3Q5FA

Crystal structure of the salmonella transcriptional regulator slya in complex with dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transcription/dna
molecule keywords Transcriptional regulator slyA
total genus 48
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q5fA00
4OIQF 4XLPF 4BYYA 2XAQA 5JI6A 4EJWA 3J80K 2P5KA 4R8HA 5HDKA 1MGTA 2W85A 4AIKA 2O61A 3R0JA 2V79A 2QBYA 3L09A 4RS8A 1U6GA 1XMKA 1O3SA 4CXFA 2HGCA 4Q4ZF 4NHJA 5ERIA 1OMIA 3R0AA 5IT3A 2QBYB 3MFKA 2M30A 1IN5A 4HYEA 4KMFA 2JT1A 5H20A 2MD5A 5FO5A 4ETSA 2DO7A 3K9TA 2FE3A 5K5OA 3T8RA 1B9NA 4M71A 1WKMA 3ZMDA 4M6XA 4PGGA 2FU4A 3V8LA 5CVVA 4ZYGA 2KIUA 1XGOA 5J6XA 1FYKA 3K2ZA 4IVNA 2A07F 1T0FA 5FB2A 3KZYA 3F72A 2PN6A 4A0YA 1Z9CA 2HTJA 3O3KA 4MNUA 2EV0A 2PMHA 1YQAA 4EV0A 4OIOF 3WE3A 3GVAA 4K2EA 3SQNA 2VC0A 3ZP5A 5D5WB 2WC2A 2CYYA 2YU3A 4BXUA 4N9IA 3SZPA 2MA3A 4FHTA 2Z5UA 1FBQA 2HZTA 3I4PA 2FEZA 5D8LB 3LSTA 2DK8A 3M1EA 1BI1A 3VOEA 3WTSC 3LFKA 2QLZA 2A68F 1CF7B 4U0YA 1EH8A 2XASA 4LGWA 2WV0A 1FZPB 4A5MA 3RKWA 4OIRF 1B4AA 2L3DA 4E70A 2IRFG 1D8KA 1XMAA 2DTRA 3PQKA 4HF0A 3KEQA 5JHUA 5HS7A 1PP8F 4AD9A 1F5TA 3BPVA 2EFOA 3HOTA 2Z3YA 3B73A 3BPXA 1XN7A 1Q1HA 2EFQA 1IUYA 1XB4A 1FLIA 1BM9A 1Z6RA 3RI4A 1TBXA 1T39A 1BOAA 5D4SA 4HX8A 3MQ0A 2BYVE 1YG2A 1UCRA 1XCBA 2HS5A 3QU3A 3KLOA 2ELHA 2DQLA 3FF5A 4ESFA 2QZ8A 4OINF 2KJCA 3V8KA 2R3SA 1HBXG 1O3RA 2XVCA 3G73A 3MZHA 3F21A 1LB2A 5DD8A 3KE2A 1IN6A 1YS6A 1B59A 2GQQA 1L3LA 3LWFA 1KYZA 5A2QK 1UHWA 3BJOA 1TTYA 4PZJA 3E3VA 5F6FA 2ZO4A 3FMRA 4CICA 4FX0A 4N9HA 4RGRA 5D4RA 3E5QA 2M45A 5DYMA 2PLYA 2FBKA 5LRSA 4KN7X 2Y48A 5HS8A 5EEHA 4QLCU 2MLKA 1IRGA 2H6BA 1HW5A 1D5VA 3HTSB 3DEUA 3FMQA 3PFIA 4A6EA 1YO5C 3EETA 3J7AO 3P9CA 4LLGF 2PJPA 1C0WA 1U8RA 2PI0A 4QWQA 2XGXA 2X4HA 3H3ZA 3TO9A 3GF2A 2ZNZA 3S2WA 3T8TA 2FBIA 4WXHA 5CVRA 3FXRA 1Z7UA 3U9GA 4ZYDA 3HHHA 3CUQC 2HYGD 3LAPA 1QZYA 2XKPA 3KP3A 4EM1A 2MH2A 5CVJA 3E6DA 4FX4A 2DAOA 1SMYF 1ZLJA 5E1ZB 3GFMA 3EYYA 1BI3A 1R1VA 2K27A 3CUQB 1SFUA 3WGGA 1OR7A 2ZJ2A 2VOOA 1PUEE 2HKOA 4RGUA 1FBSA 1T6SA 5LRRA 3WG9A 5LEJA 3L2CA 4EMSA 1BIAA 1U2WA 5F1RA 2L01A 5E8IA 4RB1A 3WGIA 4R1HA 2CG4A 2B0LA 4OU0A 1YS7A 4WXDA 4A2UA 1SD5A 1ZYRF 4GYGA 4I0BA 1FPQA 1HQCA 2OQGA 3GWZA 1T2KA 4MHGA 2KIMA 3C18A 3FHZA 4GYIA 1J2XA 2FBHA 1RIOH 1J59A 3GZ6A 3BZ6A 4WK8F 1VTNC 3JAMK 4PGHA 4I98B 2GIVA 3GEZA 5D5XB 2XKOA 2E1CA 3QAHA 1BI0A 5HLHA 3C7JA 4FT8A 5E17F 1V4RA 3HRSA 2A69F 1JXSA 5K1YA 2OZUA 2Z99A 4HBLA 3HSEA 5BQTA 3GZ5A 3M7GA 2LSOA 2DQRA 3DP7A 5KVRA 4KMUX 5DUIA 5D6EA 2F5DA 1V3FA 4BNCA 1LJ9A 1R23A 2ZFWA 1O7FA 3WTVC 4KIBA 4P55A 1B9MA 1U78A 2P6SA 3ABTA 3F8FA 5ICEA 3U1DA 3FXQA 2P5LC 2G7UA 5CLSA 3RKYA 3KP6A 5LGUA 1U5TB 1TNSA 3QP6A 3WTXC 3K69A 1WQ2A 4G6DA 2DU9A 2VE9A 1SD4A 2V1XA 1G3YA 4OMZA 1F1ZA 5DDGA 2EA4A 3DXJF 4I7HA 1B1BA 3QP5A 3IHUA 4M72A 2ETHA 4IJAA 1YW7A 1JHHA 4LG0B 4IHTA 3FMSA 4RB3C 2A5YB 4L5JA 4AIJA 4Y13A 1DPRA 1FYLA 1JGSA 3E5UA 4HW0A 5D6FA 2WTEA 4LLLA 1XSVA 2XIGA 4ESBA 3R60A 4O6JA 2EK5A 3BOQA 1J75A 3ZPLA 5FFXA 3H3UA 4IRIA 2ACJA 2HKXA 2X0LA 3BDDA 4IXAA 4RB2C 1P6RA 5BOXA 1SFXA 3K0LA 4HOBA 2CO5A 1NHAA 2VOPA 2F5EA 1CF7A 2VBYA 4A12A 3WTZA 2RDPA 2QWWA 4ZYEA 3VEPA 2ISYA 4XLNF 3R61A 5LLQA 3HOSA 4HF2A 1O3QA 2MBFA 3C1DA 1RI7A 1MZBA 2O6GE 4KNYA 3EQLF 3R6SA 3F8NA 2NYXA 2LKPA 4D0PA 2D2WA 1K79A 1S3JA 2XHKA 4Z2YA 1E17A 4KDPA 3SXYA 1G6NA 1W4MA 3WTWC 1XDUA 5HLIA 1KYWA 4GO1A 1ZN2A 1A04A 4EJUA 2L4MA 4I0AA 2Z33A 1U5TA 1AWCA 2W24A 2W57A 4XBFA 2JRTA 1QPMA 2XAJA 3JSPA 2IA2A 4S05A 2GZWA 2P4WA 3KCCA 4KYWA 4LLNA 3FWEA 2QQBA 1LNWA 3JTGA 4U88A 2PFBA 3QPTA 5TJJA 4DNCA 2EJRA 3V4GA 1S7OA 1P4WA 2VC1A 5AONA 2XV4S 3CDHA 1P4XA 3G3ZA 3KFWX 2P7VB 2MLGA 2ESNA 1QNTA 3KLNA 2W84A 4UHTA 3I54A 5FLXZ 1ZG5A 3HSFA 2ZMEA 2RKHA 4HV6A 1WRJA 2OBPA 4RGXA 2LDUA 2QQ9A 2FF4A 3P9KA 3HTUA 2RQPA 2ZCWA 4ENJA 3BJAA 1YYVA 4IRGA 3E5XA 5H6RA 3ISPA 5L3FA 1FP1D 3BY6A 1OPCA 2BE5F 2E7XA 5E8GA 3DKWA 1R1TA 4RB0A 3CO6C 2ZKZA 1IXRC 5ICCA 3RDIA 1FOKA 5J8CA 5TRDA 2AXLA 2QYOA 4LB6B 3IC7A 5HVQC 1MJAA 3RIRA 3EDPA 5K5RA 2QVOA 2K02A 1TQMA 3TGNA 3MWMA 2G9WA 1YTYA 1LEAA 1JE8A 2VBWA 1HW2A 1R7JA 2VT3A 5LHHA 2G7HA 2L02A 5BPDA 3KEOA 5FLXK 1HSTA 1ZRCA 4ENKA 5ILVA 1MDMA 1FNNA 4HLXA 3ZMZA 1Z6TA 3CTAA 2DT5A 2QQAA 5D5VB 4GXOA 1KU9A 3BWGA 4BQAA 3JTHA 3WE2A 1HW1A 1R1UA 2H27A 3GX4X 1ZH5A 1W5SA 2FRHA 1IN8A 1UFMA 1YFHA 2CFXA 3IKTA 3K1PA 6PAXA 2XAFA 1ZARA 4Y15A 2YPRA 3Q9VA 1J0RA 5L3DA 5L3EA 2EFPA 3E97A 1YLFA 2ZMEB 3LQRA 3ULQB 2K7LA 3SZTA 5HS9A 3U2RA 1ZHFA 3WTUC 2XAHA 2Q2EA 1ZG3A 1SFEA 1GHCA 1USTA 3HUGA 3M8EA 1TNTA 2VXZA 3RKXA 5D5UB 1AOYA 1ZLKA 4EGYA 2IW5A 4F7ZA 4HDVA 4PCQA 1YW9A 3JAMZ 1LVAA 2KKOA 4NQWA 4O5VA 3Q9SA 5HLGA 1O3TA 4JQFA 4G7OF 4M9XA 3WTTC 2QUFA 5HOOA 3KP7A 4Q47A 2HFHA 1MJ9A 4U7BA 1Y0UA 4BHPA 4EJOA 4JK1X 1H0MA 2P7CB 3V7CA 1FX7A 3IKVA 1K7AA 1J7KA 4MEXF 2IP2A 2M8EA 3TOBA 3CUOA 5L3CA 2GXBA 1H9TA 1K78A 1S7AA 4G6QA 1ZRDA 2OAZA 5LHIA 3V8JA 1QQIA 5LBQA 2NAZA 4O3MA 2FMYA 2IA1A 3M9AA 5E1WA 3P7NA 4UVAA 2RN7A 4CHUA 5HDGA 2BGCA 1LDDA 4ESJA 3R4KA 1BBYA 1FSHA 4BH9A 2YX7A 3LAJA 2NS0A 3CJNA 1J9IA 4CDGA 1YIOA 4I01A 2HQRA 4HZFA 1BI2A 3D0SA 3I0TA 4UVBA 1L0OC 3CO7C 2FNAA 2DI3A 1SD6A 5D8KB 4GCVA 4KIFA 3BP8A 4HAMA 2VN2A 3DF8A 3PQJA 1IRFA 3K1MA 3T0YA 3ZMUA 4HQMA 4YFNF 2UXXA 4G7HF 4KIGA 3MEXA 2M1BA 3OV8A 2AS5F 2V1UA 4G9YA 1T98A 2OZ6A 5DUKA 2CGPA 1BC7C 1DUXC 3COAC 1IXSB 2FMLA 1TQIA 5CVUA 1H9GA 3V7RA 3HYIA 1BJAA 2D1VA 4RGSA 1RZ4A 1R00A 4CYDA 5BPIA 4B09A 3AAFA 2LF7A 1MD0A 3I71A 3Q5FA 1XGSA 3L7WA 1IF1A 1R36A 1ZREA 5AIPA 1Z91A 3JSOA 4LB5A 3GXOA 1Z1DA 1XCVA 4LFUA 3TO7A 2Y75A 4ENMA 5IT9Z 5A2QZ 3HRMA 3NQOA 3WU0A 1HKTA 4H0EA 2M87A 3DQVC 4LK1F 1FBUA 5E20A 1FY7A 2Q8KA 3TKYA 3GLXA 5ICFA 2STWA 1E2XA 5CYVA 1HKQA 4EVIA 3MAJA 4RAZA 3HSRA 1S6LA 3KP4A 2IVMA 3REOA 2GA1A 3GO5A 2GWRA 1D8JA 3RYPA 1KQ9A 3WGHA 4YFKF 1WSUA 1T38A 2DBBA 5FD5A 1KU7A 4XSZF 2H6CA 1SAXA 4KT5C 5DCFA 3QU6A 1GXPA 3TO6A 1FYMA 3J81K 1BIBA 1ULYA 5E18F 2H94A 1P92A 3RJPA 1DPUA 3W6JB 5IT9K 2FNPA 3ZN0A 1R5GA 5LGNA 2A6HF 4XRFA 1R5HA 3L9FA 1UHMA 2RV8A 4WF2A 2M5WA 2VBZA 4ZZLA 1DDNA 1XDSA 2NNYA 4Y17A 2OD5A 2GXGA 2V1DA 5H6QA 4ON0A 2YX4A 2PQ8A 3ECHA 2IT0A 1IW7F 4Q5SF 3V7SA 4M9SA 3I59A 3T1BA 4HX4A 2O3FA 2RGVA 2MC3A 2DW4A 2E7WA 1KQ0A 1FWZA 4OIPF 5JR3A 4L5IA 3B02A 4L9VA 3NEUA 4WWCA 5F64A 3IRRA 4UVCA 2DPUA 1ZGJA 2EWNA 1FP2A 2O8XA 3TQNA 4ENNA 4M9ZA 3K1NA 1ON1A 3TDUC 4HA8A 3RYRA 1O57A 1TLHB 5KK1A 1B6AA 4KA4A 2PBIA 2A3SA 4IHSA 3DPTA 1HSJA 2K4JA 4CGZA 2R7DA 2CW0F 1WI9A 5ILSA 2F5FA 4PDKA 2HOEA 2IA0A 1G3WA 3HRTA 1I1GA 4AVPA 3ZMTA 1I5ZA 2D45A 4U7DA 1ZRFA 4BAYA 1YW8A 2DK5A 4G7ZF 4P5OA 5CVIA 4A0ZA 3LA7A 5DEQA 5LHGA 3ELKA 3DPLC 4L0ZB 2COMA 3F8BA 3JW4A 1R58A 4LK0F 1W7PD 3J81Z 4EQQA 2IPQX 2BEOA 1XSXA 1RNLA 4RAYA 5LEKA 1ONVA 2EV5A 4HF1A 2EFNA 3RPUA 4ZYHA 1OKRA 1DP7P 2QM3A 3DV8A 1ZG1A 3I64A 3WU1B 1I6XA 4LD5A 5ICGA 2A6EF 3ZMVA 4EJVA 2TDXA 1HXDA 3SFZA 3D5LA 3KZZA 2JSCA 4UUVA 4BHCA 2F5CA 3M8FA 2HWVA 4MGRA 4A6DA 3F8CA 2YSRA 4S04A 2HDCA 3DFGA 1IN4A 3BJ6A 4UV8A 4ZZDA 3GFJA 3N97A 1U3EM 5K5QA 3ECOA 3CLOA 3FX3A 3J80Z 2O03A 2RNJA 3GYHX 3ML6A 2XAGA 1TQPA 3F6VA 3EYIA 3LA2A 3FM3A 2ESHA 4YIIA 5FFZA 3KP5A 3QPHA 4MEYF 2JTVA 3W6KB 4EGZA 2UWMA 1STZA 3CUQA 1EH7A 2HTSA 2CSOA 4BHBA 1MDMB 1ZAOA 2UZKA 4GGGA 2PMUA 1KA8A 1IN7A 4IRHA 1FSEA 1LEBA 5FD6A 2STTA 1W7PB 4LJZF 2MH9A 4HV5A 3IL2A 4JBAA 1ON2A 3BROA 4ASNA 3E6MA 2BV6A 2XUBA 4EM0B 4EM2A 2HR3A 1IZ1A 3KP2A 3MZYA 2P6TA 2YR2A 2LF8A 3NRVA 1REPC 4UXNA 2GA2A 2RVCA 2VE8A 3GW2A 3F8MA 2CWEA 1OYIA 1QZZA 3HHGA 5AIQA 4KICA 4G94A 1S8NA 4ZH4F 5CJ9A 4CO8A 1Z05A 1PDNC 3IWFA 2ZXJA 4NB5A 2O0YA 3F3XA 1HKSA 1GVJA 2W25A 2CQKA 5DCMA 3OOPA 1P2FA 3TOAA 1WWXA 2KRFA 3RTRA 2JPCA 1PP7U 4YG2F 4XSXF 2C6YA 3KETA 2ZNYA 1K6OA 3FXUA 4WCGA 3GFLA 3ABUA 2J5PA 3HRUA 3N4MA 5HDNA 2FXAA 1JHFA 4I02A 4Q48A 5BMZA 1FT9A 1TW2A 3P9IA 3ZN1A 1MKMA 2Z9OA 4G8XA 2NNNA 4M6YA 1ZGAA 4I2OA 2VBXA 1USSA 2KIFA 3I5UA 1F4KA 1IAWA 1TW3A 4M73A 4IPAA 2XROA 2HYFA 4P96A 3IRQA 5L3GA 4OMYA 2Q0OA 2VODA 1BC8C 1D3YA 3VB2A 3EUHA 1XD7A 3IWZA 4B8XA 2D1HA 3QOPA 1QO0D 3GFIA 4UNOA 4IF4A 3T5XA 1RUOA 4AWXB 1P4AA 3VODA 3GUDA 3QRFF 1K78B 5DD4A 1FC3A 3E6CC 2V9VA 4EJTA 1IXCA 2E1NA 1CGPA 1J5YA 2ISZA 2EV6A 2P5VA 2J5OA 2EA2A 3WTYC 4R79A 2GAUA 4LG0A 4HLYA 2K4BA 5DV5A 5JFRA 1U5TC 2BBYA 1KU2A 3E6BA 2ZBKA 4M74A 2H09A 3O2PE 4P9UA 2ADUA 1KU3A 5EEGA 3WODF 1X3UA 2DPDA 3ZMSA 1OYWA 4AIHA 4L0YB 4KFCA 3VFZA 4TV7A 4L9TA 2F2EA 3I58A 2RC4A 2FSWA 2UXNA 4HX7A 1F9NA 2NRAC 1LDKB 2VT2A 5J8FA 3I59B 1EV7A 4HQEA 2FOKA 2OU2A 4CZZA 1KGSA 3FZVA 1XGNA 2EFWA 4MQ9F 4MTDA 2V6CA 1XGMA 2HQNA 1O7LA 2L4AA 2R7FA 1BN5A 3LA3A 1QBJA 3MCZA 1GXQA 2QENA 1G3SA 4L9NA 1I27A 1MJBA 2JPBA 4LMYA 4WX9A 1LQ1A 1RUNA 3F22A 2DFIA 3TDZC 1G3TA 1ODDA 3SHFA 4L18B 3LQQA 1SMTA 4DQ2A 4OOIA 4UV9A 5BS6A 3H92A 1G4DA 2OA4A 4YFXF 4KUMA 4HDUA 1W5TA 3HIFA 2L54A 1SD7A 2XRNA 1KQ8A 4A5NA 4U0WA 3RPQA 4WXCA 4MQVA 4U0VA 4N0BA 1QGPA 2JZYA 1W7PA 5JVTA 3F23A 2K86A 3L00A 5DCMB 2A61A 2EB7A 3O6BB 4KN4X 2HEOA 1I1SA 3ROUA 2PEXA 1LDJA 3FM5A 4A0XA 5FGMA 2KJBA 5LGTA 4L9JA 2P8TA 5ILUA 1UB9A 2FQ3A 2Y0MA 3I53A 2OQRA 1R22A 3F6OA 5L3BA 5E1XA 1OYYA 3ERED 4YIFA 1EH6A 2IJLA 2VONA 2PG4A 5ED4A 1S29A 3C3WA 4I09A 2FA5A 2DLLA 2WWYA 4MTEA 4P9FA 2LNBA 3ZQ7A 1XSDA
chains in the Genus database with same CATH superfamily
4OIQF 2QSFX 2OUMA 4XLPF 3HKZN 2BY1A 2ZFUA 4BYYA 2XAQA 2XPUA 1X1AA 3KEYA 5JI6A 4EJWA 3J80K 3OYEA 2P5KA 4R8HA 1ZELA 1R5ID 5HDKA 1MGTA 2W85A 4AIKA 2O61A 3R0JA 1ETWA 2V79A 2QBYA 2DA4A 3L09A 4RS8A 2VLAA 1U6GA 1XMKA 1O3SA 2LOOA 2EZKA 4CXFA 2LLKA 2HGCA 4Q4ZF 4NHJA 1LE8B 1JKPC 2PX9A 5ERIA 1OMIA 3R0AA 4H4KC 5IT3A 2DMQA 3LFUA 1WH5A 1G8XA 2QBYB 3MFKA 2M30A 1IN5A 3DEWA 1RC9A 4HYEA 2VB6A 4KMFA 3LSGA 1WJ5A 2JT1A 5H20A 2EILH 2JN6A 2FD5A 4I76A 2MD5A 1YE9A 3DU5A 4IEJA 4AM3A 5FO5A 4RAFA 2BXZA 4ETSA 2DFEA 2DO7A 2HXOA 3K9TA 3QPSA 1N78A 2FE3A 5K5OA 3T8RA 2QEXI 4I6ZA 1B9NA 3CMMA 1K6YA 2TRTA 4M71A 2JSPA 4BXXJ 5B3SH 1WKMA 2R7WA 3ZMDA 4M6XA 4PGGA 2FU4A 3H35A 2R7TA 2W7NA 2HXIA 3V8LA 4IHWA 5CVVA 4ZYGA 2KIUA 1XGOA 5J6XA 5H2FC 1FYKA 3K2ZA 4IVNA 1YRNB 3W2AA 3GTPJ 2A07F 2GLOA 1LFPA 1T0FA 5FB2A 3KZYA 2X1EA 2PN6A 3F72A 5F27A 5EG0A 2HPMA 3G1MA 4A0YA 1Z9CA 5IP9J 2HTJA 1YIJI 3O3KA 4MNUA 2EV0A 2LY2A 1YQAA 2PMHA 2LBFB 4EV0A 4OIOF 1HC8A 2W82A 3WE3A 3GVAA 4Z6YA 1ZQ3P 3DTKA 4K2EA 3SQNA 2DT7B 2ZMEC 4XONA 2VC0A 3K10A 1LUJB 4QTRA 3ZP5A 2HVRA 5D5WB 2WC2A 3BCBA 2CYYA 2YU3A 4E7LA 4FTHA 4BXUA 1WH7A 4ZDLA 2BOLA 2O5RA 1VF9A 2OCEA 4N9IA 3SZPA 5E3OA 4A3FJ 2MA3A 4FHTA 2Z5UA 1FTTA 1FBQA 2HZTA 3I4PA 2FEZA 5D8LB 3LSTA 3G6EI 2LK2A 2DK8A 3M1EA 4B47A 1A6IA 1BI1A 2FJ1A 2NVUB 1SFKA 3VOEA 4KISA 5J40A 2WADA 2ME0A 3WTSC 3LFKA 2QLZA 2A68F 1CF7B 3OIQA 5CQGA 4IZZA 4U0YA 1EH8A 2DDBA 3A01A 2XASA 2K9NA 4LGWA 1JGGA 2Z2SB 2KL4A 2WV0A 1FZPB 3BLYA 4A5MA 3RKWA 1R49A 4LG3A 4OIRF 1B4AA 2L3DA 4E70A 4BXFA 2IRFG 1D8KA 4UB6C 1XMAA 5GAGJ 4FE7A 3OYJA 3CCEI 2DTRA 3JRCA 2CQQA 3OS2A 3PQKA 1X4PA 4HF0A 3KEQA 5JHUA 3AG2H 2CH0A 5HS7A 4BU2A 1PP8F 2XGDA 2MD0A 3PNVA 4AD9A 1F5TA 3BPVA 1BW6A 2EFOA 1MMGA 3HOTA 2Z3YA 3B73A 2H8WA 3BPXA 4IKFA 1XN7A 4CUGA 1Q1HA 2EFQA 1ZR4A 2VKHA 4A3IJ 4W97A 3I4MJ 3A0BC 4A3CJ 2JA2A 1MMSA 1BA5A 1APLC 1MMNA 1XB4A 1FLIA 1BM9A 4LIVA 1Z6RA 3RI4A 1TBXA 1Y0NA 1T39A 2OJED 2ZXIA 1BOAA 5D4SA 2QF7A 4AVZA 2RQQA 4HX8A 3MQ0A 1H89C 2BYVE 4FASD 4CCNA 1YG2A 2DN0A 1M1EB 3JRDA 2M0CA 1UCRA 1XCBA 1B72B 2ZXHA 2HS5A 1QHHD 3TW7A 3QU3A 1YJNI 3KLOA 3FHNA 2ELHA 2DQLA 3FF5A 4ESFA 2QZ8A 4OINF 2KJCA 3OYFA 1O4XA 3QYBA 3V8KA 3GCMA 4MFDA 2LKXA 2R3SA 2KT0A 3CCVI 1V5EA 1HBXG 3GTMJ 1O3RA 2XVCA 3G73A 3CCUI 3MZHA 3F21A 1LB2A 5DD8A 1IDZA 3KE2A 4IX7A 2KP6A 3DTIA 3NARA 1IN6A 1YS6A 1B59A 2GQQA 1L3LA 3HZJA 1GVDA 3LWFA 3K7AJ 2KMUA 3BG6A 4MO7A 1KYZA 2L2OA 5A2QK 1UHWA 3BJOA 1TTYA 4PZJA 3E3VA 5F6FA 2ZO4A 3FMRA 3RKQA 4CICA 3C2BA 4II2A 4RMNA 3PSFA 5FRMA 2N8GA 4FX0A 4HG2A 4N9HA 4RGRA 5D4RA 3FDYA 3E5QA 2M45A 5DYMA 2PLYA 2FBKA 4XLFA 2LR8A 5LRSA 1RESA 4KN7X 2X85A 2Y48A 4F52A 3EPZA 2F48A 3DU6A 5HS8A 5EEHA 4QLCU 4ANJA 3BG3A 1Y6IA 2MLKA 2CUEA 3BR6A 1IRGA 1E0EA 2H6BA 1HW5A 1D5VA 3GBGA 3ZOBA 3HTSB 1MNDA 3NWTA 3DEUA 3FMQA 3EUKL 3PFIA 4A6EA 1YO5C 3EETA 3J7AO 1HCRA 1VQ5I 3P9CA 4LLGF 5DS9A 2PJPA 2DA3A 2NVYJ 2ELJA 3TEDA 1C0WA 1U8RA 3N05A 3WG7H 2PI0A 4QWQA 2XGXA 4A3BJ 3BR3A 2X4HA 1TWAJ 3H3ZA 1TT5B 2IS4A 3TO9A 3GF2A 2XF6A 3MMYB 2ZNZA 3S2WA 2FBIA 4WXHA 5CVRA 3FXRA 3SFIA 1Z7UA 3T8TA 4PFOA 3U9GA 4ZYDA 1G2HA 3HOUJ 3HHHA 3CUQC 2HYGD 4CCOA 2VI6A 3TP0A 3LAPA 4I99C 1QZYA 3CP2A 2XKPA 1T33A 5TGTA 3KP3A 3HEFA 4EM1A 2MH2A 5FJ8J 1IUFA 3I55I 1UJ8A 3PL8A 3C2GA 3FISA 1W5CC 2JUCA 5EF6A 5CVJA 2Y0SA 5CPRB 3E6DA 4FX4A 2DAOA 1SMYF 1UHSA 1WJEA 1ZLJA 3ABLH 5E1ZB 3GFMA 3EYYA 4AYBN 1BI3A 3BR1A 1R1VA 2JA8J 2K27A 3CUQB 1SFUA 3NAUA 3WGGA 1OR7A 1EJ9A 2ZJ2A 2VOOA 1PUEE 2HKOA 4AYBA 4RGUA 1FBSA 2HPIA 3RCOA 3UR3C 1T6SA 5LRRA 3WG9A 5LEJA 3KIOA 1VQMI 3L2CA 3JCUC 1U9OA 1SVMA 3DPUA 4EMSA 3S3MA 1BIAA 1U2WA 5F1RA 2JMWA 2L01A 5E8IA 4YELA 4RB1A 4R1HA 1Z67A 3WGIA 2CG4A 2MW8A 2B0LA 2DOAA 1MH4A 4OU0A 1YS7A 4WXDA 4A2UA 2BHYA 1SD5A 1ZYRF 4GYGA 4I0BA 1FPQA 1HQCA 1Y8RB 2KRCA 5F0CA 2JVHA 1K83J 4II3A 2R7UA 2OQGA 3GWZA 1R4MB 3HOXJ 3MN2A 1T2KA 4MHGA 2KIMA 4A3DJ 3C18A 3FHZA 4GYIA 2Q1ZB 4BQQA 1J2XA 2HOTA 1S5LC 3PJRA 1RKTA 4ZYAA 2ICWG 2FBHA 1RIOH 1J59A 3GZ6A 3H36A 3BZ6A 4WK8F 1MMDA 1Q1VA 1VTNC 3JAMK 4FISA 3BQYA 3QPLA 2VL8A 4PGHA 1A5JA 3A1YA 4I98B 4RM2A 3CC7I 2GIVA 5GAEJ 3JRHA 3GEZA 1X4OA 5D5XB 2XKOA 3MVPA 2E1CA 4CA0A 3QAHA 1BI0A 4E6KG 4OAZA 5HLHA 3C7JA 1X1CA 4DZJA 2VKVA 4FT8A 1HLVA 5E17F 1V4RA 3HRSA 2A69F 1U8BA 4V2FA 3CMEI 1GV2A 2L7MP 1JXSA 5K1YA 2OZUA 2Z99A 4HBLA 2LG4A 3HSEA 2YUSA 3GZ5A 1E3HA 4XK4A 3M7GA 3HJEA 5BQTA 2LSOA 2DQRA 2CV1A 3DP7A 5KVRA 3GLLA 4KMUX 5KNLA 5DUIA 5D6EA 3ERMA 4DBQA 2VPLA 2F5DA 3HL2A 1V3FA 2IGOA 1AHDP 2MG4A 4BNCA 1LJ9A 3KPHA 1R23A 2ZFWA 1O7FA 3WTVC 3E0JB 1LPQA 4KIBA 4XIDA 4P55A 3HGGA 2WAQA 5EGOB 2CJJA 1B9MA 1FEXA 1MBJA 2I8DA 3BT9A 1U78A 2P6SA 3ABTA 1XG1A 3F8FA 1VQ9I 1BJZA 2HQ5A 5ICEA 3CZ6A 1B8IA 2HDDA 3AG1H 2NVTJ 3U1DA 3FXQA 2P5LC 2G7UA 3MKYB 2M2EA 5CLSA 3RKYA 3KP6A 5LGUA 1WJCA 5EJCA 1U5TB 3PFYA 1XS9A 1TNSA 3QP6A 3VWBA 3WTXC 3SDGA 3K69A 2KDOA 1WQ2A 1MNMC 2WA0A 4AC0A 3WU2C 2IS2A 4G6DA 5C44J 2DU9A 3OSGA 3CCYA 2VE9A 1SD4A 2QKLB 2V1XA 4M3EA 4F3QA 1G3YA 4OMZA 1F1ZA 1TZLA 2BY3A 5DDGA 1X19A 2EA4A 2DYSH 1S7EA 3DXJF 4I7HA 1B1BA 3QP5A 3M3YJ 1NG6A 3K4CA 4BL0B 3IHUA 5BNGA 4M72A 2M0MA 2ETHA 4IJAA 2HU9A 1YW7A 4G12A 3CC4I 1JHHA 2XGEA 4LG0B 2LTPA 4W1UA 2IGNA 4C3IJ 1UG2A 1SFOJ 4AUXA 3CCSI 4IHTA 3FMSA 2HNHA 5GPAA 4BBSJ 1D5YA 4RB3C 4C30A 3D5RC 4B1RA 4LITA 2A5YB 2AHQA 2WY7Q 4L5JA 4AIJA 3D5SC 4Y13A 1NG7A 1DPRA 3S93A 1FYLA 1JGSA 3E5UA 3J7ZI 4HW0A 5D6FA 2F6CA 1W0TA 2WTEA 4LLLA 1XSVA 1K4SA 2XIGA 4ESBA 3X2QH 3NWSA 2KIQA 3R60A 1H8AC 4O6JA 1W36C 2EK5A 1DU6A 4XM3A 3BOQA 1J75A 3ZPLA 5KHDA 5JLWA 5FFXA 3BTIA 3H3UA 4IRIA 1VQ6I 2ACJA 2HKXA 4OAYA 2X0LA 3BDDA 3DCFA 4X6AJ 3ZQQA 1GT0C 3S8PA 4IXAA 1XC5A 4AU7A 4RB2C 3JRBA 1P6RA 2HQAA 3A01B 5BOXA 3IH3A 1NH3A 1SFXA 3K0LA 4HOBA 2CO5A 3FKJA 1NHAA 2VOPA 2F5EA 1CF7A 2VBYA 3E1SA 3HM5A 4XNFA 5GADJ 4A12A 4LIUA 5IY5H 3WTZA 1EA3A 2RDPA 3M1CA 1VFCA 3LNQA 3LSIA 3BG9A 2QWWA 4ZYEA 5B1BH 2LKSA 3VEPA 3H0GJ 3KYCB 1OCCH 1X2NA 2QKMB 3CF2A 3S3NA 2ISYA 4XLNF 3R61A 5LLQA 3HOSA 4HF2A 4BUPA 1O3QA 2MBFA 1OQYA 3C1DA 2EPFA 1RI7A 1S9HA 3MKLA 4IHVA 1XTAA 2M7AA 3PO3J 3S15J 1JUSA 1MZBA 4DJAA 2O6GE 1IO2A 4KNYA 3EQLF 3R6SA 3F8NA 4CZCA 3RZOJ 2NYXA 1HDPA 5M5XJ 1ERDA 2LKPA 1SVLA 4BE1A 2IS6A 4M3DA 4D0PA 5HLTA 2D2WA 3PUFA 3IV5A 1K79A 2UUZA 2WBMA 2KFDA 1SEUA 5GP9A 2LBFA 1S3JA 2V4JC 3OYMA 2XHKA 5M3MJ 4Z2YA 4XKWA 1E17A 4KDPA 3SXYA 2CV0A 1G6NA 1W4MA 3BTCA 3WTWC 1XDUA 2KZVA 5HLIA 4C3JJ 3RZDJ 1KYWA 1UG0A 4GO1A 5B1AH 1ZN2A 1P9QC 1OISA 4G6TB 1A04A 4EJUA 2B9SA 2L4MA 2E2JJ 4I0AA 1OR7C 4M3FA 1FOXA 2Z33A 2NVQJ 3FXJA 1U5TA 3GTLJ 5TISC 4KITB 3CF5F 1N77A 1AWCA 2W24A 2W57A 4XBFA 2DT6A 2JRTA 4IHYA 1QPMA 1B8IB 2XAJA 3KZIC 3JSPA 1VQ4I 2IA2A 2NVXJ 4S05A 2GZWA 4BEHB 2P4WA 1FJLA 2V6EA 3VSKA 4XICA 3KCCA 4KYWA 4LLNA 3FWEA 5J47A 2QCOA 2V9KA 2QQBA 3OL4A 4CH7A 1LNWA 3JTGA 1AKHA 4U88A 3DBLB 3HKZA 3OYHA 4B44A 2PFBA 3QPTA 2KLOA 5TJJA 4DNCA 1PUFA 1VQOI 4IQJA 3SDBA 1R6RA 2EJRA 3DBRB 2K9MA 3V4GA 4ZTFA 3PSIA 2CV2A 2DTZA 4F91B 1S7OA 4BJ6C 1ENHA 1P4WA 2CMPA 2DMPA 2E36A 2VC1A 3ASOH 5AONA 2XV4S 4N4OB 3CDHA 4DOZA 1P4XA 1GLNA 2A05A 3G3ZA 3KFWX 2P7VB 2K40A 4E7ZA 2DODA 2MLGA 1FMWA 1QNTA 2BHZA 2ESNA 3KLNA 2F4MB 2W84A 4UHTA 3LSHA 3I54A 2EH3A 5FLXZ 1ZG5A 3HSFA 2ZMEA 3CMAI 1BOBA 5FKMA 2L9NA 2RKHA 3K6GA 1LVKA 4HV6A 1WRJA 2OBPA 2W48A 4RGXA 4YEJA 2LDUA 2QQ9A 2FF4A 3P9KA 2GXAA 3HTUA 4E7SA 2RQPA 2ZCWA 4ENJA 1WI3A 4ZTJA 3BJAA 1YYVA 4IRGA 2VJ4A 1TL8A 1IC8A 1RR8C 3E5XA 1PUFB 5H6RA 3ISPA 1F43A 5L3FA 1FP1D 1MBEA 1V54H 3BY6A 1OPCA 2H8RA 3FKIJ 5K7HA 2BE5F 2E7XA 3BQZA 4D1QA 2TCTA 2LY9A 4XKCA 5E8GA 3DKWA 1R1TA 1X1BA 4RB0A 3CO6C 3OYKA 2OV7A 3G1LA 2ZKZA 1IXRC 2KISA 5ICCA 3ZXSA 2LVSA 3RDIA 1FOKA 4D9JA 5J8CA 5TRDA 2AXLA 2L9VA 2QYOA 1U0JA 4LB6B 3IC7A 5HVQC 3RQIA 1JUPA 2NOJB 1D1BA 1MJAA 3RIRA 4BQNA 3EDPA 5K5RA 2QVOA 2K02A 1Y1VJ 1TQMA 4EEFG 3TGNA 3G2BA 3MWMA 2G9WA 3BR0A 2ID6A 1JTXA 1YTYA 2EZHA 3SZGA 1LEAA 1JE8A 3OMYA 2VBWA 2WB1A 1HW2A 1R7JA 2VT3A 5LHHA 2K3FA 2G7HA 2L02A 5BPDA 1F36A 3KEOA 3VDXA 5FLXK 2F5VA 1W0UA 1HSTA 1ZRCA 4ENKA 2A6TA 4DIQA 5ILVA 1A36A 3HOVJ 3I4NJ 1MDMA 3B6AA 2IS1A 2CQNA 1FNNA 4HLXA 2MYSA 3ZMZA 1Z6TA 1WJDA 3CTAA 2DT5A 1T0FC 2X6YA 3KYDB 2QQAA 5D5VB 1D1AA 4GXOA 1KU9A 3BWGA 4BQAA 3JTHA 1OJLA 3WE2A 1A31A 1HW1A 2L0KA 1JTYA 2Q2EB 1QZEA 1R1UA 2H27A 2E5ZA 2OTLI 2B63J 3GX4X 3ZCOA 2UV1A 3QOEA 1ZH5A 1W5SA 2FRHA 1IN8A 1UFMA 2L9SA 1VQLI 1YFHA 2CFXA 3IKTA 3AL0B 3K1PA 3TL4X 2FQ4A 3CMYA 2XAFA 6PAXA 3JR9A 1ZARA 4X0GA 5FKKA 4Y15A 2YPRA 4D7NA 3Q9VA 2LP0A 1J0RA 5L3DA 4B3AA 3Q0VA 5L3EA 2VUMJ 2EFPA 2EIMH 2JA6J 2L5QA 2E60A 2VKDA 3E97A 1YLFA 4XLEA 2E1OA 2XPWA 2R0QC 2ZMEB 1X3WB 3LQRA 3K70D 3ULQB 4HRIA 2K7LA 4L5EA 1N75A 3SZTA 1IUYA 5HS9A 2MGQA 3U2RA 2QSGX 1ZHFA 1SVOA 3WTUC 4PJ0C 2XAHA 2K9SA 2Q2EA 2YU9J 1MBKA 1ZG3A 4HEA2 1SFEA 1GHCA 3HGYA 3ZQLA 4JX4A 4NQWB 1I39A 1I50J 1USTA 3D1NI 3FXKA 3ESWB 3HUGA 1WGXA 3M8EA 1TNTA 3F0CA 3OYLA 4E7HA 2GM4A 5M5WJ 4CYCB 2NXNB 4N4NB 2VXZA 4JX6A 3H3VK 1DGWY 3GTOJ 3RKXA 5D5UB 2R7RA 5LFAA 1AOYA 1ZLKA 2ZSHB 2KRHA 1GUUA 4EGYA 2IW5A 3PNYA 2FUG2 4F7ZA 4HDVA 4PCQA 1YW9A 3M8JA 3JAMZ 1LVAA 1A35A 2KKOA 5GTIC 3CP8A 4HNTA 3L2QA 2BVLA 4B3XA 5FLVA 4NQWA 3S16J 4O5VA 2DMTA 3FK6A 3Q9SA 2CFOA 5HLGA 1O3TA 1YOVB 4JQFA 2HZDA 4G7OF 3K4BA 3O8GA 4ZC3A 4M9XA 2QQ8A 3WHCA 1WJFA 3QYEA 3L2UA 3WTTC 2QUFA 2VPRA 3W6VA 4PUSA 4RBOA 4QSHA 5HOOA 3QYFA 2JA5J 1FIPA 3KP7A 4Q47A 1TWHJ 1Z0XA 2HFHA 1MJ9A 4XR6A 4U7BA 2VASA 1Y0UA 4BHPA 2BVMA 4J01A 4EJOA 4JK1X 2R5ZA 4GFBA 1H0MA 3ZQCA 2DA6A 2P7CB 2R92J 3IH2A 2AXTC 3V7CA 1FX7A 2DOFA 3IKVA 3CCRI 4BACA 1B72A 1K7AA 1J7KA 2V7FA 4P1WA 5E79C 2IP2A 2M8EA 3BC8A 4MEXF 3TOBA 4QPOA 3CUOA 5L3CA 2GXBA 3J7AY 1H9TA 3K4KA 2EIKH 3BCAA 1K78A 1IV6A 1UAAA 1S7AA 4G6QA 1ZRDA 1A6QA 2CUJA 1JUMA 1N25A 2OAZA 4JOMA 5LHIA 2ELKA 3V8JA 1QQIA 5LBQA 1U9NA 2EQRA 2NAZA 5FKLA 4O3MA 2FMYA 2IA1A 3M9AA 5E1WA 3MKWB 3P7NA 4UVAA 1XMXA 2M8GX 3S32A 2P0WA 2RN7A 4BBRJ 4CHUA 5HDGA 3K4LA 1LFBA 3H9JA 1YJWI 2Y9ZA 4Y52J 2BGCA 1Z3XA 1LDDA 3OWTA 3Q0UA 4ESJA 3R4KA 2LH9A 5IPAA 1BBYA 1FSHA 4BH9A 2YX7A 3LAJA 2XC7A 2XSDC 1TWGJ 2NS0A 3CJNA 4A3KJ 2IXSA 2DXIA 1J9IA 4QIWN 1QHGA 4CDGA 1YIOA 3OR2C 3S3OA 4I01A 2DMUA 3MD2A 1MNEA 2HQRA 2JRMA 4NBQA 4JYKA 1X2MA 4HZFA 4XKBA 1BI2A 2B7EA 2V26A 1FMVA 3D0SA 3I0TA 4UVBA 2KZGA 2R7VA 1L0OC 5IYBJ 3CO7C 2FNAA 1UZCA 1X1PA 2DI3A 1SD6A 5D8KB 1BR1A 4GCVA 2R7OA 4KIFA 1WJBA 2R4GA 3BP8A 1W1WE 4D5FA 2CW8A 1SANA 4HAMA 3S2DJ 2VN2A 4XL9A 3DF8A 2E2HJ 3PQJA 1IRFA 5J1UA 3K1MA 2LFBA 3PIOF 1RR7A 3T0YA 2P81A 2Z1DA 1Z3YA 3QQAA 3ZMUA 1MH3A 3HOYJ 4HQMA 2K3PA 1Y56A 4YFNF 5EEAA 2UXXA 2HI3A 4F93B 4KIGA 4G7HF 4C2UA 3CCJI 5K7ZA 1TC3C 2X9DA 4UUTA 4Y4RA 3MEXA 1FTZA 2M1BA 2R5YB 2JA7J 1I6HJ 1GV5A 1IDYA 3OV8A 2CU7A 1NK3P 1YX3A 4LOCA 2AS5F 1MSEC 2V1UA 1H88C 2XAUA 3W2VA 4G9YA 1T98A 5EG0B 2OZ6A 2X6XA 5DUKA 4XRMA 2AQEA 1BC7C 2AO9A 2CGPA 1DUXC 3H5AA 2MSYA 3COAC 1VI0A 2XB0X 1IXSB 5DM6F 2FMLA 1TQIA 5FROA 4DBRA 5CVUA 1H9GA 3V7RA 1YRNA 3HYIA 2I5UA 3ZGKA 1BJAA 4XN3A 2Z16A 2D1VA 3F9KA 4RGSA 2R7XA 1RZ4A 1R00A 4CYDA 5BPIA 4B09A 3AAFA 2OC6A 2DMNA 2AQFA 2LF7A 1MD0A 3I71A 3Q5FA 5KCMA 2Y9YA 4D7MA 1QRYA 4A3LJ 1XGSA 3L7WA 3OY9A 4FE4A 1IF1A 1R36A 1LE8A 3HUGB 4DYCA 4MIMA 5F08A 1GDTA 1ZREA 5AIPA 3LSRA 1Z91A 2XPVA 3JSOA 2G0EA 4LB5A 1IGNA 3GXOA 1Z1DA 1PVEA 1XCVA 1CQTA 1WHUA 5B66C 4LFUA 3TO7A 2Y75A 2CQ7A 3LSMA 4UUSA 1ETQA 4J19A 3H5NA 4A69C 3SJMA 4ENMA 3K2AA 5IT9Z 2K9LA 5A2QZ 3HRMA 3NQOA 4DYRA 3LSPA 3WU0A 4X1EA 2MFZA 1HKTA 4H0EA 2M87A 1MBFA 3DQVC 3I56I 4LK1F 3TBIA 3FXLA 1FBUA 4XKVA 5E20A 5JLXA 2Y0SN 1FY7A 2Q8KA 1PJRA 3TKYA 5KAIC 4D5CA 3GLXA 2JUGA 2VQGA 5ICFA 3K70C 2STWA 3HOWJ 3OIOA 1E2XA 3K4MA 5CYVA 1HKQA 4EVIA 5J1RA 2X1DA 2M3AA 2ZXWH 2R7QA 3ASNH 1OLTA 3HSRA 3MAJA 1S6LA 3KP4A 4RAZA 3ZR8X 2IVMA 3REOA 2GA1A 1FOYA 3GO5A 2GWRA 1D8JA 2DFFA 2VJ5A 3RYPA 2ZJPF 1KQ9A 3WGHA 3C2HA 4KJZA 5IYCJ 4YFKF 1WSUA 2RNGA 4HNVA 3ZQFA 3Q0WA 2K5CA 3M07A 4PJLA 1SAUA 3HG9A 1T38A 2Y69H 2DBBA 1AKHB 5FD5A 1KU7A 4XSZF 2H6CA 3JRGA 1SAXA 4KT5C 5DCFA 3QU6A 2QSHX 3CLQA 1GXPA 4ABZA 1UELB 3TO6A 1T08B 1FYMA 3J81K 1BIBA 1ULYA 5E18F 1D0XA 2H94A 2E5NA 1P92A 2HDWA 3RJPA 3IUOA 1DPUA 3W6JB 2IGKA 1KONA 5IT9K 2FNPA 3ZN0A 2DOEA 1R5GA 5LGNA 1T95A 5KAFC 2L7ZA 2A6HF 2EZLA 4XRFA 1R5HA 5EZHA 3L9FA 1UHMA 4XRSA 2RV8A 3LOCA 4GDFA 4WF2A 1V5GA 3BR2A 5J1YA 2M5WA 2VBZA 4RA2A 4PSXA 4ZZLA 1DDNA 1XDSA 2NNYA 3CCLI 1UMQA 3IAM2 4Y17A 1IRXA 1POGA 2OD5A 2GXGA 2V1DA 3TMOA 3LL7A 4KT6A 4BY1J 5H6QA 4ON0A 1K4TA 2YX4A 2PQ8A 3ECHA 4BDZA 4ZDOA 1MMAA 2IT0A 1IW7F 4Q5SF 9ANTA 3V7SA 3BTLA 5JVGF 4M9SA 3S1MJ 5LD2C 3PM1A 4XLAA 5M3FJ 4XQFA 4EATA 2ME6A 2R93J 3I59A 4B4CA 3T1BA 4HX4A 1XPXA 2E19A 5GPCA 2O3FA 2RGVA 2MC3A 2DW4A 3JRAA 2M9HA 2E7WA 1VQNI 1LKXA 1KQ0A 3EUHC 1FWZA 5F0HA 4OIPF 5JR3A 4L5IA 2E34A 3B02A 3HPGA 5FRNA 4RAGA 4L9VA 3ZQIA 3NEUA 4WWCA 3RQ4A 2M4KA 5F64A 3IRRA 4UVCA 2DA7A 2DPUA 1ETOA 4ZDPA 3PO2J 1ZGJA 2EWNA 1FP2A 4CCJA 1RETA 2O8XA 4RLFA 3TQNA 3U1KA 4ENNA 4M9ZA 1YX5A 1ON1A 2K9QA 3K1NA 2BW3A 3TDUC 4RLQA 4HA8A 1ETYA 3RYRA 2CS3A 4CCMA 2ZB9A 3LSKA 1O57A 1TLHB 5KK1A 2EBIA 1B6AA 4KA4A 2PBIA 1WVRA 2A3SA 2CRGA 4IHSA 3H5RA 2WAEA 1E3OC 2XDVA 3DPTA 4V19K 2H1LA 1HSJA 4BJ5C 2K4JA 4CGZA 2R7DA 2CW0F 4NDLA 1IJWC 1MBHA 1WFXA 1I3QJ 5B5EC 2R7SA 1WI9A 1PYVA 5ILSA 2F5FA 2L9RA 4PDKA 2HOEA 2IA0A 1G3WA 3HRTA 4M3GA 1I1GA 4AVPA 4E7IA 3ZMTA 1YHQI 1I5ZA 4IOCF 2M7BA 2RAEA 2D45A 3DLAA 4U7DA 3FK7A 1ZRFA 4BAYA 1YW8A 2DK5A 3OYGA 4G7ZF 5F04A 4P5OA 5CVIA 4E7JA 4A0ZA 1OFCX 2DA5A 3LA7A 5DEQA 2DCEA 5LHGA 2RREA 3ELKA 3DPLC 4XN0A 4L0ZB 2COMA 3DKXA 3LSJA 1ORKA 3OSFA 3OYCA 3F8BA 1NTCA 3JW4A 1R58A 2PJRA 4LK0F 2E35A 1W7PD 3J81Z 4EQQA 2IPQX 4PK4A 1YITI 4BQOA 2BEOA 2X1CA 2Y31A 1XSXA 3IAS2 2CQXA 4RM3A 1RNLA 3OYDA 4RAYA 3IP4B 3I9V2 5LEKA 1ONVA 2EV5A 3GMEA 1WCMJ 3M4OJ 4HF1A 2EFNA 2F4OB 3KYLA 3RPUA 4NC6A 5E3NA 4ZYHA 1OKRA 5IYDJ 1EF4A 1X3ZB 4IQ4A 4FETA 3CJTB 2BY0A 2F4IA 3U21A 3OYIA 5C3EJ 1DP7P 2VQCA 4BGDA 2MABA 2QM3A 5HNFA 3DV8A 3GZNB 1ZG1A 3BG7A 3S1RJ 2NS8A 5IOYA 3I64A 3S1QJ 3WU1B 1I6XA 4LD5A 1OCRH 5ICGA 1ITYA 1LFUP 2A6EF 3A03A 4ITVA 3ZMVA 4EJVA 2TDXA 3EUAA 3J7YJ 1HXDA 2KDZA 4Y3OA 3SFZA 3AG3H 3IH4A 3PUBA 1R4NB 3D5LA 2JSCA 3KZZA 3RSNA 4BHCA 3PIPF 4UUVA 3S17J 2FX0A 3A0HC 2F5CA 3M8FA 4CCLA 4IOAF 3OOUA 4HPQA 3DLLF 3WHBA 1DGRM 2HWVA 3OR1C 2QGUA 4MGRA 3F8CA 4A6DA 1R9TJ 4V2GA 1DU0A 3OIPA 2YSRA 4S04A 2HDCA 1MSFC 2BZTA 1IN4A 3BJ6A 3DFGA 1ZTRA 4GRIA 3CQZJ 4UV8A 4ZZDA 3CDLA 1DP3A 3GFJA 3N97A 4A93J 1U3EM 1TT0A 5K5QA 3ECOA 4YRVA 3OYAA 3CLOA 1X58A 3FX3A 3J80Z 1MW7A 1T56A 2DFHA 2DYRH 4DYQA 5F1JA 5E3MA 2O03A 2RNJA 3BR5A 3DWLE 3GYHX 3DTEA 2Y2ZA 3ML6A 1QPIA 3JREA 1JKQC 1V55H 2XAGA 1TQPA 3F6VA 1OCOH 2E1MC 4BJTA 2QA4I 1Z77A 3K4JA 3OS0A 3EYIA 1ETKA 1TP4A 4MFEA 3LA2A 3FM3A 3ONQA 2ESHA 4YIIA 4PFPA 5FFZA 3KP5A 3QPHA 1D0ZA 1P7JA 4MEYF 2JTVA 5IP6A 4JX5A 3W6KB 1QVTA 2XSJC 2WV1A 1Y39A 2R5YA 4IHXA 1Z21A 1ACIA 4EGZA 3DEEA 2UWMA 1STZA 3CUQA 5EGOA 1EH7A 2HTSA 2CSOA 1VNDA 2PJRB 4BHBA 4BS9A 1MDMB 1ZAOA 2UZKA 3ABKH 1MIJA 2XF7A 4GGGA 2PMUA 1KA8A 4XMYA 1IN7A 4IRHA 2BY2A 3UNGC 3TW6A 2ECBA 1FSEA 1LEBA 1R71A 2W00A 1QU3A 2OCCH 5FD6A 2JVGA 2STTA 3OYBA 1W7PB 4BE2A 4LJZF 4CCKA 1S72I 2MH9A 2Y30A 4HV5A 4JBAA 3IL2A 1JI8A 4PSWA 1ON2A 3BROA 4Y33A 5EDNA 3HOZJ 3FIWA 4ASNA 2GIZA 2DJIA 3E6MA 2BV6A 2XUBA 5FKOA 4EM0B 4EM2A 1VZ0A 2HR3A 1G59A 1ZGWA 1Y8QB 1IZ1A 4DZPA 3KP2A 3VSLA 1JT0A 1IG7A 3MZYA 2P6TA 2YR2A 1ETVA 2LF8A 4A3MJ 3TP3A 3NRVA 1REPC 2WB1N 2YS9A 2VQLA 2O9LA 4UXNA 2GA2A 2RVCA 3HBLA 3I3LA 1J09A 3OS1A 2VE8A 3GW2A 3AKZA 3CJRB 3F8MA 1JKRC 2KPMA 2CWEA 1OYIA 1QZZA 2VXDA 3HHGA 5AIQA 2R7ZJ 4KICA 4G94A 4PJMA 1S8NA 1HA8A 4ZH4F 2MC4A 3H9GA 5CJ9A 3CCQI 4CO8A 1Z05A 2EIJH 2K85A 2GOXB 3ZQGA 1PDNC 2R5ZB 1AU7A 5J4YA 3IWFA 2ZXJA 3SEQA 2L7KA 4NB5A 2O0YA 2E71A 2CUFA 3F3XA 1HKSA 2ID3A 2OPTA 1GVJA 2FOWA 2W25A 1BR4A 2CQKA 5DCMA 3P5JA 2ZC2A 3CCMI 1FOWA 5C4JJ 3OOPA 1P2FA 2IEKA 3TOAA 3CD6I 4JP0A 1WWXA 2M34A 2KRFA 2HVQA 3RTRA 2LD5A 1NK2P 2JPCA 1PP7U 5M5YJ 4XORA 4YG2F 3HC7A 4XSXF 2C6YA 1WJAA 3KETA 5GTHC 3S1NJ 2ZNYA 1K6OA 3FXUA 4WCGA 3GFLA 2VJJA 3ABUA 3E7LA 2LRDA 3S2HJ 2J5PA 3FBNB 5J4VA 1YI2I 5HNHA 3HRUA 3N4MA 5HDNA 2FXAA 3L2VA 3HDDA 2W4SA 1JHFA 2CUZA 1TWCJ 4I02A 4Q48A 5BMZA 1FT9A 4C2TA 3ZQHA 2VIXA 2X6OA 1TW2A 3P9IA 3ZN1A 1MKMA 2Z9OA 4G8XA 4J00A 3GTGJ 2NNNA 4CSWA 4M6YA 1ZGAA 1JJ8C 4I2OA 2VBXA 3CDIA 1USSA 2KIFA 3I5UA 3VYUB 1OCZH 2VQHA 3ZRGA 1F4KA 1IAWA 1TW3A 5FKNA 3OL3A 4M73A 5DM7F 4IPAA 2DA2A 2XROA 2HYFA 2COBA 4P96A 3AFHA 2WAFA 1VQ7I 3IRQA 5L3GA 4OMYA 4C2MJ 2Q0OA 3LMMA 2VODA 4S0HB 3CC2I 4U87A 5C4XJ 1BC8C 4E4HA 1D3YA 4CYCA 2XGCA 2O7OA 3EUHA 3VB2A 3MKZA 1XD7A 3FBIB 4NNJA 3JRIA 3IWZA 4B8XA 2PMZN 2H1KA 3HB9A 2D1HA 4UY8I 3QOPA 5DTDA 4B43A 1QO0D 3GFIA 5JHFA 2X6WA 5HODA 1W36D 2BW3B 1BL0A 4UNOA 3ABMH 4IF4A 1HOMA 1FIAA 3BZKA 1V5FA 3T5XA 1RUOA 4AWXB 1P4AA 3A4CA 4A3EJ 1T8IA 3VYSB 5IOZA 5FLMJ 2GOMA 3VODA 2GBYA 2XF5A 1WPKA 2DA1A 1BW5A 3GUDA 4FQGA 3QRFF 1K78B 1D0YA 4B48A 5DD4A 1FC3A 1XX5A 3V42A 3E6CC 1QA6A 1SC7A 2ZJQF 4PJJA 2V9VA 2XB5A 4UB8C 4EJTA 1IXCA 2E1NA 3CJQB 1CGPA 1Z7LA 1J5YA 4PJNA 2ISZA 2EV6A 2V9PA 3VYTB 2P5VA 2ZSIB 3FXOA 2J5OA 2VKEA 2EA2A 2M4GA 2LC2A 3G71I 3OYNA 3JRFA 3WTYC 1ZK8A 2JJ7A 4R79A 2GAUA 2W1OA 4LG0A 3AL0C 3DBHB 4BEHA 4HLYA 2OF7A 3VPRA 2K4BA 5DV5A 2I10A 5JFRA 5IP7J 1U5TC 3VYRB 4OWRB 4IL6C 2BBYA 1KU2A 1JJ6C 1DQUA 3E6BA 2ZBKA 4M74A 2H09A 3O2PE 4BE0A 4P9UA 2X48A 3K4NA 1YJ9I 2ADUA 1KU3A 4MLOA 5EEGA 3WODF 1X3UA 2DPDA 3ZMSA 4M3BA 3CESA 1OYWA 3FXMA 4YIRX 4AIHA 4L0YB 4C9YA 4KFCA 3VFZA 4TV7A 4L9TA 2F2EA 3I58A 2RC4A 5E3LA 2OTJI 3KX2A 2NS7A 2FSWA 5EYRA 4Y7NJ 2JK3A 5CKTA 1IV8A 2UXNA 4HX7A 4NUBA 1F9NA 1JT6A 2JWTA 4IO9F 2NRAC 1LDKB 2VT2A 5J8FA 3I59B 1EV7A 5CQEA 4HQEA 2JQ7A 4F55A 2HVSA 3W3CA 2FOKA 2CW7A 4ZJZA 2ZJRF 2OU2A 4CZZA 3AG4H 1KGSA 2LYCA 3FZVA 1XGNA 4XLHA 2EFWA 3A2KA 4MQ9F 1QVUA 3Q3SA 4MTDA 2KHMA 1WZ2A 2VJIA 3G1OA 1ZKGA 1E3PA 2HYJA 3A02A 2V6CA 5J3LA 1XGMA 2HQNA 2IGMA 4NC8A 1O7LA 2KQRA 2IAIA 2L4AA 2R7FA 3H1CA 4RDUA 1BN5A 3LA3A 2HOAA 1QBJA 2WY8Q 1D1CA 4BKXA 1VQ8I 4C3HJ 1K61A 1AA7A 3MCZA 4NC7A 1HDDC 1GXQA 3SEZA 2QENA 3BG5A 1G3SA 4L9NA 1I27A 3O8HA 1VQPI 4HSTA 1MJBA 2JPBA 4LMYA 1X1DA 1HF0A 4WX9A 1RKWA 1LQ1A 1EKEA 1RUNA 3F22A 2DFIA 1I3AA 3TDZC 1G3TA 1ODDA 2EINH 3SHFA 4L18B 3QWLA 3MZ8A 4E7KA 1IRZA 4UUSB 3QODA 3LQQA 3W2WA 1SMTA 4DQ2A 2ECCA 4BY7J 4A3GJ 5K7FA 2DJNA 4OOIA 3BZCA 3GTJJ 4M6VA 4UV9A 5BS6A 2V1NA 4BDYA 1BR2A 3H92A 4HNUA 1G4DA 2BXYA 3H9QA 4XOTA 1TWFJ 2OA4A 4YFXF 4KUMA 4HDUA 1W5TA 5EZGA 2A5WA 3HIFA 1ETXA 2L54A 2O8KA 1SD7A 3L2RA 5GAHJ 2XRNA 1KQ8A 3GTQJ 4A5NA 2E2IJ 4U0WA 3RPQA 1P7IA 4WXCA 1Y1WJ 2HOSA 4MQVA 4U0VA 4N0BA 1QGPA 4XRSG 4DW6A 2JZYA 4XLCA 1W7PA 3RPUD 5JVTA 3F23A 3BTJA 2K86A 3L00A 2EZIA 2XRLA 5DCMB 1JKOC 3G4SI 1MBGA 2A61A 2EB7A 3O6BB 4KN4X 4F92B 2HEOA 1I1SA 3L1PA 1ZR2A 3ROUA 2PEXA 3GTKJ 1LDJA 3FM5A 3HXLA 5F0FA 3SYTA 5FGMA 4A0XA 2KJBA 2LMDA 5LGTA 4XOPA 2LREA 2P8TA 4L9JA 1UB9A 4HSRA 5ILUA 2FQ3A 2Y0MA 3I53A 3UKGA 1OCPA 2OQRA 3B6CA 1R22A 3F6OA 3H0DA 2NOGA 5L3BA 5E1XA 1OYYA 4DGWB 3HPHA 3ERED 4YIFA 4FCYA 1EH6A 1KZHA 2IJLA 4A3JJ 2VONA 2PG4A 1OCTC 5ED4A 1S29A 2IBDA 3C3WA 1RPWA 2E1MB 2PMZA 1RRJA 2DDAA 4I09A 2FA5A 4AIDA 2L7FP 2DLLA 2LY1A 2WWYA 3L2WA 1VQKI 2WAQN 4MTEA 3S14J 2X51A 4P9FA 2LNBA 3ZQ7A 3PNTA 2D5VA 4QPQA 3DKYA 1XSDA
chains in the Genus database with same CATH topology
4OIQF 4XLPF 4BYYA 2XAQA 5JI6A 4EJWA 3J80K 2P5KA 4R8HA 5HDKA 1MGTA 2W85A 4AIKA 2O61A 3R0JA 2V79A 2QBYA 3L09A 4RS8A 1U6GA 1XMKA 1O3SA 4CXFA 2HGCA 4Q4ZF 4NHJA 5ERIA 1OMIA 3R0AA 5IT3A 2QBYB 3MFKA 2M30A 1IN5A 4HYEA 4KMFA 2JT1A 5H20A 2MD5A 5FO5A 4ETSA 2DO7A 3K9TA 2FE3A 5K5OA 3T8RA 1B9NA 4M71A 1WKMA 3ZMDA 4M6XA 4PGGA 2FU4A 3V8LA 5CVVA 4ZYGA 2KIUA 1XGOA 5J6XA 1FYKA 3K2ZA 4IVNA 2A07F 1T0FA 5FB2A 3KZYA 3F72A 2PN6A 4A0YA 1Z9CA 2HTJA 3O3KA 4MNUA 2EV0A 2PMHA 1YQAA 4EV0A 4OIOF 3WE3A 3GVAA 4K2EA 3SQNA 2VC0A 3ZP5A 5D5WB 2WC2A 2CYYA 2YU3A 4BXUA 4N9IA 3SZPA 2MA3A 4FHTA 2Z5UA 1FBQA 2HZTA 3I4PA 2FEZA 5D8LB 3LSTA 2DK8A 3M1EA 1BI1A 3VOEA 3WTSC 3LFKA 2QLZA 2A68F 1CF7B 4U0YA 1EH8A 2XASA 4LGWA 2WV0A 1FZPB 4A5MA 3RKWA 4OIRF 1B4AA 2L3DA 4E70A 2IRFG 1D8KA 1XMAA 2DTRA 3PQKA 4HF0A 3KEQA 5JHUA 5HS7A 1PP8F 4AD9A 1F5TA 3BPVA 2EFOA 3HOTA 2Z3YA 3B73A 3BPXA 1XN7A 1Q1HA 2EFQA 1IUYA 1XB4A 1FLIA 1BM9A 1Z6RA 3RI4A 1TBXA 1T39A 1BOAA 5D4SA 4HX8A 3MQ0A 2BYVE 1YG2A 1UCRA 1XCBA 2HS5A 3QU3A 3KLOA 2ELHA 2DQLA 3FF5A 4ESFA 2QZ8A 4OINF 2KJCA 3V8KA 2R3SA 1HBXG 1O3RA 2XVCA 3G73A 3MZHA 3F21A 1LB2A 5DD8A 3KE2A 1IN6A 1YS6A 1B59A 2GQQA 1L3LA 3LWFA 1KYZA 5A2QK 1UHWA 3BJOA 1TTYA 4PZJA 3E3VA 5F6FA 2ZO4A 3FMRA 4CICA 4FX0A 4N9HA 4RGRA 5D4RA 3E5QA 2M45A 5DYMA 2PLYA 2FBKA 5LRSA 4KN7X 2Y48A 5HS8A 5EEHA 4QLCU 2MLKA 1IRGA 2H6BA 1HW5A 1D5VA 3HTSB 3DEUA 3FMQA 3PFIA 4A6EA 1YO5C 3EETA 3J7AO 3P9CA 4LLGF 2PJPA 1C0WA 1U8RA 2PI0A 4QWQA 2XGXA 2X4HA 3H3ZA 3TO9A 3GF2A 2ZNZA 3S2WA 3T8TA 2FBIA 4WXHA 5CVRA 3FXRA 1Z7UA 3U9GA 4ZYDA 3HHHA 3CUQC 2HYGD 3LAPA 1QZYA 2XKPA 3KP3A 4EM1A 2MH2A 5CVJA 3E6DA 4FX4A 2DAOA 1SMYF 1ZLJA 5E1ZB 3GFMA 3EYYA 1BI3A 1R1VA 2K27A 3CUQB 1SFUA 3WGGA 1OR7A 2ZJ2A 2VOOA 1PUEE 2HKOA 4RGUA 1FBSA 1T6SA 5LRRA 3WG9A 5LEJA 3L2CA 4EMSA 1BIAA 1U2WA 5F1RA 2L01A 5E8IA 4RB1A 3WGIA 4R1HA 2CG4A 2B0LA 4OU0A 1YS7A 4WXDA 4A2UA 1SD5A 1ZYRF 4GYGA 4I0BA 1FPQA 1HQCA 2OQGA 3GWZA 1T2KA 4MHGA 2KIMA 3C18A 3FHZA 4GYIA 1J2XA 2FBHA 1RIOH 1J59A 3GZ6A 3BZ6A 4WK8F 1VTNC 3JAMK 4PGHA 4I98B 2GIVA 3GEZA 5D5XB 2XKOA 2E1CA 3QAHA 1BI0A 5HLHA 3C7JA 4FT8A 5E17F 1V4RA 3HRSA 2A69F 1JXSA 5K1YA 2OZUA 2Z99A 4HBLA 3HSEA 5BQTA 3GZ5A 3M7GA 2LSOA 2DQRA 3DP7A 5KVRA 4KMUX 5DUIA 5D6EA 2F5DA 1V3FA 4BNCA 1LJ9A 1R23A 2ZFWA 1O7FA 3WTVC 4KIBA 4P55A 1B9MA 1U78A 2P6SA 3ABTA 3F8FA 5ICEA 3U1DA 3FXQA 2P5LC 2G7UA 5CLSA 3RKYA 3KP6A 5LGUA 1U5TB 1TNSA 3QP6A 3WTXC 3K69A 1WQ2A 4G6DA 2DU9A 2VE9A 1SD4A 2V1XA 1G3YA 4OMZA 1F1ZA 5DDGA 2EA4A 3DXJF 4I7HA 1B1BA 3QP5A 3IHUA 4M72A 2ETHA 4IJAA 1YW7A 1JHHA 4LG0B 4IHTA 3FMSA 4RB3C 2A5YB 4L5JA 4AIJA 4Y13A 1DPRA 1FYLA 1JGSA 3E5UA 4HW0A 5D6FA 2WTEA 4LLLA 1XSVA 2XIGA 4ESBA 3R60A 4O6JA 2EK5A 3BOQA 1J75A 3ZPLA 5FFXA 3H3UA 4IRIA 2ACJA 2HKXA 2X0LA 3BDDA 4IXAA 4RB2C 1P6RA 5BOXA 1SFXA 3K0LA 4HOBA 2CO5A 1NHAA 2VOPA 2F5EA 1CF7A 2VBYA 4A12A 3WTZA 2RDPA 2QWWA 4ZYEA 3VEPA 2ISYA 4XLNF 3R61A 5LLQA 3HOSA 4HF2A 1O3QA 2MBFA 3C1DA 1RI7A 1MZBA 2O6GE 4KNYA 3EQLF 3R6SA 3F8NA 2NYXA 2LKPA 4D0PA 2D2WA 1K79A 1S3JA 2XHKA 4Z2YA 1E17A 4KDPA 3SXYA 1G6NA 1W4MA 3WTWC 1XDUA 5HLIA 1KYWA 4GO1A 1ZN2A 1A04A 4EJUA 2L4MA 4I0AA 2Z33A 1U5TA 1AWCA 2W24A 2W57A 4XBFA 2JRTA 1QPMA 2XAJA 3JSPA 2IA2A 4S05A 2GZWA 2P4WA 3KCCA 4KYWA 4LLNA 3FWEA 2QQBA 1LNWA 3JTGA 4U88A 2PFBA 3QPTA 5TJJA 4DNCA 2EJRA 3V4GA 1S7OA 1P4WA 2VC1A 5AONA 2XV4S 3CDHA 1P4XA 3G3ZA 3KFWX 2P7VB 2MLGA 2ESNA 1QNTA 3KLNA 2W84A 4UHTA 3I54A 5FLXZ 1ZG5A 3HSFA 2ZMEA 2RKHA 4HV6A 1WRJA 2OBPA 4RGXA 2LDUA 2QQ9A 2FF4A 3P9KA 3HTUA 2RQPA 2ZCWA 4ENJA 3BJAA 1YYVA 4IRGA 3E5XA 5H6RA 3ISPA 5L3FA 1FP1D 3BY6A 1OPCA 2BE5F 2E7XA 5E8GA 3DKWA 1R1TA 4RB0A 3CO6C 2ZKZA 1IXRC 5ICCA 3RDIA 1FOKA 5J8CA 5TRDA 2AXLA 2QYOA 4LB6B 3IC7A 5HVQC 1MJAA 3RIRA 3EDPA 5K5RA 2QVOA 2K02A 1TQMA 3TGNA 3MWMA 2G9WA 1YTYA 1LEAA 1JE8A 2VBWA 1HW2A 1R7JA 2VT3A 5LHHA 2G7HA 2L02A 5BPDA 3KEOA 5FLXK 1HSTA 1ZRCA 4ENKA 5ILVA 1MDMA 1FNNA 4HLXA 3ZMZA 1Z6TA 3CTAA 2DT5A 2QQAA 5D5VB 4GXOA 1KU9A 3BWGA 4BQAA 3JTHA 3WE2A 1HW1A 1R1UA 2H27A 3GX4X 1ZH5A 1W5SA 2FRHA 1IN8A 1UFMA 1YFHA 2CFXA 3IKTA 3K1PA 6PAXA 2XAFA 1ZARA 4Y15A 2YPRA 3Q9VA 1J0RA 5L3DA 5L3EA 2EFPA 3E97A 1YLFA 2ZMEB 3LQRA 3ULQB 2K7LA 3SZTA 5HS9A 3U2RA 1ZHFA 3WTUC 2XAHA 2Q2EA 1ZG3A 1SFEA 1GHCA 1USTA 3HUGA 3M8EA 1TNTA 2VXZA 3RKXA 5D5UB 1AOYA 1ZLKA 4EGYA 2IW5A 4F7ZA 4HDVA 4PCQA 1YW9A 3JAMZ 1LVAA 2KKOA 4NQWA 4O5VA 3Q9SA 5HLGA 1O3TA 4JQFA 4G7OF 4M9XA 3WTTC 2QUFA 5HOOA 3KP7A 4Q47A 2HFHA 1MJ9A 4U7BA 1Y0UA 4BHPA 4EJOA 4JK1X 1H0MA 2P7CB 3V7CA 1FX7A 3IKVA 1K7AA 1J7KA 4MEXF 2IP2A 2M8EA 3TOBA 3CUOA 5L3CA 2GXBA 1H9TA 1K78A 1S7AA 4G6QA 1ZRDA 2OAZA 5LHIA 3V8JA 1QQIA 5LBQA 2NAZA 4O3MA 2FMYA 2IA1A 3M9AA 5E1WA 3P7NA 4UVAA 2RN7A 4CHUA 5HDGA 2BGCA 1LDDA 4ESJA 3R4KA 1BBYA 1FSHA 4BH9A 2YX7A 3LAJA 2NS0A 3CJNA 1J9IA 4CDGA 1YIOA 4I01A 2HQRA 4HZFA 1BI2A 3D0SA 3I0TA 4UVBA 1L0OC 3CO7C 2FNAA 2DI3A 1SD6A 5D8KB 4GCVA 4KIFA 3BP8A 4HAMA 2VN2A 3DF8A 3PQJA 1IRFA 3K1MA 3T0YA 3ZMUA 4HQMA 4YFNF 2UXXA 4G7HF 4KIGA 3MEXA 2M1BA 3OV8A 2AS5F 2V1UA 4G9YA 1T98A 2OZ6A 5DUKA 2CGPA 1BC7C 1DUXC 3COAC 1IXSB 2FMLA 1TQIA 5CVUA 1H9GA 3V7RA 3HYIA 1BJAA 2D1VA 4RGSA 1RZ4A 1R00A 4CYDA 5BPIA 4B09A 3AAFA 2LF7A 1MD0A 3I71A 3Q5FA 1XGSA 3L7WA 1IF1A 1R36A 1ZREA 5AIPA 1Z91A 3JSOA 4LB5A 3GXOA 1Z1DA 1XCVA 4LFUA 3TO7A 2Y75A 4ENMA 5IT9Z 5A2QZ 3HRMA 3NQOA 3WU0A 1HKTA 4H0EA 2M87A 3DQVC 4LK1F 1FBUA 5E20A 1FY7A 2Q8KA 3TKYA 3GLXA 5ICFA 2STWA 1E2XA 5CYVA 1HKQA 4EVIA 3MAJA 4RAZA 3HSRA 1S6LA 3KP4A 2IVMA 3REOA 2GA1A 3GO5A 2GWRA 1D8JA 3RYPA 1KQ9A 3WGHA 4YFKF 1WSUA 1T38A 2DBBA 5FD5A 1KU7A 4XSZF 2H6CA 1SAXA 4KT5C 5DCFA 3QU6A 1GXPA 3TO6A 1FYMA 3J81K 1BIBA 1ULYA 5E18F 2H94A 1P92A 3RJPA 1DPUA 3W6JB 5IT9K 2FNPA 3ZN0A 1R5GA 5LGNA 2A6HF 4XRFA 1R5HA 3L9FA 1UHMA 2RV8A 4WF2A 2M5WA 2VBZA 4ZZLA 1DDNA 1XDSA 2NNYA 4Y17A 2OD5A 2GXGA 2V1DA 5H6QA 4ON0A 2YX4A 2PQ8A 3ECHA 2IT0A 1IW7F 4Q5SF 3V7SA 4M9SA 3I59A 3T1BA 4HX4A 2O3FA 2RGVA 2MC3A 2DW4A 2E7WA 1KQ0A 1FWZA 4OIPF 5JR3A 4L5IA 3B02A 4L9VA 3NEUA 4WWCA 5F64A 3IRRA 4UVCA 2DPUA 1ZGJA 2EWNA 1FP2A 2O8XA 3TQNA 4ENNA 4M9ZA 3K1NA 1ON1A 3TDUC 4HA8A 3RYRA 1O57A 1TLHB 5KK1A 1B6AA 4KA4A 2PBIA 2A3SA 4IHSA 3DPTA 1HSJA 2K4JA 4CGZA 2R7DA 2CW0F 1WI9A 5ILSA 2F5FA 4PDKA 2HOEA 2IA0A 1G3WA 3HRTA 1I1GA 4AVPA 3ZMTA 1I5ZA 2D45A 4U7DA 1ZRFA 4BAYA 1YW8A 2DK5A 4G7ZF 4P5OA 5CVIA 4A0ZA 3LA7A 5DEQA 5LHGA 3ELKA 3DPLC 4L0ZB 2COMA 3F8BA 3JW4A 1R58A 4LK0F 1W7PD 3J81Z 4EQQA 2IPQX 2BEOA 1XSXA 1RNLA 4RAYA 5LEKA 1ONVA 2EV5A 4HF1A 2EFNA 3RPUA 4ZYHA 1OKRA 1DP7P 2QM3A 3DV8A 1ZG1A 3I64A 3WU1B 1I6XA 4LD5A 5ICGA 2A6EF 3ZMVA 4EJVA 2TDXA 1HXDA 3SFZA 3D5LA 3KZZA 2JSCA 4UUVA 4BHCA 2F5CA 3M8FA 2HWVA 4MGRA 4A6DA 3F8CA 2YSRA 4S04A 2HDCA 3DFGA 1IN4A 3BJ6A 4UV8A 4ZZDA 3GFJA 3N97A 1U3EM 5K5QA 3ECOA 3CLOA 3FX3A 3J80Z 2O03A 2RNJA 3GYHX 3ML6A 2XAGA 1TQPA 3F6VA 3EYIA 3LA2A 3FM3A 2ESHA 4YIIA 5FFZA 3KP5A 3QPHA 4MEYF 2JTVA 3W6KB 4EGZA 2UWMA 1STZA 3CUQA 1EH7A 2HTSA 2CSOA 4BHBA 1MDMB 1ZAOA 2UZKA 4GGGA 2PMUA 1KA8A 1IN7A 4IRHA 1FSEA 1LEBA 5FD6A 2STTA 1W7PB 4LJZF 2MH9A 4HV5A 3IL2A 4JBAA 1ON2A 3BROA 4ASNA 3E6MA 2BV6A 2XUBA 4EM0B 4EM2A 2HR3A 1IZ1A 3KP2A 3MZYA 2P6TA 2YR2A 2LF8A 3NRVA 1REPC 4UXNA 2GA2A 2RVCA 2VE8A 3GW2A 3F8MA 2CWEA 1OYIA 1QZZA 3HHGA 5AIQA 4KICA 4G94A 1S8NA 4ZH4F 5CJ9A 4CO8A 1Z05A 1PDNC 3IWFA 2ZXJA 4NB5A 2O0YA 3F3XA 1HKSA 1GVJA 2W25A 2CQKA 5DCMA 3OOPA 1P2FA 3TOAA 1WWXA 2KRFA 3RTRA 2JPCA 1PP7U 4YG2F 4XSXF 2C6YA 3KETA 2ZNYA 1K6OA 3FXUA 4WCGA 3GFLA 3ABUA 2J5PA 3HRUA 3N4MA 5HDNA 2FXAA 1JHFA 4I02A 4Q48A 5BMZA 1FT9A 1TW2A 3P9IA 3ZN1A 1MKMA 2Z9OA 4G8XA 2NNNA 4M6YA 1ZGAA 4I2OA 2VBXA 1USSA 2KIFA 3I5UA 1F4KA 1IAWA 1TW3A 4M73A 4IPAA 2XROA 2HYFA 4P96A 3IRQA 5L3GA 4OMYA 2Q0OA 2VODA 1BC8C 1D3YA 3VB2A 3EUHA 1XD7A 3IWZA 4B8XA 2D1HA 3QOPA 1QO0D 3GFIA 4UNOA 4IF4A 3T5XA 1RUOA 4AWXB 1P4AA 3VODA 3GUDA 3QRFF 1K78B 5DD4A 1FC3A 3E6CC 2V9VA 4EJTA 1IXCA 2E1NA 1CGPA 1J5YA 2ISZA 2EV6A 2P5VA 2J5OA 2EA2A 3WTYC 4R79A 2GAUA 4LG0A 4HLYA 2K4BA 5DV5A 5JFRA 1U5TC 2BBYA 1KU2A 3E6BA 2ZBKA 4M74A 2H09A 3O2PE 4P9UA 2ADUA 1KU3A 5EEGA 3WODF 1X3UA 2DPDA 3ZMSA 1OYWA 4AIHA 4L0YB 4KFCA 3VFZA 4TV7A 4L9TA 2F2EA 3I58A 2RC4A 2FSWA 2UXNA 4HX7A 1F9NA 2NRAC 1LDKB 2VT2A 5J8FA 3I59B 1EV7A 4HQEA 2FOKA 2OU2A 4CZZA 1KGSA 3FZVA 1XGNA 2EFWA 4MQ9F 4MTDA 2V6CA 1XGMA 2HQNA 1O7LA 2L4AA 2R7FA 1BN5A 3LA3A 1QBJA 3MCZA 1GXQA 2QENA 1G3SA 4L9NA 1I27A 1MJBA 2JPBA 4LMYA 4WX9A 1LQ1A 1RUNA 3F22A 2DFIA 3TDZC 1G3TA 1ODDA 3SHFA 4L18B 3LQQA 1SMTA 4DQ2A 4OOIA 4UV9A 5BS6A 3H92A 1G4DA 2OA4A 4YFXF 4KUMA 4HDUA 1W5TA 3HIFA 2L54A 1SD7A 2XRNA 1KQ8A 4A5NA 4U0WA 3RPQA 4WXCA 4MQVA 4U0VA 4N0BA 1QGPA 2JZYA 1W7PA 5JVTA 3F23A 2K86A 3L00A 5DCMB 2A61A 2EB7A 3O6BB 4KN4X 2HEOA 1I1SA 3ROUA 2PEXA 1LDJA 3FM5A 4A0XA 5FGMA 2KJBA 5LGTA 4L9JA 2P8TA 5ILUA 1UB9A 2FQ3A 2Y0MA 3I53A 2OQRA 1R22A 3F6OA 5L3BA 5E1XA 1OYYA 3ERED 4YIFA 1EH6A 2IJLA 2VONA 2PG4A 5ED4A 1S29A 3C3WA 4I09A 2FA5A 2DLLA 2WWYA 4MTEA 4P9FA 2LNBA 3ZQ7A 1XSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ F;  4XLP F;  4BYY A;  2XAQ A;  5JI6 A;  4EJW A;  3J80 K;  2P5K A;  4R8H A;  5HDK A;  1MGT A;  2W85 A;  4AIK A;  2O61 A;  3R0J A;  2V79 A;  2QBY A;  3L09 A;  4RS8 A;  1U6G A;  1XMK A;  1O3S A;  4CXF A;  2HGC A;  4Q4Z F;  4NHJ A;  5ERI A;  1OMI A;  3R0A A;  5IT3 A;  2QBY B;  3MFK A;  2M30 A;  1IN5 A;  4HYE A;  4KMF A;  2JT1 A;  5H20 A;  2MD5 A;  5FO5 A;  4ETS A;  2DO7 A;  3K9T A;  2FE3 A;  5K5O A;  3T8R A;  1B9N A;  4M71 A;  1WKM A;  3ZMD A;  4M6X A;  4PGG A;  2FU4 A;  3V8L A;  5CVV A;  4ZYG A;  2KIU A;  1XGO A;  5J6X A;  1FYK A;  3K2Z A;  4IVN A;  2A07 F;  1T0F A;  5FB2 A;  3KZY A;  3F72 A;  2PN6 A;  4A0Y A;  1Z9C A;  2HTJ A;  3O3K A;  4MNU A;  2EV0 A;  2PMH A;  1YQA A;  4EV0 A;  4OIO F;  3WE3 A;  3GVA A;  4K2E A;  3SQN A;  2VC0 A;  3ZP5 A;  5D5W B;  2WC2 A;  2CYY A;  2YU3 A;  4BXU A;  4N9I A;  3SZP A;  2MA3 A;  4FHT A;  2Z5U A;  1FBQ A;  2HZT A;  3I4P A;  2FEZ A;  5D8L B;  3LST A;  2DK8 A;  3M1E A;  1BI1 A;  3VOE A;  3WTS C;  3LFK A;  2QLZ A;  2A68 F;  1CF7 B;  4U0Y A;  1EH8 A;  2XAS A;  4LGW A;  2WV0 A;  1FZP B;  4A5M A;  3RKW A;  4OIR F;  1B4A A;  2L3D A;  4E70 A;  2IRF G;  1D8K A;  1XMA A;  2DTR A;  3PQK A;  4HF0 A;  3KEQ A;  5JHU A;  5HS7 A;  1PP8 F;  4AD9 A;  1F5T A;  3BPV A;  2EFO A;  3HOT A;  2Z3Y A;  3B73 A;  3BPX A;  1XN7 A;  1Q1H A;  2EFQ A;  1IUY A;  1XB4 A;  1FLI A;  1BM9 A;  1Z6R A;  3RI4 A;  1TBX A;  1T39 A;  1BOA A;  5D4S A;  4HX8 A;  3MQ0 A;  2BYV E;  1YG2 A;  1UCR A;  1XCB A;  2HS5 A;  3QU3 A;  3KLO A;  2ELH A;  2DQL A;  3FF5 A;  4ESF A;  2QZ8 A;  4OIN F;  2KJC A;  3V8K A;  2R3S A;  1HBX G;  1O3R A;  2XVC A;  3G73 A;  3MZH A;  3F21 A;  1LB2 A;  5DD8 A;  3KE2 A;  1IN6 A;  1YS6 A;  1B59 A;  2GQQ A;  1L3L A;  3LWF A;  1KYZ A;  5A2Q K;  1UHW A;  3BJO A;  1TTY A;  4PZJ A;  3E3V A;  5F6F A;  2ZO4 A;  3FMR A;  4CIC A;  4FX0 A;  4N9H A;  4RGR A;  5D4R A;  3E5Q A;  2M45 A;  5DYM A;  2PLY A;  2FBK A;  5LRS A;  4KN7 X;  2Y48 A;  5HS8 A;  5EEH A;  4QLC U;  2MLK A;  1IRG A;  2H6B A;  1HW5 A;  1D5V A;  3HTS B;  3DEU A;  3FMQ A;  3PFI A;  4A6E A;  1YO5 C;  3EET A;  3J7A O;  3P9C A;  4LLG F;  2PJP A;  1C0W A;  1U8R A;  2PI0 A;  4QWQ A;  2XGX A;  2X4H A;  3H3Z A;  3TO9 A;  3GF2 A;  2ZNZ A;  3S2W A;  3T8T A;  2FBI A;  4WXH A;  5CVR A;  3FXR A;  1Z7U A;  3U9G A;  4ZYD A;  3HHH A;  3CUQ C;  2HYG D;  3LAP A;  1QZY A;  2XKP A;  3KP3 A;  4EM1 A;  2MH2 A;  5CVJ A;  3E6D A;  4FX4 A;  2DAO A;  1SMY F;  1ZLJ A;  5E1Z B;  3GFM A;  3EYY A;  1BI3 A;  1R1V A;  2K27 A;  3CUQ B;  1SFU A;  3WGG A;  1OR7 A;  2ZJ2 A;  2VOO A;  1PUE E;  2HKO A;  4RGU A;  1FBS A;  1T6S A;  5LRR A;  3WG9 A;  5LEJ A;  3L2C A;  4EMS A;  1BIA A;  1U2W A;  5F1R A;  2L01 A;  5E8I A;  4RB1 A;  3WGI A;  4R1H A;  2CG4 A;  2B0L A;  4OU0 A;  1YS7 A;  4WXD A;  4A2U A;  1SD5 A;  1ZYR F;  4GYG A;  4I0B A;  1FPQ A;  1HQC A;  2OQG A;  3GWZ A;  1T2K A;  4MHG A;  2KIM A;  3C18 A;  3FHZ A;  4GYI A;  1J2X A;  2FBH A;  1RIO H;  1J59 A;  3GZ6 A;  3BZ6 A;  4WK8 F;  1VTN C;  3JAM K;  4PGH A;  4I98 B;  2GIV A;  3GEZ A;  5D5X B;  2XKO A;  2E1C A;  3QAH A;  1BI0 A;  5HLH A;  3C7J A;  4FT8 A;  5E17 F;  1V4R A;  3HRS A;  2A69 F;  1JXS A;  5K1Y A;  2OZU A;  2Z99 A;  4HBL A;  3HSE A;  5BQT A;  3GZ5 A;  3M7G A;  2LSO A;  2DQR A;  3DP7 A;  5KVR A;  4KMU X;  5DUI A;  5D6E A;  2F5D A;  1V3F A;  4BNC A;  1LJ9 A;  1R23 A;  2ZFW A;  1O7F A;  3WTV C;  4KIB A;  4P55 A;  1B9M A;  1U78 A;  2P6S A;  3ABT A;  3F8F A;  5ICE A;  3U1D A;  3FXQ A;  2P5L C;  2G7U A;  5CLS A;  3RKY A;  3KP6 A;  5LGU A;  1U5T B;  1TNS A;  3QP6 A;  3WTX C;  3K69 A;  1WQ2 A;  4G6D A;  2DU9 A;  2VE9 A;  1SD4 A;  2V1X A;  1G3Y A;  4OMZ A;  1F1Z A;  5DDG A;  2EA4 A;  3DXJ F;  4I7H A;  1B1B A;  3QP5 A;  3IHU A;  4M72 A;  2ETH A;  4IJA A;  1YW7 A;  1JHH A;  4LG0 B;  4IHT A;  3FMS A;  4RB3 C;  2A5Y B;  4L5J A;  4AIJ A;  4Y13 A;  1DPR A;  1FYL A;  1JGS A;  3E5U A;  4HW0 A;  5D6F A;  2WTE A;  4LLL A;  1XSV A;  2XIG A;  4ESB A;  3R60 A;  4O6J A;  2EK5 A;  3BOQ A;  1J75 A;  3ZPL A;  5FFX A;  3H3U A;  4IRI A;  2ACJ A;  2HKX A;  2X0L A;  3BDD A;  4IXA A;  4RB2 C;  1P6R A;  5BOX A;  1SFX A;  3K0L A;  4HOB A;  2CO5 A;  1NHA A;  2VOP A;  2F5E A;  1CF7 A;  2VBY A;  4A12 A;  3WTZ A;  2RDP A;  2QWW A;  4ZYE A;  3VEP A;  2ISY A;  4XLN F;  3R61 A;  5LLQ A;  3HOS A;  4HF2 A;  1O3Q A;  2MBF A;  3C1D A;  1RI7 A;  1MZB A;  2O6G E;  4KNY A;  3EQL F;  3R6S A;  3F8N A;  2NYX A;  2LKP A;  4D0P A;  2D2W A;  1K79 A;  1S3J A;  2XHK A;  4Z2Y A;  1E17 A;  4KDP A;  3SXY A;  1G6N A;  1W4M A;  3WTW C;  1XDU A;  5HLI A;  1KYW A;  4GO1 A;  1ZN2 A;  1A04 A;  4EJU A;  2L4M A;  4I0A A;  2Z33 A;  1U5T A;  1AWC A;  2W24 A;  2W57 A;  4XBF A;  2JRT A;  1QPM A;  2XAJ A;  3JSP A;  2IA2 A;  4S05 A;  2GZW A;  2P4W A;  3KCC A;  4KYW A;  4LLN A;  3FWE A;  2QQB A;  1LNW A;  3JTG A;  4U88 A;  2PFB A;  3QPT A;  5TJJ A;  4DNC A;  2EJR A;  3V4G A;  1S7O A;  1P4W A;  2VC1 A;  5AON A;  2XV4 S;  3CDH A;  1P4X A;  3G3Z A;  3KFW X;  2P7V B;  2MLG A;  2ESN A;  1QNT A;  3KLN A;  2W84 A;  4UHT A;  3I54 A;  5FLX Z;  1ZG5 A;  3HSF A;  2ZME A;  2RKH A;  4HV6 A;  1WRJ A;  2OBP A;  4RGX A;  2LDU A;  2QQ9 A;  2FF4 A;  3P9K A;  3HTU A;  2RQP A;  2ZCW A;  4ENJ A;  3BJA A;  1YYV A;  4IRG A;  3E5X A;  5H6R A;  3ISP A;  5L3F A;  1FP1 D;  3BY6 A;  1OPC A;  2BE5 F;  2E7X A;  5E8G A;  3DKW A;  1R1T A;  4RB0 A;  3CO6 C;  2ZKZ A;  1IXR C;  5ICC A;  3RDI A;  1FOK A;  5J8C A;  5TRD A;  2AXL A;  2QYO A;  4LB6 B;  3IC7 A;  5HVQ C;  1MJA A;  3RIR A;  3EDP A;  5K5R A;  2QVO A;  2K02 A;  1TQM A;  3TGN A;  3MWM A;  2G9W A;  1YTY A;  1LEA A;  1JE8 A;  2VBW A;  1HW2 A;  1R7J A;  2VT3 A;  5LHH A;  2G7H A;  2L02 A;  5BPD A;  3KEO A;  5FLX K;  1HST A;  1ZRC A;  4ENK A;  5ILV A;  1MDM A;  1FNN A;  4HLX A;  3ZMZ A;  1Z6T A;  3CTA A;  2DT5 A;  2QQA A;  5D5V B;  4GXO A;  1KU9 A;  3BWG A;  4BQA A;  3JTH A;  3WE2 A;  1HW1 A;  1R1U A;  2H27 A;  3GX4 X;  1ZH5 A;  1W5S A;  2FRH A;  1IN8 A;  1UFM A;  1YFH A;  2CFX A;  3IKT A;  3K1P A;  6PAX A;  2XAF A;  1ZAR A;  4Y15 A;  2YPR A;  3Q9V A;  1J0R A;  5L3D A;  5L3E A;  2EFP A;  3E97 A;  1YLF A;  2ZME B;  3LQR A;  3ULQ B;  2K7L A;  3SZT A;  5HS9 A;  3U2R A;  1ZHF A;  3WTU C;  2XAH A;  2Q2E A;  1ZG3 A;  1SFE A;  1GHC A;  1UST A;  3HUG A;  3M8E A;  1TNT A;  2VXZ A;  3RKX A;  5D5U B;  1AOY A;  1ZLK A;  4EGY A;  2IW5 A;  4F7Z A;  4HDV A;  4PCQ A;  1YW9 A;  3JAM Z;  1LVA A;  2KKO A;  4NQW A;  4O5V A;  3Q9S A;  5HLG A;  1O3T A;  4JQF A;  4G7O F;  4M9X A;  3WTT C;  2QUF A;  5HOO A;  3KP7 A;  4Q47 A;  2HFH A;  1MJ9 A;  4U7B A;  1Y0U A;  4BHP A;  4EJO A;  4JK1 X;  1H0M A;  2P7C B;  3V7C A;  1FX7 A;  3IKV A;  1K7A A;  1J7K A;  4MEX F;  2IP2 A;  2M8E A;  3TOB A;  3CUO A;  5L3C A;  2GXB A;  1H9T A;  1K78 A;  1S7A A;  4G6Q A;  1ZRD A;  2OAZ A;  5LHI A;  3V8J A;  1QQI A;  5LBQ A;  2NAZ A;  4O3M A;  2FMY A;  2IA1 A;  3M9A A;  5E1W A;  3P7N A;  4UVA A;  2RN7 A;  4CHU A;  5HDG A;  2BGC A;  1LDD A;  4ESJ A;  3R4K A;  1BBY A;  1FSH A;  4BH9 A;  2YX7 A;  3LAJ A;  2NS0 A;  3CJN A;  1J9I A;  4CDG A;  1YIO A;  4I01 A;  2HQR A;  4HZF A;  1BI2 A;  3D0S A;  3I0T A;  4UVB A;  1L0O C;  3CO7 C;  2FNA A;  2DI3 A;  1SD6 A;  5D8K B;  4GCV A;  4KIF A;  3BP8 A;  4HAM A;  2VN2 A;  3DF8 A;  3PQJ A;  1IRF A;  3K1M A;  3T0Y A;  3ZMU A;  4HQM A;  4YFN F;  2UXX A;  4G7H F;  4KIG A;  3MEX A;  2M1B A;  3OV8 A;  2AS5 F;  2V1U A;  4G9Y A;  1T98 A;  2OZ6 A;  5DUK A;  2CGP A;  1BC7 C;  1DUX C;  3COA C;  1IXS B;  2FML A;  1TQI A;  5CVU A;  1H9G A;  3V7R A;  3HYI A;  1BJA A;  2D1V A;  4RGS A;  1RZ4 A;  1R00 A;  4CYD A;  5BPI A;  4B09 A;  3AAF A;  2LF7 A;  1MD0 A;  3I71 A;  3Q5F A;  1XGS A;  3L7W A;  1IF1 A;  1R36 A;  1ZRE A;  5AIP A;  1Z91 A;  3JSO A;  4LB5 A;  3GXO A;  1Z1D A;  1XCV A;  4LFU A;  3TO7 A;  2Y75 A;  4ENM A;  5IT9 Z;  5A2Q Z;  3HRM A;  3NQO A;  3WU0 A;  1HKT A;  4H0E A;  2M87 A;  3DQV C;  4LK1 F;  1FBU A;  5E20 A;  1FY7 A;  2Q8K A;  3TKY A;  3GLX A;  5ICF A;  2STW A;  1E2X A;  5CYV A;  1HKQ A;  4EVI A;  3MAJ A;  4RAZ A;  3HSR A;  1S6L A;  3KP4 A;  2IVM A;  3REO A;  2GA1 A;  3GO5 A;  2GWR A;  1D8J A;  3RYP A;  1KQ9 A;  3WGH A;  4YFK F;  1WSU A;  1T38 A;  2DBB A;  5FD5 A;  1KU7 A;  4XSZ F;  2H6C A;  1SAX A;  4KT5 C;  5DCF A;  3QU6 A;  1GXP A;  3TO6 A;  1FYM A;  3J81 K;  1BIB A;  1ULY A;  5E18 F;  2H94 A;  1P92 A;  3RJP A;  1DPU A;  3W6J B;  5IT9 K;  2FNP A;  3ZN0 A;  1R5G A;  5LGN A;  2A6H F;  4XRF A;  1R5H A;  3L9F A;  1UHM A;  2RV8 A;  4WF2 A;  2M5W A;  2VBZ A;  4ZZL A;  1DDN A;  1XDS A;  2NNY A;  4Y17 A;  2OD5 A;  2GXG A;  2V1D A;  5H6Q A;  4ON0 A;  2YX4 A;  2PQ8 A;  3ECH A;  2IT0 A;  1IW7 F;  4Q5S F;  3V7S A;  4M9S A;  3I59 A;  3T1B A;  4HX4 A;  2O3F A;  2RGV A;  2MC3 A;  2DW4 A;  2E7W A;  1KQ0 A;  1FWZ A;  4OIP F;  5JR3 A;  4L5I A;  3B02 A;  4L9V A;  3NEU A;  4WWC A;  5F64 A;  3IRR A;  4UVC A;  2DPU A;  1ZGJ A;  2EWN A;  1FP2 A;  2O8X A;  3TQN A;  4ENN A;  4M9Z A;  3K1N A;  1ON1 A;  3TDU C;  4HA8 A;  3RYR A;  1O57 A;  1TLH B;  5KK1 A;  1B6A A;  4KA4 A;  2PBI A;  2A3S A;  4IHS A;  3DPT A;  1HSJ A;  2K4J A;  4CGZ A;  2R7D A;  2CW0 F;  1WI9 A;  5ILS A;  2F5F A;  4PDK A;  2HOE A;  2IA0 A;  1G3W A;  3HRT A;  1I1G A;  4AVP A;  3ZMT A;  1I5Z A;  2D45 A;  4U7D A;  1ZRF A;  4BAY A;  1YW8 A;  2DK5 A;  4G7Z F;  4P5O A;  5CVI A;  4A0Z A;  3LA7 A;  5DEQ A;  5LHG A;  3ELK A;  3DPL C;  4L0Z B;  2COM A;  3F8B A;  3JW4 A;  1R58 A;  4LK0 F;  1W7P D;  3J81 Z;  4EQQ A;  2IPQ X;  2BEO A;  1XSX A;  1RNL A;  4RAY A;  5LEK A;  1ONV A;  2EV5 A;  4HF1 A;  2EFN A;  3RPU A;  4ZYH A;  1OKR A;  1DP7 P;  2QM3 A;  3DV8 A;  1ZG1 A;  3I64 A;  3WU1 B;  1I6X A;  4LD5 A;  5ICG A;  2A6E F;  3ZMV A;  4EJV A;  2TDX A;  1HXD A;  3SFZ A;  3D5L A;  3KZZ A;  2JSC A;  4UUV A;  4BHC A;  2F5C A;  3M8F A;  2HWV A;  4MGR A;  4A6D A;  3F8C A;  2YSR A;  4S04 A;  2HDC A;  3DFG A;  1IN4 A;  3BJ6 A;  4UV8 A;  4ZZD A;  3GFJ A;  3N97 A;  1U3E M;  5K5Q A;  3ECO A;  3CLO A;  3FX3 A;  3J80 Z;  2O03 A;  2RNJ A;  3GYH X;  3ML6 A;  2XAG A;  1TQP A;  3F6V A;  3EYI A;  3LA2 A;  3FM3 A;  2ESH A;  4YII A;  5FFZ A;  3KP5 A;  3QPH A;  4MEY F;  2JTV A;  3W6K B;  4EGZ A;  2UWM A;  1STZ A;  3CUQ A;  1EH7 A;  2HTS A;  2CSO A;  4BHB A;  1MDM B;  1ZAO A;  2UZK A;  4GGG A;  2PMU A;  1KA8 A;  1IN7 A;  4IRH A;  1FSE A;  1LEB A;  5FD6 A;  2STT A;  1W7P B;  4LJZ F;  2MH9 A;  4HV5 A;  3IL2 A;  4JBA A;  1ON2 A;  3BRO A;  4ASN A;  3E6M A;  2BV6 A;  2XUB A;  4EM0 B;  4EM2 A;  2HR3 A;  1IZ1 A;  3KP2 A;  3MZY A;  2P6T A;  2YR2 A;  2LF8 A;  3NRV A;  1REP C;  4UXN A;  2GA2 A;  2RVC A;  2VE8 A;  3GW2 A;  3F8M A;  2CWE A;  1OYI A;  1QZZ A;  3HHG A;  5AIQ A;  4KIC A;  4G94 A;  1S8N A;  4ZH4 F;  5CJ9 A;  4CO8 A;  1Z05 A;  1PDN C;  3IWF A;  2ZXJ A;  4NB5 A;  2O0Y A;  3F3X A;  1HKS A;  1GVJ A;  2W25 A;  2CQK A;  5DCM A;  3OOP A;  1P2F A;  3TOA A;  1WWX A;  2KRF A;  3RTR A;  2JPC A;  1PP7 U;  4YG2 F;  4XSX F;  2C6Y A;  3KET A;  2ZNY A;  1K6O A;  3FXU A;  4WCG A;  3GFL A;  3ABU A;  2J5P A;  3HRU A;  3N4M A;  5HDN A;  2FXA A;  1JHF A;  4I02 A;  4Q48 A;  5BMZ A;  1FT9 A;  1TW2 A;  3P9I A;  3ZN1 A;  1MKM A;  2Z9O A;  4G8X A;  2NNN A;  4M6Y A;  1ZGA A;  4I2O A;  2VBX A;  1USS A;  2KIF A;  3I5U A;  1F4K A;  1IAW A;  1TW3 A;  4M73 A;  4IPA A;  2XRO A;  2HYF A;  4P96 A;  3IRQ A;  5L3G A;  4OMY A;  2Q0O A;  2VOD A;  1BC8 C;  1D3Y A;  3VB2 A;  3EUH A;  1XD7 A;  3IWZ A;  4B8X A;  2D1H A;  3QOP A;  1QO0 D;  3GFI A;  4UNO A;  4IF4 A;  3T5X A;  1RUO A;  4AWX B;  1P4A A;  3VOD A;  3GUD A;  3QRF F;  1K78 B;  5DD4 A;  1FC3 A;  3E6C C;  2V9V A;  4EJT A;  1IXC A;  2E1N A;  1CGP A;  1J5Y A;  2ISZ A;  2EV6 A;  2P5V A;  2J5O A;  2EA2 A;  3WTY C;  4R79 A;  2GAU A;  4LG0 A;  4HLY A;  2K4B A;  5DV5 A;  5JFR A;  1U5T C;  2BBY A;  1KU2 A;  3E6B A;  2ZBK A;  4M74 A;  2H09 A;  3O2P E;  4P9U A;  2ADU A;  1KU3 A;  5EEG A;  3WOD F;  1X3U A;  2DPD A;  3ZMS A;  1OYW A;  4AIH A;  4L0Y B;  4KFC A;  3VFZ A;  4TV7 A;  4L9T A;  2F2E A;  3I58 A;  2RC4 A;  2FSW A;  2UXN A;  4HX7 A;  1F9N A;  2NRA C;  1LDK B;  2VT2 A;  5J8F A;  3I59 B;  1EV7 A;  4HQE A;  2FOK A;  2OU2 A;  4CZZ A;  1KGS A;  3FZV A;  1XGN A;  2EFW A;  4MQ9 F;  4MTD A;  2V6C A;  1XGM A;  2HQN A;  1O7L A;  2L4A A;  2R7F A;  1BN5 A;  3LA3 A;  1QBJ A;  3MCZ A;  1GXQ A;  2QEN A;  1G3S A;  4L9N A;  1I27 A;  1MJB A;  2JPB A;  4LMY A;  4WX9 A;  1LQ1 A;  1RUN A;  3F22 A;  2DFI A;  3TDZ C;  1G3T A;  1ODD A;  3SHF A;  4L18 B;  3LQQ A;  1SMT A;  4DQ2 A;  4OOI A;  4UV9 A;  5BS6 A;  3H92 A;  1G4D A;  2OA4 A;  4YFX F;  4KUM A;  4HDU A;  1W5T A;  3HIF A;  2L54 A;  1SD7 A;  2XRN A;  1KQ8 A;  4A5N A;  4U0W A;  3RPQ A;  4WXC A;  4MQV A;  4U0V A;  4N0B A;  1QGP A;  2JZY A;  1W7P A;  5JVT A;  3F23 A;  2K86 A;  3L00 A;  5DCM B;  2A61 A;  2EB7 A;  3O6B B;  4KN4 X;  2HEO A;  1I1S A;  3ROU A;  2PEX A;  1LDJ A;  3FM5 A;  4A0X A;  5FGM A;  2KJB A;  5LGT A;  4L9J A;  2P8T A;  5ILU A;  1UB9 A;  2FQ3 A;  2Y0M A;  3I53 A;  2OQR A;  1R22 A;  3F6O A;  5L3B A;  5E1X A;  1OYY A;  3ERE D;  4YIF A;  1EH6 A;  2IJL A;  2VON A;  2PG4 A;  5ED4 A;  1S29 A;  3C3W A;  4I09 A;  2FA5 A;  2DLL A;  2WWY A;  4MTE A;  4P9F A;  2LNB A;  3ZQ7 A;  1XSD A; 
#chains in the Genus database with same CATH topology
 4OIQ F;  2QSF X;  2OUM A;  4XLP F;  3HKZ N;  2BY1 A;  2ZFU A;  4BYY A;  2XAQ A;  2XPU A;  1X1A A;  3KEY A;  5JI6 A;  4EJW A;  3J80 K;  3OYE A;  2P5K A;  4R8H A;  1ZEL A;  1R5I D;  5HDK A;  1MGT A;  2W85 A;  4AIK A;  2O61 A;  3R0J A;  1ETW A;  2V79 A;  2QBY A;  2DA4 A;  3L09 A;  4RS8 A;  2VLA A;  1U6G A;  1XMK A;  1O3S A;  2LOO A;  2EZK A;  4CXF A;  2LLK A;  2HGC A;  4Q4Z F;  4NHJ A;  1LE8 B;  1JKP C;  2PX9 A;  5ERI A;  1OMI A;  3R0A A;  4H4K C;  5IT3 A;  2DMQ A;  3LFU A;  1WH5 A;  1G8X A;  2QBY B;  3MFK A;  2M30 A;  1IN5 A;  3DEW A;  1RC9 A;  4HYE A;  2VB6 A;  4KMF A;  3LSG A;  1WJ5 A;  2JT1 A;  5H20 A;  2EIL H;  2JN6 A;  2FD5 A;  4I76 A;  2MD5 A;  1YE9 A;  3DU5 A;  4IEJ A;  4AM3 A;  5FO5 A;  4RAF A;  2BXZ A;  4ETS A;  2DFE A;  2DO7 A;  2HXO A;  3K9T A;  3QPS A;  1N78 A;  2FE3 A;  5K5O A;  3T8R A;  2QEX I;  4I6Z A;  1B9N A;  3CMM A;  1K6Y A;  2TRT A;  4M71 A;  2JSP A;  4BXX J;  5B3S H;  1WKM A;  2R7W A;  3ZMD A;  4M6X A;  4PGG A;  2FU4 A;  3H35 A;  2R7T A;  2W7N A;  2HXI A;  3V8L A;  4IHW A;  5CVV A;  4ZYG A;  2KIU A;  1XGO A;  5J6X A;  5H2F C;  1FYK A;  3K2Z A;  4IVN A;  1YRN B;  3W2A A;  3GTP J;  2A07 F;  2GLO A;  1LFP A;  1T0F A;  5FB2 A;  3KZY A;  2X1E A;  2PN6 A;  3F72 A;  5F27 A;  5EG0 A;  2HPM A;  3G1M A;  4A0Y A;  1Z9C A;  5IP9 J;  2HTJ A;  1YIJ I;  3O3K A;  4MNU A;  2EV0 A;  2LY2 A;  1YQA A;  2PMH A;  2LBF B;  4EV0 A;  4OIO F;  1HC8 A;  2W82 A;  3WE3 A;  3GVA A;  4Z6Y A;  1ZQ3 P;  3DTK A;  4K2E A;  3SQN A;  2DT7 B;  2ZME C;  4XON A;  2VC0 A;  3K10 A;  1LUJ B;  4QTR A;  3ZP5 A;  2HVR A;  5D5W B;  2WC2 A;  3BCB A;  2CYY A;  2YU3 A;  4E7L A;  4FTH A;  4BXU A;  1WH7 A;  4ZDL A;  2BOL A;  2O5R A;  1VF9 A;  2OCE A;  4N9I A;  3SZP A;  5E3O A;  4A3F J;  2MA3 A;  4FHT A;  2Z5U A;  1FTT A;  1FBQ A;  2HZT A;  3I4P A;  2FEZ A;  5D8L B;  3LST A;  3G6E I;  2LK2 A;  2DK8 A;  3M1E A;  4B47 A;  1A6I A;  1BI1 A;  2FJ1 A;  2NVU B;  1SFK A;  3VOE A;  4KIS A;  5J40 A;  2WAD A;  2ME0 A;  3WTS C;  3LFK A;  2QLZ A;  2A68 F;  1CF7 B;  3OIQ A;  5CQG A;  4IZZ A;  4U0Y A;  1EH8 A;  2DDB A;  3A01 A;  2XAS A;  2K9N A;  4LGW A;  1JGG A;  2Z2S B;  2KL4 A;  2WV0 A;  1FZP B;  3BLY A;  4A5M A;  3RKW A;  1R49 A;  4LG3 A;  4OIR F;  1B4A A;  2L3D A;  4E70 A;  4BXF A;  2IRF G;  1D8K A;  4UB6 C;  1XMA A;  5GAG J;  4FE7 A;  3OYJ A;  3CCE I;  2DTR A;  3JRC A;  2CQQ A;  3OS2 A;  3PQK A;  1X4P A;  4HF0 A;  3KEQ A;  5JHU A;  3AG2 H;  2CH0 A;  5HS7 A;  4BU2 A;  1PP8 F;  2XGD A;  2MD0 A;  3PNV A;  4AD9 A;  1F5T A;  3BPV A;  1BW6 A;  2EFO A;  1MMG A;  3HOT A;  2Z3Y A;  3B73 A;  2H8W A;  3BPX A;  4IKF A;  1XN7 A;  4CUG A;  1Q1H A;  2EFQ A;  1ZR4 A;  2VKH A;  4A3I J;  4W97 A;  3I4M J;  3A0B C;  4A3C J;  2JA2 A;  1MMS A;  1BA5 A;  1APL C;  1MMN A;  1XB4 A;  1FLI A;  1BM9 A;  4LIV A;  1Z6R A;  3RI4 A;  1TBX A;  1Y0N A;  1T39 A;  2OJE D;  2ZXI A;  1BOA A;  5D4S A;  2QF7 A;  4AVZ A;  2RQQ A;  4HX8 A;  3MQ0 A;  1H89 C;  2BYV E;  4FAS D;  4CCN A;  1YG2 A;  2DN0 A;  1M1E B;  3JRD A;  2M0C A;  1UCR A;  1XCB A;  1B72 B;  2ZXH A;  2HS5 A;  1QHH D;  3TW7 A;  3QU3 A;  1YJN I;  3KLO A;  3FHN A;  2ELH A;  2DQL A;  3FF5 A;  4ESF A;  2QZ8 A;  4OIN F;  2KJC A;  3OYF A;  1O4X A;  3QYB A;  3V8K A;  3GCM A;  4MFD A;  2LKX A;  2R3S A;  2KT0 A;  3CCV I;  1V5E A;  1HBX G;  3GTM J;  1O3R A;  2XVC A;  3G73 A;  3CCU I;  3MZH A;  3F21 A;  1LB2 A;  5DD8 A;  1IDZ A;  3KE2 A;  4IX7 A;  2KP6 A;  3DTI A;  3NAR A;  1IN6 A;  1YS6 A;  1B59 A;  2GQQ A;  1L3L A;  3HZJ A;  1GVD A;  3LWF A;  3K7A J;  2KMU A;  3BG6 A;  4MO7 A;  1KYZ A;  2L2O A;  5A2Q K;  1UHW A;  3BJO A;  1TTY A;  4PZJ A;  3E3V A;  5F6F A;  2ZO4 A;  3FMR A;  3RKQ A;  4CIC A;  3C2B A;  4II2 A;  4RMN A;  3PSF A;  5FRM A;  2N8G A;  4FX0 A;  4HG2 A;  4N9H A;  4RGR A;  5D4R A;  3FDY A;  3E5Q A;  2M45 A;  5DYM A;  2PLY A;  2FBK A;  4XLF A;  2LR8 A;  5LRS A;  1RES A;  4KN7 X;  2X85 A;  2Y48 A;  4F52 A;  3EPZ A;  2F48 A;  3DU6 A;  5HS8 A;  5EEH A;  4QLC U;  4ANJ A;  3BG3 A;  1Y6I A;  2MLK A;  2CUE A;  3BR6 A;  1IRG A;  1E0E A;  2H6B A;  1HW5 A;  1D5V A;  3GBG A;  3ZOB A;  3HTS B;  1MND A;  3NWT A;  3DEU A;  3FMQ A;  3EUK L;  3PFI A;  4A6E A;  1YO5 C;  3EET A;  3J7A O;  1HCR A;  1VQ5 I;  3P9C A;  4LLG F;  5DS9 A;  2PJP A;  2DA3 A;  2NVY J;  2ELJ A;  3TED A;  1C0W A;  1U8R A;  3N05 A;  3WG7 H;  2PI0 A;  4QWQ A;  2XGX A;  4A3B J;  3BR3 A;  2X4H A;  1TWA J;  3H3Z A;  1TT5 B;  2IS4 A;  3TO9 A;  3GF2 A;  2XF6 A;  3MMY B;  2ZNZ A;  3S2W A;  2FBI A;  4WXH A;  5CVR A;  3FXR A;  3SFI A;  1Z7U A;  3T8T A;  4PFO A;  3U9G A;  4ZYD A;  1G2H A;  3HOU J;  3HHH A;  3CUQ C;  2HYG D;  4CCO A;  2VI6 A;  3TP0 A;  3LAP A;  4I99 C;  1QZY A;  3CP2 A;  2XKP A;  1T33 A;  5TGT A;  3KP3 A;  3HEF A;  4EM1 A;  2MH2 A;  5FJ8 J;  1IUF A;  3I55 I;  1UJ8 A;  3PL8 A;  3C2G A;  3FIS A;  1W5C C;  2JUC A;  5EF6 A;  5CVJ A;  2Y0S A;  5CPR B;  3E6D A;  4FX4 A;  2DAO A;  1SMY F;  1UHS A;  1WJE A;  1ZLJ A;  3ABL H;  5E1Z B;  3GFM A;  3EYY A;  4AYB N;  1BI3 A;  3BR1 A;  1R1V A;  2JA8 J;  2K27 A;  3CUQ B;  1SFU A;  3NAU A;  3WGG A;  1OR7 A;  1EJ9 A;  2ZJ2 A;  2VOO A;  1PUE E;  2HKO A;  4AYB A;  4RGU A;  1FBS A;  2HPI A;  3RCO A;  3UR3 C;  1T6S A;  5LRR A;  3WG9 A;  5LEJ A;  3KIO A;  1VQM I;  3L2C A;  3JCU C;  1U9O A;  1SVM A;  3DPU A;  4EMS A;  3S3M A;  1BIA A;  1U2W A;  5F1R A;  2JMW A;  2L01 A;  5E8I A;  4YEL A;  4RB1 A;  4R1H A;  1Z67 A;  3WGI A;  2CG4 A;  2MW8 A;  2B0L A;  2DOA A;  1MH4 A;  4OU0 A;  1YS7 A;  4WXD A;  4A2U A;  2BHY A;  1SD5 A;  1ZYR F;  4GYG A;  4I0B A;  1FPQ A;  1HQC A;  1Y8R B;  2KRC A;  5F0C A;  2JVH A;  1K83 J;  4II3 A;  2R7U A;  2OQG A;  3GWZ A;  1R4M B;  3HOX J;  3MN2 A;  1T2K A;  4MHG A;  2KIM A;  4A3D J;  3C18 A;  3FHZ A;  4GYI A;  2Q1Z B;  4BQQ A;  1J2X A;  2HOT A;  1S5L C;  3PJR A;  1RKT A;  4ZYA A;  2ICW G;  2FBH A;  1RIO H;  1J59 A;  3GZ6 A;  3H36 A;  3BZ6 A;  4WK8 F;  1MMD A;  1Q1V A;  1VTN C;  3JAM K;  4FIS A;  3BQY A;  3QPL A;  2VL8 A;  4PGH A;  1A5J A;  3A1Y A;  4I98 B;  4RM2 A;  3CC7 I;  2GIV A;  5GAE J;  3JRH A;  3GEZ A;  1X4O A;  5D5X B;  2XKO A;  3MVP A;  2E1C A;  4CA0 A;  3QAH A;  1BI0 A;  4E6K G;  4OAZ A;  5HLH A;  3C7J A;  1X1C A;  4DZJ A;  2VKV A;  4FT8 A;  1HLV A;  5E17 F;  1V4R A;  3HRS A;  2A69 F;  1U8B A;  4V2F A;  3CME I;  1GV2 A;  2L7M P;  1JXS A;  5K1Y A;  2OZU A;  2Z99 A;  4HBL A;  2LG4 A;  3HSE A;  2YUS A;  3GZ5 A;  1E3H A;  4XK4 A;  3M7G A;  3HJE A;  5BQT A;  2LSO A;  2DQR A;  2CV1 A;  3DP7 A;  5KVR A;  3GLL A;  4KMU X;  5KNL A;  5DUI A;  5D6E A;  3ERM A;  4DBQ A;  2VPL A;  2F5D A;  3HL2 A;  1V3F A;  2IGO A;  1AHD P;  2MG4 A;  4BNC A;  1LJ9 A;  3KPH A;  1R23 A;  2ZFW A;  1O7F A;  3WTV C;  3E0J B;  1LPQ A;  4KIB A;  4XID A;  4P55 A;  3HGG A;  2WAQ A;  5EGO B;  2CJJ A;  1B9M A;  1FEX A;  1MBJ A;  2I8D A;  3BT9 A;  1U78 A;  2P6S A;  3ABT A;  1XG1 A;  3F8F A;  1VQ9 I;  1BJZ A;  2HQ5 A;  5ICE A;  3CZ6 A;  1B8I A;  2HDD A;  3AG1 H;  2NVT J;  3U1D A;  3FXQ A;  2P5L C;  2G7U A;  3MKY B;  2M2E A;  5CLS A;  3RKY A;  3KP6 A;  5LGU A;  1WJC A;  5EJC A;  1U5T B;  3PFY A;  1XS9 A;  1TNS A;  3QP6 A;  3VWB A;  3WTX C;  3SDG A;  3K69 A;  2KDO A;  1WQ2 A;  1MNM C;  2WA0 A;  4AC0 A;  3WU2 C;  2IS2 A;  4G6D A;  5C44 J;  2DU9 A;  3OSG A;  3CCY A;  2VE9 A;  1SD4 A;  2QKL B;  2V1X A;  4M3E A;  4F3Q A;  1G3Y A;  4OMZ A;  1F1Z A;  1TZL A;  2BY3 A;  5DDG A;  1X19 A;  2EA4 A;  2DYS H;  1S7E A;  3DXJ F;  4I7H A;  1B1B A;  3QP5 A;  3M3Y J;  1NG6 A;  3K4C A;  4BL0 B;  3IHU A;  5BNG A;  4M72 A;  2M0M A;  2ETH A;  4IJA A;  2HU9 A;  1YW7 A;  4G12 A;  3CC4 I;  1JHH A;  2XGE A;  4LG0 B;  2LTP A;  4W1U A;  2IGN A;  4C3I J;  1UG2 A;  1SFO J;  4AUX A;  3CCS I;  4IHT A;  3FMS A;  2HNH A;  5GPA A;  4BBS J;  1D5Y A;  4RB3 C;  4C30 A;  3D5R C;  4B1R A;  4LIT A;  2A5Y B;  2AHQ A;  2WY7 Q;  4L5J A;  4AIJ A;  3D5S C;  4Y13 A;  1NG7 A;  1DPR A;  3S93 A;  1FYL A;  1JGS A;  3E5U A;  3J7Z I;  4HW0 A;  5D6F A;  2F6C A;  1W0T A;  2WTE A;  4LLL A;  1XSV A;  1K4S A;  2XIG A;  4ESB A;  3X2Q H;  3NWS A;  2KIQ A;  3R60 A;  1H8A C;  4O6J A;  1W36 C;  2EK5 A;  1DU6 A;  4XM3 A;  3BOQ A;  1J75 A;  3ZPL A;  5KHD A;  5JLW A;  5FFX A;  3BTI A;  3H3U A;  4IRI A;  1VQ6 I;  2ACJ A;  2HKX A;  4OAY A;  2X0L A;  3BDD A;  3DCF A;  4X6A J;  3ZQQ A;  1GT0 C;  3S8P A;  4IXA A;  1XC5 A;  4AU7 A;  4RB2 C;  3JRB A;  1P6R A;  2HQA A;  3A01 B;  5BOX A;  3IH3 A;  1NH3 A;  1SFX A;  3K0L A;  4HOB A;  2CO5 A;  3FKJ A;  1NHA A;  2VOP A;  2F5E A;  1CF7 A;  2VBY A;  3E1S A;  3HM5 A;  4XNF A;  5GAD J;  4A12 A;  4LIU A;  5IY5 H;  3WTZ A;  1EA3 A;  2RDP A;  3M1C A;  1VFC A;  3LNQ A;  3LSI A;  3BG9 A;  2QWW A;  4ZYE A;  5B1B H;  2LKS A;  3VEP A;  3H0G J;  3KYC B;  1OCC H;  1X2N A;  2QKM B;  3CF2 A;  3S3N A;  2ISY A;  4XLN F;  3R61 A;  5LLQ A;  3HOS A;  4HF2 A;  4BUP A;  1O3Q A;  2MBF A;  1OQY A;  3C1D A;  2EPF A;  1RI7 A;  1S9H A;  3MKL A;  4IHV A;  1XTA A;  2M7A A;  3PO3 J;  3S15 J;  1JUS A;  1MZB A;  4DJA A;  2O6G E;  1IO2 A;  4KNY A;  3EQL F;  3R6S A;  3F8N A;  4CZC A;  3RZO J;  2NYX A;  1HDP A;  5M5X J;  1ERD A;  2LKP A;  1SVL A;  4BE1 A;  2IS6 A;  4M3D A;  4D0P A;  5HLT A;  2D2W A;  3PUF A;  3IV5 A;  1K79 A;  2UUZ A;  2WBM A;  2KFD A;  1SEU A;  5GP9 A;  2LBF A;  1S3J A;  2V4J C;  3OYM A;  2XHK A;  5M3M J;  4Z2Y A;  4XKW A;  1E17 A;  4KDP A;  3SXY A;  2CV0 A;  1G6N A;  1W4M A;  3BTC A;  3WTW C;  1XDU A;  2KZV A;  5HLI A;  4C3J J;  3RZD J;  1KYW A;  1UG0 A;  4GO1 A;  5B1A H;  1ZN2 A;  1P9Q C;  1OIS A;  4G6T B;  1A04 A;  4EJU A;  2B9S A;  2L4M A;  2E2J J;  4I0A A;  1OR7 C;  4M3F A;  1FOX A;  2Z33 A;  2NVQ J;  3FXJ A;  1U5T A;  3GTL J;  5TIS C;  4KIT B;  3CF5 F;  1N77 A;  1AWC A;  2W24 A;  2W57 A;  4XBF A;  2DT6 A;  2JRT A;  4IHY A;  1QPM A;  1B8I B;  2XAJ A;  3KZI C;  3JSP A;  1VQ4 I;  2IA2 A;  2NVX J;  4S05 A;  2GZW A;  4BEH B;  2P4W A;  1FJL A;  2V6E A;  3VSK A;  4XIC A;  3KCC A;  4KYW A;  4LLN A;  3FWE A;  5J47 A;  2QCO A;  2V9K A;  2QQB A;  3OL4 A;  4CH7 A;  1LNW A;  3JTG A;  1AKH A;  4U88 A;  3DBL B;  3HKZ A;  3OYH A;  4B44 A;  2PFB A;  3QPT A;  2KLO A;  5TJJ A;  4DNC A;  1PUF A;  1VQO I;  4IQJ A;  3SDB A;  1R6R A;  2EJR A;  3DBR B;  2K9M A;  3V4G A;  4ZTF A;  3PSI A;  2CV2 A;  2DTZ A;  4F91 B;  1S7O A;  4BJ6 C;  1ENH A;  1P4W A;  2CMP A;  2DMP A;  2E36 A;  2VC1 A;  3ASO H;  5AON A;  2XV4 S;  4N4O B;  3CDH A;  4DOZ A;  1P4X A;  1GLN A;  2A05 A;  3G3Z A;  3KFW X;  2P7V B;  2K40 A;  4E7Z A;  2DOD A;  2MLG A;  1FMW A;  1QNT A;  2BHZ A;  2ESN A;  3KLN A;  2F4M B;  2W84 A;  4UHT A;  3LSH A;  3I54 A;  2EH3 A;  5FLX Z;  1ZG5 A;  3HSF A;  2ZME A;  3CMA I;  1BOB A;  5FKM A;  2L9N A;  2RKH A;  3K6G A;  1LVK A;  4HV6 A;  1WRJ A;  2OBP A;  2W48 A;  4RGX A;  4YEJ A;  2LDU A;  2QQ9 A;  2FF4 A;  3P9K A;  2GXA A;  3HTU A;  4E7S A;  2RQP A;  2ZCW A;  4ENJ A;  1WI3 A;  4ZTJ A;  3BJA A;  1YYV A;  4IRG A;  2VJ4 A;  1TL8 A;  1IC8 A;  1RR8 C;  3E5X A;  1PUF B;  5H6R A;  3ISP A;  1F43 A;  5L3F A;  1FP1 D;  1MBE A;  1V54 H;  3BY6 A;  1OPC A;  2H8R A;  3FKI J;  5K7H A;  2BE5 F;  2E7X A;  3BQZ A;  4D1Q A;  2TCT A;  2LY9 A;  4XKC A;  5E8G A;  3DKW A;  1R1T A;  1X1B A;  4RB0 A;  3CO6 C;  3OYK A;  2OV7 A;  3G1L A;  2ZKZ A;  1IXR C;  2KIS A;  5ICC A;  3ZXS A;  2LVS A;  3RDI A;  1FOK A;  4D9J A;  5J8C A;  5TRD A;  2AXL A;  2L9V A;  2QYO A;  1U0J A;  4LB6 B;  3IC7 A;  5HVQ C;  3RQI A;  1JUP A;  2NOJ B;  1D1B A;  1MJA A;  3RIR A;  4BQN A;  3EDP A;  5K5R A;  2QVO A;  2K02 A;  1Y1V J;  1TQM A;  4EEF G;  3TGN A;  3G2B A;  3MWM A;  2G9W A;  3BR0 A;  2ID6 A;  1JTX A;  1YTY A;  2EZH A;  3SZG A;  1LEA A;  1JE8 A;  3OMY A;  2VBW A;  2WB1 A;  1HW2 A;  1R7J A;  2VT3 A;  5LHH A;  2K3F A;  2G7H A;  2L02 A;  5BPD A;  1F36 A;  3KEO A;  3VDX A;  5FLX K;  2F5V A;  1W0U A;  1HST A;  1ZRC A;  4ENK A;  2A6T A;  4DIQ A;  5ILV A;  1A36 A;  3HOV J;  3I4N J;  1MDM A;  3B6A A;  2IS1 A;  2CQN A;  1FNN A;  4HLX A;  2MYS A;  3ZMZ A;  1Z6T A;  1WJD A;  3CTA A;  2DT5 A;  1T0F C;  2X6Y A;  3KYD B;  2QQA A;  5D5V B;  1D1A A;  4GXO A;  1KU9 A;  3BWG A;  4BQA A;  3JTH A;  1OJL A;  3WE2 A;  1A31 A;  1HW1 A;  2L0K A;  1JTY A;  2Q2E B;  1QZE A;  1R1U A;  2H27 A;  2E5Z A;  2OTL I;  2B63 J;  3GX4 X;  3ZCO A;  2UV1 A;  3QOE A;  1ZH5 A;  1W5S A;  2FRH A;  1IN8 A;  1UFM A;  2L9S A;  1VQL I;  1YFH A;  2CFX A;  3IKT A;  3AL0 B;  3K1P A;  3TL4 X;  2FQ4 A;  3CMY A;  2XAF A;  6PAX A;  3JR9 A;  1ZAR A;  4X0G A;  5FKK A;  4Y15 A;  2YPR A;  4D7N A;  3Q9V A;  2LP0 A;  1J0R A;  5L3D A;  4B3A A;  3Q0V A;  5L3E A;  2VUM J;  2EFP A;  2EIM H;  2JA6 J;  2L5Q A;  2E60 A;  2VKD A;  3E97 A;  1YLF A;  4XLE A;  2E1O A;  2XPW A;  2R0Q C;  2ZME B;  1X3W B;  3LQR A;  3K70 D;  3ULQ B;  4HRI A;  2K7L A;  4L5E A;  1N75 A;  3SZT A;  1IUY A;  5HS9 A;  2MGQ A;  3U2R A;  2QSG X;  1ZHF A;  1SVO A;  3WTU C;  4PJ0 C;  2XAH A;  2K9S A;  2Q2E A;  2YU9 J;  1MBK A;  1ZG3 A;  4HEA 2;  1SFE A;  1GHC A;  3HGY A;  3ZQL A;  4JX4 A;  4NQW B;  1I39 A;  1I50 J;  1UST A;  3D1N I;  3FXK A;  3ESW B;  3HUG A;  1WGX A;  3M8E A;  1TNT A;  3F0C A;  3OYL A;  4E7H A;  2GM4 A;  5M5W J;  4CYC B;  2NXN B;  4N4N B;  2VXZ A;  4JX6 A;  3H3V K;  1DGW Y;  3GTO J;  3RKX A;  5D5U B;  2R7R A;  5LFA A;  1AOY A;  1ZLK A;  2ZSH B;  2KRH A;  1GUU A;  4EGY A;  2IW5 A;  3PNY A;  2FUG 2;  4F7Z A;  4HDV A;  4PCQ A;  1YW9 A;  3M8J A;  3JAM Z;  1LVA A;  1A35 A;  2KKO A;  5GTI C;  3CP8 A;  4HNT A;  3L2Q A;  2BVL A;  4B3X A;  5FLV A;  4NQW A;  3S16 J;  4O5V A;  2DMT A;  3FK6 A;  3Q9S A;  2CFO A;  5HLG A;  1O3T A;  1YOV B;  4JQF A;  2HZD A;  4G7O F;  3K4B A;  3O8G A;  4ZC3 A;  4M9X A;  2QQ8 A;  3WHC A;  1WJF A;  3QYE A;  3L2U A;  3WTT C;  2QUF A;  2VPR A;  3W6V A;  4PUS A;  4RBO A;  4QSH A;  5HOO A;  3QYF A;  2JA5 J;  1FIP A;  3KP7 A;  4Q47 A;  1TWH J;  1Z0X A;  2HFH A;  1MJ9 A;  4XR6 A;  4U7B A;  2VAS A;  1Y0U A;  4BHP A;  2BVM A;  4J01 A;  4EJO A;  4JK1 X;  2R5Z A;  4GFB A;  1H0M A;  3ZQC A;  2DA6 A;  2P7C B;  2R92 J;  3IH2 A;  2AXT C;  3V7C A;  1FX7 A;  2DOF A;  3IKV A;  3CCR I;  4BAC A;  1B72 A;  1K7A A;  1J7K A;  2V7F A;  4P1W A;  5E79 C;  2IP2 A;  2M8E A;  3BC8 A;  4MEX F;  3TOB A;  4QPO A;  3CUO A;  5L3C A;  2GXB A;  3J7A Y;  1H9T A;  3K4K A;  2EIK H;  3BCA A;  1K78 A;  1IV6 A;  1UAA A;  1S7A A;  4G6Q A;  1ZRD A;  1A6Q A;  2CUJ A;  1JUM A;  1N25 A;  2OAZ A;  4JOM A;  5LHI A;  2ELK A;  3V8J A;  1QQI A;  5LBQ A;  1U9N A;  2EQR A;  2NAZ A;  5FKL A;  4O3M A;  2FMY A;  2IA1 A;  3M9A A;  5E1W A;  3MKW B;  3P7N A;  4UVA A;  1XMX A;  2M8G X;  3S32 A;  2P0W A;  2RN7 A;  4BBR J;  4CHU A;  5HDG A;  3K4L A;  1LFB A;  3H9J A;  1YJW I;  2Y9Z A;  4Y52 J;  2BGC A;  1Z3X A;  1LDD A;  3OWT A;  3Q0U A;  4ESJ A;  3R4K A;  2LH9 A;  5IPA A;  1BBY A;  1FSH A;  4BH9 A;  2YX7 A;  3LAJ A;  2XC7 A;  2XSD C;  1TWG J;  2NS0 A;  3CJN A;  4A3K J;  2IXS A;  2DXI A;  1J9I A;  4QIW N;  1QHG A;  4CDG A;  1YIO A;  3OR2 C;  3S3O A;  4I01 A;  2DMU A;  3MD2 A;  1MNE A;  2HQR A;  2JRM A;  4NBQ A;  4JYK A;  1X2M A;  4HZF A;  4XKB A;  1BI2 A;  2B7E A;  2V26 A;  1FMV A;  3D0S A;  3I0T A;  4UVB A;  2KZG A;  2R7V A;  1L0O C;  5IYB J;  3CO7 C;  2FNA A;  1UZC A;  1X1P A;  2DI3 A;  1SD6 A;  5D8K B;  1BR1 A;  4GCV A;  2R7O A;  4KIF A;  1WJB A;  2R4G A;  3BP8 A;  1W1W E;  4D5F A;  2CW8 A;  1SAN A;  4HAM A;  3S2D J;  2VN2 A;  4XL9 A;  3DF8 A;  2E2H J;  3PQJ A;  1IRF A;  5J1U A;  3K1M A;  2LFB A;  3PIO F;  1RR7 A;  3T0Y A;  2P81 A;  2Z1D A;  1Z3Y A;  3QQA A;  3ZMU A;  1MH3 A;  3HOY J;  4HQM A;  2K3P A;  1Y56 A;  4YFN F;  5EEA A;  2UXX A;  2HI3 A;  4F93 B;  4KIG A;  4G7H F;  4C2U A;  3CCJ I;  5K7Z A;  1TC3 C;  2X9D A;  4UUT A;  4Y4R A;  3MEX A;  1FTZ A;  2M1B A;  2R5Y B;  2JA7 J;  1I6H J;  1GV5 A;  1IDY A;  3OV8 A;  2CU7 A;  1NK3 P;  1YX3 A;  4LOC A;  2AS5 F;  1MSE C;  2V1U A;  1H88 C;  2XAU A;  3W2V A;  4G9Y A;  1T98 A;  5EG0 B;  2OZ6 A;  2X6X A;  5DUK A;  4XRM A;  2AQE A;  1BC7 C;  2AO9 A;  2CGP A;  1DUX C;  3H5A A;  2MSY A;  3COA C;  1VI0 A;  2XB0 X;  1IXS B;  5DM6 F;  2FML A;  1TQI A;  5FRO A;  4DBR A;  5CVU A;  1H9G A;  3V7R A;  1YRN A;  3HYI A;  2I5U A;  3ZGK A;  1BJA A;  4XN3 A;  2Z16 A;  2D1V A;  3F9K A;  4RGS A;  2R7X A;  1RZ4 A;  1R00 A;  4CYD A;  5BPI A;  4B09 A;  3AAF A;  2OC6 A;  2DMN A;  2AQF A;  2LF7 A;  1MD0 A;  3I71 A;  3Q5F A;  5KCM A;  2Y9Y A;  4D7M A;  1QRY A;  4A3L J;  1XGS A;  3L7W A;  3OY9 A;  4FE4 A;  1IF1 A;  1R36 A;  1LE8 A;  3HUG B;  4DYC A;  4MIM A;  5F08 A;  1GDT A;  1ZRE A;  5AIP A;  3LSR A;  1Z91 A;  2XPV A;  3JSO A;  2G0E A;  4LB5 A;  1IGN A;  3GXO A;  1Z1D A;  1PVE A;  1XCV A;  1CQT A;  1WHU A;  5B66 C;  4LFU A;  3TO7 A;  2Y75 A;  2CQ7 A;  3LSM A;  4UUS A;  1ETQ A;  4J19 A;  3H5N A;  4A69 C;  3SJM A;  4ENM A;  3K2A A;  5IT9 Z;  2K9L A;  5A2Q Z;  3HRM A;  3NQO A;  4DYR A;  3LSP A;  3WU0 A;  4X1E A;  2MFZ A;  1HKT A;  4H0E A;  2M87 A;  1MBF A;  3DQV C;  3I56 I;  4LK1 F;  3TBI A;  3FXL A;  1FBU A;  4XKV A;  5E20 A;  5JLX A;  2Y0S N;  1FY7 A;  2Q8K A;  1PJR A;  3TKY A;  5KAI C;  4D5C A;  3GLX A;  2JUG A;  2VQG A;  5ICF A;  3K70 C;  2STW A;  3HOW J;  3OIO A;  1E2X A;  3K4M A;  5CYV A;  1HKQ A;  4EVI A;  5J1R A;  2X1D A;  2M3A A;  2ZXW H;  2R7Q A;  3ASN H;  1OLT A;  3HSR A;  3MAJ A;  1S6L A;  3KP4 A;  4RAZ A;  3ZR8 X;  2IVM A;  3REO A;  2GA1 A;  1FOY A;  3GO5 A;  2GWR A;  1D8J A;  2DFF A;  2VJ5 A;  3RYP A;  2ZJP F;  1KQ9 A;  3WGH A;  3C2H A;  4KJZ A;  5IYC J;  4YFK F;  1WSU A;  2RNG A;  4HNV A;  3ZQF A;  3Q0W A;  2K5C A;  3M07 A;  4PJL A;  1SAU A;  3HG9 A;  1T38 A;  2Y69 H;  2DBB A;  1AKH B;  5FD5 A;  1KU7 A;  4XSZ F;  2H6C A;  3JRG A;  1SAX A;  4KT5 C;  5DCF A;  3QU6 A;  2QSH X;  3CLQ A;  1GXP A;  4ABZ A;  1UEL B;  3TO6 A;  1T08 B;  1FYM A;  3J81 K;  1BIB A;  1ULY A;  5E18 F;  1D0X A;  2H94 A;  2E5N A;  1P92 A;  2HDW A;  3RJP A;  3IUO A;  1DPU A;  3W6J B;  2IGK A;  1KON A;  5IT9 K;  2FNP A;  3ZN0 A;  2DOE A;  1R5G A;  5LGN A;  1T95 A;  5KAF C;  2L7Z A;  2A6H F;  2EZL A;  4XRF A;  1R5H A;  5EZH A;  3L9F A;  1UHM A;  4XRS A;  2RV8 A;  3LOC A;  4GDF A;  4WF2 A;  1V5G A;  3BR2 A;  5J1Y A;  2M5W A;  2VBZ A;  4RA2 A;  4PSX A;  4ZZL A;  1DDN A;  1XDS A;  2NNY A;  3CCL I;  1UMQ A;  3IAM 2;  4Y17 A;  1IRX A;  1POG A;  2OD5 A;  2GXG A;  2V1D A;  3TMO A;  3LL7 A;  4KT6 A;  4BY1 J;  5H6Q A;  4ON0 A;  1K4T A;  2YX4 A;  2PQ8 A;  3ECH A;  4BDZ A;  4ZDO A;  1MMA A;  2IT0 A;  1IW7 F;  4Q5S F;  9ANT A;  3V7S A;  3BTL A;  5JVG F;  4M9S A;  3S1M J;  5LD2 C;  3PM1 A;  4XLA A;  5M3F J;  4XQF A;  4EAT A;  2ME6 A;  2R93 J;  3I59 A;  4B4C A;  3T1B A;  4HX4 A;  1XPX A;  2E19 A;  5GPC A;  2O3F A;  2RGV A;  2MC3 A;  2DW4 A;  3JRA A;  2M9H A;  2E7W A;  1VQN I;  1LKX A;  1KQ0 A;  3EUH C;  1FWZ A;  5F0H A;  4OIP F;  5JR3 A;  4L5I A;  2E34 A;  3B02 A;  3HPG A;  5FRN A;  4RAG A;  4L9V A;  3ZQI A;  3NEU A;  4WWC A;  3RQ4 A;  2M4K A;  5F64 A;  3IRR A;  4UVC A;  2DA7 A;  2DPU A;  1ETO A;  4ZDP A;  3PO2 J;  1ZGJ A;  2EWN A;  1FP2 A;  4CCJ A;  1RET A;  2O8X A;  4RLF A;  3TQN A;  3U1K A;  4ENN A;  4M9Z A;  1YX5 A;  1ON1 A;  2K9Q A;  3K1N A;  2BW3 A;  3TDU C;  4RLQ A;  4HA8 A;  1ETY A;  3RYR A;  2CS3 A;  4CCM A;  2ZB9 A;  3LSK A;  1O57 A;  1TLH B;  5KK1 A;  2EBI A;  1B6A A;  4KA4 A;  2PBI A;  1WVR A;  2A3S A;  2CRG A;  4IHS A;  3H5R A;  2WAE A;  1E3O C;  2XDV A;  3DPT A;  4V19 K;  2H1L A;  1HSJ A;  4BJ5 C;  2K4J A;  4CGZ A;  2R7D A;  2CW0 F;  4NDL A;  1IJW C;  1MBH A;  1WFX A;  1I3Q J;  5B5E C;  2R7S A;  1WI9 A;  1PYV A;  5ILS A;  2F5F A;  2L9R A;  4PDK A;  2HOE A;  2IA0 A;  1G3W A;  3HRT A;  4M3G A;  1I1G A;  4AVP A;  4E7I A;  3ZMT A;  1YHQ I;  1I5Z A;  4IOC F;  2M7B A;  2RAE A;  2D45 A;  3DLA A;  4U7D A;  3FK7 A;  1ZRF A;  4BAY A;  1YW8 A;  2DK5 A;  3OYG A;  4G7Z F;  5F04 A;  4P5O A;  5CVI A;  4E7J A;  4A0Z A;  1OFC X;  2DA5 A;  3LA7 A;  5DEQ A;  2DCE A;  5LHG A;  2RRE A;  3ELK A;  3DPL C;  4XN0 A;  4L0Z B;  2COM A;  3DKX A;  3LSJ A;  1ORK A;  3OSF A;  3OYC A;  3F8B A;  1NTC A;  3JW4 A;  1R58 A;  2PJR A;  4LK0 F;  2E35 A;  1W7P D;  3J81 Z;  4EQQ A;  2IPQ X;  4PK4 A;  1YIT I;  4BQO A;  2BEO A;  2X1C A;  2Y31 A;  1XSX A;  3IAS 2;  2CQX A;  4RM3 A;  1RNL A;  3OYD A;  4RAY A;  3IP4 B;  3I9V 2;  5LEK A;  1ONV A;  2EV5 A;  3GME A;  1WCM J;  3M4O J;  4HF1 A;  2EFN A;  2F4O B;  3KYL A;  3RPU A;  4NC6 A;  5E3N A;  4ZYH A;  1OKR A;  5IYD J;  1EF4 A;  1X3Z B;  4IQ4 A;  4FET A;  3CJT B;  2BY0 A;  2F4I A;  3U21 A;  3OYI A;  5C3E J;  1DP7 P;  2VQC A;  4BGD A;  2MAB A;  2QM3 A;  5HNF A;  3DV8 A;  3GZN B;  1ZG1 A;  3BG7 A;  3S1R J;  2NS8 A;  5IOY A;  3I64 A;  3S1Q J;  3WU1 B;  1I6X A;  4LD5 A;  1OCR H;  5ICG A;  1ITY A;  1LFU P;  2A6E F;  3A03 A;  4ITV A;  3ZMV A;  4EJV A;  2TDX A;  3EUA A;  3J7Y J;  1HXD A;  2KDZ A;  4Y3O A;  3SFZ A;  3AG3 H;  3IH4 A;  3PUB A;  1R4N B;  3D5L A;  2JSC A;  3KZZ A;  3RSN A;  4BHC A;  3PIP F;  4UUV A;  3S17 J;  2FX0 A;  3A0H C;  2F5C A;  3M8F A;  4CCL A;  4IOA F;  3OOU A;  4HPQ A;  3DLL F;  3WHB A;  1DGR M;  2HWV A;  3OR1 C;  2QGU A;  4MGR A;  3F8C A;  4A6D A;  1R9T J;  4V2G A;  1DU0 A;  3OIP A;  2YSR A;  4S04 A;  2HDC A;  1MSF C;  2BZT A;  1IN4 A;  3BJ6 A;  3DFG A;  1ZTR A;  4GRI A;  3CQZ J;  4UV8 A;  4ZZD A;  3CDL A;  1DP3 A;  3GFJ A;  3N97 A;  4A93 J;  1U3E M;  1TT0 A;  5K5Q A;  3ECO A;  4YRV A;  3OYA A;  3CLO A;  1X58 A;  3FX3 A;  3J80 Z;  1MW7 A;  1T56 A;  2DFH A;  2DYR H;  4DYQ A;  5F1J A;  5E3M A;  2O03 A;  2RNJ A;  3BR5 A;  3DWL E;  3GYH X;  3DTE A;  2Y2Z A;  3ML6 A;  1QPI A;  3JRE A;  1JKQ C;  1V55 H;  2XAG A;  1TQP A;  3F6V A;  1OCO H;  2E1M C;  4BJT A;  2QA4 I;  1Z77 A;  3K4J A;  3OS0 A;  3EYI A;  1ETK A;  1TP4 A;  4MFE A;  3LA2 A;  3FM3 A;  3ONQ A;  2ESH A;  4YII A;  4PFP A;  5FFZ A;  3KP5 A;  3QPH A;  1D0Z A;  1P7J A;  4MEY F;  2JTV A;  5IP6 A;  4JX5 A;  3W6K B;  1QVT A;  2XSJ C;  2WV1 A;  1Y39 A;  2R5Y A;  4IHX A;  1Z21 A;  1ACI A;  4EGZ A;  3DEE A;  2UWM A;  1STZ A;  3CUQ A;  5EGO A;  1EH7 A;  2HTS A;  2CSO A;  1VND A;  2PJR B;  4BHB A;  4BS9 A;  1MDM B;  1ZAO A;  2UZK A;  3ABK H;  1MIJ A;  2XF7 A;  4GGG A;  2PMU A;  1KA8 A;  4XMY A;  1IN7 A;  4IRH A;  2BY2 A;  3UNG C;  3TW6 A;  2ECB A;  1FSE A;  1LEB A;  1R71 A;  2W00 A;  1QU3 A;  2OCC H;  5FD6 A;  2JVG A;  2STT A;  3OYB A;  1W7P B;  4BE2 A;  4LJZ F;  4CCK A;  1S72 I;  2MH9 A;  2Y30 A;  4HV5 A;  4JBA A;  3IL2 A;  1JI8 A;  4PSW A;  1ON2 A;  3BRO A;  4Y33 A;  5EDN A;  3HOZ J;  3FIW A;  4ASN A;  2GIZ A;  2DJI A;  3E6M A;  2BV6 A;  2XUB A;  5FKO A;  4EM0 B;  4EM2 A;  1VZ0 A;  2HR3 A;  1G59 A;  1ZGW A;  1Y8Q B;  1IZ1 A;  4DZP A;  3KP2 A;  3VSL A;  1JT0 A;  1IG7 A;  3MZY A;  2P6T A;  2YR2 A;  1ETV A;  2LF8 A;  4A3M J;  3TP3 A;  3NRV A;  1REP C;  2WB1 N;  2YS9 A;  2VQL A;  2O9L A;  4UXN A;  2GA2 A;  2RVC A;  3HBL A;  3I3L A;  1J09 A;  3OS1 A;  2VE8 A;  3GW2 A;  3AKZ A;  3CJR B;  3F8M A;  1JKR C;  2KPM A;  2CWE A;  1OYI A;  1QZZ A;  2VXD A;  3HHG A;  5AIQ A;  2R7Z J;  4KIC A;  4G94 A;  4PJM A;  1S8N A;  1HA8 A;  4ZH4 F;  2MC4 A;  3H9G A;  5CJ9 A;  3CCQ I;  4CO8 A;  1Z05 A;  2EIJ H;  2K85 A;  2GOX B;  3ZQG A;  1PDN C;  2R5Z B;  1AU7 A;  5J4Y A;  3IWF A;  2ZXJ A;  3SEQ A;  2L7K A;  4NB5 A;  2O0Y A;  2E71 A;  2CUF A;  3F3X A;  1HKS A;  2ID3 A;  2OPT A;  1GVJ A;  2FOW A;  2W25 A;  1BR4 A;  2CQK A;  5DCM A;  3P5J A;  2ZC2 A;  3CCM I;  1FOW A;  5C4J J;  3OOP A;  1P2F A;  2IEK A;  3TOA A;  3CD6 I;  4JP0 A;  1WWX A;  2M34 A;  2KRF A;  2HVQ A;  3RTR A;  2LD5 A;  1NK2 P;  2JPC A;  1PP7 U;  5M5Y J;  4XOR A;  4YG2 F;  3HC7 A;  4XSX F;  2C6Y A;  1WJA A;  3KET A;  5GTH C;  3S1N J;  2ZNY A;  1K6O A;  3FXU A;  4WCG A;  3GFL A;  2VJJ A;  3ABU A;  3E7L A;  2LRD A;  3S2H J;  2J5P A;  3FBN B;  5J4V A;  1YI2 I;  5HNH A;  3HRU A;  3N4M A;  5HDN A;  2FXA A;  3L2V A;  3HDD A;  2W4S A;  1JHF A;  2CUZ A;  1TWC J;  4I02 A;  4Q48 A;  5BMZ A;  1FT9 A;  4C2T A;  3ZQH A;  2VIX A;  2X6O A;  1TW2 A;  3P9I A;  3ZN1 A;  1MKM A;  2Z9O A;  4G8X A;  4J00 A;  3GTG J;  2NNN A;  4CSW A;  4M6Y A;  1ZGA A;  1JJ8 C;  4I2O A;  2VBX A;  3CDI A;  1USS A;  2KIF A;  3I5U A;  3VYU B;  1OCZ H;  2VQH A;  3ZRG A;  1F4K A;  1IAW A;  1TW3 A;  5FKN A;  3OL3 A;  4M73 A;  5DM7 F;  4IPA A;  2DA2 A;  2XRO A;  2HYF A;  2COB A;  4P96 A;  3AFH A;  2WAF A;  1VQ7 I;  3IRQ A;  5L3G A;  4OMY A;  4C2M J;  2Q0O A;  3LMM A;  2VOD A;  4S0H B;  3CC2 I;  4U87 A;  5C4X J;  1BC8 C;  4E4H A;  1D3Y A;  4CYC A;  2XGC A;  2O7O A;  3EUH A;  3VB2 A;  3MKZ A;  1XD7 A;  3FBI B;  4NNJ A;  3JRI A;  3IWZ A;  4B8X A;  2PMZ N;  2H1K A;  3HB9 A;  2D1H A;  4UY8 I;  3QOP A;  5DTD A;  4B43 A;  1QO0 D;  3GFI A;  5JHF A;  2X6W A;  5HOD A;  1W36 D;  2BW3 B;  1BL0 A;  4UNO A;  3ABM H;  4IF4 A;  1HOM A;  1FIA A;  3BZK A;  1V5F A;  3T5X A;  1RUO A;  4AWX B;  1P4A A;  3A4C A;  4A3E J;  1T8I A;  3VYS B;  5IOZ A;  5FLM J;  2GOM A;  3VOD A;  2GBY A;  2XF5 A;  1WPK A;  2DA1 A;  1BW5 A;  3GUD A;  4FQG A;  3QRF F;  1K78 B;  1D0Y A;  4B48 A;  5DD4 A;  1FC3 A;  1XX5 A;  3V42 A;  3E6C C;  1QA6 A;  1SC7 A;  2ZJQ F;  4PJJ A;  2V9V A;  2XB5 A;  4UB8 C;  4EJT A;  1IXC A;  2E1N A;  3CJQ B;  1CGP A;  1Z7L A;  1J5Y A;  4PJN A;  2ISZ A;  2EV6 A;  2V9P A;  3VYT B;  2P5V A;  2ZSI B;  3FXO A;  2J5O A;  2VKE A;  2EA2 A;  2M4G A;  2LC2 A;  3G71 I;  3OYN A;  3JRF A;  3WTY C;  1ZK8 A;  2JJ7 A;  4R79 A;  2GAU A;  2W1O A;  4LG0 A;  3AL0 C;  3DBH B;  4BEH A;  4HLY A;  2OF7 A;  3VPR A;  2K4B A;  5DV5 A;  2I10 A;  5JFR A;  5IP7 J;  1U5T C;  3VYR B;  4OWR B;  4IL6 C;  2BBY A;  1KU2 A;  1JJ6 C;  1DQU A;  3E6B A;  2ZBK A;  4M74 A;  2H09 A;  3O2P E;  4BE0 A;  4P9U A;  2X48 A;  3K4N A;  1YJ9 I;  2ADU A;  1KU3 A;  4MLO A;  5EEG A;  3WOD F;  1X3U A;  2DPD A;  3ZMS A;  4M3B A;  3CES A;  1OYW A;  3FXM A;  4YIR X;  4AIH A;  4L0Y B;  4C9Y A;  4KFC A;  3VFZ A;  4TV7 A;  4L9T A;  2F2E A;  3I58 A;  2RC4 A;  5E3L A;  2OTJ I;  3KX2 A;  2NS7 A;  2FSW A;  5EYR A;  4Y7N J;  2JK3 A;  5CKT A;  1IV8 A;  2UXN A;  4HX7 A;  4NUB A;  1F9N A;  1JT6 A;  2JWT A;  4IO9 F;  2NRA C;  1LDK B;  2VT2 A;  5J8F A;  3I59 B;  1EV7 A;  5CQE A;  4HQE A;  2JQ7 A;  4F55 A;  2HVS A;  3W3C A;  2FOK A;  2CW7 A;  4ZJZ A;  2ZJR F;  2OU2 A;  4CZZ A;  3AG4 H;  1KGS A;  2LYC A;  3FZV A;  1XGN A;  4XLH A;  2EFW A;  3A2K A;  4MQ9 F;  1QVU A;  3Q3S A;  4MTD A;  2KHM A;  1WZ2 A;  2VJI A;  3G1O A;  1ZKG A;  1E3P A;  2HYJ A;  3A02 A;  2V6C A;  5J3L A;  1XGM A;  2HQN A;  2IGM A;  4NC8 A;  1O7L A;  2KQR A;  2IAI A;  2L4A A;  2R7F A;  3H1C A;  4RDU A;  1BN5 A;  3LA3 A;  2HOA A;  1QBJ A;  2WY8 Q;  1D1C A;  4BKX A;  1VQ8 I;  4C3H J;  1K61 A;  1AA7 A;  3MCZ A;  4NC7 A;  1HDD C;  1GXQ A;  3SEZ A;  2QEN A;  3BG5 A;  1G3S A;  4L9N A;  1I27 A;  3O8H A;  1VQP I;  4HST A;  1MJB A;  2JPB A;  4LMY A;  1X1D A;  1HF0 A;  4WX9 A;  1RKW A;  1LQ1 A;  1EKE A;  1RUN A;  3F22 A;  2DFI A;  1I3A A;  3TDZ C;  1G3T A;  1ODD A;  2EIN H;  3SHF A;  4L18 B;  3QWL A;  3MZ8 A;  4E7K A;  1IRZ A;  4UUS B;  3QOD A;  3LQQ A;  3W2W A;  1SMT A;  4DQ2 A;  2ECC A;  4BY7 J;  4A3G J;  5K7F A;  2DJN A;  4OOI A;  3BZC A;  3GTJ J;  4M6V A;  4UV9 A;  5BS6 A;  2V1N A;  4BDY A;  1BR2 A;  3H92 A;  4HNU A;  1G4D A;  2BXY A;  3H9Q A;  4XOT A;  1TWF J;  2OA4 A;  4YFX F;  4KUM A;  4HDU A;  1W5T A;  5EZG A;  2A5W A;  3HIF A;  1ETX A;  2L54 A;  2O8K A;  1SD7 A;  3L2R A;  5GAH J;  2XRN A;  1KQ8 A;  3GTQ J;  4A5N A;  2E2I J;  4U0W A;  3RPQ A;  1P7I A;  4WXC A;  1Y1W J;  2HOS A;  4MQV A;  4U0V A;  4N0B A;  1QGP A;  4XRS G;  4DW6 A;  2JZY A;  4XLC A;  1W7P A;  3RPU D;  5JVT A;  3F23 A;  3BTJ A;  2K86 A;  3L00 A;  2EZI A;  2XRL A;  5DCM B;  1JKO C;  3G4S I;  1MBG A;  2A61 A;  2EB7 A;  3O6B B;  4KN4 X;  4F92 B;  2HEO A;  1I1S A;  3L1P A;  1ZR2 A;  3ROU A;  2PEX A;  3GTK J;  1LDJ A;  3FM5 A;  3HXL A;  5F0F A;  3SYT A;  5FGM A;  4A0X A;  2KJB A;  2LMD A;  5LGT A;  4XOP A;  2LRE A;  2P8T A;  4L9J A;  1UB9 A;  4HSR A;  5ILU A;  2FQ3 A;  2Y0M A;  3I53 A;  3UKG A;  1OCP A;  2OQR A;  3B6C A;  1R22 A;  3F6O A;  3H0D A;  2NOG A;  5L3B A;  5E1X A;  1OYY A;  4DGW B;  3HPH A;  3ERE D;  4YIF A;  4FCY A;  1EH6 A;  1KZH A;  2IJL A;  4A3J J;  2VON A;  2PG4 A;  1OCT C;  5ED4 A;  1S29 A;  2IBD A;  3C3W A;  1RPW A;  2E1M B;  2PMZ A;  1RRJ A;  2DDA A;  4I09 A;  2FA5 A;  4AID A;  2L7F P;  2DLL A;  2LY1 A;  2WWY A;  3L2W A;  1VQK I;  2WAQ N;  4MTE A;  3S14 J;  2X51 A;  4P9F A;  2LNB A;  3ZQ7 A;  3PNT A;  2D5V A;  4QPQ A;  3DKY A;  1XSD A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  4XLP F;  4BYY A;  2XAQ A;  5JI6 A;  4EJW A;  3J80 K;  2P5K A;  4R8H A;  5HDK A;  1MGT A;  2W85 A;  4AIK A;  2O61 A;  3R0J A;  2V79 A;  2QBY A;  3L09 A;  4RS8 A;  1U6G A;  1XMK A;  1O3S A;  4CXF A;  2HGC A;  4Q4Z F;  4NHJ A;  5ERI A;  1OMI A;  3R0A A;  5IT3 A;  2QBY B;  3MFK A;  2M30 A;  1IN5 A;  4HYE A;  4KMF A;  2JT1 A;  5H20 A;  2MD5 A;  5FO5 A;  4ETS A;  2DO7 A;  3K9T A;  2FE3 A;  5K5O A;  3T8R A;  1B9N A;  4M71 A;  1WKM A;  3ZMD A;  4M6X A;  4PGG A;  2FU4 A;  3V8L A;  5CVV A;  4ZYG A;  2KIU A;  1XGO A;  5J6X A;  1FYK A;  3K2Z A;  4IVN A;  2A07 F;  1T0F A;  5FB2 A;  3KZY A;  3F72 A;  2PN6 A;  4A0Y A;  1Z9C A;  2HTJ A;  3O3K A;  4MNU A;  2EV0 A;  2PMH A;  1YQA A;  4EV0 A;  4OIO F;  3WE3 A;  3GVA A;  4K2E A;  3SQN A;  2VC0 A;  3ZP5 A;  5D5W B;  2WC2 A;  2CYY A;  2YU3 A;  4BXU A;  4N9I A;  3SZP A;  2MA3 A;  4FHT A;  2Z5U A;  1FBQ A;  2HZT A;  3I4P A;  2FEZ A;  5D8L B;  3LST A;  2DK8 A;  3M1E A;  1BI1 A;  3VOE A;  3WTS C;  3LFK A;  2QLZ A;  2A68 F;  1CF7 B;  4U0Y A;  1EH8 A;  2XAS A;  4LGW A;  2WV0 A;  1FZP B;  4A5M A;  3RKW A;  4OIR F;  1B4A A;  2L3D A;  4E70 A;  2IRF G;  1D8K A;  1XMA A;  2DTR A;  3PQK A;  4HF0 A;  3KEQ A;  5JHU A;  5HS7 A;  1PP8 F;  4AD9 A;  1F5T A;  3BPV A;  2EFO A;  3HOT A;  2Z3Y A;  3B73 A;  3BPX A;  1XN7 A;  1Q1H A;  2EFQ A;  1IUY A;  1XB4 A;  1FLI A;  1BM9 A;  1Z6R A;  3RI4 A;  1TBX A;  1T39 A;  1BOA A;  5D4S A;  4HX8 A;  3MQ0 A;  2BYV E;  1YG2 A;  1UCR A;  1XCB A;  2HS5 A;  3QU3 A;  3KLO A;  2ELH A;  2DQL A;  3FF5 A;  4ESF A;  2QZ8 A;  4OIN F;  2KJC A;  3V8K A;  2R3S A;  1HBX G;  1O3R A;  2XVC A;  3G73 A;  3MZH A;  3F21 A;  1LB2 A;  5DD8 A;  3KE2 A;  1IN6 A;  1YS6 A;  1B59 A;  2GQQ A;  1L3L A;  3LWF A;  1KYZ A;  5A2Q K;  1UHW A;  3BJO A;  1TTY A;  4PZJ A;  3E3V A;  5F6F A;  2ZO4 A;  3FMR A;  4CIC A;  4FX0 A;  4N9H A;  4RGR A;  5D4R A;  3E5Q A;  2M45 A;  5DYM A;  2PLY A;  2FBK A;  5LRS A;  4KN7 X;  2Y48 A;  5HS8 A;  5EEH A;  4QLC U;  2MLK A;  1IRG A;  2H6B A;  1HW5 A;  1D5V A;  3HTS B;  3DEU A;  3FMQ A;  3PFI A;  4A6E A;  1YO5 C;  3EET A;  3J7A O;  3P9C A;  4LLG F;  2PJP A;  1C0W A;  1U8R A;  2PI0 A;  4QWQ A;  2XGX A;  2X4H A;  3H3Z A;  3TO9 A;  3GF2 A;  2ZNZ A;  3S2W A;  3T8T A;  2FBI A;  4WXH A;  5CVR A;  3FXR A;  1Z7U A;  3U9G A;  4ZYD A;  3HHH A;  3CUQ C;  2HYG D;  3LAP A;  1QZY A;  2XKP A;  3KP3 A;  4EM1 A;  2MH2 A;  5CVJ A;  3E6D A;  4FX4 A;  2DAO A;  1SMY F;  1ZLJ A;  5E1Z B;  3GFM A;  3EYY A;  1BI3 A;  1R1V A;  2K27 A;  3CUQ B;  1SFU A;  3WGG A;  1OR7 A;  2ZJ2 A;  2VOO A;  1PUE E;  2HKO A;  4RGU A;  1FBS A;  1T6S A;  5LRR A;  3WG9 A;  5LEJ A;  3L2C A;  4EMS A;  1BIA A;  1U2W A;  5F1R A;  2L01 A;  5E8I A;  4RB1 A;  3WGI A;  4R1H A;  2CG4 A;  2B0L A;  4OU0 A;  1YS7 A;  4WXD A;  4A2U A;  1SD5 A;  1ZYR F;  4GYG A;  4I0B A;  1FPQ A;  1HQC A;  2OQG A;  3GWZ A;  1T2K A;  4MHG A;  2KIM A;  3C18 A;  3FHZ A;  4GYI A;  1J2X A;  2FBH A;  1RIO H;  1J59 A;  3GZ6 A;  3BZ6 A;  4WK8 F;  1VTN C;  3JAM K;  4PGH A;  4I98 B;  2GIV A;  3GEZ A;  5D5X B;  2XKO A;  2E1C A;  3QAH A;  1BI0 A;  5HLH A;  3C7J A;  4FT8 A;  5E17 F;  1V4R A;  3HRS A;  2A69 F;  1JXS A;  5K1Y A;  2OZU A;  2Z99 A;  4HBL A;  3HSE A;  5BQT A;  3GZ5 A;  3M7G A;  2LSO A;  2DQR A;  3DP7 A;  5KVR A;  4KMU X;  5DUI A;  5D6E A;  2F5D A;  1V3F A;  4BNC A;  1LJ9 A;  1R23 A;  2ZFW A;  1O7F A;  3WTV C;  4KIB A;  4P55 A;  1B9M A;  1U78 A;  2P6S A;  3ABT A;  3F8F A;  5ICE A;  3U1D A;  3FXQ A;  2P5L C;  2G7U A;  5CLS A;  3RKY A;  3KP6 A;  5LGU A;  1U5T B;  1TNS A;  3QP6 A;  3WTX C;  3K69 A;  1WQ2 A;  4G6D A;  2DU9 A;  2VE9 A;  1SD4 A;  2V1X A;  1G3Y A;  4OMZ A;  1F1Z A;  5DDG A;  2EA4 A;  3DXJ F;  4I7H A;  1B1B A;  3QP5 A;  3IHU A;  4M72 A;  2ETH A;  4IJA A;  1YW7 A;  1JHH A;  4LG0 B;  4IHT A;  3FMS A;  4RB3 C;  2A5Y B;  4L5J A;  4AIJ A;  4Y13 A;  1DPR A;  1FYL A;  1JGS A;  3E5U A;  4HW0 A;  5D6F A;  2WTE A;  4LLL A;  1XSV A;  2XIG A;  4ESB A;  3R60 A;  4O6J A;  2EK5 A;  3BOQ A;  1J75 A;  3ZPL A;  5FFX A;  3H3U A;  4IRI A;  2ACJ A;  2HKX A;  2X0L A;  3BDD A;  4IXA A;  4RB2 C;  1P6R A;  5BOX A;  1SFX A;  3K0L A;  4HOB A;  2CO5 A;  1NHA A;  2VOP A;  2F5E A;  1CF7 A;  2VBY A;  4A12 A;  3WTZ A;  2RDP A;  2QWW A;  4ZYE A;  3VEP A;  2ISY A;  4XLN F;  3R61 A;  5LLQ A;  3HOS A;  4HF2 A;  1O3Q A;  2MBF A;  3C1D A;  1RI7 A;  1MZB A;  2O6G E;  4KNY A;  3EQL F;  3R6S A;  3F8N A;  2NYX A;  2LKP A;  4D0P A;  2D2W A;  1K79 A;  1S3J A;  2XHK A;  4Z2Y A;  1E17 A;  4KDP A;  3SXY A;  1G6N A;  1W4M A;  3WTW C;  1XDU A;  5HLI A;  1KYW A;  4GO1 A;  1ZN2 A;  1A04 A;  4EJU A;  2L4M A;  4I0A A;  2Z33 A;  1U5T A;  1AWC A;  2W24 A;  2W57 A;  4XBF A;  2JRT A;  1QPM A;  2XAJ A;  3JSP A;  2IA2 A;  4S05 A;  2GZW A;  2P4W A;  3KCC A;  4KYW A;  4LLN A;  3FWE A;  2QQB A;  1LNW A;  3JTG A;  4U88 A;  2PFB A;  3QPT A;  5TJJ A;  4DNC A;  2EJR A;  3V4G A;  1S7O A;  1P4W A;  2VC1 A;  5AON A;  2XV4 S;  3CDH A;  1P4X A;  3G3Z A;  3KFW X;  2P7V B;  2MLG A;  2ESN A;  1QNT A;  3KLN A;  2W84 A;  4UHT A;  3I54 A;  5FLX Z;  1ZG5 A;  3HSF A;  2ZME A;  2RKH A;  4HV6 A;  1WRJ A;  2OBP A;  4RGX A;  2LDU A;  2QQ9 A;  2FF4 A;  3P9K A;  3HTU A;  2RQP A;  2ZCW A;  4ENJ A;  3BJA A;  1YYV A;  4IRG A;  3E5X A;  5H6R A;  3ISP A;  5L3F A;  1FP1 D;  3BY6 A;  1OPC A;  2BE5 F;  2E7X A;  5E8G A;  3DKW A;  1R1T A;  4RB0 A;  3CO6 C;  2ZKZ A;  1IXR C;  5ICC A;  3RDI A;  1FOK A;  5J8C A;  5TRD A;  2AXL A;  2QYO A;  4LB6 B;  3IC7 A;  5HVQ C;  1MJA A;  3RIR A;  3EDP A;  5K5R A;  2QVO A;  2K02 A;  1TQM A;  3TGN A;  3MWM A;  2G9W A;  1YTY A;  1LEA A;  1JE8 A;  2VBW A;  1HW2 A;  1R7J A;  2VT3 A;  5LHH A;  2G7H A;  2L02 A;  5BPD A;  3KEO A;  5FLX K;  1HST A;  1ZRC A;  4ENK A;  5ILV A;  1MDM A;  1FNN A;  4HLX A;  3ZMZ A;  1Z6T A;  3CTA A;  2DT5 A;  2QQA A;  5D5V B;  4GXO A;  1KU9 A;  3BWG A;  4BQA A;  3JTH A;  3WE2 A;  1HW1 A;  1R1U A;  2H27 A;  3GX4 X;  1ZH5 A;  1W5S A;  2FRH A;  1IN8 A;  1UFM A;  1YFH A;  2CFX A;  3IKT A;  3K1P A;  6PAX A;  2XAF A;  1ZAR A;  4Y15 A;  2YPR A;  3Q9V A;  1J0R A;  5L3D A;  5L3E A;  2EFP A;  3E97 A;  1YLF A;  2ZME B;  3LQR A;  3ULQ B;  2K7L A;  3SZT A;  5HS9 A;  3U2R A;  1ZHF A;  3WTU C;  2XAH A;  2Q2E A;  1ZG3 A;  1SFE A;  1GHC A;  1UST A;  3HUG A;  3M8E A;  1TNT A;  2VXZ A;  3RKX A;  5D5U B;  1AOY A;  1ZLK A;  4EGY A;  2IW5 A;  4F7Z A;  4HDV A;  4PCQ A;  1YW9 A;  3JAM Z;  1LVA A;  2KKO A;  4NQW A;  4O5V A;  3Q9S A;  5HLG A;  1O3T A;  4JQF A;  4G7O F;  4M9X A;  3WTT C;  2QUF A;  5HOO A;  3KP7 A;  4Q47 A;  2HFH A;  1MJ9 A;  4U7B A;  1Y0U A;  4BHP A;  4EJO A;  4JK1 X;  1H0M A;  2P7C B;  3V7C A;  1FX7 A;  3IKV A;  1K7A A;  1J7K A;  4MEX F;  2IP2 A;  2M8E A;  3TOB A;  3CUO A;  5L3C A;  2GXB A;  1H9T A;  1K78 A;  1S7A A;  4G6Q A;  1ZRD A;  2OAZ A;  5LHI A;  3V8J A;  1QQI A;  5LBQ A;  2NAZ A;  4O3M A;  2FMY A;  2IA1 A;  3M9A A;  5E1W A;  3P7N A;  4UVA A;  2RN7 A;  4CHU A;  5HDG A;  2BGC A;  1LDD A;  4ESJ A;  3R4K A;  1BBY A;  1FSH A;  4BH9 A;  2YX7 A;  3LAJ A;  2NS0 A;  3CJN A;  1J9I A;  4CDG A;  1YIO A;  4I01 A;  2HQR A;  4HZF A;  1BI2 A;  3D0S A;  3I0T A;  4UVB A;  1L0O C;  3CO7 C;  2FNA A;  2DI3 A;  1SD6 A;  5D8K B;  4GCV A;  4KIF A;  3BP8 A;  4HAM A;  2VN2 A;  3DF8 A;  3PQJ A;  1IRF A;  3K1M A;  3T0Y A;  3ZMU A;  4HQM A;  4YFN F;  2UXX A;  4G7H F;  4KIG A;  3MEX A;  2M1B A;  3OV8 A;  2AS5 F;  2V1U A;  4G9Y A;  1T98 A;  2OZ6 A;  5DUK A;  2CGP A;  1BC7 C;  1DUX C;  3COA C;  1IXS B;  2FML A;  1TQI A;  5CVU A;  1H9G A;  3V7R A;  3HYI A;  1BJA A;  2D1V A;  4RGS A;  1RZ4 A;  1R00 A;  4CYD A;  5BPI A;  4B09 A;  3AAF A;  2LF7 A;  1MD0 A;  3I71 A;  3Q5F A;  1XGS A;  3L7W A;  1IF1 A;  1R36 A;  1ZRE A;  5AIP A;  1Z91 A;  3JSO A;  4LB5 A;  3GXO A;  1Z1D A;  1XCV A;  4LFU A;  3TO7 A;  2Y75 A;  4ENM A;  5IT9 Z;  5A2Q Z;  3HRM A;  3NQO A;  3WU0 A;  1HKT A;  4H0E A;  2M87 A;  3DQV C;  4LK1 F;  1FBU A;  5E20 A;  1FY7 A;  2Q8K A;  3TKY A;  3GLX A;  5ICF A;  2STW A;  1E2X A;  5CYV A;  1HKQ A;  4EVI A;  3MAJ A;  4RAZ A;  3HSR A;  1S6L A;  3KP4 A;  2IVM A;  3REO A;  2GA1 A;  3GO5 A;  2GWR A;  1D8J A;  3RYP A;  1KQ9 A;  3WGH A;  4YFK F;  1WSU A;  1T38 A;  2DBB A;  5FD5 A;  1KU7 A;  4XSZ F;  2H6C A;  1SAX A;  4KT5 C;  5DCF A;  3QU6 A;  1GXP A;  3TO6 A;  1FYM A;  3J81 K;  1BIB A;  1ULY A;  5E18 F;  2H94 A;  1P92 A;  3RJP A;  1DPU A;  3W6J B;  5IT9 K;  2FNP A;  3ZN0 A;  1R5G A;  5LGN A;  2A6H F;  4XRF A;  1R5H A;  3L9F A;  1UHM A;  2RV8 A;  4WF2 A;  2M5W A;  2VBZ A;  4ZZL A;  1DDN A;  1XDS A;  2NNY A;  4Y17 A;  2OD5 A;  2GXG A;  2V1D A;  5H6Q A;  4ON0 A;  2YX4 A;  2PQ8 A;  3ECH A;  2IT0 A;  1IW7 F;  4Q5S F;  3V7S A;  4M9S A;  3I59 A;  3T1B A;  4HX4 A;  2O3F A;  2RGV A;  2MC3 A;  2DW4 A;  2E7W A;  1KQ0 A;  1FWZ A;  4OIP F;  5JR3 A;  4L5I A;  3B02 A;  4L9V A;  3NEU A;  4WWC A;  5F64 A;  3IRR A;  4UVC A;  2DPU A;  1ZGJ A;  2EWN A;  1FP2 A;  2O8X A;  3TQN A;  4ENN A;  4M9Z A;  3K1N A;  1ON1 A;  3TDU C;  4HA8 A;  3RYR A;  1O57 A;  1TLH B;  5KK1 A;  1B6A A;  4KA4 A;  2PBI A;  2A3S A;  4IHS A;  3DPT A;  1HSJ A;  2K4J A;  4CGZ A;  2R7D A;  2CW0 F;  1WI9 A;  5ILS A;  2F5F A;  4PDK A;  2HOE A;  2IA0 A;  1G3W A;  3HRT A;  1I1G A;  4AVP A;  3ZMT A;  1I5Z A;  2D45 A;  4U7D A;  1ZRF A;  4BAY A;  1YW8 A;  2DK5 A;  4G7Z F;  4P5O A;  5CVI A;  4A0Z A;  3LA7 A;  5DEQ A;  5LHG A;  3ELK A;  3DPL C;  4L0Z B;  2COM A;  3F8B A;  3JW4 A;  1R58 A;  4LK0 F;  1W7P D;  3J81 Z;  4EQQ A;  2IPQ X;  2BEO A;  1XSX A;  1RNL A;  4RAY A;  5LEK A;  1ONV A;  2EV5 A;  4HF1 A;  2EFN A;  3RPU A;  4ZYH A;  1OKR A;  1DP7 P;  2QM3 A;  3DV8 A;  1ZG1 A;  3I64 A;  3WU1 B;  1I6X A;  4LD5 A;  5ICG A;  2A6E F;  3ZMV A;  4EJV A;  2TDX A;  1HXD A;  3SFZ A;  3D5L A;  3KZZ A;  2JSC A;  4UUV A;  4BHC A;  2F5C A;  3M8F A;  2HWV A;  4MGR A;  4A6D A;  3F8C A;  2YSR A;  4S04 A;  2HDC A;  3DFG A;  1IN4 A;  3BJ6 A;  4UV8 A;  4ZZD A;  3GFJ A;  3N97 A;  1U3E M;  5K5Q A;  3ECO A;  3CLO A;  3FX3 A;  3J80 Z;  2O03 A;  2RNJ A;  3GYH X;  3ML6 A;  2XAG A;  1TQP A;  3F6V A;  3EYI A;  3LA2 A;  3FM3 A;  2ESH A;  4YII A;  5FFZ A;  3KP5 A;  3QPH A;  4MEY F;  2JTV A;  3W6K B;  4EGZ A;  2UWM A;  1STZ A;  3CUQ A;  1EH7 A;  2HTS A;  2CSO A;  4BHB A;  1MDM B;  1ZAO A;  2UZK A;  4GGG A;  2PMU A;  1KA8 A;  1IN7 A;  4IRH A;  1FSE A;  1LEB A;  5FD6 A;  2STT A;  1W7P B;  4LJZ F;  2MH9 A;  4HV5 A;  3IL2 A;  4JBA A;  1ON2 A;  3BRO A;  4ASN A;  3E6M A;  2BV6 A;  2XUB A;  4EM0 B;  4EM2 A;  2HR3 A;  1IZ1 A;  3KP2 A;  3MZY A;  2P6T A;  2YR2 A;  2LF8 A;  3NRV A;  1REP C;  4UXN A;  2GA2 A;  2RVC A;  2VE8 A;  3GW2 A;  3F8M A;  2CWE A;  1OYI A;  1QZZ A;  3HHG A;  5AIQ A;  4KIC A;  4G94 A;  1S8N A;  4ZH4 F;  5CJ9 A;  4CO8 A;  1Z05 A;  1PDN C;  3IWF A;  2ZXJ A;  4NB5 A;  2O0Y A;  3F3X A;  1HKS A;  1GVJ A;  2W25 A;  2CQK A;  5DCM A;  3OOP A;  1P2F A;  3TOA A;  1WWX A;  2KRF A;  3RTR A;  2JPC A;  1PP7 U;  4YG2 F;  4XSX F;  2C6Y A;  3KET A;  2ZNY A;  1K6O A;  3FXU A;  4WCG A;  3GFL A;  3ABU A;  2J5P A;  3HRU A;  3N4M A;  5HDN A;  2FXA A;  1JHF A;  4I02 A;  4Q48 A;  5BMZ A;  1FT9 A;  1TW2 A;  3P9I A;  3ZN1 A;  1MKM A;  2Z9O A;  4G8X A;  2NNN A;  4M6Y A;  1ZGA A;  4I2O A;  2VBX A;  1USS A;  2KIF A;  3I5U A;  1F4K A;  1IAW A;  1TW3 A;  4M73 A;  4IPA A;  2XRO A;  2HYF A;  4P96 A;  3IRQ A;  5L3G A;  4OMY A;  2Q0O A;  2VOD A;  1BC8 C;  1D3Y A;  3VB2 A;  3EUH A;  1XD7 A;  3IWZ A;  4B8X A;  2D1H A;  3QOP A;  1QO0 D;  3GFI A;  4UNO A;  4IF4 A;  3T5X A;  1RUO A;  4AWX B;  1P4A A;  3VOD A;  3GUD A;  3QRF F;  1K78 B;  5DD4 A;  1FC3 A;  3E6C C;  2V9V A;  4EJT A;  1IXC A;  2E1N A;  1CGP A;  1J5Y A;  2ISZ A;  2EV6 A;  2P5V A;  2J5O A;  2EA2 A;  3WTY C;  4R79 A;  2GAU A;  4LG0 A;  4HLY A;  2K4B A;  5DV5 A;  5JFR A;  1U5T C;  2BBY A;  1KU2 A;  3E6B A;  2ZBK A;  4M74 A;  2H09 A;  3O2P E;  4P9U A;  2ADU A;  1KU3 A;  5EEG A;  3WOD F;  1X3U A;  2DPD A;  3ZMS A;  1OYW A;  4AIH A;  4L0Y B;  4KFC A;  3VFZ A;  4TV7 A;  4L9T A;  2F2E A;  3I58 A;  2RC4 A;  2FSW A;  2UXN A;  4HX7 A;  1F9N A;  2NRA C;  1LDK B;  2VT2 A;  5J8F A;  3I59 B;  1EV7 A;  4HQE A;  2FOK A;  2OU2 A;  4CZZ A;  1KGS A;  3FZV A;  1XGN A;  2EFW A;  4MQ9 F;  4MTD A;  2V6C A;  1XGM A;  2HQN A;  1O7L A;  2L4A A;  2R7F A;  1BN5 A;  3LA3 A;  1QBJ A;  3MCZ A;  1GXQ A;  2QEN A;  1G3S A;  4L9N A;  1I27 A;  1MJB A;  2JPB A;  4LMY A;  4WX9 A;  1LQ1 A;  1RUN A;  3F22 A;  2DFI A;  3TDZ C;  1G3T A;  1ODD A;  3SHF A;  4L18 B;  3LQQ A;  1SMT A;  4DQ2 A;  4OOI A;  4UV9 A;  5BS6 A;  3H92 A;  1G4D A;  2OA4 A;  4YFX F;  4KUM A;  4HDU A;  1W5T A;  3HIF A;  2L54 A;  1SD7 A;  2XRN A;  1KQ8 A;  4A5N A;  4U0W A;  3RPQ A;  4WXC A;  4MQV A;  4U0V A;  4N0B A;  1QGP A;  2JZY A;  1W7P A;  5JVT A;  3F23 A;  2K86 A;  3L00 A;  5DCM B;  2A61 A;  2EB7 A;  3O6B B;  4KN4 X;  2HEO A;  1I1S A;  3ROU A;  2PEX A;  1LDJ A;  3FM5 A;  4A0X A;  5FGM A;  2KJB A;  5LGT A;  4L9J A;  2P8T A;  5ILU A;  1UB9 A;  2FQ3 A;  2Y0M A;  3I53 A;  2OQR A;  1R22 A;  3F6O A;  5L3B A;  5E1X A;  1OYY A;  3ERE D;  4YIF A;  1EH6 A;  2IJL A;  2VON A;  2PG4 A;  5ED4 A;  1S29 A;  3C3W A;  4I09 A;  2FA5 A;  2DLL A;  2WWY A;  4MTE A;  4P9F A;  2LNB A;  3ZQ7 A;  1XSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...