2PMUA

Crystal structure of the dna-binding domain of phop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
VRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the DNA-binding domain of the response regulator PhoP from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulation
molecule keywords response regulator PHOP
total genus 25
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pmuA00
2HOEA 3HIFA 3T8TA 4B8XA 2UZKA 4MQ9F 2JT1A 5FFXA 1YG2A 1ODDA 3ZMSA 2HYFA 2L4AA 4AWXB 2VT3A 2L01A 1CF7A 2ISZA 1YIOA 2HS5A 2IJLA 3VB2A 4U0WA 2ZMEA 1K79A 5FFZA 1FLIA 4BH9A 3V8KA 3SZTA 5JR3A 2MD5A 1IRFA 1SD6A 2PLYA 2DU9A 4LK0F 1XDUA 4L9VA 2V1UA 2EFPA 3ISPA 4BXUA 2Z3YA 2L54A 5D5VB 1WI9A 2V6CA 3L00A 2CW0F 3TO9A 3D0SA 4EJVA 3P9KA 5J6XA 4QWQA 2PBIA 2UXNA 1LDDA 1BI2A 1I6XA 1Z1DA 1VTNC 3KP7A 1P4XA 3R0AA 2GWRA 4Q4ZF 1TQPA 1ZLKA 3J7AO 2WV0A 3I53A 3J81K 1IN4A 3L7WA 4EV0A 3P9CA 1OYWA 1SFUA 1SD7A 1MJBA 1QZZA 1XMAA 4CHUA 3F8CA 4HYEA 3I59B 4P55A 4P96A 3HRTA 2DK5A 3VEPA 2YSRA 4KMFA 1OR7A 1TQIA 3GLXA 2O6GE 1WWXA 2CSOA 1DPUA 1OKRA 2QLZA 2K86A 3CO7C 4XLPF 3GO5A 2W25A 3FXRA 3M7GA 2ZNYA 3V7RA 3HOTA 3K0LA 2LF7A 1PDNC 2DLLA 5H6QA 3DXJF 5ICGA 3LAJA 2Y48A 1ZAOA 2GZWA 5F64A 2A68F 2CFXA 2QVOA 3W6KB 5DV5A 1LNWA 1FZPB 1LDJA 5K5RA 2VONA 1IUYA 1I1SA 3O6BB 4IXAA 2IT0A 1IZ1A 4IVNA 2MBFA 4BQAA 2GAUA 1XSVA 4ENJA 3F3XA 1R36A 4AIJA 2EFWA 2DO7A 1IXCA 1HKTA 3FX3A 3TDUC 4G94A 1ZARA 4WK8F 3KZZA 4ZYEA 4BHPA 1BBYA 4I01A 1XB4A 2E7WA 1S7AA 2ZCWA 2EK5A 1FYMA 1ZREA 2RVCA 4P5OA 1SAXA 4D0PA 5J8CA 4DQ2A 3BY6A 4WX9A 5CVJA 4HV5A 2ACJA 2KRFA 1HKQA 1IN8A 2Z33A 5HLGA 3TO6A 2IRFG 3GEZA 3Q9SA 2MH9A 2GA1A 2QUFA 3F6OA 1HW1A 4RGSA 2M87A 1BI1A 4XLNF 3NEUA 3HYIA 4MNUA 2YPRA 1HXDA 3RKYA 3MWMA 3LA7A 3WTSC 4N9IA 2LKPA 3FM3A 1HBXG 1ZRFA 1R1VA 3FXQA 5CJ9A 5K5OA 5ILSA 3W6JB 3IWFA 2EA2A 2W84A 3KZYA 5HDKA 3O2PE 1KU9A 1BI0A 3HRUA 4YG2F 2BEOA 5LRSA 3IHUA 4G6QA 1FSHA 2MH2A 1B9NA 4E70A 3WTWC 3F21A 3DV8A 3JTHA 2VBYA 4OIQF 2D2WA 2IVMA 4PDKA 1U3EM 3D5LA 2G7HA 2C6YA 1E2XA 1G3SA 4M9SA 1RI7A 3ZN0A 4NB5A 1MKMA 2XKPA 1DDNA 1IW7F 5LBQA 2P6SA 3FMRA 2MA3A 2EA4A 3WTVC 4KFCA 1FBQA 3KP3A 3N97A 3MEXA 5H20A 1KQ0A 1T39A 2A6EF 2RGVA 3U2RA 2E7XA 2FBIA 3T0YA 4OIPF 3IL2A 1MGTA 1U6GA 5DDGA 4IRGA 1J75A 4CICA 3RTRA 1S6LA 1MDMA 5KK1A 3EDPA 2R3SA 1R5HA 2D45A 1R23A 5LGTA 1FPQA 5DD8A 2H09A 1IN6A 2EFNA 3R6SA 2VBZA 3F6VA 4OINF 4F7ZA 4JQFA 2FBHA 1JHFA 5E18F 1TW3A 3J80K 1A04A 2P6TA 3IC7A 1USTA 2FSWA 3F8BA 4HDVA 3CUQB 2MC3A 3GYHX 2OZ6A 3DFGA 3MCZA 2ETHA 1BC8C 2L02A 4KNYA 1TQMA 2BYVE 4OIRF 2RC4A 1USSA 2VODA 3BZ6A 2HEOA 5LHHA 1T2KA 4PGHA 5L3CA 4NQWA 2HQNA 1I5ZA 5ICFA 4CDGA 5LEKA 3JSOA 2M5WA 3KEOA 3MZHA 1OPCA 4FT8A 4L0YB 4EVIA 4PCQA 1F5TA 4MQVA 4WXDA 1RUNA 5K1YA 4WWCA 2JSCA 4A12A 4I0BA 1FSEA 3EUHA 3R4KA 1IAWA 3WE3A 4HAMA 3ZMVA 3IRQA 2JPBA 1KU3A 1FT9A 2ZNZA 2P8TA 5HDGA 2FE3A 4YFNF 2Y75A 3QPTA 3ELKA 2KIMA 1UHMA 1J0RA 4ZZLA 5HS8A 5D4SA 4ETSA 2A69F 4XSXF 2VBXA 4M72A 5IT3A 1HQCA 1FY7A 1P92A 2FU4A 2DW4A 1F4KA 3P7NA 1RIOH 3ZMTA 4GCVA 2FQ3A 1MDMB 4UXNA 3H3UA 3ZN1A 2F2EA 4RS8A 2GIVA 3WGHA 2XROA 3KP4A 2XAQA 5A2QZ 3IKTA 1J2XA 1GXPA 2NRAC 1J5YA 3OV8A 1XMKA 4XSZF 5F1RA 1KQ8A 3DEUA 4YFXF 1IN7A 1QGPA 1TLHB 2X0LA 3HSFA 3EYIA 3E5QA 1ZGAA 3HOSA 4EGZA 2PFBA 3FWEA 3QRFF 3GUDA 2DK8A 3FMSA 1Z91A 1D5VA 5FLXK 1T38A 1FBSA 2HFHA 3QU3A 5JI6A 3WU1B 4MHGA 1SMTA 2KJCA 1T0FA 1YW9A 3SHFA 2H94A 2FMLA 2HTJA 5E8IA 1YTYA 4ASNA 1DUXC 2OAZA 4O5VA 1LJ9A 3ROUA 3GFMA 1B6AA 3BWGA 5LLQA 2HGCA 3GVAA 4MEYF 4M6YA 1QNTA 4KIFA 4R79A 1W5TA 3KCCA 2BGCA 2JZYA 4I09A 2GXGA 1I1GA 3IWZA 1QO0D 2M30A 4PZJA 3V4GA 2DI3A 2VC1A 4QLCU 1MJ9A 5ILVA 3LQRA 1X3UA 1R1UA 3E5XA 2H27A 1PP8F 4H0EA 5HS9A 4G7ZF 4EM2A 1XGOA 4GGGA 1BJAA 4EJTA 2R7DA 5CVRA 3ZMDA 3IRRA 2FRHA 1UHWA 5CYVA 4N0BA 3KE2A 2V1DA 1P4AA 2W57A 1DPRA 3E97A 5D5WB 4OOIA 2W24A 1HW5A 4CO8A 4Y17A 3P9IA 4HF1A 2Q8KA 5HLIA 5L3BA 1TBXA 1XGMA 1XN7A 3Q9VA 2FMYA 3AAFA 3EETA 3I58A 4A6DA 5FD5A 2K4JA 3L9FA 1OYYA 2H6BA 1ZGJA 1W5SA 3F8NA 4HDUA 1QPMA 4LLNA 3KP6A 3QP6A 4U7BA 4RB0A 5D6EA 5J8FA 2IW5A 1KU7A 3HHHA 1W7PB 2X4HA 2HTSA 4JK1X 5D6FA 1J7KA 3FMQA 2OQRA 2HKXA 2ADUA 1CGPA 2FBKA 1Z05A 3R60A 3MFKA 2J5PA 3KEQA 4RB1A 3WTZA 4AIKA 3RKWA 4AVPA 1WQ2A 2Z99A 4L9NA 3LSTA 3QU6A 4KA4A 4PGGA 2FA5A 4L5JA 1LDKB 2OU2A 2PJPA 4R1HA 1FP2A 2M45A 2QQAA 5LEJA 1ZG3A 2VE8A 3K1NA 2QQ9A 2LDUA 5DCMB 3K1PA 1BIBA 2COMA 1XGNA 2NAZA 5HDNA 2Y0MA 4HBLA 3H92A 3TQNA 1JE8A 5D5UB 2RN7A 3I64A 2DQRA 3FHZA 1R1TA 1ONVA 3T1BA 1K6OA 2MLGA 3N4MA 1BM9A 4L5IA 3F23A 1ZG1A 3I59A 3K69A 1O3SA 3GWZA 2ZKZA 2P5KA 4YIFA 1RZ4A 2V9VA 2O3FA 1KU2A 2EV0A 2QYOA 3ZMZA 1S3JA 1H9GA 3KLOA 1BN5A 2R7FA 2HQRA 3L2CA 3GZ5A 3FF5A 3L09A 2AS5F 3KETA 2M1BA 3WU0A 1LVAA 3OOPA 4L0ZB 2DTRA 4RGRA 1T6SA 3DPTA 2VE9A 2PEXA 2EFOA 2FNAA 1QBJA 2OZUA 1B59A 2DPUA 5BPIA 3B73A 1P2FA 3FM5A 3RDIA 1V3FA 1FYKA 3Q5FA 2A5YB 3FZVA 3HRMA 4KIBA 1FNNA 2KIUA 2XIGA 1H9TA 4N9HA 1SD4A 4BHCA 5L3FA 3GFJA 3S2WA 4Q5SF 4M9ZA 1FWZA 4A0XA 2OA4A 2AXLA 1Z6TA 3VFZA 2J5OA 3HSEA 1YS7A 3LA2A 1Y0UA 1ZRDA 1RUOA 1REPC 1FOKA 1XSXA 2ELHA 1EH7A 1P4WA 4AIHA 5LHIA 2ZMEB 2ZO4A 1Z7UA 3CLOA 3GZ6A 1KA8A 1G3WA 2EV5A 2DFIA 3V8LA 3WE2A 4FHTA 3LA3A 4GXOA 1G6NA 4UVBA 3KP5A 4RGXA 5CLSA 4EQQA 2P7VB 2XAJA 2STTA 3LAPA 1Q1HA 4OMZA 4FX4A 5IT9Z 4Q47A 4A2UA 2RKHA 2XHKA 3TOBA 2BV6A 3K9TA 2FXAA 5ILUA 4MTDA 3B02A 3MQ0A 2EB7A 3TKYA 4IPAA 2JPCA 3ZMUA 1R7JA 5L3GA 4RB3C 3BP8A 4OIOF 3CO6C 4RAZA 4IF4A 3V7SA 5LRRA 5LGUA 4ESFA 4FX0A 1WSUA 1OMIA 2VOPA 2PI0A 2P5LC 5H6RA 4IJAA 1SFEA 4UHTA 2M8EA 3CUQC 4JBAA 2FNPA 3JW4A 4RGUA 4LLGF 5TJJA 4OMYA 2ESNA 4NHJA 3T5XA 4HW0A 5AONA 5JVTA 4G7OF 5F6FA 1D3YA 3BJOA 2A61A 1HSJA 3ABTA 2Q0OA 4EJOA 2ESHA 2A07F 3ULQB 2PG4A 3QP5A 2IP2A 2LNBA 5E1XA 4LB5A 2DAOA 1XDSA 4A0ZA 2L4MA 4Z2YA 1F1ZA 2P5VA 1HKSA 1Z9CA 1BI3A 4KDPA 4L9JA 5BOXA 4A5MA 3E6DA 3WTTC 3RPUA 3BOQA 4YIIA 4A5NA 2K02A 2E1NA 2FF4A 2D1VA 3ECOA 1ULYA 5FO5A 3PQKA 5D8LB 1STZA 4KYWA 2OBPA 2Z9OA 2BE5F 1XCVA 1G3TA 4HX7A 3EQLF 3WG9A 2QQBA 3LWFA 3R61A 1YLFA 5E8GA 5K5QA 2K7LA 4M6XA 5DEQA 5DUKA 5L3EA 2EWNA 4ENKA 1SMYF 5E1WA 3M9AA 2YX7A 3DQVC 3NQOA 2NYXA 2DT5A 4WCGA 2RNJA 1I27A 4GO1A 3DP7A 2CG4A 3BDDA 3CJNA 2D1HA 1S8NA 1BIAA 3EYYA 1D8JA 3RYPA 1ZYRF 5E1ZB 4ZH4F 1T98A 2WTEA 1SD5A 1U8RA 4OU0A 2OQGA 2ZXJA 3VODA 1AOYA 2B0LA 5HS7A 2GQQA 4UNOA 4LB6B 1W7PA 3JAMK 5LGNA 4LG0A 1U5TC 3U9GA 2KJBA 1BC7C 4G6DA 4B09A 1WKMA 4UUVA 3F8MA 4I7HA 3NRVA 2HDCA 1EH8A 2QENA 2WWYA 4EJWA 5L3DA 5ICEA 3I54A 3I71A 2ZJ2A 1L3LA 5JHUA 4UV9A 1G3YA 1G4DA 2G7UA 3ECHA 1O3TA 4UVCA 5DCMA 1V4RA 2P7CB 3RPQA 2CO5A 2HYGD 4EMSA 3M8FA 4UVAA 4LD5A 4WF2A 1YFHA 1F9NA 1ZRCA 2XKOA 2VN2A 2BBYA 2GXBA 2YR2A 3GF2A 3V7CA 3HSRA 4EGYA 2P4WA 3T8RA 2Z5UA 2CGPA 4KIGA 3GFIA 4ENNA 2H6CA 3CTAA 3WTXC 1HW2A 2WC2A 4LG0B 2O8XA 3KFWX 2O03A 3E6BA 2QZ8A 1FYLA 4M73A 2OD5A 1EH6A 4ESBA 5CVUA 4XRFA 2CWEA 4WXHA 4EJUA 1J59A 4IHTA 1FX7A 5BPDA 4MGRA 5JFRA 4HX8A 5ICCA 2F5DA 1D8KA 4YFKF 1DP7P 3RKXA 4MEXF 1ON2A 3TDZC 2ZFWA 2IA2A 4KICA 5DYMA 2V79A 4G8XA 1R00A 4UV8A 3C18A 1FBUA 1W7PD 1U5TA 3SQNA 1U5TB 2F5CA 3DKWA 3C3WA 1O3RA 3LQQA 3REOA 1CF7B 4AD9A 2ZBKA 2CQKA 3I4PA 3WTUC 1B9MA 1TTYA 3QAHA 1S7OA 1ZG5A 4ON0A 4ESJA 2VOOA 1GVJA 4HOBA 2IA0A 1U2WA 2JTVA 2XGXA 3E6CC 2RV8A 4LK1F 5AIPA 3HTUA 4BAYA 3J81Z 4R8HA 4I2OA 3H3ZA 2XAFA 3BROA 4HQMA 1K7AA 3MZYA 3BPXA 4HX4A 3F22A 5CVIA 3CUOA 3QOPA 3LFKA 3DF8A 1WRJA 1XCBA 2KKOA 2G9WA 5FD6A 4LMYA 4ZYDA 4XBFA 5CVVA 4A0YA 4M71A 4U7DA 5DUIA 3SFZA 3GX4X 1S29A 2MLKA 2EJRA 1YYVA 1B1BA 3F8FA 3SZPA 4LJZF 1MZBA 1PP7U 2PN6A 4Y13A 4LGWA 4LLLA 1MJAA 1YW8A 3E6MA 3VOEA 4G7HF 1KGSA 1UB9A 2NNNA 4L18B 2Q2EA 2QWWA 4M9XA 3BJ6A 2XRNA 2PQ8A 4HZFA 3GXOA 3M1EA 4Y15A 3WTYC 4EM0B 2PMHA 1ZHFA 4A6EA 2VXZA 1K78A 4IRIA 1O57A 5EEHA 2A3SA 1Z6RA 1PUEE 3CUQA 4GYGA 4LFUA 4BHBA 5DD4A 4RB2C 4GYIA 3RYRA 3RIRA 3RI4A 2O0YA 4CGZA 3MAJA 4ZYGA 2FEZA 5D8KB 5BQTA 1HSTA 2YU3A 2F5EA 1ON1A 1QQIA 3I5UA 3GW2A 4U88A 3CDHA 1P6RA 3G73A 4IRHA 1TNTA 3E3VA 1XD7A 2XUBA 4MTEA 3IKVA 1SFXA 1AWCA 2XAGA 2JRTA 4KT5C 1OYIA 5BS6A 3WODF 2NNYA 2K27A 2LF8A 4WXCA 1MD0A 2TDXA 3M8EA 2VBWA 5D5XB 3ABUA 4CZZA 3GFLA 3FXUA 1ZH5A 2STWA 4O3MA 1IRGA 5TRDA 4EM1A 4HA8A 4HLXA 1YQAA 4ZYHA 4HV6A 2VT2A 5FGMA 3KLNA 3TGNA 5DCFA 1UFMA 1YO5C 1FC3A 5AIQA 3F72A 3R0JA 3RJPA 1LQ1A 2HZTA 1J9IA 1H0MA 1U78A 4BYYA 4S05A 3TOAA 4BNCA 2EFQA 4TV7A 2EV6A 4O6JA 3SXYA 1O7FA 3BPVA 4HF0A 4M74A 1KQ9A 4KN4X 2KIFA 5IT9K 2XVCA 3HRSA 2L3DA 1GHCA 1R5GA 2W85A 1UCRA 3K1MA 1IXRC 3ZQ7A 4KUMA 1L0OC 2IPQX 4HF2A 3KP2A 2XV4S 1ZLJA 1TW2A 3QPHA 4L9TA 1RNLA 4Q48A 4ZZDA 1IF1A 5FB2A 2HWVA 1YS6A 1LEBA 3V8JA 5ERIA 3ZP5A 4RAYA 2HKOA 5E17F 1KYWA 3PQJA 3BJAA 3JTGA 2A6HF 3JSPA 5KVRA 1ZN2A 4U0YA 1IN5A 4P9FA 2F5FA 1IXSB 4KN7X 4DNCA 5ED4A 4G9YA 3WGIA 1W4MA 1R22A 1K78B 1YW7A 2HR3A 2FOKA 3O3KA 2RDPA 5FLXZ 2XASA 1O7LA 2QM3A 1GXQA 1LEAA 3I0TA 2UXXA 3C7JA 2DBBA 4I98B 4ENMA 2NS0A 3U1DA 2PMUA 2DPDA 3DPLC 2K4BA 3TO7A 2O61A 1KYZA 4CYDA 5E20A 3PFIA 5EEGA 1XSDA 3G3ZA 2YX4A 1XGSA 2XAHA 5HOOA 3ML6A 2LSOA 4HQEA 4K2EA 3J80Z 2RQPA 1QZYA 2VC0A 1BOAA 4U0VA 2QBYB 3HUGA 1JHHA 2QBYA 5A2QK 1C0WA 3ZPLA 3WGGA 1NHAA 3ERED 1TNSA 4S04A 4IHSA 3C1DA 4I0AA 1R58A 4CXFA 5LHGA 2GA2A 2ISYA 2IA1A 4KMUX 4I02A 5HLHA 3JAMZ 1FP1D 5HVQC 4P9UA 2UWMA 2CYYA 2V1XA 3HTSB 1E17A 2E1CA 3COAC 1B4AA 3HHGA 1JXSA 2DQLA 1JGSA 1LB2A 1EV7A 6PAXA 3K2ZA 5D4RA 4HLYA 5BMZA 1O3QA 3E5UA
chains in the Genus database with same CATH superfamily
2XAUA 2EINH 2HOEA 3HIFA 3T8TA 2HQ5A 1D1CA 4B8XA 2DJIA 4ANJA 2UZKA 4MQ9F 2JT1A 1P7JA 5FFXA 1YG2A 1ODDA 3ZMSA 1VFCA 1MIJA 1MBFA 1N75A 3NWSA 5K7HA 1FMWA 4CZCA 2DYRH 2JK3A 3QYEA 1G8XA 1XS9A 1VNDA 4W1UA 2HYFA 4BDYA 2L4AA 4L5EA 3OS1A 4AWXB 2VT3A 1BA5A 2L01A 4XN3A 1CF7A 4E7JA 2ISZA 1YIOA 2HS5A 2IJLA 3VB2A 4U0WA 2ZMEA 5E3OA 1K79A 5FFZA 1FLIA 4BH9A 3V8KA 3SZTA 3GTJJ 5JR3A 2MD5A 1IRFA 1SD6A 2BY0A 3G4SI 3W6VA 4BQNA 3J7AY 2EIJH 3S15J 2PLYA 2DU9A 3NAUA 4LK0F 4A3LJ 4MFEA 1XDUA 1KONA 3LFUA 4L9VA 1WJ5A 2V1UA 2GIZA 1PYVA 5BNGA 2EFPA 3ISPA 4BXUA 2Z3YA 2L54A 5DS9A 5D5VB 1WJAA 4XICA 1WI9A 2V6CA 2OCCH 3L00A 3QYBA 3RSNA 2CW0F 3TO9A 3D0SA 4EJVA 5LFAA 3P9KA 1TT0A 5J6XA 4QWQA 2PBIA 4AC0A 4EEFG 1EKEA 1LDDA 2UXNA 1BI2A 2VKEA 2ZJQF 1I6XA 4JOMA 1Z1DA 1VTNC 2XPVA 1TWGJ 3KP7A 1P4XA 3R0AA 3W2WA 2GWRA 2N8GA 3L2RA 4Q4ZF 2L9VA 2CV2A 1TQPA 2X1CA 1ZLKA 3J7AO 3TP0A 4V2GA 2WV0A 3I53A 2HOAA 3J81K 2W4SA 1IN4A 1IRXA 3L7WA 4EV0A 3H35A 2E2JJ 3CCSI 3P9CA 1OYWA 1SFUA 1V55H 1SD7A 1Y39A 3LSMA 1MJBA 3B6AA 4B43A 1QZZA 1XMAA 3VSKA 4CHUA 3F8CA 5DM7F 3S2DJ 4G6TB 3I59B 4HYEA 4P55A 5J3LA 4P96A 5FKNA 3HRTA 2DK5A 3VEPA 2YSRA 4KMFA 4XRSA 1OR7A 2LTPA 1TQIA 3GLXA 2JQ7A 2VJ5A 2O6GE 2A5WA 4PJ0C 1WWXA 2CSOA 1DPUA 1ZELA 1OKRA 2F6CA 2QLZA 4F55A 2K86A 3CO7C 4XLPF 3GO5A 3SDGA 2QSHX 1N25A 4Y52J 3S93A 2W25A 4XKWA 5IYBJ 3FXRA 1Y1VJ 1VQ4I 3M7GA 2ZNYA 2WB1N 3CCMI 1R49A 3V7RA 2CW7A 3HOTA 4E7SA 3K0LA 4DJAA 2LF7A 1PDNC 2DLLA 1UZCA 2DA1A 5H6QA 4BY7J 1LUJB 2HYJA 4BJ5C 3FXOA 3DXJF 4PJNA 5ICGA 3W2AA 2VXDA 1S72I 1E3PA 4IHXA 1RPWA 3LAJA 4PSXA 2Y48A 2LRDA 3A03A 1ZAOA 3ZQFA 3JRCA 2GZWA 5F64A 2A68F 4N4OB 1X3ZB 2CFXA 2QVOA 3W6KB 5DV5A 1LNWA 4E7KA 1WJBA 1FZPB 1LDJA 3PO3J 5K5RA 2VONA 2OTJI 5TGTA 1IUYA 1I1SA 1MMSA 3O6BB 1LKXA 2R7XA 5J4VA 4IXAA 4PJMA 2IT0A 1IZ1A 1EF4A 4IVNA 2A05A 2MBFA 4YIRX 4BQAA 2NOGA 2MFZA 2GAUA 1IDZA 1XSVA 3CLQA 3PUFA 2KDOA 3A0BC 1QU3A 4BJTA 2VLAA 2DA5A 4ENJA 1PUFA 3F3XA 1I50J 1T08B 5EG0A 1R36A 1YRNB 1BR2A 1JGGA 4AIJA 2EZKA 2EFWA 2DO7A 3N05A 2YUSA 1IXCA 1HKTA 3FX3A 5KNLA 4RM2A 3GLLA 3TDUC 3K10A 4BJ6C 4G94A 1ZARA 4WK8F 3KZZA 4G12A 3BCAA 2ZSHB 2OPTA 4ZYEA 2JJ7A 2RNGA 3GTMJ 4IZZA 4BHPA 2VKDA 2KHMA 1FOYA 1BBYA 4I01A 3S1RJ 3OYJA 4V19K 1XB4A 2E7WA 2VL8A 1S7AA 1MMGA 2KIQA 2EK5A 2ZCWA 1FYMA 1ZREA 1W1WE 1BW6A 2RVCA 4P5OA 4X0GA 1SAXA 4D0PA 1F36A 2ZC2A 1WFXA 4DQ2A 3BY6A 5J8CA 4WX9A 5CVJA 3FXLA 2WAQA 4HV5A 2EQRA 3JREA 1GV5A 3ZQGA 2ACJA 2KRFA 1HKQA 4D5FA 2DMNA 3C2BA 1IN8A 3HOWJ 4U87A 1JKQC 2Z33A 5HLGA 2JVGA 3TO6A 2IRFG 3GEZA 3Q9SA 2MH9A 2GA1A 2QUFA 4LOCA 1R5ID 3OYDA 3OSGA 3F6OA 1A6QA 2LG4A 4Y3OA 3HL2A 3GTLJ 4A3GJ 1HW1A 3EUHC 4RGSA 2EBIA 2M87A 1BI1A 4XLNF 1D1BA 4RM3A 5JHFA 2VQHA 3NEUA 4HG2A 2DYSH 3FXKA 3HYIA 4MNUA 3WU2C 1FTTA 2YPRA 3KYCB 1HXDA 1DGRM 3RKYA 4HNVA 4A93J 2QF7A 5TISC 3MWMA 3LA7A 3WTSC 4N9IA 4NBQA 1I6HJ 1QHGA 2LKPA 3FM3A 5E79C 1HBXG 1ZRFA 3OYMA 1R1VA 3FXQA 5CJ9A 4M6VA 3MKLA 2R5ZA 1K6YA 2B7EA 1UHSA 5K5OA 1QPIA 2E2IJ 1H89C 4E4HA 5ILSA 3W6JB 1DGWY 3IWFA 1OR7C 2EA2A 2X9DA 2W84A 3KZYA 5M5WJ 5FLVA 5HDKA 3O2PE 1BI0A 1KU9A 3HRUA 4YG2F 4XLHA 2GLOA 2BEOA 4CCLA 5LRSA 3IHUA 4F52A 3IUOA 3S1MJ 4G6QA 3H0DA 1FSHA 2MH2A 2HOTA 1B9NA 4E70A 3A0HC 3OR1C 2BY2A 1LE8A 2BW3B 3WTWC 3F21A 3CCRI 3DV8A 1H88C 3DLAA 2VBYA 3JTHA 4OIQF 3I4NJ 2D2WA 1WI3A 3ZCOA 2IVMA 4PDKA 3LNQA 3DEWA 3ZQQA 1BOBA 3AFHA 1U3EM 3D5LA 4X1EA 5IP7J 2G7HA 3SFIA 2C6YA 1E2XA 1G3SA 1QVTA 1HOMA 4FE7A 4M9SA 3A02A 2NVUB 1RI7A 1VQKI 3S16J 1ETYA 4NB5A 3ZN0A 4B44A 1MKMA 2XKPA 1DDNA 1IW7F 5LBQA 4J19A 1H8AC 3BG5A 2P6SA 3FMRA 3BCBA 2MA3A 2EA4A 3WTVC 4KFCA 1FBQA 3KP3A 3N97A 2DT6A 3MEXA 2E5ZA 4PFPA 2K9LA 4XR6A 3DTIA 5H20A 2EZIA 2DXIA 1KQ0A 1LFPA 1T39A 2RGVA 2A6EF 2LKSA 3U2RA 2E7XA 4AYBN 2FBIA 3T0YA 4OIPF 1MMDA 1X1BA 4CCNA 3BG6A 3MKWB 2F48A 1QZEA 2DMTA 2DA2A 3SDBA 3IL2A 4ZDPA 2H8RA 1MGTA 1U6GA 2HXIA 5DDGA 2ZMEC 2KDZA 5JLWA 3MZ8A 3F0CA 3GZNB 4IRGA 1YE9A 1A31A 5B3SH 3P5JA 3CCJI 3RPUD 1J75A 4CICA 4M3BA 3RTRA 1S6LA 3JRIA 1MDMA 2QSFX 4ZTFA 5KK1A 3X2QH 2M2EA 1NH3A 3QQAA 1U9OA 4XQFA 3FIWA 1W36C 3I56I 1IV6A 5FKOA 3EDPA 2R3SA 1W0UA 4CH7A 1R5HA 2D45A 3GTKJ 1R23A 1WJEA 5LGTA 5GP9A 2ELKA 4BEHA 1FPQA 5DD8A 2XSJC 2JUCA 1JUMA 4F93B 2Y30A 1GLNA 2LH9A 2H09A 4ZDOA 1MBEA 1RC9A 3LSGA 5C3EJ 1IN6A 3DU6A 2EFNA 3R6SA 2VBZA 2ZB9A 2MABA 4HSTA 2I5UA 3F6VA 5EZGA 2W48A 4XLCA 3PL8A 4FISA 4Y7NJ 4BDZA 4OINF 1IRZA 4HNTA 4F7ZA 4JQFA 5F08A 2DODA 4Y4RA 2FBHA 1JHFA 2R7VA 5E18F 3PUBA 4CA0A 4B48A 1TW3A 1MBKA 1XX5A 3J80K 1A04A 2P6TA 3C2HA 1TT5B 3IC7A 4AU7A 1USTA 2FSWA 1DP3A 3F8BA 4HDVA 2K3PA 3CUQB 1TWAJ 2L5QA 3LOCA 2MC3A 3GYHX 2OZ6A 3DFGA 3MCZA 2XDVA 3ERMA 2UV1A 1VQ6I 3HOUJ 2ETHA 2LD5A 2KL4A 1G2HA 1BC8C 2L02A 1SAUA 1Z3XA 4GFBA 1X19A 4KNYA 3UKGA 1I3QJ 1TQMA 4P1WA 2BYVE 5FROA 3QPSA 1W5CC 4OIRF 4NDLA 2RC4A 2DN0A 4N4NB 1USSA 4BL0B 4A3FJ 2VODA 3BZ6A 2HEOA 5LHHA 1T2KA 4UB6C 1VI0A 1WJCA 4PGHA 2XGDA 5L3CA 4NQWA 2HQNA 1I5ZA 5K7FA 5ICFA 3VYUB 4CDGA 4QIWN 3CCYA 5LEKA 3JSOA 2M5WA 3KEOA 3MZHA 2LLKA 1OPCA 4FT8A 4L0YB 4IKFA 4EVIA 4PCQA 1F5TA 3H5AA 3BTJA 4MQVA 2PJRA 1EJ9A 1HA8A 3H5RA 4WXDA 1RUNA 4CCMA 2L7FP 2ELJA 5K1YA 2JSCA 2HXOA 4WWCA 4A12A 3QYFA 3K4BA 3DEEA 3FXMA 4I0BA 1FSEA 4PSWA 3EUHA 4ABZA 1BR1A 3ABKH 5JVGF 1K61A 2E19A 3OIQA 5FRMA 3R4KA 1IAWA 1DU6A 3WE3A 4HAMA 3ZMVA 3IRQA 2DA6A 4A69C 2JPBA 1OCRH 4B3XA 1KU3A 1RR7A 3TW7A 3EUKL 1FT9A 4V2FA 2ZNZA 4II3A 1X3WB 2P8TA 5HDGA 2FE3A 4YFNF 2Y75A 1XMXA 3QPTA 5B5EC 4A3BJ 3ELKA 3SZGA 3OYHA 1VQMI 2KIMA 1HLVA 3TP3A 1R71A 2ME6A 3AG2H 1UHMA 1J0RA 4ZZLA 5HS8A 5D4SA 4ETSA 2A69F 4XSXF 4IX7A 2VBXA 4M72A 3HZJA 3U21A 1HQCA 5IT3A 1FY7A 1T33A 3OL4A 1P92A 5CKTA 3RZOJ 2FU4A 1VQNI 1Z7LA 2CUEA 2X48A 2DW4A 1F4KA 2I8DA 3P7NA 1RIOH 2KLOA 3ZMTA 3JCUC 4GCVA 2FQ3A 1MDMB 4UXNA 3H3UA 3ZN1A 2F2EA 3HJEA 2X85A 4RS8A 2GIVA 3WGHA 2XROA 1SEUA 3KP4A 1ENHA 2KQRA 2XAQA 1NG7A 5A2QZ 3IKTA 1J2XA 1GXPA 2NRAC 1J5YA 3HOZJ 3I55I 2FX0A 3OV8A 2LBFB 2BXYA 2R5YA 4C2TA 2NS8A 1XMKA 4XSZF 5F1RA 2CS3A 1KQ8A 1FOXA 2JMWA 3CDLA 3DEUA 1SC7A 1BL0A 1ETXA 4YFXF 1V54H 2VJIA 1IN7A 3OYNA 1QGPA 3AKZA 4BEHB 4NC8A 1TLHB 4M3GA 2X0LA 3HSFA 4QTRA 4OAZA 4KJZA 3EYIA 3E5QA 5GAEJ 1ZGAA 3OYGA 3HOSA 2IGOA 5KAFC 2PFBA 3FWEA 4EGZA 3QRFF 2XPWA 3GUDA 1X2MA 2DK8A 3FMSA 4XLEA 1Z91A 4D1QA 3KX2A 3MMYB 1HDPA 1D5VA 5FLXK 1T38A 3CCQI 1FBSA 2HFHA 3E1SA 3QU3A 3VYTB 2OC6A 5JI6A 3HDDA 4RMNA 3WU1B 3BTIA 4MHGA 1SMTA 2LK2A 2KJCA 1T0FA 3FISA 4XM3A 2JVHA 2OJED 3CC7I 1YW9A 3SHFA 2H94A 2FMLA 2HTJA 2RQQA 5E8IA 2DOFA 4ASNA 1YTYA 1DUXC 1BR4A 2OAZA 4QPOA 3BG3A 4O5VA 1Z77A 1LJ9A 2P81A 3ROUA 3GFMA 1B6AA 3BWGA 4PJLA 5LLQA 1RR8C 2HPMA 2HGCA 2LP0A 3GVAA 4MEYF 4M6YA 1QNTA 2ICWG 1FEXA 1FIAA 2Z16A 4KIFA 3ZQLA 4H4KC 4R79A 1G59A 2OTLI 1W5TA 1MMNA 3KCCA 3RZDJ 2BGCA 1IG7A 2JZYA 4I09A 1M1EB 2GXGA 2CJJA 1I1GA 3IWZA 5F04A 2KRHA 3ZQIA 1QO0D 2M30A 1HDDC 4PZJA 2ECBA 3V4GA 2DI3A 2KMUA 4CYCB 2VC1A 3KIOA 4QLCU 3C2GA 3E0JB 1MJ9A 5ILVA 3G1LA 3LQRA 2X1DA 1LFUP 2M4GA 1X3UA 1OCZH 1R1UA 1X58A 3E5XA 3H5NA 2H27A 4NUBA 1PP8F 4H0EA 5HS9A 4G7ZF 2AO9A 4ITVA 3Q0UA 4XRMA 4EM2A 4KISA 4DYQA 1XGOA 1WCMJ 4GGGA 1BJAA 3M07A 3FBNB 3CCEI 2R5YB 4EJTA 4I6ZA 2R7DA 1Y56A 5CVRA 1JUSA 3ZMDA 3IRRA 1UELB 2X51A 2MGQA 2QSGX 4C3IJ 2K85A 2LKXA 2FRHA 1VZ0A 4BE0A 1UHWA 5CYVA 2VASA 4N0BA 3KE2A 2V1DA 2QEXI 1VQLI 1P4AA 2HI3A 4XONA 3ASNH 2W57A 1DPRA 3E97A 3K7AJ 5D5WB 4OOIA 2W24A 1HW5A 4CO8A 3BG7A 1W36D 4PUSA 4CCJA 4DBQA 4DIQA 4Y17A 3P9IA 4HF1A 4AIDA 3IV5A 2Q8KA 4DW6A 5HLIA 3BZCA 2XB5A 1OCOH 3PSIA 5L3BA 2VUMJ 1AA7A 1TBXA 1XGMA 1XN7A 3Q9VA 2FMYA 3AAFA 5IP9J 2KP6A 5GPCA 3CCUI 2ECCA 3EETA 3I58A 4ZJZA 5KCMA 1WH7A 2K4JA 3L9FA 5FD5A 4A6DA 3OYKA 3HOYJ 1OYYA 2H6BA 4E7IA 2M3AA 1ZGJA 3PNYA 4B47A 2XRLA 1W5SA 3F8NA 4HDUA 1QPMA 3ZQCA 2DFHA 4LLNA 1WJDA 3G71I 3KP6A 2IGKA 3QP6A 3OYIA 5FKLA 4AVZA 2BHZA 4U7BA 3OWTA 4RB0A 1S5LC 2E36A 5D6EA 5J8FA 2IW5A 1KU7A 3HHHA 1W7PB 2JSPA 4XK4A 2X4HA 2HTSA 4JK1X 2DTZA 5D6FA 1J7KA 3FMQA 5HLTA 3S3OA 1YX3A 2EILH 2OQRA 2HKXA 2ADUA 1CGPA 2FBKA 3QPLA 1Z05A 3R60A 1AHDP 1RKWA 1YIJI 1QVUA 3MFKA 1LE8B 2J5PA 3KEQA 4RB1A 2R7ZJ 1FTZA 3MVPA 3WTZA 4AIKA 3TMOA 1B72B 3RKWA 4AVPA 1WQ2A 2IGNA 2Z99A 3FKJA 3ZGKA 4L9NA 1FIPA 3LSTA 3QU6A 4BU2A 5GTHC 4PGGA 4FE4A 4KA4A 2WAQN 2FA5A 4L5JA 1LDKB 2EZLA 2OU2A 4FETA 2PJPA 2DFEA 3CMMA 5EGOA 4R1HA 1FP2A 2M45A 2QQAA 3M3YJ 5LEJA 3HOVJ 4M3EA 1OISA 1ZG3A 3FKIJ 2VE8A 2Q1ZB 1ZR2A 3K1NA 2L2OA 2QQ9A 3SYTA 5M3MJ 2LDUA 2D5VA 2EIMH 2HDWA 5DCMB 5GADJ 3K1PA 1XPXA 1BIBA 2COMA 1XGNA 1PVEA 1JJ8C 2NAZA 2QCOA 5HDNA 2VPLA 2Y0MA 4HBLA 3BTCA 3H92A 1TWCJ 3PO2J 3FHNA 3H3VK 2JN6A 3TQNA 4BE1A 1JE8A 1OJLA 3IH4A 5D5UB 2RN7A 3I64A 5IOZA 1A6IA 2DQRA 3UR3C 1XTAA 4MIMA 5IPAA 3FHZA 4C2MJ 1R1TA 1PUFB 1DQUA 1ONVA 3Q0VA 3HM5A 3T1BA 1K6OA 2MLGA 3N4MA 3TEDA 4BXXJ 1BM9A 1P7IA 5EJCA 3HPGA 3S17J 4L5IA 3F23A 1ZG1A 3I59A 1MH3A 3K69A 2AXTC 2XF7A 2HNHA 1O3SA 4J01A 5HODA 2PJRB 3CZ6A 3GWZA 1YJNI 2ZKZA 2P5KA 4YIFA 3JRBA 3LSKA 3GTQJ 2B9SA 1RZ4A 4HRIA 4DOZA 2V9VA 2DFFA 2O3FA 1IJWC 1KU2A 2EV0A 2QYOA 5GAGJ 3ZMZA 1S3JA 1ORKA 1H9GA 2W00A 3KLOA 1BN5A 3IH3A 1X4OA 2R7FA 3K70C 1E3OC 2HQRA 3L2CA 3GZ5A 3BQYA 2X6XA 3FF5A 4JP0A 1HC8A 3SEZA 5B1BH 1MNEA 3L09A 4JX4A 3G1MA 3RQ4A 2AS5F 4GDFA 3A01B 4DYRA 2ZFUA 4CCOA 3A01A 4YELA 4IEJA 3GTPJ 3BT9A 1Z0XA 3KETA 4IHWA 2M1BA 2BZTA 3WU0A 2WB1A 3DWLE 1LVAA 2M7AA 3OOPA 4L0ZB 2DTRA 4D7NA 2V4JC 1APLC 4RGRA 1GUUA 1T6SA 3DPTA 2X6WA 2VE9A 2PEXA 4D7MA 3D5SC 4RDUA 2EFOA 1CQTA 2FNAA 1QBJA 2OZUA 1B59A 2DPUA 2IS6A 5BPIA 3GBGA 2CU7A 3B73A 3K4MA 1W0TA 1P2FA 3FM5A 3RDIA 1JT0A 1V3FA 4XKCA 5EEAA 1FYKA 3Q5FA 2A5YB 3HRMA 3CF2A 3FZVA 5CQGA 4KIBA 1FNNA 1I39A 2LR8A 2KIUA 3W3CA 4QPQA 2COBA 2CQNA 2XIGA 1T8IA 4XORA 5FLMJ 3K6GA 1H9TA 4N9HA 5LD2C 3HPHA 3HC7A 4CCKA 2IGMA 2DMPA 1SD4A 4BHCA 1JKOC 3DTKA 5L3FA 2MC4A 3GFJA 3S2WA 4Q5SF 1DU0A 1SVOA 4M9ZA 5EYRA 1FWZA 4A0XA 2OA4A 2AXLA 1X1CA 1Z6TA 3VSLA 1A35A 3VFZA 3K4CA 4OWRB 2J5OA 3HSEA 1YJWI 1E3HA 1YS7A 1YOVB 3GMEA 3LA2A 1Y0UA 2FD5A 4FASD 1RUOA 1REPC 1ZRDA 1FOKA 1SFKA 4XMYA 1XSXA 1JTXA 9ANTA 2ELHA 3BC8A 1EH7A 2HQAA 1P4WA 3OYBA 4AIHA 3FK6A 4II2A 5LHIA 4RA2A 1YITI 2ZMEB 2R7OA 2NVQJ 1BW5A 4LIVA 2ZO4A 4RLFA 2E35A 1Z7UA 3CLOA 2BVMA 3GZ6A 1KA8A 4JX6A 1G3WA 2V7FA 1U9NA 4MO7A 5EGOB 1IV8A 2EV5A 1JKRC 2DFIA 2DJNA 4PK4A 3V8LA 3WE2A 4A3JJ 4FHTA 3LA3A 4GXOA 5J47A 1G6NA 4UVBA 5J40A 2CQ7A 3KP5A 4RGXA 5CLSA 1Q1VA 5GAHJ 2Y9ZA 3KPHA 4EQQA 2DOEA 2P7VB 2XAJA 3GCMA 2TCTA 3H1CA 4ZYAA 3DLLF 2O8KA 2STTA 3LAPA 2F5VA 1Q1HA 4OMZA 4FX4A 2OV7A 5IT9Z 4Q47A 4A2UA 2RKHA 4E7LA 2XHKA 3TOBA 2MW8A 2BV6A 2R7RA 3K9TA 4XN0A 2FXAA 5ILUA 3BG9A 4MTDA 1D5YA 3CD6I 4X6AJ 3BLYA 5IOYA 3B02A 3MQ0A 1LPQA 3OYCA 2EB7A 3TKYA 4IPAA 2V6EA 4ZC3A 2R92J 5KHDA 3JRFA 4F3QA 2JPCA 3ZMUA 1R7JA 5L3GA 2AHQA 4RB3C 3LSRA 3K70D 3BP8A 3HKZN 2WAEA 4OIOF 3CO6C 4RAGA 2KT0A 1QHHD 2Z2SB 3RCOA 4RAZA 4IF4A 2LYCA 2KZVA 3V7SA 5LRRA 5LGUA 3HB9A 3DCFA 1YHQI 3S32A 4ESFA 2LBFA 1LFBA 4XNFA 4FX0A 1GVDA 1WSUA 1OMIA 2VOPA 2L7ZA 2PI0A 2AQEA 2F4OB 2OUMA 3K2AA 3JRHA 3BTLA 3SJMA 5M5XJ 2P5LC 5H6RA 4IJAA 2HZDA 1SFEA 3H9QA 4UHTA 4PFOA 2M8EA 3CUQC 4JBAA 2FNPA 2P0WA 3JW4A 4RGUA 4LLGF 5TJJA 4OMYA 2ESNA 3I9V2 1JTYA 4NHJA 3ZXSA 2K5CA 2LY1A 3DPUA 3T5XA 4HW0A 5AONA 4BXFA 5JVTA 2Y0SA 4HNUA 4G7OF 1IUFA 2ZXHA 2IBDA 5F6FA 1D3YA 2H1KA 3BJOA 4D5CA 2A61A 1HSJA 3ABTA 2Q0OA 4EJOA 2ESHA 4FQGA 3ULQB 2A07F 1ERDA 4XLAA 5IYDJ 2PG4A 3QP5A 2IP2A 2LNBA 4B4CA 3OL3A 3LSIA 2WADA 5E1XA 4LB5A 2DAOA 1XDSA 4A0ZA 2L4MA 4Z2YA 3O8GA 1F1ZA 2P5VA 2KRCA 2F4IA 1HKSA 5E3NA 1ACIA 2B63J 2L9RA 3M4OJ 1U0JA 2AQFA 4DBRA 5IP6A 1Z9CA 2MG4A 3MN2A 1BI3A 3CF5F 2VJ4A 3HOXJ 4KDPA 5GTIC 4L9JA 2W82A 5BOXA 1T0FC 4A5MA 3E6DA 4EATA 3WTTC 1YI2I 3RPUA 3BOQA 3DBHB 4YIIA 3WG7H 3L1PA 4A5NA 2ZJRF 3SEQA 4C2UA 2K02A 3EPZA 2E1NA 2FF4A 2D1VA 3LSHA 3ECOA 1ULYA 5FJ8J 5FO5A 4BQOA 3PQKA 3DKYA 2M4KA 4C3HJ 5D8LB 1STZA 4KT6A 4KYWA 3OYEA 1FJLA 4OAYA 2OBPA 1WH5A 2NS7A 2V1NA 2BE5F 5F0HA 2Z9OA 1XCVA 1VQ7I 1G3TA 1VF9A 4HX7A 3EQLF 4BS9A 2QQ8A 3WG9A 2G0EA 2QQBA 3LWFA 3R61A 1YLFA 5E8GA 5F0FA 2PX9A 5K5QA 4F92B 2YU9J 4FTHA 3K4KA 2K7LA 3DBLB 2QKMB 3IP4B 1VQ9I 5B66C 4M6XA 5DEQA 5DUKA 5L3EA 1V5EA 2EWNA 2V9KA 4ENKA 1SMYF 5E1WA 3M9AA 3J7ZI 2YX7A 3DQVC 1X2NA 3NQOA 2NYXA 2DT5A 4WCGA 2RNJA 1XC5A 1I27A 4GO1A 3DP7A 4HPQA 2CG4A 1OQYA 3BDDA 3CJNA 2D1HA 1TP4A 4A3DJ 1S8NA 3CP2A 1BIAA 3EYYA 4CUGA 2WAFA 3AG1H 1QA6A 3DU5A 4M3FA 4UB8C 2CV0A 4BY1J 3RYPA 1D8JA 1ZYRF 3S3NA 1FMVA 5E1ZB 5CQEA 1SVLA 3BQZA 1X1DA 4MLOA 4ZH4F 1ETQA 2VQGA 1T98A 2O9LA 2WTEA 1SD5A 1U8RA 1WPKA 4OU0A 2QKLB 1OCCH 2OQGA 2ZXJA 3VODA 1AOYA 4ZTJA 2B0LA 2CQXA 5GPAA 4HSRA 5HS7A 2WBMA 2GQQA 4UNOA 3OOUA 1O4XA 4LB6B 5IY5H 2EZHA 2NVYJ 1W7PA 3JAMK 4LITA 5LGNA 4LG0A 1U5TC 3U9GA 4D9JA 4NNJA 2K9NA 2KJBA 2W7NA 1BC7C 4G6DA 3BR5A 3QWLA 4B09A 3L2UA 1WKMA 2JA2A 2GM4A 2VKVA 4UUVA 2IS2A 1UJ8A 2XF5A 3I4MJ 1ETVA 3F8MA 4I7HA 1R6RA 3NRVA 5JLXA 2ID3A 2HDCA 1EH8A 2QENA 2WWYA 4J00A 3ESWB 3NWTA 3TW6A 3DBRB 4EJWA 2M7BA 5J1RA 4BUPA 2V26A 1IO2A 3FDYA 2HPIA 3CJQB 5L3DA 5IYCJ 5ICEA 3H36A 4BACA 3I54A 3I71A 3CQZJ 2ZJ2A 4YRVA 3VYRB 1L3LA 5JHUA 1SVMA 1S9HA 4UV9A 2XSDC 1G3YA 1Y8RB 4UUSA 3MKYB 2G7UA 1G4DA 3ECHA 3OS2A 2DA3A 2MYSA 1R4NB 1O3TA 4UVCA 2CFOA 5DCMA 1VQ8I 3W2VA 1ZK8A 3CC2I 1U8BA 3KYLA 1GT0C 1V4RA 2P7CB 1ZQ3P 4KITB 4NC6A 3RPQA 2CO5A 2HYGD 4IL6C 4XRSG 4DZPA 2XPUA 4EMSA 3HKZA 3M8FA 3KYDB 3CC4I 4UVAA 4LD5A 4WF2A 4S0HB 1YFHA 2JA7J 1F9NA 3Q0WA 1MBJA 3PSFA 3E7LA 1ZRCA 2XKOA 2VI6A 3CMYA 3LSPA 2VN2A 5J1YA 2BBYA 2QGUA 2Y9YA 1T56A 3PIOF 3CCVI 2GXBA 2YR2A 2OCEA 3GF2A 3V7CA 3HSRA 4EGYA 1YX5A 2L7KA 2P4WA 3S1NJ 3T8RA 2W1OA 2Z5UA 2CGPA 2ZSIB 2L9NA 1WGXA 2R5ZB 2JA5J 4KIGA 3GFIA 4ENNA 2H6CA 2R7WA 1Y0NA 3IAM2 2IAIA 4PJJA 3CTAA 3WTXC 3IH2A 4RLQA 1HW2A 2WC2A 4LG0B 2O8XA 3BZKA 4BE2A 3KFWX 1P9QC 1TC3C 1TL8A 3ABLH 1Z67A 2O03A 1TZLA 3E6BA 2QZ8A 2M8GX 1FYLA 2GXAA 3VDXA 4M73A 2OD5A 1NK2P 1EH6A 1JUPA 2E1MB 4Y33A 4DYCA 1JKPC 4ESBA 4C9YA 5CVUA 4XRFA 2CWEA 4RAFA 4WXHA 4EJUA 1J59A 4IHTA 4CSWA 1FX7A 2K40A 2E34A 2HVSA 2IS4A 2LMDA 5BPDA 4MGRA 1X1AA 1K4TA 5JFRA 1RRJA 4HX8A 5ICCA 2F5DA 1D8KA 4YFKF 1DP7P 1WHUA 3RKXA 3ABMH 1ON2A 3TDZC 4MEXF 2ZFWA 5E3MA 2LVSA 5FKKA 5F0CA 2A6TA 2IA2A 4KICA 2M0CA 5DYMA 1HF0A 2V79A 4G8XA 1HCRA 1PJRA 1R00A 1ETWA 1RKTA 2MSYA 3QOEA 4UV8A 3C18A 2CQQA 3HBLA 3FK7A 3G1OA 1FBUA 1W7PD 4B3AA 1T95A 2R0QC 1U5TA 2X6YA 3AG3H 3SQNA 1U5TB 2EPFA 2KZGA 5EG0B 2F5CA 3QODA 1WZ2A 1YRNA 3DKWA 2LY2A 3C3WA 5HNHA 1O3RA 1GV2A 3LQQA 3CMEI 2R7SA 3REOA 2BY1A 1CF7B 4M3DA 2VIXA 4AD9A 3Q3SA 1UG0A 2ZBKA 3TL4X 2CQKA 3HG9A 3I4PA 4A3EJ 3WTUC 2VQCA 3BR1A 1B9MA 2Y2ZA 1A36A 1TTYA 1MSFC 1IDYA 1ZKGA 2VJJA 1RESA 1S7OA 3QAHA 2ZJPF 1ZG5A 4ON0A 2MD0A 3UNGC 2BY3A 4ESJA 4BBSJ 2VOOA 1GVJA 3L2VA 1UG2A 2VPRA 3AL0C 2Y31A 2Y69H 1JT6A 1OLTA 2IA0A 4HOBA 5J1UA 3L2QA 1U2WA 2DOAA 2JTVA 2XGXA 3E6CC 2RV8A 4LK1F 5AIPA 3HTUA 3LL7A 2K3FA 3K4JA 4BAYA 3A2KA 3B6CA 3J81Z 4R8HA 5FRNA 3CJRB 4I2OA 3H3ZA 1NG6A 2XAFA 3BROA 4HQMA 1IGNA 1K7AA 3HXLA 1V5FA 3MZYA 3BPXA 4XKBA 4HX4A 3G2BA 3F22A 1NK3P 5CVIA 2HOSA 1S7EA 1ITYA 1BJZA 4HEA2 3V42A 3CUOA 3QOPA 5E3LA 3LFKA 4AUXA 4DGWB 3DF8A 4CYCA 2WV1A 3CCLI 1WRJA 2EIKH 1XCBA 2E60A 2G9WA 2KKOA 5FD6A 4XOTA 1ETKA 4LMYA 4ZYDA 4RBOA 1F43A 4XBFA 5CVVA 2PMZA 4A0YA 4M71A 1VQ5I 3FXJA 3ZOBA 4U7DA 5DUIA 3SFZA 3GX4X 3VWBA 3GTOJ 1S29A 2ZXIA 2MLKA 3WHBA 2EJRA 1YYVA 1B1BA 3F8FA 3SZPA 4IOAF 4LJZF 2CRGA 4LG3A 1MZBA 1PP7U 3OY9A 3OR2C 2LY9A 1Z21A 2PN6A 4GRIA 2CH0A 3LMMA 5C4JJ 4Y13A 3OSFA 1UMQA 4LGWA 4LLLA 1MJAA 2TRTA 1YW8A 2X1EA 3E6MA 3RQIA 3VOEA 4G7HF 4QSHA 3K4LA 1KGSA 1UB9A 4A3IJ 3DKXA 2NNNA 4L18B 3PFYA 2L9SA 2JA8J 2Q2EA 2QWWA 2NXNB 4M9XA 3BJ6A 1B8IA 2XRNA 2Q2EB 3HGYA 1X1PA 2PQ8A 2K9QA 4HZFA 3H0GJ 3OYFA 3GXOA 3PIPF 1K83J 2R93J 3H9GA 3M1EA 4Y15A 1Y6IA 3WTYC 4EM0B 1IC8A 2PMHA 1K4SA 1N78A 1ZHFA 4A6EA 2Y0SN 2VXZA 1K78A 2XGEA 1D0YA 2RREA 4IRIA 1O57A 5EEHA 2A3SA 2Z1DA 1Z6RA 1PUEE 2HVRA 2LFBA 3CUQA 2FUG2 3H9JA 4GYGA 4LIUA 4LFUA 2HDDA 1MBGA 3TBIA 4BHBA 5DD4A 4RB2C 4GYIA 1KZHA 3CDIA 3RYRA 3RIRA 2XC7A 4IHYA 3RI4A 2O0YA 4IQ4A 4CGZA 3M1CA 3MAJA 2CV1A 4ZYGA 1ZTRA 3G6EI 5DM6F 1FOWA 2FEZA 5D8KB 3PM1A 5BQTA 1TWHJ 1HSTA 2YU3A 3OYAA 2LREA 2F5EA 1ON1A 1QQIA 3I5UA 3GW2A 4U88A 3CDHA 1P6RA 3G73A 4IRHA 3NARA 3KEYA 2XF6A 4B1RA 1J09A 1TNTA 3E3VA 2CUJA 1XD7A 3OYLA 2XUBA 3OMYA 2E1MC 1MBHA 4MTEA 3IKVA 2I10A 1D0XA 1SFXA 4NC7A 4NQWB 1AKHB 1AWCA 2XAGA 2JRTA 4KT5C 1AKHA 3D1NI 3JR9A 3MD2A 3JRAA 4W97A 2BW3A 4FCYA 1OYIA 1B72A 2FOWA 4I76A 5BS6A 3A1YA 3WODF 2NNYA 2NVXJ 2K27A 2LF8A 4WXCA 5EF6A 1MD0A 2TDXA 3M8EA 2VBWA 5D5XB 3ABUA 4CZZA 3FBIB 3M8JA 3GFLA 3FXUA 3BR3A 1ZH5A 1SANA 2STWA 4O3MA 1IRGA 5TRDA 4Z6YA 1A5JA 3PNVA 2E2HJ 4EM1A 4HA8A 4HLXA 3RKQA 1YQAA 3ZRGA 3BR2A 4ZYHA 3DTEA 4HV6A 2VT2A 4BBRJ 5FGMA 2BVLA 3KLNA 1WJFA 1ZR4A 3HGGA 3TGNA 5C4XJ 1VQOI 5DCFA 1UFMA 2DMUA 4I99C 1MNMC 1YO5C 3F9KA 1FC3A 5AIQA 3F72A 3R0JA 4IQJA 3RJPA 1LQ1A 4A3CJ 2HZTA 1R9TJ 4E7HA 1VQPI 1J9IA 3OIPA 2GBYA 3MKZA 1H0MA 4IO9F 1U78A 2VB6A 2KFDA 3CESA 2KPMA 3U1KA 4BYYA 1JI8A 3CMAI 1Y8QB 2IXSA 4JYKA 1N77A 4S05A 2K9MA 5K7ZA 2DDBA 4MFDA 3ZQHA 1MMAA 1D1AA 1AU7A 3TOAA 4BNCA 2EFQA 4TV7A 2EV6A 3EUAA 2GOMA 5EZHA 5KAIC 4O6JA 5EDNA 3SXYA 2VKHA 1O7FA 5F1JA 3BPVA 2QA4I 3S3MA 4HF0A 4M74A 1KQ9A 3KZIC 4KN4X 2KIFA 4IHVA 5IT9K 2XB0X 2XVCA 3HRSA 2O7OA 2L3DA 3PJRA 2FQ4A 2V9PA 1R5GA 2W85A 2R7TA 1GHCA 1EA3A 4XLFA 3OS0A 5CPRB 3AL0B 2EH3A 1UCRA 2E5NA 1X4PA 3K1MA 1IXRC 2NOJB 2H8WA 2UUZA 4KUMA 1L0OC 2ID6A 3CP8A 2IPQX 3S8PA 3ZQ7A 4HF2A 3KP2A 2XV4S 4AYBA 1ZLJA 1TW2A 3QPHA 1XG1A 4L9TA 5B1AH 2LC2A 1RNLA 3ONQA 5J4YA 4AM3A 2HU9A 4XKVA 2X6OA 4Q48A 4ZZDA 1IF1A 2JA6J 1D0ZA 3HUGB 5FB2A 2HWVA 1YS6A 1UAAA 2M34A 5DTDA 1B8IB 1LEBA 3V8JA 3O8HA 5ERIA 3ZP5A 4RAYA 2HKOA 5E17F 2IEKA 3J7YJ 1KYWA 3VYSB 3PQJA 3BJAA 2R7UA 5F27A 3JTGA 2A6HF 3JSPA 5KVRA 1ZN2A 2BHYA 4U0YA 2L7MP 1IN5A 1QRYA 4P9FA 2O5RA 2F5FA 1IXSB 4KN7X 4DNCA 2DCEA 5ED4A 2XGCA 4G9YA 3WGIA 1W4MA 1RETA 1I3AA 3S14J 3WHCA 1R22A 1K78B 1OCPA 1OCTC 2CMPA 2R4GA 1YW7A 2HR3A 2WY8Q 2FOKA 2K9SA 3O3KA 3VPRA 2NVTJ 2RDPA 5FLXZ 2XASA 2RAEA 2BXZA 1O7LA 2QM3A 2F4MB 3PNTA 1GXQA 1LEAA 2CUZA 3BR0A 3I0TA 2UXXA 3JRGA 3C7JA 5FKMA 2DBBA 3LSJA 4UY8I 4I98B 1E0EA 4E6KG 3A4CA 3K4NA 4ENMA 2NS0A 3U1DA 3I3LA 4C30A 3S2HJ 2PMUA 5HNFA 2E71A 2DPDA 5M5YJ 3JRDA 3DPLC 4XOPA 2K4BA 2ZXWH 3IAS2 3TO7A 4BQQA 5H2FC 2O61A 4E7ZA 1KYZA 4CYDA 5E20A 3PFIA 1YJ9I 2OF7A 3HEFA 3GTGJ 5EEGA 1XSDA 2JRMA 3G3ZA 2YX4A 1XGSA 1MH4A 2JUGA 2DMQA 3S1QJ 1ZGWA 2JWTA 4DZJA 2XAHA 1MNDA 1SFOJ 2VQLA 3ML6A 2LSOA 5HOOA 4HQEA 1JJ6C 4ZDLA 4K2EA 3J80Z 1V5GA 2M9HA 2LOOA 2L0KA 2RQPA 2VC0A 1QZYA 2HVQA 2M0MA 1LVKA 1BOAA 4U0VA 2H1LA 2DDAA 2QBYB 3HUGA 1JHHA 4BGDA 2QBYA 5A2QK 2IS1A 2BOLA 1C0WA 1MW7A 2DT7B 3ZR8X 3WGGA 3ZPLA 2DA4A 1NHAA 3ERED 1TNSA 2YS9A 4C3JJ 4BKXA 2WA0A 1MSEC 1Y1WJ 2CW8A 4S04A 2ME0A 4IHSA 3C1DA 3AG4H 3ASOH 1R58A 4I0AA 2FJ1A 4CXFA 4F91B 5LHGA 4XIDA 2GA2A 4IOCF 2ISYA 2IA1A 4KMUX 4JX5A 4I02A 5HLHA 3L2WA 3JAMZ 1OFCX 1FP1D 5HVQC 2PMZN 5C44J 4P9UA 4YEJA 4XL9A 1NTCA 2UWMA 2CYYA 2GOXB 2V1XA 3HTSB 1TWFJ 2KISA 1R4MB 4UUSB 1E17A 2CUFA 3OIOA 1GDTA 2E1CA 3COAC 1Z3YA 1B4AA 3HHGA 1JXSA 3D5RC 2WY7Q 2DQLA 1JGSA 5M3FJ 1POGA 2E1OA 3CJTB 4UUTA 1ETOA 1LB2A 1EV7A 1WVRA 6PAXA 3BR6A 4A3MJ 2DA7A 3K2ZA 5D4RA 4HLYA 2R7QA 5BMZA 4A3KJ 1O3QA 3E5UA
chains in the Genus database with same CATH topology
2HOEA 3HIFA 3T8TA 4B8XA 2UZKA 4MQ9F 2JT1A 5FFXA 1YG2A 1ODDA 3ZMSA 2HYFA 2L4AA 4AWXB 2VT3A 2L01A 1CF7A 2ISZA 1YIOA 2HS5A 2IJLA 3VB2A 4U0WA 2ZMEA 1K79A 5FFZA 1FLIA 4BH9A 3V8KA 3SZTA 5JR3A 2MD5A 1IRFA 1SD6A 2PLYA 2DU9A 4LK0F 1XDUA 4L9VA 2V1UA 2EFPA 3ISPA 4BXUA 2Z3YA 2L54A 5D5VB 1WI9A 2V6CA 3L00A 2CW0F 3TO9A 3D0SA 4EJVA 3P9KA 5J6XA 4QWQA 2PBIA 2UXNA 1LDDA 1BI2A 1I6XA 1Z1DA 1VTNC 3KP7A 1P4XA 3R0AA 2GWRA 4Q4ZF 1TQPA 1ZLKA 3J7AO 2WV0A 3I53A 3J81K 1IN4A 3L7WA 4EV0A 3P9CA 1OYWA 1SFUA 1SD7A 1MJBA 1QZZA 1XMAA 4CHUA 3F8CA 4HYEA 3I59B 4P55A 4P96A 3HRTA 2DK5A 3VEPA 2YSRA 4KMFA 1OR7A 1TQIA 3GLXA 2O6GE 1WWXA 2CSOA 1DPUA 1OKRA 2QLZA 2K86A 3CO7C 4XLPF 3GO5A 2W25A 3FXRA 3M7GA 2ZNYA 3V7RA 3HOTA 3K0LA 2LF7A 1PDNC 2DLLA 5H6QA 3DXJF 5ICGA 3LAJA 2Y48A 1ZAOA 2GZWA 5F64A 2A68F 2CFXA 2QVOA 3W6KB 5DV5A 1LNWA 1FZPB 1LDJA 5K5RA 2VONA 1IUYA 1I1SA 3O6BB 4IXAA 2IT0A 1IZ1A 4IVNA 2MBFA 4BQAA 2GAUA 1XSVA 4ENJA 3F3XA 1R36A 4AIJA 2EFWA 2DO7A 1IXCA 1HKTA 3FX3A 3TDUC 4G94A 1ZARA 4WK8F 3KZZA 4ZYEA 4BHPA 1BBYA 4I01A 1XB4A 2E7WA 1S7AA 2ZCWA 2EK5A 1FYMA 1ZREA 2RVCA 4P5OA 1SAXA 4D0PA 5J8CA 4DQ2A 3BY6A 4WX9A 5CVJA 4HV5A 2ACJA 2KRFA 1HKQA 1IN8A 2Z33A 5HLGA 3TO6A 2IRFG 3GEZA 3Q9SA 2MH9A 2GA1A 2QUFA 3F6OA 1HW1A 4RGSA 2M87A 1BI1A 4XLNF 3NEUA 3HYIA 4MNUA 2YPRA 1HXDA 3RKYA 3MWMA 3LA7A 3WTSC 4N9IA 2LKPA 3FM3A 1HBXG 1ZRFA 1R1VA 3FXQA 5CJ9A 5K5OA 5ILSA 3W6JB 3IWFA 2EA2A 2W84A 3KZYA 5HDKA 3O2PE 1KU9A 1BI0A 3HRUA 4YG2F 2BEOA 5LRSA 3IHUA 4G6QA 1FSHA 2MH2A 1B9NA 4E70A 3WTWC 3F21A 3DV8A 3JTHA 2VBYA 4OIQF 2D2WA 2IVMA 4PDKA 1U3EM 3D5LA 2G7HA 2C6YA 1E2XA 1G3SA 4M9SA 1RI7A 3ZN0A 4NB5A 1MKMA 2XKPA 1DDNA 1IW7F 5LBQA 2P6SA 3FMRA 2MA3A 2EA4A 3WTVC 4KFCA 1FBQA 3KP3A 3N97A 3MEXA 5H20A 1KQ0A 1T39A 2A6EF 2RGVA 3U2RA 2E7XA 2FBIA 3T0YA 4OIPF 3IL2A 1MGTA 1U6GA 5DDGA 4IRGA 1J75A 4CICA 3RTRA 1S6LA 1MDMA 5KK1A 3EDPA 2R3SA 1R5HA 2D45A 1R23A 5LGTA 1FPQA 5DD8A 2H09A 1IN6A 2EFNA 3R6SA 2VBZA 3F6VA 4OINF 4F7ZA 4JQFA 2FBHA 1JHFA 5E18F 1TW3A 3J80K 1A04A 2P6TA 3IC7A 1USTA 2FSWA 3F8BA 4HDVA 3CUQB 2MC3A 3GYHX 2OZ6A 3DFGA 3MCZA 2ETHA 1BC8C 2L02A 4KNYA 1TQMA 2BYVE 4OIRF 2RC4A 1USSA 2VODA 3BZ6A 2HEOA 5LHHA 1T2KA 4PGHA 5L3CA 4NQWA 2HQNA 1I5ZA 5ICFA 4CDGA 5LEKA 3JSOA 2M5WA 3KEOA 3MZHA 1OPCA 4FT8A 4L0YB 4EVIA 4PCQA 1F5TA 4MQVA 4WXDA 1RUNA 5K1YA 4WWCA 2JSCA 4A12A 4I0BA 1FSEA 3EUHA 3R4KA 1IAWA 3WE3A 4HAMA 3ZMVA 3IRQA 2JPBA 1KU3A 1FT9A 2ZNZA 2P8TA 5HDGA 2FE3A 4YFNF 2Y75A 3QPTA 3ELKA 2KIMA 1UHMA 1J0RA 4ZZLA 5HS8A 5D4SA 4ETSA 2A69F 4XSXF 2VBXA 4M72A 5IT3A 1HQCA 1FY7A 1P92A 2FU4A 2DW4A 1F4KA 3P7NA 1RIOH 3ZMTA 4GCVA 2FQ3A 1MDMB 4UXNA 3H3UA 3ZN1A 2F2EA 4RS8A 2GIVA 3WGHA 2XROA 3KP4A 2XAQA 5A2QZ 3IKTA 1J2XA 1GXPA 2NRAC 1J5YA 3OV8A 1XMKA 4XSZF 5F1RA 1KQ8A 3DEUA 4YFXF 1IN7A 1QGPA 1TLHB 2X0LA 3HSFA 3EYIA 3E5QA 1ZGAA 3HOSA 4EGZA 2PFBA 3FWEA 3QRFF 3GUDA 2DK8A 3FMSA 1Z91A 1D5VA 5FLXK 1T38A 1FBSA 2HFHA 3QU3A 5JI6A 3WU1B 4MHGA 1SMTA 2KJCA 1T0FA 1YW9A 3SHFA 2H94A 2FMLA 2HTJA 5E8IA 1YTYA 4ASNA 1DUXC 2OAZA 4O5VA 1LJ9A 3ROUA 3GFMA 1B6AA 3BWGA 5LLQA 2HGCA 3GVAA 4MEYF 4M6YA 1QNTA 4KIFA 4R79A 1W5TA 3KCCA 2BGCA 2JZYA 4I09A 2GXGA 1I1GA 3IWZA 1QO0D 2M30A 4PZJA 3V4GA 2DI3A 2VC1A 4QLCU 1MJ9A 5ILVA 3LQRA 1X3UA 1R1UA 3E5XA 2H27A 1PP8F 4H0EA 5HS9A 4G7ZF 4EM2A 1XGOA 4GGGA 1BJAA 4EJTA 2R7DA 5CVRA 3ZMDA 3IRRA 2FRHA 1UHWA 5CYVA 4N0BA 3KE2A 2V1DA 1P4AA 2W57A 1DPRA 3E97A 5D5WB 4OOIA 2W24A 1HW5A 4CO8A 4Y17A 3P9IA 4HF1A 2Q8KA 5HLIA 5L3BA 1TBXA 1XGMA 1XN7A 3Q9VA 2FMYA 3AAFA 3EETA 3I58A 4A6DA 5FD5A 2K4JA 3L9FA 1OYYA 2H6BA 1ZGJA 1W5SA 3F8NA 4HDUA 1QPMA 4LLNA 3KP6A 3QP6A 4U7BA 4RB0A 5D6EA 5J8FA 2IW5A 1KU7A 3HHHA 1W7PB 2X4HA 2HTSA 4JK1X 5D6FA 1J7KA 3FMQA 2OQRA 2HKXA 2ADUA 1CGPA 2FBKA 1Z05A 3R60A 3MFKA 2J5PA 3KEQA 4RB1A 3WTZA 4AIKA 3RKWA 4AVPA 1WQ2A 2Z99A 4L9NA 3LSTA 3QU6A 4KA4A 4PGGA 2FA5A 4L5JA 1LDKB 2OU2A 2PJPA 4R1HA 1FP2A 2M45A 2QQAA 5LEJA 1ZG3A 2VE8A 3K1NA 2QQ9A 2LDUA 5DCMB 3K1PA 1BIBA 2COMA 1XGNA 2NAZA 5HDNA 2Y0MA 4HBLA 3H92A 3TQNA 1JE8A 5D5UB 2RN7A 3I64A 2DQRA 3FHZA 1R1TA 1ONVA 3T1BA 1K6OA 2MLGA 3N4MA 1BM9A 4L5IA 3F23A 1ZG1A 3I59A 3K69A 1O3SA 3GWZA 2ZKZA 2P5KA 4YIFA 1RZ4A 2V9VA 2O3FA 1KU2A 2EV0A 2QYOA 3ZMZA 1S3JA 1H9GA 3KLOA 1BN5A 2R7FA 2HQRA 3L2CA 3GZ5A 3FF5A 3L09A 2AS5F 3KETA 2M1BA 3WU0A 1LVAA 3OOPA 4L0ZB 2DTRA 4RGRA 1T6SA 3DPTA 2VE9A 2PEXA 2EFOA 2FNAA 1QBJA 2OZUA 1B59A 2DPUA 5BPIA 3B73A 1P2FA 3FM5A 3RDIA 1V3FA 1FYKA 3Q5FA 2A5YB 3FZVA 3HRMA 4KIBA 1FNNA 2KIUA 2XIGA 1H9TA 4N9HA 1SD4A 4BHCA 5L3FA 3GFJA 3S2WA 4Q5SF 4M9ZA 1FWZA 4A0XA 2OA4A 2AXLA 1Z6TA 3VFZA 2J5OA 3HSEA 1YS7A 3LA2A 1Y0UA 1ZRDA 1RUOA 1REPC 1FOKA 1XSXA 2ELHA 1EH7A 1P4WA 4AIHA 5LHIA 2ZMEB 2ZO4A 1Z7UA 3CLOA 3GZ6A 1KA8A 1G3WA 2EV5A 2DFIA 3V8LA 3WE2A 4FHTA 3LA3A 4GXOA 1G6NA 4UVBA 3KP5A 4RGXA 5CLSA 4EQQA 2P7VB 2XAJA 2STTA 3LAPA 1Q1HA 4OMZA 4FX4A 5IT9Z 4Q47A 4A2UA 2RKHA 2XHKA 3TOBA 2BV6A 3K9TA 2FXAA 5ILUA 4MTDA 3B02A 3MQ0A 2EB7A 3TKYA 4IPAA 2JPCA 3ZMUA 1R7JA 5L3GA 4RB3C 3BP8A 4OIOF 3CO6C 4RAZA 4IF4A 3V7SA 5LRRA 5LGUA 4ESFA 4FX0A 1WSUA 1OMIA 2VOPA 2PI0A 2P5LC 5H6RA 4IJAA 1SFEA 4UHTA 2M8EA 3CUQC 4JBAA 2FNPA 3JW4A 4RGUA 4LLGF 5TJJA 4OMYA 2ESNA 4NHJA 3T5XA 4HW0A 5AONA 5JVTA 4G7OF 5F6FA 1D3YA 3BJOA 2A61A 1HSJA 3ABTA 2Q0OA 4EJOA 2ESHA 2A07F 3ULQB 2PG4A 3QP5A 2IP2A 2LNBA 5E1XA 4LB5A 2DAOA 1XDSA 4A0ZA 2L4MA 4Z2YA 1F1ZA 2P5VA 1HKSA 1Z9CA 1BI3A 4KDPA 4L9JA 5BOXA 4A5MA 3E6DA 3WTTC 3RPUA 3BOQA 4YIIA 4A5NA 2K02A 2E1NA 2FF4A 2D1VA 3ECOA 1ULYA 5FO5A 3PQKA 5D8LB 1STZA 4KYWA 2OBPA 2Z9OA 2BE5F 1XCVA 1G3TA 4HX7A 3EQLF 3WG9A 2QQBA 3LWFA 3R61A 1YLFA 5E8GA 5K5QA 2K7LA 4M6XA 5DEQA 5DUKA 5L3EA 2EWNA 4ENKA 1SMYF 5E1WA 3M9AA 2YX7A 3DQVC 3NQOA 2NYXA 2DT5A 4WCGA 2RNJA 1I27A 4GO1A 3DP7A 2CG4A 3BDDA 3CJNA 2D1HA 1S8NA 1BIAA 3EYYA 1D8JA 3RYPA 1ZYRF 5E1ZB 4ZH4F 1T98A 2WTEA 1SD5A 1U8RA 4OU0A 2OQGA 2ZXJA 3VODA 1AOYA 2B0LA 5HS7A 2GQQA 4UNOA 4LB6B 1W7PA 3JAMK 5LGNA 4LG0A 1U5TC 3U9GA 2KJBA 1BC7C 4G6DA 4B09A 1WKMA 4UUVA 3F8MA 4I7HA 3NRVA 2HDCA 1EH8A 2QENA 2WWYA 4EJWA 5L3DA 5ICEA 3I54A 3I71A 2ZJ2A 1L3LA 5JHUA 4UV9A 1G3YA 1G4DA 2G7UA 3ECHA 1O3TA 4UVCA 5DCMA 1V4RA 2P7CB 3RPQA 2CO5A 2HYGD 4EMSA 3M8FA 4UVAA 4LD5A 4WF2A 1YFHA 1F9NA 1ZRCA 2XKOA 2VN2A 2BBYA 2GXBA 2YR2A 3GF2A 3V7CA 3HSRA 4EGYA 2P4WA 3T8RA 2Z5UA 2CGPA 4KIGA 3GFIA 4ENNA 2H6CA 3CTAA 3WTXC 1HW2A 2WC2A 4LG0B 2O8XA 3KFWX 2O03A 3E6BA 2QZ8A 1FYLA 4M73A 2OD5A 1EH6A 4ESBA 5CVUA 4XRFA 2CWEA 4WXHA 4EJUA 1J59A 4IHTA 1FX7A 5BPDA 4MGRA 5JFRA 4HX8A 5ICCA 2F5DA 1D8KA 4YFKF 1DP7P 3RKXA 4MEXF 1ON2A 3TDZC 2ZFWA 2IA2A 4KICA 5DYMA 2V79A 4G8XA 1R00A 4UV8A 3C18A 1FBUA 1W7PD 1U5TA 3SQNA 1U5TB 2F5CA 3DKWA 3C3WA 1O3RA 3LQQA 3REOA 1CF7B 4AD9A 2ZBKA 2CQKA 3I4PA 3WTUC 1B9MA 1TTYA 3QAHA 1S7OA 1ZG5A 4ON0A 4ESJA 2VOOA 1GVJA 4HOBA 2IA0A 1U2WA 2JTVA 2XGXA 3E6CC 2RV8A 4LK1F 5AIPA 3HTUA 4BAYA 3J81Z 4R8HA 4I2OA 3H3ZA 2XAFA 3BROA 4HQMA 1K7AA 3MZYA 3BPXA 4HX4A 3F22A 5CVIA 3CUOA 3QOPA 3LFKA 3DF8A 1WRJA 1XCBA 2KKOA 2G9WA 5FD6A 4LMYA 4ZYDA 4XBFA 5CVVA 4A0YA 4M71A 4U7DA 5DUIA 3SFZA 3GX4X 1S29A 2MLKA 2EJRA 1YYVA 1B1BA 3F8FA 3SZPA 4LJZF 1MZBA 1PP7U 2PN6A 4Y13A 4LGWA 4LLLA 1MJAA 1YW8A 3E6MA 3VOEA 4G7HF 1KGSA 1UB9A 2NNNA 4L18B 2Q2EA 2QWWA 4M9XA 3BJ6A 2XRNA 2PQ8A 4HZFA 3GXOA 3M1EA 4Y15A 3WTYC 4EM0B 2PMHA 1ZHFA 4A6EA 2VXZA 1K78A 4IRIA 1O57A 5EEHA 2A3SA 1Z6RA 1PUEE 3CUQA 4GYGA 4LFUA 4BHBA 5DD4A 4RB2C 4GYIA 3RYRA 3RIRA 3RI4A 2O0YA 4CGZA 3MAJA 4ZYGA 2FEZA 5D8KB 5BQTA 1HSTA 2YU3A 2F5EA 1ON1A 1QQIA 3I5UA 3GW2A 4U88A 3CDHA 1P6RA 3G73A 4IRHA 1TNTA 3E3VA 1XD7A 2XUBA 4MTEA 3IKVA 1SFXA 1AWCA 2XAGA 2JRTA 4KT5C 1OYIA 5BS6A 3WODF 2NNYA 2K27A 2LF8A 4WXCA 1MD0A 2TDXA 3M8EA 2VBWA 5D5XB 3ABUA 4CZZA 3GFLA 3FXUA 1ZH5A 2STWA 4O3MA 1IRGA 5TRDA 4EM1A 4HA8A 4HLXA 1YQAA 4ZYHA 4HV6A 2VT2A 5FGMA 3KLNA 3TGNA 5DCFA 1UFMA 1YO5C 1FC3A 5AIQA 3F72A 3R0JA 3RJPA 1LQ1A 2HZTA 1J9IA 1H0MA 1U78A 4BYYA 4S05A 3TOAA 4BNCA 2EFQA 4TV7A 2EV6A 4O6JA 3SXYA 1O7FA 3BPVA 4HF0A 4M74A 1KQ9A 4KN4X 2KIFA 5IT9K 2XVCA 3HRSA 2L3DA 1GHCA 1R5GA 2W85A 1UCRA 3K1MA 1IXRC 3ZQ7A 4KUMA 1L0OC 2IPQX 4HF2A 3KP2A 2XV4S 1ZLJA 1TW2A 3QPHA 4L9TA 1RNLA 4Q48A 4ZZDA 1IF1A 5FB2A 2HWVA 1YS6A 1LEBA 3V8JA 5ERIA 3ZP5A 4RAYA 2HKOA 5E17F 1KYWA 3PQJA 3BJAA 3JTGA 2A6HF 3JSPA 5KVRA 1ZN2A 4U0YA 1IN5A 4P9FA 2F5FA 1IXSB 4KN7X 4DNCA 5ED4A 4G9YA 3WGIA 1W4MA 1R22A 1K78B 1YW7A 2HR3A 2FOKA 3O3KA 2RDPA 5FLXZ 2XASA 1O7LA 2QM3A 1GXQA 1LEAA 3I0TA 2UXXA 3C7JA 2DBBA 4I98B 4ENMA 2NS0A 3U1DA 2PMUA 2DPDA 3DPLC 2K4BA 3TO7A 2O61A 1KYZA 4CYDA 5E20A 3PFIA 5EEGA 1XSDA 3G3ZA 2YX4A 1XGSA 2XAHA 5HOOA 3ML6A 2LSOA 4HQEA 4K2EA 3J80Z 2RQPA 1QZYA 2VC0A 1BOAA 4U0VA 2QBYB 3HUGA 1JHHA 2QBYA 5A2QK 1C0WA 3ZPLA 3WGGA 1NHAA 3ERED 1TNSA 4S04A 4IHSA 3C1DA 4I0AA 1R58A 4CXFA 5LHGA 2GA2A 2ISYA 2IA1A 4KMUX 4I02A 5HLHA 3JAMZ 1FP1D 5HVQC 4P9UA 2UWMA 2CYYA 2V1XA 3HTSB 1E17A 2E1CA 3COAC 1B4AA 3HHGA 1JXSA 2DQLA 1JGSA 1LB2A 1EV7A 6PAXA 3K2ZA 5D4RA 4HLYA 5BMZA 1O3QA 3E5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOE A;  3HIF A;  3T8T A;  4B8X A;  2UZK A;  4MQ9 F;  2JT1 A;  5FFX A;  1YG2 A;  1ODD A;  3ZMS A;  2HYF A;  2L4A A;  4AWX B;  2VT3 A;  2L01 A;  1CF7 A;  2ISZ A;  1YIO A;  2HS5 A;  2IJL A;  3VB2 A;  4U0W A;  2ZME A;  1K79 A;  5FFZ A;  1FLI A;  4BH9 A;  3V8K A;  3SZT A;  5JR3 A;  2MD5 A;  1IRF A;  1SD6 A;  2PLY A;  2DU9 A;  4LK0 F;  1XDU A;  4L9V A;  2V1U A;  2EFP A;  3ISP A;  4BXU A;  2Z3Y A;  2L54 A;  5D5V B;  1WI9 A;  2V6C A;  3L00 A;  2CW0 F;  3TO9 A;  3D0S A;  4EJV A;  3P9K A;  5J6X A;  4QWQ A;  2PBI A;  2UXN A;  1LDD A;  1BI2 A;  1I6X A;  1Z1D A;  1VTN C;  3KP7 A;  1P4X A;  3R0A A;  2GWR A;  4Q4Z F;  1TQP A;  1ZLK A;  3J7A O;  2WV0 A;  3I53 A;  3J81 K;  1IN4 A;  3L7W A;  4EV0 A;  3P9C A;  1OYW A;  1SFU A;  1SD7 A;  1MJB A;  1QZZ A;  1XMA A;  4CHU A;  3F8C A;  4HYE A;  3I59 B;  4P55 A;  4P96 A;  3HRT A;  2DK5 A;  3VEP A;  2YSR A;  4KMF A;  1OR7 A;  1TQI A;  3GLX A;  2O6G E;  1WWX A;  2CSO A;  1DPU A;  1OKR A;  2QLZ A;  2K86 A;  3CO7 C;  4XLP F;  3GO5 A;  2W25 A;  3FXR A;  3M7G A;  2ZNY A;  3V7R A;  3HOT A;  3K0L A;  2LF7 A;  1PDN C;  2DLL A;  5H6Q A;  3DXJ F;  5ICG A;  3LAJ A;  2Y48 A;  1ZAO A;  2GZW A;  5F64 A;  2A68 F;  2CFX A;  2QVO A;  3W6K B;  5DV5 A;  1LNW A;  1FZP B;  1LDJ A;  5K5R A;  2VON A;  1IUY A;  1I1S A;  3O6B B;  4IXA A;  2IT0 A;  1IZ1 A;  4IVN A;  2MBF A;  4BQA A;  2GAU A;  1XSV A;  4ENJ A;  3F3X A;  1R36 A;  4AIJ A;  2EFW A;  2DO7 A;  1IXC A;  1HKT A;  3FX3 A;  3TDU C;  4G94 A;  1ZAR A;  4WK8 F;  3KZZ A;  4ZYE A;  4BHP A;  1BBY A;  4I01 A;  1XB4 A;  2E7W A;  1S7A A;  2ZCW A;  2EK5 A;  1FYM A;  1ZRE A;  2RVC A;  4P5O A;  1SAX A;  4D0P A;  5J8C A;  4DQ2 A;  3BY6 A;  4WX9 A;  5CVJ A;  4HV5 A;  2ACJ A;  2KRF A;  1HKQ A;  1IN8 A;  2Z33 A;  5HLG A;  3TO6 A;  2IRF G;  3GEZ A;  3Q9S A;  2MH9 A;  2GA1 A;  2QUF A;  3F6O A;  1HW1 A;  4RGS A;  2M87 A;  1BI1 A;  4XLN F;  3NEU A;  3HYI A;  4MNU A;  2YPR A;  1HXD A;  3RKY A;  3MWM A;  3LA7 A;  3WTS C;  4N9I A;  2LKP A;  3FM3 A;  1HBX G;  1ZRF A;  1R1V A;  3FXQ A;  5CJ9 A;  5K5O A;  5ILS A;  3W6J B;  3IWF A;  2EA2 A;  2W84 A;  3KZY A;  5HDK A;  3O2P E;  1KU9 A;  1BI0 A;  3HRU A;  4YG2 F;  2BEO A;  5LRS A;  3IHU A;  4G6Q A;  1FSH A;  2MH2 A;  1B9N A;  4E70 A;  3WTW C;  3F21 A;  3DV8 A;  3JTH A;  2VBY A;  4OIQ F;  2D2W A;  2IVM A;  4PDK A;  1U3E M;  3D5L A;  2G7H A;  2C6Y A;  1E2X A;  1G3S A;  4M9S A;  1RI7 A;  3ZN0 A;  4NB5 A;  1MKM A;  2XKP A;  1DDN A;  1IW7 F;  5LBQ A;  2P6S A;  3FMR A;  2MA3 A;  2EA4 A;  3WTV C;  4KFC A;  1FBQ A;  3KP3 A;  3N97 A;  3MEX A;  5H20 A;  1KQ0 A;  1T39 A;  2A6E F;  2RGV A;  3U2R A;  2E7X A;  2FBI A;  3T0Y A;  4OIP F;  3IL2 A;  1MGT A;  1U6G A;  5DDG A;  4IRG A;  1J75 A;  4CIC A;  3RTR A;  1S6L A;  1MDM A;  5KK1 A;  3EDP A;  2R3S A;  1R5H A;  2D45 A;  1R23 A;  5LGT A;  1FPQ A;  5DD8 A;  2H09 A;  1IN6 A;  2EFN A;  3R6S A;  2VBZ A;  3F6V A;  4OIN F;  4F7Z A;  4JQF A;  2FBH A;  1JHF A;  5E18 F;  1TW3 A;  3J80 K;  1A04 A;  2P6T A;  3IC7 A;  1UST A;  2FSW A;  3F8B A;  4HDV A;  3CUQ B;  2MC3 A;  3GYH X;  2OZ6 A;  3DFG A;  3MCZ A;  2ETH A;  1BC8 C;  2L02 A;  4KNY A;  1TQM A;  2BYV E;  4OIR F;  2RC4 A;  1USS A;  2VOD A;  3BZ6 A;  2HEO A;  5LHH A;  1T2K A;  4PGH A;  5L3C A;  4NQW A;  2HQN A;  1I5Z A;  5ICF A;  4CDG A;  5LEK A;  3JSO A;  2M5W A;  3KEO A;  3MZH A;  1OPC A;  4FT8 A;  4L0Y B;  4EVI A;  4PCQ A;  1F5T A;  4MQV A;  4WXD A;  1RUN A;  5K1Y A;  4WWC A;  2JSC A;  4A12 A;  4I0B A;  1FSE A;  3EUH A;  3R4K A;  1IAW A;  3WE3 A;  4HAM A;  3ZMV A;  3IRQ A;  2JPB A;  1KU3 A;  1FT9 A;  2ZNZ A;  2P8T A;  5HDG A;  2FE3 A;  4YFN F;  2Y75 A;  3QPT A;  3ELK A;  2KIM A;  1UHM A;  1J0R A;  4ZZL A;  5HS8 A;  5D4S A;  4ETS A;  2A69 F;  4XSX F;  2VBX A;  4M72 A;  5IT3 A;  1HQC A;  1FY7 A;  1P92 A;  2FU4 A;  2DW4 A;  1F4K A;  3P7N A;  1RIO H;  3ZMT A;  4GCV A;  2FQ3 A;  1MDM B;  4UXN A;  3H3U A;  3ZN1 A;  2F2E A;  4RS8 A;  2GIV A;  3WGH A;  2XRO A;  3KP4 A;  2XAQ A;  5A2Q Z;  3IKT A;  1J2X A;  1GXP A;  2NRA C;  1J5Y A;  3OV8 A;  1XMK A;  4XSZ F;  5F1R A;  1KQ8 A;  3DEU A;  4YFX F;  1IN7 A;  1QGP A;  1TLH B;  2X0L A;  3HSF A;  3EYI A;  3E5Q A;  1ZGA A;  3HOS A;  4EGZ A;  2PFB A;  3FWE A;  3QRF F;  3GUD A;  2DK8 A;  3FMS A;  1Z91 A;  1D5V A;  5FLX K;  1T38 A;  1FBS A;  2HFH A;  3QU3 A;  5JI6 A;  3WU1 B;  4MHG A;  1SMT A;  2KJC A;  1T0F A;  1YW9 A;  3SHF A;  2H94 A;  2FML A;  2HTJ A;  5E8I A;  1YTY A;  4ASN A;  1DUX C;  2OAZ A;  4O5V A;  1LJ9 A;  3ROU A;  3GFM A;  1B6A A;  3BWG A;  5LLQ A;  2HGC A;  3GVA A;  4MEY F;  4M6Y A;  1QNT A;  4KIF A;  4R79 A;  1W5T A;  3KCC A;  2BGC A;  2JZY A;  4I09 A;  2GXG A;  1I1G A;  3IWZ A;  1QO0 D;  2M30 A;  4PZJ A;  3V4G A;  2DI3 A;  2VC1 A;  4QLC U;  1MJ9 A;  5ILV A;  3LQR A;  1X3U A;  1R1U A;  3E5X A;  2H27 A;  1PP8 F;  4H0E A;  5HS9 A;  4G7Z F;  4EM2 A;  1XGO A;  4GGG A;  1BJA A;  4EJT A;  2R7D A;  5CVR A;  3ZMD A;  3IRR A;  2FRH A;  1UHW A;  5CYV A;  4N0B A;  3KE2 A;  2V1D A;  1P4A A;  2W57 A;  1DPR A;  3E97 A;  5D5W B;  4OOI A;  2W24 A;  1HW5 A;  4CO8 A;  4Y17 A;  3P9I A;  4HF1 A;  2Q8K A;  5HLI A;  5L3B A;  1TBX A;  1XGM A;  1XN7 A;  3Q9V A;  2FMY A;  3AAF A;  3EET A;  3I58 A;  4A6D A;  5FD5 A;  2K4J A;  3L9F A;  1OYY A;  2H6B A;  1ZGJ A;  1W5S A;  3F8N A;  4HDU A;  1QPM A;  4LLN A;  3KP6 A;  3QP6 A;  4U7B A;  4RB0 A;  5D6E A;  5J8F A;  2IW5 A;  1KU7 A;  3HHH A;  1W7P B;  2X4H A;  2HTS A;  4JK1 X;  5D6F A;  1J7K A;  3FMQ A;  2OQR A;  2HKX A;  2ADU A;  1CGP A;  2FBK A;  1Z05 A;  3R60 A;  3MFK A;  2J5P A;  3KEQ A;  4RB1 A;  3WTZ A;  4AIK A;  3RKW A;  4AVP A;  1WQ2 A;  2Z99 A;  4L9N A;  3LST A;  3QU6 A;  4KA4 A;  4PGG A;  2FA5 A;  4L5J A;  1LDK B;  2OU2 A;  2PJP A;  4R1H A;  1FP2 A;  2M45 A;  2QQA A;  5LEJ A;  1ZG3 A;  2VE8 A;  3K1N A;  2QQ9 A;  2LDU A;  5DCM B;  3K1P A;  1BIB A;  2COM A;  1XGN A;  2NAZ A;  5HDN A;  2Y0M A;  4HBL A;  3H92 A;  3TQN A;  1JE8 A;  5D5U B;  2RN7 A;  3I64 A;  2DQR A;  3FHZ A;  1R1T A;  1ONV A;  3T1B A;  1K6O A;  2MLG A;  3N4M A;  1BM9 A;  4L5I A;  3F23 A;  1ZG1 A;  3I59 A;  3K69 A;  1O3S A;  3GWZ A;  2ZKZ A;  2P5K A;  4YIF A;  1RZ4 A;  2V9V A;  2O3F A;  1KU2 A;  2EV0 A;  2QYO A;  3ZMZ A;  1S3J A;  1H9G A;  3KLO A;  1BN5 A;  2R7F A;  2HQR A;  3L2C A;  3GZ5 A;  3FF5 A;  3L09 A;  2AS5 F;  3KET A;  2M1B A;  3WU0 A;  1LVA A;  3OOP A;  4L0Z B;  2DTR A;  4RGR A;  1T6S A;  3DPT A;  2VE9 A;  2PEX A;  2EFO A;  2FNA A;  1QBJ A;  2OZU A;  1B59 A;  2DPU A;  5BPI A;  3B73 A;  1P2F A;  3FM5 A;  3RDI A;  1V3F A;  1FYK A;  3Q5F A;  2A5Y B;  3FZV A;  3HRM A;  4KIB A;  1FNN A;  2KIU A;  2XIG A;  1H9T A;  4N9H A;  1SD4 A;  4BHC A;  5L3F A;  3GFJ A;  3S2W A;  4Q5S F;  4M9Z A;  1FWZ A;  4A0X A;  2OA4 A;  2AXL A;  1Z6T A;  3VFZ A;  2J5O A;  3HSE A;  1YS7 A;  3LA2 A;  1Y0U A;  1ZRD A;  1RUO A;  1REP C;  1FOK A;  1XSX A;  2ELH A;  1EH7 A;  1P4W A;  4AIH A;  5LHI A;  2ZME B;  2ZO4 A;  1Z7U A;  3CLO A;  3GZ6 A;  1KA8 A;  1G3W A;  2EV5 A;  2DFI A;  3V8L A;  3WE2 A;  4FHT A;  3LA3 A;  4GXO A;  1G6N A;  4UVB A;  3KP5 A;  4RGX A;  5CLS A;  4EQQ A;  2P7V B;  2XAJ A;  2STT A;  3LAP A;  1Q1H A;  4OMZ A;  4FX4 A;  5IT9 Z;  4Q47 A;  4A2U A;  2RKH A;  2XHK A;  3TOB A;  2BV6 A;  3K9T A;  2FXA A;  5ILU A;  4MTD A;  3B02 A;  3MQ0 A;  2EB7 A;  3TKY A;  4IPA A;  2JPC A;  3ZMU A;  1R7J A;  5L3G A;  4RB3 C;  3BP8 A;  4OIO F;  3CO6 C;  4RAZ A;  4IF4 A;  3V7S A;  5LRR A;  5LGU A;  4ESF A;  4FX0 A;  1WSU A;  1OMI A;  2VOP A;  2PI0 A;  2P5L C;  5H6R A;  4IJA A;  1SFE A;  4UHT A;  2M8E A;  3CUQ C;  4JBA A;  2FNP A;  3JW4 A;  4RGU A;  4LLG F;  5TJJ A;  4OMY A;  2ESN A;  4NHJ A;  3T5X A;  4HW0 A;  5AON A;  5JVT A;  4G7O F;  5F6F A;  1D3Y A;  3BJO A;  2A61 A;  1HSJ A;  3ABT A;  2Q0O A;  4EJO A;  2ESH A;  2A07 F;  3ULQ B;  2PG4 A;  3QP5 A;  2IP2 A;  2LNB A;  5E1X A;  4LB5 A;  2DAO A;  1XDS A;  4A0Z A;  2L4M A;  4Z2Y A;  1F1Z A;  2P5V A;  1HKS A;  1Z9C A;  1BI3 A;  4KDP A;  4L9J A;  5BOX A;  4A5M A;  3E6D A;  3WTT C;  3RPU A;  3BOQ A;  4YII A;  4A5N A;  2K02 A;  2E1N A;  2FF4 A;  2D1V A;  3ECO A;  1ULY A;  5FO5 A;  3PQK A;  5D8L B;  1STZ A;  4KYW A;  2OBP A;  2Z9O A;  2BE5 F;  1XCV A;  1G3T A;  4HX7 A;  3EQL F;  3WG9 A;  2QQB A;  3LWF A;  3R61 A;  1YLF A;  5E8G A;  5K5Q A;  2K7L A;  4M6X A;  5DEQ A;  5DUK A;  5L3E A;  2EWN A;  4ENK A;  1SMY F;  5E1W A;  3M9A A;  2YX7 A;  3DQV C;  3NQO A;  2NYX A;  2DT5 A;  4WCG A;  2RNJ A;  1I27 A;  4GO1 A;  3DP7 A;  2CG4 A;  3BDD A;  3CJN A;  2D1H A;  1S8N A;  1BIA A;  3EYY A;  1D8J A;  3RYP A;  1ZYR F;  5E1Z B;  4ZH4 F;  1T98 A;  2WTE A;  1SD5 A;  1U8R A;  4OU0 A;  2OQG A;  2ZXJ A;  3VOD A;  1AOY A;  2B0L A;  5HS7 A;  2GQQ A;  4UNO A;  4LB6 B;  1W7P A;  3JAM K;  5LGN A;  4LG0 A;  1U5T C;  3U9G A;  2KJB A;  1BC7 C;  4G6D A;  4B09 A;  1WKM A;  4UUV A;  3F8M A;  4I7H A;  3NRV A;  2HDC A;  1EH8 A;  2QEN A;  2WWY A;  4EJW A;  5L3D A;  5ICE A;  3I54 A;  3I71 A;  2ZJ2 A;  1L3L A;  5JHU A;  4UV9 A;  1G3Y A;  1G4D A;  2G7U A;  3ECH A;  1O3T A;  4UVC A;  5DCM A;  1V4R A;  2P7C B;  3RPQ A;  2CO5 A;  2HYG D;  4EMS A;  3M8F A;  4UVA A;  4LD5 A;  4WF2 A;  1YFH A;  1F9N A;  1ZRC A;  2XKO A;  2VN2 A;  2BBY A;  2GXB A;  2YR2 A;  3GF2 A;  3V7C A;  3HSR A;  4EGY A;  2P4W A;  3T8R A;  2Z5U A;  2CGP A;  4KIG A;  3GFI A;  4ENN A;  2H6C A;  3CTA A;  3WTX C;  1HW2 A;  2WC2 A;  4LG0 B;  2O8X A;  3KFW X;  2O03 A;  3E6B A;  2QZ8 A;  1FYL A;  4M73 A;  2OD5 A;  1EH6 A;  4ESB A;  5CVU A;  4XRF A;  2CWE A;  4WXH A;  4EJU A;  1J59 A;  4IHT A;  1FX7 A;  5BPD A;  4MGR A;  5JFR A;  4HX8 A;  5ICC A;  2F5D A;  1D8K A;  4YFK F;  1DP7 P;  3RKX A;  4MEX F;  1ON2 A;  3TDZ C;  2ZFW A;  2IA2 A;  4KIC A;  5DYM A;  2V79 A;  4G8X A;  1R00 A;  4UV8 A;  3C18 A;  1FBU A;  1W7P D;  1U5T A;  3SQN A;  1U5T B;  2F5C A;  3DKW A;  3C3W A;  1O3R A;  3LQQ A;  3REO A;  1CF7 B;  4AD9 A;  2ZBK A;  2CQK A;  3I4P A;  3WTU C;  1B9M A;  1TTY A;  3QAH A;  1S7O A;  1ZG5 A;  4ON0 A;  4ESJ A;  2VOO A;  1GVJ A;  4HOB A;  2IA0 A;  1U2W A;  2JTV A;  2XGX A;  3E6C C;  2RV8 A;  4LK1 F;  5AIP A;  3HTU A;  4BAY A;  3J81 Z;  4R8H A;  4I2O A;  3H3Z A;  2XAF A;  3BRO A;  4HQM A;  1K7A A;  3MZY A;  3BPX A;  4HX4 A;  3F22 A;  5CVI A;  3CUO A;  3QOP A;  3LFK A;  3DF8 A;  1WRJ A;  1XCB A;  2KKO A;  2G9W A;  5FD6 A;  4LMY A;  4ZYD A;  4XBF A;  5CVV A;  4A0Y A;  4M71 A;  4U7D A;  5DUI A;  3SFZ A;  3GX4 X;  1S29 A;  2MLK A;  2EJR A;  1YYV A;  1B1B A;  3F8F A;  3SZP A;  4LJZ F;  1MZB A;  1PP7 U;  2PN6 A;  4Y13 A;  4LGW A;  4LLL A;  1MJA A;  1YW8 A;  3E6M A;  3VOE A;  4G7H F;  1KGS A;  1UB9 A;  2NNN A;  4L18 B;  2Q2E A;  2QWW A;  4M9X A;  3BJ6 A;  2XRN A;  2PQ8 A;  4HZF A;  3GXO A;  3M1E A;  4Y15 A;  3WTY C;  4EM0 B;  2PMH A;  1ZHF A;  4A6E A;  2VXZ A;  1K78 A;  4IRI A;  1O57 A;  5EEH A;  2A3S A;  1Z6R A;  1PUE E;  3CUQ A;  4GYG A;  4LFU A;  4BHB A;  5DD4 A;  4RB2 C;  4GYI A;  3RYR A;  3RIR A;  3RI4 A;  2O0Y A;  4CGZ A;  3MAJ A;  4ZYG A;  2FEZ A;  5D8K B;  5BQT A;  1HST A;  2YU3 A;  2F5E A;  1ON1 A;  1QQI A;  3I5U A;  3GW2 A;  4U88 A;  3CDH A;  1P6R A;  3G73 A;  4IRH A;  1TNT A;  3E3V A;  1XD7 A;  2XUB A;  4MTE A;  3IKV A;  1SFX A;  1AWC A;  2XAG A;  2JRT A;  4KT5 C;  1OYI A;  5BS6 A;  3WOD F;  2NNY A;  2K27 A;  2LF8 A;  4WXC A;  1MD0 A;  2TDX A;  3M8E A;  2VBW A;  5D5X B;  3ABU A;  4CZZ A;  3GFL A;  3FXU A;  1ZH5 A;  2STW A;  4O3M A;  1IRG A;  5TRD A;  4EM1 A;  4HA8 A;  4HLX A;  1YQA A;  4ZYH A;  4HV6 A;  2VT2 A;  5FGM A;  3KLN A;  3TGN A;  5DCF A;  1UFM A;  1YO5 C;  1FC3 A;  5AIQ A;  3F72 A;  3R0J A;  3RJP A;  1LQ1 A;  2HZT A;  1J9I A;  1H0M A;  1U78 A;  4BYY A;  4S05 A;  3TOA A;  4BNC A;  2EFQ A;  4TV7 A;  2EV6 A;  4O6J A;  3SXY A;  1O7F A;  3BPV A;  4HF0 A;  4M74 A;  1KQ9 A;  4KN4 X;  2KIF A;  5IT9 K;  2XVC A;  3HRS A;  2L3D A;  1GHC A;  1R5G A;  2W85 A;  1UCR A;  3K1M A;  1IXR C;  3ZQ7 A;  4KUM A;  1L0O C;  2IPQ X;  4HF2 A;  3KP2 A;  2XV4 S;  1ZLJ A;  1TW2 A;  3QPH A;  4L9T A;  1RNL A;  4Q48 A;  4ZZD A;  1IF1 A;  5FB2 A;  2HWV A;  1YS6 A;  1LEB A;  3V8J A;  5ERI A;  3ZP5 A;  4RAY A;  2HKO A;  5E17 F;  1KYW A;  3PQJ A;  3BJA A;  3JTG A;  2A6H F;  3JSP A;  5KVR A;  1ZN2 A;  4U0Y A;  1IN5 A;  4P9F A;  2F5F A;  1IXS B;  4KN7 X;  4DNC A;  5ED4 A;  4G9Y A;  3WGI A;  1W4M A;  1R22 A;  1K78 B;  1YW7 A;  2HR3 A;  2FOK A;  3O3K A;  2RDP A;  5FLX Z;  2XAS A;  1O7L A;  2QM3 A;  1GXQ A;  1LEA A;  3I0T A;  2UXX A;  3C7J A;  2DBB A;  4I98 B;  4ENM A;  2NS0 A;  3U1D A;  2PMU A;  2DPD A;  3DPL C;  2K4B A;  3TO7 A;  2O61 A;  1KYZ A;  4CYD A;  5E20 A;  3PFI A;  5EEG A;  1XSD A;  3G3Z A;  2YX4 A;  1XGS A;  2XAH A;  5HOO A;  3ML6 A;  2LSO A;  4HQE A;  4K2E A;  3J80 Z;  2RQP A;  1QZY A;  2VC0 A;  1BOA A;  4U0V A;  2QBY B;  3HUG A;  1JHH A;  2QBY A;  5A2Q K;  1C0W A;  3ZPL A;  3WGG A;  1NHA A;  3ERE D;  1TNS A;  4S04 A;  4IHS A;  3C1D A;  4I0A A;  1R58 A;  4CXF A;  5LHG A;  2GA2 A;  2ISY A;  2IA1 A;  4KMU X;  4I02 A;  5HLH A;  3JAM Z;  1FP1 D;  5HVQ C;  4P9U A;  2UWM A;  2CYY A;  2V1X A;  3HTS B;  1E17 A;  2E1C A;  3COA C;  1B4A A;  3HHG A;  1JXS A;  2DQL A;  1JGS A;  1LB2 A;  1EV7 A;  6PAX A;  3K2Z A;  5D4R A;  4HLY A;  5BMZ A;  1O3Q A;  3E5U A; 
#chains in the Genus database with same CATH topology
 2XAU A;  2EIN H;  2HOE A;  3HIF A;  3T8T A;  2HQ5 A;  1D1C A;  4B8X A;  2DJI A;  4ANJ A;  2UZK A;  4MQ9 F;  2JT1 A;  1P7J A;  5FFX A;  1YG2 A;  1ODD A;  3ZMS A;  1VFC A;  1MIJ A;  1MBF A;  1N75 A;  3NWS A;  5K7H A;  1FMW A;  4CZC A;  2DYR H;  2JK3 A;  3QYE A;  1G8X A;  1XS9 A;  1VND A;  4W1U A;  2HYF A;  4BDY A;  2L4A A;  4L5E A;  3OS1 A;  4AWX B;  2VT3 A;  1BA5 A;  2L01 A;  4XN3 A;  1CF7 A;  4E7J A;  2ISZ A;  1YIO A;  2HS5 A;  2IJL A;  3VB2 A;  4U0W A;  2ZME A;  5E3O A;  1K79 A;  5FFZ A;  1FLI A;  4BH9 A;  3V8K A;  3SZT A;  3GTJ J;  5JR3 A;  2MD5 A;  1IRF A;  1SD6 A;  2BY0 A;  3G4S I;  3W6V A;  4BQN A;  3J7A Y;  2EIJ H;  3S15 J;  2PLY A;  2DU9 A;  3NAU A;  4LK0 F;  4A3L J;  4MFE A;  1XDU A;  1KON A;  3LFU A;  4L9V A;  1WJ5 A;  2V1U A;  2GIZ A;  1PYV A;  5BNG A;  2EFP A;  3ISP A;  4BXU A;  2Z3Y A;  2L54 A;  5DS9 A;  5D5V B;  1WJA A;  4XIC A;  1WI9 A;  2V6C A;  2OCC H;  3L00 A;  3QYB A;  3RSN A;  2CW0 F;  3TO9 A;  3D0S A;  4EJV A;  5LFA A;  3P9K A;  1TT0 A;  5J6X A;  4QWQ A;  2PBI A;  4AC0 A;  4EEF G;  1EKE A;  1LDD A;  2UXN A;  1BI2 A;  2VKE A;  2ZJQ F;  1I6X A;  4JOM A;  1Z1D A;  1VTN C;  2XPV A;  1TWG J;  3KP7 A;  1P4X A;  3R0A A;  3W2W A;  2GWR A;  2N8G A;  3L2R A;  4Q4Z F;  2L9V A;  2CV2 A;  1TQP A;  2X1C A;  1ZLK A;  3J7A O;  3TP0 A;  4V2G A;  2WV0 A;  3I53 A;  2HOA A;  3J81 K;  2W4S A;  1IN4 A;  1IRX A;  3L7W A;  4EV0 A;  3H35 A;  2E2J J;  3CCS I;  3P9C A;  1OYW A;  1SFU A;  1V55 H;  1SD7 A;  1Y39 A;  3LSM A;  1MJB A;  3B6A A;  4B43 A;  1QZZ A;  1XMA A;  3VSK A;  4CHU A;  3F8C A;  5DM7 F;  3S2D J;  4G6T B;  3I59 B;  4HYE A;  4P55 A;  5J3L A;  4P96 A;  5FKN A;  3HRT A;  2DK5 A;  3VEP A;  2YSR A;  4KMF A;  4XRS A;  1OR7 A;  2LTP A;  1TQI A;  3GLX A;  2JQ7 A;  2VJ5 A;  2O6G E;  2A5W A;  4PJ0 C;  1WWX A;  2CSO A;  1DPU A;  1ZEL A;  1OKR A;  2F6C A;  2QLZ A;  4F55 A;  2K86 A;  3CO7 C;  4XLP F;  3GO5 A;  3SDG A;  2QSH X;  1N25 A;  4Y52 J;  3S93 A;  2W25 A;  4XKW A;  5IYB J;  3FXR A;  1Y1V J;  1VQ4 I;  3M7G A;  2ZNY A;  2WB1 N;  3CCM I;  1R49 A;  3V7R A;  2CW7 A;  3HOT A;  4E7S A;  3K0L A;  4DJA A;  2LF7 A;  1PDN C;  2DLL A;  1UZC A;  2DA1 A;  5H6Q A;  4BY7 J;  1LUJ B;  2HYJ A;  4BJ5 C;  3FXO A;  3DXJ F;  4PJN A;  5ICG A;  3W2A A;  2VXD A;  1S72 I;  1E3P A;  4IHX A;  1RPW A;  3LAJ A;  4PSX A;  2Y48 A;  2LRD A;  3A03 A;  1ZAO A;  3ZQF A;  3JRC A;  2GZW A;  5F64 A;  2A68 F;  4N4O B;  1X3Z B;  2CFX A;  2QVO A;  3W6K B;  5DV5 A;  1LNW A;  4E7K A;  1WJB A;  1FZP B;  1LDJ A;  3PO3 J;  5K5R A;  2VON A;  2OTJ I;  5TGT A;  1IUY A;  1I1S A;  1MMS A;  3O6B B;  1LKX A;  2R7X A;  5J4V A;  4IXA A;  4PJM A;  2IT0 A;  1IZ1 A;  1EF4 A;  4IVN A;  2A05 A;  2MBF A;  4YIR X;  4BQA A;  2NOG A;  2MFZ A;  2GAU A;  1IDZ A;  1XSV A;  3CLQ A;  3PUF A;  2KDO A;  3A0B C;  1QU3 A;  4BJT A;  2VLA A;  2DA5 A;  4ENJ A;  1PUF A;  3F3X A;  1I50 J;  1T08 B;  5EG0 A;  1R36 A;  1YRN B;  1BR2 A;  1JGG A;  4AIJ A;  2EZK A;  2EFW A;  2DO7 A;  3N05 A;  2YUS A;  1IXC A;  1HKT A;  3FX3 A;  5KNL A;  4RM2 A;  3GLL A;  3TDU C;  3K10 A;  4BJ6 C;  4G94 A;  1ZAR A;  4WK8 F;  3KZZ A;  4G12 A;  3BCA A;  2ZSH B;  2OPT A;  4ZYE A;  2JJ7 A;  2RNG A;  3GTM J;  4IZZ A;  4BHP A;  2VKD A;  2KHM A;  1FOY A;  1BBY A;  4I01 A;  3S1R J;  3OYJ A;  4V19 K;  1XB4 A;  2E7W A;  2VL8 A;  1S7A A;  1MMG A;  2KIQ A;  2EK5 A;  2ZCW A;  1FYM A;  1ZRE A;  1W1W E;  1BW6 A;  2RVC A;  4P5O A;  4X0G A;  1SAX A;  4D0P A;  1F36 A;  2ZC2 A;  1WFX A;  4DQ2 A;  3BY6 A;  5J8C A;  4WX9 A;  5CVJ A;  3FXL A;  2WAQ A;  4HV5 A;  2EQR A;  3JRE A;  1GV5 A;  3ZQG A;  2ACJ A;  2KRF A;  1HKQ A;  4D5F A;  2DMN A;  3C2B A;  1IN8 A;  3HOW J;  4U87 A;  1JKQ C;  2Z33 A;  5HLG A;  2JVG A;  3TO6 A;  2IRF G;  3GEZ A;  3Q9S A;  2MH9 A;  2GA1 A;  2QUF A;  4LOC A;  1R5I D;  3OYD A;  3OSG A;  3F6O A;  1A6Q A;  2LG4 A;  4Y3O A;  3HL2 A;  3GTL J;  4A3G J;  1HW1 A;  3EUH C;  4RGS A;  2EBI A;  2M87 A;  1BI1 A;  4XLN F;  1D1B A;  4RM3 A;  5JHF A;  2VQH A;  3NEU A;  4HG2 A;  2DYS H;  3FXK A;  3HYI A;  4MNU A;  3WU2 C;  1FTT A;  2YPR A;  3KYC B;  1HXD A;  1DGR M;  3RKY A;  4HNV A;  4A93 J;  2QF7 A;  5TIS C;  3MWM A;  3LA7 A;  3WTS C;  4N9I A;  4NBQ A;  1I6H J;  1QHG A;  2LKP A;  3FM3 A;  5E79 C;  1HBX G;  1ZRF A;  3OYM A;  1R1V A;  3FXQ A;  5CJ9 A;  4M6V A;  3MKL A;  2R5Z A;  1K6Y A;  2B7E A;  1UHS A;  5K5O A;  1QPI A;  2E2I J;  1H89 C;  4E4H A;  5ILS A;  3W6J B;  1DGW Y;  3IWF A;  1OR7 C;  2EA2 A;  2X9D A;  2W84 A;  3KZY A;  5M5W J;  5FLV A;  5HDK A;  3O2P E;  1BI0 A;  1KU9 A;  3HRU A;  4YG2 F;  4XLH A;  2GLO A;  2BEO A;  4CCL A;  5LRS A;  3IHU A;  4F52 A;  3IUO A;  3S1M J;  4G6Q A;  3H0D A;  1FSH A;  2MH2 A;  2HOT A;  1B9N A;  4E70 A;  3A0H C;  3OR1 C;  2BY2 A;  1LE8 A;  2BW3 B;  3WTW C;  3F21 A;  3CCR I;  3DV8 A;  1H88 C;  3DLA A;  2VBY A;  3JTH A;  4OIQ F;  3I4N J;  2D2W A;  1WI3 A;  3ZCO A;  2IVM A;  4PDK A;  3LNQ A;  3DEW A;  3ZQQ A;  1BOB A;  3AFH A;  1U3E M;  3D5L A;  4X1E A;  5IP7 J;  2G7H A;  3SFI A;  2C6Y A;  1E2X A;  1G3S A;  1QVT A;  1HOM A;  4FE7 A;  4M9S A;  3A02 A;  2NVU B;  1RI7 A;  1VQK I;  3S16 J;  1ETY A;  4NB5 A;  3ZN0 A;  4B44 A;  1MKM A;  2XKP A;  1DDN A;  1IW7 F;  5LBQ A;  4J19 A;  1H8A C;  3BG5 A;  2P6S A;  3FMR A;  3BCB A;  2MA3 A;  2EA4 A;  3WTV C;  4KFC A;  1FBQ A;  3KP3 A;  3N97 A;  2DT6 A;  3MEX A;  2E5Z A;  4PFP A;  2K9L A;  4XR6 A;  3DTI A;  5H20 A;  2EZI A;  2DXI A;  1KQ0 A;  1LFP A;  1T39 A;  2RGV A;  2A6E F;  2LKS A;  3U2R A;  2E7X A;  4AYB N;  2FBI A;  3T0Y A;  4OIP F;  1MMD A;  1X1B A;  4CCN A;  3BG6 A;  3MKW B;  2F48 A;  1QZE A;  2DMT A;  2DA2 A;  3SDB A;  3IL2 A;  4ZDP A;  2H8R A;  1MGT A;  1U6G A;  2HXI A;  5DDG A;  2ZME C;  2KDZ A;  5JLW A;  3MZ8 A;  3F0C A;  3GZN B;  4IRG A;  1YE9 A;  1A31 A;  5B3S H;  3P5J A;  3CCJ I;  3RPU D;  1J75 A;  4CIC A;  4M3B A;  3RTR A;  1S6L A;  3JRI A;  1MDM A;  2QSF X;  4ZTF A;  5KK1 A;  3X2Q H;  2M2E A;  1NH3 A;  3QQA A;  1U9O A;  4XQF A;  3FIW A;  1W36 C;  3I56 I;  1IV6 A;  5FKO A;  3EDP A;  2R3S A;  1W0U A;  4CH7 A;  1R5H A;  2D45 A;  3GTK J;  1R23 A;  1WJE A;  5LGT A;  5GP9 A;  2ELK A;  4BEH A;  1FPQ A;  5DD8 A;  2XSJ C;  2JUC A;  1JUM A;  4F93 B;  2Y30 A;  1GLN A;  2LH9 A;  2H09 A;  4ZDO A;  1MBE A;  1RC9 A;  3LSG A;  5C3E J;  1IN6 A;  3DU6 A;  2EFN A;  3R6S A;  2VBZ A;  2ZB9 A;  2MAB A;  4HST A;  2I5U A;  3F6V A;  5EZG A;  2W48 A;  4XLC A;  3PL8 A;  4FIS A;  4Y7N J;  4BDZ A;  4OIN F;  1IRZ A;  4HNT A;  4F7Z A;  4JQF A;  5F08 A;  2DOD A;  4Y4R A;  2FBH A;  1JHF A;  2R7V A;  5E18 F;  3PUB A;  4CA0 A;  4B48 A;  1TW3 A;  1MBK A;  1XX5 A;  3J80 K;  1A04 A;  2P6T A;  3C2H A;  1TT5 B;  3IC7 A;  4AU7 A;  1UST A;  2FSW A;  1DP3 A;  3F8B A;  4HDV A;  2K3P A;  3CUQ B;  1TWA J;  2L5Q A;  3LOC A;  2MC3 A;  3GYH X;  2OZ6 A;  3DFG A;  3MCZ A;  2XDV A;  3ERM A;  2UV1 A;  1VQ6 I;  3HOU J;  2ETH A;  2LD5 A;  2KL4 A;  1G2H A;  1BC8 C;  2L02 A;  1SAU A;  1Z3X A;  4GFB A;  1X19 A;  4KNY A;  3UKG A;  1I3Q J;  1TQM A;  4P1W A;  2BYV E;  5FRO A;  3QPS A;  1W5C C;  4OIR F;  4NDL A;  2RC4 A;  2DN0 A;  4N4N B;  1USS A;  4BL0 B;  4A3F J;  2VOD A;  3BZ6 A;  2HEO A;  5LHH A;  1T2K A;  4UB6 C;  1VI0 A;  1WJC A;  4PGH A;  2XGD A;  5L3C A;  4NQW A;  2HQN A;  1I5Z A;  5K7F A;  5ICF A;  3VYU B;  4CDG A;  4QIW N;  3CCY A;  5LEK A;  3JSO A;  2M5W A;  3KEO A;  3MZH A;  2LLK A;  1OPC A;  4FT8 A;  4L0Y B;  4IKF A;  4EVI A;  4PCQ A;  1F5T A;  3H5A A;  3BTJ A;  4MQV A;  2PJR A;  1EJ9 A;  1HA8 A;  3H5R A;  4WXD A;  1RUN A;  4CCM A;  2L7F P;  2ELJ A;  5K1Y A;  2JSC A;  2HXO A;  4WWC A;  4A12 A;  3QYF A;  3K4B A;  3DEE A;  3FXM A;  4I0B A;  1FSE A;  4PSW A;  3EUH A;  4ABZ A;  1BR1 A;  3ABK H;  5JVG F;  1K61 A;  2E19 A;  3OIQ A;  5FRM A;  3R4K A;  1IAW A;  1DU6 A;  3WE3 A;  4HAM A;  3ZMV A;  3IRQ A;  2DA6 A;  4A69 C;  2JPB A;  1OCR H;  4B3X A;  1KU3 A;  1RR7 A;  3TW7 A;  3EUK L;  1FT9 A;  4V2F A;  2ZNZ A;  4II3 A;  1X3W B;  2P8T A;  5HDG A;  2FE3 A;  4YFN F;  2Y75 A;  1XMX A;  3QPT A;  5B5E C;  4A3B J;  3ELK A;  3SZG A;  3OYH A;  1VQM I;  2KIM A;  1HLV A;  3TP3 A;  1R71 A;  2ME6 A;  3AG2 H;  1UHM A;  1J0R A;  4ZZL A;  5HS8 A;  5D4S A;  4ETS A;  2A69 F;  4XSX F;  4IX7 A;  2VBX A;  4M72 A;  3HZJ A;  3U21 A;  1HQC A;  5IT3 A;  1FY7 A;  1T33 A;  3OL4 A;  1P92 A;  5CKT A;  3RZO J;  2FU4 A;  1VQN I;  1Z7L A;  2CUE A;  2X48 A;  2DW4 A;  1F4K A;  2I8D A;  3P7N A;  1RIO H;  2KLO A;  3ZMT A;  3JCU C;  4GCV A;  2FQ3 A;  1MDM B;  4UXN A;  3H3U A;  3ZN1 A;  2F2E A;  3HJE A;  2X85 A;  4RS8 A;  2GIV A;  3WGH A;  2XRO A;  1SEU A;  3KP4 A;  1ENH A;  2KQR A;  2XAQ A;  1NG7 A;  5A2Q Z;  3IKT A;  1J2X A;  1GXP A;  2NRA C;  1J5Y A;  3HOZ J;  3I55 I;  2FX0 A;  3OV8 A;  2LBF B;  2BXY A;  2R5Y A;  4C2T A;  2NS8 A;  1XMK A;  4XSZ F;  5F1R A;  2CS3 A;  1KQ8 A;  1FOX A;  2JMW A;  3CDL A;  3DEU A;  1SC7 A;  1BL0 A;  1ETX A;  4YFX F;  1V54 H;  2VJI A;  1IN7 A;  3OYN A;  1QGP A;  3AKZ A;  4BEH B;  4NC8 A;  1TLH B;  4M3G A;  2X0L A;  3HSF A;  4QTR A;  4OAZ A;  4KJZ A;  3EYI A;  3E5Q A;  5GAE J;  1ZGA A;  3OYG A;  3HOS A;  2IGO A;  5KAF C;  2PFB A;  3FWE A;  4EGZ A;  3QRF F;  2XPW A;  3GUD A;  1X2M A;  2DK8 A;  3FMS A;  4XLE A;  1Z91 A;  4D1Q A;  3KX2 A;  3MMY B;  1HDP A;  1D5V A;  5FLX K;  1T38 A;  3CCQ I;  1FBS A;  2HFH A;  3E1S A;  3QU3 A;  3VYT B;  2OC6 A;  5JI6 A;  3HDD A;  4RMN A;  3WU1 B;  3BTI A;  4MHG A;  1SMT A;  2LK2 A;  2KJC A;  1T0F A;  3FIS A;  4XM3 A;  2JVH A;  2OJE D;  3CC7 I;  1YW9 A;  3SHF A;  2H94 A;  2FML A;  2HTJ A;  2RQQ A;  5E8I A;  2DOF A;  4ASN A;  1YTY A;  1DUX C;  1BR4 A;  2OAZ A;  4QPO A;  3BG3 A;  4O5V A;  1Z77 A;  1LJ9 A;  2P81 A;  3ROU A;  3GFM A;  1B6A A;  3BWG A;  4PJL A;  5LLQ A;  1RR8 C;  2HPM A;  2HGC A;  2LP0 A;  3GVA A;  4MEY F;  4M6Y A;  1QNT A;  2ICW G;  1FEX A;  1FIA A;  2Z16 A;  4KIF A;  3ZQL A;  4H4K C;  4R79 A;  1G59 A;  2OTL I;  1W5T A;  1MMN A;  3KCC A;  3RZD J;  2BGC A;  1IG7 A;  2JZY A;  4I09 A;  1M1E B;  2GXG A;  2CJJ A;  1I1G A;  3IWZ A;  5F04 A;  2KRH A;  3ZQI A;  1QO0 D;  2M30 A;  1HDD C;  4PZJ A;  2ECB A;  3V4G A;  2DI3 A;  2KMU A;  4CYC B;  2VC1 A;  3KIO A;  4QLC U;  3C2G A;  3E0J B;  1MJ9 A;  5ILV A;  3G1L A;  3LQR A;  2X1D A;  1LFU P;  2M4G A;  1X3U A;  1OCZ H;  1R1U A;  1X58 A;  3E5X A;  3H5N A;  2H27 A;  4NUB A;  1PP8 F;  4H0E A;  5HS9 A;  4G7Z F;  2AO9 A;  4ITV A;  3Q0U A;  4XRM A;  4EM2 A;  4KIS A;  4DYQ A;  1XGO A;  1WCM J;  4GGG A;  1BJA A;  3M07 A;  3FBN B;  3CCE I;  2R5Y B;  4EJT A;  4I6Z A;  2R7D A;  1Y56 A;  5CVR A;  1JUS A;  3ZMD A;  3IRR A;  1UEL B;  2X51 A;  2MGQ A;  2QSG X;  4C3I J;  2K85 A;  2LKX A;  2FRH A;  1VZ0 A;  4BE0 A;  1UHW A;  5CYV A;  2VAS A;  4N0B A;  3KE2 A;  2V1D A;  2QEX I;  1VQL I;  1P4A A;  2HI3 A;  4XON A;  3ASN H;  2W57 A;  1DPR A;  3E97 A;  3K7A J;  5D5W B;  4OOI A;  2W24 A;  1HW5 A;  4CO8 A;  3BG7 A;  1W36 D;  4PUS A;  4CCJ A;  4DBQ A;  4DIQ A;  4Y17 A;  3P9I A;  4HF1 A;  4AID A;  3IV5 A;  2Q8K A;  4DW6 A;  5HLI A;  3BZC A;  2XB5 A;  1OCO H;  3PSI A;  5L3B A;  2VUM J;  1AA7 A;  1TBX A;  1XGM A;  1XN7 A;  3Q9V A;  2FMY A;  3AAF A;  5IP9 J;  2KP6 A;  5GPC A;  3CCU I;  2ECC A;  3EET A;  3I58 A;  4ZJZ A;  5KCM A;  1WH7 A;  2K4J A;  3L9F A;  5FD5 A;  4A6D A;  3OYK A;  3HOY J;  1OYY A;  2H6B A;  4E7I A;  2M3A A;  1ZGJ A;  3PNY A;  4B47 A;  2XRL A;  1W5S A;  3F8N A;  4HDU A;  1QPM A;  3ZQC A;  2DFH A;  4LLN A;  1WJD A;  3G71 I;  3KP6 A;  2IGK A;  3QP6 A;  3OYI A;  5FKL A;  4AVZ A;  2BHZ A;  4U7B A;  3OWT A;  4RB0 A;  1S5L C;  2E36 A;  5D6E A;  5J8F A;  2IW5 A;  1KU7 A;  3HHH A;  1W7P B;  2JSP A;  4XK4 A;  2X4H A;  2HTS A;  4JK1 X;  2DTZ A;  5D6F A;  1J7K A;  3FMQ A;  5HLT A;  3S3O A;  1YX3 A;  2EIL H;  2OQR A;  2HKX A;  2ADU A;  1CGP A;  2FBK A;  3QPL A;  1Z05 A;  3R60 A;  1AHD P;  1RKW A;  1YIJ I;  1QVU A;  3MFK A;  1LE8 B;  2J5P A;  3KEQ A;  4RB1 A;  2R7Z J;  1FTZ A;  3MVP A;  3WTZ A;  4AIK A;  3TMO A;  1B72 B;  3RKW A;  4AVP A;  1WQ2 A;  2IGN A;  2Z99 A;  3FKJ A;  3ZGK A;  4L9N A;  1FIP A;  3LST A;  3QU6 A;  4BU2 A;  5GTH C;  4PGG A;  4FE4 A;  4KA4 A;  2WAQ N;  2FA5 A;  4L5J A;  1LDK B;  2EZL A;  2OU2 A;  4FET A;  2PJP A;  2DFE A;  3CMM A;  5EGO A;  4R1H A;  1FP2 A;  2M45 A;  2QQA A;  3M3Y J;  5LEJ A;  3HOV J;  4M3E A;  1OIS A;  1ZG3 A;  3FKI J;  2VE8 A;  2Q1Z B;  1ZR2 A;  3K1N A;  2L2O A;  2QQ9 A;  3SYT A;  5M3M J;  2LDU A;  2D5V A;  2EIM H;  2HDW A;  5DCM B;  5GAD J;  3K1P A;  1XPX A;  1BIB A;  2COM A;  1XGN A;  1PVE A;  1JJ8 C;  2NAZ A;  2QCO A;  5HDN A;  2VPL A;  2Y0M A;  4HBL A;  3BTC A;  3H92 A;  1TWC J;  3PO2 J;  3FHN A;  3H3V K;  2JN6 A;  3TQN A;  4BE1 A;  1JE8 A;  1OJL A;  3IH4 A;  5D5U B;  2RN7 A;  3I64 A;  5IOZ A;  1A6I A;  2DQR A;  3UR3 C;  1XTA A;  4MIM A;  5IPA A;  3FHZ A;  4C2M J;  1R1T A;  1PUF B;  1DQU A;  1ONV A;  3Q0V A;  3HM5 A;  3T1B A;  1K6O A;  2MLG A;  3N4M A;  3TED A;  4BXX J;  1BM9 A;  1P7I A;  5EJC A;  3HPG A;  3S17 J;  4L5I A;  3F23 A;  1ZG1 A;  3I59 A;  1MH3 A;  3K69 A;  2AXT C;  2XF7 A;  2HNH A;  1O3S A;  4J01 A;  5HOD A;  2PJR B;  3CZ6 A;  3GWZ A;  1YJN I;  2ZKZ A;  2P5K A;  4YIF A;  3JRB A;  3LSK A;  3GTQ J;  2B9S A;  1RZ4 A;  4HRI A;  4DOZ A;  2V9V A;  2DFF A;  2O3F A;  1IJW C;  1KU2 A;  2EV0 A;  2QYO A;  5GAG J;  3ZMZ A;  1S3J A;  1ORK A;  1H9G A;  2W00 A;  3KLO A;  1BN5 A;  3IH3 A;  1X4O A;  2R7F A;  3K70 C;  1E3O C;  2HQR A;  3L2C A;  3GZ5 A;  3BQY A;  2X6X A;  3FF5 A;  4JP0 A;  1HC8 A;  3SEZ A;  5B1B H;  1MNE A;  3L09 A;  4JX4 A;  3G1M A;  3RQ4 A;  2AS5 F;  4GDF A;  3A01 B;  4DYR A;  2ZFU A;  4CCO A;  3A01 A;  4YEL A;  4IEJ A;  3GTP J;  3BT9 A;  1Z0X A;  3KET A;  4IHW A;  2M1B A;  2BZT A;  3WU0 A;  2WB1 A;  3DWL E;  1LVA A;  2M7A A;  3OOP A;  4L0Z B;  2DTR A;  4D7N A;  2V4J C;  1APL C;  4RGR A;  1GUU A;  1T6S A;  3DPT A;  2X6W A;  2VE9 A;  2PEX A;  4D7M A;  3D5S C;  4RDU A;  2EFO A;  1CQT A;  2FNA A;  1QBJ A;  2OZU A;  1B59 A;  2DPU A;  2IS6 A;  5BPI A;  3GBG A;  2CU7 A;  3B73 A;  3K4M A;  1W0T A;  1P2F A;  3FM5 A;  3RDI A;  1JT0 A;  1V3F A;  4XKC A;  5EEA A;  1FYK A;  3Q5F A;  2A5Y B;  3HRM A;  3CF2 A;  3FZV A;  5CQG A;  4KIB A;  1FNN A;  1I39 A;  2LR8 A;  2KIU A;  3W3C A;  4QPQ A;  2COB A;  2CQN A;  2XIG A;  1T8I A;  4XOR A;  5FLM J;  3K6G A;  1H9T A;  4N9H A;  5LD2 C;  3HPH A;  3HC7 A;  4CCK A;  2IGM A;  2DMP A;  1SD4 A;  4BHC A;  1JKO C;  3DTK A;  5L3F A;  2MC4 A;  3GFJ A;  3S2W A;  4Q5S F;  1DU0 A;  1SVO A;  4M9Z A;  5EYR A;  1FWZ A;  4A0X A;  2OA4 A;  2AXL A;  1X1C A;  1Z6T A;  3VSL A;  1A35 A;  3VFZ A;  3K4C A;  4OWR B;  2J5O A;  3HSE A;  1YJW I;  1E3H A;  1YS7 A;  1YOV B;  3GME A;  3LA2 A;  1Y0U A;  2FD5 A;  4FAS D;  1RUO A;  1REP C;  1ZRD A;  1FOK A;  1SFK A;  4XMY A;  1XSX A;  1JTX A;  9ANT A;  2ELH A;  3BC8 A;  1EH7 A;  2HQA A;  1P4W A;  3OYB A;  4AIH A;  3FK6 A;  4II2 A;  5LHI A;  4RA2 A;  1YIT I;  2ZME B;  2R7O A;  2NVQ J;  1BW5 A;  4LIV A;  2ZO4 A;  4RLF A;  2E35 A;  1Z7U A;  3CLO A;  2BVM A;  3GZ6 A;  1KA8 A;  4JX6 A;  1G3W A;  2V7F A;  1U9N A;  4MO7 A;  5EGO B;  1IV8 A;  2EV5 A;  1JKR C;  2DFI A;  2DJN A;  4PK4 A;  3V8L A;  3WE2 A;  4A3J J;  4FHT A;  3LA3 A;  4GXO A;  5J47 A;  1G6N A;  4UVB A;  5J40 A;  2CQ7 A;  3KP5 A;  4RGX A;  5CLS A;  1Q1V A;  5GAH J;  2Y9Z A;  3KPH A;  4EQQ A;  2DOE A;  2P7V B;  2XAJ A;  3GCM A;  2TCT A;  3H1C A;  4ZYA A;  3DLL F;  2O8K A;  2STT A;  3LAP A;  2F5V A;  1Q1H A;  4OMZ A;  4FX4 A;  2OV7 A;  5IT9 Z;  4Q47 A;  4A2U A;  2RKH A;  4E7L A;  2XHK A;  3TOB A;  2MW8 A;  2BV6 A;  2R7R A;  3K9T A;  4XN0 A;  2FXA A;  5ILU A;  3BG9 A;  4MTD A;  1D5Y A;  3CD6 I;  4X6A J;  3BLY A;  5IOY A;  3B02 A;  3MQ0 A;  1LPQ A;  3OYC A;  2EB7 A;  3TKY A;  4IPA A;  2V6E A;  4ZC3 A;  2R92 J;  5KHD A;  3JRF A;  4F3Q A;  2JPC A;  3ZMU A;  1R7J A;  5L3G A;  2AHQ A;  4RB3 C;  3LSR A;  3K70 D;  3BP8 A;  3HKZ N;  2WAE A;  4OIO F;  3CO6 C;  4RAG A;  2KT0 A;  1QHH D;  2Z2S B;  3RCO A;  4RAZ A;  4IF4 A;  2LYC A;  2KZV A;  3V7S A;  5LRR A;  5LGU A;  3HB9 A;  3DCF A;  1YHQ I;  3S32 A;  4ESF A;  2LBF A;  1LFB A;  4XNF A;  4FX0 A;  1GVD A;  1WSU A;  1OMI A;  2VOP A;  2L7Z A;  2PI0 A;  2AQE A;  2F4O B;  2OUM A;  3K2A A;  3JRH A;  3BTL A;  3SJM A;  5M5X J;  2P5L C;  5H6R A;  4IJA A;  2HZD A;  1SFE A;  3H9Q A;  4UHT A;  4PFO A;  2M8E A;  3CUQ C;  4JBA A;  2FNP A;  2P0W A;  3JW4 A;  4RGU A;  4LLG F;  5TJJ A;  4OMY A;  2ESN A;  3I9V 2;  1JTY A;  4NHJ A;  3ZXS A;  2K5C A;  2LY1 A;  3DPU A;  3T5X A;  4HW0 A;  5AON A;  4BXF A;  5JVT A;  2Y0S A;  4HNU A;  4G7O F;  1IUF A;  2ZXH A;  2IBD A;  5F6F A;  1D3Y A;  2H1K A;  3BJO A;  4D5C A;  2A61 A;  1HSJ A;  3ABT A;  2Q0O A;  4EJO A;  2ESH A;  4FQG A;  3ULQ B;  2A07 F;  1ERD A;  4XLA A;  5IYD J;  2PG4 A;  3QP5 A;  2IP2 A;  2LNB A;  4B4C A;  3OL3 A;  3LSI A;  2WAD A;  5E1X A;  4LB5 A;  2DAO A;  1XDS A;  4A0Z A;  2L4M A;  4Z2Y A;  3O8G A;  1F1Z A;  2P5V A;  2KRC A;  2F4I A;  1HKS A;  5E3N A;  1ACI A;  2B63 J;  2L9R A;  3M4O J;  1U0J A;  2AQF A;  4DBR A;  5IP6 A;  1Z9C A;  2MG4 A;  3MN2 A;  1BI3 A;  3CF5 F;  2VJ4 A;  3HOX J;  4KDP A;  5GTI C;  4L9J A;  2W82 A;  5BOX A;  1T0F C;  4A5M A;  3E6D A;  4EAT A;  3WTT C;  1YI2 I;  3RPU A;  3BOQ A;  3DBH B;  4YII A;  3WG7 H;  3L1P A;  4A5N A;  2ZJR F;  3SEQ A;  4C2U A;  2K02 A;  3EPZ A;  2E1N A;  2FF4 A;  2D1V A;  3LSH A;  3ECO A;  1ULY A;  5FJ8 J;  5FO5 A;  4BQO A;  3PQK A;  3DKY A;  2M4K A;  4C3H J;  5D8L B;  1STZ A;  4KT6 A;  4KYW A;  3OYE A;  1FJL A;  4OAY A;  2OBP A;  1WH5 A;  2NS7 A;  2V1N A;  2BE5 F;  5F0H A;  2Z9O A;  1XCV A;  1VQ7 I;  1G3T A;  1VF9 A;  4HX7 A;  3EQL F;  4BS9 A;  2QQ8 A;  3WG9 A;  2G0E A;  2QQB A;  3LWF A;  3R61 A;  1YLF A;  5E8G A;  5F0F A;  2PX9 A;  5K5Q A;  4F92 B;  2YU9 J;  4FTH A;  3K4K A;  2K7L A;  3DBL B;  2QKM B;  3IP4 B;  1VQ9 I;  5B66 C;  4M6X A;  5DEQ A;  5DUK A;  5L3E A;  1V5E A;  2EWN A;  2V9K A;  4ENK A;  1SMY F;  5E1W A;  3M9A A;  3J7Z I;  2YX7 A;  3DQV C;  1X2N A;  3NQO A;  2NYX A;  2DT5 A;  4WCG A;  2RNJ A;  1XC5 A;  1I27 A;  4GO1 A;  3DP7 A;  4HPQ A;  2CG4 A;  1OQY A;  3BDD A;  3CJN A;  2D1H A;  1TP4 A;  4A3D J;  1S8N A;  3CP2 A;  1BIA A;  3EYY A;  4CUG A;  2WAF A;  3AG1 H;  1QA6 A;  3DU5 A;  4M3F A;  4UB8 C;  2CV0 A;  4BY1 J;  3RYP A;  1D8J A;  1ZYR F;  3S3N A;  1FMV A;  5E1Z B;  5CQE A;  1SVL A;  3BQZ A;  1X1D A;  4MLO A;  4ZH4 F;  1ETQ A;  2VQG A;  1T98 A;  2O9L A;  2WTE A;  1SD5 A;  1U8R A;  1WPK A;  4OU0 A;  2QKL B;  1OCC H;  2OQG A;  2ZXJ A;  3VOD A;  1AOY A;  4ZTJ A;  2B0L A;  2CQX A;  5GPA A;  4HSR A;  5HS7 A;  2WBM A;  2GQQ A;  4UNO A;  3OOU A;  1O4X A;  4LB6 B;  5IY5 H;  2EZH A;  2NVY J;  1W7P A;  3JAM K;  4LIT A;  5LGN A;  4LG0 A;  1U5T C;  3U9G A;  4D9J A;  4NNJ A;  2K9N A;  2KJB A;  2W7N A;  1BC7 C;  4G6D A;  3BR5 A;  3QWL A;  4B09 A;  3L2U A;  1WKM A;  2JA2 A;  2GM4 A;  2VKV A;  4UUV A;  2IS2 A;  1UJ8 A;  2XF5 A;  3I4M J;  1ETV A;  3F8M A;  4I7H A;  1R6R A;  3NRV A;  5JLX A;  2ID3 A;  2HDC A;  1EH8 A;  2QEN A;  2WWY A;  4J00 A;  3ESW B;  3NWT A;  3TW6 A;  3DBR B;  4EJW A;  2M7B A;  5J1R A;  4BUP A;  2V26 A;  1IO2 A;  3FDY A;  2HPI A;  3CJQ B;  5L3D A;  5IYC J;  5ICE A;  3H36 A;  4BAC A;  3I54 A;  3I71 A;  3CQZ J;  2ZJ2 A;  4YRV A;  3VYR B;  1L3L A;  5JHU A;  1SVM A;  1S9H A;  4UV9 A;  2XSD C;  1G3Y A;  1Y8R B;  4UUS A;  3MKY B;  2G7U A;  1G4D A;  3ECH A;  3OS2 A;  2DA3 A;  2MYS A;  1R4N B;  1O3T A;  4UVC A;  2CFO A;  5DCM A;  1VQ8 I;  3W2V A;  1ZK8 A;  3CC2 I;  1U8B A;  3KYL A;  1GT0 C;  1V4R A;  2P7C B;  1ZQ3 P;  4KIT B;  4NC6 A;  3RPQ A;  2CO5 A;  2HYG D;  4IL6 C;  4XRS G;  4DZP A;  2XPU A;  4EMS A;  3HKZ A;  3M8F A;  3KYD B;  3CC4 I;  4UVA A;  4LD5 A;  4WF2 A;  4S0H B;  1YFH A;  2JA7 J;  1F9N A;  3Q0W A;  1MBJ A;  3PSF A;  3E7L A;  1ZRC A;  2XKO A;  2VI6 A;  3CMY A;  3LSP A;  2VN2 A;  5J1Y A;  2BBY A;  2QGU A;  2Y9Y A;  1T56 A;  3PIO F;  3CCV I;  2GXB A;  2YR2 A;  2OCE A;  3GF2 A;  3V7C A;  3HSR A;  4EGY A;  1YX5 A;  2L7K A;  2P4W A;  3S1N J;  3T8R A;  2W1O A;  2Z5U A;  2CGP A;  2ZSI B;  2L9N A;  1WGX A;  2R5Z B;  2JA5 J;  4KIG A;  3GFI A;  4ENN A;  2H6C A;  2R7W A;  1Y0N A;  3IAM 2;  2IAI A;  4PJJ A;  3CTA A;  3WTX C;  3IH2 A;  4RLQ A;  1HW2 A;  2WC2 A;  4LG0 B;  2O8X A;  3BZK A;  4BE2 A;  3KFW X;  1P9Q C;  1TC3 C;  1TL8 A;  3ABL H;  1Z67 A;  2O03 A;  1TZL A;  3E6B A;  2QZ8 A;  2M8G X;  1FYL A;  2GXA A;  3VDX A;  4M73 A;  2OD5 A;  1NK2 P;  1EH6 A;  1JUP A;  2E1M B;  4Y33 A;  4DYC A;  1JKP C;  4ESB A;  4C9Y A;  5CVU A;  4XRF A;  2CWE A;  4RAF A;  4WXH A;  4EJU A;  1J59 A;  4IHT A;  4CSW A;  1FX7 A;  2K40 A;  2E34 A;  2HVS A;  2IS4 A;  2LMD A;  5BPD A;  4MGR A;  1X1A A;  1K4T A;  5JFR A;  1RRJ A;  4HX8 A;  5ICC A;  2F5D A;  1D8K A;  4YFK F;  1DP7 P;  1WHU A;  3RKX A;  3ABM H;  1ON2 A;  3TDZ C;  4MEX F;  2ZFW A;  5E3M A;  2LVS A;  5FKK A;  5F0C A;  2A6T A;  2IA2 A;  4KIC A;  2M0C A;  5DYM A;  1HF0 A;  2V79 A;  4G8X A;  1HCR A;  1PJR A;  1R00 A;  1ETW A;  1RKT A;  2MSY A;  3QOE A;  4UV8 A;  3C18 A;  2CQQ A;  3HBL A;  3FK7 A;  3G1O A;  1FBU A;  1W7P D;  4B3A A;  1T95 A;  2R0Q C;  1U5T A;  2X6Y A;  3AG3 H;  3SQN A;  1U5T B;  2EPF A;  2KZG A;  5EG0 B;  2F5C A;  3QOD A;  1WZ2 A;  1YRN A;  3DKW A;  2LY2 A;  3C3W A;  5HNH A;  1O3R A;  1GV2 A;  3LQQ A;  3CME I;  2R7S A;  3REO A;  2BY1 A;  1CF7 B;  4M3D A;  2VIX A;  4AD9 A;  3Q3S A;  1UG0 A;  2ZBK A;  3TL4 X;  2CQK A;  3HG9 A;  3I4P A;  4A3E J;  3WTU C;  2VQC A;  3BR1 A;  1B9M A;  2Y2Z A;  1A36 A;  1TTY A;  1MSF C;  1IDY A;  1ZKG A;  2VJJ A;  1RES A;  1S7O A;  3QAH A;  2ZJP F;  1ZG5 A;  4ON0 A;  2MD0 A;  3UNG C;  2BY3 A;  4ESJ A;  4BBS J;  2VOO A;  1GVJ A;  3L2V A;  1UG2 A;  2VPR A;  3AL0 C;  2Y31 A;  2Y69 H;  1JT6 A;  1OLT A;  2IA0 A;  4HOB A;  5J1U A;  3L2Q A;  1U2W A;  2DOA A;  2JTV A;  2XGX A;  3E6C C;  2RV8 A;  4LK1 F;  5AIP A;  3HTU A;  3LL7 A;  2K3F A;  3K4J A;  4BAY A;  3A2K A;  3B6C A;  3J81 Z;  4R8H A;  5FRN A;  3CJR B;  4I2O A;  3H3Z A;  1NG6 A;  2XAF A;  3BRO A;  4HQM A;  1IGN A;  1K7A A;  3HXL A;  1V5F A;  3MZY A;  3BPX A;  4XKB A;  4HX4 A;  3G2B A;  3F22 A;  1NK3 P;  5CVI A;  2HOS A;  1S7E A;  1ITY A;  1BJZ A;  4HEA 2;  3V42 A;  3CUO A;  3QOP A;  5E3L A;  3LFK A;  4AUX A;  4DGW B;  3DF8 A;  4CYC A;  2WV1 A;  3CCL I;  1WRJ A;  2EIK H;  1XCB A;  2E60 A;  2G9W A;  2KKO A;  5FD6 A;  4XOT A;  1ETK A;  4LMY A;  4ZYD A;  4RBO A;  1F43 A;  4XBF A;  5CVV A;  2PMZ A;  4A0Y A;  4M71 A;  1VQ5 I;  3FXJ A;  3ZOB A;  4U7D A;  5DUI A;  3SFZ A;  3GX4 X;  3VWB A;  3GTO J;  1S29 A;  2ZXI A;  2MLK A;  3WHB A;  2EJR A;  1YYV A;  1B1B A;  3F8F A;  3SZP A;  4IOA F;  4LJZ F;  2CRG A;  4LG3 A;  1MZB A;  1PP7 U;  3OY9 A;  3OR2 C;  2LY9 A;  1Z21 A;  2PN6 A;  4GRI A;  2CH0 A;  3LMM A;  5C4J J;  4Y13 A;  3OSF A;  1UMQ A;  4LGW A;  4LLL A;  1MJA A;  2TRT A;  1YW8 A;  2X1E A;  3E6M A;  3RQI A;  3VOE A;  4G7H F;  4QSH A;  3K4L A;  1KGS A;  1UB9 A;  4A3I J;  3DKX A;  2NNN A;  4L18 B;  3PFY A;  2L9S A;  2JA8 J;  2Q2E A;  2QWW A;  2NXN B;  4M9X A;  3BJ6 A;  1B8I A;  2XRN A;  2Q2E B;  3HGY A;  1X1P A;  2PQ8 A;  2K9Q A;  4HZF A;  3H0G J;  3OYF A;  3GXO A;  3PIP F;  1K83 J;  2R93 J;  3H9G A;  3M1E A;  4Y15 A;  1Y6I A;  3WTY C;  4EM0 B;  1IC8 A;  2PMH A;  1K4S A;  1N78 A;  1ZHF A;  4A6E A;  2Y0S N;  2VXZ A;  1K78 A;  2XGE A;  1D0Y A;  2RRE A;  4IRI A;  1O57 A;  5EEH A;  2A3S A;  2Z1D A;  1Z6R A;  1PUE E;  2HVR A;  2LFB A;  3CUQ A;  2FUG 2;  3H9J A;  4GYG A;  4LIU A;  4LFU A;  2HDD A;  1MBG A;  3TBI A;  4BHB A;  5DD4 A;  4RB2 C;  4GYI A;  1KZH A;  3CDI A;  3RYR A;  3RIR A;  2XC7 A;  4IHY A;  3RI4 A;  2O0Y A;  4IQ4 A;  4CGZ A;  3M1C A;  3MAJ A;  2CV1 A;  4ZYG A;  1ZTR A;  3G6E I;  5DM6 F;  1FOW A;  2FEZ A;  5D8K B;  3PM1 A;  5BQT A;  1TWH J;  1HST A;  2YU3 A;  3OYA A;  2LRE A;  2F5E A;  1ON1 A;  1QQI A;  3I5U A;  3GW2 A;  4U88 A;  3CDH A;  1P6R A;  3G73 A;  4IRH A;  3NAR A;  3KEY A;  2XF6 A;  4B1R A;  1J09 A;  1TNT A;  3E3V A;  2CUJ A;  1XD7 A;  3OYL A;  2XUB A;  3OMY A;  2E1M C;  1MBH A;  4MTE A;  3IKV A;  2I10 A;  1D0X A;  1SFX A;  4NC7 A;  4NQW B;  1AKH B;  1AWC A;  2XAG A;  2JRT A;  4KT5 C;  1AKH A;  3D1N I;  3JR9 A;  3MD2 A;  3JRA A;  4W97 A;  2BW3 A;  4FCY A;  1OYI A;  1B72 A;  2FOW A;  4I76 A;  5BS6 A;  3A1Y A;  3WOD F;  2NNY A;  2NVX J;  2K27 A;  2LF8 A;  4WXC A;  5EF6 A;  1MD0 A;  2TDX A;  3M8E A;  2VBW A;  5D5X B;  3ABU A;  4CZZ A;  3FBI B;  3M8J A;  3GFL A;  3FXU A;  3BR3 A;  1ZH5 A;  1SAN A;  2STW A;  4O3M A;  1IRG A;  5TRD A;  4Z6Y A;  1A5J A;  3PNV A;  2E2H J;  4EM1 A;  4HA8 A;  4HLX A;  3RKQ A;  1YQA A;  3ZRG A;  3BR2 A;  4ZYH A;  3DTE A;  4HV6 A;  2VT2 A;  4BBR J;  5FGM A;  2BVL A;  3KLN A;  1WJF A;  1ZR4 A;  3HGG A;  3TGN A;  5C4X J;  1VQO I;  5DCF A;  1UFM A;  2DMU A;  4I99 C;  1MNM C;  1YO5 C;  3F9K A;  1FC3 A;  5AIQ A;  3F72 A;  3R0J A;  4IQJ A;  3RJP A;  1LQ1 A;  4A3C J;  2HZT A;  1R9T J;  4E7H A;  1VQP I;  1J9I A;  3OIP A;  2GBY A;  3MKZ A;  1H0M A;  4IO9 F;  1U78 A;  2VB6 A;  2KFD A;  3CES A;  2KPM A;  3U1K A;  4BYY A;  1JI8 A;  3CMA I;  1Y8Q B;  2IXS A;  4JYK A;  1N77 A;  4S05 A;  2K9M A;  5K7Z A;  2DDB A;  4MFD A;  3ZQH A;  1MMA A;  1D1A A;  1AU7 A;  3TOA A;  4BNC A;  2EFQ A;  4TV7 A;  2EV6 A;  3EUA A;  2GOM A;  5EZH A;  5KAI C;  4O6J A;  5EDN A;  3SXY A;  2VKH A;  1O7F A;  5F1J A;  3BPV A;  2QA4 I;  3S3M A;  4HF0 A;  4M74 A;  1KQ9 A;  3KZI C;  4KN4 X;  2KIF A;  4IHV A;  5IT9 K;  2XB0 X;  2XVC A;  3HRS A;  2O7O A;  2L3D A;  3PJR A;  2FQ4 A;  2V9P A;  1R5G A;  2W85 A;  2R7T A;  1GHC A;  1EA3 A;  4XLF A;  3OS0 A;  5CPR B;  3AL0 B;  2EH3 A;  1UCR A;  2E5N A;  1X4P A;  3K1M A;  1IXR C;  2NOJ B;  2H8W A;  2UUZ A;  4KUM A;  1L0O C;  2ID6 A;  3CP8 A;  2IPQ X;  3S8P A;  3ZQ7 A;  4HF2 A;  3KP2 A;  2XV4 S;  4AYB A;  1ZLJ A;  1TW2 A;  3QPH A;  1XG1 A;  4L9T A;  5B1A H;  2LC2 A;  1RNL A;  3ONQ A;  5J4Y A;  4AM3 A;  2HU9 A;  4XKV A;  2X6O A;  4Q48 A;  4ZZD A;  1IF1 A;  2JA6 J;  1D0Z A;  3HUG B;  5FB2 A;  2HWV A;  1YS6 A;  1UAA A;  2M34 A;  5DTD A;  1B8I B;  1LEB A;  3V8J A;  3O8H A;  5ERI A;  3ZP5 A;  4RAY A;  2HKO A;  5E17 F;  2IEK A;  3J7Y J;  1KYW A;  3VYS B;  3PQJ A;  3BJA A;  2R7U A;  5F27 A;  3JTG A;  2A6H F;  3JSP A;  5KVR A;  1ZN2 A;  2BHY A;  4U0Y A;  2L7M P;  1IN5 A;  1QRY A;  4P9F A;  2O5R A;  2F5F A;  1IXS B;  4KN7 X;  4DNC A;  2DCE A;  5ED4 A;  2XGC A;  4G9Y A;  3WGI A;  1W4M A;  1RET A;  1I3A A;  3S14 J;  3WHC A;  1R22 A;  1K78 B;  1OCP A;  1OCT C;  2CMP A;  2R4G A;  1YW7 A;  2HR3 A;  2WY8 Q;  2FOK A;  2K9S A;  3O3K A;  3VPR A;  2NVT J;  2RDP A;  5FLX Z;  2XAS A;  2RAE A;  2BXZ A;  1O7L A;  2QM3 A;  2F4M B;  3PNT A;  1GXQ A;  1LEA A;  2CUZ A;  3BR0 A;  3I0T A;  2UXX A;  3JRG A;  3C7J A;  5FKM A;  2DBB A;  3LSJ A;  4UY8 I;  4I98 B;  1E0E A;  4E6K G;  3A4C A;  3K4N A;  4ENM A;  2NS0 A;  3U1D A;  3I3L A;  4C30 A;  3S2H J;  2PMU A;  5HNF A;  2E71 A;  2DPD A;  5M5Y J;  3JRD A;  3DPL C;  4XOP A;  2K4B A;  2ZXW H;  3IAS 2;  3TO7 A;  4BQQ A;  5H2F C;  2O61 A;  4E7Z A;  1KYZ A;  4CYD A;  5E20 A;  3PFI A;  1YJ9 I;  2OF7 A;  3HEF A;  3GTG J;  5EEG A;  1XSD A;  2JRM A;  3G3Z A;  2YX4 A;  1XGS A;  1MH4 A;  2JUG A;  2DMQ A;  3S1Q J;  1ZGW A;  2JWT A;  4DZJ A;  2XAH A;  1MND A;  1SFO J;  2VQL A;  3ML6 A;  2LSO A;  5HOO A;  4HQE A;  1JJ6 C;  4ZDL A;  4K2E A;  3J80 Z;  1V5G A;  2M9H A;  2LOO A;  2L0K A;  2RQP A;  2VC0 A;  1QZY A;  2HVQ A;  2M0M A;  1LVK A;  1BOA A;  4U0V A;  2H1L A;  2DDA A;  2QBY B;  3HUG A;  1JHH A;  4BGD A;  2QBY A;  5A2Q K;  2IS1 A;  2BOL A;  1C0W A;  1MW7 A;  2DT7 B;  3ZR8 X;  3WGG A;  3ZPL A;  2DA4 A;  1NHA A;  3ERE D;  1TNS A;  2YS9 A;  4C3J J;  4BKX A;  2WA0 A;  1MSE C;  1Y1W J;  2CW8 A;  4S04 A;  2ME0 A;  4IHS A;  3C1D A;  3AG4 H;  3ASO H;  1R58 A;  4I0A A;  2FJ1 A;  4CXF A;  4F91 B;  5LHG A;  4XID A;  2GA2 A;  4IOC F;  2ISY A;  2IA1 A;  4KMU X;  4JX5 A;  4I02 A;  5HLH A;  3L2W A;  3JAM Z;  1OFC X;  1FP1 D;  5HVQ C;  2PMZ N;  5C44 J;  4P9U A;  4YEJ A;  4XL9 A;  1NTC A;  2UWM A;  2CYY A;  2GOX B;  2V1X A;  3HTS B;  1TWF J;  2KIS A;  1R4M B;  4UUS B;  1E17 A;  2CUF A;  3OIO A;  1GDT A;  2E1C A;  3COA C;  1Z3Y A;  1B4A A;  3HHG A;  1JXS A;  3D5R C;  2WY7 Q;  2DQL A;  1JGS A;  5M3F J;  1POG A;  2E1O A;  3CJT B;  4UUT A;  1ETO A;  1LB2 A;  1EV7 A;  1WVR A;  6PAX A;  3BR6 A;  4A3M J;  2DA7 A;  3K2Z A;  5D4R A;  4HLY A;  2R7Q A;  5BMZ A;  4A3K J;  1O3Q A;  3E5U A; 
#chains in the Genus database with same CATH homology
 2HOE A;  3HIF A;  3T8T A;  4B8X A;  2UZK A;  4MQ9 F;  2JT1 A;  5FFX A;  1YG2 A;  1ODD A;  3ZMS A;  2HYF A;  2L4A A;  4AWX B;  2VT3 A;  2L01 A;  1CF7 A;  2ISZ A;  1YIO A;  2HS5 A;  2IJL A;  3VB2 A;  4U0W A;  2ZME A;  1K79 A;  5FFZ A;  1FLI A;  4BH9 A;  3V8K A;  3SZT A;  5JR3 A;  2MD5 A;  1IRF A;  1SD6 A;  2PLY A;  2DU9 A;  4LK0 F;  1XDU A;  4L9V A;  2V1U A;  2EFP A;  3ISP A;  4BXU A;  2Z3Y A;  2L54 A;  5D5V B;  1WI9 A;  2V6C A;  3L00 A;  2CW0 F;  3TO9 A;  3D0S A;  4EJV A;  3P9K A;  5J6X A;  4QWQ A;  2PBI A;  2UXN A;  1LDD A;  1BI2 A;  1I6X A;  1Z1D A;  1VTN C;  3KP7 A;  1P4X A;  3R0A A;  2GWR A;  4Q4Z F;  1TQP A;  1ZLK A;  3J7A O;  2WV0 A;  3I53 A;  3J81 K;  1IN4 A;  3L7W A;  4EV0 A;  3P9C A;  1OYW A;  1SFU A;  1SD7 A;  1MJB A;  1QZZ A;  1XMA A;  4CHU A;  3F8C A;  4HYE A;  3I59 B;  4P55 A;  4P96 A;  3HRT A;  2DK5 A;  3VEP A;  2YSR A;  4KMF A;  1OR7 A;  1TQI A;  3GLX A;  2O6G E;  1WWX A;  2CSO A;  1DPU A;  1OKR A;  2QLZ A;  2K86 A;  3CO7 C;  4XLP F;  3GO5 A;  2W25 A;  3FXR A;  3M7G A;  2ZNY A;  3V7R A;  3HOT A;  3K0L A;  2LF7 A;  1PDN C;  2DLL A;  5H6Q A;  3DXJ F;  5ICG A;  3LAJ A;  2Y48 A;  1ZAO A;  2GZW A;  5F64 A;  2A68 F;  2CFX A;  2QVO A;  3W6K B;  5DV5 A;  1LNW A;  1FZP B;  1LDJ A;  5K5R A;  2VON A;  1IUY A;  1I1S A;  3O6B B;  4IXA A;  2IT0 A;  1IZ1 A;  4IVN A;  2MBF A;  4BQA A;  2GAU A;  1XSV A;  4ENJ A;  3F3X A;  1R36 A;  4AIJ A;  2EFW A;  2DO7 A;  1IXC A;  1HKT A;  3FX3 A;  3TDU C;  4G94 A;  1ZAR A;  4WK8 F;  3KZZ A;  4ZYE A;  4BHP A;  1BBY A;  4I01 A;  1XB4 A;  2E7W A;  1S7A A;  2ZCW A;  2EK5 A;  1FYM A;  1ZRE A;  2RVC A;  4P5O A;  1SAX A;  4D0P A;  5J8C A;  4DQ2 A;  3BY6 A;  4WX9 A;  5CVJ A;  4HV5 A;  2ACJ A;  2KRF A;  1HKQ A;  1IN8 A;  2Z33 A;  5HLG A;  3TO6 A;  2IRF G;  3GEZ A;  3Q9S A;  2MH9 A;  2GA1 A;  2QUF A;  3F6O A;  1HW1 A;  4RGS A;  2M87 A;  1BI1 A;  4XLN F;  3NEU A;  3HYI A;  4MNU A;  2YPR A;  1HXD A;  3RKY A;  3MWM A;  3LA7 A;  3WTS C;  4N9I A;  2LKP A;  3FM3 A;  1HBX G;  1ZRF A;  1R1V A;  3FXQ A;  5CJ9 A;  5K5O A;  5ILS A;  3W6J B;  3IWF A;  2EA2 A;  2W84 A;  3KZY A;  5HDK A;  3O2P E;  1KU9 A;  1BI0 A;  3HRU A;  4YG2 F;  2BEO A;  5LRS A;  3IHU A;  4G6Q A;  1FSH A;  2MH2 A;  1B9N A;  4E70 A;  3WTW C;  3F21 A;  3DV8 A;  3JTH A;  2VBY A;  4OIQ F;  2D2W A;  2IVM A;  4PDK A;  1U3E M;  3D5L A;  2G7H A;  2C6Y A;  1E2X A;  1G3S A;  4M9S A;  1RI7 A;  3ZN0 A;  4NB5 A;  1MKM A;  2XKP A;  1DDN A;  1IW7 F;  5LBQ A;  2P6S A;  3FMR A;  2MA3 A;  2EA4 A;  3WTV C;  4KFC A;  1FBQ A;  3KP3 A;  3N97 A;  3MEX A;  5H20 A;  1KQ0 A;  1T39 A;  2A6E F;  2RGV A;  3U2R A;  2E7X A;  2FBI A;  3T0Y A;  4OIP F;  3IL2 A;  1MGT A;  1U6G A;  5DDG A;  4IRG A;  1J75 A;  4CIC A;  3RTR A;  1S6L A;  1MDM A;  5KK1 A;  3EDP A;  2R3S A;  1R5H A;  2D45 A;  1R23 A;  5LGT A;  1FPQ A;  5DD8 A;  2H09 A;  1IN6 A;  2EFN A;  3R6S A;  2VBZ A;  3F6V A;  4OIN F;  4F7Z A;  4JQF A;  2FBH A;  1JHF A;  5E18 F;  1TW3 A;  3J80 K;  1A04 A;  2P6T A;  3IC7 A;  1UST A;  2FSW A;  3F8B A;  4HDV A;  3CUQ B;  2MC3 A;  3GYH X;  2OZ6 A;  3DFG A;  3MCZ A;  2ETH A;  1BC8 C;  2L02 A;  4KNY A;  1TQM A;  2BYV E;  4OIR F;  2RC4 A;  1USS A;  2VOD A;  3BZ6 A;  2HEO A;  5LHH A;  1T2K A;  4PGH A;  5L3C A;  4NQW A;  2HQN A;  1I5Z A;  5ICF A;  4CDG A;  5LEK A;  3JSO A;  2M5W A;  3KEO A;  3MZH A;  1OPC A;  4FT8 A;  4L0Y B;  4EVI A;  4PCQ A;  1F5T A;  4MQV A;  4WXD A;  1RUN A;  5K1Y A;  4WWC A;  2JSC A;  4A12 A;  4I0B A;  1FSE A;  3EUH A;  3R4K A;  1IAW A;  3WE3 A;  4HAM A;  3ZMV A;  3IRQ A;  2JPB A;  1KU3 A;  1FT9 A;  2ZNZ A;  2P8T A;  5HDG A;  2FE3 A;  4YFN F;  2Y75 A;  3QPT A;  3ELK A;  2KIM A;  1UHM A;  1J0R A;  4ZZL A;  5HS8 A;  5D4S A;  4ETS A;  2A69 F;  4XSX F;  2VBX A;  4M72 A;  5IT3 A;  1HQC A;  1FY7 A;  1P92 A;  2FU4 A;  2DW4 A;  1F4K A;  3P7N A;  1RIO H;  3ZMT A;  4GCV A;  2FQ3 A;  1MDM B;  4UXN A;  3H3U A;  3ZN1 A;  2F2E A;  4RS8 A;  2GIV A;  3WGH A;  2XRO A;  3KP4 A;  2XAQ A;  5A2Q Z;  3IKT A;  1J2X A;  1GXP A;  2NRA C;  1J5Y A;  3OV8 A;  1XMK A;  4XSZ F;  5F1R A;  1KQ8 A;  3DEU A;  4YFX F;  1IN7 A;  1QGP A;  1TLH B;  2X0L A;  3HSF A;  3EYI A;  3E5Q A;  1ZGA A;  3HOS A;  4EGZ A;  2PFB A;  3FWE A;  3QRF F;  3GUD A;  2DK8 A;  3FMS A;  1Z91 A;  1D5V A;  5FLX K;  1T38 A;  1FBS A;  2HFH A;  3QU3 A;  5JI6 A;  3WU1 B;  4MHG A;  1SMT A;  2KJC A;  1T0F A;  1YW9 A;  3SHF A;  2H94 A;  2FML A;  2HTJ A;  5E8I A;  1YTY A;  4ASN A;  1DUX C;  2OAZ A;  4O5V A;  1LJ9 A;  3ROU A;  3GFM A;  1B6A A;  3BWG A;  5LLQ A;  2HGC A;  3GVA A;  4MEY F;  4M6Y A;  1QNT A;  4KIF A;  4R79 A;  1W5T A;  3KCC A;  2BGC A;  2JZY A;  4I09 A;  2GXG A;  1I1G A;  3IWZ A;  1QO0 D;  2M30 A;  4PZJ A;  3V4G A;  2DI3 A;  2VC1 A;  4QLC U;  1MJ9 A;  5ILV A;  3LQR A;  1X3U A;  1R1U A;  3E5X A;  2H27 A;  1PP8 F;  4H0E A;  5HS9 A;  4G7Z F;  4EM2 A;  1XGO A;  4GGG A;  1BJA A;  4EJT A;  2R7D A;  5CVR A;  3ZMD A;  3IRR A;  2FRH A;  1UHW A;  5CYV A;  4N0B A;  3KE2 A;  2V1D A;  1P4A A;  2W57 A;  1DPR A;  3E97 A;  5D5W B;  4OOI A;  2W24 A;  1HW5 A;  4CO8 A;  4Y17 A;  3P9I A;  4HF1 A;  2Q8K A;  5HLI A;  5L3B A;  1TBX A;  1XGM A;  1XN7 A;  3Q9V A;  2FMY A;  3AAF A;  3EET A;  3I58 A;  4A6D A;  5FD5 A;  2K4J A;  3L9F A;  1OYY A;  2H6B A;  1ZGJ A;  1W5S A;  3F8N A;  4HDU A;  1QPM A;  4LLN A;  3KP6 A;  3QP6 A;  4U7B A;  4RB0 A;  5D6E A;  5J8F A;  2IW5 A;  1KU7 A;  3HHH A;  1W7P B;  2X4H A;  2HTS A;  4JK1 X;  5D6F A;  1J7K A;  3FMQ A;  2OQR A;  2HKX A;  2ADU A;  1CGP A;  2FBK A;  1Z05 A;  3R60 A;  3MFK A;  2J5P A;  3KEQ A;  4RB1 A;  3WTZ A;  4AIK A;  3RKW A;  4AVP A;  1WQ2 A;  2Z99 A;  4L9N A;  3LST A;  3QU6 A;  4KA4 A;  4PGG A;  2FA5 A;  4L5J A;  1LDK B;  2OU2 A;  2PJP A;  4R1H A;  1FP2 A;  2M45 A;  2QQA A;  5LEJ A;  1ZG3 A;  2VE8 A;  3K1N A;  2QQ9 A;  2LDU A;  5DCM B;  3K1P A;  1BIB A;  2COM A;  1XGN A;  2NAZ A;  5HDN A;  2Y0M A;  4HBL A;  3H92 A;  3TQN A;  1JE8 A;  5D5U B;  2RN7 A;  3I64 A;  2DQR A;  3FHZ A;  1R1T A;  1ONV A;  3T1B A;  1K6O A;  2MLG A;  3N4M A;  1BM9 A;  4L5I A;  3F23 A;  1ZG1 A;  3I59 A;  3K69 A;  1O3S A;  3GWZ A;  2ZKZ A;  2P5K A;  4YIF A;  1RZ4 A;  2V9V A;  2O3F A;  1KU2 A;  2EV0 A;  2QYO A;  3ZMZ A;  1S3J A;  1H9G A;  3KLO A;  1BN5 A;  2R7F A;  2HQR A;  3L2C A;  3GZ5 A;  3FF5 A;  3L09 A;  2AS5 F;  3KET A;  2M1B A;  3WU0 A;  1LVA A;  3OOP A;  4L0Z B;  2DTR A;  4RGR A;  1T6S A;  3DPT A;  2VE9 A;  2PEX A;  2EFO A;  2FNA A;  1QBJ A;  2OZU A;  1B59 A;  2DPU A;  5BPI A;  3B73 A;  1P2F A;  3FM5 A;  3RDI A;  1V3F A;  1FYK A;  3Q5F A;  2A5Y B;  3FZV A;  3HRM A;  4KIB A;  1FNN A;  2KIU A;  2XIG A;  1H9T A;  4N9H A;  1SD4 A;  4BHC A;  5L3F A;  3GFJ A;  3S2W A;  4Q5S F;  4M9Z A;  1FWZ A;  4A0X A;  2OA4 A;  2AXL A;  1Z6T A;  3VFZ A;  2J5O A;  3HSE A;  1YS7 A;  3LA2 A;  1Y0U A;  1ZRD A;  1RUO A;  1REP C;  1FOK A;  1XSX A;  2ELH A;  1EH7 A;  1P4W A;  4AIH A;  5LHI A;  2ZME B;  2ZO4 A;  1Z7U A;  3CLO A;  3GZ6 A;  1KA8 A;  1G3W A;  2EV5 A;  2DFI A;  3V8L A;  3WE2 A;  4FHT A;  3LA3 A;  4GXO A;  1G6N A;  4UVB A;  3KP5 A;  4RGX A;  5CLS A;  4EQQ A;  2P7V B;  2XAJ A;  2STT A;  3LAP A;  1Q1H A;  4OMZ A;  4FX4 A;  5IT9 Z;  4Q47 A;  4A2U A;  2RKH A;  2XHK A;  3TOB A;  2BV6 A;  3K9T A;  2FXA A;  5ILU A;  4MTD A;  3B02 A;  3MQ0 A;  2EB7 A;  3TKY A;  4IPA A;  2JPC A;  3ZMU A;  1R7J A;  5L3G A;  4RB3 C;  3BP8 A;  4OIO F;  3CO6 C;  4RAZ A;  4IF4 A;  3V7S A;  5LRR A;  5LGU A;  4ESF A;  4FX0 A;  1WSU A;  1OMI A;  2VOP A;  2PI0 A;  2P5L C;  5H6R A;  4IJA A;  1SFE A;  4UHT A;  2M8E A;  3CUQ C;  4JBA A;  2FNP A;  3JW4 A;  4RGU A;  4LLG F;  5TJJ A;  4OMY A;  2ESN A;  4NHJ A;  3T5X A;  4HW0 A;  5AON A;  5JVT A;  4G7O F;  5F6F A;  1D3Y A;  3BJO A;  2A61 A;  1HSJ A;  3ABT A;  2Q0O A;  4EJO A;  2ESH A;  2A07 F;  3ULQ B;  2PG4 A;  3QP5 A;  2IP2 A;  2LNB A;  5E1X A;  4LB5 A;  2DAO A;  1XDS A;  4A0Z A;  2L4M A;  4Z2Y A;  1F1Z A;  2P5V A;  1HKS A;  1Z9C A;  1BI3 A;  4KDP A;  4L9J A;  5BOX A;  4A5M A;  3E6D A;  3WTT C;  3RPU A;  3BOQ A;  4YII A;  4A5N A;  2K02 A;  2E1N A;  2FF4 A;  2D1V A;  3ECO A;  1ULY A;  5FO5 A;  3PQK A;  5D8L B;  1STZ A;  4KYW A;  2OBP A;  2Z9O A;  2BE5 F;  1XCV A;  1G3T A;  4HX7 A;  3EQL F;  3WG9 A;  2QQB A;  3LWF A;  3R61 A;  1YLF A;  5E8G A;  5K5Q A;  2K7L A;  4M6X A;  5DEQ A;  5DUK A;  5L3E A;  2EWN A;  4ENK A;  1SMY F;  5E1W A;  3M9A A;  2YX7 A;  3DQV C;  3NQO A;  2NYX A;  2DT5 A;  4WCG A;  2RNJ A;  1I27 A;  4GO1 A;  3DP7 A;  2CG4 A;  3BDD A;  3CJN A;  2D1H A;  1S8N A;  1BIA A;  3EYY A;  1D8J A;  3RYP A;  1ZYR F;  5E1Z B;  4ZH4 F;  1T98 A;  2WTE A;  1SD5 A;  1U8R A;  4OU0 A;  2OQG A;  2ZXJ A;  3VOD A;  1AOY A;  2B0L A;  5HS7 A;  2GQQ A;  4UNO A;  4LB6 B;  1W7P A;  3JAM K;  5LGN A;  4LG0 A;  1U5T C;  3U9G A;  2KJB A;  1BC7 C;  4G6D A;  4B09 A;  1WKM A;  4UUV A;  3F8M A;  4I7H A;  3NRV A;  2HDC A;  1EH8 A;  2QEN A;  2WWY A;  4EJW A;  5L3D A;  5ICE A;  3I54 A;  3I71 A;  2ZJ2 A;  1L3L A;  5JHU A;  4UV9 A;  1G3Y A;  1G4D A;  2G7U A;  3ECH A;  1O3T A;  4UVC A;  5DCM A;  1V4R A;  2P7C B;  3RPQ A;  2CO5 A;  2HYG D;  4EMS A;  3M8F A;  4UVA A;  4LD5 A;  4WF2 A;  1YFH A;  1F9N A;  1ZRC A;  2XKO A;  2VN2 A;  2BBY A;  2GXB A;  2YR2 A;  3GF2 A;  3V7C A;  3HSR A;  4EGY A;  2P4W A;  3T8R A;  2Z5U A;  2CGP A;  4KIG A;  3GFI A;  4ENN A;  2H6C A;  3CTA A;  3WTX C;  1HW2 A;  2WC2 A;  4LG0 B;  2O8X A;  3KFW X;  2O03 A;  3E6B A;  2QZ8 A;  1FYL A;  4M73 A;  2OD5 A;  1EH6 A;  4ESB A;  5CVU A;  4XRF A;  2CWE A;  4WXH A;  4EJU A;  1J59 A;  4IHT A;  1FX7 A;  5BPD A;  4MGR A;  5JFR A;  4HX8 A;  5ICC A;  2F5D A;  1D8K A;  4YFK F;  1DP7 P;  3RKX A;  4MEX F;  1ON2 A;  3TDZ C;  2ZFW A;  2IA2 A;  4KIC A;  5DYM A;  2V79 A;  4G8X A;  1R00 A;  4UV8 A;  3C18 A;  1FBU A;  1W7P D;  1U5T A;  3SQN A;  1U5T B;  2F5C A;  3DKW A;  3C3W A;  1O3R A;  3LQQ A;  3REO A;  1CF7 B;  4AD9 A;  2ZBK A;  2CQK A;  3I4P A;  3WTU C;  1B9M A;  1TTY A;  3QAH A;  1S7O A;  1ZG5 A;  4ON0 A;  4ESJ A;  2VOO A;  1GVJ A;  4HOB A;  2IA0 A;  1U2W A;  2JTV A;  2XGX A;  3E6C C;  2RV8 A;  4LK1 F;  5AIP A;  3HTU A;  4BAY A;  3J81 Z;  4R8H A;  4I2O A;  3H3Z A;  2XAF A;  3BRO A;  4HQM A;  1K7A A;  3MZY A;  3BPX A;  4HX4 A;  3F22 A;  5CVI A;  3CUO A;  3QOP A;  3LFK A;  3DF8 A;  1WRJ A;  1XCB A;  2KKO A;  2G9W A;  5FD6 A;  4LMY A;  4ZYD A;  4XBF A;  5CVV A;  4A0Y A;  4M71 A;  4U7D A;  5DUI A;  3SFZ A;  3GX4 X;  1S29 A;  2MLK A;  2EJR A;  1YYV A;  1B1B A;  3F8F A;  3SZP A;  4LJZ F;  1MZB A;  1PP7 U;  2PN6 A;  4Y13 A;  4LGW A;  4LLL A;  1MJA A;  1YW8 A;  3E6M A;  3VOE A;  4G7H F;  1KGS A;  1UB9 A;  2NNN A;  4L18 B;  2Q2E A;  2QWW A;  4M9X A;  3BJ6 A;  2XRN A;  2PQ8 A;  4HZF A;  3GXO A;  3M1E A;  4Y15 A;  3WTY C;  4EM0 B;  2PMH A;  1ZHF A;  4A6E A;  2VXZ A;  1K78 A;  4IRI A;  1O57 A;  5EEH A;  2A3S A;  1Z6R A;  1PUE E;  3CUQ A;  4GYG A;  4LFU A;  4BHB A;  5DD4 A;  4RB2 C;  4GYI A;  3RYR A;  3RIR A;  3RI4 A;  2O0Y A;  4CGZ A;  3MAJ A;  4ZYG A;  2FEZ A;  5D8K B;  5BQT A;  1HST A;  2YU3 A;  2F5E A;  1ON1 A;  1QQI A;  3I5U A;  3GW2 A;  4U88 A;  3CDH A;  1P6R A;  3G73 A;  4IRH A;  1TNT A;  3E3V A;  1XD7 A;  2XUB A;  4MTE A;  3IKV A;  1SFX A;  1AWC A;  2XAG A;  2JRT A;  4KT5 C;  1OYI A;  5BS6 A;  3WOD F;  2NNY A;  2K27 A;  2LF8 A;  4WXC A;  1MD0 A;  2TDX A;  3M8E A;  2VBW A;  5D5X B;  3ABU A;  4CZZ A;  3GFL A;  3FXU A;  1ZH5 A;  2STW A;  4O3M A;  1IRG A;  5TRD A;  4EM1 A;  4HA8 A;  4HLX A;  1YQA A;  4ZYH A;  4HV6 A;  2VT2 A;  5FGM A;  3KLN A;  3TGN A;  5DCF A;  1UFM A;  1YO5 C;  1FC3 A;  5AIQ A;  3F72 A;  3R0J A;  3RJP A;  1LQ1 A;  2HZT A;  1J9I A;  1H0M A;  1U78 A;  4BYY A;  4S05 A;  3TOA A;  4BNC A;  2EFQ A;  4TV7 A;  2EV6 A;  4O6J A;  3SXY A;  1O7F A;  3BPV A;  4HF0 A;  4M74 A;  1KQ9 A;  4KN4 X;  2KIF A;  5IT9 K;  2XVC A;  3HRS A;  2L3D A;  1GHC A;  1R5G A;  2W85 A;  1UCR A;  3K1M A;  1IXR C;  3ZQ7 A;  4KUM A;  1L0O C;  2IPQ X;  4HF2 A;  3KP2 A;  2XV4 S;  1ZLJ A;  1TW2 A;  3QPH A;  4L9T A;  1RNL A;  4Q48 A;  4ZZD A;  1IF1 A;  5FB2 A;  2HWV A;  1YS6 A;  1LEB A;  3V8J A;  5ERI A;  3ZP5 A;  4RAY A;  2HKO A;  5E17 F;  1KYW A;  3PQJ A;  3BJA A;  3JTG A;  2A6H F;  3JSP A;  5KVR A;  1ZN2 A;  4U0Y A;  1IN5 A;  4P9F A;  2F5F A;  1IXS B;  4KN7 X;  4DNC A;  5ED4 A;  4G9Y A;  3WGI A;  1W4M A;  1R22 A;  1K78 B;  1YW7 A;  2HR3 A;  2FOK A;  3O3K A;  2RDP A;  5FLX Z;  2XAS A;  1O7L A;  2QM3 A;  1GXQ A;  1LEA A;  3I0T A;  2UXX A;  3C7J A;  2DBB A;  4I98 B;  4ENM A;  2NS0 A;  3U1D A;  2PMU A;  2DPD A;  3DPL C;  2K4B A;  3TO7 A;  2O61 A;  1KYZ A;  4CYD A;  5E20 A;  3PFI A;  5EEG A;  1XSD A;  3G3Z A;  2YX4 A;  1XGS A;  2XAH A;  5HOO A;  3ML6 A;  2LSO A;  4HQE A;  4K2E A;  3J80 Z;  2RQP A;  1QZY A;  2VC0 A;  1BOA A;  4U0V A;  2QBY B;  3HUG A;  1JHH A;  2QBY A;  5A2Q K;  1C0W A;  3ZPL A;  3WGG A;  1NHA A;  3ERE D;  1TNS A;  4S04 A;  4IHS A;  3C1D A;  4I0A A;  1R58 A;  4CXF A;  5LHG A;  2GA2 A;  2ISY A;  2IA1 A;  4KMU X;  4I02 A;  5HLH A;  3JAM Z;  1FP1 D;  5HVQ C;  4P9U A;  2UWM A;  2CYY A;  2V1X A;  3HTS B;  1E17 A;  2E1C A;  3COA C;  1B4A A;  3HHG A;  1JXS A;  2DQL A;  1JGS A;  1LB2 A;  1EV7 A;  6PAX A;  3K2Z A;  5D4R A;  4HLY A;  5BMZ A;  1O3Q A;  3E5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...