2E2JJ

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2jJ00
2XGDA 4UUTA 2ECBA 2FX0A 2Y31A 3GTJJ 3FK6A 2L0KA 2VKEA 3GTOJ 4M3GA 1GV2A 1XC5A 4BBRJ 1B8IB 1RETA 2JA5J 3Q0VA 2M9HA 1JKQC 2LVSA 1RKTA 1SANA 5BNGA 3S1NJ 3HOZJ 1HF0A 2CUEA 4B3AA 4A3CJ 1AKHA 2EZLA 3IH4A 1BJZA 4JYKA 5EGOA 2Y2ZA 4M3EA 1YRNA 4XIDA 4DYQA 1F36A 1NK3P 3S15J 3BTLA 2JN6A 2LTPA 3HB9A 1T56A 2G0EA 1RPWA 2FJ1A 1QVTA 5EZHA 2MG4A 4AUXA 2DA7A 1PUFA 1MBJA 4RDUA 2CQQA 2IAIA 2JK3A 2ID3A 4UUSB 5FKOA 2VI6A 1XS9A 2O7OA 2XGCA 4JX6A 4A3JJ 3WHCA 5IPAA 3BTCA 2K9SA 1GV5A 1QPIA 1RR7A 3Q3SA 2LFBA 4CYCB 2Y9ZA 1JJ8C 2HQ5A 2XPUA 2CRGA 5J3LA 4I6ZA 2XB0X 3FISA 1UHSA 4IEJA 5J1RA 2COBA 2IBDA 3I4NJ 3Q0UA 2GM4A 4Y52J 3NARA 5IOYA 4A3LJ 3B6AA 1X58A 3TP3A 4DZJA 2XPWA 2JWTA 2CU7A 1U8BA 4DYCA 4X1EA 1JKOC 3QQAA 1ZK8A 5FLMJ 2DA6A 3MVPA 4A3MJ 3QPSA 1HCRA 2NVTJ 3M3YJ 1ZR4A 2HXIA 2Y0SN 3BR0A 3HOUJ 2XSDC 2ME6A 3H3VK 3JRFA 3A03A 4A3EJ 3JRGA 3I4MJ 2X9DA 2Y30A 3GTLJ 1Q1VA 1QRYA 2WV1A 4Y7NJ 1Y1WJ 2DJNA 3GTKJ 2MW8A 2X48A 3SFIA 3BG3A 2DA2A 3HOXJ 1CQTA 1UMQA 5C4JJ 1F43A 4X6AJ 1MBFA 4AYBN 4MO7A 2PMZN 4FISA 2H1KA 4A3GJ 2MSYA 5GPCA 3A01B 1K83J 3S16J 5FKNA 2ID6A 1BW6A 1JUPA 1IG7A 4G12A 2WB1N 5EG0B 2DMUA 4QSHA 3S14J 4UUSA 3JRIA 2ZB9A 1JT6A 4C3HJ 1IDZA 2FD5A 2EZHA 5C44J 4MFEA 3JR9A 3L1PA 2GBYA 1H88C 3ZQGA 2M8GX 1TWAJ 2YS9A 4CYCA 1OJLA 3HDDA 2KDZA 1MBKA 3QPLA 4ABZA 1DU0A 3TW6A 1S7EA 5IOZA 4D5CA 1Y1VJ 2HOAA 3K2AA 1TWFJ 1IDYA 3HEFA 2B63J 3BQYA 5M3FJ 3G1LA 5IYBJ 1FEXA 5J1UA 2R0QC 1GT0C 5EZGA 1GDTA 4JP0A 1MBHA 3S17J 4B1RA 5FKLA 2R5YA 1BL0A 4A3DJ 1ETQA 2YU9J 5F0CA 4BBSJ 3HGGA 4L5EA 5IP9J 1HDDC 2E1OA 5J1YA 1QVUA 5IP7J 5IYDJ 1A5JA 2NOGA 2LD5A 2EBIA 1H89C 1ZR2A 5FLVA 1MBGA 1B72B 3O8HA 3TW7A 1MH3A 4M3BA 3BR5A 1IGNA 2JA6J 4W1UA 3G1MA 4JX5A 2JA8J 5FJ8J 1JKPC 1MH4A 1OFCX 4IHXA 3O8GA 2VPRA 3MKLA 2ME0A 3ZQIA 4HNVA 1JKRC 1NK2P 4MIMA 3HM5A 1I3QJ 3JRCA 1JTYA 1FIPA 1ZQ3P 3IH3A 3A01A 1VF9A 5E3LA 1TWCJ 5EG0A 4FE7A 1JUSA 2RAEA 1VFCA 2HOTA 3GBGA 5M5WJ 2NVQJ 1IUFA 1JT0A 2KT0A 3CCYA 3SDGA 3RQIA 2E2JJ 2NS8A 5F04A 3Q0WA 3UKGA 2AO9A 2DMNA 1DU6A 4J19A 1VNDA 2R92J 1MNMC 1T33A 2MGQA 2WAQN 1LFUP 3S1QJ 4I76A 1MSFC 1B8IA 1WCMJ 2LKXA 4B4CA 2LP0A 5E3NA 3OIOA 3M4OJ 5F1JA 2NVXJ 1ITYA 3CMYA 3B6CA 1BW5A 1ETKA 3DCFA 4FTHA 2LR8A 1FTZA 3ZOBA 3ZQHA 4AC0A 3D1NI 1ETWA 1SFOJ 3JRHA 3BR2A 3MN2A 1MBEA 3BTIA 3LSGA 1RESA 3DEWA 4W97A 5DS9A 1VI0A 1WGXA 3OSGA 3A02A 3F0CA 1YRNB 1X2MA 1XG1A 3C2BA 2HDDA 4GFBA 2OF7A 3PM1A 5FKMA 5FKKA 4V2GA 2EQRA 2YUSA 5M3MJ 2R5ZB 3SJMA 2VUMJ 4A3BJ 1GVDA 4XK4A 2N8GA 5DTDA 1ZGWA 2EZIA 2I10A 2AHQA 4JX4A 3PO3J 1D5YA 2TCTA 5K7FA 1IV6A 3LSRA 3LOCA 3HBLA 5JLXA 3NAUA 2XB5A 2W48A 1Z0XA 5F0FA 5F08A 4QIWN 3HOYJ 3CQZJ 3FIWA 2EH3A 1I6HJ 5M5XJ 2JA7J 3RZOJ 1AHDP 1ORKA 3BG9A 4RBOA 2DMQA 2E2IJ 1ETOA 2E19A 1EF4A 1WH7A 2HOSA 2VKVA 4C3IJ 1LE8B 4BY1J 1IRZA 1OCTC 5EF6A 4D5FA 3S2DJ 3S2HJ 1TC3C 1P7JA 1LFBA 4S0HB 4LOCA 2L7FP 2DA1A 1FIAA 2TRTA 5EYRA 1R9TJ 1HDPA 4FE4A 1X2NA 2X6OA 3G1OA 2DA5A 2DA4A 3IV5A 2QF7A 2CJJA 3IH2A 4A3IJ 2H8RA 2LLKA 4C2MJ 1H8AC 4M3DA 5E3OA 3BR6A 5JLWA 3OOUA 3ZQLA 2JMWA 2R93J 1POGA 5E3MA 5HODA 1HOMA 2K9NA 4DW6A 1APLC 1ETYA 2O8KA 2ELKA 3CDLA 2OPTA 2M34A 3ZQFA 1WI3A 4XRSG 1GUUA 1ENHA 4XICA 1E3OC 3GTQJ 2D5VA 4DZPA 4BXXJ 3HGYA 3VPRA 2R5ZA 1WH5A 3BR1A 2L7ZA 3H0GJ 1Z77A 2DN0A 2NVYJ 3HOVJ 1NTCA 4FCYA 1IJWC 2DMTA 2LK2A 1HLVA 5GP9A 3JRDA 3BTJA 3JREA 3JRAA 3GTPJ 3LSPA 5F0HA 2GLOA 3TEDA 1ETXA 1JTXA 2M2EA 4M6VA 2LY9A 1OCPA 5K7HA 2CUFA 2P81A 2XPVA 3K7AJ 3LNQA 4IHWA 3JRBA 5IYCJ 4XRSA 1LE8A 1TWHJ 2L9RA 2EZKA 4QTRA 4NDLA 3W6VA 9ANTA 2O9LA 2DA3A 3TP0A 1JUMA 1U9OA 1AKHB 2IEKA 3ZQCA 1FTTA 3GTGJ 5EGOB 2R5YB 3S1RJ 5C3EJ 1JJ6C 1ZKGA 2K40A 3E7LA 1W0TA 1UG2A 2XGEA 2XRLA 4A3KJ 1RKWA 1BA5A 2HYJA 3FKIJ 3BR3A 4IHVA 5K7ZA 1TWGJ 2Y9YA 2NS7A 3RKQA 1A6IA 2JJ7A 1IC8A 1JGGA 1O4XA 2QCOA 4C3JJ 3BG5A 1PUFB 4EEFG 1FJLA 4MFDA 3OSFA 1P7IA 3BT9A 1B72A 1WPKA 1ZTRA 3WHBA 4XRMA 1U9NA 2DMPA 5EEAA 1MSEC 4A93J 5M5YJ 4D7MA 1W0UA 2HXOA 4MLOA 4D7NA 3RZDJ 2L7MP 1U78A 4V2FA 2HI3A 1I50J 4BY7J 4A3FJ 5F27A 2K9QA 2DTZA 1G2HA 5IP6A 3S1MJ 5EDNA 3BQZA 2CQXA 3PO2J 2E2HJ 1ETVA 4IHYA 3GTMJ 5C4XJ 4DYRA 1AU7A 4A69C 1K61A 4M3FA 2FQ4A 4BKXA 3HKZN 3LSJA 3HOWJ 3FK7A 2M0CA 2ECCA 2R7ZJ 5GPAA
chains in the Genus database with same CATH superfamily
2ZMEA 1YS6A 5E8IA 2QZ8A 4ZTFA 2DK8A 2KQRA 5L3BA 3GTOJ 4M3GA 1ZGAA 2KISA 4BBRJ 2HZTA 3R61A 3KYCB 4KIFA 3RPUD 1DPRA 2ZKZA 1OYWA 3VYSB 4EJOA 2M9HA 2AQFA 2IGKA 1JKQC 3KZYA 1RKTA 2IS6A 3HOSA 1D1BA 5CVVA 3S1NJ 1N78A 3SXYA 3LSMA 2K5CA 3X2QH 2EV6A 2VXDA 4RLQA 1AKHA 4A3CJ 2WBMA 5DCFA 1NK3P 4F55A 2LYCA 3F3XA 1SD4A 1MMAA 2FJ1A 3PL8A 1IW7F 4WXHA 2E60A 4UHTA 1PUFA 4RDUA 2KIUA 3H3UA 2LF8A 3MKZA 2IAIA 2JK3A 2UXNA 2ID3A 3T5XA 2EV0A 2XF7A 2A6TA 3ERED 2WADA 4MEYF 2VI6A 4EJVA 2DFFA 2FMLA 1MW7A 1BR1A 4A3JJ 4M71A 4LJZF 2P5LC 2WY8Q 1W7PD 1XD7A 4XKCA 2KMUA 2LFBA 2A6HF 2DDAA 2CMPA 2HQ5A 4BU2A 3L2VA 5LHGA 4IQJA 2L9NA 4IHTA 2GOXB 5J8FA 4BUPA 4Y52J 4I02A 1J5YA 5BOXA 4L0YB 3GLLA 3F22A 5H20A 2D1VA 4CCMA 3BJ6A 1NH3A 3MQ0A 4DZJA 4BJ6C 1IAWA 2OQGA 3M8JA 3SEZA 1W36C 3PNYA 5ILUA 3QWLA 4A3MJ 3MVPA 3BP8A 3MWMA 5JHFA 1D5VA 1HCRA 5B1AH 3M3YJ 2VLAA 4ASNA 3CLOA 5A2QZ 5DV5A 2XVCA 5LRRA 2R7RA 1KU2A 2QBYA 4CZCA 2ME6A 3JRFA 1MNEA 4A3EJ 3JRGA 3DPTA 3I4MJ 4E7KA 2Y30A 4HSRA 1OQYA 5IT9K 2PN6A 1Q1VA 2FNPA 1QRYA 2ELJA 5J47A 3HL2A 2V79A 3SFIA 2VXZA 2MD0A 4RB0A 3HHHA 1FYKA 5K1YA 4AYBN 1YJNI 3IKTA 2JUGA 3KP2A 4L9NA 4A3GJ 2DPUA 5H6RA 5GPCA 1Z3XA 1JXSA 1K83J 3GZ6A 3FXJA 5CKTA 1LB2A 4JBAA 1FLIA 1BW6A 5CVIA 2F5CA 5HNFA 2Q2EA 1SFKA 2DMUA 3ESWB 4UUSA 3OYJA 4HAMA 3AFHA 2IS2A 5B66C 3SZTA 1FOXA 1GXQA 2QKMB 4GO1A 2X85A 4CGZA 3MD2A 4LG3A 1EA3A 3KLNA 3L1PA 1Z3YA 2A07F 2ZJ2A 1FOYA 3DP7A 4J01A 1XGNA 4CYCA 2UZKA 1HA8A 1MD0A 3OYLA 1MBKA 3F8CA 4ABZA 1D1CA 2M7BA 2CO5A 2XF5A 1FYLA 2F5FA 2L2OA 1VQPI 3A2KA 4U7BA 5KAIC 2VJIA 2V1NA 1IDYA 1GXPA 3P9IA 4HV5A 4EM0B 1MMDA 4EV0A 4XORA 2JRMA 2C6YA 3P5JA 4S04A 1WFXA 3G1LA 1VQ8I 1GT0C 2M3AA 4HOBA 4G6TB 5EZGA 3KPHA 2XAUA 1OCRH 3TDZC 4B1RA 3KP3A 3S3MA 4IF4A 3L09A 1TNTA 2YU9J 4M9ZA 2HDWA 2Y75A 5F0CA 3V42A 2BHZA 4E7LA 1RC9A 2DODA 4F7ZA 5IYDJ 2LREA 3D5LA 2OBPA 4BS9A 2EBIA 1BC7C 4NBQA 2GOMA 4EM2A 2OUMA 1B72B 1IGNA 1TTYA 3BR5A 4E7JA 1UFMA 1CGPA 4W1UA 2PFBA 2BXZA 3G1MA 3I58A 1YQAA 2NS0A 3I59A 5FJ8J 2HTJA 4KN4X 2LKSA 4IRHA 1W7PB 4BYYA 4NUBA 4HNVA 4MIMA 5HNHA 4CH7A 3HSRA 2EA4A 3K70D 4RLFA 3KP4A 2ISZA 1JI8A 2LDUA 3BG6A 3E1SA 4G7HF 4PUSA 2XC7A 1T39A 3CC7I 4G7OF 2RAEA 2HOTA 5E1WA 1R00A 1U6GA 2NVQJ 2DQRA 1G3TA 4BH9A 2CH0A 4RGUA 2IA2A 4CUGA 4HA8A 1I27A 3A1YA 2FBIA 2R92J 1T33A 4A2UA 1TNSA 4YEJA 1ODDA 5GAEJ 1WCMJ 4ESBA 2LKXA 4FX0A 1T0FC 5E3NA 3OIOA 4D1QA 4HDVA 1BW5A 2LR8A 1FTZA 2ETHA 3BJOA 4O3MA 1BOBA 5GTIC 3D1NI 2M5WA 2X51A 1MZBA 2GQQA 1X1PA 4GXOA 3BDDA 1X1AA 4OWRB 5BMZA 3ZN1A 4W97A 5DS9A 5K5OA 3A02A 2I5UA 3I53A 2R7SA 4AYBA 1X2MA 1LDKB 5DYMA 2F48A 2OF7A 3HRUA 5L3GA 1YJWI 1VQ7I 2EQRA 3K2ZA 3H5RA 3K4LA 5D5UB 3MAJA 4XK4A 3PFYA 3RTRA 2EZIA 3VYUB 3OYBA 4IKFA 2PLYA 4EGYA 1T0FA 2X0LA 3HC7A 5K7FA 3HSFA 2L54A 3F23A 3S32A 2V26A 3LSRA 1G4DA 3E5QA 3IUOA 2GIVA 2P8TA 5CLSA 3IRQA 3AAFA 3OS1A 2W48A 3DU5A 1R1TA 5F08A 4QIWN 4ZH4F 2X6WA 3CCUI 4ZYHA 3HOYJ 2WV0A 2YU3A 5CVJA 3CQZJ 3SZGA 2W82A 4E7ZA 4NC7A 2A69F 1PUEE 2ZO4A 2JA7J 1XMAA 1AHDP 4P5OA 2VL8A 1E3PA 2DMQA 2ZSHB 4L5IA 1O3SA 3WGIA 1WH7A 1J75A 2VKVA 3RQ4A 4C3IJ 2HOSA 2L3DA 2LG4A 1TL8A 3BG7A 4XRFA 1OCTC 1P6RA 3LSIA 3GXOA 2ZFWA 3H9GA 3ZCOA 2A5YB 5E18F 1LPQA 1VQLI 3M7GA 2TRTA 2FMYA 1OLTA 1WQ2A 2ADUA 3W2AA 4FE4A 2DK5A 1XGSA 2K3PA 4WF2A 4PJ0C 2DA4A 2QF7A 2X4HA 1FC3A 1T38A 2V9PA 2H8RA 5LHHA 2M4GA 1H8AC 5LEKA 5CVUA 1X1DA 3ZQQA 5GTHC 1Y0UA 5E3OA 3BR6A 1I1SA 2JTVA 1AWCA 3ZQLA 3U21A 1QNTA 2A6EF 4PSWA 5HODA 2Z5UA 3CUQB 3FMSA 1SD5A 3PUBA 2O8KA 2HKOA 1B59A 4XSZF 2M34A 2QQBA 5LLQA 1ENHA 2A3SA 4XICA 3LAPA 3GTQJ 1HKQA 3E6MA 3FXUA 3BY6A 3HGYA 4PJLA 4O5VA 2R5ZA 2M45A 4H0EA 1KQ9A 2F4OB 1V3FA 4FHTA 3RCOA 2CSOA 3BR1A 2L7ZA 4N9HA 3H5AA 5KK1A 1KQ0A 3EPZA 4LLNA 2LK2A 1BR4A 3U1DA 3OS0A 5ICCA 3KLOA 3HZJA 4E6KG 5ICEA 3JRAA 2ZMEB 1RIOH 2O5RA 4BJTA 4EJWA 3TOBA 2F5VA 2DYSH 4AVPA 3TEDA 1F4KA 1ETXA 2YR2A 4R79A 4UVAA 2E34A 2CUFA 3KEQA 3RSNA 1R4MB 2XPVA 4G7ZF 4IHWA 3CUOA 2NYXA 3E97A 3JRBA 2W7NA 4ZTJA 1WVRA 4QWQA 4LLGF 1FMVA 5FGMA 1MNDA 1X1BA 4BQAA 2HVQA 9ANTA 2O9LA 2H6BA 2WA0A 2EFOA 3I54A 1XCBA 1AKHB 1LUJB 2IEKA 1S9HA 4IL6C 4HDUA 4UB6C 2M8EA 1SD6A 1W0TA 1R36A 2XGEA 1LDDA 1RKWA 2Y9YA 3WU0A 5ED4A 1A6IA 3GMEA 2BHYA 1O4XA 3F8MA 4C3JJ 1PUFB 1ON1A 2IW5A 1FJLA 2VC1A 3C18A 1WSUA 4IQ4A 1B72A 1WPKA 3K1MA 5IT3A 4A93J 5FRMA 1LVKA 1W0UA 5DM7F 4MLOA 1B9NA 1T98A 1I50J 1K7AA 3VYRB 2NXNB 1J09A 4WWCA 3CJNA 1FNNA 1OISA 1UELB 3BZCA 3GUDA 2Y0MA 2TDXA 1W4MA 1IN5A 3KCCA 2F4MB 3VDXA 4MTEA 2JRTA 1AU7A 4A69C 3J7YJ 1Y6IA 4M3FA 2FQ4A 1R1UA 3PFIA 4XR6A 4I0BA 3HOWJ 2RVCA 1ZELA 1ZLJA 1USTA 3FMQA 2VT2A 5GPAA 1IRGA 2ESHA 3F21A 3ZR8X 2Y31A 3TKYA 4XLAA 1B4AA 1YITI 4G6DA 3TQNA 2VODA 3G71I 2VKEA 3FF5A 4UXNA 2RV8A 2HU9A 3JSPA 4BACA 1XGOA 1O3TA 3IHUA 3BOQA 5HS9A 4A0XA 5J4VA 1RETA 3KETA 2A68F 1YS7A 1E17A 3Q0VA 3KEYA 2QBYB 4ZDLA 3R60A 4HYEA 4Y33A 3AL0C 2KL4A 2HVRA 1JGSA 1SFEA 2CYYA 4X0GA 1T8IA 2QVOA 5E20A 4KA4A 5GADJ 1WJDA 5EGOA 1MJBA 4XBFA 1U3EM 1A35A 4XIDA 2JPBA 4DYQA 4B09A 3QAHA 4I09A 5LGNA 1BN5A 2BEOA 1RPWA 2IS1A 4AUXA 5E1ZB 1ZRDA 2DA7A 3OIQA 2IRFG 2FBKA 4UY8I 1V5FA 2CQQA 2IGNA 2M4KA 2Q2EB 4AU7A 4CXFA 1R6RA 3NWSA 5DEQA 4UUSB 3ZP5A 1R5ID 4BEHB 3FBIB 3VB2A 4N9IA 2XGCA 1BBYA 4JX6A 5LRSA 3WHCA 4I99C 1XDUA 2LBFA 5IPAA 2IP2A 1GV5A 5KHDA 1KZHA 3WODF 3CP8A 1RR7A 5FD5A 4CYCB 2O8XA 2CRGA 2OA4A 2W00A 3MMYB 4F3QA 5J3LA 1V5GA 1HW1A 3FISA 1D8KA 1RR8C 2IBDA 2H8WA 3Q0UA 3PJRA 4LB5A 3FXOA 1Q1HA 1AOYA 5IOYA 3OL4A 3HIFA 4IOAF 3B6AA 1J2XA 2AXTC 2QQ9A 4DIQA 4L9JA 3K70C 1QHHD 1PDNC 1SAUA 4DYCA 4PGHA 4RGSA 2H1LA 2O3FA 5CQEA 1ZK8A 2V1DA 4C2TA 5D8KB 3QPSA 5HLTA 1ZN2A 2NVTJ 2GAUA 1ZR4A 1QZEA 1GLNA 2Y0SN 1E0EA 1O57A 3VYTB 1BI3A 1H9GA 4E7HA 3H3VK 1S29A 2V1XA 4LIUA 1FBSA 3GTLJ 1JHFA 3CMMA 4KITB 2WV1A 3K69A 3JAMK 2X48A 1WKMA 3L00A 2DA2A 2MC3A 2QLZA 3I59B 4FT8A 4GYGA 2IS4A 1CQTA 1UMQA 3S93A 5C4JJ 4G6QA 1VQNI 3C2HA 1MBFA 1UB9A 1X3ZB 2E1NA 2PMZA 1NHAA 2MSYA 4ZYAA 2UXXA 5HOOA 2DT7B 3DXJF 1TT5B 4HX7A 4XOTA 4RAYA 2FSWA 1FWZA 2WB1A 3BROA 5BPIA 2P4WA 5TJJA 5FRNA 5HDKA 1IUYA 3HG9A 1N75A 3S14J 3JRIA 2FD5A 2HTSA 2EZHA 5C44J 3OV8A 4MFEA 2LMDA 1IXSB 5D5VB 4C2UA 1MKMA 4M6XA 2JSCA 4XKBA 3VSLA 3ZGKA 4A0ZA 3MZ8A 4NB5A 1HKTA 3J7AY 2E5ZA 1GVJA 3QPLA 4P9UA 4L5JA 1LVAA 4DBQA 3TW6A 1S7EA 4WCGA 3K2AA 3WE3A 3L2WA 1TWFJ 3HEFA 2B63J 3GCMA 1R22A 3FXKA 2FNAA 3Q9SA 3F6OA 5JVGF 1U5TC 4A5NA 5J1UA 4PFPA 2R0QC 4DJAA 4ZZLA 2R3SA 4RM3A 2KPMA 2LY1A 3HRMA 2XKPA 3LQRA 3S17J 3HXLA 1BL0A 2LOOA 3V7SA 3BLYA 4PK4A 4XNFA 4PGGA 1R5GA 5IP9J 2BOLA 3BJAA 3OYHA 3R0JA 2E1OA 2F6CA 2E5NA 2HR3A 1XSVA 5FFXA 1K6OA 4PFOA 1BIAA 1TW3A 3GFIA 2ZBKA 4ETSA 1RUNA 2CG4A 3CF5F 2VQCA 1B6AA 3O8HA 1MH3A 1DUXC 2VIXA 3F8BA 4KDPA 4JX5A 2JA8J 2GA2A 4DOZA 1MH4A 4IHXA 1U5TA 3M9AA 4L9TA 1CF7A 1NK2P 3JRCA 4OAZA 2VBXA 4HQEA 1FIPA 4LGWA 2BY1A 3GZNB 1FP2A 2K85A 1IO2A 1BJAA 3RKXA 5LBQA 3MKWB 4A5MA 2WY7Q 4I2OA 5B5EC 4EJUA 4FE7A 1HSJA 1VFCA 1D8JA 2XUBA 1XTAA 4ON0A 5M5WJ 1LEAA 1W5SA 2KT0A 3CCYA 3MCZA 5F04A 4J19A 1VNDA 1HKSA 4LD5A 5F1RA 1MNMC 3HTSB 4KMFA 3EUAA 4S05A 3S1QJ 2Y0SA 2JSPA 1MSFC 3H92A 2EINH 2H94A 1ULYA 2KIQA 4ZC3A 3B6CA 4F52A 1ETKA 3DCFA 4XKWA 4FTHA 1OYIA 2D1HA 4F91B 3ZQHA 2FA5A 3J80K 1SFOJ 3QYEA 3BCAA 1VTNC 1O3RA 4H4KC 3MN2A 3H36A 2K4BA 5LEJA 3H9QA 3LA7A 3LA2A 4D0PA 1D0ZA 1T95A 4AM3A 2UWMA 3F8FA 4RMNA 2QSGX 3QPTA 3F0CA 4HV6A 2O6GE 3CC4I 5HDNA 1G6NA 5FKMA 2JQ7A 4V2GA 4EVIA 3OWTA 5M3MJ 2R5ZB 1W5CC 4ZYGA 4IJAA 4NC8A 4I98B 2K86A 1D0YA 3WTYC 2VUMJ 1ZGWA 2AHQA 1KU7A 1IRFA 5FB2A 3FHZA 2VC0A 2PG4A 2XGXA 3I3LA 1E3HA 5HS8A 1FZPB 1ONVA 3J81Z 2IVMA 3T0YA 4BEHA 3I64A 2ESNA 2Y48A 4M73A 1MGTA 3HBLA 4KMUX 4HF1A 2XB5A 3AG2H 2K7LA 5F0FA 4NHJA 3M1EA 3LMMA 1ON2A 3LAJA 3RKYA 3I5UA 3QRFF 2HNHA 4C30A 5HLIA 4P9FA 3D5RC 1I6HJ 3KIOA 5M5XJ 2F4IA 3BG9A 4RBOA 1SMTA 3WTTC 3MFKA 3SFZA 2HPIA 2E2IJ 1KYZA 2HEOA 5ICGA 3OYAA 3KP6A 4BY1J 2EWNA 5EF6A 3K4JA 4I0AA 1YI2I 3S2DJ 4Q4ZF 3S2HJ 2V6CA 3L2CA 2VT3A 3OR1C 4S0HB 2A5WA 1DP7P 2L7FP 4XLPF 4L18B 4K2EA 4XOPA 2EFWA 1X2NA 2HYGD 1SEUA 2DA5A 3IV5A 1Y0NA 4G94A 4LG0A 3HPHA 4HRIA 2LLKA 2GXGA 1SVMA 3SEQA 4M3DA 5JLWA 4U7DA 3WTVC 5DUKA 1TW2A 2EIJH 5FLXZ 2R93J 2P6TA 1POGA 1APLC 2QM3A 1X4OA 2DFEA 2G7UA 2EFPA 4KICA 2BW3A 1I5ZA 2FUG2 2O61A 4Y4RA 4GDFA 3PSIA 5DDGA 2QENA 2LKPA 3K4NA 1XN7A 4CO8A 2BXYA 2M30A 2VBZA 3U2RA 5DCMB 2XHKA 2YX4A 4YIFA 2KIFA 3I55I 2FQ3A 3E0JB 1MMGA 1IJWC 2OTJI 1D3YA 3ABTA 3FWEA 2XV4S 3IRRA 4HLYA 3AG3H 3JRDA 2Z1DA 4BXFA 1R71A 2V6EA 5F0HA 3ZMUA 2E36A 3CJRB 1WJEA 1VQ5I 2G7HA 4UUVA 1LKXA 1IZ1A 3DTEA 4I7HA 4RA2A 2M7AA 2M2EA 2LY9A 3HYIA 4IXAA 3KEOA 5K7HA 2W1OA 2P7VB 4HF0A 4HNUA 2R7OA 3LNQA 1FX7A 2VBYA 4YFKF 2UV1A 2L9RA 1AA7A 5KCMA 4A12A 4CA0A 4YFXF 1J0RA 4NDLA 3PNVA 4YRVA 3W6VA 3ZMZA 1S3JA 3ZMTA 3FDYA 3DLAA 4V19K 3ZQCA 3W6KB 3GTGJ 5ILSA 5EGOB 2R5YB 2E7XA 1JJ6C 4XM3A 4OIRF 1ZKGA 3W2VA 5EJCA 2L9VA 2XRLA 3QYBA 5D8LB 1BA5A 4EATA 1ZGJA 5K7ZA 1TWGJ 2NS7A 1PP8F 4CICA 2QYOA 2J5PA 2JJ7A 1FY7A 1IC8A 2QCOA 5FFZA 3EDPA 3OSFA 3BT9A 1ZTRA 4CCOA 4XRMA 2EILH 5EEAA 4II3A 4JOMA 2NAZA 2KRFA 1P2FA 2GIZA 3K10A 3GFMA 4BHBA 4D7MA 4IRIA 2R7WA 4D7NA 3RZDJ 3OR2C 5FD6A 5LGUA 4KYWA 1NG6A 3ELKA 3AL0B 3S8PA 4A3FJ 2W84A 5F27A 2LBFB 2DTZA 5D5XB 2OCCH 1YG2A 2KRHA 2HYFA 4HBLA 4JQFA 1YYVA 3JTHA 3ZPLA 1P4AA 2CQXA 2L01A 4CSWA 2E2HJ 1ETVA 3GTMJ 2EIKH 3ONQA 3V7RA 4AIHA 1P9QC 1YIJI 3COAC 3H9JA 1TZLA 1K61A 3TDUC 3PSFA 3HKZN 1V5EA 3LSJA 3T1BA 4GCVA 1REPC 1BM9A 4PDKA 4BQQA 3PIOF 2R7ZJ 4UUTA 2ECBA 4JK1X 3T8RA 3GTJJ 2RNGA 4J00A 1WZ2A 2G9WA 3SZPA 1X4PA 2R4GA 4IRGA 3K1NA 4WK8F 1DPUA 2VOPA 3EYYA 1XC5A 1B8IB 3D0SA 5D5WB 2DU9A 5JI6A 2JA5J 5IY5H 1YTYA 2FOWA 3CD6I 2HKXA 2BZTA 3N4MA 5B3SH 2LVSA 3B02A 3IC7A 4FETA 3QPHA 2VN2A 3B73A 1F5TA 4B3AA 1WRJA 4KUMA 3WTXC 1QBJA 3ZN0A 5KVRA 2XDVA 2EZLA 2LSOA 4JYKA 3CF2A 5LGTA 2OD5A 2KLOA 2Q8KA 4NQWA 5BS6A 2Y2ZA 4A6DA 4UVCA 1VQ4I 1S8NA 2H6CA 1F36A 2E1MC 2PI0A 3PQKA 3ISPA 4ESJA 1SAXA 4B3XA 2FBHA 3GFLA 2G0EA 3Q5FA 1OR7C 1ACIA 4XSXF 1QVTA 3RYRA 2O0YA 3KX2A 2WAEA 1MBJA 1VZ0A 2R7FA 3WTZA 1YFHA 5IT9Z 4OIOF 3QYFA 5J40A 4KT5C 3K6GA 1WHUA 2CW0F 2V4JC 4CDGA 5FKOA 1XS9A 5L3CA 3BZ6A 2L4MA 3FM5A 3V8KA 2K9MA 3Q3SA 3ROUA 4N4OB 1XMXA 3JTGA 2Y9ZA 4P96A 1RI7A 1QO0D 5E79C 3L2UA 1BIBA 4FX4A 3V4GA 2OAZA 2CUZA 4QLCU 2COBA 5J1RA 3I4NJ 2P0WA 1M1EB 3NARA 1OR7A 4WXDA 1E2XA 1I39A 3WTSC 4B48A 1QZYA 1PP7U 2B0LA 4E70A 2XPWA 1WJ5A 2CQ7A 4PJJA 3OL3A 3CCMI 1U8BA 4X1EA 1JKOC 3QQAA 3TO7A 5FLMJ 1LFPA 5GAGJ 3DLLF 4IPAA 1G59A 3BR0A 1JE8A 1G3WA 1ZG1A 1YO5C 3SQNA 1FOWA 4IX7A 2GXAA 2D2WA 3HOUJ 2XSDC 3HOTA 1LDJA 2X9DA 1ZH5A 5D6EA 1YX5A 3E6CC 5JR3A 1B9MA 2FE3A 1Y1WJ 2MW8A 2BY0A 1RRJA 4EM1A 1FBQA 4KNYA 1EJ9A 4C9YA 5K5QA 3DKWA 2ISYA 1F43A 1U5TB 1CF7B 3HHGA 3CLQA 3HUGB 2XIGA 1ZHFA 3W6JB 4MO7A 2PMZN 1Z67A 4NNJA 1S72I 3S16J 3FXLA 5DCMA 3QU3A 4MQVA 4G12A 3HKZA 2WB1N 1ERDA 1V55H 2BY2A 3G73A 1YJ9I 2DCEA 4ZYDA 2ZB9A 1IV8A 4C3HJ 3IP4B 1IDZA 1KONA 2VJJA 3RPQA 3DKXA 1U2WA 1A36A 3KP7A 1H88C 2CW8A 2HWVA 3ZQGA 2M8GX 3HRSA 4BNCA 2IA1A 3HDDA 3FXQA 4LFUA 4XL9A 1DU0A 5A2QK 3D5SC 5AONA 2R7UA 4MNUA 3SDBA 3PQJA 4D5CA 3G6EI 1XGMA 2HOAA 3H35A 2VJ5A 5M3FJ 1YW8A 1YX3A 2LC2A 4GGGA 4HG2A 3VWBA 1Y56A 1KU9A 3DFGA 5IYBJ 3WTWC 1FEXA 4BL0B 1X3WB 2OQRA 3OMYA 4LK1F 1GDTA 5HVQC 3CMAI 1P4XA 3FHNA 2IT0A 2R5YA 3C7JA 3R4KA 1MMSA 4A3DJ 3O3KA 3LFUA 2F5DA 1GHCA 2KJCA 1A04A 1BI1A 2ZJPF 1HDDC 4OAYA 2MH2A 4ZDPA 3LSHA 4LMYA 2AXLA 1IXCA 1QVUA 5IP7J 2NVUB 4IO9F 4XMYA 1A5JA 2QSHX 3PNTA 3TGNA 4HX8A 1MJAA 5JFRA 1H89C 2OCEA 1ZR2A 1MBGA 3CP2A 2VE9A 1LJ9A 1YOVB 3TW7A 4LB6B 3CCJI 1SC7A 1DP3A 2QQAA 1JKPC 4I01A 3BCBA 3MZYA 4MEXF 2VPRA 1QGPA 3MKLA 1BOAA 4L0ZB 4M74A 3HM5A 1Z91A 3FBNB 1ZQ3P 3IH3A 3A01A 2W25A 3TOAA 4O6JA 4IHSA 3DU6A 2HQRA 4DBRA 2CV0A 4MGRA 3E6BA 3ASNH 2XAFA 3GW2A 4N0BA 4DGWB 5EG0A 4RAZA 1JUSA 4BE0A 4ZDOA 1K6YA 4UNOA 3GO5A 5EEGA 3WU2C 4NC6A 3OYNA 2WTEA 4EQQA 1HSTA 1Z21A 4XLHA 2E2JJ 3Q0WA 3UKGA 2AO9A 2DMNA 1VQ6I 1DU6A 3DTIA 1SVLA 2MGQA 4BDYA 4XLCA 4RB2C 4MTDA 1B8IA 2DFHA 5ICFA 2P7CB 4F93B 2ZCWA 4RAGA 2IJLA 5F1JA 2NVXJ 3UR3C 4LG0B 3M4OJ 1ITYA 3CMYA 3SHFA 1S5LC 5H6QA 2IPQX 3OIPA 4KIGA 4YELA 2DBBA 3DBLB 1ETWA 2PJPA 3V8JA 3JRHA 4A0YA 3CCEI 3BR2A 4XLEA 2PJRA 3EETA 5HDGA 3LSGA 2DOEA 2I8DA 2V9VA 3DEWA 2PMHA 4B43A 4OMYA 1VI0A 3OYEA 2BGCA 1WGXA 2DOAA 3OSGA 5D6FA 2AS5F 2BW3B 4KT6A 1XCVA 1YRNB 1S7AA 1XG1A 2Z99A 2HDDA 4GFBA 2BBYA 1U8RA 2QQ8A 1K4SA 1TQIA 2DJIA 2YUSA 3SJMA 3RYPA 4PCQA 2NNYA 3G4SI 4A3BJ 2N8GA 5ERIA 5DTDA 4QPOA 3JSOA 4RB3C 2XAJA 4JX4A 2R7TA 3RDIA 4BXUA 1D5YA 2PBIA 5CQGA 4CYDA 2TCTA 2OU2A 1WI9A 1FPQA 2P5KA 2EIMH 5FO5A 1XSDA 5JLXA 3IKVA 2QWWA 2VONA 1Z0XA 1OCCH 1V54H 3GWZA 2HGCA 2IXSA 4U88A 3EQLF 3FIWA 1EH6A 2EH3A 3K4BA 3I0TA 2BVLA 3GLXA 3LQQA 3WTUC 2ZFUA 3F9KA 1QA6A 5F6FA 1ETOA 4EGZA 4RB1A 4CHUA 1EF4A 3BWGA 2JPCA 2BE5F 3LFKA 1IRZA 1S6LA 1HW5A 1P7JA 2DDBA 4ENKA 2EJRA 3KZIC 1LFBA 1UAAA 4KFCA 1Z6TA 3ZMDA 4Q47A 4II2A 4RGXA 1FIAA 1I6XA 3DWLE 1F9NA 3IWFA 5EYRA 1KA8A 1R9TJ 1HDPA 3S3NA 1IN4A 4HPQA 5LHIA 3DEEA 4A6EA 2PQ8A 2CJJA 3IH2A 4A3IJ 1YHQI 1C0WA 2VB6A 4Y3OA 4ZYEA 4EMSA 1FOKA 1ZAOA 4U0YA 1LNWA 2RREA 2WAFA 2LH9A 4XN3A 2JMWA 2LF7A 3C3WA 2XAHA 5E3MA 2HQAA 3TBIA 2M1BA 2X1EA 3F72A 4KN7X 5GAHJ 4XQFA 5LD2C 2STTA 1ETYA 3CESA 3QODA 3T8TA 2ELKA 3MKYB 2L7KA 2PMUA 3CDLA 3DBRB 3ZQFA 1WI3A 4XRSG 1GUUA 3HUGA 2D5VA 2L9SA 2CV2A 4ZJZA 3VPRA 1VQOI 2R7DA 2X6XA 2VE8A 1WH5A 3VEPA 2CUJA 2E7WA 1N25A 5E1XA 2B9SA 1N77A 1FT9A 3H0GJ 5J8CA 4HZFA 2DN0A 4FCYA 1UZCA 3CZ6A 4AIJA 1R58A 4WXCA 4Q48A 3OYDA 1UHMA 3F8NA 3WG7H 2KIMA 3JREA 2GXBA 2RKHA 2RNJA 3LSPA 4PZJA 4OINF 1ZRFA 2KRCA 3N05A 2GLOA 2DQLA 3C1DA 1JTXA 1A31A 4ESFA 1IN6A 2BVMA 3JW4A 3ABUA 3L2RA 1XSXA 2COMA 2P81A 2GWRA 3HJEA 1LQ1A 1HW2A 4PSXA 2IA0A 1LE8A 3K0LA 2EZKA 3ECHA 4QTRA 3R0AA 2H27A 2ACJA 3DBHB 1U9OA 3WE2A 2E71A 3ABKH 1HBXG 4XN0A 1QPMA 4GRIA 2QA4I 4ENMA 2YSRA 3S1RJ 5C3EJ 1MMNA 2JUCA 4NQWB 2CV1A 2K40A 5CJ9A 4A3KJ 3OS2A 2D45A 3BR3A 3DQVC 2EPFA 3CDIA 3RKQA 3ML6A 2KDOA 2MABA 3H0DA 3BG5A 4LLLA 1KYWA 3CCSI 4CCKA 4FASD 2LNBA 3QOPA 5BPDA 3WHBA 1R1VA 1T6SA 2DMPA 3LSTA 5M5YJ 4U87A 2HXOA 1OCOH 3CTAA 4P55A 2L7MP 1U78A 3ZQ7A 4GYIA 2KP6A 1VQMI 2HI3A 3TO6A 1ZYRF 3CCVI 4FQGA 3CDHA 4UB8C 2DOFA 3FX3A 5IP6A 2RQQA 3TO9A 3S1MJ 4MQ9F 1UCRA 4UVBA 3EUHC 2E1MB 3IWZA 4DYRA 2DT6A 2F5EA 2GA1A 4U0VA 4BKXA 4YFNF 2HS5A 2EK5A 2FXAA 4CCNA 2M0CA 2ECCA 3ULQB 3GEZA 2X1CA 1XB4A 2XGDA 2FX0A 3FK6A 3AG1H 2R7QA 2KZGA 5E8GA 2DPDA 2KHMA 2L0KA 5DUIA 3DEUA 4IZZA 1GV2A 4LIVA 3KE2A 4N4NB 2DXIA 4OU0A 1BI0A 3K1PA 2HQNA 1DGRM 2HZDA 3VFZA 2MYSA 1Z6RA 2K4JA 3ABMH 1K78A 2GZWA 2LY2A 2RC4A 2ELHA 1PYVA 1T2KA 1EKEA 1SANA 2KKOA 5BNGA 2HFHA 4B8XA 4HQMA 2YX7A 4M6YA 3HOZJ 2R7XA 1I1GA 1HF0A 2CUEA 4E7SA 3EUHA 3IH4A 1BJZA 4RGRA 2OC6A 2RQPA 2BY3A 3M1CA 2P6SA 4M3EA 1YRNA 3RI4A 3S15J 3BTLA 3KYDB 2JN6A 2LTPA 3HB9A 4R1HA 5JHUA 1T56A 3J7AO 5EZHA 2MG4A 3NQOA 2QGUA 4BQNA 3WG9A 1Z1DA 2JT1A 2KJBA 5J4YA 3NRVA 1HXDA 2RGVA 1SMYF 3JAMZ 3OYMA 1VQKI 4ZZDA 2O7OA 4ENJA 1KQ8A 3EYIA 2ZXJA 4DQ2A 3BTCA 2K9SA 2Z2SB 4LITA 3QP5A 1QPIA 1O7FA 2E35A 2ZJQF 4E7IA 1JJ8C 2JA2A 2HOEA 2XPUA 1J9IA 2W4SA 3HRTA 2XB0X 4I6ZA 1UHSA 3BZKA 4IEJA 1UHWA 3RKWA 2GM4A 2AQEA 2RN7A 4E4HA 2L4AA 4A3LJ 4ANJA 1X58A 1B1BA 3KZZA 1TP4A 5J6XA 3CO7C 3TP3A 4HF2A 3M8EA 2BYVE 2JWTA 4PJMA 2CU7A 1DGWY 2DA6A 3KFWX 1ZREA 3OYKA 1YIOA 2V7FA 3RIRA 3AKZA 2Y69H 1FSHA 2HXIA 5HLHA 3P9CA 2NRAC 2W24A 3A4CA 3A03A 4BHPA 4KIBA 1O7LA 1MDMB 2DW4A 3P9KA 4Y7NJ 2QEXI 2DJNA 2OV7A 4M9XA 3GTKJ 2IGMA 1XMKA 4OOIA 1MJ9A 1EH8A 3BG3A 5F64A 3GVAA 5BQTA 3RJPA 3HOXJ 3QOEA 5L3FA 2MLGA 2A05A 4BE2A 4X6AJ 3R6SA 2O03A 2DFIA 3NEUA 1SFXA 3FXRA 4FISA 1S7OA 2H1KA 4Y13A 3TMOA 3A01B 2ZXIA 1Y8QB 5FKNA 2ID6A 1JUPA 4KISA 1IG7A 2MC4A 4MHGA 3MZHA 1HC8A 5EG0B 4QSHA 2VASA 1OCZH 3K4KA 1JT6A 1WWXA 5L3EA 4CZZA 5HLGA 4M9SA 2R7VA 2EV5A 1YE9A 3JR9A 3DV8A 1X1CA 2GBYA 2CWEA 4F92B 2WWYA 2JVHA 1TWAJ 2YS9A 3I4PA 3FM3A 1XPXA 1JHHA 2KFDA 1OJLA 2KDZA 2QKLB 1Y8RB 3CCQI 4G9YA 5H2FC 4BQOA 3LWFA 5IOZA 1Y1VJ 1FP1D 1BI2A 3DTKA 3FXMA 3WU1B 4OIQF 3BQYA 3CJQB 1UJ8A 2H09A 2QSFX 2VKDA 3CC2I 2DT5A 1OPCA 2FF4A 3BPVA 2PJRB 2X1DA 3E6DA 2K27A 3H5NA 4HSTA 1WJAA 2XSJC 1MBHA 2M87A 4JP0A 1X3UA 3LL7A 3O2PE 5FKLA 3S3OA 5K5RA 2V1UA 3ZMVA 3H1CA 1ETQA 5AIPA 2VQHA 4BBSJ 3HGGA 4L5EA 1MIJA 4G8XA 5J1YA 1J59A 1X19A 2XAQA 2NOGA 1KGSA 5FROA 3J80Z 2LD5A 2ICWG 3W2WA 5FLVA 2XRNA 3HSEA 5CVRA 3ZXSA 2EB7A 4M3BA 2JA6J 1KU3A 3FZVA 3ECOA 3OOPA 3OYFA 3N97A 3DPLC 1OFCX 3ZRGA 1OKRA 3O8GA 1QQIA 1WJFA 3CJTB 2ME0A 3QP6A 3ZQIA 1JKRC 1IXRC 1I3QJ 5D4RA 2FOKA 3S2WA 1IN8A 1JTYA 3DPUA 1OMIA 3I71A 4CCLA 1TLHB 1Z05A 1Z7LA 1VF9A 5TRDA 1F1ZA 1W36D 5E3LA 2MLKA 5KNLA 1TWCJ 5JVTA 2PX9A 1O3QA 4AD9A 2CQKA 4HX4A 3LSKA 2MFZA 2VJ4A 5CPRB 3VOEA 2ZXHA 3GBGA 1TQPA 4UV9A 1IUFA 3QU6A 1D1AA 2XROA 3L7WA 1JT0A 4OIPF 2HDCA 5TGTA 3SDGA 3RQIA 2Q1ZB 2NS8A 4XONA 2WAQN 1LFUP 4WX9A 4I76A 3RPUA 1LEBA 1XDSA 1NG7A 1STZA 3A0BC 2VKHA 2JVGA 4B4CA 2LP0A 2ZNZA 2K9LA 1FSEA 2EFQA 3AG4H 3ZOBA 3OYIA 4AC0A 2Z16A 2XKOA 2YPRA 4AIDA 4HLXA 5LFAA 1T08B 1MBEA 1UG0A 3U1KA 3BTIA 2Z33A 2DI3A 1IF1A 2X6YA 1RESA 1PVEA 3U9GA 2CW7A 3C2GA 2OTLI 2PEXA 2J5OA 3K9TA 2VOOA 1DDNA 4XLNF 3C2BA 1EH7A 3BPXA 3CCLI 2P5VA 3PM1A 2W85A 3V8LA 3SYTA 1EV7A 5FKKA 2LRDA 1Y39A 4Z6YA 4HW0A 3E3VA 2Z9OA 4BE1A 1GVDA 5HS7A 2I10A 1TQMA 3PO3J 3BC8A 1P92A 2K02A 2UUZA 3OYGA 4BHCA 1WJCA 3GZ5A 4B44A 3GX4X 3IL2A 2OZUA 3DF8A 3E5UA 1IV6A 4RAFA 3LOCA 4DNCA 2NNNA 5CYVA 1H9TA 3NAUA 1W7PA 4Y15A 1ZG3A 2BV6A 3NWTA 4YIRX 2MH9A 4AWXB 3W3CA 1RNLA 1XX5A 2IGOA 4KJZA 3RZOJ 1FYMA 1ORKA 1WJBA 1YW7A 5DD4A 1TT0A 2CS3A 1P4WA 2ZC2A 2E19A 3HTUA 4YIIA 3P7NA 1LE8B 2JZYA 4PJNA 5DM6F 2M0MA 4D5FA 1TC3C 1SD7A 4BAYA 3GYHX 3M8FA 3V7CA 2STWA 2Z3YA 1HQCA 2CFOA 4LOCA 1J7KA 2DA1A 3IAM2 2FEZA 3EUKL 3ASOH 3OY9A 2X6OA 2F2EA 3G1OA 3GF2A 1YLFA 2VQLA 2EFNA 3FKJA 1L3LA 2ZXWH 4TV7A 4C2MJ 4CCJA 1OYYA 2MBFA 2XF6A 3OOUA 4HEA2 3KYLA 5B1BH 4YG2F 1MDMA 3J7ZI 3WGGA 1RUOA 2B7EA 1BR2A 1R49A 1HOMA 2K9NA 4DW6A 3J81K 1W5TA 4Q5SF 2L5QA 2OPTA 4M72A 2DO7A 2ZSIB 3L2QA 1E3OC 4BXXJ 4DZPA 2OJED 1R5HA 1I3AA 3ABLH 3I9V2 3UNGC 3L9FA 2CGPA 3CMEI 4ENNA 3PIPF 4QPQA 1ZG5A 1SVOA 1Z77A 4Y17A 3FMRA 3H3ZA 1W1WE 2NVYJ 1NTCA 3IAS2 3HOVJ 4R8HA 3LA3A 2DMTA 5E17F 2WC2A 3VSKA 3KP5A 3CO6C 2V9KA 2K3FA 1HLVA 5GP9A 5L3DA 3REOA 2A61A 3BTJA 1DQUA 3WGHA 3GTPJ 3F6VA 3G3ZA 1VQ9I 1D0XA 6PAXA 2FRHA 2EA2A 2WAQA 4HNTA 3DKYA 1QZZA 4L9VA 3ERMA 3E5XA 1SFUA 5ILVA 1Z7UA 3Q9VA 1OCPA 4M6VA 1Z9CA 2DTRA 1BC8C 3CUQC 2HPMA 3OYCA 1IN7A 3K7AJ 2XASA 3K4MA 5AIQA 1ZARA 1K78B 5IYCJ 4XRSA 1U0JA 5EEHA 1TWHJ 5FLXK 1FBUA 3GFJA 4Z2YA 1QHGA 2Q0OA 1YW9A 2VBWA 2DA3A 3TP0A 2VPLA 4XLFA 1JUMA 1H0MA 2CQNA 4IVNA 2XAGA 4AVZA 1FTTA 4LK0F 4XKVA 4OMZA 3I56I 3E7LA 2KZVA 1UG2A 5TISC 1K79A 2MD5A 2HYJA 3FKIJ 4IHVA 4RM2A 2OZ6A 4BGDA 1ZRCA 1QU3A 2CFXA 3MEXA 4ITVA 2DYRH 1G8XA 5D4SA 4BJ5C 1JGGA 1TBXA 4AIKA 2ZMEC 1A6QA 4EEFG 1R23A 3ZMSA 4MFDA 1P7IA 2ZJRF 3CUQA 1U9NA 2ZNYA 4U0WA 1MSEC 2FU4A 1G3SA 2VQGA 3HPGA 5KAFC 4EJTA 4V2FA 1FMWA 2DAOA 4IOCF 2W57A 4BY7J 1L0OC 3VODA 1K4TA 5DD8A 1RZ4A 2K9QA 1USSA 2RDPA 1IRXA 1G2HA 3CCRI 3G2BA 3JCUC 2HVSA 1R7JA 3A0HC 4RS8A 1ZLKA 5EDNA 3BQZA 1V4RA 3PO2J 4UV8A 3TL4X 4IHYA 4BDZA 1G3YA 4P1WA 4B47A 5C4XJ 4D9JA 2E1CA 2MA3A 3K4CA 2QUFA 2L02A 3O6BB 3M07A 2NOJB 3FK7A 1PJRA 2DLLA 1R4NB 3PUFA
chains in the Genus database with same CATH topology
2XGDA 4UUTA 2ECBA 2FX0A 2Y31A 3GTJJ 3FK6A 2L0KA 2VKEA 3GTOJ 4M3GA 1GV2A 1XC5A 4BBRJ 1B8IB 1RETA 2JA5J 3Q0VA 2M9HA 1JKQC 2LVSA 1RKTA 1SANA 5BNGA 3S1NJ 3HOZJ 1HF0A 2CUEA 4B3AA 4A3CJ 1AKHA 2EZLA 3IH4A 1BJZA 4JYKA 5EGOA 2Y2ZA 4M3EA 1YRNA 4XIDA 4DYQA 1F36A 1NK3P 3S15J 3BTLA 2JN6A 2LTPA 3HB9A 1T56A 2G0EA 1RPWA 2FJ1A 1QVTA 5EZHA 2MG4A 4AUXA 2DA7A 1PUFA 1MBJA 4RDUA 2CQQA 2IAIA 2JK3A 2ID3A 4UUSB 5FKOA 2VI6A 1XS9A 2O7OA 2XGCA 4JX6A 4A3JJ 3WHCA 5IPAA 3BTCA 2K9SA 1GV5A 1QPIA 1RR7A 3Q3SA 2LFBA 4CYCB 2Y9ZA 1JJ8C 2HQ5A 2XPUA 2CRGA 5J3LA 4I6ZA 2XB0X 3FISA 1UHSA 4IEJA 5J1RA 2COBA 2IBDA 3I4NJ 3Q0UA 2GM4A 4Y52J 3NARA 5IOYA 4A3LJ 3B6AA 1X58A 3TP3A 4DZJA 2XPWA 2JWTA 2CU7A 1U8BA 4DYCA 4X1EA 1JKOC 3QQAA 1ZK8A 5FLMJ 2DA6A 3MVPA 4A3MJ 3QPSA 1HCRA 2NVTJ 3M3YJ 1ZR4A 2HXIA 2Y0SN 3BR0A 3HOUJ 2XSDC 2ME6A 3H3VK 3JRFA 3A03A 4A3EJ 3JRGA 3I4MJ 2X9DA 2Y30A 3GTLJ 1Q1VA 1QRYA 2WV1A 4Y7NJ 1Y1WJ 2DJNA 3GTKJ 2MW8A 2X48A 3SFIA 3BG3A 2DA2A 3HOXJ 1CQTA 1UMQA 5C4JJ 1F43A 4X6AJ 1MBFA 4AYBN 4MO7A 2PMZN 4FISA 2H1KA 4A3GJ 2MSYA 5GPCA 3A01B 1K83J 3S16J 5FKNA 2ID6A 1BW6A 1JUPA 1IG7A 4G12A 2WB1N 5EG0B 2DMUA 4QSHA 3S14J 4UUSA 3JRIA 2ZB9A 1JT6A 4C3HJ 1IDZA 2FD5A 2EZHA 5C44J 4MFEA 3JR9A 3L1PA 2GBYA 1H88C 3ZQGA 2M8GX 1TWAJ 2YS9A 4CYCA 1OJLA 3HDDA 2KDZA 1MBKA 3QPLA 4ABZA 1DU0A 3TW6A 1S7EA 5IOZA 4D5CA 1Y1VJ 2HOAA 3K2AA 1TWFJ 1IDYA 3HEFA 2B63J 3BQYA 5M3FJ 3G1LA 5IYBJ 1FEXA 5J1UA 2R0QC 1GT0C 5EZGA 1GDTA 4JP0A 1MBHA 3S17J 4B1RA 5FKLA 2R5YA 1BL0A 4A3DJ 1ETQA 2YU9J 5F0CA 4BBSJ 3HGGA 4L5EA 5IP9J 1HDDC 2E1OA 5J1YA 1QVUA 5IP7J 5IYDJ 1A5JA 2NOGA 2LD5A 2EBIA 1H89C 1ZR2A 5FLVA 1MBGA 1B72B 3O8HA 3TW7A 1MH3A 4M3BA 3BR5A 1IGNA 2JA6J 4W1UA 3G1MA 4JX5A 2JA8J 5FJ8J 1JKPC 1MH4A 1OFCX 4IHXA 3O8GA 2VPRA 3MKLA 2ME0A 3ZQIA 4HNVA 1JKRC 1NK2P 4MIMA 3HM5A 1I3QJ 3JRCA 1JTYA 1FIPA 1ZQ3P 3IH3A 3A01A 1VF9A 5E3LA 1TWCJ 5EG0A 4FE7A 1JUSA 2RAEA 1VFCA 2HOTA 3GBGA 5M5WJ 2NVQJ 1IUFA 1JT0A 2KT0A 3CCYA 3SDGA 3RQIA 2E2JJ 2NS8A 5F04A 3Q0WA 3UKGA 2AO9A 2DMNA 1DU6A 4J19A 1VNDA 2R92J 1MNMC 1T33A 2MGQA 2WAQN 1LFUP 3S1QJ 4I76A 1MSFC 1B8IA 1WCMJ 2LKXA 4B4CA 2LP0A 5E3NA 3OIOA 3M4OJ 5F1JA 2NVXJ 1ITYA 3CMYA 3B6CA 1BW5A 1ETKA 3DCFA 4FTHA 2LR8A 1FTZA 3ZOBA 3ZQHA 4AC0A 3D1NI 1ETWA 1SFOJ 3JRHA 3BR2A 3MN2A 1MBEA 3BTIA 3LSGA 1RESA 3DEWA 4W97A 5DS9A 1VI0A 1WGXA 3OSGA 3A02A 3F0CA 1YRNB 1X2MA 1XG1A 3C2BA 2HDDA 4GFBA 2OF7A 3PM1A 5FKMA 5FKKA 4V2GA 2EQRA 2YUSA 5M3MJ 2R5ZB 3SJMA 2VUMJ 4A3BJ 1GVDA 4XK4A 2N8GA 5DTDA 1ZGWA 2EZIA 2I10A 2AHQA 4JX4A 3PO3J 1D5YA 2TCTA 5K7FA 1IV6A 3LSRA 3LOCA 3HBLA 5JLXA 3NAUA 2XB5A 2W48A 1Z0XA 5F0FA 5F08A 4QIWN 3HOYJ 3CQZJ 3FIWA 2EH3A 1I6HJ 5M5XJ 2JA7J 3RZOJ 1AHDP 1ORKA 3BG9A 4RBOA 2DMQA 2E2IJ 1ETOA 2E19A 1EF4A 1WH7A 2HOSA 2VKVA 4C3IJ 1LE8B 4BY1J 1IRZA 1OCTC 5EF6A 4D5FA 3S2DJ 3S2HJ 1TC3C 1P7JA 1LFBA 4S0HB 4LOCA 2L7FP 2DA1A 1FIAA 2TRTA 5EYRA 1R9TJ 1HDPA 4FE4A 1X2NA 2X6OA 3G1OA 2DA5A 2DA4A 3IV5A 2QF7A 2CJJA 3IH2A 4A3IJ 2H8RA 2LLKA 4C2MJ 1H8AC 4M3DA 5E3OA 3BR6A 5JLWA 3OOUA 3ZQLA 2JMWA 2R93J 1POGA 5E3MA 5HODA 1HOMA 2K9NA 4DW6A 1APLC 1ETYA 2O8KA 2ELKA 3CDLA 2OPTA 2M34A 3ZQFA 1WI3A 4XRSG 1GUUA 1ENHA 4XICA 1E3OC 3GTQJ 2D5VA 4DZPA 4BXXJ 3HGYA 3VPRA 2R5ZA 1WH5A 3BR1A 2L7ZA 3H0GJ 1Z77A 2DN0A 2NVYJ 3HOVJ 1NTCA 4FCYA 1IJWC 2DMTA 2LK2A 1HLVA 5GP9A 3JRDA 3BTJA 3JREA 3JRAA 3GTPJ 3LSPA 5F0HA 2GLOA 3TEDA 1ETXA 1JTXA 2M2EA 4M6VA 2LY9A 1OCPA 5K7HA 2CUFA 2P81A 2XPVA 3K7AJ 3LNQA 4IHWA 3JRBA 5IYCJ 4XRSA 1LE8A 1TWHJ 2L9RA 2EZKA 4QTRA 4NDLA 3W6VA 9ANTA 2O9LA 2DA3A 3TP0A 1JUMA 1U9OA 1AKHB 2IEKA 3ZQCA 1FTTA 3GTGJ 5EGOB 2R5YB 3S1RJ 5C3EJ 1JJ6C 1ZKGA 2K40A 3E7LA 1W0TA 1UG2A 2XGEA 2XRLA 4A3KJ 1RKWA 1BA5A 2HYJA 3FKIJ 3BR3A 4IHVA 5K7ZA 1TWGJ 2Y9YA 2NS7A 3RKQA 1A6IA 2JJ7A 1IC8A 1JGGA 1O4XA 2QCOA 4C3JJ 3BG5A 1PUFB 4EEFG 1FJLA 4MFDA 3OSFA 1P7IA 3BT9A 1B72A 1WPKA 1ZTRA 3WHBA 4XRMA 1U9NA 2DMPA 5EEAA 1MSEC 4A93J 5M5YJ 4D7MA 1W0UA 2HXOA 4MLOA 4D7NA 3RZDJ 2L7MP 1U78A 4V2FA 2HI3A 1I50J 4BY7J 4A3FJ 5F27A 2K9QA 2DTZA 1G2HA 5IP6A 3S1MJ 5EDNA 3BQZA 2CQXA 3PO2J 2E2HJ 1ETVA 4IHYA 3GTMJ 5C4XJ 4DYRA 1AU7A 4A69C 1K61A 4M3FA 2FQ4A 4BKXA 3HKZN 3LSJA 3HOWJ 3FK7A 2M0CA 2ECCA 2R7ZJ 5GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGD A;  4UUT A;  2ECB A;  2FX0 A;  2Y31 A;  3GTJ J;  3FK6 A;  2L0K A;  2VKE A;  3GTO J;  4M3G A;  1GV2 A;  1XC5 A;  4BBR J;  1B8I B;  1RET A;  2JA5 J;  3Q0V A;  2M9H A;  1JKQ C;  2LVS A;  1RKT A;  1SAN A;  5BNG A;  3S1N J;  3HOZ J;  1HF0 A;  2CUE A;  4B3A A;  4A3C J;  1AKH A;  2EZL A;  3IH4 A;  1BJZ A;  4JYK A;  5EGO A;  2Y2Z A;  4M3E A;  1YRN A;  4XID A;  4DYQ A;  1F36 A;  1NK3 P;  3S15 J;  3BTL A;  2JN6 A;  2LTP A;  3HB9 A;  1T56 A;  2G0E A;  1RPW A;  2FJ1 A;  1QVT A;  5EZH A;  2MG4 A;  4AUX A;  2DA7 A;  1PUF A;  1MBJ A;  4RDU A;  2CQQ A;  2IAI A;  2JK3 A;  2ID3 A;  4UUS B;  5FKO A;  2VI6 A;  1XS9 A;  2O7O A;  2XGC A;  4JX6 A;  4A3J J;  3WHC A;  5IPA A;  3BTC A;  2K9S A;  1GV5 A;  1QPI A;  1RR7 A;  3Q3S A;  2LFB A;  4CYC B;  2Y9Z A;  1JJ8 C;  2HQ5 A;  2XPU A;  2CRG A;  5J3L A;  4I6Z A;  2XB0 X;  3FIS A;  1UHS A;  4IEJ A;  5J1R A;  2COB A;  2IBD A;  3I4N J;  3Q0U A;  2GM4 A;  4Y52 J;  3NAR A;  5IOY A;  4A3L J;  3B6A A;  1X58 A;  3TP3 A;  4DZJ A;  2XPW A;  2JWT A;  2CU7 A;  1U8B A;  4DYC A;  4X1E A;  1JKO C;  3QQA A;  1ZK8 A;  5FLM J;  2DA6 A;  3MVP A;  4A3M J;  3QPS A;  1HCR A;  2NVT J;  3M3Y J;  1ZR4 A;  2HXI A;  2Y0S N;  3BR0 A;  3HOU J;  2XSD C;  2ME6 A;  3H3V K;  3JRF A;  3A03 A;  4A3E J;  3JRG A;  3I4M J;  2X9D A;  2Y30 A;  3GTL J;  1Q1V A;  1QRY A;  2WV1 A;  4Y7N J;  1Y1W J;  2DJN A;  3GTK J;  2MW8 A;  2X48 A;  3SFI A;  3BG3 A;  2DA2 A;  3HOX J;  1CQT A;  1UMQ A;  5C4J J;  1F43 A;  4X6A J;  1MBF A;  4AYB N;  4MO7 A;  2PMZ N;  4FIS A;  2H1K A;  4A3G J;  2MSY A;  5GPC A;  3A01 B;  1K83 J;  3S16 J;  5FKN A;  2ID6 A;  1BW6 A;  1JUP A;  1IG7 A;  4G12 A;  2WB1 N;  5EG0 B;  2DMU A;  4QSH A;  3S14 J;  4UUS A;  3JRI A;  2ZB9 A;  1JT6 A;  4C3H J;  1IDZ A;  2FD5 A;  2EZH A;  5C44 J;  4MFE A;  3JR9 A;  3L1P A;  2GBY A;  1H88 C;  3ZQG A;  2M8G X;  1TWA J;  2YS9 A;  4CYC A;  1OJL A;  3HDD A;  2KDZ A;  1MBK A;  3QPL A;  4ABZ A;  1DU0 A;  3TW6 A;  1S7E A;  5IOZ A;  4D5C A;  1Y1V J;  2HOA A;  3K2A A;  1TWF J;  1IDY A;  3HEF A;  2B63 J;  3BQY A;  5M3F J;  3G1L A;  5IYB J;  1FEX A;  5J1U A;  2R0Q C;  1GT0 C;  5EZG A;  1GDT A;  4JP0 A;  1MBH A;  3S17 J;  4B1R A;  5FKL A;  2R5Y A;  1BL0 A;  4A3D J;  1ETQ A;  2YU9 J;  5F0C A;  4BBS J;  3HGG A;  4L5E A;  5IP9 J;  1HDD C;  2E1O A;  5J1Y A;  1QVU A;  5IP7 J;  5IYD J;  1A5J A;  2NOG A;  2LD5 A;  2EBI A;  1H89 C;  1ZR2 A;  5FLV A;  1MBG A;  1B72 B;  3O8H A;  3TW7 A;  1MH3 A;  4M3B A;  3BR5 A;  1IGN A;  2JA6 J;  4W1U A;  3G1M A;  4JX5 A;  2JA8 J;  5FJ8 J;  1JKP C;  1MH4 A;  1OFC X;  4IHX A;  3O8G A;  2VPR A;  3MKL A;  2ME0 A;  3ZQI A;  4HNV A;  1JKR C;  1NK2 P;  4MIM A;  3HM5 A;  1I3Q J;  3JRC A;  1JTY A;  1FIP A;  1ZQ3 P;  3IH3 A;  3A01 A;  1VF9 A;  5E3L A;  1TWC J;  5EG0 A;  4FE7 A;  1JUS A;  2RAE A;  1VFC A;  2HOT A;  3GBG A;  5M5W J;  2NVQ J;  1IUF A;  1JT0 A;  2KT0 A;  3CCY A;  3SDG A;  3RQI A;  2E2J J;  2NS8 A;  5F04 A;  3Q0W A;  3UKG A;  2AO9 A;  2DMN A;  1DU6 A;  4J19 A;  1VND A;  2R92 J;  1MNM C;  1T33 A;  2MGQ A;  2WAQ N;  1LFU P;  3S1Q J;  4I76 A;  1MSF C;  1B8I A;  1WCM J;  2LKX A;  4B4C A;  2LP0 A;  5E3N A;  3OIO A;  3M4O J;  5F1J A;  2NVX J;  1ITY A;  3CMY A;  3B6C A;  1BW5 A;  1ETK A;  3DCF A;  4FTH A;  2LR8 A;  1FTZ A;  3ZOB A;  3ZQH A;  4AC0 A;  3D1N I;  1ETW A;  1SFO J;  3JRH A;  3BR2 A;  3MN2 A;  1MBE A;  3BTI A;  3LSG A;  1RES A;  3DEW A;  4W97 A;  5DS9 A;  1VI0 A;  1WGX A;  3OSG A;  3A02 A;  3F0C A;  1YRN B;  1X2M A;  1XG1 A;  3C2B A;  2HDD A;  4GFB A;  2OF7 A;  3PM1 A;  5FKM A;  5FKK A;  4V2G A;  2EQR A;  2YUS A;  5M3M J;  2R5Z B;  3SJM A;  2VUM J;  4A3B J;  1GVD A;  4XK4 A;  2N8G A;  5DTD A;  1ZGW A;  2EZI A;  2I10 A;  2AHQ A;  4JX4 A;  3PO3 J;  1D5Y A;  2TCT A;  5K7F A;  1IV6 A;  3LSR A;  3LOC A;  3HBL A;  5JLX A;  3NAU A;  2XB5 A;  2W48 A;  1Z0X A;  5F0F A;  5F08 A;  4QIW N;  3HOY J;  3CQZ J;  3FIW A;  2EH3 A;  1I6H J;  5M5X J;  2JA7 J;  3RZO J;  1AHD P;  1ORK A;  3BG9 A;  4RBO A;  2DMQ A;  2E2I J;  1ETO A;  2E19 A;  1EF4 A;  1WH7 A;  2HOS A;  2VKV A;  4C3I J;  1LE8 B;  4BY1 J;  1IRZ A;  1OCT C;  5EF6 A;  4D5F A;  3S2D J;  3S2H J;  1TC3 C;  1P7J A;  1LFB A;  4S0H B;  4LOC A;  2L7F P;  2DA1 A;  1FIA A;  2TRT A;  5EYR A;  1R9T J;  1HDP A;  4FE4 A;  1X2N A;  2X6O A;  3G1O A;  2DA5 A;  2DA4 A;  3IV5 A;  2QF7 A;  2CJJ A;  3IH2 A;  4A3I J;  2H8R A;  2LLK A;  4C2M J;  1H8A C;  4M3D A;  5E3O A;  3BR6 A;  5JLW A;  3OOU A;  3ZQL A;  2JMW A;  2R93 J;  1POG A;  5E3M A;  5HOD A;  1HOM A;  2K9N A;  4DW6 A;  1APL C;  1ETY A;  2O8K A;  2ELK A;  3CDL A;  2OPT A;  2M34 A;  3ZQF A;  1WI3 A;  4XRS G;  1GUU A;  1ENH A;  4XIC A;  1E3O C;  3GTQ J;  2D5V A;  4DZP A;  4BXX J;  3HGY A;  3VPR A;  2R5Z A;  1WH5 A;  3BR1 A;  2L7Z A;  3H0G J;  1Z77 A;  2DN0 A;  2NVY J;  3HOV J;  1NTC A;  4FCY A;  1IJW C;  2DMT A;  2LK2 A;  1HLV A;  5GP9 A;  3JRD A;  3BTJ A;  3JRE A;  3JRA A;  3GTP J;  3LSP A;  5F0H A;  2GLO A;  3TED A;  1ETX A;  1JTX A;  2M2E A;  4M6V A;  2LY9 A;  1OCP A;  5K7H A;  2CUF A;  2P81 A;  2XPV A;  3K7A J;  3LNQ A;  4IHW A;  3JRB A;  5IYC J;  4XRS A;  1LE8 A;  1TWH J;  2L9R A;  2EZK A;  4QTR A;  4NDL A;  3W6V A;  9ANT A;  2O9L A;  2DA3 A;  3TP0 A;  1JUM A;  1U9O A;  1AKH B;  2IEK A;  3ZQC A;  1FTT A;  3GTG J;  5EGO B;  2R5Y B;  3S1R J;  5C3E J;  1JJ6 C;  1ZKG A;  2K40 A;  3E7L A;  1W0T A;  1UG2 A;  2XGE A;  2XRL A;  4A3K J;  1RKW A;  1BA5 A;  2HYJ A;  3FKI J;  3BR3 A;  4IHV A;  5K7Z A;  1TWG J;  2Y9Y A;  2NS7 A;  3RKQ A;  1A6I A;  2JJ7 A;  1IC8 A;  1JGG A;  1O4X A;  2QCO A;  4C3J J;  3BG5 A;  1PUF B;  4EEF G;  1FJL A;  4MFD A;  3OSF A;  1P7I A;  3BT9 A;  1B72 A;  1WPK A;  1ZTR A;  3WHB A;  4XRM A;  1U9N A;  2DMP A;  5EEA A;  1MSE C;  4A93 J;  5M5Y J;  4D7M A;  1W0U A;  2HXO A;  4MLO A;  4D7N A;  3RZD J;  2L7M P;  1U78 A;  4V2F A;  2HI3 A;  1I50 J;  4BY7 J;  4A3F J;  5F27 A;  2K9Q A;  2DTZ A;  1G2H A;  5IP6 A;  3S1M J;  5EDN A;  3BQZ A;  2CQX A;  3PO2 J;  2E2H J;  1ETV A;  4IHY A;  3GTM J;  5C4X J;  4DYR A;  1AU7 A;  4A69 C;  1K61 A;  4M3F A;  2FQ4 A;  4BKX A;  3HKZ N;  3LSJ A;  3HOW J;  3FK7 A;  2M0C A;  2ECC A;  2R7Z J;  5GPA A; 
#chains in the Genus database with same CATH topology
 2ZME A;  1YS6 A;  5E8I A;  2QZ8 A;  4ZTF A;  2DK8 A;  2KQR A;  5L3B A;  3GTO J;  4M3G A;  1ZGA A;  2KIS A;  4BBR J;  2HZT A;  3R61 A;  3KYC B;  4KIF A;  3RPU D;  1DPR A;  2ZKZ A;  1OYW A;  3VYS B;  4EJO A;  2M9H A;  2AQF A;  2IGK A;  1JKQ C;  3KZY A;  1RKT A;  2IS6 A;  3HOS A;  1D1B A;  5CVV A;  3S1N J;  1N78 A;  3SXY A;  3LSM A;  2K5C A;  3X2Q H;  2EV6 A;  2VXD A;  4RLQ A;  1AKH A;  4A3C J;  2WBM A;  5DCF A;  1NK3 P;  4F55 A;  2LYC A;  3F3X A;  1SD4 A;  1MMA A;  2FJ1 A;  3PL8 A;  1IW7 F;  4WXH A;  2E60 A;  4UHT A;  1PUF A;  4RDU A;  2KIU A;  3H3U A;  2LF8 A;  3MKZ A;  2IAI A;  2JK3 A;  2UXN A;  2ID3 A;  3T5X A;  2EV0 A;  2XF7 A;  2A6T A;  3ERE D;  2WAD A;  4MEY F;  2VI6 A;  4EJV A;  2DFF A;  2FML A;  1MW7 A;  1BR1 A;  4A3J J;  4M71 A;  4LJZ F;  2P5L C;  2WY8 Q;  1W7P D;  1XD7 A;  4XKC A;  2KMU A;  2LFB A;  2A6H F;  2DDA A;  2CMP A;  2HQ5 A;  4BU2 A;  3L2V A;  5LHG A;  4IQJ A;  2L9N A;  4IHT A;  2GOX B;  5J8F A;  4BUP A;  4Y52 J;  4I02 A;  1J5Y A;  5BOX A;  4L0Y B;  3GLL A;  3F22 A;  5H20 A;  2D1V A;  4CCM A;  3BJ6 A;  1NH3 A;  3MQ0 A;  4DZJ A;  4BJ6 C;  1IAW A;  2OQG A;  3M8J A;  3SEZ A;  1W36 C;  3PNY A;  5ILU A;  3QWL A;  4A3M J;  3MVP A;  3BP8 A;  3MWM A;  5JHF A;  1D5V A;  1HCR A;  5B1A H;  3M3Y J;  2VLA A;  4ASN A;  3CLO A;  5A2Q Z;  5DV5 A;  2XVC A;  5LRR A;  2R7R A;  1KU2 A;  2QBY A;  4CZC A;  2ME6 A;  3JRF A;  1MNE A;  4A3E J;  3JRG A;  3DPT A;  3I4M J;  4E7K A;  2Y30 A;  4HSR A;  1OQY A;  5IT9 K;  2PN6 A;  1Q1V A;  2FNP A;  1QRY A;  2ELJ A;  5J47 A;  3HL2 A;  2V79 A;  3SFI A;  2VXZ A;  2MD0 A;  4RB0 A;  3HHH A;  1FYK A;  5K1Y A;  4AYB N;  1YJN I;  3IKT A;  2JUG A;  3KP2 A;  4L9N A;  4A3G J;  2DPU A;  5H6R A;  5GPC A;  1Z3X A;  1JXS A;  1K83 J;  3GZ6 A;  3FXJ A;  5CKT A;  1LB2 A;  4JBA A;  1FLI A;  1BW6 A;  5CVI A;  2F5C A;  5HNF A;  2Q2E A;  1SFK A;  2DMU A;  3ESW B;  4UUS A;  3OYJ A;  4HAM A;  3AFH A;  2IS2 A;  5B66 C;  3SZT A;  1FOX A;  1GXQ A;  2QKM B;  4GO1 A;  2X85 A;  4CGZ A;  3MD2 A;  4LG3 A;  1EA3 A;  3KLN A;  3L1P A;  1Z3Y A;  2A07 F;  2ZJ2 A;  1FOY A;  3DP7 A;  4J01 A;  1XGN A;  4CYC A;  2UZK A;  1HA8 A;  1MD0 A;  3OYL A;  1MBK A;  3F8C A;  4ABZ A;  1D1C A;  2M7B A;  2CO5 A;  2XF5 A;  1FYL A;  2F5F A;  2L2O A;  1VQP I;  3A2K A;  4U7B A;  5KAI C;  2VJI A;  2V1N A;  1IDY A;  1GXP A;  3P9I A;  4HV5 A;  4EM0 B;  1MMD A;  4EV0 A;  4XOR A;  2JRM A;  2C6Y A;  3P5J A;  4S04 A;  1WFX A;  3G1L A;  1VQ8 I;  1GT0 C;  2M3A A;  4HOB A;  4G6T B;  5EZG A;  3KPH A;  2XAU A;  1OCR H;  3TDZ C;  4B1R A;  3KP3 A;  3S3M A;  4IF4 A;  3L09 A;  1TNT A;  2YU9 J;  4M9Z A;  2HDW A;  2Y75 A;  5F0C A;  3V42 A;  2BHZ A;  4E7L A;  1RC9 A;  2DOD A;  4F7Z A;  5IYD J;  2LRE A;  3D5L A;  2OBP A;  4BS9 A;  2EBI A;  1BC7 C;  4NBQ A;  2GOM A;  4EM2 A;  2OUM A;  1B72 B;  1IGN A;  1TTY A;  3BR5 A;  4E7J A;  1UFM A;  1CGP A;  4W1U A;  2PFB A;  2BXZ A;  3G1M A;  3I58 A;  1YQA A;  2NS0 A;  3I59 A;  5FJ8 J;  2HTJ A;  4KN4 X;  2LKS A;  4IRH A;  1W7P B;  4BYY A;  4NUB A;  4HNV A;  4MIM A;  5HNH A;  4CH7 A;  3HSR A;  2EA4 A;  3K70 D;  4RLF A;  3KP4 A;  2ISZ A;  1JI8 A;  2LDU A;  3BG6 A;  3E1S A;  4G7H F;  4PUS A;  2XC7 A;  1T39 A;  3CC7 I;  4G7O F;  2RAE A;  2HOT A;  5E1W A;  1R00 A;  1U6G A;  2NVQ J;  2DQR A;  1G3T A;  4BH9 A;  2CH0 A;  4RGU A;  2IA2 A;  4CUG A;  4HA8 A;  1I27 A;  3A1Y A;  2FBI A;  2R92 J;  1T33 A;  4A2U A;  1TNS A;  4YEJ A;  1ODD A;  5GAE J;  1WCM J;  4ESB A;  2LKX A;  4FX0 A;  1T0F C;  5E3N A;  3OIO A;  4D1Q A;  4HDV A;  1BW5 A;  2LR8 A;  1FTZ A;  2ETH A;  3BJO A;  4O3M A;  1BOB A;  5GTI C;  3D1N I;  2M5W A;  2X51 A;  1MZB A;  2GQQ A;  1X1P A;  4GXO A;  3BDD A;  1X1A A;  4OWR B;  5BMZ A;  3ZN1 A;  4W97 A;  5DS9 A;  5K5O A;  3A02 A;  2I5U A;  3I53 A;  2R7S A;  4AYB A;  1X2M A;  1LDK B;  5DYM A;  2F48 A;  2OF7 A;  3HRU A;  5L3G A;  1YJW I;  1VQ7 I;  2EQR A;  3K2Z A;  3H5R A;  3K4L A;  5D5U B;  3MAJ A;  4XK4 A;  3PFY A;  3RTR A;  2EZI A;  3VYU B;  3OYB A;  4IKF A;  2PLY A;  4EGY A;  1T0F A;  2X0L A;  3HC7 A;  5K7F A;  3HSF A;  2L54 A;  3F23 A;  3S32 A;  2V26 A;  3LSR A;  1G4D A;  3E5Q A;  3IUO A;  2GIV A;  2P8T A;  5CLS A;  3IRQ A;  3AAF A;  3OS1 A;  2W48 A;  3DU5 A;  1R1T A;  5F08 A;  4QIW N;  4ZH4 F;  2X6W A;  3CCU I;  4ZYH A;  3HOY J;  2WV0 A;  2YU3 A;  5CVJ A;  3CQZ J;  3SZG A;  2W82 A;  4E7Z A;  4NC7 A;  2A69 F;  1PUE E;  2ZO4 A;  2JA7 J;  1XMA A;  1AHD P;  4P5O A;  2VL8 A;  1E3P A;  2DMQ A;  2ZSH B;  4L5I A;  1O3S A;  3WGI A;  1WH7 A;  1J75 A;  2VKV A;  3RQ4 A;  4C3I J;  2HOS A;  2L3D A;  2LG4 A;  1TL8 A;  3BG7 A;  4XRF A;  1OCT C;  1P6R A;  3LSI A;  3GXO A;  2ZFW A;  3H9G A;  3ZCO A;  2A5Y B;  5E18 F;  1LPQ A;  1VQL I;  3M7G A;  2TRT A;  2FMY A;  1OLT A;  1WQ2 A;  2ADU A;  3W2A A;  4FE4 A;  2DK5 A;  1XGS A;  2K3P A;  4WF2 A;  4PJ0 C;  2DA4 A;  2QF7 A;  2X4H A;  1FC3 A;  1T38 A;  2V9P A;  2H8R A;  5LHH A;  2M4G A;  1H8A C;  5LEK A;  5CVU A;  1X1D A;  3ZQQ A;  5GTH C;  1Y0U A;  5E3O A;  3BR6 A;  1I1S A;  2JTV A;  1AWC A;  3ZQL A;  3U21 A;  1QNT A;  2A6E F;  4PSW A;  5HOD A;  2Z5U A;  3CUQ B;  3FMS A;  1SD5 A;  3PUB A;  2O8K A;  2HKO A;  1B59 A;  4XSZ F;  2M34 A;  2QQB A;  5LLQ A;  1ENH A;  2A3S A;  4XIC A;  3LAP A;  3GTQ J;  1HKQ A;  3E6M A;  3FXU A;  3BY6 A;  3HGY A;  4PJL A;  4O5V A;  2R5Z A;  2M45 A;  4H0E A;  1KQ9 A;  2F4O B;  1V3F A;  4FHT A;  3RCO A;  2CSO A;  3BR1 A;  2L7Z A;  4N9H A;  3H5A A;  5KK1 A;  1KQ0 A;  3EPZ A;  4LLN A;  2LK2 A;  1BR4 A;  3U1D A;  3OS0 A;  5ICC A;  3KLO A;  3HZJ A;  4E6K G;  5ICE A;  3JRA A;  2ZME B;  1RIO H;  2O5R A;  4BJT A;  4EJW A;  3TOB A;  2F5V A;  2DYS H;  4AVP A;  3TED A;  1F4K A;  1ETX A;  2YR2 A;  4R79 A;  4UVA A;  2E34 A;  2CUF A;  3KEQ A;  3RSN A;  1R4M B;  2XPV A;  4G7Z F;  4IHW A;  3CUO A;  2NYX A;  3E97 A;  3JRB A;  2W7N A;  4ZTJ A;  1WVR A;  4QWQ A;  4LLG F;  1FMV A;  5FGM A;  1MND A;  1X1B A;  4BQA A;  2HVQ A;  9ANT A;  2O9L A;  2H6B A;  2WA0 A;  2EFO A;  3I54 A;  1XCB A;  1AKH B;  1LUJ B;  2IEK A;  1S9H A;  4IL6 C;  4HDU A;  4UB6 C;  2M8E A;  1SD6 A;  1W0T A;  1R36 A;  2XGE A;  1LDD A;  1RKW A;  2Y9Y A;  3WU0 A;  5ED4 A;  1A6I A;  3GME A;  2BHY A;  1O4X A;  3F8M A;  4C3J J;  1PUF B;  1ON1 A;  2IW5 A;  1FJL A;  2VC1 A;  3C18 A;  1WSU A;  4IQ4 A;  1B72 A;  1WPK A;  3K1M A;  5IT3 A;  4A93 J;  5FRM A;  1LVK A;  1W0U A;  5DM7 F;  4MLO A;  1B9N A;  1T98 A;  1I50 J;  1K7A A;  3VYR B;  2NXN B;  1J09 A;  4WWC A;  3CJN A;  1FNN A;  1OIS A;  1UEL B;  3BZC A;  3GUD A;  2Y0M A;  2TDX A;  1W4M A;  1IN5 A;  3KCC A;  2F4M B;  3VDX A;  4MTE A;  2JRT A;  1AU7 A;  4A69 C;  3J7Y J;  1Y6I A;  4M3F A;  2FQ4 A;  1R1U A;  3PFI A;  4XR6 A;  4I0B A;  3HOW J;  2RVC A;  1ZEL A;  1ZLJ A;  1UST A;  3FMQ A;  2VT2 A;  5GPA A;  1IRG A;  2ESH A;  3F21 A;  3ZR8 X;  2Y31 A;  3TKY A;  4XLA A;  1B4A A;  1YIT I;  4G6D A;  3TQN A;  2VOD A;  3G71 I;  2VKE A;  3FF5 A;  4UXN A;  2RV8 A;  2HU9 A;  3JSP A;  4BAC A;  1XGO A;  1O3T A;  3IHU A;  3BOQ A;  5HS9 A;  4A0X A;  5J4V A;  1RET A;  3KET A;  2A68 F;  1YS7 A;  1E17 A;  3Q0V A;  3KEY A;  2QBY B;  4ZDL A;  3R60 A;  4HYE A;  4Y33 A;  3AL0 C;  2KL4 A;  2HVR A;  1JGS A;  1SFE A;  2CYY A;  4X0G A;  1T8I A;  2QVO A;  5E20 A;  4KA4 A;  5GAD J;  1WJD A;  5EGO A;  1MJB A;  4XBF A;  1U3E M;  1A35 A;  4XID A;  2JPB A;  4DYQ A;  4B09 A;  3QAH A;  4I09 A;  5LGN A;  1BN5 A;  2BEO A;  1RPW A;  2IS1 A;  4AUX A;  5E1Z B;  1ZRD A;  2DA7 A;  3OIQ A;  2IRF G;  2FBK A;  4UY8 I;  1V5F A;  2CQQ A;  2IGN A;  2M4K A;  2Q2E B;  4AU7 A;  4CXF A;  1R6R A;  3NWS A;  5DEQ A;  4UUS B;  3ZP5 A;  1R5I D;  4BEH B;  3FBI B;  3VB2 A;  4N9I A;  2XGC A;  1BBY A;  4JX6 A;  5LRS A;  3WHC A;  4I99 C;  1XDU A;  2LBF A;  5IPA A;  2IP2 A;  1GV5 A;  5KHD A;  1KZH A;  3WOD F;  3CP8 A;  1RR7 A;  5FD5 A;  4CYC B;  2O8X A;  2CRG A;  2OA4 A;  2W00 A;  3MMY B;  4F3Q A;  5J3L A;  1V5G A;  1HW1 A;  3FIS A;  1D8K A;  1RR8 C;  2IBD A;  2H8W A;  3Q0U A;  3PJR A;  4LB5 A;  3FXO A;  1Q1H A;  1AOY A;  5IOY A;  3OL4 A;  3HIF A;  4IOA F;  3B6A A;  1J2X A;  2AXT C;  2QQ9 A;  4DIQ A;  4L9J A;  3K70 C;  1QHH D;  1PDN C;  1SAU A;  4DYC A;  4PGH A;  4RGS A;  2H1L A;  2O3F A;  5CQE A;  1ZK8 A;  2V1D A;  4C2T A;  5D8K B;  3QPS A;  5HLT A;  1ZN2 A;  2NVT J;  2GAU A;  1ZR4 A;  1QZE A;  1GLN A;  2Y0S N;  1E0E A;  1O57 A;  3VYT B;  1BI3 A;  1H9G A;  4E7H A;  3H3V K;  1S29 A;  2V1X A;  4LIU A;  1FBS A;  3GTL J;  1JHF A;  3CMM A;  4KIT B;  2WV1 A;  3K69 A;  3JAM K;  2X48 A;  1WKM A;  3L00 A;  2DA2 A;  2MC3 A;  2QLZ A;  3I59 B;  4FT8 A;  4GYG A;  2IS4 A;  1CQT A;  1UMQ A;  3S93 A;  5C4J J;  4G6Q A;  1VQN I;  3C2H A;  1MBF A;  1UB9 A;  1X3Z B;  2E1N A;  2PMZ A;  1NHA A;  2MSY A;  4ZYA A;  2UXX A;  5HOO A;  2DT7 B;  3DXJ F;  1TT5 B;  4HX7 A;  4XOT A;  4RAY A;  2FSW A;  1FWZ A;  2WB1 A;  3BRO A;  5BPI A;  2P4W A;  5TJJ A;  5FRN A;  5HDK A;  1IUY A;  3HG9 A;  1N75 A;  3S14 J;  3JRI A;  2FD5 A;  2HTS A;  2EZH A;  5C44 J;  3OV8 A;  4MFE A;  2LMD A;  1IXS B;  5D5V B;  4C2U A;  1MKM A;  4M6X A;  2JSC A;  4XKB A;  3VSL A;  3ZGK A;  4A0Z A;  3MZ8 A;  4NB5 A;  1HKT A;  3J7A Y;  2E5Z A;  1GVJ A;  3QPL A;  4P9U A;  4L5J A;  1LVA A;  4DBQ A;  3TW6 A;  1S7E A;  4WCG A;  3K2A A;  3WE3 A;  3L2W A;  1TWF J;  3HEF A;  2B63 J;  3GCM A;  1R22 A;  3FXK A;  2FNA A;  3Q9S A;  3F6O A;  5JVG F;  1U5T C;  4A5N A;  5J1U A;  4PFP A;  2R0Q C;  4DJA A;  4ZZL A;  2R3S A;  4RM3 A;  2KPM A;  2LY1 A;  3HRM A;  2XKP A;  3LQR A;  3S17 J;  3HXL A;  1BL0 A;  2LOO A;  3V7S A;  3BLY A;  4PK4 A;  4XNF A;  4PGG A;  1R5G A;  5IP9 J;  2BOL A;  3BJA A;  3OYH A;  3R0J A;  2E1O A;  2F6C A;  2E5N A;  2HR3 A;  1XSV A;  5FFX A;  1K6O A;  4PFO A;  1BIA A;  1TW3 A;  3GFI A;  2ZBK A;  4ETS A;  1RUN A;  2CG4 A;  3CF5 F;  2VQC A;  1B6A A;  3O8H A;  1MH3 A;  1DUX C;  2VIX A;  3F8B A;  4KDP A;  4JX5 A;  2JA8 J;  2GA2 A;  4DOZ A;  1MH4 A;  4IHX A;  1U5T A;  3M9A A;  4L9T A;  1CF7 A;  1NK2 P;  3JRC A;  4OAZ A;  2VBX A;  4HQE A;  1FIP A;  4LGW A;  2BY1 A;  3GZN B;  1FP2 A;  2K85 A;  1IO2 A;  1BJA A;  3RKX A;  5LBQ A;  3MKW B;  4A5M A;  2WY7 Q;  4I2O A;  5B5E C;  4EJU A;  4FE7 A;  1HSJ A;  1VFC A;  1D8J A;  2XUB A;  1XTA A;  4ON0 A;  5M5W J;  1LEA A;  1W5S A;  2KT0 A;  3CCY A;  3MCZ A;  5F04 A;  4J19 A;  1VND A;  1HKS A;  4LD5 A;  5F1R A;  1MNM C;  3HTS B;  4KMF A;  3EUA A;  4S05 A;  3S1Q J;  2Y0S A;  2JSP A;  1MSF C;  3H92 A;  2EIN H;  2H94 A;  1ULY A;  2KIQ A;  4ZC3 A;  3B6C A;  4F52 A;  1ETK A;  3DCF A;  4XKW A;  4FTH A;  1OYI A;  2D1H A;  4F91 B;  3ZQH A;  2FA5 A;  3J80 K;  1SFO J;  3QYE A;  3BCA A;  1VTN C;  1O3R A;  4H4K C;  3MN2 A;  3H36 A;  2K4B A;  5LEJ A;  3H9Q A;  3LA7 A;  3LA2 A;  4D0P A;  1D0Z A;  1T95 A;  4AM3 A;  2UWM A;  3F8F A;  4RMN A;  2QSG X;  3QPT A;  3F0C A;  4HV6 A;  2O6G E;  3CC4 I;  5HDN A;  1G6N A;  5FKM A;  2JQ7 A;  4V2G A;  4EVI A;  3OWT A;  5M3M J;  2R5Z B;  1W5C C;  4ZYG A;  4IJA A;  4NC8 A;  4I98 B;  2K86 A;  1D0Y A;  3WTY C;  2VUM J;  1ZGW A;  2AHQ A;  1KU7 A;  1IRF A;  5FB2 A;  3FHZ A;  2VC0 A;  2PG4 A;  2XGX A;  3I3L A;  1E3H A;  5HS8 A;  1FZP B;  1ONV A;  3J81 Z;  2IVM A;  3T0Y A;  4BEH A;  3I64 A;  2ESN A;  2Y48 A;  4M73 A;  1MGT A;  3HBL A;  4KMU X;  4HF1 A;  2XB5 A;  3AG2 H;  2K7L A;  5F0F A;  4NHJ A;  3M1E A;  3LMM A;  1ON2 A;  3LAJ A;  3RKY A;  3I5U A;  3QRF F;  2HNH A;  4C30 A;  5HLI A;  4P9F A;  3D5R C;  1I6H J;  3KIO A;  5M5X J;  2F4I A;  3BG9 A;  4RBO A;  1SMT A;  3WTT C;  3MFK A;  3SFZ A;  2HPI A;  2E2I J;  1KYZ A;  2HEO A;  5ICG A;  3OYA A;  3KP6 A;  4BY1 J;  2EWN A;  5EF6 A;  3K4J A;  4I0A A;  1YI2 I;  3S2D J;  4Q4Z F;  3S2H J;  2V6C A;  3L2C A;  2VT3 A;  3OR1 C;  4S0H B;  2A5W A;  1DP7 P;  2L7F P;  4XLP F;  4L18 B;  4K2E A;  4XOP A;  2EFW A;  1X2N A;  2HYG D;  1SEU A;  2DA5 A;  3IV5 A;  1Y0N A;  4G94 A;  4LG0 A;  3HPH A;  4HRI A;  2LLK A;  2GXG A;  1SVM A;  3SEQ A;  4M3D A;  5JLW A;  4U7D A;  3WTV C;  5DUK A;  1TW2 A;  2EIJ H;  5FLX Z;  2R93 J;  2P6T A;  1POG A;  1APL C;  2QM3 A;  1X4O A;  2DFE A;  2G7U A;  2EFP A;  4KIC A;  2BW3 A;  1I5Z A;  2FUG 2;  2O61 A;  4Y4R A;  4GDF A;  3PSI A;  5DDG A;  2QEN A;  2LKP A;  3K4N A;  1XN7 A;  4CO8 A;  2BXY A;  2M30 A;  2VBZ A;  3U2R A;  5DCM B;  2XHK A;  2YX4 A;  4YIF A;  2KIF A;  3I55 I;  2FQ3 A;  3E0J B;  1MMG A;  1IJW C;  2OTJ I;  1D3Y A;  3ABT A;  3FWE A;  2XV4 S;  3IRR A;  4HLY A;  3AG3 H;  3JRD A;  2Z1D A;  4BXF A;  1R71 A;  2V6E A;  5F0H A;  3ZMU A;  2E36 A;  3CJR B;  1WJE A;  1VQ5 I;  2G7H A;  4UUV A;  1LKX A;  1IZ1 A;  3DTE A;  4I7H A;  4RA2 A;  2M7A A;  2M2E A;  2LY9 A;  3HYI A;  4IXA A;  3KEO A;  5K7H A;  2W1O A;  2P7V B;  4HF0 A;  4HNU A;  2R7O A;  3LNQ A;  1FX7 A;  2VBY A;  4YFK F;  2UV1 A;  2L9R A;  1AA7 A;  5KCM A;  4A12 A;  4CA0 A;  4YFX F;  1J0R A;  4NDL A;  3PNV A;  4YRV A;  3W6V A;  3ZMZ A;  1S3J A;  3ZMT A;  3FDY A;  3DLA A;  4V19 K;  3ZQC A;  3W6K B;  3GTG J;  5ILS A;  5EGO B;  2R5Y B;  2E7X A;  1JJ6 C;  4XM3 A;  4OIR F;  1ZKG A;  3W2V A;  5EJC A;  2L9V A;  2XRL A;  3QYB A;  5D8L B;  1BA5 A;  4EAT A;  1ZGJ A;  5K7Z A;  1TWG J;  2NS7 A;  1PP8 F;  4CIC A;  2QYO A;  2J5P A;  2JJ7 A;  1FY7 A;  1IC8 A;  2QCO A;  5FFZ A;  3EDP A;  3OSF A;  3BT9 A;  1ZTR A;  4CCO A;  4XRM A;  2EIL H;  5EEA A;  4II3 A;  4JOM A;  2NAZ A;  2KRF A;  1P2F A;  2GIZ A;  3K10 A;  3GFM A;  4BHB A;  4D7M A;  4IRI A;  2R7W A;  4D7N A;  3RZD J;  3OR2 C;  5FD6 A;  5LGU A;  4KYW A;  1NG6 A;  3ELK A;  3AL0 B;  3S8P A;  4A3F J;  2W84 A;  5F27 A;  2LBF B;  2DTZ A;  5D5X B;  2OCC H;  1YG2 A;  2KRH A;  2HYF A;  4HBL A;  4JQF A;  1YYV A;  3JTH A;  3ZPL A;  1P4A A;  2CQX A;  2L01 A;  4CSW A;  2E2H J;  1ETV A;  3GTM J;  2EIK H;  3ONQ A;  3V7R A;  4AIH A;  1P9Q C;  1YIJ I;  3COA C;  3H9J A;  1TZL A;  1K61 A;  3TDU C;  3PSF A;  3HKZ N;  1V5E A;  3LSJ A;  3T1B A;  4GCV A;  1REP C;  1BM9 A;  4PDK A;  4BQQ A;  3PIO F;  2R7Z J;  4UUT A;  2ECB A;  4JK1 X;  3T8R A;  3GTJ J;  2RNG A;  4J00 A;  1WZ2 A;  2G9W A;  3SZP A;  1X4P A;  2R4G A;  4IRG A;  3K1N A;  4WK8 F;  1DPU A;  2VOP A;  3EYY A;  1XC5 A;  1B8I B;  3D0S A;  5D5W B;  2DU9 A;  5JI6 A;  2JA5 J;  5IY5 H;  1YTY A;  2FOW A;  3CD6 I;  2HKX A;  2BZT A;  3N4M A;  5B3S H;  2LVS A;  3B02 A;  3IC7 A;  4FET A;  3QPH A;  2VN2 A;  3B73 A;  1F5T A;  4B3A A;  1WRJ A;  4KUM A;  3WTX C;  1QBJ A;  3ZN0 A;  5KVR A;  2XDV A;  2EZL A;  2LSO A;  4JYK A;  3CF2 A;  5LGT A;  2OD5 A;  2KLO A;  2Q8K A;  4NQW A;  5BS6 A;  2Y2Z A;  4A6D A;  4UVC A;  1VQ4 I;  1S8N A;  2H6C A;  1F36 A;  2E1M C;  2PI0 A;  3PQK A;  3ISP A;  4ESJ A;  1SAX A;  4B3X A;  2FBH A;  3GFL A;  2G0E A;  3Q5F A;  1OR7 C;  1ACI A;  4XSX F;  1QVT A;  3RYR A;  2O0Y A;  3KX2 A;  2WAE A;  1MBJ A;  1VZ0 A;  2R7F A;  3WTZ A;  1YFH A;  5IT9 Z;  4OIO F;  3QYF A;  5J40 A;  4KT5 C;  3K6G A;  1WHU A;  2CW0 F;  2V4J C;  4CDG A;  5FKO A;  1XS9 A;  5L3C A;  3BZ6 A;  2L4M A;  3FM5 A;  3V8K A;  2K9M A;  3Q3S A;  3ROU A;  4N4O B;  1XMX A;  3JTG A;  2Y9Z A;  4P96 A;  1RI7 A;  1QO0 D;  5E79 C;  3L2U A;  1BIB A;  4FX4 A;  3V4G A;  2OAZ A;  2CUZ A;  4QLC U;  2COB A;  5J1R A;  3I4N J;  2P0W A;  1M1E B;  3NAR A;  1OR7 A;  4WXD A;  1E2X A;  1I39 A;  3WTS C;  4B48 A;  1QZY A;  1PP7 U;  2B0L A;  4E70 A;  2XPW A;  1WJ5 A;  2CQ7 A;  4PJJ A;  3OL3 A;  3CCM I;  1U8B A;  4X1E A;  1JKO C;  3QQA A;  3TO7 A;  5FLM J;  1LFP A;  5GAG J;  3DLL F;  4IPA A;  1G59 A;  3BR0 A;  1JE8 A;  1G3W A;  1ZG1 A;  1YO5 C;  3SQN A;  1FOW A;  4IX7 A;  2GXA A;  2D2W A;  3HOU J;  2XSD C;  3HOT A;  1LDJ A;  2X9D A;  1ZH5 A;  5D6E A;  1YX5 A;  3E6C C;  5JR3 A;  1B9M A;  2FE3 A;  1Y1W J;  2MW8 A;  2BY0 A;  1RRJ A;  4EM1 A;  1FBQ A;  4KNY A;  1EJ9 A;  4C9Y A;  5K5Q A;  3DKW A;  2ISY A;  1F43 A;  1U5T B;  1CF7 B;  3HHG A;  3CLQ A;  3HUG B;  2XIG A;  1ZHF A;  3W6J B;  4MO7 A;  2PMZ N;  1Z67 A;  4NNJ A;  1S72 I;  3S16 J;  3FXL A;  5DCM A;  3QU3 A;  4MQV A;  4G12 A;  3HKZ A;  2WB1 N;  1ERD A;  1V55 H;  2BY2 A;  3G73 A;  1YJ9 I;  2DCE A;  4ZYD A;  2ZB9 A;  1IV8 A;  4C3H J;  3IP4 B;  1IDZ A;  1KON A;  2VJJ A;  3RPQ A;  3DKX A;  1U2W A;  1A36 A;  3KP7 A;  1H88 C;  2CW8 A;  2HWV A;  3ZQG A;  2M8G X;  3HRS A;  4BNC A;  2IA1 A;  3HDD A;  3FXQ A;  4LFU A;  4XL9 A;  1DU0 A;  5A2Q K;  3D5S C;  5AON A;  2R7U A;  4MNU A;  3SDB A;  3PQJ A;  4D5C A;  3G6E I;  1XGM A;  2HOA A;  3H35 A;  2VJ5 A;  5M3F J;  1YW8 A;  1YX3 A;  2LC2 A;  4GGG A;  4HG2 A;  3VWB A;  1Y56 A;  1KU9 A;  3DFG A;  5IYB J;  3WTW C;  1FEX A;  4BL0 B;  1X3W B;  2OQR A;  3OMY A;  4LK1 F;  1GDT A;  5HVQ C;  3CMA I;  1P4X A;  3FHN A;  2IT0 A;  2R5Y A;  3C7J A;  3R4K A;  1MMS A;  4A3D J;  3O3K A;  3LFU A;  2F5D A;  1GHC A;  2KJC A;  1A04 A;  1BI1 A;  2ZJP F;  1HDD C;  4OAY A;  2MH2 A;  4ZDP A;  3LSH A;  4LMY A;  2AXL A;  1IXC A;  1QVU A;  5IP7 J;  2NVU B;  4IO9 F;  4XMY A;  1A5J A;  2QSH X;  3PNT A;  3TGN A;  4HX8 A;  1MJA A;  5JFR A;  1H89 C;  2OCE A;  1ZR2 A;  1MBG A;  3CP2 A;  2VE9 A;  1LJ9 A;  1YOV B;  3TW7 A;  4LB6 B;  3CCJ I;  1SC7 A;  1DP3 A;  2QQA A;  1JKP C;  4I01 A;  3BCB A;  3MZY A;  4MEX F;  2VPR A;  1QGP A;  3MKL A;  1BOA A;  4L0Z B;  4M74 A;  3HM5 A;  1Z91 A;  3FBN B;  1ZQ3 P;  3IH3 A;  3A01 A;  2W25 A;  3TOA A;  4O6J A;  4IHS A;  3DU6 A;  2HQR A;  4DBR A;  2CV0 A;  4MGR A;  3E6B A;  3ASN H;  2XAF A;  3GW2 A;  4N0B A;  4DGW B;  5EG0 A;  4RAZ A;  1JUS A;  4BE0 A;  4ZDO A;  1K6Y A;  4UNO A;  3GO5 A;  5EEG A;  3WU2 C;  4NC6 A;  3OYN A;  2WTE A;  4EQQ A;  1HST A;  1Z21 A;  4XLH A;  2E2J J;  3Q0W A;  3UKG A;  2AO9 A;  2DMN A;  1VQ6 I;  1DU6 A;  3DTI A;  1SVL A;  2MGQ A;  4BDY A;  4XLC A;  4RB2 C;  4MTD A;  1B8I A;  2DFH A;  5ICF A;  2P7C B;  4F93 B;  2ZCW A;  4RAG A;  2IJL A;  5F1J A;  2NVX J;  3UR3 C;  4LG0 B;  3M4O J;  1ITY A;  3CMY A;  3SHF A;  1S5L C;  5H6Q A;  2IPQ X;  3OIP A;  4KIG A;  4YEL A;  2DBB A;  3DBL B;  1ETW A;  2PJP A;  3V8J A;  3JRH A;  4A0Y A;  3CCE I;  3BR2 A;  4XLE A;  2PJR A;  3EET A;  5HDG A;  3LSG A;  2DOE A;  2I8D A;  2V9V A;  3DEW A;  2PMH A;  4B43 A;  4OMY A;  1VI0 A;  3OYE A;  2BGC A;  1WGX A;  2DOA A;  3OSG A;  5D6F A;  2AS5 F;  2BW3 B;  4KT6 A;  1XCV A;  1YRN B;  1S7A A;  1XG1 A;  2Z99 A;  2HDD A;  4GFB A;  2BBY A;  1U8R A;  2QQ8 A;  1K4S A;  1TQI A;  2DJI A;  2YUS A;  3SJM A;  3RYP A;  4PCQ A;  2NNY A;  3G4S I;  4A3B J;  2N8G A;  5ERI A;  5DTD A;  4QPO A;  3JSO A;  4RB3 C;  2XAJ A;  4JX4 A;  2R7T A;  3RDI A;  4BXU A;  1D5Y A;  2PBI A;  5CQG A;  4CYD A;  2TCT A;  2OU2 A;  1WI9 A;  1FPQ A;  2P5K A;  2EIM H;  5FO5 A;  1XSD A;  5JLX A;  3IKV A;  2QWW A;  2VON A;  1Z0X A;  1OCC H;  1V54 H;  3GWZ A;  2HGC A;  2IXS A;  4U88 A;  3EQL F;  3FIW A;  1EH6 A;  2EH3 A;  3K4B A;  3I0T A;  2BVL A;  3GLX A;  3LQQ A;  3WTU C;  2ZFU A;  3F9K A;  1QA6 A;  5F6F A;  1ETO A;  4EGZ A;  4RB1 A;  4CHU A;  1EF4 A;  3BWG A;  2JPC A;  2BE5 F;  3LFK A;  1IRZ A;  1S6L A;  1HW5 A;  1P7J A;  2DDB A;  4ENK A;  2EJR A;  3KZI C;  1LFB A;  1UAA A;  4KFC A;  1Z6T A;  3ZMD A;  4Q47 A;  4II2 A;  4RGX A;  1FIA A;  1I6X A;  3DWL E;  1F9N A;  3IWF A;  5EYR A;  1KA8 A;  1R9T J;  1HDP A;  3S3N A;  1IN4 A;  4HPQ A;  5LHI A;  3DEE A;  4A6E A;  2PQ8 A;  2CJJ A;  3IH2 A;  4A3I J;  1YHQ I;  1C0W A;  2VB6 A;  4Y3O A;  4ZYE A;  4EMS A;  1FOK A;  1ZAO A;  4U0Y A;  1LNW A;  2RRE A;  2WAF A;  2LH9 A;  4XN3 A;  2JMW A;  2LF7 A;  3C3W A;  2XAH A;  5E3M A;  2HQA A;  3TBI A;  2M1B A;  2X1E A;  3F72 A;  4KN7 X;  5GAH J;  4XQF A;  5LD2 C;  2STT A;  1ETY A;  3CES A;  3QOD A;  3T8T A;  2ELK A;  3MKY B;  2L7K A;  2PMU A;  3CDL A;  3DBR B;  3ZQF A;  1WI3 A;  4XRS G;  1GUU A;  3HUG A;  2D5V A;  2L9S A;  2CV2 A;  4ZJZ A;  3VPR A;  1VQO I;  2R7D A;  2X6X A;  2VE8 A;  1WH5 A;  3VEP A;  2CUJ A;  2E7W A;  1N25 A;  5E1X A;  2B9S A;  1N77 A;  1FT9 A;  3H0G J;  5J8C A;  4HZF A;  2DN0 A;  4FCY A;  1UZC A;  3CZ6 A;  4AIJ A;  1R58 A;  4WXC A;  4Q48 A;  3OYD A;  1UHM A;  3F8N A;  3WG7 H;  2KIM A;  3JRE A;  2GXB A;  2RKH A;  2RNJ A;  3LSP A;  4PZJ A;  4OIN F;  1ZRF A;  2KRC A;  3N05 A;  2GLO A;  2DQL A;  3C1D A;  1JTX A;  1A31 A;  4ESF A;  1IN6 A;  2BVM A;  3JW4 A;  3ABU A;  3L2R A;  1XSX A;  2COM A;  2P81 A;  2GWR A;  3HJE A;  1LQ1 A;  1HW2 A;  4PSX A;  2IA0 A;  1LE8 A;  3K0L A;  2EZK A;  3ECH A;  4QTR A;  3R0A A;  2H27 A;  2ACJ A;  3DBH B;  1U9O A;  3WE2 A;  2E71 A;  3ABK H;  1HBX G;  4XN0 A;  1QPM A;  4GRI A;  2QA4 I;  4ENM A;  2YSR A;  3S1R J;  5C3E J;  1MMN A;  2JUC A;  4NQW B;  2CV1 A;  2K40 A;  5CJ9 A;  4A3K J;  3OS2 A;  2D45 A;  3BR3 A;  3DQV C;  2EPF A;  3CDI A;  3RKQ A;  3ML6 A;  2KDO A;  2MAB A;  3H0D A;  3BG5 A;  4LLL A;  1KYW A;  3CCS I;  4CCK A;  4FAS D;  2LNB A;  3QOP A;  5BPD A;  3WHB A;  1R1V A;  1T6S A;  2DMP A;  3LST A;  5M5Y J;  4U87 A;  2HXO A;  1OCO H;  3CTA A;  4P55 A;  2L7M P;  1U78 A;  3ZQ7 A;  4GYI A;  2KP6 A;  1VQM I;  2HI3 A;  3TO6 A;  1ZYR F;  3CCV I;  4FQG A;  3CDH A;  4UB8 C;  2DOF A;  3FX3 A;  5IP6 A;  2RQQ A;  3TO9 A;  3S1M J;  4MQ9 F;  1UCR A;  4UVB A;  3EUH C;  2E1M B;  3IWZ A;  4DYR A;  2DT6 A;  2F5E A;  2GA1 A;  4U0V A;  4BKX A;  4YFN F;  2HS5 A;  2EK5 A;  2FXA A;  4CCN A;  2M0C A;  2ECC A;  3ULQ B;  3GEZ A;  2X1C A;  1XB4 A;  2XGD A;  2FX0 A;  3FK6 A;  3AG1 H;  2R7Q A;  2KZG A;  5E8G A;  2DPD A;  2KHM A;  2L0K A;  5DUI A;  3DEU A;  4IZZ A;  1GV2 A;  4LIV A;  3KE2 A;  4N4N B;  2DXI A;  4OU0 A;  1BI0 A;  3K1P A;  2HQN A;  1DGR M;  2HZD A;  3VFZ A;  2MYS A;  1Z6R A;  2K4J A;  3ABM H;  1K78 A;  2GZW A;  2LY2 A;  2RC4 A;  2ELH A;  1PYV A;  1T2K A;  1EKE A;  1SAN A;  2KKO A;  5BNG A;  2HFH A;  4B8X A;  4HQM A;  2YX7 A;  4M6Y A;  3HOZ J;  2R7X A;  1I1G A;  1HF0 A;  2CUE A;  4E7S A;  3EUH A;  3IH4 A;  1BJZ A;  4RGR A;  2OC6 A;  2RQP A;  2BY3 A;  3M1C A;  2P6S A;  4M3E A;  1YRN A;  3RI4 A;  3S15 J;  3BTL A;  3KYD B;  2JN6 A;  2LTP A;  3HB9 A;  4R1H A;  5JHU A;  1T56 A;  3J7A O;  5EZH A;  2MG4 A;  3NQO A;  2QGU A;  4BQN A;  3WG9 A;  1Z1D A;  2JT1 A;  2KJB A;  5J4Y A;  3NRV A;  1HXD A;  2RGV A;  1SMY F;  3JAM Z;  3OYM A;  1VQK I;  4ZZD A;  2O7O A;  4ENJ A;  1KQ8 A;  3EYI A;  2ZXJ A;  4DQ2 A;  3BTC A;  2K9S A;  2Z2S B;  4LIT A;  3QP5 A;  1QPI A;  1O7F A;  2E35 A;  2ZJQ F;  4E7I A;  1JJ8 C;  2JA2 A;  2HOE A;  2XPU A;  1J9I A;  2W4S A;  3HRT A;  2XB0 X;  4I6Z A;  1UHS A;  3BZK A;  4IEJ A;  1UHW A;  3RKW A;  2GM4 A;  2AQE A;  2RN7 A;  4E4H A;  2L4A A;  4A3L J;  4ANJ A;  1X58 A;  1B1B A;  3KZZ A;  1TP4 A;  5J6X A;  3CO7 C;  3TP3 A;  4HF2 A;  3M8E A;  2BYV E;  2JWT A;  4PJM A;  2CU7 A;  1DGW Y;  2DA6 A;  3KFW X;  1ZRE A;  3OYK A;  1YIO A;  2V7F A;  3RIR A;  3AKZ A;  2Y69 H;  1FSH A;  2HXI A;  5HLH A;  3P9C A;  2NRA C;  2W24 A;  3A4C A;  3A03 A;  4BHP A;  4KIB A;  1O7L A;  1MDM B;  2DW4 A;  3P9K A;  4Y7N J;  2QEX I;  2DJN A;  2OV7 A;  4M9X A;  3GTK J;  2IGM A;  1XMK A;  4OOI A;  1MJ9 A;  1EH8 A;  3BG3 A;  5F64 A;  3GVA A;  5BQT A;  3RJP A;  3HOX J;  3QOE A;  5L3F A;  2MLG A;  2A05 A;  4BE2 A;  4X6A J;  3R6S A;  2O03 A;  2DFI A;  3NEU A;  1SFX A;  3FXR A;  4FIS A;  1S7O A;  2H1K A;  4Y13 A;  3TMO A;  3A01 B;  2ZXI A;  1Y8Q B;  5FKN A;  2ID6 A;  1JUP A;  4KIS A;  1IG7 A;  2MC4 A;  4MHG A;  3MZH A;  1HC8 A;  5EG0 B;  4QSH A;  2VAS A;  1OCZ H;  3K4K A;  1JT6 A;  1WWX A;  5L3E A;  4CZZ A;  5HLG A;  4M9S A;  2R7V A;  2EV5 A;  1YE9 A;  3JR9 A;  3DV8 A;  1X1C A;  2GBY A;  2CWE A;  4F92 B;  2WWY A;  2JVH A;  1TWA J;  2YS9 A;  3I4P A;  3FM3 A;  1XPX A;  1JHH A;  2KFD A;  1OJL A;  2KDZ A;  2QKL B;  1Y8R B;  3CCQ I;  4G9Y A;  5H2F C;  4BQO A;  3LWF A;  5IOZ A;  1Y1V J;  1FP1 D;  1BI2 A;  3DTK A;  3FXM A;  3WU1 B;  4OIQ F;  3BQY A;  3CJQ B;  1UJ8 A;  2H09 A;  2QSF X;  2VKD A;  3CC2 I;  2DT5 A;  1OPC A;  2FF4 A;  3BPV A;  2PJR B;  2X1D A;  3E6D A;  2K27 A;  3H5N A;  4HST A;  1WJA A;  2XSJ C;  1MBH A;  2M87 A;  4JP0 A;  1X3U A;  3LL7 A;  3O2P E;  5FKL A;  3S3O A;  5K5R A;  2V1U A;  3ZMV A;  3H1C A;  1ETQ A;  5AIP A;  2VQH A;  4BBS J;  3HGG A;  4L5E A;  1MIJ A;  4G8X A;  5J1Y A;  1J59 A;  1X19 A;  2XAQ A;  2NOG A;  1KGS A;  5FRO A;  3J80 Z;  2LD5 A;  2ICW G;  3W2W A;  5FLV A;  2XRN A;  3HSE A;  5CVR A;  3ZXS A;  2EB7 A;  4M3B A;  2JA6 J;  1KU3 A;  3FZV A;  3ECO A;  3OOP A;  3OYF A;  3N97 A;  3DPL C;  1OFC X;  3ZRG A;  1OKR A;  3O8G A;  1QQI A;  1WJF A;  3CJT B;  2ME0 A;  3QP6 A;  3ZQI A;  1JKR C;  1IXR C;  1I3Q J;  5D4R A;  2FOK A;  3S2W A;  1IN8 A;  1JTY A;  3DPU A;  1OMI A;  3I71 A;  4CCL A;  1TLH B;  1Z05 A;  1Z7L A;  1VF9 A;  5TRD A;  1F1Z A;  1W36 D;  5E3L A;  2MLK A;  5KNL A;  1TWC J;  5JVT A;  2PX9 A;  1O3Q A;  4AD9 A;  2CQK A;  4HX4 A;  3LSK A;  2MFZ A;  2VJ4 A;  5CPR B;  3VOE A;  2ZXH A;  3GBG A;  1TQP A;  4UV9 A;  1IUF A;  3QU6 A;  1D1A A;  2XRO A;  3L7W A;  1JT0 A;  4OIP F;  2HDC A;  5TGT A;  3SDG A;  3RQI A;  2Q1Z B;  2NS8 A;  4XON A;  2WAQ N;  1LFU P;  4WX9 A;  4I76 A;  3RPU A;  1LEB A;  1XDS A;  1NG7 A;  1STZ A;  3A0B C;  2VKH A;  2JVG A;  4B4C A;  2LP0 A;  2ZNZ A;  2K9L A;  1FSE A;  2EFQ A;  3AG4 H;  3ZOB A;  3OYI A;  4AC0 A;  2Z16 A;  2XKO A;  2YPR A;  4AID A;  4HLX A;  5LFA A;  1T08 B;  1MBE A;  1UG0 A;  3U1K A;  3BTI A;  2Z33 A;  2DI3 A;  1IF1 A;  2X6Y A;  1RES A;  1PVE A;  3U9G A;  2CW7 A;  3C2G A;  2OTL I;  2PEX A;  2J5O A;  3K9T A;  2VOO A;  1DDN A;  4XLN F;  3C2B A;  1EH7 A;  3BPX A;  3CCL I;  2P5V A;  3PM1 A;  2W85 A;  3V8L A;  3SYT A;  1EV7 A;  5FKK A;  2LRD A;  1Y39 A;  4Z6Y A;  4HW0 A;  3E3V A;  2Z9O A;  4BE1 A;  1GVD A;  5HS7 A;  2I10 A;  1TQM A;  3PO3 J;  3BC8 A;  1P92 A;  2K02 A;  2UUZ A;  3OYG A;  4BHC A;  1WJC A;  3GZ5 A;  4B44 A;  3GX4 X;  3IL2 A;  2OZU A;  3DF8 A;  3E5U A;  1IV6 A;  4RAF A;  3LOC A;  4DNC A;  2NNN A;  5CYV A;  1H9T A;  3NAU A;  1W7P A;  4Y15 A;  1ZG3 A;  2BV6 A;  3NWT A;  4YIR X;  2MH9 A;  4AWX B;  3W3C A;  1RNL A;  1XX5 A;  2IGO A;  4KJZ A;  3RZO J;  1FYM A;  1ORK A;  1WJB A;  1YW7 A;  5DD4 A;  1TT0 A;  2CS3 A;  1P4W A;  2ZC2 A;  2E19 A;  3HTU A;  4YII A;  3P7N A;  1LE8 B;  2JZY A;  4PJN A;  5DM6 F;  2M0M A;  4D5F A;  1TC3 C;  1SD7 A;  4BAY A;  3GYH X;  3M8F A;  3V7C A;  2STW A;  2Z3Y A;  1HQC A;  2CFO A;  4LOC A;  1J7K A;  2DA1 A;  3IAM 2;  2FEZ A;  3EUK L;  3ASO H;  3OY9 A;  2X6O A;  2F2E A;  3G1O A;  3GF2 A;  1YLF A;  2VQL A;  2EFN A;  3FKJ A;  1L3L A;  2ZXW H;  4TV7 A;  4C2M J;  4CCJ A;  1OYY A;  2MBF A;  2XF6 A;  3OOU A;  4HEA 2;  3KYL A;  5B1B H;  4YG2 F;  1MDM A;  3J7Z I;  3WGG A;  1RUO A;  2B7E A;  1BR2 A;  1R49 A;  1HOM A;  2K9N A;  4DW6 A;  3J81 K;  1W5T A;  4Q5S F;  2L5Q A;  2OPT A;  4M72 A;  2DO7 A;  2ZSI B;  3L2Q A;  1E3O C;  4BXX J;  4DZP A;  2OJE D;  1R5H A;  1I3A A;  3ABL H;  3I9V 2;  3UNG C;  3L9F A;  2CGP A;  3CME I;  4ENN A;  3PIP F;  4QPQ A;  1ZG5 A;  1SVO A;  1Z77 A;  4Y17 A;  3FMR A;  3H3Z A;  1W1W E;  2NVY J;  1NTC A;  3IAS 2;  3HOV J;  4R8H A;  3LA3 A;  2DMT A;  5E17 F;  2WC2 A;  3VSK A;  3KP5 A;  3CO6 C;  2V9K A;  2K3F A;  1HLV A;  5GP9 A;  5L3D A;  3REO A;  2A61 A;  3BTJ A;  1DQU A;  3WGH A;  3GTP J;  3F6V A;  3G3Z A;  1VQ9 I;  1D0X A;  6PAX A;  2FRH A;  2EA2 A;  2WAQ A;  4HNT A;  3DKY A;  1QZZ A;  4L9V A;  3ERM A;  3E5X A;  1SFU A;  5ILV A;  1Z7U A;  3Q9V A;  1OCP A;  4M6V A;  1Z9C A;  2DTR A;  1BC8 C;  3CUQ C;  2HPM A;  3OYC A;  1IN7 A;  3K7A J;  2XAS A;  3K4M A;  5AIQ A;  1ZAR A;  1K78 B;  5IYC J;  4XRS A;  1U0J A;  5EEH A;  1TWH J;  5FLX K;  1FBU A;  3GFJ A;  4Z2Y A;  1QHG A;  2Q0O A;  1YW9 A;  2VBW A;  2DA3 A;  3TP0 A;  2VPL A;  4XLF A;  1JUM A;  1H0M A;  2CQN A;  4IVN A;  2XAG A;  4AVZ A;  1FTT A;  4LK0 F;  4XKV A;  4OMZ A;  3I56 I;  3E7L A;  2KZV A;  1UG2 A;  5TIS C;  1K79 A;  2MD5 A;  2HYJ A;  3FKI J;  4IHV A;  4RM2 A;  2OZ6 A;  4BGD A;  1ZRC A;  1QU3 A;  2CFX A;  3MEX A;  4ITV A;  2DYR H;  1G8X A;  5D4S A;  4BJ5 C;  1JGG A;  1TBX A;  4AIK A;  2ZME C;  1A6Q A;  4EEF G;  1R23 A;  3ZMS A;  4MFD A;  1P7I A;  2ZJR F;  3CUQ A;  1U9N A;  2ZNY A;  4U0W A;  1MSE C;  2FU4 A;  1G3S A;  2VQG A;  3HPG A;  5KAF C;  4EJT A;  4V2F A;  1FMW A;  2DAO A;  4IOC F;  2W57 A;  4BY7 J;  1L0O C;  3VOD A;  1K4T A;  5DD8 A;  1RZ4 A;  2K9Q A;  1USS A;  2RDP A;  1IRX A;  1G2H A;  3CCR I;  3G2B A;  3JCU C;  2HVS A;  1R7J A;  3A0H C;  4RS8 A;  1ZLK A;  5EDN A;  3BQZ A;  1V4R A;  3PO2 J;  4UV8 A;  3TL4 X;  4IHY A;  4BDZ A;  1G3Y A;  4P1W A;  4B47 A;  5C4X J;  4D9J A;  2E1C A;  2MA3 A;  3K4C A;  2QUF A;  2L02 A;  3O6B B;  3M07 A;  2NOJ B;  3FK7 A;  1PJR A;  2DLL A;  1R4N B;  3PUF A; 
#chains in the Genus database with same CATH homology
 2XGD A;  4UUT A;  2ECB A;  2FX0 A;  2Y31 A;  3GTJ J;  3FK6 A;  2L0K A;  2VKE A;  3GTO J;  4M3G A;  1GV2 A;  1XC5 A;  4BBR J;  1B8I B;  1RET A;  2JA5 J;  3Q0V A;  2M9H A;  1JKQ C;  2LVS A;  1RKT A;  1SAN A;  5BNG A;  3S1N J;  3HOZ J;  1HF0 A;  2CUE A;  4B3A A;  4A3C J;  1AKH A;  2EZL A;  3IH4 A;  1BJZ A;  4JYK A;  5EGO A;  2Y2Z A;  4M3E A;  1YRN A;  4XID A;  4DYQ A;  1F36 A;  1NK3 P;  3S15 J;  3BTL A;  2JN6 A;  2LTP A;  3HB9 A;  1T56 A;  2G0E A;  1RPW A;  2FJ1 A;  1QVT A;  5EZH A;  2MG4 A;  4AUX A;  2DA7 A;  1PUF A;  1MBJ A;  4RDU A;  2CQQ A;  2IAI A;  2JK3 A;  2ID3 A;  4UUS B;  5FKO A;  2VI6 A;  1XS9 A;  2O7O A;  2XGC A;  4JX6 A;  4A3J J;  3WHC A;  5IPA A;  3BTC A;  2K9S A;  1GV5 A;  1QPI A;  1RR7 A;  3Q3S A;  2LFB A;  4CYC B;  2Y9Z A;  1JJ8 C;  2HQ5 A;  2XPU A;  2CRG A;  5J3L A;  4I6Z A;  2XB0 X;  3FIS A;  1UHS A;  4IEJ A;  5J1R A;  2COB A;  2IBD A;  3I4N J;  3Q0U A;  2GM4 A;  4Y52 J;  3NAR A;  5IOY A;  4A3L J;  3B6A A;  1X58 A;  3TP3 A;  4DZJ A;  2XPW A;  2JWT A;  2CU7 A;  1U8B A;  4DYC A;  4X1E A;  1JKO C;  3QQA A;  1ZK8 A;  5FLM J;  2DA6 A;  3MVP A;  4A3M J;  3QPS A;  1HCR A;  2NVT J;  3M3Y J;  1ZR4 A;  2HXI A;  2Y0S N;  3BR0 A;  3HOU J;  2XSD C;  2ME6 A;  3H3V K;  3JRF A;  3A03 A;  4A3E J;  3JRG A;  3I4M J;  2X9D A;  2Y30 A;  3GTL J;  1Q1V A;  1QRY A;  2WV1 A;  4Y7N J;  1Y1W J;  2DJN A;  3GTK J;  2MW8 A;  2X48 A;  3SFI A;  3BG3 A;  2DA2 A;  3HOX J;  1CQT A;  1UMQ A;  5C4J J;  1F43 A;  4X6A J;  1MBF A;  4AYB N;  4MO7 A;  2PMZ N;  4FIS A;  2H1K A;  4A3G J;  2MSY A;  5GPC A;  3A01 B;  1K83 J;  3S16 J;  5FKN A;  2ID6 A;  1BW6 A;  1JUP A;  1IG7 A;  4G12 A;  2WB1 N;  5EG0 B;  2DMU A;  4QSH A;  3S14 J;  4UUS A;  3JRI A;  2ZB9 A;  1JT6 A;  4C3H J;  1IDZ A;  2FD5 A;  2EZH A;  5C44 J;  4MFE A;  3JR9 A;  3L1P A;  2GBY A;  1H88 C;  3ZQG A;  2M8G X;  1TWA J;  2YS9 A;  4CYC A;  1OJL A;  3HDD A;  2KDZ A;  1MBK A;  3QPL A;  4ABZ A;  1DU0 A;  3TW6 A;  1S7E A;  5IOZ A;  4D5C A;  1Y1V J;  2HOA A;  3K2A A;  1TWF J;  1IDY A;  3HEF A;  2B63 J;  3BQY A;  5M3F J;  3G1L A;  5IYB J;  1FEX A;  5J1U A;  2R0Q C;  1GT0 C;  5EZG A;  1GDT A;  4JP0 A;  1MBH A;  3S17 J;  4B1R A;  5FKL A;  2R5Y A;  1BL0 A;  4A3D J;  1ETQ A;  2YU9 J;  5F0C A;  4BBS J;  3HGG A;  4L5E A;  5IP9 J;  1HDD C;  2E1O A;  5J1Y A;  1QVU A;  5IP7 J;  5IYD J;  1A5J A;  2NOG A;  2LD5 A;  2EBI A;  1H89 C;  1ZR2 A;  5FLV A;  1MBG A;  1B72 B;  3O8H A;  3TW7 A;  1MH3 A;  4M3B A;  3BR5 A;  1IGN A;  2JA6 J;  4W1U A;  3G1M A;  4JX5 A;  2JA8 J;  5FJ8 J;  1JKP C;  1MH4 A;  1OFC X;  4IHX A;  3O8G A;  2VPR A;  3MKL A;  2ME0 A;  3ZQI A;  4HNV A;  1JKR C;  1NK2 P;  4MIM A;  3HM5 A;  1I3Q J;  3JRC A;  1JTY A;  1FIP A;  1ZQ3 P;  3IH3 A;  3A01 A;  1VF9 A;  5E3L A;  1TWC J;  5EG0 A;  4FE7 A;  1JUS A;  2RAE A;  1VFC A;  2HOT A;  3GBG A;  5M5W J;  2NVQ J;  1IUF A;  1JT0 A;  2KT0 A;  3CCY A;  3SDG A;  3RQI A;  2E2J J;  2NS8 A;  5F04 A;  3Q0W A;  3UKG A;  2AO9 A;  2DMN A;  1DU6 A;  4J19 A;  1VND A;  2R92 J;  1MNM C;  1T33 A;  2MGQ A;  2WAQ N;  1LFU P;  3S1Q J;  4I76 A;  1MSF C;  1B8I A;  1WCM J;  2LKX A;  4B4C A;  2LP0 A;  5E3N A;  3OIO A;  3M4O J;  5F1J A;  2NVX J;  1ITY A;  3CMY A;  3B6C A;  1BW5 A;  1ETK A;  3DCF A;  4FTH A;  2LR8 A;  1FTZ A;  3ZOB A;  3ZQH A;  4AC0 A;  3D1N I;  1ETW A;  1SFO J;  3JRH A;  3BR2 A;  3MN2 A;  1MBE A;  3BTI A;  3LSG A;  1RES A;  3DEW A;  4W97 A;  5DS9 A;  1VI0 A;  1WGX A;  3OSG A;  3A02 A;  3F0C A;  1YRN B;  1X2M A;  1XG1 A;  3C2B A;  2HDD A;  4GFB A;  2OF7 A;  3PM1 A;  5FKM A;  5FKK A;  4V2G A;  2EQR A;  2YUS A;  5M3M J;  2R5Z B;  3SJM A;  2VUM J;  4A3B J;  1GVD A;  4XK4 A;  2N8G A;  5DTD A;  1ZGW A;  2EZI A;  2I10 A;  2AHQ A;  4JX4 A;  3PO3 J;  1D5Y A;  2TCT A;  5K7F A;  1IV6 A;  3LSR A;  3LOC A;  3HBL A;  5JLX A;  3NAU A;  2XB5 A;  2W48 A;  1Z0X A;  5F0F A;  5F08 A;  4QIW N;  3HOY J;  3CQZ J;  3FIW A;  2EH3 A;  1I6H J;  5M5X J;  2JA7 J;  3RZO J;  1AHD P;  1ORK A;  3BG9 A;  4RBO A;  2DMQ A;  2E2I J;  1ETO A;  2E19 A;  1EF4 A;  1WH7 A;  2HOS A;  2VKV A;  4C3I J;  1LE8 B;  4BY1 J;  1IRZ A;  1OCT C;  5EF6 A;  4D5F A;  3S2D J;  3S2H J;  1TC3 C;  1P7J A;  1LFB A;  4S0H B;  4LOC A;  2L7F P;  2DA1 A;  1FIA A;  2TRT A;  5EYR A;  1R9T J;  1HDP A;  4FE4 A;  1X2N A;  2X6O A;  3G1O A;  2DA5 A;  2DA4 A;  3IV5 A;  2QF7 A;  2CJJ A;  3IH2 A;  4A3I J;  2H8R A;  2LLK A;  4C2M J;  1H8A C;  4M3D A;  5E3O A;  3BR6 A;  5JLW A;  3OOU A;  3ZQL A;  2JMW A;  2R93 J;  1POG A;  5E3M A;  5HOD A;  1HOM A;  2K9N A;  4DW6 A;  1APL C;  1ETY A;  2O8K A;  2ELK A;  3CDL A;  2OPT A;  2M34 A;  3ZQF A;  1WI3 A;  4XRS G;  1GUU A;  1ENH A;  4XIC A;  1E3O C;  3GTQ J;  2D5V A;  4DZP A;  4BXX J;  3HGY A;  3VPR A;  2R5Z A;  1WH5 A;  3BR1 A;  2L7Z A;  3H0G J;  1Z77 A;  2DN0 A;  2NVY J;  3HOV J;  1NTC A;  4FCY A;  1IJW C;  2DMT A;  2LK2 A;  1HLV A;  5GP9 A;  3JRD A;  3BTJ A;  3JRE A;  3JRA A;  3GTP J;  3LSP A;  5F0H A;  2GLO A;  3TED A;  1ETX A;  1JTX A;  2M2E A;  4M6V A;  2LY9 A;  1OCP A;  5K7H A;  2CUF A;  2P81 A;  2XPV A;  3K7A J;  3LNQ A;  4IHW A;  3JRB A;  5IYC J;  4XRS A;  1LE8 A;  1TWH J;  2L9R A;  2EZK A;  4QTR A;  4NDL A;  3W6V A;  9ANT A;  2O9L A;  2DA3 A;  3TP0 A;  1JUM A;  1U9O A;  1AKH B;  2IEK A;  3ZQC A;  1FTT A;  3GTG J;  5EGO B;  2R5Y B;  3S1R J;  5C3E J;  1JJ6 C;  1ZKG A;  2K40 A;  3E7L A;  1W0T A;  1UG2 A;  2XGE A;  2XRL A;  4A3K J;  1RKW A;  1BA5 A;  2HYJ A;  3FKI J;  3BR3 A;  4IHV A;  5K7Z A;  1TWG J;  2Y9Y A;  2NS7 A;  3RKQ A;  1A6I A;  2JJ7 A;  1IC8 A;  1JGG A;  1O4X A;  2QCO A;  4C3J J;  3BG5 A;  1PUF B;  4EEF G;  1FJL A;  4MFD A;  3OSF A;  1P7I A;  3BT9 A;  1B72 A;  1WPK A;  1ZTR A;  3WHB A;  4XRM A;  1U9N A;  2DMP A;  5EEA A;  1MSE C;  4A93 J;  5M5Y J;  4D7M A;  1W0U A;  2HXO A;  4MLO A;  4D7N A;  3RZD J;  2L7M P;  1U78 A;  4V2F A;  2HI3 A;  1I50 J;  4BY7 J;  4A3F J;  5F27 A;  2K9Q A;  2DTZ A;  1G2H A;  5IP6 A;  3S1M J;  5EDN A;  3BQZ A;  2CQX A;  3PO2 J;  2E2H J;  1ETV A;  4IHY A;  3GTM J;  5C4X J;  4DYR A;  1AU7 A;  4A69 C;  1K61 A;  4M3F A;  2FQ4 A;  4BKX A;  3HKZ N;  3LSJ A;  3HOW J;  3FK7 A;  2M0C A;  2ECC A;  2R7Z J;  5GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...