2LKXA

Nmr structure of the homeodomain of pitx2 in complex with a taatcc dna binding site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Pituitary homeobox 3
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lkxA00
2M0CA 1JKPC 3WHBA 4W97A 3BQYA 2DA7A 1SANA 2WV1A 3S16J 1X2MA 5F1JA 5EZGA 2ID3A 4DW6A 2LLKA 1QRYA 1TWCJ 2K9QA 3QPLA 3IH2A 1ZKGA 2ECCA 4XRMA 2JA5J 4A3EJ 1ETOA 4A3GJ 4M3DA 4JP0A 4A3IJ 1H88C 1TWAJ 4MFDA 1ZR4A 2E1OA 1WPKA 1FTTA 5M5WJ 5IYCJ 1Z77A 1MNMC 2HOAA 3M3YJ 3PO2J 1PUFA 4IHWA 1F43A 2X6OA 3CQZJ 3S15J 1WGXA 2NVYJ 1K61A 2NVQJ 3HGGA 1U9OA 2K9SA 1QVUA 1JGGA 2Y30A 4RBOA 2NOGA 2XSDC 1UG2A 3Q0UA 4X6AJ 2NS8A 3UKGA 1GV5A 3HOWJ 4X1EA 3I4NJ 2XB5A 5JLXA 2DJNA 3S1RJ 1U78A 2X9DA 1Q1VA 2KDZA 5E3NA 4A3CJ 3LSGA 2JWTA 3LSPA 1HF0A 5EG0B 1POGA 1ETXA 1HCRA 3JRHA 5M3FJ 2HOTA 1IDZA 2K9NA 3HGYA 2R5YA 1YRNA 2MGQA 2EQRA 2MSYA 3TP3A 5FKMA 2ZB9A 3BTLA 1RETA 2L9RA 3GTKJ 1ORKA 1S7EA 1O4XA 3BR0A 4HNVA 1MBKA 1OCTC 4W1UA 2R7ZJ 2H1KA 2I10A 5J1UA 2JK3A 5J1RA 1IRZA 2IBDA 3GTLJ 4BBSJ 2CUFA 3G1MA 4AUXA 3GTOJ 5IOYA 3CMYA 2E2HJ 5IP6A 1QVTA 1LE8B 1NK2P 5FJ8J 4DYRA 4J19A 1JKRC 4GFBA 3HBLA 3ZQIA 3BR2A 4BKXA 2E19A 2K40A 5DS9A 4M3BA 1ZGWA 3S1NJ 4M6VA 3GTMJ 2R5ZB 5IP9J 2XRLA 2R92J 3JRBA 2YUSA 4QSHA 3GTJJ 5FLMJ 1GDTA 1ETVA 1XG1A 2TCTA 4B3AA 5C4JJ 3C2BA 2OPTA 5EF6A 3S2DJ 4C2MJ 3M4OJ 2XPUA 4G12A 4BXXJ 3TEDA 5EGOB 4M3EA 1I6HJ 3FK7A 1AKHA 5E3LA 3TW6A 4XRSA 4D7MA 5C4XJ 2OF7A 2O8KA 2KT0A 3RZOJ 3LSRA 4Y7NJ 3ZQFA 1U9NA 4AYBN 3IV5A 1G2HA 1IG7A 1IGNA 4EEFG 3A01B 5EZHA 3GBGA 1WH7A 5GP9A 1EF4A 3RQIA 2DMQA 2R5YB 1DU0A 1T56A 3HOUJ 2JA6J 5K7ZA 1IDYA 1WI3A 1R9TJ 2E2JJ 2FX0A 2WAQN 3Q0VA 3BR1A 5C3EJ 3K7AJ 1PUFB 1UHSA 2EBIA 4CYCB 4B1RA 5J3LA 5J1YA 3CCYA 5GPAA 2VKVA 4A3FJ 2E2IJ 2QF7A 3OOUA 5M5XJ 5F0HA 2QCOA 4M3FA 3RZDJ 1UMQA 1B72B 1ETYA 2Y31A 4C3JJ 2RAEA 2LP0A 2EH3A 5IYDJ 3QQAA 1Y1WJ 1W0TA 1TWHJ 2DA1A 2HQ5A 1ZK8A 4BY7J 2CQXA 1RKWA 4MFEA 5IPAA 2O7OA 1W0UA 1ZTRA 1X2NA 5GPCA 1JUPA 9ANTA 1OCPA 1JKQC 3TW7A 5DTDA 2LTPA 1ETKA 2DA3A 2DN0A 3S2HJ 3OSGA 2LK2A 1AKHB 4XRSG 1AHDP 3G1LA 5JLWA 4UUTA 2N8GA 1MH3A 3JRAA 4A3KJ 2NS7A 5EYRA 5EEAA 1IJWC 3BTIA 4L5EA 1Z0XA 2Y9YA 1GUUA 4A3MJ 1LE8A 2EZLA 1MBFA 5IOZA 4V2GA 2HXIA 3HKZN 2R5ZA 2EZHA 4FE4A 5E3MA 4CYCA 2HYJA 3H0GJ 3IH3A 4A69C 2MW8A 1BA5A 4IHYA 4JX5A 2L7MP 5IYBJ 2GM4A 3GTQJ 2LR8A 5E3OA 1H89C 2M8GX 2PMZN 4A93J 3NARA 2H8RA 1LFUP 1I50J 2R93J 1HOMA 1SFOJ 3JREA 3S14J 5K7FA 1JUSA 1U8BA 3BR5A 2HDDA 1ZQ3P 1RR7A 1P7IA 1MSEC 2FD5A 5FLVA 3SFIA 1VI0A 1MH4A 2L7ZA 4IHXA 3SDGA 2XPVA 1JTXA 3WHCA 1RPWA 4IEJA 3JRGA 2CQQA 3OSFA 1VNDA 4FISA 3S1QJ 2X48A 2DA5A 2ELKA 2XGCA 1APLC 1I3QJ 4D5FA 3BG5A 1B72A 2CRGA 1BL0A 5FKKA 4DYCA 2G0EA 3PO3J 3K2AA 3RKQA 1Y1VJ 3HM5A 2YU9J 1E3OC 4A3BJ 1YRNB 2M34A 2ME0A 3S1MJ 4A3DJ 3NAUA 4S0HB 3W6VA 3D1NI 5M3MJ 2JMWA 4DZJA 4IHVA 4JX4A 3HOVJ 3TP0A 4DZPA 1AU7A 3BTCA 4FCYA 1H8AC 1CQTA 4I6ZA 4AC0A 3FKIJ 3ZQGA 2AO9A 1JKOC 4C3IJ 4V2FA 3BR3A 1F36A 5F08A 5FKLA 3HB9A 2TRTA 4LOCA 2LFBA 2LD5A 3FK6A 4I76A 2HI3A 2JJ7A 2DA6A 5M5YJ 2MG4A 4MO7A 3HOXJ 1DU6A 2CUEA 1MBJA 3JRIA 1FJLA 4RDUA 5FKNA 2DMNA 1ENHA 4DYQA 1JT6A 3MN2A 3Q0WA 3SJMA 1X58A 2VKEA 4A3JJ 1BJZA 2L7FP 2IEKA 1WH5A 3BQZA 3HDDA 2Y0SN 4D5CA 3BT9A 2EZKA 5F04A 3E7LA 1OJLA 5EGOA 1JT0A 1OFCX 1A6IA 4MIMA 2VPRA 1TWFJ 2XB0X 4C3HJ 1HDPA 2VUMJ 3B6AA 1TWGJ 3A01A 2COBA 2M2EA 3FIWA 2ECBA 5HODA 1FIAA 3L1PA 4MLOA 1IUFA 2HXOA 4JYKA 4JX6A 1JUMA 1FEXA 4UUSA 1GVDA 2B63J 2XGDA 1A5JA 3ZOBA 2LVSA 5F27A 2Y9ZA 5C44J 3BG3A 5BNGA 4NDLA 2VI6A 5FKOA 3JRCA 4ABZA 4XICA 2LY9A 1HDDC 3BTJA 2M9HA 3ZQCA 1ITYA 4FE7A 3JRFA 2Y2ZA 1IC8A 2ME6A 1JJ6C 1ETWA 3F0CA 2NVTJ 3ZQHA 1D5YA 4Y52J 1ETQA 1MSFC 1P7JA 2JN6A 2DA4A 2JA8J 3GTPJ 4A3LJ 1HLVA 3GTGJ 3H3VK 3G1OA 2ID6A 1B8IB 3A02A 2DMTA 2EZIA 2DA2A 4BY1J 3Q3SA 2LKXA 3ZQLA 3JR9A 1ZR2A 5IP7J 2JA7J 2XGEA 2DMUA 2WB1N 1WCMJ 1FIPA 1VF9A 1RESA 3BG9A 5F0FA 2O9LA 3DCFA 3JRDA 4XIDA 3O8GA 1NK3P 2IAIA 3PM1A 1BW5A 3FISA 1GV2A 3MKLA 4BBRJ 1GT0C 2DTZA 3O8HA 2CJJA 1RKTA 2XPWA 3LNQA 2P81A 1MBEA 4QIWN 4UUSB 1XS9A 3QPSA 2DMPA 5EDNA 5K7HA 1LFBA 1MBGA 2AHQA 3S17J 1T33A 1JTYA 3MVPA 1IV6A 3HOZJ 2FQ4A 2D5VA 4QTRA 4D7NA 2R0QC 3LSJA 1XC5A 5EG0A 1JJ8C 2L0KA 1NTCA 3OIOA 1K83J 3HOYJ 3IH4A 2CU7A 3I4MJ 4M3GA 1TC3C 2NVXJ 2GLOA 2W48A 5F0CA 2GBYA 1MBHA 3BR6A 1FTZA 2YS9A 3VPRA 4B4CA 1B8IA 1VFCA 3A03A 3B6CA 2FJ1A 1BW6A 4XK4A 1QPIA 2HOSA 4FTHA 3CDLA 3HEFA 3DEWA 3LOCA
chains in the Genus database with same CATH superfamily
2M0CA 2QKMB 4XLEA 1JKPC 3CO6C 1NH3A 3H3ZA 3GVAA 3S16J 1X2MA 1VQ6I 4DW6A 3E3VA 2ZFWA 2MD5A 4IRGA 2CFOA 4E7KA 3IH2A 4XN0A 1ETOA 4M3DA 4EJUA 4A3IJ 3RCOA 1A36A 1OR7C 1Z7LA 2C6YA 3DV8A 5BS6A 4KNYA 2WBMA 2CO5A 3UR3C 3WE3A 4EGYA 2LSOA 4QPOA 2R4GA 3LA7A 4I98B 1EJ9A 5B3SH 4CSWA 2Z16A 2IGOA 3LSTA 1U9OA 4KMFA 4X6AJ 4JQFA 3HSRA 2XF7A 4CH7A 3M9AA 1USTA 1FZPB 2NS8A 2H09A 1GV5A 2KRCA 4X1EA 1QPMA 5JLXA 5L3CA 1R7JA 1Q1VA 2RVCA 2KDZA 1R1UA 3LSGA 1HF0A 2R7WA 4XLAA 5TGTA 2X51A 4U87A 2W57A 3ASNH 3CZ6A 5E1XA 1RI7A 3IAS2 1FMWA 1YRNA 3FBIB 2EQRA 3I58A 1X1DA 3M07A 2FRHA 3TP3A 5FKMA 1RETA 1N25A 2A6TA 3K4MA 2Z3YA 3SZPA 3IRQA 1NG7A 2E1NA 2Y69H 4HNVA 2VPLA 2QSFX 1DP3A 4OOIA 4R1HA 3K4NA 3GZNB 1VTNC 3GTLJ 1R22A 2MLKA 3FMRA 2VQLA 1E17A 4BBSJ 2AXTC 4AU7A 1ON1A 5E18F 2R7TA 2E2HJ 1QVTA 4A6DA 3WTXC 4KITB 1LE8B 1RR8C 5CVJA 1ZH5A 1NK2P 2QLZA 3ZQIA 2IGMA 1R5ID 2F5FA 4I09A 1OPCA 1ZGWA 1W7PB 2MD0A 2Z2SB 4EVIA 2R5ZB 1LVAA 3ZMTA 1AWCA 4IHSA 3MEXA 3VYTB 3JRBA 2Y75A 3K10A 1Z67A 3G3ZA 4CCNA 1XG1A 2QEXI 3M4OJ 3FM5A 2EINH 2RGVA 1XD7A 4LK0F 2IS4A 4XRSA 2EPFA 1EH6A 2H27A 5C4XJ 2OF7A 4NQWB 2DT6A 1WSUA 4DIQA 4N4NB 3ZMSA 1KQ8A 2PMUA 4AYBN 3IV5A 3EDPA 2L4AA 3JTGA 3SZTA 4N4OB 2OQRA 3HIFA 2HQAA 1FP2A 1WQ2A 1YE9A 1BN5A 5BQTA 2KJCA 2F5DA 2JA6J 4YRVA 4OMYA 2FX0A 1O3TA 1IRFA 1SD4A 1O7LA 1IZ1A 3K7AJ 3WGIA 2ZMEC 2EBIA 2DT7B 3K1MA 5HS7A 4B1RA 2BW3A 4EJVA 2EV5A 1XMXA 3N4MA 1T39A 3M8EA 2XROA 4PZJA 3FMSA 2OU2A 2QF7A 2QM3A 2X1EA 2JTVA 3OOUA 1X1PA 2EV6A 2IRFG 4M9ZA 1K78A 5M5XJ 4M3FA 4E7JA 1RUOA 1I3AA 1TQPA 2O8XA 3KZYA 2XAJA 3QU3A 1ETYA 4AD9A 3OIQA 2ZC2A 1B72B 2STWA 1D1BA 4NB5A 2LP0A 1FSEA 3H5NA 1EKEA 2IA2A 2K86A 2VT2A 2DA1A 2ACJA 1I27A 2MYSA 2CQXA 3WTTC 1GXQA 1RKWA 2O7OA 4AIKA 2QQAA 1X2NA 3EUHC 9ANTA 3BC8A 2K5CA 5KK1A 4BHCA 2BHYA 5DD8A 4DJAA 3PQKA 4EM1A 2UV1A 2Z99A 4YFXF 1SAXA 2KP6A 1VQ4I 4PJLA 2D1HA 3OSGA 1AKHB 3L2CA 3HJEA 1AHDP 3GYHX 3G1LA 1V55H 4UUTA 3JRAA 4A3KJ 2NS7A 4BXUA 5EEAA 4LJZF 4KYWA 3BJAA 2HTSA 1W1WE 3ASOH 1GVJA 1I1SA 1KYWA 4N9IA 2EZLA 1GLNA 4D0PA 2LNBA 2R5ZA 1QZYA 3FF5A 2VJJA 4FE4A 4A12A 1U2WA 2RQPA 3KYLA 4MHGA 1XDUA 3H1CA 1FBQA 1X3ZB 2MW8A 3OWTA 3PIOF 4D9JA 3OYLA 3N05A 4J01A 1K7AA 2DPUA 1BA5A 2R3SA 2M1BA 4IHYA 2VE8A 3CF5F 1VQPI 2GM4A 5IYBJ 2F5EA 2LR8A 1OR7A 1Q1HA 4Y3OA 4A5NA 5E3OA 1H89C 2W00A 4U7DA 1SMYF 3NARA 4PJNA 2H8RA 4NHJA 4IF4A 5J4VA 2R93J 4PGGA 1SC7A 3D0SA 3HHGA 5FB2A 3DBRB 1IO2A 3FXMA 1YQAA 2QA4I 1T38A 2ZCWA 2HKXA 2HDDA 1ZQ3P 1RR7A 3LSKA 1IF1A 3H36A 2FD5A 1B1BA 2CWEA 5DCMA 1MH4A 4LFUA 1S6LA 3PUFA 3LFKA 4B47A 1BOBA 2WY8Q 1A04A 3WHCA 4OIPF 1RPWA 3OSFA 3S1QJ 1VNDA 2X48A 2JQ7A 2P5KA 3HYIA 4UUVA 4UY8I 3GZ6A 5HLIA 3GO5A 2ELKA 5GADJ 1FMVA 3VB2A 2A68F 2M8EA 3QWLA 2QVOA 1B72A 2E35A 3H9JA 2G0EA 3SYTA 1J75A 3ZXSA 3I9V2 4HF0A 4Y33A 2JVHA 1T0FA 1R5HA 2XRNA 2ME0A 2RKHA 2VLAA 2PMZA 1IXSB 2IW5A 4NNJA 3W6VA 2P5LC 3HRSA 2W24A 4B48A 3GXOA 5M3MJ 2HU9A 4P96A 4FQGA 2R7QA 2LKPA 5CVUA 3HOVJ 4QPQA 4DBQA 2KIQA 3U2RA 2ESHA 3TOBA 4NC7A 5HOOA 4GYIA 5K1YA 3X2QH 2FNPA 1R23A 4KDPA 1XGNA 2H6CA 1ACIA 1EV7A 3ABUA 4LLGF 1T8IA 2PLYA 4V2FA 3BR3A 1YO5C 1OCOH 3MWMA 1CGPA 3KLNA 4UV8A 3HB9A 2TRTA 4RGUA 1OISA 4PCQA 1DGWY 3FHNA 2P7VB 3CF2A 3LSHA 2JJ7A 2DA6A 4ZYDA 2MG4A 4NUBA 2KRFA 3HZJA 4UVCA 1QA6A 3T5XA 2DFEA 1PJRA 4YIIA 5K5RA 1S8NA 3FXKA 1C0WA 4IQ4A 3M7GA 4ON0A 2P4WA 3EUAA 2UUZA 4HQEA 3PFIA 1XSVA 1V3FA 4EQQA 2LMDA 3RYPA 3DLAA 3HRTA 4MEYF 3CESA 5AIQA 3CUQB 4A3JJ 4LB6B 1IXRC 2O3FA 2IEKA 2VT3A 2R7OA 4HLYA 5LGUA 3EUKL 1X1AA 3HDDA 2Y0SN 2B9SA 2GQQA 4D5CA 1QNTA 2AQFA 3E7LA 5F04A 4I0AA 5H2FC 1OFCX 5L3FA 4G6TB 4MIMA 2XB0X 3HSEA 4O6JA 5JHFA 1KYZA 2VUMJ 1TWGJ 4A0YA 2M2EA 3FIWA 2DYSH 4MLOA 3WTVC 3OS1A 3OYMA 3RKXA 3M8FA 3CLQA 1B6AA 2MC4A 2M4KA 2HQNA 1LDKB 4YIFA 4H4KC 2OCCH 4KIGA 2E5NA 5AONA 2XAGA 3K4KA 3BTJA 3WTWC 1ITYA 3RI4A 4WXDA 3F8BA 2F4IA 2ZSIB 1YI2I 2QSHX 2Y2ZA 4XM3A 2ME6A 1SFKA 4HW0A 3E6MA 1XX5A 2O03A 3BG6A 2AS5F 2OC6A 4ZTJA 1KU9A 4YG2F 1USSA 2E36A 4ENNA 4HX7A 4FHTA 3GTPJ 3GTGJ 3MKWB 3A02A 4S04A 4KT6A 1AA7A 2IXSA 2EZIA 3VFZA 4YIRX 2KZVA 4IX7A 3Q3SA 2LKXA 2UXXA 2W25A 3ZQLA 1G3TA 1Z7UA 4I99C 4UVBA 3K1NA 2MA3A 3RPUD 2XGEA 2DQLA 2V7FA 2YR2A 3PQJA 2ZXIA 2R7XA 1WCMJ 2IP2A 1RESA 1GXPA 2HVQA 4GXOA 4HSRA 3JRDA 4XIDA 4F3QA 1TW2A 3O8GA 1MD0A 4P5OA 5H6QA 4EJOA 2QQ9A 3FISA 4HV5A 3T1BA 1WJDA 4Q47A 1I6XA 3E97A 4RM2A 2EFNA 3GFJA 1RKTA 1QHHD 2XPWA 3G6EI 3RKYA 4HDVA 1O57A 2K27A 3ZPLA 2G7UA 4Q4ZF 2VONA 4FETA 2ZJ2A 4HNTA 4KMUX 3F3XA 4IZZA 2JUGA 5K7HA 2GXBA 1WI9A 2ESNA 1MBGA 2VJ4A 4XMYA 5D6FA 2FSWA 1MKMA 1J5YA 4A5MA 3CC4I 2HVSA 2WAQA 2JRTA 2ZBKA 3ISPA 2OZUA 4QTRA 3H5RA 3TBIA 4M73A 2JSPA 1HKSA 3CCRI 3VDXA 1IAWA 2EIKH 1T98A 2VC1A 4RAFA 2GLOA 4UXNA 1ZARA 3CC7I 3VPRA 4WXCA 5CQGA 1TT0A 2CW8A 3B6CA 1HW5A 1WRJA 3QP6A 4XK4A 1QPIA 3GZ5A 1Z3YA 4A2UA 3CDLA 4L0ZB 2ZJPF 2HPIA 2ECCA 2K4BA 2WV1A 5F1JA 3OYAA 3H92A 1X4PA 3CCLI 2LLKA 4ZC3A 3FBNB 1TWCJ 4CZCA 2V1NA 1ZKGA 4U0YA 4A3EJ 3AAFA 4JP0A 2WAFA 1TWAJ 1FYLA 4C2UA 1P4AA 2E1OA 4F93B 3CCUI 2L9NA 3BG7A 1FTTA 4ETSA 1Z77A 4C30A 5KNLA 2ZSHB 4LGWA 2K3PA 2HOAA 3J7AO 5J8CA 3M3YJ 2UWMA 3AG2H 3V7SA 1PUFA 3CQZJ 1WGXA 2RNGA 3QRFF 2NVQJ 3FMQA 3HRMA 2EV0A 3CCEI 5D4SA 2K9SA 1QVUA 1JGGA 1S7AA 3CDHA 4BHPA 1ZGAA 2BY1A 2E1MC 4F92B 1U78A 2JUCA 4CXFA 3MZHA 3RQ4A 1I39A 1P2FA 3H0DA 4MTEA 3ZCOA 3LSPA 3F6VA 1KU7A 2V26A 1RIOH 4ZZLA 2WTEA 2H6BA 2QZ8A 5E1WA 5M3FJ 1ZG3A 4DQ2A 3I0TA 4GGGA 2D45A 4DOZA 3BTLA 2L9RA 1U0JA 1ORKA 2VC0A 3F22A 1IN8A 2ZNZA 3OYBA 1G59A 1B4AA 1J7KA 3PSFA 3RDIA 3OS2A 1FOXA 2I10A 1JHHA 5KHDA 3DEEA 4ZYAA 4OIRF 2PN6A 1VQNI 4LD5A 5J1RA 2X4HA 1UFMA 3K4CA 2ZFUA 5ICCA 4Q5SF 2DTRA 5LEKA 3OYFA 2AQEA 1MMAA 2CUFA 2E5ZA 3KP7A 1SFXA 4KIBA 1KA8A 1U8RA 4Y15A 2VOOA 2HDCA 2WB1A 1VQ7I 1JKRC 2RREA 3LA2A 1U5TB 2LOOA 2XAHA 4BQAA 2V6CA 3BR2A 3WU2C 4AVZA 1QQIA 3KFWX 1YIOA 1Z6RA 3SEQA 2Z9OA 3GFMA 3S1NJ 3ZN1A 4P55A 3GTMJ 2XRLA 3VYSB 1IN7A 2DK5A 2YUSA 4QSHA 5FLMJ 2TCTA 4ZDLA 2KMUA 3C2BA 2IT0A 5EF6A 3GFLA 3JAMZ 4MNUA 4E6KG 5EGOB 3L00A 3B73A 5FD5A 1AKHA 1UZCA 2WC2A 3WGGA 1N75A 3RTRA 1ZRFA 3A0BC 3IC7A 3S3NA 2O8KA 3U1KA 2UZKA 3BLYA 2BVMA 5A2QK 3VSLA 4R79A 1R1TA 3JSPA 2ZXWH 4IHTA 1IG7A 1IGNA 1ZYRF 4EEFG 3A01B 3GBGA 3I4PA 3DEUA 4HX8A 3FXRA 1EF4A 3RQIA 4II2A 2DMQA 2R5YB 5CVRA 5E8IA 1T56A 3QAHA 3RPUA 3ROUA 2EFOA 5JR3A 5K7ZA 3HOUJ 3I3LA 3OL4A 2E2JJ 2LH9A 3Q0VA 2X6YA 1PUFB 3LFUA 2RDPA 4BL0B 3WG9A 5HDKA 5K5OA 4DBRA 2XVCA 4F91B 1YFHA 5J3LA 5J1YA 2CW7A 1N77A 4EJTA 4ZYHA 4GCVA 3E6BA 2QYOA 3BZ6A 4G6DA 3I55I 4CCLA 2A5YB 3HTSB 1XDSA 3CJQB 1UMQA 4OAZA 3ZQ7A 4C3JJ 1FPQA 1EH8A 1QZEA 1UHWA 1JE8A 4IOAF 3TOAA 1Y1WJ 1W0TA 2FF4A 1VQKI 1Y56A 3OR1C 4BY7J 1EA3A 1S29A 2ZMEA 2Q0OA 1LVKA 3OY9A 2M5WA 2QKLB 2CSOA 4MFEA 5ILUA 1K6OA 4IVNA 4L5IA 3I53A 1VZ0A 1WHUA 2LDUA 4E70A 4AVPA 4ENJA 3IWZA 1HBXG 3EYIA 1OCPA 4WWCA 4GDFA 2PFBA 5DTDA 1PVEA 2BW3B 2Y0MA 1ETKA 1MMNA 2DA3A 2DN0A 2LK2A 4RS8A 2ZJRF 4MEXF 2G7HA 3MCZA 2EIJH 1MH3A 1LNWA 2KDOA 4XSZF 3C7JA 4LIUA 3J81K 1NHAA 4AM3A 4CYDA 1OCCH 4CUGA 1Z0XA 2Y9YA 2PJRA 2ICWG 4KT5C 5EJCA 3J80Z 4YEJA 2KL4A 2MH2A 4HEA2 3TGNA 5D5WB 1MBFA 4V2GA 2HXIA 1ZREA 4RLFA 2EZHA 4WF2A 3P9CA 5E3MA 4ZYGA 1W5SA 4XN3A 2B7EA 4EATA 2PEXA 5AIPA 2OZ6A 2VBXA 2PQ8A 3V42A 5BPDA 2CQNA 4E7HA 4A93J 3H35A 2A3SA 2FOKA 1U3EM 2O61A 3DF8A 3PNYA 4LG3A 2XASA 1I50J 4HOBA 2FEZA 3S14J 4IPAA 3K4BA 4HLXA 4CZZA 4XLPF 4KFCA 4XLCA 2OD5A 3BR5A 4XNFA 5B5EC 2A6HF 1MSEC 5DV5A 5HNHA 2DPDA 3VWBA 3SFIA 1YTYA 1VI0A 1G8XA 2E71A 5K5QA 1X3WB 1QO0D 1SFEA 2E60A 5CKTA 3V8KA 3ERED 1JTXA 5HDGA 1SMTA 3ABTA 4IEJA 2ADUA 3COAC 3RSNA 4U0WA 1ZG5A 2DA5A 2M87A 2LY1A 4KA4A 4BEHB 3DBLB 3OS0A 4HBLA 1I1GA 3BG5A 5FKKA 1HW2A 3RKQA 4BQOA 2HZDA 4O5VA 4P9FA 1W7PD 3ZMVA 1FYKA 4BJ6C 4A3BJ 3QODA 2XAQA 4S05A 2P6SA 5CJ9A 2GIZA 1V5GA 2ZMEB 3CP2A 1QZZA 4IKFA 3CMMA 3HL2A 1BI0A 2KZGA 3TP0A 3DKXA 4XLNF 3EETA 3C2HA 1U5TC 1CQTA 1TLHB 1TW3A 5LGNA 2Z5UA 3ZQGA 2AO9A 2O0YA 2KIUA 3GLLA 3MAJA 4WX9A 2L4MA 1F36A 4RB1A 2QBYA 4XRFA 2CYYA 1BBYA 4BJ5C 2LD5A 2LF8A 2K9MA 2CFXA 5B66C 1DU6A 2IS1A 2CUEA 1MBJA 3LSMA 3KP2A 4L9VA 2Q1ZB 1G3YA 5FKNA 2VKHA 3A0HC 2DMNA 4IRIA 2V1XA 4F55A 4DYQA 3MN2A 1WZ2A 5F6FA 3ZR8X 2BGCA 1A35A 1MMGA 3S93A 4CCOA 4JBAA 2IGKA 1V54H 1WJAA 4RAYA 4BEHA 3BQZA 3KCCA 4EM0B 2M45A 1Z21A 3OYNA 3NEUA 3F8FA 3SEZA 2VPRA 1TWFJ 2HZTA 5KAFC 2DOAA 3BPXA 2XHKA 4KIFA 2W82A 3TQNA 3B6AA 2ISYA 2ECBA 4RGXA 3KEQA 2W85A 3SFZA 3L1PA 1V5FA 1X1BA 4JYKA 1BI1A 1MMDA 1VQ9I 1FEXA 4UUSA 2FMYA 2B63J 3JTHA 3EQLF 1FC3A 2K7LA 5LGTA 4BAYA 4BQNA 4H0EA 1YG2A 4QLCU 4NDLA 2VI6A 1V5EA 3JRCA 4XICA 2DI3A 1WFXA 2L5QA 4WCGA 3LWFA 4G7ZF 1ZG1A 1HDDC 3ABLH 3K70D 3P9IA 1QGPA 4I2OA 2Z33A 4B44A 3QU6A 4MQVA 4UNOA 4FE7A 3QOEA 2BEOA 3DKYA 4IXAA 3WU0A 1ETWA 3F0CA 2NVTJ 3ZQHA 4L0YB 4Y52J 3TMOA 3CJNA 2VASA 3L2QA 1ETQA 1FNNA 1H9GA 1MSFC 2BVLA 2E1CA 1P7JA 2X85A 3IAM2 5DDGA 2Z1DA 1RC9A 1HLVA 1T6SA 2EFQA 3G1OA 3WTSC 1WWXA 4CCMA 2DMTA 4OU0A 1Z3XA 5JVTA 3L9FA 5A2QZ 4BY1J 3V8LA 2CV0A 5ED4A 4EGZA 4OINF 5DUIA 4G8XA 2JA7J 1XGMA 2WB1N 1R58A 2H1LA 1TTYA 3KP6A 3I54A 3BG9A 1FIPA 5LRSA 4I0BA 3V7RA 2XUBA 5FGMA 3P7NA 1J59A 2QBYB 4ESBA 1O3SA 3DCFA 1JXSA 1NK3P 2A69F 3SXYA 3DFGA 3BWGA 4ASNA 4CDGA 2MC3A 4GYGA 2W7NA 3F9KA 5CQEA 1E3PA 2K02A 5J47A 2IJLA 4EV0A 4AIJA 5ICGA 1LDDA 2P81A 1WJ5A 2Y0SA 3TO7A 2DQRA 1XS9A 4BHBA 1VQLI 3HG9A 2RQQA 4HF1A 1LFBA 5HS9A 3HTUA 5LHHA 3OYJA 3AL0B 2M0MA 2E7WA 3OYGA 4KISA 3HOZJ 2JA2A 2FQ4A 4BUPA 3KIOA 4D7NA 1DP7P 4ZDPA 2FA5A 3OYIA 1R36A 4KN4X 2LC2A 3WODF 3R0AA 1JJ8C 1NTCA 3V4GA 1YHQI 3CLOA 2VBZA 5FLXK 5E8GA 2CU7A 3I4MJ 2IA1A 3L2WA 1TC3C 1Z91A 3L2RA 2F2EA 2KPMA 5DCMB 2W48A 3MQ0A 1P6RA 1KGSA 2NRAC 4I01A 2A5WA 4B4CA 1B8IA 2R7DA 3A03A 4D1QA 1OCZH 2XF5A 2OAZA 5CLSA 1G4DA 1OKRA 4FTHA 3L2VA 3HEFA 2QQ8A 4LG0A 3LOCA 4W97A 2P7CB 5GTHC 2DA7A 2BY0A 3C3WA 1D0ZA 4KJZA 3ZQQA 1HSJA 1TNTA 2ID3A 1LJ9A 2QQBA 4UVAA 1QRYA 1YS6A 2K9QA 3QPLA 4PSXA 4A3GJ 1R49A 2JA5J 2KQRA 1R6RA 3KETA 4MFDA 1SVMA 1ZR4A 1WPKA 1IRXA 5IYCJ 1J09A 1MNMC 2CQKA 2P0WA 3OYEA 1N78A 1U5TA 2R7VA 3LAPA 3PO2J 2GOMA 4IHWA 1F43A 2NVUB 2RN7A 2LYCA 3GLXA 2NVYJ 1K61A 3D5LA 5D5VB 2FUG2 1IW7F 3HGGA 2EILH 5HNFA 1IN4A 2Y30A 2NOGA 3RJPA 1UG2A 3W2VA 2XSDC 3LAJA 1BR4A 4PFOA 1Z1DA 2VODA 1PYVA 2VBWA 4CCKA 2EA4A 2DU9A 3ZMUA 5J8FA 4RAGA 2J5PA 3QPTA 4NQWA 5L3EA 5L3GA 2JWTA 3NQOA 5EG0B 1FYMA 1ZGJA 1HCRA 3BCBA 1O7FA 3I64A 4IOCF 4XKVA 2HOTA 1IDZA 2K9NA 2KRHA 2OTJI 4II3A 4MGRA 1X19A 2CH0A 2JRMA 2ZB9A 3Q5FA 3GTKJ 3GEZA 4RM3A 3DU5A 4NC6A 1UHMA 2B0LA 1WKMA 1FX7A 5BPIA 4XLFA 1MBKA 1OCTC 4W1UA 2R7ZJ 3CO7C 5FRNA 4U7BA 5IY5H 1XPXA 5JHUA 5LRRA 2FQ3A 1YIJI 3BZCA 2IBDA 1IRZA 4N0BA 5L3BA 5FLXZ 5DCFA 3LL7A 3WGHA 1ZN2A 3CTAA 3DWLE 3G1MA 4AUXA 4LITA 3GTOJ 5IOYA 1QHGA 3PUBA 3CMYA 2DOEA 2EIMH 3IWFA 1VQMI 2D1VA 2XSJC 3AL0C 1XSXA 4DYRA 5FJ8J 4J19A 2H8WA 1A31A 2ZNYA 4GFBA 5HLTA 3G2BA 2G9WA 3KZIC 4BKXA 1G3WA 5DS9A 3REOA 2PMHA 3ONQA 4M6VA 1W5CC 2QGUA 3W6JB 1QU3A 2IVMA 1F1ZA 3HKZA 5C4JJ 2OPTA 1R5GA 2VB6A 3S2DJ 2HR3A 4G12A 2FXAA 4BXXJ 2ISZA 3ULQB 3FXLA 3TW6A 2HS5A 2DFHA 4ESJA 4D7MA 1LPQA 4HYEA 2KT0A 1P4WA 1HSTA 3RZOJ 2V4JC 3IL2A 3OV8A 1U9NA 1GHCA 3E0JB 2XF6A 2BY2A 1D0YA 1HKQA 1D8JA 2X6WA 4JOMA 2Q2EA 3BPVA 3HUGA 2KIMA 1MDMA 1W7PA 1T08B 2JT1A 1BIBA 1IDYA 1WI3A 3AFHA 2FE3A 2NYXA 2DXIA 3TDUC 3C2GA 2AXLA 1MW7A 4FT8A 4BS9A 3ZN0A 1VQOI 5FFXA 2HOEA 3CP8A 1X4OA 3M1CA 5GPAA 2E2IJ 2VKVA 3Q9VA 2NXNB 1LEBA 2V9VA 1OMIA 1RNLA 3HXLA 2W4SA 2Y31A 5E79C 4A0XA 5J6XA 1YJWI 5TJJA 4HRIA 2OV7A 2RAEA 1VQ8I 1LEAA 2WADA 4CHUA 2CG4A 2L54A 2MLGA 5IYDJ 1PUEE 4LMYA 5LLQA 1YW9A 4M72A 4C2TA 2HQ5A 1ZK8A 1STZA 3H9GA 1PP8F 1W0UA 1ZTRA 3JSOA 2TDXA 1O3QA 5GPCA 2HQRA 3A1YA 2CGPA 2F4MB 2HYGD 1JKQC 1E2XA 4M6XA 2LTPA 3KP5A 4G6QA 4XRSG 4XOPA 4LIVA 5JLWA 5HDNA 3CCJI 1BI3A 3EPZA 1MJ9A 1I5ZA 4RB0A 1JGSA 4ESFA 5LHIA 3B02A 1IJWC 4Z6YA 4L5EA 3U21A 6PAXA 3GCMA 3IP4B 3TO6A 1JI8A 1LDJA 5D5XB 2NAZA 1LKXA 2XC7A 4M71A 1YS7A 4CYCA 1Y8QB 3H0GJ 3IH3A 3DBHB 4A69C 4ZZDA 3F21A 3DPLC 4RAZA 1D5VA 1IRGA 1RZ4A 4A6EA 1DGRM 4DGWB 4ITVA 4RB3C 4XONA 3GTQJ 1R1VA 1BIAA 3ESWB 2M8GX 5HLHA 2QENA 1NG6A 3AG4H 2NOJB 1LFUP 1K78B 3ECOA 4MQ9F 1HOMA 2F48A 4KICA 1H0MA 1SD6A 1SFOJ 3JREA 1JUSA 4BGDA 1U8BA 2BV6A 3A2KA 1YX5A 1P92A 1ZRCA 4PFPA 2HVRA 1MDMB 3RPQA 5J4YA 1KQ0A 3GMEA 3R0JA 2MBFA 2KJBA 4RA2A 1W5TA 5TRDA 1YJ9I 5FLVA 2L7ZA 1ONVA 2BHZA 1SVLA 4HA8A 1ZRDA 4IHXA 3QP5A 1KZHA 2XPVA 4M9SA 3WU1B 3JRGA 2CQQA 4FISA 3OMYA 1ODDA 2VBYA 3V8JA 2XGCA 2HKOA 3IHUA 4MTDA 1RRJA 1I3QJ 3BDDA 3PFYA 4D5FA 2CRGA 2VJ5A 4DYCA 4B09A 1T2KA 1BL0A 1MJBA 1W36C 3PIPF 3D5RC 1YRNB 2M34A 3S1MJ 4A3DJ 3NAUA 1YYVA 2XAUA 2ELJA 3ELKA 4ANJA 2X1CA 3LA3A 4IHVA 4JX4A 2RC4A 3K4JA 4DZPA 1AU7A 1R4NB 3FXOA 4XQFA 2KKOA 1H8AC 1OYIA 2F5CA 2KLOA 3GW2A 4I6ZA 4EJWA 3FKIJ 2ZJQF 1XCVA 4GRIA 2VQCA 5DM7F 3WG7H 1Z05A 4C3IJ 1YLFA 3I59B 3VSKA 2V9PA 3G4SI 1L0OC 4LOCA 3TO9A 1WJEA 3CCQI 2WA0A 2FU4A 3FK6A 4I76A 2WAEA 2HI3A 1BI2A 3DXJF 4PGHA 4BJTA 5FRMA 4MO7A 3ZRGA 1VQ5I 2FBIA 3F8CA 3VEPA 2A61A 2ZXJA 3EUHA 4HZFA 1D8KA 4M6YA 1REPC 3FXJA 1FJLA 4RDUA 4ZYEA 3I5UA 2V1UA 4XKBA 1Y6IA 1JT6A 4FX0A 5D5UB 2W84A 3Q0WA 1IXCA 4HNUA 1S5LC 5LBQA 3J7ZI 3SJMA 1UCRA 2EFPA 2VJIA 2VKEA 4QWQA 1BJZA 4PK4A 3WE2A 1DPUA 1WH5A 3C18A 2E7XA 3HSFA 3BOQA 1RUNA 5EGOA 1JT0A 3J7AY 1A6IA 3PNVA 4R8HA 1Y0UA 4CA0A 1HDPA 3AG1H 5CVIA 3KX2A 3F23A 5J40A 2HXOA 3I56I 4JX6A 3O6BB 4HX4A 1JUMA 2LKSA 1XSDA 2QUFA 4XSXF 1A5JA 3ZOBA 3OYCA 5F27A 2PI0A 3BG3A 5BNGA 5FKOA 4ABZA 4E7LA 1BR1A 2JZYA 1P4XA 2LY9A 4ENMA 3C1DA 5IT9K 2LBFB 3ZQCA 3IRRA 5D6EA 1WJFA 2YX7A 3DTEA 3JRFA 1MJAA 2JVGA 1IC8A 3ZGKA 2BXZA 1JJ6C 1XGOA 4OMZA 2DBBA 3SZGA 1TT5B 5FROA 1Y39A 1X1CA 4HPQA 4OIOF 2JN6A 2FMLA 2XIGA 2JA8J 1AOYA 1W4MA 3J7YJ 3H3VK 4A3LJ 3KPHA 2W1OA 1OYYA 5LD2C 5IT9Z 1B8IB 2BBYA 4G7OF 3RYRA 1YX3A 1BC8C 2DA2A 2BE5F 2STTA 2K3FA 4O3MA 1ZR2A 3DTKA 2VQHA 2DMUA 5ICEA 4LG0B 2WY7Q 3PSIA 2GXGA 2O9LA 3L7WA 4E7SA 5GAGJ 5EEHA 5DM6F 5D8KB 1MZBA 3CJTB 1S3JA 4PUSA 2IAIA 3BY6A 1J0RA 5FD6A 1SEUA 2M7AA 1BW5A 1GV2A 4BBRJ 3Q9SA 1GT0C 5DD4A 3MD2A 3JAMK 3O8HA 4IRHA 4YELA 2CUJA 3QYFA 4IQJA 2L9SA 3G73A 2M30A 2XGXA 2MABA 3DU6A 3DQVC 2DMPA 3QPSA 3OYDA 2OTLI 1SFUA 3MKZA 4JK1X 3OOPA 4LK1F 1T33A 2O5RA 5JI6A 3MVPA 3DP7A 2FBHA 3A4CA 2D5VA 1TNSA 5B1AH 5BOXA 2R0QC 4PDKA 5H6RA 1ZELA 3W6KB 5EG0A 4WK8F 2EA2A 2ELHA 1XN7A 2E34A 3IKTA 4TV7A 4I02A 1FWZA 3D5SC 3QOPA 3R4KA 5FFZA 2FNAA 4BQQA 2CS3A 3WTYC 2OJED 2NVXJ 4F7ZA 4HV6A 1FLIA 1BC7C 1FTZA 2NS0A 1VFCA 1ZHFA 4AIDA 2HOSA 1X3UA 2OA4A 4U88A 1H9TA 1YOVB 2XKPA 3DEWA 2A6EF 3WHBA 1TBXA 4Q48A 3BQYA 1SANA 5EZGA 1FBSA 3AKZA 3FM3A 1Y0NA 4XRMA 1G3SA 1K4TA 3W3CA 1R4MB 1H88C 2XAFA 3SDBA 3K1PA 4EMSA 2CV1A 4GO1A 5M5WJ 1TL8A 2DO7A 2E1MB 5TISC 3E1SA 3S8PA 4HDUA 4BE2A 3M8JA 2I8DA 3T0YA 1XTAA 4G94A 3F72A 4NBQA 3CCSI 3FWEA 2X6OA 2DJIA 3S15J 1Z6TA 3KYCB 2VKDA 1E0EA 2EK5A 5KVRA 1D1AA 1D3YA 2WV0A 4L9JA 4RBOA 3Q0UA 3EYYA 2CUZA 3S2WA 1ERDA 3UKGA 4ZH4F 1G6NA 2BY3A 1MNDA 3HOWJ 3I59A 3DPUA 3I4NJ 1S7OA 2P8TA 2XB5A 2DJNA 3S1RJ 4F52A 2JSCA 5LFAA 2VXDA 2X9DA 2DT5A 1IN5A 5IT3A 1JHFA 5D8LB 5E3NA 4BE1A 4A3CJ 1HW1A 4ZDOA 1J2XA 1POGA 1ETXA 3RKWA 5HVQC 2RNJA 1B9NA 3HGYA 3CUOA 2R5YA 5BMZA 2MGQA 1CF7A 1B9MA 1TP4A 1KU3A 2JPCA 2LF7A 2MSYA 3NWSA 1XCBA 2V6EA 2PJPA 4UHTA 1S7EA 1UG0A 1O4XA 3ZMZA 3BR0A 4BXFA 2LREA 3S3OA 2PG4A 4N9HA 2JPBA 3OIPA 2H1KA 3TDZC 3ABMH 5J1UA 2JK3A 3CDIA 4X0GA 2K9LA 2VL8A 1Y8RB 3QYBA 1DQUA 1E3HA 3NWTA 5H20A 4BYYA 2VXZA 4M9XA 4UB8C 2L02A 2DDAA 5GAHJ 2VN2A 2ZKZA 5IP6A 1O3RA 2GA1A 4L9NA 3K9TA 2M4GA 2CV2A 1J9IA 4AWXB 3OYHA 3HBLA 3CUQC 2E19A 2K40A 4IL6C 4KUMA 1XGSA 4A0ZA 1OQYA 4I7HA 4M3BA 5GAEJ 3W2WA 3HOSA 4HSTA 1IV8A 2H94A 5HS8A 5IP9J 2VOPA 2R92J 3H9QA 5KAIC 4PJ0C 5CYVA 5DYMA 2Q8KA 3GTJJ 3FX3A 1GDTA 1ETVA 2P6TA 4B3AA 1OCRH 4UB6C 4K2EA 4C2MJ 4KN7X 2XPUA 3K6GA 3TEDA 1KONA 2GIVA 4M3EA 1I6HJ 3FK7A 2IS6A 1ZLKA 5E3LA 3U1DA 2HWVA 4Z2YA 1XMKA 2FBKA 4HG2A 2R7FA 4Y7NJ 3LSRA 3T8RA 5LEJA 3ZQFA 4RB2C 1G2HA 3KYDB 3JW4A 5EZHA 4B8XA 1WH7A 2COMA 5GP9A 4IO9F 3VOEA 1KQ9A 2HEOA 1DU0A 1FSHA 2V1DA 4CGZA 3IUOA 1A6QA 1R9TJ 3NRVA 2WAQN 4Y13A 3BR1A 5C3EJ 1TQMA 1UHSA 4CYCB 1L3LA 1ZAOA 3TL4X 3KEOA 1PP7U 1XMAA 3CCYA 3MZYA 4A3FJ 2ZXHA 1YJNI 5ILVA 1YW7A 1YW8A 1EH7A 4ZTFA 1HA8A 2X6XA 2IGNA 2PBIA 5F0HA 2QCOA 3LQRA 3RZDJ 2BYVE 4HAMA 1F4KA 2L9VA 3DPTA 2VQGA 2EH3A 1R00A 4Y17A 1Z9CA 1M1EB 3WTUC 3QQAA 5FO5A 1TWHJ 2GAUA 5E20A 2Q2EB 1FOYA 3WTZA 1KU2A 5IPAA 1LFPA 3VYRB 1TZLA 3HRUA 2A05A 3OYKA 3LQQA 1JUPA 1LB2A 4FASD 4EM2A 3FZVA 3TW7A 1DDNA 2YX4A 2L2OA 4OIQF 2KHMA 3S2HJ 3SHFA 1BR2A 1BM9A 3ML6A 3MFKA 3CD6I 3FXQA 4BU2A 4P9UA 2N8GA 3QPHA 4G7HF 3HOTA 3R61A 1IUYA 3H3UA 5EYRA 4L18B 3F8NA 1YITI 3BTIA 3QYEA 2DYRH 3KLOA 1GUUA 4A3MJ 2WWYA 1LE8A 3K69A 4CO8A 1LUJB 4UV9A 2HNHA 5IOZA 3HKZN 3KE2A 2P5VA 4XL9A 3J81Z 3U9GA 4BDYA 4LB5A 2DODA 3L09A 3N97A 2HYJA 4BNCA 2V79A 3K4LA 4PJJA 2KFDA 1MIJA 2I5UA 3CUQA 1T0FC 2LG4A 3AG3H 2X1DA 2OBPA 4JX5A 2L7MP 3RIRA 3KZZA 1F9NA 1FY7A 3PJRA 3E5UA 2PMZN 4G9YA 2XKOA 5ILSA 2F6CA 2KISA 2K4JA 2QWWA 3E6DA 1WJBA 4RGRA 3UNGC 5K7FA 4CICA 4BH9A 1R71A 1UELB 2GZWA 3OL3A 3GFIA 3FDYA 4BACA 1P7IA 2HDWA 5JFRA 3K70C 1FOKA 4C9YA 3F8MA 3FHZA 2RV8A 2EB7A 3VYUB 3SDGA 4XORA 3F6OA 5HLGA 2D2WA 2LBFA 1QBJA 4ZJZA 3TKYA 3CMEI 1WVRA 1SVOA 5F64A 1V4RA 3R6SA 1APLC 1S72I 4E4HA 1FOWA 5LHGA 2UXNA 3I71A 2IPQX 3PO3J 3K2AA 2Y48A 1K79A 3E5XA 1SD5A 5DUKA 1Y1VJ 3HM5A 2YU9J 3HHHA 1E3OC 2DAOA 3ZMDA 4S0HB 4XR6A 1FP1D 2IS2A 2GXAA 3M1EA 3D1NI 4DNCA 2JMWA 4RLQA 4DZJA 3SQNA 4E7ZA 5JVGF 5ERIA 2BXYA 4AYBA 3BTCA 4FCYA 1D0XA 4AC0A 3E6CC 5GTIC 4PSWA 2F4OB 2VE9A 1XB4A 2YSRA 1JKOC 4ENKA 2GOXB 4XLHA 5F08A 4OAYA 1UB9A 5FKLA 4FX4A 2DOFA 2HFHA 2LFBA 2CW0F 4L9TA 2KIFA 3K0LA 5ICFA 2YU3A 3MMYB 2OCEA 5M5YJ 3HOXJ 1MGTA 3W2AA 1HC8A 3JRIA 3T8TA 2XV4S 3FXUA 2IA0A 1W36D 1LQ1A 1ENHA 2V9KA 3KP4A 4J00A 2R7UA 1UJ8A 2DFFA 2EFWA 3GUDA 1X58A 2F5VA 2FOWA 5F1RA 2L7FP 3GX4X 3CCVI 2K85A 4BDZA 3PNTA 4B43A 3G71I 1BJAA 4CCJA 3BT9A 5KCMA 2EZKA 3V7CA 2L3DA 1OJLA 3L2UA 2HPMA 2DK8A 4C3HJ 1U6GA 5DEQA 3ECHA 2O6GE 5CPRB 3A01A 1MMSA 2COBA 4XKWA 1SAUA 3JCUC 3P9KA 5HODA 1FIAA 2ETHA 2PX9A 1IUFA 4LLLA 1SD7A 1GVDA 5L3DA 1OLTA 1B59A 2XGDA 3GWZA 3LSIA 2LVSA 3P5JA 2Y9ZA 4U0VA 5C44J 2GWRA 3GF2A 3HC7A 1UAAA 2MH9A 5CVVA 1K4SA 4RMNA 4XKCA 3H5AA 3J80K 2M9HA 3O2PE 3E5QA 1MNEA 3ERMA 4P1WA 4IJAA 5D4RA 4PJMA 4Y4RA 3BJOA 4RGSA 4E7IA 1OYWA 1D5YA 2M7BA 5E17F 4HF2A 4YFKF 1K6YA 3KP3A 2DA4A 3BP8A 3K2ZA 3ZP5A 2HYFA 1ULYA 2ID6A 5EEGA 2OUMA 3HUGB 3PL8A 2CMPA 4XBFA 1DUXC 3VODA 1P9QC 2NNNA 2BZTA 1ON2A 4NC8A 4B3XA 4HQMA 1PDNC 3JR9A 2XDVA 2LY2A 5IP7J 2DDBA 2LRDA 1BOAA 4WXHA 2X0LA 1HQCA 3DLLF 2L01A 5F0FA 1VF9A 2ZO4A 3BZKA 2VIXA 2OQGA 2GA2A 2YPRA 4M74A 2HGCA 1DPRA 1ZLJA 3BJ6A 2R7SA 2PJRB 1F5TA 2QSGX 2L7KA 3CC2I 3PM1A 2NNYA 3MKLA 3ABKH 3FKJA 4LLNA 2DTZA 2CJJA 5B1BH 1FT9A 1TQIA 3CJRB 4XOTA 3LNQA 3LMMA 4BE0A 3MZ8A 2DCEA 1MBEA 4QIWN 4UUSB 3IKVA 4V19K 2J5OA 2HTJA 5EDNA 2EJRA 2CQ7A 2AHQA 1WJCA 3S17J 1T95A 2R7RA 2DFIA 1JTYA 4AIHA 2DW4A 1IV6A 3R60A 2MFZA 3OR2C 3LSJA 3HPHA 3BCAA 1FBUA 1XC5A 3KEYA 5E1ZB 2DLLA 3CCMI 2L0KA 4L5JA 2EWNA 3OIOA 1K83J 3HOYJ 3IH4A 1IN6A 3MKYB 1S9HA 2M3AA 3CMAI 1HXDA 4M3GA 3DTIA 2BOLA 3S3MA 3HPGA 1CF7B 2GBYA 5F0CA 1MBHA 3BR6A 2YS9A 2FJ1A 1BW6A 1D1CA 3DKWA 3O3KA 2A07F 4YFNF 1HKTA 3BROA 3S32A 4OWRB 3JRHA
chains in the Genus database with same CATH topology
2M0CA 1JKPC 3WHBA 4W97A 3BQYA 2DA7A 1SANA 2WV1A 3S16J 1X2MA 5F1JA 5EZGA 2ID3A 4DW6A 2LLKA 1QRYA 1TWCJ 2K9QA 3QPLA 3IH2A 1ZKGA 2ECCA 4XRMA 2JA5J 4A3EJ 1ETOA 4A3GJ 4M3DA 4JP0A 4A3IJ 1H88C 1TWAJ 4MFDA 1ZR4A 2E1OA 1WPKA 1FTTA 5M5WJ 5IYCJ 1Z77A 1MNMC 2HOAA 3M3YJ 3PO2J 1PUFA 4IHWA 1F43A 2X6OA 3CQZJ 3S15J 1WGXA 2NVYJ 1K61A 2NVQJ 3HGGA 1U9OA 2K9SA 1QVUA 1JGGA 2Y30A 4RBOA 2NOGA 2XSDC 1UG2A 3Q0UA 4X6AJ 2NS8A 3UKGA 1GV5A 3HOWJ 4X1EA 3I4NJ 2XB5A 5JLXA 2DJNA 3S1RJ 1U78A 2X9DA 1Q1VA 2KDZA 5E3NA 4A3CJ 3LSGA 2JWTA 3LSPA 1HF0A 5EG0B 1POGA 1ETXA 1HCRA 3JRHA 5M3FJ 2HOTA 1IDZA 2K9NA 3HGYA 2R5YA 1YRNA 2MGQA 2EQRA 2MSYA 3TP3A 5FKMA 2ZB9A 3BTLA 1RETA 2L9RA 3GTKJ 1ORKA 1S7EA 1O4XA 3BR0A 4HNVA 1MBKA 1OCTC 4W1UA 2R7ZJ 2H1KA 2I10A 5J1UA 2JK3A 5J1RA 1IRZA 2IBDA 3GTLJ 4BBSJ 2CUFA 3G1MA 4AUXA 3GTOJ 5IOYA 3CMYA 2E2HJ 5IP6A 1QVTA 1LE8B 1NK2P 5FJ8J 4DYRA 4J19A 1JKRC 4GFBA 3HBLA 3ZQIA 3BR2A 4BKXA 2E19A 2K40A 5DS9A 4M3BA 1ZGWA 3S1NJ 4M6VA 3GTMJ 2R5ZB 5IP9J 2XRLA 2R92J 3JRBA 2YUSA 4QSHA 3GTJJ 5FLMJ 1GDTA 1ETVA 1XG1A 2TCTA 4B3AA 5C4JJ 3C2BA 2OPTA 5EF6A 3S2DJ 4C2MJ 3M4OJ 2XPUA 4G12A 4BXXJ 3TEDA 5EGOB 4M3EA 1I6HJ 3FK7A 1AKHA 5E3LA 3TW6A 4XRSA 4D7MA 5C4XJ 2OF7A 2O8KA 2KT0A 3RZOJ 3LSRA 4Y7NJ 3ZQFA 1U9NA 4AYBN 3IV5A 1G2HA 1IG7A 1IGNA 4EEFG 3A01B 5EZHA 3GBGA 1WH7A 5GP9A 1EF4A 3RQIA 2DMQA 2R5YB 1DU0A 1T56A 3HOUJ 2JA6J 5K7ZA 1IDYA 1WI3A 1R9TJ 2E2JJ 2FX0A 2WAQN 3Q0VA 3BR1A 5C3EJ 3K7AJ 1PUFB 1UHSA 2EBIA 4CYCB 4B1RA 5J3LA 5J1YA 3CCYA 5GPAA 2VKVA 4A3FJ 2E2IJ 2QF7A 3OOUA 5M5XJ 5F0HA 2QCOA 4M3FA 3RZDJ 1UMQA 1B72B 1ETYA 2Y31A 4C3JJ 2RAEA 2LP0A 2EH3A 5IYDJ 3QQAA 1Y1WJ 1W0TA 1TWHJ 2DA1A 2HQ5A 1ZK8A 4BY7J 2CQXA 1RKWA 4MFEA 5IPAA 2O7OA 1W0UA 1ZTRA 1X2NA 5GPCA 1JUPA 9ANTA 1OCPA 1JKQC 3TW7A 5DTDA 2LTPA 1ETKA 2DA3A 2DN0A 3S2HJ 3OSGA 2LK2A 1AKHB 4XRSG 1AHDP 3G1LA 5JLWA 4UUTA 2N8GA 1MH3A 3JRAA 4A3KJ 2NS7A 5EYRA 5EEAA 1IJWC 3BTIA 4L5EA 1Z0XA 2Y9YA 1GUUA 4A3MJ 1LE8A 2EZLA 1MBFA 5IOZA 4V2GA 2HXIA 3HKZN 2R5ZA 2EZHA 4FE4A 5E3MA 4CYCA 2HYJA 3H0GJ 3IH3A 4A69C 2MW8A 1BA5A 4IHYA 4JX5A 2L7MP 5IYBJ 2GM4A 3GTQJ 2LR8A 5E3OA 1H89C 2M8GX 2PMZN 4A93J 3NARA 2H8RA 1LFUP 1I50J 2R93J 1HOMA 1SFOJ 3JREA 3S14J 5K7FA 1JUSA 1U8BA 3BR5A 2HDDA 1ZQ3P 1RR7A 1P7IA 1MSEC 2FD5A 5FLVA 3SFIA 1VI0A 1MH4A 2L7ZA 4IHXA 3SDGA 2XPVA 1JTXA 3WHCA 1RPWA 4IEJA 3JRGA 2CQQA 3OSFA 1VNDA 4FISA 3S1QJ 2X48A 2DA5A 2ELKA 2XGCA 1APLC 1I3QJ 4D5FA 3BG5A 1B72A 2CRGA 1BL0A 5FKKA 4DYCA 2G0EA 3PO3J 3K2AA 3RKQA 1Y1VJ 3HM5A 2YU9J 1E3OC 4A3BJ 1YRNB 2M34A 2ME0A 3S1MJ 4A3DJ 3NAUA 4S0HB 3W6VA 3D1NI 5M3MJ 2JMWA 4DZJA 4IHVA 4JX4A 3HOVJ 3TP0A 4DZPA 1AU7A 3BTCA 4FCYA 1H8AC 1CQTA 4I6ZA 4AC0A 3FKIJ 3ZQGA 2AO9A 1JKOC 4C3IJ 4V2FA 3BR3A 1F36A 5F08A 5FKLA 3HB9A 2TRTA 4LOCA 2LFBA 2LD5A 3FK6A 4I76A 2HI3A 2JJ7A 2DA6A 5M5YJ 2MG4A 4MO7A 3HOXJ 1DU6A 2CUEA 1MBJA 3JRIA 1FJLA 4RDUA 5FKNA 2DMNA 1ENHA 4DYQA 1JT6A 3MN2A 3Q0WA 3SJMA 1X58A 2VKEA 4A3JJ 1BJZA 2L7FP 2IEKA 1WH5A 3BQZA 3HDDA 2Y0SN 4D5CA 3BT9A 2EZKA 5F04A 3E7LA 1OJLA 5EGOA 1JT0A 1OFCX 1A6IA 4MIMA 2VPRA 1TWFJ 2XB0X 4C3HJ 1HDPA 2VUMJ 3B6AA 1TWGJ 3A01A 2COBA 2M2EA 3FIWA 2ECBA 5HODA 1FIAA 3L1PA 4MLOA 1IUFA 2HXOA 4JYKA 4JX6A 1JUMA 1FEXA 4UUSA 1GVDA 2B63J 2XGDA 1A5JA 3ZOBA 2LVSA 5F27A 2Y9ZA 5C44J 3BG3A 5BNGA 4NDLA 2VI6A 5FKOA 3JRCA 4ABZA 4XICA 2LY9A 1HDDC 3BTJA 2M9HA 3ZQCA 1ITYA 4FE7A 3JRFA 2Y2ZA 1IC8A 2ME6A 1JJ6C 1ETWA 3F0CA 2NVTJ 3ZQHA 1D5YA 4Y52J 1ETQA 1MSFC 1P7JA 2JN6A 2DA4A 2JA8J 3GTPJ 4A3LJ 1HLVA 3GTGJ 3H3VK 3G1OA 2ID6A 1B8IB 3A02A 2DMTA 2EZIA 2DA2A 4BY1J 3Q3SA 2LKXA 3ZQLA 3JR9A 1ZR2A 5IP7J 2JA7J 2XGEA 2DMUA 2WB1N 1WCMJ 1FIPA 1VF9A 1RESA 3BG9A 5F0FA 2O9LA 3DCFA 3JRDA 4XIDA 3O8GA 1NK3P 2IAIA 3PM1A 1BW5A 3FISA 1GV2A 3MKLA 4BBRJ 1GT0C 2DTZA 3O8HA 2CJJA 1RKTA 2XPWA 3LNQA 2P81A 1MBEA 4QIWN 4UUSB 1XS9A 3QPSA 2DMPA 5EDNA 5K7HA 1LFBA 1MBGA 2AHQA 3S17J 1T33A 1JTYA 3MVPA 1IV6A 3HOZJ 2FQ4A 2D5VA 4QTRA 4D7NA 2R0QC 3LSJA 1XC5A 5EG0A 1JJ8C 2L0KA 1NTCA 3OIOA 1K83J 3HOYJ 3IH4A 2CU7A 3I4MJ 4M3GA 1TC3C 2NVXJ 2GLOA 2W48A 5F0CA 2GBYA 1MBHA 3BR6A 1FTZA 2YS9A 3VPRA 4B4CA 1B8IA 1VFCA 3A03A 3B6CA 2FJ1A 1BW6A 4XK4A 1QPIA 2HOSA 4FTHA 3CDLA 3HEFA 3DEWA 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0C A;  1JKP C;  3WHB A;  4W97 A;  3BQY A;  2DA7 A;  1SAN A;  2WV1 A;  3S16 J;  1X2M A;  5F1J A;  5EZG A;  2ID3 A;  4DW6 A;  2LLK A;  1QRY A;  1TWC J;  2K9Q A;  3QPL A;  3IH2 A;  1ZKG A;  2ECC A;  4XRM A;  2JA5 J;  4A3E J;  1ETO A;  4A3G J;  4M3D A;  4JP0 A;  4A3I J;  1H88 C;  1TWA J;  4MFD A;  1ZR4 A;  2E1O A;  1WPK A;  1FTT A;  5M5W J;  5IYC J;  1Z77 A;  1MNM C;  2HOA A;  3M3Y J;  3PO2 J;  1PUF A;  4IHW A;  1F43 A;  2X6O A;  3CQZ J;  3S15 J;  1WGX A;  2NVY J;  1K61 A;  2NVQ J;  3HGG A;  1U9O A;  2K9S A;  1QVU A;  1JGG A;  2Y30 A;  4RBO A;  2NOG A;  2XSD C;  1UG2 A;  3Q0U A;  4X6A J;  2NS8 A;  3UKG A;  1GV5 A;  3HOW J;  4X1E A;  3I4N J;  2XB5 A;  5JLX A;  2DJN A;  3S1R J;  1U78 A;  2X9D A;  1Q1V A;  2KDZ A;  5E3N A;  4A3C J;  3LSG A;  2JWT A;  3LSP A;  1HF0 A;  5EG0 B;  1POG A;  1ETX A;  1HCR A;  3JRH A;  5M3F J;  2HOT A;  1IDZ A;  2K9N A;  3HGY A;  2R5Y A;  1YRN A;  2MGQ A;  2EQR A;  2MSY A;  3TP3 A;  5FKM A;  2ZB9 A;  3BTL A;  1RET A;  2L9R A;  3GTK J;  1ORK A;  1S7E A;  1O4X A;  3BR0 A;  4HNV A;  1MBK A;  1OCT C;  4W1U A;  2R7Z J;  2H1K A;  2I10 A;  5J1U A;  2JK3 A;  5J1R A;  1IRZ A;  2IBD A;  3GTL J;  4BBS J;  2CUF A;  3G1M A;  4AUX A;  3GTO J;  5IOY A;  3CMY A;  2E2H J;  5IP6 A;  1QVT A;  1LE8 B;  1NK2 P;  5FJ8 J;  4DYR A;  4J19 A;  1JKR C;  4GFB A;  3HBL A;  3ZQI A;  3BR2 A;  4BKX A;  2E19 A;  2K40 A;  5DS9 A;  4M3B A;  1ZGW A;  3S1N J;  4M6V A;  3GTM J;  2R5Z B;  5IP9 J;  2XRL A;  2R92 J;  3JRB A;  2YUS A;  4QSH A;  3GTJ J;  5FLM J;  1GDT A;  1ETV A;  1XG1 A;  2TCT A;  4B3A A;  5C4J J;  3C2B A;  2OPT A;  5EF6 A;  3S2D J;  4C2M J;  3M4O J;  2XPU A;  4G12 A;  4BXX J;  3TED A;  5EGO B;  4M3E A;  1I6H J;  3FK7 A;  1AKH A;  5E3L A;  3TW6 A;  4XRS A;  4D7M A;  5C4X J;  2OF7 A;  2O8K A;  2KT0 A;  3RZO J;  3LSR A;  4Y7N J;  3ZQF A;  1U9N A;  4AYB N;  3IV5 A;  1G2H A;  1IG7 A;  1IGN A;  4EEF G;  3A01 B;  5EZH A;  3GBG A;  1WH7 A;  5GP9 A;  1EF4 A;  3RQI A;  2DMQ A;  2R5Y B;  1DU0 A;  1T56 A;  3HOU J;  2JA6 J;  5K7Z A;  1IDY A;  1WI3 A;  1R9T J;  2E2J J;  2FX0 A;  2WAQ N;  3Q0V A;  3BR1 A;  5C3E J;  3K7A J;  1PUF B;  1UHS A;  2EBI A;  4CYC B;  4B1R A;  5J3L A;  5J1Y A;  3CCY A;  5GPA A;  2VKV A;  4A3F J;  2E2I J;  2QF7 A;  3OOU A;  5M5X J;  5F0H A;  2QCO A;  4M3F A;  3RZD J;  1UMQ A;  1B72 B;  1ETY A;  2Y31 A;  4C3J J;  2RAE A;  2LP0 A;  2EH3 A;  5IYD J;  3QQA A;  1Y1W J;  1W0T A;  1TWH J;  2DA1 A;  2HQ5 A;  1ZK8 A;  4BY7 J;  2CQX A;  1RKW A;  4MFE A;  5IPA A;  2O7O A;  1W0U A;  1ZTR A;  1X2N A;  5GPC A;  1JUP A;  9ANT A;  1OCP A;  1JKQ C;  3TW7 A;  5DTD A;  2LTP A;  1ETK A;  2DA3 A;  2DN0 A;  3S2H J;  3OSG A;  2LK2 A;  1AKH B;  4XRS G;  1AHD P;  3G1L A;  5JLW A;  4UUT A;  2N8G A;  1MH3 A;  3JRA A;  4A3K J;  2NS7 A;  5EYR A;  5EEA A;  1IJW C;  3BTI A;  4L5E A;  1Z0X A;  2Y9Y A;  1GUU A;  4A3M J;  1LE8 A;  2EZL A;  1MBF A;  5IOZ A;  4V2G A;  2HXI A;  3HKZ N;  2R5Z A;  2EZH A;  4FE4 A;  5E3M A;  4CYC A;  2HYJ A;  3H0G J;  3IH3 A;  4A69 C;  2MW8 A;  1BA5 A;  4IHY A;  4JX5 A;  2L7M P;  5IYB J;  2GM4 A;  3GTQ J;  2LR8 A;  5E3O A;  1H89 C;  2M8G X;  2PMZ N;  4A93 J;  3NAR A;  2H8R A;  1LFU P;  1I50 J;  2R93 J;  1HOM A;  1SFO J;  3JRE A;  3S14 J;  5K7F A;  1JUS A;  1U8B A;  3BR5 A;  2HDD A;  1ZQ3 P;  1RR7 A;  1P7I A;  1MSE C;  2FD5 A;  5FLV A;  3SFI A;  1VI0 A;  1MH4 A;  2L7Z A;  4IHX A;  3SDG A;  2XPV A;  1JTX A;  3WHC A;  1RPW A;  4IEJ A;  3JRG A;  2CQQ A;  3OSF A;  1VND A;  4FIS A;  3S1Q J;  2X48 A;  2DA5 A;  2ELK A;  2XGC A;  1APL C;  1I3Q J;  4D5F A;  3BG5 A;  1B72 A;  2CRG A;  1BL0 A;  5FKK A;  4DYC A;  2G0E A;  3PO3 J;  3K2A A;  3RKQ A;  1Y1V J;  3HM5 A;  2YU9 J;  1E3O C;  4A3B J;  1YRN B;  2M34 A;  2ME0 A;  3S1M J;  4A3D J;  3NAU A;  4S0H B;  3W6V A;  3D1N I;  5M3M J;  2JMW A;  4DZJ A;  4IHV A;  4JX4 A;  3HOV J;  3TP0 A;  4DZP A;  1AU7 A;  3BTC A;  4FCY A;  1H8A C;  1CQT A;  4I6Z A;  4AC0 A;  3FKI J;  3ZQG A;  2AO9 A;  1JKO C;  4C3I J;  4V2F A;  3BR3 A;  1F36 A;  5F08 A;  5FKL A;  3HB9 A;  2TRT A;  4LOC A;  2LFB A;  2LD5 A;  3FK6 A;  4I76 A;  2HI3 A;  2JJ7 A;  2DA6 A;  5M5Y J;  2MG4 A;  4MO7 A;  3HOX J;  1DU6 A;  2CUE A;  1MBJ A;  3JRI A;  1FJL A;  4RDU A;  5FKN A;  2DMN A;  1ENH A;  4DYQ A;  1JT6 A;  3MN2 A;  3Q0W A;  3SJM A;  1X58 A;  2VKE A;  4A3J J;  1BJZ A;  2L7F P;  2IEK A;  1WH5 A;  3BQZ A;  3HDD A;  2Y0S N;  4D5C A;  3BT9 A;  2EZK A;  5F04 A;  3E7L A;  1OJL A;  5EGO A;  1JT0 A;  1OFC X;  1A6I A;  4MIM A;  2VPR A;  1TWF J;  2XB0 X;  4C3H J;  1HDP A;  2VUM J;  3B6A A;  1TWG J;  3A01 A;  2COB A;  2M2E A;  3FIW A;  2ECB A;  5HOD A;  1FIA A;  3L1P A;  4MLO A;  1IUF A;  2HXO A;  4JYK A;  4JX6 A;  1JUM A;  1FEX A;  4UUS A;  1GVD A;  2B63 J;  2XGD A;  1A5J A;  3ZOB A;  2LVS A;  5F27 A;  2Y9Z A;  5C44 J;  3BG3 A;  5BNG A;  4NDL A;  2VI6 A;  5FKO A;  3JRC A;  4ABZ A;  4XIC A;  2LY9 A;  1HDD C;  3BTJ A;  2M9H A;  3ZQC A;  1ITY A;  4FE7 A;  3JRF A;  2Y2Z A;  1IC8 A;  2ME6 A;  1JJ6 C;  1ETW A;  3F0C A;  2NVT J;  3ZQH A;  1D5Y A;  4Y52 J;  1ETQ A;  1MSF C;  1P7J A;  2JN6 A;  2DA4 A;  2JA8 J;  3GTP J;  4A3L J;  1HLV A;  3GTG J;  3H3V K;  3G1O A;  2ID6 A;  1B8I B;  3A02 A;  2DMT A;  2EZI A;  2DA2 A;  4BY1 J;  3Q3S A;  2LKX A;  3ZQL A;  3JR9 A;  1ZR2 A;  5IP7 J;  2JA7 J;  2XGE A;  2DMU A;  2WB1 N;  1WCM J;  1FIP A;  1VF9 A;  1RES A;  3BG9 A;  5F0F A;  2O9L A;  3DCF A;  3JRD A;  4XID A;  3O8G A;  1NK3 P;  2IAI A;  3PM1 A;  1BW5 A;  3FIS A;  1GV2 A;  3MKL A;  4BBR J;  1GT0 C;  2DTZ A;  3O8H A;  2CJJ A;  1RKT A;  2XPW A;  3LNQ A;  2P81 A;  1MBE A;  4QIW N;  4UUS B;  1XS9 A;  3QPS A;  2DMP A;  5EDN A;  5K7H A;  1LFB A;  1MBG A;  2AHQ A;  3S17 J;  1T33 A;  1JTY A;  3MVP A;  1IV6 A;  3HOZ J;  2FQ4 A;  2D5V A;  4QTR A;  4D7N A;  2R0Q C;  3LSJ A;  1XC5 A;  5EG0 A;  1JJ8 C;  2L0K A;  1NTC A;  3OIO A;  1K83 J;  3HOY J;  3IH4 A;  2CU7 A;  3I4M J;  4M3G A;  1TC3 C;  2NVX J;  2GLO A;  2W48 A;  5F0C A;  2GBY A;  1MBH A;  3BR6 A;  1FTZ A;  2YS9 A;  3VPR A;  4B4C A;  1B8I A;  1VFC A;  3A03 A;  3B6C A;  2FJ1 A;  1BW6 A;  4XK4 A;  1QPI A;  2HOS A;  4FTH A;  3CDL A;  3HEF A;  3DEW A;  3LOC A; 
#chains in the Genus database with same CATH topology
 2M0C A;  2QKM B;  4XLE A;  1JKP C;  3CO6 C;  1NH3 A;  3H3Z A;  3GVA A;  3S16 J;  1X2M A;  1VQ6 I;  4DW6 A;  3E3V A;  2ZFW A;  2MD5 A;  4IRG A;  2CFO A;  4E7K A;  3IH2 A;  4XN0 A;  1ETO A;  4M3D A;  4EJU A;  4A3I J;  3RCO A;  1A36 A;  1OR7 C;  1Z7L A;  2C6Y A;  3DV8 A;  5BS6 A;  4KNY A;  2WBM A;  2CO5 A;  3UR3 C;  3WE3 A;  4EGY A;  2LSO A;  4QPO A;  2R4G A;  3LA7 A;  4I98 B;  1EJ9 A;  5B3S H;  4CSW A;  2Z16 A;  2IGO A;  3LST A;  1U9O A;  4KMF A;  4X6A J;  4JQF A;  3HSR A;  2XF7 A;  4CH7 A;  3M9A A;  1UST A;  1FZP B;  2NS8 A;  2H09 A;  1GV5 A;  2KRC A;  4X1E A;  1QPM A;  5JLX A;  5L3C A;  1R7J A;  1Q1V A;  2RVC A;  2KDZ A;  1R1U A;  3LSG A;  1HF0 A;  2R7W A;  4XLA A;  5TGT A;  2X51 A;  4U87 A;  2W57 A;  3ASN H;  3CZ6 A;  5E1X A;  1RI7 A;  3IAS 2;  1FMW A;  1YRN A;  3FBI B;  2EQR A;  3I58 A;  1X1D A;  3M07 A;  2FRH A;  3TP3 A;  5FKM A;  1RET A;  1N25 A;  2A6T A;  3K4M A;  2Z3Y A;  3SZP A;  3IRQ A;  1NG7 A;  2E1N A;  2Y69 H;  4HNV A;  2VPL A;  2QSF X;  1DP3 A;  4OOI A;  4R1H A;  3K4N A;  3GZN B;  1VTN C;  3GTL J;  1R22 A;  2MLK A;  3FMR A;  2VQL A;  1E17 A;  4BBS J;  2AXT C;  4AU7 A;  1ON1 A;  5E18 F;  2R7T A;  2E2H J;  1QVT A;  4A6D A;  3WTX C;  4KIT B;  1LE8 B;  1RR8 C;  5CVJ A;  1ZH5 A;  1NK2 P;  2QLZ A;  3ZQI A;  2IGM A;  1R5I D;  2F5F A;  4I09 A;  1OPC A;  1ZGW A;  1W7P B;  2MD0 A;  2Z2S B;  4EVI A;  2R5Z B;  1LVA A;  3ZMT A;  1AWC A;  4IHS A;  3MEX A;  3VYT B;  3JRB A;  2Y75 A;  3K10 A;  1Z67 A;  3G3Z A;  4CCN A;  1XG1 A;  2QEX I;  3M4O J;  3FM5 A;  2EIN H;  2RGV A;  1XD7 A;  4LK0 F;  2IS4 A;  4XRS A;  2EPF A;  1EH6 A;  2H27 A;  5C4X J;  2OF7 A;  4NQW B;  2DT6 A;  1WSU A;  4DIQ A;  4N4N B;  3ZMS A;  1KQ8 A;  2PMU A;  4AYB N;  3IV5 A;  3EDP A;  2L4A A;  3JTG A;  3SZT A;  4N4O B;  2OQR A;  3HIF A;  2HQA A;  1FP2 A;  1WQ2 A;  1YE9 A;  1BN5 A;  5BQT A;  2KJC A;  2F5D A;  2JA6 J;  4YRV A;  4OMY A;  2FX0 A;  1O3T A;  1IRF A;  1SD4 A;  1O7L A;  1IZ1 A;  3K7A J;  3WGI A;  2ZME C;  2EBI A;  2DT7 B;  3K1M A;  5HS7 A;  4B1R A;  2BW3 A;  4EJV A;  2EV5 A;  1XMX A;  3N4M A;  1T39 A;  3M8E A;  2XRO A;  4PZJ A;  3FMS A;  2OU2 A;  2QF7 A;  2QM3 A;  2X1E A;  2JTV A;  3OOU A;  1X1P A;  2EV6 A;  2IRF G;  4M9Z A;  1K78 A;  5M5X J;  4M3F A;  4E7J A;  1RUO A;  1I3A A;  1TQP A;  2O8X A;  3KZY A;  2XAJ A;  3QU3 A;  1ETY A;  4AD9 A;  3OIQ A;  2ZC2 A;  1B72 B;  2STW A;  1D1B A;  4NB5 A;  2LP0 A;  1FSE A;  3H5N A;  1EKE A;  2IA2 A;  2K86 A;  2VT2 A;  2DA1 A;  2ACJ A;  1I27 A;  2MYS A;  2CQX A;  3WTT C;  1GXQ A;  1RKW A;  2O7O A;  4AIK A;  2QQA A;  1X2N A;  3EUH C;  9ANT A;  3BC8 A;  2K5C A;  5KK1 A;  4BHC A;  2BHY A;  5DD8 A;  4DJA A;  3PQK A;  4EM1 A;  2UV1 A;  2Z99 A;  4YFX F;  1SAX A;  2KP6 A;  1VQ4 I;  4PJL A;  2D1H A;  3OSG A;  1AKH B;  3L2C A;  3HJE A;  1AHD P;  3GYH X;  3G1L A;  1V55 H;  4UUT A;  3JRA A;  4A3K J;  2NS7 A;  4BXU A;  5EEA A;  4LJZ F;  4KYW A;  3BJA A;  2HTS A;  1W1W E;  3ASO H;  1GVJ A;  1I1S A;  1KYW A;  4N9I A;  2EZL A;  1GLN A;  4D0P A;  2LNB A;  2R5Z A;  1QZY A;  3FF5 A;  2VJJ A;  4FE4 A;  4A12 A;  1U2W A;  2RQP A;  3KYL A;  4MHG A;  1XDU A;  3H1C A;  1FBQ A;  1X3Z B;  2MW8 A;  3OWT A;  3PIO F;  4D9J A;  3OYL A;  3N05 A;  4J01 A;  1K7A A;  2DPU A;  1BA5 A;  2R3S A;  2M1B A;  4IHY A;  2VE8 A;  3CF5 F;  1VQP I;  2GM4 A;  5IYB J;  2F5E A;  2LR8 A;  1OR7 A;  1Q1H A;  4Y3O A;  4A5N A;  5E3O A;  1H89 C;  2W00 A;  4U7D A;  1SMY F;  3NAR A;  4PJN A;  2H8R A;  4NHJ A;  4IF4 A;  5J4V A;  2R93 J;  4PGG A;  1SC7 A;  3D0S A;  3HHG A;  5FB2 A;  3DBR B;  1IO2 A;  3FXM A;  1YQA A;  2QA4 I;  1T38 A;  2ZCW A;  2HKX A;  2HDD A;  1ZQ3 P;  1RR7 A;  3LSK A;  1IF1 A;  3H36 A;  2FD5 A;  1B1B A;  2CWE A;  5DCM A;  1MH4 A;  4LFU A;  1S6L A;  3PUF A;  3LFK A;  4B47 A;  1BOB A;  2WY8 Q;  1A04 A;  3WHC A;  4OIP F;  1RPW A;  3OSF A;  3S1Q J;  1VND A;  2X48 A;  2JQ7 A;  2P5K A;  3HYI A;  4UUV A;  4UY8 I;  3GZ6 A;  5HLI A;  3GO5 A;  2ELK A;  5GAD J;  1FMV A;  3VB2 A;  2A68 F;  2M8E A;  3QWL A;  2QVO A;  1B72 A;  2E35 A;  3H9J A;  2G0E A;  3SYT A;  1J75 A;  3ZXS A;  3I9V 2;  4HF0 A;  4Y33 A;  2JVH A;  1T0F A;  1R5H A;  2XRN A;  2ME0 A;  2RKH A;  2VLA A;  2PMZ A;  1IXS B;  2IW5 A;  4NNJ A;  3W6V A;  2P5L C;  3HRS A;  2W24 A;  4B48 A;  3GXO A;  5M3M J;  2HU9 A;  4P96 A;  4FQG A;  2R7Q A;  2LKP A;  5CVU A;  3HOV J;  4QPQ A;  4DBQ A;  2KIQ A;  3U2R A;  2ESH A;  3TOB A;  4NC7 A;  5HOO A;  4GYI A;  5K1Y A;  3X2Q H;  2FNP A;  1R23 A;  4KDP A;  1XGN A;  2H6C A;  1ACI A;  1EV7 A;  3ABU A;  4LLG F;  1T8I A;  2PLY A;  4V2F A;  3BR3 A;  1YO5 C;  1OCO H;  3MWM A;  1CGP A;  3KLN A;  4UV8 A;  3HB9 A;  2TRT A;  4RGU A;  1OIS A;  4PCQ A;  1DGW Y;  3FHN A;  2P7V B;  3CF2 A;  3LSH A;  2JJ7 A;  2DA6 A;  4ZYD A;  2MG4 A;  4NUB A;  2KRF A;  3HZJ A;  4UVC A;  1QA6 A;  3T5X A;  2DFE A;  1PJR A;  4YII A;  5K5R A;  1S8N A;  3FXK A;  1C0W A;  4IQ4 A;  3M7G A;  4ON0 A;  2P4W A;  3EUA A;  2UUZ A;  4HQE A;  3PFI A;  1XSV A;  1V3F A;  4EQQ A;  2LMD A;  3RYP A;  3DLA A;  3HRT A;  4MEY F;  3CES A;  5AIQ A;  3CUQ B;  4A3J J;  4LB6 B;  1IXR C;  2O3F A;  2IEK A;  2VT3 A;  2R7O A;  4HLY A;  5LGU A;  3EUK L;  1X1A A;  3HDD A;  2Y0S N;  2B9S A;  2GQQ A;  4D5C A;  1QNT A;  2AQF A;  3E7L A;  5F04 A;  4I0A A;  5H2F C;  1OFC X;  5L3F A;  4G6T B;  4MIM A;  2XB0 X;  3HSE A;  4O6J A;  5JHF A;  1KYZ A;  2VUM J;  1TWG J;  4A0Y A;  2M2E A;  3FIW A;  2DYS H;  4MLO A;  3WTV C;  3OS1 A;  3OYM A;  3RKX A;  3M8F A;  3CLQ A;  1B6A A;  2MC4 A;  2M4K A;  2HQN A;  1LDK B;  4YIF A;  4H4K C;  2OCC H;  4KIG A;  2E5N A;  5AON A;  2XAG A;  3K4K A;  3BTJ A;  3WTW C;  1ITY A;  3RI4 A;  4WXD A;  3F8B A;  2F4I A;  2ZSI B;  1YI2 I;  2QSH X;  2Y2Z A;  4XM3 A;  2ME6 A;  1SFK A;  4HW0 A;  3E6M A;  1XX5 A;  2O03 A;  3BG6 A;  2AS5 F;  2OC6 A;  4ZTJ A;  1KU9 A;  4YG2 F;  1USS A;  2E36 A;  4ENN A;  4HX7 A;  4FHT A;  3GTP J;  3GTG J;  3MKW B;  3A02 A;  4S04 A;  4KT6 A;  1AA7 A;  2IXS A;  2EZI A;  3VFZ A;  4YIR X;  2KZV A;  4IX7 A;  3Q3S A;  2LKX A;  2UXX A;  2W25 A;  3ZQL A;  1G3T A;  1Z7U A;  4I99 C;  4UVB A;  3K1N A;  2MA3 A;  3RPU D;  2XGE A;  2DQL A;  2V7F A;  2YR2 A;  3PQJ A;  2ZXI A;  2R7X A;  1WCM J;  2IP2 A;  1RES A;  1GXP A;  2HVQ A;  4GXO A;  4HSR A;  3JRD A;  4XID A;  4F3Q A;  1TW2 A;  3O8G A;  1MD0 A;  4P5O A;  5H6Q A;  4EJO A;  2QQ9 A;  3FIS A;  4HV5 A;  3T1B A;  1WJD A;  4Q47 A;  1I6X A;  3E97 A;  4RM2 A;  2EFN A;  3GFJ A;  1RKT A;  1QHH D;  2XPW A;  3G6E I;  3RKY A;  4HDV A;  1O57 A;  2K27 A;  3ZPL A;  2G7U A;  4Q4Z F;  2VON A;  4FET A;  2ZJ2 A;  4HNT A;  4KMU X;  3F3X A;  4IZZ A;  2JUG A;  5K7H A;  2GXB A;  1WI9 A;  2ESN A;  1MBG A;  2VJ4 A;  4XMY A;  5D6F A;  2FSW A;  1MKM A;  1J5Y A;  4A5M A;  3CC4 I;  2HVS A;  2WAQ A;  2JRT A;  2ZBK A;  3ISP A;  2OZU A;  4QTR A;  3H5R A;  3TBI A;  4M73 A;  2JSP A;  1HKS A;  3CCR I;  3VDX A;  1IAW A;  2EIK H;  1T98 A;  2VC1 A;  4RAF A;  2GLO A;  4UXN A;  1ZAR A;  3CC7 I;  3VPR A;  4WXC A;  5CQG A;  1TT0 A;  2CW8 A;  3B6C A;  1HW5 A;  1WRJ A;  3QP6 A;  4XK4 A;  1QPI A;  3GZ5 A;  1Z3Y A;  4A2U A;  3CDL A;  4L0Z B;  2ZJP F;  2HPI A;  2ECC A;  2K4B A;  2WV1 A;  5F1J A;  3OYA A;  3H92 A;  1X4P A;  3CCL I;  2LLK A;  4ZC3 A;  3FBN B;  1TWC J;  4CZC A;  2V1N A;  1ZKG A;  4U0Y A;  4A3E J;  3AAF A;  4JP0 A;  2WAF A;  1TWA J;  1FYL A;  4C2U A;  1P4A A;  2E1O A;  4F93 B;  3CCU I;  2L9N A;  3BG7 A;  1FTT A;  4ETS A;  1Z77 A;  4C30 A;  5KNL A;  2ZSH B;  4LGW A;  2K3P A;  2HOA A;  3J7A O;  5J8C A;  3M3Y J;  2UWM A;  3AG2 H;  3V7S A;  1PUF A;  3CQZ J;  1WGX A;  2RNG A;  3QRF F;  2NVQ J;  3FMQ A;  3HRM A;  2EV0 A;  3CCE I;  5D4S A;  2K9S A;  1QVU A;  1JGG A;  1S7A A;  3CDH A;  4BHP A;  1ZGA A;  2BY1 A;  2E1M C;  4F92 B;  1U78 A;  2JUC A;  4CXF A;  3MZH A;  3RQ4 A;  1I39 A;  1P2F A;  3H0D A;  4MTE A;  3ZCO A;  3LSP A;  3F6V A;  1KU7 A;  2V26 A;  1RIO H;  4ZZL A;  2WTE A;  2H6B A;  2QZ8 A;  5E1W A;  5M3F J;  1ZG3 A;  4DQ2 A;  3I0T A;  4GGG A;  2D45 A;  4DOZ A;  3BTL A;  2L9R A;  1U0J A;  1ORK A;  2VC0 A;  3F22 A;  1IN8 A;  2ZNZ A;  3OYB A;  1G59 A;  1B4A A;  1J7K A;  3PSF A;  3RDI A;  3OS2 A;  1FOX A;  2I10 A;  1JHH A;  5KHD A;  3DEE A;  4ZYA A;  4OIR F;  2PN6 A;  1VQN I;  4LD5 A;  5J1R A;  2X4H A;  1UFM A;  3K4C A;  2ZFU A;  5ICC A;  4Q5S F;  2DTR A;  5LEK A;  3OYF A;  2AQE A;  1MMA A;  2CUF A;  2E5Z A;  3KP7 A;  1SFX A;  4KIB A;  1KA8 A;  1U8R A;  4Y15 A;  2VOO A;  2HDC A;  2WB1 A;  1VQ7 I;  1JKR C;  2RRE A;  3LA2 A;  1U5T B;  2LOO A;  2XAH A;  4BQA A;  2V6C A;  3BR2 A;  3WU2 C;  4AVZ A;  1QQI A;  3KFW X;  1YIO A;  1Z6R A;  3SEQ A;  2Z9O A;  3GFM A;  3S1N J;  3ZN1 A;  4P55 A;  3GTM J;  2XRL A;  3VYS B;  1IN7 A;  2DK5 A;  2YUS A;  4QSH A;  5FLM J;  2TCT A;  4ZDL A;  2KMU A;  3C2B A;  2IT0 A;  5EF6 A;  3GFL A;  3JAM Z;  4MNU A;  4E6K G;  5EGO B;  3L00 A;  3B73 A;  5FD5 A;  1AKH A;  1UZC A;  2WC2 A;  3WGG A;  1N75 A;  3RTR A;  1ZRF A;  3A0B C;  3IC7 A;  3S3N A;  2O8K A;  3U1K A;  2UZK A;  3BLY A;  2BVM A;  5A2Q K;  3VSL A;  4R79 A;  1R1T A;  3JSP A;  2ZXW H;  4IHT A;  1IG7 A;  1IGN A;  1ZYR F;  4EEF G;  3A01 B;  3GBG A;  3I4P A;  3DEU A;  4HX8 A;  3FXR A;  1EF4 A;  3RQI A;  4II2 A;  2DMQ A;  2R5Y B;  5CVR A;  5E8I A;  1T56 A;  3QAH A;  3RPU A;  3ROU A;  2EFO A;  5JR3 A;  5K7Z A;  3HOU J;  3I3L A;  3OL4 A;  2E2J J;  2LH9 A;  3Q0V A;  2X6Y A;  1PUF B;  3LFU A;  2RDP A;  4BL0 B;  3WG9 A;  5HDK A;  5K5O A;  4DBR A;  2XVC A;  4F91 B;  1YFH A;  5J3L A;  5J1Y A;  2CW7 A;  1N77 A;  4EJT A;  4ZYH A;  4GCV A;  3E6B A;  2QYO A;  3BZ6 A;  4G6D A;  3I55 I;  4CCL A;  2A5Y B;  3HTS B;  1XDS A;  3CJQ B;  1UMQ A;  4OAZ A;  3ZQ7 A;  4C3J J;  1FPQ A;  1EH8 A;  1QZE A;  1UHW A;  1JE8 A;  4IOA F;  3TOA A;  1Y1W J;  1W0T A;  2FF4 A;  1VQK I;  1Y56 A;  3OR1 C;  4BY7 J;  1EA3 A;  1S29 A;  2ZME A;  2Q0O A;  1LVK A;  3OY9 A;  2M5W A;  2QKL B;  2CSO A;  4MFE A;  5ILU A;  1K6O A;  4IVN A;  4L5I A;  3I53 A;  1VZ0 A;  1WHU A;  2LDU A;  4E70 A;  4AVP A;  4ENJ A;  3IWZ A;  1HBX G;  3EYI A;  1OCP A;  4WWC A;  4GDF A;  2PFB A;  5DTD A;  1PVE A;  2BW3 B;  2Y0M A;  1ETK A;  1MMN A;  2DA3 A;  2DN0 A;  2LK2 A;  4RS8 A;  2ZJR F;  4MEX F;  2G7H A;  3MCZ A;  2EIJ H;  1MH3 A;  1LNW A;  2KDO A;  4XSZ F;  3C7J A;  4LIU A;  3J81 K;  1NHA A;  4AM3 A;  4CYD A;  1OCC H;  4CUG A;  1Z0X A;  2Y9Y A;  2PJR A;  2ICW G;  4KT5 C;  5EJC A;  3J80 Z;  4YEJ A;  2KL4 A;  2MH2 A;  4HEA 2;  3TGN A;  5D5W B;  1MBF A;  4V2G A;  2HXI A;  1ZRE A;  4RLF A;  2EZH A;  4WF2 A;  3P9C A;  5E3M A;  4ZYG A;  1W5S A;  4XN3 A;  2B7E A;  4EAT A;  2PEX A;  5AIP A;  2OZ6 A;  2VBX A;  2PQ8 A;  3V42 A;  5BPD A;  2CQN A;  4E7H A;  4A93 J;  3H35 A;  2A3S A;  2FOK A;  1U3E M;  2O61 A;  3DF8 A;  3PNY A;  4LG3 A;  2XAS A;  1I50 J;  4HOB A;  2FEZ A;  3S14 J;  4IPA A;  3K4B A;  4HLX A;  4CZZ A;  4XLP F;  4KFC A;  4XLC A;  2OD5 A;  3BR5 A;  4XNF A;  5B5E C;  2A6H F;  1MSE C;  5DV5 A;  5HNH A;  2DPD A;  3VWB A;  3SFI A;  1YTY A;  1VI0 A;  1G8X A;  2E71 A;  5K5Q A;  1X3W B;  1QO0 D;  1SFE A;  2E60 A;  5CKT A;  3V8K A;  3ERE D;  1JTX A;  5HDG A;  1SMT A;  3ABT A;  4IEJ A;  2ADU A;  3COA C;  3RSN A;  4U0W A;  1ZG5 A;  2DA5 A;  2M87 A;  2LY1 A;  4KA4 A;  4BEH B;  3DBL B;  3OS0 A;  4HBL A;  1I1G A;  3BG5 A;  5FKK A;  1HW2 A;  3RKQ A;  4BQO A;  2HZD A;  4O5V A;  4P9F A;  1W7P D;  3ZMV A;  1FYK A;  4BJ6 C;  4A3B J;  3QOD A;  2XAQ A;  4S05 A;  2P6S A;  5CJ9 A;  2GIZ A;  1V5G A;  2ZME B;  3CP2 A;  1QZZ A;  4IKF A;  3CMM A;  3HL2 A;  1BI0 A;  2KZG A;  3TP0 A;  3DKX A;  4XLN F;  3EET A;  3C2H A;  1U5T C;  1CQT A;  1TLH B;  1TW3 A;  5LGN A;  2Z5U A;  3ZQG A;  2AO9 A;  2O0Y A;  2KIU A;  3GLL A;  3MAJ A;  4WX9 A;  2L4M A;  1F36 A;  4RB1 A;  2QBY A;  4XRF A;  2CYY A;  1BBY A;  4BJ5 C;  2LD5 A;  2LF8 A;  2K9M A;  2CFX A;  5B66 C;  1DU6 A;  2IS1 A;  2CUE A;  1MBJ A;  3LSM A;  3KP2 A;  4L9V A;  2Q1Z B;  1G3Y A;  5FKN A;  2VKH A;  3A0H C;  2DMN A;  4IRI A;  2V1X A;  4F55 A;  4DYQ A;  3MN2 A;  1WZ2 A;  5F6F A;  3ZR8 X;  2BGC A;  1A35 A;  1MMG A;  3S93 A;  4CCO A;  4JBA A;  2IGK A;  1V54 H;  1WJA A;  4RAY A;  4BEH A;  3BQZ A;  3KCC A;  4EM0 B;  2M45 A;  1Z21 A;  3OYN A;  3NEU A;  3F8F A;  3SEZ A;  2VPR A;  1TWF J;  2HZT A;  5KAF C;  2DOA A;  3BPX A;  2XHK A;  4KIF A;  2W82 A;  3TQN A;  3B6A A;  2ISY A;  2ECB A;  4RGX A;  3KEQ A;  2W85 A;  3SFZ A;  3L1P A;  1V5F A;  1X1B A;  4JYK A;  1BI1 A;  1MMD A;  1VQ9 I;  1FEX A;  4UUS A;  2FMY A;  2B63 J;  3JTH A;  3EQL F;  1FC3 A;  2K7L A;  5LGT A;  4BAY A;  4BQN A;  4H0E A;  1YG2 A;  4QLC U;  4NDL A;  2VI6 A;  1V5E A;  3JRC A;  4XIC A;  2DI3 A;  1WFX A;  2L5Q A;  4WCG A;  3LWF A;  4G7Z F;  1ZG1 A;  1HDD C;  3ABL H;  3K70 D;  3P9I A;  1QGP A;  4I2O A;  2Z33 A;  4B44 A;  3QU6 A;  4MQV A;  4UNO A;  4FE7 A;  3QOE A;  2BEO A;  3DKY A;  4IXA A;  3WU0 A;  1ETW A;  3F0C A;  2NVT J;  3ZQH A;  4L0Y B;  4Y52 J;  3TMO A;  3CJN A;  2VAS A;  3L2Q A;  1ETQ A;  1FNN A;  1H9G A;  1MSF C;  2BVL A;  2E1C A;  1P7J A;  2X85 A;  3IAM 2;  5DDG A;  2Z1D A;  1RC9 A;  1HLV A;  1T6S A;  2EFQ A;  3G1O A;  3WTS C;  1WWX A;  4CCM A;  2DMT A;  4OU0 A;  1Z3X A;  5JVT A;  3L9F A;  5A2Q Z;  4BY1 J;  3V8L A;  2CV0 A;  5ED4 A;  4EGZ A;  4OIN F;  5DUI A;  4G8X A;  2JA7 J;  1XGM A;  2WB1 N;  1R58 A;  2H1L A;  1TTY A;  3KP6 A;  3I54 A;  3BG9 A;  1FIP A;  5LRS A;  4I0B A;  3V7R A;  2XUB A;  5FGM A;  3P7N A;  1J59 A;  2QBY B;  4ESB A;  1O3S A;  3DCF A;  1JXS A;  1NK3 P;  2A69 F;  3SXY A;  3DFG A;  3BWG A;  4ASN A;  4CDG A;  2MC3 A;  4GYG A;  2W7N A;  3F9K A;  5CQE A;  1E3P A;  2K02 A;  5J47 A;  2IJL A;  4EV0 A;  4AIJ A;  5ICG A;  1LDD A;  2P81 A;  1WJ5 A;  2Y0S A;  3TO7 A;  2DQR A;  1XS9 A;  4BHB A;  1VQL I;  3HG9 A;  2RQQ A;  4HF1 A;  1LFB A;  5HS9 A;  3HTU A;  5LHH A;  3OYJ A;  3AL0 B;  2M0M A;  2E7W A;  3OYG A;  4KIS A;  3HOZ J;  2JA2 A;  2FQ4 A;  4BUP A;  3KIO A;  4D7N A;  1DP7 P;  4ZDP A;  2FA5 A;  3OYI A;  1R36 A;  4KN4 X;  2LC2 A;  3WOD F;  3R0A A;  1JJ8 C;  1NTC A;  3V4G A;  1YHQ I;  3CLO A;  2VBZ A;  5FLX K;  5E8G A;  2CU7 A;  3I4M J;  2IA1 A;  3L2W A;  1TC3 C;  1Z91 A;  3L2R A;  2F2E A;  2KPM A;  5DCM B;  2W48 A;  3MQ0 A;  1P6R A;  1KGS A;  2NRA C;  4I01 A;  2A5W A;  4B4C A;  1B8I A;  2R7D A;  3A03 A;  4D1Q A;  1OCZ H;  2XF5 A;  2OAZ A;  5CLS A;  1G4D A;  1OKR A;  4FTH A;  3L2V A;  3HEF A;  2QQ8 A;  4LG0 A;  3LOC A;  4W97 A;  2P7C B;  5GTH C;  2DA7 A;  2BY0 A;  3C3W A;  1D0Z A;  4KJZ A;  3ZQQ A;  1HSJ A;  1TNT A;  2ID3 A;  1LJ9 A;  2QQB A;  4UVA A;  1QRY A;  1YS6 A;  2K9Q A;  3QPL A;  4PSX A;  4A3G J;  1R49 A;  2JA5 J;  2KQR A;  1R6R A;  3KET A;  4MFD A;  1SVM A;  1ZR4 A;  1WPK A;  1IRX A;  5IYC J;  1J09 A;  1MNM C;  2CQK A;  2P0W A;  3OYE A;  1N78 A;  1U5T A;  2R7V A;  3LAP A;  3PO2 J;  2GOM A;  4IHW A;  1F43 A;  2NVU B;  2RN7 A;  2LYC A;  3GLX A;  2NVY J;  1K61 A;  3D5L A;  5D5V B;  2FUG 2;  1IW7 F;  3HGG A;  2EIL H;  5HNF A;  1IN4 A;  2Y30 A;  2NOG A;  3RJP A;  1UG2 A;  3W2V A;  2XSD C;  3LAJ A;  1BR4 A;  4PFO A;  1Z1D A;  2VOD A;  1PYV A;  2VBW A;  4CCK A;  2EA4 A;  2DU9 A;  3ZMU A;  5J8F A;  4RAG A;  2J5P A;  3QPT A;  4NQW A;  5L3E A;  5L3G A;  2JWT A;  3NQO A;  5EG0 B;  1FYM A;  1ZGJ A;  1HCR A;  3BCB A;  1O7F A;  3I64 A;  4IOC F;  4XKV A;  2HOT A;  1IDZ A;  2K9N A;  2KRH A;  2OTJ I;  4II3 A;  4MGR A;  1X19 A;  2CH0 A;  2JRM A;  2ZB9 A;  3Q5F A;  3GTK J;  3GEZ A;  4RM3 A;  3DU5 A;  4NC6 A;  1UHM A;  2B0L A;  1WKM A;  1FX7 A;  5BPI A;  4XLF A;  1MBK A;  1OCT C;  4W1U A;  2R7Z J;  3CO7 C;  5FRN A;  4U7B A;  5IY5 H;  1XPX A;  5JHU A;  5LRR A;  2FQ3 A;  1YIJ I;  3BZC A;  2IBD A;  1IRZ A;  4N0B A;  5L3B A;  5FLX Z;  5DCF A;  3LL7 A;  3WGH A;  1ZN2 A;  3CTA A;  3DWL E;  3G1M A;  4AUX A;  4LIT A;  3GTO J;  5IOY A;  1QHG A;  3PUB A;  3CMY A;  2DOE A;  2EIM H;  3IWF A;  1VQM I;  2D1V A;  2XSJ C;  3AL0 C;  1XSX A;  4DYR A;  5FJ8 J;  4J19 A;  2H8W A;  1A31 A;  2ZNY A;  4GFB A;  5HLT A;  3G2B A;  2G9W A;  3KZI C;  4BKX A;  1G3W A;  5DS9 A;  3REO A;  2PMH A;  3ONQ A;  4M6V A;  1W5C C;  2QGU A;  3W6J B;  1QU3 A;  2IVM A;  1F1Z A;  3HKZ A;  5C4J J;  2OPT A;  1R5G A;  2VB6 A;  3S2D J;  2HR3 A;  4G12 A;  2FXA A;  4BXX J;  2ISZ A;  3ULQ B;  3FXL A;  3TW6 A;  2HS5 A;  2DFH A;  4ESJ A;  4D7M A;  1LPQ A;  4HYE A;  2KT0 A;  1P4W A;  1HST A;  3RZO J;  2V4J C;  3IL2 A;  3OV8 A;  1U9N A;  1GHC A;  3E0J B;  2XF6 A;  2BY2 A;  1D0Y A;  1HKQ A;  1D8J A;  2X6W A;  4JOM A;  2Q2E A;  3BPV A;  3HUG A;  2KIM A;  1MDM A;  1W7P A;  1T08 B;  2JT1 A;  1BIB A;  1IDY A;  1WI3 A;  3AFH A;  2FE3 A;  2NYX A;  2DXI A;  3TDU C;  3C2G A;  2AXL A;  1MW7 A;  4FT8 A;  4BS9 A;  3ZN0 A;  1VQO I;  5FFX A;  2HOE A;  3CP8 A;  1X4O A;  3M1C A;  5GPA A;  2E2I J;  2VKV A;  3Q9V A;  2NXN B;  1LEB A;  2V9V A;  1OMI A;  1RNL A;  3HXL A;  2W4S A;  2Y31 A;  5E79 C;  4A0X A;  5J6X A;  1YJW I;  5TJJ A;  4HRI A;  2OV7 A;  2RAE A;  1VQ8 I;  1LEA A;  2WAD A;  4CHU A;  2CG4 A;  2L54 A;  2MLG A;  5IYD J;  1PUE E;  4LMY A;  5LLQ A;  1YW9 A;  4M72 A;  4C2T A;  2HQ5 A;  1ZK8 A;  1STZ A;  3H9G A;  1PP8 F;  1W0U A;  1ZTR A;  3JSO A;  2TDX A;  1O3Q A;  5GPC A;  2HQR A;  3A1Y A;  2CGP A;  2F4M B;  2HYG D;  1JKQ C;  1E2X A;  4M6X A;  2LTP A;  3KP5 A;  4G6Q A;  4XRS G;  4XOP A;  4LIV A;  5JLW A;  5HDN A;  3CCJ I;  1BI3 A;  3EPZ A;  1MJ9 A;  1I5Z A;  4RB0 A;  1JGS A;  4ESF A;  5LHI A;  3B02 A;  1IJW C;  4Z6Y A;  4L5E A;  3U21 A;  6PAX A;  3GCM A;  3IP4 B;  3TO6 A;  1JI8 A;  1LDJ A;  5D5X B;  2NAZ A;  1LKX A;  2XC7 A;  4M71 A;  1YS7 A;  4CYC A;  1Y8Q B;  3H0G J;  3IH3 A;  3DBH B;  4A69 C;  4ZZD A;  3F21 A;  3DPL C;  4RAZ A;  1D5V A;  1IRG A;  1RZ4 A;  4A6E A;  1DGR M;  4DGW B;  4ITV A;  4RB3 C;  4XON A;  3GTQ J;  1R1V A;  1BIA A;  3ESW B;  2M8G X;  5HLH A;  2QEN A;  1NG6 A;  3AG4 H;  2NOJ B;  1LFU P;  1K78 B;  3ECO A;  4MQ9 F;  1HOM A;  2F48 A;  4KIC A;  1H0M A;  1SD6 A;  1SFO J;  3JRE A;  1JUS A;  4BGD A;  1U8B A;  2BV6 A;  3A2K A;  1YX5 A;  1P92 A;  1ZRC A;  4PFP A;  2HVR A;  1MDM B;  3RPQ A;  5J4Y A;  1KQ0 A;  3GME A;  3R0J A;  2MBF A;  2KJB A;  4RA2 A;  1W5T A;  5TRD A;  1YJ9 I;  5FLV A;  2L7Z A;  1ONV A;  2BHZ A;  1SVL A;  4HA8 A;  1ZRD A;  4IHX A;  3QP5 A;  1KZH A;  2XPV A;  4M9S A;  3WU1 B;  3JRG A;  2CQQ A;  4FIS A;  3OMY A;  1ODD A;  2VBY A;  3V8J A;  2XGC A;  2HKO A;  3IHU A;  4MTD A;  1RRJ A;  1I3Q J;  3BDD A;  3PFY A;  4D5F A;  2CRG A;  2VJ5 A;  4DYC A;  4B09 A;  1T2K A;  1BL0 A;  1MJB A;  1W36 C;  3PIP F;  3D5R C;  1YRN B;  2M34 A;  3S1M J;  4A3D J;  3NAU A;  1YYV A;  2XAU A;  2ELJ A;  3ELK A;  4ANJ A;  2X1C A;  3LA3 A;  4IHV A;  4JX4 A;  2RC4 A;  3K4J A;  4DZP A;  1AU7 A;  1R4N B;  3FXO A;  4XQF A;  2KKO A;  1H8A C;  1OYI A;  2F5C A;  2KLO A;  3GW2 A;  4I6Z A;  4EJW A;  3FKI J;  2ZJQ F;  1XCV A;  4GRI A;  2VQC A;  5DM7 F;  3WG7 H;  1Z05 A;  4C3I J;  1YLF A;  3I59 B;  3VSK A;  2V9P A;  3G4S I;  1L0O C;  4LOC A;  3TO9 A;  1WJE A;  3CCQ I;  2WA0 A;  2FU4 A;  3FK6 A;  4I76 A;  2WAE A;  2HI3 A;  1BI2 A;  3DXJ F;  4PGH A;  4BJT A;  5FRM A;  4MO7 A;  3ZRG A;  1VQ5 I;  2FBI A;  3F8C A;  3VEP A;  2A61 A;  2ZXJ A;  3EUH A;  4HZF A;  1D8K A;  4M6Y A;  1REP C;  3FXJ A;  1FJL A;  4RDU A;  4ZYE A;  3I5U A;  2V1U A;  4XKB A;  1Y6I A;  1JT6 A;  4FX0 A;  5D5U B;  2W84 A;  3Q0W A;  1IXC A;  4HNU A;  1S5L C;  5LBQ A;  3J7Z I;  3SJM A;  1UCR A;  2EFP A;  2VJI A;  2VKE A;  4QWQ A;  1BJZ A;  4PK4 A;  3WE2 A;  1DPU A;  1WH5 A;  3C18 A;  2E7X A;  3HSF A;  3BOQ A;  1RUN A;  5EGO A;  1JT0 A;  3J7A Y;  1A6I A;  3PNV A;  4R8H A;  1Y0U A;  4CA0 A;  1HDP A;  3AG1 H;  5CVI A;  3KX2 A;  3F23 A;  5J40 A;  2HXO A;  3I56 I;  4JX6 A;  3O6B B;  4HX4 A;  1JUM A;  2LKS A;  1XSD A;  2QUF A;  4XSX F;  1A5J A;  3ZOB A;  3OYC A;  5F27 A;  2PI0 A;  3BG3 A;  5BNG A;  5FKO A;  4ABZ A;  4E7L A;  1BR1 A;  2JZY A;  1P4X A;  2LY9 A;  4ENM A;  3C1D A;  5IT9 K;  2LBF B;  3ZQC A;  3IRR A;  5D6E A;  1WJF A;  2YX7 A;  3DTE A;  3JRF A;  1MJA A;  2JVG A;  1IC8 A;  3ZGK A;  2BXZ A;  1JJ6 C;  1XGO A;  4OMZ A;  2DBB A;  3SZG A;  1TT5 B;  5FRO A;  1Y39 A;  1X1C A;  4HPQ A;  4OIO F;  2JN6 A;  2FML A;  2XIG A;  2JA8 J;  1AOY A;  1W4M A;  3J7Y J;  3H3V K;  4A3L J;  3KPH A;  2W1O A;  1OYY A;  5LD2 C;  5IT9 Z;  1B8I B;  2BBY A;  4G7O F;  3RYR A;  1YX3 A;  1BC8 C;  2DA2 A;  2BE5 F;  2STT A;  2K3F A;  4O3M A;  1ZR2 A;  3DTK A;  2VQH A;  2DMU A;  5ICE A;  4LG0 B;  2WY7 Q;  3PSI A;  2GXG A;  2O9L A;  3L7W A;  4E7S A;  5GAG J;  5EEH A;  5DM6 F;  5D8K B;  1MZB A;  3CJT B;  1S3J A;  4PUS A;  2IAI A;  3BY6 A;  1J0R A;  5FD6 A;  1SEU A;  2M7A A;  1BW5 A;  1GV2 A;  4BBR J;  3Q9S A;  1GT0 C;  5DD4 A;  3MD2 A;  3JAM K;  3O8H A;  4IRH A;  4YEL A;  2CUJ A;  3QYF A;  4IQJ A;  2L9S A;  3G73 A;  2M30 A;  2XGX A;  2MAB A;  3DU6 A;  3DQV C;  2DMP A;  3QPS A;  3OYD A;  2OTL I;  1SFU A;  3MKZ A;  4JK1 X;  3OOP A;  4LK1 F;  1T33 A;  2O5R A;  5JI6 A;  3MVP A;  3DP7 A;  2FBH A;  3A4C A;  2D5V A;  1TNS A;  5B1A H;  5BOX A;  2R0Q C;  4PDK A;  5H6R A;  1ZEL A;  3W6K B;  5EG0 A;  4WK8 F;  2EA2 A;  2ELH A;  1XN7 A;  2E34 A;  3IKT A;  4TV7 A;  4I02 A;  1FWZ A;  3D5S C;  3QOP A;  3R4K A;  5FFZ A;  2FNA A;  4BQQ A;  2CS3 A;  3WTY C;  2OJE D;  2NVX J;  4F7Z A;  4HV6 A;  1FLI A;  1BC7 C;  1FTZ A;  2NS0 A;  1VFC A;  1ZHF A;  4AID A;  2HOS A;  1X3U A;  2OA4 A;  4U88 A;  1H9T A;  1YOV B;  2XKP A;  3DEW A;  2A6E F;  3WHB A;  1TBX A;  4Q48 A;  3BQY A;  1SAN A;  5EZG A;  1FBS A;  3AKZ A;  3FM3 A;  1Y0N A;  4XRM A;  1G3S A;  1K4T A;  3W3C A;  1R4M B;  1H88 C;  2XAF A;  3SDB A;  3K1P A;  4EMS A;  2CV1 A;  4GO1 A;  5M5W J;  1TL8 A;  2DO7 A;  2E1M B;  5TIS C;  3E1S A;  3S8P A;  4HDU A;  4BE2 A;  3M8J A;  2I8D A;  3T0Y A;  1XTA A;  4G94 A;  3F72 A;  4NBQ A;  3CCS I;  3FWE A;  2X6O A;  2DJI A;  3S15 J;  1Z6T A;  3KYC B;  2VKD A;  1E0E A;  2EK5 A;  5KVR A;  1D1A A;  1D3Y A;  2WV0 A;  4L9J A;  4RBO A;  3Q0U A;  3EYY A;  2CUZ A;  3S2W A;  1ERD A;  3UKG A;  4ZH4 F;  1G6N A;  2BY3 A;  1MND A;  3HOW J;  3I59 A;  3DPU A;  3I4N J;  1S7O A;  2P8T A;  2XB5 A;  2DJN A;  3S1R J;  4F52 A;  2JSC A;  5LFA A;  2VXD A;  2X9D A;  2DT5 A;  1IN5 A;  5IT3 A;  1JHF A;  5D8L B;  5E3N A;  4BE1 A;  4A3C J;  1HW1 A;  4ZDO A;  1J2X A;  1POG A;  1ETX A;  3RKW A;  5HVQ C;  2RNJ A;  1B9N A;  3HGY A;  3CUO A;  2R5Y A;  5BMZ A;  2MGQ A;  1CF7 A;  1B9M A;  1TP4 A;  1KU3 A;  2JPC A;  2LF7 A;  2MSY A;  3NWS A;  1XCB A;  2V6E A;  2PJP A;  4UHT A;  1S7E A;  1UG0 A;  1O4X A;  3ZMZ A;  3BR0 A;  4BXF A;  2LRE A;  3S3O A;  2PG4 A;  4N9H A;  2JPB A;  3OIP A;  2H1K A;  3TDZ C;  3ABM H;  5J1U A;  2JK3 A;  3CDI A;  4X0G A;  2K9L A;  2VL8 A;  1Y8R B;  3QYB A;  1DQU A;  1E3H A;  3NWT A;  5H20 A;  4BYY A;  2VXZ A;  4M9X A;  4UB8 C;  2L02 A;  2DDA A;  5GAH J;  2VN2 A;  2ZKZ A;  5IP6 A;  1O3R A;  2GA1 A;  4L9N A;  3K9T A;  2M4G A;  2CV2 A;  1J9I A;  4AWX B;  3OYH A;  3HBL A;  3CUQ C;  2E19 A;  2K40 A;  4IL6 C;  4KUM A;  1XGS A;  4A0Z A;  1OQY A;  4I7H A;  4M3B A;  5GAE J;  3W2W A;  3HOS A;  4HST A;  1IV8 A;  2H94 A;  5HS8 A;  5IP9 J;  2VOP A;  2R92 J;  3H9Q A;  5KAI C;  4PJ0 C;  5CYV A;  5DYM A;  2Q8K A;  3GTJ J;  3FX3 A;  1GDT A;  1ETV A;  2P6T A;  4B3A A;  1OCR H;  4UB6 C;  4K2E A;  4C2M J;  4KN7 X;  2XPU A;  3K6G A;  3TED A;  1KON A;  2GIV A;  4M3E A;  1I6H J;  3FK7 A;  2IS6 A;  1ZLK A;  5E3L A;  3U1D A;  2HWV A;  4Z2Y A;  1XMK A;  2FBK A;  4HG2 A;  2R7F A;  4Y7N J;  3LSR A;  3T8R A;  5LEJ A;  3ZQF A;  4RB2 C;  1G2H A;  3KYD B;  3JW4 A;  5EZH A;  4B8X A;  1WH7 A;  2COM A;  5GP9 A;  4IO9 F;  3VOE A;  1KQ9 A;  2HEO A;  1DU0 A;  1FSH A;  2V1D A;  4CGZ A;  3IUO A;  1A6Q A;  1R9T J;  3NRV A;  2WAQ N;  4Y13 A;  3BR1 A;  5C3E J;  1TQM A;  1UHS A;  4CYC B;  1L3L A;  1ZAO A;  3TL4 X;  3KEO A;  1PP7 U;  1XMA A;  3CCY A;  3MZY A;  4A3F J;  2ZXH A;  1YJN I;  5ILV A;  1YW7 A;  1YW8 A;  1EH7 A;  4ZTF A;  1HA8 A;  2X6X A;  2IGN A;  2PBI A;  5F0H A;  2QCO A;  3LQR A;  3RZD J;  2BYV E;  4HAM A;  1F4K A;  2L9V A;  3DPT A;  2VQG A;  2EH3 A;  1R00 A;  4Y17 A;  1Z9C A;  1M1E B;  3WTU C;  3QQA A;  5FO5 A;  1TWH J;  2GAU A;  5E20 A;  2Q2E B;  1FOY A;  3WTZ A;  1KU2 A;  5IPA A;  1LFP A;  3VYR B;  1TZL A;  3HRU A;  2A05 A;  3OYK A;  3LQQ A;  1JUP A;  1LB2 A;  4FAS D;  4EM2 A;  3FZV A;  3TW7 A;  1DDN A;  2YX4 A;  2L2O A;  4OIQ F;  2KHM A;  3S2H J;  3SHF A;  1BR2 A;  1BM9 A;  3ML6 A;  3MFK A;  3CD6 I;  3FXQ A;  4BU2 A;  4P9U A;  2N8G A;  3QPH A;  4G7H F;  3HOT A;  3R61 A;  1IUY A;  3H3U A;  5EYR A;  4L18 B;  3F8N A;  1YIT I;  3BTI A;  3QYE A;  2DYR H;  3KLO A;  1GUU A;  4A3M J;  2WWY A;  1LE8 A;  3K69 A;  4CO8 A;  1LUJ B;  4UV9 A;  2HNH A;  5IOZ A;  3HKZ N;  3KE2 A;  2P5V A;  4XL9 A;  3J81 Z;  3U9G A;  4BDY A;  4LB5 A;  2DOD A;  3L09 A;  3N97 A;  2HYJ A;  4BNC A;  2V79 A;  3K4L A;  4PJJ A;  2KFD A;  1MIJ A;  2I5U A;  3CUQ A;  1T0F C;  2LG4 A;  3AG3 H;  2X1D A;  2OBP A;  4JX5 A;  2L7M P;  3RIR A;  3KZZ A;  1F9N A;  1FY7 A;  3PJR A;  3E5U A;  2PMZ N;  4G9Y A;  2XKO A;  5ILS A;  2F6C A;  2KIS A;  2K4J A;  2QWW A;  3E6D A;  1WJB A;  4RGR A;  3UNG C;  5K7F A;  4CIC A;  4BH9 A;  1R71 A;  1UEL B;  2GZW A;  3OL3 A;  3GFI A;  3FDY A;  4BAC A;  1P7I A;  2HDW A;  5JFR A;  3K70 C;  1FOK A;  4C9Y A;  3F8M A;  3FHZ A;  2RV8 A;  2EB7 A;  3VYU B;  3SDG A;  4XOR A;  3F6O A;  5HLG A;  2D2W A;  2LBF A;  1QBJ A;  4ZJZ A;  3TKY A;  3CME I;  1WVR A;  1SVO A;  5F64 A;  1V4R A;  3R6S A;  1APL C;  1S72 I;  4E4H A;  1FOW A;  5LHG A;  2UXN A;  3I71 A;  2IPQ X;  3PO3 J;  3K2A A;  2Y48 A;  1K79 A;  3E5X A;  1SD5 A;  5DUK A;  1Y1V J;  3HM5 A;  2YU9 J;  3HHH A;  1E3O C;  2DAO A;  3ZMD A;  4S0H B;  4XR6 A;  1FP1 D;  2IS2 A;  2GXA A;  3M1E A;  3D1N I;  4DNC A;  2JMW A;  4RLQ A;  4DZJ A;  3SQN A;  4E7Z A;  5JVG F;  5ERI A;  2BXY A;  4AYB A;  3BTC A;  4FCY A;  1D0X A;  4AC0 A;  3E6C C;  5GTI C;  4PSW A;  2F4O B;  2VE9 A;  1XB4 A;  2YSR A;  1JKO C;  4ENK A;  2GOX B;  4XLH A;  5F08 A;  4OAY A;  1UB9 A;  5FKL A;  4FX4 A;  2DOF A;  2HFH A;  2LFB A;  2CW0 F;  4L9T A;  2KIF A;  3K0L A;  5ICF A;  2YU3 A;  3MMY B;  2OCE A;  5M5Y J;  3HOX J;  1MGT A;  3W2A A;  1HC8 A;  3JRI A;  3T8T A;  2XV4 S;  3FXU A;  2IA0 A;  1W36 D;  1LQ1 A;  1ENH A;  2V9K A;  3KP4 A;  4J00 A;  2R7U A;  1UJ8 A;  2DFF A;  2EFW A;  3GUD A;  1X58 A;  2F5V A;  2FOW A;  5F1R A;  2L7F P;  3GX4 X;  3CCV I;  2K85 A;  4BDZ A;  3PNT A;  4B43 A;  3G71 I;  1BJA A;  4CCJ A;  3BT9 A;  5KCM A;  2EZK A;  3V7C A;  2L3D A;  1OJL A;  3L2U A;  2HPM A;  2DK8 A;  4C3H J;  1U6G A;  5DEQ A;  3ECH A;  2O6G E;  5CPR B;  3A01 A;  1MMS A;  2COB A;  4XKW A;  1SAU A;  3JCU C;  3P9K A;  5HOD A;  1FIA A;  2ETH A;  2PX9 A;  1IUF A;  4LLL A;  1SD7 A;  1GVD A;  5L3D A;  1OLT A;  1B59 A;  2XGD A;  3GWZ A;  3LSI A;  2LVS A;  3P5J A;  2Y9Z A;  4U0V A;  5C44 J;  2GWR A;  3GF2 A;  3HC7 A;  1UAA A;  2MH9 A;  5CVV A;  1K4S A;  4RMN A;  4XKC A;  3H5A A;  3J80 K;  2M9H A;  3O2P E;  3E5Q A;  1MNE A;  3ERM A;  4P1W A;  4IJA A;  5D4R A;  4PJM A;  4Y4R A;  3BJO A;  4RGS A;  4E7I A;  1OYW A;  1D5Y A;  2M7B A;  5E17 F;  4HF2 A;  4YFK F;  1K6Y A;  3KP3 A;  2DA4 A;  3BP8 A;  3K2Z A;  3ZP5 A;  2HYF A;  1ULY A;  2ID6 A;  5EEG A;  2OUM A;  3HUG B;  3PL8 A;  2CMP A;  4XBF A;  1DUX C;  3VOD A;  1P9Q C;  2NNN A;  2BZT A;  1ON2 A;  4NC8 A;  4B3X A;  4HQM A;  1PDN C;  3JR9 A;  2XDV A;  2LY2 A;  5IP7 J;  2DDB A;  2LRD A;  1BOA A;  4WXH A;  2X0L A;  1HQC A;  3DLL F;  2L01 A;  5F0F A;  1VF9 A;  2ZO4 A;  3BZK A;  2VIX A;  2OQG A;  2GA2 A;  2YPR A;  4M74 A;  2HGC A;  1DPR A;  1ZLJ A;  3BJ6 A;  2R7S A;  2PJR B;  1F5T A;  2QSG X;  2L7K A;  3CC2 I;  3PM1 A;  2NNY A;  3MKL A;  3ABK H;  3FKJ A;  4LLN A;  2DTZ A;  2CJJ A;  5B1B H;  1FT9 A;  1TQI A;  3CJR B;  4XOT A;  3LNQ A;  3LMM A;  4BE0 A;  3MZ8 A;  2DCE A;  1MBE A;  4QIW N;  4UUS B;  3IKV A;  4V19 K;  2J5O A;  2HTJ A;  5EDN A;  2EJR A;  2CQ7 A;  2AHQ A;  1WJC A;  3S17 J;  1T95 A;  2R7R A;  2DFI A;  1JTY A;  4AIH A;  2DW4 A;  1IV6 A;  3R60 A;  2MFZ A;  3OR2 C;  3LSJ A;  3HPH A;  3BCA A;  1FBU A;  1XC5 A;  3KEY A;  5E1Z B;  2DLL A;  3CCM I;  2L0K A;  4L5J A;  2EWN A;  3OIO A;  1K83 J;  3HOY J;  3IH4 A;  1IN6 A;  3MKY B;  1S9H A;  2M3A A;  3CMA I;  1HXD A;  4M3G A;  3DTI A;  2BOL A;  3S3M A;  3HPG A;  1CF7 B;  2GBY A;  5F0C A;  1MBH A;  3BR6 A;  2YS9 A;  2FJ1 A;  1BW6 A;  1D1C A;  3DKW A;  3O3K A;  2A07 F;  4YFN F;  1HKT A;  3BRO A;  3S32 A;  4OWR B;  3JRH A; 
#chains in the Genus database with same CATH homology
 2M0C A;  1JKP C;  3WHB A;  4W97 A;  3BQY A;  2DA7 A;  1SAN A;  2WV1 A;  3S16 J;  1X2M A;  5F1J A;  5EZG A;  2ID3 A;  4DW6 A;  2LLK A;  1QRY A;  1TWC J;  2K9Q A;  3QPL A;  3IH2 A;  1ZKG A;  2ECC A;  4XRM A;  2JA5 J;  4A3E J;  1ETO A;  4A3G J;  4M3D A;  4JP0 A;  4A3I J;  1H88 C;  1TWA J;  4MFD A;  1ZR4 A;  2E1O A;  1WPK A;  1FTT A;  5M5W J;  5IYC J;  1Z77 A;  1MNM C;  2HOA A;  3M3Y J;  3PO2 J;  1PUF A;  4IHW A;  1F43 A;  2X6O A;  3CQZ J;  3S15 J;  1WGX A;  2NVY J;  1K61 A;  2NVQ J;  3HGG A;  1U9O A;  2K9S A;  1QVU A;  1JGG A;  2Y30 A;  4RBO A;  2NOG A;  2XSD C;  1UG2 A;  3Q0U A;  4X6A J;  2NS8 A;  3UKG A;  1GV5 A;  3HOW J;  4X1E A;  3I4N J;  2XB5 A;  5JLX A;  2DJN A;  3S1R J;  1U78 A;  2X9D A;  1Q1V A;  2KDZ A;  5E3N A;  4A3C J;  3LSG A;  2JWT A;  3LSP A;  1HF0 A;  5EG0 B;  1POG A;  1ETX A;  1HCR A;  3JRH A;  5M3F J;  2HOT A;  1IDZ A;  2K9N A;  3HGY A;  2R5Y A;  1YRN A;  2MGQ A;  2EQR A;  2MSY A;  3TP3 A;  5FKM A;  2ZB9 A;  3BTL A;  1RET A;  2L9R A;  3GTK J;  1ORK A;  1S7E A;  1O4X A;  3BR0 A;  4HNV A;  1MBK A;  1OCT C;  4W1U A;  2R7Z J;  2H1K A;  2I10 A;  5J1U A;  2JK3 A;  5J1R A;  1IRZ A;  2IBD A;  3GTL J;  4BBS J;  2CUF A;  3G1M A;  4AUX A;  3GTO J;  5IOY A;  3CMY A;  2E2H J;  5IP6 A;  1QVT A;  1LE8 B;  1NK2 P;  5FJ8 J;  4DYR A;  4J19 A;  1JKR C;  4GFB A;  3HBL A;  3ZQI A;  3BR2 A;  4BKX A;  2E19 A;  2K40 A;  5DS9 A;  4M3B A;  1ZGW A;  3S1N J;  4M6V A;  3GTM J;  2R5Z B;  5IP9 J;  2XRL A;  2R92 J;  3JRB A;  2YUS A;  4QSH A;  3GTJ J;  5FLM J;  1GDT A;  1ETV A;  1XG1 A;  2TCT A;  4B3A A;  5C4J J;  3C2B A;  2OPT A;  5EF6 A;  3S2D J;  4C2M J;  3M4O J;  2XPU A;  4G12 A;  4BXX J;  3TED A;  5EGO B;  4M3E A;  1I6H J;  3FK7 A;  1AKH A;  5E3L A;  3TW6 A;  4XRS A;  4D7M A;  5C4X J;  2OF7 A;  2O8K A;  2KT0 A;  3RZO J;  3LSR A;  4Y7N J;  3ZQF A;  1U9N A;  4AYB N;  3IV5 A;  1G2H A;  1IG7 A;  1IGN A;  4EEF G;  3A01 B;  5EZH A;  3GBG A;  1WH7 A;  5GP9 A;  1EF4 A;  3RQI A;  2DMQ A;  2R5Y B;  1DU0 A;  1T56 A;  3HOU J;  2JA6 J;  5K7Z A;  1IDY A;  1WI3 A;  1R9T J;  2E2J J;  2FX0 A;  2WAQ N;  3Q0V A;  3BR1 A;  5C3E J;  3K7A J;  1PUF B;  1UHS A;  2EBI A;  4CYC B;  4B1R A;  5J3L A;  5J1Y A;  3CCY A;  5GPA A;  2VKV A;  4A3F J;  2E2I J;  2QF7 A;  3OOU A;  5M5X J;  5F0H A;  2QCO A;  4M3F A;  3RZD J;  1UMQ A;  1B72 B;  1ETY A;  2Y31 A;  4C3J J;  2RAE A;  2LP0 A;  2EH3 A;  5IYD J;  3QQA A;  1Y1W J;  1W0T A;  1TWH J;  2DA1 A;  2HQ5 A;  1ZK8 A;  4BY7 J;  2CQX A;  1RKW A;  4MFE A;  5IPA A;  2O7O A;  1W0U A;  1ZTR A;  1X2N A;  5GPC A;  1JUP A;  9ANT A;  1OCP A;  1JKQ C;  3TW7 A;  5DTD A;  2LTP A;  1ETK A;  2DA3 A;  2DN0 A;  3S2H J;  3OSG A;  2LK2 A;  1AKH B;  4XRS G;  1AHD P;  3G1L A;  5JLW A;  4UUT A;  2N8G A;  1MH3 A;  3JRA A;  4A3K J;  2NS7 A;  5EYR A;  5EEA A;  1IJW C;  3BTI A;  4L5E A;  1Z0X A;  2Y9Y A;  1GUU A;  4A3M J;  1LE8 A;  2EZL A;  1MBF A;  5IOZ A;  4V2G A;  2HXI A;  3HKZ N;  2R5Z A;  2EZH A;  4FE4 A;  5E3M A;  4CYC A;  2HYJ A;  3H0G J;  3IH3 A;  4A69 C;  2MW8 A;  1BA5 A;  4IHY A;  4JX5 A;  2L7M P;  5IYB J;  2GM4 A;  3GTQ J;  2LR8 A;  5E3O A;  1H89 C;  2M8G X;  2PMZ N;  4A93 J;  3NAR A;  2H8R A;  1LFU P;  1I50 J;  2R93 J;  1HOM A;  1SFO J;  3JRE A;  3S14 J;  5K7F A;  1JUS A;  1U8B A;  3BR5 A;  2HDD A;  1ZQ3 P;  1RR7 A;  1P7I A;  1MSE C;  2FD5 A;  5FLV A;  3SFI A;  1VI0 A;  1MH4 A;  2L7Z A;  4IHX A;  3SDG A;  2XPV A;  1JTX A;  3WHC A;  1RPW A;  4IEJ A;  3JRG A;  2CQQ A;  3OSF A;  1VND A;  4FIS A;  3S1Q J;  2X48 A;  2DA5 A;  2ELK A;  2XGC A;  1APL C;  1I3Q J;  4D5F A;  3BG5 A;  1B72 A;  2CRG A;  1BL0 A;  5FKK A;  4DYC A;  2G0E A;  3PO3 J;  3K2A A;  3RKQ A;  1Y1V J;  3HM5 A;  2YU9 J;  1E3O C;  4A3B J;  1YRN B;  2M34 A;  2ME0 A;  3S1M J;  4A3D J;  3NAU A;  4S0H B;  3W6V A;  3D1N I;  5M3M J;  2JMW A;  4DZJ A;  4IHV A;  4JX4 A;  3HOV J;  3TP0 A;  4DZP A;  1AU7 A;  3BTC A;  4FCY A;  1H8A C;  1CQT A;  4I6Z A;  4AC0 A;  3FKI J;  3ZQG A;  2AO9 A;  1JKO C;  4C3I J;  4V2F A;  3BR3 A;  1F36 A;  5F08 A;  5FKL A;  3HB9 A;  2TRT A;  4LOC A;  2LFB A;  2LD5 A;  3FK6 A;  4I76 A;  2HI3 A;  2JJ7 A;  2DA6 A;  5M5Y J;  2MG4 A;  4MO7 A;  3HOX J;  1DU6 A;  2CUE A;  1MBJ A;  3JRI A;  1FJL A;  4RDU A;  5FKN A;  2DMN A;  1ENH A;  4DYQ A;  1JT6 A;  3MN2 A;  3Q0W A;  3SJM A;  1X58 A;  2VKE A;  4A3J J;  1BJZ A;  2L7F P;  2IEK A;  1WH5 A;  3BQZ A;  3HDD A;  2Y0S N;  4D5C A;  3BT9 A;  2EZK A;  5F04 A;  3E7L A;  1OJL A;  5EGO A;  1JT0 A;  1OFC X;  1A6I A;  4MIM A;  2VPR A;  1TWF J;  2XB0 X;  4C3H J;  1HDP A;  2VUM J;  3B6A A;  1TWG J;  3A01 A;  2COB A;  2M2E A;  3FIW A;  2ECB A;  5HOD A;  1FIA A;  3L1P A;  4MLO A;  1IUF A;  2HXO A;  4JYK A;  4JX6 A;  1JUM A;  1FEX A;  4UUS A;  1GVD A;  2B63 J;  2XGD A;  1A5J A;  3ZOB A;  2LVS A;  5F27 A;  2Y9Z A;  5C44 J;  3BG3 A;  5BNG A;  4NDL A;  2VI6 A;  5FKO A;  3JRC A;  4ABZ A;  4XIC A;  2LY9 A;  1HDD C;  3BTJ A;  2M9H A;  3ZQC A;  1ITY A;  4FE7 A;  3JRF A;  2Y2Z A;  1IC8 A;  2ME6 A;  1JJ6 C;  1ETW A;  3F0C A;  2NVT J;  3ZQH A;  1D5Y A;  4Y52 J;  1ETQ A;  1MSF C;  1P7J A;  2JN6 A;  2DA4 A;  2JA8 J;  3GTP J;  4A3L J;  1HLV A;  3GTG J;  3H3V K;  3G1O A;  2ID6 A;  1B8I B;  3A02 A;  2DMT A;  2EZI A;  2DA2 A;  4BY1 J;  3Q3S A;  2LKX A;  3ZQL A;  3JR9 A;  1ZR2 A;  5IP7 J;  2JA7 J;  2XGE A;  2DMU A;  2WB1 N;  1WCM J;  1FIP A;  1VF9 A;  1RES A;  3BG9 A;  5F0F A;  2O9L A;  3DCF A;  3JRD A;  4XID A;  3O8G A;  1NK3 P;  2IAI A;  3PM1 A;  1BW5 A;  3FIS A;  1GV2 A;  3MKL A;  4BBR J;  1GT0 C;  2DTZ A;  3O8H A;  2CJJ A;  1RKT A;  2XPW A;  3LNQ A;  2P81 A;  1MBE A;  4QIW N;  4UUS B;  1XS9 A;  3QPS A;  2DMP A;  5EDN A;  5K7H A;  1LFB A;  1MBG A;  2AHQ A;  3S17 J;  1T33 A;  1JTY A;  3MVP A;  1IV6 A;  3HOZ J;  2FQ4 A;  2D5V A;  4QTR A;  4D7N A;  2R0Q C;  3LSJ A;  1XC5 A;  5EG0 A;  1JJ8 C;  2L0K A;  1NTC A;  3OIO A;  1K83 J;  3HOY J;  3IH4 A;  2CU7 A;  3I4M J;  4M3G A;  1TC3 C;  2NVX J;  2GLO A;  2W48 A;  5F0C A;  2GBY A;  1MBH A;  3BR6 A;  1FTZ A;  2YS9 A;  3VPR A;  4B4C A;  1B8I A;  1VFC A;  3A03 A;  3B6C A;  2FJ1 A;  1BW6 A;  4XK4 A;  1QPI A;  2HOS A;  4FTH A;  3CDL A;  3HEF A;  3DEW A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...