2E36A

L11 with sans refinement
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords 50S ribosomal protein L11
publication title The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
pubmed doi rcsb
source organism Thermus thermophilus
total genus 21
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2e36A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2e36A01
3G6EI 2ZJQF 2NXNB 3CMEI 1VQ6I 1VQMI 4IOAF 3CCEI 1VQKI 3PIOF 5DM7F 2E35A 3G4SI 4IOCF 3CCMI 3CJSB 3CCJI 3CC4I 3G71I 3CCUI 1VQPI 3J7ZI 1QA6A 2H8WA 1YJWI 1VQ9I 3CCRI 1YI2I 4V19K 1FOYA 5DM6F 2ZJPF 1YJ9I 3CJRB 3CD6I 1HC8A 1VQNI 5GAEJ 3I55I 3CC7I 1VQ8I 2E36A 5GAGJ 3CC2I 2OTJI 1YIJI 2FOWA 2OTLI 3DLLF 2E34A 5GAHJ 2ZJRF 5GADJ 3CMAI 1ACIA 1WIBA 3CJTB 3CJQB 1VQ7I 1YHQI 1S72I 2JQ7A 3CCLI 2QEXI 1FOWA 4UY8I 3CCSI 1VQ5I 1YITI 3J7YJ 4IO9F 3CCVI 5JVGF 1YJNI 1MMSA 3EGVB 2K3FA 1VQOI 2QA4I 3I56I 1VQ4I 1FOXA 3CF5F 1Y39A 3PIPF 3CCQI 1VQLI
chains in the Genus database with same CATH superfamily
5M3FJ 1TQMA 2R5YB 5LHHA 1ZG5A 2MGQA 1BBYA 5L3CA 4EJOA 3VYRB 3P7NA 2EV6A 1KYWA 3NQOA 4JQFA 1W4MA 2CO5A 1J59A 4BUPA 1V5EA 5EG0A 2NS8A 3EUHA 4WXHA 3H5AA 4D7NA 1FMVA 4UVAA 3SZGA 4UB6C 2LKSA 1BL0A 2R93J 2H8WA 2VKDA 2QSHX 2ESNA 2WB1N 2PJPA 1VQ9I 2XPVA 2DTRA 1R36A 2P5KA 5FJ8J 3DKWA 1W5SA 4II2A 2M8GX 1EV7A 4MIMA 1TLHB 2VBYA 2M4GA 3BPXA 3I3LA 5HDNA 2P7CB 1O7LA 2KJBA 4G9YA 5J8CA 1ON2A 5M5XJ 1RETA 4H0EA 4HSTA 1R71A 4A6DA 1GHCA 2XDVA 1BN5A 2I5UA 2E5NA 3KP4A 2EILH 2BOLA 1P7JA 3I59A 1LFUP 2E36A 1W36D 4KFCA 4CXFA 3GWZA 5K7ZA 2QQAA 3AG4H 2EWNA 3O2PE 4XN3A 4CH7A 1BIAA 4TV7A 2FXAA 2L0KA 2G9WA 4OIRF 4N4NB 4HBLA 5HNFA 3QU6A 3DBLB 1R23A 4NUBA 1MMNA 5LGTA 5J47A 5FD6A 1I3AA 4YFNF 1WIBA 3ERMA 4OIOF 1H9GA 3S3NA 1SFOJ 2VPLA 2YUSA 5FLXZ 1V4RA 3LMMA 1KU7A 4BHPA 3LSMA 3MAJA 3R0JA 4Q48A 3EUHC 2EZIA 2WV0A 1B8IA 2R7OA 1A36A 2HZTA 1G3WA 2AXTC 3ESWB 1IRXA 2BHZA 1Z21A 4L9VA 1AA7A 4DJAA 2JUCA 3TL4X 3QPSA 1WJDA 1ZELA 4AU7A 1Z6TA 3TW7A 3J7YJ 2KMUA 3K10A 4IO9F 2IS6A 5E17F 4A2UA 2ZFUA 4PJNA 3F72A 3J81Z 3VSLA 5F1JA 3DKXA 2YX4A 2CG4A 5J3LA 3S2DJ 4CICA 3HOSA 2KDZA 2EPFA 3DEUA 3A01A 4KIFA 3BQZA 4HQEA 2B0LA 2HXIA 4NB5A 4EGYA 4IKFA 4EATA 1YW9A 3K7AJ 4C9YA 4CCLA 4DBRA 2R7VA 1RUNA 4X0GA 1A6IA 1S29A 4BBRJ 4Y52J 2R92J 4EMSA 2GA1A 3OYAA 1IXSB 1AHDP 2CUEA 3IL2A 2M1BA 2O3FA 3G4SI 3S93A 3HSEA 4HW0A 2VJ5A 3E7LA 3MKZA 2E1NA 3M1EA 1T08B 2OC6A 3CC4I 2ETHA 3FBIB 1AKHB 3ISPA 3E3VA 4YFXF 2X6WA 4BQAA 3CCUI 2LMDA 4XOTA 3WTZA 2VBZA 2R5YA 1IN8A 2COBA 4YG2F 2DFFA 3DP7A 1ZLJA 4B44A 5E1WA 4ENNA 2M0MA 1MW7A 3K4JA 4F93B 3BG7A 3LA3A 3HXLA 4AD9A 1IXRC 1TNTA 5JHFA 3PQKA 3PSFA 1LEBA 3HPHA 2PMZN 5CVVA 2V1XA 1FP2A 3BJAA 4P9UA 5BPDA 4HG2A 3F0CA 4U0WA 1XSDA 1TWHJ 1TW2A 1DQUA 2W1OA 4AIDA 2EFOA 2FOWA 3BR2A 4DYRA 5ICGA 2M7AA 4WK8F 3WTXC 2DYSH 2DMNA 1QGPA 4A3DJ 1MGTA 4IL6C 1F9NA 3G1MA 3WTTC 5ED4A 4M71A 3MKYB 3VOEA 2LKXA 2DT5A 4CSWA 4IHSA 3GUDA 5IT3A 1BC8C 4AUXA 4L0YB 1JUMA 2JA2A 4NC8A 2STWA 1I27A 5B1BH 2IS4A 2MC4A 4Y13A 5K5QA 3L2RA 1R1UA 1SANA 3S8PA 1LKXA 2V9VA 1X1DA 2KIQA 4AWXB 1LJ9A 5BNGA 4RLFA 1XDSA 4LGWA 1R49A 3HG9A 2Y2ZA 2DFEA 4RB0A 1YJNI 1U78A 1QZEA 3HUGB 1WKMA 3G3ZA 4YIRX 4HDVA 4ZYAA 2KISA 1Y8RB 2R7ZJ 2DJIA 4EJWA 2A07F 2V6CA 5E8GA 3ZQHA 4HF1A 2DA7A 5TGTA 4JBAA 1APLC 3B6AA 3FHNA 4ESJA 2LFBA 1UAAA 3GTOJ 3D5RC 1QZYA 1ENHA 2DBBA 3DV8A 1X3ZB 3HL2A 4BQNA 3C18A 1UG0A 4RGXA 2X1CA 4A5MA 2XAQA 2HPIA 4AVZA 3VWBA 1ZTRA 1K7AA 1D0ZA 2ZO4A 3CUQC 4LITA 4F7ZA 1QU3A 2N8GA 4A3FJ 3W2AA 5DCMA 1T95A 3PNVA 1W7PD 3FBNB 1S5LC 2K9NA 2NVQJ 1N25A 3FZVA 2XPWA 1IUYA 3I9V2 3NWSA 2K40A 1IRFA 3TOAA 4RM3A 3FXJA 2ELHA 1A31A 4MLOA 5GTIC 5KVRA 3OSFA 2QSGX 1OCTC 1GDTA 5KAIC 3SEZA 1WJAA 1KU9A 1QPMA 2CFXA 3ZQ7A 2R7QA 4CUGA 1SD6A 4BU2A 3GFMA 3KFWX 1IF1A 4A5NA 3ZCOA 4HPQA 3N97A 2NVTJ 2FSWA 4A0ZA 1HLVA 3HOWJ 1X2MA 5JLWA 5HS9A 1AKHA 3HKZN 4UUVA 4UUSB 4A3LJ 3N05A 3CESA 1HBXG 4M72A 3FXQA 4IPAA 1J0RA 2FQ4A 2IP2A 1DU0A 5FLXK 1YIOA 4Y7NJ 2HR3A 2K4BA 2Y9ZA 2X48A 1K78B 1IN4A 3KZYA 3LSRA 3S2HJ 3DWLE 3GF2A 2L5QA 4I7HA 1RUOA 2L2OA 2D1HA 2RQQA 4OOIA 3SZTA 3BLYA 1OCRH 4D1QA 1ETWA 2FF4A 2PEXA 5KCMA 1P2FA 4KNYA 5J1YA 2QGUA 4M74A 1IG7A 2FOKA 3ZN0A 2R7RA 3RJPA 3QQAA 2MLKA 4A0XA 2KJCA 3WTYC 2IA1A 3VDXA 1IW7F 1PP8F 2NRAC 3HIFA 9ANTA 3GFJA 3J81K 2A6EF 3GLLA 4U88A 1MDMA 3CQZJ 5HOOA 4W1UA 2R7TA 3Q5FA 3E6CC 1JKRC 2F48A 4HYEA 1YITI 3K0LA 4XONA 4ANJA 4D5FA 5GPAA 4L0ZB 3ROUA 2Z99A 2VOOA 4LG0B 1W7PB 2XC7A 2B9SA 2PLYA 1SD5A 4WXDA 2EJRA 2NS0A 4PGGA 1VQ4I 2RDPA 2FX0A 5FKMA 3LAPA 1LNWA 1RNLA 3CLOA 2VN2A 3PIPF 1UFMA 4XRMA 2ZFWA 3RYPA 1MNDA 2E1MC 1W36C 2CFOA 1WSUA 1X2NA 3PL8A 5HLGA 2M45A 1MBKA 4GGGA 3HUGA 5FKLA 1XMAA 4ASNA 2EZLA 5AIPA 2EV5A 2VONA 3J80Z 1H88C 1QVTA 3KLNA 2IGKA 2OU2A 1Q1VA 1U5TB 4Q47A 2ACJA 2M7BA 3EPZA 2ZNYA 3KP6A 2P0WA 2P4WA 3AG3H 3K4MA 2VXZA 4YEJA 2XAJA 3I53A 3SZPA 4E4HA 3G71I 1QA6A 2L7FP 3FXMA 4BDZA 2ISYA 3DKYA 4IZZA 1L0OC 4IQ4A 4JX4A 3ZQIA 1ON1A 4HNTA 3FXLA 3KP3A 2M5WA 3FXKA 1LDDA 2YX7A 1P6RA 4BAYA 2K9MA 4GRIA 1JGGA 2PQ8A 1ETXA 3LWFA 4ZTJA 1IAWA 2CQQA 3DFGA 1MBHA 2M8EA 4G6DA 5LRRA 5LFAA 1HOMA 1J9IA 3L2QA 2P6TA 1STZA 2R0QC 2GOMA 4XRSA 2LF7A 4XRFA 5DD8A 2J5PA 1USTA 2V9PA 1XPXA 1E3HA 3OIOA 1WRJA 2HQNA 2V6EA 3GCMA 3K4KA 4CCNA 3C7JA 4CZZA 1T39A 3U1DA 3AL0B 1X58A 1XMXA 2VL8A 4ESBA 2L9SA 2JWTA 5CJ9A 1GXQA 1P4XA 4BGDA 5FB2A 4FQGA 2XHKA 1ZGAA 1UMQA 2DOEA 3SXYA 4ZC3A 1RKTA 4LFUA 1KQ0A 4P96A 3C1DA 2ADUA 3LQQA 2HQRA 5TJJA 5GPCA 2ID6A 1B9NA 4U87A 4OWRB 4UUSA 3JSOA 1KZHA 2HOSA 3IWZA 4OU0A 4RAFA 4IRIA 3E5QA 4CYCB 2MH9A 3H3ZA 1R9TJ 5IP7J 3FIWA 1ETQA 4KJZA 2KIMA 4LMYA 4CA0A 1OR7C 1K78A 4ZYGA 3QYBA 1W5TA 2JRMA 3BTCA 4F3QA 2HDCA 1LFBA 2FE3A 2LDUA 2FNPA 4G6QA 4M6VA 2PN6A 3MKWB 3E1SA 2VE8A 1G2HA 2K3FA 2JRTA 5JHUA 3GXOA 3H92A 1WH5A 3V8KA 5D5UB 2DJNA 3AG1H 2HOAA 2F4MB 3WE2A 2CH0A 3KZZA 4E7LA 3BG9A 1Y0NA 5IYBJ 3AFHA 2W4SA 4I09A 3JTHA 1YFHA 3GEZA 4BXXJ 5ICFA 1DUXC 4C3JJ 1D0YA 1FLIA 2YU3A 3ZGKA 4A3IJ 3WG9A 1ORKA 3M8JA 3OR2C 2VOPA 2GXAA 4J00A 4BJ6C 1MMAA 4LG0A 1W7PA 5LHIA 1BOAA 2VKEA 3ASNH 5H6RA 1R7JA 2E7XA 4HX4A 2MSYA 2RAEA 3O3KA 3OS1A 1WI3A 2VI6A 3HC7A 3GTQJ 1BJAA 4BQQA 2XASA 1K83J 2CWEA 2ZJ2A 3BCAA 3H1CA 2V79A 3E6BA 2DT7B 5H2FC 3PFIA 4C2MJ 4BHBA 1I50J 4RAYA 3OYIA 4ENKA 3V7RA 4KT5C 2TRTA 4F91B 3S1NJ 1IO2A 1X1BA 2UV1A 2VLAA 3WODF 2IXSA 3RZDJ 1QHHD 3FX3A 5EEAA 3ERED 4PJ0C 3QOEA 5LGUA 1XD7A 3GFLA 4RGRA 2TDXA 2F5EA 3G73A 3M4OJ 1A6QA 4G12A 4A3MJ 2STTA 3NWTA 2HKOA 3S2WA 2Y0MA 4GYGA 4MTEA 1PUFB 2W85A 5CVRA 1B6AA 3O8HA 3DEEA 2WY7Q 4MEYF 2ME6A 2XAHA 1ZHFA 3EUKL 4AC0A 4AYBA 3BR5A 3BC8A 3ZMVA 1LDKB 2HOTA 4JOMA 4YRVA 5KAFC 3D1NI 2XROA 3PJRA 3M9AA 4PZJA 2FD5A 3HRTA 4AIKA 2E60A 4D9JA 2L02A 2DDAA 2KFDA 5FKOA 3OYLA 4X6AJ 2H1LA 3CP8A 4RLQA 4DBQA 2L7MP 3PO2J 5F04A 1JHHA 1N78A 2L4AA 4RB3C 1FTTA 4LOCA 4U7BA 3WU1B 2O6GE 4MQ9F 5C4JJ 3BJOA 3TOBA 4ENJA 5E3LA 4KDPA 1CQTA 2EZKA 4FE4A 2ECBA 3U1KA 2ID3A 1FYMA 2PI0A 4O6JA 5F08A 1O57A 2L54A 4XM3A 1R6RA 4GDFA 2EIJH 2RKHA 1I39A 2DMPA 2OQRA 3I4MJ 4CCKA 2NVYJ 2WAEA 1S7AA 4HZFA 3VYTB 4CYCA 1DGRM 1A04A 4R8HA 3E5XA 3LA2A 3J80K 1MJBA 3FKJA 2XUBA 5HS7A 3JRCA 4BACA 4UVBA 2XF5A 1EKEA 2NXNB 3FMSA 3SDBA 3CMEI 3N4MA 3LA7A 2EA2A 5K1YA 4E7IA 4A93J 3OOUA 1MZBA 2DYRH 1WJBA 2A69F 2GAUA 3LSGA 4IQJA 3VODA 5DV5A 1SMYF 2E35A 4DYQA 3WU2C 1J7KA 4EV0A 3L09A 3GFIA 1OCPA 1F1ZA 2JVHA 2ZSHB 3IH3A 4RMNA 3DBHB 1LVAA 2EQRA 2X6XA 2HVSA 1D5VA 4L5EA 4A3BJ 5DUKA 1ZN2A 4G8XA 2Q0OA 3CDHA 3PUFA 3BQYA 3VSKA 2Y9YA 3A03A 1RI7A 2ZB9A 2VQLA 3F22A 4IHVA 3VFZA 5DCFA 2MFZA 4S04A 1MBJA 1OQYA 2WBMA 4V2GA 4EEFG 3IRQA 1PYVA 3TO7A 2Q8KA 2B7EA 2DI3A 1C0WA 1JUPA 1JT6A 4EJVA 3HTUA 2EFNA 2MG4A 3S1QJ 2X6OA 3I55I 4WCGA 2M4KA 2IEKA 3CTAA 3W3CA 2K02A 3BZKA 3GLXA 3A4CA 1FYKA 4FE7A 2DMUA 1PUEE 2LBFA 3V8JA 3JCUC 4MGRA 1HKSA 1A5JA 2ZJRF 3OS2A 4XNFA 2DA1A 3CUQB 3HSRA 4Z6YA 4OIQF 1MJAA 1ULYA 3J7AY 1O7FA 3WGHA 5L3EA 2LKPA 2VASA 3MMYB 3I71A 4HRIA 1ZREA 4KITB 2D45A 5FROA 2K7LA 1VNDA 5FKKA 3IUOA 2A68F 3TO9A 3CCLI 5A2QZ 4HNUA 2JA8J 2BXZA 2X6YA 1PP7U 5B3SH 2BE5F 1PUFA 1FZPB 3CMMA 5ERIA 3JRBA 1EF4A 3JR9A 1VFCA 3DU5A 2DQLA 4HAMA 4DW6A 1I6XA 4OMYA 1W1WE 3MWMA 3JRAA 2QM3A 1E3OC 3G1LA 1S7OA 3IKTA 2BVLA 1LVKA 1UB9A 2NNYA 2VE9A 5CLSA 2DU9A 2IS1A 1MBGA 4IVNA 3CCYA 4QWQA 1TW3A 2OD5A 3K4BA 4M3GA 1SVLA 2E19A 2EZHA 2MLGA 4PSXA 3GBGA 3TBIA 5H20A 1UHMA 2QLZA 3TP3A 4FHTA 2Y0SA 1SD4A 3L2VA 5JLXA 3GX4X 4PFOA 3VPRA 3LFUA 4M6XA 3ABMH 4ESFA 3KEQA 2P5VA 5EEGA 1DDNA 4RB1A 5HVQC 2JUGA 2XRLA 4LLGF 5DM7F 2XF7A 2HGCA 5DCMB 4B3XA 1FC3A 1U8RA 1JKOC 4MO7A 5CQEA 2FBHA 3DPLC 2OZ6A 3CJNA 5E1ZB 2GZWA 1FWZA 1VTNC 1GV2A 3DQVC 3BY6A 3BPVA 3E6DA 3FK7A 5BPIA 5F0CA 2ELKA 3VB2A 4BNCA 3OY9A 4E7SA 1V5GA 4E7HA 2L01A 2HNHA 3L7WA 1T33A 2HOEA 5DYMA 4PK4A 5F1RA 4HLYA 2HU9A 3E0JB 2QENA 5JVTA 2O8KA 2LF8A 3RYRA 3WTSC 3KCCA 2M0CA 1NK3P 4S0HB 4I76A 2DPUA 5FRNA 4PCQA 3I4PA 5GAEJ 4CO8A 4BKXA 1TP4A 1WJCA 3T1BA 1MBFA 4KN7X 3KE2A 5E79C 3Q0WA 1S6LA 3SFIA 2OF7A 2ZCWA 2K3PA 3SDGA 3M3YJ 2VT2A 1LQ1A 3BR3A 1GVJA 1X1CA 2CUFA 4UV8A 3DLLF 2CYYA 2HWVA 3GVAA 5GAHJ 2E1MB 3D5LA 4XSZF 3MQ0A 1MKMA 1UELB 3CMAI 3KP2A 3FISA 2K9QA 2CW7A 2H8RA 2HKXA 4DGWB 2R7XA 2BZTA 2CV2A 1SFKA 1Y56A 2HQ5A 4L9NA 2DK5A 3PO3J 3K4NA 2R7DA 1OISA 4KYWA 3LFKA 5HS8A 3RDIA 4UNOA 3WE3A 1ZGWA 2RVCA 5JI6A 1G3YA 1PDNC 1ZLKA 5EEHA 3JREA 3CUQA 1NHAA 1TT5B 5C3EJ 3OV8A 4KUMA 3ZMZA 1TWAJ 5FFZA 3S16J 1MDMB 3HBLA 3WU0A 1OCZH 3ZMDA 1AU7A 1P4AA 2V9KA 2QA4I 3OMYA 3I56I 3H3UA 2QBYB 1U8BA 1Z7UA 3MCZA 2L9VA 3NRVA 2NVUB 5LBQA 1LB2A 5D4SA 1MBEA 5EJCA 3QOPA 4HLXA 2JZYA 3TDUC 1H8AC 4F92B 3W6JB 3GTJJ 1FX7A 2K5CA 2Y0SN 1QO0D 2CQNA 2EBIA 3QYFA 4NBQA 2MC3A 4BXFA 2L4MA 4DQ2A 4W97A 3QPTA 3BP8A 1VF9A 3TDZC 2VC0A 3I4NJ 2X1EA 3DPTA 4II3A 1Z6RA 3CDIA 4DNCA 1ZARA 4QLCU 2MA3A 1U2WA 3R60A 2JVGA 1SEUA 2ZNZA 4G7HF 2X9DA 1EH7A 4M6YA 1G4DA 1Z3XA 1M1EB 3DTKA 2JN6A 4V19K 3RZOJ 1BI2A 2ESHA 3DLAA 2ZXJA 2HTSA 4KN4X 1HXDA 4BE0A 5FRMA 2HYGD 3LSPA 4HF0A 5JFRA 3LAJA 4I99C 2RC4A 1BW5A 2WADA 5F6FA 2O03A 3DCFA 1R1TA 4R79A 2ECCA 2LY9A 1H89C 4CYDA 1T8IA 3GO5A 3CUOA 4XKCA 4RM2A 4WXCA 2GXGA 1SMTA 2GIVA 4YFKF 2ZC2A 1YIJI 2GA2A 1WQ2A 4HA8A 3WTVC 3FM5A 3JRGA 2LK2A 3HEFA 4UXNA 1JUSA 5A2QK 2A61A 2W24A 4LD5A 2ME0A 3RPUD 5ICEA 5D5VB 1MSFC 4RB2C 1ACIA 3JRHA 2P8TA 1HA8A 2EH3A 2EK5A 5FO5A 2K86A 2RNGA 4X1EA 4O5VA 5CYVA 1FSEA 3KLOA 1T38A 1REPC 4MQVA 3HRMA 1B72B 1GXPA 2YPRA 1BR4A 1YHQI 4PGHA 1HW2A 4IRGA 2PG4A 3R0AA 3O6BB 4E7KA 2CRGA 4EM0B 3PQJA 3OYMA 2VODA 1E17A 1AOYA 4UY8I 4DOZA 3Q9SA 1P7IA 3PUBA 4KMFA 1QRYA 4E7ZA 1R22A 4B4CA 1MMGA 1BC7C 3OIQA 2LH9A 2M87A 2LRDA 1F4KA 2BHYA 4XMYA 2WAQA 2AO9A 4PSWA 2MYSA 2ZSIB 2QKMB 3MVPA 2JSPA 3LSKA 3S3OA 1B59A 2XB0X 3BJ6A 1LUJB 3QU3A 2Z1DA 2BEOA 2DA6A 4XKVA 1ZKGA 1QBJA 2VQHA 4N9IA 1MNMC 4HOBA 3K9TA 1Y8QB 4A3GJ 2DFHA 4RDUA 3PIOF 2XB5A 1E0EA 1X19A 2VUMJ 3BTIA 4XORA 2XGXA 3HGGA 2QBYA 3FXOA 1B9MA 2A6HF 3FHZA 1Y1VJ 1DP7P 4ZDPA 3CCMI 2DCEA 2A6TA 3ZQFA 2DMQA 1SC7A 3G1OA 1V55H 2ZMEC 5BQTA 3J7AO 1OPCA 2CQKA 2O61A 1ONVA 1RPWA 3FKIJ 4B1RA 4G94A 3EETA 3HHHA 1TL8A 2JA7J 2ELJA 5IP9J 1LE8A 3FXRA 1ERDA 1U9OA 1TWGJ 2JA6J 1MH4A 5E3MA 3MN2A 4AIJA 2E2HJ 3C2BA 1DP3A 2GWRA 2VPRA 2KZGA 2XSJC 4P5OA 1ETKA 3L1PA 4EM2A 1UZCA 2F5FA 2NVXJ 1OR7A 3OYCA 2JPCA 3HRUA 3HJEA 1TC3C 2AXLA 3CJTB 3WHCA 4HX7A 1Z1DA 2QKLB 2CV0A 4K2EA 2BW3A 1XTAA 2BGCA 3ZMTA 2H1KA 1BA5A 2D2WA 5BOXA 4YIIA 4C3IJ 1I6HJ 2CW8A 2KL4A 2JQ7A 4XKWA 3FK6A 4KA4A 2DOAA 1IRGA 1YLFA 4XLEA 2HEOA 1E2XA 2BY2A 1X1PA 1R5ID 2K9LA 3S32A 5C44J 3ZQGA 4M3EA 2LG4A 4FETA 2KPMA 2VBWA 1KQ9A 1WJEA 3ZR8X 3MFKA 2O8XA 2NOGA 2R4GA 2DA4A 3SYTA 1B72A 1VQOI 1KONA 1HKTA 5J8FA 1FEXA 3NAUA 3DTIA 3IRRA 4M3DA 2LC2A 3BZ6A 1WCMJ 1YRNA 1L3LA 3F23A 4QSHA 2RV8A 2OJED 3DPUA 2OV7A 1R5GA 1SFEA 1Y39A 2KLOA 3NARA 4CZCA 1H0MA 2IRFG 3GTKJ 3TW6A 3F8FA 1ZAOA 1D3YA 1VQMI 5D5WB 2KP6A 5AONA 1IRZA 1QNTA 5CKTA 4CDGA 1J2XA 4AVPA 2QZ8A 3OL4A 2B63J 2DO7A 2W84A 3TEDA 5CPRB 1FBUA 3QAHA 3SQNA 5H6QA 2Y69H 4WF2A 5B5EC 2E1OA 2CU7A 5JR3A 2VQCA 3VEPA 3ABTA 1P9QC 4L5JA 2MW8A 4BJTA 2X0LA 1ZR2A 2UUZA 3I54A 1V5FA 1J5YA 1XMKA 5J6XA 3T8TA 4BH9A 4XIDA 1JKQC 4N4OB 3BG5A 3IP4B 1KYZA 1X4OA 4ON0A 2IJLA 1XG1A 1WH7A 4L5IA 4ZDLA 2JPBA 3RKQA 1YX3A 3Q0VA 3ZOBA 5K5RA 2WY8Q 2OCEA 3HOTA 3CJRB 3KIOA 3GW2A 3IV5A 1VQNI 3BG3A 3GZNB 2EFWA 4LK1F 2OCCH 4BY7J 4B09A 2DMTA 1TNSA 1LPQA 1F5TA 2CGPA 4I6ZA 1IV6A 2M34A 3QRFF 3H36A 2ZBKA 2E2JJ 3T8RA 2OZUA 1WVRA 1T56A 1Z9CA 3FMRA 1R4MB 2ICWG 2G0EA 4Y3OA 2W82A 2LBFB 4P1WA 4ZDOA 2PX9A 3RPUA 5K7HA 4BHCA 3LSTA 2GXBA 2R3SA 1FJLA 3W6VA 2BVMA 1IUFA 3JAMZ 3I64A 4IEJA 1SFXA 3H5NA 4Y33A 4G7ZF 1NK2P 2A3SA 4NHJA 4NC6A 1BR2A 3H9QA 3K2ZA 1U9NA 3HM5A 2F5CA 3K1MA 2DODA 1AWCA 3KZIC 5ILVA 3BG6A 4MFEA 2BY0A 5FD5A 1NG6A 3HZJA 4XLCA 3VYUB 3VYSB 3RKWA 2HDDA 2G7HA 3RIRA 5FLVA 1RC9A 2V4JC 3ULQB 5BS6A 5K7FA 4ZYHA 3BTLA 4ENMA 4XSXF 3GTLJ 4D7MA 2MD0A 1KU2A 3OOPA 2WB1A 2CJJA 1O3TA 2XPUA 2KZVA 4LB6B 1ZRFA 2QVOA 2VXDA 1K79A 4C3HJ 3CO7C 1J75A 2LP0A 3EDPA 3FM3A 1TQPA 2VT3A 1EJ9A 4HV6A 4L9JA 2F5DA 4O3MA 3HGYA 3M1CA 2F6CA 4D5CA 3G2BA 3CCQI 1Y6IA 3F9KA 1MIJA 2QSFX 1LFPA 5FGMA 4IHWA 2ZXIA 2LNBA 3W2VA 3P9IA 1O3RA 5E20A 2E2IJ 3BR0A 3ZQCA 1XSXA 1N77A 3TGNA 1H9TA 3S15J 4A69C 2KHMA 3TMOA 4U0YA 2IS2A 3IAM2 3WHBA 3QODA 5DDGA 2BBYA 1WI9A 1DGWY 2QQ9A 1Z91A 4LK0F 2E7WA 1IXCA 3R6SA 2CUZA 6PAXA 1JI8A 2UXNA 1Z7LA 2E5ZA 1HW1A 4AIHA 3ABKH 4BEHB 2ISZA 2FA5A 4QPOA 4LLNA 3GTMJ 2M2EA 5FFXA 4GXOA 2Z3YA 2XKOA 3CD6I 2K9SA 1MSEC 3C3WA 1DU6A 3BOQA 1JJ6C 2HZDA 3DEWA 1YQAA 3RI4A 1G3SA 4XRSG 3H9JA 4OAYA 5LEJA 1NTCA 2KRFA 3ZP5A 5KHDA 2LVSA 1BI1A 3UNGC 1D8JA 4NQWA 2OTLI 3OR1C 2AHQA 4C2UA 4N0BA 2HPMA 1ETOA 1XCVA 2IGNA 4MNUA 1IJWC 3LSHA 3K70D 5E8IA 2GQQA 2LSOA 3KX2A 1K61A 1JTXA 1XGSA 1P4WA 4E7JA 3H3VK 2IGMA 2KRHA 3ECOA 4Q4ZF 2CS3A 2XGEA 5HDGA 1FMWA 1FIPA 4LJZF 4A12A 4Q5SF 4IX7A 2H6CA 4UB8C 1EH8A 2VQGA 3REOA 3KYLA 1IGNA 2DPDA 3R4KA 1WZ2A 5F0FA 5LEKA 1J09A 3OS0A 2CSOA 3QPHA 1XSVA 5E3NA 2CV1A 3EUAA 1WGXA 2JMWA 2XGCA 2QEXI 4OINF 1X4PA 3QPLA 2AS5F 2EIKH 3F3XA 5HLIA 1OJLA 3Q0UA 1UCRA 3A02A 3LL7A 2GLOA 3ECHA 3PNTA 1W0UA 2HVQA 5HLHA 2W7NA 4ETSA 5DD4A 5LLQA 3HTSB 1CF7A 4QPQA 4QTRA 1ETVA 3RSNA 1USSA 1Q1HA 4I01A 4I02A 5IYCJ 3MZHA 5IOZA 3FF5A 1K4TA 2CW0F 3ABUA 4AYBN 2PMUA 1NG7A 1TZLA 3IWFA 3OYHA 1HF0A 1D8KA 5L3FA 4EM1A 2R7UA 1W5CC 1YX5A 1OLTA 1IV8A 3CMYA 1Z05A 1WJFA 1HDDC 3BCBA 2KKOA 5K5OA 4L9TA 3Q9VA 4EQQA 4IOAF 2JT1A 1FBSA 2EFPA 3CO6C 1HW5A 2PMZA 1D1CA 2HQAA 2P7VB 4ZYEA 1HSJA 2VKVA 5E18F 1KGSA 3R61A 4QIWN 4DIQA 1R1VA 1TWCJ 4UUTA 3DBRB 1V3FA 3ONQA 4CGZA 1R4NB 3JRIA 3B02A 3CCJI 2HFHA 2ZKZA 2XVCA 1D1BA 3J7ZI 4Y17A 5L3GA 5D8LB 4M73A 3CCRI 5M5WJ 1ITYA 1R5HA 1YI2I 1KQ8A 3U9GA 1HKQA 1SAXA 1FIAA 1BI3A 1XN7A 2IW5A 3WG7H 1T6SA 2HXOA 3CDLA 3WTUC 1Z3YA 5EGOA 3MZ8A 1JE8A 2LR8A 5D5XB 2JTVA 2O7OA 1G6NA 2DAOA 1IN6A 5J4YA 3IH4A 3OYJA 2HVRA 3L9FA 3DF8A 4B3AA 2DXIA 2CMPA 5LHGA 1YTYA 1RIOH 3F6VA 4RAGA 4BQOA 3BDDA 2OTJI 1T98A 3JAMK 1X3WB 1KA8A 1Y0UA 2IA0A 5LGNA 2OQGA 4BEHA 5DUIA 2QYOA 1Y1WJ 3CF2A 2PFBA 4BXUA 5GADJ 5E1XA 3TO6A 4M9XA 1ETYA 1PJRA 4N9HA 3L2UA 1RR7A 3U21A 4ZZDA 1VQ7I 3PNYA 1W0TA 5CVIA 2QQ8A 2LYCA 3EQLF 1BOBA 3P9CA 2CQXA 3FXUA 2Y31A 3LSJA 2YSRA 3FDYA 1ZRCA 2FU4A 2F4OB 2IAIA 4C30A 5EDNA 2IPQX 5F27A 2FBIA 2R5ZB 2XAFA 4XLNF 2FQ3A 2ZMEB 3S1MJ 3OYBA 2QCOA 2EIMH 3ZRGA 3CCSI 4XN0A 1GLNA 4XR6A 2XAGA 4JYKA 4OAZA 3H9GA 2QWWA 3HYIA 1HSTA 5HODA 3FMQA 5DEQA 1FOKA 4MHGA 1OCCH 2W48A 5F64A 3HOUJ 2OA4A 3DU6A 2R7SA 1ODDA 5ILUA 4ZYDA 3JRDA 1Z67A 4R1HA 3OYFA 5FLMJ 2YU9J 3BR1A 4HQMA 3K4LA 5M5YJ 3G6EI 2NAZA 1K4SA 2GM4A 4F55A 4IJAA 4KIBA 3M8FA 3PSIA 3HKZA 2WAFA 3K4CA 1LEAA 4FISA 1FYLA 1SVOA 1ZH5A 2LLKA 5KNLA 3HOYJ 3I0TA 4U7DA 2L9RA 2EV0A 4A3KJ 4NNJA 4ITVA 5IP6A 2D5VA 4A0YA 3BT9A 2DA3A 5DS9A 1F43A 1NH3A 2LOOA 4FTHA 2P6SA 1FTZA 2XAUA 4PFPA 2Y30A 1UJ8A 3UKGA 4ZJZA 1V54H 4Y15A 3F8MA 2I8DA 4XLFA 3ZMUA 1SAUA 3RKYA 4HX8A 1FY7A 1OKRA 5J1UA 4ZTFA 2Q2EB 2QF7A 2KIFA 3QP5A 1RESA 1LE8B 2W00A 2BYVE 3OYDA 4B48A 2WC2A 3ZN1A 5L3BA 2HS5A 1TWFJ 1FT9A 5D8KB 5IY5H 3ASOH 3ZMSA 3V7CA 3CC7I 4CCJA 4BY1J 4NDLA 4LLLA 3MKLA 4KIGA 2V1UA 4MTDA 5HNHA 1D1AA 1F36A 4RBOA 2DK8A 4V2FA 2LD5A 4RGUA 2HYFA 4UHTA 2OUMA 1MH3A 4YIFA 3L2WA 1T0FA 2P81A 2Z2SB 1ZR4A 2K4JA 2D1VA 4P9FA 2Z9OA 1Z77A 3LNQA 2DDBA 2LTPA 4CCOA 2IT0A 4HDUA 3IH2A 4BS9A 3CJQB 3HPGA 3LQRA 3COAC 1MNEA 4E6KG 1YO5C 3OYKA 1OCOH 1S9HA 3SJMA 2RNJA 3BR6A 2G7UA 3P5JA 3GZ5A 4B43A 2VIXA 2BW3B 3S1RJ 2IVMA 2QUFA 2UZKA 2EB7A 5FKNA 1G8XA 2K27A 2L3DA 3V4GA 1XC5A 1YOVB 2R7WA 1WPKA 1HQCA 1EA3A 1JXSA 2XSDC 1Z0XA 2M30A 2YR2A 4AM3A 2H27A 2FNAA 2R7FA 4IRHA 5KK1A 1FPQA 3K1PA 3OWTA 3KEYA 2PJRB 5ICCA 1MD0A 3TP0A 4BYYA 3CF5F 2GIZA 2R5ZA 1FNNA 1YRNB 1JKPC 2ZMEA 4A3JJ 2DA5A 2IBDA 1VQLI 1O4XA 1YS7A 1YYVA 1YE9A 3S3MA 4XBFA 1T0FC 3FWEA 1VQ6I 2V26A 1UHSA 4PJMA 3AKZA 1XDUA 1VQKI 2BXYA 4G6TB 3K70C 1ZRDA 4KT6A 4KMUX 4IOCF 2DN0A 4HEA2 1B4AA 2IA2A 4PJJA 3CJSB 1IDZA 1KU3A 2ZXWH 4CCMA 2XGDA 1IN7A 1RZ4A 1OYWA 4IXAA 1QPIA 1HCRA 2E71A 2ZJPF 3HOXJ 5HDKA 1E3PA 1GVDA 1WHUA 5D6EA 4OIPF 4FASD 1QVUA 1X3UA 1SD7A 2Y48A 1G59A 1YW7A 1PVEA 3MEXA 2UWMA 4C2TA 3A2KA 4FX0A 3ZPLA 4XLAA 4JK1X 3ZXSA 1O3SA 1ZQ3P 4L18B 3ELKA 3RCOA 1TTYA 3OYEA 2J5OA 1OYIA 3W6KB 1VQ8I 2KQRA 3CC2I 2L7KA 1XGOA 3O8GA 4XLHA 3A0HC 3BTJA 3AAFA 2W57A 3P9KA 2E34A 3F8NA 5BMZA 4HNVA 2AQFA 1R58A 2Q2EA 5LRSA 3RPQA 3JTGA 3JRFA 4KISA 3EYYA 5E3OA 3V8LA 4Z2YA 1GT0C 2VJIA 3KPHA 1O3QA 2GOXB 1QQIA 1I1GA 5EZHA 4YELA 4ABZA 2TCTA 3ABLH 4HSRA 1IC8A 2A05A 1U0JA 2LY1A 4OMZA 1S72I 1UG2A 4HV5A 1D5YA 4Y4RA 4MFDA 2DLLA 3BROA 2YS9A 1FOWA 2JJ7A 2Z5UA 4XLPF 4CHUA 4IHTA 5IT9Z 3F6OA 2DA2A 5TISC 4D0PA 4DZJA 4JP0A 1OYYA 4XL9A 3PFYA 4J19A 2IGOA 4BBSJ 3B73A 2LY2A 2Y75A 2BY3A 1CGPA 1MMSA 1QZZA 1JHFA 4I2OA 3GZ6A 2DTZA 4UVCA 3E6MA 1FOXA 5D6FA 3I58A 1OMIA 4WWCA 4IHXA 5IYDJ 2NOJB 4BJ5C 2VB6A 1RR8C 5M3MJ 3BWGA 1BJZA 2Z16A 5TRDA 2W25A 3PM1A 2ZJQF 1N75A 5CVUA 5GTHC 3OYNA 1POGA 2DFIA 1IN5A 2DW4A 1EH6A 2UXXA 3CCEI 4M9SA 2XF6A 3OL3A 5C4XJ 1WWXA 4UV9A 1I5ZA 2WTEA 5D4RA 5J4VA 2PJRA 3K2AA 2VKHA 1FSHA 1S8NA 2HTJA 2Z33A 1BR1A 1P92A 2PBIA 2BY1A 2RGVA 5EZGA 1VI0A 1SVMA 2FBKA 1U6GA 2WAQN 1VQPI 3SEQA 1FP1D 2ZXHA 2PMHA 3ZQLA 3A0BC 3RKXA 3IHUA 5CQGA 3HRSA 1FOYA 4A6EA 3KYDB 5DM6F 4DYCA 1ZK8A 3QYEA 2A5WA 2XRNA 3Q3SA 3E97A 3SFZA 2EINH 2FJ1A 1TBXA 3IKVA 4P55A 2P5LC 1ZG1A 2CUJA 4FCYA 4I0BA 4RGSA 1XS9A 3MZYA 4B8XA 4A3CJ 4XQFA 3F21A 1IDYA 4GO1A 5HLTA 1JT0A 4RS8A 3HOZJ 3KP5A 2I10A 3H5RA 1R00A 3HDDA 1DPRA 2H94A 2JK3A 4MEXF 5IOYA 3AG2H 1ZGJA 1XB4A 4M3BA 4NQWB 2DOFA 3QWLA 4LIVA 4EJTA 3ML6A 3K6GA 1ZG3A 4GCVA 2E1CA 4FX4A 4LB5A 3M7GA 4JX6A 4IF4A 1LDJA 3DXJF 2HI3A 3WTWC 1YW8A 1IZ1A 3F8BA 3E5UA 2Q1ZB 2XV4S 3HB9A 1RRJA 4XK4A 4WX9A 2H6BA 4GYIA 3M8EA 3D0SA 4F52A 5IPAA 4PDKA 5LD2C 2COMA 3A1YA 3C2HA 1XGNA 3T5XA 4E70A 3TQNA 1VQ5I 3ZQQA 5AIQA 1G3TA 3V42A 1I3QJ 3CCVI 5JVGF 4M3FA 3T0YA 1MJ9A 3EGVB 3K69A 4RA2A 2BV6A 1QHGA 2H09A 3F8CA 1MMDA 3M07A 2X4HA 2RREA 1CF7B 1UHWA 5J1RA 3W2WA 2JA5J 2V1NA 4BE2A 2NS7A 2KDOA 2X1DA 1TT0A 3RQ4A 5EG0B 2V7FA 3HHGA 4XOPA 2EFQA 2VJJA 1GUUA 3K1NA 2HDWA 4LG3A 2MD5A 2MH2A 3KYCB 1OFCX 2F4IA 3RQIA 3OSGA 4NC7A 5B66C 1A35A 3U2RA 2VC1A 2GBYA 3JW4A 1WFXA 1D0XA 1U5TA 3CP2A 5F0HA 2A5YB 1SFUA 3GMEA 1VZ0A 2KRCA 1JJ8C 4PJLA 2L9NA 2MBFA 1I1SA 2F2EA 2X51A 3H35A 1DPUA 2WWYA 1K6YA 4G7OF 3GYHX 3HOVJ 5J40A 1BW6A 3I59B 4BL0B 1K6OA 1YJWI 3KEOA 1BIBA 3L2CA 3IC7A 3OYGA 3IAS2 4I0AA 3GTPJ 3CLQA 1BI0A 2QQBA 1GV5A 2JSCA 5ILSA 4ZZLA 3BZCA 5GP9A 1YJ9I 2FEZA 3H0GJ 4M9ZA 1YS6A 4FT8A 2OPTA 4EJUA 3WGIA 3EYIA 5EGOB 2HYJA 2NNNA 4EGZA 2F5VA 4EVIA 1HC8A 1ZYRF 4LIUA 3TKYA 2FMLA 3GTGJ 1RKWA 1U3EM 3KP7A 3QP6A 4B47A 4S05A 3D5SC 4KICA 2O5RA 3HSFA 5GAGJ 3C2GA 4JX5A 3X2QH 2KT0A 1B8IB 5DTDA 2O9LA 3WGGA 4XKBA 2DT6A 4A3EJ 4H4KC 3OIPA 2M3AA 2RN7A 5EF6A 3JSPA 1YG2A 2AQEA 2XKPA 3LOCA 2DQRA 3RTRA 4J01A 4IHYA 5L3DA 2M9HA 1U5TC 5IT9K 1B1BA 2WA0A 2C6YA 4I98B 5B1AH 1S7EA 2KIUA 2FMYA 3MD2A 2O0YA 2FUG2 4HF2A 4BDYA 3V7SA 2EA4A 2OAZA 2FRHA 3UR3C 2VJ4A 2RQPA 3B6CA 3A01B 1BM9A 2K85A 2OBPA 3SHFA 1XCBA 1FBQA 3CZ6A 3I5UA 4DZPA 3KETA 3DTEA 4BE1A 2NYXA 1X1AA 2MABA 4U0VA 3L00A 3NEUA 1JGSA 2CQ7A 4PUSA 2XIGA 5EYRA 3S17J 5CVJA 2LREA 2L7ZA 1TQIA 2WV1A 2X85A 3LSIA 1WJ5A 3S14J 1S3JA 1T2KA 3AL0C 2VBXA 4RAZA 1JTYA 4ZH4F 4GFBA 4XICA 1HDPA 1XX5A 1XGMA 3H0DA 2V1DA
chains in the Genus database with same CATH topology
3G6EI 2ZJQF 2NXNB 3CMEI 1VQ6I 1VQMI 4IOAF 3CCEI 1VQKI 3PIOF 5DM7F 2E35A 3G4SI 4IOCF 3CCMI 3CJSB 3CCJI 3CC4I 3G71I 3CCUI 1VQPI 3J7ZI 1QA6A 2H8WA 1YJWI 1VQ9I 3CCRI 1YI2I 4V19K 1FOYA 5DM6F 2ZJPF 1YJ9I 3CJRB 3CD6I 1HC8A 1VQNI 5GAEJ 3I55I 3CC7I 1VQ8I 2E36A 5GAGJ 3CC2I 2OTJI 1YIJI 2FOWA 2OTLI 3DLLF 2E34A 5GAHJ 2ZJRF 5GADJ 3CMAI 1ACIA 1WIBA 3CJTB 3CJQB 1VQ7I 1YHQI 1S72I 2JQ7A 3CCLI 2QEXI 1FOWA 4UY8I 3CCSI 1VQ5I 1YITI 3J7YJ 4IO9F 3CCVI 5JVGF 1YJNI 1MMSA 3EGVB 2K3FA 1VQOI 2QA4I 3I56I 1VQ4I 1FOXA 3CF5F 1Y39A 3PIPF 3CCQI 1VQLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  2ZJQ F;  2NXN B;  3CME I;  1VQ6 I;  1VQM I;  4IOA F;  3CCE I;  1VQK I;  3PIO F;  5DM7 F;  2E35 A;  3G4S I;  4IOC F;  3CCM I;  3CJS B;  3CCJ I;  3CC4 I;  3G71 I;  3CCU I;  1VQP I;  3J7Z I;  1QA6 A;  2H8W A;  1YJW I;  1VQ9 I;  3CCR I;  1YI2 I;  4V19 K;  1FOY A;  5DM6 F;  2ZJP F;  1YJ9 I;  3CJR B;  3CD6 I;  1HC8 A;  1VQN I;  5GAE J;  3I55 I;  3CC7 I;  1VQ8 I;  2E36 A;  5GAG J;  3CC2 I;  2OTJ I;  1YIJ I;  2FOW A;  2OTL I;  3DLL F;  2E34 A;  5GAH J;  2ZJR F;  5GAD J;  3CMA I;  1ACI A;  1WIB A;  3CJT B;  3CJQ B;  1VQ7 I;  1YHQ I;  1S72 I;  2JQ7 A;  3CCL I;  2QEX I;  1FOW A;  4UY8 I;  3CCS I;  1VQ5 I;  1YIT I;  3J7Y J;  4IO9 F;  3CCV I;  5JVG F;  1YJN I;  1MMS A;  3EGV B;  2K3F A;  1VQO I;  2QA4 I;  3I56 I;  1VQ4 I;  1FOX A;  3CF5 F;  1Y39 A;  3PIP F;  3CCQ I;  1VQL I; 
#chains in the Genus database with same CATH topology
 5M3F J;  1TQM A;  2R5Y B;  5LHH A;  1ZG5 A;  2MGQ A;  1BBY A;  5L3C A;  4EJO A;  3VYR B;  3P7N A;  2EV6 A;  1KYW A;  3NQO A;  4JQF A;  1W4M A;  2CO5 A;  1J59 A;  4BUP A;  1V5E A;  5EG0 A;  2NS8 A;  3EUH A;  4WXH A;  3H5A A;  4D7N A;  1FMV A;  4UVA A;  3SZG A;  4UB6 C;  2LKS A;  1BL0 A;  2R93 J;  2H8W A;  2VKD A;  2QSH X;  2ESN A;  2WB1 N;  2PJP A;  1VQ9 I;  2XPV A;  2DTR A;  1R36 A;  2P5K A;  5FJ8 J;  3DKW A;  1W5S A;  4II2 A;  2M8G X;  1EV7 A;  4MIM A;  1TLH B;  2VBY A;  2M4G A;  3BPX A;  3I3L A;  5HDN A;  2P7C B;  1O7L A;  2KJB A;  4G9Y A;  5J8C A;  1ON2 A;  5M5X J;  1RET A;  4H0E A;  4HST A;  1R71 A;  4A6D A;  1GHC A;  2XDV A;  1BN5 A;  2I5U A;  2E5N A;  3KP4 A;  2EIL H;  2BOL A;  1P7J A;  3I59 A;  1LFU P;  2E36 A;  1W36 D;  4KFC A;  4CXF A;  3GWZ A;  5K7Z A;  2QQA A;  3AG4 H;  2EWN A;  3O2P E;  4XN3 A;  4CH7 A;  1BIA A;  4TV7 A;  2FXA A;  2L0K A;  2G9W A;  4OIR F;  4N4N B;  4HBL A;  5HNF A;  3QU6 A;  3DBL B;  1R23 A;  4NUB A;  1MMN A;  5LGT A;  5J47 A;  5FD6 A;  1I3A A;  4YFN F;  1WIB A;  3ERM A;  4OIO F;  1H9G A;  3S3N A;  1SFO J;  2VPL A;  2YUS A;  5FLX Z;  1V4R A;  3LMM A;  1KU7 A;  4BHP A;  3LSM A;  3MAJ A;  3R0J A;  4Q48 A;  3EUH C;  2EZI A;  2WV0 A;  1B8I A;  2R7O A;  1A36 A;  2HZT A;  1G3W A;  2AXT C;  3ESW B;  1IRX A;  2BHZ A;  1Z21 A;  4L9V A;  1AA7 A;  4DJA A;  2JUC A;  3TL4 X;  3QPS A;  1WJD A;  1ZEL A;  4AU7 A;  1Z6T A;  3TW7 A;  3J7Y J;  2KMU A;  3K10 A;  4IO9 F;  2IS6 A;  5E17 F;  4A2U A;  2ZFU A;  4PJN A;  3F72 A;  3J81 Z;  3VSL A;  5F1J A;  3DKX A;  2YX4 A;  2CG4 A;  5J3L A;  3S2D J;  4CIC A;  3HOS A;  2KDZ A;  2EPF A;  3DEU A;  3A01 A;  4KIF A;  3BQZ A;  4HQE A;  2B0L A;  2HXI A;  4NB5 A;  4EGY A;  4IKF A;  4EAT A;  1YW9 A;  3K7A J;  4C9Y A;  4CCL A;  4DBR A;  2R7V A;  1RUN A;  4X0G A;  1A6I A;  1S29 A;  4BBR J;  4Y52 J;  2R92 J;  4EMS A;  2GA1 A;  3OYA A;  1IXS B;  1AHD P;  2CUE A;  3IL2 A;  2M1B A;  2O3F A;  3G4S I;  3S93 A;  3HSE A;  4HW0 A;  2VJ5 A;  3E7L A;  3MKZ A;  2E1N A;  3M1E A;  1T08 B;  2OC6 A;  3CC4 I;  2ETH A;  3FBI B;  1AKH B;  3ISP A;  3E3V A;  4YFX F;  2X6W A;  4BQA A;  3CCU I;  2LMD A;  4XOT A;  3WTZ A;  2VBZ A;  2R5Y A;  1IN8 A;  2COB A;  4YG2 F;  2DFF A;  3DP7 A;  1ZLJ A;  4B44 A;  5E1W A;  4ENN A;  2M0M A;  1MW7 A;  3K4J A;  4F93 B;  3BG7 A;  3LA3 A;  3HXL A;  4AD9 A;  1IXR C;  1TNT A;  5JHF A;  3PQK A;  3PSF A;  1LEB A;  3HPH A;  2PMZ N;  5CVV A;  2V1X A;  1FP2 A;  3BJA A;  4P9U A;  5BPD A;  4HG2 A;  3F0C A;  4U0W A;  1XSD A;  1TWH J;  1TW2 A;  1DQU A;  2W1O A;  4AID A;  2EFO A;  2FOW A;  3BR2 A;  4DYR A;  5ICG A;  2M7A A;  4WK8 F;  3WTX C;  2DYS H;  2DMN A;  1QGP A;  4A3D J;  1MGT A;  4IL6 C;  1F9N A;  3G1M A;  3WTT C;  5ED4 A;  4M71 A;  3MKY B;  3VOE A;  2LKX A;  2DT5 A;  4CSW A;  4IHS A;  3GUD A;  5IT3 A;  1BC8 C;  4AUX A;  4L0Y B;  1JUM A;  2JA2 A;  4NC8 A;  2STW A;  1I27 A;  5B1B H;  2IS4 A;  2MC4 A;  4Y13 A;  5K5Q A;  3L2R A;  1R1U A;  1SAN A;  3S8P A;  1LKX A;  2V9V A;  1X1D A;  2KIQ A;  4AWX B;  1LJ9 A;  5BNG A;  4RLF A;  1XDS A;  4LGW A;  1R49 A;  3HG9 A;  2Y2Z A;  2DFE A;  4RB0 A;  1YJN I;  1U78 A;  1QZE A;  3HUG B;  1WKM A;  3G3Z A;  4YIR X;  4HDV A;  4ZYA A;  2KIS A;  1Y8R B;  2R7Z J;  2DJI A;  4EJW A;  2A07 F;  2V6C A;  5E8G A;  3ZQH A;  4HF1 A;  2DA7 A;  5TGT A;  4JBA A;  1APL C;  3B6A A;  3FHN A;  4ESJ A;  2LFB A;  1UAA A;  3GTO J;  3D5R C;  1QZY A;  1ENH A;  2DBB A;  3DV8 A;  1X3Z B;  3HL2 A;  4BQN A;  3C18 A;  1UG0 A;  4RGX A;  2X1C A;  4A5M A;  2XAQ A;  2HPI A;  4AVZ A;  3VWB A;  1ZTR A;  1K7A A;  1D0Z A;  2ZO4 A;  3CUQ C;  4LIT A;  4F7Z A;  1QU3 A;  2N8G A;  4A3F J;  3W2A A;  5DCM A;  1T95 A;  3PNV A;  1W7P D;  3FBN B;  1S5L C;  2K9N A;  2NVQ J;  1N25 A;  3FZV A;  2XPW A;  1IUY A;  3I9V 2;  3NWS A;  2K40 A;  1IRF A;  3TOA A;  4RM3 A;  3FXJ A;  2ELH A;  1A31 A;  4MLO A;  5GTI C;  5KVR A;  3OSF A;  2QSG X;  1OCT C;  1GDT A;  5KAI C;  3SEZ A;  1WJA A;  1KU9 A;  1QPM A;  2CFX A;  3ZQ7 A;  2R7Q A;  4CUG A;  1SD6 A;  4BU2 A;  3GFM A;  3KFW X;  1IF1 A;  4A5N A;  3ZCO A;  4HPQ A;  3N97 A;  2NVT J;  2FSW A;  4A0Z A;  1HLV A;  3HOW J;  1X2M A;  5JLW A;  5HS9 A;  1AKH A;  3HKZ N;  4UUV A;  4UUS B;  4A3L J;  3N05 A;  3CES A;  1HBX G;  4M72 A;  3FXQ A;  4IPA A;  1J0R A;  2FQ4 A;  2IP2 A;  1DU0 A;  5FLX K;  1YIO A;  4Y7N J;  2HR3 A;  2K4B A;  2Y9Z A;  2X48 A;  1K78 B;  1IN4 A;  3KZY A;  3LSR A;  3S2H J;  3DWL E;  3GF2 A;  2L5Q A;  4I7H A;  1RUO A;  2L2O A;  2D1H A;  2RQQ A;  4OOI A;  3SZT A;  3BLY A;  1OCR H;  4D1Q A;  1ETW A;  2FF4 A;  2PEX A;  5KCM A;  1P2F A;  4KNY A;  5J1Y A;  2QGU A;  4M74 A;  1IG7 A;  2FOK A;  3ZN0 A;  2R7R A;  3RJP A;  3QQA A;  2MLK A;  4A0X A;  2KJC A;  3WTY C;  2IA1 A;  3VDX A;  1IW7 F;  1PP8 F;  2NRA C;  3HIF A;  9ANT A;  3GFJ A;  3J81 K;  2A6E F;  3GLL A;  4U88 A;  1MDM A;  3CQZ J;  5HOO A;  4W1U A;  2R7T A;  3Q5F A;  3E6C C;  1JKR C;  2F48 A;  4HYE A;  1YIT I;  3K0L A;  4XON A;  4ANJ A;  4D5F A;  5GPA A;  4L0Z B;  3ROU A;  2Z99 A;  2VOO A;  4LG0 B;  1W7P B;  2XC7 A;  2B9S A;  2PLY A;  1SD5 A;  4WXD A;  2EJR A;  2NS0 A;  4PGG A;  1VQ4 I;  2RDP A;  2FX0 A;  5FKM A;  3LAP A;  1LNW A;  1RNL A;  3CLO A;  2VN2 A;  3PIP F;  1UFM A;  4XRM A;  2ZFW A;  3RYP A;  1MND A;  2E1M C;  1W36 C;  2CFO A;  1WSU A;  1X2N A;  3PL8 A;  5HLG A;  2M45 A;  1MBK A;  4GGG A;  3HUG A;  5FKL A;  1XMA A;  4ASN A;  2EZL A;  5AIP A;  2EV5 A;  2VON A;  3J80 Z;  1H88 C;  1QVT A;  3KLN A;  2IGK A;  2OU2 A;  1Q1V A;  1U5T B;  4Q47 A;  2ACJ A;  2M7B A;  3EPZ A;  2ZNY A;  3KP6 A;  2P0W A;  2P4W A;  3AG3 H;  3K4M A;  2VXZ A;  4YEJ A;  2XAJ A;  3I53 A;  3SZP A;  4E4H A;  3G71 I;  1QA6 A;  2L7F P;  3FXM A;  4BDZ A;  2ISY A;  3DKY A;  4IZZ A;  1L0O C;  4IQ4 A;  4JX4 A;  3ZQI A;  1ON1 A;  4HNT A;  3FXL A;  3KP3 A;  2M5W A;  3FXK A;  1LDD A;  2YX7 A;  1P6R A;  4BAY A;  2K9M A;  4GRI A;  1JGG A;  2PQ8 A;  1ETX A;  3LWF A;  4ZTJ A;  1IAW A;  2CQQ A;  3DFG A;  1MBH A;  2M8E A;  4G6D A;  5LRR A;  5LFA A;  1HOM A;  1J9I A;  3L2Q A;  2P6T A;  1STZ A;  2R0Q C;  2GOM A;  4XRS A;  2LF7 A;  4XRF A;  5DD8 A;  2J5P A;  1UST A;  2V9P A;  1XPX A;  1E3H A;  3OIO A;  1WRJ A;  2HQN A;  2V6E A;  3GCM A;  3K4K A;  4CCN A;  3C7J A;  4CZZ A;  1T39 A;  3U1D A;  3AL0 B;  1X58 A;  1XMX A;  2VL8 A;  4ESB A;  2L9S A;  2JWT A;  5CJ9 A;  1GXQ A;  1P4X A;  4BGD A;  5FB2 A;  4FQG A;  2XHK A;  1ZGA A;  1UMQ A;  2DOE A;  3SXY A;  4ZC3 A;  1RKT A;  4LFU A;  1KQ0 A;  4P96 A;  3C1D A;  2ADU A;  3LQQ A;  2HQR A;  5TJJ A;  5GPC A;  2ID6 A;  1B9N A;  4U87 A;  4OWR B;  4UUS A;  3JSO A;  1KZH A;  2HOS A;  3IWZ A;  4OU0 A;  4RAF A;  4IRI A;  3E5Q A;  4CYC B;  2MH9 A;  3H3Z A;  1R9T J;  5IP7 J;  3FIW A;  1ETQ A;  4KJZ A;  2KIM A;  4LMY A;  4CA0 A;  1OR7 C;  1K78 A;  4ZYG A;  3QYB A;  1W5T A;  2JRM A;  3BTC A;  4F3Q A;  2HDC A;  1LFB A;  2FE3 A;  2LDU A;  2FNP A;  4G6Q A;  4M6V A;  2PN6 A;  3MKW B;  3E1S A;  2VE8 A;  1G2H A;  2K3F A;  2JRT A;  5JHU A;  3GXO A;  3H92 A;  1WH5 A;  3V8K A;  5D5U B;  2DJN A;  3AG1 H;  2HOA A;  2F4M B;  3WE2 A;  2CH0 A;  3KZZ A;  4E7L A;  3BG9 A;  1Y0N A;  5IYB J;  3AFH A;  2W4S A;  4I09 A;  3JTH A;  1YFH A;  3GEZ A;  4BXX J;  5ICF A;  1DUX C;  4C3J J;  1D0Y A;  1FLI A;  2YU3 A;  3ZGK A;  4A3I J;  3WG9 A;  1ORK A;  3M8J A;  3OR2 C;  2VOP A;  2GXA A;  4J00 A;  4BJ6 C;  1MMA A;  4LG0 A;  1W7P A;  5LHI A;  1BOA A;  2VKE A;  3ASN H;  5H6R A;  1R7J A;  2E7X A;  4HX4 A;  2MSY A;  2RAE A;  3O3K A;  3OS1 A;  1WI3 A;  2VI6 A;  3HC7 A;  3GTQ J;  1BJA A;  4BQQ A;  2XAS A;  1K83 J;  2CWE A;  2ZJ2 A;  3BCA A;  3H1C A;  2V79 A;  3E6B A;  2DT7 B;  5H2F C;  3PFI A;  4C2M J;  4BHB A;  1I50 J;  4RAY A;  3OYI A;  4ENK A;  3V7R A;  4KT5 C;  2TRT A;  4F91 B;  3S1N J;  1IO2 A;  1X1B A;  2UV1 A;  2VLA A;  3WOD F;  2IXS A;  3RZD J;  1QHH D;  3FX3 A;  5EEA A;  3ERE D;  4PJ0 C;  3QOE A;  5LGU A;  1XD7 A;  3GFL A;  4RGR A;  2TDX A;  2F5E A;  3G73 A;  3M4O J;  1A6Q A;  4G12 A;  4A3M J;  2STT A;  3NWT A;  2HKO A;  3S2W A;  2Y0M A;  4GYG A;  4MTE A;  1PUF B;  2W85 A;  5CVR A;  1B6A A;  3O8H A;  3DEE A;  2WY7 Q;  4MEY F;  2ME6 A;  2XAH A;  1ZHF A;  3EUK L;  4AC0 A;  4AYB A;  3BR5 A;  3BC8 A;  3ZMV A;  1LDK B;  2HOT A;  4JOM A;  4YRV A;  5KAF C;  3D1N I;  2XRO A;  3PJR A;  3M9A A;  4PZJ A;  2FD5 A;  3HRT A;  4AIK A;  2E60 A;  4D9J A;  2L02 A;  2DDA A;  2KFD A;  5FKO A;  3OYL A;  4X6A J;  2H1L A;  3CP8 A;  4RLQ A;  4DBQ A;  2L7M P;  3PO2 J;  5F04 A;  1JHH A;  1N78 A;  2L4A A;  4RB3 C;  1FTT A;  4LOC A;  4U7B A;  3WU1 B;  2O6G E;  4MQ9 F;  5C4J J;  3BJO A;  3TOB A;  4ENJ A;  5E3L A;  4KDP A;  1CQT A;  2EZK A;  4FE4 A;  2ECB A;  3U1K A;  2ID3 A;  1FYM A;  2PI0 A;  4O6J A;  5F08 A;  1O57 A;  2L54 A;  4XM3 A;  1R6R A;  4GDF A;  2EIJ H;  2RKH A;  1I39 A;  2DMP A;  2OQR A;  3I4M J;  4CCK A;  2NVY J;  2WAE A;  1S7A A;  4HZF A;  3VYT B;  4CYC A;  1DGR M;  1A04 A;  4R8H A;  3E5X A;  3LA2 A;  3J80 K;  1MJB A;  3FKJ A;  2XUB A;  5HS7 A;  3JRC A;  4BAC A;  4UVB A;  2XF5 A;  1EKE A;  2NXN B;  3FMS A;  3SDB A;  3CME I;  3N4M A;  3LA7 A;  2EA2 A;  5K1Y A;  4E7I A;  4A93 J;  3OOU A;  1MZB A;  2DYR H;  1WJB A;  2A69 F;  2GAU A;  3LSG A;  4IQJ A;  3VOD A;  5DV5 A;  1SMY F;  2E35 A;  4DYQ A;  3WU2 C;  1J7K A;  4EV0 A;  3L09 A;  3GFI A;  1OCP A;  1F1Z A;  2JVH A;  2ZSH B;  3IH3 A;  4RMN A;  3DBH B;  1LVA A;  2EQR A;  2X6X A;  2HVS A;  1D5V A;  4L5E A;  4A3B J;  5DUK A;  1ZN2 A;  4G8X A;  2Q0O A;  3CDH A;  3PUF A;  3BQY A;  3VSK A;  2Y9Y A;  3A03 A;  1RI7 A;  2ZB9 A;  2VQL A;  3F22 A;  4IHV A;  3VFZ A;  5DCF A;  2MFZ A;  4S04 A;  1MBJ A;  1OQY A;  2WBM A;  4V2G A;  4EEF G;  3IRQ A;  1PYV A;  3TO7 A;  2Q8K A;  2B7E A;  2DI3 A;  1C0W A;  1JUP A;  1JT6 A;  4EJV A;  3HTU A;  2EFN A;  2MG4 A;  3S1Q J;  2X6O A;  3I55 I;  4WCG A;  2M4K A;  2IEK A;  3CTA A;  3W3C A;  2K02 A;  3BZK A;  3GLX A;  3A4C A;  1FYK A;  4FE7 A;  2DMU A;  1PUE E;  2LBF A;  3V8J A;  3JCU C;  4MGR A;  1HKS A;  1A5J A;  2ZJR F;  3OS2 A;  4XNF A;  2DA1 A;  3CUQ B;  3HSR A;  4Z6Y A;  4OIQ F;  1MJA A;  1ULY A;  3J7A Y;  1O7F A;  3WGH A;  5L3E A;  2LKP A;  2VAS A;  3MMY B;  3I71 A;  4HRI A;  1ZRE A;  4KIT B;  2D45 A;  5FRO A;  2K7L A;  1VND A;  5FKK A;  3IUO A;  2A68 F;  3TO9 A;  3CCL I;  5A2Q Z;  4HNU A;  2JA8 J;  2BXZ A;  2X6Y A;  1PP7 U;  5B3S H;  2BE5 F;  1PUF A;  1FZP B;  3CMM A;  5ERI A;  3JRB A;  1EF4 A;  3JR9 A;  1VFC A;  3DU5 A;  2DQL A;  4HAM A;  4DW6 A;  1I6X A;  4OMY A;  1W1W E;  3MWM A;  3JRA A;  2QM3 A;  1E3O C;  3G1L A;  1S7O A;  3IKT A;  2BVL A;  1LVK A;  1UB9 A;  2NNY A;  2VE9 A;  5CLS A;  2DU9 A;  2IS1 A;  1MBG A;  4IVN A;  3CCY A;  4QWQ A;  1TW3 A;  2OD5 A;  3K4B A;  4M3G A;  1SVL A;  2E19 A;  2EZH A;  2MLG A;  4PSX A;  3GBG A;  3TBI A;  5H20 A;  1UHM A;  2QLZ A;  3TP3 A;  4FHT A;  2Y0S A;  1SD4 A;  3L2V A;  5JLX A;  3GX4 X;  4PFO A;  3VPR A;  3LFU A;  4M6X A;  3ABM H;  4ESF A;  3KEQ A;  2P5V A;  5EEG A;  1DDN A;  4RB1 A;  5HVQ C;  2JUG A;  2XRL A;  4LLG F;  5DM7 F;  2XF7 A;  2HGC A;  5DCM B;  4B3X A;  1FC3 A;  1U8R A;  1JKO C;  4MO7 A;  5CQE A;  2FBH A;  3DPL C;  2OZ6 A;  3CJN A;  5E1Z B;  2GZW A;  1FWZ A;  1VTN C;  1GV2 A;  3DQV C;  3BY6 A;  3BPV A;  3E6D A;  3FK7 A;  5BPI A;  5F0C A;  2ELK A;  3VB2 A;  4BNC A;  3OY9 A;  4E7S A;  1V5G A;  4E7H A;  2L01 A;  2HNH A;  3L7W A;  1T33 A;  2HOE A;  5DYM A;  4PK4 A;  5F1R A;  4HLY A;  2HU9 A;  3E0J B;  2QEN A;  5JVT A;  2O8K A;  2LF8 A;  3RYR A;  3WTS C;  3KCC A;  2M0C A;  1NK3 P;  4S0H B;  4I76 A;  2DPU A;  5FRN A;  4PCQ A;  3I4P A;  5GAE J;  4CO8 A;  4BKX A;  1TP4 A;  1WJC A;  3T1B A;  1MBF A;  4KN7 X;  3KE2 A;  5E79 C;  3Q0W A;  1S6L A;  3SFI A;  2OF7 A;  2ZCW A;  2K3P A;  3SDG A;  3M3Y J;  2VT2 A;  1LQ1 A;  3BR3 A;  1GVJ A;  1X1C A;  2CUF A;  4UV8 A;  3DLL F;  2CYY A;  2HWV A;  3GVA A;  5GAH J;  2E1M B;  3D5L A;  4XSZ F;  3MQ0 A;  1MKM A;  1UEL B;  3CMA I;  3KP2 A;  3FIS A;  2K9Q A;  2CW7 A;  2H8R A;  2HKX A;  4DGW B;  2R7X A;  2BZT A;  2CV2 A;  1SFK A;  1Y56 A;  2HQ5 A;  4L9N A;  2DK5 A;  3PO3 J;  3K4N A;  2R7D A;  1OIS A;  4KYW A;  3LFK A;  5HS8 A;  3RDI A;  4UNO A;  3WE3 A;  1ZGW A;  2RVC A;  5JI6 A;  1G3Y A;  1PDN C;  1ZLK A;  5EEH A;  3JRE A;  3CUQ A;  1NHA A;  1TT5 B;  5C3E J;  3OV8 A;  4KUM A;  3ZMZ A;  1TWA J;  5FFZ A;  3S16 J;  1MDM B;  3HBL A;  3WU0 A;  1OCZ H;  3ZMD A;  1AU7 A;  1P4A A;  2V9K A;  2QA4 I;  3OMY A;  3I56 I;  3H3U A;  2QBY B;  1U8B A;  1Z7U A;  3MCZ A;  2L9V A;  3NRV A;  2NVU B;  5LBQ A;  1LB2 A;  5D4S A;  1MBE A;  5EJC A;  3QOP A;  4HLX A;  2JZY A;  3TDU C;  1H8A C;  4F92 B;  3W6J B;  3GTJ J;  1FX7 A;  2K5C A;  2Y0S N;  1QO0 D;  2CQN A;  2EBI A;  3QYF A;  4NBQ A;  2MC3 A;  4BXF A;  2L4M A;  4DQ2 A;  4W97 A;  3QPT A;  3BP8 A;  1VF9 A;  3TDZ C;  2VC0 A;  3I4N J;  2X1E A;  3DPT A;  4II3 A;  1Z6R A;  3CDI A;  4DNC A;  1ZAR A;  4QLC U;  2MA3 A;  1U2W A;  3R60 A;  2JVG A;  1SEU A;  2ZNZ A;  4G7H F;  2X9D A;  1EH7 A;  4M6Y A;  1G4D A;  1Z3X A;  1M1E B;  3DTK A;  2JN6 A;  4V19 K;  3RZO J;  1BI2 A;  2ESH A;  3DLA A;  2ZXJ A;  2HTS A;  4KN4 X;  1HXD A;  4BE0 A;  5FRM A;  2HYG D;  3LSP A;  4HF0 A;  5JFR A;  3LAJ A;  4I99 C;  2RC4 A;  1BW5 A;  2WAD A;  5F6F A;  2O03 A;  3DCF A;  1R1T A;  4R79 A;  2ECC A;  2LY9 A;  1H89 C;  4CYD A;  1T8I A;  3GO5 A;  3CUO A;  4XKC A;  4RM2 A;  4WXC A;  2GXG A;  1SMT A;  2GIV A;  4YFK F;  2ZC2 A;  1YIJ I;  2GA2 A;  1WQ2 A;  4HA8 A;  3WTV C;  3FM5 A;  3JRG A;  2LK2 A;  3HEF A;  4UXN A;  1JUS A;  5A2Q K;  2A61 A;  2W24 A;  4LD5 A;  2ME0 A;  3RPU D;  5ICE A;  5D5V B;  1MSF C;  4RB2 C;  1ACI A;  3JRH A;  2P8T A;  1HA8 A;  2EH3 A;  2EK5 A;  5FO5 A;  2K86 A;  2RNG A;  4X1E A;  4O5V A;  5CYV A;  1FSE A;  3KLO A;  1T38 A;  1REP C;  4MQV A;  3HRM A;  1B72 B;  1GXP A;  2YPR A;  1BR4 A;  1YHQ I;  4PGH A;  1HW2 A;  4IRG A;  2PG4 A;  3R0A A;  3O6B B;  4E7K A;  2CRG A;  4EM0 B;  3PQJ A;  3OYM A;  2VOD A;  1E17 A;  1AOY A;  4UY8 I;  4DOZ A;  3Q9S A;  1P7I A;  3PUB A;  4KMF A;  1QRY A;  4E7Z A;  1R22 A;  4B4C A;  1MMG A;  1BC7 C;  3OIQ A;  2LH9 A;  2M87 A;  2LRD A;  1F4K A;  2BHY A;  4XMY A;  2WAQ A;  2AO9 A;  4PSW A;  2MYS A;  2ZSI B;  2QKM B;  3MVP A;  2JSP A;  3LSK A;  3S3O A;  1B59 A;  2XB0 X;  3BJ6 A;  1LUJ B;  3QU3 A;  2Z1D A;  2BEO A;  2DA6 A;  4XKV A;  1ZKG A;  1QBJ A;  2VQH A;  4N9I A;  1MNM C;  4HOB A;  3K9T A;  1Y8Q B;  4A3G J;  2DFH A;  4RDU A;  3PIO F;  2XB5 A;  1E0E A;  1X19 A;  2VUM J;  3BTI A;  4XOR A;  2XGX A;  3HGG A;  2QBY A;  3FXO A;  1B9M A;  2A6H F;  3FHZ A;  1Y1V J;  1DP7 P;  4ZDP A;  3CCM I;  2DCE A;  2A6T A;  3ZQF A;  2DMQ A;  1SC7 A;  3G1O A;  1V55 H;  2ZME C;  5BQT A;  3J7A O;  1OPC A;  2CQK A;  2O61 A;  1ONV A;  1RPW A;  3FKI J;  4B1R A;  4G94 A;  3EET A;  3HHH A;  1TL8 A;  2JA7 J;  2ELJ A;  5IP9 J;  1LE8 A;  3FXR A;  1ERD A;  1U9O A;  1TWG J;  2JA6 J;  1MH4 A;  5E3M A;  3MN2 A;  4AIJ A;  2E2H J;  3C2B A;  1DP3 A;  2GWR A;  2VPR A;  2KZG A;  2XSJ C;  4P5O A;  1ETK A;  3L1P A;  4EM2 A;  1UZC A;  2F5F A;  2NVX J;  1OR7 A;  3OYC A;  2JPC A;  3HRU A;  3HJE A;  1TC3 C;  2AXL A;  3CJT B;  3WHC A;  4HX7 A;  1Z1D A;  2QKL B;  2CV0 A;  4K2E A;  2BW3 A;  1XTA A;  2BGC A;  3ZMT A;  2H1K A;  1BA5 A;  2D2W A;  5BOX A;  4YII A;  4C3I J;  1I6H J;  2CW8 A;  2KL4 A;  2JQ7 A;  4XKW A;  3FK6 A;  4KA4 A;  2DOA A;  1IRG A;  1YLF A;  4XLE A;  2HEO A;  1E2X A;  2BY2 A;  1X1P A;  1R5I D;  2K9L A;  3S32 A;  5C44 J;  3ZQG A;  4M3E A;  2LG4 A;  4FET A;  2KPM A;  2VBW A;  1KQ9 A;  1WJE A;  3ZR8 X;  3MFK A;  2O8X A;  2NOG A;  2R4G A;  2DA4 A;  3SYT A;  1B72 A;  1VQO I;  1KON A;  1HKT A;  5J8F A;  1FEX A;  3NAU A;  3DTI A;  3IRR A;  4M3D A;  2LC2 A;  3BZ6 A;  1WCM J;  1YRN A;  1L3L A;  3F23 A;  4QSH A;  2RV8 A;  2OJE D;  3DPU A;  2OV7 A;  1R5G A;  1SFE A;  1Y39 A;  2KLO A;  3NAR A;  4CZC A;  1H0M A;  2IRF G;  3GTK J;  3TW6 A;  3F8F A;  1ZAO A;  1D3Y A;  1VQM I;  5D5W B;  2KP6 A;  5AON A;  1IRZ A;  1QNT A;  5CKT A;  4CDG A;  1J2X A;  4AVP A;  2QZ8 A;  3OL4 A;  2B63 J;  2DO7 A;  2W84 A;  3TED A;  5CPR B;  1FBU A;  3QAH A;  3SQN A;  5H6Q A;  2Y69 H;  4WF2 A;  5B5E C;  2E1O A;  2CU7 A;  5JR3 A;  2VQC A;  3VEP A;  3ABT A;  1P9Q C;  4L5J A;  2MW8 A;  4BJT A;  2X0L A;  1ZR2 A;  2UUZ A;  3I54 A;  1V5F A;  1J5Y A;  1XMK A;  5J6X A;  3T8T A;  4BH9 A;  4XID A;  1JKQ C;  4N4O B;  3BG5 A;  3IP4 B;  1KYZ A;  1X4O A;  4ON0 A;  2IJL A;  1XG1 A;  1WH7 A;  4L5I A;  4ZDL A;  2JPB A;  3RKQ A;  1YX3 A;  3Q0V A;  3ZOB A;  5K5R A;  2WY8 Q;  2OCE A;  3HOT A;  3CJR B;  3KIO A;  3GW2 A;  3IV5 A;  1VQN I;  3BG3 A;  3GZN B;  2EFW A;  4LK1 F;  2OCC H;  4BY7 J;  4B09 A;  2DMT A;  1TNS A;  1LPQ A;  1F5T A;  2CGP A;  4I6Z A;  1IV6 A;  2M34 A;  3QRF F;  3H36 A;  2ZBK A;  2E2J J;  3T8R A;  2OZU A;  1WVR A;  1T56 A;  1Z9C A;  3FMR A;  1R4M B;  2ICW G;  2G0E A;  4Y3O A;  2W82 A;  2LBF B;  4P1W A;  4ZDO A;  2PX9 A;  3RPU A;  5K7H A;  4BHC A;  3LST A;  2GXB A;  2R3S A;  1FJL A;  3W6V A;  2BVM A;  1IUF A;  3JAM Z;  3I64 A;  4IEJ A;  1SFX A;  3H5N A;  4Y33 A;  4G7Z F;  1NK2 P;  2A3S A;  4NHJ A;  4NC6 A;  1BR2 A;  3H9Q A;  3K2Z A;  1U9N A;  3HM5 A;  2F5C A;  3K1M A;  2DOD A;  1AWC A;  3KZI C;  5ILV A;  3BG6 A;  4MFE A;  2BY0 A;  5FD5 A;  1NG6 A;  3HZJ A;  4XLC A;  3VYU B;  3VYS B;  3RKW A;  2HDD A;  2G7H A;  3RIR A;  5FLV A;  1RC9 A;  2V4J C;  3ULQ B;  5BS6 A;  5K7F A;  4ZYH A;  3BTL A;  4ENM A;  4XSX F;  3GTL J;  4D7M A;  2MD0 A;  1KU2 A;  3OOP A;  2WB1 A;  2CJJ A;  1O3T A;  2XPU A;  2KZV A;  4LB6 B;  1ZRF A;  2QVO A;  2VXD A;  1K79 A;  4C3H J;  3CO7 C;  1J75 A;  2LP0 A;  3EDP A;  3FM3 A;  1TQP A;  2VT3 A;  1EJ9 A;  4HV6 A;  4L9J A;  2F5D A;  4O3M A;  3HGY A;  3M1C A;  2F6C A;  4D5C A;  3G2B A;  3CCQ I;  1Y6I A;  3F9K A;  1MIJ A;  2QSF X;  1LFP A;  5FGM A;  4IHW A;  2ZXI A;  2LNB A;  3W2V A;  3P9I A;  1O3R A;  5E20 A;  2E2I J;  3BR0 A;  3ZQC A;  1XSX A;  1N77 A;  3TGN A;  1H9T A;  3S15 J;  4A69 C;  2KHM A;  3TMO A;  4U0Y A;  2IS2 A;  3IAM 2;  3WHB A;  3QOD A;  5DDG A;  2BBY A;  1WI9 A;  1DGW Y;  2QQ9 A;  1Z91 A;  4LK0 F;  2E7W A;  1IXC A;  3R6S A;  2CUZ A;  6PAX A;  1JI8 A;  2UXN A;  1Z7L A;  2E5Z A;  1HW1 A;  4AIH A;  3ABK H;  4BEH B;  2ISZ A;  2FA5 A;  4QPO A;  4LLN A;  3GTM J;  2M2E A;  5FFX A;  4GXO A;  2Z3Y A;  2XKO A;  3CD6 I;  2K9S A;  1MSE C;  3C3W A;  1DU6 A;  3BOQ A;  1JJ6 C;  2HZD A;  3DEW A;  1YQA A;  3RI4 A;  1G3S A;  4XRS G;  3H9J A;  4OAY A;  5LEJ A;  1NTC A;  2KRF A;  3ZP5 A;  5KHD A;  2LVS A;  1BI1 A;  3UNG C;  1D8J A;  4NQW A;  2OTL I;  3OR1 C;  2AHQ A;  4C2U A;  4N0B A;  2HPM A;  1ETO A;  1XCV A;  2IGN A;  4MNU A;  1IJW C;  3LSH A;  3K70 D;  5E8I A;  2GQQ A;  2LSO A;  3KX2 A;  1K61 A;  1JTX A;  1XGS A;  1P4W A;  4E7J A;  3H3V K;  2IGM A;  2KRH A;  3ECO A;  4Q4Z F;  2CS3 A;  2XGE A;  5HDG A;  1FMW A;  1FIP A;  4LJZ F;  4A12 A;  4Q5S F;  4IX7 A;  2H6C A;  4UB8 C;  1EH8 A;  2VQG A;  3REO A;  3KYL A;  1IGN A;  2DPD A;  3R4K A;  1WZ2 A;  5F0F A;  5LEK A;  1J09 A;  3OS0 A;  2CSO A;  3QPH A;  1XSV A;  5E3N A;  2CV1 A;  3EUA A;  1WGX A;  2JMW A;  2XGC A;  2QEX I;  4OIN F;  1X4P A;  3QPL A;  2AS5 F;  2EIK H;  3F3X A;  5HLI A;  1OJL A;  3Q0U A;  1UCR A;  3A02 A;  3LL7 A;  2GLO A;  3ECH A;  3PNT A;  1W0U A;  2HVQ A;  5HLH A;  2W7N A;  4ETS A;  5DD4 A;  5LLQ A;  3HTS B;  1CF7 A;  4QPQ A;  4QTR A;  1ETV A;  3RSN A;  1USS A;  1Q1H A;  4I01 A;  4I02 A;  5IYC J;  3MZH A;  5IOZ A;  3FF5 A;  1K4T A;  2CW0 F;  3ABU A;  4AYB N;  2PMU A;  1NG7 A;  1TZL A;  3IWF A;  3OYH A;  1HF0 A;  1D8K A;  5L3F A;  4EM1 A;  2R7U A;  1W5C C;  1YX5 A;  1OLT A;  1IV8 A;  3CMY A;  1Z05 A;  1WJF A;  1HDD C;  3BCB A;  2KKO A;  5K5O A;  4L9T A;  3Q9V A;  4EQQ A;  4IOA F;  2JT1 A;  1FBS A;  2EFP A;  3CO6 C;  1HW5 A;  2PMZ A;  1D1C A;  2HQA A;  2P7V B;  4ZYE A;  1HSJ A;  2VKV A;  5E18 F;  1KGS A;  3R61 A;  4QIW N;  4DIQ A;  1R1V A;  1TWC J;  4UUT A;  3DBR B;  1V3F A;  3ONQ A;  4CGZ A;  1R4N B;  3JRI A;  3B02 A;  3CCJ I;  2HFH A;  2ZKZ A;  2XVC A;  1D1B A;  3J7Z I;  4Y17 A;  5L3G A;  5D8L B;  4M73 A;  3CCR I;  5M5W J;  1ITY A;  1R5H A;  1YI2 I;  1KQ8 A;  3U9G A;  1HKQ A;  1SAX A;  1FIA A;  1BI3 A;  1XN7 A;  2IW5 A;  3WG7 H;  1T6S A;  2HXO A;  3CDL A;  3WTU C;  1Z3Y A;  5EGO A;  3MZ8 A;  1JE8 A;  2LR8 A;  5D5X B;  2JTV A;  2O7O A;  1G6N A;  2DAO A;  1IN6 A;  5J4Y A;  3IH4 A;  3OYJ A;  2HVR A;  3L9F A;  3DF8 A;  4B3A A;  2DXI A;  2CMP A;  5LHG A;  1YTY A;  1RIO H;  3F6V A;  4RAG A;  4BQO A;  3BDD A;  2OTJ I;  1T98 A;  3JAM K;  1X3W B;  1KA8 A;  1Y0U A;  2IA0 A;  5LGN A;  2OQG A;  4BEH A;  5DUI A;  2QYO A;  1Y1W J;  3CF2 A;  2PFB A;  4BXU A;  5GAD J;  5E1X A;  3TO6 A;  4M9X A;  1ETY A;  1PJR A;  4N9H A;  3L2U A;  1RR7 A;  3U21 A;  4ZZD A;  1VQ7 I;  3PNY A;  1W0T A;  5CVI A;  2QQ8 A;  2LYC A;  3EQL F;  1BOB A;  3P9C A;  2CQX A;  3FXU A;  2Y31 A;  3LSJ A;  2YSR A;  3FDY A;  1ZRC A;  2FU4 A;  2F4O B;  2IAI A;  4C30 A;  5EDN A;  2IPQ X;  5F27 A;  2FBI A;  2R5Z B;  2XAF A;  4XLN F;  2FQ3 A;  2ZME B;  3S1M J;  3OYB A;  2QCO A;  2EIM H;  3ZRG A;  3CCS I;  4XN0 A;  1GLN A;  4XR6 A;  2XAG A;  4JYK A;  4OAZ A;  3H9G A;  2QWW A;  3HYI A;  1HST A;  5HOD A;  3FMQ A;  5DEQ A;  1FOK A;  4MHG A;  1OCC H;  2W48 A;  5F64 A;  3HOU J;  2OA4 A;  3DU6 A;  2R7S A;  1ODD A;  5ILU A;  4ZYD A;  3JRD A;  1Z67 A;  4R1H A;  3OYF A;  5FLM J;  2YU9 J;  3BR1 A;  4HQM A;  3K4L A;  5M5Y J;  3G6E I;  2NAZ A;  1K4S A;  2GM4 A;  4F55 A;  4IJA A;  4KIB A;  3M8F A;  3PSI A;  3HKZ A;  2WAF A;  3K4C A;  1LEA A;  4FIS A;  1FYL A;  1SVO A;  1ZH5 A;  2LLK A;  5KNL A;  3HOY J;  3I0T A;  4U7D A;  2L9R A;  2EV0 A;  4A3K J;  4NNJ A;  4ITV A;  5IP6 A;  2D5V A;  4A0Y A;  3BT9 A;  2DA3 A;  5DS9 A;  1F43 A;  1NH3 A;  2LOO A;  4FTH A;  2P6S A;  1FTZ A;  2XAU A;  4PFP A;  2Y30 A;  1UJ8 A;  3UKG A;  4ZJZ A;  1V54 H;  4Y15 A;  3F8M A;  2I8D A;  4XLF A;  3ZMU A;  1SAU A;  3RKY A;  4HX8 A;  1FY7 A;  1OKR A;  5J1U A;  4ZTF A;  2Q2E B;  2QF7 A;  2KIF A;  3QP5 A;  1RES A;  1LE8 B;  2W00 A;  2BYV E;  3OYD A;  4B48 A;  2WC2 A;  3ZN1 A;  5L3B A;  2HS5 A;  1TWF J;  1FT9 A;  5D8K B;  5IY5 H;  3ASO H;  3ZMS A;  3V7C A;  3CC7 I;  4CCJ A;  4BY1 J;  4NDL A;  4LLL A;  3MKL A;  4KIG A;  2V1U A;  4MTD A;  5HNH A;  1D1A A;  1F36 A;  4RBO A;  2DK8 A;  4V2F A;  2LD5 A;  4RGU A;  2HYF A;  4UHT A;  2OUM A;  1MH3 A;  4YIF A;  3L2W A;  1T0F A;  2P81 A;  2Z2S B;  1ZR4 A;  2K4J A;  2D1V A;  4P9F A;  2Z9O A;  1Z77 A;  3LNQ A;  2DDB A;  2LTP A;  4CCO A;  2IT0 A;  4HDU A;  3IH2 A;  4BS9 A;  3CJQ B;  3HPG A;  3LQR A;  3COA C;  1MNE A;  4E6K G;  1YO5 C;  3OYK A;  1OCO H;  1S9H A;  3SJM A;  2RNJ A;  3BR6 A;  2G7U A;  3P5J A;  3GZ5 A;  4B43 A;  2VIX A;  2BW3 B;  3S1R J;  2IVM A;  2QUF A;  2UZK A;  2EB7 A;  5FKN A;  1G8X A;  2K27 A;  2L3D A;  3V4G A;  1XC5 A;  1YOV B;  2R7W A;  1WPK A;  1HQC A;  1EA3 A;  1JXS A;  2XSD C;  1Z0X A;  2M30 A;  2YR2 A;  4AM3 A;  2H27 A;  2FNA A;  2R7F A;  4IRH A;  5KK1 A;  1FPQ A;  3K1P A;  3OWT A;  3KEY A;  2PJR B;  5ICC A;  1MD0 A;  3TP0 A;  4BYY A;  3CF5 F;  2GIZ A;  2R5Z A;  1FNN A;  1YRN B;  1JKP C;  2ZME A;  4A3J J;  2DA5 A;  2IBD A;  1VQL I;  1O4X A;  1YS7 A;  1YYV A;  1YE9 A;  3S3M A;  4XBF A;  1T0F C;  3FWE A;  1VQ6 I;  2V26 A;  1UHS A;  4PJM A;  3AKZ A;  1XDU A;  1VQK I;  2BXY A;  4G6T B;  3K70 C;  1ZRD A;  4KT6 A;  4KMU X;  4IOC F;  2DN0 A;  4HEA 2;  1B4A A;  2IA2 A;  4PJJ A;  3CJS B;  1IDZ A;  1KU3 A;  2ZXW H;  4CCM A;  2XGD A;  1IN7 A;  1RZ4 A;  1OYW A;  4IXA A;  1QPI A;  1HCR A;  2E71 A;  2ZJP F;  3HOX J;  5HDK A;  1E3P A;  1GVD A;  1WHU A;  5D6E A;  4OIP F;  4FAS D;  1QVU A;  1X3U A;  1SD7 A;  2Y48 A;  1G59 A;  1YW7 A;  1PVE A;  3MEX A;  2UWM A;  4C2T A;  3A2K A;  4FX0 A;  3ZPL A;  4XLA A;  4JK1 X;  3ZXS A;  1O3S A;  1ZQ3 P;  4L18 B;  3ELK A;  3RCO A;  1TTY A;  3OYE A;  2J5O A;  1OYI A;  3W6K B;  1VQ8 I;  2KQR A;  3CC2 I;  2L7K A;  1XGO A;  3O8G A;  4XLH A;  3A0H C;  3BTJ A;  3AAF A;  2W57 A;  3P9K A;  2E34 A;  3F8N A;  5BMZ A;  4HNV A;  2AQF A;  1R58 A;  2Q2E A;  5LRS A;  3RPQ A;  3JTG A;  3JRF A;  4KIS A;  3EYY A;  5E3O A;  3V8L A;  4Z2Y A;  1GT0 C;  2VJI A;  3KPH A;  1O3Q A;  2GOX B;  1QQI A;  1I1G A;  5EZH A;  4YEL A;  4ABZ A;  2TCT A;  3ABL H;  4HSR A;  1IC8 A;  2A05 A;  1U0J A;  2LY1 A;  4OMZ A;  1S72 I;  1UG2 A;  4HV5 A;  1D5Y A;  4Y4R A;  4MFD A;  2DLL A;  3BRO A;  2YS9 A;  1FOW A;  2JJ7 A;  2Z5U A;  4XLP F;  4CHU A;  4IHT A;  5IT9 Z;  3F6O A;  2DA2 A;  5TIS C;  4D0P A;  4DZJ A;  4JP0 A;  1OYY A;  4XL9 A;  3PFY A;  4J19 A;  2IGO A;  4BBS J;  3B73 A;  2LY2 A;  2Y75 A;  2BY3 A;  1CGP A;  1MMS A;  1QZZ A;  1JHF A;  4I2O A;  3GZ6 A;  2DTZ A;  4UVC A;  3E6M A;  1FOX A;  5D6F A;  3I58 A;  1OMI A;  4WWC A;  4IHX A;  5IYD J;  2NOJ B;  4BJ5 C;  2VB6 A;  1RR8 C;  5M3M J;  3BWG A;  1BJZ A;  2Z16 A;  5TRD A;  2W25 A;  3PM1 A;  2ZJQ F;  1N75 A;  5CVU A;  5GTH C;  3OYN A;  1POG A;  2DFI A;  1IN5 A;  2DW4 A;  1EH6 A;  2UXX A;  3CCE I;  4M9S A;  2XF6 A;  3OL3 A;  5C4X J;  1WWX A;  4UV9 A;  1I5Z A;  2WTE A;  5D4R A;  5J4V A;  2PJR A;  3K2A A;  2VKH A;  1FSH A;  1S8N A;  2HTJ A;  2Z33 A;  1BR1 A;  1P92 A;  2PBI A;  2BY1 A;  2RGV A;  5EZG A;  1VI0 A;  1SVM A;  2FBK A;  1U6G A;  2WAQ N;  1VQP I;  3SEQ A;  1FP1 D;  2ZXH A;  2PMH A;  3ZQL A;  3A0B C;  3RKX A;  3IHU A;  5CQG A;  3HRS A;  1FOY A;  4A6E A;  3KYD B;  5DM6 F;  4DYC A;  1ZK8 A;  3QYE A;  2A5W A;  2XRN A;  3Q3S A;  3E97 A;  3SFZ A;  2EIN H;  2FJ1 A;  1TBX A;  3IKV A;  4P55 A;  2P5L C;  1ZG1 A;  2CUJ A;  4FCY A;  4I0B A;  4RGS A;  1XS9 A;  3MZY A;  4B8X A;  4A3C J;  4XQF A;  3F21 A;  1IDY A;  4GO1 A;  5HLT A;  1JT0 A;  4RS8 A;  3HOZ J;  3KP5 A;  2I10 A;  3H5R A;  1R00 A;  3HDD A;  1DPR A;  2H94 A;  2JK3 A;  4MEX F;  5IOY A;  3AG2 H;  1ZGJ A;  1XB4 A;  4M3B A;  4NQW B;  2DOF A;  3QWL A;  4LIV A;  4EJT A;  3ML6 A;  3K6G A;  1ZG3 A;  4GCV A;  2E1C A;  4FX4 A;  4LB5 A;  3M7G A;  4JX6 A;  4IF4 A;  1LDJ A;  3DXJ F;  2HI3 A;  3WTW C;  1YW8 A;  1IZ1 A;  3F8B A;  3E5U A;  2Q1Z B;  2XV4 S;  3HB9 A;  1RRJ A;  4XK4 A;  4WX9 A;  2H6B A;  4GYI A;  3M8E A;  3D0S A;  4F52 A;  5IPA A;  4PDK A;  5LD2 C;  2COM A;  3A1Y A;  3C2H A;  1XGN A;  3T5X A;  4E70 A;  3TQN A;  1VQ5 I;  3ZQQ A;  5AIQ A;  1G3T A;  3V42 A;  1I3Q J;  3CCV I;  5JVG F;  4M3F A;  3T0Y A;  1MJ9 A;  3EGV B;  3K69 A;  4RA2 A;  2BV6 A;  1QHG A;  2H09 A;  3F8C A;  1MMD A;  3M07 A;  2X4H A;  2RRE A;  1CF7 B;  1UHW A;  5J1R A;  3W2W A;  2JA5 J;  2V1N A;  4BE2 A;  2NS7 A;  2KDO A;  2X1D A;  1TT0 A;  3RQ4 A;  5EG0 B;  2V7F A;  3HHG A;  4XOP A;  2EFQ A;  2VJJ A;  1GUU A;  3K1N A;  2HDW A;  4LG3 A;  2MD5 A;  2MH2 A;  3KYC B;  1OFC X;  2F4I A;  3RQI A;  3OSG A;  4NC7 A;  5B66 C;  1A35 A;  3U2R A;  2VC1 A;  2GBY A;  3JW4 A;  1WFX A;  1D0X A;  1U5T A;  3CP2 A;  5F0H A;  2A5Y B;  1SFU A;  3GME A;  1VZ0 A;  2KRC A;  1JJ8 C;  4PJL A;  2L9N A;  2MBF A;  1I1S A;  2F2E A;  2X51 A;  3H35 A;  1DPU A;  2WWY A;  1K6Y A;  4G7O F;  3GYH X;  3HOV J;  5J40 A;  1BW6 A;  3I59 B;  4BL0 B;  1K6O A;  1YJW I;  3KEO A;  1BIB A;  3L2C A;  3IC7 A;  3OYG A;  3IAS 2;  4I0A A;  3GTP J;  3CLQ A;  1BI0 A;  2QQB A;  1GV5 A;  2JSC A;  5ILS A;  4ZZL A;  3BZC A;  5GP9 A;  1YJ9 I;  2FEZ A;  3H0G J;  4M9Z A;  1YS6 A;  4FT8 A;  2OPT A;  4EJU A;  3WGI A;  3EYI A;  5EGO B;  2HYJ A;  2NNN A;  4EGZ A;  2F5V A;  4EVI A;  1HC8 A;  1ZYR F;  4LIU A;  3TKY A;  2FML A;  3GTG J;  1RKW A;  1U3E M;  3KP7 A;  3QP6 A;  4B47 A;  4S05 A;  3D5S C;  4KIC A;  2O5R A;  3HSF A;  5GAG J;  3C2G A;  4JX5 A;  3X2Q H;  2KT0 A;  1B8I B;  5DTD A;  2O9L A;  3WGG A;  4XKB A;  2DT6 A;  4A3E J;  4H4K C;  3OIP A;  2M3A A;  2RN7 A;  5EF6 A;  3JSP A;  1YG2 A;  2AQE A;  2XKP A;  3LOC A;  2DQR A;  3RTR A;  4J01 A;  4IHY A;  5L3D A;  2M9H A;  1U5T C;  5IT9 K;  1B1B A;  2WA0 A;  2C6Y A;  4I98 B;  5B1A H;  1S7E A;  2KIU A;  2FMY A;  3MD2 A;  2O0Y A;  2FUG 2;  4HF2 A;  4BDY A;  3V7S A;  2EA4 A;  2OAZ A;  2FRH A;  3UR3 C;  2VJ4 A;  2RQP A;  3B6C A;  3A01 B;  1BM9 A;  2K85 A;  2OBP A;  3SHF A;  1XCB A;  1FBQ A;  3CZ6 A;  3I5U A;  4DZP A;  3KET A;  3DTE A;  4BE1 A;  2NYX A;  1X1A A;  2MAB A;  4U0V A;  3L00 A;  3NEU A;  1JGS A;  2CQ7 A;  4PUS A;  2XIG A;  5EYR A;  3S17 J;  5CVJ A;  2LRE A;  2L7Z A;  1TQI A;  2WV1 A;  2X85 A;  3LSI A;  1WJ5 A;  3S14 J;  1S3J A;  1T2K A;  3AL0 C;  2VBX A;  4RAZ A;  1JTY A;  4ZH4 F;  4GFB A;  4XIC A;  1HDP A;  1XX5 A;  1XGM A;  3H0D A;  2V1D A; 
#chains in the Genus database with same CATH homology
 3G6E I;  2ZJQ F;  2NXN B;  3CME I;  1VQ6 I;  1VQM I;  4IOA F;  3CCE I;  1VQK I;  3PIO F;  5DM7 F;  2E35 A;  3G4S I;  4IOC F;  3CCM I;  3CJS B;  3CCJ I;  3CC4 I;  3G71 I;  3CCU I;  1VQP I;  3J7Z I;  1QA6 A;  2H8W A;  1YJW I;  1VQ9 I;  3CCR I;  1YI2 I;  4V19 K;  1FOY A;  5DM6 F;  2ZJP F;  1YJ9 I;  3CJR B;  3CD6 I;  1HC8 A;  1VQN I;  5GAE J;  3I55 I;  3CC7 I;  1VQ8 I;  2E36 A;  5GAG J;  3CC2 I;  2OTJ I;  1YIJ I;  2FOW A;  2OTL I;  3DLL F;  2E34 A;  5GAH J;  2ZJR F;  5GAD J;  3CMA I;  1ACI A;  1WIB A;  3CJT B;  3CJQ B;  1VQ7 I;  1YHQ I;  1S72 I;  2JQ7 A;  3CCL I;  2QEX I;  1FOW A;  4UY8 I;  3CCS I;  1VQ5 I;  1YIT I;  3J7Y J;  4IO9 F;  3CCV I;  5JVG F;  1YJN I;  1MMS A;  3EGV B;  2K3F A;  1VQO I;  2QA4 I;  3I56 I;  1VQ4 I;  1FOX A;  3CF5 F;  1Y39 A;  3PIP F;  3CCQ I;  1VQL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...