2KQRA

Solution structure of the n-terminal domain (residues 1-111) of brugia malayi asparaginyl-trna synthetase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
GSMTVYICPETGDDGNDGSELKPLRTLYQAMIITKSSKGDFLIRTKKDGKQVWEAASKTALKKSWKRYEQEMLKNEKVAAKMLEKDATEVGVKAALEEAKKVQIELDTSLSYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asparaginyl-tRNA synthetase, cytoplasmic
publication title A Hybrid Structural Model of the Complete Brugia malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
pubmed doi rcsb
source organism Brugia malayi
molecule tags Ligase
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kqrA01
2KQRA 4ZYAA
chains in the Genus database with same CATH superfamily
3TMOA 3BZ6A 1K7AA 3L1PA 4OIOF 5EF6A 3P5JA 2EV5A 1E0EA 4IF4A 1MGTA 3CD6I 5LRSA 2VUMJ 2DFIA 3F6VA 3WHCA 5ICEA 1Z0XA 1JTXA 3WE3A 2KIMA 1T33A 3V4GA 2M5WA 3FM3A 2KRHA 3CTAA 3TGNA 5BQTA 1QHHD 4A6DA 1LE8A 2LBFB 1LVAA 1JKOC 2X4HA 3K2ZA 2QQBA 1R6RA 4KIGA 4Y3OA 5E18F 3Q0UA 1E3PA 1ZGAA 2X6YA 3HHGA 5GTHC 1DUXC 2AHQA 2BY0A 4RMNA 1UZCA 2FRHA 1A04A 2Z33A 1TW3A 4AYBA 4BDYA 1R1UA 4HLYA 4BXFA 4XIDA 3F8NA 1GXPA 1XGNA 3CCJI 2VBWA 3KP2A 3CMYA 3SHFA 2JQ7A 3OYKA 4XQFA 1Q1VA 3FHZA 2FUG2 3CF5F 2CQ7A 1XDSA 3A02A 1GUUA 3C2GA 1X1PA 2VPLA 5LHGA 3MAJA 5CVRA 2Y31A 3DBHB 3LA3A 5BOXA 2V7FA 3E3VA 3ZQLA 1XB4A 2ZFWA 2C6YA 3HIFA 5HLIA 1DGWY 1HA8A 4JP0A 4ABZA 2WY8Q 1K79A 3R4KA 3U1KA 1V5EA 3EYIA 3COAC 2KT0A 3ULQB 1ETXA 2NVUB 3IC7A 3K6GA 5D8LB 1OISA 2NVYJ 3CJTB 3DEWA 5J47A 1RUOA 4OIQF 1GT0C 2ZXWH 4V19K 4HRIA 1MDMB 1YG2A 2R7FA 2KJCA 5FLXZ 3GTGJ 3PUBA 1J09A 3CF2A 3VEPA 4MQ9F 4A93J 1LDDA 1SVLA 4OU0A 2CYYA 2HYFA 3FK7A 4DQ2A 5K7FA 1QBJA 4KFCA 2XKPA 2DJNA 3K2AA 2X51A 1KU3A 1P7JA 1TWCJ 2QSGX 4DJAA 1U2WA 2VIXA 4JX6A 4DGWB 3F8MA 1UCRA 5HS8A 4A3JJ 4XR6A 2CMPA 4CSWA 3HB9A 2K9MA 4LG3A 1T39A 5IPAA 2E1OA 3S8PA 1OR7C 3QP5A 3TO7A 3LNQA 4Q5SF 3O8HA 1N75A 2PN6A 4MHGA 4BJ5C 2L9VA 1IXRC 4WWCA 3CC2I 2YSRA 1OYYA 3PIOF 3J81K 1REPC 3VYRB 3BCAA 4G7OF 3NWSA 2NVXJ 1OCOH 1H9TA 2KIFA 4ZYAA 2VQGA 2QQ8A 2ECCA 3FBIB 2O6GE 2X1EA 3HRUA 1XS9A 1OCCH 1FZPB 1LDJA 1IW7F 4XLNF 3I4MJ 4CCKA 4HYEA 2Y69H 1CF7B 1U5TC 2B63J 2LMDA 2EFWA 2M34A 4WXDA 1ZG3A 4H4KC 4AVZA 4UHTA 2IA1A 2YX4A 2WWYA 5M3FJ 3S1MJ 1W5TA 2LYCA 1OMIA 3OS0A 1SD5A 3I4NJ 2Q8KA 1UHSA 2DA3A 4EV0A 3TBIA 1Z3YA 4M74A 3OYGA 1BC7C 4XKWA 4WX9A 2IA0A 5F1JA 2BOLA 2CFOA 3K4KA 2P5KA 5TJJA 2NYXA 3E5XA 1ETVA 3HOUJ 4YRVA 2LF8A 2STTA 4XKVA 4OOIA 3DWLE 1OQYA 2DK8A 3LSRA 2H1KA 4EJTA 3OYHA 1X3UA 4OMYA 1DDNA 3A4CA 3HL2A 1I50J 1S7OA 5HDGA 2VBYA 4BJTA 1R23A 2DA6A 2MA3A 2FD5A 3IWFA 4CCNA 1B72B 3AL0C 2LY2A 1T8IA 2I10A 3K4CA 4H0EA 1BI0A 2FF4A 3KEYA 3DLLF 4UUSA 4XK4A 4MLOA 2XHKA 4A0YA 2HOAA 1EH6A 2X0LA 2FX0A 1MJAA 3DKWA 1JTYA 4YEJA 3MKWB 4BQQA 2ICWG 4ZDPA 3WODF 5ERIA 3ZMVA 2H27A 2HTSA 1DP7P 2DCEA 1R49A 3CJNA 2CRGA 2L9NA 3TL4X 2MGQA 5F08A 1KA8A 1S6LA 1TC3C 1D1BA 2JTVA 1JT0A 2MBFA 3RYRA 2IA2A 4AC0A 5FLMJ 1OKRA 1WJDA 1WJFA 1JGGA 1FT9A 1JGSA 2O7OA 3WTZA 1IDYA 3LAJA 2KHMA 2ZMEB 2K4BA 3H0GJ 2EPFA 3TQNA 3UKGA 3M4OJ 2VKEA 4BY7J 3QQAA 5DDGA 3DLAA 5CYVA 4E7JA 1ON2A 5F64A 2M8EA 3CO6C 3FM5A 1VQPI 4F92B 2YS9A 5FRMA 4PK4A 1K4SA 1FSHA 2CQKA 2E1NA 2EFQA 4IX7A 1LKXA 3OY9A 1BW6A 2VT3A 3JSPA 1JKQC 4A3FJ 2ID6A 3F9KA 1LDKB 1IRFA 1MMSA 3G1LA 4RAYA 1IN6A 2VJJA 4FASD 2ME6A 1RI7A 4IOAF 3D5SC 2ESHA 2DK5A 3H5RA 3HRTA 3NQOA 1S5LC 4A3CJ 3GF2A 1XMKA 1HSTA 5E3MA 1RZ4A 3CP2A 2L01A 1QO0D 3SEZA 5JHFA 4EJOA 1VQOI 1XSDA 1PYVA 2E19A 2HVSA 3BG3A 5DUKA 4IKFA 1B9MA 2VJ5A 1L0OC 2VLAA 4HV5A 1LFUP 2MLGA 1FBQA 2QCOA 4NC6A 2DYRH 2GLOA 2O9LA 4B47A 2VQLA 3J7AO 2LH9A 3MCZA 4BEHB 4A2UA 2BXZA 5FKNA 1GLNA 5KHDA 4XLEA 3S1QJ 1RESA 4MEXF 1SFUA 2OBPA 5EGOA 1F43A 5FFZA 1M1EB 2X1CA 4IXAA 3GZ5A 4OWRB 3KP4A 2GZWA 2BV6A 2VN2A 2QEXI 2ZJQF 2AQEA 5ICGA 1U9NA 5BPIA 4A12A 1BOBA 2COBA 1Z91A 1X3WB 1T98A 2FNAA 3CP8A 3TO6A 3ZN1A 2M30A 2EZIA 1E3OC 3E5UA 3IL2A 4R8HA 2DMTA 1S9HA 4ZYDA 4BQAA 4CZCA 4NQWB 1IO2A 3S1NJ 4GDFA 4OIPF 2FQ4A 5HVQC 4DNCA 3OYDA 5LD2C 3ZGKA 1WZ2A 1RPWA 3CUQA 2OZ6A 3CQZJ 5LGTA 4A3LJ 3A01B 3MKLA 3DQVC 2ZJPF 4W97A 1S7AA 1FOWA 3HRMA 4TV7A 1ETQA 2Z2SB 4LIUA 1I5ZA 1U78A 1IXSB 1Z3XA 2Y0SN 3DTEA 1QQIA 4FHTA 3GW2A 1IN7A 3E6MA 2VQCA 1D1AA 1QZEA 1R5ID 3VYUB 3TOAA 3W6JB 3R60A 3S17J 3BTIA 1IF1A 5DD4A 2Z9OA 1LFPA 5CVIA 5ED4A 2RC4A 1UG2A 3S16J 4PSWA 1SFOJ 4Z6YA 2ECBA 2YPRA 3ASOH 3I58A 3I59B 1FOYA 4I6ZA 2ZXHA 3OV8A 2TDXA 4MNUA 4M71A 1O4XA 2KDOA 5C4XJ 3ZP5A 1LFBA 3PUFA 3ABTA 1G6NA 2M2EA 2EZKA 4GO1A 2RVCA 2CWEA 2JA7J 1YS7A 3BZKA 3K0LA 2FE3A 2LFBA 2XAHA 3PFIA 2BBYA 2L4AA 1G4DA 2CUJA 2XRNA 3C1DA 2O03A 2L5QA 3LOCA 4C9YA 5DCMB 4XOPA 1Y8RB 4F7ZA 2P5LC 5B66C 3G2BA 3M8EA 3ONQA 1YJWI 5CJ9A 3QYBA 1J5YA 1H9GA 2QZ8A 4NB5A 1JXSA 3BJAA 3MKYB 1OCTC 2IS6A 2CV1A 3GTPJ 3H35A 3RPUA 2LREA 2PMZN 4L0YB 2DT7B 1FBUA 3V7SA 5M5XJ 3DU6A 3I71A 2EQRA 2Q0OA 3L09A 4XL9A 3JRCA 4D1QA 2HVQA 5D5VB 2GA1A 5E3LA 1MBEA 2WAQA 3KP6A 2Q2EA 3OYEA 2NNYA 2M7BA 3AG1H 3KZYA 2DFFA 2IGMA 3CUOA 5B5EC 2R93J 3O8GA 4IVNA 5EYRA 4L9NA 3IKTA 2VL8A 4BS9A 1QGPA 4AU7A 1FEXA 3O2PE 1USTA 2EB7A 4IRIA 1T38A 3W6KB 1JJ8C 2DYSH 2GQQA 2R7ZJ 3S32A 2LP0A 1ERDA 2HS5A 5J1YA 3BG6A 2XF6A 5DD8A 4D0PA 2O0YA 3GBGA 4M9SA 5H6QA 3DF8A 3FZVA 2IVMA 3PL8A 5EZHA 4GRIA 3MD2A 3L2WA 5TGTA 2DA5A 2NS8A 4OIRF 4ZYHA 4AYBN 3J80Z 3F3XA 4DBQA 3ML6A 5F0HA 5J1UA 3HOSA 1I39A 4A3IJ 4B09A 4N9HA 2VASA 2GOXB 1X3ZB 2PMHA 4ZYGA 2L54A 2OTJI 2DA4A 4A3DJ 3NWTA 1LB2A 2NAZA 5JLWA 2W00A 4B3XA 1GV5A 4X1EA 2E71A 3GVAA 3RDIA 1IV8A 3K10A 1D5YA 5IYCJ 5HNFA 2RKHA 3PNTA 3RTRA 3SDBA 2ZNYA 1YIJI 2CW8A 2V9PA 3HSEA 3PQJA 4OAYA 1UHMA 2E5ZA 1IN8A 2W25A 3CC4I 4UV9A 1ZKGA 4GXOA 1GV2A 3DXJF 1K6OA 5KCMA 2R5ZB 1R22A 3DFGA 1UG0A 4DZJA 2M7AA 2E35A 1BBYA 1B59A 1T95A 5EDNA 3LQQA 4NUBA 1ZR2A 1R4NB 2EFNA 1OCZH 2HKOA 2ISZA 1HKQA 2JUCA 2HDWA 3RKXA 1YE9A 4BBSJ 1XGSA 1XGMA 1IN4A 3JAMK 3OYMA 4KICA 4I2OA 3TDUC 3WTUC 1BI3A 2DXIA 3JRDA 3TW7A 1N77A 3IHUA 4ZTFA 2FMYA 2IGKA 1FWZA 3BJ6A 2NOGA 2JSPA 3DBLB 1W0UA 4F55A 1G2HA 1LEAA 2DFHA 3CCUI 1H88C 4YFXF 2M1BA 4PJLA 2JRMA 4FE7A 3MZ8A 1EH7A 1XMAA 1K78A 2HR3A 3FK6A 5LEJA 5F27A 5DCFA 2Y0MA 1G3TA 1TWAJ 4C30A 1XDUA 2DDBA 4HBLA 3RKWA 3WTVC 4AWXB 4UV8A 4PGHA 4RB3C 1MW7A 2WAFA 2MLKA 2P6TA 5FKKA 4CYDA 1SVMA 3T5XA 4I7HA 3ZPLA 5C3EJ 1S72I 3FXJA 2ZB9A 3C7JA 3VOEA 4GYIA 5F0CA 3CO7C 2CGPA 1TW2A 5DYMA 1X4OA 2DO7A 1VQ7I 2K9LA 3FXRA 2HU9A 2ZC2A 4V2FA 4HDUA 2CQXA 1IUFA 2PJRA 2OAZA 2CUZA 3KLNA 2QYOA 3GLLA 1BJZA 2JJ7A 3V7RA 1U3EM 2EV6A 5CVUA 5FRNA 1FYMA 4PCQA 3KEOA 2VJIA 4A3KJ 1SAXA 3VFZA 2QBYB 2H6CA 1UAAA 3JREA 1BC8C 1BR1A 2DOFA 1P4WA 3HYIA 3TP0A 1F1ZA 3I54A 2UZKA 1ZREA 2JA6J 1QRYA 1W36D 2R7UA 1T0FA 3QU6A 2DPUA 1VFCA 5JVGF 3I53A 1W1WE 3I9V2 4RB1A 2ZMEC 3SYTA 1MH4A 2JWTA 3T8RA 3EYYA 1ZRDA 4Q47A 4AIKA 2BZTA 2QKMB 3OS1A 2XPWA 2P81A 2R7QA 4IRHA 3S3MA 2OF7A 3DPTA 4UVAA 2ADUA 2VONA 1OYWA 1A5JA 2EZLA 4N4OB 1D8KA 2VPRA 1AU7A 5E79C 2KIUA 3LSTA 3BWGA 2A5YB 2Z99A 4GYGA 2F5FA 1VQMI 1Y0UA 1XGOA 2BEOA 2DN0A 1HF0A 3FDYA 5KAFC 2VB6A 3JCUC 2R7SA 2CG4A 1YW8A 2WA0A 3CLOA 1U0JA 2BE5F 1ENHA 1YFHA 2B7EA 1MBGA 1H0MA 4RB2C 4BHBA 1BIAA 4XM3A 2K7LA 3GZ6A 3G1OA 1VI0A 4AVPA 1K6YA 2A68F 3MQ0A 1FMWA 2HFHA 4OMZA 3BTJA 3GWZA 3G1MA 4B3AA 3FMQA 2ISYA 3OWTA 2JMWA 2ZJ2A 3W2VA 3O6BB 1X2NA 5BPDA 2H6BA 2W84A 3T0YA 3H9GA 3JR9A 3CCMI 1O3QA 2WC2A 5CPRB 2FBIA 4HG2A 4IHSA 1X19A 4A69C 1YRNA 2Z5UA 2ZFUA 1BI1A 3FF5A 2VKVA 3SZTA 2HWVA 4JBAA 5ICFA 4E7HA 3MMYB 3HOTA 3M07A 4KA4A 1ZYRF 3RKQA 3ABLH 3H92A 3KZIC 3HKZA 1A36A 3QPSA 3OYLA 2AQFA 4LJZF 3MZYA 2LOOA 1YO5C 5HLHA 1YYVA 2IAIA 3CMMA 3OR2C 3O3KA 3KZZA 3JTGA 4XRMA 3KP5A 3HOWJ 2LKSA 2R5YB 1ZRFA 4HF0A 5IP9J 3IRQA 1B6AA 1ZG1A 4JOMA 2GM4A 2VKDA 1FTTA 1I1GA 1RKTA 1K61A 4FX0A 1EF4A 5HODA 4UUTA 2PQ8A 4WK8F 4P9FA 3MN2A 3QWLA 1LJ9A 5AIPA 2XF7A 5GAHJ 4UB8C 4ZC3A 2M45A 4F91B 2K27A 5J3LA 4KT6A 1SFXA 1UMQA 3C3WA 1BOAA 3HUGA 4XSZF 1CQTA 3QOPA 1OR7A 3JRIA 4Y15A 1AOYA 3KFWX 1SC7A 1D8JA 3WU1B 5CLSA 4DIQA 1ZN2A 3HSRA 3B6CA 2PFBA 2A6TA 3BR1A 2L02A 5FD5A 3WTTC 5ILUA 2ESNA 1RIOH 3HSFA 3OYAA 1D0ZA 2DMNA 3GTQJ 4GFBA 3BG7A 2HEOA 2QVOA 4IHVA 3RI4A 2VE8A 1X1CA 3DPLC 5A2QZ 5D4RA 1U5TA 4HPQA 3CCYA 4U7DA 1A6IA 3VODA 1ZTRA 2PG4A 5C44J 4C3IJ 2HZDA 2JPCA 3BZCA 4XORA 2O3FA 3I5UA 1YITI 2V6EA 2JPBA 4MTEA 1ZELA 1XSVA 2K5CA 5FLXK 2BW3A 2HYJA 2L0KA 2LY1A 1PUFB 2CU7A 3K4MA 3PNYA 3R0JA 2BHYA 4P96A 3CCQI 3LSHA 4KIBA 1SMTA 1QNTA 4YIFA 4BGDA 2GBYA 1B8IB 4WF2A 4X0GA 3Q0WA 3H5AA 1TT0A 2HQNA 3GLXA 2XF5A 2IT0A 2EBIA 1Z1DA 2Z16A 5M5YJ 1SD4A 4HSTA 3RYPA 5K7HA 2EV0A 4QWQA 1X1AA 1KZHA 1TZLA 1HW1A 4A3GJ 2L2OA 2XC7A 4IJAA 5EG0B 3WGGA 1MJBA 5JHUA 2XRLA 1JHHA 1ZQ3P 4AD9A 3AKZA 3HJEA 2B0LA 2W82A 1W36C 2H1LA 4AIHA 2W24A 1ULYA 3P9IA 1QPIA 4HSRA 3ROUA 3J7AY 3BR6A 2NRAC 4IHYA 4LB6B 3HOVJ 1HCRA 4I0AA 3L2CA 1ZR4A 4PFPA 1VNDA 4E7SA 2OTLI 2IPQX 3ISPA 3MVPA 3K4BA 3QAHA 1SFEA 2O5RA 3VSKA 4NBQA 1POGA 4ZZLA 3JSOA 1ETKA 3T1BA 3E6CC 2WAQN 2LDUA 3BT9A 1JKRC 4RAZA 2HGCA 4CH7A 1YW7A 3HPGA 2A07F 1MD0A 4XRSG 2COMA 3BQYA 4HNVA 1ZLJA 2R7XA 4IOCF 2FXAA 3UR3C 1D0YA 4C2MJ 4HX7A 2A6HF 4J00A 3FX3A 5E8GA 4E6KG 1WJCA 2JUGA 3GFLA 2IEKA 1RC9A 4BBRJ 4ENKA 5GAEJ 2WTEA 4UNOA 1DQUA 4KIFA 5L3GA 3BR0A 2STWA 1P2FA 2RN7A 1VQ6I 4A0ZA 1TL8A 1H8AC 2QQAA 1FPQA 5HDNA 2V79A 2A05A 1T6SA 3OMYA 4XLCA 4N0BA 2QM3A 2X6WA 4II3A 3H9JA 2VOOA 3LAPA 2L4MA 2I5UA 2QF7A 5E17F 4CICA 1MZBA 1WVRA 3TEDA 2HPIA 4ZTJA 3PM1A 3GYHX 2DTRA 4S04A 4MFDA 1E17A 1MMGA 4ENJA 1PUEE 4L9TA 2OD5A 2BY2A 2JVHA 5DUIA 4XRFA 2DTZA 3VYSB 3ZMDA 2V4JC 4M9XA 3F8BA 1TQMA 3VWBA 1XMXA 1LEBA 3FIWA 1WQ2A 1OLTA 4LD5A 3OYBA 2E2JJ 4Z2YA 3GUDA 1W7PB 2FSWA 5J40A 1BR4A 2AO9A 2GXBA 4E7KA 1S8NA 2H09A 3HHHA 1MJ9A 2LR8A 2O8XA 4PZJA 3TDZC 4A5MA 3EUAA 4D9JA 2DT5A 3CC7I 3S14J 4CCJA 4CYCB 3RQ4A 4EGZA 1T56A 2BY3A 2IW5A 1F4KA 3GEZA 1X4PA 4S0HB 4L18B 4PDKA 3QU3A 2E5NA 3HOXJ 3C2BA 1Z6RA 2IS1A 1JUSA 2HVRA 2OCEA 3B6AA 4KNYA 5AIQA 2XGCA 1NG6A 4JK1X 4JQFA 3K4NA 2QUFA 4HNTA 4G9YA 4EJVA 2LD5A 2BHZA 2Y30A 4BYYA 4RGSA 5EJCA 1C0WA 1Z7UA 2MH9A 3G71I 4HLXA 3ZQHA 1LNWA 3GXOA 2WB1A 3LL7A 4XMYA 2X6XA 2E7WA 1ITYA 1IV6A 1I6HJ 3L2UA 5BNGA 3ECOA 1Z6TA 1W5CC 4HV6A 3ZR8X 2Y75A 3VPRA 1TQIA 1X2MA 1WJ5A 1ZG5A 1X1DA 4L9VA 4QTRA 1AKHA 3CCSI 1XCVA 4E4HA 4LB5A 4LG0A 4KN7X 4Q48A 2QLZA 4Y52J 4NHJA 4HOBA 3GFIA 4E7ZA 2I8DA 4ASNA 1OCPA 4GGGA 2FJ1A 1LE8B 5E1ZB 3EPZA 1EV7A 1H89C 2VKHA 1HC8A 5KVRA 4DYRA 4EM0B 1W4MA 4AUXA 3KEQA 4IZZA 3EUHC 1LQ1A 3NARA 2YU9J 3HG9A 3DEUA 3OR1C 2XROA 1I6XA 2KIQA 5DS9A 3L2VA 1WKMA 2LBFA 1OJLA 4BUPA 4S05A 1V5FA 2DPDA 5DTDA 1Z21A 5GPAA 1DP3A 4O3MA 3H0DA 2VXDA 4BKXA 2LG4A 1KONA 2DI3A 3F0CA 1HLVA 4XN0A 2VBXA 3L9FA 5ILSA 2PBIA 1WJEA 4IHXA 2NVQJ 4O6JA 3GTMJ 2W1OA 1BL0A 4KN4X 1Y1VJ 3RZOJ 2EWNA 1YJ9I 2DMQA 2FEZA 4M72A 1T08B 1ZHFA 3K9TA 2FQ3A 2LSOA 4I09A 2V1XA 5KK1A 1RKWA 4XLAA 4AIJA 2ZXJA 3UNGC 3M1EA 1YJNI 2ZNZA 3OOPA 5E3OA 3H36A 1MNEA 5LRRA 9ANTA 2D1VA 2WBMA 3T8TA 1ZLKA 1G3WA 4A3EJ 5JVTA 4D7NA 3BR2A 4LLLA 2VE9A 3ZMUA 2CV2A 4YIIA 1HOMA 2O8KA 4A0XA 3GTLJ 3JRHA 4MTDA 1APLC 1FP2A 3A1YA 3M8FA 3QYEA 1QVTA 3MZHA 2GA2A 4LLGF 2LC2A 3HGGA 4M3GA 1MIJA 3HDDA 2P4WA 3M9AA 1W7PD 2G0EA 3CMAI 2RAEA 4J19A 3IAM2 2HOTA 3TOBA 3ZMTA 1MDMA 3K69A 2IS2A 3HGYA 5LGNA 1WWXA 4OAZA 3KYDB 1PDNC 1IC8A 5BMZA 2KMUA 3AG4H 3HOZJ 1LVKA 4ENNA 5HNHA 5DM6F 3G4SI 3KCCA 4BXXJ 3DTKA 1BR2A 1P6RA 2X85A 3ABUA 3LFKA 4BHPA 4B43A 2FNPA 3D5RC 4DZPA 3P7NA 2AXTC 4LFUA 3ZMSA 3Q9SA 2DLLA 2BY1A 4G6DA 3HKZN 5IYBJ 2LRDA 3WTYC 3KE2A 4ETSA 4Y7NJ 4ENMA 3HTSB 2CW0F 2E36A 2UV1A 4OINF 5K5OA 4FX4A 2K40A 4QPQA 1J9IA 4G7ZF 1TNSA 2BYVE 3ZRGA 3AL0B 3KYCB 2VQHA 1B4AA 1TNTA 1IRGA 3MEXA 1KQ0A 1X1BA 2H8WA 1CF7A 4NC7A 1MMNA 1ONVA 2GIZA 1YI2I 1NTCA 5D5XB 3ZQGA 3BG9A 3CESA 4IHTA 1D1CA 2MFZA 3W2AA 3BG5A 3J80K 1UJ8A 5D8KB 4IQJA 2Y48A 2V9KA 5FKLA 1YQAA 3SZPA 2AS5F 3OSFA 1FP1D 2UUZA 2M9HA 3V8JA 4NDLA 3LMMA 2IBDA 4HQMA 4ZDLA 4CHUA 2Z1DA 4UUSB 4L0ZB 2D5VA 1F36A 4BL0B 4BE1A 3K4LA 1MBJA 4K2EA 5EEHA 1K83J 3KLOA 4Y4RA 3G3ZA 1U8RA 4I0BA 2RV8A 1VQ5I 3FXQA 5IY5H 4BAYA 3ZN0A 4AM3A 3W2WA 1B72A 5JLXA 2A3SA 4A3BJ 1WH5A 3EDPA 2NVTJ 3EUKL 1DU0A 1YW9A 1SFKA 2XAGA 1KQ8A 4PGGA 4XOTA 1BW5A 5HLGA 4B1RA 4LGWA 1UFMA 1WCMJ 3ASNH 2F48A 5K5RA 3L00A 2YX7A 2N8GA 3E6BA 2JA8J 2M0MA 3HOYJ 2OQRA 2CJJA 2P7CB 2R7DA 3LFUA 3QODA 3TW6A 4RGUA 2JVGA 4HNUA 3J7ZI 2WY7Q 4G12A 1MMDA 3I55I 1GDTA 2HDCA 1ZGJA 2ID3A 4P55A 2HOSA 3QRFF 2FOWA 2L7FP 5D4SA 1BJAA 3L7WA 1E3HA 1AWCA 3E0JB 3J7YJ 5F0FA 2CV0A 2GXGA 1P9QC 1EA3A 1TWHJ 1X58A 2ZMEA 1N25A 5E20A 2R7VA 3I64A 4UB6C 4B48A 2IXSA 3R61A 2TRTA 1I3QJ 2OU2A 5D5UB 2EA2A 5IP6A 2H94A 4EJUA 2KDZA 2JK3A 2IGOA 5M3MJ 4CXFA 3CZ6A 3LSJA 1TTYA 2DOAA 3D5LA 3DTIA 3U21A 3RZDJ 4UUVA 5JI6A 2IRFG 4CA0A 2ACJA 1PVEA 4LITA 5FD6A 1YTYA 4B4CA 4HAMA 4EATA 1U9OA 2LTPA 4CUGA 1F9NA 3VB2A 2DBBA 3OYIA 4ESFA 1HQCA 2VT2A 5K7ZA 4BACA 2LLKA 3CMEI 3LSPA 2B9SA 5KNLA 1PP8F 4M3EA 2G7HA 1VQ4I 4Y33A 4ZDOA 4U0VA 4U88A 1XTAA 3NRVA 1XN7A 1J7KA 1KQ9A 3W3CA 4IO9F 1E2XA 3BPVA 2KZGA 2TCTA 2HXOA 2Y2ZA 3PFYA 5IT9Z 1IZ1A 1Y6IA 1NG7A 2D2WA 2E1CA 5GAGJ 5TISC 4BE0A 5EGOB 3FMSA 3CJQB 2VOPA 1D0XA 3QYFA 3RCOA 2PJPA 1O7LA 1FSEA 1WHUA 1EH8A 1YIOA 4LMYA 3S2DJ 1WI3A 2KPMA 2QKLB 5FKMA 3PNVA 2K02A 4ZH4F 2CUFA 3ESWB 4ON0A 4BEHA 4A3MJ 1ZARA 1I3AA 2F5DA 1FYLA 3X2QH 3WTSC 2QQ9A 1P7IA 2OA4A 1O57A 2HQ5A 3KPHA 1MSEC 3E7LA 3Q5FA 3MFKA 3L2QA 4BHCA 4BNCA 2LF7A 1MNDA 4MGRA 2R7WA 1JT6A 3AG2H 3DKYA 5DM7F 1V55H 2KJBA 1JE8A 3CUQB 4ITVA 3IH3A 3U9GA 4LK0F 4XONA 5HS9A 4HX8A 2MSYA 2GXAA 2OJED 4KYWA 3WTXC 4E70A 3ERED 2WV1A 4NQWA 5GTIC 1JHFA 1G59A 4M6VA 3M3YJ 1UELB 3G6EI 4G6TB 4MEYF 4JYKA 4KDPA 3PO3J 4QSHA 4WXCA 2ZKZA 2EIJH 3IH2A 1HBXG 2ETHA 3P9KA 2XAFA 1R5HA 1J59A 3CDHA 3A01A 5F04A 2X9DA 1S7EA 3GO5A 5J8CA 1ZK8A 4BQOA 4F3QA 3JRFA 4PJ0C 3SEQA 3ZXSA 5BS6A 3FISA 2MD5A 2R7RA 4HW0A 4FQGA 4KJZA 3OIQA 2WAEA 3QPTA 2ME0A 4XKBA 3CDIA 5IP7J 5L3CA 1BIBA 2RDPA 5J4VA 2VI6A 2XSJC 4II2A 1W0TA 2JA2A 1XG1A 2DDAA 1MBFA 4WCGA 2KP6A 4L5IA 2CH0A 3I59A 2W85A 3H1CA 4C2UA 3LSGA 3FXLA 2XIGA 1XCBA 4PJMA 2DW4A 2LVSA 3K7AJ 1PP7U 4QLCU 3N97A 1EJ9A 2VJ4A 3HTUA 2X48A 3SZGA 5AONA 1JI8A 4ZYEA 2M8GX 2QSFX 3E1SA 2W4SA 2Y9ZA 1V54H 2Z3YA 3FXMA 4LK1F 4R79A 2E1MB 3L2RA 3U2RA 3SFZA 2A61A 4EEFG 1TQPA 4P9UA 1CGPA 3B73A 2L7ZA 5DCMA 1UB9A 3CCRI 5E8IA 4CCLA 3FHNA 2WB1N 3S1RJ 4C3JJ 4I98B 2P6SA 3A2KA 2M4KA 2Q2EB 2O61A 2M0CA 1R36A 2K9SA 4D5CA 3J81Z 2GAUA 1FOKA 1VQ8I 2VXZA 2QWWA 1Z7LA 4ZZDA 3DEEA 4I99C 1STZA 4KMUX 1J2XA 3AAFA 4RB0A 3TKYA 1I1SA 4DYQA 1SANA 2PX9A 4PJNA 4HA8A 3P9CA 3GTOJ 3ECHA 3DKXA 3A0HC 3OL3A 2EH3A 2G7UA 3ZMZA 1XX5A 1YX5A 3WGIA 1P4AA 2F5VA 3GZNB 3IUOA 3Q3SA 2CQQA 4PUSA 2DJIA 2YR2A 2R7OA 2EZHA 2EFOA 3ZOBA 1WPKA 4XSXF 4X6AJ 3ZQFA 1Y1WJ 1R7JA 3LQRA 5K1YA 2BGCA 1RETA 1WJBA 5FGMA 4DOZA 2L9SA 3EETA 4YG2F 2Y9YA 2M3AA 2MW8A 3HM5A 3RSNA 4A5NA 3F22A 5A2QK 2K4JA 2YUSA 2J5OA 2MD0A 2VBZA 5CQEA 1ZAOA 5GPCA 4YIRX 2DQRA 2KKOA 2Q1ZB 4I01A 1LUJB 5IT3A 4Q4ZF 2WV0A 1G3SA 4C3HJ 2OV7A 4LLNA 2F4IA 2XKOA 5K5QA 2HOEA 1V4RA 3JTHA 2LKXA 3DV8A 4KISA 1FYKA 2EIMH 4IQ4A 4ESBA 5J8FA 2K85A 2JA5J 3ZQ7A 3H3VK 2XB5A 2XGDA 4MFEA 1EKEA 4HEA2 1MH3A 2OPTA 2OCCH 5LHIA 1QVUA 4M3FA 4EQQA 4G8XA 2RQQA 5EZGA 1A6QA 3WG9A 1IAWA 2HKXA 2PEXA 2K86A 3K1MA 5H20A 2ELJA 1IUYA 4U0YA 1K4TA 4CO8A 3EQLF 2OC6A 3FWEA 3CDLA 3BR5A 1IN5A 1Y8QB 2FU4A 2V26A 4RBOA 4FCYA 1R1TA 2XVCA 5D6FA 2QGUA 4J01A 1WFXA 2KL4A 2R5ZA 1OCRH 3FXOA 1VF9A 3CCVI 2JT1A 3E97A 4RAGA 1IDZA 2JN6A 2A69F 2XGEA 3D0SA 4L5JA 1Y0NA 3HC7A 4PFOA 3PQKA 3OL4A 2V1NA 4ESJA 2NNNA 3F21A 1O3TA 1K78B 1SAUA 4RAFA 2R92J 1B9NA 3OSGA 2XGXA 1HKSA 4CDGA 2XPVA 4F52A 3TP3A 1YLFA 2L9RA 2NXNB 4LIVA 4M3DA 3WE2A 5F6FA 3BPXA 3H5NA 3WU0A 3H3ZA 2E34A 3RPUD 3FKJA 4E7IA 1V5GA 2QSHX 3CJRB 2IGNA 4IHWA 2F4MB 2D1HA 2DAOA 1QZZA 3S15J 1D5VA 1OPCA 3HEFA 2XB0X 3OIPA 4RLFA 3I56I 2XAJA 1NK2P 2P0WA 2PJRB 1KYZA 1YX3A 2ZBKA 4RGRA 3V42A 1MKMA 2KLOA 5LEKA 3I0TA 1USSA 2ELHA 3BQZA 5HOOA 1MNMC 1IXCA 2DQLA 4O5VA 3WGHA 1Z9CA 4HF1A 3GFJA 1AHDP 5J6XA 1T2KA 5ILVA 1BM9A 3VSLA 2FA5A 3Q0VA 4E7LA 4IPAA 3W6VA 3VDXA 2L7MP 1R00A 2RGVA 2JSCA 2W48A 2CW7A 1D3YA 4KITB 5E3NA 1VQLI 5DEQA 5FKOA 5EEAA 2H8RA 3K1NA 2QENA 3DPUA 4DBRA 1RUNA 1UHWA 1R71A 2QBYA 2FMLA 2F4OB 4BE2A 3S3OA 2LK2A 4P1WA 5D5WB 4DW6A 4U0WA 4EVIA 5EEGA 3IRRA 3R6SA 1DU6A 4R1HA 3JRBA 2MH2A 4Y17A 3IAS2 1FOXA 2XSDC 4XBFA 2IS4A 1B1BA 2HNHA 3CLQA 5CKTA 2EINH 5JFRA 3GX4X 4W1UA 1DPRA 2KQRA 2AXLA 3ZQIA 2VODA 4NC8A 1DPUA 2X1DA 2DOEA 4NNJA 1MSFC 3V7CA 1J75A 4D5FA 5B1BH 2HQAA 4RM2A 1FBSA 1YOVB 1ZH5A 3QPLA 2JZYA 2E60A 3OOUA 3RKYA 3EUHA 4BQNA 2GOMA 3BROA 3C2HA 3F8CA 3RPQA 3U1DA 2KISA 3DU5A 4CCMA 2OZUA 4V2GA 1L3LA 5IOYA 1Z77A 2V6CA 2XASA 4ZJZA 3KETA 3FKIJ 4EGYA 2DT6A 4B8XA 2F5EA 1KYWA 2JRTA 3FBNB 3ERMA 5L3DA 2RNJA 2K3FA 1ETOA 1Z67A 2E2HJ 3BLYA 1DGRM 1HDDC 5F1RA 3HRSA 1MMAA 5E1XA 2V1DA 1BA5A 1HDPA 4G94A 1TLHB 3CCEI 2K9NA 4RDUA 1YRNB 3QOEA 3ZQQA 4QIWN 4YELA 1FLIA 3IKVA 5H6RA 3BJOA 3JRGA 1NK3P 3REOA 3F8FA 1N78A 3F23A 3S2HJ 1R58A 2P8TA 1JUPA 1SMYF 3IV5A 1J0RA 2E2IJ 1FTZA 3QPHA 4PSXA 1SVOA 1PJRA 5B3SH 3OIOA 4XKCA 2W7NA 3GFMA 5HDKA 2ZJRF 3MWMA 1IJWC 2CO5A 5B1AH 5LFAA 3LA7A 2GIVA 2P7VB 2RNGA 3D1NI 5TRDA 1ODDA 1WH7A 2CQNA 3R0AA 2EA4A 2E7XA 1Y39A 5H2FC 2PMUA 5LHHA 3S93A 1XC5A 2KRFA 3E5QA 3KP3A 1YHQI 3CUQC 3I3LA 3AFHA 1A35A 4M6YA 1FX7A 4BXUA 2UXXA 3H9QA 3WG7H 3SFIA 3RQIA 2R5YA 4G7HF 4N9IA 1F5TA 3SQNA 3CCLI 1R5GA 2XAUA 4MO7A 2QA4I 2XUBA 1O7FA 3HUGB 4EJWA 4EM1A 5CVJA 3K70D 5KAIC 3A03A 1RR7A 5GADJ 2DMPA 4LOCA 2HXIA 2EJRA 2KFDA 2P5VA 2NS0A 4XLHA 3LSMA 5J1RA 5FROA 4WXHA 1BI2A 3KIOA 2F2EA 3BCBA 4F93B 1IG7A 3BOQA 1Y56A 4P5OA 1GVJA 1VQ9I 1MBKA 1QU3A 2NS7A 4B44A 2ZCWA 4YFKF 1RNLA 1FNNA 1WJAA 2HTJA 4HF2A 2CFXA 2X6OA 3FXUA 2YU3A 3K4JA 2CUEA 5CVVA 3S2WA 5E1WA 2EILH 3NEUA 2HI3A 1GXQA 2BXYA 2DFEA 2W57A 3M8JA 1U5TB 3ZCOA 4XLFA 2HQRA 1JUMA 3HBLA 3N05A 2EFPA 2A6EF 3V8LA 1OYIA 2R3SA 2V9VA 3HXLA 4U7BA 5LLQA 4HX4A 2UWMA 3ZQCA 5LGUA 3BY6A 4KUMA 4M6XA 1HW2A 3B02A 4KT5C 3DCFA 4CGZA 1KU9A 1Z05A 1O3RA 1FJLA 2BW3B 5FJ8J 3GMEA 2E1MC 3LA2A 2R0QC 5GP9A 2HYGD 2VC1A 3BR3A 1G3YA 2FBHA 1S3JA 3M7GA 1HSJA 4ANJA 4L9JA 3LWFA 4FTHA 3A0BC 4MQVA 5FB2A 5HLTA 3FXKA 3F6OA 2FOKA 1ZGWA 2IP2A 3KX2A 3HZJA 4XICA 2G9WA 2LKPA 3OYJA 4UVCA 1MBHA 3RJPA 1PUFA 1KU2A 1WGXA 1KU7A 1QZYA 1GHCA 3BC8A 3OS2A 4RGXA 2DMUA 1FC3A 2OUMA 1B8IA 2GWRA 4KMFA 1JKPC 4CCOA 2MC4A 5IYDJ 3IWZA 2PLYA 4FE4A 2MG4A 4EMSA 3OYNA 2PI0A 1FMVA 1WI9A 1R9TJ 1ON1A 3OYFA 1P4XA 3ABKH 5CQGA 4A6EA 2MABA 1KGSA 3JAMZ 1WSUA 5D6EA 1TT5B 3PIPF 1S29A 2L7KA 3WU2C 2HPMA 5FFXA 5EG0A 5IOZA 1SEUA 1BN5A 1QHGA 3Q9VA 3QP6A 3G73A 1U8BA 3AG3H 4M9ZA 1P92A 3ABMH 4IL6C 4G6QA 4EM2A 5J4YA 3N4MA 4AIDA 2MC3A 3ELKA 5LBQA 1HKTA 5DV5A 1JJ6C 6PAXA 3DP7A 2FBKA 1FIAA 2OQGA 1G8XA 3BDDA 4DYCA 4M73A 3KP7A 5L3EA 3WTWC 5L3BA 5C4JJ 1VTNC 1ORKA 1NH3A 2A5WA 1O3SA 2EK5A 5ICCA 3JW4A 4BDZA 4BH9A 3BTLA 2D45A 1TBXA 4D7MA 4FETA 2R7TA 1NHAA 3JRAA 3RIRA 4RA2A 4JX5A 3H3UA 2VC0A 1ETWA 4QPOA 3GTKJ 4Y13A 4HZFA 2ZSHB 3LSKA 4BJ6C 2XDVA 4U87A 4UVBA 4C2TA 1GVDA 2K9QA 3C18A 2F6CA 1R1VA 1W5SA 2M87A 2KZVA 1SD6A 3PSFA 2V1UA 3SJMA 3PJRA 3V8KA 4RLQA 3IP4B 1YS6A 1HXDA 2NOJB 2UXNA 2F5CA 3FMRA 1XSXA 4UY8I 1TWFJ 4N4NB 3SXYA 3GCMA 5JR3A 2BVLA 2ZXIA 1VQNI 4IEJA 2RQPA 3KYLA 4JX4A 4XNFA 1SD7A 2EIKH 1VQKI 2Y0SA 2K3PA 4MIMA 2ZSIB 2WADA 2BVMA 4FISA 1QA6A 2IJLA 4FT8A 2DU9A 1I27A 2DA2A 3PSIA 2HDDA 1WRJA 3NAUA 4XLPF 1XPXA 1A31A 1AA7A 2J5PA 1W7PA 1XD7A 3F72A 1IGNA 4HDVA 5HS7A 2M4GA 2LY9A 4CZZA 1U6GA 3PO2J 2MYSA 3BTCA 4RS8A 1IRXA 1V3FA 2XPUA 1R4MB 2LNBA 4XRSA 4I76A 2XAQA 4UXNA 4BU2A 4CYCA 1FY7A 3HPHA 3VYTB 3K70C 3S3NA 4I02A 5FLVA 1ETYA 2DA1A 1Q1HA 3MKZA 4L5EA 5L3FA 3DBRB 2ZO4A 3GTJJ 4XN3A 4YFNF 3M1CA 5M5WJ 3OYCA 1TWGJ 1ACIA 2HZTA 3IH4A 3WHBA 1QPMA 1TP4A 2CS3A 1FIPA 1VZ0A 4PJJA 3TO9A 1ZRCA 2PMZA 3K1PA 4RM3A 4BY1J 1OFCX 1IRZA 4GCVA 2L3DA 4IRGA 4HQEA 2RREA 1RR8C 3BP8A 1RRJA 1HW5A 1AKHB 2CSOA 2KRCA 2DODA 5FO5A 1T0FC 3E6DA 2ELKA 3SDGA 1LPQA 4LG0B 5IT9K 2R4GA 2DA7A 3I4PA 3LSIA 2XV4S 4M3BA
chains in the Genus database with same CATH topology
3TMOA 5HNFA 1E0EA 3PNTA 3RTRA 3SDBA 4E4HA 4HEA2 2CW8A 4E7ZA 2I8DA 4OAYA 2E5ZA 3EPZA 2RQQA 2VKHA 2ELJA 2KRHA 4IZZA 5KCMA 1QHHD 1UG0A 3EUHC 2LBFB 2M7AA 2OC6A 3HG9A 1T95A 2V26A 3OR1C 1R6RA 4NUBA 4Y3OA 4J01A 1WFXA 2KL4A 2HDWA 3L2VA 2LBFA 2X6YA 4BUPA 1V5FA 4RMNA 1YE9A 1Z21A 1DP3A 3H0DA 2VXDA 2LG4A 4AYBA 4BDYA 3OYMA 1KONA 3HC7A 4PFOA 3OL4A 4XN0A 2V1NA 2DXIA 4BXFA 1N77A 1WJEA 4ZTFA 2IGKA 1SAUA 2JSPA 4F55A 2W1OA 4PJLA 4F52A 3OYKA 4XQFA 2FUG2 4LIVA 3H5NA 4C30A 3C2GA 2VPLA 4XLAA 3RPUD 3FKJA 4E7IA 1V5GA 3CJRB 2IGNA 2V7FA 3UNGC 1MW7A 2WAFA 1MNEA 1DGWY 2WBMA 1HA8A 3OIPA 4RLFA 2P0WA 2CV2A 2PJRB 2WY8Q 1YX3A 1V5EA 3V42A 1X4OA 2KLOA 3A1YA 3QYEA 2K9LA 3K6GA 2HU9A 5HOOA 2PJRA 2CUZA 4HRIA 2LC2A 3VSLA 5FRNA 4E7LA 3PUBA 3VDXA 1J09A 3CF2A 3IAM2 2VJIA 2CW7A 4KITB 2IS2A 2X51A 4OAZA 1UAAA 3DPUA 4DBRA 4DJAA 2VIXA 1BR1A 4DGWB 4XR6A 2KMUA 4BE2A 1LVKA 2CMPA 4LG3A 2K9MA 4CSWA 5HNHA 3S3OA 1W36D 4P1WA 2R7UA 3DTKA 1BR2A 3S8PA 3I9V2 1OR7C 2X85A 1N75A 4B43A 3D5RC 3SYTA 3IAS2 4BJ5C 2IS4A 2QKMB 2HNHA 3VYRB 3OS1A 5CKTA 2R7QA 3S3MA 3BCAA 3DPTA 3NWSA 2KQRA 4NC8A 4ZYAA 2X1DA 2VQGA 4N4OB 4NNJA 3FBIB 2LRDA 2HQAA 4RM2A 2X1EA 2UV1A 3OOUA 2E60A 4BQNA 2GOMA 3C2HA 4CCKA 4QPQA 3ZRGA 3AL0B 3DU5A 4CCMA 2VQHA 3FDYA 2VB6A 4H4KC 4AVZA 2R7SA 4ZJZA 2WA0A 1X1BA 2LYCA 1U0JA 3OS0A 2DT6A 4NC7A 1MMNA 4XM3A 3FBNB 3TBIA 1Z3YA 3OYGA 3CESA 1D1CA 1K6YA 2MFZA 3BLYA 4XKWA 1DGRM 1FMWA 2BOLA 2CFOA 3K4KA 3W2AA 1MMAA 4YRVA 4IQJA 2V9KA 3OWTA 4XKVA 3DWLE 3W2VA 3QOEA 3ZQQA 4YELA 2UUZA 3OYHA 3H9GA 3LMMA 4ZDLA 3A4CA 1N78A 3HL2A 5CPRB 4HG2A 2Z1DA 1X19A 4BJTA 4BL0B 4BE1A 3K4LA 2ZFUA 4PSXA 4CCNA 3AL0C 2LY2A 3K4CA 1PJRA 4Y4RA 4XKCA 2W7NA 4E7HA 3KEYA 3MMYB 4MLOA 3HOTA 3HKZA 5LFAA 3W2WA 3OYLA 4YEJA 2AQFA 3MKWB 4BQQA 2RNGA 2LOOA 4ZDPA 3EUKL 3CMMA 3OR2C 1SFKA 2DCEA 3S93A 2L9NA 4XOTA 3TL4X 3I3LA 3AFHA 4JOMA 2VKDA 1D1BA 3H9QA 2M0MA 3LFUA 2XAUA 3QODA 4HNUA 2JVGA 2WY7Q 1MMDA 1WJDA 1WJFA 2XF7A 3HUGB 3K70D 4ZC3A 2KHMA 4F91B 4KT6A 3E0JB 3DLAA 4XLHA 3LSMA 5FROA 4E7JA 2CV0A 1P9QC 1EA3A 3BCBA 4F93B 2R7VA 4F92B 1Y56A 4P5OA 5FRMA 4PK4A 4DIQA 1QU3A 4B44A 4B48A 2IXSA 4IX7A 1LKXA 3OY9A 2A6TA 1WJAA 2IGOA 3CZ6A 3U21A 2DOAA 3D5LA 3DTIA 3K4JA 3F9KA 3OYAA 1LDKB 4CA0A 4LITA 2VJJA 3M8JA 3ZCOA 4FASD 4XLFA 1D0ZA 4EATA 3D5SC 3N05A 3BG7A 3H5RA 4CUGA 1X1CA 3HXLA 4U7BA 3DPLC 3OYIA 3CP2A 4BACA 4HPQA 2UWMA 5KNLA 3SEZA 5JHFA 1PYVA 2HVSA 4Y33A 4ZDOA 4IKFA 2VJ5A 2VLAA 2BW3B 4IQ4A 3W3CA 2HZDA 2E1MC 4XORA 3PFYA 2V6EA 1Y6IA 1NG7A 1ZELA 4B47A 2K5CA 2VQLA 4BE0A 3CJQB 2BW3A 1D0XA 3QYFA 3RCOA 2LH9A 2LY1A 4BEHB 4ANJA 1GLNA 3K4MA 3PNYA 5HLTA 5KHDA 4XLEA 3KX2A 2KPMA 3LSHA 2QKLB 3PNVA 4BGDA 3OYJA 4X0GA 4BEHA 2X1CA 3H5AA 1TT0A 4OWRB 2XF5A 3BC8A 3OS2A 2AQEA 2Z16A 2OUMA 1BOBA 4HSTA 4CCOA 2MC4A 3L2QA 1X1AA 3CP8A 1TZLA 1MNDA 2R7WA 3OYNA 2L2OA 1FMVA 3DKYA 2XC7A 1S9HA 3OYFA 4CZCA 4ITVA 4NQWB 2MABA 5CQGA 4XONA 2L7KA 3AKZA 2HPMA 5HVQC 3OYDA 5LD2C 2W82A 3ZGKA 1QHGA 1W36C 1G59A 4HSRA 3J7AY 1UELB 3DQVC 4G6TB 2Z2SB 4LIUA 4PFPA 4E7SA 1Z3XA 3K4BA 3DTEA 4BQOA 4F3QA 2O5RA 2VQCA 1D1AA 3VSKA 3SEQA 3VYUB 3ZXSA 2R7RA 1G8XA 1LFPA 4KJZA 3OIQA 2WAEA 4XKBA 4PSWA 4CH7A 3HPGA 2XSJC 4II2A 2ZXHA 2JA2A 2A5WA 4BDZA 2R7XA 3UR3C 1D0YA 2R7TA 4FETA 2KDOA 2KP6A 4J00A 4E6KG 2CH0A 1WJCA 2JUGA 4C2UA 4QPOA 3LSGA 2ZSHB 1DQUA 4PJMA 3LSKA 4BJ6C 2XDVA 4U87A 4C2TA 2VJ4A 3SZGA 1JI8A 2F6CA 3E1SA 2W4SA 2CUJA 4XLCA 2L5QA 3OMYA 2KZVA 4C9YA 3PSFA 4XOPA 3PJRA 4R79A 4RLQA 3G2BA 2X6WA 4II3A 3ONQA 2E1MB 3L2RA 3H9JA 3QYBA 3IP4B 2NOJB 3MKYB 2IS6A 4N4NB 2CV1A 2HPIA 3H35A 2BVLA 2ZXIA 4ZTJA 2LREA 4CCLA 3FHNA 3KYLA 3A2KA 4XNFA 2DT7B 2M4KA 2Q2EB 1MMGA 2JVHA 3DU6A 2Y0SA 4XL9A 2K3PA 2ZSIB 2WADA 3VYSB 4D1QA 2HVQA 2BVMA 2V4JC 2WAQA 2VXZA 3OYEA 3VWBA 1Z7LA 2M7BA 2IGMA 1OLTA 3DEEA 3OYBA 1BR4A 4PJNA 3PSIA 4E7KA 2VL8A 3DKXA 4BS9A 4AU7A 3OL3A 1AA7A 1YX5A 2F5VA 3EUAA 4D9JA 3IUOA 2M4GA 4CCJA 4PUSA 3RQ4A 2MYSA 2DJIA 3S32A 2R7OA 1IRXA 1ERDA 1X4PA 3BG6A 2XF6A 2E5NA 3GBGA 4BU2A 3S3NA 3HPHA 3VYTB 3K70C 2IS1A 2HVRA 1WJBA 3PL8A 4DOZA 2L9SA 3MKZA 4GRIA 3MD2A 4XN3A 5TGTA 3L2WA 2M3AA 1NG6A 3M1CA 4JQFA 3K4NA 3OYCA 4HNTA 4DBQA 3HOSA 3RSNA 2MD0A 5CQEA 2CS3A 1VZ0A 4PJJA 3LL7A 2WB1A 4XMYA 2X6XA 2PMZA 2Q1ZB 4RM3A 2VASA 2GOXB 2OV7A 2F4IA 2RREA 3NWTA 3L2UA 3ZR8X 2KRCA 2W00A 4B3XA 1T0FC 4KISA 1WJ5A 2R4GA 3LSIA 3K10A 1X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQR A;  4ZYA A; 
#chains in the Genus database with same CATH topology
 3TMO A;  3BZ6 A;  1K7A A;  3L1P A;  4OIO F;  5EF6 A;  3P5J A;  2EV5 A;  1E0E A;  4IF4 A;  1MGT A;  3CD6 I;  5LRS A;  2VUM J;  2DFI A;  3F6V A;  3WHC A;  5ICE A;  1Z0X A;  1JTX A;  3WE3 A;  2KIM A;  1T33 A;  3V4G A;  2M5W A;  3FM3 A;  2KRH A;  3CTA A;  3TGN A;  5BQT A;  1QHH D;  4A6D A;  1LE8 A;  2LBF B;  1LVA A;  1JKO C;  2X4H A;  3K2Z A;  2QQB A;  1R6R A;  4KIG A;  4Y3O A;  5E18 F;  3Q0U A;  1E3P A;  1ZGA A;  2X6Y A;  3HHG A;  5GTH C;  1DUX C;  2AHQ A;  2BY0 A;  4RMN A;  1UZC A;  2FRH A;  1A04 A;  2Z33 A;  1TW3 A;  4AYB A;  4BDY A;  1R1U A;  4HLY A;  4BXF A;  4XID A;  3F8N A;  1GXP A;  1XGN A;  3CCJ I;  2VBW A;  3KP2 A;  3CMY A;  3SHF A;  2JQ7 A;  3OYK A;  4XQF A;  1Q1V A;  3FHZ A;  2FUG 2;  3CF5 F;  2CQ7 A;  1XDS A;  3A02 A;  1GUU A;  3C2G A;  1X1P A;  2VPL A;  5LHG A;  3MAJ A;  5CVR A;  2Y31 A;  3DBH B;  3LA3 A;  5BOX A;  2V7F A;  3E3V A;  3ZQL A;  1XB4 A;  2ZFW A;  2C6Y A;  3HIF A;  5HLI A;  1DGW Y;  1HA8 A;  4JP0 A;  4ABZ A;  2WY8 Q;  1K79 A;  3R4K A;  3U1K A;  1V5E A;  3EYI A;  3COA C;  2KT0 A;  3ULQ B;  1ETX A;  2NVU B;  3IC7 A;  3K6G A;  5D8L B;  1OIS A;  2NVY J;  3CJT B;  3DEW A;  5J47 A;  1RUO A;  4OIQ F;  1GT0 C;  2ZXW H;  4V19 K;  4HRI A;  1MDM B;  1YG2 A;  2R7F A;  2KJC A;  5FLX Z;  3GTG J;  3PUB A;  1J09 A;  3CF2 A;  3VEP A;  4MQ9 F;  4A93 J;  1LDD A;  1SVL A;  4OU0 A;  2CYY A;  2HYF A;  3FK7 A;  4DQ2 A;  5K7F A;  1QBJ A;  4KFC A;  2XKP A;  2DJN A;  3K2A A;  2X51 A;  1KU3 A;  1P7J A;  1TWC J;  2QSG X;  4DJA A;  1U2W A;  2VIX A;  4JX6 A;  4DGW B;  3F8M A;  1UCR A;  5HS8 A;  4A3J J;  4XR6 A;  2CMP A;  4CSW A;  3HB9 A;  2K9M A;  4LG3 A;  1T39 A;  5IPA A;  2E1O A;  3S8P A;  1OR7 C;  3QP5 A;  3TO7 A;  3LNQ A;  4Q5S F;  3O8H A;  1N75 A;  2PN6 A;  4MHG A;  4BJ5 C;  2L9V A;  1IXR C;  4WWC A;  3CC2 I;  2YSR A;  1OYY A;  3PIO F;  3J81 K;  1REP C;  3VYR B;  3BCA A;  4G7O F;  3NWS A;  2NVX J;  1OCO H;  1H9T A;  2KIF A;  4ZYA A;  2VQG A;  2QQ8 A;  2ECC A;  3FBI B;  2O6G E;  2X1E A;  3HRU A;  1XS9 A;  1OCC H;  1FZP B;  1LDJ A;  1IW7 F;  4XLN F;  3I4M J;  4CCK A;  4HYE A;  2Y69 H;  1CF7 B;  1U5T C;  2B63 J;  2LMD A;  2EFW A;  2M34 A;  4WXD A;  1ZG3 A;  4H4K C;  4AVZ A;  4UHT A;  2IA1 A;  2YX4 A;  2WWY A;  5M3F J;  3S1M J;  1W5T A;  2LYC A;  1OMI A;  3OS0 A;  1SD5 A;  3I4N J;  2Q8K A;  1UHS A;  2DA3 A;  4EV0 A;  3TBI A;  1Z3Y A;  4M74 A;  3OYG A;  1BC7 C;  4XKW A;  4WX9 A;  2IA0 A;  5F1J A;  2BOL A;  2CFO A;  3K4K A;  2P5K A;  5TJJ A;  2NYX A;  3E5X A;  1ETV A;  3HOU J;  4YRV A;  2LF8 A;  2STT A;  4XKV A;  4OOI A;  3DWL E;  1OQY A;  2DK8 A;  3LSR A;  2H1K A;  4EJT A;  3OYH A;  1X3U A;  4OMY A;  1DDN A;  3A4C A;  3HL2 A;  1I50 J;  1S7O A;  5HDG A;  2VBY A;  4BJT A;  1R23 A;  2DA6 A;  2MA3 A;  2FD5 A;  3IWF A;  4CCN A;  1B72 B;  3AL0 C;  2LY2 A;  1T8I A;  2I10 A;  3K4C A;  4H0E A;  1BI0 A;  2FF4 A;  3KEY A;  3DLL F;  4UUS A;  4XK4 A;  4MLO A;  2XHK A;  4A0Y A;  2HOA A;  1EH6 A;  2X0L A;  2FX0 A;  1MJA A;  3DKW A;  1JTY A;  4YEJ A;  3MKW B;  4BQQ A;  2ICW G;  4ZDP A;  3WOD F;  5ERI A;  3ZMV A;  2H27 A;  2HTS A;  1DP7 P;  2DCE A;  1R49 A;  3CJN A;  2CRG A;  2L9N A;  3TL4 X;  2MGQ A;  5F08 A;  1KA8 A;  1S6L A;  1TC3 C;  1D1B A;  2JTV A;  1JT0 A;  2MBF A;  3RYR A;  2IA2 A;  4AC0 A;  5FLM J;  1OKR A;  1WJD A;  1WJF A;  1JGG A;  1FT9 A;  1JGS A;  2O7O A;  3WTZ A;  1IDY A;  3LAJ A;  2KHM A;  2ZME B;  2K4B A;  3H0G J;  2EPF A;  3TQN A;  3UKG A;  3M4O J;  2VKE A;  4BY7 J;  3QQA A;  5DDG A;  3DLA A;  5CYV A;  4E7J A;  1ON2 A;  5F64 A;  2M8E A;  3CO6 C;  3FM5 A;  1VQP I;  4F92 B;  2YS9 A;  5FRM A;  4PK4 A;  1K4S A;  1FSH A;  2CQK A;  2E1N A;  2EFQ A;  4IX7 A;  1LKX A;  3OY9 A;  1BW6 A;  2VT3 A;  3JSP A;  1JKQ C;  4A3F J;  2ID6 A;  3F9K A;  1LDK B;  1IRF A;  1MMS A;  3G1L A;  4RAY A;  1IN6 A;  2VJJ A;  4FAS D;  2ME6 A;  1RI7 A;  4IOA F;  3D5S C;  2ESH A;  2DK5 A;  3H5R A;  3HRT A;  3NQO A;  1S5L C;  4A3C J;  3GF2 A;  1XMK A;  1HST A;  5E3M A;  1RZ4 A;  3CP2 A;  2L01 A;  1QO0 D;  3SEZ A;  5JHF A;  4EJO A;  1VQO I;  1XSD A;  1PYV A;  2E19 A;  2HVS A;  3BG3 A;  5DUK A;  4IKF A;  1B9M A;  2VJ5 A;  1L0O C;  2VLA A;  4HV5 A;  1LFU P;  2MLG A;  1FBQ A;  2QCO A;  4NC6 A;  2DYR H;  2GLO A;  2O9L A;  4B47 A;  2VQL A;  3J7A O;  2LH9 A;  3MCZ A;  4BEH B;  4A2U A;  2BXZ A;  5FKN A;  1GLN A;  5KHD A;  4XLE A;  3S1Q J;  1RES A;  4MEX F;  1SFU A;  2OBP A;  5EGO A;  1F43 A;  5FFZ A;  1M1E B;  2X1C A;  4IXA A;  3GZ5 A;  4OWR B;  3KP4 A;  2GZW A;  2BV6 A;  2VN2 A;  2QEX I;  2ZJQ F;  2AQE A;  5ICG A;  1U9N A;  5BPI A;  4A12 A;  1BOB A;  2COB A;  1Z91 A;  1X3W B;  1T98 A;  2FNA A;  3CP8 A;  3TO6 A;  3ZN1 A;  2M30 A;  2EZI A;  1E3O C;  3E5U A;  3IL2 A;  4R8H A;  2DMT A;  1S9H A;  4ZYD A;  4BQA A;  4CZC A;  4NQW B;  1IO2 A;  3S1N J;  4GDF A;  4OIP F;  2FQ4 A;  5HVQ C;  4DNC A;  3OYD A;  5LD2 C;  3ZGK A;  1WZ2 A;  1RPW A;  3CUQ A;  2OZ6 A;  3CQZ J;  5LGT A;  4A3L J;  3A01 B;  3MKL A;  3DQV C;  2ZJP F;  4W97 A;  1S7A A;  1FOW A;  3HRM A;  4TV7 A;  1ETQ A;  2Z2S B;  4LIU A;  1I5Z A;  1U78 A;  1IXS B;  1Z3X A;  2Y0S N;  3DTE A;  1QQI A;  4FHT A;  3GW2 A;  1IN7 A;  3E6M A;  2VQC A;  1D1A A;  1QZE A;  1R5I D;  3VYU B;  3TOA A;  3W6J B;  3R60 A;  3S17 J;  3BTI A;  1IF1 A;  5DD4 A;  2Z9O A;  1LFP A;  5CVI A;  5ED4 A;  2RC4 A;  1UG2 A;  3S16 J;  4PSW A;  1SFO J;  4Z6Y A;  2ECB A;  2YPR A;  3ASO H;  3I58 A;  3I59 B;  1FOY A;  4I6Z A;  2ZXH A;  3OV8 A;  2TDX A;  4MNU A;  4M71 A;  1O4X A;  2KDO A;  5C4X J;  3ZP5 A;  1LFB A;  3PUF A;  3ABT A;  1G6N A;  2M2E A;  2EZK A;  4GO1 A;  2RVC A;  2CWE A;  2JA7 J;  1YS7 A;  3BZK A;  3K0L A;  2FE3 A;  2LFB A;  2XAH A;  3PFI A;  2BBY A;  2L4A A;  1G4D A;  2CUJ A;  2XRN A;  3C1D A;  2O03 A;  2L5Q A;  3LOC A;  4C9Y A;  5DCM B;  4XOP A;  1Y8R B;  4F7Z A;  2P5L C;  5B66 C;  3G2B A;  3M8E A;  3ONQ A;  1YJW I;  5CJ9 A;  3QYB A;  1J5Y A;  1H9G A;  2QZ8 A;  4NB5 A;  1JXS A;  3BJA A;  3MKY B;  1OCT C;  2IS6 A;  2CV1 A;  3GTP J;  3H35 A;  3RPU A;  2LRE A;  2PMZ N;  4L0Y B;  2DT7 B;  1FBU A;  3V7S A;  5M5X J;  3DU6 A;  3I71 A;  2EQR A;  2Q0O A;  3L09 A;  4XL9 A;  3JRC A;  4D1Q A;  2HVQ A;  5D5V B;  2GA1 A;  5E3L A;  1MBE A;  2WAQ A;  3KP6 A;  2Q2E A;  3OYE A;  2NNY A;  2M7B A;  3AG1 H;  3KZY A;  2DFF A;  2IGM A;  3CUO A;  5B5E C;  2R93 J;  3O8G A;  4IVN A;  5EYR A;  4L9N A;  3IKT A;  2VL8 A;  4BS9 A;  1QGP A;  4AU7 A;  1FEX A;  3O2P E;  1UST A;  2EB7 A;  4IRI A;  1T38 A;  3W6K B;  1JJ8 C;  2DYS H;  2GQQ A;  2R7Z J;  3S32 A;  2LP0 A;  1ERD A;  2HS5 A;  5J1Y A;  3BG6 A;  2XF6 A;  5DD8 A;  4D0P A;  2O0Y A;  3GBG A;  4M9S A;  5H6Q A;  3DF8 A;  3FZV A;  2IVM A;  3PL8 A;  5EZH A;  4GRI A;  3MD2 A;  3L2W A;  5TGT A;  2DA5 A;  2NS8 A;  4OIR F;  4ZYH A;  4AYB N;  3J80 Z;  3F3X A;  4DBQ A;  3ML6 A;  5F0H A;  5J1U A;  3HOS A;  1I39 A;  4A3I J;  4B09 A;  4N9H A;  2VAS A;  2GOX B;  1X3Z B;  2PMH A;  4ZYG A;  2L54 A;  2OTJ I;  2DA4 A;  4A3D J;  3NWT A;  1LB2 A;  2NAZ A;  5JLW A;  2W00 A;  4B3X A;  1GV5 A;  4X1E A;  2E71 A;  3GVA A;  3RDI A;  1IV8 A;  3K10 A;  1D5Y A;  5IYC J;  5HNF A;  2RKH A;  3PNT A;  3RTR A;  3SDB A;  2ZNY A;  1YIJ I;  2CW8 A;  2V9P A;  3HSE A;  3PQJ A;  4OAY A;  1UHM A;  2E5Z A;  1IN8 A;  2W25 A;  3CC4 I;  4UV9 A;  1ZKG A;  4GXO A;  1GV2 A;  3DXJ F;  1K6O A;  5KCM A;  2R5Z B;  1R22 A;  3DFG A;  1UG0 A;  4DZJ A;  2M7A A;  2E35 A;  1BBY A;  1B59 A;  1T95 A;  5EDN A;  3LQQ A;  4NUB A;  1ZR2 A;  1R4N B;  2EFN A;  1OCZ H;  2HKO A;  2ISZ A;  1HKQ A;  2JUC A;  2HDW A;  3RKX A;  1YE9 A;  4BBS J;  1XGS A;  1XGM A;  1IN4 A;  3JAM K;  3OYM A;  4KIC A;  4I2O A;  3TDU C;  3WTU C;  1BI3 A;  2DXI A;  3JRD A;  3TW7 A;  1N77 A;  3IHU A;  4ZTF A;  2FMY A;  2IGK A;  1FWZ A;  3BJ6 A;  2NOG A;  2JSP A;  3DBL B;  1W0U A;  4F55 A;  1G2H A;  1LEA A;  2DFH A;  3CCU I;  1H88 C;  4YFX F;  2M1B A;  4PJL A;  2JRM A;  4FE7 A;  3MZ8 A;  1EH7 A;  1XMA A;  1K78 A;  2HR3 A;  3FK6 A;  5LEJ A;  5F27 A;  5DCF A;  2Y0M A;  1G3T A;  1TWA J;  4C30 A;  1XDU A;  2DDB A;  4HBL A;  3RKW A;  3WTV C;  4AWX B;  4UV8 A;  4PGH A;  4RB3 C;  1MW7 A;  2WAF A;  2MLK A;  2P6T A;  5FKK A;  4CYD A;  1SVM A;  3T5X A;  4I7H A;  3ZPL A;  5C3E J;  1S72 I;  3FXJ A;  2ZB9 A;  3C7J A;  3VOE A;  4GYI A;  5F0C A;  3CO7 C;  2CGP A;  1TW2 A;  5DYM A;  1X4O A;  2DO7 A;  1VQ7 I;  2K9L A;  3FXR A;  2HU9 A;  2ZC2 A;  4V2F A;  4HDU A;  2CQX A;  1IUF A;  2PJR A;  2OAZ A;  2CUZ A;  3KLN A;  2QYO A;  3GLL A;  1BJZ A;  2JJ7 A;  3V7R A;  1U3E M;  2EV6 A;  5CVU A;  5FRN A;  1FYM A;  4PCQ A;  3KEO A;  2VJI A;  4A3K J;  1SAX A;  3VFZ A;  2QBY B;  2H6C A;  1UAA A;  3JRE A;  1BC8 C;  1BR1 A;  2DOF A;  1P4W A;  3HYI A;  3TP0 A;  1F1Z A;  3I54 A;  2UZK A;  1ZRE A;  2JA6 J;  1QRY A;  1W36 D;  2R7U A;  1T0F A;  3QU6 A;  2DPU A;  1VFC A;  5JVG F;  3I53 A;  1W1W E;  3I9V 2;  4RB1 A;  2ZME C;  3SYT A;  1MH4 A;  2JWT A;  3T8R A;  3EYY A;  1ZRD A;  4Q47 A;  4AIK A;  2BZT A;  2QKM B;  3OS1 A;  2XPW A;  2P81 A;  2R7Q A;  4IRH A;  3S3M A;  2OF7 A;  3DPT A;  4UVA A;  2ADU A;  2VON A;  1OYW A;  1A5J A;  2EZL A;  4N4O B;  1D8K A;  2VPR A;  1AU7 A;  5E79 C;  2KIU A;  3LST A;  3BWG A;  2A5Y B;  2Z99 A;  4GYG A;  2F5F A;  1VQM I;  1Y0U A;  1XGO A;  2BEO A;  2DN0 A;  1HF0 A;  3FDY A;  5KAF C;  2VB6 A;  3JCU C;  2R7S A;  2CG4 A;  1YW8 A;  2WA0 A;  3CLO A;  1U0J A;  2BE5 F;  1ENH A;  1YFH A;  2B7E A;  1MBG A;  1H0M A;  4RB2 C;  4BHB A;  1BIA A;  4XM3 A;  2K7L A;  3GZ6 A;  3G1O A;  1VI0 A;  4AVP A;  1K6Y A;  2A68 F;  3MQ0 A;  1FMW A;  2HFH A;  4OMZ A;  3BTJ A;  3GWZ A;  3G1M A;  4B3A A;  3FMQ A;  2ISY A;  3OWT A;  2JMW A;  2ZJ2 A;  3W2V A;  3O6B B;  1X2N A;  5BPD A;  2H6B A;  2W84 A;  3T0Y A;  3H9G A;  3JR9 A;  3CCM I;  1O3Q A;  2WC2 A;  5CPR B;  2FBI A;  4HG2 A;  4IHS A;  1X19 A;  4A69 C;  1YRN A;  2Z5U A;  2ZFU A;  1BI1 A;  3FF5 A;  2VKV A;  3SZT A;  2HWV A;  4JBA A;  5ICF A;  4E7H A;  3MMY B;  3HOT A;  3M07 A;  4KA4 A;  1ZYR F;  3RKQ A;  3ABL H;  3H92 A;  3KZI C;  3HKZ A;  1A36 A;  3QPS A;  3OYL A;  2AQF A;  4LJZ F;  3MZY A;  2LOO A;  1YO5 C;  5HLH A;  1YYV A;  2IAI A;  3CMM A;  3OR2 C;  3O3K A;  3KZZ A;  3JTG A;  4XRM A;  3KP5 A;  3HOW J;  2LKS A;  2R5Y B;  1ZRF A;  4HF0 A;  5IP9 J;  3IRQ A;  1B6A A;  1ZG1 A;  4JOM A;  2GM4 A;  2VKD A;  1FTT A;  1I1G A;  1RKT A;  1K61 A;  4FX0 A;  1EF4 A;  5HOD A;  4UUT A;  2PQ8 A;  4WK8 F;  4P9F A;  3MN2 A;  3QWL A;  1LJ9 A;  5AIP A;  2XF7 A;  5GAH J;  4UB8 C;  4ZC3 A;  2M45 A;  4F91 B;  2K27 A;  5J3L A;  4KT6 A;  1SFX A;  1UMQ A;  3C3W A;  1BOA A;  3HUG A;  4XSZ F;  1CQT A;  3QOP A;  1OR7 A;  3JRI A;  4Y15 A;  1AOY A;  3KFW X;  1SC7 A;  1D8J A;  3WU1 B;  5CLS A;  4DIQ A;  1ZN2 A;  3HSR A;  3B6C A;  2PFB A;  2A6T A;  3BR1 A;  2L02 A;  5FD5 A;  3WTT C;  5ILU A;  2ESN A;  1RIO H;  3HSF A;  3OYA A;  1D0Z A;  2DMN A;  3GTQ J;  4GFB A;  3BG7 A;  2HEO A;  2QVO A;  4IHV A;  3RI4 A;  2VE8 A;  1X1C A;  3DPL C;  5A2Q Z;  5D4R A;  1U5T A;  4HPQ A;  3CCY A;  4U7D A;  1A6I A;  3VOD A;  1ZTR A;  2PG4 A;  5C44 J;  4C3I J;  2HZD A;  2JPC A;  3BZC A;  4XOR A;  2O3F A;  3I5U A;  1YIT I;  2V6E A;  2JPB A;  4MTE A;  1ZEL A;  1XSV A;  2K5C A;  5FLX K;  2BW3 A;  2HYJ A;  2L0K A;  2LY1 A;  1PUF B;  2CU7 A;  3K4M A;  3PNY A;  3R0J A;  2BHY A;  4P96 A;  3CCQ I;  3LSH A;  4KIB A;  1SMT A;  1QNT A;  4YIF A;  4BGD A;  2GBY A;  1B8I B;  4WF2 A;  4X0G A;  3Q0W A;  3H5A A;  1TT0 A;  2HQN A;  3GLX A;  2XF5 A;  2IT0 A;  2EBI A;  1Z1D A;  2Z16 A;  5M5Y J;  1SD4 A;  4HST A;  3RYP A;  5K7H A;  2EV0 A;  4QWQ A;  1X1A A;  1KZH A;  1TZL A;  1HW1 A;  4A3G J;  2L2O A;  2XC7 A;  4IJA A;  5EG0 B;  3WGG A;  1MJB A;  5JHU A;  2XRL A;  1JHH A;  1ZQ3 P;  4AD9 A;  3AKZ A;  3HJE A;  2B0L A;  2W82 A;  1W36 C;  2H1L A;  4AIH A;  2W24 A;  1ULY A;  3P9I A;  1QPI A;  4HSR A;  3ROU A;  3J7A Y;  3BR6 A;  2NRA C;  4IHY A;  4LB6 B;  3HOV J;  1HCR A;  4I0A A;  3L2C A;  1ZR4 A;  4PFP A;  1VND A;  4E7S A;  2OTL I;  2IPQ X;  3ISP A;  3MVP A;  3K4B A;  3QAH A;  1SFE A;  2O5R A;  3VSK A;  4NBQ A;  1POG A;  4ZZL A;  3JSO A;  1ETK A;  3T1B A;  3E6C C;  2WAQ N;  2LDU A;  3BT9 A;  1JKR C;  4RAZ A;  2HGC A;  4CH7 A;  1YW7 A;  3HPG A;  2A07 F;  1MD0 A;  4XRS G;  2COM A;  3BQY A;  4HNV A;  1ZLJ A;  2R7X A;  4IOC F;  2FXA A;  3UR3 C;  1D0Y A;  4C2M J;  4HX7 A;  2A6H F;  4J00 A;  3FX3 A;  5E8G A;  4E6K G;  1WJC A;  2JUG A;  3GFL A;  2IEK A;  1RC9 A;  4BBR J;  4ENK A;  5GAE J;  2WTE A;  4UNO A;  1DQU A;  4KIF A;  5L3G A;  3BR0 A;  2STW A;  1P2F A;  2RN7 A;  1VQ6 I;  4A0Z A;  1TL8 A;  1H8A C;  2QQA A;  1FPQ A;  5HDN A;  2V79 A;  2A05 A;  1T6S A;  3OMY A;  4XLC A;  4N0B A;  2QM3 A;  2X6W A;  4II3 A;  3H9J A;  2VOO A;  3LAP A;  2L4M A;  2I5U A;  2QF7 A;  5E17 F;  4CIC A;  1MZB A;  1WVR A;  3TED A;  2HPI A;  4ZTJ A;  3PM1 A;  3GYH X;  2DTR A;  4S04 A;  4MFD A;  1E17 A;  1MMG A;  4ENJ A;  1PUE E;  4L9T A;  2OD5 A;  2BY2 A;  2JVH A;  5DUI A;  4XRF A;  2DTZ A;  3VYS B;  3ZMD A;  2V4J C;  4M9X A;  3F8B A;  1TQM A;  3VWB A;  1XMX A;  1LEB A;  3FIW A;  1WQ2 A;  1OLT A;  4LD5 A;  3OYB A;  2E2J J;  4Z2Y A;  3GUD A;  1W7P B;  2FSW A;  5J40 A;  1BR4 A;  2AO9 A;  2GXB A;  4E7K A;  1S8N A;  2H09 A;  3HHH A;  1MJ9 A;  2LR8 A;  2O8X A;  4PZJ A;  3TDZ C;  4A5M A;  3EUA A;  4D9J A;  2DT5 A;  3CC7 I;  3S14 J;  4CCJ A;  4CYC B;  3RQ4 A;  4EGZ A;  1T56 A;  2BY3 A;  2IW5 A;  1F4K A;  3GEZ A;  1X4P A;  4S0H B;  4L18 B;  4PDK A;  3QU3 A;  2E5N A;  3HOX J;  3C2B A;  1Z6R A;  2IS1 A;  1JUS A;  2HVR A;  2OCE A;  3B6A A;  4KNY A;  5AIQ A;  2XGC A;  1NG6 A;  4JK1 X;  4JQF A;  3K4N A;  2QUF A;  4HNT A;  4G9Y A;  4EJV A;  2LD5 A;  2BHZ A;  2Y30 A;  4BYY A;  4RGS A;  5EJC A;  1C0W A;  1Z7U A;  2MH9 A;  3G71 I;  4HLX A;  3ZQH A;  1LNW A;  3GXO A;  2WB1 A;  3LL7 A;  4XMY A;  2X6X A;  2E7W A;  1ITY A;  1IV6 A;  1I6H J;  3L2U A;  5BNG A;  3ECO A;  1Z6T A;  1W5C C;  4HV6 A;  3ZR8 X;  2Y75 A;  3VPR A;  1TQI A;  1X2M A;  1WJ5 A;  1ZG5 A;  1X1D A;  4L9V A;  4QTR A;  1AKH A;  3CCS I;  1XCV A;  4E4H A;  4LB5 A;  4LG0 A;  4KN7 X;  4Q48 A;  2QLZ A;  4Y52 J;  4NHJ A;  4HOB A;  3GFI A;  4E7Z A;  2I8D A;  4ASN A;  1OCP A;  4GGG A;  2FJ1 A;  1LE8 B;  5E1Z B;  3EPZ A;  1EV7 A;  1H89 C;  2VKH A;  1HC8 A;  5KVR A;  4DYR A;  4EM0 B;  1W4M A;  4AUX A;  3KEQ A;  4IZZ A;  3EUH C;  1LQ1 A;  3NAR A;  2YU9 J;  3HG9 A;  3DEU A;  3OR1 C;  2XRO A;  1I6X A;  2KIQ A;  5DS9 A;  3L2V A;  1WKM A;  2LBF A;  1OJL A;  4BUP A;  4S05 A;  1V5F A;  2DPD A;  5DTD A;  1Z21 A;  5GPA A;  1DP3 A;  4O3M A;  3H0D A;  2VXD A;  4BKX A;  2LG4 A;  1KON A;  2DI3 A;  3F0C A;  1HLV A;  4XN0 A;  2VBX A;  3L9F A;  5ILS A;  2PBI A;  1WJE A;  4IHX A;  2NVQ J;  4O6J A;  3GTM J;  2W1O A;  1BL0 A;  4KN4 X;  1Y1V J;  3RZO J;  2EWN A;  1YJ9 I;  2DMQ A;  2FEZ A;  4M72 A;  1T08 B;  1ZHF A;  3K9T A;  2FQ3 A;  2LSO A;  4I09 A;  2V1X A;  5KK1 A;  1RKW A;  4XLA A;  4AIJ A;  2ZXJ A;  3UNG C;  3M1E A;  1YJN I;  2ZNZ A;  3OOP A;  5E3O A;  3H36 A;  1MNE A;  5LRR A;  9ANT A;  2D1V A;  2WBM A;  3T8T A;  1ZLK A;  1G3W A;  4A3E J;  5JVT A;  4D7N A;  3BR2 A;  4LLL A;  2VE9 A;  3ZMU A;  2CV2 A;  4YII A;  1HOM A;  2O8K A;  4A0X A;  3GTL J;  3JRH A;  4MTD A;  1APL C;  1FP2 A;  3A1Y A;  3M8F A;  3QYE A;  1QVT A;  3MZH A;  2GA2 A;  4LLG F;  2LC2 A;  3HGG A;  4M3G A;  1MIJ A;  3HDD A;  2P4W A;  3M9A A;  1W7P D;  2G0E A;  3CMA I;  2RAE A;  4J19 A;  3IAM 2;  2HOT A;  3TOB A;  3ZMT A;  1MDM A;  3K69 A;  2IS2 A;  3HGY A;  5LGN A;  1WWX A;  4OAZ A;  3KYD B;  1PDN C;  1IC8 A;  5BMZ A;  2KMU A;  3AG4 H;  3HOZ J;  1LVK A;  4ENN A;  5HNH A;  5DM6 F;  3G4S I;  3KCC A;  4BXX J;  3DTK A;  1BR2 A;  1P6R A;  2X85 A;  3ABU A;  3LFK A;  4BHP A;  4B43 A;  2FNP A;  3D5R C;  4DZP A;  3P7N A;  2AXT C;  4LFU A;  3ZMS A;  3Q9S A;  2DLL A;  2BY1 A;  4G6D A;  3HKZ N;  5IYB J;  2LRD A;  3WTY C;  3KE2 A;  4ETS A;  4Y7N J;  4ENM A;  3HTS B;  2CW0 F;  2E36 A;  2UV1 A;  4OIN F;  5K5O A;  4FX4 A;  2K40 A;  4QPQ A;  1J9I A;  4G7Z F;  1TNS A;  2BYV E;  3ZRG A;  3AL0 B;  3KYC B;  2VQH A;  1B4A A;  1TNT A;  1IRG A;  3MEX A;  1KQ0 A;  1X1B A;  2H8W A;  1CF7 A;  4NC7 A;  1MMN A;  1ONV A;  2GIZ A;  1YI2 I;  1NTC A;  5D5X B;  3ZQG A;  3BG9 A;  3CES A;  4IHT A;  1D1C A;  2MFZ A;  3W2A A;  3BG5 A;  3J80 K;  1UJ8 A;  5D8K B;  4IQJ A;  2Y48 A;  2V9K A;  5FKL A;  1YQA A;  3SZP A;  2AS5 F;  3OSF A;  1FP1 D;  2UUZ A;  2M9H A;  3V8J A;  4NDL A;  3LMM A;  2IBD A;  4HQM A;  4ZDL A;  4CHU A;  2Z1D A;  4UUS B;  4L0Z B;  2D5V A;  1F36 A;  4BL0 B;  4BE1 A;  3K4L A;  1MBJ A;  4K2E A;  5EEH A;  1K83 J;  3KLO A;  4Y4R A;  3G3Z A;  1U8R A;  4I0B A;  2RV8 A;  1VQ5 I;  3FXQ A;  5IY5 H;  4BAY A;  3ZN0 A;  4AM3 A;  3W2W A;  1B72 A;  5JLX A;  2A3S A;  4A3B J;  1WH5 A;  3EDP A;  2NVT J;  3EUK L;  1DU0 A;  1YW9 A;  1SFK A;  2XAG A;  1KQ8 A;  4PGG A;  4XOT A;  1BW5 A;  5HLG A;  4B1R A;  4LGW A;  1UFM A;  1WCM J;  3ASN H;  2F48 A;  5K5R A;  3L00 A;  2YX7 A;  2N8G A;  3E6B A;  2JA8 J;  2M0M A;  3HOY J;  2OQR A;  2CJJ A;  2P7C B;  2R7D A;  3LFU A;  3QOD A;  3TW6 A;  4RGU A;  2JVG A;  4HNU A;  3J7Z I;  2WY7 Q;  4G12 A;  1MMD A;  3I55 I;  1GDT A;  2HDC A;  1ZGJ A;  2ID3 A;  4P55 A;  2HOS A;  3QRF F;  2FOW A;  2L7F P;  5D4S A;  1BJA A;  3L7W A;  1E3H A;  1AWC A;  3E0J B;  3J7Y J;  5F0F A;  2CV0 A;  2GXG A;  1P9Q C;  1EA3 A;  1TWH J;  1X58 A;  2ZME A;  1N25 A;  5E20 A;  2R7V A;  3I64 A;  4UB6 C;  4B48 A;  2IXS A;  3R61 A;  2TRT A;  1I3Q J;  2OU2 A;  5D5U B;  2EA2 A;  5IP6 A;  2H94 A;  4EJU A;  2KDZ A;  2JK3 A;  2IGO A;  5M3M J;  4CXF A;  3CZ6 A;  3LSJ A;  1TTY A;  2DOA A;  3D5L A;  3DTI A;  3U21 A;  3RZD J;  4UUV A;  5JI6 A;  2IRF G;  4CA0 A;  2ACJ A;  1PVE A;  4LIT A;  5FD6 A;  1YTY A;  4B4C A;  4HAM A;  4EAT A;  1U9O A;  2LTP A;  4CUG A;  1F9N A;  3VB2 A;  2DBB A;  3OYI A;  4ESF A;  1HQC A;  2VT2 A;  5K7Z A;  4BAC A;  2LLK A;  3CME I;  3LSP A;  2B9S A;  5KNL A;  1PP8 F;  4M3E A;  2G7H A;  1VQ4 I;  4Y33 A;  4ZDO A;  4U0V A;  4U88 A;  1XTA A;  3NRV A;  1XN7 A;  1J7K A;  1KQ9 A;  3W3C A;  4IO9 F;  1E2X A;  3BPV A;  2KZG A;  2TCT A;  2HXO A;  2Y2Z A;  3PFY A;  5IT9 Z;  1IZ1 A;  1Y6I A;  1NG7 A;  2D2W A;  2E1C A;  5GAG J;  5TIS C;  4BE0 A;  5EGO B;  3FMS A;  3CJQ B;  2VOP A;  1D0X A;  3QYF A;  3RCO A;  2PJP A;  1O7L A;  1FSE A;  1WHU A;  1EH8 A;  1YIO A;  4LMY A;  3S2D J;  1WI3 A;  2KPM A;  2QKL B;  5FKM A;  3PNV A;  2K02 A;  4ZH4 F;  2CUF A;  3ESW B;  4ON0 A;  4BEH A;  4A3M J;  1ZAR A;  1I3A A;  2F5D A;  1FYL A;  3X2Q H;  3WTS C;  2QQ9 A;  1P7I A;  2OA4 A;  1O57 A;  2HQ5 A;  3KPH A;  1MSE C;  3E7L A;  3Q5F A;  3MFK A;  3L2Q A;  4BHC A;  4BNC A;  2LF7 A;  1MND A;  4MGR A;  2R7W A;  1JT6 A;  3AG2 H;  3DKY A;  5DM7 F;  1V55 H;  2KJB A;  1JE8 A;  3CUQ B;  4ITV A;  3IH3 A;  3U9G A;  4LK0 F;  4XON A;  5HS9 A;  4HX8 A;  2MSY A;  2GXA A;  2OJE D;  4KYW A;  3WTX C;  4E70 A;  3ERE D;  2WV1 A;  4NQW A;  5GTI C;  1JHF A;  1G59 A;  4M6V A;  3M3Y J;  1UEL B;  3G6E I;  4G6T B;  4MEY F;  4JYK A;  4KDP A;  3PO3 J;  4QSH A;  4WXC A;  2ZKZ A;  2EIJ H;  3IH2 A;  1HBX G;  2ETH A;  3P9K A;  2XAF A;  1R5H A;  1J59 A;  3CDH A;  3A01 A;  5F04 A;  2X9D A;  1S7E A;  3GO5 A;  5J8C A;  1ZK8 A;  4BQO A;  4F3Q A;  3JRF A;  4PJ0 C;  3SEQ A;  3ZXS A;  5BS6 A;  3FIS A;  2MD5 A;  2R7R A;  4HW0 A;  4FQG A;  4KJZ A;  3OIQ A;  2WAE A;  3QPT A;  2ME0 A;  4XKB A;  3CDI A;  5IP7 J;  5L3C A;  1BIB A;  2RDP A;  5J4V A;  2VI6 A;  2XSJ C;  4II2 A;  1W0T A;  2JA2 A;  1XG1 A;  2DDA A;  1MBF A;  4WCG A;  2KP6 A;  4L5I A;  2CH0 A;  3I59 A;  2W85 A;  3H1C A;  4C2U A;  3LSG A;  3FXL A;  2XIG A;  1XCB A;  4PJM A;  2DW4 A;  2LVS A;  3K7A J;  1PP7 U;  4QLC U;  3N97 A;  1EJ9 A;  2VJ4 A;  3HTU A;  2X48 A;  3SZG A;  5AON A;  1JI8 A;  4ZYE A;  2M8G X;  2QSF X;  3E1S A;  2W4S A;  2Y9Z A;  1V54 H;  2Z3Y A;  3FXM A;  4LK1 F;  4R79 A;  2E1M B;  3L2R A;  3U2R A;  3SFZ A;  2A61 A;  4EEF G;  1TQP A;  4P9U A;  1CGP A;  3B73 A;  2L7Z A;  5DCM A;  1UB9 A;  3CCR I;  5E8I A;  4CCL A;  3FHN A;  2WB1 N;  3S1R J;  4C3J J;  4I98 B;  2P6S A;  3A2K A;  2M4K A;  2Q2E B;  2O61 A;  2M0C A;  1R36 A;  2K9S A;  4D5C A;  3J81 Z;  2GAU A;  1FOK A;  1VQ8 I;  2VXZ A;  2QWW A;  1Z7L A;  4ZZD A;  3DEE A;  4I99 C;  1STZ A;  4KMU X;  1J2X A;  3AAF A;  4RB0 A;  3TKY A;  1I1S A;  4DYQ A;  1SAN A;  2PX9 A;  4PJN A;  4HA8 A;  3P9C A;  3GTO J;  3ECH A;  3DKX A;  3A0H C;  3OL3 A;  2EH3 A;  2G7U A;  3ZMZ A;  1XX5 A;  1YX5 A;  3WGI A;  1P4A A;  2F5V A;  3GZN B;  3IUO A;  3Q3S A;  2CQQ A;  4PUS A;  2DJI A;  2YR2 A;  2R7O A;  2EZH A;  2EFO A;  3ZOB A;  1WPK A;  4XSX F;  4X6A J;  3ZQF A;  1Y1W J;  1R7J A;  3LQR A;  5K1Y A;  2BGC A;  1RET A;  1WJB A;  5FGM A;  4DOZ A;  2L9S A;  3EET A;  4YG2 F;  2Y9Y A;  2M3A A;  2MW8 A;  3HM5 A;  3RSN A;  4A5N A;  3F22 A;  5A2Q K;  2K4J A;  2YUS A;  2J5O A;  2MD0 A;  2VBZ A;  5CQE A;  1ZAO A;  5GPC A;  4YIR X;  2DQR A;  2KKO A;  2Q1Z B;  4I01 A;  1LUJ B;  5IT3 A;  4Q4Z F;  2WV0 A;  1G3S A;  4C3H J;  2OV7 A;  4LLN A;  2F4I A;  2XKO A;  5K5Q A;  2HOE A;  1V4R A;  3JTH A;  2LKX A;  3DV8 A;  4KIS A;  1FYK A;  2EIM H;  4IQ4 A;  4ESB A;  5J8F A;  2K85 A;  2JA5 J;  3ZQ7 A;  3H3V K;  2XB5 A;  2XGD A;  4MFE A;  1EKE A;  4HEA 2;  1MH3 A;  2OPT A;  2OCC H;  5LHI A;  1QVU A;  4M3F A;  4EQQ A;  4G8X A;  2RQQ A;  5EZG A;  1A6Q A;  3WG9 A;  1IAW A;  2HKX A;  2PEX A;  2K86 A;  3K1M A;  5H20 A;  2ELJ A;  1IUY A;  4U0Y A;  1K4T A;  4CO8 A;  3EQL F;  2OC6 A;  3FWE A;  3CDL A;  3BR5 A;  1IN5 A;  1Y8Q B;  2FU4 A;  2V26 A;  4RBO A;  4FCY A;  1R1T A;  2XVC A;  5D6F A;  2QGU A;  4J01 A;  1WFX A;  2KL4 A;  2R5Z A;  1OCR H;  3FXO A;  1VF9 A;  3CCV I;  2JT1 A;  3E97 A;  4RAG A;  1IDZ A;  2JN6 A;  2A69 F;  2XGE A;  3D0S A;  4L5J A;  1Y0N A;  3HC7 A;  4PFO A;  3PQK A;  3OL4 A;  2V1N A;  4ESJ A;  2NNN A;  3F21 A;  1O3T A;  1K78 B;  1SAU A;  4RAF A;  2R92 J;  1B9N A;  3OSG A;  2XGX A;  1HKS A;  4CDG A;  2XPV A;  4F52 A;  3TP3 A;  1YLF A;  2L9R A;  2NXN B;  4LIV A;  4M3D A;  3WE2 A;  5F6F A;  3BPX A;  3H5N A;  3WU0 A;  3H3Z A;  2E34 A;  3RPU D;  3FKJ A;  4E7I A;  1V5G A;  2QSH X;  3CJR B;  2IGN A;  4IHW A;  2F4M B;  2D1H A;  2DAO A;  1QZZ A;  3S15 J;  1D5V A;  1OPC A;  3HEF A;  2XB0 X;  3OIP A;  4RLF A;  3I56 I;  2XAJ A;  1NK2 P;  2P0W A;  2PJR B;  1KYZ A;  1YX3 A;  2ZBK A;  4RGR A;  3V42 A;  1MKM A;  2KLO A;  5LEK A;  3I0T A;  1USS A;  2ELH A;  3BQZ A;  5HOO A;  1MNM C;  1IXC A;  2DQL A;  4O5V A;  3WGH A;  1Z9C A;  4HF1 A;  3GFJ A;  1AHD P;  5J6X A;  1T2K A;  5ILV A;  1BM9 A;  3VSL A;  2FA5 A;  3Q0V A;  4E7L A;  4IPA A;  3W6V A;  3VDX A;  2L7M P;  1R00 A;  2RGV A;  2JSC A;  2W48 A;  2CW7 A;  1D3Y A;  4KIT B;  5E3N A;  1VQL I;  5DEQ A;  5FKO A;  5EEA A;  2H8R A;  3K1N A;  2QEN A;  3DPU A;  4DBR A;  1RUN A;  1UHW A;  1R71 A;  2QBY A;  2FML A;  2F4O B;  4BE2 A;  3S3O A;  2LK2 A;  4P1W A;  5D5W B;  4DW6 A;  4U0W A;  4EVI A;  5EEG A;  3IRR A;  3R6S A;  1DU6 A;  4R1H A;  3JRB A;  2MH2 A;  4Y17 A;  3IAS 2;  1FOX A;  2XSD C;  4XBF A;  2IS4 A;  1B1B A;  2HNH A;  3CLQ A;  5CKT A;  2EIN H;  5JFR A;  3GX4 X;  4W1U A;  1DPR A;  2KQR A;  2AXL A;  3ZQI A;  2VOD A;  4NC8 A;  1DPU A;  2X1D A;  2DOE A;  4NNJ A;  1MSF C;  3V7C A;  1J75 A;  4D5F A;  5B1B H;  2HQA A;  4RM2 A;  1FBS A;  1YOV B;  1ZH5 A;  3QPL A;  2JZY A;  2E60 A;  3OOU A;  3RKY A;  3EUH A;  4BQN A;  2GOM A;  3BRO A;  3C2H A;  3F8C A;  3RPQ A;  3U1D A;  2KIS A;  3DU5 A;  4CCM A;  2OZU A;  4V2G A;  1L3L A;  5IOY A;  1Z77 A;  2V6C A;  2XAS A;  4ZJZ A;  3KET A;  3FKI J;  4EGY A;  2DT6 A;  4B8X A;  2F5E A;  1KYW A;  2JRT A;  3FBN B;  3ERM A;  5L3D A;  2RNJ A;  2K3F A;  1ETO A;  1Z67 A;  2E2H J;  3BLY A;  1DGR M;  1HDD C;  5F1R A;  3HRS A;  1MMA A;  5E1X A;  2V1D A;  1BA5 A;  1HDP A;  4G94 A;  1TLH B;  3CCE I;  2K9N A;  4RDU A;  1YRN B;  3QOE A;  3ZQQ A;  4QIW N;  4YEL A;  1FLI A;  3IKV A;  5H6R A;  3BJO A;  3JRG A;  1NK3 P;  3REO A;  3F8F A;  1N78 A;  3F23 A;  3S2H J;  1R58 A;  2P8T A;  1JUP A;  1SMY F;  3IV5 A;  1J0R A;  2E2I J;  1FTZ A;  3QPH A;  4PSX A;  1SVO A;  1PJR A;  5B3S H;  3OIO A;  4XKC A;  2W7N A;  3GFM A;  5HDK A;  2ZJR F;  3MWM A;  1IJW C;  2CO5 A;  5B1A H;  5LFA A;  3LA7 A;  2GIV A;  2P7V B;  2RNG A;  3D1N I;  5TRD A;  1ODD A;  1WH7 A;  2CQN A;  3R0A A;  2EA4 A;  2E7X A;  1Y39 A;  5H2F C;  2PMU A;  5LHH A;  3S93 A;  1XC5 A;  2KRF A;  3E5Q A;  3KP3 A;  1YHQ I;  3CUQ C;  3I3L A;  3AFH A;  1A35 A;  4M6Y A;  1FX7 A;  4BXU A;  2UXX A;  3H9Q A;  3WG7 H;  3SFI A;  3RQI A;  2R5Y A;  4G7H F;  4N9I A;  1F5T A;  3SQN A;  3CCL I;  1R5G A;  2XAU A;  4MO7 A;  2QA4 I;  2XUB A;  1O7F A;  3HUG B;  4EJW A;  4EM1 A;  5CVJ A;  3K70 D;  5KAI C;  3A03 A;  1RR7 A;  5GAD J;  2DMP A;  4LOC A;  2HXI A;  2EJR A;  2KFD A;  2P5V A;  2NS0 A;  4XLH A;  3LSM A;  5J1R A;  5FRO A;  4WXH A;  1BI2 A;  3KIO A;  2F2E A;  3BCB A;  4F93 B;  1IG7 A;  3BOQ A;  1Y56 A;  4P5O A;  1GVJ A;  1VQ9 I;  1MBK A;  1QU3 A;  2NS7 A;  4B44 A;  2ZCW A;  4YFK F;  1RNL A;  1FNN A;  1WJA A;  2HTJ A;  4HF2 A;  2CFX A;  2X6O A;  3FXU A;  2YU3 A;  3K4J A;  2CUE A;  5CVV A;  3S2W A;  5E1W A;  2EIL H;  3NEU A;  2HI3 A;  1GXQ A;  2BXY A;  2DFE A;  2W57 A;  3M8J A;  1U5T B;  3ZCO A;  4XLF A;  2HQR A;  1JUM A;  3HBL A;  3N05 A;  2EFP A;  2A6E F;  3V8L A;  1OYI A;  2R3S A;  2V9V A;  3HXL A;  4U7B A;  5LLQ A;  4HX4 A;  2UWM A;  3ZQC A;  5LGU A;  3BY6 A;  4KUM A;  4M6X A;  1HW2 A;  3B02 A;  4KT5 C;  3DCF A;  4CGZ A;  1KU9 A;  1Z05 A;  1O3R A;  1FJL A;  2BW3 B;  5FJ8 J;  3GME A;  2E1M C;  3LA2 A;  2R0Q C;  5GP9 A;  2HYG D;  2VC1 A;  3BR3 A;  1G3Y A;  2FBH A;  1S3J A;  3M7G A;  1HSJ A;  4ANJ A;  4L9J A;  3LWF A;  4FTH A;  3A0B C;  4MQV A;  5FB2 A;  5HLT A;  3FXK A;  3F6O A;  2FOK A;  1ZGW A;  2IP2 A;  3KX2 A;  3HZJ A;  4XIC A;  2G9W A;  2LKP A;  3OYJ A;  4UVC A;  1MBH A;  3RJP A;  1PUF A;  1KU2 A;  1WGX A;  1KU7 A;  1QZY A;  1GHC A;  3BC8 A;  3OS2 A;  4RGX A;  2DMU A;  1FC3 A;  2OUM A;  1B8I A;  2GWR A;  4KMF A;  1JKP C;  4CCO A;  2MC4 A;  5IYD J;  3IWZ A;  2PLY A;  4FE4 A;  2MG4 A;  4EMS A;  3OYN A;  2PI0 A;  1FMV A;  1WI9 A;  1R9T J;  1ON1 A;  3OYF A;  1P4X A;  3ABK H;  5CQG A;  4A6E A;  2MAB A;  1KGS A;  3JAM Z;  1WSU A;  5D6E A;  1TT5 B;  3PIP F;  1S29 A;  2L7K A;  3WU2 C;  2HPM A;  5FFX A;  5EG0 A;  5IOZ A;  1SEU A;  1BN5 A;  1QHG A;  3Q9V A;  3QP6 A;  3G73 A;  1U8B A;  3AG3 H;  4M9Z A;  1P92 A;  3ABM H;  4IL6 C;  4G6Q A;  4EM2 A;  5J4Y A;  3N4M A;  4AID A;  2MC3 A;  3ELK A;  5LBQ A;  1HKT A;  5DV5 A;  1JJ6 C;  6PAX A;  3DP7 A;  2FBK A;  1FIA A;  2OQG A;  1G8X A;  3BDD A;  4DYC A;  4M73 A;  3KP7 A;  5L3E A;  3WTW C;  5L3B A;  5C4J J;  1VTN C;  1ORK A;  1NH3 A;  2A5W A;  1O3S A;  2EK5 A;  5ICC A;  3JW4 A;  4BDZ A;  4BH9 A;  3BTL A;  2D45 A;  1TBX A;  4D7M A;  4FET A;  2R7T A;  1NHA A;  3JRA A;  3RIR A;  4RA2 A;  4JX5 A;  3H3U A;  2VC0 A;  1ETW A;  4QPO A;  3GTK J;  4Y13 A;  4HZF A;  2ZSH B;  3LSK A;  4BJ6 C;  2XDV A;  4U87 A;  4UVB A;  4C2T A;  1GVD A;  2K9Q A;  3C18 A;  2F6C A;  1R1V A;  1W5S A;  2M87 A;  2KZV A;  1SD6 A;  3PSF A;  2V1U A;  3SJM A;  3PJR A;  3V8K A;  4RLQ A;  3IP4 B;  1YS6 A;  1HXD A;  2NOJ B;  2UXN A;  2F5C A;  3FMR A;  1XSX A;  4UY8 I;  1TWF J;  4N4N B;  3SXY A;  3GCM A;  5JR3 A;  2BVL A;  2ZXI A;  1VQN I;  4IEJ A;  2RQP A;  3KYL A;  4JX4 A;  4XNF A;  1SD7 A;  2EIK H;  1VQK I;  2Y0S A;  2K3P A;  4MIM A;  2ZSI B;  2WAD A;  2BVM A;  4FIS A;  1QA6 A;  2IJL A;  4FT8 A;  2DU9 A;  1I27 A;  2DA2 A;  3PSI A;  2HDD A;  1WRJ A;  3NAU A;  4XLP F;  1XPX A;  1A31 A;  1AA7 A;  2J5P A;  1W7P A;  1XD7 A;  3F72 A;  1IGN A;  4HDV A;  5HS7 A;  2M4G A;  2LY9 A;  4CZZ A;  1U6G A;  3PO2 J;  2MYS A;  3BTC A;  4RS8 A;  1IRX A;  1V3F A;  2XPU A;  1R4M B;  2LNB A;  4XRS A;  4I76 A;  2XAQ A;  4UXN A;  4BU2 A;  4CYC A;  1FY7 A;  3HPH A;  3VYT B;  3K70 C;  3S3N A;  4I02 A;  5FLV A;  1ETY A;  2DA1 A;  1Q1H A;  3MKZ A;  4L5E A;  5L3F A;  3DBR B;  2ZO4 A;  3GTJ J;  4XN3 A;  4YFN F;  3M1C A;  5M5W J;  3OYC A;  1TWG J;  1ACI A;  2HZT A;  3IH4 A;  3WHB A;  1QPM A;  1TP4 A;  2CS3 A;  1FIP A;  1VZ0 A;  4PJJ A;  3TO9 A;  1ZRC A;  2PMZ A;  3K1P A;  4RM3 A;  4BY1 J;  1OFC X;  1IRZ A;  4GCV A;  2L3D A;  4IRG A;  4HQE A;  2RRE A;  1RR8 C;  3BP8 A;  1RRJ A;  1HW5 A;  1AKH B;  2CSO A;  2KRC A;  2DOD A;  5FO5 A;  1T0F C;  3E6D A;  2ELK A;  3SDG A;  1LPQ A;  4LG0 B;  5IT9 K;  2R4G A;  2DA7 A;  3I4P A;  3LSI A;  2XV4 S;  4M3B A; 
#chains in the Genus database with same CATH homology
 3TMO A;  5HNF A;  1E0E A;  3PNT A;  3RTR A;  3SDB A;  4E4H A;  4HEA 2;  2CW8 A;  4E7Z A;  2I8D A;  4OAY A;  2E5Z A;  3EPZ A;  2RQQ A;  2VKH A;  2ELJ A;  2KRH A;  4IZZ A;  5KCM A;  1QHH D;  1UG0 A;  3EUH C;  2LBF B;  2M7A A;  2OC6 A;  3HG9 A;  1T95 A;  2V26 A;  3OR1 C;  1R6R A;  4NUB A;  4Y3O A;  4J01 A;  1WFX A;  2KL4 A;  2HDW A;  3L2V A;  2LBF A;  2X6Y A;  4BUP A;  1V5F A;  4RMN A;  1YE9 A;  1Z21 A;  1DP3 A;  3H0D A;  2VXD A;  2LG4 A;  4AYB A;  4BDY A;  3OYM A;  1KON A;  3HC7 A;  4PFO A;  3OL4 A;  4XN0 A;  2V1N A;  2DXI A;  4BXF A;  1N77 A;  1WJE A;  4ZTF A;  2IGK A;  1SAU A;  2JSP A;  4F55 A;  2W1O A;  4PJL A;  4F52 A;  3OYK A;  4XQF A;  2FUG 2;  4LIV A;  3H5N A;  4C30 A;  3C2G A;  2VPL A;  4XLA A;  3RPU D;  3FKJ A;  4E7I A;  1V5G A;  3CJR B;  2IGN A;  2V7F A;  3UNG C;  1MW7 A;  2WAF A;  1MNE A;  1DGW Y;  2WBM A;  1HA8 A;  3OIP A;  4RLF A;  2P0W A;  2CV2 A;  2PJR B;  2WY8 Q;  1YX3 A;  1V5E A;  3V42 A;  1X4O A;  2KLO A;  3A1Y A;  3QYE A;  2K9L A;  3K6G A;  2HU9 A;  5HOO A;  2PJR A;  2CUZ A;  4HRI A;  2LC2 A;  3VSL A;  5FRN A;  4E7L A;  3PUB A;  3VDX A;  1J09 A;  3CF2 A;  3IAM 2;  2VJI A;  2CW7 A;  4KIT B;  2IS2 A;  2X51 A;  4OAZ A;  1UAA A;  3DPU A;  4DBR A;  4DJA A;  2VIX A;  1BR1 A;  4DGW B;  4XR6 A;  2KMU A;  4BE2 A;  1LVK A;  2CMP A;  4LG3 A;  2K9M A;  4CSW A;  5HNH A;  3S3O A;  1W36 D;  4P1W A;  2R7U A;  3DTK A;  1BR2 A;  3S8P A;  3I9V 2;  1OR7 C;  2X85 A;  1N75 A;  4B43 A;  3D5R C;  3SYT A;  3IAS 2;  4BJ5 C;  2IS4 A;  2QKM B;  2HNH A;  3VYR B;  3OS1 A;  5CKT A;  2R7Q A;  3S3M A;  3BCA A;  3DPT A;  3NWS A;  2KQR A;  4NC8 A;  4ZYA A;  2X1D A;  2VQG A;  4N4O B;  4NNJ A;  3FBI B;  2LRD A;  2HQA A;  4RM2 A;  2X1E A;  2UV1 A;  3OOU A;  2E60 A;  4BQN A;  2GOM A;  3C2H A;  4CCK A;  4QPQ A;  3ZRG A;  3AL0 B;  3DU5 A;  4CCM A;  2VQH A;  3FDY A;  2VB6 A;  4H4K C;  4AVZ A;  2R7S A;  4ZJZ A;  2WA0 A;  1X1B A;  2LYC A;  1U0J A;  3OS0 A;  2DT6 A;  4NC7 A;  1MMN A;  4XM3 A;  3FBN B;  3TBI A;  1Z3Y A;  3OYG A;  3CES A;  1D1C A;  1K6Y A;  2MFZ A;  3BLY A;  4XKW A;  1DGR M;  1FMW A;  2BOL A;  2CFO A;  3K4K A;  3W2A A;  1MMA A;  4YRV A;  4IQJ A;  2V9K A;  3OWT A;  4XKV A;  3DWL E;  3W2V A;  3QOE A;  3ZQQ A;  4YEL A;  2UUZ A;  3OYH A;  3H9G A;  3LMM A;  4ZDL A;  3A4C A;  1N78 A;  3HL2 A;  5CPR B;  4HG2 A;  2Z1D A;  1X19 A;  4BJT A;  4BL0 B;  4BE1 A;  3K4L A;  2ZFU A;  4PSX A;  4CCN A;  3AL0 C;  2LY2 A;  3K4C A;  1PJR A;  4Y4R A;  4XKC A;  2W7N A;  4E7H A;  3KEY A;  3MMY B;  4MLO A;  3HOT A;  3HKZ A;  5LFA A;  3W2W A;  3OYL A;  4YEJ A;  2AQF A;  3MKW B;  4BQQ A;  2RNG A;  2LOO A;  4ZDP A;  3EUK L;  3CMM A;  3OR2 C;  1SFK A;  2DCE A;  3S93 A;  2L9N A;  4XOT A;  3TL4 X;  3I3L A;  3AFH A;  4JOM A;  2VKD A;  1D1B A;  3H9Q A;  2M0M A;  3LFU A;  2XAU A;  3QOD A;  4HNU A;  2JVG A;  2WY7 Q;  1MMD A;  1WJD A;  1WJF A;  2XF7 A;  3HUG B;  3K70 D;  4ZC3 A;  2KHM A;  4F91 B;  4KT6 A;  3E0J B;  3DLA A;  4XLH A;  3LSM A;  5FRO A;  4E7J A;  2CV0 A;  1P9Q C;  1EA3 A;  3BCB A;  4F93 B;  2R7V A;  4F92 B;  1Y56 A;  4P5O A;  5FRM A;  4PK4 A;  4DIQ A;  1QU3 A;  4B44 A;  4B48 A;  2IXS A;  4IX7 A;  1LKX A;  3OY9 A;  2A6T A;  1WJA A;  2IGO A;  3CZ6 A;  3U21 A;  2DOA A;  3D5L A;  3DTI A;  3K4J A;  3F9K A;  3OYA A;  1LDK B;  4CA0 A;  4LIT A;  2VJJ A;  3M8J A;  3ZCO A;  4FAS D;  4XLF A;  1D0Z A;  4EAT A;  3D5S C;  3N05 A;  3BG7 A;  3H5R A;  4CUG A;  1X1C A;  3HXL A;  4U7B A;  3DPL C;  3OYI A;  3CP2 A;  4BAC A;  4HPQ A;  2UWM A;  5KNL A;  3SEZ A;  5JHF A;  1PYV A;  2HVS A;  4Y33 A;  4ZDO A;  4IKF A;  2VJ5 A;  2VLA A;  2BW3 B;  4IQ4 A;  3W3C A;  2HZD A;  2E1M C;  4XOR A;  3PFY A;  2V6E A;  1Y6I A;  1NG7 A;  1ZEL A;  4B47 A;  2K5C A;  2VQL A;  4BE0 A;  3CJQ B;  2BW3 A;  1D0X A;  3QYF A;  3RCO A;  2LH9 A;  2LY1 A;  4BEH B;  4ANJ A;  1GLN A;  3K4M A;  3PNY A;  5HLT A;  5KHD A;  4XLE A;  3KX2 A;  2KPM A;  3LSH A;  2QKL B;  3PNV A;  4BGD A;  3OYJ A;  4X0G A;  4BEH A;  2X1C A;  3H5A A;  1TT0 A;  4OWR B;  2XF5 A;  3BC8 A;  3OS2 A;  2AQE A;  2Z16 A;  2OUM A;  1BOB A;  4HST A;  4CCO A;  2MC4 A;  3L2Q A;  1X1A A;  3CP8 A;  1TZL A;  1MND A;  2R7W A;  3OYN A;  2L2O A;  1FMV A;  3DKY A;  2XC7 A;  1S9H A;  3OYF A;  4CZC A;  4ITV A;  4NQW B;  2MAB A;  5CQG A;  4XON A;  2L7K A;  3AKZ A;  2HPM A;  5HVQ C;  3OYD A;  5LD2 C;  2W82 A;  3ZGK A;  1QHG A;  1W36 C;  1G59 A;  4HSR A;  3J7A Y;  1UEL B;  3DQV C;  4G6T B;  2Z2S B;  4LIU A;  4PFP A;  4E7S A;  1Z3X A;  3K4B A;  3DTE A;  4BQO A;  4F3Q A;  2O5R A;  2VQC A;  1D1A A;  3VSK A;  3SEQ A;  3VYU B;  3ZXS A;  2R7R A;  1G8X A;  1LFP A;  4KJZ A;  3OIQ A;  2WAE A;  4XKB A;  4PSW A;  4CH7 A;  3HPG A;  2XSJ C;  4II2 A;  2ZXH A;  2JA2 A;  2A5W A;  4BDZ A;  2R7X A;  3UR3 C;  1D0Y A;  2R7T A;  4FET A;  2KDO A;  2KP6 A;  4J00 A;  4E6K G;  2CH0 A;  1WJC A;  2JUG A;  4C2U A;  4QPO A;  3LSG A;  2ZSH B;  1DQU A;  4PJM A;  3LSK A;  4BJ6 C;  2XDV A;  4U87 A;  4C2T A;  2VJ4 A;  3SZG A;  1JI8 A;  2F6C A;  3E1S A;  2W4S A;  2CUJ A;  4XLC A;  2L5Q A;  3OMY A;  2KZV A;  4C9Y A;  3PSF A;  4XOP A;  3PJR A;  4R79 A;  4RLQ A;  3G2B A;  2X6W A;  4II3 A;  3ONQ A;  2E1M B;  3L2R A;  3H9J A;  3QYB A;  3IP4 B;  2NOJ B;  3MKY B;  2IS6 A;  4N4N B;  2CV1 A;  2HPI A;  3H35 A;  2BVL A;  2ZXI A;  4ZTJ A;  2LRE A;  4CCL A;  3FHN A;  3KYL A;  3A2K A;  4XNF A;  2DT7 B;  2M4K A;  2Q2E B;  1MMG A;  2JVH A;  3DU6 A;  2Y0S A;  4XL9 A;  2K3P A;  2ZSI B;  2WAD A;  3VYS B;  4D1Q A;  2HVQ A;  2BVM A;  2V4J C;  2WAQ A;  2VXZ A;  3OYE A;  3VWB A;  1Z7L A;  2M7B A;  2IGM A;  1OLT A;  3DEE A;  3OYB A;  1BR4 A;  4PJN A;  3PSI A;  4E7K A;  2VL8 A;  3DKX A;  4BS9 A;  4AU7 A;  3OL3 A;  1AA7 A;  1YX5 A;  2F5V A;  3EUA A;  4D9J A;  3IUO A;  2M4G A;  4CCJ A;  4PUS A;  3RQ4 A;  2MYS A;  2DJI A;  3S32 A;  2R7O A;  1IRX A;  1ERD A;  1X4P A;  3BG6 A;  2XF6 A;  2E5N A;  3GBG A;  4BU2 A;  3S3N A;  3HPH A;  3VYT B;  3K70 C;  2IS1 A;  2HVR A;  1WJB A;  3PL8 A;  4DOZ A;  2L9S A;  3MKZ A;  4GRI A;  3MD2 A;  4XN3 A;  5TGT A;  3L2W A;  2M3A A;  1NG6 A;  3M1C A;  4JQF A;  3K4N A;  3OYC A;  4HNT A;  4DBQ A;  3HOS A;  3RSN A;  2MD0 A;  5CQE A;  2CS3 A;  1VZ0 A;  4PJJ A;  3LL7 A;  2WB1 A;  4XMY A;  2X6X A;  2PMZ A;  2Q1Z B;  4RM3 A;  2VAS A;  2GOX B;  2OV7 A;  2F4I A;  2RRE A;  3NWT A;  3L2U A;  3ZR8 X;  2KRC A;  2W00 A;  4B3X A;  1T0F C;  4KIS A;  1WJ5 A;  2R4G A;  3LSI A;  3K10 A;  1X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...