2KQRA

Solution structure of the n-terminal domain (residues 1-111) of brugia malayi asparaginyl-trna synthetase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'GSMTVYICPETGDDGNDGSELKPLRTLYQAMIITKSSKGDFLIRTKKDGKQVWEAASKTALKKSWKRYEQEMLKNEKVAAKMLEKDATEVGVKAALEEAKKVQIELDTSLSYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asparaginyl-tRNA synthetase, cytoplasmic
publication title A Hybrid Structural Model of the Complete Brugia malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kqrA01
4ZYAA 2KQRA
chains in the Genus database with same CATH superfamily
1TT5B 5D5VB 2WAQN 3BP8A 3BTIA 3F8NA 3K2ZA 4PJJA 4HDUA 2V7FA 4IHVA 2X48A 1OYWA 5L3GA 5J8CA 5F04A 4KMFA 3WHBA 3OSGA 4AIDA 4MLOA 1MJBA 1LDDA 2QVOA 4RAFA 1T56A 3C2HA 4GRIA 4BYYA 1BC8C 2XRNA 1ZN2A 2VKVA 3A01A 2DCEA 2DFHA 3FK7A 3GTJJ 2X9DA 4KN7X 1BJZA 5TRDA 3KPHA 2H27A 5HNHA 3RYRA 4KT5C 2M7AA 1XSVA 1T2KA 4M3GA 1XGSA 2HKXA 4HV6A 5FKOA 1UAAA 2DMNA 2GAUA 3KEQA 2R7XA 5ICGA 1WHUA 5CVRA 1GUUA 2NYXA 3WODF 3A01B 1WSUA 4UB8C 4RLFA 2QQ8A 3LFUA 1YRNA 1RETA 2A61A 4BGDA 2L4AA 4J01A 2OUMA 3F0CA 3C18A 2O3FA 1FY7A 1HDPA 3FMSA 3ZQHA 1T8IA 2CRGA 4HNTA 4KYWA 2DU9A 1B59A 2VBWA 4HX7A 2ZFWA 3CDIA 1XMAA 3IKVA 3RQ4A 5LLQA 4A3BJ 4I0BA 2CQ7A 1YRNB 4AVZA 4Y15A 2VL8A 2NOJB 3C2BA 4D9JA 1YTYA 3CCMI 2BXYA 4I7HA 3WTZA 3S2DJ 3MN2A 1Z6RA 4XLHA 2UXXA 1YW7A 3IV5A 1KZHA 1E0EA 1T98A 1LDKB 2F5CA 3CO6C 3HRSA 4IOCF 1RIOH 3H35A 1YJWI 4BQQA 3PO2J 2R93J 3U2RA 1NK2P 1P9QC 4EVIA 2X6OA 1GXPA 3FWEA 3TOAA 3S1QJ 4DOZA 3G4SI 2M2EA 2LSOA 2DT5A 4A3CJ 3K69A 3K1PA 3VPRA 5C4JJ 3ROUA 2DJNA 4AU7A 2JA8J 3ZXSA 4D7MA 4KIFA 3CCRI 3A02A 4XRSA 3CQZJ 2HPIA 2X85A 2EIKH 5L3EA 2QM3A 4A3MJ 4CICA 3S16J 1IXCA 2IW5A 2XPVA 3KLNA 5J4YA 3MKZA 2A5WA 2RREA 2KRCA 4HW0A 1K4TA 2NXNB 2V79A 2Z3YA 1HF0A 3IRRA 5EGOA 4L9TA 2MH2A 2R7DA 2KIMA 4I02A 1AHDP 1REPC 3ZRGA 3CO7C 2HOSA 3L2VA 4C30A 1OYIA 5FRNA 2WB1A 1Z3XA 3DKXA 1JKOC 2RNGA 2ECBA 5ICEA 5M5YJ 2BOLA 2CV1A 3J81Z 3HOZJ 5K5OA 2X4HA 1WH5A 2K4BA 4XORA 3QODA 5EEAA 3GUDA 1TL8A 4PZJA 3P9CA 1XTAA 5EGOB 1FMVA 3S32A 1JKPC 1ZLKA 2DYRH 2D2WA 2K40A 3MD2A 2IS1A 2Z16A 2ZXIA 1FP1D 4B48A 1YE9A 3BCAA 1SD4A 5EZGA 5L3DA 5C3EJ 2BXZA 1JTYA 4KFCA 3V42A 2LC2A 3HHHA 3HRTA 1ZQ3P 1FEXA 3FXRA 2ZKZA 1DQUA 2VQGA 5J6XA 2K5CA 4LLLA 2VPLA 2DA7A 2GXGA 2XV4S 2DI3A 3LNQA 3FBNB 2M4KA 2RQPA 3H1CA 3JREA 1SD7A 3U1KA 4AYBA 2XB0X 1JGGA 3DKYA 3IKTA 3RJPA 3MFKA 1ZRCA 4Z2YA 3KYLA 2HS5A 3FXLA 2VQLA 5BQTA 3LAJA 2H1KA 4YFNF 1Z21A 2ZXWH 1HSTA 2FU4A 2M0CA 2GIVA 2YS9A 1I1SA 1PVEA 2E5ZA 1JTXA 2EINH 4JP0A 3TL4X 3U21A 5KHDA 1P4AA 1TWAJ 2E1NA 4JX4A 3PSIA 5K7FA 3OYKA 3M3YJ 3DTIA 4MO7A 1LFBA 3C1DA 2VXDA 4TV7A 2L7FP 4WXDA 1B1BA 3PUFA 1MSFC 3DBRB 3AL0C 4DGWB 1GVJA 4G7HF 4A12A 2XUBA 4IHWA 4QTRA 2QYOA 2HEOA 3S1RJ 5DDGA 1H0MA 3JTGA 5FKNA 2XGCA 4RAZA 1V5FA 1WKMA 2BY2A 3IH3A 3F6OA 4FTHA 3TO7A 5TISC 1MBHA 1VQ9I 3M8FA 3F3XA 3CCUI 3BG5A 4B1RA 4NC6A 3NARA 4I09A 4RS8A 4O5VA 1QZEA 2EH3A 4I2OA 1MBFA 1IRGA 4I76A 4H4KC 4M6XA 1RKTA 1CF7A 1VFCA 3HGGA 3SZPA 2ECCA 3KYCB 4XRSG 2XGEA 1ORKA 2A3SA 5HS8A 4M73A 2V9PA 4XICA 2WAEA 3HOTA 3M7GA 4ZTJA 4Q4ZF 1ZAOA 1V4RA 2K9QA 5E18F 1D0XA 1WJAA 1CF7B 1YLFA 4XLEA 2VJIA 3GXOA 1AKHA 3I71A 3OS2A 2CG4A 4DBQA 2W57A 4ESJA 2IEKA 2GBYA 4BL0B 2EILH 4OIRF 1QQIA 1ZH5A 3LSKA 2LVSA 3HSEA 2A6HF 2DA5A 4OAYA 1BN5A 4XONA 1AKHB 4EJOA 2QSFX 4LITA 2J5PA 3BLYA 2KIQA 2VPRA 1I6HJ 3OSFA 3BG6A 3G3ZA 4D5FA 3PFIA 2Z9OA 1HQCA 1FT9A 1MKMA 3IWZA 2ELJA 2E5NA 4RGUA 2M0MA 1N75A 2K9SA 2ZBKA 1ZG1A 2M34A 3PNTA 5DTDA 1A35A 1X1AA 2E2IJ 2N8GA 4NQWA 1NK3P 3QPLA 3IC7A 2NVUB 1LUJB 2M8GX 2DT7B 3FZVA 2CQXA 1JT0A 3P9IA 3S2HJ 2O9LA 2GXBA 4FASD 1E2XA 3OR1C 4OIOF 3CJQB 3CDHA 2V1DA 1NTCA 2IAIA 1J7KA 1ZRFA 3LSIA 4NQWB 2B0LA 4M3BA 2MG4A 4XN0A 1PYVA 1TWCJ 5DM7F 3G6EI 4KNYA 2KQRA 5HLTA 2VKEA 5IY5H 4BACA 3JAMK 3NAUA 1MMGA 4P1WA 3JSPA 1BM9A 2L9SA 4E4HA 2HDDA 1OKRA 1P4WA 1YOVB 2HVQA 4F93B 4K2EA 3GFIA 1TWGJ 1BI0A 2ID6A 3K2AA 3C2GA 1YIJI 5HS9A 4WK8F 1GVDA 3KIOA 3WTWC 1Z7UA 5IT9K 3GLXA 1BC7C 1W5SA 1EA3A 4BXFA 2DMUA 1YITI 2FA5A 2QLZA 5FB2A 2ZNYA 3O8GA 1OLTA 1DPUA 2FOKA 2CUZA 3BQYA 2R4GA 4EJVA 2KDOA 3E5XA 4Y33A 5L3FA 1R5ID 1BBYA 1F36A 2W48A 4NBQA 5DD4A 1E3OC 4IOAF 2TCTA 2R7VA 5HLGA 4LK0F 1VQ5I 4QPOA 2JA7J 5FJ8J 4B8XA 4Y52J 4XKVA 2JN6A 1MJAA 2X6XA 2LBFA 1IZ1A 3LWFA 4LG3A 4BDZA 4CCKA 2X1CA 3HBLA 4UV8A 4YG2F 6PAXA 2MABA 1YYVA 1A36A 3CUQC 1SFUA 1OMIA 3KP3A 3A4CA 3M07A 3DPTA 3FM3A 2KMUA 3S3OA 1FIAA 4OIQF 2WC2A 2FMYA 4PJNA 5LHGA 3K1NA 3CCLI 3FXJA 2FJ1A 2ADUA 5B5EC 4IX7A 1BIBA 2E19A 4DQ2A 5GADJ 1RNLA 1PUEE 2W00A 3HXLA 2XPWA 1MMNA 4B4CA 3HSFA 2G7UA 3LSPA 1UHMA 1YIOA 3Q0UA 4BE2A 1Y8RB 2HQNA 2DQLA 4I98B 1A04A 4M6VA 4OU0A 3RYPA 4EM2A 5GPCA 4CCLA 5F1RA 1RKWA 2BW3B 4RM2A 2MA3A 2CWEA 4CHUA 2IBDA 4ZJZA 3K9TA 5BPIA 2O8KA 1OCPA 2DA3A 3KP4A 4GCVA 1DU6A 2RC4A 3ABUA 1S29A 2A69F 3ZMUA 5B1AH 3EUHC 1IDZA 1XDUA 3GBGA 3H3UA 4MQVA 2DOAA 3WE2A 3PL8A 2OBPA 4A3IJ 4EJTA 1BI3A 4HZFA 2LFBA 4CYCA 1YQAA 4IL6C 1B6AA 1E17A 3VSKA 1J9IA 2ME0A 2PMHA 3FIWA 3H3ZA 1R9TJ 4NB5A 2GA2A 1ULYA 1X58A 4GO1A 5CLSA 3HDDA 4Y13A 3ZN0A 5IOYA 4UXNA 2V6EA 2FBIA 5LGUA 1FZPB 3RDIA 2HOEA 4A3GJ 1AOYA 3GTPJ 1G3WA 3F8BA 3F8MA 4CUGA 2VONA 2WB1N 4IHSA 3RTRA 3G1MA 2VB6A 4CYCB 3BR1A 3WGHA 2L54A 3H9GA 1FTTA 1F5TA 3SEQA 2DFIA 3H3VK 2KLOA 1U9OA 1WJ5A 1XCVA 3CCSI 4W1UA 1VQ7I 2G9WA 3BR5A 1R6RA 1D0ZA 1UJ8A 3OYHA 2XROA 4HQEA 2R5YB 2HXOA 1EF4A 1FBUA 2KT0A 4RAGA 3WG9A 4BQNA 1SFXA 1GLNA 1TC3C 4PK4A 2RQQA 2I8DA 3RPUA 5DM6F 1MNEA 4UB6C 4U7DA 1ZRDA 4U0YA 2Y0MA 1MIJA 4A2UA 2DDBA 2DAOA 3KYDB 5E79C 3T8TA 1QGPA 1MSEC 3I0TA 2P0WA 1R1TA 1UELB 1VI0A 2KJBA 2OF7A 1BOBA 3BWGA 4AYBN 1N78A 2W85A 2CQKA 1XSXA 2WAFA 4XN3A 5EJCA 2FQ3A 3AL0B 1KU3A 1FC3A 3B02A 4FT8A 2ZCWA 2ELKA 2EZKA 3VSLA 2B63J 5CVIA 3IH4A 2QEXI 1R4NB 1Y1VJ 3ZQFA 1DGRM 3E1SA 4S05A 1PJRA 1LFPA 4ITVA 4XRFA 1DUXC 2DJIA 2E36A 1ETXA 4NNJA 2JQ7A 2E2JJ 5M5XJ 3H92A 3ZQLA 4YFKF 2KPMA 5GPAA 3TKYA 2QKMB 1O57A 1FSHA 3BJAA 5D6EA 1MBEA 3JRIA 3GFJA 3TW6A 3J7YJ 2QENA 2HNHA 1YW8A 2ZSHB 5ILVA 3IWFA 2DMPA 2YU3A 1NG7A 1J75A 2HYFA 3MZYA 5IT9Z 4ON0A 1IN7A 5EG0A 3FX3A 4CGZA 1WJEA 1YS6A 2YX7A 3V7CA 5IP6A 1YS7A 4F7ZA 3H9JA 2EV6A 5K1YA 3LSTA 3BTCA 2ESHA 2XF6A 2E34A 2HGCA 1TZLA 1OQYA 5FLVA 3Q5FA 1F1ZA 2ZJPF 2FBKA 2OV7A 1ZELA 3CJNA 3I3LA 5EG0B 3QU3A 3HOYJ 2XAUA 3RZOJ 3REOA 1VQKI 2VUMJ 1IGNA 1FYLA 3OIOA 1Y0NA 4XSZF 4E7IA 5CVJA 2CU7A 4F55A 2BE5F 1SC7A 3NWTA 1TQMA 1BOAA 3HGYA 1NHAA 3HSRA 2HFHA 2G0EA 3HRUA 3R60A 1DDNA 4JX6A 2K02A 1H9GA 4L5JA 3D1NI 1KU2A 4XK4A 2O7OA 2X1DA 4GGGA 1WQ2A 1TTYA 2XAQA 3K7AJ 1ZYRF 3WE3A 1D0YA 2BZTA 1OYYA 3BY6A 1YHQI 2XASA 4MFDA 1IXRC 2CH0A 3VYTB 1YG2A 4MHGA 1B9MA 3N05A 1W4MA 3A1YA 3DPLC 2VASA 2AHQA 2LK2A 1ON2A 2MD5A 2ACJA 4FQGA 4E7LA 4EEFG 1G3YA 3HKZA 4IXAA 2F5DA 4U88A 5KCMA 3K6GA 1S8NA 2DOFA 3FDYA 3DU6A 2WY8Q 3DBHB 3OYCA 3OYNA 1LVAA 3HOWJ 3ECOA 3ZMVA 5E1XA 4CO8A 2IXSA 3I4PA 2XF5A 3ASNH 2M3AA 4PGHA 1LPQA 3IAM2 2OU2A 3R4KA 1VNDA 4EQQA 2XC7A 3R6SA 2L9NA 1Z67A 4RB0A 3RPUD 2GOXB 5J1RA 2IS2A 2FNAA 2HU9A 2NS8A 3LMMA 1XB4A 2CW0F 1U5TC 2Z5UA 3S93A 4L18B 1VQ6I 2FSWA 2HDCA 3OR2C 3ZR8X 2PQ8A 3MQ0A 3KZIC 4L5IA 1ZGWA 5FLXK 3P9KA 4ZZLA 1K6YA 1X4OA 4IHXA 5LFAA 2OQGA 4E7JA 1X19A 4UHTA 1OJLA 4BKXA 4PJ0C 1D5VA 3L2WA 3I54A 1JJ8C 2ZB9A 1WFXA 1YJNI 4N0BA 4UUVA 2K85A 2NVYJ 4QIWN 4PJLA 1STZA 2GQQA 2MYSA 2HPMA 4IEJA 4L9NA 5CJ9A 4EGZA 2K3FA 4KICA 1MBKA 4A69C 2DXIA 2Q0OA 2ISYA 2ZXJA 1O7FA 2JPCA 4B09A 2E71A 2DPDA 4BHPA 3QP6A 3W2AA 3AKZA 1MBGA 1X2NA 4OOIA 1Z77A 2Z2SB 1UCRA 1LE8A 2VE9A 2CV2A 4HF2A 3CDLA 1CQTA 1SMYF 3IH2A 3V7SA 2R92J 1FBQA 3K70C 2DA2A 3RQIA 1FIPA 1P6RA 2MFZA 3CESA 1R71A 2XSJC 3RZDJ 3PNVA 3OYJA 2XSDC 5EYRA 2HXIA 1Z6TA 4WXHA 1NH3A 2XIGA 1MJ9A 3CP2A 4BXUA 4LIVA 2AXTC 3H0GJ 1KYWA 2YX4A 3L2CA 1R22A 3SHFA 5HDKA 3D5RC 2E2HJ 1JKRC 2BYVE 5M3FJ 3ML6A 4HYEA 4PFOA 4CH7A 2COMA 2DN0A 2H1LA 1O3SA 3GFLA 1ZLJA 3HEFA 1GV5A 2LKXA 3D0SA 4HX4A 3R0JA 1WJFA 3V8KA 1QHGA 5ICFA 1TLHB 1N25A 3CC4I 3B6CA 2H8WA 3HZJA 3ZOBA 3E3VA 4LOCA 2HVRA 1R1UA 2V26A 2M1BA 3TO9A 5J8FA 2YR2A 4AVPA 1IAWA 2JUGA 4ENMA 3MMYB 1IDYA 1KQ0A 1R5HA 3T1BA 1POGA 1SFKA 4M3FA 2XKOA 3UR3C 4HRIA 2JPBA 3CD6I 2LF8A 5IYBJ 1V3FA 1RI7A 3U1DA 3BT9A 4AIJA 2AS5F 2GWRA 1M1EB 1KQ8A 1C0WA 2Y2ZA 3BC8A 4RM3A 5M5WJ 1XX5A 3WU0A 1QO0D 1IN8A 4DIQA 2MD0A 4D0PA 2JSPA 3DLLF 5CYVA 3R61A 3BR0A 4LLGF 2LOOA 1MNMC 4BHBA 4D1QA 2JK3A 2LF7A 3HOUJ 1PP8F 5E1WA 2B7EA 2STTA 2GIZA 3L2QA 4AIKA 3JRCA 5E20A 2FX0A 3A03A 2X1EA 4PUSA 3KETA 5CVUA 2HR3A 4XIDA 3X2QH 1XN7A 5KAFC 3J7AY 1FX7A 1BR2A 5D6FA 3K0LA 2ZXHA 3PQJA 3CMEI 4CCMA 5J4VA 1QVTA 1ZARA 3FXOA 2ZMEC 3ISPA 3CLQA 3TMOA 2LLKA 3W3CA 1K6OA 2QCOA 3OIPA 1FPQA 4WX9A 1ZGJA 3ABKH 5FROA 1QPMA 4RGSA 4CYDA 4GYIA 2I5UA 3VB2A 3TEDA 1ENHA 1TWFJ 5JFRA 3KEOA 4E7KA 3SDGA 2HYGD 5D4RA 3WTUC 1BIAA 4MNUA 2P6SA 5E1ZB 2JVGA 3OY9A 1VQLI 4G6DA 3HTSB 1D8KA 4IQ4A 1T95A 4BJ5C 1QU3A 3NQOA 2BV6A 4XLNF 4OWRB 5ED4A 4X6AJ 2DBBA 1Z9CA 2H6BA 2E1CA 1G2HA 4F3QA 2VLAA 1X4PA 2VT3A 1MBJA 2K27A 2LYCA 2D1VA 4XR6A 2R7QA 3GW2A 4BJ6C 5EZHA 4HA8A 1SAUA 2X51A 4RGRA 4C3HJ 2MLKA 3HJEA 3L2RA 2F5FA 1OR7C 2VC1A 3OWTA 3K10A 2CJJA 4G6QA 4MFEA 1S7EA 2VOOA 1SD5A 2LR8A 1BW5A 4JYKA 1BR4A 3KP2A 3OYBA 2RV8A 4V19K 2ZFUA 1FYMA 3E7LA 1JI8A 1WI3A 3OYGA 2NVTJ 2D1HA 1JE8A 3DEUA 2DK5A 5FLXZ 2LREA 4KT6A 4A6DA 2MLGA 1TNTA 1TBXA 4M3DA 1MZBA 4ZYEA 2IA0A 2FD5A 4M9SA 5J40A 5KAIC 3JRBA 3K4CA 4XRMA 1IF1A 2HZTA 1U3EM 1D1CA 2DTZA 2OZ6A 1OPCA 3RIRA 1E3PA 3D5LA 3RCOA 1HSJA 1FLIA 2EFWA 4ENNA 2ZJ2A 1JGSA 3GF2A 2XGXA 1K83J 1W5TA 1R4MB 4C9YA 4DW6A 3BG9A 5FKLA 2KDZA 2J5OA 3SQNA 2KL4A 2CYYA 5K7ZA 4JBAA 3JSOA 3GZNB 2R7ZJ 2EZIA 2RGVA 4A6EA 4EJUA 2ZSIB 3LA7A 1FTZA 1IJWC 3TDUC 4A0ZA 4RB2C 4A3EJ 4OIPF 3JR9A 4J00A 2IGMA 3K4LA 1L0OC 2IGNA 1MH4A 3IRQA 4LLNA 3L09A 2KJCA 2ZC2A 2HI3A 1PDNC 3PQKA 1ZG5A 1S6LA 3FXUA 3JTHA 2MC3A 2EK5A 2W84A 5KK1A 1ETWA 4HLYA 2P5LC 1ZG3A 2V6CA 4FISA 4NC8A 3NRVA 4ZYHA 1Z0XA 2E1MB 4BJTA 2VBZA 5LEJA 2LKSA 3PIPF 2JMWA 4EJWA 4V2GA 3CC7I 3WGIA 1FSEA 4MEXF 2YUSA 4X1EA 2OZUA 4HV5A 4MQ9F 4UV9A 3QYFA 3DP7A 3ELKA 3DPUA 4BNCA 4BQAA 5LEKA 2IRFG 4A3DJ 4ZYDA 2CUFA 5IP7J 1U5TA 3M8EA 2EIMH 4YELA 3HB9A 3ERED 4KISA 3OIQA 4HBLA 4B3AA 1LEBA 4HSTA 3DU5A 3GZ6A 4ZDOA 2JUCA 3COAC 2A68F 3HC7A 4XLCA 4Y17A 4M72A 5F0CA 1HDDC 1XC5A 2X0LA 1Z1DA 2P81A 5F0HA 1HOMA 1FJLA 2TRTA 3CF5F 4A3JJ 4WF2A 3QOEA 1BL0A 3LQRA 2ZJRF 1EKEA 3UKGA 1O3TA 4HNVA 1PP7U 3HKZN 2VQHA 3OMYA 1VF9A 3Q3SA 3RSNA 3U9GA 4ABZA 4EM1A 3F23A 2V9VA 5EDNA 2IGOA 2QUFA 3RI4A 3BDDA 3QQAA 3MKYB 1R36A 2DFFA 4ZYAA 5JLWA 3W2WA 2CW8A 1OFCX 4AC0A 1LJ9A 2XGDA 2LY9A 4N4NB 5DCMA 3VDXA 5KVRA 1T6SA 4V2FA 2LH9A 4U87A 3ZQIA 4IRGA 4GDFA 5HVQC 2NNNA 1Z3YA 1XSDA 3OV8A 3DV8A 3CCVI 1W0TA 1ETQA 1U78A 5FGMA 4AD9A 3T5XA 4CSWA 4M71A 5CKTA 3WU2C 1MDMA 2ETHA 2WTEA 1Y1WJ 5DCMB 5DYMA 4D7NA 3WTYC 2V1UA 2NNYA 4F52A 3KZZA 4R8HA 1IN4A 4DYCA 2H6CA 1F9NA 4JQFA 2OAZA 3DXJF 1IUFA 4OAZA 5IT3A 4A93J 1P2FA 3F8CA 2BHZA 4I0AA 3HHGA 2LBFB 1ZR4A 3M8JA 1MDMB 2VE8A 3W2VA 3AG2H 3BQZA 5A2QZ 3ABLH 2PI0A 1JUMA 3W6KB 1ITYA 2KP6A 3CJTB 4L9VA 3O2PE 3V8LA 5F1JA 2GXAA 2Q1ZB 1VTNC 3OYEA 3SZTA 2VOPA 2EV5A 4ENKA 2VI6A 2EFQA 3K4MA 3HOVJ 3OL3A 4EATA 3BPXA 1HC8A 4HPQA 2FOWA 2JTVA 4FX4A 2VIXA 4EV0A 2EPFA 2OJED 5CVVA 3M1CA 3RKXA 3QAHA 1FOKA 4L9JA 3RKWA 4YEJA 2KISA 2EBIA 1AA7A 4XBFA 3I5UA 1J59A 2QQBA 4ZZDA 4HSRA 3PNYA 5LGTA 2STWA 2K4JA 4KIBA 2HQAA 4A3KJ 2BHYA 4FX0A 4RGXA 4Z6YA 2DODA 1DP3A 3FHNA 2JA6J 1RC9A 3FISA 1GT0C 3QU6A 4UVCA 4FE7A 1FOYA 4U0WA 3BZCA 4BXXJ 2TDXA 2LG4A 3GX4X 4E7ZA 3J7ZI 4R79A 3H5RA 5DCFA 1S3JA 4BEHA 4E7HA 5EEGA 3KLOA 2NOGA 2V1NA 4CDGA 2CMPA 2EFPA 5LD2C 4ANJA 1IV8A 2Y48A 2VJ4A 5DUKA 5K5QA 4J19A 5JVGF 2RDPA 1R5GA 4RDUA 2ZMEA 3GTQJ 2NRAC 3V8JA 4EMSA 5JHFA 2PX9A 1EH7A 1TP4A 1MH3A 3SJMA 5FD6A 1BA5A 3SYTA 3RKYA 2EJRA 2E1OA 3HPGA 2KFDA 1U8RA 1AWCA 1D8JA 1OCTC 1I5ZA 2L0KA 5E3LA 2DW4A 3GTOJ 4F92B 3HG9A 1TQPA 2DA1A 4XM3A 2HTJA 5FO5A 2ICWG 4WXCA 3SDBA 1LQ1A 3IL2A 3I59A 4Y7NJ 1TWHJ 4C2TA 1U0JA 2XDVA 5J1UA 4IHTA 3FKIJ 4LJZF 1DGWY 2JA2A 5GAEJ 4UVBA 4RB1A 1YX3A 2A05A 3TQNA 1XD7A 1XS9A 4P9FA 1H88C 1T38A 1XPXA 4L0ZB 3G2BA 2RVCA 3HPHA 3I59B 4PCQA 2M5WA 1PUFA 2Z1DA 2XAJA 4AWXB 1B8IA 1USSA 2VJ5A 4UUSA 5FFZA 1QNTA 1UG0A 3ABTA 3DTKA 3H9QA 3S1NJ 3K4JA 4NDLA 3B73A 4HF0A 1O7LA 2HQ5A 4MEYF 3EDPA 2M7BA 1QPIA 1J2XA 3BCBA 4P9UA 4N9IA 1PUFB 1BI2A 5FKKA 4E70A 1OCRH 2O0YA 1T0FC 3K1MA 2VKDA 2AQFA 1VQ4I 1R49A 4F91B 3OS1A 2CV0A 2HWVA 2HYJA 3E6DA 1GHCA 2PBIA 3KP5A 1R23A 3DBLB 3FM5A 1LKXA 4FE4A 4IVNA 1IRXA 2EQRA 3GTMJ 2ELHA 2FBHA 1GXQA 5F27A 3AAFA 1A6IA 3N4MA 2PJRA 3ONQA 4G12A 3WTTC 4NUBA 3ZMDA 5JR3A 1JUSA 2WV0A 3LOCA 1IRFA 4IKFA 3D5SC 3PSFA 1ERDA 4KA4A 1ZHFA 2ME6A 1EH6A 1MMAA 1LFUP 3ZMTA 2PJRB 1XGMA 5BPDA 4DNCA 2L4MA 2H09A 2IA1A 2VKHA 4XSXF 1VQPI 9ANTA 4LG0A 2DA6A 3E5QA 4HDVA 5E17F 2P4WA 2HKOA 1T33A 3WG7H 1KGSA 4O3MA 5DS9A 4KUMA 2ID3A 3TDZC 2VC0A 1XMKA 1G6NA 1K78A 1YI2I 4A3LJ 1P7IA 1IXSB 3PFYA 1HKSA 2CFXA 3P7NA 2R5ZA 1WRJA 2LNBA 2FF4A 1HW2A 3QWLA 4XQFA 1EH8A 3G1OA 4LG0B 4EGYA 2BBYA 4PGGA 4G7ZF 1DP7P 2MC4A 3MEXA 2WADA 4YIRX 2W24A 1VQOI 2P7CB 1T39A 1IV6A 1K78B 3MAJA 4BU2A 1RRJA 1VZ0A 1K61A 2LP0A 3MZ8A 1UG2A 2GLOA 3ZMSA 2R5ZB 3M1EA 3CC2I 2IGKA 4IZZA 2OD5A 2JSCA 3NEUA 5K5RA 5LRSA 4RAYA 4GFBA 5JHUA 5HS7A 3VODA 3N97A 3MVPA 4M9XA 2HOAA 5IPAA 3LQQA 3ZQCA 1Y6IA 2QF7A 1GV2A 2QA4I 1Q1HA 5CPRB 5GTHC 3CUOA 3TOBA 2P6TA 4IQJA 4Q5SF 1MW7A 5E8GA 1X3ZB 1JHFA 2EA4A 2JT1A 2NVXJ 4M6YA 1Y56A 2DA4A 2GOMA 3H36A 4ZH4F 1IO2A 1YX5A 2M8EA 1S9HA 2OA4A 2W25A 5IOZA 3ZGKA 3ZP5A 2KIFA 1LNWA 5ICCA 4HLXA 3I53A 3LL7A 1UB9A 2PMZA 4G6TB 1X1DA 3ESWB 1ON1A 4AIHA 3CP8A 3O8HA 2HVSA 3L9FA 1WJDA 2EV0A 5AONA 2O61A 4D5CA 2FNPA 4QWQA 1SVLA 2QSGX 1ZKGA 2I10A 1IG7A 4KN4X 4RLQA 3A0BC 4BQOA 2BGCA 3VYRB 3HL2A 4DJAA 3PO3J 3CUQA 2L01A 2DPUA 1NG6A 3DFGA 5IP9J 2L7KA 5HDNA 1O3RA 2IVMA 2IT0A 1T08B 3BG7A 2MSYA 2F4IA 1RR8C 2BY3A 4ZTFA 1OCCH 2MGQA 3GTLJ 3Q0VA 3CUQB 2EA2A 3W6JB 3PIOF 1P4XA 1ACIA 1XGOA 3BR3A 4X0GA 2L5QA 4L5EA 2VXZA 3BPVA 3EYIA 2KZGA 2K9LA 3MWMA 2JZYA 1D1BA 2RN7A 1U6GA 1FBSA 2RKHA 1ETVA 3BG3A 3ZCOA 1WCMJ 2BVLA 4WWCA 3HOSA 1JJ6C 2VBXA 3BJOA 3AFHA 3IHUA 1W36C 4N9HA 4ZC3A 5D5UB 3CCJI 4XLPF 4LK1F 1V54H 4DYRA 1LE8B 3BZKA 2L9VA 5DV5A 2GM4A 4HF1A 2AXLA 1S7AA 3S1MJ 3ZQGA 2HZDA 2L2OA 3BTLA 1I50J 3EUHA 3PUBA 1TNSA 1G8XA 2RAEA 2KIUA 1Z91A 5HODA 3GMEA 1F43A 1R00A 1J5YA 2M4GA 5GAGJ 3M4OJ 3SZGA 2W82A 3G1LA 1BI1A 2CS3A 1KQ9A 4CCJA 3E6CC 5D8KB 3OYDA 1FOWA 1G3SA 4RMNA 2LD5A 4BUPA 2PMUA 4H0EA 4XOPA 5KNLA 3K4NA 1TT0A 4OMYA 2EFOA 2DO7A 2X6YA 3E6MA 3EETA 2CO5A 2DLLA 3FMQA 2L7MP 4UNOA 5DD8A 3BTJA 3J7AO 2M45A 5EEHA 4A0XA 1XCBA 4R1HA 1W7PA 5FLMJ 4A0YA 3QRFF 4P5OA 1P92A 3SEZA 3LSHA 4XMYA 4L0YB 1Y8QB 1X1PA 3CTAA 2CUJA 1A6QA 2XKPA 5E3OA 3R0AA 3ZMZA 2XAHA 3H0DA 1FWZA 1JT6A 2JVHA 3QP5A 3VWBA 1J0RA 1TW3A 2JJ7A 1SMTA 2B9SA 4RBOA 2LMDA 1W7PB 2L02A 3J80Z 1OCOH 3LA2A 4MIMA 2NAZA 2A07F 1YW9A 1ZK8A 2P5VA 1X2MA 3E97A 3Q0WA 2R7WA 1W1WE 3T0YA 1FOXA 4G9YA 1SEUA 2QWWA 2KRHA 2Y0SA 1WI9A 2LRDA 3EQLF 1SVOA 2R0QC 1A5JA 4YIFA 4U0VA 1TW2A 3QPSA 4AUXA 1S7OA 5BOXA 2O03A 3JRHA 3V4GA 1D5YA 3DKWA 1QHHD 4MTDA 3KCCA 3BJ6A 5A2QK 2H94A 4S04A 2EIJH 4B3XA 3S17J 3PJRA 1TQIA 3VYUB 1T0FA 4AM3A 3DEWA 3I58A 4Q47A 2QSHX 2LY1A 4PDKA 3B6AA 2VT2A 3S15J 1HW1A 4YFXF 1Q1VA 3ZQQA 1E3HA 1I27A 3I56I 5LRRA 1LDJA 2M30A 4OMZA 1APLC 4CCNA 2V1XA 5HLIA 1UZCA 2WWYA 2R7TA 3LFKA 2HDWA 2W4SA 1S72I 2UZKA 2A6TA 3JRDA 3ULQB 2OTLI 4G94A 1DPRA 2IJLA 5B3SH 3VYSB 4HEA2 2OPTA 1X1BA 2UUZA 1W5CC 5LGNA 2O6GE 1U9NA 2CUEA 1UMQA 4C2MJ 3WTSC 1F4KA 2R7OA 1XMXA 2HTSA 1WJCA 1HCRA 1FYKA 5BNGA 3F21A 2NVQJ 4XL9A 4Y3OA 4MGRA 2CSOA 2BVMA 2WY7Q 4HX8A 1SD6A 1I6XA 4QPQA 1XGNA 4IJAA 4IRHA 1SANA 4BS9A 2O5RA 3ABMH 3F22A 2VBYA 4XOTA 2BEOA 5L3BA 2X6WA 2XAGA 4QSHA 1K4SA 2VODA 3DTEA 3AG1H 3GTGJ 3LSGA 1SAXA 2ZO4A 2EZLA 2DFEA 1YFHA 4BY7J 5D4SA 2QZ8A 2WBMA 2E7XA 3DF8A 4UY8I 2FEZA 2MH9A 4EM0B 1Z7LA 4KJZA 1I3AA 2A5YB 2FUG2 1EJ9A 2KRFA 1ETKA 3WTXC 1IN5A 3I4NJ 3V7RA 1H8AC 1W7PD 2Y9ZA 4BE1A 3S8PA 5TGTA 1Z05A 2F2EA 4BAYA 2M87A 4C3IJ 4C3JJ 2H8RA 3P5JA 4ESFA 4B44A 5J47A 1QRYA 4UVAA 2Y75A 5H6RA 5IYDJ 4ZDLA 5GTIC 2Z99A 3WGGA 5D5WB 3ERMA 3GLLA 4PFPA 1UHSA 4XKBA 3TBIA 1Y0UA 2JRTA 3HUGA 5H20A 4CXFA 2XB5A 2XPUA 4WCGA 1BJAA 2LDUA 5JVTA 3FHZA 3VFZA 4QLCU 1XDSA 3TO6A 2GA1A 4YRVA 1O3QA 4CA0A 2YU9J 2YPRA 2Y30A 3MZHA 3OOUA 5C44J 1BR1A 4W97A 1QVUA 2K3PA 5AIPA 3GEZA 3E6BA 5H2FC 3Q9SA 2E35A 3QPHA 2WAQA 4CCOA 3HUGB 2Z33A 4KIGA 5FD5A 1B72A 3JRGA 1GDTA 4KMUX 1JHHA 2E7WA 5TJJA 4IPAA 3IAS2 4A3FJ 2D45A 1H89C 3TW7A 3LSMA 1U5TB 1WWXA 5J3LA 1IW7F 3IUOA 5DUIA 5L3CA 5H6QA 2R7RA 4CZCA 2AQEA 1YO5C 2EFNA 2V9KA 5HNFA 3ECHA 1CGPA 1P7JA 3HOXJ 1B72B 2O8XA 1S5LC 4XKWA 3TGNA 5ILSA 2DMQA 2FQ4A 5D8LB 3CMYA 3LSRA 2HOTA 3DLAA 1JXSA 1V5EA 4I6ZA 1YJ9I 2W7NA 2DK8A 3H5NA 2CW7A 3GWZA 2JWTA 3FBIB 2WA0A 4KITB 2C6YA 3VEPA 3EUKL 2UXNA 1I3QJ 5LHIA 5FKMA 4HOBA 3KX2A 3OL4A 3HIFA 1MMSA 1RESA 4C2UA 1RPWA 3BROA 1FNNA 4I01A 3SFZA 1HBXG 3KE2A 1KA8A 2PFBA 2PMZN 1VQ8I 1KU9A 3KFWX 3CCQI 4PSWA 3OYMA 2QKLB 1USTA 3KP6A 3DQVC 1VQNI 2DOEA 3AG3H 2KKOA 2IS4A 2OCEA 1ODDA 1Y39A 4LGWA 4ZYGA 1I39A 5HDGA 1UFMA 4RB3C 2NS7A 4FETA 2OTJI 2R7SA 3DCFA 3CF2A 2YSRA 2ISZA 3C7JA 2UV1A 5M3MJ 3FKJA 1L3LA 4GXOA 3EUAA 3HM5A 4P55A 5JLXA 3OYAA 5E3MA 2DQRA 1WVRA 3WHCA 5E8IA 1IUYA 3S3MA 1LB2A 1JUPA 2F4MB 4ASNA 4JK1X 4MTEA 3JRAA 3I9V2 3JW4A 2F5EA 5FRMA 4DZJA 3E0JB 1RUOA 3KP7A 2K7LA 4CZZA 3MCZA 3TP0A 4E6KG 2PN6A 1RUNA 3A0HC 2KZVA 3CCYA 4IO9F 4ETSA 3QPTA 5JI6A 2VJJA 2CQQA 1H9TA 3K4KA 3GZ5A 3LA3A 4KDPA 3S3NA 4M3EA 1ZR2A 2BW3A 3F72A 5EF6A 3F9KA 2F6CA 5ERIA 2FE3A 2L9RA 1J09A 1LEAA 3CZ6A 2HQRA 5J1YA 2EZHA 3SFIA 1HA8A 3OOPA 4G7OF 2GZWA 4BE0A 4O6JA 3TP3A 4IHYA 3OS0A 2AO9A 3HRMA 3AG4H 1HKQA 4UUTA 3QYBA 2DMTA 4A5NA 4LB6B 2MBFA 2IS6A 2ZNZA 1B9NA 3H5AA 3S2WA 4A5MA 3GYHX 3K4BA 1G4DA 3BZ6A 3O3KA 1X3UA 1HKTA 2JA5J 1RZ4A 3JRFA 1FMWA 3MKLA 1IN6A 1X3WB 1WPKA 5F6FA 1MD0A 2COBA 5F0FA 4DZPA 1KYZA 3CLOA 1AU7A 2A6EF 3E5UA 2DDAA 4BEHB 1X1CA 3FMRA 4BBRJ 3FXQA 5ILUA 3KEYA 2IA2A 5C4XJ 3DWLE 1XG1A 4I99C 4DYQA 3CJRB 1QA6A 3I4MJ 3GCMA 2BY1A 1V55H 2PEXA 2ZMEB 4BHCA 1WH7A 1B4AA 4II2A 1RR7A 2FRHA 2R5YA 4U7BA 1IRZA 2OQRA 2Y69H 4II3A 1EV7A 5D5XB 2PJPA 3DEEA 3BR2A 1MMDA 1IC8A 2OCCH 3C3WA 4NC7A 2CFOA 4XLAA 1OR7A 3L2UA 3K70D 3Q9VA 5F64A 5K7HA 1KONA 3F8FA 2Y0SN 1SFEA 1W36D 4M9ZA 4RA2A 1U8BA 2P7VB 1SFOJ 1A31A 2PG4A 4NHJA 5IYCJ 1W0UA 3M9AA 3CCEI 2IP2A 5GAHJ 3EYYA 1U2WA 3SXYA 3FXMA 4IF4A 1B8IB 2OC6A 3MKWB 1OISA 3BR6A 5B66C 3LSJA 4UUSB 1ETOA 4PJMA 1DU0A 2VN2A 4LMYA 1G59A 1MNDA 4HAMA 2CQNA 2KHMA 2PLYA 4BY1J 3KZYA 3G71I 4ZDPA 4BDYA 3T8RA 2LY2A 1JKQC 3RKQA 3I55I 3EPZA 4XKCA 2R7FA 3ASOH 1R1VA 2VQCA 1UHWA 2K86A 4LB5A 2DTRA 2L3DA 4JOMA 1QZZA 3HYIA 4ENJA 2XAFA 1R7JA 3JAMZ 3JCUC 2Y31A 2Y9YA 4B43A 1R58A 4XNFA 5F08A 5FFXA 3WTVC 3O6BB 1K7AA 3J81K 4B47A 1ZGAA 3L00A 3NWSA 3QOPA 3J80K 1MGTA 4GYGA 4LFUA 3S14J 3VOEA 2P8TA 5LHHA 1D3YA 2IPQX 4JX5A 2QGUA 3WU1B 3OYIA 1ZREA 2D5VA 4FHTA 1OCZH 2V4JC 1D1AA 3W6VA 4IRIA 2P5KA 2WV1A 2DYSH 3QYEA 1HLVA 2CGPA 4HG2A 2Q8KA 1ETYA 2FMLA 2G7HA 3PM1A 4G8XA 1QZYA 5AIQA 5DEQA 1QBJA 2FXAA 2LTPA 1HW5A 2L7ZA 4LD5A 1SVMA 2QBYA 3ZQ7A 1KU7A 2R7UA 2EB7A 2EWNA 3IP4B 4XLFA 1O4XA 4BBSJ 2F48A 2K9MA 4PSXA 5HOOA 3L1PA 2F4OB 2JRMA 3GFMA 4S0HB 3I64A 5B1BH 3ZN1A 3LAPA 2XF7A 4LIUA 5E3NA 2E60A 3GTKJ 2LKPA 2MW8A 4P96A 2ESNA 4M74A 1V5GA 3OYLA 3GO5A 2QBYB 3CMAI 4YIIA 1K79A 1N77A 3FF5A 1VQMI 2Q2EA 5CQEA 1WZ2A 1WGXA 3RPQA 2ZJQF 2K9NA 4N4OB 3G73A 2XRLA 2W1OA 3ZPLA 2M9HA 2QQ9A 5BMZA 1ZTRA 3CMMA 2RNJA 2E1MC 4ESBA 1BW6A 4FCYA 3BOQA 2R3SA 2DT6A 1FP2A 1WJBA 5GP9A 1I1GA 1LVKA 4HNUA 3F6VA 2NS0A 4Y4RA 4BH9A 3FK6A 3GVAA 4OINF 3A2KA 5HLHA 2XVCA 1G3TA 3UNGC 2BY0A 2Q2EB 4Q48A 5LBQA 3FXKA 2UWMA 3OYFA 1HXDA 4HQMA 2F5VA 3L7WA 3HTUA 5CQGA 4DBRA 2XHKA 5BS6A 1ONVA 2QQAA 4E7SA
chains in the Genus database with same CATH topology
1R6RA 4PJJA 1D0ZA 2V7FA 2VQHA 3OYHA 3OMYA 1QHHD 4BQNA 3RSNA 4MLOA 1GLNA 4B3XA 2IGOA 3PJRA 3VYUB 4PK4A 2RQQA 3MKYB 4GRIA 3C2HA 2I8DA 2LY1A 1MNEA 2DCEA 4ZYAA 3ZQQA 3W2WA 2CW8A 4CCNA 5HNHA 2P0WA 2R7TA 2M7AA 1UELB 2HDWA 1BOBA 2W4SA 1N78A 2A6TA 4N4NB 3VDXA 1UAAA 2WAFA 4XN3A 2R7XA 3AL0B 2LH9A 3VYSB 4U87A 4HEA2 4RLFA 1X1BA 5HVQC 3VSLA 3LFUA 1Z3YA 2UUZA 4BGDA 4J01A 2OUMA 4CSWA 5CKTA 1DGRM 3E1SA 1PJRA 4HNTA 1LFPA 4ITVA 4F52A 2DJIA 2R7OA 1WJCA 3RQ4A 4NNJA 4XL9A 4AVZA 4Y3OA 4JQFA 2VL8A 2NOJB 2KPMA 4OAZA 2BVMA 4D9JA 2QKMB 2WY7Q 2LBFB 4QPQA 3M8JA 3W2VA 4BS9A 2O5RA 4XLHA 2HNHA 1E0EA 2ZSHB 4XOTA 1LDKB 1NG7A 2KP6A 2X6WA 3H35A 4BQQA 2Q1ZB 3OYEA 3DTEA 3LSGA 1P9QC 1WJEA 3K4MA 3OL3A 4EATA 4DOZA 3H9JA 2WBMA 4HPQA 2VIXA 3M1CA 2XF6A 1Z7LA 4KJZA 1TZLA 4YEJA 2FUG2 4AU7A 1AA7A 2OV7A 3ZXSA 1ZELA 3I3LA 2XAUA 4BE1A 4HSRA 3S8PA 2HPIA 3PNYA 2X85A 5TGTA 2HQAA 4E7IA 3MKZA 2A5WA 1DP3A 2RREA 3FHNA 2KRCA 4B44A 4F55A 4ZDLA 3NWTA 3ZRGA 4PFPA 3L2VA 4XKBA 4C30A 3TBIA 5FRNA 2WB1A 2X1DA 2LG4A 1Z3XA 3DKXA 2RNGA 4E7ZA 2BOLA 2CV1A 4R79A 3H5RA 4BEHA 4E7HA 1D0YA 3QODA 4XORA 2CH0A 2V1NA 2CMPA 3VYTB 5LD2C 4ANJA 4YRVA 4CA0A 1FMVA 3S32A 2VJ4A 3N05A 3OOUA 3DPLC 1BR1A 3A1YA 2VASA 2K3PA 3MD2A 2Z16A 2IS1A 2ZXIA 4E7LA 2WAQA 4CCOA 3HUGB 4B48A 1YE9A 3BCAA 3HKZA 5JHFA 5KCMA 3K6GA 3IAS2 3SYTA 3FDYA 3DU6A 3LSMA 2WY8Q 3V42A 3OYCA 2LC2A 3OYNA 3HPGA 3IUOA 2R7RA 4CZCA 1DQUA 2IXSA 2AQEA 2VQGA 2XF5A 2M3AA 2K5CA 3IAM2 2VPLA 4F92B 3HG9A 2XC7A 2V9KA 4XM3A 5HNFA 2L9NA 3SDBA 3RPUD 2GOXB 2IS2A 2HU9A 4C2TA 3LMMA 1U0JA 2XDVA 4XKWA 3FBNB 2M4KA 3S93A 4AYBA 3OR2C 1DGWY 2JA2A 3ZR8X 3DKYA 1YX3A 3DLAA 1V5EA 3KYLA 3G2BA 2W7NA 2VQLA 1K6YA 3H5NA 2CW7A 1X4OA 5LFAA 3HPHA 3FBIB 4E7JA 1X19A 2WA0A 4KITB 3EUKL 1Z21A 2Z1DA 3KX2A 3OL4A 4C2UA 2E5ZA 2VJ5A 3TL4X 3U21A 5KHDA 3L2WA 1UG0A 3DTKA 3PSIA 3OYKA 3H9QA 3K4JA 1WFXA 3DTIA 2M7BA 2VXDA 4PSWA 4PJLA 3BCBA 3OYMA 2QKLB 2MYSA 2HPMA 1T0FC 3DQVC 2VKDA 3AL0C 4DGWB 2AQFA 2IS4A 4F91B 3OS1A 2DXIA 2CV0A 4FETA 1LKXA 3W2AA 2R7SA 1IRXA 3AKZA 3CF2A 2Z2SB 2UV1A 3FKJA 2CV2A 2PJRA 3ONQA 3EUAA 1V5FA 3OYAA 4NUBA 3K70C 3S3MA 3CESA 2MFZA 2XSJC 3PNVA 3OYJA 4IKFA 3D5SC 3PSFA 1ERDA 3I9V2 4H4KC 1MMAA 5FRMA 3E0JB 3CP2A 2PJRB 4LIVA 4E6KG 2VKHA 2WAEA 3HOTA 2KZVA 3D5RC 4ZTJA 2VJJA 3K4KA 4CH7A 4PFOA 3S3NA 1D0XA 1WJAA 2BW3A 3F9KA 2F6CA 3PFYA 4XLEA 2VJIA 1WJFA 1J09A 3CZ6A 1QHGA 3OS2A 4XQFA 4DBQA 1HA8A 2MC4A 2WADA 2HVRA 2V26A 4BL0B 4BE0A 2JUGA 3LSKA 3MMYB 4BU2A 1VZ0A 3OS0A 4OAYA 4XONA 3QYBA 1SFKA 3UR3C 4HRIA 4LITA 2IS6A 3BLYA 3H5AA 2IGKA 4IZZA 3K4BA 3BG6A 3BC8A 4RM3A 1FMWA 4DIQA 2MD0A 2JSPA 2ELJA 2E5NA 4BEHB 1X1CA 2LOOA 1N75A 2M0MA 1Y6IA 4D1QA 3KEYA 5CPRB 3PNTA 1X1AA 3DWLE 4IQJA 1MW7A 3CJRB 3L2QA 1Y56A 2DT7B 2GOMA 2X1EA 4PUSA 4II2A 4FASD 3OR1C 3CJQB 3J7AY 1YX5A 1S9HA 4U7BA 1BR2A 3ZGKA 2ZXHA 3LSIA 4NQWB 4XN0A 4II3A 1PYVA 4CCMA 2KQRA 3LL7A 2PMZA 4G6TB 5HLTA 1X1DA 3DEEA 3TMOA 3W3CA 3CP8A 1MMDA 4BACA 4NC7A 3OIPA 2HVSA 1WJDA 1MMGA 2CFOA 4XLAA 5FROA 4P1WA 3L2UA 3K70D 2L9SA 4E4HA 1KONA 4RLQA 1W36D 2HVQA 4F93B 4E7KA 4BQOA 3C2GA 3VYRB 3HL2A 4DJAA 2JVGA 3OY9A 1NG6A 4IQ4A 1T95A 1EA3A 4BJ5C 2L7KA 4BXFA 1QU3A 4OWRB 3BG7A 2F4IA 2OC6A 4F3QA 2VLAA 1X4PA 3MKWB 1OLTA 4ZTFA 2LYCA 2CUZA 2R4GA 4PJMA 4XR6A 2KDOA 2R7QA 1G59A 4Y33A 4BJ6C 1MNDA 1SAUA 2X51A 2KHMA 3L2RA 2R7VA 4ZDPA 4BDYA 1OR7C 3OWTA 3K10A 2L5QA 4X0GA 2VXZA 4QPOA 2LY2A 2K9LA 1BR4A 3OYBA 4XKVA 1D1BA 2X6XA 2ZFUA 2LBFA 3EPZA 4LG3A 4XKCA 4BDZA 4CCKA 1JI8A 2X1CA 3OYGA 2VQCA 2BVLA 3ZCOA 3HOSA 2MABA 3AFHA 2LREA 3A4CA 4JOMA 1W36C 4KT6A 3DPTA 4ZC3A 2KMUA 3S3OA 4B43A 4XNFA 4PJNA 3K4CA 4B47A 1D1CA 3NWSA 4IX7A 2HZDA 2L2OA 3D5LA 3RCOA 2W00A 3HXLA 3PUBA 1MMNA 3OYIA 1G8XA 4C9YA 2V4JC 1D1AA 2M4GA 3SZGA 2KL4A 2W82A 3QYEA 2CS3A 4CCJA 4HG2A 3OYDA 4BE2A 2ZSIB 4RMNA 4CCLA 4BUPA 4XOPA 5KNLA 3K4NA 1TT0A 2X6YA 2IGMA 4J00A 2BW3B 4RM2A 3K4LA 2IGNA 2R7UA 3IP4B 4XLFA 4ZJZA 2K9MA 4PSXA 5HOOA 4NC8A 4P5OA 2E1MB 4BJTA 3EUHC 2XF7A 3GBGA 2DOAA 4LIUA 3SEZA 3LSHA 3PL8A 4XMYA 2E60A 3OYLA 1V5GA 2CUJA 1N77A 3H0DA 5CQEA 3VSKA 2JVHA 3QYFA 4N4OB 3VWBA 3DPUA 2W1OA 3CMMA 4YELA 2E1MC 2V6EA 4KISA 2DT6A 1WJBA 1LVKA 4HNUA 3OIQA 4Y4RA 4CUGA 3A2KA 4HSTA 3RTRA 3DU5A 4ZDOA 2VB6A 3HC7A 4XLCA 3UNGC 2Q2EB 2R7WA 2UWMA 3H9GA 3OYFA 2F5VA 2KRHA 2Y0SA 2LRDA 3SEQA 5CQGA 4DBRA 2KLOA 3QOEA 1WJ5A 4E7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYA A;  2KQR A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  5D5V B;  2WAQ N;  3BP8 A;  3BTI A;  3F8N A;  3K2Z A;  4PJJ A;  4HDU A;  2V7F A;  4IHV A;  2X48 A;  1OYW A;  5L3G A;  5J8C A;  5F04 A;  4KMF A;  3WHB A;  3OSG A;  4AID A;  4MLO A;  1MJB A;  1LDD A;  2QVO A;  4RAF A;  1T56 A;  3C2H A;  4GRI A;  4BYY A;  1BC8 C;  2XRN A;  1ZN2 A;  2VKV A;  3A01 A;  2DCE A;  2DFH A;  3FK7 A;  3GTJ J;  2X9D A;  4KN7 X;  1BJZ A;  5TRD A;  3KPH A;  2H27 A;  5HNH A;  3RYR A;  4KT5 C;  2M7A A;  1XSV A;  1T2K A;  4M3G A;  1XGS A;  2HKX A;  4HV6 A;  5FKO A;  1UAA A;  2DMN A;  2GAU A;  3KEQ A;  2R7X A;  5ICG A;  1WHU A;  5CVR A;  1GUU A;  2NYX A;  3WOD F;  3A01 B;  1WSU A;  4UB8 C;  4RLF A;  2QQ8 A;  3LFU A;  1YRN A;  1RET A;  2A61 A;  4BGD A;  2L4A A;  4J01 A;  2OUM A;  3F0C A;  3C18 A;  2O3F A;  1FY7 A;  1HDP A;  3FMS A;  3ZQH A;  1T8I A;  2CRG A;  4HNT A;  4KYW A;  2DU9 A;  1B59 A;  2VBW A;  4HX7 A;  2ZFW A;  3CDI A;  1XMA A;  3IKV A;  3RQ4 A;  5LLQ A;  4A3B J;  4I0B A;  2CQ7 A;  1YRN B;  4AVZ A;  4Y15 A;  2VL8 A;  2NOJ B;  3C2B A;  4D9J A;  1YTY A;  3CCM I;  2BXY A;  4I7H A;  3WTZ A;  3S2D J;  3MN2 A;  1Z6R A;  4XLH A;  2UXX A;  1YW7 A;  3IV5 A;  1KZH A;  1E0E A;  1T98 A;  1LDK B;  2F5C A;  3CO6 C;  3HRS A;  4IOC F;  1RIO H;  3H35 A;  1YJW I;  4BQQ A;  3PO2 J;  2R93 J;  3U2R A;  1NK2 P;  1P9Q C;  4EVI A;  2X6O A;  1GXP A;  3FWE A;  3TOA A;  3S1Q J;  4DOZ A;  3G4S I;  2M2E A;  2LSO A;  2DT5 A;  4A3C J;  3K69 A;  3K1P A;  3VPR A;  5C4J J;  3ROU A;  2DJN A;  4AU7 A;  2JA8 J;  3ZXS A;  4D7M A;  4KIF A;  3CCR I;  3A02 A;  4XRS A;  3CQZ J;  2HPI A;  2X85 A;  2EIK H;  5L3E A;  2QM3 A;  4A3M J;  4CIC A;  3S16 J;  1IXC A;  2IW5 A;  2XPV A;  3KLN A;  5J4Y A;  3MKZ A;  2A5W A;  2RRE A;  2KRC A;  4HW0 A;  1K4T A;  2NXN B;  2V79 A;  2Z3Y A;  1HF0 A;  3IRR A;  5EGO A;  4L9T A;  2MH2 A;  2R7D A;  2KIM A;  4I02 A;  1AHD P;  1REP C;  3ZRG A;  3CO7 C;  2HOS A;  3L2V A;  4C30 A;  1OYI A;  5FRN A;  2WB1 A;  1Z3X A;  3DKX A;  1JKO C;  2RNG A;  2ECB A;  5ICE A;  5M5Y J;  2BOL A;  2CV1 A;  3J81 Z;  3HOZ J;  5K5O A;  2X4H A;  1WH5 A;  2K4B A;  4XOR A;  3QOD A;  5EEA A;  3GUD A;  1TL8 A;  4PZJ A;  3P9C A;  1XTA A;  5EGO B;  1FMV A;  3S32 A;  1JKP C;  1ZLK A;  2DYR H;  2D2W A;  2K40 A;  3MD2 A;  2IS1 A;  2Z16 A;  2ZXI A;  1FP1 D;  4B48 A;  1YE9 A;  3BCA A;  1SD4 A;  5EZG A;  5L3D A;  5C3E J;  2BXZ A;  1JTY A;  4KFC A;  3V42 A;  2LC2 A;  3HHH A;  3HRT A;  1ZQ3 P;  1FEX A;  3FXR A;  2ZKZ A;  1DQU A;  2VQG A;  5J6X A;  2K5C A;  4LLL A;  2VPL A;  2DA7 A;  2GXG A;  2XV4 S;  2DI3 A;  3LNQ A;  3FBN B;  2M4K A;  2RQP A;  3H1C A;  3JRE A;  1SD7 A;  3U1K A;  4AYB A;  2XB0 X;  1JGG A;  3DKY A;  3IKT A;  3RJP A;  3MFK A;  1ZRC A;  4Z2Y A;  3KYL A;  2HS5 A;  3FXL A;  2VQL A;  5BQT A;  3LAJ A;  2H1K A;  4YFN F;  1Z21 A;  2ZXW H;  1HST A;  2FU4 A;  2M0C A;  2GIV A;  2YS9 A;  1I1S A;  1PVE A;  2E5Z A;  1JTX A;  2EIN H;  4JP0 A;  3TL4 X;  3U21 A;  5KHD A;  1P4A A;  1TWA J;  2E1N A;  4JX4 A;  3PSI A;  5K7F A;  3OYK A;  3M3Y J;  3DTI A;  4MO7 A;  1LFB A;  3C1D A;  2VXD A;  4TV7 A;  2L7F P;  4WXD A;  1B1B A;  3PUF A;  1MSF C;  3DBR B;  3AL0 C;  4DGW B;  1GVJ A;  4G7H F;  4A12 A;  2XUB A;  4IHW A;  4QTR A;  2QYO A;  2HEO A;  3S1R J;  5DDG A;  1H0M A;  3JTG A;  5FKN A;  2XGC A;  4RAZ A;  1V5F A;  1WKM A;  2BY2 A;  3IH3 A;  3F6O A;  4FTH A;  3TO7 A;  5TIS C;  1MBH A;  1VQ9 I;  3M8F A;  3F3X A;  3CCU I;  3BG5 A;  4B1R A;  4NC6 A;  3NAR A;  4I09 A;  4RS8 A;  4O5V A;  1QZE A;  2EH3 A;  4I2O A;  1MBF A;  1IRG A;  4I76 A;  4H4K C;  4M6X A;  1RKT A;  1CF7 A;  1VFC A;  3HGG A;  3SZP A;  2ECC A;  3KYC B;  4XRS G;  2XGE A;  1ORK A;  2A3S A;  5HS8 A;  4M73 A;  2V9P A;  4XIC A;  2WAE A;  3HOT A;  3M7G A;  4ZTJ A;  4Q4Z F;  1ZAO A;  1V4R A;  2K9Q A;  5E18 F;  1D0X A;  1WJA A;  1CF7 B;  1YLF A;  4XLE A;  2VJI A;  3GXO A;  1AKH A;  3I71 A;  3OS2 A;  2CG4 A;  4DBQ A;  2W57 A;  4ESJ A;  2IEK A;  2GBY A;  4BL0 B;  2EIL H;  4OIR F;  1QQI A;  1ZH5 A;  3LSK A;  2LVS A;  3HSE A;  2A6H F;  2DA5 A;  4OAY A;  1BN5 A;  4XON A;  1AKH B;  4EJO A;  2QSF X;  4LIT A;  2J5P A;  3BLY A;  2KIQ A;  2VPR A;  1I6H J;  3OSF A;  3BG6 A;  3G3Z A;  4D5F A;  3PFI A;  2Z9O A;  1HQC A;  1FT9 A;  1MKM A;  3IWZ A;  2ELJ A;  2E5N A;  4RGU A;  2M0M A;  1N75 A;  2K9S A;  2ZBK A;  1ZG1 A;  2M34 A;  3PNT A;  5DTD A;  1A35 A;  1X1A A;  2E2I J;  2N8G A;  4NQW A;  1NK3 P;  3QPL A;  3IC7 A;  2NVU B;  1LUJ B;  2M8G X;  2DT7 B;  3FZV A;  2CQX A;  1JT0 A;  3P9I A;  3S2H J;  2O9L A;  2GXB A;  4FAS D;  1E2X A;  3OR1 C;  4OIO F;  3CJQ B;  3CDH A;  2V1D A;  1NTC A;  2IAI A;  1J7K A;  1ZRF A;  3LSI A;  4NQW B;  2B0L A;  4M3B A;  2MG4 A;  4XN0 A;  1PYV A;  1TWC J;  5DM7 F;  3G6E I;  4KNY A;  2KQR A;  5HLT A;  2VKE A;  5IY5 H;  4BAC A;  3JAM K;  3NAU A;  1MMG A;  4P1W A;  3JSP A;  1BM9 A;  2L9S A;  4E4H A;  2HDD A;  1OKR A;  1P4W A;  1YOV B;  2HVQ A;  4F93 B;  4K2E A;  3GFI A;  1TWG J;  1BI0 A;  2ID6 A;  3K2A A;  3C2G A;  1YIJ I;  5HS9 A;  4WK8 F;  1GVD A;  3KIO A;  3WTW C;  1Z7U A;  5IT9 K;  3GLX A;  1BC7 C;  1W5S A;  1EA3 A;  4BXF A;  2DMU A;  1YIT I;  2FA5 A;  2QLZ A;  5FB2 A;  2ZNY A;  3O8G A;  1OLT A;  1DPU A;  2FOK A;  2CUZ A;  3BQY A;  2R4G A;  4EJV A;  2KDO A;  3E5X A;  4Y33 A;  5L3F A;  1R5I D;  1BBY A;  1F36 A;  2W48 A;  4NBQ A;  5DD4 A;  1E3O C;  4IOA F;  2TCT A;  2R7V A;  5HLG A;  4LK0 F;  1VQ5 I;  4QPO A;  2JA7 J;  5FJ8 J;  4B8X A;  4Y52 J;  4XKV A;  2JN6 A;  1MJA A;  2X6X A;  2LBF A;  1IZ1 A;  3LWF A;  4LG3 A;  4BDZ A;  4CCK A;  2X1C A;  3HBL A;  4UV8 A;  4YG2 F;  6PAX A;  2MAB A;  1YYV A;  1A36 A;  3CUQ C;  1SFU A;  1OMI A;  3KP3 A;  3A4C A;  3M07 A;  3DPT A;  3FM3 A;  2KMU A;  3S3O A;  1FIA A;  4OIQ F;  2WC2 A;  2FMY A;  4PJN A;  5LHG A;  3K1N A;  3CCL I;  3FXJ A;  2FJ1 A;  2ADU A;  5B5E C;  4IX7 A;  1BIB A;  2E19 A;  4DQ2 A;  5GAD J;  1RNL A;  1PUE E;  2W00 A;  3HXL A;  2XPW A;  1MMN A;  4B4C A;  3HSF A;  2G7U A;  3LSP A;  1UHM A;  1YIO A;  3Q0U A;  4BE2 A;  1Y8R B;  2HQN A;  2DQL A;  4I98 B;  1A04 A;  4M6V A;  4OU0 A;  3RYP A;  4EM2 A;  5GPC A;  4CCL A;  5F1R A;  1RKW A;  2BW3 B;  4RM2 A;  2MA3 A;  2CWE A;  4CHU A;  2IBD A;  4ZJZ A;  3K9T A;  5BPI A;  2O8K A;  1OCP A;  2DA3 A;  3KP4 A;  4GCV A;  1DU6 A;  2RC4 A;  3ABU A;  1S29 A;  2A69 F;  3ZMU A;  5B1A H;  3EUH C;  1IDZ A;  1XDU A;  3GBG A;  3H3U A;  4MQV A;  2DOA A;  3WE2 A;  3PL8 A;  2OBP A;  4A3I J;  4EJT A;  1BI3 A;  4HZF A;  2LFB A;  4CYC A;  1YQA A;  4IL6 C;  1B6A A;  1E17 A;  3VSK A;  1J9I A;  2ME0 A;  2PMH A;  3FIW A;  3H3Z A;  1R9T J;  4NB5 A;  2GA2 A;  1ULY A;  1X58 A;  4GO1 A;  5CLS A;  3HDD A;  4Y13 A;  3ZN0 A;  5IOY A;  4UXN A;  2V6E A;  2FBI A;  5LGU A;  1FZP B;  3RDI A;  2HOE A;  4A3G J;  1AOY A;  3GTP J;  1G3W A;  3F8B A;  3F8M A;  4CUG A;  2VON A;  2WB1 N;  4IHS A;  3RTR A;  3G1M A;  2VB6 A;  4CYC B;  3BR1 A;  3WGH A;  2L54 A;  3H9G A;  1FTT A;  1F5T A;  3SEQ A;  2DFI A;  3H3V K;  2KLO A;  1U9O A;  1WJ5 A;  1XCV A;  3CCS I;  4W1U A;  1VQ7 I;  2G9W A;  3BR5 A;  1R6R A;  1D0Z A;  1UJ8 A;  3OYH A;  2XRO A;  4HQE A;  2R5Y B;  2HXO A;  1EF4 A;  1FBU A;  2KT0 A;  4RAG A;  3WG9 A;  4BQN A;  1SFX A;  1GLN A;  1TC3 C;  4PK4 A;  2RQQ A;  2I8D A;  3RPU A;  5DM6 F;  1MNE A;  4UB6 C;  4U7D A;  1ZRD A;  4U0Y A;  2Y0M A;  1MIJ A;  4A2U A;  2DDB A;  2DAO A;  3KYD B;  5E79 C;  3T8T A;  1QGP A;  1MSE C;  3I0T A;  2P0W A;  1R1T A;  1UEL B;  1VI0 A;  2KJB A;  2OF7 A;  1BOB A;  3BWG A;  4AYB N;  1N78 A;  2W85 A;  2CQK A;  1XSX A;  2WAF A;  4XN3 A;  5EJC A;  2FQ3 A;  3AL0 B;  1KU3 A;  1FC3 A;  3B02 A;  4FT8 A;  2ZCW A;  2ELK A;  2EZK A;  3VSL A;  2B63 J;  5CVI A;  3IH4 A;  2QEX I;  1R4N B;  1Y1V J;  3ZQF A;  1DGR M;  3E1S A;  4S05 A;  1PJR A;  1LFP A;  4ITV A;  4XRF A;  1DUX C;  2DJI A;  2E36 A;  1ETX A;  4NNJ A;  2JQ7 A;  2E2J J;  5M5X J;  3H92 A;  3ZQL A;  4YFK F;  2KPM A;  5GPA A;  3TKY A;  2QKM B;  1O57 A;  1FSH A;  3BJA A;  5D6E A;  1MBE A;  3JRI A;  3GFJ A;  3TW6 A;  3J7Y J;  2QEN A;  2HNH A;  1YW8 A;  2ZSH B;  5ILV A;  3IWF A;  2DMP A;  2YU3 A;  1NG7 A;  1J75 A;  2HYF A;  3MZY A;  5IT9 Z;  4ON0 A;  1IN7 A;  5EG0 A;  3FX3 A;  4CGZ A;  1WJE A;  1YS6 A;  2YX7 A;  3V7C A;  5IP6 A;  1YS7 A;  4F7Z A;  3H9J A;  2EV6 A;  5K1Y A;  3LST A;  3BTC A;  2ESH A;  2XF6 A;  2E34 A;  2HGC A;  1TZL A;  1OQY A;  5FLV A;  3Q5F A;  1F1Z A;  2ZJP F;  2FBK A;  2OV7 A;  1ZEL A;  3CJN A;  3I3L A;  5EG0 B;  3QU3 A;  3HOY J;  2XAU A;  3RZO J;  3REO A;  1VQK I;  2VUM J;  1IGN A;  1FYL A;  3OIO A;  1Y0N A;  4XSZ F;  4E7I A;  5CVJ A;  2CU7 A;  4F55 A;  2BE5 F;  1SC7 A;  3NWT A;  1TQM A;  1BOA A;  3HGY A;  1NHA A;  3HSR A;  2HFH A;  2G0E A;  3HRU A;  3R60 A;  1DDN A;  4JX6 A;  2K02 A;  1H9G A;  4L5J A;  3D1N I;  1KU2 A;  4XK4 A;  2O7O A;  2X1D A;  4GGG A;  1WQ2 A;  1TTY A;  2XAQ A;  3K7A J;  1ZYR F;  3WE3 A;  1D0Y A;  2BZT A;  1OYY A;  3BY6 A;  1YHQ I;  2XAS A;  4MFD A;  1IXR C;  2CH0 A;  3VYT B;  1YG2 A;  4MHG A;  1B9M A;  3N05 A;  1W4M A;  3A1Y A;  3DPL C;  2VAS A;  2AHQ A;  2LK2 A;  1ON2 A;  2MD5 A;  2ACJ A;  4FQG A;  4E7L A;  4EEF G;  1G3Y A;  3HKZ A;  4IXA A;  2F5D A;  4U88 A;  5KCM A;  3K6G A;  1S8N A;  2DOF A;  3FDY A;  3DU6 A;  2WY8 Q;  3DBH B;  3OYC A;  3OYN A;  1LVA A;  3HOW J;  3ECO A;  3ZMV A;  5E1X A;  4CO8 A;  2IXS A;  3I4P A;  2XF5 A;  3ASN H;  2M3A A;  4PGH A;  1LPQ A;  3IAM 2;  2OU2 A;  3R4K A;  1VND A;  4EQQ A;  2XC7 A;  3R6S A;  2L9N A;  1Z67 A;  4RB0 A;  3RPU D;  2GOX B;  5J1R A;  2IS2 A;  2FNA A;  2HU9 A;  2NS8 A;  3LMM A;  1XB4 A;  2CW0 F;  1U5T C;  2Z5U A;  3S93 A;  4L18 B;  1VQ6 I;  2FSW A;  2HDC A;  3OR2 C;  3ZR8 X;  2PQ8 A;  3MQ0 A;  3KZI C;  4L5I A;  1ZGW A;  5FLX K;  3P9K A;  4ZZL A;  1K6Y A;  1X4O A;  4IHX A;  5LFA A;  2OQG A;  4E7J A;  1X19 A;  4UHT A;  1OJL A;  4BKX A;  4PJ0 C;  1D5V A;  3L2W A;  3I54 A;  1JJ8 C;  2ZB9 A;  1WFX A;  1YJN I;  4N0B A;  4UUV A;  2K85 A;  2NVY J;  4QIW N;  4PJL A;  1STZ A;  2GQQ A;  2MYS A;  2HPM A;  4IEJ A;  4L9N A;  5CJ9 A;  4EGZ A;  2K3F A;  4KIC A;  1MBK A;  4A69 C;  2DXI A;  2Q0O A;  2ISY A;  2ZXJ A;  1O7F A;  2JPC A;  4B09 A;  2E71 A;  2DPD A;  4BHP A;  3QP6 A;  3W2A A;  3AKZ A;  1MBG A;  1X2N A;  4OOI A;  1Z77 A;  2Z2S B;  1UCR A;  1LE8 A;  2VE9 A;  2CV2 A;  4HF2 A;  3CDL A;  1CQT A;  1SMY F;  3IH2 A;  3V7S A;  2R92 J;  1FBQ A;  3K70 C;  2DA2 A;  3RQI A;  1FIP A;  1P6R A;  2MFZ A;  3CES A;  1R71 A;  2XSJ C;  3RZD J;  3PNV A;  3OYJ A;  2XSD C;  5EYR A;  2HXI A;  1Z6T A;  4WXH A;  1NH3 A;  2XIG A;  1MJ9 A;  3CP2 A;  4BXU A;  4LIV A;  2AXT C;  3H0G J;  1KYW A;  2YX4 A;  3L2C A;  1R22 A;  3SHF A;  5HDK A;  3D5R C;  2E2H J;  1JKR C;  2BYV E;  5M3F J;  3ML6 A;  4HYE A;  4PFO A;  4CH7 A;  2COM A;  2DN0 A;  2H1L A;  1O3S A;  3GFL A;  1ZLJ A;  3HEF A;  1GV5 A;  2LKX A;  3D0S A;  4HX4 A;  3R0J A;  1WJF A;  3V8K A;  1QHG A;  5ICF A;  1TLH B;  1N25 A;  3CC4 I;  3B6C A;  2H8W A;  3HZJ A;  3ZOB A;  3E3V A;  4LOC A;  2HVR A;  1R1U A;  2V26 A;  2M1B A;  3TO9 A;  5J8F A;  2YR2 A;  4AVP A;  1IAW A;  2JUG A;  4ENM A;  3MMY B;  1IDY A;  1KQ0 A;  1R5H A;  3T1B A;  1POG A;  1SFK A;  4M3F A;  2XKO A;  3UR3 C;  4HRI A;  2JPB A;  3CD6 I;  2LF8 A;  5IYB J;  1V3F A;  1RI7 A;  3U1D A;  3BT9 A;  4AIJ A;  2AS5 F;  2GWR A;  1M1E B;  1KQ8 A;  1C0W A;  2Y2Z A;  3BC8 A;  4RM3 A;  5M5W J;  1XX5 A;  3WU0 A;  1QO0 D;  1IN8 A;  4DIQ A;  2MD0 A;  4D0P A;  2JSP A;  3DLL F;  5CYV A;  3R61 A;  3BR0 A;  4LLG F;  2LOO A;  1MNM C;  4BHB A;  4D1Q A;  2JK3 A;  2LF7 A;  3HOU J;  1PP8 F;  5E1W A;  2B7E A;  2STT A;  2GIZ A;  3L2Q A;  4AIK A;  3JRC A;  5E20 A;  2FX0 A;  3A03 A;  2X1E A;  4PUS A;  3KET A;  5CVU A;  2HR3 A;  4XID A;  3X2Q H;  1XN7 A;  5KAF C;  3J7A Y;  1FX7 A;  1BR2 A;  5D6F A;  3K0L A;  2ZXH A;  3PQJ A;  3CME I;  4CCM A;  5J4V A;  1QVT A;  1ZAR A;  3FXO A;  2ZME C;  3ISP A;  3CLQ A;  3TMO A;  2LLK A;  3W3C A;  1K6O A;  2QCO A;  3OIP A;  1FPQ A;  4WX9 A;  1ZGJ A;  3ABK H;  5FRO A;  1QPM A;  4RGS A;  4CYD A;  4GYI A;  2I5U A;  3VB2 A;  3TED A;  1ENH A;  1TWF J;  5JFR A;  3KEO A;  4E7K A;  3SDG A;  2HYG D;  5D4R A;  3WTU C;  1BIA A;  4MNU A;  2P6S A;  5E1Z B;  2JVG A;  3OY9 A;  1VQL I;  4G6D A;  3HTS B;  1D8K A;  4IQ4 A;  1T95 A;  4BJ5 C;  1QU3 A;  3NQO A;  2BV6 A;  4XLN F;  4OWR B;  5ED4 A;  4X6A J;  2DBB A;  1Z9C A;  2H6B A;  2E1C A;  1G2H A;  4F3Q A;  2VLA A;  1X4P A;  2VT3 A;  1MBJ A;  2K27 A;  2LYC A;  2D1V A;  4XR6 A;  2R7Q A;  3GW2 A;  4BJ6 C;  5EZH A;  4HA8 A;  1SAU A;  2X51 A;  4RGR A;  4C3H J;  2MLK A;  3HJE A;  3L2R A;  2F5F A;  1OR7 C;  2VC1 A;  3OWT A;  3K10 A;  2CJJ A;  4G6Q A;  4MFE A;  1S7E A;  2VOO A;  1SD5 A;  2LR8 A;  1BW5 A;  4JYK A;  1BR4 A;  3KP2 A;  3OYB A;  2RV8 A;  4V19 K;  2ZFU A;  1FYM A;  3E7L A;  1JI8 A;  1WI3 A;  3OYG A;  2NVT J;  2D1H A;  1JE8 A;  3DEU A;  2DK5 A;  5FLX Z;  2LRE A;  4KT6 A;  4A6D A;  2MLG A;  1TNT A;  1TBX A;  4M3D A;  1MZB A;  4ZYE A;  2IA0 A;  2FD5 A;  4M9S A;  5J40 A;  5KAI C;  3JRB A;  3K4C A;  4XRM A;  1IF1 A;  2HZT A;  1U3E M;  1D1C A;  2DTZ A;  2OZ6 A;  1OPC A;  3RIR A;  1E3P A;  3D5L A;  3RCO A;  1HSJ A;  1FLI A;  2EFW A;  4ENN A;  2ZJ2 A;  1JGS A;  3GF2 A;  2XGX A;  1K83 J;  1W5T A;  1R4M B;  4C9Y A;  4DW6 A;  3BG9 A;  5FKL A;  2KDZ A;  2J5O A;  3SQN A;  2KL4 A;  2CYY A;  5K7Z A;  4JBA A;  3JSO A;  3GZN B;  2R7Z J;  2EZI A;  2RGV A;  4A6E A;  4EJU A;  2ZSI B;  3LA7 A;  1FTZ A;  1IJW C;  3TDU C;  4A0Z A;  4RB2 C;  4A3E J;  4OIP F;  3JR9 A;  4J00 A;  2IGM A;  3K4L A;  1L0O C;  2IGN A;  1MH4 A;  3IRQ A;  4LLN A;  3L09 A;  2KJC A;  2ZC2 A;  2HI3 A;  1PDN C;  3PQK A;  1ZG5 A;  1S6L A;  3FXU A;  3JTH A;  2MC3 A;  2EK5 A;  2W84 A;  5KK1 A;  1ETW A;  4HLY A;  2P5L C;  1ZG3 A;  2V6C A;  4FIS A;  4NC8 A;  3NRV A;  4ZYH A;  1Z0X A;  2E1M B;  4BJT A;  2VBZ A;  5LEJ A;  2LKS A;  3PIP F;  2JMW A;  4EJW A;  4V2G A;  3CC7 I;  3WGI A;  1FSE A;  4MEX F;  2YUS A;  4X1E A;  2OZU A;  4HV5 A;  4MQ9 F;  4UV9 A;  3QYF A;  3DP7 A;  3ELK A;  3DPU A;  4BNC A;  4BQA A;  5LEK A;  2IRF G;  4A3D J;  4ZYD A;  2CUF A;  5IP7 J;  1U5T A;  3M8E A;  2EIM H;  4YEL A;  3HB9 A;  3ERE D;  4KIS A;  3OIQ A;  4HBL A;  4B3A A;  1LEB A;  4HST A;  3DU5 A;  3GZ6 A;  4ZDO A;  2JUC A;  3COA C;  2A68 F;  3HC7 A;  4XLC A;  4Y17 A;  4M72 A;  5F0C A;  1HDD C;  1XC5 A;  2X0L A;  1Z1D A;  2P81 A;  5F0H A;  1HOM A;  1FJL A;  2TRT A;  3CF5 F;  4A3J J;  4WF2 A;  3QOE A;  1BL0 A;  3LQR A;  2ZJR F;  1EKE A;  3UKG A;  1O3T A;  4HNV A;  1PP7 U;  3HKZ N;  2VQH A;  3OMY A;  1VF9 A;  3Q3S A;  3RSN A;  3U9G A;  4ABZ A;  4EM1 A;  3F23 A;  2V9V A;  5EDN A;  2IGO A;  2QUF A;  3RI4 A;  3BDD A;  3QQA A;  3MKY B;  1R36 A;  2DFF A;  4ZYA A;  5JLW A;  3W2W A;  2CW8 A;  1OFC X;  4AC0 A;  1LJ9 A;  2XGD A;  2LY9 A;  4N4N B;  5DCM A;  3VDX A;  5KVR A;  1T6S A;  4V2F A;  2LH9 A;  4U87 A;  3ZQI A;  4IRG A;  4GDF A;  5HVQ C;  2NNN A;  1Z3Y A;  1XSD A;  3OV8 A;  3DV8 A;  3CCV I;  1W0T A;  1ETQ A;  1U78 A;  5FGM A;  4AD9 A;  3T5X A;  4CSW A;  4M71 A;  5CKT A;  3WU2 C;  1MDM A;  2ETH A;  2WTE A;  1Y1W J;  5DCM B;  5DYM A;  4D7N A;  3WTY C;  2V1U A;  2NNY A;  4F52 A;  3KZZ A;  4R8H A;  1IN4 A;  4DYC A;  2H6C A;  1F9N A;  4JQF A;  2OAZ A;  3DXJ F;  1IUF A;  4OAZ A;  5IT3 A;  4A93 J;  1P2F A;  3F8C A;  2BHZ A;  4I0A A;  3HHG A;  2LBF B;  1ZR4 A;  3M8J A;  1MDM B;  2VE8 A;  3W2V A;  3AG2 H;  3BQZ A;  5A2Q Z;  3ABL H;  2PI0 A;  1JUM A;  3W6K B;  1ITY A;  2KP6 A;  3CJT B;  4L9V A;  3O2P E;  3V8L A;  5F1J A;  2GXA A;  2Q1Z B;  1VTN C;  3OYE A;  3SZT A;  2VOP A;  2EV5 A;  4ENK A;  2VI6 A;  2EFQ A;  3K4M A;  3HOV J;  3OL3 A;  4EAT A;  3BPX A;  1HC8 A;  4HPQ A;  2FOW A;  2JTV A;  4FX4 A;  2VIX A;  4EV0 A;  2EPF A;  2OJE D;  5CVV A;  3M1C A;  3RKX A;  3QAH A;  1FOK A;  4L9J A;  3RKW A;  4YEJ A;  2KIS A;  2EBI A;  1AA7 A;  4XBF A;  3I5U A;  1J59 A;  2QQB A;  4ZZD A;  4HSR A;  3PNY A;  5LGT A;  2STW A;  2K4J A;  4KIB A;  2HQA A;  4A3K J;  2BHY A;  4FX0 A;  4RGX A;  4Z6Y A;  2DOD A;  1DP3 A;  3FHN A;  2JA6 J;  1RC9 A;  3FIS A;  1GT0 C;  3QU6 A;  4UVC A;  4FE7 A;  1FOY A;  4U0W A;  3BZC A;  4BXX J;  2TDX A;  2LG4 A;  3GX4 X;  4E7Z A;  3J7Z I;  4R79 A;  3H5R A;  5DCF A;  1S3J A;  4BEH A;  4E7H A;  5EEG A;  3KLO A;  2NOG A;  2V1N A;  4CDG A;  2CMP A;  2EFP A;  5LD2 C;  4ANJ A;  1IV8 A;  2Y48 A;  2VJ4 A;  5DUK A;  5K5Q A;  4J19 A;  5JVG F;  2RDP A;  1R5G A;  4RDU A;  2ZME A;  3GTQ J;  2NRA C;  3V8J A;  4EMS A;  5JHF A;  2PX9 A;  1EH7 A;  1TP4 A;  1MH3 A;  3SJM A;  5FD6 A;  1BA5 A;  3SYT A;  3RKY A;  2EJR A;  2E1O A;  3HPG A;  2KFD A;  1U8R A;  1AWC A;  1D8J A;  1OCT C;  1I5Z A;  2L0K A;  5E3L A;  2DW4 A;  3GTO J;  4F92 B;  3HG9 A;  1TQP A;  2DA1 A;  4XM3 A;  2HTJ A;  5FO5 A;  2ICW G;  4WXC A;  3SDB A;  1LQ1 A;  3IL2 A;  3I59 A;  4Y7N J;  1TWH J;  4C2T A;  1U0J A;  2XDV A;  5J1U A;  4IHT A;  3FKI J;  4LJZ F;  1DGW Y;  2JA2 A;  5GAE J;  4UVB A;  4RB1 A;  1YX3 A;  2A05 A;  3TQN A;  1XD7 A;  1XS9 A;  4P9F A;  1H88 C;  1T38 A;  1XPX A;  4L0Z B;  3G2B A;  2RVC A;  3HPH A;  3I59 B;  4PCQ A;  2M5W A;  1PUF A;  2Z1D A;  2XAJ A;  4AWX B;  1B8I A;  1USS A;  2VJ5 A;  4UUS A;  5FFZ A;  1QNT A;  1UG0 A;  3ABT A;  3DTK A;  3H9Q A;  3S1N J;  3K4J A;  4NDL A;  3B73 A;  4HF0 A;  1O7L A;  2HQ5 A;  4MEY F;  3EDP A;  2M7B A;  1QPI A;  1J2X A;  3BCB A;  4P9U A;  4N9I A;  1PUF B;  1BI2 A;  5FKK A;  4E70 A;  1OCR H;  2O0Y A;  1T0F C;  3K1M A;  2VKD A;  2AQF A;  1VQ4 I;  1R49 A;  4F91 B;  3OS1 A;  2CV0 A;  2HWV A;  2HYJ A;  3E6D A;  1GHC A;  2PBI A;  3KP5 A;  1R23 A;  3DBL B;  3FM5 A;  1LKX A;  4FE4 A;  4IVN A;  1IRX A;  2EQR A;  3GTM J;  2ELH A;  2FBH A;  1GXQ A;  5F27 A;  3AAF A;  1A6I A;  3N4M A;  2PJR A;  3ONQ A;  4G12 A;  3WTT C;  4NUB A;  3ZMD A;  5JR3 A;  1JUS A;  2WV0 A;  3LOC A;  1IRF A;  4IKF A;  3D5S C;  3PSF A;  1ERD A;  4KA4 A;  1ZHF A;  2ME6 A;  1EH6 A;  1MMA A;  1LFU P;  3ZMT A;  2PJR B;  1XGM A;  5BPD A;  4DNC A;  2L4M A;  2H09 A;  2IA1 A;  2VKH A;  4XSX F;  1VQP I;  9ANT A;  4LG0 A;  2DA6 A;  3E5Q A;  4HDV A;  5E17 F;  2P4W A;  2HKO A;  1T33 A;  3WG7 H;  1KGS A;  4O3M A;  5DS9 A;  4KUM A;  2ID3 A;  3TDZ C;  2VC0 A;  1XMK A;  1G6N A;  1K78 A;  1YI2 I;  4A3L J;  1P7I A;  1IXS B;  3PFY A;  1HKS A;  2CFX A;  3P7N A;  2R5Z A;  1WRJ A;  2LNB A;  2FF4 A;  1HW2 A;  3QWL A;  4XQF A;  1EH8 A;  3G1O A;  4LG0 B;  4EGY A;  2BBY A;  4PGG A;  4G7Z F;  1DP7 P;  2MC4 A;  3MEX A;  2WAD A;  4YIR X;  2W24 A;  1VQO I;  2P7C B;  1T39 A;  1IV6 A;  1K78 B;  3MAJ A;  4BU2 A;  1RRJ A;  1VZ0 A;  1K61 A;  2LP0 A;  3MZ8 A;  1UG2 A;  2GLO A;  3ZMS A;  2R5Z B;  3M1E A;  3CC2 I;  2IGK A;  4IZZ A;  2OD5 A;  2JSC A;  3NEU A;  5K5R A;  5LRS A;  4RAY A;  4GFB A;  5JHU A;  5HS7 A;  3VOD A;  3N97 A;  3MVP A;  4M9X A;  2HOA A;  5IPA A;  3LQQ A;  3ZQC A;  1Y6I A;  2QF7 A;  1GV2 A;  2QA4 I;  1Q1H A;  5CPR B;  5GTH C;  3CUO A;  3TOB A;  2P6T A;  4IQJ A;  4Q5S F;  1MW7 A;  5E8G A;  1X3Z B;  1JHF A;  2EA4 A;  2JT1 A;  2NVX J;  4M6Y A;  1Y56 A;  2DA4 A;  2GOM A;  3H36 A;  4ZH4 F;  1IO2 A;  1YX5 A;  2M8E A;  1S9H A;  2OA4 A;  2W25 A;  5IOZ A;  3ZGK A;  3ZP5 A;  2KIF A;  1LNW A;  5ICC A;  4HLX A;  3I53 A;  3LL7 A;  1UB9 A;  2PMZ A;  4G6T B;  1X1D A;  3ESW B;  1ON1 A;  4AIH A;  3CP8 A;  3O8H A;  2HVS A;  3L9F A;  1WJD A;  2EV0 A;  5AON A;  2O61 A;  4D5C A;  2FNP A;  4QWQ A;  1SVL A;  2QSG X;  1ZKG A;  2I10 A;  1IG7 A;  4KN4 X;  4RLQ A;  3A0B C;  4BQO A;  2BGC A;  3VYR B;  3HL2 A;  4DJA A;  3PO3 J;  3CUQ A;  2L01 A;  2DPU A;  1NG6 A;  3DFG A;  5IP9 J;  2L7K A;  5HDN A;  1O3R A;  2IVM A;  2IT0 A;  1T08 B;  3BG7 A;  2MSY A;  2F4I A;  1RR8 C;  2BY3 A;  4ZTF A;  1OCC H;  2MGQ A;  3GTL J;  3Q0V A;  3CUQ B;  2EA2 A;  3W6J B;  3PIO F;  1P4X A;  1ACI A;  1XGO A;  3BR3 A;  4X0G A;  2L5Q A;  4L5E A;  2VXZ A;  3BPV A;  3EYI A;  2KZG A;  2K9L A;  3MWM A;  2JZY A;  1D1B A;  2RN7 A;  1U6G A;  1FBS A;  2RKH A;  1ETV A;  3BG3 A;  3ZCO A;  1WCM J;  2BVL A;  4WWC A;  3HOS A;  1JJ6 C;  2VBX A;  3BJO A;  3AFH A;  3IHU A;  1W36 C;  4N9H A;  4ZC3 A;  5D5U B;  3CCJ I;  4XLP F;  4LK1 F;  1V54 H;  4DYR A;  1LE8 B;  3BZK A;  2L9V A;  5DV5 A;  2GM4 A;  4HF1 A;  2AXL A;  1S7A A;  3S1M J;  3ZQG A;  2HZD A;  2L2O A;  3BTL A;  1I50 J;  3EUH A;  3PUB A;  1TNS A;  1G8X A;  2RAE A;  2KIU A;  1Z91 A;  5HOD A;  3GME A;  1F43 A;  1R00 A;  1J5Y A;  2M4G A;  5GAG J;  3M4O J;  3SZG A;  2W82 A;  3G1L A;  1BI1 A;  2CS3 A;  1KQ9 A;  4CCJ A;  3E6C C;  5D8K B;  3OYD A;  1FOW A;  1G3S A;  4RMN A;  2LD5 A;  4BUP A;  2PMU A;  4H0E A;  4XOP A;  5KNL A;  3K4N A;  1TT0 A;  4OMY A;  2EFO A;  2DO7 A;  2X6Y A;  3E6M A;  3EET A;  2CO5 A;  2DLL A;  3FMQ A;  2L7M P;  4UNO A;  5DD8 A;  3BTJ A;  3J7A O;  2M45 A;  5EEH A;  4A0X A;  1XCB A;  4R1H A;  1W7P A;  5FLM J;  4A0Y A;  3QRF F;  4P5O A;  1P92 A;  3SEZ A;  3LSH A;  4XMY A;  4L0Y B;  1Y8Q B;  1X1P A;  3CTA A;  2CUJ A;  1A6Q A;  2XKP A;  5E3O A;  3R0A A;  3ZMZ A;  2XAH A;  3H0D A;  1FWZ A;  1JT6 A;  2JVH A;  3QP5 A;  3VWB A;  1J0R A;  1TW3 A;  2JJ7 A;  1SMT A;  2B9S A;  4RBO A;  2LMD A;  1W7P B;  2L02 A;  3J80 Z;  1OCO H;  3LA2 A;  4MIM A;  2NAZ A;  2A07 F;  1YW9 A;  1ZK8 A;  2P5V A;  1X2M A;  3E97 A;  3Q0W A;  2R7W A;  1W1W E;  3T0Y A;  1FOX A;  4G9Y A;  1SEU A;  2QWW A;  2KRH A;  2Y0S A;  1WI9 A;  2LRD A;  3EQL F;  1SVO A;  2R0Q C;  1A5J A;  4YIF A;  4U0V A;  1TW2 A;  3QPS A;  4AUX A;  1S7O A;  5BOX A;  2O03 A;  3JRH A;  3V4G A;  1D5Y A;  3DKW A;  1QHH D;  4MTD A;  3KCC A;  3BJ6 A;  5A2Q K;  2H94 A;  4S04 A;  2EIJ H;  4B3X A;  3S17 J;  3PJR A;  1TQI A;  3VYU B;  1T0F A;  4AM3 A;  3DEW A;  3I58 A;  4Q47 A;  2QSH X;  2LY1 A;  4PDK A;  3B6A A;  2VT2 A;  3S15 J;  1HW1 A;  4YFX F;  1Q1V A;  3ZQQ A;  1E3H A;  1I27 A;  3I56 I;  5LRR A;  1LDJ A;  2M30 A;  4OMZ A;  1APL C;  4CCN A;  2V1X A;  5HLI A;  1UZC A;  2WWY A;  2R7T A;  3LFK A;  2HDW A;  2W4S A;  1S72 I;  2UZK A;  2A6T A;  3JRD A;  3ULQ B;  2OTL I;  4G94 A;  1DPR A;  2IJL A;  5B3S H;  3VYS B;  4HEA 2;  2OPT A;  1X1B A;  2UUZ A;  1W5C C;  5LGN A;  2O6G E;  1U9N A;  2CUE A;  1UMQ A;  4C2M J;  3WTS C;  1F4K A;  2R7O A;  1XMX A;  2HTS A;  1WJC A;  1HCR A;  1FYK A;  5BNG A;  3F21 A;  2NVQ J;  4XL9 A;  4Y3O A;  4MGR A;  2CSO A;  2BVM A;  2WY7 Q;  4HX8 A;  1SD6 A;  1I6X A;  4QPQ A;  1XGN A;  4IJA A;  4IRH A;  1SAN A;  4BS9 A;  2O5R A;  3ABM H;  3F22 A;  2VBY A;  4XOT A;  2BEO A;  5L3B A;  2X6W A;  2XAG A;  4QSH A;  1K4S A;  2VOD A;  3DTE A;  3AG1 H;  3GTG J;  3LSG A;  1SAX A;  2ZO4 A;  2EZL A;  2DFE A;  1YFH A;  4BY7 J;  5D4S A;  2QZ8 A;  2WBM A;  2E7X A;  3DF8 A;  4UY8 I;  2FEZ A;  2MH9 A;  4EM0 B;  1Z7L A;  4KJZ A;  1I3A A;  2A5Y B;  2FUG 2;  1EJ9 A;  2KRF A;  1ETK A;  3WTX C;  1IN5 A;  3I4N J;  3V7R A;  1H8A C;  1W7P D;  2Y9Z A;  4BE1 A;  3S8P A;  5TGT A;  1Z05 A;  2F2E A;  4BAY A;  2M87 A;  4C3I J;  4C3J J;  2H8R A;  3P5J A;  4ESF A;  4B44 A;  5J47 A;  1QRY A;  4UVA A;  2Y75 A;  5H6R A;  5IYD J;  4ZDL A;  5GTI C;  2Z99 A;  3WGG A;  5D5W B;  3ERM A;  3GLL A;  4PFP A;  1UHS A;  4XKB A;  3TBI A;  1Y0U A;  2JRT A;  3HUG A;  5H20 A;  4CXF A;  2XB5 A;  2XPU A;  4WCG A;  1BJA A;  2LDU A;  5JVT A;  3FHZ A;  3VFZ A;  4QLC U;  1XDS A;  3TO6 A;  2GA1 A;  4YRV A;  1O3Q A;  4CA0 A;  2YU9 J;  2YPR A;  2Y30 A;  3MZH A;  3OOU A;  5C44 J;  1BR1 A;  4W97 A;  1QVU A;  2K3P A;  5AIP A;  3GEZ A;  3E6B A;  5H2F C;  3Q9S A;  2E35 A;  3QPH A;  2WAQ A;  4CCO A;  3HUG B;  2Z33 A;  4KIG A;  5FD5 A;  1B72 A;  3JRG A;  1GDT A;  4KMU X;  1JHH A;  2E7W A;  5TJJ A;  4IPA A;  3IAS 2;  4A3F J;  2D45 A;  1H89 C;  3TW7 A;  3LSM A;  1U5T B;  1WWX A;  5J3L A;  1IW7 F;  3IUO A;  5DUI A;  5L3C A;  5H6Q A;  2R7R A;  4CZC A;  2AQE A;  1YO5 C;  2EFN A;  2V9K A;  5HNF A;  3ECH A;  1CGP A;  1P7J A;  3HOX J;  1B72 B;  2O8X A;  1S5L C;  4XKW A;  3TGN A;  5ILS A;  2DMQ A;  2FQ4 A;  5D8L B;  3CMY A;  3LSR A;  2HOT A;  3DLA A;  1JXS A;  1V5E A;  4I6Z A;  1YJ9 I;  2W7N A;  2DK8 A;  3H5N A;  2CW7 A;  3GWZ A;  2JWT A;  3FBI B;  2WA0 A;  4KIT B;  2C6Y A;  3VEP A;  3EUK L;  2UXN A;  1I3Q J;  5LHI A;  5FKM A;  4HOB A;  3KX2 A;  3OL4 A;  3HIF A;  1MMS A;  1RES A;  4C2U A;  1RPW A;  3BRO A;  1FNN A;  4I01 A;  3SFZ A;  1HBX G;  3KE2 A;  1KA8 A;  2PFB A;  2PMZ N;  1VQ8 I;  1KU9 A;  3KFW X;  3CCQ I;  4PSW A;  3OYM A;  2QKL B;  1UST A;  3KP6 A;  3DQV C;  1VQN I;  2DOE A;  3AG3 H;  2KKO A;  2IS4 A;  2OCE A;  1ODD A;  1Y39 A;  4LGW A;  4ZYG A;  1I39 A;  5HDG A;  1UFM A;  4RB3 C;  2NS7 A;  4FET A;  2OTJ I;  2R7S A;  3DCF A;  3CF2 A;  2YSR A;  2ISZ A;  3C7J A;  2UV1 A;  5M3M J;  3FKJ A;  1L3L A;  4GXO A;  3EUA A;  3HM5 A;  4P55 A;  5JLX A;  3OYA A;  5E3M A;  2DQR A;  1WVR A;  3WHC A;  5E8I A;  1IUY A;  3S3M A;  1LB2 A;  1JUP A;  2F4M B;  4ASN A;  4JK1 X;  4MTE A;  3JRA A;  3I9V 2;  3JW4 A;  2F5E A;  5FRM A;  4DZJ A;  3E0J B;  1RUO A;  3KP7 A;  2K7L A;  4CZZ A;  3MCZ A;  3TP0 A;  4E6K G;  2PN6 A;  1RUN A;  3A0H C;  2KZV A;  3CCY A;  4IO9 F;  4ETS A;  3QPT A;  5JI6 A;  2VJJ A;  2CQQ A;  1H9T A;  3K4K A;  3GZ5 A;  3LA3 A;  4KDP A;  3S3N A;  4M3E A;  1ZR2 A;  2BW3 A;  3F72 A;  5EF6 A;  3F9K A;  2F6C A;  5ERI A;  2FE3 A;  2L9R A;  1J09 A;  1LEA A;  3CZ6 A;  2HQR A;  5J1Y A;  2EZH A;  3SFI A;  1HA8 A;  3OOP A;  4G7O F;  2GZW A;  4BE0 A;  4O6J A;  3TP3 A;  4IHY A;  3OS0 A;  2AO9 A;  3HRM A;  3AG4 H;  1HKQ A;  4UUT A;  3QYB A;  2DMT A;  4A5N A;  4LB6 B;  2MBF A;  2IS6 A;  2ZNZ A;  1B9N A;  3H5A A;  3S2W A;  4A5M A;  3GYH X;  3K4B A;  1G4D A;  3BZ6 A;  3O3K A;  1X3U A;  1HKT A;  2JA5 J;  1RZ4 A;  3JRF A;  1FMW A;  3MKL A;  1IN6 A;  1X3W B;  1WPK A;  5F6F A;  1MD0 A;  2COB A;  5F0F A;  4DZP A;  1KYZ A;  3CLO A;  1AU7 A;  2A6E F;  3E5U A;  2DDA A;  4BEH B;  1X1C A;  3FMR A;  4BBR J;  3FXQ A;  5ILU A;  3KEY A;  2IA2 A;  5C4X J;  3DWL E;  1XG1 A;  4I99 C;  4DYQ A;  3CJR B;  1QA6 A;  3I4M J;  3GCM A;  2BY1 A;  1V55 H;  2PEX A;  2ZME B;  4BHC A;  1WH7 A;  1B4A A;  4II2 A;  1RR7 A;  2FRH A;  2R5Y A;  4U7B A;  1IRZ A;  2OQR A;  2Y69 H;  4II3 A;  1EV7 A;  5D5X B;  2PJP A;  3DEE A;  3BR2 A;  1MMD A;  1IC8 A;  2OCC H;  3C3W A;  4NC7 A;  2CFO A;  4XLA A;  1OR7 A;  3L2U A;  3K70 D;  3Q9V A;  5F64 A;  5K7H A;  1KON A;  3F8F A;  2Y0S N;  1SFE A;  1W36 D;  4M9Z A;  4RA2 A;  1U8B A;  2P7V B;  1SFO J;  1A31 A;  2PG4 A;  4NHJ A;  5IYC J;  1W0U A;  3M9A A;  3CCE I;  2IP2 A;  5GAH J;  3EYY A;  1U2W A;  3SXY A;  3FXM A;  4IF4 A;  1B8I B;  2OC6 A;  3MKW B;  1OIS A;  3BR6 A;  5B66 C;  3LSJ A;  4UUS B;  1ETO A;  4PJM A;  1DU0 A;  2VN2 A;  4LMY A;  1G59 A;  1MND A;  4HAM A;  2CQN A;  2KHM A;  2PLY A;  4BY1 J;  3KZY A;  3G71 I;  4ZDP A;  4BDY A;  3T8R A;  2LY2 A;  1JKQ C;  3RKQ A;  3I55 I;  3EPZ A;  4XKC A;  2R7F A;  3ASO H;  1R1V A;  2VQC A;  1UHW A;  2K86 A;  4LB5 A;  2DTR A;  2L3D A;  4JOM A;  1QZZ A;  3HYI A;  4ENJ A;  2XAF A;  1R7J A;  3JAM Z;  3JCU C;  2Y31 A;  2Y9Y A;  4B43 A;  1R58 A;  4XNF A;  5F08 A;  5FFX A;  3WTV C;  3O6B B;  1K7A A;  3J81 K;  4B47 A;  1ZGA A;  3L00 A;  3NWS A;  3QOP A;  3J80 K;  1MGT A;  4GYG A;  4LFU A;  3S14 J;  3VOE A;  2P8T A;  5LHH A;  1D3Y A;  2IPQ X;  4JX5 A;  2QGU A;  3WU1 B;  3OYI A;  1ZRE A;  2D5V A;  4FHT A;  1OCZ H;  2V4J C;  1D1A A;  3W6V A;  4IRI A;  2P5K A;  2WV1 A;  2DYS H;  3QYE A;  1HLV A;  2CGP A;  4HG2 A;  2Q8K A;  1ETY A;  2FML A;  2G7H A;  3PM1 A;  4G8X A;  1QZY A;  5AIQ A;  5DEQ A;  1QBJ A;  2FXA A;  2LTP A;  1HW5 A;  2L7Z A;  4LD5 A;  1SVM A;  2QBY A;  3ZQ7 A;  1KU7 A;  2R7U A;  2EB7 A;  2EWN A;  3IP4 B;  4XLF A;  1O4X A;  4BBS J;  2F48 A;  2K9M A;  4PSX A;  5HOO A;  3L1P A;  2F4O B;  2JRM A;  3GFM A;  4S0H B;  3I64 A;  5B1B H;  3ZN1 A;  3LAP A;  2XF7 A;  4LIU A;  5E3N A;  2E60 A;  3GTK J;  2LKP A;  2MW8 A;  4P96 A;  2ESN A;  4M74 A;  1V5G A;  3OYL A;  3GO5 A;  2QBY B;  3CMA I;  4YII A;  1K79 A;  1N77 A;  3FF5 A;  1VQM I;  2Q2E A;  5CQE A;  1WZ2 A;  1WGX A;  3RPQ A;  2ZJQ F;  2K9N A;  4N4O B;  3G73 A;  2XRL A;  2W1O A;  3ZPL A;  2M9H A;  2QQ9 A;  5BMZ A;  1ZTR A;  3CMM A;  2RNJ A;  2E1M C;  4ESB A;  1BW6 A;  4FCY A;  3BOQ A;  2R3S A;  2DT6 A;  1FP2 A;  1WJB A;  5GP9 A;  1I1G A;  1LVK A;  4HNU A;  3F6V A;  2NS0 A;  4Y4R A;  4BH9 A;  3FK6 A;  3GVA A;  4OIN F;  3A2K A;  5HLH A;  2XVC A;  1G3T A;  3UNG C;  2BY0 A;  2Q2E B;  4Q48 A;  5LBQ A;  3FXK A;  2UWM A;  3OYF A;  1HXD A;  4HQM A;  2F5V A;  3L7W A;  3HTU A;  5CQG A;  4DBR A;  2XHK A;  5BS6 A;  1ONV A;  2QQA A;  4E7S A; 
#chains in the Genus database with same CATH homology
 1R6R A;  4PJJ A;  1D0Z A;  2V7F A;  2VQH A;  3OYH A;  3OMY A;  1QHH D;  4BQN A;  3RSN A;  4MLO A;  1GLN A;  4B3X A;  2IGO A;  3PJR A;  3VYU B;  4PK4 A;  2RQQ A;  3MKY B;  4GRI A;  3C2H A;  2I8D A;  2LY1 A;  1MNE A;  2DCE A;  4ZYA A;  3ZQQ A;  3W2W A;  2CW8 A;  4CCN A;  5HNH A;  2P0W A;  2R7T A;  2M7A A;  1UEL B;  2HDW A;  1BOB A;  2W4S A;  1N78 A;  2A6T A;  4N4N B;  3VDX A;  1UAA A;  2WAF A;  4XN3 A;  2R7X A;  3AL0 B;  2LH9 A;  3VYS B;  4U87 A;  4HEA 2;  4RLF A;  1X1B A;  5HVQ C;  3VSL A;  3LFU A;  1Z3Y A;  2UUZ A;  4BGD A;  4J01 A;  2OUM A;  4CSW A;  5CKT A;  1DGR M;  3E1S A;  1PJR A;  4HNT A;  1LFP A;  4ITV A;  4F52 A;  2DJI A;  2R7O A;  1WJC A;  3RQ4 A;  4NNJ A;  4XL9 A;  4AVZ A;  4Y3O A;  4JQF A;  2VL8 A;  2NOJ B;  2KPM A;  4OAZ A;  2BVM A;  4D9J A;  2QKM B;  2WY7 Q;  2LBF B;  4QPQ A;  3M8J A;  3W2V A;  4BS9 A;  2O5R A;  4XLH A;  2HNH A;  1E0E A;  2ZSH B;  4XOT A;  1LDK B;  1NG7 A;  2KP6 A;  2X6W A;  3H35 A;  4BQQ A;  2Q1Z B;  3OYE A;  3DTE A;  3LSG A;  1P9Q C;  1WJE A;  3K4M A;  3OL3 A;  4EAT A;  4DOZ A;  3H9J A;  2WBM A;  4HPQ A;  2VIX A;  3M1C A;  2XF6 A;  1Z7L A;  4KJZ A;  1TZL A;  4YEJ A;  2FUG 2;  4AU7 A;  1AA7 A;  2OV7 A;  3ZXS A;  1ZEL A;  3I3L A;  2XAU A;  4BE1 A;  4HSR A;  3S8P A;  2HPI A;  3PNY A;  2X85 A;  5TGT A;  2HQA A;  4E7I A;  3MKZ A;  2A5W A;  1DP3 A;  2RRE A;  3FHN A;  2KRC A;  4B44 A;  4F55 A;  4ZDL A;  3NWT A;  3ZRG A;  4PFP A;  3L2V A;  4XKB A;  4C30 A;  3TBI A;  5FRN A;  2WB1 A;  2X1D A;  2LG4 A;  1Z3X A;  3DKX A;  2RNG A;  4E7Z A;  2BOL A;  2CV1 A;  4R79 A;  3H5R A;  4BEH A;  4E7H A;  1D0Y A;  3QOD A;  4XOR A;  2CH0 A;  2V1N A;  2CMP A;  3VYT B;  5LD2 C;  4ANJ A;  4YRV A;  4CA0 A;  1FMV A;  3S32 A;  2VJ4 A;  3N05 A;  3OOU A;  3DPL C;  1BR1 A;  3A1Y A;  2VAS A;  2K3P A;  3MD2 A;  2Z16 A;  2IS1 A;  2ZXI A;  4E7L A;  2WAQ A;  4CCO A;  3HUG B;  4B48 A;  1YE9 A;  3BCA A;  3HKZ A;  5JHF A;  5KCM A;  3K6G A;  3IAS 2;  3SYT A;  3FDY A;  3DU6 A;  3LSM A;  2WY8 Q;  3V42 A;  3OYC A;  2LC2 A;  3OYN A;  3HPG A;  3IUO A;  2R7R A;  4CZC A;  1DQU A;  2IXS A;  2AQE A;  2VQG A;  2XF5 A;  2M3A A;  2K5C A;  3IAM 2;  2VPL A;  4F92 B;  3HG9 A;  2XC7 A;  2V9K A;  4XM3 A;  5HNF A;  2L9N A;  3SDB A;  3RPU D;  2GOX B;  2IS2 A;  2HU9 A;  4C2T A;  3LMM A;  1U0J A;  2XDV A;  4XKW A;  3FBN B;  2M4K A;  3S93 A;  4AYB A;  3OR2 C;  1DGW Y;  2JA2 A;  3ZR8 X;  3DKY A;  1YX3 A;  3DLA A;  1V5E A;  3KYL A;  3G2B A;  2W7N A;  2VQL A;  1K6Y A;  3H5N A;  2CW7 A;  1X4O A;  5LFA A;  3HPH A;  3FBI B;  4E7J A;  1X19 A;  2WA0 A;  4KIT B;  3EUK L;  1Z21 A;  2Z1D A;  3KX2 A;  3OL4 A;  4C2U A;  2E5Z A;  2VJ5 A;  3TL4 X;  3U21 A;  5KHD A;  3L2W A;  1UG0 A;  3DTK A;  3PSI A;  3OYK A;  3H9Q A;  3K4J A;  1WFX A;  3DTI A;  2M7B A;  2VXD A;  4PSW A;  4PJL A;  3BCB A;  3OYM A;  2QKL B;  2MYS A;  2HPM A;  1T0F C;  3DQV C;  2VKD A;  3AL0 C;  4DGW B;  2AQF A;  2IS4 A;  4F91 B;  3OS1 A;  2DXI A;  2CV0 A;  4FET A;  1LKX A;  3W2A A;  2R7S A;  1IRX A;  3AKZ A;  3CF2 A;  2Z2S B;  2UV1 A;  3FKJ A;  2CV2 A;  2PJR A;  3ONQ A;  3EUA A;  1V5F A;  3OYA A;  4NUB A;  3K70 C;  3S3M A;  3CES A;  2MFZ A;  2XSJ C;  3PNV A;  3OYJ A;  4IKF A;  3D5S C;  3PSF A;  1ERD A;  3I9V 2;  4H4K C;  1MMA A;  5FRM A;  3E0J B;  3CP2 A;  2PJR B;  4LIV A;  4E6K G;  2VKH A;  2WAE A;  3HOT A;  2KZV A;  3D5R C;  4ZTJ A;  2VJJ A;  3K4K A;  4CH7 A;  4PFO A;  3S3N A;  1D0X A;  1WJA A;  2BW3 A;  3F9K A;  2F6C A;  3PFY A;  4XLE A;  2VJI A;  1WJF A;  1J09 A;  3CZ6 A;  1QHG A;  3OS2 A;  4XQF A;  4DBQ A;  1HA8 A;  2MC4 A;  2WAD A;  2HVR A;  2V26 A;  4BL0 B;  4BE0 A;  2JUG A;  3LSK A;  3MMY B;  4BU2 A;  1VZ0 A;  3OS0 A;  4OAY A;  4XON A;  3QYB A;  1SFK A;  3UR3 C;  4HRI A;  4LIT A;  2IS6 A;  3BLY A;  3H5A A;  2IGK A;  4IZZ A;  3K4B A;  3BG6 A;  3BC8 A;  4RM3 A;  1FMW A;  4DIQ A;  2MD0 A;  2JSP A;  2ELJ A;  2E5N A;  4BEH B;  1X1C A;  2LOO A;  1N75 A;  2M0M A;  1Y6I A;  4D1Q A;  3KEY A;  5CPR B;  3PNT A;  1X1A A;  3DWL E;  4IQJ A;  1MW7 A;  3CJR B;  3L2Q A;  1Y56 A;  2DT7 B;  2GOM A;  2X1E A;  4PUS A;  4II2 A;  4FAS D;  3OR1 C;  3CJQ B;  3J7A Y;  1YX5 A;  1S9H A;  4U7B A;  1BR2 A;  3ZGK A;  2ZXH A;  3LSI A;  4NQW B;  4XN0 A;  4II3 A;  1PYV A;  4CCM A;  2KQR A;  3LL7 A;  2PMZ A;  4G6T B;  5HLT A;  1X1D A;  3DEE A;  3TMO A;  3W3C A;  3CP8 A;  1MMD A;  4BAC A;  4NC7 A;  3OIP A;  2HVS A;  1WJD A;  1MMG A;  2CFO A;  4XLA A;  5FRO A;  4P1W A;  3L2U A;  3K70 D;  2L9S A;  4E4H A;  1KON A;  4RLQ A;  1W36 D;  2HVQ A;  4F93 B;  4E7K A;  4BQO A;  3C2G A;  3VYR B;  3HL2 A;  4DJA A;  2JVG A;  3OY9 A;  1NG6 A;  4IQ4 A;  1T95 A;  1EA3 A;  4BJ5 C;  2L7K A;  4BXF A;  1QU3 A;  4OWR B;  3BG7 A;  2F4I A;  2OC6 A;  4F3Q A;  2VLA A;  1X4P A;  3MKW B;  1OLT A;  4ZTF A;  2LYC A;  2CUZ A;  2R4G A;  4PJM A;  4XR6 A;  2KDO A;  2R7Q A;  1G59 A;  4Y33 A;  4BJ6 C;  1MND A;  1SAU A;  2X51 A;  2KHM A;  3L2R A;  2R7V A;  4ZDP A;  4BDY A;  1OR7 C;  3OWT A;  3K10 A;  2L5Q A;  4X0G A;  2VXZ A;  4QPO A;  2LY2 A;  2K9L A;  1BR4 A;  3OYB A;  4XKV A;  1D1B A;  2X6X A;  2ZFU A;  2LBF A;  3EPZ A;  4LG3 A;  4XKC A;  4BDZ A;  4CCK A;  1JI8 A;  2X1C A;  3OYG A;  2VQC A;  2BVL A;  3ZCO A;  3HOS A;  2MAB A;  3AFH A;  2LRE A;  3A4C A;  4JOM A;  1W36 C;  4KT6 A;  3DPT A;  4ZC3 A;  2KMU A;  3S3O A;  4B43 A;  4XNF A;  4PJN A;  3K4C A;  4B47 A;  1D1C A;  3NWS A;  4IX7 A;  2HZD A;  2L2O A;  3D5L A;  3RCO A;  2W00 A;  3HXL A;  3PUB A;  1MMN A;  3OYI A;  1G8X A;  4C9Y A;  2V4J C;  1D1A A;  2M4G A;  3SZG A;  2KL4 A;  2W82 A;  3QYE A;  2CS3 A;  4CCJ A;  4HG2 A;  3OYD A;  4BE2 A;  2ZSI B;  4RMN A;  4CCL A;  4BUP A;  4XOP A;  5KNL A;  3K4N A;  1TT0 A;  2X6Y A;  2IGM A;  4J00 A;  2BW3 B;  4RM2 A;  3K4L A;  2IGN A;  2R7U A;  3IP4 B;  4XLF A;  4ZJZ A;  2K9M A;  4PSX A;  5HOO A;  4NC8 A;  4P5O A;  2E1M B;  4BJT A;  3EUH C;  2XF7 A;  3GBG A;  2DOA A;  4LIU A;  3SEZ A;  3LSH A;  3PL8 A;  4XMY A;  2E60 A;  3OYL A;  1V5G A;  2CUJ A;  1N77 A;  3H0D A;  5CQE A;  3VSK A;  2JVH A;  3QYF A;  4N4O B;  3VWB A;  3DPU A;  2W1O A;  3CMM A;  4YEL A;  2E1M C;  2V6E A;  4KIS A;  2DT6 A;  1WJB A;  1LVK A;  4HNU A;  3OIQ A;  4Y4R A;  4CUG A;  3A2K A;  4HST A;  3RTR A;  3DU5 A;  4ZDO A;  2VB6 A;  3HC7 A;  4XLC A;  3UNG C;  2Q2E B;  2R7W A;  2UWM A;  3H9G A;  3OYF A;  2F5V A;  2KRH A;  2Y0S A;  2LRD A;  3SEQ A;  5CQG A;  4DBR A;  2KLO A;  3QOE A;  1WJ5 A;  4E7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...