2KQRA

Solution structure of the n-terminal domain (residues 1-111) of brugia malayi asparaginyl-trna synthetase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
GSMTVYICPETGDDGNDGSELKPLRTLYQAMIITKSSKGDFLIRTKKDGKQVWEAASKTALKKSWKRYEQEMLKNEKVAAKMLEKDATEVGVKAALEEAKKVQIELDTSLSYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Asparaginyl-tRNA synthetase, cytoplasmic
publication title A Hybrid Structural Model of the Complete Brugia malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kqrA01
2KQRA 4ZYAA
chains in the Genus database with same CATH superfamily
1Y39A 5GP9A 1SD6A 2XPVA 2R7WA 4J01A 3BJ6A 2P7CB 4GFBA 2IEKA 3PO3J 1S6LA 4A69C 4I2OA 1H8AC 3AG4H 1U5TC 3ROUA 4R79A 4DGWB 1JJ8C 3CCEI 1B9NA 1UMQA 2EV0A 3IKTA 1F4KA 3CDIA 1YS7A 1KZHA 3JRGA 2K9LA 3RZOJ 4FE7A 4IOCF 4XKCA 5E3LA 1GT0C 5L3DA 4N9IA 4BKXA 3CUQB 1B72A 2WTEA 4U0VA 2ZKZA 2X1CA 1H9GA 3F6VA 2I5UA 4L0ZB 4O5VA 1LFBA 3DEWA 2O6GE 3IWZA 2M3AA 1FOWA 3ERED 4UUVA 1EKEA 2ISYA 2E7WA 1HW5A 3GZNB 3FXRA 4ENNA 2LKPA 4G7ZF 2XHKA 3QYEA 2DA1A 1IAWA 1IV8A 1F9NA 5CVVA 2H94A 2E1NA 3GEZA 5FKLA 2VQHA 2WADA 2MGQA 5DYMA 4XRFA 1IRZA 5KAIC 1NTCA 3KP6A 4XRMA 1IRGA 1JHFA 3TDZC 4X6AJ 3B02A 4EJTA 3H9GA 3GTLJ 1VQ8I 4IX7A 2E36A 4E7JA 2BE5F 1FBUA 4HF1A 1Y0NA 2J5OA 3S2HJ 3MEXA 1X1AA 5ICFA 1HBXG 1DU6A 5HNFA 3QU3A 2RKHA 5IYCJ 4RBOA 5J8CA 3D5SC 3AAFA 3FM3A 4RA2A 2ACJA 3EUKL 4YELA 3CDLA 3JR9A 3EUHA 1WWXA 2MW8A 3TGNA 5HLHA 4D1QA 1IF1A 5HODA 2M30A 2R0QC 2VASA 1AHDP 2ZMEB 2V79A 4LLLA 5HNHA 4BDZA 3R60A 5IT3A 4RAFA 5M3MJ 3BQYA 2VKEA 4ZDLA 2Z1DA 3A03A 3SEQA 4DOZA 3L00A 1EH8A 2DPDA 2QA4I 2ME6A 3I55I 1KU2A 1P7IA 1WRJA 5FO5A 1NG7A 2KHMA 3R0JA 1J59A 4A3BJ 3CZ6A 2DQLA 2DTRA 3F9KA 2VIXA 1ZREA 1WJFA 1SFXA 3HHHA 3BPXA 2JA7J 2XC7A 3OSGA 2L9NA 5LLQA 3HRUA 2ICWG 1D5YA 1IN8A 1FOXA 1FY7A 3GLXA 3G71I 2CUEA 4HNVA 3V8KA 2DA7A 4AVZA 3RKQA 3ZQCA 1UHWA 2Q1ZB 1TNTA 2XF6A 3O6BB 1Z21A 3FKJA 3ZR8X 2LKXA 1DP7P 2FOKA 1MBEA 2XVCA 3S16J 2JT1A 3H36A 2ZFWA 1TQPA 5KAFC 2DMTA 4FTHA 2MH9A 2L2OA 3RPUD 2OF7A 2JRMA 5F6FA 5BPIA 2DA6A 5DD8A 1MSEC 3DU6A 1OJLA 3I58A 2C6YA 4XRSG 5DDGA 5K7HA 2IA1A 3P9IA 5DEQA 5A2QK 2XROA 3E6CC 2R7RA 5D5XB 3MCZA 2XAQA 3RI4A 2IA0A 5D6FA 3BT9A 3GO5A 1B72B 4YFKF 3T5XA 3DF8A 3HL2A 3IRQA 2Q8KA 1WH5A 4WCGA 3OYDA 3JRFA 5F64A 3W2WA 2V1UA 3FMRA 1S7EA 2CYYA 2JPCA 3WTUC 3P9CA 1V4RA 5FRMA 3FF5A 2DQRA 1WJEA 2CUZA 1V55H 4BYYA 4MTEA 1X4OA 2XAGA 5M5YJ 4HRIA 4GDFA 4PJMA 1PUFA 4BE1A 5J47A 1ZH5A 5M5WJ 4DYCA 5GTIC 2AHQA 4EM1A 2JUCA 1KQ0A 1I1SA 4CH7A 4A3FJ 3OYAA 3AL0B 2HPMA 5HDNA 4PFOA 3C2GA 2CRGA 2M8EA 3E6MA 4JBAA 3ELKA 3EPZA 1Y8QB 2L01A 2BEOA 2X4HA 4JP0A 5GADJ 3HKZN 3PUFA 3WGIA 2RNGA 1G8XA 3X2QH 1OYYA 2P7VB 2YPRA 1UHMA 2DOAA 3LSPA 2IPQX 2OBPA 2O03A 2Y0SN 4MIMA 3VB2A 4WWCA 2LP0A 3DU5A 2LDUA 2RVCA 2RGVA 2HU9A 2DJNA 1OCTC 1R1VA 3FBNB 5CKTA 1T95A 5DUKA 1FP1D 2F5DA 3I9V2 1TBXA 3H3UA 1H9TA 4RGUA 1MNDA 1W7PD 1BIAA 4I7HA 1BC7C 4EJWA 4LJZF 2PFBA 2R7ZJ 4BHPA 1HDPA 1BOAA 3FISA 4S0HB 3NAUA 4M9SA 3BTJA 2CJJA 3MQ0A 2Y31A 4AYBN 4BAYA 4BQAA 1DPUA 1I1GA 3ABUA 4Q5SF 2QQAA 1MKMA 1QNTA 2CS3A 3ZQFA 1O57A 3FKIJ 2UXNA 3HGYA 3P7NA 5DV5A 2I10A 3QP5A 1PP8F 1XGOA 2GXGA 2HTSA 4HV5A 2BW3A 2Q2EA 4CZZA 1BR4A 3REOA 5TRDA 2VT3A 3QRFF 2XASA 2M4KA 2ELJA 2WBMA 2YU3A 1K61A 4WXCA 4CCKA 5F0HA 1B4AA 2YSRA 2E5NA 1BC8C 3MN2A 1Z0XA 3J7AO 1TW3A 2BGCA 2JK3A 3DWLE 1MMSA 5H6QA 2QCOA 2XGEA 3Q0WA 2M7AA 1J2XA 1ZHFA 1YS6A 2LVSA 3HOSA 4WXHA 3B73A 4RGXA 1VQKI 2IVMA 1X19A 1EV7A 2XB5A 3WTZA 4B47A 4RM2A 4HDVA 2Z2SB 3CTAA 2HOEA 3ECOA 3KEYA 3P9KA 1YI2I 2M7BA 1T38A 4I6ZA 1U8BA 1TLHB 3GZ6A 3O8HA 2HVRA 3HRMA 4BBRJ 2OZ6A 1J0RA 3W3CA 1R71A 5LHGA 4KDPA 2ID6A 4ESFA 4C9YA 5FLVA 3IH4A 5EEGA 2DW4A 3CF5F 2YS9A 1QHGA 1W7PA 2L4AA 4XL9A 3VODA 3BC8A 3HC7A 3LFUA 2BHZA 2EIMH 3MZYA 5HLTA 2M1BA 1SFKA 2VONA 4F55A 3HRTA 4IVNA 2FD5A 3LSGA 4M73A 3LFKA 3EETA 4BDYA 1R6RA 3R4KA 1RR8C 1PUFB 3QYBA 3JCUC 1G2HA 2P0WA 2DYSH 3HPGA 4Y13A 1R49A 2PJRA 4OIOF 1O4XA 2VLAA 3BY6A 2RQQA 4L5IA 2XAHA 3ZGKA 1TT0A 3K4MA 3WU0A 1B9MA 2GOMA 2ZXHA 4PZJA 4EMSA 3ZQLA 2EQRA 1YX5A 2Z3YA 3JSOA 3S2DJ 3IKVA 2E2HJ 2HYJA 1G3TA 3TOBA 4P9FA 4A3EJ 1D0XA 1ETYA 2JPBA 4HYEA 5JLXA 4BXFA 3ZP5A 2K3PA 4XNFA 2V9VA 3D5RC 2HFHA 1N25A 2R7DA 4B1RA 3ZXSA 2HOSA 4U0WA 2YR2A 2K40A 3QODA 5K7ZA 3GFMA 1IC8A 3QAHA 3TW7A 2CW0F 3G73A 1LE8B 4CDGA 1K78A 2VQGA 4HX8A 2V4JC 3F8NA 3HSRA 2VBXA 2OJED 3GZ5A 4LFUA 4NQWA 4RGRA 2BXYA 4XN0A 4ETSA 1REPC 3OOUA 1Z05A 1U9NA 3LSKA 4BJTA 2JMWA 2ELKA 2R7FA 4YIIA 2CO5A 4II2A 1MSFC 1WKMA 3V4GA 5J8FA 5JLWA 4HLYA 1FJLA 4I98B 3NRVA 1ZG1A 3COAC 2WY8Q 2IBDA 2QYOA 5DS9A 2OZUA 4B48A 2R4GA 3ZCOA 3L1PA 4BBSJ 2FEZA 2XKOA 3W2VA 1IN5A 3I4PA 4XQFA 3OR2C 1ETOA 3WGGA 4A3KJ 3K70D 2DA5A 2Y0MA 1XGNA 1I27A 3FK6A 3R0AA 2VJIA 1TQIA 2Q2EB 4KIGA 4F52A 3H3VK 1SVLA 1W5TA 2FMLA 2ZXWH 4ZDOA 2KIQA 4HNTA 4N4NB 3F21A 4MO7A 5E3MA 4HEA2 3QOEA 4G9YA 1B59A 5FKKA 4U0YA 3F3XA 1EA3A 4BJ6C 2K4BA 1RETA 3H9QA 2MG4A 5D5UB 1FOKA 5KVRA 2E19A 2UV1A 3I54A 4XSZF 2K27A 3LMMA 4L9NA 1R00A 2STWA 1J7KA 2IJLA 4BHCA 5E3NA 1V3FA 2CFXA 2G0EA 1ZKGA 2EJRA 2XRNA 5CPRB 4MQVA 2H6CA 5FKOA 3WGHA 2DXIA 4P96A 2KIFA 3I71A 5CYVA 2JA8J 1O3QA 5L3FA 1HXDA 1R5HA 2ZXJA 5K5QA 1TL8A 5LBQA 2Y9YA 4A12A 3MKZA 3CCLI 3GXOA 2DFEA 3DBRB 2VQCA 1U5TA 5CQEA 3CUOA 4YFXF 3SFIA 3OS0A 1W7PB 2V6CA 2HQNA 4IO9F 1T8IA 4ON0A 2J5PA 3CCQI 1KGSA 1Y8RB 3LAJA 4NUBA 3B6AA 3T8RA 2YUSA 4Z6YA 5EDNA 1HW2A 4XM3A 3ABMH 4RB3C 2EB7A 4EGZA 3OOPA 3MKYB 2V1NA 1AKHA 4L18B 5HOOA 1OCRH 4MTDA 3BTIA 1JGGA 2PJRB 4FCYA 5H2FC 1FC3A 2MD0A 3HKZA 2HKXA 3E5QA 5B3SH 2IT0A 1JHHA 1RUNA 3ABKH 3PL8A 3BG9A 3GUDA 1T56A 3M1CA 2BZTA 3SDBA 3V8LA 4KUMA 2K02A 3QU6A 5D4SA 1H89C 1G6NA 4HA8A 3WE3A 5GAEJ 5B66C 4M3BA 2QQBA 1RKWA 4ZYAA 3Q3SA 5JI6A 1W0TA 6PAXA 3LQQA 2D2WA 1FTZA 4RAYA 4CA0A 4D5FA 3OYFA 1R22A 3DPTA 3GFLA 3WG7H 4G7OF 1V54H 5LRRA 3T8TA 2K4JA 5LD2C 1ZRCA 2OTJI 2YX4A 5DCFA 4PJNA 1P9QC 4LITA 2FQ4A 1K78B 3SZGA 4U88A 3GTQJ 2H8WA 2V26A 4KJZA 2VKVA 4AYBA 2HQAA 5FD5A 3Q9VA 2VL8A 2K5CA 4E7IA 2JVGA 3FZVA 3ASOH 4Y15A 2F6CA 3OYEA 3S2WA 5JHUA 1V5FA 4GRIA 3C7JA 2GA2A 1OR7C 2CV1A 3VWBA 2L3DA 4RGSA 3H0GJ 3V7SA 4HNUA 5FKNA 3RQIA 2GXBA 3GTOJ 5E1ZB 4E7ZA 3V8JA 4ZH4F 1P7JA 3G4SI 2X51A 2R7UA 2HI3A 1IGNA 1ULYA 4DBRA 3F72A 1FYMA 3IV5A 1Z6TA 4I0AA 2F2EA 2L4MA 1SAUA 2P81A 4LK1F 3K4NA 5BS6A 5FLXZ 4NB5A 4Y33A 5FFXA 2OA4A 1Z67A 1RIOH 4UVCA 3L2QA 3RKWA 1NK3P 2NVXJ 4TV7A 3FHNA 3KE2A 3LQRA 5J40A 2R5ZA 2JSPA 1LJ9A 2HKOA 5C44J 1QA6A 5JR3A 2W85A 3TO7A 3A4CA 1BN5A 2ADUA 4EGYA 4QPQA 3PFIA 2WY7Q 1OCCH 4UVBA 5HDGA 4IF4A 5GPAA 4A2UA 2JA6J 3RDIA 1NK2P 5E1WA 5BQTA 4HG2A 2M34A 1ONVA 2ZJPF 2ETHA 3GF2A 1ZLKA 3Q0UA 4CO8A 1O3TA 4AC0A 1IXCA 1UG2A 3AG1H 2H1LA 4EM0B 3QPLA 1U5TB 1XMXA 4ZYHA 1JUSA 4IRIA 3O3KA 2ZJ2A 1FYLA 1MD0A 3FX3A 4E7SA 1FTTA 4XR6A 2MYSA 5J6XA 2BYVE 2K7LA 3CO6C 1A36A 2B0LA 3DV8A 3DKXA 4GXOA 3FXMA 2KIMA 1AKHB 4H4KC 2UZKA 2O0YA 1GVDA 3MFKA 3RYPA 4ESBA 1AA7A 2KPMA 3P5JA 2HVQA 1OMIA 2DYRH 1WI3A 1YFHA 3E1SA 2W4SA 4HPQA 2ZSHB 2GQQA 1UAAA 2FJ1A 3F8FA 4XSXF 5IOYA 2QKMB 1QPIA 1WCMJ 1RR7A 2XF7A 5CVUA 1IZ1A 3U21A 1K83J 4AM3A 1O7FA 2K85A 3MWMA 5DM7F 4M6YA 4G12A 3CJRB 3ZQGA 4IQ4A 4F92B 3F8CA 4LIUA 1HOMA 1E3HA 1ON1A 1QGPA 3S1RJ 2LNBA 4BQNA 4X1EA 4N4OB 3ZN1A 3O2PE 4GCVA 5FD6A 1GV5A 2OCCH 3I0TA 3WG9A 3J7AY 1IUFA 4OWRB 1Y1WJ 3R6SA 4FHTA 4GGGA 3K4BA 3MAJA 4IL6C 3SDGA 4HBLA 5LEJA 2KMUA 2ZO4A 1UB9A 1SMTA 3W2AA 4MHGA 1LVAA 3I56I 1ACIA 1IXRC 3S8PA 3ABLH 2O5RA 1S5LC 1Z6RA 1P6RA 4XLAA 4CYDA 1S9HA 2DA2A 3E5UA 3HG9A 2X6OA 2PQ8A 2COBA 2HGCA 1I39A 4WK8F 4OAZA 3SYTA 5IT9Z 1ITYA 1AWCA 3H1CA 3TBIA 2LY9A 4PUSA 1K4TA 5LGNA 2LMDA 1AOYA 3BG5A 1D0ZA 1GLNA 2MFZA 4I02A 5CVIA 4KIBA 1A35A 4RB2C 1N78A 5IP6A 2AXLA 3CCYA 2Y48A 1TWCJ 1WPKA 2B63J 2GXAA 2HEOA 1FMWA 1YQAA 3L2WA 3GW2A 4DZPA 4AIKA 2PMUA 1SANA 2R5ZB 4MGRA 1ETVA 1UHSA 5JFRA 2MC4A 5EGOA 3T0YA 3OYKA 5D4RA 2M0MA 4G6QA 1ZQ3P 4KT6A 1HW1A 3CUQC 1K4SA 3WTXC 1CQTA 3K4KA 2H27A 1OLTA 1MBGA 2YX7A 2EIJH 5HLGA 2IGKA 1WHUA 2CUFA 2M87A 1UELB 1WJBA 3K7AJ 4P1WA 2PI0A 1XG1A 2K9SA 1FYKA 3S32A 3CP2A 1O7LA 2ZXIA 2K86A 1ZG3A 2EPFA 2XUBA 3A02A 3PIOF 1T08B 3I4MJ 1FWZA 1DU0A 1J09A 3E0JB 2VKHA 5IOZA 1XCBA 1APLC 3C3WA 2DI3A 1I5ZA 2OQGA 2LG4A 3K2AA 2DT5A 1VFCA 2BXZA 2VODA 3WTVC 1KU7A 1STZA 3I59A 2RAEA 3G1OA 2XGCA 3ZOBA 2QSGX 4HF2A 3CC4I 5D5VB 4XRSA 5HLIA 3ULQB 2I8DA 2VXDA 1ODDA 2HVSA 2W25A 3LSRA 5J1RA 4M72A 4AIDA 2OQRA 2K3FA 4KISA 1JI8A 3IH2A 3GFJA 2VBYA 5LGUA 2FOWA 4M74A 2HPIA 4E7HA 1GV2A 1ZK8A 3V7CA 2MSYA 3M3YJ 2JQ7A 1BM9A 2JN6A 3K2ZA 2ZMEC 1NHAA 4A6DA 1VZ0A 4FASD 3KEOA 3M4OJ 2NS0A 2CG4A 1XC5A 2A6EF 3K4CA 1FIAA 1TNSA 3TO9A 4G6TB 3L2RA 3KEQA 3VYSB 3AG2H 1CF7A 2LF7A 5E1XA 3OYGA 4EM2A 3UNGC 3I53A 4Y52J 3LWFA 2D45A 1XDUA 2NRAC 3D0SA 3BP8A 3OL3A 4KNYA 2L54A 4HAMA 4KICA 3FK7A 4LG0B 2VQLA 3BDDA 4G7HF 1XGSA 2LH9A 4OIPF 2IS2A 4XKWA 1SAXA 5K5OA 4BUPA 3A1YA 1TWAJ 3J7YJ 2P5LC 5TGTA 2LTPA 5J3LA 3IUOA 3PFYA 5FKMA 1WVRA 4D9JA 3HOWJ 1MMAA 2HZTA 2A3SA 3DLAA 3FWEA 3RYRA 4NDLA 2P8TA 2EV5A 5M3FJ 3L09A 2D1HA 4MNUA 1Y56A 4BY7J 4JX5A 1S72I 3RPUA 5IYBJ 1XCVA 2E2JJ 2DFHA 5KCMA 4YIFA 5CVRA 1XMAA 4B43A 5EGOB 1LE8A 3JW4A 2W48A 1FT9A 2M2EA 2F5FA 4A93J 1MH4A 1MW7A 4ZZLA 1GXQA 2FUG2 3K6GA 3NARA 4NC6A 5AONA 2DOFA 3OS1A 3EYIA 2IRFG 4AD9A 1USSA 3M9AA 1E2XA 3PM1A 4BQQA 2EH3A 4KITB 3K69A 1K6OA 3BPVA 3L7WA 5LEKA 5FJ8J 3BZCA 2IS6A 4RMNA 2WB1A 4XLCA 1LEBA 1PVEA 3WU2C 1B6AA 2X0LA 3JREA 4A3IJ 1WQ2A 2FE3A 1YJ9I 1IW7F 2BV6A 3I5UA 2XAUA 1F36A 4AVPA 1W36C 3K70C 2HXIA 2QKLB 4OIQF 4GO1A 3AL0C 2M8GX 3K9TA 2OU2A 3J80Z 1IG7A 1JTYA 4BHBA 3A0BC 2KDOA 3Q0VA 4IXAA 4BU2A 3CLOA 4L9JA 4N9HA 3PO2J 2DODA 3BQZA 2UWMA 3DQVC 3M1EA 1FX7A 1I50J 4DYQA 4LB5A 3I59B 2JTVA 1U2WA 5C3EJ 4OINF 4DIQA 2FF4A 3A0HC 2X85A 3ZMUA 1ZAOA 1WI9A 3JAMZ 2HDDA 3EUHC 3TDUC 4CCMA 1Z3XA 1X3ZB 2DO7A 4BY1J 3M8FA 1TT5B 4J19A 2QBYB 2M45A 3HYIA 1D8KA 5LHHA 5DTDA 1SC7A 3GTKJ 1JTXA 3RPQA 4C2MJ 2NNYA 2MABA 1MJBA 5J4YA 3FXJA 4M9XA 1XPXA 4C2UA 2ZSIB 1PYVA 4XKBA 4HQMA 1Y0UA 3HOYJ 5F27A 1EF4A 2TDXA 2XSDC 4PGHA 1CF7B 2L9VA 3OMYA 2D1VA 1WJCA 1X1BA 3KYCB 4XIDA 1MBJA 3J80K 4DBQA 3MKLA 1VQ7I 3C18A 5JVGF 3OYNA 4XLNF 3G1MA 2E1MC 4JYKA 9ANTA 2QQ8A 1QVUA 1MZBA 2DCEA 5EYRA 2E1OA 3RIRA 4I0BA 2K9QA 3CJTB 4YFNF 4KN7X 4I99C 1OR7A 2FBHA 1M1EB 3VDXA 2F5EA 2OCEA 5D5WB 4E7LA 1RKTA 4CUGA 2EFOA 5BNGA 1R4NB 1HDDC 2AQEA 1F5TA 2R7XA 1ENHA 2TRTA 3MZ8A 1N75A 4CYCB 2EINH 3JRAA 3GTPJ 3E6DA 2ISZA 3H0DA 3ZQ7A 4ZYEA 5E8IA 2V6EA 4IHVA 4C3IJ 2L7KA 2NS7A 2DFIA 1LKXA 2W84A 4UNOA 2HXOA 4IKFA 1W5CC 4XKVA 1FMVA 2LLKA 2DK5A 2HNHA 3U1DA 4UV9A 3DKWA 5ICGA 4A3JJ 2AO9A 4U7BA 1IRFA 3U9GA 1KA8A 2JVHA 4C3HJ 2QEXI 3ZMZA 3S1NJ 5HVQC 4N0BA 1HSTA 5F0FA 5HDKA 3F6OA 2LK2A 4CHUA 4KMFA 4AIHA 1RPWA 3PUBA 4V2FA 2XGXA 1YJWI 1SVOA 4J00A 2HOAA 4DQ2A 5KHDA 3OIQA 1X1DA 1QPMA 5ILUA 3ZRGA 1Z3YA 3FXKA 2XRLA 3CCRI 2NXNB 2DA3A 2OTLI 1JXSA 2KRCA 3CESA 3F23A 1V5EA 3J81Z 3W6VA 1XSXA 1YW8A 4KFCA 1ERDA 1U6GA 2P5VA 4ZTJA 1MJAA 1OKRA 1LPQA 3JRHA 1Y1VJ 3VSKA 3CLQA 2FQ3A 5TJJA 1ZG5A 1LQ1A 3SEZA 5EEHA 4OAYA 3PJRA 1BW6A 1SD7A 1XSVA 4AIJA 3EYYA 3NQOA 5DM6F 1TC3C 5F0CA 1T0FA 2MLGA 2XGDA 3KIOA 4BNCA 2JSCA 4E7KA 1E3OC 3DBLB 1NG6A 2RNJA 4MEXF 3OR1C 1MIJA 3DP7A 5EZHA 1IXSB 3BG7A 1TWGJ 4RAGA 1MBHA 3KZZA 3OYIA 2ZNYA 1X2NA 4EV0A 1O3SA 3Q5FA 1OFCX 2HOTA 1Z9CA 5L3CA 2UUZA 3G1LA 1JE8A 2CW8A 1VNDA 4I09A 1YJNI 3F22A 1R1UA 2G9WA 3JSPA 4BACA 2P5KA 4K2EA 4CGZA 1PP7U 1P4XA 3DLLF 4M9ZA 2HS5A 3GCMA 5L3EA 4OMZA 2IW5A 3GFIA 2LR8A 1SD5A 2X48A 2EZLA 3KP3A 4UY8I 2QQ9A 2XAJA 1J9IA 4IPAA 1YX3A 3LSJA 2A6TA 2KIUA 4CCNA 3MVPA 1FPQA 3IH3A 3DKYA 3UR3C 3K4LA 2VT2A 3PQKA 3G3ZA 2X9DA 3BZ6A 4OMYA 2CWEA 1GDTA 4UVAA 1WGXA 3BR1A 4LOCA 4AUXA 4V19K 3A2KA 1T98A 2VC1A 5E79C 1KYZA 2M9HA 2QLZA 5E3OA 2NVYJ 3SJMA 4MLOA 2GIVA 4MQ9F 3QYFA 2E5ZA 3GTGJ 2D5VA 5E20A 2AQFA 2PMZN 1Z77A 4RB1A 3ZN0A 4LB6B 3BLYA 1D0YA 2PJPA 3H3ZA 5F1JA 2OPTA 2DK8A 3J7ZI 2LD5A 3JRIA 1RUOA 2JA2A 1FBSA 2A05A 5GPCA 3ZMTA 3CCVI 1S8NA 5J4VA 2EFWA 2EFNA 2VJJA 5M5XJ 5L3BA 1TZLA 2GZWA 3HM5A 3K0LA 1TQMA 5F1RA 2E34A 3OL4A 3WODF 2Z9OA 4PSXA 3KETA 1X3UA 3S14J 3LSHA 3RJPA 1GXPA 2IGOA 4B3XA 4UXNA 1EH7A 2P6SA 1U3EM 2H6BA 3QPSA 3ZQIA 4E6KG 2XPWA 3W6JB 4ZZDA 3OYMA 3CJQB 2L0KA 3FDYA 3H5AA 1BJAA 1F1ZA 2R5YB 1XSDA 1FP2A 1Q1HA 4M3DA 3IC7A 5IPAA 3DTEA 3BCBA 2NNNA 3HZJA 2X6YA 5AIPA 2DMPA 3JRDA 1A5JA 1XGMA 2ME0A 4JQFA 3ZMSA 4PFPA 1TWHJ 4V2GA 2XF5A 4L5EA 4XLPF 1RNLA 3HOTA 1T2KA 3OIPA 3HSFA 3HBLA 4L9TA 4YEJA 4B3AA 2L7ZA 1A31A 2F4OB 4IZZA 2DFFA 4LLNA 1OYIA 3V42A 3WHCA 2ELHA 2VOOA 3HTUA 4XONA 1KYWA 4Q47A 5K1YA 4BGDA 2LF8A 1KU3A 3NEUA 3RSNA 5IY5H 1MH3A 1MDMA 1LDDA 4A3CJ 1NH3A 2FXAA 1PDNC 2X6XA 1S29A 2KDZA 1QO0D 5C4XJ 3DCFA 1G4DA 3H92A 2STTA 2ZJRF 3S1MJ 5JVTA 1JKQC 2VJ4A 1QVTA 2CH0A 4XOTA 2CFOA 1Z7LA 1VQ4I 2QWWA 5LGTA 1ZGAA 1OPCA 2B9SA 2WC2A 3LL7A 4HZFA 3HOZJ 3CC2I 2GOXB 3ABTA 2DDBA 2X1EA 1VQ9I 3ECHA 4S05A 5L3GA 2E35A 2WB1N 2RC4A 2KRFA 4G6DA 3DBHB 4FISA 5K5RA 1LNWA 5ED4A 4BE2A 2Z5UA 1VF9A 5FLXK 2FX0A 4UUTA 3G6EI 4HF0A 1ON2A 4FETA 2E71A 2A69F 4M71A 4II3A 2VPRA 2QGUA 4NNJA 1RC9A 1BI1A 2M5WA 3F8MA 3N05A 3KP5A 1P4WA 1R36A 1DGRM 4M6VA 4A0XA 1SFUA 2F48A 5ILVA 4XLEA 4LK0F 3SXYA 1W36D 1J5YA 1LEAA 1POGA 3K1NA 4XLHA 2XIGA 2L9SA 4DZJA 5FB2A 5EG0A 4ABZA 1I6HJ 4FX0A 2L7MP 2QUFA 1WH7A 4HX7A 1D1AA 2PLYA 3CQZJ 2LC2A 4KIFA 3L2VA 1JT0A 1K7AA 1LDKB 4UV8A 1QHHD 2HQRA 3OYCA 2KISA 2BVLA 3BJAA 4JX4A 3HDDA 4F93B 1X2MA 1WJDA 2OC6A 5KNLA 2V7FA 2VBZA 1ETXA 1XB4A 2ZJQF 2MA3A 3NWTA 1E17A 4IJAA 1MGTA 2VI6A 3OYBA 4EATA 3E97A 3HUGA 3IL2A 2XDVA 3TP3A 4ENKA 4D0PA 1IN6A 3LSIA 2HDWA 4BJ5C 3HSEA 4L5JA 4LG0A 3H5NA 2R7TA 2RDPA 4BXUA 3LNQA 4PJJA 3UKGA 3ML6A 4KMUX 1T6SA 2EZHA 2CV2A 2V9KA 4BQOA 4Y7NJ 2Z99A 5H6RA 3O8GA 4A3DJ 2WV1A 1FBQA 1ZARA 2LSOA 1LUJB 1KQ9A 1R5GA 3RKYA 5E18F 4WF2A 3RKXA 4HSTA 2HWVA 3HIFA 2MD5A 2LREA 1H88C 3I64A 2L5QA 2R7OA 4XMYA 1A6QA 2DT6A 4C2TA 2LYCA 2A68F 4W1UA 3PNYA 3JTGA 2KQRA 2R3SA 3CCUI 3MD2A 3PQJA 2GAUA 3FMQA 3E3VA 1I3QJ 1BI3A 4KYWA 1IO2A 1MDMB 3PNVA 3L2CA 3KZYA 2M4GA 4PSWA 4UHTA 2AXTC 1IV6A 4C3JJ 1X1CA 2GLOA 3OYLA 3BTLA 2VXZA 2WWYA 5BOXA 1D5VA 3VSLA 4LLGF 3S93A 5FROA 5EEAA 1JKOC 3MZHA 1PJRA 1ETWA 1YG2A 3H9JA 3LAPA 1FLIA 2IGMA 2WAFA 1J75A 5IT9K 2B7EA 1YO5C 3BWGA 1R4MB 3LA3A 4LIVA 1U78A 3C2BA 3TMOA 4A0ZA 5LRSA 2VC0A 5IP9J 5A2QZ 4UUSB 2IGNA 3BCAA 1IJWC 5DCMA 4JOMA 3ZMVA 4XN3A 4QIWN 3CF2A 1IDZA 3TW6A 2VKDA 1DP3A 1MBFA 1Q1VA 1TW2A 2VE9A 3M07A 4HX4A 5HS7A 4MEYF 1R7JA 1X4PA 2KFDA 3BROA 1E0EA 1SEUA 3GLLA 2ECBA 3SFZA 3KLNA 3KP2A 2E1CA 1HKSA 2HQ5A 1MMDA 1K79A 1JKPC 3T1BA 4EJUA 5EG0B 1W5SA 2PMZA 3BG6A 4PCQA 3W6KB 2F5CA 2WAQN 3KFWX 2QBYA 5FRNA 4KA4A 1KU9A 3NWSA 5ERIA 4X0GA 2BVMA 1Z91A 2XSJC 2JA5J 1USTA 1O3RA 3GX4X 3QOPA 2EILH 4I01A 2R7QA 4CICA 1G59A 3ZQHA 4M3FA 1UG0A 2IS4A 2COMA 2LFBA 4A3LJ 2KKOA 2X6WA 1FNNA 2FA5A 3DEEA 5E8GA 1VQMI 3HUGB 1MNMC 3QPHA 2HYGD 5GAHJ 1MBKA 1RRJA 5D8LB 2W7NA 1WJ5A 3K1PA 1S3JA 1ZRFA 1OCZH 1HKQA 4ENMA 1OISA 1L0OC 2L9RA 1VQ6I 4A3GJ 1EH6A 3ONQA 5IP7J 2ID3A 1TTYA 3PSFA 1V5GA 3FMSA 1XMKA 1BI0A 2Y9ZA 5J1YA 3HOXJ 4P5OA 5F08A 5ICCA 4LGWA 2DAOA 4FQGA 3HHGA 2A5WA 1U0JA 4F7ZA 4XICA 1EJ9A 2LY2A 4FE4A 3EQLF 1QZZA 3L9FA 4G94A 5CQGA 2MC3A 4OU0A 1HQCA 4RM3A 4E4HA 2DN0A 3IP4B 4LMYA 1P4AA 4CYCA 2KZGA 2NYXA 2OAZA 1S7OA 1HC8A 2LRDA 1YITI 2CQXA 3QP6A 1XDSA 1JT6A 3N4MA 2GIZA 2DOEA 1ZRDA 1BJZA 3OS2A 1JKRC 2KT0A 2LOOA 2K9MA 1VQPI 1WFXA 3EDPA 3TP0A 2BY1A 3HTSB 2CMPA 1QQIA 2IA2A 4CXFA 4RLFA 2DMUA 1ZN2A 2KP6A 3LA2A 2W1OA 3C1DA 5EF6A 2ESNA 4G8XA 1GHCA 2DBBA 4HSRA 2CQKA 2FSWA 4JK1X 2H8RA 1DQUA 2CQQA 5K7FA 2O8XA 4P9UA 2LKSA 1E3PA 5ICEA 2P4WA 3CMEI 3C2HA 1W1WE 1U9OA 4A0YA 4M3EA 5JHFA 3DFGA 2JUGA 3QQAA 4BE0A 4ENJA 2W24A 3VEPA 2WAEA 4LD5A 1R58A 3JRCA 4E70A 4D7NA 1LFUP 3BR6A 2GBYA 5FGMA 1XTAA 2HR3A 5CVJA 1X3WB 1H0MA 1B8IA 1FEXA 5DCMB 4B09A 1ZGJA 2QF7A 3TQNA 1IRXA 4W97A 3SZTA 4ANJA 5BPDA 3F8BA 3HEFA 3HB9A 4S04A 3CC7I 4MFEA 2PBIA 1ETKA 3JTHA 3BR2A 3OIOA 4RB0A 3MMYB 1HF0A 4IHWA 2BHYA 3AFHA 1JUPA 1YRNA 3DPUA 1Z1DA 4R8HA 2ZB9A 3ESWB 2DDAA 3CO7C 2KJCA 2CW7A 2IP2A 2QENA 5GTHC 4U87A 2E1MB 2A5YB 1T39A 3D5LA 1BW5A 2ZFUA 4YG2F 4UB6C 2JRTA 2QZ8A 4PK4A 3RQ4A 3GTMJ 3HGGA 3BG3A 2XAFA 4Y4RA 5GAGJ 1IN4A 2KJBA 2KLOA 1SD4A 3I4NJ 1ORKA 2BY2A 4F91B 3WTWC 1XX5A 1TP4A 2BY3A 2QSFX 2GM4A 4OOIA 4Z2YA 4GYIA 1VI0A 2O61A 1SVMA 2RQPA 3FIWA 1MMGA 1OYWA 2EBIA 1K6YA 1WSUA 2EFQA 3SHFA 3JRBA 3WTTC 1IDYA 1W0UA 2NVTJ 3S3NA 1ZGWA 3ZQQA 1QZEA 3DPLC 2WA0A 4PGGA 2EZIA 4YIRX 2QM3A 4NC7A 4L9VA 2P6TA 4CSWA 4OIRF 4M3GA 3RZDJ 1G3YA 2OUMA 2NAZA 1D3YA 4B4CA 4RLQA 4ESJA 2Z16A 2A6HF 1P2FA 4ZYDA 2RREA 3JAMK 1ZR4A 2O8KA 2E7XA 2VPLA 3HRSA 2DMQA 2W82A 4BS9A 3ISPA 2Y2ZA 2CSOA 1YIOA 2G7HA 3EUAA 3FXLA 2V9PA 1XN7A 2G7UA 4A5NA 1RZ4A 2CQ7A 4KN4X 3KYLA 1JJ6C 2CQNA 3VYUB 4O6JA 3KLOA 3GBGA 4B8XA 2OV7A 2F5VA 4XOPA 2DT7B 3OYJA 1P92A 2QVOA 3VPRA 3FM5A 1MMNA 1SFEA 2N8GA 4EVIA 4CCOA 4CCLA 2XV4S 3ERMA 4Q48A 1FIPA 2M0CA 4RAZA 1RI7A 2R92J 2F4MB 3M7GA 4ZJZA 2ZC2A 5C4JJ 2FU4A 4ITVA 2XPUA 3VYTB 3WTYC 1AU7A 3CJNA 2MBFA 1RESA 1LB2A 2O9LA 1MJ9A 2EIKH 3VFZA 3BTCA 4ASNA 3WTSC 2ECCA 3IAM2 4XBFA 2E60A 4EJVA 1BR2A 3R61A 2FRHA 3SQNA 4O3MA 3KPHA 2EV6A 5ILSA 2ZCWA 1CGPA 3GYHX 1ZYRF 4EEFG 1LFPA 4CCJA 3M8EA 2BY0A 3DEUA 1VQNI 1OCPA 2R5YA 2NOGA 3PSIA 2Y30A 1OCOH 2IAIA 4GYGA 2DU9A 3GTJJ 1B8IB 3A01A 2CU7A 1FZPB 2EA2A 1YLFA 3OWTA 1YE9A 3WHBA 1HKTA 1MNEA 1R5ID 2WAQA 1A04A 4ZDPA 1FSHA 2ESHA 4H0EA 1VQOI 1VTNC 5EJCA 1YOVB 1HSJA 4LG3A 1I3AA 1YRNB 2VB6A 2W00A 1ZELA 4QSHA 3GVAA 3K1MA 1VQ5I 1SMYF 4EQQA 3BOQA 3B6CA 4FT8A 2BW3B 3ZPLA 2VOPA 3CCSI 1G3WA 3D1NI 4HOBA 3ASNH 3RTRA 4A3MJ 2EFPA 3DXJF 3FBIB 3H5RA 4A5MA 1WJAA 5B1AH 3I3LA 4QLCU 4FX4A 1DDNA 3GWZA 3S3OA 1DPRA 1QU3A 5B1BH 2VJ5A 1GVJA 1X58A 1LDJA 3S17J 5E17F 3G2BA 2A61A 2MH2A 4IRHA 4YRVA 2LBFA 2NOJB 4PJLA 4IHXA 4A6EA 3LSTA 4IRGA 4BEHA 4HDUA 2YU9J 1DGWY 1I6XA 3TOAA 5CLSA 1JGSA 3S1QJ 4NC8A 2IXSA 4MFDA 4Y3OA 4ZYGA 1BR1A 4WXDA 4KT5C 5TISC 1YYVA 2VN2A 4RDUA 2DPUA 2GWRA 2A07F 1IUYA 3OSFA 2EA4A 1VQLI 4D5CA 5B5EC 2Z33A 1XS9A 3J81K 1BI2A 2LY1A 2VE8A 3RCOA 3IRRA 1U8RA 4UB8C 3CMAI 2NVQJ 2RN7A 4D7MA 2Y75A 3TL4X 1BBYA 2KZVA 3IHUA 2CUJA 2L7FP 2PG4A 4IHYA 2HTJA 4CZCA 3FHZA 4IHSA 3LA7A 5CJ9A 4BL0B 4XK4A 1HLVA 2JWTA 1R1TA 4R1HA 4ZTFA 2NS8A 1TWFJ 2ZBKA 2R93J 3KP7A 4U7DA 1LVKA 2HYFA 1HCRA 3BR0A 3BR3A 3DTIA 1QZYA 4HW0A 2KRHA 1W4MA 5HS8A 3OYHA 3FXOA 3OY9A 1L3LA 3HXLA 3OV8A 2QSHX 2PN6A 2EZKA 1DUXC 5H20A 5AIQA 2Y0SA 2E2IJ 1G3SA 3LOCA 2R7SA 1KQ8A 1YW9A 3TKYA 2CGPA 4QPOA 3MKWB 2DTZA 5FFZA 3PIPF 3CP8A 1A6IA 2PX9A 3K10A 4QTRA 3IAS2 4RS8A 1PUEE 1UFMA 1FOYA 2R7VA 1S7AA 2KL4A 3PNTA 1B1BA 3WU1B 4L0YB 2DLLA 3CUQA 5DUIA 1ETQA 4XORA 4DYRA 3CCMI 4NQWB 5LHIA 3BJOA 3F0CA 3QWLA 3U2RA 1SFOJ 1ZLJA 3GMEA 3E6BA 2O7OA 1WZ2A 3HPHA 1BOBA 4IQJA 1BL0A 1R9TJ 1HA8A 2W57A 4JX6A 2Q0OA 2PEXA 3E5XA 1JUMA 3BR5A 3E7LA 4Y17A 3A01B 2HZDA 4F3QA 4DJAA 3Q9SA 3IWFA 4B44A 4HQEA 3WE2A 1YTYA 2DJIA 1D1CA 2JJ7A 4P55A 1KONA 1R23A 2VBWA 2XB0X 1ZTRA 1GUUA 2O3FA 3KYDB 3KZIC 2AS5F 3CD6I 1C0WA 2IS1A 3LSMA 1X1PA 3K4JA 3AKZA 3H35A 4HV6A 3SZPA 3N97A 1XD7A 1N77A 2EK5A 3S3MA 4PJ0C 1Z7UA 1UJ8A 1BA5A 5EZGA 4IHTA 2UXXA 3KP4A 3ZMDA 2FNPA 2HDCA 1D1BA 1FSEA 2V1DA 3HJEA 3KCCA 3S15J 5D8KB 5LFAA 5F04A 3HOUJ 4Q4ZF 2LBFB 3CCJI 5J1UA 1QBJA 4BEHB 3L2UA 5IYDJ 2FMYA 3VOEA 2TCTA 1IN7A 5KK1A 3TO6A 2ZMEA 2Y69H 4HLXA 4PDKA 3CMMA 3U1KA 5HS9A 2RV8A 5FLMJ 2DMNA 2EWNA 4IEJA 1T33A 3VYRB 1UZCA 4NBQA 4UUSA 2BOLA 2K9NA 1D8JA 2H09A 3HOVJ 4XLFA 3CDHA 2MLKA 3DTKA 2WV0A 4NHJA 5DD4A 5D6EA 1QRYA 1YIJI 5BMZA 1YW7A 4BH9A 4WX9A 2BBYA 4I76A 1BIBA 3KX2A 3QPTA 2ZNZA 2FBIA 4QWQA 2OD5A 2XKPA 3FXQA 3CMYA 1OQYA 1ZR2A 2PMHA 3FXUA 1YHQI 2F4IA 2L02A 3M8JA 4DW6A 2X1DA 4M6XA 2DA4A 3V7RA 4DNCA 4AU7A 1T0FC 4BXXJ 1Y6IA 2GA1A 2JZYA 2NVUB 1F43A 2FNAA 2FBKA 2CV0A 2V1XA 4AWXB 4EJOA 1UCRA 4C30A 4IOAF 3AG3H 2H1KA 3BZKA 4ZC3A 3TEDA 2VUMJ
chains in the Genus database with same CATH topology
3OMYA 2IS4A 1WJCA 1X1BA 2X6WA 2MD0A 3HKZA 2R7WA 3DEEA 4J01A 4DBQA 3HUGB 3OYNA 4R79A 4DGWB 1WJ5A 3PL8A 2E1MC 2W7NA 3M1CA 3SDBA 3ONQA 2K9LA 2DCEA 3PSFA 1V5GA 4XKCA 4P5OA 4ZYAA 3VDXA 4CA0A 3OYFA 4CUGA 4E7LA 2A5WA 1U0JA 3DPTA 2X1CA 2AQEA 2LY2A 2R7XA 5LD2C 1N75A 5CQGA 4PJNA 1P9QC 4RM3A 4LITA 4E4HA 3H0DA 2M3AA 3SZGA 2V26A 3IP4B 4KJZA 2V6EA 4AYBA 2HQAA 2L7KA 1LKXA 2LRDA 3QYEA 4IKFA 4XKVA 2VL8A 1FMVA 2K5CA 4E7IA 2JVGA 3OS2A 2HNHA 2LOOA 2K9MA 2F6CA 3OYEA 1V5FA 4GRIA 1WFXA 2CV1A 2VQHA 1OR7C 2WADA 3VWBA 4U7BA 4HNUA 2CMPA 2JVHA 4RLFA 3H9GA 2KP6A 5HVQC 4IX7A 4E7ZA 2W1OA 2X51A 4E7JA 3PUBA 2R7UA 4HSRA 1X1AA 4J00A 4DBRA 5HNFA 5KHDA 1DQUA 3OIQA 1SAUA 1X1DA 3K4NA 3ZRGA 1Z3YA 4Y33A 3D5SC 3EUKL 4YELA 3C2HA 3L2QA 5JHFA 2JUGA 3FHNA 4D1QA 2KRCA 3CESA 4BE0A 1V5EA 1ERDA 2JSPA 2WAEA 4ZTJA 2VASA 3VSKA 3A4CA 5HNHA 4BDZA 3SEZA 4OAYA 2Z1DA 4ZDLA 3SEQA 4DOZA 4QPQA 3PJRA 1IRXA 2WY7Q 4ANJA 1NG7A 2KHMA 4HG2A 3CZ6A 3MMYB 4E7KA 3AFHA 3F9KA 2VIXA 1NG6A 1WJFA 3DPUA 3OR1C 2XC7A 3BG7A 2CW7A 3OYIA 2L9NA 4U87A 2E1MB 3D5LA 2ZFUA 4PK4A 3RQ4A 4E7SA 2UUZA 4XR6A 2CW8A 2MYSA 4Y4RA 4AVZA 2KLOA 3DKXA 4F91B 4BACA 2Q1ZB 4H4KC 2XF6A 1Z21A 3FKJA 3ZR8X 1AA7A 2KPMA 2HVQA 1MMGA 1K6YA 3E1SA 2W4SA 4HPQA 2ZSHB 3S3NA 2L2OA 3RPUD 3ZQQA 1UAAA 3DPLC 2WA0A 2QKMB 1YX3A 3DU6A 2XF7A 2A6TA 4NC7A 4CCNA 3U21A 4CSWA 3DKYA 3UR3C 3K4LA 2R7RA 2OUMA 3CJRB 4IQ4A 4F92B 4RLQA 2Z16A 4LIUA 2RREA 3A2KA 3HL2A 4BQNA 2VPLA 2W82A 4N4OB 3OYDA 4BS9A 3W2WA 3EUAA 4MLOA 5FRMA 3J7AY 1WJEA 2CUZA 2E5ZA 3QYFA 3KYLA 4OWRB 4HRIA 1X4OA 3VYUB 4PJMA 2AQFA 3GBGA 4BE1A 3K4BA 2OV7A 2F5VA 4XOPA 2DT7B 3OYJA 2KMUA 3BLYA 1D0YA 3W2AA 1MMNA 3S8PA 4CCOA 2JA2A 2O5RA 4XLAA 4CH7A 3OYAA 4CCLA 3AL0B 1S9HA 2HPMA 3HG9A 4PFOA 3C2GA 2VJJA 4OAZA 3SYTA 1TZLA 3EPZA 4ZJZA 3TBIA 3OL4A 4ITVA 4PSXA 4PUSA 3VYTB 3LSHA 2IGOA 1D0ZA 1GLNA 2MFZA 4B3XA 2RNGA 1N78A 1G8XA 4E6KG 3IAM2 2E60A 3OYMA 1BR2A 3CJQB 3FDYA 3H5AA 1FMWA 2DOAA 3L2WA 3DTEA 3BCBA 1LFPA 2X6YA 4CCJA 4JQFA 3DU5A 3PSIA 4PFPA 2HU9A 2XF5A 2MC4A 3FBNB 3OYKA 3HOTA 3OIPA 2M0MA 1T95A 5CKTA 4YEJA 4KT6A 3I9V2 1MNDA 3OWTA 1YE9A 4IZZA 1MNEA 3K4KA 3V42A 2WAQA 4ZDPA 4XONA 4BGDA 1OLTA 3RSNA 4LG3A 2VB6A 2W00A 1ZELA 2IGKA 1UELB 1WJBA 2BW3B 2CS3A 4P1WA 2X6XA 3RTRA 3S32A 3CP2A 3FBIB 2ZXIA 3H5RA 1WJAA 3I3LA 2BW3A 1BR4A 3S3OA 2VJ4A 1QU3A 2CH0A 2M4KA 2ELJA 2VJ5A 2WBMA 2CFOA 1Z7LA 4XOTA 4CCKA 1J09A 3E0JB 3G2BA 3LL7A 2VKHA 2E5NA 4YRVA 2GOXB 2LBFA 2NOJB 2X1EA 4PJLA 4BEHA 1DGWY 3DWLE 2LG4A 4NC8A 2IXSA 4BE2A 2M7AA 4Y3OA 1BR1A 4FETA 3HOSA 4II3A 1X19A 4B47A 2I8DA 2VXDA 4NNJA 4RM2A 2HVSA 2LY1A 2Z2SB 3KEYA 3RCOA 1JI8A 2M7BA 4KISA 3N05A 3TL4X 1DGRM 2HPIA 4E7HA 2HVRA 2KZVA 2CUJA 3W3CA 4XLEA 4CZCA 4C9YA 4BL0B 1W36D 3K70D 4XLHA 1QHGA 2L9SA 1VZ0A 4FASD 4ZTFA 4XL9A 3BC8A 3HC7A 1D1AA 3LFUA 5HLTA 1SFKA 2LC2A 3L2VA 4F55A 1LVKA 1LDKB 1QHHD 3DTIA 3K4CA 3OYCA 3LSGA 4BDYA 2KRHA 1R6RA 4G6TB 2BVLA 3L2RA 3QYBA 4F93B 2P0WA 3HPGA 1WJDA 2OC6A 3VYSB 5KNLA 2PJRA 2V7FA 3OYHA 3OY9A 3OYGA 3HXLA 2VLAA 3UNGC 3NWTA 2RQQA 3ZGKA 1TT0A 3K4MA 3OYBA 2GOMA 4EATA 3OL3A 2Y0SA 2ZXHA 2XDVA 2R7SA 1YX5A 2VQLA 4QPOA 3MKWB 2LH9A 3CP8A 3LSIA 2IS2A 2HDWA 1D0XA 4BJ5C 3K10A 4XKWA 4BXFA 3IAS2 2K3PA 3H5NA 4BUPA 2R7TA 3A1YA 2R7VA 5TGTA 2KL4A 3PNTA 4PJJA 4XNFA 3D5RC 3IUOA 3PFYA 4D9JA 2CV2A 2V9KA 1MMAA 3ZXSA 4BQOA 3DLAA 4XORA 4NQWB 3QODA 1Y56A 2VQGA 2V4JC 1BOBA 3HPHA 4IQJA 5KCMA 4XN0A 4B43A 1HA8A 4HSTA 3OOUA 3LSKA 4BJTA 2LREA 1MW7A 2HZDA 2L5QA 2R7OA 4XMYA 4DJAA 2DT6A 2FUG2 3K6GA 4F3QA 4C2TA 4B44A 2LYCA 4II2A 3OS1A 3PNYA 2KQRA 2DJIA 1D1CA 4BQQA 4KITB 3MD2A 1KONA 2WY8Q 4B48A 4RMNA 2IS6A 2WB1A 4XLCA 2R4GA 2IS1A 3LSMA 3PNVA 3ZCOA 4PSWA 2M4GA 3K4JA 3AKZA 3H35A 3W2VA 4XQFA 3OR2C 1N77A 1X1CA 3S3MA 3OYLA 2VXZA 2VJIA 2XAUA 2Q2EB 4F52A 3VSLA 3S93A 1W36C 5FROA 3K70C 4ZDOA 1D1BA 1PJRA 2QKLB 3H9JA 4HNTA 2IGMA 2WAFA 3AL0C 5LFAA 4N4NB 2LBFB 4LIVA 4HEA2 3QOEA 4BEHB 3L2UA 2KDOA 4BU2A 3TMOA 1EA3A 4BJ6C 3H9QA 2UWMA 3DQVC 2UV1A 2IGNA 3BCAA 3CMMA 3LMMA 4JOMA 4XN3A 4DIQA 3CF2A 2X85A 3VYRB 2VKDA 1DP3A 5CPRB 2BOLA 3EUHC 2DXIA 4XLFA 4CCMA 3DTKA 1Z3XA 1X4PA 1E0EA 3MKZA 1MMDA 3KX2A 2VQCA 2PMZA 3BG6A 5CQEA 3OS0A 2MABA 5FRNA 4X0GA 3NWSA 2BVMA 2XSJC 4NUBA 2F4IA 4C2UA 2ZSIB 3M8JA 2X1DA 4AU7A 1PYVA 1T0FC 1Y6IA 4XKBA 4XM3A 3MKYB 2CV0A 2R7QA 2V1NA 4C30A 5HOOA 1G59A 4ZC3A 2PJRB 1UG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQR A;  4ZYA A; 
#chains in the Genus database with same CATH topology
 1Y39 A;  5GP9 A;  1SD6 A;  2XPV A;  2R7W A;  4J01 A;  3BJ6 A;  2P7C B;  4GFB A;  2IEK A;  3PO3 J;  1S6L A;  4A69 C;  4I2O A;  1H8A C;  3AG4 H;  1U5T C;  3ROU A;  4R79 A;  4DGW B;  1JJ8 C;  3CCE I;  1B9N A;  1UMQ A;  2EV0 A;  3IKT A;  1F4K A;  3CDI A;  1YS7 A;  1KZH A;  3JRG A;  2K9L A;  3RZO J;  4FE7 A;  4IOC F;  4XKC A;  5E3L A;  1GT0 C;  5L3D A;  4N9I A;  4BKX A;  3CUQ B;  1B72 A;  2WTE A;  4U0V A;  2ZKZ A;  2X1C A;  1H9G A;  3F6V A;  2I5U A;  4L0Z B;  4O5V A;  1LFB A;  3DEW A;  2O6G E;  3IWZ A;  2M3A A;  1FOW A;  3ERE D;  4UUV A;  1EKE A;  2ISY A;  2E7W A;  1HW5 A;  3GZN B;  3FXR A;  4ENN A;  2LKP A;  4G7Z F;  2XHK A;  3QYE A;  2DA1 A;  1IAW A;  1IV8 A;  1F9N A;  5CVV A;  2H94 A;  2E1N A;  3GEZ A;  5FKL A;  2VQH A;  2WAD A;  2MGQ A;  5DYM A;  4XRF A;  1IRZ A;  5KAI C;  1NTC A;  3KP6 A;  4XRM A;  1IRG A;  1JHF A;  3TDZ C;  4X6A J;  3B02 A;  4EJT A;  3H9G A;  3GTL J;  1VQ8 I;  4IX7 A;  2E36 A;  4E7J A;  2BE5 F;  1FBU A;  4HF1 A;  1Y0N A;  2J5O A;  3S2H J;  3MEX A;  1X1A A;  5ICF A;  1HBX G;  1DU6 A;  5HNF A;  3QU3 A;  2RKH A;  5IYC J;  4RBO A;  5J8C A;  3D5S C;  3AAF A;  3FM3 A;  4RA2 A;  2ACJ A;  3EUK L;  4YEL A;  3CDL A;  3JR9 A;  3EUH A;  1WWX A;  2MW8 A;  3TGN A;  5HLH A;  4D1Q A;  1IF1 A;  5HOD A;  2M30 A;  2R0Q C;  2VAS A;  1AHD P;  2ZME B;  2V79 A;  4LLL A;  5HNH A;  4BDZ A;  3R60 A;  5IT3 A;  4RAF A;  5M3M J;  3BQY A;  2VKE A;  4ZDL A;  2Z1D A;  3A03 A;  3SEQ A;  4DOZ A;  3L00 A;  1EH8 A;  2DPD A;  2QA4 I;  2ME6 A;  3I55 I;  1KU2 A;  1P7I A;  1WRJ A;  5FO5 A;  1NG7 A;  2KHM A;  3R0J A;  1J59 A;  4A3B J;  3CZ6 A;  2DQL A;  2DTR A;  3F9K A;  2VIX A;  1ZRE A;  1WJF A;  1SFX A;  3HHH A;  3BPX A;  2JA7 J;  2XC7 A;  3OSG A;  2L9N A;  5LLQ A;  3HRU A;  2ICW G;  1D5Y A;  1IN8 A;  1FOX A;  1FY7 A;  3GLX A;  3G71 I;  2CUE A;  4HNV A;  3V8K A;  2DA7 A;  4AVZ A;  3RKQ A;  3ZQC A;  1UHW A;  2Q1Z B;  1TNT A;  2XF6 A;  3O6B B;  1Z21 A;  3FKJ A;  3ZR8 X;  2LKX A;  1DP7 P;  2FOK A;  1MBE A;  2XVC A;  3S16 J;  2JT1 A;  3H36 A;  2ZFW A;  1TQP A;  5KAF C;  2DMT A;  4FTH A;  2MH9 A;  2L2O A;  3RPU D;  2OF7 A;  2JRM A;  5F6F A;  5BPI A;  2DA6 A;  5DD8 A;  1MSE C;  3DU6 A;  1OJL A;  3I58 A;  2C6Y A;  4XRS G;  5DDG A;  5K7H A;  2IA1 A;  3P9I A;  5DEQ A;  5A2Q K;  2XRO A;  3E6C C;  2R7R A;  5D5X B;  3MCZ A;  2XAQ A;  3RI4 A;  2IA0 A;  5D6F A;  3BT9 A;  3GO5 A;  1B72 B;  4YFK F;  3T5X A;  3DF8 A;  3HL2 A;  3IRQ A;  2Q8K A;  1WH5 A;  4WCG A;  3OYD A;  3JRF A;  5F64 A;  3W2W A;  2V1U A;  3FMR A;  1S7E A;  2CYY A;  2JPC A;  3WTU C;  3P9C A;  1V4R A;  5FRM A;  3FF5 A;  2DQR A;  1WJE A;  2CUZ A;  1V55 H;  4BYY A;  4MTE A;  1X4O A;  2XAG A;  5M5Y J;  4HRI A;  4GDF A;  4PJM A;  1PUF A;  4BE1 A;  5J47 A;  1ZH5 A;  5M5W J;  4DYC A;  5GTI C;  2AHQ A;  4EM1 A;  2JUC A;  1KQ0 A;  1I1S A;  4CH7 A;  4A3F J;  3OYA A;  3AL0 B;  2HPM A;  5HDN A;  4PFO A;  3C2G A;  2CRG A;  2M8E A;  3E6M A;  4JBA A;  3ELK A;  3EPZ A;  1Y8Q B;  2L01 A;  2BEO A;  2X4H A;  4JP0 A;  5GAD J;  3HKZ N;  3PUF A;  3WGI A;  2RNG A;  1G8X A;  3X2Q H;  1OYY A;  2P7V B;  2YPR A;  1UHM A;  2DOA A;  3LSP A;  2IPQ X;  2OBP A;  2O03 A;  2Y0S N;  4MIM A;  3VB2 A;  4WWC A;  2LP0 A;  3DU5 A;  2LDU A;  2RVC A;  2RGV A;  2HU9 A;  2DJN A;  1OCT C;  1R1V A;  3FBN B;  5CKT A;  1T95 A;  5DUK A;  1FP1 D;  2F5D A;  3I9V 2;  1TBX A;  3H3U A;  1H9T A;  4RGU A;  1MND A;  1W7P D;  1BIA A;  4I7H A;  1BC7 C;  4EJW A;  4LJZ F;  2PFB A;  2R7Z J;  4BHP A;  1HDP A;  1BOA A;  3FIS A;  4S0H B;  3NAU A;  4M9S A;  3BTJ A;  2CJJ A;  3MQ0 A;  2Y31 A;  4AYB N;  4BAY A;  4BQA A;  1DPU A;  1I1G A;  3ABU A;  4Q5S F;  2QQA A;  1MKM A;  1QNT A;  2CS3 A;  3ZQF A;  1O57 A;  3FKI J;  2UXN A;  3HGY A;  3P7N A;  5DV5 A;  2I10 A;  3QP5 A;  1PP8 F;  1XGO A;  2GXG A;  2HTS A;  4HV5 A;  2BW3 A;  2Q2E A;  4CZZ A;  1BR4 A;  3REO A;  5TRD A;  2VT3 A;  3QRF F;  2XAS A;  2M4K A;  2ELJ A;  2WBM A;  2YU3 A;  1K61 A;  4WXC A;  4CCK A;  5F0H A;  1B4A A;  2YSR A;  2E5N A;  1BC8 C;  3MN2 A;  1Z0X A;  3J7A O;  1TW3 A;  2BGC A;  2JK3 A;  3DWL E;  1MMS A;  5H6Q A;  2QCO A;  2XGE A;  3Q0W A;  2M7A A;  1J2X A;  1ZHF A;  1YS6 A;  2LVS A;  3HOS A;  4WXH A;  3B73 A;  4RGX A;  1VQK I;  2IVM A;  1X19 A;  1EV7 A;  2XB5 A;  3WTZ A;  4B47 A;  4RM2 A;  4HDV A;  2Z2S B;  3CTA A;  2HOE A;  3ECO A;  3KEY A;  3P9K A;  1YI2 I;  2M7B A;  1T38 A;  4I6Z A;  1U8B A;  1TLH B;  3GZ6 A;  3O8H A;  2HVR A;  3HRM A;  4BBR J;  2OZ6 A;  1J0R A;  3W3C A;  1R71 A;  5LHG A;  4KDP A;  2ID6 A;  4ESF A;  4C9Y A;  5FLV A;  3IH4 A;  5EEG A;  2DW4 A;  3CF5 F;  2YS9 A;  1QHG A;  1W7P A;  2L4A A;  4XL9 A;  3VOD A;  3BC8 A;  3HC7 A;  3LFU A;  2BHZ A;  2EIM H;  3MZY A;  5HLT A;  2M1B A;  1SFK A;  2VON A;  4F55 A;  3HRT A;  4IVN A;  2FD5 A;  3LSG A;  4M73 A;  3LFK A;  3EET A;  4BDY A;  1R6R A;  3R4K A;  1RR8 C;  1PUF B;  3QYB A;  3JCU C;  1G2H A;  2P0W A;  2DYS H;  3HPG A;  4Y13 A;  1R49 A;  2PJR A;  4OIO F;  1O4X A;  2VLA A;  3BY6 A;  2RQQ A;  4L5I A;  2XAH A;  3ZGK A;  1TT0 A;  3K4M A;  3WU0 A;  1B9M A;  2GOM A;  2ZXH A;  4PZJ A;  4EMS A;  3ZQL A;  2EQR A;  1YX5 A;  2Z3Y A;  3JSO A;  3S2D J;  3IKV A;  2E2H J;  2HYJ A;  1G3T A;  3TOB A;  4P9F A;  4A3E J;  1D0X A;  1ETY A;  2JPB A;  4HYE A;  5JLX A;  4BXF A;  3ZP5 A;  2K3P A;  4XNF A;  2V9V A;  3D5R C;  2HFH A;  1N25 A;  2R7D A;  4B1R A;  3ZXS A;  2HOS A;  4U0W A;  2YR2 A;  2K40 A;  3QOD A;  5K7Z A;  3GFM A;  1IC8 A;  3QAH A;  3TW7 A;  2CW0 F;  3G73 A;  1LE8 B;  4CDG A;  1K78 A;  2VQG A;  4HX8 A;  2V4J C;  3F8N A;  3HSR A;  2VBX A;  2OJE D;  3GZ5 A;  4LFU A;  4NQW A;  4RGR A;  2BXY A;  4XN0 A;  4ETS A;  1REP C;  3OOU A;  1Z05 A;  1U9N A;  3LSK A;  4BJT A;  2JMW A;  2ELK A;  2R7F A;  4YII A;  2CO5 A;  4II2 A;  1MSF C;  1WKM A;  3V4G A;  5J8F A;  5JLW A;  4HLY A;  1FJL A;  4I98 B;  3NRV A;  1ZG1 A;  3COA C;  2WY8 Q;  2IBD A;  2QYO A;  5DS9 A;  2OZU A;  4B48 A;  2R4G A;  3ZCO A;  3L1P A;  4BBS J;  2FEZ A;  2XKO A;  3W2V A;  1IN5 A;  3I4P A;  4XQF A;  3OR2 C;  1ETO A;  3WGG A;  4A3K J;  3K70 D;  2DA5 A;  2Y0M A;  1XGN A;  1I27 A;  3FK6 A;  3R0A A;  2VJI A;  1TQI A;  2Q2E B;  4KIG A;  4F52 A;  3H3V K;  1SVL A;  1W5T A;  2FML A;  2ZXW H;  4ZDO A;  2KIQ A;  4HNT A;  4N4N B;  3F21 A;  4MO7 A;  5E3M A;  4HEA 2;  3QOE A;  4G9Y A;  1B59 A;  5FKK A;  4U0Y A;  3F3X A;  1EA3 A;  4BJ6 C;  2K4B A;  1RET A;  3H9Q A;  2MG4 A;  5D5U B;  1FOK A;  5KVR A;  2E19 A;  2UV1 A;  3I54 A;  4XSZ F;  2K27 A;  3LMM A;  4L9N A;  1R00 A;  2STW A;  1J7K A;  2IJL A;  4BHC A;  5E3N A;  1V3F A;  2CFX A;  2G0E A;  1ZKG A;  2EJR A;  2XRN A;  5CPR B;  4MQV A;  2H6C A;  5FKO A;  3WGH A;  2DXI A;  4P96 A;  2KIF A;  3I71 A;  5CYV A;  2JA8 J;  1O3Q A;  5L3F A;  1HXD A;  1R5H A;  2ZXJ A;  5K5Q A;  1TL8 A;  5LBQ A;  2Y9Y A;  4A12 A;  3MKZ A;  3CCL I;  3GXO A;  2DFE A;  3DBR B;  2VQC A;  1U5T A;  5CQE A;  3CUO A;  4YFX F;  3SFI A;  3OS0 A;  1W7P B;  2V6C A;  2HQN A;  4IO9 F;  1T8I A;  4ON0 A;  2J5P A;  3CCQ I;  1KGS A;  1Y8R B;  3LAJ A;  4NUB A;  3B6A A;  3T8R A;  2YUS A;  4Z6Y A;  5EDN A;  1HW2 A;  4XM3 A;  3ABM H;  4RB3 C;  2EB7 A;  4EGZ A;  3OOP A;  3MKY B;  2V1N A;  1AKH A;  4L18 B;  5HOO A;  1OCR H;  4MTD A;  3BTI A;  1JGG A;  2PJR B;  4FCY A;  5H2F C;  1FC3 A;  2MD0 A;  3HKZ A;  2HKX A;  3E5Q A;  5B3S H;  2IT0 A;  1JHH A;  1RUN A;  3ABK H;  3PL8 A;  3BG9 A;  3GUD A;  1T56 A;  3M1C A;  2BZT A;  3SDB A;  3V8L A;  4KUM A;  2K02 A;  3QU6 A;  5D4S A;  1H89 C;  1G6N A;  4HA8 A;  3WE3 A;  5GAE J;  5B66 C;  4M3B A;  2QQB A;  1RKW A;  4ZYA A;  3Q3S A;  5JI6 A;  1W0T A;  6PAX A;  3LQQ A;  2D2W A;  1FTZ A;  4RAY A;  4CA0 A;  4D5F A;  3OYF A;  1R22 A;  3DPT A;  3GFL A;  3WG7 H;  4G7O F;  1V54 H;  5LRR A;  3T8T A;  2K4J A;  5LD2 C;  1ZRC A;  2OTJ I;  2YX4 A;  5DCF A;  4PJN A;  1P9Q C;  4LIT A;  2FQ4 A;  1K78 B;  3SZG A;  4U88 A;  3GTQ J;  2H8W A;  2V26 A;  4KJZ A;  2VKV A;  4AYB A;  2HQA A;  5FD5 A;  3Q9V A;  2VL8 A;  2K5C A;  4E7I A;  2JVG A;  3FZV A;  3ASO H;  4Y15 A;  2F6C A;  3OYE A;  3S2W A;  5JHU A;  1V5F A;  4GRI A;  3C7J A;  2GA2 A;  1OR7 C;  2CV1 A;  3VWB A;  2L3D A;  4RGS A;  3H0G J;  3V7S A;  4HNU A;  5FKN A;  3RQI A;  2GXB A;  3GTO J;  5E1Z B;  4E7Z A;  3V8J A;  4ZH4 F;  1P7J A;  3G4S I;  2X51 A;  2R7U A;  2HI3 A;  1IGN A;  1ULY A;  4DBR A;  3F72 A;  1FYM A;  3IV5 A;  1Z6T A;  4I0A A;  2F2E A;  2L4M A;  1SAU A;  2P81 A;  4LK1 F;  3K4N A;  5BS6 A;  5FLX Z;  4NB5 A;  4Y33 A;  5FFX A;  2OA4 A;  1Z67 A;  1RIO H;  4UVC A;  3L2Q A;  3RKW A;  1NK3 P;  2NVX J;  4TV7 A;  3FHN A;  3KE2 A;  3LQR A;  5J40 A;  2R5Z A;  2JSP A;  1LJ9 A;  2HKO A;  5C44 J;  1QA6 A;  5JR3 A;  2W85 A;  3TO7 A;  3A4C A;  1BN5 A;  2ADU A;  4EGY A;  4QPQ A;  3PFI A;  2WY7 Q;  1OCC H;  4UVB A;  5HDG A;  4IF4 A;  5GPA A;  4A2U A;  2JA6 J;  3RDI A;  1NK2 P;  5E1W A;  5BQT A;  4HG2 A;  2M34 A;  1ONV A;  2ZJP F;  2ETH A;  3GF2 A;  1ZLK A;  3Q0U A;  4CO8 A;  1O3T A;  4AC0 A;  1IXC A;  1UG2 A;  3AG1 H;  2H1L A;  4EM0 B;  3QPL A;  1U5T B;  1XMX A;  4ZYH A;  1JUS A;  4IRI A;  3O3K A;  2ZJ2 A;  1FYL A;  1MD0 A;  3FX3 A;  4E7S A;  1FTT A;  4XR6 A;  2MYS A;  5J6X A;  2BYV E;  2K7L A;  3CO6 C;  1A36 A;  2B0L A;  3DV8 A;  3DKX A;  4GXO A;  3FXM A;  2KIM A;  1AKH B;  4H4K C;  2UZK A;  2O0Y A;  1GVD A;  3MFK A;  3RYP A;  4ESB A;  1AA7 A;  2KPM A;  3P5J A;  2HVQ A;  1OMI A;  2DYR H;  1WI3 A;  1YFH A;  3E1S A;  2W4S A;  4HPQ A;  2ZSH B;  2GQQ A;  1UAA A;  2FJ1 A;  3F8F A;  4XSX F;  5IOY A;  2QKM B;  1QPI A;  1WCM J;  1RR7 A;  2XF7 A;  5CVU A;  1IZ1 A;  3U21 A;  1K83 J;  4AM3 A;  1O7F A;  2K85 A;  3MWM A;  5DM7 F;  4M6Y A;  4G12 A;  3CJR B;  3ZQG A;  4IQ4 A;  4F92 B;  3F8C A;  4LIU A;  1HOM A;  1E3H A;  1ON1 A;  1QGP A;  3S1R J;  2LNB A;  4BQN A;  4X1E A;  4N4O B;  3ZN1 A;  3O2P E;  4GCV A;  5FD6 A;  1GV5 A;  2OCC H;  3I0T A;  3WG9 A;  3J7A Y;  1IUF A;  4OWR B;  1Y1W J;  3R6S A;  4FHT A;  4GGG A;  3K4B A;  3MAJ A;  4IL6 C;  3SDG A;  4HBL A;  5LEJ A;  2KMU A;  2ZO4 A;  1UB9 A;  1SMT A;  3W2A A;  4MHG A;  1LVA A;  3I56 I;  1ACI A;  1IXR C;  3S8P A;  3ABL H;  2O5R A;  1S5L C;  1Z6R A;  1P6R A;  4XLA A;  4CYD A;  1S9H A;  2DA2 A;  3E5U A;  3HG9 A;  2X6O A;  2PQ8 A;  2COB A;  2HGC A;  1I39 A;  4WK8 F;  4OAZ A;  3SYT A;  5IT9 Z;  1ITY A;  1AWC A;  3H1C A;  3TBI A;  2LY9 A;  4PUS A;  1K4T A;  5LGN A;  2LMD A;  1AOY A;  3BG5 A;  1D0Z A;  1GLN A;  2MFZ A;  4I02 A;  5CVI A;  4KIB A;  1A35 A;  4RB2 C;  1N78 A;  5IP6 A;  2AXL A;  3CCY A;  2Y48 A;  1TWC J;  1WPK A;  2B63 J;  2GXA A;  2HEO A;  1FMW A;  1YQA A;  3L2W A;  3GW2 A;  4DZP A;  4AIK A;  2PMU A;  1SAN A;  2R5Z B;  4MGR A;  1ETV A;  1UHS A;  5JFR A;  2MC4 A;  5EGO A;  3T0Y A;  3OYK A;  5D4R A;  2M0M A;  4G6Q A;  1ZQ3 P;  4KT6 A;  1HW1 A;  3CUQ C;  1K4S A;  3WTX C;  1CQT A;  3K4K A;  2H27 A;  1OLT A;  1MBG A;  2YX7 A;  2EIJ H;  5HLG A;  2IGK A;  1WHU A;  2CUF A;  2M87 A;  1UEL B;  1WJB A;  3K7A J;  4P1W A;  2PI0 A;  1XG1 A;  2K9S A;  1FYK A;  3S32 A;  3CP2 A;  1O7L A;  2ZXI A;  2K86 A;  1ZG3 A;  2EPF A;  2XUB A;  3A02 A;  3PIO F;  1T08 B;  3I4M J;  1FWZ A;  1DU0 A;  1J09 A;  3E0J B;  2VKH A;  5IOZ A;  1XCB A;  1APL C;  3C3W A;  2DI3 A;  1I5Z A;  2OQG A;  2LG4 A;  3K2A A;  2DT5 A;  1VFC A;  2BXZ A;  2VOD A;  3WTV C;  1KU7 A;  1STZ A;  3I59 A;  2RAE A;  3G1O A;  2XGC A;  3ZOB A;  2QSG X;  4HF2 A;  3CC4 I;  5D5V B;  4XRS A;  5HLI A;  3ULQ B;  2I8D A;  2VXD A;  1ODD A;  2HVS A;  2W25 A;  3LSR A;  5J1R A;  4M72 A;  4AID A;  2OQR A;  2K3F A;  4KIS A;  1JI8 A;  3IH2 A;  3GFJ A;  2VBY A;  5LGU A;  2FOW A;  4M74 A;  2HPI A;  4E7H A;  1GV2 A;  1ZK8 A;  3V7C A;  2MSY A;  3M3Y J;  2JQ7 A;  1BM9 A;  2JN6 A;  3K2Z A;  2ZME C;  1NHA A;  4A6D A;  1VZ0 A;  4FAS D;  3KEO A;  3M4O J;  2NS0 A;  2CG4 A;  1XC5 A;  2A6E F;  3K4C A;  1FIA A;  1TNS A;  3TO9 A;  4G6T B;  3L2R A;  3KEQ A;  3VYS B;  3AG2 H;  1CF7 A;  2LF7 A;  5E1X A;  3OYG A;  4EM2 A;  3UNG C;  3I53 A;  4Y52 J;  3LWF A;  2D45 A;  1XDU A;  2NRA C;  3D0S A;  3BP8 A;  3OL3 A;  4KNY A;  2L54 A;  4HAM A;  4KIC A;  3FK7 A;  4LG0 B;  2VQL A;  3BDD A;  4G7H F;  1XGS A;  2LH9 A;  4OIP F;  2IS2 A;  4XKW A;  1SAX A;  5K5O A;  4BUP A;  3A1Y A;  1TWA J;  3J7Y J;  2P5L C;  5TGT A;  2LTP A;  5J3L A;  3IUO A;  3PFY A;  5FKM A;  1WVR A;  4D9J A;  3HOW J;  1MMA A;  2HZT A;  2A3S A;  3DLA A;  3FWE A;  3RYR A;  4NDL A;  2P8T A;  2EV5 A;  5M3F J;  3L09 A;  2D1H A;  4MNU A;  1Y56 A;  4BY7 J;  4JX5 A;  1S72 I;  3RPU A;  5IYB J;  1XCV A;  2E2J J;  2DFH A;  5KCM A;  4YIF A;  5CVR A;  1XMA A;  4B43 A;  5EGO B;  1LE8 A;  3JW4 A;  2W48 A;  1FT9 A;  2M2E A;  2F5F A;  4A93 J;  1MH4 A;  1MW7 A;  4ZZL A;  1GXQ A;  2FUG 2;  3K6G A;  3NAR A;  4NC6 A;  5AON A;  2DOF A;  3OS1 A;  3EYI A;  2IRF G;  4AD9 A;  1USS A;  3M9A A;  1E2X A;  3PM1 A;  4BQQ A;  2EH3 A;  4KIT B;  3K69 A;  1K6O A;  3BPV A;  3L7W A;  5LEK A;  5FJ8 J;  3BZC A;  2IS6 A;  4RMN A;  2WB1 A;  4XLC A;  1LEB A;  1PVE A;  3WU2 C;  1B6A A;  2X0L A;  3JRE A;  4A3I J;  1WQ2 A;  2FE3 A;  1YJ9 I;  1IW7 F;  2BV6 A;  3I5U A;  2XAU A;  1F36 A;  4AVP A;  1W36 C;  3K70 C;  2HXI A;  2QKL B;  4OIQ F;  4GO1 A;  3AL0 C;  2M8G X;  3K9T A;  2OU2 A;  3J80 Z;  1IG7 A;  1JTY A;  4BHB A;  3A0B C;  2KDO A;  3Q0V A;  4IXA A;  4BU2 A;  3CLO A;  4L9J A;  4N9H A;  3PO2 J;  2DOD A;  3BQZ A;  2UWM A;  3DQV C;  3M1E A;  1FX7 A;  1I50 J;  4DYQ A;  4LB5 A;  3I59 B;  2JTV A;  1U2W A;  5C3E J;  4OIN F;  4DIQ A;  2FF4 A;  3A0H C;  2X85 A;  3ZMU A;  1ZAO A;  1WI9 A;  3JAM Z;  2HDD A;  3EUH C;  3TDU C;  4CCM A;  1Z3X A;  1X3Z B;  2DO7 A;  4BY1 J;  3M8F A;  1TT5 B;  4J19 A;  2QBY B;  2M45 A;  3HYI A;  1D8K A;  5LHH A;  5DTD A;  1SC7 A;  3GTK J;  1JTX A;  3RPQ A;  4C2M J;  2NNY A;  2MAB A;  1MJB A;  5J4Y A;  3FXJ A;  4M9X A;  1XPX A;  4C2U A;  2ZSI B;  1PYV A;  4XKB A;  4HQM A;  1Y0U A;  3HOY J;  5F27 A;  1EF4 A;  2TDX A;  2XSD C;  4PGH A;  1CF7 B;  2L9V A;  3OMY A;  2D1V A;  1WJC A;  1X1B A;  3KYC B;  4XID A;  1MBJ A;  3J80 K;  4DBQ A;  3MKL A;  1VQ7 I;  3C18 A;  5JVG F;  3OYN A;  4XLN F;  3G1M A;  2E1M C;  4JYK A;  9ANT A;  2QQ8 A;  1QVU A;  1MZB A;  2DCE A;  5EYR A;  2E1O A;  3RIR A;  4I0B A;  2K9Q A;  3CJT B;  4YFN F;  4KN7 X;  4I99 C;  1OR7 A;  2FBH A;  1M1E B;  3VDX A;  2F5E A;  2OCE A;  5D5W B;  4E7L A;  1RKT A;  4CUG A;  2EFO A;  5BNG A;  1R4N B;  1HDD C;  2AQE A;  1F5T A;  2R7X A;  1ENH A;  2TRT A;  3MZ8 A;  1N75 A;  4CYC B;  2EIN H;  3JRA A;  3GTP J;  3E6D A;  2ISZ A;  3H0D A;  3ZQ7 A;  4ZYE A;  5E8I A;  2V6E A;  4IHV A;  4C3I J;  2L7K A;  2NS7 A;  2DFI A;  1LKX A;  2W84 A;  4UNO A;  2HXO A;  4IKF A;  1W5C C;  4XKV A;  1FMV A;  2LLK A;  2DK5 A;  2HNH A;  3U1D A;  4UV9 A;  3DKW A;  5ICG A;  4A3J J;  2AO9 A;  4U7B A;  1IRF A;  3U9G A;  1KA8 A;  2JVH A;  4C3H J;  2QEX I;  3ZMZ A;  3S1N J;  5HVQ C;  4N0B A;  1HST A;  5F0F A;  5HDK A;  3F6O A;  2LK2 A;  4CHU A;  4KMF A;  4AIH A;  1RPW A;  3PUB A;  4V2F A;  2XGX A;  1YJW I;  1SVO A;  4J00 A;  2HOA A;  4DQ2 A;  5KHD A;  3OIQ A;  1X1D A;  1QPM A;  5ILU A;  3ZRG A;  1Z3Y A;  3FXK A;  2XRL A;  3CCR I;  2NXN B;  2DA3 A;  2OTL I;  1JXS A;  2KRC A;  3CES A;  3F23 A;  1V5E A;  3J81 Z;  3W6V A;  1XSX A;  1YW8 A;  4KFC A;  1ERD A;  1U6G A;  2P5V A;  4ZTJ A;  1MJA A;  1OKR A;  1LPQ A;  3JRH A;  1Y1V J;  3VSK A;  3CLQ A;  2FQ3 A;  5TJJ A;  1ZG5 A;  1LQ1 A;  3SEZ A;  5EEH A;  4OAY A;  3PJR A;  1BW6 A;  1SD7 A;  1XSV A;  4AIJ A;  3EYY A;  3NQO A;  5DM6 F;  1TC3 C;  5F0C A;  1T0F A;  2MLG A;  2XGD A;  3KIO A;  4BNC A;  2JSC A;  4E7K A;  1E3O C;  3DBL B;  1NG6 A;  2RNJ A;  4MEX F;  3OR1 C;  1MIJ A;  3DP7 A;  5EZH A;  1IXS B;  3BG7 A;  1TWG J;  4RAG A;  1MBH A;  3KZZ A;  3OYI A;  2ZNY A;  1X2N A;  4EV0 A;  1O3S A;  3Q5F A;  1OFC X;  2HOT A;  1Z9C A;  5L3C A;  2UUZ A;  3G1L A;  1JE8 A;  2CW8 A;  1VND A;  4I09 A;  1YJN I;  3F22 A;  1R1U A;  2G9W A;  3JSP A;  4BAC A;  2P5K A;  4K2E A;  4CGZ A;  1PP7 U;  1P4X A;  3DLL F;  4M9Z A;  2HS5 A;  3GCM A;  5L3E A;  4OMZ A;  2IW5 A;  3GFI A;  2LR8 A;  1SD5 A;  2X48 A;  2EZL A;  3KP3 A;  4UY8 I;  2QQ9 A;  2XAJ A;  1J9I A;  4IPA A;  1YX3 A;  3LSJ A;  2A6T A;  2KIU A;  4CCN A;  3MVP A;  1FPQ A;  3IH3 A;  3DKY A;  3UR3 C;  3K4L A;  2VT2 A;  3PQK A;  3G3Z A;  2X9D A;  3BZ6 A;  4OMY A;  2CWE A;  1GDT A;  4UVA A;  1WGX A;  3BR1 A;  4LOC A;  4AUX A;  4V19 K;  3A2K A;  1T98 A;  2VC1 A;  5E79 C;  1KYZ A;  2M9H A;  2QLZ A;  5E3O A;  2NVY J;  3SJM A;  4MLO A;  2GIV A;  4MQ9 F;  3QYF A;  2E5Z A;  3GTG J;  2D5V A;  5E20 A;  2AQF A;  2PMZ N;  1Z77 A;  4RB1 A;  3ZN0 A;  4LB6 B;  3BLY A;  1D0Y A;  2PJP A;  3H3Z A;  5F1J A;  2OPT A;  2DK8 A;  3J7Z I;  2LD5 A;  3JRI A;  1RUO A;  2JA2 A;  1FBS A;  2A05 A;  5GPC A;  3ZMT A;  3CCV I;  1S8N A;  5J4V A;  2EFW A;  2EFN A;  2VJJ A;  5M5X J;  5L3B A;  1TZL A;  2GZW A;  3HM5 A;  3K0L A;  1TQM A;  5F1R A;  2E34 A;  3OL4 A;  3WOD F;  2Z9O A;  4PSX A;  3KET A;  1X3U A;  3S14 J;  3LSH A;  3RJP A;  1GXP A;  2IGO A;  4B3X A;  4UXN A;  1EH7 A;  2P6S A;  1U3E M;  2H6B A;  3QPS A;  3ZQI A;  4E6K G;  2XPW A;  3W6J B;  4ZZD A;  3OYM A;  3CJQ B;  2L0K A;  3FDY A;  3H5A A;  1BJA A;  1F1Z A;  2R5Y B;  1XSD A;  1FP2 A;  1Q1H A;  4M3D A;  3IC7 A;  5IPA A;  3DTE A;  3BCB A;  2NNN A;  3HZJ A;  2X6Y A;  5AIP A;  2DMP A;  3JRD A;  1A5J A;  1XGM A;  2ME0 A;  4JQF A;  3ZMS A;  4PFP A;  1TWH J;  4V2G A;  2XF5 A;  4L5E A;  4XLP F;  1RNL A;  3HOT A;  1T2K A;  3OIP A;  3HSF A;  3HBL A;  4L9T A;  4YEJ A;  4B3A A;  2L7Z A;  1A31 A;  2F4O B;  4IZZ A;  2DFF A;  4LLN A;  1OYI A;  3V42 A;  3WHC A;  2ELH A;  2VOO A;  3HTU A;  4XON A;  1KYW A;  4Q47 A;  5K1Y A;  4BGD A;  2LF8 A;  1KU3 A;  3NEU A;  3RSN A;  5IY5 H;  1MH3 A;  1MDM A;  1LDD A;  4A3C J;  1NH3 A;  2FXA A;  1PDN C;  2X6X A;  1S29 A;  2KDZ A;  1QO0 D;  5C4X J;  3DCF A;  1G4D A;  3H92 A;  2STT A;  2ZJR F;  3S1M J;  5JVT A;  1JKQ C;  2VJ4 A;  1QVT A;  2CH0 A;  4XOT A;  2CFO A;  1Z7L A;  1VQ4 I;  2QWW A;  5LGT A;  1ZGA A;  1OPC A;  2B9S A;  2WC2 A;  3LL7 A;  4HZF A;  3HOZ J;  3CC2 I;  2GOX B;  3ABT A;  2DDB A;  2X1E A;  1VQ9 I;  3ECH A;  4S05 A;  5L3G A;  2E35 A;  2WB1 N;  2RC4 A;  2KRF A;  4G6D A;  3DBH B;  4FIS A;  5K5R A;  1LNW A;  5ED4 A;  4BE2 A;  2Z5U A;  1VF9 A;  5FLX K;  2FX0 A;  4UUT A;  3G6E I;  4HF0 A;  1ON2 A;  4FET A;  2E71 A;  2A69 F;  4M71 A;  4II3 A;  2VPR A;  2QGU A;  4NNJ A;  1RC9 A;  1BI1 A;  2M5W A;  3F8M A;  3N05 A;  3KP5 A;  1P4W A;  1R36 A;  1DGR M;  4M6V A;  4A0X A;  1SFU A;  2F48 A;  5ILV A;  4XLE A;  4LK0 F;  3SXY A;  1W36 D;  1J5Y A;  1LEA A;  1POG A;  3K1N A;  4XLH A;  2XIG A;  2L9S A;  4DZJ A;  5FB2 A;  5EG0 A;  4ABZ A;  1I6H J;  4FX0 A;  2L7M P;  2QUF A;  1WH7 A;  4HX7 A;  1D1A A;  2PLY A;  3CQZ J;  2LC2 A;  4KIF A;  3L2V A;  1JT0 A;  1K7A A;  1LDK B;  4UV8 A;  1QHH D;  2HQR A;  3OYC A;  2KIS A;  2BVL A;  3BJA A;  4JX4 A;  3HDD A;  4F93 B;  1X2M A;  1WJD A;  2OC6 A;  5KNL A;  2V7F A;  2VBZ A;  1ETX A;  1XB4 A;  2ZJQ F;  2MA3 A;  3NWT A;  1E17 A;  4IJA A;  1MGT A;  2VI6 A;  3OYB A;  4EAT A;  3E97 A;  3HUG A;  3IL2 A;  2XDV A;  3TP3 A;  4ENK A;  4D0P A;  1IN6 A;  3LSI A;  2HDW A;  4BJ5 C;  3HSE A;  4L5J A;  4LG0 A;  3H5N A;  2R7T A;  2RDP A;  4BXU A;  3LNQ A;  4PJJ A;  3UKG A;  3ML6 A;  4KMU X;  1T6S A;  2EZH A;  2CV2 A;  2V9K A;  4BQO A;  4Y7N J;  2Z99 A;  5H6R A;  3O8G A;  4A3D J;  2WV1 A;  1FBQ A;  1ZAR A;  2LSO A;  1LUJ B;  1KQ9 A;  1R5G A;  3RKY A;  5E18 F;  4WF2 A;  3RKX A;  4HST A;  2HWV A;  3HIF A;  2MD5 A;  2LRE A;  1H88 C;  3I64 A;  2L5Q A;  2R7O A;  4XMY A;  1A6Q A;  2DT6 A;  4C2T A;  2LYC A;  2A68 F;  4W1U A;  3PNY A;  3JTG A;  2KQR A;  2R3S A;  3CCU I;  3MD2 A;  3PQJ A;  2GAU A;  3FMQ A;  3E3V A;  1I3Q J;  1BI3 A;  4KYW A;  1IO2 A;  1MDM B;  3PNV A;  3L2C A;  3KZY A;  2M4G A;  4PSW A;  4UHT A;  2AXT C;  1IV6 A;  4C3J J;  1X1C A;  2GLO A;  3OYL A;  3BTL A;  2VXZ A;  2WWY A;  5BOX A;  1D5V A;  3VSL A;  4LLG F;  3S93 A;  5FRO A;  5EEA A;  1JKO C;  3MZH A;  1PJR A;  1ETW A;  1YG2 A;  3H9J A;  3LAP A;  1FLI A;  2IGM A;  2WAF A;  1J75 A;  5IT9 K;  2B7E A;  1YO5 C;  3BWG A;  1R4M B;  3LA3 A;  4LIV A;  1U78 A;  3C2B A;  3TMO A;  4A0Z A;  5LRS A;  2VC0 A;  5IP9 J;  5A2Q Z;  4UUS B;  2IGN A;  3BCA A;  1IJW C;  5DCM A;  4JOM A;  3ZMV A;  4XN3 A;  4QIW N;  3CF2 A;  1IDZ A;  3TW6 A;  2VKD A;  1DP3 A;  1MBF A;  1Q1V A;  1TW2 A;  2VE9 A;  3M07 A;  4HX4 A;  5HS7 A;  4MEY F;  1R7J A;  1X4P A;  2KFD A;  3BRO A;  1E0E A;  1SEU A;  3GLL A;  2ECB A;  3SFZ A;  3KLN A;  3KP2 A;  2E1C A;  1HKS A;  2HQ5 A;  1MMD A;  1K79 A;  1JKP C;  3T1B A;  4EJU A;  5EG0 B;  1W5S A;  2PMZ A;  3BG6 A;  4PCQ A;  3W6K B;  2F5C A;  2WAQ N;  3KFW X;  2QBY A;  5FRN A;  4KA4 A;  1KU9 A;  3NWS A;  5ERI A;  4X0G A;  2BVM A;  1Z91 A;  2XSJ C;  2JA5 J;  1UST A;  1O3R A;  3GX4 X;  3QOP A;  2EIL H;  4I01 A;  2R7Q A;  4CIC A;  1G59 A;  3ZQH A;  4M3F A;  1UG0 A;  2IS4 A;  2COM A;  2LFB A;  4A3L J;  2KKO A;  2X6W A;  1FNN A;  2FA5 A;  3DEE A;  5E8G A;  1VQM I;  3HUG B;  1MNM C;  3QPH A;  2HYG D;  5GAH J;  1MBK A;  1RRJ A;  5D8L B;  2W7N A;  1WJ5 A;  3K1P A;  1S3J A;  1ZRF A;  1OCZ H;  1HKQ A;  4ENM A;  1OIS A;  1L0O C;  2L9R A;  1VQ6 I;  4A3G J;  1EH6 A;  3ONQ A;  5IP7 J;  2ID3 A;  1TTY A;  3PSF A;  1V5G A;  3FMS A;  1XMK A;  1BI0 A;  2Y9Z A;  5J1Y A;  3HOX J;  4P5O A;  5F08 A;  5ICC A;  4LGW A;  2DAO A;  4FQG A;  3HHG A;  2A5W A;  1U0J A;  4F7Z A;  4XIC A;  1EJ9 A;  2LY2 A;  4FE4 A;  3EQL F;  1QZZ A;  3L9F A;  4G94 A;  5CQG A;  2MC3 A;  4OU0 A;  1HQC A;  4RM3 A;  4E4H A;  2DN0 A;  3IP4 B;  4LMY A;  1P4A A;  4CYC A;  2KZG A;  2NYX A;  2OAZ A;  1S7O A;  1HC8 A;  2LRD A;  1YIT I;  2CQX A;  3QP6 A;  1XDS A;  1JT6 A;  3N4M A;  2GIZ A;  2DOE A;  1ZRD A;  1BJZ A;  3OS2 A;  1JKR C;  2KT0 A;  2LOO A;  2K9M A;  1VQP I;  1WFX A;  3EDP A;  3TP0 A;  2BY1 A;  3HTS B;  2CMP A;  1QQI A;  2IA2 A;  4CXF A;  4RLF A;  2DMU A;  1ZN2 A;  2KP6 A;  3LA2 A;  2W1O A;  3C1D A;  5EF6 A;  2ESN A;  4G8X A;  1GHC A;  2DBB A;  4HSR A;  2CQK A;  2FSW A;  4JK1 X;  2H8R A;  1DQU A;  2CQQ A;  5K7F A;  2O8X A;  4P9U A;  2LKS A;  1E3P A;  5ICE A;  2P4W A;  3CME I;  3C2H A;  1W1W E;  1U9O A;  4A0Y A;  4M3E A;  5JHF A;  3DFG A;  2JUG A;  3QQA A;  4BE0 A;  4ENJ A;  2W24 A;  3VEP A;  2WAE A;  4LD5 A;  1R58 A;  3JRC A;  4E70 A;  4D7N A;  1LFU P;  3BR6 A;  2GBY A;  5FGM A;  1XTA A;  2HR3 A;  5CVJ A;  1X3W B;  1H0M A;  1B8I A;  1FEX A;  5DCM B;  4B09 A;  1ZGJ A;  2QF7 A;  3TQN A;  1IRX A;  4W97 A;  3SZT A;  4ANJ A;  5BPD A;  3F8B A;  3HEF A;  3HB9 A;  4S04 A;  3CC7 I;  4MFE A;  2PBI A;  1ETK A;  3JTH A;  3BR2 A;  3OIO A;  4RB0 A;  3MMY B;  1HF0 A;  4IHW A;  2BHY A;  3AFH A;  1JUP A;  1YRN A;  3DPU A;  1Z1D A;  4R8H A;  2ZB9 A;  3ESW B;  2DDA A;  3CO7 C;  2KJC A;  2CW7 A;  2IP2 A;  2QEN A;  5GTH C;  4U87 A;  2E1M B;  2A5Y B;  1T39 A;  3D5L A;  1BW5 A;  2ZFU A;  4YG2 F;  4UB6 C;  2JRT A;  2QZ8 A;  4PK4 A;  3RQ4 A;  3GTM J;  3HGG A;  3BG3 A;  2XAF A;  4Y4R A;  5GAG J;  1IN4 A;  2KJB A;  2KLO A;  1SD4 A;  3I4N J;  1ORK A;  2BY2 A;  4F91 B;  3WTW C;  1XX5 A;  1TP4 A;  2BY3 A;  2QSF X;  2GM4 A;  4OOI A;  4Z2Y A;  4GYI A;  1VI0 A;  2O61 A;  1SVM A;  2RQP A;  3FIW A;  1MMG A;  1OYW A;  2EBI A;  1K6Y A;  1WSU A;  2EFQ A;  3SHF A;  3JRB A;  3WTT C;  1IDY A;  1W0U A;  2NVT J;  3S3N A;  1ZGW A;  3ZQQ A;  1QZE A;  3DPL C;  2WA0 A;  4PGG A;  2EZI A;  4YIR X;  2QM3 A;  4NC7 A;  4L9V A;  2P6T A;  4CSW A;  4OIR F;  4M3G A;  3RZD J;  1G3Y A;  2OUM A;  2NAZ A;  1D3Y A;  4B4C A;  4RLQ A;  4ESJ A;  2Z16 A;  2A6H F;  1P2F A;  4ZYD A;  2RRE A;  3JAM K;  1ZR4 A;  2O8K A;  2E7X A;  2VPL A;  3HRS A;  2DMQ A;  2W82 A;  4BS9 A;  3ISP A;  2Y2Z A;  2CSO A;  1YIO A;  2G7H A;  3EUA A;  3FXL A;  2V9P A;  1XN7 A;  2G7U A;  4A5N A;  1RZ4 A;  2CQ7 A;  4KN4 X;  3KYL A;  1JJ6 C;  2CQN A;  3VYU B;  4O6J A;  3KLO A;  3GBG A;  4B8X A;  2OV7 A;  2F5V A;  4XOP A;  2DT7 B;  3OYJ A;  1P92 A;  2QVO A;  3VPR A;  3FM5 A;  1MMN A;  1SFE A;  2N8G A;  4EVI A;  4CCO A;  4CCL A;  2XV4 S;  3ERM A;  4Q48 A;  1FIP A;  2M0C A;  4RAZ A;  1RI7 A;  2R92 J;  2F4M B;  3M7G A;  4ZJZ A;  2ZC2 A;  5C4J J;  2FU4 A;  4ITV A;  2XPU A;  3VYT B;  3WTY C;  1AU7 A;  3CJN A;  2MBF A;  1RES A;  1LB2 A;  2O9L A;  1MJ9 A;  2EIK H;  3VFZ A;  3BTC A;  4ASN A;  3WTS C;  2ECC A;  3IAM 2;  4XBF A;  2E60 A;  4EJV A;  1BR2 A;  3R61 A;  2FRH A;  3SQN A;  4O3M A;  3KPH A;  2EV6 A;  5ILS A;  2ZCW A;  1CGP A;  3GYH X;  1ZYR F;  4EEF G;  1LFP A;  4CCJ A;  3M8E A;  2BY0 A;  3DEU A;  1VQN I;  1OCP A;  2R5Y A;  2NOG A;  3PSI A;  2Y30 A;  1OCO H;  2IAI A;  4GYG A;  2DU9 A;  3GTJ J;  1B8I B;  3A01 A;  2CU7 A;  1FZP B;  2EA2 A;  1YLF A;  3OWT A;  1YE9 A;  3WHB A;  1HKT A;  1MNE A;  1R5I D;  2WAQ A;  1A04 A;  4ZDP A;  1FSH A;  2ESH A;  4H0E A;  1VQO I;  1VTN C;  5EJC A;  1YOV B;  1HSJ A;  4LG3 A;  1I3A A;  1YRN B;  2VB6 A;  2W00 A;  1ZEL A;  4QSH A;  3GVA A;  3K1M A;  1VQ5 I;  1SMY F;  4EQQ A;  3BOQ A;  3B6C A;  4FT8 A;  2BW3 B;  3ZPL A;  2VOP A;  3CCS I;  1G3W A;  3D1N I;  4HOB A;  3ASN H;  3RTR A;  4A3M J;  2EFP A;  3DXJ F;  3FBI B;  3H5R A;  4A5M A;  1WJA A;  5B1A H;  3I3L A;  4QLC U;  4FX4 A;  1DDN A;  3GWZ A;  3S3O A;  1DPR A;  1QU3 A;  5B1B H;  2VJ5 A;  1GVJ A;  1X58 A;  1LDJ A;  3S17 J;  5E17 F;  3G2B A;  2A61 A;  2MH2 A;  4IRH A;  4YRV A;  2LBF A;  2NOJ B;  4PJL A;  4IHX A;  4A6E A;  3LST A;  4IRG A;  4BEH A;  4HDU A;  2YU9 J;  1DGW Y;  1I6X A;  3TOA A;  5CLS A;  1JGS A;  3S1Q J;  4NC8 A;  2IXS A;  4MFD A;  4Y3O A;  4ZYG A;  1BR1 A;  4WXD A;  4KT5 C;  5TIS C;  1YYV A;  2VN2 A;  4RDU A;  2DPU A;  2GWR A;  2A07 F;  1IUY A;  3OSF A;  2EA4 A;  1VQL I;  4D5C A;  5B5E C;  2Z33 A;  1XS9 A;  3J81 K;  1BI2 A;  2LY1 A;  2VE8 A;  3RCO A;  3IRR A;  1U8R A;  4UB8 C;  3CMA I;  2NVQ J;  2RN7 A;  4D7M A;  2Y75 A;  3TL4 X;  1BBY A;  2KZV A;  3IHU A;  2CUJ A;  2L7F P;  2PG4 A;  4IHY A;  2HTJ A;  4CZC A;  3FHZ A;  4IHS A;  3LA7 A;  5CJ9 A;  4BL0 B;  4XK4 A;  1HLV A;  2JWT A;  1R1T A;  4R1H A;  4ZTF A;  2NS8 A;  1TWF J;  2ZBK A;  2R93 J;  3KP7 A;  4U7D A;  1LVK A;  2HYF A;  1HCR A;  3BR0 A;  3BR3 A;  3DTI A;  1QZY A;  4HW0 A;  2KRH A;  1W4M A;  5HS8 A;  3OYH A;  3FXO A;  3OY9 A;  1L3L A;  3HXL A;  3OV8 A;  2QSH X;  2PN6 A;  2EZK A;  1DUX C;  5H20 A;  5AIQ A;  2Y0S A;  2E2I J;  1G3S A;  3LOC A;  2R7S A;  1KQ8 A;  1YW9 A;  3TKY A;  2CGP A;  4QPO A;  3MKW B;  2DTZ A;  5FFZ A;  3PIP F;  3CP8 A;  1A6I A;  2PX9 A;  3K10 A;  4QTR A;  3IAS 2;  4RS8 A;  1PUE E;  1UFM A;  1FOY A;  2R7V A;  1S7A A;  2KL4 A;  3PNT A;  1B1B A;  3WU1 B;  4L0Y B;  2DLL A;  3CUQ A;  5DUI A;  1ETQ A;  4XOR A;  4DYR A;  3CCM I;  4NQW B;  5LHI A;  3BJO A;  3F0C A;  3QWL A;  3U2R A;  1SFO J;  1ZLJ A;  3GME A;  3E6B A;  2O7O A;  1WZ2 A;  3HPH A;  1BOB A;  4IQJ A;  1BL0 A;  1R9T J;  1HA8 A;  2W57 A;  4JX6 A;  2Q0O A;  2PEX A;  3E5X A;  1JUM A;  3BR5 A;  3E7L A;  4Y17 A;  3A01 B;  2HZD A;  4F3Q A;  4DJA A;  3Q9S A;  3IWF A;  4B44 A;  4HQE A;  3WE2 A;  1YTY A;  2DJI A;  1D1C A;  2JJ7 A;  4P55 A;  1KON A;  1R23 A;  2VBW A;  2XB0 X;  1ZTR A;  1GUU A;  2O3F A;  3KYD B;  3KZI C;  2AS5 F;  3CD6 I;  1C0W A;  2IS1 A;  3LSM A;  1X1P A;  3K4J A;  3AKZ A;  3H35 A;  4HV6 A;  3SZP A;  3N97 A;  1XD7 A;  1N77 A;  2EK5 A;  3S3M A;  4PJ0 C;  1Z7U A;  1UJ8 A;  1BA5 A;  5EZG A;  4IHT A;  2UXX A;  3KP4 A;  3ZMD A;  2FNP A;  2HDC A;  1D1B A;  1FSE A;  2V1D A;  3HJE A;  3KCC A;  3S15 J;  5D8K B;  5LFA A;  5F04 A;  3HOU J;  4Q4Z F;  2LBF B;  3CCJ I;  5J1U A;  1QBJ A;  4BEH B;  3L2U A;  5IYD J;  2FMY A;  3VOE A;  2TCT A;  1IN7 A;  5KK1 A;  3TO6 A;  2ZME A;  2Y69 H;  4HLX A;  4PDK A;  3CMM A;  3U1K A;  5HS9 A;  2RV8 A;  5FLM J;  2DMN A;  2EWN A;  4IEJ A;  1T33 A;  3VYR B;  1UZC A;  4NBQ A;  4UUS A;  2BOL A;  2K9N A;  1D8J A;  2H09 A;  3HOV J;  4XLF A;  3CDH A;  2MLK A;  3DTK A;  2WV0 A;  4NHJ A;  5DD4 A;  5D6E A;  1QRY A;  1YIJ I;  5BMZ A;  1YW7 A;  4BH9 A;  4WX9 A;  2BBY A;  4I76 A;  1BIB A;  3KX2 A;  3QPT A;  2ZNZ A;  2FBI A;  4QWQ A;  2OD5 A;  2XKP A;  3FXQ A;  3CMY A;  1OQY A;  1ZR2 A;  2PMH A;  3FXU A;  1YHQ I;  2F4I A;  2L02 A;  3M8J A;  4DW6 A;  2X1D A;  4M6X A;  2DA4 A;  3V7R A;  4DNC A;  4AU7 A;  1T0F C;  4BXX J;  1Y6I A;  2GA1 A;  2JZY A;  2NVU B;  1F43 A;  2FNA A;  2FBK A;  2CV0 A;  2V1X A;  4AWX B;  4EJO A;  1UCR A;  4C30 A;  4IOA F;  3AG3 H;  2H1K A;  3BZK A;  4ZC3 A;  3TED A;  2VUM J; 
#chains in the Genus database with same CATH homology
 3OMY A;  2IS4 A;  1WJC A;  1X1B A;  2X6W A;  2MD0 A;  3HKZ A;  2R7W A;  3DEE A;  4J01 A;  4DBQ A;  3HUG B;  3OYN A;  4R79 A;  4DGW B;  1WJ5 A;  3PL8 A;  2E1M C;  2W7N A;  3M1C A;  3SDB A;  3ONQ A;  2K9L A;  2DCE A;  3PSF A;  1V5G A;  4XKC A;  4P5O A;  4ZYA A;  3VDX A;  4CA0 A;  3OYF A;  4CUG A;  4E7L A;  2A5W A;  1U0J A;  3DPT A;  2X1C A;  2AQE A;  2LY2 A;  2R7X A;  5LD2 C;  1N75 A;  5CQG A;  4PJN A;  1P9Q C;  4RM3 A;  4LIT A;  4E4H A;  3H0D A;  2M3A A;  3SZG A;  2V26 A;  3IP4 B;  4KJZ A;  2V6E A;  4AYB A;  2HQA A;  2L7K A;  1LKX A;  2LRD A;  3QYE A;  4IKF A;  4XKV A;  2VL8 A;  1FMV A;  2K5C A;  4E7I A;  2JVG A;  3OS2 A;  2HNH A;  2LOO A;  2K9M A;  2F6C A;  3OYE A;  1V5F A;  4GRI A;  1WFX A;  2CV1 A;  2VQH A;  1OR7 C;  2WAD A;  3VWB A;  4U7B A;  4HNU A;  2CMP A;  2JVH A;  4RLF A;  3H9G A;  2KP6 A;  5HVQ C;  4IX7 A;  4E7Z A;  2W1O A;  2X51 A;  4E7J A;  3PUB A;  2R7U A;  4HSR A;  1X1A A;  4J00 A;  4DBR A;  5HNF A;  5KHD A;  1DQU A;  3OIQ A;  1SAU A;  1X1D A;  3K4N A;  3ZRG A;  1Z3Y A;  4Y33 A;  3D5S C;  3EUK L;  4YEL A;  3C2H A;  3L2Q A;  5JHF A;  2JUG A;  3FHN A;  4D1Q A;  2KRC A;  3CES A;  4BE0 A;  1V5E A;  1ERD A;  2JSP A;  2WAE A;  4ZTJ A;  2VAS A;  3VSK A;  3A4C A;  5HNH A;  4BDZ A;  3SEZ A;  4OAY A;  2Z1D A;  4ZDL A;  3SEQ A;  4DOZ A;  4QPQ A;  3PJR A;  1IRX A;  2WY7 Q;  4ANJ A;  1NG7 A;  2KHM A;  4HG2 A;  3CZ6 A;  3MMY B;  4E7K A;  3AFH A;  3F9K A;  2VIX A;  1NG6 A;  1WJF A;  3DPU A;  3OR1 C;  2XC7 A;  3BG7 A;  2CW7 A;  3OYI A;  2L9N A;  4U87 A;  2E1M B;  3D5L A;  2ZFU A;  4PK4 A;  3RQ4 A;  4E7S A;  2UUZ A;  4XR6 A;  2CW8 A;  2MYS A;  4Y4R A;  4AVZ A;  2KLO A;  3DKX A;  4F91 B;  4BAC A;  2Q1Z B;  4H4K C;  2XF6 A;  1Z21 A;  3FKJ A;  3ZR8 X;  1AA7 A;  2KPM A;  2HVQ A;  1MMG A;  1K6Y A;  3E1S A;  2W4S A;  4HPQ A;  2ZSH B;  3S3N A;  2L2O A;  3RPU D;  3ZQQ A;  1UAA A;  3DPL C;  2WA0 A;  2QKM B;  1YX3 A;  3DU6 A;  2XF7 A;  2A6T A;  4NC7 A;  4CCN A;  3U21 A;  4CSW A;  3DKY A;  3UR3 C;  3K4L A;  2R7R A;  2OUM A;  3CJR B;  4IQ4 A;  4F92 B;  4RLQ A;  2Z16 A;  4LIU A;  2RRE A;  3A2K A;  3HL2 A;  4BQN A;  2VPL A;  2W82 A;  4N4O B;  3OYD A;  4BS9 A;  3W2W A;  3EUA A;  4MLO A;  5FRM A;  3J7A Y;  1WJE A;  2CUZ A;  2E5Z A;  3QYF A;  3KYL A;  4OWR B;  4HRI A;  1X4O A;  3VYU B;  4PJM A;  2AQF A;  3GBG A;  4BE1 A;  3K4B A;  2OV7 A;  2F5V A;  4XOP A;  2DT7 B;  3OYJ A;  2KMU A;  3BLY A;  1D0Y A;  3W2A A;  1MMN A;  3S8P A;  4CCO A;  2JA2 A;  2O5R A;  4XLA A;  4CH7 A;  3OYA A;  4CCL A;  3AL0 B;  1S9H A;  2HPM A;  3HG9 A;  4PFO A;  3C2G A;  2VJJ A;  4OAZ A;  3SYT A;  1TZL A;  3EPZ A;  4ZJZ A;  3TBI A;  3OL4 A;  4ITV A;  4PSX A;  4PUS A;  3VYT B;  3LSH A;  2IGO A;  1D0Z A;  1GLN A;  2MFZ A;  4B3X A;  2RNG A;  1N78 A;  1G8X A;  4E6K G;  3IAM 2;  2E60 A;  3OYM A;  1BR2 A;  3CJQ B;  3FDY A;  3H5A A;  1FMW A;  2DOA A;  3L2W A;  3DTE A;  3BCB A;  1LFP A;  2X6Y A;  4CCJ A;  4JQF A;  3DU5 A;  3PSI A;  4PFP A;  2HU9 A;  2XF5 A;  2MC4 A;  3FBN B;  3OYK A;  3HOT A;  3OIP A;  2M0M A;  1T95 A;  5CKT A;  4YEJ A;  4KT6 A;  3I9V 2;  1MND A;  3OWT A;  1YE9 A;  4IZZ A;  1MNE A;  3K4K A;  3V42 A;  2WAQ A;  4ZDP A;  4XON A;  4BGD A;  1OLT A;  3RSN A;  4LG3 A;  2VB6 A;  2W00 A;  1ZEL A;  2IGK A;  1UEL B;  1WJB A;  2BW3 B;  2CS3 A;  4P1W A;  2X6X A;  3RTR A;  3S32 A;  3CP2 A;  3FBI B;  2ZXI A;  3H5R A;  1WJA A;  3I3L A;  2BW3 A;  1BR4 A;  3S3O A;  2VJ4 A;  1QU3 A;  2CH0 A;  2M4K A;  2ELJ A;  2VJ5 A;  2WBM A;  2CFO A;  1Z7L A;  4XOT A;  4CCK A;  1J09 A;  3E0J B;  3G2B A;  3LL7 A;  2VKH A;  2E5N A;  4YRV A;  2GOX B;  2LBF A;  2NOJ B;  2X1E A;  4PJL A;  4BEH A;  1DGW Y;  3DWL E;  2LG4 A;  4NC8 A;  2IXS A;  4BE2 A;  2M7A A;  4Y3O A;  1BR1 A;  4FET A;  3HOS A;  4II3 A;  1X19 A;  4B47 A;  2I8D A;  2VXD A;  4NNJ A;  4RM2 A;  2HVS A;  2LY1 A;  2Z2S B;  3KEY A;  3RCO A;  1JI8 A;  2M7B A;  4KIS A;  3N05 A;  3TL4 X;  1DGR M;  2HPI A;  4E7H A;  2HVR A;  2KZV A;  2CUJ A;  3W3C A;  4XLE A;  4CZC A;  4C9Y A;  4BL0 B;  1W36 D;  3K70 D;  4XLH A;  1QHG A;  2L9S A;  1VZ0 A;  4FAS D;  4ZTF A;  4XL9 A;  3BC8 A;  3HC7 A;  1D1A A;  3LFU A;  5HLT A;  1SFK A;  2LC2 A;  3L2V A;  4F55 A;  1LVK A;  1LDK B;  1QHH D;  3DTI A;  3K4C A;  3OYC A;  3LSG A;  4BDY A;  2KRH A;  1R6R A;  4G6T B;  2BVL A;  3L2R A;  3QYB A;  4F93 B;  2P0W A;  3HPG A;  1WJD A;  2OC6 A;  3VYS B;  5KNL A;  2PJR A;  2V7F A;  3OYH A;  3OY9 A;  3OYG A;  3HXL A;  2VLA A;  3UNG C;  3NWT A;  2RQQ A;  3ZGK A;  1TT0 A;  3K4M A;  3OYB A;  2GOM A;  4EAT A;  3OL3 A;  2Y0S A;  2ZXH A;  2XDV A;  2R7S A;  1YX5 A;  2VQL A;  4QPO A;  3MKW B;  2LH9 A;  3CP8 A;  3LSI A;  2IS2 A;  2HDW A;  1D0X A;  4BJ5 C;  3K10 A;  4XKW A;  4BXF A;  3IAS 2;  2K3P A;  3H5N A;  4BUP A;  2R7T A;  3A1Y A;  2R7V A;  5TGT A;  2KL4 A;  3PNT A;  4PJJ A;  4XNF A;  3D5R C;  3IUO A;  3PFY A;  4D9J A;  2CV2 A;  2V9K A;  1MMA A;  3ZXS A;  4BQO A;  3DLA A;  4XOR A;  4NQW B;  3QOD A;  1Y56 A;  2VQG A;  2V4J C;  1BOB A;  3HPH A;  4IQJ A;  5KCM A;  4XN0 A;  4B43 A;  1HA8 A;  4HST A;  3OOU A;  3LSK A;  4BJT A;  2LRE A;  1MW7 A;  2HZD A;  2L5Q A;  2R7O A;  4XMY A;  4DJA A;  2DT6 A;  2FUG 2;  3K6G A;  4F3Q A;  4C2T A;  4B44 A;  2LYC A;  4II2 A;  3OS1 A;  3PNY A;  2KQR A;  2DJI A;  1D1C A;  4BQQ A;  4KIT B;  3MD2 A;  1KON A;  2WY8 Q;  4B48 A;  4RMN A;  2IS6 A;  2WB1 A;  4XLC A;  2R4G A;  2IS1 A;  3LSM A;  3PNV A;  3ZCO A;  4PSW A;  2M4G A;  3K4J A;  3AKZ A;  3H35 A;  3W2V A;  4XQF A;  3OR2 C;  1N77 A;  1X1C A;  3S3M A;  3OYL A;  2VXZ A;  2VJI A;  2XAU A;  2Q2E B;  4F52 A;  3VSL A;  3S93 A;  1W36 C;  5FRO A;  3K70 C;  4ZDO A;  1D1B A;  1PJR A;  2QKL B;  3H9J A;  4HNT A;  2IGM A;  2WAF A;  3AL0 C;  5LFA A;  4N4N B;  2LBF B;  4LIV A;  4HEA 2;  3QOE A;  4BEH B;  3L2U A;  2KDO A;  4BU2 A;  3TMO A;  1EA3 A;  4BJ6 C;  3H9Q A;  2UWM A;  3DQV C;  2UV1 A;  2IGN A;  3BCA A;  3CMM A;  3LMM A;  4JOM A;  4XN3 A;  4DIQ A;  3CF2 A;  2X85 A;  3VYR B;  2VKD A;  1DP3 A;  5CPR B;  2BOL A;  3EUH C;  2DXI A;  4XLF A;  4CCM A;  3DTK A;  1Z3X A;  1X4P A;  1E0E A;  3MKZ A;  1MMD A;  3KX2 A;  2VQC A;  2PMZ A;  3BG6 A;  5CQE A;  3OS0 A;  2MAB A;  5FRN A;  4X0G A;  3NWS A;  2BVM A;  2XSJ C;  4NUB A;  2F4I A;  4C2U A;  2ZSI B;  3M8J A;  2X1D A;  4AU7 A;  1PYV A;  1T0F C;  1Y6I A;  4XKB A;  4XM3 A;  3MKY B;  2CV0 A;  2R7Q A;  2V1N A;  4C30 A;  5HOO A;  1G59 A;  4ZC3 A;  2PJR B;  1UG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...