2E2JJ

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2jJ00
3JRGA 4A93J 1ZR2A 1K83J 3G1MA 2WV1A 1HF0A 4AYBN 2JA8J 1VFCA 3LSGA 3LOCA 2HDDA 3FK6A 1X2NA 1OCTC 4DYQA 3MKLA 1VNDA 1RPWA 2E1OA 2DA3A 3A03A 1JKRC 2DMQA 4IHVA 3CDLA 3ZQCA 3BR6A 5IP6A 3JRAA 1JT6A 1ZR4A 2WAQN 4RDUA 1GT0C 4DZJA 2FQ4A 4JP0A 3OSFA 1IV6A 2JK3A 3W6VA 3BQZA 3HGGA 2DA4A 1ETVA 1ITYA 3BQYA 1U78A 2NOGA 4V2FA 2ME0A 1CQTA 5FLVA 4IHYA 2DA6A 1D5YA 5F27A 5FLMJ 3JRDA 1TWCJ 2EZLA 4M3DA 1VI0A 4FE7A 5IOZA 4FCYA 2HXIA 3JRCA 5M5YJ 2ID6A 4D7MA 1FJLA 4FISA 1GDTA 3S1MJ 1ETYA 5EGOA 3Q0UA 3GTPJ 4X1EA 2VUMJ 3SFIA 1PUFA 1F43A 3GTJJ 5K7HA 2NVTJ 3Q3SA 1EF4A 1Q1VA 1TWGJ 1YRNB 2IEKA 5J1UA 5IPAA 3TP3A 4JX4A 2K9NA 2MGQA 2XPVA 4V2GA 3RKQA 3ZQLA 1ZQ3P 3I4MJ 2O7OA 1DU6A 2WB1N 2O8KA 5K7FA 1T33A 2ID3A 4A3LJ 2LK2A 1TWAJ 5M3FJ 2LP0A 3JRHA 1BA5A 2VKEA 3BG5A 1ETQA 1NK2P 3B6CA 3I4NJ 1JUMA 1MBFA 1S7EA 3PM1A 4FE4A 3ZQHA 2R93J 5IYDJ 3G1LA 2VKVA 5EGOB 3BTLA 3BR3A 3S15J 4M3GA 4X6AJ 4A3IJ 1B8IA 2JWTA 3LSPA 2DMNA 4M3BA 2HXOA 1Z77A 3CQZJ 4JX6A 1JJ8C 3QQAA 1OFCX 1X2MA 1WGXA 1B72B 5FKMA 1GV2A 2HOAA 5JLWA 1RESA 1G2HA 2M9HA 4I6ZA 3A02A 4BBSJ 1MBGA 1IRZA 2K9SA 3HB9A 3S14J 1W0TA 2H8RA 4MFDA 4A3JJ 3F0CA 3C2BA 3IH2A 1WH7A 3L1PA 4BBRJ 2DTZA 4A69C 4FTHA 3K7AJ 4QIWN 1VF9A 3E7LA 2E19A 2LY9A 1AKHA 1FIPA 1MNMC 4IHWA 1RETA 2KT0A 1AKHB 4DW6A 2FD5A 3TW6A 1BL0A 3S2HJ 5F0FA 3HEFA 5GPCA 2ECBA 3TP0A 5EZGA 2R5ZA 5F1JA 5EG0B 2PMZN 2EZHA 2L0KA 3FK7A 3FIWA 4BKXA 9ANTA 3A01B 3M3YJ 1ETKA 2DN0A 2MG4A 2E2HJ 2ECCA 1ETXA 2XB0X 2H1KA 1OJLA 1OCPA 4ABZA 3HOZJ 4IHXA 3BTCA 4W1UA 3SDGA 4NDLA 2ELKA 4W97A 4XRSA 3IH4A 4S0HB 1JUPA 2E2JJ 3BR1A 5IP9J 3GTOJ 2QF7A 2DA5A 2LTPA 2M2EA 2Y2ZA 3HOUJ 2EBIA 4G12A 5FKOA 4UUTA 4D5FA 5EYRA 3JRFA 2GM4A 3S16J 3FISA 4A3DJ 4M3FA 3GTLJ 3GTGJ 4A3BJ 2TRTA 1UG2A 5F08A 4D5CA 1LE8B 1WH5A 2M8GX 3DCFA 2JA5J 4JYKA 2CUFA 2YS9A 1AU7A 4XIDA 2R5YB 2EZIA 4A3GJ 3QPSA 5FJ8J 2XRLA 4BY7J 5EG0A 4M3EA 3GBGA 2XSDC 2VPRA 2ZB9A 2CJJA 3LNQA 3B6AA 1TWHJ 1JKOC 5IYCJ 2GBYA 4C3IJ 4XK4A 1IUFA 5C4XJ 4AC0A 4C3JJ 1RKWA 4RBOA 5J1YA 1I3QJ 2OF7A 3HM5A 2HOTA 2JA7J 2YUSA 2Y31A 1W0UA 1MH4A 4M6VA 3BTIA 4LOCA 1QVTA 2QCOA 2LLKA 1P7JA 5EDNA 1WPKA 4Y52J 1MSFC 2GLOA 3S1NJ 3S1QJ 1JKPC 2HYJA 1FTTA 2TCTA 2Y0SN 5K7ZA 3ZQFA 3D1NI 3BR2A 3GTKJ 1GV5A 4UUSB 2R7ZJ 2LD5A 2Y9YA 3K2AA 4B3AA 3HOWJ 1ORKA 3HGYA 3A01A 3BR0A 1Y1VJ 3Q0VA 3UKGA 1MBHA 1IJWC 4A3CJ 3DEWA 3TW7A 5DTDA 2K9QA 5F04A 3GTMJ 3LSRA 2KDZA 4MLOA 3FKIJ 1K61A 1UHSA 4QSHA 2AHQA 3JRBA 1R9TJ 2X9DA 4L5EA 2O9LA 2FX0A 4JX5A 3Q0WA 3JR9A 1TWFJ 1LE8A 2D5VA 5E3LA 4AUXA 1IGNA 2OPTA 1FEXA 2NS7A 1RKTA 3G1OA 1U9NA 1MBJA 3ZOBA 4MFEA 2LKXA 1F36A 2XGDA 3O8GA 2DJNA 3HKZN 2R5YA 1H88C 5IOYA 4DZPA 3RQIA 1ZTRA 1MBKA 1APLC 2NS8A 5F0HA 5IP7J 3CCYA 3LSJA 1YRNA 3M4OJ 2I10A 2XPUA 1E3OC 1TC3C 2B63J 3ZQGA 5M3MJ 2IBDA 2VI6A 3QPLA 2P81A 2X6OA 5M5WJ 4J19A 1ZGWA 5DS9A 4DYRA 1MSEC 3S1RJ 3JREA 4GFBA 1NTCA 1JGGA 2XB5A 2JN6A 1SANA 3MVPA 2JJ7A 2DA2A 3TEDA 1BW5A 2DMUA 4DYCA 4HNVA 2M0CA 1QVUA 2DA1A 2R0QC 5C4JJ 4CYCB 1HOMA 1JTXA 2L7FP 3BR5A 1LFBA 1IG7A 1A5JA 1RR7A 2CQXA 2Y9ZA 3O8HA 1WI3A 2M34A 2R92J 3H0GJ 3GTQJ 1AHDP 5E3OA 5FKKA 2HI3A 4D7NA 2NVYJ 4MO7A 4A3KJ 1IDZA 1JUSA 4XRSG 2HOSA 3HOVJ 3OIOA 4XRMA 3MN2A 2R5ZB 1GUUA 1B72A 5JLXA 5EZHA 2AO9A 5IYBJ 4IEJA 1JT0A 4I76A 1I50J 4C3HJ 3JRIA 2RAEA 2XGEA 2FJ1A 2JMWA 2N8GA 1A6IA 2DA7A 3PO2J 1UMQA 5HODA 2G0EA 5J1RA 5GP9A 3WHBA 4MIMA 4A3FJ 2EQRA 2LVSA 1WCMJ 1FTZA 1ZKGA 5C3EJ 1HLVA 3H3VK 3RZDJ 3S17J 1I6HJ 2E2IJ 5FKLA 2XGCA 4A3MJ 3HDDA 1Z0XA 1JTYA 3S2DJ 1HCRA 3IV5A 2JA6J 1XS9A 1DU0A 3CMYA 5FKNA 2CRGA 1HDPA 1NK3P 3RZOJ 2IAIA 1B8IB 2DMTA 2LFBA 1P7IA 1QPIA 2Y30A 1PUFB 5E3MA 2MW8A 5E3NA 2K40A 1HDDC 4BXXJ 4B4CA 2X48A 2EZKA 2YU9J 1ETOA 1MH3A 4EEFG 1Y1WJ 1LFUP 3BG3A 3WHCA 3PO3J 1QRYA 5BNGA 1FIAA 1JKQC 2L7ZA 2XPWA 1ENHA 1GVDA 2ME6A 1BJZA 2DMPA 4A3EJ 1XC5A 3HOYJ 3BG9A 1SFOJ 2W48A 4QTRA 5J3LA 1IDYA 1X58A 4XICA 5M5XJ 1O4XA 2COBA 1H89C 2NVQJ 1BW6A 3BT9A 2CQQA 2EH3A 3BTJA 3HBLA 1IC8A 3IH3A 5GPAA 4BY1J 4UUSA 5C44J 4CYCA 1XG1A 3OSGA 2CUEA 5F0CA 1T56A 5EEAA 1U8BA 1H8AC 3NAUA 5EF6A 4Y7NJ 2NVXJ 1ZK8A 3ZQIA 3HOXJ 3SJMA 2CU7A 1POGA 2LR8A 1MBEA 3VPRA 4B1RA 2MSYA 4C2MJ 2HQ5A 1JJ6C 1ETWA 3NARA 2L7MP 2L9RA 1U9OA 3OOUA
chains in the Genus database with same CATH superfamily
3DPLC 1D8KA 4F52A 3JRGA 4GO1A 3G1MA 4CXFA 1HF0A 4AYBN 2B9SA 2JA8J 4CGZA 2ZJRF 1EH8A 1G4DA 1TW3A 1ZG3A 2QGUA 2R7QA 1S7AA 2XUBA 2KIQA 1KQ8A 1B6AA 4HNTA 2X1EA 1K4TA 2GZWA 4A2UA 5KNLA 1RPWA 4WXHA 1E3HA 3A03A 4M74A 1JKRC 3H36A 2DMQA 2UXNA 3CDLA 3S3MA 5IP6A 5B1AH 1W5CC 3L2RA 1W1WE 4RMNA 1GT0C 2EV0A 4GCVA 3F3XA 4DZJA 1I5ZA 3G71I 1J5YA 4N9IA 3K1NA 2ISZA 3GYHX 4G6QA 2Y0MA 1MMDA 3GZ6A 3W6VA 3BQZA 2DXIA 4RAYA 3M8JA 4YFNF 5HS9A 3BQYA 1W36D 3SYTA 2NOGA 1FOWA 4R1HA 3DBLB 2O0YA 2KIFA 2DA6A 1Y56A 1LQ1A 5FLMJ 2MH9A 4M3DA 2A07F 2CGPA 2WBMA 5AIPA 1YG2A 1XPXA 3S1MJ 3Q0UA 2E1NA 3WTWC 4X1EA 1XMAA 2Y48A 3OYEA 1PUFA 1F43A 2NVTJ 3OYFA 3COAC 1Q1VA 5CVUA 2IEKA 1J59A 1GXPA 2VOPA 1IZ1A 1LFPA 3TP3A 4JX4A 3CUQB 2MGQA 4PK4A 2DI3A 3DBRB 1YTYA 4BHPA 2L3DA 2LY2A 4LJZF 4X0GA 1VQOI 2Y0SA 3ISPA 4HNUA 5KAFC 3H9JA 3CMMA 4ZYAA 1U6GA 3KCCA 4ENNA 4Z2YA 2EFPA 2LH9A 4OMZA 2QSHX 3WG9A 4DOZA 5M3FJ 3JRHA 3CLQA 4ZZLA 2L2OA 4L18B 3M8EA 5CKTA 1ETQA 1AOYA 4ZC3A 5D5UB 3ZP5A 3L2CA 1K6OA 1JXSA 1MBFA 4A6DA 2OU2A 2XVCA 1TNSA 2A3SA 4ZDLA 3BPXA 4DBRA 1IAWA 2V6CA 3PM1A 3KIOA 4IF4A 4UVAA 3W2AA 2VKVA 5E17F 5EGOB 3WU2C 3W2WA 1V5EA 2IT0A 3S15J 4OIRF 1B8IA 2JWTA 1QZYA 2OZUA 2M87A 4PJMA 2HXOA 5HDKA 2HYGD 1FOKA 4E7HA 3ZMZA 1SD4A 5DCMB 5JLWA 4RM2A 1P4XA 3ZMSA 2RREA 2Z9OA 1ZYRF 1USSA 1NHAA 3L7WA 3UNGC 1BR4A 2EJRA 2X85A 3IH2A 4HZFA 1U2WA 1WH7A 2CH0A 4BBRJ 4A69C 1SVMA 2W84A 5ILSA 3TBIA 4QIWN 5BPDA 1UHMA 2E19A 1Y0UA 1MNMC 2XAGA 4LB6B 1VQ5I 1NH3A 2AXTC 2M1BA 3TW6A 5DEQA 1R4NB 5F0FA 3HEFA 1MKMA 3LSMA 5GPCA 3OS1A 5EZGA 1SEUA 5F1JA 2PMZN 2L0KA 3FIWA 2QZ8A 5IT3A 3ERED 1ZRDA 1FOXA 5H2FC 2Z1DA 2XDVA 2QKMB 1OJLA 3K4MA 3KYDB 1OCPA 1FOYA 3HOZJ 4IHXA 2W24A 3E3VA 2ELKA 4W97A 5FO5A 4ZJZA 4HF1A 3IH4A 5K5OA 1D8JA 4FASD 1JUPA 4ESJA 3FXLA 3BR1A 5IP9J 3GTOJ 2DA5A 2M5WA 4ZYEA 1OCCH 2LTPA 2M2EA 1OPCA 5FKOA 4PUSA 1VQNI 4UUTA 3JRFA 3I59A 2F5DA 2XIGA 1J9IA 2TRTA 5F08A 1BOAA 1MMSA 2JA5J 2VASA 3DPUA 4JYKA 5GAEJ 3J7YJ 2YS9A 4M9SA 4XIDA 2MFZA 2EZIA 3VFZA 2VODA 4D1QA 1LPQA 4JQFA 5FJ8J 1YW8A 1O3QA 4II2A 3WE3A 4CICA 2XSDC 4XLHA 3CP2A 2ZB9A 2EIJH 2IPQX 2FMYA 2PMUA 3CUQC 3I4PA 3KLNA 3LL7A 3LFKA 3LQQA 1VQLI 4RB1A 3WODF 1SFUA 4OIPF 2GAUA 4C3JJ 4RBOA 4ZDOA 1DPRA 2D2WA 4HOBA 2OF7A 4OAZA 1MH4A 3ABKH 1QVTA 1RI7A 2LLKA 3K9TA 4ZH4F 1QZZA 1WPKA 5LBQA 3DKWA 5J4VA 4Y52J 1MSFC 1U3EM 4S05A 2A05A 2KKOA 2GOMA 2HYJA 5D4SA 2CWEA 1TTYA 3MKZA 1XCVA 3BR2A 3GTKJ 2H94A 2LD5A 1EA3A 4B3AA 3A01A 1X3ZB 3HRMA 1HC8A 2R7UA 2LG4A 2WAFA 2ZJPF 1X19A 3DEWA 4KUMA 3CMEI 1J75A 5DTDA 1MNEA 4QSHA 4U0VA 4HDVA 1PP7U 5D5XB 4G7HF 2AHQA 1V5GA 1R9TJ 2X9DA 2O9LA 1Y8RB 2FX0A 4YEJA 3JR9A 3VDXA 1SAXA 1X3WB 3EYYA 3FXJA 3GX4X 2X0LA 2OPTA 1RKTA 5KAIC 3G1OA 3WGGA 4BU2A 1MBJA 2MD0A 3ZOBA 2LKXA 4K2EA 2RC4A 3WE2A 4A5NA 3LQRA 2HQRA 2CW7A 1OYIA 5LGTA 3PIOF 2VE8A 2BHYA 2DK5A 4DZPA 1N75A 4EJUA 2VT3A 1MBKA 2LKPA 1TNTA 2RNJA 5F0HA 3M4OJ 1YRNA 1QGPA 1G3WA 1E3OC 3NWTA 3HSRA 2HFHA 3KEOA 4ENJA 1IW7F 2DFFA 1EV7A 1LDJA 3T5XA 2YX7A 3M7GA 1OCOH 1Z9CA 2X6OA 4IOCF 4CZZA 4BGDA 5M5WJ 4BYYA 3NWSA 2IVMA 2YX4A 2LBFB 3T8TA 4GFBA 1NTCA 3FMSA 1EJ9A 2MD5A 3ULQB 3MZHA 2XB5A 2IS1A 4KN4X 2JJ7A 5DM7F 3P9CA 4V19K 2L5QA 1BW5A 1JTXA 4CA0A 2F2EA 5E8GA 1R4MB 2RN7A 1QA6A 2Y9ZA 1MMAA 2FOKA 3O8HA 3H0GJ 3P7NA 3IAS2 2KISA 2KDOA 3DU6A 3BJ6A 3GTQJ 5E3OA 1UZCA 5FKKA 2BYVE 2ZMEA 1M1EB 5H6QA 2FEZA 3CF5F 4A3KJ 4XRSG 3HOVJ 4UNOA 3I71A 4NUBA 3I0TA 4HA8A 3BY6A 2HGCA 2R7DA 5FRMA 1K79A 5JLXA 4BDZA 3GFLA 2HTSA 2V1XA 3VYSB 3DU5A 2FBIA 3QRFF 3FHNA 2CFOA 4I76A 4M9ZA 3ZQQA 1FSEA 1W7PA 2XAJA 3BZKA 3GMEA 4I0BA 3JTHA 2JMWA 3OYLA 2E7WA 4O6JA 3PO2J 2DT5A 5L3BA 2EA4A 3CJTB 4AIJA 2ADUA 5GP9A 2LSOA 1IF1A 2NRAC 4RS8A 3ZN1A 3RQ4A 2IA1A 1OMIA 3H3VK 3OWTA 1I6HJ 1YO5C 3S17J 3QPHA 2HU9A 5FKLA 2P6TA 2P7VB 1Z0XA 2NVUB 4RGRA 5E1ZB 3GO5A 1Z6TA 3CMYA 5FKNA 2KJCA 2M45A 2H27A 4MNUA 2IAIA 1B8IB 2CG4A 2RGVA 2DOAA 1P7IA 1QPIA 1BIAA 3LA2A 1JGSA 3HIFA 1I1SA 2K40A 2FBHA 4HV5A 2V1UA 1HDDC 5EJCA 4B4CA 2X48A 4XOPA 2B7EA 2EZKA 1XTAA 3DTEA 4DJAA 1Y1WJ 1LFUP 3AKZA 3WTXC 3FXQA 4U88A 1Z67A 3KYCB 1FIAA 2XGXA 1KONA 2L7ZA 4U7DA 4HDUA 1T6SA 2CO5A 3F72A 2R7XA 2H6CA 1BJZA 4L9JA 2OTJI 2DMPA 2ZMEC 3FMQA 4HPQA 1YIJI 1KQ0A 1FYMA 4PDKA 5J3LA 1IDYA 2ETHA 1A36A 1ZRFA 3MZYA 2CSOA 1PYVA 4GYGA 5HS7A 4KMFA 2NVQJ 3CMAI 1BW6A 2EH3A 3K4JA 1TLHB 1X1PA 4N9HA 3HUGA 4XORA 5D6FA 3RKWA 1IC8A 5IT9K 4PFOA 4BY1J 5C44J 3OSGA 3N97A 2CUEA 1T8IA 1T56A 2KMUA 1O3TA 1TP4A 1U8BA 4GDFA 3TL4X 2DOFA 2XC7A 3VYTB 2W25A 1YOVB 2DJIA 1HW5A 3VPRA 2NYXA 5FFZA 3QPTA 2E7XA 3BP8A 1D0YA 1ETWA 3H1CA 2L7MP 1U9OA 3CCSI 1NG7A 4A93J 3WTTC 1ZR2A 3L00A 1K83J 3E1SA 3K0LA 3H5AA 1MNDA 3RPUA 1OCZH 3F22A 2KQRA 2M7AA 4R79A 1R58A 3LSGA 4P9FA 1K6YA 2VLAA 2HDDA 1QQIA 3FK6A 1X2NA 3RPQA 4RLFA 3CC7I 1YW7A 1R7JA 1B9MA 1HW2A 1TQPA 3L2VA 2E1OA 4H4KC 2G7HA 4Q47A 1SD6A 4OAYA 4L9VA 3H5RA 4IHVA 1N77A 1R5HA 3RI4A 1R23A 2PMHA 5LFAA 1E17A 2ZSHB 2OJED 2XF7A 1TZLA 3OYNA 5LGUA 1IV6A 2VT2A 2EV5A 2FA5A 3RPUD 2DA4A 1ETVA 4WXCA 3ABLH 4FHTA 4OOIA 1BIBA 1XGMA 1ODDA 2CUJA 2O61A 1XGOA 1I1GA 3KP2A 4CYDA 3F8BA 5F27A 3E6CC 2Q2EA 4NBQA 4EJWA 3JRDA 1RIOH 2HXIA 1WI9A 4KICA 1IN5A 3ZCOA 5D5WB 4WK8F 1KU7A 3SZTA 3T0YA 1W36C 3VEPA 5M5YJ 4UY8I 4D7MA 4QPQA 3F8MA 1SFXA 3CZ6A 5EGOA 4HQEA 3GTPJ 3GEZA 2VUMJ 4Y4RA 4KT6A 3GTJJ 5K7HA 3KFWX 4E6KG 5L3EA 1YRNB 2V79A 4BJTA 4LG3A 5EEHA 2RV8A 3EPZA 1RC9A 3OYCA 1VQKI 3HSEA 1DU6A 3ZQLA 4Q4ZF 4EM0B 1LJ9A 2O8XA 1D0XA 2O8KA 5K7FA 5E18F 1T33A 2ID3A 4IQ4A 2LK2A 1X1BA 1TWAJ 2HKXA 3EUHA 3LSIA 2JTVA 2VOOA 1TBXA 4PSXA 2VKEA 2FUG2 3BG5A 3B6CA 2CS3A 2ZKZA 3H9QA 3OYAA 3CCEI 1JUMA 2OV7A 4P1WA 1SMYF 5E79C 1QU3A 1D0ZA 2FSWA 2VL8A 3CCRI 2ACJA 1V54H 4CO8A 3G1LA 4YIIA 5K5QA 3BTLA 1WWXA 2BE5F 3BR3A 3N05A 2ZXWH 2LY1A 1FBSA 1A35A 1V4RA 4YIFA 1EKEA 1Z77A 4JX6A 1U5TB 1X2MA 2VB6A 5DDGA 4BDYA 1SFKA 1G2HA 2M9HA 5L3CA 3D5LA 1QHGA 2VE9A 4CCJA 4CUGA 1IRZA 1RZ4A 3S14J 2H8RA 3AL0B 5FLXK 1ON1A 4MFDA 4A3JJ 3G3ZA 2ZNZA 3QU6A 1Z3YA 2R7WA 3BZ6A 1UB9A 2DTZA 5JFRA 4FTHA 3K7AJ 2L7KA 3W6JB 1VF9A 4BNCA 2LY9A 1AKHA 1L3LA 1FIPA 2PJRB 4IHWA 1AKHB 4DW6A 3QP6A 4YELA 1BL0A 4XLPF 2STWA 5A2QK 1GLNA 1S3JA 1UG0A 5FD6A 4AIKA 4EJVA 3FDYA 2R5ZA 4B48A 1J09A 2EZHA 3CD6I 3FK7A 2BGCA 3E97A 4MHGA 2ZFWA 9ANTA 4PGHA 2PJPA 4IHSA 2MG4A 2XB0X 3SZGA 3HKZA 3T8RA 2JPBA 2PN6A 3KPHA 3J81Z 3OYKA 2JSCA 5IY5H 2VKHA 5JHUA 5CJ9A 4NDLA 2F5EA 3IWZA 4YFKF 2DTRA 4F3QA 3OL3A 2UZKA 2QQ8A 5D8KB 3DV8A 2QF7A 2K02A 1P4AA 3PL8A 3HOUJ 1G6NA 1Y0NA 2A6HF 2EBIA 3SEQA 5EYRA 4KIFA 2IXSA 3PQJA 1PP8F 4HLXA 3GTLJ 3OYBA 1ZELA 3DKYA 1P2FA 1Z05A 3TO9A 2XV4S 1LB2A 2CUFA 4IVNA 2DQRA 5KK1A 4CCMA 4A3GJ 1BBYA 2OQRA 3X2QH 1HKSA 1Z7UA 2XRLA 2OAZA 1RR8C 3ML6A 5EG0A 2CW0F 1JHFA 5DUKA 4XKWA 1O7FA 3IP4B 3AG3H 1FBUA 3D0SA 4N4NB 4AIDA 5E20A 2CJJA 3M1EA 1FPQA 2ZC2A 1TWHJ 2XASA 5IYCJ 2GBYA 4C3IJ 4E4HA 1YS6A 1IUFA 4AC0A 1RKWA 2ZJQF 3M1CA 4G6TB 4ENKA 2JRMA 2QEXI 1I3QJ 2A61A 3HM5A 1Y8QB 2E71A 2JA7J 4MTDA 1U0JA 1W0UA 2Z5UA 5K1YA 4M6VA 2M4KA 1S6LA 5EDNA 3IUOA 2CQKA 2FXAA 2QQ9A 3S1QJ 2XF6A 4RGXA 1FTTA 4BHCA 2TCTA 3FXKA 1J7KA 4R8HA 3RTRA 3T1BA 3GFJA 2Y0SN 1QPMA 1W5SA 2FU4A 1YJ9I 1K4SA 4KDPA 1B4AA 1LUJB 3D1NI 2VBYA 2OBPA 5FRNA 4IHTA 2R7ZJ 1FP2A 4NNJA 4UV8A 1ORKA 2XSJC 1I27A 3EETA 3HZJA 4IXAA 4DIQA 3BR0A 3V8JA 3UR3C 1Y1VJ 3Q0VA 2I8DA 1W7PD 5FGMA 3QAHA 3VOEA 6PAXA 2K9QA 2MA3A 2BY2A 3LSRA 3S3OA 1Q1HA 1U8RA 3ASOH 1UHSA 2H09A 1S9HA 2X1CA 4RAZA 1VQ9I 4EATA 2PJRA 1HXDA 4JX5A 3Q0WA 1UAAA 4IOAF 2JT1A 4AUXA 2KL4A 5TGTA 2VC1A 1IGNA 3KLOA 1FEXA 2NS7A 1X1DA 2PG4A 1R6RA 1U9NA 4UUVA 4JOMA 3ECOA 1YLFA 2BW3B 3HKZN 2TDXA 2R5YA 5HLTA 1K78A 2J5PA 2KP6A 1WHUA 3G2BA 2F4MB 3RQIA 2HEOA 2BEOA 3AG2H 4N0BA 4FX4A 2P6SA 1VQ6I 1BI1A 5IP7J 3CCYA 3LSJA 3W2VA 1XSXA 3J81K 3QODA 5M3MJ 3MCZA 3QOEA 3C1DA 2VIXA 4B43A 3QPLA 2UV1A 3PUBA 2Z16A 2O03A 2KLOA 1XDUA 2Q1ZB 1RUOA 1YJNI 4Y13A 2UWMA 2DFIA 4DYRA 5JVGF 3S1RJ 3JREA 4RA2A 1WQ2A 1Y39A 1JGGA 4F91B 4OIQF 4XQFA 3GW2A 2FMLA 3EQLF 4DQ2A 1SANA 2RQQA 1FWZA 1XB4A 5ICCA 2BXYA 3BG7A 4DYCA 3L2WA 1R49A 2BXZA 4BJ6C 2DA1A 2R0QC 3L09A 2VJIA 2LMDA 4CYCB 2ZO4A 1HOMA 3OYDA 1S8NA 2L4MA 2WTEA 3CF2A 3DLAA 4HW0A 2JVGA 2QM3A 1N25A 4HEA2 1QNTA 2R92J 2DT6A 2FOWA 3FX3A 4C9YA 2IGNA 2FF4A 4LLGF 2K85A 1AHDP 2EWNA 2NVYJ 2P8TA 2QKLB 3E6DA 1VTNC 2MH2A 3I58A 5BQTA 3CCVI 1UELB 5ERIA 4XRMA 5B5EC 1YE9A 3MN2A 3K1PA 2NNNA 1B72A 4XKCA 4NQWB 5EZHA 3R61A 3JSPA 4WWCA 1S7OA 1WJAA 3FWEA 4IEJA 4LB5A 2MYSA 3E5UA 1P92A 4C3HJ 1WJCA 2NXNB 1SAUA 4OU0A 1O3SA 3ZRGA 1CF7A 2FJ1A 2BW3A 2ISYA 2DA7A 4XSZF 4OINF 3I55I 1ULYA 2RQPA 5J1RA 1YX3A 4A3FJ 4MIMA 4Y15A 1BR1A 3A0HC 2PI0A 2EINH 2EK5A 1ZKGA 1D3YA 3RZDJ 2E2IJ 2OTLI 2NAZA 4KFCA 3FXOA 2Y69H 4XLFA 1JTYA 4CZCA 2JUCA 2DW4A 2VBXA 3S2DJ 4YG2F 4GRIA 1HKQA 4F7ZA 4KMUX 4KYWA 3RZOJ 2P5VA 1NK3P 2MC3A 5CLSA 5D4RA 2LFBA 2K7LA 1D1CA 2Y30A 1S5LC 2GOXB 1LEBA 1KZHA 3FZVA 4E7LA 5LRRA 4XKVA 5E3NA 1WJFA 3MMYB 2KIUA 5CYVA 2DLLA 2WB1A 2KRFA 3BLYA 4M6YA 1OISA 4HF0A 1ETOA 1MH3A 3TO7A 4BQQA 1BI3A 3WGIA 3S32A 2XKPA 4ANJA 4XLNF 1FMVA 2BVLA 3OYJA 1QRYA 5BNGA 2LYCA 1JKQC 3OR1C 1LVAA 5ICEA 5LD2C 5CVJA 1XN7A 2ME6A 3TOBA 3GUDA 2DK8A 1SD5A 3KEQA 2CYYA 2EA2A 3K10A 3I59B 4CCLA 3LMMA 3K4CA 4EJTA 1X58A 4NC6A 4NC7A 1OCRH 1KU3A 4LGWA 3TOAA 5LGNA 5HDNA 5M5XJ 1O4XA 1A31A 3CC4I 1VQPI 2XAUA 3BT9A 4CCNA 2CQQA 3OV8A 3HBLA 4HLYA 5HLIA 1E3PA 5CVVA 5CPRB 4CYCA 1XG1A 1HSTA 2E1CA 2LOOA 3DLLF 1H8AC 4IPAA 1H9GA 3V7SA 5EF6A 3RDIA 1KYWA 1ZK8A 2WA0A 3PFIA 2LR8A 4RAFA 1MBEA 4B3XA 3KP4A 4B1RA 2MSYA 4C2MJ 1O3RA 2KPMA 2HQ5A 1JJ6C 2BVMA 2STTA 4U87A 3K69A 3NARA 2E36A 4MQVA 1G3TA 4UV9A 1ZGJA 4ZYHA 1VQ4I 3OOUA 3Q9SA 5DV5A 1DGWY 4LK1F 5KCMA 1BI0A 5CQEA 2WV1A 3KEYA 4L0YB 2QA4I 1F5TA 1HQCA 2XROA 2H6BA 2G7UA 3TDUC 1VFCA 3LOCA 4G7ZF 2IJLA 2VQLA 2A69F 3MKLA 1VNDA 1MZBA 2IGMA 2XKOA 3WU1B 3GWZA 4C2UA 1WJ5A 1BN5A 3BR6A 3JRAA 4BHBA 2O3FA 1ZR4A 2WAQN 4RDUA 4IRIA 5GAGJ 2VPLA 4P96A 4RM3A 1VQ8I 1VZ0A 4LIUA 3R60A 4MEXF 1Z1DA 1FX7A 2JK3A 1KU2A 3HGGA 1ITYA 3MEXA 1V55H 4I99C 2KHMA 1BC8C 4B09A 4V2FA 2ME0A 1CQTA 5FLVA 2VXDA 2DPUA 1EH7A 4QLCU 5LHIA 2R7VA 1TWCJ 3ABTA 2CQNA 1BR2A 1MD0A 5IOZA 1E2XA 3GLLA 2DDBA 3DEEA 3HTSB 3JRCA 2Z99A 4B44A 2W85A 1LNWA 1FJLA 3CO7C 5F64A 2C6YA 1FBQA 3M07A 3ONQA 1GDTA 3KP3A 2W82A 4RGSA 3VB2A 1W7PB 4EVIA 3Q3SA 2M30A 1EF4A 4AVZA 2HTJA 2F4IA 5IPAA 2R7TA 2K9NA 3L9FA 3RKQA 1ZQ3P 2W4SA 4D9JA 2O7OA 2M4GA 1VQ7I 2WB1N 2L4AA 3MWMA 5AIQA 1FNNA 2QQAA 3FXMA 4AWXB 5J6XA 4KIBA 2R7FA 3LA7A 2LP0A 3FM3A 1MDMB 2X4HA 4E7ZA 2LBFA 3O2PE 3A4CA 4HAMA 2QENA 4XKBA 4II3A 4PJLA 2RVCA 4OIOF 4PFPA 1S7EA 5GTHC 5KHDA 4XLAA 4FE4A 4IJAA 3ZQHA 2R93J 4TV7A 2K9LA 2QQBA 4BE0A 3HJEA 4M9XA 3IAM2 4M3GA 1Z7LA 4Z6YA 3CCMI 1WJEA 4A3IJ 2DMNA 2L9VA 3U1DA 1QO0D 3CQZJ 3QQAA 4BEHB 1B72B 5HOOA 4XL9A 4LMYA 5DD4A 1RESA 4Y3OA 3M9AA 4F92B 2HPIA 1R71A 1SFEA 2COMA 4LFUA 4BBSJ 1MBGA 1SVOA 3L2QA 2EFOA 1W0TA 3F0CA 2VC0A 5J8FA 2DPDA 4BQAA 3PUFA 1OQYA 1SMTA 3HPHA 3S2WA 2EFNA 1I39A 5BS6A 2HS5A 5LHGA 3KX2A 1C0WA 2KT0A 4HF2A 3MZ8A 2QBYA 2FD5A 1JE8A 4XOTA 4AIHA 3E0JB 2IW5A 5FROA 2G9WA 3CJNA 3NQOA 4NB5A 3TP0A 3KZZA 4KIGA 2K3FA 4Y17A 3MFKA 4BACA 1YS7A 2ELJA 2FQ3A 1BJAA 2HR3A 5A2QZ 3V42A 1T0FC 3S93A 4IX7A 3IKTA 1MJBA 3GVAA 3A01B 1ETKA 2ECCA 1BI2A 2JRTA 1XDSA 2X6WA 4F93B 2V1NA 4J00A 1EH6A 3BTCA 4W1UA 2V9VA 2ZBKA 3SDGA 2HQNA 1ZARA 3QYEA 3LFUA 3P5JA 4BJ5C 4BE2A 4S0HB 4BQOA 3C2GA 2BY3A 2QVOA 3QYBA 5D5VB 4RB3C 1YFHA 4A0XA 1DP3A 1WVRA 3KP7A 3TMOA 2Y2ZA 3I5UA 4XMYA 4WXDA 4G12A 4E7IA 3VSKA 1IN6A 1V3FA 3CCLI 2JVHA 4M3FA 3GTGJ 4A3BJ 4PJ0C 1UG2A 3NEUA 4XR6A 4D5CA 1LE8B 2DAOA 3GZNB 2M8GX 4BH9A 1AU7A 2R5YB 1K78B 3LAJA 3KETA 4WCGA 1TL8A 1CF7B 2OC6A 1DDNA 3GCMA 2LF7A 3BC8A 1IXRC 1I3AA 3FKJA 4QWQA 4BY7J 4ZZDA 1N78A 1TQMA 4M3EA 2KZGA 3BDDA 1ZRCA 3AG4H 1IRGA 4O3MA 1HW1A 2OA4A 2VPRA 3LNQA 2EIKH 4RAGA 3ZXSA 4JBAA 2HDWA 2MLGA 1JKOC 2VJ4A 3ASNH 4LG0A 4L9NA 4XK4A 5C4XJ 3AL0C 4LLNA 1Z6RA 2HVRA 1UHWA 2HOTA 5J40A 3GLXA 3CTAA 3BWGA 2Y31A 4CCKA 3QWLA 4LOCA 1IRXA 4BL0B 1X1CA 3DFGA 4MGRA 2BY0A 2HQAA 2GLOA 4PJNA 1JKPC 4L9TA 1UFMA 2RNGA 4BAYA 3BPVA 1YIOA 5BMZA 2GXBA 2YSRA 4BEHA 3HYIA 5B66C 3K1MA 1T0FA 3EDPA 3C3WA 1WFXA 4EMSA 4G6DA 3K2AA 2OQGA 3G4SI 3HOWJ 3HGYA 4D0PA 3V4GA 1GHCA 2DOEA 2NOJB 5DCMA 1R1UA 3PNVA 1MBHA 4XSXF 1IJWC 3WGHA 3TW7A 2WY7Q 2BBYA 2P0WA 2CUZA 4EGYA 3GTMJ 2KDZA 4MLOA 5BPIA 1FZPB 4CSWA 3FKIJ 1K61A 5GADJ 1QBJA 4UVBA 2DT7B 2CFXA 3G6EI 3ZGKA 3HL2A 1R5GA 3OOPA 5KVRA 3F9KA 1V5FA 1J0RA 2E1MB 1XX5A 2DFHA 2XAFA 2XGDA 3O8GA 1JI8A 2WWYA 3WTVC 1H88C 5FD5A 1IO2A 4P55A 5IOYA 2LREA 4C2TA 3JAMZ 3BCBA 1ZHFA 2ZNYA 1NG6A 1ZTRA 1P9QC 3RCOA 3I54A 1HBXG 2NS8A 4QPOA 2JUGA 3GFIA 2I10A 2XPUA 1MDMA 1TC3C 3RSNA 3S3NA 2E5ZA 1OKRA 2AQFA 2QSGX 4PJJA 2IBDA 2VI6A 1VQMI 1F4KA 2K5CA 3KP6A 2P81A 3JW4A 5TRDA 2K4BA 1ON2A 4J19A 1ZGWA 5DS9A 4KJZA 1G3SA 4E7KA 3O6BB 3HRSA 3C2HA 2F6CA 1IN8A 2V26A 3MVPA 4MQ9F 4BQNA 2GQQA 1IXSB 1HSJA 2DA2A 3J7ZI 4HNVA 2PBIA 3R0AA 1QVUA 1Y6IA 3I9V2 1FSHA 5C4JJ 2K4JA 2HDCA 2GWRA 2L7FP 1LFBA 1IG7A 2GA2A 1KU9A 1A5JA 1RR7A 4EJOA 4HX4A 5LEKA 2M34A 1LDKB 4IO9F 4ZYGA 2AS5F 2ZMEB 4IL6C 5D6EA 3KZYA 3ZMUA 4D7NA 4MO7A 1SC7A 3SFZA 1IDZA 1SD7A 1JUSA 2HOSA 3Q9VA 2EFWA 4I02A 4IRGA 2P5KA 4XONA 2R4GA 3J80K 2LF8A 1A6QA 4G9YA 5CVRA 2QWWA 4KNYA 1O7LA 2R5ZB 3QOPA 2A6TA 1KGSA 1KYZA 2KJBA 5D8LB 2WAEA 4GGGA 3BZCA 4XBFA 4E7SA 1I50J 1MJ9A 5IT9Z 1MJAA 5F1RA 2RAEA 2XGEA 1W4MA 2N8GA 3FF5A 3IKVA 2M3AA 5DCFA 5LLQA 3IL2A 2BHZA 2G0EA 4ON0A 2PMZA 1PDNC 2X51A 3U21A 3K4BA 3WHBA 2VJ5A 2OZ6A 4UVCA 5DD8A 3OYIA 1GVJA 5L3GA 1WCMJ 2XRNA 3CCUI 1FTZA 1HLVA 1RNLA 1UJ8A 2XGCA 2KRCA 5F6FA 2E35A 4FQGA 3A2KA 2NNYA 2AXLA 2O5RA 4HRIA 1XS9A 2CW8A 1T95A 4ZYDA 2JZYA 4I09A 3CLOA 3H9GA 3REOA 4EV0A 3HTUA 2QSFX 2J5OA 5TISC 2MW8A 4GXOA 3V8KA 4BXFA 1GXQA 2ELHA 1G8XA 2DO7A 3SEZA 1T98A 5HLHA 2PQ8A 2GXGA 2UUZA 3BG3A 3FXRA 3WHCA 1YYVA 1R36A 4BUPA 3PO3J 1MIJA 4O5VA 1DUXC 1A04A 2ESHA 3K70D 2H1LA 3J7AY 3TGNA 2HOEA 1ENHA 1GVDA 2A5YB 3HHHA 1X1AA 2F4OB 5J8CA 5JHFA 3HPGA 2BV6A 3DTIA 1YHQI 4A3EJ 1B1BA 4RB2C 2OD5A 3HOYJ 3BG9A 3OL4A 4PCQA 1SFOJ 2W48A 4QTRA 4XICA 1YITI 2COBA 4FT8A 3DPTA 3EYIA 4M72A 3ZN0A 3WTYC 3BTJA 4JK1X 1R1VA 3HRTA 3P9IA 4I7HA 1WKMA 4AVPA 4HYEA 1X4PA 2VJJA 4U7BA 1U5TA 3OYGA 5EEAA 3GXOA 3J80Z 2NVXJ 3VYRB 2GXAA 3ZQIA 4I98B 3SJMA 2CU7A 2IA0A 2CV0A 1POGA 3HXLA 1L0OC 1PUEE 3HOTA 2H8WA 1REPC 5CQGA 2A68F 1WJDA 1XGSA 2CQ7A 3K4NA 4XRFA 2PFBA 4XM3A 1ZH5A 3D5SC 2M7BA 3PIPF 5ICFA 2L9RA 4DBQA 5J47A 2XHKA 3AG1H 3H3UA 4A12A 3C7JA 5FB2A 1PJRA 2XAQA 2HWVA 3DTKA 3LSKA 2WV0A 3PNTA 1G59A 2DCEA 4WX9A 2Z33A 4AD9A 1IN4A 1O57A 3OYHA 5BOXA 4I2OA 3CJQB 3E5QA 1OCTC 4DYQA 2L02A 4MEYF 4NHJA 1HKTA 3PQKA 2HZDA 2DA3A 1U5TC 3I53A 2Q0OA 5B1BH 1XMXA 4C30A 3PSFA 4J01A 4N4OB 1D1AA 2K9MA 3ZQCA 1JT6A 1FLIA 4LIVA 2FQ4A 3FBNB 2IA2A 4JP0A 3OSFA 2A6EF 3H92A 1YQAA 1OR7C 1U78A 4M71A 2O6GE 1UCRA 2R3SA 2AQEA 2Q2EB 1H0MA 4IHYA 1D5YA 2D45A 1RUNA 3L2UA 1ERDA 4ZTJA 3H3ZA 3ZPLA 2P4WA 5CVIA 2EZLA 4FCYA 1VI0A 4FE7A 3ROUA 2DBBA 4F55A 3U9GA 4IRHA 2W7NA 5JR3A 2EILH 4RGUA 3HOSA 3F8CA 4ZTFA 3HRUA 2FNPA 2ID6A 3FMRA 4I01A 2HNHA 3RKXA 4FISA 4PZJA 4RB0A 2DDAA 1ETYA 3OR2C 3DQVC 1P4WA 3SFIA 3WTZA 2IS4A 3P9KA 1TWGJ 2VXZA 1IUYA 2V4JC 4AM3A 2KIMA 5J1UA 3PFYA 3LA3A 4V2GA 2XPVA 3I4MJ 4KISA 5E1WA 3VYUB 4IQJA 3OS0A 2Z3YA 4A3LJ 1G3YA 3IWFA 3R6SA 2VBZA 3AAFA 2W1OA 1FMWA 1F9NA 1BA5A 3PJRA 1FP1D 1NK2P 3LAPA 3I4NJ 1FY7A 1FYLA 1RRJA 2YPRA 2YU3A 1MMGA 5TJJA 3WTSC 1ZG5A 2ZXJA 2PLYA 4BE1A 1DGRM 3K2ZA 3ECHA 3RJPA 1D5VA 2LC2A 1PVEA 1XMKA 3HG9A 5LEJA 3JSOA 5IYDJ 3ESWB 2K3PA 4X6AJ 3LSPA 4M3BA 1JJ8C 2KFDA 1OFCX 4ESBA 2DODA 5L3DA 1LKXA 1WGXA 2QYOA 5FKMA 1FT9A 1GV2A 2HOAA 2W00A 4I6ZA 1BM9A 2Z2SB 4CDGA 3A02A 3OIQA 4LG0B 3HC7A 1S72I 1T08B 1LEAA 3BG6A 3IHUA 2K9SA 3HB9A 1STZA 2HVQA 3FBIB 4FETA 1OR7A 4M6XA 3K6GA 3IRQA 3KZIC 3C2BA 3EUAA 3DWLE 2XF5A 5LHHA 3QU3A 3L1PA 4EQQA 1ZLJA 3M8FA 3OIPA 2DFEA 3E7LA 2VN2A 3F8FA 1RETA 3Q5FA 3VSLA 2WAQA 3S2HJ 4A0YA 1IN7A 2BOLA 5GTIC 5LRSA 2ECBA 2L01A 2ZCWA 2QUFA 3ZQ7A 5EG0B 1R1TA 2RDPA 4UHTA 4BKXA 4RLQA 3H5NA 3M3YJ 2DN0A 2E2HJ 1ETXA 2X6YA 3O3KA 3U1KA 3BROA 3AFHA 4YFXF 3NRVA 4YIRX 3TKYA 2H1KA 1OLTA 4ABZA 1YJWI 1BOBA 5H6RA 4OMYA 2ZJ2A 4XRSA 4A6EA 2E2JJ 1W5TA 1WSUA 3IC7A 1TT5B 2HPMA 1JHHA 3BOQA 3PNYA 2HVSA 2WY8Q 3HSFA 2X1DA 4HQMA 3CUOA 4D5FA 1BC7C 1WJBA 2GM4A 3S16J 3FISA 4A3DJ 1X4OA 3RYRA 4XLCA 1WH5A 2EV6A 2JSPA 3DCFA 3CP8A 1ONVA 1OYWA 2Y75A 3FM5A 3H35A 4KITB 3PSIA 2B0LA 3JAMK 3R4KA 1ACIA 2VQGA 4AYBA 5EEGA 3ABMH 3QPSA 4ZDPA 1T38A 5ILUA 3K4LA 4DGWB 3GBGA 1CGPA 1AWCA 4H0EA 2DYSH 2F5CA 2E34A 2ZSIB 5E1XA 2WC2A 5DM6F 3B6AA 3CO6C 3I3LA 3ABUA 4L5JA 2F5VA 4ESFA 5K5RA 3W6KB 2FNAA 1Z21A 3WG7H 2Q8KA 4LITA 4EM1A 5J1YA 4A5MA 4HV6A 3KE2A 3IRRA 2YUSA 4I0AA 4UB8C 3BTIA 3I64A 2QCOA 1YW9A 1P7JA 4FX0A 4ETSA 3S1NJ 2E60A 3K70C 1P6RA 2ICWG 3MKWB 3MKYB 1Z91A 3TO6A 4YRVA 4XN3A 2D1VA 5K7ZA 2UXXA 3ZQFA 3E6MA 1FC3A 1GV5A 3DBHB 4ASNA 5AONA 4UUSB 2CV2A 1DPUA 1X3UA 2Y9YA 2LNBA 1I6XA 4PSWA 4B47A 4G8XA 2YR2A 3RYPA 5HS8A 4E70A 2EB7A 2L54A 5HLGA 5HNFA 2BY1A 4XLEA 3UKGA 1B59A 3V7RA 2OUMA 4A3CJ 1IV8A 4E7JA 4U0YA 5ED4A 5F04A 2WADA 3DKXA 2EIMH 2LKSA 2KZVA 4P5OA 2MC4A 3RIRA 4IKFA 2JQ7A 2ZXIA 3JTGA 4MTEA 3JRBA 1XSDA 3K4KA 3TQNA 1ZAOA 4L5EA 3GFMA 3B02A 1ZLKA 3C18A 3MAJA 3WU0A 1TWFJ 1LE8A 2D5VA 5E3LA 3LSHA 3VWBA 2IP2A 3G73A 4BS9A 4NQWA 3GF2A 3S8PA 5J4YA 2IS2A 3DF8A 4MFEA 3CJRB 1F36A 1LVKA 3HUGB 2DJNA 4EM2A 1R5ID 3KP5A 2L9NA 5H20A 5ILVA 4DNCA 1ZG1A 2L9SA 3LSTA 2EPFA 4CH7A 4L5IA 3CCJI 1APLC 5HDGA 1XD7A 2P7CB 5L3FA 3E5XA 2VQCA 1TT0A 2V1DA 3E6BA 1D1BA 2JA2A 2B63J 1OYYA 3GZ5A 2HZTA 3A1YA 3ZQGA 2VQHA 1AA7A 2IGKA 2IS6A 2KRHA 3F8NA 4KN7X 3ZMTA 3J7AO 2FRHA 1MSEC 1YX5A 2GA1A 4HG2A 3I56I 2JPCA 2CV1A 1MGTA 4B8XA 3ERMA 3V7CA 2JN6A 4UXNA 3A0BC 3QYFA 4GYIA 3TEDA 3F6OA 2DMUA 2DU9A 2DYRH 2M0CA 3SXYA 3H0DA 4LK0F 5DYMA 1KQ9A 3ZMDA 2PX9A 3BR5A 4U0WA 1ZREA 3F6VA 3W3CA 5JI6A 2FE3A 4AU7A 2VBWA 4LD5A 2HKOA 1FYKA 2CQXA 1YI2I 1WI3A 2A5WA 2D1HA 4M73A 2M8EA 4HX7A 5B3SH 4KA4A 3CCQI 4ENMA 2F5FA 2HI3A 5E8IA 4CHUA 2IRFG 1WZ2A 3HHGA 4XNFA 1SVLA 5FLXZ 3OIOA 2HYFA 2K27A 3SQNA 2VONA 3DP7A 1B9NA 1GUUA 2BZTA 1S29A 2ESNA 2RKHA 1QZEA 2AO9A 3LWFA 4WF2A 5IYBJ 2GIVA 3VODA 3CUQA 1H9TA 2NS0A 2GIZA 4Q5SF 3U2RA 1JT0A 3MQ0A 1TW2A 3JRIA 3KYLA 4ITVA 4G94A 2P5LC 2MBFA 2R7SA 1XSVA 1A6IA 2FBKA 1UMQA 5HODA 2OCCH 2R7RA 1DP7P 2EQRA 2LVSA 3B73A 4Y33A 4Q48A 3R0JA 4HSRA 5C3EJ 4LLLA 2QLZA 3DXJF 2XAHA 4KT5C 2K86A 3SDBA 2OCEA 1IRFA 4A3MJ 1R22A 3HDDA 3OY9A 3CESA 2W57A 1HCRA 1E0EA 2V7FA 2DQLA 3ELKA 3IV5A 3EUHC 1DU0A 1J2XA 2JA6J 1HA8A 2ZXHA 2CRGA 2V9KA 1HDPA 3SZPA 2I5UA 3DEUA 2DMTA 2LDUA 4HX8A 2MABA 2X6XA 2PEXA 5E3MA 1PUFB 4CCOA 2E1MC 4XN0A 1LDDA 3MD2A 2F48A 1F1ZA 4BXXJ 3FXUA 3SHFA 1T39A 2YU9J 4S04A 1Z3XA 1R00A 4HBLA 4EEFG 2V9PA 4BXUA 5GAHJ 4EGZA 3N4MA 3ZR8X 3OYMA 3QP5A 4UB6C 2MLKA 1K7AA 2ZFUA 2XPWA 1MMNA 3FHZA 4OWRB 1USTA 4P9UA 1T2KA 4HSTA 4IZZA 3WTUC 3JCUC 1XC5A 2IGOA 5HNHA 4L0ZB 3TDZC 1XCBA 3BJAA 2LRDA 2EFQA 1H89C 4A0ZA 5ICGA 1WRJA 1IXCA 2QBYB 5DUIA 3BJOA 3RKYA 1QHHD 1ZGAA 3F23A 3CDHA 3IH3A 5GPAA 3CC2I 2R7OA 4UUSA 4PGGA 3CDIA 3BCAA 3D5RC 3EUKL 1XGNA 5F0CA 5HVQC 4G7OF 3F21A 3NAUA 4Y7NJ 3OS2A 3HOXJ 3ZMVA 1KA8A 2M0MA 3V8LA 2CMPA 5FFXA 3OMYA 1DQUA 5JVTA 1TQIA 1ZN2A 4NC8A 2VKDA 1MW7A 2V6EA 2E5NA
chains in the Genus database with same CATH topology
3JRGA 4A93J 1ZR2A 1K83J 3G1MA 2WV1A 1HF0A 4AYBN 2JA8J 1VFCA 3LSGA 3LOCA 2HDDA 3FK6A 1X2NA 1OCTC 4DYQA 3MKLA 1VNDA 1RPWA 2E1OA 2DA3A 3A03A 1JKRC 2DMQA 4IHVA 3CDLA 3ZQCA 3BR6A 5IP6A 3JRAA 1JT6A 1ZR4A 2WAQN 4RDUA 1GT0C 4DZJA 2FQ4A 4JP0A 3OSFA 1IV6A 2JK3A 3W6VA 3BQZA 3HGGA 2DA4A 1ETVA 1ITYA 3BQYA 1U78A 2NOGA 4V2FA 2ME0A 1CQTA 5FLVA 4IHYA 2DA6A 1D5YA 5F27A 5FLMJ 3JRDA 1TWCJ 2EZLA 4M3DA 1VI0A 4FE7A 5IOZA 4FCYA 2HXIA 3JRCA 5M5YJ 2ID6A 4D7MA 1FJLA 4FISA 1GDTA 3S1MJ 1ETYA 5EGOA 3Q0UA 3GTPJ 4X1EA 2VUMJ 3SFIA 1PUFA 1F43A 3GTJJ 5K7HA 2NVTJ 3Q3SA 1EF4A 1Q1VA 1TWGJ 1YRNB 2IEKA 5J1UA 5IPAA 3TP3A 4JX4A 2K9NA 2MGQA 2XPVA 4V2GA 3RKQA 3ZQLA 1ZQ3P 3I4MJ 2O7OA 1DU6A 2WB1N 2O8KA 5K7FA 1T33A 2ID3A 4A3LJ 2LK2A 1TWAJ 5M3FJ 2LP0A 3JRHA 1BA5A 2VKEA 3BG5A 1ETQA 1NK2P 3B6CA 3I4NJ 1JUMA 1MBFA 1S7EA 3PM1A 4FE4A 3ZQHA 2R93J 5IYDJ 3G1LA 2VKVA 5EGOB 3BTLA 3BR3A 3S15J 4M3GA 4X6AJ 4A3IJ 1B8IA 2JWTA 3LSPA 2DMNA 4M3BA 2HXOA 1Z77A 3CQZJ 4JX6A 1JJ8C 3QQAA 1OFCX 1X2MA 1WGXA 1B72B 5FKMA 1GV2A 2HOAA 5JLWA 1RESA 1G2HA 2M9HA 4I6ZA 3A02A 4BBSJ 1MBGA 1IRZA 2K9SA 3HB9A 3S14J 1W0TA 2H8RA 4MFDA 4A3JJ 3F0CA 3C2BA 3IH2A 1WH7A 3L1PA 4BBRJ 2DTZA 4A69C 4FTHA 3K7AJ 4QIWN 1VF9A 3E7LA 2E19A 2LY9A 1AKHA 1FIPA 1MNMC 4IHWA 1RETA 2KT0A 1AKHB 4DW6A 2FD5A 3TW6A 1BL0A 3S2HJ 5F0FA 3HEFA 5GPCA 2ECBA 3TP0A 5EZGA 2R5ZA 5F1JA 5EG0B 2PMZN 2EZHA 2L0KA 3FK7A 3FIWA 4BKXA 9ANTA 3A01B 3M3YJ 1ETKA 2DN0A 2MG4A 2E2HJ 2ECCA 1ETXA 2XB0X 2H1KA 1OJLA 1OCPA 4ABZA 3HOZJ 4IHXA 3BTCA 4W1UA 3SDGA 4NDLA 2ELKA 4W97A 4XRSA 3IH4A 4S0HB 1JUPA 2E2JJ 3BR1A 5IP9J 3GTOJ 2QF7A 2DA5A 2LTPA 2M2EA 2Y2ZA 3HOUJ 2EBIA 4G12A 5FKOA 4UUTA 4D5FA 5EYRA 3JRFA 2GM4A 3S16J 3FISA 4A3DJ 4M3FA 3GTLJ 3GTGJ 4A3BJ 2TRTA 1UG2A 5F08A 4D5CA 1LE8B 1WH5A 2M8GX 3DCFA 2JA5J 4JYKA 2CUFA 2YS9A 1AU7A 4XIDA 2R5YB 2EZIA 4A3GJ 3QPSA 5FJ8J 2XRLA 4BY7J 5EG0A 4M3EA 3GBGA 2XSDC 2VPRA 2ZB9A 2CJJA 3LNQA 3B6AA 1TWHJ 1JKOC 5IYCJ 2GBYA 4C3IJ 4XK4A 1IUFA 5C4XJ 4AC0A 4C3JJ 1RKWA 4RBOA 5J1YA 1I3QJ 2OF7A 3HM5A 2HOTA 2JA7J 2YUSA 2Y31A 1W0UA 1MH4A 4M6VA 3BTIA 4LOCA 1QVTA 2QCOA 2LLKA 1P7JA 5EDNA 1WPKA 4Y52J 1MSFC 2GLOA 3S1NJ 3S1QJ 1JKPC 2HYJA 1FTTA 2TCTA 2Y0SN 5K7ZA 3ZQFA 3D1NI 3BR2A 3GTKJ 1GV5A 4UUSB 2R7ZJ 2LD5A 2Y9YA 3K2AA 4B3AA 3HOWJ 1ORKA 3HGYA 3A01A 3BR0A 1Y1VJ 3Q0VA 3UKGA 1MBHA 1IJWC 4A3CJ 3DEWA 3TW7A 5DTDA 2K9QA 5F04A 3GTMJ 3LSRA 2KDZA 4MLOA 3FKIJ 1K61A 1UHSA 4QSHA 2AHQA 3JRBA 1R9TJ 2X9DA 4L5EA 2O9LA 2FX0A 4JX5A 3Q0WA 3JR9A 1TWFJ 1LE8A 2D5VA 5E3LA 4AUXA 1IGNA 2OPTA 1FEXA 2NS7A 1RKTA 3G1OA 1U9NA 1MBJA 3ZOBA 4MFEA 2LKXA 1F36A 2XGDA 3O8GA 2DJNA 3HKZN 2R5YA 1H88C 5IOYA 4DZPA 3RQIA 1ZTRA 1MBKA 1APLC 2NS8A 5F0HA 5IP7J 3CCYA 3LSJA 1YRNA 3M4OJ 2I10A 2XPUA 1E3OC 1TC3C 2B63J 3ZQGA 5M3MJ 2IBDA 2VI6A 3QPLA 2P81A 2X6OA 5M5WJ 4J19A 1ZGWA 5DS9A 4DYRA 1MSEC 3S1RJ 3JREA 4GFBA 1NTCA 1JGGA 2XB5A 2JN6A 1SANA 3MVPA 2JJ7A 2DA2A 3TEDA 1BW5A 2DMUA 4DYCA 4HNVA 2M0CA 1QVUA 2DA1A 2R0QC 5C4JJ 4CYCB 1HOMA 1JTXA 2L7FP 3BR5A 1LFBA 1IG7A 1A5JA 1RR7A 2CQXA 2Y9ZA 3O8HA 1WI3A 2M34A 2R92J 3H0GJ 3GTQJ 1AHDP 5E3OA 5FKKA 2HI3A 4D7NA 2NVYJ 4MO7A 4A3KJ 1IDZA 1JUSA 4XRSG 2HOSA 3HOVJ 3OIOA 4XRMA 3MN2A 2R5ZB 1GUUA 1B72A 5JLXA 5EZHA 2AO9A 5IYBJ 4IEJA 1JT0A 4I76A 1I50J 4C3HJ 3JRIA 2RAEA 2XGEA 2FJ1A 2JMWA 2N8GA 1A6IA 2DA7A 3PO2J 1UMQA 5HODA 2G0EA 5J1RA 5GP9A 3WHBA 4MIMA 4A3FJ 2EQRA 2LVSA 1WCMJ 1FTZA 1ZKGA 5C3EJ 1HLVA 3H3VK 3RZDJ 3S17J 1I6HJ 2E2IJ 5FKLA 2XGCA 4A3MJ 3HDDA 1Z0XA 1JTYA 3S2DJ 1HCRA 3IV5A 2JA6J 1XS9A 1DU0A 3CMYA 5FKNA 2CRGA 1HDPA 1NK3P 3RZOJ 2IAIA 1B8IB 2DMTA 2LFBA 1P7IA 1QPIA 2Y30A 1PUFB 5E3MA 2MW8A 5E3NA 2K40A 1HDDC 4BXXJ 4B4CA 2X48A 2EZKA 2YU9J 1ETOA 1MH3A 4EEFG 1Y1WJ 1LFUP 3BG3A 3WHCA 3PO3J 1QRYA 5BNGA 1FIAA 1JKQC 2L7ZA 2XPWA 1ENHA 1GVDA 2ME6A 1BJZA 2DMPA 4A3EJ 1XC5A 3HOYJ 3BG9A 1SFOJ 2W48A 4QTRA 5J3LA 1IDYA 1X58A 4XICA 5M5XJ 1O4XA 2COBA 1H89C 2NVQJ 1BW6A 3BT9A 2CQQA 2EH3A 3BTJA 3HBLA 1IC8A 3IH3A 5GPAA 4BY1J 4UUSA 5C44J 4CYCA 1XG1A 3OSGA 2CUEA 5F0CA 1T56A 5EEAA 1U8BA 1H8AC 3NAUA 5EF6A 4Y7NJ 2NVXJ 1ZK8A 3ZQIA 3HOXJ 3SJMA 2CU7A 1POGA 2LR8A 1MBEA 3VPRA 4B1RA 2MSYA 4C2MJ 2HQ5A 1JJ6C 1ETWA 3NARA 2L7MP 2L9RA 1U9OA 3OOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRG A;  4A93 J;  1ZR2 A;  1K83 J;  3G1M A;  2WV1 A;  1HF0 A;  4AYB N;  2JA8 J;  1VFC A;  3LSG A;  3LOC A;  2HDD A;  3FK6 A;  1X2N A;  1OCT C;  4DYQ A;  3MKL A;  1VND A;  1RPW A;  2E1O A;  2DA3 A;  3A03 A;  1JKR C;  2DMQ A;  4IHV A;  3CDL A;  3ZQC A;  3BR6 A;  5IP6 A;  3JRA A;  1JT6 A;  1ZR4 A;  2WAQ N;  4RDU A;  1GT0 C;  4DZJ A;  2FQ4 A;  4JP0 A;  3OSF A;  1IV6 A;  2JK3 A;  3W6V A;  3BQZ A;  3HGG A;  2DA4 A;  1ETV A;  1ITY A;  3BQY A;  1U78 A;  2NOG A;  4V2F A;  2ME0 A;  1CQT A;  5FLV A;  4IHY A;  2DA6 A;  1D5Y A;  5F27 A;  5FLM J;  3JRD A;  1TWC J;  2EZL A;  4M3D A;  1VI0 A;  4FE7 A;  5IOZ A;  4FCY A;  2HXI A;  3JRC A;  5M5Y J;  2ID6 A;  4D7M A;  1FJL A;  4FIS A;  1GDT A;  3S1M J;  1ETY A;  5EGO A;  3Q0U A;  3GTP J;  4X1E A;  2VUM J;  3SFI A;  1PUF A;  1F43 A;  3GTJ J;  5K7H A;  2NVT J;  3Q3S A;  1EF4 A;  1Q1V A;  1TWG J;  1YRN B;  2IEK A;  5J1U A;  5IPA A;  3TP3 A;  4JX4 A;  2K9N A;  2MGQ A;  2XPV A;  4V2G A;  3RKQ A;  3ZQL A;  1ZQ3 P;  3I4M J;  2O7O A;  1DU6 A;  2WB1 N;  2O8K A;  5K7F A;  1T33 A;  2ID3 A;  4A3L J;  2LK2 A;  1TWA J;  5M3F J;  2LP0 A;  3JRH A;  1BA5 A;  2VKE A;  3BG5 A;  1ETQ A;  1NK2 P;  3B6C A;  3I4N J;  1JUM A;  1MBF A;  1S7E A;  3PM1 A;  4FE4 A;  3ZQH A;  2R93 J;  5IYD J;  3G1L A;  2VKV A;  5EGO B;  3BTL A;  3BR3 A;  3S15 J;  4M3G A;  4X6A J;  4A3I J;  1B8I A;  2JWT A;  3LSP A;  2DMN A;  4M3B A;  2HXO A;  1Z77 A;  3CQZ J;  4JX6 A;  1JJ8 C;  3QQA A;  1OFC X;  1X2M A;  1WGX A;  1B72 B;  5FKM A;  1GV2 A;  2HOA A;  5JLW A;  1RES A;  1G2H A;  2M9H A;  4I6Z A;  3A02 A;  4BBS J;  1MBG A;  1IRZ A;  2K9S A;  3HB9 A;  3S14 J;  1W0T A;  2H8R A;  4MFD A;  4A3J J;  3F0C A;  3C2B A;  3IH2 A;  1WH7 A;  3L1P A;  4BBR J;  2DTZ A;  4A69 C;  4FTH A;  3K7A J;  4QIW N;  1VF9 A;  3E7L A;  2E19 A;  2LY9 A;  1AKH A;  1FIP A;  1MNM C;  4IHW A;  1RET A;  2KT0 A;  1AKH B;  4DW6 A;  2FD5 A;  3TW6 A;  1BL0 A;  3S2H J;  5F0F A;  3HEF A;  5GPC A;  2ECB A;  3TP0 A;  5EZG A;  2R5Z A;  5F1J A;  5EG0 B;  2PMZ N;  2EZH A;  2L0K A;  3FK7 A;  3FIW A;  4BKX A;  9ANT A;  3A01 B;  3M3Y J;  1ETK A;  2DN0 A;  2MG4 A;  2E2H J;  2ECC A;  1ETX A;  2XB0 X;  2H1K A;  1OJL A;  1OCP A;  4ABZ A;  3HOZ J;  4IHX A;  3BTC A;  4W1U A;  3SDG A;  4NDL A;  2ELK A;  4W97 A;  4XRS A;  3IH4 A;  4S0H B;  1JUP A;  2E2J J;  3BR1 A;  5IP9 J;  3GTO J;  2QF7 A;  2DA5 A;  2LTP A;  2M2E A;  2Y2Z A;  3HOU J;  2EBI A;  4G12 A;  5FKO A;  4UUT A;  4D5F A;  5EYR A;  3JRF A;  2GM4 A;  3S16 J;  3FIS A;  4A3D J;  4M3F A;  3GTL J;  3GTG J;  4A3B J;  2TRT A;  1UG2 A;  5F08 A;  4D5C A;  1LE8 B;  1WH5 A;  2M8G X;  3DCF A;  2JA5 J;  4JYK A;  2CUF A;  2YS9 A;  1AU7 A;  4XID A;  2R5Y B;  2EZI A;  4A3G J;  3QPS A;  5FJ8 J;  2XRL A;  4BY7 J;  5EG0 A;  4M3E A;  3GBG A;  2XSD C;  2VPR A;  2ZB9 A;  2CJJ A;  3LNQ A;  3B6A A;  1TWH J;  1JKO C;  5IYC J;  2GBY A;  4C3I J;  4XK4 A;  1IUF A;  5C4X J;  4AC0 A;  4C3J J;  1RKW A;  4RBO A;  5J1Y A;  1I3Q J;  2OF7 A;  3HM5 A;  2HOT A;  2JA7 J;  2YUS A;  2Y31 A;  1W0U A;  1MH4 A;  4M6V A;  3BTI A;  4LOC A;  1QVT A;  2QCO A;  2LLK A;  1P7J A;  5EDN A;  1WPK A;  4Y52 J;  1MSF C;  2GLO A;  3S1N J;  3S1Q J;  1JKP C;  2HYJ A;  1FTT A;  2TCT A;  2Y0S N;  5K7Z A;  3ZQF A;  3D1N I;  3BR2 A;  3GTK J;  1GV5 A;  4UUS B;  2R7Z J;  2LD5 A;  2Y9Y A;  3K2A A;  4B3A A;  3HOW J;  1ORK A;  3HGY A;  3A01 A;  3BR0 A;  1Y1V J;  3Q0V A;  3UKG A;  1MBH A;  1IJW C;  4A3C J;  3DEW A;  3TW7 A;  5DTD A;  2K9Q A;  5F04 A;  3GTM J;  3LSR A;  2KDZ A;  4MLO A;  3FKI J;  1K61 A;  1UHS A;  4QSH A;  2AHQ A;  3JRB A;  1R9T J;  2X9D A;  4L5E A;  2O9L A;  2FX0 A;  4JX5 A;  3Q0W A;  3JR9 A;  1TWF J;  1LE8 A;  2D5V A;  5E3L A;  4AUX A;  1IGN A;  2OPT A;  1FEX A;  2NS7 A;  1RKT A;  3G1O A;  1U9N A;  1MBJ A;  3ZOB A;  4MFE A;  2LKX A;  1F36 A;  2XGD A;  3O8G A;  2DJN A;  3HKZ N;  2R5Y A;  1H88 C;  5IOY A;  4DZP A;  3RQI A;  1ZTR A;  1MBK A;  1APL C;  2NS8 A;  5F0H A;  5IP7 J;  3CCY A;  3LSJ A;  1YRN A;  3M4O J;  2I10 A;  2XPU A;  1E3O C;  1TC3 C;  2B63 J;  3ZQG A;  5M3M J;  2IBD A;  2VI6 A;  3QPL A;  2P81 A;  2X6O A;  5M5W J;  4J19 A;  1ZGW A;  5DS9 A;  4DYR A;  1MSE C;  3S1R J;  3JRE A;  4GFB A;  1NTC A;  1JGG A;  2XB5 A;  2JN6 A;  1SAN A;  3MVP A;  2JJ7 A;  2DA2 A;  3TED A;  1BW5 A;  2DMU A;  4DYC A;  4HNV A;  2M0C A;  1QVU A;  2DA1 A;  2R0Q C;  5C4J J;  4CYC B;  1HOM A;  1JTX A;  2L7F P;  3BR5 A;  1LFB A;  1IG7 A;  1A5J A;  1RR7 A;  2CQX A;  2Y9Z A;  3O8H A;  1WI3 A;  2M34 A;  2R92 J;  3H0G J;  3GTQ J;  1AHD P;  5E3O A;  5FKK A;  2HI3 A;  4D7N A;  2NVY J;  4MO7 A;  4A3K J;  1IDZ A;  1JUS A;  4XRS G;  2HOS A;  3HOV J;  3OIO A;  4XRM A;  3MN2 A;  2R5Z B;  1GUU A;  1B72 A;  5JLX A;  5EZH A;  2AO9 A;  5IYB J;  4IEJ A;  1JT0 A;  4I76 A;  1I50 J;  4C3H J;  3JRI A;  2RAE A;  2XGE A;  2FJ1 A;  2JMW A;  2N8G A;  1A6I A;  2DA7 A;  3PO2 J;  1UMQ A;  5HOD A;  2G0E A;  5J1R A;  5GP9 A;  3WHB A;  4MIM A;  4A3F J;  2EQR A;  2LVS A;  1WCM J;  1FTZ A;  1ZKG A;  5C3E J;  1HLV A;  3H3V K;  3RZD J;  3S17 J;  1I6H J;  2E2I J;  5FKL A;  2XGC A;  4A3M J;  3HDD A;  1Z0X A;  1JTY A;  3S2D J;  1HCR A;  3IV5 A;  2JA6 J;  1XS9 A;  1DU0 A;  3CMY A;  5FKN A;  2CRG A;  1HDP A;  1NK3 P;  3RZO J;  2IAI A;  1B8I B;  2DMT A;  2LFB A;  1P7I A;  1QPI A;  2Y30 A;  1PUF B;  5E3M A;  2MW8 A;  5E3N A;  2K40 A;  1HDD C;  4BXX J;  4B4C A;  2X48 A;  2EZK A;  2YU9 J;  1ETO A;  1MH3 A;  4EEF G;  1Y1W J;  1LFU P;  3BG3 A;  3WHC A;  3PO3 J;  1QRY A;  5BNG A;  1FIA A;  1JKQ C;  2L7Z A;  2XPW A;  1ENH A;  1GVD A;  2ME6 A;  1BJZ A;  2DMP A;  4A3E J;  1XC5 A;  3HOY J;  3BG9 A;  1SFO J;  2W48 A;  4QTR A;  5J3L A;  1IDY A;  1X58 A;  4XIC A;  5M5X J;  1O4X A;  2COB A;  1H89 C;  2NVQ J;  1BW6 A;  3BT9 A;  2CQQ A;  2EH3 A;  3BTJ A;  3HBL A;  1IC8 A;  3IH3 A;  5GPA A;  4BY1 J;  4UUS A;  5C44 J;  4CYC A;  1XG1 A;  3OSG A;  2CUE A;  5F0C A;  1T56 A;  5EEA A;  1U8B A;  1H8A C;  3NAU A;  5EF6 A;  4Y7N J;  2NVX J;  1ZK8 A;  3ZQI A;  3HOX J;  3SJM A;  2CU7 A;  1POG A;  2LR8 A;  1MBE A;  3VPR A;  4B1R A;  2MSY A;  4C2M J;  2HQ5 A;  1JJ6 C;  1ETW A;  3NAR A;  2L7M P;  2L9R A;  1U9O A;  3OOU A; 
#chains in the Genus database with same CATH topology
 3DPL C;  1D8K A;  4F52 A;  3JRG A;  4GO1 A;  3G1M A;  4CXF A;  1HF0 A;  4AYB N;  2B9S A;  2JA8 J;  4CGZ A;  2ZJR F;  1EH8 A;  1G4D A;  1TW3 A;  1ZG3 A;  2QGU A;  2R7Q A;  1S7A A;  2XUB A;  2KIQ A;  1KQ8 A;  1B6A A;  4HNT A;  2X1E A;  1K4T A;  2GZW A;  4A2U A;  5KNL A;  1RPW A;  4WXH A;  1E3H A;  3A03 A;  4M74 A;  1JKR C;  3H36 A;  2DMQ A;  2UXN A;  3CDL A;  3S3M A;  5IP6 A;  5B1A H;  1W5C C;  3L2R A;  1W1W E;  4RMN A;  1GT0 C;  2EV0 A;  4GCV A;  3F3X A;  4DZJ A;  1I5Z A;  3G71 I;  1J5Y A;  4N9I A;  3K1N A;  2ISZ A;  3GYH X;  4G6Q A;  2Y0M A;  1MMD A;  3GZ6 A;  3W6V A;  3BQZ A;  2DXI A;  4RAY A;  3M8J A;  4YFN F;  5HS9 A;  3BQY A;  1W36 D;  3SYT A;  2NOG A;  1FOW A;  4R1H A;  3DBL B;  2O0Y A;  2KIF A;  2DA6 A;  1Y56 A;  1LQ1 A;  5FLM J;  2MH9 A;  4M3D A;  2A07 F;  2CGP A;  2WBM A;  5AIP A;  1YG2 A;  1XPX A;  3S1M J;  3Q0U A;  2E1N A;  3WTW C;  4X1E A;  1XMA A;  2Y48 A;  3OYE A;  1PUF A;  1F43 A;  2NVT J;  3OYF A;  3COA C;  1Q1V A;  5CVU A;  2IEK A;  1J59 A;  1GXP A;  2VOP A;  1IZ1 A;  1LFP A;  3TP3 A;  4JX4 A;  3CUQ B;  2MGQ A;  4PK4 A;  2DI3 A;  3DBR B;  1YTY A;  4BHP A;  2L3D A;  2LY2 A;  4LJZ F;  4X0G A;  1VQO I;  2Y0S A;  3ISP A;  4HNU A;  5KAF C;  3H9J A;  3CMM A;  4ZYA A;  1U6G A;  3KCC A;  4ENN A;  4Z2Y A;  2EFP A;  2LH9 A;  4OMZ A;  2QSH X;  3WG9 A;  4DOZ A;  5M3F J;  3JRH A;  3CLQ A;  4ZZL A;  2L2O A;  4L18 B;  3M8E A;  5CKT A;  1ETQ A;  1AOY A;  4ZC3 A;  5D5U B;  3ZP5 A;  3L2C A;  1K6O A;  1JXS A;  1MBF A;  4A6D A;  2OU2 A;  2XVC A;  1TNS A;  2A3S A;  4ZDL A;  3BPX A;  4DBR A;  1IAW A;  2V6C A;  3PM1 A;  3KIO A;  4IF4 A;  4UVA A;  3W2A A;  2VKV A;  5E17 F;  5EGO B;  3WU2 C;  3W2W A;  1V5E A;  2IT0 A;  3S15 J;  4OIR F;  1B8I A;  2JWT A;  1QZY A;  2OZU A;  2M87 A;  4PJM A;  2HXO A;  5HDK A;  2HYG D;  1FOK A;  4E7H A;  3ZMZ A;  1SD4 A;  5DCM B;  5JLW A;  4RM2 A;  1P4X A;  3ZMS A;  2RRE A;  2Z9O A;  1ZYR F;  1USS A;  1NHA A;  3L7W A;  3UNG C;  1BR4 A;  2EJR A;  2X85 A;  3IH2 A;  4HZF A;  1U2W A;  1WH7 A;  2CH0 A;  4BBR J;  4A69 C;  1SVM A;  2W84 A;  5ILS A;  3TBI A;  4QIW N;  5BPD A;  1UHM A;  2E19 A;  1Y0U A;  1MNM C;  2XAG A;  4LB6 B;  1VQ5 I;  1NH3 A;  2AXT C;  2M1B A;  3TW6 A;  5DEQ A;  1R4N B;  5F0F A;  3HEF A;  1MKM A;  3LSM A;  5GPC A;  3OS1 A;  5EZG A;  1SEU A;  5F1J A;  2PMZ N;  2L0K A;  3FIW A;  2QZ8 A;  5IT3 A;  3ERE D;  1ZRD A;  1FOX A;  5H2F C;  2Z1D A;  2XDV A;  2QKM B;  1OJL A;  3K4M A;  3KYD B;  1OCP A;  1FOY A;  3HOZ J;  4IHX A;  2W24 A;  3E3V A;  2ELK A;  4W97 A;  5FO5 A;  4ZJZ A;  4HF1 A;  3IH4 A;  5K5O A;  1D8J A;  4FAS D;  1JUP A;  4ESJ A;  3FXL A;  3BR1 A;  5IP9 J;  3GTO J;  2DA5 A;  2M5W A;  4ZYE A;  1OCC H;  2LTP A;  2M2E A;  1OPC A;  5FKO A;  4PUS A;  1VQN I;  4UUT A;  3JRF A;  3I59 A;  2F5D A;  2XIG A;  1J9I A;  2TRT A;  5F08 A;  1BOA A;  1MMS A;  2JA5 J;  2VAS A;  3DPU A;  4JYK A;  5GAE J;  3J7Y J;  2YS9 A;  4M9S A;  4XID A;  2MFZ A;  2EZI A;  3VFZ A;  2VOD A;  4D1Q A;  1LPQ A;  4JQF A;  5FJ8 J;  1YW8 A;  1O3Q A;  4II2 A;  3WE3 A;  4CIC A;  2XSD C;  4XLH A;  3CP2 A;  2ZB9 A;  2EIJ H;  2IPQ X;  2FMY A;  2PMU A;  3CUQ C;  3I4P A;  3KLN A;  3LL7 A;  3LFK A;  3LQQ A;  1VQL I;  4RB1 A;  3WOD F;  1SFU A;  4OIP F;  2GAU A;  4C3J J;  4RBO A;  4ZDO A;  1DPR A;  2D2W A;  4HOB A;  2OF7 A;  4OAZ A;  1MH4 A;  3ABK H;  1QVT A;  1RI7 A;  2LLK A;  3K9T A;  4ZH4 F;  1QZZ A;  1WPK A;  5LBQ A;  3DKW A;  5J4V A;  4Y52 J;  1MSF C;  1U3E M;  4S05 A;  2A05 A;  2KKO A;  2GOM A;  2HYJ A;  5D4S A;  2CWE A;  1TTY A;  3MKZ A;  1XCV A;  3BR2 A;  3GTK J;  2H94 A;  2LD5 A;  1EA3 A;  4B3A A;  3A01 A;  1X3Z B;  3HRM A;  1HC8 A;  2R7U A;  2LG4 A;  2WAF A;  2ZJP F;  1X19 A;  3DEW A;  4KUM A;  3CME I;  1J75 A;  5DTD A;  1MNE A;  4QSH A;  4U0V A;  4HDV A;  1PP7 U;  5D5X B;  4G7H F;  2AHQ A;  1V5G A;  1R9T J;  2X9D A;  2O9L A;  1Y8R B;  2FX0 A;  4YEJ A;  3JR9 A;  3VDX A;  1SAX A;  1X3W B;  3EYY A;  3FXJ A;  3GX4 X;  2X0L A;  2OPT A;  1RKT A;  5KAI C;  3G1O A;  3WGG A;  4BU2 A;  1MBJ A;  2MD0 A;  3ZOB A;  2LKX A;  4K2E A;  2RC4 A;  3WE2 A;  4A5N A;  3LQR A;  2HQR A;  2CW7 A;  1OYI A;  5LGT A;  3PIO F;  2VE8 A;  2BHY A;  2DK5 A;  4DZP A;  1N75 A;  4EJU A;  2VT3 A;  1MBK A;  2LKP A;  1TNT A;  2RNJ A;  5F0H A;  3M4O J;  1YRN A;  1QGP A;  1G3W A;  1E3O C;  3NWT A;  3HSR A;  2HFH A;  3KEO A;  4ENJ A;  1IW7 F;  2DFF A;  1EV7 A;  1LDJ A;  3T5X A;  2YX7 A;  3M7G A;  1OCO H;  1Z9C A;  2X6O A;  4IOC F;  4CZZ A;  4BGD A;  5M5W J;  4BYY A;  3NWS A;  2IVM A;  2YX4 A;  2LBF B;  3T8T A;  4GFB A;  1NTC A;  3FMS A;  1EJ9 A;  2MD5 A;  3ULQ B;  3MZH A;  2XB5 A;  2IS1 A;  4KN4 X;  2JJ7 A;  5DM7 F;  3P9C A;  4V19 K;  2L5Q A;  1BW5 A;  1JTX A;  4CA0 A;  2F2E A;  5E8G A;  1R4M B;  2RN7 A;  1QA6 A;  2Y9Z A;  1MMA A;  2FOK A;  3O8H A;  3H0G J;  3P7N A;  3IAS 2;  2KIS A;  2KDO A;  3DU6 A;  3BJ6 A;  3GTQ J;  5E3O A;  1UZC A;  5FKK A;  2BYV E;  2ZME A;  1M1E B;  5H6Q A;  2FEZ A;  3CF5 F;  4A3K J;  4XRS G;  3HOV J;  4UNO A;  3I71 A;  4NUB A;  3I0T A;  4HA8 A;  3BY6 A;  2HGC A;  2R7D A;  5FRM A;  1K79 A;  5JLX A;  4BDZ A;  3GFL A;  2HTS A;  2V1X A;  3VYS B;  3DU5 A;  2FBI A;  3QRF F;  3FHN A;  2CFO A;  4I76 A;  4M9Z A;  3ZQQ A;  1FSE A;  1W7P A;  2XAJ A;  3BZK A;  3GME A;  4I0B A;  3JTH A;  2JMW A;  3OYL A;  2E7W A;  4O6J A;  3PO2 J;  2DT5 A;  5L3B A;  2EA4 A;  3CJT B;  4AIJ A;  2ADU A;  5GP9 A;  2LSO A;  1IF1 A;  2NRA C;  4RS8 A;  3ZN1 A;  3RQ4 A;  2IA1 A;  1OMI A;  3H3V K;  3OWT A;  1I6H J;  1YO5 C;  3S17 J;  3QPH A;  2HU9 A;  5FKL A;  2P6T A;  2P7V B;  1Z0X A;  2NVU B;  4RGR A;  5E1Z B;  3GO5 A;  1Z6T A;  3CMY A;  5FKN A;  2KJC A;  2M45 A;  2H27 A;  4MNU A;  2IAI A;  1B8I B;  2CG4 A;  2RGV A;  2DOA A;  1P7I A;  1QPI A;  1BIA A;  3LA2 A;  1JGS A;  3HIF A;  1I1S A;  2K40 A;  2FBH A;  4HV5 A;  2V1U A;  1HDD C;  5EJC A;  4B4C A;  2X48 A;  4XOP A;  2B7E A;  2EZK A;  1XTA A;  3DTE A;  4DJA A;  1Y1W J;  1LFU P;  3AKZ A;  3WTX C;  3FXQ A;  4U88 A;  1Z67 A;  3KYC B;  1FIA A;  2XGX A;  1KON A;  2L7Z A;  4U7D A;  4HDU A;  1T6S A;  2CO5 A;  3F72 A;  2R7X A;  2H6C A;  1BJZ A;  4L9J A;  2OTJ I;  2DMP A;  2ZME C;  3FMQ A;  4HPQ A;  1YIJ I;  1KQ0 A;  1FYM A;  4PDK A;  5J3L A;  1IDY A;  2ETH A;  1A36 A;  1ZRF A;  3MZY A;  2CSO A;  1PYV A;  4GYG A;  5HS7 A;  4KMF A;  2NVQ J;  3CMA I;  1BW6 A;  2EH3 A;  3K4J A;  1TLH B;  1X1P A;  4N9H A;  3HUG A;  4XOR A;  5D6F A;  3RKW A;  1IC8 A;  5IT9 K;  4PFO A;  4BY1 J;  5C44 J;  3OSG A;  3N97 A;  2CUE A;  1T8I A;  1T56 A;  2KMU A;  1O3T A;  1TP4 A;  1U8B A;  4GDF A;  3TL4 X;  2DOF A;  2XC7 A;  3VYT B;  2W25 A;  1YOV B;  2DJI A;  1HW5 A;  3VPR A;  2NYX A;  5FFZ A;  3QPT A;  2E7X A;  3BP8 A;  1D0Y A;  1ETW A;  3H1C A;  2L7M P;  1U9O A;  3CCS I;  1NG7 A;  4A93 J;  3WTT C;  1ZR2 A;  3L00 A;  1K83 J;  3E1S A;  3K0L A;  3H5A A;  1MND A;  3RPU A;  1OCZ H;  3F22 A;  2KQR A;  2M7A A;  4R79 A;  1R58 A;  3LSG A;  4P9F A;  1K6Y A;  2VLA A;  2HDD A;  1QQI A;  3FK6 A;  1X2N A;  3RPQ A;  4RLF A;  3CC7 I;  1YW7 A;  1R7J A;  1B9M A;  1HW2 A;  1TQP A;  3L2V A;  2E1O A;  4H4K C;  2G7H A;  4Q47 A;  1SD6 A;  4OAY A;  4L9V A;  3H5R A;  4IHV A;  1N77 A;  1R5H A;  3RI4 A;  1R23 A;  2PMH A;  5LFA A;  1E17 A;  2ZSH B;  2OJE D;  2XF7 A;  1TZL A;  3OYN A;  5LGU A;  1IV6 A;  2VT2 A;  2EV5 A;  2FA5 A;  3RPU D;  2DA4 A;  1ETV A;  4WXC A;  3ABL H;  4FHT A;  4OOI A;  1BIB A;  1XGM A;  1ODD A;  2CUJ A;  2O61 A;  1XGO A;  1I1G A;  3KP2 A;  4CYD A;  3F8B A;  5F27 A;  3E6C C;  2Q2E A;  4NBQ A;  4EJW A;  3JRD A;  1RIO H;  2HXI A;  1WI9 A;  4KIC A;  1IN5 A;  3ZCO A;  5D5W B;  4WK8 F;  1KU7 A;  3SZT A;  3T0Y A;  1W36 C;  3VEP A;  5M5Y J;  4UY8 I;  4D7M A;  4QPQ A;  3F8M A;  1SFX A;  3CZ6 A;  5EGO A;  4HQE A;  3GTP J;  3GEZ A;  2VUM J;  4Y4R A;  4KT6 A;  3GTJ J;  5K7H A;  3KFW X;  4E6K G;  5L3E A;  1YRN B;  2V79 A;  4BJT A;  4LG3 A;  5EEH A;  2RV8 A;  3EPZ A;  1RC9 A;  3OYC A;  1VQK I;  3HSE A;  1DU6 A;  3ZQL A;  4Q4Z F;  4EM0 B;  1LJ9 A;  2O8X A;  1D0X A;  2O8K A;  5K7F A;  5E18 F;  1T33 A;  2ID3 A;  4IQ4 A;  2LK2 A;  1X1B A;  1TWA J;  2HKX A;  3EUH A;  3LSI A;  2JTV A;  2VOO A;  1TBX A;  4PSX A;  2VKE A;  2FUG 2;  3BG5 A;  3B6C A;  2CS3 A;  2ZKZ A;  3H9Q A;  3OYA A;  3CCE I;  1JUM A;  2OV7 A;  4P1W A;  1SMY F;  5E79 C;  1QU3 A;  1D0Z A;  2FSW A;  2VL8 A;  3CCR I;  2ACJ A;  1V54 H;  4CO8 A;  3G1L A;  4YII A;  5K5Q A;  3BTL A;  1WWX A;  2BE5 F;  3BR3 A;  3N05 A;  2ZXW H;  2LY1 A;  1FBS A;  1A35 A;  1V4R A;  4YIF A;  1EKE A;  1Z77 A;  4JX6 A;  1U5T B;  1X2M A;  2VB6 A;  5DDG A;  4BDY A;  1SFK A;  1G2H A;  2M9H A;  5L3C A;  3D5L A;  1QHG A;  2VE9 A;  4CCJ A;  4CUG A;  1IRZ A;  1RZ4 A;  3S14 J;  2H8R A;  3AL0 B;  5FLX K;  1ON1 A;  4MFD A;  4A3J J;  3G3Z A;  2ZNZ A;  3QU6 A;  1Z3Y A;  2R7W A;  3BZ6 A;  1UB9 A;  2DTZ A;  5JFR A;  4FTH A;  3K7A J;  2L7K A;  3W6J B;  1VF9 A;  4BNC A;  2LY9 A;  1AKH A;  1L3L A;  1FIP A;  2PJR B;  4IHW A;  1AKH B;  4DW6 A;  3QP6 A;  4YEL A;  1BL0 A;  4XLP F;  2STW A;  5A2Q K;  1GLN A;  1S3J A;  1UG0 A;  5FD6 A;  4AIK A;  4EJV A;  3FDY A;  2R5Z A;  4B48 A;  1J09 A;  2EZH A;  3CD6 I;  3FK7 A;  2BGC A;  3E97 A;  4MHG A;  2ZFW A;  9ANT A;  4PGH A;  2PJP A;  4IHS A;  2MG4 A;  2XB0 X;  3SZG A;  3HKZ A;  3T8R A;  2JPB A;  2PN6 A;  3KPH A;  3J81 Z;  3OYK A;  2JSC A;  5IY5 H;  2VKH A;  5JHU A;  5CJ9 A;  4NDL A;  2F5E A;  3IWZ A;  4YFK F;  2DTR A;  4F3Q A;  3OL3 A;  2UZK A;  2QQ8 A;  5D8K B;  3DV8 A;  2QF7 A;  2K02 A;  1P4A A;  3PL8 A;  3HOU J;  1G6N A;  1Y0N A;  2A6H F;  2EBI A;  3SEQ A;  5EYR A;  4KIF A;  2IXS A;  3PQJ A;  1PP8 F;  4HLX A;  3GTL J;  3OYB A;  1ZEL A;  3DKY A;  1P2F A;  1Z05 A;  3TO9 A;  2XV4 S;  1LB2 A;  2CUF A;  4IVN A;  2DQR A;  5KK1 A;  4CCM A;  4A3G J;  1BBY A;  2OQR A;  3X2Q H;  1HKS A;  1Z7U A;  2XRL A;  2OAZ A;  1RR8 C;  3ML6 A;  5EG0 A;  2CW0 F;  1JHF A;  5DUK A;  4XKW A;  1O7F A;  3IP4 B;  3AG3 H;  1FBU A;  3D0S A;  4N4N B;  4AID A;  5E20 A;  2CJJ A;  3M1E A;  1FPQ A;  2ZC2 A;  1TWH J;  2XAS A;  5IYC J;  2GBY A;  4C3I J;  4E4H A;  1YS6 A;  1IUF A;  4AC0 A;  1RKW A;  2ZJQ F;  3M1C A;  4G6T B;  4ENK A;  2JRM A;  2QEX I;  1I3Q J;  2A61 A;  3HM5 A;  1Y8Q B;  2E71 A;  2JA7 J;  4MTD A;  1U0J A;  1W0U A;  2Z5U A;  5K1Y A;  4M6V A;  2M4K A;  1S6L A;  5EDN A;  3IUO A;  2CQK A;  2FXA A;  2QQ9 A;  3S1Q J;  2XF6 A;  4RGX A;  1FTT A;  4BHC A;  2TCT A;  3FXK A;  1J7K A;  4R8H A;  3RTR A;  3T1B A;  3GFJ A;  2Y0S N;  1QPM A;  1W5S A;  2FU4 A;  1YJ9 I;  1K4S A;  4KDP A;  1B4A A;  1LUJ B;  3D1N I;  2VBY A;  2OBP A;  5FRN A;  4IHT A;  2R7Z J;  1FP2 A;  4NNJ A;  4UV8 A;  1ORK A;  2XSJ C;  1I27 A;  3EET A;  3HZJ A;  4IXA A;  4DIQ A;  3BR0 A;  3V8J A;  3UR3 C;  1Y1V J;  3Q0V A;  2I8D A;  1W7P D;  5FGM A;  3QAH A;  3VOE A;  6PAX A;  2K9Q A;  2MA3 A;  2BY2 A;  3LSR A;  3S3O A;  1Q1H A;  1U8R A;  3ASO H;  1UHS A;  2H09 A;  1S9H A;  2X1C A;  4RAZ A;  1VQ9 I;  4EAT A;  2PJR A;  1HXD A;  4JX5 A;  3Q0W A;  1UAA A;  4IOA F;  2JT1 A;  4AUX A;  2KL4 A;  5TGT A;  2VC1 A;  1IGN A;  3KLO A;  1FEX A;  2NS7 A;  1X1D A;  2PG4 A;  1R6R A;  1U9N A;  4UUV A;  4JOM A;  3ECO A;  1YLF A;  2BW3 B;  3HKZ N;  2TDX A;  2R5Y A;  5HLT A;  1K78 A;  2J5P A;  2KP6 A;  1WHU A;  3G2B A;  2F4M B;  3RQI A;  2HEO A;  2BEO A;  3AG2 H;  4N0B A;  4FX4 A;  2P6S A;  1VQ6 I;  1BI1 A;  5IP7 J;  3CCY A;  3LSJ A;  3W2V A;  1XSX A;  3J81 K;  3QOD A;  5M3M J;  3MCZ A;  3QOE A;  3C1D A;  2VIX A;  4B43 A;  3QPL A;  2UV1 A;  3PUB A;  2Z16 A;  2O03 A;  2KLO A;  1XDU A;  2Q1Z B;  1RUO A;  1YJN I;  4Y13 A;  2UWM A;  2DFI A;  4DYR A;  5JVG F;  3S1R J;  3JRE A;  4RA2 A;  1WQ2 A;  1Y39 A;  1JGG A;  4F91 B;  4OIQ F;  4XQF A;  3GW2 A;  2FML A;  3EQL F;  4DQ2 A;  1SAN A;  2RQQ A;  1FWZ A;  1XB4 A;  5ICC A;  2BXY A;  3BG7 A;  4DYC A;  3L2W A;  1R49 A;  2BXZ A;  4BJ6 C;  2DA1 A;  2R0Q C;  3L09 A;  2VJI A;  2LMD A;  4CYC B;  2ZO4 A;  1HOM A;  3OYD A;  1S8N A;  2L4M A;  2WTE A;  3CF2 A;  3DLA A;  4HW0 A;  2JVG A;  2QM3 A;  1N25 A;  4HEA 2;  1QNT A;  2R92 J;  2DT6 A;  2FOW A;  3FX3 A;  4C9Y A;  2IGN A;  2FF4 A;  4LLG F;  2K85 A;  1AHD P;  2EWN A;  2NVY J;  2P8T A;  2QKL B;  3E6D A;  1VTN C;  2MH2 A;  3I58 A;  5BQT A;  3CCV I;  1UEL B;  5ERI A;  4XRM A;  5B5E C;  1YE9 A;  3MN2 A;  3K1P A;  2NNN A;  1B72 A;  4XKC A;  4NQW B;  5EZH A;  3R61 A;  3JSP A;  4WWC A;  1S7O A;  1WJA A;  3FWE A;  4IEJ A;  4LB5 A;  2MYS A;  3E5U A;  1P92 A;  4C3H J;  1WJC A;  2NXN B;  1SAU A;  4OU0 A;  1O3S A;  3ZRG A;  1CF7 A;  2FJ1 A;  2BW3 A;  2ISY A;  2DA7 A;  4XSZ F;  4OIN F;  3I55 I;  1ULY A;  2RQP A;  5J1R A;  1YX3 A;  4A3F J;  4MIM A;  4Y15 A;  1BR1 A;  3A0H C;  2PI0 A;  2EIN H;  2EK5 A;  1ZKG A;  1D3Y A;  3RZD J;  2E2I J;  2OTL I;  2NAZ A;  4KFC A;  3FXO A;  2Y69 H;  4XLF A;  1JTY A;  4CZC A;  2JUC A;  2DW4 A;  2VBX A;  3S2D J;  4YG2 F;  4GRI A;  1HKQ A;  4F7Z A;  4KMU X;  4KYW A;  3RZO J;  2P5V A;  1NK3 P;  2MC3 A;  5CLS A;  5D4R A;  2LFB A;  2K7L A;  1D1C A;  2Y30 A;  1S5L C;  2GOX B;  1LEB A;  1KZH A;  3FZV A;  4E7L A;  5LRR A;  4XKV A;  5E3N A;  1WJF A;  3MMY B;  2KIU A;  5CYV A;  2DLL A;  2WB1 A;  2KRF A;  3BLY A;  4M6Y A;  1OIS A;  4HF0 A;  1ETO A;  1MH3 A;  3TO7 A;  4BQQ A;  1BI3 A;  3WGI A;  3S32 A;  2XKP A;  4ANJ A;  4XLN F;  1FMV A;  2BVL A;  3OYJ A;  1QRY A;  5BNG A;  2LYC A;  1JKQ C;  3OR1 C;  1LVA A;  5ICE A;  5LD2 C;  5CVJ A;  1XN7 A;  2ME6 A;  3TOB A;  3GUD A;  2DK8 A;  1SD5 A;  3KEQ A;  2CYY A;  2EA2 A;  3K10 A;  3I59 B;  4CCL A;  3LMM A;  3K4C A;  4EJT A;  1X58 A;  4NC6 A;  4NC7 A;  1OCR H;  1KU3 A;  4LGW A;  3TOA A;  5LGN A;  5HDN A;  5M5X J;  1O4X A;  1A31 A;  3CC4 I;  1VQP I;  2XAU A;  3BT9 A;  4CCN A;  2CQQ A;  3OV8 A;  3HBL A;  4HLY A;  5HLI A;  1E3P A;  5CVV A;  5CPR B;  4CYC A;  1XG1 A;  1HST A;  2E1C A;  2LOO A;  3DLL F;  1H8A C;  4IPA A;  1H9G A;  3V7S A;  5EF6 A;  3RDI A;  1KYW A;  1ZK8 A;  2WA0 A;  3PFI A;  2LR8 A;  4RAF A;  1MBE A;  4B3X A;  3KP4 A;  4B1R A;  2MSY A;  4C2M J;  1O3R A;  2KPM A;  2HQ5 A;  1JJ6 C;  2BVM A;  2STT A;  4U87 A;  3K69 A;  3NAR A;  2E36 A;  4MQV A;  1G3T A;  4UV9 A;  1ZGJ A;  4ZYH A;  1VQ4 I;  3OOU A;  3Q9S A;  5DV5 A;  1DGW Y;  4LK1 F;  5KCM A;  1BI0 A;  5CQE A;  2WV1 A;  3KEY A;  4L0Y B;  2QA4 I;  1F5T A;  1HQC A;  2XRO A;  2H6B A;  2G7U A;  3TDU C;  1VFC A;  3LOC A;  4G7Z F;  2IJL A;  2VQL A;  2A69 F;  3MKL A;  1VND A;  1MZB A;  2IGM A;  2XKO A;  3WU1 B;  3GWZ A;  4C2U A;  1WJ5 A;  1BN5 A;  3BR6 A;  3JRA A;  4BHB A;  2O3F A;  1ZR4 A;  2WAQ N;  4RDU A;  4IRI A;  5GAG J;  2VPL A;  4P96 A;  4RM3 A;  1VQ8 I;  1VZ0 A;  4LIU A;  3R60 A;  4MEX F;  1Z1D A;  1FX7 A;  2JK3 A;  1KU2 A;  3HGG A;  1ITY A;  3MEX A;  1V55 H;  4I99 C;  2KHM A;  1BC8 C;  4B09 A;  4V2F A;  2ME0 A;  1CQT A;  5FLV A;  2VXD A;  2DPU A;  1EH7 A;  4QLC U;  5LHI A;  2R7V A;  1TWC J;  3ABT A;  2CQN A;  1BR2 A;  1MD0 A;  5IOZ A;  1E2X A;  3GLL A;  2DDB A;  3DEE A;  3HTS B;  3JRC A;  2Z99 A;  4B44 A;  2W85 A;  1LNW A;  1FJL A;  3CO7 C;  5F64 A;  2C6Y A;  1FBQ A;  3M07 A;  3ONQ A;  1GDT A;  3KP3 A;  2W82 A;  4RGS A;  3VB2 A;  1W7P B;  4EVI A;  3Q3S A;  2M30 A;  1EF4 A;  4AVZ A;  2HTJ A;  2F4I A;  5IPA A;  2R7T A;  2K9N A;  3L9F A;  3RKQ A;  1ZQ3 P;  2W4S A;  4D9J A;  2O7O A;  2M4G A;  1VQ7 I;  2WB1 N;  2L4A A;  3MWM A;  5AIQ A;  1FNN A;  2QQA A;  3FXM A;  4AWX B;  5J6X A;  4KIB A;  2R7F A;  3LA7 A;  2LP0 A;  3FM3 A;  1MDM B;  2X4H A;  4E7Z A;  2LBF A;  3O2P E;  3A4C A;  4HAM A;  2QEN A;  4XKB A;  4II3 A;  4PJL A;  2RVC A;  4OIO F;  4PFP A;  1S7E A;  5GTH C;  5KHD A;  4XLA A;  4FE4 A;  4IJA A;  3ZQH A;  2R93 J;  4TV7 A;  2K9L A;  2QQB A;  4BE0 A;  3HJE A;  4M9X A;  3IAM 2;  4M3G A;  1Z7L A;  4Z6Y A;  3CCM I;  1WJE A;  4A3I J;  2DMN A;  2L9V A;  3U1D A;  1QO0 D;  3CQZ J;  3QQA A;  4BEH B;  1B72 B;  5HOO A;  4XL9 A;  4LMY A;  5DD4 A;  1RES A;  4Y3O A;  3M9A A;  4F92 B;  2HPI A;  1R71 A;  1SFE A;  2COM A;  4LFU A;  4BBS J;  1MBG A;  1SVO A;  3L2Q A;  2EFO A;  1W0T A;  3F0C A;  2VC0 A;  5J8F A;  2DPD A;  4BQA A;  3PUF A;  1OQY A;  1SMT A;  3HPH A;  3S2W A;  2EFN A;  1I39 A;  5BS6 A;  2HS5 A;  5LHG A;  3KX2 A;  1C0W A;  2KT0 A;  4HF2 A;  3MZ8 A;  2QBY A;  2FD5 A;  1JE8 A;  4XOT A;  4AIH A;  3E0J B;  2IW5 A;  5FRO A;  2G9W A;  3CJN A;  3NQO A;  4NB5 A;  3TP0 A;  3KZZ A;  4KIG A;  2K3F A;  4Y17 A;  3MFK A;  4BAC A;  1YS7 A;  2ELJ A;  2FQ3 A;  1BJA A;  2HR3 A;  5A2Q Z;  3V42 A;  1T0F C;  3S93 A;  4IX7 A;  3IKT A;  1MJB A;  3GVA A;  3A01 B;  1ETK A;  2ECC A;  1BI2 A;  2JRT A;  1XDS A;  2X6W A;  4F93 B;  2V1N A;  4J00 A;  1EH6 A;  3BTC A;  4W1U A;  2V9V A;  2ZBK A;  3SDG A;  2HQN A;  1ZAR A;  3QYE A;  3LFU A;  3P5J A;  4BJ5 C;  4BE2 A;  4S0H B;  4BQO A;  3C2G A;  2BY3 A;  2QVO A;  3QYB A;  5D5V B;  4RB3 C;  1YFH A;  4A0X A;  1DP3 A;  1WVR A;  3KP7 A;  3TMO A;  2Y2Z A;  3I5U A;  4XMY A;  4WXD A;  4G12 A;  4E7I A;  3VSK A;  1IN6 A;  1V3F A;  3CCL I;  2JVH A;  4M3F A;  3GTG J;  4A3B J;  4PJ0 C;  1UG2 A;  3NEU A;  4XR6 A;  4D5C A;  1LE8 B;  2DAO A;  3GZN B;  2M8G X;  4BH9 A;  1AU7 A;  2R5Y B;  1K78 B;  3LAJ A;  3KET A;  4WCG A;  1TL8 A;  1CF7 B;  2OC6 A;  1DDN A;  3GCM A;  2LF7 A;  3BC8 A;  1IXR C;  1I3A A;  3FKJ A;  4QWQ A;  4BY7 J;  4ZZD A;  1N78 A;  1TQM A;  4M3E A;  2KZG A;  3BDD A;  1ZRC A;  3AG4 H;  1IRG A;  4O3M A;  1HW1 A;  2OA4 A;  2VPR A;  3LNQ A;  2EIK H;  4RAG A;  3ZXS A;  4JBA A;  2HDW A;  2MLG A;  1JKO C;  2VJ4 A;  3ASN H;  4LG0 A;  4L9N A;  4XK4 A;  5C4X J;  3AL0 C;  4LLN A;  1Z6R A;  2HVR A;  1UHW A;  2HOT A;  5J40 A;  3GLX A;  3CTA A;  3BWG A;  2Y31 A;  4CCK A;  3QWL A;  4LOC A;  1IRX A;  4BL0 B;  1X1C A;  3DFG A;  4MGR A;  2BY0 A;  2HQA A;  2GLO A;  4PJN A;  1JKP C;  4L9T A;  1UFM A;  2RNG A;  4BAY A;  3BPV A;  1YIO A;  5BMZ A;  2GXB A;  2YSR A;  4BEH A;  3HYI A;  5B66 C;  3K1M A;  1T0F A;  3EDP A;  3C3W A;  1WFX A;  4EMS A;  4G6D A;  3K2A A;  2OQG A;  3G4S I;  3HOW J;  3HGY A;  4D0P A;  3V4G A;  1GHC A;  2DOE A;  2NOJ B;  5DCM A;  1R1U A;  3PNV A;  1MBH A;  4XSX F;  1IJW C;  3WGH A;  3TW7 A;  2WY7 Q;  2BBY A;  2P0W A;  2CUZ A;  4EGY A;  3GTM J;  2KDZ A;  4MLO A;  5BPI A;  1FZP B;  4CSW A;  3FKI J;  1K61 A;  5GAD J;  1QBJ A;  4UVB A;  2DT7 B;  2CFX A;  3G6E I;  3ZGK A;  3HL2 A;  1R5G A;  3OOP A;  5KVR A;  3F9K A;  1V5F A;  1J0R A;  2E1M B;  1XX5 A;  2DFH A;  2XAF A;  2XGD A;  3O8G A;  1JI8 A;  2WWY A;  3WTV C;  1H88 C;  5FD5 A;  1IO2 A;  4P55 A;  5IOY A;  2LRE A;  4C2T A;  3JAM Z;  3BCB A;  1ZHF A;  2ZNY A;  1NG6 A;  1ZTR A;  1P9Q C;  3RCO A;  3I54 A;  1HBX G;  2NS8 A;  4QPO A;  2JUG A;  3GFI A;  2I10 A;  2XPU A;  1MDM A;  1TC3 C;  3RSN A;  3S3N A;  2E5Z A;  1OKR A;  2AQF A;  2QSG X;  4PJJ A;  2IBD A;  2VI6 A;  1VQM I;  1F4K A;  2K5C A;  3KP6 A;  2P81 A;  3JW4 A;  5TRD A;  2K4B A;  1ON2 A;  4J19 A;  1ZGW A;  5DS9 A;  4KJZ A;  1G3S A;  4E7K A;  3O6B B;  3HRS A;  3C2H A;  2F6C A;  1IN8 A;  2V26 A;  3MVP A;  4MQ9 F;  4BQN A;  2GQQ A;  1IXS B;  1HSJ A;  2DA2 A;  3J7Z I;  4HNV A;  2PBI A;  3R0A A;  1QVU A;  1Y6I A;  3I9V 2;  1FSH A;  5C4J J;  2K4J A;  2HDC A;  2GWR A;  2L7F P;  1LFB A;  1IG7 A;  2GA2 A;  1KU9 A;  1A5J A;  1RR7 A;  4EJO A;  4HX4 A;  5LEK A;  2M34 A;  1LDK B;  4IO9 F;  4ZYG A;  2AS5 F;  2ZME B;  4IL6 C;  5D6E A;  3KZY A;  3ZMU A;  4D7N A;  4MO7 A;  1SC7 A;  3SFZ A;  1IDZ A;  1SD7 A;  1JUS A;  2HOS A;  3Q9V A;  2EFW A;  4I02 A;  4IRG A;  2P5K A;  4XON A;  2R4G A;  3J80 K;  2LF8 A;  1A6Q A;  4G9Y A;  5CVR A;  2QWW A;  4KNY A;  1O7L A;  2R5Z B;  3QOP A;  2A6T A;  1KGS A;  1KYZ A;  2KJB A;  5D8L B;  2WAE A;  4GGG A;  3BZC A;  4XBF A;  4E7S A;  1I50 J;  1MJ9 A;  5IT9 Z;  1MJA A;  5F1R A;  2RAE A;  2XGE A;  1W4M A;  2N8G A;  3FF5 A;  3IKV A;  2M3A A;  5DCF A;  5LLQ A;  3IL2 A;  2BHZ A;  2G0E A;  4ON0 A;  2PMZ A;  1PDN C;  2X51 A;  3U21 A;  3K4B A;  3WHB A;  2VJ5 A;  2OZ6 A;  4UVC A;  5DD8 A;  3OYI A;  1GVJ A;  5L3G A;  1WCM J;  2XRN A;  3CCU I;  1FTZ A;  1HLV A;  1RNL A;  1UJ8 A;  2XGC A;  2KRC A;  5F6F A;  2E35 A;  4FQG A;  3A2K A;  2NNY A;  2AXL A;  2O5R A;  4HRI A;  1XS9 A;  2CW8 A;  1T95 A;  4ZYD A;  2JZY A;  4I09 A;  3CLO A;  3H9G A;  3REO A;  4EV0 A;  3HTU A;  2QSF X;  2J5O A;  5TIS C;  2MW8 A;  4GXO A;  3V8K A;  4BXF A;  1GXQ A;  2ELH A;  1G8X A;  2DO7 A;  3SEZ A;  1T98 A;  5HLH A;  2PQ8 A;  2GXG A;  2UUZ A;  3BG3 A;  3FXR A;  3WHC A;  1YYV A;  1R36 A;  4BUP A;  3PO3 J;  1MIJ A;  4O5V A;  1DUX C;  1A04 A;  2ESH A;  3K70 D;  2H1L A;  3J7A Y;  3TGN A;  2HOE A;  1ENH A;  1GVD A;  2A5Y B;  3HHH A;  1X1A A;  2F4O B;  5J8C A;  5JHF A;  3HPG A;  2BV6 A;  3DTI A;  1YHQ I;  4A3E J;  1B1B A;  4RB2 C;  2OD5 A;  3HOY J;  3BG9 A;  3OL4 A;  4PCQ A;  1SFO J;  2W48 A;  4QTR A;  4XIC A;  1YIT I;  2COB A;  4FT8 A;  3DPT A;  3EYI A;  4M72 A;  3ZN0 A;  3WTY C;  3BTJ A;  4JK1 X;  1R1V A;  3HRT A;  3P9I A;  4I7H A;  1WKM A;  4AVP A;  4HYE A;  1X4P A;  2VJJ A;  4U7B A;  1U5T A;  3OYG A;  5EEA A;  3GXO A;  3J80 Z;  2NVX J;  3VYR B;  2GXA A;  3ZQI A;  4I98 B;  3SJM A;  2CU7 A;  2IA0 A;  2CV0 A;  1POG A;  3HXL A;  1L0O C;  1PUE E;  3HOT A;  2H8W A;  1REP C;  5CQG A;  2A68 F;  1WJD A;  1XGS A;  2CQ7 A;  3K4N A;  4XRF A;  2PFB A;  4XM3 A;  1ZH5 A;  3D5S C;  2M7B A;  3PIP F;  5ICF A;  2L9R A;  4DBQ A;  5J47 A;  2XHK A;  3AG1 H;  3H3U A;  4A12 A;  3C7J A;  5FB2 A;  1PJR A;  2XAQ A;  2HWV A;  3DTK A;  3LSK A;  2WV0 A;  3PNT A;  1G59 A;  2DCE A;  4WX9 A;  2Z33 A;  4AD9 A;  1IN4 A;  1O57 A;  3OYH A;  5BOX A;  4I2O A;  3CJQ B;  3E5Q A;  1OCT C;  4DYQ A;  2L02 A;  4MEY F;  4NHJ A;  1HKT A;  3PQK A;  2HZD A;  2DA3 A;  1U5T C;  3I53 A;  2Q0O A;  5B1B H;  1XMX A;  4C30 A;  3PSF A;  4J01 A;  4N4O B;  1D1A A;  2K9M A;  3ZQC A;  1JT6 A;  1FLI A;  4LIV A;  2FQ4 A;  3FBN B;  2IA2 A;  4JP0 A;  3OSF A;  2A6E F;  3H92 A;  1YQA A;  1OR7 C;  1U78 A;  4M71 A;  2O6G E;  1UCR A;  2R3S A;  2AQE A;  2Q2E B;  1H0M A;  4IHY A;  1D5Y A;  2D45 A;  1RUN A;  3L2U A;  1ERD A;  4ZTJ A;  3H3Z A;  3ZPL A;  2P4W A;  5CVI A;  2EZL A;  4FCY A;  1VI0 A;  4FE7 A;  3ROU A;  2DBB A;  4F55 A;  3U9G A;  4IRH A;  2W7N A;  5JR3 A;  2EIL H;  4RGU A;  3HOS A;  3F8C A;  4ZTF A;  3HRU A;  2FNP A;  2ID6 A;  3FMR A;  4I01 A;  2HNH A;  3RKX A;  4FIS A;  4PZJ A;  4RB0 A;  2DDA A;  1ETY A;  3OR2 C;  3DQV C;  1P4W A;  3SFI A;  3WTZ A;  2IS4 A;  3P9K A;  1TWG J;  2VXZ A;  1IUY A;  2V4J C;  4AM3 A;  2KIM A;  5J1U A;  3PFY A;  3LA3 A;  4V2G A;  2XPV A;  3I4M J;  4KIS A;  5E1W A;  3VYU B;  4IQJ A;  3OS0 A;  2Z3Y A;  4A3L J;  1G3Y A;  3IWF A;  3R6S A;  2VBZ A;  3AAF A;  2W1O A;  1FMW A;  1F9N A;  1BA5 A;  3PJR A;  1FP1 D;  1NK2 P;  3LAP A;  3I4N J;  1FY7 A;  1FYL A;  1RRJ A;  2YPR A;  2YU3 A;  1MMG A;  5TJJ A;  3WTS C;  1ZG5 A;  2ZXJ A;  2PLY A;  4BE1 A;  1DGR M;  3K2Z A;  3ECH A;  3RJP A;  1D5V A;  2LC2 A;  1PVE A;  1XMK A;  3HG9 A;  5LEJ A;  3JSO A;  5IYD J;  3ESW B;  2K3P A;  4X6A J;  3LSP A;  4M3B A;  1JJ8 C;  2KFD A;  1OFC X;  4ESB A;  2DOD A;  5L3D A;  1LKX A;  1WGX A;  2QYO A;  5FKM A;  1FT9 A;  1GV2 A;  2HOA A;  2W00 A;  4I6Z A;  1BM9 A;  2Z2S B;  4CDG A;  3A02 A;  3OIQ A;  4LG0 B;  3HC7 A;  1S72 I;  1T08 B;  1LEA A;  3BG6 A;  3IHU A;  2K9S A;  3HB9 A;  1STZ A;  2HVQ A;  3FBI B;  4FET A;  1OR7 A;  4M6X A;  3K6G A;  3IRQ A;  3KZI C;  3C2B A;  3EUA A;  3DWL E;  2XF5 A;  5LHH A;  3QU3 A;  3L1P A;  4EQQ A;  1ZLJ A;  3M8F A;  3OIP A;  2DFE A;  3E7L A;  2VN2 A;  3F8F A;  1RET A;  3Q5F A;  3VSL A;  2WAQ A;  3S2H J;  4A0Y A;  1IN7 A;  2BOL A;  5GTI C;  5LRS A;  2ECB A;  2L01 A;  2ZCW A;  2QUF A;  3ZQ7 A;  5EG0 B;  1R1T A;  2RDP A;  4UHT A;  4BKX A;  4RLQ A;  3H5N A;  3M3Y J;  2DN0 A;  2E2H J;  1ETX A;  2X6Y A;  3O3K A;  3U1K A;  3BRO A;  3AFH A;  4YFX F;  3NRV A;  4YIR X;  3TKY A;  2H1K A;  1OLT A;  4ABZ A;  1YJW I;  1BOB A;  5H6R A;  4OMY A;  2ZJ2 A;  4XRS A;  4A6E A;  2E2J J;  1W5T A;  1WSU A;  3IC7 A;  1TT5 B;  2HPM A;  1JHH A;  3BOQ A;  3PNY A;  2HVS A;  2WY8 Q;  3HSF A;  2X1D A;  4HQM A;  3CUO A;  4D5F A;  1BC7 C;  1WJB A;  2GM4 A;  3S16 J;  3FIS A;  4A3D J;  1X4O A;  3RYR A;  4XLC A;  1WH5 A;  2EV6 A;  2JSP A;  3DCF A;  3CP8 A;  1ONV A;  1OYW A;  2Y75 A;  3FM5 A;  3H35 A;  4KIT B;  3PSI A;  2B0L A;  3JAM K;  3R4K A;  1ACI A;  2VQG A;  4AYB A;  5EEG A;  3ABM H;  3QPS A;  4ZDP A;  1T38 A;  5ILU A;  3K4L A;  4DGW B;  3GBG A;  1CGP A;  1AWC A;  4H0E A;  2DYS H;  2F5C A;  2E34 A;  2ZSI B;  5E1X A;  2WC2 A;  5DM6 F;  3B6A A;  3CO6 C;  3I3L A;  3ABU A;  4L5J A;  2F5V A;  4ESF A;  5K5R A;  3W6K B;  2FNA A;  1Z21 A;  3WG7 H;  2Q8K A;  4LIT A;  4EM1 A;  5J1Y A;  4A5M A;  4HV6 A;  3KE2 A;  3IRR A;  2YUS A;  4I0A A;  4UB8 C;  3BTI A;  3I64 A;  2QCO A;  1YW9 A;  1P7J A;  4FX0 A;  4ETS A;  3S1N J;  2E60 A;  3K70 C;  1P6R A;  2ICW G;  3MKW B;  3MKY B;  1Z91 A;  3TO6 A;  4YRV A;  4XN3 A;  2D1V A;  5K7Z A;  2UXX A;  3ZQF A;  3E6M A;  1FC3 A;  1GV5 A;  3DBH B;  4ASN A;  5AON A;  4UUS B;  2CV2 A;  1DPU A;  1X3U A;  2Y9Y A;  2LNB A;  1I6X A;  4PSW A;  4B47 A;  4G8X A;  2YR2 A;  3RYP A;  5HS8 A;  4E70 A;  2EB7 A;  2L54 A;  5HLG A;  5HNF A;  2BY1 A;  4XLE A;  3UKG A;  1B59 A;  3V7R A;  2OUM A;  4A3C J;  1IV8 A;  4E7J A;  4U0Y A;  5ED4 A;  5F04 A;  2WAD A;  3DKX A;  2EIM H;  2LKS A;  2KZV A;  4P5O A;  2MC4 A;  3RIR A;  4IKF A;  2JQ7 A;  2ZXI A;  3JTG A;  4MTE A;  3JRB A;  1XSD A;  3K4K A;  3TQN A;  1ZAO A;  4L5E A;  3GFM A;  3B02 A;  1ZLK A;  3C18 A;  3MAJ A;  3WU0 A;  1TWF J;  1LE8 A;  2D5V A;  5E3L A;  3LSH A;  3VWB A;  2IP2 A;  3G73 A;  4BS9 A;  4NQW A;  3GF2 A;  3S8P A;  5J4Y A;  2IS2 A;  3DF8 A;  4MFE A;  3CJR B;  1F36 A;  1LVK A;  3HUG B;  2DJN A;  4EM2 A;  1R5I D;  3KP5 A;  2L9N A;  5H20 A;  5ILV A;  4DNC A;  1ZG1 A;  2L9S A;  3LST A;  2EPF A;  4CH7 A;  4L5I A;  3CCJ I;  1APL C;  5HDG A;  1XD7 A;  2P7C B;  5L3F A;  3E5X A;  2VQC A;  1TT0 A;  2V1D A;  3E6B A;  1D1B A;  2JA2 A;  2B63 J;  1OYY A;  3GZ5 A;  2HZT A;  3A1Y A;  3ZQG A;  2VQH A;  1AA7 A;  2IGK A;  2IS6 A;  2KRH A;  3F8N A;  4KN7 X;  3ZMT A;  3J7A O;  2FRH A;  1MSE C;  1YX5 A;  2GA1 A;  4HG2 A;  3I56 I;  2JPC A;  2CV1 A;  1MGT A;  4B8X A;  3ERM A;  3V7C A;  2JN6 A;  4UXN A;  3A0B C;  3QYF A;  4GYI A;  3TED A;  3F6O A;  2DMU A;  2DU9 A;  2DYR H;  2M0C A;  3SXY A;  3H0D A;  4LK0 F;  5DYM A;  1KQ9 A;  3ZMD A;  2PX9 A;  3BR5 A;  4U0W A;  1ZRE A;  3F6V A;  3W3C A;  5JI6 A;  2FE3 A;  4AU7 A;  2VBW A;  4LD5 A;  2HKO A;  1FYK A;  2CQX A;  1YI2 I;  1WI3 A;  2A5W A;  2D1H A;  4M73 A;  2M8E A;  4HX7 A;  5B3S H;  4KA4 A;  3CCQ I;  4ENM A;  2F5F A;  2HI3 A;  5E8I A;  4CHU A;  2IRF G;  1WZ2 A;  3HHG A;  4XNF A;  1SVL A;  5FLX Z;  3OIO A;  2HYF A;  2K27 A;  3SQN A;  2VON A;  3DP7 A;  1B9N A;  1GUU A;  2BZT A;  1S29 A;  2ESN A;  2RKH A;  1QZE A;  2AO9 A;  3LWF A;  4WF2 A;  5IYB J;  2GIV A;  3VOD A;  3CUQ A;  1H9T A;  2NS0 A;  2GIZ A;  4Q5S F;  3U2R A;  1JT0 A;  3MQ0 A;  1TW2 A;  3JRI A;  3KYL A;  4ITV A;  4G94 A;  2P5L C;  2MBF A;  2R7S A;  1XSV A;  1A6I A;  2FBK A;  1UMQ A;  5HOD A;  2OCC H;  2R7R A;  1DP7 P;  2EQR A;  2LVS A;  3B73 A;  4Y33 A;  4Q48 A;  3R0J A;  4HSR A;  5C3E J;  4LLL A;  2QLZ A;  3DXJ F;  2XAH A;  4KT5 C;  2K86 A;  3SDB A;  2OCE A;  1IRF A;  4A3M J;  1R22 A;  3HDD A;  3OY9 A;  3CES A;  2W57 A;  1HCR A;  1E0E A;  2V7F A;  2DQL A;  3ELK A;  3IV5 A;  3EUH C;  1DU0 A;  1J2X A;  2JA6 J;  1HA8 A;  2ZXH A;  2CRG A;  2V9K A;  1HDP A;  3SZP A;  2I5U A;  3DEU A;  2DMT A;  2LDU A;  4HX8 A;  2MAB A;  2X6X A;  2PEX A;  5E3M A;  1PUF B;  4CCO A;  2E1M C;  4XN0 A;  1LDD A;  3MD2 A;  2F48 A;  1F1Z A;  4BXX J;  3FXU A;  3SHF A;  1T39 A;  2YU9 J;  4S04 A;  1Z3X A;  1R00 A;  4HBL A;  4EEF G;  2V9P A;  4BXU A;  5GAH J;  4EGZ A;  3N4M A;  3ZR8 X;  3OYM A;  3QP5 A;  4UB6 C;  2MLK A;  1K7A A;  2ZFU A;  2XPW A;  1MMN A;  3FHZ A;  4OWR B;  1UST A;  4P9U A;  1T2K A;  4HST A;  4IZZ A;  3WTU C;  3JCU C;  1XC5 A;  2IGO A;  5HNH A;  4L0Z B;  3TDZ C;  1XCB A;  3BJA A;  2LRD A;  2EFQ A;  1H89 C;  4A0Z A;  5ICG A;  1WRJ A;  1IXC A;  2QBY B;  5DUI A;  3BJO A;  3RKY A;  1QHH D;  1ZGA A;  3F23 A;  3CDH A;  3IH3 A;  5GPA A;  3CC2 I;  2R7O A;  4UUS A;  4PGG A;  3CDI A;  3BCA A;  3D5R C;  3EUK L;  1XGN A;  5F0C A;  5HVQ C;  4G7O F;  3F21 A;  3NAU A;  4Y7N J;  3OS2 A;  3HOX J;  3ZMV A;  1KA8 A;  2M0M A;  3V8L A;  2CMP A;  5FFX A;  3OMY A;  1DQU A;  5JVT A;  1TQI A;  1ZN2 A;  4NC8 A;  2VKD A;  1MW7 A;  2V6E A;  2E5N A; 
#chains in the Genus database with same CATH homology
 3JRG A;  4A93 J;  1ZR2 A;  1K83 J;  3G1M A;  2WV1 A;  1HF0 A;  4AYB N;  2JA8 J;  1VFC A;  3LSG A;  3LOC A;  2HDD A;  3FK6 A;  1X2N A;  1OCT C;  4DYQ A;  3MKL A;  1VND A;  1RPW A;  2E1O A;  2DA3 A;  3A03 A;  1JKR C;  2DMQ A;  4IHV A;  3CDL A;  3ZQC A;  3BR6 A;  5IP6 A;  3JRA A;  1JT6 A;  1ZR4 A;  2WAQ N;  4RDU A;  1GT0 C;  4DZJ A;  2FQ4 A;  4JP0 A;  3OSF A;  1IV6 A;  2JK3 A;  3W6V A;  3BQZ A;  3HGG A;  2DA4 A;  1ETV A;  1ITY A;  3BQY A;  1U78 A;  2NOG A;  4V2F A;  2ME0 A;  1CQT A;  5FLV A;  4IHY A;  2DA6 A;  1D5Y A;  5F27 A;  5FLM J;  3JRD A;  1TWC J;  2EZL A;  4M3D A;  1VI0 A;  4FE7 A;  5IOZ A;  4FCY A;  2HXI A;  3JRC A;  5M5Y J;  2ID6 A;  4D7M A;  1FJL A;  4FIS A;  1GDT A;  3S1M J;  1ETY A;  5EGO A;  3Q0U A;  3GTP J;  4X1E A;  2VUM J;  3SFI A;  1PUF A;  1F43 A;  3GTJ J;  5K7H A;  2NVT J;  3Q3S A;  1EF4 A;  1Q1V A;  1TWG J;  1YRN B;  2IEK A;  5J1U A;  5IPA A;  3TP3 A;  4JX4 A;  2K9N A;  2MGQ A;  2XPV A;  4V2G A;  3RKQ A;  3ZQL A;  1ZQ3 P;  3I4M J;  2O7O A;  1DU6 A;  2WB1 N;  2O8K A;  5K7F A;  1T33 A;  2ID3 A;  4A3L J;  2LK2 A;  1TWA J;  5M3F J;  2LP0 A;  3JRH A;  1BA5 A;  2VKE A;  3BG5 A;  1ETQ A;  1NK2 P;  3B6C A;  3I4N J;  1JUM A;  1MBF A;  1S7E A;  3PM1 A;  4FE4 A;  3ZQH A;  2R93 J;  5IYD J;  3G1L A;  2VKV A;  5EGO B;  3BTL A;  3BR3 A;  3S15 J;  4M3G A;  4X6A J;  4A3I J;  1B8I A;  2JWT A;  3LSP A;  2DMN A;  4M3B A;  2HXO A;  1Z77 A;  3CQZ J;  4JX6 A;  1JJ8 C;  3QQA A;  1OFC X;  1X2M A;  1WGX A;  1B72 B;  5FKM A;  1GV2 A;  2HOA A;  5JLW A;  1RES A;  1G2H A;  2M9H A;  4I6Z A;  3A02 A;  4BBS J;  1MBG A;  1IRZ A;  2K9S A;  3HB9 A;  3S14 J;  1W0T A;  2H8R A;  4MFD A;  4A3J J;  3F0C A;  3C2B A;  3IH2 A;  1WH7 A;  3L1P A;  4BBR J;  2DTZ A;  4A69 C;  4FTH A;  3K7A J;  4QIW N;  1VF9 A;  3E7L A;  2E19 A;  2LY9 A;  1AKH A;  1FIP A;  1MNM C;  4IHW A;  1RET A;  2KT0 A;  1AKH B;  4DW6 A;  2FD5 A;  3TW6 A;  1BL0 A;  3S2H J;  5F0F A;  3HEF A;  5GPC A;  2ECB A;  3TP0 A;  5EZG A;  2R5Z A;  5F1J A;  5EG0 B;  2PMZ N;  2EZH A;  2L0K A;  3FK7 A;  3FIW A;  4BKX A;  9ANT A;  3A01 B;  3M3Y J;  1ETK A;  2DN0 A;  2MG4 A;  2E2H J;  2ECC A;  1ETX A;  2XB0 X;  2H1K A;  1OJL A;  1OCP A;  4ABZ A;  3HOZ J;  4IHX A;  3BTC A;  4W1U A;  3SDG A;  4NDL A;  2ELK A;  4W97 A;  4XRS A;  3IH4 A;  4S0H B;  1JUP A;  2E2J J;  3BR1 A;  5IP9 J;  3GTO J;  2QF7 A;  2DA5 A;  2LTP A;  2M2E A;  2Y2Z A;  3HOU J;  2EBI A;  4G12 A;  5FKO A;  4UUT A;  4D5F A;  5EYR A;  3JRF A;  2GM4 A;  3S16 J;  3FIS A;  4A3D J;  4M3F A;  3GTL J;  3GTG J;  4A3B J;  2TRT A;  1UG2 A;  5F08 A;  4D5C A;  1LE8 B;  1WH5 A;  2M8G X;  3DCF A;  2JA5 J;  4JYK A;  2CUF A;  2YS9 A;  1AU7 A;  4XID A;  2R5Y B;  2EZI A;  4A3G J;  3QPS A;  5FJ8 J;  2XRL A;  4BY7 J;  5EG0 A;  4M3E A;  3GBG A;  2XSD C;  2VPR A;  2ZB9 A;  2CJJ A;  3LNQ A;  3B6A A;  1TWH J;  1JKO C;  5IYC J;  2GBY A;  4C3I J;  4XK4 A;  1IUF A;  5C4X J;  4AC0 A;  4C3J J;  1RKW A;  4RBO A;  5J1Y A;  1I3Q J;  2OF7 A;  3HM5 A;  2HOT A;  2JA7 J;  2YUS A;  2Y31 A;  1W0U A;  1MH4 A;  4M6V A;  3BTI A;  4LOC A;  1QVT A;  2QCO A;  2LLK A;  1P7J A;  5EDN A;  1WPK A;  4Y52 J;  1MSF C;  2GLO A;  3S1N J;  3S1Q J;  1JKP C;  2HYJ A;  1FTT A;  2TCT A;  2Y0S N;  5K7Z A;  3ZQF A;  3D1N I;  3BR2 A;  3GTK J;  1GV5 A;  4UUS B;  2R7Z J;  2LD5 A;  2Y9Y A;  3K2A A;  4B3A A;  3HOW J;  1ORK A;  3HGY A;  3A01 A;  3BR0 A;  1Y1V J;  3Q0V A;  3UKG A;  1MBH A;  1IJW C;  4A3C J;  3DEW A;  3TW7 A;  5DTD A;  2K9Q A;  5F04 A;  3GTM J;  3LSR A;  2KDZ A;  4MLO A;  3FKI J;  1K61 A;  1UHS A;  4QSH A;  2AHQ A;  3JRB A;  1R9T J;  2X9D A;  4L5E A;  2O9L A;  2FX0 A;  4JX5 A;  3Q0W A;  3JR9 A;  1TWF J;  1LE8 A;  2D5V A;  5E3L A;  4AUX A;  1IGN A;  2OPT A;  1FEX A;  2NS7 A;  1RKT A;  3G1O A;  1U9N A;  1MBJ A;  3ZOB A;  4MFE A;  2LKX A;  1F36 A;  2XGD A;  3O8G A;  2DJN A;  3HKZ N;  2R5Y A;  1H88 C;  5IOY A;  4DZP A;  3RQI A;  1ZTR A;  1MBK A;  1APL C;  2NS8 A;  5F0H A;  5IP7 J;  3CCY A;  3LSJ A;  1YRN A;  3M4O J;  2I10 A;  2XPU A;  1E3O C;  1TC3 C;  2B63 J;  3ZQG A;  5M3M J;  2IBD A;  2VI6 A;  3QPL A;  2P81 A;  2X6O A;  5M5W J;  4J19 A;  1ZGW A;  5DS9 A;  4DYR A;  1MSE C;  3S1R J;  3JRE A;  4GFB A;  1NTC A;  1JGG A;  2XB5 A;  2JN6 A;  1SAN A;  3MVP A;  2JJ7 A;  2DA2 A;  3TED A;  1BW5 A;  2DMU A;  4DYC A;  4HNV A;  2M0C A;  1QVU A;  2DA1 A;  2R0Q C;  5C4J J;  4CYC B;  1HOM A;  1JTX A;  2L7F P;  3BR5 A;  1LFB A;  1IG7 A;  1A5J A;  1RR7 A;  2CQX A;  2Y9Z A;  3O8H A;  1WI3 A;  2M34 A;  2R92 J;  3H0G J;  3GTQ J;  1AHD P;  5E3O A;  5FKK A;  2HI3 A;  4D7N A;  2NVY J;  4MO7 A;  4A3K J;  1IDZ A;  1JUS A;  4XRS G;  2HOS A;  3HOV J;  3OIO A;  4XRM A;  3MN2 A;  2R5Z B;  1GUU A;  1B72 A;  5JLX A;  5EZH A;  2AO9 A;  5IYB J;  4IEJ A;  1JT0 A;  4I76 A;  1I50 J;  4C3H J;  3JRI A;  2RAE A;  2XGE A;  2FJ1 A;  2JMW A;  2N8G A;  1A6I A;  2DA7 A;  3PO2 J;  1UMQ A;  5HOD A;  2G0E A;  5J1R A;  5GP9 A;  3WHB A;  4MIM A;  4A3F J;  2EQR A;  2LVS A;  1WCM J;  1FTZ A;  1ZKG A;  5C3E J;  1HLV A;  3H3V K;  3RZD J;  3S17 J;  1I6H J;  2E2I J;  5FKL A;  2XGC A;  4A3M J;  3HDD A;  1Z0X A;  1JTY A;  3S2D J;  1HCR A;  3IV5 A;  2JA6 J;  1XS9 A;  1DU0 A;  3CMY A;  5FKN A;  2CRG A;  1HDP A;  1NK3 P;  3RZO J;  2IAI A;  1B8I B;  2DMT A;  2LFB A;  1P7I A;  1QPI A;  2Y30 A;  1PUF B;  5E3M A;  2MW8 A;  5E3N A;  2K40 A;  1HDD C;  4BXX J;  4B4C A;  2X48 A;  2EZK A;  2YU9 J;  1ETO A;  1MH3 A;  4EEF G;  1Y1W J;  1LFU P;  3BG3 A;  3WHC A;  3PO3 J;  1QRY A;  5BNG A;  1FIA A;  1JKQ C;  2L7Z A;  2XPW A;  1ENH A;  1GVD A;  2ME6 A;  1BJZ A;  2DMP A;  4A3E J;  1XC5 A;  3HOY J;  3BG9 A;  1SFO J;  2W48 A;  4QTR A;  5J3L A;  1IDY A;  1X58 A;  4XIC A;  5M5X J;  1O4X A;  2COB A;  1H89 C;  2NVQ J;  1BW6 A;  3BT9 A;  2CQQ A;  2EH3 A;  3BTJ A;  3HBL A;  1IC8 A;  3IH3 A;  5GPA A;  4BY1 J;  4UUS A;  5C44 J;  4CYC A;  1XG1 A;  3OSG A;  2CUE A;  5F0C A;  1T56 A;  5EEA A;  1U8B A;  1H8A C;  3NAU A;  5EF6 A;  4Y7N J;  2NVX J;  1ZK8 A;  3ZQI A;  3HOX J;  3SJM A;  2CU7 A;  1POG A;  2LR8 A;  1MBE A;  3VPR A;  4B1R A;  2MSY A;  4C2M J;  2HQ5 A;  1JJ6 C;  1ETW A;  3NAR A;  2L7M P;  2L9R A;  1U9O A;  3OOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...