2E2JJ

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2jJ00
3UKGA 2R92J 1S7EA 3GTQJ 4FE4A 1GV5A 4V2FA 5E3NA 1RPWA 5J3LA 4BBRJ 1RESA 3W6VA 2DMNA 3FIWA 4AUXA 3LNQA 3S1QJ 2EH3A 1BW5A 3BG9A 2GBYA 1I50J 5IYDJ 5EG0A 4UUSA 3FK7A 5FLMJ 3GBGA 2NVTJ 3I4MJ 2DJNA 2LY9A 3TW7A 2Y0SN 4C3IJ 4XRSA 2DMPA 3ZQCA 2O9LA 5M5YJ 3HBLA 2R5ZA 1Z0XA 1HDPA 1SFOJ 2IAIA 1LFUP 1Y1WJ 2M8GX 3PM1A 3QPLA 2JN6A 3JREA 2LD5A 1QPIA 5FKKA 1AHDP 2WV1A 1FTZA 1FIAA 3CCYA 4B3AA 1IGNA 4FTHA 2NVQJ 1JT6A 4A3KJ 1ITYA 1GT0C 1X2MA 2X48A 2DA1A 1TWGJ 2L9RA 1AKHA 1TC3C 4XIDA 2Y9YA 1B72A 4I6ZA 1QVUA 2DA5A 3K7AJ 3B6AA 5F0FA 2Y2ZA 5EGOA 4RDUA 1MH3A 1ENHA 2O8KA 1Q1VA 1JTXA 3TP0A 1Z77A 2ECBA 3JRIA 1ZQ3P 3JRAA 2ME6A 5FKMA 1JTYA 4D5CA 1BL0A 3HDDA 1WI3A 2XGDA 3DCFA 1HCRA 5DS9A 2IEKA 3BQYA 2NS7A 3ZQLA 5FLVA 1U9OA 3CQZJ 5K7HA 3LSPA 3K2AA 1H8AC 1OCTC 4JX5A 3QQAA 3BT9A 3SJMA 4MIMA 1IV6A 1A5JA 1VFCA 4A93J 5EYRA 5F08A 3S1RJ 1W0UA 3JRHA 4BBSJ 4XICA 1QVTA 5E3MA 1B8IA 1X58A 4S0HB 3BTIA 2TCTA 3TEDA 2VKEA 3IV5A 5E3LA 1R9TJ 3HB9A 5EZHA 2MG4A 1WGXA 1JT0A 2M0CA 3HOXJ 3BTJA 4QSHA 1XG1A 1DU6A 2EQRA 5JLWA 5GPCA 2ZB9A 1X2NA 3BG3A 1MBKA 2EZKA 1VNDA 3S16J 4EEFG 2CUEA 3HOVJ 2R5YB 1O4XA 4A3BJ 4M3DA 1I6HJ 2W48A 1JUSA 3HOWJ 2G0EA 2R0QC 3HKZN 3G1MA 2L7MP 2CJJA 3RQIA 1ZTRA 2HXIA 1G2HA 1MBGA 1MBEA 4DW6A 4DYRA 5K7FA 2K9NA 2QCOA 2DA6A 2HDDA 4M3FA 3ZOBA 2H1KA 2K40A 2N8GA 1GDTA 2DN0A 5C44J 2HOAA 3E7LA 1JGGA 4HNVA 4C2MJ 4A3CJ 2K9QA 4JYKA 2WB1N 1U9NA 3JR9A 4M6VA 2CQQA 1WPKA 2LKXA 1JJ8C 1YRNA 1APLC 3LOCA 3GTJJ 1HLVA 4XK4A 2XPUA 5IP6A 1K83J 1F36A 1ETKA 5IOYA 4FE7A 2JWTA 2VI6A 1ZR2A 1JUMA 1AU7A 1HF0A 3HOUJ 4W97A 5F04A 4L5EA 3G1OA 4NDLA 2HYJA 4B1RA 1RKWA 3NARA 5IYCJ 2DA7A 4IHXA 2XPWA 1VF9A 2DA2A 1E3OC 3A01A 3PO3J 4AC0A 1MSEC 2DMUA 4LOCA 3S17J 3M3YJ 3JRCA 5J1UA 3OSGA 2L7FP 4MLOA 3DEWA 3ZQIA 3ZQHA 1ZK8A 1XS9A 2I10A 1IG7A 2QF7A 2TRTA 3Q0UA 3G1LA 2KT0A 2NS8A 3JRFA 5F0HA 3I4NJ 3LSJA 1GVDA 3A02A 2JA7J 2EZHA 3A03A 3VPRA 3JRGA 4D5FA 2K9SA 4DZJA 3OIOA 1HOMA 1W0TA 2XRLA 5EF6A 2GLOA 5J1YA 1Y1VJ 1OJLA 3TW6A 4D7NA 5FJ8J 4C3HJ 1MH4A 1WH5A 2X6OA 4IEJA 2ECCA 3MKLA 4FISA 2NOGA 2YUSA 3M4OJ 3HEFA 5J1RA 3LSRA 1RR7A 2HOSA 1FEXA 3RZDJ 1JKPC 1D5YA 2ID3A 2AO9A 1ORKA 2CUFA 3MVPA 2Y31A 2H8RA 2JA8J 1OFCX 1RETA 2COBA 5FKOA 3WHBA 2XB0X 2FD5A 3BR3A 4QIWN 5FKLA 1UMQA 1GUUA 1JKRC 2ME0A 3GTMJ 2XGEA 5C4XJ 4I76A 2D5VA 4IHYA 1ZR4A 1K61A 2YS9A 4A3FJ 2VPRA 2CQXA 3S14J 1FTTA 4A3JJ 1TWAJ 3GTKJ 3B6CA 1JJ6C 2PMZN 4MFDA 1ZGWA 3HOYJ 4CYCB 4BY1J 5EZGA 4X1EA 4DYQA 1F43A 1ETVA 4IHVA 2DA4A 2M34A 3JRBA 1CQTA 3HOZJ 2R7ZJ 1LE8B 3S1MJ 1UHSA 3PO2J 1MBHA 4DZPA 2E19A 3Q0WA 2X9DA 3S15J 2HOTA 2OF7A 2P81A 2LFBA 5F27A 3CDLA 4QTRA 2FQ4A 3TP3A 3BR2A 1JUPA 2EZLA 4Y52J 2YU9J 1T33A 2GM4A 2E1OA 5EG0B 4UUSB 3CMYA 2LLKA 4A3DJ 2M2EA 4A3EJ 5EDNA 1IDYA 4D7MA 4M3BA 5C3EJ 1IC8A 2R5ZB 4DYCA 2LTPA 4AYBN 3H0GJ 4B4CA 1A6IA 4M3GA 1HDDC 1U78A 3GTOJ 1LE8A 4A3MJ 3BR1A 2L0KA 4V2GA 5GP9A 2XGCA 4ABZA 1WH7A 4GFBA 1BA5A 2R5YA 1UG2A 3Q3SA 2ELKA 1NK2P 4MFEA 3SDGA 1MBFA 4MO7A 4RBOA 2DA3A 4FCYA 2FX0A 3IH3A 2JA5J 5M5WJ 5M3FJ 1AKHB 5HODA 3LSGA 1P7JA 5M5XJ 2JJ7A 3C2BA 4XRMA 2DMQA 1BW6A 5EEAA 1B72B 3S1NJ 1XC5A 1NTCA 1IRZA 1SANA 4UUTA 3RKQA 2HXOA 2CRGA 4JP0A 3IH2A 2ID6A 1LFBA 5GPAA 5EGOB 4BXXJ 5K7ZA 1NK3P 4Y7NJ 3ZQGA 3GTPJ 2E2IJ 1TWFJ 3FKIJ 2AHQA 5BNGA 2R93J 4W1UA 1JKOC 5IYBJ 5E3OA 2OPTA 1H89C 3S2HJ 4JX4A 3BR5A 5JLXA 1DU0A 2JK3A 1MBJA 4XRSG 2XSDC 4X6AJ 2LR8A 2B63J 1ETQA 1I3QJ 1JKQC 1POGA 2DTZA 2MW8A 3BR0A 1P7IA 1B8IB 3OOUA 3NAUA 3HM5A 2M9HA 2Y30A 4A3LJ 4A3GJ 1ETWA 2HQ5A 1PUFB 1H88C 2O7OA 3HGGA 1T56A 2JA6J 3WHCA 1TWCJ 4BKXA 4M3EA 2CU7A 1GV2A 3H3VK 5F1JA 2NVYJ 1VI0A 1RKTA 3HGYA 5IPAA 3SFIA 4J19A 3BG5A 2EZIA 1QRYA 1WCMJ 1TWHJ 2VKVA 2L7ZA 4G12A 2VUMJ 2KDZA 3S2DJ 1ETYA 5IOZA 1IDZA 2FJ1A 1EF4A 3BR6A 3ZQFA 1BJZA 2LK2A 2MGQA 1IJWC 1OCPA 3RZOJ 4A69C 5DTDA 2XB5A 5F0CA 1ETOA 2E2JJ 4BY7J 3BQZA 1ZKGA 1U8BA 3L1PA 2EBIA 4C3JJ 3QPSA 3OSFA 1PUFA 9ANTA 2JMWA 3BTLA 2Y9ZA 3JRDA 5C4JJ 3FISA 3IH4A 1YRNB 3O8GA 5IP9J 2LVSA 5IP7J 1MNMC 3Q0VA 3D1NI 3GTLJ 2E2HJ 1FIPA 3MN2A 4JX6A 3BTCA 3F0CA 4CYCA 2RAEA 4A3IJ 3FK6A 2NVXJ 3O8HA 2IBDA 2MSYA 1ETXA 2HI3A 2LP0A 1FJLA 2WAQN 1MSFC 2XPVA 5M3MJ 3GTGJ 3A01B 5FKNA 2DMTA 4IHWA 1IUFA
chains in the Genus database with same CATH superfamily
4BNCA 3H92A 1GV5A 5E3NA 1DQUA 4H0EA 1D1CA 2OJED 4AUXA 3S1QJ 4IQ4A 2BW3A 2CGPA 3L2WA 3BCAA 2HTJA 2CQKA 2NAZA 1O3QA 1XPXA 1KONA 3CUQA 3ZR8X 3Q5FA 1I50J 1X4OA 1YX5A 3KEYA 3KP7A 4I0AA 4LG0A 2RNGA 3FK7A 2ZNZA 1X1PA 4AIKA 2P6SA 1XDSA 1YHQI 1XN7A 2MLKA 2X1EA 3BY6A 3KP6A 3RJPA 2Y0SN 3I4MJ 3QP6A 4XRSA 4BGDA 2DMPA 3ZQCA 3S3MA 2ELJA 1W36C 1FC3A 2R5ZA 3K4MA 3HPHA 4KYWA 6PAXA 1YTYA 1W7PD 1OYIA 3HHHA 4CUGA 1XGNA 3JAMZ 3HUGB 1VQLI 1S72I 3PM1A 2JN6A 4XLEA 3JREA 1QPIA 5FKKA 3PNYA 5LHGA 5LFAA 2VE9A 3CCYA 3OY9A 1A35A 1FTZA 1W7PA 2KMUA 2AXLA 4FTHA 4HQMA 1ITYA 3GWZA 1CF7A 3KYDB 2IGNA 4G94A 2X48A 5E8IA 5HDKA 2OUMA 5D4SA 3HPGA 1V3FA 3DTIA 3E6MA 2WAQA 1Z6TA 2R7TA 2Y9YA 2IGOA 1B72A 2CQ7A 3T1BA 3AAFA 2K4BA 4GCVA 2QQBA 2MD0A 3E5XA 4BEHB 2FUG2 2Y2ZA 3ZPLA 5BOXA 2EILH 2MLGA 5GTHC 4KMUX 1Q1VA 1A36A 5BQTA 2ECBA 3JRIA 3JRAA 3VEPA 1R5ID 4ZYHA 1IF1A 1WI3A 3MD2A 2XGDA 2CFOA 3RYRA 1S9HA 2W85A 1T0FA 2R7WA 2NS7A 1OCCH 1U9OA 4CCNA 3K2AA 1WI9A 4BXUA 4H4KC 2CW0F 3BT9A 4MIMA 3SJMA 1T08B 3KPHA 4FX4A 2LRDA 5L3BA 4BBSJ 3O6BB 3LA7A 1B8IA 4S0HB 3OIPA 4Q5SF 3CJTB 4U0WA 1JE8A 2VBZA 3I56I 2DFIA 4KMFA 3TEDA 1MMSA 1MKMA 1X3UA 2I5UA 3E3VA 5K1YA 3HB9A 5FO5A 2V9VA 4ZYEA 1JT0A 2R7SA 1I6XA 3GF2A 2L02A 3GFJA 2QENA 3QU3A 1XG1A 1R1TA 3DU5A 5CVRA 1SD5A 5JLWA 2JRMA 5GPCA 4HF1A 2DOEA 2VJ5A 4ZDPA 3DPLC 1MBKA 3J7AY 3GMEA 3HOVJ 1OCOH 3FBNB 4XSZF 3ABMH 4M3DA 1LDDA 4YIFA 4O5VA 2CV1A 5FROA 2G0EA 2EK5A 2WY7Q 3HKZN 3G1MA 4BH9A 5HOOA 2HYFA 2CV2A 3GW2A 3KZIC 2DI3A 1MBEA 2AS5F 4DYRA 1ZG3A 2L4MA 5D5VB 2DA6A 4F7ZA 3OL3A 3IKVA 2HDDA 3FHNA 4IO9F 1X3WB 2JUGA 1FMWA 4OOIA 5ERIA 5BS6A 2DN0A 3E7LA 4HW0A 1EH8A 3CMMA 5K5QA 2RV8A 1JJ8C 1WPKA 2R7FA 4L9NA 1R1UA 3I0TA 4WF2A 4PJNA 1A04A 3HC7A 3GTJJ 1HLVA 2ISZA 2STWA 2XPUA 3TQNA 5IP6A 3SZPA 1FP2A 4N4OB 1TQPA 4HX7A 2JWTA 2VI6A 4U87A 2MC4A 1AU7A 4XLNF 4W97A 2E1MC 4KIFA 4DQ2A 2K85A 4PCQA 1N75A 2V4JC 2DA7A 1FOYA 4IHXA 4KITB 3U21A 1SFUA 4YRVA 3WE2A 2FXAA 4OMZA 1OKRA 1ERDA 1WJCA 3PO3J 3DU6A 4AC0A 4ZH4F 4LOCA 4M9ZA 1IXSB 1P4AA 2KJBA 2VIXA 4A2UA 2DFEA 5J1UA 4IKFA 2FBHA 2L7FP 3I71A 4EM2A 4UV8A 3FXUA 2VE8A 1DP3A 4ANJA 2OAZA 3S3NA 4PDKA 4B43A 3Q0UA 2KT0A 3NWTA 1XMXA 2W4SA 3LSJA 3TOBA 1GVDA 1VQ4I 1MZBA 2HR3A 3FXJA 2EZHA 2RVCA 4EM0B 3A03A 3VPRA 1GXPA 2CQNA 3W6KB 3FHZA 2NS0A 2XC7A 1WJAA 2XRLA 5EF6A 5J1YA 1Y1VJ 1OJLA 3S93A 3TW6A 1DPRA 3D0SA 4GXOA 2A68F 4IEJA 2ECCA 2CW8A 5EEHA 2NOGA 5B5EC 4EJVA 3J7AO 3TDZC 1ON1A 4XLAA 5DD8A 1BIAA 2BHZA 4IOCF 1FEXA 2W1OA 3RSNA 5ILUA 5GADJ 4AIHA 1K6YA 3WTVC 3LAPA 4C2UA 4IVNA 2JA8J 1OFCX 5FKOA 4L5JA 5DM6F 3QPTA 4OMYA 5L3FA 1JHFA 5FKLA 3DPUA 1VTNC 1J75A 3OYEA 2ME0A 1QNTA 3GTMJ 2F4MB 2K3PA 4PGGA 2XGEA 3R0AA 1S7AA 3E97A 1XMKA 2PQ8A 2YS9A 3LQRA 4LMYA 4A3FJ 3S14J 1FTTA 3GTKJ 2ZJRF 2DDAA 1ZGWA 3CLQA 1WHUA 2W24A 1TLHB 1DGWY 2M7BA 2FBIA 1O3RA 4DYQA 2BY3A 4IRIA 3U9GA 2O5RA 2DK5A 2M34A 4GGGA 3HOZJ 2OD5A 5FRNA 1LE8B 2VPLA 1RR8C 1XSXA 2VJIA 1MBHA 3W3CA 1HSJA 2J5OA 4AVZA 2V1XA 5JR3A 1SVLA 3EDPA 3IAM2 2WA0A 4ZZLA 3WGIA 3PIPF 2RGVA 4FETA 3V7CA 5DUIA 3H5RA 3BDDA 4NC6A 1IUYA 1R6RA 2FQ4A 2BW3B 3BC8A 4II2A 4RM2A 3M07A 4PJJA 3MKWB 3CUQB 2BXYA 3CMYA 2PI0A 4LG0B 2LLKA 3JTHA 2M2EA 1G8XA 3R0JA 1WSUA 3ZN1A 4M3BA 2COMA 2X1CA 3K9TA 1T38A 3DP7A 2R5ZB 4DYCA 1PP8F 1YFHA 1ZYRF 1A6IA 2P5KA 2EFOA 1ODDA 2EJRA 4P5OA 2DBBA 4FX0A 1Y8RB 2V1UA 4II3A 3ZCOA 1QHHD 3VDXA 2V9PA 2V9KA 1WH7A 2A3SA 3I3LA 3CCLI 1IZ1A 2BZTA 1D0YA 3Q3SA 2R5YA 1W7PB 2CH0A 3CESA 3K10A 3PQJA 2PMZA 1Y8QB 1YW8A 1CF7B 1MBFA 1FPQA 4GYGA 2DA3A 3E1SA 4F55A 3HSFA 3IH3A 4DOZA 2PJRA 1K78A 5HS8A 4HX4A 5HODA 5FGMA 3ECOA 3LSGA 1M1EB 2VBWA 5M5XJ 3IWFA 2XV4S 2FMLA 1J9IA 1B72B 1XC5A 2LY2A 1NTCA 3SHFA 5KVRA 3IC7A 4UUTA 4Z6YA 3RKQA 2HXOA 1FLIA 3IH2A 3T5XA 3WG9A 3HZJA 1N78A 1R49A 3OOPA 1NK3P 3RYPA 3CO6C 4Y15A 1EKEA 2O03A 1KYZA 1YW7A 5BNGA 2PX9A 4W1UA 4L18B 3GYHX 1IRFA 2DXIA 3ASOH 5HNFA 1ZARA 2CMPA 4CZCA 5DCMA 2D1HA 2BOLA 5JLXA 3N05A 2HQNA 2QEXI 4MQVA 2XSDC 1JHHA 4L5IA 1SD4A 2LR8A 1SMYF 1I3QJ 4WXCA 2Z2SB 1B8IB 3OOUA 4LFUA 1XD7A 2H8WA 3HM5A 3OYMA 3DFGA 4ZJZA 2M9HA 1TW2A 1KU3A 2OZ6A 2Y30A 3CCJI 1HSTA 1ETWA 4M6XA 2HQ5A 1W5SA 1PUFB 2DFFA 2MH9A 5CVIA 1S7OA 2OTLI 2JA6J 3A0BC 3PFYA 1BIBA 2PMUA 5CJ9A 1TWCJ 1MMAA 1UCRA 5F1JA 1D1AA 3HGYA 5KAIC 4XMYA 2HKOA 4MTDA 1PJRA 4F92B 2VKDA 1OQYA 2NNYA 2VKVA 1YYVA 3S2DJ 1R5HA 2IPQX 4F3QA 2M4KA 3P9IA 3F23A 4E7SA 2ADUA 5D6EA 5FB2A 1R5GA 1ETYA 4HSRA 2VQLA 5IT9Z 1EF4A 3ZQFA 3LSKA 5DCFA 1XX5A 2KL4A 1OCPA 2EIJH 1IJWC 2QKLB 2XB5A 1R36A 1ETOA 1V5FA 4UXNA 2GOXB 3F8BA 2FNAA 4XORA 4BY7J 1RRJA 2KRCA 2K27A 5KAFC 3R6SA 3Q9SA 4C3JJ 3M8JA 2V1NA 3ONQA 4NQWA 4IF4A 2DW4A 3L2VA 3LWFA 5TRDA 9ANTA 2JMWA 2WAFA 2L01A 1WJBA 3M8FA 2VQHA 2XRNA 2Y9ZA 5C4JJ 3FISA 2H1LA 2W57A 5AIQA 5IP9J 1N25A 2EIKH 3H35A 2P7VB 3I5UA 4PJMA 3GTLJ 1FSEA 5LGUA 2VASA 3WU1B 1YJNI 3F0CA 2O61A 3FXRA 1MIJA 4QWQA 4AD9A 4GRIA 1C0WA 2IBDA 2O6GE 1FJLA 2GQQA 3LL7A 2VN2A 1MSFC 3FMSA 2B0LA 3TO6A 2LF7A 2ZMEA 5L3GA 2G7UA 1B1BA 4MNUA 5K5RA 1KQ0A 3DBHB 3CP2A 1RPWA 5J3LA 4DGWB 1R1VA 1RESA 2PLYA 5E1XA 2DMNA 3DKWA 3FIWA 1U2WA 2X0LA 3DPTA 2EH3A 3GEZA 2NOJB 2QQ9A 3PNTA 4NHJA 2ZFUA 2X6XA 2XDVA 3B73A 3E6DA 4RAFA 1NHAA 2NVTJ 4PFPA 1TNTA 2LY9A 1SC7A 4C3IJ 1XCBA 1ZN2A 2XKPA 4YEJA 5F6FA 3CC4I 5HVQC 1Z0XA 4ENMA 4PZJA 1SFOJ 2IAIA 2VXDA 3L2QA 2ZKZA 3F8NA 4ESBA 1Y1WJ 1B4AA 2ZSHB 1HA8A 2QSGX 2IS6A 1EH7A 4HEA2 3FKJA 2CYYA 4P55A 1LQ1A 3DBRB 1FIAA 3W6JB 1IGNA 3PIOF 3KP5A 2NVQJ 2EWNA 4IRHA 1JT6A 1Z6RA 2NXNB 4XLCA 3GFMA 1LNWA 1X4PA 1X2MA 1X3ZB 1TWGJ 2L9RA 3GZNB 1AKHA 1SFXA 5KNLA 1TC3C 3GUDA 3TO7A 1E3HA 3F3XA 5E18F 4RB2C 2IS4A 1DPUA 4TV7A 1ZRDA 3MMYB 2JVGA 2GIVA 3V8KA 1WQ2A 4IJAA 1BM9A 1MJAA 1YS6A 4UHTA 3I58A 1MH3A 2L9NA 2F48A 4XBFA 5KHDA 1ENHA 2O8KA 2VBXA 3OS1A 3TP0A 4ZZDA 3VYTB 5F1RA 1Z77A 1JTYA 4D5CA 1BL0A 1Y56A 1YJ9I 3U1DA 5DS9A 2IEKA 4Q48A 2KIQA 2HQAA 1PP7U 5LHIA 3M1EA 2VJ4A 3LSPA 2HVRA 3W2VA 2BY2A 1OCTC 1Q1HA 2Y0SA 1L0OC 3OYCA 4A6DA 3K4NA 2WC2A 3EETA 1IV6A 1A5JA 5E1ZB 5F08A 5D8LB 5D5XB 3S1RJ 1W0UA 2LC2A 2KRFA 4EGZA 4HOBA 4U88A 3VYSB 3I54A 1X58A 1MMDA 4EJWA 3EUHC 4J01A 3SEZA 5HS9A 2H6CA 3KZYA 5LRSA 2HEOA 2A6TA 5DUKA 3H9QA 4KFCA 3RPUD 1VQNI 5IT9K 2VKEA 2ELHA 2PJPA 2DT6A 4EJUA 2A5WA 2OU2A 1WZ2A 1V55H 4BE1A 1JI8A 5CVJA 1W36D 2UZKA 2J5PA 4N4NB 3HTUA 2M0CA 2QSFX 1B59A 3SDBA 1R4MB 5JFRA 4YELA 1XMAA 3CCMI 3BTJA 3RPUA 4E7HA 1UHMA 2KJCA 3PSIA 2VONA 2QQ8A 3BG3A 1ZLKA 4EEFG 2A61A 1BJAA 5FFZA 5EEGA 2R5YB 2H27A 1RIOH 2CWEA 3Q9VA 3KYLA 3KYCB 2G7HA 2KDOA 3W2AA 1ZTRA 4OWRB 1JGSA 3DXJF 5K7FA 1K78B 2PJRB 5LGNA 1I1SA 1I3AA 2CG4A 3ML6A 1BC8C 3ZOBA 1RUOA 3LMMA 3MZHA 2NYXA 2N8GA 1SFKA 1GDTA 5C44J 1ACIA 3PL8A 3CP8A 2K9QA 2RQQA 3OYNA 3CMEI 2LSOA 4JYKA 4FT8A 1ZH5A 2WB1N 2F5CA 4HQEA 2V1DA 1LDJA 4CSWA 4YG2F 1APLC 2P5VA 3LOCA 4XK4A 4NC8A 5ICEA 1F36A 3BLYA 2F2EA 3OS0A 3PSFA 1USTA 1GLNA 1ZR2A 1JUMA 3AG4H 1SD7A 5DCMB 3HOUJ 5F04A 4RAYA 3LSHA 3G1OA 3BZ6A 3ABLH 4LLNA 3H36A 1RKWA 4E6KG 5IYCJ 2XPWA 4BHBA 2B7EA 1VF9A 4PJ0C 1Z7UA 1SAXA 2M8EA 4M73A 2GZWA 2DA2A 3F8FA 4PGHA 4A0XA 3L2UA 4J00A 1WJFA 2EB7A 2VKHA 4RB1A 1BC7C 3S17J 3DQVC 3KIOA 3FZVA 4RMNA 3OSGA 1B6AA 4NB5A 4MLOA 4BU2A 1YG2A 1IXRC 5H2FC 4ZYDA 1MMNA 2QF7A 3J81Z 4HF0A 2YX4A 3H5AA 1K6OA 2A07F 2DYSH 3OS2A 4G7ZF 2JA7J 1P6RA 1QBJA 3MEXA 3WG7H 2DLLA 2Z16A 3I4PA 3JRGA 1TTYA 3VB2A 4DZJA 3ZMSA 4BXFA 3OIOA 3TGNA 1HOMA 2BGCA 2HQRA 5FJ8J 2K3FA 3BOQA 3JCUC 4V19K 1WH5A 1FYKA 4P9UA 4FISA 2A6EF 3OYKA 2A69F 4A0ZA 3LFUA 3FXOA 5J1RA 1ZG1A 4Y33A 5LD2C 4Y4RA 2ZBKA 5DV5A 2Q1ZB 2HOSA 1TL8A 2UWMA 1D5YA 2XKOA 2IXSA 2CUFA 3CUQC 3MVPA 4ITVA 2H8RA 1YX3A 1YO5C 1T39A 4NQWB 4Z2YA 3WHBA 4S05A 3EUAA 1HW5A 2YR2A 1REPC 1GUUA 2WADA 1HBXG 5DEQA 5C4XJ 2GA1A 3OYDA 4DIQA 2HFHA 2X4HA 5TISC 2VPRA 2EFWA 3B6CA 3K1PA 3TDUC 1TZLA 1J5YA 2LKPA 4OAYA 2F5VA 4CYDA 3KETA 1EH6A 3P9KA 4R1HA 1TT5B 1F43A 3MKYB 5IT3A 3VOEA 4DBRA 5L3DA 4IHVA 4C2TA 3L00A 1CQTA 4D0PA 2R7ZJ 4XLHA 5JVTA 1U5TA 4ZDOA 3G2BA 2ZMEB 3TKYA 1W5TA 3BPVA 2E19A 1WRJA 2X9DA 4CHUA 3C2HA 2HOTA 5D5UB 1Z67A 2OF7A 1YIOA 2LFBA 1VZ0A 1OPCA 3T0YA 3L2RA 3CDLA 4XNFA 4QTRA 1J59A 1JUPA 2EZLA 4G9YA 4CCMA 5ED4A 1I1GA 1ZLJA 3FWEA 3FDYA 1S3JA 2MFZA 1FBSA 2X85A 5TGTA 1KYWA 4KJZA 2E35A 2ZFWA 3T8TA 1F4KA 1XGMA 4CCJA 3K2ZA 2F4IA 5C3EJ 4U0YA 2OTJI 1P92A 3FXLA 2LTPA 4AYBN 3H0GJ 5E20A 2VLAA 4XRFA 3ZQ7A 1QA6A 2HU9A 5H6RA 1TW3A 1O3TA 2V26A 1JXSA 1A31A 1P2FA 2ZJ2A 4FQGA 2VQGA 2V79A 3BP8A 2IT0A 3ZMZA 3M9AA 1SVMA 1IV8A 4PJLA 3BPXA 1SD6A 2FX0A 5J47A 2JA5J 4UUVA 2Z5UA 1AKHB 1FYMA 1XCVA 5LHHA 3D5RC 1W4MA 4BDYA 4KNYA 1O7LA 3C2BA 2DMQA 3V4GA 3GFLA 4EQQA 5CPRB 4L0ZB 3A1YA 3JAMK 2ID6A 4ESFA 5GPAA 4OIRF 3SEQA 5D4RA 4ZYAA 3RKYA 1E2XA 2BHYA 5K7ZA 3CF5F 2VOOA 3ZQGA 1E0EA 3PJRA 1HKQA 4G6DA 4LGWA 5DM7F 4AU7A 2AHQA 2R93J 5IYBJ 2GIZA 3ULQB 3J81K 2OPTA 1T98A 3ZGKA 3S2HJ 3KP2A 3MQ0A 1MNDA 1LPQA 3BZCA 4R79A 4B3XA 2OCCH 2XAQA 5GAGJ 5FD5A 1P4XA 1T2KA 3DEUA 5FFXA 1STZA 4ZDLA 4IX7A 2HVSA 1FMVA 1POGA 2MW8A 3BR0A 1O7FA 1P7IA 3F8CA 1IO2A 3E5UA 2LBFA 5HDGA 1WVRA 3NAUA 2BVLA 4CZZA 3M7GA 2HKXA 3P9CA 4YIRX 1N77A 2XHKA 2R7DA 1H88C 3HGGA 5HNHA 4XOPA 4HSTA 1KZHA 3QOEA 3WHCA 5LGTA 2DOAA 2FOWA 1H9TA 4M3EA 3QWLA 1UELB 3EPZA 3CO7C 2FRHA 4HG2A 2IA2A 3P5JA 3MCZA 3CCEI 2WWYA 2EZIA 1WCMJ 1TWHJ 3SZGA 1U3EM 4G12A 2KDZA 3VSLA 1V4RA 3CZ6A 3M8EA 4Q4ZF 2E7WA 2FJ1A 1BJZA 1MGTA 2F5DA 4A5NA 1TP4A 2EPFA 2D2WA 5DTDA 3ZMDA 2E2JJ 1PVEA 5HS7A 3BQZA 5AIPA 3L1PA 2EBIA 3CJNA 1U8RA 1T8IA 1X1DA 5E17F 2M5WA 4M71A 5DD4A 2IS2A 4I01A 2XAUA 3RTRA 4KISA 2WAEA 2IP2A 4MQ9F 4E7JA 3JRDA 4Y3OA 2ETHA 2VC0A 3O8GA 2E71A 3OMYA 1Y39A 1BOAA 2LVSA 1FIPA 3MN2A 4RLFA 2BYVE 4IPAA 4KN7X 1FP1D 2Q2EA 4P96A 3O8HA 2DOFA 2LOOA 2HI3A 3QODA 3DLAA 3N4MA 3GTGJ 5M3MJ 1OR7C 3RPQA 1WWXA 2K5CA 1RZ4A 3HRTA 4AM3A 4IHWA 1IUFA 1ZELA 3QYBA 4XL9A 4FE4A 3CF2A 2E1CA 4BBRJ 1IN6A 4LITA 1X1CA 5DDGA 2F5EA 3F6VA 4ENKA 2AQFA 4ASNA 1BW5A 3BG9A 2HGCA 1V5GA 2OV7A 3LSMA 4FASD 2GBYA 2M30A 4XKBA 5IYDJ 1V54H 4S04A 5EG0A 4UUSA 3GLLA 3HL2A 1EJ9A 1ZHFA 5FLMJ 3BROA 1YQAA 2DJNA 2VT3A 2EFQA 3TW7A 2GWRA 4MHGA 3F9KA 2O9LA 2OBPA 1WJDA 3HBLA 1VQ5I 5ICGA 1S8NA 1I27A 5IY5H 1HDPA 2XF5A 1LFUP 4UB8C 1G3TA 2RC4A 3GZ5A 4RS8A 3K1NA 4ENNA 2KRHA 3M1CA 3KZZA 1HXDA 3QPLA 2RQPA 1DUXC 2LYCA 5J4VA 1AHDP 2R3SA 2JT1A 1J7KA 4B3AA 1TT0A 2EA2A 1XGOA 3VYRB 5J8CA 2LH9A 3G3ZA 3S8PA 3ECHA 3FX3A 1LB2A 3C1DA 2HDWA 5D5WB 1MD0A 3GLXA 2DA1A 3K4LA 2CFXA 4OINF 1P9QC 3NQOA 3JTGA 1OCRH 4XIDA 4KUMA 1YIJI 3I55I 4M9XA 1QVUA 2Y0MA 3K7AJ 3WU2C 4EMSA 3B6AA 5F0FA 2YSRA 4LIUA 4CA0A 4DBQA 2HPIA 3DTEA 5EGOA 1FOXA 5FRMA 2M4GA 1BBYA 1VQPI 2P4WA 1LVKA 1QPMA 3LQQA 1SMTA 3EYYA 2X6YA 4KICA 4KIBA 1YS7A 3K4JA 1G6NA 1U5TB 4UVCA 1IAWA 2E1MB 3BQYA 2YPRA 3ZQLA 4LD5A 3CQZJ 5K7HA 2CO5A 2EFNA 3EYIA 4MGRA 3ZMVA 4E7LA 4BE0A 1EV7A 2DCEA 1WKMA 3JRHA 1ZRCA 3QP5A 4U0VA 5ILSA 2H09A 2W25A 3OYLA 1YJWI 2TCTA 3ASNH 1GVJA 2FEZA 4XONA 4O3MA 2OQGA 2OC6A 5E3LA 5EZHA 4UVAA 3I9V2 1X19A 2MG4A 4DJAA 1WGXA 3ABUA 4QPQA 4PUSA 4BQNA 4KDPA 2XF6A 3FXKA 2XROA 4E7KA 5BPDA 2EQRA 2PFBA 2NNNA 2ZB9A 4A5MA 1VNDA 2E5NA 1O4XA 4A3BJ 4I98B 4ZYGA 2OCEA 1JUSA 3V7SA 1A6QA 2L7MP 2ZJPF 3QRFF 3RQIA 2X1DA 3OYJA 2QYOA 2K9NA 1RI7A 2QCOA 3RKXA 1IRXA 3DBLB 1FT9A 2DU9A 4ETSA 4RB3C 3GFIA 4MEXF 3H9JA 4B09A 1VQ9I 2JQ7A 2DPDA 2H1KA 4WK8F 3HRSA 2K40A 3VFZA 3J7ZI 2DYRH 1IXCA 3KE2A 2HOAA 2Y48A 3R60A 4HNVA 4C2MJ 3LAJA 2VQCA 1WJ5A 1FY7A 1U9NA 3JR9A 4M6VA 2CQQA 2LKXA 2DO7A 3VODA 1YRNA 4BUPA 4L9TA 1BOBA 1LEBA 1FYLA 2KKOA 1FSHA 2KZVA 2QGUA 3H1CA 2GXAA 5GAEJ 3C18A 1SFEA 1RNLA 5CVUA 2PG4A 1HF0A 2FNPA 1QGPA 1Y0NA 4L5EA 2BE5F 3E5QA 2CS3A 3ZN0A 1I39A 2IW5A 4B1RA 3NARA 2A05A 2DTRA 4I7HA 3H9GA 3F8MA 3PNVA 1E3OC 3A01A 4CXFA 2KP6A 2L9SA 2QLZA 2LBFB 1AA7A 3JRCA 4LB5A 1USSA 1F5TA 3ZQIA 1ZK8A 1B9MA 1XS9A 1R71A 1BI0A 2NS8A 3CC2I 2RN7A 2L5QA 3A02A 4LJZF 5HLGA 3OIQA 1K7AA 5CQGA 2VT2A 1W0TA 4XOTA 5BPIA 2R7QA 3I59A 2X6OA 3AG1H 1VQMI 2YUSA 3M4OJ 4NUBA 4CCOA 3HEFA 1VQKI 2XUBA 1S5LC 1U6GA 3ABTA 3KP3A 2WB1A 1MMGA 3RZDJ 1K79A 1ORKA 3H3ZA 4AIDA 2QM3A 3VYUB 3CDIA 2QWWA 4XKCA 1RETA 2COBA 2M45A 2XB0X 2FD5A 3BR3A 4QIWN 3COAC 2X51A 3UR3C 2Y69H 4RLQA 1OLTA 3K4BA 3NEUA 2YX7A 2NVUB 5EJCA 1ZR4A 1K61A 3HTSB 3LSTA 2FMYA 2L9VA 3WTWC 1XDUA 5B1AH 1IRGA 4BJ6C 4HLYA 1IN8A 1JJ6C 3HRMA 2HPMA 1IW7F 2Q2EB 2FF4A 4X1EA 2VL8A 2XSJC 1KQ9A 4XLPF 5CVVA 3FF5A 3BCBA 3T8RA 4U7BA 1ETVA 2IVMA 1OISA 4A6EA 1PDNC 4I2OA 3S1MJ 3PO2J 1UHSA 1H9GA 1QZYA 3ZQQA 3WTYC 4BHCA 1BR4A 3Q0WA 2PMHA 1VQ7I 3HHGA 4CICA 4BAYA 1S29A 2P81A 3V8JA 3GO5A 4XKWA 5F27A 4RGRA 4KN4X 4E4HA 2JPBA 2GOMA 4Y52J 5CLSA 2YU9J 3OYBA 4EATA 2GM4A 1UHWA 2E1OA 4ZTFA 2K7LA 2DK8A 2KFDA 5EG0B 1ZGAA 4UUSB 3HIFA 5JI6A 1D8JA 2HTSA 3TL4X 4L9JA 2JTVA 1IDYA 4D7MA 2IRFG 3RDIA 3BJ6A 1QZEA 1IC8A 4ESJA 1Z1DA 3FM3A 3CCQI 4BS9A 4RGXA 3U1KA 1SAUA 2LMDA 4B4CA 3KLOA 3RCOA 2XVCA 4M3GA 4XM3A 3K70C 1D3YA 1U78A 1HW2A 3CCVI 3ERED 1LE8A 2IA0A 5E1WA 2O3FA 4V2GA 4GFBA 1BA5A 4F52A 3WTUC 2DQRA 5B1BH 1NK2P 2ELKA 4MFEA 4OIQF 1ULYA 3QOPA 3SDGA 4MO7A 4RBOA 4UB6C 2XF7A 1KGSA 1ZG5A 1D1BA 5GTIC 3FMRA 5L3EA 2DJIA 4FCYA 4OAZA 4M9SA 5M3FJ 1B9NA 1XB4A 1Z05A 2P0WA 1HW1A 3IRRA 3NRVA 1P7JA 4E70A 2QA4I 4CCKA 4XRMA 1BW6A 5EEAA 1Z9CA 2FOKA 4B8XA 4WXHA 1GHCA 5D8KB 1NG7A 1MNEA 2CRGA 4JP0A 3TO9A 3AG3H 5HLTA 1LFBA 5EGOB 5FLXZ 4Y17A 4BXXJ 3AFHA 3KLNA 4B47A 2OZUA 2CV0A 2RNJA 3GTPJ 2AXTC 3HKZA 4IXAA 2E2IJ 5D6FA 3R61A 3I53A 4YIIA 5E3OA 3HOSA 2BVMA 3ZP5A 3S32A 1H89C 2JRTA 2M1BA 3F6OA 2BXZA 4BDZA 1OYWA 4KA4A 1DU0A 5CKTA 2E34A 1MBJA 4HV6A 2JA2A 1Z91A 3L7WA 4XRSG 2GXGA 2MC3A 4KIGA 1Y0UA 4X6AJ 3IWZA 1ETQA 2G9WA 1JKQC 2AQEA 4BACA 4ZTJA 4AYBA 1FZPB 3L2CA 1SEUA 2CUZA 3IHUA 5H20A 1G3SA 2IJLA 3O2PE 3ERMA 2JPCA 2UV1A 3G73A 4QPOA 3PUFA 3IRQA 5CQEA 3CCRI 3OYAA 2GA2A 3K69A 1ZREA 2KIMA 2Z99A 2L4AA 2CU7A 1GV2A 1F1ZA 3H3VK 2HS5A 1RKTA 2H6BA 2K9LA 4J19A 5A2QZ 2ZO4A 4AVPA 1FWZA 3BG5A 3F72A 3PFIA 4PFOA 4AIJA 1UAAA 3J7YJ 2Z3YA 1NG6A 3CMAI 2DAOA 2L7ZA 2GXBA 5IOZA 2ISYA 3CTAA 3CCUI 1IDZA 1P4WA 4N0BA 2MGQA 1Y6IA 4HLXA 4A69C 5KK1A 2DPUA 4Q47A 4WXDA 2V6CA 3WODF 4IZZA 1YI2I 4F93B 3WTSC 3CLOA 1ZKGA 3H5NA 1U8BA 5B3SH 1F9NA 2W84A 3L09A 3KCCA 4NC7A 2NRAC 2W7NA 2UXXA 3OSFA 1PUFA 2WBMA 4RB0A 2OQRA 2KHMA 2HVQA 1RC9A 3BTLA 2XASA 1Z3XA 2HYGD 2O8XA 4YFKF 1UJ8A 4GO1A 3D5LA 4HF2A 4WCGA 3TMOA 5F64A 3IH4A 1MDMA 1YRNB 3KFWX 1R23A 5IP7J 3GXOA 4HZFA 2E2HJ 5J8FA 2YU3A 4JX6A 3QU6A 4CYCA 2RAEA 4A3IJ 2A5YB 3DKXA 2ACJA 2NVXJ 1T0FC 1T95A 3KX2A 5E79C 2MSYA 3ISPA 3OR1C 5J6XA 2QSHX 3ABKH 3ELKA 2ZXHA 5HLIA 2WAQN 3QAHA 4R8HA 3A01B 1G3YA 5FKNA 4MEYF 3UKGA 2R92J 1S7EA 3CJQB 3AL0B 3GTQJ 4ON0A 4V2FA 4IHTA 4G6TB 2ZNYA 2FSWA 4LK0F 2K86A 1DDNA 3W6VA 4BE2A 3LNQA 4XN0A 3REOA 2DFHA 2XAJA 4EVIA 4Y13A 1WFXA 1MJBA 1TBXA 1MJ9A 2ESNA 3JSPA 2L54A 2PEXA 4XN3A 3MZYA 1KQ8A 5AONA 4OIPF 4LLLA 1D5VA 1AOYA 3GBGA 4WWCA 1QQIA 2K4JA 4BYYA 1U5TC 2CSOA 5M5YJ 3I59B 2DT7B 1VQOI 4F91B 1U0JA 1OYYA 2KPMA 2DT5A 3QYEA 3K6GA 2LNBA 1YOVB 3IP4B 2M8GX 3K1MA 3MKZA 2F6CA 3PUBA 1D8KA 2MA3A 1LDKB 1MW7A 2LD5A 3C2GA 5FLXK 2PBIA 2WV1A 1LKXA 1KU7A 4EV0A 2W00A 2QUFA 2A6HF 2P6TA 3ROUA 4A3KJ 2VXZA 3RQ4A 1GT0C 3D5SC 3G4SI 1RUNA 2JSCA 2BY1A 2KIUA 3K0LA 4DNCA 2ZJQF 1QU3A 1LEAA 5J4YA 4I6ZA 3BWGA 2DA5A 1SVOA 2VC1A 3IKTA 4RDUA 3CUOA 4UNOA 3WGHA 3BJAA 1JTXA 2MH2A 2E36A 3K4KA 2L3DA 2CW7A 1ZQ3P 2ME6A 5FKMA 1V5EA 3TOAA 3HDDA 3BG7A 2VODA 3MAJA 4P1WA 3DCFA 4O6JA 5FD6A 1HCRA 2R7XA 4K2EA 2EINH 2EIMH 5FLVA 2QKMB 4N9HA 1H8AC 3CCSI 4KT5C 2HNHA 4GDFA 4JX5A 5A2QK 3QQAA 3G6EI 1OR7A 3J80Z 1VFCA 4A93J 5EYRA 4UY8I 4XICA 1QVTA 1TNSA 2VBYA 5E3MA 4G6QA 2I8DA 1XSVA 3BTIA 3HG9A 3WE3A 1H0MA 2QQAA 3IV5A 4UVBA 4WX9A 2OA4A 2D1VA 3FMQA 2M3AA 1R9TJ 4XQFA 4IOAF 2EV0A 3BG6A 2MABA 2P8TA 4HV5A 2RDPA 4JBAA 3HOXJ 2B9SA 4QSHA 4CCLA 3OL4A 2W82A 4RAGA 4EJTA 1DU6A 1ZAOA 2LKSA 1E17A 1X2NA 2D45A 2EZKA 2RKHA 3C3WA 3NWSA 3S16J 2CUEA 3JSOA 4FHTA 5KCMA 4M74A 5JHUA 5JVGF 3V8LA 2W48A 5B66C 1I6HJ 2Z1DA 3HOWJ 4CGZA 2R0QC 4M72A 2CJJA 4UV9A 3OYFA 3MZ8A 2HXIA 1G2HA 4D9JA 1MBGA 2BV6A 1XTAA 4DW6A 2WV0A 2JVHA 2V6EA 2ZXWH 4RGSA 4XR6A 3DLLF 3A0HC 3E0JB 4U7DA 4M3FA 3AKZA 4RAZA 4A0YA 3R4KA 4I0BA 2L2OA 3WU0A 2TDXA 2O0YA 4A12A 4LG3A 3CDHA 3CD6I 1JGGA 4A3CJ 1YLFA 1Z3YA 1LFPA 2VJJA 2QBYA 1K83J 1ETKA 5IOYA 4JK1X 4FE7A 4PSWA 3MWMA 4LB6B 1TQIA 1QZZA 4HAMA 1QHGA 2K9MA 1TQMA 4NDLA 2HYJA 4JOMA 3OYGA 2ZXJA 4HNTA 3FXQA 4RM3A 1PYVA 4BQOA 5GAHJ 1W5CC 4RA2A 5ILVA 3G71I 2LDUA 1MSEC 3OYIA 2DMUA 3M3YJ 1J0RA 1NH3A 2E1NA 2IS1A 3HOTA 5J40A 3DEWA 3UNGC 2EA4A 2E5ZA 3ZQHA 5LRRA 1VQ6I 2I10A 3ZXSA 3GX4X 1IG7A 1PUEE 3S3OA 2TRTA 3G1LA 2KQRA 3K4CA 3JRFA 2QZ8A 5F0HA 3AG2H 3I4NJ 2P5LC 5LEJA 2M7AA 1G59A 4G8XA 3H0DA 1XSDA 2L7KA 1HQCA 4D5FA 1BI3A 2K9SA 3V7RA 2DDBA 4CDGA 2GLOA 4XKVA 4D7NA 1OMIA 4C3HJ 1MH4A 3HSRA 1BI1A 4IQJA 4BL0B 3MKLA 1G3WA 2Z9OA 1O57A 1R4NB 3DEEA 4CH7A 3F21A 3TBIA 3FBIB 3LSRA 1RR7A 3ZRGA 1OCZH 3HUGA 1X1AA 3CC7I 1JKPC 3HJEA 2ID3A 1W1WE 2AO9A 3IAS2 4GYIA 4KT6A 5L3CA 2Y31A 4YFNF 2DQLA 5ICCA 1G4DA 1R7JA 4XLFA 4HPQA 4PSXA 3OR2C 3F22A 1UMQA 3QYFA 1JKRC 1UB9A 4HDUA 3HSEA 1IN7A 3SQNA 4I76A 1MDMB 2KZGA 2D5VA 5LBQA 4IHYA 2M0MA 3ZMTA 2CQXA 4A3JJ 1TWAJ 3J80K 1K4SA 3SZTA 2PMZN 4MFDA 3HOYJ 3DV8A 4BEHA 1IN5A 4CYCB 3LA2A 4BY1J 2ZXIA 5EZGA 3BZKA 2ZCWA 3SFZA 2FU4A 4I02A 4D1QA 2HDCA 1FOKA 4NBQA 1FOWA 4BQAA 3QPHA 1FBQA 2DA4A 3JRBA 1AWCA 2HWVA 2JUCA 5K5OA 2R7UA 1DP7P 3PQKA 4DZPA 3SYTA 3O3KA 3E6BA 2ESHA 4HA8A 3S15J 4HX8A 3N97A 4EM1A 2BY0A 5BMZA 2LF8A 1YITI 4OU0A 5JHFA 4LLGF 3TP3A 1GXQA 3BR2A 3KEQA 1ZRFA 2LREA 2JZYA 2RREA 1T33A 3WGGA 1BI2A 1FBUA 1T6SA 4BQQA 2M87A 3C7JA 3MFKA 3HXLA 4A3DJ 4A3EJ 2IA1A 2ZC2A 5DYMA 4NNJA 5EDNA 1UFMA 3DTKA 4BJTA 1KA8A 1X1BA 2UXNA 2DODA 4YFXF 2ZSIB 2HOEA 5ICFA 4XSXF 3CJRB 3RKWA 4E7IA 1HC8A 4AWXB 1HDDC 3EUKL 3ESWB 3E6CC 3WTXC 3GTOJ 4L0YB 2CUJA 1WJEA 3OV8A 4A3MJ 2X6WA 3BR1A 2L0KA 5GP9A 2XGCA 2MBFA 4ABZA 4P9FA 4BHPA 1HKSA 1UG2A 3GCMA 2EFPA 4EJOA 1LUJB 2UUZA 4BJ5C 3BJOA 4ZC3A 2LY1A 4CO8A 3B02A 4EGYA 4ENJA 1DGRM 1UZCA 3OYHA 5M5WJ 4QLCU 3OWTA 2ICWG 3VSKA 2FQ3A 2HZDA 2KIFA 2JJ7A 4HDVA 1E3PA 3S1NJ 3I64A 3SXYA 2Y75A 2WTEA 2Q8KA 3X2QH 1IRZA 2JSPA 1SANA 4G7OF 2MYSA 3WTZA 3EUHA 2WY8Q 3P7NA 4Y7NJ 2GAUA 4HNUA 2BBYA 3A2KA 3EQLF 5HDNA 1VQ8I 1TWFJ 3FKIJ 4LIVA 4HRIA 2IGKA 1JKOC 1J2XA 5LLQA 2Q0OA 2C6YA 4JX4A 3BR5A 3U2RA 4G7HF 2JK3A 2ZMEC 2XAFA 3L9FA 3LA3A 5LEKA 2B63J 2DTZA 1Z21A 2IGMA 4B48A 4IRGA 3V42A 1KU9A 2QVOA 1QO0D 3KEOA 4JQFA 2KISA 1J09A 2STTA 2VB6A 4A3LJ 4A3GJ 1IN4A 2FE3A 2O7OA 2R4GA 1T56A 2BEOA 2K02A 4M6YA 4MTEA 4LK1F 3FXMA 3S2WA 1R22A 3GZ6A 2MD5A 4BKXA 3IL2A 3DWLE 3H3UA 5CYVA 1BR2A 1UG0A 3RIRA 3ZMUA 1I5ZA 2NVYJ 1VI0A 3K70D 3W2WA 2Z33A 5IPAA 3SFIA 2R7OA 2P7CB 2H94A 3VWBA 3IUOA 2R7VA 1QRYA 3RI4A 3DF8A 2FA5A 3JW4A 1Z7LA 2VUMJ 4C9YA 2E60A 3AL0C 3LFKA 1L3LA 4PK4A 4X0GA 1BR1A 3BR6A 1EA3A 1YW9A 2FBKA 2LK2A 2E7XA 2XAGA 1BN5A 2HZTA 3RZOJ 2F4OB 2R7RA 4B44A 1CGPA 2KLOA 5F0CA 3HRUA 4IHSA 1FNNA 3GVAA 1FX7A 1ON2A 3DKYA 5H6QA 3QPSA 4RGUA 3WTTC 1R00A 4E7ZA 3FM5A 5TJJA 1R58A 4N9IA 2PN6A 2EV5A 4C30A 4HYEA 2F5FA 1HKTA 2LG4A 3A4CA 2QBYB 4I09A 3LSIA 1MNMC 5E8GA 3Q0VA 3D1NI 4L9VA 1XGSA 3BTCA 1ONVA 2V7FA 1D0ZA 1ZGJA 3FK6A 1LJ9A 2XIGA 1S6LA 1D0XA 1LVAA 2EV6A 5HLHA 4IL6C 4OIOF 1ETXA 4I99C 2XGXA 2LP0A 2VOPA 1KU2A 4HBLA 1YE9A 2XPVA 3HYIA 3KP4A 1O3SA 1K4TA 2XAHA 2DMTA
chains in the Genus database with same CATH topology
3UKGA 2R92J 1S7EA 3GTQJ 4FE4A 1GV5A 4V2FA 5E3NA 1RPWA 5J3LA 4BBRJ 1RESA 3W6VA 2DMNA 3FIWA 4AUXA 3LNQA 3S1QJ 2EH3A 1BW5A 3BG9A 2GBYA 1I50J 5IYDJ 5EG0A 4UUSA 3FK7A 5FLMJ 3GBGA 2NVTJ 3I4MJ 2DJNA 2LY9A 3TW7A 2Y0SN 4C3IJ 4XRSA 2DMPA 3ZQCA 2O9LA 5M5YJ 3HBLA 2R5ZA 1Z0XA 1HDPA 1SFOJ 2IAIA 1LFUP 1Y1WJ 2M8GX 3PM1A 3QPLA 2JN6A 3JREA 2LD5A 1QPIA 5FKKA 1AHDP 2WV1A 1FTZA 1FIAA 3CCYA 4B3AA 1IGNA 4FTHA 2NVQJ 1JT6A 4A3KJ 1ITYA 1GT0C 1X2MA 2X48A 2DA1A 1TWGJ 2L9RA 1AKHA 1TC3C 4XIDA 2Y9YA 1B72A 4I6ZA 1QVUA 2DA5A 3K7AJ 3B6AA 5F0FA 2Y2ZA 5EGOA 4RDUA 1MH3A 1ENHA 2O8KA 1Q1VA 1JTXA 3TP0A 1Z77A 2ECBA 3JRIA 1ZQ3P 3JRAA 2ME6A 5FKMA 1JTYA 4D5CA 1BL0A 3HDDA 1WI3A 2XGDA 3DCFA 1HCRA 5DS9A 2IEKA 3BQYA 2NS7A 3ZQLA 5FLVA 1U9OA 3CQZJ 5K7HA 3LSPA 3K2AA 1H8AC 1OCTC 4JX5A 3QQAA 3BT9A 3SJMA 4MIMA 1IV6A 1A5JA 1VFCA 4A93J 5EYRA 5F08A 3S1RJ 1W0UA 3JRHA 4BBSJ 4XICA 1QVTA 5E3MA 1B8IA 1X58A 4S0HB 3BTIA 2TCTA 3TEDA 2VKEA 3IV5A 5E3LA 1R9TJ 3HB9A 5EZHA 2MG4A 1WGXA 1JT0A 2M0CA 3HOXJ 3BTJA 4QSHA 1XG1A 1DU6A 2EQRA 5JLWA 5GPCA 2ZB9A 1X2NA 3BG3A 1MBKA 2EZKA 1VNDA 3S16J 4EEFG 2CUEA 3HOVJ 2R5YB 1O4XA 4A3BJ 4M3DA 1I6HJ 2W48A 1JUSA 3HOWJ 2G0EA 2R0QC 3HKZN 3G1MA 2L7MP 2CJJA 3RQIA 1ZTRA 2HXIA 1G2HA 1MBGA 1MBEA 4DW6A 4DYRA 5K7FA 2K9NA 2QCOA 2DA6A 2HDDA 4M3FA 3ZOBA 2H1KA 2K40A 2N8GA 1GDTA 2DN0A 5C44J 2HOAA 3E7LA 1JGGA 4HNVA 4C2MJ 4A3CJ 2K9QA 4JYKA 2WB1N 1U9NA 3JR9A 4M6VA 2CQQA 1WPKA 2LKXA 1JJ8C 1YRNA 1APLC 3LOCA 3GTJJ 1HLVA 4XK4A 2XPUA 5IP6A 1K83J 1F36A 1ETKA 5IOYA 4FE7A 2JWTA 2VI6A 1ZR2A 1JUMA 1AU7A 1HF0A 3HOUJ 4W97A 5F04A 4L5EA 3G1OA 4NDLA 2HYJA 4B1RA 1RKWA 3NARA 5IYCJ 2DA7A 4IHXA 2XPWA 1VF9A 2DA2A 1E3OC 3A01A 3PO3J 4AC0A 1MSEC 2DMUA 4LOCA 3S17J 3M3YJ 3JRCA 5J1UA 3OSGA 2L7FP 4MLOA 3DEWA 3ZQIA 3ZQHA 1ZK8A 1XS9A 2I10A 1IG7A 2QF7A 2TRTA 3Q0UA 3G1LA 2KT0A 2NS8A 3JRFA 5F0HA 3I4NJ 3LSJA 1GVDA 3A02A 2JA7J 2EZHA 3A03A 3VPRA 3JRGA 4D5FA 2K9SA 4DZJA 3OIOA 1HOMA 1W0TA 2XRLA 5EF6A 2GLOA 5J1YA 1Y1VJ 1OJLA 3TW6A 4D7NA 5FJ8J 4C3HJ 1MH4A 1WH5A 2X6OA 4IEJA 2ECCA 3MKLA 4FISA 2NOGA 2YUSA 3M4OJ 3HEFA 5J1RA 3LSRA 1RR7A 2HOSA 1FEXA 3RZDJ 1JKPC 1D5YA 2ID3A 2AO9A 1ORKA 2CUFA 3MVPA 2Y31A 2H8RA 2JA8J 1OFCX 1RETA 2COBA 5FKOA 3WHBA 2XB0X 2FD5A 3BR3A 4QIWN 5FKLA 1UMQA 1GUUA 1JKRC 2ME0A 3GTMJ 2XGEA 5C4XJ 4I76A 2D5VA 4IHYA 1ZR4A 1K61A 2YS9A 4A3FJ 2VPRA 2CQXA 3S14J 1FTTA 4A3JJ 1TWAJ 3GTKJ 3B6CA 1JJ6C 2PMZN 4MFDA 1ZGWA 3HOYJ 4CYCB 4BY1J 5EZGA 4X1EA 4DYQA 1F43A 1ETVA 4IHVA 2DA4A 2M34A 3JRBA 1CQTA 3HOZJ 2R7ZJ 1LE8B 3S1MJ 1UHSA 3PO2J 1MBHA 4DZPA 2E19A 3Q0WA 2X9DA 3S15J 2HOTA 2OF7A 2P81A 2LFBA 5F27A 3CDLA 4QTRA 2FQ4A 3TP3A 3BR2A 1JUPA 2EZLA 4Y52J 2YU9J 1T33A 2GM4A 2E1OA 5EG0B 4UUSB 3CMYA 2LLKA 4A3DJ 2M2EA 4A3EJ 5EDNA 1IDYA 4D7MA 4M3BA 5C3EJ 1IC8A 2R5ZB 4DYCA 2LTPA 4AYBN 3H0GJ 4B4CA 1A6IA 4M3GA 1HDDC 1U78A 3GTOJ 1LE8A 4A3MJ 3BR1A 2L0KA 4V2GA 5GP9A 2XGCA 4ABZA 1WH7A 4GFBA 1BA5A 2R5YA 1UG2A 3Q3SA 2ELKA 1NK2P 4MFEA 3SDGA 1MBFA 4MO7A 4RBOA 2DA3A 4FCYA 2FX0A 3IH3A 2JA5J 5M5WJ 5M3FJ 1AKHB 5HODA 3LSGA 1P7JA 5M5XJ 2JJ7A 3C2BA 4XRMA 2DMQA 1BW6A 5EEAA 1B72B 3S1NJ 1XC5A 1NTCA 1IRZA 1SANA 4UUTA 3RKQA 2HXOA 2CRGA 4JP0A 3IH2A 2ID6A 1LFBA 5GPAA 5EGOB 4BXXJ 5K7ZA 1NK3P 4Y7NJ 3ZQGA 3GTPJ 2E2IJ 1TWFJ 3FKIJ 2AHQA 5BNGA 2R93J 4W1UA 1JKOC 5IYBJ 5E3OA 2OPTA 1H89C 3S2HJ 4JX4A 3BR5A 5JLXA 1DU0A 2JK3A 1MBJA 4XRSG 2XSDC 4X6AJ 2LR8A 2B63J 1ETQA 1I3QJ 1JKQC 1POGA 2DTZA 2MW8A 3BR0A 1P7IA 1B8IB 3OOUA 3NAUA 3HM5A 2M9HA 2Y30A 4A3LJ 4A3GJ 1ETWA 2HQ5A 1PUFB 1H88C 2O7OA 3HGGA 1T56A 2JA6J 3WHCA 1TWCJ 4BKXA 4M3EA 2CU7A 1GV2A 3H3VK 5F1JA 2NVYJ 1VI0A 1RKTA 3HGYA 5IPAA 3SFIA 4J19A 3BG5A 2EZIA 1QRYA 1WCMJ 1TWHJ 2VKVA 2L7ZA 4G12A 2VUMJ 2KDZA 3S2DJ 1ETYA 5IOZA 1IDZA 2FJ1A 1EF4A 3BR6A 3ZQFA 1BJZA 2LK2A 2MGQA 1IJWC 1OCPA 3RZOJ 4A69C 5DTDA 2XB5A 5F0CA 1ETOA 2E2JJ 4BY7J 3BQZA 1ZKGA 1U8BA 3L1PA 2EBIA 4C3JJ 3QPSA 3OSFA 1PUFA 9ANTA 2JMWA 3BTLA 2Y9ZA 3JRDA 5C4JJ 3FISA 3IH4A 1YRNB 3O8GA 5IP9J 2LVSA 5IP7J 1MNMC 3Q0VA 3D1NI 3GTLJ 2E2HJ 1FIPA 3MN2A 4JX6A 3BTCA 3F0CA 4CYCA 2RAEA 4A3IJ 3FK6A 2NVXJ 3O8HA 2IBDA 2MSYA 1ETXA 2HI3A 2LP0A 1FJLA 2WAQN 1MSFC 2XPVA 5M3MJ 3GTGJ 3A01B 5FKNA 2DMTA 4IHWA 1IUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKG A;  2R92 J;  1S7E A;  3GTQ J;  4FE4 A;  1GV5 A;  4V2F A;  5E3N A;  1RPW A;  5J3L A;  4BBR J;  1RES A;  3W6V A;  2DMN A;  3FIW A;  4AUX A;  3LNQ A;  3S1Q J;  2EH3 A;  1BW5 A;  3BG9 A;  2GBY A;  1I50 J;  5IYD J;  5EG0 A;  4UUS A;  3FK7 A;  5FLM J;  3GBG A;  2NVT J;  3I4M J;  2DJN A;  2LY9 A;  3TW7 A;  2Y0S N;  4C3I J;  4XRS A;  2DMP A;  3ZQC A;  2O9L A;  5M5Y J;  3HBL A;  2R5Z A;  1Z0X A;  1HDP A;  1SFO J;  2IAI A;  1LFU P;  1Y1W J;  2M8G X;  3PM1 A;  3QPL A;  2JN6 A;  3JRE A;  2LD5 A;  1QPI A;  5FKK A;  1AHD P;  2WV1 A;  1FTZ A;  1FIA A;  3CCY A;  4B3A A;  1IGN A;  4FTH A;  2NVQ J;  1JT6 A;  4A3K J;  1ITY A;  1GT0 C;  1X2M A;  2X48 A;  2DA1 A;  1TWG J;  2L9R A;  1AKH A;  1TC3 C;  4XID A;  2Y9Y A;  1B72 A;  4I6Z A;  1QVU A;  2DA5 A;  3K7A J;  3B6A A;  5F0F A;  2Y2Z A;  5EGO A;  4RDU A;  1MH3 A;  1ENH A;  2O8K A;  1Q1V A;  1JTX A;  3TP0 A;  1Z77 A;  2ECB A;  3JRI A;  1ZQ3 P;  3JRA A;  2ME6 A;  5FKM A;  1JTY A;  4D5C A;  1BL0 A;  3HDD A;  1WI3 A;  2XGD A;  3DCF A;  1HCR A;  5DS9 A;  2IEK A;  3BQY A;  2NS7 A;  3ZQL A;  5FLV A;  1U9O A;  3CQZ J;  5K7H A;  3LSP A;  3K2A A;  1H8A C;  1OCT C;  4JX5 A;  3QQA A;  3BT9 A;  3SJM A;  4MIM A;  1IV6 A;  1A5J A;  1VFC A;  4A93 J;  5EYR A;  5F08 A;  3S1R J;  1W0U A;  3JRH A;  4BBS J;  4XIC A;  1QVT A;  5E3M A;  1B8I A;  1X58 A;  4S0H B;  3BTI A;  2TCT A;  3TED A;  2VKE A;  3IV5 A;  5E3L A;  1R9T J;  3HB9 A;  5EZH A;  2MG4 A;  1WGX A;  1JT0 A;  2M0C A;  3HOX J;  3BTJ A;  4QSH A;  1XG1 A;  1DU6 A;  2EQR A;  5JLW A;  5GPC A;  2ZB9 A;  1X2N A;  3BG3 A;  1MBK A;  2EZK A;  1VND A;  3S16 J;  4EEF G;  2CUE A;  3HOV J;  2R5Y B;  1O4X A;  4A3B J;  4M3D A;  1I6H J;  2W48 A;  1JUS A;  3HOW J;  2G0E A;  2R0Q C;  3HKZ N;  3G1M A;  2L7M P;  2CJJ A;  3RQI A;  1ZTR A;  2HXI A;  1G2H A;  1MBG A;  1MBE A;  4DW6 A;  4DYR A;  5K7F A;  2K9N A;  2QCO A;  2DA6 A;  2HDD A;  4M3F A;  3ZOB A;  2H1K A;  2K40 A;  2N8G A;  1GDT A;  2DN0 A;  5C44 J;  2HOA A;  3E7L A;  1JGG A;  4HNV A;  4C2M J;  4A3C J;  2K9Q A;  4JYK A;  2WB1 N;  1U9N A;  3JR9 A;  4M6V A;  2CQQ A;  1WPK A;  2LKX A;  1JJ8 C;  1YRN A;  1APL C;  3LOC A;  3GTJ J;  1HLV A;  4XK4 A;  2XPU A;  5IP6 A;  1K83 J;  1F36 A;  1ETK A;  5IOY A;  4FE7 A;  2JWT A;  2VI6 A;  1ZR2 A;  1JUM A;  1AU7 A;  1HF0 A;  3HOU J;  4W97 A;  5F04 A;  4L5E A;  3G1O A;  4NDL A;  2HYJ A;  4B1R A;  1RKW A;  3NAR A;  5IYC J;  2DA7 A;  4IHX A;  2XPW A;  1VF9 A;  2DA2 A;  1E3O C;  3A01 A;  3PO3 J;  4AC0 A;  1MSE C;  2DMU A;  4LOC A;  3S17 J;  3M3Y J;  3JRC A;  5J1U A;  3OSG A;  2L7F P;  4MLO A;  3DEW A;  3ZQI A;  3ZQH A;  1ZK8 A;  1XS9 A;  2I10 A;  1IG7 A;  2QF7 A;  2TRT A;  3Q0U A;  3G1L A;  2KT0 A;  2NS8 A;  3JRF A;  5F0H A;  3I4N J;  3LSJ A;  1GVD A;  3A02 A;  2JA7 J;  2EZH A;  3A03 A;  3VPR A;  3JRG A;  4D5F A;  2K9S A;  4DZJ A;  3OIO A;  1HOM A;  1W0T A;  2XRL A;  5EF6 A;  2GLO A;  5J1Y A;  1Y1V J;  1OJL A;  3TW6 A;  4D7N A;  5FJ8 J;  4C3H J;  1MH4 A;  1WH5 A;  2X6O A;  4IEJ A;  2ECC A;  3MKL A;  4FIS A;  2NOG A;  2YUS A;  3M4O J;  3HEF A;  5J1R A;  3LSR A;  1RR7 A;  2HOS A;  1FEX A;  3RZD J;  1JKP C;  1D5Y A;  2ID3 A;  2AO9 A;  1ORK A;  2CUF A;  3MVP A;  2Y31 A;  2H8R A;  2JA8 J;  1OFC X;  1RET A;  2COB A;  5FKO A;  3WHB A;  2XB0 X;  2FD5 A;  3BR3 A;  4QIW N;  5FKL A;  1UMQ A;  1GUU A;  1JKR C;  2ME0 A;  3GTM J;  2XGE A;  5C4X J;  4I76 A;  2D5V A;  4IHY A;  1ZR4 A;  1K61 A;  2YS9 A;  4A3F J;  2VPR A;  2CQX A;  3S14 J;  1FTT A;  4A3J J;  1TWA J;  3GTK J;  3B6C A;  1JJ6 C;  2PMZ N;  4MFD A;  1ZGW A;  3HOY J;  4CYC B;  4BY1 J;  5EZG A;  4X1E A;  4DYQ A;  1F43 A;  1ETV A;  4IHV A;  2DA4 A;  2M34 A;  3JRB A;  1CQT A;  3HOZ J;  2R7Z J;  1LE8 B;  3S1M J;  1UHS A;  3PO2 J;  1MBH A;  4DZP A;  2E19 A;  3Q0W A;  2X9D A;  3S15 J;  2HOT A;  2OF7 A;  2P81 A;  2LFB A;  5F27 A;  3CDL A;  4QTR A;  2FQ4 A;  3TP3 A;  3BR2 A;  1JUP A;  2EZL A;  4Y52 J;  2YU9 J;  1T33 A;  2GM4 A;  2E1O A;  5EG0 B;  4UUS B;  3CMY A;  2LLK A;  4A3D J;  2M2E A;  4A3E J;  5EDN A;  1IDY A;  4D7M A;  4M3B A;  5C3E J;  1IC8 A;  2R5Z B;  4DYC A;  2LTP A;  4AYB N;  3H0G J;  4B4C A;  1A6I A;  4M3G A;  1HDD C;  1U78 A;  3GTO J;  1LE8 A;  4A3M J;  3BR1 A;  2L0K A;  4V2G A;  5GP9 A;  2XGC A;  4ABZ A;  1WH7 A;  4GFB A;  1BA5 A;  2R5Y A;  1UG2 A;  3Q3S A;  2ELK A;  1NK2 P;  4MFE A;  3SDG A;  1MBF A;  4MO7 A;  4RBO A;  2DA3 A;  4FCY A;  2FX0 A;  3IH3 A;  2JA5 J;  5M5W J;  5M3F J;  1AKH B;  5HOD A;  3LSG A;  1P7J A;  5M5X J;  2JJ7 A;  3C2B A;  4XRM A;  2DMQ A;  1BW6 A;  5EEA A;  1B72 B;  3S1N J;  1XC5 A;  1NTC A;  1IRZ A;  1SAN A;  4UUT A;  3RKQ A;  2HXO A;  2CRG A;  4JP0 A;  3IH2 A;  2ID6 A;  1LFB A;  5GPA A;  5EGO B;  4BXX J;  5K7Z A;  1NK3 P;  4Y7N J;  3ZQG A;  3GTP J;  2E2I J;  1TWF J;  3FKI J;  2AHQ A;  5BNG A;  2R93 J;  4W1U A;  1JKO C;  5IYB J;  5E3O A;  2OPT A;  1H89 C;  3S2H J;  4JX4 A;  3BR5 A;  5JLX A;  1DU0 A;  2JK3 A;  1MBJ A;  4XRS G;  2XSD C;  4X6A J;  2LR8 A;  2B63 J;  1ETQ A;  1I3Q J;  1JKQ C;  1POG A;  2DTZ A;  2MW8 A;  3BR0 A;  1P7I A;  1B8I B;  3OOU A;  3NAU A;  3HM5 A;  2M9H A;  2Y30 A;  4A3L J;  4A3G J;  1ETW A;  2HQ5 A;  1PUF B;  1H88 C;  2O7O A;  3HGG A;  1T56 A;  2JA6 J;  3WHC A;  1TWC J;  4BKX A;  4M3E A;  2CU7 A;  1GV2 A;  3H3V K;  5F1J A;  2NVY J;  1VI0 A;  1RKT A;  3HGY A;  5IPA A;  3SFI A;  4J19 A;  3BG5 A;  2EZI A;  1QRY A;  1WCM J;  1TWH J;  2VKV A;  2L7Z A;  4G12 A;  2VUM J;  2KDZ A;  3S2D J;  1ETY A;  5IOZ A;  1IDZ A;  2FJ1 A;  1EF4 A;  3BR6 A;  3ZQF A;  1BJZ A;  2LK2 A;  2MGQ A;  1IJW C;  1OCP A;  3RZO J;  4A69 C;  5DTD A;  2XB5 A;  5F0C A;  1ETO A;  2E2J J;  4BY7 J;  3BQZ A;  1ZKG A;  1U8B A;  3L1P A;  2EBI A;  4C3J J;  3QPS A;  3OSF A;  1PUF A;  9ANT A;  2JMW A;  3BTL A;  2Y9Z A;  3JRD A;  5C4J J;  3FIS A;  3IH4 A;  1YRN B;  3O8G A;  5IP9 J;  2LVS A;  5IP7 J;  1MNM C;  3Q0V A;  3D1N I;  3GTL J;  2E2H J;  1FIP A;  3MN2 A;  4JX6 A;  3BTC A;  3F0C A;  4CYC A;  2RAE A;  4A3I J;  3FK6 A;  2NVX J;  3O8H A;  2IBD A;  2MSY A;  1ETX A;  2HI3 A;  2LP0 A;  1FJL A;  2WAQ N;  1MSF C;  2XPV A;  5M3M J;  3GTG J;  3A01 B;  5FKN A;  2DMT A;  4IHW A;  1IUF A; 
#chains in the Genus database with same CATH topology
 4BNC A;  3H92 A;  1GV5 A;  5E3N A;  1DQU A;  4H0E A;  1D1C A;  2OJE D;  4AUX A;  3S1Q J;  4IQ4 A;  2BW3 A;  2CGP A;  3L2W A;  3BCA A;  2HTJ A;  2CQK A;  2NAZ A;  1O3Q A;  1XPX A;  1KON A;  3CUQ A;  3ZR8 X;  3Q5F A;  1I50 J;  1X4O A;  1YX5 A;  3KEY A;  3KP7 A;  4I0A A;  4LG0 A;  2RNG A;  3FK7 A;  2ZNZ A;  1X1P A;  4AIK A;  2P6S A;  1XDS A;  1YHQ I;  1XN7 A;  2MLK A;  2X1E A;  3BY6 A;  3KP6 A;  3RJP A;  2Y0S N;  3I4M J;  3QP6 A;  4XRS A;  4BGD A;  2DMP A;  3ZQC A;  3S3M A;  2ELJ A;  1W36 C;  1FC3 A;  2R5Z A;  3K4M A;  3HPH A;  4KYW A;  6PAX A;  1YTY A;  1W7P D;  1OYI A;  3HHH A;  4CUG A;  1XGN A;  3JAM Z;  3HUG B;  1VQL I;  1S72 I;  3PM1 A;  2JN6 A;  4XLE A;  3JRE A;  1QPI A;  5FKK A;  3PNY A;  5LHG A;  5LFA A;  2VE9 A;  3CCY A;  3OY9 A;  1A35 A;  1FTZ A;  1W7P A;  2KMU A;  2AXL A;  4FTH A;  4HQM A;  1ITY A;  3GWZ A;  1CF7 A;  3KYD B;  2IGN A;  4G94 A;  2X48 A;  5E8I A;  5HDK A;  2OUM A;  5D4S A;  3HPG A;  1V3F A;  3DTI A;  3E6M A;  2WAQ A;  1Z6T A;  2R7T A;  2Y9Y A;  2IGO A;  1B72 A;  2CQ7 A;  3T1B A;  3AAF A;  2K4B A;  4GCV A;  2QQB A;  2MD0 A;  3E5X A;  4BEH B;  2FUG 2;  2Y2Z A;  3ZPL A;  5BOX A;  2EIL H;  2MLG A;  5GTH C;  4KMU X;  1Q1V A;  1A36 A;  5BQT A;  2ECB A;  3JRI A;  3JRA A;  3VEP A;  1R5I D;  4ZYH A;  1IF1 A;  1WI3 A;  3MD2 A;  2XGD A;  2CFO A;  3RYR A;  1S9H A;  2W85 A;  1T0F A;  2R7W A;  2NS7 A;  1OCC H;  1U9O A;  4CCN A;  3K2A A;  1WI9 A;  4BXU A;  4H4K C;  2CW0 F;  3BT9 A;  4MIM A;  3SJM A;  1T08 B;  3KPH A;  4FX4 A;  2LRD A;  5L3B A;  4BBS J;  3O6B B;  3LA7 A;  1B8I A;  4S0H B;  3OIP A;  4Q5S F;  3CJT B;  4U0W A;  1JE8 A;  2VBZ A;  3I56 I;  2DFI A;  4KMF A;  3TED A;  1MMS A;  1MKM A;  1X3U A;  2I5U A;  3E3V A;  5K1Y A;  3HB9 A;  5FO5 A;  2V9V A;  4ZYE A;  1JT0 A;  2R7S A;  1I6X A;  3GF2 A;  2L02 A;  3GFJ A;  2QEN A;  3QU3 A;  1XG1 A;  1R1T A;  3DU5 A;  5CVR A;  1SD5 A;  5JLW A;  2JRM A;  5GPC A;  4HF1 A;  2DOE A;  2VJ5 A;  4ZDP A;  3DPL C;  1MBK A;  3J7A Y;  3GME A;  3HOV J;  1OCO H;  3FBN B;  4XSZ F;  3ABM H;  4M3D A;  1LDD A;  4YIF A;  4O5V A;  2CV1 A;  5FRO A;  2G0E A;  2EK5 A;  2WY7 Q;  3HKZ N;  3G1M A;  4BH9 A;  5HOO A;  2HYF A;  2CV2 A;  3GW2 A;  3KZI C;  2DI3 A;  1MBE A;  2AS5 F;  4DYR A;  1ZG3 A;  2L4M A;  5D5V B;  2DA6 A;  4F7Z A;  3OL3 A;  3IKV A;  2HDD A;  3FHN A;  4IO9 F;  1X3W B;  2JUG A;  1FMW A;  4OOI A;  5ERI A;  5BS6 A;  2DN0 A;  3E7L A;  4HW0 A;  1EH8 A;  3CMM A;  5K5Q A;  2RV8 A;  1JJ8 C;  1WPK A;  2R7F A;  4L9N A;  1R1U A;  3I0T A;  4WF2 A;  4PJN A;  1A04 A;  3HC7 A;  3GTJ J;  1HLV A;  2ISZ A;  2STW A;  2XPU A;  3TQN A;  5IP6 A;  3SZP A;  1FP2 A;  4N4O B;  1TQP A;  4HX7 A;  2JWT A;  2VI6 A;  4U87 A;  2MC4 A;  1AU7 A;  4XLN F;  4W97 A;  2E1M C;  4KIF A;  4DQ2 A;  2K85 A;  4PCQ A;  1N75 A;  2V4J C;  2DA7 A;  1FOY A;  4IHX A;  4KIT B;  3U21 A;  1SFU A;  4YRV A;  3WE2 A;  2FXA A;  4OMZ A;  1OKR A;  1ERD A;  1WJC A;  3PO3 J;  3DU6 A;  4AC0 A;  4ZH4 F;  4LOC A;  4M9Z A;  1IXS B;  1P4A A;  2KJB A;  2VIX A;  4A2U A;  2DFE A;  5J1U A;  4IKF A;  2FBH A;  2L7F P;  3I71 A;  4EM2 A;  4UV8 A;  3FXU A;  2VE8 A;  1DP3 A;  4ANJ A;  2OAZ A;  3S3N A;  4PDK A;  4B43 A;  3Q0U A;  2KT0 A;  3NWT A;  1XMX A;  2W4S A;  3LSJ A;  3TOB A;  1GVD A;  1VQ4 I;  1MZB A;  2HR3 A;  3FXJ A;  2EZH A;  2RVC A;  4EM0 B;  3A03 A;  3VPR A;  1GXP A;  2CQN A;  3W6K B;  3FHZ A;  2NS0 A;  2XC7 A;  1WJA A;  2XRL A;  5EF6 A;  5J1Y A;  1Y1V J;  1OJL A;  3S93 A;  3TW6 A;  1DPR A;  3D0S A;  4GXO A;  2A68 F;  4IEJ A;  2ECC A;  2CW8 A;  5EEH A;  2NOG A;  5B5E C;  4EJV A;  3J7A O;  3TDZ C;  1ON1 A;  4XLA A;  5DD8 A;  1BIA A;  2BHZ A;  4IOC F;  1FEX A;  2W1O A;  3RSN A;  5ILU A;  5GAD J;  4AIH A;  1K6Y A;  3WTV C;  3LAP A;  4C2U A;  4IVN A;  2JA8 J;  1OFC X;  5FKO A;  4L5J A;  5DM6 F;  3QPT A;  4OMY A;  5L3F A;  1JHF A;  5FKL A;  3DPU A;  1VTN C;  1J75 A;  3OYE A;  2ME0 A;  1QNT A;  3GTM J;  2F4M B;  2K3P A;  4PGG A;  2XGE A;  3R0A A;  1S7A A;  3E97 A;  1XMK A;  2PQ8 A;  2YS9 A;  3LQR A;  4LMY A;  4A3F J;  3S14 J;  1FTT A;  3GTK J;  2ZJR F;  2DDA A;  1ZGW A;  3CLQ A;  1WHU A;  2W24 A;  1TLH B;  1DGW Y;  2M7B A;  2FBI A;  1O3R A;  4DYQ A;  2BY3 A;  4IRI A;  3U9G A;  2O5R A;  2DK5 A;  2M34 A;  4GGG A;  3HOZ J;  2OD5 A;  5FRN A;  1LE8 B;  2VPL A;  1RR8 C;  1XSX A;  2VJI A;  1MBH A;  3W3C A;  1HSJ A;  2J5O A;  4AVZ A;  2V1X A;  5JR3 A;  1SVL A;  3EDP A;  3IAM 2;  2WA0 A;  4ZZL A;  3WGI A;  3PIP F;  2RGV A;  4FET A;  3V7C A;  5DUI A;  3H5R A;  3BDD A;  4NC6 A;  1IUY A;  1R6R A;  2FQ4 A;  2BW3 B;  3BC8 A;  4II2 A;  4RM2 A;  3M07 A;  4PJJ A;  3MKW B;  3CUQ B;  2BXY A;  3CMY A;  2PI0 A;  4LG0 B;  2LLK A;  3JTH A;  2M2E A;  1G8X A;  3R0J A;  1WSU A;  3ZN1 A;  4M3B A;  2COM A;  2X1C A;  3K9T A;  1T38 A;  3DP7 A;  2R5Z B;  4DYC A;  1PP8 F;  1YFH A;  1ZYR F;  1A6I A;  2P5K A;  2EFO A;  1ODD A;  2EJR A;  4P5O A;  2DBB A;  4FX0 A;  1Y8R B;  2V1U A;  4II3 A;  3ZCO A;  1QHH D;  3VDX A;  2V9P A;  2V9K A;  1WH7 A;  2A3S A;  3I3L A;  3CCL I;  1IZ1 A;  2BZT A;  1D0Y A;  3Q3S A;  2R5Y A;  1W7P B;  2CH0 A;  3CES A;  3K10 A;  3PQJ A;  2PMZ A;  1Y8Q B;  1YW8 A;  1CF7 B;  1MBF A;  1FPQ A;  4GYG A;  2DA3 A;  3E1S A;  4F55 A;  3HSF A;  3IH3 A;  4DOZ A;  2PJR A;  1K78 A;  5HS8 A;  4HX4 A;  5HOD A;  5FGM A;  3ECO A;  3LSG A;  1M1E B;  2VBW A;  5M5X J;  3IWF A;  2XV4 S;  2FML A;  1J9I A;  1B72 B;  1XC5 A;  2LY2 A;  1NTC A;  3SHF A;  5KVR A;  3IC7 A;  4UUT A;  4Z6Y A;  3RKQ A;  2HXO A;  1FLI A;  3IH2 A;  3T5X A;  3WG9 A;  3HZJ A;  1N78 A;  1R49 A;  3OOP A;  1NK3 P;  3RYP A;  3CO6 C;  4Y15 A;  1EKE A;  2O03 A;  1KYZ A;  1YW7 A;  5BNG A;  2PX9 A;  4W1U A;  4L18 B;  3GYH X;  1IRF A;  2DXI A;  3ASO H;  5HNF A;  1ZAR A;  2CMP A;  4CZC A;  5DCM A;  2D1H A;  2BOL A;  5JLX A;  3N05 A;  2HQN A;  2QEX I;  4MQV A;  2XSD C;  1JHH A;  4L5I A;  1SD4 A;  2LR8 A;  1SMY F;  1I3Q J;  4WXC A;  2Z2S B;  1B8I B;  3OOU A;  4LFU A;  1XD7 A;  2H8W A;  3HM5 A;  3OYM A;  3DFG A;  4ZJZ A;  2M9H A;  1TW2 A;  1KU3 A;  2OZ6 A;  2Y30 A;  3CCJ I;  1HST A;  1ETW A;  4M6X A;  2HQ5 A;  1W5S A;  1PUF B;  2DFF A;  2MH9 A;  5CVI A;  1S7O A;  2OTL I;  2JA6 J;  3A0B C;  3PFY A;  1BIB A;  2PMU A;  5CJ9 A;  1TWC J;  1MMA A;  1UCR A;  5F1J A;  1D1A A;  3HGY A;  5KAI C;  4XMY A;  2HKO A;  4MTD A;  1PJR A;  4F92 B;  2VKD A;  1OQY A;  2NNY A;  2VKV A;  1YYV A;  3S2D J;  1R5H A;  2IPQ X;  4F3Q A;  2M4K A;  3P9I A;  3F23 A;  4E7S A;  2ADU A;  5D6E A;  5FB2 A;  1R5G A;  1ETY A;  4HSR A;  2VQL A;  5IT9 Z;  1EF4 A;  3ZQF A;  3LSK A;  5DCF A;  1XX5 A;  2KL4 A;  1OCP A;  2EIJ H;  1IJW C;  2QKL B;  2XB5 A;  1R36 A;  1ETO A;  1V5F A;  4UXN A;  2GOX B;  3F8B A;  2FNA A;  4XOR A;  4BY7 J;  1RRJ A;  2KRC A;  2K27 A;  5KAF C;  3R6S A;  3Q9S A;  4C3J J;  3M8J A;  2V1N A;  3ONQ A;  4NQW A;  4IF4 A;  2DW4 A;  3L2V A;  3LWF A;  5TRD A;  9ANT A;  2JMW A;  2WAF A;  2L01 A;  1WJB A;  3M8F A;  2VQH A;  2XRN A;  2Y9Z A;  5C4J J;  3FIS A;  2H1L A;  2W57 A;  5AIQ A;  5IP9 J;  1N25 A;  2EIK H;  3H35 A;  2P7V B;  3I5U A;  4PJM A;  3GTL J;  1FSE A;  5LGU A;  2VAS A;  3WU1 B;  1YJN I;  3F0C A;  2O61 A;  3FXR A;  1MIJ A;  4QWQ A;  4AD9 A;  4GRI A;  1C0W A;  2IBD A;  2O6G E;  1FJL A;  2GQQ A;  3LL7 A;  2VN2 A;  1MSF C;  3FMS A;  2B0L A;  3TO6 A;  2LF7 A;  2ZME A;  5L3G A;  2G7U A;  1B1B A;  4MNU A;  5K5R A;  1KQ0 A;  3DBH B;  3CP2 A;  1RPW A;  5J3L A;  4DGW B;  1R1V A;  1RES A;  2PLY A;  5E1X A;  2DMN A;  3DKW A;  3FIW A;  1U2W A;  2X0L A;  3DPT A;  2EH3 A;  3GEZ A;  2NOJ B;  2QQ9 A;  3PNT A;  4NHJ A;  2ZFU A;  2X6X A;  2XDV A;  3B73 A;  3E6D A;  4RAF A;  1NHA A;  2NVT J;  4PFP A;  1TNT A;  2LY9 A;  1SC7 A;  4C3I J;  1XCB A;  1ZN2 A;  2XKP A;  4YEJ A;  5F6F A;  3CC4 I;  5HVQ C;  1Z0X A;  4ENM A;  4PZJ A;  1SFO J;  2IAI A;  2VXD A;  3L2Q A;  2ZKZ A;  3F8N A;  4ESB A;  1Y1W J;  1B4A A;  2ZSH B;  1HA8 A;  2QSG X;  2IS6 A;  1EH7 A;  4HEA 2;  3FKJ A;  2CYY A;  4P55 A;  1LQ1 A;  3DBR B;  1FIA A;  3W6J B;  1IGN A;  3PIO F;  3KP5 A;  2NVQ J;  2EWN A;  4IRH A;  1JT6 A;  1Z6R A;  2NXN B;  4XLC A;  3GFM A;  1LNW A;  1X4P A;  1X2M A;  1X3Z B;  1TWG J;  2L9R A;  3GZN B;  1AKH A;  1SFX A;  5KNL A;  1TC3 C;  3GUD A;  3TO7 A;  1E3H A;  3F3X A;  5E18 F;  4RB2 C;  2IS4 A;  1DPU A;  4TV7 A;  1ZRD A;  3MMY B;  2JVG A;  2GIV A;  3V8K A;  1WQ2 A;  4IJA A;  1BM9 A;  1MJA A;  1YS6 A;  4UHT A;  3I58 A;  1MH3 A;  2L9N A;  2F48 A;  4XBF A;  5KHD A;  1ENH A;  2O8K A;  2VBX A;  3OS1 A;  3TP0 A;  4ZZD A;  3VYT B;  5F1R A;  1Z77 A;  1JTY A;  4D5C A;  1BL0 A;  1Y56 A;  1YJ9 I;  3U1D A;  5DS9 A;  2IEK A;  4Q48 A;  2KIQ A;  2HQA A;  1PP7 U;  5LHI A;  3M1E A;  2VJ4 A;  3LSP A;  2HVR A;  3W2V A;  2BY2 A;  1OCT C;  1Q1H A;  2Y0S A;  1L0O C;  3OYC A;  4A6D A;  3K4N A;  2WC2 A;  3EET A;  1IV6 A;  1A5J A;  5E1Z B;  5F08 A;  5D8L B;  5D5X B;  3S1R J;  1W0U A;  2LC2 A;  2KRF A;  4EGZ A;  4HOB A;  4U88 A;  3VYS B;  3I54 A;  1X58 A;  1MMD A;  4EJW A;  3EUH C;  4J01 A;  3SEZ A;  5HS9 A;  2H6C A;  3KZY A;  5LRS A;  2HEO A;  2A6T A;  5DUK A;  3H9Q A;  4KFC A;  3RPU D;  1VQN I;  5IT9 K;  2VKE A;  2ELH A;  2PJP A;  2DT6 A;  4EJU A;  2A5W A;  2OU2 A;  1WZ2 A;  1V55 H;  4BE1 A;  1JI8 A;  5CVJ A;  1W36 D;  2UZK A;  2J5P A;  4N4N B;  3HTU A;  2M0C A;  2QSF X;  1B59 A;  3SDB A;  1R4M B;  5JFR A;  4YEL A;  1XMA A;  3CCM I;  3BTJ A;  3RPU A;  4E7H A;  1UHM A;  2KJC A;  3PSI A;  2VON A;  2QQ8 A;  3BG3 A;  1ZLK A;  4EEF G;  2A61 A;  1BJA A;  5FFZ A;  5EEG A;  2R5Y B;  2H27 A;  1RIO H;  2CWE A;  3Q9V A;  3KYL A;  3KYC B;  2G7H A;  2KDO A;  3W2A A;  1ZTR A;  4OWR B;  1JGS A;  3DXJ F;  5K7F A;  1K78 B;  2PJR B;  5LGN A;  1I1S A;  1I3A A;  2CG4 A;  3ML6 A;  1BC8 C;  3ZOB A;  1RUO A;  3LMM A;  3MZH A;  2NYX A;  2N8G A;  1SFK A;  1GDT A;  5C44 J;  1ACI A;  3PL8 A;  3CP8 A;  2K9Q A;  2RQQ A;  3OYN A;  3CME I;  2LSO A;  4JYK A;  4FT8 A;  1ZH5 A;  2WB1 N;  2F5C A;  4HQE A;  2V1D A;  1LDJ A;  4CSW A;  4YG2 F;  1APL C;  2P5V A;  3LOC A;  4XK4 A;  4NC8 A;  5ICE A;  1F36 A;  3BLY A;  2F2E A;  3OS0 A;  3PSF A;  1UST A;  1GLN A;  1ZR2 A;  1JUM A;  3AG4 H;  1SD7 A;  5DCM B;  3HOU J;  5F04 A;  4RAY A;  3LSH A;  3G1O A;  3BZ6 A;  3ABL H;  4LLN A;  3H36 A;  1RKW A;  4E6K G;  5IYC J;  2XPW A;  4BHB A;  2B7E A;  1VF9 A;  4PJ0 C;  1Z7U A;  1SAX A;  2M8E A;  4M73 A;  2GZW A;  2DA2 A;  3F8F A;  4PGH A;  4A0X A;  3L2U A;  4J00 A;  1WJF A;  2EB7 A;  2VKH A;  4RB1 A;  1BC7 C;  3S17 J;  3DQV C;  3KIO A;  3FZV A;  4RMN A;  3OSG A;  1B6A A;  4NB5 A;  4MLO A;  4BU2 A;  1YG2 A;  1IXR C;  5H2F C;  4ZYD A;  1MMN A;  2QF7 A;  3J81 Z;  4HF0 A;  2YX4 A;  3H5A A;  1K6O A;  2A07 F;  2DYS H;  3OS2 A;  4G7Z F;  2JA7 J;  1P6R A;  1QBJ A;  3MEX A;  3WG7 H;  2DLL A;  2Z16 A;  3I4P A;  3JRG A;  1TTY A;  3VB2 A;  4DZJ A;  3ZMS A;  4BXF A;  3OIO A;  3TGN A;  1HOM A;  2BGC A;  2HQR A;  5FJ8 J;  2K3F A;  3BOQ A;  3JCU C;  4V19 K;  1WH5 A;  1FYK A;  4P9U A;  4FIS A;  2A6E F;  3OYK A;  2A69 F;  4A0Z A;  3LFU A;  3FXO A;  5J1R A;  1ZG1 A;  4Y33 A;  5LD2 C;  4Y4R A;  2ZBK A;  5DV5 A;  2Q1Z B;  2HOS A;  1TL8 A;  2UWM A;  1D5Y A;  2XKO A;  2IXS A;  2CUF A;  3CUQ C;  3MVP A;  4ITV A;  2H8R A;  1YX3 A;  1YO5 C;  1T39 A;  4NQW B;  4Z2Y A;  3WHB A;  4S05 A;  3EUA A;  1HW5 A;  2YR2 A;  1REP C;  1GUU A;  2WAD A;  1HBX G;  5DEQ A;  5C4X J;  2GA1 A;  3OYD A;  4DIQ A;  2HFH A;  2X4H A;  5TIS C;  2VPR A;  2EFW A;  3B6C A;  3K1P A;  3TDU C;  1TZL A;  1J5Y A;  2LKP A;  4OAY A;  2F5V A;  4CYD A;  3KET A;  1EH6 A;  3P9K A;  4R1H A;  1TT5 B;  1F43 A;  3MKY B;  5IT3 A;  3VOE A;  4DBR A;  5L3D A;  4IHV A;  4C2T A;  3L00 A;  1CQT A;  4D0P A;  2R7Z J;  4XLH A;  5JVT A;  1U5T A;  4ZDO A;  3G2B A;  2ZME B;  3TKY A;  1W5T A;  3BPV A;  2E19 A;  1WRJ A;  2X9D A;  4CHU A;  3C2H A;  2HOT A;  5D5U B;  1Z67 A;  2OF7 A;  1YIO A;  2LFB A;  1VZ0 A;  1OPC A;  3T0Y A;  3L2R A;  3CDL A;  4XNF A;  4QTR A;  1J59 A;  1JUP A;  2EZL A;  4G9Y A;  4CCM A;  5ED4 A;  1I1G A;  1ZLJ A;  3FWE A;  3FDY A;  1S3J A;  2MFZ A;  1FBS A;  2X85 A;  5TGT A;  1KYW A;  4KJZ A;  2E35 A;  2ZFW A;  3T8T A;  1F4K A;  1XGM A;  4CCJ A;  3K2Z A;  2F4I A;  5C3E J;  4U0Y A;  2OTJ I;  1P92 A;  3FXL A;  2LTP A;  4AYB N;  3H0G J;  5E20 A;  2VLA A;  4XRF A;  3ZQ7 A;  1QA6 A;  2HU9 A;  5H6R A;  1TW3 A;  1O3T A;  2V26 A;  1JXS A;  1A31 A;  1P2F A;  2ZJ2 A;  4FQG A;  2VQG A;  2V79 A;  3BP8 A;  2IT0 A;  3ZMZ A;  3M9A A;  1SVM A;  1IV8 A;  4PJL A;  3BPX A;  1SD6 A;  2FX0 A;  5J47 A;  2JA5 J;  4UUV A;  2Z5U A;  1AKH B;  1FYM A;  1XCV A;  5LHH A;  3D5R C;  1W4M A;  4BDY A;  4KNY A;  1O7L A;  3C2B A;  2DMQ A;  3V4G A;  3GFL A;  4EQQ A;  5CPR B;  4L0Z B;  3A1Y A;  3JAM K;  2ID6 A;  4ESF A;  5GPA A;  4OIR F;  3SEQ A;  5D4R A;  4ZYA A;  3RKY A;  1E2X A;  2BHY A;  5K7Z A;  3CF5 F;  2VOO A;  3ZQG A;  1E0E A;  3PJR A;  1HKQ A;  4G6D A;  4LGW A;  5DM7 F;  4AU7 A;  2AHQ A;  2R93 J;  5IYB J;  2GIZ A;  3ULQ B;  3J81 K;  2OPT A;  1T98 A;  3ZGK A;  3S2H J;  3KP2 A;  3MQ0 A;  1MND A;  1LPQ A;  3BZC A;  4R79 A;  4B3X A;  2OCC H;  2XAQ A;  5GAG J;  5FD5 A;  1P4X A;  1T2K A;  3DEU A;  5FFX A;  1STZ A;  4ZDL A;  4IX7 A;  2HVS A;  1FMV A;  1POG A;  2MW8 A;  3BR0 A;  1O7F A;  1P7I A;  3F8C A;  1IO2 A;  3E5U A;  2LBF A;  5HDG A;  1WVR A;  3NAU A;  2BVL A;  4CZZ A;  3M7G A;  2HKX A;  3P9C A;  4YIR X;  1N77 A;  2XHK A;  2R7D A;  1H88 C;  3HGG A;  5HNH A;  4XOP A;  4HST A;  1KZH A;  3QOE A;  3WHC A;  5LGT A;  2DOA A;  2FOW A;  1H9T A;  4M3E A;  3QWL A;  1UEL B;  3EPZ A;  3CO7 C;  2FRH A;  4HG2 A;  2IA2 A;  3P5J A;  3MCZ A;  3CCE I;  2WWY A;  2EZI A;  1WCM J;  1TWH J;  3SZG A;  1U3E M;  4G12 A;  2KDZ A;  3VSL A;  1V4R A;  3CZ6 A;  3M8E A;  4Q4Z F;  2E7W A;  2FJ1 A;  1BJZ A;  1MGT A;  2F5D A;  4A5N A;  1TP4 A;  2EPF A;  2D2W A;  5DTD A;  3ZMD A;  2E2J J;  1PVE A;  5HS7 A;  3BQZ A;  5AIP A;  3L1P A;  2EBI A;  3CJN A;  1U8R A;  1T8I A;  1X1D A;  5E17 F;  2M5W A;  4M71 A;  5DD4 A;  2IS2 A;  4I01 A;  2XAU A;  3RTR A;  4KIS A;  2WAE A;  2IP2 A;  4MQ9 F;  4E7J A;  3JRD A;  4Y3O A;  2ETH A;  2VC0 A;  3O8G A;  2E71 A;  3OMY A;  1Y39 A;  1BOA A;  2LVS A;  1FIP A;  3MN2 A;  4RLF A;  2BYV E;  4IPA A;  4KN7 X;  1FP1 D;  2Q2E A;  4P96 A;  3O8H A;  2DOF A;  2LOO A;  2HI3 A;  3QOD A;  3DLA A;  3N4M A;  3GTG J;  5M3M J;  1OR7 C;  3RPQ A;  1WWX A;  2K5C A;  1RZ4 A;  3HRT A;  4AM3 A;  4IHW A;  1IUF A;  1ZEL A;  3QYB A;  4XL9 A;  4FE4 A;  3CF2 A;  2E1C A;  4BBR J;  1IN6 A;  4LIT A;  1X1C A;  5DDG A;  2F5E A;  3F6V A;  4ENK A;  2AQF A;  4ASN A;  1BW5 A;  3BG9 A;  2HGC A;  1V5G A;  2OV7 A;  3LSM A;  4FAS D;  2GBY A;  2M30 A;  4XKB A;  5IYD J;  1V54 H;  4S04 A;  5EG0 A;  4UUS A;  3GLL A;  3HL2 A;  1EJ9 A;  1ZHF A;  5FLM J;  3BRO A;  1YQA A;  2DJN A;  2VT3 A;  2EFQ A;  3TW7 A;  2GWR A;  4MHG A;  3F9K A;  2O9L A;  2OBP A;  1WJD A;  3HBL A;  1VQ5 I;  5ICG A;  1S8N A;  1I27 A;  5IY5 H;  1HDP A;  2XF5 A;  1LFU P;  4UB8 C;  1G3T A;  2RC4 A;  3GZ5 A;  4RS8 A;  3K1N A;  4ENN A;  2KRH A;  3M1C A;  3KZZ A;  1HXD A;  3QPL A;  2RQP A;  1DUX C;  2LYC A;  5J4V A;  1AHD P;  2R3S A;  2JT1 A;  1J7K A;  4B3A A;  1TT0 A;  2EA2 A;  1XGO A;  3VYR B;  5J8C A;  2LH9 A;  3G3Z A;  3S8P A;  3ECH A;  3FX3 A;  1LB2 A;  3C1D A;  2HDW A;  5D5W B;  1MD0 A;  3GLX A;  2DA1 A;  3K4L A;  2CFX A;  4OIN F;  1P9Q C;  3NQO A;  3JTG A;  1OCR H;  4XID A;  4KUM A;  1YIJ I;  3I55 I;  4M9X A;  1QVU A;  2Y0M A;  3K7A J;  3WU2 C;  4EMS A;  3B6A A;  5F0F A;  2YSR A;  4LIU A;  4CA0 A;  4DBQ A;  2HPI A;  3DTE A;  5EGO A;  1FOX A;  5FRM A;  2M4G A;  1BBY A;  1VQP I;  2P4W A;  1LVK A;  1QPM A;  3LQQ A;  1SMT A;  3EYY A;  2X6Y A;  4KIC A;  4KIB A;  1YS7 A;  3K4J A;  1G6N A;  1U5T B;  4UVC A;  1IAW A;  2E1M B;  3BQY A;  2YPR A;  3ZQL A;  4LD5 A;  3CQZ J;  5K7H A;  2CO5 A;  2EFN A;  3EYI A;  4MGR A;  3ZMV A;  4E7L A;  4BE0 A;  1EV7 A;  2DCE A;  1WKM A;  3JRH A;  1ZRC A;  3QP5 A;  4U0V A;  5ILS A;  2H09 A;  2W25 A;  3OYL A;  1YJW I;  2TCT A;  3ASN H;  1GVJ A;  2FEZ A;  4XON A;  4O3M A;  2OQG A;  2OC6 A;  5E3L A;  5EZH A;  4UVA A;  3I9V 2;  1X19 A;  2MG4 A;  4DJA A;  1WGX A;  3ABU A;  4QPQ A;  4PUS A;  4BQN A;  4KDP A;  2XF6 A;  3FXK A;  2XRO A;  4E7K A;  5BPD A;  2EQR A;  2PFB A;  2NNN A;  2ZB9 A;  4A5M A;  1VND A;  2E5N A;  1O4X A;  4A3B J;  4I98 B;  4ZYG A;  2OCE A;  1JUS A;  3V7S A;  1A6Q A;  2L7M P;  2ZJP F;  3QRF F;  3RQI A;  2X1D A;  3OYJ A;  2QYO A;  2K9N A;  1RI7 A;  2QCO A;  3RKX A;  1IRX A;  3DBL B;  1FT9 A;  2DU9 A;  4ETS A;  4RB3 C;  3GFI A;  4MEX F;  3H9J A;  4B09 A;  1VQ9 I;  2JQ7 A;  2DPD A;  2H1K A;  4WK8 F;  3HRS A;  2K40 A;  3VFZ A;  3J7Z I;  2DYR H;  1IXC A;  3KE2 A;  2HOA A;  2Y48 A;  3R60 A;  4HNV A;  4C2M J;  3LAJ A;  2VQC A;  1WJ5 A;  1FY7 A;  1U9N A;  3JR9 A;  4M6V A;  2CQQ A;  2LKX A;  2DO7 A;  3VOD A;  1YRN A;  4BUP A;  4L9T A;  1BOB A;  1LEB A;  1FYL A;  2KKO A;  1FSH A;  2KZV A;  2QGU A;  3H1C A;  2GXA A;  5GAE J;  3C18 A;  1SFE A;  1RNL A;  5CVU A;  2PG4 A;  1HF0 A;  2FNP A;  1QGP A;  1Y0N A;  4L5E A;  2BE5 F;  3E5Q A;  2CS3 A;  3ZN0 A;  1I39 A;  2IW5 A;  4B1R A;  3NAR A;  2A05 A;  2DTR A;  4I7H A;  3H9G A;  3F8M A;  3PNV A;  1E3O C;  3A01 A;  4CXF A;  2KP6 A;  2L9S A;  2QLZ A;  2LBF B;  1AA7 A;  3JRC A;  4LB5 A;  1USS A;  1F5T A;  3ZQI A;  1ZK8 A;  1B9M A;  1XS9 A;  1R71 A;  1BI0 A;  2NS8 A;  3CC2 I;  2RN7 A;  2L5Q A;  3A02 A;  4LJZ F;  5HLG A;  3OIQ A;  1K7A A;  5CQG A;  2VT2 A;  1W0T A;  4XOT A;  5BPI A;  2R7Q A;  3I59 A;  2X6O A;  3AG1 H;  1VQM I;  2YUS A;  3M4O J;  4NUB A;  4CCO A;  3HEF A;  1VQK I;  2XUB A;  1S5L C;  1U6G A;  3ABT A;  3KP3 A;  2WB1 A;  1MMG A;  3RZD J;  1K79 A;  1ORK A;  3H3Z A;  4AID A;  2QM3 A;  3VYU B;  3CDI A;  2QWW A;  4XKC A;  1RET A;  2COB A;  2M45 A;  2XB0 X;  2FD5 A;  3BR3 A;  4QIW N;  3COA C;  2X51 A;  3UR3 C;  2Y69 H;  4RLQ A;  1OLT A;  3K4B A;  3NEU A;  2YX7 A;  2NVU B;  5EJC A;  1ZR4 A;  1K61 A;  3HTS B;  3LST A;  2FMY A;  2L9V A;  3WTW C;  1XDU A;  5B1A H;  1IRG A;  4BJ6 C;  4HLY A;  1IN8 A;  1JJ6 C;  3HRM A;  2HPM A;  1IW7 F;  2Q2E B;  2FF4 A;  4X1E A;  2VL8 A;  2XSJ C;  1KQ9 A;  4XLP F;  5CVV A;  3FF5 A;  3BCB A;  3T8R A;  4U7B A;  1ETV A;  2IVM A;  1OIS A;  4A6E A;  1PDN C;  4I2O A;  3S1M J;  3PO2 J;  1UHS A;  1H9G A;  1QZY A;  3ZQQ A;  3WTY C;  4BHC A;  1BR4 A;  3Q0W A;  2PMH A;  1VQ7 I;  3HHG A;  4CIC A;  4BAY A;  1S29 A;  2P81 A;  3V8J A;  3GO5 A;  4XKW A;  5F27 A;  4RGR A;  4KN4 X;  4E4H A;  2JPB A;  2GOM A;  4Y52 J;  5CLS A;  2YU9 J;  3OYB A;  4EAT A;  2GM4 A;  1UHW A;  2E1O A;  4ZTF A;  2K7L A;  2DK8 A;  2KFD A;  5EG0 B;  1ZGA A;  4UUS B;  3HIF A;  5JI6 A;  1D8J A;  2HTS A;  3TL4 X;  4L9J A;  2JTV A;  1IDY A;  4D7M A;  2IRF G;  3RDI A;  3BJ6 A;  1QZE A;  1IC8 A;  4ESJ A;  1Z1D A;  3FM3 A;  3CCQ I;  4BS9 A;  4RGX A;  3U1K A;  1SAU A;  2LMD A;  4B4C A;  3KLO A;  3RCO A;  2XVC A;  4M3G A;  4XM3 A;  3K70 C;  1D3Y A;  1U78 A;  1HW2 A;  3CCV I;  3ERE D;  1LE8 A;  2IA0 A;  5E1W A;  2O3F A;  4V2G A;  4GFB A;  1BA5 A;  4F52 A;  3WTU C;  2DQR A;  5B1B H;  1NK2 P;  2ELK A;  4MFE A;  4OIQ F;  1ULY A;  3QOP A;  3SDG A;  4MO7 A;  4RBO A;  4UB6 C;  2XF7 A;  1KGS A;  1ZG5 A;  1D1B A;  5GTI C;  3FMR A;  5L3E A;  2DJI A;  4FCY A;  4OAZ A;  4M9S A;  5M3F J;  1B9N A;  1XB4 A;  1Z05 A;  2P0W A;  1HW1 A;  3IRR A;  3NRV A;  1P7J A;  4E70 A;  2QA4 I;  4CCK A;  4XRM A;  1BW6 A;  5EEA A;  1Z9C A;  2FOK A;  4B8X A;  4WXH A;  1GHC A;  5D8K B;  1NG7 A;  1MNE A;  2CRG A;  4JP0 A;  3TO9 A;  3AG3 H;  5HLT A;  1LFB A;  5EGO B;  5FLX Z;  4Y17 A;  4BXX J;  3AFH A;  3KLN A;  4B47 A;  2OZU A;  2CV0 A;  2RNJ A;  3GTP J;  2AXT C;  3HKZ A;  4IXA A;  2E2I J;  5D6F A;  3R61 A;  3I53 A;  4YII A;  5E3O A;  3HOS A;  2BVM A;  3ZP5 A;  3S32 A;  1H89 C;  2JRT A;  2M1B A;  3F6O A;  2BXZ A;  4BDZ A;  1OYW A;  4KA4 A;  1DU0 A;  5CKT A;  2E34 A;  1MBJ A;  4HV6 A;  2JA2 A;  1Z91 A;  3L7W A;  4XRS G;  2GXG A;  2MC3 A;  4KIG A;  1Y0U A;  4X6A J;  3IWZ A;  1ETQ A;  2G9W A;  1JKQ C;  2AQE A;  4BAC A;  4ZTJ A;  4AYB A;  1FZP B;  3L2C A;  1SEU A;  2CUZ A;  3IHU A;  5H20 A;  1G3S A;  2IJL A;  3O2P E;  3ERM A;  2JPC A;  2UV1 A;  3G73 A;  4QPO A;  3PUF A;  3IRQ A;  5CQE A;  3CCR I;  3OYA A;  2GA2 A;  3K69 A;  1ZRE A;  2KIM A;  2Z99 A;  2L4A A;  2CU7 A;  1GV2 A;  1F1Z A;  3H3V K;  2HS5 A;  1RKT A;  2H6B A;  2K9L A;  4J19 A;  5A2Q Z;  2ZO4 A;  4AVP A;  1FWZ A;  3BG5 A;  3F72 A;  3PFI A;  4PFO A;  4AIJ A;  1UAA A;  3J7Y J;  2Z3Y A;  1NG6 A;  3CMA I;  2DAO A;  2L7Z A;  2GXB A;  5IOZ A;  2ISY A;  3CTA A;  3CCU I;  1IDZ A;  1P4W A;  4N0B A;  2MGQ A;  1Y6I A;  4HLX A;  4A69 C;  5KK1 A;  2DPU A;  4Q47 A;  4WXD A;  2V6C A;  3WOD F;  4IZZ A;  1YI2 I;  4F93 B;  3WTS C;  3CLO A;  1ZKG A;  3H5N A;  1U8B A;  5B3S H;  1F9N A;  2W84 A;  3L09 A;  3KCC A;  4NC7 A;  2NRA C;  2W7N A;  2UXX A;  3OSF A;  1PUF A;  2WBM A;  4RB0 A;  2OQR A;  2KHM A;  2HVQ A;  1RC9 A;  3BTL A;  2XAS A;  1Z3X A;  2HYG D;  2O8X A;  4YFK F;  1UJ8 A;  4GO1 A;  3D5L A;  4HF2 A;  4WCG A;  3TMO A;  5F64 A;  3IH4 A;  1MDM A;  1YRN B;  3KFW X;  1R23 A;  5IP7 J;  3GXO A;  4HZF A;  2E2H J;  5J8F A;  2YU3 A;  4JX6 A;  3QU6 A;  4CYC A;  2RAE A;  4A3I J;  2A5Y B;  3DKX A;  2ACJ A;  2NVX J;  1T0F C;  1T95 A;  3KX2 A;  5E79 C;  2MSY A;  3ISP A;  3OR1 C;  5J6X A;  2QSH X;  3ABK H;  3ELK A;  2ZXH A;  5HLI A;  2WAQ N;  3QAH A;  4R8H A;  3A01 B;  1G3Y A;  5FKN A;  4MEY F;  3UKG A;  2R92 J;  1S7E A;  3CJQ B;  3AL0 B;  3GTQ J;  4ON0 A;  4V2F A;  4IHT A;  4G6T B;  2ZNY A;  2FSW A;  4LK0 F;  2K86 A;  1DDN A;  3W6V A;  4BE2 A;  3LNQ A;  4XN0 A;  3REO A;  2DFH A;  2XAJ A;  4EVI A;  4Y13 A;  1WFX A;  1MJB A;  1TBX A;  1MJ9 A;  2ESN A;  3JSP A;  2L54 A;  2PEX A;  4XN3 A;  3MZY A;  1KQ8 A;  5AON A;  4OIP F;  4LLL A;  1D5V A;  1AOY A;  3GBG A;  4WWC A;  1QQI A;  2K4J A;  4BYY A;  1U5T C;  2CSO A;  5M5Y J;  3I59 B;  2DT7 B;  1VQO I;  4F91 B;  1U0J A;  1OYY A;  2KPM A;  2DT5 A;  3QYE A;  3K6G A;  2LNB A;  1YOV B;  3IP4 B;  2M8G X;  3K1M A;  3MKZ A;  2F6C A;  3PUB A;  1D8K A;  2MA3 A;  1LDK B;  1MW7 A;  2LD5 A;  3C2G A;  5FLX K;  2PBI A;  2WV1 A;  1LKX A;  1KU7 A;  4EV0 A;  2W00 A;  2QUF A;  2A6H F;  2P6T A;  3ROU A;  4A3K J;  2VXZ A;  3RQ4 A;  1GT0 C;  3D5S C;  3G4S I;  1RUN A;  2JSC A;  2BY1 A;  2KIU A;  3K0L A;  4DNC A;  2ZJQ F;  1QU3 A;  1LEA A;  5J4Y A;  4I6Z A;  3BWG A;  2DA5 A;  1SVO A;  2VC1 A;  3IKT A;  4RDU A;  3CUO A;  4UNO A;  3WGH A;  3BJA A;  1JTX A;  2MH2 A;  2E36 A;  3K4K A;  2L3D A;  2CW7 A;  1ZQ3 P;  2ME6 A;  5FKM A;  1V5E A;  3TOA A;  3HDD A;  3BG7 A;  2VOD A;  3MAJ A;  4P1W A;  3DCF A;  4O6J A;  5FD6 A;  1HCR A;  2R7X A;  4K2E A;  2EIN H;  2EIM H;  5FLV A;  2QKM B;  4N9H A;  1H8A C;  3CCS I;  4KT5 C;  2HNH A;  4GDF A;  4JX5 A;  5A2Q K;  3QQA A;  3G6E I;  1OR7 A;  3J80 Z;  1VFC A;  4A93 J;  5EYR A;  4UY8 I;  4XIC A;  1QVT A;  1TNS A;  2VBY A;  5E3M A;  4G6Q A;  2I8D A;  1XSV A;  3BTI A;  3HG9 A;  3WE3 A;  1H0M A;  2QQA A;  3IV5 A;  4UVB A;  4WX9 A;  2OA4 A;  2D1V A;  3FMQ A;  2M3A A;  1R9T J;  4XQF A;  4IOA F;  2EV0 A;  3BG6 A;  2MAB A;  2P8T A;  4HV5 A;  2RDP A;  4JBA A;  3HOX J;  2B9S A;  4QSH A;  4CCL A;  3OL4 A;  2W82 A;  4RAG A;  4EJT A;  1DU6 A;  1ZAO A;  2LKS A;  1E17 A;  1X2N A;  2D45 A;  2EZK A;  2RKH A;  3C3W A;  3NWS A;  3S16 J;  2CUE A;  3JSO A;  4FHT A;  5KCM A;  4M74 A;  5JHU A;  5JVG F;  3V8L A;  2W48 A;  5B66 C;  1I6H J;  2Z1D A;  3HOW J;  4CGZ A;  2R0Q C;  4M72 A;  2CJJ A;  4UV9 A;  3OYF A;  3MZ8 A;  2HXI A;  1G2H A;  4D9J A;  1MBG A;  2BV6 A;  1XTA A;  4DW6 A;  2WV0 A;  2JVH A;  2V6E A;  2ZXW H;  4RGS A;  4XR6 A;  3DLL F;  3A0H C;  3E0J B;  4U7D A;  4M3F A;  3AKZ A;  4RAZ A;  4A0Y A;  3R4K A;  4I0B A;  2L2O A;  3WU0 A;  2TDX A;  2O0Y A;  4A12 A;  4LG3 A;  3CDH A;  3CD6 I;  1JGG A;  4A3C J;  1YLF A;  1Z3Y A;  1LFP A;  2VJJ A;  2QBY A;  1K83 J;  1ETK A;  5IOY A;  4JK1 X;  4FE7 A;  4PSW A;  3MWM A;  4LB6 B;  1TQI A;  1QZZ A;  4HAM A;  1QHG A;  2K9M A;  1TQM A;  4NDL A;  2HYJ A;  4JOM A;  3OYG A;  2ZXJ A;  4HNT A;  3FXQ A;  4RM3 A;  1PYV A;  4BQO A;  5GAH J;  1W5C C;  4RA2 A;  5ILV A;  3G71 I;  2LDU A;  1MSE C;  3OYI A;  2DMU A;  3M3Y J;  1J0R A;  1NH3 A;  2E1N A;  2IS1 A;  3HOT A;  5J40 A;  3DEW A;  3UNG C;  2EA4 A;  2E5Z A;  3ZQH A;  5LRR A;  1VQ6 I;  2I10 A;  3ZXS A;  3GX4 X;  1IG7 A;  1PUE E;  3S3O A;  2TRT A;  3G1L A;  2KQR A;  3K4C A;  3JRF A;  2QZ8 A;  5F0H A;  3AG2 H;  3I4N J;  2P5L C;  5LEJ A;  2M7A A;  1G59 A;  4G8X A;  3H0D A;  1XSD A;  2L7K A;  1HQC A;  4D5F A;  1BI3 A;  2K9S A;  3V7R A;  2DDB A;  4CDG A;  2GLO A;  4XKV A;  4D7N A;  1OMI A;  4C3H J;  1MH4 A;  3HSR A;  1BI1 A;  4IQJ A;  4BL0 B;  3MKL A;  1G3W A;  2Z9O A;  1O57 A;  1R4N B;  3DEE A;  4CH7 A;  3F21 A;  3TBI A;  3FBI B;  3LSR A;  1RR7 A;  3ZRG A;  1OCZ H;  3HUG A;  1X1A A;  3CC7 I;  1JKP C;  3HJE A;  2ID3 A;  1W1W E;  2AO9 A;  3IAS 2;  4GYI A;  4KT6 A;  5L3C A;  2Y31 A;  4YFN F;  2DQL A;  5ICC A;  1G4D A;  1R7J A;  4XLF A;  4HPQ A;  4PSX A;  3OR2 C;  3F22 A;  1UMQ A;  3QYF A;  1JKR C;  1UB9 A;  4HDU A;  3HSE A;  1IN7 A;  3SQN A;  4I76 A;  1MDM B;  2KZG A;  2D5V A;  5LBQ A;  4IHY A;  2M0M A;  3ZMT A;  2CQX A;  4A3J J;  1TWA J;  3J80 K;  1K4S A;  3SZT A;  2PMZ N;  4MFD A;  3HOY J;  3DV8 A;  4BEH A;  1IN5 A;  4CYC B;  3LA2 A;  4BY1 J;  2ZXI A;  5EZG A;  3BZK A;  2ZCW A;  3SFZ A;  2FU4 A;  4I02 A;  4D1Q A;  2HDC A;  1FOK A;  4NBQ A;  1FOW A;  4BQA A;  3QPH A;  1FBQ A;  2DA4 A;  3JRB A;  1AWC A;  2HWV A;  2JUC A;  5K5O A;  2R7U A;  1DP7 P;  3PQK A;  4DZP A;  3SYT A;  3O3K A;  3E6B A;  2ESH A;  4HA8 A;  3S15 J;  4HX8 A;  3N97 A;  4EM1 A;  2BY0 A;  5BMZ A;  2LF8 A;  1YIT I;  4OU0 A;  5JHF A;  4LLG F;  3TP3 A;  1GXQ A;  3BR2 A;  3KEQ A;  1ZRF A;  2LRE A;  2JZY A;  2RRE A;  1T33 A;  3WGG A;  1BI2 A;  1FBU A;  1T6S A;  4BQQ A;  2M87 A;  3C7J A;  3MFK A;  3HXL A;  4A3D J;  4A3E J;  2IA1 A;  2ZC2 A;  5DYM A;  4NNJ A;  5EDN A;  1UFM A;  3DTK A;  4BJT A;  1KA8 A;  1X1B A;  2UXN A;  2DOD A;  4YFX F;  2ZSI B;  2HOE A;  5ICF A;  4XSX F;  3CJR B;  3RKW A;  4E7I A;  1HC8 A;  4AWX B;  1HDD C;  3EUK L;  3ESW B;  3E6C C;  3WTX C;  3GTO J;  4L0Y B;  2CUJ A;  1WJE A;  3OV8 A;  4A3M J;  2X6W A;  3BR1 A;  2L0K A;  5GP9 A;  2XGC A;  2MBF A;  4ABZ A;  4P9F A;  4BHP A;  1HKS A;  1UG2 A;  3GCM A;  2EFP A;  4EJO A;  1LUJ B;  2UUZ A;  4BJ5 C;  3BJO A;  4ZC3 A;  2LY1 A;  4CO8 A;  3B02 A;  4EGY A;  4ENJ A;  1DGR M;  1UZC A;  3OYH A;  5M5W J;  4QLC U;  3OWT A;  2ICW G;  3VSK A;  2FQ3 A;  2HZD A;  2KIF A;  2JJ7 A;  4HDV A;  1E3P A;  3S1N J;  3I64 A;  3SXY A;  2Y75 A;  2WTE A;  2Q8K A;  3X2Q H;  1IRZ A;  2JSP A;  1SAN A;  4G7O F;  2MYS A;  3WTZ A;  3EUH A;  2WY8 Q;  3P7N A;  4Y7N J;  2GAU A;  4HNU A;  2BBY A;  3A2K A;  3EQL F;  5HDN A;  1VQ8 I;  1TWF J;  3FKI J;  4LIV A;  4HRI A;  2IGK A;  1JKO C;  1J2X A;  5LLQ A;  2Q0O A;  2C6Y A;  4JX4 A;  3BR5 A;  3U2R A;  4G7H F;  2JK3 A;  2ZME C;  2XAF A;  3L9F A;  3LA3 A;  5LEK A;  2B63 J;  2DTZ A;  1Z21 A;  2IGM A;  4B48 A;  4IRG A;  3V42 A;  1KU9 A;  2QVO A;  1QO0 D;  3KEO A;  4JQF A;  2KIS A;  1J09 A;  2STT A;  2VB6 A;  4A3L J;  4A3G J;  1IN4 A;  2FE3 A;  2O7O A;  2R4G A;  1T56 A;  2BEO A;  2K02 A;  4M6Y A;  4MTE A;  4LK1 F;  3FXM A;  3S2W A;  1R22 A;  3GZ6 A;  2MD5 A;  4BKX A;  3IL2 A;  3DWL E;  3H3U A;  5CYV A;  1BR2 A;  1UG0 A;  3RIR A;  3ZMU A;  1I5Z A;  2NVY J;  1VI0 A;  3K70 D;  3W2W A;  2Z33 A;  5IPA A;  3SFI A;  2R7O A;  2P7C B;  2H94 A;  3VWB A;  3IUO A;  2R7V A;  1QRY A;  3RI4 A;  3DF8 A;  2FA5 A;  3JW4 A;  1Z7L A;  2VUM J;  4C9Y A;  2E60 A;  3AL0 C;  3LFK A;  1L3L A;  4PK4 A;  4X0G A;  1BR1 A;  3BR6 A;  1EA3 A;  1YW9 A;  2FBK A;  2LK2 A;  2E7X A;  2XAG A;  1BN5 A;  2HZT A;  3RZO J;  2F4O B;  2R7R A;  4B44 A;  1CGP A;  2KLO A;  5F0C A;  3HRU A;  4IHS A;  1FNN A;  3GVA A;  1FX7 A;  1ON2 A;  3DKY A;  5H6Q A;  3QPS A;  4RGU A;  3WTT C;  1R00 A;  4E7Z A;  3FM5 A;  5TJJ A;  1R58 A;  4N9I A;  2PN6 A;  2EV5 A;  4C30 A;  4HYE A;  2F5F A;  1HKT A;  2LG4 A;  3A4C A;  2QBY B;  4I09 A;  3LSI A;  1MNM C;  5E8G A;  3Q0V A;  3D1N I;  4L9V A;  1XGS A;  3BTC A;  1ONV A;  2V7F A;  1D0Z A;  1ZGJ A;  3FK6 A;  1LJ9 A;  2XIG A;  1S6L A;  1D0X A;  1LVA A;  2EV6 A;  5HLH A;  4IL6 C;  4OIO F;  1ETX A;  4I99 C;  2XGX A;  2LP0 A;  2VOP A;  1KU2 A;  4HBL A;  1YE9 A;  2XPV A;  3HYI A;  3KP4 A;  1O3S A;  1K4T A;  2XAH A;  2DMT A; 
#chains in the Genus database with same CATH homology
 3UKG A;  2R92 J;  1S7E A;  3GTQ J;  4FE4 A;  1GV5 A;  4V2F A;  5E3N A;  1RPW A;  5J3L A;  4BBR J;  1RES A;  3W6V A;  2DMN A;  3FIW A;  4AUX A;  3LNQ A;  3S1Q J;  2EH3 A;  1BW5 A;  3BG9 A;  2GBY A;  1I50 J;  5IYD J;  5EG0 A;  4UUS A;  3FK7 A;  5FLM J;  3GBG A;  2NVT J;  3I4M J;  2DJN A;  2LY9 A;  3TW7 A;  2Y0S N;  4C3I J;  4XRS A;  2DMP A;  3ZQC A;  2O9L A;  5M5Y J;  3HBL A;  2R5Z A;  1Z0X A;  1HDP A;  1SFO J;  2IAI A;  1LFU P;  1Y1W J;  2M8G X;  3PM1 A;  3QPL A;  2JN6 A;  3JRE A;  2LD5 A;  1QPI A;  5FKK A;  1AHD P;  2WV1 A;  1FTZ A;  1FIA A;  3CCY A;  4B3A A;  1IGN A;  4FTH A;  2NVQ J;  1JT6 A;  4A3K J;  1ITY A;  1GT0 C;  1X2M A;  2X48 A;  2DA1 A;  1TWG J;  2L9R A;  1AKH A;  1TC3 C;  4XID A;  2Y9Y A;  1B72 A;  4I6Z A;  1QVU A;  2DA5 A;  3K7A J;  3B6A A;  5F0F A;  2Y2Z A;  5EGO A;  4RDU A;  1MH3 A;  1ENH A;  2O8K A;  1Q1V A;  1JTX A;  3TP0 A;  1Z77 A;  2ECB A;  3JRI A;  1ZQ3 P;  3JRA A;  2ME6 A;  5FKM A;  1JTY A;  4D5C A;  1BL0 A;  3HDD A;  1WI3 A;  2XGD A;  3DCF A;  1HCR A;  5DS9 A;  2IEK A;  3BQY A;  2NS7 A;  3ZQL A;  5FLV A;  1U9O A;  3CQZ J;  5K7H A;  3LSP A;  3K2A A;  1H8A C;  1OCT C;  4JX5 A;  3QQA A;  3BT9 A;  3SJM A;  4MIM A;  1IV6 A;  1A5J A;  1VFC A;  4A93 J;  5EYR A;  5F08 A;  3S1R J;  1W0U A;  3JRH A;  4BBS J;  4XIC A;  1QVT A;  5E3M A;  1B8I A;  1X58 A;  4S0H B;  3BTI A;  2TCT A;  3TED A;  2VKE A;  3IV5 A;  5E3L A;  1R9T J;  3HB9 A;  5EZH A;  2MG4 A;  1WGX A;  1JT0 A;  2M0C A;  3HOX J;  3BTJ A;  4QSH A;  1XG1 A;  1DU6 A;  2EQR A;  5JLW A;  5GPC A;  2ZB9 A;  1X2N A;  3BG3 A;  1MBK A;  2EZK A;  1VND A;  3S16 J;  4EEF G;  2CUE A;  3HOV J;  2R5Y B;  1O4X A;  4A3B J;  4M3D A;  1I6H J;  2W48 A;  1JUS A;  3HOW J;  2G0E A;  2R0Q C;  3HKZ N;  3G1M A;  2L7M P;  2CJJ A;  3RQI A;  1ZTR A;  2HXI A;  1G2H A;  1MBG A;  1MBE A;  4DW6 A;  4DYR A;  5K7F A;  2K9N A;  2QCO A;  2DA6 A;  2HDD A;  4M3F A;  3ZOB A;  2H1K A;  2K40 A;  2N8G A;  1GDT A;  2DN0 A;  5C44 J;  2HOA A;  3E7L A;  1JGG A;  4HNV A;  4C2M J;  4A3C J;  2K9Q A;  4JYK A;  2WB1 N;  1U9N A;  3JR9 A;  4M6V A;  2CQQ A;  1WPK A;  2LKX A;  1JJ8 C;  1YRN A;  1APL C;  3LOC A;  3GTJ J;  1HLV A;  4XK4 A;  2XPU A;  5IP6 A;  1K83 J;  1F36 A;  1ETK A;  5IOY A;  4FE7 A;  2JWT A;  2VI6 A;  1ZR2 A;  1JUM A;  1AU7 A;  1HF0 A;  3HOU J;  4W97 A;  5F04 A;  4L5E A;  3G1O A;  4NDL A;  2HYJ A;  4B1R A;  1RKW A;  3NAR A;  5IYC J;  2DA7 A;  4IHX A;  2XPW A;  1VF9 A;  2DA2 A;  1E3O C;  3A01 A;  3PO3 J;  4AC0 A;  1MSE C;  2DMU A;  4LOC A;  3S17 J;  3M3Y J;  3JRC A;  5J1U A;  3OSG A;  2L7F P;  4MLO A;  3DEW A;  3ZQI A;  3ZQH A;  1ZK8 A;  1XS9 A;  2I10 A;  1IG7 A;  2QF7 A;  2TRT A;  3Q0U A;  3G1L A;  2KT0 A;  2NS8 A;  3JRF A;  5F0H A;  3I4N J;  3LSJ A;  1GVD A;  3A02 A;  2JA7 J;  2EZH A;  3A03 A;  3VPR A;  3JRG A;  4D5F A;  2K9S A;  4DZJ A;  3OIO A;  1HOM A;  1W0T A;  2XRL A;  5EF6 A;  2GLO A;  5J1Y A;  1Y1V J;  1OJL A;  3TW6 A;  4D7N A;  5FJ8 J;  4C3H J;  1MH4 A;  1WH5 A;  2X6O A;  4IEJ A;  2ECC A;  3MKL A;  4FIS A;  2NOG A;  2YUS A;  3M4O J;  3HEF A;  5J1R A;  3LSR A;  1RR7 A;  2HOS A;  1FEX A;  3RZD J;  1JKP C;  1D5Y A;  2ID3 A;  2AO9 A;  1ORK A;  2CUF A;  3MVP A;  2Y31 A;  2H8R A;  2JA8 J;  1OFC X;  1RET A;  2COB A;  5FKO A;  3WHB A;  2XB0 X;  2FD5 A;  3BR3 A;  4QIW N;  5FKL A;  1UMQ A;  1GUU A;  1JKR C;  2ME0 A;  3GTM J;  2XGE A;  5C4X J;  4I76 A;  2D5V A;  4IHY A;  1ZR4 A;  1K61 A;  2YS9 A;  4A3F J;  2VPR A;  2CQX A;  3S14 J;  1FTT A;  4A3J J;  1TWA J;  3GTK J;  3B6C A;  1JJ6 C;  2PMZ N;  4MFD A;  1ZGW A;  3HOY J;  4CYC B;  4BY1 J;  5EZG A;  4X1E A;  4DYQ A;  1F43 A;  1ETV A;  4IHV A;  2DA4 A;  2M34 A;  3JRB A;  1CQT A;  3HOZ J;  2R7Z J;  1LE8 B;  3S1M J;  1UHS A;  3PO2 J;  1MBH A;  4DZP A;  2E19 A;  3Q0W A;  2X9D A;  3S15 J;  2HOT A;  2OF7 A;  2P81 A;  2LFB A;  5F27 A;  3CDL A;  4QTR A;  2FQ4 A;  3TP3 A;  3BR2 A;  1JUP A;  2EZL A;  4Y52 J;  2YU9 J;  1T33 A;  2GM4 A;  2E1O A;  5EG0 B;  4UUS B;  3CMY A;  2LLK A;  4A3D J;  2M2E A;  4A3E J;  5EDN A;  1IDY A;  4D7M A;  4M3B A;  5C3E J;  1IC8 A;  2R5Z B;  4DYC A;  2LTP A;  4AYB N;  3H0G J;  4B4C A;  1A6I A;  4M3G A;  1HDD C;  1U78 A;  3GTO J;  1LE8 A;  4A3M J;  3BR1 A;  2L0K A;  4V2G A;  5GP9 A;  2XGC A;  4ABZ A;  1WH7 A;  4GFB A;  1BA5 A;  2R5Y A;  1UG2 A;  3Q3S A;  2ELK A;  1NK2 P;  4MFE A;  3SDG A;  1MBF A;  4MO7 A;  4RBO A;  2DA3 A;  4FCY A;  2FX0 A;  3IH3 A;  2JA5 J;  5M5W J;  5M3F J;  1AKH B;  5HOD A;  3LSG A;  1P7J A;  5M5X J;  2JJ7 A;  3C2B A;  4XRM A;  2DMQ A;  1BW6 A;  5EEA A;  1B72 B;  3S1N J;  1XC5 A;  1NTC A;  1IRZ A;  1SAN A;  4UUT A;  3RKQ A;  2HXO A;  2CRG A;  4JP0 A;  3IH2 A;  2ID6 A;  1LFB A;  5GPA A;  5EGO B;  4BXX J;  5K7Z A;  1NK3 P;  4Y7N J;  3ZQG A;  3GTP J;  2E2I J;  1TWF J;  3FKI J;  2AHQ A;  5BNG A;  2R93 J;  4W1U A;  1JKO C;  5IYB J;  5E3O A;  2OPT A;  1H89 C;  3S2H J;  4JX4 A;  3BR5 A;  5JLX A;  1DU0 A;  2JK3 A;  1MBJ A;  4XRS G;  2XSD C;  4X6A J;  2LR8 A;  2B63 J;  1ETQ A;  1I3Q J;  1JKQ C;  1POG A;  2DTZ A;  2MW8 A;  3BR0 A;  1P7I A;  1B8I B;  3OOU A;  3NAU A;  3HM5 A;  2M9H A;  2Y30 A;  4A3L J;  4A3G J;  1ETW A;  2HQ5 A;  1PUF B;  1H88 C;  2O7O A;  3HGG A;  1T56 A;  2JA6 J;  3WHC A;  1TWC J;  4BKX A;  4M3E A;  2CU7 A;  1GV2 A;  3H3V K;  5F1J A;  2NVY J;  1VI0 A;  1RKT A;  3HGY A;  5IPA A;  3SFI A;  4J19 A;  3BG5 A;  2EZI A;  1QRY A;  1WCM J;  1TWH J;  2VKV A;  2L7Z A;  4G12 A;  2VUM J;  2KDZ A;  3S2D J;  1ETY A;  5IOZ A;  1IDZ A;  2FJ1 A;  1EF4 A;  3BR6 A;  3ZQF A;  1BJZ A;  2LK2 A;  2MGQ A;  1IJW C;  1OCP A;  3RZO J;  4A69 C;  5DTD A;  2XB5 A;  5F0C A;  1ETO A;  2E2J J;  4BY7 J;  3BQZ A;  1ZKG A;  1U8B A;  3L1P A;  2EBI A;  4C3J J;  3QPS A;  3OSF A;  1PUF A;  9ANT A;  2JMW A;  3BTL A;  2Y9Z A;  3JRD A;  5C4J J;  3FIS A;  3IH4 A;  1YRN B;  3O8G A;  5IP9 J;  2LVS A;  5IP7 J;  1MNM C;  3Q0V A;  3D1N I;  3GTL J;  2E2H J;  1FIP A;  3MN2 A;  4JX6 A;  3BTC A;  3F0C A;  4CYC A;  2RAE A;  4A3I J;  3FK6 A;  2NVX J;  3O8H A;  2IBD A;  2MSY A;  1ETX A;  2HI3 A;  2LP0 A;  1FJL A;  2WAQ N;  1MSF C;  2XPV A;  5M3M J;  3GTG J;  3A01 B;  5FKN A;  2DMT A;  4IHW A;  1IUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...