2PMUA

Crystal structure of the dna-binding domain of phop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
VRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the DNA-binding domain of the response regulator PhoP from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulation
molecule keywords response regulator PHOP
total genus 25
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pmuA00
1MJBA 3JSOA 2NYXA 3BPVA 2YPRA 1Y0UA 3C1DA 2P5LC 5HS9A 2ELHA 1GXPA 4RGSA 2B0LA 2W57A 5E17F 3ELKA 2J5OA 1T0FA 1BI0A 3HTSB 3KP2A 1DPRA 4P5OA 3IRRA 1QZYA 3E6DA 2JTVA 1OMIA 4CZZA 4G8XA 4WXCA 5AONA 4HQMA 4AIKA 1SD7A 4JK1X 1JXSA 3AAFA 2A3SA 4Y13A 4XLNF 1R1TA 1JHHA 4I09A 5DUIA 4ENKA 1YIOA 2WWYA 3DPTA 3L00A 2QLZA 4G9YA 3KP7A 1O3SA 2V1DA 5AIPA 2R7DA 4HAMA 4U7DA 3M7GA 5D6FA 1HXDA 2ZNYA 3FXUA 4KNYA 1UCRA 2GXGA 4DNCA 4OMZA 3QP6A 4TV7A 2M1BA 4LG0A 4HA8A 2R7FA 1IXCA 4CICA 3GUDA 5D4SA 1XGMA 3L7WA 2OZUA 1IRFA 2EA2A 1T38A 1XSVA 1SFUA 2H6CA 5LHGA 3ZMDA 2STWA 1O3RA 1CGPA 1T98A 3J80Z 2D45A 1XMKA 2DI3A 5H6RA 2IT0A 4UVBA 1FYKA 2WTEA 4R1HA 3OOPA 4AIHA 4M73A 4Q5SF 2DQRA 3CLOA 1PUEE 2GAUA 4WX9A 1UFMA 3GWZA 1OYYA 4CO8A 1QNTA 4I01A 3KP3A 1FT9A 1XGSA 4MNUA 1O3QA 2CYYA 5HDNA 2ZMEB 4I0BA 2H27A 4N0BA 2JPBA 4MTDA 3WTTC 1QQIA 5K5RA 2P6TA 2ZXJA 1MDMA 2HDCA 5HLHA 1UHMA 3ZMVA 4BNCA 1XN7A 2LNBA 2VE9A 5DUKA 5E8GA 3KP5A 3R0JA 1E2XA 4AVPA 1KQ8A 1F9NA 3WTXC 3U2RA 2RKHA 2CO5A 4L9NA 3WODF 1U2WA 2FU4A 1XCVA 1HSTA 1B6AA 2K02A 3T0YA 3TKYA 2EJRA 1V4RA 2E1NA 4O6JA 2VBYA 4BQAA 4KIGA 1XSXA 4ESJA 2CWEA 3TQNA 4I7HA 1K79A 2RGVA 2ESHA 2IA0A 5LRRA 5DCMA 4Q47A 2L54A 1GVJA 1ZLKA 3CJNA 2HOEA 2ETHA 2TDXA 5E1XA 1YO5C 3KLNA 1CF7A 4WXHA 2ZCWA 2A61A 2W85A 5F6FA 4M9ZA 3IWZA 5IT9K 2ZFWA 3BZ6A 3MEXA 1P4WA 5ICCA 5K1YA 4M6YA 5ICEA 2HKXA 2X4HA 5D4RA 5DDGA 1IZ1A 2ZKZA 2ZO4A 3HHHA 2RDPA 2HYGD 3NEUA 1B4AA 3LQRA 1S8NA 3SZTA 1K78A 4KYWA 3I71A 1SFXA 2GA2A 4L5JA 4AIJA 3RYPA 5BS6A 2DK5A 2A6HF 3DV8A 4FHTA 3NQOA 5DCMB 3RI4A 1LB2A 4IHTA 2DT5A 2OBPA 1D8JA 1PP7U 3HIFA 4L5IA 4MGRA 5CLSA 5KK1A 2LSOA 4IRGA 2JRTA 3HRTA 4PGGA 2RVCA 2OQRA 2EFNA 2KIUA 1HKTA 3DFGA 2XAJA 2V9VA 1KQ9A 1IN4A 1IN6A 1YS7A 5L3GA 4IPAA 4P55A 3LFKA 3HRSA 3DPLC 4XSZF 1BOAA 1Z6RA 2PI0A 2HYFA 3WTSC 3RJPA 3DF8A 4XSXF 1Z9CA 1MDMB 3F3XA 4HX4A 3KFWX 3J81K 3ZP5A 2P5VA 2QENA 2H94A 4GXOA 1DP7P 2PEXA 5LBQA 5JFRA 4JBAA 2PFBA 2OQGA 4KN4X 5FLXK 1YQAA 3K9TA 1ON1A 1E17A 1U8RA 2K4BA 2IA1A 2FNAA 2HEOA 4FX0A 2FOKA 4ZYDA 3WGGA 3C18A 4OOIA 2F5CA 4N9IA 3VOEA 4U88A 2JT1A 2A07F 4EM1A 1BC7C 1QGPA 1J9IA 1FBQA 3BPXA 3OV8A 1ZG1A 3E97A 4M9XA 4AD9A 5A2QK 3BDDA 3IKVA 2A6EF 3EDPA 3KEQA 3QPTA 2W25A 2XROA 1KQ0A 3QU3A 5LEKA 2L3DA 5ILUA 2FEZA 1S3JA 4WXDA 3MCZA 5L3FA 3KP6A 2V6CA 3M8EA 4ASNA 2G7HA 2IP2A 1IUYA 3SQNA 1LEBA 3C7JA 3VODA 2MD5A 4LGWA 4A2UA 5LGUA 4LG0B 1Q1HA 1Z6TA 3V7CA 2O0YA 2VE8A 4G6QA 2E1CA 2XKPA 2DPDA 1ZN2A 1FY7A 3MAJA 2MLKA 5LEJA 5BQTA 2IJLA 2HGCA 2XVCA 3V8JA 1O7LA 2L01A 4S05A 3WU0A 2KJCA 3GVAA 4GYIA 3PQJA 1B9NA 2ACJA 1HBXG 3J80K 1K7AA 1FNNA 4BXUA 2EA4A 4Q4ZF 2DW4A 3I4PA 1GHCA 4KA4A 2XAHA 1CF7B 4KIFA 2EV5A 2Y75A 3QRFF 3R4KA 4P9FA 5H6QA 1W5SA 4KMFA 1MZBA 4A0ZA 4EJVA 1TW2A 2OD5A 1QZZA 2G9WA 5E20A 3ISPA 5BPIA 1G3TA 3FMSA 2Z99A 1I1GA 2FQ3A 4Y17A 4G7HF 3ROUA 3GFIA 2HS5A 2HFHA 2VOPA 3COAC 4U0YA 2DBBA 4PGHA 4GYGA 1TQIA 5E1WA 1F5TA 4A0YA 1KYZA 1MD0A 4A5MA 1LQ1A 5HLIA 4PCQA 1HQCA 2BV6A 1USTA 2O6GE 1W4MA 4EGYA 3D5LA 3RKXA 4D0PA 1ON2A 1T2KA 5HS7A 3CTAA 1G6NA 3ZMZA 5HLGA 1ZHFA 2YSRA 1U78A 3DEUA 4OU0A 5ILVA 4CDGA 4ETSA 1Z7UA 5L3CA 3WE2A 4QWQA 5EEHA 1A04A 3CUQA 4ESBA 2HR3A 2HQNA 2PMHA 5D5VB 1YW7A 1DDNA 3GW2A 5IT3A 2P8TA 3HRUA 2XAGA 3WTYC 4OMYA 3HOSA 1V3FA 3F8NA 2CQKA 1XMAA 4XRFA 2HTSA 1EH7A 3GFJA 1KA8A 5FD5A 1P6RA 4OINF 2LF8A 1RNLA 5DCFA 4U7BA 3DXJF 2DK8A 3ABTA 1FWZA 2Y48A 1G3YA 3E6BA 1HKSA 2VN2A 1P4AA 4MEYF 4KIBA 2EV0A 1LDJA 5J6XA 4EJWA 4EJTA 2VT3A 4HW0A 1IN5A 2JSCA 3TOBA 3E3VA 1DUXC 5KVRA 1K78B 1SD6A 1D5VA 2F5DA 2CGPA 4L0YB 1KU2A 4UUVA 1BBYA 3B02A 3H3UA 1FSHA 3IRQA 1XB4A 3WU1B 2EB7A 1IN7A 2J5PA 1C0WA 1DPUA 2QZ8A 1PP8F 4HYEA 5FD6A 1Z91A 6PAXA 2V1XA 5FO5A 2FBIA 3PQKA 2BEOA 1TNSA 1BJAA 4CHUA 4RS8A 3KEOA 4A12A 2KRFA 5E18F 2HWVA 3SFZA 3EYIA 3Q9VA 4EGZA 3WTZA 5ICFA 3ECHA 4UVCA 5JVTA 3CUOA 2XIGA 3F8BA 2QBYA 4HF2A 1YW8A 3WGIA 2A69F 1KU3A 3H3ZA 1RIOH 1S7OA 3ULQB 3SHFA 4EV0A 1TTYA 3WTVC 3QOPA 2UXXA 2P7VB 3EUHA 3FWEA 5LLQA 1LNWA 4LMYA 1O3TA 2EFQA 1WRJA 1P92A 3P9CA 3N4MA 2COMA 3E6MA 1BI1A 1F4KA 4A6EA 3BY6A 1EV7A 4UNOA 1XD7A 2VXZA 3O2PE 4LK0F 1R5GA 1ZG3A 4MHGA 1BI2A 3J7AO 2KKOA 4KT5C 3IWFA 2XASA 2Q2EA 1H0MA 5HDGA 4BYYA 4KFCA 4NB5A 2XHKA 1K6OA 3G3ZA 1G3WA 4LLGF 2KIFA 3RTRA 1ZRCA 3LWFA 1I27A 2YX7A 2QM3A 1FPQA 5BMZA 1ZAOA 5JHUA 3VEPA 4Y15A 2DTRA 4RGXA 1Z1DA 2GQQA 5LGTA 2FA5A 4ZZLA 1XGNA 5HVQC 1YLFA 3JTGA 3GF2A 3BWGA 4DQ2A 4IVNA 1J7KA 3WG9A 2C6YA 2Q8KA 3W6KB 4LFUA 4ZYEA 5HS8A 3JAMK 3LQQA 2E7XA 4MQ9F 1YTYA 3MZYA 3F8CA 1AWCA 1LVAA 2EFOA 3SXYA 4OIRF 2JZYA 1XCBA 3FM5A 2DQLA 3IKTA 4EJUA 5FFZA 1XGOA 3BP8A 3ZN0A 4B8XA 4RB2C 4EQQA 3EYYA 3KZZA 5IT9Z 5D5XB 1OYWA 4YFNF 2GXBA 2IVMA 3G73A 3HSRA 1ZARA 4UV9A 4OIPF 4HZFA 3RKYA 3T1BA 1YS6A 2P4WA 1L0OC 4OIOF 3H92A 2M87A 1XDSA 3I59A 3BROA 3HTUA 4A6DA 3E5QA 3FMQA 3CO6C 5CVUA 2A68F 3HUGA 4U0VA 5CVVA 4RGRA 4LD5A 2RQPA 5ILSA 4WWCA 1J2XA 4IJAA 5TRDA 2STTA 3EQLF 2W24A 4O5VA 1OR7A 4H0EA 1W7PD 4R8HA 1R36A 1S6LA 4LJZF 3TGNA 4HLYA 1JE8A 4GCVA 4G7OF 3HSFA 2ADUA 3WGHA 1H9GA 4YIIA 2L4AA 4MQVA 2UWMA 4ESFA 2UZKA 2FE3A 2BGCA 2M30A 2ISYA 3TO9A 2IRFG 2Z3YA 3REOA 1U3EM 4HBLA 3GLXA 4RAYA 5ED4A 4P96A 1TW3A 4UV8A 3F6VA 2DLLA 4OIQF 4RAZA 2BYVE 1S29A 4M71A 4YIFA 4S04A 3F22A 4GGGA 1ZYRF 2NNNA 5FFXA 4ZZDA 4I2OA 3P7NA 1MGTA 3F72A 4A5NA 2LF7A 2X0LA 5DYMA 1FYMA 1QPMA 1SAXA 3QAHA 2CG4A 4BAYA 5FLXZ 4FT8A 2P7CB 2EWNA 1IAWA 1ZGJA 5CVIA 2IA2A 5ICGA 1EH6A 1YFHA 4ZYHA 5L3DA 2PQ8A 3RPUA 5CVRA 2ZJ2A 1AOYA 3QP5A 2RV8A 2HTJA 2OA4A 2ZMEA 2NRAC 2QQ9A 4L9TA 2RC4A 2M45A 2O61A 3HYIA 3TDZC 5FB2A 2R3SA 5LGNA 3LAJA 1WI9A 2GWRA 3CDHA 4AWXB 5HOOA 3FMRA 4KN7X 3LA7A 4A0XA 4L18B 3E5XA 3TOAA 1IW7F 1W5TA 3KLOA 2DFIA 4WF2A 4QLCU 2CSOA 2RN7A 3QU6A 3FHZA 3P9KA 5A2QZ 1I6XA 2MLGA 3BJOA 3JSPA 1MJAA 3B73A 5D8KB 3HOTA 1KU9A 5H20A 2XAFA 1RI7A 5L3EA 1ZREA 2K27A 1SD5A 4M9SA 4XLPF 1TLHB 1O57A 3VFZA 4YFXF 3BJAA 3CO7C 3S2WA 2QQAA 4UVAA 2VT2A 4E70A 1R58A 4LLNA 3BJ6A 1SMTA 2ISZA 2E7WA 3TDUC 1TQPA 5FGMA 1U5TB 1HW2A 3GYHX 3DQVC 4HV6A 4KMUX 1X3UA 3F8FA 3HSEA 1U5TA 3FXQA 1GXQA 2GA1A 2V1UA 4IHSA 4BHCA 2LKPA 3N97A 2G7UA 2GIVA 1USSA 2FRHA 2VBZA 3ABUA 5BOXA 3IL2A 4YFKF 1FC3A 2M5WA 1R7JA 4K2EA 5LRSA 3V4GA 2DPUA 1D8KA 2QBYB 2VBWA 1B1BA 1J5YA 4RB0A 1U6GA 4UHTA 5LHHA 3KZYA 4IXAA 1R1UA 2PBIA 2HZTA 2MA3A 1LEAA 1B9MA 3RKWA 2P6SA 1O7FA 1I1SA 2V79A 3W6JB 2Z9OA 3CUQB 2XKOA 5J8CA 2L02A 5BPDA 1YW9A 4RGUA 4MTEA 2MH2A 2XGXA 2NAZA 1ODDA 1TBXA 4FX4A 3CUQC 4JQFA 1IN8A 3WE3A 1FZPB 4IRHA 2CFXA 4U0WA 4ON0A 1BN5A 2Z33A 3K1PA 5EEGA 3T5XA 1MJ9A 3C3WA 3GX4X 2PMUA 2NNYA 3U9GA 1W7PA 3MZHA 3I64A 4HX7A 1R00A 4EMSA 3ECOA 2QQBA 4I0AA 3GFMA 1FP2A 4EVIA 1LJ9A 4P9UA 2VBXA 4BHBA 2FMYA 3K1NA 3O3KA 3KP4A 1H9TA 4XBFA 5DD8A 3LAPA 5D5WB 1TNTA 1L3LA 2L4MA 5CVJA 3Q9SA 4LK1F 1FSEA 5F64A 1WKMA 1TQMA 4I98B 1JHFA 2FXAA 5F1RA 3L09A 4L0ZB 3Q5FA 4G7ZF 1BIBA 3V7SA 5K5OA 2JPCA 2ESNA 2WV0A 1J75A 4ZYGA 3F8MA 2DAOA 4B09A 3V7RA 3P9IA 2W84A 1WQ2A 4ENMA 3LSTA 3WTUC 1IRGA 4PDKA 3O6BB 3GFLA 1XDUA 1ZGAA 1P2FA 1XSDA 1S7AA 3M1EA 3K2ZA 4M6XA 3D0SA 2ZBKA 5D8LB 5JI6A 3T8TA 3F6OA 2PG4A 1HKQA 3K69A 4ENJA 1U5TC 1Z05A 2VC1A 3I53A 4R79A 2YU3A 4HQEA 1FLIA 2D2WA 3M9AA 5J8FA 5ERIA 2H6BA 4G6DA 3FZVA 1FX7A 4KDPA 4ENNA 3ZMTA 3I59B 4HF1A 4NQWA 3R0AA 3MQ0A 3IHUA 2XUBA 2QWWA 1I5ZA 2NS0A 1SFEA 3GXOA 2FBKA 4CYDA 3WTWC 3LA3A 2Q0OA 1ZRFA 4HLXA 4I02A 2OZ6A 4L9JA 5E8IA 3FM3A 4RB3C 2F5EA 2GZWA 4BHPA 3E5UA 1FOKA 2Y0MA 3MWMA 2K7LA 4L9VA 1G4DA 3EETA 3RYRA 3PFIA 3RDIA 1STZA 2CW0F 2DU9A 2O8XA 1KU7A 3FF5A 1YYVA 2UXNA 3ERED 3I54A 4HDVA 1R22A 2D1HA 1WSUA 2BBYA 2ZNZA 3I58A 3HRMA 1FP1D 3I0TA 4Q48A 4G94A 1FBSA 2VC0A 3ZQ7A 1LDKB 4HOBA 3FXRA 2M8EA 1JGSA 1IF1A 1ZLJA 1HW5A 1PDNC 1G3SA 2EK5A 2MBFA 4PZJA 3JTHA 2XAQA 2VONA 3R61A 2K86A 2OAZA 1HW1A 2FSWA 2MC3A 4EJOA 2A5YB 2BE5F 3DP7A 2WC2A 3QPHA 1KYWA 3F21A 4WCGA 1FBUA 2LDUA 4ZH4F 4HF0A 1OKRA 5CJ9A 1J0RA 2PLYA 4KUMA 5K5QA 2OU2A 3M8FA 5TJJA 2FF4A 5D5UB 3HHGA 3K1MA 1VTNC 1KGSA 2F5FA 2Z5UA 1ONVA 2RNJA 1ZRDA 1UHWA 2YX4A 3FX3A 1BC8C 1D3YA 2IW5A 4IF4A 3NRVA 5DV5A 3SZPA 4CGZA 4LLLA 3I5UA 5HDKA 3ZN1A 1J59A 1NHAA 3TO7A 1IXSB 3KETA 1EH8A 2PN6A 3RPQA 3ZMUA 2VODA 3KE2A 3E6CC 3VB2A 1BI3A 1LDDA 1B59A 3R6SA 2EFWA 4HV5A 4HDUA 4NHJA 4RB1A 1SMYF 5AIQA 3ZMSA 3DKWA 1R1VA 3KCCA 4Z2YA 1RUNA 5D6EA 4WK8F 2FBHA 1QBJA 1W7PB 4HX8A 1ZG5A 2KJBA 5DD4A 2YR2A 4UXNA 1ULYA 1R23A 4N9HA 4F7ZA 1BIAA 3TO6A 3GZ6A 2KIMA 1UB9A 2IPQX 2QYOA 3GO5A 2EV6A 4CXFA 2D1VA 2AXLA 2VOOA 5CYVA 2QVOA 3U1DA 1R5HA 3L2CA 2O3FA 3ZPLA 1ZH5A 1T39A 3MFKA 4BH9A 4LB6B 3R60A 3V8LA 1YG2A 4M72A 1REPC 1OYIA 3RIRA 3V8KA 2QUFA 4M74A 3IC7A 2PJPA 1QO0D 5JR3A 1F1ZA 1P4XA 4MEXF 1BM9A 2HQRA 2XRNA 3L9FA 2MH9A 1HSJA 4EM0B 3LA2A 4YG2F 4KICA 2FNPA 1RUOA 1SD4A 1IXRC 4EM2A 1WWXA 2DO7A 3GZ5A 3K0LA 1RZ4A 3BOQA 3J81Z 3GEZA 2FMLA 5L3BA 3JW4A 1OPCA 2K4JA 3JAMZ 1FYLA 3T8RA 2F2EA 1MKMA 2H09A 2O03A 4O3MA 4GO1A 5E1ZB 2P5KA 5DEQA 2AS5F 3F23A 1T6SA 4IRIA 2XV4S 3ML6A 4LB5A 2HKOA 2EFPA 5LHIA
chains in the Genus database with same CATH superfamily
4HNUA 1MJBA 3S8PA 4I99C 3JSOA 2DJNA 2NYXA 2E2JJ 2L9RA 3BPVA 4QSHA 2YPRA 1Y0UA 3C1DA 2P5LC 1OQYA 2LVSA 5GPCA 4CCLA 5HS9A 2ELHA 4BS9A 3CCQI 1GXPA 2FQ4A 4RGSA 3H5NA 4CZCA 2B0LA 2W57A 4HSTA 4CCOA 5E17F 3ELKA 3H0DA 1JJ8C 1A31A 2J5OA 3CCYA 1K6YA 4DGWB 1T0FA 3CF5F 1BI0A 3ZQGA 3HTSB 3KP2A 1DPRA 3CP8A 4P5OA 4XIDA 2DMTA 3IRRA 1QZYA 1LPQA 2HZDA 3E6DA 3OYMA 1VQ4I 5IOYA 4UB8C 2HVSA 2JTVA 1NG7A 1OMIA 4CZZA 1FJLA 4G8XA 4WXCA 4B4CA 5AONA 3K10A 4M3EA 3BZCA 4HQMA 4B44A 3AG4H 1XTAA 3PSIA 4BBRJ 4E6KG 2XDVA 4AIKA 2VIXA 1FOXA 1SD7A 4JK1X 3C2BA 3OSFA 3DLLF 1JXSA 3AAFA 2A3SA 1SANA 4Y13A 4XLNF 1LVKA 1R1TA 3ZQIA 1JHHA 2GIZA 3BCBA 4I09A 5DUIA 4ENKA 3LSKA 2VKDA 1PVEA 4XR6A 1YIOA 4B3XA 1F43A 2WWYA 3DPTA 3HG9A 4ZJZA 3L00A 3S16J 2QLZA 2BOLA 3IAM2 1A35A 4HRIA 4G9YA 3E1SA 3KP7A 1O3SA 1VQOI 2BW3A 2V1DA 3CCRI 5AIPA 2R7DA 5CKTA 4CUGA 4HAMA 4U7DA 2BVLA 1PJRA 3M7GA 4LG3A 5D6FA 1HXDA 1RKTA 2ZNYA 3JRHA 3OWTA 3CCUI 5IYBJ 3FXUA 1XC5A 4FCYA 1BW5A 3SFIA 2L2OA 4B47A 4KNYA 4V2GA 1UCRA 4CYCB 2CQQA 2GXGA 4DNCA 4OMZA 3QP6A 1BR2A 3A4CA 1OCPA 4XICA 1WJEA 2M4GA 4TV7A 3BR0A 2H1KA 2M1BA 2H1LA 4LG0A 4HA8A 2R7FA 2Y69H 2HQAA 4UUTA 2V7FA 3MKLA 1IXCA 5GPAA 3FISA 4CICA 5JLWA 3ABKH 1XX5A 2LP0A 3GUDA 5D4SA 1XGMA 1ZKGA 3L7WA 3W6VA 2OZUA 1IRFA 2DA4A 3JRDA 2EA2A 1T38A 1XSVA 4J01A 3DEEA 1A5JA 1QVUA 1SFUA 2H6CA 5LHGA 1XS9A 1JKRC 3ZMDA 3PIPF 3DBRB 2NXNB 2STWA 3AG1H 1O3RA 1U8BA 1IV8A 3WG7H 1CGPA 3DKYA 1T98A 3J80Z 3K7AJ 1X1PA 2D45A 1R71A 1XMKA 2DI3A 5H6RA 2IT0A 3G1OA 4UVBA 1VQMI 1FYKA 1MMDA 2WTEA 4R1HA 4MLOA 3OOPA 1LUJB 4M73A 4AIHA 4Q5SF 2IGKA 2DQRA 3CLOA 3RQ4A 1PUEE 5M3MJ 2GAUA 2Y30A 3JR9A 2OJED 3ASNH 4WX9A 1RESA 1UFMA 1X3WB 3I4NJ 4II3A 3GWZA 1D1CA 1OYYA 4XKBA 4CO8A 5J3LA 1QNTA 2Z2SB 4I01A 5IP7J 3KP3A 1FT9A 2IGOA 1XGSA 4MNUA 1O3QA 1MSFC 2CYYA 1Y0NA 2VQHA 5HDNA 2ZMEB 4I0BA 2H27A 1TWGJ 2QEXI 4N0BA 4XLEA 2JPBA 4MTDA 3WTTC 1QQIA 3SEQA 5K5RA 2XRLA 2P6TA 2ZXJA 1IDZA 2OCCH 1MDMA 2CFOA 3K4NA 1G59A 2CV2A 2HDCA 5HLHA 1UHMA 3ZMVA 2VKHA 3BT9A 4AVZA 4X1EA 1VQPI 4BNCA 1XN7A 3OS1A 2LNBA 4F91B 2VE9A 4MFDA 5DUKA 2ZB9A 5E8GA 3KP5A 4IHWA 3R0JA 1E2XA 2VLAA 4AVPA 1OCZH 4IX7A 3BR5A 1KQ8A 4HSRA 1ETYA 1Z7LA 1F9NA 3RZOJ 3U2RA 3WTXC 2RKHA 2CO5A 4YRVA 4L9NA 3WODF 1U2WA 2FU4A 1XCVA 1HSTA 5M5XJ 3DBHB 1B6AA 2K02A 3T0YA 2R7OA 3TKYA 2EJRA 1V4RA 2E1NA 2ID6A 4O6JA 3PSFA 2VBYA 5KCMA 2KRHA 2DMPA 2DN0A 4KIGA 4BQAA 2UUZA 1XSXA 3VDXA 1D5YA 1SEUA 3CC2I 5J47A 1WI3A 2RAEA 4ESJA 2CWEA 4BY7J 2ZJQF 3TQNA 3QQAA 4I7HA 3AL0B 1K79A 2RGVA 4A3LJ 4AIDA 2ESHA 2KPMA 5J1RA 1W5CC 4PJ0C 1A6QA 2IA0A 1B72A 1ZTRA 2E1MB 2WY7Q 5LRRA 3A02A 5DCMA 2HXOA 4Q47A 2L54A 2BY3A 1GVJA 3FHNA 1IO2A 3CJNA 1ZLKA 2HOEA 4C2TA 2ETHA 2TDXA 5E1XA 1YO5C 1YX3A 3W3CA 2K3FA 3AL0C 3KLNA 3ZQCA 1CF7A 4WXHA 2ZCWA 1YX5A 2A61A 2HQ5A 4A3MJ 2W85A 1T0FC 2JA8J 5F6FA 2R92J 3ABMH 4BJ5C 4M9ZA 1Z3YA 3IWZA 1I3QJ 5IP6A 1YJ9I 5IT9K 4BE2A 2ZFWA 5EZGA 3BZ6A 3MEXA 1P4WA 3H3VK 1XG1A 3ZOBA 3DU6A 5ICCA 5K1YA 4M6YA 1TC3C 2V4JC 4KISA 5ICEA 4PSXA 2HKXA 2X4HA 4RM3A 2JA5J 4XOPA 1I3AA 5HLTA 2W4SA 5D4RA 1MMAA 5DDGA 2XB5A 4Y3OA 1IZ1A 2ZKZA 2ZO4A 3HHHA 2RDPA 2HYGD 1YJNI 3NEUA 2QSHX 2VPRA 2IS1A 1B4AA 1POGA 3HGYA 1S8NA 3LQRA 3SZTA 2EILH 1OLTA 2M0MA 1K78A 4BUPA 4KYWA 5B5EC 3I71A 1H88C 1SFXA 2GA2A 4L5JA 4AIJA 5TISC 3RYPA 5BS6A 1LFPA 2A6HF 2DK5A 3DV8A 3Q0UA 4FHTA 3NQOA 5DCMB 3RI4A 1LB2A 4IHTA 2DT5A 2OBPA 1D8JA 1PP7U 2HVQA 3HIFA 3ESWB 4L5IA 2R93J 1MBFA 4MGRA 5CLSA 2ZSIB 2DT7B 1W0TA 2X6YA 2O8KA 3HOZJ 5KK1A 4IL6C 4I76A 2LSOA 4IRGA 2JRTA 3HRTA 3Q0WA 4PGGA 2RVCA 4E7JA 2OQRA 4HG2A 2JUCA 4M3FA 2EFNA 2KIUA 2Y0SA 1HKTA 1Y56A 5HNFA 2LY9A 2IGMA 3DFGA 2P0WA 5F04A 3S15J 4RBOA 2XAJA 3DEWA 5B1BH 1PYVA 2V9VA 1KQ9A 1IN4A 1GLNA 1IN6A 3QODA 1YS7A 3OYDA 2VI6A 5L3GA 1JKPC 4IPAA 4P55A 2KISA 1ETQA 3S3MA 3MMYB 2VB6A 3LFKA 3HRSA 1OCCH 3DPLC 4AC0A 2XGDA 3K4JA 5IP9J 2CW8A 4EATA 2E71A 4XSZF 1BOAA 3JRAA 1Z6RA 4OWRB 2PI0A 4RLQA 2HYFA 3WTSC 1BR1A 2EZHA 4IQJA 3TL4X 4U87A 3HBLA 3RJPA 1M1EB 2V1NA 4DBQA 3DF8A 4XSXF 1Z9CA 3K70C 1MDMB 1QHGA 3F3XA 4HX4A 3OYBA 3KFWX 3VYRB 2TCTA 2AHQA 3J81K 4X0GA 3JRFA 4DJAA 3ZP5A 2P5VA 2QENA 3SEZA 2H94A 1HDPA 4GXOA 3HL2A 1WJBA 1AU7A 3H9QA 1DP7P 2K9MA 1B8IA 2PEXA 2R7XA 5LBQA 5JFRA 3L2WA 4JBAA 4ZDOA 1RC9A 2PFBA 3MVPA 1MBHA 1S7EA 2E36A 1FIAA 2OQGA 3IH3A 4KN4X 5FLXK 1YQAA 2QCOA 4FETA 3K9TA 1LE8B 4D9JA 3FXKA 2VASA 2LOOA 1ON1A 1E17A 1U8RA 2K4BA 1RR7A 2IA1A 2FNAA 1N78A 2HEOA 3DPUA 4FX0A 3BR2A 2FOKA 4ZYDA 3WGGA 4E7SA 3C18A 3K4KA 4NNJA 4OOIA 2F5CA 5F1JA 3OYEA 4N9IA 3S93A 4M6VA 2ME0A 3VOEA 4U88A 1UMQA 1YITI 2JT1A 2KRCA 3DCFA 2A07F 2XGEA 4XRMA 4EM1A 2AQEA 1BC7C 1QGPA 1MH3A 1J9IA 1FBQA 2FOWA 2GM4A 3BPXA 3QOEA 3BG7A 3OV8A 1ZG1A 4ZDLA 3E97A 4M9XA 4AD9A 5A2QK 1WZ2A 3BDDA 3LOCA 2XSDC 2IXSA 5M5WJ 1EJ9A 2ZFUA 3IKVA 3GCMA 2PMZN 2W00A 2DA7A 2A6EF 2W82A 2DT6A 3EDPA 3KEQA 3QPTA 2QA4I 2W25A 2XROA 1KQ0A 3QU3A 3V42A 5LEKA 2L3DA 5F27A 5ILUA 2FEZA 2R7QA 2ECBA 1S3JA 2M8GX 3QPLA 4WXDA 3MCZA 5L3FA 3KP6A 2V6CA 2CS3A 3M8EA 1VQ7I 3S32A 4ASNA 2G7HA 2IP2A 1IUYA 1WGXA 1T56A 4A3IJ 1H8AC 4A69C 2CRGA 3SQNA 1LEBA 3LNQA 5EG0A 3C7JA 4RLFA 2HPMA 3VODA 2Q2EB 2MD5A 4JYKA 4LGWA 4A2UA 5LGUA 2LK2A 4BL0B 4C2UA 3K4MA 4LG0B 1Q1HA 1Z6TA 2MW8A 3V7CA 2O0YA 5GTIC 2F4OB 2VE8A 4G6QA 3CCEI 3OIPA 4HNVA 1X1DA 1X1AA 3ASOH 2E1CA 2XKPA 2DPDA 1ZN2A 1FY7A 3MAJA 5EGOA 2MLKA 5C3EJ 1HC8A 3KIOA 1RETA 5LEJA 5BQTA 2IJLA 2HGCA 1I6HJ 2XVCA 3V8JA 1O7LA 1X19A 5IYCJ 4A3BJ 1IRXA 4UB6C 2L01A 4S05A 3WU0A 2E1MC 2KJCA 3GVAA 4GYIA 4F55A 3S2DJ 3PQJA 1B9NA 2ACJA 4DYQA 3JREA 1HBXG 3J80K 3PO2J 2NVTJ 4KT6A 3CCLI 2BW3B 2KFDA 3FXMA 1K7AA 2CU7A 3J7YJ 1FNNA 3OYLA 1QPIA 2BXZA 4BXUA 2EA4A 4Q4ZF 2DW4A 3I4PA 5HODA 1GHCA 1JKOC 4KA4A 2XAHA 1CF7B 4KIFA 4PFOA 2EV5A 2Y75A 3QRFF 2YS9A 3AG3H 2L9VA 3R4KA 4P9FA 3GTMJ 2JA2A 5H6QA 9ANTA 1W5SA 2L9NA 2NVQJ 4KMFA 1IV6A 1MZBA 4A0ZA 4EJVA 1TW2A 2WADA 2OD5A 1QZZA 2G9WA 2PMZA 3HPGA 5E20A 2OC6A 3CCVI 3ISPA 4J00A 2VJ4A 4D1QA 5BPIA 1G3TA 3FMSA 3KEYA 3BQZA 1K61A 2Z99A 2NS7A 1I1GA 2FQ3A 2GOMA 4Y17A 4G7HF 3ROUA 1WPKA 3GFIA 2HS5A 2HFHA 5J1YA 1X4PA 2VOPA 3COAC 4FE4A 4U0YA 4BGDA 1R49A 3OL3A 2DBBA 4PGHA 3A03A 2EQRA 5GAGJ 4GYGA 1VQ5I 1TQIA 5E1WA 1F5TA 4A0YA 1KYZA 1TT0A 1MD0A 3ZQFA 4A5MA 2WAQN 2JVGA 1LQ1A 5HLIA 3K2AA 4PCQA 1HQCA 1JI8A 3OYGA 2BVMA 1VQ9I 2W48A 4FASD 2BV6A 5C4JJ 1Z0XA 3U1KA 3D1NI 1USTA 2O6GE 1W4MA 4EGYA 3D5LA 2R4GA 3RKXA 4D0PA 1ZR4A 1DGWY 1ON2A 1T2KA 4HEA2 5HS7A 2K40A 3G1LA 3CTAA 1G6NA 3ZMZA 1WH5A 5HLGA 5E3OA 1ZHFA 1U9NA 2YSRA 4PJMA 1U78A 1GV5A 3ZXSA 4NDLA 3DEUA 4OU0A 5ILVA 3A01A 3S1NJ 5KHDA 4CDGA 4ETSA 1Z7UA 4AM3A 2NVYJ 5L3CA 2KMUA 2X1CA 4V2FA 3S3OA 3WE2A 4QWQA 4N4NB 1X4OA 5EEHA 5FKMA 1A04A 2HI3A 3CUQA 4ESBA 2R5ZB 2HR3A 3HDDA 2HQNA 3JRCA 2WV1A 2PMHA 2B9SA 5D5VB 1YW7A 1DDNA 1HDDC 3GW2A 5IT3A 2P8TA 2LKSA 3HRUA 2ZMEC 4HPQA 2XAGA 3WTYC 4OMYA 3HOSA 4Y33A 4C30A 1V3FA 3F8NA 2CQKA 2K9NA 3C2GA 1XMAA 4XRFA 2HTSA 2O5RA 1EH7A 3GFJA 3O8GA 5FKOA 1KA8A 3D5RC 5FD5A 3W2WA 1S72I 1P6RA 3GTPJ 2A6TA 2BY2A 4OINF 2DJIA 2LF8A 1RNLA 5DCFA 2X6OA 4U7BA 1MMNA 3DXJF 4IHVA 2DK8A 3ABTA 1YI2I 1FWZA 1WFXA 2Y48A 3ZCOA 2I5UA 1G3YA 2WB1A 4JX6A 3BR3A 3E6BA 1PUFA 4E7IA 1HKSA 2VN2A 1P4AA 4B43A 4YEJA 4MEYF 4KIBA 2EV0A 1LDJA 5J6XA 4EJWA 2XPWA 4EJTA 4W97A 2WBMA 2VT3A 1YIJI 4HW0A 2DYRH 4BQQA 1IJWC 1T33A 1IN5A 3JRBA 1TP4A 2JSCA 3BR1A 4W1UA 3E3VA 3TOBA 4P1WA 2W1OA 1DUXC 3OYIA 5KVRA 3PM1A 4E7KA 1Z67A 1K78B 1SD6A 1D5VA 2F5DA 3MZ8A 4ITVA 2CGPA 4L0YB 1JUSA 2VQCA 2P81A 3CZ6A 4F3QA 1KU2A 3PIOF 3MD2A 4UUVA 1YRNB 1BBYA 4BE1A 2V9PA 2QSGX 2OF7A 2TRTA 3B02A 3H3UA 4LOCA 2M9HA 3CF2A 1FSHA 2LBFA 1I50J 1K4TA 3GTGJ 3IRQA 2K9QA 1XB4A 3WU1B 2J5PA 1IN7A 1MBKA 2EB7A 2EZIA 2LG4A 1U9OA 1C0WA 2QZ8A 1Y8QB 1DPUA 1PP8F 2K85A 4H4KC 4HYEA 2V9KA 3OYHA 5FD6A 1Z91A 2JRMA 1R5ID 5F0FA 6PAXA 2V1XA 5FO5A 2FBIA 3PQKA 3GLLA 2BEOA 1FMWA 2R7ZJ 1TNSA 1BJAA 4CHUA 2XB0X 4RS8A 3KEOA 2CV0A 1SVMA 4A12A 2KRFA 5E18F 1TZLA 2HWVA 3IH4A 1MH4A 1QVTA 2VUMJ 4N4OB 3SFZA 4XRSA 3EYIA 2LYCA 1AKHB 3Q9VA 4EGZA 1J09A 3WTZA 4D5FA 3GTLJ 3I55I 4IOAF 2A05A 3H5AA 5ICFA 3ECHA 3P5JA 2DA1A 4E4HA 4UVCA 1OCRH 5JVTA 3CUOA 1DGRM 2XIGA 3F8BA 3CDLA 1EF4A 3OY9A 2QBYA 4HF2A 1YW8A 1KONA 3WGIA 2A69F 1WH7A 1KU3A 1F36A 3H3ZA 1RIOH 3M3YJ 2L5QA 1S7OA 3ULQB 2ECCA 4BKXA 4L5EA 3SHFA 1T8IA 1FEXA 3QYFA 4EV0A 2LREA 1TTYA 5E3NA 3QOPA 3WTVC 4B3AA 1HF0A 2CQNA 2UXXA 2P7VB 3EUHA 3FWEA 5LLQA 3H1CA 4DOZA 3HPHA 2MGQA 1LNWA 4LMYA 1O3TA 4BDYA 1WRJA 2EFQA 1P92A 3P9CA 3N4MA 5H2FC 4NUBA 2COMA 2I10A 3E6MA 1BI1A 4LIUA 1X2MA 1F4KA 4A6EA 3BQYA 3BY6A 2JA6J 3ERMA 2H8WA 2FUG2 2UV1A 3CMAI 1EV7A 4UNOA 1XD7A 2VXZA 3HJEA 3O2PE 2EH3A 2HOSA 4LK0F 1R5GA 1Y1VJ 1ZG3A 4MHGA 1BI2A 3X2QH 2ME6A 3L2VA 2VKVA 2IBDA 4PJJA 3J7AO 2X48A 2KKOA 4KT5C 1P7IA 3IWFA 4RDUA 1V55H 2MABA 3BC8A 2CMPA 4Y7NJ 3IH2A 2XASA 4AU7A 2Q2EA 1H0MA 2JN6A 4XN0A 5HDGA 4BYYA 2CQ7A 3LMMA 2HOAA 4ZDPA 4KFCA 3HOVJ 3TBIA 2KHMA 4AUXA 2E34A 4NB5A 2XHKA 1K6OA 3VYUB 4IOCF 3G3ZA 2JWTA 2L7MP 1G3WA 4LLGF 2KIFA 3RTRA 1JUPA 1D0ZA 2E5ZA 1ZRCA 2CW7A 5J4VA 3LWFA 1I27A 2F6CA 3GTOJ 4JOMA 5EEAA 2E2HJ 3BG5A 5EF6A 2YX7A 1H89C 2LTPA 4DZPA 2QM3A 1FPQA 1VQNI 5IPAA 5BMZA 1ZAOA 5JHUA 3IV5A 3VEPA 4Y15A 1HOMA 1VF9A 3K6GA 2EIMH 2DTRA 4RGXA 1Z1DA 2GQQA 5LGTA 2FA5A 4ZZLA 1XGNA 3Q0VA 3BG9A 5HVQC 1JKQC 1YLFA 2LH9A 3JTGA 4I6ZA 4CCJA 1IRZA 5B3SH 3GF2A 3BWGA 4DQ2A 3OYNA 3E7LA 3HZJA 4IVNA 2KDZA 1IG7A 1J7KA 3WG9A 2C6YA 2Q8KA 2IS4A 1SAUA 3W6KB 2XPUA 4LFUA 4ZYEA 5HS8A 3JAMK 2KIQA 3LQQA 2E7XA 1AA7A 4CA0A 5IOZA 3CCJI 4MQ9F 2EINH 1YTYA 3MZYA 3F8CA 3PNVA 1AWCA 1LVAA 2EFOA 3SXYA 4AYBA 1VQ6I 3OS0A 4OIRF 2CUEA 4MIMA 3BTLA 2OCEA 4CCKA 2JZYA 4BBSJ 2O7OA 3A0BC 1XCBA 3I4MJ 1Z21A 3FM5A 2DQLA 3GTJJ 1OISA 1RKWA 4XL9A 2XF7A 1K4SA 3B6CA 3CJRB 3IKTA 4EJUA 1N25A 1Y8RB 5FFZA 1XGOA 1MNDA 3OYCA 1WJCA 3BP8A 1NK3P 2DOFA 1A6IA 3OIOA 4BACA 1E0EA 3ZN0A 4ZTJA 4B8XA 3A2KA 3CD6I 4RB2C 3PNYA 3FXLA 4EQQA 3EYYA 3MKYB 2ZSHB 1E3PA 2M7BA 5CPRB 4QPQA 3KZZA 5IT9Z 5D5XB 1OYWA 2CJJA 4RMNA 4YFNF 3GTQJ 2GXBA 2IVMA 3G73A 3HSRA 1ZARA 3TW7A 2HXIA 1A36A 4NC8A 5EYRA 4UV9A 4OIPF 4FQGA 1HLVA 4HZFA 2X1EA 3G1MA 3RKYA 3T1BA 3WU2C 3G71I 1YS6A 2P4WA 5FKLA 3H35A 1L0OC 4OIOF 3H92A 3PUFA 3KYCB 2M87A 4XLFA 1BW6A 1TWFJ 1XDSA 3BROA 3HTUA 3I59A 2R5YB 4A6DA 3E5QA 3FMQA 3CO6C 1WJAA 3CCMI 5CVUA 2A68F 3HUGA 3LSPA 2WAQA 4U0VA 5CVVA 4IHXA 4RGRA 4LD5A 2RQPA 5ILSA 4WWCA 2IS6A 3DWLE 3S1MJ 2Q1ZB 3ZR8X 1J2XA 4J19A 3L2QA 2R0QC 4IJAA 3BZKA 2X51A 5TRDA 2STTA 3EQLF 3DTEA 2WY8Q 2W24A 4O5VA 1OR7A 4H0EA 1VZ0A 1W7PD 2ZC2A 4CSWA 4R8HA 2DA3A 1R36A 3HUGB 1S6LA 4LJZF 3TGNA 4HLYA 1JE8A 4DIQA 1OJLA 4GCVA 4C9YA 4G7OF 1FOWA 3LSHA 2XC7A 1XPXA 3HSFA 2ADUA 2WAFA 3WGHA 4BQOA 2R5YA 1H9GA 4YIIA 1ETXA 3UKGA 1NK2P 2L4AA 4MQVA 2YUSA 2UWMA 4ESFA 5F08A 2UZKA 2FE3A 2JUGA 3O8HA 2R7RA 1X3ZB 2QSFX 4JP0A 2BGCA 2M30A 1RR8C 1B72B 2ISYA 3TO9A 2CV1A 2IRFG 4MFEA 4BJTA 2Z3YA 3REOA 3M4OJ 1U3EM 1X58A 4HBLA 3GLXA 4IO9F 4RAYA 1ERDA 5ED4A 2X85A 4P96A 1TW3A 4UV8A 3F6VA 1VNDA 2DLLA 4OIQF 3VYSB 4RAZA 2BYVE 1S29A 3EUKL 2L9SA 4M71A 4YIFA 4S04A 4XORA 3F22A 5KAIC 2OV7A 4JX4A 2OPTA 4GGGA 1ZYRF 2NNNA 1W0UA 5FFXA 4ZZDA 4I2OA 2KZGA 3P7NA 1MGTA 2IAIA 3F72A 4A5NA 2LF7A 5FRNA 2X0LA 2Z16A 3K4CA 5DYMA 1O4XA 1FYMA 1QPMA 2ZJRF 1SAXA 3BG3A 2NOGA 2BXYA 2CG4A 2N8GA 3QAHA 4BAYA 5FLXZ 3DTKA 4FT8A 4NC6A 1Q1VA 3FXJA 2P7CB 2EWNA 1IAWA 5FROA 1ZGJA 4A3DJ 4DZJA 5CVIA 2IA2A 3S3NA 5ICGA 3HOUJ 4E7HA 1EH6A 1YFHA 4ZYHA 2RQQA 5L3DA 2PQ8A 1YE9A 3RPUA 5CVRA 4Y4RA 1V5EA 2ZJ2A 3F0CA 3FXOA 1AOYA 3QP5A 2RV8A 2Y0SN 2HTJA 2OA4A 2BHYA 2L7ZA 2ZMEA 2NRAC 2LC2A 2QQ9A 2HDDA 4L9TA 2RC4A 2M45A 2O61A 3W2AA 1TWCJ 2QKLB 5F0HA 2E35A 3BR6A 1LKXA 3HYIA 3TDZC 5FB2A 2DDBA 3OSGA 2R3SA 5LGNA 3LAJA 1WI9A 3S1RJ 4FE7A 2GWRA 1YOVB 2F48A 3CDHA 4AWXB 1VQLI 5DS9A 5HOOA 3QYEA 3FMRA 1JGGA 4KN7X 3LA7A 4A0XA 3M8JA 3MKZA 4L18B 2EBIA 3E5XA 4BXFA 3LL7A 3ZQHA 3TOAA 1IW7F 1W5TA 5CQEA 3KLOA 2DFIA 2LRDA 2DOEA 4WF2A 3CP2A 4ZC3A 5FRMA 4QLCU 2BY1A 3HOXJ 2NS8A 2CSOA 2RN7A 2LY1A 3QU6A 3VYTB 2LY2A 3FHZA 3P9KA 5A2QZ 1MSEC 4F93B 2XSJC 1W36D 3HOWJ 1I6XA 1ETWA 1S5LC 2FX0A 2MLGA 3BJOA 3CMMA 3GTKJ 3JSPA 2PJRA 4GDFA 3SDGA 1MJAA 3B73A 5D8KB 3HOTA 1KU9A 5H20A 2XAFA 4A3CJ 1RI7A 1VQKI 1VI0A 2M34A 5L3EA 3IAS2 1ZREA 2K27A 1SD5A 1X2NA 1IUFA 1X1CA 4M9SA 2MC4A 4XLPF 1TLHB 4BXXJ 1O57A 1SFOJ 3VFZA 3CLQA 4YFXF 3BJAA 3CO7C 3S2WA 1RPWA 4XLCA 3OYKA 1ETOA 3J7AY 1Z77A 2QQAA 4UVAA 2VT2A 4E70A 1R58A 2GBYA 3IP4B 2LR8A 4LLNA 3BJ6A 3RCOA 3CESA 1SMTA 5DTDA 2ISZA 2E7WA 4BDZA 3TDUC 1W36C 3KYLA 2OUMA 2VL8A 1TQPA 4LITA 1IC8A 5FGMA 2X9DA 1UJ8A 1WJFA 4A3GJ 2XGCA 1U5TB 4G12A 1HW2A 4CYCA 3GYHX 3DQVC 4HV6A 2B7EA 2WAEA 3CC7I 3M07A 4KMUX 1X3UA 3F8FA 3CC4I 3HSEA 1MBJA 4IZZA 2XAUA 1R4MB 3FXQA 1U5TA 2AQFA 2H8RA 1GXQA 2GA1A 2V1UA 3HGGA 3FKIJ 3PUBA 4IHSA 2LKPA 4BHCA 3N97A 4ZTFA 2G7UA 2GIVA 2JMWA 1USSA 3W2VA 2V6EA 4OAYA 5C44J 2FRHA 5FKNA 1MMSA 4M3DA 1FTTA 2VBZA 3C2HA 3K4LA 2Y31A 2R7SA 3ABUA 5BOXA 3HKZN 3IL2A 1AHDP 2HU9A 2I8DA 1MBGA 2DODA 2DYSH 1E3OC 1AKHA 5GAHJ 2WB1N 3NWTA 3PFYA 2AXTC 1BJZA 2F5VA 2ELKA 4YFKF 3K70D 4A3JJ 1FC3A 2M5WA 1R7JA 4K2EA 2L7KA 2MSYA 2V26A 1QU3A 2CUZA 5LRSA 3V4GA 2VXDA 2DPUA 5FLVA 1D8KA 3OL4A 3EUHC 2QBYB 2VBWA 3IUOA 1FOYA 2DOAA 4DYCA 5IYDJ 3G4SI 3PJRA 5EGOB 1B1BA 5M3FJ 1ZQ3P 1J5YA 4RB0A 1U6GA 4UHTA 1BOBA 5LHHA 3JRGA 3KZYA 4IXAA 5JLXA 1R1UA 2PBIA 1GT0C 2HZTA 2MA3A 1Y1WJ 2E5NA 1LEAA 1B9MA 1MNMC 1SC7A 1UZCA 3RKWA 5C4XJ 1NTCA 2P6SA 1O7FA 1G8XA 3ONQA 5E3LA 4IHYA 1I1SA 2V79A 2R7UA 2KQRA 3S1QJ 3OOUA 3W6JB 2Z9OA 3CUQB 2R5ZA 2XKOA 5J8CA 3OYJA 2L02A 5BPDA 1YW9A 4XLHA 4QPOA 2NOJB 1JT0A 2DA2A 1IGNA 4RGUA 2R7WA 1JUMA 4E7ZA 3HOYJ 2CUFA 4MTEA 2XPVA 2MH2A 2XGXA 2NAZA 1ODDA 1TBXA 4RM2A 5LFAA 2HVRA 4FX4A 2ICWG 3CUQC 1JTXA 4JQFA 1IN8A 3CJTB 3WE3A 3E0JB 1FZPB 4IRHA 2CFXA 1WHUA 3KZIC 3RZDJ 4U0WA 4ON0A 2E19A 1VQ8I 1BN5A 2Z33A 1V54H 3LSJA 4PJLA 3CMEI 3K1PA 2D5VA 5KAFC 1B8IB 5EEGA 2KDOA 1MJ9A 3C3WA 3T5XA 3GX4X 1HA8A 2PMUA 5J4YA 3ZRGA 4BJ6C 2OTLI 2RNGA 3PO3J 2NNYA 3U9GA 1W7PA 3MZHA 3I64A 5E3MA 1ETKA 4HX7A 1R00A 4MO7A 3I9V2 4D7NA 2ZXIA 2HDWA 4F52A 4EMSA 3ECOA 2QQBA 3FIWA 4I0AA 5HNHA 3GFMA 1FP2A 4EVIA 1LJ9A 4P9UA 2BHZA 2VBXA 2VQGA 1BA5A 3TEDA 4LIVA 4BHBA 2FMYA 2M3AA 1Y6IA 1DU6A 3J7ZI 3K1NA 3O3KA 1I39A 3KP4A 4GFBA 1VFCA 2DMQA 2DA6A 1H9TA 4XBFA 2LKXA 5DD8A 3LAPA 1X1BA 5D5WB 4YELA 1TNTA 5K7HA 2L4MA 5CVJA 1L3LA 1R6RA 3Q9SA 4LK1F 5K7FA 1FSEA 5F64A 4ZYAA 3HKZA 3I3LA 3ABLH 3S17J 4IEJA 1WKMA 1OCTC 1TQMA 2KZVA 3RSNA 2LLKA 4AYBN 4C3HJ 4I98B 1JHFA 2FXAA 4KJZA 5F1RA 2DMNA 4Y52J 3L09A 3CCSI 4L0ZB 1ENHA 2QQ8A 5B1AH 3I56I 3Q5FA 4G7ZF 2DDAA 3B6AA 2R7VA 1BIBA 3DLAA 3V7SA 5K5OA 4JX5A 1Y39A 2JPCA 2XF5A 2ESNA 2WV0A 1KZHA 1J75A 3S2HJ 4ZYGA 3F8MA 2DAOA 1FIPA 2BZTA 1P7JA 3HM5A 4CCNA 4B09A 3V7RA 3P9IA 3ZQLA 2W84A 1LFBA 2EIKH 3VPRA 1QHHD 1WQ2A 4ENMA 3N05A 2MFZA 3LSTA 3WTUC 3F9KA 1IRGA 4DW6A 3NARA 4PDKA 3O6BB 3GFLA 5EG0B 3HXLA 3LSIA 1XDUA 1ZGAA 2WA0A 2HYJA 4PJNA 1V5GA 2ZXWH 2CQXA 1P2FA 3SJMA 1D1BA 4XRSG 1XSDA 2OTJI 2Y2ZA 1LE8A 4RAFA 1S7AA 3M1EA 2DFFA 3K2ZA 4M6XA 3D0SA 2KP6A 2ZBKA 3OYFA 5JHFA 4GRIA 5D8LB 3BTIA 2COBA 5JI6A 4BQNA 2EPFA 1WVRA 3QPSA 2VQLA 3T8TA 3HC7A 1QA6A 3F6OA 2PG4A 4XKCA 4IQ4A 4X6AJ 1HKQA 4M3BA 3K69A 1OR7C 2JJ7A 4ENJA 1U5TC 2NVXJ 2DFHA 1YRNA 5GAEJ 1EKEA 1Z05A 3JRIA 3FK6A 2VC1A 3I53A 4R79A 2YU3A 4HQEA 3UNGC 4Z6YA 2D2WA 1FLIA 3M9AA 4E7LA 5J8FA 2M7AA 5ERIA 2H6BA 4G6DA 3FZVA 3DKXA 4DYRA 1FX7A 5GADJ 4KDPA 4ENNA 3ZMTA 2O9LA 2HNHA 1XMXA 3I59B 1RRJA 4HF1A 4NQWA 2YU9J 4XKVA 3R0AA 4IKFA 3MQ0A 4XQFA 3LFUA 2JK3A 3IHUA 2XUBA 3JCUC 2QWWA 2GLOA 1I5ZA 1V5FA 2L7FP 4PK4A 1SVOA 4NQWB 2NS0A 1SFEA 2BY0A 3GXOA 2FBKA 4CYDA 1ITYA 1FMVA 1NG6A 2FD5A 1D0XA 3WTWC 1ETVA 2K9LA 3LA3A 2Q0OA 3BTCA 4HLXA 1ZRFA 1MBEA 2OZ6A 4I02A 4L9JA 3OIQA 5E8IA 3FM3A 4II2A 4XK4A 1LFUP 1ACIA 3OYAA 3DBLB 4RB3C 3OMYA 5B66C 2F5EA 3A1YA 2GZWA 4BHPA 3E5UA 1FOKA 1GVDA 4G6TB 1MIJA 2Y0MA 3MWMA 5IY5H 3OS2A 2K7LA 3TP3A 4L9VA 5EDNA 3CMYA 1G4DA 3EETA 3FBIB 3RYRA 2K9SA 3PFIA 3RDIA 1STZA 1U0JA 2CW0F 4CCMA 3LSRA 2DU9A 2O8XA 1KU7A 4BEHB 3FF5A 1YYVA 3FDYA 2UXNA 4ABZA 3ERED 3I54A 3FK7A 3MKWB 3VWBA 2JSPA 2E2IJ 4HDVA 4FTHA 1R22A 2D1HA 3UR3C 1ORKA 1WSUA 3H9JA 2GXAA 2BBYA 2ZNZA 4D5CA 4PFPA 3TMOA 3AKZA 3I58A 3G2BA 3L2UA 2VPLA 3H5RA 4KITB 3HRMA 3M1CA 3OR2C 3A01B 3EUAA 3CJQB 1GDTA 2PJRB 2AO9A 4XNFA 1FP1D 3I0TA 4Q48A 2E60A 3KYDB 2Z1DA 5GTHC 5BNGA 4G94A 1FBSA 5KNLA 3BG6A 2VC0A 3ZQ7A 1LDKB 4HOBA 3FXRA 2M8EA 1JGSA 1IF1A 1ZLJA 1HW5A 1PDNC 1YJWI 2QKMB 3GBGA 4QTRA 2Y9ZA 1G3SA 2EK5A 2MBFA 4PZJA 4EEFG 3DU5A 3JTHA 2XAQA 4C2MJ 2VONA 3AFHA 2VJIA 3R61A 4XM3A 1G2HA 2K86A 3LSMA 1T08B 4CH7A 4A93J 3VSKA 2OAZA 1HW1A 1JJ6C 2FSWA 2MC3A 1JTYA 3LSGA 1OFCX 4EJOA 2JQ7A 2A5YB 3Q3SA 1UHSA 3RPUD 3DP7A 2BE5F 5CQGA 5J1UA 4C3IJ 3ZGKA 2DA5A 2WC2A 3QPHA 2ZJPF 3FKJA 1KYWA 3F21A 4WCGA 1FBUA 1N75A 1Z3XA 2LDUA 3ZQQA 4ZH4F 2NVUB 3SZGA 4HF0A 1OKRA 5CJ9A 2M0CA 5LHIA 3EPZA 1E3HA 1D0YA 1J0RA 2DCEA 4ANJA 1R4NB 2PLYA 5F0CA 4KUMA 4BE0A 3BCAA 5J40A 5K5QA 2OU2A 3M8FA 5TJJA 2FF4A 5D5UB 3HHGA 2KT0A 3K1MA 5TGTA 1VTNC 3K4BA 1W1WE 2LMDA 1KGSA 2F5FA 2X6XA 2Z5UA 3NWSA 4A3FJ 2IS2A 1ONVA 2RNJA 1ZRDA 4C3JJ 1UHWA 4B48A 2YX4A 1TWHJ 2EIJH 1ZK8A 3FX3A 1BC8C 1D3YA 3NAUA 2IW5A 3GZNB 4IF4A 3NRVA 2G0EA 4V19K 5DM6F 5DV5A 2KL4A 1P9QC 3SZPA 4LLLA 4UUSA 4CGZA 3I5UA 3KPHA 5HDKA 4A3EJ 3ZN1A 1J59A 2EZKA 4RA2A 5FJ8J 4PUSA 4B1RA 3CQZJ 1NHAA 3TO7A 1IXSB 3KETA 1EH8A 2PN6A 1JT6A 3HB9A 5E79C 3RPQA 2EZLA 3U21A 3ZMUA 2VODA 4NC7A 1N77A 3KE2A 2M4KA 3E6CC 3VB2A 1QRYA 4XMYA 2M2EA 4PSWA 1BI3A 2CUJA 1LDDA 4XONA 1B59A 1K83J 3BTJA 3R6SA 1DQUA 2EFWA 3S14J 4HV5A 1OCOH 2K3PA 3OR1C 2MD0A 2KLOA 1UG2A 2HPIA 4HDUA 2GOXB 1QZEA 4NHJA 4RB1A 1R9TJ 1APLC 4NBQA 1ZELA 3H9GA 1SMYF 1UG0A 5AIQA 1HCRA 1IDYA 1EA3A 1S9HA 4UY8I 3ZMSA 3DKWA 1GV2A 2IGNA 2Y9YA 1R1VA 2X6WA 3L2RA 3KCCA 4Z2YA 2B63J 1RUNA 2XF6A 5D6EA 3CDIA 3A0HC 1NH3A 4WK8F 1DP3A 2FBHA 3VSLA 1YHQI 1QBJA 1W7PB 4HX8A 1ZG5A 2VJ5A 5JVGF 1D1AA 3AG2H 4FISA 4BEHA 4RAGA 2KJBA 1WCMJ 3GMEA 1TWAJ 5DD4A 2YR2A 4UXNA 1ULYA 4YIRX 4XOTA 1R23A 4N9HA 4F7ZA 1MNEA 1BIAA 3TO6A 2ELJA 1SVLA 3GZ6A 2KIMA 2F4IA 3FBNB 5FLMJ 1UB9A 2IPQX 4S0HB 2QYOA 1WJDA 3PNTA 3GO5A 3TW6A 3WHCA 1CQTA 4D7MA 2EV6A 4CXFA 3D5SC 3MN2A 2LBFB 2D1VA 2AXLA 3QYBA 5CYVA 2VOOA 2QVOA 3U1DA 1WJ5A 2QGUA 1R5HA 2LD5A 3L2CA 3H36A 2O3FA 3RKQA 3ZPLA 4QIWN 1ZH5A 5DM7F 2VKEA 1T39A 2X1DA 3MFKA 2IEKA 4BH9A 1TL8A 2CH0A 4OAZA 3SDBA 3RQIA 4LB6B 3R60A 3V8LA 1YG2A 4M72A 1REPC 1OYIA 5K7ZA 2DTZA 2QF7A 3SYTA 2W7NA 3RIRA 3V8KA 2QUFA 1ZGWA 2L0KA 4M74A 1FTZA 1UAAA 1GUUA 3IC7A 5EJCA 2PJPA 1BL0A 2MG4A 1MW7A 1QO0D 5JR3A 3QWLA 1F1ZA 2LFBA 5EZHA 3G6EI 5FKKA 3BLYA 1P4XA 4DBRA 4MEXF 4XLAA 3WHBA 3L1PA 1BM9A 3H0GJ 1ZR2A 2HQRA 2E1OA 1PUFB 2XRNA 3L9FA 2MH9A 1HSJA 2JVHA 4EM0B 3LA2A 4YG2F 5M5YJ 1UELB 2FJ1A 4KICA 2FNPA 1RUOA 1SD4A 4A3KJ 1TT5B 1MMGA 2MYSA 1IXRC 4EM2A 4BY1J 1WWXA 2DO7A 1T95A 3GZ5A 3HEFA 2ID3A 3K0LA 3KX2A 2A5WA 1RZ4A 1SFKA 3BOQA 5GP9A 3J81Z 1DU0A 3GEZA 2FMLA 5L3BA 4HNTA 2ZXHA 3JW4A 3PL8A 1OPCA 2K4JA 1BR4A 3JAMZ 2JA7J 1FYLA 2DFEA 2RREA 3T8RA 4XN3A 2F2EA 1MKMA 4BU2A 2H09A 2HOTA 2O03A 2VJJA 4O3MA 2DXIA 4GO1A 5E1ZB 2P5KA 5DEQA 2R7TA 4M3GA 2AS5F 3F23A 1T6SA 4IRIA 3TP0A 2DMUA 2XV4S 3ML6A 5LD2C 2PX9A 4UUSB 3DTIA 4LB5A 2HKOA 4XKWA 2EFPA 2F4MB 2K5CA 4F92B
chains in the Genus database with same CATH topology
1MJBA 3JSOA 2NYXA 3BPVA 2YPRA 1Y0UA 3C1DA 2P5LC 5HS9A 2ELHA 1GXPA 4RGSA 2B0LA 2W57A 5E17F 3ELKA 2J5OA 1T0FA 1BI0A 3HTSB 3KP2A 1DPRA 4P5OA 3IRRA 1QZYA 3E6DA 2JTVA 1OMIA 4CZZA 4G8XA 4WXCA 5AONA 4HQMA 4AIKA 1SD7A 4JK1X 1JXSA 3AAFA 2A3SA 4Y13A 4XLNF 1R1TA 1JHHA 4I09A 5DUIA 4ENKA 1YIOA 2WWYA 3DPTA 3L00A 2QLZA 4G9YA 3KP7A 1O3SA 2V1DA 5AIPA 2R7DA 4HAMA 4U7DA 3M7GA 5D6FA 1HXDA 2ZNYA 3FXUA 4KNYA 1UCRA 2GXGA 4DNCA 4OMZA 3QP6A 4TV7A 2M1BA 4LG0A 4HA8A 2R7FA 1IXCA 4CICA 3GUDA 5D4SA 1XGMA 3L7WA 2OZUA 1IRFA 2EA2A 1T38A 1XSVA 1SFUA 2H6CA 5LHGA 3ZMDA 2STWA 1O3RA 1CGPA 1T98A 3J80Z 2D45A 1XMKA 2DI3A 5H6RA 2IT0A 4UVBA 1FYKA 2WTEA 4R1HA 3OOPA 4AIHA 4M73A 4Q5SF 2DQRA 3CLOA 1PUEE 2GAUA 4WX9A 1UFMA 3GWZA 1OYYA 4CO8A 1QNTA 4I01A 3KP3A 1FT9A 1XGSA 4MNUA 1O3QA 2CYYA 5HDNA 2ZMEB 4I0BA 2H27A 4N0BA 2JPBA 4MTDA 3WTTC 1QQIA 5K5RA 2P6TA 2ZXJA 1MDMA 2HDCA 5HLHA 1UHMA 3ZMVA 4BNCA 1XN7A 2LNBA 2VE9A 5DUKA 5E8GA 3KP5A 3R0JA 1E2XA 4AVPA 1KQ8A 1F9NA 3WTXC 3U2RA 2RKHA 2CO5A 4L9NA 3WODF 1U2WA 2FU4A 1XCVA 1HSTA 1B6AA 2K02A 3T0YA 3TKYA 2EJRA 1V4RA 2E1NA 4O6JA 2VBYA 4BQAA 4KIGA 1XSXA 4ESJA 2CWEA 3TQNA 4I7HA 1K79A 2RGVA 2ESHA 2IA0A 5LRRA 5DCMA 4Q47A 2L54A 1GVJA 1ZLKA 3CJNA 2HOEA 2ETHA 2TDXA 5E1XA 1YO5C 3KLNA 1CF7A 4WXHA 2ZCWA 2A61A 2W85A 5F6FA 4M9ZA 3IWZA 5IT9K 2ZFWA 3BZ6A 3MEXA 1P4WA 5ICCA 5K1YA 4M6YA 5ICEA 2HKXA 2X4HA 5D4RA 5DDGA 1IZ1A 2ZKZA 2ZO4A 3HHHA 2RDPA 2HYGD 3NEUA 1B4AA 3LQRA 1S8NA 3SZTA 1K78A 4KYWA 3I71A 1SFXA 2GA2A 4L5JA 4AIJA 3RYPA 5BS6A 2DK5A 2A6HF 3DV8A 4FHTA 3NQOA 5DCMB 3RI4A 1LB2A 4IHTA 2DT5A 2OBPA 1D8JA 1PP7U 3HIFA 4L5IA 4MGRA 5CLSA 5KK1A 2LSOA 4IRGA 2JRTA 3HRTA 4PGGA 2RVCA 2OQRA 2EFNA 2KIUA 1HKTA 3DFGA 2XAJA 2V9VA 1KQ9A 1IN4A 1IN6A 1YS7A 5L3GA 4IPAA 4P55A 3LFKA 3HRSA 3DPLC 4XSZF 1BOAA 1Z6RA 2PI0A 2HYFA 3WTSC 3RJPA 3DF8A 4XSXF 1Z9CA 1MDMB 3F3XA 4HX4A 3KFWX 3J81K 3ZP5A 2P5VA 2QENA 2H94A 4GXOA 1DP7P 2PEXA 5LBQA 5JFRA 4JBAA 2PFBA 2OQGA 4KN4X 5FLXK 1YQAA 3K9TA 1ON1A 1E17A 1U8RA 2K4BA 2IA1A 2FNAA 2HEOA 4FX0A 2FOKA 4ZYDA 3WGGA 3C18A 4OOIA 2F5CA 4N9IA 3VOEA 4U88A 2JT1A 2A07F 4EM1A 1BC7C 1QGPA 1J9IA 1FBQA 3BPXA 3OV8A 1ZG1A 3E97A 4M9XA 4AD9A 5A2QK 3BDDA 3IKVA 2A6EF 3EDPA 3KEQA 3QPTA 2W25A 2XROA 1KQ0A 3QU3A 5LEKA 2L3DA 5ILUA 2FEZA 1S3JA 4WXDA 3MCZA 5L3FA 3KP6A 2V6CA 3M8EA 4ASNA 2G7HA 2IP2A 1IUYA 3SQNA 1LEBA 3C7JA 3VODA 2MD5A 4LGWA 4A2UA 5LGUA 4LG0B 1Q1HA 1Z6TA 3V7CA 2O0YA 2VE8A 4G6QA 2E1CA 2XKPA 2DPDA 1ZN2A 1FY7A 3MAJA 2MLKA 5LEJA 5BQTA 2IJLA 2HGCA 2XVCA 3V8JA 1O7LA 2L01A 4S05A 3WU0A 2KJCA 3GVAA 4GYIA 3PQJA 1B9NA 2ACJA 1HBXG 3J80K 1K7AA 1FNNA 4BXUA 2EA4A 4Q4ZF 2DW4A 3I4PA 1GHCA 4KA4A 2XAHA 1CF7B 4KIFA 2EV5A 2Y75A 3QRFF 3R4KA 4P9FA 5H6QA 1W5SA 4KMFA 1MZBA 4A0ZA 4EJVA 1TW2A 2OD5A 1QZZA 2G9WA 5E20A 3ISPA 5BPIA 1G3TA 3FMSA 2Z99A 1I1GA 2FQ3A 4Y17A 4G7HF 3ROUA 3GFIA 2HS5A 2HFHA 2VOPA 3COAC 4U0YA 2DBBA 4PGHA 4GYGA 1TQIA 5E1WA 1F5TA 4A0YA 1KYZA 1MD0A 4A5MA 1LQ1A 5HLIA 4PCQA 1HQCA 2BV6A 1USTA 2O6GE 1W4MA 4EGYA 3D5LA 3RKXA 4D0PA 1ON2A 1T2KA 5HS7A 3CTAA 1G6NA 3ZMZA 5HLGA 1ZHFA 2YSRA 1U78A 3DEUA 4OU0A 5ILVA 4CDGA 4ETSA 1Z7UA 5L3CA 3WE2A 4QWQA 5EEHA 1A04A 3CUQA 4ESBA 2HR3A 2HQNA 2PMHA 5D5VB 1YW7A 1DDNA 3GW2A 5IT3A 2P8TA 3HRUA 2XAGA 3WTYC 4OMYA 3HOSA 1V3FA 3F8NA 2CQKA 1XMAA 4XRFA 2HTSA 1EH7A 3GFJA 1KA8A 5FD5A 1P6RA 4OINF 2LF8A 1RNLA 5DCFA 4U7BA 3DXJF 2DK8A 3ABTA 1FWZA 2Y48A 1G3YA 3E6BA 1HKSA 2VN2A 1P4AA 4MEYF 4KIBA 2EV0A 1LDJA 5J6XA 4EJWA 4EJTA 2VT3A 4HW0A 1IN5A 2JSCA 3TOBA 3E3VA 1DUXC 5KVRA 1K78B 1SD6A 1D5VA 2F5DA 2CGPA 4L0YB 1KU2A 4UUVA 1BBYA 3B02A 3H3UA 1FSHA 3IRQA 1XB4A 3WU1B 2EB7A 1IN7A 2J5PA 1C0WA 1DPUA 2QZ8A 1PP8F 4HYEA 5FD6A 1Z91A 6PAXA 2V1XA 5FO5A 2FBIA 3PQKA 2BEOA 1TNSA 1BJAA 4CHUA 4RS8A 3KEOA 4A12A 2KRFA 5E18F 2HWVA 3SFZA 3EYIA 3Q9VA 4EGZA 3WTZA 5ICFA 3ECHA 4UVCA 5JVTA 3CUOA 2XIGA 3F8BA 2QBYA 4HF2A 1YW8A 3WGIA 2A69F 1KU3A 3H3ZA 1RIOH 1S7OA 3ULQB 3SHFA 4EV0A 1TTYA 3WTVC 3QOPA 2UXXA 2P7VB 3EUHA 3FWEA 5LLQA 1LNWA 4LMYA 1O3TA 2EFQA 1WRJA 1P92A 3P9CA 3N4MA 2COMA 3E6MA 1BI1A 1F4KA 4A6EA 3BY6A 1EV7A 4UNOA 1XD7A 2VXZA 3O2PE 4LK0F 1R5GA 1ZG3A 4MHGA 1BI2A 3J7AO 2KKOA 4KT5C 3IWFA 2XASA 2Q2EA 1H0MA 5HDGA 4BYYA 4KFCA 4NB5A 2XHKA 1K6OA 3G3ZA 1G3WA 4LLGF 2KIFA 3RTRA 1ZRCA 3LWFA 1I27A 2YX7A 2QM3A 1FPQA 5BMZA 1ZAOA 5JHUA 3VEPA 4Y15A 2DTRA 4RGXA 1Z1DA 2GQQA 5LGTA 2FA5A 4ZZLA 1XGNA 5HVQC 1YLFA 3JTGA 3GF2A 3BWGA 4DQ2A 4IVNA 1J7KA 3WG9A 2C6YA 2Q8KA 3W6KB 4LFUA 4ZYEA 5HS8A 3JAMK 3LQQA 2E7XA 4MQ9F 1YTYA 3MZYA 3F8CA 1AWCA 1LVAA 2EFOA 3SXYA 4OIRF 2JZYA 1XCBA 3FM5A 2DQLA 3IKTA 4EJUA 5FFZA 1XGOA 3BP8A 3ZN0A 4B8XA 4RB2C 4EQQA 3EYYA 3KZZA 5IT9Z 5D5XB 1OYWA 4YFNF 2GXBA 2IVMA 3G73A 3HSRA 1ZARA 4UV9A 4OIPF 4HZFA 3RKYA 3T1BA 1YS6A 2P4WA 1L0OC 4OIOF 3H92A 2M87A 1XDSA 3I59A 3BROA 3HTUA 4A6DA 3E5QA 3FMQA 3CO6C 5CVUA 2A68F 3HUGA 4U0VA 5CVVA 4RGRA 4LD5A 2RQPA 5ILSA 4WWCA 1J2XA 4IJAA 5TRDA 2STTA 3EQLF 2W24A 4O5VA 1OR7A 4H0EA 1W7PD 4R8HA 1R36A 1S6LA 4LJZF 3TGNA 4HLYA 1JE8A 4GCVA 4G7OF 3HSFA 2ADUA 3WGHA 1H9GA 4YIIA 2L4AA 4MQVA 2UWMA 4ESFA 2UZKA 2FE3A 2BGCA 2M30A 2ISYA 3TO9A 2IRFG 2Z3YA 3REOA 1U3EM 4HBLA 3GLXA 4RAYA 5ED4A 4P96A 1TW3A 4UV8A 3F6VA 2DLLA 4OIQF 4RAZA 2BYVE 1S29A 4M71A 4YIFA 4S04A 3F22A 4GGGA 1ZYRF 2NNNA 5FFXA 4ZZDA 4I2OA 3P7NA 1MGTA 3F72A 4A5NA 2LF7A 2X0LA 5DYMA 1FYMA 1QPMA 1SAXA 3QAHA 2CG4A 4BAYA 5FLXZ 4FT8A 2P7CB 2EWNA 1IAWA 1ZGJA 5CVIA 2IA2A 5ICGA 1EH6A 1YFHA 4ZYHA 5L3DA 2PQ8A 3RPUA 5CVRA 2ZJ2A 1AOYA 3QP5A 2RV8A 2HTJA 2OA4A 2ZMEA 2NRAC 2QQ9A 4L9TA 2RC4A 2M45A 2O61A 3HYIA 3TDZC 5FB2A 2R3SA 5LGNA 3LAJA 1WI9A 2GWRA 3CDHA 4AWXB 5HOOA 3FMRA 4KN7X 3LA7A 4A0XA 4L18B 3E5XA 3TOAA 1IW7F 1W5TA 3KLOA 2DFIA 4WF2A 4QLCU 2CSOA 2RN7A 3QU6A 3FHZA 3P9KA 5A2QZ 1I6XA 2MLGA 3BJOA 3JSPA 1MJAA 3B73A 5D8KB 3HOTA 1KU9A 5H20A 2XAFA 1RI7A 5L3EA 1ZREA 2K27A 1SD5A 4M9SA 4XLPF 1TLHB 1O57A 3VFZA 4YFXF 3BJAA 3CO7C 3S2WA 2QQAA 4UVAA 2VT2A 4E70A 1R58A 4LLNA 3BJ6A 1SMTA 2ISZA 2E7WA 3TDUC 1TQPA 5FGMA 1U5TB 1HW2A 3GYHX 3DQVC 4HV6A 4KMUX 1X3UA 3F8FA 3HSEA 1U5TA 3FXQA 1GXQA 2GA1A 2V1UA 4IHSA 4BHCA 2LKPA 3N97A 2G7UA 2GIVA 1USSA 2FRHA 2VBZA 3ABUA 5BOXA 3IL2A 4YFKF 1FC3A 2M5WA 1R7JA 4K2EA 5LRSA 3V4GA 2DPUA 1D8KA 2QBYB 2VBWA 1B1BA 1J5YA 4RB0A 1U6GA 4UHTA 5LHHA 3KZYA 4IXAA 1R1UA 2PBIA 2HZTA 2MA3A 1LEAA 1B9MA 3RKWA 2P6SA 1O7FA 1I1SA 2V79A 3W6JB 2Z9OA 3CUQB 2XKOA 5J8CA 2L02A 5BPDA 1YW9A 4RGUA 4MTEA 2MH2A 2XGXA 2NAZA 1ODDA 1TBXA 4FX4A 3CUQC 4JQFA 1IN8A 3WE3A 1FZPB 4IRHA 2CFXA 4U0WA 4ON0A 1BN5A 2Z33A 3K1PA 5EEGA 3T5XA 1MJ9A 3C3WA 3GX4X 2PMUA 2NNYA 3U9GA 1W7PA 3MZHA 3I64A 4HX7A 1R00A 4EMSA 3ECOA 2QQBA 4I0AA 3GFMA 1FP2A 4EVIA 1LJ9A 4P9UA 2VBXA 4BHBA 2FMYA 3K1NA 3O3KA 3KP4A 1H9TA 4XBFA 5DD8A 3LAPA 5D5WB 1TNTA 1L3LA 2L4MA 5CVJA 3Q9SA 4LK1F 1FSEA 5F64A 1WKMA 1TQMA 4I98B 1JHFA 2FXAA 5F1RA 3L09A 4L0ZB 3Q5FA 4G7ZF 1BIBA 3V7SA 5K5OA 2JPCA 2ESNA 2WV0A 1J75A 4ZYGA 3F8MA 2DAOA 4B09A 3V7RA 3P9IA 2W84A 1WQ2A 4ENMA 3LSTA 3WTUC 1IRGA 4PDKA 3O6BB 3GFLA 1XDUA 1ZGAA 1P2FA 1XSDA 1S7AA 3M1EA 3K2ZA 4M6XA 3D0SA 2ZBKA 5D8LB 5JI6A 3T8TA 3F6OA 2PG4A 1HKQA 3K69A 4ENJA 1U5TC 1Z05A 2VC1A 3I53A 4R79A 2YU3A 4HQEA 1FLIA 2D2WA 3M9AA 5J8FA 5ERIA 2H6BA 4G6DA 3FZVA 1FX7A 4KDPA 4ENNA 3ZMTA 3I59B 4HF1A 4NQWA 3R0AA 3MQ0A 3IHUA 2XUBA 2QWWA 1I5ZA 2NS0A 1SFEA 3GXOA 2FBKA 4CYDA 3WTWC 3LA3A 2Q0OA 1ZRFA 4HLXA 4I02A 2OZ6A 4L9JA 5E8IA 3FM3A 4RB3C 2F5EA 2GZWA 4BHPA 3E5UA 1FOKA 2Y0MA 3MWMA 2K7LA 4L9VA 1G4DA 3EETA 3RYRA 3PFIA 3RDIA 1STZA 2CW0F 2DU9A 2O8XA 1KU7A 3FF5A 1YYVA 2UXNA 3ERED 3I54A 4HDVA 1R22A 2D1HA 1WSUA 2BBYA 2ZNZA 3I58A 3HRMA 1FP1D 3I0TA 4Q48A 4G94A 1FBSA 2VC0A 3ZQ7A 1LDKB 4HOBA 3FXRA 2M8EA 1JGSA 1IF1A 1ZLJA 1HW5A 1PDNC 1G3SA 2EK5A 2MBFA 4PZJA 3JTHA 2XAQA 2VONA 3R61A 2K86A 2OAZA 1HW1A 2FSWA 2MC3A 4EJOA 2A5YB 2BE5F 3DP7A 2WC2A 3QPHA 1KYWA 3F21A 4WCGA 1FBUA 2LDUA 4ZH4F 4HF0A 1OKRA 5CJ9A 1J0RA 2PLYA 4KUMA 5K5QA 2OU2A 3M8FA 5TJJA 2FF4A 5D5UB 3HHGA 3K1MA 1VTNC 1KGSA 2F5FA 2Z5UA 1ONVA 2RNJA 1ZRDA 1UHWA 2YX4A 3FX3A 1BC8C 1D3YA 2IW5A 4IF4A 3NRVA 5DV5A 3SZPA 4CGZA 4LLLA 3I5UA 5HDKA 3ZN1A 1J59A 1NHAA 3TO7A 1IXSB 3KETA 1EH8A 2PN6A 3RPQA 3ZMUA 2VODA 3KE2A 3E6CC 3VB2A 1BI3A 1LDDA 1B59A 3R6SA 2EFWA 4HV5A 4HDUA 4NHJA 4RB1A 1SMYF 5AIQA 3ZMSA 3DKWA 1R1VA 3KCCA 4Z2YA 1RUNA 5D6EA 4WK8F 2FBHA 1QBJA 1W7PB 4HX8A 1ZG5A 2KJBA 5DD4A 2YR2A 4UXNA 1ULYA 1R23A 4N9HA 4F7ZA 1BIAA 3TO6A 3GZ6A 2KIMA 1UB9A 2IPQX 2QYOA 3GO5A 2EV6A 4CXFA 2D1VA 2AXLA 2VOOA 5CYVA 2QVOA 3U1DA 1R5HA 3L2CA 2O3FA 3ZPLA 1ZH5A 1T39A 3MFKA 4BH9A 4LB6B 3R60A 3V8LA 1YG2A 4M72A 1REPC 1OYIA 3RIRA 3V8KA 2QUFA 4M74A 3IC7A 2PJPA 1QO0D 5JR3A 1F1ZA 1P4XA 4MEXF 1BM9A 2HQRA 2XRNA 3L9FA 2MH9A 1HSJA 4EM0B 3LA2A 4YG2F 4KICA 2FNPA 1RUOA 1SD4A 1IXRC 4EM2A 1WWXA 2DO7A 3GZ5A 3K0LA 1RZ4A 3BOQA 3J81Z 3GEZA 2FMLA 5L3BA 3JW4A 1OPCA 2K4JA 3JAMZ 1FYLA 3T8RA 2F2EA 1MKMA 2H09A 2O03A 4O3MA 4GO1A 5E1ZB 2P5KA 5DEQA 2AS5F 3F23A 1T6SA 4IRIA 2XV4S 3ML6A 4LB5A 2HKOA 2EFPA 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJB A;  3JSO A;  2NYX A;  3BPV A;  2YPR A;  1Y0U A;  3C1D A;  2P5L C;  5HS9 A;  2ELH A;  1GXP A;  4RGS A;  2B0L A;  2W57 A;  5E17 F;  3ELK A;  2J5O A;  1T0F A;  1BI0 A;  3HTS B;  3KP2 A;  1DPR A;  4P5O A;  3IRR A;  1QZY A;  3E6D A;  2JTV A;  1OMI A;  4CZZ A;  4G8X A;  4WXC A;  5AON A;  4HQM A;  4AIK A;  1SD7 A;  4JK1 X;  1JXS A;  3AAF A;  2A3S A;  4Y13 A;  4XLN F;  1R1T A;  1JHH A;  4I09 A;  5DUI A;  4ENK A;  1YIO A;  2WWY A;  3DPT A;  3L00 A;  2QLZ A;  4G9Y A;  3KP7 A;  1O3S A;  2V1D A;  5AIP A;  2R7D A;  4HAM A;  4U7D A;  3M7G A;  5D6F A;  1HXD A;  2ZNY A;  3FXU A;  4KNY A;  1UCR A;  2GXG A;  4DNC A;  4OMZ A;  3QP6 A;  4TV7 A;  2M1B A;  4LG0 A;  4HA8 A;  2R7F A;  1IXC A;  4CIC A;  3GUD A;  5D4S A;  1XGM A;  3L7W A;  2OZU A;  1IRF A;  2EA2 A;  1T38 A;  1XSV A;  1SFU A;  2H6C A;  5LHG A;  3ZMD A;  2STW A;  1O3R A;  1CGP A;  1T98 A;  3J80 Z;  2D45 A;  1XMK A;  2DI3 A;  5H6R A;  2IT0 A;  4UVB A;  1FYK A;  2WTE A;  4R1H A;  3OOP A;  4AIH A;  4M73 A;  4Q5S F;  2DQR A;  3CLO A;  1PUE E;  2GAU A;  4WX9 A;  1UFM A;  3GWZ A;  1OYY A;  4CO8 A;  1QNT A;  4I01 A;  3KP3 A;  1FT9 A;  1XGS A;  4MNU A;  1O3Q A;  2CYY A;  5HDN A;  2ZME B;  4I0B A;  2H27 A;  4N0B A;  2JPB A;  4MTD A;  3WTT C;  1QQI A;  5K5R A;  2P6T A;  2ZXJ A;  1MDM A;  2HDC A;  5HLH A;  1UHM A;  3ZMV A;  4BNC A;  1XN7 A;  2LNB A;  2VE9 A;  5DUK A;  5E8G A;  3KP5 A;  3R0J A;  1E2X A;  4AVP A;  1KQ8 A;  1F9N A;  3WTX C;  3U2R A;  2RKH A;  2CO5 A;  4L9N A;  3WOD F;  1U2W A;  2FU4 A;  1XCV A;  1HST A;  1B6A A;  2K02 A;  3T0Y A;  3TKY A;  2EJR A;  1V4R A;  2E1N A;  4O6J A;  2VBY A;  4BQA A;  4KIG A;  1XSX A;  4ESJ A;  2CWE A;  3TQN A;  4I7H A;  1K79 A;  2RGV A;  2ESH A;  2IA0 A;  5LRR A;  5DCM A;  4Q47 A;  2L54 A;  1GVJ A;  1ZLK A;  3CJN A;  2HOE A;  2ETH A;  2TDX A;  5E1X A;  1YO5 C;  3KLN A;  1CF7 A;  4WXH A;  2ZCW A;  2A61 A;  2W85 A;  5F6F A;  4M9Z A;  3IWZ A;  5IT9 K;  2ZFW A;  3BZ6 A;  3MEX A;  1P4W A;  5ICC A;  5K1Y A;  4M6Y A;  5ICE A;  2HKX A;  2X4H A;  5D4R A;  5DDG A;  1IZ1 A;  2ZKZ A;  2ZO4 A;  3HHH A;  2RDP A;  2HYG D;  3NEU A;  1B4A A;  3LQR A;  1S8N A;  3SZT A;  1K78 A;  4KYW A;  3I71 A;  1SFX A;  2GA2 A;  4L5J A;  4AIJ A;  3RYP A;  5BS6 A;  2DK5 A;  2A6H F;  3DV8 A;  4FHT A;  3NQO A;  5DCM B;  3RI4 A;  1LB2 A;  4IHT A;  2DT5 A;  2OBP A;  1D8J A;  1PP7 U;  3HIF A;  4L5I A;  4MGR A;  5CLS A;  5KK1 A;  2LSO A;  4IRG A;  2JRT A;  3HRT A;  4PGG A;  2RVC A;  2OQR A;  2EFN A;  2KIU A;  1HKT A;  3DFG A;  2XAJ A;  2V9V A;  1KQ9 A;  1IN4 A;  1IN6 A;  1YS7 A;  5L3G A;  4IPA A;  4P55 A;  3LFK A;  3HRS A;  3DPL C;  4XSZ F;  1BOA A;  1Z6R A;  2PI0 A;  2HYF A;  3WTS C;  3RJP A;  3DF8 A;  4XSX F;  1Z9C A;  1MDM B;  3F3X A;  4HX4 A;  3KFW X;  3J81 K;  3ZP5 A;  2P5V A;  2QEN A;  2H94 A;  4GXO A;  1DP7 P;  2PEX A;  5LBQ A;  5JFR A;  4JBA A;  2PFB A;  2OQG A;  4KN4 X;  5FLX K;  1YQA A;  3K9T A;  1ON1 A;  1E17 A;  1U8R A;  2K4B A;  2IA1 A;  2FNA A;  2HEO A;  4FX0 A;  2FOK A;  4ZYD A;  3WGG A;  3C18 A;  4OOI A;  2F5C A;  4N9I A;  3VOE A;  4U88 A;  2JT1 A;  2A07 F;  4EM1 A;  1BC7 C;  1QGP A;  1J9I A;  1FBQ A;  3BPX A;  3OV8 A;  1ZG1 A;  3E97 A;  4M9X A;  4AD9 A;  5A2Q K;  3BDD A;  3IKV A;  2A6E F;  3EDP A;  3KEQ A;  3QPT A;  2W25 A;  2XRO A;  1KQ0 A;  3QU3 A;  5LEK A;  2L3D A;  5ILU A;  2FEZ A;  1S3J A;  4WXD A;  3MCZ A;  5L3F A;  3KP6 A;  2V6C A;  3M8E A;  4ASN A;  2G7H A;  2IP2 A;  1IUY A;  3SQN A;  1LEB A;  3C7J A;  3VOD A;  2MD5 A;  4LGW A;  4A2U A;  5LGU A;  4LG0 B;  1Q1H A;  1Z6T A;  3V7C A;  2O0Y A;  2VE8 A;  4G6Q A;  2E1C A;  2XKP A;  2DPD A;  1ZN2 A;  1FY7 A;  3MAJ A;  2MLK A;  5LEJ A;  5BQT A;  2IJL A;  2HGC A;  2XVC A;  3V8J A;  1O7L A;  2L01 A;  4S05 A;  3WU0 A;  2KJC A;  3GVA A;  4GYI A;  3PQJ A;  1B9N A;  2ACJ A;  1HBX G;  3J80 K;  1K7A A;  1FNN A;  4BXU A;  2EA4 A;  4Q4Z F;  2DW4 A;  3I4P A;  1GHC A;  4KA4 A;  2XAH A;  1CF7 B;  4KIF A;  2EV5 A;  2Y75 A;  3QRF F;  3R4K A;  4P9F A;  5H6Q A;  1W5S A;  4KMF A;  1MZB A;  4A0Z A;  4EJV A;  1TW2 A;  2OD5 A;  1QZZ A;  2G9W A;  5E20 A;  3ISP A;  5BPI A;  1G3T A;  3FMS A;  2Z99 A;  1I1G A;  2FQ3 A;  4Y17 A;  4G7H F;  3ROU A;  3GFI A;  2HS5 A;  2HFH A;  2VOP A;  3COA C;  4U0Y A;  2DBB A;  4PGH A;  4GYG A;  1TQI A;  5E1W A;  1F5T A;  4A0Y A;  1KYZ A;  1MD0 A;  4A5M A;  1LQ1 A;  5HLI A;  4PCQ A;  1HQC A;  2BV6 A;  1UST A;  2O6G E;  1W4M A;  4EGY A;  3D5L A;  3RKX A;  4D0P A;  1ON2 A;  1T2K A;  5HS7 A;  3CTA A;  1G6N A;  3ZMZ A;  5HLG A;  1ZHF A;  2YSR A;  1U78 A;  3DEU A;  4OU0 A;  5ILV A;  4CDG A;  4ETS A;  1Z7U A;  5L3C A;  3WE2 A;  4QWQ A;  5EEH A;  1A04 A;  3CUQ A;  4ESB A;  2HR3 A;  2HQN A;  2PMH A;  5D5V B;  1YW7 A;  1DDN A;  3GW2 A;  5IT3 A;  2P8T A;  3HRU A;  2XAG A;  3WTY C;  4OMY A;  3HOS A;  1V3F A;  3F8N A;  2CQK A;  1XMA A;  4XRF A;  2HTS A;  1EH7 A;  3GFJ A;  1KA8 A;  5FD5 A;  1P6R A;  4OIN F;  2LF8 A;  1RNL A;  5DCF A;  4U7B A;  3DXJ F;  2DK8 A;  3ABT A;  1FWZ A;  2Y48 A;  1G3Y A;  3E6B A;  1HKS A;  2VN2 A;  1P4A A;  4MEY F;  4KIB A;  2EV0 A;  1LDJ A;  5J6X A;  4EJW A;  4EJT A;  2VT3 A;  4HW0 A;  1IN5 A;  2JSC A;  3TOB A;  3E3V A;  1DUX C;  5KVR A;  1K78 B;  1SD6 A;  1D5V A;  2F5D A;  2CGP A;  4L0Y B;  1KU2 A;  4UUV A;  1BBY A;  3B02 A;  3H3U A;  1FSH A;  3IRQ A;  1XB4 A;  3WU1 B;  2EB7 A;  1IN7 A;  2J5P A;  1C0W A;  1DPU A;  2QZ8 A;  1PP8 F;  4HYE A;  5FD6 A;  1Z91 A;  6PAX A;  2V1X A;  5FO5 A;  2FBI A;  3PQK A;  2BEO A;  1TNS A;  1BJA A;  4CHU A;  4RS8 A;  3KEO A;  4A12 A;  2KRF A;  5E18 F;  2HWV A;  3SFZ A;  3EYI A;  3Q9V A;  4EGZ A;  3WTZ A;  5ICF A;  3ECH A;  4UVC A;  5JVT A;  3CUO A;  2XIG A;  3F8B A;  2QBY A;  4HF2 A;  1YW8 A;  3WGI A;  2A69 F;  1KU3 A;  3H3Z A;  1RIO H;  1S7O A;  3ULQ B;  3SHF A;  4EV0 A;  1TTY A;  3WTV C;  3QOP A;  2UXX A;  2P7V B;  3EUH A;  3FWE A;  5LLQ A;  1LNW A;  4LMY A;  1O3T A;  2EFQ A;  1WRJ A;  1P92 A;  3P9C A;  3N4M A;  2COM A;  3E6M A;  1BI1 A;  1F4K A;  4A6E A;  3BY6 A;  1EV7 A;  4UNO A;  1XD7 A;  2VXZ A;  3O2P E;  4LK0 F;  1R5G A;  1ZG3 A;  4MHG A;  1BI2 A;  3J7A O;  2KKO A;  4KT5 C;  3IWF A;  2XAS A;  2Q2E A;  1H0M A;  5HDG A;  4BYY A;  4KFC A;  4NB5 A;  2XHK A;  1K6O A;  3G3Z A;  1G3W A;  4LLG F;  2KIF A;  3RTR A;  1ZRC A;  3LWF A;  1I27 A;  2YX7 A;  2QM3 A;  1FPQ A;  5BMZ A;  1ZAO A;  5JHU A;  3VEP A;  4Y15 A;  2DTR A;  4RGX A;  1Z1D A;  2GQQ A;  5LGT A;  2FA5 A;  4ZZL A;  1XGN A;  5HVQ C;  1YLF A;  3JTG A;  3GF2 A;  3BWG A;  4DQ2 A;  4IVN A;  1J7K A;  3WG9 A;  2C6Y A;  2Q8K A;  3W6K B;  4LFU A;  4ZYE A;  5HS8 A;  3JAM K;  3LQQ A;  2E7X A;  4MQ9 F;  1YTY A;  3MZY A;  3F8C A;  1AWC A;  1LVA A;  2EFO A;  3SXY A;  4OIR F;  2JZY A;  1XCB A;  3FM5 A;  2DQL A;  3IKT A;  4EJU A;  5FFZ A;  1XGO A;  3BP8 A;  3ZN0 A;  4B8X A;  4RB2 C;  4EQQ A;  3EYY A;  3KZZ A;  5IT9 Z;  5D5X B;  1OYW A;  4YFN F;  2GXB A;  2IVM A;  3G73 A;  3HSR A;  1ZAR A;  4UV9 A;  4OIP F;  4HZF A;  3RKY A;  3T1B A;  1YS6 A;  2P4W A;  1L0O C;  4OIO F;  3H92 A;  2M87 A;  1XDS A;  3I59 A;  3BRO A;  3HTU A;  4A6D A;  3E5Q A;  3FMQ A;  3CO6 C;  5CVU A;  2A68 F;  3HUG A;  4U0V A;  5CVV A;  4RGR A;  4LD5 A;  2RQP A;  5ILS A;  4WWC A;  1J2X A;  4IJA A;  5TRD A;  2STT A;  3EQL F;  2W24 A;  4O5V A;  1OR7 A;  4H0E A;  1W7P D;  4R8H A;  1R36 A;  1S6L A;  4LJZ F;  3TGN A;  4HLY A;  1JE8 A;  4GCV A;  4G7O F;  3HSF A;  2ADU A;  3WGH A;  1H9G A;  4YII A;  2L4A A;  4MQV A;  2UWM A;  4ESF A;  2UZK A;  2FE3 A;  2BGC A;  2M30 A;  2ISY A;  3TO9 A;  2IRF G;  2Z3Y A;  3REO A;  1U3E M;  4HBL A;  3GLX A;  4RAY A;  5ED4 A;  4P96 A;  1TW3 A;  4UV8 A;  3F6V A;  2DLL A;  4OIQ F;  4RAZ A;  2BYV E;  1S29 A;  4M71 A;  4YIF A;  4S04 A;  3F22 A;  4GGG A;  1ZYR F;  2NNN A;  5FFX A;  4ZZD A;  4I2O A;  3P7N A;  1MGT A;  3F72 A;  4A5N A;  2LF7 A;  2X0L A;  5DYM A;  1FYM A;  1QPM A;  1SAX A;  3QAH A;  2CG4 A;  4BAY A;  5FLX Z;  4FT8 A;  2P7C B;  2EWN A;  1IAW A;  1ZGJ A;  5CVI A;  2IA2 A;  5ICG A;  1EH6 A;  1YFH A;  4ZYH A;  5L3D A;  2PQ8 A;  3RPU A;  5CVR A;  2ZJ2 A;  1AOY A;  3QP5 A;  2RV8 A;  2HTJ A;  2OA4 A;  2ZME A;  2NRA C;  2QQ9 A;  4L9T A;  2RC4 A;  2M45 A;  2O61 A;  3HYI A;  3TDZ C;  5FB2 A;  2R3S A;  5LGN A;  3LAJ A;  1WI9 A;  2GWR A;  3CDH A;  4AWX B;  5HOO A;  3FMR A;  4KN7 X;  3LA7 A;  4A0X A;  4L18 B;  3E5X A;  3TOA A;  1IW7 F;  1W5T A;  3KLO A;  2DFI A;  4WF2 A;  4QLC U;  2CSO A;  2RN7 A;  3QU6 A;  3FHZ A;  3P9K A;  5A2Q Z;  1I6X A;  2MLG A;  3BJO A;  3JSP A;  1MJA A;  3B73 A;  5D8K B;  3HOT A;  1KU9 A;  5H20 A;  2XAF A;  1RI7 A;  5L3E A;  1ZRE A;  2K27 A;  1SD5 A;  4M9S A;  4XLP F;  1TLH B;  1O57 A;  3VFZ A;  4YFX F;  3BJA A;  3CO7 C;  3S2W A;  2QQA A;  4UVA A;  2VT2 A;  4E70 A;  1R58 A;  4LLN A;  3BJ6 A;  1SMT A;  2ISZ A;  2E7W A;  3TDU C;  1TQP A;  5FGM A;  1U5T B;  1HW2 A;  3GYH X;  3DQV C;  4HV6 A;  4KMU X;  1X3U A;  3F8F A;  3HSE A;  1U5T A;  3FXQ A;  1GXQ A;  2GA1 A;  2V1U A;  4IHS A;  4BHC A;  2LKP A;  3N97 A;  2G7U A;  2GIV A;  1USS A;  2FRH A;  2VBZ A;  3ABU A;  5BOX A;  3IL2 A;  4YFK F;  1FC3 A;  2M5W A;  1R7J A;  4K2E A;  5LRS A;  3V4G A;  2DPU A;  1D8K A;  2QBY B;  2VBW A;  1B1B A;  1J5Y A;  4RB0 A;  1U6G A;  4UHT A;  5LHH A;  3KZY A;  4IXA A;  1R1U A;  2PBI A;  2HZT A;  2MA3 A;  1LEA A;  1B9M A;  3RKW A;  2P6S A;  1O7F A;  1I1S A;  2V79 A;  3W6J B;  2Z9O A;  3CUQ B;  2XKO A;  5J8C A;  2L02 A;  5BPD A;  1YW9 A;  4RGU A;  4MTE A;  2MH2 A;  2XGX A;  2NAZ A;  1ODD A;  1TBX A;  4FX4 A;  3CUQ C;  4JQF A;  1IN8 A;  3WE3 A;  1FZP B;  4IRH A;  2CFX A;  4U0W A;  4ON0 A;  1BN5 A;  2Z33 A;  3K1P A;  5EEG A;  3T5X A;  1MJ9 A;  3C3W A;  3GX4 X;  2PMU A;  2NNY A;  3U9G A;  1W7P A;  3MZH A;  3I64 A;  4HX7 A;  1R00 A;  4EMS A;  3ECO A;  2QQB A;  4I0A A;  3GFM A;  1FP2 A;  4EVI A;  1LJ9 A;  4P9U A;  2VBX A;  4BHB A;  2FMY A;  3K1N A;  3O3K A;  3KP4 A;  1H9T A;  4XBF A;  5DD8 A;  3LAP A;  5D5W B;  1TNT A;  1L3L A;  2L4M A;  5CVJ A;  3Q9S A;  4LK1 F;  1FSE A;  5F64 A;  1WKM A;  1TQM A;  4I98 B;  1JHF A;  2FXA A;  5F1R A;  3L09 A;  4L0Z B;  3Q5F A;  4G7Z F;  1BIB A;  3V7S A;  5K5O A;  2JPC A;  2ESN A;  2WV0 A;  1J75 A;  4ZYG A;  3F8M A;  2DAO A;  4B09 A;  3V7R A;  3P9I A;  2W84 A;  1WQ2 A;  4ENM A;  3LST A;  3WTU C;  1IRG A;  4PDK A;  3O6B B;  3GFL A;  1XDU A;  1ZGA A;  1P2F A;  1XSD A;  1S7A A;  3M1E A;  3K2Z A;  4M6X A;  3D0S A;  2ZBK A;  5D8L B;  5JI6 A;  3T8T A;  3F6O A;  2PG4 A;  1HKQ A;  3K69 A;  4ENJ A;  1U5T C;  1Z05 A;  2VC1 A;  3I53 A;  4R79 A;  2YU3 A;  4HQE A;  1FLI A;  2D2W A;  3M9A A;  5J8F A;  5ERI A;  2H6B A;  4G6D A;  3FZV A;  1FX7 A;  4KDP A;  4ENN A;  3ZMT A;  3I59 B;  4HF1 A;  4NQW A;  3R0A A;  3MQ0 A;  3IHU A;  2XUB A;  2QWW A;  1I5Z A;  2NS0 A;  1SFE A;  3GXO A;  2FBK A;  4CYD A;  3WTW C;  3LA3 A;  2Q0O A;  1ZRF A;  4HLX A;  4I02 A;  2OZ6 A;  4L9J A;  5E8I A;  3FM3 A;  4RB3 C;  2F5E A;  2GZW A;  4BHP A;  3E5U A;  1FOK A;  2Y0M A;  3MWM A;  2K7L A;  4L9V A;  1G4D A;  3EET A;  3RYR A;  3PFI A;  3RDI A;  1STZ A;  2CW0 F;  2DU9 A;  2O8X A;  1KU7 A;  3FF5 A;  1YYV A;  2UXN A;  3ERE D;  3I54 A;  4HDV A;  1R22 A;  2D1H A;  1WSU A;  2BBY A;  2ZNZ A;  3I58 A;  3HRM A;  1FP1 D;  3I0T A;  4Q48 A;  4G94 A;  1FBS A;  2VC0 A;  3ZQ7 A;  1LDK B;  4HOB A;  3FXR A;  2M8E A;  1JGS A;  1IF1 A;  1ZLJ A;  1HW5 A;  1PDN C;  1G3S A;  2EK5 A;  2MBF A;  4PZJ A;  3JTH A;  2XAQ A;  2VON A;  3R61 A;  2K86 A;  2OAZ A;  1HW1 A;  2FSW A;  2MC3 A;  4EJO A;  2A5Y B;  2BE5 F;  3DP7 A;  2WC2 A;  3QPH A;  1KYW A;  3F21 A;  4WCG A;  1FBU A;  2LDU A;  4ZH4 F;  4HF0 A;  1OKR A;  5CJ9 A;  1J0R A;  2PLY A;  4KUM A;  5K5Q A;  2OU2 A;  3M8F A;  5TJJ A;  2FF4 A;  5D5U B;  3HHG A;  3K1M A;  1VTN C;  1KGS A;  2F5F A;  2Z5U A;  1ONV A;  2RNJ A;  1ZRD A;  1UHW A;  2YX4 A;  3FX3 A;  1BC8 C;  1D3Y A;  2IW5 A;  4IF4 A;  3NRV A;  5DV5 A;  3SZP A;  4CGZ A;  4LLL A;  3I5U A;  5HDK A;  3ZN1 A;  1J59 A;  1NHA A;  3TO7 A;  1IXS B;  3KET A;  1EH8 A;  2PN6 A;  3RPQ A;  3ZMU A;  2VOD A;  3KE2 A;  3E6C C;  3VB2 A;  1BI3 A;  1LDD A;  1B59 A;  3R6S A;  2EFW A;  4HV5 A;  4HDU A;  4NHJ A;  4RB1 A;  1SMY F;  5AIQ A;  3ZMS A;  3DKW A;  1R1V A;  3KCC A;  4Z2Y A;  1RUN A;  5D6E A;  4WK8 F;  2FBH A;  1QBJ A;  1W7P B;  4HX8 A;  1ZG5 A;  2KJB A;  5DD4 A;  2YR2 A;  4UXN A;  1ULY A;  1R23 A;  4N9H A;  4F7Z A;  1BIA A;  3TO6 A;  3GZ6 A;  2KIM A;  1UB9 A;  2IPQ X;  2QYO A;  3GO5 A;  2EV6 A;  4CXF A;  2D1V A;  2AXL A;  2VOO A;  5CYV A;  2QVO A;  3U1D A;  1R5H A;  3L2C A;  2O3F A;  3ZPL A;  1ZH5 A;  1T39 A;  3MFK A;  4BH9 A;  4LB6 B;  3R60 A;  3V8L A;  1YG2 A;  4M72 A;  1REP C;  1OYI A;  3RIR A;  3V8K A;  2QUF A;  4M74 A;  3IC7 A;  2PJP A;  1QO0 D;  5JR3 A;  1F1Z A;  1P4X A;  4MEX F;  1BM9 A;  2HQR A;  2XRN A;  3L9F A;  2MH9 A;  1HSJ A;  4EM0 B;  3LA2 A;  4YG2 F;  4KIC A;  2FNP A;  1RUO A;  1SD4 A;  1IXR C;  4EM2 A;  1WWX A;  2DO7 A;  3GZ5 A;  3K0L A;  1RZ4 A;  3BOQ A;  3J81 Z;  3GEZ A;  2FML A;  5L3B A;  3JW4 A;  1OPC A;  2K4J A;  3JAM Z;  1FYL A;  3T8R A;  2F2E A;  1MKM A;  2H09 A;  2O03 A;  4O3M A;  4GO1 A;  5E1Z B;  2P5K A;  5DEQ A;  2AS5 F;  3F23 A;  1T6S A;  4IRI A;  2XV4 S;  3ML6 A;  4LB5 A;  2HKO A;  2EFP A;  5LHI A; 
#chains in the Genus database with same CATH topology
 4HNU A;  1MJB A;  3S8P A;  4I99 C;  3JSO A;  2DJN A;  2NYX A;  2E2J J;  2L9R A;  3BPV A;  4QSH A;  2YPR A;  1Y0U A;  3C1D A;  2P5L C;  1OQY A;  2LVS A;  5GPC A;  4CCL A;  5HS9 A;  2ELH A;  4BS9 A;  3CCQ I;  1GXP A;  2FQ4 A;  4RGS A;  3H5N A;  4CZC A;  2B0L A;  2W57 A;  4HST A;  4CCO A;  5E17 F;  3ELK A;  3H0D A;  1JJ8 C;  1A31 A;  2J5O A;  3CCY A;  1K6Y A;  4DGW B;  1T0F A;  3CF5 F;  1BI0 A;  3ZQG A;  3HTS B;  3KP2 A;  1DPR A;  3CP8 A;  4P5O A;  4XID A;  2DMT A;  3IRR A;  1QZY A;  1LPQ A;  2HZD A;  3E6D A;  3OYM A;  1VQ4 I;  5IOY A;  4UB8 C;  2HVS A;  2JTV A;  1NG7 A;  1OMI A;  4CZZ A;  1FJL A;  4G8X A;  4WXC A;  4B4C A;  5AON A;  3K10 A;  4M3E A;  3BZC A;  4HQM A;  4B44 A;  3AG4 H;  1XTA A;  3PSI A;  4BBR J;  4E6K G;  2XDV A;  4AIK A;  2VIX A;  1FOX A;  1SD7 A;  4JK1 X;  3C2B A;  3OSF A;  3DLL F;  1JXS A;  3AAF A;  2A3S A;  1SAN A;  4Y13 A;  4XLN F;  1LVK A;  1R1T A;  3ZQI A;  1JHH A;  2GIZ A;  3BCB A;  4I09 A;  5DUI A;  4ENK A;  3LSK A;  2VKD A;  1PVE A;  4XR6 A;  1YIO A;  4B3X A;  1F43 A;  2WWY A;  3DPT A;  3HG9 A;  4ZJZ A;  3L00 A;  3S16 J;  2QLZ A;  2BOL A;  3IAM 2;  1A35 A;  4HRI A;  4G9Y A;  3E1S A;  3KP7 A;  1O3S A;  1VQO I;  2BW3 A;  2V1D A;  3CCR I;  5AIP A;  2R7D A;  5CKT A;  4CUG A;  4HAM A;  4U7D A;  2BVL A;  1PJR A;  3M7G A;  4LG3 A;  5D6F A;  1HXD A;  1RKT A;  2ZNY A;  3JRH A;  3OWT A;  3CCU I;  5IYB J;  3FXU A;  1XC5 A;  4FCY A;  1BW5 A;  3SFI A;  2L2O A;  4B47 A;  4KNY A;  4V2G A;  1UCR A;  4CYC B;  2CQQ A;  2GXG A;  4DNC A;  4OMZ A;  3QP6 A;  1BR2 A;  3A4C A;  1OCP A;  4XIC A;  1WJE A;  2M4G A;  4TV7 A;  3BR0 A;  2H1K A;  2M1B A;  2H1L A;  4LG0 A;  4HA8 A;  2R7F A;  2Y69 H;  2HQA A;  4UUT A;  2V7F A;  3MKL A;  1IXC A;  5GPA A;  3FIS A;  4CIC A;  5JLW A;  3ABK H;  1XX5 A;  2LP0 A;  3GUD A;  5D4S A;  1XGM A;  1ZKG A;  3L7W A;  3W6V A;  2OZU A;  1IRF A;  2DA4 A;  3JRD A;  2EA2 A;  1T38 A;  1XSV A;  4J01 A;  3DEE A;  1A5J A;  1QVU A;  1SFU A;  2H6C A;  5LHG A;  1XS9 A;  1JKR C;  3ZMD A;  3PIP F;  3DBR B;  2NXN B;  2STW A;  3AG1 H;  1O3R A;  1U8B A;  1IV8 A;  3WG7 H;  1CGP A;  3DKY A;  1T98 A;  3J80 Z;  3K7A J;  1X1P A;  2D45 A;  1R71 A;  1XMK A;  2DI3 A;  5H6R A;  2IT0 A;  3G1O A;  4UVB A;  1VQM I;  1FYK A;  1MMD A;  2WTE A;  4R1H A;  4MLO A;  3OOP A;  1LUJ B;  4M73 A;  4AIH A;  4Q5S F;  2IGK A;  2DQR A;  3CLO A;  3RQ4 A;  1PUE E;  5M3M J;  2GAU A;  2Y30 A;  3JR9 A;  2OJE D;  3ASN H;  4WX9 A;  1RES A;  1UFM A;  1X3W B;  3I4N J;  4II3 A;  3GWZ A;  1D1C A;  1OYY A;  4XKB A;  4CO8 A;  5J3L A;  1QNT A;  2Z2S B;  4I01 A;  5IP7 J;  3KP3 A;  1FT9 A;  2IGO A;  1XGS A;  4MNU A;  1O3Q A;  1MSF C;  2CYY A;  1Y0N A;  2VQH A;  5HDN A;  2ZME B;  4I0B A;  2H27 A;  1TWG J;  2QEX I;  4N0B A;  4XLE A;  2JPB A;  4MTD A;  3WTT C;  1QQI A;  3SEQ A;  5K5R A;  2XRL A;  2P6T A;  2ZXJ A;  1IDZ A;  2OCC H;  1MDM A;  2CFO A;  3K4N A;  1G59 A;  2CV2 A;  2HDC A;  5HLH A;  1UHM A;  3ZMV A;  2VKH A;  3BT9 A;  4AVZ A;  4X1E A;  1VQP I;  4BNC A;  1XN7 A;  3OS1 A;  2LNB A;  4F91 B;  2VE9 A;  4MFD A;  5DUK A;  2ZB9 A;  5E8G A;  3KP5 A;  4IHW A;  3R0J A;  1E2X A;  2VLA A;  4AVP A;  1OCZ H;  4IX7 A;  3BR5 A;  1KQ8 A;  4HSR A;  1ETY A;  1Z7L A;  1F9N A;  3RZO J;  3U2R A;  3WTX C;  2RKH A;  2CO5 A;  4YRV A;  4L9N A;  3WOD F;  1U2W A;  2FU4 A;  1XCV A;  1HST A;  5M5X J;  3DBH B;  1B6A A;  2K02 A;  3T0Y A;  2R7O A;  3TKY A;  2EJR A;  1V4R A;  2E1N A;  2ID6 A;  4O6J A;  3PSF A;  2VBY A;  5KCM A;  2KRH A;  2DMP A;  2DN0 A;  4KIG A;  4BQA A;  2UUZ A;  1XSX A;  3VDX A;  1D5Y A;  1SEU A;  3CC2 I;  5J47 A;  1WI3 A;  2RAE A;  4ESJ A;  2CWE A;  4BY7 J;  2ZJQ F;  3TQN A;  3QQA A;  4I7H A;  3AL0 B;  1K79 A;  2RGV A;  4A3L J;  4AID A;  2ESH A;  2KPM A;  5J1R A;  1W5C C;  4PJ0 C;  1A6Q A;  2IA0 A;  1B72 A;  1ZTR A;  2E1M B;  2WY7 Q;  5LRR A;  3A02 A;  5DCM A;  2HXO A;  4Q47 A;  2L54 A;  2BY3 A;  1GVJ A;  3FHN A;  1IO2 A;  3CJN A;  1ZLK A;  2HOE A;  4C2T A;  2ETH A;  2TDX A;  5E1X A;  1YO5 C;  1YX3 A;  3W3C A;  2K3F A;  3AL0 C;  3KLN A;  3ZQC A;  1CF7 A;  4WXH A;  2ZCW A;  1YX5 A;  2A61 A;  2HQ5 A;  4A3M J;  2W85 A;  1T0F C;  2JA8 J;  5F6F A;  2R92 J;  3ABM H;  4BJ5 C;  4M9Z A;  1Z3Y A;  3IWZ A;  1I3Q J;  5IP6 A;  1YJ9 I;  5IT9 K;  4BE2 A;  2ZFW A;  5EZG A;  3BZ6 A;  3MEX A;  1P4W A;  3H3V K;  1XG1 A;  3ZOB A;  3DU6 A;  5ICC A;  5K1Y A;  4M6Y A;  1TC3 C;  2V4J C;  4KIS A;  5ICE A;  4PSX A;  2HKX A;  2X4H A;  4RM3 A;  2JA5 J;  4XOP A;  1I3A A;  5HLT A;  2W4S A;  5D4R A;  1MMA A;  5DDG A;  2XB5 A;  4Y3O A;  1IZ1 A;  2ZKZ A;  2ZO4 A;  3HHH A;  2RDP A;  2HYG D;  1YJN I;  3NEU A;  2QSH X;  2VPR A;  2IS1 A;  1B4A A;  1POG A;  3HGY A;  1S8N A;  3LQR A;  3SZT A;  2EIL H;  1OLT A;  2M0M A;  1K78 A;  4BUP A;  4KYW A;  5B5E C;  3I71 A;  1H88 C;  1SFX A;  2GA2 A;  4L5J A;  4AIJ A;  5TIS C;  3RYP A;  5BS6 A;  1LFP A;  2A6H F;  2DK5 A;  3DV8 A;  3Q0U A;  4FHT A;  3NQO A;  5DCM B;  3RI4 A;  1LB2 A;  4IHT A;  2DT5 A;  2OBP A;  1D8J A;  1PP7 U;  2HVQ A;  3HIF A;  3ESW B;  4L5I A;  2R93 J;  1MBF A;  4MGR A;  5CLS A;  2ZSI B;  2DT7 B;  1W0T A;  2X6Y A;  2O8K A;  3HOZ J;  5KK1 A;  4IL6 C;  4I76 A;  2LSO A;  4IRG A;  2JRT A;  3HRT A;  3Q0W A;  4PGG A;  2RVC A;  4E7J A;  2OQR A;  4HG2 A;  2JUC A;  4M3F A;  2EFN A;  2KIU A;  2Y0S A;  1HKT A;  1Y56 A;  5HNF A;  2LY9 A;  2IGM A;  3DFG A;  2P0W A;  5F04 A;  3S15 J;  4RBO A;  2XAJ A;  3DEW A;  5B1B H;  1PYV A;  2V9V A;  1KQ9 A;  1IN4 A;  1GLN A;  1IN6 A;  3QOD A;  1YS7 A;  3OYD A;  2VI6 A;  5L3G A;  1JKP C;  4IPA A;  4P55 A;  2KIS A;  1ETQ A;  3S3M A;  3MMY B;  2VB6 A;  3LFK A;  3HRS A;  1OCC H;  3DPL C;  4AC0 A;  2XGD A;  3K4J A;  5IP9 J;  2CW8 A;  4EAT A;  2E71 A;  4XSZ F;  1BOA A;  3JRA A;  1Z6R A;  4OWR B;  2PI0 A;  4RLQ A;  2HYF A;  3WTS C;  1BR1 A;  2EZH A;  4IQJ A;  3TL4 X;  4U87 A;  3HBL A;  3RJP A;  1M1E B;  2V1N A;  4DBQ A;  3DF8 A;  4XSX F;  1Z9C A;  3K70 C;  1MDM B;  1QHG A;  3F3X A;  4HX4 A;  3OYB A;  3KFW X;  3VYR B;  2TCT A;  2AHQ A;  3J81 K;  4X0G A;  3JRF A;  4DJA A;  3ZP5 A;  2P5V A;  2QEN A;  3SEZ A;  2H94 A;  1HDP A;  4GXO A;  3HL2 A;  1WJB A;  1AU7 A;  3H9Q A;  1DP7 P;  2K9M A;  1B8I A;  2PEX A;  2R7X A;  5LBQ A;  5JFR A;  3L2W A;  4JBA A;  4ZDO A;  1RC9 A;  2PFB A;  3MVP A;  1MBH A;  1S7E A;  2E36 A;  1FIA A;  2OQG A;  3IH3 A;  4KN4 X;  5FLX K;  1YQA A;  2QCO A;  4FET A;  3K9T A;  1LE8 B;  4D9J A;  3FXK A;  2VAS A;  2LOO A;  1ON1 A;  1E17 A;  1U8R A;  2K4B A;  1RR7 A;  2IA1 A;  2FNA A;  1N78 A;  2HEO A;  3DPU A;  4FX0 A;  3BR2 A;  2FOK A;  4ZYD A;  3WGG A;  4E7S A;  3C18 A;  3K4K A;  4NNJ A;  4OOI A;  2F5C A;  5F1J A;  3OYE A;  4N9I A;  3S93 A;  4M6V A;  2ME0 A;  3VOE A;  4U88 A;  1UMQ A;  1YIT I;  2JT1 A;  2KRC A;  3DCF A;  2A07 F;  2XGE A;  4XRM A;  4EM1 A;  2AQE A;  1BC7 C;  1QGP A;  1MH3 A;  1J9I A;  1FBQ A;  2FOW A;  2GM4 A;  3BPX A;  3QOE A;  3BG7 A;  3OV8 A;  1ZG1 A;  4ZDL A;  3E97 A;  4M9X A;  4AD9 A;  5A2Q K;  1WZ2 A;  3BDD A;  3LOC A;  2XSD C;  2IXS A;  5M5W J;  1EJ9 A;  2ZFU A;  3IKV A;  3GCM A;  2PMZ N;  2W00 A;  2DA7 A;  2A6E F;  2W82 A;  2DT6 A;  3EDP A;  3KEQ A;  3QPT A;  2QA4 I;  2W25 A;  2XRO A;  1KQ0 A;  3QU3 A;  3V42 A;  5LEK A;  2L3D A;  5F27 A;  5ILU A;  2FEZ A;  2R7Q A;  2ECB A;  1S3J A;  2M8G X;  3QPL A;  4WXD A;  3MCZ A;  5L3F A;  3KP6 A;  2V6C A;  2CS3 A;  3M8E A;  1VQ7 I;  3S32 A;  4ASN A;  2G7H A;  2IP2 A;  1IUY A;  1WGX A;  1T56 A;  4A3I J;  1H8A C;  4A69 C;  2CRG A;  3SQN A;  1LEB A;  3LNQ A;  5EG0 A;  3C7J A;  4RLF A;  2HPM A;  3VOD A;  2Q2E B;  2MD5 A;  4JYK A;  4LGW A;  4A2U A;  5LGU A;  2LK2 A;  4BL0 B;  4C2U A;  3K4M A;  4LG0 B;  1Q1H A;  1Z6T A;  2MW8 A;  3V7C A;  2O0Y A;  5GTI C;  2F4O B;  2VE8 A;  4G6Q A;  3CCE I;  3OIP A;  4HNV A;  1X1D A;  1X1A A;  3ASO H;  2E1C A;  2XKP A;  2DPD A;  1ZN2 A;  1FY7 A;  3MAJ A;  5EGO A;  2MLK A;  5C3E J;  1HC8 A;  3KIO A;  1RET A;  5LEJ A;  5BQT A;  2IJL A;  2HGC A;  1I6H J;  2XVC A;  3V8J A;  1O7L A;  1X19 A;  5IYC J;  4A3B J;  1IRX A;  4UB6 C;  2L01 A;  4S05 A;  3WU0 A;  2E1M C;  2KJC A;  3GVA A;  4GYI A;  4F55 A;  3S2D J;  3PQJ A;  1B9N A;  2ACJ A;  4DYQ A;  3JRE A;  1HBX G;  3J80 K;  3PO2 J;  2NVT J;  4KT6 A;  3CCL I;  2BW3 B;  2KFD A;  3FXM A;  1K7A A;  2CU7 A;  3J7Y J;  1FNN A;  3OYL A;  1QPI A;  2BXZ A;  4BXU A;  2EA4 A;  4Q4Z F;  2DW4 A;  3I4P A;  5HOD A;  1GHC A;  1JKO C;  4KA4 A;  2XAH A;  1CF7 B;  4KIF A;  4PFO A;  2EV5 A;  2Y75 A;  3QRF F;  2YS9 A;  3AG3 H;  2L9V A;  3R4K A;  4P9F A;  3GTM J;  2JA2 A;  5H6Q A;  9ANT A;  1W5S A;  2L9N A;  2NVQ J;  4KMF A;  1IV6 A;  1MZB A;  4A0Z A;  4EJV A;  1TW2 A;  2WAD A;  2OD5 A;  1QZZ A;  2G9W A;  2PMZ A;  3HPG A;  5E20 A;  2OC6 A;  3CCV I;  3ISP A;  4J00 A;  2VJ4 A;  4D1Q A;  5BPI A;  1G3T A;  3FMS A;  3KEY A;  3BQZ A;  1K61 A;  2Z99 A;  2NS7 A;  1I1G A;  2FQ3 A;  2GOM A;  4Y17 A;  4G7H F;  3ROU A;  1WPK A;  3GFI A;  2HS5 A;  2HFH A;  5J1Y A;  1X4P A;  2VOP A;  3COA C;  4FE4 A;  4U0Y A;  4BGD A;  1R49 A;  3OL3 A;  2DBB A;  4PGH A;  3A03 A;  2EQR A;  5GAG J;  4GYG A;  1VQ5 I;  1TQI A;  5E1W A;  1F5T A;  4A0Y A;  1KYZ A;  1TT0 A;  1MD0 A;  3ZQF A;  4A5M A;  2WAQ N;  2JVG A;  1LQ1 A;  5HLI A;  3K2A A;  4PCQ A;  1HQC A;  1JI8 A;  3OYG A;  2BVM A;  1VQ9 I;  2W48 A;  4FAS D;  2BV6 A;  5C4J J;  1Z0X A;  3U1K A;  3D1N I;  1UST A;  2O6G E;  1W4M A;  4EGY A;  3D5L A;  2R4G A;  3RKX A;  4D0P A;  1ZR4 A;  1DGW Y;  1ON2 A;  1T2K A;  4HEA 2;  5HS7 A;  2K40 A;  3G1L A;  3CTA A;  1G6N A;  3ZMZ A;  1WH5 A;  5HLG A;  5E3O A;  1ZHF A;  1U9N A;  2YSR A;  4PJM A;  1U78 A;  1GV5 A;  3ZXS A;  4NDL A;  3DEU A;  4OU0 A;  5ILV A;  3A01 A;  3S1N J;  5KHD A;  4CDG A;  4ETS A;  1Z7U A;  4AM3 A;  2NVY J;  5L3C A;  2KMU A;  2X1C A;  4V2F A;  3S3O A;  3WE2 A;  4QWQ A;  4N4N B;  1X4O A;  5EEH A;  5FKM A;  1A04 A;  2HI3 A;  3CUQ A;  4ESB A;  2R5Z B;  2HR3 A;  3HDD A;  2HQN A;  3JRC A;  2WV1 A;  2PMH A;  2B9S A;  5D5V B;  1YW7 A;  1DDN A;  1HDD C;  3GW2 A;  5IT3 A;  2P8T A;  2LKS A;  3HRU A;  2ZME C;  4HPQ A;  2XAG A;  3WTY C;  4OMY A;  3HOS A;  4Y33 A;  4C30 A;  1V3F A;  3F8N A;  2CQK A;  2K9N A;  3C2G A;  1XMA A;  4XRF A;  2HTS A;  2O5R A;  1EH7 A;  3GFJ A;  3O8G A;  5FKO A;  1KA8 A;  3D5R C;  5FD5 A;  3W2W A;  1S72 I;  1P6R A;  3GTP J;  2A6T A;  2BY2 A;  4OIN F;  2DJI A;  2LF8 A;  1RNL A;  5DCF A;  2X6O A;  4U7B A;  1MMN A;  3DXJ F;  4IHV A;  2DK8 A;  3ABT A;  1YI2 I;  1FWZ A;  1WFX A;  2Y48 A;  3ZCO A;  2I5U A;  1G3Y A;  2WB1 A;  4JX6 A;  3BR3 A;  3E6B A;  1PUF A;  4E7I A;  1HKS A;  2VN2 A;  1P4A A;  4B43 A;  4YEJ A;  4MEY F;  4KIB A;  2EV0 A;  1LDJ A;  5J6X A;  4EJW A;  2XPW A;  4EJT A;  4W97 A;  2WBM A;  2VT3 A;  1YIJ I;  4HW0 A;  2DYR H;  4BQQ A;  1IJW C;  1T33 A;  1IN5 A;  3JRB A;  1TP4 A;  2JSC A;  3BR1 A;  4W1U A;  3E3V A;  3TOB A;  4P1W A;  2W1O A;  1DUX C;  3OYI A;  5KVR A;  3PM1 A;  4E7K A;  1Z67 A;  1K78 B;  1SD6 A;  1D5V A;  2F5D A;  3MZ8 A;  4ITV A;  2CGP A;  4L0Y B;  1JUS A;  2VQC A;  2P81 A;  3CZ6 A;  4F3Q A;  1KU2 A;  3PIO F;  3MD2 A;  4UUV A;  1YRN B;  1BBY A;  4BE1 A;  2V9P A;  2QSG X;  2OF7 A;  2TRT A;  3B02 A;  3H3U A;  4LOC A;  2M9H A;  3CF2 A;  1FSH A;  2LBF A;  1I50 J;  1K4T A;  3GTG J;  3IRQ A;  2K9Q A;  1XB4 A;  3WU1 B;  2J5P A;  1IN7 A;  1MBK A;  2EB7 A;  2EZI A;  2LG4 A;  1U9O A;  1C0W A;  2QZ8 A;  1Y8Q B;  1DPU A;  1PP8 F;  2K85 A;  4H4K C;  4HYE A;  2V9K A;  3OYH A;  5FD6 A;  1Z91 A;  2JRM A;  1R5I D;  5F0F A;  6PAX A;  2V1X A;  5FO5 A;  2FBI A;  3PQK A;  3GLL A;  2BEO A;  1FMW A;  2R7Z J;  1TNS A;  1BJA A;  4CHU A;  2XB0 X;  4RS8 A;  3KEO A;  2CV0 A;  1SVM A;  4A12 A;  2KRF A;  5E18 F;  1TZL A;  2HWV A;  3IH4 A;  1MH4 A;  1QVT A;  2VUM J;  4N4O B;  3SFZ A;  4XRS A;  3EYI A;  2LYC A;  1AKH B;  3Q9V A;  4EGZ A;  1J09 A;  3WTZ A;  4D5F A;  3GTL J;  3I55 I;  4IOA F;  2A05 A;  3H5A A;  5ICF A;  3ECH A;  3P5J A;  2DA1 A;  4E4H A;  4UVC A;  1OCR H;  5JVT A;  3CUO A;  1DGR M;  2XIG A;  3F8B A;  3CDL A;  1EF4 A;  3OY9 A;  2QBY A;  4HF2 A;  1YW8 A;  1KON A;  3WGI A;  2A69 F;  1WH7 A;  1KU3 A;  1F36 A;  3H3Z A;  1RIO H;  3M3Y J;  2L5Q A;  1S7O A;  3ULQ B;  2ECC A;  4BKX A;  4L5E A;  3SHF A;  1T8I A;  1FEX A;  3QYF A;  4EV0 A;  2LRE A;  1TTY A;  5E3N A;  3QOP A;  3WTV C;  4B3A A;  1HF0 A;  2CQN A;  2UXX A;  2P7V B;  3EUH A;  3FWE A;  5LLQ A;  3H1C A;  4DOZ A;  3HPH A;  2MGQ A;  1LNW A;  4LMY A;  1O3T A;  4BDY A;  1WRJ A;  2EFQ A;  1P92 A;  3P9C A;  3N4M A;  5H2F C;  4NUB A;  2COM A;  2I10 A;  3E6M A;  1BI1 A;  4LIU A;  1X2M A;  1F4K A;  4A6E A;  3BQY A;  3BY6 A;  2JA6 J;  3ERM A;  2H8W A;  2FUG 2;  2UV1 A;  3CMA I;  1EV7 A;  4UNO A;  1XD7 A;  2VXZ A;  3HJE A;  3O2P E;  2EH3 A;  2HOS A;  4LK0 F;  1R5G A;  1Y1V J;  1ZG3 A;  4MHG A;  1BI2 A;  3X2Q H;  2ME6 A;  3L2V A;  2VKV A;  2IBD A;  4PJJ A;  3J7A O;  2X48 A;  2KKO A;  4KT5 C;  1P7I A;  3IWF A;  4RDU A;  1V55 H;  2MAB A;  3BC8 A;  2CMP A;  4Y7N J;  3IH2 A;  2XAS A;  4AU7 A;  2Q2E A;  1H0M A;  2JN6 A;  4XN0 A;  5HDG A;  4BYY A;  2CQ7 A;  3LMM A;  2HOA A;  4ZDP A;  4KFC A;  3HOV J;  3TBI A;  2KHM A;  4AUX A;  2E34 A;  4NB5 A;  2XHK A;  1K6O A;  3VYU B;  4IOC F;  3G3Z A;  2JWT A;  2L7M P;  1G3W A;  4LLG F;  2KIF A;  3RTR A;  1JUP A;  1D0Z A;  2E5Z A;  1ZRC A;  2CW7 A;  5J4V A;  3LWF A;  1I27 A;  2F6C A;  3GTO J;  4JOM A;  5EEA A;  2E2H J;  3BG5 A;  5EF6 A;  2YX7 A;  1H89 C;  2LTP A;  4DZP A;  2QM3 A;  1FPQ A;  1VQN I;  5IPA A;  5BMZ A;  1ZAO A;  5JHU A;  3IV5 A;  3VEP A;  4Y15 A;  1HOM A;  1VF9 A;  3K6G A;  2EIM H;  2DTR A;  4RGX A;  1Z1D A;  2GQQ A;  5LGT A;  2FA5 A;  4ZZL A;  1XGN A;  3Q0V A;  3BG9 A;  5HVQ C;  1JKQ C;  1YLF A;  2LH9 A;  3JTG A;  4I6Z A;  4CCJ A;  1IRZ A;  5B3S H;  3GF2 A;  3BWG A;  4DQ2 A;  3OYN A;  3E7L A;  3HZJ A;  4IVN A;  2KDZ A;  1IG7 A;  1J7K A;  3WG9 A;  2C6Y A;  2Q8K A;  2IS4 A;  1SAU A;  3W6K B;  2XPU A;  4LFU A;  4ZYE A;  5HS8 A;  3JAM K;  2KIQ A;  3LQQ A;  2E7X A;  1AA7 A;  4CA0 A;  5IOZ A;  3CCJ I;  4MQ9 F;  2EIN H;  1YTY A;  3MZY A;  3F8C A;  3PNV A;  1AWC A;  1LVA A;  2EFO A;  3SXY A;  4AYB A;  1VQ6 I;  3OS0 A;  4OIR F;  2CUE A;  4MIM A;  3BTL A;  2OCE A;  4CCK A;  2JZY A;  4BBS J;  2O7O A;  3A0B C;  1XCB A;  3I4M J;  1Z21 A;  3FM5 A;  2DQL A;  3GTJ J;  1OIS A;  1RKW A;  4XL9 A;  2XF7 A;  1K4S A;  3B6C A;  3CJR B;  3IKT A;  4EJU A;  1N25 A;  1Y8R B;  5FFZ A;  1XGO A;  1MND A;  3OYC A;  1WJC A;  3BP8 A;  1NK3 P;  2DOF A;  1A6I A;  3OIO A;  4BAC A;  1E0E A;  3ZN0 A;  4ZTJ A;  4B8X A;  3A2K A;  3CD6 I;  4RB2 C;  3PNY A;  3FXL A;  4EQQ A;  3EYY A;  3MKY B;  2ZSH B;  1E3P A;  2M7B A;  5CPR B;  4QPQ A;  3KZZ A;  5IT9 Z;  5D5X B;  1OYW A;  2CJJ A;  4RMN A;  4YFN F;  3GTQ J;  2GXB A;  2IVM A;  3G73 A;  3HSR A;  1ZAR A;  3TW7 A;  2HXI A;  1A36 A;  4NC8 A;  5EYR A;  4UV9 A;  4OIP F;  4FQG A;  1HLV A;  4HZF A;  2X1E A;  3G1M A;  3RKY A;  3T1B A;  3WU2 C;  3G71 I;  1YS6 A;  2P4W A;  5FKL A;  3H35 A;  1L0O C;  4OIO F;  3H92 A;  3PUF A;  3KYC B;  2M87 A;  4XLF A;  1BW6 A;  1TWF J;  1XDS A;  3BRO A;  3HTU A;  3I59 A;  2R5Y B;  4A6D A;  3E5Q A;  3FMQ A;  3CO6 C;  1WJA A;  3CCM I;  5CVU A;  2A68 F;  3HUG A;  3LSP A;  2WAQ A;  4U0V A;  5CVV A;  4IHX A;  4RGR A;  4LD5 A;  2RQP A;  5ILS A;  4WWC A;  2IS6 A;  3DWL E;  3S1M J;  2Q1Z B;  3ZR8 X;  1J2X A;  4J19 A;  3L2Q A;  2R0Q C;  4IJA A;  3BZK A;  2X51 A;  5TRD A;  2STT A;  3EQL F;  3DTE A;  2WY8 Q;  2W24 A;  4O5V A;  1OR7 A;  4H0E A;  1VZ0 A;  1W7P D;  2ZC2 A;  4CSW A;  4R8H A;  2DA3 A;  1R36 A;  3HUG B;  1S6L A;  4LJZ F;  3TGN A;  4HLY A;  1JE8 A;  4DIQ A;  1OJL A;  4GCV A;  4C9Y A;  4G7O F;  1FOW A;  3LSH A;  2XC7 A;  1XPX A;  3HSF A;  2ADU A;  2WAF A;  3WGH A;  4BQO A;  2R5Y A;  1H9G A;  4YII A;  1ETX A;  3UKG A;  1NK2 P;  2L4A A;  4MQV A;  2YUS A;  2UWM A;  4ESF A;  5F08 A;  2UZK A;  2FE3 A;  2JUG A;  3O8H A;  2R7R A;  1X3Z B;  2QSF X;  4JP0 A;  2BGC A;  2M30 A;  1RR8 C;  1B72 B;  2ISY A;  3TO9 A;  2CV1 A;  2IRF G;  4MFE A;  4BJT A;  2Z3Y A;  3REO A;  3M4O J;  1U3E M;  1X58 A;  4HBL A;  3GLX A;  4IO9 F;  4RAY A;  1ERD A;  5ED4 A;  2X85 A;  4P96 A;  1TW3 A;  4UV8 A;  3F6V A;  1VND A;  2DLL A;  4OIQ F;  3VYS B;  4RAZ A;  2BYV E;  1S29 A;  3EUK L;  2L9S A;  4M71 A;  4YIF A;  4S04 A;  4XOR A;  3F22 A;  5KAI C;  2OV7 A;  4JX4 A;  2OPT A;  4GGG A;  1ZYR F;  2NNN A;  1W0U A;  5FFX A;  4ZZD A;  4I2O A;  2KZG A;  3P7N A;  1MGT A;  2IAI A;  3F72 A;  4A5N A;  2LF7 A;  5FRN A;  2X0L A;  2Z16 A;  3K4C A;  5DYM A;  1O4X A;  1FYM A;  1QPM A;  2ZJR F;  1SAX A;  3BG3 A;  2NOG A;  2BXY A;  2CG4 A;  2N8G A;  3QAH A;  4BAY A;  5FLX Z;  3DTK A;  4FT8 A;  4NC6 A;  1Q1V A;  3FXJ A;  2P7C B;  2EWN A;  1IAW A;  5FRO A;  1ZGJ A;  4A3D J;  4DZJ A;  5CVI A;  2IA2 A;  3S3N A;  5ICG A;  3HOU J;  4E7H A;  1EH6 A;  1YFH A;  4ZYH A;  2RQQ A;  5L3D A;  2PQ8 A;  1YE9 A;  3RPU A;  5CVR A;  4Y4R A;  1V5E A;  2ZJ2 A;  3F0C A;  3FXO A;  1AOY A;  3QP5 A;  2RV8 A;  2Y0S N;  2HTJ A;  2OA4 A;  2BHY A;  2L7Z A;  2ZME A;  2NRA C;  2LC2 A;  2QQ9 A;  2HDD A;  4L9T A;  2RC4 A;  2M45 A;  2O61 A;  3W2A A;  1TWC J;  2QKL B;  5F0H A;  2E35 A;  3BR6 A;  1LKX A;  3HYI A;  3TDZ C;  5FB2 A;  2DDB A;  3OSG A;  2R3S A;  5LGN A;  3LAJ A;  1WI9 A;  3S1R J;  4FE7 A;  2GWR A;  1YOV B;  2F48 A;  3CDH A;  4AWX B;  1VQL I;  5DS9 A;  5HOO A;  3QYE A;  3FMR A;  1JGG A;  4KN7 X;  3LA7 A;  4A0X A;  3M8J A;  3MKZ A;  4L18 B;  2EBI A;  3E5X A;  4BXF A;  3LL7 A;  3ZQH A;  3TOA A;  1IW7 F;  1W5T A;  5CQE A;  3KLO A;  2DFI A;  2LRD A;  2DOE A;  4WF2 A;  3CP2 A;  4ZC3 A;  5FRM A;  4QLC U;  2BY1 A;  3HOX J;  2NS8 A;  2CSO A;  2RN7 A;  2LY1 A;  3QU6 A;  3VYT B;  2LY2 A;  3FHZ A;  3P9K A;  5A2Q Z;  1MSE C;  4F93 B;  2XSJ C;  1W36 D;  3HOW J;  1I6X A;  1ETW A;  1S5L C;  2FX0 A;  2MLG A;  3BJO A;  3CMM A;  3GTK J;  3JSP A;  2PJR A;  4GDF A;  3SDG A;  1MJA A;  3B73 A;  5D8K B;  3HOT A;  1KU9 A;  5H20 A;  2XAF A;  4A3C J;  1RI7 A;  1VQK I;  1VI0 A;  2M34 A;  5L3E A;  3IAS 2;  1ZRE A;  2K27 A;  1SD5 A;  1X2N A;  1IUF A;  1X1C A;  4M9S A;  2MC4 A;  4XLP F;  1TLH B;  4BXX J;  1O57 A;  1SFO J;  3VFZ A;  3CLQ A;  4YFX F;  3BJA A;  3CO7 C;  3S2W A;  1RPW A;  4XLC A;  3OYK A;  1ETO A;  3J7A Y;  1Z77 A;  2QQA A;  4UVA A;  2VT2 A;  4E70 A;  1R58 A;  2GBY A;  3IP4 B;  2LR8 A;  4LLN A;  3BJ6 A;  3RCO A;  3CES A;  1SMT A;  5DTD A;  2ISZ A;  2E7W A;  4BDZ A;  3TDU C;  1W36 C;  3KYL A;  2OUM A;  2VL8 A;  1TQP A;  4LIT A;  1IC8 A;  5FGM A;  2X9D A;  1UJ8 A;  1WJF A;  4A3G J;  2XGC A;  1U5T B;  4G12 A;  1HW2 A;  4CYC A;  3GYH X;  3DQV C;  4HV6 A;  2B7E A;  2WAE A;  3CC7 I;  3M07 A;  4KMU X;  1X3U A;  3F8F A;  3CC4 I;  3HSE A;  1MBJ A;  4IZZ A;  2XAU A;  1R4M B;  3FXQ A;  1U5T A;  2AQF A;  2H8R A;  1GXQ A;  2GA1 A;  2V1U A;  3HGG A;  3FKI J;  3PUB A;  4IHS A;  2LKP A;  4BHC A;  3N97 A;  4ZTF A;  2G7U A;  2GIV A;  2JMW A;  1USS A;  3W2V A;  2V6E A;  4OAY A;  5C44 J;  2FRH A;  5FKN A;  1MMS A;  4M3D A;  1FTT A;  2VBZ A;  3C2H A;  3K4L A;  2Y31 A;  2R7S A;  3ABU A;  5BOX A;  3HKZ N;  3IL2 A;  1AHD P;  2HU9 A;  2I8D A;  1MBG A;  2DOD A;  2DYS H;  1E3O C;  1AKH A;  5GAH J;  2WB1 N;  3NWT A;  3PFY A;  2AXT C;  1BJZ A;  2F5V A;  2ELK A;  4YFK F;  3K70 D;  4A3J J;  1FC3 A;  2M5W A;  1R7J A;  4K2E A;  2L7K A;  2MSY A;  2V26 A;  1QU3 A;  2CUZ A;  5LRS A;  3V4G A;  2VXD A;  2DPU A;  5FLV A;  1D8K A;  3OL4 A;  3EUH C;  2QBY B;  2VBW A;  3IUO A;  1FOY A;  2DOA A;  4DYC A;  5IYD J;  3G4S I;  3PJR A;  5EGO B;  1B1B A;  5M3F J;  1ZQ3 P;  1J5Y A;  4RB0 A;  1U6G A;  4UHT A;  1BOB A;  5LHH A;  3JRG A;  3KZY A;  4IXA A;  5JLX A;  1R1U A;  2PBI A;  1GT0 C;  2HZT A;  2MA3 A;  1Y1W J;  2E5N A;  1LEA A;  1B9M A;  1MNM C;  1SC7 A;  1UZC A;  3RKW A;  5C4X J;  1NTC A;  2P6S A;  1O7F A;  1G8X A;  3ONQ A;  5E3L A;  4IHY A;  1I1S A;  2V79 A;  2R7U A;  2KQR A;  3S1Q J;  3OOU A;  3W6J B;  2Z9O A;  3CUQ B;  2R5Z A;  2XKO A;  5J8C A;  3OYJ A;  2L02 A;  5BPD A;  1YW9 A;  4XLH A;  4QPO A;  2NOJ B;  1JT0 A;  2DA2 A;  1IGN A;  4RGU A;  2R7W A;  1JUM A;  4E7Z A;  3HOY J;  2CUF A;  4MTE A;  2XPV A;  2MH2 A;  2XGX A;  2NAZ A;  1ODD A;  1TBX A;  4RM2 A;  5LFA A;  2HVR A;  4FX4 A;  2ICW G;  3CUQ C;  1JTX A;  4JQF A;  1IN8 A;  3CJT B;  3WE3 A;  3E0J B;  1FZP B;  4IRH A;  2CFX A;  1WHU A;  3KZI C;  3RZD J;  4U0W A;  4ON0 A;  2E19 A;  1VQ8 I;  1BN5 A;  2Z33 A;  1V54 H;  3LSJ A;  4PJL A;  3CME I;  3K1P A;  2D5V A;  5KAF C;  1B8I B;  5EEG A;  2KDO A;  1MJ9 A;  3C3W A;  3T5X A;  3GX4 X;  1HA8 A;  2PMU A;  5J4Y A;  3ZRG A;  4BJ6 C;  2OTL I;  2RNG A;  3PO3 J;  2NNY A;  3U9G A;  1W7P A;  3MZH A;  3I64 A;  5E3M A;  1ETK A;  4HX7 A;  1R00 A;  4MO7 A;  3I9V 2;  4D7N A;  2ZXI A;  2HDW A;  4F52 A;  4EMS A;  3ECO A;  2QQB A;  3FIW A;  4I0A A;  5HNH A;  3GFM A;  1FP2 A;  4EVI A;  1LJ9 A;  4P9U A;  2BHZ A;  2VBX A;  2VQG A;  1BA5 A;  3TED A;  4LIV A;  4BHB A;  2FMY A;  2M3A A;  1Y6I A;  1DU6 A;  3J7Z I;  3K1N A;  3O3K A;  1I39 A;  3KP4 A;  4GFB A;  1VFC A;  2DMQ A;  2DA6 A;  1H9T A;  4XBF A;  2LKX A;  5DD8 A;  3LAP A;  1X1B A;  5D5W B;  4YEL A;  1TNT A;  5K7H A;  2L4M A;  5CVJ A;  1L3L A;  1R6R A;  3Q9S A;  4LK1 F;  5K7F A;  1FSE A;  5F64 A;  4ZYA A;  3HKZ A;  3I3L A;  3ABL H;  3S17 J;  4IEJ A;  1WKM A;  1OCT C;  1TQM A;  2KZV A;  3RSN A;  2LLK A;  4AYB N;  4C3H J;  4I98 B;  1JHF A;  2FXA A;  4KJZ A;  5F1R A;  2DMN A;  4Y52 J;  3L09 A;  3CCS I;  4L0Z B;  1ENH A;  2QQ8 A;  5B1A H;  3I56 I;  3Q5F A;  4G7Z F;  2DDA A;  3B6A A;  2R7V A;  1BIB A;  3DLA A;  3V7S A;  5K5O A;  4JX5 A;  1Y39 A;  2JPC A;  2XF5 A;  2ESN A;  2WV0 A;  1KZH A;  1J75 A;  3S2H J;  4ZYG A;  3F8M A;  2DAO A;  1FIP A;  2BZT A;  1P7J A;  3HM5 A;  4CCN A;  4B09 A;  3V7R A;  3P9I A;  3ZQL A;  2W84 A;  1LFB A;  2EIK H;  3VPR A;  1QHH D;  1WQ2 A;  4ENM A;  3N05 A;  2MFZ A;  3LST A;  3WTU C;  3F9K A;  1IRG A;  4DW6 A;  3NAR A;  4PDK A;  3O6B B;  3GFL A;  5EG0 B;  3HXL A;  3LSI A;  1XDU A;  1ZGA A;  2WA0 A;  2HYJ A;  4PJN A;  1V5G A;  2ZXW H;  2CQX A;  1P2F A;  3SJM A;  1D1B A;  4XRS G;  1XSD A;  2OTJ I;  2Y2Z A;  1LE8 A;  4RAF A;  1S7A A;  3M1E A;  2DFF A;  3K2Z A;  4M6X A;  3D0S A;  2KP6 A;  2ZBK A;  3OYF A;  5JHF A;  4GRI A;  5D8L B;  3BTI A;  2COB A;  5JI6 A;  4BQN A;  2EPF A;  1WVR A;  3QPS A;  2VQL A;  3T8T A;  3HC7 A;  1QA6 A;  3F6O A;  2PG4 A;  4XKC A;  4IQ4 A;  4X6A J;  1HKQ A;  4M3B A;  3K69 A;  1OR7 C;  2JJ7 A;  4ENJ A;  1U5T C;  2NVX J;  2DFH A;  1YRN A;  5GAE J;  1EKE A;  1Z05 A;  3JRI A;  3FK6 A;  2VC1 A;  3I53 A;  4R79 A;  2YU3 A;  4HQE A;  3UNG C;  4Z6Y A;  2D2W A;  1FLI A;  3M9A A;  4E7L A;  5J8F A;  2M7A A;  5ERI A;  2H6B A;  4G6D A;  3FZV A;  3DKX A;  4DYR A;  1FX7 A;  5GAD J;  4KDP A;  4ENN A;  3ZMT A;  2O9L A;  2HNH A;  1XMX A;  3I59 B;  1RRJ A;  4HF1 A;  4NQW A;  2YU9 J;  4XKV A;  3R0A A;  4IKF A;  3MQ0 A;  4XQF A;  3LFU A;  2JK3 A;  3IHU A;  2XUB A;  3JCU C;  2QWW A;  2GLO A;  1I5Z A;  1V5F A;  2L7F P;  4PK4 A;  1SVO A;  4NQW B;  2NS0 A;  1SFE A;  2BY0 A;  3GXO A;  2FBK A;  4CYD A;  1ITY A;  1FMV A;  1NG6 A;  2FD5 A;  1D0X A;  3WTW C;  1ETV A;  2K9L A;  3LA3 A;  2Q0O A;  3BTC A;  4HLX A;  1ZRF A;  1MBE A;  2OZ6 A;  4I02 A;  4L9J A;  3OIQ A;  5E8I A;  3FM3 A;  4II2 A;  4XK4 A;  1LFU P;  1ACI A;  3OYA A;  3DBL B;  4RB3 C;  3OMY A;  5B66 C;  2F5E A;  3A1Y A;  2GZW A;  4BHP A;  3E5U A;  1FOK A;  1GVD A;  4G6T B;  1MIJ A;  2Y0M A;  3MWM A;  5IY5 H;  3OS2 A;  2K7L A;  3TP3 A;  4L9V A;  5EDN A;  3CMY A;  1G4D A;  3EET A;  3FBI B;  3RYR A;  2K9S A;  3PFI A;  3RDI A;  1STZ A;  1U0J A;  2CW0 F;  4CCM A;  3LSR A;  2DU9 A;  2O8X A;  1KU7 A;  4BEH B;  3FF5 A;  1YYV A;  3FDY A;  2UXN A;  4ABZ A;  3ERE D;  3I54 A;  3FK7 A;  3MKW B;  3VWB A;  2JSP A;  2E2I J;  4HDV A;  4FTH A;  1R22 A;  2D1H A;  3UR3 C;  1ORK A;  1WSU A;  3H9J A;  2GXA A;  2BBY A;  2ZNZ A;  4D5C A;  4PFP A;  3TMO A;  3AKZ A;  3I58 A;  3G2B A;  3L2U A;  2VPL A;  3H5R A;  4KIT B;  3HRM A;  3M1C A;  3OR2 C;  3A01 B;  3EUA A;  3CJQ B;  1GDT A;  2PJR B;  2AO9 A;  4XNF A;  1FP1 D;  3I0T A;  4Q48 A;  2E60 A;  3KYD B;  2Z1D A;  5GTH C;  5BNG A;  4G94 A;  1FBS A;  5KNL A;  3BG6 A;  2VC0 A;  3ZQ7 A;  1LDK B;  4HOB A;  3FXR A;  2M8E A;  1JGS A;  1IF1 A;  1ZLJ A;  1HW5 A;  1PDN C;  1YJW I;  2QKM B;  3GBG A;  4QTR A;  2Y9Z A;  1G3S A;  2EK5 A;  2MBF A;  4PZJ A;  4EEF G;  3DU5 A;  3JTH A;  2XAQ A;  4C2M J;  2VON A;  3AFH A;  2VJI A;  3R61 A;  4XM3 A;  1G2H A;  2K86 A;  3LSM A;  1T08 B;  4CH7 A;  4A93 J;  3VSK A;  2OAZ A;  1HW1 A;  1JJ6 C;  2FSW A;  2MC3 A;  1JTY A;  3LSG A;  1OFC X;  4EJO A;  2JQ7 A;  2A5Y B;  3Q3S A;  1UHS A;  3RPU D;  3DP7 A;  2BE5 F;  5CQG A;  5J1U A;  4C3I J;  3ZGK A;  2DA5 A;  2WC2 A;  3QPH A;  2ZJP F;  3FKJ A;  1KYW A;  3F21 A;  4WCG A;  1FBU A;  1N75 A;  1Z3X A;  2LDU A;  3ZQQ A;  4ZH4 F;  2NVU B;  3SZG A;  4HF0 A;  1OKR A;  5CJ9 A;  2M0C A;  5LHI A;  3EPZ A;  1E3H A;  1D0Y A;  1J0R A;  2DCE A;  4ANJ A;  1R4N B;  2PLY A;  5F0C A;  4KUM A;  4BE0 A;  3BCA A;  5J40 A;  5K5Q A;  2OU2 A;  3M8F A;  5TJJ A;  2FF4 A;  5D5U B;  3HHG A;  2KT0 A;  3K1M A;  5TGT A;  1VTN C;  3K4B A;  1W1W E;  2LMD A;  1KGS A;  2F5F A;  2X6X A;  2Z5U A;  3NWS A;  4A3F J;  2IS2 A;  1ONV A;  2RNJ A;  1ZRD A;  4C3J J;  1UHW A;  4B48 A;  2YX4 A;  1TWH J;  2EIJ H;  1ZK8 A;  3FX3 A;  1BC8 C;  1D3Y A;  3NAU A;  2IW5 A;  3GZN B;  4IF4 A;  3NRV A;  2G0E A;  4V19 K;  5DM6 F;  5DV5 A;  2KL4 A;  1P9Q C;  3SZP A;  4LLL A;  4UUS A;  4CGZ A;  3I5U A;  3KPH A;  5HDK A;  4A3E J;  3ZN1 A;  1J59 A;  2EZK A;  4RA2 A;  5FJ8 J;  4PUS A;  4B1R A;  3CQZ J;  1NHA A;  3TO7 A;  1IXS B;  3KET A;  1EH8 A;  2PN6 A;  1JT6 A;  3HB9 A;  5E79 C;  3RPQ A;  2EZL A;  3U21 A;  3ZMU A;  2VOD A;  4NC7 A;  1N77 A;  3KE2 A;  2M4K A;  3E6C C;  3VB2 A;  1QRY A;  4XMY A;  2M2E A;  4PSW A;  1BI3 A;  2CUJ A;  1LDD A;  4XON A;  1B59 A;  1K83 J;  3BTJ A;  3R6S A;  1DQU A;  2EFW A;  3S14 J;  4HV5 A;  1OCO H;  2K3P A;  3OR1 C;  2MD0 A;  2KLO A;  1UG2 A;  2HPI A;  4HDU A;  2GOX B;  1QZE A;  4NHJ A;  4RB1 A;  1R9T J;  1APL C;  4NBQ A;  1ZEL A;  3H9G A;  1SMY F;  1UG0 A;  5AIQ A;  1HCR A;  1IDY A;  1EA3 A;  1S9H A;  4UY8 I;  3ZMS A;  3DKW A;  1GV2 A;  2IGN A;  2Y9Y A;  1R1V A;  2X6W A;  3L2R A;  3KCC A;  4Z2Y A;  2B63 J;  1RUN A;  2XF6 A;  5D6E A;  3CDI A;  3A0H C;  1NH3 A;  4WK8 F;  1DP3 A;  2FBH A;  3VSL A;  1YHQ I;  1QBJ A;  1W7P B;  4HX8 A;  1ZG5 A;  2VJ5 A;  5JVG F;  1D1A A;  3AG2 H;  4FIS A;  4BEH A;  4RAG A;  2KJB A;  1WCM J;  3GME A;  1TWA J;  5DD4 A;  2YR2 A;  4UXN A;  1ULY A;  4YIR X;  4XOT A;  1R23 A;  4N9H A;  4F7Z A;  1MNE A;  1BIA A;  3TO6 A;  2ELJ A;  1SVL A;  3GZ6 A;  2KIM A;  2F4I A;  3FBN B;  5FLM J;  1UB9 A;  2IPQ X;  4S0H B;  2QYO A;  1WJD A;  3PNT A;  3GO5 A;  3TW6 A;  3WHC A;  1CQT A;  4D7M A;  2EV6 A;  4CXF A;  3D5S C;  3MN2 A;  2LBF B;  2D1V A;  2AXL A;  3QYB A;  5CYV A;  2VOO A;  2QVO A;  3U1D A;  1WJ5 A;  2QGU A;  1R5H A;  2LD5 A;  3L2C A;  3H36 A;  2O3F A;  3RKQ A;  3ZPL A;  4QIW N;  1ZH5 A;  5DM7 F;  2VKE A;  1T39 A;  2X1D A;  3MFK A;  2IEK A;  4BH9 A;  1TL8 A;  2CH0 A;  4OAZ A;  3SDB A;  3RQI A;  4LB6 B;  3R60 A;  3V8L A;  1YG2 A;  4M72 A;  1REP C;  1OYI A;  5K7Z A;  2DTZ A;  2QF7 A;  3SYT A;  2W7N A;  3RIR A;  3V8K A;  2QUF A;  1ZGW A;  2L0K A;  4M74 A;  1FTZ A;  1UAA A;  1GUU A;  3IC7 A;  5EJC A;  2PJP A;  1BL0 A;  2MG4 A;  1MW7 A;  1QO0 D;  5JR3 A;  3QWL A;  1F1Z A;  2LFB A;  5EZH A;  3G6E I;  5FKK A;  3BLY A;  1P4X A;  4DBR A;  4MEX F;  4XLA A;  3WHB A;  3L1P A;  1BM9 A;  3H0G J;  1ZR2 A;  2HQR A;  2E1O A;  1PUF B;  2XRN A;  3L9F A;  2MH9 A;  1HSJ A;  2JVH A;  4EM0 B;  3LA2 A;  4YG2 F;  5M5Y J;  1UEL B;  2FJ1 A;  4KIC A;  2FNP A;  1RUO A;  1SD4 A;  4A3K J;  1TT5 B;  1MMG A;  2MYS A;  1IXR C;  4EM2 A;  4BY1 J;  1WWX A;  2DO7 A;  1T95 A;  3GZ5 A;  3HEF A;  2ID3 A;  3K0L A;  3KX2 A;  2A5W A;  1RZ4 A;  1SFK A;  3BOQ A;  5GP9 A;  3J81 Z;  1DU0 A;  3GEZ A;  2FML A;  5L3B A;  4HNT A;  2ZXH A;  3JW4 A;  3PL8 A;  1OPC A;  2K4J A;  1BR4 A;  3JAM Z;  2JA7 J;  1FYL A;  2DFE A;  2RRE A;  3T8R A;  4XN3 A;  2F2E A;  1MKM A;  4BU2 A;  2H09 A;  2HOT A;  2O03 A;  2VJJ A;  4O3M A;  2DXI A;  4GO1 A;  5E1Z B;  2P5K A;  5DEQ A;  2R7T A;  4M3G A;  2AS5 F;  3F23 A;  1T6S A;  4IRI A;  3TP0 A;  2DMU A;  2XV4 S;  3ML6 A;  5LD2 C;  2PX9 A;  4UUS B;  3DTI A;  4LB5 A;  2HKO A;  4XKW A;  2EFP A;  2F4M B;  2K5C A;  4F92 B; 
#chains in the Genus database with same CATH homology
 1MJB A;  3JSO A;  2NYX A;  3BPV A;  2YPR A;  1Y0U A;  3C1D A;  2P5L C;  5HS9 A;  2ELH A;  1GXP A;  4RGS A;  2B0L A;  2W57 A;  5E17 F;  3ELK A;  2J5O A;  1T0F A;  1BI0 A;  3HTS B;  3KP2 A;  1DPR A;  4P5O A;  3IRR A;  1QZY A;  3E6D A;  2JTV A;  1OMI A;  4CZZ A;  4G8X A;  4WXC A;  5AON A;  4HQM A;  4AIK A;  1SD7 A;  4JK1 X;  1JXS A;  3AAF A;  2A3S A;  4Y13 A;  4XLN F;  1R1T A;  1JHH A;  4I09 A;  5DUI A;  4ENK A;  1YIO A;  2WWY A;  3DPT A;  3L00 A;  2QLZ A;  4G9Y A;  3KP7 A;  1O3S A;  2V1D A;  5AIP A;  2R7D A;  4HAM A;  4U7D A;  3M7G A;  5D6F A;  1HXD A;  2ZNY A;  3FXU A;  4KNY A;  1UCR A;  2GXG A;  4DNC A;  4OMZ A;  3QP6 A;  4TV7 A;  2M1B A;  4LG0 A;  4HA8 A;  2R7F A;  1IXC A;  4CIC A;  3GUD A;  5D4S A;  1XGM A;  3L7W A;  2OZU A;  1IRF A;  2EA2 A;  1T38 A;  1XSV A;  1SFU A;  2H6C A;  5LHG A;  3ZMD A;  2STW A;  1O3R A;  1CGP A;  1T98 A;  3J80 Z;  2D45 A;  1XMK A;  2DI3 A;  5H6R A;  2IT0 A;  4UVB A;  1FYK A;  2WTE A;  4R1H A;  3OOP A;  4AIH A;  4M73 A;  4Q5S F;  2DQR A;  3CLO A;  1PUE E;  2GAU A;  4WX9 A;  1UFM A;  3GWZ A;  1OYY A;  4CO8 A;  1QNT A;  4I01 A;  3KP3 A;  1FT9 A;  1XGS A;  4MNU A;  1O3Q A;  2CYY A;  5HDN A;  2ZME B;  4I0B A;  2H27 A;  4N0B A;  2JPB A;  4MTD A;  3WTT C;  1QQI A;  5K5R A;  2P6T A;  2ZXJ A;  1MDM A;  2HDC A;  5HLH A;  1UHM A;  3ZMV A;  4BNC A;  1XN7 A;  2LNB A;  2VE9 A;  5DUK A;  5E8G A;  3KP5 A;  3R0J A;  1E2X A;  4AVP A;  1KQ8 A;  1F9N A;  3WTX C;  3U2R A;  2RKH A;  2CO5 A;  4L9N A;  3WOD F;  1U2W A;  2FU4 A;  1XCV A;  1HST A;  1B6A A;  2K02 A;  3T0Y A;  3TKY A;  2EJR A;  1V4R A;  2E1N A;  4O6J A;  2VBY A;  4BQA A;  4KIG A;  1XSX A;  4ESJ A;  2CWE A;  3TQN A;  4I7H A;  1K79 A;  2RGV A;  2ESH A;  2IA0 A;  5LRR A;  5DCM A;  4Q47 A;  2L54 A;  1GVJ A;  1ZLK A;  3CJN A;  2HOE A;  2ETH A;  2TDX A;  5E1X A;  1YO5 C;  3KLN A;  1CF7 A;  4WXH A;  2ZCW A;  2A61 A;  2W85 A;  5F6F A;  4M9Z A;  3IWZ A;  5IT9 K;  2ZFW A;  3BZ6 A;  3MEX A;  1P4W A;  5ICC A;  5K1Y A;  4M6Y A;  5ICE A;  2HKX A;  2X4H A;  5D4R A;  5DDG A;  1IZ1 A;  2ZKZ A;  2ZO4 A;  3HHH A;  2RDP A;  2HYG D;  3NEU A;  1B4A A;  3LQR A;  1S8N A;  3SZT A;  1K78 A;  4KYW A;  3I71 A;  1SFX A;  2GA2 A;  4L5J A;  4AIJ A;  3RYP A;  5BS6 A;  2DK5 A;  2A6H F;  3DV8 A;  4FHT A;  3NQO A;  5DCM B;  3RI4 A;  1LB2 A;  4IHT A;  2DT5 A;  2OBP A;  1D8J A;  1PP7 U;  3HIF A;  4L5I A;  4MGR A;  5CLS A;  5KK1 A;  2LSO A;  4IRG A;  2JRT A;  3HRT A;  4PGG A;  2RVC A;  2OQR A;  2EFN A;  2KIU A;  1HKT A;  3DFG A;  2XAJ A;  2V9V A;  1KQ9 A;  1IN4 A;  1IN6 A;  1YS7 A;  5L3G A;  4IPA A;  4P55 A;  3LFK A;  3HRS A;  3DPL C;  4XSZ F;  1BOA A;  1Z6R A;  2PI0 A;  2HYF A;  3WTS C;  3RJP A;  3DF8 A;  4XSX F;  1Z9C A;  1MDM B;  3F3X A;  4HX4 A;  3KFW X;  3J81 K;  3ZP5 A;  2P5V A;  2QEN A;  2H94 A;  4GXO A;  1DP7 P;  2PEX A;  5LBQ A;  5JFR A;  4JBA A;  2PFB A;  2OQG A;  4KN4 X;  5FLX K;  1YQA A;  3K9T A;  1ON1 A;  1E17 A;  1U8R A;  2K4B A;  2IA1 A;  2FNA A;  2HEO A;  4FX0 A;  2FOK A;  4ZYD A;  3WGG A;  3C18 A;  4OOI A;  2F5C A;  4N9I A;  3VOE A;  4U88 A;  2JT1 A;  2A07 F;  4EM1 A;  1BC7 C;  1QGP A;  1J9I A;  1FBQ A;  3BPX A;  3OV8 A;  1ZG1 A;  3E97 A;  4M9X A;  4AD9 A;  5A2Q K;  3BDD A;  3IKV A;  2A6E F;  3EDP A;  3KEQ A;  3QPT A;  2W25 A;  2XRO A;  1KQ0 A;  3QU3 A;  5LEK A;  2L3D A;  5ILU A;  2FEZ A;  1S3J A;  4WXD A;  3MCZ A;  5L3F A;  3KP6 A;  2V6C A;  3M8E A;  4ASN A;  2G7H A;  2IP2 A;  1IUY A;  3SQN A;  1LEB A;  3C7J A;  3VOD A;  2MD5 A;  4LGW A;  4A2U A;  5LGU A;  4LG0 B;  1Q1H A;  1Z6T A;  3V7C A;  2O0Y A;  2VE8 A;  4G6Q A;  2E1C A;  2XKP A;  2DPD A;  1ZN2 A;  1FY7 A;  3MAJ A;  2MLK A;  5LEJ A;  5BQT A;  2IJL A;  2HGC A;  2XVC A;  3V8J A;  1O7L A;  2L01 A;  4S05 A;  3WU0 A;  2KJC A;  3GVA A;  4GYI A;  3PQJ A;  1B9N A;  2ACJ A;  1HBX G;  3J80 K;  1K7A A;  1FNN A;  4BXU A;  2EA4 A;  4Q4Z F;  2DW4 A;  3I4P A;  1GHC A;  4KA4 A;  2XAH A;  1CF7 B;  4KIF A;  2EV5 A;  2Y75 A;  3QRF F;  3R4K A;  4P9F A;  5H6Q A;  1W5S A;  4KMF A;  1MZB A;  4A0Z A;  4EJV A;  1TW2 A;  2OD5 A;  1QZZ A;  2G9W A;  5E20 A;  3ISP A;  5BPI A;  1G3T A;  3FMS A;  2Z99 A;  1I1G A;  2FQ3 A;  4Y17 A;  4G7H F;  3ROU A;  3GFI A;  2HS5 A;  2HFH A;  2VOP A;  3COA C;  4U0Y A;  2DBB A;  4PGH A;  4GYG A;  1TQI A;  5E1W A;  1F5T A;  4A0Y A;  1KYZ A;  1MD0 A;  4A5M A;  1LQ1 A;  5HLI A;  4PCQ A;  1HQC A;  2BV6 A;  1UST A;  2O6G E;  1W4M A;  4EGY A;  3D5L A;  3RKX A;  4D0P A;  1ON2 A;  1T2K A;  5HS7 A;  3CTA A;  1G6N A;  3ZMZ A;  5HLG A;  1ZHF A;  2YSR A;  1U78 A;  3DEU A;  4OU0 A;  5ILV A;  4CDG A;  4ETS A;  1Z7U A;  5L3C A;  3WE2 A;  4QWQ A;  5EEH A;  1A04 A;  3CUQ A;  4ESB A;  2HR3 A;  2HQN A;  2PMH A;  5D5V B;  1YW7 A;  1DDN A;  3GW2 A;  5IT3 A;  2P8T A;  3HRU A;  2XAG A;  3WTY C;  4OMY A;  3HOS A;  1V3F A;  3F8N A;  2CQK A;  1XMA A;  4XRF A;  2HTS A;  1EH7 A;  3GFJ A;  1KA8 A;  5FD5 A;  1P6R A;  4OIN F;  2LF8 A;  1RNL A;  5DCF A;  4U7B A;  3DXJ F;  2DK8 A;  3ABT A;  1FWZ A;  2Y48 A;  1G3Y A;  3E6B A;  1HKS A;  2VN2 A;  1P4A A;  4MEY F;  4KIB A;  2EV0 A;  1LDJ A;  5J6X A;  4EJW A;  4EJT A;  2VT3 A;  4HW0 A;  1IN5 A;  2JSC A;  3TOB A;  3E3V A;  1DUX C;  5KVR A;  1K78 B;  1SD6 A;  1D5V A;  2F5D A;  2CGP A;  4L0Y B;  1KU2 A;  4UUV A;  1BBY A;  3B02 A;  3H3U A;  1FSH A;  3IRQ A;  1XB4 A;  3WU1 B;  2EB7 A;  1IN7 A;  2J5P A;  1C0W A;  1DPU A;  2QZ8 A;  1PP8 F;  4HYE A;  5FD6 A;  1Z91 A;  6PAX A;  2V1X A;  5FO5 A;  2FBI A;  3PQK A;  2BEO A;  1TNS A;  1BJA A;  4CHU A;  4RS8 A;  3KEO A;  4A12 A;  2KRF A;  5E18 F;  2HWV A;  3SFZ A;  3EYI A;  3Q9V A;  4EGZ A;  3WTZ A;  5ICF A;  3ECH A;  4UVC A;  5JVT A;  3CUO A;  2XIG A;  3F8B A;  2QBY A;  4HF2 A;  1YW8 A;  3WGI A;  2A69 F;  1KU3 A;  3H3Z A;  1RIO H;  1S7O A;  3ULQ B;  3SHF A;  4EV0 A;  1TTY A;  3WTV C;  3QOP A;  2UXX A;  2P7V B;  3EUH A;  3FWE A;  5LLQ A;  1LNW A;  4LMY A;  1O3T A;  2EFQ A;  1WRJ A;  1P92 A;  3P9C A;  3N4M A;  2COM A;  3E6M A;  1BI1 A;  1F4K A;  4A6E A;  3BY6 A;  1EV7 A;  4UNO A;  1XD7 A;  2VXZ A;  3O2P E;  4LK0 F;  1R5G A;  1ZG3 A;  4MHG A;  1BI2 A;  3J7A O;  2KKO A;  4KT5 C;  3IWF A;  2XAS A;  2Q2E A;  1H0M A;  5HDG A;  4BYY A;  4KFC A;  4NB5 A;  2XHK A;  1K6O A;  3G3Z A;  1G3W A;  4LLG F;  2KIF A;  3RTR A;  1ZRC A;  3LWF A;  1I27 A;  2YX7 A;  2QM3 A;  1FPQ A;  5BMZ A;  1ZAO A;  5JHU A;  3VEP A;  4Y15 A;  2DTR A;  4RGX A;  1Z1D A;  2GQQ A;  5LGT A;  2FA5 A;  4ZZL A;  1XGN A;  5HVQ C;  1YLF A;  3JTG A;  3GF2 A;  3BWG A;  4DQ2 A;  4IVN A;  1J7K A;  3WG9 A;  2C6Y A;  2Q8K A;  3W6K B;  4LFU A;  4ZYE A;  5HS8 A;  3JAM K;  3LQQ A;  2E7X A;  4MQ9 F;  1YTY A;  3MZY A;  3F8C A;  1AWC A;  1LVA A;  2EFO A;  3SXY A;  4OIR F;  2JZY A;  1XCB A;  3FM5 A;  2DQL A;  3IKT A;  4EJU A;  5FFZ A;  1XGO A;  3BP8 A;  3ZN0 A;  4B8X A;  4RB2 C;  4EQQ A;  3EYY A;  3KZZ A;  5IT9 Z;  5D5X B;  1OYW A;  4YFN F;  2GXB A;  2IVM A;  3G73 A;  3HSR A;  1ZAR A;  4UV9 A;  4OIP F;  4HZF A;  3RKY A;  3T1B A;  1YS6 A;  2P4W A;  1L0O C;  4OIO F;  3H92 A;  2M87 A;  1XDS A;  3I59 A;  3BRO A;  3HTU A;  4A6D A;  3E5Q A;  3FMQ A;  3CO6 C;  5CVU A;  2A68 F;  3HUG A;  4U0V A;  5CVV A;  4RGR A;  4LD5 A;  2RQP A;  5ILS A;  4WWC A;  1J2X A;  4IJA A;  5TRD A;  2STT A;  3EQL F;  2W24 A;  4O5V A;  1OR7 A;  4H0E A;  1W7P D;  4R8H A;  1R36 A;  1S6L A;  4LJZ F;  3TGN A;  4HLY A;  1JE8 A;  4GCV A;  4G7O F;  3HSF A;  2ADU A;  3WGH A;  1H9G A;  4YII A;  2L4A A;  4MQV A;  2UWM A;  4ESF A;  2UZK A;  2FE3 A;  2BGC A;  2M30 A;  2ISY A;  3TO9 A;  2IRF G;  2Z3Y A;  3REO A;  1U3E M;  4HBL A;  3GLX A;  4RAY A;  5ED4 A;  4P96 A;  1TW3 A;  4UV8 A;  3F6V A;  2DLL A;  4OIQ F;  4RAZ A;  2BYV E;  1S29 A;  4M71 A;  4YIF A;  4S04 A;  3F22 A;  4GGG A;  1ZYR F;  2NNN A;  5FFX A;  4ZZD A;  4I2O A;  3P7N A;  1MGT A;  3F72 A;  4A5N A;  2LF7 A;  2X0L A;  5DYM A;  1FYM A;  1QPM A;  1SAX A;  3QAH A;  2CG4 A;  4BAY A;  5FLX Z;  4FT8 A;  2P7C B;  2EWN A;  1IAW A;  1ZGJ A;  5CVI A;  2IA2 A;  5ICG A;  1EH6 A;  1YFH A;  4ZYH A;  5L3D A;  2PQ8 A;  3RPU A;  5CVR A;  2ZJ2 A;  1AOY A;  3QP5 A;  2RV8 A;  2HTJ A;  2OA4 A;  2ZME A;  2NRA C;  2QQ9 A;  4L9T A;  2RC4 A;  2M45 A;  2O61 A;  3HYI A;  3TDZ C;  5FB2 A;  2R3S A;  5LGN A;  3LAJ A;  1WI9 A;  2GWR A;  3CDH A;  4AWX B;  5HOO A;  3FMR A;  4KN7 X;  3LA7 A;  4A0X A;  4L18 B;  3E5X A;  3TOA A;  1IW7 F;  1W5T A;  3KLO A;  2DFI A;  4WF2 A;  4QLC U;  2CSO A;  2RN7 A;  3QU6 A;  3FHZ A;  3P9K A;  5A2Q Z;  1I6X A;  2MLG A;  3BJO A;  3JSP A;  1MJA A;  3B73 A;  5D8K B;  3HOT A;  1KU9 A;  5H20 A;  2XAF A;  1RI7 A;  5L3E A;  1ZRE A;  2K27 A;  1SD5 A;  4M9S A;  4XLP F;  1TLH B;  1O57 A;  3VFZ A;  4YFX F;  3BJA A;  3CO7 C;  3S2W A;  2QQA A;  4UVA A;  2VT2 A;  4E70 A;  1R58 A;  4LLN A;  3BJ6 A;  1SMT A;  2ISZ A;  2E7W A;  3TDU C;  1TQP A;  5FGM A;  1U5T B;  1HW2 A;  3GYH X;  3DQV C;  4HV6 A;  4KMU X;  1X3U A;  3F8F A;  3HSE A;  1U5T A;  3FXQ A;  1GXQ A;  2GA1 A;  2V1U A;  4IHS A;  4BHC A;  2LKP A;  3N97 A;  2G7U A;  2GIV A;  1USS A;  2FRH A;  2VBZ A;  3ABU A;  5BOX A;  3IL2 A;  4YFK F;  1FC3 A;  2M5W A;  1R7J A;  4K2E A;  5LRS A;  3V4G A;  2DPU A;  1D8K A;  2QBY B;  2VBW A;  1B1B A;  1J5Y A;  4RB0 A;  1U6G A;  4UHT A;  5LHH A;  3KZY A;  4IXA A;  1R1U A;  2PBI A;  2HZT A;  2MA3 A;  1LEA A;  1B9M A;  3RKW A;  2P6S A;  1O7F A;  1I1S A;  2V79 A;  3W6J B;  2Z9O A;  3CUQ B;  2XKO A;  5J8C A;  2L02 A;  5BPD A;  1YW9 A;  4RGU A;  4MTE A;  2MH2 A;  2XGX A;  2NAZ A;  1ODD A;  1TBX A;  4FX4 A;  3CUQ C;  4JQF A;  1IN8 A;  3WE3 A;  1FZP B;  4IRH A;  2CFX A;  4U0W A;  4ON0 A;  1BN5 A;  2Z33 A;  3K1P A;  5EEG A;  3T5X A;  1MJ9 A;  3C3W A;  3GX4 X;  2PMU A;  2NNY A;  3U9G A;  1W7P A;  3MZH A;  3I64 A;  4HX7 A;  1R00 A;  4EMS A;  3ECO A;  2QQB A;  4I0A A;  3GFM A;  1FP2 A;  4EVI A;  1LJ9 A;  4P9U A;  2VBX A;  4BHB A;  2FMY A;  3K1N A;  3O3K A;  3KP4 A;  1H9T A;  4XBF A;  5DD8 A;  3LAP A;  5D5W B;  1TNT A;  1L3L A;  2L4M A;  5CVJ A;  3Q9S A;  4LK1 F;  1FSE A;  5F64 A;  1WKM A;  1TQM A;  4I98 B;  1JHF A;  2FXA A;  5F1R A;  3L09 A;  4L0Z B;  3Q5F A;  4G7Z F;  1BIB A;  3V7S A;  5K5O A;  2JPC A;  2ESN A;  2WV0 A;  1J75 A;  4ZYG A;  3F8M A;  2DAO A;  4B09 A;  3V7R A;  3P9I A;  2W84 A;  1WQ2 A;  4ENM A;  3LST A;  3WTU C;  1IRG A;  4PDK A;  3O6B B;  3GFL A;  1XDU A;  1ZGA A;  1P2F A;  1XSD A;  1S7A A;  3M1E A;  3K2Z A;  4M6X A;  3D0S A;  2ZBK A;  5D8L B;  5JI6 A;  3T8T A;  3F6O A;  2PG4 A;  1HKQ A;  3K69 A;  4ENJ A;  1U5T C;  1Z05 A;  2VC1 A;  3I53 A;  4R79 A;  2YU3 A;  4HQE A;  1FLI A;  2D2W A;  3M9A A;  5J8F A;  5ERI A;  2H6B A;  4G6D A;  3FZV A;  1FX7 A;  4KDP A;  4ENN A;  3ZMT A;  3I59 B;  4HF1 A;  4NQW A;  3R0A A;  3MQ0 A;  3IHU A;  2XUB A;  2QWW A;  1I5Z A;  2NS0 A;  1SFE A;  3GXO A;  2FBK A;  4CYD A;  3WTW C;  3LA3 A;  2Q0O A;  1ZRF A;  4HLX A;  4I02 A;  2OZ6 A;  4L9J A;  5E8I A;  3FM3 A;  4RB3 C;  2F5E A;  2GZW A;  4BHP A;  3E5U A;  1FOK A;  2Y0M A;  3MWM A;  2K7L A;  4L9V A;  1G4D A;  3EET A;  3RYR A;  3PFI A;  3RDI A;  1STZ A;  2CW0 F;  2DU9 A;  2O8X A;  1KU7 A;  3FF5 A;  1YYV A;  2UXN A;  3ERE D;  3I54 A;  4HDV A;  1R22 A;  2D1H A;  1WSU A;  2BBY A;  2ZNZ A;  3I58 A;  3HRM A;  1FP1 D;  3I0T A;  4Q48 A;  4G94 A;  1FBS A;  2VC0 A;  3ZQ7 A;  1LDK B;  4HOB A;  3FXR A;  2M8E A;  1JGS A;  1IF1 A;  1ZLJ A;  1HW5 A;  1PDN C;  1G3S A;  2EK5 A;  2MBF A;  4PZJ A;  3JTH A;  2XAQ A;  2VON A;  3R61 A;  2K86 A;  2OAZ A;  1HW1 A;  2FSW A;  2MC3 A;  4EJO A;  2A5Y B;  2BE5 F;  3DP7 A;  2WC2 A;  3QPH A;  1KYW A;  3F21 A;  4WCG A;  1FBU A;  2LDU A;  4ZH4 F;  4HF0 A;  1OKR A;  5CJ9 A;  1J0R A;  2PLY A;  4KUM A;  5K5Q A;  2OU2 A;  3M8F A;  5TJJ A;  2FF4 A;  5D5U B;  3HHG A;  3K1M A;  1VTN C;  1KGS A;  2F5F A;  2Z5U A;  1ONV A;  2RNJ A;  1ZRD A;  1UHW A;  2YX4 A;  3FX3 A;  1BC8 C;  1D3Y A;  2IW5 A;  4IF4 A;  3NRV A;  5DV5 A;  3SZP A;  4CGZ A;  4LLL A;  3I5U A;  5HDK A;  3ZN1 A;  1J59 A;  1NHA A;  3TO7 A;  1IXS B;  3KET A;  1EH8 A;  2PN6 A;  3RPQ A;  3ZMU A;  2VOD A;  3KE2 A;  3E6C C;  3VB2 A;  1BI3 A;  1LDD A;  1B59 A;  3R6S A;  2EFW A;  4HV5 A;  4HDU A;  4NHJ A;  4RB1 A;  1SMY F;  5AIQ A;  3ZMS A;  3DKW A;  1R1V A;  3KCC A;  4Z2Y A;  1RUN A;  5D6E A;  4WK8 F;  2FBH A;  1QBJ A;  1W7P B;  4HX8 A;  1ZG5 A;  2KJB A;  5DD4 A;  2YR2 A;  4UXN A;  1ULY A;  1R23 A;  4N9H A;  4F7Z A;  1BIA A;  3TO6 A;  3GZ6 A;  2KIM A;  1UB9 A;  2IPQ X;  2QYO A;  3GO5 A;  2EV6 A;  4CXF A;  2D1V A;  2AXL A;  2VOO A;  5CYV A;  2QVO A;  3U1D A;  1R5H A;  3L2C A;  2O3F A;  3ZPL A;  1ZH5 A;  1T39 A;  3MFK A;  4BH9 A;  4LB6 B;  3R60 A;  3V8L A;  1YG2 A;  4M72 A;  1REP C;  1OYI A;  3RIR A;  3V8K A;  2QUF A;  4M74 A;  3IC7 A;  2PJP A;  1QO0 D;  5JR3 A;  1F1Z A;  1P4X A;  4MEX F;  1BM9 A;  2HQR A;  2XRN A;  3L9F A;  2MH9 A;  1HSJ A;  4EM0 B;  3LA2 A;  4YG2 F;  4KIC A;  2FNP A;  1RUO A;  1SD4 A;  1IXR C;  4EM2 A;  1WWX A;  2DO7 A;  3GZ5 A;  3K0L A;  1RZ4 A;  3BOQ A;  3J81 Z;  3GEZ A;  2FML A;  5L3B A;  3JW4 A;  1OPC A;  2K4J A;  3JAM Z;  1FYL A;  3T8R A;  2F2E A;  1MKM A;  2H09 A;  2O03 A;  4O3M A;  4GO1 A;  5E1Z B;  2P5K A;  5DEQ A;  2AS5 F;  3F23 A;  1T6S A;  4IRI A;  2XV4 S;  3ML6 A;  4LB5 A;  2HKO A;  2EFP A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...