2E2JJ

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2jJ00
2HOAA 4UUSA 1JT0A 1GVDA 2X9DA 1WH5A 2XGDA 5FKMA 2H8RA 1AKHB 3OIOA 3S15J 1IC8A 2JJ7A 1JGGA 1ENHA 4MLOA 4AYBN 3A01B 2DA4A 2HOSA 2VUMJ 1VI0A 2D5VA 3GTOJ 5DTDA 2XRLA 3GTLJ 2LLKA 4M3DA 3ZQHA 4W97A 5FLVA 1Z0XA 5M5YJ 2XGEA 3JREA 2HI3A 3JRBA 3HB9A 1IRZA 1QVUA 2MSYA 4FTHA 4XICA 3SFIA 5J1UA 4A3CJ 1D5YA 4V2GA 4MFEA 2QCOA 4C3HJ 4QIWN 4BBRJ 3I4MJ 3TP0A 3DEWA 1BL0A 3HEFA 5M3FJ 1HLVA 1IDYA 3HGGA 3RZDJ 4UUSB 2YS9A 4D5FA 3SJMA 5FKNA 3S1MJ 1H89C 5GP9A 1Z77A 1DU6A 1RPWA 4X1EA 2X48A 2E2JJ 1FEXA 2DMUA 2TRTA 2L7FP 3G1MA 3BR0A 5IPAA 1A6IA 5EF6A 2AHQA 3HOUJ 2K9QA 3LSPA 2Y30A 2DMTA 1WGXA 3ZQCA 5JLXA 1MH4A 2DA7A 2DN0A 3C2BA 1MBGA 4FISA 1FJLA 5IYDJ 1LFBA 1IG7A 5FKLA 9ANTA 4B3AA 1YRNA 4C3JJ 3JRGA 3FK7A 2K9SA 2MW8A 5E3LA 1GDTA 1IGNA 1JKPC 2ME6A 3LSGA 1ZK8A 4IHYA 2X6OA 1HCRA 1K83J 3HOYJ 3BQYA 3CDLA 4QTRA 1PUFA 1HDDC 3H3VK 2EH3A 3IV5A 2L7MP 4A3GJ 1ETYA 2CJJA 2MG4A 4IEJA 4DYRA 2LTPA 5F08A 1MBFA 3FIWA 2B63J 5K7ZA 1RKWA 1P7IA 4XIDA 2E2IJ 1MBHA 5M3MJ 1K61A 1I3QJ 1RR7A 3H0GJ 4M3EA 4AUXA 4EEFG 2E1OA 3A03A 2VKVA 3JR9A 1TWGJ 3M4OJ 1YRNB 5J1RA 1X2NA 2EZLA 3HKZN 1MSFC 1ETOA 2OPTA 2PMZN 3Q0UA 4BKXA 3GBGA 3M3YJ 5EDNA 2LY9A 1A5JA 1U8BA 2ME0A 1H8AC 2L7ZA 2KT0A 4MO7A 3ZQFA 3MVPA 3I4NJ 1IUFA 1ITYA 2YUSA 1IDZA 1PUFB 1B72A 1UHSA 1JUPA 5EG0A 1WCMJ 1MNMC 2HDDA 1LFUP 4A3DJ 2H1KA 2DMPA 2R5ZA 3ZQIA 3S16J 3S2DJ 2QF7A 5JLWA 1Y1WJ 2XB0X 4MFDA 3NAUA 4QSHA 2R5YA 3HM5A 4L5EA 3RZOJ 2DTZA 4BY1J 3S17J 4A3FJ 4NDLA 1IJWC 4FE4A 4X6AJ 5BNGA 4A3JJ 2JMWA 3IH4A 2TCTA 1RESA 3HOVJ 4ABZA 3MKLA 2N8GA 1B8IA 2M2EA 2ECCA 5M5WJ 3BG3A 3S14J 2ECBA 4M6VA 2GM4A 3TP3A 4IHXA 2DMQA 1UMQA 4GFBA 2WB1N 4M3FA 5GPAA 4DZPA 5GPCA 5EZGA 2JA5J 3O8GA 5F1JA 5FKOA 1F43A 2XPWA 3Q0VA 1ORKA 3CCYA 1RKTA 3CMYA 1B72B 5EG0B 4AC0A 5M5XJ 5IP9J 2JK3A 2OF7A 2M8GX 2R5ZB 1H88C 3HBLA 4C3IJ 4A93J 2IBDA 3F0CA 4G12A 2K9NA 3OSGA 2L9RA 1AHDP 1DU0A 3SDGA 2R5YB 5K7HA 5EGOA 2GLOA 2ZB9A 5IP6A 3FK6A 1MBEA 4FE7A 5EYRA 4M3GA 2R7ZJ 4MIMA 3G1LA 3BQZA 1B8IB 4BBSJ 1I6HJ 3JRDA 1EF4A 1HOMA 4JX5A 1WPKA 5C3EJ 3BG9A 1Q1VA 3HDDA 1IV6A 2I10A 5IP7J 2XPUA 4A3IJ 1FTZA 3K7AJ 3PO2J 1JUSA 5F0HA 5F27A 3LSRA 1BW6A 1OCPA 2IEKA 4D5CA 1BJZA 2Y9YA 3BTLA 3QPSA 5IOYA 3UKGA 1R9TJ 4XK4A 4A3EJ 2E19A 2GBYA 1ZKGA 2DA5A 4RDUA 3PO3J 3GTMJ 1SANA 2EZIA 1JJ8C 1WI3A 4LOCA 2LP0A 4CYCA 1FTTA 2CRGA 1JTYA 2EZHA 5EGOB 3GTQJ 2EBIA 2W48A 4DYQA 1NK3P 1X58A 2LR8A 2Y0SN 3ZOBA 5E3NA 2CQQA 2P81A 4Y52J 1U78A 1X2MA 2EZKA 3L1PA 2DA3A 2NS8A 1QPIA 1FIPA 3G1OA 3QPLA 1ZQ3P 1P7JA 2NS7A 5F0CA 3D1NI 1ZGWA 3GTPJ 1GV5A 4JYKA 2CUFA 2DMNA 3IH3A 2CQXA 3GTKJ 5FJ8J 4JX6A 2AO9A 3BR2A 3JRFA 4J19A 2Y2ZA 4C2MJ 3FKIJ 1T56A 1U9NA 1JUMA 4CYCB 3MN2A 3TW7A 2K40A 1MBJA 3BTIA 4B4CA 5IOZA 3FISA 4FCYA 5FKKA 2FD5A 2XSDC 3HOXJ 2O9LA 3JRHA 1RETA 1GT0C 2Y31A 1ETWA 3W6VA 4JP0A 2M9HA 3WHCA 1APLC 2M0CA 3HOZJ 2DA1A 5J1YA 3BR6A 3O8HA 4DYCA 2COBA 3TEDA 3IH2A 3GTGJ 1GUUA 1WH7A 4Y7NJ 1NK2P 1OJLA 4UUTA 3NARA 4I76A 1MH3A 3BR3A 1ZR4A 2NVQJ 1TWHJ 4IHVA 2HYJA 2JN6A 3HOWJ 4V2FA 3JRIA 2LFBA 3VPRA 4BXXJ 3TW6A 1XS9A 1HF0A 4RBOA 1BA5A 1JT6A 3GTJJ 1XC5A 1LE8A 2ELKA 1ETXA 1GV2A 3BT9A 3JRAA 1BW5A 5F04A 1AU7A 3E7LA 4A69C 1O4XA 2R0QC 3S1NJ 2DA2A 1XG1A 3BR5A 1OFCX 3PM1A 2ID6A 2YU9J 2Y9ZA 1I50J 2XPVA 2VI6A 2HOTA 4S0HB 1Y1VJ 2FQ4A 3BR1A 2NVYJ 1ETKA 5J3LA 5C4JJ 2JWTA 1MSEC 2O8KA 2XGCA 1QRYA 3S2HJ 3ZQLA 4W1UA 4M3BA 3A02A 1POGA 5K7FA 4DW6A 1T33A 3WHBA 4IHWA 1HDPA 1U9OA 3B6CA 3BG5A 4HNVA 5C44J 2DJNA 2NOGA 1ETVA 3BTJA 1E3OC 1OCTC 2HXOA 1TC3C 5DS9A 3JRCA 3S1QJ 3Q3SA 2O7OA 4I6ZA 3LNQA 1TWCJ 1LE8B 3K2AA 3Q0WA 3LSJA 3B6AA 2CUEA 1VFCA 2VPRA 4JX4A 4A3KJ 1MBKA 1TWFJ 1JJ6C 5HODA 3OOUA 2WAQN 3QQAA 1SFOJ 1JKQC 2WV1A 2R93J 3BTCA 1JKRC 1F36A 4A3MJ 5C4XJ 2R92J 2MGQA 4DZJA 5IYCJ 2NVTJ 1VF9A 2CU7A 5EZHA 5EEAA 1AKHA 2XB5A 1VNDA 2JA7J 2HXIA 5F0FA 1ZR2A 2JA8J 1QVTA 2E2HJ 2NVXJ 3S1RJ 3HGYA 4XRMA 3RKQA 1NTCA 3A01A 1CQTA 1FIAA 5E3OA 4D7NA 2RAEA 2KDZA 2DA6A 2ID3A 2LVSA 3OSFA 1ETQA 2G0EA 3DCFA 2FJ1A 3CQZJ 5FLMJ 4A3BJ 2LKXA 1S7EA 1G2HA 2EQRA 2FX0A 2VKEA 4D7MA 1W0UA 1JKOC 1ZTRA 1JTXA 2JA6J 4XRSA 4BY7J 1TWAJ 4XRSG 2LD5A 1W0TA 4B1RA 2IAIA 5IYBJ 2HQ5A 3RQIA 5E3MA 2L0KA 1UG2A 3LOCA 2LK2A 4A3LJ 3ZQGA 2M34A
chains in the Genus database with same CATH superfamily
1OQYA 1GVDA 2XAUA 2H8RA 2DYRH 3HC7A 4PUSA 2DJIA 2QQ8A 2FQ3A 4DJAA 3RCOA 3P5JA 4MLOA 5KCMA 4AYBN 4P5OA 2HOSA 2H6BA 5JHUA 3OYEA 4ESBA 1V55H 1TNTA 2LRDA 2XRLA 4LG0B 4BHBA 1DDNA 4RB0A 2LLKA 1ZELA 3LA7A 4IQJA 4IOCF 1O3QA 5FLVA 3HHGA 4ESJA 5M5YJ 1LB2A 3K10A 3FBIB 1WRJA 1TT0A 5GAEJ 3JRBA 2HPMA 2LF8A 2MSYA 3K9TA 4PZJA 3FXQA 4KT6A 3S2WA 2MH2A 1D5YA 4V2GA 4QIWN 1BOAA 2DDBA 3DPTA 3EYIA 4HDUA 3ZXSA 5M3FJ 2F5VA 1FYMA 1IDYA 3PNTA 1D0ZA 3HGGA 4UUSB 2DTRA 3SJMA 2OV7A 1T95A 5LFAA 2HDWA 2VOOA 2JPCA 1H89C 4LFUA 3HOTA 2DQRA 1ZGJA 1EJ9A 2HEOA 2PX9A 3H9QA 3AAFA 2FSWA 2XSJC 2LY2A 2UUZA 3M7GA 4B09A 1FEXA 2X1EA 3WTVC 1TT5B 2QQAA 3DBRB 4ITVA 4FT8A 4NB5A 3FDYA 3BR0A 1LKXA 2NXNB 3CZ6A 4C30A 1G8XA 1A6IA 1UCRA 4J01A 2EIKH 5BQTA 3LSPA 2DMTA 1KU7A 1PP8F 2DA7A 3W2WA 3OYNA 1MBGA 3DU5A 4EMSA 4N9IA 5D5XB 9ANTA 4B3AA 1RZ4A 2NVUB 3S3MA 1IGNA 1V4RA 2MW8A 1E3HA 4IPAA 5E3LA 1GDTA 5GAHJ 3SYTA 4CCOA 1T6SA 1FYLA 2ZNYA 2QBYA 2WB1A 4DNCA 2PG4A 2EILH 2V6CA 2YPRA 3CDLA 5KK1A 3C2GA 4QTRA 1VTNC 1PUFA 2PJRA 3IV5A 1Z91A 2COMA 1S3JA 2HKOA 5ICGA 3TDZC 3L2VA 1H9TA 1FMWA 2LTPA 5GTHC 1IZ1A 2EFPA 1LVAA 2QWWA 1HKTA 3I5UA 4TV7A 3FXLA 5H20A 4R79A 4CCNA 1Z7UA 1P7IA 4Q5SF 1GXQA 4L9NA 5M3MJ 1K61A 2A07F 2V1NA 1OMIA 5D6EA 3F8FA 4ASNA 2CWEA 3LQQA 4CZCA 2DFIA 4OWRB 5J1RA 5LHGA 2HYFA 4HW0A 5DD4A 1Z7LA 3BLYA 1XDSA 2OPTA 4LK1F 4C2TA 2CV0A 5CVIA 3M3YJ 5EDNA 2LY9A 4Q48A 2PEXA 2ME0A 2K3FA 1YE9A 3L09A 4ZTJA 4K2EA 3RQ4A 5LBQA 4WXHA 3FXMA 2EIMH 2ISYA 3CCQI 1UHSA 1WCMJ 1OCCH 1S7AA 3TO9A 2HDDA 1LFUP 3E6CC 2H1KA 3DTEA 2V6EA 3DP7A 1FLIA 4HRIA 3S16J 3KP7A 2NNNA 1W36C 3W2AA 5CLSA 2XB0X 4MFDA 4UHTA 3OYHA 4FX4A 2R5YA 2RGVA 4PCQA 3W6KB 2DTZA 1B9MA 2OUMA 3ZR8X 2CS3A 5DEQA 4FE4A 4IZZA 1IN7A 2VONA 2Y0SA 2Z16A 4XLCA 1K6YA 4UY8I 4H4KC 4E7LA 1B8IA 2M2EA 2VBZA 4M6VA 2GM4A 5HNFA 3TP3A 2R7TA 1QZYA 2DMQA 1FBSA 2HZDA 2WB1N 2CW8A 4HAMA 1HBXG 3R60A 1D5VA 3VFZA 2HTSA 3HG9A 4A5NA 4ZYAA 5F1JA 1G3WA 3GXOA 1KU3A 1YJWI 1ON1A 5ILVA 3CCYA 3U1DA 3CMYA 1B72B 2M8EA 5E79C 2MLGA 2Z1DA 4PGGA 5M5XJ 5E18F 2KMUA 5IP9J 3QRFF 1DP7P 2JK3A 2OF7A 4U0WA 1Z6RA 5DCMA 3RTRA 4AD9A 3VYSB 1X4OA 4DQ2A 4MTDA 1H88C 2JVGA 2VIXA 2M30A 3TKYA 4G12A 1AHDP 1X4PA 1QZEA 1UELB 4NC6A 5EGOA 1PUEE 4F91B 4E7ZA 4FE7A 2Y75A 4LIVA 3ZN1A 1YOVB 2Y0MA 4O5VA 1WWXA 3GEZA 4RM2A 4MIMA 5IT3A 3R4KA 4HX4A 2V1XA 1EF4A 5LRRA 3JRDA 4JX5A 1R1TA 2JA2A 3LSMA 2LYCA 4GRIA 1VQ5I 3L00A 1X1AA 2BW3A 1USTA 1IV6A 3RKYA 3CP8A 4M9SA 2VXZA 3QU3A 3OY9A 3K7AJ 2VQHA 3PO2J 1JUSA 4XM3A 3PQJA 1BW6A 2V9PA 1VQ4I 4E7KA 2Y9YA 1U5TC 3F8BA 4RS8A 5ICEA 2DO7A 3PO3J 4PFOA 1MKMA 3H9JA 3LMMA 2K86A 3AG1H 1XMAA 2D1HA 1YTYA 1WI3A 4LOCA 2LP0A 3IL2A 1JJ8C 1OPCA 2FU4A 5ERIA 2CQKA 1FTTA 2VE8A 2IS6A 3B73A 4ZYHA 1OR7A 3PIOF 4I2OA 1MMAA 1W7PD 2EBIA 2CV1A 1V54H 2W48A 3K70C 2Y0SN 1UB9A 2DK5A 4ZYGA 2HVQA 5E3NA 5IT9Z 4IVNA 1GLNA 3BWGA 5B3SH 2BY1A 4O6JA 3GUDA 1X2MA 3CLOA 2EZKA 4N9HA 1MDMB 1Y0UA 2X6YA 2Q8KA 3I9V2 1P4AA 4ETSA 1D3YA 2ZC2A 1FIPA 4FASD 5LHIA 2B9SA 1I3AA 3FBNB 2P0WA 3E0JB 1GV5A 1XGOA 2CUFA 5FFZA 3ZQQA 3GTKJ 4WXCA 3JAMZ 2XF6A 3OR2C 2A6HF 2CUZA 3CDIA 2CW7A 4CA0A 4D1QA 3H0DA 1J59A 2HFHA 1XGNA 2TDXA 3F72A 3MN2A 4EM1A 3DBHB 2K40A 5E1XA 2PJPA 3F3XA 3RPUD 5IOZA 1E3PA 1TZLA 4I01A 1D0YA 3KCCA 4XORA 2XVCA 3K4JA 4FCYA 2OTLI 4IRIA 5L3EA 2FD5A 2R7QA 5EJCA 4KIFA 1QPMA 1YX3A 5TGTA 4OIPF 4XMYA 2ACJA 2BVMA 3ULQB 2M9HA 4OIRF 3WHCA 2X85A 2FNAA 5J1YA 5HDNA 1F9NA 5DUKA 3BR6A 5FD5A 3X2QH 2COBA 3FMSA 3IH2A 3J81Z 1VQKI 4XLNF 2EA2A 2ZBKA 3L9FA 3MEXA 3BR3A 1U3EM 1TWHJ 4I98B 1HXDA 2XAFA 2NVQJ 2HYJA 2JN6A 3HOWJ 4V2FA 2WWYA 2WY7Q 1U5TA 3VDXA 4RBOA 2DI3A 3H5NA 3SZPA 1XSXA 2GOMA 5HLGA 1JHHA 3H35A 3DWLE 2K3PA 2KKOA 4CH7A 2IS2A 5DM7F 2J5OA 2EFOA 4EJOA 3TBIA 1BOBA 3BT9A 1BW5A 2XRNA 3E7LA 3HKZA 4S04A 1O4XA 4RLQA 2DA2A 4PJJA 2DT7B 3T5XA 2E7XA 2YU9J 2Y9ZA 4PJLA 1KYWA 1I50J 1X19A 2AQFA 2HOTA 5J40A 3DKYA 3BR1A 3E3VA 1ETKA 2M3AA 4I0AA 2JWTA 5D8KB 2O8KA 4XKCA 1YFHA 1DUXC 2XGCA 2ZMEB 3E97A 3NWTA 2IT0A 2CMPA 3IAS2 4M3BA 3A02A 3CJRB 2X6XA 2EB7A 3ERMA 1HDPA 3GLXA 3B6CA 1YG2A 4HNVA 1H9GA 2VBXA 3BTJA 1VQNI 3LQRA 1JXSA 1TC3C 1B1BA 2JRTA 2O7OA 1LE8B 4H0EA 2FRHA 2WA0A 4LD5A 3H5RA 4OAZA 2CUEA 4BJTA 5KNLA 1VFCA 2VPRA 3GZNB 4A3KJ 1JJ6C 1TWFJ 2ZCWA 3H3ZA 5HODA 3SEQA 1ZREA 1G3SA 3OOUA 3CO6C 1JKQC 1T98A 2M45A 5EEGA 3KYDB 2ZO4A 2IA1A 4ENMA 3K69A 1JKRC 4UNOA 4A3MJ 2A6TA 2JQ7A 2FUG2 3KLOA 2MGQA 4DZJA 4YFNF 4N4OB 3V7SA 2QQ9A 2QA4I 1VF9A 4EQQA 2NVTJ 2E1CA 4HLYA 4HNUA 1QU3A 5EZHA 2W1OA 2VBYA 1VNDA 4NQWA 2HXIA 4BEHA 5F0FA 2JA8J 2E2HJ 4XRMA 3BZ6A 2LH9A 1FIAA 2DFHA 4GYIA 5HLIA 5EEHA 1Z3YA 2KDZA 2DA6A 4AIJA 3OYKA 1NG7A 3V8LA 3RI4A 1D8JA 3OIQA 2IP2A 2GXAA 3GFJA 3CQZJ 2FJ1A 4AIDA 3AG3H 5L3FA 1P2FA 2VKEA 4D7MA 3BZCA 2JA6J 4XRSA 4E7JA 2W4SA 1FZPB 1YITI 3ZCOA 1R00A 1TQIA 5E3MA 2DDAA 3KFWX 4PJNA 1UG2A 1MMNA 3HUGB 3LOCA 4YIIA 4E70A 2RC4A 3ZQGA 1J2XA 1TBXA 2HOAA 2EPFA 3DEUA 4A6DA 1JT0A 4L9TA 2X9DA 1WH5A 2Q2EB 3HL2A 1PYVA 3WGIA 3GYHX 3WTWC 3SZTA 3K4MA 2AS5F 3A01B 2KHMA 4HF0A 1VI0A 3LSIA 2VUMJ 3GTOJ 5DTDA 2DBBA 3GTLJ 1ULYA 3RPQA 1Z05A 5AONA 2VC0A 1KQ9A 3FM5A 5HS8A 4PSWA 2JPBA 2VPLA 1Z0XA 2M1BA 2VJJA 2XGEA 2LDUA 2HTJA 3WTUC 3JREA 4N0BA 2KIFA 1IXSB 3HB9A 4KUMA 1EA3A 1QVUA 4FTHA 2FF4A 1ZYRF 1KA8A 3LSKA 3KP3A 2OAZA 2QCOA 3CC7I 1ONVA 3I4MJ 2W00A 3TP0A 3DEWA 1BL0A 3HEFA 4XOPA 3I4PA 3QOPA 3G3ZA 2YS9A 4D5FA 2ZXIA 1N78A 5E8GA 3HPHA 3OYLA 4CCMA 1QA6A 2LG4A 2ZJQF 3CC4I 2K4JA 2LF7A 3SHFA 5ICFA 3AG2H 3DEEA 2X48A 1RC9A 2DMUA 2B0LA 2E71A 1O7LA 2TRTA 3PSFA 3G1MA 1J7KA 1YQAA 4MQ9F 3W2VA 5IPAA 4BHPA 4RGXA 2K9QA 2BY2A 2OCCH 3ZQCA 5JLXA 4X0GA 4FISA 3T8RA 1FJLA 5IYDJ 3GZ5A 3G2BA 1ZH5A 1B59A 4F52A 1YRNA 4FQGA 1UJ8A 2NRAC 2KIQA 3OYIA 1BR4A 2R7OA 4KDPA 4FX0A 1JKPC 2ME6A 3OR1C 1J09A 1WVRA 4IJAA 4DBQA 5HLTA 4IHYA 1IN6A 1K83J 4RB2C 3QPHA 4Y33A 2FOKA 3BQYA 4UVAA 1J75A 1YW7A 4AWXB 1MJAA 2BEOA 4F7ZA 2L7MP 4PSXA 2FBIA 3EYYA 2MG4A 3SQNA 4IEJA 2UZKA 2P6TA 1WQ2A 1U6GA 2FXAA 4KJZA 3FIWA 3OYJA 3IC7A 4A0ZA 3J7ZI 1RKWA 4YG2F 3E5XA 4BACA 4HPQA 4Y4RA 3Q5FA 3H0GJ 2HWVA 1Z3XA 3KX2A 4XBFA 2LREA 3BCBA 1P6RA 5FLXZ 3QP6A 3ZMDA 4RGUA 3M4OJ 2LBFB 4U87A 2V9KA 1MSFC 1M1EB 5HOOA 3CCSI 4C2UA 3I56I 1WHUA 2VODA 2ZJRF 1MMDA 5HDGA 2D2WA 1KU9A 1H8AC 1ZARA 5DCFA 3WTSC 2M4GA 2OBPA 3U21A 1T8IA 1QGPA 3OMYA 3ZQFA 4QLCU 1HW2A 4IX7A 3MFKA 1IRFA 1OCRH 2DMPA 2P4WA 2R5ZA 1TTYA 2V79A 2IA0A 2EJRA 3ASOH 5JLWA 1RR8C 2E1MC 4ZZDA 2VQCA 3CMMA 5B1BH 1N25A 2KRFA 2RNJA 5CVUA 3RZOJ 2O61A 3KP4A 1K78B 5BNGA 1ZN2A 1UAAA 1I5ZA 4CZZA 3CUQC 1Y0NA 4OOIA 3MKLA 1H0MA 4A0YA 3BJOA 2AXLA 2N8GA 3M1EA 4NUBA 5M5WJ 3E6BA 2ECBA 3BG7A 1HA8A 3RYPA 4IHXA 5HS7A 2ZKZA 1R4MB 5H2FC 3BJ6A 1UMQA 3GMEA 2KJBA 4HF1A 4XOTA 5GPAA 3WGHA 5FKOA 2A5YB 2XPWA 2BVLA 2LSOA 3Q0VA 1ORKA 3HYIA 1BIAA 1U2WA 5EG0B 4IO9F 2L3DA 1R71A 4BL0B 2RV8A 1P92A 4I0BA 2Z5UA 3HBLA 4C3IJ 1A36A 4A93J 1I1GA 1R22A 3K1NA 1VQ8I 5IT9K 2K9NA 1WJDA 2L9RA 3IWFA 1XCBA 2F4OB 3IUOA 4XLPF 2Z99A 5K7HA 3E6MA 1EH7A 4G6TB 4BQQA 1MBEA 2BY3A 3F6VA 4UV9A 5J47A 1ZHFA 2H1LA 3N97A 4I02A 3TDUC 4BBSJ 4DOZA 4HV6A 1TP4A 4IHTA 1X1BA 5C3EJ 1Q1VA 1YIJI 3GCMA 3GF2A 4KN4X 5IP7J 1BM9A 2XAGA 3TOBA 1DPRA 3MZHA 3L2WA 1IV8A 2JVHA 3LSRA 4IF4A 4D5CA 3KP2A 3I55I 2FMYA 3CCRI 1S5LC 1BJZA 2HZTA 2K27A 3BTLA 4HA8A 5CJ9A 3N05A 5IOYA 3J80Z 3UKGA 1Q1HA 1XSDA 4A3EJ 2XGXA 2E19A 2GBYA 1S8NA 1ZKGA 4HX8A 4CCJA 3L2CA 3GTMJ 1HSJA 4L5IA 4J00A 3S8PA 1XN7A 2EZIA 2QSGX 2PBIA 1FOWA 5B1AH 1XD7A 4Z6YA 2X51A 5LD2C 2HYGD 1NK3P 3WODF 2LR8A 1JI8A 3QOEA 3ZOBA 3EUAA 3J81K 3HRUA 4OMYA 4BQAA 3TQNA 3TOAA 3ZMVA 3K1MA 2F5EA 3L1PA 2DA3A 2IGOA 3HRTA 4BGDA 2NS8A 4QPOA 3CUQA 4XKVA 3G1OA 2XASA 2CG4A 1ZQ3P 3H36A 5F0CA 3DF8A 3BP8A 2I5UA 4XKBA 1ZGWA 3GTPJ 4XLEA 4JYKA 3NQOA 1FP2A 2DMNA 1UHMA 3HPGA 5FJ8J 1J9IA 3DLLF 1X3WB 2CW0F 3FKIJ 3VYTB 3NRVA 4RA2A 3H5AA 1FYKA 3SFZA 4BYYA 1YJ9I 3VWBA 1YW8A 4U0YA 1T56A 1X1PA 3A1YA 2XKPA 1IN4A 3I3LA 4CYCB 2VT2A 3OYGA 3TW7A 2XF5A 3K70D 2VOPA 4ENNA 4B4CA 5J6XA 3MD2A 2UXXA 3DKXA 3M8EA 3MWMA 1BJAA 3EUHC 4KMUX 3LSHA 4GYGA 5TRDA 1R49A 3CJNA 2XSDC 2KDOA 1QHGA 2UV1A 3GFLA 1VQMI 1GT0C 4L0YB 2L5QA 2WAQA 3W6JB 4JP0A 2BZTA 4B44A 4E7SA 1W4MA 2DA1A 2PFBA 4RMNA 4BJ5C 3CCEI 3FXOA 4CO8A 3O8HA 4DYCA 4CXFA 2XHKA 3TEDA 4CCLA 3GTGJ 1WH7A 1O3RA 1OJLA 4UUTA 3NARA 5CPRB 4KITB 1ZRDA 1IN8A 1ZR4A 4HG2A 4IHVA 2BXZA 1HW5A 2HQAA 2K9MA 2MH9A 1V5GA 4G6QA 2PLYA 2LFBA 3V8JA 3VPRA 4D9JA 3J7YJ 3TW6A 2H8WA 3DV8A 1XS9A 2YR2A 3L2RA 1UFMA 2OU2A 1BA5A 4Q47A 4RAZA 4YIFA 2VXDA 3CF2A 3GTJJ 3PIPF 4XONA 2ELKA 4B47A 1NG6A 3KZYA 3QWLA 1GV2A 4G8XA 3K4LA 3I58A 1STZA 2HGCA 3LA2A 1X3UA 2Z3YA 2R0QC 3S1NJ 5ICCA 2JSCA 3ONQA 3BR5A 1IRXA 3PM1A 3OYAA 3OS1A 2K85A 4CUGA 1XB4A 2BYVE 2BE5F 2VC1A 2VI6A 1J5YA 2XPVA 1W7PB 1Y1VJ 2NVYJ 4RAYA 5J3LA 5C4JJ 4A5MA 4II2A 3A0HC 1V5EA 3ZQLA 2FMLA 2NNYA 4W1UA 1XPXA 3I59B 1SVMA 3C2HA 5E20A 4C9YA 3IRRA 1T33A 3DPLC 3ZRGA 4BH9A 4Y15A 3BG5A 5C44J 1WJFA 1NH3A 2CQNA 1E3OC 3G71I 3WE2A 3ABUA 2E60A 1O3SA 5FB2A 1MIJA 5DS9A 3Q3SA 4I6ZA 2HDCA 1X3ZB 3K2AA 3QYBA 3LSJA 2EIJH 3VB2A 1UG0A 2FBHA 2K9LA 3I53A 3KPHA 4MGRA 2STTA 2KPMA 1MBKA 3CP2A 3MMYB 1S7OA 2WAEA 3F6OA 4B8XA 1T38A 2DAOA 2WAQN 4BNCA 1OYWA 5HVQC 2QYOA 2R93J 2X4HA 3BTCA 2KRCA 4HYEA 2IA2A 3CD6I 3WGGA 1F36A 5C4XJ 4XSXF 4MQVA 1TW3A 1R5ID 3COAC 3VOEA 3BCAA 5IYCJ 4G7OF 2V4JC 2ELJA 4ZZLA 1R58A 2J5PA 5EEAA 3F23A 1A35A 3ZP5A 1RUNA 1R5GA 1ZR2A 3HOSA 3LL7A 1D1CA 4YELA 1R36A 1TLHB 3CJQB 3SXYA 1CQTA 1VQOI 4LG0A 2JRMA 2RAEA 4ZH4F 1MGTA 5FRMA 4G94A 2GWRA 1TW2A 3PQKA 3ECOA 2LKSA 1E0EA 1LNWA 4IRGA 2V1DA 2LVSA 1ETQA 2OZ6A 3DCFA 2XIGA 2ZSHB 3ZMSA 2K02A 2YSRA 2LKXA 2QGUA 4UXNA 4Y3OA 5HLHA 2R3SA 1W0UA 2A6EF 4RLFA 1A31A 1BR1A 3MCZA 1TWAJ 4XRSG 3HRSA 4B1RA 1Z67A 5IYBJ 1MW7A 3RQIA 2L0KA 2KL4A 3KE2A 4XN3A 2FNPA 2VJ4A 2MYSA 3T0YA 2BXYA 1J0RA 5J4VA 3ZMUA 2RVCA 2HS5A 2M34A 1V3FA 4UUSA 3A2KA 3WTYC 4JK1X 1WJCA 1AKHB 3OIOA 2QUFA 3FXRA 1IC8A 3K1PA 1BBYA 4M6YA 3EPZA 4KFCA 1ZRCA 2DA4A 3RSNA 3N4MA 3RKWA 3I0TA 1L3LA 2CGPA 1AOYA 5DUIA 3ABMH 3LAJA 3ZQHA 4W97A 3SEZA 2DLLA 2VJIA 3FMQA 2A05A 5JI6A 3IWZA 2DFEA 3S32A 2HI3A 3ZMZA 1MJ9A 4IHSA 3DBLB 1BC8C 3KP6A 4AM3A 2JT1A 3B02A 2ZFWA 2H27A 4XICA 3LAPA 1P4XA 2WBMA 2IS4A 2MLKA 2KZVA 5J1UA 4A3CJ 4U7DA 4C3HJ 2BHZA 1R6RA 3NWSA 3M07A 1SMYF 1HLVA 2W24A 1D8KA 3RZDJ 2HR3A 3M8JA 4S05A 1T39A 5FKNA 1OLTA 3S1MJ 3LSTA 2E5NA 4BE2A 5L3CA 1I1SA 4YRVA 1DU6A 1RPWA 5A2QK 2XC7A 3F21A 2RDPA 4X1EA 2A61A 3ASNH 3F8NA 5D5UB 4ZDPA 1JGSA 5DV5A 2E2JJ 3C18A 3PSIA 5FLXK 5LHHA 4OAYA 3WU1B 5DYMA 1SVOA 3WTTC 2W84A 2AHQA 3HOUJ 2Y30A 5BOXA 1WGXA 2ZSIB 2CQ7A 2D45A 3AFHA 2GIVA 3C2BA 4CDGA 4B43A 1IG7A 5FKLA 2BY0A 4UB8C 2MD0A 1G4DA 3R61A 3JSPA 3GO5A 4C3JJ 2IXSA 2OZUA 1XSVA 1FY7A 2X0LA 4IOAF 4G9YA 2E1NA 2RQQA 2RNGA 3CJTB 2QSHX 5F64A 3P7NA 1IXCA 4I7HA 1BI2A 1SFXA 4WXDA 4Y13A 1YHQI 1Z9CA 4AU7A 2WTEA 1HDDC 3CESA 2E35A 4M6XA 2HOEA 3H3VK 3T8TA 4DYRA 2YU3A 3WU0A 2V7FA 2ZXJA 2XDVA 1LVKA 5K7ZA 4EM2A 5BPDA 1YJNI 2XROA 4XIDA 2K5CA 1MBHA 1I3QJ 4EV0A 4RB3C 4M3EA 4BQNA 4EEFG 1MMGA 2E1OA 4HOBA 4LB5A 1QHHD 4XLHA 4M73A 2ZNZA 3D5LA 1SD5A 3HHHA 2DFFA 3EQLF 1B4AA 3DPUA 3Q9VA 4OIOF 2EZLA 3HKZN 3F9KA 4A2UA 2IGNA 1FPQA 2XAQA 1WZ2A 3GBGA 2KZGA 5TJJA 1A5JA 2HU9A 2XV4S 3D5RC 4BHCA 2QBYB 3U2RA 2KT0A 3S3NA 1C0WA 3REOA 1PVEA 2LKPA 3I4NJ 2YUSA 2KP6A 2HQNA 3LFKA 1AA7A 4XL9A 4XRFA 1PUFB 1B72A 5ILSA 2PJRB 5HS9A 2VASA 1FBQA 4PFPA 3JCUC 3ZQIA 4ZYDA 2A69F 3VYRB 2QF7A 3T1BA 1Y1WJ 2O8XA 1FP1D 3KYLA 3HM5A 4EJUA 3H92A 4NDLA 5FRNA 4X6AJ 4A3JJ 1ZG5A 4CHUA 3IH4A 3ABLH 2M7BA 4OINF 1RESA 3HOVJ 3J7AO 2XAJA 2XAHA 4ABZA 2YX7A 2IRFG 2ECCA 1LFPA 3S14J 4LIUA 3LFUA 1W5SA 4LLLA 4GFBA 3BY6A 5JVTA 4M3FA 1ZAOA 1IO2A 3R0JA 3OL3A 3OV8A 2ZJ2A 1BI1A 2EWNA 1F43A 1TNSA 1RKTA 2CFOA 2DT6A 3FXKA 4OIQF 4UVCA 4YFKF 5FD6A 1TQPA 2OA4A 1VQ9I 2EINH 3WG7H 1XDUA 2M8GX 3FXUA 3QAHA 4ZJZA 4KMFA 2L02A 1P4WA 2IBDA 2LY1A 1ZRFA 6PAXA 4N4NB 3SDGA 3F8CA 1DU0A 2R5YB 1F1ZA 2GLOA 5E1WA 2ZB9A 2FA5A 3FK6A 1PP7U 1K79A 5KAFC 5EYRA 3MZ8A 1SAUA 1FBUA 1UZCA 2STWA 5ILUA 3BOQA 5K5QA 3KZZA 3ERED 3CUOA 2R7RA 3DTKA 3BQZA 5IY5H 1B8IB 1LEAA 4KYWA 1HC8A 1MDMA 4BXFA 5D5VB 1MD0A 2ZMEC 3BG9A 5HDKA 4EM0B 3DKWA 3HDDA 2A68F 2HNHA 3PNVA 3QYEA 3E6DA 2XPUA 1FTZA 2BOLA 3L2QA 3ESWB 4HSRA 5F0HA 5F27A 1OCPA 3HSRA 2EFQA 4G7ZF 1AWCA 3FXJA 2NS0A 2IVMA 3TMOA 4HBLA 2P7VB 5DDGA 2W85A 3SDBA 1K4TA 2DA5A 5LEKA 5DCMB 3ROUA 3OIPA 4P55A 2ELHA 2MD5A 1BR2A 3NEUA 4RM3A 3AL0B 4E7IA 1JTYA 2EZHA 2NOJB 5EGOB 2BBYA 3OYMA 4UVBA 2KLOA 3CCUI 3KEOA 1FSHA 4Y52J 5BS6A 1U78A 2H09A 3UNGC 5LGNA 4LGWA 1OYYA 3IKVA 4WX9A 3ISPA 2L9VA 5AIQA 2R7UA 3QPLA 1P7JA 3KIOA 2GZWA 3D1NI 1VQPI 3ABTA 1DP3A 1IUYA 3IH3A 4JX6A 3JRFA 4J19A 2Y2ZA 2I8DA 3DTIA 5DD8A 2M4KA 1EKEA 2ESNA 1G3TA 2WAFA 3HTUA 1U9NA 4WWCA 1U0JA 1O3TA 3A0BC 2VBWA 1IN5A 2Q0OA 1MBJA 2R7XA 2ETHA 4HF2A 3FISA 5CKTA 2LOOA 4EGZA 2K4BA 2OC6A 1GHCA 1G59A 2HPIA 2H6CA 5FKKA 2CUJA 3PUBA 3HOXJ 4HZFA 3JRHA 4JOMA 4M9ZA 3IP4B 2Y31A 2VT3A 3W6VA 4FHTA 1R5HA 1APLC 2E34A 1QNTA 4XQFA 2WADA 3L2UA 2O03A 2GAUA 1YI2I 3IHUA 1XGSA 3V7CA 2P5VA 2Y48A 1K7AA 1GUUA 2ICWG 1NK2P 4I76A 1MH3A 2ZMEA 5J8FA 2FE3A 3DFGA 2XF7A 1WJBA 5B5EC 3M8FA 2CV2A 4GDFA 3JRIA 2DQLA 2DYSH 4BXXJ 3CCVI 1O57A 1HF0A 3KEYA 3C1DA 4RAGA 3KETA 1NHAA 1W36D 1JT6A 1FMVA 1LE8A 2H94A 2DU9A 3PFIA 3O2PE 2GOXB 3CCMI 4PGHA 3ELKA 1ZLJA 1ETXA 2PN6A 2QKLB 5DM6F 4BS9A 2GXGA 1BC7C 4KN7X 4WK8F 3S3OA 2DW4A 4NHJA 4M71A 4BQOA 3BROA 1Z6TA 4A69C 2G7UA 1SVLA 2EK5A 2L54A 4QWQA 4U7BA 2R7WA 1LDDA 1OFCX 1FT9A 4KISA 2ID6A 2ZXWH 2CYYA 2MFZA 5L3BA 1S72I 1LDJA 4CICA 4DGWB 4ESFA 2FQ4A 3QODA 4A6EA 4NBQA 1S29A 3S2HJ 5LEJA 3JAMK 1IRGA 4FETA 3D5SC 3OYFA 1POGA 3TO7A 2M87A 1SC7A 4XLFA 2P7CB 4IKFA 1I27A 1U5TB 2DJNA 2NOGA 1OCTC 2PQ8A 5F6FA 2HXOA 2M5WA 3S1QJ 3FMRA 1TWCJ 2X1DA 5LRSA 5CVVA 4NC7A 5BPIA 4JX4A 2K7LA 1LJ9A 5HNHA 1SFOJ 3GW2A 4RGSA 3BZKA 1UHWA 4E4HA 2ISZA 4IXAA 4G7HF 3K4NA 2DPUA 1BI0A 3GVAA 3CDHA 4LK0F 3I64A 5K5OA 2O5RA 1HKQA 3HUGA 2R7VA 1KQ0A 2F4IA 4E7HA 1SAXA 2FOWA 4Z2YA 2F4MB 2DCEA 2Q2EA 2RQPA 3DU6A 3FM3A 5LGUA 4F3QA 4BE1A 3AL0C 2JA7J 1MMSA 4NNJA 1QVTA 2NVXJ 3GLLA 3HGYA 3P9IA 5H6QA 5KAIC 3RKQA 1JE8A 3A01A 3CMEI 3FF5A 4D7NA 2O6GE 3GWZA 3E1SA 2RN7A 4BDZA 1IAWA 4IQ4A 2MABA 3GFMA 4F55A 1D0XA 2ID3A 2JTVA 2D1VA 3KEQA 2VKHA 1K6OA 2IS1A 2O0YA 1ZLKA 2EQRA 2FX0A 5JHFA 2L4AA 1ON2A 1JTXA 1REPC 4JBAA 1E2XA 1A6QA 1N77A 2LD5A 4R8HA 1OCZH 1X1CA 2IAIA 2EV6A 2M0MA 1V5FA 4O3MA 1QPIA 1YIOA 3KLNA 2XGDA 5FKMA 3IKTA 4ZC3A 4B3XA 1OR7C 4NQWB 4BEHB 3GZ6A 3S15J 4F93B 2JJ7A 1JGGA 1ENHA 1N75A 4PJMA 3ZPLA 3F8MA 4UUVA 2CSOA 3JW4A 1BIBA 2HVRA 2D5VA 5K1YA 3HSEA 3MZYA 2E5ZA 1LDKB 3DQVC 4M3DA 4P1WA 2EV5A 3TO6A 2XKOA 4MEYF 3ABKH 1XMKA 4L18B 3KYCB 4G6DA 1XMXA 4XLAA 1IRZA 3VODA 4PDKA 3MAJA 4HLXA 3SFIA 2OQRA 5LGTA 1FSEA 4MEXF 4CCKA 4LG3A 5GAGJ 4BUPA 1VZ0A 4CSWA 4MFEA 3CMAI 4RAFA 2Z9OA 4BBRJ 3KZIC 3ZQ7A 2OTJI 4AVPA 1G3YA 2L4MA 1WFXA 2PMZA 5E17F 1I6XA 1RRJA 2F2EA 4E6KG 1LUJB 3JSOA 3I54A 2BHYA 1F4KA 1ACIA 5GP9A 4BXUA 1Z77A 5KHDA 1SD6A 5J8CA 2VB6A 2L9NA 4R1HA 3MKZA 2F6CA 2DPDA 4L9JA 2ESHA 3PL8A 2MBFA 4LLGF 2L7FP 5JR3A 1SD7A 5D6FA 2IPQX 2HQRA 1YYVA 1KZHA 4M72A 3V4GA 1ZG3A 1HQCA 3DXJF 5EF6A 4HEA2 3AG4H 1ZGAA 5D4SA 2IW5A 3PNYA 1VQ7I 1MH4A 2DN0A 4IRHA 4L5JA 1LFBA 5FGMA 3K4CA 4L0ZB 2LBFA 1SFKA 2DT5A 1FX7A 2E7WA 2Y69H 3JRGA 4P96A 3FK7A 1SMTA 2K9SA 4P9UA 1CF7B 2R7FA 3G6EI 3LSGA 4IL6C 1ZK8A 3EUHA 3D0SA 1EH8A 3RIRA 1WKMA 1W1WE 2F48A 2KFDA 2X6OA 1HCRA 5TISC 2OQGA 3HOYJ 2KRHA 1SD4A 3V8KA 4CGZA 2EH3A 4A3GJ 1ETYA 2CJJA 5D8LB 5F08A 2Q1ZB 1MBFA 3OWTA 4BAYA 2B63J 2F5FA 2JUCA 1LEBA 4ENJA 2E2IJ 2ZFUA 3HRMA 1RR7A 1T0FC 4AUXA 3ZGKA 2W82A 1IXRC 1L0OC 3A03A 5L3GA 1OCOH 1K78A 2VKVA 3JR9A 4HNTA 1TWGJ 1YRNB 3MKYB 3RDIA 2XUBA 1OKRA 4EJWA 1X2NA 1T2KA 3E5UA 1D1AA 1ETOA 2IJLA 2PMZN 4CYDA 4ON0A 3Q0UA 4BKXA 5K5RA 1HSTA 1U8BA 2PMUA 2L7ZA 4UV8A 2QM3A 1U8RA 2E36A 1WJAA 4MO7A 5JVGF 2GXBA 3MVPA 3V7RA 1IUFA 1FWZA 1ITYA 1IDZA 3BPXA 2DOEA 3FHZA 1QZZA 4MTEA 1JUPA 5EG0A 1GXPA 1MNMC 2A3SA 4F92B 1F5TA 1EH6A 3MQ0A 3CCJI 4A3DJ 1Z1DA 2RREA 4HSTA 3S2DJ 2G7HA 2DOAA 1Y8QB 3HSFA 5CYVA 4II3A 1MZBA 3O3KA 2CFXA 4KICA 1IW7F 4U0VA 3NAUA 4QSHA 1BN5A 2VN2A 2QLZA 4L5EA 1RUOA 4BY1J 4A3FJ 3S17J 3BPVA 1IJWC 4YFXF 1LQ1A 2JMWA 2VL8A 3FKJA 2TCTA 3SZGA 2BGCA 4XKWA 5LLQA 1XX5A 3I71A 5H6RA 3BG3A 1TQMA 2C6YA 2AQEA 3OOPA 5L3DA 2JSPA 3WE3A 1S9HA 4DZPA 4WCGA 3L7WA 4GGGA 5GPCA 5EZGA 2JA5J 1E17A 3O8GA 2KJCA 2QVOA 1R23A 1X1DA 4MHGA 1WJEA 2VLAA 4P9FA 2KIMA 4AC0A 1QO0D 5FO5A 3TL4X 1YLFA 1Y39A 2R5ZB 4Q4ZF 1FOYA 2LMDA 2WV0A 3VYUB 2Z33A 4ENKA 3EDPA 4YIRX 2DK8A 3F0CA 3OSGA 1RNLA 2Z2SB 4BJ6C 2QZ8A 5D4RA 3CCLI 5IP6A 2GIZA 1WI9A 3PUFA 3F22A 4M3GA 2L01A 2EV0A 2R7ZJ 3G1LA 1I6HJ 1XGMA 1T0FA 1HOMA 1S6LA 1W5TA 2ADUA 1FC3A 5GADJ 1WPKA 4AVZA 1VQLI 2W25A 3S93A 2I10A 4OMZA 4MNUA 3JTHA 4A3IJ 2QENA 2LC2A 3G4SI 1R1UA 3GX4X 2IEKA 4PJ0C 5B66C 1P9QC 4XN0A 3QPSA 4RB1A 3HTSB 1R9TJ 2MC3A 4XK4A 1XCVA 1KU2A 4KT5C 5KVRA 3ECHA 4Y17A 3RJPA 1B9NA 2VQLA 4RDUA 1R1VA 2GA1A 1LPQA 3FZVA 3OYDA 1SANA 2DOFA 3C3WA 3HJEA 3R6SA 3H3UA 4CYCA 4EJTA 3OL4A 1YS7A 2CRGA 1A04A 3WTXC 3GTQJ 1Y6IA 2NYXA 4DYQA 1X58A 3P9CA 2NAZA 1ZG1A 1Y8RB 3PJRA 4XR6A 2CQQA 2P81A 1PJRA 3H9GA 2W57A 3OS0A 3CF5F 2IGKA 2P6SA 1BI3A 4LMYA 3DLAA 4ZDOA 3EUKL 4HV5A 1WSUA 2VE9A 3K4KA 5E1ZB 2UXNA 1EV7A 2NS7A 2WY8Q 2CO5A 2O3FA 4ZDLA 1GVJA 2CQXA 3ZMTA 3M1CA 2AO9A 3BR2A 3IAM2 1SFEA 4LB6B 1K4SA 2OCEA 3P9KA 4I99C 4KIBA 4C2MJ 3RYRA 2QEXI 2KIUA 5JFRA 4PK4A 3BDDA 1RIOH 1JUMA 1G6NA 1DQUA 3FX3A 1ERDA 1KONA 3BTIA 2F5CA 3K2ZA 3WG9A 4XSZF 4KA4A 4ANJA 3H1CA 2P5LC 2E1MB 4A0XA 2O9LA 3OYBA 1RETA 1YO5C 3KP5A 3BC8A 2FEZA 1ETWA 3RKXA 2MA3A 1USSA 2M0CA 4U88A 3HOZJ 1O7FA 3K6GA 5E8IA 4EATA 3CUQB 5D5WB 2F5DA 2HKXA 3MKWB 4ZTFA 1OYIA 1W7PA 5GTIC 3FHNA 3QYFA 4Y7NJ 4XNFA 3J80K 3FWEA 2PI0A 3WTZA 2LNBA 1D1BA 3I59A 2L7KA 3HZJA 2JZYA 4UB6C 5ED4A 1OISA 2YX4A 5BMZA 3PFYA 2B7EA 3CO7C 3U1KA 2GQQA 4EGYA 3LWFA 2HVSA 3QU6A 3K0LA 1XC5A 3ML6A 3R0AA 1DGWY 1TL8A 4RGRA 1FOXA 1FNNA 1KGSA 1B6AA 1R4NB 4BU2A 2G9WA 2RKHA 5FROA 3JRAA 1MNDA 3U9GA 2P8TA 1Z21A 2GA2A 5F04A 4HDVA 1AU7A 3M9AA 5CQGA 5CVJA 3IRQA 1CF7A 2R4GA 4HX7A 3C7JA 1XG1A 1QQIA 2MC4A 3A4CA 3EETA 4GCVA 1VQ6I 4AIKA 3CTAA 4LJZF 3J7AY 3CC2I 2W7NA 4LLNA 3RPUA 4KNYA 4S0HB 2R7SA 3TGNA 4NC8A 1KYZA 1YX5A 1W5CC 1MSEC 4I09A 3VSKA 1QRYA 4B48A 2PMHA 4OU0A 4GO1A 2CH0A 5K7FA 4DW6A 3E5QA 2QQBA 5CQEA 4HQEA 3O6BB 3WHBA 4A12A 3HXLA 4AYBA 4IHWA 1U9OA 1Y56A 5FFXA 1SEUA 3BG6A 4LITA 1ETVA 3K4BA 3VSLA 2DXIA 4BDYA 2EA4A 2FBKA 3ZN0A 1YW9A 1KQ8A 3LA3A 3JRCA 4M74A 4DBRA 3LNQA 1MNEA 1R7JA 3Q0WA 3UR3C 2ZJPF 3B6AA 3G73A 4D0PA 2KQRA 4M9XA 2JUGA 2OD5A 1IF1A 1I39A 2AXTC 5F1RA 1DGRM 3W3CA 2L2OA 3V42A 2QSFX 2X1CA 3QQAA 2KISA 2WV1A 1YS6A 3VEPA 1HW1A 3BJAA 2UWMA 5J4YA 3Q9SA 1SFUA 2R92J 4L9VA 2L9SA 2WC2A 5AIPA 2VQGA 2CU7A 1FOKA 2BW3B 2ZXHA 1RI7A 2EFWA 1WJ5A 1ODDA 2V1UA 1AKHA 2EFNA 1XTAA 2XB5A 2M7AA 3QPTA 4GXOA 3GFIA 2P5KA 3S1RJ 4BE0A 2VKDA 1NTCA 3OYCA 1CGPA 4V19K 4HQMA 5E3OA 4JQFA 5A2QZ 2BV6A 2V26A 3WU2C 3OS2A 1PDNC 2V9VA 3OSFA 2G0EA 4ZYEA 4EJVA 3QP5A 5FLMJ 1T08B 4A3BJ 4YEJA 4WF2A 1S7EA 2OJED 2X6WA 1DPUA 1G2HA 5CVRA 1QBJA 1JKOC 1ZTRA 2A5WA 4BY7J 4KIGA 2R7DA 4AIHA 4DIQA 3JTGA 1JHFA 3CLQA 1W0TA 2HQ5A 2QKMB 2DODA 4QPQA 4EVIA 3AKZA 1MJBA 2VJ5A 1HKSA 2LK2A 3HIFA 4A3LJ 2IGMA
chains in the Genus database with same CATH topology
2HOAA 4UUSA 1JT0A 1GVDA 2X9DA 1WH5A 2XGDA 5FKMA 2H8RA 1AKHB 3OIOA 3S15J 1IC8A 2JJ7A 1JGGA 1ENHA 4MLOA 4AYBN 3A01B 2DA4A 2HOSA 2VUMJ 1VI0A 2D5VA 3GTOJ 5DTDA 2XRLA 3GTLJ 2LLKA 4M3DA 3ZQHA 4W97A 5FLVA 1Z0XA 5M5YJ 2XGEA 3JREA 2HI3A 3JRBA 3HB9A 1IRZA 1QVUA 2MSYA 4FTHA 4XICA 3SFIA 5J1UA 4A3CJ 1D5YA 4V2GA 4MFEA 2QCOA 4C3HJ 4QIWN 4BBRJ 3I4MJ 3TP0A 3DEWA 1BL0A 3HEFA 5M3FJ 1HLVA 1IDYA 3HGGA 3RZDJ 4UUSB 2YS9A 4D5FA 3SJMA 5FKNA 3S1MJ 1H89C 5GP9A 1Z77A 1DU6A 1RPWA 4X1EA 2X48A 2E2JJ 1FEXA 2DMUA 2TRTA 2L7FP 3G1MA 3BR0A 5IPAA 1A6IA 5EF6A 2AHQA 3HOUJ 2K9QA 3LSPA 2Y30A 2DMTA 1WGXA 3ZQCA 5JLXA 1MH4A 2DA7A 2DN0A 3C2BA 1MBGA 4FISA 1FJLA 5IYDJ 1LFBA 1IG7A 5FKLA 9ANTA 4B3AA 1YRNA 4C3JJ 3JRGA 3FK7A 2K9SA 2MW8A 5E3LA 1GDTA 1IGNA 1JKPC 2ME6A 3LSGA 1ZK8A 4IHYA 2X6OA 1HCRA 1K83J 3HOYJ 3BQYA 3CDLA 4QTRA 1PUFA 1HDDC 3H3VK 2EH3A 3IV5A 2L7MP 4A3GJ 1ETYA 2CJJA 2MG4A 4IEJA 4DYRA 2LTPA 5F08A 1MBFA 3FIWA 2B63J 5K7ZA 1RKWA 1P7IA 4XIDA 2E2IJ 1MBHA 5M3MJ 1K61A 1I3QJ 1RR7A 3H0GJ 4M3EA 4AUXA 4EEFG 2E1OA 3A03A 2VKVA 3JR9A 1TWGJ 3M4OJ 1YRNB 5J1RA 1X2NA 2EZLA 3HKZN 1MSFC 1ETOA 2OPTA 2PMZN 3Q0UA 4BKXA 3GBGA 3M3YJ 5EDNA 2LY9A 1A5JA 1U8BA 2ME0A 1H8AC 2L7ZA 2KT0A 4MO7A 3ZQFA 3MVPA 3I4NJ 1IUFA 1ITYA 2YUSA 1IDZA 1PUFB 1B72A 1UHSA 1JUPA 5EG0A 1WCMJ 1MNMC 2HDDA 1LFUP 4A3DJ 2H1KA 2DMPA 2R5ZA 3ZQIA 3S16J 3S2DJ 2QF7A 5JLWA 1Y1WJ 2XB0X 4MFDA 3NAUA 4QSHA 2R5YA 3HM5A 4L5EA 3RZOJ 2DTZA 4BY1J 3S17J 4A3FJ 4NDLA 1IJWC 4FE4A 4X6AJ 5BNGA 4A3JJ 2JMWA 3IH4A 2TCTA 1RESA 3HOVJ 4ABZA 3MKLA 2N8GA 1B8IA 2M2EA 2ECCA 5M5WJ 3BG3A 3S14J 2ECBA 4M6VA 2GM4A 3TP3A 4IHXA 2DMQA 1UMQA 4GFBA 2WB1N 4M3FA 5GPAA 4DZPA 5GPCA 5EZGA 2JA5J 3O8GA 5F1JA 5FKOA 1F43A 2XPWA 3Q0VA 1ORKA 3CCYA 1RKTA 3CMYA 1B72B 5EG0B 4AC0A 5M5XJ 5IP9J 2JK3A 2OF7A 2M8GX 2R5ZB 1H88C 3HBLA 4C3IJ 4A93J 2IBDA 3F0CA 4G12A 2K9NA 3OSGA 2L9RA 1AHDP 1DU0A 3SDGA 2R5YB 5K7HA 5EGOA 2GLOA 2ZB9A 5IP6A 3FK6A 1MBEA 4FE7A 5EYRA 4M3GA 2R7ZJ 4MIMA 3G1LA 3BQZA 1B8IB 4BBSJ 1I6HJ 3JRDA 1EF4A 1HOMA 4JX5A 1WPKA 5C3EJ 3BG9A 1Q1VA 3HDDA 1IV6A 2I10A 5IP7J 2XPUA 4A3IJ 1FTZA 3K7AJ 3PO2J 1JUSA 5F0HA 5F27A 3LSRA 1BW6A 1OCPA 2IEKA 4D5CA 1BJZA 2Y9YA 3BTLA 3QPSA 5IOYA 3UKGA 1R9TJ 4XK4A 4A3EJ 2E19A 2GBYA 1ZKGA 2DA5A 4RDUA 3PO3J 3GTMJ 1SANA 2EZIA 1JJ8C 1WI3A 4LOCA 2LP0A 4CYCA 1FTTA 2CRGA 1JTYA 2EZHA 5EGOB 3GTQJ 2EBIA 2W48A 4DYQA 1NK3P 1X58A 2LR8A 2Y0SN 3ZOBA 5E3NA 2CQQA 2P81A 4Y52J 1U78A 1X2MA 2EZKA 3L1PA 2DA3A 2NS8A 1QPIA 1FIPA 3G1OA 3QPLA 1ZQ3P 1P7JA 2NS7A 5F0CA 3D1NI 1ZGWA 3GTPJ 1GV5A 4JYKA 2CUFA 2DMNA 3IH3A 2CQXA 3GTKJ 5FJ8J 4JX6A 2AO9A 3BR2A 3JRFA 4J19A 2Y2ZA 4C2MJ 3FKIJ 1T56A 1U9NA 1JUMA 4CYCB 3MN2A 3TW7A 2K40A 1MBJA 3BTIA 4B4CA 5IOZA 3FISA 4FCYA 5FKKA 2FD5A 2XSDC 3HOXJ 2O9LA 3JRHA 1RETA 1GT0C 2Y31A 1ETWA 3W6VA 4JP0A 2M9HA 3WHCA 1APLC 2M0CA 3HOZJ 2DA1A 5J1YA 3BR6A 3O8HA 4DYCA 2COBA 3TEDA 3IH2A 3GTGJ 1GUUA 1WH7A 4Y7NJ 1NK2P 1OJLA 4UUTA 3NARA 4I76A 1MH3A 3BR3A 1ZR4A 2NVQJ 1TWHJ 4IHVA 2HYJA 2JN6A 3HOWJ 4V2FA 3JRIA 2LFBA 3VPRA 4BXXJ 3TW6A 1XS9A 1HF0A 4RBOA 1BA5A 1JT6A 3GTJJ 1XC5A 1LE8A 2ELKA 1ETXA 1GV2A 3BT9A 3JRAA 1BW5A 5F04A 1AU7A 3E7LA 4A69C 1O4XA 2R0QC 3S1NJ 2DA2A 1XG1A 3BR5A 1OFCX 3PM1A 2ID6A 2YU9J 2Y9ZA 1I50J 2XPVA 2VI6A 2HOTA 4S0HB 1Y1VJ 2FQ4A 3BR1A 2NVYJ 1ETKA 5J3LA 5C4JJ 2JWTA 1MSEC 2O8KA 2XGCA 1QRYA 3S2HJ 3ZQLA 4W1UA 4M3BA 3A02A 1POGA 5K7FA 4DW6A 1T33A 3WHBA 4IHWA 1HDPA 1U9OA 3B6CA 3BG5A 4HNVA 5C44J 2DJNA 2NOGA 1ETVA 3BTJA 1E3OC 1OCTC 2HXOA 1TC3C 5DS9A 3JRCA 3S1QJ 3Q3SA 2O7OA 4I6ZA 3LNQA 1TWCJ 1LE8B 3K2AA 3Q0WA 3LSJA 3B6AA 2CUEA 1VFCA 2VPRA 4JX4A 4A3KJ 1MBKA 1TWFJ 1JJ6C 5HODA 3OOUA 2WAQN 3QQAA 1SFOJ 1JKQC 2WV1A 2R93J 3BTCA 1JKRC 1F36A 4A3MJ 5C4XJ 2R92J 2MGQA 4DZJA 5IYCJ 2NVTJ 1VF9A 2CU7A 5EZHA 5EEAA 1AKHA 2XB5A 1VNDA 2JA7J 2HXIA 5F0FA 1ZR2A 2JA8J 1QVTA 2E2HJ 2NVXJ 3S1RJ 3HGYA 4XRMA 3RKQA 1NTCA 3A01A 1CQTA 1FIAA 5E3OA 4D7NA 2RAEA 2KDZA 2DA6A 2ID3A 2LVSA 3OSFA 1ETQA 2G0EA 3DCFA 2FJ1A 3CQZJ 5FLMJ 4A3BJ 2LKXA 1S7EA 1G2HA 2EQRA 2FX0A 2VKEA 4D7MA 1W0UA 1JKOC 1ZTRA 1JTXA 2JA6J 4XRSA 4BY7J 1TWAJ 4XRSG 2LD5A 1W0TA 4B1RA 2IAIA 5IYBJ 2HQ5A 3RQIA 5E3MA 2L0KA 1UG2A 3LOCA 2LK2A 4A3LJ 3ZQGA 2M34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOA A;  4UUS A;  1JT0 A;  1GVD A;  2X9D A;  1WH5 A;  2XGD A;  5FKM A;  2H8R A;  1AKH B;  3OIO A;  3S15 J;  1IC8 A;  2JJ7 A;  1JGG A;  1ENH A;  4MLO A;  4AYB N;  3A01 B;  2DA4 A;  2HOS A;  2VUM J;  1VI0 A;  2D5V A;  3GTO J;  5DTD A;  2XRL A;  3GTL J;  2LLK A;  4M3D A;  3ZQH A;  4W97 A;  5FLV A;  1Z0X A;  5M5Y J;  2XGE A;  3JRE A;  2HI3 A;  3JRB A;  3HB9 A;  1IRZ A;  1QVU A;  2MSY A;  4FTH A;  4XIC A;  3SFI A;  5J1U A;  4A3C J;  1D5Y A;  4V2G A;  4MFE A;  2QCO A;  4C3H J;  4QIW N;  4BBR J;  3I4M J;  3TP0 A;  3DEW A;  1BL0 A;  3HEF A;  5M3F J;  1HLV A;  1IDY A;  3HGG A;  3RZD J;  4UUS B;  2YS9 A;  4D5F A;  3SJM A;  5FKN A;  3S1M J;  1H89 C;  5GP9 A;  1Z77 A;  1DU6 A;  1RPW A;  4X1E A;  2X48 A;  2E2J J;  1FEX A;  2DMU A;  2TRT A;  2L7F P;  3G1M A;  3BR0 A;  5IPA A;  1A6I A;  5EF6 A;  2AHQ A;  3HOU J;  2K9Q A;  3LSP A;  2Y30 A;  2DMT A;  1WGX A;  3ZQC A;  5JLX A;  1MH4 A;  2DA7 A;  2DN0 A;  3C2B A;  1MBG A;  4FIS A;  1FJL A;  5IYD J;  1LFB A;  1IG7 A;  5FKL A;  9ANT A;  4B3A A;  1YRN A;  4C3J J;  3JRG A;  3FK7 A;  2K9S A;  2MW8 A;  5E3L A;  1GDT A;  1IGN A;  1JKP C;  2ME6 A;  3LSG A;  1ZK8 A;  4IHY A;  2X6O A;  1HCR A;  1K83 J;  3HOY J;  3BQY A;  3CDL A;  4QTR A;  1PUF A;  1HDD C;  3H3V K;  2EH3 A;  3IV5 A;  2L7M P;  4A3G J;  1ETY A;  2CJJ A;  2MG4 A;  4IEJ A;  4DYR A;  2LTP A;  5F08 A;  1MBF A;  3FIW A;  2B63 J;  5K7Z A;  1RKW A;  1P7I A;  4XID A;  2E2I J;  1MBH A;  5M3M J;  1K61 A;  1I3Q J;  1RR7 A;  3H0G J;  4M3E A;  4AUX A;  4EEF G;  2E1O A;  3A03 A;  2VKV A;  3JR9 A;  1TWG J;  3M4O J;  1YRN B;  5J1R A;  1X2N A;  2EZL A;  3HKZ N;  1MSF C;  1ETO A;  2OPT A;  2PMZ N;  3Q0U A;  4BKX A;  3GBG A;  3M3Y J;  5EDN A;  2LY9 A;  1A5J A;  1U8B A;  2ME0 A;  1H8A C;  2L7Z A;  2KT0 A;  4MO7 A;  3ZQF A;  3MVP A;  3I4N J;  1IUF A;  1ITY A;  2YUS A;  1IDZ A;  1PUF B;  1B72 A;  1UHS A;  1JUP A;  5EG0 A;  1WCM J;  1MNM C;  2HDD A;  1LFU P;  4A3D J;  2H1K A;  2DMP A;  2R5Z A;  3ZQI A;  3S16 J;  3S2D J;  2QF7 A;  5JLW A;  1Y1W J;  2XB0 X;  4MFD A;  3NAU A;  4QSH A;  2R5Y A;  3HM5 A;  4L5E A;  3RZO J;  2DTZ A;  4BY1 J;  3S17 J;  4A3F J;  4NDL A;  1IJW C;  4FE4 A;  4X6A J;  5BNG A;  4A3J J;  2JMW A;  3IH4 A;  2TCT A;  1RES A;  3HOV J;  4ABZ A;  3MKL A;  2N8G A;  1B8I A;  2M2E A;  2ECC A;  5M5W J;  3BG3 A;  3S14 J;  2ECB A;  4M6V A;  2GM4 A;  3TP3 A;  4IHX A;  2DMQ A;  1UMQ A;  4GFB A;  2WB1 N;  4M3F A;  5GPA A;  4DZP A;  5GPC A;  5EZG A;  2JA5 J;  3O8G A;  5F1J A;  5FKO A;  1F43 A;  2XPW A;  3Q0V A;  1ORK A;  3CCY A;  1RKT A;  3CMY A;  1B72 B;  5EG0 B;  4AC0 A;  5M5X J;  5IP9 J;  2JK3 A;  2OF7 A;  2M8G X;  2R5Z B;  1H88 C;  3HBL A;  4C3I J;  4A93 J;  2IBD A;  3F0C A;  4G12 A;  2K9N A;  3OSG A;  2L9R A;  1AHD P;  1DU0 A;  3SDG A;  2R5Y B;  5K7H A;  5EGO A;  2GLO A;  2ZB9 A;  5IP6 A;  3FK6 A;  1MBE A;  4FE7 A;  5EYR A;  4M3G A;  2R7Z J;  4MIM A;  3G1L A;  3BQZ A;  1B8I B;  4BBS J;  1I6H J;  3JRD A;  1EF4 A;  1HOM A;  4JX5 A;  1WPK A;  5C3E J;  3BG9 A;  1Q1V A;  3HDD A;  1IV6 A;  2I10 A;  5IP7 J;  2XPU A;  4A3I J;  1FTZ A;  3K7A J;  3PO2 J;  1JUS A;  5F0H A;  5F27 A;  3LSR A;  1BW6 A;  1OCP A;  2IEK A;  4D5C A;  1BJZ A;  2Y9Y A;  3BTL A;  3QPS A;  5IOY A;  3UKG A;  1R9T J;  4XK4 A;  4A3E J;  2E19 A;  2GBY A;  1ZKG A;  2DA5 A;  4RDU A;  3PO3 J;  3GTM J;  1SAN A;  2EZI A;  1JJ8 C;  1WI3 A;  4LOC A;  2LP0 A;  4CYC A;  1FTT A;  2CRG A;  1JTY A;  2EZH A;  5EGO B;  3GTQ J;  2EBI A;  2W48 A;  4DYQ A;  1NK3 P;  1X58 A;  2LR8 A;  2Y0S N;  3ZOB A;  5E3N A;  2CQQ A;  2P81 A;  4Y52 J;  1U78 A;  1X2M A;  2EZK A;  3L1P A;  2DA3 A;  2NS8 A;  1QPI A;  1FIP A;  3G1O A;  3QPL A;  1ZQ3 P;  1P7J A;  2NS7 A;  5F0C A;  3D1N I;  1ZGW A;  3GTP J;  1GV5 A;  4JYK A;  2CUF A;  2DMN A;  3IH3 A;  2CQX A;  3GTK J;  5FJ8 J;  4JX6 A;  2AO9 A;  3BR2 A;  3JRF A;  4J19 A;  2Y2Z A;  4C2M J;  3FKI J;  1T56 A;  1U9N A;  1JUM A;  4CYC B;  3MN2 A;  3TW7 A;  2K40 A;  1MBJ A;  3BTI A;  4B4C A;  5IOZ A;  3FIS A;  4FCY A;  5FKK A;  2FD5 A;  2XSD C;  3HOX J;  2O9L A;  3JRH A;  1RET A;  1GT0 C;  2Y31 A;  1ETW A;  3W6V A;  4JP0 A;  2M9H A;  3WHC A;  1APL C;  2M0C A;  3HOZ J;  2DA1 A;  5J1Y A;  3BR6 A;  3O8H A;  4DYC A;  2COB A;  3TED A;  3IH2 A;  3GTG J;  1GUU A;  1WH7 A;  4Y7N J;  1NK2 P;  1OJL A;  4UUT A;  3NAR A;  4I76 A;  1MH3 A;  3BR3 A;  1ZR4 A;  2NVQ J;  1TWH J;  4IHV A;  2HYJ A;  2JN6 A;  3HOW J;  4V2F A;  3JRI A;  2LFB A;  3VPR A;  4BXX J;  3TW6 A;  1XS9 A;  1HF0 A;  4RBO A;  1BA5 A;  1JT6 A;  3GTJ J;  1XC5 A;  1LE8 A;  2ELK A;  1ETX A;  1GV2 A;  3BT9 A;  3JRA A;  1BW5 A;  5F04 A;  1AU7 A;  3E7L A;  4A69 C;  1O4X A;  2R0Q C;  3S1N J;  2DA2 A;  1XG1 A;  3BR5 A;  1OFC X;  3PM1 A;  2ID6 A;  2YU9 J;  2Y9Z A;  1I50 J;  2XPV A;  2VI6 A;  2HOT A;  4S0H B;  1Y1V J;  2FQ4 A;  3BR1 A;  2NVY J;  1ETK A;  5J3L A;  5C4J J;  2JWT A;  1MSE C;  2O8K A;  2XGC A;  1QRY A;  3S2H J;  3ZQL A;  4W1U A;  4M3B A;  3A02 A;  1POG A;  5K7F A;  4DW6 A;  1T33 A;  3WHB A;  4IHW A;  1HDP A;  1U9O A;  3B6C A;  3BG5 A;  4HNV A;  5C44 J;  2DJN A;  2NOG A;  1ETV A;  3BTJ A;  1E3O C;  1OCT C;  2HXO A;  1TC3 C;  5DS9 A;  3JRC A;  3S1Q J;  3Q3S A;  2O7O A;  4I6Z A;  3LNQ A;  1TWC J;  1LE8 B;  3K2A A;  3Q0W A;  3LSJ A;  3B6A A;  2CUE A;  1VFC A;  2VPR A;  4JX4 A;  4A3K J;  1MBK A;  1TWF J;  1JJ6 C;  5HOD A;  3OOU A;  2WAQ N;  3QQA A;  1SFO J;  1JKQ C;  2WV1 A;  2R93 J;  3BTC A;  1JKR C;  1F36 A;  4A3M J;  5C4X J;  2R92 J;  2MGQ A;  4DZJ A;  5IYC J;  2NVT J;  1VF9 A;  2CU7 A;  5EZH A;  5EEA A;  1AKH A;  2XB5 A;  1VND A;  2JA7 J;  2HXI A;  5F0F A;  1ZR2 A;  2JA8 J;  1QVT A;  2E2H J;  2NVX J;  3S1R J;  3HGY A;  4XRM A;  3RKQ A;  1NTC A;  3A01 A;  1CQT A;  1FIA A;  5E3O A;  4D7N A;  2RAE A;  2KDZ A;  2DA6 A;  2ID3 A;  2LVS A;  3OSF A;  1ETQ A;  2G0E A;  3DCF A;  2FJ1 A;  3CQZ J;  5FLM J;  4A3B J;  2LKX A;  1S7E A;  1G2H A;  2EQR A;  2FX0 A;  2VKE A;  4D7M A;  1W0U A;  1JKO C;  1ZTR A;  1JTX A;  2JA6 J;  4XRS A;  4BY7 J;  1TWA J;  4XRS G;  2LD5 A;  1W0T A;  4B1R A;  2IAI A;  5IYB J;  2HQ5 A;  3RQI A;  5E3M A;  2L0K A;  1UG2 A;  3LOC A;  2LK2 A;  4A3L J;  3ZQG A;  2M34 A; 
#chains in the Genus database with same CATH topology
 1OQY A;  1GVD A;  2XAU A;  2H8R A;  2DYR H;  3HC7 A;  4PUS A;  2DJI A;  2QQ8 A;  2FQ3 A;  4DJA A;  3RCO A;  3P5J A;  4MLO A;  5KCM A;  4AYB N;  4P5O A;  2HOS A;  2H6B A;  5JHU A;  3OYE A;  4ESB A;  1V55 H;  1TNT A;  2LRD A;  2XRL A;  4LG0 B;  4BHB A;  1DDN A;  4RB0 A;  2LLK A;  1ZEL A;  3LA7 A;  4IQJ A;  4IOC F;  1O3Q A;  5FLV A;  3HHG A;  4ESJ A;  5M5Y J;  1LB2 A;  3K10 A;  3FBI B;  1WRJ A;  1TT0 A;  5GAE J;  3JRB A;  2HPM A;  2LF8 A;  2MSY A;  3K9T A;  4PZJ A;  3FXQ A;  4KT6 A;  3S2W A;  2MH2 A;  1D5Y A;  4V2G A;  4QIW N;  1BOA A;  2DDB A;  3DPT A;  3EYI A;  4HDU A;  3ZXS A;  5M3F J;  2F5V A;  1FYM A;  1IDY A;  3PNT A;  1D0Z A;  3HGG A;  4UUS B;  2DTR A;  3SJM A;  2OV7 A;  1T95 A;  5LFA A;  2HDW A;  2VOO A;  2JPC A;  1H89 C;  4LFU A;  3HOT A;  2DQR A;  1ZGJ A;  1EJ9 A;  2HEO A;  2PX9 A;  3H9Q A;  3AAF A;  2FSW A;  2XSJ C;  2LY2 A;  2UUZ A;  3M7G A;  4B09 A;  1FEX A;  2X1E A;  3WTV C;  1TT5 B;  2QQA A;  3DBR B;  4ITV A;  4FT8 A;  4NB5 A;  3FDY A;  3BR0 A;  1LKX A;  2NXN B;  3CZ6 A;  4C30 A;  1G8X A;  1A6I A;  1UCR A;  4J01 A;  2EIK H;  5BQT A;  3LSP A;  2DMT A;  1KU7 A;  1PP8 F;  2DA7 A;  3W2W A;  3OYN A;  1MBG A;  3DU5 A;  4EMS A;  4N9I A;  5D5X B;  9ANT A;  4B3A A;  1RZ4 A;  2NVU B;  3S3M A;  1IGN A;  1V4R A;  2MW8 A;  1E3H A;  4IPA A;  5E3L A;  1GDT A;  5GAH J;  3SYT A;  4CCO A;  1T6S A;  1FYL A;  2ZNY A;  2QBY A;  2WB1 A;  4DNC A;  2PG4 A;  2EIL H;  2V6C A;  2YPR A;  3CDL A;  5KK1 A;  3C2G A;  4QTR A;  1VTN C;  1PUF A;  2PJR A;  3IV5 A;  1Z91 A;  2COM A;  1S3J A;  2HKO A;  5ICG A;  3TDZ C;  3L2V A;  1H9T A;  1FMW A;  2LTP A;  5GTH C;  1IZ1 A;  2EFP A;  1LVA A;  2QWW A;  1HKT A;  3I5U A;  4TV7 A;  3FXL A;  5H20 A;  4R79 A;  4CCN A;  1Z7U A;  1P7I A;  4Q5S F;  1GXQ A;  4L9N A;  5M3M J;  1K61 A;  2A07 F;  2V1N A;  1OMI A;  5D6E A;  3F8F A;  4ASN A;  2CWE A;  3LQQ A;  4CZC A;  2DFI A;  4OWR B;  5J1R A;  5LHG A;  2HYF A;  4HW0 A;  5DD4 A;  1Z7L A;  3BLY A;  1XDS A;  2OPT A;  4LK1 F;  4C2T A;  2CV0 A;  5CVI A;  3M3Y J;  5EDN A;  2LY9 A;  4Q48 A;  2PEX A;  2ME0 A;  2K3F A;  1YE9 A;  3L09 A;  4ZTJ A;  4K2E A;  3RQ4 A;  5LBQ A;  4WXH A;  3FXM A;  2EIM H;  2ISY A;  3CCQ I;  1UHS A;  1WCM J;  1OCC H;  1S7A A;  3TO9 A;  2HDD A;  1LFU P;  3E6C C;  2H1K A;  3DTE A;  2V6E A;  3DP7 A;  1FLI A;  4HRI A;  3S16 J;  3KP7 A;  2NNN A;  1W36 C;  3W2A A;  5CLS A;  2XB0 X;  4MFD A;  4UHT A;  3OYH A;  4FX4 A;  2R5Y A;  2RGV A;  4PCQ A;  3W6K B;  2DTZ A;  1B9M A;  2OUM A;  3ZR8 X;  2CS3 A;  5DEQ A;  4FE4 A;  4IZZ A;  1IN7 A;  2VON A;  2Y0S A;  2Z16 A;  4XLC A;  1K6Y A;  4UY8 I;  4H4K C;  4E7L A;  1B8I A;  2M2E A;  2VBZ A;  4M6V A;  2GM4 A;  5HNF A;  3TP3 A;  2R7T A;  1QZY A;  2DMQ A;  1FBS A;  2HZD A;  2WB1 N;  2CW8 A;  4HAM A;  1HBX G;  3R60 A;  1D5V A;  3VFZ A;  2HTS A;  3HG9 A;  4A5N A;  4ZYA A;  5F1J A;  1G3W A;  3GXO A;  1KU3 A;  1YJW I;  1ON1 A;  5ILV A;  3CCY A;  3U1D A;  3CMY A;  1B72 B;  2M8E A;  5E79 C;  2MLG A;  2Z1D A;  4PGG A;  5M5X J;  5E18 F;  2KMU A;  5IP9 J;  3QRF F;  1DP7 P;  2JK3 A;  2OF7 A;  4U0W A;  1Z6R A;  5DCM A;  3RTR A;  4AD9 A;  3VYS B;  1X4O A;  4DQ2 A;  4MTD A;  1H88 C;  2JVG A;  2VIX A;  2M30 A;  3TKY A;  4G12 A;  1AHD P;  1X4P A;  1QZE A;  1UEL B;  4NC6 A;  5EGO A;  1PUE E;  4F91 B;  4E7Z A;  4FE7 A;  2Y75 A;  4LIV A;  3ZN1 A;  1YOV B;  2Y0M A;  4O5V A;  1WWX A;  3GEZ A;  4RM2 A;  4MIM A;  5IT3 A;  3R4K A;  4HX4 A;  2V1X A;  1EF4 A;  5LRR A;  3JRD A;  4JX5 A;  1R1T A;  2JA2 A;  3LSM A;  2LYC A;  4GRI A;  1VQ5 I;  3L00 A;  1X1A A;  2BW3 A;  1UST A;  1IV6 A;  3RKY A;  3CP8 A;  4M9S A;  2VXZ A;  3QU3 A;  3OY9 A;  3K7A J;  2VQH A;  3PO2 J;  1JUS A;  4XM3 A;  3PQJ A;  1BW6 A;  2V9P A;  1VQ4 I;  4E7K A;  2Y9Y A;  1U5T C;  3F8B A;  4RS8 A;  5ICE A;  2DO7 A;  3PO3 J;  4PFO A;  1MKM A;  3H9J A;  3LMM A;  2K86 A;  3AG1 H;  1XMA A;  2D1H A;  1YTY A;  1WI3 A;  4LOC A;  2LP0 A;  3IL2 A;  1JJ8 C;  1OPC A;  2FU4 A;  5ERI A;  2CQK A;  1FTT A;  2VE8 A;  2IS6 A;  3B73 A;  4ZYH A;  1OR7 A;  3PIO F;  4I2O A;  1MMA A;  1W7P D;  2EBI A;  2CV1 A;  1V54 H;  2W48 A;  3K70 C;  2Y0S N;  1UB9 A;  2DK5 A;  4ZYG A;  2HVQ A;  5E3N A;  5IT9 Z;  4IVN A;  1GLN A;  3BWG A;  5B3S H;  2BY1 A;  4O6J A;  3GUD A;  1X2M A;  3CLO A;  2EZK A;  4N9H A;  1MDM B;  1Y0U A;  2X6Y A;  2Q8K A;  3I9V 2;  1P4A A;  4ETS A;  1D3Y A;  2ZC2 A;  1FIP A;  4FAS D;  5LHI A;  2B9S A;  1I3A A;  3FBN B;  2P0W A;  3E0J B;  1GV5 A;  1XGO A;  2CUF A;  5FFZ A;  3ZQQ A;  3GTK J;  4WXC A;  3JAM Z;  2XF6 A;  3OR2 C;  2A6H F;  2CUZ A;  3CDI A;  2CW7 A;  4CA0 A;  4D1Q A;  3H0D A;  1J59 A;  2HFH A;  1XGN A;  2TDX A;  3F72 A;  3MN2 A;  4EM1 A;  3DBH B;  2K40 A;  5E1X A;  2PJP A;  3F3X A;  3RPU D;  5IOZ A;  1E3P A;  1TZL A;  4I01 A;  1D0Y A;  3KCC A;  4XOR A;  2XVC A;  3K4J A;  4FCY A;  2OTL I;  4IRI A;  5L3E A;  2FD5 A;  2R7Q A;  5EJC A;  4KIF A;  1QPM A;  1YX3 A;  5TGT A;  4OIP F;  4XMY A;  2ACJ A;  2BVM A;  3ULQ B;  2M9H A;  4OIR F;  3WHC A;  2X85 A;  2FNA A;  5J1Y A;  5HDN A;  1F9N A;  5DUK A;  3BR6 A;  5FD5 A;  3X2Q H;  2COB A;  3FMS A;  3IH2 A;  3J81 Z;  1VQK I;  4XLN F;  2EA2 A;  2ZBK A;  3L9F A;  3MEX A;  3BR3 A;  1U3E M;  1TWH J;  4I98 B;  1HXD A;  2XAF A;  2NVQ J;  2HYJ A;  2JN6 A;  3HOW J;  4V2F A;  2WWY A;  2WY7 Q;  1U5T A;  3VDX A;  4RBO A;  2DI3 A;  3H5N A;  3SZP A;  1XSX A;  2GOM A;  5HLG A;  1JHH A;  3H35 A;  3DWL E;  2K3P A;  2KKO A;  4CH7 A;  2IS2 A;  5DM7 F;  2J5O A;  2EFO A;  4EJO A;  3TBI A;  1BOB A;  3BT9 A;  1BW5 A;  2XRN A;  3E7L A;  3HKZ A;  4S04 A;  1O4X A;  4RLQ A;  2DA2 A;  4PJJ A;  2DT7 B;  3T5X A;  2E7X A;  2YU9 J;  2Y9Z A;  4PJL A;  1KYW A;  1I50 J;  1X19 A;  2AQF A;  2HOT A;  5J40 A;  3DKY A;  3BR1 A;  3E3V A;  1ETK A;  2M3A A;  4I0A A;  2JWT A;  5D8K B;  2O8K A;  4XKC A;  1YFH A;  1DUX C;  2XGC A;  2ZME B;  3E97 A;  3NWT A;  2IT0 A;  2CMP A;  3IAS 2;  4M3B A;  3A02 A;  3CJR B;  2X6X A;  2EB7 A;  3ERM A;  1HDP A;  3GLX A;  3B6C A;  1YG2 A;  4HNV A;  1H9G A;  2VBX A;  3BTJ A;  1VQN I;  3LQR A;  1JXS A;  1TC3 C;  1B1B A;  2JRT A;  2O7O A;  1LE8 B;  4H0E A;  2FRH A;  2WA0 A;  4LD5 A;  3H5R A;  4OAZ A;  2CUE A;  4BJT A;  5KNL A;  1VFC A;  2VPR A;  3GZN B;  4A3K J;  1JJ6 C;  1TWF J;  2ZCW A;  3H3Z A;  5HOD A;  3SEQ A;  1ZRE A;  1G3S A;  3OOU A;  3CO6 C;  1JKQ C;  1T98 A;  2M45 A;  5EEG A;  3KYD B;  2ZO4 A;  2IA1 A;  4ENM A;  3K69 A;  1JKR C;  4UNO A;  4A3M J;  2A6T A;  2JQ7 A;  2FUG 2;  3KLO A;  2MGQ A;  4DZJ A;  4YFN F;  4N4O B;  3V7S A;  2QQ9 A;  2QA4 I;  1VF9 A;  4EQQ A;  2NVT J;  2E1C A;  4HLY A;  4HNU A;  1QU3 A;  5EZH A;  2W1O A;  2VBY A;  1VND A;  4NQW A;  2HXI A;  4BEH A;  5F0F A;  2JA8 J;  2E2H J;  4XRM A;  3BZ6 A;  2LH9 A;  1FIA A;  2DFH A;  4GYI A;  5HLI A;  5EEH A;  1Z3Y A;  2KDZ A;  2DA6 A;  4AIJ A;  3OYK A;  1NG7 A;  3V8L A;  3RI4 A;  1D8J A;  3OIQ A;  2IP2 A;  2GXA A;  3GFJ A;  3CQZ J;  2FJ1 A;  4AID A;  3AG3 H;  5L3F A;  1P2F A;  2VKE A;  4D7M A;  3BZC A;  2JA6 J;  4XRS A;  4E7J A;  2W4S A;  1FZP B;  1YIT I;  3ZCO A;  1R00 A;  1TQI A;  5E3M A;  2DDA A;  3KFW X;  4PJN A;  1UG2 A;  1MMN A;  3HUG B;  3LOC A;  4YII A;  4E70 A;  2RC4 A;  3ZQG A;  1J2X A;  1TBX A;  2HOA A;  2EPF A;  3DEU A;  4A6D A;  1JT0 A;  4L9T A;  2X9D A;  1WH5 A;  2Q2E B;  3HL2 A;  1PYV A;  3WGI A;  3GYH X;  3WTW C;  3SZT A;  3K4M A;  2AS5 F;  3A01 B;  2KHM A;  4HF0 A;  1VI0 A;  3LSI A;  2VUM J;  3GTO J;  5DTD A;  2DBB A;  3GTL J;  1ULY A;  3RPQ A;  1Z05 A;  5AON A;  2VC0 A;  1KQ9 A;  3FM5 A;  5HS8 A;  4PSW A;  2JPB A;  2VPL A;  1Z0X A;  2M1B A;  2VJJ A;  2XGE A;  2LDU A;  2HTJ A;  3WTU C;  3JRE A;  4N0B A;  2KIF A;  1IXS B;  3HB9 A;  4KUM A;  1EA3 A;  1QVU A;  4FTH A;  2FF4 A;  1ZYR F;  1KA8 A;  3LSK A;  3KP3 A;  2OAZ A;  2QCO A;  3CC7 I;  1ONV A;  3I4M J;  2W00 A;  3TP0 A;  3DEW A;  1BL0 A;  3HEF A;  4XOP A;  3I4P A;  3QOP A;  3G3Z A;  2YS9 A;  4D5F A;  2ZXI A;  1N78 A;  5E8G A;  3HPH A;  3OYL A;  4CCM A;  1QA6 A;  2LG4 A;  2ZJQ F;  3CC4 I;  2K4J A;  2LF7 A;  3SHF A;  5ICF A;  3AG2 H;  3DEE A;  2X48 A;  1RC9 A;  2DMU A;  2B0L A;  2E71 A;  1O7L A;  2TRT A;  3PSF A;  3G1M A;  1J7K A;  1YQA A;  4MQ9 F;  3W2V A;  5IPA A;  4BHP A;  4RGX A;  2K9Q A;  2BY2 A;  2OCC H;  3ZQC A;  5JLX A;  4X0G A;  4FIS A;  3T8R A;  1FJL A;  5IYD J;  3GZ5 A;  3G2B A;  1ZH5 A;  1B59 A;  4F52 A;  1YRN A;  4FQG A;  1UJ8 A;  2NRA C;  2KIQ A;  3OYI A;  1BR4 A;  2R7O A;  4KDP A;  4FX0 A;  1JKP C;  2ME6 A;  3OR1 C;  1J09 A;  1WVR A;  4IJA A;  4DBQ A;  5HLT A;  4IHY A;  1IN6 A;  1K83 J;  4RB2 C;  3QPH A;  4Y33 A;  2FOK A;  3BQY A;  4UVA A;  1J75 A;  1YW7 A;  4AWX B;  1MJA A;  2BEO A;  4F7Z A;  2L7M P;  4PSX A;  2FBI A;  3EYY A;  2MG4 A;  3SQN A;  4IEJ A;  2UZK A;  2P6T A;  1WQ2 A;  1U6G A;  2FXA A;  4KJZ A;  3FIW A;  3OYJ A;  3IC7 A;  4A0Z A;  3J7Z I;  1RKW A;  4YG2 F;  3E5X A;  4BAC A;  4HPQ A;  4Y4R A;  3Q5F A;  3H0G J;  2HWV A;  1Z3X A;  3KX2 A;  4XBF A;  2LRE A;  3BCB A;  1P6R A;  5FLX Z;  3QP6 A;  3ZMD A;  4RGU A;  3M4O J;  2LBF B;  4U87 A;  2V9K A;  1MSF C;  1M1E B;  5HOO A;  3CCS I;  4C2U A;  3I56 I;  1WHU A;  2VOD A;  2ZJR F;  1MMD A;  5HDG A;  2D2W A;  1KU9 A;  1H8A C;  1ZAR A;  5DCF A;  3WTS C;  2M4G A;  2OBP A;  3U21 A;  1T8I A;  1QGP A;  3OMY A;  3ZQF A;  4QLC U;  1HW2 A;  4IX7 A;  3MFK A;  1IRF A;  1OCR H;  2DMP A;  2P4W A;  2R5Z A;  1TTY A;  2V79 A;  2IA0 A;  2EJR A;  3ASO H;  5JLW A;  1RR8 C;  2E1M C;  4ZZD A;  2VQC A;  3CMM A;  5B1B H;  1N25 A;  2KRF A;  2RNJ A;  5CVU A;  3RZO J;  2O61 A;  3KP4 A;  1K78 B;  5BNG A;  1ZN2 A;  1UAA A;  1I5Z A;  4CZZ A;  3CUQ C;  1Y0N A;  4OOI A;  3MKL A;  1H0M A;  4A0Y A;  3BJO A;  2AXL A;  2N8G A;  3M1E A;  4NUB A;  5M5W J;  3E6B A;  2ECB A;  3BG7 A;  1HA8 A;  3RYP A;  4IHX A;  5HS7 A;  2ZKZ A;  1R4M B;  5H2F C;  3BJ6 A;  1UMQ A;  3GME A;  2KJB A;  4HF1 A;  4XOT A;  5GPA A;  3WGH A;  5FKO A;  2A5Y B;  2XPW A;  2BVL A;  2LSO A;  3Q0V A;  1ORK A;  3HYI A;  1BIA A;  1U2W A;  5EG0 B;  4IO9 F;  2L3D A;  1R71 A;  4BL0 B;  2RV8 A;  1P92 A;  4I0B A;  2Z5U A;  3HBL A;  4C3I J;  1A36 A;  4A93 J;  1I1G A;  1R22 A;  3K1N A;  1VQ8 I;  5IT9 K;  2K9N A;  1WJD A;  2L9R A;  3IWF A;  1XCB A;  2F4O B;  3IUO A;  4XLP F;  2Z99 A;  5K7H A;  3E6M A;  1EH7 A;  4G6T B;  4BQQ A;  1MBE A;  2BY3 A;  3F6V A;  4UV9 A;  5J47 A;  1ZHF A;  2H1L A;  3N97 A;  4I02 A;  3TDU C;  4BBS J;  4DOZ A;  4HV6 A;  1TP4 A;  4IHT A;  1X1B A;  5C3E J;  1Q1V A;  1YIJ I;  3GCM A;  3GF2 A;  4KN4 X;  5IP7 J;  1BM9 A;  2XAG A;  3TOB A;  1DPR A;  3MZH A;  3L2W A;  1IV8 A;  2JVH A;  3LSR A;  4IF4 A;  4D5C A;  3KP2 A;  3I55 I;  2FMY A;  3CCR I;  1S5L C;  1BJZ A;  2HZT A;  2K27 A;  3BTL A;  4HA8 A;  5CJ9 A;  3N05 A;  5IOY A;  3J80 Z;  3UKG A;  1Q1H A;  1XSD A;  4A3E J;  2XGX A;  2E19 A;  2GBY A;  1S8N A;  1ZKG A;  4HX8 A;  4CCJ A;  3L2C A;  3GTM J;  1HSJ A;  4L5I A;  4J00 A;  3S8P A;  1XN7 A;  2EZI A;  2QSG X;  2PBI A;  1FOW A;  5B1A H;  1XD7 A;  4Z6Y A;  2X51 A;  5LD2 C;  2HYG D;  1NK3 P;  3WOD F;  2LR8 A;  1JI8 A;  3QOE A;  3ZOB A;  3EUA A;  3J81 K;  3HRU A;  4OMY A;  4BQA A;  3TQN A;  3TOA A;  3ZMV A;  3K1M A;  2F5E A;  3L1P A;  2DA3 A;  2IGO A;  3HRT A;  4BGD A;  2NS8 A;  4QPO A;  3CUQ A;  4XKV A;  3G1O A;  2XAS A;  2CG4 A;  1ZQ3 P;  3H36 A;  5F0C A;  3DF8 A;  3BP8 A;  2I5U A;  4XKB A;  1ZGW A;  3GTP J;  4XLE A;  4JYK A;  3NQO A;  1FP2 A;  2DMN A;  1UHM A;  3HPG A;  5FJ8 J;  1J9I A;  3DLL F;  1X3W B;  2CW0 F;  3FKI J;  3VYT B;  3NRV A;  4RA2 A;  3H5A A;  1FYK A;  3SFZ A;  4BYY A;  1YJ9 I;  3VWB A;  1YW8 A;  4U0Y A;  1T56 A;  1X1P A;  3A1Y A;  2XKP A;  1IN4 A;  3I3L A;  4CYC B;  2VT2 A;  3OYG A;  3TW7 A;  2XF5 A;  3K70 D;  2VOP A;  4ENN A;  4B4C A;  5J6X A;  3MD2 A;  2UXX A;  3DKX A;  3M8E A;  3MWM A;  1BJA A;  3EUH C;  4KMU X;  3LSH A;  4GYG A;  5TRD A;  1R49 A;  3CJN A;  2XSD C;  2KDO A;  1QHG A;  2UV1 A;  3GFL A;  1VQM I;  1GT0 C;  4L0Y B;  2L5Q A;  2WAQ A;  3W6J B;  4JP0 A;  2BZT A;  4B44 A;  4E7S A;  1W4M A;  2DA1 A;  2PFB A;  4RMN A;  4BJ5 C;  3CCE I;  3FXO A;  4CO8 A;  3O8H A;  4DYC A;  4CXF A;  2XHK A;  3TED A;  4CCL A;  3GTG J;  1WH7 A;  1O3R A;  1OJL A;  4UUT A;  3NAR A;  5CPR B;  4KIT B;  1ZRD A;  1IN8 A;  1ZR4 A;  4HG2 A;  4IHV A;  2BXZ A;  1HW5 A;  2HQA A;  2K9M A;  2MH9 A;  1V5G A;  4G6Q A;  2PLY A;  2LFB A;  3V8J A;  3VPR A;  4D9J A;  3J7Y J;  3TW6 A;  2H8W A;  3DV8 A;  1XS9 A;  2YR2 A;  3L2R A;  1UFM A;  2OU2 A;  1BA5 A;  4Q47 A;  4RAZ A;  4YIF A;  2VXD A;  3CF2 A;  3GTJ J;  3PIP F;  4XON A;  2ELK A;  4B47 A;  1NG6 A;  3KZY A;  3QWL A;  1GV2 A;  4G8X A;  3K4L A;  3I58 A;  1STZ A;  2HGC A;  3LA2 A;  1X3U A;  2Z3Y A;  2R0Q C;  3S1N J;  5ICC A;  2JSC A;  3ONQ A;  3BR5 A;  1IRX A;  3PM1 A;  3OYA A;  3OS1 A;  2K85 A;  4CUG A;  1XB4 A;  2BYV E;  2BE5 F;  2VC1 A;  2VI6 A;  1J5Y A;  2XPV A;  1W7P B;  1Y1V J;  2NVY J;  4RAY A;  5J3L A;  5C4J J;  4A5M A;  4II2 A;  3A0H C;  1V5E A;  3ZQL A;  2FML A;  2NNY A;  4W1U A;  1XPX A;  3I59 B;  1SVM A;  3C2H A;  5E20 A;  4C9Y A;  3IRR A;  1T33 A;  3DPL C;  3ZRG A;  4BH9 A;  4Y15 A;  3BG5 A;  5C44 J;  1WJF A;  1NH3 A;  2CQN A;  1E3O C;  3G71 I;  3WE2 A;  3ABU A;  2E60 A;  1O3S A;  5FB2 A;  1MIJ A;  5DS9 A;  3Q3S A;  4I6Z A;  2HDC A;  1X3Z B;  3K2A A;  3QYB A;  3LSJ A;  2EIJ H;  3VB2 A;  1UG0 A;  2FBH A;  2K9L A;  3I53 A;  3KPH A;  4MGR A;  2STT A;  2KPM A;  1MBK A;  3CP2 A;  3MMY B;  1S7O A;  2WAE A;  3F6O A;  4B8X A;  1T38 A;  2DAO A;  2WAQ N;  4BNC A;  1OYW A;  5HVQ C;  2QYO A;  2R93 J;  2X4H A;  3BTC A;  2KRC A;  4HYE A;  2IA2 A;  3CD6 I;  3WGG A;  1F36 A;  5C4X J;  4XSX F;  4MQV A;  1TW3 A;  1R5I D;  3COA C;  3VOE A;  3BCA A;  5IYC J;  4G7O F;  2V4J C;  2ELJ A;  4ZZL A;  1R58 A;  2J5P A;  5EEA A;  3F23 A;  1A35 A;  3ZP5 A;  1RUN A;  1R5G A;  1ZR2 A;  3HOS A;  3LL7 A;  1D1C A;  4YEL A;  1R36 A;  1TLH B;  3CJQ B;  3SXY A;  1CQT A;  1VQO I;  4LG0 A;  2JRM A;  2RAE A;  4ZH4 F;  1MGT A;  5FRM A;  4G94 A;  2GWR A;  1TW2 A;  3PQK A;  3ECO A;  2LKS A;  1E0E A;  1LNW A;  4IRG A;  2V1D A;  2LVS A;  1ETQ A;  2OZ6 A;  3DCF A;  2XIG A;  2ZSH B;  3ZMS A;  2K02 A;  2YSR A;  2LKX A;  2QGU A;  4UXN A;  4Y3O A;  5HLH A;  2R3S A;  1W0U A;  2A6E F;  4RLF A;  1A31 A;  1BR1 A;  3MCZ A;  1TWA J;  4XRS G;  3HRS A;  4B1R A;  1Z67 A;  5IYB J;  1MW7 A;  3RQI A;  2L0K A;  2KL4 A;  3KE2 A;  4XN3 A;  2FNP A;  2VJ4 A;  2MYS A;  3T0Y A;  2BXY A;  1J0R A;  5J4V A;  3ZMU A;  2RVC A;  2HS5 A;  2M34 A;  1V3F A;  4UUS A;  3A2K A;  3WTY C;  4JK1 X;  1WJC A;  1AKH B;  3OIO A;  2QUF A;  3FXR A;  1IC8 A;  3K1P A;  1BBY A;  4M6Y A;  3EPZ A;  4KFC A;  1ZRC A;  2DA4 A;  3RSN A;  3N4M A;  3RKW A;  3I0T A;  1L3L A;  2CGP A;  1AOY A;  5DUI A;  3ABM H;  3LAJ A;  3ZQH A;  4W97 A;  3SEZ A;  2DLL A;  2VJI A;  3FMQ A;  2A05 A;  5JI6 A;  3IWZ A;  2DFE A;  3S32 A;  2HI3 A;  3ZMZ A;  1MJ9 A;  4IHS A;  3DBL B;  1BC8 C;  3KP6 A;  4AM3 A;  2JT1 A;  3B02 A;  2ZFW A;  2H27 A;  4XIC A;  3LAP A;  1P4X A;  2WBM A;  2IS4 A;  2MLK A;  2KZV A;  5J1U A;  4A3C J;  4U7D A;  4C3H J;  2BHZ A;  1R6R A;  3NWS A;  3M07 A;  1SMY F;  1HLV A;  2W24 A;  1D8K A;  3RZD J;  2HR3 A;  3M8J A;  4S05 A;  1T39 A;  5FKN A;  1OLT A;  3S1M J;  3LST A;  2E5N A;  4BE2 A;  5L3C A;  1I1S A;  4YRV A;  1DU6 A;  1RPW A;  5A2Q K;  2XC7 A;  3F21 A;  2RDP A;  4X1E A;  2A61 A;  3ASN H;  3F8N A;  5D5U B;  4ZDP A;  1JGS A;  5DV5 A;  2E2J J;  3C18 A;  3PSI A;  5FLX K;  5LHH A;  4OAY A;  3WU1 B;  5DYM A;  1SVO A;  3WTT C;  2W84 A;  2AHQ A;  3HOU J;  2Y30 A;  5BOX A;  1WGX A;  2ZSI B;  2CQ7 A;  2D45 A;  3AFH A;  2GIV A;  3C2B A;  4CDG A;  4B43 A;  1IG7 A;  5FKL A;  2BY0 A;  4UB8 C;  2MD0 A;  1G4D A;  3R61 A;  3JSP A;  3GO5 A;  4C3J J;  2IXS A;  2OZU A;  1XSV A;  1FY7 A;  2X0L A;  4IOA F;  4G9Y A;  2E1N A;  2RQQ A;  2RNG A;  3CJT B;  2QSH X;  5F64 A;  3P7N A;  1IXC A;  4I7H A;  1BI2 A;  1SFX A;  4WXD A;  4Y13 A;  1YHQ I;  1Z9C A;  4AU7 A;  2WTE A;  1HDD C;  3CES A;  2E35 A;  4M6X A;  2HOE A;  3H3V K;  3T8T A;  4DYR A;  2YU3 A;  3WU0 A;  2V7F A;  2ZXJ A;  2XDV A;  1LVK A;  5K7Z A;  4EM2 A;  5BPD A;  1YJN I;  2XRO A;  4XID A;  2K5C A;  1MBH A;  1I3Q J;  4EV0 A;  4RB3 C;  4M3E A;  4BQN A;  4EEF G;  1MMG A;  2E1O A;  4HOB A;  4LB5 A;  1QHH D;  4XLH A;  4M73 A;  2ZNZ A;  3D5L A;  1SD5 A;  3HHH A;  2DFF A;  3EQL F;  1B4A A;  3DPU A;  3Q9V A;  4OIO F;  2EZL A;  3HKZ N;  3F9K A;  4A2U A;  2IGN A;  1FPQ A;  2XAQ A;  1WZ2 A;  3GBG A;  2KZG A;  5TJJ A;  1A5J A;  2HU9 A;  2XV4 S;  3D5R C;  4BHC A;  2QBY B;  3U2R A;  2KT0 A;  3S3N A;  1C0W A;  3REO A;  1PVE A;  2LKP A;  3I4N J;  2YUS A;  2KP6 A;  2HQN A;  3LFK A;  1AA7 A;  4XL9 A;  4XRF A;  1PUF B;  1B72 A;  5ILS A;  2PJR B;  5HS9 A;  2VAS A;  1FBQ A;  4PFP A;  3JCU C;  3ZQI A;  4ZYD A;  2A69 F;  3VYR B;  2QF7 A;  3T1B A;  1Y1W J;  2O8X A;  1FP1 D;  3KYL A;  3HM5 A;  4EJU A;  3H92 A;  4NDL A;  5FRN A;  4X6A J;  4A3J J;  1ZG5 A;  4CHU A;  3IH4 A;  3ABL H;  2M7B A;  4OIN F;  1RES A;  3HOV J;  3J7A O;  2XAJ A;  2XAH A;  4ABZ A;  2YX7 A;  2IRF G;  2ECC A;  1LFP A;  3S14 J;  4LIU A;  3LFU A;  1W5S A;  4LLL A;  4GFB A;  3BY6 A;  5JVT A;  4M3F A;  1ZAO A;  1IO2 A;  3R0J A;  3OL3 A;  3OV8 A;  2ZJ2 A;  1BI1 A;  2EWN A;  1F43 A;  1TNS A;  1RKT A;  2CFO A;  2DT6 A;  3FXK A;  4OIQ F;  4UVC A;  4YFK F;  5FD6 A;  1TQP A;  2OA4 A;  1VQ9 I;  2EIN H;  3WG7 H;  1XDU A;  2M8G X;  3FXU A;  3QAH A;  4ZJZ A;  4KMF A;  2L02 A;  1P4W A;  2IBD A;  2LY1 A;  1ZRF A;  6PAX A;  4N4N B;  3SDG A;  3F8C A;  1DU0 A;  2R5Y B;  1F1Z A;  2GLO A;  5E1W A;  2ZB9 A;  2FA5 A;  3FK6 A;  1PP7 U;  1K79 A;  5KAF C;  5EYR A;  3MZ8 A;  1SAU A;  1FBU A;  1UZC A;  2STW A;  5ILU A;  3BOQ A;  5K5Q A;  3KZZ A;  3ERE D;  3CUO A;  2R7R A;  3DTK A;  3BQZ A;  5IY5 H;  1B8I B;  1LEA A;  4KYW A;  1HC8 A;  1MDM A;  4BXF A;  5D5V B;  1MD0 A;  2ZME C;  3BG9 A;  5HDK A;  4EM0 B;  3DKW A;  3HDD A;  2A68 F;  2HNH A;  3PNV A;  3QYE A;  3E6D A;  2XPU A;  1FTZ A;  2BOL A;  3L2Q A;  3ESW B;  4HSR A;  5F0H A;  5F27 A;  1OCP A;  3HSR A;  2EFQ A;  4G7Z F;  1AWC A;  3FXJ A;  2NS0 A;  2IVM A;  3TMO A;  4HBL A;  2P7V B;  5DDG A;  2W85 A;  3SDB A;  1K4T A;  2DA5 A;  5LEK A;  5DCM B;  3ROU A;  3OIP A;  4P55 A;  2ELH A;  2MD5 A;  1BR2 A;  3NEU A;  4RM3 A;  3AL0 B;  4E7I A;  1JTY A;  2EZH A;  2NOJ B;  5EGO B;  2BBY A;  3OYM A;  4UVB A;  2KLO A;  3CCU I;  3KEO A;  1FSH A;  4Y52 J;  5BS6 A;  1U78 A;  2H09 A;  3UNG C;  5LGN A;  4LGW A;  1OYY A;  3IKV A;  4WX9 A;  3ISP A;  2L9V A;  5AIQ A;  2R7U A;  3QPL A;  1P7J A;  3KIO A;  2GZW A;  3D1N I;  1VQP I;  3ABT A;  1DP3 A;  1IUY A;  3IH3 A;  4JX6 A;  3JRF A;  4J19 A;  2Y2Z A;  2I8D A;  3DTI A;  5DD8 A;  2M4K A;  1EKE A;  2ESN A;  1G3T A;  2WAF A;  3HTU A;  1U9N A;  4WWC A;  1U0J A;  1O3T A;  3A0B C;  2VBW A;  1IN5 A;  2Q0O A;  1MBJ A;  2R7X A;  2ETH A;  4HF2 A;  3FIS A;  5CKT A;  2LOO A;  4EGZ A;  2K4B A;  2OC6 A;  1GHC A;  1G59 A;  2HPI A;  2H6C A;  5FKK A;  2CUJ A;  3PUB A;  3HOX J;  4HZF A;  3JRH A;  4JOM A;  4M9Z A;  3IP4 B;  2Y31 A;  2VT3 A;  3W6V A;  4FHT A;  1R5H A;  1APL C;  2E34 A;  1QNT A;  4XQF A;  2WAD A;  3L2U A;  2O03 A;  2GAU A;  1YI2 I;  3IHU A;  1XGS A;  3V7C A;  2P5V A;  2Y48 A;  1K7A A;  1GUU A;  2ICW G;  1NK2 P;  4I76 A;  1MH3 A;  2ZME A;  5J8F A;  2FE3 A;  3DFG A;  2XF7 A;  1WJB A;  5B5E C;  3M8F A;  2CV2 A;  4GDF A;  3JRI A;  2DQL A;  2DYS H;  4BXX J;  3CCV I;  1O57 A;  1HF0 A;  3KEY A;  3C1D A;  4RAG A;  3KET A;  1NHA A;  1W36 D;  1JT6 A;  1FMV A;  1LE8 A;  2H94 A;  2DU9 A;  3PFI A;  3O2P E;  2GOX B;  3CCM I;  4PGH A;  3ELK A;  1ZLJ A;  1ETX A;  2PN6 A;  2QKL B;  5DM6 F;  4BS9 A;  2GXG A;  1BC7 C;  4KN7 X;  4WK8 F;  3S3O A;  2DW4 A;  4NHJ A;  4M71 A;  4BQO A;  3BRO A;  1Z6T A;  4A69 C;  2G7U A;  1SVL A;  2EK5 A;  2L54 A;  4QWQ A;  4U7B A;  2R7W A;  1LDD A;  1OFC X;  1FT9 A;  4KIS A;  2ID6 A;  2ZXW H;  2CYY A;  2MFZ A;  5L3B A;  1S72 I;  1LDJ A;  4CIC A;  4DGW B;  4ESF A;  2FQ4 A;  3QOD A;  4A6E A;  4NBQ A;  1S29 A;  3S2H J;  5LEJ A;  3JAM K;  1IRG A;  4FET A;  3D5S C;  3OYF A;  1POG A;  3TO7 A;  2M87 A;  1SC7 A;  4XLF A;  2P7C B;  4IKF A;  1I27 A;  1U5T B;  2DJN A;  2NOG A;  1OCT C;  2PQ8 A;  5F6F A;  2HXO A;  2M5W A;  3S1Q J;  3FMR A;  1TWC J;  2X1D A;  5LRS A;  5CVV A;  4NC7 A;  5BPI A;  4JX4 A;  2K7L A;  1LJ9 A;  5HNH A;  1SFO J;  3GW2 A;  4RGS A;  3BZK A;  1UHW A;  4E4H A;  2ISZ A;  4IXA A;  4G7H F;  3K4N A;  2DPU A;  1BI0 A;  3GVA A;  3CDH A;  4LK0 F;  3I64 A;  5K5O A;  2O5R A;  1HKQ A;  3HUG A;  2R7V A;  1KQ0 A;  2F4I A;  4E7H A;  1SAX A;  2FOW A;  4Z2Y A;  2F4M B;  2DCE A;  2Q2E A;  2RQP A;  3DU6 A;  3FM3 A;  5LGU A;  4F3Q A;  4BE1 A;  3AL0 C;  2JA7 J;  1MMS A;  4NNJ A;  1QVT A;  2NVX J;  3GLL A;  3HGY A;  3P9I A;  5H6Q A;  5KAI C;  3RKQ A;  1JE8 A;  3A01 A;  3CME I;  3FF5 A;  4D7N A;  2O6G E;  3GWZ A;  3E1S A;  2RN7 A;  4BDZ A;  1IAW A;  4IQ4 A;  2MAB A;  3GFM A;  4F55 A;  1D0X A;  2ID3 A;  2JTV A;  2D1V A;  3KEQ A;  2VKH A;  1K6O A;  2IS1 A;  2O0Y A;  1ZLK A;  2EQR A;  2FX0 A;  5JHF A;  2L4A A;  1ON2 A;  1JTX A;  1REP C;  4JBA A;  1E2X A;  1A6Q A;  1N77 A;  2LD5 A;  4R8H A;  1OCZ H;  1X1C A;  2IAI A;  2EV6 A;  2M0M A;  1V5F A;  4O3M A;  1QPI A;  1YIO A;  3KLN A;  2XGD A;  5FKM A;  3IKT A;  4ZC3 A;  4B3X A;  1OR7 C;  4NQW B;  4BEH B;  3GZ6 A;  3S15 J;  4F93 B;  2JJ7 A;  1JGG A;  1ENH A;  1N75 A;  4PJM A;  3ZPL A;  3F8M A;  4UUV A;  2CSO A;  3JW4 A;  1BIB A;  2HVR A;  2D5V A;  5K1Y A;  3HSE A;  3MZY A;  2E5Z A;  1LDK B;  3DQV C;  4M3D A;  4P1W A;  2EV5 A;  3TO6 A;  2XKO A;  4MEY F;  3ABK H;  1XMK A;  4L18 B;  3KYC B;  4G6D A;  1XMX A;  4XLA A;  1IRZ A;  3VOD A;  4PDK A;  3MAJ A;  4HLX A;  3SFI A;  2OQR A;  5LGT A;  1FSE A;  4MEX F;  4CCK A;  4LG3 A;  5GAG J;  4BUP A;  1VZ0 A;  4CSW A;  4MFE A;  3CMA I;  4RAF A;  2Z9O A;  4BBR J;  3KZI C;  3ZQ7 A;  2OTJ I;  4AVP A;  1G3Y A;  2L4M A;  1WFX A;  2PMZ A;  5E17 F;  1I6X A;  1RRJ A;  2F2E A;  4E6K G;  1LUJ B;  3JSO A;  3I54 A;  2BHY A;  1F4K A;  1ACI A;  5GP9 A;  4BXU A;  1Z77 A;  5KHD A;  1SD6 A;  5J8C A;  2VB6 A;  2L9N A;  4R1H A;  3MKZ A;  2F6C A;  2DPD A;  4L9J A;  2ESH A;  3PL8 A;  2MBF A;  4LLG F;  2L7F P;  5JR3 A;  1SD7 A;  5D6F A;  2IPQ X;  2HQR A;  1YYV A;  1KZH A;  4M72 A;  3V4G A;  1ZG3 A;  1HQC A;  3DXJ F;  5EF6 A;  4HEA 2;  3AG4 H;  1ZGA A;  5D4S A;  2IW5 A;  3PNY A;  1VQ7 I;  1MH4 A;  2DN0 A;  4IRH A;  4L5J A;  1LFB A;  5FGM A;  3K4C A;  4L0Z B;  2LBF A;  1SFK A;  2DT5 A;  1FX7 A;  2E7W A;  2Y69 H;  3JRG A;  4P96 A;  3FK7 A;  1SMT A;  2K9S A;  4P9U A;  1CF7 B;  2R7F A;  3G6E I;  3LSG A;  4IL6 C;  1ZK8 A;  3EUH A;  3D0S A;  1EH8 A;  3RIR A;  1WKM A;  1W1W E;  2F48 A;  2KFD A;  2X6O A;  1HCR A;  5TIS C;  2OQG A;  3HOY J;  2KRH A;  1SD4 A;  3V8K A;  4CGZ A;  2EH3 A;  4A3G J;  1ETY A;  2CJJ A;  5D8L B;  5F08 A;  2Q1Z B;  1MBF A;  3OWT A;  4BAY A;  2B63 J;  2F5F A;  2JUC A;  1LEB A;  4ENJ A;  2E2I J;  2ZFU A;  3HRM A;  1RR7 A;  1T0F C;  4AUX A;  3ZGK A;  2W82 A;  1IXR C;  1L0O C;  3A03 A;  5L3G A;  1OCO H;  1K78 A;  2VKV A;  3JR9 A;  4HNT A;  1TWG J;  1YRN B;  3MKY B;  3RDI A;  2XUB A;  1OKR A;  4EJW A;  1X2N A;  1T2K A;  3E5U A;  1D1A A;  1ETO A;  2IJL A;  2PMZ N;  4CYD A;  4ON0 A;  3Q0U A;  4BKX A;  5K5R A;  1HST A;  1U8B A;  2PMU A;  2L7Z A;  4UV8 A;  2QM3 A;  1U8R A;  2E36 A;  1WJA A;  4MO7 A;  5JVG F;  2GXB A;  3MVP A;  3V7R A;  1IUF A;  1FWZ A;  1ITY A;  1IDZ A;  3BPX A;  2DOE A;  3FHZ A;  1QZZ A;  4MTE A;  1JUP A;  5EG0 A;  1GXP A;  1MNM C;  2A3S A;  4F92 B;  1F5T A;  1EH6 A;  3MQ0 A;  3CCJ I;  4A3D J;  1Z1D A;  2RRE A;  4HST A;  3S2D J;  2G7H A;  2DOA A;  1Y8Q B;  3HSF A;  5CYV A;  4II3 A;  1MZB A;  3O3K A;  2CFX A;  4KIC A;  1IW7 F;  4U0V A;  3NAU A;  4QSH A;  1BN5 A;  2VN2 A;  2QLZ A;  4L5E A;  1RUO A;  4BY1 J;  4A3F J;  3S17 J;  3BPV A;  1IJW C;  4YFX F;  1LQ1 A;  2JMW A;  2VL8 A;  3FKJ A;  2TCT A;  3SZG A;  2BGC A;  4XKW A;  5LLQ A;  1XX5 A;  3I71 A;  5H6R A;  3BG3 A;  1TQM A;  2C6Y A;  2AQE A;  3OOP A;  5L3D A;  2JSP A;  3WE3 A;  1S9H A;  4DZP A;  4WCG A;  3L7W A;  4GGG A;  5GPC A;  5EZG A;  2JA5 J;  1E17 A;  3O8G A;  2KJC A;  2QVO A;  1R23 A;  1X1D A;  4MHG A;  1WJE A;  2VLA A;  4P9F A;  2KIM A;  4AC0 A;  1QO0 D;  5FO5 A;  3TL4 X;  1YLF A;  1Y39 A;  2R5Z B;  4Q4Z F;  1FOY A;  2LMD A;  2WV0 A;  3VYU B;  2Z33 A;  4ENK A;  3EDP A;  4YIR X;  2DK8 A;  3F0C A;  3OSG A;  1RNL A;  2Z2S B;  4BJ6 C;  2QZ8 A;  5D4R A;  3CCL I;  5IP6 A;  2GIZ A;  1WI9 A;  3PUF A;  3F22 A;  4M3G A;  2L01 A;  2EV0 A;  2R7Z J;  3G1L A;  1I6H J;  1XGM A;  1T0F A;  1HOM A;  1S6L A;  1W5T A;  2ADU A;  1FC3 A;  5GAD J;  1WPK A;  4AVZ A;  1VQL I;  2W25 A;  3S93 A;  2I10 A;  4OMZ A;  4MNU A;  3JTH A;  4A3I J;  2QEN A;  2LC2 A;  3G4S I;  1R1U A;  3GX4 X;  2IEK A;  4PJ0 C;  5B66 C;  1P9Q C;  4XN0 A;  3QPS A;  4RB1 A;  3HTS B;  1R9T J;  2MC3 A;  4XK4 A;  1XCV A;  1KU2 A;  4KT5 C;  5KVR A;  3ECH A;  4Y17 A;  3RJP A;  1B9N A;  2VQL A;  4RDU A;  1R1V A;  2GA1 A;  1LPQ A;  3FZV A;  3OYD A;  1SAN A;  2DOF A;  3C3W A;  3HJE A;  3R6S A;  3H3U A;  4CYC A;  4EJT A;  3OL4 A;  1YS7 A;  2CRG A;  1A04 A;  3WTX C;  3GTQ J;  1Y6I A;  2NYX A;  4DYQ A;  1X58 A;  3P9C A;  2NAZ A;  1ZG1 A;  1Y8R B;  3PJR A;  4XR6 A;  2CQQ A;  2P81 A;  1PJR A;  3H9G A;  2W57 A;  3OS0 A;  3CF5 F;  2IGK A;  2P6S A;  1BI3 A;  4LMY A;  3DLA A;  4ZDO A;  3EUK L;  4HV5 A;  1WSU A;  2VE9 A;  3K4K A;  5E1Z B;  2UXN A;  1EV7 A;  2NS7 A;  2WY8 Q;  2CO5 A;  2O3F A;  4ZDL A;  1GVJ A;  2CQX A;  3ZMT A;  3M1C A;  2AO9 A;  3BR2 A;  3IAM 2;  1SFE A;  4LB6 B;  1K4S A;  2OCE A;  3P9K A;  4I99 C;  4KIB A;  4C2M J;  3RYR A;  2QEX I;  2KIU A;  5JFR A;  4PK4 A;  3BDD A;  1RIO H;  1JUM A;  1G6N A;  1DQU A;  3FX3 A;  1ERD A;  1KON A;  3BTI A;  2F5C A;  3K2Z A;  3WG9 A;  4XSZ F;  4KA4 A;  4ANJ A;  3H1C A;  2P5L C;  2E1M B;  4A0X A;  2O9L A;  3OYB A;  1RET A;  1YO5 C;  3KP5 A;  3BC8 A;  2FEZ A;  1ETW A;  3RKX A;  2MA3 A;  1USS A;  2M0C A;  4U88 A;  3HOZ J;  1O7F A;  3K6G A;  5E8I A;  4EAT A;  3CUQ B;  5D5W B;  2F5D A;  2HKX A;  3MKW B;  4ZTF A;  1OYI A;  1W7P A;  5GTI C;  3FHN A;  3QYF A;  4Y7N J;  4XNF A;  3J80 K;  3FWE A;  2PI0 A;  3WTZ A;  2LNB A;  1D1B A;  3I59 A;  2L7K A;  3HZJ A;  2JZY A;  4UB6 C;  5ED4 A;  1OIS A;  2YX4 A;  5BMZ A;  3PFY A;  2B7E A;  3CO7 C;  3U1K A;  2GQQ A;  4EGY A;  3LWF A;  2HVS A;  3QU6 A;  3K0L A;  1XC5 A;  3ML6 A;  3R0A A;  1DGW Y;  1TL8 A;  4RGR A;  1FOX A;  1FNN A;  1KGS A;  1B6A A;  1R4N B;  4BU2 A;  2G9W A;  2RKH A;  5FRO A;  3JRA A;  1MND A;  3U9G A;  2P8T A;  1Z21 A;  2GA2 A;  5F04 A;  4HDV A;  1AU7 A;  3M9A A;  5CQG A;  5CVJ A;  3IRQ A;  1CF7 A;  2R4G A;  4HX7 A;  3C7J A;  1XG1 A;  1QQI A;  2MC4 A;  3A4C A;  3EET A;  4GCV A;  1VQ6 I;  4AIK A;  3CTA A;  4LJZ F;  3J7A Y;  3CC2 I;  2W7N A;  4LLN A;  3RPU A;  4KNY A;  4S0H B;  2R7S A;  3TGN A;  4NC8 A;  1KYZ A;  1YX5 A;  1W5C C;  1MSE C;  4I09 A;  3VSK A;  1QRY A;  4B48 A;  2PMH A;  4OU0 A;  4GO1 A;  2CH0 A;  5K7F A;  4DW6 A;  3E5Q A;  2QQB A;  5CQE A;  4HQE A;  3O6B B;  3WHB A;  4A12 A;  3HXL A;  4AYB A;  4IHW A;  1U9O A;  1Y56 A;  5FFX A;  1SEU A;  3BG6 A;  4LIT A;  1ETV A;  3K4B A;  3VSL A;  2DXI A;  4BDY A;  2EA4 A;  2FBK A;  3ZN0 A;  1YW9 A;  1KQ8 A;  3LA3 A;  3JRC A;  4M74 A;  4DBR A;  3LNQ A;  1MNE A;  1R7J A;  3Q0W A;  3UR3 C;  2ZJP F;  3B6A A;  3G73 A;  4D0P A;  2KQR A;  4M9X A;  2JUG A;  2OD5 A;  1IF1 A;  1I39 A;  2AXT C;  5F1R A;  1DGR M;  3W3C A;  2L2O A;  3V42 A;  2QSF X;  2X1C A;  3QQA A;  2KIS A;  2WV1 A;  1YS6 A;  3VEP A;  1HW1 A;  3BJA A;  2UWM A;  5J4Y A;  3Q9S A;  1SFU A;  2R92 J;  4L9V A;  2L9S A;  2WC2 A;  5AIP A;  2VQG A;  2CU7 A;  1FOK A;  2BW3 B;  2ZXH A;  1RI7 A;  2EFW A;  1WJ5 A;  1ODD A;  2V1U A;  1AKH A;  2EFN A;  1XTA A;  2XB5 A;  2M7A A;  3QPT A;  4GXO A;  3GFI A;  2P5K A;  3S1R J;  4BE0 A;  2VKD A;  1NTC A;  3OYC A;  1CGP A;  4V19 K;  4HQM A;  5E3O A;  4JQF A;  5A2Q Z;  2BV6 A;  2V26 A;  3WU2 C;  3OS2 A;  1PDN C;  2V9V A;  3OSF A;  2G0E A;  4ZYE A;  4EJV A;  3QP5 A;  5FLM J;  1T08 B;  4A3B J;  4YEJ A;  4WF2 A;  1S7E A;  2OJE D;  2X6W A;  1DPU A;  1G2H A;  5CVR A;  1QBJ A;  1JKO C;  1ZTR A;  2A5W A;  4BY7 J;  4KIG A;  2R7D A;  4AIH A;  4DIQ A;  3JTG A;  1JHF A;  3CLQ A;  1W0T A;  2HQ5 A;  2QKM B;  2DOD A;  4QPQ A;  4EVI A;  3AKZ A;  1MJB A;  2VJ5 A;  1HKS A;  2LK2 A;  3HIF A;  4A3L J;  2IGM A; 
#chains in the Genus database with same CATH homology
 2HOA A;  4UUS A;  1JT0 A;  1GVD A;  2X9D A;  1WH5 A;  2XGD A;  5FKM A;  2H8R A;  1AKH B;  3OIO A;  3S15 J;  1IC8 A;  2JJ7 A;  1JGG A;  1ENH A;  4MLO A;  4AYB N;  3A01 B;  2DA4 A;  2HOS A;  2VUM J;  1VI0 A;  2D5V A;  3GTO J;  5DTD A;  2XRL A;  3GTL J;  2LLK A;  4M3D A;  3ZQH A;  4W97 A;  5FLV A;  1Z0X A;  5M5Y J;  2XGE A;  3JRE A;  2HI3 A;  3JRB A;  3HB9 A;  1IRZ A;  1QVU A;  2MSY A;  4FTH A;  4XIC A;  3SFI A;  5J1U A;  4A3C J;  1D5Y A;  4V2G A;  4MFE A;  2QCO A;  4C3H J;  4QIW N;  4BBR J;  3I4M J;  3TP0 A;  3DEW A;  1BL0 A;  3HEF A;  5M3F J;  1HLV A;  1IDY A;  3HGG A;  3RZD J;  4UUS B;  2YS9 A;  4D5F A;  3SJM A;  5FKN A;  3S1M J;  1H89 C;  5GP9 A;  1Z77 A;  1DU6 A;  1RPW A;  4X1E A;  2X48 A;  2E2J J;  1FEX A;  2DMU A;  2TRT A;  2L7F P;  3G1M A;  3BR0 A;  5IPA A;  1A6I A;  5EF6 A;  2AHQ A;  3HOU J;  2K9Q A;  3LSP A;  2Y30 A;  2DMT A;  1WGX A;  3ZQC A;  5JLX A;  1MH4 A;  2DA7 A;  2DN0 A;  3C2B A;  1MBG A;  4FIS A;  1FJL A;  5IYD J;  1LFB A;  1IG7 A;  5FKL A;  9ANT A;  4B3A A;  1YRN A;  4C3J J;  3JRG A;  3FK7 A;  2K9S A;  2MW8 A;  5E3L A;  1GDT A;  1IGN A;  1JKP C;  2ME6 A;  3LSG A;  1ZK8 A;  4IHY A;  2X6O A;  1HCR A;  1K83 J;  3HOY J;  3BQY A;  3CDL A;  4QTR A;  1PUF A;  1HDD C;  3H3V K;  2EH3 A;  3IV5 A;  2L7M P;  4A3G J;  1ETY A;  2CJJ A;  2MG4 A;  4IEJ A;  4DYR A;  2LTP A;  5F08 A;  1MBF A;  3FIW A;  2B63 J;  5K7Z A;  1RKW A;  1P7I A;  4XID A;  2E2I J;  1MBH A;  5M3M J;  1K61 A;  1I3Q J;  1RR7 A;  3H0G J;  4M3E A;  4AUX A;  4EEF G;  2E1O A;  3A03 A;  2VKV A;  3JR9 A;  1TWG J;  3M4O J;  1YRN B;  5J1R A;  1X2N A;  2EZL A;  3HKZ N;  1MSF C;  1ETO A;  2OPT A;  2PMZ N;  3Q0U A;  4BKX A;  3GBG A;  3M3Y J;  5EDN A;  2LY9 A;  1A5J A;  1U8B A;  2ME0 A;  1H8A C;  2L7Z A;  2KT0 A;  4MO7 A;  3ZQF A;  3MVP A;  3I4N J;  1IUF A;  1ITY A;  2YUS A;  1IDZ A;  1PUF B;  1B72 A;  1UHS A;  1JUP A;  5EG0 A;  1WCM J;  1MNM C;  2HDD A;  1LFU P;  4A3D J;  2H1K A;  2DMP A;  2R5Z A;  3ZQI A;  3S16 J;  3S2D J;  2QF7 A;  5JLW A;  1Y1W J;  2XB0 X;  4MFD A;  3NAU A;  4QSH A;  2R5Y A;  3HM5 A;  4L5E A;  3RZO J;  2DTZ A;  4BY1 J;  3S17 J;  4A3F J;  4NDL A;  1IJW C;  4FE4 A;  4X6A J;  5BNG A;  4A3J J;  2JMW A;  3IH4 A;  2TCT A;  1RES A;  3HOV J;  4ABZ A;  3MKL A;  2N8G A;  1B8I A;  2M2E A;  2ECC A;  5M5W J;  3BG3 A;  3S14 J;  2ECB A;  4M6V A;  2GM4 A;  3TP3 A;  4IHX A;  2DMQ A;  1UMQ A;  4GFB A;  2WB1 N;  4M3F A;  5GPA A;  4DZP A;  5GPC A;  5EZG A;  2JA5 J;  3O8G A;  5F1J A;  5FKO A;  1F43 A;  2XPW A;  3Q0V A;  1ORK A;  3CCY A;  1RKT A;  3CMY A;  1B72 B;  5EG0 B;  4AC0 A;  5M5X J;  5IP9 J;  2JK3 A;  2OF7 A;  2M8G X;  2R5Z B;  1H88 C;  3HBL A;  4C3I J;  4A93 J;  2IBD A;  3F0C A;  4G12 A;  2K9N A;  3OSG A;  2L9R A;  1AHD P;  1DU0 A;  3SDG A;  2R5Y B;  5K7H A;  5EGO A;  2GLO A;  2ZB9 A;  5IP6 A;  3FK6 A;  1MBE A;  4FE7 A;  5EYR A;  4M3G A;  2R7Z J;  4MIM A;  3G1L A;  3BQZ A;  1B8I B;  4BBS J;  1I6H J;  3JRD A;  1EF4 A;  1HOM A;  4JX5 A;  1WPK A;  5C3E J;  3BG9 A;  1Q1V A;  3HDD A;  1IV6 A;  2I10 A;  5IP7 J;  2XPU A;  4A3I J;  1FTZ A;  3K7A J;  3PO2 J;  1JUS A;  5F0H A;  5F27 A;  3LSR A;  1BW6 A;  1OCP A;  2IEK A;  4D5C A;  1BJZ A;  2Y9Y A;  3BTL A;  3QPS A;  5IOY A;  3UKG A;  1R9T J;  4XK4 A;  4A3E J;  2E19 A;  2GBY A;  1ZKG A;  2DA5 A;  4RDU A;  3PO3 J;  3GTM J;  1SAN A;  2EZI A;  1JJ8 C;  1WI3 A;  4LOC A;  2LP0 A;  4CYC A;  1FTT A;  2CRG A;  1JTY A;  2EZH A;  5EGO B;  3GTQ J;  2EBI A;  2W48 A;  4DYQ A;  1NK3 P;  1X58 A;  2LR8 A;  2Y0S N;  3ZOB A;  5E3N A;  2CQQ A;  2P81 A;  4Y52 J;  1U78 A;  1X2M A;  2EZK A;  3L1P A;  2DA3 A;  2NS8 A;  1QPI A;  1FIP A;  3G1O A;  3QPL A;  1ZQ3 P;  1P7J A;  2NS7 A;  5F0C A;  3D1N I;  1ZGW A;  3GTP J;  1GV5 A;  4JYK A;  2CUF A;  2DMN A;  3IH3 A;  2CQX A;  3GTK J;  5FJ8 J;  4JX6 A;  2AO9 A;  3BR2 A;  3JRF A;  4J19 A;  2Y2Z A;  4C2M J;  3FKI J;  1T56 A;  1U9N A;  1JUM A;  4CYC B;  3MN2 A;  3TW7 A;  2K40 A;  1MBJ A;  3BTI A;  4B4C A;  5IOZ A;  3FIS A;  4FCY A;  5FKK A;  2FD5 A;  2XSD C;  3HOX J;  2O9L A;  3JRH A;  1RET A;  1GT0 C;  2Y31 A;  1ETW A;  3W6V A;  4JP0 A;  2M9H A;  3WHC A;  1APL C;  2M0C A;  3HOZ J;  2DA1 A;  5J1Y A;  3BR6 A;  3O8H A;  4DYC A;  2COB A;  3TED A;  3IH2 A;  3GTG J;  1GUU A;  1WH7 A;  4Y7N J;  1NK2 P;  1OJL A;  4UUT A;  3NAR A;  4I76 A;  1MH3 A;  3BR3 A;  1ZR4 A;  2NVQ J;  1TWH J;  4IHV A;  2HYJ A;  2JN6 A;  3HOW J;  4V2F A;  3JRI A;  2LFB A;  3VPR A;  4BXX J;  3TW6 A;  1XS9 A;  1HF0 A;  4RBO A;  1BA5 A;  1JT6 A;  3GTJ J;  1XC5 A;  1LE8 A;  2ELK A;  1ETX A;  1GV2 A;  3BT9 A;  3JRA A;  1BW5 A;  5F04 A;  1AU7 A;  3E7L A;  4A69 C;  1O4X A;  2R0Q C;  3S1N J;  2DA2 A;  1XG1 A;  3BR5 A;  1OFC X;  3PM1 A;  2ID6 A;  2YU9 J;  2Y9Z A;  1I50 J;  2XPV A;  2VI6 A;  2HOT A;  4S0H B;  1Y1V J;  2FQ4 A;  3BR1 A;  2NVY J;  1ETK A;  5J3L A;  5C4J J;  2JWT A;  1MSE C;  2O8K A;  2XGC A;  1QRY A;  3S2H J;  3ZQL A;  4W1U A;  4M3B A;  3A02 A;  1POG A;  5K7F A;  4DW6 A;  1T33 A;  3WHB A;  4IHW A;  1HDP A;  1U9O A;  3B6C A;  3BG5 A;  4HNV A;  5C44 J;  2DJN A;  2NOG A;  1ETV A;  3BTJ A;  1E3O C;  1OCT C;  2HXO A;  1TC3 C;  5DS9 A;  3JRC A;  3S1Q J;  3Q3S A;  2O7O A;  4I6Z A;  3LNQ A;  1TWC J;  1LE8 B;  3K2A A;  3Q0W A;  3LSJ A;  3B6A A;  2CUE A;  1VFC A;  2VPR A;  4JX4 A;  4A3K J;  1MBK A;  1TWF J;  1JJ6 C;  5HOD A;  3OOU A;  2WAQ N;  3QQA A;  1SFO J;  1JKQ C;  2WV1 A;  2R93 J;  3BTC A;  1JKR C;  1F36 A;  4A3M J;  5C4X J;  2R92 J;  2MGQ A;  4DZJ A;  5IYC J;  2NVT J;  1VF9 A;  2CU7 A;  5EZH A;  5EEA A;  1AKH A;  2XB5 A;  1VND A;  2JA7 J;  2HXI A;  5F0F A;  1ZR2 A;  2JA8 J;  1QVT A;  2E2H J;  2NVX J;  3S1R J;  3HGY A;  4XRM A;  3RKQ A;  1NTC A;  3A01 A;  1CQT A;  1FIA A;  5E3O A;  4D7N A;  2RAE A;  2KDZ A;  2DA6 A;  2ID3 A;  2LVS A;  3OSF A;  1ETQ A;  2G0E A;  3DCF A;  2FJ1 A;  3CQZ J;  5FLM J;  4A3B J;  2LKX A;  1S7E A;  1G2H A;  2EQR A;  2FX0 A;  2VKE A;  4D7M A;  1W0U A;  1JKO C;  1ZTR A;  1JTX A;  2JA6 J;  4XRS A;  4BY7 J;  1TWA J;  4XRS G;  2LD5 A;  1W0T A;  4B1R A;  2IAI A;  5IYB J;  2HQ5 A;  3RQI A;  5E3M A;  2L0K A;  1UG2 A;  3LOC A;  2LK2 A;  4A3L J;  3ZQG A;  2M34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...