2E36A

L11 with sans refinement
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
publication title The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2e36A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2e36A01
2OTLI 2JQ7A 1FOWA 3EGVB 1VQLI 4IOAF 2ZJRF 3G6EI 3CC7I 5DM7F 1QA6A 3J7YJ 3CCEI 2H8WA 2NXNB 3CJTB 1VQ4I 3CCQI 4IO9F 3CCVI 5DM6F 3J7ZI 2E34A 1YHQI 3CJSB 2E35A 3CCJI 1VQKI 1ACIA 3PIPF 1VQ9I 2QEXI 2OTJI 4V19K 1VQPI 3G71I 1HC8A 1VQ5I 1YI2I 1VQ6I 3CJQB 3I55I 3CMEI 2QA4I 4UY8I 3CF5F 2E36A 1FOYA 3CC4I 3CCMI 2ZJQF 1VQMI 3G4SI 1Y39A 1VQNI 1YJNI 3CMAI 1YITI 5GAEJ 1WIBA 5JVGF 2FOWA 1VQ8I 5GADJ 2ZJPF 1VQOI 3CCRI 2K3FA 3CCUI 4IOCF 1FOXA 3CC2I 1YJ9I 3CJRB 3CD6I 3PIOF 5GAGJ 1VQ7I 3I56I 1YIJI 5GAHJ 3CCLI 1YJWI 1MMSA 1S72I 3CCSI 3DLLF
chains in the Genus database with same CATH superfamily
5EDNA 3KYLA 2HOTA 3DEWA 3K2ZA 3PQKA 4PK4A 5LEKA 1F1ZA 3FZVA 1TNSA 1TP4A 1FYKA 3A01A 4GRIA 3RQ4A 3PL8A 2ZSIB 1FNNA 4D5FA 2JMWA 3ZQHA 3K4BA 4Q4ZF 3FM5A 4L9TA 3FXKA 2AXLA 1MDMA 2Q2EA 2KIQA 3A2KA 3CJTB 4C30A 3P7NA 4A3MJ 3F8MA 4BQQA 1WPKA 4YIRX 4CO8A 1DP3A 1IJWC 1WRJA 1JUMA 5JHUA 4LIUA 2DMNA 3CCVI 4JX6A 3SZPA 2UXNA 3LQQA 1G4DA 3BTCA 5DM6F 3ZOBA 2HTSA 1JT0A 3G1OA 5KAFC 1WJCA 2XF5A 4N9IA 3S32A 1DDNA 3F3XA 3K1MA 2COBA 4A6DA 2CFXA 4A3BJ 2MD0A 3NWSA 1E2XA 2MGQA 3WHBA 4FTHA 2VQGA 3OYGA 1SD7A 2CQ7A 2HQ5A 3RTRA 3JREA 1QVTA 4O6JA 5F08A 2DFFA 2LOOA 4UVAA 1BW6A 4A5MA 1MH4A 3RSNA 4XK4A 1A6QA 3K4CA 3Q0WA 4GYGA 1K78B 3K4NA 3CJQB 4A3DJ 1O3SA 2Y48A 3V7RA 2XVCA 2LREA 1Y8QB 1A6IA 2JA2A 2RV8A 2L9RA 2YX7A 5L3BA 3RZOJ 4RS8A 2DK8A 2FBKA 3B6CA 2WB1N 4YELA 3M1EA 5L3CA 3OL4A 4XN0A 1SVMA 1BJZA 3OYHA 3JRGA 3KETA 2G7UA 2JVHA 3IKVA 1OPCA 2VBXA 4HQMA 1EV7A 4LK1F 2CW0F 3ABUA 3VYSB 3ECOA 2P6TA 3MVPA 1FJLA 2QQ8A 3CCUI 1YTYA 4YRVA 1IN7A 3MWMA 2O61A 3LFUA 4IXAA 2CV2A 1OCTC 2XAJA 4XNFA 3A1YA 3F9KA 1HKTA 2YUSA 2JA5J 3HM5A 3VB2A 1T2KA 1TQIA 5E3NA 4A3CJ 1X1CA 2A07F 3IUOA 1D3YA 1B8IA 3I59A 2IXSA 1NG6A 5HS8A 2DK5A 1RUNA 1XSXA 3ISPA 5FGMA 2WB1A 4DZPA 3ESWB 4G12A 3A03A 1J7KA 2EFOA 2X51A 4BQOA 2JQ7A 1Z1DA 2LK2A 2HNHA 2P7VB 1BR4A 2A5YB 5IP6A 2HKXA 4XORA 2DMQA 2V79A 3ABTA 1JKRC 4XOPA 3CC7I 1JTXA 5DM7F 2KT0A 4QPQA 4Y13A 4IO9F 3GTGJ 3T5XA 2NYXA 3PFIA 5JHFA 2FQ4A 4OAZA 3S1MJ 1YLFA 2G0EA 3G1LA 2TDXA 3KEQA 5ICCA 2KRFA 2Z1DA 1E3PA 4AU7A 4D7MA 4BNCA 5DEQA 1SC7A 1TQMA 4MFDA 3VYUB 1Y6IA 1E0EA 1LJ9A 2VXDA 1FP1D 2GQQA 4FE7A 3TBIA 1Y1WJ 4YG2F 2K02A 4U0YA 3KIOA 2F5CA 5TJJA 2XV4S 2K9MA 4C3HJ 1IRGA 4C3JJ 3I64A 3SDBA 2OTJI 5E3OA 2DLLA 1NTCA 2H09A 1ZRFA 2FBIA 3BR5A 3G71I 2WAQA 1ITYA 4MHGA 2NS8A 1B9NA 3SXYA 3HEFA 1O7LA 1U5TC 2KIMA 5H2FC 3PO2J 3B02A 3BG5A 5A2QK 3Q9VA 4IEJA 2VE9A 4UY8I 2H8RA 4KT6A 1FOYA 3DBLB 3SEZA 4XICA 5HNFA 3OS2A 4RA2A 2GXGA 4HNUA 1H9GA 4FX0A 4IHTA 3UR3C 5EZHA 3FKIJ 2JTVA 2XSDC 1K6OA 1X1AA 3CMAI 3H5RA 3MD2A 2M0MA 2GXAA 2R7OA 5JVGF 2L7KA 2K7LA 2JN6A 2CUZA 2HXIA 2MSYA 3GTPJ 1JUPA 2HI3A 2X6YA 3Q5FA 2HWVA 2ADUA 2MYSA 1D5VA 5IOYA 3P5JA 4ENNA 2L7MP 1R4MB 1Y1VJ 3CC2I 1GHCA 3GTOJ 2LNBA 1UHMA 1X4OA 1QQIA 4XBFA 1HDDC 3MN2A 4HAMA 4ENMA 3G1MA 3E97A 4M71A 5D4RA 1B4AA 2QQ9A 4CYCA 1LFBA 1Z7UA 4L5EA 2A68F 2LRDA 5J3LA 3BG9A 3TDZC 2R92J 2IA0A 4YFNF 1UHSA 2ID3A 1CF7A 5D4SA 1O3QA 2QQAA 1S72I 2E60A 2M30A 3RPQA 1U5TA 2V6CA 3ZQLA 2XAFA 2I10A 5C4JJ 2HQAA 4E7KA 1WZ2A 4DBRA 4II3A 3I4NJ 2BY0A 1U78A 3O2PE 1YIOA 2XHKA 5J1UA 3R61A 5CJ9A 3TW6A 5FRNA 1IAWA 2BXZA 3WGIA 2LP0A 2X4HA 4C9YA 1VNDA 4MQVA 2H1KA 3KFWX 4HLYA 2F5DA 3F8NA 3F8FA 2NXNB 3BTLA 1JGSA 1P7JA 2LBFB 2FF4A 4RLQA 3OS1A 3OYBA 2KRCA 5C3EJ 1O3RA 4IF4A 3OYNA 1X19A 4LGWA 3RKQA 3V7CA 4OAYA 2VONA 4BJ5C 3J7ZI 1B59A 3DTIA 2VQCA 2KZVA 2JWTA 1DGRM 3CJNA 1VQKI 4WWCA 1D8JA 4IHXA 2CW8A 1EH8A 1LE8A 2A69F 2NVTJ 2QEXI 2UV1A 2NVQJ 5HODA 3IH3A 1JTYA 2WA0A 3PNYA 4KMUX 3VPRA 1HC8A 1DU0A 2LKPA 2DJNA 2CUFA 2OU2A 3MZ8A 3ZMUA 1ETKA 1LDJA 2V1XA 3HDDA 2KFDA 4XLAA 4ZJZA 2WAFA 4G9YA 2Z5UA 2R5ZB 2LMDA 4HX8A 1HW1A 5JR3A 1RETA 4RAFA 1ZN2A 5JFRA 5K7FA 3BROA 1KU3A 2W48A 2IGKA 2EIKH 3OSFA 3W6KB 3QPSA 4G94A 6PAXA 3QPTA 4NC6A 4ABZA 1Y39A 1FYMA 1VQMI 1VQNI 4N4NB 4LLLA 4OWRB 5M3FJ 2M7BA 1YQAA 3AKZA 3I58A 2MLGA 5CKTA 1FBQA 4M3GA 1R00A 2PLYA 3CCRI 4Q5SF 4UVCA 3K2AA 5H6RA 2MLKA 1MMDA 2AHQA 2DT7B 3IP4B 3PSIA 2EZKA 3K10A 4G7OF 2EA4A 3GFLA 3ROUA 3JRFA 5F64A 1S7AA 1T98A 1QRYA 2W84A 3HOTA 1USSA 2PI0A 2VASA 2CGPA 4NB5A 4DYRA 1YIJI 1MDMB 4A69C 3E0JB 4I6ZA 1ODDA 4CCKA 4E7SA 2K3PA 4A3FJ 3CCSI 1BR2A 3MMYB 2DO7A 2ECBA 4X0GA 2FSWA 4BBRJ 1BM9A 3DLLF 4XRMA 2X6OA 2MH9A 2F5EA 2WY7Q 4IX7A 2HOEA 4XL9A 2KKOA 1UCRA 4B3AA 1WJEA 3D5LA 3AFHA 3BDDA 2DMTA 1Z0XA 2VBYA 4DGWB 3P9CA 3ERED 1KU2A 1UJ8A 1R49A 4UV9A 3WTTC 1XS9A 1R71A 5K5RA 2H27A 4UNOA 1ZRDA 1X58A 1ENHA 2WV0A 1JKQC 3RKYA 1MBHA 2XAQA 4OIQF 1OCPA 3F72A 5EYRA 1BI3A 4Q47A 1IXCA 3TO9A 2HYJA 4EGZA 4B48A 3CTAA 4WX9A 3KEOA 3TOAA 4M72A 4XM3A 3V42A 3HTSB 1X4PA 5AONA 3S2HJ 1NG7A 3LSHA 2J5OA 1TWCJ 3WU2C 5KHDA 3OY9A 2V7FA 3OYEA 1RKTA 3E6MA 2M9HA 1FPQA 1I50J 4R1HA 2WADA 1MW7A 2DTZA 3ABKH 3OOUA 2HVSA 4ZTJA 4G8XA 1MNEA 2DT6A 2LKSA 4XONA 3PNTA 1XC5A 4GO1A 5FLMJ 3CQZJ 5HLIA 3LA7A 2J5PA 3KEYA 2QWWA 4UXNA 1Y0UA 1LDKB 3CO7C 4RB3C 2L54A 2O7OA 1C0WA 4QWQA 5J4VA 2Q8KA 3R60A 1G8XA 3FDYA 4A3KJ 3H36A 2HPMA 1FC3A 2BYVE 1G3WA 4E4HA 1F43A 3A02A 3DLAA 3SYTA 4KITB 1OQYA 5B5EC 1FTZA 2P81A 3H92A 2ZJPF 1OFCX 2BV6A 4RLFA 1USTA 2PMZN 5EG0B 2R5YB 3TP3A 5E1ZB 1ZLKA 2OZUA 5C44J 4ESJA 1DU6A 2RKHA 1O4XA 1G3YA 3K9TA 3K4KA 1UHWA 4M6YA 4GGGA 3GTJJ 1ON1A 4BACA 2VOOA 1NHAA 1KU9A 4BU2A 5H6QA 4C2MJ 1IN4A 1BBYA 4HBLA 1SMYF 1E3OC 1YRNB 3O3KA 4WXHA 5D5XB 1H0MA 1K79A 1JUSA 4OIPF 3AAFA 2AXTC 1ORKA 1OYWA 2BBYA 1U2WA 1HLVA 4F55A 2CRGA 3QU3A 5C4XJ 5F1RA 3OYFA 5IP9J 5A2QZ 2O3FA 1ERDA 1FOWA 3NWTA 1Z05A 1AKHB 1KQ9A 2F6CA 1RR8C 2OC6A 2NRAC 2E5ZA 3R4KA 3DU5A 5DD8A 2DCEA 4AVZA 3LSPA 4A3IJ 2FXAA 3S3MA 1ZR2A 2VQLA 2VOPA 1W5SA 5CPRB 1A36A 2R4GA 4UUTA 4OIOF 5EEHA 1BI2A 4ZYEA 3TMOA 4B8XA 4AIDA 3WTUC 1F9NA 1BC7C 1V5EA 2R7ZJ 4UV8A 1OCZH 4F52A 4HA8A 5TISC 1MBJA 1IN5A 3AG3H 1YFHA 2E34A 2YR2A 1DUXC 4HYEA 2XGEA 4KJZA 2LLKA 4IHSA 3GMEA 3HXLA 3JRCA 2CQXA 1MMGA 4H0EA 1TWGJ 3WE3A 3PIPF 1GXPA 3S3NA 2K9LA 2EBIA 1V55H 5F27A 2DA3A 2KDOA 2M4KA 1AOYA 2DPUA 4CUGA 4V19K 3K70C 1U8BA 2LC2A 3IL2A 2EFWA 1ZGAA 3M1CA 1U9NA 2GAUA 3VWBA 4E7HA 3BPVA 4U0WA 3C1DA 3ZXSA 3L2CA 1SVLA 1R5HA 4ON0A 3GZ5A 3OYKA 2X6XA 3FK7A 4HG2A 2BGCA 2ZXIA 4LMYA 3FMQA 4NUBA 3TL4X 2V1NA 3DCFA 1QBJA 1QHGA 1R1TA 2IVMA 1FIAA 1KA8A 2M45A 3CCMI 4HLXA 1E3HA 1J0RA 4LLGF 1MZBA 5FKNA 2LBFA 2EIMH 2L5QA 5F0FA 3V8JA 4EJOA 3HHHA 1Q1HA 2OPTA 1TL8A 3MCZA 2HTJA 3FXJA 5ED4A 3WHCA 3F23A 4ITVA 2QUFA 1LEBA 5E79C 2E7XA 3LOCA 2X0LA 1Y8RB 2X1DA 4IOCF 3GLLA 4RB1A 3DKWA 1BA5A 2FE3A 3RJPA 2B63J 2IGOA 1XSDA 4CHUA 3OS0A 3W2VA 2IT0A 3DPTA 1R9TJ 1BOAA 4DW6A 2A3SA 2L9SA 3DP7A 3A4CA 4F7ZA 4O3MA 4G6TB 9ANTA 2PBIA 3AG4H 2IGNA 2H6BA 3PNVA 5EZGA 1KONA 2E71A 4PUSA 4I0BA 4XSXF 3HOZJ 1WGXA 3BZKA 3H3VK 3TO7A 2R5ZA 2DA5A 3PJRA 3T8TA 2CO5A 2P6SA 4FQGA 2Y0SA 2K4JA 4L18B 2IGMA 3SFIA 2N8GA 4RGXA 2DOEA 4MGRA 2Y75A 3FMSA 4CZZA 4OIRF 1S9HA 2PJRB 1CQTA 3VEPA 5LGUA 1ON2A 2YX4A 5ILSA 4EJVA 2VL8A 1HKSA 1XN7A 2VI6A 5IOZA 3MKYB 3GTKJ 2HDCA 1HXDA 3EUKL 1MD0A 3FBNB 3RZDJ 4CCLA 4NDLA 3CJSB 4JX5A 1ZHFA 4XOTA 2LDUA 1PP7U 3T0YA 3WTSC 4UUVA 1GUUA 2F5FA 5TRDA 4KUMA 4XLPF 4PSWA 3REOA 4CGZA 5D6EA 3C2BA 2JUGA 3KZZA 5LHGA 3HIFA 2M2EA 3TOBA 5KCMA 1ZREA 1I3QJ 4DZJA 1RPWA 1EJ9A 2OQGA 1UFMA 2ZFWA 2QSFX 2ELJA 4IQ4A 2GIVA 2VLAA 4EV0A 1VQ5I 2XDVA 1O57A 2WBMA 3M4OJ 3LSTA 3ZGKA 5L3DA 2JSCA 3W2AA 4KDPA 2HU9A 4HZFA 3V8KA 3RPUA 1ZAOA 1W0TA 4BY7J 3WGGA 1MGTA 4UUSB 1S7EA 2RNJA 1WJ5A 4YEJA 2GIZA 2RN7A 3ZQCA 5IT3A 3G4SI 3FXLA 3HOWJ 4CCMA 1SFKA 3RYPA 5D8KB 3K1PA 1FX7A 4HX4A 3CUOA 2DBBA 2Z9OA 2K9NA 3QAHA 3LWFA 5TGTA 3U1DA 3WODF 1ETOA 4JOMA 3I9V2 2DTRA 1MBEA 1MIJA 2L0KA 4BE2A 4UHTA 3OMYA 4RBOA 4II2A 2EINH 5BMZA 2EV5A 3CD6I 2Q1ZB 4Y3OA 1KQ0A 2EQRA 2LD5A 3QODA 3WTXC 4KIFA 4BL0B 4MQ9F 3I56I 1HCRA 5CQGA 3K70D 5J8FA 4A0XA 3DXJF 3PFYA 3KP7A 3DBHB 2EPFA 3I4PA 3CESA 1K83J 4AYBN 1NK2P 1J2XA 1GV5A 2YS9A 4HV6A 3VODA 2IA1A 2XPWA 4R8HA 1SFEA 5GTHC 1XSVA 1F5TA 2IJLA 3I5UA 1K6YA 1I27A 3HKZN 3K6GA 3OIQA 3S2WA 3IC7A 3U9GA 2ID6A 2MC3A 5FKKA 1MJ9A 1FTTA 4L9JA 2ZJRF 3EDPA 3LSJA 4B43A 4AIJA 3UKGA 1QA6A 3H5AA 4S05A 1RUOA 4B1RA 4ZTFA 2EZLA 2CMPA 3Q0VA 3CUQB 2RQPA 4N4OB 4A0ZA 4TV7A 5ILVA 1ETYA 3N05A 3IH4A 5EG0A 1XGMA 4A5NA 2R5YA 1B1BA 3L1PA 2Z16A 4Q48A 4UVBA 4KFCA 3CCJI 3GXOA 5DYMA 1QU3A 2DA6A 1W1WE 2KMUA 2V9VA 3FISA 3T1BA 3LL7A 2R7VA 1XGSA 4CH7A 1PUEE 3HKZA 4F3QA 3L2WA 3HRMA 3JSOA 2XRLA 3MFKA 4YIIA 3IRQA 1YRNA 3H0DA 3DPLC 1BOBA 5LFAA 3HRTA 1AHDP 3ASNH 1Z7LA 1UELB 2DA7A 4BEHA 4KIGA 2K9QA 2R7RA 3OYJA 1SD5A 3RPUD 3QP6A 5CYVA 1AKHA 2O03A 1EF4A 3DEEA 2STWA 1S8NA 4F93B 2H94A 1W0UA 4MTEA 4L5IA 3F8BA 4HNTA 2HQRA 4QPOA 2A05A 3KYCB 4YFXF 1ZGWA 3H9JA 2JSPA 5D8LB 1BI0A 5IT9K 2FOWA 3LSKA 2P5VA 3ZMDA 4M3DA 5J1RA 2HEOA 3OL3A 1OISA 2ISYA 3F22A 3HBLA 2UXXA 2DDBA 2I8DA 3M3YJ 3LSIA 3TP0A 1D8KA 5ERIA 5LD2C 3HPHA 3WTWC 1Z9CA 1VF9A 1EKEA 3NQOA 4HX7A 3K7AJ 4M9SA 1POGA 3KLNA 3GZNB 2BEOA 4C2TA 5GAHJ 1WWXA 1ZG3A 4KN4X 3RKWA 2EIJH 2GXBA 4KICA 2VBZA 1MBKA 3K4MA 4CICA 1XDSA 3O8GA 1XCBA 3ZR8X 1JE8A 2K5CA 3SJMA 5BQTA 5LLQA 3E6BA 3SQNA 2NVYJ 1U3EM 3GTQJ 4J19A 5F04A 4XKBA 3M8EA 5J1YA 2A6TA 3IV5A 3Q9SA 1FMVA 4I2OA 3DKYA 3CCEI 3MQ0A 2OQRA 1NH3A 3GFJA 3JAMK 1QNTA 2ME6A 2AO9A 3VSKA 1T33A 2HQNA 2K40A 3GFIA 3ZQQA 3HHGA 2W1OA 1U8RA 2TRTA 2DU9A 2GLOA 5GPAA 3ZMZA 3ULQB 5FFXA 1DQUA 1ZKGA 4BHPA 4OOIA 1OCOH 3FMRA 4U87A 4HV5A 4CSWA 3V4GA 1QZEA 3DBRB 4CDGA 3FXRA 4FASD 3BPXA 2VJ4A 1B6AA 4RM2A 1IV8A 5DUKA 1OCCH 2LSOA 5E17F 1D0YA 2E1NA 3D5RC 1N77A 3BOQA 4FE4A 2DJIA 4HOBA 4X1EA 4XLNF 4I01A 4ZDLA 5DDGA 2AQFA 3A0BC 5JLXA 4RGSA 2IEKA 4CYDA 3VSLA 4G7HF 1V54H 5HDKA 1GDTA 5HNHA 4I99C 2PJPA 1BJAA 2XGXA 1XG1A 4P1WA 2DAOA 4LOCA 4DQ2A 1JJ6C 1R58A 1GXQA 3A0HC 1XMXA 1LQ1A 2ZSHB 3K69A 5E1WA 1YJNI 3QYFA 1A04A 2L01A 3AG2H 4PFOA 2IS6A 3M8JA 3S17J 2CU7A 1FOKA 1FZPB 1Z6RA 2PJRA 2H6CA 3GO5A 4XLHA 1E17A 3B6AA 5BNGA 1V5GA 3E5XA 1VFCA 2E1MB 3ZP5A 3L2RA 2JK3A 3JRDA 2JPCA 4LB5A 3OYDA 3OOPA 4IRGA 3HGGA 4RMNA 1LFPA 3OR1C 3E6CC 3AG1H 3LAJA 3D5SC 2NOGA 2CQKA 3PIOF 2GOXB 3FBIB 3KX2A 4EJUA 3H3UA 4D9JA 5GAGJ 2D45A 3WTZA 1MJAA 2R7DA 1K4TA 4DYQA 4CCNA 2E5NA 2DMPA 4AUXA 2VJIA 1OR7C 2MBFA 3TGNA 1HA8A 3FF5A 4BH9A 3KE2A 4LG3A 1F36A 2VPRA 2R7FA 2OAZA 4HQEA 4LG0B 1FLIA 2JZYA 2F48A 2VC0A 4L9VA 2OF7A 2OTLI 3LFKA 4JYKA 2UUZA 3HRUA 2WV1A 2G7HA 4E7ZA 3CMYA 4UUSA 4MO7A 3GUDA 1ZARA 1D5YA 4GDFA 2HZDA 5M5WJ 1Z3YA 5AIQA 1XDUA 2IS1A 2XKOA 3G6EI 4BYYA 2MABA 1YS7A 2ZBKA 3LSGA 4PCQA 2ZC2A 2MH2A 3TW7A 4BQAA 3TQNA 3BTIA 3CUQC 3QP5A 1X1PA 2P7CB 2BY3A 1RKWA 4IVNA 2OCEA 1G6NA 3QU6A 3M9AA 1ONVA 3V7SA 2BY1A 4BDYA 2NVXJ 1P6RA 2L9NA 4LB6B 4I98B 2V26A 2LF7A 4Z6YA 2EJRA 1FEXA 5EEGA 3VYRB 4E6KG 1M1EB 4XN3A 1VI0A 3BG7A 4BBSJ 1WHUA 2DA4A 1VQPI 1SD6A 1OR7A 3RKXA 3DTEA 3RDIA 2IRFG 2O8XA 2LH9A 1P4XA 4HW0A 1Z21A 3K1NA 3BQYA 4FCYA 1S29A 1V4RA 2JRMA 2V9PA 4HEA2 3JCUC 2FBHA 3KP6A 3BR0A 4M9ZA 4PZJA 2FUG2 1P2FA 1T6SA 1TWFJ 1ETXA 5LEJA 4EM1A 2WC2A 1N75A 1P92A 2KISA 2PQ8A 2QYOA 2NNYA 4KNYA 3BR6A 3ONQA 2GA2A 3BG3A 4BY1J 4I02A 4PJJA 3CUQA 4NQWA 2VODA 4NC7A 2EFQA 1TW3A 4XRFA 3SZGA 3LAPA 2CQNA 4W1UA 2CS3A 4XLFA 4IHVA 1JKOC 2MFZA 3C7JA 1S5LC 1JHFA 4FHTA 1H88C 2YU9J 1IUFA 3H9QA 2CG4A 1FOXA 3FXMA 2X85A 2DQLA 5HLTA 1VTNC 2YU3A 1Z77A 3WGHA 2R3SA 2M1BA 3OR2C 2P4WA 2F4OB 3IRRA 4PJNA 3QWLA 1BIAA 4XKWA 4WCGA 4LIVA 4KN7X 2FMYA 4B44A 2XF6A 3I3LA 3HOYJ 4I0AA 4C2UA 3PUFA 3ML6A 2P5LC 2CYYA 1MMSA 2KDZA 1Z91A 5FLXK 3MZHA 2DODA 1RESA 3ZN1A 3T8RA 4P9UA 1W36C 2D2WA 4E7JA 4B3XA 4HF0A 3ERMA 3ZMTA 3D0SA 2XPUA 1XGOA 1QZZA 5DUIA 4HRIA 3H9GA 2GOMA 2LY9A 2Y9ZA 4XLCA 3WG7H 4JX4A 3S15J 4LLNA 1FY7A 1R7JA 2AQEA 3CP2A 4U7DA 1T95A 4YIFA 5F0HA 3G3ZA 1W4MA 1A35A 3PO3J 3S16J 2W57A 1APLC 4G6QA 1YE9A 4DJAA 4AIKA 1JT6A 5IT9Z 2BW3B 4JK1X 5B66C 4AM3A 2QVOA 3G73A 2FA5A 1IDZA 4BEHB 1SAXA 2ZXJA 4B47A 2RDPA 1TWHJ 2E2IJ 3MKZA 2W00A 1ACIA 1TT5B 3Q3SA 1Z67A 2PMHA 4AWXB 2XAUA 1IN8A 4D0PA 2PMZA 1QVUA 2F2EA 2BE5F 2V6EA 2B7EA 1ZYRF 3O6BB 3U1KA 3FHZA 2ACJA 5IYCJ 2DI3A 2EA2A 1LFUP 2E7WA 2H1LA 3U2RA 2IP2A 3OV8A 2XASA 3N97A 1YYVA 4G7ZF 4M6VA 1R1UA 1QO0D 2X9DA 3CMMA 1P7IA 1SVOA 1YW9A 2K85A 2NNNA 1MBFA 1FMWA 2RC4A 3WTVC 1UMQA 1WJFA 2K4BA 3OSGA 1YO5C 3F0CA 2ESNA 3OWTA 3R6SA 3IHUA 2QM3A 4F92B 3ZMSA 2ELKA 2ZO4A 3W6JB 3JAMZ 4GFBA 1IC8A 1ZRCA 2OUMA 1NK3P 3I4MJ 2KZGA 4MIMA 5J40A 1I6XA 1Z3XA 2CW7A 3WU0A 2E1MC 2FJ1A 4B4CA 5F6FA 4IZZA 5D5WB 3HOUJ 3CO6C 2Z3YA 3CJRB 4A93J 1XTAA 2DQRA 1IZ1A 2EZHA 2M87A 1FWZA 4E7LA 2DDAA 1ZQ3P 3I54A 5D5UB 1J5YA 2W85A 4BXUA 4ENJA 1IV6A 3F6OA 1T56A 3KPHA 2L9VA 3QRFF 3D1NI 1QPMA 3JW4A 3BP8A 4OINF 1T0FC 3IKTA 3HUGB 4S0HB 1ETQA 2XSJC 3RIRA 1P4WA 1X1DA 3WTYC 3LSRA 4HF2A 2VJ5A 3EGVB 2OD5A 5HLGA 1TTYA 2CWEA 4XR6A 2FNPA 3FIWA 3M07A 3R0AA 3GCMA 5LBQA 1GT0C 2R7UA 1J9IA 1RRJA 2WAEA 2Z2SB 3GX4X 4BJTA 5FROA 5J6XA 2D1HA 1H89C 5LHHA 4EEFG 4ANJA 1I1GA 2DFIA 2OCCH 1W5CC 2ZFUA 3FM3A 3F6VA 1GVDA 3JTHA 3BTJA 2KP6A 5EJCA 3L00A 3C2HA 1IUYA 3HL2A 2HOSA 3L2UA 1V3FA 3MKWB 5D5VB 5FO5A 2XKPA 2EH3A 4WXCA 4CZCA 2L02A 2O6GE 2P0WA 5E8IA 1HKQA 1WI3A 2KQRA 1IG7A 2IS2A 4M74A 2IPQX 2EV6A 4MFEA 4X6AJ 1W36D 2V4JC 5L3EA 2PX9A 4LG0A 2LFBA 1T0FA 2VQHA 1WVRA 3I55I 2STTA 3CMEI 1D1CA 2VBWA 1ZLJA 5HDGA 2JUCA 5E18F 2QBYB 3GTLJ 5EGOA 1IO2A 3S2DJ 2D5VA 4BKXA 2M34A 2W4SA 4JBAA 5FRMA 3FHNA 4MLOA 4K2EA 1SFOJ 4HF1A 2Y2ZA 1KQ8A 3CDIA 2TCTA 3CC4I 2W24A 3QPHA 3QYBA 1H9TA 4ZYGA 2DT5A 1RC9A 3WU1B 1YITI 4RAYA 2ECCA 2X6WA 5F1JA 1PP8F 2MA3A 2A61A 1MH3A 1LDDA 2EILH 3W2WA 5DV5A 2QZ8A 4JP0A 2R7SA 4RAGA 1CGPA 4DYCA 3DTKA 3DU6A 3RCOA 3SZTA 1LEAA 2CJJA 3GEZA 3KP4A 4AC0A 4EATA 2UWMA 1YJ9I 1V5FA 2K27A 1OLTA 3ABLH 4A2UA 5HOOA 1UB9A 2LY2A 2HYGD 2MC4A 3HOVJ 3JRIA 2IW5A 2VIXA 3I0TA 1ZR4A 1DGWY 2JA7J 5CVUA 1KU7A 3ZQIA 1T38A 4M3BA 1D1BA 2PG4A 2VUMJ 1X3ZB 3BR2A 2JT1A 2NS7A 1XCVA 3CCLI 2JVGA 3ASOH 1YJWI 1MSEC 1PDNC 2KJCA 2ETHA 2FNAA 3KP2A 1T08B 1PUFB 2HGCA 1XB4A 1HW2A 1ULYA 1HSTA 1MMNA 5CVJA 5FKLA 4ESFA 1P4AA 3BZ6A 1K4SA 3I71A 1QPIA 3DEUA 2Y30A 3CZ6A 3FK6A 3FXUA 2AS5F 5IYDJ 3HJEA 1VQ4I 5D6FA 3CCQI 2O9LA 5CLSA 2IAIA 3M7GA 2XB5A 5CQEA 5ICEA 4H4KC 1KGSA 3BJAA 3W3CA 1RIOH 2VJJA 4P55A 3EQLF 1O7FA 3TDUC 4PSXA 2IBDA 1R5ID 3H0GJ 1TLHB 1BL0A 2E2JJ 4XSZF 2JA6J 5DD4A 4XRSG 4WK8F 4ZC3A 3DF8A 4Y33A 1ZK8A 2M7AA 2E2HJ 2EV0A 2JJ7A 4LK0F 2R7TA 2HDWA 2ZMEB 1MJBA 2CH0A 1TC3C 2P8TA 2V1DA 1OJLA 1VQ9I 3BC8A 3NRVA 1HSJA 5K7HA 5IY5H 1XD7A 4LITA 4MTDA 4PDKA 2I5UA 1TWAJ 3IWFA 1IF1A 3AL0C 4NQWB 1ZELA 1UAAA 2XGCA 4OMZA 3OYIA 5FLXZ 2F4IA 4FETA 1HQCA 3FWEA 4Z2YA 3JSPA 1X2MA 5FFZA 4C3IJ 2R93J 3BR3A 3CF5F 5DCMB 5FJ8J 3K4LA 3HRSA 4AYBA 2DW4A 1R5GA 2UZKA 1FT9A 2EFPA 1IRZA 3S93A 2O8KA 2DMUA 3KLOA 1ZTRA 1FBSA 3V8LA 4QLCU 1PYVA 3HTUA 4G6DA 1YX5A 3KCCA 2VKDA 5E20A 1BC8C 2BW3A 1MNMC 4KISA 5CVRA 1TZLA 5EF6A 3EYIA 2FRHA 3NARA 2ZB9A 2DYSH 2K3FA 1WFXA 2L7FP 2L3DA 1LNWA 3QYEA 2WAQN 5FB2A 1T39A 2HKOA 1EH6A 1KYWA 1A5JA 5JLWA 1PJRA 1JKPC 4EM0B 3LA3A 2QSGX 4KYWA 3J81K 5BPIA 1G2HA 4ETSA 1K61A 2FOKA 1MMAA 4IJAA 3RYRA 5HDNA 1IDYA 4WXDA 3QQAA 2VB6A 4Y52J 2VT3A 1BR1A 3DKXA 1WJAA 1I5ZA 1I6HJ 2A5WA 3TKYA 1S7OA 1B72A 1WI9A 5E8GA 3SFZA 3VYTB 2X1CA 3S14J 5JVTA 5K5QA 3OYMA 1DPUA 3FKJA 1LKXA 1WJDA 1VZ0A 5K7ZA 1TBXA 4BAYA 3E6DA 4ZDOA 1VQLI 4M3EA 5ICGA 5L3GA 3E5UA 5BPDA 2JA8J 2BY2A 3IAM2 2W82A 2OA4A 2XROA 2ZNZA 3EYYA 5LRRA 3GW2A 3E5QA 1MNDA 2G9WA 2KRHA 1FBUA 1Y0NA 5LRSA 4U88A 1W7PB 2QCOA 5KK1A 1SAUA 5KAIC 3UNGC 1WSUA 3IH2A 3L2VA 4Y7NJ 5LHIA 4LD5A 4RB2C 4Y15A 3ZQFA 2BOLA 4XQFA 2LYCA 3ZMVA 4EM2A 2EK5A 2PMUA 2JRTA 3EUAA 3BG6A 1GLNA 2B0LA 3CCYA 1I39A 3BT9A 2QSHX 2ZKZA 1L3LA 2VE8A 1YOVB 2D1VA 3B73A 4BUPA 3CLQA 5EEAA 2Y69H 1TQPA 5J8CA 1Y56A 4F91B 3GBGA 3FX3A 2CQQA 2M8GX 2QKLB 4IQJA 3R0JA 4D7NA 2GBYA 3HUGA 3C3WA 4V2GA 4R79A 2CUJA 4XKVA 5M3MJ 1QZYA 2QQBA 1KZHA 2HR3A 3H35A 2NOJB 5CVIA 1KYZA 4CA0A 4IRHA 2RVCA 2Z99A 1BN5A 3CDHA 4A3LJ 2A6EF 3HOSA 2XAGA 2DN0A 5M5XJ 3E3VA 3SEQA 4M3FA 1BI1A 4DIQA 3PSFA 2XPVA 1VQ8I 1WJBA 4CCJA 4PJLA 1GV2A 4BXFA 4ZYDA 3HC7A 2L7ZA 4XKCA 1VQOI 3S8PA 4IL6C 4L0ZB 1I1SA 1OCRH 5B3SH 4XIDA 3OYCA 5GP9A 2FQ3A 2Q0OA 5LGNA 1WQ2A 1PVEA 2XAHA 2CV1A 4BJ6C 1T8IA 2VT2A 3HOXJ 4HSRA 4Y4RA 2DFEA 2LG4A 5B1BH 3J7AO 2PFBA 2HVQA 3ZPLA 5LGTA 1VQ7I 2MW8A 1SD4A 3BJ6A 4MEXF 2MG4A 1O3TA 3HPGA 2EFNA 4OU0A 4M6XA 3BLYA 4N0BA 4PGGA 2WY8Q 4ZYAA 3ECHA 2FU4A 1R1VA 3LMMA 2HOAA 2QBYA 1HF0A 3GWZA 1N25A 1JGGA 2IS4A 5IYBJ 1J59A 2CV0A 2CUEA 3OIPA 1R6RA 2HDDA 2DOFA 1R22A 4O5VA 1N78A 1MBGA 3J7YJ 2H8WA 2XUBA 4NNJA 3MAJA 5HS9A 4KMFA 1FSHA 2OBPA 4HDUA 3J80K 1J75A 1LVAA 2DYRH 3BY6A 3FXOA 4DOZA 1QHHD 1R4NB 3CLOA 2HFHA 3QOEA 4FX4A 1SFXA 3GYHX 1ZH5A 4RM3A 3K0LA 3QOPA 5J47A 4BS9A 3KZIC 4W97A 2GM4A 4RAZA 2ZMEC 4XRSA 5EGOB 3OYAA 3S3OA 2HXOA 3LQRA 4A6EA 4L9NA 1W5TA 1XGNA 1IW7F 2BVLA 2JPBA 3CDLA 2GZWA 3PQJA 1JI8A 4QSHA 3KYDB 3TEDA 3E1SA 1WKMA 2BHYA 3GFMA 2KL4A 1PUFA 5IP7J 3VFZA 1R36A 2RAEA 1L0OC 3TO6A 4EMSA 3DPUA 1U6GA 2M4GA 3L9FA 4CCOA 2E36A 1QGPA 3A01B 3DFGA 4P96A 1HW5A 4HDVA 3X2QH 1SMTA 5JI6A 1X3UA 4BHBA 4BHCA 1H8AC 3N4MA 1YW8A 1K7AA 2Q2EB 1Z6TA 3W6VA 1I3AA 4A3GJ 1LUJB 3BCBA 4QIWN 5GAEJ 1TW2A 2LKXA 2DA1A 4GCVA 4M73A 1SEUA 4E70A 3SDGA 3C2GA 1K78A 2ZXWH 1D0ZA 2DPDA 2DFHA 1X1BA 1JHHA 2F5VA 3HSRA 2W25A 2VPLA 3JRAA 3P9KA 5B1AH 4OMYA 2XF7A 5FD6A 3JRBA 4P5OA 5KNLA 1HBXG 2ZMEA 1OYIA 3DQVC 2A6HF 2DOAA 2E1OA 2L2OA 4BGDA 1FP2A 4PFPA 1EA3A 2KJBA 5KVRA 4MEYF 5K5OA 1RR7A 5HVQC 4S04A 3EPZA 3RI4A 2Y0MA 2X1EA 3BCAA 5K1YA 5BS6A 2VKHA 2KLOA 2QKMB 4J01A 4LFUA 5ICFA 3C18A 1XMAA 3Q0UA 4NHJA 4MNUA 4AD9A 2MD5A 5DCMA 2VKVA 2VKEA 1AA7A 4IRIA 3LNQA 1LB2A 2M0CA 4I09A 2YSRA 4ZYHA 3SHFA 1YW7A 3JRHA 5J4YA 2PEXA 2VN2A 4ZDPA 3DWLE 3MZYA 4ZZDA 4AVPA 2GA1A 5M5YJ 2FX0A 2DXIA 3H1CA 2WWYA 4EQQA 2KIFA 5GTIC 1A31A 4HPQA 3GZ6A 4L5JA 4B09A 1XPXA 1TT0A 3I53A 3NEUA 1AWCA 2LF8A 3U21A 3MKLA 1YHQI 2C6YA 4HSTA 2M3AA 1J09A 2LY1A 2BXYA 2LR8A 2ICWG 3WE2A 2QF7A 3RQIA 1OKRA 2HYFA 1ETVA 5IPAA 3P9IA 3J81Z 4HNVA 2OV7A 2PN6A 4LJZF 1LPQA 5HS7A 1B8IB 3I59B 2K9SA 1TNTA 2P5KA 1B9MA 2GWRA 1VQ6I 3LA2A 2RNGA 3OIOA 2B9SA 3WG9A 1STZA 2RREA 4IKFA 4WF2A 4CXFA 2QA4I 4BE0A 3JTGA 4PGHA 2QLZA 1BIBA 1XMKA 3H5NA 3S1NJ 2F4MB 5ILUA 2ZCWA 3BZCA 4GYIA 1BW5A 2E19A 3HSFA 5FKOA 4ESBA 2ZJQF 3GF2A 1G3SA 2COMA 3VOEA 3ZCOA 4E7IA 3IWZA 4KA4A 3HZJA 2L4AA 5E3MA 4BQNA 3AL0B 1W7PA 4A0YA 5DS9A 1D1AA 1ETWA 3L2QA 5E1XA 1OMIA 2DA2A 1B72B 2IA2A 2FD5A 4AIHA 4JQFA 1G59A 2FMLA 5H20A 4EJTA 2V1UA 4A3JJ 4IPAA 2VC1A 2E1CA 4RGUA 2OZ6A 3ZN0A 3EETA 5AIPA 3HGYA 3HYIA 1X3WB 1AU7A 3GTMJ 1HDPA 2BZTA 4EGYA 1WH5A 2R7QA 4Y17A 1MSFC 1RI7A 1LVKA 5BOXA 2EWNA 3H3ZA 2ESHA 4BE1A 1FYLA 2ISZA 2R7WA 4BXXJ 2K86A 3KP5A 1U0JA 3M8FA 4XLEA 5DCFA 1UG0A 3BWGA 4RDUA 3ABMH 4FISA 4D1QA 3JR9A 1ZGJA 4IOAF 1MKMA 2O5RA 2YPRA 2LVSA 3E7LA 2RQQA 1X2NA 4GXOA 3IAS2 3ZQGA 4KIBA 4ASNA 3QPLA 4BDZA 1UG2A 4ENKA 1S6LA 2NS0A 1JJ8C 2ELHA 4D5CA 4UB6C 2W7NA 1ZG5A 2R0QC 2KPMA 2CFOA 2M5WA 1UZCA 2EB7A 3HSEA 4P9FA 4ZH4F 4L0YB 1IRXA 4N9HA 4V2FA 1DP7P 1RNLA 2E35A 4I76A 3O8HA 4PJMA 2X48A 3F21A 2EZIA 1IXRC 5FKMA 2CSOA 1Q1VA 3CP8A 5GPCA 2XGDA 2XRNA 4UB8C 1IGNA 4CYCB 1IRFA 1REPC 2Z33A 3OYLA 3EUHC 3FXQA 4A3EJ 1SFUA 2O0YA 3HB9A 4EJWA 2FEZA 4DBQA 2NAZA 4DNCA 2Y0SN 5HLHA 3ELKA 4A12A 1YI2I 1CF7B 2KHMA 4FT8A 1IXSB 2L4MA 1DPRA 2Y31A 1U5TB 1S3JA 1U9OA 3KZYA 5FLVA 4M9XA 2ZNYA 3KP3A 1D0XA 2HZTA 3G2BA 3MEXA 2LTPA 3F8CA 1WH7A 1F4KA 1IN6A 1P9QC 3GLXA 2ZXHA 4U0VA 1WCMJ 4NBQA 1HOMA 4XMYA 3CF2A 4EVIA 4RGRA 5CVVA 2NVUB 1ZG1A 3GVAA 1SANA 3PM1A 3COAC 4IHYA 4IHWA 5E3LA 3NAUA 1W7PD 1WIBA 3ZQ7A 2XC7A 2XIGA 3ZRGA 1R23A 2HPIA 2KIUA 2V9KA 2WTEA 3VDXA 5GADJ 3J80Z 2BHZA 2ME0A 2Y9YA 2XB0X 3HG9A 1YX3A 3BR1A 2ZJ2A 1OYYA 1EH7A 2HVRA 4I7HA 2HS5A 3BQZA 4ZZLA 2R7XA 3S1QJ 2RGVA 1YS6A 3BJOA 1G3TA 3L7WA 1RZ4A 2QENA 1FSEA 4J00A 2VXZA 4RB0A 4U7BA 3K4JA 1JXSA 1LE8B 2QGUA 3PUBA 4YFKF 3J7AY 5F0CA 3S1RJ 3EUHA 2OJED 2BVMA 3DV8A 5DTDA 1GVJA 5L3FA 1FIPA 1XX5A 2M8EA 4QTRA 3L09A 1YG2A 3LSMA 4PJ0C 5FD5A 4KT5C 4NC8A
chains in the Genus database with same CATH topology
2OTLI 2JQ7A 1FOWA 3EGVB 1VQLI 4IOAF 2ZJRF 3G6EI 3CC7I 5DM7F 1QA6A 3J7YJ 3CCEI 2H8WA 2NXNB 3CJTB 1VQ4I 3CCQI 4IO9F 3CCVI 5DM6F 3J7ZI 2E34A 1YHQI 3CJSB 2E35A 3CCJI 1VQKI 1ACIA 3PIPF 1VQ9I 2QEXI 2OTJI 4V19K 1VQPI 3G71I 1HC8A 1VQ5I 1YI2I 1VQ6I 3CJQB 3I55I 3CMEI 2QA4I 4UY8I 3CF5F 2E36A 1FOYA 3CC4I 3CCMI 2ZJQF 1VQMI 3G4SI 1Y39A 1VQNI 1YJNI 3CMAI 1YITI 5GAEJ 1WIBA 5JVGF 2FOWA 1VQ8I 5GADJ 2ZJPF 1VQOI 3CCRI 2K3FA 3CCUI 4IOCF 1FOXA 3CC2I 1YJ9I 3CJRB 3CD6I 3PIOF 5GAGJ 1VQ7I 3I56I 1YIJI 5GAHJ 3CCLI 1YJWI 1MMSA 1S72I 3CCSI 3DLLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL I;  2JQ7 A;  1FOW A;  3EGV B;  1VQL I;  4IOA F;  2ZJR F;  3G6E I;  3CC7 I;  5DM7 F;  1QA6 A;  3J7Y J;  3CCE I;  2H8W A;  2NXN B;  3CJT B;  1VQ4 I;  3CCQ I;  4IO9 F;  3CCV I;  5DM6 F;  3J7Z I;  2E34 A;  1YHQ I;  3CJS B;  2E35 A;  3CCJ I;  1VQK I;  1ACI A;  3PIP F;  1VQ9 I;  2QEX I;  2OTJ I;  4V19 K;  1VQP I;  3G71 I;  1HC8 A;  1VQ5 I;  1YI2 I;  1VQ6 I;  3CJQ B;  3I55 I;  3CME I;  2QA4 I;  4UY8 I;  3CF5 F;  2E36 A;  1FOY A;  3CC4 I;  3CCM I;  2ZJQ F;  1VQM I;  3G4S I;  1Y39 A;  1VQN I;  1YJN I;  3CMA I;  1YIT I;  5GAE J;  1WIB A;  5JVG F;  2FOW A;  1VQ8 I;  5GAD J;  2ZJP F;  1VQO I;  3CCR I;  2K3F A;  3CCU I;  4IOC F;  1FOX A;  3CC2 I;  1YJ9 I;  3CJR B;  3CD6 I;  3PIO F;  5GAG J;  1VQ7 I;  3I56 I;  1YIJ I;  5GAH J;  3CCL I;  1YJW I;  1MMS A;  1S72 I;  3CCS I;  3DLL F; 
#chains in the Genus database with same CATH topology
 5EDN A;  3KYL A;  2HOT A;  3DEW A;  3K2Z A;  3PQK A;  4PK4 A;  5LEK A;  1F1Z A;  3FZV A;  1TNS A;  1TP4 A;  1FYK A;  3A01 A;  4GRI A;  3RQ4 A;  3PL8 A;  2ZSI B;  1FNN A;  4D5F A;  2JMW A;  3ZQH A;  3K4B A;  4Q4Z F;  3FM5 A;  4L9T A;  3FXK A;  2AXL A;  1MDM A;  2Q2E A;  2KIQ A;  3A2K A;  3CJT B;  4C30 A;  3P7N A;  4A3M J;  3F8M A;  4BQQ A;  1WPK A;  4YIR X;  4CO8 A;  1DP3 A;  1IJW C;  1WRJ A;  1JUM A;  5JHU A;  4LIU A;  2DMN A;  3CCV I;  4JX6 A;  3SZP A;  2UXN A;  3LQQ A;  1G4D A;  3BTC A;  5DM6 F;  3ZOB A;  2HTS A;  1JT0 A;  3G1O A;  5KAF C;  1WJC A;  2XF5 A;  4N9I A;  3S32 A;  1DDN A;  3F3X A;  3K1M A;  2COB A;  4A6D A;  2CFX A;  4A3B J;  2MD0 A;  3NWS A;  1E2X A;  2MGQ A;  3WHB A;  4FTH A;  2VQG A;  3OYG A;  1SD7 A;  2CQ7 A;  2HQ5 A;  3RTR A;  3JRE A;  1QVT A;  4O6J A;  5F08 A;  2DFF A;  2LOO A;  4UVA A;  1BW6 A;  4A5M A;  1MH4 A;  3RSN A;  4XK4 A;  1A6Q A;  3K4C A;  3Q0W A;  4GYG A;  1K78 B;  3K4N A;  3CJQ B;  4A3D J;  1O3S A;  2Y48 A;  3V7R A;  2XVC A;  2LRE A;  1Y8Q B;  1A6I A;  2JA2 A;  2RV8 A;  2L9R A;  2YX7 A;  5L3B A;  3RZO J;  4RS8 A;  2DK8 A;  2FBK A;  3B6C A;  2WB1 N;  4YEL A;  3M1E A;  5L3C A;  3OL4 A;  4XN0 A;  1SVM A;  1BJZ A;  3OYH A;  3JRG A;  3KET A;  2G7U A;  2JVH A;  3IKV A;  1OPC A;  2VBX A;  4HQM A;  1EV7 A;  4LK1 F;  2CW0 F;  3ABU A;  3VYS B;  3ECO A;  2P6T A;  3MVP A;  1FJL A;  2QQ8 A;  3CCU I;  1YTY A;  4YRV A;  1IN7 A;  3MWM A;  2O61 A;  3LFU A;  4IXA A;  2CV2 A;  1OCT C;  2XAJ A;  4XNF A;  3A1Y A;  3F9K A;  1HKT A;  2YUS A;  2JA5 J;  3HM5 A;  3VB2 A;  1T2K A;  1TQI A;  5E3N A;  4A3C J;  1X1C A;  2A07 F;  3IUO A;  1D3Y A;  1B8I A;  3I59 A;  2IXS A;  1NG6 A;  5HS8 A;  2DK5 A;  1RUN A;  1XSX A;  3ISP A;  5FGM A;  2WB1 A;  4DZP A;  3ESW B;  4G12 A;  3A03 A;  1J7K A;  2EFO A;  2X51 A;  4BQO A;  2JQ7 A;  1Z1D A;  2LK2 A;  2HNH A;  2P7V B;  1BR4 A;  2A5Y B;  5IP6 A;  2HKX A;  4XOR A;  2DMQ A;  2V79 A;  3ABT A;  1JKR C;  4XOP A;  3CC7 I;  1JTX A;  5DM7 F;  2KT0 A;  4QPQ A;  4Y13 A;  4IO9 F;  3GTG J;  3T5X A;  2NYX A;  3PFI A;  5JHF A;  2FQ4 A;  4OAZ A;  3S1M J;  1YLF A;  2G0E A;  3G1L A;  2TDX A;  3KEQ A;  5ICC A;  2KRF A;  2Z1D A;  1E3P A;  4AU7 A;  4D7M A;  4BNC A;  5DEQ A;  1SC7 A;  1TQM A;  4MFD A;  3VYU B;  1Y6I A;  1E0E A;  1LJ9 A;  2VXD A;  1FP1 D;  2GQQ A;  4FE7 A;  3TBI A;  1Y1W J;  4YG2 F;  2K02 A;  4U0Y A;  3KIO A;  2F5C A;  5TJJ A;  2XV4 S;  2K9M A;  4C3H J;  1IRG A;  4C3J J;  3I64 A;  3SDB A;  2OTJ I;  5E3O A;  2DLL A;  1NTC A;  2H09 A;  1ZRF A;  2FBI A;  3BR5 A;  3G71 I;  2WAQ A;  1ITY A;  4MHG A;  2NS8 A;  1B9N A;  3SXY A;  3HEF A;  1O7L A;  1U5T C;  2KIM A;  5H2F C;  3PO2 J;  3B02 A;  3BG5 A;  5A2Q K;  3Q9V A;  4IEJ A;  2VE9 A;  4UY8 I;  2H8R A;  4KT6 A;  1FOY A;  3DBL B;  3SEZ A;  4XIC A;  5HNF A;  3OS2 A;  4RA2 A;  2GXG A;  4HNU A;  1H9G A;  4FX0 A;  4IHT A;  3UR3 C;  5EZH A;  3FKI J;  2JTV A;  2XSD C;  1K6O A;  1X1A A;  3CMA I;  3H5R A;  3MD2 A;  2M0M A;  2GXA A;  2R7O A;  5JVG F;  2L7K A;  2K7L A;  2JN6 A;  2CUZ A;  2HXI A;  2MSY A;  3GTP J;  1JUP A;  2HI3 A;  2X6Y A;  3Q5F A;  2HWV A;  2ADU A;  2MYS A;  1D5V A;  5IOY A;  3P5J A;  4ENN A;  2L7M P;  1R4M B;  1Y1V J;  3CC2 I;  1GHC A;  3GTO J;  2LNB A;  1UHM A;  1X4O A;  1QQI A;  4XBF A;  1HDD C;  3MN2 A;  4HAM A;  4ENM A;  3G1M A;  3E97 A;  4M71 A;  5D4R A;  1B4A A;  2QQ9 A;  4CYC A;  1LFB A;  1Z7U A;  4L5E A;  2A68 F;  2LRD A;  5J3L A;  3BG9 A;  3TDZ C;  2R92 J;  2IA0 A;  4YFN F;  1UHS A;  2ID3 A;  1CF7 A;  5D4S A;  1O3Q A;  2QQA A;  1S72 I;  2E60 A;  2M30 A;  3RPQ A;  1U5T A;  2V6C A;  3ZQL A;  2XAF A;  2I10 A;  5C4J J;  2HQA A;  4E7K A;  1WZ2 A;  4DBR A;  4II3 A;  3I4N J;  2BY0 A;  1U78 A;  3O2P E;  1YIO A;  2XHK A;  5J1U A;  3R61 A;  5CJ9 A;  3TW6 A;  5FRN A;  1IAW A;  2BXZ A;  3WGI A;  2LP0 A;  2X4H A;  4C9Y A;  1VND A;  4MQV A;  2H1K A;  3KFW X;  4HLY A;  2F5D A;  3F8N A;  3F8F A;  2NXN B;  3BTL A;  1JGS A;  1P7J A;  2LBF B;  2FF4 A;  4RLQ A;  3OS1 A;  3OYB A;  2KRC A;  5C3E J;  1O3R A;  4IF4 A;  3OYN A;  1X19 A;  4LGW A;  3RKQ A;  3V7C A;  4OAY A;  2VON A;  4BJ5 C;  3J7Z I;  1B59 A;  3DTI A;  2VQC A;  2KZV A;  2JWT A;  1DGR M;  3CJN A;  1VQK I;  4WWC A;  1D8J A;  4IHX A;  2CW8 A;  1EH8 A;  1LE8 A;  2A69 F;  2NVT J;  2QEX I;  2UV1 A;  2NVQ J;  5HOD A;  3IH3 A;  1JTY A;  2WA0 A;  3PNY A;  4KMU X;  3VPR A;  1HC8 A;  1DU0 A;  2LKP A;  2DJN A;  2CUF A;  2OU2 A;  3MZ8 A;  3ZMU A;  1ETK A;  1LDJ A;  2V1X A;  3HDD A;  2KFD A;  4XLA A;  4ZJZ A;  2WAF A;  4G9Y A;  2Z5U A;  2R5Z B;  2LMD A;  4HX8 A;  1HW1 A;  5JR3 A;  1RET A;  4RAF A;  1ZN2 A;  5JFR A;  5K7F A;  3BRO A;  1KU3 A;  2W48 A;  2IGK A;  2EIK H;  3OSF A;  3W6K B;  3QPS A;  4G94 A;  6PAX A;  3QPT A;  4NC6 A;  4ABZ A;  1Y39 A;  1FYM A;  1VQM I;  1VQN I;  4N4N B;  4LLL A;  4OWR B;  5M3F J;  2M7B A;  1YQA A;  3AKZ A;  3I58 A;  2MLG A;  5CKT A;  1FBQ A;  4M3G A;  1R00 A;  2PLY A;  3CCR I;  4Q5S F;  4UVC A;  3K2A A;  5H6R A;  2MLK A;  1MMD A;  2AHQ A;  2DT7 B;  3IP4 B;  3PSI A;  2EZK A;  3K10 A;  4G7O F;  2EA4 A;  3GFL A;  3ROU A;  3JRF A;  5F64 A;  1S7A A;  1T98 A;  1QRY A;  2W84 A;  3HOT A;  1USS A;  2PI0 A;  2VAS A;  2CGP A;  4NB5 A;  4DYR A;  1YIJ I;  1MDM B;  4A69 C;  3E0J B;  4I6Z A;  1ODD A;  4CCK A;  4E7S A;  2K3P A;  4A3F J;  3CCS I;  1BR2 A;  3MMY B;  2DO7 A;  2ECB A;  4X0G A;  2FSW A;  4BBR J;  1BM9 A;  3DLL F;  4XRM A;  2X6O A;  2MH9 A;  2F5E A;  2WY7 Q;  4IX7 A;  2HOE A;  4XL9 A;  2KKO A;  1UCR A;  4B3A A;  1WJE A;  3D5L A;  3AFH A;  3BDD A;  2DMT A;  1Z0X A;  2VBY A;  4DGW B;  3P9C A;  3ERE D;  1KU2 A;  1UJ8 A;  1R49 A;  4UV9 A;  3WTT C;  1XS9 A;  1R71 A;  5K5R A;  2H27 A;  4UNO A;  1ZRD A;  1X58 A;  1ENH A;  2WV0 A;  1JKQ C;  3RKY A;  1MBH A;  2XAQ A;  4OIQ F;  1OCP A;  3F72 A;  5EYR A;  1BI3 A;  4Q47 A;  1IXC A;  3TO9 A;  2HYJ A;  4EGZ A;  4B48 A;  3CTA A;  4WX9 A;  3KEO A;  3TOA A;  4M72 A;  4XM3 A;  3V42 A;  3HTS B;  1X4P A;  5AON A;  3S2H J;  1NG7 A;  3LSH A;  2J5O A;  1TWC J;  3WU2 C;  5KHD A;  3OY9 A;  2V7F A;  3OYE A;  1RKT A;  3E6M A;  2M9H A;  1FPQ A;  1I50 J;  4R1H A;  2WAD A;  1MW7 A;  2DTZ A;  3ABK H;  3OOU A;  2HVS A;  4ZTJ A;  4G8X A;  1MNE A;  2DT6 A;  2LKS A;  4XON A;  3PNT A;  1XC5 A;  4GO1 A;  5FLM J;  3CQZ J;  5HLI A;  3LA7 A;  2J5P A;  3KEY A;  2QWW A;  4UXN A;  1Y0U A;  1LDK B;  3CO7 C;  4RB3 C;  2L54 A;  2O7O A;  1C0W A;  4QWQ A;  5J4V A;  2Q8K A;  3R60 A;  1G8X A;  3FDY A;  4A3K J;  3H36 A;  2HPM A;  1FC3 A;  2BYV E;  1G3W A;  4E4H A;  1F43 A;  3A02 A;  3DLA A;  3SYT A;  4KIT B;  1OQY A;  5B5E C;  1FTZ A;  2P81 A;  3H92 A;  2ZJP F;  1OFC X;  2BV6 A;  4RLF A;  1UST A;  2PMZ N;  5EG0 B;  2R5Y B;  3TP3 A;  5E1Z B;  1ZLK A;  2OZU A;  5C44 J;  4ESJ A;  1DU6 A;  2RKH A;  1O4X A;  1G3Y A;  3K9T A;  3K4K A;  1UHW A;  4M6Y A;  4GGG A;  3GTJ J;  1ON1 A;  4BAC A;  2VOO A;  1NHA A;  1KU9 A;  4BU2 A;  5H6Q A;  4C2M J;  1IN4 A;  1BBY A;  4HBL A;  1SMY F;  1E3O C;  1YRN B;  3O3K A;  4WXH A;  5D5X B;  1H0M A;  1K79 A;  1JUS A;  4OIP F;  3AAF A;  2AXT C;  1ORK A;  1OYW A;  2BBY A;  1U2W A;  1HLV A;  4F55 A;  2CRG A;  3QU3 A;  5C4X J;  5F1R A;  3OYF A;  5IP9 J;  5A2Q Z;  2O3F A;  1ERD A;  1FOW A;  3NWT A;  1Z05 A;  1AKH B;  1KQ9 A;  2F6C A;  1RR8 C;  2OC6 A;  2NRA C;  2E5Z A;  3R4K A;  3DU5 A;  5DD8 A;  2DCE A;  4AVZ A;  3LSP A;  4A3I J;  2FXA A;  3S3M A;  1ZR2 A;  2VQL A;  2VOP A;  1W5S A;  5CPR B;  1A36 A;  2R4G A;  4UUT A;  4OIO F;  5EEH A;  1BI2 A;  4ZYE A;  3TMO A;  4B8X A;  4AID A;  3WTU C;  1F9N A;  1BC7 C;  1V5E A;  2R7Z J;  4UV8 A;  1OCZ H;  4F52 A;  4HA8 A;  5TIS C;  1MBJ A;  1IN5 A;  3AG3 H;  1YFH A;  2E34 A;  2YR2 A;  1DUX C;  4HYE A;  2XGE A;  4KJZ A;  2LLK A;  4IHS A;  3GME A;  3HXL A;  3JRC A;  2CQX A;  1MMG A;  4H0E A;  1TWG J;  3WE3 A;  3PIP F;  1GXP A;  3S3N A;  2K9L A;  2EBI A;  1V55 H;  5F27 A;  2DA3 A;  2KDO A;  2M4K A;  1AOY A;  2DPU A;  4CUG A;  4V19 K;  3K70 C;  1U8B A;  2LC2 A;  3IL2 A;  2EFW A;  1ZGA A;  3M1C A;  1U9N A;  2GAU A;  3VWB A;  4E7H A;  3BPV A;  4U0W A;  3C1D A;  3ZXS A;  3L2C A;  1SVL A;  1R5H A;  4ON0 A;  3GZ5 A;  3OYK A;  2X6X A;  3FK7 A;  4HG2 A;  2BGC A;  2ZXI A;  4LMY A;  3FMQ A;  4NUB A;  3TL4 X;  2V1N A;  3DCF A;  1QBJ A;  1QHG A;  1R1T A;  2IVM A;  1FIA A;  1KA8 A;  2M45 A;  3CCM I;  4HLX A;  1E3H A;  1J0R A;  4LLG F;  1MZB A;  5FKN A;  2LBF A;  2EIM H;  2L5Q A;  5F0F A;  3V8J A;  4EJO A;  3HHH A;  1Q1H A;  2OPT A;  1TL8 A;  3MCZ A;  2HTJ A;  3FXJ A;  5ED4 A;  3WHC A;  3F23 A;  4ITV A;  2QUF A;  1LEB A;  5E79 C;  2E7X A;  3LOC A;  2X0L A;  1Y8R B;  2X1D A;  4IOC F;  3GLL A;  4RB1 A;  3DKW A;  1BA5 A;  2FE3 A;  3RJP A;  2B63 J;  2IGO A;  1XSD A;  4CHU A;  3OS0 A;  3W2V A;  2IT0 A;  3DPT A;  1R9T J;  1BOA A;  4DW6 A;  2A3S A;  2L9S A;  3DP7 A;  3A4C A;  4F7Z A;  4O3M A;  4G6T B;  9ANT A;  2PBI A;  3AG4 H;  2IGN A;  2H6B A;  3PNV A;  5EZG A;  1KON A;  2E71 A;  4PUS A;  4I0B A;  4XSX F;  3HOZ J;  1WGX A;  3BZK A;  3H3V K;  3TO7 A;  2R5Z A;  2DA5 A;  3PJR A;  3T8T A;  2CO5 A;  2P6S A;  4FQG A;  2Y0S A;  2K4J A;  4L18 B;  2IGM A;  3SFI A;  2N8G A;  4RGX A;  2DOE A;  4MGR A;  2Y75 A;  3FMS A;  4CZZ A;  4OIR F;  1S9H A;  2PJR B;  1CQT A;  3VEP A;  5LGU A;  1ON2 A;  2YX4 A;  5ILS A;  4EJV A;  2VL8 A;  1HKS A;  1XN7 A;  2VI6 A;  5IOZ A;  3MKY B;  3GTK J;  2HDC A;  1HXD A;  3EUK L;  1MD0 A;  3FBN B;  3RZD J;  4CCL A;  4NDL A;  3CJS B;  4JX5 A;  1ZHF A;  4XOT A;  2LDU A;  1PP7 U;  3T0Y A;  3WTS C;  4UUV A;  1GUU A;  2F5F A;  5TRD A;  4KUM A;  4XLP F;  4PSW A;  3REO A;  4CGZ A;  5D6E A;  3C2B A;  2JUG A;  3KZZ A;  5LHG A;  3HIF A;  2M2E A;  3TOB A;  5KCM A;  1ZRE A;  1I3Q J;  4DZJ A;  1RPW A;  1EJ9 A;  2OQG A;  1UFM A;  2ZFW A;  2QSF X;  2ELJ A;  4IQ4 A;  2GIV A;  2VLA A;  4EV0 A;  1VQ5 I;  2XDV A;  1O57 A;  2WBM A;  3M4O J;  3LST A;  3ZGK A;  5L3D A;  2JSC A;  3W2A A;  4KDP A;  2HU9 A;  4HZF A;  3V8K A;  3RPU A;  1ZAO A;  1W0T A;  4BY7 J;  3WGG A;  1MGT A;  4UUS B;  1S7E A;  2RNJ A;  1WJ5 A;  4YEJ A;  2GIZ A;  2RN7 A;  3ZQC A;  5IT3 A;  3G4S I;  3FXL A;  3HOW J;  4CCM A;  1SFK A;  3RYP A;  5D8K B;  3K1P A;  1FX7 A;  4HX4 A;  3CUO A;  2DBB A;  2Z9O A;  2K9N A;  3QAH A;  3LWF A;  5TGT A;  3U1D A;  3WOD F;  1ETO A;  4JOM A;  3I9V 2;  2DTR A;  1MBE A;  1MIJ A;  2L0K A;  4BE2 A;  4UHT A;  3OMY A;  4RBO A;  4II2 A;  2EIN H;  5BMZ A;  2EV5 A;  3CD6 I;  2Q1Z B;  4Y3O A;  1KQ0 A;  2EQR A;  2LD5 A;  3QOD A;  3WTX C;  4KIF A;  4BL0 B;  4MQ9 F;  3I56 I;  1HCR A;  5CQG A;  3K70 D;  5J8F A;  4A0X A;  3DXJ F;  3PFY A;  3KP7 A;  3DBH B;  2EPF A;  3I4P A;  3CES A;  1K83 J;  4AYB N;  1NK2 P;  1J2X A;  1GV5 A;  2YS9 A;  4HV6 A;  3VOD A;  2IA1 A;  2XPW A;  4R8H A;  1SFE A;  5GTH C;  1XSV A;  1F5T A;  2IJL A;  3I5U A;  1K6Y A;  1I27 A;  3HKZ N;  3K6G A;  3OIQ A;  3S2W A;  3IC7 A;  3U9G A;  2ID6 A;  2MC3 A;  5FKK A;  1MJ9 A;  1FTT A;  4L9J A;  2ZJR F;  3EDP A;  3LSJ A;  4B43 A;  4AIJ A;  3UKG A;  1QA6 A;  3H5A A;  4S05 A;  1RUO A;  4B1R A;  4ZTF A;  2EZL A;  2CMP A;  3Q0V A;  3CUQ B;  2RQP A;  4N4O B;  4A0Z A;  4TV7 A;  5ILV A;  1ETY A;  3N05 A;  3IH4 A;  5EG0 A;  1XGM A;  4A5N A;  2R5Y A;  1B1B A;  3L1P A;  2Z16 A;  4Q48 A;  4UVB A;  4KFC A;  3CCJ I;  3GXO A;  5DYM A;  1QU3 A;  2DA6 A;  1W1W E;  2KMU A;  2V9V A;  3FIS A;  3T1B A;  3LL7 A;  2R7V A;  1XGS A;  4CH7 A;  1PUE E;  3HKZ A;  4F3Q A;  3L2W A;  3HRM A;  3JSO A;  2XRL A;  3MFK A;  4YII A;  3IRQ A;  1YRN A;  3H0D A;  3DPL C;  1BOB A;  5LFA A;  3HRT A;  1AHD P;  3ASN H;  1Z7L A;  1UEL B;  2DA7 A;  4BEH A;  4KIG A;  2K9Q A;  2R7R A;  3OYJ A;  1SD5 A;  3RPU D;  3QP6 A;  5CYV A;  1AKH A;  2O03 A;  1EF4 A;  3DEE A;  2STW A;  1S8N A;  4F93 B;  2H94 A;  1W0U A;  4MTE A;  4L5I A;  3F8B A;  4HNT A;  2HQR A;  4QPO A;  2A05 A;  3KYC B;  4YFX F;  1ZGW A;  3H9J A;  2JSP A;  5D8L B;  1BI0 A;  5IT9 K;  2FOW A;  3LSK A;  2P5V A;  3ZMD A;  4M3D A;  5J1R A;  2HEO A;  3OL3 A;  1OIS A;  2ISY A;  3F22 A;  3HBL A;  2UXX A;  2DDB A;  2I8D A;  3M3Y J;  3LSI A;  3TP0 A;  1D8K A;  5ERI A;  5LD2 C;  3HPH A;  3WTW C;  1Z9C A;  1VF9 A;  1EKE A;  3NQO A;  4HX7 A;  3K7A J;  4M9S A;  1POG A;  3KLN A;  3GZN B;  2BEO A;  4C2T A;  5GAH J;  1WWX A;  1ZG3 A;  4KN4 X;  3RKW A;  2EIJ H;  2GXB A;  4KIC A;  2VBZ A;  1MBK A;  3K4M A;  4CIC A;  1XDS A;  3O8G A;  1XCB A;  3ZR8 X;  1JE8 A;  2K5C A;  3SJM A;  5BQT A;  5LLQ A;  3E6B A;  3SQN A;  2NVY J;  1U3E M;  3GTQ J;  4J19 A;  5F04 A;  4XKB A;  3M8E A;  5J1Y A;  2A6T A;  3IV5 A;  3Q9S A;  1FMV A;  4I2O A;  3DKY A;  3CCE I;  3MQ0 A;  2OQR A;  1NH3 A;  3GFJ A;  3JAM K;  1QNT A;  2ME6 A;  2AO9 A;  3VSK A;  1T33 A;  2HQN A;  2K40 A;  3GFI A;  3ZQQ A;  3HHG A;  2W1O A;  1U8R A;  2TRT A;  2DU9 A;  2GLO A;  5GPA A;  3ZMZ A;  3ULQ B;  5FFX A;  1DQU A;  1ZKG A;  4BHP A;  4OOI A;  1OCO H;  3FMR A;  4U87 A;  4HV5 A;  4CSW A;  3V4G A;  1QZE A;  3DBR B;  4CDG A;  3FXR A;  4FAS D;  3BPX A;  2VJ4 A;  1B6A A;  4RM2 A;  1IV8 A;  5DUK A;  1OCC H;  2LSO A;  5E17 F;  1D0Y A;  2E1N A;  3D5R C;  1N77 A;  3BOQ A;  4FE4 A;  2DJI A;  4HOB A;  4X1E A;  4XLN F;  4I01 A;  4ZDL A;  5DDG A;  2AQF A;  3A0B C;  5JLX A;  4RGS A;  2IEK A;  4CYD A;  3VSL A;  4G7H F;  1V54 H;  5HDK A;  1GDT A;  5HNH A;  4I99 C;  2PJP A;  1BJA A;  2XGX A;  1XG1 A;  4P1W A;  2DAO A;  4LOC A;  4DQ2 A;  1JJ6 C;  1R58 A;  1GXQ A;  3A0H C;  1XMX A;  1LQ1 A;  2ZSH B;  3K69 A;  5E1W A;  1YJN I;  3QYF A;  1A04 A;  2L01 A;  3AG2 H;  4PFO A;  2IS6 A;  3M8J A;  3S17 J;  2CU7 A;  1FOK A;  1FZP B;  1Z6R A;  2PJR A;  2H6C A;  3GO5 A;  4XLH A;  1E17 A;  3B6A A;  5BNG A;  1V5G A;  3E5X A;  1VFC A;  2E1M B;  3ZP5 A;  3L2R A;  2JK3 A;  3JRD A;  2JPC A;  4LB5 A;  3OYD A;  3OOP A;  4IRG A;  3HGG A;  4RMN A;  1LFP A;  3OR1 C;  3E6C C;  3AG1 H;  3LAJ A;  3D5S C;  2NOG A;  2CQK A;  3PIO F;  2GOX B;  3FBI B;  3KX2 A;  4EJU A;  3H3U A;  4D9J A;  5GAG J;  2D45 A;  3WTZ A;  1MJA A;  2R7D A;  1K4T A;  4DYQ A;  4CCN A;  2E5N A;  2DMP A;  4AUX A;  2VJI A;  1OR7 C;  2MBF A;  3TGN A;  1HA8 A;  3FF5 A;  4BH9 A;  3KE2 A;  4LG3 A;  1F36 A;  2VPR A;  2R7F A;  2OAZ A;  4HQE A;  4LG0 B;  1FLI A;  2JZY A;  2F48 A;  2VC0 A;  4L9V A;  2OF7 A;  2OTL I;  3LFK A;  4JYK A;  2UUZ A;  3HRU A;  2WV1 A;  2G7H A;  4E7Z A;  3CMY A;  4UUS A;  4MO7 A;  3GUD A;  1ZAR A;  1D5Y A;  4GDF A;  2HZD A;  5M5W J;  1Z3Y A;  5AIQ A;  1XDU A;  2IS1 A;  2XKO A;  3G6E I;  4BYY A;  2MAB A;  1YS7 A;  2ZBK A;  3LSG A;  4PCQ A;  2ZC2 A;  2MH2 A;  3TW7 A;  4BQA A;  3TQN A;  3BTI A;  3CUQ C;  3QP5 A;  1X1P A;  2P7C B;  2BY3 A;  1RKW A;  4IVN A;  2OCE A;  1G6N A;  3QU6 A;  3M9A A;  1ONV A;  3V7S A;  2BY1 A;  4BDY A;  2NVX J;  1P6R A;  2L9N A;  4LB6 B;  4I98 B;  2V26 A;  2LF7 A;  4Z6Y A;  2EJR A;  1FEX A;  5EEG A;  3VYR B;  4E6K G;  1M1E B;  4XN3 A;  1VI0 A;  3BG7 A;  4BBS J;  1WHU A;  2DA4 A;  1VQP I;  1SD6 A;  1OR7 A;  3RKX A;  3DTE A;  3RDI A;  2IRF G;  2O8X A;  2LH9 A;  1P4X A;  4HW0 A;  1Z21 A;  3K1N A;  3BQY A;  4FCY A;  1S29 A;  1V4R A;  2JRM A;  2V9P A;  4HEA 2;  3JCU C;  2FBH A;  3KP6 A;  3BR0 A;  4M9Z A;  4PZJ A;  2FUG 2;  1P2F A;  1T6S A;  1TWF J;  1ETX A;  5LEJ A;  4EM1 A;  2WC2 A;  1N75 A;  1P92 A;  2KIS A;  2PQ8 A;  2QYO A;  2NNY A;  4KNY A;  3BR6 A;  3ONQ A;  2GA2 A;  3BG3 A;  4BY1 J;  4I02 A;  4PJJ A;  3CUQ A;  4NQW A;  2VOD A;  4NC7 A;  2EFQ A;  1TW3 A;  4XRF A;  3SZG A;  3LAP A;  2CQN A;  4W1U A;  2CS3 A;  4XLF A;  4IHV A;  1JKO C;  2MFZ A;  3C7J A;  1S5L C;  1JHF A;  4FHT A;  1H88 C;  2YU9 J;  1IUF A;  3H9Q A;  2CG4 A;  1FOX A;  3FXM A;  2X85 A;  2DQL A;  5HLT A;  1VTN C;  2YU3 A;  1Z77 A;  3WGH A;  2R3S A;  2M1B A;  3OR2 C;  2P4W A;  2F4O B;  3IRR A;  4PJN A;  3QWL A;  1BIA A;  4XKW A;  4WCG A;  4LIV A;  4KN7 X;  2FMY A;  4B44 A;  2XF6 A;  3I3L A;  3HOY J;  4I0A A;  4C2U A;  3PUF A;  3ML6 A;  2P5L C;  2CYY A;  1MMS A;  2KDZ A;  1Z91 A;  5FLX K;  3MZH A;  2DOD A;  1RES A;  3ZN1 A;  3T8R A;  4P9U A;  1W36 C;  2D2W A;  4E7J A;  4B3X A;  4HF0 A;  3ERM A;  3ZMT A;  3D0S A;  2XPU A;  1XGO A;  1QZZ A;  5DUI A;  4HRI A;  3H9G A;  2GOM A;  2LY9 A;  2Y9Z A;  4XLC A;  3WG7 H;  4JX4 A;  3S15 J;  4LLN A;  1FY7 A;  1R7J A;  2AQE A;  3CP2 A;  4U7D A;  1T95 A;  4YIF A;  5F0H A;  3G3Z A;  1W4M A;  1A35 A;  3PO3 J;  3S16 J;  2W57 A;  1APL C;  4G6Q A;  1YE9 A;  4DJA A;  4AIK A;  1JT6 A;  5IT9 Z;  2BW3 B;  4JK1 X;  5B66 C;  4AM3 A;  2QVO A;  3G73 A;  2FA5 A;  1IDZ A;  4BEH B;  1SAX A;  2ZXJ A;  4B47 A;  2RDP A;  1TWH J;  2E2I J;  3MKZ A;  2W00 A;  1ACI A;  1TT5 B;  3Q3S A;  1Z67 A;  2PMH A;  4AWX B;  2XAU A;  1IN8 A;  4D0P A;  2PMZ A;  1QVU A;  2F2E A;  2BE5 F;  2V6E A;  2B7E A;  1ZYR F;  3O6B B;  3U1K A;  3FHZ A;  2ACJ A;  5IYC J;  2DI3 A;  2EA2 A;  1LFU P;  2E7W A;  2H1L A;  3U2R A;  2IP2 A;  3OV8 A;  2XAS A;  3N97 A;  1YYV A;  4G7Z F;  4M6V A;  1R1U A;  1QO0 D;  2X9D A;  3CMM A;  1P7I A;  1SVO A;  1YW9 A;  2K85 A;  2NNN A;  1MBF A;  1FMW A;  2RC4 A;  3WTV C;  1UMQ A;  1WJF A;  2K4B A;  3OSG A;  1YO5 C;  3F0C A;  2ESN A;  3OWT A;  3R6S A;  3IHU A;  2QM3 A;  4F92 B;  3ZMS A;  2ELK A;  2ZO4 A;  3W6J B;  3JAM Z;  4GFB A;  1IC8 A;  1ZRC A;  2OUM A;  1NK3 P;  3I4M J;  2KZG A;  4MIM A;  5J40 A;  1I6X A;  1Z3X A;  2CW7 A;  3WU0 A;  2E1M C;  2FJ1 A;  4B4C A;  5F6F A;  4IZZ A;  5D5W B;  3HOU J;  3CO6 C;  2Z3Y A;  3CJR B;  4A93 J;  1XTA A;  2DQR A;  1IZ1 A;  2EZH A;  2M87 A;  1FWZ A;  4E7L A;  2DDA A;  1ZQ3 P;  3I54 A;  5D5U B;  1J5Y A;  2W85 A;  4BXU A;  4ENJ A;  1IV6 A;  3F6O A;  1T56 A;  3KPH A;  2L9V A;  3QRF F;  3D1N I;  1QPM A;  3JW4 A;  3BP8 A;  4OIN F;  1T0F C;  3IKT A;  3HUG B;  4S0H B;  1ETQ A;  2XSJ C;  3RIR A;  1P4W A;  1X1D A;  3WTY C;  3LSR A;  4HF2 A;  2VJ5 A;  3EGV B;  2OD5 A;  5HLG A;  1TTY A;  2CWE A;  4XR6 A;  2FNP A;  3FIW A;  3M07 A;  3R0A A;  3GCM A;  5LBQ A;  1GT0 C;  2R7U A;  1J9I A;  1RRJ A;  2WAE A;  2Z2S B;  3GX4 X;  4BJT A;  5FRO A;  5J6X A;  2D1H A;  1H89 C;  5LHH A;  4EEF G;  4ANJ A;  1I1G A;  2DFI A;  2OCC H;  1W5C C;  2ZFU A;  3FM3 A;  3F6V A;  1GVD A;  3JTH A;  3BTJ A;  2KP6 A;  5EJC A;  3L00 A;  3C2H A;  1IUY A;  3HL2 A;  2HOS A;  3L2U A;  1V3F A;  3MKW B;  5D5V B;  5FO5 A;  2XKP A;  2EH3 A;  4WXC A;  4CZC A;  2L02 A;  2O6G E;  2P0W A;  5E8I A;  1HKQ A;  1WI3 A;  2KQR A;  1IG7 A;  2IS2 A;  4M74 A;  2IPQ X;  2EV6 A;  4MFE A;  4X6A J;  1W36 D;  2V4J C;  5L3E A;  2PX9 A;  4LG0 A;  2LFB A;  1T0F A;  2VQH A;  1WVR A;  3I55 I;  2STT A;  3CME I;  1D1C A;  2VBW A;  1ZLJ A;  5HDG A;  2JUC A;  5E18 F;  2QBY B;  3GTL J;  5EGO A;  1IO2 A;  3S2D J;  2D5V A;  4BKX A;  2M34 A;  2W4S A;  4JBA A;  5FRM A;  3FHN A;  4MLO A;  4K2E A;  1SFO J;  4HF1 A;  2Y2Z A;  1KQ8 A;  3CDI A;  2TCT A;  3CC4 I;  2W24 A;  3QPH A;  3QYB A;  1H9T A;  4ZYG A;  2DT5 A;  1RC9 A;  3WU1 B;  1YIT I;  4RAY A;  2ECC A;  2X6W A;  5F1J A;  1PP8 F;  2MA3 A;  2A61 A;  1MH3 A;  1LDD A;  2EIL H;  3W2W A;  5DV5 A;  2QZ8 A;  4JP0 A;  2R7S A;  4RAG A;  1CGP A;  4DYC A;  3DTK A;  3DU6 A;  3RCO A;  3SZT A;  1LEA A;  2CJJ A;  3GEZ A;  3KP4 A;  4AC0 A;  4EAT A;  2UWM A;  1YJ9 I;  1V5F A;  2K27 A;  1OLT A;  3ABL H;  4A2U A;  5HOO A;  1UB9 A;  2LY2 A;  2HYG D;  2MC4 A;  3HOV J;  3JRI A;  2IW5 A;  2VIX A;  3I0T A;  1ZR4 A;  1DGW Y;  2JA7 J;  5CVU A;  1KU7 A;  3ZQI A;  1T38 A;  4M3B A;  1D1B A;  2PG4 A;  2VUM J;  1X3Z B;  3BR2 A;  2JT1 A;  2NS7 A;  1XCV A;  3CCL I;  2JVG A;  3ASO H;  1YJW I;  1MSE C;  1PDN C;  2KJC A;  2ETH A;  2FNA A;  3KP2 A;  1T08 B;  1PUF B;  2HGC A;  1XB4 A;  1HW2 A;  1ULY A;  1HST A;  1MMN A;  5CVJ A;  5FKL A;  4ESF A;  1P4A A;  3BZ6 A;  1K4S A;  3I71 A;  1QPI A;  3DEU A;  2Y30 A;  3CZ6 A;  3FK6 A;  3FXU A;  2AS5 F;  5IYD J;  3HJE A;  1VQ4 I;  5D6F A;  3CCQ I;  2O9L A;  5CLS A;  2IAI A;  3M7G A;  2XB5 A;  5CQE A;  5ICE A;  4H4K C;  1KGS A;  3BJA A;  3W3C A;  1RIO H;  2VJJ A;  4P55 A;  3EQL F;  1O7F A;  3TDU C;  4PSX A;  2IBD A;  1R5I D;  3H0G J;  1TLH B;  1BL0 A;  2E2J J;  4XSZ F;  2JA6 J;  5DD4 A;  4XRS G;  4WK8 F;  4ZC3 A;  3DF8 A;  4Y33 A;  1ZK8 A;  2M7A A;  2E2H J;  2EV0 A;  2JJ7 A;  4LK0 F;  2R7T A;  2HDW A;  2ZME B;  1MJB A;  2CH0 A;  1TC3 C;  2P8T A;  2V1D A;  1OJL A;  1VQ9 I;  3BC8 A;  3NRV A;  1HSJ A;  5K7H A;  5IY5 H;  1XD7 A;  4LIT A;  4MTD A;  4PDK A;  2I5U A;  1TWA J;  3IWF A;  1IF1 A;  3AL0 C;  4NQW B;  1ZEL A;  1UAA A;  2XGC A;  4OMZ A;  3OYI A;  5FLX Z;  2F4I A;  4FET A;  1HQC A;  3FWE A;  4Z2Y A;  3JSP A;  1X2M A;  5FFZ A;  4C3I J;  2R93 J;  3BR3 A;  3CF5 F;  5DCM B;  5FJ8 J;  3K4L A;  3HRS A;  4AYB A;  2DW4 A;  1R5G A;  2UZK A;  1FT9 A;  2EFP A;  1IRZ A;  3S93 A;  2O8K A;  2DMU A;  3KLO A;  1ZTR A;  1FBS A;  3V8L A;  4QLC U;  1PYV A;  3HTU A;  4G6D A;  1YX5 A;  3KCC A;  2VKD A;  5E20 A;  1BC8 C;  2BW3 A;  1MNM C;  4KIS A;  5CVR A;  1TZL A;  5EF6 A;  3EYI A;  2FRH A;  3NAR A;  2ZB9 A;  2DYS H;  2K3F A;  1WFX A;  2L7F P;  2L3D A;  1LNW A;  3QYE A;  2WAQ N;  5FB2 A;  1T39 A;  2HKO A;  1EH6 A;  1KYW A;  1A5J A;  5JLW A;  1PJR A;  1JKP C;  4EM0 B;  3LA3 A;  2QSG X;  4KYW A;  3J81 K;  5BPI A;  1G2H A;  4ETS A;  1K61 A;  2FOK A;  1MMA A;  4IJA A;  3RYR A;  5HDN A;  1IDY A;  4WXD A;  3QQA A;  2VB6 A;  4Y52 J;  2VT3 A;  1BR1 A;  3DKX A;  1WJA A;  1I5Z A;  1I6H J;  2A5W A;  3TKY A;  1S7O A;  1B72 A;  1WI9 A;  5E8G A;  3SFZ A;  3VYT B;  2X1C A;  3S14 J;  5JVT A;  5K5Q A;  3OYM A;  1DPU A;  3FKJ A;  1LKX A;  1WJD A;  1VZ0 A;  5K7Z A;  1TBX A;  4BAY A;  3E6D A;  4ZDO A;  1VQL I;  4M3E A;  5ICG A;  5L3G A;  3E5U A;  5BPD A;  2JA8 J;  2BY2 A;  3IAM 2;  2W82 A;  2OA4 A;  2XRO A;  2ZNZ A;  3EYY A;  5LRR A;  3GW2 A;  3E5Q A;  1MND A;  2G9W A;  2KRH A;  1FBU A;  1Y0N A;  5LRS A;  4U88 A;  1W7P B;  2QCO A;  5KK1 A;  1SAU A;  5KAI C;  3UNG C;  1WSU A;  3IH2 A;  3L2V A;  4Y7N J;  5LHI A;  4LD5 A;  4RB2 C;  4Y15 A;  3ZQF A;  2BOL A;  4XQF A;  2LYC A;  3ZMV A;  4EM2 A;  2EK5 A;  2PMU A;  2JRT A;  3EUA A;  3BG6 A;  1GLN A;  2B0L A;  3CCY A;  1I39 A;  3BT9 A;  2QSH X;  2ZKZ A;  1L3L A;  2VE8 A;  1YOV B;  2D1V A;  3B73 A;  4BUP A;  3CLQ A;  5EEA A;  2Y69 H;  1TQP A;  5J8C A;  1Y56 A;  4F91 B;  3GBG A;  3FX3 A;  2CQQ A;  2M8G X;  2QKL B;  4IQJ A;  3R0J A;  4D7N A;  2GBY A;  3HUG A;  3C3W A;  4V2G A;  4R79 A;  2CUJ A;  4XKV A;  5M3M J;  1QZY A;  2QQB A;  1KZH A;  2HR3 A;  3H35 A;  2NOJ B;  5CVI A;  1KYZ A;  4CA0 A;  4IRH A;  2RVC A;  2Z99 A;  1BN5 A;  3CDH A;  4A3L J;  2A6E F;  3HOS A;  2XAG A;  2DN0 A;  5M5X J;  3E3V A;  3SEQ A;  4M3F A;  1BI1 A;  4DIQ A;  3PSF A;  2XPV A;  1VQ8 I;  1WJB A;  4CCJ A;  4PJL A;  1GV2 A;  4BXF A;  4ZYD A;  3HC7 A;  2L7Z A;  4XKC A;  1VQO I;  3S8P A;  4IL6 C;  4L0Z B;  1I1S A;  1OCR H;  5B3S H;  4XID A;  3OYC A;  5GP9 A;  2FQ3 A;  2Q0O A;  5LGN A;  1WQ2 A;  1PVE A;  2XAH A;  2CV1 A;  4BJ6 C;  1T8I A;  2VT2 A;  3HOX J;  4HSR A;  4Y4R A;  2DFE A;  2LG4 A;  5B1B H;  3J7A O;  2PFB A;  2HVQ A;  3ZPL A;  5LGT A;  1VQ7 I;  2MW8 A;  1SD4 A;  3BJ6 A;  4MEX F;  2MG4 A;  1O3T A;  3HPG A;  2EFN A;  4OU0 A;  4M6X A;  3BLY A;  4N0B A;  4PGG A;  2WY8 Q;  4ZYA A;  3ECH A;  2FU4 A;  1R1V A;  3LMM A;  2HOA A;  2QBY A;  1HF0 A;  3GWZ A;  1N25 A;  1JGG A;  2IS4 A;  5IYB J;  1J59 A;  2CV0 A;  2CUE A;  3OIP A;  1R6R A;  2HDD A;  2DOF A;  1R22 A;  4O5V A;  1N78 A;  1MBG A;  3J7Y J;  2H8W A;  2XUB A;  4NNJ A;  3MAJ A;  5HS9 A;  4KMF A;  1FSH A;  2OBP A;  4HDU A;  3J80 K;  1J75 A;  1LVA A;  2DYR H;  3BY6 A;  3FXO A;  4DOZ A;  1QHH D;  1R4N B;  3CLO A;  2HFH A;  3QOE A;  4FX4 A;  1SFX A;  3GYH X;  1ZH5 A;  4RM3 A;  3K0L A;  3QOP A;  5J47 A;  4BS9 A;  3KZI C;  4W97 A;  2GM4 A;  4RAZ A;  2ZME C;  4XRS A;  5EGO B;  3OYA A;  3S3O A;  2HXO A;  3LQR A;  4A6E A;  4L9N A;  1W5T A;  1XGN A;  1IW7 F;  2BVL A;  2JPB A;  3CDL A;  2GZW A;  3PQJ A;  1JI8 A;  4QSH A;  3KYD B;  3TED A;  3E1S A;  1WKM A;  2BHY A;  3GFM A;  2KL4 A;  1PUF A;  5IP7 J;  3VFZ A;  1R36 A;  2RAE A;  1L0O C;  3TO6 A;  4EMS A;  3DPU A;  1U6G A;  2M4G A;  3L9F A;  4CCO A;  2E36 A;  1QGP A;  3A01 B;  3DFG A;  4P96 A;  1HW5 A;  4HDV A;  3X2Q H;  1SMT A;  5JI6 A;  1X3U A;  4BHB A;  4BHC A;  1H8A C;  3N4M A;  1YW8 A;  1K7A A;  2Q2E B;  1Z6T A;  3W6V A;  1I3A A;  4A3G J;  1LUJ B;  3BCB A;  4QIW N;  5GAE J;  1TW2 A;  2LKX A;  2DA1 A;  4GCV A;  4M73 A;  1SEU A;  4E70 A;  3SDG A;  3C2G A;  1K78 A;  2ZXW H;  1D0Z A;  2DPD A;  2DFH A;  1X1B A;  1JHH A;  2F5V A;  3HSR A;  2W25 A;  2VPL A;  3JRA A;  3P9K A;  5B1A H;  4OMY A;  2XF7 A;  5FD6 A;  3JRB A;  4P5O A;  5KNL A;  1HBX G;  2ZME A;  1OYI A;  3DQV C;  2A6H F;  2DOA A;  2E1O A;  2L2O A;  4BGD A;  1FP2 A;  4PFP A;  1EA3 A;  2KJB A;  5KVR A;  4MEY F;  5K5O A;  1RR7 A;  5HVQ C;  4S04 A;  3EPZ A;  3RI4 A;  2Y0M A;  2X1E A;  3BCA A;  5K1Y A;  5BS6 A;  2VKH A;  2KLO A;  2QKM B;  4J01 A;  4LFU A;  5ICF A;  3C18 A;  1XMA A;  3Q0U A;  4NHJ A;  4MNU A;  4AD9 A;  2MD5 A;  5DCM A;  2VKV A;  2VKE A;  1AA7 A;  4IRI A;  3LNQ A;  1LB2 A;  2M0C A;  4I09 A;  2YSR A;  4ZYH A;  3SHF A;  1YW7 A;  3JRH A;  5J4Y A;  2PEX A;  2VN2 A;  4ZDP A;  3DWL E;  3MZY A;  4ZZD A;  4AVP A;  2GA1 A;  5M5Y J;  2FX0 A;  2DXI A;  3H1C A;  2WWY A;  4EQQ A;  2KIF A;  5GTI C;  1A31 A;  4HPQ A;  3GZ6 A;  4L5J A;  4B09 A;  1XPX A;  1TT0 A;  3I53 A;  3NEU A;  1AWC A;  2LF8 A;  3U21 A;  3MKL A;  1YHQ I;  2C6Y A;  4HST A;  2M3A A;  1J09 A;  2LY1 A;  2BXY A;  2LR8 A;  2ICW G;  3WE2 A;  2QF7 A;  3RQI A;  1OKR A;  2HYF A;  1ETV A;  5IPA A;  3P9I A;  3J81 Z;  4HNV A;  2OV7 A;  2PN6 A;  4LJZ F;  1LPQ A;  5HS7 A;  1B8I B;  3I59 B;  2K9S A;  1TNT A;  2P5K A;  1B9M A;  2GWR A;  1VQ6 I;  3LA2 A;  2RNG A;  3OIO A;  2B9S A;  3WG9 A;  1STZ A;  2RRE A;  4IKF A;  4WF2 A;  4CXF A;  2QA4 I;  4BE0 A;  3JTG A;  4PGH A;  2QLZ A;  1BIB A;  1XMK A;  3H5N A;  3S1N J;  2F4M B;  5ILU A;  2ZCW A;  3BZC A;  4GYI A;  1BW5 A;  2E19 A;  3HSF A;  5FKO A;  4ESB A;  2ZJQ F;  3GF2 A;  1G3S A;  2COM A;  3VOE A;  3ZCO A;  4E7I A;  3IWZ A;  4KA4 A;  3HZJ A;  2L4A A;  5E3M A;  4BQN A;  3AL0 B;  1W7P A;  4A0Y A;  5DS9 A;  1D1A A;  1ETW A;  3L2Q A;  5E1X A;  1OMI A;  2DA2 A;  1B72 B;  2IA2 A;  2FD5 A;  4AIH A;  4JQF A;  1G59 A;  2FML A;  5H20 A;  4EJT A;  2V1U A;  4A3J J;  4IPA A;  2VC1 A;  2E1C A;  4RGU A;  2OZ6 A;  3ZN0 A;  3EET A;  5AIP A;  3HGY A;  3HYI A;  1X3W B;  1AU7 A;  3GTM J;  1HDP A;  2BZT A;  4EGY A;  1WH5 A;  2R7Q A;  4Y17 A;  1MSF C;  1RI7 A;  1LVK A;  5BOX A;  2EWN A;  3H3Z A;  2ESH A;  4BE1 A;  1FYL A;  2ISZ A;  2R7W A;  4BXX J;  2K86 A;  3KP5 A;  1U0J A;  3M8F A;  4XLE A;  5DCF A;  1UG0 A;  3BWG A;  4RDU A;  3ABM H;  4FIS A;  4D1Q A;  3JR9 A;  1ZGJ A;  4IOA F;  1MKM A;  2O5R A;  2YPR A;  2LVS A;  3E7L A;  2RQQ A;  1X2N A;  4GXO A;  3IAS 2;  3ZQG A;  4KIB A;  4ASN A;  3QPL A;  4BDZ A;  1UG2 A;  4ENK A;  1S6L A;  2NS0 A;  1JJ8 C;  2ELH A;  4D5C A;  4UB6 C;  2W7N A;  1ZG5 A;  2R0Q C;  2KPM A;  2CFO A;  2M5W A;  1UZC A;  2EB7 A;  3HSE A;  4P9F A;  4ZH4 F;  4L0Y B;  1IRX A;  4N9H A;  4V2F A;  1DP7 P;  1RNL A;  2E35 A;  4I76 A;  3O8H A;  4PJM A;  2X48 A;  3F21 A;  2EZI A;  1IXR C;  5FKM A;  2CSO A;  1Q1V A;  3CP8 A;  5GPC A;  2XGD A;  2XRN A;  4UB8 C;  1IGN A;  4CYC B;  1IRF A;  1REP C;  2Z33 A;  3OYL A;  3EUH C;  3FXQ A;  4A3E J;  1SFU A;  2O0Y A;  3HB9 A;  4EJW A;  2FEZ A;  4DBQ A;  2NAZ A;  4DNC A;  2Y0S N;  5HLH A;  3ELK A;  4A12 A;  1YI2 I;  1CF7 B;  2KHM A;  4FT8 A;  1IXS B;  2L4M A;  1DPR A;  2Y31 A;  1U5T B;  1S3J A;  1U9O A;  3KZY A;  5FLV A;  4M9X A;  2ZNY A;  3KP3 A;  1D0X A;  2HZT A;  3G2B A;  3MEX A;  2LTP A;  3F8C A;  1WH7 A;  1F4K A;  1IN6 A;  1P9Q C;  3GLX A;  2ZXH A;  4U0V A;  1WCM J;  4NBQ A;  1HOM A;  4XMY A;  3CF2 A;  4EVI A;  4RGR A;  5CVV A;  2NVU B;  1ZG1 A;  3GVA A;  1SAN A;  3PM1 A;  3COA C;  4IHY A;  4IHW A;  5E3L A;  3NAU A;  1W7P D;  1WIB A;  3ZQ7 A;  2XC7 A;  2XIG A;  3ZRG A;  1R23 A;  2HPI A;  2KIU A;  2V9K A;  2WTE A;  3VDX A;  5GAD J;  3J80 Z;  2BHZ A;  2ME0 A;  2Y9Y A;  2XB0 X;  3HG9 A;  1YX3 A;  3BR1 A;  2ZJ2 A;  1OYY A;  1EH7 A;  2HVR A;  4I7H A;  2HS5 A;  3BQZ A;  4ZZL A;  2R7X A;  3S1Q J;  2RGV A;  1YS6 A;  3BJO A;  1G3T A;  3L7W A;  1RZ4 A;  2QEN A;  1FSE A;  4J00 A;  2VXZ A;  4RB0 A;  4U7B A;  3K4J A;  1JXS A;  1LE8 B;  2QGU A;  3PUB A;  4YFK F;  3J7A Y;  5F0C A;  3S1R J;  3EUH A;  2OJE D;  2BVM A;  3DV8 A;  5DTD A;  1GVJ A;  5L3F A;  1FIP A;  1XX5 A;  2M8E A;  4QTR A;  3L09 A;  1YG2 A;  3LSM A;  4PJ0 C;  5FD5 A;  4KT5 C;  4NC8 A; 
#chains in the Genus database with same CATH homology
 2OTL I;  2JQ7 A;  1FOW A;  3EGV B;  1VQL I;  4IOA F;  2ZJR F;  3G6E I;  3CC7 I;  5DM7 F;  1QA6 A;  3J7Y J;  3CCE I;  2H8W A;  2NXN B;  3CJT B;  1VQ4 I;  3CCQ I;  4IO9 F;  3CCV I;  5DM6 F;  3J7Z I;  2E34 A;  1YHQ I;  3CJS B;  2E35 A;  3CCJ I;  1VQK I;  1ACI A;  3PIP F;  1VQ9 I;  2QEX I;  2OTJ I;  4V19 K;  1VQP I;  3G71 I;  1HC8 A;  1VQ5 I;  1YI2 I;  1VQ6 I;  3CJQ B;  3I55 I;  3CME I;  2QA4 I;  4UY8 I;  3CF5 F;  2E36 A;  1FOY A;  3CC4 I;  3CCM I;  2ZJQ F;  1VQM I;  3G4S I;  1Y39 A;  1VQN I;  1YJN I;  3CMA I;  1YIT I;  5GAE J;  1WIB A;  5JVG F;  2FOW A;  1VQ8 I;  5GAD J;  2ZJP F;  1VQO I;  3CCR I;  2K3F A;  3CCU I;  4IOC F;  1FOX A;  3CC2 I;  1YJ9 I;  3CJR B;  3CD6 I;  3PIO F;  5GAG J;  1VQ7 I;  3I56 I;  1YIJ I;  5GAH J;  3CCL I;  1YJW I;  1MMS A;  1S72 I;  3CCS I;  3DLL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...