2LKXA

Nmr structure of the homeodomain of pitx2 in complex with a taatcc dna binding site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
b'GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 3
molecule tags Transcription/dna
source organism Homo sapiens
publication title Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
pubmed doi rcsb
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lkxA00
1ITYA 2CUEA 2JK3A 3SFIA 9ANTA 3ZQFA 3PO3J 2XB0X 1FTTA 1S7EA 4A3GJ 5EG0A 1IUFA 2DA2A 1QVTA 2CU7A 5F0CA 1VFCA 3F0CA 1I6HJ 2JA7J 2B63J 3BTCA 2HOTA 4M3DA 1U9OA 3JRGA 2HYJA 1T56A 5IYBJ 2O7OA 4FTHA 2NS8A 3SJMA 2NVYJ 4XRSA 1JKOC 5J1YA 4A3CJ 1R9TJ 1TWHJ 4A69C 5M3FJ 5FKMA 2LVSA 4FISA 4M3GA 4DZPA 4A3KJ 1B72B 2Y2ZA 3E7LA 2R0QC 2XGEA 2ELKA 1MBKA 1IDYA 5E3NA 4DYRA 4EEFG 1ZQ3P 5EZGA 4C2MJ 5IP6A 1JGGA 4FCYA 1E3OC 5IP7J 3RQIA 2EQRA 2GM4A 2VUMJ 1I3QJ 3ZQGA 4C3HJ 4D7NA 4QIWN 4A3BJ 3PM1A 1IC8A 4AC0A 4BY7J 2R5YB 2VPRA 5JLXA 2XGCA 3LOCA 2X9DA 4B1RA 2DJNA 3FKIJ 1RETA 2D5VA 1TWGJ 5J3LA 5BNGA 1H88C 5IOZA 1ETVA 1QRYA 2XRLA 2H1KA 3S2HJ 3BG3A 1BW5A 4I76A 2MG4A 2DA1A 5C4JJ 2JWTA 5K7FA 4DYCA 5GPAA 3S15J 1GUUA 5FKKA 3TW7A 2I10A 5J1RA 1ETOA 1F43A 2IAIA 4JP0A 4BY1J 5C44J 5EGOB 2NOGA 2NVXJ 3RZOJ 2COBA 5F04A 3BTLA 1AU7A 2RAEA 1MSEC 1BA5A 3BG9A 3BR1A 3L1PA 2ME6A 2R5ZB 3OIOA 1JTYA 1UMQA 1QPIA 3S1NJ 3TP0A 4RBOA 2ECCA 1VI0A 2OPTA 2JJ7A 4ABZA 3GTJJ 3B6CA 1JUMA 4CYCA 3CMYA 2NVTJ 1MBEA 3BR3A 4C3IJ 1OCTC 2LK2A 2JA8J 4D7MA 4RDUA 3HOXJ 3HOYJ 2ME0A 3Q0VA 4UUSA 3K7AJ 1IG7A 3NAUA 5F08A 1GV5A 3A02A 4JX6A 3ZQLA 1U78A 3PO2J 3VPRA 3G1LA 1A6IA 2Y31A 4V2GA 2WV1A 5EZHA 3GTPJ 1HOMA 2IBDA 1JJ8C 3GTMJ 3RKQA 5JLWA 2VKEA 2G0EA 1RPWA 3I4MJ 2HI3A 3BG5A 2VKVA 2LR8A 2M8GX 4XRSG 3JRAA 2ID3A 2ECBA 3RZDJ 3ZOBA 5GP9A 1VNDA 4Y52J 4A3JJ 3A01A 1ETKA 3BQZA 3HOUJ 2M34A 3QPLA 1UHSA 2M0CA 4GFBA 2E2HJ 1HLVA 4MLOA 1BL0A 5M5XJ 1ENHA 3B6AA 3GTLJ 2K40A 4DYQA 3TP3A 2MSYA 3S1MJ 3IH2A 1XG1A 2CUFA 3M4OJ 4MIMA 2YUSA 4B3AA 5F0HA 1JUSA 1MH3A 1X2NA 1GVDA 3OOUA 1OJLA 1K83J 2XSDC 3BR6A 1TWAJ 1WI3A 2R7ZJ 3JRFA 3G1MA 3GTOJ 2XPUA 3LNQA 2K9NA 5E3MA 2DA6A 4W1UA 3LSRA 3JREA 2DMNA 4M6VA 4QSHA 1W0UA 2JMWA 2L9RA 2WB1N 1MSFC 1LE8B 1X58A 2LP0A 3JR9A 2GLOA 2DA3A 4X1EA 4X6AJ 2L7MP 2DTZA 2CQQA 3SDGA 5EDNA 1K61A 2R92J 3HOVJ 1T33A 4A3MJ 1BJZA 2CJJA 1P7JA 1SANA 4IHWA 4I6ZA 1WH5A 1Z0XA 4A3FJ 3S16J 1AHDP 2EH3A 4D5FA 1WPKA 2Y30A 4IHYA 4BKXA 1H8AC 2LKXA 4IEJA 1MNMC 2GBYA 1AKHA 3HGGA 3LSJA 3S14J 2FQ4A 1JTXA 2LFBA 3BTIA 4A3EJ 2PMZN 4BBSJ 3BR2A 5M5WJ 3A03A 5IPAA 1Y1WJ 3IH4A 2TCTA 4JX4A 4AUXA 1HF0A 4M3BA 1AKHB 1DU0A 2NVQJ 1JUPA 4XICA 2DMQA 1FJLA 3ZQHA 1RKWA 4B4CA 1IRZA 2EZKA 3HGYA 4NDLA 3NARA 4M3EA 5K7HA 2H8RA 3DEWA 2ID6A 2E2IJ 1VF9A 1NK3P 4MFEA 1YRNB 5F1JA 3CCYA 3S1QJ 5DS9A 3D1NI 1FEXA 2HXIA 3UKGA 2MW8A 4D5CA 3CDLA 1IV6A 5FLMJ 4BBRJ 5IYDJ 3GTGJ 1ZR2A 5F27A 3WHBA 1QVUA 2M2EA 2O8KA 1UG2A 5E3OA 1YRNA 1ETXA 4IHXA 5EEAA 2DMTA 3BQYA 4HNVA 5M3MJ 1LE8A 2AHQA 2Y9ZA 3HM5A 1XC5A 3QQAA 1HCRA 3JRCA 1Y1VJ 5F0FA 4MFDA 2ZB9A 1Z77A 4S0HB 5EF6A 2VI6A 2YU9J 2DA5A 1O4XA 3CQZJ 4Y7NJ 5C3EJ 1GV2A 3JRDA 1GDTA 2XPWA 2K9SA 2HOSA 3HOZJ 3BR0A 2JA6J 2DA4A 2WAQN 3O8HA 1Q1VA 2Y9YA 1ZTRA 1I50J 1ZR4A 4G12A 2MGQA 3GTKJ 1F36A 4JYKA 2DMPA 3C2BA 1H89C 4XRMA 2DA7A 2DMUA 2FX0A 4AYBN 3I4NJ 1POGA 1MBJA 2LD5A 1DU6A 3HEFA 3S1RJ 2R5YA 1D5YA 4A3DJ 1WGXA 3Q0WA 4JX5A 3GTQJ 1IGNA 2LTPA 2KDZA 3WHCA 1W0TA 5J1UA 1HDDC 4FE7A 2CQXA 2JN6A 4UUSB 2TRTA 2X48A 3BR5A 1LFBA 5E3LA 5GPCA 5M5YJ 2R93J 3M3YJ 3IH3A 4A3IJ 4FE4A 1X2MA 1ETWA 3MN2A 3JRIA 3HOWJ 4V2FA 3HBLA 5HODA 1TWCJ 5IOYA 1NTCA 2X6OA 1OFCX 4LOCA 2EZIA 2E2JJ 1SFOJ 2FJ1A 5IYCJ 1TWFJ 1FTZA 5FLVA 2L7FP 5DTDA 2YS9A 1WH7A 3HKZN 1TC3C 5EGOA 3K2AA 3Q0UA 1MBHA 3ZQIA 4CYCB 3JRBA 1XS9A 1ZKGA 3TW6A 5K7ZA 2R5ZA 1A5JA 5IP9J 3QPSA 2QF7A 4M3FA 2EZLA 4A3LJ 5EYRA 1JT0A 2XB5A 4XIDA 2XGDA 3BTJA 2EZHA 3LSGA 3O8GA 2W48A 2HQ5A 1ZK8A 3A01B 3MKLA 2NS7A 1RESA 1WCMJ 4DW6A 3FIWA 3FK7A 3G1OA 2E19A 1JKPC 1MH4A 1U9NA 5FJ8J 2OF7A 2L0KA 3OSFA 2P81A 2M9HA 5FKNA 1IDZA 4XK4A 3LSPA 2FD5A 2L7ZA 2LLKA 1HDPA 1NK2P 1FIPA 1JT6A 1B8IA 3DCFA 3S2DJ 1EF4A 1PUFA 1LFUP 4DZJA 1FIAA 1CQTA 1MBGA 2KT0A 1ETYA 3S17J 1G2HA 3IV5A 1JKRC 3HB9A 1RKTA 1GT0C 1APLC 4L5EA 5C4XJ 2IEKA 1PUFB 3ZQCA 3BT9A 2HDDA 2DN0A 4A93J 1B8IB 2EBIA 5FKOA 2N8GA 5EG0B 2AO9A 3H3VK 1BW6A 3TEDA 3FISA 4IHVA 2O9LA 4J19A 2Y0SN 3HDDA 1OCPA 4UUTA 4C3JJ 2K9QA 2HOAA 3MVPA 5FKLA 2CRGA 1U8BA 1ZGWA 2QCOA 3W6VA 1ETQA 2LY9A 1IJWC 1MBFA 1RR7A 2XPVA 3OSGA 1P7IA 3FK6A 3Q3SA 2HXOA 4QTRA 4W97A 1ORKA 1JJ6C 4BXXJ 3H0GJ 4MO7A 3GBGA 1JKQC 2JA5J 3JRHA 1B72A 2E1OA
chains in the Genus database with same CATH superfamily
1KU9A 2PJRA 1LDDA 3DTKA 3FXMA 4XBFA 4IO9F 2M7BA 1N78A 3ZMVA 2GA1A 3WG7H 2H1LA 1OMIA 1BI3A 2ACJA 3GFJA 1I6HJ 1UELB 3BTCA 2HYFA 2HOTA 1I1SA 4XKVA 3JRGA 4DBRA 3ECOA 2L54A 3DV8A 2IT0A 2FF4A 1LVKA 5IYBJ 1UZCA 3I71A 4PDKA 2KIFA 3DU6A 1VQ7I 1IXRC 4XRSA 3VSLA 3HZJA 1JKOC 1YYVA 2IGNA 5J1YA 1GLNA 4A3CJ 1R9TJ 3K4KA 1SAXA 4M73A 3OV8A 4UVAA 3A2KA 4DZPA 1MDMB 1MMDA 2OV7A 2Y2ZA 2R0QC 3SEZA 2A5YB 2X6WA 2XGEA 1DP7P 1KYZA 3E6DA 3FBIB 1T2KA 4DYRA 2BHYA 2DFIA 4RS8A 1B6AA 2BHZA 1OYIA 3F72A 1YS6A 2XRNA 1Y56A 3AL0C 1I3QJ 1Z6TA 3ZQGA 4E7ZA 4D7NA 3CF2A 2DOFA 1YW9A 2VPRA 3K1MA 5D4RA 4I7HA 2QGUA 4C2TA 3PIPF 1VQPI 4XORA 1R6RA 2WTEA 3LOCA 2X9DA 4B1RA 5LFAA 3TGNA 3HIFA 1RETA 5J3LA 3H5RA 2M0MA 4PFOA 3KP5A 2KJCA 1ETVA 5IOZA 3H5NA 2XRLA 3QAHA 2HQNA 4I76A 4L0ZB 1HKSA 2RNGA 1LFPA 1RNLA 1MJBA 2PFBA 2GIZA 2CH0A 3TW7A 2FBIA 5LGTA 1QQIA 1K6YA 2I10A 3X2QH 1Y0NA 5J1RA 2CGPA 1ERDA 4MTDA 3EETA 3GVAA 3H5AA 4D1QA 1F43A 2BY1A 2LREA 3ZMDA 1F4KA 5KVRA 4BY1J 4XRFA 5FGMA 2WAQA 3F9KA 4LD5A 4WXCA 1YW7A 2Y0MA 1LB2A 2COBA 1YITI 1BA5A 5LLQA 2ZNZA 1Z7LA 3I5UA 1IN8A 2ME6A 2R5ZB 3GZ5A 3OYJA 6PAXA 1WJCA 2HPIA 3S1NJ 4ZTJA 2OU2A 3GZNB 2EJRA 1JXSA 2VOOA 3ABLH 3DBLB 2LBFA 1EV7A 2Y0SA 3I4PA 3GTJJ 1JUMA 3B6CA 3ERMA 2V1UA 3J7AY 5L3EA 4CYCA 3LSIA 2E60A 2R7QA 4XKCA 3H9JA 3VOEA 2LK2A 2JA8J 3SZGA 4RDUA 3WG9A 3DBHB 1W1WE 4XM3A 5LRRA 4ZYAA 3A02A 2UXXA 4RAGA 4JX6A 5L3BA 4CUGA 5ERIA 1EH7A 1R4NB 3WU1B 2DLLA 3W2WA 4A12A 4LG0A 2BW3B 1JJ8C 3R0JA 1UHWA 5JLWA 4NQWB 1RPWA 3CCLI 2LNBA 4B44A 2LC2A 3E6BA 2VE9A 2VKVA 2O0YA 4HEA2 2BY3A 1ZG1A 4QLCU 3WU2C 1ONVA 1Z1DA 5FRMA 3EUAA 3ZR8X 3BQZA 2Q2EB 3QPLA 4M71A 1UHSA 4OIPF 4GDFA 4HLXA 2WADA 4OIRF 3QODA 2YX4A 1Z67A 3HC7A 4MLOA 1OCCH 5M5XJ 1ENHA 4WWCA 3VEPA 2HEOA 1Z05A 4A0ZA 3IH2A 4XLCA 3FHNA 4BJ6C 4MIMA 5F0HA 3CO7C 1XTAA 1KGSA 1X2NA 4BUPA 4EM2A 1ZARA 4NBQA 1G6NA 2MFZA 3CJQB 1UG0A 4XLFA 2R7ZJ 1O3QA 4QWQA 2XKPA 2RREA 1TLHB 4LB5A 3FXOA 3G1MA 3S3NA 3F8NA 2K9NA 3J81K 5E3MA 4W1UA 2GZWA 1J5YA 2O03A 5LBQA 2VXZA 3C2GA 5ICCA 3K4JA 2ELJA 1RI7A 2I8DA 2Q2EA 4HF0A 2FEZA 4X1EA 2JA2A 3TKYA 3ZP5A 3GF2A 4RB0A 2CJJA 1R00A 3TDUC 3KEQA 4IHWA 4I6ZA 5LEKA 3ZCOA 3CCEI 2LRDA 1PUEE 1F9NA 3S16J 1UHMA 2K3PA 2JPCA 4E7SA 3UR3C 1H8AC 3DEUA 1OQYA 3BCBA 3FXQA 3S14J 4GXOA 2O6GE 3FMRA 3I64A 1JTXA 2LFBA 1RC9A 3BR2A 5ILUA 1K79A 5M5WJ 3PFYA 3SZTA 3OYAA 3IH4A 4JX4A 4RLFA 3OYGA 1AKHB 1D3YA 1WJEA 2CUJA 2K5CA 2LF8A 4I01A 5B66C 3GZ6A 3UNGC 4XICA 4M9ZA 3VYTB 2MA3A 1RKWA 3HGYA 5BMZA 5K7HA 2DT5A 2H8RA 4A5MA 4KDPA 3FDYA 2ID6A 4RGUA 2CWEA 4MFEA 3A0HC 4IPAA 1YRNB 5EEHA 3D5SC 4EMSA 3D1NI 1FEXA 5DD4A 2OJED 1GXQA 3VYRB 3KYLA 5FLMJ 2CV2A 5IYDJ 2DFEA 3WHBA 1JGSA 1Z7UA 1PVEA 2IS6A 2VKDA 3H9GA 1YRNA 4XN3A 2YSRA 2JSCA 3JSPA 5EEAA 5AIQA 2R4GA 4O3MA 2HWVA 1Z91A 2OZ6A 2IGKA 3O3KA 3GXOA 2V7FA 2EB7A 3SEQA 2JZYA 1O7FA 2KRCA 1R5ID 3GWZA 4XKWA 2VI6A 3IHUA 3T5XA 1VQ8I 3CQZJ 4U0VA 1XSVA 4DBQA 3E0JB 1GDTA 2XPWA 4Y3OA 3T8RA 2DA4A 2LBFB 3RYPA 1Q1VA 1AWCA 2ZMEA 1ZTRA 3QOPA 4ON0A 2ESNA 5LEJA 2DDAA 2K4BA 2M3AA 1ZR4A 2AXLA 2P0WA 4YIIA 4JYKA 2XUBA 1NH3A 3GFMA 3GMEA 2XHKA 2VJIA 4XRMA 1IUYA 2KDOA 4DIQA 4AYBN 1K4SA 3I4NJ 1EKEA 2F4MB 3OYEA 2LD5A 1DU6A 3HEFA 1XDUA 3KLNA 3RPUA 3L2QA 1GVJA 3C3WA 4JX5A 1YS7A 1T98A 4FETA 1OISA 2KDZA 4IZZA 3MZ8A 5J1UA 2DDBA 4E7JA 3WGHA 1TNSA 4TV7A 2W82A 2X48A 4DNCA 3BR5A 1LFBA 3NWTA 1ZRDA 5GPCA 5M5YJ 2R93J 3M3YJ 1OYWA 2A68F 3IH3A 3O6BB 4UNOA 3WTZA 1ZHFA 4FE4A 5LHHA 3MN2A 3JRIA 3HOWJ 5JVTA 4EM1A 3DU5A 4PK4A 1TWCJ 3OS2A 1NTCA 2DQLA 3PFIA 2E2JJ 4XN0A 1X4PA 4BHPA 5FLVA 5DTDA 4YIFA 2VXDA 3GO5A 3K2AA 3M8EA 1DDNA 3FM3A 4PJLA 5K7ZA 2QZ8A 5D5VB 2QF7A 3ABKH 3JAMZ 2QQBA 2Q1ZB 5D5XB 1ZLKA 3KCCA 5J8CA 4XOPA 3E3VA 3J81Z 3DXJF 4A6EA 2W48A 4A0YA 4F52A 3CUOA 1ZK8A 4CH7A 2R3SA 1XGOA 2NS7A 1CF7B 1VQ4I 3BOQA 1WCMJ 3MKWB 3FIWA 5D8LB 2KP6A 3HXLA 3NWSA 4DOZA 3H9QA 5KAFC 5J4VA 1D0ZA 4ENJA 2E7WA 5CQEA 1JKPC 5JVGF 1WJDA 1TW3A 1U9NA 5DM6F 1MJAA 3OOPA 5AIPA 1XN7A 2OF7A 1TL8A 3CCSI 4XLHA 2F6CA 2BVLA 3Q9SA 4CSWA 3AG4H 4C2UA 5FKNA 3OMYA 4XK4A 5KAIC 2MH2A 2R7DA 1J7KA 4KA4A 5LHGA 2D1HA 1S9HA 2ZSHB 5E20A 4LB6B 4J00A 4BYYA 1VQKI 1MBGA 4LGWA 3Q5FA 3BC8A 3K10A 3NRVA 1JKRC 1IRFA 3HB9A 4HV6A 3WTWC 1GT0C 1FT9A 4ESBA 1A36A 5H2FC 2M45A 3K4NA 4Y17A 5JR3A 3CC7I 2DN0A 4EJVA 2RQPA 2EBIA 1REPC 5EG0B 3H3VK 3G3ZA 1BW6A 3FISA 4J19A 3EPZA 4ZYDA 1F5TA 1FNNA 2EFOA 3HDDA 2L9NA 1KZHA 2KZGA 4C3JJ 4BXUA 2HOAA 2LMDA 5FKLA 3L09A 1NHAA 3DPTA 2CRGA 2V79A 3PIOF 1ETQA 3I56I 1RUNA 1YJWI 3FMSA 1MBFA 1MD0A 1RR7A 1TTYA 2HQAA 3GCMA 1SD6A 1L3LA 2HYGD 2VONA 2GAUA 3RSNA 1P7IA 2TDXA 2QSFX 2Z3YA 3Q3SA 3FBNB 2M30A 2M7AA 1ORKA 1IZ1A 4BXXJ 1IV8A 2HOEA 5LGUA 2JA5J 1BN5A 2UWMA 2CYYA 3KETA 2M4KA 4E4HA 5L3CA 3S3MA 1ITYA 2CUEA 2JK3A 2K02A 3HKZA 3LA7A 9ANTA 2HVRA 3ZQFA 2XB0X 2ZFUA 1S7EA 4ZC3A 1UJ8A 2Q8KA 4BU2A 4Y15A 4YRVA 1MNEA 5EG0A 1YHQI 4LLLA 2WAFA 2DA2A 3U21A 4KJZA 3F0CA 2HR3A 2AXTC 2JRMA 3L00A 2Z9OA 2V26A 2VL8A 1VTNC 4M3DA 4HNUA 4IVNA 3DP7A 3R60A 4I2OA 2CW8A 1SMTA 3ABTA 1IN5A 3E5QA 1RZ4A 2NVYJ 4FQGA 4P9FA 2STWA 2ESHA 1BI2A 1OCOH 1DGWY 1CGPA 2ZCWA 4IX7A 1TWHJ 5M3FJ 1J75A 5TISC 2VBXA 2L2OA 1U8RA 1WZ2A 3FXUA 4A3KJ 1R49A 1B72B 3W6KB 1QBJA 2V6EA 1U0JA 2ELKA 1MBKA 3W2VA 1HW2A 2IA2A 1KQ0A 1I5ZA 4FCYA 1FBQA 1E3OC 5IP7J 4EJWA 4XLAA 5DUIA 2PI0A 1OR7A 4QIWN 4O6JA 2E1MC 1W4MA 1R1VA 3T0YA 5JLXA 4ENMA 4XOTA 1K7AA 1YW8A 4LLGF 2E34A 1G3WA 2RV8A 2VPLA 4Z6YA 2DJNA 3FKIJ 4PSXA 4BXFA 1QU3A 2LKSA 2OTJI 1LNWA 2PMHA 5BS6A 2L4MA 3PNYA 3F21A 5GADJ 4BACA 1BW5A 3I58A 1B4AA 2IA0A 4LG0B 2OCCH 3OYLA 2JWTA 5K7FA 4F55A 1GUUA 5FKKA 2XSJC 4U0WA 4L18B 1ETOA 1P4AA 2IAIA 2L01A 4ZTFA 5EGOB 4HDVA 1HKQA 5FRNA 3F23A 2NVUB 1K78A 1S6LA 3I59A 4N9HA 3BTLA 5A2QK 2RAEA 2KIMA 1MSEC 2J5OA 2DOEA 2L4AA 4Z2YA 3OS0A 1FYMA 1PDNC 5CVIA 3L1PA 1STZA 3E5UA 2NS0A 2VBWA 1JTYA 3OIOA 1O7LA 4MGRA 3TO6A 4HYEA 3KX2A 3CUQA 2ECCA 2HNHA 2KRHA 1VI0A 2KZVA 2IS4A 3WGGA 4ABZA 4UV8A 2Z5UA 3HRUA 3ZGKA 4U7DA 1TZLA 2HU9A 3DKYA 3BR3A 4PSWA 5FLXZ 4D7MA 5ILSA 1OCRH 3HOYJ 2ME0A 4ZZLA 1XD7A 4F7ZA 2BBYA 2WB1A 1BR2A 3R0AA 4UUSA 3ZRGA 2BY0A 3BJAA 1SD7A 3K7AJ 1SVOA 1LQ1A 3E97A 5D6EA 1T8IA 1TQMA 3OYDA 3LWFA 3L2CA 3ZQLA 2HTJA 4GRIA 3OL3A 2KIUA 2ADUA 4LIVA 4NB5A 3VPRA 4DJAA 2Y31A 4UXNA 3M1CA 1HOMA 1RIOH 3GTPJ 3GTMJ 1PJRA 3GLXA 3M8FA 1O3SA 2VKEA 2E1MB 2G0EA 2DI3A 5FD5A 3BG5A 2A3SA 2LR8A 2M8GX 3EUHC 2ID3A 2IGOA 2EV0A 2MH9A 3ZOBA 3RKWA 4HDUA 4MEXF 3QP5A 2F5DA 1XMAA 2F5CA 4HSRA 3LSTA 1H9TA 2ZXIA 3E1SA 3HTSB 1Q1HA 2CS3A 3HOUJ 1AA7A 2M0CA 4GFBA 5FB2A 2DQRA 3D5LA 1U6GA 3F22A 1D0YA 2K40A 3DBRB 5GAGJ 5J40A 2O61A 2YUSA 2VB6A 1S5LC 1YX3A 1MH3A 4U7BA 3KEOA 1GVDA 2VODA 5L3GA 1XGNA 2HDCA 3OOUA 1OJLA 2BGCA 3BR6A 1WI3A 4D9JA 1IN4A 2BVMA 4LFUA 2K9LA 2ZJ2A 5DCMA 3M7GA 2EINH 2KFDA 3O2PE 5CJ9A 4HRIA 4HG2A 2PMZA 3LSRA 2W57A 3ELKA 3OIPA 1VQ6I 2L9RA 1USTA 2Q0OA 2HZTA 2W00A 4G7OF 3F8CA 3BPVA 5DV5A 4E7HA 4Q5SF 3IWFA 3JR9A 2RKHA 2FU4A 2DA3A 4X6AJ 2DTZA 5EDNA 4KFCA 2IW5A 4HQMA 3J7AO 1T33A 1WJBA 5CQGA 1RUOA 4M9XA 5D5WB 1SANA 4WCGA 4H0EA 2JQ7A 1WH5A 4XR6A 2ZC2A 1V3FA 2YX7A 3DPLC 1BIBA 1FSEA 3BZKA 3CDIA 4BKXA 3PUFA 1VQ5I 4IEJA 1SEUA 5BPIA 4AU7A 1WRJA 2K27A 3GLLA 1ON1A 2GBYA 3HGGA 5ED4A 2BYVE 3R4KA 3JCUC 3CLQA 3EQLF 1KU3A 4U0YA 4A3EJ 1D1CA 2FUG2 2O5RA 2FSWA 3H0DA 4K2EA 1YO5C 1Y1WJ 1DGRM 4AUXA 4M3BA 1J9IA 1LPQA 3A0BC 2DMQA 1R7JA 1YIJI 2RVCA 1ZGJA 2EV6A 2LG4A 2ZJQF 4N0BA 2YPRA 1LEAA 4B4CA 1TNTA 1YJNI 2ZXHA 4NDLA 4BQAA 3T1BA 3DEWA 3MZYA 1OYYA 3BDDA 4WXDA 4BNCA 3IC7A 1FMWA 3K4CA 3LFUA 5DEQA 5DS9A 2V9KA 3AFHA 2PQ8A 4BDZA 1SD4A 1X1BA 2VN2A 3RPQA 2L5QA 3GTGJ 5F27A 2GIVA 1N75A 4FX0A 4L0YB 4J01A 2KQRA 3DLAA 1QVUA 4ITVA 4II2A 3P9IA 2PLYA 4EV0A 3BQYA 1FBUA 3K1PA 4ZYEA 2Z16A 1HCRA 3JRCA 2X1DA 1YX5A 2ZB9A 3DKXA 3WTYC 2DA5A 3L7WA 1P2FA 1O4XA 1IAWA 2RGVA 2HTSA 2OA4A 1TT0A 3F3XA 2K9SA 2GXGA 2WAQN 3SFZA 2P7CB 2ZMEC 5B1AH 4L9TA 2FNPA 4IJAA 4UB6C 4HF2A 4G12A 4YG2F 1F36A 2DMPA 3C2BA 1HKTA 1JHFA 3K0LA 3BPXA 5CKTA 3U1DA 2XKOA 1V54H 4BGDA 1DPUA 4PJ0C 4HX4A 3I59B 1MBJA 4HQEA 2R5YA 1D5YA 4A3DJ 2ZSIB 1WGXA 2R7WA 4XMYA 2PBIA 2DT6A 5CVRA 2LTPA 3HSFA 4XLNF 2OUMA 1ZRCA 1OR7C 4E70A 2DBBA 1XPXA 4C30A 1OLTA 2KRFA 2JN6A 4UUSB 4KIFA 2O3FA 2VT3A 4ETSA 4D0PA 3QP6A 2QWWA 2EFPA 4BQNA 1QGPA 3BG6A 1MMNA 2VC1A 5ICEA 2ISZA 2QQ8A 3M9AA 4V2FA 1YFHA 1QZEA 4PGHA 3H3ZA 5IOYA 4PJJA 3WU0A 4A2UA 1OFCX 2E5ZA 2XAHA 2EZIA 2F4OB 1SFOJ 2CV0A 2FJ1A 1TWFJ 1JE8A 4OINF 1DPRA 2CQNA 3I55I 3JTHA 2YS9A 1PP8F 3PSIA 5HDKA 1MBHA 3ZQIA 3JRBA 3D5RC 3TW6A 5TRDA 3QPSA 3DTIA 3S8PA 3DPUA 1XX5A 4LK1F 3IRRA 2A5WA 3AKZA 3KP7A 1JT0A 2E35A 4GCVA 1KU2A 2XGDA 3R6SA 1J09A 4XQFA 4X0GA 4ENKA 4A6DA 2V9VA 1V5FA 3AG3H 3CC4I 3CP8A 2XV4S 3T8TA 2FBHA 4WK8F 4KN4X 4PUSA 1WHUA 1OPCA 2BY2A 2FRHA 3LQQA 1E3PA 3MCZA 4KMUX 4PJMA 3CTAA 1T39A 3IKTA 2VIXA 3OR2C 3CCVI 2X4HA 3PQKA 2E1NA 3IAS2 3IUOA 4L5JA 1HQCA 1DUXC 2ZXJA 1FSHA 2A6HF 2M9HA 3HOTA 5E1ZB 4M74A 2WAEA 1FIPA 1JT6A 1L0OC 1WQ2A 1EF4A 1GHCA 4UV9A 3FXLA 4OOIA 1UAAA 2XROA 1PUFA 1LDJA 1FIAA 1CQTA 2DW4A 2KT0A 3S17J 2KISA 4WXHA 1SC7A 3IV5A 4PJNA 1XB4A 2OQGA 2VKHA 5J47A 4XSZF 5C4XJ 2IEKA 4M9SA 3J7YJ 4UB8C 3BT9A 3GEZA 4BDYA 1T38A 4A93J 2B0LA 3QYFA 2Y75A 2AO9A 4MEYF 4AIKA 3TEDA 1BR1A 4OU0A 3DLLF 3SDBA 3DEEA 2EPFA 2LKPA 1K6OA 4IF4A 3TQNA 4BEHA 3CDHA 3M1EA 2KL4A 2EIKH 1U8BA 1FPQA 1QHHD 3W6VA 4HNTA 1A6QA 3SYTA 4EGZA 1VQLI 1BM9A 4XONA 3REOA 3WODF 2XPVA 1QZZA 2F4IA 4UUVA 3QU3A 5B3SH 4LLNA 2HKXA 4KIGA 2HXOA 1XCVA 4QTRA 3FWEA 3I54A 3E6MA 4YFNF 3OYMA 4M6XA 3L2RA 2MABA 5BOXA 3PO3J 3PUBA 2AS5F 2K4JA 4OIOF 5ICFA 2KHMA 1XGMA 3OYKA 1V4RA 2R7UA 4LK0F 2R7FA 1IUFA 1X1DA 1QVTA 5F0CA 2ZJRF 1VFCA 4P1WA 1HA8A 2HZDA 2W25A 2JA7J 5HLTA 2OZUA 1N25A 1U9OA 5F6FA 4GYIA 3F8FA 4CDGA 2HYJA 3CP2A 4EJTA 3H1CA 2H94A 1T56A 1LKXA 1SFUA 2O7OA 5AONA 1BIAA 2VE8A 2NS8A 4AM3A 3SJMA 1HC8A 1X19A 2IXSA 4LIUA 1HXDA 1FOYA 2PN6A 2DK8A 3HRSA 4N4NB 1S3JA 2LVSA 1I1GA 4FISA 4M3GA 2VJ4A 3BY6A 1BC8C 1BOBA 2MYSA 3B02A 4YFXF 3E7LA 4KIBA 3H35A 3KP4A 2J5PA 3LQRA 4EEFG 1T0FC 1ZQ3P 2W24A 1FZPB 3HHGA 5IP6A 3VWBA 4HA8A 1FP2A 3ZN0A 4E7IA 2EQRA 3BWGA 2GM4A 2D1VA 2YR2A 3BP8A 1Z6RA 4IXAA 5HS7A 4C3HJ 3K1NA 1BOAA 2P5KA 3PM1A 2XAJA 2R5YB 1YG2A 1I27A 3A4CA 2V1XA 5GTIC 1FOXA 4M6YA 4PZJA 1K4TA 5E8IA 1U2WA 4NNJA 2DYSH 3DTEA 4EATA 4KT5C 1QRYA 2GQQA 2H1KA 5IY5H 1TP4A 2MD5A 1YJ9I 3F8BA 5C4JJ 3RDIA 1TBXA 4DYCA 5GPAA 3S15J 2CSOA 3ESWB 2QLZA 2UUZA 1E17A 3IRQA 3COAC 4G9YA 2DOAA 1D1AA 2LOOA 2LH9A 1FC3A 1V5GA 1QA6A 3CCRI 4UVBA 1J2XA 2MLGA 3WTUC 1EJ9A 3ML6A 2NOGA 2NVXJ 2R7VA 1LUJB 5F04A 1AU7A 4BQOA 1UCRA 1ZG3A 1YIOA 4BJ5C 3HYIA 4WX9A 2VJ5A 4HF1A 1FY7A 1UMQA 4CCLA 2JUGA 5D4SA 4OAYA 4BS9A 1W36D 2R7RA 1D1BA 2XGXA 1EH6A 4NC7A 3FMQA 1R5GA 5JHUA 1Z21A 3F6VA 3CMYA 1MBEA 1A35A 2LY1A 3WTSC 4C3IJ 1OCTC 3RKYA 2GOXB 4QPOA 3HOXJ 5DD8A 3OYCA 1TT5B 1V5EA 1ZREA 1IG7A 3SZPA 2P6SA 3NAUA 3U2RA 5F64A 1K78B 3KPHA 4IQ4A 1GV5A 1QPMA 4ENNA 1U78A 4CCNA 4CCOA 1SVLA 4B3XA 2FA5A 5HLHA 3G1LA 1A6IA 2WV1A 5KK1A 3VODA 3K70C 1EA3A 4MTEA 3ERED 3ASOH 5EZHA 1P4WA 1XDSA 2JSPA 4XSXF 2ZMEB 1YI2I 2F5FA 3RKQA 1LJ9A 2Z33A 1WI9A 3CO6C 2K9MA 3TO7A 2D45A 1QHGA 1XGSA 2HI3A 1PP7U 4XRSG 3JRAA 2ECBA 3RZDJ 4H4KC 4I0AA 3V7SA 1VNDA 2F48A 4A3JJ 2RNJA 4JOMA 4AIJA 2BXZA 4N4OB 4RMNA 3N97A 5F1RA 3A01A 2VC0A 3E5XA 3CJTB 2M34A 3IP4B 1KONA 2XC7A 3MMYB 4I09A 4UVCA 5ILVA 1YTYA 2E2HJ 4EQQA 1O3RA 1QZYA 1BL0A 2L9SA 4RB2C 3CLOA 2IS2A 3GTLJ 1O3TA 3TP3A 3S1MJ 3L2UA 2LF7A 1R4MB 2CUFA 3M4OJ 2V9PA 4B3AA 4ZDOA 2IGMA 3EYYA 3S93A 4EJOA 3WTXC 2EFQA 4CCKA 3F6OA 4BL0B 4CCJA 3KYCB 1E0EA 3IAM2 4HBLA 1YQAA 2LY2A 4RAYA 3JSOA 2XPUA 5FFXA 3LNQA 3CESA 4YEJA 3JREA 2BE5F 2DMNA 4QSHA 1W0UA 1IF1A 3RQ4A 2L02A 2CG4A 1P6RA 1BR4A 5GAHJ 3K4LA 5HS9A 3TBIA 2GLOA 2CQQA 3HG9A 2R92J 3MKZA 1R1TA 3FXRA 3PNTA 3EUHA 4AYBA 1R71A 4HZFA 1ZG5A 1Z0XA 2XDVA 4G94A 2E36A 4D5FA 2QKLB 1W7PA 1WPKA 1T95A 4JQFA 2WA0A 4BHCA 3LSJA 3F8MA 3HSEA 3OS1A 2OQRA 1F1ZA 3G6EI 4RGXA 5A2QZ 1IXCA 5HNHA 2X6YA 2MBFA 5IPAA 1X4OA 1A04A 2XAQA 1WVRA 4ZH4F 1W5CC 1HF0A 5E8GA 1DU0A 2MC3A 3NEUA 2JTVA 3V8KA 1X1CA 2NVQJ 3P9KA 4LITA 4N9IA 3ZQHA 2EFNA 1VQOI 1IRZA 2EZKA 2L3DA 4M3EA 1MNDA 2VQCA 2DK5A 4RGRA 1S7OA 1NK3P 2OBPA 3I0TA 1XSXA 4Q48A 3S1QJ 1SFEA 1Z9CA 4KICA 2HXIA 5FROA 1RRJA 1FYKA 3UKGA 2MW8A 3TOBA 5JHFA 4D5CA 2ZXWH 1R58A 3ZXSA 4RB1A 3BJOA 3CUQB 1ZR2A 5CPRB 3K4MA 1KA8A 1Y8QB 3V8JA 3A1YA 3ZMUA 5BPDA 2M2EA 1UG2A 4XNFA 5E3OA 2ZO4A 2WWYA 3PJRA 4IHXA 4IKFA 3U9GA 3PL8A 5JFRA 2DMTA 1W7PB 3G71I 5M3MJ 3OYIA 2NNYA 3GYHX 4IRHA 2VBZA 1LE8A 1W5TA 2AHQA 3KYDB 4HX8A 1FOWA 2Y9ZA 1BJAA 5E1WA 3HM5A 3VDXA 3CMMA 2W85A 3QQAA 2DPUA 3ZMSA 5F0FA 4MFDA 3TMOA 1P92A 1Z77A 2YU3A 2JPBA 1FX7A 2MC4A 3BZ6A 4Y7NJ 5C3EJ 1G3SA 3HTUA 1GV2A 1DP3A 2UXNA 5KHDA 2HOSA 5HDNA 3BR0A 2JA6J 1FBSA 1U5TA 3V8LA 4HW0A 3OWTA 2Y9YA 1I50J 4BE2A 4L9JA 4FASD 3FXKA 2OTLI 2VJJA 3N4MA 1H89C 3K2ZA 3LMMA 1HW1A 2FX0A 2OCEA 3KEYA 4HV5A 3HL2A 5CVVA 3HSRA 1POGA 2QQAA 2GOMA 2X85A 3S1RJ 2HGCA 3Q0WA 4CYDA 4R79A 2DAOA 3GTQJ 2Z1DA 3IKVA 2HPMA 3WHCA 1W0TA 5L3DA 1KYWA 4NUBA 3V7RA 4YELA 2ICWG 2TRTA 4G7HF 2IRFG 4OMZA 2PX9A 3M07A 2XIGA 5E3LA 2BEOA 3K6GA 1FOKA 4LJZF 3RJPA 4KUMA 3W3CA 1ETWA 2VQLA 4DQ2A 2IS1A 2P5VA 4HSTA 5CVUA 4AIDA 5HODA 3TDZC 2ISYA 2L9VA 5HS8A 2FMYA 1IN7A 2FNAA 5IYCJ 2A07F 1S8NA 2STTA 1FTZA 4KYWA 3KZYA 1WH7A 3Q0UA 1ZAOA 4A5NA 2XVCA 2NRAC 3HHHA 2H27A 1TQPA 5IP9J 3R61A 2ELHA 4RM2A 3BJ6A 4B09A 4A3LJ 2A61A 1ULYA 2B7EA 2EZHA 3LSGA 4F91B 5EJCA 1X3WB 3GW2A 2BV6A 1G3TA 2M8EA 3K4BA 5JI6A 4DW6A 3C18A 4ASNA 4CZZA 1TW2A 3G1OA 2E19A 3J7ZI 2QENA 2O8XA 1R22A 1IRXA 4L5IA 1Y0UA 2QVOA 3CMAI 3V42A 5FJ8J 3GX4X 5BQTA 3BG7A 3ZPLA 2EA2A 2L0KA 2BW3A 3FXJA 3AAFA 4I02A 2P81A 3CZ6A 1IDZA 3D0SA 2FD5A 2L7ZA 1HBXG 1NK2P 2W84A 1B8IA 2D2WA 4II3A 2UV1A 3DCFA 3S2DJ 4RM3A 1MKMA 4UHTA 1KQ8A 1WJFA 2IVMA 1LFUP 2DU9A 1ETYA 3EDPA 1G2HA 1HSJA 3ZMZA 4B48A 2DFHA 3FHZA 2OC6A 1RKTA 5B5EC 2VLAA 1XSDA 4L5EA 2EV5A 3C2HA 3CCMI 1J0RA 4S04A 3GFIA 1PUFB 2QSGX 3ZQCA 5E1XA 2L7KA 3OYNA 4KT6A 4R8HA 4CGZA 3CCJI 1E2XA 2ZKZA 3LSMA 5FKOA 1JI8A 2DPDA 2WBMA 4Q47A 2DCEA 1OCPA 4UUTA 5KCMA 2K9QA 3S2WA 1G8XA 2ETHA 3SHFA 3P9CA 2QCOA 1FYLA 1IJWC 3GFLA 3CJRB 2G9WA 4BE0A 3H92A 2X1CA 3DFGA 3OSGA 5GTHC 3EUKL 1T0FA 5J4YA 1UFMA 1A31A 2EILH 1SFXA 4W97A 4KITB 1ON2A 3KP6A 4M72A 4ANJA 3KLOA 1JJ6C 3H0GJ 4MO7A 1JKQC 2ZBKA 3JRHA 4BH9A 1MDMA 1PYVA 2KIQA 2QM3A 5LRSA 3SFIA 2R7TA 1FTTA 1Z3XA 4G6QA 3WE3A 2QBYA 2GWRA 1JHHA 4A3GJ 3CUQC 4F92B 2HKOA 4IRGA 2PJPA 2R7SA 1WSUA 3WTTC 2CU7A 2CFXA 4QPQA 1C0WA 2CW7A 1X1PA 2DODA 1OCZH 2B63J 1FWZA 1S7AA 2FXAA 4KN7X 3OYFA 1BI1A 1SFKA 2ZFWA 4CO8A 2R7OA 2F2EA 2JVGA 2H09A 3TL4X 1GXPA 4FTHA 1S29A 3CF5F 1D0XA 3AG2H 4IHTA 2FQ3A 2K86A 1D8KA 3ZQ7A 2M4GA 4A69C 1SMYF 5FKMA 1WFXA 1I3AA 1MMAA 3DKWA 2NAZA 2K85A 1MZBA 2PMUA 3FF5A 3VYSB 1U5TB 2Z99A 2DYRH 2JRTA 4NC6A 2CFOA 3HPGA 2NNNA 3Q9VA 4F3QA 4MHGA 4G8XA 4P9UA 1IDYA 1ZGAA 5E3NA 3QPHA 4IL6C 3K69A 2NXNB 5EZGA 4C2MJ 1JGGA 1LEBA 5K5OA 4IOCF 3RQIA 3KFWX 1N77A 2VUMJ 5CYVA 3ABMH 2IJLA 3FX3A 2HS5A 4A3BJ 1IC8A 4AC0A 4BY7J 4L9NA 4ZJZA 2COMA 2A69F 2XGCA 1ZELA 4ESFA 3FM5A 5HDGA 2FE3A 2P7VB 3DQVC 2H8WA 3OR1C 4P5OA 2D5VA 1R23A 1TWGJ 1G3YA 5BNGA 1H88C 3I9V2 2WY7Q 4MQVA 3I53A 3BG3A 3ULQB 3S2HJ 3VSKA 5HLIA 1G59A 1WKMA 2MG4A 2V1NA 3RYRA 2DA1A 4Y33A 5DYMA 2Y69H 2XF7A 3RI4A 2FBKA 1ZN2A 4AIHA 5LGNA 4FX4A 1HW5A 4I98B 1ODDA 2BOLA 3KP2A 2PJRB 4G6DA 2RDPA 5CVJA 4CCMA 4JP0A 4MQ9F 2W1OA 5C44J 3LAPA 2FOKA 1S72I 4KMFA 3NQOA 5HVQC 1ZH5A 2KLOA 4EM0B 3RZOJ 4ZDPA 1I39A 2JT1A 3BG9A 3EYIA 1W7PD 3BR1A 4FHTA 1CF7A 3MFKA 2E1CA 1P9QC 2ZNYA 3TO9A 1QPIA 3TP0A 4RBOA 2P5LC 2KJBA 2CO5A 4OIQF 2UZKA 1H0MA 2OPTA 2JJ7A 3JW4A 5TGTA 3G73A 3KZIC 2NYXA 2NVTJ 2EK5A 2QUFA 5H20A 1YOVB 2CQ7A 2AQEA 3HUGA 3V4GA 3I3LA 1ZLJA 2A05A 3VYUB 3Q0VA 3OL4A 2E71A 2C6YA 2CW0F 5F08A 4AVPA 4LG3A 2VOPA 4OMYA 2CUZA 1RR8C 3OIQA 4R1HA 4FT8A 3PO2J 2P8TA 1MIJA 1Y8RB 4V2GA 3AL0B 2IBDA 3SXYA 2M5WA 2F5VA 3B73A 4P55A 3I4MJ 4CA0A 1WJ5A 2I5UA 4AVZA 3FKJA 3ECHA 5IT3A 2LYCA 3VB2A 1NG6A 5GP9A 1IXSB 4U87A 1YE9A 4L9VA 1ETKA 4BEHB 1D5VA 1XMXA 3H3UA 3K70D 3OYBA 1O57A 3TOAA 2LDUA 3LA2A 2LSOA 2E5NA 3OY9A 3WGIA 1HLVA 3QU6A 4HAMA 5CLSA 2XAUA 3B6AA 4DYQA 2MSYA 3HOSA 1XG1A 4DGWB 2HQRA 1M1EB 2EFWA 1JUSA 2GXBA 3W6JB 5FD6A 2X51A 1BC7C 1K83J 2PG4A 2XSDC 4ESJA 1TWAJ 1FMVA 4YIRX 1P4XA 2OAZA 4A0XA 3JRFA 3AG1H 5H6QA 3GTOJ 4MNUA 2PEXA 1MGTA 2DA6A 4HLYA 3L9FA 4M6VA 4UY8I 5IT9Z 5K5QA 2XAFA 4U88A 5D8KB 1ZRFA 1ACIA 2JMWA 3C1DA 2WB1N 4WF2A 1MSFC 2DT7B 1LE8B 2GXAA 2M87A 4PFPA 3WE2A 2ZJPF 1X58A 2LP0A 4XLEA 2DXIA 2L7MP 5J6XA 3SDGA 3MKYB 2XAGA 3RKXA 1K61A 3HOVJ 5FLXK 3RCOA 1BJZA 3HPHA 4A3MJ 1X1AA 1P7JA 2V4JC 4XL9A 2WV0A 2OD5A 2XASA 4EJUA 4P96A 3ZMTA 2HDWA 1LVAA 4A3FJ 4ZYHA 1AHDP 5E17F 2EH3A 2Y30A 3J80Z 4XKBA 4IHYA 2KKOA 4CICA 2LKXA 2RC4A 3CCUI 1MNMC 1VZ0A 1AKHA 3ZQQA 3H36A 4KNYA 4NHJA 1SAUA 2FQ4A 5J8FA 2QYOA 1SVMA 2CQKA 3BTIA 3KIOA 2PMZN 4IQJA 4BBSJ 2V1DA 4HPQA 3A03A 3KE2A 3MWMA 4GGGA 2WY8Q 2IP2A 2TCTA 4G6TB 2FOWA 3QOEA 1TQIA 4PGGA 2QBYB 1JUPA 3ONQA 1FJLA 3CCQI 4RAFA 3QPTA 3CD6I 3BROA 5KNLA 3LSKA 4OAZA 1R1UA 3NARA 4B8XA 3BZCA 2WC2A 3DF8A 2HFHA 2E2IJ 4YFKF 1VF9A 5L3FA 2VQGA 4E6KG 4JK1X 4RB3C 4ZZDA 5F1JA 3CCYA 3KZZA 4BHBA 2K3FA 2Y48A 5D5UB 4I0BA 4BQQA 1VQMI 1IV6A 3CDLA 1X3ZB 1T08B 1EH8A 4RAZA 4BBRJ 1T6SA 2XF5A 3ISPA 5FO5A 3L2WA 2MD0A 3OYHA 3SQNA 3M8JA 3CMEI 2O8KA 4PCQA 1X3UA 1ETXA 1LDKB 4E7LA 2E7XA 2QKMB 4HNVA 3N05A 1IRGA 3K9TA 4F93B 5HOOA 4NQWA 3J80K 5K5RA 2B9SA 1G4DA 1XC5A 2RQQA 4CZCA 1Y39A 1Y1VJ 4XLPF 2X1EA 4S0HB 5EF6A 5B1BH 2YU9J 3ZN1A 2CV1A 2HVQA 2DFFA 2GA2A 3MEXA 2IPQX 3U1KA 3JRDA 3PSFA 3DWLE 4B43A 3JTGA 3HOZJ 3O8HA 3W2AA 1IO2A 1D8JA 3LA3A 1J59A 1U5TC 4CXFA 1W36C 4Y4RA 3VFZA 3S32A 4EVIA 4O5VA 1XCBA 3HRMA 2MGQA 3GTKJ 5TJJA 3G2BA 3RTRA 4Q4ZF 5IT9K 3QYBA 2DJIA 2VBYA 3QWLA 1R36A 4V19K 3MD2A 1ZYRF 2DA7A 2DMUA 1B59A 4HOBA 1FP1D 3MQ0A 2H6CA 2VASA 3L2VA 1IGNA 2H6BA 2KPMA 1HDDC 4ZYGA 2A6TA 2DO7A 4FE7A 4IHSA 2G7HA 2G7UA 2CQXA 4RLQA 1KQ9A 1OKRA 2JVHA 2P4WA 5HLGA 1DQUA 2QA4I 2X6XA 4A3IJ 5DUKA 1WWXA 1MMGA 1X2MA 1QNTA 3V7CA 2VQHA 1USSA 4HX7A 2KMUA 3HBLA 3BCAA 4IOAF 2X6OA 3E6CC 1I6XA 4LOCA 1H9GA 4B47A 3GUDA 3BLYA 5HNFA 2L7FP 3HKZN 1TC3C 2A6EF 4ZDLA 2V6CA 5EGOA 1WJAA 4EGYA 4CYCB 1XS9A 1QO0D 1ZKGA 2BXYA 3LFKA 5DCFA 1R5HA 5E18F 2R5ZA 5GAEJ 1BI0A 1A5JA 4M3FA 3QRFF 2EA4A 2EZLA 2MLKA 5EYRA 1Y6IA 2XB5A 3PQJA 4XIDA 1BBYA 3BTJA 2QEXI 3O8GA 5E79C 3HJEA 5DDGA 3JAMK 2M1BA 2HQ5A 3KP3A 3LSHA 3A01B 1NG7A 3MKLA 5H6RA 4BAYA 2AQFA 1RESA 1AOYA 1B9MA 3ABUA 4G7ZF 1XMKA 2FMLA 5DM7F 3IL2A 3HUGB 2BZTA 3FK7A 5LHIA 1IN6A 1V55H 1MJ9A 3ASNH 1MH4A 3S3OA 4C9YA 4IRIA 1W5SA 1U3EM 4CHUA 2IA1A 4GO1A 1YLFA 2X0LA 2EIJH 3P7NA 2RN7A 3OSFA 4E7KA 1UB9A 3LSPA 4KISA 2Z2SB 2LLKA 1HDPA 3LAJA 1B1BA 1IW7F 1KU7A 3G4SI 5LD2C 3MZHA 3QYEA 2P6TA 4DZJA 2R7XA 1VQNI 2K7LA 2EIMH 1B9NA 4Y52J 1FLIA 3FZVA 1APLC 4RA2A 4S05A 4RGSA 1E3HA 2W4SA 4LMYA 5D6FA 3CC2I 3RIRA 2HVSA 4AD9A 2EWNA 3C7JA 2VT2A 4I99C 2HDDA 3P5JA 1B8IB 2QQ9A 3HRTA 2XF6A 2N8GA 4IHVA 2O9LA 3PNVA 2Y0SN 2NOJB 5ICGA 2W7NA 3LL7A 3MVPA 3CJNA 4GYGA 1Z3YA 1MW7A 2F5EA 1ZGWA 4BJTA 1SD5A 2LY9A 5EEGA 1VQ9I 4NC8A 3RPUD 4OWRB 3WTVC 1MMSA 4Y13A 3FK6A 4JBAA 1HSTA 3IWZA 2CMPA 3ROUA 2JUCA 5DCMB 2QSHX 4AWXB 4BE1A 2DTRA 3GBGA 5K1YA 3MAJA 1B72A 5FFZA 2E1OA
chains in the Genus database with same CATH topology
1ITYA 2CUEA 2JK3A 3SFIA 9ANTA 3ZQFA 3PO3J 2XB0X 1FTTA 1S7EA 4A3GJ 5EG0A 1IUFA 2DA2A 1QVTA 2CU7A 5F0CA 1VFCA 3F0CA 1I6HJ 2JA7J 2B63J 3BTCA 2HOTA 4M3DA 1U9OA 3JRGA 2HYJA 1T56A 5IYBJ 2O7OA 4FTHA 2NS8A 3SJMA 2NVYJ 4XRSA 1JKOC 5J1YA 4A3CJ 1R9TJ 1TWHJ 4A69C 5M3FJ 5FKMA 2LVSA 4FISA 4M3GA 4DZPA 4A3KJ 1B72B 2Y2ZA 3E7LA 2R0QC 2XGEA 2ELKA 1MBKA 1IDYA 5E3NA 4DYRA 4EEFG 1ZQ3P 5EZGA 4C2MJ 5IP6A 1JGGA 4FCYA 1E3OC 5IP7J 3RQIA 2EQRA 2GM4A 2VUMJ 1I3QJ 3ZQGA 4C3HJ 4D7NA 4QIWN 4A3BJ 3PM1A 1IC8A 4AC0A 4BY7J 2R5YB 2VPRA 5JLXA 2XGCA 3LOCA 2X9DA 4B1RA 2DJNA 3FKIJ 1RETA 2D5VA 1TWGJ 5J3LA 5BNGA 1H88C 5IOZA 1ETVA 1QRYA 2XRLA 2H1KA 3S2HJ 3BG3A 1BW5A 4I76A 2MG4A 2DA1A 5C4JJ 2JWTA 5K7FA 4DYCA 5GPAA 3S15J 1GUUA 5FKKA 3TW7A 2I10A 5J1RA 1ETOA 1F43A 2IAIA 4JP0A 4BY1J 5C44J 5EGOB 2NOGA 2NVXJ 3RZOJ 2COBA 5F04A 3BTLA 1AU7A 2RAEA 1MSEC 1BA5A 3BG9A 3BR1A 3L1PA 2ME6A 2R5ZB 3OIOA 1JTYA 1UMQA 1QPIA 3S1NJ 3TP0A 4RBOA 2ECCA 1VI0A 2OPTA 2JJ7A 4ABZA 3GTJJ 3B6CA 1JUMA 4CYCA 3CMYA 2NVTJ 1MBEA 3BR3A 4C3IJ 1OCTC 2LK2A 2JA8J 4D7MA 4RDUA 3HOXJ 3HOYJ 2ME0A 3Q0VA 4UUSA 3K7AJ 1IG7A 3NAUA 5F08A 1GV5A 3A02A 4JX6A 3ZQLA 1U78A 3PO2J 3VPRA 3G1LA 1A6IA 2Y31A 4V2GA 2WV1A 5EZHA 3GTPJ 1HOMA 2IBDA 1JJ8C 3GTMJ 3RKQA 5JLWA 2VKEA 2G0EA 1RPWA 3I4MJ 2HI3A 3BG5A 2VKVA 2LR8A 2M8GX 4XRSG 3JRAA 2ID3A 2ECBA 3RZDJ 3ZOBA 5GP9A 1VNDA 4Y52J 4A3JJ 3A01A 1ETKA 3BQZA 3HOUJ 2M34A 3QPLA 1UHSA 2M0CA 4GFBA 2E2HJ 1HLVA 4MLOA 1BL0A 5M5XJ 1ENHA 3B6AA 3GTLJ 2K40A 4DYQA 3TP3A 2MSYA 3S1MJ 3IH2A 1XG1A 2CUFA 3M4OJ 4MIMA 2YUSA 4B3AA 5F0HA 1JUSA 1MH3A 1X2NA 1GVDA 3OOUA 1OJLA 1K83J 2XSDC 3BR6A 1TWAJ 1WI3A 2R7ZJ 3JRFA 3G1MA 3GTOJ 2XPUA 3LNQA 2K9NA 5E3MA 2DA6A 4W1UA 3LSRA 3JREA 2DMNA 4M6VA 4QSHA 1W0UA 2JMWA 2L9RA 2WB1N 1MSFC 1LE8B 1X58A 2LP0A 3JR9A 2GLOA 2DA3A 4X1EA 4X6AJ 2L7MP 2DTZA 2CQQA 3SDGA 5EDNA 1K61A 2R92J 3HOVJ 1T33A 4A3MJ 1BJZA 2CJJA 1P7JA 1SANA 4IHWA 4I6ZA 1WH5A 1Z0XA 4A3FJ 3S16J 1AHDP 2EH3A 4D5FA 1WPKA 2Y30A 4IHYA 4BKXA 1H8AC 2LKXA 4IEJA 1MNMC 2GBYA 1AKHA 3HGGA 3LSJA 3S14J 2FQ4A 1JTXA 2LFBA 3BTIA 4A3EJ 2PMZN 4BBSJ 3BR2A 5M5WJ 3A03A 5IPAA 1Y1WJ 3IH4A 2TCTA 4JX4A 4AUXA 1HF0A 4M3BA 1AKHB 1DU0A 2NVQJ 1JUPA 4XICA 2DMQA 1FJLA 3ZQHA 1RKWA 4B4CA 1IRZA 2EZKA 3HGYA 4NDLA 3NARA 4M3EA 5K7HA 2H8RA 3DEWA 2ID6A 2E2IJ 1VF9A 1NK3P 4MFEA 1YRNB 5F1JA 3CCYA 3S1QJ 5DS9A 3D1NI 1FEXA 2HXIA 3UKGA 2MW8A 4D5CA 3CDLA 1IV6A 5FLMJ 4BBRJ 5IYDJ 3GTGJ 1ZR2A 5F27A 3WHBA 1QVUA 2M2EA 2O8KA 1UG2A 5E3OA 1YRNA 1ETXA 4IHXA 5EEAA 2DMTA 3BQYA 4HNVA 5M3MJ 1LE8A 2AHQA 2Y9ZA 3HM5A 1XC5A 3QQAA 1HCRA 3JRCA 1Y1VJ 5F0FA 4MFDA 2ZB9A 1Z77A 4S0HB 5EF6A 2VI6A 2YU9J 2DA5A 1O4XA 3CQZJ 4Y7NJ 5C3EJ 1GV2A 3JRDA 1GDTA 2XPWA 2K9SA 2HOSA 3HOZJ 3BR0A 2JA6J 2DA4A 2WAQN 3O8HA 1Q1VA 2Y9YA 1ZTRA 1I50J 1ZR4A 4G12A 2MGQA 3GTKJ 1F36A 4JYKA 2DMPA 3C2BA 1H89C 4XRMA 2DA7A 2DMUA 2FX0A 4AYBN 3I4NJ 1POGA 1MBJA 2LD5A 1DU6A 3HEFA 3S1RJ 2R5YA 1D5YA 4A3DJ 1WGXA 3Q0WA 4JX5A 3GTQJ 1IGNA 2LTPA 2KDZA 3WHCA 1W0TA 5J1UA 1HDDC 4FE7A 2CQXA 2JN6A 4UUSB 2TRTA 2X48A 3BR5A 1LFBA 5E3LA 5GPCA 5M5YJ 2R93J 3M3YJ 3IH3A 4A3IJ 4FE4A 1X2MA 1ETWA 3MN2A 3JRIA 3HOWJ 4V2FA 3HBLA 5HODA 1TWCJ 5IOYA 1NTCA 2X6OA 1OFCX 4LOCA 2EZIA 2E2JJ 1SFOJ 2FJ1A 5IYCJ 1TWFJ 1FTZA 5FLVA 2L7FP 5DTDA 2YS9A 1WH7A 3HKZN 1TC3C 5EGOA 3K2AA 3Q0UA 1MBHA 3ZQIA 4CYCB 3JRBA 1XS9A 1ZKGA 3TW6A 5K7ZA 2R5ZA 1A5JA 5IP9J 3QPSA 2QF7A 4M3FA 2EZLA 4A3LJ 5EYRA 1JT0A 2XB5A 4XIDA 2XGDA 3BTJA 2EZHA 3LSGA 3O8GA 2W48A 2HQ5A 1ZK8A 3A01B 3MKLA 2NS7A 1RESA 1WCMJ 4DW6A 3FIWA 3FK7A 3G1OA 2E19A 1JKPC 1MH4A 1U9NA 5FJ8J 2OF7A 2L0KA 3OSFA 2P81A 2M9HA 5FKNA 1IDZA 4XK4A 3LSPA 2FD5A 2L7ZA 2LLKA 1HDPA 1NK2P 1FIPA 1JT6A 1B8IA 3DCFA 3S2DJ 1EF4A 1PUFA 1LFUP 4DZJA 1FIAA 1CQTA 1MBGA 2KT0A 1ETYA 3S17J 1G2HA 3IV5A 1JKRC 3HB9A 1RKTA 1GT0C 1APLC 4L5EA 5C4XJ 2IEKA 1PUFB 3ZQCA 3BT9A 2HDDA 2DN0A 4A93J 1B8IB 2EBIA 5FKOA 2N8GA 5EG0B 2AO9A 3H3VK 1BW6A 3TEDA 3FISA 4IHVA 2O9LA 4J19A 2Y0SN 3HDDA 1OCPA 4UUTA 4C3JJ 2K9QA 2HOAA 3MVPA 5FKLA 2CRGA 1U8BA 1ZGWA 2QCOA 3W6VA 1ETQA 2LY9A 1IJWC 1MBFA 1RR7A 2XPVA 3OSGA 1P7IA 3FK6A 3Q3SA 2HXOA 4QTRA 4W97A 1ORKA 1JJ6C 4BXXJ 3H0GJ 4MO7A 3GBGA 1JKQC 2JA5J 3JRHA 1B72A 2E1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITY A;  2CUE A;  2JK3 A;  3SFI A;  9ANT A;  3ZQF A;  3PO3 J;  2XB0 X;  1FTT A;  1S7E A;  4A3G J;  5EG0 A;  1IUF A;  2DA2 A;  1QVT A;  2CU7 A;  5F0C A;  1VFC A;  3F0C A;  1I6H J;  2JA7 J;  2B63 J;  3BTC A;  2HOT A;  4M3D A;  1U9O A;  3JRG A;  2HYJ A;  1T56 A;  5IYB J;  2O7O A;  4FTH A;  2NS8 A;  3SJM A;  2NVY J;  4XRS A;  1JKO C;  5J1Y A;  4A3C J;  1R9T J;  1TWH J;  4A69 C;  5M3F J;  5FKM A;  2LVS A;  4FIS A;  4M3G A;  4DZP A;  4A3K J;  1B72 B;  2Y2Z A;  3E7L A;  2R0Q C;  2XGE A;  2ELK A;  1MBK A;  1IDY A;  5E3N A;  4DYR A;  4EEF G;  1ZQ3 P;  5EZG A;  4C2M J;  5IP6 A;  1JGG A;  4FCY A;  1E3O C;  5IP7 J;  3RQI A;  2EQR A;  2GM4 A;  2VUM J;  1I3Q J;  3ZQG A;  4C3H J;  4D7N A;  4QIW N;  4A3B J;  3PM1 A;  1IC8 A;  4AC0 A;  4BY7 J;  2R5Y B;  2VPR A;  5JLX A;  2XGC A;  3LOC A;  2X9D A;  4B1R A;  2DJN A;  3FKI J;  1RET A;  2D5V A;  1TWG J;  5J3L A;  5BNG A;  1H88 C;  5IOZ A;  1ETV A;  1QRY A;  2XRL A;  2H1K A;  3S2H J;  3BG3 A;  1BW5 A;  4I76 A;  2MG4 A;  2DA1 A;  5C4J J;  2JWT A;  5K7F A;  4DYC A;  5GPA A;  3S15 J;  1GUU A;  5FKK A;  3TW7 A;  2I10 A;  5J1R A;  1ETO A;  1F43 A;  2IAI A;  4JP0 A;  4BY1 J;  5C44 J;  5EGO B;  2NOG A;  2NVX J;  3RZO J;  2COB A;  5F04 A;  3BTL A;  1AU7 A;  2RAE A;  1MSE C;  1BA5 A;  3BG9 A;  3BR1 A;  3L1P A;  2ME6 A;  2R5Z B;  3OIO A;  1JTY A;  1UMQ A;  1QPI A;  3S1N J;  3TP0 A;  4RBO A;  2ECC A;  1VI0 A;  2OPT A;  2JJ7 A;  4ABZ A;  3GTJ J;  3B6C A;  1JUM A;  4CYC A;  3CMY A;  2NVT J;  1MBE A;  3BR3 A;  4C3I J;  1OCT C;  2LK2 A;  2JA8 J;  4D7M A;  4RDU A;  3HOX J;  3HOY J;  2ME0 A;  3Q0V A;  4UUS A;  3K7A J;  1IG7 A;  3NAU A;  5F08 A;  1GV5 A;  3A02 A;  4JX6 A;  3ZQL A;  1U78 A;  3PO2 J;  3VPR A;  3G1L A;  1A6I A;  2Y31 A;  4V2G A;  2WV1 A;  5EZH A;  3GTP J;  1HOM A;  2IBD A;  1JJ8 C;  3GTM J;  3RKQ A;  5JLW A;  2VKE A;  2G0E A;  1RPW A;  3I4M J;  2HI3 A;  3BG5 A;  2VKV A;  2LR8 A;  2M8G X;  4XRS G;  3JRA A;  2ID3 A;  2ECB A;  3RZD J;  3ZOB A;  5GP9 A;  1VND A;  4Y52 J;  4A3J J;  3A01 A;  1ETK A;  3BQZ A;  3HOU J;  2M34 A;  3QPL A;  1UHS A;  2M0C A;  4GFB A;  2E2H J;  1HLV A;  4MLO A;  1BL0 A;  5M5X J;  1ENH A;  3B6A A;  3GTL J;  2K40 A;  4DYQ A;  3TP3 A;  2MSY A;  3S1M J;  3IH2 A;  1XG1 A;  2CUF A;  3M4O J;  4MIM A;  2YUS A;  4B3A A;  5F0H A;  1JUS A;  1MH3 A;  1X2N A;  1GVD A;  3OOU A;  1OJL A;  1K83 J;  2XSD C;  3BR6 A;  1TWA J;  1WI3 A;  2R7Z J;  3JRF A;  3G1M A;  3GTO J;  2XPU A;  3LNQ A;  2K9N A;  5E3M A;  2DA6 A;  4W1U A;  3LSR A;  3JRE A;  2DMN A;  4M6V A;  4QSH A;  1W0U A;  2JMW A;  2L9R A;  2WB1 N;  1MSF C;  1LE8 B;  1X58 A;  2LP0 A;  3JR9 A;  2GLO A;  2DA3 A;  4X1E A;  4X6A J;  2L7M P;  2DTZ A;  2CQQ A;  3SDG A;  5EDN A;  1K61 A;  2R92 J;  3HOV J;  1T33 A;  4A3M J;  1BJZ A;  2CJJ A;  1P7J A;  1SAN A;  4IHW A;  4I6Z A;  1WH5 A;  1Z0X A;  4A3F J;  3S16 J;  1AHD P;  2EH3 A;  4D5F A;  1WPK A;  2Y30 A;  4IHY A;  4BKX A;  1H8A C;  2LKX A;  4IEJ A;  1MNM C;  2GBY A;  1AKH A;  3HGG A;  3LSJ A;  3S14 J;  2FQ4 A;  1JTX A;  2LFB A;  3BTI A;  4A3E J;  2PMZ N;  4BBS J;  3BR2 A;  5M5W J;  3A03 A;  5IPA A;  1Y1W J;  3IH4 A;  2TCT A;  4JX4 A;  4AUX A;  1HF0 A;  4M3B A;  1AKH B;  1DU0 A;  2NVQ J;  1JUP A;  4XIC A;  2DMQ A;  1FJL A;  3ZQH A;  1RKW A;  4B4C A;  1IRZ A;  2EZK A;  3HGY A;  4NDL A;  3NAR A;  4M3E A;  5K7H A;  2H8R A;  3DEW A;  2ID6 A;  2E2I J;  1VF9 A;  1NK3 P;  4MFE A;  1YRN B;  5F1J A;  3CCY A;  3S1Q J;  5DS9 A;  3D1N I;  1FEX A;  2HXI A;  3UKG A;  2MW8 A;  4D5C A;  3CDL A;  1IV6 A;  5FLM J;  4BBR J;  5IYD J;  3GTG J;  1ZR2 A;  5F27 A;  3WHB A;  1QVU A;  2M2E A;  2O8K A;  1UG2 A;  5E3O A;  1YRN A;  1ETX A;  4IHX A;  5EEA A;  2DMT A;  3BQY A;  4HNV A;  5M3M J;  1LE8 A;  2AHQ A;  2Y9Z A;  3HM5 A;  1XC5 A;  3QQA A;  1HCR A;  3JRC A;  1Y1V J;  5F0F A;  4MFD A;  2ZB9 A;  1Z77 A;  4S0H B;  5EF6 A;  2VI6 A;  2YU9 J;  2DA5 A;  1O4X A;  3CQZ J;  4Y7N J;  5C3E J;  1GV2 A;  3JRD A;  1GDT A;  2XPW A;  2K9S A;  2HOS A;  3HOZ J;  3BR0 A;  2JA6 J;  2DA4 A;  2WAQ N;  3O8H A;  1Q1V A;  2Y9Y A;  1ZTR A;  1I50 J;  1ZR4 A;  4G12 A;  2MGQ A;  3GTK J;  1F36 A;  4JYK A;  2DMP A;  3C2B A;  1H89 C;  4XRM A;  2DA7 A;  2DMU A;  2FX0 A;  4AYB N;  3I4N J;  1POG A;  1MBJ A;  2LD5 A;  1DU6 A;  3HEF A;  3S1R J;  2R5Y A;  1D5Y A;  4A3D J;  1WGX A;  3Q0W A;  4JX5 A;  3GTQ J;  1IGN A;  2LTP A;  2KDZ A;  3WHC A;  1W0T A;  5J1U A;  1HDD C;  4FE7 A;  2CQX A;  2JN6 A;  4UUS B;  2TRT A;  2X48 A;  3BR5 A;  1LFB A;  5E3L A;  5GPC A;  5M5Y J;  2R93 J;  3M3Y J;  3IH3 A;  4A3I J;  4FE4 A;  1X2M A;  1ETW A;  3MN2 A;  3JRI A;  3HOW J;  4V2F A;  3HBL A;  5HOD A;  1TWC J;  5IOY A;  1NTC A;  2X6O A;  1OFC X;  4LOC A;  2EZI A;  2E2J J;  1SFO J;  2FJ1 A;  5IYC J;  1TWF J;  1FTZ A;  5FLV A;  2L7F P;  5DTD A;  2YS9 A;  1WH7 A;  3HKZ N;  1TC3 C;  5EGO A;  3K2A A;  3Q0U A;  1MBH A;  3ZQI A;  4CYC B;  3JRB A;  1XS9 A;  1ZKG A;  3TW6 A;  5K7Z A;  2R5Z A;  1A5J A;  5IP9 J;  3QPS A;  2QF7 A;  4M3F A;  2EZL A;  4A3L J;  5EYR A;  1JT0 A;  2XB5 A;  4XID A;  2XGD A;  3BTJ A;  2EZH A;  3LSG A;  3O8G A;  2W48 A;  2HQ5 A;  1ZK8 A;  3A01 B;  3MKL A;  2NS7 A;  1RES A;  1WCM J;  4DW6 A;  3FIW A;  3FK7 A;  3G1O A;  2E19 A;  1JKP C;  1MH4 A;  1U9N A;  5FJ8 J;  2OF7 A;  2L0K A;  3OSF A;  2P81 A;  2M9H A;  5FKN A;  1IDZ A;  4XK4 A;  3LSP A;  2FD5 A;  2L7Z A;  2LLK A;  1HDP A;  1NK2 P;  1FIP A;  1JT6 A;  1B8I A;  3DCF A;  3S2D J;  1EF4 A;  1PUF A;  1LFU P;  4DZJ A;  1FIA A;  1CQT A;  1MBG A;  2KT0 A;  1ETY A;  3S17 J;  1G2H A;  3IV5 A;  1JKR C;  3HB9 A;  1RKT A;  1GT0 C;  1APL C;  4L5E A;  5C4X J;  2IEK A;  1PUF B;  3ZQC A;  3BT9 A;  2HDD A;  2DN0 A;  4A93 J;  1B8I B;  2EBI A;  5FKO A;  2N8G A;  5EG0 B;  2AO9 A;  3H3V K;  1BW6 A;  3TED A;  3FIS A;  4IHV A;  2O9L A;  4J19 A;  2Y0S N;  3HDD A;  1OCP A;  4UUT A;  4C3J J;  2K9Q A;  2HOA A;  3MVP A;  5FKL A;  2CRG A;  1U8B A;  1ZGW A;  2QCO A;  3W6V A;  1ETQ A;  2LY9 A;  1IJW C;  1MBF A;  1RR7 A;  2XPV A;  3OSG A;  1P7I A;  3FK6 A;  3Q3S A;  2HXO A;  4QTR A;  4W97 A;  1ORK A;  1JJ6 C;  4BXX J;  3H0G J;  4MO7 A;  3GBG A;  1JKQ C;  2JA5 J;  3JRH A;  1B72 A;  2E1O A; 
#chains in the Genus database with same CATH topology
 1KU9 A;  2PJR A;  1LDD A;  3DTK A;  3FXM A;  4XBF A;  4IO9 F;  2M7B A;  1N78 A;  3ZMV A;  2GA1 A;  3WG7 H;  2H1L A;  1OMI A;  1BI3 A;  2ACJ A;  3GFJ A;  1I6H J;  1UEL B;  3BTC A;  2HYF A;  2HOT A;  1I1S A;  4XKV A;  3JRG A;  4DBR A;  3ECO A;  2L54 A;  3DV8 A;  2IT0 A;  2FF4 A;  1LVK A;  5IYB J;  1UZC A;  3I71 A;  4PDK A;  2KIF A;  3DU6 A;  1VQ7 I;  1IXR C;  4XRS A;  3VSL A;  3HZJ A;  1JKO C;  1YYV A;  2IGN A;  5J1Y A;  1GLN A;  4A3C J;  1R9T J;  3K4K A;  1SAX A;  4M73 A;  3OV8 A;  4UVA A;  3A2K A;  4DZP A;  1MDM B;  1MMD A;  2OV7 A;  2Y2Z A;  2R0Q C;  3SEZ A;  2A5Y B;  2X6W A;  2XGE A;  1DP7 P;  1KYZ A;  3E6D A;  3FBI B;  1T2K A;  4DYR A;  2BHY A;  2DFI A;  4RS8 A;  1B6A A;  2BHZ A;  1OYI A;  3F72 A;  1YS6 A;  2XRN A;  1Y56 A;  3AL0 C;  1I3Q J;  1Z6T A;  3ZQG A;  4E7Z A;  4D7N A;  3CF2 A;  2DOF A;  1YW9 A;  2VPR A;  3K1M A;  5D4R A;  4I7H A;  2QGU A;  4C2T A;  3PIP F;  1VQP I;  4XOR A;  1R6R A;  2WTE A;  3LOC A;  2X9D A;  4B1R A;  5LFA A;  3TGN A;  3HIF A;  1RET A;  5J3L A;  3H5R A;  2M0M A;  4PFO A;  3KP5 A;  2KJC A;  1ETV A;  5IOZ A;  3H5N A;  2XRL A;  3QAH A;  2HQN A;  4I76 A;  4L0Z B;  1HKS A;  2RNG A;  1LFP A;  1RNL A;  1MJB A;  2PFB A;  2GIZ A;  2CH0 A;  3TW7 A;  2FBI A;  5LGT A;  1QQI A;  1K6Y A;  2I10 A;  3X2Q H;  1Y0N A;  5J1R A;  2CGP A;  1ERD A;  4MTD A;  3EET A;  3GVA A;  3H5A A;  4D1Q A;  1F43 A;  2BY1 A;  2LRE A;  3ZMD A;  1F4K A;  5KVR A;  4BY1 J;  4XRF A;  5FGM A;  2WAQ A;  3F9K A;  4LD5 A;  4WXC A;  1YW7 A;  2Y0M A;  1LB2 A;  2COB A;  1YIT I;  1BA5 A;  5LLQ A;  2ZNZ A;  1Z7L A;  3I5U A;  1IN8 A;  2ME6 A;  2R5Z B;  3GZ5 A;  3OYJ A;  6PAX A;  1WJC A;  2HPI A;  3S1N J;  4ZTJ A;  2OU2 A;  3GZN B;  2EJR A;  1JXS A;  2VOO A;  3ABL H;  3DBL B;  2LBF A;  1EV7 A;  2Y0S A;  3I4P A;  3GTJ J;  1JUM A;  3B6C A;  3ERM A;  2V1U A;  3J7A Y;  5L3E A;  4CYC A;  3LSI A;  2E60 A;  2R7Q A;  4XKC A;  3H9J A;  3VOE A;  2LK2 A;  2JA8 J;  3SZG A;  4RDU A;  3WG9 A;  3DBH B;  1W1W E;  4XM3 A;  5LRR A;  4ZYA A;  3A02 A;  2UXX A;  4RAG A;  4JX6 A;  5L3B A;  4CUG A;  5ERI A;  1EH7 A;  1R4N B;  3WU1 B;  2DLL A;  3W2W A;  4A12 A;  4LG0 A;  2BW3 B;  1JJ8 C;  3R0J A;  1UHW A;  5JLW A;  4NQW B;  1RPW A;  3CCL I;  2LNB A;  4B44 A;  2LC2 A;  3E6B A;  2VE9 A;  2VKV A;  2O0Y A;  4HEA 2;  2BY3 A;  1ZG1 A;  4QLC U;  3WU2 C;  1ONV A;  1Z1D A;  5FRM A;  3EUA A;  3ZR8 X;  3BQZ A;  2Q2E B;  3QPL A;  4M71 A;  1UHS A;  4OIP F;  4GDF A;  4HLX A;  2WAD A;  4OIR F;  3QOD A;  2YX4 A;  1Z67 A;  3HC7 A;  4MLO A;  1OCC H;  5M5X J;  1ENH A;  4WWC A;  3VEP A;  2HEO A;  1Z05 A;  4A0Z A;  3IH2 A;  4XLC A;  3FHN A;  4BJ6 C;  4MIM A;  5F0H A;  3CO7 C;  1XTA A;  1KGS A;  1X2N A;  4BUP A;  4EM2 A;  1ZAR A;  4NBQ A;  1G6N A;  2MFZ A;  3CJQ B;  1UG0 A;  4XLF A;  2R7Z J;  1O3Q A;  4QWQ A;  2XKP A;  2RRE A;  1TLH B;  4LB5 A;  3FXO A;  3G1M A;  3S3N A;  3F8N A;  2K9N A;  3J81 K;  5E3M A;  4W1U A;  2GZW A;  1J5Y A;  2O03 A;  5LBQ A;  2VXZ A;  3C2G A;  5ICC A;  3K4J A;  2ELJ A;  1RI7 A;  2I8D A;  2Q2E A;  4HF0 A;  2FEZ A;  4X1E A;  2JA2 A;  3TKY A;  3ZP5 A;  3GF2 A;  4RB0 A;  2CJJ A;  1R00 A;  3TDU C;  3KEQ A;  4IHW A;  4I6Z A;  5LEK A;  3ZCO A;  3CCE I;  2LRD A;  1PUE E;  1F9N A;  3S16 J;  1UHM A;  2K3P A;  2JPC A;  4E7S A;  3UR3 C;  1H8A C;  3DEU A;  1OQY A;  3BCB A;  3FXQ A;  3S14 J;  4GXO A;  2O6G E;  3FMR A;  3I64 A;  1JTX A;  2LFB A;  1RC9 A;  3BR2 A;  5ILU A;  1K79 A;  5M5W J;  3PFY A;  3SZT A;  3OYA A;  3IH4 A;  4JX4 A;  4RLF A;  3OYG A;  1AKH B;  1D3Y A;  1WJE A;  2CUJ A;  2K5C A;  2LF8 A;  4I01 A;  5B66 C;  3GZ6 A;  3UNG C;  4XIC A;  4M9Z A;  3VYT B;  2MA3 A;  1RKW A;  3HGY A;  5BMZ A;  5K7H A;  2DT5 A;  2H8R A;  4A5M A;  4KDP A;  3FDY A;  2ID6 A;  4RGU A;  2CWE A;  4MFE A;  3A0H C;  4IPA A;  1YRN B;  5EEH A;  3D5S C;  4EMS A;  3D1N I;  1FEX A;  5DD4 A;  2OJE D;  1GXQ A;  3VYR B;  3KYL A;  5FLM J;  2CV2 A;  5IYD J;  2DFE A;  3WHB A;  1JGS A;  1Z7U A;  1PVE A;  2IS6 A;  2VKD A;  3H9G A;  1YRN A;  4XN3 A;  2YSR A;  2JSC A;  3JSP A;  5EEA A;  5AIQ A;  2R4G A;  4O3M A;  2HWV A;  1Z91 A;  2OZ6 A;  2IGK A;  3O3K A;  3GXO A;  2V7F A;  2EB7 A;  3SEQ A;  2JZY A;  1O7F A;  2KRC A;  1R5I D;  3GWZ A;  4XKW A;  2VI6 A;  3IHU A;  3T5X A;  1VQ8 I;  3CQZ J;  4U0V A;  1XSV A;  4DBQ A;  3E0J B;  1GDT A;  2XPW A;  4Y3O A;  3T8R A;  2DA4 A;  2LBF B;  3RYP A;  1Q1V A;  1AWC A;  2ZME A;  1ZTR A;  3QOP A;  4ON0 A;  2ESN A;  5LEJ A;  2DDA A;  2K4B A;  2M3A A;  1ZR4 A;  2AXL A;  2P0W A;  4YII A;  4JYK A;  2XUB A;  1NH3 A;  3GFM A;  3GME A;  2XHK A;  2VJI A;  4XRM A;  1IUY A;  2KDO A;  4DIQ A;  4AYB N;  1K4S A;  3I4N J;  1EKE A;  2F4M B;  3OYE A;  2LD5 A;  1DU6 A;  3HEF A;  1XDU A;  3KLN A;  3RPU A;  3L2Q A;  1GVJ A;  3C3W A;  4JX5 A;  1YS7 A;  1T98 A;  4FET A;  1OIS A;  2KDZ A;  4IZZ A;  3MZ8 A;  5J1U A;  2DDB A;  4E7J A;  3WGH A;  1TNS A;  4TV7 A;  2W82 A;  2X48 A;  4DNC A;  3BR5 A;  1LFB A;  3NWT A;  1ZRD A;  5GPC A;  5M5Y J;  2R93 J;  3M3Y J;  1OYW A;  2A68 F;  3IH3 A;  3O6B B;  4UNO A;  3WTZ A;  1ZHF A;  4FE4 A;  5LHH A;  3MN2 A;  3JRI A;  3HOW J;  5JVT A;  4EM1 A;  3DU5 A;  4PK4 A;  1TWC J;  3OS2 A;  1NTC A;  2DQL A;  3PFI A;  2E2J J;  4XN0 A;  1X4P A;  4BHP A;  5FLV A;  5DTD A;  4YIF A;  2VXD A;  3GO5 A;  3K2A A;  3M8E A;  1DDN A;  3FM3 A;  4PJL A;  5K7Z A;  2QZ8 A;  5D5V B;  2QF7 A;  3ABK H;  3JAM Z;  2QQB A;  2Q1Z B;  5D5X B;  1ZLK A;  3KCC A;  5J8C A;  4XOP A;  3E3V A;  3J81 Z;  3DXJ F;  4A6E A;  2W48 A;  4A0Y A;  4F52 A;  3CUO A;  1ZK8 A;  4CH7 A;  2R3S A;  1XGO A;  2NS7 A;  1CF7 B;  1VQ4 I;  3BOQ A;  1WCM J;  3MKW B;  3FIW A;  5D8L B;  2KP6 A;  3HXL A;  3NWS A;  4DOZ A;  3H9Q A;  5KAF C;  5J4V A;  1D0Z A;  4ENJ A;  2E7W A;  5CQE A;  1JKP C;  5JVG F;  1WJD A;  1TW3 A;  1U9N A;  5DM6 F;  1MJA A;  3OOP A;  5AIP A;  1XN7 A;  2OF7 A;  1TL8 A;  3CCS I;  4XLH A;  2F6C A;  2BVL A;  3Q9S A;  4CSW A;  3AG4 H;  4C2U A;  5FKN A;  3OMY A;  4XK4 A;  5KAI C;  2MH2 A;  2R7D A;  1J7K A;  4KA4 A;  5LHG A;  2D1H A;  1S9H A;  2ZSH B;  5E20 A;  4LB6 B;  4J00 A;  4BYY A;  1VQK I;  1MBG A;  4LGW A;  3Q5F A;  3BC8 A;  3K10 A;  3NRV A;  1JKR C;  1IRF A;  3HB9 A;  4HV6 A;  3WTW C;  1GT0 C;  1FT9 A;  4ESB A;  1A36 A;  5H2F C;  2M45 A;  3K4N A;  4Y17 A;  5JR3 A;  3CC7 I;  2DN0 A;  4EJV A;  2RQP A;  2EBI A;  1REP C;  5EG0 B;  3H3V K;  3G3Z A;  1BW6 A;  3FIS A;  4J19 A;  3EPZ A;  4ZYD A;  1F5T A;  1FNN A;  2EFO A;  3HDD A;  2L9N A;  1KZH A;  2KZG A;  4C3J J;  4BXU A;  2HOA A;  2LMD A;  5FKL A;  3L09 A;  1NHA A;  3DPT A;  2CRG A;  2V79 A;  3PIO F;  1ETQ A;  3I56 I;  1RUN A;  1YJW I;  3FMS A;  1MBF A;  1MD0 A;  1RR7 A;  1TTY A;  2HQA A;  3GCM A;  1SD6 A;  1L3L A;  2HYG D;  2VON A;  2GAU A;  3RSN A;  1P7I A;  2TDX A;  2QSF X;  2Z3Y A;  3Q3S A;  3FBN B;  2M30 A;  2M7A A;  1ORK A;  1IZ1 A;  4BXX J;  1IV8 A;  2HOE A;  5LGU A;  2JA5 J;  1BN5 A;  2UWM A;  2CYY A;  3KET A;  2M4K A;  4E4H A;  5L3C A;  3S3M A;  1ITY A;  2CUE A;  2JK3 A;  2K02 A;  3HKZ A;  3LA7 A;  9ANT A;  2HVR A;  3ZQF A;  2XB0 X;  2ZFU A;  1S7E A;  4ZC3 A;  1UJ8 A;  2Q8K A;  4BU2 A;  4Y15 A;  4YRV A;  1MNE A;  5EG0 A;  1YHQ I;  4LLL A;  2WAF A;  2DA2 A;  3U21 A;  4KJZ A;  3F0C A;  2HR3 A;  2AXT C;  2JRM A;  3L00 A;  2Z9O A;  2V26 A;  2VL8 A;  1VTN C;  4M3D A;  4HNU A;  4IVN A;  3DP7 A;  3R60 A;  4I2O A;  2CW8 A;  1SMT A;  3ABT A;  1IN5 A;  3E5Q A;  1RZ4 A;  2NVY J;  4FQG A;  4P9F A;  2STW A;  2ESH A;  1BI2 A;  1OCO H;  1DGW Y;  1CGP A;  2ZCW A;  4IX7 A;  1TWH J;  5M3F J;  1J75 A;  5TIS C;  2VBX A;  2L2O A;  1U8R A;  1WZ2 A;  3FXU A;  4A3K J;  1R49 A;  1B72 B;  3W6K B;  1QBJ A;  2V6E A;  1U0J A;  2ELK A;  1MBK A;  3W2V A;  1HW2 A;  2IA2 A;  1KQ0 A;  1I5Z A;  4FCY A;  1FBQ A;  1E3O C;  5IP7 J;  4EJW A;  4XLA A;  5DUI A;  2PI0 A;  1OR7 A;  4QIW N;  4O6J A;  2E1M C;  1W4M A;  1R1V A;  3T0Y A;  5JLX A;  4ENM A;  4XOT A;  1K7A A;  1YW8 A;  4LLG F;  2E34 A;  1G3W A;  2RV8 A;  2VPL A;  4Z6Y A;  2DJN A;  3FKI J;  4PSX A;  4BXF A;  1QU3 A;  2LKS A;  2OTJ I;  1LNW A;  2PMH A;  5BS6 A;  2L4M A;  3PNY A;  3F21 A;  5GAD J;  4BAC A;  1BW5 A;  3I58 A;  1B4A A;  2IA0 A;  4LG0 B;  2OCC H;  3OYL A;  2JWT A;  5K7F A;  4F55 A;  1GUU A;  5FKK A;  2XSJ C;  4U0W A;  4L18 B;  1ETO A;  1P4A A;  2IAI A;  2L01 A;  4ZTF A;  5EGO B;  4HDV A;  1HKQ A;  5FRN A;  3F23 A;  2NVU B;  1K78 A;  1S6L A;  3I59 A;  4N9H A;  3BTL A;  5A2Q K;  2RAE A;  2KIM A;  1MSE C;  2J5O A;  2DOE A;  2L4A A;  4Z2Y A;  3OS0 A;  1FYM A;  1PDN C;  5CVI A;  3L1P A;  1STZ A;  3E5U A;  2NS0 A;  2VBW A;  1JTY A;  3OIO A;  1O7L A;  4MGR A;  3TO6 A;  4HYE A;  3KX2 A;  3CUQ A;  2ECC A;  2HNH A;  2KRH A;  1VI0 A;  2KZV A;  2IS4 A;  3WGG A;  4ABZ A;  4UV8 A;  2Z5U A;  3HRU A;  3ZGK A;  4U7D A;  1TZL A;  2HU9 A;  3DKY A;  3BR3 A;  4PSW A;  5FLX Z;  4D7M A;  5ILS A;  1OCR H;  3HOY J;  2ME0 A;  4ZZL A;  1XD7 A;  4F7Z A;  2BBY A;  2WB1 A;  1BR2 A;  3R0A A;  4UUS A;  3ZRG A;  2BY0 A;  3BJA A;  1SD7 A;  3K7A J;  1SVO A;  1LQ1 A;  3E97 A;  5D6E A;  1T8I A;  1TQM A;  3OYD A;  3LWF A;  3L2C A;  3ZQL A;  2HTJ A;  4GRI A;  3OL3 A;  2KIU A;  2ADU A;  4LIV A;  4NB5 A;  3VPR A;  4DJA A;  2Y31 A;  4UXN A;  3M1C A;  1HOM A;  1RIO H;  3GTP J;  3GTM J;  1PJR A;  3GLX A;  3M8F A;  1O3S A;  2VKE A;  2E1M B;  2G0E A;  2DI3 A;  5FD5 A;  3BG5 A;  2A3S A;  2LR8 A;  2M8G X;  3EUH C;  2ID3 A;  2IGO A;  2EV0 A;  2MH9 A;  3ZOB A;  3RKW A;  4HDU A;  4MEX F;  3QP5 A;  2F5D A;  1XMA A;  2F5C A;  4HSR A;  3LST A;  1H9T A;  2ZXI A;  3E1S A;  3HTS B;  1Q1H A;  2CS3 A;  3HOU J;  1AA7 A;  2M0C A;  4GFB A;  5FB2 A;  2DQR A;  3D5L A;  1U6G A;  3F22 A;  1D0Y A;  2K40 A;  3DBR B;  5GAG J;  5J40 A;  2O61 A;  2YUS A;  2VB6 A;  1S5L C;  1YX3 A;  1MH3 A;  4U7B A;  3KEO A;  1GVD A;  2VOD A;  5L3G A;  1XGN A;  2HDC A;  3OOU A;  1OJL A;  2BGC A;  3BR6 A;  1WI3 A;  4D9J A;  1IN4 A;  2BVM A;  4LFU A;  2K9L A;  2ZJ2 A;  5DCM A;  3M7G A;  2EIN H;  2KFD A;  3O2P E;  5CJ9 A;  4HRI A;  4HG2 A;  2PMZ A;  3LSR A;  2W57 A;  3ELK A;  3OIP A;  1VQ6 I;  2L9R A;  1UST A;  2Q0O A;  2HZT A;  2W00 A;  4G7O F;  3F8C A;  3BPV A;  5DV5 A;  4E7H A;  4Q5S F;  3IWF A;  3JR9 A;  2RKH A;  2FU4 A;  2DA3 A;  4X6A J;  2DTZ A;  5EDN A;  4KFC A;  2IW5 A;  4HQM A;  3J7A O;  1T33 A;  1WJB A;  5CQG A;  1RUO A;  4M9X A;  5D5W B;  1SAN A;  4WCG A;  4H0E A;  2JQ7 A;  1WH5 A;  4XR6 A;  2ZC2 A;  1V3F A;  2YX7 A;  3DPL C;  1BIB A;  1FSE A;  3BZK A;  3CDI A;  4BKX A;  3PUF A;  1VQ5 I;  4IEJ A;  1SEU A;  5BPI A;  4AU7 A;  1WRJ A;  2K27 A;  3GLL A;  1ON1 A;  2GBY A;  3HGG A;  5ED4 A;  2BYV E;  3R4K A;  3JCU C;  3CLQ A;  3EQL F;  1KU3 A;  4U0Y A;  4A3E J;  1D1C A;  2FUG 2;  2O5R A;  2FSW A;  3H0D A;  4K2E A;  1YO5 C;  1Y1W J;  1DGR M;  4AUX A;  4M3B A;  1J9I A;  1LPQ A;  3A0B C;  2DMQ A;  1R7J A;  1YIJ I;  2RVC A;  1ZGJ A;  2EV6 A;  2LG4 A;  2ZJQ F;  4N0B A;  2YPR A;  1LEA A;  4B4C A;  1TNT A;  1YJN I;  2ZXH A;  4NDL A;  4BQA A;  3T1B A;  3DEW A;  3MZY A;  1OYY A;  3BDD A;  4WXD A;  4BNC A;  3IC7 A;  1FMW A;  3K4C A;  3LFU A;  5DEQ A;  5DS9 A;  2V9K A;  3AFH A;  2PQ8 A;  4BDZ A;  1SD4 A;  1X1B A;  2VN2 A;  3RPQ A;  2L5Q A;  3GTG J;  5F27 A;  2GIV A;  1N75 A;  4FX0 A;  4L0Y B;  4J01 A;  2KQR A;  3DLA A;  1QVU A;  4ITV A;  4II2 A;  3P9I A;  2PLY A;  4EV0 A;  3BQY A;  1FBU A;  3K1P A;  4ZYE A;  2Z16 A;  1HCR A;  3JRC A;  2X1D A;  1YX5 A;  2ZB9 A;  3DKX A;  3WTY C;  2DA5 A;  3L7W A;  1P2F A;  1O4X A;  1IAW A;  2RGV A;  2HTS A;  2OA4 A;  1TT0 A;  3F3X A;  2K9S A;  2GXG A;  2WAQ N;  3SFZ A;  2P7C B;  2ZME C;  5B1A H;  4L9T A;  2FNP A;  4IJA A;  4UB6 C;  4HF2 A;  4G12 A;  4YG2 F;  1F36 A;  2DMP A;  3C2B A;  1HKT A;  1JHF A;  3K0L A;  3BPX A;  5CKT A;  3U1D A;  2XKO A;  1V54 H;  4BGD A;  1DPU A;  4PJ0 C;  4HX4 A;  3I59 B;  1MBJ A;  4HQE A;  2R5Y A;  1D5Y A;  4A3D J;  2ZSI B;  1WGX A;  2R7W A;  4XMY A;  2PBI A;  2DT6 A;  5CVR A;  2LTP A;  3HSF A;  4XLN F;  2OUM A;  1ZRC A;  1OR7 C;  4E70 A;  2DBB A;  1XPX A;  4C30 A;  1OLT A;  2KRF A;  2JN6 A;  4UUS B;  4KIF A;  2O3F A;  2VT3 A;  4ETS A;  4D0P A;  3QP6 A;  2QWW A;  2EFP A;  4BQN A;  1QGP A;  3BG6 A;  1MMN A;  2VC1 A;  5ICE A;  2ISZ A;  2QQ8 A;  3M9A A;  4V2F A;  1YFH A;  1QZE A;  4PGH A;  3H3Z A;  5IOY A;  4PJJ A;  3WU0 A;  4A2U A;  1OFC X;  2E5Z A;  2XAH A;  2EZI A;  2F4O B;  1SFO J;  2CV0 A;  2FJ1 A;  1TWF J;  1JE8 A;  4OIN F;  1DPR A;  2CQN A;  3I55 I;  3JTH A;  2YS9 A;  1PP8 F;  3PSI A;  5HDK A;  1MBH A;  3ZQI A;  3JRB A;  3D5R C;  3TW6 A;  5TRD A;  3QPS A;  3DTI A;  3S8P A;  3DPU A;  1XX5 A;  4LK1 F;  3IRR A;  2A5W A;  3AKZ A;  3KP7 A;  1JT0 A;  2E35 A;  4GCV A;  1KU2 A;  2XGD A;  3R6S A;  1J09 A;  4XQF A;  4X0G A;  4ENK A;  4A6D A;  2V9V A;  1V5F A;  3AG3 H;  3CC4 I;  3CP8 A;  2XV4 S;  3T8T A;  2FBH A;  4WK8 F;  4KN4 X;  4PUS A;  1WHU A;  1OPC A;  2BY2 A;  2FRH A;  3LQQ A;  1E3P A;  3MCZ A;  4KMU X;  4PJM A;  3CTA A;  1T39 A;  3IKT A;  2VIX A;  3OR2 C;  3CCV I;  2X4H A;  3PQK A;  2E1N A;  3IAS 2;  3IUO A;  4L5J A;  1HQC A;  1DUX C;  2ZXJ A;  1FSH A;  2A6H F;  2M9H A;  3HOT A;  5E1Z B;  4M74 A;  2WAE A;  1FIP A;  1JT6 A;  1L0O C;  1WQ2 A;  1EF4 A;  1GHC A;  4UV9 A;  3FXL A;  4OOI A;  1UAA A;  2XRO A;  1PUF A;  1LDJ A;  1FIA A;  1CQT A;  2DW4 A;  2KT0 A;  3S17 J;  2KIS A;  4WXH A;  1SC7 A;  3IV5 A;  4PJN A;  1XB4 A;  2OQG A;  2VKH A;  5J47 A;  4XSZ F;  5C4X J;  2IEK A;  4M9S A;  3J7Y J;  4UB8 C;  3BT9 A;  3GEZ A;  4BDY A;  1T38 A;  4A93 J;  2B0L A;  3QYF A;  2Y75 A;  2AO9 A;  4MEY F;  4AIK A;  3TED A;  1BR1 A;  4OU0 A;  3DLL F;  3SDB A;  3DEE A;  2EPF A;  2LKP A;  1K6O A;  4IF4 A;  3TQN A;  4BEH A;  3CDH A;  3M1E A;  2KL4 A;  2EIK H;  1U8B A;  1FPQ A;  1QHH D;  3W6V A;  4HNT A;  1A6Q A;  3SYT A;  4EGZ A;  1VQL I;  1BM9 A;  4XON A;  3REO A;  3WOD F;  2XPV A;  1QZZ A;  2F4I A;  4UUV A;  3QU3 A;  5B3S H;  4LLN A;  2HKX A;  4KIG A;  2HXO A;  1XCV A;  4QTR A;  3FWE A;  3I54 A;  3E6M A;  4YFN F;  3OYM A;  4M6X A;  3L2R A;  2MAB A;  5BOX A;  3PO3 J;  3PUB A;  2AS5 F;  2K4J A;  4OIO F;  5ICF A;  2KHM A;  1XGM A;  3OYK A;  1V4R A;  2R7U A;  4LK0 F;  2R7F A;  1IUF A;  1X1D A;  1QVT A;  5F0C A;  2ZJR F;  1VFC A;  4P1W A;  1HA8 A;  2HZD A;  2W25 A;  2JA7 J;  5HLT A;  2OZU A;  1N25 A;  1U9O A;  5F6F A;  4GYI A;  3F8F A;  4CDG A;  2HYJ A;  3CP2 A;  4EJT A;  3H1C A;  2H94 A;  1T56 A;  1LKX A;  1SFU A;  2O7O A;  5AON A;  1BIA A;  2VE8 A;  2NS8 A;  4AM3 A;  3SJM A;  1HC8 A;  1X19 A;  2IXS A;  4LIU A;  1HXD A;  1FOY A;  2PN6 A;  2DK8 A;  3HRS A;  4N4N B;  1S3J A;  2LVS A;  1I1G A;  4FIS A;  4M3G A;  2VJ4 A;  3BY6 A;  1BC8 C;  1BOB A;  2MYS A;  3B02 A;  4YFX F;  3E7L A;  4KIB A;  3H35 A;  3KP4 A;  2J5P A;  3LQR A;  4EEF G;  1T0F C;  1ZQ3 P;  2W24 A;  1FZP B;  3HHG A;  5IP6 A;  3VWB A;  4HA8 A;  1FP2 A;  3ZN0 A;  4E7I A;  2EQR A;  3BWG A;  2GM4 A;  2D1V A;  2YR2 A;  3BP8 A;  1Z6R A;  4IXA A;  5HS7 A;  4C3H J;  3K1N A;  1BOA A;  2P5K A;  3PM1 A;  2XAJ A;  2R5Y B;  1YG2 A;  1I27 A;  3A4C A;  2V1X A;  5GTI C;  1FOX A;  4M6Y A;  4PZJ A;  1K4T A;  5E8I A;  1U2W A;  4NNJ A;  2DYS H;  3DTE A;  4EAT A;  4KT5 C;  1QRY A;  2GQQ A;  2H1K A;  5IY5 H;  1TP4 A;  2MD5 A;  1YJ9 I;  3F8B A;  5C4J J;  3RDI A;  1TBX A;  4DYC A;  5GPA A;  3S15 J;  2CSO A;  3ESW B;  2QLZ A;  2UUZ A;  1E17 A;  3IRQ A;  3COA C;  4G9Y A;  2DOA A;  1D1A A;  2LOO A;  2LH9 A;  1FC3 A;  1V5G A;  1QA6 A;  3CCR I;  4UVB A;  1J2X A;  2MLG A;  3WTU C;  1EJ9 A;  3ML6 A;  2NOG A;  2NVX J;  2R7V A;  1LUJ B;  5F04 A;  1AU7 A;  4BQO A;  1UCR A;  1ZG3 A;  1YIO A;  4BJ5 C;  3HYI A;  4WX9 A;  2VJ5 A;  4HF1 A;  1FY7 A;  1UMQ A;  4CCL A;  2JUG A;  5D4S A;  4OAY A;  4BS9 A;  1W36 D;  2R7R A;  1D1B A;  2XGX A;  1EH6 A;  4NC7 A;  3FMQ A;  1R5G A;  5JHU A;  1Z21 A;  3F6V A;  3CMY A;  1MBE A;  1A35 A;  2LY1 A;  3WTS C;  4C3I J;  1OCT C;  3RKY A;  2GOX B;  4QPO A;  3HOX J;  5DD8 A;  3OYC A;  1TT5 B;  1V5E A;  1ZRE A;  1IG7 A;  3SZP A;  2P6S A;  3NAU A;  3U2R A;  5F64 A;  1K78 B;  3KPH A;  4IQ4 A;  1GV5 A;  1QPM A;  4ENN A;  1U78 A;  4CCN A;  4CCO A;  1SVL A;  4B3X A;  2FA5 A;  5HLH A;  3G1L A;  1A6I A;  2WV1 A;  5KK1 A;  3VOD A;  3K70 C;  1EA3 A;  4MTE A;  3ERE D;  3ASO H;  5EZH A;  1P4W A;  1XDS A;  2JSP A;  4XSX F;  2ZME B;  1YI2 I;  2F5F A;  3RKQ A;  1LJ9 A;  2Z33 A;  1WI9 A;  3CO6 C;  2K9M A;  3TO7 A;  2D45 A;  1QHG A;  1XGS A;  2HI3 A;  1PP7 U;  4XRS G;  3JRA A;  2ECB A;  3RZD J;  4H4K C;  4I0A A;  3V7S A;  1VND A;  2F48 A;  4A3J J;  2RNJ A;  4JOM A;  4AIJ A;  2BXZ A;  4N4O B;  4RMN A;  3N97 A;  5F1R A;  3A01 A;  2VC0 A;  3E5X A;  3CJT B;  2M34 A;  3IP4 B;  1KON A;  2XC7 A;  3MMY B;  4I09 A;  4UVC A;  5ILV A;  1YTY A;  2E2H J;  4EQQ A;  1O3R A;  1QZY A;  1BL0 A;  2L9S A;  4RB2 C;  3CLO A;  2IS2 A;  3GTL J;  1O3T A;  3TP3 A;  3S1M J;  3L2U A;  2LF7 A;  1R4M B;  2CUF A;  3M4O J;  2V9P A;  4B3A A;  4ZDO A;  2IGM A;  3EYY A;  3S93 A;  4EJO A;  3WTX C;  2EFQ A;  4CCK A;  3F6O A;  4BL0 B;  4CCJ A;  3KYC B;  1E0E A;  3IAM 2;  4HBL A;  1YQA A;  2LY2 A;  4RAY A;  3JSO A;  2XPU A;  5FFX A;  3LNQ A;  3CES A;  4YEJ A;  3JRE A;  2BE5 F;  2DMN A;  4QSH A;  1W0U A;  1IF1 A;  3RQ4 A;  2L02 A;  2CG4 A;  1P6R A;  1BR4 A;  5GAH J;  3K4L A;  5HS9 A;  3TBI A;  2GLO A;  2CQQ A;  3HG9 A;  2R92 J;  3MKZ A;  1R1T A;  3FXR A;  3PNT A;  3EUH A;  4AYB A;  1R71 A;  4HZF A;  1ZG5 A;  1Z0X A;  2XDV A;  4G94 A;  2E36 A;  4D5F A;  2QKL B;  1W7P A;  1WPK A;  1T95 A;  4JQF A;  2WA0 A;  4BHC A;  3LSJ A;  3F8M A;  3HSE A;  3OS1 A;  2OQR A;  1F1Z A;  3G6E I;  4RGX A;  5A2Q Z;  1IXC A;  5HNH A;  2X6Y A;  2MBF A;  5IPA A;  1X4O A;  1A04 A;  2XAQ A;  1WVR A;  4ZH4 F;  1W5C C;  1HF0 A;  5E8G A;  1DU0 A;  2MC3 A;  3NEU A;  2JTV A;  3V8K A;  1X1C A;  2NVQ J;  3P9K A;  4LIT A;  4N9I A;  3ZQH A;  2EFN A;  1VQO I;  1IRZ A;  2EZK A;  2L3D A;  4M3E A;  1MND A;  2VQC A;  2DK5 A;  4RGR A;  1S7O A;  1NK3 P;  2OBP A;  3I0T A;  1XSX A;  4Q48 A;  3S1Q J;  1SFE A;  1Z9C A;  4KIC A;  2HXI A;  5FRO A;  1RRJ A;  1FYK A;  3UKG A;  2MW8 A;  3TOB A;  5JHF A;  4D5C A;  2ZXW H;  1R58 A;  3ZXS A;  4RB1 A;  3BJO A;  3CUQ B;  1ZR2 A;  5CPR B;  3K4M A;  1KA8 A;  1Y8Q B;  3V8J A;  3A1Y A;  3ZMU A;  5BPD A;  2M2E A;  1UG2 A;  4XNF A;  5E3O A;  2ZO4 A;  2WWY A;  3PJR A;  4IHX A;  4IKF A;  3U9G A;  3PL8 A;  5JFR A;  2DMT A;  1W7P B;  3G71 I;  5M3M J;  3OYI A;  2NNY A;  3GYH X;  4IRH A;  2VBZ A;  1LE8 A;  1W5T A;  2AHQ A;  3KYD B;  4HX8 A;  1FOW A;  2Y9Z A;  1BJA A;  5E1W A;  3HM5 A;  3VDX A;  3CMM A;  2W85 A;  3QQA A;  2DPU A;  3ZMS A;  5F0F A;  4MFD A;  3TMO A;  1P92 A;  1Z77 A;  2YU3 A;  2JPB A;  1FX7 A;  2MC4 A;  3BZ6 A;  4Y7N J;  5C3E J;  1G3S A;  3HTU A;  1GV2 A;  1DP3 A;  2UXN A;  5KHD A;  2HOS A;  5HDN A;  3BR0 A;  2JA6 J;  1FBS A;  1U5T A;  3V8L A;  4HW0 A;  3OWT A;  2Y9Y A;  1I50 J;  4BE2 A;  4L9J A;  4FAS D;  3FXK A;  2OTL I;  2VJJ A;  3N4M A;  1H89 C;  3K2Z A;  3LMM A;  1HW1 A;  2FX0 A;  2OCE A;  3KEY A;  4HV5 A;  3HL2 A;  5CVV A;  3HSR A;  1POG A;  2QQA A;  2GOM A;  2X85 A;  3S1R J;  2HGC A;  3Q0W A;  4CYD A;  4R79 A;  2DAO A;  3GTQ J;  2Z1D A;  3IKV A;  2HPM A;  3WHC A;  1W0T A;  5L3D A;  1KYW A;  4NUB A;  3V7R A;  4YEL A;  2ICW G;  2TRT A;  4G7H F;  2IRF G;  4OMZ A;  2PX9 A;  3M07 A;  2XIG A;  5E3L A;  2BEO A;  3K6G A;  1FOK A;  4LJZ F;  3RJP A;  4KUM A;  3W3C A;  1ETW A;  2VQL A;  4DQ2 A;  2IS1 A;  2P5V A;  4HST A;  5CVU A;  4AID A;  5HOD A;  3TDZ C;  2ISY A;  2L9V A;  5HS8 A;  2FMY A;  1IN7 A;  2FNA A;  5IYC J;  2A07 F;  1S8N A;  2STT A;  1FTZ A;  4KYW A;  3KZY A;  1WH7 A;  3Q0U A;  1ZAO A;  4A5N A;  2XVC A;  2NRA C;  3HHH A;  2H27 A;  1TQP A;  5IP9 J;  3R61 A;  2ELH A;  4RM2 A;  3BJ6 A;  4B09 A;  4A3L J;  2A61 A;  1ULY A;  2B7E A;  2EZH A;  3LSG A;  4F91 B;  5EJC A;  1X3W B;  3GW2 A;  2BV6 A;  1G3T A;  2M8E A;  3K4B A;  5JI6 A;  4DW6 A;  3C18 A;  4ASN A;  4CZZ A;  1TW2 A;  3G1O A;  2E19 A;  3J7Z I;  2QEN A;  2O8X A;  1R22 A;  1IRX A;  4L5I A;  1Y0U A;  2QVO A;  3CMA I;  3V42 A;  5FJ8 J;  3GX4 X;  5BQT A;  3BG7 A;  3ZPL A;  2EA2 A;  2L0K A;  2BW3 A;  3FXJ A;  3AAF A;  4I02 A;  2P81 A;  3CZ6 A;  1IDZ A;  3D0S A;  2FD5 A;  2L7Z A;  1HBX G;  1NK2 P;  2W84 A;  1B8I A;  2D2W A;  4II3 A;  2UV1 A;  3DCF A;  3S2D J;  4RM3 A;  1MKM A;  4UHT A;  1KQ8 A;  1WJF A;  2IVM A;  1LFU P;  2DU9 A;  1ETY A;  3EDP A;  1G2H A;  1HSJ A;  3ZMZ A;  4B48 A;  2DFH A;  3FHZ A;  2OC6 A;  1RKT A;  5B5E C;  2VLA A;  1XSD A;  4L5E A;  2EV5 A;  3C2H A;  3CCM I;  1J0R A;  4S04 A;  3GFI A;  1PUF B;  2QSG X;  3ZQC A;  5E1X A;  2L7K A;  3OYN A;  4KT6 A;  4R8H A;  4CGZ A;  3CCJ I;  1E2X A;  2ZKZ A;  3LSM A;  5FKO A;  1JI8 A;  2DPD A;  2WBM A;  4Q47 A;  2DCE A;  1OCP A;  4UUT A;  5KCM A;  2K9Q A;  3S2W A;  1G8X A;  2ETH A;  3SHF A;  3P9C A;  2QCO A;  1FYL A;  1IJW C;  3GFL A;  3CJR B;  2G9W A;  4BE0 A;  3H92 A;  2X1C A;  3DFG A;  3OSG A;  5GTH C;  3EUK L;  1T0F A;  5J4Y A;  1UFM A;  1A31 A;  2EIL H;  1SFX A;  4W97 A;  4KIT B;  1ON2 A;  3KP6 A;  4M72 A;  4ANJ A;  3KLO A;  1JJ6 C;  3H0G J;  4MO7 A;  1JKQ C;  2ZBK A;  3JRH A;  4BH9 A;  1MDM A;  1PYV A;  2KIQ A;  2QM3 A;  5LRS A;  3SFI A;  2R7T A;  1FTT A;  1Z3X A;  4G6Q A;  3WE3 A;  2QBY A;  2GWR A;  1JHH A;  4A3G J;  3CUQ C;  4F92 B;  2HKO A;  4IRG A;  2PJP A;  2R7S A;  1WSU A;  3WTT C;  2CU7 A;  2CFX A;  4QPQ A;  1C0W A;  2CW7 A;  1X1P A;  2DOD A;  1OCZ H;  2B63 J;  1FWZ A;  1S7A A;  2FXA A;  4KN7 X;  3OYF A;  1BI1 A;  1SFK A;  2ZFW A;  4CO8 A;  2R7O A;  2F2E A;  2JVG A;  2H09 A;  3TL4 X;  1GXP A;  4FTH A;  1S29 A;  3CF5 F;  1D0X A;  3AG2 H;  4IHT A;  2FQ3 A;  2K86 A;  1D8K A;  3ZQ7 A;  2M4G A;  4A69 C;  1SMY F;  5FKM A;  1WFX A;  1I3A A;  1MMA A;  3DKW A;  2NAZ A;  2K85 A;  1MZB A;  2PMU A;  3FF5 A;  3VYS B;  1U5T B;  2Z99 A;  2DYR H;  2JRT A;  4NC6 A;  2CFO A;  3HPG A;  2NNN A;  3Q9V A;  4F3Q A;  4MHG A;  4G8X A;  4P9U A;  1IDY A;  1ZGA A;  5E3N A;  3QPH A;  4IL6 C;  3K69 A;  2NXN B;  5EZG A;  4C2M J;  1JGG A;  1LEB A;  5K5O A;  4IOC F;  3RQI A;  3KFW X;  1N77 A;  2VUM J;  5CYV A;  3ABM H;  2IJL A;  3FX3 A;  2HS5 A;  4A3B J;  1IC8 A;  4AC0 A;  4BY7 J;  4L9N A;  4ZJZ A;  2COM A;  2A69 F;  2XGC A;  1ZEL A;  4ESF A;  3FM5 A;  5HDG A;  2FE3 A;  2P7V B;  3DQV C;  2H8W A;  3OR1 C;  4P5O A;  2D5V A;  1R23 A;  1TWG J;  1G3Y A;  5BNG A;  1H88 C;  3I9V 2;  2WY7 Q;  4MQV A;  3I53 A;  3BG3 A;  3ULQ B;  3S2H J;  3VSK A;  5HLI A;  1G59 A;  1WKM A;  2MG4 A;  2V1N A;  3RYR A;  2DA1 A;  4Y33 A;  5DYM A;  2Y69 H;  2XF7 A;  3RI4 A;  2FBK A;  1ZN2 A;  4AIH A;  5LGN A;  4FX4 A;  1HW5 A;  4I98 B;  1ODD A;  2BOL A;  3KP2 A;  2PJR B;  4G6D A;  2RDP A;  5CVJ A;  4CCM A;  4JP0 A;  4MQ9 F;  2W1O A;  5C44 J;  3LAP A;  2FOK A;  1S72 I;  4KMF A;  3NQO A;  5HVQ C;  1ZH5 A;  2KLO A;  4EM0 B;  3RZO J;  4ZDP A;  1I39 A;  2JT1 A;  3BG9 A;  3EYI A;  1W7P D;  3BR1 A;  4FHT A;  1CF7 A;  3MFK A;  2E1C A;  1P9Q C;  2ZNY A;  3TO9 A;  1QPI A;  3TP0 A;  4RBO A;  2P5L C;  2KJB A;  2CO5 A;  4OIQ F;  2UZK A;  1H0M A;  2OPT A;  2JJ7 A;  3JW4 A;  5TGT A;  3G73 A;  3KZI C;  2NYX A;  2NVT J;  2EK5 A;  2QUF A;  5H20 A;  1YOV B;  2CQ7 A;  2AQE A;  3HUG A;  3V4G A;  3I3L A;  1ZLJ A;  2A05 A;  3VYU B;  3Q0V A;  3OL4 A;  2E71 A;  2C6Y A;  2CW0 F;  5F08 A;  4AVP A;  4LG3 A;  2VOP A;  4OMY A;  2CUZ A;  1RR8 C;  3OIQ A;  4R1H A;  4FT8 A;  3PO2 J;  2P8T A;  1MIJ A;  1Y8R B;  4V2G A;  3AL0 B;  2IBD A;  3SXY A;  2M5W A;  2F5V A;  3B73 A;  4P55 A;  3I4M J;  4CA0 A;  1WJ5 A;  2I5U A;  4AVZ A;  3FKJ A;  3ECH A;  5IT3 A;  2LYC A;  3VB2 A;  1NG6 A;  5GP9 A;  1IXS B;  4U87 A;  1YE9 A;  4L9V A;  1ETK A;  4BEH B;  1D5V A;  1XMX A;  3H3U A;  3K70 D;  3OYB A;  1O57 A;  3TOA A;  2LDU A;  3LA2 A;  2LSO A;  2E5N A;  3OY9 A;  3WGI A;  1HLV A;  3QU6 A;  4HAM A;  5CLS A;  2XAU A;  3B6A A;  4DYQ A;  2MSY A;  3HOS A;  1XG1 A;  4DGW B;  2HQR A;  1M1E B;  2EFW A;  1JUS A;  2GXB A;  3W6J B;  5FD6 A;  2X51 A;  1BC7 C;  1K83 J;  2PG4 A;  2XSD C;  4ESJ A;  1TWA J;  1FMV A;  4YIR X;  1P4X A;  2OAZ A;  4A0X A;  3JRF A;  3AG1 H;  5H6Q A;  3GTO J;  4MNU A;  2PEX A;  1MGT A;  2DA6 A;  4HLY A;  3L9F A;  4M6V A;  4UY8 I;  5IT9 Z;  5K5Q A;  2XAF A;  4U88 A;  5D8K B;  1ZRF A;  1ACI A;  2JMW A;  3C1D A;  2WB1 N;  4WF2 A;  1MSF C;  2DT7 B;  1LE8 B;  2GXA A;  2M87 A;  4PFP A;  3WE2 A;  2ZJP F;  1X58 A;  2LP0 A;  4XLE A;  2DXI A;  2L7M P;  5J6X A;  3SDG A;  3MKY B;  2XAG A;  3RKX A;  1K61 A;  3HOV J;  5FLX K;  3RCO A;  1BJZ A;  3HPH A;  4A3M J;  1X1A A;  1P7J A;  2V4J C;  4XL9 A;  2WV0 A;  2OD5 A;  2XAS A;  4EJU A;  4P96 A;  3ZMT A;  2HDW A;  1LVA A;  4A3F J;  4ZYH A;  1AHD P;  5E17 F;  2EH3 A;  2Y30 A;  3J80 Z;  4XKB A;  4IHY A;  2KKO A;  4CIC A;  2LKX A;  2RC4 A;  3CCU I;  1MNM C;  1VZ0 A;  1AKH A;  3ZQQ A;  3H36 A;  4KNY A;  4NHJ A;  1SAU A;  2FQ4 A;  5J8F A;  2QYO A;  1SVM A;  2CQK A;  3BTI A;  3KIO A;  2PMZ N;  4IQJ A;  4BBS J;  2V1D A;  4HPQ A;  3A03 A;  3KE2 A;  3MWM A;  4GGG A;  2WY8 Q;  2IP2 A;  2TCT A;  4G6T B;  2FOW A;  3QOE A;  1TQI A;  4PGG A;  2QBY B;  1JUP A;  3ONQ A;  1FJL A;  3CCQ I;  4RAF A;  3QPT A;  3CD6 I;  3BRO A;  5KNL A;  3LSK A;  4OAZ A;  1R1U A;  3NAR A;  4B8X A;  3BZC A;  2WC2 A;  3DF8 A;  2HFH A;  2E2I J;  4YFK F;  1VF9 A;  5L3F A;  2VQG A;  4E6K G;  4JK1 X;  4RB3 C;  4ZZD A;  5F1J A;  3CCY A;  3KZZ A;  4BHB A;  2K3F A;  2Y48 A;  5D5U B;  4I0B A;  4BQQ A;  1VQM I;  1IV6 A;  3CDL A;  1X3Z B;  1T08 B;  1EH8 A;  4RAZ A;  4BBR J;  1T6S A;  2XF5 A;  3ISP A;  5FO5 A;  3L2W A;  2MD0 A;  3OYH A;  3SQN A;  3M8J A;  3CME I;  2O8K A;  4PCQ A;  1X3U A;  1ETX A;  1LDK B;  4E7L A;  2E7X A;  2QKM B;  4HNV A;  3N05 A;  1IRG A;  3K9T A;  4F93 B;  5HOO A;  4NQW A;  3J80 K;  5K5R A;  2B9S A;  1G4D A;  1XC5 A;  2RQQ A;  4CZC A;  1Y39 A;  1Y1V J;  4XLP F;  2X1E A;  4S0H B;  5EF6 A;  5B1B H;  2YU9 J;  3ZN1 A;  2CV1 A;  2HVQ A;  2DFF A;  2GA2 A;  3MEX A;  2IPQ X;  3U1K A;  3JRD A;  3PSF A;  3DWL E;  4B43 A;  3JTG A;  3HOZ J;  3O8H A;  3W2A A;  1IO2 A;  1D8J A;  3LA3 A;  1J59 A;  1U5T C;  4CXF A;  1W36 C;  4Y4R A;  3VFZ A;  3S32 A;  4EVI A;  4O5V A;  1XCB A;  3HRM A;  2MGQ A;  3GTK J;  5TJJ A;  3G2B A;  3RTR A;  4Q4Z F;  5IT9 K;  3QYB A;  2DJI A;  2VBY A;  3QWL A;  1R36 A;  4V19 K;  3MD2 A;  1ZYR F;  2DA7 A;  2DMU A;  1B59 A;  4HOB A;  1FP1 D;  3MQ0 A;  2H6C A;  2VAS A;  3L2V A;  1IGN A;  2H6B A;  2KPM A;  1HDD C;  4ZYG A;  2A6T A;  2DO7 A;  4FE7 A;  4IHS A;  2G7H A;  2G7U A;  2CQX A;  4RLQ A;  1KQ9 A;  1OKR A;  2JVH A;  2P4W A;  5HLG A;  1DQU A;  2QA4 I;  2X6X A;  4A3I J;  5DUK A;  1WWX A;  1MMG A;  1X2M A;  1QNT A;  3V7C A;  2VQH A;  1USS A;  4HX7 A;  2KMU A;  3HBL A;  3BCA A;  4IOA F;  2X6O A;  3E6C C;  1I6X A;  4LOC A;  1H9G A;  4B47 A;  3GUD A;  3BLY A;  5HNF A;  2L7F P;  3HKZ N;  1TC3 C;  2A6E F;  4ZDL A;  2V6C A;  5EGO A;  1WJA A;  4EGY A;  4CYC B;  1XS9 A;  1QO0 D;  1ZKG A;  2BXY A;  3LFK A;  5DCF A;  1R5H A;  5E18 F;  2R5Z A;  5GAE J;  1BI0 A;  1A5J A;  4M3F A;  3QRF F;  2EA4 A;  2EZL A;  2MLK A;  5EYR A;  1Y6I A;  2XB5 A;  3PQJ A;  4XID A;  1BBY A;  3BTJ A;  2QEX I;  3O8G A;  5E79 C;  3HJE A;  5DDG A;  3JAM K;  2M1B A;  2HQ5 A;  3KP3 A;  3LSH A;  3A01 B;  1NG7 A;  3MKL A;  5H6R A;  4BAY A;  2AQF A;  1RES A;  1AOY A;  1B9M A;  3ABU A;  4G7Z F;  1XMK A;  2FML A;  5DM7 F;  3IL2 A;  3HUG B;  2BZT A;  3FK7 A;  5LHI A;  1IN6 A;  1V55 H;  1MJ9 A;  3ASN H;  1MH4 A;  3S3O A;  4C9Y A;  4IRI A;  1W5S A;  1U3E M;  4CHU A;  2IA1 A;  4GO1 A;  1YLF A;  2X0L A;  2EIJ H;  3P7N A;  2RN7 A;  3OSF A;  4E7K A;  1UB9 A;  3LSP A;  4KIS A;  2Z2S B;  2LLK A;  1HDP A;  3LAJ A;  1B1B A;  1IW7 F;  1KU7 A;  3G4S I;  5LD2 C;  3MZH A;  3QYE A;  2P6T A;  4DZJ A;  2R7X A;  1VQN I;  2K7L A;  2EIM H;  1B9N A;  4Y52 J;  1FLI A;  3FZV A;  1APL C;  4RA2 A;  4S05 A;  4RGS A;  1E3H A;  2W4S A;  4LMY A;  5D6F A;  3CC2 I;  3RIR A;  2HVS A;  4AD9 A;  2EWN A;  3C7J A;  2VT2 A;  4I99 C;  2HDD A;  3P5J A;  1B8I B;  2QQ9 A;  3HRT A;  2XF6 A;  2N8G A;  4IHV A;  2O9L A;  3PNV A;  2Y0S N;  2NOJ B;  5ICG A;  2W7N A;  3LL7 A;  3MVP A;  3CJN A;  4GYG A;  1Z3Y A;  1MW7 A;  2F5E A;  1ZGW A;  4BJT A;  1SD5 A;  2LY9 A;  5EEG A;  1VQ9 I;  4NC8 A;  3RPU D;  4OWR B;  3WTV C;  1MMS A;  4Y13 A;  3FK6 A;  4JBA A;  1HST A;  3IWZ A;  2CMP A;  3ROU A;  2JUC A;  5DCM B;  2QSH X;  4AWX B;  4BE1 A;  2DTR A;  3GBG A;  5K1Y A;  3MAJ A;  1B72 A;  5FFZ A;  2E1O A; 
#chains in the Genus database with same CATH homology
 1ITY A;  2CUE A;  2JK3 A;  3SFI A;  9ANT A;  3ZQF A;  3PO3 J;  2XB0 X;  1FTT A;  1S7E A;  4A3G J;  5EG0 A;  1IUF A;  2DA2 A;  1QVT A;  2CU7 A;  5F0C A;  1VFC A;  3F0C A;  1I6H J;  2JA7 J;  2B63 J;  3BTC A;  2HOT A;  4M3D A;  1U9O A;  3JRG A;  2HYJ A;  1T56 A;  5IYB J;  2O7O A;  4FTH A;  2NS8 A;  3SJM A;  2NVY J;  4XRS A;  1JKO C;  5J1Y A;  4A3C J;  1R9T J;  1TWH J;  4A69 C;  5M3F J;  5FKM A;  2LVS A;  4FIS A;  4M3G A;  4DZP A;  4A3K J;  1B72 B;  2Y2Z A;  3E7L A;  2R0Q C;  2XGE A;  2ELK A;  1MBK A;  1IDY A;  5E3N A;  4DYR A;  4EEF G;  1ZQ3 P;  5EZG A;  4C2M J;  5IP6 A;  1JGG A;  4FCY A;  1E3O C;  5IP7 J;  3RQI A;  2EQR A;  2GM4 A;  2VUM J;  1I3Q J;  3ZQG A;  4C3H J;  4D7N A;  4QIW N;  4A3B J;  3PM1 A;  1IC8 A;  4AC0 A;  4BY7 J;  2R5Y B;  2VPR A;  5JLX A;  2XGC A;  3LOC A;  2X9D A;  4B1R A;  2DJN A;  3FKI J;  1RET A;  2D5V A;  1TWG J;  5J3L A;  5BNG A;  1H88 C;  5IOZ A;  1ETV A;  1QRY A;  2XRL A;  2H1K A;  3S2H J;  3BG3 A;  1BW5 A;  4I76 A;  2MG4 A;  2DA1 A;  5C4J J;  2JWT A;  5K7F A;  4DYC A;  5GPA A;  3S15 J;  1GUU A;  5FKK A;  3TW7 A;  2I10 A;  5J1R A;  1ETO A;  1F43 A;  2IAI A;  4JP0 A;  4BY1 J;  5C44 J;  5EGO B;  2NOG A;  2NVX J;  3RZO J;  2COB A;  5F04 A;  3BTL A;  1AU7 A;  2RAE A;  1MSE C;  1BA5 A;  3BG9 A;  3BR1 A;  3L1P A;  2ME6 A;  2R5Z B;  3OIO A;  1JTY A;  1UMQ A;  1QPI A;  3S1N J;  3TP0 A;  4RBO A;  2ECC A;  1VI0 A;  2OPT A;  2JJ7 A;  4ABZ A;  3GTJ J;  3B6C A;  1JUM A;  4CYC A;  3CMY A;  2NVT J;  1MBE A;  3BR3 A;  4C3I J;  1OCT C;  2LK2 A;  2JA8 J;  4D7M A;  4RDU A;  3HOX J;  3HOY J;  2ME0 A;  3Q0V A;  4UUS A;  3K7A J;  1IG7 A;  3NAU A;  5F08 A;  1GV5 A;  3A02 A;  4JX6 A;  3ZQL A;  1U78 A;  3PO2 J;  3VPR A;  3G1L A;  1A6I A;  2Y31 A;  4V2G A;  2WV1 A;  5EZH A;  3GTP J;  1HOM A;  2IBD A;  1JJ8 C;  3GTM J;  3RKQ A;  5JLW A;  2VKE A;  2G0E A;  1RPW A;  3I4M J;  2HI3 A;  3BG5 A;  2VKV A;  2LR8 A;  2M8G X;  4XRS G;  3JRA A;  2ID3 A;  2ECB A;  3RZD J;  3ZOB A;  5GP9 A;  1VND A;  4Y52 J;  4A3J J;  3A01 A;  1ETK A;  3BQZ A;  3HOU J;  2M34 A;  3QPL A;  1UHS A;  2M0C A;  4GFB A;  2E2H J;  1HLV A;  4MLO A;  1BL0 A;  5M5X J;  1ENH A;  3B6A A;  3GTL J;  2K40 A;  4DYQ A;  3TP3 A;  2MSY A;  3S1M J;  3IH2 A;  1XG1 A;  2CUF A;  3M4O J;  4MIM A;  2YUS A;  4B3A A;  5F0H A;  1JUS A;  1MH3 A;  1X2N A;  1GVD A;  3OOU A;  1OJL A;  1K83 J;  2XSD C;  3BR6 A;  1TWA J;  1WI3 A;  2R7Z J;  3JRF A;  3G1M A;  3GTO J;  2XPU A;  3LNQ A;  2K9N A;  5E3M A;  2DA6 A;  4W1U A;  3LSR A;  3JRE A;  2DMN A;  4M6V A;  4QSH A;  1W0U A;  2JMW A;  2L9R A;  2WB1 N;  1MSF C;  1LE8 B;  1X58 A;  2LP0 A;  3JR9 A;  2GLO A;  2DA3 A;  4X1E A;  4X6A J;  2L7M P;  2DTZ A;  2CQQ A;  3SDG A;  5EDN A;  1K61 A;  2R92 J;  3HOV J;  1T33 A;  4A3M J;  1BJZ A;  2CJJ A;  1P7J A;  1SAN A;  4IHW A;  4I6Z A;  1WH5 A;  1Z0X A;  4A3F J;  3S16 J;  1AHD P;  2EH3 A;  4D5F A;  1WPK A;  2Y30 A;  4IHY A;  4BKX A;  1H8A C;  2LKX A;  4IEJ A;  1MNM C;  2GBY A;  1AKH A;  3HGG A;  3LSJ A;  3S14 J;  2FQ4 A;  1JTX A;  2LFB A;  3BTI A;  4A3E J;  2PMZ N;  4BBS J;  3BR2 A;  5M5W J;  3A03 A;  5IPA A;  1Y1W J;  3IH4 A;  2TCT A;  4JX4 A;  4AUX A;  1HF0 A;  4M3B A;  1AKH B;  1DU0 A;  2NVQ J;  1JUP A;  4XIC A;  2DMQ A;  1FJL A;  3ZQH A;  1RKW A;  4B4C A;  1IRZ A;  2EZK A;  3HGY A;  4NDL A;  3NAR A;  4M3E A;  5K7H A;  2H8R A;  3DEW A;  2ID6 A;  2E2I J;  1VF9 A;  1NK3 P;  4MFE A;  1YRN B;  5F1J A;  3CCY A;  3S1Q J;  5DS9 A;  3D1N I;  1FEX A;  2HXI A;  3UKG A;  2MW8 A;  4D5C A;  3CDL A;  1IV6 A;  5FLM J;  4BBR J;  5IYD J;  3GTG J;  1ZR2 A;  5F27 A;  3WHB A;  1QVU A;  2M2E A;  2O8K A;  1UG2 A;  5E3O A;  1YRN A;  1ETX A;  4IHX A;  5EEA A;  2DMT A;  3BQY A;  4HNV A;  5M3M J;  1LE8 A;  2AHQ A;  2Y9Z A;  3HM5 A;  1XC5 A;  3QQA A;  1HCR A;  3JRC A;  1Y1V J;  5F0F A;  4MFD A;  2ZB9 A;  1Z77 A;  4S0H B;  5EF6 A;  2VI6 A;  2YU9 J;  2DA5 A;  1O4X A;  3CQZ J;  4Y7N J;  5C3E J;  1GV2 A;  3JRD A;  1GDT A;  2XPW A;  2K9S A;  2HOS A;  3HOZ J;  3BR0 A;  2JA6 J;  2DA4 A;  2WAQ N;  3O8H A;  1Q1V A;  2Y9Y A;  1ZTR A;  1I50 J;  1ZR4 A;  4G12 A;  2MGQ A;  3GTK J;  1F36 A;  4JYK A;  2DMP A;  3C2B A;  1H89 C;  4XRM A;  2DA7 A;  2DMU A;  2FX0 A;  4AYB N;  3I4N J;  1POG A;  1MBJ A;  2LD5 A;  1DU6 A;  3HEF A;  3S1R J;  2R5Y A;  1D5Y A;  4A3D J;  1WGX A;  3Q0W A;  4JX5 A;  3GTQ J;  1IGN A;  2LTP A;  2KDZ A;  3WHC A;  1W0T A;  5J1U A;  1HDD C;  4FE7 A;  2CQX A;  2JN6 A;  4UUS B;  2TRT A;  2X48 A;  3BR5 A;  1LFB A;  5E3L A;  5GPC A;  5M5Y J;  2R93 J;  3M3Y J;  3IH3 A;  4A3I J;  4FE4 A;  1X2M A;  1ETW A;  3MN2 A;  3JRI A;  3HOW J;  4V2F A;  3HBL A;  5HOD A;  1TWC J;  5IOY A;  1NTC A;  2X6O A;  1OFC X;  4LOC A;  2EZI A;  2E2J J;  1SFO J;  2FJ1 A;  5IYC J;  1TWF J;  1FTZ A;  5FLV A;  2L7F P;  5DTD A;  2YS9 A;  1WH7 A;  3HKZ N;  1TC3 C;  5EGO A;  3K2A A;  3Q0U A;  1MBH A;  3ZQI A;  4CYC B;  3JRB A;  1XS9 A;  1ZKG A;  3TW6 A;  5K7Z A;  2R5Z A;  1A5J A;  5IP9 J;  3QPS A;  2QF7 A;  4M3F A;  2EZL A;  4A3L J;  5EYR A;  1JT0 A;  2XB5 A;  4XID A;  2XGD A;  3BTJ A;  2EZH A;  3LSG A;  3O8G A;  2W48 A;  2HQ5 A;  1ZK8 A;  3A01 B;  3MKL A;  2NS7 A;  1RES A;  1WCM J;  4DW6 A;  3FIW A;  3FK7 A;  3G1O A;  2E19 A;  1JKP C;  1MH4 A;  1U9N A;  5FJ8 J;  2OF7 A;  2L0K A;  3OSF A;  2P81 A;  2M9H A;  5FKN A;  1IDZ A;  4XK4 A;  3LSP A;  2FD5 A;  2L7Z A;  2LLK A;  1HDP A;  1NK2 P;  1FIP A;  1JT6 A;  1B8I A;  3DCF A;  3S2D J;  1EF4 A;  1PUF A;  1LFU P;  4DZJ A;  1FIA A;  1CQT A;  1MBG A;  2KT0 A;  1ETY A;  3S17 J;  1G2H A;  3IV5 A;  1JKR C;  3HB9 A;  1RKT A;  1GT0 C;  1APL C;  4L5E A;  5C4X J;  2IEK A;  1PUF B;  3ZQC A;  3BT9 A;  2HDD A;  2DN0 A;  4A93 J;  1B8I B;  2EBI A;  5FKO A;  2N8G A;  5EG0 B;  2AO9 A;  3H3V K;  1BW6 A;  3TED A;  3FIS A;  4IHV A;  2O9L A;  4J19 A;  2Y0S N;  3HDD A;  1OCP A;  4UUT A;  4C3J J;  2K9Q A;  2HOA A;  3MVP A;  5FKL A;  2CRG A;  1U8B A;  1ZGW A;  2QCO A;  3W6V A;  1ETQ A;  2LY9 A;  1IJW C;  1MBF A;  1RR7 A;  2XPV A;  3OSG A;  1P7I A;  3FK6 A;  3Q3S A;  2HXO A;  4QTR A;  4W97 A;  1ORK A;  1JJ6 C;  4BXX J;  3H0G J;  4MO7 A;  3GBG A;  1JKQ C;  2JA5 J;  3JRH A;  1B72 A;  2E1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...