3Q5FA

Crystal structure of the salmonella transcriptional regulator slya in complex with dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcriptional regulator slyA
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
total genus 48
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q5fA00
2HEOA 1X3UA 2DQLA 4KIFA 3T0YA 5K5RA 1W4MA 4HF0A 5L3DA 2KKOA 2X4HA 1IRFA 3FMSA 4HAMA 1D8JA 2XAHA 3GZ6A 1GXQA 3I59A 2VBYA 4WCGA 1SMTA 2GZWA 5CVIA 2ZNYA 2IRFG 5DYMA 3RKYA 3WTZA 4MGRA 3T1BA 3IRRA 2IVMA 2HR3A 2O8XA 2P4WA 4OMZA 2Q2EA 1D5VA 3ABTA 3ZN0A 2A6EF 4WXHA 1IN8A 3ELKA 2KIFA 1S6LA 4Q47A 2RKHA 2MLGA 1TW3A 3LAPA 3R60A 4EM0B 1YW8A 3DP7A 4NB5A 2F5FA 5CVUA 1MDMB 4KUMA 4PZJA 2D2WA 2LKPA 1R36A 2RV8A 3D5LA 1GXPA 3W6KB 3KP2A 4N9HA 5HS7A 1U5TA 4HX8A 4ASNA 3E97A 1SMYF 2IW5A 2TDXA 5LGTA 1QZYA 4OIOF 2WTEA 3LWFA 4R79A 3RKWA 4XLPF 3RYPA 1J75A 1R1TA 5HS8A 2STWA 3KZZA 3HSEA 1FT9A 1IN4A 2YX7A 1R5GA 4EJWA 2OQRA 1YW9A 3CUOA 2P7VB 3O3KA 4IHTA 2FNAA 4LJZF 2BE5F 4FX0A 3ROUA 3RKXA 2O3FA 1S29A 5BPDA 3GFJA 1YS7A 4M9ZA 2MBFA 3TDUC 3I71A 4YG2F 4HF1A 2A3SA 3TOBA 5CVJA 4YIFA 4KN4X 5A2QK 5CVRA 3REOA 3ABUA 2FA5A 3FHZA 1FX7A 1YW7A 4RGUA 1ODDA 5JVTA 3HRMA 1XCVA 1J5YA 2GA2A 1MD0A 1LDKB 4KICA 3TDZC 3K0LA 1EH8A 4F7ZA 1BJAA 1XD7A 3KFWX 1B6AA 3DEUA 4RGRA 4E70A 5E20A 3K1PA 1Z6RA 3BP8A 4HYEA 3TKYA 2O61A 2NNYA 2H27A 3PFIA 4FX4A 2KJCA 4Q48A 3VOEA 5A2QZ 2VE8A 1U8RA 1QBJA 1O3TA 4P55A 4CDGA 5L3EA 4MEXF 3R0AA 3KEQA 1S7AA 5D8KB 4I02A 3F72A 4P9UA 1J9IA 4LGWA 1KU2A 5HDGA 5LHHA 2DFIA 2QYOA 3H92A 1SFEA 3CUQA 3ZMTA 1TTYA 4CHUA 1QO0D 4IHSA 4ZZLA 3KZYA 2H09A 1HW2A 4RAZA 4MHGA 1Z6TA 3O2PE 4Z2YA 2KJBA 2W84A 4PGGA 5DUKA 1W7PA 4P96A 1MJAA 4PCQA 3TO7A 1SD5A 2L02A 3RIRA 1XGNA 4JQFA 3V8JA 4S04A 2OQGA 5CYVA 2CG4A 2JPBA 4M9XA 3LQQA 5HS9A 1Y0UA 1MJBA 4G6QA 1IAWA 4HV6A 4PGHA 4L9VA 4IPAA 3E6CC 1ULYA 2Z33A 1QGPA 2PBIA 4KIGA 3K69A 5ICGA 5F1RA 5F6FA 4EGZA 2MLKA 5DCMA 3IL2A 3KEOA 1OYWA 2W25A 3GUDA 4NHJA 3KE2A 1I6XA 5H6QA 1RI7A 3HOSA 4LB6B 4HA8A 4AIKA 5FD5A 5K5OA 1SD7A 2P5VA 4O5VA 1HQCA 1R5HA 1R23A 3SXYA 2OD5A 1I1GA 5LEKA 3WTXC 5L3CA 1LVAA 4HOBA 2XKOA 1ZLJA 1FSHA 3ZMZA 2O6GE 2M30A 4G7HF 1P6RA 1J0RA 3LA7A 1P92A 1W5SA 2VODA 1LDJA 2OZUA 2KRFA 2HYFA 2HFHA 2JTVA 4EJUA 2EFNA 4KMUX 4LLLA 2J5OA 1V4RA 4HBLA 4A0XA 3MCZA 1ZRCA 4ZYGA 1DDNA 3TQNA 3R6SA 3JAMK 1OKRA 3KETA 3E6BA 3BROA 2DQRA 2CGPA 1IF1A 4AVPA 3WE2A 3MZHA 2QBYA 1R22A 3PQKA 4UVCA 1QZZA 4BHPA 5K1YA 2FF4A 2VT3A 2E1CA 1LQ1A 2MC3A 4M74A 3J7AO 2V6CA 2M45A 2V79A 5BPIA 5ERIA 2B0LA 1PDNC 2EK5A 2NRAC 4AIHA 4EJOA 4BHBA 5AIQA 1IXRC 2Y75A 2ZMEB 3JAMZ 1RIOH 2Z3YA 2EV0A 3F8MA 1LDDA 3NRVA 1IW7F 4MTEA 1L3LA 4IVNA 1JHHA 3I0TA 4AIJA 2EV5A 4UHTA 1USTA 1QNTA 2KIUA 1LB2A 3I5UA 2ZFWA 4Y13A 2XAFA 1UB9A 1PUEE 1G3YA 1YG2A 1D3YA 5FLXK 1FBSA 3CO6C 4HW0A 4UNOA 3E3VA 2W57A 1JHFA 1BC8C 3WTTC 2ZXJA 3LQRA 4MNUA 5BQTA 3ECHA 5AONA 4A2UA 5E8GA 5IT9Z 1DUXC 4N9IA 3F8CA 2XV4S 5JI6A 4OOIA 5FLXZ 3V8LA 3MFKA 1UHWA 1RUNA 4LFUA 4HX4A 2XRNA 4GYIA 4R1HA 4ESBA 2AS5F 1FC3A 5DD8A 2G7HA 1UHMA 2BV6A 3BDDA 2JZYA 4FHTA 3FMRA 1FY7A 2QENA 1BOAA 4ZYEA 1B9NA 1P4WA 2K27A 4HDUA 2IJLA 2FXAA 2IA1A 3WGGA 4ZZDA 3R4KA 1MDMA 4L0YB 1XSDA 5D6FA 1XB4A 2XIGA 4CXFA 4R8HA 3C7JA 1SFXA 5H20A 4IRGA 2L3DA 2E1NA 1CF7B 3N4MA 3WTSC 1Z7UA 3GFMA 5LRRA 2HS5A 2PN6A 4ETSA 2BEOA 3ML6A 1P2FA 2PI0A 4KNYA 1OYIA 1ON1A 1YLFA 1YTYA 3QP6A 2GXBA 5LBQA 2RNJA 2EB7A 4H0EA 1R7JA 3TOAA 1ZYRF 3QU6A 1XCBA 3LSTA 2K86A 2J5PA 4HZFA 2DBBA 2HDCA 1T98A 3J80K 3DXJF 3I54A 1BC7C 2VBZA 3DPTA 1MGTA 5FFZA 1I27A 4A0ZA 3HRTA 3ZPLA 1FZPB 1DPUA 1ZREA 3JSPA 1HSTA 4IRIA 1OMIA 1KU3A 4HDVA 3BOQA 3KCCA 4XRFA 2FBKA 2QWWA 3WE3A 4G7OF 3SZPA 2ESNA 5FB2A 3F6VA 2OBPA 4XSZF 3DKWA 5ICEA 2UXNA 2CO5A 2FBIA 1WKMA 3IC7A 3J80Z 1BI3A 2ZJ2A 3CO7C 3HTUA 2UXXA 2BYVE 1MKMA 2OU2A 2WV0A 2EJRA 4KFCA 2WC2A 1C0WA 3PQJA 4MQ9F 1I5ZA 3ZN1A 4P9FA 4ZH4F 2HQRA 1IXSB 4HX7A 1PP8F 2QVOA 4HF2A 5EEHA 2ZCWA 1OR7A 3HYIA 2DPUA 2PLYA 2NNNA 4TV7A 3P9CA 2FNPA 4M6XA 4DQ2A 2LF8A 5ED4A 4UVBA 5ICFA 4RGXA 3L2CA 4MQVA 4Y15A 1XGSA 3HIFA 4YFNF 1FPQA 4FT8A 1TW2A 3L9FA 3P7NA 3FF5A 4XBFA 2MH2A 2VOPA 1ZGJA 1GHCA 2O03A 2HZTA 5KVRA 5JFRA 4S05A 1FWZA 3JSOA 3QRFF 3ZMSA 1R1VA 4IJAA 1B4AA 1G6NA 3M1EA 1BI0A 3BZ6A 3QP5A 4G7ZF 1U5TB 3HHHA 4I2OA 3L09A 2DTRA 1O7LA 1T39A 2M87A 4I0BA 4AD9A 3O6BB 4Y17A 2VBXA 2HTJA 2Y48A 5FD6A 3V8KA 3K1MA 3JW4A 3LA2A 2EWNA 1U6GA 4O3MA 3RPQA 2AXLA 4U0WA 1EH7A 1ZH5A 2GQQA 3HOTA 3MWMA 1LJ9A 3HHGA 2BGCA 2DPDA 2P8TA 2VT2A 2Y0MA 2ZNZA 4M73A 4GYGA 3ISPA 1IRGA 4L9NA 2IA0A 4ON0A 1QPMA 4HV5A 1TNSA 2K4BA 2MH9A 2Q8KA 4G6DA 5FFXA 2CYYA 4A12A 2OZ6A 1H9GA 1ZGAA 1KQ8A 3V4GA 2A6HF 1J2XA 2ISZA 3F8FA 2XUBA 3D0SA 2F5EA 3WTYC 1SAXA 5E1WA 4PDKA 1HKQA 5AIPA 4XSXF 1FYKA 1L0OC 5L3BA 3BJ6A 1XMKA 1FLIA 4LD5A 2M5WA 2ADUA 5TRDA 4OIQF 3T5XA 2FRHA 2IA2A 2Q0OA 2ZMEA 4A5NA 5LHGA 5ILSA 3CUQB 4L5JA 1LEBA 4A6EA 3FXQA 5E1XA 5E17F 2F5DA 2VOOA 3GVAA 5E8IA 3WTWC 5JR3A 3IWZA 3T8RA 4LLNA 4L0ZB 4U0YA 1REPC 5HLIA 2Z99A 1G3WA 2LDUA 5DUIA 1HSJA 2QM3A 3EUHA 4OINF 2YX4A 5TJJA 3RDIA 2V9VA 3QOPA 3HSRA 4DNCA 4GXOA 4CGZA 1Z05A 2G9WA 1S3JA 5BOXA 1P4XA 2W85A 5HVQC 4LG0B 5IT3A 2HQNA 4IXAA 1G4DA 3B73A 1OYYA 3VODA 1S8NA 2JPCA 2XAGA 4WWCA 2A69F 3LA3A 3MAJA 4KDPA 4RB3C 1ZRFA 1K6OA 4BH9A 1F4KA 1W7PD 1WSUA 1BN5A 1RUOA 4IF4A 4I0AA 4RB0A 2Z9OA 3CDHA 1BI2A 2IT0A 3U9GA 1SFUA 3WU0A 4ENMA 2M8EA 1HKSA 4WXDA 4EM1A 2EV6A 2ZO4A 1D8KA 4BHCA 1FNNA 4UV9A 2A5YB 2EFPA 3GFIA 2K7LA 3HRUA 2RC4A 3WG9A 2QUFA 3IHUA 5DCFA 3MEXA 2ELHA 1O3RA 1SD4A 3KP6A 4U0VA 1YFHA 2OAZA 3J81K 2ISYA 1RNLA 5LHIA 5LEJA 1HBXG 3I4PA 1MJ9A 1CF7A 2L01A 1JE8A 3DV8A 2R7DA 3Q5FA 1J7KA 5HLHA 2PQ8A 5D8LB 1O7FA 3EYIA 1XGOA 5FGMA 2KIMA 3WGIA 3JTGA 3OOPA 4I01A 3V7SA 2DK8A 4KA4A 4U7DA 4MEYF 4O6JA 5FO5A 1QQIA 1BM9A 3J81Z 1Z9CA 4LB5A 1FBUA 5J8FA 5K5QA 2HWVA 1FSEA 1W5TA 1O3QA 5DD4A 2GAUA 3WTUC 4UUVA 3HSFA 5H6RA 5HDKA 2UWMA 1Z91A 3M8EA 1E17A 1USSA 2P5LC 5L3FA 4ESFA 1WQ2A 2CWEA 1XGMA 2COMA 3ZQ7A 1NHAA 1K78B 5JHUA 2K02A 2YSRA 2PMUA 2H6BA 3CJNA 4EJVA 3RPUA 3TO6A 2F5CA 1IN6A 4A0YA 3IWFA 3QAHA 5DDGA 3C3WA 1IZ1A 1TQPA 3KP4A 5D5UB 2GWRA 3KP3A 1F5TA 2PJPA 3K2ZA 3GO5A 1U5TC 4EMSA 2DO7A 4OIPF 4LMYA 2XHKA 2L4AA 3ZP5A 4EVIA 2IP2A 4EV0A 5DV5A 2QQBA 3IKTA 1O3SA 1Z1DA 2YR2A 2OA4A 2EFWA 3N97A 2STTA 2ETHA 4K2EA 3RJPA 2V1XA 1HW1A 2LSOA 1KQ9A 1ZHFA 1HXDA 5F64A 1KA8A 2VE9A 4LK1F 4EM2A 2XGXA 1CGPA 4GGGA 3GYHX 2E7WA 3G3ZA 3F22A 1KGSA 4BNCA 2P5KA 4HQEA 2E7XA 2K4JA 3CLOA 1R00A 5HDNA 1U3EM 2FU4A 3ERED 2HTSA 1YQAA 4RGSA 3K9TA 1ZG5A 4L9TA 4ENNA 1XDUA 5EEGA 1WI9A 1ON2A 2O0YA 2QQ9A 2M1BA 3BY6A 3EQLF 1KQ0A 1S7OA 3RYRA 4RS8A 4M9SA 4I09A 1TQIA 5LGNA 5ILVA 5HLGA 3EETA 2FQ3A 3FXUA 1FBQA 2FMLA 2DI3A 1GVJA 2LNBA 4I98B 4QLCU 1EH6A 3ZMDA 1ZN2A 2NS0A 4BQAA 2YPRA 3FMQA 3I59B 2EFQA 4JBAA 1BIBA 2HYGD 3CUQC 4QWQA 1F9NA 3IKVA 2QQAA 2QZ8A 1ZARA 1XN7A 3COAC 1TQMA 3CTAA 3NQOA 3ECOA 4ENJA 1BBYA 1JXSA 3GLXA 1T6SA 4UXNA 5ILUA 1LNWA 2V1DA 3KP7A 2DK5A 3BPXA 2JSCA 3KP5A 3VEPA 4CICA 2P7CB 3F6OA 5LGUA 4UVAA 2FSWA 3KLOA 1DPRA 3T8TA 4YFKF 1K79A 3DFGA 2W24A 1SD6A 4EGYA 3ZMVA 3SFZA 1ONVA 4OIRF 2C6YA 3U1DA 4A5MA 1OPCA 3V7RA 2EA2A 2H6CA 4RAYA 1R1UA 4M6YA 1IN7A 2DAOA 3ZMUA 1STZA 4WXCA 4BAYA 4XLNF 5E18F 3U2RA 4ZYDA 3W6JB 1R58A 1AOYA 2XVCA 5D5XB 3E5XA 2D1VA 2X0LA 1K7AA 2HKOA 3HUGA 3L7WA 4U88A 3GF2A 1PP7U 3F8BA 1YS6A 3LAJA 2JT1A 2P6TA 2JRTA 1J59A 3OV8A 4OMYA 3I58A 5CVVA 2D45A 1I1SA 2YU3A 3TO9A 4JK1X 3WODF 3EDPA 1H9TA 5CJ9A 3E6MA 3P9KA 1A04A 4G94A 2V1UA 1HKTA 1IUYA 3S2WA 2BBYA 2VONA 4LK0F 4Q4ZF 4KYWA 1FYLA 3AAFA 3I53A 4HLXA 1IN5A 4KIBA 4BYYA 4M72A 3GX4X 2RGVA 2NYXA 4HLYA 1KYZA 2CQKA 4I7HA 2P6SA 3NEUA 2D1HA 1U2WA 3C1DA 3RI4A 2ZBKA 1XSVA 3L00A 4GO1A 1B59A 2G7UA 3R61A 2VBWA 1FP1D 2HGCA 1ZRDA 1MZBA 3GXOA 3GWZA 2A61A 5LLQA 3GZ5A 3WGHA 3QPHA 2DU9A 4CYDA 4LG0A 1WWXA 3C18A 3FWEA 2RQPA 3WU1B 5LRSA 3HRSA 3H3UA 1YIOA 1TNTA 4L18B 3RTRA 4UV8A 3LFKA 4U7BA 1P4AA 4B8XA 3FM3A 3DPLC 5D5VB 3Q9SA 3E5UA 2HKXA 4KT5C 4CO8A 3MQ0A 1T38A 4IRHA 1W7PB 4EJTA 2R7FA 5HOOA 2ESHA 3Q9VA 2L4MA 3GFLA 1B1BA 4GCVA 5CLSA 4G9YA 1FOKA 5D5WB 1KU9A 4N0BA 5J8CA 2DW4A 3BPVA 1V3FA 2CFXA 2EA4A 2XROA 3E5QA 1ZG3A 3DF8A 2FOKA 1B9MA 1BI1A 3EYYA 1TLHB 3WTVC 1T2KA 3BWGA 3V7CA 2FEZA 2CW0F 3DQVC 5DCMB 2GXGA 2XASA 3P9IA 1JGSA 2UZKA 4HQMA 4YFXF 1KYWA 4OU0A 3MZYA 2FBHA 2HOEA 3VFZA 5ICCA 2XKPA 2H94A 2R3SA 2GA1A 1XDSA 3M8FA 3GW2A 5D4SA 4WK8F 4ENKA 3R0JA 4BXUA 1WRJA 4CZZA 3GEZA 2PFBA 2EFOA 4L9JA 1BIAA 4YIIA 1XSXA 1YO5C 1RZ4A 3G73A 2LF7A 1ZG1A 4M71A 3FZVA 2MD5A 2ACJA 2NAZA 2IPQX 2A68F 3KLNA 2XAQA 1K78A 1IXCA 4A6DA 2RN7A 2WWYA 5IT9K 5L3GA 1FYMA 3BJAA 1FP2A 3SHFA 1TBXA 4WX9A 4D0PA 2DLLA 2Z5UA 3SQNA 2QLZA 2RVCA 3I64A 2DT5A 3TGNA 4RB2C 3F8NA 1VTNC 1ZAOA 2QBYB 4MTDA 1H0MA 2VXZA 1XMAA 5KK1A 2MA3A 2FMYA 3M9AA 3H3ZA 3K1NA 1YYVA 1G3TA 4P5OA 4NQWA 3ULQB 4L5IA 5DEQA 3BJOA 2FE3A 2PEXA 3HTSB 4KN7X 2CSOA 1LEAA 3F23A 5D6EA 3FM5A 3FX3A 2VC0A 1T0FA 1F1ZA 2A07F 3IRQA 4RB1A 4ESJA 4Q5SF 3QPTA 4AWXB 1UFMA 3E6DA 1E2XA 1O57A 4ZYHA 5D4RA 1HW5A 2GIVA 3F21A 2ZKZA 3F3XA 6PAXA 5BS6A 1U78A 1ZLKA 3VB2A 1Q1HA 5J6XA 2VN2A 1KU7A 2RDPA 4LLGF 1EV7A 3FXRA 3JTHA 4G8XA 4KMFA 2F2EA 5E1ZB 1AWCA 1UCRA 3M7GA 3QU3A 4WF2A 2PMHA 1G3SA 1DP7P 2VC1A 4EQQA 4B09A 5BMZA 2PG4A 3B02A 2L54A 2XAJA 3SZTA
chains in the Genus database with same CATH superfamily
1VQ9I 2HEOA 2CV1A 4B48A 1JKRC 4AM3A 1X3UA 2DQLA 2MD0A 4KIFA 3T0YA 5K5RA 1W4MA 2CS3A 4HF0A 5L3DA 4FE7A 1TWFJ 2KKOA 2X4HA 2X6OA 1UG2A 1IRFA 3OSFA 2VJ5A 3FMSA 2BZTA 4HAMA 5DTDA 1D8JA 2ECBA 2KFDA 2XAHA 1QHGA 2KISA 3GZ6A 5B3SH 1GXQA 3I59A 2VBYA 4WCGA 4RBOA 1SMTA 3AG1H 2LH9A 4W1UA 4BS9A 2GZWA 5CVIA 2DMUA 2ZNYA 4IO9F 2B63J 2IRFG 1R71A 5DYMA 3OYGA 4XONA 3JRIA 3RKYA 4F92B 2H1LA 3WTZA 4MGRA 2YU9J 2RQQA 1OCCH 3T1BA 4BGDA 3IRRA 3JRCA 4LIUA 3Q0WA 1RRJA 2IVMA 1JJ6C 1Y8QB 2HR3A 2O8XA 2P4WA 4OMZA 2Q2EA 4PUSA 1D5VA 1X19A 3ABTA 3ZN0A 4BDZA 2A6EF 4A3LJ 3DKXA 4WXHA 3VYRB 4AYBN 1IN8A 3ELKA 1WCMJ 2KIFA 1GDTA 1S6LA 4Q47A 1I3AA 2RKHA 1DU0A 2MLGA 1TW3A 3FXMA 2QGUA 3LAPA 3R60A 4EM0B 1YW8A 3HBLA 3DP7A 4B4CA 4X1EA 4NB5A 2OV7A 2F5FA 1HCRA 5CVUA 1MDMB 4KUMA 3DEWA 4PZJA 2CJJA 2D2WA 2LKPA 1R36A 2RV8A 2V26A 3D5LA 1M1EB 1GXPA 3W6KB 4Y7NJ 1WFXA 3KP2A 4N9HA 5HS7A 5C4XJ 3MVPA 3TW7A 1U5TA 2W4SA 4HX8A 4ASNA 3E97A 4DYRA 1SMYF 2IW5A 1Q1VA 2TDXA 2EH3A 2DTZA 5LGTA 1QZYA 5K7ZA 1HLVA 4OIOF 2WTEA 3LWFA 4R79A 3SJMA 4XQFA 3RKWA 4XLPF 1D1AA 3RYPA 4ZDLA 1J75A 1R1TA 4J01A 4BEHB 5HS8A 2STWA 3KZZA 2BHYA 2LBFA 3HSEA 3OYMA 1FT9A 1IN4A 2YX7A 1R5GA 4EJWA 2IS2A 3QYBA 2OQRA 1YW9A 3OS2A 3CUOA 2ID6A 2P7VB 3O3KA 4LITA 4IHTA 1LUJB 1MNMC 3S2DJ 2FNAA 4LJZF 4HNVA 4E6KG 2BE5F 3LSIA 4FX0A 2KDZA 3OIOA 3QYFA 3ROUA 3RKXA 1NK2P 3BG5A 1X1BA 3BTCA 2O3FA 1S29A 5BPDA 4Y52J 3CJRB 2BOLA 2VJ4A 3SFIA 1WJFA 3GFJA 2QSGX 1YS7A 2CQXA 1HOMA 2F6CA 4M9ZA 1Z0XA 2MBFA 3TDUC 3I71A 4YG2F 2DDAA 4HF1A 2A3SA 3TOBA 4HSTA 2R0QC 2IGNA 1LVKA 5CVJA 4YIFA 1X3WB 4F55A 4KN4X 5A2QK 2BY0A 1SVOA 5CVRA 5M3MJ 4E7KA 3REOA 3W6VA 3ABUA 3OYFA 2FA5A 3FHZA 1LFUP 2XDVA 1FX7A 1YW7A 2KPMA 3ZQGA 1BL0A 4RGUA 1ODDA 5JVTA 3HRMA 4PJLA 1XCVA 1J5YA 2GA2A 3RPUD 3GCMA 1MD0A 2LG4A 2LKSA 1LDKB 4KICA 3TDZC 4YIRX 3K0LA 2ZXHA 1EH8A 4D7NA 4F7ZA 1BJAA 1XD7A 3KFWX 4BU2A 1B6AA 3H9GA 5EZHA 4ZDPA 3LSJA 3DEUA 4RGRA 2I10A 4XLCA 4E70A 4IOAF 3VDXA 5E20A 1AHDP 1OFCX 3K1PA 1Z6RA 3BP8A 4HYEA 3TKYA 2O61A 2NNYA 2LREA 2TCTA 4A3JJ 1ENHA 2M4KA 1FIPA 1XS9A 3PFIA 2H27A 2DYRH 2KJCA 4FX4A 4Q48A 3VOEA 5A2QZ 1IC8A 2VE8A 1U8RA 1QBJA 1O3TA 4C2UA 4P55A 3DU5A 4CDGA 1D1CA 5L3EA 4MEXF 3R0AA 3KEQA 1S7AA 4XIDA 5D8KB 4I02A 1XC5A 1QRYA 4FQGA 3F72A 4P9UA 1J9IA 4LGWA 5EYRA 4GRIA 3ZQHA 1R4MB 1KU2A 5HDGA 4KJZA 5LHHA 2HZDA 3CMEI 4XLEA 1IJWC 1UMQA 2DFIA 2QYOA 3H92A 3M3YJ 3NAUA 1SFEA 3CUQA 3ZMTA 3CDIA 2HDWA 1TTYA 2K9SA 1QO0D 4CHUA 4IHSA 1G2HA 3FK7A 2B9SA 2CQNA 4RM2A 1H89C 5FRNA 4ZZLA 3JRBA 3OYDA 3KZYA 3S2HJ 2H09A 2E2JJ 1HW2A 4RAZA 3BCAA 4ANJA 4MHGA 1Z6TA 5J47A 2KP6A 2WV1A 3O2PE 4Z2YA 2KJBA 2W84A 4PGGA 4AC0A 4A3MJ 2LTPA 5DUKA 1W7PA 4P96A 2O7OA 1MJAA 5GAHJ 4PCQA 3TO7A 1SD5A 3AG4H 4RLQA 2L02A 3S1RJ 1PYVA 2VKVA 5M5YJ 3OMYA 3DCFA 4M3GA 2KRHA 1GLNA 3RIRA 3VPRA 1XGNA 2HVRA 2E2HJ 4JQFA 3V8JA 2BY3A 2OQGA 3C2BA 3BQYA 4S04A 3GTQJ 5CYVA 2CG4A 2JPBA 3PFYA 3LQQA 4M9XA 5HS9A 1Y0UA 2NOJB 1MJBA 4G6QA 3CCJI 1IAWA 4HV6A 4PGHA 1OISA 1X1DA 4L9VA 4IPAA 3E6CC 1ULYA 3BR3A 2Z33A 4PJNA 3BTJA 1QGPA 2IEKA 3S3NA 4RMNA 1PJRA 3C2GA 2PBIA 4KIGA 3L2VA 4PSWA 3K69A 5ICGA 1EKEA 5F1RA 4OAYA 3WHBA 2CRGA 5F6FA 2NVYJ 4EGZA 2MLKA 1YX5A 2L7FP 1E3HA 3J7AY 3I4NJ 5DCMA 3IL2A 2K9QA 3KEOA 1OYWA 4A3CJ 2W25A 1Z3XA 2WB1N 2QEXI 3GUDA 2EZHA 4NHJA 3KE2A 2EBIA 1I6XA 3E0JB 4ZJZA 5H6QA 1SAUA 1RI7A 3HOSA 4LB6B 3ABMH 4HA8A 3QQAA 4Y33A 3DLLF 4AIKA 5FD5A 5K5OA 1SD7A 2P5VA 4QSHA 2QA4I 2HQAA 4O5VA 1WI3A 2EIKH 2R7RA 3CCLI 4RLFA 2WA0A 4G12A 4BE2A 1HQCA 2IS1A 5E79C 3TP0A 4D5CA 1R5HA 1R23A 2DT7B 3H5NA 3SXYA 2NVQJ 4X0GA 2OD5A 3HEFA 2Q1ZB 5LD2C 1I1GA 5LEKA 3WTXC 2JN6A 2K9NA 5L3CA 1LVAA 3QYEA 4HOBA 2XKOA 1ZLJA 3I56I 1FSHA 3ZMZA 2O6GE 2M30A 4G7HF 4BQOA 1P6RA 3VSLA 4NUBA 1J0RA 3S17J 1V54H 5F0HA 1A35A 3LA7A 2X6XA 2X9DA 3UKGA 1IDYA 2JA7J 1P92A 1W5SA 2VODA 4BJ6C 3FBNB 3CCMI 3HG9A 1LDJA 5CPRB 2ZXIA 1HDPA 1R5ID 2L9SA 2OZUA 2DN0A 2KRFA 1LKXA 1HA8A 3BR2A 2HYFA 2DFEA 2HFHA 2JTVA 5GAEJ 1JUPA 3BLYA 1BR4A 4EJUA 2EFNA 4KMUX 4LLLA 3CLQA 4PJMA 2IS6A 2J5OA 2YUSA 1HDDC 1V4RA 3AFHA 3PJRA 1WJCA 4HBLA 4A0XA 3MCZA 1ZRCA 4A3GJ 4ZYGA 1DDNA 3TQNA 3R6SA 3A1YA 3JAMK 5H2FC 2W48A 1OKRA 3KETA 3E6BA 3BROA 2VIXA 5IY5H 1U9NA 2DQRA 2CGPA 1IF1A 4AVPA 3WE2A 3ZQFA 4HEA2 3MZHA 2QBYA 1AU7A 3MKLA 2WB1A 1R22A 2CQQA 2KMUA 1WJAA 3PQKA 4UVCA 1HF0A 1QZZA 4BHPA 5DS9A 5K1YA 3OS0A 1SFOJ 2FF4A 2VT3A 2R92J 2E1CA 1LQ1A 2MC3A 2F4OB 4M74A 4ABZA 4G6TB 1LFPA 2W82A 3ZXSA 2R7ZJ 3J7AO 1A36A 3OR2C 2V6CA 1MMNA 2M45A 2V79A 2XB0X 5BPIA 1FTTA 5ERIA 2B0LA 3DBLB 1SEUA 1A6QA 1PDNC 2EK5A 4UUSB 2NRAC 4AIHA 4EJOA 4BHBA 4IKFA 5AIQA 2EPFA 4C3IJ 4KISA 1IXRC 2Y75A 4XLHA 2MG4A 1E3PA 2L2OA 3NWTA 3O8HA 2ZMEB 3BG3A 3JAMZ 1NH3A 1RIOH 2R4GA 1Y56A 2ELJA 1MSFC 4EEFG 1XPXA 2Z3YA 4UB8C 2EV0A 2Y69H 2JA2A 3F8MA 1LDDA 3DU6A 3NRVA 1IW7F 2DA5A 2HNHA 2L9NA 4MTEA 1L3LA 3LFUA 4XM3A 4IVNA 2AQEA 1JHHA 3O8GA 5JHFA 3I0TA 4AIJA 2EV5A 4UHTA 1USTA 1QNTA 3BZCA 3OYJA 3GTGJ 2KIUA 1LB2A 2CQ7A 4C3HJ 1K6YA 3I5UA 3MKWB 3HL2A 1CQTA 4XKCA 1W36C 2ZFWA 2CW7A 4Y13A 2XAFA 4HRIA 2R7UA 1ZTRA 1UB9A 2L5QA 1PUEE 3FXLA 3S8PA 1UELB 1G3YA 1OJLA 1YG2A 1D3YA 5FLXK 3AL0B 4II2A 1FBSA 2IGKA 3CO6C 5IYDJ 4HW0A 3N05A 4UNOA 3E3VA 3FXOA 2W57A 1K4TA 1JHFA 4FTHA 2F48A 1BC8C 3WTTC 3ABKH 2ZXJA 3LQRA 4MNUA 3ASOH 3F0CA 5BQTA 3CJQB 5FKNA 3ECHA 5AONA 1VNDA 4A2UA 1X2MA 3NARA 4LG3A 5E8GA 5IT9Z 5EGOB 1DUXC 3KPHA 2M4GA 4N9IA 3F8CA 4E7HA 2XV4S 3Q0VA 5JI6A 1FOWA 4OOIA 2KDOA 5FLXZ 3CCRI 1EA3A 3V8LA 3K2AA 4CYCA 3MFKA 1QZEA 1UHWA 1RUNA 4LFUA 5IP7J 3IAS2 4B3AA 3OYKA 3S1QJ 3S1MJ 4HX4A 2XRNA 4GYIA 2ZJPF 4R1HA 4ESBA 2AS5F 2GM4A 4CA0A 3HOZJ 5IOYA 1UHSA 1FC3A 1U8BA 5DD8A 3CP2A 1IRXA 2G7HA 3PO3J 1UHMA 2BV6A 3BDDA 2JZYA 4FHTA 2DMTA 4C3JJ 3VYUB 2IS4A 3FMRA 2BW3B 2M0MA 1FY7A 2QENA 1XX5A 3L2WA 2VKEA 1VI0A 4UY8I 1LFBA 3QPLA 1BOAA 3NWSA 1V5GA 3CCVI 4ZYEA 1D0ZA 1B9NA 1P4WA 5BNGA 2K27A 1N75A 3H3VK 1APLC 4HDUA 1PUFB 2IJLA 2HVSA 3H0DA 2JA6J 2FXAA 3AG2H 3OIQA 3S93A 2IA1A 3GMEA 3WGGA 4ZZDA 3PIOF 3R4KA 1YHQI 1MDMA 4L0YB 1XSDA 2OTJI 5D6FA 2M3AA 1XB4A 2XIGA 4CXFA 2H8RA 1ZGWA 4R8HA 2FJ1A 1XMXA 2KZGA 4I99C 1T95A 3C7JA 1MBJA 1MBHA 1SFXA 5H20A 4IRGA 2L3DA 4BY1J 2LVSA 2VJJA 3S14J 3S15J 2E1NA 5EF6A 1CF7B 2QQ8A 2BY1A 3OYHA 3X2QH 3WTSC 3N4MA 1X1AA 1WJ5A 2HI3A 1Z7UA 2R7QA 1VFCA 1Z77A 2EINH 3GFMA 2DFHA 2FOWA 3SYTA 3P5JA 5LRRA 2G0EA 2HS5A 2PN6A 2VQHA 1G59A 4H4KC 4ETSA 2BEOA 3ML6A 4XRSG 3M1CA 2HXIA 2H8WA 1P2FA 2PI0A 1T8IA 4KNYA 2TRTA 5FKLA 1OYIA 1ON1A 4CSWA 3OL3A 3A02A 1YLFA 1YTYA 3QP6A 2GXBA 5LBQA 3OYLA 2RNJA 2EB7A 1MBEA 3A4CA 4H0EA 1YRNB 1R7JA 2HU9A 2R7VA 1GV2A 1LPQA 3TOAA 1ZYRF 4PSXA 3PUBA 3CC2I 5F27A 4PFPA 3QU6A 1XCBA 1OR7C 1QVUA 3LSTA 2CH0A 2K86A 2J5PA 4HZFA 2DBBA 3ZQCA 2HDCA 1T98A 2VI6A 2GOXB 2XSJC 4RM3A 4E7ZA 2VJIA 3J80K 4IOCF 3DXJF 4M6VA 3I54A 4I76A 1BC7C 2VBZA 3DPTA 1MGTA 2E5ZA 5FFZA 2BXZA 2CFOA 1I27A 4A0ZA 2R5YA 1TWCJ 3K10A 3HRTA 2NVXJ 3ZPLA 2GBYA 1FZPB 1DPUA 1ZREA 2Y30A 3CP8A 3JSPA 3JRAA 1U0JA 1OCPA 5LFAA 1HSTA 1OCRH 2PMZN 1YE9A 4IRIA 3OWTA 1OMIA 1KU3A 3OYCA 4HDVA 3UNGC 3BOQA 3KCCA 4XRFA 2FBKA 2QWWA 5K7HA 3WE3A 4G7OF 3SZPA 1RR7A 2ESNA 5FB2A 3F6VA 2NS8A 2COBA 3TEDA 2OBPA 4XSZF 3DKWA 2NS7A 5ICEA 2UXNA 2CO5A 1DQUA 3L2QA 5M3FJ 4BDYA 3WU2C 3K4CA 2A6TA 2AO9A 2FBIA 1WKMA 3IC7A 3J80Z 1BI3A 1JT6A 1XTAA 2ZJ2A 4DJAA 1A31A 3CO7C 1DGRM 3HTUA 4BXXJ 2UXXA 2BYVE 1V5EA 2DJNA 1MKMA 2CUFA 2OU2A 2WV0A 3LSHA 4PJ0C 4DBRA 5JVGF 5GTIC 2EJRA 4KFCA 2ZJRF 3ASNH 2WC2A 3PUFA 1C0WA 2NOGA 3K4MA 3PQJA 5GP9A 2BHZA 4ZDOA 4MQ9F 1I5ZA 5EJCA 3ZN1A 4P9FA 4ZH4F 2EIJH 1MW7A 2HQRA 1IXSB 3H35A 4HX7A 1PP8F 1EJ9A 3DPUA 2QVOA 4HNTA 3H1CA 1FEXA 4HF2A 5EEHA 1AA7A 2ZCWA 1OR7A 3HYIA 3IV5A 2DPUA 2PLYA 2VB6A 2NNNA 4V2FA 3PNYA 3G4SI 5F08A 4TV7A 3P9CA 2FNPA 2QSFX 2A5WA 3TP3A 4M6XA 4DQ2A 3OY9A 2JUGA 3I4MJ 2Y0SA 4V19K 2LF8A 3LSRA 2E19A 2HVQA 4Y3OA 3HOUJ 2F5VA 2AXTC 3DBRB 5ED4A 4UVBA 4DOZA 5ICFA 3G1MA 4BACA 3S3MA 4RGXA 3L2CA 5M5XJ 2M7BA 5IYCJ 4BQQA 4MQVA 4Y15A 1WPKA 1XGSA 3HIFA 4YFNF 2H1KA 1FPQA 4FT8A 1TW2A 2PMZA 3L9FA 4A93J 3P7NA 4CCNA 2K9MA 3FF5A 4U87A 2JVGA 3SDGA 3K7AJ 1IGNA 2X48A 3QODA 2NXNB 5F0CA 2W00A 4XBFA 1NG7A 2MH2A 2VOPA 1ZGJA 4AU7A 2BVLA 2O03A 1GHCA 2HZTA 3K4BA 4NDLA 5KVRA 2XGCA 5JFRA 4B47A 1MBFA 3LSMA 3IH2A 4S05A 1FWZA 3GBGA 3JSOA 1FJLA 3L2UA 3LSPA 4N4NB 3QRFF 3CC4I 3QWLA 4KITB 2DMQA 3ZMSA 4BBSJ 1R1VA 1MSEC 4IJAA 1B4AA 1G6NA 4CCLA 1D0XA 3M1EA 2M9HA 3UR3C 1BI0A 3BZ6A 3QP5A 2VPLA 1WVRA 1TL8A 2ECCA 4G7ZF 1U5TB 3HHHA 1JUMA 1B8IB 4I2OA 5FKKA 1IUFA 3J7YJ 3L09A 2DODA 2DTRA 1O7LA 1T39A 1RR8C 2M87A 4I0BA 4AD9A 3O6BB 4Y17A 2VBXA 4I6ZA 2XPUA 2HTJA 4E7IA 1JKOC 2Y48A 4F3QA 2ZSHB 3V8KA 5FD6A 5CKTA 5J4VA 3IAM2 2QKMB 3K1MA 3JW4A 3LA2A 2EWNA 1U6GA 1TWHJ 4O3MA 3RPQA 3FHNA 2CMPA 2AXLA 5J1YA 2JA8J 4U0WA 4IHYA 2ZMEC 5M5WJ 1EH7A 1ZH5A 2R7OA 2GQQA 3BCBA 4BE1A 1NG6A 1N78A 3L1PA 3HOTA 3MWMA 2OCEA 1LJ9A 3HHGA 2BGCA 3HOVJ 2XGEA 2LOOA 2DPDA 2P8TA 2VT2A 1FIAA 2Y0MA 2OJED 2ZNZA 4JYKA 4M73A 1F43A 4GYGA 2DCEA 3ISPA 4BJ5C 1G8XA 1IRGA 1E0EA 3A0HC 4L9NA 2IA0A 4ON0A 1QPMA 1ZQ3P 3Q3SA 3PSIA 4HV5A 4D1QA 1QPIA 1TNSA 2K4BA 2MH9A 4XKBA 4A3IJ 1WJBA 2VLAA 1W0UA 2Q8KA 2DYSH 1X3ZB 2JWTA 4G6DA 5FFXA 2KZVA 2CYYA 1D5YA 1Y0NA 3DBHB 4A12A 2OZ6A 1H9GA 3AL0C 2ZXWH 4DW6A 1ZGAA 3CC7I 1KQ8A 3EUHC 3J7ZI 3DEEA 2X1DA 3V4GA 4A69C 3BTLA 1R6RA 2A6HF 1J2XA 3M07A 1Y8RB 2ISZA 3CESA 2ELKA 2WAFA 3MMYB 3F8FA 3TL4X 3G1OA 2NVTJ 2XUBA 3D0SA 2F5EA 3WTYC 3PNTA 3BR1A 1RC9A 1SAXA 2XB5A 5E1WA 4PDKA 2L7MP 3D5RC 3CCUI 1HKQA 5AIPA 4XSXF 1FYKA 1L0OC 5L3BA 3BJ6A 3BTIA 1TWAJ 2LRDA 2F4IA 4RA2A 3KZIC 1UJ8A 1A5JA 1XMKA 1TC3C 1QVTA 1FLIA 4LD5A 2E35A 2M5WA 4V2GA 3BG6A 2ADUA 5TRDA 4IHWA 4OIQF 3FKJA 3BQZA 3T5XA 5HNHA 3U21A 2MGQA 3DWLE 2Y9YA 4UUSA 2FRHA 2VUMJ 4FE4A 4Y4RA 3RQIA 2ZB9A 4HSRA 4A3DJ 2IA2A 2Q0OA 2FUG2 2ZMEA 3HUGB 3IH4A 4A5NA 5LHGA 5ILSA 3CUQB 2E34A 1VQ5I 3CJTB 3Q0UA 4L5JA 1YIJI 4MFDA 4QPQA 2DOFA 4F52A 4NC8A 2B7EA 1LEBA 2K5CA 4A6EA 4YELA 3FXQA 5E1XA 1B72B 2E1OA 3KEYA 5E17F 4D5FA 5J1UA 3BT9A 1ZR4A 2WY8Q 1YJWI 2F5DA 2LFBA 2PJRA 3HKZA 2VOOA 2ZFUA 3GVAA 5E8IA 3WTWC 5JR3A 2WY7Q 3IWZA 3HOWJ 4XKVA 3T8RA 4LLNA 1OQYA 2AQFA 3JCUC 4L0ZB 1BOBA 3PL8A 2L0KA 4U0YA 3FBIB 4C9YA 2VPRA 1REPC 1I3QJ 3OOUA 1X58A 3QPSA 1W1WE 2LYCA 1X2NA 5HLIA 4GFBA 2Z99A 1G3WA 2LDUA 5DUIA 1HSJA 2QM3A 3EUHA 3OSGA 4OINF 2YX4A 5TJJA 3VSKA 4XNFA 3ESWB 1BR2A 1RKWA 3RDIA 1K61A 3OR1C 2V9VA 4HPQA 3QOPA 2AHQA 3HSRA 2E5NA 4YEJA 5DM6F 2CUJA 1Y1VJ 4DNCA 4GXOA 4CGZA 2FQ4A 5HLTA 3HGGA 1Z05A 2G9WA 1S3JA 5BOXA 3KIOA 1P4XA 3W3CA 1S9HA 4RAGA 2JK3A 2WAQA 5J40A 1U9OA 3MD2A 2W85A 2O8KA 3A2KA 3H36A 5HVQC 5GPCA 2E2IJ 4LG0B 5IT3A 2I8DA 1T56A 2HQNA 2W1OA 4JX5A 1I39A 4IXAA 4XK4A 1G4DA 3B73A 3G1LA 1OYYA 3VODA 5FKMA 1S8NA 2R5ZB 2JPCA 4S0HB 1QA6A 2LK2A 5B66C 2HYJA 2XAGA 4WWCA 2A69F 3LA3A 1ETOA 2DOAA 2CV0A 3MAJA 2RAEA 4KDPA 4RB3C 1Y6IA 3EUAA 4ZTJA 1ZRFA 3JR9A 1K4SA 1K6OA 5FJ8J 2CUZA 4BH9A 5B1BH 2XC7A 1F4KA 1W7PD 1P7JA 3VYTB 1WSUA 1BN5A 1QHHD 3MZ8A 4CCOA 1RUOA 2DFFA 1ZK8A 2LR8A 4IF4A 4D7MA 2BW3A 4I0AA 4RB0A 2Z9OA 1ETKA 3CDHA 2KQRA 1BI2A 3LOCA 1OCZH 3PM1A 3TBIA 2IT0A 3U9GA 2Y2ZA 1SFUA 4MO7A 3ZQQA 1OCTC 3WU0A 4ENMA 1X4PA 2XF6A 2I5UA 4XLAA 2M8EA 1HKSA 4WXDA 4EM1A 5CQGA 2EV6A 2ZO4A 2JA5J 1D8KA 4BHCA 1FNNA 3GTKJ 1PUFA 4UV9A 2A5YB 2EFPA 3GFIA 2K7LA 3S1NJ 3HRUA 2RC4A 4FISA 3WG9A 2QUFA 3E1SA 4XN3A 3IHUA 5DCFA 3MEXA 2ELHA 3KYCB 1O3RA 1UAAA 4CCJA 1SD4A 3KP6A 4U0VA 1YFHA 4OWRB 2OAZA 4B3XA 4BJTA 2LP0A 3J81K 2ISYA 5FLMJ 1RNLA 3SZGA 1VQMI 1MMAA 5LHIA 5LEJA 1HBXG 3I4PA 4B43A 1MJ9A 2DOEA 1CF7A 2L01A 1JE8A 3DV8A 5DM7F 2OCCH 1H88C 3C2HA 5B1AH 1KZHA 2R7DA 3A03A 3Q5FA 1J7KA 5HLHA 2PQ8A 5D8LB 2XF7A 1O7FA 3BZKA 4DIQA 1R9TJ 1MH4A 3EYIA 4OAZA 2IBDA 1XGOA 2K9LA 4IQJA 5FGMA 5FLVA 4E7LA 2KIMA 1TP4A 3WGIA 3JTGA 3OOPA 3KYDB 4I01A 3V7SA 4ZC3A 2EQRA 2DK8A 4KA4A 4U7DA 4CUGA 4MEYF 4O6JA 5FO5A 1H8AC 1YRNA 2E71A 1QQIA 1BM9A 2FD5A 2YS9A 4LOCA 3SEZA 2DMNA 3H5AA 3J81Z 1Z9CA 4LB5A 1FBUA 3H9JA 3SDBA 1ZELA 5J8FA 5K5QA 2HWVA 4BBRJ 4B1RA 1FSEA 1W5TA 2OF7A 1O3QA 5DD4A 3G71I 2GAUA 5CQEA 3WTUC 5B5EC 1Z21A 3HSFA 5H6RA 5HDKA 4UUVA 2UWMA 1Z91A 3M8EA 2UUZA 1E17A 2A05A 1USSA 2P5LC 3FDYA 2HDDA 5L3FA 4ESFA 1TT0A 2UV1A 3F9KA 1WQ2A 2CWEA 1S7EA 4BL0B 1WHUA 1XGMA 4PJJA 2COMA 3RKQA 2HOSA 3ZQ7A 1R4NB 1VF9A 1NHAA 3AKZA 2KT0A 1K78B 3TMOA 5JHUA 2K02A 2P81A 1FMWA 2YSRA 3PIPF 2V1NA 2PMUA 4XICA 2LKXA 1T08B 3IH3A 2Z2SB 2H6BA 3CJNA 1YITI 5FRMA 5C3EJ 2LY2A 3FK6A 3RPUA 4EJVA 1BW5A 3TO6A 2F5CA 1IN6A 2LLKA 3DTIA 4A0YA 3IWFA 3QAHA 5DDGA 3C3WA 5TGTA 1IZ1A 3ZR8X 4B44A 1TQPA 3CMAI 2LMDA 3HC7A 5GAGJ 3KP4A 5D5UB 4CCMA 2GWRA 4M3FA 3GTJJ 2HOAA 3KP3A 1F5TA 1WJDA 4E7SA 4X6AJ 1X1CA 2XRLA 1EF4A 1FOYA 5IYBJ 5E3OA 4BEHA 2PJPA 3K2ZA 1LE8B 1UG0A 4UUTA 3GO5A 4XRMA 1U5TC 4EMSA 2DO7A 3HB9A 4QIWN 3D1NI 4OIPF 4LMYA 5HNFA 2XHKA 1F36A 2L4AA 1JTXA 4NQWB 4DYQA 3ZP5A 4EVIA 2IP2A 2DXIA 4KT6A 2VASA 2HQ5A 4EV0A 5DV5A 2QQBA 3IKTA 1O3SA 1Z1DA 2YR2A 2OA4A 2KL4A 2EFWA 3N97A 2Y9ZA 2STTA 2ETHA 4CYCB 4K2EA 3RJPA 1UZCA 2V1XA 4F91B 1HW1A 2LSOA 1KQ9A 1ZHFA 2HOTA 1MMDA 1HXDA 5F64A 4ZYAA 1MH3A 1IV8A 1KA8A 2LD5A 2VQCA 2VE9A 1HC8A 2WBMA 3OL4A 4LK1F 4EM2A 2XGXA 1CGPA 2CU7A 3S3OA 1FMVA 1GUUA 1Z3YA 2IGMA 1VQKI 4BKXA 4GGGA 2Y0SN 3GYHX 3VWBA 2E7WA 3G3ZA 1BW6A 4UB6C 3F22A 1KGSA 4BNCA 1W5CC 4L5EA 5EG0B 2P5KA 4HQEA 2E7XA 3A01B 2K4JA 3CLOA 3W2WA 1R00A 2R7WA 5HDNA 1U3EM 1BA5A 2MC4A 2FU4A 3ERED 2HTSA 2Z1DA 2M34A 1YQAA 4PK4A 5F0FA 4RGSA 3K9TA 1ZG5A 4II3A 4L9TA 2X1CA 5IOZA 3ERMA 4ENNA 1XDUA 3OYAA 3EUKL 5HODA 5EEGA 3OYEA 1WI9A 2GIZA 2E1MB 4D9JA 4XORA 1ON2A 2O0YA 4CCKA 4BE0A 2QQ9A 1GT0C 3JRDA 1IG7A 4C2TA 1AKHB 2M1BA 3BY6A 3EQLF 1KQ0A 2R93J 1S7OA 3FKIJ 3CF5F 2HPMA 1B8IA 3RYRA 1V55H 4RS8A 4M9SA 4W97A 4DYCA 4I09A 2EIMH 2XGDA 1TQIA 2QSHX 2MFZA 5LGNA 3CDLA 5ILVA 5HLGA 3EETA 2FQ3A 3FXUA 1FBQA 3MKYB 2ID3A 2DA3A 1ZR2A 5JLWA 2FMLA 2DI3A 1GVJA 1VQOI 1Y1WJ 1BR1A 4CZCA 2DA2A 4AVZA 2LNBA 1ITYA 4I98B 4QLCU 4C30A 4J00A 1EH6A 3ZMDA 5IP9J 4JP0A 4P1WA 2HPIA 1ZN2A 2NS0A 1VQ8I 2GLOA 4BQAA 2YPRA 3FMQA 3I59B 2XSDC 1X4OA 2EFQA 4JBAA 3OIPA 1RETA 1BIBA 2CUEA 2HYGD 2GXAA 3CUQC 5KNLA 2V4JC 1F9NA 1YX3A 4QWQA 2RNGA 3IKVA 2QQAA 2QZ8A 1ZARA 1XN7A 3COAC 1TQMA 3CTAA 5E3LA 1MNEA 2NVUB 4AIDA 1W36D 1I50J 3NQOA 1YJ9I 3ECOA 1ETYA 1BBYA 4C2MJ 4ENJA 1JXSA 3K70D 2EILH 1FTZA 3GLXA 2OPTA 3OYIA 2Q2EB 2XPVA 1T6SA 2HXOA 4UXNA 4IEJA 1ETWA 5ILUA 1LNWA 4AYBA 2V1DA 1BJZA 3KP7A 2VQGA 2DK5A 3BPXA 1SVMA 2JSCA 3KP5A 1ZKGA 3VEPA 4CICA 1QU3A 2P7CB 3F6OA 2M2EA 1P7IA 2R5YB 5LGUA 4UVAA 2FSWA 2DT6A 1DPRA 3KLOA 3ZGKA 3T8TA 1JUSA 4M3BA 4YFKF 1OCOH 3DFGA 1K79A 1D1BA 3CZ6A 2D5VA 2W24A 1SD6A 4EGYA 3ZMVA 3SFZA 1IO2A 3H9QA 1ETXA 1ONVA 4ITVA 4OIRF 2ZSIB 2OUMA 2ZC2A 2C6YA 2V9KA 3U1DA 4A5MA 3PO2J 3IUOA 1OPCA 3JRGA 3V7RA 2EA2A 2H6CA 3JREA 1RKTA 4RAYA 1R1UA 4M6YA 4RDUA 5C44J 1O4XA 1IN7A 2DAOA 2X6YA 3JRHA 1STZA 3ZMUA 4WXCA 4BAYA 4XLNF 3K4LA 2EZLA 3LMMA 2X85A 5E18F 1TZLA 2XF5A 3GZNB 2LBFB 2X1EA 2JMWA 3U2RA 4ZYDA 1VQ6I 3W6JB 1R58A 2DA4A 2IAIA 4FCYA 2QKLB 3K4JA 1Y39A 1AOYA 2XVCA 1MIJA 3ONQA 5D5XB 3U1KA 1YI2I 1NK3P 3E5XA 1N77A 3BR6A 2D1VA 3BC8A 2X0LA 1JKQC 1K7AA 2HKOA 4IHVA 3E7LA 3HUGA 3L7WA 3HXLA 3CMMA 3GF2A 4U88A 4Z6YA 1PP7U 3W2VA 3ZQLA 4JX6A 3F8BA 1YS6A 5J4YA 3VYSB 2L7ZA 3LAJA 2JT1A 2P6TA 2JRTA 3G6EI 1J59A 3OV8A 4OMYA 1B72A 3I58A 5CVVA 2D45A 4YRVA 1I1SA 2YU3A 3OS1A 3TO9A 4JK1X 3WODF 1MMGA 3EDPA 4JOMA 1H9TA 3H0GJ 5CJ9A 3HKZN 3E6MA 3P9KA 3K4KA 2K3FA 1A04A 4G94A 2V1UA 4RAFA 1HKTA 1IUYA 3S2WA 2BBYA 2VONA 4LIVA 1JTYA 3ZQIA 4LK0F 5FKOA 4Q4ZF 4KYWA 1FYLA 1VQ7I 3AAFA 3I53A 2Y31A 4HLXA 3DTEA 4N4OB 1IN5A 4KIBA 4BYYA 2JQ7A 5IPAA 4XRSA 4M72A 3GX4X 4GDFA 2RGVA 3D5SC 4FETA 3M8JA 3BG9A 4E4HA 3CD6I 1A6IA 2NYXA 4FASD 4HLYA 1KYZA 1ORKA 2DA6A 4DBQA 2DA1A 2CQKA 3PSFA 4I7HA 2K40A 4A3EJ 2P6SA 3NEUA 2D1HA 2VKHA 1U2WA 3C1DA 2BY2A 3RI4A 2V6EA 2ZBKA 1XSVA 3L00A 4GO1A 3KX2A 1B59A 2G7UA 2CV2A 5JLXA 3R61A 2VBWA 2Z16A 1FP1D 2EZIA 2HGCA 1ZRDA 4NC7A 1MZBA 3GXOA 1ETVA 3GWZA 5EZGA 2A61A 5LLQA 4NNJA 4A3FJ 3GZ5A 3WGHA 1NTCA 2WAQN 3QPHA 2DU9A 5FROA 4CYDA 5K7FA 2X6WA 4LG0A 3GTOJ 1Z7LA 1WWXA 3C18A 3FWEA 2RQPA 3WU1B 3HM5A 1IV6A 1RESA 4NBQA 4JX4A 2BXYA 3CCYA 2LC2A 2R5ZA 1YOVB 3IP4B 5F1JA 5LRSA 3ZRGA 3AG3H 3ZCOA 3HRSA 4XR6A 1R49A 3H3UA 5KHDA 1YIOA 1TNTA 4L18B 3RTRA 1N25A 4UV8A 5GTHC 4E7JA 3GTPJ 3LFKA 4U7BA 1P4AA 3RSNA 4B8XA 3FM3A 4BQNA 3A0BC 4DZJA 3DPLC 3JRFA 5D5VB 3Q9SA 5C4JJ 3CMYA 3E5UA 4M3EA 3WHCA 3HPHA 3LSGA 2ME6A 2HKXA 4KT5C 3GTMJ 3FIWA 4CO8A 1MBKA 3MQ0A 2O9LA 1T38A 4IRHA 2WAEA 1W7PB 1POGA 5EEAA 4EJTA 2R7FA 5HOOA 1GV5A 3GTLJ 2L9VA 2ESHA 3Q9VA 2L4MA 3GFLA 1ETQA 5IP6A 3HJEA 1B1BA 2OC6A 3S16J 1T33A 3L2RA 4GCVA 4HNUA 2P0WA 5CLSA 4G9YA 3CCSI 1FOKA 1WH5A 5D5WB 1KU9A 1VQ4I 3TW6A 4N0BA 5J8CA 3HGYA 2DW4A 3BPVA 4BXFA 1V3FA 2CFXA 3FXKA 3GLLA 2EA4A 2O5RA 4XOTA 2XROA 2DMPA 4XLFA 3M4OJ 3E5QA 1ZG3A 3MKZA 3DF8A 2FOKA 4IX7A 1B9MA 2VQLA 1JGGA 1BI1A 3EYYA 1TLHB 3DKYA 3I3LA 3WTVC 1T2KA 3BWGA 3V7CA 2FEZA 2CW0F 2MYSA 2BVMA 3DQVC 5DCMB 5EGOA 3MN2A 4IL6C 4CH7A 2GXGA 2XASA 2MABA 2WADA 3P9IA 2QF7A 2JJ7A 3K6GA 1JGSA 1SC7A 3HZJA 2UZKA 3I55I 2JUCA 4HQMA 3HPGA 2XAUA 4YFXF 1KYWA 4OU0A 3MZYA 5E3NA 4A3KJ 2JSPA 2FBHA 2HOEA 3HDDA 3VFZA 5ICCA 2XKPA 4XL9A 4IHXA 2H94A 2R3SA 1P9QC 2GA1A 1XDSA 3M8FA 1W0TA 1K83J 1VQPI 4EATA 3GW2A 3V42A 2FX0A 3RZDJ 5D4SA 1WJEA 4XMYA 4WK8F 2V7FA 4ENKA 3R0JA 4BXUA 3RZOJ 1T0FC 1WRJA 4BY7J 4CZZA 2CW8A 1KONA 3GEZA 4DGWB 2PFBA 2RREA 1WGXA 2JRMA 1FOXA 2EFOA 4L9JA 1BIAA 4YIIA 4QTRA 1XSXA 3LNQA 1YO5C 1RZ4A 5J3LA 3G73A 2M7AA 2LF7A 1ZG1A 3RQ4A 2KHMA 1OLTA 5EDNA 4M71A 5F04A 4IZZA 2IXSA 2MD5A 1RPWA 3FZVA 2PJRB 2ACJA 2NAZA 2IPQX 1E3OC 2A68F 2K85A 2PX9A 3KLNA 3CQZJ 3W2AA 2XAQA 5KAFC 1IXCA 1K78A 1SVLA 4A6DA 2RN7A 2WWYA 3G2BA 2R7SA 5IT9K 5L3GA 1FYMA 5GPAA 3DTKA 3BJAA 1FP2A 3I9V2 3K70C 3SHFA 1TBXA 4WX9A 2KRCA 3BR5A 4D0PA 1MMSA 2DLLA 2ME0A 1S72I 1ACIA 2W7NA 1SFKA 4MLOA 2DJIA 2E1MC 3CCEI 2OTLI 2Z5UA 3SQNA 2QLZA 3FXJA 4XKWA 3OYBA 2RVCA 3BG7A 3I64A 2DT5A 3HOXJ 3TGNA 4RB2C 2EZKA 1JT0A 3F8NA 2LY1A 4PFOA 1YJNI 1VTNC 3B6CA 4F93B 1JJ8C 1ZAOA 1SANA 2QBYB 4MTDA 1H0MA 2VXZA 1XMAA 2IGOA 2VKDA 3RCOA 5KK1A 1LE8A 2VL8A 1WH7A 2MA3A 2FMYA 2M0CA 2VXDA 3M9AA 3BR0A 3H3ZA 1S5LC 1Z67A 3PNVA 9ANTA 2XPWA 3ABLH 1MNDA 4XN0A 3K1NA 2MSYA 1YYVA 3WG7H 1G3TA 4P5OA 1VZ0A 3DLAA 1MBGA 4NQWA 3ULQB 4L5IA 1XG1A 5DEQA 2V9PA 4BUPA 3BJOA 2FE3A 2KIQA 2PEXA 3HTSB 2MW8A 4KN7X 3KYLA 3LL7A 2R7TA 2CSOA 1LEAA 3F23A 1DGWY 2E36A 3QOEA 2R7XA 5D6EA 2LY9A 3FM5A 2VC0A 3FX3A 1T0FA 1F1ZA 2A07F 2L9RA 5TISC 3IRQA 2E60A 4XOPA 4ZTFA 1TT5B 4RB1A 4ESJA 5GADJ 5E3MA 2DDBA 4NC6A 1TWGJ 2ZJQF 4Q5SF 1DU6A 3QPTA 4AWXB 1UFMA 1JKPC 3E6DA 1IDZA 4A3BJ 2GOMA 3CF2A 1E2XA 1O57A 2F4MB 4ZYHA 5D4RA 1HW5A 4J19A 1I6HJ 3SEQA 2K3PA 1DP3A 3HOYJ 4IQ4A 2QCOA 2X51A 2GIVA 3F21A 2ZKZA 1V5FA 4AUXA 5EG0A 2ICWG 1WZ2A 3F3XA 3A01A 1VQLI 1D0YA 4HG2A 6PAXA 1J09A 4MIMA 1ERDA 5BS6A 5J1RA 1PVEA 2DA7A 4DZPA 1U78A 1ZLKA 3VB2A 5KAIC 1GVDA 3EPZA 3LSKA 4MFEA 3K4NA 1Q1HA 1VQNI 5J6XA 2VN2A 3H5RA 1IRZA 1KU7A 2RDPA 5KCMA 2L7KA 4LLGF 3FISA 1EV7A 3FXRA 3JTHA 4G8XA 4QPOA 4KMFA 3OYNA 2F2EA 5E1ZB 1AWCA 2M8GX 3CCQI 1UCRA 3M7GA 3QU3A 4WF2A 2PMHA 1AKHA 1G3SA 2JVHA 3B6AA 2VC1A 3S32A 1DP7P 4M3DA 4B09A 4EQQA 1JI8A 2KLOA 5BMZA 2N8GA 2PG4A 1X1PA 3ZOBA 3B02A 2L54A 2XAJA 3SZTA
chains in the Genus database with same CATH topology
2HEOA 1X3UA 2DQLA 4KIFA 3T0YA 5K5RA 1W4MA 4HF0A 5L3DA 2KKOA 2X4HA 1IRFA 3FMSA 4HAMA 1D8JA 2XAHA 3GZ6A 1GXQA 3I59A 2VBYA 4WCGA 1SMTA 2GZWA 5CVIA 2ZNYA 2IRFG 5DYMA 3RKYA 3WTZA 4MGRA 3T1BA 3IRRA 2IVMA 2HR3A 2O8XA 2P4WA 4OMZA 2Q2EA 1D5VA 3ABTA 3ZN0A 2A6EF 4WXHA 1IN8A 3ELKA 2KIFA 1S6LA 4Q47A 2RKHA 2MLGA 1TW3A 3LAPA 3R60A 4EM0B 1YW8A 3DP7A 4NB5A 2F5FA 5CVUA 1MDMB 4KUMA 4PZJA 2D2WA 2LKPA 1R36A 2RV8A 3D5LA 1GXPA 3W6KB 3KP2A 4N9HA 5HS7A 1U5TA 4HX8A 4ASNA 3E97A 1SMYF 2IW5A 2TDXA 5LGTA 1QZYA 4OIOF 2WTEA 3LWFA 4R79A 3RKWA 4XLPF 3RYPA 1J75A 1R1TA 5HS8A 2STWA 3KZZA 3HSEA 1FT9A 1IN4A 2YX7A 1R5GA 4EJWA 2OQRA 1YW9A 3CUOA 2P7VB 3O3KA 4IHTA 2FNAA 4LJZF 2BE5F 4FX0A 3ROUA 3RKXA 2O3FA 1S29A 5BPDA 3GFJA 1YS7A 4M9ZA 2MBFA 3TDUC 3I71A 4YG2F 4HF1A 2A3SA 3TOBA 5CVJA 4YIFA 4KN4X 5A2QK 5CVRA 3REOA 3ABUA 2FA5A 3FHZA 1FX7A 1YW7A 4RGUA 1ODDA 5JVTA 3HRMA 1XCVA 1J5YA 2GA2A 1MD0A 1LDKB 4KICA 3TDZC 3K0LA 1EH8A 4F7ZA 1BJAA 1XD7A 3KFWX 1B6AA 3DEUA 4RGRA 4E70A 5E20A 3K1PA 1Z6RA 3BP8A 4HYEA 3TKYA 2O61A 2NNYA 2H27A 3PFIA 4FX4A 2KJCA 4Q48A 3VOEA 5A2QZ 2VE8A 1U8RA 1QBJA 1O3TA 4P55A 4CDGA 5L3EA 4MEXF 3R0AA 3KEQA 1S7AA 5D8KB 4I02A 3F72A 4P9UA 1J9IA 4LGWA 1KU2A 5HDGA 5LHHA 2DFIA 2QYOA 3H92A 1SFEA 3CUQA 3ZMTA 1TTYA 4CHUA 1QO0D 4IHSA 4ZZLA 3KZYA 2H09A 1HW2A 4RAZA 4MHGA 1Z6TA 3O2PE 4Z2YA 2KJBA 2W84A 4PGGA 5DUKA 1W7PA 4P96A 1MJAA 4PCQA 3TO7A 1SD5A 2L02A 3RIRA 1XGNA 4JQFA 3V8JA 4S04A 2OQGA 5CYVA 2CG4A 2JPBA 4M9XA 3LQQA 5HS9A 1Y0UA 1MJBA 4G6QA 1IAWA 4HV6A 4PGHA 4L9VA 4IPAA 3E6CC 1ULYA 2Z33A 1QGPA 2PBIA 4KIGA 3K69A 5ICGA 5F1RA 5F6FA 4EGZA 2MLKA 5DCMA 3IL2A 3KEOA 1OYWA 2W25A 3GUDA 4NHJA 3KE2A 1I6XA 5H6QA 1RI7A 3HOSA 4LB6B 4HA8A 4AIKA 5FD5A 5K5OA 1SD7A 2P5VA 4O5VA 1HQCA 1R5HA 1R23A 3SXYA 2OD5A 1I1GA 5LEKA 3WTXC 5L3CA 1LVAA 4HOBA 2XKOA 1ZLJA 1FSHA 3ZMZA 2O6GE 2M30A 4G7HF 1P6RA 1J0RA 3LA7A 1P92A 1W5SA 2VODA 1LDJA 2OZUA 2KRFA 2HYFA 2HFHA 2JTVA 4EJUA 2EFNA 4KMUX 4LLLA 2J5OA 1V4RA 4HBLA 4A0XA 3MCZA 1ZRCA 4ZYGA 1DDNA 3TQNA 3R6SA 3JAMK 1OKRA 3KETA 3E6BA 3BROA 2DQRA 2CGPA 1IF1A 4AVPA 3WE2A 3MZHA 2QBYA 1R22A 3PQKA 4UVCA 1QZZA 4BHPA 5K1YA 2FF4A 2VT3A 2E1CA 1LQ1A 2MC3A 4M74A 3J7AO 2V6CA 2M45A 2V79A 5BPIA 5ERIA 2B0LA 1PDNC 2EK5A 2NRAC 4AIHA 4EJOA 4BHBA 5AIQA 1IXRC 2Y75A 2ZMEB 3JAMZ 1RIOH 2Z3YA 2EV0A 3F8MA 1LDDA 3NRVA 1IW7F 4MTEA 1L3LA 4IVNA 1JHHA 3I0TA 4AIJA 2EV5A 4UHTA 1USTA 1QNTA 2KIUA 1LB2A 3I5UA 2ZFWA 4Y13A 2XAFA 1UB9A 1PUEE 1G3YA 1YG2A 1D3YA 5FLXK 1FBSA 3CO6C 4HW0A 4UNOA 3E3VA 2W57A 1JHFA 1BC8C 3WTTC 2ZXJA 3LQRA 4MNUA 5BQTA 3ECHA 5AONA 4A2UA 5E8GA 5IT9Z 1DUXC 4N9IA 3F8CA 2XV4S 5JI6A 4OOIA 5FLXZ 3V8LA 3MFKA 1UHWA 1RUNA 4LFUA 4HX4A 2XRNA 4GYIA 4R1HA 4ESBA 2AS5F 1FC3A 5DD8A 2G7HA 1UHMA 2BV6A 3BDDA 2JZYA 4FHTA 3FMRA 1FY7A 2QENA 1BOAA 4ZYEA 1B9NA 1P4WA 2K27A 4HDUA 2IJLA 2FXAA 2IA1A 3WGGA 4ZZDA 3R4KA 1MDMA 4L0YB 1XSDA 5D6FA 1XB4A 2XIGA 4CXFA 4R8HA 3C7JA 1SFXA 5H20A 4IRGA 2L3DA 2E1NA 1CF7B 3N4MA 3WTSC 1Z7UA 3GFMA 5LRRA 2HS5A 2PN6A 4ETSA 2BEOA 3ML6A 1P2FA 2PI0A 4KNYA 1OYIA 1ON1A 1YLFA 1YTYA 3QP6A 2GXBA 5LBQA 2RNJA 2EB7A 4H0EA 1R7JA 3TOAA 1ZYRF 3QU6A 1XCBA 3LSTA 2K86A 2J5PA 4HZFA 2DBBA 2HDCA 1T98A 3J80K 3DXJF 3I54A 1BC7C 2VBZA 3DPTA 1MGTA 5FFZA 1I27A 4A0ZA 3HRTA 3ZPLA 1FZPB 1DPUA 1ZREA 3JSPA 1HSTA 4IRIA 1OMIA 1KU3A 4HDVA 3BOQA 3KCCA 4XRFA 2FBKA 2QWWA 3WE3A 4G7OF 3SZPA 2ESNA 5FB2A 3F6VA 2OBPA 4XSZF 3DKWA 5ICEA 2UXNA 2CO5A 2FBIA 1WKMA 3IC7A 3J80Z 1BI3A 2ZJ2A 3CO7C 3HTUA 2UXXA 2BYVE 1MKMA 2OU2A 2WV0A 2EJRA 4KFCA 2WC2A 1C0WA 3PQJA 4MQ9F 1I5ZA 3ZN1A 4P9FA 4ZH4F 2HQRA 1IXSB 4HX7A 1PP8F 2QVOA 4HF2A 5EEHA 2ZCWA 1OR7A 3HYIA 2DPUA 2PLYA 2NNNA 4TV7A 3P9CA 2FNPA 4M6XA 4DQ2A 2LF8A 5ED4A 4UVBA 5ICFA 4RGXA 3L2CA 4MQVA 4Y15A 1XGSA 3HIFA 4YFNF 1FPQA 4FT8A 1TW2A 3L9FA 3P7NA 3FF5A 4XBFA 2MH2A 2VOPA 1ZGJA 1GHCA 2O03A 2HZTA 5KVRA 5JFRA 4S05A 1FWZA 3JSOA 3QRFF 3ZMSA 1R1VA 4IJAA 1B4AA 1G6NA 3M1EA 1BI0A 3BZ6A 3QP5A 4G7ZF 1U5TB 3HHHA 4I2OA 3L09A 2DTRA 1O7LA 1T39A 2M87A 4I0BA 4AD9A 3O6BB 4Y17A 2VBXA 2HTJA 2Y48A 5FD6A 3V8KA 3K1MA 3JW4A 3LA2A 2EWNA 1U6GA 4O3MA 3RPQA 2AXLA 4U0WA 1EH7A 1ZH5A 2GQQA 3HOTA 3MWMA 1LJ9A 3HHGA 2BGCA 2DPDA 2P8TA 2VT2A 2Y0MA 2ZNZA 4M73A 4GYGA 3ISPA 1IRGA 4L9NA 2IA0A 4ON0A 1QPMA 4HV5A 1TNSA 2K4BA 2MH9A 2Q8KA 4G6DA 5FFXA 2CYYA 4A12A 2OZ6A 1H9GA 1ZGAA 1KQ8A 3V4GA 2A6HF 1J2XA 2ISZA 3F8FA 2XUBA 3D0SA 2F5EA 3WTYC 1SAXA 5E1WA 4PDKA 1HKQA 5AIPA 4XSXF 1FYKA 1L0OC 5L3BA 3BJ6A 1XMKA 1FLIA 4LD5A 2M5WA 2ADUA 5TRDA 4OIQF 3T5XA 2FRHA 2IA2A 2Q0OA 2ZMEA 4A5NA 5LHGA 5ILSA 3CUQB 4L5JA 1LEBA 4A6EA 3FXQA 5E1XA 5E17F 2F5DA 2VOOA 3GVAA 5E8IA 3WTWC 5JR3A 3IWZA 3T8RA 4LLNA 4L0ZB 4U0YA 1REPC 5HLIA 2Z99A 1G3WA 2LDUA 5DUIA 1HSJA 2QM3A 3EUHA 4OINF 2YX4A 5TJJA 3RDIA 2V9VA 3QOPA 3HSRA 4DNCA 4GXOA 4CGZA 1Z05A 2G9WA 1S3JA 5BOXA 1P4XA 2W85A 5HVQC 4LG0B 5IT3A 2HQNA 4IXAA 1G4DA 3B73A 1OYYA 3VODA 1S8NA 2JPCA 2XAGA 4WWCA 2A69F 3LA3A 3MAJA 4KDPA 4RB3C 1ZRFA 1K6OA 4BH9A 1F4KA 1W7PD 1WSUA 1BN5A 1RUOA 4IF4A 4I0AA 4RB0A 2Z9OA 3CDHA 1BI2A 2IT0A 3U9GA 1SFUA 3WU0A 4ENMA 2M8EA 1HKSA 4WXDA 4EM1A 2EV6A 2ZO4A 1D8KA 4BHCA 1FNNA 4UV9A 2A5YB 2EFPA 3GFIA 2K7LA 3HRUA 2RC4A 3WG9A 2QUFA 3IHUA 5DCFA 3MEXA 2ELHA 1O3RA 1SD4A 3KP6A 4U0VA 1YFHA 2OAZA 3J81K 2ISYA 1RNLA 5LHIA 5LEJA 1HBXG 3I4PA 1MJ9A 1CF7A 2L01A 1JE8A 3DV8A 2R7DA 3Q5FA 1J7KA 5HLHA 2PQ8A 5D8LB 1O7FA 3EYIA 1XGOA 5FGMA 2KIMA 3WGIA 3JTGA 3OOPA 4I01A 3V7SA 2DK8A 4KA4A 4U7DA 4MEYF 4O6JA 5FO5A 1QQIA 1BM9A 3J81Z 1Z9CA 4LB5A 1FBUA 5J8FA 5K5QA 2HWVA 1FSEA 1W5TA 1O3QA 5DD4A 2GAUA 3WTUC 4UUVA 3HSFA 5H6RA 5HDKA 2UWMA 1Z91A 3M8EA 1E17A 1USSA 2P5LC 5L3FA 4ESFA 1WQ2A 2CWEA 1XGMA 2COMA 3ZQ7A 1NHAA 1K78B 5JHUA 2K02A 2YSRA 2PMUA 2H6BA 3CJNA 4EJVA 3RPUA 3TO6A 2F5CA 1IN6A 4A0YA 3IWFA 3QAHA 5DDGA 3C3WA 1IZ1A 1TQPA 3KP4A 5D5UB 2GWRA 3KP3A 1F5TA 2PJPA 3K2ZA 3GO5A 1U5TC 4EMSA 2DO7A 4OIPF 4LMYA 2XHKA 2L4AA 3ZP5A 4EVIA 2IP2A 4EV0A 5DV5A 2QQBA 3IKTA 1O3SA 1Z1DA 2YR2A 2OA4A 2EFWA 3N97A 2STTA 2ETHA 4K2EA 3RJPA 2V1XA 1HW1A 2LSOA 1KQ9A 1ZHFA 1HXDA 5F64A 1KA8A 2VE9A 4LK1F 4EM2A 2XGXA 1CGPA 4GGGA 3GYHX 2E7WA 3G3ZA 3F22A 1KGSA 4BNCA 2P5KA 4HQEA 2E7XA 2K4JA 3CLOA 1R00A 5HDNA 1U3EM 2FU4A 3ERED 2HTSA 1YQAA 4RGSA 3K9TA 1ZG5A 4L9TA 4ENNA 1XDUA 5EEGA 1WI9A 1ON2A 2O0YA 2QQ9A 2M1BA 3BY6A 3EQLF 1KQ0A 1S7OA 3RYRA 4RS8A 4M9SA 4I09A 1TQIA 5LGNA 5ILVA 5HLGA 3EETA 2FQ3A 3FXUA 1FBQA 2FMLA 2DI3A 1GVJA 2LNBA 4I98B 4QLCU 1EH6A 3ZMDA 1ZN2A 2NS0A 4BQAA 2YPRA 3FMQA 3I59B 2EFQA 4JBAA 1BIBA 2HYGD 3CUQC 4QWQA 1F9NA 3IKVA 2QQAA 2QZ8A 1ZARA 1XN7A 3COAC 1TQMA 3CTAA 3NQOA 3ECOA 4ENJA 1BBYA 1JXSA 3GLXA 1T6SA 4UXNA 5ILUA 1LNWA 2V1DA 3KP7A 2DK5A 3BPXA 2JSCA 3KP5A 3VEPA 4CICA 2P7CB 3F6OA 5LGUA 4UVAA 2FSWA 3KLOA 1DPRA 3T8TA 4YFKF 1K79A 3DFGA 2W24A 1SD6A 4EGYA 3ZMVA 3SFZA 1ONVA 4OIRF 2C6YA 3U1DA 4A5MA 1OPCA 3V7RA 2EA2A 2H6CA 4RAYA 1R1UA 4M6YA 1IN7A 2DAOA 3ZMUA 1STZA 4WXCA 4BAYA 4XLNF 5E18F 3U2RA 4ZYDA 3W6JB 1R58A 1AOYA 2XVCA 5D5XB 3E5XA 2D1VA 2X0LA 1K7AA 2HKOA 3HUGA 3L7WA 4U88A 3GF2A 1PP7U 3F8BA 1YS6A 3LAJA 2JT1A 2P6TA 2JRTA 1J59A 3OV8A 4OMYA 3I58A 5CVVA 2D45A 1I1SA 2YU3A 3TO9A 4JK1X 3WODF 3EDPA 1H9TA 5CJ9A 3E6MA 3P9KA 1A04A 4G94A 2V1UA 1HKTA 1IUYA 3S2WA 2BBYA 2VONA 4LK0F 4Q4ZF 4KYWA 1FYLA 3AAFA 3I53A 4HLXA 1IN5A 4KIBA 4BYYA 4M72A 3GX4X 2RGVA 2NYXA 4HLYA 1KYZA 2CQKA 4I7HA 2P6SA 3NEUA 2D1HA 1U2WA 3C1DA 3RI4A 2ZBKA 1XSVA 3L00A 4GO1A 1B59A 2G7UA 3R61A 2VBWA 1FP1D 2HGCA 1ZRDA 1MZBA 3GXOA 3GWZA 2A61A 5LLQA 3GZ5A 3WGHA 3QPHA 2DU9A 4CYDA 4LG0A 1WWXA 3C18A 3FWEA 2RQPA 3WU1B 5LRSA 3HRSA 3H3UA 1YIOA 1TNTA 4L18B 3RTRA 4UV8A 3LFKA 4U7BA 1P4AA 4B8XA 3FM3A 3DPLC 5D5VB 3Q9SA 3E5UA 2HKXA 4KT5C 4CO8A 3MQ0A 1T38A 4IRHA 1W7PB 4EJTA 2R7FA 5HOOA 2ESHA 3Q9VA 2L4MA 3GFLA 1B1BA 4GCVA 5CLSA 4G9YA 1FOKA 5D5WB 1KU9A 4N0BA 5J8CA 2DW4A 3BPVA 1V3FA 2CFXA 2EA4A 2XROA 3E5QA 1ZG3A 3DF8A 2FOKA 1B9MA 1BI1A 3EYYA 1TLHB 3WTVC 1T2KA 3BWGA 3V7CA 2FEZA 2CW0F 3DQVC 5DCMB 2GXGA 2XASA 3P9IA 1JGSA 2UZKA 4HQMA 4YFXF 1KYWA 4OU0A 3MZYA 2FBHA 2HOEA 3VFZA 5ICCA 2XKPA 2H94A 2R3SA 2GA1A 1XDSA 3M8FA 3GW2A 5D4SA 4WK8F 4ENKA 3R0JA 4BXUA 1WRJA 4CZZA 3GEZA 2PFBA 2EFOA 4L9JA 1BIAA 4YIIA 1XSXA 1YO5C 1RZ4A 3G73A 2LF7A 1ZG1A 4M71A 3FZVA 2MD5A 2ACJA 2NAZA 2IPQX 2A68F 3KLNA 2XAQA 1K78A 1IXCA 4A6DA 2RN7A 2WWYA 5IT9K 5L3GA 1FYMA 3BJAA 1FP2A 3SHFA 1TBXA 4WX9A 4D0PA 2DLLA 2Z5UA 3SQNA 2QLZA 2RVCA 3I64A 2DT5A 3TGNA 4RB2C 3F8NA 1VTNC 1ZAOA 2QBYB 4MTDA 1H0MA 2VXZA 1XMAA 5KK1A 2MA3A 2FMYA 3M9AA 3H3ZA 3K1NA 1YYVA 1G3TA 4P5OA 4NQWA 3ULQB 4L5IA 5DEQA 3BJOA 2FE3A 2PEXA 3HTSB 4KN7X 2CSOA 1LEAA 3F23A 5D6EA 3FM5A 3FX3A 2VC0A 1T0FA 1F1ZA 2A07F 3IRQA 4RB1A 4ESJA 4Q5SF 3QPTA 4AWXB 1UFMA 3E6DA 1E2XA 1O57A 4ZYHA 5D4RA 1HW5A 2GIVA 3F21A 2ZKZA 3F3XA 6PAXA 5BS6A 1U78A 1ZLKA 3VB2A 1Q1HA 5J6XA 2VN2A 1KU7A 2RDPA 4LLGF 1EV7A 3FXRA 3JTHA 4G8XA 4KMFA 2F2EA 5E1ZB 1AWCA 1UCRA 3M7GA 3QU3A 4WF2A 2PMHA 1G3SA 1DP7P 2VC1A 4EQQA 4B09A 5BMZA 2PG4A 3B02A 2L54A 2XAJA 3SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEO A;  1X3U A;  2DQL A;  4KIF A;  3T0Y A;  5K5R A;  1W4M A;  4HF0 A;  5L3D A;  2KKO A;  2X4H A;  1IRF A;  3FMS A;  4HAM A;  1D8J A;  2XAH A;  3GZ6 A;  1GXQ A;  3I59 A;  2VBY A;  4WCG A;  1SMT A;  2GZW A;  5CVI A;  2ZNY A;  2IRF G;  5DYM A;  3RKY A;  3WTZ A;  4MGR A;  3T1B A;  3IRR A;  2IVM A;  2HR3 A;  2O8X A;  2P4W A;  4OMZ A;  2Q2E A;  1D5V A;  3ABT A;  3ZN0 A;  2A6E F;  4WXH A;  1IN8 A;  3ELK A;  2KIF A;  1S6L A;  4Q47 A;  2RKH A;  2MLG A;  1TW3 A;  3LAP A;  3R60 A;  4EM0 B;  1YW8 A;  3DP7 A;  4NB5 A;  2F5F A;  5CVU A;  1MDM B;  4KUM A;  4PZJ A;  2D2W A;  2LKP A;  1R36 A;  2RV8 A;  3D5L A;  1GXP A;  3W6K B;  3KP2 A;  4N9H A;  5HS7 A;  1U5T A;  4HX8 A;  4ASN A;  3E97 A;  1SMY F;  2IW5 A;  2TDX A;  5LGT A;  1QZY A;  4OIO F;  2WTE A;  3LWF A;  4R79 A;  3RKW A;  4XLP F;  3RYP A;  1J75 A;  1R1T A;  5HS8 A;  2STW A;  3KZZ A;  3HSE A;  1FT9 A;  1IN4 A;  2YX7 A;  1R5G A;  4EJW A;  2OQR A;  1YW9 A;  3CUO A;  2P7V B;  3O3K A;  4IHT A;  2FNA A;  4LJZ F;  2BE5 F;  4FX0 A;  3ROU A;  3RKX A;  2O3F A;  1S29 A;  5BPD A;  3GFJ A;  1YS7 A;  4M9Z A;  2MBF A;  3TDU C;  3I71 A;  4YG2 F;  4HF1 A;  2A3S A;  3TOB A;  5CVJ A;  4YIF A;  4KN4 X;  5A2Q K;  5CVR A;  3REO A;  3ABU A;  2FA5 A;  3FHZ A;  1FX7 A;  1YW7 A;  4RGU A;  1ODD A;  5JVT A;  3HRM A;  1XCV A;  1J5Y A;  2GA2 A;  1MD0 A;  1LDK B;  4KIC A;  3TDZ C;  3K0L A;  1EH8 A;  4F7Z A;  1BJA A;  1XD7 A;  3KFW X;  1B6A A;  3DEU A;  4RGR A;  4E70 A;  5E20 A;  3K1P A;  1Z6R A;  3BP8 A;  4HYE A;  3TKY A;  2O61 A;  2NNY A;  2H27 A;  3PFI A;  4FX4 A;  2KJC A;  4Q48 A;  3VOE A;  5A2Q Z;  2VE8 A;  1U8R A;  1QBJ A;  1O3T A;  4P55 A;  4CDG A;  5L3E A;  4MEX F;  3R0A A;  3KEQ A;  1S7A A;  5D8K B;  4I02 A;  3F72 A;  4P9U A;  1J9I A;  4LGW A;  1KU2 A;  5HDG A;  5LHH A;  2DFI A;  2QYO A;  3H92 A;  1SFE A;  3CUQ A;  3ZMT A;  1TTY A;  4CHU A;  1QO0 D;  4IHS A;  4ZZL A;  3KZY A;  2H09 A;  1HW2 A;  4RAZ A;  4MHG A;  1Z6T A;  3O2P E;  4Z2Y A;  2KJB A;  2W84 A;  4PGG A;  5DUK A;  1W7P A;  4P96 A;  1MJA A;  4PCQ A;  3TO7 A;  1SD5 A;  2L02 A;  3RIR A;  1XGN A;  4JQF A;  3V8J A;  4S04 A;  2OQG A;  5CYV A;  2CG4 A;  2JPB A;  4M9X A;  3LQQ A;  5HS9 A;  1Y0U A;  1MJB A;  4G6Q A;  1IAW A;  4HV6 A;  4PGH A;  4L9V A;  4IPA A;  3E6C C;  1ULY A;  2Z33 A;  1QGP A;  2PBI A;  4KIG A;  3K69 A;  5ICG A;  5F1R A;  5F6F A;  4EGZ A;  2MLK A;  5DCM A;  3IL2 A;  3KEO A;  1OYW A;  2W25 A;  3GUD A;  4NHJ A;  3KE2 A;  1I6X A;  5H6Q A;  1RI7 A;  3HOS A;  4LB6 B;  4HA8 A;  4AIK A;  5FD5 A;  5K5O A;  1SD7 A;  2P5V A;  4O5V A;  1HQC A;  1R5H A;  1R23 A;  3SXY A;  2OD5 A;  1I1G A;  5LEK A;  3WTX C;  5L3C A;  1LVA A;  4HOB A;  2XKO A;  1ZLJ A;  1FSH A;  3ZMZ A;  2O6G E;  2M30 A;  4G7H F;  1P6R A;  1J0R A;  3LA7 A;  1P92 A;  1W5S A;  2VOD A;  1LDJ A;  2OZU A;  2KRF A;  2HYF A;  2HFH A;  2JTV A;  4EJU A;  2EFN A;  4KMU X;  4LLL A;  2J5O A;  1V4R A;  4HBL A;  4A0X A;  3MCZ A;  1ZRC A;  4ZYG A;  1DDN A;  3TQN A;  3R6S A;  3JAM K;  1OKR A;  3KET A;  3E6B A;  3BRO A;  2DQR A;  2CGP A;  1IF1 A;  4AVP A;  3WE2 A;  3MZH A;  2QBY A;  1R22 A;  3PQK A;  4UVC A;  1QZZ A;  4BHP A;  5K1Y A;  2FF4 A;  2VT3 A;  2E1C A;  1LQ1 A;  2MC3 A;  4M74 A;  3J7A O;  2V6C A;  2M45 A;  2V79 A;  5BPI A;  5ERI A;  2B0L A;  1PDN C;  2EK5 A;  2NRA C;  4AIH A;  4EJO A;  4BHB A;  5AIQ A;  1IXR C;  2Y75 A;  2ZME B;  3JAM Z;  1RIO H;  2Z3Y A;  2EV0 A;  3F8M A;  1LDD A;  3NRV A;  1IW7 F;  4MTE A;  1L3L A;  4IVN A;  1JHH A;  3I0T A;  4AIJ A;  2EV5 A;  4UHT A;  1UST A;  1QNT A;  2KIU A;  1LB2 A;  3I5U A;  2ZFW A;  4Y13 A;  2XAF A;  1UB9 A;  1PUE E;  1G3Y A;  1YG2 A;  1D3Y A;  5FLX K;  1FBS A;  3CO6 C;  4HW0 A;  4UNO A;  3E3V A;  2W57 A;  1JHF A;  1BC8 C;  3WTT C;  2ZXJ A;  3LQR A;  4MNU A;  5BQT A;  3ECH A;  5AON A;  4A2U A;  5E8G A;  5IT9 Z;  1DUX C;  4N9I A;  3F8C A;  2XV4 S;  5JI6 A;  4OOI A;  5FLX Z;  3V8L A;  3MFK A;  1UHW A;  1RUN A;  4LFU A;  4HX4 A;  2XRN A;  4GYI A;  4R1H A;  4ESB A;  2AS5 F;  1FC3 A;  5DD8 A;  2G7H A;  1UHM A;  2BV6 A;  3BDD A;  2JZY A;  4FHT A;  3FMR A;  1FY7 A;  2QEN A;  1BOA A;  4ZYE A;  1B9N A;  1P4W A;  2K27 A;  4HDU A;  2IJL A;  2FXA A;  2IA1 A;  3WGG A;  4ZZD A;  3R4K A;  1MDM A;  4L0Y B;  1XSD A;  5D6F A;  1XB4 A;  2XIG A;  4CXF A;  4R8H A;  3C7J A;  1SFX A;  5H20 A;  4IRG A;  2L3D A;  2E1N A;  1CF7 B;  3N4M A;  3WTS C;  1Z7U A;  3GFM A;  5LRR A;  2HS5 A;  2PN6 A;  4ETS A;  2BEO A;  3ML6 A;  1P2F A;  2PI0 A;  4KNY A;  1OYI A;  1ON1 A;  1YLF A;  1YTY A;  3QP6 A;  2GXB A;  5LBQ A;  2RNJ A;  2EB7 A;  4H0E A;  1R7J A;  3TOA A;  1ZYR F;  3QU6 A;  1XCB A;  3LST A;  2K86 A;  2J5P A;  4HZF A;  2DBB A;  2HDC A;  1T98 A;  3J80 K;  3DXJ F;  3I54 A;  1BC7 C;  2VBZ A;  3DPT A;  1MGT A;  5FFZ A;  1I27 A;  4A0Z A;  3HRT A;  3ZPL A;  1FZP B;  1DPU A;  1ZRE A;  3JSP A;  1HST A;  4IRI A;  1OMI A;  1KU3 A;  4HDV A;  3BOQ A;  3KCC A;  4XRF A;  2FBK A;  2QWW A;  3WE3 A;  4G7O F;  3SZP A;  2ESN A;  5FB2 A;  3F6V A;  2OBP A;  4XSZ F;  3DKW A;  5ICE A;  2UXN A;  2CO5 A;  2FBI A;  1WKM A;  3IC7 A;  3J80 Z;  1BI3 A;  2ZJ2 A;  3CO7 C;  3HTU A;  2UXX A;  2BYV E;  1MKM A;  2OU2 A;  2WV0 A;  2EJR A;  4KFC A;  2WC2 A;  1C0W A;  3PQJ A;  4MQ9 F;  1I5Z A;  3ZN1 A;  4P9F A;  4ZH4 F;  2HQR A;  1IXS B;  4HX7 A;  1PP8 F;  2QVO A;  4HF2 A;  5EEH A;  2ZCW A;  1OR7 A;  3HYI A;  2DPU A;  2PLY A;  2NNN A;  4TV7 A;  3P9C A;  2FNP A;  4M6X A;  4DQ2 A;  2LF8 A;  5ED4 A;  4UVB A;  5ICF A;  4RGX A;  3L2C A;  4MQV A;  4Y15 A;  1XGS A;  3HIF A;  4YFN F;  1FPQ A;  4FT8 A;  1TW2 A;  3L9F A;  3P7N A;  3FF5 A;  4XBF A;  2MH2 A;  2VOP A;  1ZGJ A;  1GHC A;  2O03 A;  2HZT A;  5KVR A;  5JFR A;  4S05 A;  1FWZ A;  3JSO A;  3QRF F;  3ZMS A;  1R1V A;  4IJA A;  1B4A A;  1G6N A;  3M1E A;  1BI0 A;  3BZ6 A;  3QP5 A;  4G7Z F;  1U5T B;  3HHH A;  4I2O A;  3L09 A;  2DTR A;  1O7L A;  1T39 A;  2M87 A;  4I0B A;  4AD9 A;  3O6B B;  4Y17 A;  2VBX A;  2HTJ A;  2Y48 A;  5FD6 A;  3V8K A;  3K1M A;  3JW4 A;  3LA2 A;  2EWN A;  1U6G A;  4O3M A;  3RPQ A;  2AXL A;  4U0W A;  1EH7 A;  1ZH5 A;  2GQQ A;  3HOT A;  3MWM A;  1LJ9 A;  3HHG A;  2BGC A;  2DPD A;  2P8T A;  2VT2 A;  2Y0M A;  2ZNZ A;  4M73 A;  4GYG A;  3ISP A;  1IRG A;  4L9N A;  2IA0 A;  4ON0 A;  1QPM A;  4HV5 A;  1TNS A;  2K4B A;  2MH9 A;  2Q8K A;  4G6D A;  5FFX A;  2CYY A;  4A12 A;  2OZ6 A;  1H9G A;  1ZGA A;  1KQ8 A;  3V4G A;  2A6H F;  1J2X A;  2ISZ A;  3F8F A;  2XUB A;  3D0S A;  2F5E A;  3WTY C;  1SAX A;  5E1W A;  4PDK A;  1HKQ A;  5AIP A;  4XSX F;  1FYK A;  1L0O C;  5L3B A;  3BJ6 A;  1XMK A;  1FLI A;  4LD5 A;  2M5W A;  2ADU A;  5TRD A;  4OIQ F;  3T5X A;  2FRH A;  2IA2 A;  2Q0O A;  2ZME A;  4A5N A;  5LHG A;  5ILS A;  3CUQ B;  4L5J A;  1LEB A;  4A6E A;  3FXQ A;  5E1X A;  5E17 F;  2F5D A;  2VOO A;  3GVA A;  5E8I A;  3WTW C;  5JR3 A;  3IWZ A;  3T8R A;  4LLN A;  4L0Z B;  4U0Y A;  1REP C;  5HLI A;  2Z99 A;  1G3W A;  2LDU A;  5DUI A;  1HSJ A;  2QM3 A;  3EUH A;  4OIN F;  2YX4 A;  5TJJ A;  3RDI A;  2V9V A;  3QOP A;  3HSR A;  4DNC A;  4GXO A;  4CGZ A;  1Z05 A;  2G9W A;  1S3J A;  5BOX A;  1P4X A;  2W85 A;  5HVQ C;  4LG0 B;  5IT3 A;  2HQN A;  4IXA A;  1G4D A;  3B73 A;  1OYY A;  3VOD A;  1S8N A;  2JPC A;  2XAG A;  4WWC A;  2A69 F;  3LA3 A;  3MAJ A;  4KDP A;  4RB3 C;  1ZRF A;  1K6O A;  4BH9 A;  1F4K A;  1W7P D;  1WSU A;  1BN5 A;  1RUO A;  4IF4 A;  4I0A A;  4RB0 A;  2Z9O A;  3CDH A;  1BI2 A;  2IT0 A;  3U9G A;  1SFU A;  3WU0 A;  4ENM A;  2M8E A;  1HKS A;  4WXD A;  4EM1 A;  2EV6 A;  2ZO4 A;  1D8K A;  4BHC A;  1FNN A;  4UV9 A;  2A5Y B;  2EFP A;  3GFI A;  2K7L A;  3HRU A;  2RC4 A;  3WG9 A;  2QUF A;  3IHU A;  5DCF A;  3MEX A;  2ELH A;  1O3R A;  1SD4 A;  3KP6 A;  4U0V A;  1YFH A;  2OAZ A;  3J81 K;  2ISY A;  1RNL A;  5LHI A;  5LEJ A;  1HBX G;  3I4P A;  1MJ9 A;  1CF7 A;  2L01 A;  1JE8 A;  3DV8 A;  2R7D A;  3Q5F A;  1J7K A;  5HLH A;  2PQ8 A;  5D8L B;  1O7F A;  3EYI A;  1XGO A;  5FGM A;  2KIM A;  3WGI A;  3JTG A;  3OOP A;  4I01 A;  3V7S A;  2DK8 A;  4KA4 A;  4U7D A;  4MEY F;  4O6J A;  5FO5 A;  1QQI A;  1BM9 A;  3J81 Z;  1Z9C A;  4LB5 A;  1FBU A;  5J8F A;  5K5Q A;  2HWV A;  1FSE A;  1W5T A;  1O3Q A;  5DD4 A;  2GAU A;  3WTU C;  4UUV A;  3HSF A;  5H6R A;  5HDK A;  2UWM A;  1Z91 A;  3M8E A;  1E17 A;  1USS A;  2P5L C;  5L3F A;  4ESF A;  1WQ2 A;  2CWE A;  1XGM A;  2COM A;  3ZQ7 A;  1NHA A;  1K78 B;  5JHU A;  2K02 A;  2YSR A;  2PMU A;  2H6B A;  3CJN A;  4EJV A;  3RPU A;  3TO6 A;  2F5C A;  1IN6 A;  4A0Y A;  3IWF A;  3QAH A;  5DDG A;  3C3W A;  1IZ1 A;  1TQP A;  3KP4 A;  5D5U B;  2GWR A;  3KP3 A;  1F5T A;  2PJP A;  3K2Z A;  3GO5 A;  1U5T C;  4EMS A;  2DO7 A;  4OIP F;  4LMY A;  2XHK A;  2L4A A;  3ZP5 A;  4EVI A;  2IP2 A;  4EV0 A;  5DV5 A;  2QQB A;  3IKT A;  1O3S A;  1Z1D A;  2YR2 A;  2OA4 A;  2EFW A;  3N97 A;  2STT A;  2ETH A;  4K2E A;  3RJP A;  2V1X A;  1HW1 A;  2LSO A;  1KQ9 A;  1ZHF A;  1HXD A;  5F64 A;  1KA8 A;  2VE9 A;  4LK1 F;  4EM2 A;  2XGX A;  1CGP A;  4GGG A;  3GYH X;  2E7W A;  3G3Z A;  3F22 A;  1KGS A;  4BNC A;  2P5K A;  4HQE A;  2E7X A;  2K4J A;  3CLO A;  1R00 A;  5HDN A;  1U3E M;  2FU4 A;  3ERE D;  2HTS A;  1YQA A;  4RGS A;  3K9T A;  1ZG5 A;  4L9T A;  4ENN A;  1XDU A;  5EEG A;  1WI9 A;  1ON2 A;  2O0Y A;  2QQ9 A;  2M1B A;  3BY6 A;  3EQL F;  1KQ0 A;  1S7O A;  3RYR A;  4RS8 A;  4M9S A;  4I09 A;  1TQI A;  5LGN A;  5ILV A;  5HLG A;  3EET A;  2FQ3 A;  3FXU A;  1FBQ A;  2FML A;  2DI3 A;  1GVJ A;  2LNB A;  4I98 B;  4QLC U;  1EH6 A;  3ZMD A;  1ZN2 A;  2NS0 A;  4BQA A;  2YPR A;  3FMQ A;  3I59 B;  2EFQ A;  4JBA A;  1BIB A;  2HYG D;  3CUQ C;  4QWQ A;  1F9N A;  3IKV A;  2QQA A;  2QZ8 A;  1ZAR A;  1XN7 A;  3COA C;  1TQM A;  3CTA A;  3NQO A;  3ECO A;  4ENJ A;  1BBY A;  1JXS A;  3GLX A;  1T6S A;  4UXN A;  5ILU A;  1LNW A;  2V1D A;  3KP7 A;  2DK5 A;  3BPX A;  2JSC A;  3KP5 A;  3VEP A;  4CIC A;  2P7C B;  3F6O A;  5LGU A;  4UVA A;  2FSW A;  3KLO A;  1DPR A;  3T8T A;  4YFK F;  1K79 A;  3DFG A;  2W24 A;  1SD6 A;  4EGY A;  3ZMV A;  3SFZ A;  1ONV A;  4OIR F;  2C6Y A;  3U1D A;  4A5M A;  1OPC A;  3V7R A;  2EA2 A;  2H6C A;  4RAY A;  1R1U A;  4M6Y A;  1IN7 A;  2DAO A;  3ZMU A;  1STZ A;  4WXC A;  4BAY A;  4XLN F;  5E18 F;  3U2R A;  4ZYD A;  3W6J B;  1R58 A;  1AOY A;  2XVC A;  5D5X B;  3E5X A;  2D1V A;  2X0L A;  1K7A A;  2HKO A;  3HUG A;  3L7W A;  4U88 A;  3GF2 A;  1PP7 U;  3F8B A;  1YS6 A;  3LAJ A;  2JT1 A;  2P6T A;  2JRT A;  1J59 A;  3OV8 A;  4OMY A;  3I58 A;  5CVV A;  2D45 A;  1I1S A;  2YU3 A;  3TO9 A;  4JK1 X;  3WOD F;  3EDP A;  1H9T A;  5CJ9 A;  3E6M A;  3P9K A;  1A04 A;  4G94 A;  2V1U A;  1HKT A;  1IUY A;  3S2W A;  2BBY A;  2VON A;  4LK0 F;  4Q4Z F;  4KYW A;  1FYL A;  3AAF A;  3I53 A;  4HLX A;  1IN5 A;  4KIB A;  4BYY A;  4M72 A;  3GX4 X;  2RGV A;  2NYX A;  4HLY A;  1KYZ A;  2CQK A;  4I7H A;  2P6S A;  3NEU A;  2D1H A;  1U2W A;  3C1D A;  3RI4 A;  2ZBK A;  1XSV A;  3L00 A;  4GO1 A;  1B59 A;  2G7U A;  3R61 A;  2VBW A;  1FP1 D;  2HGC A;  1ZRD A;  1MZB A;  3GXO A;  3GWZ A;  2A61 A;  5LLQ A;  3GZ5 A;  3WGH A;  3QPH A;  2DU9 A;  4CYD A;  4LG0 A;  1WWX A;  3C18 A;  3FWE A;  2RQP A;  3WU1 B;  5LRS A;  3HRS A;  3H3U A;  1YIO A;  1TNT A;  4L18 B;  3RTR A;  4UV8 A;  3LFK A;  4U7B A;  1P4A A;  4B8X A;  3FM3 A;  3DPL C;  5D5V B;  3Q9S A;  3E5U A;  2HKX A;  4KT5 C;  4CO8 A;  3MQ0 A;  1T38 A;  4IRH A;  1W7P B;  4EJT A;  2R7F A;  5HOO A;  2ESH A;  3Q9V A;  2L4M A;  3GFL A;  1B1B A;  4GCV A;  5CLS A;  4G9Y A;  1FOK A;  5D5W B;  1KU9 A;  4N0B A;  5J8C A;  2DW4 A;  3BPV A;  1V3F A;  2CFX A;  2EA4 A;  2XRO A;  3E5Q A;  1ZG3 A;  3DF8 A;  2FOK A;  1B9M A;  1BI1 A;  3EYY A;  1TLH B;  3WTV C;  1T2K A;  3BWG A;  3V7C A;  2FEZ A;  2CW0 F;  3DQV C;  5DCM B;  2GXG A;  2XAS A;  3P9I A;  1JGS A;  2UZK A;  4HQM A;  4YFX F;  1KYW A;  4OU0 A;  3MZY A;  2FBH A;  2HOE A;  3VFZ A;  5ICC A;  2XKP A;  2H94 A;  2R3S A;  2GA1 A;  1XDS A;  3M8F A;  3GW2 A;  5D4S A;  4WK8 F;  4ENK A;  3R0J A;  4BXU A;  1WRJ A;  4CZZ A;  3GEZ A;  2PFB A;  2EFO A;  4L9J A;  1BIA A;  4YII A;  1XSX A;  1YO5 C;  1RZ4 A;  3G73 A;  2LF7 A;  1ZG1 A;  4M71 A;  3FZV A;  2MD5 A;  2ACJ A;  2NAZ A;  2IPQ X;  2A68 F;  3KLN A;  2XAQ A;  1K78 A;  1IXC A;  4A6D A;  2RN7 A;  2WWY A;  5IT9 K;  5L3G A;  1FYM A;  3BJA A;  1FP2 A;  3SHF A;  1TBX A;  4WX9 A;  4D0P A;  2DLL A;  2Z5U A;  3SQN A;  2QLZ A;  2RVC A;  3I64 A;  2DT5 A;  3TGN A;  4RB2 C;  3F8N A;  1VTN C;  1ZAO A;  2QBY B;  4MTD A;  1H0M A;  2VXZ A;  1XMA A;  5KK1 A;  2MA3 A;  2FMY A;  3M9A A;  3H3Z A;  3K1N A;  1YYV A;  1G3T A;  4P5O A;  4NQW A;  3ULQ B;  4L5I A;  5DEQ A;  3BJO A;  2FE3 A;  2PEX A;  3HTS B;  4KN7 X;  2CSO A;  1LEA A;  3F23 A;  5D6E A;  3FM5 A;  3FX3 A;  2VC0 A;  1T0F A;  1F1Z A;  2A07 F;  3IRQ A;  4RB1 A;  4ESJ A;  4Q5S F;  3QPT A;  4AWX B;  1UFM A;  3E6D A;  1E2X A;  1O57 A;  4ZYH A;  5D4R A;  1HW5 A;  2GIV A;  3F21 A;  2ZKZ A;  3F3X A;  6PAX A;  5BS6 A;  1U78 A;  1ZLK A;  3VB2 A;  1Q1H A;  5J6X A;  2VN2 A;  1KU7 A;  2RDP A;  4LLG F;  1EV7 A;  3FXR A;  3JTH A;  4G8X A;  4KMF A;  2F2E A;  5E1Z B;  1AWC A;  1UCR A;  3M7G A;  3QU3 A;  4WF2 A;  2PMH A;  1G3S A;  1DP7 P;  2VC1 A;  4EQQ A;  4B09 A;  5BMZ A;  2PG4 A;  3B02 A;  2L54 A;  2XAJ A;  3SZT A; 
#chains in the Genus database with same CATH topology
 1VQ9 I;  2HEO A;  2CV1 A;  4B48 A;  1JKR C;  4AM3 A;  1X3U A;  2DQL A;  2MD0 A;  4KIF A;  3T0Y A;  5K5R A;  1W4M A;  2CS3 A;  4HF0 A;  5L3D A;  4FE7 A;  1TWF J;  2KKO A;  2X4H A;  2X6O A;  1UG2 A;  1IRF A;  3OSF A;  2VJ5 A;  3FMS A;  2BZT A;  4HAM A;  5DTD A;  1D8J A;  2ECB A;  2KFD A;  2XAH A;  1QHG A;  2KIS A;  3GZ6 A;  5B3S H;  1GXQ A;  3I59 A;  2VBY A;  4WCG A;  4RBO A;  1SMT A;  3AG1 H;  2LH9 A;  4W1U A;  4BS9 A;  2GZW A;  5CVI A;  2DMU A;  2ZNY A;  4IO9 F;  2B63 J;  2IRF G;  1R71 A;  5DYM A;  3OYG A;  4XON A;  3JRI A;  3RKY A;  4F92 B;  2H1L A;  3WTZ A;  4MGR A;  2YU9 J;  2RQQ A;  1OCC H;  3T1B A;  4BGD A;  3IRR A;  3JRC A;  4LIU A;  3Q0W A;  1RRJ A;  2IVM A;  1JJ6 C;  1Y8Q B;  2HR3 A;  2O8X A;  2P4W A;  4OMZ A;  2Q2E A;  4PUS A;  1D5V A;  1X19 A;  3ABT A;  3ZN0 A;  4BDZ A;  2A6E F;  4A3L J;  3DKX A;  4WXH A;  3VYR B;  4AYB N;  1IN8 A;  3ELK A;  1WCM J;  2KIF A;  1GDT A;  1S6L A;  4Q47 A;  1I3A A;  2RKH A;  1DU0 A;  2MLG A;  1TW3 A;  3FXM A;  2QGU A;  3LAP A;  3R60 A;  4EM0 B;  1YW8 A;  3HBL A;  3DP7 A;  4B4C A;  4X1E A;  4NB5 A;  2OV7 A;  2F5F A;  1HCR A;  5CVU A;  1MDM B;  4KUM A;  3DEW A;  4PZJ A;  2CJJ A;  2D2W A;  2LKP A;  1R36 A;  2RV8 A;  2V26 A;  3D5L A;  1M1E B;  1GXP A;  3W6K B;  4Y7N J;  1WFX A;  3KP2 A;  4N9H A;  5HS7 A;  5C4X J;  3MVP A;  3TW7 A;  1U5T A;  2W4S A;  4HX8 A;  4ASN A;  3E97 A;  4DYR A;  1SMY F;  2IW5 A;  1Q1V A;  2TDX A;  2EH3 A;  2DTZ A;  5LGT A;  1QZY A;  5K7Z A;  1HLV A;  4OIO F;  2WTE A;  3LWF A;  4R79 A;  3SJM A;  4XQF A;  3RKW A;  4XLP F;  1D1A A;  3RYP A;  4ZDL A;  1J75 A;  1R1T A;  4J01 A;  4BEH B;  5HS8 A;  2STW A;  3KZZ A;  2BHY A;  2LBF A;  3HSE A;  3OYM A;  1FT9 A;  1IN4 A;  2YX7 A;  1R5G A;  4EJW A;  2IS2 A;  3QYB A;  2OQR A;  1YW9 A;  3OS2 A;  3CUO A;  2ID6 A;  2P7V B;  3O3K A;  4LIT A;  4IHT A;  1LUJ B;  1MNM C;  3S2D J;  2FNA A;  4LJZ F;  4HNV A;  4E6K G;  2BE5 F;  3LSI A;  4FX0 A;  2KDZ A;  3OIO A;  3QYF A;  3ROU A;  3RKX A;  1NK2 P;  3BG5 A;  1X1B A;  3BTC A;  2O3F A;  1S29 A;  5BPD A;  4Y52 J;  3CJR B;  2BOL A;  2VJ4 A;  3SFI A;  1WJF A;  3GFJ A;  2QSG X;  1YS7 A;  2CQX A;  1HOM A;  2F6C A;  4M9Z A;  1Z0X A;  2MBF A;  3TDU C;  3I71 A;  4YG2 F;  2DDA A;  4HF1 A;  2A3S A;  3TOB A;  4HST A;  2R0Q C;  2IGN A;  1LVK A;  5CVJ A;  4YIF A;  1X3W B;  4F55 A;  4KN4 X;  5A2Q K;  2BY0 A;  1SVO A;  5CVR A;  5M3M J;  4E7K A;  3REO A;  3W6V A;  3ABU A;  3OYF A;  2FA5 A;  3FHZ A;  1LFU P;  2XDV A;  1FX7 A;  1YW7 A;  2KPM A;  3ZQG A;  1BL0 A;  4RGU A;  1ODD A;  5JVT A;  3HRM A;  4PJL A;  1XCV A;  1J5Y A;  2GA2 A;  3RPU D;  3GCM A;  1MD0 A;  2LG4 A;  2LKS A;  1LDK B;  4KIC A;  3TDZ C;  4YIR X;  3K0L A;  2ZXH A;  1EH8 A;  4D7N A;  4F7Z A;  1BJA A;  1XD7 A;  3KFW X;  4BU2 A;  1B6A A;  3H9G A;  5EZH A;  4ZDP A;  3LSJ A;  3DEU A;  4RGR A;  2I10 A;  4XLC A;  4E70 A;  4IOA F;  3VDX A;  5E20 A;  1AHD P;  1OFC X;  3K1P A;  1Z6R A;  3BP8 A;  4HYE A;  3TKY A;  2O61 A;  2NNY A;  2LRE A;  2TCT A;  4A3J J;  1ENH A;  2M4K A;  1FIP A;  1XS9 A;  3PFI A;  2H27 A;  2DYR H;  2KJC A;  4FX4 A;  4Q48 A;  3VOE A;  5A2Q Z;  1IC8 A;  2VE8 A;  1U8R A;  1QBJ A;  1O3T A;  4C2U A;  4P55 A;  3DU5 A;  4CDG A;  1D1C A;  5L3E A;  4MEX F;  3R0A A;  3KEQ A;  1S7A A;  4XID A;  5D8K B;  4I02 A;  1XC5 A;  1QRY A;  4FQG A;  3F72 A;  4P9U A;  1J9I A;  4LGW A;  5EYR A;  4GRI A;  3ZQH A;  1R4M B;  1KU2 A;  5HDG A;  4KJZ A;  5LHH A;  2HZD A;  3CME I;  4XLE A;  1IJW C;  1UMQ A;  2DFI A;  2QYO A;  3H92 A;  3M3Y J;  3NAU A;  1SFE A;  3CUQ A;  3ZMT A;  3CDI A;  2HDW A;  1TTY A;  2K9S A;  1QO0 D;  4CHU A;  4IHS A;  1G2H A;  3FK7 A;  2B9S A;  2CQN A;  4RM2 A;  1H89 C;  5FRN A;  4ZZL A;  3JRB A;  3OYD A;  3KZY A;  3S2H J;  2H09 A;  2E2J J;  1HW2 A;  4RAZ A;  3BCA A;  4ANJ A;  4MHG A;  1Z6T A;  5J47 A;  2KP6 A;  2WV1 A;  3O2P E;  4Z2Y A;  2KJB A;  2W84 A;  4PGG A;  4AC0 A;  4A3M J;  2LTP A;  5DUK A;  1W7P A;  4P96 A;  2O7O A;  1MJA A;  5GAH J;  4PCQ A;  3TO7 A;  1SD5 A;  3AG4 H;  4RLQ A;  2L02 A;  3S1R J;  1PYV A;  2VKV A;  5M5Y J;  3OMY A;  3DCF A;  4M3G A;  2KRH A;  1GLN A;  3RIR A;  3VPR A;  1XGN A;  2HVR A;  2E2H J;  4JQF A;  3V8J A;  2BY3 A;  2OQG A;  3C2B A;  3BQY A;  4S04 A;  3GTQ J;  5CYV A;  2CG4 A;  2JPB A;  3PFY A;  3LQQ A;  4M9X A;  5HS9 A;  1Y0U A;  2NOJ B;  1MJB A;  4G6Q A;  3CCJ I;  1IAW A;  4HV6 A;  4PGH A;  1OIS A;  1X1D A;  4L9V A;  4IPA A;  3E6C C;  1ULY A;  3BR3 A;  2Z33 A;  4PJN A;  3BTJ A;  1QGP A;  2IEK A;  3S3N A;  4RMN A;  1PJR A;  3C2G A;  2PBI A;  4KIG A;  3L2V A;  4PSW A;  3K69 A;  5ICG A;  1EKE A;  5F1R A;  4OAY A;  3WHB A;  2CRG A;  5F6F A;  2NVY J;  4EGZ A;  2MLK A;  1YX5 A;  2L7F P;  1E3H A;  3J7A Y;  3I4N J;  5DCM A;  3IL2 A;  2K9Q A;  3KEO A;  1OYW A;  4A3C J;  2W25 A;  1Z3X A;  2WB1 N;  2QEX I;  3GUD A;  2EZH A;  4NHJ A;  3KE2 A;  2EBI A;  1I6X A;  3E0J B;  4ZJZ A;  5H6Q A;  1SAU A;  1RI7 A;  3HOS A;  4LB6 B;  3ABM H;  4HA8 A;  3QQA A;  4Y33 A;  3DLL F;  4AIK A;  5FD5 A;  5K5O A;  1SD7 A;  2P5V A;  4QSH A;  2QA4 I;  2HQA A;  4O5V A;  1WI3 A;  2EIK H;  2R7R A;  3CCL I;  4RLF A;  2WA0 A;  4G12 A;  4BE2 A;  1HQC A;  2IS1 A;  5E79 C;  3TP0 A;  4D5C A;  1R5H A;  1R23 A;  2DT7 B;  3H5N A;  3SXY A;  2NVQ J;  4X0G A;  2OD5 A;  3HEF A;  2Q1Z B;  5LD2 C;  1I1G A;  5LEK A;  3WTX C;  2JN6 A;  2K9N A;  5L3C A;  1LVA A;  3QYE A;  4HOB A;  2XKO A;  1ZLJ A;  3I56 I;  1FSH A;  3ZMZ A;  2O6G E;  2M30 A;  4G7H F;  4BQO A;  1P6R A;  3VSL A;  4NUB A;  1J0R A;  3S17 J;  1V54 H;  5F0H A;  1A35 A;  3LA7 A;  2X6X A;  2X9D A;  3UKG A;  1IDY A;  2JA7 J;  1P92 A;  1W5S A;  2VOD A;  4BJ6 C;  3FBN B;  3CCM I;  3HG9 A;  1LDJ A;  5CPR B;  2ZXI A;  1HDP A;  1R5I D;  2L9S A;  2OZU A;  2DN0 A;  2KRF A;  1LKX A;  1HA8 A;  3BR2 A;  2HYF A;  2DFE A;  2HFH A;  2JTV A;  5GAE J;  1JUP A;  3BLY A;  1BR4 A;  4EJU A;  2EFN A;  4KMU X;  4LLL A;  3CLQ A;  4PJM A;  2IS6 A;  2J5O A;  2YUS A;  1HDD C;  1V4R A;  3AFH A;  3PJR A;  1WJC A;  4HBL A;  4A0X A;  3MCZ A;  1ZRC A;  4A3G J;  4ZYG A;  1DDN A;  3TQN A;  3R6S A;  3A1Y A;  3JAM K;  5H2F C;  2W48 A;  1OKR A;  3KET A;  3E6B A;  3BRO A;  2VIX A;  5IY5 H;  1U9N A;  2DQR A;  2CGP A;  1IF1 A;  4AVP A;  3WE2 A;  3ZQF A;  4HEA 2;  3MZH A;  2QBY A;  1AU7 A;  3MKL A;  2WB1 A;  1R22 A;  2CQQ A;  2KMU A;  1WJA A;  3PQK A;  4UVC A;  1HF0 A;  1QZZ A;  4BHP A;  5DS9 A;  5K1Y A;  3OS0 A;  1SFO J;  2FF4 A;  2VT3 A;  2R92 J;  2E1C A;  1LQ1 A;  2MC3 A;  2F4O B;  4M74 A;  4ABZ A;  4G6T B;  1LFP A;  2W82 A;  3ZXS A;  2R7Z J;  3J7A O;  1A36 A;  3OR2 C;  2V6C A;  1MMN A;  2M45 A;  2V79 A;  2XB0 X;  5BPI A;  1FTT A;  5ERI A;  2B0L A;  3DBL B;  1SEU A;  1A6Q A;  1PDN C;  2EK5 A;  4UUS B;  2NRA C;  4AIH A;  4EJO A;  4BHB A;  4IKF A;  5AIQ A;  2EPF A;  4C3I J;  4KIS A;  1IXR C;  2Y75 A;  4XLH A;  2MG4 A;  1E3P A;  2L2O A;  3NWT A;  3O8H A;  2ZME B;  3BG3 A;  3JAM Z;  1NH3 A;  1RIO H;  2R4G A;  1Y56 A;  2ELJ A;  1MSF C;  4EEF G;  1XPX A;  2Z3Y A;  4UB8 C;  2EV0 A;  2Y69 H;  2JA2 A;  3F8M A;  1LDD A;  3DU6 A;  3NRV A;  1IW7 F;  2DA5 A;  2HNH A;  2L9N A;  4MTE A;  1L3L A;  3LFU A;  4XM3 A;  4IVN A;  2AQE A;  1JHH A;  3O8G A;  5JHF A;  3I0T A;  4AIJ A;  2EV5 A;  4UHT A;  1UST A;  1QNT A;  3BZC A;  3OYJ A;  3GTG J;  2KIU A;  1LB2 A;  2CQ7 A;  4C3H J;  1K6Y A;  3I5U A;  3MKW B;  3HL2 A;  1CQT A;  4XKC A;  1W36 C;  2ZFW A;  2CW7 A;  4Y13 A;  2XAF A;  4HRI A;  2R7U A;  1ZTR A;  1UB9 A;  2L5Q A;  1PUE E;  3FXL A;  3S8P A;  1UEL B;  1G3Y A;  1OJL A;  1YG2 A;  1D3Y A;  5FLX K;  3AL0 B;  4II2 A;  1FBS A;  2IGK A;  3CO6 C;  5IYD J;  4HW0 A;  3N05 A;  4UNO A;  3E3V A;  3FXO A;  2W57 A;  1K4T A;  1JHF A;  4FTH A;  2F48 A;  1BC8 C;  3WTT C;  3ABK H;  2ZXJ A;  3LQR A;  4MNU A;  3ASO H;  3F0C A;  5BQT A;  3CJQ B;  5FKN A;  3ECH A;  5AON A;  1VND A;  4A2U A;  1X2M A;  3NAR A;  4LG3 A;  5E8G A;  5IT9 Z;  5EGO B;  1DUX C;  3KPH A;  2M4G A;  4N9I A;  3F8C A;  4E7H A;  2XV4 S;  3Q0V A;  5JI6 A;  1FOW A;  4OOI A;  2KDO A;  5FLX Z;  3CCR I;  1EA3 A;  3V8L A;  3K2A A;  4CYC A;  3MFK A;  1QZE A;  1UHW A;  1RUN A;  4LFU A;  5IP7 J;  3IAS 2;  4B3A A;  3OYK A;  3S1Q J;  3S1M J;  4HX4 A;  2XRN A;  4GYI A;  2ZJP F;  4R1H A;  4ESB A;  2AS5 F;  2GM4 A;  4CA0 A;  3HOZ J;  5IOY A;  1UHS A;  1FC3 A;  1U8B A;  5DD8 A;  3CP2 A;  1IRX A;  2G7H A;  3PO3 J;  1UHM A;  2BV6 A;  3BDD A;  2JZY A;  4FHT A;  2DMT A;  4C3J J;  3VYU B;  2IS4 A;  3FMR A;  2BW3 B;  2M0M A;  1FY7 A;  2QEN A;  1XX5 A;  3L2W A;  2VKE A;  1VI0 A;  4UY8 I;  1LFB A;  3QPL A;  1BOA A;  3NWS A;  1V5G A;  3CCV I;  4ZYE A;  1D0Z A;  1B9N A;  1P4W A;  5BNG A;  2K27 A;  1N75 A;  3H3V K;  1APL C;  4HDU A;  1PUF B;  2IJL A;  2HVS A;  3H0D A;  2JA6 J;  2FXA A;  3AG2 H;  3OIQ A;  3S93 A;  2IA1 A;  3GME A;  3WGG A;  4ZZD A;  3PIO F;  3R4K A;  1YHQ I;  1MDM A;  4L0Y B;  1XSD A;  2OTJ I;  5D6F A;  2M3A A;  1XB4 A;  2XIG A;  4CXF A;  2H8R A;  1ZGW A;  4R8H A;  2FJ1 A;  1XMX A;  2KZG A;  4I99 C;  1T95 A;  3C7J A;  1MBJ A;  1MBH A;  1SFX A;  5H20 A;  4IRG A;  2L3D A;  4BY1 J;  2LVS A;  2VJJ A;  3S14 J;  3S15 J;  2E1N A;  5EF6 A;  1CF7 B;  2QQ8 A;  2BY1 A;  3OYH A;  3X2Q H;  3WTS C;  3N4M A;  1X1A A;  1WJ5 A;  2HI3 A;  1Z7U A;  2R7Q A;  1VFC A;  1Z77 A;  2EIN H;  3GFM A;  2DFH A;  2FOW A;  3SYT A;  3P5J A;  5LRR A;  2G0E A;  2HS5 A;  2PN6 A;  2VQH A;  1G59 A;  4H4K C;  4ETS A;  2BEO A;  3ML6 A;  4XRS G;  3M1C A;  2HXI A;  2H8W A;  1P2F A;  2PI0 A;  1T8I A;  4KNY A;  2TRT A;  5FKL A;  1OYI A;  1ON1 A;  4CSW A;  3OL3 A;  3A02 A;  1YLF A;  1YTY A;  3QP6 A;  2GXB A;  5LBQ A;  3OYL A;  2RNJ A;  2EB7 A;  1MBE A;  3A4C A;  4H0E A;  1YRN B;  1R7J A;  2HU9 A;  2R7V A;  1GV2 A;  1LPQ A;  3TOA A;  1ZYR F;  4PSX A;  3PUB A;  3CC2 I;  5F27 A;  4PFP A;  3QU6 A;  1XCB A;  1OR7 C;  1QVU A;  3LST A;  2CH0 A;  2K86 A;  2J5P A;  4HZF A;  2DBB A;  3ZQC A;  2HDC A;  1T98 A;  2VI6 A;  2GOX B;  2XSJ C;  4RM3 A;  4E7Z A;  2VJI A;  3J80 K;  4IOC F;  3DXJ F;  4M6V A;  3I54 A;  4I76 A;  1BC7 C;  2VBZ A;  3DPT A;  1MGT A;  2E5Z A;  5FFZ A;  2BXZ A;  2CFO A;  1I27 A;  4A0Z A;  2R5Y A;  1TWC J;  3K10 A;  3HRT A;  2NVX J;  3ZPL A;  2GBY A;  1FZP B;  1DPU A;  1ZRE A;  2Y30 A;  3CP8 A;  3JSP A;  3JRA A;  1U0J A;  1OCP A;  5LFA A;  1HST A;  1OCR H;  2PMZ N;  1YE9 A;  4IRI A;  3OWT A;  1OMI A;  1KU3 A;  3OYC A;  4HDV A;  3UNG C;  3BOQ A;  3KCC A;  4XRF A;  2FBK A;  2QWW A;  5K7H A;  3WE3 A;  4G7O F;  3SZP A;  1RR7 A;  2ESN A;  5FB2 A;  3F6V A;  2NS8 A;  2COB A;  3TED A;  2OBP A;  4XSZ F;  3DKW A;  2NS7 A;  5ICE A;  2UXN A;  2CO5 A;  1DQU A;  3L2Q A;  5M3F J;  4BDY A;  3WU2 C;  3K4C A;  2A6T A;  2AO9 A;  2FBI A;  1WKM A;  3IC7 A;  3J80 Z;  1BI3 A;  1JT6 A;  1XTA A;  2ZJ2 A;  4DJA A;  1A31 A;  3CO7 C;  1DGR M;  3HTU A;  4BXX J;  2UXX A;  2BYV E;  1V5E A;  2DJN A;  1MKM A;  2CUF A;  2OU2 A;  2WV0 A;  3LSH A;  4PJ0 C;  4DBR A;  5JVG F;  5GTI C;  2EJR A;  4KFC A;  2ZJR F;  3ASN H;  2WC2 A;  3PUF A;  1C0W A;  2NOG A;  3K4M A;  3PQJ A;  5GP9 A;  2BHZ A;  4ZDO A;  4MQ9 F;  1I5Z A;  5EJC A;  3ZN1 A;  4P9F A;  4ZH4 F;  2EIJ H;  1MW7 A;  2HQR A;  1IXS B;  3H35 A;  4HX7 A;  1PP8 F;  1EJ9 A;  3DPU A;  2QVO A;  4HNT A;  3H1C A;  1FEX A;  4HF2 A;  5EEH A;  1AA7 A;  2ZCW A;  1OR7 A;  3HYI A;  3IV5 A;  2DPU A;  2PLY A;  2VB6 A;  2NNN A;  4V2F A;  3PNY A;  3G4S I;  5F08 A;  4TV7 A;  3P9C A;  2FNP A;  2QSF X;  2A5W A;  3TP3 A;  4M6X A;  4DQ2 A;  3OY9 A;  2JUG A;  3I4M J;  2Y0S A;  4V19 K;  2LF8 A;  3LSR A;  2E19 A;  2HVQ A;  4Y3O A;  3HOU J;  2F5V A;  2AXT C;  3DBR B;  5ED4 A;  4UVB A;  4DOZ A;  5ICF A;  3G1M A;  4BAC A;  3S3M A;  4RGX A;  3L2C A;  5M5X J;  2M7B A;  5IYC J;  4BQQ A;  4MQV A;  4Y15 A;  1WPK A;  1XGS A;  3HIF A;  4YFN F;  2H1K A;  1FPQ A;  4FT8 A;  1TW2 A;  2PMZ A;  3L9F A;  4A93 J;  3P7N A;  4CCN A;  2K9M A;  3FF5 A;  4U87 A;  2JVG A;  3SDG A;  3K7A J;  1IGN A;  2X48 A;  3QOD A;  2NXN B;  5F0C A;  2W00 A;  4XBF A;  1NG7 A;  2MH2 A;  2VOP A;  1ZGJ A;  4AU7 A;  2BVL A;  2O03 A;  1GHC A;  2HZT A;  3K4B A;  4NDL A;  5KVR A;  2XGC A;  5JFR A;  4B47 A;  1MBF A;  3LSM A;  3IH2 A;  4S05 A;  1FWZ A;  3GBG A;  3JSO A;  1FJL A;  3L2U A;  3LSP A;  4N4N B;  3QRF F;  3CC4 I;  3QWL A;  4KIT B;  2DMQ A;  3ZMS A;  4BBS J;  1R1V A;  1MSE C;  4IJA A;  1B4A A;  1G6N A;  4CCL A;  1D0X A;  3M1E A;  2M9H A;  3UR3 C;  1BI0 A;  3BZ6 A;  3QP5 A;  2VPL A;  1WVR A;  1TL8 A;  2ECC A;  4G7Z F;  1U5T B;  3HHH A;  1JUM A;  1B8I B;  4I2O A;  5FKK A;  1IUF A;  3J7Y J;  3L09 A;  2DOD A;  2DTR A;  1O7L A;  1T39 A;  1RR8 C;  2M87 A;  4I0B A;  4AD9 A;  3O6B B;  4Y17 A;  2VBX A;  4I6Z A;  2XPU A;  2HTJ A;  4E7I A;  1JKO C;  2Y48 A;  4F3Q A;  2ZSH B;  3V8K A;  5FD6 A;  5CKT A;  5J4V A;  3IAM 2;  2QKM B;  3K1M A;  3JW4 A;  3LA2 A;  2EWN A;  1U6G A;  1TWH J;  4O3M A;  3RPQ A;  3FHN A;  2CMP A;  2AXL A;  5J1Y A;  2JA8 J;  4U0W A;  4IHY A;  2ZME C;  5M5W J;  1EH7 A;  1ZH5 A;  2R7O A;  2GQQ A;  3BCB A;  4BE1 A;  1NG6 A;  1N78 A;  3L1P A;  3HOT A;  3MWM A;  2OCE A;  1LJ9 A;  3HHG A;  2BGC A;  3HOV J;  2XGE A;  2LOO A;  2DPD A;  2P8T A;  2VT2 A;  1FIA A;  2Y0M A;  2OJE D;  2ZNZ A;  4JYK A;  4M73 A;  1F43 A;  4GYG A;  2DCE A;  3ISP A;  4BJ5 C;  1G8X A;  1IRG A;  1E0E A;  3A0H C;  4L9N A;  2IA0 A;  4ON0 A;  1QPM A;  1ZQ3 P;  3Q3S A;  3PSI A;  4HV5 A;  4D1Q A;  1QPI A;  1TNS A;  2K4B A;  2MH9 A;  4XKB A;  4A3I J;  1WJB A;  2VLA A;  1W0U A;  2Q8K A;  2DYS H;  1X3Z B;  2JWT A;  4G6D A;  5FFX A;  2KZV A;  2CYY A;  1D5Y A;  1Y0N A;  3DBH B;  4A12 A;  2OZ6 A;  1H9G A;  3AL0 C;  2ZXW H;  4DW6 A;  1ZGA A;  3CC7 I;  1KQ8 A;  3EUH C;  3J7Z I;  3DEE A;  2X1D A;  3V4G A;  4A69 C;  3BTL A;  1R6R A;  2A6H F;  1J2X A;  3M07 A;  1Y8R B;  2ISZ A;  3CES A;  2ELK A;  2WAF A;  3MMY B;  3F8F A;  3TL4 X;  3G1O A;  2NVT J;  2XUB A;  3D0S A;  2F5E A;  3WTY C;  3PNT A;  3BR1 A;  1RC9 A;  1SAX A;  2XB5 A;  5E1W A;  4PDK A;  2L7M P;  3D5R C;  3CCU I;  1HKQ A;  5AIP A;  4XSX F;  1FYK A;  1L0O C;  5L3B A;  3BJ6 A;  3BTI A;  1TWA J;  2LRD A;  2F4I A;  4RA2 A;  3KZI C;  1UJ8 A;  1A5J A;  1XMK A;  1TC3 C;  1QVT A;  1FLI A;  4LD5 A;  2E35 A;  2M5W A;  4V2G A;  3BG6 A;  2ADU A;  5TRD A;  4IHW A;  4OIQ F;  3FKJ A;  3BQZ A;  3T5X A;  5HNH A;  3U21 A;  2MGQ A;  3DWL E;  2Y9Y A;  4UUS A;  2FRH A;  2VUM J;  4FE4 A;  4Y4R A;  3RQI A;  2ZB9 A;  4HSR A;  4A3D J;  2IA2 A;  2Q0O A;  2FUG 2;  2ZME A;  3HUG B;  3IH4 A;  4A5N A;  5LHG A;  5ILS A;  3CUQ B;  2E34 A;  1VQ5 I;  3CJT B;  3Q0U A;  4L5J A;  1YIJ I;  4MFD A;  4QPQ A;  2DOF A;  4F52 A;  4NC8 A;  2B7E A;  1LEB A;  2K5C A;  4A6E A;  4YEL A;  3FXQ A;  5E1X A;  1B72 B;  2E1O A;  3KEY A;  5E17 F;  4D5F A;  5J1U A;  3BT9 A;  1ZR4 A;  2WY8 Q;  1YJW I;  2F5D A;  2LFB A;  2PJR A;  3HKZ A;  2VOO A;  2ZFU A;  3GVA A;  5E8I A;  3WTW C;  5JR3 A;  2WY7 Q;  3IWZ A;  3HOW J;  4XKV A;  3T8R A;  4LLN A;  1OQY A;  2AQF A;  3JCU C;  4L0Z B;  1BOB A;  3PL8 A;  2L0K A;  4U0Y A;  3FBI B;  4C9Y A;  2VPR A;  1REP C;  1I3Q J;  3OOU A;  1X58 A;  3QPS A;  1W1W E;  2LYC A;  1X2N A;  5HLI A;  4GFB A;  2Z99 A;  1G3W A;  2LDU A;  5DUI A;  1HSJ A;  2QM3 A;  3EUH A;  3OSG A;  4OIN F;  2YX4 A;  5TJJ A;  3VSK A;  4XNF A;  3ESW B;  1BR2 A;  1RKW A;  3RDI A;  1K61 A;  3OR1 C;  2V9V A;  4HPQ A;  3QOP A;  2AHQ A;  3HSR A;  2E5N A;  4YEJ A;  5DM6 F;  2CUJ A;  1Y1V J;  4DNC A;  4GXO A;  4CGZ A;  2FQ4 A;  5HLT A;  3HGG A;  1Z05 A;  2G9W A;  1S3J A;  5BOX A;  3KIO A;  1P4X A;  3W3C A;  1S9H A;  4RAG A;  2JK3 A;  2WAQ A;  5J40 A;  1U9O A;  3MD2 A;  2W85 A;  2O8K A;  3A2K A;  3H36 A;  5HVQ C;  5GPC A;  2E2I J;  4LG0 B;  5IT3 A;  2I8D A;  1T56 A;  2HQN A;  2W1O A;  4JX5 A;  1I39 A;  4IXA A;  4XK4 A;  1G4D A;  3B73 A;  3G1L A;  1OYY A;  3VOD A;  5FKM A;  1S8N A;  2R5Z B;  2JPC A;  4S0H B;  1QA6 A;  2LK2 A;  5B66 C;  2HYJ A;  2XAG A;  4WWC A;  2A69 F;  3LA3 A;  1ETO A;  2DOA A;  2CV0 A;  3MAJ A;  2RAE A;  4KDP A;  4RB3 C;  1Y6I A;  3EUA A;  4ZTJ A;  1ZRF A;  3JR9 A;  1K4S A;  1K6O A;  5FJ8 J;  2CUZ A;  4BH9 A;  5B1B H;  2XC7 A;  1F4K A;  1W7P D;  1P7J A;  3VYT B;  1WSU A;  1BN5 A;  1QHH D;  3MZ8 A;  4CCO A;  1RUO A;  2DFF A;  1ZK8 A;  2LR8 A;  4IF4 A;  4D7M A;  2BW3 A;  4I0A A;  4RB0 A;  2Z9O A;  1ETK A;  3CDH A;  2KQR A;  1BI2 A;  3LOC A;  1OCZ H;  3PM1 A;  3TBI A;  2IT0 A;  3U9G A;  2Y2Z A;  1SFU A;  4MO7 A;  3ZQQ A;  1OCT C;  3WU0 A;  4ENM A;  1X4P A;  2XF6 A;  2I5U A;  4XLA A;  2M8E A;  1HKS A;  4WXD A;  4EM1 A;  5CQG A;  2EV6 A;  2ZO4 A;  2JA5 J;  1D8K A;  4BHC A;  1FNN A;  3GTK J;  1PUF A;  4UV9 A;  2A5Y B;  2EFP A;  3GFI A;  2K7L A;  3S1N J;  3HRU A;  2RC4 A;  4FIS A;  3WG9 A;  2QUF A;  3E1S A;  4XN3 A;  3IHU A;  5DCF A;  3MEX A;  2ELH A;  3KYC B;  1O3R A;  1UAA A;  4CCJ A;  1SD4 A;  3KP6 A;  4U0V A;  1YFH A;  4OWR B;  2OAZ A;  4B3X A;  4BJT A;  2LP0 A;  3J81 K;  2ISY A;  5FLM J;  1RNL A;  3SZG A;  1VQM I;  1MMA A;  5LHI A;  5LEJ A;  1HBX G;  3I4P A;  4B43 A;  1MJ9 A;  2DOE A;  1CF7 A;  2L01 A;  1JE8 A;  3DV8 A;  5DM7 F;  2OCC H;  1H88 C;  3C2H A;  5B1A H;  1KZH A;  2R7D A;  3A03 A;  3Q5F A;  1J7K A;  5HLH A;  2PQ8 A;  5D8L B;  2XF7 A;  1O7F A;  3BZK A;  4DIQ A;  1R9T J;  1MH4 A;  3EYI A;  4OAZ A;  2IBD A;  1XGO A;  2K9L A;  4IQJ A;  5FGM A;  5FLV A;  4E7L A;  2KIM A;  1TP4 A;  3WGI A;  3JTG A;  3OOP A;  3KYD B;  4I01 A;  3V7S A;  4ZC3 A;  2EQR A;  2DK8 A;  4KA4 A;  4U7D A;  4CUG A;  4MEY F;  4O6J A;  5FO5 A;  1H8A C;  1YRN A;  2E71 A;  1QQI A;  1BM9 A;  2FD5 A;  2YS9 A;  4LOC A;  3SEZ A;  2DMN A;  3H5A A;  3J81 Z;  1Z9C A;  4LB5 A;  1FBU A;  3H9J A;  3SDB A;  1ZEL A;  5J8F A;  5K5Q A;  2HWV A;  4BBR J;  4B1R A;  1FSE A;  1W5T A;  2OF7 A;  1O3Q A;  5DD4 A;  3G71 I;  2GAU A;  5CQE A;  3WTU C;  5B5E C;  1Z21 A;  3HSF A;  5H6R A;  5HDK A;  4UUV A;  2UWM A;  1Z91 A;  3M8E A;  2UUZ A;  1E17 A;  2A05 A;  1USS A;  2P5L C;  3FDY A;  2HDD A;  5L3F A;  4ESF A;  1TT0 A;  2UV1 A;  3F9K A;  1WQ2 A;  2CWE A;  1S7E A;  4BL0 B;  1WHU A;  1XGM A;  4PJJ A;  2COM A;  3RKQ A;  2HOS A;  3ZQ7 A;  1R4N B;  1VF9 A;  1NHA A;  3AKZ A;  2KT0 A;  1K78 B;  3TMO A;  5JHU A;  2K02 A;  2P81 A;  1FMW A;  2YSR A;  3PIP F;  2V1N A;  2PMU A;  4XIC A;  2LKX A;  1T08 B;  3IH3 A;  2Z2S B;  2H6B A;  3CJN A;  1YIT I;  5FRM A;  5C3E J;  2LY2 A;  3FK6 A;  3RPU A;  4EJV A;  1BW5 A;  3TO6 A;  2F5C A;  1IN6 A;  2LLK A;  3DTI A;  4A0Y A;  3IWF A;  3QAH A;  5DDG A;  3C3W A;  5TGT A;  1IZ1 A;  3ZR8 X;  4B44 A;  1TQP A;  3CMA I;  2LMD A;  3HC7 A;  5GAG J;  3KP4 A;  5D5U B;  4CCM A;  2GWR A;  4M3F A;  3GTJ J;  2HOA A;  3KP3 A;  1F5T A;  1WJD A;  4E7S A;  4X6A J;  1X1C A;  2XRL A;  1EF4 A;  1FOY A;  5IYB J;  5E3O A;  4BEH A;  2PJP A;  3K2Z A;  1LE8 B;  1UG0 A;  4UUT A;  3GO5 A;  4XRM A;  1U5T C;  4EMS A;  2DO7 A;  3HB9 A;  4QIW N;  3D1N I;  4OIP F;  4LMY A;  5HNF A;  2XHK A;  1F36 A;  2L4A A;  1JTX A;  4NQW B;  4DYQ A;  3ZP5 A;  4EVI A;  2IP2 A;  2DXI A;  4KT6 A;  2VAS A;  2HQ5 A;  4EV0 A;  5DV5 A;  2QQB A;  3IKT A;  1O3S A;  1Z1D A;  2YR2 A;  2OA4 A;  2KL4 A;  2EFW A;  3N97 A;  2Y9Z A;  2STT A;  2ETH A;  4CYC B;  4K2E A;  3RJP A;  1UZC A;  2V1X A;  4F91 B;  1HW1 A;  2LSO A;  1KQ9 A;  1ZHF A;  2HOT A;  1MMD A;  1HXD A;  5F64 A;  4ZYA A;  1MH3 A;  1IV8 A;  1KA8 A;  2LD5 A;  2VQC A;  2VE9 A;  1HC8 A;  2WBM A;  3OL4 A;  4LK1 F;  4EM2 A;  2XGX A;  1CGP A;  2CU7 A;  3S3O A;  1FMV A;  1GUU A;  1Z3Y A;  2IGM A;  1VQK I;  4BKX A;  4GGG A;  2Y0S N;  3GYH X;  3VWB A;  2E7W A;  3G3Z A;  1BW6 A;  4UB6 C;  3F22 A;  1KGS A;  4BNC A;  1W5C C;  4L5E A;  5EG0 B;  2P5K A;  4HQE A;  2E7X A;  3A01 B;  2K4J A;  3CLO A;  3W2W A;  1R00 A;  2R7W A;  5HDN A;  1U3E M;  1BA5 A;  2MC4 A;  2FU4 A;  3ERE D;  2HTS A;  2Z1D A;  2M34 A;  1YQA A;  4PK4 A;  5F0F A;  4RGS A;  3K9T A;  1ZG5 A;  4II3 A;  4L9T A;  2X1C A;  5IOZ A;  3ERM A;  4ENN A;  1XDU A;  3OYA A;  3EUK L;  5HOD A;  5EEG A;  3OYE A;  1WI9 A;  2GIZ A;  2E1M B;  4D9J A;  4XOR A;  1ON2 A;  2O0Y A;  4CCK A;  4BE0 A;  2QQ9 A;  1GT0 C;  3JRD A;  1IG7 A;  4C2T A;  1AKH B;  2M1B A;  3BY6 A;  3EQL F;  1KQ0 A;  2R93 J;  1S7O A;  3FKI J;  3CF5 F;  2HPM A;  1B8I A;  3RYR A;  1V55 H;  4RS8 A;  4M9S A;  4W97 A;  4DYC A;  4I09 A;  2EIM H;  2XGD A;  1TQI A;  2QSH X;  2MFZ A;  5LGN A;  3CDL A;  5ILV A;  5HLG A;  3EET A;  2FQ3 A;  3FXU A;  1FBQ A;  3MKY B;  2ID3 A;  2DA3 A;  1ZR2 A;  5JLW A;  2FML A;  2DI3 A;  1GVJ A;  1VQO I;  1Y1W J;  1BR1 A;  4CZC A;  2DA2 A;  4AVZ A;  2LNB A;  1ITY A;  4I98 B;  4QLC U;  4C30 A;  4J00 A;  1EH6 A;  3ZMD A;  5IP9 J;  4JP0 A;  4P1W A;  2HPI A;  1ZN2 A;  2NS0 A;  1VQ8 I;  2GLO A;  4BQA A;  2YPR A;  3FMQ A;  3I59 B;  2XSD C;  1X4O A;  2EFQ A;  4JBA A;  3OIP A;  1RET A;  1BIB A;  2CUE A;  2HYG D;  2GXA A;  3CUQ C;  5KNL A;  2V4J C;  1F9N A;  1YX3 A;  4QWQ A;  2RNG A;  3IKV A;  2QQA A;  2QZ8 A;  1ZAR A;  1XN7 A;  3COA C;  1TQM A;  3CTA A;  5E3L A;  1MNE A;  2NVU B;  4AID A;  1W36 D;  1I50 J;  3NQO A;  1YJ9 I;  3ECO A;  1ETY A;  1BBY A;  4C2M J;  4ENJ A;  1JXS A;  3K70 D;  2EIL H;  1FTZ A;  3GLX A;  2OPT A;  3OYI A;  2Q2E B;  2XPV A;  1T6S A;  2HXO A;  4UXN A;  4IEJ A;  1ETW A;  5ILU A;  1LNW A;  4AYB A;  2V1D A;  1BJZ A;  3KP7 A;  2VQG A;  2DK5 A;  3BPX A;  1SVM A;  2JSC A;  3KP5 A;  1ZKG A;  3VEP A;  4CIC A;  1QU3 A;  2P7C B;  3F6O A;  2M2E A;  1P7I A;  2R5Y B;  5LGU A;  4UVA A;  2FSW A;  2DT6 A;  1DPR A;  3KLO A;  3ZGK A;  3T8T A;  1JUS A;  4M3B A;  4YFK F;  1OCO H;  3DFG A;  1K79 A;  1D1B A;  3CZ6 A;  2D5V A;  2W24 A;  1SD6 A;  4EGY A;  3ZMV A;  3SFZ A;  1IO2 A;  3H9Q A;  1ETX A;  1ONV A;  4ITV A;  4OIR F;  2ZSI B;  2OUM A;  2ZC2 A;  2C6Y A;  2V9K A;  3U1D A;  4A5M A;  3PO2 J;  3IUO A;  1OPC A;  3JRG A;  3V7R A;  2EA2 A;  2H6C A;  3JRE A;  1RKT A;  4RAY A;  1R1U A;  4M6Y A;  4RDU A;  5C44 J;  1O4X A;  1IN7 A;  2DAO A;  2X6Y A;  3JRH A;  1STZ A;  3ZMU A;  4WXC A;  4BAY A;  4XLN F;  3K4L A;  2EZL A;  3LMM A;  2X85 A;  5E18 F;  1TZL A;  2XF5 A;  3GZN B;  2LBF B;  2X1E A;  2JMW A;  3U2R A;  4ZYD A;  1VQ6 I;  3W6J B;  1R58 A;  2DA4 A;  2IAI A;  4FCY A;  2QKL B;  3K4J A;  1Y39 A;  1AOY A;  2XVC A;  1MIJ A;  3ONQ A;  5D5X B;  3U1K A;  1YI2 I;  1NK3 P;  3E5X A;  1N77 A;  3BR6 A;  2D1V A;  3BC8 A;  2X0L A;  1JKQ C;  1K7A A;  2HKO A;  4IHV A;  3E7L A;  3HUG A;  3L7W A;  3HXL A;  3CMM A;  3GF2 A;  4U88 A;  4Z6Y A;  1PP7 U;  3W2V A;  3ZQL A;  4JX6 A;  3F8B A;  1YS6 A;  5J4Y A;  3VYS B;  2L7Z A;  3LAJ A;  2JT1 A;  2P6T A;  2JRT A;  3G6E I;  1J59 A;  3OV8 A;  4OMY A;  1B72 A;  3I58 A;  5CVV A;  2D45 A;  4YRV A;  1I1S A;  2YU3 A;  3OS1 A;  3TO9 A;  4JK1 X;  3WOD F;  1MMG A;  3EDP A;  4JOM A;  1H9T A;  3H0G J;  5CJ9 A;  3HKZ N;  3E6M A;  3P9K A;  3K4K A;  2K3F A;  1A04 A;  4G94 A;  2V1U A;  4RAF A;  1HKT A;  1IUY A;  3S2W A;  2BBY A;  2VON A;  4LIV A;  1JTY A;  3ZQI A;  4LK0 F;  5FKO A;  4Q4Z F;  4KYW A;  1FYL A;  1VQ7 I;  3AAF A;  3I53 A;  2Y31 A;  4HLX A;  3DTE A;  4N4O B;  1IN5 A;  4KIB A;  4BYY A;  2JQ7 A;  5IPA A;  4XRS A;  4M72 A;  3GX4 X;  4GDF A;  2RGV A;  3D5S C;  4FET A;  3M8J A;  3BG9 A;  4E4H A;  3CD6 I;  1A6I A;  2NYX A;  4FAS D;  4HLY A;  1KYZ A;  1ORK A;  2DA6 A;  4DBQ A;  2DA1 A;  2CQK A;  3PSF A;  4I7H A;  2K40 A;  4A3E J;  2P6S A;  3NEU A;  2D1H A;  2VKH A;  1U2W A;  3C1D A;  2BY2 A;  3RI4 A;  2V6E A;  2ZBK A;  1XSV A;  3L00 A;  4GO1 A;  3KX2 A;  1B59 A;  2G7U A;  2CV2 A;  5JLX A;  3R61 A;  2VBW A;  2Z16 A;  1FP1 D;  2EZI A;  2HGC A;  1ZRD A;  4NC7 A;  1MZB A;  3GXO A;  1ETV A;  3GWZ A;  5EZG A;  2A61 A;  5LLQ A;  4NNJ A;  4A3F J;  3GZ5 A;  3WGH A;  1NTC A;  2WAQ N;  3QPH A;  2DU9 A;  5FRO A;  4CYD A;  5K7F A;  2X6W A;  4LG0 A;  3GTO J;  1Z7L A;  1WWX A;  3C18 A;  3FWE A;  2RQP A;  3WU1 B;  3HM5 A;  1IV6 A;  1RES A;  4NBQ A;  4JX4 A;  2BXY A;  3CCY A;  2LC2 A;  2R5Z A;  1YOV B;  3IP4 B;  5F1J A;  5LRS A;  3ZRG A;  3AG3 H;  3ZCO A;  3HRS A;  4XR6 A;  1R49 A;  3H3U A;  5KHD A;  1YIO A;  1TNT A;  4L18 B;  3RTR A;  1N25 A;  4UV8 A;  5GTH C;  4E7J A;  3GTP J;  3LFK A;  4U7B A;  1P4A A;  3RSN A;  4B8X A;  3FM3 A;  4BQN A;  3A0B C;  4DZJ A;  3DPL C;  3JRF A;  5D5V B;  3Q9S A;  5C4J J;  3CMY A;  3E5U A;  4M3E A;  3WHC A;  3HPH A;  3LSG A;  2ME6 A;  2HKX A;  4KT5 C;  3GTM J;  3FIW A;  4CO8 A;  1MBK A;  3MQ0 A;  2O9L A;  1T38 A;  4IRH A;  2WAE A;  1W7P B;  1POG A;  5EEA A;  4EJT A;  2R7F A;  5HOO A;  1GV5 A;  3GTL J;  2L9V A;  2ESH A;  3Q9V A;  2L4M A;  3GFL A;  1ETQ A;  5IP6 A;  3HJE A;  1B1B A;  2OC6 A;  3S16 J;  1T33 A;  3L2R A;  4GCV A;  4HNU A;  2P0W A;  5CLS A;  4G9Y A;  3CCS I;  1FOK A;  1WH5 A;  5D5W B;  1KU9 A;  1VQ4 I;  3TW6 A;  4N0B A;  5J8C A;  3HGY A;  2DW4 A;  3BPV A;  4BXF A;  1V3F A;  2CFX A;  3FXK A;  3GLL A;  2EA4 A;  2O5R A;  4XOT A;  2XRO A;  2DMP A;  4XLF A;  3M4O J;  3E5Q A;  1ZG3 A;  3MKZ A;  3DF8 A;  2FOK A;  4IX7 A;  1B9M A;  2VQL A;  1JGG A;  1BI1 A;  3EYY A;  1TLH B;  3DKY A;  3I3L A;  3WTV C;  1T2K A;  3BWG A;  3V7C A;  2FEZ A;  2CW0 F;  2MYS A;  2BVM A;  3DQV C;  5DCM B;  5EGO A;  3MN2 A;  4IL6 C;  4CH7 A;  2GXG A;  2XAS A;  2MAB A;  2WAD A;  3P9I A;  2QF7 A;  2JJ7 A;  3K6G A;  1JGS A;  1SC7 A;  3HZJ A;  2UZK A;  3I55 I;  2JUC A;  4HQM A;  3HPG A;  2XAU A;  4YFX F;  1KYW A;  4OU0 A;  3MZY A;  5E3N A;  4A3K J;  2JSP A;  2FBH A;  2HOE A;  3HDD A;  3VFZ A;  5ICC A;  2XKP A;  4XL9 A;  4IHX A;  2H94 A;  2R3S A;  1P9Q C;  2GA1 A;  1XDS A;  3M8F A;  1W0T A;  1K83 J;  1VQP I;  4EAT A;  3GW2 A;  3V42 A;  2FX0 A;  3RZD J;  5D4S A;  1WJE A;  4XMY A;  4WK8 F;  2V7F A;  4ENK A;  3R0J A;  4BXU A;  3RZO J;  1T0F C;  1WRJ A;  4BY7 J;  4CZZ A;  2CW8 A;  1KON A;  3GEZ A;  4DGW B;  2PFB A;  2RRE A;  1WGX A;  2JRM A;  1FOX A;  2EFO A;  4L9J A;  1BIA A;  4YII A;  4QTR A;  1XSX A;  3LNQ A;  1YO5 C;  1RZ4 A;  5J3L A;  3G73 A;  2M7A A;  2LF7 A;  1ZG1 A;  3RQ4 A;  2KHM A;  1OLT A;  5EDN A;  4M71 A;  5F04 A;  4IZZ A;  2IXS A;  2MD5 A;  1RPW A;  3FZV A;  2PJR B;  2ACJ A;  2NAZ A;  2IPQ X;  1E3O C;  2A68 F;  2K85 A;  2PX9 A;  3KLN A;  3CQZ J;  3W2A A;  2XAQ A;  5KAF C;  1IXC A;  1K78 A;  1SVL A;  4A6D A;  2RN7 A;  2WWY A;  3G2B A;  2R7S A;  5IT9 K;  5L3G A;  1FYM A;  5GPA A;  3DTK A;  3BJA A;  1FP2 A;  3I9V 2;  3K70 C;  3SHF A;  1TBX A;  4WX9 A;  2KRC A;  3BR5 A;  4D0P A;  1MMS A;  2DLL A;  2ME0 A;  1S72 I;  1ACI A;  2W7N A;  1SFK A;  4MLO A;  2DJI A;  2E1M C;  3CCE I;  2OTL I;  2Z5U A;  3SQN A;  2QLZ A;  3FXJ A;  4XKW A;  3OYB A;  2RVC A;  3BG7 A;  3I64 A;  2DT5 A;  3HOX J;  3TGN A;  4RB2 C;  2EZK A;  1JT0 A;  3F8N A;  2LY1 A;  4PFO A;  1YJN I;  1VTN C;  3B6C A;  4F93 B;  1JJ8 C;  1ZAO A;  1SAN A;  2QBY B;  4MTD A;  1H0M A;  2VXZ A;  1XMA A;  2IGO A;  2VKD A;  3RCO A;  5KK1 A;  1LE8 A;  2VL8 A;  1WH7 A;  2MA3 A;  2FMY A;  2M0C A;  2VXD A;  3M9A A;  3BR0 A;  3H3Z A;  1S5L C;  1Z67 A;  3PNV A;  9ANT A;  2XPW A;  3ABL H;  1MND A;  4XN0 A;  3K1N A;  2MSY A;  1YYV A;  3WG7 H;  1G3T A;  4P5O A;  1VZ0 A;  3DLA A;  1MBG A;  4NQW A;  3ULQ B;  4L5I A;  1XG1 A;  5DEQ A;  2V9P A;  4BUP A;  3BJO A;  2FE3 A;  2KIQ A;  2PEX A;  3HTS B;  2MW8 A;  4KN7 X;  3KYL A;  3LL7 A;  2R7T A;  2CSO A;  1LEA A;  3F23 A;  1DGW Y;  2E36 A;  3QOE A;  2R7X A;  5D6E A;  2LY9 A;  3FM5 A;  2VC0 A;  3FX3 A;  1T0F A;  1F1Z A;  2A07 F;  2L9R A;  5TIS C;  3IRQ A;  2E60 A;  4XOP A;  4ZTF A;  1TT5 B;  4RB1 A;  4ESJ A;  5GAD J;  5E3M A;  2DDB A;  4NC6 A;  1TWG J;  2ZJQ F;  4Q5S F;  1DU6 A;  3QPT A;  4AWX B;  1UFM A;  1JKP C;  3E6D A;  1IDZ A;  4A3B J;  2GOM A;  3CF2 A;  1E2X A;  1O57 A;  2F4M B;  4ZYH A;  5D4R A;  1HW5 A;  4J19 A;  1I6H J;  3SEQ A;  2K3P A;  1DP3 A;  3HOY J;  4IQ4 A;  2QCO A;  2X51 A;  2GIV A;  3F21 A;  2ZKZ A;  1V5F A;  4AUX A;  5EG0 A;  2ICW G;  1WZ2 A;  3F3X A;  3A01 A;  1VQL I;  1D0Y A;  4HG2 A;  6PAX A;  1J09 A;  4MIM A;  1ERD A;  5BS6 A;  5J1R A;  1PVE A;  2DA7 A;  4DZP A;  1U78 A;  1ZLK A;  3VB2 A;  5KAI C;  1GVD A;  3EPZ A;  3LSK A;  4MFE A;  3K4N A;  1Q1H A;  1VQN I;  5J6X A;  2VN2 A;  3H5R A;  1IRZ A;  1KU7 A;  2RDP A;  5KCM A;  2L7K A;  4LLG F;  3FIS A;  1EV7 A;  3FXR A;  3JTH A;  4G8X A;  4QPO A;  4KMF A;  3OYN A;  2F2E A;  5E1Z B;  1AWC A;  2M8G X;  3CCQ I;  1UCR A;  3M7G A;  3QU3 A;  4WF2 A;  2PMH A;  1AKH A;  1G3S A;  2JVH A;  3B6A A;  2VC1 A;  3S32 A;  1DP7 P;  4M3D A;  4B09 A;  4EQQ A;  1JI8 A;  2KLO A;  5BMZ A;  2N8G A;  2PG4 A;  1X1P A;  3ZOB A;  3B02 A;  2L54 A;  2XAJ A;  3SZT A; 
#chains in the Genus database with same CATH homology
 2HEO A;  1X3U A;  2DQL A;  4KIF A;  3T0Y A;  5K5R A;  1W4M A;  4HF0 A;  5L3D A;  2KKO A;  2X4H A;  1IRF A;  3FMS A;  4HAM A;  1D8J A;  2XAH A;  3GZ6 A;  1GXQ A;  3I59 A;  2VBY A;  4WCG A;  1SMT A;  2GZW A;  5CVI A;  2ZNY A;  2IRF G;  5DYM A;  3RKY A;  3WTZ A;  4MGR A;  3T1B A;  3IRR A;  2IVM A;  2HR3 A;  2O8X A;  2P4W A;  4OMZ A;  2Q2E A;  1D5V A;  3ABT A;  3ZN0 A;  2A6E F;  4WXH A;  1IN8 A;  3ELK A;  2KIF A;  1S6L A;  4Q47 A;  2RKH A;  2MLG A;  1TW3 A;  3LAP A;  3R60 A;  4EM0 B;  1YW8 A;  3DP7 A;  4NB5 A;  2F5F A;  5CVU A;  1MDM B;  4KUM A;  4PZJ A;  2D2W A;  2LKP A;  1R36 A;  2RV8 A;  3D5L A;  1GXP A;  3W6K B;  3KP2 A;  4N9H A;  5HS7 A;  1U5T A;  4HX8 A;  4ASN A;  3E97 A;  1SMY F;  2IW5 A;  2TDX A;  5LGT A;  1QZY A;  4OIO F;  2WTE A;  3LWF A;  4R79 A;  3RKW A;  4XLP F;  3RYP A;  1J75 A;  1R1T A;  5HS8 A;  2STW A;  3KZZ A;  3HSE A;  1FT9 A;  1IN4 A;  2YX7 A;  1R5G A;  4EJW A;  2OQR A;  1YW9 A;  3CUO A;  2P7V B;  3O3K A;  4IHT A;  2FNA A;  4LJZ F;  2BE5 F;  4FX0 A;  3ROU A;  3RKX A;  2O3F A;  1S29 A;  5BPD A;  3GFJ A;  1YS7 A;  4M9Z A;  2MBF A;  3TDU C;  3I71 A;  4YG2 F;  4HF1 A;  2A3S A;  3TOB A;  5CVJ A;  4YIF A;  4KN4 X;  5A2Q K;  5CVR A;  3REO A;  3ABU A;  2FA5 A;  3FHZ A;  1FX7 A;  1YW7 A;  4RGU A;  1ODD A;  5JVT A;  3HRM A;  1XCV A;  1J5Y A;  2GA2 A;  1MD0 A;  1LDK B;  4KIC A;  3TDZ C;  3K0L A;  1EH8 A;  4F7Z A;  1BJA A;  1XD7 A;  3KFW X;  1B6A A;  3DEU A;  4RGR A;  4E70 A;  5E20 A;  3K1P A;  1Z6R A;  3BP8 A;  4HYE A;  3TKY A;  2O61 A;  2NNY A;  2H27 A;  3PFI A;  4FX4 A;  2KJC A;  4Q48 A;  3VOE A;  5A2Q Z;  2VE8 A;  1U8R A;  1QBJ A;  1O3T A;  4P55 A;  4CDG A;  5L3E A;  4MEX F;  3R0A A;  3KEQ A;  1S7A A;  5D8K B;  4I02 A;  3F72 A;  4P9U A;  1J9I A;  4LGW A;  1KU2 A;  5HDG A;  5LHH A;  2DFI A;  2QYO A;  3H92 A;  1SFE A;  3CUQ A;  3ZMT A;  1TTY A;  4CHU A;  1QO0 D;  4IHS A;  4ZZL A;  3KZY A;  2H09 A;  1HW2 A;  4RAZ A;  4MHG A;  1Z6T A;  3O2P E;  4Z2Y A;  2KJB A;  2W84 A;  4PGG A;  5DUK A;  1W7P A;  4P96 A;  1MJA A;  4PCQ A;  3TO7 A;  1SD5 A;  2L02 A;  3RIR A;  1XGN A;  4JQF A;  3V8J A;  4S04 A;  2OQG A;  5CYV A;  2CG4 A;  2JPB A;  4M9X A;  3LQQ A;  5HS9 A;  1Y0U A;  1MJB A;  4G6Q A;  1IAW A;  4HV6 A;  4PGH A;  4L9V A;  4IPA A;  3E6C C;  1ULY A;  2Z33 A;  1QGP A;  2PBI A;  4KIG A;  3K69 A;  5ICG A;  5F1R A;  5F6F A;  4EGZ A;  2MLK A;  5DCM A;  3IL2 A;  3KEO A;  1OYW A;  2W25 A;  3GUD A;  4NHJ A;  3KE2 A;  1I6X A;  5H6Q A;  1RI7 A;  3HOS A;  4LB6 B;  4HA8 A;  4AIK A;  5FD5 A;  5K5O A;  1SD7 A;  2P5V A;  4O5V A;  1HQC A;  1R5H A;  1R23 A;  3SXY A;  2OD5 A;  1I1G A;  5LEK A;  3WTX C;  5L3C A;  1LVA A;  4HOB A;  2XKO A;  1ZLJ A;  1FSH A;  3ZMZ A;  2O6G E;  2M30 A;  4G7H F;  1P6R A;  1J0R A;  3LA7 A;  1P92 A;  1W5S A;  2VOD A;  1LDJ A;  2OZU A;  2KRF A;  2HYF A;  2HFH A;  2JTV A;  4EJU A;  2EFN A;  4KMU X;  4LLL A;  2J5O A;  1V4R A;  4HBL A;  4A0X A;  3MCZ A;  1ZRC A;  4ZYG A;  1DDN A;  3TQN A;  3R6S A;  3JAM K;  1OKR A;  3KET A;  3E6B A;  3BRO A;  2DQR A;  2CGP A;  1IF1 A;  4AVP A;  3WE2 A;  3MZH A;  2QBY A;  1R22 A;  3PQK A;  4UVC A;  1QZZ A;  4BHP A;  5K1Y A;  2FF4 A;  2VT3 A;  2E1C A;  1LQ1 A;  2MC3 A;  4M74 A;  3J7A O;  2V6C A;  2M45 A;  2V79 A;  5BPI A;  5ERI A;  2B0L A;  1PDN C;  2EK5 A;  2NRA C;  4AIH A;  4EJO A;  4BHB A;  5AIQ A;  1IXR C;  2Y75 A;  2ZME B;  3JAM Z;  1RIO H;  2Z3Y A;  2EV0 A;  3F8M A;  1LDD A;  3NRV A;  1IW7 F;  4MTE A;  1L3L A;  4IVN A;  1JHH A;  3I0T A;  4AIJ A;  2EV5 A;  4UHT A;  1UST A;  1QNT A;  2KIU A;  1LB2 A;  3I5U A;  2ZFW A;  4Y13 A;  2XAF A;  1UB9 A;  1PUE E;  1G3Y A;  1YG2 A;  1D3Y A;  5FLX K;  1FBS A;  3CO6 C;  4HW0 A;  4UNO A;  3E3V A;  2W57 A;  1JHF A;  1BC8 C;  3WTT C;  2ZXJ A;  3LQR A;  4MNU A;  5BQT A;  3ECH A;  5AON A;  4A2U A;  5E8G A;  5IT9 Z;  1DUX C;  4N9I A;  3F8C A;  2XV4 S;  5JI6 A;  4OOI A;  5FLX Z;  3V8L A;  3MFK A;  1UHW A;  1RUN A;  4LFU A;  4HX4 A;  2XRN A;  4GYI A;  4R1H A;  4ESB A;  2AS5 F;  1FC3 A;  5DD8 A;  2G7H A;  1UHM A;  2BV6 A;  3BDD A;  2JZY A;  4FHT A;  3FMR A;  1FY7 A;  2QEN A;  1BOA A;  4ZYE A;  1B9N A;  1P4W A;  2K27 A;  4HDU A;  2IJL A;  2FXA A;  2IA1 A;  3WGG A;  4ZZD A;  3R4K A;  1MDM A;  4L0Y B;  1XSD A;  5D6F A;  1XB4 A;  2XIG A;  4CXF A;  4R8H A;  3C7J A;  1SFX A;  5H20 A;  4IRG A;  2L3D A;  2E1N A;  1CF7 B;  3N4M A;  3WTS C;  1Z7U A;  3GFM A;  5LRR A;  2HS5 A;  2PN6 A;  4ETS A;  2BEO A;  3ML6 A;  1P2F A;  2PI0 A;  4KNY A;  1OYI A;  1ON1 A;  1YLF A;  1YTY A;  3QP6 A;  2GXB A;  5LBQ A;  2RNJ A;  2EB7 A;  4H0E A;  1R7J A;  3TOA A;  1ZYR F;  3QU6 A;  1XCB A;  3LST A;  2K86 A;  2J5P A;  4HZF A;  2DBB A;  2HDC A;  1T98 A;  3J80 K;  3DXJ F;  3I54 A;  1BC7 C;  2VBZ A;  3DPT A;  1MGT A;  5FFZ A;  1I27 A;  4A0Z A;  3HRT A;  3ZPL A;  1FZP B;  1DPU A;  1ZRE A;  3JSP A;  1HST A;  4IRI A;  1OMI A;  1KU3 A;  4HDV A;  3BOQ A;  3KCC A;  4XRF A;  2FBK A;  2QWW A;  3WE3 A;  4G7O F;  3SZP A;  2ESN A;  5FB2 A;  3F6V A;  2OBP A;  4XSZ F;  3DKW A;  5ICE A;  2UXN A;  2CO5 A;  2FBI A;  1WKM A;  3IC7 A;  3J80 Z;  1BI3 A;  2ZJ2 A;  3CO7 C;  3HTU A;  2UXX A;  2BYV E;  1MKM A;  2OU2 A;  2WV0 A;  2EJR A;  4KFC A;  2WC2 A;  1C0W A;  3PQJ A;  4MQ9 F;  1I5Z A;  3ZN1 A;  4P9F A;  4ZH4 F;  2HQR A;  1IXS B;  4HX7 A;  1PP8 F;  2QVO A;  4HF2 A;  5EEH A;  2ZCW A;  1OR7 A;  3HYI A;  2DPU A;  2PLY A;  2NNN A;  4TV7 A;  3P9C A;  2FNP A;  4M6X A;  4DQ2 A;  2LF8 A;  5ED4 A;  4UVB A;  5ICF A;  4RGX A;  3L2C A;  4MQV A;  4Y15 A;  1XGS A;  3HIF A;  4YFN F;  1FPQ A;  4FT8 A;  1TW2 A;  3L9F A;  3P7N A;  3FF5 A;  4XBF A;  2MH2 A;  2VOP A;  1ZGJ A;  1GHC A;  2O03 A;  2HZT A;  5KVR A;  5JFR A;  4S05 A;  1FWZ A;  3JSO A;  3QRF F;  3ZMS A;  1R1V A;  4IJA A;  1B4A A;  1G6N A;  3M1E A;  1BI0 A;  3BZ6 A;  3QP5 A;  4G7Z F;  1U5T B;  3HHH A;  4I2O A;  3L09 A;  2DTR A;  1O7L A;  1T39 A;  2M87 A;  4I0B A;  4AD9 A;  3O6B B;  4Y17 A;  2VBX A;  2HTJ A;  2Y48 A;  5FD6 A;  3V8K A;  3K1M A;  3JW4 A;  3LA2 A;  2EWN A;  1U6G A;  4O3M A;  3RPQ A;  2AXL A;  4U0W A;  1EH7 A;  1ZH5 A;  2GQQ A;  3HOT A;  3MWM A;  1LJ9 A;  3HHG A;  2BGC A;  2DPD A;  2P8T A;  2VT2 A;  2Y0M A;  2ZNZ A;  4M73 A;  4GYG A;  3ISP A;  1IRG A;  4L9N A;  2IA0 A;  4ON0 A;  1QPM A;  4HV5 A;  1TNS A;  2K4B A;  2MH9 A;  2Q8K A;  4G6D A;  5FFX A;  2CYY A;  4A12 A;  2OZ6 A;  1H9G A;  1ZGA A;  1KQ8 A;  3V4G A;  2A6H F;  1J2X A;  2ISZ A;  3F8F A;  2XUB A;  3D0S A;  2F5E A;  3WTY C;  1SAX A;  5E1W A;  4PDK A;  1HKQ A;  5AIP A;  4XSX F;  1FYK A;  1L0O C;  5L3B A;  3BJ6 A;  1XMK A;  1FLI A;  4LD5 A;  2M5W A;  2ADU A;  5TRD A;  4OIQ F;  3T5X A;  2FRH A;  2IA2 A;  2Q0O A;  2ZME A;  4A5N A;  5LHG A;  5ILS A;  3CUQ B;  4L5J A;  1LEB A;  4A6E A;  3FXQ A;  5E1X A;  5E17 F;  2F5D A;  2VOO A;  3GVA A;  5E8I A;  3WTW C;  5JR3 A;  3IWZ A;  3T8R A;  4LLN A;  4L0Z B;  4U0Y A;  1REP C;  5HLI A;  2Z99 A;  1G3W A;  2LDU A;  5DUI A;  1HSJ A;  2QM3 A;  3EUH A;  4OIN F;  2YX4 A;  5TJJ A;  3RDI A;  2V9V A;  3QOP A;  3HSR A;  4DNC A;  4GXO A;  4CGZ A;  1Z05 A;  2G9W A;  1S3J A;  5BOX A;  1P4X A;  2W85 A;  5HVQ C;  4LG0 B;  5IT3 A;  2HQN A;  4IXA A;  1G4D A;  3B73 A;  1OYY A;  3VOD A;  1S8N A;  2JPC A;  2XAG A;  4WWC A;  2A69 F;  3LA3 A;  3MAJ A;  4KDP A;  4RB3 C;  1ZRF A;  1K6O A;  4BH9 A;  1F4K A;  1W7P D;  1WSU A;  1BN5 A;  1RUO A;  4IF4 A;  4I0A A;  4RB0 A;  2Z9O A;  3CDH A;  1BI2 A;  2IT0 A;  3U9G A;  1SFU A;  3WU0 A;  4ENM A;  2M8E A;  1HKS A;  4WXD A;  4EM1 A;  2EV6 A;  2ZO4 A;  1D8K A;  4BHC A;  1FNN A;  4UV9 A;  2A5Y B;  2EFP A;  3GFI A;  2K7L A;  3HRU A;  2RC4 A;  3WG9 A;  2QUF A;  3IHU A;  5DCF A;  3MEX A;  2ELH A;  1O3R A;  1SD4 A;  3KP6 A;  4U0V A;  1YFH A;  2OAZ A;  3J81 K;  2ISY A;  1RNL A;  5LHI A;  5LEJ A;  1HBX G;  3I4P A;  1MJ9 A;  1CF7 A;  2L01 A;  1JE8 A;  3DV8 A;  2R7D A;  3Q5F A;  1J7K A;  5HLH A;  2PQ8 A;  5D8L B;  1O7F A;  3EYI A;  1XGO A;  5FGM A;  2KIM A;  3WGI A;  3JTG A;  3OOP A;  4I01 A;  3V7S A;  2DK8 A;  4KA4 A;  4U7D A;  4MEY F;  4O6J A;  5FO5 A;  1QQI A;  1BM9 A;  3J81 Z;  1Z9C A;  4LB5 A;  1FBU A;  5J8F A;  5K5Q A;  2HWV A;  1FSE A;  1W5T A;  1O3Q A;  5DD4 A;  2GAU A;  3WTU C;  4UUV A;  3HSF A;  5H6R A;  5HDK A;  2UWM A;  1Z91 A;  3M8E A;  1E17 A;  1USS A;  2P5L C;  5L3F A;  4ESF A;  1WQ2 A;  2CWE A;  1XGM A;  2COM A;  3ZQ7 A;  1NHA A;  1K78 B;  5JHU A;  2K02 A;  2YSR A;  2PMU A;  2H6B A;  3CJN A;  4EJV A;  3RPU A;  3TO6 A;  2F5C A;  1IN6 A;  4A0Y A;  3IWF A;  3QAH A;  5DDG A;  3C3W A;  1IZ1 A;  1TQP A;  3KP4 A;  5D5U B;  2GWR A;  3KP3 A;  1F5T A;  2PJP A;  3K2Z A;  3GO5 A;  1U5T C;  4EMS A;  2DO7 A;  4OIP F;  4LMY A;  2XHK A;  2L4A A;  3ZP5 A;  4EVI A;  2IP2 A;  4EV0 A;  5DV5 A;  2QQB A;  3IKT A;  1O3S A;  1Z1D A;  2YR2 A;  2OA4 A;  2EFW A;  3N97 A;  2STT A;  2ETH A;  4K2E A;  3RJP A;  2V1X A;  1HW1 A;  2LSO A;  1KQ9 A;  1ZHF A;  1HXD A;  5F64 A;  1KA8 A;  2VE9 A;  4LK1 F;  4EM2 A;  2XGX A;  1CGP A;  4GGG A;  3GYH X;  2E7W A;  3G3Z A;  3F22 A;  1KGS A;  4BNC A;  2P5K A;  4HQE A;  2E7X A;  2K4J A;  3CLO A;  1R00 A;  5HDN A;  1U3E M;  2FU4 A;  3ERE D;  2HTS A;  1YQA A;  4RGS A;  3K9T A;  1ZG5 A;  4L9T A;  4ENN A;  1XDU A;  5EEG A;  1WI9 A;  1ON2 A;  2O0Y A;  2QQ9 A;  2M1B A;  3BY6 A;  3EQL F;  1KQ0 A;  1S7O A;  3RYR A;  4RS8 A;  4M9S A;  4I09 A;  1TQI A;  5LGN A;  5ILV A;  5HLG A;  3EET A;  2FQ3 A;  3FXU A;  1FBQ A;  2FML A;  2DI3 A;  1GVJ A;  2LNB A;  4I98 B;  4QLC U;  1EH6 A;  3ZMD A;  1ZN2 A;  2NS0 A;  4BQA A;  2YPR A;  3FMQ A;  3I59 B;  2EFQ A;  4JBA A;  1BIB A;  2HYG D;  3CUQ C;  4QWQ A;  1F9N A;  3IKV A;  2QQA A;  2QZ8 A;  1ZAR A;  1XN7 A;  3COA C;  1TQM A;  3CTA A;  3NQO A;  3ECO A;  4ENJ A;  1BBY A;  1JXS A;  3GLX A;  1T6S A;  4UXN A;  5ILU A;  1LNW A;  2V1D A;  3KP7 A;  2DK5 A;  3BPX A;  2JSC A;  3KP5 A;  3VEP A;  4CIC A;  2P7C B;  3F6O A;  5LGU A;  4UVA A;  2FSW A;  3KLO A;  1DPR A;  3T8T A;  4YFK F;  1K79 A;  3DFG A;  2W24 A;  1SD6 A;  4EGY A;  3ZMV A;  3SFZ A;  1ONV A;  4OIR F;  2C6Y A;  3U1D A;  4A5M A;  1OPC A;  3V7R A;  2EA2 A;  2H6C A;  4RAY A;  1R1U A;  4M6Y A;  1IN7 A;  2DAO A;  3ZMU A;  1STZ A;  4WXC A;  4BAY A;  4XLN F;  5E18 F;  3U2R A;  4ZYD A;  3W6J B;  1R58 A;  1AOY A;  2XVC A;  5D5X B;  3E5X A;  2D1V A;  2X0L A;  1K7A A;  2HKO A;  3HUG A;  3L7W A;  4U88 A;  3GF2 A;  1PP7 U;  3F8B A;  1YS6 A;  3LAJ A;  2JT1 A;  2P6T A;  2JRT A;  1J59 A;  3OV8 A;  4OMY A;  3I58 A;  5CVV A;  2D45 A;  1I1S A;  2YU3 A;  3TO9 A;  4JK1 X;  3WOD F;  3EDP A;  1H9T A;  5CJ9 A;  3E6M A;  3P9K A;  1A04 A;  4G94 A;  2V1U A;  1HKT A;  1IUY A;  3S2W A;  2BBY A;  2VON A;  4LK0 F;  4Q4Z F;  4KYW A;  1FYL A;  3AAF A;  3I53 A;  4HLX A;  1IN5 A;  4KIB A;  4BYY A;  4M72 A;  3GX4 X;  2RGV A;  2NYX A;  4HLY A;  1KYZ A;  2CQK A;  4I7H A;  2P6S A;  3NEU A;  2D1H A;  1U2W A;  3C1D A;  3RI4 A;  2ZBK A;  1XSV A;  3L00 A;  4GO1 A;  1B59 A;  2G7U A;  3R61 A;  2VBW A;  1FP1 D;  2HGC A;  1ZRD A;  1MZB A;  3GXO A;  3GWZ A;  2A61 A;  5LLQ A;  3GZ5 A;  3WGH A;  3QPH A;  2DU9 A;  4CYD A;  4LG0 A;  1WWX A;  3C18 A;  3FWE A;  2RQP A;  3WU1 B;  5LRS A;  3HRS A;  3H3U A;  1YIO A;  1TNT A;  4L18 B;  3RTR A;  4UV8 A;  3LFK A;  4U7B A;  1P4A A;  4B8X A;  3FM3 A;  3DPL C;  5D5V B;  3Q9S A;  3E5U A;  2HKX A;  4KT5 C;  4CO8 A;  3MQ0 A;  1T38 A;  4IRH A;  1W7P B;  4EJT A;  2R7F A;  5HOO A;  2ESH A;  3Q9V A;  2L4M A;  3GFL A;  1B1B A;  4GCV A;  5CLS A;  4G9Y A;  1FOK A;  5D5W B;  1KU9 A;  4N0B A;  5J8C A;  2DW4 A;  3BPV A;  1V3F A;  2CFX A;  2EA4 A;  2XRO A;  3E5Q A;  1ZG3 A;  3DF8 A;  2FOK A;  1B9M A;  1BI1 A;  3EYY A;  1TLH B;  3WTV C;  1T2K A;  3BWG A;  3V7C A;  2FEZ A;  2CW0 F;  3DQV C;  5DCM B;  2GXG A;  2XAS A;  3P9I A;  1JGS A;  2UZK A;  4HQM A;  4YFX F;  1KYW A;  4OU0 A;  3MZY A;  2FBH A;  2HOE A;  3VFZ A;  5ICC A;  2XKP A;  2H94 A;  2R3S A;  2GA1 A;  1XDS A;  3M8F A;  3GW2 A;  5D4S A;  4WK8 F;  4ENK A;  3R0J A;  4BXU A;  1WRJ A;  4CZZ A;  3GEZ A;  2PFB A;  2EFO A;  4L9J A;  1BIA A;  4YII A;  1XSX A;  1YO5 C;  1RZ4 A;  3G73 A;  2LF7 A;  1ZG1 A;  4M71 A;  3FZV A;  2MD5 A;  2ACJ A;  2NAZ A;  2IPQ X;  2A68 F;  3KLN A;  2XAQ A;  1K78 A;  1IXC A;  4A6D A;  2RN7 A;  2WWY A;  5IT9 K;  5L3G A;  1FYM A;  3BJA A;  1FP2 A;  3SHF A;  1TBX A;  4WX9 A;  4D0P A;  2DLL A;  2Z5U A;  3SQN A;  2QLZ A;  2RVC A;  3I64 A;  2DT5 A;  3TGN A;  4RB2 C;  3F8N A;  1VTN C;  1ZAO A;  2QBY B;  4MTD A;  1H0M A;  2VXZ A;  1XMA A;  5KK1 A;  2MA3 A;  2FMY A;  3M9A A;  3H3Z A;  3K1N A;  1YYV A;  1G3T A;  4P5O A;  4NQW A;  3ULQ B;  4L5I A;  5DEQ A;  3BJO A;  2FE3 A;  2PEX A;  3HTS B;  4KN7 X;  2CSO A;  1LEA A;  3F23 A;  5D6E A;  3FM5 A;  3FX3 A;  2VC0 A;  1T0F A;  1F1Z A;  2A07 F;  3IRQ A;  4RB1 A;  4ESJ A;  4Q5S F;  3QPT A;  4AWX B;  1UFM A;  3E6D A;  1E2X A;  1O57 A;  4ZYH A;  5D4R A;  1HW5 A;  2GIV A;  3F21 A;  2ZKZ A;  3F3X A;  6PAX A;  5BS6 A;  1U78 A;  1ZLK A;  3VB2 A;  1Q1H A;  5J6X A;  2VN2 A;  1KU7 A;  2RDP A;  4LLG F;  1EV7 A;  3FXR A;  3JTH A;  4G8X A;  4KMF A;  2F2E A;  5E1Z B;  1AWC A;  1UCR A;  3M7G A;  3QU3 A;  4WF2 A;  2PMH A;  1G3S A;  1DP7 P;  2VC1 A;  4EQQ A;  4B09 A;  5BMZ A;  2PG4 A;  3B02 A;  2L54 A;  2XAJ A;  3SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...