2PMUA

Crystal structure of the dna-binding domain of phop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
VRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation
molecule keywords response regulator PHOP
publication title Structure of the DNA-binding domain of the response regulator PhoP from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 25
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pmuA00
2FBIA 3PQJA 1XSDA 1G3TA 3ZPLA 3I59A 2WTEA 2DI3A 3IKTA 3GLXA 4JQFA 5D6EA 3IL2A 4HOBA 1SFXA 5KK1A 3FMRA 4WK8F 3Q9SA 4LD5A 2ZCWA 4EGYA 3IKVA 1G4DA 4LB5A 2H09A 1LDDA 1W7PA 3EYIA 3FF5A 1YYVA 2EJRA 2V9VA 5JHUA 3IHUA 1Z6TA 5LGNA 4DNCA 1LEBA 1ZGJA 3K1PA 2XAGA 1R00A 2JZYA 4XLNF 4EJOA 3V7CA 3KP5A 2CO5A 4R79A 3Q5FA 3RTRA 5DUIA 2XIGA 1XSVA 3G73A 1Z05A 4U7DA 2XROA 2YU3A 3O3KA 3WODF 3KEOA 5DD8A 1BIAA 4ESJA 4L0YB 4EGZA 3U1DA 1S3JA 4YIFA 3WTTC 3CUQA 1IN7A 3I64A 3S2WA 4A2UA 2PBIA 3I54A 4I0AA 4BHCA 4YFNF 1FX7A 4ZH4F 2FMYA 2WC2A 3ZQ7A 4ENMA 3BJ6A 2P8TA 3IC7A 1FT9A 2ZXJA 1XD7A 3ML6A 3VFZA 4XSZF 3E97A 2Z9OA 3HRUA 4G7HF 4A0ZA 2IW5A 2Y48A 4UHTA 4KT5C 2V1UA 1XSXA 3FMQA 2MH2A 3HRTA 2H27A 3J81K 3WU0A 2W85A 2XAQA 6PAXA 4L9NA 1J7KA 1F1ZA 3TO9A 4CGZA 1XDSA 4GXOA 4G7ZF 2L01A 3BWGA 5BOXA 1XN7A 3QPHA 5LHGA 3LFKA 1ZAOA 3GZ5A 1YLFA 3AAFA 2D1VA 2Z5UA 3KP6A 2M5WA 2OA4A 1MDMA 2MLGA 3WGIA 4HQMA 4MEXF 3KP3A 2L54A 4PGGA 2HR3A 1JXSA 2BGCA 5JR3A 5D6FA 1ZG3A 1QO0D 2VN2A 2STWA 4A0XA 2A5YB 5TRDA 1KGSA 1OYYA 2P5LC 1SMTA 2KIFA 1P4AA 3R0AA 5FO5A 3K2ZA 1T2KA 2DU9A 4MEYF 4LMYA 4M9XA 4HQEA 5LGTA 3ZN1A 5DD4A 1TLHB 1AWCA 4KMUX 5FGMA 2EA2A 2OBPA 5H20A 4LG0B 1U8RA 2KJBA 3GWZA 3SFZA 5E8GA 3GX4X 3CO7C 3F23A 2W24A 4U0YA 4EQQA 1WQ2A 3BZ6A 1RIOH 4KICA 4HDVA 1O3TA 1FP1D 2Z99A 2IA2A 3FM5A 4BHPA 1LB2A 2YX7A 2ACJA 2MD5A 5K1YA 1OYWA 3TDUC 1QPMA 1OR7A 4AVPA 1IXSB 2LNBA 1ZHFA 5BS6A 3K69A 4U7BA 1S6LA 1I5ZA 2FU4A 2HYGD 1YTYA 1R58A 3SHFA 1A04A 2QQ9A 1R22A 1IXCA 2FMLA 2HQRA 3QPTA 2HDCA 3RIRA 3E5QA 4MGRA 2YSRA 2VXZA 3F8CA 1XGMA 2JPCA 4YFKF 5HLHA 1RNLA 5DEQA 2CSOA 3WGHA 1RI7A 2EFPA 2W84A 4EMSA 4E70A 3DF8A 4HF0A 3BPVA 2VBZA 3QU6A 2EV0A 4O6JA 3T8RA 5D5UB 2QZ8A 4YFXF 3KCCA 4R8HA 2XAHA 3M8EA 3HSRA 2DLLA 3I59B 3KP7A 4EM2A 1J9IA 1BI3A 3M9AA 1J59A 3V4GA 4KIFA 4Z2YA 3GZ6A 4CHUA 2AXLA 4OMYA 2DPUA 3EDPA 4HW0A 3C7JA 3GFLA 1W7PB 4L5JA 2NNYA 5A2QK 2OAZA 5AIPA 5HLIA 3LA3A 5EEHA 2EB7A 2HGCA 3TKYA 2UWMA 4EJVA 3V8JA 2YR2A 1XDUA 3E6CC 4BAYA 1UHMA 1ZH5A 2A68F 3GF2A 4G94A 2F5EA 5FFXA 2OD5A 2E1CA 2M45A 3CUQB 4HAMA 3KLNA 3R61A 3T0YA 2ZJ2A 2YX4A 3HHGA 4XRFA 3I5UA 1KA8A 1U5TA 2XAJA 1KQ0A 3F8BA 2FQ3A 3SQNA 1I6XA 1I1GA 3JSOA 4KNYA 4I02A 4P9UA 1W7PD 3WE2A 2JTVA 2K7LA 4Q47A 4RGRA 3DXJF 1ZRFA 4Q4ZF 3WTZA 4IVNA 1J75A 1H9TA 1MGTA 1MJ9A 2K4JA 4JK1X 4M6YA 3WG9A 1SFEA 2OQRA 4RAZA 2EFWA 1K78A 3KP2A 4WWCA 1XMAA 1WKMA 4A6EA 4UUVA 4S04A 1SAXA 3O6BB 4MTDA 1O3SA 2H94A 4BHBA 4PZJA 3WTWC 4G6DA 4L9TA 2DQRA 4EJWA 2XVCA 1ZREA 2FBHA 4IJAA 5HS9A 5K5RA 3ELKA 2TDXA 2HKOA 2DTRA 4I01A 1YIOA 1BI1A 1YW8A 4UXNA 4P9FA 3L7WA 1S29A 3T5XA 1T98A 1GVJA 2IA0A 1FNNA 4PDKA 1S8NA 2HTSA 4FT8A 1MDMB 1KU9A 2Z33A 2J5PA 4ZYDA 4OIOF 1KQ8A 2FOKA 3LQRA 2BBYA 3FHZA 4BH9A 1FYLA 3T8TA 1FSEA 2IRFG 1Z9CA 5J8FA 1O7LA 1R5HA 4UVCA 4FX4A 5BPIA 1Z91A 2L02A 5ICGA 2E7WA 3BP8A 2UXXA 4HX8A 1UB9A 4RB3C 5J6XA 3LSTA 1EH6A 3J81Z 2MLKA 2D2WA 3KP4A 2F2EA 5BQTA 4EV0A 2FNPA 3HOTA 3FXUA 2FSWA 3KZYA 1ULYA 3K1MA 2PI0A 3COAC 1HW2A 3F72A 2XGXA 3LA7A 3KETA 3E5XA 2G7HA 3TGNA 5L3EA 1PUEE 4LGWA 1B9NA 4A5MA 2FBKA 2PEXA 2LKPA 2L4AA 2HQNA 2FRHA 1FBSA 4EJUA 4L18B 2PJPA 5L3CA 1LJ9A 4HV5A 3HRSA 1T0FA 5CJ9A 4U0VA 1B6AA 3DFGA 2BYVE 3F8FA 4IF4A 3C18A 3GUDA 2QM3A 2CGPA 1V3FA 4K2EA 4ENNA 2OZUA 3GFJA 4Y15A 3E5UA 2ADUA 3MZYA 3WTYC 2J5OA 1GHCA 4MQVA 2IT0A 2COMA 4HA8A 3RKYA 4OIRF 1F9NA 3HSFA 4A6DA 2ZMEA 4RB2C 4ENKA 4OIQF 4P96A 1YS7A 1YQAA 3PFIA 2G7UA 4TV7A 4WF2A 2W57A 2VT3A 2Y75A 1LDKB 2EFQA 2R7FA 2JSCA 1MJBA 2L4MA 4EJTA 2HKXA 4KUMA 1BIBA 3C3WA 1SFUA 2QQAA 1Z1DA 2ESNA 3JSPA 2VC1A 5LRRA 3K0LA 4I0BA 2CG4A 4KN4X 3H3ZA 3Q9VA 3J80K 2EA4A 4GO1A 2H6CA 3R4KA 2CWEA 3KEQA 1U3EM 4M72A 2XKOA 3QP6A 5CVRA 3GEZA 2NRAC 4EM0B 4HLYA 1IN8A 2ZKZA 2KIUA 4HDUA 5LGUA 3LA2A 4YG2F 4GGGA 3CUOA 3HTUA 4BQAA 3DPTA 4KFCA 4N9HA 5E18F 2QBYA 4IHTA 1EV7A 1PP8F 3BOQA 1R7JA 4NB5A 5ICCA 2VOOA 1F5TA 4LLLA 2P5KA 3V7RA 3HTSB 3BDDA 1R1VA 2ZNYA 1DDNA 4IHSA 4M74A 3CJNA 3RJPA 4KA4A 3ECHA 2C6YA 5D5WB 2V79A 5IT3A 4L5IA 1B59A 1TQPA 3L9FA 2QWWA 3JTHA 3W6JB 1EH8A 4U88A 2FF4A 1U5TB 2F5FA 3F8MA 2MA3A 2GWRA 5E1XA 3IWFA 3JTGA 1USSA 1BC7C 3ZMTA 2G9WA 4M9ZA 3RDIA 3QP5A 1FY7A 5LHHA 5A2QZ 5JFRA 3MZHA 1SD6A 2RKHA 1MJAA 5HVQC 3EETA 1ZG5A 3ABUA 1GXPA 2Q2EA 4M73A 4B09A 2DBBA 3OV8A 3MWMA 4A12A 5AIQA 4B8XA 1FSHA 5ICEA 5E17F 3JAMK 1QZZA 1O3QA 5HOOA 1TTYA 1IAWA 3FXQA 3I0TA 1B9MA 3KLOA 1MD0A 2XAFA 1RZ4A 5LHIA 4OU0A 1OMIA 2KIMA 3GFMA 3FX3A 1KQ9A 1Z7UA 3GVAA 1ON1A 2KRFA 4QLCU 4Q48A 5CYVA 2B0LA 2V1DA 1DPUA 1JGSA 1ON2A 2P5VA 2LDUA 2CFXA 2QYOA 2ETHA 2MBFA 4MNUA 2O03A 3M7GA 1FBUA 3R0JA 4H0EA 1BC8C 1D8KA 1DP7P 1L3LA 5L3DA 2DW4A 2GXGA 5D5VB 2CQKA 5EEGA 4CXFA 4P5OA 2ZFWA 1JHHA 1YG2A 1SMYF 5E1ZB 1FP2A 3F22A 2ELHA 2OQGA 3VEPA 5DYMA 1B1BA 5E8IA 2VOPA 2EFOA 4F7ZA 3ECOA 4KMFA 2E1NA 3RPUA 4BXUA 4WXCA 1HXDA 1P4XA 3MCZA 4IXAA 4M71A 2HEOA 4ZYGA 2VE8A 4LK1F 3T1BA 2A61A 2P4WA 2K4BA 1IZ1A 2IJLA 3ZMSA 1SD7A 2FA5A 4BNCA 2DO7A 3K9TA 5DCFA 3HUGA 5D4SA 3ABTA 3M1EA 2L3DA 2HFHA 3B02A 1UHWA 2ZMEB 4HLXA 3KE2A 3V7SA 3PQKA 2PQ8A 3C1DA 2CYYA 3H92A 2VC0A 2QQBA 4U0WA 4NHJA 1LEAA 4OMZA 4Y17A 2UXNA 2P7CB 1DUXC 2K27A 4HF2A 1BBYA 5L3FA 3VB2A 2PLYA 5DV5A 1HKQA 5ILUA 4G7OF 5TJJA 4RGSA 4GYGA 3F6OA 1R36A 4QWQA 5HDKA 3V8LA 2O8XA 3R60A 3DV8A 1J5YA 4LFUA 4AIKA 2Q8KA 3LWFA 3I4PA 5KVRA 4AIHA 2EV5A 2QBYB 1O3RA 4RGUA 2DFIA 1FWZA 1AOYA 2ZNZA 5J8CA 3DPLC 1OKRA 3V8KA 4AIJA 2E7XA 1BM9A 4RGXA 2F5CA 5CVVA 5F6FA 4PCQA 4OIPF 5HLGA 3IWZA 4IPAA 5E1WA 1IXRC 2O6GE 5ED4A 1XMKA 2A07F 2XV4S 3ISPA 1ZLKA 2YPRA 2OU2A 2GA2A 3J80Z 2LF8A 3QU3A 2D1HA 3WE3A 3TO6A 1ZARA 1JHFA 4LB6B 2NS0A 1NHAA 5JVTA 4G6QA 1QBJA 3SZPA 1J2XA 5H6RA 4XLPF 2X0LA 1I27A 1UFMA 3L2CA 2RVCA 5DUKA 3ZMDA 3KZZA 1VTNC 5L3GA 3P9KA 3SZTA 4ZYHA 2IP2A 4AWXB 4GYIA 1BOAA 4ZZLA 1P4WA 1WI9A 1XGOA 3GFIA 3ZMVA 2QENA 2HYFA 3ZMZA 5HDNA 1ODDA 2DT5A 3ERED 4G9YA 3DQVC 5CVUA 2M1BA 2NAZA 1D8JA 4HX4A 5ERIA 5FLXK 1USTA 1W4MA 5ILSA 4DQ2A 1LDJA 4LLNA 1G3WA 1HBXG 4HYEA 2GIVA 2RGVA 4IRIA 4AD9A 3FWEA 1HSTA 2RNJA 1ONVA 1W5SA 2A6HF 1HKSA 1HQCA 2HZTA 3NRVA 4HX7A 2P6SA 4UV8A 3N97A 2XKPA 2AS5F 2RC4A 1XB4A 1D3YA 3HOSA 4WXHA 3F6VA 2QLZA 3SXYA 2DPDA 4WX9A 1KYZA 4LJZF 5CVJA 2A6EF 2Z3YA 3CUQC 4N0BA 1XGNA 3E6MA 3U2RA 2DK5A 2K02A 4LK0F 1S7OA 1WWXA 5FD5A 5D8KB 4CZZA 2X4HA 1CF7A 4CDGA 4O5VA 2O0YA 1REPC 3CLOA 2BE5F 2HWVA 1G3SA 1FZPB 4MQ9F 5H6QA 3JAMZ 3EUHA 3FMSA 4G8XA 3F8NA 4KYWA 3DP7A 3FM3A 1LVAA 2FE3A 3H3UA 1BI0A 3MAJA 1IRGA 5ICFA 3QAHA 4JBAA 3LAJA 4XSXF 3QRFF 1U6GA 1O7FA 4UVBA 2V1XA 1R23A 2WWYA 1IN4A 4LLGF 3O2PE 1O57A 1QZYA 1WSUA 4IRHA 1GXQA 2XASA 1Y0UA 2UZKA 3D0SA 3RYRA 3TOBA 5AONA 2VBYA 3RPQA 4OINF 1ZG1A 5F64A 3N4MA 2EV6A 3P9CA 4M9SA 1TW3A 5LEKA 1R5GA 5HDGA 1G3YA 3BJAA 1IUYA 2JT1A 2XHKA 3WU1B 2Q0OA 2CW0F 4CYDA 3ZMUA 3W6KB 1P2FA 2VE9A 1S7AA 2DQLA 2ISZA 1U78A 1LQ1A 1EH7A 3BJOA 2VBXA 1LNWA 2KKOA 3L09A 4RS8A 2GQQA 3WTVC 4KDPA 2ZO4A 3NQOA 3BPXA 2QUFA 4EVIA 5DDGA 2RDPA 1R1TA 3WTXC 2M87A 2EK5A 1SD5A 2IPQX 5DCMA 3GW2A 3D5LA 3HHHA 4L9JA 2MH9A 1H0MA 1YW7A 2QVOA 5HS8A 4M6XA 2O61A 1IN6A 1K78B 2W25A 2O3FA 1FYKA 3I71A 3ULQB 2BV6A 3GXOA 2M8EA 3VODA 1PP7U 4P55A 1MKMA 5CVIA 4GCVA 3LQQA 1SD4A 4PGHA 2LSOA 1G6NA 1TNSA 2GZWA 4Y13A 1T38A 1HSJA 3F3XA 1MZBA 2A3SA 2HS5A 1K6OA 1V4RA 3ROUA 5BPDA 1YO5C 1JE8A 4RB1A 3E6DA 1K79A 3I53A 2PMUA 1FOKA 2HTJA 3HYIA 2IA1A 1FBQA 2ISYA 4ZYEA 3RYPA 5HS7A 5L3BA 2DK8A 2RQPA 1IN5A 5FB2A 1P6RA 2F5DA 5LEJA 5BMZA 2RN7A 2JPBA 1XGSA 5LLQA 5LRSA 2DAOA 3BY6A 4KIBA 1ZRCA 1KYWA 1U2WA 3DKWA 3EYYA 1R1UA 3I58A 3KFWX 3R6SA 1T39A 2M30A 3FXRA 4CICA 4FHTA 4I98B 1IRFA 1ZN2A 3ZP5A 2P7VB 3TO7A 3F21A 1X3UA 3HIFA 1QNTA 4S05A 2IVMA 1HW1A 1OPCA 1UCRA 2MC3A 3TOAA 3MEXA 2FEZA 5LBQA 3RI4A 2FNAA 1K7AA 2XUBA 4KIGA 1TNTA 3QOPA 4ESFA 4N9IA 1H9GA 3WGGA 2R3SA 2KJCA 2STTA 4MHGA 5JI6A 1BN5A 2FXAA 1TQMA 2V6CA 3CO6C 1ZRDA 1ZLJA 2GAUA 1J0RA 3MQ0A 4A5NA 1CGPA 2ESHA 1WRJA 4WCGA 4BYYA 2RV8A 1HW5A 1YFHA 4O3MA 2K86A 1Q1HA 2PN6A 4UVAA 2ZBKA 1FYMA 3MFKA 1TQIA 1U5TC 4EM1A 4IRGA 2VBWA 5CLSA 1TBXA 1CF7B 2BEOA 5IT9Z 5FLXZ 1D5VA 3P7NA 1STZA 2VODA 1BI2A 3E3VA 4I7HA 1YS6A 3BROA 1DPRA 3ZN0A 2P6TA 2XRNA 3OOPA 4Q5SF 1QQIA 2EWNA 2NYXA 1KU2A 2PFBA 4MTEA 5K5QA 3DEUA 1B4AA 3GO5A 3EQLF 3RKWA 2WV0A 1FLIA 2PG4A 2HOEA 3VOEA 1W5TA 4UNOA 4FX0A 4UV9A 4I09A 3P9IA 1RUOA 2PMHA 2VT2A 2D45A 4LG0A 1XCBA 1RUNA 3IRQA 5D5XB 1ZYRF 3RKXA 4HV6A 4ESBA 4ON0A 1TW2A 1E17A 5FFZA 1OYIA 5E20A 3REOA 3L00A 2VONA 3TQNA 3GYHX 2LF7A 4L0ZB 1I1SA 4ENJA 1BJAA 3K1NA 5F1RA 1YW9A 3LAPA 4I2OA 1ZGAA 3E6BA 3FZVA 4RAYA 3U9GA 4YIIA 3WTSC 1P92A 4D0PA 3CDHA 1PDNC 1T6SA 2Y0MA 4HZFA 2R7DA 4RB0A 3JW4A 2A69F 2EFNA 4R1HA 4OOIA 4XBFA 4NQWA 4L9VA 1IF1A 3B73A 3HSEA 1KU3A 1F4KA 1QGPA 4CO8A 1C0WA 4WXDA 5FD6A 3J7AO 2GA1A 4KN7X 3NEUA 5K5OA 4HBLA 5ILVA 3WTUC 4ZZDA 1FC3A 1FPQA 5DCMB 2H6BA 1IW7F 1KU7A 3CTAA 4ETSA 3IRRA 4HF1A 1XCVA 3HRMA 2JRTA 5D4RA 5D8LB 2OZ6A 2NNNA 1HKTA 4ASNA 3M8FA 3TDZC 1Z6RA 5IT9K 3G3ZA 1L0OC 4A0YA 2GXBA 1E2XA
chains in the Genus database with same CATH superfamily
3ZQIA 2FBIA 1T08B 3ABMH 3QYEA 3PQJA 1APLC 3FISA 1XSDA 3S3OA 4A93J 1G3TA 3ZPLA 3I59A 1S5LC 3IH4A 1ACIA 2WTEA 1QPIA 4DOZA 2DI3A 3GBGA 3IKTA 3SJMA 3GTOJ 3GLXA 4JQFA 5D6EA 3IL2A 4HOBA 1SFXA 3F9KA 5KK1A 3FMRA 4WK8F 3FXJA 3Q9SA 4LD5A 3H9GA 2ZCWA 5EG0B 1KONA 4EGYA 3IKVA 1ZGWA 1G4DA 4EEFG 1G59A 4LB5A 4RAFA 2H09A 1BA5A 1LDDA 1WH5A 2ZMEC 1W7PA 2KFDA 3EYIA 3FF5A 3BLYA 1YYVA 2EJRA 3ZQGA 1RKWA 2V9VA 2WY7Q 5JHUA 3RKQA 4ZTJA 5FRMA 3IHUA 3RZDJ 1Z6TA 2DFEA 5LGNA 3K70C 3PUFA 1Z77A 1JJ8C 4DNCA 1LEBA 1ZGJA 3K1PA 2XAGA 1R00A 2JZYA 2DJNA 1DGRM 4XLNF 3HGGA 1NG6A 4IHXA 3I4NJ 4LITA 4EJOA 1HLVA 2H1LA 3V7CA 3KP5A 2CO5A 4R79A 3Q5FA 3RTRA 2V4JC 5DUIA 2XIGA 3CJQB 1XSVA 1GV2A 3G73A 3K4CA 2HVRA 1Z05A 4U7DA 4XOPA 2XROA 2YU3A 3O3KA 3WODF 1RESA 3KEOA 5DD8A 1R9TJ 1BIAA 4ESJA 4L0YB 1WZ2A 4EGZA 3U1DA 2KDOA 2WAEA 1S3JA 4M6VA 4YIFA 3WTTC 3V42A 3CCUI 3CUQA 5KHDA 1YIJI 1IN7A 2D5VA 2WAQA 4MO7A 3I64A 2KPMA 3S2WA 4A2UA 2PBIA 3I54A 4I0AA 4XOTA 1VQ8I 2X6OA 2DDAA 3BTIA 4BHCA 4YFNF 1H89C 1FX7A 4ZH4F 2FMYA 2WC2A 3ZQ7A 1IDYA 2OF7A 3NWTA 4BE0A 2UUZA 4ENMA 2L9NA 3BJ6A 2H8RA 4PJ0C 2P8TA 1Y8RB 2AXTC 3IC7A 1Z67A 1FT9A 2HU9A 2ZXJA 1XD7A 3J7YJ 4IX7A 5H2FC 2F48A 4XNFA 5LFAA 3ML6A 3VFZA 1BOBA 4XSZF 3E97A 4CCOA 5GAHJ 2Z9OA 2M8GX 4ZDLA 3HRUA 4G7HF 3DTKA 2YU9J 4A0ZA 1Y39A 2IW5A 2Y48A 3UR3C 1X1DA 4LOCA 4UHTA 4KT5C 2V1UA 1XSXA 3RCOA 3FMQA 2MH2A 5FKOA 4Y3OA 3HRTA 2H27A 2XGEA 3FBIB 2ZSHB 1Y1VJ 3J81K 2FOWA 3WU0A 2W85A 2XAQA 1X2MA 6PAXA 1QZEA 4L9NA 2WB1N 3HOVJ 1J7KA 1F1ZA 1MBJA 3TO9A 4HNUA 4CGZA 2BZTA 1XDSA 4A3JJ 5KAFC 2OPTA 2LYCA 4GXOA 4G7ZF 2ECCA 2L01A 3BWGA 3UNGC 5BOXA 2HDDA 1XN7A 1DU0A 1TL8A 4ITVA 1YITI 3QPHA 5LHGA 1WJAA 3LFKA 1ZAOA 3GZ5A 1YLFA 3EUKL 3AAFA 4ZJZA 2D1VA 2Z5UA 3KP6A 1CQTA 5EEAA 2M5WA 2OA4A 1B8IA 3S15J 4XR6A 4M3FA 1X4PA 3AG4H 1MDMA 2MLGA 3WGIA 1IV8A 2LP0A 2X51A 4HQMA 2HOAA 4NC6A 3A02A 4ZYAA 4QPQA 4MEXF 1AKHB 1FIPA 3KP3A 2L54A 4PGGA 2JVGA 1FIAA 1X19A 3BR5A 2HR3A 2XGCA 1JUPA 3L2VA 1JXSA 2BGCA 5JR3A 2E1MB 2CQXA 4D7MA 2VPLA 5D6FA 4A3MJ 3BTLA 1ZG3A 3WHBA 1QO0D 1V55H 4HRIA 4KITB 1GV5A 2VN2A 2STWA 1Y56A 1VQMI 2L9RA 1NG7A 4XK4A 4A0XA 3KZIC 2XC7A 2A5YB 5TRDA 1KGSA 1OYYA 4JYKA 1D1AA 2P5LC 1SMTA 1KZHA 2KIFA 2LR8A 3CQZJ 4XKVA 2VQGA 2Z16A 2XF6A 4DGWB 1P4AA 3R0AA 3JRBA 1IC8A 5FO5A 4ZDOA 5M5YJ 3FDYA 3K2ZA 1T2KA 2DU9A 4MEYF 4LMYA 4M9XA 4HQEA 5LGTA 3OYCA 1XS9A 4F91B 4DBQA 1ERDA 3ZN1A 5DD4A 1VQ7I 4QSHA 2LRDA 1TLHB 2E5ZA 4KMUX 5FGMA 4E6KG 2EA2A 2OBPA 1K83J 1AWCA 4BJ6C 5H20A 2ZC2A 3LL7A 4LG0B 1U8RA 2KJBA 5C4XJ 3GWZA 3SFZA 3TEDA 5E8GA 1MMSA 1B72B 1WGXA 1WJFA 2W4SA 4D9JA 4I6ZA 3GX4X 3CO7C 2ELJA 3IAM2 1ETKA 4XONA 1YRNA 3F23A 2W24A 4U0YA 3OYBA 4EQQA 5HODA 1N78A 1WQ2A 3BZ6A 1ZR4A 1RIOH 4KICA 4HDVA 5KCMA 2NVTJ 1QVTA 1O3TA 1FP1D 2Z99A 2IA2A 2ZFUA 4J19A 3FM5A 4BHPA 1E3OC 1LB2A 2FD5A 2NOGA 2YX7A 1OCTC 1HCRA 2ACJA 4A69C 2MD5A 5B1BH 2QF7A 5K1YA 4IEJA 3DKXA 1XPXA 1OYWA 2O5RA 5B1AH 3PIPF 3HZJA 5E3LA 2P0WA 3TDUC 3CCMI 1QPMA 1FTZA 1X1CA 3I56I 4II2A 1OR7A 4AVPA 1IXSB 4DZJA 1XTAA 2LNBA 1ZHFA 5BS6A 3K69A 2DA4A 4RLQA 3LSMA 1S6LA 4BBRJ 4U7BA 4FTHA 1MIJA 1I5ZA 2FU4A 2HYGD 3TW6A 1YTYA 1R58A 2DFFA 3SHFA 3LSJA 1R4MB 1Y8QB 2JVHA 1A04A 2W1OA 4CYCB 1JKOC 4BBSJ 1VQOI 4XRSG 1TC3C 2HDWA 2QQ9A 4NQWB 5EDNA 2LREA 3BG5A 4IHVA 3H9QA 1OLTA 1R22A 1MNMC 1IXCA 1X4OA 1VF9A 2FMLA 2HQRA 3QPTA 4AYBA 4BE1A 3H1CA 2XRLA 2LMDA 2KDZA 2HDCA 5J3LA 3RIRA 1YJWI 3E5QA 4MGRA 2YSRA 3QWLA 4B4CA 2VXZA 3F8CA 4E4HA 1XGMA 4CUGA 4FETA 1V54H 2JPCA 4YFKF 4AM3A 5HLHA 1RNLA 4LG3A 3S17J 5DEQA 2CSOA 2HOTA 3WGHA 1HC8A 2OCCH 1RI7A 1A6IA 3S16J 2EFPA 2W84A 2R92J 4EMSA 4E70A 3S1NJ 1S72I 1AU7A 2VJ4A 3DF8A 1NK2P 2QSHX 3HOZJ 4HF0A 3BPVA 1V5GA 2VBZA 3QU6A 2EV0A 4O6JA 2K85A 3T8RA 5D5UB 4Y7NJ 2RQQA 2QZ8A 4YFXF 1W0UA 3KCCA 2MYSA 2CUEA 2Y0SA 2MGQA 2L7ZA 1N75A 4R8HA 2VLAA 2XAHA 2EILH 1VI0A 5FLVA 9ANTA 3M8EA 2IS2A 3HSRA 1GLNA 2DLLA 3I59B 3KP7A 4Y33A 4EM2A 1OFCX 4PUSA 5DM6F 1J9IA 1BI3A 3M9AA 1J59A 3V4GA 4DIQA 4KIFA 4Z2YA 3GZ6A 5F0FA 2ID6A 1WPKA 3ZGKA 3SDBA 4CHUA 2ECBA 2AXLA 3EUAA 5C44J 4OMYA 2QSGX 2DPUA 2FQ4A 1MMAA 2IBDA 3EDPA 1IG7A 4HW0A 3C7JA 4A3FJ 4V2FA 1W5CC 1LE8A 2JUCA 3GFLA 4HSTA 1W7PB 2CU7A 3CC2I 1MH4A 1ZTRA 1X3ZB 4L5JA 2NNYA 3E0JB 1D1CA 4C30A 5F0HA 4C2MJ 1DU6A 1SEUA 5A2QK 3VYTB 2OAZA 5AIPA 5HLIA 3LA3A 5EEHA 4S0HB 4M3GA 2EB7A 2HGCA 3TKYA 2UWMA 5JLWA 1JUMA 1FEXA 3I9V2 3WHCA 4EJVA 4XRMA 2GOXB 3V8JA 3ERMA 2YR2A 1XDUA 3E6CC 2OV7A 1X3WB 3B6AA 3HOYJ 4BAYA 1UHMA 1SANA 4ZDPA 1ZH5A 2A68F 3GF2A 4JX4A 4DYQA 1TWHJ 3K4NA 4G94A 2F5EA 1H88C 5FFXA 2ZXIA 1WJ5A 2OD5A 4LIVA 3BQZA 5B5EC 2OCEA 4FE7A 4BS9A 5IOZA 3CP2A 1O4XA 2E1CA 2M45A 3CUQB 4KT6A 4HAMA 3KYDB 1MMNA 3KLNA 3R61A 1ZQ3P 3OS2A 1BW6A 3HKZN 3T0YA 3SYTA 2M0CA 2ZJ2A 2DA5A 2YX4A 2JA6J 3HHGA 3IUOA 4XRFA 2M0MA 3I5UA 1KA8A 5FKLA 1U5TA 2XAJA 1VQLI 1KQ0A 1SFOJ 4A3LJ 3F8BA 2NS8A 2FQ3A 3H5AA 3SQNA 1I6XA 1I1GA 3JSOA 4KNYA 2LTPA 4I02A 2LVSA 4GFBA 3BC8A 1W1WE 5EJCA 4P9UA 1W7PD 3S14J 4BGDA 3WE2A 2JTVA 2K7LA 2Y30A 4Q47A 4YRVA 4RGRA 3VPRA 3DXJF 4IOAF 2XB0X 1ZRFA 3PUBA 1V5FA 4Q4ZF 4NC8A 3WTZA 3NARA 4IVNA 1J75A 5FRNA 1H9TA 1MGTA 1MJ9A 5FJ8J 1TT0A 2K4JA 3BG6A 4JK1X 4M6YA 3WG9A 2KRHA 1SFEA 2W7NA 2OQRA 4RAZA 2KP6A 4U87A 2EFWA 3KP2A 4WWCA 3HXLA 1XMAA 1K78A 1WKMA 4A6EA 4UUVA 1RKTA 4S04A 1SAXA 1IJWC 3O6BB 4MTDA 2XDVA 2H94A 1O3SA 5DTDA 4BHBA 1PVEA 4PZJA 3WTWC 4G6DA 4L9TA 3TP0A 5IP9J 1OCPA 1NH3A 2E19A 2DQRA 4EJWA 4B1RA 3OSGA 2XVCA 1TWAJ 1MSFC 2M34A 1ZREA 2FBHA 2WB1A 4IJAA 5HS9A 5K5RA 1U0JA 3ELKA 2TDXA 4RM3A 2HKOA 2DTRA 4I01A 2L7FP 1YIOA 2DYSH 3VYUB 4BXXJ 1BI1A 1YW8A 3AFHA 3K4LA 4UXNA 1Y0NA 4P9FA 3TBIA 3L7WA 2VPRA 4AUXA 1S29A 3T5XA 1T98A 2KQRA 1GVJA 2IA0A 1FNNA 3S1RJ 1G2HA 3HOUJ 4PDKA 2W00A 1S8NA 2HTSA 4FT8A 1B8IB 1MDMB 1KU9A 2Z33A 2J5PA 3BR0A 3B6CA 3D5SC 4ZYDA 4OIOF 1KQ8A 5M3MJ 2FOKA 2E2HJ 3LQRA 2BBYA 3FHZA 1D0ZA 2B63J 4BH9A 4RBOA 2VI6A 1FYLA 3VYRB 3T8TA 1FSEA 2IRFG 2K40A 1Z9CA 5J8FA 5K7ZA 1O7LA 1R5HA 4UVCA 3S8PA 2ZJRF 4FX4A 5BPIA 1Z91A 2L02A 5ICGA 3LSHA 5GAGJ 4MFEA 3BP8A 2E7WA 3P5JA 1S7EA 2LC2A 2UXXA 4HX8A 1UB9A 4RB3C 3BCAA 2QCOA 4UB6C 2X1DA 5J6XA 1LFPA 2VJJA 3OYJA 5EZHA 5E3OA 3LSTA 1EH6A 2CJJA 3J81Z 2MLKA 2D2WA 2JK3A 2OUMA 3KP4A 2IGNA 2DJIA 1WJBA 2F2EA 5BQTA 2BW3A 4EV0A 2FNPA 1Y6IA 3HOTA 4A3DJ 3J7AY 5DS9A 3FXUA 2FSWA 3KZYA 2EH3A 2K9MA 4C3JJ 2E60A 1T0FC 3FXLA 1ULYA 3K1MA 2PI0A 3COAC 2BOLA 2L7KA 1HW2A 3F72A 2XGXA 2R7ZJ 1T56A 2X48A 3LA7A 5J1YA 3KETA 3E5XA 2G7HA 3TGNA 3JRGA 5L3EA 3UKGA 1YRNB 1PUEE 2XF5A 4LGWA 5FKKA 2BY0A 1B9NA 1D1BA 3PM1A 4A5MA 4UUSA 2FBKA 2PEXA 2LKPA 4PSWA 2L4AA 3QPLA 2HQNA 2FRHA 1OCZH 1FBSA 4EJUA 4L18B 1UAAA 5GPAA 2PJPA 5L3CA 1LJ9A 4HV5A 1F36A 3HRSA 1T0FA 5CJ9A 4U0VA 4X0GA 1B6AA 3DFGA 4CCKA 2BYVE 1A31A 2IXSA 3HEFA 3F8FA 3H0GJ 4IF4A 2IS4A 4XICA 1JJ6C 3C18A 3GUDA 3OY9A 1YE9A 3AL0B 2QM3A 2CGPA 3PNVA 5M5XJ 2K5CA 3G71I 1V3FA 5EF6A 4K2EA 4CH7A 4ENNA 2OZUA 3GFJA 4Y15A 3E5UA 2ADUA 3MZYA 2E5NA 3WTYC 1BR2A 4E7ZA 2J5OA 1VQKI 2FUG2 1BW5A 1GHCA 1OCRH 2E36A 1U8BA 4MQVA 2IT0A 2COMA 2LY1A 4HA8A 3RKYA 4OIRF 1F9NA 3HSFA 4A6DA 4B48A 4MFDA 2ZMEA 4RB2C 4ENKA 4OIQF 4P96A 1YS7A 4NNJA 1YQAA 4BU2A 4LIUA 2X1EA 2DT7B 3PFIA 2G7UA 4YELA 5EGOA 3OYEA 3IP4B 4TV7A 4WF2A 2W57A 3OL3A 2VT3A 3A2KA 3MKZA 2Y75A 2DFHA 5E3MA 1LDKB 2EFQA 4PJNA 3S32A 2R7FA 2JSCA 4UUTA 2CQ7A 1MJBA 2MSYA 2L4MA 4EJTA 2HKXA 4KUMA 1BIBA 3H36A 3K4KA 1E0EA 3C3WA 1R5ID 1SFUA 2QQAA 4PK4A 1Z1DA 2DCEA 1QHGA 2ESNA 1P9QC 1IRZA 4BE2A 5IYDJ 1XX5A 3JSPA 2VC1A 5LRRA 3ZQHA 1LPQA 2E2IJ 1YOVB 2BVMA 3K0LA 4I0BA 4XKBA 2CG4A 4KN4X 1D5YA 1TWGJ 3H3ZA 3Q9VA 3J80K 2EA4A 4GO1A 2H6CA 3R4KA 2CWEA 3MKWB 3KEQA 1U3EM 4M72A 2XKOA 2XPUA 3QP6A 1Z0XA 3DLLF 5CVRA 3GEZA 2NRAC 3CCLI 3L2UA 4EM0B 3LSGA 4HLYA 1IN8A 2ZKZA 2KIUA 4HDUA 2R7QA 5LGUA 1RETA 3LA2A 4YG2F 4GGGA 2EPFA 3CUOA 3X2QH 3HTUA 4B47A 4BQAA 3DPTA 3VWBA 3S93A 2DODA 4PSXA 4N9HA 4KFCA 5E18F 1LE8B 2VJIA 4BJTA 2QBYA 4IHTA 2HQ5A 3SEQA 1EV7A 4PJMA 5F08A 3BR3A 3GTQJ 1PP8F 2MG4A 2HVSA 3BOQA 1R7JA 3A1YA 4NB5A 5ICCA 3HL2A 2VOOA 3G1LA 1GT0C 1F5TA 4LLLA 3U21A 2P5KA 2PX9A 2NVYJ 2B9SA 4X1EA 2BHZA 1M1EB 3V7RA 1IRXA 2EZLA 3ZR8X 2WY8Q 3J7ZI 3HTSB 3BDDA 2XAUA 1R1VA 2ZNYA 1EKEA 3BG9A 1DDNA 2NOJB 4J00A 4HSRA 1NTCA 4FCYA 4IHSA 4M74A 4CZCA 2E2JJ 3CJNA 3RJPA 2OC6A 4KA4A 3GTGJ 3HG9A 3G6EI 3OS1A 3ECHA 2AO9A 2C6YA 3HC7A 5D5WB 3GTPJ 3HPHA 2CMPA 5JVGF 4F55A 2V79A 1I39A 2WADA 3NWSA 5IT3A 4L5IA 2JA5J 3OOUA 1B59A 1I50J 1TQPA 3JRAA 4NDLA 3EPZA 3ZQLA 3L9FA 2DA2A 3OYLA 2KZGA 2QWWA 3JTHA 3W6JB 2O9LA 2KZVA 1EH8A 4U88A 1YX5A 2FF4A 1U5TB 2F5FA 3F8MA 2MA3A 3CF2A 2GWRA 2JUGA 5E1XA 4DW6A 3HKZA 2NS7A 1IV6A 4XL9A 1I6HJ 3IWFA 3JTGA 1USSA 2JRMA 2VQCA 3AG3H 1X2NA 4PFOA 3VSLA 4NUBA 2HVQA 1BC7C 3ZMTA 2G9WA 4M9ZA 2W48A 2COBA 3RDIA 5GTIC 2GBYA 2DOEA 3RSNA 1VQ5I 3QP5A 1FY7A 5LHHA 3ZOBA 5CKTA 5A2QZ 5JFRA 3MZHA 2I10A 2EINH 1SD6A 2RKHA 1BL0A 3OR1C 1MJAA 2KL4A 3MVPA 5HVQC 3EETA 1ZG5A 3ZQCA 3ABUA 2DA3A 3LSKA 3D5RC 1GXPA 2F6CA 2Q2EA 4M73A 4B09A 2CUJA 2DBBA 3OV8A 3MWMA 4AU7A 1VFCA 4L5EA 1JT6A 4A12A 5AIQA 3CMAI 4B8XA 1FJLA 5ICEA 1FSHA 4XLHA 5E17F 3JAMK 1DP3A 1QZZA 4PJJA 1QRYA 1O3QA 2JQ7A 5HOOA 3CD6I 1TTYA 1IAWA 3FXQA 1PUFA 4BQNA 3I0TA 1B9MA 3KLOA 1MD0A 2CV2A 2XAFA 1RZ4A 2L9VA 5LHIA 4OU0A 2CFOA 1OMIA 2KIMA 3K4MA 5F1JA 1UELB 3DU6A 3FXOA 1W36C 3MZ8A 5C3EJ 2CS3A 2ME0A 3AG1H 3GFMA 1A35A 3FX3A 5KNLA 1KQ9A 1Z7UA 3GVAA 1ON1A 2KRFA 5IP6A 5J4YA 3FBNB 3CCRI 3OYDA 2V9PA 4FASD 1ENHA 1Z7LA 3IAS2 4RLFA 3M8JA 4QLCU 4Q48A 4G12A 5CYVA 2B0LA 5BNGA 2V1DA 3D1NI 3LMMA 2YS9A 4XQFA 1DPUA 1JGSA 4V19K 1QA6A 1ON2A 2P5VA 1E3HA 2LDUA 4OAZA 1UJ8A 4A3BJ 2CFXA 2QYOA 3KEYA 2ETHA 2MBFA 4OAYA 3OYHA 4MNUA 3MD2A 2O03A 4JOMA 3M7GA 3ESWB 2IGMA 1FBUA 3R0JA 4YIRX 1ZELA 4H0EA 4E7LA 1BC8C 1D8KA 5K7FA 1DP7P 4CA0A 3RQIA 3CESA 1PYVA 2KISA 3W2WA 1L3LA 5L3DA 3TMOA 2DW4A 3FXMA 2GXGA 3Q0WA 5D5VB 2CQKA 2WAFA 5EEGA 1UG0A 4CXFA 4P5OA 2BW3B 3IH2A 2R7TA 3F0CA 4ZTFA 2ZFWA 1JHHA 1YG2A 2DYRH 3GTLJ 1SMYF 3BR2A 5E1ZB 2CUFA 1MNDA 2JJ7A 1FP2A 3F22A 2ELHA 4NC7A 2R7XA 2OQGA 2R4GA 3DEEA 3VEPA 5DYMA 2K9LA 1B1BA 5E8IA 1PJRA 5TGTA 5EYRA 2VOPA 3DBRB 2EFOA 4F7ZA 4UUSB 3S1MJ 1D0XA 3ZRGA 3ECOA 4KMFA 4BXFA 2E1NA 3RZOJ 3RPUA 1BJZA 3CF5F 3QOEA 4DYRA 4CCMA 4BXUA 4WXCA 2R7RA 5TISC 4AC0A 2GM4A 3OIPA 1ETWA 1HXDA 1ETOA 1P4XA 1X1BA 2QKMB 3BTJA 2R5ZA 3MCZA 4IXAA 1HDDC 2GLOA 4M71A 2HEOA 1MW7A 4ZYGA 2VE8A 3DWLE 4LK1F 4XLEA 2JA7J 3T1BA 2A05A 2A61A 2PMZN 4BL0B 4DZPA 2P4WA 1JTXA 5HNFA 2K4BA 3CCYA 3HDDA 1IZ1A 5GPCA 2IJLA 3ZMSA 1SD7A 2FA5A 4BNCA 2DO7A 2Q1ZB 3BG7A 3K9TA 5DCFA 1JUSA 3HUGA 2HOSA 5D4SA 5C4JJ 4B3AA 1K4TA 3ABTA 3M1EA 2L3DA 4B3XA 2HFHA 3B02A 3SFIA 1X1AA 3CZ6A 1UHWA 2ZMEB 2XSDC 2DTZA 1VQ4I 4HLXA 2WBMA 3KE2A 2E1MC 3V7SA 5EGOB 3PQKA 4AVZA 1TP4A 2HXOA 2PQ8A 3C1DA 3VDXA 2CYYA 3H92A 4W97A 2VC0A 1R71A 2QQBA 1LFBA 4U0WA 4IO9F 2K9SA 4NHJA 1LEAA 4OMZA 4UB8C 1E3PA 4Y17A 2BY1A 4XLAA 3S3NA 3JCUC 2LBFA 2UXNA 2P7CB 4CCNA 4BJ5C 3OYAA 1DUXC 2K27A 5GADJ 2M4KA 4HF2A 5CQEA 1FMWA 2DOFA 1BBYA 5L3FA 1GDTA 3HB9A 3VB2A 2LY2A 4RAGA 3K4BA 4C9YA 5FROA 4UY8I 2PLYA 2DMNA 5DV5A 1HKQA 1MSEC 5ILUA 4II3A 4G7OF 4ABZA 2IS6A 4JP0A 2L0KA 4HEA2 5TJJA 4E7SA 4RGSA 3FK6A 4GYGA 2XPVA 3F6OA 1R36A 4QWQA 5HDKA 3A01A 3V8LA 2O8XA 3R60A 2QQ8A 3QYBA 2VQLA 4QPOA 2MFZA 1LVKA 3DV8A 3CMEI 1J5YA 5B66C 1MBGA 4LFUA 2AHQA 1MBEA 4AIKA 4A3KJ 4NBQA 2Q8KA 3PFYA 3LWFA 1ZR2A 5F27A 2F5VA 4F52A 5JLXA 2I5UA 2EZHA 3I4MJ 5FKNA 3I4PA 2BXZA 1EA3A 3A4CA 5KVRA 2F4IA 2QA4I 4AIHA 1ORKA 2EV5A 2QBYB 1O3RA 4B43A 4RGUA 2DFIA 1FWZA 1AOYA 3K70D 2DN0A 2ZNZA 5J8CA 2KHMA 3DPLC 1YHQI 1VNDA 1OKRA 1HOMA 3V8KA 4AIJA 2PJRA 3KIOA 3CMMA 2E7XA 1BM9A 3BR6A 1YJ9I 4RGXA 2F5CA 2R0QC 2BHYA 5CVVA 5F6FA 4PCQA 3HJEA 4OIPF 4XMYA 2N8GA 5HLGA 3OYIA 3IWZA 3HM5A 4IPAA 5E1WA 1IXRC 2GXAA 1A5JA 4IL6C 2O6GE 2DA1A 5ED4A 1XMKA 2A07F 1IO2A 2H8WA 4BQQA 4I76A 2XV4S 2W82A 3ISPA 1ZLKA 2YPRA 1FOWA 2OU2A 2Y2ZA 1JTYA 2GA2A 3J80Z 2HQAA 4IHWA 2LF8A 5B3SH 3U1KA 4D5FA 3QU3A 2D1HA 3ABKH 3OR2C 2X6YA 4F93B 3WE3A 3TO6A 1ZARA 2VKHA 1JHFA 3HGYA 1OISA 1FOXA 5GTHC 1I3QJ 4LB6B 2NVXJ 2NS0A 3CJTB 4BEHA 2AQFA 1WVRA 1NHAA 5JVTA 4G6QA 2VUMJ 2AQEA 1QBJA 3SZPA 1J2XA 5H6RA 4XLPF 2X0LA 1I27A 3FK7A 2ZJPF 4Z6YA 1YI2I 1UFMA 3L2CA 4BY7J 3H35A 1UMQA 2CV1A 2WA0A 2JN6A 2RVCA 5KAIC 5DUKA 3ZMDA 3O8GA 3KZZA 1RPWA 2QEXI 5L3GA 1VTNC 2ZXWH 3P9KA 3SZTA 1WFXA 4ZYHA 2IP2A 4D5CA 4AWXB 1WJCA 4GYIA 1BOAA 4ZZLA 1JT0A 2ELKA 1P4WA 1WI9A 3O8HA 1XGOA 3GFIA 2DDBA 3ZMVA 2QENA 2HYFA 3ZMZA 5HDNA 1ODDA 2DT5A 4E7HA 3ERED 1JI8A 3VSKA 2CUZA 4G9YA 2Q2EB 3DQVC 5CVUA 2M1BA 5IPAA 4BACA 2NAZA 1D8JA 4HX4A 2DA6A 5ERIA 4BKXA 5FLXK 1USTA 3OIOA 1W4MA 5ILSA 2ME6A 4DQ2A 3L2WA 3C2GA 1W0TA 4C2TA 1LDJA 2QSFX 2MD0A 2DMUA 4LLNA 1G3WA 1HBXG 2HPIA 4HYEA 2GIVA 2RGVA 2V6EA 1WI3A 3DKYA 4PJLA 3MN2A 4IRIA 2LH9A 3OL4A 3SEZA 3CDIA 5IP7J 1PUFB 4H4KC 1DQUA 2L5QA 3KX2A 4AD9A 4BQOA 2DXIA 3FWEA 2IGKA 2DOAA 1HSTA 4D7NA 1T95A 2RNJA 1BR1A 1ONVA 1W5SA 2A6HF 1JKPC 4V2GA 1VZ0A 1HKSA 1HQCA 2HZTA 3NRVA 4HX7A 5F0CA 2P6SA 3BQYA 2G0EA 4UV8A 3N97A 2LKXA 2XKPA 2AS5F 2ICWG 1MBHA 2RC4A 2V7FA 1XB4A 1D3YA 1FOYA 3CMYA 3K10A 3HOSA 4WXHA 3F6VA 2QLZA 3TW7A 4XM3A 1UHSA 3SXYA 3N05A 1K6YA 4WX9A 2HPMA 2DPDA 1KYZA 3AKZA 4LJZF 1TZLA 1XC5A 2KMUA 3QQAA 2LY9A 2A6EF 2Z3YA 5CVJA 3AG2H 1XMXA 3CUQC 3EUHC 3CCQI 4N0BA 1XGNA 3E6MA 3GTJJ 3U2RA 2DK5A 2K02A 2LOOA 4LK0F 2R7OA 2K9NA 2LFBA 1EJ9A 3DPUA 2R7WA 1S7OA 1WWXA 5FD5A 2FX0A 5D8KB 4IKFA 4CZZA 1MBFA 2NXNB 2X4HA 1CF7A 1U9OA 4CDGA 5IY5H 4O5VA 2O0YA 1REPC 3CLOA 2BE5F 2DMPA 2HWVA 1G3SA 3E1SA 3SDGA 3S3MA 1FZPB 1ITYA 3KYLA 2HZDA 1SAUA 1RR7A 2EIJH 2TRTA 2M7BA 1SFKA 4OWRB 4MQ9F 2IS1A 5H6QA 3MKLA 4BY1J 3QYFA 3JAMZ 3EUHA 4F3QA 3FMSA 4IZZA 3OMYA 2HI3A 2M9HA 4G8XA 3F8NA 4KYWA 4JX6A 3S1QJ 3DP7A 3FM3A 1LVAA 2DMQA 3Q3SA 2FE3A 2NVUB 3H3UA 1BI0A 2EQRA 3DLAA 3MAJA 1D0YA 1GUUA 3DBLB 3CLQA 5ICFA 1TT5B 1IRGA 3QAHA 1R4NB 2LD5A 2Y31A 4JBAA 3LAJA 3FKJA 3K2AA 4XSXF 1U6GA 3QRFF 1NK3P 4G6TB 3HOWJ 4HG2A 3LSPA 1O7FA 4UVBA 3E7LA 2V1XA 1RRJA 1R23A 3GLLA 2WWYA 1IN4A 2XPWA 4LLGF 4N4NB 3O2PE 3KPHA 1O57A 1QZYA 3Q0UA 1WSUA 1ZK8A 4IRHA 2R5ZB 4XKCA 1GXQA 2XASA 1Y0UA 2DT6A 2UZKA 2BY2A 3D0SA 1W36D 3RYRA 5GP9A 3TOBA 5AONA 2VBYA 3ASOH 3RPQA 4F92B 5HNHA 4OINF 3L2RA 2X9DA 1ZG1A 3NAUA 5F64A 2MC4A 3N4MA 1P7JA 2PMZA 4AIDA 5E3NA 3K4JA 2EV6A 3HUGB 3BR1A 1MBKA 3PO2J 3P9CA 1J09A 4M9SA 3BG3A 1TW3A 2B7EA 4M3BA 5LEKA 1WJEA 1WCMJ 1OCOH 3PL8A 4QTRA 4C3HJ 2TCTA 1R5GA 3PNYA 3OYGA 1JGGA 5HDGA 1G3YA 3GMEA 3BJAA 2K3FA 1IUYA 2JT1A 2XHKA 3M4OJ 2R7VA 1SC7A 2OTJI 2R5YA 3WU1B 2Q0OA 2CW0F 3OS0A 4CYDA 3ZMUA 1YX3A 3G1MA 3W6KB 2VXDA 2OTLI 2QKLB 1P2FA 4CSWA 2VE9A 3H9JA 2M2EA 3MKYB 1S7AA 2LBFB 2CH0A 2DQLA 3RQ4A 4BDZA 3RPUD 2ISZA 1LFUP 1U78A 5CPRB 2VJ5A 1ETQA 3PJRA 1VQ6I 1LQ1A 1EH7A 4IQJA 3BJOA 4I99C 3CCEI 2VBXA 1LNWA 2KKOA 3L09A 4RS8A 2GQQA 4XIDA 3WTVC 3CCJI 4KDPA 2ZO4A 4A3IJ 4CCJA 1UG2A 2VASA 3NQOA 3BPXA 2ID3A 2QUFA 4EVIA 2Z2SB 5DDGA 1X1PA 2RREA 2X1CA 2RDPA 1U9NA 3IH3A 1VQNI 2QGUA 4RMNA 2CV0A 1R1TA 4XLFA 3WTXC 2M87A 2EK5A 1SD5A 2LLKA 2IPQX 5CQGA 5DCMA 3GW2A 4KJZA 3D5LA 3HHHA 3WU2C 4L9JA 3H5RA 3HBLA 3A01B 2MH9A 1H0MA 1YW7A 2QVOA 1MH3A 3OIQA 5HS8A 2O7OA 3VYSB 4M6XA 2O61A 1IN6A 2LG4A 1K78B 2W25A 3C2HA 2O3FA 1FYKA 3A03A 4JX5A 1QU3A 3I71A 3OYFA 1WHUA 3GTKJ 3ULQB 2BV6A 3GXOA 2RNGA 2L7MP 3CP8A 3S2DJ 4KISA 1BR4A 2M8EA 4A3CJ 3VODA 2YUSA 1OCCH 1PP7U 4P55A 1MKMA 2XGDA 1JKRC 2R7SA 5CVIA 4A3GJ 4GCVA 2BXYA 3LQQA 3ZQQA 2I8DA 1VQPI 1SD4A 1OR7C 4PGHA 3AL0C 2VL8A 2H1KA 2LSOA 1G6NA 1TNSA 2GZWA 2E35A 4Y13A 4HNTA 1T38A 2PJRB 1HSJA 3F3XA 3H0DA 1MZBA 2A3SA 2HS5A 1K6OA 3QPSA 1V4RA 2KT0A 3ROUA 3OYNA 5F04A 5BPDA 3M1CA 5EG0A 1YO5C 2Z1DA 5HLTA 3ABLH 1JE8A 4RB1A 3GTMJ 1IGNA 3E6DA 1K79A 3GZNB 3I53A 1K4SA 3G4SI 2PMUA 3G1OA 2NVQJ 2E34A 1S9HA 1FOKA 2HTJA 4RA2A 2P81A 4E7JA 3HYIA 2IA1A 1FBQA 2ISYA 4ZYEA 3RYPA 2L9SA 4DYCA 1ZKGA 5HS7A 1AHDP 4P1WA 3BT9A 5L3BA 2DK8A 4XRSA 2RQPA 1IN5A 5J47A 5FB2A 1P6RA 2K9QA 2CW7A 5J1RA 3W2VA 2F5DA 5LEJA 3LSIA 5BMZA 3PO3J 2RN7A 4BEHB 2JPBA 1XGSA 5LLQA 2M4GA 5LRSA 2DAOA 3BY6A 4KIBA 5J40A 2M3AA 3MMYB 2WAQN 1ZRCA 1KYWA 1U2WA 3DKWA 3EYYA 1R1UA 3I58A 2JMWA 4XLCA 4M3EA 1FTTA 3JRDA 2E1OA 1JKQC 1SVMA 3KFWX 3R6SA 1T39A 2M30A 3FXRA 4CICA 1N77A 4FHTA 5E79C 1SVLA 4I98B 4E7IA 3CCVI 1IRFA 1HF0A 3JRFA 3S2HJ 4ZC3A 2MW8A 4XN3A 2V26A 3LNQA 1ZN2A 1X58A 3ZP5A 2P7VB 3TO7A 3F21A 2V1NA 3BCBA 1T33A 3DU5A 1X3UA 2LKSA 2CQQA 3HIFA 1QNTA 5J1UA 4S05A 2K3PA 2IVMA 3W2AA 1HW1A 1OPCA 1UCRA 2GOMA 2MC3A 2KLOA 2IGOA 3TOAA 3MEXA 2FEZA 5LBQA 4MIMA 1POGA 3RI4A 2R93J 2FNAA 4IQ4A 4XN0A 1K7AA 4IOCF 3PIOF 5DM7F 2XUBA 3WG7H 3DBHB 1LKXA 2VB6A 1V5EA 1HDPA 4KIGA 5M5WJ 4CCLA 1TNTA 3QOPA 4ESFA 4N9IA 1H9GA 1K61A 3GCMA 5IYCJ 4GDFA 4W1UA 3WGGA 2R3SA 2KJCA 1WJDA 1N25A 4HPQA 3K6GA 5JHFA 3TP3A 4A3EJ 2E71A 2STTA 4MHGA 2VKDA 4X6AJ 2CW8A 2DA7A 4Y52J 4M3DA 3TL4X 4HNVA 5JI6A 2EIMH 4FE4A 1BN5A 3CC7I 3L2QA 1Q1VA 2BVLA 2FXAA 1TQMA 1QHHD 2V6CA 2EIKH 2X6XA 1H8AC 2WV1A 1HA8A 3CO6C 5EZGA 3CDLA 1ZRDA 2OJED 1ZLJA 3LOCA 2GAUA 1J0RA 3MQ0A 2IAIA 4A5NA 4ANJA 1CGPA 1Z3YA 1OJLA 2A6TA 2ESHA 1WRJA 4WCGA 4BYYA 2JWTA 3H3VK 2RV8A 1R49A 3OSFA 1HW5A 2DMTA 2EBIA 1YFHA 2LK2A 2HYJA 1Z3XA 2X6WA 1VQ9I 4O3MA 3ZQFA 3JRHA 2ZXHA 1EF4A 2K86A 1Q1HA 2MABA 5FLMJ 5GAEJ 3JREA 2PN6A 4E7KA 4UVAA 2ZBKA 3FXKA 1FYMA 2O8KA 3MFKA 4XORA 3PSIA 4C3IJ 2F4OB 1TQIA 1U5TC 4EM1A 4IRGA 2VBWA 5CLSA 1TBXA 2JA2A 1CF7B 2BEOA 1AKHA 5IT9Z 3G2BA 5FLXZ 1D5VA 1GVDA 3P7NA 1STZA 3JR9A 2VODA 1BI2A 3A0BC 1DGWY 4BDYA 3E3VA 4I7HA 1YS6A 3BROA 1P7IA 1DPRA 1RC9A 1ETVA 1XG1A 3ZN0A 4C2UA 3DTIA 1YJNI 3BZKA 3Q0VA 5IYBJ 4EATA 2P6TA 2GIZA 3H5NA 2XRNA 3CC4I 3M07A 3I3LA 3OOPA 2A5WA 1QQIA 4Q5SF 1MMDA 1ETXA 2EWNA 4J01A 2M7AA 2NYXA 2V9KA 3QODA 3W6VA 1KU2A 2PFBA 3CJRB 3PNTA 2EZIA 3FHNA 4MTEA 5K5QA 1FMVA 2ZSIB 1UZCA 2VIXA 3DEUA 2CRGA 2UV1A 1B4AA 3GO5A 3EQLF 3RKWA 2WV0A 1FLIA 4FISA 2HXIA 2PG4A 2HOEA 3HPGA 3VOEA 1W5TA 1IUFA 4UNOA 2IEKA 2VKVA 4Y4RA 4RDUA 1ETYA 1IDZA 1QVUA 3DCFA 3KYCB 4FX0A 4UV9A 4I09A 3P9IA 4RM2A 1RUOA 2PMHA 4B44A 1Y1WJ 2VT2A 2D45A 4LG0A 1XCBA 3FIWA 1TWFJ 3IV5A 2L2OA 3SZGA 4GRIA 1R6RA 1RUNA 1B72A 4DJAA 2FJ1A 1A36A 1MMGA 3IRQA 1A6QA 5D5XB 2Y69H 1ZYRF 2ZJQF 3RKXA 4HV6A 4QIWN 3I55I 5FKMA 4ESBA 4ON0A 3BZCA 1TW2A 2BY3A 3LSRA 1E17A 2JSPA 3ZCOA 1LUJB 5FFZA 1I3AA 2ZB9A 1OYIA 5E20A 3REOA 3L00A 2VONA 2HNHA 3W3CA 1AA7A 3TQNA 3GYHX 2LF7A 3DTEA 1F43A 4L0ZB 1I1SA 1T8IA 5M3FJ 2EZKA 3L1PA 4ENJA 3BTCA 3OYMA 1BJAA 1G8XA 3K1NA 5F1RA 1RR8C 1YW9A 2KIQA 2F4MB 3LAPA 4I2OA 1ZGAA 4BUPA 3E6BA 3FZVA 4RAYA 3U9GA 4D1QA 3JRIA 4YIIA 5K7HA 5IOYA 3WTSC 1P92A 4D0PA 3OYKA 3CDHA 3FKIJ 2R5YB 1PDNC 2X85A 1OQYA 1T6SA 2KRCA 1MNEA 4XKWA 2Y0MA 1WH7A 4HZFA 4PFPA 2JA8J 2R7DA 4RB0A 3ASNH 3JW4A 2A69F 2EFNA 3LFUA 5LD2C 4R1HA 4OOIA 4CYCA 4XBFA 3DEWA 4AYBN 4NQWA 1SVOA 4L9VA 3ZXSA 1IF1A 5J4VA 3B73A 3HSEA 1KU3A 1F4KA 1QGPA 4CO8A 3M3YJ 1C0WA 4WXDA 1TWCJ 2RAEA 5FD6A 3J7AO 2XSJC 2GA1A 3CCSI 4KN7X 3NEUA 4HBLA 5K5OA 5ILVA 3WTUC 3OWTA 4ZZDA 2Y9YA 1FC3A 1FPQA 2XF7A 5DCMB 4FQGA 2H6BA 2Y9ZA 1IW7F 3JRCA 1Z21A 3ONQA 1KU7A 2XB5A 3CTAA 4ETSA 3IRRA 4HF1A 1XCVA 4IHYA 3HRMA 2JRTA 3C2BA 3HOXJ 5D4RA 3A0HC 5D8LB 2OZ6A 2NNNA 2Y0SN 1HKTA 4ASNA 2VQHA 3M8FA 2CQNA 3PSFA 3TDZC 1Z6RA 5IT9K 2R7UA 2VKEA 3G3ZA 1L0OC 4N4OB 4A0YA 4DBRA 2GXBA 1E2XA 4MLOA 4YEJA 3K7AJ
chains in the Genus database with same CATH topology
2FBIA 3PQJA 1XSDA 1G3TA 3ZPLA 3I59A 2WTEA 2DI3A 3IKTA 3GLXA 4JQFA 5D6EA 3IL2A 4HOBA 1SFXA 5KK1A 3FMRA 4WK8F 3Q9SA 4LD5A 2ZCWA 4EGYA 3IKVA 1G4DA 4LB5A 2H09A 1LDDA 1W7PA 3EYIA 3FF5A 1YYVA 2EJRA 2V9VA 5JHUA 3IHUA 1Z6TA 5LGNA 4DNCA 1LEBA 1ZGJA 3K1PA 2XAGA 1R00A 2JZYA 4XLNF 4EJOA 3V7CA 3KP5A 2CO5A 4R79A 3Q5FA 3RTRA 5DUIA 2XIGA 1XSVA 3G73A 1Z05A 4U7DA 2XROA 2YU3A 3O3KA 3WODF 3KEOA 5DD8A 1BIAA 4ESJA 4L0YB 4EGZA 3U1DA 1S3JA 4YIFA 3WTTC 3CUQA 1IN7A 3I64A 3S2WA 4A2UA 2PBIA 3I54A 4I0AA 4BHCA 4YFNF 1FX7A 4ZH4F 2FMYA 2WC2A 3ZQ7A 4ENMA 3BJ6A 2P8TA 3IC7A 1FT9A 2ZXJA 1XD7A 3ML6A 3VFZA 4XSZF 3E97A 2Z9OA 3HRUA 4G7HF 4A0ZA 2IW5A 2Y48A 4UHTA 4KT5C 2V1UA 1XSXA 3FMQA 2MH2A 3HRTA 2H27A 3J81K 3WU0A 2W85A 2XAQA 6PAXA 4L9NA 1J7KA 1F1ZA 3TO9A 4CGZA 1XDSA 4GXOA 4G7ZF 2L01A 3BWGA 5BOXA 1XN7A 3QPHA 5LHGA 3LFKA 1ZAOA 3GZ5A 1YLFA 3AAFA 2D1VA 2Z5UA 3KP6A 2M5WA 2OA4A 1MDMA 2MLGA 3WGIA 4HQMA 4MEXF 3KP3A 2L54A 4PGGA 2HR3A 1JXSA 2BGCA 5JR3A 5D6FA 1ZG3A 1QO0D 2VN2A 2STWA 4A0XA 2A5YB 5TRDA 1KGSA 1OYYA 2P5LC 1SMTA 2KIFA 1P4AA 3R0AA 5FO5A 3K2ZA 1T2KA 2DU9A 4MEYF 4LMYA 4M9XA 4HQEA 5LGTA 3ZN1A 5DD4A 1TLHB 1AWCA 4KMUX 5FGMA 2EA2A 2OBPA 5H20A 4LG0B 1U8RA 2KJBA 3GWZA 3SFZA 5E8GA 3GX4X 3CO7C 3F23A 2W24A 4U0YA 4EQQA 1WQ2A 3BZ6A 1RIOH 4KICA 4HDVA 1O3TA 1FP1D 2Z99A 2IA2A 3FM5A 4BHPA 1LB2A 2YX7A 2ACJA 2MD5A 5K1YA 1OYWA 3TDUC 1QPMA 1OR7A 4AVPA 1IXSB 2LNBA 1ZHFA 5BS6A 3K69A 4U7BA 1S6LA 1I5ZA 2FU4A 2HYGD 1YTYA 1R58A 3SHFA 1A04A 2QQ9A 1R22A 1IXCA 2FMLA 2HQRA 3QPTA 2HDCA 3RIRA 3E5QA 4MGRA 2YSRA 2VXZA 3F8CA 1XGMA 2JPCA 4YFKF 5HLHA 1RNLA 5DEQA 2CSOA 3WGHA 1RI7A 2EFPA 2W84A 4EMSA 4E70A 3DF8A 4HF0A 3BPVA 2VBZA 3QU6A 2EV0A 4O6JA 3T8RA 5D5UB 2QZ8A 4YFXF 3KCCA 4R8HA 2XAHA 3M8EA 3HSRA 2DLLA 3I59B 3KP7A 4EM2A 1J9IA 1BI3A 3M9AA 1J59A 3V4GA 4KIFA 4Z2YA 3GZ6A 4CHUA 2AXLA 4OMYA 2DPUA 3EDPA 4HW0A 3C7JA 3GFLA 1W7PB 4L5JA 2NNYA 5A2QK 2OAZA 5AIPA 5HLIA 3LA3A 5EEHA 2EB7A 2HGCA 3TKYA 2UWMA 4EJVA 3V8JA 2YR2A 1XDUA 3E6CC 4BAYA 1UHMA 1ZH5A 2A68F 3GF2A 4G94A 2F5EA 5FFXA 2OD5A 2E1CA 2M45A 3CUQB 4HAMA 3KLNA 3R61A 3T0YA 2ZJ2A 2YX4A 3HHGA 4XRFA 3I5UA 1KA8A 1U5TA 2XAJA 1KQ0A 3F8BA 2FQ3A 3SQNA 1I6XA 1I1GA 3JSOA 4KNYA 4I02A 4P9UA 1W7PD 3WE2A 2JTVA 2K7LA 4Q47A 4RGRA 3DXJF 1ZRFA 4Q4ZF 3WTZA 4IVNA 1J75A 1H9TA 1MGTA 1MJ9A 2K4JA 4JK1X 4M6YA 3WG9A 1SFEA 2OQRA 4RAZA 2EFWA 1K78A 3KP2A 4WWCA 1XMAA 1WKMA 4A6EA 4UUVA 4S04A 1SAXA 3O6BB 4MTDA 1O3SA 2H94A 4BHBA 4PZJA 3WTWC 4G6DA 4L9TA 2DQRA 4EJWA 2XVCA 1ZREA 2FBHA 4IJAA 5HS9A 5K5RA 3ELKA 2TDXA 2HKOA 2DTRA 4I01A 1YIOA 1BI1A 1YW8A 4UXNA 4P9FA 3L7WA 1S29A 3T5XA 1T98A 1GVJA 2IA0A 1FNNA 4PDKA 1S8NA 2HTSA 4FT8A 1MDMB 1KU9A 2Z33A 2J5PA 4ZYDA 4OIOF 1KQ8A 2FOKA 3LQRA 2BBYA 3FHZA 4BH9A 1FYLA 3T8TA 1FSEA 2IRFG 1Z9CA 5J8FA 1O7LA 1R5HA 4UVCA 4FX4A 5BPIA 1Z91A 2L02A 5ICGA 2E7WA 3BP8A 2UXXA 4HX8A 1UB9A 4RB3C 5J6XA 3LSTA 1EH6A 3J81Z 2MLKA 2D2WA 3KP4A 2F2EA 5BQTA 4EV0A 2FNPA 3HOTA 3FXUA 2FSWA 3KZYA 1ULYA 3K1MA 2PI0A 3COAC 1HW2A 3F72A 2XGXA 3LA7A 3KETA 3E5XA 2G7HA 3TGNA 5L3EA 1PUEE 4LGWA 1B9NA 4A5MA 2FBKA 2PEXA 2LKPA 2L4AA 2HQNA 2FRHA 1FBSA 4EJUA 4L18B 2PJPA 5L3CA 1LJ9A 4HV5A 3HRSA 1T0FA 5CJ9A 4U0VA 1B6AA 3DFGA 2BYVE 3F8FA 4IF4A 3C18A 3GUDA 2QM3A 2CGPA 1V3FA 4K2EA 4ENNA 2OZUA 3GFJA 4Y15A 3E5UA 2ADUA 3MZYA 3WTYC 2J5OA 1GHCA 4MQVA 2IT0A 2COMA 4HA8A 3RKYA 4OIRF 1F9NA 3HSFA 4A6DA 2ZMEA 4RB2C 4ENKA 4OIQF 4P96A 1YS7A 1YQAA 3PFIA 2G7UA 4TV7A 4WF2A 2W57A 2VT3A 2Y75A 1LDKB 2EFQA 2R7FA 2JSCA 1MJBA 2L4MA 4EJTA 2HKXA 4KUMA 1BIBA 3C3WA 1SFUA 2QQAA 1Z1DA 2ESNA 3JSPA 2VC1A 5LRRA 3K0LA 4I0BA 2CG4A 4KN4X 3H3ZA 3Q9VA 3J80K 2EA4A 4GO1A 2H6CA 3R4KA 2CWEA 3KEQA 1U3EM 4M72A 2XKOA 3QP6A 5CVRA 3GEZA 2NRAC 4EM0B 4HLYA 1IN8A 2ZKZA 2KIUA 4HDUA 5LGUA 3LA2A 4YG2F 4GGGA 3CUOA 3HTUA 4BQAA 3DPTA 4KFCA 4N9HA 5E18F 2QBYA 4IHTA 1EV7A 1PP8F 3BOQA 1R7JA 4NB5A 5ICCA 2VOOA 1F5TA 4LLLA 2P5KA 3V7RA 3HTSB 3BDDA 1R1VA 2ZNYA 1DDNA 4IHSA 4M74A 3CJNA 3RJPA 4KA4A 3ECHA 2C6YA 5D5WB 2V79A 5IT3A 4L5IA 1B59A 1TQPA 3L9FA 2QWWA 3JTHA 3W6JB 1EH8A 4U88A 2FF4A 1U5TB 2F5FA 3F8MA 2MA3A 2GWRA 5E1XA 3IWFA 3JTGA 1USSA 1BC7C 3ZMTA 2G9WA 4M9ZA 3RDIA 3QP5A 1FY7A 5LHHA 5A2QZ 5JFRA 3MZHA 1SD6A 2RKHA 1MJAA 5HVQC 3EETA 1ZG5A 3ABUA 1GXPA 2Q2EA 4M73A 4B09A 2DBBA 3OV8A 3MWMA 4A12A 5AIQA 4B8XA 1FSHA 5ICEA 5E17F 3JAMK 1QZZA 1O3QA 5HOOA 1TTYA 1IAWA 3FXQA 3I0TA 1B9MA 3KLOA 1MD0A 2XAFA 1RZ4A 5LHIA 4OU0A 1OMIA 2KIMA 3GFMA 3FX3A 1KQ9A 1Z7UA 3GVAA 1ON1A 2KRFA 4QLCU 4Q48A 5CYVA 2B0LA 2V1DA 1DPUA 1JGSA 1ON2A 2P5VA 2LDUA 2CFXA 2QYOA 2ETHA 2MBFA 4MNUA 2O03A 3M7GA 1FBUA 3R0JA 4H0EA 1BC8C 1D8KA 1DP7P 1L3LA 5L3DA 2DW4A 2GXGA 5D5VB 2CQKA 5EEGA 4CXFA 4P5OA 2ZFWA 1JHHA 1YG2A 1SMYF 5E1ZB 1FP2A 3F22A 2ELHA 2OQGA 3VEPA 5DYMA 1B1BA 5E8IA 2VOPA 2EFOA 4F7ZA 3ECOA 4KMFA 2E1NA 3RPUA 4BXUA 4WXCA 1HXDA 1P4XA 3MCZA 4IXAA 4M71A 2HEOA 4ZYGA 2VE8A 4LK1F 3T1BA 2A61A 2P4WA 2K4BA 1IZ1A 2IJLA 3ZMSA 1SD7A 2FA5A 4BNCA 2DO7A 3K9TA 5DCFA 3HUGA 5D4SA 3ABTA 3M1EA 2L3DA 2HFHA 3B02A 1UHWA 2ZMEB 4HLXA 3KE2A 3V7SA 3PQKA 2PQ8A 3C1DA 2CYYA 3H92A 2VC0A 2QQBA 4U0WA 4NHJA 1LEAA 4OMZA 4Y17A 2UXNA 2P7CB 1DUXC 2K27A 4HF2A 1BBYA 5L3FA 3VB2A 2PLYA 5DV5A 1HKQA 5ILUA 4G7OF 5TJJA 4RGSA 4GYGA 3F6OA 1R36A 4QWQA 5HDKA 3V8LA 2O8XA 3R60A 3DV8A 1J5YA 4LFUA 4AIKA 2Q8KA 3LWFA 3I4PA 5KVRA 4AIHA 2EV5A 2QBYB 1O3RA 4RGUA 2DFIA 1FWZA 1AOYA 2ZNZA 5J8CA 3DPLC 1OKRA 3V8KA 4AIJA 2E7XA 1BM9A 4RGXA 2F5CA 5CVVA 5F6FA 4PCQA 4OIPF 5HLGA 3IWZA 4IPAA 5E1WA 1IXRC 2O6GE 5ED4A 1XMKA 2A07F 2XV4S 3ISPA 1ZLKA 2YPRA 2OU2A 2GA2A 3J80Z 2LF8A 3QU3A 2D1HA 3WE3A 3TO6A 1ZARA 1JHFA 4LB6B 2NS0A 1NHAA 5JVTA 4G6QA 1QBJA 3SZPA 1J2XA 5H6RA 4XLPF 2X0LA 1I27A 1UFMA 3L2CA 2RVCA 5DUKA 3ZMDA 3KZZA 1VTNC 5L3GA 3P9KA 3SZTA 4ZYHA 2IP2A 4AWXB 4GYIA 1BOAA 4ZZLA 1P4WA 1WI9A 1XGOA 3GFIA 3ZMVA 2QENA 2HYFA 3ZMZA 5HDNA 1ODDA 2DT5A 3ERED 4G9YA 3DQVC 5CVUA 2M1BA 2NAZA 1D8JA 4HX4A 5ERIA 5FLXK 1USTA 1W4MA 5ILSA 4DQ2A 1LDJA 4LLNA 1G3WA 1HBXG 4HYEA 2GIVA 2RGVA 4IRIA 4AD9A 3FWEA 1HSTA 2RNJA 1ONVA 1W5SA 2A6HF 1HKSA 1HQCA 2HZTA 3NRVA 4HX7A 2P6SA 4UV8A 3N97A 2XKPA 2AS5F 2RC4A 1XB4A 1D3YA 3HOSA 4WXHA 3F6VA 2QLZA 3SXYA 2DPDA 4WX9A 1KYZA 4LJZF 5CVJA 2A6EF 2Z3YA 3CUQC 4N0BA 1XGNA 3E6MA 3U2RA 2DK5A 2K02A 4LK0F 1S7OA 1WWXA 5FD5A 5D8KB 4CZZA 2X4HA 1CF7A 4CDGA 4O5VA 2O0YA 1REPC 3CLOA 2BE5F 2HWVA 1G3SA 1FZPB 4MQ9F 5H6QA 3JAMZ 3EUHA 3FMSA 4G8XA 3F8NA 4KYWA 3DP7A 3FM3A 1LVAA 2FE3A 3H3UA 1BI0A 3MAJA 1IRGA 5ICFA 3QAHA 4JBAA 3LAJA 4XSXF 3QRFF 1U6GA 1O7FA 4UVBA 2V1XA 1R23A 2WWYA 1IN4A 4LLGF 3O2PE 1O57A 1QZYA 1WSUA 4IRHA 1GXQA 2XASA 1Y0UA 2UZKA 3D0SA 3RYRA 3TOBA 5AONA 2VBYA 3RPQA 4OINF 1ZG1A 5F64A 3N4MA 2EV6A 3P9CA 4M9SA 1TW3A 5LEKA 1R5GA 5HDGA 1G3YA 3BJAA 1IUYA 2JT1A 2XHKA 3WU1B 2Q0OA 2CW0F 4CYDA 3ZMUA 3W6KB 1P2FA 2VE9A 1S7AA 2DQLA 2ISZA 1U78A 1LQ1A 1EH7A 3BJOA 2VBXA 1LNWA 2KKOA 3L09A 4RS8A 2GQQA 3WTVC 4KDPA 2ZO4A 3NQOA 3BPXA 2QUFA 4EVIA 5DDGA 2RDPA 1R1TA 3WTXC 2M87A 2EK5A 1SD5A 2IPQX 5DCMA 3GW2A 3D5LA 3HHHA 4L9JA 2MH9A 1H0MA 1YW7A 2QVOA 5HS8A 4M6XA 2O61A 1IN6A 1K78B 2W25A 2O3FA 1FYKA 3I71A 3ULQB 2BV6A 3GXOA 2M8EA 3VODA 1PP7U 4P55A 1MKMA 5CVIA 4GCVA 3LQQA 1SD4A 4PGHA 2LSOA 1G6NA 1TNSA 2GZWA 4Y13A 1T38A 1HSJA 3F3XA 1MZBA 2A3SA 2HS5A 1K6OA 1V4RA 3ROUA 5BPDA 1YO5C 1JE8A 4RB1A 3E6DA 1K79A 3I53A 2PMUA 1FOKA 2HTJA 3HYIA 2IA1A 1FBQA 2ISYA 4ZYEA 3RYPA 5HS7A 5L3BA 2DK8A 2RQPA 1IN5A 5FB2A 1P6RA 2F5DA 5LEJA 5BMZA 2RN7A 2JPBA 1XGSA 5LLQA 5LRSA 2DAOA 3BY6A 4KIBA 1ZRCA 1KYWA 1U2WA 3DKWA 3EYYA 1R1UA 3I58A 3KFWX 3R6SA 1T39A 2M30A 3FXRA 4CICA 4FHTA 4I98B 1IRFA 1ZN2A 3ZP5A 2P7VB 3TO7A 3F21A 1X3UA 3HIFA 1QNTA 4S05A 2IVMA 1HW1A 1OPCA 1UCRA 2MC3A 3TOAA 3MEXA 2FEZA 5LBQA 3RI4A 2FNAA 1K7AA 2XUBA 4KIGA 1TNTA 3QOPA 4ESFA 4N9IA 1H9GA 3WGGA 2R3SA 2KJCA 2STTA 4MHGA 5JI6A 1BN5A 2FXAA 1TQMA 2V6CA 3CO6C 1ZRDA 1ZLJA 2GAUA 1J0RA 3MQ0A 4A5NA 1CGPA 2ESHA 1WRJA 4WCGA 4BYYA 2RV8A 1HW5A 1YFHA 4O3MA 2K86A 1Q1HA 2PN6A 4UVAA 2ZBKA 1FYMA 3MFKA 1TQIA 1U5TC 4EM1A 4IRGA 2VBWA 5CLSA 1TBXA 1CF7B 2BEOA 5IT9Z 5FLXZ 1D5VA 3P7NA 1STZA 2VODA 1BI2A 3E3VA 4I7HA 1YS6A 3BROA 1DPRA 3ZN0A 2P6TA 2XRNA 3OOPA 4Q5SF 1QQIA 2EWNA 2NYXA 1KU2A 2PFBA 4MTEA 5K5QA 3DEUA 1B4AA 3GO5A 3EQLF 3RKWA 2WV0A 1FLIA 2PG4A 2HOEA 3VOEA 1W5TA 4UNOA 4FX0A 4UV9A 4I09A 3P9IA 1RUOA 2PMHA 2VT2A 2D45A 4LG0A 1XCBA 1RUNA 3IRQA 5D5XB 1ZYRF 3RKXA 4HV6A 4ESBA 4ON0A 1TW2A 1E17A 5FFZA 1OYIA 5E20A 3REOA 3L00A 2VONA 3TQNA 3GYHX 2LF7A 4L0ZB 1I1SA 4ENJA 1BJAA 3K1NA 5F1RA 1YW9A 3LAPA 4I2OA 1ZGAA 3E6BA 3FZVA 4RAYA 3U9GA 4YIIA 3WTSC 1P92A 4D0PA 3CDHA 1PDNC 1T6SA 2Y0MA 4HZFA 2R7DA 4RB0A 3JW4A 2A69F 2EFNA 4R1HA 4OOIA 4XBFA 4NQWA 4L9VA 1IF1A 3B73A 3HSEA 1KU3A 1F4KA 1QGPA 4CO8A 1C0WA 4WXDA 5FD6A 3J7AO 2GA1A 4KN7X 3NEUA 5K5OA 4HBLA 5ILVA 3WTUC 4ZZDA 1FC3A 1FPQA 5DCMB 2H6BA 1IW7F 1KU7A 3CTAA 4ETSA 3IRRA 4HF1A 1XCVA 3HRMA 2JRTA 5D4RA 5D8LB 2OZ6A 2NNNA 1HKTA 4ASNA 3M8FA 3TDZC 1Z6RA 5IT9K 3G3ZA 1L0OC 4A0YA 2GXBA 1E2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBI A;  3PQJ A;  1XSD A;  1G3T A;  3ZPL A;  3I59 A;  2WTE A;  2DI3 A;  3IKT A;  3GLX A;  4JQF A;  5D6E A;  3IL2 A;  4HOB A;  1SFX A;  5KK1 A;  3FMR A;  4WK8 F;  3Q9S A;  4LD5 A;  2ZCW A;  4EGY A;  3IKV A;  1G4D A;  4LB5 A;  2H09 A;  1LDD A;  1W7P A;  3EYI A;  3FF5 A;  1YYV A;  2EJR A;  2V9V A;  5JHU A;  3IHU A;  1Z6T A;  5LGN A;  4DNC A;  1LEB A;  1ZGJ A;  3K1P A;  2XAG A;  1R00 A;  2JZY A;  4XLN F;  4EJO A;  3V7C A;  3KP5 A;  2CO5 A;  4R79 A;  3Q5F A;  3RTR A;  5DUI A;  2XIG A;  1XSV A;  3G73 A;  1Z05 A;  4U7D A;  2XRO A;  2YU3 A;  3O3K A;  3WOD F;  3KEO A;  5DD8 A;  1BIA A;  4ESJ A;  4L0Y B;  4EGZ A;  3U1D A;  1S3J A;  4YIF A;  3WTT C;  3CUQ A;  1IN7 A;  3I64 A;  3S2W A;  4A2U A;  2PBI A;  3I54 A;  4I0A A;  4BHC A;  4YFN F;  1FX7 A;  4ZH4 F;  2FMY A;  2WC2 A;  3ZQ7 A;  4ENM A;  3BJ6 A;  2P8T A;  3IC7 A;  1FT9 A;  2ZXJ A;  1XD7 A;  3ML6 A;  3VFZ A;  4XSZ F;  3E97 A;  2Z9O A;  3HRU A;  4G7H F;  4A0Z A;  2IW5 A;  2Y48 A;  4UHT A;  4KT5 C;  2V1U A;  1XSX A;  3FMQ A;  2MH2 A;  3HRT A;  2H27 A;  3J81 K;  3WU0 A;  2W85 A;  2XAQ A;  6PAX A;  4L9N A;  1J7K A;  1F1Z A;  3TO9 A;  4CGZ A;  1XDS A;  4GXO A;  4G7Z F;  2L01 A;  3BWG A;  5BOX A;  1XN7 A;  3QPH A;  5LHG A;  3LFK A;  1ZAO A;  3GZ5 A;  1YLF A;  3AAF A;  2D1V A;  2Z5U A;  3KP6 A;  2M5W A;  2OA4 A;  1MDM A;  2MLG A;  3WGI A;  4HQM A;  4MEX F;  3KP3 A;  2L54 A;  4PGG A;  2HR3 A;  1JXS A;  2BGC A;  5JR3 A;  5D6F A;  1ZG3 A;  1QO0 D;  2VN2 A;  2STW A;  4A0X A;  2A5Y B;  5TRD A;  1KGS A;  1OYY A;  2P5L C;  1SMT A;  2KIF A;  1P4A A;  3R0A A;  5FO5 A;  3K2Z A;  1T2K A;  2DU9 A;  4MEY F;  4LMY A;  4M9X A;  4HQE A;  5LGT A;  3ZN1 A;  5DD4 A;  1TLH B;  1AWC A;  4KMU X;  5FGM A;  2EA2 A;  2OBP A;  5H20 A;  4LG0 B;  1U8R A;  2KJB A;  3GWZ A;  3SFZ A;  5E8G A;  3GX4 X;  3CO7 C;  3F23 A;  2W24 A;  4U0Y A;  4EQQ A;  1WQ2 A;  3BZ6 A;  1RIO H;  4KIC A;  4HDV A;  1O3T A;  1FP1 D;  2Z99 A;  2IA2 A;  3FM5 A;  4BHP A;  1LB2 A;  2YX7 A;  2ACJ A;  2MD5 A;  5K1Y A;  1OYW A;  3TDU C;  1QPM A;  1OR7 A;  4AVP A;  1IXS B;  2LNB A;  1ZHF A;  5BS6 A;  3K69 A;  4U7B A;  1S6L A;  1I5Z A;  2FU4 A;  2HYG D;  1YTY A;  1R58 A;  3SHF A;  1A04 A;  2QQ9 A;  1R22 A;  1IXC A;  2FML A;  2HQR A;  3QPT A;  2HDC A;  3RIR A;  3E5Q A;  4MGR A;  2YSR A;  2VXZ A;  3F8C A;  1XGM A;  2JPC A;  4YFK F;  5HLH A;  1RNL A;  5DEQ A;  2CSO A;  3WGH A;  1RI7 A;  2EFP A;  2W84 A;  4EMS A;  4E70 A;  3DF8 A;  4HF0 A;  3BPV A;  2VBZ A;  3QU6 A;  2EV0 A;  4O6J A;  3T8R A;  5D5U B;  2QZ8 A;  4YFX F;  3KCC A;  4R8H A;  2XAH A;  3M8E A;  3HSR A;  2DLL A;  3I59 B;  3KP7 A;  4EM2 A;  1J9I A;  1BI3 A;  3M9A A;  1J59 A;  3V4G A;  4KIF A;  4Z2Y A;  3GZ6 A;  4CHU A;  2AXL A;  4OMY A;  2DPU A;  3EDP A;  4HW0 A;  3C7J A;  3GFL A;  1W7P B;  4L5J A;  2NNY A;  5A2Q K;  2OAZ A;  5AIP A;  5HLI A;  3LA3 A;  5EEH A;  2EB7 A;  2HGC A;  3TKY A;  2UWM A;  4EJV A;  3V8J A;  2YR2 A;  1XDU A;  3E6C C;  4BAY A;  1UHM A;  1ZH5 A;  2A68 F;  3GF2 A;  4G94 A;  2F5E A;  5FFX A;  2OD5 A;  2E1C A;  2M45 A;  3CUQ B;  4HAM A;  3KLN A;  3R61 A;  3T0Y A;  2ZJ2 A;  2YX4 A;  3HHG A;  4XRF A;  3I5U A;  1KA8 A;  1U5T A;  2XAJ A;  1KQ0 A;  3F8B A;  2FQ3 A;  3SQN A;  1I6X A;  1I1G A;  3JSO A;  4KNY A;  4I02 A;  4P9U A;  1W7P D;  3WE2 A;  2JTV A;  2K7L A;  4Q47 A;  4RGR A;  3DXJ F;  1ZRF A;  4Q4Z F;  3WTZ A;  4IVN A;  1J75 A;  1H9T A;  1MGT A;  1MJ9 A;  2K4J A;  4JK1 X;  4M6Y A;  3WG9 A;  1SFE A;  2OQR A;  4RAZ A;  2EFW A;  1K78 A;  3KP2 A;  4WWC A;  1XMA A;  1WKM A;  4A6E A;  4UUV A;  4S04 A;  1SAX A;  3O6B B;  4MTD A;  1O3S A;  2H94 A;  4BHB A;  4PZJ A;  3WTW C;  4G6D A;  4L9T A;  2DQR A;  4EJW A;  2XVC A;  1ZRE A;  2FBH A;  4IJA A;  5HS9 A;  5K5R A;  3ELK A;  2TDX A;  2HKO A;  2DTR A;  4I01 A;  1YIO A;  1BI1 A;  1YW8 A;  4UXN A;  4P9F A;  3L7W A;  1S29 A;  3T5X A;  1T98 A;  1GVJ A;  2IA0 A;  1FNN A;  4PDK A;  1S8N A;  2HTS A;  4FT8 A;  1MDM B;  1KU9 A;  2Z33 A;  2J5P A;  4ZYD A;  4OIO F;  1KQ8 A;  2FOK A;  3LQR A;  2BBY A;  3FHZ A;  4BH9 A;  1FYL A;  3T8T A;  1FSE A;  2IRF G;  1Z9C A;  5J8F A;  1O7L A;  1R5H A;  4UVC A;  4FX4 A;  5BPI A;  1Z91 A;  2L02 A;  5ICG A;  2E7W A;  3BP8 A;  2UXX A;  4HX8 A;  1UB9 A;  4RB3 C;  5J6X A;  3LST A;  1EH6 A;  3J81 Z;  2MLK A;  2D2W A;  3KP4 A;  2F2E A;  5BQT A;  4EV0 A;  2FNP A;  3HOT A;  3FXU A;  2FSW A;  3KZY A;  1ULY A;  3K1M A;  2PI0 A;  3COA C;  1HW2 A;  3F72 A;  2XGX A;  3LA7 A;  3KET A;  3E5X A;  2G7H A;  3TGN A;  5L3E A;  1PUE E;  4LGW A;  1B9N A;  4A5M A;  2FBK A;  2PEX A;  2LKP A;  2L4A A;  2HQN A;  2FRH A;  1FBS A;  4EJU A;  4L18 B;  2PJP A;  5L3C A;  1LJ9 A;  4HV5 A;  3HRS A;  1T0F A;  5CJ9 A;  4U0V A;  1B6A A;  3DFG A;  2BYV E;  3F8F A;  4IF4 A;  3C18 A;  3GUD A;  2QM3 A;  2CGP A;  1V3F A;  4K2E A;  4ENN A;  2OZU A;  3GFJ A;  4Y15 A;  3E5U A;  2ADU A;  3MZY A;  3WTY C;  2J5O A;  1GHC A;  4MQV A;  2IT0 A;  2COM A;  4HA8 A;  3RKY A;  4OIR F;  1F9N A;  3HSF A;  4A6D A;  2ZME A;  4RB2 C;  4ENK A;  4OIQ F;  4P96 A;  1YS7 A;  1YQA A;  3PFI A;  2G7U A;  4TV7 A;  4WF2 A;  2W57 A;  2VT3 A;  2Y75 A;  1LDK B;  2EFQ A;  2R7F A;  2JSC A;  1MJB A;  2L4M A;  4EJT A;  2HKX A;  4KUM A;  1BIB A;  3C3W A;  1SFU A;  2QQA A;  1Z1D A;  2ESN A;  3JSP A;  2VC1 A;  5LRR A;  3K0L A;  4I0B A;  2CG4 A;  4KN4 X;  3H3Z A;  3Q9V A;  3J80 K;  2EA4 A;  4GO1 A;  2H6C A;  3R4K A;  2CWE A;  3KEQ A;  1U3E M;  4M72 A;  2XKO A;  3QP6 A;  5CVR A;  3GEZ A;  2NRA C;  4EM0 B;  4HLY A;  1IN8 A;  2ZKZ A;  2KIU A;  4HDU A;  5LGU A;  3LA2 A;  4YG2 F;  4GGG A;  3CUO A;  3HTU A;  4BQA A;  3DPT A;  4KFC A;  4N9H A;  5E18 F;  2QBY A;  4IHT A;  1EV7 A;  1PP8 F;  3BOQ A;  1R7J A;  4NB5 A;  5ICC A;  2VOO A;  1F5T A;  4LLL A;  2P5K A;  3V7R A;  3HTS B;  3BDD A;  1R1V A;  2ZNY A;  1DDN A;  4IHS A;  4M74 A;  3CJN A;  3RJP A;  4KA4 A;  3ECH A;  2C6Y A;  5D5W B;  2V79 A;  5IT3 A;  4L5I A;  1B59 A;  1TQP A;  3L9F A;  2QWW A;  3JTH A;  3W6J B;  1EH8 A;  4U88 A;  2FF4 A;  1U5T B;  2F5F A;  3F8M A;  2MA3 A;  2GWR A;  5E1X A;  3IWF A;  3JTG A;  1USS A;  1BC7 C;  3ZMT A;  2G9W A;  4M9Z A;  3RDI A;  3QP5 A;  1FY7 A;  5LHH A;  5A2Q Z;  5JFR A;  3MZH A;  1SD6 A;  2RKH A;  1MJA A;  5HVQ C;  3EET A;  1ZG5 A;  3ABU A;  1GXP A;  2Q2E A;  4M73 A;  4B09 A;  2DBB A;  3OV8 A;  3MWM A;  4A12 A;  5AIQ A;  4B8X A;  1FSH A;  5ICE A;  5E17 F;  3JAM K;  1QZZ A;  1O3Q A;  5HOO A;  1TTY A;  1IAW A;  3FXQ A;  3I0T A;  1B9M A;  3KLO A;  1MD0 A;  2XAF A;  1RZ4 A;  5LHI A;  4OU0 A;  1OMI A;  2KIM A;  3GFM A;  3FX3 A;  1KQ9 A;  1Z7U A;  3GVA A;  1ON1 A;  2KRF A;  4QLC U;  4Q48 A;  5CYV A;  2B0L A;  2V1D A;  1DPU A;  1JGS A;  1ON2 A;  2P5V A;  2LDU A;  2CFX A;  2QYO A;  2ETH A;  2MBF A;  4MNU A;  2O03 A;  3M7G A;  1FBU A;  3R0J A;  4H0E A;  1BC8 C;  1D8K A;  1DP7 P;  1L3L A;  5L3D A;  2DW4 A;  2GXG A;  5D5V B;  2CQK A;  5EEG A;  4CXF A;  4P5O A;  2ZFW A;  1JHH A;  1YG2 A;  1SMY F;  5E1Z B;  1FP2 A;  3F22 A;  2ELH A;  2OQG A;  3VEP A;  5DYM A;  1B1B A;  5E8I A;  2VOP A;  2EFO A;  4F7Z A;  3ECO A;  4KMF A;  2E1N A;  3RPU A;  4BXU A;  4WXC A;  1HXD A;  1P4X A;  3MCZ A;  4IXA A;  4M71 A;  2HEO A;  4ZYG A;  2VE8 A;  4LK1 F;  3T1B A;  2A61 A;  2P4W A;  2K4B A;  1IZ1 A;  2IJL A;  3ZMS A;  1SD7 A;  2FA5 A;  4BNC A;  2DO7 A;  3K9T A;  5DCF A;  3HUG A;  5D4S A;  3ABT A;  3M1E A;  2L3D A;  2HFH A;  3B02 A;  1UHW A;  2ZME B;  4HLX A;  3KE2 A;  3V7S A;  3PQK A;  2PQ8 A;  3C1D A;  2CYY A;  3H92 A;  2VC0 A;  2QQB A;  4U0W A;  4NHJ A;  1LEA A;  4OMZ A;  4Y17 A;  2UXN A;  2P7C B;  1DUX C;  2K27 A;  4HF2 A;  1BBY A;  5L3F A;  3VB2 A;  2PLY A;  5DV5 A;  1HKQ A;  5ILU A;  4G7O F;  5TJJ A;  4RGS A;  4GYG A;  3F6O A;  1R36 A;  4QWQ A;  5HDK A;  3V8L A;  2O8X A;  3R60 A;  3DV8 A;  1J5Y A;  4LFU A;  4AIK A;  2Q8K A;  3LWF A;  3I4P A;  5KVR A;  4AIH A;  2EV5 A;  2QBY B;  1O3R A;  4RGU A;  2DFI A;  1FWZ A;  1AOY A;  2ZNZ A;  5J8C A;  3DPL C;  1OKR A;  3V8K A;  4AIJ A;  2E7X A;  1BM9 A;  4RGX A;  2F5C A;  5CVV A;  5F6F A;  4PCQ A;  4OIP F;  5HLG A;  3IWZ A;  4IPA A;  5E1W A;  1IXR C;  2O6G E;  5ED4 A;  1XMK A;  2A07 F;  2XV4 S;  3ISP A;  1ZLK A;  2YPR A;  2OU2 A;  2GA2 A;  3J80 Z;  2LF8 A;  3QU3 A;  2D1H A;  3WE3 A;  3TO6 A;  1ZAR A;  1JHF A;  4LB6 B;  2NS0 A;  1NHA A;  5JVT A;  4G6Q A;  1QBJ A;  3SZP A;  1J2X A;  5H6R A;  4XLP F;  2X0L A;  1I27 A;  1UFM A;  3L2C A;  2RVC A;  5DUK A;  3ZMD A;  3KZZ A;  1VTN C;  5L3G A;  3P9K A;  3SZT A;  4ZYH A;  2IP2 A;  4AWX B;  4GYI A;  1BOA A;  4ZZL A;  1P4W A;  1WI9 A;  1XGO A;  3GFI A;  3ZMV A;  2QEN A;  2HYF A;  3ZMZ A;  5HDN A;  1ODD A;  2DT5 A;  3ERE D;  4G9Y A;  3DQV C;  5CVU A;  2M1B A;  2NAZ A;  1D8J A;  4HX4 A;  5ERI A;  5FLX K;  1UST A;  1W4M A;  5ILS A;  4DQ2 A;  1LDJ A;  4LLN A;  1G3W A;  1HBX G;  4HYE A;  2GIV A;  2RGV A;  4IRI A;  4AD9 A;  3FWE A;  1HST A;  2RNJ A;  1ONV A;  1W5S A;  2A6H F;  1HKS A;  1HQC A;  2HZT A;  3NRV A;  4HX7 A;  2P6S A;  4UV8 A;  3N97 A;  2XKP A;  2AS5 F;  2RC4 A;  1XB4 A;  1D3Y A;  3HOS A;  4WXH A;  3F6V A;  2QLZ A;  3SXY A;  2DPD A;  4WX9 A;  1KYZ A;  4LJZ F;  5CVJ A;  2A6E F;  2Z3Y A;  3CUQ C;  4N0B A;  1XGN A;  3E6M A;  3U2R A;  2DK5 A;  2K02 A;  4LK0 F;  1S7O A;  1WWX A;  5FD5 A;  5D8K B;  4CZZ A;  2X4H A;  1CF7 A;  4CDG A;  4O5V A;  2O0Y A;  1REP C;  3CLO A;  2BE5 F;  2HWV A;  1G3S A;  1FZP B;  4MQ9 F;  5H6Q A;  3JAM Z;  3EUH A;  3FMS A;  4G8X A;  3F8N A;  4KYW A;  3DP7 A;  3FM3 A;  1LVA A;  2FE3 A;  3H3U A;  1BI0 A;  3MAJ A;  1IRG A;  5ICF A;  3QAH A;  4JBA A;  3LAJ A;  4XSX F;  3QRF F;  1U6G A;  1O7F A;  4UVB A;  2V1X A;  1R23 A;  2WWY A;  1IN4 A;  4LLG F;  3O2P E;  1O57 A;  1QZY A;  1WSU A;  4IRH A;  1GXQ A;  2XAS A;  1Y0U A;  2UZK A;  3D0S A;  3RYR A;  3TOB A;  5AON A;  2VBY A;  3RPQ A;  4OIN F;  1ZG1 A;  5F64 A;  3N4M A;  2EV6 A;  3P9C A;  4M9S A;  1TW3 A;  5LEK A;  1R5G A;  5HDG A;  1G3Y A;  3BJA A;  1IUY A;  2JT1 A;  2XHK A;  3WU1 B;  2Q0O A;  2CW0 F;  4CYD A;  3ZMU A;  3W6K B;  1P2F A;  2VE9 A;  1S7A A;  2DQL A;  2ISZ A;  1U78 A;  1LQ1 A;  1EH7 A;  3BJO A;  2VBX A;  1LNW A;  2KKO A;  3L09 A;  4RS8 A;  2GQQ A;  3WTV C;  4KDP A;  2ZO4 A;  3NQO A;  3BPX A;  2QUF A;  4EVI A;  5DDG A;  2RDP A;  1R1T A;  3WTX C;  2M87 A;  2EK5 A;  1SD5 A;  2IPQ X;  5DCM A;  3GW2 A;  3D5L A;  3HHH A;  4L9J A;  2MH9 A;  1H0M A;  1YW7 A;  2QVO A;  5HS8 A;  4M6X A;  2O61 A;  1IN6 A;  1K78 B;  2W25 A;  2O3F A;  1FYK A;  3I71 A;  3ULQ B;  2BV6 A;  3GXO A;  2M8E A;  3VOD A;  1PP7 U;  4P55 A;  1MKM A;  5CVI A;  4GCV A;  3LQQ A;  1SD4 A;  4PGH A;  2LSO A;  1G6N A;  1TNS A;  2GZW A;  4Y13 A;  1T38 A;  1HSJ A;  3F3X A;  1MZB A;  2A3S A;  2HS5 A;  1K6O A;  1V4R A;  3ROU A;  5BPD A;  1YO5 C;  1JE8 A;  4RB1 A;  3E6D A;  1K79 A;  3I53 A;  2PMU A;  1FOK A;  2HTJ A;  3HYI A;  2IA1 A;  1FBQ A;  2ISY A;  4ZYE A;  3RYP A;  5HS7 A;  5L3B A;  2DK8 A;  2RQP A;  1IN5 A;  5FB2 A;  1P6R A;  2F5D A;  5LEJ A;  5BMZ A;  2RN7 A;  2JPB A;  1XGS A;  5LLQ A;  5LRS A;  2DAO A;  3BY6 A;  4KIB A;  1ZRC A;  1KYW A;  1U2W A;  3DKW A;  3EYY A;  1R1U A;  3I58 A;  3KFW X;  3R6S A;  1T39 A;  2M30 A;  3FXR A;  4CIC A;  4FHT A;  4I98 B;  1IRF A;  1ZN2 A;  3ZP5 A;  2P7V B;  3TO7 A;  3F21 A;  1X3U A;  3HIF A;  1QNT A;  4S05 A;  2IVM A;  1HW1 A;  1OPC A;  1UCR A;  2MC3 A;  3TOA A;  3MEX A;  2FEZ A;  5LBQ A;  3RI4 A;  2FNA A;  1K7A A;  2XUB A;  4KIG A;  1TNT A;  3QOP A;  4ESF A;  4N9I A;  1H9G A;  3WGG A;  2R3S A;  2KJC A;  2STT A;  4MHG A;  5JI6 A;  1BN5 A;  2FXA A;  1TQM A;  2V6C A;  3CO6 C;  1ZRD A;  1ZLJ A;  2GAU A;  1J0R A;  3MQ0 A;  4A5N A;  1CGP A;  2ESH A;  1WRJ A;  4WCG A;  4BYY A;  2RV8 A;  1HW5 A;  1YFH A;  4O3M A;  2K86 A;  1Q1H A;  2PN6 A;  4UVA A;  2ZBK A;  1FYM A;  3MFK A;  1TQI A;  1U5T C;  4EM1 A;  4IRG A;  2VBW A;  5CLS A;  1TBX A;  1CF7 B;  2BEO A;  5IT9 Z;  5FLX Z;  1D5V A;  3P7N A;  1STZ A;  2VOD A;  1BI2 A;  3E3V A;  4I7H A;  1YS6 A;  3BRO A;  1DPR A;  3ZN0 A;  2P6T A;  2XRN A;  3OOP A;  4Q5S F;  1QQI A;  2EWN A;  2NYX A;  1KU2 A;  2PFB A;  4MTE A;  5K5Q A;  3DEU A;  1B4A A;  3GO5 A;  3EQL F;  3RKW A;  2WV0 A;  1FLI A;  2PG4 A;  2HOE A;  3VOE A;  1W5T A;  4UNO A;  4FX0 A;  4UV9 A;  4I09 A;  3P9I A;  1RUO A;  2PMH A;  2VT2 A;  2D45 A;  4LG0 A;  1XCB A;  1RUN A;  3IRQ A;  5D5X B;  1ZYR F;  3RKX A;  4HV6 A;  4ESB A;  4ON0 A;  1TW2 A;  1E17 A;  5FFZ A;  1OYI A;  5E20 A;  3REO A;  3L00 A;  2VON A;  3TQN A;  3GYH X;  2LF7 A;  4L0Z B;  1I1S A;  4ENJ A;  1BJA A;  3K1N A;  5F1R A;  1YW9 A;  3LAP A;  4I2O A;  1ZGA A;  3E6B A;  3FZV A;  4RAY A;  3U9G A;  4YII A;  3WTS C;  1P92 A;  4D0P A;  3CDH A;  1PDN C;  1T6S A;  2Y0M A;  4HZF A;  2R7D A;  4RB0 A;  3JW4 A;  2A69 F;  2EFN A;  4R1H A;  4OOI A;  4XBF A;  4NQW A;  4L9V A;  1IF1 A;  3B73 A;  3HSE A;  1KU3 A;  1F4K A;  1QGP A;  4CO8 A;  1C0W A;  4WXD A;  5FD6 A;  3J7A O;  2GA1 A;  4KN7 X;  3NEU A;  5K5O A;  4HBL A;  5ILV A;  3WTU C;  4ZZD A;  1FC3 A;  1FPQ A;  5DCM B;  2H6B A;  1IW7 F;  1KU7 A;  3CTA A;  4ETS A;  3IRR A;  4HF1 A;  1XCV A;  3HRM A;  2JRT A;  5D4R A;  5D8L B;  2OZ6 A;  2NNN A;  1HKT A;  4ASN A;  3M8F A;  3TDZ C;  1Z6R A;  5IT9 K;  3G3Z A;  1L0O C;  4A0Y A;  2GXB A;  1E2X A; 
#chains in the Genus database with same CATH topology
 3ZQI A;  2FBI A;  1T08 B;  3ABM H;  3QYE A;  3PQJ A;  1APL C;  3FIS A;  1XSD A;  3S3O A;  4A93 J;  1G3T A;  3ZPL A;  3I59 A;  1S5L C;  3IH4 A;  1ACI A;  2WTE A;  1QPI A;  4DOZ A;  2DI3 A;  3GBG A;  3IKT A;  3SJM A;  3GTO J;  3GLX A;  4JQF A;  5D6E A;  3IL2 A;  4HOB A;  1SFX A;  3F9K A;  5KK1 A;  3FMR A;  4WK8 F;  3FXJ A;  3Q9S A;  4LD5 A;  3H9G A;  2ZCW A;  5EG0 B;  1KON A;  4EGY A;  3IKV A;  1ZGW A;  1G4D A;  4EEF G;  1G59 A;  4LB5 A;  4RAF A;  2H09 A;  1BA5 A;  1LDD A;  1WH5 A;  2ZME C;  1W7P A;  2KFD A;  3EYI A;  3FF5 A;  3BLY A;  1YYV A;  2EJR A;  3ZQG A;  1RKW A;  2V9V A;  2WY7 Q;  5JHU A;  3RKQ A;  4ZTJ A;  5FRM A;  3IHU A;  3RZD J;  1Z6T A;  2DFE A;  5LGN A;  3K70 C;  3PUF A;  1Z77 A;  1JJ8 C;  4DNC A;  1LEB A;  1ZGJ A;  3K1P A;  2XAG A;  1R00 A;  2JZY A;  2DJN A;  1DGR M;  4XLN F;  3HGG A;  1NG6 A;  4IHX A;  3I4N J;  4LIT A;  4EJO A;  1HLV A;  2H1L A;  3V7C A;  3KP5 A;  2CO5 A;  4R79 A;  3Q5F A;  3RTR A;  2V4J C;  5DUI A;  2XIG A;  3CJQ B;  1XSV A;  1GV2 A;  3G73 A;  3K4C A;  2HVR A;  1Z05 A;  4U7D A;  4XOP A;  2XRO A;  2YU3 A;  3O3K A;  3WOD F;  1RES A;  3KEO A;  5DD8 A;  1R9T J;  1BIA A;  4ESJ A;  4L0Y B;  1WZ2 A;  4EGZ A;  3U1D A;  2KDO A;  2WAE A;  1S3J A;  4M6V A;  4YIF A;  3WTT C;  3V42 A;  3CCU I;  3CUQ A;  5KHD A;  1YIJ I;  1IN7 A;  2D5V A;  2WAQ A;  4MO7 A;  3I64 A;  2KPM A;  3S2W A;  4A2U A;  2PBI A;  3I54 A;  4I0A A;  4XOT A;  1VQ8 I;  2X6O A;  2DDA A;  3BTI A;  4BHC A;  4YFN F;  1H89 C;  1FX7 A;  4ZH4 F;  2FMY A;  2WC2 A;  3ZQ7 A;  1IDY A;  2OF7 A;  3NWT A;  4BE0 A;  2UUZ A;  4ENM A;  2L9N A;  3BJ6 A;  2H8R A;  4PJ0 C;  2P8T A;  1Y8R B;  2AXT C;  3IC7 A;  1Z67 A;  1FT9 A;  2HU9 A;  2ZXJ A;  1XD7 A;  3J7Y J;  4IX7 A;  5H2F C;  2F48 A;  4XNF A;  5LFA A;  3ML6 A;  3VFZ A;  1BOB A;  4XSZ F;  3E97 A;  4CCO A;  5GAH J;  2Z9O A;  2M8G X;  4ZDL A;  3HRU A;  4G7H F;  3DTK A;  2YU9 J;  4A0Z A;  1Y39 A;  2IW5 A;  2Y48 A;  3UR3 C;  1X1D A;  4LOC A;  4UHT A;  4KT5 C;  2V1U A;  1XSX A;  3RCO A;  3FMQ A;  2MH2 A;  5FKO A;  4Y3O A;  3HRT A;  2H27 A;  2XGE A;  3FBI B;  2ZSH B;  1Y1V J;  3J81 K;  2FOW A;  3WU0 A;  2W85 A;  2XAQ A;  1X2M A;  6PAX A;  1QZE A;  4L9N A;  2WB1 N;  3HOV J;  1J7K A;  1F1Z A;  1MBJ A;  3TO9 A;  4HNU A;  4CGZ A;  2BZT A;  1XDS A;  4A3J J;  5KAF C;  2OPT A;  2LYC A;  4GXO A;  4G7Z F;  2ECC A;  2L01 A;  3BWG A;  3UNG C;  5BOX A;  2HDD A;  1XN7 A;  1DU0 A;  1TL8 A;  4ITV A;  1YIT I;  3QPH A;  5LHG A;  1WJA A;  3LFK A;  1ZAO A;  3GZ5 A;  1YLF A;  3EUK L;  3AAF A;  4ZJZ A;  2D1V A;  2Z5U A;  3KP6 A;  1CQT A;  5EEA A;  2M5W A;  2OA4 A;  1B8I A;  3S15 J;  4XR6 A;  4M3F A;  1X4P A;  3AG4 H;  1MDM A;  2MLG A;  3WGI A;  1IV8 A;  2LP0 A;  2X51 A;  4HQM A;  2HOA A;  4NC6 A;  3A02 A;  4ZYA A;  4QPQ A;  4MEX F;  1AKH B;  1FIP A;  3KP3 A;  2L54 A;  4PGG A;  2JVG A;  1FIA A;  1X19 A;  3BR5 A;  2HR3 A;  2XGC A;  1JUP A;  3L2V A;  1JXS A;  2BGC A;  5JR3 A;  2E1M B;  2CQX A;  4D7M A;  2VPL A;  5D6F A;  4A3M J;  3BTL A;  1ZG3 A;  3WHB A;  1QO0 D;  1V55 H;  4HRI A;  4KIT B;  1GV5 A;  2VN2 A;  2STW A;  1Y56 A;  1VQM I;  2L9R A;  1NG7 A;  4XK4 A;  4A0X A;  3KZI C;  2XC7 A;  2A5Y B;  5TRD A;  1KGS A;  1OYY A;  4JYK A;  1D1A A;  2P5L C;  1SMT A;  1KZH A;  2KIF A;  2LR8 A;  3CQZ J;  4XKV A;  2VQG A;  2Z16 A;  2XF6 A;  4DGW B;  1P4A A;  3R0A A;  3JRB A;  1IC8 A;  5FO5 A;  4ZDO A;  5M5Y J;  3FDY A;  3K2Z A;  1T2K A;  2DU9 A;  4MEY F;  4LMY A;  4M9X A;  4HQE A;  5LGT A;  3OYC A;  1XS9 A;  4F91 B;  4DBQ A;  1ERD A;  3ZN1 A;  5DD4 A;  1VQ7 I;  4QSH A;  2LRD A;  1TLH B;  2E5Z A;  4KMU X;  5FGM A;  4E6K G;  2EA2 A;  2OBP A;  1K83 J;  1AWC A;  4BJ6 C;  5H20 A;  2ZC2 A;  3LL7 A;  4LG0 B;  1U8R A;  2KJB A;  5C4X J;  3GWZ A;  3SFZ A;  3TED A;  5E8G A;  1MMS A;  1B72 B;  1WGX A;  1WJF A;  2W4S A;  4D9J A;  4I6Z A;  3GX4 X;  3CO7 C;  2ELJ A;  3IAM 2;  1ETK A;  4XON A;  1YRN A;  3F23 A;  2W24 A;  4U0Y A;  3OYB A;  4EQQ A;  5HOD A;  1N78 A;  1WQ2 A;  3BZ6 A;  1ZR4 A;  1RIO H;  4KIC A;  4HDV A;  5KCM A;  2NVT J;  1QVT A;  1O3T A;  1FP1 D;  2Z99 A;  2IA2 A;  2ZFU A;  4J19 A;  3FM5 A;  4BHP A;  1E3O C;  1LB2 A;  2FD5 A;  2NOG A;  2YX7 A;  1OCT C;  1HCR A;  2ACJ A;  4A69 C;  2MD5 A;  5B1B H;  2QF7 A;  5K1Y A;  4IEJ A;  3DKX A;  1XPX A;  1OYW A;  2O5R A;  5B1A H;  3PIP F;  3HZJ A;  5E3L A;  2P0W A;  3TDU C;  3CCM I;  1QPM A;  1FTZ A;  1X1C A;  3I56 I;  4II2 A;  1OR7 A;  4AVP A;  1IXS B;  4DZJ A;  1XTA A;  2LNB A;  1ZHF A;  5BS6 A;  3K69 A;  2DA4 A;  4RLQ A;  3LSM A;  1S6L A;  4BBR J;  4U7B A;  4FTH A;  1MIJ A;  1I5Z A;  2FU4 A;  2HYG D;  3TW6 A;  1YTY A;  1R58 A;  2DFF A;  3SHF A;  3LSJ A;  1R4M B;  1Y8Q B;  2JVH A;  1A04 A;  2W1O A;  4CYC B;  1JKO C;  4BBS J;  1VQO I;  4XRS G;  1TC3 C;  2HDW A;  2QQ9 A;  4NQW B;  5EDN A;  2LRE A;  3BG5 A;  4IHV A;  3H9Q A;  1OLT A;  1R22 A;  1MNM C;  1IXC A;  1X4O A;  1VF9 A;  2FML A;  2HQR A;  3QPT A;  4AYB A;  4BE1 A;  3H1C A;  2XRL A;  2LMD A;  2KDZ A;  2HDC A;  5J3L A;  3RIR A;  1YJW I;  3E5Q A;  4MGR A;  2YSR A;  3QWL A;  4B4C A;  2VXZ A;  3F8C A;  4E4H A;  1XGM A;  4CUG A;  4FET A;  1V54 H;  2JPC A;  4YFK F;  4AM3 A;  5HLH A;  1RNL A;  4LG3 A;  3S17 J;  5DEQ A;  2CSO A;  2HOT A;  3WGH A;  1HC8 A;  2OCC H;  1RI7 A;  1A6I A;  3S16 J;  2EFP A;  2W84 A;  2R92 J;  4EMS A;  4E70 A;  3S1N J;  1S72 I;  1AU7 A;  2VJ4 A;  3DF8 A;  1NK2 P;  2QSH X;  3HOZ J;  4HF0 A;  3BPV A;  1V5G A;  2VBZ A;  3QU6 A;  2EV0 A;  4O6J A;  2K85 A;  3T8R A;  5D5U B;  4Y7N J;  2RQQ A;  2QZ8 A;  4YFX F;  1W0U A;  3KCC A;  2MYS A;  2CUE A;  2Y0S A;  2MGQ A;  2L7Z A;  1N75 A;  4R8H A;  2VLA A;  2XAH A;  2EIL H;  1VI0 A;  5FLV A;  9ANT A;  3M8E A;  2IS2 A;  3HSR A;  1GLN A;  2DLL A;  3I59 B;  3KP7 A;  4Y33 A;  4EM2 A;  1OFC X;  4PUS A;  5DM6 F;  1J9I A;  1BI3 A;  3M9A A;  1J59 A;  3V4G A;  4DIQ A;  4KIF A;  4Z2Y A;  3GZ6 A;  5F0F A;  2ID6 A;  1WPK A;  3ZGK A;  3SDB A;  4CHU A;  2ECB A;  2AXL A;  3EUA A;  5C44 J;  4OMY A;  2QSG X;  2DPU A;  2FQ4 A;  1MMA A;  2IBD A;  3EDP A;  1IG7 A;  4HW0 A;  3C7J A;  4A3F J;  4V2F A;  1W5C C;  1LE8 A;  2JUC A;  3GFL A;  4HST A;  1W7P B;  2CU7 A;  3CC2 I;  1MH4 A;  1ZTR A;  1X3Z B;  4L5J A;  2NNY A;  3E0J B;  1D1C A;  4C30 A;  5F0H A;  4C2M J;  1DU6 A;  1SEU A;  5A2Q K;  3VYT B;  2OAZ A;  5AIP A;  5HLI A;  3LA3 A;  5EEH A;  4S0H B;  4M3G A;  2EB7 A;  2HGC A;  3TKY A;  2UWM A;  5JLW A;  1JUM A;  1FEX A;  3I9V 2;  3WHC A;  4EJV A;  4XRM A;  2GOX B;  3V8J A;  3ERM A;  2YR2 A;  1XDU A;  3E6C C;  2OV7 A;  1X3W B;  3B6A A;  3HOY J;  4BAY A;  1UHM A;  1SAN A;  4ZDP A;  1ZH5 A;  2A68 F;  3GF2 A;  4JX4 A;  4DYQ A;  1TWH J;  3K4N A;  4G94 A;  2F5E A;  1H88 C;  5FFX A;  2ZXI A;  1WJ5 A;  2OD5 A;  4LIV A;  3BQZ A;  5B5E C;  2OCE A;  4FE7 A;  4BS9 A;  5IOZ A;  3CP2 A;  1O4X A;  2E1C A;  2M45 A;  3CUQ B;  4KT6 A;  4HAM A;  3KYD B;  1MMN A;  3KLN A;  3R61 A;  1ZQ3 P;  3OS2 A;  1BW6 A;  3HKZ N;  3T0Y A;  3SYT A;  2M0C A;  2ZJ2 A;  2DA5 A;  2YX4 A;  2JA6 J;  3HHG A;  3IUO A;  4XRF A;  2M0M A;  3I5U A;  1KA8 A;  5FKL A;  1U5T A;  2XAJ A;  1VQL I;  1KQ0 A;  1SFO J;  4A3L J;  3F8B A;  2NS8 A;  2FQ3 A;  3H5A A;  3SQN A;  1I6X A;  1I1G A;  3JSO A;  4KNY A;  2LTP A;  4I02 A;  2LVS A;  4GFB A;  3BC8 A;  1W1W E;  5EJC A;  4P9U A;  1W7P D;  3S14 J;  4BGD A;  3WE2 A;  2JTV A;  2K7L A;  2Y30 A;  4Q47 A;  4YRV A;  4RGR A;  3VPR A;  3DXJ F;  4IOA F;  2XB0 X;  1ZRF A;  3PUB A;  1V5F A;  4Q4Z F;  4NC8 A;  3WTZ A;  3NAR A;  4IVN A;  1J75 A;  5FRN A;  1H9T A;  1MGT A;  1MJ9 A;  5FJ8 J;  1TT0 A;  2K4J A;  3BG6 A;  4JK1 X;  4M6Y A;  3WG9 A;  2KRH A;  1SFE A;  2W7N A;  2OQR A;  4RAZ A;  2KP6 A;  4U87 A;  2EFW A;  3KP2 A;  4WWC A;  3HXL A;  1XMA A;  1K78 A;  1WKM A;  4A6E A;  4UUV A;  1RKT A;  4S04 A;  1SAX A;  1IJW C;  3O6B B;  4MTD A;  2XDV A;  2H94 A;  1O3S A;  5DTD A;  4BHB A;  1PVE A;  4PZJ A;  3WTW C;  4G6D A;  4L9T A;  3TP0 A;  5IP9 J;  1OCP A;  1NH3 A;  2E19 A;  2DQR A;  4EJW A;  4B1R A;  3OSG A;  2XVC A;  1TWA J;  1MSF C;  2M34 A;  1ZRE A;  2FBH A;  2WB1 A;  4IJA A;  5HS9 A;  5K5R A;  1U0J A;  3ELK A;  2TDX A;  4RM3 A;  2HKO A;  2DTR A;  4I01 A;  2L7F P;  1YIO A;  2DYS H;  3VYU B;  4BXX J;  1BI1 A;  1YW8 A;  3AFH A;  3K4L A;  4UXN A;  1Y0N A;  4P9F A;  3TBI A;  3L7W A;  2VPR A;  4AUX A;  1S29 A;  3T5X A;  1T98 A;  2KQR A;  1GVJ A;  2IA0 A;  1FNN A;  3S1R J;  1G2H A;  3HOU J;  4PDK A;  2W00 A;  1S8N A;  2HTS A;  4FT8 A;  1B8I B;  1MDM B;  1KU9 A;  2Z33 A;  2J5P A;  3BR0 A;  3B6C A;  3D5S C;  4ZYD A;  4OIO F;  1KQ8 A;  5M3M J;  2FOK A;  2E2H J;  3LQR A;  2BBY A;  3FHZ A;  1D0Z A;  2B63 J;  4BH9 A;  4RBO A;  2VI6 A;  1FYL A;  3VYR B;  3T8T A;  1FSE A;  2IRF G;  2K40 A;  1Z9C A;  5J8F A;  5K7Z A;  1O7L A;  1R5H A;  4UVC A;  3S8P A;  2ZJR F;  4FX4 A;  5BPI A;  1Z91 A;  2L02 A;  5ICG A;  3LSH A;  5GAG J;  4MFE A;  3BP8 A;  2E7W A;  3P5J A;  1S7E A;  2LC2 A;  2UXX A;  4HX8 A;  1UB9 A;  4RB3 C;  3BCA A;  2QCO A;  4UB6 C;  2X1D A;  5J6X A;  1LFP A;  2VJJ A;  3OYJ A;  5EZH A;  5E3O A;  3LST A;  1EH6 A;  2CJJ A;  3J81 Z;  2MLK A;  2D2W A;  2JK3 A;  2OUM A;  3KP4 A;  2IGN A;  2DJI A;  1WJB A;  2F2E A;  5BQT A;  2BW3 A;  4EV0 A;  2FNP A;  1Y6I A;  3HOT A;  4A3D J;  3J7A Y;  5DS9 A;  3FXU A;  2FSW A;  3KZY A;  2EH3 A;  2K9M A;  4C3J J;  2E60 A;  1T0F C;  3FXL A;  1ULY A;  3K1M A;  2PI0 A;  3COA C;  2BOL A;  2L7K A;  1HW2 A;  3F72 A;  2XGX A;  2R7Z J;  1T56 A;  2X48 A;  3LA7 A;  5J1Y A;  3KET A;  3E5X A;  2G7H A;  3TGN A;  3JRG A;  5L3E A;  3UKG A;  1YRN B;  1PUE E;  2XF5 A;  4LGW A;  5FKK A;  2BY0 A;  1B9N A;  1D1B A;  3PM1 A;  4A5M A;  4UUS A;  2FBK A;  2PEX A;  2LKP A;  4PSW A;  2L4A A;  3QPL A;  2HQN A;  2FRH A;  1OCZ H;  1FBS A;  4EJU A;  4L18 B;  1UAA A;  5GPA A;  2PJP A;  5L3C A;  1LJ9 A;  4HV5 A;  1F36 A;  3HRS A;  1T0F A;  5CJ9 A;  4U0V A;  4X0G A;  1B6A A;  3DFG A;  4CCK A;  2BYV E;  1A31 A;  2IXS A;  3HEF A;  3F8F A;  3H0G J;  4IF4 A;  2IS4 A;  4XIC A;  1JJ6 C;  3C18 A;  3GUD A;  3OY9 A;  1YE9 A;  3AL0 B;  2QM3 A;  2CGP A;  3PNV A;  5M5X J;  2K5C A;  3G71 I;  1V3F A;  5EF6 A;  4K2E A;  4CH7 A;  4ENN A;  2OZU A;  3GFJ A;  4Y15 A;  3E5U A;  2ADU A;  3MZY A;  2E5N A;  3WTY C;  1BR2 A;  4E7Z A;  2J5O A;  1VQK I;  2FUG 2;  1BW5 A;  1GHC A;  1OCR H;  2E36 A;  1U8B A;  4MQV A;  2IT0 A;  2COM A;  2LY1 A;  4HA8 A;  3RKY A;  4OIR F;  1F9N A;  3HSF A;  4A6D A;  4B48 A;  4MFD A;  2ZME A;  4RB2 C;  4ENK A;  4OIQ F;  4P96 A;  1YS7 A;  4NNJ A;  1YQA A;  4BU2 A;  4LIU A;  2X1E A;  2DT7 B;  3PFI A;  2G7U A;  4YEL A;  5EGO A;  3OYE A;  3IP4 B;  4TV7 A;  4WF2 A;  2W57 A;  3OL3 A;  2VT3 A;  3A2K A;  3MKZ A;  2Y75 A;  2DFH A;  5E3M A;  1LDK B;  2EFQ A;  4PJN A;  3S32 A;  2R7F A;  2JSC A;  4UUT A;  2CQ7 A;  1MJB A;  2MSY A;  2L4M A;  4EJT A;  2HKX A;  4KUM A;  1BIB A;  3H36 A;  3K4K A;  1E0E A;  3C3W A;  1R5I D;  1SFU A;  2QQA A;  4PK4 A;  1Z1D A;  2DCE A;  1QHG A;  2ESN A;  1P9Q C;  1IRZ A;  4BE2 A;  5IYD J;  1XX5 A;  3JSP A;  2VC1 A;  5LRR A;  3ZQH A;  1LPQ A;  2E2I J;  1YOV B;  2BVM A;  3K0L A;  4I0B A;  4XKB A;  2CG4 A;  4KN4 X;  1D5Y A;  1TWG J;  3H3Z A;  3Q9V A;  3J80 K;  2EA4 A;  4GO1 A;  2H6C A;  3R4K A;  2CWE A;  3MKW B;  3KEQ A;  1U3E M;  4M72 A;  2XKO A;  2XPU A;  3QP6 A;  1Z0X A;  3DLL F;  5CVR A;  3GEZ A;  2NRA C;  3CCL I;  3L2U A;  4EM0 B;  3LSG A;  4HLY A;  1IN8 A;  2ZKZ A;  2KIU A;  4HDU A;  2R7Q A;  5LGU A;  1RET A;  3LA2 A;  4YG2 F;  4GGG A;  2EPF A;  3CUO A;  3X2Q H;  3HTU A;  4B47 A;  4BQA A;  3DPT A;  3VWB A;  3S93 A;  2DOD A;  4PSX A;  4N9H A;  4KFC A;  5E18 F;  1LE8 B;  2VJI A;  4BJT A;  2QBY A;  4IHT A;  2HQ5 A;  3SEQ A;  1EV7 A;  4PJM A;  5F08 A;  3BR3 A;  3GTQ J;  1PP8 F;  2MG4 A;  2HVS A;  3BOQ A;  1R7J A;  3A1Y A;  4NB5 A;  5ICC A;  3HL2 A;  2VOO A;  3G1L A;  1GT0 C;  1F5T A;  4LLL A;  3U21 A;  2P5K A;  2PX9 A;  2NVY J;  2B9S A;  4X1E A;  2BHZ A;  1M1E B;  3V7R A;  1IRX A;  2EZL A;  3ZR8 X;  2WY8 Q;  3J7Z I;  3HTS B;  3BDD A;  2XAU A;  1R1V A;  2ZNY A;  1EKE A;  3BG9 A;  1DDN A;  2NOJ B;  4J00 A;  4HSR A;  1NTC A;  4FCY A;  4IHS A;  4M74 A;  4CZC A;  2E2J J;  3CJN A;  3RJP A;  2OC6 A;  4KA4 A;  3GTG J;  3HG9 A;  3G6E I;  3OS1 A;  3ECH A;  2AO9 A;  2C6Y A;  3HC7 A;  5D5W B;  3GTP J;  3HPH A;  2CMP A;  5JVG F;  4F55 A;  2V79 A;  1I39 A;  2WAD A;  3NWS A;  5IT3 A;  4L5I A;  2JA5 J;  3OOU A;  1B59 A;  1I50 J;  1TQP A;  3JRA A;  4NDL A;  3EPZ A;  3ZQL A;  3L9F A;  2DA2 A;  3OYL A;  2KZG A;  2QWW A;  3JTH A;  3W6J B;  2O9L A;  2KZV A;  1EH8 A;  4U88 A;  1YX5 A;  2FF4 A;  1U5T B;  2F5F A;  3F8M A;  2MA3 A;  3CF2 A;  2GWR A;  2JUG A;  5E1X A;  4DW6 A;  3HKZ A;  2NS7 A;  1IV6 A;  4XL9 A;  1I6H J;  3IWF A;  3JTG A;  1USS A;  2JRM A;  2VQC A;  3AG3 H;  1X2N A;  4PFO A;  3VSL A;  4NUB A;  2HVQ A;  1BC7 C;  3ZMT A;  2G9W A;  4M9Z A;  2W48 A;  2COB A;  3RDI A;  5GTI C;  2GBY A;  2DOE A;  3RSN A;  1VQ5 I;  3QP5 A;  1FY7 A;  5LHH A;  3ZOB A;  5CKT A;  5A2Q Z;  5JFR A;  3MZH A;  2I10 A;  2EIN H;  1SD6 A;  2RKH A;  1BL0 A;  3OR1 C;  1MJA A;  2KL4 A;  3MVP A;  5HVQ C;  3EET A;  1ZG5 A;  3ZQC A;  3ABU A;  2DA3 A;  3LSK A;  3D5R C;  1GXP A;  2F6C A;  2Q2E A;  4M73 A;  4B09 A;  2CUJ A;  2DBB A;  3OV8 A;  3MWM A;  4AU7 A;  1VFC A;  4L5E A;  1JT6 A;  4A12 A;  5AIQ A;  3CMA I;  4B8X A;  1FJL A;  5ICE A;  1FSH A;  4XLH A;  5E17 F;  3JAM K;  1DP3 A;  1QZZ A;  4PJJ A;  1QRY A;  1O3Q A;  2JQ7 A;  5HOO A;  3CD6 I;  1TTY A;  1IAW A;  3FXQ A;  1PUF A;  4BQN A;  3I0T A;  1B9M A;  3KLO A;  1MD0 A;  2CV2 A;  2XAF A;  1RZ4 A;  2L9V A;  5LHI A;  4OU0 A;  2CFO A;  1OMI A;  2KIM A;  3K4M A;  5F1J A;  1UEL B;  3DU6 A;  3FXO A;  1W36 C;  3MZ8 A;  5C3E J;  2CS3 A;  2ME0 A;  3AG1 H;  3GFM A;  1A35 A;  3FX3 A;  5KNL A;  1KQ9 A;  1Z7U A;  3GVA A;  1ON1 A;  2KRF A;  5IP6 A;  5J4Y A;  3FBN B;  3CCR I;  3OYD A;  2V9P A;  4FAS D;  1ENH A;  1Z7L A;  3IAS 2;  4RLF A;  3M8J A;  4QLC U;  4Q48 A;  4G12 A;  5CYV A;  2B0L A;  5BNG A;  2V1D A;  3D1N I;  3LMM A;  2YS9 A;  4XQF A;  1DPU A;  1JGS A;  4V19 K;  1QA6 A;  1ON2 A;  2P5V A;  1E3H A;  2LDU A;  4OAZ A;  1UJ8 A;  4A3B J;  2CFX A;  2QYO A;  3KEY A;  2ETH A;  2MBF A;  4OAY A;  3OYH A;  4MNU A;  3MD2 A;  2O03 A;  4JOM A;  3M7G A;  3ESW B;  2IGM A;  1FBU A;  3R0J A;  4YIR X;  1ZEL A;  4H0E A;  4E7L A;  1BC8 C;  1D8K A;  5K7F A;  1DP7 P;  4CA0 A;  3RQI A;  3CES A;  1PYV A;  2KIS A;  3W2W A;  1L3L A;  5L3D A;  3TMO A;  2DW4 A;  3FXM A;  2GXG A;  3Q0W A;  5D5V B;  2CQK A;  2WAF A;  5EEG A;  1UG0 A;  4CXF A;  4P5O A;  2BW3 B;  3IH2 A;  2R7T A;  3F0C A;  4ZTF A;  2ZFW A;  1JHH A;  1YG2 A;  2DYR H;  3GTL J;  1SMY F;  3BR2 A;  5E1Z B;  2CUF A;  1MND A;  2JJ7 A;  1FP2 A;  3F22 A;  2ELH A;  4NC7 A;  2R7X A;  2OQG A;  2R4G A;  3DEE A;  3VEP A;  5DYM A;  2K9L A;  1B1B A;  5E8I A;  1PJR A;  5TGT A;  5EYR A;  2VOP A;  3DBR B;  2EFO A;  4F7Z A;  4UUS B;  3S1M J;  1D0X A;  3ZRG A;  3ECO A;  4KMF A;  4BXF A;  2E1N A;  3RZO J;  3RPU A;  1BJZ A;  3CF5 F;  3QOE A;  4DYR A;  4CCM A;  4BXU A;  4WXC A;  2R7R A;  5TIS C;  4AC0 A;  2GM4 A;  3OIP A;  1ETW A;  1HXD A;  1ETO A;  1P4X A;  1X1B A;  2QKM B;  3BTJ A;  2R5Z A;  3MCZ A;  4IXA A;  1HDD C;  2GLO A;  4M71 A;  2HEO A;  1MW7 A;  4ZYG A;  2VE8 A;  3DWL E;  4LK1 F;  4XLE A;  2JA7 J;  3T1B A;  2A05 A;  2A61 A;  2PMZ N;  4BL0 B;  4DZP A;  2P4W A;  1JTX A;  5HNF A;  2K4B A;  3CCY A;  3HDD A;  1IZ1 A;  5GPC A;  2IJL A;  3ZMS A;  1SD7 A;  2FA5 A;  4BNC A;  2DO7 A;  2Q1Z B;  3BG7 A;  3K9T A;  5DCF A;  1JUS A;  3HUG A;  2HOS A;  5D4S A;  5C4J J;  4B3A A;  1K4T A;  3ABT A;  3M1E A;  2L3D A;  4B3X A;  2HFH A;  3B02 A;  3SFI A;  1X1A A;  3CZ6 A;  1UHW A;  2ZME B;  2XSD C;  2DTZ A;  1VQ4 I;  4HLX A;  2WBM A;  3KE2 A;  2E1M C;  3V7S A;  5EGO B;  3PQK A;  4AVZ A;  1TP4 A;  2HXO A;  2PQ8 A;  3C1D A;  3VDX A;  2CYY A;  3H92 A;  4W97 A;  2VC0 A;  1R71 A;  2QQB A;  1LFB A;  4U0W A;  4IO9 F;  2K9S A;  4NHJ A;  1LEA A;  4OMZ A;  4UB8 C;  1E3P A;  4Y17 A;  2BY1 A;  4XLA A;  3S3N A;  3JCU C;  2LBF A;  2UXN A;  2P7C B;  4CCN A;  4BJ5 C;  3OYA A;  1DUX C;  2K27 A;  5GAD J;  2M4K A;  4HF2 A;  5CQE A;  1FMW A;  2DOF A;  1BBY A;  5L3F A;  1GDT A;  3HB9 A;  3VB2 A;  2LY2 A;  4RAG A;  3K4B A;  4C9Y A;  5FRO A;  4UY8 I;  2PLY A;  2DMN A;  5DV5 A;  1HKQ A;  1MSE C;  5ILU A;  4II3 A;  4G7O F;  4ABZ A;  2IS6 A;  4JP0 A;  2L0K A;  4HEA 2;  5TJJ A;  4E7S A;  4RGS A;  3FK6 A;  4GYG A;  2XPV A;  3F6O A;  1R36 A;  4QWQ A;  5HDK A;  3A01 A;  3V8L A;  2O8X A;  3R60 A;  2QQ8 A;  3QYB A;  2VQL A;  4QPO A;  2MFZ A;  1LVK A;  3DV8 A;  3CME I;  1J5Y A;  5B66 C;  1MBG A;  4LFU A;  2AHQ A;  1MBE A;  4AIK A;  4A3K J;  4NBQ A;  2Q8K A;  3PFY A;  3LWF A;  1ZR2 A;  5F27 A;  2F5V A;  4F52 A;  5JLX A;  2I5U A;  2EZH A;  3I4M J;  5FKN A;  3I4P A;  2BXZ A;  1EA3 A;  3A4C A;  5KVR A;  2F4I A;  2QA4 I;  4AIH A;  1ORK A;  2EV5 A;  2QBY B;  1O3R A;  4B43 A;  4RGU A;  2DFI A;  1FWZ A;  1AOY A;  3K70 D;  2DN0 A;  2ZNZ A;  5J8C A;  2KHM A;  3DPL C;  1YHQ I;  1VND A;  1OKR A;  1HOM A;  3V8K A;  4AIJ A;  2PJR A;  3KIO A;  3CMM A;  2E7X A;  1BM9 A;  3BR6 A;  1YJ9 I;  4RGX A;  2F5C A;  2R0Q C;  2BHY A;  5CVV A;  5F6F A;  4PCQ A;  3HJE A;  4OIP F;  4XMY A;  2N8G A;  5HLG A;  3OYI A;  3IWZ A;  3HM5 A;  4IPA A;  5E1W A;  1IXR C;  2GXA A;  1A5J A;  4IL6 C;  2O6G E;  2DA1 A;  5ED4 A;  1XMK A;  2A07 F;  1IO2 A;  2H8W A;  4BQQ A;  4I76 A;  2XV4 S;  2W82 A;  3ISP A;  1ZLK A;  2YPR A;  1FOW A;  2OU2 A;  2Y2Z A;  1JTY A;  2GA2 A;  3J80 Z;  2HQA A;  4IHW A;  2LF8 A;  5B3S H;  3U1K A;  4D5F A;  3QU3 A;  2D1H A;  3ABK H;  3OR2 C;  2X6Y A;  4F93 B;  3WE3 A;  3TO6 A;  1ZAR A;  2VKH A;  1JHF A;  3HGY A;  1OIS A;  1FOX A;  5GTH C;  1I3Q J;  4LB6 B;  2NVX J;  2NS0 A;  3CJT B;  4BEH A;  2AQF A;  1WVR A;  1NHA A;  5JVT A;  4G6Q A;  2VUM J;  2AQE A;  1QBJ A;  3SZP A;  1J2X A;  5H6R A;  4XLP F;  2X0L A;  1I27 A;  3FK7 A;  2ZJP F;  4Z6Y A;  1YI2 I;  1UFM A;  3L2C A;  4BY7 J;  3H35 A;  1UMQ A;  2CV1 A;  2WA0 A;  2JN6 A;  2RVC A;  5KAI C;  5DUK A;  3ZMD A;  3O8G A;  3KZZ A;  1RPW A;  2QEX I;  5L3G A;  1VTN C;  2ZXW H;  3P9K A;  3SZT A;  1WFX A;  4ZYH A;  2IP2 A;  4D5C A;  4AWX B;  1WJC A;  4GYI A;  1BOA A;  4ZZL A;  1JT0 A;  2ELK A;  1P4W A;  1WI9 A;  3O8H A;  1XGO A;  3GFI A;  2DDB A;  3ZMV A;  2QEN A;  2HYF A;  3ZMZ A;  5HDN A;  1ODD A;  2DT5 A;  4E7H A;  3ERE D;  1JI8 A;  3VSK A;  2CUZ A;  4G9Y A;  2Q2E B;  3DQV C;  5CVU A;  2M1B A;  5IPA A;  4BAC A;  2NAZ A;  1D8J A;  4HX4 A;  2DA6 A;  5ERI A;  4BKX A;  5FLX K;  1UST A;  3OIO A;  1W4M A;  5ILS A;  2ME6 A;  4DQ2 A;  3L2W A;  3C2G A;  1W0T A;  4C2T A;  1LDJ A;  2QSF X;  2MD0 A;  2DMU A;  4LLN A;  1G3W A;  1HBX G;  2HPI A;  4HYE A;  2GIV A;  2RGV A;  2V6E A;  1WI3 A;  3DKY A;  4PJL A;  3MN2 A;  4IRI A;  2LH9 A;  3OL4 A;  3SEZ A;  3CDI A;  5IP7 J;  1PUF B;  4H4K C;  1DQU A;  2L5Q A;  3KX2 A;  4AD9 A;  4BQO A;  2DXI A;  3FWE A;  2IGK A;  2DOA A;  1HST A;  4D7N A;  1T95 A;  2RNJ A;  1BR1 A;  1ONV A;  1W5S A;  2A6H F;  1JKP C;  4V2G A;  1VZ0 A;  1HKS A;  1HQC A;  2HZT A;  3NRV A;  4HX7 A;  5F0C A;  2P6S A;  3BQY A;  2G0E A;  4UV8 A;  3N97 A;  2LKX A;  2XKP A;  2AS5 F;  2ICW G;  1MBH A;  2RC4 A;  2V7F A;  1XB4 A;  1D3Y A;  1FOY A;  3CMY A;  3K10 A;  3HOS A;  4WXH A;  3F6V A;  2QLZ A;  3TW7 A;  4XM3 A;  1UHS A;  3SXY A;  3N05 A;  1K6Y A;  4WX9 A;  2HPM A;  2DPD A;  1KYZ A;  3AKZ A;  4LJZ F;  1TZL A;  1XC5 A;  2KMU A;  3QQA A;  2LY9 A;  2A6E F;  2Z3Y A;  5CVJ A;  3AG2 H;  1XMX A;  3CUQ C;  3EUH C;  3CCQ I;  4N0B A;  1XGN A;  3E6M A;  3GTJ J;  3U2R A;  2DK5 A;  2K02 A;  2LOO A;  4LK0 F;  2R7O A;  2K9N A;  2LFB A;  1EJ9 A;  3DPU A;  2R7W A;  1S7O A;  1WWX A;  5FD5 A;  2FX0 A;  5D8K B;  4IKF A;  4CZZ A;  1MBF A;  2NXN B;  2X4H A;  1CF7 A;  1U9O A;  4CDG A;  5IY5 H;  4O5V A;  2O0Y A;  1REP C;  3CLO A;  2BE5 F;  2DMP A;  2HWV A;  1G3S A;  3E1S A;  3SDG A;  3S3M A;  1FZP B;  1ITY A;  3KYL A;  2HZD A;  1SAU A;  1RR7 A;  2EIJ H;  2TRT A;  2M7B A;  1SFK A;  4OWR B;  4MQ9 F;  2IS1 A;  5H6Q A;  3MKL A;  4BY1 J;  3QYF A;  3JAM Z;  3EUH A;  4F3Q A;  3FMS A;  4IZZ A;  3OMY A;  2HI3 A;  2M9H A;  4G8X A;  3F8N A;  4KYW A;  4JX6 A;  3S1Q J;  3DP7 A;  3FM3 A;  1LVA A;  2DMQ A;  3Q3S A;  2FE3 A;  2NVU B;  3H3U A;  1BI0 A;  2EQR A;  3DLA A;  3MAJ A;  1D0Y A;  1GUU A;  3DBL B;  3CLQ A;  5ICF A;  1TT5 B;  1IRG A;  3QAH A;  1R4N B;  2LD5 A;  2Y31 A;  4JBA A;  3LAJ A;  3FKJ A;  3K2A A;  4XSX F;  1U6G A;  3QRF F;  1NK3 P;  4G6T B;  3HOW J;  4HG2 A;  3LSP A;  1O7F A;  4UVB A;  3E7L A;  2V1X A;  1RRJ A;  1R23 A;  3GLL A;  2WWY A;  1IN4 A;  2XPW A;  4LLG F;  4N4N B;  3O2P E;  3KPH A;  1O57 A;  1QZY A;  3Q0U A;  1WSU A;  1ZK8 A;  4IRH A;  2R5Z B;  4XKC A;  1GXQ A;  2XAS A;  1Y0U A;  2DT6 A;  2UZK A;  2BY2 A;  3D0S A;  1W36 D;  3RYR A;  5GP9 A;  3TOB A;  5AON A;  2VBY A;  3ASO H;  3RPQ A;  4F92 B;  5HNH A;  4OIN F;  3L2R A;  2X9D A;  1ZG1 A;  3NAU A;  5F64 A;  2MC4 A;  3N4M A;  1P7J A;  2PMZ A;  4AID A;  5E3N A;  3K4J A;  2EV6 A;  3HUG B;  3BR1 A;  1MBK A;  3PO2 J;  3P9C A;  1J09 A;  4M9S A;  3BG3 A;  1TW3 A;  2B7E A;  4M3B A;  5LEK A;  1WJE A;  1WCM J;  1OCO H;  3PL8 A;  4QTR A;  4C3H J;  2TCT A;  1R5G A;  3PNY A;  3OYG A;  1JGG A;  5HDG A;  1G3Y A;  3GME A;  3BJA A;  2K3F A;  1IUY A;  2JT1 A;  2XHK A;  3M4O J;  2R7V A;  1SC7 A;  2OTJ I;  2R5Y A;  3WU1 B;  2Q0O A;  2CW0 F;  3OS0 A;  4CYD A;  3ZMU A;  1YX3 A;  3G1M A;  3W6K B;  2VXD A;  2OTL I;  2QKL B;  1P2F A;  4CSW A;  2VE9 A;  3H9J A;  2M2E A;  3MKY B;  1S7A A;  2LBF B;  2CH0 A;  2DQL A;  3RQ4 A;  4BDZ A;  3RPU D;  2ISZ A;  1LFU P;  1U78 A;  5CPR B;  2VJ5 A;  1ETQ A;  3PJR A;  1VQ6 I;  1LQ1 A;  1EH7 A;  4IQJ A;  3BJO A;  4I99 C;  3CCE I;  2VBX A;  1LNW A;  2KKO A;  3L09 A;  4RS8 A;  2GQQ A;  4XID A;  3WTV C;  3CCJ I;  4KDP A;  2ZO4 A;  4A3I J;  4CCJ A;  1UG2 A;  2VAS A;  3NQO A;  3BPX A;  2ID3 A;  2QUF A;  4EVI A;  2Z2S B;  5DDG A;  1X1P A;  2RRE A;  2X1C A;  2RDP A;  1U9N A;  3IH3 A;  1VQN I;  2QGU A;  4RMN A;  2CV0 A;  1R1T A;  4XLF A;  3WTX C;  2M87 A;  2EK5 A;  1SD5 A;  2LLK A;  2IPQ X;  5CQG A;  5DCM A;  3GW2 A;  4KJZ A;  3D5L A;  3HHH A;  3WU2 C;  4L9J A;  3H5R A;  3HBL A;  3A01 B;  2MH9 A;  1H0M A;  1YW7 A;  2QVO A;  1MH3 A;  3OIQ A;  5HS8 A;  2O7O A;  3VYS B;  4M6X A;  2O61 A;  1IN6 A;  2LG4 A;  1K78 B;  2W25 A;  3C2H A;  2O3F A;  1FYK A;  3A03 A;  4JX5 A;  1QU3 A;  3I71 A;  3OYF A;  1WHU A;  3GTK J;  3ULQ B;  2BV6 A;  3GXO A;  2RNG A;  2L7M P;  3CP8 A;  3S2D J;  4KIS A;  1BR4 A;  2M8E A;  4A3C J;  3VOD A;  2YUS A;  1OCC H;  1PP7 U;  4P55 A;  1MKM A;  2XGD A;  1JKR C;  2R7S A;  5CVI A;  4A3G J;  4GCV A;  2BXY A;  3LQQ A;  3ZQQ A;  2I8D A;  1VQP I;  1SD4 A;  1OR7 C;  4PGH A;  3AL0 C;  2VL8 A;  2H1K A;  2LSO A;  1G6N A;  1TNS A;  2GZW A;  2E35 A;  4Y13 A;  4HNT A;  1T38 A;  2PJR B;  1HSJ A;  3F3X A;  3H0D A;  1MZB A;  2A3S A;  2HS5 A;  1K6O A;  3QPS A;  1V4R A;  2KT0 A;  3ROU A;  3OYN A;  5F04 A;  5BPD A;  3M1C A;  5EG0 A;  1YO5 C;  2Z1D A;  5HLT A;  3ABL H;  1JE8 A;  4RB1 A;  3GTM J;  1IGN A;  3E6D A;  1K79 A;  3GZN B;  3I53 A;  1K4S A;  3G4S I;  2PMU A;  3G1O A;  2NVQ J;  2E34 A;  1S9H A;  1FOK A;  2HTJ A;  4RA2 A;  2P81 A;  4E7J A;  3HYI A;  2IA1 A;  1FBQ A;  2ISY A;  4ZYE A;  3RYP A;  2L9S A;  4DYC A;  1ZKG A;  5HS7 A;  1AHD P;  4P1W A;  3BT9 A;  5L3B A;  2DK8 A;  4XRS A;  2RQP A;  1IN5 A;  5J47 A;  5FB2 A;  1P6R A;  2K9Q A;  2CW7 A;  5J1R A;  3W2V A;  2F5D A;  5LEJ A;  3LSI A;  5BMZ A;  3PO3 J;  2RN7 A;  4BEH B;  2JPB A;  1XGS A;  5LLQ A;  2M4G A;  5LRS A;  2DAO A;  3BY6 A;  4KIB A;  5J40 A;  2M3A A;  3MMY B;  2WAQ N;  1ZRC A;  1KYW A;  1U2W A;  3DKW A;  3EYY A;  1R1U A;  3I58 A;  2JMW A;  4XLC A;  4M3E A;  1FTT A;  3JRD A;  2E1O A;  1JKQ C;  1SVM A;  3KFW X;  3R6S A;  1T39 A;  2M30 A;  3FXR A;  4CIC A;  1N77 A;  4FHT A;  5E79 C;  1SVL A;  4I98 B;  4E7I A;  3CCV I;  1IRF A;  1HF0 A;  3JRF A;  3S2H J;  4ZC3 A;  2MW8 A;  4XN3 A;  2V26 A;  3LNQ A;  1ZN2 A;  1X58 A;  3ZP5 A;  2P7V B;  3TO7 A;  3F21 A;  2V1N A;  3BCB A;  1T33 A;  3DU5 A;  1X3U A;  2LKS A;  2CQQ A;  3HIF A;  1QNT A;  5J1U A;  4S05 A;  2K3P A;  2IVM A;  3W2A A;  1HW1 A;  1OPC A;  1UCR A;  2GOM A;  2MC3 A;  2KLO A;  2IGO A;  3TOA A;  3MEX A;  2FEZ A;  5LBQ A;  4MIM A;  1POG A;  3RI4 A;  2R93 J;  2FNA A;  4IQ4 A;  4XN0 A;  1K7A A;  4IOC F;  3PIO F;  5DM7 F;  2XUB A;  3WG7 H;  3DBH B;  1LKX A;  2VB6 A;  1V5E A;  1HDP A;  4KIG A;  5M5W J;  4CCL A;  1TNT A;  3QOP A;  4ESF A;  4N9I A;  1H9G A;  1K61 A;  3GCM A;  5IYC J;  4GDF A;  4W1U A;  3WGG A;  2R3S A;  2KJC A;  1WJD A;  1N25 A;  4HPQ A;  3K6G A;  5JHF A;  3TP3 A;  4A3E J;  2E71 A;  2STT A;  4MHG A;  2VKD A;  4X6A J;  2CW8 A;  2DA7 A;  4Y52 J;  4M3D A;  3TL4 X;  4HNV A;  5JI6 A;  2EIM H;  4FE4 A;  1BN5 A;  3CC7 I;  3L2Q A;  1Q1V A;  2BVL A;  2FXA A;  1TQM A;  1QHH D;  2V6C A;  2EIK H;  2X6X A;  1H8A C;  2WV1 A;  1HA8 A;  3CO6 C;  5EZG A;  3CDL A;  1ZRD A;  2OJE D;  1ZLJ A;  3LOC A;  2GAU A;  1J0R A;  3MQ0 A;  2IAI A;  4A5N A;  4ANJ A;  1CGP A;  1Z3Y A;  1OJL A;  2A6T A;  2ESH A;  1WRJ A;  4WCG A;  4BYY A;  2JWT A;  3H3V K;  2RV8 A;  1R49 A;  3OSF A;  1HW5 A;  2DMT A;  2EBI A;  1YFH A;  2LK2 A;  2HYJ A;  1Z3X A;  2X6W A;  1VQ9 I;  4O3M A;  3ZQF A;  3JRH A;  2ZXH A;  1EF4 A;  2K86 A;  1Q1H A;  2MAB A;  5FLM J;  5GAE J;  3JRE A;  2PN6 A;  4E7K A;  4UVA A;  2ZBK A;  3FXK A;  1FYM A;  2O8K A;  3MFK A;  4XOR A;  3PSI A;  4C3I J;  2F4O B;  1TQI A;  1U5T C;  4EM1 A;  4IRG A;  2VBW A;  5CLS A;  1TBX A;  2JA2 A;  1CF7 B;  2BEO A;  1AKH A;  5IT9 Z;  3G2B A;  5FLX Z;  1D5V A;  1GVD A;  3P7N A;  1STZ A;  3JR9 A;  2VOD A;  1BI2 A;  3A0B C;  1DGW Y;  4BDY A;  3E3V A;  4I7H A;  1YS6 A;  3BRO A;  1P7I A;  1DPR A;  1RC9 A;  1ETV A;  1XG1 A;  3ZN0 A;  4C2U A;  3DTI A;  1YJN I;  3BZK A;  3Q0V A;  5IYB J;  4EAT A;  2P6T A;  2GIZ A;  3H5N A;  2XRN A;  3CC4 I;  3M07 A;  3I3L A;  3OOP A;  2A5W A;  1QQI A;  4Q5S F;  1MMD A;  1ETX A;  2EWN A;  4J01 A;  2M7A A;  2NYX A;  2V9K A;  3QOD A;  3W6V A;  1KU2 A;  2PFB A;  3CJR B;  3PNT A;  2EZI A;  3FHN A;  4MTE A;  5K5Q A;  1FMV A;  2ZSI B;  1UZC A;  2VIX A;  3DEU A;  2CRG A;  2UV1 A;  1B4A A;  3GO5 A;  3EQL F;  3RKW A;  2WV0 A;  1FLI A;  4FIS A;  2HXI A;  2PG4 A;  2HOE A;  3HPG A;  3VOE A;  1W5T A;  1IUF A;  4UNO A;  2IEK A;  2VKV A;  4Y4R A;  4RDU A;  1ETY A;  1IDZ A;  1QVU A;  3DCF A;  3KYC B;  4FX0 A;  4UV9 A;  4I09 A;  3P9I A;  4RM2 A;  1RUO A;  2PMH A;  4B44 A;  1Y1W J;  2VT2 A;  2D45 A;  4LG0 A;  1XCB A;  3FIW A;  1TWF J;  3IV5 A;  2L2O A;  3SZG A;  4GRI A;  1R6R A;  1RUN A;  1B72 A;  4DJA A;  2FJ1 A;  1A36 A;  1MMG A;  3IRQ A;  1A6Q A;  5D5X B;  2Y69 H;  1ZYR F;  2ZJQ F;  3RKX A;  4HV6 A;  4QIW N;  3I55 I;  5FKM A;  4ESB A;  4ON0 A;  3BZC A;  1TW2 A;  2BY3 A;  3LSR A;  1E17 A;  2JSP A;  3ZCO A;  1LUJ B;  5FFZ A;  1I3A A;  2ZB9 A;  1OYI A;  5E20 A;  3REO A;  3L00 A;  2VON A;  2HNH A;  3W3C A;  1AA7 A;  3TQN A;  3GYH X;  2LF7 A;  3DTE A;  1F43 A;  4L0Z B;  1I1S A;  1T8I A;  5M3F J;  2EZK A;  3L1P A;  4ENJ A;  3BTC A;  3OYM A;  1BJA A;  1G8X A;  3K1N A;  5F1R A;  1RR8 C;  1YW9 A;  2KIQ A;  2F4M B;  3LAP A;  4I2O A;  1ZGA A;  4BUP A;  3E6B A;  3FZV A;  4RAY A;  3U9G A;  4D1Q A;  3JRI A;  4YII A;  5K7H A;  5IOY A;  3WTS C;  1P92 A;  4D0P A;  3OYK A;  3CDH A;  3FKI J;  2R5Y B;  1PDN C;  2X85 A;  1OQY A;  1T6S A;  2KRC A;  1MNE A;  4XKW A;  2Y0M A;  1WH7 A;  4HZF A;  4PFP A;  2JA8 J;  2R7D A;  4RB0 A;  3ASN H;  3JW4 A;  2A69 F;  2EFN A;  3LFU A;  5LD2 C;  4R1H A;  4OOI A;  4CYC A;  4XBF A;  3DEW A;  4AYB N;  4NQW A;  1SVO A;  4L9V A;  3ZXS A;  1IF1 A;  5J4V A;  3B73 A;  3HSE A;  1KU3 A;  1F4K A;  1QGP A;  4CO8 A;  3M3Y J;  1C0W A;  4WXD A;  1TWC J;  2RAE A;  5FD6 A;  3J7A O;  2XSJ C;  2GA1 A;  3CCS I;  4KN7 X;  3NEU A;  4HBL A;  5K5O A;  5ILV A;  3WTU C;  3OWT A;  4ZZD A;  2Y9Y A;  1FC3 A;  1FPQ A;  2XF7 A;  5DCM B;  4FQG A;  2H6B A;  2Y9Z A;  1IW7 F;  3JRC A;  1Z21 A;  3ONQ A;  1KU7 A;  2XB5 A;  3CTA A;  4ETS A;  3IRR A;  4HF1 A;  1XCV A;  4IHY A;  3HRM A;  2JRT A;  3C2B A;  3HOX J;  5D4R A;  3A0H C;  5D8L B;  2OZ6 A;  2NNN A;  2Y0S N;  1HKT A;  4ASN A;  2VQH A;  3M8F A;  2CQN A;  3PSF A;  3TDZ C;  1Z6R A;  5IT9 K;  2R7U A;  2VKE A;  3G3Z A;  1L0O C;  4N4O B;  4A0Y A;  4DBR A;  2GXB A;  1E2X A;  4MLO A;  4YEJ A;  3K7A J; 
#chains in the Genus database with same CATH homology
 2FBI A;  3PQJ A;  1XSD A;  1G3T A;  3ZPL A;  3I59 A;  2WTE A;  2DI3 A;  3IKT A;  3GLX A;  4JQF A;  5D6E A;  3IL2 A;  4HOB A;  1SFX A;  5KK1 A;  3FMR A;  4WK8 F;  3Q9S A;  4LD5 A;  2ZCW A;  4EGY A;  3IKV A;  1G4D A;  4LB5 A;  2H09 A;  1LDD A;  1W7P A;  3EYI A;  3FF5 A;  1YYV A;  2EJR A;  2V9V A;  5JHU A;  3IHU A;  1Z6T A;  5LGN A;  4DNC A;  1LEB A;  1ZGJ A;  3K1P A;  2XAG A;  1R00 A;  2JZY A;  4XLN F;  4EJO A;  3V7C A;  3KP5 A;  2CO5 A;  4R79 A;  3Q5F A;  3RTR A;  5DUI A;  2XIG A;  1XSV A;  3G73 A;  1Z05 A;  4U7D A;  2XRO A;  2YU3 A;  3O3K A;  3WOD F;  3KEO A;  5DD8 A;  1BIA A;  4ESJ A;  4L0Y B;  4EGZ A;  3U1D A;  1S3J A;  4YIF A;  3WTT C;  3CUQ A;  1IN7 A;  3I64 A;  3S2W A;  4A2U A;  2PBI A;  3I54 A;  4I0A A;  4BHC A;  4YFN F;  1FX7 A;  4ZH4 F;  2FMY A;  2WC2 A;  3ZQ7 A;  4ENM A;  3BJ6 A;  2P8T A;  3IC7 A;  1FT9 A;  2ZXJ A;  1XD7 A;  3ML6 A;  3VFZ A;  4XSZ F;  3E97 A;  2Z9O A;  3HRU A;  4G7H F;  4A0Z A;  2IW5 A;  2Y48 A;  4UHT A;  4KT5 C;  2V1U A;  1XSX A;  3FMQ A;  2MH2 A;  3HRT A;  2H27 A;  3J81 K;  3WU0 A;  2W85 A;  2XAQ A;  6PAX A;  4L9N A;  1J7K A;  1F1Z A;  3TO9 A;  4CGZ A;  1XDS A;  4GXO A;  4G7Z F;  2L01 A;  3BWG A;  5BOX A;  1XN7 A;  3QPH A;  5LHG A;  3LFK A;  1ZAO A;  3GZ5 A;  1YLF A;  3AAF A;  2D1V A;  2Z5U A;  3KP6 A;  2M5W A;  2OA4 A;  1MDM A;  2MLG A;  3WGI A;  4HQM A;  4MEX F;  3KP3 A;  2L54 A;  4PGG A;  2HR3 A;  1JXS A;  2BGC A;  5JR3 A;  5D6F A;  1ZG3 A;  1QO0 D;  2VN2 A;  2STW A;  4A0X A;  2A5Y B;  5TRD A;  1KGS A;  1OYY A;  2P5L C;  1SMT A;  2KIF A;  1P4A A;  3R0A A;  5FO5 A;  3K2Z A;  1T2K A;  2DU9 A;  4MEY F;  4LMY A;  4M9X A;  4HQE A;  5LGT A;  3ZN1 A;  5DD4 A;  1TLH B;  1AWC A;  4KMU X;  5FGM A;  2EA2 A;  2OBP A;  5H20 A;  4LG0 B;  1U8R A;  2KJB A;  3GWZ A;  3SFZ A;  5E8G A;  3GX4 X;  3CO7 C;  3F23 A;  2W24 A;  4U0Y A;  4EQQ A;  1WQ2 A;  3BZ6 A;  1RIO H;  4KIC A;  4HDV A;  1O3T A;  1FP1 D;  2Z99 A;  2IA2 A;  3FM5 A;  4BHP A;  1LB2 A;  2YX7 A;  2ACJ A;  2MD5 A;  5K1Y A;  1OYW A;  3TDU C;  1QPM A;  1OR7 A;  4AVP A;  1IXS B;  2LNB A;  1ZHF A;  5BS6 A;  3K69 A;  4U7B A;  1S6L A;  1I5Z A;  2FU4 A;  2HYG D;  1YTY A;  1R58 A;  3SHF A;  1A04 A;  2QQ9 A;  1R22 A;  1IXC A;  2FML A;  2HQR A;  3QPT A;  2HDC A;  3RIR A;  3E5Q A;  4MGR A;  2YSR A;  2VXZ A;  3F8C A;  1XGM A;  2JPC A;  4YFK F;  5HLH A;  1RNL A;  5DEQ A;  2CSO A;  3WGH A;  1RI7 A;  2EFP A;  2W84 A;  4EMS A;  4E70 A;  3DF8 A;  4HF0 A;  3BPV A;  2VBZ A;  3QU6 A;  2EV0 A;  4O6J A;  3T8R A;  5D5U B;  2QZ8 A;  4YFX F;  3KCC A;  4R8H A;  2XAH A;  3M8E A;  3HSR A;  2DLL A;  3I59 B;  3KP7 A;  4EM2 A;  1J9I A;  1BI3 A;  3M9A A;  1J59 A;  3V4G A;  4KIF A;  4Z2Y A;  3GZ6 A;  4CHU A;  2AXL A;  4OMY A;  2DPU A;  3EDP A;  4HW0 A;  3C7J A;  3GFL A;  1W7P B;  4L5J A;  2NNY A;  5A2Q K;  2OAZ A;  5AIP A;  5HLI A;  3LA3 A;  5EEH A;  2EB7 A;  2HGC A;  3TKY A;  2UWM A;  4EJV A;  3V8J A;  2YR2 A;  1XDU A;  3E6C C;  4BAY A;  1UHM A;  1ZH5 A;  2A68 F;  3GF2 A;  4G94 A;  2F5E A;  5FFX A;  2OD5 A;  2E1C A;  2M45 A;  3CUQ B;  4HAM A;  3KLN A;  3R61 A;  3T0Y A;  2ZJ2 A;  2YX4 A;  3HHG A;  4XRF A;  3I5U A;  1KA8 A;  1U5T A;  2XAJ A;  1KQ0 A;  3F8B A;  2FQ3 A;  3SQN A;  1I6X A;  1I1G A;  3JSO A;  4KNY A;  4I02 A;  4P9U A;  1W7P D;  3WE2 A;  2JTV A;  2K7L A;  4Q47 A;  4RGR A;  3DXJ F;  1ZRF A;  4Q4Z F;  3WTZ A;  4IVN A;  1J75 A;  1H9T A;  1MGT A;  1MJ9 A;  2K4J A;  4JK1 X;  4M6Y A;  3WG9 A;  1SFE A;  2OQR A;  4RAZ A;  2EFW A;  1K78 A;  3KP2 A;  4WWC A;  1XMA A;  1WKM A;  4A6E A;  4UUV A;  4S04 A;  1SAX A;  3O6B B;  4MTD A;  1O3S A;  2H94 A;  4BHB A;  4PZJ A;  3WTW C;  4G6D A;  4L9T A;  2DQR A;  4EJW A;  2XVC A;  1ZRE A;  2FBH A;  4IJA A;  5HS9 A;  5K5R A;  3ELK A;  2TDX A;  2HKO A;  2DTR A;  4I01 A;  1YIO A;  1BI1 A;  1YW8 A;  4UXN A;  4P9F A;  3L7W A;  1S29 A;  3T5X A;  1T98 A;  1GVJ A;  2IA0 A;  1FNN A;  4PDK A;  1S8N A;  2HTS A;  4FT8 A;  1MDM B;  1KU9 A;  2Z33 A;  2J5P A;  4ZYD A;  4OIO F;  1KQ8 A;  2FOK A;  3LQR A;  2BBY A;  3FHZ A;  4BH9 A;  1FYL A;  3T8T A;  1FSE A;  2IRF G;  1Z9C A;  5J8F A;  1O7L A;  1R5H A;  4UVC A;  4FX4 A;  5BPI A;  1Z91 A;  2L02 A;  5ICG A;  2E7W A;  3BP8 A;  2UXX A;  4HX8 A;  1UB9 A;  4RB3 C;  5J6X A;  3LST A;  1EH6 A;  3J81 Z;  2MLK A;  2D2W A;  3KP4 A;  2F2E A;  5BQT A;  4EV0 A;  2FNP A;  3HOT A;  3FXU A;  2FSW A;  3KZY A;  1ULY A;  3K1M A;  2PI0 A;  3COA C;  1HW2 A;  3F72 A;  2XGX A;  3LA7 A;  3KET A;  3E5X A;  2G7H A;  3TGN A;  5L3E A;  1PUE E;  4LGW A;  1B9N A;  4A5M A;  2FBK A;  2PEX A;  2LKP A;  2L4A A;  2HQN A;  2FRH A;  1FBS A;  4EJU A;  4L18 B;  2PJP A;  5L3C A;  1LJ9 A;  4HV5 A;  3HRS A;  1T0F A;  5CJ9 A;  4U0V A;  1B6A A;  3DFG A;  2BYV E;  3F8F A;  4IF4 A;  3C18 A;  3GUD A;  2QM3 A;  2CGP A;  1V3F A;  4K2E A;  4ENN A;  2OZU A;  3GFJ A;  4Y15 A;  3E5U A;  2ADU A;  3MZY A;  3WTY C;  2J5O A;  1GHC A;  4MQV A;  2IT0 A;  2COM A;  4HA8 A;  3RKY A;  4OIR F;  1F9N A;  3HSF A;  4A6D A;  2ZME A;  4RB2 C;  4ENK A;  4OIQ F;  4P96 A;  1YS7 A;  1YQA A;  3PFI A;  2G7U A;  4TV7 A;  4WF2 A;  2W57 A;  2VT3 A;  2Y75 A;  1LDK B;  2EFQ A;  2R7F A;  2JSC A;  1MJB A;  2L4M A;  4EJT A;  2HKX A;  4KUM A;  1BIB A;  3C3W A;  1SFU A;  2QQA A;  1Z1D A;  2ESN A;  3JSP A;  2VC1 A;  5LRR A;  3K0L A;  4I0B A;  2CG4 A;  4KN4 X;  3H3Z A;  3Q9V A;  3J80 K;  2EA4 A;  4GO1 A;  2H6C A;  3R4K A;  2CWE A;  3KEQ A;  1U3E M;  4M72 A;  2XKO A;  3QP6 A;  5CVR A;  3GEZ A;  2NRA C;  4EM0 B;  4HLY A;  1IN8 A;  2ZKZ A;  2KIU A;  4HDU A;  5LGU A;  3LA2 A;  4YG2 F;  4GGG A;  3CUO A;  3HTU A;  4BQA A;  3DPT A;  4KFC A;  4N9H A;  5E18 F;  2QBY A;  4IHT A;  1EV7 A;  1PP8 F;  3BOQ A;  1R7J A;  4NB5 A;  5ICC A;  2VOO A;  1F5T A;  4LLL A;  2P5K A;  3V7R A;  3HTS B;  3BDD A;  1R1V A;  2ZNY A;  1DDN A;  4IHS A;  4M74 A;  3CJN A;  3RJP A;  4KA4 A;  3ECH A;  2C6Y A;  5D5W B;  2V79 A;  5IT3 A;  4L5I A;  1B59 A;  1TQP A;  3L9F A;  2QWW A;  3JTH A;  3W6J B;  1EH8 A;  4U88 A;  2FF4 A;  1U5T B;  2F5F A;  3F8M A;  2MA3 A;  2GWR A;  5E1X A;  3IWF A;  3JTG A;  1USS A;  1BC7 C;  3ZMT A;  2G9W A;  4M9Z A;  3RDI A;  3QP5 A;  1FY7 A;  5LHH A;  5A2Q Z;  5JFR A;  3MZH A;  1SD6 A;  2RKH A;  1MJA A;  5HVQ C;  3EET A;  1ZG5 A;  3ABU A;  1GXP A;  2Q2E A;  4M73 A;  4B09 A;  2DBB A;  3OV8 A;  3MWM A;  4A12 A;  5AIQ A;  4B8X A;  1FSH A;  5ICE A;  5E17 F;  3JAM K;  1QZZ A;  1O3Q A;  5HOO A;  1TTY A;  1IAW A;  3FXQ A;  3I0T A;  1B9M A;  3KLO A;  1MD0 A;  2XAF A;  1RZ4 A;  5LHI A;  4OU0 A;  1OMI A;  2KIM A;  3GFM A;  3FX3 A;  1KQ9 A;  1Z7U A;  3GVA A;  1ON1 A;  2KRF A;  4QLC U;  4Q48 A;  5CYV A;  2B0L A;  2V1D A;  1DPU A;  1JGS A;  1ON2 A;  2P5V A;  2LDU A;  2CFX A;  2QYO A;  2ETH A;  2MBF A;  4MNU A;  2O03 A;  3M7G A;  1FBU A;  3R0J A;  4H0E A;  1BC8 C;  1D8K A;  1DP7 P;  1L3L A;  5L3D A;  2DW4 A;  2GXG A;  5D5V B;  2CQK A;  5EEG A;  4CXF A;  4P5O A;  2ZFW A;  1JHH A;  1YG2 A;  1SMY F;  5E1Z B;  1FP2 A;  3F22 A;  2ELH A;  2OQG A;  3VEP A;  5DYM A;  1B1B A;  5E8I A;  2VOP A;  2EFO A;  4F7Z A;  3ECO A;  4KMF A;  2E1N A;  3RPU A;  4BXU A;  4WXC A;  1HXD A;  1P4X A;  3MCZ A;  4IXA A;  4M71 A;  2HEO A;  4ZYG A;  2VE8 A;  4LK1 F;  3T1B A;  2A61 A;  2P4W A;  2K4B A;  1IZ1 A;  2IJL A;  3ZMS A;  1SD7 A;  2FA5 A;  4BNC A;  2DO7 A;  3K9T A;  5DCF A;  3HUG A;  5D4S A;  3ABT A;  3M1E A;  2L3D A;  2HFH A;  3B02 A;  1UHW A;  2ZME B;  4HLX A;  3KE2 A;  3V7S A;  3PQK A;  2PQ8 A;  3C1D A;  2CYY A;  3H92 A;  2VC0 A;  2QQB A;  4U0W A;  4NHJ A;  1LEA A;  4OMZ A;  4Y17 A;  2UXN A;  2P7C B;  1DUX C;  2K27 A;  4HF2 A;  1BBY A;  5L3F A;  3VB2 A;  2PLY A;  5DV5 A;  1HKQ A;  5ILU A;  4G7O F;  5TJJ A;  4RGS A;  4GYG A;  3F6O A;  1R36 A;  4QWQ A;  5HDK A;  3V8L A;  2O8X A;  3R60 A;  3DV8 A;  1J5Y A;  4LFU A;  4AIK A;  2Q8K A;  3LWF A;  3I4P A;  5KVR A;  4AIH A;  2EV5 A;  2QBY B;  1O3R A;  4RGU A;  2DFI A;  1FWZ A;  1AOY A;  2ZNZ A;  5J8C A;  3DPL C;  1OKR A;  3V8K A;  4AIJ A;  2E7X A;  1BM9 A;  4RGX A;  2F5C A;  5CVV A;  5F6F A;  4PCQ A;  4OIP F;  5HLG A;  3IWZ A;  4IPA A;  5E1W A;  1IXR C;  2O6G E;  5ED4 A;  1XMK A;  2A07 F;  2XV4 S;  3ISP A;  1ZLK A;  2YPR A;  2OU2 A;  2GA2 A;  3J80 Z;  2LF8 A;  3QU3 A;  2D1H A;  3WE3 A;  3TO6 A;  1ZAR A;  1JHF A;  4LB6 B;  2NS0 A;  1NHA A;  5JVT A;  4G6Q A;  1QBJ A;  3SZP A;  1J2X A;  5H6R A;  4XLP F;  2X0L A;  1I27 A;  1UFM A;  3L2C A;  2RVC A;  5DUK A;  3ZMD A;  3KZZ A;  1VTN C;  5L3G A;  3P9K A;  3SZT A;  4ZYH A;  2IP2 A;  4AWX B;  4GYI A;  1BOA A;  4ZZL A;  1P4W A;  1WI9 A;  1XGO A;  3GFI A;  3ZMV A;  2QEN A;  2HYF A;  3ZMZ A;  5HDN A;  1ODD A;  2DT5 A;  3ERE D;  4G9Y A;  3DQV C;  5CVU A;  2M1B A;  2NAZ A;  1D8J A;  4HX4 A;  5ERI A;  5FLX K;  1UST A;  1W4M A;  5ILS A;  4DQ2 A;  1LDJ A;  4LLN A;  1G3W A;  1HBX G;  4HYE A;  2GIV A;  2RGV A;  4IRI A;  4AD9 A;  3FWE A;  1HST A;  2RNJ A;  1ONV A;  1W5S A;  2A6H F;  1HKS A;  1HQC A;  2HZT A;  3NRV A;  4HX7 A;  2P6S A;  4UV8 A;  3N97 A;  2XKP A;  2AS5 F;  2RC4 A;  1XB4 A;  1D3Y A;  3HOS A;  4WXH A;  3F6V A;  2QLZ A;  3SXY A;  2DPD A;  4WX9 A;  1KYZ A;  4LJZ F;  5CVJ A;  2A6E F;  2Z3Y A;  3CUQ C;  4N0B A;  1XGN A;  3E6M A;  3U2R A;  2DK5 A;  2K02 A;  4LK0 F;  1S7O A;  1WWX A;  5FD5 A;  5D8K B;  4CZZ A;  2X4H A;  1CF7 A;  4CDG A;  4O5V A;  2O0Y A;  1REP C;  3CLO A;  2BE5 F;  2HWV A;  1G3S A;  1FZP B;  4MQ9 F;  5H6Q A;  3JAM Z;  3EUH A;  3FMS A;  4G8X A;  3F8N A;  4KYW A;  3DP7 A;  3FM3 A;  1LVA A;  2FE3 A;  3H3U A;  1BI0 A;  3MAJ A;  1IRG A;  5ICF A;  3QAH A;  4JBA A;  3LAJ A;  4XSX F;  3QRF F;  1U6G A;  1O7F A;  4UVB A;  2V1X A;  1R23 A;  2WWY A;  1IN4 A;  4LLG F;  3O2P E;  1O57 A;  1QZY A;  1WSU A;  4IRH A;  1GXQ A;  2XAS A;  1Y0U A;  2UZK A;  3D0S A;  3RYR A;  3TOB A;  5AON A;  2VBY A;  3RPQ A;  4OIN F;  1ZG1 A;  5F64 A;  3N4M A;  2EV6 A;  3P9C A;  4M9S A;  1TW3 A;  5LEK A;  1R5G A;  5HDG A;  1G3Y A;  3BJA A;  1IUY A;  2JT1 A;  2XHK A;  3WU1 B;  2Q0O A;  2CW0 F;  4CYD A;  3ZMU A;  3W6K B;  1P2F A;  2VE9 A;  1S7A A;  2DQL A;  2ISZ A;  1U78 A;  1LQ1 A;  1EH7 A;  3BJO A;  2VBX A;  1LNW A;  2KKO A;  3L09 A;  4RS8 A;  2GQQ A;  3WTV C;  4KDP A;  2ZO4 A;  3NQO A;  3BPX A;  2QUF A;  4EVI A;  5DDG A;  2RDP A;  1R1T A;  3WTX C;  2M87 A;  2EK5 A;  1SD5 A;  2IPQ X;  5DCM A;  3GW2 A;  3D5L A;  3HHH A;  4L9J A;  2MH9 A;  1H0M A;  1YW7 A;  2QVO A;  5HS8 A;  4M6X A;  2O61 A;  1IN6 A;  1K78 B;  2W25 A;  2O3F A;  1FYK A;  3I71 A;  3ULQ B;  2BV6 A;  3GXO A;  2M8E A;  3VOD A;  1PP7 U;  4P55 A;  1MKM A;  5CVI A;  4GCV A;  3LQQ A;  1SD4 A;  4PGH A;  2LSO A;  1G6N A;  1TNS A;  2GZW A;  4Y13 A;  1T38 A;  1HSJ A;  3F3X A;  1MZB A;  2A3S A;  2HS5 A;  1K6O A;  1V4R A;  3ROU A;  5BPD A;  1YO5 C;  1JE8 A;  4RB1 A;  3E6D A;  1K79 A;  3I53 A;  2PMU A;  1FOK A;  2HTJ A;  3HYI A;  2IA1 A;  1FBQ A;  2ISY A;  4ZYE A;  3RYP A;  5HS7 A;  5L3B A;  2DK8 A;  2RQP A;  1IN5 A;  5FB2 A;  1P6R A;  2F5D A;  5LEJ A;  5BMZ A;  2RN7 A;  2JPB A;  1XGS A;  5LLQ A;  5LRS A;  2DAO A;  3BY6 A;  4KIB A;  1ZRC A;  1KYW A;  1U2W A;  3DKW A;  3EYY A;  1R1U A;  3I58 A;  3KFW X;  3R6S A;  1T39 A;  2M30 A;  3FXR A;  4CIC A;  4FHT A;  4I98 B;  1IRF A;  1ZN2 A;  3ZP5 A;  2P7V B;  3TO7 A;  3F21 A;  1X3U A;  3HIF A;  1QNT A;  4S05 A;  2IVM A;  1HW1 A;  1OPC A;  1UCR A;  2MC3 A;  3TOA A;  3MEX A;  2FEZ A;  5LBQ A;  3RI4 A;  2FNA A;  1K7A A;  2XUB A;  4KIG A;  1TNT A;  3QOP A;  4ESF A;  4N9I A;  1H9G A;  3WGG A;  2R3S A;  2KJC A;  2STT A;  4MHG A;  5JI6 A;  1BN5 A;  2FXA A;  1TQM A;  2V6C A;  3CO6 C;  1ZRD A;  1ZLJ A;  2GAU A;  1J0R A;  3MQ0 A;  4A5N A;  1CGP A;  2ESH A;  1WRJ A;  4WCG A;  4BYY A;  2RV8 A;  1HW5 A;  1YFH A;  4O3M A;  2K86 A;  1Q1H A;  2PN6 A;  4UVA A;  2ZBK A;  1FYM A;  3MFK A;  1TQI A;  1U5T C;  4EM1 A;  4IRG A;  2VBW A;  5CLS A;  1TBX A;  1CF7 B;  2BEO A;  5IT9 Z;  5FLX Z;  1D5V A;  3P7N A;  1STZ A;  2VOD A;  1BI2 A;  3E3V A;  4I7H A;  1YS6 A;  3BRO A;  1DPR A;  3ZN0 A;  2P6T A;  2XRN A;  3OOP A;  4Q5S F;  1QQI A;  2EWN A;  2NYX A;  1KU2 A;  2PFB A;  4MTE A;  5K5Q A;  3DEU A;  1B4A A;  3GO5 A;  3EQL F;  3RKW A;  2WV0 A;  1FLI A;  2PG4 A;  2HOE A;  3VOE A;  1W5T A;  4UNO A;  4FX0 A;  4UV9 A;  4I09 A;  3P9I A;  1RUO A;  2PMH A;  2VT2 A;  2D45 A;  4LG0 A;  1XCB A;  1RUN A;  3IRQ A;  5D5X B;  1ZYR F;  3RKX A;  4HV6 A;  4ESB A;  4ON0 A;  1TW2 A;  1E17 A;  5FFZ A;  1OYI A;  5E20 A;  3REO A;  3L00 A;  2VON A;  3TQN A;  3GYH X;  2LF7 A;  4L0Z B;  1I1S A;  4ENJ A;  1BJA A;  3K1N A;  5F1R A;  1YW9 A;  3LAP A;  4I2O A;  1ZGA A;  3E6B A;  3FZV A;  4RAY A;  3U9G A;  4YII A;  3WTS C;  1P92 A;  4D0P A;  3CDH A;  1PDN C;  1T6S A;  2Y0M A;  4HZF A;  2R7D A;  4RB0 A;  3JW4 A;  2A69 F;  2EFN A;  4R1H A;  4OOI A;  4XBF A;  4NQW A;  4L9V A;  1IF1 A;  3B73 A;  3HSE A;  1KU3 A;  1F4K A;  1QGP A;  4CO8 A;  1C0W A;  4WXD A;  5FD6 A;  3J7A O;  2GA1 A;  4KN7 X;  3NEU A;  5K5O A;  4HBL A;  5ILV A;  3WTU C;  4ZZD A;  1FC3 A;  1FPQ A;  5DCM B;  2H6B A;  1IW7 F;  1KU7 A;  3CTA A;  4ETS A;  3IRR A;  4HF1 A;  1XCV A;  3HRM A;  2JRT A;  5D4R A;  5D8L B;  2OZ6 A;  2NNN A;  1HKT A;  4ASN A;  3M8F A;  3TDZ C;  1Z6R A;  5IT9 K;  3G3Z A;  1L0O C;  4A0Y A;  2GXB A;  1E2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...