2LKXA

Nmr structure of the homeodomain of pitx2 in complex with a taatcc dna binding site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Pituitary homeobox 3
publication title Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lkxA00
3OOUA 1FTTA 2XB0X 1EF4A 3BG5A 4M3FA 1K61A 5C4XJ 3IH4A 3ZQIA 2E2JJ 2COBA 2JJ7A 2CJJA 5HODA 3HM5A 1TWCJ 1R9TJ 4UUSB 1TWAJ 2KT0A 3GTQJ 1MBJA 1F36A 2H8RA 1VFCA 1ETKA 2Y9ZA 1IV6A 2NS7A 2HOAA 3HOXJ 2DJNA 3SDGA 3LNQA 4M6VA 2JN6A 4A3GJ 2HXOA 1MBEA 3ZOBA 5FKKA 1MSFC 3BR6A 3MN2A 1JJ8C 4BXXJ 2RAEA 4X1EA 3ZQFA 3HBLA 4IHYA 3FKIJ 2M8GX 1RR7A 3M4OJ 2ELKA 4UUTA 3M3YJ 4AC0A 2LD5A 1ETYA 3S2DJ 1TWHJ 2Y0SN 2K9NA 3OIOA 4B3AA 2JMWA 1VF9A 1HLVA 2R5YB 2R7ZJ 2GBYA 4BY7J 4CYCB 2HI3A 3BR5A 3Q3SA 5JLXA 2IBDA 2DTZA 2LTPA 1FTZA 5GPCA 5E3NA 2E2IJ 1JUPA 2AO9A 4A3MJ 2DA2A 4C3HJ 1W0TA 3FISA 2NVXJ 1FIAA 4B1RA 3DCFA 3IH2A 3TW6A 5J1YA 5EF6A 5FKLA 3OSGA 5F0CA 1I3QJ 1MNMC 3H0GJ 3S17J 1WI3A 4M3EA 1XG1A 1JGGA 5DS9A 1IGNA 4C3IJ 1BA5A 4L5EA 3JR9A 3RKQA 3Q0WA 1IUFA 5IP6A 3LSPA 1UG2A 3PM1A 2HQ5A 5IOZA 5EGOA 3G1OA 1MBKA 3B6CA 1BL0A 1IDZA 2NVQJ 1T33A 2JWTA 4GFBA 3JRIA 3BQZA 3BT9A 3SFIA 2XRLA 4DYCA 3RZDJ 2ZB9A 3FK7A 1FEXA 2CUFA 3BQYA 2VKEA 1B72A 4XRSA 4QTRA 1GVDA 1MSEC 1O4XA 3GTKJ 2IEKA 4IEJA 5FKOA 1JKPC 4CYCA 5EG0A 3ZQGA 2E19A 4W1UA 3GTOJ 3HOYJ 2X6OA 3JRCA 3S1QJ 1CQTA 1P7JA 1WH5A 2Y30A 3B6AA 2K9SA 3BR0A 2XPWA 1A5JA 5FLMJ 2L7ZA 1AKHA 3GTMJ 2KDZA 1GUUA 4J19A 1VNDA 2VPRA 5F04A 2LKXA 3HKZN 2MW8A 3TP3A 4RBOA 2HOSA 3Q0UA 3I4NJ 4AUXA 1WPKA 1IC8A 1RETA 4X6AJ 2NS8A 3MKLA 2DN0A 4MIMA 1H8AC 4M3BA 1IDYA 1IRZA 2JA6J 4G12A 5J3LA 3A01B 3JRAA 1ENHA 5EZGA 1RKWA 4MLOA 2H1KA 3H3VK 2L0KA 1B8IB 2LK2A 2CUEA 1U9OA 1JUSA 2E1OA 4FE7A 2CQQA 5IPAA 1FJLA 3K2AA 2DA1A 5IYBJ 1ZKGA 2B63J 3WHCA 2LVSA 1MH3A 2NVTJ 3D1NI 2EZIA 2LFBA 1OFCX 3BR3A 4A3EJ 2OPTA 5C4JJ 2FQ4A 3IV5A 3IH3A 1ZQ3P 1S7EA 4A3LJ 1GV2A 2LY9A 3TEDA 1GV5A 2DA6A 2NOGA 3JRGA 4M3DA 4A3CJ 3L1PA 2EH3A 4MFEA 1QPIA 2TRTA 4DZPA 1TWGJ 1ORKA 1NTCA 3JREA 2HOTA 3QPLA 2QF7A 2CU7A 2O7OA 1HF0A 3OSFA 2K40A 2XPUA 3BR1A 4A3BJ 3E7LA 3TP0A 1Z0XA 3BTLA 1GDTA 5IOYA 1JKQC 1Z77A 2FX0A 2R92J 5M5XJ 4UUSA 5DTDA 3S15J 4QSHA 3HOWJ 1AU7A 3HGGA 2JA7J 2K9QA 3F0CA 1NK2P 2GM4A 1QRYA 1U9NA 2R5ZB 3JRDA 2VKVA 5F1JA 1W0UA 4D5FA 5BNGA 1AHDP 2O9LA 1RESA 2Y2ZA 5EDNA 1VI0A 2NVYJ 3G1LA 3HB9A 1LFBA 2EZLA 4MO7A 2R0QC 1HOMA 1JT6A 5K7FA 1ZGWA 3A02A 3WHBA 1ZK8A 2HYJA 2P81A 3Q0VA 4XK4A 1PUFB 4V2FA 3HOZJ 5IYDJ 2AHQA 5IP7J 2ID3A 3S14J 4JYKA 2N8GA 2R93J 1ETWA 2XGCA 1SFOJ 2Y31A 2DMTA 1WCMJ 3W6VA 1E3OC 4DYQA 2R5YA 3ZQLA 2E2HJ 3S1MJ 1NK3P 4RDUA 1OJLA 2HXIA 4ABZA 1TC3C 4BBSJ 1IJWC 3ZQCA 2WB1N 5C44J 5GPAA 3HOUJ 1BW6A 2L7FP 1X58A 4I76A 4D7MA 5K7HA 1LFUP 4A3FJ 4B4CA 5J1RA 1D5YA 4D5CA 3VPRA 5FKMA 2DA7A 1ITYA 2LP0A 2G0EA 2EZKA 2XGDA 4LOCA 1LE8B 3K7AJ 2TCTA 3LSGA 3GTGJ 1TWFJ 3I4MJ 1I50J 2DA3A 2MGQA 1JT0A 1XS9A 3S1RJ 2ID6A 2X9DA 2VI6A 2DA5A 3BTCA 1MBFA 3BTJA 2DMQA 5C3EJ 1JTXA 5E3OA 5E3MA 4HNVA 4JX6A 5GP9A 4Y7NJ 5FJ8J 4FISA 5FKNA 4BBRJ 4XIDA 3GTLJ 2LR8A 5F0FA 1ETXA 2L7MP 3HGYA 2WAQN 2WV1A 2YUSA 1DU0A 4FCYA 2O8KA 1MBHA 2X48A 4Y52J 3JRHA 2W48A 1FIPA 3BTIA 1WGXA 4BY1J 1SANA 3RZOJ 1YRNB 3LSJA 4IHWA 1BJZA 2XSDC 2XB5A 3HEFA 5F08A 1IG7A 1QVUA 5FLVA 3RQIA 4QIWN 1Q1VA 5EGOB 2VUMJ 1ETQA 3NARA 1LE8A 4IHVA 3SJMA 4DW6A 1GT0C 3FIWA 3O8GA 1HDDC 3UKGA 3PO3J 3A03A 3LSRA 3C2BA 2M34A 1APLC 1X2NA 4M3GA 1Y1VJ 2PMZN 2D5VA 3A01A 1JKRC 1B72B 4I6ZA 2YS9A 1H89C 1I6HJ 5J1UA 2M2EA 2JK3A 4S0HB 4XICA 2MG4A 3CDLA 5EZHA 1B8IA 4MFDA 3CQZJ 4A3KJ 1RPWA 2ME0A 5M5WJ 5F0HA 1JJ6C 2HDDA 1OCPA 3CMYA 5EG0B 3GTPJ 3MVPA 2YU9J 2XPVA 3HDDA 3O8HA 2GLOA 3BR2A 2QCOA 4D7NA 3JRFA 3JRBA 2FD5A 2Y9YA 1U8BA 3PO2J 2DMPA 3NAUA 1A6IA 1F43A 3S1NJ 1AKHB 1POGA 2CRGA 4FE4A 5M3MJ 1DU6A 4BKXA 5M3FJ 1YRNA 1P7IA 1Y1WJ 1HDPA 4C3JJ 5IP9J 2L9RA 3DEWA 3S16J 4DYRA 3QPSA 5IYCJ 4JP0A 4A3JJ 3HOVJ 4A93J 3BG3A 5EYRA 2ME6A 1OCTC 1MBGA 5JLWA 2FJ1A 3LOCA 4IHXA 3QQAA 4DZJA 1H88C 4A3IJ 2IAIA 2ECCA 1ZR4A 4XRMA 4NDLA 4JX4A 3BG9A 1UMQA 4XRSG 2EZHA 4A69C 3S2HJ 1MH4A 2DMNA 3CCYA 3TW7A 3ZQHA 4W97A 1ZR2A 1UHSA 1JTYA 1WH7A 5EEAA 5E3LA 1JKOC 2EQRA 2MSYA 4C2MJ 2M0CA 4JX5A 2DA4A 1ETVA 3GTJJ 3G1MA 2XGEA 1ZTRA 4FTHA 1RKTA 1HCRA 2JA8J 2R5ZA 2JA5J 2OF7A 1X2MA 2I10A 2ECBA 4EEFG 4A3DJ 1BW5A 1QVTA 1U78A 4AYBN 2EBIA 2LLKA 1JUMA 9ANTA 2M9HA 5K7ZA 1PUFA 1K83J 2CQXA 3FK6A 1XC5A 3GBGA 5M5YJ 4V2GA 1ETOA 1T56A 2DMUA 1G2HA 5F27A
chains in the Genus database with same CATH superfamily
1DQUA 3P5JA 3OOUA 4KISA 2HYGD 2XB0X 3G71I 3BG5A 4M3FA 3CCSI 3IH4A 3ZQIA 2DT5A 3V7CA 2E2JJ 2CJJA 2V26A 2VN2A 3GW2A 4PJ0C 1R9TJ 1TWAJ 1FMWA 3GTQJ 5KK1A 3HRSA 1RRJA 1OKRA 2H8RA 1STZA 4I02A 2MH9A 5HLTA 1R49A 2LNBA 2NS7A 2E36A 4HDVA 2JSPA 3GXOA 1TNSA 3K10A 3HOXJ 3BOQA 4M6VA 2PMUA 3ZOBA 1M1EB 5FKKA 1MSFC 2DFIA 2O3FA 4X1EA 3MD2A 3GFMA 3TKYA 3ZQFA 3HBLA 3HL2A 1RR7A 4Z6YA 3M4OJ 2ELKA 3K70C 4OIQF 1Y0NA 2HTJA 2L02A 3ZMSA 3AAFA 2VJJA 3U1DA 3CCMI 3OIOA 3DEEA 1LFPA 4HRIA 2LREA 4XLHA 3JAMK 3WE2A 1VF9A 4XRFA 3ABLH 2F5EA 3J80K 1XD7A 4U0YA 1V5GA 3BR5A 2PJRB 1R5HA 1P4XA 1RIOH 2NAZA 2A69F 3SYTA 3NWSA 2IJLA 1FTZA 2E2IJ 2EV5A 2HVSA 2KIMA 3RPUD 4AVPA 1XDUA 1W0TA 2NOJB 4B1RA 4HA8A 3IH2A 5HS8A 4HQEA 1Q1HA 1X19A 1LPQA 3BJOA 1P92A 3C1DA 3OSGA 1I3QJ 3HOSA 3W2AA 2DK8A 1FSEA 1JGGA 1ERDA 4CUGA 5DS9A 3HSEA 2L3DA 1IGNA 1QHGA 4C3IJ 1V5FA 1BA5A 2DPDA 2R7OA 3SZGA 4HEA2 2WTEA 5IP6A 3LMMA 4BE1A 1HKTA 2QUFA 3A2KA 4M6XA 4I99C 2NVQJ 2JWTA 3LA3A 4FX4A 3H9JA 3JRIA 2LC2A 3BQZA 3BT9A 2YSRA 2EFNA 3U9GA 4BDYA 3KYDB 3J7YJ 2W84A 3BQYA 2VKEA 4OIRF 2H1LA 4UB8C 4KNYA 2QBYA 1O4XA 3BP8A 2XAQA 2OZUA 3FZVA 2IEKA 3RPUA 3F22A 2V9PA 1XMAA 3S93A 3R61A 1JKPC 4CCJA 1QGPA 2VJ4A 1ZG1A 1DGRM 3J81Z 2M45A 4AU7A 5IT3A 5J40A 2P8TA 3HOYJ 2L4AA 1AWCA 1YO5C 2X6OA 1B1BA 5H6RA 4IRGA 5J8CA 4UB6C 3B6AA 1X3WB 3F3XA 5LHHA 1HW2A 1GUUA 4BXFA 3MZHA 1OYWA 1V3FA 1FBSA 2MW8A 3R0JA 3TP3A 3CCEI 2A5YB 3Q0UA 2JRTA 4PGHA 1H0MA 2NS8A 2ZC2A 3K4LA 3KZYA 3QP6A 4LD5A 2JA6J 3I55I 3HC7A 1HBXG 2H1KA 4IHTA 1L3LA 5CVJA 3H3VK 1G3WA 2A6HF 2L0KA 3P7NA 1B8IB 1U9OA 1W7PD 4FE7A 3RJPA 5KAIC 1LJ9A 1D0YA 2ZJRF 2VC0A 1T2KA 3K2AA 2DA1A 3HSFA 1V4RA 4YIIA 2B63J 4IOAF 4MEXF 4I2OA 2W1OA 2RV8A 2NNNA 3E1SA 2LKPA 1D8KA 2H09A 4U7BA 1D3YA 1YIOA 3V4GA 1VQ6I 2PX9A 5DEQA 2OPTA 2FQ4A 4P5OA 3TOBA 5DUIA 3CC7I 3GYHX 2LY9A 4P1WA 1IXRC 2BY1A 2BVMA 3JRGA 1ON1A 4TV7A 1W1WE 3FMSA 4Y17A 2HOEA 3OV8A 3CCVI 1SFKA 2FBKA 4XKVA 3OYHA 1AOYA 4CCOA 2FRHA 2VKHA 1O7LA 1LVKA 4HF0A 4DZPA 2P7CB 1TWGJ 3U21A 3C18A 4E7SA 4PSWA 1YJNI 2R7DA 4BUPA 2COMA 2IS4A 4A6EA 2CH0A 1D1CA 3GFJA 3H92A 2FQ3A 1HF0A 2KPMA 2STWA 1XGOA 3TP0A 3CCRI 5FGMA 1MMAA 1ON2A 4MQ9F 1YW8A 3F23A 5IOYA 3LAJA 4M9XA 2DYRH 2FX0A 2D1VA 3IKVA 4B44A 2XF6A 2GXBA 2BY0A 1S8NA 1B59A 3A0BC 3HOWJ 1FBUA 3HGGA 4RGRA 2JA7J 3GO5A 3F0CA 4RB1A 1WSUA 2GM4A 1YE9A 1YW9A 1OCZH 1QRYA 1U9NA 4KJZA 1WVRA 3F8NA 3ZGKA 3JTGA 1LB2A 1FX7A 5ED4A 3ABKH 2PMZA 4JK1X 2HKOA 1AHDP 2V7FA 3ZPLA 1D0ZA 1VI0A 1MNEA 4KT5C 5K1YA 1A36A 2VODA 3CF2A 3PUFA 4EJTA 1LFBA 1TLHB 1JT6A 1EJ9A 4ZTFA 1XGMA 3BZ6A 2W85A 5KAFC 4B47A 4KIBA 4XKWA 1E3HA 2JZYA 2AHQA 3KZZA 1BR1A 1FBQA 2N8GA 3KEQA 4RMNA 4BJ6C 3HPHA 3G73A 3FMQA 4L9VA 1J59A 4XKBA 5HLGA 2E2HJ 2MC4A 2P4WA 5LRSA 1BM9A 1RUOA 1TC3C 1IJWC 2PJRA 5CVRA 5C44J 1SAUA 1X58A 5LHIA 3TOAA 2EB7A 2V1NA 1UZCA 2KQRA 3K1PA 1T6SA 4D5CA 5EEHA 3AL0C 4QPQA 2JPCA 2LP0A 5D5XB 1WZ2A 2EZKA 2XGDA 4LOCA 2MD5A 5J8FA 2LYCA 3OYEA 3OMYA 3BWGA 2ADUA 3I4MJ 1TWFJ 2O0YA 5DM7F 1I50J 3GZ6A 2UZKA 4E7KA 3S1RJ 1W5SA 2VI6A 1Z7UA 1XSXA 2A68F 1VQ5I 2DA5A 2HU9A 1MBFA 1X4OA 1TZLA 2DTRA 4RM2A 5IT9Z 2DMQA 1JTXA 2X0LA 2KIQA 2L01A 1KYWA 2ZSHB 3CC4I 5FJ8J 3FWEA 3J81K 1FNNA 1ETXA 2V1UA 2WAQN 2WV1A 4MQVA 5HDKA 5LHGA 5GAGJ 4FCYA 4ZH4F 2QENA 2ISYA 4IL6C 1SMYF 1B9NA 3EDPA 5E8GA 3PQJA 2BHZA 4UV8A 1Z3XA 3UR3C 1WQ2A 2RQPA 3KP3A 1WGXA 4ZDOA 4AYBA 1SANA 3SDBA 3LSJA 1Y0UA 4IHWA 1MKMA 1YS6A 1XB4A 1ZARA 2ZXHA 1YI2I 2FBIA 4IQJA 2XSDC 3WE3A 3HEFA 3DKWA 2M3AA 5F08A 5FD6A 1FMVA 2WA0A 4AVZA 3HIFA 1WWXA 1FWZA 1I5ZA 2VJIA 2WAFA 1C0WA 2P0WA 4ZYEA 1ETQA 3NARA 2HFHA 3CTAA 3PQKA 2ZBKA 4LLLA 2ZJ2A 4DW6A 3E6DA 3CC2I 3C2BA 2CSOA 3OL3A 3KP4A 2X4HA 1D5VA 2XGXA 3OS0A 2RREA 5E8IA 1JKRC 3CCLI 1B72B 1H89C 1I6HJ 1WJEA 2KZGA 2M2EA 1B8IA 4E7ZA 2HNHA 3CQZJ 4HOBA 4I98B 4NHJA 2CW0F 2ME0A 2BE5F 2LBFB 5M5WJ 3ZMTA 1N78A 3KZIC 1EV7A 5EG0B 1FY7A 3GTPJ 3K4MA 3CUOA 4PJJA 3N05A 1NG7A 2ZNZA 4KT6A 4ON0A 2FXAA 1NH3A 3H3UA 2GLOA 2ZXIA 4EQQA 4D7NA 3JRFA 2FD5A 4U0VA 4XLPF 1Z1DA 3PO2J 3RCOA 4UVAA 1F43A 5D8KB 3FM3A 2BOLA 3S1NJ 1AKHB 4FE4A 4HV5A 3LQQA 4S04A 4BKXA 1YRNA 4BS9A 4R79A 2K9LA 2EK5A 1BOBA 3SEZA 4D1QA 1HDPA 3AFHA 3DV8A 1USSA 3ESWB 1GXPA 4KYWA 5IP9J 3M8FA 4KIFA 2AS5F 1J09A 4HG2A 5LGUA 5IYCJ 4A3JJ 1X3ZB 4CCMA 4E7JA 2QSHX 3VSKA 3H9QA 1KQ0A 3CP2A 4IHXA 3VOEA 2W25A 4LIVA 4DZJA 1U5TA 3IUOA 3ECHA 4GRIA 1Y56A 2HPIA 4L5JA 1H88C 2IAIA 3CLQA 2ECCA 4KN4X 1ZR4A 2CV1A 4NDLA 1VQNI 1UMQA 2ACJA 4XN3A 3VSLA 2EZHA 3OYDA 2MBFA 2XKPA 3CZ6A 2NNYA 4Y13A 3TQNA 4EGZA 2BW3B 3MKZA 1DPUA 2VQLA 2QWWA 2DMNA 3CCYA 3N97A 3HHHA 3GFIA 1UHSA 1LDKB 3H3ZA 4WCGA 5E3LA 2CQ7A 3SXYA 3CJRB 3DWLE 2AXTC 2M0CA 4HX4A 4NUBA 1ETVA 4XBFA 1JHFA 1USTA 3QOPA 1RKTA 1HCRA 2CV0A 4CZCA 3D5SC 5H2FC 3OOPA 3TDZC 3I3LA 1SD7A 2Z99A 2J5PA 2LF7A 4PDKA 1TT5B 3RYPA 4XLNF 1MDMA 3AG3H 4IKFA 4OAZA 2VT3A 3A0HC 4LFUA 4RGSA 4MTDA 4BQNA 4N9HA 1Z9CA 9ANTA 1EH8A 3DBRB 4WX9A 2CQXA 1XC5A 1ETOA 2EA4A 3FF5A 4P55A 1T56A 2ZMEA 1G2HA 2VQCA 1FC3A 2KRHA 1EF4A 1QHHD 3R6SA 1K61A 5C4XJ 1FOWA 2RQQA 2JJ7A 4XSXF 1SD4A 4ZZLA 5HODA 3HKZA 4BJTA 4BQAA 5FD5A 2KT0A 1XDSA 3GFLA 5TISC 2XHKA 2X6YA 3OYGA 1F36A 1NG6A 2HWVA 3CUQA 1VFCA 3OYIA 2E1MC 2PQ8A 1LDDA 2FOWA 4Q47A 5LD2C 5E18F 2VKDA 1I1SA 2HOAA 2M1BA 2DJNA 3GF2A 4LB6B 2XIGA 3LNQA 4U88A 2JA2A 2LY2A 5IT9K 3V42A 1U5TC 1MBEA 4BXXJ 4Q48A 2NYXA 3GWZA 1HW5A 4IHYA 3FKIJ 1LVAA 4HAMA 1S29A 2OV7A 2OU2A 3M3YJ 3HPGA 4PSXA 3L2VA 1WJAA 3J7AO 2E34A 1R5ID 4B3AA 3LFUA 2MA3A 1HLVA 2OA4A 1S3JA 1R1UA 3DFGA 2R7ZJ 3QODA 4BY7J 4D9JA 5KNLA 2KIFA 2LKSA 2HI3A 3F8CA 4LGWA 3K70D 4BE2A 4BXUA 4KMFA 2KZVA 3CO7C 1QU3A 2IBDA 2DTZA 4ASNA 2X1EA 2R7WA 1IRXA 5GPCA 5E3NA 1JUPA 2F6CA 2AO9A 3BZCA 2ZXWH 4A3MJ 3MZYA 2DA2A 1K4TA 1YFHA 4C3HJ 2EILH 2PLYA 3PIOF 5J1YA 1ZLKA 3TW6A 2AQEA 2EJRA 1QBJA 4FETA 5F0CA 1T39A 3Q9VA 3S17J 1G59A 2OD5A 4M3EA 4J01A 2V9VA 2VQHA 1FOKA 1HA8A 4ZC3A 1OCRH 3BPXA 1X1PA 2FOKA 2M0MA 3SZTA 3PM1A 2ZMEC 5IOZA 1BL0A 3B6CA 4YRVA 4EJWA 1IDZA 1T0FC 4KN7X 2PBIA 1ZH5A 4I0AA 1X3UA 3IHUA 3BPVA 4DYCA 1LEAA 3OYKA 2ZB9A 3FK7A 2FA5A 1O3QA 2CUFA 1MMNA 1KA8A 1B72A 2E71A 4LITA 5HNHA 1GVDA 4LG3A 2A61A 4EJOA 3CUQC 2ZNYA 3CCQI 3GTKJ 2K27A 3VB2A 3E3VA 2LBFA 5FKOA 5J4YA 1QZZA 1XPXA 3A4CA 5EG0A 1VQKI 5DDGA 2L2OA 2W7NA 3ZQQA 3JRCA 2GIVA 3A1YA 2IA0A 4BHPA 2XPWA 4YFXF 2QLZA 3IWFA 1A5JA 4UUVA 1FYLA 4AM3A 1IXCA 1RC9A 4HW0A 1AKHA 2KDZA 2CGPA 1Y39A 3I53A 3ONQA 3AL0B 5F1RA 5B66C 1B9MA 4J19A 1VNDA 4BEHB 4ENKA 1FP2A 3BZKA 4RBOA 5J47A 4K2EA 4HV6A 3MFKA 4L18B 4AUXA 1W7PB 3PFIA 4B8XA 2WB1A 1VTNC 2GXGA 1RETA 3VODA 1YYVA 2QQ9A 3GLXA 2WY8Q 3F8BA 2RNGA 3ZN0A 3T5XA 3PJRA 3OIPA 2R4GA 4NQWB 4P9UA 4G12A 2IGMA 3E6MA 4BHBA 1S7AA 1RKWA 2H6CA 1FSHA 4II3A 3KCCA 2IP2A 5HS9A 2LK2A 2XF5A 2XROA 2JQ7A 2CUEA 2IW5A 1A35A 1LUJB 5AIPA 2DT6A 2IGKA 1FJLA 2CV2A 4PZJA 4XKCA 1ZKGA 1S9HA 3WHCA 1LNWA 2KKOA 3K4BA 1YITI 3IC7A 2BW3A 2KFDA 4CYDA 1H9TA 1PUEE 1YOVB 2VASA 3PNTA 4Q5SF 1IUYA 3I5UA 2LFBA 2ESHA 3V8LA 1X4PA 2I5UA 4U87A 1VQLI 4A3EJ 4KDPA 1T38A 5C4JJ 2VPLA 3IH3A 2GA1A 3H5NA 2LSOA 1GV2A 2E5NA 1SD5A 4II2A 1GV5A 5DCFA 1R36A 4A3CJ 1O57A 1UCRA 2FBHA 2RC4A 2Y48A 3HRUA 2M87A 4MFEA 1BOAA 4A5NA 3R60A 3ZMUA 2TRTA 2B0LA 2L7KA 2GIZA 4FQGA 1TT0A 4NC8A 1UB9A 5JHFA 4O3MA 2R7RA 2X51A 1PJRA 3AG1H 5B1AH 4OIPF 3V7RA 1JXSA 3TMOA 1PP8F 5DCMB 1BC8C 1K78B 1BIBA 2O7OA 4WWCA 3OSFA 1XN7A 2K40A 2XPUA 3BR1A 2OQRA 2BY3A 2F5FA 3F6OA 4ZYHA 3GMEA 3BTLA 3LL7A 1ZGJA 3ELKA 1TQIA 4IHSA 2R92J 2VT2A 5TRDA 2R3SA 3NRVA 4HLXA 3S15J 4QSHA 2E7XA 1AU7A 2HQRA 4S05A 1XGNA 3OL4A 4Q4ZF 2M4KA 1XSDA 1P9QC 5H6QA 3MZ8A 3J7AY 3R4KA 2V6CA 3OYAA 1PP7U 4D5FA 1G8XA 2I8DA 1IN6A 1XCBA 3MEXA 1KU2A 2LH9A 3M07A 1SEUA 2BHYA 3G1LA 5ICEA 1CGPA 3K0LA 3OR1C 3KPHA 4MO7A 4RLQA 4BYYA 1HOMA 1ZGWA 3QYBA 2QQAA 4ZJZA 2P81A 2K7LA 3CD6I 1QZYA 5IYDJ 2A05A 2BGCA 5IP7J 2ID3A 3K69A 3CMEI 5FROA 2R93J 2XGCA 4A0XA 1SFOJ 2L54A 4DYQA 1BI0A 3ZQLA 2FMYA 3S1MJ 2CO5A 2FF4A 2OCEA 4RDUA 1IN5A 2HXIA 1YHQI 1TTYA 2DJIA 2NS0A 1N77A 3ZQCA 1E3PA 3DKXA 5GPAA 4IX7A 3HOUJ 2IGOA 2L7FP 5D6FA 2A6TA 1LFUP 2HQNA 4HF2A 5FRNA 3MKWB 2Q2EB 1ONVA 1U0JA 1VQPI 5J1RA 1T98A 1Y8RB 4O6JA 4HF1A 5GAEJ 3TL4X 5ICCA 4L0YB 3BC8A 2G7UA 3LAPA 1ITYA 3QU3A 4PJNA 5A2QK 1BC7C 2K9MA 2JSCA 3MQ0A 4OIOF 3K7AJ 3GTGJ 2X1CA 4ANJA 1JT0A 1XS9A 4LG0B 2ID6A 3EETA 3BROA 1BR4A 3QPTA 2Q1ZB 4IXAA 3ZMVA 3GVAA 3TGNA 1TNTA 5H20A 5D5WB 3BTCA 5DM6F 2R7UA 1UHMA 3ASOH 3BTJA 3FBIB 2XAUA 1K6YA 1YW7A 4HNVA 1SVMA 1WHUA 3AG4H 4MHGA 5GP9A 4GCVA 3H35A 4FISA 4BBRJ 1ZAOA 3ASNH 4XIDA 5ERIA 4IRIA 2LR8A 3V8KA 3DLLF 1G4DA 3E6BA 4AD9A 1DU0A 2LF8A 1R58A 2O8KA 5D6EA 5HLIA 2JRMA 4ZDLA 2GOMA 1CF7B 1U8RA 4Y52J 3JRHA 2W48A 3BTIA 4AIKA 3D5RC 3HOTA 3L09A 2D2WA 4BY1J 3RZOJ 1YRNB 1BJZA 1MJBA 2OTJI 4MGRA 3J7ZI 4YG2F 2XB5A 3DQVC 5ILSA 4AIDA 2E1MB 3HJEA 3DKYA 4CO8A 5FLVA 2NVUB 1U2WA 3KLNA 2BVLA 4BEHA 1OMIA 3PSIA 4QIWN 4NNJA 5EGOB 2DFFA 2VUMJ 3PUBA 3V8JA 1U5TB 2KP6A 4FT8A 2BYVE 1VQ7I 4G7OF 2XSJC 3SJMA 4IVNA 3FIWA 1W7PA 1HDDC 2K85A 3PO3J 1R4NB 3LSRA 2M34A 2VJ5A 3I9V2 2H27A 1GXQA 1UELB 3LWFA 2PMZN 4NQWA 4U0WA 2KLOA 4HNUA 4I6ZA 1IW7F 1FOXA 5J1UA 5CQEA 2JK3A 4XICA 4M6YA 4MFDA 4BL0B 3M1CA 4BGDA 3RKYA 4A3KJ 3DU5A 5AONA 3LSTA 3K4KA 3MWMA 5F0HA 3RIRA 2HDDA 1OCPA 3CMYA 1OYYA 2PI0A 3MVPA 2YU9J 2DLLA 3JTHA 2OQGA 4MNUA 2XPVA 2XRNA 4A5MA 2R7QA 2HZTA 3P9IA 3O8HA 2ZJQF 3EYYA 3CMAI 2DBBA 2QCOA 4ZDPA 3JSPA 1U8BA 1MMSA 2CW8A 3L2QA 3K6GA 2Y0SA 3M7GA 1MDMB 2QQBA 3BJ6A 1V5EA 1RUNA 4GO1A 2HTSA 1SC7A 5DD8A 3I54A 3IP4B 4C3JJ 2K5CA 1XMXA 1K79A 1O3TA 4NC7A 2L9RA 3D0SA 3QPSA 3KFWX 4B43A 5EYRA 2ZMEB 1MBGA 5JLWA 2FJ1A 3QQAA 3CP8A 3DBHB 2CUJA 3I58A 2VBZA 2X6WA 5BPDA 1F9NA 5CLSA 4XRMA 1FPQA 4HSRA 4A0YA 2W57A 2V1XA 3BG9A 2EFWA 5DCMA 1K78A 2FUG2 2ZKZA 2HEOA 3S2HJ 1MH4A 1KU7A 2STTA 3T8RA 3DTIA 3CUQB 2A3SA 1Z05A 3TW7A 4RB0A 1ZR2A 2WC2A 5EEAA 2Z1DA 1JKOC 2DXIA 2HVRA 2EQRA 3E5UA 1V54H 2DAOA 4FX0A 2HVQA 2DA4A 3S3NA 2EV0A 4RGXA 2XGEA 5DYMA 4BH9A 4HDUA 1R4MB 4PJMA 4P9FA 5FB2A 2OF7A 3H5RA 4P96A 2I10A 4RGUA 1BW5A 4ZYGA 1HSTA 2ZXJA 1QVTA 4AYBN 4G7HF 2LLKA 3BG7A 1OYIA 4A2UA 4C2UA 1J0RA 2XUBA 1IF1A 1BI2A 2F4IA 4WK8F 2M9HA 4XOPA 4E7HA 3ZRGA 1JGSA 5TJJA 3QP5A 1O3RA 4V2GA 2DMUA 3IRQA 1A6QA 3QAHA 1XGSA 5L3DA 5B1BH 3HYIA 4GYIA 4E6KG 1HQCA 2Y0MA 3B02A 2G7HA 2KJCA 3F9KA 4UUSB 3JSOA 4QWQA 3ABTA 2Q2EA 2PG4A 2VQGA 1ETKA 2Y9ZA 1IV6A 2OZ6A 3HZJA 5JI6A 2DOEA 3DF8A 5TGTA 3WODF 2OCCH 1FP1D 3QWLA 2Z33A 1ZLJA 3E5XA 4A3GJ 3S2WA 2HXOA 5LEJA 2O03A 3JW4A 4LG0A 1JJ8C 5HDGA 4KUMA 1Y6IA 3I59B 2CFXA 6PAXA 1QO0D 2M8GX 5EEGA 2BBYA 4UUTA 4DIQA 2LD5A 1ETYA 4XQFA 3S2DJ 1TWHJ 2K9NA 1FT9A 5BS6A 2JTVA 4N4OB 3QYFA 2JMWA 3F6VA 5LFAA 2ELJA 2GBYA 3CCUI 2XAJA 2BXZA 3DPTA 3JCUC 3Q3SA 4OOIA 5JLXA 1RR8C 3DTEA 2LTPA 1HKSA 1Z6RA 2K4JA 2CQNA 3D5LA 1XTAA 2HQAA 2ETHA 4NBQA 4XSZF 1CF7A 2NVXJ 2VOOA 3DCFA 3HUGA 5EF6A 2VXDA 1TL8A 1EKEA 1J9IA 2WV0A 1ZHFA 1RZ4A 1MNMC 2QQ8A 3H0GJ 4L5IA 1XG1A 1YJWI 2L9VA 3RKQA 3Q0WA 1IUFA 1MZBA 2OJED 2L9SA 1UFMA 4G94A 3LSPA 3WGHA 4YELA 4DNCA 5EGOA 2BEOA 3G1OA 3RYRA 5FO5A 3KLOA 3W2WA 4BU2A 2J5OA 1Z6TA 3G2BA 2DI3A 3U1KA 3ML6A 3SFIA 4GDFA 1GVJA 5CYVA 3RZDJ 5FLXZ 1ZRDA 3GX4X 2VC1A 4XNFA 1F5TA 1YG2A 4XRSA 2NXNB 2QSGX 1R1TA 2XAFA 3ZN1A 3DP7A 1E0EA 5E1XA 3VDXA 1JHHA 1S72I 3CESA 4IEJA 2H94A 1HXDA 3LFKA 4CYCA 2OTLI 5LLQA 4XLAA 2E19A 1UJ8A 2VBWA 1IN7A 4W1UA 3GTOJ 3OWTA 2PJPA 2FNPA 2VONA 2Y69H 3KP2A 2EIJH 4RLFA 1CQTA 2UWMA 1ZRCA 1UG0A 4I01A 2RNJA 4HNTA 5L3CA 3GTMJ 5LGTA 2JUGA 2P7VB 2DOAA 4XL9A 2LKXA 3MKYB 3HKZN 4BE0A 3NEUA 3I4NJ 1KU9A 1WPKA 1IC8A 2B9SA 1FYMA 2DN0A 2F48A 1H8AC 4M3BA 1IRZA 2GOXB 5J3LA 3M9AA 3A01B 3JRAA 1T0FA 1ENHA 3OIQA 5EZGA 4MLOA 3ZP5A 2DO7A 3OYNA 2KRFA 5FFZA 2HYFA 4L0ZB 2GZWA 4L9JA 4LK1F 1KGSA 1JUSA 2M7AA 3VYUB 2E1OA 2H8WA 3G6EI 1HKQA 4YIFA 2LVSA 1W4MA 4N4NB 1MH3A 1XCVA 2XKOA 2NVTJ 4XOTA 1I6XA 4E4HA 3D1NI 1X1AA 2EZIA 3CJNA 3ISPA 5F6FA 3WGGA 3BG6A 1OFCX 4NB5A 2P5KA 3BR3A 3SEQA 3JAMZ 2E1CA 2DK5A 4YFKF 3C7JA 3J80Z 2EA2A 3IV5A 3FX3A 2IA1A 1S7EA 1ZYRF 2EINH 3DPLC 3OYFA 3BLYA 2W00A 3TEDA 1KYZA 3FDYA 2NOGA 4XN0A 4IOCF 3TBIA 2ZJPF 1OR7C 4NC6A 2VL8A 2XAGA 4CDGA 5LGNA 4JBAA 2EH3A 5KVRA 2Q8KA 1MNDA 2M4GA 1X1DA 1DGWY 1QPIA 5D5VB 3T8TA 4I09A 1UHWA 2D1HA 4F93B 4AIHA 1NTCA 1KQ8A 3JREA 2DW4A 5DV5A 2B7EA 2CU7A 2VXZA 3KX2A 5K5QA 3T0YA 2GA2A 3QPHA 4RAYA 2MLKA 2MLGA 3HG9A 2W82A 2KJBA 5KCMA 4DOZA 3G3ZA 1Z77A 4YFNF 1Z21A 4C9YA 2ZFWA 4N9IA 1ZRFA 4UUSA 3CCJI 5DTDA 4RB3C 2DOFA 3F21A 2JT1A 4G6QA 2K9QA 2OBPA 2R5ZB 4PK4A 3WG7H 3BCBA 2QM3A 3F8MA 4OU0A 4L9TA 4B3XA 3TO9A 3S8PA 5BNGA 1QZEA 1RESA 2Y2ZA 5EDNA 3O6BB 5FFXA 1LKXA 3DU6A 3EUHA 3RQ4A 3HB9A 2EZLA 3OYBA 2R0QC 1TQPA 2FMLA 3WU1B 4ESJA 3I59A 4QPOA 2DQRA 2HYJA 1R6RA 3GEZA 3Q0VA 3TDUC 4HSTA 3BDDA 3HOZJ 4X0GA 2DFEA 4UVCA 1HW1A 2CS3A 4OWRB 3K4JA 3QU6A 3CO6C 1PYVA 2DMTA 1WCMJ 2EFPA 1R23A 5KHDA 1YS7A 4WXHA 1OJLA 3DTKA 4ABZA 4V19K 2XVCA 3QOEA 2LRDA 2WB1N 2DT7B 4DGWB 4U7DA 4D7MA 2DU9A 4WXCA 1I3AA 5B5EC 5K7HA 2R7SA 2O61A 4DBRA 4A3FJ 1S7OA 1OCOH 5CPRB 1VQ4I 1D5YA 2P5LC 1QNTA 1OQYA 4EM0B 1OISA 1ZG3A 4BAYA 4ETSA 1JI8A 2Q0OA 3LQRA 2GQQA 2AXLA 2TCTA 3LSGA 2EWNA 1ZELA 2DA3A 2MGQA 4G9YA 1B6AA 4CCLA 3KP6A 5FLXK 4I0BA 1WJDA 2XAHA 4JOMA 4F91B 1IRFA 4YIRX 3WTVC 2RN7A 5C3EJ 4G8XA 2IA2A 4ESFA 4UNOA 1GLNA 2VIXA 1SFEA 4ENMA 4RA2A 4UV9A 3SZPA 4JX6A 5LRRA 2OAZA 3AKZA 2O8XA 3HRTA 5ILVA 3K1MA 4EGYA 2P5VA 1BI3A 3M8EA 5F0FA 3OYCA 3I56I 4LK0F 2L7MP 2JPBA 4IPAA 2X6XA 2HKXA 3CF5F 1IN8A 2IS1A 4L9NA 1W36C 2Y75A 1MBHA 3WTZA 5HDNA 4RAGA 4KFCA 2L9NA 1FIPA 1DP3A 3EUHC 4LLGF 1Z67A 2HS5A 2MFZA 2HR3A 3ZR8X 2IS6A 1AA7A 3N4MA 2K86A 3MCZA 5GAHJ 2XC7A 3WU2C 3ULQB 5L3GA 3E0JB 3ROUA 4AWXB 1IG7A 3HTUA 3CDIA 4HQMA 1BR2A 1QVUA 5HVQC 3L2WA 1TQMA 3BCAA 4FASD 3PNVA 1LE8A 2E7WA 2F2EA 2ICWG 2MYSA 1GT0C 1WJBA 3O8GA 4HX8A 5JR3A 4BHCA 3UKGA 3KIOA 5ICGA 1APLC 1Y1VJ 3GUDA 1BN5A 2XASA 4ZTJA 3A01A 2NRAC 3EPZA 2X1DA 2GWRA 4S0HB 3M8JA 4RB2C 2EIKH 2BXYA 2DDBA 4PGGA 1RPWA 2EPFA 3E6CC 1JJ6C 2QKMB 1X1BA 1KONA 3HDDA 1DDNA 3SFZA 3OYMA 2PEXA 3RTRA 3JRBA 2E35A 4R8HA 1A6IA 1POGA 1KZHA 5M3MJ 5M3FJ 2XV4S 2XF7A 1P7IA 2PFBA 3E97A 3NQOA 2CYYA 1Y1WJ 1I1GA 4F7ZA 3FXKA 2Z3YA 4WXDA 2QSFX 1WFXA 3COAC 5JFRA 1PVEA 3S16J 2O6GE 4A93J 1IZ1A 2ME6A 1R7JA 4RAZA 3LOCA 3GCMA 3K1NA 5JHUA 4E70A 5E20A 1XX5A 4AIJA 2UXXA 2LY1A 4OAYA 4A3IJ 2ZSIB 3RSNA 2UUZA 1BI1A 1R71A 2A07F 2G9WA 4XMYA 4UHTA 4KMUX 2LOOA 4GGGA 4A69C 3IRRA 1XMKA 3FXJA 4O5VA 2Z16A 3K4CA 3L9FA 3VEPA 5LEKA 5FRMA 3PL8A 4JQFA 1YX5A 1WH7A 2IPQX 4XR6A 3HXLA 3ZXSA 2RKHA 2MSYA 2MABA 4C2MJ 1T08B 4JX5A 2IXSA 3KYLA 4IO9F 5ILUA 1ZTRA 3E5QA 2OC6A 3B73A 5K5RA 2JA8J 2R5ZA 4Y33A 4M74A 3NWTA 1IXSB 3EUAA 4PFPA 5D4SA 2JA5J 3P9KA 3R0AA 1VQ8I 4CXFA 3H9GA 4OMZA 1X2MA 2O5RA 2ECBA 4EEFG 4DQ2A 1P6RA 2IRFG 2WWYA 1P4WA 1U78A 2EBIA 3HRMA 1SMTA 4R1HA 3L7WA 3LSHA 1D0XA 5GTHC 2ZFUA 4J00A 2DQLA 1WJFA 1Z7LA 1K83J 3FXUA 3GBGA 2QYOA 4HZFA 3W2VA 3T1BA 2BY2A 5F27A 1G3SA 4N0BA 1W5CC 1FTTA 1B4AA 2E5ZA 3H1CA 2HPMA 4EVIA 2HGCA 2RVCA 2YX4A 3GZNB 2COBA 3HUGB 4CHUA 3SHFA 1OCCH 4PUSA 3HM5A 1TWCJ 2IS2A 4PFOA 4KITB 1MBJA 4XLFA 1YQAA 4YEJA 2W24A 4C30A 1IO2A 4BQOA 2QA4I 5D8LB 5HLHA 1J5YA 1ULYA 2CMPA 3SDGA 5CVIA 4CZZA 2JN6A 2ZCWA 5K5OA 4E7LA 1HSJA 4MEYF 2HDWA 2M8EA 3BR6A 3MN2A 4FHTA 2RAEA 2UV1A 4HPQA 5CVVA 1MJAA 3WU0A 4AC0A 2Y0SN 3C2HA 2P6SA 3K4NA 5E1WA 1ZN2A 3KETA 2EV6A 1UAAA 1WRJA 2R5YB 1D1AA 2JUCA 1Y8QB 2CQKA 2YR2A 3I71A 4UXNA 4CYCB 1G3TA 3VFZA 1VQ9I 1MGTA 3OR2C 3KP7A 2L4MA 4ITVA 3H36A 2HZDA 4LJZF 2L5QA 1TBXA 3ERED 3KEYA 2IVMA 2CWEA 4E7IA 3FISA 1FIAA 2DFHA 5FKLA 1IV8A 4ENJA 1IAWA 1E17A 1WI3A 4LLNA 1MMGA 2M7BA 2HDCA 1XSVA 2Z9OA 4L5EA 3JR9A 2EIMH 2TDXA 4OMYA 4KICA 1UG2A 4MTEA 1O3SA 2HQ5A 3K9TA 2ELHA 1MBKA 5L3BA 2CW7A 1T33A 3ZQ7A 2GAUA 3QYEA 4GFBA 4F3QA 1Z91A 2XRLA 5CQGA 2X85A 1MIJA 1FEXA 3KP5A 3FXRA 2R7VA 2K02A 2DPUA 4PJLA 2V1DA 2R7XA 2QVOA 3HTSB 4QTRA 1MSEC 2F5VA 4XM3A 3WTYC 2V9KA 2WBMA 3V7SA 1J75A 3DPUA 3VWBA 4ENNA 4GXOA 1K6OA 1WI9A 4IF4A 2K4BA 3ZQGA 1X1CA 2QKLB 1A04A 3L2UA 1PDNC 4IQ4A 4QLCU 1U6GA 4DBQA 5JVGF 3BY6A 3VYRB 3S1QJ 3AG2H 4A12A 1P7JA 1WH5A 2Y30A 3BR0A 2K9SA 5BPIA 4WF2A 2FNAA 4XORA 4CICA 1ZG5A 5DUKA 2K3PA 2MC3A 5FLMJ 2ISZA 2L7ZA 3ABMH 2DCEA 2VPRA 5F04A 1MW7A 2FU4A 1EA3A 3EQLF 4M73A 1QA6A 1O7FA 2F5CA 2HOSA 2D45A 4F55A 2UXNA 4X6AJ 3MKLA 4MIMA 1IDYA 3O3KA 3ZMDA 1WKMA 1Z3YA 3H5AA 5CJ9A 1LDJA 2QZ8A 5CVUA 2LG4A 4EM2A 1N75A 4BACA 5D5UB 2FE3A 3M1EA 4DJAA 2CQQA 5IPAA 5IYBJ 2BV6A 1F4KA 4BNCA 1TW3A 4IRHA 3FHNA 4XLCA 2ZO4A 3MAJA 5ICFA 4OINF 4XONA 3KE2A 3F72A 2KISA 4Y4RA 4CCKA 4ZYAA 3BJAA 1YIJI 3W3CA 1T8IA 3ZCOA 1MD0A 4CH7A 2Z2SB 1ZQ3P 1P2FA 3CJQB 4A3LJ 3HSRA 2KL4A 2BZTA 1I27A 1FZPB 1YLFA 3S3OA 1K7AA 2DA6A 1KU3A 1HC8A 4M3DA 4ESBA 1IRGA 3L1PA 3FBNB 4LIUA 4M71A 4IJAA 3PIPF 2WAQA 1K4SA 2XDVA 3WTSC 3WTWC 3L00A 3LA2A 4M9ZA 2C6YA 1ORKA 3SQNA 4BDZA 2HOTA 3QRFF 3QPLA 2QF7A 3CDHA 3WG9A 5BQTA 5L3EA 3IAM2 4EMSA 4A3BJ 3E7LA 1Z0XA 5DD4A 5GTIC 1F1ZA 1GDTA 2WAEA 3OS1A 3GZ5A 1JKQC 2R7FA 5M5XJ 3MMYB 1QQIA 4KA4A 4EJUA 3OYJA 1NK2P 3I4PA 3PSFA 3JRDA 2VKVA 5F1JA 1W0UA 3FXQA 3KYCB 4G6DA 3CJTB 2O9LA 3L2RA 1GHCA 2OUMA 1RNLA 2M5WA 3LA7A 4UY8I 5HOOA 2NVYJ 4EJVA 3FM5A 5HS7A 5K7FA 3A02A 3WHBA 1OR7A 1ZK8A 2VBXA 3TO7A 4XK4A 3FMRA 1PUFB 4V2FA 1WJ5A 4Z2YA 2F4OB 5E79C 4ZZDA 5D4RA 3WGIA 2W4SA 4G6TB 3S14J 4JYKA 3RKXA 1LEBA 1V55H 2VE8A 2F5DA 1ETWA 3WTTC 2VOPA 2Y31A 3W6JB 3W6VA 1E3OC 2R5YA 1G6NA 1NK3P 4Y15A 1T95A 4BBSJ 1IN4A 1RI7A 3DLAA 3G4SI 1OPCA 1BW6A 4I76A 3DEUA 3REOA 1DP7P 3OYLA 1BIAA 4B4CA 1D1BA 2YU3A 4RM3A 4ZYDA 4F52A 3PFYA 3S32A 2RGVA 3VPRA 1BJAA 4BJ5C 5FKMA 2DA7A 2E60A 4IZZA 2G0EA 2LDUA 1LE8B 1A31A 4Y3OA 2K3FA 1MMDA 4A0ZA 2X9DA 2E1NA 2KDOA 3C2GA 2H6BA 4C2TA 1VQMI 1R22A 5IY5H 1ZREA 3UNGC 4F92B 5BMZA 3FXMA 2DYSH 5E3OA 3X2QH 5E3MA 4XLEA 1U3EM 4H4KC 4Y7NJ 1WJCA 3DBLB 5FKNA 2QGUA 1J7KA 2YPRA 4EV0A 5L3FA 3GTLJ 5EJCA 2VB6A 1G3YA 3TO6A 3HHGA 2CUZA 3HGYA 3KEOA 2YUSA 2CFOA 5F64A 1MJ9A 2LMDA 3WTUC 3I0TA 4M9SA 2Z5UA 3IAS2 2X48A 2QEXI 2V6EA 3Q9SA 3CMMA 4CSWA 1YX3A 2A5WA 2AQFA 3K2ZA 4CGZA 1W36D 1W5TA 3FHZA 3FKJA 1DPRA 1P4AA 1J2XA 1SFXA 2DDAA 2KHMA 3O2PE 3RI4A 2RDPA 3PNYA 5BOXA 3RQIA 1LQ1A 2R7TA 1Q1VA 3LSMA 3LSKA 1YJ9I 4IHVA 3Q5FA 1JE8A 1TP4A 3FXLA 4M72A 4B48A 3A03A 3GLLA 4HLYA 1X2NA 4M3GA 3VYTB 2D5VA 5GADJ 2YS9A 2CG4A 5HNFA 1FLIA 3S3MA 1BBYA 1OLTA 2MG4A 3CDLA 5EZHA 1EH6A 1SAXA 2QBYB 2VE9A 4H0EA 3ZMZA 2EFQA 4RS8A 4PCQA 1EH7A 4D0PA 5JVTA 1VZ0A 1VQOI 1H9GA 3I64A 1SVLA 3BR2A 2KIUA 2FEZA 1SD6A 1SFUA 2Y9YA 2VLAA 1R1VA 2DMPA 3NAUA 3L2CA 2PMHA 1TW2A 2CRGA 5J4VA 3RDIA 1DU6A 1I39A 4LB5A 3VYSB 3OY9A 2M30A 3FXOA 2DODA 2MD0A 2VBYA 3DEWA 4CCNA 4DYRA 3HOVJ 2KRCA 2EFOA 2WY7Q 4HBLA 4JP0A 1FYKA 3BG3A 1OCTC 3EYIA 2V4JC 1QPMA 4EM1A 1N25A 4KIGA 3C3WA 4I7HA 3IKTA 1R00A 4HX7A 2IT0A 5A2QZ 3LSIA 1ZGAA 4JX4A 2MH2A 2P6TA 4B09A 1NHAA 1SVOA 4XRSG 2WADA 3DXJF 3F8FA 2JVHA 2PN6A 4LMYA 1D8JA 4EATA 3ZQHA 1R5GA 5CKTA 4W97A 1REPC 1JTYA 2IGNA 3ERMA 3ECOA 1L0OC 3H0DA 1ACIA 1KQ9A 3GTJJ 3G1MA 3IL2A 4FTHA 3EUKL 5AIQA 1E2XA 1FOYA 5E1ZB 4BQQA 1YTYA 2V79A 1S5LC 3RKWA 3CLOA 2F4MB 2GXAA 4A3DJ 4RAFA 2A6EF 4UVBA 3ABUA 3RPQA 5B3SH 3IWZA 2JVGA 2YX7A 4G7ZF 4CA0A 5J6XA 4HYEA 1JUMA 1ODDA 3U2RA 3OS2A 1S6LA 5E17F 5K7ZA 1DUXC 1PUFA 3W6KB 4A6DA 3FK6A 2KMUA 5M5YJ 2ESNA 2FSWA 3P9CA 5LBQA 4GYGA 3WTXC
chains in the Genus database with same CATH topology
3OOUA 1FTTA 2XB0X 1EF4A 3BG5A 4M3FA 1K61A 5C4XJ 3IH4A 3ZQIA 2E2JJ 2COBA 2JJ7A 2CJJA 5HODA 3HM5A 1TWCJ 1R9TJ 4UUSB 1TWAJ 2KT0A 3GTQJ 1MBJA 1F36A 2H8RA 1VFCA 1ETKA 2Y9ZA 1IV6A 2NS7A 2HOAA 3HOXJ 2DJNA 3SDGA 3LNQA 4M6VA 2JN6A 4A3GJ 2HXOA 1MBEA 3ZOBA 5FKKA 1MSFC 3BR6A 3MN2A 1JJ8C 4BXXJ 2RAEA 4X1EA 3ZQFA 3HBLA 4IHYA 3FKIJ 2M8GX 1RR7A 3M4OJ 2ELKA 4UUTA 3M3YJ 4AC0A 2LD5A 1ETYA 3S2DJ 1TWHJ 2Y0SN 2K9NA 3OIOA 4B3AA 2JMWA 1VF9A 1HLVA 2R5YB 2R7ZJ 2GBYA 4BY7J 4CYCB 2HI3A 3BR5A 3Q3SA 5JLXA 2IBDA 2DTZA 2LTPA 1FTZA 5GPCA 5E3NA 2E2IJ 1JUPA 2AO9A 4A3MJ 2DA2A 4C3HJ 1W0TA 3FISA 2NVXJ 1FIAA 4B1RA 3DCFA 3IH2A 3TW6A 5J1YA 5EF6A 5FKLA 3OSGA 5F0CA 1I3QJ 1MNMC 3H0GJ 3S17J 1WI3A 4M3EA 1XG1A 1JGGA 5DS9A 1IGNA 4C3IJ 1BA5A 4L5EA 3JR9A 3RKQA 3Q0WA 1IUFA 5IP6A 3LSPA 1UG2A 3PM1A 2HQ5A 5IOZA 5EGOA 3G1OA 1MBKA 3B6CA 1BL0A 1IDZA 2NVQJ 1T33A 2JWTA 4GFBA 3JRIA 3BQZA 3BT9A 3SFIA 2XRLA 4DYCA 3RZDJ 2ZB9A 3FK7A 1FEXA 2CUFA 3BQYA 2VKEA 1B72A 4XRSA 4QTRA 1GVDA 1MSEC 1O4XA 3GTKJ 2IEKA 4IEJA 5FKOA 1JKPC 4CYCA 5EG0A 3ZQGA 2E19A 4W1UA 3GTOJ 3HOYJ 2X6OA 3JRCA 3S1QJ 1CQTA 1P7JA 1WH5A 2Y30A 3B6AA 2K9SA 3BR0A 2XPWA 1A5JA 5FLMJ 2L7ZA 1AKHA 3GTMJ 2KDZA 1GUUA 4J19A 1VNDA 2VPRA 5F04A 2LKXA 3HKZN 2MW8A 3TP3A 4RBOA 2HOSA 3Q0UA 3I4NJ 4AUXA 1WPKA 1IC8A 1RETA 4X6AJ 2NS8A 3MKLA 2DN0A 4MIMA 1H8AC 4M3BA 1IDYA 1IRZA 2JA6J 4G12A 5J3LA 3A01B 3JRAA 1ENHA 5EZGA 1RKWA 4MLOA 2H1KA 3H3VK 2L0KA 1B8IB 2LK2A 2CUEA 1U9OA 1JUSA 2E1OA 4FE7A 2CQQA 5IPAA 1FJLA 3K2AA 2DA1A 5IYBJ 1ZKGA 2B63J 3WHCA 2LVSA 1MH3A 2NVTJ 3D1NI 2EZIA 2LFBA 1OFCX 3BR3A 4A3EJ 2OPTA 5C4JJ 2FQ4A 3IV5A 3IH3A 1ZQ3P 1S7EA 4A3LJ 1GV2A 2LY9A 3TEDA 1GV5A 2DA6A 2NOGA 3JRGA 4M3DA 4A3CJ 3L1PA 2EH3A 4MFEA 1QPIA 2TRTA 4DZPA 1TWGJ 1ORKA 1NTCA 3JREA 2HOTA 3QPLA 2QF7A 2CU7A 2O7OA 1HF0A 3OSFA 2K40A 2XPUA 3BR1A 4A3BJ 3E7LA 3TP0A 1Z0XA 3BTLA 1GDTA 5IOYA 1JKQC 1Z77A 2FX0A 2R92J 5M5XJ 4UUSA 5DTDA 3S15J 4QSHA 3HOWJ 1AU7A 3HGGA 2JA7J 2K9QA 3F0CA 1NK2P 2GM4A 1QRYA 1U9NA 2R5ZB 3JRDA 2VKVA 5F1JA 1W0UA 4D5FA 5BNGA 1AHDP 2O9LA 1RESA 2Y2ZA 5EDNA 1VI0A 2NVYJ 3G1LA 3HB9A 1LFBA 2EZLA 4MO7A 2R0QC 1HOMA 1JT6A 5K7FA 1ZGWA 3A02A 3WHBA 1ZK8A 2HYJA 2P81A 3Q0VA 4XK4A 1PUFB 4V2FA 3HOZJ 5IYDJ 2AHQA 5IP7J 2ID3A 3S14J 4JYKA 2N8GA 2R93J 1ETWA 2XGCA 1SFOJ 2Y31A 2DMTA 1WCMJ 3W6VA 1E3OC 4DYQA 2R5YA 3ZQLA 2E2HJ 3S1MJ 1NK3P 4RDUA 1OJLA 2HXIA 4ABZA 1TC3C 4BBSJ 1IJWC 3ZQCA 2WB1N 5C44J 5GPAA 3HOUJ 1BW6A 2L7FP 1X58A 4I76A 4D7MA 5K7HA 1LFUP 4A3FJ 4B4CA 5J1RA 1D5YA 4D5CA 3VPRA 5FKMA 2DA7A 1ITYA 2LP0A 2G0EA 2EZKA 2XGDA 4LOCA 1LE8B 3K7AJ 2TCTA 3LSGA 3GTGJ 1TWFJ 3I4MJ 1I50J 2DA3A 2MGQA 1JT0A 1XS9A 3S1RJ 2ID6A 2X9DA 2VI6A 2DA5A 3BTCA 1MBFA 3BTJA 2DMQA 5C3EJ 1JTXA 5E3OA 5E3MA 4HNVA 4JX6A 5GP9A 4Y7NJ 5FJ8J 4FISA 5FKNA 4BBRJ 4XIDA 3GTLJ 2LR8A 5F0FA 1ETXA 2L7MP 3HGYA 2WAQN 2WV1A 2YUSA 1DU0A 4FCYA 2O8KA 1MBHA 2X48A 4Y52J 3JRHA 2W48A 1FIPA 3BTIA 1WGXA 4BY1J 1SANA 3RZOJ 1YRNB 3LSJA 4IHWA 1BJZA 2XSDC 2XB5A 3HEFA 5F08A 1IG7A 1QVUA 5FLVA 3RQIA 4QIWN 1Q1VA 5EGOB 2VUMJ 1ETQA 3NARA 1LE8A 4IHVA 3SJMA 4DW6A 1GT0C 3FIWA 3O8GA 1HDDC 3UKGA 3PO3J 3A03A 3LSRA 3C2BA 2M34A 1APLC 1X2NA 4M3GA 1Y1VJ 2PMZN 2D5VA 3A01A 1JKRC 1B72B 4I6ZA 2YS9A 1H89C 1I6HJ 5J1UA 2M2EA 2JK3A 4S0HB 4XICA 2MG4A 3CDLA 5EZHA 1B8IA 4MFDA 3CQZJ 4A3KJ 1RPWA 2ME0A 5M5WJ 5F0HA 1JJ6C 2HDDA 1OCPA 3CMYA 5EG0B 3GTPJ 3MVPA 2YU9J 2XPVA 3HDDA 3O8HA 2GLOA 3BR2A 2QCOA 4D7NA 3JRFA 3JRBA 2FD5A 2Y9YA 1U8BA 3PO2J 2DMPA 3NAUA 1A6IA 1F43A 3S1NJ 1AKHB 1POGA 2CRGA 4FE4A 5M3MJ 1DU6A 4BKXA 5M3FJ 1YRNA 1P7IA 1Y1WJ 1HDPA 4C3JJ 5IP9J 2L9RA 3DEWA 3S16J 4DYRA 3QPSA 5IYCJ 4JP0A 4A3JJ 3HOVJ 4A93J 3BG3A 5EYRA 2ME6A 1OCTC 1MBGA 5JLWA 2FJ1A 3LOCA 4IHXA 3QQAA 4DZJA 1H88C 4A3IJ 2IAIA 2ECCA 1ZR4A 4XRMA 4NDLA 4JX4A 3BG9A 1UMQA 4XRSG 2EZHA 4A69C 3S2HJ 1MH4A 2DMNA 3CCYA 3TW7A 3ZQHA 4W97A 1ZR2A 1UHSA 1JTYA 1WH7A 5EEAA 5E3LA 1JKOC 2EQRA 2MSYA 4C2MJ 2M0CA 4JX5A 2DA4A 1ETVA 3GTJJ 3G1MA 2XGEA 1ZTRA 4FTHA 1RKTA 1HCRA 2JA8J 2R5ZA 2JA5J 2OF7A 1X2MA 2I10A 2ECBA 4EEFG 4A3DJ 1BW5A 1QVTA 1U78A 4AYBN 2EBIA 2LLKA 1JUMA 9ANTA 2M9HA 5K7ZA 1PUFA 1K83J 2CQXA 3FK6A 1XC5A 3GBGA 5M5YJ 4V2GA 1ETOA 1T56A 2DMUA 1G2HA 5F27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOU A;  1FTT A;  2XB0 X;  1EF4 A;  3BG5 A;  4M3F A;  1K61 A;  5C4X J;  3IH4 A;  3ZQI A;  2E2J J;  2COB A;  2JJ7 A;  2CJJ A;  5HOD A;  3HM5 A;  1TWC J;  1R9T J;  4UUS B;  1TWA J;  2KT0 A;  3GTQ J;  1MBJ A;  1F36 A;  2H8R A;  1VFC A;  1ETK A;  2Y9Z A;  1IV6 A;  2NS7 A;  2HOA A;  3HOX J;  2DJN A;  3SDG A;  3LNQ A;  4M6V A;  2JN6 A;  4A3G J;  2HXO A;  1MBE A;  3ZOB A;  5FKK A;  1MSF C;  3BR6 A;  3MN2 A;  1JJ8 C;  4BXX J;  2RAE A;  4X1E A;  3ZQF A;  3HBL A;  4IHY A;  3FKI J;  2M8G X;  1RR7 A;  3M4O J;  2ELK A;  4UUT A;  3M3Y J;  4AC0 A;  2LD5 A;  1ETY A;  3S2D J;  1TWH J;  2Y0S N;  2K9N A;  3OIO A;  4B3A A;  2JMW A;  1VF9 A;  1HLV A;  2R5Y B;  2R7Z J;  2GBY A;  4BY7 J;  4CYC B;  2HI3 A;  3BR5 A;  3Q3S A;  5JLX A;  2IBD A;  2DTZ A;  2LTP A;  1FTZ A;  5GPC A;  5E3N A;  2E2I J;  1JUP A;  2AO9 A;  4A3M J;  2DA2 A;  4C3H J;  1W0T A;  3FIS A;  2NVX J;  1FIA A;  4B1R A;  3DCF A;  3IH2 A;  3TW6 A;  5J1Y A;  5EF6 A;  5FKL A;  3OSG A;  5F0C A;  1I3Q J;  1MNM C;  3H0G J;  3S17 J;  1WI3 A;  4M3E A;  1XG1 A;  1JGG A;  5DS9 A;  1IGN A;  4C3I J;  1BA5 A;  4L5E A;  3JR9 A;  3RKQ A;  3Q0W A;  1IUF A;  5IP6 A;  3LSP A;  1UG2 A;  3PM1 A;  2HQ5 A;  5IOZ A;  5EGO A;  3G1O A;  1MBK A;  3B6C A;  1BL0 A;  1IDZ A;  2NVQ J;  1T33 A;  2JWT A;  4GFB A;  3JRI A;  3BQZ A;  3BT9 A;  3SFI A;  2XRL A;  4DYC A;  3RZD J;  2ZB9 A;  3FK7 A;  1FEX A;  2CUF A;  3BQY A;  2VKE A;  1B72 A;  4XRS A;  4QTR A;  1GVD A;  1MSE C;  1O4X A;  3GTK J;  2IEK A;  4IEJ A;  5FKO A;  1JKP C;  4CYC A;  5EG0 A;  3ZQG A;  2E19 A;  4W1U A;  3GTO J;  3HOY J;  2X6O A;  3JRC A;  3S1Q J;  1CQT A;  1P7J A;  1WH5 A;  2Y30 A;  3B6A A;  2K9S A;  3BR0 A;  2XPW A;  1A5J A;  5FLM J;  2L7Z A;  1AKH A;  3GTM J;  2KDZ A;  1GUU A;  4J19 A;  1VND A;  2VPR A;  5F04 A;  2LKX A;  3HKZ N;  2MW8 A;  3TP3 A;  4RBO A;  2HOS A;  3Q0U A;  3I4N J;  4AUX A;  1WPK A;  1IC8 A;  1RET A;  4X6A J;  2NS8 A;  3MKL A;  2DN0 A;  4MIM A;  1H8A C;  4M3B A;  1IDY A;  1IRZ A;  2JA6 J;  4G12 A;  5J3L A;  3A01 B;  3JRA A;  1ENH A;  5EZG A;  1RKW A;  4MLO A;  2H1K A;  3H3V K;  2L0K A;  1B8I B;  2LK2 A;  2CUE A;  1U9O A;  1JUS A;  2E1O A;  4FE7 A;  2CQQ A;  5IPA A;  1FJL A;  3K2A A;  2DA1 A;  5IYB J;  1ZKG A;  2B63 J;  3WHC A;  2LVS A;  1MH3 A;  2NVT J;  3D1N I;  2EZI A;  2LFB A;  1OFC X;  3BR3 A;  4A3E J;  2OPT A;  5C4J J;  2FQ4 A;  3IV5 A;  3IH3 A;  1ZQ3 P;  1S7E A;  4A3L J;  1GV2 A;  2LY9 A;  3TED A;  1GV5 A;  2DA6 A;  2NOG A;  3JRG A;  4M3D A;  4A3C J;  3L1P A;  2EH3 A;  4MFE A;  1QPI A;  2TRT A;  4DZP A;  1TWG J;  1ORK A;  1NTC A;  3JRE A;  2HOT A;  3QPL A;  2QF7 A;  2CU7 A;  2O7O A;  1HF0 A;  3OSF A;  2K40 A;  2XPU A;  3BR1 A;  4A3B J;  3E7L A;  3TP0 A;  1Z0X A;  3BTL A;  1GDT A;  5IOY A;  1JKQ C;  1Z77 A;  2FX0 A;  2R92 J;  5M5X J;  4UUS A;  5DTD A;  3S15 J;  4QSH A;  3HOW J;  1AU7 A;  3HGG A;  2JA7 J;  2K9Q A;  3F0C A;  1NK2 P;  2GM4 A;  1QRY A;  1U9N A;  2R5Z B;  3JRD A;  2VKV A;  5F1J A;  1W0U A;  4D5F A;  5BNG A;  1AHD P;  2O9L A;  1RES A;  2Y2Z A;  5EDN A;  1VI0 A;  2NVY J;  3G1L A;  3HB9 A;  1LFB A;  2EZL A;  4MO7 A;  2R0Q C;  1HOM A;  1JT6 A;  5K7F A;  1ZGW A;  3A02 A;  3WHB A;  1ZK8 A;  2HYJ A;  2P81 A;  3Q0V A;  4XK4 A;  1PUF B;  4V2F A;  3HOZ J;  5IYD J;  2AHQ A;  5IP7 J;  2ID3 A;  3S14 J;  4JYK A;  2N8G A;  2R93 J;  1ETW A;  2XGC A;  1SFO J;  2Y31 A;  2DMT A;  1WCM J;  3W6V A;  1E3O C;  4DYQ A;  2R5Y A;  3ZQL A;  2E2H J;  3S1M J;  1NK3 P;  4RDU A;  1OJL A;  2HXI A;  4ABZ A;  1TC3 C;  4BBS J;  1IJW C;  3ZQC A;  2WB1 N;  5C44 J;  5GPA A;  3HOU J;  1BW6 A;  2L7F P;  1X58 A;  4I76 A;  4D7M A;  5K7H A;  1LFU P;  4A3F J;  4B4C A;  5J1R A;  1D5Y A;  4D5C A;  3VPR A;  5FKM A;  2DA7 A;  1ITY A;  2LP0 A;  2G0E A;  2EZK A;  2XGD A;  4LOC A;  1LE8 B;  3K7A J;  2TCT A;  3LSG A;  3GTG J;  1TWF J;  3I4M J;  1I50 J;  2DA3 A;  2MGQ A;  1JT0 A;  1XS9 A;  3S1R J;  2ID6 A;  2X9D A;  2VI6 A;  2DA5 A;  3BTC A;  1MBF A;  3BTJ A;  2DMQ A;  5C3E J;  1JTX A;  5E3O A;  5E3M A;  4HNV A;  4JX6 A;  5GP9 A;  4Y7N J;  5FJ8 J;  4FIS A;  5FKN A;  4BBR J;  4XID A;  3GTL J;  2LR8 A;  5F0F A;  1ETX A;  2L7M P;  3HGY A;  2WAQ N;  2WV1 A;  2YUS A;  1DU0 A;  4FCY A;  2O8K A;  1MBH A;  2X48 A;  4Y52 J;  3JRH A;  2W48 A;  1FIP A;  3BTI A;  1WGX A;  4BY1 J;  1SAN A;  3RZO J;  1YRN B;  3LSJ A;  4IHW A;  1BJZ A;  2XSD C;  2XB5 A;  3HEF A;  5F08 A;  1IG7 A;  1QVU A;  5FLV A;  3RQI A;  4QIW N;  1Q1V A;  5EGO B;  2VUM J;  1ETQ A;  3NAR A;  1LE8 A;  4IHV A;  3SJM A;  4DW6 A;  1GT0 C;  3FIW A;  3O8G A;  1HDD C;  3UKG A;  3PO3 J;  3A03 A;  3LSR A;  3C2B A;  2M34 A;  1APL C;  1X2N A;  4M3G A;  1Y1V J;  2PMZ N;  2D5V A;  3A01 A;  1JKR C;  1B72 B;  4I6Z A;  2YS9 A;  1H89 C;  1I6H J;  5J1U A;  2M2E A;  2JK3 A;  4S0H B;  4XIC A;  2MG4 A;  3CDL A;  5EZH A;  1B8I A;  4MFD A;  3CQZ J;  4A3K J;  1RPW A;  2ME0 A;  5M5W J;  5F0H A;  1JJ6 C;  2HDD A;  1OCP A;  3CMY A;  5EG0 B;  3GTP J;  3MVP A;  2YU9 J;  2XPV A;  3HDD A;  3O8H A;  2GLO A;  3BR2 A;  2QCO A;  4D7N A;  3JRF A;  3JRB A;  2FD5 A;  2Y9Y A;  1U8B A;  3PO2 J;  2DMP A;  3NAU A;  1A6I A;  1F43 A;  3S1N J;  1AKH B;  1POG A;  2CRG A;  4FE4 A;  5M3M J;  1DU6 A;  4BKX A;  5M3F J;  1YRN A;  1P7I A;  1Y1W J;  1HDP A;  4C3J J;  5IP9 J;  2L9R A;  3DEW A;  3S16 J;  4DYR A;  3QPS A;  5IYC J;  4JP0 A;  4A3J J;  3HOV J;  4A93 J;  3BG3 A;  5EYR A;  2ME6 A;  1OCT C;  1MBG A;  5JLW A;  2FJ1 A;  3LOC A;  4IHX A;  3QQA A;  4DZJ A;  1H88 C;  4A3I J;  2IAI A;  2ECC A;  1ZR4 A;  4XRM A;  4NDL A;  4JX4 A;  3BG9 A;  1UMQ A;  4XRS G;  2EZH A;  4A69 C;  3S2H J;  1MH4 A;  2DMN A;  3CCY A;  3TW7 A;  3ZQH A;  4W97 A;  1ZR2 A;  1UHS A;  1JTY A;  1WH7 A;  5EEA A;  5E3L A;  1JKO C;  2EQR A;  2MSY A;  4C2M J;  2M0C A;  4JX5 A;  2DA4 A;  1ETV A;  3GTJ J;  3G1M A;  2XGE A;  1ZTR A;  4FTH A;  1RKT A;  1HCR A;  2JA8 J;  2R5Z A;  2JA5 J;  2OF7 A;  1X2M A;  2I10 A;  2ECB A;  4EEF G;  4A3D J;  1BW5 A;  1QVT A;  1U78 A;  4AYB N;  2EBI A;  2LLK A;  1JUM A;  9ANT A;  2M9H A;  5K7Z A;  1PUF A;  1K83 J;  2CQX A;  3FK6 A;  1XC5 A;  3GBG A;  5M5Y J;  4V2G A;  1ETO A;  1T56 A;  2DMU A;  1G2H A;  5F27 A; 
#chains in the Genus database with same CATH topology
 1DQU A;  3P5J A;  3OOU A;  4KIS A;  2HYG D;  2XB0 X;  3G71 I;  3BG5 A;  4M3F A;  3CCS I;  3IH4 A;  3ZQI A;  2DT5 A;  3V7C A;  2E2J J;  2CJJ A;  2V26 A;  2VN2 A;  3GW2 A;  4PJ0 C;  1R9T J;  1TWA J;  1FMW A;  3GTQ J;  5KK1 A;  3HRS A;  1RRJ A;  1OKR A;  2H8R A;  1STZ A;  4I02 A;  2MH9 A;  5HLT A;  1R49 A;  2LNB A;  2NS7 A;  2E36 A;  4HDV A;  2JSP A;  3GXO A;  1TNS A;  3K10 A;  3HOX J;  3BOQ A;  4M6V A;  2PMU A;  3ZOB A;  1M1E B;  5FKK A;  1MSF C;  2DFI A;  2O3F A;  4X1E A;  3MD2 A;  3GFM A;  3TKY A;  3ZQF A;  3HBL A;  3HL2 A;  1RR7 A;  4Z6Y A;  3M4O J;  2ELK A;  3K70 C;  4OIQ F;  1Y0N A;  2HTJ A;  2L02 A;  3ZMS A;  3AAF A;  2VJJ A;  3U1D A;  3CCM I;  3OIO A;  3DEE A;  1LFP A;  4HRI A;  2LRE A;  4XLH A;  3JAM K;  3WE2 A;  1VF9 A;  4XRF A;  3ABL H;  2F5E A;  3J80 K;  1XD7 A;  4U0Y A;  1V5G A;  3BR5 A;  2PJR B;  1R5H A;  1P4X A;  1RIO H;  2NAZ A;  2A69 F;  3SYT A;  3NWS A;  2IJL A;  1FTZ A;  2E2I J;  2EV5 A;  2HVS A;  2KIM A;  3RPU D;  4AVP A;  1XDU A;  1W0T A;  2NOJ B;  4B1R A;  4HA8 A;  3IH2 A;  5HS8 A;  4HQE A;  1Q1H A;  1X19 A;  1LPQ A;  3BJO A;  1P92 A;  3C1D A;  3OSG A;  1I3Q J;  3HOS A;  3W2A A;  2DK8 A;  1FSE A;  1JGG A;  1ERD A;  4CUG A;  5DS9 A;  3HSE A;  2L3D A;  1IGN A;  1QHG A;  4C3I J;  1V5F A;  1BA5 A;  2DPD A;  2R7O A;  3SZG A;  4HEA 2;  2WTE A;  5IP6 A;  3LMM A;  4BE1 A;  1HKT A;  2QUF A;  3A2K A;  4M6X A;  4I99 C;  2NVQ J;  2JWT A;  3LA3 A;  4FX4 A;  3H9J A;  3JRI A;  2LC2 A;  3BQZ A;  3BT9 A;  2YSR A;  2EFN A;  3U9G A;  4BDY A;  3KYD B;  3J7Y J;  2W84 A;  3BQY A;  2VKE A;  4OIR F;  2H1L A;  4UB8 C;  4KNY A;  2QBY A;  1O4X A;  3BP8 A;  2XAQ A;  2OZU A;  3FZV A;  2IEK A;  3RPU A;  3F22 A;  2V9P A;  1XMA A;  3S93 A;  3R61 A;  1JKP C;  4CCJ A;  1QGP A;  2VJ4 A;  1ZG1 A;  1DGR M;  3J81 Z;  2M45 A;  4AU7 A;  5IT3 A;  5J40 A;  2P8T A;  3HOY J;  2L4A A;  1AWC A;  1YO5 C;  2X6O A;  1B1B A;  5H6R A;  4IRG A;  5J8C A;  4UB6 C;  3B6A A;  1X3W B;  3F3X A;  5LHH A;  1HW2 A;  1GUU A;  4BXF A;  3MZH A;  1OYW A;  1V3F A;  1FBS A;  2MW8 A;  3R0J A;  3TP3 A;  3CCE I;  2A5Y B;  3Q0U A;  2JRT A;  4PGH A;  1H0M A;  2NS8 A;  2ZC2 A;  3K4L A;  3KZY A;  3QP6 A;  4LD5 A;  2JA6 J;  3I55 I;  3HC7 A;  1HBX G;  2H1K A;  4IHT A;  1L3L A;  5CVJ A;  3H3V K;  1G3W A;  2A6H F;  2L0K A;  3P7N A;  1B8I B;  1U9O A;  1W7P D;  4FE7 A;  3RJP A;  5KAI C;  1LJ9 A;  1D0Y A;  2ZJR F;  2VC0 A;  1T2K A;  3K2A A;  2DA1 A;  3HSF A;  1V4R A;  4YII A;  2B63 J;  4IOA F;  4MEX F;  4I2O A;  2W1O A;  2RV8 A;  2NNN A;  3E1S A;  2LKP A;  1D8K A;  2H09 A;  4U7B A;  1D3Y A;  1YIO A;  3V4G A;  1VQ6 I;  2PX9 A;  5DEQ A;  2OPT A;  2FQ4 A;  4P5O A;  3TOB A;  5DUI A;  3CC7 I;  3GYH X;  2LY9 A;  4P1W A;  1IXR C;  2BY1 A;  2BVM A;  3JRG A;  1ON1 A;  4TV7 A;  1W1W E;  3FMS A;  4Y17 A;  2HOE A;  3OV8 A;  3CCV I;  1SFK A;  2FBK A;  4XKV A;  3OYH A;  1AOY A;  4CCO A;  2FRH A;  2VKH A;  1O7L A;  1LVK A;  4HF0 A;  4DZP A;  2P7C B;  1TWG J;  3U21 A;  3C18 A;  4E7S A;  4PSW A;  1YJN I;  2R7D A;  4BUP A;  2COM A;  2IS4 A;  4A6E A;  2CH0 A;  1D1C A;  3GFJ A;  3H92 A;  2FQ3 A;  1HF0 A;  2KPM A;  2STW A;  1XGO A;  3TP0 A;  3CCR I;  5FGM A;  1MMA A;  1ON2 A;  4MQ9 F;  1YW8 A;  3F23 A;  5IOY A;  3LAJ A;  4M9X A;  2DYR H;  2FX0 A;  2D1V A;  3IKV A;  4B44 A;  2XF6 A;  2GXB A;  2BY0 A;  1S8N A;  1B59 A;  3A0B C;  3HOW J;  1FBU A;  3HGG A;  4RGR A;  2JA7 J;  3GO5 A;  3F0C A;  4RB1 A;  1WSU A;  2GM4 A;  1YE9 A;  1YW9 A;  1OCZ H;  1QRY A;  1U9N A;  4KJZ A;  1WVR A;  3F8N A;  3ZGK A;  3JTG A;  1LB2 A;  1FX7 A;  5ED4 A;  3ABK H;  2PMZ A;  4JK1 X;  2HKO A;  1AHD P;  2V7F A;  3ZPL A;  1D0Z A;  1VI0 A;  1MNE A;  4KT5 C;  5K1Y A;  1A36 A;  2VOD A;  3CF2 A;  3PUF A;  4EJT A;  1LFB A;  1TLH B;  1JT6 A;  1EJ9 A;  4ZTF A;  1XGM A;  3BZ6 A;  2W85 A;  5KAF C;  4B47 A;  4KIB A;  4XKW A;  1E3H A;  2JZY A;  2AHQ A;  3KZZ A;  1BR1 A;  1FBQ A;  2N8G A;  3KEQ A;  4RMN A;  4BJ6 C;  3HPH A;  3G73 A;  3FMQ A;  4L9V A;  1J59 A;  4XKB A;  5HLG A;  2E2H J;  2MC4 A;  2P4W A;  5LRS A;  1BM9 A;  1RUO A;  1TC3 C;  1IJW C;  2PJR A;  5CVR A;  5C44 J;  1SAU A;  1X58 A;  5LHI A;  3TOA A;  2EB7 A;  2V1N A;  1UZC A;  2KQR A;  3K1P A;  1T6S A;  4D5C A;  5EEH A;  3AL0 C;  4QPQ A;  2JPC A;  2LP0 A;  5D5X B;  1WZ2 A;  2EZK A;  2XGD A;  4LOC A;  2MD5 A;  5J8F A;  2LYC A;  3OYE A;  3OMY A;  3BWG A;  2ADU A;  3I4M J;  1TWF J;  2O0Y A;  5DM7 F;  1I50 J;  3GZ6 A;  2UZK A;  4E7K A;  3S1R J;  1W5S A;  2VI6 A;  1Z7U A;  1XSX A;  2A68 F;  1VQ5 I;  2DA5 A;  2HU9 A;  1MBF A;  1X4O A;  1TZL A;  2DTR A;  4RM2 A;  5IT9 Z;  2DMQ A;  1JTX A;  2X0L A;  2KIQ A;  2L01 A;  1KYW A;  2ZSH B;  3CC4 I;  5FJ8 J;  3FWE A;  3J81 K;  1FNN A;  1ETX A;  2V1U A;  2WAQ N;  2WV1 A;  4MQV A;  5HDK A;  5LHG A;  5GAG J;  4FCY A;  4ZH4 F;  2QEN A;  2ISY A;  4IL6 C;  1SMY F;  1B9N A;  3EDP A;  5E8G A;  3PQJ A;  2BHZ A;  4UV8 A;  1Z3X A;  3UR3 C;  1WQ2 A;  2RQP A;  3KP3 A;  1WGX A;  4ZDO A;  4AYB A;  1SAN A;  3SDB A;  3LSJ A;  1Y0U A;  4IHW A;  1MKM A;  1YS6 A;  1XB4 A;  1ZAR A;  2ZXH A;  1YI2 I;  2FBI A;  4IQJ A;  2XSD C;  3WE3 A;  3HEF A;  3DKW A;  2M3A A;  5F08 A;  5FD6 A;  1FMV A;  2WA0 A;  4AVZ A;  3HIF A;  1WWX A;  1FWZ A;  1I5Z A;  2VJI A;  2WAF A;  1C0W A;  2P0W A;  4ZYE A;  1ETQ A;  3NAR A;  2HFH A;  3CTA A;  3PQK A;  2ZBK A;  4LLL A;  2ZJ2 A;  4DW6 A;  3E6D A;  3CC2 I;  3C2B A;  2CSO A;  3OL3 A;  3KP4 A;  2X4H A;  1D5V A;  2XGX A;  3OS0 A;  2RRE A;  5E8I A;  1JKR C;  3CCL I;  1B72 B;  1H89 C;  1I6H J;  1WJE A;  2KZG A;  2M2E A;  1B8I A;  4E7Z A;  2HNH A;  3CQZ J;  4HOB A;  4I98 B;  4NHJ A;  2CW0 F;  2ME0 A;  2BE5 F;  2LBF B;  5M5W J;  3ZMT A;  1N78 A;  3KZI C;  1EV7 A;  5EG0 B;  1FY7 A;  3GTP J;  3K4M A;  3CUO A;  4PJJ A;  3N05 A;  1NG7 A;  2ZNZ A;  4KT6 A;  4ON0 A;  2FXA A;  1NH3 A;  3H3U A;  2GLO A;  2ZXI A;  4EQQ A;  4D7N A;  3JRF A;  2FD5 A;  4U0V A;  4XLP F;  1Z1D A;  3PO2 J;  3RCO A;  4UVA A;  1F43 A;  5D8K B;  3FM3 A;  2BOL A;  3S1N J;  1AKH B;  4FE4 A;  4HV5 A;  3LQQ A;  4S04 A;  4BKX A;  1YRN A;  4BS9 A;  4R79 A;  2K9L A;  2EK5 A;  1BOB A;  3SEZ A;  4D1Q A;  1HDP A;  3AFH A;  3DV8 A;  1USS A;  3ESW B;  1GXP A;  4KYW A;  5IP9 J;  3M8F A;  4KIF A;  2AS5 F;  1J09 A;  4HG2 A;  5LGU A;  5IYC J;  4A3J J;  1X3Z B;  4CCM A;  4E7J A;  2QSH X;  3VSK A;  3H9Q A;  1KQ0 A;  3CP2 A;  4IHX A;  3VOE A;  2W25 A;  4LIV A;  4DZJ A;  1U5T A;  3IUO A;  3ECH A;  4GRI A;  1Y56 A;  2HPI A;  4L5J A;  1H88 C;  2IAI A;  3CLQ A;  2ECC A;  4KN4 X;  1ZR4 A;  2CV1 A;  4NDL A;  1VQN I;  1UMQ A;  2ACJ A;  4XN3 A;  3VSL A;  2EZH A;  3OYD A;  2MBF A;  2XKP A;  3CZ6 A;  2NNY A;  4Y13 A;  3TQN A;  4EGZ A;  2BW3 B;  3MKZ A;  1DPU A;  2VQL A;  2QWW A;  2DMN A;  3CCY A;  3N97 A;  3HHH A;  3GFI A;  1UHS A;  1LDK B;  3H3Z A;  4WCG A;  5E3L A;  2CQ7 A;  3SXY A;  3CJR B;  3DWL E;  2AXT C;  2M0C A;  4HX4 A;  4NUB A;  1ETV A;  4XBF A;  1JHF A;  1UST A;  3QOP A;  1RKT A;  1HCR A;  2CV0 A;  4CZC A;  3D5S C;  5H2F C;  3OOP A;  3TDZ C;  3I3L A;  1SD7 A;  2Z99 A;  2J5P A;  2LF7 A;  4PDK A;  1TT5 B;  3RYP A;  4XLN F;  1MDM A;  3AG3 H;  4IKF A;  4OAZ A;  2VT3 A;  3A0H C;  4LFU A;  4RGS A;  4MTD A;  4BQN A;  4N9H A;  1Z9C A;  9ANT A;  1EH8 A;  3DBR B;  4WX9 A;  2CQX A;  1XC5 A;  1ETO A;  2EA4 A;  3FF5 A;  4P55 A;  1T56 A;  2ZME A;  1G2H A;  2VQC A;  1FC3 A;  2KRH A;  1EF4 A;  1QHH D;  3R6S A;  1K61 A;  5C4X J;  1FOW A;  2RQQ A;  2JJ7 A;  4XSX F;  1SD4 A;  4ZZL A;  5HOD A;  3HKZ A;  4BJT A;  4BQA A;  5FD5 A;  2KT0 A;  1XDS A;  3GFL A;  5TIS C;  2XHK A;  2X6Y A;  3OYG A;  1F36 A;  1NG6 A;  2HWV A;  3CUQ A;  1VFC A;  3OYI A;  2E1M C;  2PQ8 A;  1LDD A;  2FOW A;  4Q47 A;  5LD2 C;  5E18 F;  2VKD A;  1I1S A;  2HOA A;  2M1B A;  2DJN A;  3GF2 A;  4LB6 B;  2XIG A;  3LNQ A;  4U88 A;  2JA2 A;  2LY2 A;  5IT9 K;  3V42 A;  1U5T C;  1MBE A;  4BXX J;  4Q48 A;  2NYX A;  3GWZ A;  1HW5 A;  4IHY A;  3FKI J;  1LVA A;  4HAM A;  1S29 A;  2OV7 A;  2OU2 A;  3M3Y J;  3HPG A;  4PSX A;  3L2V A;  1WJA A;  3J7A O;  2E34 A;  1R5I D;  4B3A A;  3LFU A;  2MA3 A;  1HLV A;  2OA4 A;  1S3J A;  1R1U A;  3DFG A;  2R7Z J;  3QOD A;  4BY7 J;  4D9J A;  5KNL A;  2KIF A;  2LKS A;  2HI3 A;  3F8C A;  4LGW A;  3K70 D;  4BE2 A;  4BXU A;  4KMF A;  2KZV A;  3CO7 C;  1QU3 A;  2IBD A;  2DTZ A;  4ASN A;  2X1E A;  2R7W A;  1IRX A;  5GPC A;  5E3N A;  1JUP A;  2F6C A;  2AO9 A;  3BZC A;  2ZXW H;  4A3M J;  3MZY A;  2DA2 A;  1K4T A;  1YFH A;  4C3H J;  2EIL H;  2PLY A;  3PIO F;  5J1Y A;  1ZLK A;  3TW6 A;  2AQE A;  2EJR A;  1QBJ A;  4FET A;  5F0C A;  1T39 A;  3Q9V A;  3S17 J;  1G59 A;  2OD5 A;  4M3E A;  4J01 A;  2V9V A;  2VQH A;  1FOK A;  1HA8 A;  4ZC3 A;  1OCR H;  3BPX A;  1X1P A;  2FOK A;  2M0M A;  3SZT A;  3PM1 A;  2ZME C;  5IOZ A;  1BL0 A;  3B6C A;  4YRV A;  4EJW A;  1IDZ A;  1T0F C;  4KN7 X;  2PBI A;  1ZH5 A;  4I0A A;  1X3U A;  3IHU A;  3BPV A;  4DYC A;  1LEA A;  3OYK A;  2ZB9 A;  3FK7 A;  2FA5 A;  1O3Q A;  2CUF A;  1MMN A;  1KA8 A;  1B72 A;  2E71 A;  4LIT A;  5HNH A;  1GVD A;  4LG3 A;  2A61 A;  4EJO A;  3CUQ C;  2ZNY A;  3CCQ I;  3GTK J;  2K27 A;  3VB2 A;  3E3V A;  2LBF A;  5FKO A;  5J4Y A;  1QZZ A;  1XPX A;  3A4C A;  5EG0 A;  1VQK I;  5DDG A;  2L2O A;  2W7N A;  3ZQQ A;  3JRC A;  2GIV A;  3A1Y A;  2IA0 A;  4BHP A;  2XPW A;  4YFX F;  2QLZ A;  3IWF A;  1A5J A;  4UUV A;  1FYL A;  4AM3 A;  1IXC A;  1RC9 A;  4HW0 A;  1AKH A;  2KDZ A;  2CGP A;  1Y39 A;  3I53 A;  3ONQ A;  3AL0 B;  5F1R A;  5B66 C;  1B9M A;  4J19 A;  1VND A;  4BEH B;  4ENK A;  1FP2 A;  3BZK A;  4RBO A;  5J47 A;  4K2E A;  4HV6 A;  3MFK A;  4L18 B;  4AUX A;  1W7P B;  3PFI A;  4B8X A;  2WB1 A;  1VTN C;  2GXG A;  1RET A;  3VOD A;  1YYV A;  2QQ9 A;  3GLX A;  2WY8 Q;  3F8B A;  2RNG A;  3ZN0 A;  3T5X A;  3PJR A;  3OIP A;  2R4G A;  4NQW B;  4P9U A;  4G12 A;  2IGM A;  3E6M A;  4BHB A;  1S7A A;  1RKW A;  2H6C A;  1FSH A;  4II3 A;  3KCC A;  2IP2 A;  5HS9 A;  2LK2 A;  2XF5 A;  2XRO A;  2JQ7 A;  2CUE A;  2IW5 A;  1A35 A;  1LUJ B;  5AIP A;  2DT6 A;  2IGK A;  1FJL A;  2CV2 A;  4PZJ A;  4XKC A;  1ZKG A;  1S9H A;  3WHC A;  1LNW A;  2KKO A;  3K4B A;  1YIT I;  3IC7 A;  2BW3 A;  2KFD A;  4CYD A;  1H9T A;  1PUE E;  1YOV B;  2VAS A;  3PNT A;  4Q5S F;  1IUY A;  3I5U A;  2LFB A;  2ESH A;  3V8L A;  1X4P A;  2I5U A;  4U87 A;  1VQL I;  4A3E J;  4KDP A;  1T38 A;  5C4J J;  2VPL A;  3IH3 A;  2GA1 A;  3H5N A;  2LSO A;  1GV2 A;  2E5N A;  1SD5 A;  4II2 A;  1GV5 A;  5DCF A;  1R36 A;  4A3C J;  1O57 A;  1UCR A;  2FBH A;  2RC4 A;  2Y48 A;  3HRU A;  2M87 A;  4MFE A;  1BOA A;  4A5N A;  3R60 A;  3ZMU A;  2TRT A;  2B0L A;  2L7K A;  2GIZ A;  4FQG A;  1TT0 A;  4NC8 A;  1UB9 A;  5JHF A;  4O3M A;  2R7R A;  2X51 A;  1PJR A;  3AG1 H;  5B1A H;  4OIP F;  3V7R A;  1JXS A;  3TMO A;  1PP8 F;  5DCM B;  1BC8 C;  1K78 B;  1BIB A;  2O7O A;  4WWC A;  3OSF A;  1XN7 A;  2K40 A;  2XPU A;  3BR1 A;  2OQR A;  2BY3 A;  2F5F A;  3F6O A;  4ZYH A;  3GME A;  3BTL A;  3LL7 A;  1ZGJ A;  3ELK A;  1TQI A;  4IHS A;  2R92 J;  2VT2 A;  5TRD A;  2R3S A;  3NRV A;  4HLX A;  3S15 J;  4QSH A;  2E7X A;  1AU7 A;  2HQR A;  4S05 A;  1XGN A;  3OL4 A;  4Q4Z F;  2M4K A;  1XSD A;  1P9Q C;  5H6Q A;  3MZ8 A;  3J7A Y;  3R4K A;  2V6C A;  3OYA A;  1PP7 U;  4D5F A;  1G8X A;  2I8D A;  1IN6 A;  1XCB A;  3MEX A;  1KU2 A;  2LH9 A;  3M07 A;  1SEU A;  2BHY A;  3G1L A;  5ICE A;  1CGP A;  3K0L A;  3OR1 C;  3KPH A;  4MO7 A;  4RLQ A;  4BYY A;  1HOM A;  1ZGW A;  3QYB A;  2QQA A;  4ZJZ A;  2P81 A;  2K7L A;  3CD6 I;  1QZY A;  5IYD J;  2A05 A;  2BGC A;  5IP7 J;  2ID3 A;  3K69 A;  3CME I;  5FRO A;  2R93 J;  2XGC A;  4A0X A;  1SFO J;  2L54 A;  4DYQ A;  1BI0 A;  3ZQL A;  2FMY A;  3S1M J;  2CO5 A;  2FF4 A;  2OCE A;  4RDU A;  1IN5 A;  2HXI A;  1YHQ I;  1TTY A;  2DJI A;  2NS0 A;  1N77 A;  3ZQC A;  1E3P A;  3DKX A;  5GPA A;  4IX7 A;  3HOU J;  2IGO A;  2L7F P;  5D6F A;  2A6T A;  1LFU P;  2HQN A;  4HF2 A;  5FRN A;  3MKW B;  2Q2E B;  1ONV A;  1U0J A;  1VQP I;  5J1R A;  1T98 A;  1Y8R B;  4O6J A;  4HF1 A;  5GAE J;  3TL4 X;  5ICC A;  4L0Y B;  3BC8 A;  2G7U A;  3LAP A;  1ITY A;  3QU3 A;  4PJN A;  5A2Q K;  1BC7 C;  2K9M A;  2JSC A;  3MQ0 A;  4OIO F;  3K7A J;  3GTG J;  2X1C A;  4ANJ A;  1JT0 A;  1XS9 A;  4LG0 B;  2ID6 A;  3EET A;  3BRO A;  1BR4 A;  3QPT A;  2Q1Z B;  4IXA A;  3ZMV A;  3GVA A;  3TGN A;  1TNT A;  5H20 A;  5D5W B;  3BTC A;  5DM6 F;  2R7U A;  1UHM A;  3ASO H;  3BTJ A;  3FBI B;  2XAU A;  1K6Y A;  1YW7 A;  4HNV A;  1SVM A;  1WHU A;  3AG4 H;  4MHG A;  5GP9 A;  4GCV A;  3H35 A;  4FIS A;  4BBR J;  1ZAO A;  3ASN H;  4XID A;  5ERI A;  4IRI A;  2LR8 A;  3V8K A;  3DLL F;  1G4D A;  3E6B A;  4AD9 A;  1DU0 A;  2LF8 A;  1R58 A;  2O8K A;  5D6E A;  5HLI A;  2JRM A;  4ZDL A;  2GOM A;  1CF7 B;  1U8R A;  4Y52 J;  3JRH A;  2W48 A;  3BTI A;  4AIK A;  3D5R C;  3HOT A;  3L09 A;  2D2W A;  4BY1 J;  3RZO J;  1YRN B;  1BJZ A;  1MJB A;  2OTJ I;  4MGR A;  3J7Z I;  4YG2 F;  2XB5 A;  3DQV C;  5ILS A;  4AID A;  2E1M B;  3HJE A;  3DKY A;  4CO8 A;  5FLV A;  2NVU B;  1U2W A;  3KLN A;  2BVL A;  4BEH A;  1OMI A;  3PSI A;  4QIW N;  4NNJ A;  5EGO B;  2DFF A;  2VUM J;  3PUB A;  3V8J A;  1U5T B;  2KP6 A;  4FT8 A;  2BYV E;  1VQ7 I;  4G7O F;  2XSJ C;  3SJM A;  4IVN A;  3FIW A;  1W7P A;  1HDD C;  2K85 A;  3PO3 J;  1R4N B;  3LSR A;  2M34 A;  2VJ5 A;  3I9V 2;  2H27 A;  1GXQ A;  1UEL B;  3LWF A;  2PMZ N;  4NQW A;  4U0W A;  2KLO A;  4HNU A;  4I6Z A;  1IW7 F;  1FOX A;  5J1U A;  5CQE A;  2JK3 A;  4XIC A;  4M6Y A;  4MFD A;  4BL0 B;  3M1C A;  4BGD A;  3RKY A;  4A3K J;  3DU5 A;  5AON A;  3LST A;  3K4K A;  3MWM A;  5F0H A;  3RIR A;  2HDD A;  1OCP A;  3CMY A;  1OYY A;  2PI0 A;  3MVP A;  2YU9 J;  2DLL A;  3JTH A;  2OQG A;  4MNU A;  2XPV A;  2XRN A;  4A5M A;  2R7Q A;  2HZT A;  3P9I A;  3O8H A;  2ZJQ F;  3EYY A;  3CMA I;  2DBB A;  2QCO A;  4ZDP A;  3JSP A;  1U8B A;  1MMS A;  2CW8 A;  3L2Q A;  3K6G A;  2Y0S A;  3M7G A;  1MDM B;  2QQB A;  3BJ6 A;  1V5E A;  1RUN A;  4GO1 A;  2HTS A;  1SC7 A;  5DD8 A;  3I54 A;  3IP4 B;  4C3J J;  2K5C A;  1XMX A;  1K79 A;  1O3T A;  4NC7 A;  2L9R A;  3D0S A;  3QPS A;  3KFW X;  4B43 A;  5EYR A;  2ZME B;  1MBG A;  5JLW A;  2FJ1 A;  3QQA A;  3CP8 A;  3DBH B;  2CUJ A;  3I58 A;  2VBZ A;  2X6W A;  5BPD A;  1F9N A;  5CLS A;  4XRM A;  1FPQ A;  4HSR A;  4A0Y A;  2W57 A;  2V1X A;  3BG9 A;  2EFW A;  5DCM A;  1K78 A;  2FUG 2;  2ZKZ A;  2HEO A;  3S2H J;  1MH4 A;  1KU7 A;  2STT A;  3T8R A;  3DTI A;  3CUQ B;  2A3S A;  1Z05 A;  3TW7 A;  4RB0 A;  1ZR2 A;  2WC2 A;  5EEA A;  2Z1D A;  1JKO C;  2DXI A;  2HVR A;  2EQR A;  3E5U A;  1V54 H;  2DAO A;  4FX0 A;  2HVQ A;  2DA4 A;  3S3N A;  2EV0 A;  4RGX A;  2XGE A;  5DYM A;  4BH9 A;  4HDU A;  1R4M B;  4PJM A;  4P9F A;  5FB2 A;  2OF7 A;  3H5R A;  4P96 A;  2I10 A;  4RGU A;  1BW5 A;  4ZYG A;  1HST A;  2ZXJ A;  1QVT A;  4AYB N;  4G7H F;  2LLK A;  3BG7 A;  1OYI A;  4A2U A;  4C2U A;  1J0R A;  2XUB A;  1IF1 A;  1BI2 A;  2F4I A;  4WK8 F;  2M9H A;  4XOP A;  4E7H A;  3ZRG A;  1JGS A;  5TJJ A;  3QP5 A;  1O3R A;  4V2G A;  2DMU A;  3IRQ A;  1A6Q A;  3QAH A;  1XGS A;  5L3D A;  5B1B H;  3HYI A;  4GYI A;  4E6K G;  1HQC A;  2Y0M A;  3B02 A;  2G7H A;  2KJC A;  3F9K A;  4UUS B;  3JSO A;  4QWQ A;  3ABT A;  2Q2E A;  2PG4 A;  2VQG A;  1ETK A;  2Y9Z A;  1IV6 A;  2OZ6 A;  3HZJ A;  5JI6 A;  2DOE A;  3DF8 A;  5TGT A;  3WOD F;  2OCC H;  1FP1 D;  3QWL A;  2Z33 A;  1ZLJ A;  3E5X A;  4A3G J;  3S2W A;  2HXO A;  5LEJ A;  2O03 A;  3JW4 A;  4LG0 A;  1JJ8 C;  5HDG A;  4KUM A;  1Y6I A;  3I59 B;  2CFX A;  6PAX A;  1QO0 D;  2M8G X;  5EEG A;  2BBY A;  4UUT A;  4DIQ A;  2LD5 A;  1ETY A;  4XQF A;  3S2D J;  1TWH J;  2K9N A;  1FT9 A;  5BS6 A;  2JTV A;  4N4O B;  3QYF A;  2JMW A;  3F6V A;  5LFA A;  2ELJ A;  2GBY A;  3CCU I;  2XAJ A;  2BXZ A;  3DPT A;  3JCU C;  3Q3S A;  4OOI A;  5JLX A;  1RR8 C;  3DTE A;  2LTP A;  1HKS A;  1Z6R A;  2K4J A;  2CQN A;  3D5L A;  1XTA A;  2HQA A;  2ETH A;  4NBQ A;  4XSZ F;  1CF7 A;  2NVX J;  2VOO A;  3DCF A;  3HUG A;  5EF6 A;  2VXD A;  1TL8 A;  1EKE A;  1J9I A;  2WV0 A;  1ZHF A;  1RZ4 A;  1MNM C;  2QQ8 A;  3H0G J;  4L5I A;  1XG1 A;  1YJW I;  2L9V A;  3RKQ A;  3Q0W A;  1IUF A;  1MZB A;  2OJE D;  2L9S A;  1UFM A;  4G94 A;  3LSP A;  3WGH A;  4YEL A;  4DNC A;  5EGO A;  2BEO A;  3G1O A;  3RYR A;  5FO5 A;  3KLO A;  3W2W A;  4BU2 A;  2J5O A;  1Z6T A;  3G2B A;  2DI3 A;  3U1K A;  3ML6 A;  3SFI A;  4GDF A;  1GVJ A;  5CYV A;  3RZD J;  5FLX Z;  1ZRD A;  3GX4 X;  2VC1 A;  4XNF A;  1F5T A;  1YG2 A;  4XRS A;  2NXN B;  2QSG X;  1R1T A;  2XAF A;  3ZN1 A;  3DP7 A;  1E0E A;  5E1X A;  3VDX A;  1JHH A;  1S72 I;  3CES A;  4IEJ A;  2H94 A;  1HXD A;  3LFK A;  4CYC A;  2OTL I;  5LLQ A;  4XLA A;  2E19 A;  1UJ8 A;  2VBW A;  1IN7 A;  4W1U A;  3GTO J;  3OWT A;  2PJP A;  2FNP A;  2VON A;  2Y69 H;  3KP2 A;  2EIJ H;  4RLF A;  1CQT A;  2UWM A;  1ZRC A;  1UG0 A;  4I01 A;  2RNJ A;  4HNT A;  5L3C A;  3GTM J;  5LGT A;  2JUG A;  2P7V B;  2DOA A;  4XL9 A;  2LKX A;  3MKY B;  3HKZ N;  4BE0 A;  3NEU A;  3I4N J;  1KU9 A;  1WPK A;  1IC8 A;  2B9S A;  1FYM A;  2DN0 A;  2F48 A;  1H8A C;  4M3B A;  1IRZ A;  2GOX B;  5J3L A;  3M9A A;  3A01 B;  3JRA A;  1T0F A;  1ENH A;  3OIQ A;  5EZG A;  4MLO A;  3ZP5 A;  2DO7 A;  3OYN A;  2KRF A;  5FFZ A;  2HYF A;  4L0Z B;  2GZW A;  4L9J A;  4LK1 F;  1KGS A;  1JUS A;  2M7A A;  3VYU B;  2E1O A;  2H8W A;  3G6E I;  1HKQ A;  4YIF A;  2LVS A;  1W4M A;  4N4N B;  1MH3 A;  1XCV A;  2XKO A;  2NVT J;  4XOT A;  1I6X A;  4E4H A;  3D1N I;  1X1A A;  2EZI A;  3CJN A;  3ISP A;  5F6F A;  3WGG A;  3BG6 A;  1OFC X;  4NB5 A;  2P5K A;  3BR3 A;  3SEQ A;  3JAM Z;  2E1C A;  2DK5 A;  4YFK F;  3C7J A;  3J80 Z;  2EA2 A;  3IV5 A;  3FX3 A;  2IA1 A;  1S7E A;  1ZYR F;  2EIN H;  3DPL C;  3OYF A;  3BLY A;  2W00 A;  3TED A;  1KYZ A;  3FDY A;  2NOG A;  4XN0 A;  4IOC F;  3TBI A;  2ZJP F;  1OR7 C;  4NC6 A;  2VL8 A;  2XAG A;  4CDG A;  5LGN A;  4JBA A;  2EH3 A;  5KVR A;  2Q8K A;  1MND A;  2M4G A;  1X1D A;  1DGW Y;  1QPI A;  5D5V B;  3T8T A;  4I09 A;  1UHW A;  2D1H A;  4F93 B;  4AIH A;  1NTC A;  1KQ8 A;  3JRE A;  2DW4 A;  5DV5 A;  2B7E A;  2CU7 A;  2VXZ A;  3KX2 A;  5K5Q A;  3T0Y A;  2GA2 A;  3QPH A;  4RAY A;  2MLK A;  2MLG A;  3HG9 A;  2W82 A;  2KJB A;  5KCM A;  4DOZ A;  3G3Z A;  1Z77 A;  4YFN F;  1Z21 A;  4C9Y A;  2ZFW A;  4N9I A;  1ZRF A;  4UUS A;  3CCJ I;  5DTD A;  4RB3 C;  2DOF A;  3F21 A;  2JT1 A;  4G6Q A;  2K9Q A;  2OBP A;  2R5Z B;  4PK4 A;  3WG7 H;  3BCB A;  2QM3 A;  3F8M A;  4OU0 A;  4L9T A;  4B3X A;  3TO9 A;  3S8P A;  5BNG A;  1QZE A;  1RES A;  2Y2Z A;  5EDN A;  3O6B B;  5FFX A;  1LKX A;  3DU6 A;  3EUH A;  3RQ4 A;  3HB9 A;  2EZL A;  3OYB A;  2R0Q C;  1TQP A;  2FML A;  3WU1 B;  4ESJ A;  3I59 A;  4QPO A;  2DQR A;  2HYJ A;  1R6R A;  3GEZ A;  3Q0V A;  3TDU C;  4HST A;  3BDD A;  3HOZ J;  4X0G A;  2DFE A;  4UVC A;  1HW1 A;  2CS3 A;  4OWR B;  3K4J A;  3QU6 A;  3CO6 C;  1PYV A;  2DMT A;  1WCM J;  2EFP A;  1R23 A;  5KHD A;  1YS7 A;  4WXH A;  1OJL A;  3DTK A;  4ABZ A;  4V19 K;  2XVC A;  3QOE A;  2LRD A;  2WB1 N;  2DT7 B;  4DGW B;  4U7D A;  4D7M A;  2DU9 A;  4WXC A;  1I3A A;  5B5E C;  5K7H A;  2R7S A;  2O61 A;  4DBR A;  4A3F J;  1S7O A;  1OCO H;  5CPR B;  1VQ4 I;  1D5Y A;  2P5L C;  1QNT A;  1OQY A;  4EM0 B;  1OIS A;  1ZG3 A;  4BAY A;  4ETS A;  1JI8 A;  2Q0O A;  3LQR A;  2GQQ A;  2AXL A;  2TCT A;  3LSG A;  2EWN A;  1ZEL A;  2DA3 A;  2MGQ A;  4G9Y A;  1B6A A;  4CCL A;  3KP6 A;  5FLX K;  4I0B A;  1WJD A;  2XAH A;  4JOM A;  4F91 B;  1IRF A;  4YIR X;  3WTV C;  2RN7 A;  5C3E J;  4G8X A;  2IA2 A;  4ESF A;  4UNO A;  1GLN A;  2VIX A;  1SFE A;  4ENM A;  4RA2 A;  4UV9 A;  3SZP A;  4JX6 A;  5LRR A;  2OAZ A;  3AKZ A;  2O8X A;  3HRT A;  5ILV A;  3K1M A;  4EGY A;  2P5V A;  1BI3 A;  3M8E A;  5F0F A;  3OYC A;  3I56 I;  4LK0 F;  2L7M P;  2JPB A;  4IPA A;  2X6X A;  2HKX A;  3CF5 F;  1IN8 A;  2IS1 A;  4L9N A;  1W36 C;  2Y75 A;  1MBH A;  3WTZ A;  5HDN A;  4RAG A;  4KFC A;  2L9N A;  1FIP A;  1DP3 A;  3EUH C;  4LLG F;  1Z67 A;  2HS5 A;  2MFZ A;  2HR3 A;  3ZR8 X;  2IS6 A;  1AA7 A;  3N4M A;  2K86 A;  3MCZ A;  5GAH J;  2XC7 A;  3WU2 C;  3ULQ B;  5L3G A;  3E0J B;  3ROU A;  4AWX B;  1IG7 A;  3HTU A;  3CDI A;  4HQM A;  1BR2 A;  1QVU A;  5HVQ C;  3L2W A;  1TQM A;  3BCA A;  4FAS D;  3PNV A;  1LE8 A;  2E7W A;  2F2E A;  2ICW G;  2MYS A;  1GT0 C;  1WJB A;  3O8G A;  4HX8 A;  5JR3 A;  4BHC A;  3UKG A;  3KIO A;  5ICG A;  1APL C;  1Y1V J;  3GUD A;  1BN5 A;  2XAS A;  4ZTJ A;  3A01 A;  2NRA C;  3EPZ A;  2X1D A;  2GWR A;  4S0H B;  3M8J A;  4RB2 C;  2EIK H;  2BXY A;  2DDB A;  4PGG A;  1RPW A;  2EPF A;  3E6C C;  1JJ6 C;  2QKM B;  1X1B A;  1KON A;  3HDD A;  1DDN A;  3SFZ A;  3OYM A;  2PEX A;  3RTR A;  3JRB A;  2E35 A;  4R8H A;  1A6I A;  1POG A;  1KZH A;  5M3M J;  5M3F J;  2XV4 S;  2XF7 A;  1P7I A;  2PFB A;  3E97 A;  3NQO A;  2CYY A;  1Y1W J;  1I1G A;  4F7Z A;  3FXK A;  2Z3Y A;  4WXD A;  2QSF X;  1WFX A;  3COA C;  5JFR A;  1PVE A;  3S16 J;  2O6G E;  4A93 J;  1IZ1 A;  2ME6 A;  1R7J A;  4RAZ A;  3LOC A;  3GCM A;  3K1N A;  5JHU A;  4E70 A;  5E20 A;  1XX5 A;  4AIJ A;  2UXX A;  2LY1 A;  4OAY A;  4A3I J;  2ZSI B;  3RSN A;  2UUZ A;  1BI1 A;  1R71 A;  2A07 F;  2G9W A;  4XMY A;  4UHT A;  4KMU X;  2LOO A;  4GGG A;  4A69 C;  3IRR A;  1XMK A;  3FXJ A;  4O5V A;  2Z16 A;  3K4C A;  3L9F A;  3VEP A;  5LEK A;  5FRM A;  3PL8 A;  4JQF A;  1YX5 A;  1WH7 A;  2IPQ X;  4XR6 A;  3HXL A;  3ZXS A;  2RKH A;  2MSY A;  2MAB A;  4C2M J;  1T08 B;  4JX5 A;  2IXS A;  3KYL A;  4IO9 F;  5ILU A;  1ZTR A;  3E5Q A;  2OC6 A;  3B73 A;  5K5R A;  2JA8 J;  2R5Z A;  4Y33 A;  4M74 A;  3NWT A;  1IXS B;  3EUA A;  4PFP A;  5D4S A;  2JA5 J;  3P9K A;  3R0A A;  1VQ8 I;  4CXF A;  3H9G A;  4OMZ A;  1X2M A;  2O5R A;  2ECB A;  4EEF G;  4DQ2 A;  1P6R A;  2IRF G;  2WWY A;  1P4W A;  1U78 A;  2EBI A;  3HRM A;  1SMT A;  4R1H A;  3L7W A;  3LSH A;  1D0X A;  5GTH C;  2ZFU A;  4J00 A;  2DQL A;  1WJF A;  1Z7L A;  1K83 J;  3FXU A;  3GBG A;  2QYO A;  4HZF A;  3W2V A;  3T1B A;  2BY2 A;  5F27 A;  1G3S A;  4N0B A;  1W5C C;  1FTT A;  1B4A A;  2E5Z A;  3H1C A;  2HPM A;  4EVI A;  2HGC A;  2RVC A;  2YX4 A;  3GZN B;  2COB A;  3HUG B;  4CHU A;  3SHF A;  1OCC H;  4PUS A;  3HM5 A;  1TWC J;  2IS2 A;  4PFO A;  4KIT B;  1MBJ A;  4XLF A;  1YQA A;  4YEJ A;  2W24 A;  4C30 A;  1IO2 A;  4BQO A;  2QA4 I;  5D8L B;  5HLH A;  1J5Y A;  1ULY A;  2CMP A;  3SDG A;  5CVI A;  4CZZ A;  2JN6 A;  2ZCW A;  5K5O A;  4E7L A;  1HSJ A;  4MEY F;  2HDW A;  2M8E A;  3BR6 A;  3MN2 A;  4FHT A;  2RAE A;  2UV1 A;  4HPQ A;  5CVV A;  1MJA A;  3WU0 A;  4AC0 A;  2Y0S N;  3C2H A;  2P6S A;  3K4N A;  5E1W A;  1ZN2 A;  3KET A;  2EV6 A;  1UAA A;  1WRJ A;  2R5Y B;  1D1A A;  2JUC A;  1Y8Q B;  2CQK A;  2YR2 A;  3I71 A;  4UXN A;  4CYC B;  1G3T A;  3VFZ A;  1VQ9 I;  1MGT A;  3OR2 C;  3KP7 A;  2L4M A;  4ITV A;  3H36 A;  2HZD A;  4LJZ F;  2L5Q A;  1TBX A;  3ERE D;  3KEY A;  2IVM A;  2CWE A;  4E7I A;  3FIS A;  1FIA A;  2DFH A;  5FKL A;  1IV8 A;  4ENJ A;  1IAW A;  1E17 A;  1WI3 A;  4LLN A;  1MMG A;  2M7B A;  2HDC A;  1XSV A;  2Z9O A;  4L5E A;  3JR9 A;  2EIM H;  2TDX A;  4OMY A;  4KIC A;  1UG2 A;  4MTE A;  1O3S A;  2HQ5 A;  3K9T A;  2ELH A;  1MBK A;  5L3B A;  2CW7 A;  1T33 A;  3ZQ7 A;  2GAU A;  3QYE A;  4GFB A;  4F3Q A;  1Z91 A;  2XRL A;  5CQG A;  2X85 A;  1MIJ A;  1FEX A;  3KP5 A;  3FXR A;  2R7V A;  2K02 A;  2DPU A;  4PJL A;  2V1D A;  2R7X A;  2QVO A;  3HTS B;  4QTR A;  1MSE C;  2F5V A;  4XM3 A;  3WTY C;  2V9K A;  2WBM A;  3V7S A;  1J75 A;  3DPU A;  3VWB A;  4ENN A;  4GXO A;  1K6O A;  1WI9 A;  4IF4 A;  2K4B A;  3ZQG A;  1X1C A;  2QKL B;  1A04 A;  3L2U A;  1PDN C;  4IQ4 A;  4QLC U;  1U6G A;  4DBQ A;  5JVG F;  3BY6 A;  3VYR B;  3S1Q J;  3AG2 H;  4A12 A;  1P7J A;  1WH5 A;  2Y30 A;  3BR0 A;  2K9S A;  5BPI A;  4WF2 A;  2FNA A;  4XOR A;  4CIC A;  1ZG5 A;  5DUK A;  2K3P A;  2MC3 A;  5FLM J;  2ISZ A;  2L7Z A;  3ABM H;  2DCE A;  2VPR A;  5F04 A;  1MW7 A;  2FU4 A;  1EA3 A;  3EQL F;  4M73 A;  1QA6 A;  1O7F A;  2F5C A;  2HOS A;  2D45 A;  4F55 A;  2UXN A;  4X6A J;  3MKL A;  4MIM A;  1IDY A;  3O3K A;  3ZMD A;  1WKM A;  1Z3Y A;  3H5A A;  5CJ9 A;  1LDJ A;  2QZ8 A;  5CVU A;  2LG4 A;  4EM2 A;  1N75 A;  4BAC A;  5D5U B;  2FE3 A;  3M1E A;  4DJA A;  2CQQ A;  5IPA A;  5IYB J;  2BV6 A;  1F4K A;  4BNC A;  1TW3 A;  4IRH A;  3FHN A;  4XLC A;  2ZO4 A;  3MAJ A;  5ICF A;  4OIN F;  4XON A;  3KE2 A;  3F72 A;  2KIS A;  4Y4R A;  4CCK A;  4ZYA A;  3BJA A;  1YIJ I;  3W3C A;  1T8I A;  3ZCO A;  1MD0 A;  4CH7 A;  2Z2S B;  1ZQ3 P;  1P2F A;  3CJQ B;  4A3L J;  3HSR A;  2KL4 A;  2BZT A;  1I27 A;  1FZP B;  1YLF A;  3S3O A;  1K7A A;  2DA6 A;  1KU3 A;  1HC8 A;  4M3D A;  4ESB A;  1IRG A;  3L1P A;  3FBN B;  4LIU A;  4M71 A;  4IJA A;  3PIP F;  2WAQ A;  1K4S A;  2XDV A;  3WTS C;  3WTW C;  3L00 A;  3LA2 A;  4M9Z A;  2C6Y A;  1ORK A;  3SQN A;  4BDZ A;  2HOT A;  3QRF F;  3QPL A;  2QF7 A;  3CDH A;  3WG9 A;  5BQT A;  5L3E A;  3IAM 2;  4EMS A;  4A3B J;  3E7L A;  1Z0X A;  5DD4 A;  5GTI C;  1F1Z A;  1GDT A;  2WAE A;  3OS1 A;  3GZ5 A;  1JKQ C;  2R7F A;  5M5X J;  3MMY B;  1QQI A;  4KA4 A;  4EJU A;  3OYJ A;  1NK2 P;  3I4P A;  3PSF A;  3JRD A;  2VKV A;  5F1J A;  1W0U A;  3FXQ A;  3KYC B;  4G6D A;  3CJT B;  2O9L A;  3L2R A;  1GHC A;  2OUM A;  1RNL A;  2M5W A;  3LA7 A;  4UY8 I;  5HOO A;  2NVY J;  4EJV A;  3FM5 A;  5HS7 A;  5K7F A;  3A02 A;  3WHB A;  1OR7 A;  1ZK8 A;  2VBX A;  3TO7 A;  4XK4 A;  3FMR A;  1PUF B;  4V2F A;  1WJ5 A;  4Z2Y A;  2F4O B;  5E79 C;  4ZZD A;  5D4R A;  3WGI A;  2W4S A;  4G6T B;  3S14 J;  4JYK A;  3RKX A;  1LEB A;  1V55 H;  2VE8 A;  2F5D A;  1ETW A;  3WTT C;  2VOP A;  2Y31 A;  3W6J B;  3W6V A;  1E3O C;  2R5Y A;  1G6N A;  1NK3 P;  4Y15 A;  1T95 A;  4BBS J;  1IN4 A;  1RI7 A;  3DLA A;  3G4S I;  1OPC A;  1BW6 A;  4I76 A;  3DEU A;  3REO A;  1DP7 P;  3OYL A;  1BIA A;  4B4C A;  1D1B A;  2YU3 A;  4RM3 A;  4ZYD A;  4F52 A;  3PFY A;  3S32 A;  2RGV A;  3VPR A;  1BJA A;  4BJ5 C;  5FKM A;  2DA7 A;  2E60 A;  4IZZ A;  2G0E A;  2LDU A;  1LE8 B;  1A31 A;  4Y3O A;  2K3F A;  1MMD A;  4A0Z A;  2X9D A;  2E1N A;  2KDO A;  3C2G A;  2H6B A;  4C2T A;  1VQM I;  1R22 A;  5IY5 H;  1ZRE A;  3UNG C;  4F92 B;  5BMZ A;  3FXM A;  2DYS H;  5E3O A;  3X2Q H;  5E3M A;  4XLE A;  1U3E M;  4H4K C;  4Y7N J;  1WJC A;  3DBL B;  5FKN A;  2QGU A;  1J7K A;  2YPR A;  4EV0 A;  5L3F A;  3GTL J;  5EJC A;  2VB6 A;  1G3Y A;  3TO6 A;  3HHG A;  2CUZ A;  3HGY A;  3KEO A;  2YUS A;  2CFO A;  5F64 A;  1MJ9 A;  2LMD A;  3WTU C;  3I0T A;  4M9S A;  2Z5U A;  3IAS 2;  2X48 A;  2QEX I;  2V6E A;  3Q9S A;  3CMM A;  4CSW A;  1YX3 A;  2A5W A;  2AQF A;  3K2Z A;  4CGZ A;  1W36 D;  1W5T A;  3FHZ A;  3FKJ A;  1DPR A;  1P4A A;  1J2X A;  1SFX A;  2DDA A;  2KHM A;  3O2P E;  3RI4 A;  2RDP A;  3PNY A;  5BOX A;  3RQI A;  1LQ1 A;  2R7T A;  1Q1V A;  3LSM A;  3LSK A;  1YJ9 I;  4IHV A;  3Q5F A;  1JE8 A;  1TP4 A;  3FXL A;  4M72 A;  4B48 A;  3A03 A;  3GLL A;  4HLY A;  1X2N A;  4M3G A;  3VYT B;  2D5V A;  5GAD J;  2YS9 A;  2CG4 A;  5HNF A;  1FLI A;  3S3M A;  1BBY A;  1OLT A;  2MG4 A;  3CDL A;  5EZH A;  1EH6 A;  1SAX A;  2QBY B;  2VE9 A;  4H0E A;  3ZMZ A;  2EFQ A;  4RS8 A;  4PCQ A;  1EH7 A;  4D0P A;  5JVT A;  1VZ0 A;  1VQO I;  1H9G A;  3I64 A;  1SVL A;  3BR2 A;  2KIU A;  2FEZ A;  1SD6 A;  1SFU A;  2Y9Y A;  2VLA A;  1R1V A;  2DMP A;  3NAU A;  3L2C A;  2PMH A;  1TW2 A;  2CRG A;  5J4V A;  3RDI A;  1DU6 A;  1I39 A;  4LB5 A;  3VYS B;  3OY9 A;  2M30 A;  3FXO A;  2DOD A;  2MD0 A;  2VBY A;  3DEW A;  4CCN A;  4DYR A;  3HOV J;  2KRC A;  2EFO A;  2WY7 Q;  4HBL A;  4JP0 A;  1FYK A;  3BG3 A;  1OCT C;  3EYI A;  2V4J C;  1QPM A;  4EM1 A;  1N25 A;  4KIG A;  3C3W A;  4I7H A;  3IKT A;  1R00 A;  4HX7 A;  2IT0 A;  5A2Q Z;  3LSI A;  1ZGA A;  4JX4 A;  2MH2 A;  2P6T A;  4B09 A;  1NHA A;  1SVO A;  4XRS G;  2WAD A;  3DXJ F;  3F8F A;  2JVH A;  2PN6 A;  4LMY A;  1D8J A;  4EAT A;  3ZQH A;  1R5G A;  5CKT A;  4W97 A;  1REP C;  1JTY A;  2IGN A;  3ERM A;  3ECO A;  1L0O C;  3H0D A;  1ACI A;  1KQ9 A;  3GTJ J;  3G1M A;  3IL2 A;  4FTH A;  3EUK L;  5AIQ A;  1E2X A;  1FOY A;  5E1Z B;  4BQQ A;  1YTY A;  2V79 A;  1S5L C;  3RKW A;  3CLO A;  2F4M B;  2GXA A;  4A3D J;  4RAF A;  2A6E F;  4UVB A;  3ABU A;  3RPQ A;  5B3S H;  3IWZ A;  2JVG A;  2YX7 A;  4G7Z F;  4CA0 A;  5J6X A;  4HYE A;  1JUM A;  1ODD A;  3U2R A;  3OS2 A;  1S6L A;  5E17 F;  5K7Z A;  1DUX C;  1PUF A;  3W6K B;  4A6D A;  3FK6 A;  2KMU A;  5M5Y J;  2ESN A;  2FSW A;  3P9C A;  5LBQ A;  4GYG A;  3WTX C; 
#chains in the Genus database with same CATH homology
 3OOU A;  1FTT A;  2XB0 X;  1EF4 A;  3BG5 A;  4M3F A;  1K61 A;  5C4X J;  3IH4 A;  3ZQI A;  2E2J J;  2COB A;  2JJ7 A;  2CJJ A;  5HOD A;  3HM5 A;  1TWC J;  1R9T J;  4UUS B;  1TWA J;  2KT0 A;  3GTQ J;  1MBJ A;  1F36 A;  2H8R A;  1VFC A;  1ETK A;  2Y9Z A;  1IV6 A;  2NS7 A;  2HOA A;  3HOX J;  2DJN A;  3SDG A;  3LNQ A;  4M6V A;  2JN6 A;  4A3G J;  2HXO A;  1MBE A;  3ZOB A;  5FKK A;  1MSF C;  3BR6 A;  3MN2 A;  1JJ8 C;  4BXX J;  2RAE A;  4X1E A;  3ZQF A;  3HBL A;  4IHY A;  3FKI J;  2M8G X;  1RR7 A;  3M4O J;  2ELK A;  4UUT A;  3M3Y J;  4AC0 A;  2LD5 A;  1ETY A;  3S2D J;  1TWH J;  2Y0S N;  2K9N A;  3OIO A;  4B3A A;  2JMW A;  1VF9 A;  1HLV A;  2R5Y B;  2R7Z J;  2GBY A;  4BY7 J;  4CYC B;  2HI3 A;  3BR5 A;  3Q3S A;  5JLX A;  2IBD A;  2DTZ A;  2LTP A;  1FTZ A;  5GPC A;  5E3N A;  2E2I J;  1JUP A;  2AO9 A;  4A3M J;  2DA2 A;  4C3H J;  1W0T A;  3FIS A;  2NVX J;  1FIA A;  4B1R A;  3DCF A;  3IH2 A;  3TW6 A;  5J1Y A;  5EF6 A;  5FKL A;  3OSG A;  5F0C A;  1I3Q J;  1MNM C;  3H0G J;  3S17 J;  1WI3 A;  4M3E A;  1XG1 A;  1JGG A;  5DS9 A;  1IGN A;  4C3I J;  1BA5 A;  4L5E A;  3JR9 A;  3RKQ A;  3Q0W A;  1IUF A;  5IP6 A;  3LSP A;  1UG2 A;  3PM1 A;  2HQ5 A;  5IOZ A;  5EGO A;  3G1O A;  1MBK A;  3B6C A;  1BL0 A;  1IDZ A;  2NVQ J;  1T33 A;  2JWT A;  4GFB A;  3JRI A;  3BQZ A;  3BT9 A;  3SFI A;  2XRL A;  4DYC A;  3RZD J;  2ZB9 A;  3FK7 A;  1FEX A;  2CUF A;  3BQY A;  2VKE A;  1B72 A;  4XRS A;  4QTR A;  1GVD A;  1MSE C;  1O4X A;  3GTK J;  2IEK A;  4IEJ A;  5FKO A;  1JKP C;  4CYC A;  5EG0 A;  3ZQG A;  2E19 A;  4W1U A;  3GTO J;  3HOY J;  2X6O A;  3JRC A;  3S1Q J;  1CQT A;  1P7J A;  1WH5 A;  2Y30 A;  3B6A A;  2K9S A;  3BR0 A;  2XPW A;  1A5J A;  5FLM J;  2L7Z A;  1AKH A;  3GTM J;  2KDZ A;  1GUU A;  4J19 A;  1VND A;  2VPR A;  5F04 A;  2LKX A;  3HKZ N;  2MW8 A;  3TP3 A;  4RBO A;  2HOS A;  3Q0U A;  3I4N J;  4AUX A;  1WPK A;  1IC8 A;  1RET A;  4X6A J;  2NS8 A;  3MKL A;  2DN0 A;  4MIM A;  1H8A C;  4M3B A;  1IDY A;  1IRZ A;  2JA6 J;  4G12 A;  5J3L A;  3A01 B;  3JRA A;  1ENH A;  5EZG A;  1RKW A;  4MLO A;  2H1K A;  3H3V K;  2L0K A;  1B8I B;  2LK2 A;  2CUE A;  1U9O A;  1JUS A;  2E1O A;  4FE7 A;  2CQQ A;  5IPA A;  1FJL A;  3K2A A;  2DA1 A;  5IYB J;  1ZKG A;  2B63 J;  3WHC A;  2LVS A;  1MH3 A;  2NVT J;  3D1N I;  2EZI A;  2LFB A;  1OFC X;  3BR3 A;  4A3E J;  2OPT A;  5C4J J;  2FQ4 A;  3IV5 A;  3IH3 A;  1ZQ3 P;  1S7E A;  4A3L J;  1GV2 A;  2LY9 A;  3TED A;  1GV5 A;  2DA6 A;  2NOG A;  3JRG A;  4M3D A;  4A3C J;  3L1P A;  2EH3 A;  4MFE A;  1QPI A;  2TRT A;  4DZP A;  1TWG J;  1ORK A;  1NTC A;  3JRE A;  2HOT A;  3QPL A;  2QF7 A;  2CU7 A;  2O7O A;  1HF0 A;  3OSF A;  2K40 A;  2XPU A;  3BR1 A;  4A3B J;  3E7L A;  3TP0 A;  1Z0X A;  3BTL A;  1GDT A;  5IOY A;  1JKQ C;  1Z77 A;  2FX0 A;  2R92 J;  5M5X J;  4UUS A;  5DTD A;  3S15 J;  4QSH A;  3HOW J;  1AU7 A;  3HGG A;  2JA7 J;  2K9Q A;  3F0C A;  1NK2 P;  2GM4 A;  1QRY A;  1U9N A;  2R5Z B;  3JRD A;  2VKV A;  5F1J A;  1W0U A;  4D5F A;  5BNG A;  1AHD P;  2O9L A;  1RES A;  2Y2Z A;  5EDN A;  1VI0 A;  2NVY J;  3G1L A;  3HB9 A;  1LFB A;  2EZL A;  4MO7 A;  2R0Q C;  1HOM A;  1JT6 A;  5K7F A;  1ZGW A;  3A02 A;  3WHB A;  1ZK8 A;  2HYJ A;  2P81 A;  3Q0V A;  4XK4 A;  1PUF B;  4V2F A;  3HOZ J;  5IYD J;  2AHQ A;  5IP7 J;  2ID3 A;  3S14 J;  4JYK A;  2N8G A;  2R93 J;  1ETW A;  2XGC A;  1SFO J;  2Y31 A;  2DMT A;  1WCM J;  3W6V A;  1E3O C;  4DYQ A;  2R5Y A;  3ZQL A;  2E2H J;  3S1M J;  1NK3 P;  4RDU A;  1OJL A;  2HXI A;  4ABZ A;  1TC3 C;  4BBS J;  1IJW C;  3ZQC A;  2WB1 N;  5C44 J;  5GPA A;  3HOU J;  1BW6 A;  2L7F P;  1X58 A;  4I76 A;  4D7M A;  5K7H A;  1LFU P;  4A3F J;  4B4C A;  5J1R A;  1D5Y A;  4D5C A;  3VPR A;  5FKM A;  2DA7 A;  1ITY A;  2LP0 A;  2G0E A;  2EZK A;  2XGD A;  4LOC A;  1LE8 B;  3K7A J;  2TCT A;  3LSG A;  3GTG J;  1TWF J;  3I4M J;  1I50 J;  2DA3 A;  2MGQ A;  1JT0 A;  1XS9 A;  3S1R J;  2ID6 A;  2X9D A;  2VI6 A;  2DA5 A;  3BTC A;  1MBF A;  3BTJ A;  2DMQ A;  5C3E J;  1JTX A;  5E3O A;  5E3M A;  4HNV A;  4JX6 A;  5GP9 A;  4Y7N J;  5FJ8 J;  4FIS A;  5FKN A;  4BBR J;  4XID A;  3GTL J;  2LR8 A;  5F0F A;  1ETX A;  2L7M P;  3HGY A;  2WAQ N;  2WV1 A;  2YUS A;  1DU0 A;  4FCY A;  2O8K A;  1MBH A;  2X48 A;  4Y52 J;  3JRH A;  2W48 A;  1FIP A;  3BTI A;  1WGX A;  4BY1 J;  1SAN A;  3RZO J;  1YRN B;  3LSJ A;  4IHW A;  1BJZ A;  2XSD C;  2XB5 A;  3HEF A;  5F08 A;  1IG7 A;  1QVU A;  5FLV A;  3RQI A;  4QIW N;  1Q1V A;  5EGO B;  2VUM J;  1ETQ A;  3NAR A;  1LE8 A;  4IHV A;  3SJM A;  4DW6 A;  1GT0 C;  3FIW A;  3O8G A;  1HDD C;  3UKG A;  3PO3 J;  3A03 A;  3LSR A;  3C2B A;  2M34 A;  1APL C;  1X2N A;  4M3G A;  1Y1V J;  2PMZ N;  2D5V A;  3A01 A;  1JKR C;  1B72 B;  4I6Z A;  2YS9 A;  1H89 C;  1I6H J;  5J1U A;  2M2E A;  2JK3 A;  4S0H B;  4XIC A;  2MG4 A;  3CDL A;  5EZH A;  1B8I A;  4MFD A;  3CQZ J;  4A3K J;  1RPW A;  2ME0 A;  5M5W J;  5F0H A;  1JJ6 C;  2HDD A;  1OCP A;  3CMY A;  5EG0 B;  3GTP J;  3MVP A;  2YU9 J;  2XPV A;  3HDD A;  3O8H A;  2GLO A;  3BR2 A;  2QCO A;  4D7N A;  3JRF A;  3JRB A;  2FD5 A;  2Y9Y A;  1U8B A;  3PO2 J;  2DMP A;  3NAU A;  1A6I A;  1F43 A;  3S1N J;  1AKH B;  1POG A;  2CRG A;  4FE4 A;  5M3M J;  1DU6 A;  4BKX A;  5M3F J;  1YRN A;  1P7I A;  1Y1W J;  1HDP A;  4C3J J;  5IP9 J;  2L9R A;  3DEW A;  3S16 J;  4DYR A;  3QPS A;  5IYC J;  4JP0 A;  4A3J J;  3HOV J;  4A93 J;  3BG3 A;  5EYR A;  2ME6 A;  1OCT C;  1MBG A;  5JLW A;  2FJ1 A;  3LOC A;  4IHX A;  3QQA A;  4DZJ A;  1H88 C;  4A3I J;  2IAI A;  2ECC A;  1ZR4 A;  4XRM A;  4NDL A;  4JX4 A;  3BG9 A;  1UMQ A;  4XRS G;  2EZH A;  4A69 C;  3S2H J;  1MH4 A;  2DMN A;  3CCY A;  3TW7 A;  3ZQH A;  4W97 A;  1ZR2 A;  1UHS A;  1JTY A;  1WH7 A;  5EEA A;  5E3L A;  1JKO C;  2EQR A;  2MSY A;  4C2M J;  2M0C A;  4JX5 A;  2DA4 A;  1ETV A;  3GTJ J;  3G1M A;  2XGE A;  1ZTR A;  4FTH A;  1RKT A;  1HCR A;  2JA8 J;  2R5Z A;  2JA5 J;  2OF7 A;  1X2M A;  2I10 A;  2ECB A;  4EEF G;  4A3D J;  1BW5 A;  1QVT A;  1U78 A;  4AYB N;  2EBI A;  2LLK A;  1JUM A;  9ANT A;  2M9H A;  5K7Z A;  1PUF A;  1K83 J;  2CQX A;  3FK6 A;  1XC5 A;  3GBG A;  5M5Y J;  4V2G A;  1ETO A;  1T56 A;  2DMU A;  1G2H A;  5F27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...