXJ A;  2F5E A;  2HS5 A;  3CCV I;  2IJL A;  3SEQ A;  3BQY A;  4RMN A;  1YQA A;  2JTV A;  5IOZ A;  5C44 J;  2DFI A;  1IW7 F;  3KEY A;  3ZQQ A;  2PQ8 A;  2Y75 A;  3FX3 A;  3WHB A;  3Q3S A;  3ZR8 X;  1A5J A;  2ZME C;  1IRG A;  1SFO J;  1FOX A;  3MCZ A;  2V9P A;  5DEQ A;  5E3L A;  1MBJ A;  2HZT A;  1T38 A;  5DCM A;  1XDU A;  3OYB A;  4BBS J;  2EFN A;  1QPM A;  2DCE A;  1GVJ A;  4OIN F;  4CIC A;  3HOU J;  4G6T B;  3FK7 A;  5EG0 A;  4IHS A;  4OMZ A;  2ZFW A;  3KP2 A;  2CRG A;  1CQT A;  1YS7 A;  2RV8 A;  3M8J A;  3H5R A;  5E3M A;  2K02 A;  2LF7 A;  3NAR A;  4M3F A;  2IGK A;  1K61 A;  2VUM J;  4CUG A;  3EUK L;  3C18 A;  1NG7 A;  2VJI A;  2Y69 H;  2P4W A;  3ELK A;  3R4K A;  4LIV A;  3CMA I;  4Y52 J;  4ZYH A;  1R4N B;  4M9X A;  3NWS A;  2WB1 N;  1H88 C;  2JT1 A;  3F3X A;  5B66 C;  4C2T A;  2VIX A;  3I9V 2;  2D5V A;  2FNP A;  3L00 A;  3SZT A;  2BY3 A;  1XCB A;  3ZRG A;  4P55 A;  5L3D A;  4B48 A;  1O3R A;  5FD6 A;  3CZ6 A;  5LRR A;  3H3Z A;  3SYT A;  1MIJ A;  2GZW A;  2F5C A;  1REP C;  1AKH A;  2WB1 A;  1MNM C;  4HRI A;  4LG3 A;  4NDL A;  1TLH B;  2CH0 A;  1PJR A;  4J00 A;  3JW4 A;  1CF7 B;  3J81 K;  3HUG A;  1E2X A;  3W3C A;  1PVE A;  3QYF A;  1ZEL A;  3KX2 A;  4HLY A;  4EJV A;  4JK1 X;  4A5M A;  4G8X A;  1YRN A;  4WXD A;  3A1Y A;  5J1R A;  1S3J A;  3F8B A;  4ON0 A;  4UUS B;  1LFU P;  3DEU A;  2RQP A;  2ELJ A;  5GTI C;  1F5T A;  1E17 A;  1FMV A;  2EA4 A;  3NAU A;  2CFO A;  4L0Z B;  1ITY A;  4UUT A;  3P9C A;  2IP2 A;  3TED A;  1PYV A;  4FET A;  5TIS C;  4XRF A;  2NVX J;  1WCM J;  1MH3 A;  3I59 B;  5CVJ A;  4YIR X;  1W5C C;  1YG2 A;  3NWT A;  4EJO A;  2NAZ A;  3LWF A;  4XLP F;  4HNU A;  1EV7 A;  3IH2 A;  3HSF A;  5FD5 A;  4ABZ A;  4EJU A;  4CCM A;  5DDG A;  3H1C A;  4U88 A;  3JRH A;  2HQA A;  4J19 A;  1R1V A;  3BG5 A;  4UV9 A;  4CZZ A;  2M87 A;  1X1C A;  3J7Z I;  1DGW Y;  2LTP A;  3BG7 A;  3OYG A;  1H9G A;  4RA2 A;  3C2H A;  2W1O A;  4L5E A;  4F92 B;  3OYL A;  3H9G A;  2CJJ A;  3GFJ A;  2QM3 A;  1U8R A;  1X2N A;  2MG4 A;  4XOR A;  5GAD J;  3CC2 I;  2OCC H;  2XKP A;  2KKO A;  2M3A A;  2EWN A;  2RNJ A;  3QYB A;  3A4C A;  3HPH A;  3R60 A;  4IRI A;  1KU2 A;  4W1U A;  2P6T A;  2G7U A;  2JMW A;  1X3U A;  4I7H A;  2WAQ N;  1LVA A;  1YX5 A;  1U6G A;  4XLH A;  1JUS A;  2ZKZ A;  4ITV A;  2NRA C;  2VBX A;  2EQR A;  3I55 I;  4HF2 A;  2OF7 A;  1TP4 A;  1XB4 A;  5ICE A;  4CXF A;  5EGO A;  4OIR F;  1ZG5 A;  2HWV A;  3HOX J;  1VZ0 A;  2DT7 B;  4XRS G;  2COB A;  5J8C A;  1IXS B;  4XQF A;  2ISZ A;  3QYE A;  2LY9 A;  3RCO A;  2QWW A;  2LG4 A;  1SFK A;  2R7W A;  1YYV A;  3CJN A;  1JKP C;  1TT0 A;  2L7Z A;  2JPC A;  4ZYE A;  3FMR A;  4Z6Y A;  2PI0 A;  2O0Y A;  3HXL A;  3CME I;  3WTW C;  1BC7 C;  1D8K A;  3V8K A;  1F9N A;  1LFP A;  4KMU X;  2FD5 A;  1K79 A;  2DJI A;  1O7F A;  3K4M A;  3HPG A;  1XDS A;  2JZY A;  5HLG A;  2L4A A;  2QKM B;  3FWE A;  3R0A A;  1TT5 B;  5H6R A;  4FQG A;  2FNA A;  3FXM A;  4S05 A;  2ZXH A;  3BR3 A;  3UNG C;  3IRQ A;  1TWC J;  3V7S A;  2DMQ A;  3JCU C;  2DT5 A;  2CW8 A;  3AG1 H;  3U1D A;  4C9Y A;  1ERD A;  1W5T A;  1ENH A;  3JTH A;  4BJT A;  2UUZ A;  2Y0M A;  5DS9 A;  4NC8 A;  4XKW A;  3E6D A;  2LDU A;  1Y56 A;  4P9F A;  3ZMU A;  4YRV A;  4JOM A;  4GDF A;  3RIR A;  3PO2 J;  3WU0 A;  2OPT A;  2JSC A;  2BW3 B;  3WU1 B;  3IC7 A;  1R4M B;  3CDL A;  1VND A;  3MQ0 A;  3KCC A;  2F4O B;  1FOY A;  1MSF C;  3LA7 A;  1WSU A;  3OSG A;  2CV0 A;  2E5N A;  3GTM J;  5C3E J;  3CJT B;  1S7E A;  1O3S A;  2VKE A;  2E36 A;  2FQ4 A;  1YE9 A;  1YLF A;  1QVT A;  4Q5S F;  4AWX B;  2R92 J;  4MQV A;  4CCN A;  5IT3 A;  1HKT A;  3ZMV A;  3L2W A;  1T39 A;  2STW A;  3GTJ J;  4II3 A;  1SAU A;  1R22 A;  2A3S A;  2H1L A;  4DBQ A;  1PP7 U;  3HOW J;  3HYI A;  1J2X A;  4O6J A;  3LA2 A;  1G3S A;  1R6R A;  4DZJ A;  2E1O A;  4I0A A;  4EEF G;  2DMN A;  2EZI A;  1V54 H;  3HOZ J;  1WFX A;  2V4J C;  1T95 A;  4XL9 A;  2CYY A;  1KU3 A;  5J40 A;  1YIO A;  5GAE J;  2N8G A;  3CDH A;  4R1H A;  2LBF B;  4UV8 A;  2GA2 A;  1BBY A;  2VC1 A;  2DLL A;  2OZ6 A;  3VSK A;  4CCK A;  1U3E M;  5E8G A;  3MZH A;  4PGH A;  4BXU A;  2MLG A;  3BT9 A;  1LB2 A;  2EIL H;  3K4J A;  1ZLJ A;  3GFL A;  2GOM A;  3TGN A;  2KDO A;  1VQL I;  1Z9C A;  1SAN A;  4LLN A;  4XNF A;  3CLO A;  2HOS A;  2DN0 A;  1YIJ I;  4HX8 A;  1IRF A;  1RES A;  3DTE A;  4KNY A;  2YPR A;  2Q2E A;  2E1N A;  2ZNZ A;  3R0J A;  2HPI A;  2ZJR F;  1RUO A;  2XHK A;  1JJ6 C;  2EK5 A;  2KPM A;  4CCL A;  1OKR A;  1UAA A;  1DU6 A;  2VKH A;  3CUO A;  3K0L A;  3HOS A;  2RN7 A;  1HCR A;  3K2Z A;  3BCB A;  2JA5 J;  3ECO A;  2VKV A;  4A2U A;  3MZ8 A;  2YUS A;  2MA3 A;  4RAY A;  4EV0 A;  3ZMT A;  1IXR C;  4WXH A;  1Y1W J;  4P1W A;  4D5C A;  3OYH A;  3G73 A;  4II2 A;  2DDA A;  1K4S A;  1FP1 D;  2CQX A;  1R71 A;  1Z3X A;  5EEH A;  4LK1 F;  5B1A H;  2L9S A;  1USS A;  2DMU A;  1HQC A;  3TW6 A;  1QHH D;  2WAD A;  3T0Y A;  1R5G A;  3CP2 A;  2K3F A;  1LQ1 A;  2YX4 A;  1XSD A;  3NQO A;  2LH9 A;  2DA4 A;  4LLG F;  4G7H F;  5F1J A;  4AD9 A;  3G1O A;  4ZH4 F;  1YW9 A;  3H0D A;  1T0F C;  4D1Q A;  4W97 A;  5IP9 J;  1X58 A;  2Q8K A;  1WJC A;  2W7N A;  4HST A;  4BY1 J;  1H0M A;  3J7Y J;  2PJR A;  4NC7 A;  1V55 H;  3DBR B;  2ELK A;  2IXS A;  2E1M B;  3HTU A;  2QBY A;  2EBI A;  1SEU A;  2M2E A;  4I99 C;  2CQN A;  3CUQ C;  1UB9 A;  5FB2 A;  5LRS A;  5F6F A;  4LB5 A;  1W5S A;  5HNH A;  2MSY A;  5F0F A;  4FHT A;  3I58 A;  2XSJ C;  2XPV A;  1DU0 A;  5CKT A;  1EH6 A;  1OCP A;  3T8T A;  1AOY A;  2M34 A;  1GT0 C;  1WWX A;  4AVZ A;  3M8E A;  3S1N J;  2BBY A;  3CMM A;  3K70 C;  3DEE A;  2WAE A;  5CQG A;  1OCZ H;  2IBD A;  1ZGJ A;  3FIS A;  2JA7 J;  4LJZ F;  3LAJ A;  4BAY A;  4X6A J;  3M07 A;  2CV2 A;  4Q47 A;  1MMD A;  2LKS A;  4F3Q A;  2H6C A;  4CCJ A;  1PDN C;  3CCJ I;  2DFH A;  2RGV A;  4GO1 A;  2OC6 A;  5IP7 J;  1FYL A;  4NB5 A;  1JE8 A;  2HFH A;  2KIU A;  3CQZ J;  2QA4 I;  2AQE A;  3W6V A;  3V8J A;  4A3K J;  4I02 A;  4PFO A;  1S8N A;  3COA C;  2GLO A;  2QSF X;  2CUZ A;  5JLW A;  2HI3 A;  4E6K G;  4LFU A;  3LA3 A;  1KQ8 A;  3F21 A;  1I6X A;  4DBR A;  1R9T J;  3S2H J;  1SVO A;  2QLZ A;  1T0F A;  1L0O C;  4YFX F;  1B8I A;  2DA7 A;  1KU9 A;  2JUG A;  3JAM K;  2L01 A;  4PJN A;  4A5N A;  1VQO I;  3DFG A;  1GXQ A;  1FP2 A;  1T98 A;  1TC3 C;  1RET A;  4ANJ A;  3GWZ A;  4DGW B;  4IHY A;  3GTP J;  2F4M B;  4ZDP A;  1QNT A;  2XGD A;  4OOI A;  3OYA A;  4ZYA A;  1BI3 A;  3ZXS A;  2ZBK A;  3LFK A;  2DXI A;  3BG3 A;  3DKW A;  5ICG A;  3CMY A;  2TCT A;  4IEJ A;  4I76 A;  2QQB A;  2OU2 A;  4A3D J;  3LSK A;  2LF8 A;  1XG1 A;  4ZTF A;  2R7R A;  2Z99 A;  5E18 F;  2OTL I;  1Z7L A;  1HA8 A;  5F64 A;  1FBQ A;  4KIF A;  1OLT A;  2VE8 A;  3R6S A;  3PIP F;  3WG9 A;  2GXB A;  2NS0 A;  4XON A;  5ILU A;  2O7O A;  3T5X A;  5J1U A;  2HOE A;  4AVP A;  5GAH J;  2VQH A;  3ZN1 A;  1RR7 A;  3G1L A;  4L9N A;  3O8H A;  5JVT A;  2XC7 A;  4OWR B;  1PUE E;  4UUV A;  2EIN H;  3F8M A;  2X6X A;  3BR6 A;  1JTY A;  4BHB A;  3CF5 F;  2EZL A;  3HB9 A;  3MN2 A;  1WPK A;  4DQ2 A;  5L3B A;  4EGZ A;  1IXC A;  3H5N A;  1YJW I;  4IKF A;  4YG2 F;  5FO5 A;  1YHQ I;  4R8H A;  1RNL A;  1VFC A;  1MMS A;  4H4K C;  3Q9V A;  2W24 A;  4N0B A;  4PUS A;  2M4K A;  2XIG A;  2ZJP F;  1R58 A;  5EZH A;  1JT6 A;  4NHJ A;  1JKQ C;  2HOA A;  1TTY A;  2VC0 A;  2XAU A;  4B4C A;  1XCV A;  3IP4 B;  2GXG A;  3GFI A;  4C3H J;  3MFK A;  5A2Q K;  2VLA A;  2VXZ A;  3QRF F;  2XGC A;  4B8X A;  2K5C A;  5CQE A;  1STZ A;  2UXX A;  3CCR I;  3QPT A;  3HSR A;  1ZN2 A;  5DTD A;  5FRO A;  3PFY A;  2HVR A;  4UXN A;  1G4D A;  3A01 A;  4UVA A;  1FSE A;  2Z1D A;  1DP3 A;  3ZQH A;  3E1S A;  2FMY A;  5ERI A;  3GUD A;  1IDZ A;  3RKX A;  1B6A A;  4F91 B;  4M9S A;  4RAG A;  1P92 A;  3A0B C;  4MLO A;  4PJL A;  1TWA J;  5KAF C;  1WJE A;  4H0E A;  3DKX A;  4BHC A;  1N25 A;  4M71 A;  1IN5 A;  1FIP A;  3PIO F;  4E7K A;  3SQN A;  3M3Y J;  2ZXI A;  2I10 A;  5HDN A;  3VDX A;  1OYW A;  2DBB A;  1OCC H;  1Z7U A;  1VQM I;  4XLF A;  5AON A;  3TO6 A;  1FPQ A;  3IKV A;  4CYC A;  3RZO J;  2DK8 A;  3K4K A;  2EV6 A;  3BR0 A;  5DM6 F;  1ZRF A;  3CP8 A;  4M6X A;  3WTZ A;  1GVD A;  4V2G A;  1FYM A;  2MW8 A;  3UR3 C;  5FFX A;  2L9N A;  4BQA A;  4MEX F;  4MIM A;  4R79 A;  5D5U B;  1OCT C;  1P7J A;  2GIZ A;  2JQ7 A;  3ISP A;  2ELH A;  1UCR A;  3OV8 A;  1Y0U A;  4D7N A;  4XID A;  4IQJ A;  4B1R A;  3H5A A;  5E17 F;  2QQA A;  3HRM A;  1HW1 A;  3DP7 A;  1OCO H;  5HDG A;  4LOC A;  3DV8 A;  1FC3 A;  3MVP A;  4OIP F;  4XLC A;  2UV1 A;  2GWR A;  2JK3 A;  2Y31 A;  5M5X J;  2VOO A;  1LE8 A;  1T2K A;  1ZKG A;  1HSJ A;  3WTU C;  3I3L A;  3ZPL A;  1I3Q J;  1POG A;  1NHA A;  2JA2 A;  2JVH A;  1W7P D;  3FM5 A;  3F8F A;  1LEA A;  3L1P A;  2VBY A;  1FWZ A;  3E3V A;  1HBX G;  3LSG A;  3QOP A;  5HS7 A;  2VL8 A;  2K9L A;  1UJ8 A;  3CCE I;  4ENN A;  2OQG A;  3OIQ A;  4CA0 A;  1ON2 A;  2HQR A;  1OFC X;  4CHU A;  3DLA A;  3KYL A;  1H89 C;  3AKZ A;  2ID3 A;  4OU0 A;  4ZC3 A;  1J59 A;  2R5Z B;  5KHD A;  2O8X A;  3BPV A;  1FBU A;  4BDY A;  3F8C A;  4RS8 A;  1YS6 A;  2KHM A;  1XGN A;  3LST A;  4DYR A;  3VOE A;  5BPD A;  2DOA A;  2VJJ A;  5ICC A;  2AXT C;  1W1W E;  2DA1 A;  2RNG A;  2MC4 A;  4BEH B;  3ZOB A;  1HF0 A;  2ZO4 A;  3MKW B;  4ZYD A;  1FNN A;  2VJ5 A;  3CC4 I;  3LSR A;  1HLV A;  1B4A A;  3RZD J;  2CQK A;  4QLC U;  3HGG A;  3D0S A;  4YFN F;  2YX7 A;  2ZJQ F;  1G6N A;  3RPU D;  1GXP A;  4KDP A;  1T56 A;  3K70 D;  4AU7 A;  3MWM A;  1R49 A;  4IPA A;  2H8W A;  5HDK A;  3FBN B;  1XTA A;  3ONQ A;  3G1M A;  1VQ8 I;  5HLT A;  3H3U A;  4DJA A;  4RB3 C;  3L2C A;  2DJN A;  4AIK A;  4FTH A;  1ONV A;  4V2F A;  1RKW A;  1W36 C;  1APL C;  3EUH C;  2JN6 A;  2FSW A;  2CW0 F;  1UG0 A;  1X19 A;  4FX0 A;  4MHG A;  1QPI A;  2ZSI B;  2XGE A;  3V8L A;  4S04 A;  4YFK F;  3EDP A;  5EF6 A;  4N4O B;  2J5P A;  1U5T B;  2ME0 A;  2Y30 A;  4Y13 A;  1IJW C;  5JVG F;  3DBL B;  1KYZ A;  2Q0O A;  4V19 K;  3BOQ A;  1TL8 A;  5LEJ A;  3S16 J;  1RR8 C;  1IAW A;  1MND A;  1BIB A;  3ASN H;  1X4O A;  4UB8 C;  5HS8 A;  3AAF A;  2PMH A;  2GQQ A;  1XPX A;  1NH3 A;  2LFB A;  4E7Z A;  3LSJ A;  5IT9 Z;  1JTX A;  3S3O A;  2CGP A;  3JSP A;  2MAB A;  2L7K A;  3GXO A;  1YJ9 I;  5BOX A;  2EIM H;  1K83 J;  4PJJ A;  2Z33 A;  2LR8 A;  1ZHF A;  3H9J A;  3LSM A;  3N4M A;  2H1K A;  1D3Y A;  1FY7 A;  3WGH A;  4HSR A;  1UEL B;  1G3W A;  2E35 A;  2Y48 A;  3DQV C;  3PNY A;  1KQ0 A;  3IKT A;  5BS6 A;  1IDY A;  4C2M J;  1MJB A;  3C2B A;  1P4W A;  1R36 A;  3DU5 A;  3VEP A;  2HPM A;  1LJ9 A;  3Q9S A;  1O4X A;  3F23 A;  3CES A;  1BJZ A;  1BC8 C;  1S29 A;  5DCM B;  2A61 A;  4E7L A;  1B72 A;  1ETW A;  3IH3 A;  1FLI A;  4OAY A;  1I1S A;  2ZME A;  1Z6R A;  3TDZ C;  4C3J J;  3OY9 A;  1X1B A;  1ZAO A;  2F48 A;  3HZJ A;  3E97 A;  4B09 A;  5EG0 B;  4BS9 A;  2LOO A;  2XF5 A;  5F1R A;  2X6Y A;  2VQG A;  3BG9 A;  4XBF A;  4D5F A;  2A5W A;  2L54 A;  2VAS A;  5HOO A;  1MD0 A;  3EUH A;  1FSH A;  3PNV A;  1A6I A;  3S14 J;  5E20 A;  1PP8 F;  4EM1 A;  3B73 A;  4ZYG A;  4XK4 A;  3IUO A;  2XF6 A;  4BYY A;  5ED4 A;  2BE5 F;  2RRE A;  1XGS A;  3K4C A;  4NQW A;  3KZZ A;  5HLH A;  5ILS A;  3TMO A;  3S1M J;  3FMS A;  3DTI A;  4G7O F;  1G8X A;  2K7L A;  4MNU A;  1S6L A;  2K4J A;  3FBI B;  3C3W A;  2BXY A;  3C7J A;  2PX9 A;  4U0Y A;  3J7A O;  4S0H B;  1K7A A;  2FX0 A;  4HW0 A;  4WX9 A;  2OAZ A;  1K4T A;  1GLN A;  5IYD J;  3A2K A;  2CU7 A;  1AKH B;  2CS3 A;  4A3I J;  2M0M A;  2QEX I;  2DT6 A;  3ZQF A;  3A0H C;  4GFB A;  1I27 A;  3HRU A;  2NVU B;  1LDD A;  1OMI A;  4XRS A;  5HOD A;  3SJM A;  4PSW A;  3FHN A;  2NVY J;  2XAS A;  3HUG B;  2LKX A;  2CG4 A;  2X51 A;  3JRF A;  3DKY A;  3BZ6 A;  4U0V A;  4A3E J;  4A0X A;  1Y39 A;  1FZP B;  1ZAR A;  2EZK A;  1FT9 A;  4HLX A;  4QPO A;  3WG7 H;  4ZDO A;  5EZG A;  2WA0 A;  1YRN B;  2QQ9 A;  4EJW A;  4A3F J;  3G6E I;  1WVR A;  3KP3 A;  5LHG A;  1X2M A;  1XX5 A;  3QWL A;  4HA8 A;  3W2A A;  1NK3 P;  1BOB A;  2V1N A;  4ETS A;  4UY8 I;  2D2W A;  4PSX A;  3KP4 A;  3HRT A;  5HVQ C;  2IEK A;  4HX4 A;  3H0G J;  1QO0 D;  1Y0N A;  2WWY A;  2Y9Z A;  2YU9 J;  1YO5 C;  3EYY A;  4XKB A;  1E3P A;  1FIA A;  2WAQ A;  3JSO A;  2P5K A;  3ABK H;  4EQQ A;  4XR6 A;  2AHQ A;  4JQF A;  4NBQ A;  1K6O A;  2DTR A;  3GW2 A;  3KET A;  4Y3O A;  2G9W A;  2RQQ A;  2W84 A;  5HNF A;  1IRZ A;  4KA4 A;  4RGU A;  4A3B J;  4ESJ A;  2IA1 A;  3FIW A;  3KEQ A;  2B0L A;  4OAZ A;  3FF5 A;  3CLQ A;  2HEO A;  5FRM A;  1XGO A;  2BZT A;  3JRE A;  2HDC A;  3I4M J;  1BR1 A;  4ESB A;  3HEF A;  3Q5F A;  2F5D A;  1AU7 A;  3WTY C;  2XGX A;  2TDX A;  3JAM Z;  4ENM A;  2NNN A;  3V4G A;  3BPX A;  2JWT A;  4JX4 A;  3EET A;  4LIT A;  4XLN F;  1VQK I;  1ETX A;  4A0Y A;  3VWB A;  4HYE A;  2BV6 A;  2M1B A;  3MKZ A;  2R7S A;  2BHZ A;  3CDI A;  4XRM A;  3OYK A;  2M30 A;  2BHY A;  2EA2 A;  2VBW A;  3AG2 H;  2FE3 A;  1G59 A;  2R5Y A;  3T1B A;  1ZH5 A;  1MNE A;  5HLI A;  3VYU B;  2BY2 A;  2MD5 A;  4G9Y A;  3MAJ A;  3GCM A;  1D0X A;  3S93 A;  5D5X B;  5EGO B;  5GAG J;  4IQ4 A;  1VF9 A;  3P7N A;  5CJ9 A;  4GYG A;  3TL4 X;  3LQR A;  3VSL A;  4YIF A;  2ZNY A;  5F04 A;  1ORK A;  1IN4 A;  4ZDL A;  3E5X A;  2KRF A;  3ZGK A;  1XC5 A;  3E5U A;  1D1C A;  3ULQ B;  1TBX A;  5FRN A;  4G94 A;  3MKL A;  3J7A Y;  2XAQ A;  3I4N J;  2Y0S N;  2L02 A;  1ZR2 A;  3P5J A;  3TP3 A;  3WE2 A;  3BLY A;  1TQP A;  3ERE D;  1O3T A;  1FTT A;  5FLV A;  3LOC A;  6PAX A;  3QQA A;  2NNY A;  2OTJ I;  1FX7 A;  1AHD P;  2A68 F;  3HOY J;  2P7V B;  3M7G A;  5FLM J;  2IPQ X;  3PNT A;  5D6E A;  4X0G A;  2R93 J;  3TDU C;  5LHI A;  3O8G A;  3DBH B;  1E0E A;  2UZK A;  3K4L A;  1LEB A;  2ECC A;  4HPQ A;  1IV6 A;  5IT9 K;  3FDY A;  1K78 A;  4RB2 C;  2JJ7 A;  3HHG A;  1VQ7 I;  1D5V A;  3OL3 A;  4M3B A;  2DOE A;  5IP6 A;  3I4P A;  1QQI A;  2BOL A;  3OOU A;  5IYB J;  5A2Q Z;  4E7H A;  2ACJ A;  5B3S H;  3BR5 A;  1JHF A;  2STT A;  2A05 A;  1W36 D;  1X1P A;  3FXR A;  4HG2 A;  5EEA A;  3OYE A;  3N05 A;  4MQ9 F;  3WTX C;  4C2U A;  4BQQ A;  3I54 A;  3IAS 2;  2YSR A;  4MFE A;  3QP5 A;  1MH4 A;  2OV7 A;  3TO7 A;  1QGP A;  4BE0 A;  3EPZ A;  3G3Z A;  1NG6 A;  2WTE A;  3DPL C;  2P6S A;  3C1D A;  2BEO A;  2LVS A;  1MSE C;  2FA5 A;  2HYF A;  3JRA A;  3GFM A;  2IA2 A;  3L2R A;  3HOT A;  4UNO A;  3LQQ A;  4RAF A;  2K27 A;  1S9H A;  3ZQI A;  4CCO A;  4LG0 A;  5L3C A;  1JXS A;  3OYN A;  3ABT A;  2P0W A;  3WE3 A;  2WY7 Q;  3I56 I;  1VTN C;  3ECH A;  1HOM A;  2DQL A;  1I3A A;  2DYS H;  1PUF A;  2KJB A;  4ZJZ A;  3L9F A;  2VQC A;  3K69 A;  4RDU A;  3L09 A;  2WC2 A;  2IRF G;  4LK0 F;  3O2P E;  3HHH A;  2QKL B;  1AA7 A;  5ILV A;  4A69 C;  4RB1 A;  4MGR A;  2X1D A;  4HF0 A;  4IRH A;  2Q2E B;  3HL2 A;  1GV5 A;  3U21 A;  2HU9 A;  2BVM A;  3MEX A;  5LHH A;  1GV2 A;  3DLL F;  4XIC A;  4Q4Z F;  1EH7 A;  3IWF A;  3HDD A;  1MBH A;  4QWQ A;  2LD5 A;  3JTG A;  2PBI A;  1FJL A;  2MYS A;  2L5Q A;  1P4X A;  1BM9 A;  2KT0 A;  5JHF A;  3FKI J;  1YIT I;  1D0Z A;  2R7U A;  2DA3 A;  3O3K A;  5FFZ A;  5H2F C;  4A12 A;  1B9M A;  2ZXW H;  5GTH C;  2M7A A;  3QPL A;  3RYP A;  5D5W B;  3GX4 X;  3BJA A;  5LGN A;  2KMU A;  4IOC F;  3DU6 A;  1AWC A;  1XMA A;  2LYC A;  3S32 A;  5KCM A;  1I5Z A;  3ZQ7 A;  1ZRD A;  2E71 A;  2R7F A;  3E0J B;  3A02 A;  1W7P A;  2K9M A;  2CUF A;  4HOB A;  3VYR B;  1F43 A;  3IWZ A;  4RM3 A;  5K1Y A;  3AFH A;  3KLO A;  1RIO H;  1BA5 A;  2H09 A;  3S1R J;  4DW6 A;  3I64 A;  4Y7N J;  2HQN A;  2Y9Y A;  3LSP A;  5E79 C;  4JP0 A;  2KJC A;  4LLL A;  3TP0 A;  4M3G A;  2B7E A;  3SHF A;  3M1E A;  3KP7 A;  2O6G E;  1TNT A;  3EYI A;  2PJR B;  2R7Z J;  1SC7 A;  2QBY B;  4RGX A;  2JUC A;  2ZCW A;  2DQR A;  1OQY A;  4BQN A;  3F22 A;  3VYT B;  1GUU A;  3FZV A;  1ETQ A;  5E1X A;  4AM3 A;  2IT0 A;  1SFX A;  4KN7 X;  2L9R A;  3CUQ A;  2DAO A;  3GZN B;  3GLL A;  3W2V A;  2XB5 A;  2DOD A;  2CQ7 A;  2BY0 A;  1U2W A;  1LFB A;  3RPU A;  1FBS A;  1HKS A;  4XOT A;  4EJT A;  1SD7 A;  2EFP A;  1Y8Q B;  1X1A A;  1Z1D A;  1Z91 A;  4K2E A;  2LY2 A;  2DK5 A;  4HV5 A;  2H6B A;  4FX4 A;  4IL6 C;  3MD2 A;  4IHV A;  2AO9 A;  4LD5 A;  2K85 A;  1TWF J;  1X3Z B;  1V5E A;  1U8B A;  1I39 A;  3JRB A;  1QU3 A;  2E1C A;  2BYV E;  2GA1 A;  2W4S A;  5K5Q A;  5EDN A;  2L3D A;  3A03 A;  3S15 J;  4IHW A;  1IN8 A;  1Z05 A;  2LRD A;  3HSE A;  1UHW A;  2LP0 A;  3E5Q A;  1RZ4 A;  4YEL A;  1FMW A;  3K2A A;  4AC0 A;  5IPA A;  2WV1 A;  5E8I A;  4D9J A;  2H27 A;  1B8I B;  5IY5 H;  4KFC A;  2G7H A;  2EFW A;  2E7W A;  1MDM A;  1ETV A;  2E60 A;  2JVG A;  4IVN A;  4GCV A;  3CCM I;  1ZQ3 P;  1W0T A;  3PQJ A;  2FRH A;  2AXL A;  2KDZ A;  1S72 I;  5E1W A;  3QU6 A;  2Z5U A;  2UXN A;  1RPW A;  1WH7 A;  2CSO A;  4BDZ A;  1VQP I;  3OR2 C;  1BL0 A;  2FBH A;  5FJ8 J;  3T8R A;  2XRL A;  2JRM A;  1OYY A;  3SDG A;  3BZC A;  1V5F A;  2LKP A;  2XV4 S;  2KRH A; 
#chains in the Genus database with same CATH homology
 1JT0 A;  2ME0 A;  2Y30 A;  1IJW C;  3BR3 A;  2ECB A;  1TWC J;  2DMQ A;  2PMZ N;  3S16 J;  2LLK A;  1I6H J;  1ENH A;  2VI6 A;  2LFB A;  1T33 A;  5DS9 A;  3LSJ A;  4D7M A;  1JTX A;  1XS9 A;  3ZQG A;  4FE4 A;  1K83 J;  5E3O A;  2LR8 A;  1JUP A;  3PO2 J;  2H1K A;  3VPR A;  2NOG A;  2OPT A;  2TRT A;  1PUF B;  3CDL A;  1VND A;  3BTI A;  4AUX A;  1IDY A;  4C2M J;  2DA2 A;  3C2B A;  2R0Q C;  1U78 A;  1O4X A;  3CCY A;  1HDD C;  1BJZ A;  1MSF C;  3OSG A;  3GTM J;  5C3E J;  1B72 A;  1ETW A;  1S7E A;  3IH3 A;  4IHX A;  2VKE A;  2FQ4 A;  4C3J J;  1QVT A;  2E2I J;  2R92 J;  1JKR C;  2E2J J;  2RAE A;  3GTJ J;  5EG0 B;  1ETO A;  3HOW J;  1G2H A;  2L7M P;  2O8K A;  4DZJ A;  2E1O A;  4D5F A;  3BG9 A;  4EEF G;  2DMN A;  3F0C A;  2EZI A;  2ZB9 A;  3A01 B;  3HOZ J;  3FK6 A;  2EH3 A;  1A6I A;  1WGX A;  3S14 J;  3JRG A;  2VPR A;  5F0H A;  2N8G A;  2XB0 X;  3Q0W A;  2EZH A;  4XK4 A;  1TWH J;  3OIO A;  3S2D J;  4BKX A;  1ZTR A;  5F0C A;  3S1M J;  2DMP A;  1JKO C;  3S17 J;  3GBG A;  3BT9 A;  4MO7 A;  4S0H B;  2FX0 A;  1QVU A;  1SAN A;  5FKO A;  4DYQ A;  5K7H A;  4QTR A;  2HOS A;  2DN0 A;  5IYD J;  4CYC B;  2CU7 A;  2CUE A;  1AKH B;  1RES A;  1EF4 A;  4A3I J;  3ZQF A;  2NVT J;  4FE7 A;  4GFB A;  2GBY A;  1JJ6 C;  4XRS A;  1WI3 A;  5HOD A;  1DU6 A;  3SJM A;  2NVY J;  4M3E A;  2LKX A;  1ZK8 A;  1UHS A;  1HCR A;  3JRF A;  2JA5 J;  4A3E J;  2EZK A;  4AYB N;  5IOY A;  5GPC A;  2VKV A;  3ZQC A;  1VI0 A;  2YUS A;  2K40 A;  5EZG A;  1YRN B;  4A3M J;  2JA6 J;  4A3F J;  4DZP A;  3HKZ N;  1FTZ A;  1X2M A;  1NK3 P;  1Y1W J;  4D5C A;  3PO3 J;  1IG7 A;  1LE8 B;  2IEK A;  2CQX A;  3B6A A;  3H0G J;  4BXX J;  5M5Y J;  1Z77 A;  2DMU A;  3TW6 A;  1QRY A;  2Y9Z A;  2YU9 J;  4DYC A;  1JJ8 C;  1FIA A;  2G0E A;  2QF7 A;  5IYC J;  2M9H A;  2AHQ A;  5F27 A;  2DA4 A;  2XPU A;  4A93 J;  4C3I J;  5F1J A;  1RKT A;  1IRZ A;  3G1O A;  4A3B J;  1U9N A;  3FIW A;  1MBG A;  4W97 A;  3JRE A;  5IP9 J;  1X58 A;  4BY1 J;  3I4M J;  3HEF A;  4A3L J;  2DTZ A;  5E3N A;  2ME6 A;  1AU7 A;  2QCO A;  2ELK A;  2P81 A;  3Q0V A;  2EBI A;  4M3D A;  2M2E A;  1BW5 A;  2JWT A;  4JX4 A;  2DMT A;  4UUS A;  4JX5 A;  1ETX A;  1MBF A;  2MSY A;  5F0F A;  2XSD C;  1IGN A;  5FKL A;  2XPV A;  3JRD A;  1DU0 A;  5GP9 A;  1OCP A;  4XRM A;  9ANT A;  4B3A A;  2M34 A;  1GT0 C;  2R5Y A;  3Q0U A;  3S1N J;  1Y1V J;  3E7L A;  2E2H J;  2IBD A;  2MGQ A;  3FIS A;  2JA7 J;  5EGO B;  4FCY A;  1VF9 A;  2HYJ A;  4X6A J;  2FJ1 A;  5M3M J;  4M6V A;  5F04 A;  1ORK A;  1MBK A;  1W0U A;  5EYR A;  5IP7 J;  1XC5 A;  5BNG A;  1JGG A;  3CQZ J;  3W6V A;  2R5Z A;  4A3K J;  3ZQL A;  5F08 A;  3MKL A;  1Q1V A;  3HGY A;  3I4N J;  3PM1 A;  2Y0S N;  2GLO A;  1ZR2 A;  3TP3 A;  5JLW A;  2HI3 A;  3GTO J;  3DEW A;  1FTT A;  5FLV A;  3LOC A;  3BQZ A;  3QQA A;  3GTK J;  1F36 A;  3BTC A;  3UKG A;  1AHD P;  4A3G J;  2NS7 A;  3HOV J;  4FIS A;  3HOY J;  1R9T J;  3DCF A;  3S2H J;  1ETY A;  3GTQ J;  2K9Q A;  4QIW N;  5FLM J;  2R93 J;  1B8I A;  2DA7 A;  3S1Q J;  1U9O A;  3O8G A;  2NVQ J;  2DA6 A;  2ECC A;  1IV6 A;  1TC3 C;  1RET A;  5K7Z A;  4IHY A;  3GTP J;  2JJ7 A;  2XGD A;  2Y2Z A;  4M3B A;  4QSH A;  5IP6 A;  5GPA A;  1H8A C;  4BBR J;  3OOU A;  5IYB J;  2L0K A;  3BG3 A;  2X48 A;  3CMY A;  3BR5 A;  2TCT A;  4IEJ A;  4I76 A;  4HNV A;  1HDP A;  4A3D J;  1XG1 A;  4RBO A;  3HM5 A;  5EEA A;  1B72 B;  2IAI A;  2GM4 A;  4X1E A;  5J1Y A;  1IUF A;  4MFE A;  1I50 J;  4G12 A;  1MH4 A;  4JYK A;  3BTL A;  1UMQ A;  1P7I A;  3JRI A;  4I6Z A;  1ZGW A;  1D5Y A;  3JR9 A;  2K9S A;  2LVS A;  1Z0X A;  2O7O A;  3JRC A;  3JRA A;  1MSE C;  1IC8 A;  2HXO A;  2HQ5 A;  5J1U A;  5C4X J;  2NS8 A;  3HBL A;  3ZQI A;  1RR7 A;  3G1L A;  3O8H A;  3BQY A;  3BR6 A;  1JTY A;  2EZL A;  3HB9 A;  3MN2 A;  5IOZ A;  5C44 J;  1WPK A;  2HOT A;  2B63 J;  2HDD A;  1HOM A;  1VFC A;  1PUF A;  4RDU A;  1MBE A;  5J3L A;  3WHB A;  3Q3S A;  1A5J A;  1SFO J;  5EZH A;  5E3L A;  1JT6 A;  1MBJ A;  1JKQ C;  3M4O J;  2HOA A;  4A69 C;  4B4C A;  4BBS J;  1GV5 A;  1GDT A;  3BR2 A;  1GV2 A;  4C3H J;  3HOU J;  3FK7 A;  4XIC A;  5EG0 A;  3HDD A;  1MBH A;  2XGC A;  1CQT A;  2CRG A;  2E19 A;  3QPS A;  5DTD A;  2LD5 A;  5E3M A;  2XPW A;  1FJL A;  3A01 A;  2KT0 A;  3NAR A;  3FKI J;  2W48 A;  4M3F A;  1K61 A;  3ZQH A;  2VUM J;  2DA3 A;  1IDZ A;  4Y52 J;  2LK2 A;  2M8G X;  4MLO A;  3QPL A;  3WHC A;  1TWG J;  1TWA J;  2WB1 N;  1H88 C;  2DA5 A;  1FIP A;  1UG2 A;  2D5V A;  2JA8 J;  2H8R A;  5M3F J;  3M3Y J;  2YS9 A;  5FKM A;  2I10 A;  3BR1 A;  3A02 A;  1F43 A;  2CUF A;  4CYC A;  3RZO J;  1AKH A;  1BA5 A;  3BR0 A;  4JX6 A;  1MNM C;  3S1R J;  4NDL A;  4DW6 A;  2X6O A;  4Y7N J;  1GVD A;  1ZR4 A;  2Y9Y A;  3LSP A;  4JP0 A;  3TP0 A;  4V2G A;  3SFI A;  4M3G A;  2MW8 A;  4MIM A;  1OCT C;  1P7J A;  1FEX A;  2R7Z J;  1YRN A;  4D7N A;  5J1R A;  4XID A;  2CQQ A;  4B1R A;  4UUS B;  1LFU P;  1GUU A;  3LNQ A;  1ETQ A;  4LOC A;  3NAU A;  3MVP A;  1ITY A;  4UUT A;  3RQI A;  2Y31 A;  5M5X J;  2JK3 A;  3TED A;  2L9R A;  1LE8 A;  2R5Y B;  2NVX J;  1ZKG A;  1WCM J;  1I3Q J;  1MH3 A;  1POG A;  3GTG J;  2XB5 A;  5FKN A;  2O9L A;  3IV5 A;  3L1P A;  3IH2 A;  3LSG A;  4A3J J;  1LFB A;  4ABZ A;  1JUM A;  1NK2 P;  1OFC X;  3IH4 A;  1H89 C;  2ID3 A;  3JRH A;  4J19 A;  3GTL J;  3BG5 A;  2K9N A;  2LTP A;  4MFD A;  2R5Z B;  4IHV A;  2AO9 A;  4L5E A;  1TWF J;  3BTJ A;  2CJJ A;  2L7F P;  1U8B A;  3JRB A;  4DYR A;  1X2N A;  2MG4 A;  5EDN A;  3S15 J;  3A03 A;  4IHW A;  2DA1 A;  2LP0 A;  3K2A A;  3ZOB A;  4AC0 A;  3H3V K;  1HF0 A;  5IPA A;  5M5W J;  3OSF A;  4A3C J;  2WV1 A;  3RKQ A;  1WH5 A;  2ID6 A;  4W1U A;  1NTC A;  5C4J J;  3LSR A;  2JMW A;  1HLV A;  3RZD J;  1B8I B;  2WAQ N;  3HGG A;  3K7A J;  1BW6 A;  5FKK A;  3TW7 A;  1JUS A;  1ETV A;  1T56 A;  1ZQ3 P;  2EQR A;  2OF7 A;  2X9D A;  1W0T A;  5EGO A;  1E3O C;  3HOX J;  5K7F A;  3G1M A;  4XRS G;  5JLX A;  2COB A;  1ETK A;  2KDZ A;  2M0C A;  2HXI A;  2LY9 A;  1OJL A;  1RPW A;  3B6C A;  1WH7 A;  1JKP C;  2DJN A;  2L7Z A;  4FTH A;  1BL0 A;  4V2F A;  1RKW A;  5FJ8 J;  1APL C;  4BY7 J;  2JN6 A;  2XRL A;  3SDG A;  1QPI A;  2FD5 A;  3D1N I;  2XGE A;  5EF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...