2LKXA

Nmr structure of the homeodomain of pitx2 in complex with a taatcc dna binding site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pituitary homeobox 3
publication title Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 20
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2lkxA00
3S1MJ 1X2NA 2QF7A 4A3MJ 5C44J 2LR8A 3HBLA 4FE7A 1WH5A 3VPRA 5K7HA 1MBKA 3TW7A 3RZDJ 4MO7A 1IGNA 5E3MA 1OCPA 5E3LA 1RETA 4M6VA 1GT0C 1GV5A 5IYCJ 3BQZA 1ZR2A 3ZQHA 1UMQA 4C3IJ 1HCRA 1VNDA 4ABZA 4A3JJ 1S7EA 4DYRA 4C3HJ 1ENHA 2XGDA 4MLOA 2RAEA 5IOZA 3F0CA 3LSGA 5M3MJ 1MNMC 4MIMA 4IEJA 4EEFG 4CYCB 2LP0A 1HDPA 1QVTA 3MN2A 3OOUA 1RKTA 3GTLJ 1O4XA 5IYDJ 1K83J 2L7MP 5F27A 1JT0A 3A03A 1P7IA 2DMPA 3JR9A 2W48A 2X48A 3D1NI 1MH3A 3PM1A 5JLWA 3GTQJ 3HOVJ 5M5YJ 1Y1WJ 3FISA 2HOAA 1T56A 3OSFA 2EZKA 4D7MA 2H1KA 3FKIJ 1PUFB 3BR5A 1IUFA 1B8IB 3BTCA 2M0CA 5EZGA 2VKVA 1Q1VA 1P7JA 4A3GJ 1NTCA 2LK2A 2E2HJ 1Z77A 2GLOA 2DMNA 1MBJA 3JRBA 5E3NA 5C4XJ 5FKKA 4BKXA 1FJLA 2L9RA 2CUFA 1JKOC 1DU0A 2VI6A 1FTTA 1WI3A 3ZOBA 4XIDA 2IAIA 4A3BJ 4MFEA 2X6OA 1I6HJ 2R5ZA 4A3KJ 2FQ4A 1JKQC 1TWHJ 2Y9YA 4UUSB 1X2MA 1NK3P 4FTHA 1WPKA 1BW6A 3G1OA 3BTJA 2MGQA 2AO9A 1ITYA 2QCOA 2KDZA 5FKOA 3WHCA 1BL0A 5IPAA 3NARA 3GTOJ 4X1EA 3TW6A 3HGYA 1IV6A 4L5EA 2E19A 5K7ZA 4FCYA 2H8RA 2ID6A 1RESA 2XB5A 4NDLA 5IP6A 5DS9A 2O7OA 4AYBN 2HYJA 2VPRA 2R5YB 2TRTA 3HEFA 1I50J 3MKLA 2CRGA 1MBEA 2CJJA 1ETQA 3LSJA 4XRSA 1ETXA 5J1UA 1APLC 1GDTA 1G2HA 2JK3A 2ME6A 3SDGA 1IJWC 3E7LA 2XPUA 2HQ5A 4XRSG 3ZQGA 4BBRJ 2WV1A 2M2EA 4FISA 1F43A 2VKEA 4UUTA 5EEAA 3Q3SA 1R9TJ 3B6CA 2L7FP 2K9NA 4M3FA 2ELKA 1AKHA 5EGOA 4D7NA 1YRNA 2YU9J 2D5VA 1GVDA 4JYKA 2DA3A 4W97A 5EG0A 1QPIA 5HODA 3NAUA 5FKLA 2OPTA 3FIWA 2AHQA 3JRHA 3DEWA 1JKRC 2DN0A 3RQIA 5GP9A 1Z0XA 1X58A 2DMTA 3A01B 1T33A 4B3AA 1LE8B 2HOTA 3M4OJ 1TC3C 3IH2A 3JRIA 2MG4A 3SJMA 4S0HB 1ETWA 5FKMA 3LOCA 1MBGA 1RKWA 2R93J 2ME0A 2ID3A 1A6IA 3CDLA 5F1JA 2NOGA 1JUMA 1U78A 4G12A 2YS9A 4Y7NJ 2O9LA 3Q0VA 3GBGA 3S14J 2JA8J 3IH3A 4RDUA 5F0CA 5J1RA 2E2IJ 5EZHA 4C3JJ 5M5XJ 1U8BA 4IHWA 4DYQA 2JJ7A 1WGXA 4J19A 3CCYA 1SANA 1QVUA 2R7ZJ 2CU7A 1OJLA 1LFBA 2EZIA 2L7ZA 1LFUP 2P81A 4A93J 2DMUA 3K2AA 2DTZA 2LKXA 4B4CA 2Y0SN 5BNGA 4DYCA 4BY7J 1B72A 2CQXA 2NVXJ 1HF0A 1HLVA 3G1LA 5K7FA 5C4JJ 5M3FJ 2LY9A 3HDDA 4M3GA 2IBDA 2FD5A 1JUPA 3BR2A 2ECCA 3Q0UA 2XPWA 1VF9A 1H88C 3HB9A 5M5WJ 1U9OA 1AHDP 1ETKA 1FEXA 2XRLA 1YRNB 2M8GX 1IG7A 4D5CA 4BY1J 1UHSA 3S2DJ 2L0KA 1MSEC 1RPWA 1DU6A 2XSDC 4V2FA 1ZKGA 3MVPA 2COBA 1ETOA 2KT0A 2DA2A 5F08A 2EZHA 2TCTA 3LNQA 2JA6J 3QPLA 3TP3A 4A3LJ 3HOXJ 1JJ8C 3GTPJ 1VI0A 4M3BA 3RKQA 2K9QA 2Y9ZA 1U9NA 4DW6A 2DA6A 2Y31A 4DZPA 2E2JJ 2Y30A 4A3IJ 9ANTA 1CQTA 4M3EA 3I4NJ 4C2MJ 4A3CJ 3S15J 3JRFA 3JREA 2CUEA 5EDNA 2DA5A 3M3YJ 1GUUA 4CYCA 2YUSA 1H8AC 1ZR4A 3S1QJ 3DCFA 3H0GJ 4GFBA 3S16J 3ZQFA 1JTXA 3JRAA 4D5FA 1EF4A 1IDYA 1ZGWA 3BTLA 1D5YA 3ZQCA 2Y2ZA 3G1MA 1JTYA 4I6ZA 1PUFA 2JMWA 1WCMJ 1B8IA 4JX5A 3GTMJ 4HNVA 5FLVA 2EZLA 5IYBJ 3HGGA 2CQQA 2JN6A 4AC0A 1JJ6C 2DA1A 3S1RJ 5JLXA 4IHXA 3TEDA 3GTJJ 2O8KA 2DA7A 1MBHA 3Q0WA 4BXXJ 3CQZJ 2GBYA 1ETVA 4BBSJ 1JGGA 3K7AJ 5J1YA 4FE4A 2LVSA 1VFCA 3JRDA 2R5ZB 2FJ1A 1E3OC 4M3DA 2IEKA 3PO2J 3H3VK 1TWGJ 2HI3A 5FJ8J 1W0TA 3LSRA 4B1RA 1NK2P 4W1UA 1BA5A 1XC5A 2JA7J 3HOWJ 4UUSA 2NS7A 2HOSA 4A3DJ 2M34A 2I10A 1JT6A 4DZJA 2NVQJ 3GTKJ 3B6AA 1FTZA 5F0HA 5IP7J 2XPVA 2PMZN 1ETYA 5EF6A 4IHVA 2VUMJ 5J3LA 1IC8A 4A3FJ 2XGCA 2EQRA 2DJNA 4AUXA 3BG5A 4A3EJ 3JRCA 1FIPA 3JRGA 2DMQA 3S2HJ 1I3QJ 5FLMJ 4MFDA 4QIWN 4RBOA 3HOUJ 2ECBA 3TP0A 5F04A 5EYRA 5E3OA 2R5YA 1A5JA 3WHBA 5GPCA 1HDDC 2XGEA 1JUSA 1ORKA 1ZTRA 5IOYA 1ZK8A 3RZOJ 2XB0X 1OFCX 3BQYA 1H89C 1AKHB 5EGOB 1AU7A 3BTIA 2FX0A 1JKPC 2X9DA 2MSYA 3HOZJ 3OSGA 2JA5J 3HM5A 5EG0B 3CMYA 1MSFC 5DTDA 3BR6A 5C3EJ 2MW8A 4I76A 4X6AJ 2NS8A 1TWFJ 1IRZA 1W0UA 3OIOA 2LLKA 4JX6A 1POGA 1QRYA 2R0QC 3QQAA 1IDZA 3L1PA 3FK7A 3BR3A 3I4MJ 3A01A 1LE8A 4XRMA 2B63J 2DA4A 1XS9A 3GTGJ 4IHYA 4QTRA 2G0EA 3IV5A 2E1OA 2M9HA 1WH7A 2GM4A 3S17J 5FKNA 4QSHA 2HDDA 1HOMA 3O8HA 1Y1VJ 3UKGA 1GV2A 1FIAA 1OCTC 2K40A 3FK6A 4XK4A 4XICA 3ZQLA 2NVYJ 2HXIA 3BT9A 1ZQ3P 1TWAJ 1F36A 1UG2A 2LFBA 2HXOA 3BG9A 3HOYJ 1RR7A 2ZB9A 3BR1A 3C2BA 3IH4A 3S1NJ 4LOCA 1XG1A 2OF7A 1B72B 1SFOJ 3BR0A 5IP9J 2WB1N 3SFIA 2R92J 3HKZN 3BG3A 1TWCJ 2JWTA 1K61A 2N8GA 2NVTJ 5F0FA 3QPSA 2EBIA 5GPAA 4JX4A 3O8GA 4JP0A 3ZQIA 2WAQN 1MH4A 1BW5A 4V2GA 2LD5A 3W6VA 1MBFA 3PO3J 3A02A 3LSPA 2LTPA 2K9SA 4Y52J 2EH3A 4A69C 1BJZA
chains in the Genus database with same CATH superfamily
2XROA 3R60A 1X2NA 2QF7A 3ZN1A 5C44J 3DP7A 4EGYA 1WH5A 2DK8A 3EYIA 4A2UA 1LVKA 3KP7A 4Q4ZF 2DFEA 1QZZA 2X1CA 4MO7A 4Q47A 5AIPA 3VSLA 4ENMA 4Z2YA 4M6VA 3SZGA 3O2PE 5IYCJ 2DQLA 2ZJPF 2X6WA 1T95A 3W3CA 1VQ5I 2BXZA 4XORA 1VNDA 2DBBA 1ENHA 5IOZA 2RAEA 3KFWX 2Z9OA 1TT0A 3KP4A 1MJBA 1YJWI 4MIMA 2DYSH 4BDZA 2DOFA 3WTYC 1K83J 1ON2A 1ZN2A 3A03A 4ZYGA 1SVLA 1XGNA 2M1BA 4EJWA 4OU0A 4N4OB 3BY6A 1NHAA 4CHUA 3FM5A 2G9WA 3FISA 3GMEA 3RKXA 2W00A 3WGGA 3I5UA 2WAEA 1T6SA 1QZYA 2CW7A 2KJCA 3SQNA 1XSVA 1IUFA 3MZYA 2O6GE 3QP5A 5EZGA 5KCMA 4XLFA 3Q9SA 4PDKA 4WXDA 2HWVA 2R7SA 1YLFA 1T0FC 2GLOA 2L4AA 2F4MB 2M87A 3A2KA 1MBJA 4IQ4A 4M71A 1O3TA 1SMYF 2K7LA 2LKSA 1TP4A 1LDJA 2CW8A 4BKXA 1G6NA 2L9RA 4UVBA 1LFPA 5J8CA 2CUFA 1G3WA 3RPUD 3QYEA 4XIDA 4NHJA 1ACIA 3J7AO 4HNTA 4HQEA 3GFIA 4EVIA 1S6LA 3LSIA 4BJ5C 4L0YB 2JVHA 3AL0B 2R5ZA 3F72A 4R79A 5FRNA 2LYCA 3HC7A 4O5VA 4U88A 2VKDA 3GWZA 1IF1A 3OR2C 3S8PA 5TGTA 3WODF 1MGTA 2RNJA 5HLHA 4AWXB 2L9VA 1BW6A 3PFYA 3A0BC 3G1OA 3BTJA 3RPUA 4MGRA 2PJRA 2DT7B 4V19K 1ITYA 1WZ2A 4UVAA 3GXOA 4X1EA 4G6DA 2ID6A 1V3FA 3F23A 2DODA 3G4SI 1OPCA 2VE8A 4ZH4F 2IS4A 3DPLC 2PBIA 5B1AH 1DQUA 4ESJA 4OIPF 2D1VA 1N78A 3ONQA 3GZNB 2DYRH 3KEOA 1G8XA 1MBEA 1ETQA 2OV7A 1XD7A 2V1XA 1SFXA 3FXJA 3MEXA 3ZP5A 2JK3A 1PUEE 3ESWB 2XPUA 2HQ5A 3ZQGA 3AG3H 1XN7A 2M2EA 4FISA 1MMGA 1F43A 2LH9A 1FYLA 5EEAA 4C9YA 1G3SA 1ZLJA 1FOYA 3B6CA 1KGSA 2KIFA 2K9NA 1YX5A 4B44A 3VB2A 1P4XA 2DDBA 3CP2A 2YU9J 4XR6A 1ULYA 5HODA 5FKLA 2OPTA 2MC4A 3P9KA 4PGGA 3JRHA 3DEWA 2AQEA 3M9AA 2NRAC 3PQJA 2QKMB 3F21A 5ED4A 3ZXSA 4WXHA 2WV0A 3RQIA 2M5WA 2DI3A 2MFZA 1FPQA 2WTEA 4HZFA 4JK1X 3JRIA 2STTA 5J4VA 2JPBA 2GOXB 2KRHA 2KZVA 3IC7A 1ETWA 4QWQA 2PJPA 2KIQA 4I7HA 1WJBA 3R4KA 4LFUA 3RJPA 2R93J 5ICCA 1A6IA 2IGOA 4TV7A 1Z7LA 4OIOF 2QQAA 3CZ6A 4HF0A 5EJCA 1OYIA 5F1JA 4XN3A 2B7EA 3ELKA 4U0WA 3K4CA 1QQIA 5D8LB 2YS9A 2GA2A 3K70C 5F0CA 5LFAA 5J1RA 3CO7C 1R5ID 4RGXA 1WJ5A 2ZJRF 4Y15A 2JJ7A 2X85A 1WGXA 4UB6C 2A07F 5GTIC 4J19A 3CCYA 3K4JA 1LFUP 1LFBA 2L7ZA 3WTWC 1X1CA 1KQ9A 3LSHA 3K4MA 4A93J 3OS0A 3GFJA 1SVOA 3K4NA 1B72A 2CQXA 4EATA 4HV5A 1X1AA 4WCGA 3LWFA 4KA4A 4YFNF 3BPVA 3ERED 1VQKI 2M7BA 2IBDA 3TBIA 2W7NA 2ECCA 2E1NA 1VF9A 3HB9A 3TO7A 1X1BA 2BGCA 3LMMA 3F8NA 3OR1C 5LEJA 2M8GX 1OCOH 4ON0A 3S2DJ 2M30A 2QUFA 3I64A 3QAHA 4CO8A 1ZKGA 3MVPA 3WTZA 3CCSI 1KONA 4M74A 3TDZC 1YW7A 1E3HA 2CV2A 3LNQA 1GLNA 3E3VA 4A3LJ 3HJEA 1VI0A 2IJLA 2RV8A 2F5DA 1H0MA 1WHUA 3OYNA 4EQQA 2DA6A 2F5FA 2Y30A 4BQOA 3KYLA 2CUZA 4HV6A 4RAZA 4KIBA 3MKWB 2JRTA 3BZ6A 2MH2A 2VQLA 3QU3A 4M72A 3S15J 3ZRGA 4A3CJ 1Z3XA 3HPHA 2FBHA 3FXKA 2YU3A 3RYRA 5KAIC 2V1DA 1SD4A 4YELA 3FDYA 2RREA 1OR7A 2RC4A 4XSXF 1JTXA 1V4RA 2EINH 1JGSA 2ESNA 4D5FA 1EF4A 1IDYA 1B1BA 2ZXWH 3BP8A 4A0YA 3ZQCA 2IVMA 3H1CA 3V8LA 3C18A 3LAPA 4ZTFA 1KU3A 2FBKA 1ON1A 1W7PB 1JTYA 5B66C 1PUFA 1YIOA 5JI6A 3KX2A 5FFZA 5FLVA 1AA7A 3ABMH 1J59A 3KZZA 4G6TB 3K6GA 2ZXJA 1A6QA 4C30A 5GAEJ 1D0XA 4OMZA 3S1RJ 1S72I 5JHUA 2V9VA 5CYVA 1KZHA 2K3PA 4BXXJ 2GBYA 3RKYA 3N97A 3Q5FA 1JGGA 4BJ6C 5J1YA 1CF7A 4I02A 3M8JA 5CQEA 1D8KA 4FE4A 1K4SA 2HPMA 3BOQA 4RM2A 4XQFA 2GXAA 1KU7A 3QU6A 1PDNC 4A12A 3H3VK 1U5TA 4AIKA 5FJ8J 1W0TA 3BCBA 1ZHFA 3KP3A 2V1NA 3E5UA 2LNBA 2ZJQF 1L0OC 1RZ4A 3ABTA 3WG7H 3NEUA 4UUSA 3K4KA 2NS7A 2A61A 3VEPA 2HOSA 1Z91A 4KT6A 2M34A 1FMVA 1BR4A 1G59A 1FTZA 2AXLA 3ZMZA 2PMZN 4PJNA 4IHVA 1FBUA 1TLHB 1EKEA 3ABLH 5LEKA 4CDGA 2L01A 2EQRA 3O3KA 4H4KC 1K78A 1EH6A 2CQ7A 3BG5A 2Q2EA 4PJ0C 4G6QA 2ZMEB 2R7QA 3CCEI 3H5RA 3V8KA 3M8EA 5FLMJ 3CCQI 3ABUA 2DFIA 1FX7A 2BW3B 2WWYA 5H6QA 5E3OA 2R5YA 1KU9A 2CFXA 2IA2A 2Z2SB 3KEQA 3PFIA 2CGPA 3T1BA 4UVCA 3DTEA 5ILUA 1RUOA 4L5JA 2ICWG 1GXQA 3DBHB 1ZK8A 2OAZA 1BC8C 2VBZA 3ML6A 5H20A 1IW7F 1DPRA 5EGOB 1AU7A 1Z1DA 4OINF 5LRSA 1JKPC 2MSYA 2JA5J 2FE3A 5TRDA 3KIOA 3EETA 2ZO4A 1TWFJ 4NC7A 1IRZA 4PFPA 4I99C 4HDUA 2HTSA 2VBYA 3DU5A 1ONVA 3FK7A 2P6SA 3A01A 2PMUA 1LE8A 1T0FA 2OC6A 1IN8A 2FBIA 1HKSA 2DA4A 3OIPA 4QTRA 2OU2A 2M9HA 1B9NA 1MD0A 4PJMA 2GM4A 1D1CA 2KMUA 3BZCA 4BE0A 3GFLA 4QSHA 2UXXA 1QZEA 2K02A 3ECHA 3O8HA 4MQ9F 1Y1VJ 2QM3A 1JXSA 3HXLA 1FIAA 2CYYA 4PSWA 3CUQB 2CQNA 4RB2C 2K86A 3COAC 2HXIA 3VYTB 2Y75A 1ZQ3P 1X4OA 2X4HA 4LG0B 1UG2A 1R5GA 4HSRA 2HXOA 2ZB9A 3IH4A 4BHPA 1RC9A 3WTTC 3G6EI 3HRSA 2MC3A 2OF7A 3C2HA 3WU2C 1SFOJ 3C7JA 4BEHA 4CUGA 3K2ZA 4F7ZA 5ILSA 2Y48A 1TWCJ 2QWWA 4P1WA 3DXJF 3WGIA 3D5RC 4YFKF 2ELJA 2A6HF 3L2UA 2L3DA 1SEUA 3DKXA 1JHFA 4H0EA 3AAFA 4B09A 3HKZA 3EUHC 4I98B 3RDIA 5GAHJ 5E8GA 4OWRB 1BW5A 3C3WA 4KUMA 1LKXA 1MBFA 3VYSB 4IPAA 2EPFA 1LQ1A 4B47A 3OYFA 3LSPA 2VONA 3LSKA 2F4OB 2NAZA 1TNSA 3H36A 2ESHA 1UG0A 4Y52J 4IHXA 1FYMA 2LR8A 3Q9VA 5DUIA 2ZXHA 5K7HA 3RZDJ 3DKYA 2H94A 2BBYA 2R7TA 1IGNA 4KJZA 1TQPA 5E3MA 4HBLA 2JA2A 4LB6B 5L3DA 5KVRA 1GT0C 5BQTA 4XLPF 2FQ3A 2VT2A 3K0LA 2IP2A 1W5TA 4A3JJ 4FT8A 1S7EA 4A6DA 2XGDA 5M3MJ 3K4BA 4OAZA 3F0CA 5D5VB 2OTLI 1STZA 2H6BA 4AM3A 4IEJA 2BEOA 2M8EA 3HIFA 3PNYA 2LP0A 1HDPA 3MN2A 4CYCB 1RKTA 1TQMA 5CVRA 2DLLA 2JSCA 5IYDJ 2L7MP 1SD5A 4WF2A 4N9IA 2PG4A 4U7BA 3D1NI 3PM1A 5JLWA 4XL9A 2CV1A 3GTQJ 2EA2A 3QRFF 1Y1WJ 2HOAA 5DYMA 4B8XA 1B59A 4IVNA 1T56A 1Z9CA 3PNVA 3GLXA 3GZ6A 2L02A 2EZKA 2HPIA 3FKIJ 1QO0D 4Z6YA 1B8IB 3DTKA 3P9IA 3GFMA 2Y69H 3WG9A 1K6OA 4ETSA 3UR3C 1Q1VA 4IX7A 4ESBA 3GCMA 2R7WA 2E2HJ 1Z77A 2QSFX 4KT5C 3V8JA 1XPXA 2LBFB 1LUJB 2WAFA 3B02A 1Y0UA 3EQLF 4KMUX 2Y0SA 3RPQA 2J5PA 2LY1A 3ZN0A 1RI7A 3CMEI 3N4MA 4G9YA 1YO5C 5LHHA 1WKMA 2VI6A 3CLQA 1FTTA 1CGPA 2VPLA 1FMWA 3J7YJ 2IAIA 4A3BJ 3FXQA 5HLIA 2X6OA 3A1YA 5BOXA 1XSXA 4HA8A 4HDVA 5CVUA 1IRXA 2XDVA 4KN7X 2OCEA 2JPCA 3P7NA 3E0JB 1R1UA 4FTHA 1Y39A 1X1DA 4I0AA 1ZRDA 4XONA 2NYXA 2NNYA 3KLOA 3IKTA 3ASNH 3TKYA 3DQVC 4KICA 2HU9A 2AO9A 3FMRA 2HZDA 2BHZA 2QCOA 3F8MA 1T38A 1SMTA 2COMA 1MDMB 4K2EA 1Y0NA 3NARA 4YG2F 4ZYHA 3GTOJ 3HGYA 3V7CA 4G7HF 2QVOA 4LMYA 2EFPA 2E19A 2H8RA 3KETA 3CP8A 5DS9A 3OS2A 1VZ0A 2HYJA 4C2UA 3OYGA 2QA4I 4KIFA 1IV8A 3HEFA 1I50J 3MKLA 4IRHA 1D8JA 2CJJA 3LSJA 4B43A 4ANJA 5J1UA 2Y0MA 1GDTA 1G2HA 5ICGA 4RGRA 1BI1A 3C1DA 3LFKA 3SDGA 1IJWC 4XRSG 2HYFA 2QEXI 1J0RA 2ACJA 5IT9K 4UUTA 5FD5A 1VQLI 4UB8C 5HS8A 4MQVA 4HAMA 3IL2A 1R9TJ 2DQRA 2L7FP 3WU0A 2L54A 4YIRX 1AKHA 2XVCA 4XLNF 5CVIA 2FOKA 4D7NA 2K3FA 1YRNA 2XF7A 2D5VA 4W97A 2Q1ZB 1QPMA 1QPIA 4ZDOA 3T8RA 4GYIA 3FIWA 3EUKL 1UELB 3MFKA 1XGMA 3FBNB 5FLXK 1YS7A 1MZBA 4RLQA 3ROUA 1Z67A 5GP9A 5E8IA 1VTNC 1X58A 2HQAA 2DMTA 2HOTA 4B3AA 2P7CB 3M4OJ 5HLGA 3IH2A 1T98A 3RIRA 5JVTA 3SJMA 2IS6A 3KCCA 4S0HB 2DU9A 4D0PA 5BS6A 1OYWA 3LOCA 1RKWA 3HSEA 4KIGA 3CDLA 3KLNA 1JUMA 1U78A 3QWLA 3H9QA 2QBYA 4IRIA 4Y7NJ 3H5NA 5CJ9A 3GBGA 3WTUC 3S14J 4I0BA 3IH3A 4RDUA 4X0GA 1X4PA 3CCLI 2E2IJ 5EZHA 2FOWA 2EFOA 1BN5A 1OISA 3K1NA 3KPHA 4A6EA 3IWZA 3FHNA 2JQ7A 2W24A 1IXCA 1X3ZB 3BROA 2UZKA 4RB1A 4LGWA 1HW5A 4HG2A 1OJLA 2EZIA 3FHZA 1P2FA 2P81A 3MZ8A 2UUZA 2LKXA 4DYCA 2KDOA 4NQWA 2XAJA 2NVXJ 5HS9A 1OQYA 2RDPA 5ICFA 2IT0A 2VODA 3M7GA 3G1LA 4E7LA 1ERDA 1MJAA 4FX0A 2WC2A 2RVCA 5L3EA 5K5RA 1B9MA 3HDDA 3H92A 3CO6C 1ZRCA 2XPWA 3W2VA 1H88C 4UY8I 4I2OA 2LSOA 2Q8KA 2EFWA 3MMYB 4O6JA 1J2XA 1MMAA 2ZXIA 2XRNA 2JT1A 2DPUA 1I27A 3LQRA 3HOTA 4WXCA 4I01A 5BMZA 1HBXG 4BY1J 2L0KA 1FP1D 1FZPB 3DU6A 3FMSA 1O3RA 1FT9A 1PVEA 2Z5UA 2TCTA 5ERIA 3MD2A 3ZMTA 2EILH 4AIHA 4OAYA 1JJ8C 4DJAA 3F8CA 5A2QZ 5AONA 2ZMEC 2PQ8A 1TT5B 3G3ZA 4HX4A 2M0MA 2QQBA 3RKQA 3CC4I 1U9NA 5L3CA 2KHMA 4ZDPA 3CCMI 2Y31A 3DFGA 2VL8A 2E2JJ 5JHFA 5FB2A 2FNAA 3OWTA 3WE3A 3SXYA 5CVJA 1ZYRF 2F5EA 2GOMA 3JRFA 4GYGA 4PJJA 2CUEA 5EDNA 4LD5A 5FRMA 4Y4RA 2DA5A 1GUUA 5L3FA 2HOEA 1I6XA 1H8AC 1A36A 4BGDA 3S1QJ 3K9TA 1USSA 3DCFA 3H0GJ 2QENA 4PGHA 4GFBA 2R7UA 3CDHA 3TO6A 1DGWY 4ZC3A 2HQRA 4ITVA 3KP6A 3S32A 3JRAA 1N25A 1LNWA 3RI4A 4XOPA 4JOMA 2Y2ZA 3U21A 3G1MA 2EH3A 1E0EA 1KA8A 2JMWA 1O3SA 1WWXA 3GTMJ 3IAS2 5CLSA 4CCOA 1G3TA 4HSTA 5IYBJ 3ZCOA 4F55A 1RIOH 1X19A 5B5EC 3JW4A 2XV4S 3ECOA 5J8FA 1JJ6C 2DA1A 2EIKH 2F5CA 3AG2H 4M6XA 2WB1A 4Q48A 2O8KA 5HS7A 1LDDA 3JSPA 1RR8C 3ZMDA 5KNLA 3CD6I 1FSHA 3LAJA 1Y8QB 3K7AJ 1MMDA 1O7LA 1VFCA 2R7XA 4XKBA 3BJOA 1E3OC 5BPDA 3DLAA 3CUQC 2HI3A 1Y56A 4HQMA 1NK2P 3K1MA 1BA5A 2A69F 2EFNA 2W4SA 2CG4A 3CTAA 3TQNA 3EUHA 2STWA 4FASD 2GXGA 3V42A 3DPTA 3AFHA 3ASOH 2BY0A 3J80K 4EGZA 3GTKJ 3B6AA 5F0HA 3RKWA 4EJTA 5LD2C 1ETYA 2VUMJ 1ZREA 3WU1B 2HYGD 5J3LA 1SD7A 1HQCA 3AG4H 4A3FJ 2VKHA 1YS6A 3MKZA 2XGCA 2CFOA 4PZJA 2DOAA 3J81K 1GXPA 4AUXA 2H27A 3F6VA 3DBRB 2DFHA 2R7RA 4HLYA 3JRCA 1FIPA 1S8NA 1I3QJ 4ZDLA 5AIQA 3HOUJ 4BQNA 1QBJA 1J9IA 2ECBA 4M9ZA 1UB9A 5EYRA 1FWZA 1RRJA 2CMPA 5D5XB 4CCJA 1WJCA 2JZYA 2BE5F 2XGEA 1ORKA 1HKQA 5IOYA 2VB6A 1W5CC 3ZQQA 2DPDA 1VQPI 3ISPA 3HHHA 2L7KA 5GADJ 3F9KA 3HOZJ 1FLIA 5EG0B 3CMYA 4OIQF 1IN6A 2ELHA 5DTDA 5E17F 2MD0A 2RQQA 2XF6A 3OIOA 4ESFA 3R0JA 3QQAA 4KFCA 4LLGF 1R4NB 2P6TA 3VYRB 3L1PA 3BG6A 1SAXA 1TBXA 3I56I 4LLNA 2KISA 3I9V2 2FMYA 1PJRA 5E1WA 4BACA 3GTGJ 2UXNA 3IV5A 2E1OA 1WH7A 2Q0OA 1I3AA 5FKNA 5DV5A 4PK4A 2IGKA 1T08B 1S9HA 1R4MB 5HNFA 3OY9A 3UKGA 4U87A 2FA5A 1OCTC 5DD8A 1G3YA 1ZARA 2P4WA 4XK4A 4XICA 4NC6A 2NVYJ 5DCMB 1EJ9A 3PIOF 5EEGA 1R22A 1TWAJ 5FD6A 2ISZA 2HDWA 3M1CA 1XDSA 1IXSB 2ETHA 3F8FA 3VFZA 1BC7C 1PYVA 3CJQB 5DM7F 3QPTA 4LOCA 2XIGA 2LMDA 3BR0A 3C2GA 2LF7A 3ZGKA 1IRFA 3HKZN 3JAMK 1MIJA 4IL6C 1K61A 2L2OA 4XMYA 1BBYA 4KMFA 4L9VA 1EA3A 2RKHA 1S7AA 2RN7A 1I1SA 1UHMA 2N8GA 2PI0A 1K6YA 3OYEA 3WGHA 1Y6IA 2NVTJ 1WFXA 1DUXC 1FOWA 5GPAA 2XAFA 1MJ9A 3O8GA 4QPQA 5B1BH 4J01A 2WAQN 1MH4A 3OYCA 4HOBA 1IUYA 1J7KA 4V2GA 4E7HA 3GX4X 1J09A 4EM1A 5CKTA 1U0JA 1P4AA 4WK8F 2LTPA 2XUBA 1D1BA 2X6YA 4Y33A 4FE7A 1MBKA 3TW7A 5HLTA 1EV7A 1TW2A 5JFRA 1YE9A 1WJEA 1KYZA 3IRRA 2P5VA 1OCPA 4P55A 5E3LA 2ISYA 4L0ZB 1F9NA 2CS3A 3BQZA 3FZVA 2KKOA 3QP6A 4ABZA 1RUNA 3RYPA 5DCFA 4DYRA 4MLOA 3OS1A 3OIQA 4EEFG 1QVTA 3GTLJ 3OOUA 1O4XA 1W7PD 1JT0A 3PUFA 2VBWA 4ASNA 3KEYA 1SFUA 2EV5A 3JR9A 2W48A 4G8XA 1P9QC 3L00A 5M5YJ 4ENNA 1YYVA 3LQQA 4XKWA 3K1PA 1XTAA 3VWBA 4HRIA 3CC2I 4D7MA 1R1TA 5L3BA 2H1KA 3WTSC 1R36A 3F3XA 4LIVA 3GF2A 2VKVA 2DW4A 2XHKA 2VC0A 2IXSA 1YQAA 1W7PA 2L9SA 4P96A 4RAGA 4A3GJ 2IS2A 2LK2A 3DPUA 1FBSA 2DMNA 2EA4A 4IZZA 4BNCA 1FJLA 2DK5A 3HZJA 2FNPA 3CCJI 3HG9A 5GAGJ 4IOCF 1JKOC 1USTA 1B4AA 1A04A 3GUDA 1WI3A 3LSMA 3AKZA 2XC7A 1R5HA 3ZOBA 2VE9A 2WA0A 1ZG3A 3G2BA 4MFEA 2VLAA 2VBXA 4L9TA 2OZ6A 4F93B 1ZGJA 1I6HJ 2HZTA 2XF5A 1FY7A 1V55H 2B0LA 1JKQC 2UV1A 4CGZA 1S7OA 1NK3P 2UWMA 4XLCA 3I0TA 1BOAA 2OQRA 2R7FA 3BZKA 4FETA 4P9UA 4MHGA 4S04A 1HW1A 2EB7A 1S3JA 5IPAA 2ZJ2A 2I8DA 3PSIA 1T39A 4IXAA 3OYJA 3HUGB 4L9JA 1N75A 3E5QA 2W57A 4FHTA 2XSJC 2Z1DA 3K69A 4ZZDA 2BVMA 4KDPA 2VASA 4L5EA 3TO9A 5K7ZA 1UCRA 1OLTA 1RESA 2XB5A 2O7OA 2IS1A 3BWGA 3O6BB 2ZMEA 3SHFA 1T8IA 4M9SA 4XLEA 1BI3A 2KRCA 2TRTA 4A5NA 2CRGA 2DFFA 2M4GA 1LB2A 2K9LA 3JCUC 5LHGA 1N77A 3DBLB 4ZYEA 2BW3A 2QKLB 3I59B 4KITB 1APLC 2HTJA 2AXTC 3IUOA 3MKYB 3AL0C 3F22A 2V9PA 4AYBA 2E1MB 4FQGA 3CESA 4CXFA 2IA1A 2WV1A 4ZYDA 3JSOA 2TDXA 2RNGA 3KP2A 3Q3SA 2OTJI 5LLQA 4CYDA 1K7AA 1YW9A 2CW0F 1WSUA 3OYDA 2K27A 5J40A 2XKOA 5EGOA 5LGNA 1MW7A 4JQFA 2BZTA 2G7HA 2DA3A 4DBQA 2KFDA 3NAUA 2LOOA 2AHQA 2VOOA 1ZRFA 1PP8F 3OYLA 4AVZA 1X3WB 4MEYF 3SZTA 4RS8A 2XASA 5A2QK 4XM3A 4WX9A 2R3SA 4EMSA 4HNUA 4KNYA 4BL0B 4E7KA 2NNNA 2JRMA 2ME0A 2O8XA 2VJ4A 3FXUA 4Y3OA 4UV8A 4RA2A 1E2XA 2FF4A 2NOGA 3K70D 2KIMA 1Y8RB 4G12A 3H3UA 3W2AA 3GYHX 2X1EA 4BE2A 2O9LA 4LB5A 1HXDA 2O0YA 2JA8J 4NUBA 1NG6A 1QU3A 4C3JJ 1U8BA 2IGNA 2BY2A 3CUQA 4DYQA 1ZAOA 4AVPA 2ZSHB 2OCCH 3H3ZA 1NH3A 3HSRA 2MABA 1SANA 1QVUA 3V7RA 4LG0A 2CU7A 2O03A 4GRIA 4E7IA 1VQMI 2DMUA 2F4IA 3E6BA 2HDCA 4LK1F 4B4CA 2DTRA 5BNGA 2PMZA 1Z3YA 4RLFA 1HF0A 1HLVA 5D6FA 3QPHA 5K7FA 5M3FJ 1QGPA 2HFHA 4M3GA 2FD5A 2JSPA 5FGMA 1LJ9A 2HVQA 3Q0UA 1T2KA 4OMYA 2DJIA 3PJRA 5M5WJ 1U9OA 5EEHA 1A31A 4AIJA 1TNTA 1R71A 3GO5A 2LDUA 2M4KA 1W36C 2XRLA 1WJFA 1YRNB 1IG7A 2DCEA 5E1XA 4BXUA 4RAYA 2G7UA 2PEXA 1KQ0A 2YPRA 2L4MA 3IWFA 3W2WA 3HTSB 1U8RA 2XSDC 3F6OA 1NG7A 1UHWA 3K4LA 4DQ2A 3IHUA 2KT0A 2MA3A 2DA2A 4I09A 5HDKA 5HDNA 2JA6J 3TP3A 3GTPJ 2V1UA 2C6YA 4XOTA 1HC8A 2ADUA 4F3QA 2FMLA 2GQQA 1TL8A 5H6RA 1XX5A 1BJAA 2K9QA 2V6EA 1P6RA 3ERMA 4OIRF 5FROA 3I55I 3IAM2 2NS0A 2E36A 2HR3A 4A3IJ 9ANTA 2ZC2A 2QBYB 1FP2A 2OZUA 5DD4A 3I4NJ 2VN2A 3WTXC 5FFXA 2E5ZA 4E7ZA 3M3YJ 4II3A 4CYCA 2YUSA 3V7SA 1ZR4A 3HRMA 4U0YA 3MZHA 2V9KA 3U9GA 3L2VA 3MCZA 2VT3A 2P7VB 1VQ7I 3HL2A 4C2TA 3IKVA 1ZGWA 5DUKA 1LEAA 3E6CC 3HHGA 1ODDA 3FXOA 1X3UA 2VC1A 4NQWB 1D5YA 1G4DA 2H1LA 2E71A 2VJJA 5D5WB 3ZMSA 5J6XA 3VSKA 2HKXA 4I6ZA 1B8IA 1WCMJ 4Q5SF 1IN4A 4JX5A 5K5OA 4HNVA 2LRDA 3OOPA 2WY8Q 2DO7A 3KYCB 1OYYA 5B3SH 3HGGA 1BOBA 2CQQA 4DIQA 4RB3C 1V5EA 2LKPA 2JN6A 2F5VA 4B3XA 2E5NA 4OOIA 2IW5A 3GTJJ 4ZZLA 3MWMA 1WJDA 2FRHA 3A4CA 2DA7A 3Q0WA 3SYTA 3CQZJ 4BBSJ 1YTYA 3QYBA 1QA6A 3SEQA 2DT6A 3JRDA 2R5ZB 3BDDA 3GEZA 1D5VA 1BIAA 2FJ1A 4M3DA 3PO2J 4D9JA 1TWGJ 1I39A 3I4PA 3J7ZI 2QYOA 3LSRA 1I1GA 3I53A 4BQAA 1M1EB 4W1UA 1AOYA 2VQCA 1XC5A 3BC8A 2JA7J 4G7OF 3D5SC 3VYUB 3HOWJ 3OV8A 3NQOA 3H9JA 4UHTA 3HPGA 3VOEA 2PJRB 3BG7A 4DGWB 1FBQA 1JT6A 1HSJA 4DZJA 3CCVI 2JUCA 1HW2A 2ZFUA 5IP7J 4BHBA 3AG1H 4U7DA 2XPVA 5TJJA 1MDMA 4LIUA 3HRUA 4BAYA 1ZG5A 2XKPA 1IC8A 2CO5A 2NVUB 4AU7A 2F6CA 3PNTA 1HKTA 4UXNA 3JRGA 3IP4B 4IRGA 4YEJA 3S2HJ 3IRQA 4QIWN 3GZ5A 1IN7A 4UV9A 3TP0A 2R7OA 4BXFA 4D1QA 2GA1A 4P9FA 2CH0A 2NOJB 2O5RA 5GPCA 1VQOI 1HDDC 1JUSA 5FO5A 1ZTRA 3V4GA 1JI8A 3S2WA 4F91B 3RZOJ 2XB0X 2H09A 1OFCX 3CUOA 4P5OA 2E7WA 1FOXA 4L5IA 4PFOA 5KK1A 2OBPA 3FBIB 2J5OA 2FX0A 2KRFA 2QLZA 2X9DA 1O7FA 2BYVE 2P8TA 3BJAA 3HM5A 4QPOA 1MSFC 2KQRA 2CV0A 3KE2A 5LRRA 2E7XA 2EIJH 3BR6A 2NS8A 2EV0A 1WQ2A 4GO1A 1I5ZA 3QODA 3KZIC 2R0QC 2KLOA 1HSTA 3I4MJ 1D0ZA 5LHIA 2PFBA 3LFUA 4RM3A 3T8TA 1XS9A 3FWEA 1Q1HA 4GGGA 4IHYA 1JHHA 2LC2A 3U1DA 1KU2A 4N0BA 1XCVA 2WADA 3S17J 4GXOA 1R6RA 3L2WA 3DLLF 2HDDA 4RGSA 1HOMA 4RGUA 2LG4A 1D1AA 4BYYA 1OCCH 1UAAA 1SVMA 1OCRH 2K40A 3OL3A 1MKMA 2MYSA 3OYHA 1ZH5A 2W84A 3W6KB 3BT9A 5JVGF 2BOLA 1TW3A 4PJLA 1B6AA 2LFBA 3BG9A 4IHSA 1RR7A 3C2BA 3HOYJ 2PLYA 4XNFA 3GW2A 4NC8A 4CH7A 1UZCA 1B72B 3SZPA 1BM9A 2X51A 4N9HA 5KHDA 1E3PA 3R0AA 3SFIA 2R92J 3BG3A 2Z99A 3CCRI 1F4KA 4L9NA 4R1HA 3CCUI 2QSHX 4MEXF 3BPXA 2KIUA 4RB0A 2MBFA 3H35A 3QPSA 5F0FA 4BH9A 2EBIA 2E1CA 3KYDB 3M1EA 2W25A 4YIIA 3S3OA 4JX4A 4G94A 4JP0A 3ZR8X 2M7AA 1DDNA 2P0WA 2QGUA 2M45A 2LD5A 3W6VA 3A02A 2VQGA 1UJ8A 1OCZH 2K9MA 1LDKB 2ZFWA 1DGRM 2K9SA 3FKJA 3CMAI 3NWTA 3GVAA 1J5YA 1BJZA 2VXZA 3S1MJ 4A3MJ 1XGOA 3HBLA 3VPRA 2PMHA 4EJVA 1RNLA 2A05A 4IF4A 4M6YA 5DEQA 3H9GA 5K1YA 3CC7I 1RETA 1GV5A 5E18F 1ZR2A 1YG2A 3PIPF 2A68F 2CSOA 5ILVA 3ZQHA 1UMQA 4C3IJ 1HCRA 3R61A 2HNHA 4N4NB 4C3HJ 4Y13A 1MNMC 4CZCA 3LSGA 3CJNA 4WWCA 1XDUA 3L2QA 5DDGA 2LF8A 3CF5F 2E1MC 2R4GA 1YI2I 3DEEA 5F27A 2W82A 2F2EA 1P7IA 2A6EF 2DMPA 4MTEA 5F64A 2K4JA 5HVQC 2X48A 1MH3A 3HOVJ 4HW0A 2IRFG 1MNDA 3EYYA 3S93A 3OSFA 2VJ5A 1EH7A 4XBFA 4DNCA 4XN0A 1BR2A 1U3EM 1DP7P 1PUFB 3BR5A 2GAUA 2DOEA 2DDAA 2M0CA 3BTCA 2ZSIB 3ZPLA 1P7JA 1QHHD 2GZWA 1NTCA 3HOSA 1U6GA 4BS9A 1IRGA 3CJRB 4CZZA 1FC3A 1QNTA 4XKCA 3JRBA 5DM6F 5E3NA 3ULQB 5C4XJ 5FKKA 1H9GA 4M73A 1W36D 2JTVA 3WTVC 1CF7B 1AWCA 2PN6A 1DU0A 2O3FA 5IT9Z 1MNEA 1VQ6I 1U5TB 2K85A 1KYWA 3QYFA 1YHQI 4A3KJ 3L7WA 2FQ4A 4LITA 1TWHJ 3TL4X 2Y9YA 1P92A 4CCLA 1X2MA 4UUSB 4KYWA 3S3MA 1O3QA 1WPKA 4YFXF 2FUG2 5FLXZ 3I3LA 1PP7U 3DF8A 3DKWA 2MGQA 5HNHA 3JTGA 1P4WA 5E79C 2YX4A 2KDZA 4UNOA 5FKOA 1YJNI 3WHCA 1BL0A 3ZMUA 2MD5A 1HA8A 4EJOA 2LY2A 2IGMA 3I54A 3TW6A 3E1SA 1SFEA 4M9XA 1K78B 3FM3A 1IV6A 1EH8A 2Q2EB 3NWSA 2EJRA 4FCYA 4F52A 3PL8A 1IO2A 4CCKA 5IP6A 4NDLA 1MMSA 4AYBN 1DP3A 2VPRA 2ZBKA 4IQJA 3L2RA 3B73A 2IPQX 3OYMA 2R5YB 4HX7A 3E97A 2E34A 3FX3A 3K10A 4JBAA 4ENJA 4XRSA 1ETXA 2ZKZA 5CPRB 1JE8A 2ME6A 3RCOA 3QOPA 1R49A 1Z21A 3E7LA 3CJTB 4BBRJ 1K79A 3OYIA 1W5SA 3D5LA 2OD5A 2VKEA 4EM0B 3H5AA 1SC7A 4M3FA 2ELKA 4BHCA 3W6JB 5BPIA 5D4SA 1GVDA 2HKOA 4JYKA 3U2RA 5EG0A 4CSWA 4BQQA 2D45A 1Z7UA 4IHTA 2VJIA 4IOAF 1JKRC 5E1ZB 3TOBA 3L9FA 2EV6A 2DN0A 1K4TA 2Z3YA 1WRJA 3EDPA 1OMIA 3ABKH 1Z0XA 2VOPA 1R7JA 3LSTA 1T33A 2WBMA 3A01B 1LE8B 1UFMA 1TC3C 1SD6A 2MG4A 4II2A 2M3AA 2HS5A 3EUAA 5FKMA 1MBGA 3MQ0A 4HEA2 3SDBA 2ID3A 3TGNA 3FXLA 1YFHA 2X0LA 1W4MA 3OL4A 3L2CA 3BCAA 1Z6TA 2QQ9A 3E6DA 1FSEA 3MAJA 1WVRA 2P5KA 3Q0VA 5HDGA 4NB5A 6PAXA 5M5XJ 4EM2A 3LA2A 4IHWA 5IT3A 3JTHA 2V26A 5DCMA 1E17A 4LG3A 4GCVA 2HQNA 4LK0F 4CCMA 5K5QA 4IKFA 3DTIA 2R7ZJ 1GHCA 1XB4A 4BEHB 2FEZA 1S29A 3K2AA 2Z33A 2DTZA 1F1ZA 2Y0SN 4IJAA 4BY7J 1WJAA 5CVVA 3HSFA 4BE1A 4CICA 5C4JJ 2I5UA 2LY9A 5F1RA 3DWLE 1BIBA 1JUPA 3BR2A 2F48A 1LVAA 4KN4X 5ICEA 2IA0A 2JVGA 4DBRA 1AHDP 4UUVA 2P5LC 4HF2A 1ETKA 3UNGC 5LGTA 1FEXA 4ENKA 1VQ4I 4NNJA 1R00A 5D8KB 2FSWA 2EFQA 4D5CA 2DT5A 1F5TA 3PUBA 2XAHA 1UHSA 5D6EA 1BI2A 1C0WA 4BUPA 1MSEC 1RPWA 1DU6A 4V2FA 3KP5A 1Z6RA 2COBA 1ETOA 3D0SA 5F08A 3OYAA 1SAUA 2EZHA 3ZMVA 3NRVA 4A0XA 2BY3A 1R58A 2AQFA 3QPLA 3VDXA 3HOXJ 3SFZA 4E70A 2EWNA 3LA7A 3I71A 4M3BA 1XGSA 5GTHC 4EJUA 5D4RA 1VQ9I 2CWEA 3X2QH 2Y9ZA 4DW6A 4U0VA 1SFKA 5CQGA 2VIXA 5J4YA 1V5FA 4DZPA 5LGUA 2XGXA 4O3MA 3CLOA 3TMOA 2HVSA 2A3SA 3L09A 4ZTJA 2KP6A 4HX8A 3E5XA 4M3EA 1GVJA 4C2MJ 1CQTA 1OKRA 4J00A 3JREA 4BDYA 2HGCA 2BVLA 4L18B 3TDUC 3U1KA 3TOAA 2K4BA 3G73A 4DOZA 3ZQ7A 3J80Z 5F6FA 1J75A 4Y17A 1XMXA 1REPC 4E4HA 3S16J 2A5YB 3ZQFA 3J81Z 2CQKA 3LA3A 4ZYAA 3BTLA 3PSFA 1TTYA 3FF5A 2KJBA 4FX4A 1BI0A 1D3YA 2YSRA 2D1HA 3P5JA 2EZLA 2KPMA 2ZNZA 1MMNA 2GXBA 1TQIA 1QHGA 4AC0A 4E7JA 2KZGA 4HYEA 5L3GA 2W85A 3F8BA 5JLXA 3HTUA 4PCQA 3TEDA 3FXMA 1KQ8A 1MBHA 3QOEA 3P9CA 1ETVA 2BV6A 1TZLA 3A0HC 2LVSA 3FMQA 1ZG1A 2WY7Q 1YIJI 3M07A 2D2WA 2QSGX 1O57A 2R7DA 2IEKA 4A0ZA 2EK5A 1YX3A 1BR1A 4B1RA 4XLAA 2XAGA 1XCBA 1IZ1A 2WAQA 2V6CA 5TISC 3GLLA 4A3DJ 2OJED 3DEUA 3E6MA 1R23A 2I10A 5D5UB 2NVQJ 1IXRC 2W1OA 3LL7A 2L9NA 3BLYA 2OA4A 4A5MA 4CCNA 5E20A 2YR2A 5EF6A 3G71I 4LLLA 4F92B 5IY5H 2H8WA 3HUGA 2X1DA 2DJNA 2FXAA 1IN5A 1LPQA 1VQNI 4A3EJ 4ZJZA 2DMQA 2VXDA 2EIMH 2H6CA 4MFDA 4RBOA 1DPUA 3RQ4A 5F04A 4BU2A 3HYIA 1XMAA 1A5JA 3WHBA 4MTDA 2JUGA 4HLXA 3I59A 2DXIA 3BQYA 1LEBA 2MLGA 2GIVA 3EPZA 1XSDA 1H89C 3CF2A 1V5GA 1W1WE 1YW8A 1FNNA 2NXNB 1WI9A 1X1PA 3SEZA 1YITI 1AKHB 3T0YA 3BTIA 4G7ZF 2BY1A 3OSGA 4S05A 4EV0A 4XRFA 3JAMZ 3RSNA 4R8HA 2A6TA 5KAFC 5C3EJ 2MW8A 4I76A 4X6AJ 3J7AY 3OYKA 3T5XA 2L5QA 1FYKA 2ZNYA 1W0UA 3R6SA 2LLKA 4JX6A 4QLCU 1POGA 1QRYA 4GDFA 4MNUA 2DAOA 2V4JC 1ZGAA 3I58A 3CDIA 1IDZA 4PUSA 1Z05A 3BR3A 1S5LC 2QZ8A 4XRMA 4NBQA 3OYBA 2B63J 4YIFA 2MH9A 4B48A 3FXRA 3M8FA 2G0EA 4AD9A 1OR7C 3KZYA 3RTRA 1FOKA 1VQ8I 4PSXA 4CA0A 4IO9F 2A5WA 2Z16A 4BJTA 4XLHA 2HVRA 2B9SA 1R1VA 2GWRA 4LJZF 1GV2A 4RAFA 2E60A 1L3LA 3FK6A 2K5CA 4XSZF 3ZQLA 1IAWA 2V79A 3BJ6A 3OMYA 1ZELA 1F36A 3VODA 4HPQA 3REOA 2YX7A 3BR1A 3DV8A 3N05A 4E7SA 2VQHA 2R7VA 3CMMA 2HEOA 3S1NJ 5JR3A 3H0DA 1XMKA 3WE2A 1XG1A 2XAQA 1ZLKA 1H9TA 2KL4A 5H2FC 2WB1N 5IP9J 1V54H 2XAUA 2O61A 2V7FA 2BHYA 5HOOA 2JWTA 5J47A 4XKVA 3PQKA 2OUMA 4AIDA 2RQPA 2LREA 5LBQA 2BXYA 1U5TC 2LBFA 1D0YA 2E35A 2QQ8A 1A35A 4YRVA 2PX9A 2ZCWA 2X6XA 4RMNA 4E6KG 2GIZA 3S3NA 4HF1A 3ZQIA 1YOVB 3PO3J 2OQGA 1YJ9I 2AS5F 2FU4A 3HRTA 2MLKA 1U2WA 4KISA 2RGVA 4A69C 2CUJA
chains in the Genus database with same CATH topology
3S1MJ 1X2NA 2QF7A 4A3MJ 5C44J 2LR8A 3HBLA 4FE7A 1WH5A 3VPRA 5K7HA 1MBKA 3TW7A 3RZDJ 4MO7A 1IGNA 5E3MA 1OCPA 5E3LA 1RETA 4M6VA 1GT0C 1GV5A 5IYCJ 3BQZA 1ZR2A 3ZQHA 1UMQA 4C3IJ 1HCRA 1VNDA 4ABZA 4A3JJ 1S7EA 4DYRA 4C3HJ 1ENHA 2XGDA 4MLOA 2RAEA 5IOZA 3F0CA 3LSGA 5M3MJ 1MNMC 4MIMA 4IEJA 4EEFG 4CYCB 2LP0A 1HDPA 1QVTA 3MN2A 3OOUA 1RKTA 3GTLJ 1O4XA 5IYDJ 1K83J 2L7MP 5F27A 1JT0A 3A03A 1P7IA 2DMPA 3JR9A 2W48A 2X48A 3D1NI 1MH3A 3PM1A 5JLWA 3GTQJ 3HOVJ 5M5YJ 1Y1WJ 3FISA 2HOAA 1T56A 3OSFA 2EZKA 4D7MA 2H1KA 3FKIJ 1PUFB 3BR5A 1IUFA 1B8IB 3BTCA 2M0CA 5EZGA 2VKVA 1Q1VA 1P7JA 4A3GJ 1NTCA 2LK2A 2E2HJ 1Z77A 2GLOA 2DMNA 1MBJA 3JRBA 5E3NA 5C4XJ 5FKKA 4BKXA 1FJLA 2L9RA 2CUFA 1JKOC 1DU0A 2VI6A 1FTTA 1WI3A 3ZOBA 4XIDA 2IAIA 4A3BJ 4MFEA 2X6OA 1I6HJ 2R5ZA 4A3KJ 2FQ4A 1JKQC 1TWHJ 2Y9YA 4UUSB 1X2MA 1NK3P 4FTHA 1WPKA 1BW6A 3G1OA 3BTJA 2MGQA 2AO9A 1ITYA 2QCOA 2KDZA 5FKOA 3WHCA 1BL0A 5IPAA 3NARA 3GTOJ 4X1EA 3TW6A 3HGYA 1IV6A 4L5EA 2E19A 5K7ZA 4FCYA 2H8RA 2ID6A 1RESA 2XB5A 4NDLA 5IP6A 5DS9A 2O7OA 4AYBN 2HYJA 2VPRA 2R5YB 2TRTA 3HEFA 1I50J 3MKLA 2CRGA 1MBEA 2CJJA 1ETQA 3LSJA 4XRSA 1ETXA 5J1UA 1APLC 1GDTA 1G2HA 2JK3A 2ME6A 3SDGA 1IJWC 3E7LA 2XPUA 2HQ5A 4XRSG 3ZQGA 4BBRJ 2WV1A 2M2EA 4FISA 1F43A 2VKEA 4UUTA 5EEAA 3Q3SA 1R9TJ 3B6CA 2L7FP 2K9NA 4M3FA 2ELKA 1AKHA 5EGOA 4D7NA 1YRNA 2YU9J 2D5VA 1GVDA 4JYKA 2DA3A 4W97A 5EG0A 1QPIA 5HODA 3NAUA 5FKLA 2OPTA 3FIWA 2AHQA 3JRHA 3DEWA 1JKRC 2DN0A 3RQIA 5GP9A 1Z0XA 1X58A 2DMTA 3A01B 1T33A 4B3AA 1LE8B 2HOTA 3M4OJ 1TC3C 3IH2A 3JRIA 2MG4A 3SJMA 4S0HB 1ETWA 5FKMA 3LOCA 1MBGA 1RKWA 2R93J 2ME0A 2ID3A 1A6IA 3CDLA 5F1JA 2NOGA 1JUMA 1U78A 4G12A 2YS9A 4Y7NJ 2O9LA 3Q0VA 3GBGA 3S14J 2JA8J 3IH3A 4RDUA 5F0CA 5J1RA 2E2IJ 5EZHA 4C3JJ 5M5XJ 1U8BA 4IHWA 4DYQA 2JJ7A 1WGXA 4J19A 3CCYA 1SANA 1QVUA 2R7ZJ 2CU7A 1OJLA 1LFBA 2EZIA 2L7ZA 1LFUP 2P81A 4A93J 2DMUA 3K2AA 2DTZA 2LKXA 4B4CA 2Y0SN 5BNGA 4DYCA 4BY7J 1B72A 2CQXA 2NVXJ 1HF0A 1HLVA 3G1LA 5K7FA 5C4JJ 5M3FJ 2LY9A 3HDDA 4M3GA 2IBDA 2FD5A 1JUPA 3BR2A 2ECCA 3Q0UA 2XPWA 1VF9A 1H88C 3HB9A 5M5WJ 1U9OA 1AHDP 1ETKA 1FEXA 2XRLA 1YRNB 2M8GX 1IG7A 4D5CA 4BY1J 1UHSA 3S2DJ 2L0KA 1MSEC 1RPWA 1DU6A 2XSDC 4V2FA 1ZKGA 3MVPA 2COBA 1ETOA 2KT0A 2DA2A 5F08A 2EZHA 2TCTA 3LNQA 2JA6J 3QPLA 3TP3A 4A3LJ 3HOXJ 1JJ8C 3GTPJ 1VI0A 4M3BA 3RKQA 2K9QA 2Y9ZA 1U9NA 4DW6A 2DA6A 2Y31A 4DZPA 2E2JJ 2Y30A 4A3IJ 9ANTA 1CQTA 4M3EA 3I4NJ 4C2MJ 4A3CJ 3S15J 3JRFA 3JREA 2CUEA 5EDNA 2DA5A 3M3YJ 1GUUA 4CYCA 2YUSA 1H8AC 1ZR4A 3S1QJ 3DCFA 3H0GJ 4GFBA 3S16J 3ZQFA 1JTXA 3JRAA 4D5FA 1EF4A 1IDYA 1ZGWA 3BTLA 1D5YA 3ZQCA 2Y2ZA 3G1MA 1JTYA 4I6ZA 1PUFA 2JMWA 1WCMJ 1B8IA 4JX5A 3GTMJ 4HNVA 5FLVA 2EZLA 5IYBJ 3HGGA 2CQQA 2JN6A 4AC0A 1JJ6C 2DA1A 3S1RJ 5JLXA 4IHXA 3TEDA 3GTJJ 2O8KA 2DA7A 1MBHA 3Q0WA 4BXXJ 3CQZJ 2GBYA 1ETVA 4BBSJ 1JGGA 3K7AJ 5J1YA 4FE4A 2LVSA 1VFCA 3JRDA 2R5ZB 2FJ1A 1E3OC 4M3DA 2IEKA 3PO2J 3H3VK 1TWGJ 2HI3A 5FJ8J 1W0TA 3LSRA 4B1RA 1NK2P 4W1UA 1BA5A 1XC5A 2JA7J 3HOWJ 4UUSA 2NS7A 2HOSA 4A3DJ 2M34A 2I10A 1JT6A 4DZJA 2NVQJ 3GTKJ 3B6AA 1FTZA 5F0HA 5IP7J 2XPVA 2PMZN 1ETYA 5EF6A 4IHVA 2VUMJ 5J3LA 1IC8A 4A3FJ 2XGCA 2EQRA 2DJNA 4AUXA 3BG5A 4A3EJ 3JRCA 1FIPA 3JRGA 2DMQA 3S2HJ 1I3QJ 5FLMJ 4MFDA 4QIWN 4RBOA 3HOUJ 2ECBA 3TP0A 5F04A 5EYRA 5E3OA 2R5YA 1A5JA 3WHBA 5GPCA 1HDDC 2XGEA 1JUSA 1ORKA 1ZTRA 5IOYA 1ZK8A 3RZOJ 2XB0X 1OFCX 3BQYA 1H89C 1AKHB 5EGOB 1AU7A 3BTIA 2FX0A 1JKPC 2X9DA 2MSYA 3HOZJ 3OSGA 2JA5J 3HM5A 5EG0B 3CMYA 1MSFC 5DTDA 3BR6A 5C3EJ 2MW8A 4I76A 4X6AJ 2NS8A 1TWFJ 1IRZA 1W0UA 3OIOA 2LLKA 4JX6A 1POGA 1QRYA 2R0QC 3QQAA 1IDZA 3L1PA 3FK7A 3BR3A 3I4MJ 3A01A 1LE8A 4XRMA 2B63J 2DA4A 1XS9A 3GTGJ 4IHYA 4QTRA 2G0EA 3IV5A 2E1OA 2M9HA 1WH7A 2GM4A 3S17J 5FKNA 4QSHA 2HDDA 1HOMA 3O8HA 1Y1VJ 3UKGA 1GV2A 1FIAA 1OCTC 2K40A 3FK6A 4XK4A 4XICA 3ZQLA 2NVYJ 2HXIA 3BT9A 1ZQ3P 1TWAJ 1F36A 1UG2A 2LFBA 2HXOA 3BG9A 3HOYJ 1RR7A 2ZB9A 3BR1A 3C2BA 3IH4A 3S1NJ 4LOCA 1XG1A 2OF7A 1B72B 1SFOJ 3BR0A 5IP9J 2WB1N 3SFIA 2R92J 3HKZN 3BG3A 1TWCJ 2JWTA 1K61A 2N8GA 2NVTJ 5F0FA 3QPSA 2EBIA 5GPAA 4JX4A 3O8GA 4JP0A 3ZQIA 2WAQN 1MH4A 1BW5A 4V2GA 2LD5A 3W6VA 1MBFA 3PO3J 3A02A 3LSPA 2LTPA 2K9SA 4Y52J 2EH3A 4A69C 1BJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M J;  1X2N A;  2QF7 A;  4A3M J;  5C44 J;  2LR8 A;  3HBL A;  4FE7 A;  1WH5 A;  3VPR A;  5K7H A;  1MBK A;  3TW7 A;  3RZD J;  4MO7 A;  1IGN A;  5E3M A;  1OCP A;  5E3L A;  1RET A;  4M6V A;  1GT0 C;  1GV5 A;  5IYC J;  3BQZ A;  1ZR2 A;  3ZQH A;  1UMQ A;  4C3I J;  1HCR A;  1VND A;  4ABZ A;  4A3J J;  1S7E A;  4DYR A;  4C3H J;  1ENH A;  2XGD A;  4MLO A;  2RAE A;  5IOZ A;  3F0C A;  3LSG A;  5M3M J;  1MNM C;  4MIM A;  4IEJ A;  4EEF G;  4CYC B;  2LP0 A;  1HDP A;  1QVT A;  3MN2 A;  3OOU A;  1RKT A;  3GTL J;  1O4X A;  5IYD J;  1K83 J;  2L7M P;  5F27 A;  1JT0 A;  3A03 A;  1P7I A;  2DMP A;  3JR9 A;  2W48 A;  2X48 A;  3D1N I;  1MH3 A;  3PM1 A;  5JLW A;  3GTQ J;  3HOV J;  5M5Y J;  1Y1W J;  3FIS A;  2HOA A;  1T56 A;  3OSF A;  2EZK A;  4D7M A;  2H1K A;  3FKI J;  1PUF B;  3BR5 A;  1IUF A;  1B8I B;  3BTC A;  2M0C A;  5EZG A;  2VKV A;  1Q1V A;  1P7J A;  4A3G J;  1NTC A;  2LK2 A;  2E2H J;  1Z77 A;  2GLO A;  2DMN A;  1MBJ A;  3JRB A;  5E3N A;  5C4X J;  5FKK A;  4BKX A;  1FJL A;  2L9R A;  2CUF A;  1JKO C;  1DU0 A;  2VI6 A;  1FTT A;  1WI3 A;  3ZOB A;  4XID A;  2IAI A;  4A3B J;  4MFE A;  2X6O A;  1I6H J;  2R5Z A;  4A3K J;  2FQ4 A;  1JKQ C;  1TWH J;  2Y9Y A;  4UUS B;  1X2M A;  1NK3 P;  4FTH A;  1WPK A;  1BW6 A;  3G1O A;  3BTJ A;  2MGQ A;  2AO9 A;  1ITY A;  2QCO A;  2KDZ A;  5FKO A;  3WHC A;  1BL0 A;  5IPA A;  3NAR A;  3GTO J;  4X1E A;  3TW6 A;  3HGY A;  1IV6 A;  4L5E A;  2E19 A;  5K7Z A;  4FCY A;  2H8R A;  2ID6 A;  1RES A;  2XB5 A;  4NDL A;  5IP6 A;  5DS9 A;  2O7O A;  4AYB N;  2HYJ A;  2VPR A;  2R5Y B;  2TRT A;  3HEF A;  1I50 J;  3MKL A;  2CRG A;  1MBE A;  2CJJ A;  1ETQ A;  3LSJ A;  4XRS A;  1ETX A;  5J1U A;  1APL C;  1GDT A;  1G2H A;  2JK3 A;  2ME6 A;  3SDG A;  1IJW C;  3E7L A;  2XPU A;  2HQ5 A;  4XRS G;  3ZQG A;  4BBR J;  2WV1 A;  2M2E A;  4FIS A;  1F43 A;  2VKE A;  4UUT A;  5EEA A;  3Q3S A;  1R9T J;  3B6C A;  2L7F P;  2K9N A;  4M3F A;  2ELK A;  1AKH A;  5EGO A;  4D7N A;  1YRN A;  2YU9 J;  2D5V A;  1GVD A;  4JYK A;  2DA3 A;  4W97 A;  5EG0 A;  1QPI A;  5HOD A;  3NAU A;  5FKL A;  2OPT A;  3FIW A;  2AHQ A;  3JRH A;  3DEW A;  1JKR C;  2DN0 A;  3RQI A;  5GP9 A;  1Z0X A;  1X58 A;  2DMT A;  3A01 B;  1T33 A;  4B3A A;  1LE8 B;  2HOT A;  3M4O J;  1TC3 C;  3IH2 A;  3JRI A;  2MG4 A;  3SJM A;  4S0H B;  1ETW A;  5FKM A;  3LOC A;  1MBG A;  1RKW A;  2R93 J;  2ME0 A;  2ID3 A;  1A6I A;  3CDL A;  5F1J A;  2NOG A;  1JUM A;  1U78 A;  4G12 A;  2YS9 A;  4Y7N J;  2O9L A;  3Q0V A;  3GBG A;  3S14 J;  2JA8 J;  3IH3 A;  4RDU A;  5F0C A;  5J1R A;  2E2I J;  5EZH A;  4C3J J;  5M5X J;  1U8B A;  4IHW A;  4DYQ A;  2JJ7 A;  1WGX A;  4J19 A;  3CCY A;  1SAN A;  1QVU A;  2R7Z J;  2CU7 A;  1OJL A;  1LFB A;  2EZI A;  2L7Z A;  1LFU P;  2P81 A;  4A93 J;  2DMU A;  3K2A A;  2DTZ A;  2LKX A;  4B4C A;  2Y0S N;  5BNG A;  4DYC A;  4BY7 J;  1B72 A;  2CQX A;  2NVX J;  1HF0 A;  1HLV A;  3G1L A;  5K7F A;  5C4J J;  5M3F J;  2LY9 A;  3HDD A;  4M3G A;  2IBD A;  2FD5 A;  1JUP A;  3BR2 A;  2ECC A;  3Q0U A;  2XPW A;  1VF9 A;  1H88 C;  3HB9 A;  5M5W J;  1U9O A;  1AHD P;  1ETK A;  1FEX A;  2XRL A;  1YRN B;  2M8G X;  1IG7 A;  4D5C A;  4BY1 J;  1UHS A;  3S2D J;  2L0K A;  1MSE C;  1RPW A;  1DU6 A;  2XSD C;  4V2F A;  1ZKG A;  3MVP A;  2COB A;  1ETO A;  2KT0 A;  2DA2 A;  5F08 A;  2EZH A;  2TCT A;  3LNQ A;  2JA6 J;  3QPL A;  3TP3 A;  4A3L J;  3HOX J;  1JJ8 C;  3GTP J;  1VI0 A;  4M3B A;  3RKQ A;  2K9Q A;  2Y9Z A;  1U9N A;  4DW6 A;  2DA6 A;  2Y31 A;  4DZP A;  2E2J J;  2Y30 A;  4A3I J;  9ANT A;  1CQT A;  4M3E A;  3I4N J;  4C2M J;  4A3C J;  3S15 J;  3JRF A;  3JRE A;  2CUE A;  5EDN A;  2DA5 A;  3M3Y J;  1GUU A;  4CYC A;  2YUS A;  1H8A C;  1ZR4 A;  3S1Q J;  3DCF A;  3H0G J;  4GFB A;  3S16 J;  3ZQF A;  1JTX A;  3JRA A;  4D5F A;  1EF4 A;  1IDY A;  1ZGW A;  3BTL A;  1D5Y A;  3ZQC A;  2Y2Z A;  3G1M A;  1JTY A;  4I6Z A;  1PUF A;  2JMW A;  1WCM J;  1B8I A;  4JX5 A;  3GTM J;  4HNV A;  5FLV A;  2EZL A;  5IYB J;  3HGG A;  2CQQ A;  2JN6 A;  4AC0 A;  1JJ6 C;  2DA1 A;  3S1R J;  5JLX A;  4IHX A;  3TED A;  3GTJ J;  2O8K A;  2DA7 A;  1MBH A;  3Q0W A;  4BXX J;  3CQZ J;  2GBY A;  1ETV A;  4BBS J;  1JGG A;  3K7A J;  5J1Y A;  4FE4 A;  2LVS A;  1VFC A;  3JRD A;  2R5Z B;  2FJ1 A;  1E3O C;  4M3D A;  2IEK A;  3PO2 J;  3H3V K;  1TWG J;  2HI3 A;  5FJ8 J;  1W0T A;  3LSR A;  4B1R A;  1NK2 P;  4W1U A;  1BA5 A;  1XC5 A;  2JA7 J;  3HOW J;  4UUS A;  2NS7 A;  2HOS A;  4A3D J;  2M34 A;  2I10 A;  1JT6 A;  4DZJ A;  2NVQ J;  3GTK J;  3B6A A;  1FTZ A;  5F0H A;  5IP7 J;  2XPV A;  2PMZ N;  1ETY A;  5EF6 A;  4IHV A;  2VUM J;  5J3L A;  1IC8 A;  4A3F J;  2XGC A;  2EQR A;  2DJN A;  4AUX A;  3BG5 A;  4A3E J;  3JRC A;  1FIP A;  3JRG A;  2DMQ A;  3S2H J;  1I3Q J;  5FLM J;  4MFD A;  4QIW N;  4RBO A;  3HOU J;  2ECB A;  3TP0 A;  5F04 A;  5EYR A;  5E3O A;  2R5Y A;  1A5J A;  3WHB A;  5GPC A;  1HDD C;  2XGE A;  1JUS A;  1ORK A;  1ZTR A;  5IOY A;  1ZK8 A;  3RZO J;  2XB0 X;  1OFC X;  3BQY A;  1H89 C;  1AKH B;  5EGO B;  1AU7 A;  3BTI A;  2FX0 A;  1JKP C;  2X9D A;  2MSY A;  3HOZ J;  3OSG A;  2JA5 J;  3HM5 A;  5EG0 B;  3CMY A;  1MSF C;  5DTD A;  3BR6 A;  5C3E J;  2MW8 A;  4I76 A;  4X6A J;  2NS8 A;  1TWF J;  1IRZ A;  1W0U A;  3OIO A;  2LLK A;  4JX6 A;  1POG A;  1QRY A;  2R0Q C;  3QQA A;  1IDZ A;  3L1P A;  3FK7 A;  3BR3 A;  3I4M J;  3A01 A;  1LE8 A;  4XRM A;  2B63 J;  2DA4 A;  1XS9 A;  3GTG J;  4IHY A;  4QTR A;  2G0E A;  3IV5 A;  2E1O A;  2M9H A;  1WH7 A;  2GM4 A;  3S17 J;  5FKN A;  4QSH A;  2HDD A;  1HOM A;  3O8H A;  1Y1V J;  3UKG A;  1GV2 A;  1FIA A;  1OCT C;  2K40 A;  3FK6 A;  4XK4 A;  4XIC A;  3ZQL A;  2NVY J;  2HXI A;  3BT9 A;  1ZQ3 P;  1TWA J;  1F36 A;  1UG2 A;  2LFB A;  2HXO A;  3BG9 A;  3HOY J;  1RR7 A;  2ZB9 A;  3BR1 A;  3C2B A;  3IH4 A;  3S1N J;  4LOC A;  1XG1 A;  2OF7 A;  1B72 B;  1SFO J;  3BR0 A;  5IP9 J;  2WB1 N;  3SFI A;  2R92 J;  3HKZ N;  3BG3 A;  1TWC J;  2JWT A;  1K61 A;  2N8G A;  2NVT J;  5F0F A;  3QPS A;  2EBI A;  5GPA A;  4JX4 A;  3O8G A;  4JP0 A;  3ZQI A;  2WAQ N;  1MH4 A;  1BW5 A;  4V2G A;  2LD5 A;  3W6V A;  1MBF A;  3PO3 J;  3A02 A;  3LSP A;  2LTP A;  2K9S A;  4Y52 J;  2EH3 A;  4A69 C;  1BJZ A; 
#chains in the Genus database with same CATH topology
 2XRO A;  3R60 A;  1X2N A;  2QF7 A;  3ZN1 A;  5C44 J;  3DP7 A;  4EGY A;  1WH5 A;  2DK8 A;  3EYI A;  4A2U A;  1LVK A;  3KP7 A;  4Q4Z F;  2DFE A;  1QZZ A;  2X1C A;  4MO7 A;  4Q47 A;  5AIP A;  3VSL A;  4ENM A;  4Z2Y A;  4M6V A;  3SZG A;  3O2P E;  5IYC J;  2DQL A;  2ZJP F;  2X6W A;  1T95 A;  3W3C A;  1VQ5 I;  2BXZ A;  4XOR A;  1VND A;  2DBB A;  1ENH A;  5IOZ A;  2RAE A;  3KFW X;  2Z9O A;  1TT0 A;  3KP4 A;  1MJB A;  1YJW I;  4MIM A;  2DYS H;  4BDZ A;  2DOF A;  3WTY C;  1K83 J;  1ON2 A;  1ZN2 A;  3A03 A;  4ZYG A;  1SVL A;  1XGN A;  2M1B A;  4EJW A;  4OU0 A;  4N4O B;  3BY6 A;  1NHA A;  4CHU A;  3FM5 A;  2G9W A;  3FIS A;  3GME A;  3RKX A;  2W00 A;  3WGG A;  3I5U A;  2WAE A;  1T6S A;  1QZY A;  2CW7 A;  2KJC A;  3SQN A;  1XSV A;  1IUF A;  3MZY A;  2O6G E;  3QP5 A;  5EZG A;  5KCM A;  4XLF A;  3Q9S A;  4PDK A;  4WXD A;  2HWV A;  2R7S A;  1YLF A;  1T0F C;  2GLO A;  2L4A A;  2F4M B;  2M87 A;  3A2K A;  1MBJ A;  4IQ4 A;  4M71 A;  1O3T A;  1SMY F;  2K7L A;  2LKS A;  1TP4 A;  1LDJ A;  2CW8 A;  4BKX A;  1G6N A;  2L9R A;  4UVB A;  1LFP A;  5J8C A;  2CUF A;  1G3W A;  3RPU D;  3QYE A;  4XID A;  4NHJ A;  1ACI A;  3J7A O;  4HNT A;  4HQE A;  3GFI A;  4EVI A;  1S6L A;  3LSI A;  4BJ5 C;  4L0Y B;  2JVH A;  3AL0 B;  2R5Z A;  3F72 A;  4R79 A;  5FRN A;  2LYC A;  3HC7 A;  4O5V A;  4U88 A;  2VKD A;  3GWZ A;  1IF1 A;  3OR2 C;  3S8P A;  5TGT A;  3WOD F;  1MGT A;  2RNJ A;  5HLH A;  4AWX B;  2L9V A;  1BW6 A;  3PFY A;  3A0B C;  3G1O A;  3BTJ A;  3RPU A;  4MGR A;  2PJR A;  2DT7 B;  4V19 K;  1ITY A;  1WZ2 A;  4UVA A;  3GXO A;  4X1E A;  4G6D A;  2ID6 A;  1V3F A;  3F23 A;  2DOD A;  3G4S I;  1OPC A;  2VE8 A;  4ZH4 F;  2IS4 A;  3DPL C;  2PBI A;  5B1A H;  1DQU A;  4ESJ A;  4OIP F;  2D1V A;  1N78 A;  3ONQ A;  3GZN B;  2DYR H;  3KEO A;  1G8X A;  1MBE A;  1ETQ A;  2OV7 A;  1XD7 A;  2V1X A;  1SFX A;  3FXJ A;  3MEX A;  3ZP5 A;  2JK3 A;  1PUE E;  3ESW B;  2XPU A;  2HQ5 A;  3ZQG A;  3AG3 H;  1XN7 A;  2M2E A;  4FIS A;  1MMG A;  1F43 A;  2LH9 A;  1FYL A;  5EEA A;  4C9Y A;  1G3S A;  1ZLJ A;  1FOY A;  3B6C A;  1KGS A;  2KIF A;  2K9N A;  1YX5 A;  4B44 A;  3VB2 A;  1P4X A;  2DDB A;  3CP2 A;  2YU9 J;  4XR6 A;  1ULY A;  5HOD A;  5FKL A;  2OPT A;  2MC4 A;  3P9K A;  4PGG A;  3JRH A;  3DEW A;  2AQE A;  3M9A A;  2NRA C;  3PQJ A;  2QKM B;  3F21 A;  5ED4 A;  3ZXS A;  4WXH A;  2WV0 A;  3RQI A;  2M5W A;  2DI3 A;  2MFZ A;  1FPQ A;  2WTE A;  4HZF A;  4JK1 X;  3JRI A;  2STT A;  5J4V A;  2JPB A;  2GOX B;  2KRH A;  2KZV A;  3IC7 A;  1ETW A;  4QWQ A;  2PJP A;  2KIQ A;  4I7H A;  1WJB A;  3R4K A;  4LFU A;  3RJP A;  2R93 J;  5ICC A;  1A6I A;  2IGO A;  4TV7 A;  1Z7L A;  4OIO F;  2QQA A;  3CZ6 A;  4HF0 A;  5EJC A;  1OYI A;  5F1J A;  4XN3 A;  2B7E A;  3ELK A;  4U0W A;  3K4C A;  1QQI A;  5D8L B;  2YS9 A;  2GA2 A;  3K70 C;  5F0C A;  5LFA A;  5J1R A;  3CO7 C;  1R5I D;  4RGX A;  1WJ5 A;  2ZJR F;  4Y15 A;  2JJ7 A;  2X85 A;  1WGX A;  4UB6 C;  2A07 F;  5GTI C;  4J19 A;  3CCY A;  3K4J A;  1LFU P;  1LFB A;  2L7Z A;  3WTW C;  1X1C A;  1KQ9 A;  3LSH A;  3K4M A;  4A93 J;  3OS0 A;  3GFJ A;  1SVO A;  3K4N A;  1B72 A;  2CQX A;  4EAT A;  4HV5 A;  1X1A A;  4WCG A;  3LWF A;  4KA4 A;  4YFN F;  3BPV A;  3ERE D;  1VQK I;  2M7B A;  2IBD A;  3TBI A;  2W7N A;  2ECC A;  2E1N A;  1VF9 A;  3HB9 A;  3TO7 A;  1X1B A;  2BGC A;  3LMM A;  3F8N A;  3OR1 C;  5LEJ A;  2M8G X;  1OCO H;  4ON0 A;  3S2D J;  2M30 A;  2QUF A;  3I64 A;  3QAH A;  4CO8 A;  1ZKG A;  3MVP A;  3WTZ A;  3CCS I;  1KON A;  4M74 A;  3TDZ C;  1YW7 A;  1E3H A;  2CV2 A;  3LNQ A;  1GLN A;  3E3V A;  4A3L J;  3HJE A;  1VI0 A;  2IJL A;  2RV8 A;  2F5D A;  1H0M A;  1WHU A;  3OYN A;  4EQQ A;  2DA6 A;  2F5F A;  2Y30 A;  4BQO A;  3KYL A;  2CUZ A;  4HV6 A;  4RAZ A;  4KIB A;  3MKW B;  2JRT A;  3BZ6 A;  2MH2 A;  2VQL A;  3QU3 A;  4M72 A;  3S15 J;  3ZRG A;  4A3C J;  1Z3X A;  3HPH A;  2FBH A;  3FXK A;  2YU3 A;  3RYR A;  5KAI C;  2V1D A;  1SD4 A;  4YEL A;  3FDY A;  2RRE A;  1OR7 A;  2RC4 A;  4XSX F;  1JTX A;  1V4R A;  2EIN H;  1JGS A;  2ESN A;  4D5F A;  1EF4 A;  1IDY A;  1B1B A;  2ZXW H;  3BP8 A;  4A0Y A;  3ZQC A;  2IVM A;  3H1C A;  3V8L A;  3C18 A;  3LAP A;  4ZTF A;  1KU3 A;  2FBK A;  1ON1 A;  1W7P B;  1JTY A;  5B66 C;  1PUF A;  1YIO A;  5JI6 A;  3KX2 A;  5FFZ A;  5FLV A;  1AA7 A;  3ABM H;  1J59 A;  3KZZ A;  4G6T B;  3K6G A;  2ZXJ A;  1A6Q A;  4C30 A;  5GAE J;  1D0X A;  4OMZ A;  3S1R J;  1S72 I;  5JHU A;  2V9V A;  5CYV A;  1KZH A;  2K3P A;  4BXX J;  2GBY A;  3RKY A;  3N97 A;  3Q5F A;  1JGG A;  4BJ6 C;  5J1Y A;  1CF7 A;  4I02 A;  3M8J A;  5CQE A;  1D8K A;  4FE4 A;  1K4S A;  2HPM A;  3BOQ A;  4RM2 A;  4XQF A;  2GXA A;  1KU7 A;  3QU6 A;  1PDN C;  4A12 A;  3H3V K;  1U5T A;  4AIK A;  5FJ8 J;  1W0T A;  3BCB A;  1ZHF A;  3KP3 A;  2V1N A;  3E5U A;  2LNB A;  2ZJQ F;  1L0O C;  1RZ4 A;  3ABT A;  3WG7 H;  3NEU A;  4UUS A;  3K4K A;  2NS7 A;  2A61 A;  3VEP A;  2HOS A;  1Z91 A;  4KT6 A;  2M34 A;  1FMV A;  1BR4 A;  1G59 A;  1FTZ A;  2AXL A;  3ZMZ A;  2PMZ N;  4PJN A;  4IHV A;  1FBU A;  1TLH B;  1EKE A;  3ABL H;  5LEK A;  4CDG A;  2L01 A;  2EQR A;  3O3K A;  4H4K C;  1K78 A;  1EH6 A;  2CQ7 A;  3BG5 A;  2Q2E A;  4PJ0 C;  4G6Q A;  2ZME B;  2R7Q A;  3CCE I;  3H5R A;  3V8K A;  3M8E A;  5FLM J;  3CCQ I;  3ABU A;  2DFI A;  1FX7 A;  2BW3 B;  2WWY A;  5H6Q A;  5E3O A;  2R5Y A;  1KU9 A;  2CFX A;  2IA2 A;  2Z2S B;  3KEQ A;  3PFI A;  2CGP A;  3T1B A;  4UVC A;  3DTE A;  5ILU A;  1RUO A;  4L5J A;  2ICW G;  1GXQ A;  3DBH B;  1ZK8 A;  2OAZ A;  1BC8 C;  2VBZ A;  3ML6 A;  5H20 A;  1IW7 F;  1DPR A;  5EGO B;  1AU7 A;  1Z1D A;  4OIN F;  5LRS A;  1JKP C;  2MSY A;  2JA5 J;  2FE3 A;  5TRD A;  3KIO A;  3EET A;  2ZO4 A;  1TWF J;  4NC7 A;  1IRZ A;  4PFP A;  4I99 C;  4HDU A;  2HTS A;  2VBY A;  3DU5 A;  1ONV A;  3FK7 A;  2P6S A;  3A01 A;  2PMU A;  1LE8 A;  1T0F A;  2OC6 A;  1IN8 A;  2FBI A;  1HKS A;  2DA4 A;  3OIP A;  4QTR A;  2OU2 A;  2M9H A;  1B9N A;  1MD0 A;  4PJM A;  2GM4 A;  1D1C A;  2KMU A;  3BZC A;  4BE0 A;  3GFL A;  4QSH A;  2UXX A;  1QZE A;  2K02 A;  3ECH A;  3O8H A;  4MQ9 F;  1Y1V J;  2QM3 A;  1JXS A;  3HXL A;  1FIA A;  2CYY A;  4PSW A;  3CUQ B;  2CQN A;  4RB2 C;  2K86 A;  3COA C;  2HXI A;  3VYT B;  2Y75 A;  1ZQ3 P;  1X4O A;  2X4H A;  4LG0 B;  1UG2 A;  1R5G A;  4HSR A;  2HXO A;  2ZB9 A;  3IH4 A;  4BHP A;  1RC9 A;  3WTT C;  3G6E I;  3HRS A;  2MC3 A;  2OF7 A;  3C2H A;  3WU2 C;  1SFO J;  3C7J A;  4BEH A;  4CUG A;  3K2Z A;  4F7Z A;  5ILS A;  2Y48 A;  1TWC J;  2QWW A;  4P1W A;  3DXJ F;  3WGI A;  3D5R C;  4YFK F;  2ELJ A;  2A6H F;  3L2U A;  2L3D A;  1SEU A;  3DKX A;  1JHF A;  4H0E A;  3AAF A;  4B09 A;  3HKZ A;  3EUH C;  4I98 B;  3RDI A;  5GAH J;  5E8G A;  4OWR B;  1BW5 A;  3C3W A;  4KUM A;  1LKX A;  1MBF A;  3VYS B;  4IPA A;  2EPF A;  1LQ1 A;  4B47 A;  3OYF A;  3LSP A;  2VON A;  3LSK A;  2F4O B;  2NAZ A;  1TNS A;  3H36 A;  2ESH A;  1UG0 A;  4Y52 J;  4IHX A;  1FYM A;  2LR8 A;  3Q9V A;  5DUI A;  2ZXH A;  5K7H A;  3RZD J;  3DKY A;  2H94 A;  2BBY A;  2R7T A;  1IGN A;  4KJZ A;  1TQP A;  5E3M A;  4HBL A;  2JA2 A;  4LB6 B;  5L3D A;  5KVR A;  1GT0 C;  5BQT A;  4XLP F;  2FQ3 A;  2VT2 A;  3K0L A;  2IP2 A;  1W5T A;  4A3J J;  4FT8 A;  1S7E A;  4A6D A;  2XGD A;  5M3M J;  3K4B A;  4OAZ A;  3F0C A;  5D5V B;  2OTL I;  1STZ A;  2H6B A;  4AM3 A;  4IEJ A;  2BEO A;  2M8E A;  3HIF A;  3PNY A;  2LP0 A;  1HDP A;  3MN2 A;  4CYC B;  1RKT A;  1TQM A;  5CVR A;  2DLL A;  2JSC A;  5IYD J;  2L7M P;  1SD5 A;  4WF2 A;  4N9I A;  2PG4 A;  4U7B A;  3D1N I;  3PM1 A;  5JLW A;  4XL9 A;  2CV1 A;  3GTQ J;  2EA2 A;  3QRF F;  1Y1W J;  2HOA A;  5DYM A;  4B8X A;  1B59 A;  4IVN A;  1T56 A;  1Z9C A;  3PNV A;  3GLX A;  3GZ6 A;  2L02 A;  2EZK A;  2HPI A;  3FKI J;  1QO0 D;  4Z6Y A;  1B8I B;  3DTK A;  3P9I A;  3GFM A;  2Y69 H;  3WG9 A;  1K6O A;  4ETS A;  3UR3 C;  1Q1V A;  4IX7 A;  4ESB A;  3GCM A;  2R7W A;  2E2H J;  1Z77 A;  2QSF X;  4KT5 C;  3V8J A;  1XPX A;  2LBF B;  1LUJ B;  2WAF A;  3B02 A;  1Y0U A;  3EQL F;  4KMU X;  2Y0S A;  3RPQ A;  2J5P A;  2LY1 A;  3ZN0 A;  1RI7 A;  3CME I;  3N4M A;  4G9Y A;  1YO5 C;  5LHH A;  1WKM A;  2VI6 A;  3CLQ A;  1FTT A;  1CGP A;  2VPL A;  1FMW A;  3J7Y J;  2IAI A;  4A3B J;  3FXQ A;  5HLI A;  2X6O A;  3A1Y A;  5BOX A;  1XSX A;  4HA8 A;  4HDV A;  5CVU A;  1IRX A;  2XDV A;  4KN7 X;  2OCE A;  2JPC A;  3P7N A;  3E0J B;  1R1U A;  4FTH A;  1Y39 A;  1X1D A;  4I0A A;  1ZRD A;  4XON A;  2NYX A;  2NNY A;  3KLO A;  3IKT A;  3ASN H;  3TKY A;  3DQV C;  4KIC A;  2HU9 A;  2AO9 A;  3FMR A;  2HZD A;  2BHZ A;  2QCO A;  3F8M A;  1T38 A;  1SMT A;  2COM A;  1MDM B;  4K2E A;  1Y0N A;  3NAR A;  4YG2 F;  4ZYH A;  3GTO J;  3HGY A;  3V7C A;  4G7H F;  2QVO A;  4LMY A;  2EFP A;  2E19 A;  2H8R A;  3KET A;  3CP8 A;  5DS9 A;  3OS2 A;  1VZ0 A;  2HYJ A;  4C2U A;  3OYG A;  2QA4 I;  4KIF A;  1IV8 A;  3HEF A;  1I50 J;  3MKL A;  4IRH A;  1D8J A;  2CJJ A;  3LSJ A;  4B43 A;  4ANJ A;  5J1U A;  2Y0M A;  1GDT A;  1G2H A;  5ICG A;  4RGR A;  1BI1 A;  3C1D A;  3LFK A;  3SDG A;  1IJW C;  4XRS G;  2HYF A;  2QEX I;  1J0R A;  2ACJ A;  5IT9 K;  4UUT A;  5FD5 A;  1VQL I;  4UB8 C;  5HS8 A;  4MQV A;  4HAM A;  3IL2 A;  1R9T J;  2DQR A;  2L7F P;  3WU0 A;  2L54 A;  4YIR X;  1AKH A;  2XVC A;  4XLN F;  5CVI A;  2FOK A;  4D7N A;  2K3F A;  1YRN A;  2XF7 A;  2D5V A;  4W97 A;  2Q1Z B;  1QPM A;  1QPI A;  4ZDO A;  3T8R A;  4GYI A;  3FIW A;  3EUK L;  1UEL B;  3MFK A;  1XGM A;  3FBN B;  5FLX K;  1YS7 A;  1MZB A;  4RLQ A;  3ROU A;  1Z67 A;  5GP9 A;  5E8I A;  1VTN C;  1X58 A;  2HQA A;  2DMT A;  2HOT A;  4B3A A;  2P7C B;  3M4O J;  5HLG A;  3IH2 A;  1T98 A;  3RIR A;  5JVT A;  3SJM A;  2IS6 A;  3KCC A;  4S0H B;  2DU9 A;  4D0P A;  5BS6 A;  1OYW A;  3LOC A;  1RKW A;  3HSE A;  4KIG A;  3CDL A;  3KLN A;  1JUM A;  1U78 A;  3QWL A;  3H9Q A;  2QBY A;  4IRI A;  4Y7N J;  3H5N A;  5CJ9 A;  3GBG A;  3WTU C;  3S14 J;  4I0B A;  3IH3 A;  4RDU A;  4X0G A;  1X4P A;  3CCL I;  2E2I J;  5EZH A;  2FOW A;  2EFO A;  1BN5 A;  1OIS A;  3K1N A;  3KPH A;  4A6E A;  3IWZ A;  3FHN A;  2JQ7 A;  2W24 A;  1IXC A;  1X3Z B;  3BRO A;  2UZK A;  4RB1 A;  4LGW A;  1HW5 A;  4HG2 A;  1OJL A;  2EZI A;  3FHZ A;  1P2F A;  2P81 A;  3MZ8 A;  2UUZ A;  2LKX A;  4DYC A;  2KDO A;  4NQW A;  2XAJ A;  2NVX J;  5HS9 A;  1OQY A;  2RDP A;  5ICF A;  2IT0 A;  2VOD A;  3M7G A;  3G1L A;  4E7L A;  1ERD A;  1MJA A;  4FX0 A;  2WC2 A;  2RVC A;  5L3E A;  5K5R A;  1B9M A;  3HDD A;  3H92 A;  3CO6 C;  1ZRC A;  2XPW A;  3W2V A;  1H88 C;  4UY8 I;  4I2O A;  2LSO A;  2Q8K A;  2EFW A;  3MMY B;  4O6J A;  1J2X A;  1MMA A;  2ZXI A;  2XRN A;  2JT1 A;  2DPU A;  1I27 A;  3LQR A;  3HOT A;  4WXC A;  4I01 A;  5BMZ A;  1HBX G;  4BY1 J;  2L0K A;  1FP1 D;  1FZP B;  3DU6 A;  3FMS A;  1O3R A;  1FT9 A;  1PVE A;  2Z5U A;  2TCT A;  5ERI A;  3MD2 A;  3ZMT A;  2EIL H;  4AIH A;  4OAY A;  1JJ8 C;  4DJA A;  3F8C A;  5A2Q Z;  5AON A;  2ZME C;  2PQ8 A;  1TT5 B;  3G3Z A;  4HX4 A;  2M0M A;  2QQB A;  3RKQ A;  3CC4 I;  1U9N A;  5L3C A;  2KHM A;  4ZDP A;  3CCM I;  2Y31 A;  3DFG A;  2VL8 A;  2E2J J;  5JHF A;  5FB2 A;  2FNA A;  3OWT A;  3WE3 A;  3SXY A;  5CVJ A;  1ZYR F;  2F5E A;  2GOM A;  3JRF A;  4GYG A;  4PJJ A;  2CUE A;  5EDN A;  4LD5 A;  5FRM A;  4Y4R A;  2DA5 A;  1GUU A;  5L3F A;  2HOE A;  1I6X A;  1H8A C;  1A36 A;  4BGD A;  3S1Q J;  3K9T A;  1USS A;  3DCF A;  3H0G J;  2QEN A;  4PGH A;  4GFB A;  2R7U A;  3CDH A;  3TO6 A;  1DGW Y;  4ZC3 A;  2HQR A;  4ITV A;  3KP6 A;  3S32 A;  3JRA A;  1N25 A;  1LNW A;  3RI4 A;  4XOP A;  4JOM A;  2Y2Z A;  3U21 A;  3G1M A;  2EH3 A;  1E0E A;  1KA8 A;  2JMW A;  1O3S A;  1WWX A;  3GTM J;  3IAS 2;  5CLS A;  4CCO A;  1G3T A;  4HST A;  5IYB J;  3ZCO A;  4F55 A;  1RIO H;  1X19 A;  5B5E C;  3JW4 A;  2XV4 S;  3ECO A;  5J8F A;  1JJ6 C;  2DA1 A;  2EIK H;  2F5C A;  3AG2 H;  4M6X A;  2WB1 A;  4Q48 A;  2O8K A;  5HS7 A;  1LDD A;  3JSP A;  1RR8 C;  3ZMD A;  5KNL A;  3CD6 I;  1FSH A;  3LAJ A;  1Y8Q B;  3K7A J;  1MMD A;  1O7L A;  1VFC A;  2R7X A;  4XKB A;  3BJO A;  1E3O C;  5BPD A;  3DLA A;  3CUQ C;  2HI3 A;  1Y56 A;  4HQM A;  1NK2 P;  3K1M A;  1BA5 A;  2A69 F;  2EFN A;  2W4S A;  2CG4 A;  3CTA A;  3TQN A;  3EUH A;  2STW A;  4FAS D;  2GXG A;  3V42 A;  3DPT A;  3AFH A;  3ASO H;  2BY0 A;  3J80 K;  4EGZ A;  3GTK J;  3B6A A;  5F0H A;  3RKW A;  4EJT A;  5LD2 C;  1ETY A;  2VUM J;  1ZRE A;  3WU1 B;  2HYG D;  5J3L A;  1SD7 A;  1HQC A;  3AG4 H;  4A3F J;  2VKH A;  1YS6 A;  3MKZ A;  2XGC A;  2CFO A;  4PZJ A;  2DOA A;  3J81 K;  1GXP A;  4AUX A;  2H27 A;  3F6V A;  3DBR B;  2DFH A;  2R7R A;  4HLY A;  3JRC A;  1FIP A;  1S8N A;  1I3Q J;  4ZDL A;  5AIQ A;  3HOU J;  4BQN A;  1QBJ A;  1J9I A;  2ECB A;  4M9Z A;  1UB9 A;  5EYR A;  1FWZ A;  1RRJ A;  2CMP A;  5D5X B;  4CCJ A;  1WJC A;  2JZY A;  2BE5 F;  2XGE A;  1ORK A;  1HKQ A;  5IOY A;  2VB6 A;  1W5C C;  3ZQQ A;  2DPD A;  1VQP I;  3ISP A;  3HHH A;  2L7K A;  5GAD J;  3F9K A;  3HOZ J;  1FLI A;  5EG0 B;  3CMY A;  4OIQ F;  1IN6 A;  2ELH A;  5DTD A;  5E17 F;  2MD0 A;  2RQQ A;  2XF6 A;  3OIO A;  4ESF A;  3R0J A;  3QQA A;  4KFC A;  4LLG F;  1R4N B;  2P6T A;  3VYR B;  3L1P A;  3BG6 A;  1SAX A;  1TBX A;  3I56 I;  4LLN A;  2KIS A;  3I9V 2;  2FMY A;  1PJR A;  5E1W A;  4BAC A;  3GTG J;  2UXN A;  3IV5 A;  2E1O A;  1WH7 A;  2Q0O A;  1I3A A;  5FKN A;  5DV5 A;  4PK4 A;  2IGK A;  1T08 B;  1S9H A;  1R4M B;  5HNF A;  3OY9 A;  3UKG A;  4U87 A;  2FA5 A;  1OCT C;  5DD8 A;  1G3Y A;  1ZAR A;  2P4W A;  4XK4 A;  4XIC A;  4NC6 A;  2NVY J;  5DCM B;  1EJ9 A;  3PIO F;  5EEG A;  1R22 A;  1TWA J;  5FD6 A;  2ISZ A;  2HDW A;  3M1C A;  1XDS A;  1IXS B;  2ETH A;  3F8F A;  3VFZ A;  1BC7 C;  1PYV A;  3CJQ B;  5DM7 F;  3QPT A;  4LOC A;  2XIG A;  2LMD A;  3BR0 A;  3C2G A;  2LF7 A;  3ZGK A;  1IRF A;  3HKZ N;  3JAM K;  1MIJ A;  4IL6 C;  1K61 A;  2L2O A;  4XMY A;  1BBY A;  4KMF A;  4L9V A;  1EA3 A;  2RKH A;  1S7A A;  2RN7 A;  1I1S A;  1UHM A;  2N8G A;  2PI0 A;  1K6Y A;  3OYE A;  3WGH A;  1Y6I A;  2NVT J;  1WFX A;  1DUX C;  1FOW A;  5GPA A;  2XAF A;  1MJ9 A;  3O8G A;  4QPQ A;  5B1B H;  4J01 A;  2WAQ N;  1MH4 A;  3OYC A;  4HOB A;  1IUY A;  1J7K A;  4V2G A;  4E7H A;  3GX4 X;  1J09 A;  4EM1 A;  5CKT A;  1U0J A;  1P4A A;  4WK8 F;  2LTP A;  2XUB A;  1D1B A;  2X6Y A;  4Y33 A;  4FE7 A;  1MBK A;  3TW7 A;  5HLT A;  1EV7 A;  1TW2 A;  5JFR A;  1YE9 A;  1WJE A;  1KYZ A;  3IRR A;  2P5V A;  1OCP A;  4P55 A;  5E3L A;  2ISY A;  4L0Z B;  1F9N A;  2CS3 A;  3BQZ A;  3FZV A;  2KKO A;  3QP6 A;  4ABZ A;  1RUN A;  3RYP A;  5DCF A;  4DYR A;  4MLO A;  3OS1 A;  3OIQ A;  4EEF G;  1QVT A;  3GTL J;  3OOU A;  1O4X A;  1W7P D;  1JT0 A;  3PUF A;  2VBW A;  4ASN A;  3KEY A;  1SFU A;  2EV5 A;  3JR9 A;  2W48 A;  4G8X A;  1P9Q C;  3L00 A;  5M5Y J;  4ENN A;  1YYV A;  3LQQ A;  4XKW A;  3K1P A;  1XTA A;  3VWB A;  4HRI A;  3CC2 I;  4D7M A;  1R1T A;  5L3B A;  2H1K A;  3WTS C;  1R36 A;  3F3X A;  4LIV A;  3GF2 A;  2VKV A;  2DW4 A;  2XHK A;  2VC0 A;  2IXS A;  1YQA A;  1W7P A;  2L9S A;  4P96 A;  4RAG A;  4A3G J;  2IS2 A;  2LK2 A;  3DPU A;  1FBS A;  2DMN A;  2EA4 A;  4IZZ A;  4BNC A;  1FJL A;  2DK5 A;  3HZJ A;  2FNP A;  3CCJ I;  3HG9 A;  5GAG J;  4IOC F;  1JKO C;  1UST A;  1B4A A;  1A04 A;  3GUD A;  1WI3 A;  3LSM A;  3AKZ A;  2XC7 A;  1R5H A;  3ZOB A;  2VE9 A;  2WA0 A;  1ZG3 A;  3G2B A;  4MFE A;  2VLA A;  2VBX A;  4L9T A;  2OZ6 A;  4F93 B;  1ZGJ A;  1I6H J;  2HZT A;  2XF5 A;  1FY7 A;  1V55 H;  2B0L A;  1JKQ C;  2UV1 A;  4CGZ A;  1S7O A;  1NK3 P;  2UWM A;  4XLC A;  3I0T A;  1BOA A;  2OQR A;  2R7F A;  3BZK A;  4FET A;  4P9U A;  4MHG A;  4S04 A;  1HW1 A;  2EB7 A;  1S3J A;  5IPA A;  2ZJ2 A;  2I8D A;  3PSI A;  1T39 A;  4IXA A;  3OYJ A;  3HUG B;  4L9J A;  1N75 A;  3E5Q A;  2W57 A;  4FHT A;  2XSJ C;  2Z1D A;  3K69 A;  4ZZD A;  2BVM A;  4KDP A;  2VAS A;  4L5E A;  3TO9 A;  5K7Z A;  1UCR A;  1OLT A;  1RES A;  2XB5 A;  2O7O A;  2IS1 A;  3BWG A;  3O6B B;  2ZME A;  3SHF A;  1T8I A;  4M9S A;  4XLE A;  1BI3 A;  2KRC A;  2TRT A;  4A5N A;  2CRG A;  2DFF A;  2M4G A;  1LB2 A;  2K9L A;  3JCU C;  5LHG A;  1N77 A;  3DBL B;  4ZYE A;  2BW3 A;  2QKL B;  3I59 B;  4KIT B;  1APL C;  2HTJ A;  2AXT C;  3IUO A;  3MKY B;  3AL0 C;  3F22 A;  2V9P A;  4AYB A;  2E1M B;  4FQG A;  3CES A;  4CXF A;  2IA1 A;  2WV1 A;  4ZYD A;  3JSO A;  2TDX A;  2RNG A;  3KP2 A;  3Q3S A;  2OTJ I;  5LLQ A;  4CYD A;  1K7A A;  1YW9 A;  2CW0 F;  1WSU A;  3OYD A;  2K27 A;  5J40 A;  2XKO A;  5EGO A;  5LGN A;  1MW7 A;  4JQF A;  2BZT A;  2G7H A;  2DA3 A;  4DBQ A;  2KFD A;  3NAU A;  2LOO A;  2AHQ A;  2VOO A;  1ZRF A;  1PP8 F;  3OYL A;  4AVZ A;  1X3W B;  4MEY F;  3SZT A;  4RS8 A;  2XAS A;  5A2Q K;  4XM3 A;  4WX9 A;  2R3S A;  4EMS A;  4HNU A;  4KNY A;  4BL0 B;  4E7K A;  2NNN A;  2JRM A;  2ME0 A;  2O8X A;  2VJ4 A;  3FXU A;  4Y3O A;  4UV8 A;  4RA2 A;  1E2X A;  2FF4 A;  2NOG A;  3K70 D;  2KIM A;  1Y8R B;  4G12 A;  3H3U A;  3W2A A;  3GYH X;  2X1E A;  4BE2 A;  2O9L A;  4LB5 A;  1HXD A;  2O0Y A;  2JA8 J;  4NUB A;  1NG6 A;  1QU3 A;  4C3J J;  1U8B A;  2IGN A;  2BY2 A;  3CUQ A;  4DYQ A;  1ZAO A;  4AVP A;  2ZSH B;  2OCC H;  3H3Z A;  1NH3 A;  3HSR A;  2MAB A;  1SAN A;  1QVU A;  3V7R A;  4LG0 A;  2CU7 A;  2O03 A;  4GRI A;  4E7I A;  1VQM I;  2DMU A;  2F4I A;  3E6B A;  2HDC A;  4LK1 F;  4B4C A;  2DTR A;  5BNG A;  2PMZ A;  1Z3Y A;  4RLF A;  1HF0 A;  1HLV A;  5D6F A;  3QPH A;  5K7F A;  5M3F J;  1QGP A;  2HFH A;  4M3G A;  2FD5 A;  2JSP A;  5FGM A;  1LJ9 A;  2HVQ A;  3Q0U A;  1T2K A;  4OMY A;  2DJI A;  3PJR A;  5M5W J;  1U9O A;  5EEH A;  1A31 A;  4AIJ A;  1TNT A;  1R71 A;  3GO5 A;  2LDU A;  2M4K A;  1W36 C;  2XRL A;  1WJF A;  1YRN B;  1IG7 A;  2DCE A;  5E1X A;  4BXU A;  4RAY A;  2G7U A;  2PEX A;  1KQ0 A;  2YPR A;  2L4M A;  3IWF A;  3W2W A;  3HTS B;  1U8R A;  2XSD C;  3F6O A;  1NG7 A;  1UHW A;  3K4L A;  4DQ2 A;  3IHU A;  2KT0 A;  2MA3 A;  2DA2 A;  4I09 A;  5HDK A;  5HDN A;  2JA6 J;  3TP3 A;  3GTP J;  2V1U A;  2C6Y A;  4XOT A;  1HC8 A;  2ADU A;  4F3Q A;  2FML A;  2GQQ A;  1TL8 A;  5H6R A;  1XX5 A;  1BJA A;  2K9Q A;  2V6E A;  1P6R A;  3ERM A;  4OIR F;  5FRO A;  3I55 I;  3IAM 2;  2NS0 A;  2E36 A;  2HR3 A;  4A3I J;  9ANT A;  2ZC2 A;  2QBY B;  1FP2 A;  2OZU A;  5DD4 A;  3I4N J;  2VN2 A;  3WTX C;  5FFX A;  2E5Z A;  4E7Z A;  3M3Y J;  4II3 A;  4CYC A;  2YUS A;  3V7S A;  1ZR4 A;  3HRM A;  4U0Y A;  3MZH A;  2V9K A;  3U9G A;  3L2V A;  3MCZ A;  2VT3 A;  2P7V B;  1VQ7 I;  3HL2 A;  4C2T A;  3IKV A;  1ZGW A;  5DUK A;  1LEA A;  3E6C C;  3HHG A;  1ODD A;  3FXO A;  1X3U A;  2VC1 A;  4NQW B;  1D5Y A;  1G4D A;  2H1L A;  2E71 A;  2VJJ A;  5D5W B;  3ZMS A;  5J6X A;  3VSK A;  2HKX A;  4I6Z A;  1B8I A;  1WCM J;  4Q5S F;  1IN4 A;  4JX5 A;  5K5O A;  4HNV A;  2LRD A;  3OOP A;  2WY8 Q;  2DO7 A;  3KYC B;  1OYY A;  5B3S H;  3HGG A;  1BOB A;  2CQQ A;  4DIQ A;  4RB3 C;  1V5E A;  2LKP A;  2JN6 A;  2F5V A;  4B3X A;  2E5N A;  4OOI A;  2IW5 A;  3GTJ J;  4ZZL A;  3MWM A;  1WJD A;  2FRH A;  3A4C A;  2DA7 A;  3Q0W A;  3SYT A;  3CQZ J;  4BBS J;  1YTY A;  3QYB A;  1QA6 A;  3SEQ A;  2DT6 A;  3JRD A;  2R5Z B;  3BDD A;  3GEZ A;  1D5V A;  1BIA A;  2FJ1 A;  4M3D A;  3PO2 J;  4D9J A;  1TWG J;  1I39 A;  3I4P A;  3J7Z I;  2QYO A;  3LSR A;  1I1G A;  3I53 A;  4BQA A;  1M1E B;  4W1U A;  1AOY A;  2VQC A;  1XC5 A;  3BC8 A;  2JA7 J;  4G7O F;  3D5S C;  3VYU B;  3HOW J;  3OV8 A;  3NQO A;  3H9J A;  4UHT A;  3HPG A;  3VOE A;  2PJR B;  3BG7 A;  4DGW B;  1FBQ A;  1JT6 A;  1HSJ A;  4DZJ A;  3CCV I;  2JUC A;  1HW2 A;  2ZFU A;  5IP7 J;  4BHB A;  3AG1 H;  4U7D A;  2XPV A;  5TJJ A;  1MDM A;  4LIU A;  3HRU A;  4BAY A;  1ZG5 A;  2XKP A;  1IC8 A;  2CO5 A;  2NVU B;  4AU7 A;  2F6C A;  3PNT A;  1HKT A;  4UXN A;  3JRG A;  3IP4 B;  4IRG A;  4YEJ A;  3S2H J;  3IRQ A;  4QIW N;  3GZ5 A;  1IN7 A;  4UV9 A;  3TP0 A;  2R7O A;  4BXF A;  4D1Q A;  2GA1 A;  4P9F A;  2CH0 A;  2NOJ B;  2O5R A;  5GPC A;  1VQO I;  1HDD C;  1JUS A;  5FO5 A;  1ZTR A;  3V4G A;  1JI8 A;  3S2W A;  4F91 B;  3RZO J;  2XB0 X;  2H09 A;  1OFC X;  3CUO A;  4P5O A;  2E7W A;  1FOX A;  4L5I A;  4PFO A;  5KK1 A;  2OBP A;  3FBI B;  2J5O A;  2FX0 A;  2KRF A;  2QLZ A;  2X9D A;  1O7F A;  2BYV E;  2P8T A;  3BJA A;  3HM5 A;  4QPO A;  1MSF C;  2KQR A;  2CV0 A;  3KE2 A;  5LRR A;  2E7X A;  2EIJ H;  3BR6 A;  2NS8 A;  2EV0 A;  1WQ2 A;  4GO1 A;  1I5Z A;  3QOD A;  3KZI C;  2R0Q C;  2KLO A;  1HST A;  3I4M J;  1D0Z A;  5LHI A;  2PFB A;  3LFU A;  4RM3 A;  3T8T A;  1XS9 A;  3FWE A;  1Q1H A;  4GGG A;  4IHY A;  1JHH A;  2LC2 A;  3U1D A;  1KU2 A;  4N0B A;  1XCV A;  2WAD A;  3S17 J;  4GXO A;  1R6R A;  3L2W A;  3DLL F;  2HDD A;  4RGS A;  1HOM A;  4RGU A;  2LG4 A;  1D1A A;  4BYY A;  1OCC H;  1UAA A;  1SVM A;  1OCR H;  2K40 A;  3OL3 A;  1MKM A;  2MYS A;  3OYH A;  1ZH5 A;  2W84 A;  3W6K B;  3BT9 A;  5JVG F;  2BOL A;  1TW3 A;  4PJL A;  1B6A A;  2LFB A;  3BG9 A;  4IHS A;  1RR7 A;  3C2B A;  3HOY J;  2PLY A;  4XNF A;  3GW2 A;  4NC8 A;  4CH7 A;  1UZC A;  1B72 B;  3SZP A;  1BM9 A;  2X51 A;  4N9H A;  5KHD A;  1E3P A;  3R0A A;  3SFI A;  2R92 J;  3BG3 A;  2Z99 A;  3CCR I;  1F4K A;  4L9N A;  4R1H A;  3CCU I;  2QSH X;  4MEX F;  3BPX A;  2KIU A;  4RB0 A;  2MBF A;  3H35 A;  3QPS A;  5F0F A;  4BH9 A;  2EBI A;  2E1C A;  3KYD B;  3M1E A;  2W25 A;  4YII A;  3S3O A;  4JX4 A;  4G94 A;  4JP0 A;  3ZR8 X;  2M7A A;  1DDN A;  2P0W A;  2QGU A;  2M45 A;  2LD5 A;  3W6V A;  3A02 A;  2VQG A;  1UJ8 A;  1OCZ H;  2K9M A;  1LDK B;  2ZFW A;  1DGR M;  2K9S A;  3FKJ A;  3CMA I;  3NWT A;  3GVA A;  1J5Y A;  1BJZ A;  2VXZ A;  3S1M J;  4A3M J;  1XGO A;  3HBL A;  3VPR A;  2PMH A;  4EJV A;  1RNL A;  2A05 A;  4IF4 A;  4M6Y A;  5DEQ A;  3H9G A;  5K1Y A;  3CC7 I;  1RET A;  1GV5 A;  5E18 F;  1ZR2 A;  1YG2 A;  3PIP F;  2A68 F;  2CSO A;  5ILV A;  3ZQH A;  1UMQ A;  4C3I J;  1HCR A;  3R61 A;  2HNH A;  4N4N B;  4C3H J;  4Y13 A;  1MNM C;  4CZC A;  3LSG A;  3CJN A;  4WWC A;  1XDU A;  3L2Q A;  5DDG A;  2LF8 A;  3CF5 F;  2E1M C;  2R4G A;  1YI2 I;  3DEE A;  5F27 A;  2W82 A;  2F2E A;  1P7I A;  2A6E F;  2DMP A;  4MTE A;  5F64 A;  2K4J A;  5HVQ C;  2X48 A;  1MH3 A;  3HOV J;  4HW0 A;  2IRF G;  1MND A;  3EYY A;  3S93 A;  3OSF A;  2VJ5 A;  1EH7 A;  4XBF A;  4DNC A;  4XN0 A;  1BR2 A;  1U3E M;  1DP7 P;  1PUF B;  3BR5 A;  2GAU A;  2DOE A;  2DDA A;  2M0C A;  3BTC A;  2ZSI B;  3ZPL A;  1P7J A;  1QHH D;  2GZW A;  1NTC A;  3HOS A;  1U6G A;  4BS9 A;  1IRG A;  3CJR B;  4CZZ A;  1FC3 A;  1QNT A;  4XKC A;  3JRB A;  5DM6 F;  5E3N A;  3ULQ B;  5C4X J;  5FKK A;  1H9G A;  4M73 A;  1W36 D;  2JTV A;  3WTV C;  1CF7 B;  1AWC A;  2PN6 A;  1DU0 A;  2O3F A;  5IT9 Z;  1MNE A;  1VQ6 I;  1U5T B;  2K85 A;  1KYW A;  3QYF A;  1YHQ I;  4A3K J;  3L7W A;  2FQ4 A;  4LIT A;  1TWH J;  3TL4 X;  2Y9Y A;  1P92 A;  4CCL A;  1X2M A;  4UUS B;  4KYW A;  3S3M A;  1O3Q A;  1WPK A;  4YFX F;  2FUG 2;  5FLX Z;  3I3L A;  1PP7 U;  3DF8 A;  3DKW A;  2MGQ A;  5HNH A;  3JTG A;  1P4W A;  5E79 C;  2YX4 A;  2KDZ A;  4UNO A;  5FKO A;  1YJN I;  3WHC A;  1BL0 A;  3ZMU A;  2MD5 A;  1HA8 A;  4EJO A;  2LY2 A;  2IGM A;  3I54 A;  3TW6 A;  3E1S A;  1SFE A;  4M9X A;  1K78 B;  3FM3 A;  1IV6 A;  1EH8 A;  2Q2E B;  3NWS A;  2EJR A;  4FCY A;  4F52 A;  3PL8 A;  1IO2 A;  4CCK A;  5IP6 A;  4NDL A;  1MMS A;  4AYB N;  1DP3 A;  2VPR A;  2ZBK A;  4IQJ A;  3L2R A;  3B73 A;  2IPQ X;  3OYM A;  2R5Y B;  4HX7 A;  3E97 A;  2E34 A;  3FX3 A;  3K10 A;  4JBA A;  4ENJ A;  4XRS A;  1ETX A;  2ZKZ A;  5CPR B;  1JE8 A;  2ME6 A;  3RCO A;  3QOP A;  1R49 A;  1Z21 A;  3E7L A;  3CJT B;  4BBR J;  1K79 A;  3OYI A;  1W5S A;  3D5L A;  2OD5 A;  2VKE A;  4EM0 B;  3H5A A;  1SC7 A;  4M3F A;  2ELK A;  4BHC A;  3W6J B;  5BPI A;  5D4S A;  1GVD A;  2HKO A;  4JYK A;  3U2R A;  5EG0 A;  4CSW A;  4BQQ A;  2D45 A;  1Z7U A;  4IHT A;  2VJI A;  4IOA F;  1JKR C;  5E1Z B;  3TOB A;  3L9F A;  2EV6 A;  2DN0 A;  1K4T A;  2Z3Y A;  1WRJ A;  3EDP A;  1OMI A;  3ABK H;  1Z0X A;  2VOP A;  1R7J A;  3LST A;  1T33 A;  2WBM A;  3A01 B;  1LE8 B;  1UFM A;  1TC3 C;  1SD6 A;  2MG4 A;  4II2 A;  2M3A A;  2HS5 A;  3EUA A;  5FKM A;  1MBG A;  3MQ0 A;  4HEA 2;  3SDB A;  2ID3 A;  3TGN A;  3FXL A;  1YFH A;  2X0L A;  1W4M A;  3OL4 A;  3L2C A;  3BCA A;  1Z6T A;  2QQ9 A;  3E6D A;  1FSE A;  3MAJ A;  1WVR A;  2P5K A;  3Q0V A;  5HDG A;  4NB5 A;  6PAX A;  5M5X J;  4EM2 A;  3LA2 A;  4IHW A;  5IT3 A;  3JTH A;  2V26 A;  5DCM A;  1E17 A;  4LG3 A;  4GCV A;  2HQN A;  4LK0 F;  4CCM A;  5K5Q A;  4IKF A;  3DTI A;  2R7Z J;  1GHC A;  1XB4 A;  4BEH B;  2FEZ A;  1S29 A;  3K2A A;  2Z33 A;  2DTZ A;  1F1Z A;  2Y0S N;  4IJA A;  4BY7 J;  1WJA A;  5CVV A;  3HSF A;  4BE1 A;  4CIC A;  5C4J J;  2I5U A;  2LY9 A;  5F1R A;  3DWL E;  1BIB A;  1JUP A;  3BR2 A;  2F48 A;  1LVA A;  4KN4 X;  5ICE A;  2IA0 A;  2JVG A;  4DBR A;  1AHD P;  4UUV A;  2P5L C;  4HF2 A;  1ETK A;  3UNG C;  5LGT A;  1FEX A;  4ENK A;  1VQ4 I;  4NNJ A;  1R00 A;  5D8K B;  2FSW A;  2EFQ A;  4D5C A;  2DT5 A;  1F5T A;  3PUB A;  2XAH A;  1UHS A;  5D6E A;  1BI2 A;  1C0W A;  4BUP A;  1MSE C;  1RPW A;  1DU6 A;  4V2F A;  3KP5 A;  1Z6R A;  2COB A;  1ETO A;  3D0S A;  5F08 A;  3OYA A;  1SAU A;  2EZH A;  3ZMV A;  3NRV A;  4A0X A;  2BY3 A;  1R58 A;  2AQF A;  3QPL A;  3VDX A;  3HOX J;  3SFZ A;  4E70 A;  2EWN A;  3LA7 A;  3I71 A;  4M3B A;  1XGS A;  5GTH C;  4EJU A;  5D4R A;  1VQ9 I;  2CWE A;  3X2Q H;  2Y9Z A;  4DW6 A;  4U0V A;  1SFK A;  5CQG A;  2VIX A;  5J4Y A;  1V5F A;  4DZP A;  5LGU A;  2XGX A;  4O3M A;  3CLO A;  3TMO A;  2HVS A;  2A3S A;  3L09 A;  4ZTJ A;  2KP6 A;  4HX8 A;  3E5X A;  4M3E A;  1GVJ A;  4C2M J;  1CQT A;  1OKR A;  4J00 A;  3JRE A;  4BDY A;  2HGC A;  2BVL A;  4L18 B;  3TDU C;  3U1K A;  3TOA A;  2K4B A;  3G73 A;  4DOZ A;  3ZQ7 A;  3J80 Z;  5F6F A;  1J75 A;  4Y17 A;  1XMX A;  1REP C;  4E4H A;  3S16 J;  2A5Y B;  3ZQF A;  3J81 Z;  2CQK A;  3LA3 A;  4ZYA A;  3BTL A;  3PSF A;  1TTY A;  3FF5 A;  2KJB A;  4FX4 A;  1BI0 A;  1D3Y A;  2YSR A;  2D1H A;  3P5J A;  2EZL A;  2KPM A;  2ZNZ A;  1MMN A;  2GXB A;  1TQI A;  1QHG A;  4AC0 A;  4E7J A;  2KZG A;  4HYE A;  5L3G A;  2W85 A;  3F8B A;  5JLX A;  3HTU A;  4PCQ A;  3TED A;  3FXM A;  1KQ8 A;  1MBH A;  3QOE A;  3P9C A;  1ETV A;  2BV6 A;  1TZL A;  3A0H C;  2LVS A;  3FMQ A;  1ZG1 A;  2WY7 Q;  1YIJ I;  3M07 A;  2D2W A;  2QSG X;  1O57 A;  2R7D A;  2IEK A;  4A0Z A;  2EK5 A;  1YX3 A;  1BR1 A;  4B1R A;  4XLA A;  2XAG A;  1XCB A;  1IZ1 A;  2WAQ A;  2V6C A;  5TIS C;  3GLL A;  4A3D J;  2OJE D;  3DEU A;  3E6M A;  1R23 A;  2I10 A;  5D5U B;  2NVQ J;  1IXR C;  2W1O A;  3LL7 A;  2L9N A;  3BLY A;  2OA4 A;  4A5M A;  4CCN A;  5E20 A;  2YR2 A;  5EF6 A;  3G71 I;  4LLL A;  4F92 B;  5IY5 H;  2H8W A;  3HUG A;  2X1D A;  2DJN A;  2FXA A;  1IN5 A;  1LPQ A;  1VQN I;  4A3E J;  4ZJZ A;  2DMQ A;  2VXD A;  2EIM H;  2H6C A;  4MFD A;  4RBO A;  1DPU A;  3RQ4 A;  5F04 A;  4BU2 A;  3HYI A;  1XMA A;  1A5J A;  3WHB A;  4MTD A;  2JUG A;  4HLX A;  3I59 A;  2DXI A;  3BQY A;  1LEB A;  2MLG A;  2GIV A;  3EPZ A;  1XSD A;  1H89 C;  3CF2 A;  1V5G A;  1W1W E;  1YW8 A;  1FNN A;  2NXN B;  1WI9 A;  1X1P A;  3SEZ A;  1YIT I;  1AKH B;  3T0Y A;  3BTI A;  4G7Z F;  2BY1 A;  3OSG A;  4S05 A;  4EV0 A;  4XRF A;  3JAM Z;  3RSN A;  4R8H A;  2A6T A;  5KAF C;  5C3E J;  2MW8 A;  4I76 A;  4X6A J;  3J7A Y;  3OYK A;  3T5X A;  2L5Q A;  1FYK A;  2ZNY A;  1W0U A;  3R6S A;  2LLK A;  4JX6 A;  4QLC U;  1POG A;  1QRY A;  4GDF A;  4MNU A;  2DAO A;  2V4J C;  1ZGA A;  3I58 A;  3CDI A;  1IDZ A;  4PUS A;  1Z05 A;  3BR3 A;  1S5L C;  2QZ8 A;  4XRM A;  4NBQ A;  3OYB A;  2B63 J;  4YIF A;  2MH9 A;  4B48 A;  3FXR A;  3M8F A;  2G0E A;  4AD9 A;  1OR7 C;  3KZY A;  3RTR A;  1FOK A;  1VQ8 I;  4PSX A;  4CA0 A;  4IO9 F;  2A5W A;  2Z16 A;  4BJT A;  4XLH A;  2HVR A;  2B9S A;  1R1V A;  2GWR A;  4LJZ F;  1GV2 A;  4RAF A;  2E60 A;  1L3L A;  3FK6 A;  2K5C A;  4XSZ F;  3ZQL A;  1IAW A;  2V79 A;  3BJ6 A;  3OMY A;  1ZEL A;  1F36 A;  3VOD A;  4HPQ A;  3REO A;  2YX7 A;  3BR1 A;  3DV8 A;  3N05 A;  4E7S A;  2VQH A;  2R7V A;  3CMM A;  2HEO A;  3S1N J;  5JR3 A;  3H0D A;  1XMK A;  3WE2 A;  1XG1 A;  2XAQ A;  1ZLK A;  1H9T A;  2KL4 A;  5H2F C;  2WB1 N;  5IP9 J;  1V54 H;  2XAU A;  2O61 A;  2V7F A;  2BHY A;  5HOO A;  2JWT A;  5J47 A;  4XKV A;  3PQK A;  2OUM A;  4AID A;  2RQP A;  2LRE A;  5LBQ A;  2BXY A;  1U5T C;  2LBF A;  1D0Y A;  2E35 A;  2QQ8 A;  1A35 A;  4YRV A;  2PX9 A;  2ZCW A;  2X6X A;  4RMN A;  4E6K G;  2GIZ A;  3S3N A;  4HF1 A;  3ZQI A;  1YOV B;  3PO3 J;  2OQG A;  1YJ9 I;  2AS5 F;  2FU4 A;  3HRT A;  2MLK A;  1U2W A;  4KIS A;  2RGV A;  4A69 C;  2CUJ A; 
#chains in the Genus database with same CATH homology
 3S1M J;  1X2N A;  2QF7 A;  4A3M J;  5C44 J;  2LR8 A;  3HBL A;  4FE7 A;  1WH5 A;  3VPR A;  5K7H A;  1MBK A;  3TW7 A;  3RZD J;  4MO7 A;  1IGN A;  5E3M A;  1OCP A;  5E3L A;  1RET A;  4M6V A;  1GT0 C;  1GV5 A;  5IYC J;  3BQZ A;  1ZR2 A;  3ZQH A;  1UMQ A;  4C3I J;  1HCR A;  1VND A;  4ABZ A;  4A3J J;  1S7E A;  4DYR A;  4C3H J;  1ENH A;  2XGD A;  4MLO A;  2RAE A;  5IOZ A;  3F0C A;  3LSG A;  5M3M J;  1MNM C;  4MIM A;  4IEJ A;  4EEF G;  4CYC B;  2LP0 A;  1HDP A;  1QVT A;  3MN2 A;  3OOU A;  1RKT A;  3GTL J;  1O4X A;  5IYD J;  1K83 J;  2L7M P;  5F27 A;  1JT0 A;  3A03 A;  1P7I A;  2DMP A;  3JR9 A;  2W48 A;  2X48 A;  3D1N I;  1MH3 A;  3PM1 A;  5JLW A;  3GTQ J;  3HOV J;  5M5Y J;  1Y1W J;  3FIS A;  2HOA A;  1T56 A;  3OSF A;  2EZK A;  4D7M A;  2H1K A;  3FKI J;  1PUF B;  3BR5 A;  1IUF A;  1B8I B;  3BTC A;  2M0C A;  5EZG A;  2VKV A;  1Q1V A;  1P7J A;  4A3G J;  1NTC A;  2LK2 A;  2E2H J;  1Z77 A;  2GLO A;  2DMN A;  1MBJ A;  3JRB A;  5E3N A;  5C4X J;  5FKK A;  4BKX A;  1FJL A;  2L9R A;  2CUF A;  1JKO C;  1DU0 A;  2VI6 A;  1FTT A;  1WI3 A;  3ZOB A;  4XID A;  2IAI A;  4A3B J;  4MFE A;  2X6O A;  1I6H J;  2R5Z A;  4A3K J;  2FQ4 A;  1JKQ C;  1TWH J;  2Y9Y A;  4UUS B;  1X2M A;  1NK3 P;  4FTH A;  1WPK A;  1BW6 A;  3G1O A;  3BTJ A;  2MGQ A;  2AO9 A;  1ITY A;  2QCO A;  2KDZ A;  5FKO A;  3WHC A;  1BL0 A;  5IPA A;  3NAR A;  3GTO J;  4X1E A;  3TW6 A;  3HGY A;  1IV6 A;  4L5E A;  2E19 A;  5K7Z A;  4FCY A;  2H8R A;  2ID6 A;  1RES A;  2XB5 A;  4NDL A;  5IP6 A;  5DS9 A;  2O7O A;  4AYB N;  2HYJ A;  2VPR A;  2R5Y B;  2TRT A;  3HEF A;  1I50 J;  3MKL A;  2CRG A;  1MBE A;  2CJJ A;  1ETQ A;  3LSJ A;  4XRS A;  1ETX A;  5J1U A;  1APL C;  1GDT A;  1G2H A;  2JK3 A;  2ME6 A;  3SDG A;  1IJW C;  3E7L A;  2XPU A;  2HQ5 A;  4XRS G;  3ZQG A;  4BBR J;  2WV1 A;  2M2E A;  4FIS A;  1F43 A;  2VKE A;  4UUT A;  5EEA A;  3Q3S A;  1R9T J;  3B6C A;  2L7F P;  2K9N A;  4M3F A;  2ELK A;  1AKH A;  5EGO A;  4D7N A;  1YRN A;  2YU9 J;  2D5V A;  1GVD A;  4JYK A;  2DA3 A;  4W97 A;  5EG0 A;  1QPI A;  5HOD A;  3NAU A;  5FKL A;  2OPT A;  3FIW A;  2AHQ A;  3JRH A;  3DEW A;  1JKR C;  2DN0 A;  3RQI A;  5GP9 A;  1Z0X A;  1X58 A;  2DMT A;  3A01 B;  1T33 A;  4B3A A;  1LE8 B;  2HOT A;  3M4O J;  1TC3 C;  3IH2 A;  3JRI A;  2MG4 A;  3SJM A;  4S0H B;  1ETW A;  5FKM A;  3LOC A;  1MBG A;  1RKW A;  2R93 J;  2ME0 A;  2ID3 A;  1A6I A;  3CDL A;  5F1J A;  2NOG A;  1JUM A;  1U78 A;  4G12 A;  2YS9 A;  4Y7N J;  2O9L A;  3Q0V A;  3GBG A;  3S14 J;  2JA8 J;  3IH3 A;  4RDU A;  5F0C A;  5J1R A;  2E2I J;  5EZH A;  4C3J J;  5M5X J;  1U8B A;  4IHW A;  4DYQ A;  2JJ7 A;  1WGX A;  4J19 A;  3CCY A;  1SAN A;  1QVU A;  2R7Z J;  2CU7 A;  1OJL A;  1LFB A;  2EZI A;  2L7Z A;  1LFU P;  2P81 A;  4A93 J;  2DMU A;  3K2A A;  2DTZ A;  2LKX A;  4B4C A;  2Y0S N;  5BNG A;  4DYC A;  4BY7 J;  1B72 A;  2CQX A;  2NVX J;  1HF0 A;  1HLV A;  3G1L A;  5K7F A;  5C4J J;  5M3F J;  2LY9 A;  3HDD A;  4M3G A;  2IBD A;  2FD5 A;  1JUP A;  3BR2 A;  2ECC A;  3Q0U A;  2XPW A;  1VF9 A;  1H88 C;  3HB9 A;  5M5W J;  1U9O A;  1AHD P;  1ETK A;  1FEX A;  2XRL A;  1YRN B;  2M8G X;  1IG7 A;  4D5C A;  4BY1 J;  1UHS A;  3S2D J;  2L0K A;  1MSE C;  1RPW A;  1DU6 A;  2XSD C;  4V2F A;  1ZKG A;  3MVP A;  2COB A;  1ETO A;  2KT0 A;  2DA2 A;  5F08 A;  2EZH A;  2TCT A;  3LNQ A;  2JA6 J;  3QPL A;  3TP3 A;  4A3L J;  3HOX J;  1JJ8 C;  3GTP J;  1VI0 A;  4M3B A;  3RKQ A;  2K9Q A;  2Y9Z A;  1U9N A;  4DW6 A;  2DA6 A;  2Y31 A;  4DZP A;  2E2J J;  2Y30 A;  4A3I J;  9ANT A;  1CQT A;  4M3E A;  3I4N J;  4C2M J;  4A3C J;  3S15 J;  3JRF A;  3JRE A;  2CUE A;  5EDN A;  2DA5 A;  3M3Y J;  1GUU A;  4CYC A;  2YUS A;  1H8A C;  1ZR4 A;  3S1Q J;  3DCF A;  3H0G J;  4GFB A;  3S16 J;  3ZQF A;  1JTX A;  3JRA A;  4D5F A;  1EF4 A;  1IDY A;  1ZGW A;  3BTL A;  1D5Y A;  3ZQC A;  2Y2Z A;  3G1M A;  1JTY A;  4I6Z A;  1PUF A;  2JMW A;  1WCM J;  1B8I A;  4JX5 A;  3GTM J;  4HNV A;  5FLV A;  2EZL A;  5IYB J;  3HGG A;  2CQQ A;  2JN6 A;  4AC0 A;  1JJ6 C;  2DA1 A;  3S1R J;  5JLX A;  4IHX A;  3TED A;  3GTJ J;  2O8K A;  2DA7 A;  1MBH A;  3Q0W A;  4BXX J;  3CQZ J;  2GBY A;  1ETV A;  4BBS J;  1JGG A;  3K7A J;  5J1Y A;  4FE4 A;  2LVS A;  1VFC A;  3JRD A;  2R5Z B;  2FJ1 A;  1E3O C;  4M3D A;  2IEK A;  3PO2 J;  3H3V K;  1TWG J;  2HI3 A;  5FJ8 J;  1W0T A;  3LSR A;  4B1R A;  1NK2 P;  4W1U A;  1BA5 A;  1XC5 A;  2JA7 J;  3HOW J;  4UUS A;  2NS7 A;  2HOS A;  4A3D J;  2M34 A;  2I10 A;  1JT6 A;  4DZJ A;  2NVQ J;  3GTK J;  3B6A A;  1FTZ A;  5F0H A;  5IP7 J;  2XPV A;  2PMZ N;  1ETY A;  5EF6 A;  4IHV A;  2VUM J;  5J3L A;  1IC8 A;  4A3F J;  2XGC A;  2EQR A;  2DJN A;  4AUX A;  3BG5 A;  4A3E J;  3JRC A;  1FIP A;  3JRG A;  2DMQ A;  3S2H J;  1I3Q J;  5FLM J;  4MFD A;  4QIW N;  4RBO A;  3HOU J;  2ECB A;  3TP0 A;  5F04 A;  5EYR A;  5E3O A;  2R5Y A;  1A5J A;  3WHB A;  5GPC A;  1HDD C;  2XGE A;  1JUS A;  1ORK A;  1ZTR A;  5IOY A;  1ZK8 A;  3RZO J;  2XB0 X;  1OFC X;  3BQY A;  1H89 C;  1AKH B;  5EGO B;  1AU7 A;  3BTI A;  2FX0 A;  1JKP C;  2X9D A;  2MSY A;  3HOZ J;  3OSG A;  2JA5 J;  3HM5 A;  5EG0 B;  3CMY A;  1MSF C;  5DTD A;  3BR6 A;  5C3E J;  2MW8 A;  4I76 A;  4X6A J;  2NS8 A;  1TWF J;  1IRZ A;  1W0U A;  3OIO A;  2LLK A;  4JX6 A;  1POG A;  1QRY A;  2R0Q C;  3QQA A;  1IDZ A;  3L1P A;  3FK7 A;  3BR3 A;  3I4M J;  3A01 A;  1LE8 A;  4XRM A;  2B63 J;  2DA4 A;  1XS9 A;  3GTG J;  4IHY A;  4QTR A;  2G0E A;  3IV5 A;  2E1O A;  2M9H A;  1WH7 A;  2GM4 A;  3S17 J;  5FKN A;  4QSH A;  2HDD A;  1HOM A;  3O8H A;  1Y1V J;  3UKG A;  1GV2 A;  1FIA A;  1OCT C;  2K40 A;  3FK6 A;  4XK4 A;  4XIC A;  3ZQL A;  2NVY J;  2HXI A;  3BT9 A;  1ZQ3 P;  1TWA J;  1F36 A;  1UG2 A;  2LFB A;  2HXO A;  3BG9 A;  3HOY J;  1RR7 A;  2ZB9 A;  3BR1 A;  3C2B A;  3IH4 A;  3S1N J;  4LOC A;  1XG1 A;  2OF7 A;  1B72 B;  1SFO J;  3BR0 A;  5IP9 J;  2WB1 N;  3SFI A;  2R92 J;  3HKZ N;  3BG3 A;  1TWC J;  2JWT A;  1K61 A;  2N8G A;  2NVT J;  5F0F A;  3QPS A;  2EBI A;  5GPA A;  4JX4 A;  3O8G A;  4JP0 A;  3ZQI A;  2WAQ N;  1MH4 A;  1BW5 A;  4V2G A;  2LD5 A;  3W6V A;  1MBF A;  3PO3 J;  3A02 A;  3LSP A;  2LTP A;  2K9S A;  4Y52 J;  2EH3 A;  4A69 C;  1BJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...