2PMUA

Crystal structure of the dna-binding domain of phop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
VRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords response regulator PHOP
publication title Structure of the DNA-binding domain of the response regulator PhoP from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulation
total genus 25
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2pmuA00
4ZZDA 4RGSA 1R1UA 5L3DA 5HLGA 4G94A 2FBKA 1WRJA 1J2XA 1Z6TA 3JW4A 2HR3A 2QVOA 4NQWA 2IRFG 3NRVA 1LDDA 1P4XA 2OQRA 4RGUA 1VTNC 3F8BA 1Y0UA 4CO8A 3KZZA 3KFWX 3KEOA 2NS0A 4CGZA 4M6YA 2UWMA 1QZZA 3P9CA 1SD7A 1ZYRF 2YX7A 3CJNA 2CG4A 4K2EA 3ELKA 4IPAA 4P9UA 3K69A 1H9GA 4TV7A 2Y48A 1U5TC 4YIIA 2Z33A 1WI9A 4N9IA 2K4BA 1W7PD 4P9FA 4A6EA 4KMUX 4EJOA 2Y75A 1X3UA 2PBIA 3FXQA 4BQAA 1XMAA 2FRHA 5FFZA 1J7KA 2CFXA 2RNJA 1KU3A 5K5RA 2GWRA 3C1DA 3K9TA 1R58A 4U88A 2HGCA 2XASA 3CUQA 3E6BA 2P5KA 3BY6A 4P5OA 5AIQA 1W4MA 3DQVC 3V8KA 5BQTA 2P6TA 2JT1A 2EV0A 1YLFA 1U2WA 5FLXK 3HRMA 4IRHA 3WTYC 4UV8A 1ON2A 1QO0D 3P9IA 4A0ZA 3KETA 5LHIA 1GVJA 2P5LC 4KN4X 3QAHA 4IJAA 5FLXZ 3G3ZA 2D45A 3BPVA 1XSDA 4HYEA 5D8LB 1FY7A 1V4RA 2E1CA 3GFIA 1B9NA 1STZA 4MNUA 3E6MA 2MLKA 1B6AA 3F72A 3F22A 1XDSA 3L2CA 3V7CA 5CJ9A 3L7WA 5D5UB 4HZFA 2ETHA 2K02A 2FEZA 5JR3A 2HTJA 4PGGA 3WTZA 4YFXF 1IN6A 5ICFA 3MAJA 2NAZA 3HTUA 1HKTA 1XMKA 3RJPA 1G3SA 1K78B 3DF8A 2VE8A 2OZ6A 3GF2A 3QPTA 4LGWA 4LK0F 3O3KA 2A07F 1ZHFA 5L3BA 4IHTA 3ML6A 1KQ0A 4WF2A 4HX8A 3R61A 4DQ2A 2O3FA 5HLIA 1Z7UA 4LMYA 1ZREA 4KNYA 2B0LA 3VEPA 4G7HF 4S05A 2QQAA 4FT8A 4UUVA 3O6BB 1YTYA 4A5MA 2FXAA 3QP6A 4OIOF 2C6YA 1FX7A 3DPLC 3JAMK 1UHWA 3PQKA 2UXXA 1LEBA 1IRGA 2Z99A 4M9XA 5AONA 5DD4A 4HF1A 2GQQA 1RI7A 3HRSA 3HSFA 4ASNA 5HDGA 1Q1HA 3MZYA 3F8MA 1Z1DA 3BOQA 1OYIA 2P4WA 3F6OA 3IWFA 5DD8A 2Z9OA 1I5ZA 4LB5A 4GYGA 1F5TA 4HDUA 1YFHA 4D0PA 3L00A 2A6EF 1EV7A 3CUOA 2FE3A 4EQQA 3LWFA 1YO5C 2R7FA 1KA8A 5BOXA 2M1BA 1T2KA 4NB5A 3GEZA 4WK8F 4I01A 1BM9A 3JSOA 1BOAA 1PP8F 1KQ8A 5CVIA 2XRNA 1LDJA 3V8LA 4I0BA 3VB2A 2PFBA 4U0WA 1S29A 1XDUA 1ON1A 4GYIA 2QWWA 1P4WA 3TDUC 3RKYA 1LDKB 2BEOA 4BH9A 1H0MA 1B59A 4UV9A 1V3FA 4R79A 4HV6A 2FNAA 4EM1A 5FGMA 5D4RA 2ZMEA 3H92A 3F8FA 1FBUA 4U7DA 1D3YA 1TLHB 2XUBA 1P2FA 1USSA 2VN2A 2WTEA 1R7JA 3CUQB 1ZRCA 1XCVA 2GIVA 2Z3YA 1F1ZA 4UVCA 5CVUA 3OV8A 3KZYA 2OA4A 1JHFA 4Q48A 2ZXJA 4N0BA 2DTRA 3COAC 1J9IA 4BHPA 1RIOH 1G3YA 5L3EA 3KP7A 2HOEA 2OU2A 4YFNF 5H20A 3E6CC 4M72A 1OYWA 1USTA 2XAJA 3U2RA 2QYOA 2M5WA 5KVRA 4ESJA 3VODA 2ZBKA 4MTDA 5DV5A 3LSTA 4LLLA 1MJAA 4ZH4F 4OOIA 1S7OA 2HKXA 3KEQA 3R4KA 3IC7A 2GA2A 1T0FA 4RGXA 1G3WA 4O3MA 5E8GA 2XHKA 1PP7U 3ZN0A 5F6FA 3GZ6A 1ZGJA 1ZH5A 3Q9VA 4RS8A 2DU9A 2G9WA 2H6CA 2YPRA 4OIQF 2FU4A 1T98A 3K1PA 5AIPA 2EWNA 3PQJA 5TRDA 3T1BA 4AIJA 5JFRA 3LA7A 4ON0A 1IN8A 4PZJA 3HSRA 3N97A 4MEXF 2WC2A 2P5VA 3MZHA 2KIFA 1BC7C 3NEUA 2QBYB 3TO7A 1HSTA 2E1NA 1QGPA 3CO7C 3R0AA 3FMRA 2PLYA 2HQNA 2EFWA 2QLZA 3ZMZA 2PJPA 5FD5A 5HS8A 2ZNZA 1IXSB 3DFGA 4BXUA 1TW3A 4A5NA 1E2XA 4MGRA 5F1RA 1JGSA 4ZZLA 4OIPF 3U9GA 3WTUC 2VBZA 2L4AA 3R60A 1TQMA 3HYIA 1B9MA 3I53A 1LQ1A 2UXNA 1SFXA 3ZQ7A 4KIBA 1MGTA 3VOEA 2XV4S 2RKHA 1SFUA 4QLCU 1HW5A 1QNTA 4G7OF 4JBAA 3TOBA 1BI0A 1S7AA 2HTSA 5JI6A 3H3UA 2J5OA 5ERIA 4L9NA 3ZMDA 4IRIA 2OD5A 2DPDA 5D8KB 1KQ9A 2RDPA 4I02A 2RN7A 5A2QZ 1QPMA 1IN5A 2RVCA 3EYYA 1CF7A 2ACJA 5HLHA 3FHZA 2CWEA 3WTWC 4OINF 5K5OA 3J81K 2OBPA 4UVBA 5LEKA 3FF5A 4A0XA 4G6QA 1HSJA 2IA2A 1RUOA 4ENJA 2IJLA 3BJOA 5CYVA 1WKMA 3F8NA 2Y0MA 2Z5UA 4M9ZA 4ESBA 2V1DA 3BJ6A 4LG0B 4L9JA 3IKVA 3TKYA 3HHHA 3O2PE 2ZFWA 1JHHA 2XAQA 2ISZA 1IXRC 4Y17A 4G9YA 5TJJA 5ICGA 1ZAOA 4PGHA 2KIMA 1IZ1A 3F21A 4KUMA 2ZMEB 4AWXB 2QZ8A 2FA5A 1YG2A 2NNNA 2DBBA 1K7AA 2RGVA 2E7WA 2PG4A 2Q2EA 1Z6RA 1XGOA 3GW2A 4FHTA 2A6HF 3KP5A 5FO5A 3SHFA 2FSWA 2W57A 2GXGA 3RI4A 1YW9A 2EFOA 3WTSC 2F5CA 3BPXA 5CVVA 3L9FA 5E18F 2EA4A 3T5XA 1F4KA 1ZG1A 1ZLJA 2IT0A 2ZO4A 2GZWA 2BBYA 4G7ZF 4ENMA 4WXDA 3JTHA 4RAZA 2PI0A 2R7DA 4ESFA 3GLXA 1FYLA 2PEXA 3C3WA 3FM5A 3ULQB 1XCBA 4L0ZB 2AXLA 1KU9A 1DPUA 2XAGA 1T38A 4LK1F 5EEHA 4AIHA 4HBLA 3I5UA 4MHGA 5H6RA 2LDUA 1ZN2A 3KP3A 3F3XA 1WWXA 3ECHA 4RB0A 3BZ6A 1S8NA 1IXCA 4QWQA 5ILSA 4EJWA 3E3VA 4MTEA 5DUIA 1HW1A 5DCFA 3RYPA 1EH8A 2PQ8A 3K1MA 5E1WA 5LHGA 3N4MA 3C18A 3F23A 3ZMVA 1R00A 4HDVA 4WWCA 1BJAA 1OMIA 2IA0A 1JXSA 5IT9K 5L3GA 4MEYF 3ZMTA 2DO7A 3GXOA 4AVPA 3OOPA 4N9HA 2Q8KA 2CYYA 3WU0A 3WTXC 2R3SA 4U0YA 3PFIA 4KFCA 1HKSA 3LA3A 2MLGA 2BE5F 3GWZA 2HYGD 5LEJA 2YX4A 5LLQA 2DW4A 4IVNA 3GFMA 3M8EA 2A5YB 3K2ZA 2ZCWA 1FLIA 1ZG3A 1FNNA 3DPTA 1T6SA 4P55A 2XROA 2DK5A 2STWA 1F9NA 2OQGA 2EFNA 3LAPA 3C7JA 3ABUA 2CQKA 4WXHA 4BYYA 3BWGA 2DAOA 4R1HA 1R5HA 3KP6A 4HLYA 3QU3A 5BPIA 1OR7A 2HYFA 4PCQA 1SAXA 4S04A 1OPCA 2IA1A 2YSRA 3JAMZ 2MC3A 1L3LA 3B02A 2A3SA 2ISYA 3Q9SA 1DP7P 1GXPA 2VOPA 1J5YA 2HS5A 1DUXC 2RC4A 1EH7A 2CO5A 2YU3A 1FSEA 5J6XA 2O0YA 1HQCA 3V7SA 4I98B 3LFKA 4WXCA 2V79A 4KYWA 3CTAA 2G7HA 5HVQC 2NYXA 1MD0A 2MBFA 3K0LA 2PN6A 1W7PA 5E1XA 1MDMA 4XRFA 5DCMA 4EMSA 4ZYDA 2FMYA 4IRGA 2DLLA 2HFHA 4YFKF 2O6GE 4B8XA 3GX4X 4UHTA 3G73A 2K27A 3KP2A 5DEQA 5EEGA 1SD4A 1QBJA 4HLXA 3TO9A 3DKWA 1Z9CA 4OU0A 1G3TA 4KMFA 4LB6B 1FWZA 2QQBA 3I0TA 3ERED 4HX7A 4AD9A 2O8XA 1D8JA 1XN7A 1KYZA 1RZ4A 3K1NA 4R8HA 3TGNA 5FB2A 2WWYA 3DEUA 5DDGA 1ZGAA 3QPHA 2M30A 2XKOA 3GYHX 1LNWA 2P7VB 3BP8A 1IN7A 1I6XA 3V4GA 1W5TA 4M74A 3IWZA 3W6JB 1FP2A 2ZNYA 2JPCA 4PDKA 4XBFA 3RPQA 2D1VA 4CXFA 1I1GA 2LSOA 1QQIA 2P6SA 5CVJA 4Q4ZF 5ILVA 4Y13A 2HQRA 3P7NA 2P8TA 2L4MA 1ODDA 5JVTA 2A69F 4CZZA 1KYWA 3HUGA 3I59A 4RB2C 2QENA 2L02A 3T8RA 2DPUA 4GO1A 3RDIA 2XVCA 5HDNA 3M7GA 2VBXA 3M8FA 2HKOA 4U0VA 1S6LA 3Q5FA 5ICEA 1QZYA 3E6DA 2XAHA 3RYRA 1SFEA 4KDPA 4L5JA 2Q0OA 1XGMA 1RNLA 2G7UA 1FT9A 3E5QA 2EV6A 2HEOA 1R1VA 4P96A 3GVAA 3DV8A 1R23A 2D1HA 4HW0A 3I64A 1BI3A 4KT5C 1XD7A 2EFPA 1KU7A 2BV6A 3FXRA 1REPC 1GXQA 1SD6A 4NHJA 5ED4A 2M8EA 2IVMA 4KICA 1FYMA 4HF0A 4BHCA 4KIGA 5FD6A 2L01A 2XAFA 3H3ZA 4EGZA 2NRAC 5HS7A 1YS6A 2F5DA 3WE2A 3ABTA 1IAWA 3IHUA 1TNTA 2QUFA 5F64A 1XB4A 3ZMUA 1UCRA 4A0YA 1FBSA 4BHBA 1K6OA 3RTRA 2JTVA 4CDGA 5LGNA 3KLOA 1GHCA 1J59A 1FBQA 3I54A 3SZTA 4U7BA 3KCCA 2LKPA 3KP4A 3CUQC 2RV8A 5D5XB 2LF8A 2AS5F 2K4JA 4A2UA 3J7AO 3FMSA 1YYVA 3ZP5A 3HHGA 2JPBA 4HV5A 3GFLA 4YG2F 1XSXA 4L5IA 1SMYF 2CGPA 1JE8A 1FSHA 3TOAA 1Z91A 1ZLKA 1P92A 3M1EA 3WTTC 3RKXA 3HRTA 5DCMB 1YIOA 1UFMA 4DNCA 4AIKA 1ZG5A 3P9KA 1J0RA 2FBHA 3HRUA 1IUYA 1YS7A 3FMQA 3FM3A 3GZ5A 3J81Z 5D5VB 5E1ZB 5LGUA 4I09A 5D5WB 2A68F 2FOKA 2W84A 3IKTA 2KKOA 5J8CA 1TTYA 1FOKA 2X4HA 3RPUA 4EJTA 2P7CB 3AAFA 4I7HA 4RB3C 1A04A 1HXDA 1HBXG 2EB7A 4M6XA 2IP2A 1HW2A 3ISPA 4GCVA 5D4SA 3MFKA 2MH2A 4OIRF 4EM2A 1W5SA 4UXNA 3NQOA 5DUKA 2VBWA 3GUDA 1U78A 4IHSA 3R6SA 4G8XA 4FX0A 2XKPA 3WTVC 2IW5A 3W6KB 1Z05A 4IXAA 5LRSA 3LQRA 3FXUA 1LB2A 1SMTA 4JK1X 1O3QA 4ZYEA 4XSZF 3RIRA 2L3DA 4CHUA 1R5GA 3E97A 4EGYA 1OKRA 2VC0A 3EUHA 2VE9A 4HOBA 4XLPF 4HX4A 3T8TA 1MZBA 1BI1A 3R0JA 2V9VA 3GFJA 3I59B 3QOPA 2FQ3A 1BBYA 3S2WA 2VT3A 3QRFF 3BROA 3T0YA 3FX3A 1PDNC 2VC1A 2CW0F 2VBYA 4BAYA 2M45A 4H0EA 4Q5SF 2VOOA 1XGSA 2PMUA 4EV0A 1U6GA 1WQ2A 1S3JA 5CLSA 2W85A 3MQ0A 2H27A 2TDXA 2DK8A 4O6JA 1J75A 1H9TA 2GAUA 3MEXA 1FZPB 1LJ9A 2MD5A 5FFXA 2DQRA 5H6QA 4HA8A 4WX9A 5DYMA 5CVRA 3EETA 3LQQA 3DP7A 2BYVE 4HAMA 5LGTA 1O3RA 3GO5A 2QM3A 4Y15A 1G6NA 5HS9A 4FX4A 3REOA 3HSEA 1FP1D 2W24A 2DI3A 1OYYA 3LAJA 2YR2A 1ZRFA 3KE2A 4UVAA 5LRRA 4RGRA 3EYIA 5LBQA 5IT9Z 1IF1A 3ROUA 1YW7A 2VONA 1R22A 2FNPA 2H94A 3EQLF 1RUNA 4L0YB 5LHHA 3TDZC 3D0SA 2MA3A 5E8IA 1T39A 2QBYA 1FPQA 1NHAA 2EV5A 4CYDA 2GXBA 5BMZA 1DDNA 3JTGA 1U5TA 4KN7X 5ILUA 2DFIA 2DQLA 1G4DA 4MQ9F 2HDCA 3WGIA 3MCZA 4LFUA 4RAYA 4HQMA 4LJZF 2H09A 2BGCA 1WSUA 5K1YA 3DXJF 3E5UA 2K86A 3KLNA 1CF7B 3QP5A 1KU2A 3BDDA 4E70A 3IRQA 1P4AA 2XIGA 3BJAA 1FYKA 1D8KA 2JZYA 2JSCA 2E7XA 1EH6A 2GA1A 1K79A 4ZYGA 1I27A 4LLGF 5HDKA 4G6DA 1L0OC 1R1TA 1TBXA 1ZARA 1LEAA 5L3FA 4YIFA 1CGPA 1MKMA 3M9AA 1YQAA 2EJRA 2COMA 3TO6A 1BN5A 5ICCA 1ZRDA 4B09A 1I1SA 4M9SA 5E17F 4HF2A 4L9VA 2PMHA 5J8FA 1XGNA 2W25A 4IF4A 4ENNA 3WGGA 2A61A 2EA2A 2O03A 3ZMSA 2K7LA 4UNOA 3SQNA 5JHUA 2KJBA 1MJBA 3MWMA 3SZPA 4WCGA 4EJUA 2OAZA 4XSXF 4LG0A 4M73A 4O5VA 1BI2A 5D6FA 1TW2A 1U3EM 3RKWA 1O57A 2RQPA 2ELHA 3F8CA 5BPDA 2FF4A 3HIFA 5KK1A 2L54A 1YW8A 1TQPA 3F6VA 4L9TA 1UB9A 3I58A 4HQEA 5E20A 4GXOA 2KIUA 3SXYA 4XLNF 1TNSA 1BIBA 1IW7F 1MJ9A 3WE3A 3WG9A 2F5EA 2EK5A 1XSVA 4L18B 4CICA 3B73A 4KA4A 2UZKA 2KJCA 1O7LA 2M87A 1IRFA 2CSOA 3WODF 1O3SA 3WU1B 3CLOA 3ZPLA 1AOYA 2OZUA 3D5LA 2QQ9A 1C0WA 1LVAA 1D5VA 4MQVA 1UHMA 3FWEA 1P6RA 4I0AA 4Z2YA 2HZTA 2D2WA 4ETSA 3HOSA 2JRTA 2NNYA 2F2EA 2H6BA 3J80K 4OMZA 1B1BA 1B4AA 1BIAA 3QU6A 3HOTA 5IT3A 2FBIA 1R36A 3WGHA 5K5QA 2XGXA 1O3TA 3EDPA 3J80Z 5HOOA 3TQNA 4ENKA 3ZN1A 2HWVA 3I71A 2ESHA 4Q47A 3VFZA 2IPQX 3V8JA 2O61A 3HTSB 4EJVA 2F5FA 1KGSA 1E17A 2ESNA 2V1XA 1U5TB 2MH9A 1HKQA 4JQFA 1BC8C 2FMLA 1O7FA 1FC3A 4GGGA 4M71A 1K78A 3IL2A 2ZKZA 4BNCA 4EM0B 5D6EA 2J5PA 4A6DA 3ECOA 3IRRA 3FZVA 1DPRA 2WV0A 2VODA 3I4PA 4OMYA 2ZJ2A 3JSPA 2EFQA 2KRFA 1AWCA 3CO6C 1SD5A 4RB1A 1TQIA 4ZYHA 4I2OA 2V6CA 5A2QK 6PAXA 1IN4A 5BS6A 1W7PB 1MDMB 2DT5A 2X0LA 4A12A 2STTA 3CDHA 4F7ZA 4LLNA 4KIFA 4LD5A 2V1UA 3E5XA 3U1DA 3LA2A 5L3CA 2ADUA 1U8RA 3L09A 1ONVA 3V7RA 2VXZA 1ULYA 2VT2A 3SFZA 4EVIA 1PUEE 2LNBA 2LF7A
chains in the Genus database with same CATH superfamily
4ZZDA 1OFCX 4RGSA 2F6CA 1R1UA 1TWAJ 3WHBA 2KHMA 2WY7Q 5L3DA 1OCTC 5HLGA 1CQTA 3CMMA 4G94A 4II2A 2OC6A 2FBKA 4ABZA 4DZPA 1MBJA 1WRJA 5DS9A 4E7LA 1J2XA 1V5FA 1WZ2A 1Z6TA 3JW4A 2HR3A 2IGOA 2QVOA 4NQWA 2IRFG 5GP9A 2CUZA 3NRVA 1LDDA 1P4XA 4JP0A 3FIWA 1I3QJ 4MFDA 2L7FP 3FXJA 3VDXA 2OQRA 4RGUA 1VTNC 1A6IA 3F8BA 1Y0UA 4EATA 4CO8A 3KZZA 3KFWX 1BW6A 3KEOA 3GBGA 2VQHA 3DKYA 2NS0A 4CGZA 2CUEA 1IGNA 4M6YA 2UWMA 1QZZA 3P9CA 1SD7A 1ZYRF 2YX7A 3CJNA 3FK7A 1BR2A 1QVTA 2K9NA 3SDGA 2CG4A 3A4CA 1IG7A 4K2EA 3ELKA 4IPAA 4P9UA 2LY2A 1H9GA 3K69A 4TV7A 2XDVA 4HNUA 2Y48A 2Z16A 1U5TC 4YIIA 2Z33A 1WI9A 2ZFUA 4N9IA 2VASA 2K4BA 1W7PD 4P9FA 4A6EA 4KMUX 4F92B 1XMXA 4XKBA 3OY9A 2HDDA 4EJOA 2WADA 2Y75A 1X3UA 4AVZA 4KISA 2PBIA 3IAM2 3FXQA 1YITI 5E79C 1FOYA 4BQAA 1XMAA 2FRHA 3HUGB 1TL8A 5FFZA 5GAEJ 1J7KA 2CFXA 2RNJA 3HXLA 1KU3A 4C2TA 1BR4A 1OR7C 3K2AA 5K5RA 3CJTB 4Q48A 2GWRA 3C1DA 3K9TA 1R58A 3ZR8X 4BGDA 4A3KJ 3S93A 2IS4A 1RR7A 4U88A 4D7NA 2HGCA 2XASA 3CUQA 3E6BA 2P5KA 2K9MA 3BY6A 2LRDA 3GTLJ 4P5OA 3B6CA 5AIQA 4QTRA 1W4MA 3DQVC 3V8KA 3H9JA 4XLFA 2OCEA 5BQTA 5EZGA 1S7EA 4II3A 2P6TA 3FK6A 1YIJI 2HOTA 2MD0A 2JT1A 3CC4I 2EV0A 2JSPA 4PK4A 1YLFA 1U2WA 5J40A 5FLXK 3A0BC 3HRMA 4IRHA 3WTYC 1D0XA 2JA6J 2G0EA 5KAFC 1X1CA 4UV8A 1ON2A 3DLLF 1QO0D 3MMYB 3P9IA 4A0ZA 4RDUA 3KETA 5LHIA 1GVJA 2P5LC 4KN4X 4BJTA 2QQ8A 3QAHA 1A36A 4IJAA 3H1CA 3KPHA 5FLXZ 3OS0A 3I4MJ 2K3PA 3G3ZA 2D45A 3BPVA 1XSDA 2JVGA 4HYEA 5D8LB 4YIRX 3E1SA 3GZNB 3G6EI 1TT0A 4A3FJ 1FY7A 1V4RA 2E1CA 3GFIA 1B9NA 2QF7A 1STZA 4MNUA 4ZDOA 1SEUA 1HDDC 1P9QC 3E6MA 2MLKA 1WJDA 4P1WA 2F4OB 1B6AA 4PSXA 2QKLB 2X85A 1OCZH 3F72A 3F22A 1XDSA 2RREA 3PUBA 3RQ4A 3L2CA 2IEKA 4F55A 3V7CA 2KIQA 2BXZA 3HKZN 2LMDA 1R71A 5CJ9A 4BBSJ 4XKVA 3L7WA 5D5UB 3ASOH 4HZFA 1SC7A 4XOPA 4BY7J 5K7HA 3SDBA 5TISC 4Y33A 1BA5A 4M3BA 2ETHA 4XN0A 2KDZA 2K02A 1K83J 2FEZA 5JR3A 2HTJA 4PGGA 1KONA 3WTZA 4YFXF 4PJNA 1IN6A 5ICFA 3MAJA 1OCRH 2CQXA 1ZR2A 2GLOA 2NAZA 3HTUA 1JJ8C 2QSGX 1HKTA 1XMKA 3RJPA 3HOVJ 1G3SA 4Y7NJ 2R7RA 1K78B 5CKTA 2KZVA 3DF8A 3EUAA 4HEA2 2VE8A 3KEYA 2OZ6A 3GF2A 3QPTA 4LGWA 4LK0F 3O3KA 5M3MJ 2A07F 1ZHFA 3BR0A 4D5CA 4BE2A 5L3BA 3BG6A 4IHTA 2LG4A 1JJ6C 3S1QJ 3CCLI 3ML6A 1KQ0A 4WF2A 4HX8A 1SFKA 4FE4A 3R61A 4DQ2A 1MH4A 2CQ7A 2O3FA 5HLIA 3HDDA 3F9KA 1Z7UA 4LMYA 1ZREA 1U8BA 2VPRA 4KNYA 4DJAA 2B0LA 5IYBJ 3PFYA 3VEPA 5JHFA 4G7HF 4S05A 3ZQQA 2QQAA 2KZGA 4FT8A 4UUVA 4A69C 3O6BB 4J19A 1YTYA 2JA8J 3CF2A 4A5MA 1I39A 2FXAA 3QP6A 1V5EA 4OIOF 2C6YA 1FX7A 5FKMA 1QVUA 2JN6A 1QU3A 2N8GA 2DMNA 2DODA 2KDOA 4KJZA 1JKOC 1BL0A 4FISA 2ZJQF 3DPLC 2BHZA 3JAMK 1UHWA 1YE9A 3K4KA 3PQKA 2UXXA 5K7ZA 3BR1A 2ZJPF 5GAHJ 1LEBA 1IC8A 1IRGA 1UAAA 4XKCA 2Z99A 4M9XA 3ZQIA 5IOZA 3M4OJ 5AONA 3JRGA 1MSEC 5DD4A 4HF1A 2F4MB 2GQQA 1RI7A 2EIMH 3HRSA 3VSLA 3HSFA 4ASNA 1UG0A 5HDGA 2WAEA 1SAUA 1Q1HA 3MZYA 3F8MA 3BQYA 2HXIA 1Z1DA 3GLLA 3BOQA 2HVRA 1OYIA 3DU5A 1XC5A 2P4WA 3F6OA 1MNEA 3PJRA 2LBFA 1B72A 1BR1A 3IWFA 3UR3C 1YHQI 1DP3A 5DD8A 4ZYAA 2Z9OA 3KYLA 1ETXA 2V4JC 1I5ZA 3CC2I 4LB5A 4GYGA 1F5TA 4HDUA 4PJ0C 1LE8A 3DTEA 4AYBA 4IZZA 1YFHA 4D0PA 1SVLA 3L00A 3ZGKA 2A6EF 2R5ZB 1EV7A 5J1UA 3CUOA 2FE3A 3G1OA 4EQQA 1P7JA 2HPMA 3LWFA 1YO5C 1QHHD 3OYBA 2R7FA 4HG2A 1KA8A 1IO2A 4I99C 5BOXA 2M1BA 1T2KA 4NB5A 2E2JJ 3GEZA 2YU9J 5IP9J 4XLEA 1NG6A 4ZDPA 2LD5A 2JWTA 4WK8F 1VNDA 4I01A 1BM9A 3JSOA 3G4SI 4M3FA 1BOAA 1YJWI 3JRHA 1PP8F 3AG3H 4GDFA 2LK2A 1KQ8A 2AO9A 1SVOA 1PYVA 2BY3A 5CVIA 5IP6A 4A93J 3TEDA 2XRNA 1LDJA 2DA4A 2XSJC 3V8LA 2OJED 4I0BA 2Y0SN 1Z3YA 2DJNA 1AU7A 3VB2A 2PFBA 4XNFA 1P7IA 4U0WA 3W2WA 2HU9A 3HB9A 4XONA 3FISA 1S29A 1XDUA 1ON1A 2WA0A 4EEFG 4GYIA 3BTLA 4F93B 2QWWA 1P4WA 3TDUC 1MH3A 5KCMA 3TMOA 5E3MA 3RKYA 1LDKB 2BEOA 2COBA 4BH9A 1H0MA 1B59A 4UV9A 1V3FA 3K4CA 4R79A 2F5VA 4HV6A 2FNAA 4EM1A 2BVLA 1X1BA 5FGMA 5D4RA 3SEQA 2ZMEA 3H92A 3F8FA 4CCKA 1W36C 1FBUA 1TWCJ 4U7DA 1D3YA 2DMUA 1TLHB 2L7ZA 4UY8I 1UJ8A 4PUSA 2XUBA 3RZOJ 1P2FA 1USSA 2VN2A 2WTEA 4B48A 1R7JA 1VQ8I 4DBRA 3DBRB 3LMMA 3CUQB 2WV1A 1ZRCA 1XCVA 2GIVA 2Z3YA 1F1ZA 4UVCA 5CVUA 3OV8A 2CUJA 2Q1ZB 3KZYA 2DA6A 1JHFA 1TP4A 1D0ZA 2OA4A 2ZXJA 3HEFA 4N0BA 4OWRB 2DTRA 3AG4H 3COAC 1XTAA 1J9IA 4BHPA 1RIOH 2PJRA 1G3YA 2GOXB 2VB6A 5L3EA 3KP7A 3S16J 3TBIA 2M9HA 1WJEA 1D1CA 2HOEA 3CDIA 2OU2A 4YFNF 3OYFA 2EILH 5H20A 3E6CC 4M72A 1H88C 1VQ5I 1R4MB 1OYWA 1USTA 2XAJA 3U2RA 3MN2A 1JI8A 2QYOA 4XOTA 3P5JA 2VJJA 4BU2A 1AKHA 3C2BA 4H4KC 4FCYA 3FXMA 2M5WA 5KVRA 4ESJA 5GPAA 2XF6A 4F52A 3VODA 3K70D 2ZBKA 4MTDA 2BW3A 1TC3C 5DV5A 3LSTA 2LY9A 4LLLA 1MJAA 4ZH4F 4CYCB 4OOIA 4E7SA 1S7OA 1YRNB 2HKXA 1QHGA 3QYEA 3KEQA 3R4KA 3IC7A 2GA2A 1T0FA 3ZQLA 4RGXA 1G3WA 3PNTA 1O4XA 3H0GJ 4O3MA 5E8GA 1R6RA 2CQQA 2XHKA 2MFZA 3L2WA 3BR2A 3FHNA 1PP7U 3ZN0A 5F6FA 3GZ6A 1ZGJA 5LD2C 3KIOA 1ZH5A 1A5JA 1X2MA 3BG5A 3Q9VA 4RS8A 2X1CA 2DU9A 2G9WA 2H6CA 1N25A 2VJ5A 2YPRA 3RKQA 4OIQF 2L9SA 3OWTA 2FU4A 4BEHA 1T98A 3K1PA 5AIPA 1OJLA 2EWNA 4ZJZA 4FQGA 3PQJA 5TRDA 2VL8A 3DTIA 3T1BA 2EBIA 3D5SC 4AIJA 5JFRA 4A3CJ 2PMZA 1X4OA 2JUGA 3LA7A 1DQUA 4IQ4A 4ON0A 2XPVA 1IN8A 1QZEA 4PZJA 3HSRA 2JJ7A 2JMWA 3G2BA 3OYAA 3N97A 2WC2A 4MEXF 2ZXWH 2WB1N 3RZDJ 2DA1A 2M8GX 2P5VA 3MZHA 2KIFA 1BC7C 3NEUA 2QBYB 3QOEA 2XAUA 1HSTA 3TO7A 4BQQA 4X6AJ 2E1NA 1QGPA 3M8JA 2M4KA 3CO7C 3R0AA 2JA7J 3S15J 1UZCA 3FMRA 2PLYA 2DA5A 2HQNA 2EFWA 2QLZA 2M7BA 4LIVA 3OR1C 3ZMZA 1VQ4I 2PJPA 3CC7I 5FD5A 5HS8A 2ZNZA 2JVHA 1IXSB 3DFGA 4BXUA 3ZQCA 2HYJA 1TW3A 4A5NA 1VQMI 1E2XA 3DBHB 4LG3A 3O8HA 4MGRA 5F1RA 1JGSA 4ZZLA 3CCUI 4OIPF 3U9GA 3WTUC 2EINH 3HGYA 2VBZA 2L4AA 1ZKGA 3K4NA 3R60A 1TQMA 3ESWB 3HYIA 3HL2A 1YX3A 1B9MA 3I53A 1LQ1A 3EUHC 5F1JA 1MBGA 1SFXA 2UXNA 5FKOA 1JUMA 3ZQ7A 5F0HA 3MZ8A 4XN3A 4KIBA 1MGTA 2VKVA 2VJIA 3VOEA 2XV4S 3OIQA 4CCJA 5GPCA 3HC7A 1MBKA 1MMSA 3MD2A 1WCMJ 1GT0C 4HNVA 2RKHA 3A02A 1K4SA 3QPLA 1SFUA 4QLCU 5EJCA 1VQOI 2CV2A 1HW5A 2AHQA 1QNTA 4G7OF 4JBAA 4BUPA 3TOBA 1ETOA 1BI0A 3LNQA 1S7AA 2HTSA 3NARA 3H3UA 5JI6A 2J5OA 4NBQA 5ERIA 4L9NA 4NUBA 3ZMDA 3HBLA 4IRIA 2GBYA 2OD5A 2DPDA 1GV2A 1WJBA 2LBFB 1B72B 1T95A 3CCRI 1FTZA 5D8KB 1KQ9A 2CV1A 1JTYA 2RDPA 4BL0B 1ZK8A 4I02A 2RN7A 2R5YA 1F43A 5A2QZ 1QPMA 3LSPA 1IN5A 2RVCA 2Y30A 3EYYA 2ACJA 1CF7A 2M7AA 2MSYA 5HLHA 3FHZA 4BDYA 2CWEA 4D9JA 3WTWC 5C3EJ 1UELB 4OINF 3BCBA 5K5OA 3J81K 3BR6A 2NS8A 3ZQGA 2OBPA 2QCOA 4UVBA 4NC8A 5LEKA 1WJFA 2W4SA 3FF5A 4A0XA 4G6QA 1HSJA 2IA2A 1RUOA 4ENJA 2IJLA 2H1LA 3BJOA 5CYVA 4HSTA 1R49A 1WKMA 3G1MA 3KYCB 1D1AA 3F8NA 4Y4RA 2RAEA 4ZDLA 1W0TA 2Y0MA 2Z5UA 4M9ZA 1Z77A 4ESBA 4RLFA 1Y56A 3E0JB 3DLAA 1VQ7I 3ABMH 2XC7A 3ASNH 1D5YA 2K5CA 2V1DA 4HPQA 1APLC 3CCYA 3BJ6A 1ZELA 3H36A 1KZHA 4RA2A 4LG0B 4L9JA 5K7FA 1DGWY 3IKVA 1MIJA 3TKYA 3BLYA 1FTTA 4ANJA 5B3SH 4BQNA 4D1QA 3D5RC 3HHHA 3TW7A 3O2PE 4BQOA 2JUCA 2ZFWA 1JHHA 2XAQA 2ISZA 1Z21A 1IXRC 1E3PA 3L2RA 1U0JA 1OCPA 1ZQ3P 4Y17A 4G9YA 3JRBA 5TJJA 5ICGA 4PJJA 1ZAOA 3AL0B 4PGHA 2KIMA 1IZ1A 2OF7A 4JOMA 1WFXA 2QSFX 3F21A 3CDLA 4KUMA 1VQLI 2ZMEB 3H9GA 4AWXB 2QZ8A 2FA5A 1YG2A 2NNNA 3JRFA 2A6TA 2DBBA 2RGVA 1K7AA 1WHUA 2E7WA 2PG4A 2Q2EA 1Z6RA 1VZ0A 5BNGA 1XGOA 3GW2A 4FHTA 3M3YJ 2A6HF 3KP5A 5FO5A 4RAFA 2FSWA 2VJ4A 3SHFA 1HLVA 2W57A 1U9OA 2GXGA 5FKKA 3RI4A 1YW9A 2EFOA 3CLQA 3WTSC 4KT6A 2F5CA 1ITYA 3BPXA 5CVVA 1E3OC 3L9FA 4JX5A 5E18F 2EA4A 1RRJA 3T5XA 1VQNI 1ETQA 2PJRB 2E35A 2MC4A 2KQRA 1F4KA 4C3JJ 1ZG1A 3FBNB 1ZLJA 2WAQA 5E3LA 2IT0A 2ZO4A 2GZWA 2BBYA 4G7ZF 4ENMA 4WXDA 2GM4A 3J7YJ 2B7EA 2ECBA 4DYCA 4DGWB 1X2NA 3JTHA 4RAZA 2OPTA 3J7ZI 3FBIB 2PI0A 2R7DA 4ESFA 3GLXA 1ZTRA 1FYLA 5DTDA 2PEXA 3C3WA 3FM5A 2V9KA 3ULQB 1XCBA 4L0ZB 3F0CA 4XMYA 2AXLA 1KU9A 3K7AJ 2E1MC 3H9QA 3HGGA 1DPUA 2BY0A 2E71A 1FJLA 2XAGA 2ZC2A 1T38A 3HOUJ 4LK1F 3IH3A 5EEHA 3C2GA 4AIHA 4HBLA 2CH0A 3CP2A 3I5UA 4MHGA 5H6RA 3S1RJ 2LDUA 4A3IJ 2JA5J 1ZN2A 3KP3A 3F3XA 2FD5A 3JRCA 3GTGJ 2R7TA 1WWXA 3ECHA 1FMVA 4RB0A 1N77A 2OCCH 1GLNA 2Z1DA 4CZCA 2XB0X 3LOCA 4HSRA 4FETA 3BZ6A 1S8NA 1IXCA 4QWQA 5ILSA 3L1PA 4EJWA 3E3VA 2E2HJ 4MTEA 5F04A 1GUUA 3NAUA 2IXSA 5DUIA 1HW1A 5DCFA 3RYPA 2DXIA 2ZSHB 2XGEA 3VYSB 3CMYA 3A03A 1I6HJ 4E7IA 1EH8A 1MBHA 5FKLA 2PQ8A 3K1MA 5E1WA 2M3AA 5LHGA 2DT7B 3N4MA 4NDLA 3C18A 2L7KA 3F23A 2K9SA 3ZMVA 1R00A 2EZLA 2ZXHA 4HDVA 5M5XJ 4WWCA 1H8AC 2NOJB 1BJAA 1OMIA 2IA0A 3JRDA 4Z6YA 1ORKA 2GOMA 1JXSA 5IT9K 5L3GA 2Z2SB 5KHDA 1PUFA 3AG2H 4E7ZA 2IGKA 4B47A 4XIDA 4MEYF 2BY1A 3ZMTA 2DO7A 3GXOA 4AVPA 3OOPA 4N9HA 3FXKA 2Q8KA 2CYYA 1R9TJ 3K4MA 3WU0A 1V5GA 3WTXC 4DBQA 2R3SA 2ME0A 4U0YA 3PFIA 4KFCA 1HKSA 3LA3A 3OYDA 4LITA 2MLGA 2BE5F 1FIAA 3GWZA 5GTIC 4XRSG 2HYGD 2F4IA 5LEJA 4L5EA 2YX4A 3VWBA 2LREA 4FASD 1LUJB 5LLQA 3BR3A 2DW4A 4IVNA 3OMYA 3I4NJ 3GFMA 3M8EA 3VSKA 1LFPA 2A5YB 3K2ZA 2ZCWA 1FLIA 1ETYA 3IUOA 4ZTJA 1ZG3A 3AL0C 4UUSA 1GV5A 1FNNA 3DPTA 1T6SA 4P55A 3K4BA 2XROA 2DK5A 1G8XA 3D1NI 2NOGA 4GRIA 2ZMEC 2STWA 1F9NA 2ZB9A 2OQGA 2DOEA 5M5YJ 3JR9A 1JT6A 2W82A 2EFNA 4C3IJ 3DTKA 3H0DA 3DCFA 3PL8A 3BZCA 3LAPA 2R7QA 4YEJA 3C7JA 3ABUA 2CQKA 4WXHA 4BYYA 2K9LA 2HXOA 3OR2C 1LKXA 1MMDA 2DAOA 3BWGA 1EA3A 4R1HA 3CCJI 1R5HA 3KP6A 3BR5A 2ECCA 5IPAA 3BC8A 2R5YB 4HLYA 3QU3A 5BPIA 1OR7A 2HYFA 4PCQA 4B1RA 5J1RA 3A0HC 1SAXA 3MVPA 4S04A 2DTZA 1D1BA 3ZXSA 3PO2J 1OPCA 2IA1A 2YSRA 3JAMZ 2MC3A 2KMUA 1L3LA 3B02A 2A3SA 2ISYA 3Q9SA 1DP7P 1GXPA 2R7OA 2VOPA 1J5YA 2HS5A 2XF7A 1DUXC 2RC4A 1X3WB 1EH7A 2CO5A 2YU3A 4I6ZA 4YRVA 3TP3A 3MKWB 4XR6A 1FSEA 2DYRH 5J6XA 2O0YA 1EJ9A 1HQCA 3V7SA 1X3ZB 2FJ1A 4I98B 3LFKA 3GTJJ 4A3DJ 4WXCA 2KL4A 1Z67A 2ME6A 5LFAA 2V79A 4KYWA 3CTAA 2X6WA 4XKWA 2G7HA 4N4OB 5HVQC 2I10A 3DEWA 2NYXA 1MD0A 2NVXJ 1X1AA 2MBFA 3K0LA 2PN6A 1W7PA 1M1EB 5E1XA 1MDMA 5IOYA 4A3EJ 2E1OA 4XRFA 2VUMJ 5DCMA 2IGNA 4EMSA 1W36D 3GTOJ 4ZYDA 3LSKA 2P0WA 2K9QA 2FMYA 4IRGA 2DLLA 3CCMI 4NQWB 2HFHA 4KITB 3LSRA 1NK3P 2CW8A 4YFKF 1LVKA 1JKQC 4A3MJ 2O6GE 1A35A 3CCVI 4B8XA 2LC2A 4PFPA 3I55I 3GX4X 4UHTA 3G73A 2CMPA 5JLWA 2K27A 4RAGA 1ETKA 3KP2A 5DEQA 3N05A 2DMQA 2DYSH 5EEGA 2Q2EB 5B1AH 1SD4A 1QBJA 4HLXA 4N4NB 5FRMA 2R7VA 2IS2A 2QKMB 1IDZA 2KT0A 2BHYA 3TO9A 4W1UA 1S72I 3DKWA 4ZC3A 1Z9CA 3Q0UA 3S17J 2X51A 4OU0A 2DMPA 1G3TA 3VYUB 3PNVA 3Q0VA 4KMFA 4LB6B 4AIDA 1FWZA 2QQBA 4M3EA 3I0TA 3ERED 4RBOA 2RNGA 4HX7A 4AD9A 2KRHA 2E5ZA 1Y1VJ 2DFEA 2MGQA 2WBMA 4A3JJ 1RKWA 2O8XA 1D8JA 1XN7A 1KYZA 1RZ4A 3K1NA 4R8HA 3TGNA 3U1KA 5FB2A 1Y0NA 2CFOA 2WWYA 3DEUA 5DDGA 1HC8A 5C4XJ 1ZGAA 3QPHA 2M30A 5KAIC 2LR8A 4V2FA 4W97A 2X6OA 2XKOA 2XPWA 3GYHX 2LKXA 1LNWA 1F36A 2P7VB 2L9VA 3BP8A 3OYCA 2BY2A 3UKGA 1IN7A 3KX2A 1I6XA 3V4GA 5DM7F 1W5TA 4DW6A 1FIPA 3A01A 4C3HJ 3BTCA 4E4HA 4IO9F 4M74A 3IWZA 3W6JB 3RPUD 1FP2A 3OYMA 1HA8A 2HQAA 2ZNYA 3QODA 3DKXA 3OYLA 2JPCA 2NXNB 4BJ6C 4PDKA 3C2HA 4XBFA 3RPQA 1RPWA 2D1VA 4CXFA 2HOSA 2VXDA 1EF4A 3JRIA 1I1GA 2LSOA 3OSFA 1QQIA 2P6SA 5CVJA 4Q4ZF 5ILVA 4Y13A 2HQRA 3P7NA 1GVDA 2P8TA 3H5RA 1Z7LA 1MBEA 2L4MA 1ODDA 5JVTA 1S5LC 2A69F 1VQ9I 4XM3A 4JX4A 4CZZA 4AU7A 4C9YA 3H3VK 1KYWA 3HUGA 1MMGA 3DWLE 2ELJA 3I59A 4HNTA 4RB2C 2QENA 3ABKH 2L02A 4NC7A 4GFBA 3T8RA 2DPUA 4GO1A 3RDIA 2XVCA 2CW7A 5J47A 3JRAA 2ZXIA 4BE1A 5HDNA 3M7GA 2VBXA 3M8FA 2HKOA 4U0VA 1HDPA 3OL4A 2HVSA 1BW5A 3I56I 4V2GA 2KISA 1EKEA 1S6LA 3Q5FA 1NTCA 3OYJA 5ICEA 2PMZN 1QZYA 3E6DA 1A6QA 3BG9A 2XAHA 3RYRA 1SFEA 1PUFB 4KDPA 4L5JA 2Q0OA 1XGMA 3JREA 2VPLA 1RNLA 1YJ9I 2JRMA 5HNFA 2G7UA 1FT9A 3E5QA 3OYNA 2H8RA 2EV6A 1Y8RB 2HEOA 1R1VA 4YELA 2XGDA 4P96A 3GVAA 4F3QA 3DV8A 5IYCJ 3GMEA 4IHWA 1ERDA 1R23A 2D1HA 5C44J 5J4YA 4HW0A 3MKZA 3I64A 1BI3A 4BE0A 4KT5C 5E3OA 1XD7A 1FOXA 3HOXJ 2EZHA 2EFPA 1KU7A 2BV6A 3FXRA 1REPC 1GXQA 1SD6A 3S2HJ 3PO3J 4NHJA 4IHVA 2EZIA 4QSHA 5ED4A 2M8EA 2IVMA 4KICA 1FYMA 4HF0A 5IY5H 4UUSB 4BHCA 4KIGA 4XRSA 5FD6A 5EYRA 4F91B 2L01A 2XAFA 3H3ZA 4EGZA 2NRAC 5HS7A 1YS6A 2F5DA 1R4NB 3WE2A 1V54H 4BXFA 3ABTA 1IAWA 3IHUA 1PVEA 4BBRJ 1TNTA 2QUFA 5F64A 4J00A 1XB4A 3ZMUA 2LLKA 1UCRA 4DYRA 5EGOA 1AHDP 2KP6A 3A1YA 2WB1A 3HOYJ 4A0YA 1FBSA 4BHBA 1K6OA 4OAYA 3RTRA 1IDYA 2IBDA 2JTVA 4CDGA 5LGNA 2E34A 4S0HB 2P81A 2RQQA 2L0KA 3KLOA 5FLMJ 1GHCA 3LSIA 2UUZA 1J59A 1FBQA 2X9DA 1Y1WJ 3I54A 3NWSA 1HF0A 4BY1J 5JVGF 3QPSA 3SZTA 4U7BA 3DEEA 2L9RA 3CQZJ 3ZQFA 1WJCA 3KCCA 3OYGA 2LKPA 4QPOA 2DDAA 2NS7A 2EIKH 1BOBA 1WJAA 2DFFA 3KP4A 3CUQC 2RV8A 5D5XB 1MMAA 2LF8A 4AM3A 3TP0A 3K4LA 2AS5F 2K4JA 3VPRA 4A2UA 2VQLA 3J7AO 4Y52J 2EPFA 3FMSA 4IKFA 3ZCOA 1YYVA 3ZP5A 3HHGA 2JPBA 4HV5A 4XLCA 3GFLA 4YG2F 1B8IA 1LE8B 1XSXA 4L5IA 3RQIA 1SMYF 4CCNA 1IV8A 2XF5A 2CGPA 1JE8A 2X48A 4XK4A 3TOAA 1Z91A 1FSHA 3BG3A 1ZLKA 1P92A 2UV1A 3M1EA 3WTTC 2EQRA 3RKXA 3HRTA 4IQJA 1X58A 5DCMB 1YIOA 2V7FA 1UFMA 2W48A 4DNCA 1MBFA 2CRGA 4AIKA 2ID3A 4B3AA 1ZG5A 3P9KA 1J0RA 2E36A 1TWGJ 1T08B 2FBHA 3HRUA 1BJZA 1IUYA 1MMNA 2QSHX 1YS7A 3FMQA 3FM3A 3M1CA 1TWFJ 3GZ5A 4CCMA 2WY8Q 3J81Z 1X1PA 5D5VB 1I50J 5E1ZB 5LGUA 4I09A 5D5WB 5IYDJ 5EEAA 4E6KG 1Q1VA 2OTLI 2A68F 2FOKA 2W84A 4IOCF 1ETVA 2XRLA 3IKTA 2KKOA 5J8CA 3BTJA 1TTYA 4M6VA 2V1NA 1DGRM 2X4HA 1FOKA 3RPUA 1YOVB 4EJTA 2CV0A 2P7CB 3AAFA 4I7HA 4RB3C 1A04A 4E7JA 1T8IA 1HXDA 5GADJ 1HBXG 2EB7A 1GDTA 3LSJA 1OISA 4M6XA 2IP2A 1HW2A 3OYHA 4DYQA 3ISPA 4GCVA 2R5ZA 3S8PA 1IV6A 3IAS2 5D4SA 4PJLA 3MFKA 2NVQJ 2MH2A 4OIRF 1RETA 1X4PA 4FTHA 4EM2A 1N78A 2O8KA 1W5SA 2DA3A 2CQNA 3NQOA 4UXNA 5DUKA 2NVUB 3QWLA 2H8WA 2VBWA 2YUSA 3GUDA 3ERMA 1U78A 2HQ5A 4IHSA 3R6SA 1SANA 4UB8C 4G8XA 4FX0A 3OS2A 2XKPA 5EDNA 3WTVC 3LL7A 2IW5A 3W6KB 2FX0A 1Z05A 2K3FA 5IP7J 2WAQN 4IXAA 5LRSA 3LQRA 2XB5A 3FXUA 2ELKA 1LB2A 1SMTA 3HZJA 4JK1X 3RSNA 1O3QA 3PUFA 5FKNA 4ZYEA 3CCSI 4XSZF 3RIRA 2LP0A 1OQYA 4NC6A 3A01B 3WU2C 4ZTFA 1PJRA 2L3DA 2L2OA 2QGUA 3CD6I 2M0MA 4BDZA 4CHUA 1R5GA 3E97A 4EGYA 2HNHA 5B5EC 1OKRA 2VC0A 2O5RA 3EPZA 3E7LA 3EUHA 4UUTA 2VE9A 1XS9A 2K40A 4HOBA 4RM2A 3S3MA 2DMTA 4XLPF 1H89C 4HX4A 2GXAA 1MNDA 3OIOA 3T8TA 4XL9A 1MZBA 1BI1A 3R0JA 1AKHB 2V9VA 3U21A 1NH3A 1UG2A 2W00A 1Y6IA 3ZRGA 2BW3B 4IX7A 3GFJA 3I59B 3QOPA 1K6YA 2FQ3A 1BBYA 3S2WA 2VT3A 3QRFF 3BROA 2VQGA 4UB6C 3T0YA 3FX3A 1X1DA 1PDNC 3JCUC 2DFHA 2VC1A 2CW0F 2VBYA 4MIMA 4BAYA 4J01A 3LSHA 2M45A 2TRTA 1LFUP 2HVQA 5F27A 4OAZA 4H0EA 2LOOA 2CU7A 4Q5SF 5B1BH 5HODA 2VOOA 1XGSA 2OTJI 2TCTA 3CCQI 1XX5A 2PMUA 3GTQJ 2F48A 1U6GA 4EV0A 2QA4I 1WQ2A 3SYTA 1S3JA 3G71I 5CLSA 2W85A 3MQ0A 2H27A 2TDXA 2DK8A 4O6JA 1J75A 1H9TA 2FUG2 2R7XA 3G1LA 2GAUA 3MEXA 1TZLA 2V26A 1FZPB 2HDWA 4BEHB 1LJ9A 2MD5A 5FFXA 3ABLH 2DQRA 2Y2ZA 5H6QA 4XLAA 2BZTA 3S32A 2V9PA 2OV7A 4HA8A 4M3GA 4WX9A 5DYMA 5CVRA 3S2DJ 3EETA 3LQQA 2LYCA 3FXOA 5GTHC 2R93J 3DP7A 3S1MJ 3PIPF 5EZHA 2BYVE 4HAMA 1OLTA 1OCOH 1YX5A 1VF9A 5LGTA 1O3RA 3GO5A 3CCEI 2QM3A 4Y15A 1G6NA 4CYCA 5HS9A 2MW8A 2HPIA 3REOA 4FX4A 1YRNA 1WH7A 3HSEA 9ANTA 2K85A 1FP1D 2DN0A 2L5QA 2W24A 4CSWA 2DI3A 1Y39A 2Y9YA 4U87A 4RLQA 2X6YA 2NVTJ 3V42A 3J7AY 1W1WE 1OYYA 1WGXA 3LAJA 2YR2A 1ZRFA 3KE2A 4UVAA 5M5WJ 3DU6A 5LRRA 4RGRA 3EYIA 4XLHA 2CS3A 5LBQA 5IT9Z 2DDBA 1IF1A 3IV5A 2KRCA 2L9NA 3ROUA 4M3DA 1YW7A 5EGOB 2VONA 2B63J 1R22A 3HKZA 2FNPA 2H94A 4C2UA 1J09A 2LTPA 2AQFA 2KLOA 3LSMA 3WG7H 1N75A 1XG1A 4CUGA 3EQLF 1RUNA 1DU0A 3A2KA 1RESA 4L0YB 5LHHA 3TDZC 3BQZA 4XQFA 3D0SA 4V19K 2MA3A 5E8IA 1T39A 2QBYA 1WJ5A 1FPQA 3OL3A 1NHAA 3LFUA 3SJMA 2EV5A 4CYDA 2HI3A 3LSGA 2GXBA 3H35A 5BMZA 1DDNA 3JTGA 1U5TA 4KN7X 5ILUA 2DFIA 2M2EA 4D7MA 2DQLA 1WVRA 3K4JA 3S14J 1G4DA 4MQ9F 2HDCA 3GTPJ 3HG9A 3WGIA 4JYKA 3MCZA 5C4JJ 2FOWA 1ETWA 4ITVA 4LFUA 3L2UA 4RAYA 4HQMA 4LJZF 2H09A 3OS1A 2BGCA 1B8IB 1WSUA 5K1YA 4CA0A 3DXJF 3E5UA 2K86A 4BS9A 3KLNA 5H2FC 1CF7B 5FROA 4A3BJ 3QP5A 1KU2A 2E60A 3M07A 1Y8QB 3BDDA 3OSGA 4E70A 3HOWJ 3IRQA 2LH9A 1P4AA 4AYBN 5TGTA 1ACIA 2XIGA 2R7ZJ 3BJAA 1FYKA 4Y3OA 3AG1H 1D8KA 2DOAA 2JZYA 2JSCA 2VKEA 4BKXA 1MW7A 2E7XA 1EH6A 3IH4A 2GA1A 4LIUA 1WH5A 1K79A 1YJNI 3IH2A 5FJ8J 4ZYGA 1I27A 1IUFA 2DT6A 2DCEA 4LLGF 2I5UA 5HDKA 1XPXA 1HOMA 3CJQB 3S3OA 4PFOA 4G6DA 3S1NJ 4X1EA 1L0OC 1R1TA 1TBXA 1ZARA 5F0FA 1IRXA 5EG0A 1LEAA 1T0FC 4BJ5C 2MYSA 5L3FA 2IGMA 4YIFA 1CGPA 2MG4A 3CZ6A 1MKMA 3M9AA 3GCMA 2R4GA 1YQAA 2DOFA 1ZGWA 1NK2P 2EJRA 2COMA 1VFCA 3TO6A 2EIJH 1BN5A 4IOAF 3SZGA 5ICCA 1UHSA 4B09A 1ZRDA 2IS6A 3EUKL 3PSIA 4IEJA 1I1SA 4M9SA 1TWHJ 4X0GA 4QIWN 3DBLB 5E17F 4B44A 4HF2A 3CP8A 2A5WA 2PMHA 3OIPA 2X1DA 4L9VA 3OYKA 4MLOA 5J8FA 2W25A 1D0YA 1XGNA 1Z3XA 2X1EA 4IF4A 3CF5F 4HRIA 1QRYA 3B6AA 4ENNA 1SVMA 3WGGA 4RM3A 2A61A 4D5FA 2EH3A 2EA2A 1G59A 2O03A 3DPUA 3ZMSA 2K7LA 2CUFA 3OYEA 4UNOA 3SQNA 5JHUA 1ENHA 2JK3A 3VYRB 3PSFA 1RC9A 2KJBA 1MJBA 3L2QA 1MSFC 3MWMA 3SZPA 3SFIA 1IRZA 1NG7A 2NVYJ 2R92J 3X2QH 4WCGA 2MABA 4EJUA 2OAZA 2E5NA 4XSXF 4LG0A 5B66C 4M73A 2KPMA 4O5VA 4MFEA 2VIXA 3BG7A 2B9SA 4E7HA 1W0UA 1BI2A 5D6FA 1TW2A 1U3EM 3TL4X 3RKWA 2GIZA 2M0CA 1O57A 3KYDB 3PM1A 2RQPA 4CCOA 2ELHA 3F8CA 5BPDA 2X6XA 2FF4A 3HIFA 5KK1A 1T33A 3QYBA 2L54A 1W5CC 1YW8A 3ZOBA 1TQPA 1IJWC 2Y0SA 3F6VA 4L9TA 1UB9A 3I58A 4HQEA 1OCCH 5E20A 4GXOA 2M34A 1K4TA 3OOUA 2BOLA 5JLXA 2KIUA 2R7SA 3I9V2 3SXYA 4XLNF 1TNSA 2JQ7A 2CJJA 1BIBA 1IW7F 5GAGJ 2FQ4A 1G2HA 2DJIA 4IL6C 1MJ9A 1HCRA 3H5AA 3WE3A 3WG9A 2F5EA 2A05A 1VI0A 2EK5A 5CQEA 3MKLA 1XSVA 3AKZA 2D5VA 1WI3A 4L18B 3O8GA 4CICA 4NNJA 3SEZA 3Q3SA 3B73A 4KA4A 2LKSA 3RCOA 2XGCA 2UZKA 2KJCA 1FOWA 1O7LA 4I76A 2M87A 1IRFA 2CSOA 3WODF 1O3SA 3WU1B 3CLOA 3ZPLA 1JT0A 1AOYA 1S9HA 2OZUA 3FKJA 3BTIA 3D5LA 2QQ9A 1C0WA 1LVAA 1VQPI 3UNGC 4E7KA 1D5VA 4MQVA 1UHMA 1RKTA 3FWEA 2HZDA 1P6RA 4I0AA 3K10A 4Z2YA 2HZTA 2E19A 2D2WA 4ETSA 3I3LA 3HOSA 4A3LJ 1V55H 3Q0WA 5M3FJ 2JRTA 1X19A 3W3CA 1QPIA 4A3GJ 3GTKJ 2NNYA 2AXTC 2F2EA 3BCAA 2O9LA 2H6BA 4DOZA 3J80K 2LY1A 2XPUA 1Z0XA 4OMZA 1B1BA 1B4AA 1BIAA 5J4VA 2DA7A 3K6GA 3QU6A 3PIOF 3HOTA 5IT3A 2FBIA 3S3NA 1R36A 3WGHA 5K5QA 4XICA 2M4GA 2XGXA 3HPGA 1T56A 1O3TA 3EDPA 4QPQA 1JTXA 3J80Z 3BT9A 2R0QC 5HOOA 4C30A 1JGGA 3TQNA 4ENKA 5HLTA 2YS9A 3ZN1A 2HWVA 3I71A 5KNLA 2ESHA 3QYFA 4B4CA 4MO7A 2OUMA 4Q47A 1VQKI 3VFZA 4PJMA 2IPQX 2BXYA 5E3NA 2I8DA 1UMQA 2Y9ZA 3IP4B 5F08A 2ID6A 3V8JA 3ZQHA 2O61A 3HTSB 4EJVA 2W1OA 3K70C 2HOAA 2F5FA 2R7UA 1KGSA 1E17A 2VKHA 5CQGA 4CCLA 3HJEA 1FMWA 2ESNA 2V1XA 1U5TB 3FKIJ 2ZSIB 4FE7A 2MH9A 1HKQA 3H5NA 4JQFA 4PSWA 1BC8C 4XORA 1K61A 1QA6A 2FMLA 1O7FA 2IS1A 1FC3A 4GGGA 2L7MP 4M71A 1K78A 4AUXA 3IL2A 2ZKZA 1VQ6I 1FEXA 3CMAI 5J3LA 4BNCA 4EM0B 1A31A 4IHYA 5D6EA 3HOZJ 5DM6F 2J5PA 4A6DA 4IHXA 3ECOA 3FDYA 4RMNA 3IRRA 5HNHA 2R7WA 3PNYA 4G12A 2EZKA 3FZVA 1DPRA 2WV0A 2VODA 3I4PA 3NWTA 5EF6A 2ICWG 4DZJA 4OMYA 2ZJRF 3HPHA 1LFBA 2E1MB 2ZJ2A 3ONQA 3JSPA 2EFQA 3CJRB 2XSDC 2KRFA 3TW6A 5FLVA 1AWCA 3CO6C 1AA7A 1SD5A 4BACA 2AQEA 4RB1A 1MNMC 4B43A 3L2VA 1TQIA 1WPKA 2WAFA 1TT5B 2W7NA 2Y69H 3QQAA 3GTMJ 4JX6A 4C2MJ 4ZYHA 1E3HA 2V6EA 4I2OA 3AFHA 2V6CA 5A2QK 1LPQA 3OYIA 6PAXA 4DIQA 2VQCA 1IN4A 1POGA 5BS6A 3W6VA 2JA2A 3WHCA 2DA2A 3VYTB 1W7PB 4CH7A 1MDMB 5EG0B 2DT5A 2X0LA 2VKDA 2Y31A 3W2AA 4A12A 2O7OA 2STTA 2E2IJ 3CDHA 3MKYB 4XRMA 1E0EA 1JUPA 4AC0A 1ZR4A 4F7ZA 1JKRC 3CESA 4KIFA 2H1KA 4LLNA 2KFDA 1JKPC 4LD5A 2V1UA 1JUSA 3E5XA 4G6TB 2BVMA 1RR8C 3U1DA 1SFOJ 2IAIA 2QEXI 1YI2I 3BZKA 3LA2A 5L3CA 2ADUA 3KZIC 3W2VA 1I3AA 1U8RA 3L09A 4LOCA 5J1YA 2LFBA 1ONVA 5F0CA 2VI6A 3V7RA 3CMEI 3HM5A 2LVSA 2VXZA 5FRNA 1ULYA 2VT2A 3SFZA 1U9NA 1R5ID 4EVIA 4BXXJ 1PUEE 2LNBA 2LF7A 1DU6A 5CPRB 4B3XA 2PX9A 3FXLA 2VLAA
chains in the Genus database with same CATH topology
4ZZDA 4RGSA 1R1UA 5L3DA 5HLGA 4G94A 2FBKA 1WRJA 1J2XA 1Z6TA 3JW4A 2HR3A 2QVOA 4NQWA 2IRFG 3NRVA 1LDDA 1P4XA 2OQRA 4RGUA 1VTNC 3F8BA 1Y0UA 4CO8A 3KZZA 3KFWX 3KEOA 2NS0A 4CGZA 4M6YA 2UWMA 1QZZA 3P9CA 1SD7A 1ZYRF 2YX7A 3CJNA 2CG4A 4K2EA 3ELKA 4IPAA 4P9UA 3K69A 1H9GA 4TV7A 2Y48A 1U5TC 4YIIA 2Z33A 1WI9A 4N9IA 2K4BA 1W7PD 4P9FA 4A6EA 4KMUX 4EJOA 2Y75A 1X3UA 2PBIA 3FXQA 4BQAA 1XMAA 2FRHA 5FFZA 1J7KA 2CFXA 2RNJA 1KU3A 5K5RA 2GWRA 3C1DA 3K9TA 1R58A 4U88A 2HGCA 2XASA 3CUQA 3E6BA 2P5KA 3BY6A 4P5OA 5AIQA 1W4MA 3DQVC 3V8KA 5BQTA 2P6TA 2JT1A 2EV0A 1YLFA 1U2WA 5FLXK 3HRMA 4IRHA 3WTYC 4UV8A 1ON2A 1QO0D 3P9IA 4A0ZA 3KETA 5LHIA 1GVJA 2P5LC 4KN4X 3QAHA 4IJAA 5FLXZ 3G3ZA 2D45A 3BPVA 1XSDA 4HYEA 5D8LB 1FY7A 1V4RA 2E1CA 3GFIA 1B9NA 1STZA 4MNUA 3E6MA 2MLKA 1B6AA 3F72A 3F22A 1XDSA 3L2CA 3V7CA 5CJ9A 3L7WA 5D5UB 4HZFA 2ETHA 2K02A 2FEZA 5JR3A 2HTJA 4PGGA 3WTZA 4YFXF 1IN6A 5ICFA 3MAJA 2NAZA 3HTUA 1HKTA 1XMKA 3RJPA 1G3SA 1K78B 3DF8A 2VE8A 2OZ6A 3GF2A 3QPTA 4LGWA 4LK0F 3O3KA 2A07F 1ZHFA 5L3BA 4IHTA 3ML6A 1KQ0A 4WF2A 4HX8A 3R61A 4DQ2A 2O3FA 5HLIA 1Z7UA 4LMYA 1ZREA 4KNYA 2B0LA 3VEPA 4G7HF 4S05A 2QQAA 4FT8A 4UUVA 3O6BB 1YTYA 4A5MA 2FXAA 3QP6A 4OIOF 2C6YA 1FX7A 3DPLC 3JAMK 1UHWA 3PQKA 2UXXA 1LEBA 1IRGA 2Z99A 4M9XA 5AONA 5DD4A 4HF1A 2GQQA 1RI7A 3HRSA 3HSFA 4ASNA 5HDGA 1Q1HA 3MZYA 3F8MA 1Z1DA 3BOQA 1OYIA 2P4WA 3F6OA 3IWFA 5DD8A 2Z9OA 1I5ZA 4LB5A 4GYGA 1F5TA 4HDUA 1YFHA 4D0PA 3L00A 2A6EF 1EV7A 3CUOA 2FE3A 4EQQA 3LWFA 1YO5C 2R7FA 1KA8A 5BOXA 2M1BA 1T2KA 4NB5A 3GEZA 4WK8F 4I01A 1BM9A 3JSOA 1BOAA 1PP8F 1KQ8A 5CVIA 2XRNA 1LDJA 3V8LA 4I0BA 3VB2A 2PFBA 4U0WA 1S29A 1XDUA 1ON1A 4GYIA 2QWWA 1P4WA 3TDUC 3RKYA 1LDKB 2BEOA 4BH9A 1H0MA 1B59A 4UV9A 1V3FA 4R79A 4HV6A 2FNAA 4EM1A 5FGMA 5D4RA 2ZMEA 3H92A 3F8FA 1FBUA 4U7DA 1D3YA 1TLHB 2XUBA 1P2FA 1USSA 2VN2A 2WTEA 1R7JA 3CUQB 1ZRCA 1XCVA 2GIVA 2Z3YA 1F1ZA 4UVCA 5CVUA 3OV8A 3KZYA 2OA4A 1JHFA 4Q48A 2ZXJA 4N0BA 2DTRA 3COAC 1J9IA 4BHPA 1RIOH 1G3YA 5L3EA 3KP7A 2HOEA 2OU2A 4YFNF 5H20A 3E6CC 4M72A 1OYWA 1USTA 2XAJA 3U2RA 2QYOA 2M5WA 5KVRA 4ESJA 3VODA 2ZBKA 4MTDA 5DV5A 3LSTA 4LLLA 1MJAA 4ZH4F 4OOIA 1S7OA 2HKXA 3KEQA 3R4KA 3IC7A 2GA2A 1T0FA 4RGXA 1G3WA 4O3MA 5E8GA 2XHKA 1PP7U 3ZN0A 5F6FA 3GZ6A 1ZGJA 1ZH5A 3Q9VA 4RS8A 2DU9A 2G9WA 2H6CA 2YPRA 4OIQF 2FU4A 1T98A 3K1PA 5AIPA 2EWNA 3PQJA 5TRDA 3T1BA 4AIJA 5JFRA 3LA7A 4ON0A 1IN8A 4PZJA 3HSRA 3N97A 4MEXF 2WC2A 2P5VA 3MZHA 2KIFA 1BC7C 3NEUA 2QBYB 3TO7A 1HSTA 2E1NA 1QGPA 3CO7C 3R0AA 3FMRA 2PLYA 2HQNA 2EFWA 2QLZA 3ZMZA 2PJPA 5FD5A 5HS8A 2ZNZA 1IXSB 3DFGA 4BXUA 1TW3A 4A5NA 1E2XA 4MGRA 5F1RA 1JGSA 4ZZLA 4OIPF 3U9GA 3WTUC 2VBZA 2L4AA 3R60A 1TQMA 3HYIA 1B9MA 3I53A 1LQ1A 2UXNA 1SFXA 3ZQ7A 4KIBA 1MGTA 3VOEA 2XV4S 2RKHA 1SFUA 4QLCU 1HW5A 1QNTA 4G7OF 4JBAA 3TOBA 1BI0A 1S7AA 2HTSA 5JI6A 3H3UA 2J5OA 5ERIA 4L9NA 3ZMDA 4IRIA 2OD5A 2DPDA 5D8KB 1KQ9A 2RDPA 4I02A 2RN7A 5A2QZ 1QPMA 1IN5A 2RVCA 3EYYA 1CF7A 2ACJA 5HLHA 3FHZA 2CWEA 3WTWC 4OINF 5K5OA 3J81K 2OBPA 4UVBA 5LEKA 3FF5A 4A0XA 4G6QA 1HSJA 2IA2A 1RUOA 4ENJA 2IJLA 3BJOA 5CYVA 1WKMA 3F8NA 2Y0MA 2Z5UA 4M9ZA 4ESBA 2V1DA 3BJ6A 4LG0B 4L9JA 3IKVA 3TKYA 3HHHA 3O2PE 2ZFWA 1JHHA 2XAQA 2ISZA 1IXRC 4Y17A 4G9YA 5TJJA 5ICGA 1ZAOA 4PGHA 2KIMA 1IZ1A 3F21A 4KUMA 2ZMEB 4AWXB 2QZ8A 2FA5A 1YG2A 2NNNA 2DBBA 1K7AA 2RGVA 2E7WA 2PG4A 2Q2EA 1Z6RA 1XGOA 3GW2A 4FHTA 2A6HF 3KP5A 5FO5A 3SHFA 2FSWA 2W57A 2GXGA 3RI4A 1YW9A 2EFOA 3WTSC 2F5CA 3BPXA 5CVVA 3L9FA 5E18F 2EA4A 3T5XA 1F4KA 1ZG1A 1ZLJA 2IT0A 2ZO4A 2GZWA 2BBYA 4G7ZF 4ENMA 4WXDA 3JTHA 4RAZA 2PI0A 2R7DA 4ESFA 3GLXA 1FYLA 2PEXA 3C3WA 3FM5A 3ULQB 1XCBA 4L0ZB 2AXLA 1KU9A 1DPUA 2XAGA 1T38A 4LK1F 5EEHA 4AIHA 4HBLA 3I5UA 4MHGA 5H6RA 2LDUA 1ZN2A 3KP3A 3F3XA 1WWXA 3ECHA 4RB0A 3BZ6A 1S8NA 1IXCA 4QWQA 5ILSA 4EJWA 3E3VA 4MTEA 5DUIA 1HW1A 5DCFA 3RYPA 1EH8A 2PQ8A 3K1MA 5E1WA 5LHGA 3N4MA 3C18A 3F23A 3ZMVA 1R00A 4HDVA 4WWCA 1BJAA 1OMIA 2IA0A 1JXSA 5IT9K 5L3GA 4MEYF 3ZMTA 2DO7A 3GXOA 4AVPA 3OOPA 4N9HA 2Q8KA 2CYYA 3WU0A 3WTXC 2R3SA 4U0YA 3PFIA 4KFCA 1HKSA 3LA3A 2MLGA 2BE5F 3GWZA 2HYGD 5LEJA 2YX4A 5LLQA 2DW4A 4IVNA 3GFMA 3M8EA 2A5YB 3K2ZA 2ZCWA 1FLIA 1ZG3A 1FNNA 3DPTA 1T6SA 4P55A 2XROA 2DK5A 2STWA 1F9NA 2OQGA 2EFNA 3LAPA 3C7JA 3ABUA 2CQKA 4WXHA 4BYYA 3BWGA 2DAOA 4R1HA 1R5HA 3KP6A 4HLYA 3QU3A 5BPIA 1OR7A 2HYFA 4PCQA 1SAXA 4S04A 1OPCA 2IA1A 2YSRA 3JAMZ 2MC3A 1L3LA 3B02A 2A3SA 2ISYA 3Q9SA 1DP7P 1GXPA 2VOPA 1J5YA 2HS5A 1DUXC 2RC4A 1EH7A 2CO5A 2YU3A 1FSEA 5J6XA 2O0YA 1HQCA 3V7SA 4I98B 3LFKA 4WXCA 2V79A 4KYWA 3CTAA 2G7HA 5HVQC 2NYXA 1MD0A 2MBFA 3K0LA 2PN6A 1W7PA 5E1XA 1MDMA 4XRFA 5DCMA 4EMSA 4ZYDA 2FMYA 4IRGA 2DLLA 2HFHA 4YFKF 2O6GE 4B8XA 3GX4X 4UHTA 3G73A 2K27A 3KP2A 5DEQA 5EEGA 1SD4A 1QBJA 4HLXA 3TO9A 3DKWA 1Z9CA 4OU0A 1G3TA 4KMFA 4LB6B 1FWZA 2QQBA 3I0TA 3ERED 4HX7A 4AD9A 2O8XA 1D8JA 1XN7A 1KYZA 1RZ4A 3K1NA 4R8HA 3TGNA 5FB2A 2WWYA 3DEUA 5DDGA 1ZGAA 3QPHA 2M30A 2XKOA 3GYHX 1LNWA 2P7VB 3BP8A 1IN7A 1I6XA 3V4GA 1W5TA 4M74A 3IWZA 3W6JB 1FP2A 2ZNYA 2JPCA 4PDKA 4XBFA 3RPQA 2D1VA 4CXFA 1I1GA 2LSOA 1QQIA 2P6SA 5CVJA 4Q4ZF 5ILVA 4Y13A 2HQRA 3P7NA 2P8TA 2L4MA 1ODDA 5JVTA 2A69F 4CZZA 1KYWA 3HUGA 3I59A 4RB2C 2QENA 2L02A 3T8RA 2DPUA 4GO1A 3RDIA 2XVCA 5HDNA 3M7GA 2VBXA 3M8FA 2HKOA 4U0VA 1S6LA 3Q5FA 5ICEA 1QZYA 3E6DA 2XAHA 3RYRA 1SFEA 4KDPA 4L5JA 2Q0OA 1XGMA 1RNLA 2G7UA 1FT9A 3E5QA 2EV6A 2HEOA 1R1VA 4P96A 3GVAA 3DV8A 1R23A 2D1HA 4HW0A 3I64A 1BI3A 4KT5C 1XD7A 2EFPA 1KU7A 2BV6A 3FXRA 1REPC 1GXQA 1SD6A 4NHJA 5ED4A 2M8EA 2IVMA 4KICA 1FYMA 4HF0A 4BHCA 4KIGA 5FD6A 2L01A 2XAFA 3H3ZA 4EGZA 2NRAC 5HS7A 1YS6A 2F5DA 3WE2A 3ABTA 1IAWA 3IHUA 1TNTA 2QUFA 5F64A 1XB4A 3ZMUA 1UCRA 4A0YA 1FBSA 4BHBA 1K6OA 3RTRA 2JTVA 4CDGA 5LGNA 3KLOA 1GHCA 1J59A 1FBQA 3I54A 3SZTA 4U7BA 3KCCA 2LKPA 3KP4A 3CUQC 2RV8A 5D5XB 2LF8A 2AS5F 2K4JA 4A2UA 3J7AO 3FMSA 1YYVA 3ZP5A 3HHGA 2JPBA 4HV5A 3GFLA 4YG2F 1XSXA 4L5IA 1SMYF 2CGPA 1JE8A 1FSHA 3TOAA 1Z91A 1ZLKA 1P92A 3M1EA 3WTTC 3RKXA 3HRTA 5DCMB 1YIOA 1UFMA 4DNCA 4AIKA 1ZG5A 3P9KA 1J0RA 2FBHA 3HRUA 1IUYA 1YS7A 3FMQA 3FM3A 3GZ5A 3J81Z 5D5VB 5E1ZB 5LGUA 4I09A 5D5WB 2A68F 2FOKA 2W84A 3IKTA 2KKOA 5J8CA 1TTYA 1FOKA 2X4HA 3RPUA 4EJTA 2P7CB 3AAFA 4I7HA 4RB3C 1A04A 1HXDA 1HBXG 2EB7A 4M6XA 2IP2A 1HW2A 3ISPA 4GCVA 5D4SA 3MFKA 2MH2A 4OIRF 4EM2A 1W5SA 4UXNA 3NQOA 5DUKA 2VBWA 3GUDA 1U78A 4IHSA 3R6SA 4G8XA 4FX0A 2XKPA 3WTVC 2IW5A 3W6KB 1Z05A 4IXAA 5LRSA 3LQRA 3FXUA 1LB2A 1SMTA 4JK1X 1O3QA 4ZYEA 4XSZF 3RIRA 2L3DA 4CHUA 1R5GA 3E97A 4EGYA 1OKRA 2VC0A 3EUHA 2VE9A 4HOBA 4XLPF 4HX4A 3T8TA 1MZBA 1BI1A 3R0JA 2V9VA 3GFJA 3I59B 3QOPA 2FQ3A 1BBYA 3S2WA 2VT3A 3QRFF 3BROA 3T0YA 3FX3A 1PDNC 2VC1A 2CW0F 2VBYA 4BAYA 2M45A 4H0EA 4Q5SF 2VOOA 1XGSA 2PMUA 4EV0A 1U6GA 1WQ2A 1S3JA 5CLSA 2W85A 3MQ0A 2H27A 2TDXA 2DK8A 4O6JA 1J75A 1H9TA 2GAUA 3MEXA 1FZPB 1LJ9A 2MD5A 5FFXA 2DQRA 5H6QA 4HA8A 4WX9A 5DYMA 5CVRA 3EETA 3LQQA 3DP7A 2BYVE 4HAMA 5LGTA 1O3RA 3GO5A 2QM3A 4Y15A 1G6NA 5HS9A 4FX4A 3REOA 3HSEA 1FP1D 2W24A 2DI3A 1OYYA 3LAJA 2YR2A 1ZRFA 3KE2A 4UVAA 5LRRA 4RGRA 3EYIA 5LBQA 5IT9Z 1IF1A 3ROUA 1YW7A 2VONA 1R22A 2FNPA 2H94A 3EQLF 1RUNA 4L0YB 5LHHA 3TDZC 3D0SA 2MA3A 5E8IA 1T39A 2QBYA 1FPQA 1NHAA 2EV5A 4CYDA 2GXBA 5BMZA 1DDNA 3JTGA 1U5TA 4KN7X 5ILUA 2DFIA 2DQLA 1G4DA 4MQ9F 2HDCA 3WGIA 3MCZA 4LFUA 4RAYA 4HQMA 4LJZF 2H09A 2BGCA 1WSUA 5K1YA 3DXJF 3E5UA 2K86A 3KLNA 1CF7B 3QP5A 1KU2A 3BDDA 4E70A 3IRQA 1P4AA 2XIGA 3BJAA 1FYKA 1D8KA 2JZYA 2JSCA 2E7XA 1EH6A 2GA1A 1K79A 4ZYGA 1I27A 4LLGF 5HDKA 4G6DA 1L0OC 1R1TA 1TBXA 1ZARA 1LEAA 5L3FA 4YIFA 1CGPA 1MKMA 3M9AA 1YQAA 2EJRA 2COMA 3TO6A 1BN5A 5ICCA 1ZRDA 4B09A 1I1SA 4M9SA 5E17F 4HF2A 4L9VA 2PMHA 5J8FA 1XGNA 2W25A 4IF4A 4ENNA 3WGGA 2A61A 2EA2A 2O03A 3ZMSA 2K7LA 4UNOA 3SQNA 5JHUA 2KJBA 1MJBA 3MWMA 3SZPA 4WCGA 4EJUA 2OAZA 4XSXF 4LG0A 4M73A 4O5VA 1BI2A 5D6FA 1TW2A 1U3EM 3RKWA 1O57A 2RQPA 2ELHA 3F8CA 5BPDA 2FF4A 3HIFA 5KK1A 2L54A 1YW8A 1TQPA 3F6VA 4L9TA 1UB9A 3I58A 4HQEA 5E20A 4GXOA 2KIUA 3SXYA 4XLNF 1TNSA 1BIBA 1IW7F 1MJ9A 3WE3A 3WG9A 2F5EA 2EK5A 1XSVA 4L18B 4CICA 3B73A 4KA4A 2UZKA 2KJCA 1O7LA 2M87A 1IRFA 2CSOA 3WODF 1O3SA 3WU1B 3CLOA 3ZPLA 1AOYA 2OZUA 3D5LA 2QQ9A 1C0WA 1LVAA 1D5VA 4MQVA 1UHMA 3FWEA 1P6RA 4I0AA 4Z2YA 2HZTA 2D2WA 4ETSA 3HOSA 2JRTA 2NNYA 2F2EA 2H6BA 3J80K 4OMZA 1B1BA 1B4AA 1BIAA 3QU6A 3HOTA 5IT3A 2FBIA 1R36A 3WGHA 5K5QA 2XGXA 1O3TA 3EDPA 3J80Z 5HOOA 3TQNA 4ENKA 3ZN1A 2HWVA 3I71A 2ESHA 4Q47A 3VFZA 2IPQX 3V8JA 2O61A 3HTSB 4EJVA 2F5FA 1KGSA 1E17A 2ESNA 2V1XA 1U5TB 2MH9A 1HKQA 4JQFA 1BC8C 2FMLA 1O7FA 1FC3A 4GGGA 4M71A 1K78A 3IL2A 2ZKZA 4BNCA 4EM0B 5D6EA 2J5PA 4A6DA 3ECOA 3IRRA 3FZVA 1DPRA 2WV0A 2VODA 3I4PA 4OMYA 2ZJ2A 3JSPA 2EFQA 2KRFA 1AWCA 3CO6C 1SD5A 4RB1A 1TQIA 4ZYHA 4I2OA 2V6CA 5A2QK 6PAXA 1IN4A 5BS6A 1W7PB 1MDMB 2DT5A 2X0LA 4A12A 2STTA 3CDHA 4F7ZA 4LLNA 4KIFA 4LD5A 2V1UA 3E5XA 3U1DA 3LA2A 5L3CA 2ADUA 1U8RA 3L09A 1ONVA 3V7RA 2VXZA 1ULYA 2VT2A 3SFZA 4EVIA 1PUEE 2LNBA 2LF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZZD A;  4RGS A;  1R1U A;  5L3D A;  5HLG A;  4G94 A;  2FBK A;  1WRJ A;  1J2X A;  1Z6T A;  3JW4 A;  2HR3 A;  2QVO A;  4NQW A;  2IRF G;  3NRV A;  1LDD A;  1P4X A;  2OQR A;  4RGU A;  1VTN C;  3F8B A;  1Y0U A;  4CO8 A;  3KZZ A;  3KFW X;  3KEO A;  2NS0 A;  4CGZ A;  4M6Y A;  2UWM A;  1QZZ A;  3P9C A;  1SD7 A;  1ZYR F;  2YX7 A;  3CJN A;  2CG4 A;  4K2E A;  3ELK A;  4IPA A;  4P9U A;  3K69 A;  1H9G A;  4TV7 A;  2Y48 A;  1U5T C;  4YII A;  2Z33 A;  1WI9 A;  4N9I A;  2K4B A;  1W7P D;  4P9F A;  4A6E A;  4KMU X;  4EJO A;  2Y75 A;  1X3U A;  2PBI A;  3FXQ A;  4BQA A;  1XMA A;  2FRH A;  5FFZ A;  1J7K A;  2CFX A;  2RNJ A;  1KU3 A;  5K5R A;  2GWR A;  3C1D A;  3K9T A;  1R58 A;  4U88 A;  2HGC A;  2XAS A;  3CUQ A;  3E6B A;  2P5K A;  3BY6 A;  4P5O A;  5AIQ A;  1W4M A;  3DQV C;  3V8K A;  5BQT A;  2P6T A;  2JT1 A;  2EV0 A;  1YLF A;  1U2W A;  5FLX K;  3HRM A;  4IRH A;  3WTY C;  4UV8 A;  1ON2 A;  1QO0 D;  3P9I A;  4A0Z A;  3KET A;  5LHI A;  1GVJ A;  2P5L C;  4KN4 X;  3QAH A;  4IJA A;  5FLX Z;  3G3Z A;  2D45 A;  3BPV A;  1XSD A;  4HYE A;  5D8L B;  1FY7 A;  1V4R A;  2E1C A;  3GFI A;  1B9N A;  1STZ A;  4MNU A;  3E6M A;  2MLK A;  1B6A A;  3F72 A;  3F22 A;  1XDS A;  3L2C A;  3V7C A;  5CJ9 A;  3L7W A;  5D5U B;  4HZF A;  2ETH A;  2K02 A;  2FEZ A;  5JR3 A;  2HTJ A;  4PGG A;  3WTZ A;  4YFX F;  1IN6 A;  5ICF A;  3MAJ A;  2NAZ A;  3HTU A;  1HKT A;  1XMK A;  3RJP A;  1G3S A;  1K78 B;  3DF8 A;  2VE8 A;  2OZ6 A;  3GF2 A;  3QPT A;  4LGW A;  4LK0 F;  3O3K A;  2A07 F;  1ZHF A;  5L3B A;  4IHT A;  3ML6 A;  1KQ0 A;  4WF2 A;  4HX8 A;  3R61 A;  4DQ2 A;  2O3F A;  5HLI A;  1Z7U A;  4LMY A;  1ZRE A;  4KNY A;  2B0L A;  3VEP A;  4G7H F;  4S05 A;  2QQA A;  4FT8 A;  4UUV A;  3O6B B;  1YTY A;  4A5M A;  2FXA A;  3QP6 A;  4OIO F;  2C6Y A;  1FX7 A;  3DPL C;  3JAM K;  1UHW A;  3PQK A;  2UXX A;  1LEB A;  1IRG A;  2Z99 A;  4M9X A;  5AON A;  5DD4 A;  4HF1 A;  2GQQ A;  1RI7 A;  3HRS A;  3HSF A;  4ASN A;  5HDG A;  1Q1H A;  3MZY A;  3F8M A;  1Z1D A;  3BOQ A;  1OYI A;  2P4W A;  3F6O A;  3IWF A;  5DD8 A;  2Z9O A;  1I5Z A;  4LB5 A;  4GYG A;  1F5T A;  4HDU A;  1YFH A;  4D0P A;  3L00 A;  2A6E F;  1EV7 A;  3CUO A;  2FE3 A;  4EQQ A;  3LWF A;  1YO5 C;  2R7F A;  1KA8 A;  5BOX A;  2M1B A;  1T2K A;  4NB5 A;  3GEZ A;  4WK8 F;  4I01 A;  1BM9 A;  3JSO A;  1BOA A;  1PP8 F;  1KQ8 A;  5CVI A;  2XRN A;  1LDJ A;  3V8L A;  4I0B A;  3VB2 A;  2PFB A;  4U0W A;  1S29 A;  1XDU A;  1ON1 A;  4GYI A;  2QWW A;  1P4W A;  3TDU C;  3RKY A;  1LDK B;  2BEO A;  4BH9 A;  1H0M A;  1B59 A;  4UV9 A;  1V3F A;  4R79 A;  4HV6 A;  2FNA A;  4EM1 A;  5FGM A;  5D4R A;  2ZME A;  3H92 A;  3F8F A;  1FBU A;  4U7D A;  1D3Y A;  1TLH B;  2XUB A;  1P2F A;  1USS A;  2VN2 A;  2WTE A;  1R7J A;  3CUQ B;  1ZRC A;  1XCV A;  2GIV A;  2Z3Y A;  1F1Z A;  4UVC A;  5CVU A;  3OV8 A;  3KZY A;  2OA4 A;  1JHF A;  4Q48 A;  2ZXJ A;  4N0B A;  2DTR A;  3COA C;  1J9I A;  4BHP A;  1RIO H;  1G3Y A;  5L3E A;  3KP7 A;  2HOE A;  2OU2 A;  4YFN F;  5H20 A;  3E6C C;  4M72 A;  1OYW A;  1UST A;  2XAJ A;  3U2R A;  2QYO A;  2M5W A;  5KVR A;  4ESJ A;  3VOD A;  2ZBK A;  4MTD A;  5DV5 A;  3LST A;  4LLL A;  1MJA A;  4ZH4 F;  4OOI A;  1S7O A;  2HKX A;  3KEQ A;  3R4K A;  3IC7 A;  2GA2 A;  1T0F A;  4RGX A;  1G3W A;  4O3M A;  5E8G A;  2XHK A;  1PP7 U;  3ZN0 A;  5F6F A;  3GZ6 A;  1ZGJ A;  1ZH5 A;  3Q9V A;  4RS8 A;  2DU9 A;  2G9W A;  2H6C A;  2YPR A;  4OIQ F;  2FU4 A;  1T98 A;  3K1P A;  5AIP A;  2EWN A;  3PQJ A;  5TRD A;  3T1B A;  4AIJ A;  5JFR A;  3LA7 A;  4ON0 A;  1IN8 A;  4PZJ A;  3HSR A;  3N97 A;  4MEX F;  2WC2 A;  2P5V A;  3MZH A;  2KIF A;  1BC7 C;  3NEU A;  2QBY B;  3TO7 A;  1HST A;  2E1N A;  1QGP A;  3CO7 C;  3R0A A;  3FMR A;  2PLY A;  2HQN A;  2EFW A;  2QLZ A;  3ZMZ A;  2PJP A;  5FD5 A;  5HS8 A;  2ZNZ A;  1IXS B;  3DFG A;  4BXU A;  1TW3 A;  4A5N A;  1E2X A;  4MGR A;  5F1R A;  1JGS A;  4ZZL A;  4OIP F;  3U9G A;  3WTU C;  2VBZ A;  2L4A A;  3R60 A;  1TQM A;  3HYI A;  1B9M A;  3I53 A;  1LQ1 A;  2UXN A;  1SFX A;  3ZQ7 A;  4KIB A;  1MGT A;  3VOE A;  2XV4 S;  2RKH A;  1SFU A;  4QLC U;  1HW5 A;  1QNT A;  4G7O F;  4JBA A;  3TOB A;  1BI0 A;  1S7A A;  2HTS A;  5JI6 A;  3H3U A;  2J5O A;  5ERI A;  4L9N A;  3ZMD A;  4IRI A;  2OD5 A;  2DPD A;  5D8K B;  1KQ9 A;  2RDP A;  4I02 A;  2RN7 A;  5A2Q Z;  1QPM A;  1IN5 A;  2RVC A;  3EYY A;  1CF7 A;  2ACJ A;  5HLH A;  3FHZ A;  2CWE A;  3WTW C;  4OIN F;  5K5O A;  3J81 K;  2OBP A;  4UVB A;  5LEK A;  3FF5 A;  4A0X A;  4G6Q A;  1HSJ A;  2IA2 A;  1RUO A;  4ENJ A;  2IJL A;  3BJO A;  5CYV A;  1WKM A;  3F8N A;  2Y0M A;  2Z5U A;  4M9Z A;  4ESB A;  2V1D A;  3BJ6 A;  4LG0 B;  4L9J A;  3IKV A;  3TKY A;  3HHH A;  3O2P E;  2ZFW A;  1JHH A;  2XAQ A;  2ISZ A;  1IXR C;  4Y17 A;  4G9Y A;  5TJJ A;  5ICG A;  1ZAO A;  4PGH A;  2KIM A;  1IZ1 A;  3F21 A;  4KUM A;  2ZME B;  4AWX B;  2QZ8 A;  2FA5 A;  1YG2 A;  2NNN A;  2DBB A;  1K7A A;  2RGV A;  2E7W A;  2PG4 A;  2Q2E A;  1Z6R A;  1XGO A;  3GW2 A;  4FHT A;  2A6H F;  3KP5 A;  5FO5 A;  3SHF A;  2FSW A;  2W57 A;  2GXG A;  3RI4 A;  1YW9 A;  2EFO A;  3WTS C;  2F5C A;  3BPX A;  5CVV A;  3L9F A;  5E18 F;  2EA4 A;  3T5X A;  1F4K A;  1ZG1 A;  1ZLJ A;  2IT0 A;  2ZO4 A;  2GZW A;  2BBY A;  4G7Z F;  4ENM A;  4WXD A;  3JTH A;  4RAZ A;  2PI0 A;  2R7D A;  4ESF A;  3GLX A;  1FYL A;  2PEX A;  3C3W A;  3FM5 A;  3ULQ B;  1XCB A;  4L0Z B;  2AXL A;  1KU9 A;  1DPU A;  2XAG A;  1T38 A;  4LK1 F;  5EEH A;  4AIH A;  4HBL A;  3I5U A;  4MHG A;  5H6R A;  2LDU A;  1ZN2 A;  3KP3 A;  3F3X A;  1WWX A;  3ECH A;  4RB0 A;  3BZ6 A;  1S8N A;  1IXC A;  4QWQ A;  5ILS A;  4EJW A;  3E3V A;  4MTE A;  5DUI A;  1HW1 A;  5DCF A;  3RYP A;  1EH8 A;  2PQ8 A;  3K1M A;  5E1W A;  5LHG A;  3N4M A;  3C18 A;  3F23 A;  3ZMV A;  1R00 A;  4HDV A;  4WWC A;  1BJA A;  1OMI A;  2IA0 A;  1JXS A;  5IT9 K;  5L3G A;  4MEY F;  3ZMT A;  2DO7 A;  3GXO A;  4AVP A;  3OOP A;  4N9H A;  2Q8K A;  2CYY A;  3WU0 A;  3WTX C;  2R3S A;  4U0Y A;  3PFI A;  4KFC A;  1HKS A;  3LA3 A;  2MLG A;  2BE5 F;  3GWZ A;  2HYG D;  5LEJ A;  2YX4 A;  5LLQ A;  2DW4 A;  4IVN A;  3GFM A;  3M8E A;  2A5Y B;  3K2Z A;  2ZCW A;  1FLI A;  1ZG3 A;  1FNN A;  3DPT A;  1T6S A;  4P55 A;  2XRO A;  2DK5 A;  2STW A;  1F9N A;  2OQG A;  2EFN A;  3LAP A;  3C7J A;  3ABU A;  2CQK A;  4WXH A;  4BYY A;  3BWG A;  2DAO A;  4R1H A;  1R5H A;  3KP6 A;  4HLY A;  3QU3 A;  5BPI A;  1OR7 A;  2HYF A;  4PCQ A;  1SAX A;  4S04 A;  1OPC A;  2IA1 A;  2YSR A;  3JAM Z;  2MC3 A;  1L3L A;  3B02 A;  2A3S A;  2ISY A;  3Q9S A;  1DP7 P;  1GXP A;  2VOP A;  1J5Y A;  2HS5 A;  1DUX C;  2RC4 A;  1EH7 A;  2CO5 A;  2YU3 A;  1FSE A;  5J6X A;  2O0Y A;  1HQC A;  3V7S A;  4I98 B;  3LFK A;  4WXC A;  2V79 A;  4KYW A;  3CTA A;  2G7H A;  5HVQ C;  2NYX A;  1MD0 A;  2MBF A;  3K0L A;  2PN6 A;  1W7P A;  5E1X A;  1MDM A;  4XRF A;  5DCM A;  4EMS A;  4ZYD A;  2FMY A;  4IRG A;  2DLL A;  2HFH A;  4YFK F;  2O6G E;  4B8X A;  3GX4 X;  4UHT A;  3G73 A;  2K27 A;  3KP2 A;  5DEQ A;  5EEG A;  1SD4 A;  1QBJ A;  4HLX A;  3TO9 A;  3DKW A;  1Z9C A;  4OU0 A;  1G3T A;  4KMF A;  4LB6 B;  1FWZ A;  2QQB A;  3I0T A;  3ERE D;  4HX7 A;  4AD9 A;  2O8X A;  1D8J A;  1XN7 A;  1KYZ A;  1RZ4 A;  3K1N A;  4R8H A;  3TGN A;  5FB2 A;  2WWY A;  3DEU A;  5DDG A;  1ZGA A;  3QPH A;  2M30 A;  2XKO A;  3GYH X;  1LNW A;  2P7V B;  3BP8 A;  1IN7 A;  1I6X A;  3V4G A;  1W5T A;  4M74 A;  3IWZ A;  3W6J B;  1FP2 A;  2ZNY A;  2JPC A;  4PDK A;  4XBF A;  3RPQ A;  2D1V A;  4CXF A;  1I1G A;  2LSO A;  1QQI A;  2P6S A;  5CVJ A;  4Q4Z F;  5ILV A;  4Y13 A;  2HQR A;  3P7N A;  2P8T A;  2L4M A;  1ODD A;  5JVT A;  2A69 F;  4CZZ A;  1KYW A;  3HUG A;  3I59 A;  4RB2 C;  2QEN A;  2L02 A;  3T8R A;  2DPU A;  4GO1 A;  3RDI A;  2XVC A;  5HDN A;  3M7G A;  2VBX A;  3M8F A;  2HKO A;  4U0V A;  1S6L A;  3Q5F A;  5ICE A;  1QZY A;  3E6D A;  2XAH A;  3RYR A;  1SFE A;  4KDP A;  4L5J A;  2Q0O A;  1XGM A;  1RNL A;  2G7U A;  1FT9 A;  3E5Q A;  2EV6 A;  2HEO A;  1R1V A;  4P96 A;  3GVA A;  3DV8 A;  1R23 A;  2D1H A;  4HW0 A;  3I64 A;  1BI3 A;  4KT5 C;  1XD7 A;  2EFP A;  1KU7 A;  2BV6 A;  3FXR A;  1REP C;  1GXQ A;  1SD6 A;  4NHJ A;  5ED4 A;  2M8E A;  2IVM A;  4KIC A;  1FYM A;  4HF0 A;  4BHC A;  4KIG A;  5FD6 A;  2L01 A;  2XAF A;  3H3Z A;  4EGZ A;  2NRA C;  5HS7 A;  1YS6 A;  2F5D A;  3WE2 A;  3ABT A;  1IAW A;  3IHU A;  1TNT A;  2QUF A;  5F64 A;  1XB4 A;  3ZMU A;  1UCR A;  4A0Y A;  1FBS A;  4BHB A;  1K6O A;  3RTR A;  2JTV A;  4CDG A;  5LGN A;  3KLO A;  1GHC A;  1J59 A;  1FBQ A;  3I54 A;  3SZT A;  4U7B A;  3KCC A;  2LKP A;  3KP4 A;  3CUQ C;  2RV8 A;  5D5X B;  2LF8 A;  2AS5 F;  2K4J A;  4A2U A;  3J7A O;  3FMS A;  1YYV A;  3ZP5 A;  3HHG A;  2JPB A;  4HV5 A;  3GFL A;  4YG2 F;  1XSX A;  4L5I A;  1SMY F;  2CGP A;  1JE8 A;  1FSH A;  3TOA A;  1Z91 A;  1ZLK A;  1P92 A;  3M1E A;  3WTT C;  3RKX A;  3HRT A;  5DCM B;  1YIO A;  1UFM A;  4DNC A;  4AIK A;  1ZG5 A;  3P9K A;  1J0R A;  2FBH A;  3HRU A;  1IUY A;  1YS7 A;  3FMQ A;  3FM3 A;  3GZ5 A;  3J81 Z;  5D5V B;  5E1Z B;  5LGU A;  4I09 A;  5D5W B;  2A68 F;  2FOK A;  2W84 A;  3IKT A;  2KKO A;  5J8C A;  1TTY A;  1FOK A;  2X4H A;  3RPU A;  4EJT A;  2P7C B;  3AAF A;  4I7H A;  4RB3 C;  1A04 A;  1HXD A;  1HBX G;  2EB7 A;  4M6X A;  2IP2 A;  1HW2 A;  3ISP A;  4GCV A;  5D4S A;  3MFK A;  2MH2 A;  4OIR F;  4EM2 A;  1W5S A;  4UXN A;  3NQO A;  5DUK A;  2VBW A;  3GUD A;  1U78 A;  4IHS A;  3R6S A;  4G8X A;  4FX0 A;  2XKP A;  3WTV C;  2IW5 A;  3W6K B;  1Z05 A;  4IXA A;  5LRS A;  3LQR A;  3FXU A;  1LB2 A;  1SMT A;  4JK1 X;  1O3Q A;  4ZYE A;  4XSZ F;  3RIR A;  2L3D A;  4CHU A;  1R5G A;  3E97 A;  4EGY A;  1OKR A;  2VC0 A;  3EUH A;  2VE9 A;  4HOB A;  4XLP F;  4HX4 A;  3T8T A;  1MZB A;  1BI1 A;  3R0J A;  2V9V A;  3GFJ A;  3I59 B;  3QOP A;  2FQ3 A;  1BBY A;  3S2W A;  2VT3 A;  3QRF F;  3BRO A;  3T0Y A;  3FX3 A;  1PDN C;  2VC1 A;  2CW0 F;  2VBY A;  4BAY A;  2M45 A;  4H0E A;  4Q5S F;  2VOO A;  1XGS A;  2PMU A;  4EV0 A;  1U6G A;  1WQ2 A;  1S3J A;  5CLS A;  2W85 A;  3MQ0 A;  2H27 A;  2TDX A;  2DK8 A;  4O6J A;  1J75 A;  1H9T A;  2GAU A;  3MEX A;  1FZP B;  1LJ9 A;  2MD5 A;  5FFX A;  2DQR A;  5H6Q A;  4HA8 A;  4WX9 A;  5DYM A;  5CVR A;  3EET A;  3LQQ A;  3DP7 A;  2BYV E;  4HAM A;  5LGT A;  1O3R A;  3GO5 A;  2QM3 A;  4Y15 A;  1G6N A;  5HS9 A;  4FX4 A;  3REO A;  3HSE A;  1FP1 D;  2W24 A;  2DI3 A;  1OYY A;  3LAJ A;  2YR2 A;  1ZRF A;  3KE2 A;  4UVA A;  5LRR A;  4RGR A;  3EYI A;  5LBQ A;  5IT9 Z;  1IF1 A;  3ROU A;  1YW7 A;  2VON A;  1R22 A;  2FNP A;  2H94 A;  3EQL F;  1RUN A;  4L0Y B;  5LHH A;  3TDZ C;  3D0S A;  2MA3 A;  5E8I A;  1T39 A;  2QBY A;  1FPQ A;  1NHA A;  2EV5 A;  4CYD A;  2GXB A;  5BMZ A;  1DDN A;  3JTG A;  1U5T A;  4KN7 X;  5ILU A;  2DFI A;  2DQL A;  1G4D A;  4MQ9 F;  2HDC A;  3WGI A;  3MCZ A;  4LFU A;  4RAY A;  4HQM A;  4LJZ F;  2H09 A;  2BGC A;  1WSU A;  5K1Y A;  3DXJ F;  3E5U A;  2K86 A;  3KLN A;  1CF7 B;  3QP5 A;  1KU2 A;  3BDD A;  4E70 A;  3IRQ A;  1P4A A;  2XIG A;  3BJA A;  1FYK A;  1D8K A;  2JZY A;  2JSC A;  2E7X A;  1EH6 A;  2GA1 A;  1K79 A;  4ZYG A;  1I27 A;  4LLG F;  5HDK A;  4G6D A;  1L0O C;  1R1T A;  1TBX A;  1ZAR A;  1LEA A;  5L3F A;  4YIF A;  1CGP A;  1MKM A;  3M9A A;  1YQA A;  2EJR A;  2COM A;  3TO6 A;  1BN5 A;  5ICC A;  1ZRD A;  4B09 A;  1I1S A;  4M9S A;  5E17 F;  4HF2 A;  4L9V A;  2PMH A;  5J8F A;  1XGN A;  2W25 A;  4IF4 A;  4ENN A;  3WGG A;  2A61 A;  2EA2 A;  2O03 A;  3ZMS A;  2K7L A;  4UNO A;  3SQN A;  5JHU A;  2KJB A;  1MJB A;  3MWM A;  3SZP A;  4WCG A;  4EJU A;  2OAZ A;  4XSX F;  4LG0 A;  4M73 A;  4O5V A;  1BI2 A;  5D6F A;  1TW2 A;  1U3E M;  3RKW A;  1O57 A;  2RQP A;  2ELH A;  3F8C A;  5BPD A;  2FF4 A;  3HIF A;  5KK1 A;  2L54 A;  1YW8 A;  1TQP A;  3F6V A;  4L9T A;  1UB9 A;  3I58 A;  4HQE A;  5E20 A;  4GXO A;  2KIU A;  3SXY A;  4XLN F;  1TNS A;  1BIB A;  1IW7 F;  1MJ9 A;  3WE3 A;  3WG9 A;  2F5E A;  2EK5 A;  1XSV A;  4L18 B;  4CIC A;  3B73 A;  4KA4 A;  2UZK A;  2KJC A;  1O7L A;  2M87 A;  1IRF A;  2CSO A;  3WOD F;  1O3S A;  3WU1 B;  3CLO A;  3ZPL A;  1AOY A;  2OZU A;  3D5L A;  2QQ9 A;  1C0W A;  1LVA A;  1D5V A;  4MQV A;  1UHM A;  3FWE A;  1P6R A;  4I0A A;  4Z2Y A;  2HZT A;  2D2W A;  4ETS A;  3HOS A;  2JRT A;  2NNY A;  2F2E A;  2H6B A;  3J80 K;  4OMZ A;  1B1B A;  1B4A A;  1BIA A;  3QU6 A;  3HOT A;  5IT3 A;  2FBI A;  1R36 A;  3WGH A;  5K5Q A;  2XGX A;  1O3T A;  3EDP A;  3J80 Z;  5HOO A;  3TQN A;  4ENK A;  3ZN1 A;  2HWV A;  3I71 A;  2ESH A;  4Q47 A;  3VFZ A;  2IPQ X;  3V8J A;  2O61 A;  3HTS B;  4EJV A;  2F5F A;  1KGS A;  1E17 A;  2ESN A;  2V1X A;  1U5T B;  2MH9 A;  1HKQ A;  4JQF A;  1BC8 C;  2FML A;  1O7F A;  1FC3 A;  4GGG A;  4M71 A;  1K78 A;  3IL2 A;  2ZKZ A;  4BNC A;  4EM0 B;  5D6E A;  2J5P A;  4A6D A;  3ECO A;  3IRR A;  3FZV A;  1DPR A;  2WV0 A;  2VOD A;  3I4P A;  4OMY A;  2ZJ2 A;  3JSP A;  2EFQ A;  2KRF A;  1AWC A;  3CO6 C;  1SD5 A;  4RB1 A;  1TQI A;  4ZYH A;  4I2O A;  2V6C A;  5A2Q K;  6PAX A;  1IN4 A;  5BS6 A;  1W7P B;  1MDM B;  2DT5 A;  2X0L A;  4A12 A;  2STT A;  3CDH A;  4F7Z A;  4LLN A;  4KIF A;  4LD5 A;  2V1U A;  3E5X A;  3U1D A;  3LA2 A;  5L3C A;  2ADU A;  1U8R A;  3L09 A;  1ONV A;  3V7R A;  2VXZ A;  1ULY A;  2VT2 A;  3SFZ A;  4EVI A;  1PUE E;  2LNB A;  2LF7 A; 
#chains in the Genus database with same CATH topology
 4ZZD A;  1OFC X;  4RGS A;  2F6C A;  1R1U A;  1TWA J;  3WHB A;  2KHM A;  2WY7 Q;  5L3D A;  1OCT C;  5HLG A;  1CQT A;  3CMM A;  4G94 A;  4II2 A;  2OC6 A;  2FBK A;  4ABZ A;  4DZP A;  1MBJ A;  1WRJ A;  5DS9 A;  4E7L A;  1J2X A;  1V5F A;  1WZ2 A;  1Z6T A;  3JW4 A;  2HR3 A;  2IGO A;  2QVO A;  4NQW A;  2IRF G;  5GP9 A;  2CUZ A;  3NRV A;  1LDD A;  1P4X A;  4JP0 A;  3FIW A;  1I3Q J;  4MFD A;  2L7F P;  3FXJ A;  3VDX A;  2OQR A;  4RGU A;  1VTN C;  1A6I A;  3F8B A;  1Y0U A;  4EAT A;  4CO8 A;  3KZZ A;  3KFW X;  1BW6 A;  3KEO A;  3GBG A;  2VQH A;  3DKY A;  2NS0 A;  4CGZ A;  2CUE A;  1IGN A;  4M6Y A;  2UWM A;  1QZZ A;  3P9C A;  1SD7 A;  1ZYR F;  2YX7 A;  3CJN A;  3FK7 A;  1BR2 A;  1QVT A;  2K9N A;  3SDG A;  2CG4 A;  3A4C A;  1IG7 A;  4K2E A;  3ELK A;  4IPA A;  4P9U A;  2LY2 A;  1H9G A;  3K69 A;  4TV7 A;  2XDV A;  4HNU A;  2Y48 A;  2Z16 A;  1U5T C;  4YII A;  2Z33 A;  1WI9 A;  2ZFU A;  4N9I A;  2VAS A;  2K4B A;  1W7P D;  4P9F A;  4A6E A;  4KMU X;  4F92 B;  1XMX A;  4XKB A;  3OY9 A;  2HDD A;  4EJO A;  2WAD A;  2Y75 A;  1X3U A;  4AVZ A;  4KIS A;  2PBI A;  3IAM 2;  3FXQ A;  1YIT I;  5E79 C;  1FOY A;  4BQA A;  1XMA A;  2FRH A;  3HUG B;  1TL8 A;  5FFZ A;  5GAE J;  1J7K A;  2CFX A;  2RNJ A;  3HXL A;  1KU3 A;  4C2T A;  1BR4 A;  1OR7 C;  3K2A A;  5K5R A;  3CJT B;  4Q48 A;  2GWR A;  3C1D A;  3K9T A;  1R58 A;  3ZR8 X;  4BGD A;  4A3K J;  3S93 A;  2IS4 A;  1RR7 A;  4U88 A;  4D7N A;  2HGC A;  2XAS A;  3CUQ A;  3E6B A;  2P5K A;  2K9M A;  3BY6 A;  2LRD A;  3GTL J;  4P5O A;  3B6C A;  5AIQ A;  4QTR A;  1W4M A;  3DQV C;  3V8K A;  3H9J A;  4XLF A;  2OCE A;  5BQT A;  5EZG A;  1S7E A;  4II3 A;  2P6T A;  3FK6 A;  1YIJ I;  2HOT A;  2MD0 A;  2JT1 A;  3CC4 I;  2EV0 A;  2JSP A;  4PK4 A;  1YLF A;  1U2W A;  5J40 A;  5FLX K;  3A0B C;  3HRM A;  4IRH A;  3WTY C;  1D0X A;  2JA6 J;  2G0E A;  5KAF C;  1X1C A;  4UV8 A;  1ON2 A;  3DLL F;  1QO0 D;  3MMY B;  3P9I A;  4A0Z A;  4RDU A;  3KET A;  5LHI A;  1GVJ A;  2P5L C;  4KN4 X;  4BJT A;  2QQ8 A;  3QAH A;  1A36 A;  4IJA A;  3H1C A;  3KPH A;  5FLX Z;  3OS0 A;  3I4M J;  2K3P A;  3G3Z A;  2D45 A;  3BPV A;  1XSD A;  2JVG A;  4HYE A;  5D8L B;  4YIR X;  3E1S A;  3GZN B;  3G6E I;  1TT0 A;  4A3F J;  1FY7 A;  1V4R A;  2E1C A;  3GFI A;  1B9N A;  2QF7 A;  1STZ A;  4MNU A;  4ZDO A;  1SEU A;  1HDD C;  1P9Q C;  3E6M A;  2MLK A;  1WJD A;  4P1W A;  2F4O B;  1B6A A;  4PSX A;  2QKL B;  2X85 A;  1OCZ H;  3F72 A;  3F22 A;  1XDS A;  2RRE A;  3PUB A;  3RQ4 A;  3L2C A;  2IEK A;  4F55 A;  3V7C A;  2KIQ A;  2BXZ A;  3HKZ N;  2LMD A;  1R71 A;  5CJ9 A;  4BBS J;  4XKV A;  3L7W A;  5D5U B;  3ASO H;  4HZF A;  1SC7 A;  4XOP A;  4BY7 J;  5K7H A;  3SDB A;  5TIS C;  4Y33 A;  1BA5 A;  4M3B A;  2ETH A;  4XN0 A;  2KDZ A;  2K02 A;  1K83 J;  2FEZ A;  5JR3 A;  2HTJ A;  4PGG A;  1KON A;  3WTZ A;  4YFX F;  4PJN A;  1IN6 A;  5ICF A;  3MAJ A;  1OCR H;  2CQX A;  1ZR2 A;  2GLO A;  2NAZ A;  3HTU A;  1JJ8 C;  2QSG X;  1HKT A;  1XMK A;  3RJP A;  3HOV J;  1G3S A;  4Y7N J;  2R7R A;  1K78 B;  5CKT A;  2KZV A;  3DF8 A;  3EUA A;  4HEA 2;  2VE8 A;  3KEY A;  2OZ6 A;  3GF2 A;  3QPT A;  4LGW A;  4LK0 F;  3O3K A;  5M3M J;  2A07 F;  1ZHF A;  3BR0 A;  4D5C A;  4BE2 A;  5L3B A;  3BG6 A;  4IHT A;  2LG4 A;  1JJ6 C;  3S1Q J;  3CCL I;  3ML6 A;  1KQ0 A;  4WF2 A;  4HX8 A;  1SFK A;  4FE4 A;  3R61 A;  4DQ2 A;  1MH4 A;  2CQ7 A;  2O3F A;  5HLI A;  3HDD A;  3F9K A;  1Z7U A;  4LMY A;  1ZRE A;  1U8B A;  2VPR A;  4KNY A;  4DJA A;  2B0L A;  5IYB J;  3PFY A;  3VEP A;  5JHF A;  4G7H F;  4S05 A;  3ZQQ A;  2QQA A;  2KZG A;  4FT8 A;  4UUV A;  4A69 C;  3O6B B;  4J19 A;  1YTY A;  2JA8 J;  3CF2 A;  4A5M A;  1I39 A;  2FXA A;  3QP6 A;  1V5E A;  4OIO F;  2C6Y A;  1FX7 A;  5FKM A;  1QVU A;  2JN6 A;  1QU3 A;  2N8G A;  2DMN A;  2DOD A;  2KDO A;  4KJZ A;  1JKO C;  1BL0 A;  4FIS A;  2ZJQ F;  3DPL C;  2BHZ A;  3JAM K;  1UHW A;  1YE9 A;  3K4K A;  3PQK A;  2UXX A;  5K7Z A;  3BR1 A;  2ZJP F;  5GAH J;  1LEB A;  1IC8 A;  1IRG A;  1UAA A;  4XKC A;  2Z99 A;  4M9X A;  3ZQI A;  5IOZ A;  3M4O J;  5AON A;  3JRG A;  1MSE C;  5DD4 A;  4HF1 A;  2F4M B;  2GQQ A;  1RI7 A;  2EIM H;  3HRS A;  3VSL A;  3HSF A;  4ASN A;  1UG0 A;  5HDG A;  2WAE A;  1SAU A;  1Q1H A;  3MZY A;  3F8M A;  3BQY A;  2HXI A;  1Z1D A;  3GLL A;  3BOQ A;  2HVR A;  1OYI A;  3DU5 A;  1XC5 A;  2P4W A;  3F6O A;  1MNE A;  3PJR A;  2LBF A;  1B72 A;  1BR1 A;  3IWF A;  3UR3 C;  1YHQ I;  1DP3 A;  5DD8 A;  4ZYA A;  2Z9O A;  3KYL A;  1ETX A;  2V4J C;  1I5Z A;  3CC2 I;  4LB5 A;  4GYG A;  1F5T A;  4HDU A;  4PJ0 C;  1LE8 A;  3DTE A;  4AYB A;  4IZZ A;  1YFH A;  4D0P A;  1SVL A;  3L00 A;  3ZGK A;  2A6E F;  2R5Z B;  1EV7 A;  5J1U A;  3CUO A;  2FE3 A;  3G1O A;  4EQQ A;  1P7J A;  2HPM A;  3LWF A;  1YO5 C;  1QHH D;  3OYB A;  2R7F A;  4HG2 A;  1KA8 A;  1IO2 A;  4I99 C;  5BOX A;  2M1B A;  1T2K A;  4NB5 A;  2E2J J;  3GEZ A;  2YU9 J;  5IP9 J;  4XLE A;  1NG6 A;  4ZDP A;  2LD5 A;  2JWT A;  4WK8 F;  1VND A;  4I01 A;  1BM9 A;  3JSO A;  3G4S I;  4M3F A;  1BOA A;  1YJW I;  3JRH A;  1PP8 F;  3AG3 H;  4GDF A;  2LK2 A;  1KQ8 A;  2AO9 A;  1SVO A;  1PYV A;  2BY3 A;  5CVI A;  5IP6 A;  4A93 J;  3TED A;  2XRN A;  1LDJ A;  2DA4 A;  2XSJ C;  3V8L A;  2OJE D;  4I0B A;  2Y0S N;  1Z3Y A;  2DJN A;  1AU7 A;  3VB2 A;  2PFB A;  4XNF A;  1P7I A;  4U0W A;  3W2W A;  2HU9 A;  3HB9 A;  4XON A;  3FIS A;  1S29 A;  1XDU A;  1ON1 A;  2WA0 A;  4EEF G;  4GYI A;  3BTL A;  4F93 B;  2QWW A;  1P4W A;  3TDU C;  1MH3 A;  5KCM A;  3TMO A;  5E3M A;  3RKY A;  1LDK B;  2BEO A;  2COB A;  4BH9 A;  1H0M A;  1B59 A;  4UV9 A;  1V3F A;  3K4C A;  4R79 A;  2F5V A;  4HV6 A;  2FNA A;  4EM1 A;  2BVL A;  1X1B A;  5FGM A;  5D4R A;  3SEQ A;  2ZME A;  3H92 A;  3F8F A;  4CCK A;  1W36 C;  1FBU A;  1TWC J;  4U7D A;  1D3Y A;  2DMU A;  1TLH B;  2L7Z A;  4UY8 I;  1UJ8 A;  4PUS A;  2XUB A;  3RZO J;  1P2F A;  1USS A;  2VN2 A;  2WTE A;  4B48 A;  1R7J A;  1VQ8 I;  4DBR A;  3DBR B;  3LMM A;  3CUQ B;  2WV1 A;  1ZRC A;  1XCV A;  2GIV A;  2Z3Y A;  1F1Z A;  4UVC A;  5CVU A;  3OV8 A;  2CUJ A;  2Q1Z B;  3KZY A;  2DA6 A;  1JHF A;  1TP4 A;  1D0Z A;  2OA4 A;  2ZXJ A;  3HEF A;  4N0B A;  4OWR B;  2DTR A;  3AG4 H;  3COA C;  1XTA A;  1J9I A;  4BHP A;  1RIO H;  2PJR A;  1G3Y A;  2GOX B;  2VB6 A;  5L3E A;  3KP7 A;  3S16 J;  3TBI A;  2M9H A;  1WJE A;  1D1C A;  2HOE A;  3CDI A;  2OU2 A;  4YFN F;  3OYF A;  2EIL H;  5H20 A;  3E6C C;  4M72 A;  1H88 C;  1VQ5 I;  1R4M B;  1OYW A;  1UST A;  2XAJ A;  3U2R A;  3MN2 A;  1JI8 A;  2QYO A;  4XOT A;  3P5J A;  2VJJ A;  4BU2 A;  1AKH A;  3C2B A;  4H4K C;  4FCY A;  3FXM A;  2M5W A;  5KVR A;  4ESJ A;  5GPA A;  2XF6 A;  4F52 A;  3VOD A;  3K70 D;  2ZBK A;  4MTD A;  2BW3 A;  1TC3 C;  5DV5 A;  3LST A;  2LY9 A;  4LLL A;  1MJA A;  4ZH4 F;  4CYC B;  4OOI A;  4E7S A;  1S7O A;  1YRN B;  2HKX A;  1QHG A;  3QYE A;  3KEQ A;  3R4K A;  3IC7 A;  2GA2 A;  1T0F A;  3ZQL A;  4RGX A;  1G3W A;  3PNT A;  1O4X A;  3H0G J;  4O3M A;  5E8G A;  1R6R A;  2CQQ A;  2XHK A;  2MFZ A;  3L2W A;  3BR2 A;  3FHN A;  1PP7 U;  3ZN0 A;  5F6F A;  3GZ6 A;  1ZGJ A;  5LD2 C;  3KIO A;  1ZH5 A;  1A5J A;  1X2M A;  3BG5 A;  3Q9V A;  4RS8 A;  2X1C A;  2DU9 A;  2G9W A;  2H6C A;  1N25 A;  2VJ5 A;  2YPR A;  3RKQ A;  4OIQ F;  2L9S A;  3OWT A;  2FU4 A;  4BEH A;  1T98 A;  3K1P A;  5AIP A;  1OJL A;  2EWN A;  4ZJZ A;  4FQG A;  3PQJ A;  5TRD A;  2VL8 A;  3DTI A;  3T1B A;  2EBI A;  3D5S C;  4AIJ A;  5JFR A;  4A3C J;  2PMZ A;  1X4O A;  2JUG A;  3LA7 A;  1DQU A;  4IQ4 A;  4ON0 A;  2XPV A;  1IN8 A;  1QZE A;  4PZJ A;  3HSR A;  2JJ7 A;  2JMW A;  3G2B A;  3OYA A;  3N97 A;  2WC2 A;  4MEX F;  2ZXW H;  2WB1 N;  3RZD J;  2DA1 A;  2M8G X;  2P5V A;  3MZH A;  2KIF A;  1BC7 C;  3NEU A;  2QBY B;  3QOE A;  2XAU A;  1HST A;  3TO7 A;  4BQQ A;  4X6A J;  2E1N A;  1QGP A;  3M8J A;  2M4K A;  3CO7 C;  3R0A A;  2JA7 J;  3S15 J;  1UZC A;  3FMR A;  2PLY A;  2DA5 A;  2HQN A;  2EFW A;  2QLZ A;  2M7B A;  4LIV A;  3OR1 C;  3ZMZ A;  1VQ4 I;  2PJP A;  3CC7 I;  5FD5 A;  5HS8 A;  2ZNZ A;  2JVH A;  1IXS B;  3DFG A;  4BXU A;  3ZQC A;  2HYJ A;  1TW3 A;  4A5N A;  1VQM I;  1E2X A;  3DBH B;  4LG3 A;  3O8H A;  4MGR A;  5F1R A;  1JGS A;  4ZZL A;  3CCU I;  4OIP F;  3U9G A;  3WTU C;  2EIN H;  3HGY A;  2VBZ A;  2L4A A;  1ZKG A;  3K4N A;  3R60 A;  1TQM A;  3ESW B;  3HYI A;  3HL2 A;  1YX3 A;  1B9M A;  3I53 A;  1LQ1 A;  3EUH C;  5F1J A;  1MBG A;  1SFX A;  2UXN A;  5FKO A;  1JUM A;  3ZQ7 A;  5F0H A;  3MZ8 A;  4XN3 A;  4KIB A;  1MGT A;  2VKV A;  2VJI A;  3VOE A;  2XV4 S;  3OIQ A;  4CCJ A;  5GPC A;  3HC7 A;  1MBK A;  1MMS A;  3MD2 A;  1WCM J;  1GT0 C;  4HNV A;  2RKH A;  3A02 A;  1K4S A;  3QPL A;  1SFU A;  4QLC U;  5EJC A;  1VQO I;  2CV2 A;  1HW5 A;  2AHQ A;  1QNT A;  4G7O F;  4JBA A;  4BUP A;  3TOB A;  1ETO A;  1BI0 A;  3LNQ A;  1S7A A;  2HTS A;  3NAR A;  3H3U A;  5JI6 A;  2J5O A;  4NBQ A;  5ERI A;  4L9N A;  4NUB A;  3ZMD A;  3HBL A;  4IRI A;  2GBY A;  2OD5 A;  2DPD A;  1GV2 A;  1WJB A;  2LBF B;  1B72 B;  1T95 A;  3CCR I;  1FTZ A;  5D8K B;  1KQ9 A;  2CV1 A;  1JTY A;  2RDP A;  4BL0 B;  1ZK8 A;  4I02 A;  2RN7 A;  2R5Y A;  1F43 A;  5A2Q Z;  1QPM A;  3LSP A;  1IN5 A;  2RVC A;  2Y30 A;  3EYY A;  2ACJ A;  1CF7 A;  2M7A A;  2MSY A;  5HLH A;  3FHZ A;  4BDY A;  2CWE A;  4D9J A;  3WTW C;  5C3E J;  1UEL B;  4OIN F;  3BCB A;  5K5O A;  3J81 K;  3BR6 A;  2NS8 A;  3ZQG A;  2OBP A;  2QCO A;  4UVB A;  4NC8 A;  5LEK A;  1WJF A;  2W4S A;  3FF5 A;  4A0X A;  4G6Q A;  1HSJ A;  2IA2 A;  1RUO A;  4ENJ A;  2IJL A;  2H1L A;  3BJO A;  5CYV A;  4HST A;  1R49 A;  1WKM A;  3G1M A;  3KYC B;  1D1A A;  3F8N A;  4Y4R A;  2RAE A;  4ZDL A;  1W0T A;  2Y0M A;  2Z5U A;  4M9Z A;  1Z77 A;  4ESB A;  4RLF A;  1Y56 A;  3E0J B;  3DLA A;  1VQ7 I;  3ABM H;  2XC7 A;  3ASN H;  1D5Y A;  2K5C A;  2V1D A;  4HPQ A;  1APL C;  3CCY A;  3BJ6 A;  1ZEL A;  3H36 A;  1KZH A;  4RA2 A;  4LG0 B;  4L9J A;  5K7F A;  1DGW Y;  3IKV A;  1MIJ A;  3TKY A;  3BLY A;  1FTT A;  4ANJ A;  5B3S H;  4BQN A;  4D1Q A;  3D5R C;  3HHH A;  3TW7 A;  3O2P E;  4BQO A;  2JUC A;  2ZFW A;  1JHH A;  2XAQ A;  2ISZ A;  1Z21 A;  1IXR C;  1E3P A;  3L2R A;  1U0J A;  1OCP A;  1ZQ3 P;  4Y17 A;  4G9Y A;  3JRB A;  5TJJ A;  5ICG A;  4PJJ A;  1ZAO A;  3AL0 B;  4PGH A;  2KIM A;  1IZ1 A;  2OF7 A;  4JOM A;  1WFX A;  2QSF X;  3F21 A;  3CDL A;  4KUM A;  1VQL I;  2ZME B;  3H9G A;  4AWX B;  2QZ8 A;  2FA5 A;  1YG2 A;  2NNN A;  3JRF A;  2A6T A;  2DBB A;  2RGV A;  1K7A A;  1WHU A;  2E7W A;  2PG4 A;  2Q2E A;  1Z6R A;  1VZ0 A;  5BNG A;  1XGO A;  3GW2 A;  4FHT A;  3M3Y J;  2A6H F;  3KP5 A;  5FO5 A;  4RAF A;  2FSW A;  2VJ4 A;  3SHF A;  1HLV A;  2W57 A;  1U9O A;  2GXG A;  5FKK A;  3RI4 A;  1YW9 A;  2EFO A;  3CLQ A;  3WTS C;  4KT6 A;  2F5C A;  1ITY A;  3BPX A;  5CVV A;  1E3O C;  3L9F A;  4JX5 A;  5E18 F;  2EA4 A;  1RRJ A;  3T5X A;  1VQN I;  1ETQ A;  2PJR B;  2E35 A;  2MC4 A;  2KQR A;  1F4K A;  4C3J J;  1ZG1 A;  3FBN B;  1ZLJ A;  2WAQ A;  5E3L A;  2IT0 A;  2ZO4 A;  2GZW A;  2BBY A;  4G7Z F;  4ENM A;  4WXD A;  2GM4 A;  3J7Y J;  2B7E A;  2ECB A;  4DYC A;  4DGW B;  1X2N A;  3JTH A;  4RAZ A;  2OPT A;  3J7Z I;  3FBI B;  2PI0 A;  2R7D A;  4ESF A;  3GLX A;  1ZTR A;  1FYL A;  5DTD A;  2PEX A;  3C3W A;  3FM5 A;  2V9K A;  3ULQ B;  1XCB A;  4L0Z B;  3F0C A;  4XMY A;  2AXL A;  1KU9 A;  3K7A J;  2E1M C;  3H9Q A;  3HGG A;  1DPU A;  2BY0 A;  2E71 A;  1FJL A;  2XAG A;  2ZC2 A;  1T38 A;  3HOU J;  4LK1 F;  3IH3 A;  5EEH A;  3C2G A;  4AIH A;  4HBL A;  2CH0 A;  3CP2 A;  3I5U A;  4MHG A;  5H6R A;  3S1R J;  2LDU A;  4A3I J;  2JA5 J;  1ZN2 A;  3KP3 A;  3F3X A;  2FD5 A;  3JRC A;  3GTG J;  2R7T A;  1WWX A;  3ECH A;  1FMV A;  4RB0 A;  1N77 A;  2OCC H;  1GLN A;  2Z1D A;  4CZC A;  2XB0 X;  3LOC A;  4HSR A;  4FET A;  3BZ6 A;  1S8N A;  1IXC A;  4QWQ A;  5ILS A;  3L1P A;  4EJW A;  3E3V A;  2E2H J;  4MTE A;  5F04 A;  1GUU A;  3NAU A;  2IXS A;  5DUI A;  1HW1 A;  5DCF A;  3RYP A;  2DXI A;  2ZSH B;  2XGE A;  3VYS B;  3CMY A;  3A03 A;  1I6H J;  4E7I A;  1EH8 A;  1MBH A;  5FKL A;  2PQ8 A;  3K1M A;  5E1W A;  2M3A A;  5LHG A;  2DT7 B;  3N4M A;  4NDL A;  3C18 A;  2L7K A;  3F23 A;  2K9S A;  3ZMV A;  1R00 A;  2EZL A;  2ZXH A;  4HDV A;  5M5X J;  4WWC A;  1H8A C;  2NOJ B;  1BJA A;  1OMI A;  2IA0 A;  3JRD A;  4Z6Y A;  1ORK A;  2GOM A;  1JXS A;  5IT9 K;  5L3G A;  2Z2S B;  5KHD A;  1PUF A;  3AG2 H;  4E7Z A;  2IGK A;  4B47 A;  4XID A;  4MEY F;  2BY1 A;  3ZMT A;  2DO7 A;  3GXO A;  4AVP A;  3OOP A;  4N9H A;  3FXK A;  2Q8K A;  2CYY A;  1R9T J;  3K4M A;  3WU0 A;  1V5G A;  3WTX C;  4DBQ A;  2R3S A;  2ME0 A;  4U0Y A;  3PFI A;  4KFC A;  1HKS A;  3LA3 A;  3OYD A;  4LIT A;  2MLG A;  2BE5 F;  1FIA A;  3GWZ A;  5GTI C;  4XRS G;  2HYG D;  2F4I A;  5LEJ A;  4L5E A;  2YX4 A;  3VWB A;  2LRE A;  4FAS D;  1LUJ B;  5LLQ A;  3BR3 A;  2DW4 A;  4IVN A;  3OMY A;  3I4N J;  3GFM A;  3M8E A;  3VSK A;  1LFP A;  2A5Y B;  3K2Z A;  2ZCW A;  1FLI A;  1ETY A;  3IUO A;  4ZTJ A;  1ZG3 A;  3AL0 C;  4UUS A;  1GV5 A;  1FNN A;  3DPT A;  1T6S A;  4P55 A;  3K4B A;  2XRO A;  2DK5 A;  1G8X A;  3D1N I;  2NOG A;  4GRI A;  2ZME C;  2STW A;  1F9N A;  2ZB9 A;  2OQG A;  2DOE A;  5M5Y J;  3JR9 A;  1JT6 A;  2W82 A;  2EFN A;  4C3I J;  3DTK A;  3H0D A;  3DCF A;  3PL8 A;  3BZC A;  3LAP A;  2R7Q A;  4YEJ A;  3C7J A;  3ABU A;  2CQK A;  4WXH A;  4BYY A;  2K9L A;  2HXO A;  3OR2 C;  1LKX A;  1MMD A;  2DAO A;  3BWG A;  1EA3 A;  4R1H A;  3CCJ I;  1R5H A;  3KP6 A;  3BR5 A;  2ECC A;  5IPA A;  3BC8 A;  2R5Y B;  4HLY A;  3QU3 A;  5BPI A;  1OR7 A;  2HYF A;  4PCQ A;  4B1R A;  5J1R A;  3A0H C;  1SAX A;  3MVP A;  4S04 A;  2DTZ A;  1D1B A;  3ZXS A;  3PO2 J;  1OPC A;  2IA1 A;  2YSR A;  3JAM Z;  2MC3 A;  2KMU A;  1L3L A;  3B02 A;  2A3S A;  2ISY A;  3Q9S A;  1DP7 P;  1GXP A;  2R7O A;  2VOP A;  1J5Y A;  2HS5 A;  2XF7 A;  1DUX C;  2RC4 A;  1X3W B;  1EH7 A;  2CO5 A;  2YU3 A;  4I6Z A;  4YRV A;  3TP3 A;  3MKW B;  4XR6 A;  1FSE A;  2DYR H;  5J6X A;  2O0Y A;  1EJ9 A;  1HQC A;  3V7S A;  1X3Z B;  2FJ1 A;  4I98 B;  3LFK A;  3GTJ J;  4A3D J;  4WXC A;  2KL4 A;  1Z67 A;  2ME6 A;  5LFA A;  2V79 A;  4KYW A;  3CTA A;  2X6W A;  4XKW A;  2G7H A;  4N4O B;  5HVQ C;  2I10 A;  3DEW A;  2NYX A;  1MD0 A;  2NVX J;  1X1A A;  2MBF A;  3K0L A;  2PN6 A;  1W7P A;  1M1E B;  5E1X A;  1MDM A;  5IOY A;  4A3E J;  2E1O A;  4XRF A;  2VUM J;  5DCM A;  2IGN A;  4EMS A;  1W36 D;  3GTO J;  4ZYD A;  3LSK A;  2P0W A;  2K9Q A;  2FMY A;  4IRG A;  2DLL A;  3CCM I;  4NQW B;  2HFH A;  4KIT B;  3LSR A;  1NK3 P;  2CW8 A;  4YFK F;  1LVK A;  1JKQ C;  4A3M J;  2O6G E;  1A35 A;  3CCV I;  4B8X A;  2LC2 A;  4PFP A;  3I55 I;  3GX4 X;  4UHT A;  3G73 A;  2CMP A;  5JLW A;  2K27 A;  4RAG A;  1ETK A;  3KP2 A;  5DEQ A;  3N05 A;  2DMQ A;  2DYS H;  5EEG A;  2Q2E B;  5B1A H;  1SD4 A;  1QBJ A;  4HLX A;  4N4N B;  5FRM A;  2R7V A;  2IS2 A;  2QKM B;  1IDZ A;  2KT0 A;  2BHY A;  3TO9 A;  4W1U A;  1S72 I;  3DKW A;  4ZC3 A;  1Z9C A;  3Q0U A;  3S17 J;  2X51 A;  4OU0 A;  2DMP A;  1G3T A;  3VYU B;  3PNV A;  3Q0V A;  4KMF A;  4LB6 B;  4AID A;  1FWZ A;  2QQB A;  4M3E A;  3I0T A;  3ERE D;  4RBO A;  2RNG A;  4HX7 A;  4AD9 A;  2KRH A;  2E5Z A;  1Y1V J;  2DFE A;  2MGQ A;  2WBM A;  4A3J J;  1RKW A;  2O8X A;  1D8J A;  1XN7 A;  1KYZ A;  1RZ4 A;  3K1N A;  4R8H A;  3TGN A;  3U1K A;  5FB2 A;  1Y0N A;  2CFO A;  2WWY A;  3DEU A;  5DDG A;  1HC8 A;  5C4X J;  1ZGA A;  3QPH A;  2M30 A;  5KAI C;  2LR8 A;  4V2F A;  4W97 A;  2X6O A;  2XKO A;  2XPW A;  3GYH X;  2LKX A;  1LNW A;  1F36 A;  2P7V B;  2L9V A;  3BP8 A;  3OYC A;  2BY2 A;  3UKG A;  1IN7 A;  3KX2 A;  1I6X A;  3V4G A;  5DM7 F;  1W5T A;  4DW6 A;  1FIP A;  3A01 A;  4C3H J;  3BTC A;  4E4H A;  4IO9 F;  4M74 A;  3IWZ A;  3W6J B;  3RPU D;  1FP2 A;  3OYM A;  1HA8 A;  2HQA A;  2ZNY A;  3QOD A;  3DKX A;  3OYL A;  2JPC A;  2NXN B;  4BJ6 C;  4PDK A;  3C2H A;  4XBF A;  3RPQ A;  1RPW A;  2D1V A;  4CXF A;  2HOS A;  2VXD A;  1EF4 A;  3JRI A;  1I1G A;  2LSO A;  3OSF A;  1QQI A;  2P6S A;  5CVJ A;  4Q4Z F;  5ILV A;  4Y13 A;  2HQR A;  3P7N A;  1GVD A;  2P8T A;  3H5R A;  1Z7L A;  1MBE A;  2L4M A;  1ODD A;  5JVT A;  1S5L C;  2A69 F;  1VQ9 I;  4XM3 A;  4JX4 A;  4CZZ A;  4AU7 A;  4C9Y A;  3H3V K;  1KYW A;  3HUG A;  1MMG A;  3DWL E;  2ELJ A;  3I59 A;  4HNT A;  4RB2 C;  2QEN A;  3ABK H;  2L02 A;  4NC7 A;  4GFB A;  3T8R A;  2DPU A;  4GO1 A;  3RDI A;  2XVC A;  2CW7 A;  5J47 A;  3JRA A;  2ZXI A;  4BE1 A;  5HDN A;  3M7G A;  2VBX A;  3M8F A;  2HKO A;  4U0V A;  1HDP A;  3OL4 A;  2HVS A;  1BW5 A;  3I56 I;  4V2G A;  2KIS A;  1EKE A;  1S6L A;  3Q5F A;  1NTC A;  3OYJ A;  5ICE A;  2PMZ N;  1QZY A;  3E6D A;  1A6Q A;  3BG9 A;  2XAH A;  3RYR A;  1SFE A;  1PUF B;  4KDP A;  4L5J A;  2Q0O A;  1XGM A;  3JRE A;  2VPL A;  1RNL A;  1YJ9 I;  2JRM A;  5HNF A;  2G7U A;  1FT9 A;  3E5Q A;  3OYN A;  2H8R A;  2EV6 A;  1Y8R B;  2HEO A;  1R1V A;  4YEL A;  2XGD A;  4P96 A;  3GVA A;  4F3Q A;  3DV8 A;  5IYC J;  3GME A;  4IHW A;  1ERD A;  1R23 A;  2D1H A;  5C44 J;  5J4Y A;  4HW0 A;  3MKZ A;  3I64 A;  1BI3 A;  4BE0 A;  4KT5 C;  5E3O A;  1XD7 A;  1FOX A;  3HOX J;  2EZH A;  2EFP A;  1KU7 A;  2BV6 A;  3FXR A;  1REP C;  1GXQ A;  1SD6 A;  3S2H J;  3PO3 J;  4NHJ A;  4IHV A;  2EZI A;  4QSH A;  5ED4 A;  2M8E A;  2IVM A;  4KIC A;  1FYM A;  4HF0 A;  5IY5 H;  4UUS B;  4BHC A;  4KIG A;  4XRS A;  5FD6 A;  5EYR A;  4F91 B;  2L01 A;  2XAF A;  3H3Z A;  4EGZ A;  2NRA C;  5HS7 A;  1YS6 A;  2F5D A;  1R4N B;  3WE2 A;  1V54 H;  4BXF A;  3ABT A;  1IAW A;  3IHU A;  1PVE A;  4BBR J;  1TNT A;  2QUF A;  5F64 A;  4J00 A;  1XB4 A;  3ZMU A;  2LLK A;  1UCR A;  4DYR A;  5EGO A;  1AHD P;  2KP6 A;  3A1Y A;  2WB1 A;  3HOY J;  4A0Y A;  1FBS A;  4BHB A;  1K6O A;  4OAY A;  3RTR A;  1IDY A;  2IBD A;  2JTV A;  4CDG A;  5LGN A;  2E34 A;  4S0H B;  2P81 A;  2RQQ A;  2L0K A;  3KLO A;  5FLM J;  1GHC A;  3LSI A;  2UUZ A;  1J59 A;  1FBQ A;  2X9D A;  1Y1W J;  3I54 A;  3NWS A;  1HF0 A;  4BY1 J;  5JVG F;  3QPS A;  3SZT A;  4U7B A;  3DEE A;  2L9R A;  3CQZ J;  3ZQF A;  1WJC A;  3KCC A;  3OYG A;  2LKP A;  4QPO A;  2DDA A;  2NS7 A;  2EIK H;  1BOB A;  1WJA A;  2DFF A;  3KP4 A;  3CUQ C;  2RV8 A;  5D5X B;  1MMA A;  2LF8 A;  4AM3 A;  3TP0 A;  3K4L A;  2AS5 F;  2K4J A;  3VPR A;  4A2U A;  2VQL A;  3J7A O;  4Y52 J;  2EPF A;  3FMS A;  4IKF A;  3ZCO A;  1YYV A;  3ZP5 A;  3HHG A;  2JPB A;  4HV5 A;  4XLC A;  3GFL A;  4YG2 F;  1B8I A;  1LE8 B;  1XSX A;  4L5I A;  3RQI A;  1SMY F;  4CCN A;  1IV8 A;  2XF5 A;  2CGP A;  1JE8 A;  2X48 A;  4XK4 A;  3TOA A;  1Z91 A;  1FSH A;  3BG3 A;  1ZLK A;  1P92 A;  2UV1 A;  3M1E A;  3WTT C;  2EQR A;  3RKX A;  3HRT A;  4IQJ A;  1X58 A;  5DCM B;  1YIO A;  2V7F A;  1UFM A;  2W48 A;  4DNC A;  1MBF A;  2CRG A;  4AIK A;  2ID3 A;  4B3A A;  1ZG5 A;  3P9K A;  1J0R A;  2E36 A;  1TWG J;  1T08 B;  2FBH A;  3HRU A;  1BJZ A;  1IUY A;  1MMN A;  2QSH X;  1YS7 A;  3FMQ A;  3FM3 A;  3M1C A;  1TWF J;  3GZ5 A;  4CCM A;  2WY8 Q;  3J81 Z;  1X1P A;  5D5V B;  1I50 J;  5E1Z B;  5LGU A;  4I09 A;  5D5W B;  5IYD J;  5EEA A;  4E6K G;  1Q1V A;  2OTL I;  2A68 F;  2FOK A;  2W84 A;  4IOC F;  1ETV A;  2XRL A;  3IKT A;  2KKO A;  5J8C A;  3BTJ A;  1TTY A;  4M6V A;  2V1N A;  1DGR M;  2X4H A;  1FOK A;  3RPU A;  1YOV B;  4EJT A;  2CV0 A;  2P7C B;  3AAF A;  4I7H A;  4RB3 C;  1A04 A;  4E7J A;  1T8I A;  1HXD A;  5GAD J;  1HBX G;  2EB7 A;  1GDT A;  3LSJ A;  1OIS A;  4M6X A;  2IP2 A;  1HW2 A;  3OYH A;  4DYQ A;  3ISP A;  4GCV A;  2R5Z A;  3S8P A;  1IV6 A;  3IAS 2;  5D4S A;  4PJL A;  3MFK A;  2NVQ J;  2MH2 A;  4OIR F;  1RET A;  1X4P A;  4FTH A;  4EM2 A;  1N78 A;  2O8K A;  1W5S A;  2DA3 A;  2CQN A;  3NQO A;  4UXN A;  5DUK A;  2NVU B;  3QWL A;  2H8W A;  2VBW A;  2YUS A;  3GUD A;  3ERM A;  1U78 A;  2HQ5 A;  4IHS A;  3R6S A;  1SAN A;  4UB8 C;  4G8X A;  4FX0 A;  3OS2 A;  2XKP A;  5EDN A;  3WTV C;  3LL7 A;  2IW5 A;  3W6K B;  2FX0 A;  1Z05 A;  2K3F A;  5IP7 J;  2WAQ N;  4IXA A;  5LRS A;  3LQR A;  2XB5 A;  3FXU A;  2ELK A;  1LB2 A;  1SMT A;  3HZJ A;  4JK1 X;  3RSN A;  1O3Q A;  3PUF A;  5FKN A;  4ZYE A;  3CCS I;  4XSZ F;  3RIR A;  2LP0 A;  1OQY A;  4NC6 A;  3A01 B;  3WU2 C;  4ZTF A;  1PJR A;  2L3D A;  2L2O A;  2QGU A;  3CD6 I;  2M0M A;  4BDZ A;  4CHU A;  1R5G A;  3E97 A;  4EGY A;  2HNH A;  5B5E C;  1OKR A;  2VC0 A;  2O5R A;  3EPZ A;  3E7L A;  3EUH A;  4UUT A;  2VE9 A;  1XS9 A;  2K40 A;  4HOB A;  4RM2 A;  3S3M A;  2DMT A;  4XLP F;  1H89 C;  4HX4 A;  2GXA A;  1MND A;  3OIO A;  3T8T A;  4XL9 A;  1MZB A;  1BI1 A;  3R0J A;  1AKH B;  2V9V A;  3U21 A;  1NH3 A;  1UG2 A;  2W00 A;  1Y6I A;  3ZRG A;  2BW3 B;  4IX7 A;  3GFJ A;  3I59 B;  3QOP A;  1K6Y A;  2FQ3 A;  1BBY A;  3S2W A;  2VT3 A;  3QRF F;  3BRO A;  2VQG A;  4UB6 C;  3T0Y A;  3FX3 A;  1X1D A;  1PDN C;  3JCU C;  2DFH A;  2VC1 A;  2CW0 F;  2VBY A;  4MIM A;  4BAY A;  4J01 A;  3LSH A;  2M45 A;  2TRT A;  1LFU P;  2HVQ A;  5F27 A;  4OAZ A;  4H0E A;  2LOO A;  2CU7 A;  4Q5S F;  5B1B H;  5HOD A;  2VOO A;  1XGS A;  2OTJ I;  2TCT A;  3CCQ I;  1XX5 A;  2PMU A;  3GTQ J;  2F48 A;  1U6G A;  4EV0 A;  2QA4 I;  1WQ2 A;  3SYT A;  1S3J A;  3G71 I;  5CLS A;  2W85 A;  3MQ0 A;  2H27 A;  2TDX A;  2DK8 A;  4O6J A;  1J75 A;  1H9T A;  2FUG 2;  2R7X A;  3G1L A;  2GAU A;  3MEX A;  1TZL A;  2V26 A;  1FZP B;  2HDW A;  4BEH B;  1LJ9 A;  2MD5 A;  5FFX A;  3ABL H;  2DQR A;  2Y2Z A;  5H6Q A;  4XLA A;  2BZT A;  3S32 A;  2V9P A;  2OV7 A;  4HA8 A;  4M3G A;  4WX9 A;  5DYM A;  5CVR A;  3S2D J;  3EET A;  3LQQ A;  2LYC A;  3FXO A;  5GTH C;  2R93 J;  3DP7 A;  3S1M J;  3PIP F;  5EZH A;  2BYV E;  4HAM A;  1OLT A;  1OCO H;  1YX5 A;  1VF9 A;  5LGT A;  1O3R A;  3GO5 A;  3CCE I;  2QM3 A;  4Y15 A;  1G6N A;  4CYC A;  5HS9 A;  2MW8 A;  2HPI A;  3REO A;  4FX4 A;  1YRN A;  1WH7 A;  3HSE A;  9ANT A;  2K85 A;  1FP1 D;  2DN0 A;  2L5Q A;  2W24 A;  4CSW A;  2DI3 A;  1Y39 A;  2Y9Y A;  4U87 A;  4RLQ A;  2X6Y A;  2NVT J;  3V42 A;  3J7A Y;  1W1W E;  1OYY A;  1WGX A;  3LAJ A;  2YR2 A;  1ZRF A;  3KE2 A;  4UVA A;  5M5W J;  3DU6 A;  5LRR A;  4RGR A;  3EYI A;  4XLH A;  2CS3 A;  5LBQ A;  5IT9 Z;  2DDB A;  1IF1 A;  3IV5 A;  2KRC A;  2L9N A;  3ROU A;  4M3D A;  1YW7 A;  5EGO B;  2VON A;  2B63 J;  1R22 A;  3HKZ A;  2FNP A;  2H94 A;  4C2U A;  1J09 A;  2LTP A;  2AQF A;  2KLO A;  3LSM A;  3WG7 H;  1N75 A;  1XG1 A;  4CUG A;  3EQL F;  1RUN A;  1DU0 A;  3A2K A;  1RES A;  4L0Y B;  5LHH A;  3TDZ C;  3BQZ A;  4XQF A;  3D0S A;  4V19 K;  2MA3 A;  5E8I A;  1T39 A;  2QBY A;  1WJ5 A;  1FPQ A;  3OL3 A;  1NHA A;  3LFU A;  3SJM A;  2EV5 A;  4CYD A;  2HI3 A;  3LSG A;  2GXB A;  3H35 A;  5BMZ A;  1DDN A;  3JTG A;  1U5T A;  4KN7 X;  5ILU A;  2DFI A;  2M2E A;  4D7M A;  2DQL A;  1WVR A;  3K4J A;  3S14 J;  1G4D A;  4MQ9 F;  2HDC A;  3GTP J;  3HG9 A;  3WGI A;  4JYK A;  3MCZ A;  5C4J J;  2FOW A;  1ETW A;  4ITV A;  4LFU A;  3L2U A;  4RAY A;  4HQM A;  4LJZ F;  2H09 A;  3OS1 A;  2BGC A;  1B8I B;  1WSU A;  5K1Y A;  4CA0 A;  3DXJ F;  3E5U A;  2K86 A;  4BS9 A;  3KLN A;  5H2F C;  1CF7 B;  5FRO A;  4A3B J;  3QP5 A;  1KU2 A;  2E60 A;  3M07 A;  1Y8Q B;  3BDD A;  3OSG A;  4E70 A;  3HOW J;  3IRQ A;  2LH9 A;  1P4A A;  4AYB N;  5TGT A;  1ACI A;  2XIG A;  2R7Z J;  3BJA A;  1FYK A;  4Y3O A;  3AG1 H;  1D8K A;  2DOA A;  2JZY A;  2JSC A;  2VKE A;  4BKX A;  1MW7 A;  2E7X A;  1EH6 A;  3IH4 A;  2GA1 A;  4LIU A;  1WH5 A;  1K79 A;  1YJN I;  3IH2 A;  5FJ8 J;  4ZYG A;  1I27 A;  1IUF A;  2DT6 A;  2DCE A;  4LLG F;  2I5U A;  5HDK A;  1XPX A;  1HOM A;  3CJQ B;  3S3O A;  4PFO A;  4G6D A;  3S1N J;  4X1E A;  1L0O C;  1R1T A;  1TBX A;  1ZAR A;  5F0F A;  1IRX A;  5EG0 A;  1LEA A;  1T0F C;  4BJ5 C;  2MYS A;  5L3F A;  2IGM A;  4YIF A;  1CGP A;  2MG4 A;  3CZ6 A;  1MKM A;  3M9A A;  3GCM A;  2R4G A;  1YQA A;  2DOF A;  1ZGW A;  1NK2 P;  2EJR A;  2COM A;  1VFC A;  3TO6 A;  2EIJ H;  1BN5 A;  4IOA F;  3SZG A;  5ICC A;  1UHS A;  4B09 A;  1ZRD A;  2IS6 A;  3EUK L;  3PSI A;  4IEJ A;  1I1S A;  4M9S A;  1TWH J;  4X0G A;  4QIW N;  3DBL B;  5E17 F;  4B44 A;  4HF2 A;  3CP8 A;  2A5W A;  2PMH A;  3OIP A;  2X1D A;  4L9V A;  3OYK A;  4MLO A;  5J8F A;  2W25 A;  1D0Y A;  1XGN A;  1Z3X A;  2X1E A;  4IF4 A;  3CF5 F;  4HRI A;  1QRY A;  3B6A A;  4ENN A;  1SVM A;  3WGG A;  4RM3 A;  2A61 A;  4D5F A;  2EH3 A;  2EA2 A;  1G59 A;  2O03 A;  3DPU A;  3ZMS A;  2K7L A;  2CUF A;  3OYE A;  4UNO A;  3SQN A;  5JHU A;  1ENH A;  2JK3 A;  3VYR B;  3PSF A;  1RC9 A;  2KJB A;  1MJB A;  3L2Q A;  1MSF C;  3MWM A;  3SZP A;  3SFI A;  1IRZ A;  1NG7 A;  2NVY J;  2R92 J;  3X2Q H;  4WCG A;  2MAB A;  4EJU A;  2OAZ A;  2E5N A;  4XSX F;  4LG0 A;  5B66 C;  4M73 A;  2KPM A;  4O5V A;  4MFE A;  2VIX A;  3BG7 A;  2B9S A;  4E7H A;  1W0U A;  1BI2 A;  5D6F A;  1TW2 A;  1U3E M;  3TL4 X;  3RKW A;  2GIZ A;  2M0C A;  1O57 A;  3KYD B;  3PM1 A;  2RQP A;  4CCO A;  2ELH A;  3F8C A;  5BPD A;  2X6X A;  2FF4 A;  3HIF A;  5KK1 A;  1T33 A;  3QYB A;  2L54 A;  1W5C C;  1YW8 A;  3ZOB A;  1TQP A;  1IJW C;  2Y0S A;  3F6V A;  4L9T A;  1UB9 A;  3I58 A;  4HQE A;  1OCC H;  5E20 A;  4GXO A;  2M34 A;  1K4T A;  3OOU A;  2BOL A;  5JLX A;  2KIU A;  2R7S A;  3I9V 2;  3SXY A;  4XLN F;  1TNS A;  2JQ7 A;  2CJJ A;  1BIB A;  1IW7 F;  5GAG J;  2FQ4 A;  1G2H A;  2DJI A;  4IL6 C;  1MJ9 A;  1HCR A;  3H5A A;  3WE3 A;  3WG9 A;  2F5E A;  2A05 A;  1VI0 A;  2EK5 A;  5CQE A;  3MKL A;  1XSV A;  3AKZ A;  2D5V A;  1WI3 A;  4L18 B;  3O8G A;  4CIC A;  4NNJ A;  3SEZ A;  3Q3S A;  3B73 A;  4KA4 A;  2LKS A;  3RCO A;  2XGC A;  2UZK A;  2KJC A;  1FOW A;  1O7L A;  4I76 A;  2M87 A;  1IRF A;  2CSO A;  3WOD F;  1O3S A;  3WU1 B;  3CLO A;  3ZPL A;  1JT0 A;  1AOY A;  1S9H A;  2OZU A;  3FKJ A;  3BTI A;  3D5L A;  2QQ9 A;  1C0W A;  1LVA A;  1VQP I;  3UNG C;  4E7K A;  1D5V A;  4MQV A;  1UHM A;  1RKT A;  3FWE A;  2HZD A;  1P6R A;  4I0A A;  3K10 A;  4Z2Y A;  2HZT A;  2E19 A;  2D2W A;  4ETS A;  3I3L A;  3HOS A;  4A3L J;  1V55 H;  3Q0W A;  5M3F J;  2JRT A;  1X19 A;  3W3C A;  1QPI A;  4A3G J;  3GTK J;  2NNY A;  2AXT C;  2F2E A;  3BCA A;  2O9L A;  2H6B A;  4DOZ A;  3J80 K;  2LY1 A;  2XPU A;  1Z0X A;  4OMZ A;  1B1B A;  1B4A A;  1BIA A;  5J4V A;  2DA7 A;  3K6G A;  3QU6 A;  3PIO F;  3HOT A;  5IT3 A;  2FBI A;  3S3N A;  1R36 A;  3WGH A;  5K5Q A;  4XIC A;  2M4G A;  2XGX A;  3HPG A;  1T56 A;  1O3T A;  3EDP A;  4QPQ A;  1JTX A;  3J80 Z;  3BT9 A;  2R0Q C;  5HOO A;  4C30 A;  1JGG A;  3TQN A;  4ENK A;  5HLT A;  2YS9 A;  3ZN1 A;  2HWV A;  3I71 A;  5KNL A;  2ESH A;  3QYF A;  4B4C A;  4MO7 A;  2OUM A;  4Q47 A;  1VQK I;  3VFZ A;  4PJM A;  2IPQ X;  2BXY A;  5E3N A;  2I8D A;  1UMQ A;  2Y9Z A;  3IP4 B;  5F08 A;  2ID6 A;  3V8J A;  3ZQH A;  2O61 A;  3HTS B;  4EJV A;  2W1O A;  3K70 C;  2HOA A;  2F5F A;  2R7U A;  1KGS A;  1E17 A;  2VKH A;  5CQG A;  4CCL A;  3HJE A;  1FMW A;  2ESN A;  2V1X A;  1U5T B;  3FKI J;  2ZSI B;  4FE7 A;  2MH9 A;  1HKQ A;  3H5N A;  4JQF A;  4PSW A;  1BC8 C;  4XOR A;  1K61 A;  1QA6 A;  2FML A;  1O7F A;  2IS1 A;  1FC3 A;  4GGG A;  2L7M P;  4M71 A;  1K78 A;  4AUX A;  3IL2 A;  2ZKZ A;  1VQ6 I;  1FEX A;  3CMA I;  5J3L A;  4BNC A;  4EM0 B;  1A31 A;  4IHY A;  5D6E A;  3HOZ J;  5DM6 F;  2J5P A;  4A6D A;  4IHX A;  3ECO A;  3FDY A;  4RMN A;  3IRR A;  5HNH A;  2R7W A;  3PNY A;  4G12 A;  2EZK A;  3FZV A;  1DPR A;  2WV0 A;  2VOD A;  3I4P A;  3NWT A;  5EF6 A;  2ICW G;  4DZJ A;  4OMY A;  2ZJR F;  3HPH A;  1LFB A;  2E1M B;  2ZJ2 A;  3ONQ A;  3JSP A;  2EFQ A;  3CJR B;  2XSD C;  2KRF A;  3TW6 A;  5FLV A;  1AWC A;  3CO6 C;  1AA7 A;  1SD5 A;  4BAC A;  2AQE A;  4RB1 A;  1MNM C;  4B43 A;  3L2V A;  1TQI A;  1WPK A;  2WAF A;  1TT5 B;  2W7N A;  2Y69 H;  3QQA A;  3GTM J;  4JX6 A;  4C2M J;  4ZYH A;  1E3H A;  2V6E A;  4I2O A;  3AFH A;  2V6C A;  5A2Q K;  1LPQ A;  3OYI A;  6PAX A;  4DIQ A;  2VQC A;  1IN4 A;  1POG A;  5BS6 A;  3W6V A;  2JA2 A;  3WHC A;  2DA2 A;  3VYT B;  1W7P B;  4CH7 A;  1MDM B;  5EG0 B;  2DT5 A;  2X0L A;  2VKD A;  2Y31 A;  3W2A A;  4A12 A;  2O7O A;  2STT A;  2E2I J;  3CDH A;  3MKY B;  4XRM A;  1E0E A;  1JUP A;  4AC0 A;  1ZR4 A;  4F7Z A;  1JKR C;  3CES A;  4KIF A;  2H1K A;  4LLN A;  2KFD A;  1JKP C;  4LD5 A;  2V1U A;  1JUS A;  3E5X A;  4G6T B;  2BVM A;  1RR8 C;  3U1D A;  1SFO J;  2IAI A;  2QEX I;  1YI2 I;  3BZK A;  3LA2 A;  5L3C A;  2ADU A;  3KZI C;  3W2V A;  1I3A A;  1U8R A;  3L09 A;  4LOC A;  5J1Y A;  2LFB A;  1ONV A;  5F0C A;  2VI6 A;  3V7R A;  3CME I;  3HM5 A;  2LVS A;  2VXZ A;  5FRN A;  1ULY A;  2VT2 A;  3SFZ A;  1U9N A;  1R5I D;  4EVI A;  4BXX J;  1PUE E;  2LNB A;  2LF7 A;  1DU6 A;  5CPR B;  4B3X A;  2PX9 A;  3FXL A;  2VLA A; 
#chains in the Genus database with same CATH homology
 4ZZD A;  4RGS A;  1R1U A;  5L3D A;  5HLG A;  4G94 A;  2FBK A;  1WRJ A;  1J2X A;  1Z6T A;  3JW4 A;  2HR3 A;  2QVO A;  4NQW A;  2IRF G;  3NRV A;  1LDD A;  1P4X A;  2OQR A;  4RGU A;  1VTN C;  3F8B A;  1Y0U A;  4CO8 A;  3KZZ A;  3KFW X;  3KEO A;  2NS0 A;  4CGZ A;  4M6Y A;  2UWM A;  1QZZ A;  3P9C A;  1SD7 A;  1ZYR F;  2YX7 A;  3CJN A;  2CG4 A;  4K2E A;  3ELK A;  4IPA A;  4P9U A;  3K69 A;  1H9G A;  4TV7 A;  2Y48 A;  1U5T C;  4YII A;  2Z33 A;  1WI9 A;  4N9I A;  2K4B A;  1W7P D;  4P9F A;  4A6E A;  4KMU X;  4EJO A;  2Y75 A;  1X3U A;  2PBI A;  3FXQ A;  4BQA A;  1XMA A;  2FRH A;  5FFZ A;  1J7K A;  2CFX A;  2RNJ A;  1KU3 A;  5K5R A;  2GWR A;  3C1D A;  3K9T A;  1R58 A;  4U88 A;  2HGC A;  2XAS A;  3CUQ A;  3E6B A;  2P5K A;  3BY6 A;  4P5O A;  5AIQ A;  1W4M A;  3DQV C;  3V8K A;  5BQT A;  2P6T A;  2JT1 A;  2EV0 A;  1YLF A;  1U2W A;  5FLX K;  3HRM A;  4IRH A;  3WTY C;  4UV8 A;  1ON2 A;  1QO0 D;  3P9I A;  4A0Z A;  3KET A;  5LHI A;  1GVJ A;  2P5L C;  4KN4 X;  3QAH A;  4IJA A;  5FLX Z;  3G3Z A;  2D45 A;  3BPV A;  1XSD A;  4HYE A;  5D8L B;  1FY7 A;  1V4R A;  2E1C A;  3GFI A;  1B9N A;  1STZ A;  4MNU A;  3E6M A;  2MLK A;  1B6A A;  3F72 A;  3F22 A;  1XDS A;  3L2C A;  3V7C A;  5CJ9 A;  3L7W A;  5D5U B;  4HZF A;  2ETH A;  2K02 A;  2FEZ A;  5JR3 A;  2HTJ A;  4PGG A;  3WTZ A;  4YFX F;  1IN6 A;  5ICF A;  3MAJ A;  2NAZ A;  3HTU A;  1HKT A;  1XMK A;  3RJP A;  1G3S A;  1K78 B;  3DF8 A;  2VE8 A;  2OZ6 A;  3GF2 A;  3QPT A;  4LGW A;  4LK0 F;  3O3K A;  2A07 F;  1ZHF A;  5L3B A;  4IHT A;  3ML6 A;  1KQ0 A;  4WF2 A;  4HX8 A;  3R61 A;  4DQ2 A;  2O3F A;  5HLI A;  1Z7U A;  4LMY A;  1ZRE A;  4KNY A;  2B0L A;  3VEP A;  4G7H F;  4S05 A;  2QQA A;  4FT8 A;  4UUV A;  3O6B B;  1YTY A;  4A5M A;  2FXA A;  3QP6 A;  4OIO F;  2C6Y A;  1FX7 A;  3DPL C;  3JAM K;  1UHW A;  3PQK A;  2UXX A;  1LEB A;  1IRG A;  2Z99 A;  4M9X A;  5AON A;  5DD4 A;  4HF1 A;  2GQQ A;  1RI7 A;  3HRS A;  3HSF A;  4ASN A;  5HDG A;  1Q1H A;  3MZY A;  3F8M A;  1Z1D A;  3BOQ A;  1OYI A;  2P4W A;  3F6O A;  3IWF A;  5DD8 A;  2Z9O A;  1I5Z A;  4LB5 A;  4GYG A;  1F5T A;  4HDU A;  1YFH A;  4D0P A;  3L00 A;  2A6E F;  1EV7 A;  3CUO A;  2FE3 A;  4EQQ A;  3LWF A;  1YO5 C;  2R7F A;  1KA8 A;  5BOX A;  2M1B A;  1T2K A;  4NB5 A;  3GEZ A;  4WK8 F;  4I01 A;  1BM9 A;  3JSO A;  1BOA A;  1PP8 F;  1KQ8 A;  5CVI A;  2XRN A;  1LDJ A;  3V8L A;  4I0B A;  3VB2 A;  2PFB A;  4U0W A;  1S29 A;  1XDU A;  1ON1 A;  4GYI A;  2QWW A;  1P4W A;  3TDU C;  3RKY A;  1LDK B;  2BEO A;  4BH9 A;  1H0M A;  1B59 A;  4UV9 A;  1V3F A;  4R79 A;  4HV6 A;  2FNA A;  4EM1 A;  5FGM A;  5D4R A;  2ZME A;  3H92 A;  3F8F A;  1FBU A;  4U7D A;  1D3Y A;  1TLH B;  2XUB A;  1P2F A;  1USS A;  2VN2 A;  2WTE A;  1R7J A;  3CUQ B;  1ZRC A;  1XCV A;  2GIV A;  2Z3Y A;  1F1Z A;  4UVC A;  5CVU A;  3OV8 A;  3KZY A;  2OA4 A;  1JHF A;  4Q48 A;  2ZXJ A;  4N0B A;  2DTR A;  3COA C;  1J9I A;  4BHP A;  1RIO H;  1G3Y A;  5L3E A;  3KP7 A;  2HOE A;  2OU2 A;  4YFN F;  5H20 A;  3E6C C;  4M72 A;  1OYW A;  1UST A;  2XAJ A;  3U2R A;  2QYO A;  2M5W A;  5KVR A;  4ESJ A;  3VOD A;  2ZBK A;  4MTD A;  5DV5 A;  3LST A;  4LLL A;  1MJA A;  4ZH4 F;  4OOI A;  1S7O A;  2HKX A;  3KEQ A;  3R4K A;  3IC7 A;  2GA2 A;  1T0F A;  4RGX A;  1G3W A;  4O3M A;  5E8G A;  2XHK A;  1PP7 U;  3ZN0 A;  5F6F A;  3GZ6 A;  1ZGJ A;  1ZH5 A;  3Q9V A;  4RS8 A;  2DU9 A;  2G9W A;  2H6C A;  2YPR A;  4OIQ F;  2FU4 A;  1T98 A;  3K1P A;  5AIP A;  2EWN A;  3PQJ A;  5TRD A;  3T1B A;  4AIJ A;  5JFR A;  3LA7 A;  4ON0 A;  1IN8 A;  4PZJ A;  3HSR A;  3N97 A;  4MEX F;  2WC2 A;  2P5V A;  3MZH A;  2KIF A;  1BC7 C;  3NEU A;  2QBY B;  3TO7 A;  1HST A;  2E1N A;  1QGP A;  3CO7 C;  3R0A A;  3FMR A;  2PLY A;  2HQN A;  2EFW A;  2QLZ A;  3ZMZ A;  2PJP A;  5FD5 A;  5HS8 A;  2ZNZ A;  1IXS B;  3DFG A;  4BXU A;  1TW3 A;  4A5N A;  1E2X A;  4MGR A;  5F1R A;  1JGS A;  4ZZL A;  4OIP F;  3U9G A;  3WTU C;  2VBZ A;  2L4A A;  3R60 A;  1TQM A;  3HYI A;  1B9M A;  3I53 A;  1LQ1 A;  2UXN A;  1SFX A;  3ZQ7 A;  4KIB A;  1MGT A;  3VOE A;  2XV4 S;  2RKH A;  1SFU A;  4QLC U;  1HW5 A;  1QNT A;  4G7O F;  4JBA A;  3TOB A;  1BI0 A;  1S7A A;  2HTS A;  5JI6 A;  3H3U A;  2J5O A;  5ERI A;  4L9N A;  3ZMD A;  4IRI A;  2OD5 A;  2DPD A;  5D8K B;  1KQ9 A;  2RDP A;  4I02 A;  2RN7 A;  5A2Q Z;  1QPM A;  1IN5 A;  2RVC A;  3EYY A;  1CF7 A;  2ACJ A;  5HLH A;  3FHZ A;  2CWE A;  3WTW C;  4OIN F;  5K5O A;  3J81 K;  2OBP A;  4UVB A;  5LEK A;  3FF5 A;  4A0X A;  4G6Q A;  1HSJ A;  2IA2 A;  1RUO A;  4ENJ A;  2IJL A;  3BJO A;  5CYV A;  1WKM A;  3F8N A;  2Y0M A;  2Z5U A;  4M9Z A;  4ESB A;  2V1D A;  3BJ6 A;  4LG0 B;  4L9J A;  3IKV A;  3TKY A;  3HHH A;  3O2P E;  2ZFW A;  1JHH A;  2XAQ A;  2ISZ A;  1IXR C;  4Y17 A;  4G9Y A;  5TJJ A;  5ICG A;  1ZAO A;  4PGH A;  2KIM A;  1IZ1 A;  3F21 A;  4KUM A;  2ZME B;  4AWX B;  2QZ8 A;  2FA5 A;  1YG2 A;  2NNN A;  2DBB A;  1K7A A;  2RGV A;  2E7W A;  2PG4 A;  2Q2E A;  1Z6R A;  1XGO A;  3GW2 A;  4FHT A;  2A6H F;  3KP5 A;  5FO5 A;  3SHF A;  2FSW A;  2W57 A;  2GXG A;  3RI4 A;  1YW9 A;  2EFO A;  3WTS C;  2F5C A;  3BPX A;  5CVV A;  3L9F A;  5E18 F;  2EA4 A;  3T5X A;  1F4K A;  1ZG1 A;  1ZLJ A;  2IT0 A;  2ZO4 A;  2GZW A;  2BBY A;  4G7Z F;  4ENM A;  4WXD A;  3JTH A;  4RAZ A;  2PI0 A;  2R7D A;  4ESF A;  3GLX A;  1FYL A;  2PEX A;  3C3W A;  3FM5 A;  3ULQ B;  1XCB A;  4L0Z B;  2AXL A;  1KU9 A;  1DPU A;  2XAG A;  1T38 A;  4LK1 F;  5EEH A;  4AIH A;  4HBL A;  3I5U A;  4MHG A;  5H6R A;  2LDU A;  1ZN2 A;  3KP3 A;  3F3X A;  1WWX A;  3ECH A;  4RB0 A;  3BZ6 A;  1S8N A;  1IXC A;  4QWQ A;  5ILS A;  4EJW A;  3E3V A;  4MTE A;  5DUI A;  1HW1 A;  5DCF A;  3RYP A;  1EH8 A;  2PQ8 A;  3K1M A;  5E1W A;  5LHG A;  3N4M A;  3C18 A;  3F23 A;  3ZMV A;  1R00 A;  4HDV A;  4WWC A;  1BJA A;  1OMI A;  2IA0 A;  1JXS A;  5IT9 K;  5L3G A;  4MEY F;  3ZMT A;  2DO7 A;  3GXO A;  4AVP A;  3OOP A;  4N9H A;  2Q8K A;  2CYY A;  3WU0 A;  3WTX C;  2R3S A;  4U0Y A;  3PFI A;  4KFC A;  1HKS A;  3LA3 A;  2MLG A;  2BE5 F;  3GWZ A;  2HYG D;  5LEJ A;  2YX4 A;  5LLQ A;  2DW4 A;  4IVN A;  3GFM A;  3M8E A;  2A5Y B;  3K2Z A;  2ZCW A;  1FLI A;  1ZG3 A;  1FNN A;  3DPT A;  1T6S A;  4P55 A;  2XRO A;  2DK5 A;  2STW A;  1F9N A;  2OQG A;  2EFN A;  3LAP A;  3C7J A;  3ABU A;  2CQK A;  4WXH A;  4BYY A;  3BWG A;  2DAO A;  4R1H A;  1R5H A;  3KP6 A;  4HLY A;  3QU3 A;  5BPI A;  1OR7 A;  2HYF A;  4PCQ A;  1SAX A;  4S04 A;  1OPC A;  2IA1 A;  2YSR A;  3JAM Z;  2MC3 A;  1L3L A;  3B02 A;  2A3S A;  2ISY A;  3Q9S A;  1DP7 P;  1GXP A;  2VOP A;  1J5Y A;  2HS5 A;  1DUX C;  2RC4 A;  1EH7 A;  2CO5 A;  2YU3 A;  1FSE A;  5J6X A;  2O0Y A;  1HQC A;  3V7S A;  4I98 B;  3LFK A;  4WXC A;  2V79 A;  4KYW A;  3CTA A;  2G7H A;  5HVQ C;  2NYX A;  1MD0 A;  2MBF A;  3K0L A;  2PN6 A;  1W7P A;  5E1X A;  1MDM A;  4XRF A;  5DCM A;  4EMS A;  4ZYD A;  2FMY A;  4IRG A;  2DLL A;  2HFH A;  4YFK F;  2O6G E;  4B8X A;  3GX4 X;  4UHT A;  3G73 A;  2K27 A;  3KP2 A;  5DEQ A;  5EEG A;  1SD4 A;  1QBJ A;  4HLX A;  3TO9 A;  3DKW A;  1Z9C A;  4OU0 A;  1G3T A;  4KMF A;  4LB6 B;  1FWZ A;  2QQB A;  3I0T A;  3ERE D;  4HX7 A;  4AD9 A;  2O8X A;  1D8J A;  1XN7 A;  1KYZ A;  1RZ4 A;  3K1N A;  4R8H A;  3TGN A;  5FB2 A;  2WWY A;  3DEU A;  5DDG A;  1ZGA A;  3QPH A;  2M30 A;  2XKO A;  3GYH X;  1LNW A;  2P7V B;  3BP8 A;  1IN7 A;  1I6X A;  3V4G A;  1W5T A;  4M74 A;  3IWZ A;  3W6J B;  1FP2 A;  2ZNY A;  2JPC A;  4PDK A;  4XBF A;  3RPQ A;  2D1V A;  4CXF A;  1I1G A;  2LSO A;  1QQI A;  2P6S A;  5CVJ A;  4Q4Z F;  5ILV A;  4Y13 A;  2HQR A;  3P7N A;  2P8T A;  2L4M A;  1ODD A;  5JVT A;  2A69 F;  4CZZ A;  1KYW A;  3HUG A;  3I59 A;  4RB2 C;  2QEN A;  2L02 A;  3T8R A;  2DPU A;  4GO1 A;  3RDI A;  2XVC A;  5HDN A;  3M7G A;  2VBX A;  3M8F A;  2HKO A;  4U0V A;  1S6L A;  3Q5F A;  5ICE A;  1QZY A;  3E6D A;  2XAH A;  3RYR A;  1SFE A;  4KDP A;  4L5J A;  2Q0O A;  1XGM A;  1RNL A;  2G7U A;  1FT9 A;  3E5Q A;  2EV6 A;  2HEO A;  1R1V A;  4P96 A;  3GVA A;  3DV8 A;  1R23 A;  2D1H A;  4HW0 A;  3I64 A;  1BI3 A;  4KT5 C;  1XD7 A;  2EFP A;  1KU7 A;  2BV6 A;  3FXR A;  1REP C;  1GXQ A;  1SD6 A;  4NHJ A;  5ED4 A;  2M8E A;  2IVM A;  4KIC A;  1FYM A;  4HF0 A;  4BHC A;  4KIG A;  5FD6 A;  2L01 A;  2XAF A;  3H3Z A;  4EGZ A;  2NRA C;  5HS7 A;  1YS6 A;  2F5D A;  3WE2 A;  3ABT A;  1IAW A;  3IHU A;  1TNT A;  2QUF A;  5F64 A;  1XB4 A;  3ZMU A;  1UCR A;  4A0Y A;  1FBS A;  4BHB A;  1K6O A;  3RTR A;  2JTV A;  4CDG A;  5LGN A;  3KLO A;  1GHC A;  1J59 A;  1FBQ A;  3I54 A;  3SZT A;  4U7B A;  3KCC A;  2LKP A;  3KP4 A;  3CUQ C;  2RV8 A;  5D5X B;  2LF8 A;  2AS5 F;  2K4J A;  4A2U A;  3J7A O;  3FMS A;  1YYV A;  3ZP5 A;  3HHG A;  2JPB A;  4HV5 A;  3GFL A;  4YG2 F;  1XSX A;  4L5I A;  1SMY F;  2CGP A;  1JE8 A;  1FSH A;  3TOA A;  1Z91 A;  1ZLK A;  1P92 A;  3M1E A;  3WTT C;  3RKX A;  3HRT A;  5DCM B;  1YIO A;  1UFM A;  4DNC A;  4AIK A;  1ZG5 A;  3P9K A;  1J0R A;  2FBH A;  3HRU A;  1IUY A;  1YS7 A;  3FMQ A;  3FM3 A;  3GZ5 A;  3J81 Z;  5D5V B;  5E1Z B;  5LGU A;  4I09 A;  5D5W B;  2A68 F;  2FOK A;  2W84 A;  3IKT A;  2KKO A;  5J8C A;  1TTY A;  1FOK A;  2X4H A;  3RPU A;  4EJT A;  2P7C B;  3AAF A;  4I7H A;  4RB3 C;  1A04 A;  1HXD A;  1HBX G;  2EB7 A;  4M6X A;  2IP2 A;  1HW2 A;  3ISP A;  4GCV A;  5D4S A;  3MFK A;  2MH2 A;  4OIR F;  4EM2 A;  1W5S A;  4UXN A;  3NQO A;  5DUK A;  2VBW A;  3GUD A;  1U78 A;  4IHS A;  3R6S A;  4G8X A;  4FX0 A;  2XKP A;  3WTV C;  2IW5 A;  3W6K B;  1Z05 A;  4IXA A;  5LRS A;  3LQR A;  3FXU A;  1LB2 A;  1SMT A;  4JK1 X;  1O3Q A;  4ZYE A;  4XSZ F;  3RIR A;  2L3D A;  4CHU A;  1R5G A;  3E97 A;  4EGY A;  1OKR A;  2VC0 A;  3EUH A;  2VE9 A;  4HOB A;  4XLP F;  4HX4 A;  3T8T A;  1MZB A;  1BI1 A;  3R0J A;  2V9V A;  3GFJ A;  3I59 B;  3QOP A;  2FQ3 A;  1BBY A;  3S2W A;  2VT3 A;  3QRF F;  3BRO A;  3T0Y A;  3FX3 A;  1PDN C;  2VC1 A;  2CW0 F;  2VBY A;  4BAY A;  2M45 A;  4H0E A;  4Q5S F;  2VOO A;  1XGS A;  2PMU A;  4EV0 A;  1U6G A;  1WQ2 A;  1S3J A;  5CLS A;  2W85 A;  3MQ0 A;  2H27 A;  2TDX A;  2DK8 A;  4O6J A;  1J75 A;  1H9T A;  2GAU A;  3MEX A;  1FZP B;  1LJ9 A;  2MD5 A;  5FFX A;  2DQR A;  5H6Q A;  4HA8 A;  4WX9 A;  5DYM A;  5CVR A;  3EET A;  3LQQ A;  3DP7 A;  2BYV E;  4HAM A;  5LGT A;  1O3R A;  3GO5 A;  2QM3 A;  4Y15 A;  1G6N A;  5HS9 A;  4FX4 A;  3REO A;  3HSE A;  1FP1 D;  2W24 A;  2DI3 A;  1OYY A;  3LAJ A;  2YR2 A;  1ZRF A;  3KE2 A;  4UVA A;  5LRR A;  4RGR A;  3EYI A;  5LBQ A;  5IT9 Z;  1IF1 A;  3ROU A;  1YW7 A;  2VON A;  1R22 A;  2FNP A;  2H94 A;  3EQL F;  1RUN A;  4L0Y B;  5LHH A;  3TDZ C;  3D0S A;  2MA3 A;  5E8I A;  1T39 A;  2QBY A;  1FPQ A;  1NHA A;  2EV5 A;  4CYD A;  2GXB A;  5BMZ A;  1DDN A;  3JTG A;  1U5T A;  4KN7 X;  5ILU A;  2DFI A;  2DQL A;  1G4D A;  4MQ9 F;  2HDC A;  3WGI A;  3MCZ A;  4LFU A;  4RAY A;  4HQM A;  4LJZ F;  2H09 A;  2BGC A;  1WSU A;  5K1Y A;  3DXJ F;  3E5U A;  2K86 A;  3KLN A;  1CF7 B;  3QP5 A;  1KU2 A;  3BDD A;  4E70 A;  3IRQ A;  1P4A A;  2XIG A;  3BJA A;  1FYK A;  1D8K A;  2JZY A;  2JSC A;  2E7X A;  1EH6 A;  2GA1 A;  1K79 A;  4ZYG A;  1I27 A;  4LLG F;  5HDK A;  4G6D A;  1L0O C;  1R1T A;  1TBX A;  1ZAR A;  1LEA A;  5L3F A;  4YIF A;  1CGP A;  1MKM A;  3M9A A;  1YQA A;  2EJR A;  2COM A;  3TO6 A;  1BN5 A;  5ICC A;  1ZRD A;  4B09 A;  1I1S A;  4M9S A;  5E17 F;  4HF2 A;  4L9V A;  2PMH A;  5J8F A;  1XGN A;  2W25 A;  4IF4 A;  4ENN A;  3WGG A;  2A61 A;  2EA2 A;  2O03 A;  3ZMS A;  2K7L A;  4UNO A;  3SQN A;  5JHU A;  2KJB A;  1MJB A;  3MWM A;  3SZP A;  4WCG A;  4EJU A;  2OAZ A;  4XSX F;  4LG0 A;  4M73 A;  4O5V A;  1BI2 A;  5D6F A;  1TW2 A;  1U3E M;  3RKW A;  1O57 A;  2RQP A;  2ELH A;  3F8C A;  5BPD A;  2FF4 A;  3HIF A;  5KK1 A;  2L54 A;  1YW8 A;  1TQP A;  3F6V A;  4L9T A;  1UB9 A;  3I58 A;  4HQE A;  5E20 A;  4GXO A;  2KIU A;  3SXY A;  4XLN F;  1TNS A;  1BIB A;  1IW7 F;  1MJ9 A;  3WE3 A;  3WG9 A;  2F5E A;  2EK5 A;  1XSV A;  4L18 B;  4CIC A;  3B73 A;  4KA4 A;  2UZK A;  2KJC A;  1O7L A;  2M87 A;  1IRF A;  2CSO A;  3WOD F;  1O3S A;  3WU1 B;  3CLO A;  3ZPL A;  1AOY A;  2OZU A;  3D5L A;  2QQ9 A;  1C0W A;  1LVA A;  1D5V A;  4MQV A;  1UHM A;  3FWE A;  1P6R A;  4I0A A;  4Z2Y A;  2HZT A;  2D2W A;  4ETS A;  3HOS A;  2JRT A;  2NNY A;  2F2E A;  2H6B A;  3J80 K;  4OMZ A;  1B1B A;  1B4A A;  1BIA A;  3QU6 A;  3HOT A;  5IT3 A;  2FBI A;  1R36 A;  3WGH A;  5K5Q A;  2XGX A;  1O3T A;  3EDP A;  3J80 Z;  5HOO A;  3TQN A;  4ENK A;  3ZN1 A;  2HWV A;  3I71 A;  2ESH A;  4Q47 A;  3VFZ A;  2IPQ X;  3V8J A;  2O61 A;  3HTS B;  4EJV A;  2F5F A;  1KGS A;  1E17 A;  2ESN A;  2V1X A;  1U5T B;  2MH9 A;  1HKQ A;  4JQF A;  1BC8 C;  2FML A;  1O7F A;  1FC3 A;  4GGG A;  4M71 A;  1K78 A;  3IL2 A;  2ZKZ A;  4BNC A;  4EM0 B;  5D6E A;  2J5P A;  4A6D A;  3ECO A;  3IRR A;  3FZV A;  1DPR A;  2WV0 A;  2VOD A;  3I4P A;  4OMY A;  2ZJ2 A;  3JSP A;  2EFQ A;  2KRF A;  1AWC A;  3CO6 C;  1SD5 A;  4RB1 A;  1TQI A;  4ZYH A;  4I2O A;  2V6C A;  5A2Q K;  6PAX A;  1IN4 A;  5BS6 A;  1W7P B;  1MDM B;  2DT5 A;  2X0L A;  4A12 A;  2STT A;  3CDH A;  4F7Z A;  4LLN A;  4KIF A;  4LD5 A;  2V1U A;  3E5X A;  3U1D A;  3LA2 A;  5L3C A;  2ADU A;  1U8R A;  3L09 A;  1ONV A;  3V7R A;  2VXZ A;  1ULY A;  2VT2 A;  3SFZ A;  4EVI A;  1PUE E;  2LNB A;  2LF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...