3Q5FA

Crystal structure of the salmonella transcriptional regulator slya in complex with dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator slyA
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transcription/dna
total genus 48
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q5fA00
4HW0A 2FSWA 1WWXA 4RS8A 4BXUA 3QU3A 3ROUA 3WGIA 3ZMVA 4A0XA 1TQMA 5D6EA 1QGPA 2PI0A 1ZRDA 2MLKA 3FXQA 5IT9K 2BEOA 3CJNA 3Q9VA 1F9NA 1P6RA 2QQ9A 4K2EA 2IW5A 5J8FA 5LLQA 4I09A 1FOKA 4ENKA 3TDZC 1REPC 2VE8A 3HRUA 3KETA 1RUOA 4IRGA 4FX4A 3QP6A 2K4BA 3JTHA 2VE9A 4LG0A 3RYPA 2ZMEA 4ZH4F 2ISZA 4LG0B 2ZMEB 3QPTA 2P5KA 1UCRA 4OIPF 3ZP5A 2Z5UA 3H3ZA 4YG2F 4L5IA 4U0VA 3EYIA 2ZO4A 1F5TA 1B59A 2KIMA 2FU4A 2DFIA 5BPDA 2KRFA 3WTXC 1DPRA 5A2QZ 4WWCA 2UZKA 4LJZF 3H92A 5ICGA 2ACJA 1G3SA 4G7OF 4KN4X 3BJAA 2PFBA 1HBXG 1LVAA 2VN2A 4ZZLA 2D1VA 2H09A 2GZWA 4IRIA 4LK0F 2C6YA 2HTJA 2Q8KA 1FYKA 1XB4A 1HSJA 2HYFA 1FLIA 1EH6A 5D5WB 5JI6A 1R00A 3GLXA 1P4AA 1G6NA 4Q4ZF 1YLFA 4WXCA 3WU0A 1V4RA 3AAFA 5J6XA 1FX7A 3GFMA 5E8IA 4I2OA 4IXAA 2G7UA 1GXQA 3O2PE 2H27A 3T1BA 4ASNA 3L9FA 4JK1X 3M9AA 1KGSA 4ZYGA 2CWEA 3I5UA 1J75A 1A04A 4RGSA 1RIOH 2ELHA 1R1TA 1QZYA 2W24A 3TO7A 3ABUA 3BZ6A 3CTAA 3G3ZA 1B1BA 3V8LA 3LA2A 4JBAA 1FYMA 1MZBA 2HZTA 3N97A 4BH9A 2VOPA 1FBSA 5J8CA 4LLNA 1IN4A 2IP2A 3MFKA 5HLGA 4MEXF 3I0TA 5HS8A 3HOSA 1LDJA 1J9IA 3RIRA 4PGGA 3RKXA 2EV5A 4HQEA 2WC2A 1ZN2A 1JHHA 1U5TA 1DDNA 4KNYA 2DT5A 3PFIA 4M71A 4CZZA 1K6OA 1CGPA 4AVPA 1O3RA 5D4RA 3KP7A 1Z1DA 5K5RA 2CSOA 2ESHA 3I54A 2XAQA 4R79A 4IHSA 5FB2A 2OA4A 4P96A 4ETSA 1J5YA 1ZG1A 2GXBA 1BN5A 2ISYA 2XVCA 5ILVA 3FMQA 3KCCA 2RQPA 2VC1A 2NNYA 1XGMA 4GCVA 3T0YA 3R0AA 5IT3A 2DK8A 3FM5A 1U5TC 1UB9A 2XASA 3QAHA 3FMRA 1TNSA 4HF0A 3LQRA 1SMYF 1TNTA 1FPQA 2J5PA 4P55A 3F8BA 1Q1HA 3K1PA 4ESBA 1R36A 2D1HA 2EFWA 4IHTA 3CUQC 1K7AA 2L54A 1FSEA 4WK8F 1YS7A 2HFHA 3D5LA 1ZH5A 5DD8A 4N9IA 1YFHA 4EV0A 4OMYA 5L3CA 2RVCA 1I1GA 3Q5FA 4YFXF 2ZKZA 5FD5A 4IJAA 1RNLA 2IVMA 1T39A 1SD6A 1R22A 5LHGA 3GVAA 2QM3A 1ZARA 3GFJA 4M6XA 2HS5A 2DW4A 3K9TA 4O5VA 4KMFA 3FXUA 4EJTA 4UVCA 2D45A 4KIFA 4KDPA 3F23A 1BC7C 4UVBA 1G3YA 4Q47A 3ECOA 1KU3A 3E6DA 4RB2C 2RNJA 3IHUA 5FD6A 1PP7U 4GYGA 4MTEA 4WXHA 1OMIA 3F22A 2DK5A 5ILSA 5ICCA 1FP1D 1FWZA 3KP6A 2OQGA 3FZVA 1B4AA 2CQKA 1OPCA 2P5LC 2RGVA 1R7JA 5DCMA 4ESFA 1QZZA 5DCMB 1U8RA 3C1DA 4LB6B 3JAMZ 3FM3A 1KU9A 5DUIA 4P9FA 2EA2A 4L9JA 2YX7A 2ZJ2A 4RAZA 2KIFA 3GFIA 2L3DA 4OOIA 1LDKB 2O61A 3L7WA 3V4GA 5K5OA 4S04A 4BHBA 1BIBA 1MJ9A 3Q9SA 2ZNZA 5LGTA 2VT3A 1B9MA 5FGMA 5LEJA 3KP5A 3CO7C 2XHKA 1KYZA 1YG2A 3F8FA 5D5UB 2Y0MA 3IKTA 3ULQB 3LFKA 1LNWA 1H9TA 4EM0B 2ADUA 1OR7A 4ZYHA 2LSOA 1RI7A 1R5HA 5HDGA 5E1XA 1B6AA 2KJCA 1JGSA 3F8CA 3L00A 2Z3YA 3K69A 3HSFA 3DKWA 4LLGF 3L09A 4AIKA 2A3SA 3H3UA 2XAHA 4ZYDA 1O3SA 4L9VA 5D8LB 4L0YB 2PJPA 1SD5A 2QQAA 5JVTA 3JSOA 1FY7A 4OIOF 1KU7A 1RUNA 1CF7A 3WTYC 2W25A 1CF7B 5ED4A 5L3GA 2XKPA 3K1NA 4DNCA 2K27A 1OYYA 4ZYEA 3WTZA 4ZZDA 3D0SA 4MQ9F 3IC7A 3WE3A 5HDKA 1S7AA 1HSTA 5HLIA 2WWYA 1TBXA 2Q2EA 2HOEA 1XMAA 4U0WA 1SFEA 1LJ9A 1IN7A 1R5GA 3HSEA 2JTVA 5HOOA 2CO5A 3P9KA 5ICFA 2OQRA 5LHIA 1ZREA 3GUDA 5CJ9A 4HBLA 4I0AA 3JAMK 5K5QA 4HX7A 2EFQA 3BOQA 2KJBA 5FLXZ 2VT2A 1K79A 1QBJA 4QLCU 4P9UA 5H6RA 2VBYA 2IPQX 4AWXB 3HRSA 1SFXA 2EWNA 3U1DA 3TO9A 1IF1A 3BPXA 1Z7UA 1LEBA 2J5OA 3M7GA 1ULYA 5E18F 1TQPA 4JQFA 2HDCA 5F6FA 1XD7A 2V1DA 1O3QA 2YSRA 1XCBA 3F6VA 3KP3A 1S29A 1ZG3A 4R8HA 3TO6A 3RJPA 3NQOA 1FNNA 1ZLJA 4A5NA 1BI0A 2XKOA 4XSXF 3IRRA 1D8JA 4DQ2A 2RKHA 2WTEA 1FC3A 2KKOA 4HAMA 4CO8A 3K1MA 5TRDA 3ZMUA 2H6BA 1S8NA 1HKSA 3V7CA 2RN7A 5HVQC 4PZJA 2HEOA 2QZ8A 3E6MA 3W6JB 5CVVA 1I6XA 1L3LA 4LK1F 2LF8A 5ERIA 3S2WA 3DQVC 5CYVA 1FSHA 1YO5C 1EH7A 2FBKA 3I4PA 5AONA 5LRRA 4HF1A 3ZMSA 4CHUA 3VFZA 4LMYA 5L3EA 5DUKA 1QQIA 3HIFA 2W57A 1T6SA 3WTUC 2P8TA 3F8MA 4OMZA 4RB0A 2DBBA 2JRTA 1IAWA 1ON1A 3QPHA 2V79A 4HA8A 2TDXA 2CYYA 1G4DA 3QRFF 2IA2A 2ZBKA 3E5QA 1BM9A 1P92A 2RV8A 1SAXA 2DPDA 4AIJA 1TQIA 1IN6A 4I98B 2E1CA 2Q0OA 2YPRA 3REOA 4LGWA 3GW2A 1KYWA 3RI4A 3ZPLA 2FA5A 5LGNA 4RGRA 3QOPA 4MEYF 1S7OA 2B0LA 1PUEE 4M9XA 2A68F 5EEGA 3IRQA 2JPBA 2F2EA 1ZRFA 3I71A 5HLHA 2L01A 4GXOA 4RAYA 4EVIA 1F1ZA 1I1SA 1G3WA 4G6DA 3ABTA 1KQ8A 3MZYA 4XLNF 4PGHA 4KFCA 1YQAA 2CFXA 2Z33A 1B9NA 1HW2A 3E6BA 3KZYA 4WXDA 1H9GA 2QQBA 1OYIA 1XSDA 2R7DA 4OIQF 2XUBA 1XGOA 1OKRA 1ZGJA 2DQRA 2FF4A 2STWA 5BMZA 1T2KA 4G7ZF 1ZHFA 1YYVA 1U6GA 4YFKF 2V6CA 2QUFA 4IRHA 1IRGA 1T0FA 1TLHB 1WRJA 2L4MA 2PMHA 1LEAA 3DEUA 4YFNF 5ICEA 3FF5A 5E20A 4XSZF 2GXGA 5HDNA 2E7XA 1H0MA 3HRTA 2D2WA 2WV0A 2FNPA 4KYWA 1USSA 4MHGA 2IJLA 1AOYA 5LGUA 4QWQA 4M6YA 5KVRA 3WTWC 1HKQA 4U88A 1OYWA 4MNUA 5A2QK 2VOOA 1LDDA 3R0JA 1J7KA 1U78A 4AD9A 3JW4A 1FP2A 1U2WA 3KZZA 5CVIA 4XBFA 4A0YA 1GVJA 2K7LA 5BPIA 3GZ5A 2V1XA 5DYMA 2P5VA 2A69F 1HXDA 4I01A 3KE2A 1J0RA 3B73A 3U9GA 2YU3A 4L18B 3R60A 4HV6A 4R1HA 5CLSA 2M30A 4GO1A 3T5XA 3O3KA 2Z9OA 1HW5A 1UHWA 3HUGA 3GX4X 2NYXA 4YIIA 3IWFA 2UXNA 4NHJA 3U2RA 1DP7P 2NRAC 3BJ6A 5JHUA 2GQQA 1ODDA 2P6SA 2COMA 2FE3A 2VXZA 1WSUA 1I5ZA 2XAFA 5FFZA 4IF4A 3LA3A 2M87A 2FMLA 5JR3A 4WF2A 4HZFA 5DV5A 1IN8A 2ZNYA 1BBYA 2Y48A 2A6EF 4A6EA 2DU9A 3V8JA 2EFNA 3BROA 3VEPA 1Z91A 4IPAA 1MD0A 3HHGA 1O7LA 4EGZA 5HS9A 2QWWA 2CG4A 4Y13A 4UHTA 5CVRA 4RGXA 3MZHA 4L5JA 2OD5A 2VC0A 4G94A 3OOPA 1BI2A 1IXSB 1DPUA 2KIUA 3KFWX 2EJRA 1QNTA 1SFUA 1E2XA 3WTSC 1KA8A 2DLLA 2GWRA 4ENMA 1MJAA 3BDDA 3B02A 4OINF 2H6CA 1ZLKA 1BC8C 2E1NA 1Z9CA 4Q48A 2NS0A 5L3DA 4I02A 4GYIA 1FYLA 3RYRA 1L0OC 3ZN1A 1EV7A 3LA7A 1Z05A 4U0YA 3T8RA 5D4SA 2P6TA 2ESNA 3HHHA 2EB7A 5F64A 4N0BA 1SD4A 2RC4A 5JFRA 1Y0UA 2FMYA 5CVUA 3KLOA 2O6GE 2DQLA 4HOBA 2QBYA 1IRFA 4RGUA 5H20A 2QBYB 4KIBA 3BPVA 1BI1A 3KEQA 2G9WA 3F8NA 2EK5A 1DUXC 3MAJA 2QLZA 2P7VB 4Z2YA 5FFXA 3VB2A 2O03A 5DCFA 1STZA 2EV0A 4ON0A 5D5VB 3CO6C 5E17F 2HYGD 4UV9A 4EJVA 3RKYA 3GO5A 4FX0A 3FXRA 3LWFA 2RDPA 2BGCA 1SD7A 2XIGA 1E17A 3FMSA 3J80Z 5TJJA 3LQQA 1XDSA 2FRHA 3EUHA 1O7FA 4S05A 2BE5F 1UFMA 3TDUC 2F5FA 2G7HA 4E70A 4RB1A 4EJUA 4OU0A 2LKPA 4Y15A 1V3FA 1UHMA 3PQJA 2JT1A 1USTA 6PAXA 3WGHA 4B09A 1S6LA 4MGRA 3DPLC 1KQ9A 1ZG5A 4UXNA 1XGSA 4PCQA 4UUVA 2VONA 2IA1A 2YX4A 3R61A 2FBIA 5LRSA 3GFLA 1T98A 2NNNA 2HQNA 5FO5A 1YW7A 2M8EA 1D5VA 3F72A 4OIRF 1JHFA 3SZTA 1XGNA 2LDUA 4KUMA 3TOAA 3WTTC 3TKYA 2A07F 3V7RA 2L02A 4A6DA 5E8GA 3VOEA 3HSRA 4EJWA 1GXPA 3F6OA 4BAYA 1J59A 1XCVA 1IW7F 2IA0A 3NRVA 2FOKA 3F21A 1MGTA 2R3SA 4LB5A 4BHCA 4L9TA 3ZMZA 2JZYA 5KK1A 3FX3A 1XN7A 2OBPA 2EFPA 2OAZA 5L3FA 3CUOA 2P7CB 2MH2A 1BOAA 1U3EM 1P4WA 2AS5F 2QVOA 3I64A 3HTUA 3ELKA 4EGYA 5BOXA 3L2CA 3J80K 3LSTA 2DTRA 3JSPA 3EETA 1IXRC 1P2FA 4KICA 5FLXK 2HGCA 3SZPA 3EQLF 1YW8A 4G8XA 3KP2A 4G7HF 1TTYA 4TV7A 4M9ZA 1J2XA 1HKTA 1ON2A 4HLXA 4U7BA 1GHCA 1YIOA 2OU2A 1QPMA 3MWMA 3IL2A 1W4MA 4KN7X 4HF2A 4YIFA 3SFZA 3G73A 3ERED 3BY6A 2ZXJA 2HQRA 2ZCWA 2W85A 1PP8F 5HS7A 2EV6A 1QO0D 2DI3A 2MH9A 1IXCA 2XAGA 2O0YA 4A0ZA 1BJAA 3M1EA 2O8XA 5L3BA 2CW0F 3WTVC 1IZ1A 1D3YA 3QU6A 4BHPA 1W7PA 1XDUA 3WU1B 1W7PB 1NHAA 3P7NA 1TW3A 4EM2A 2PEXA 3BJOA 1YW9A 3BWGA 2MBFA 1EH8A 3QP5A 4EM1A 2A5YB 2K86A 4UVAA 2VBXA 2HKOA 4HLYA 2XROA 1YTYA 1IUYA 3VODA 5F1RA 3M8EA 1ZAOA 3LAJA 2PBIA 1BIAA 3DV8A 1FZPB 1PDNC 5DDGA 2PG4A 2IT0A 3SQNA 3COAC 5LBQA 4M74A 2JSCA 1ZRCA 1HQCA 1U5TB 4P5OA 4B8XA 2OZ6A 2VODA 4O3MA 3C7JA 5D5XB 3FHZA 4G9YA 3KLNA 4HDVA 2V1UA 4A12A 2A6HF 4M72A 4HX4A 3DXJF 3CUQA 2A61A 4FHTA 3CUQB 2BV6A 2LNBA 3RPQA 1KU2A 1ZGAA 3ECHA 2XGXA 3RDIA 1X3UA 1MDMA 2L4AA 2MLGA 1MDMB 3ML6A 4Y17A 2Z99A 2MD5A 2F5DA 3O6BB 5D6FA 4IVNA 1LB2A 2YR2A 4M9SA 3HOTA 4I7HA 3K0LA 5EEHA 2LF7A 4UNOA 4N9HA 4O6JA 5BS6A 3W6KB 3JTGA 1WKMA 2GIVA 5E1ZB 3RKWA 5K1YA 3R4KA 5H6QA 3J81Z 4RB3C 2GAUA 2XRNA 3T8TA 4NB5A 1MJBA 4BYYA 4EMSA 2FQ3A 3IKVA 3MEXA 1FBQA 2CGPA 1K78A 2XAJA 3TOBA 1K78B 1ZYRF 2JPCA 2PMUA 2MC3A 2HWVA 5AIPA 2STTA 2BBYA 3HYIA 1AWCA 3ZMTA 2E7WA 3I58A 3R6SA 4EQQA 1Z6RA 3P9CA 4LFUA 2MA3A 4EJOA 4HX8A 1VTNC 3DP7A 4KT5C 1C0WA 4ESJA 3J7AO 2UWMA 4U7DA 4UV8A 3M8FA 2H94A 3NEUA 2EA4A 5AIQA 2F5EA 2HR3A 1RZ4A 1W7PD 4XRFA 2M45A 2FNAA 2X0LA 5E1WA 2EFOA 3WG9A 2GA1A 3I59A 1FBUA 3I59B 3E5XA 4L9NA 4LLLA 3EYYA 1XMKA 1W5SA 3C3WA 4WCGA 4I0BA 1WQ2A 3DFGA 3WGGA 1JXSA 3WE2A 2X4HA 1S3JA 2QYOA 3PQKA 4HYEA 4H0EA 4BNCA 2HTSA 4KIGA 1WI9A 1R1VA 3P9IA 2DAOA 4HV5A 4XLPF 1O3TA 3CDHA 3V8KA 4CICA 1XSVA 5D8KB 1P4XA 1JE8A 3KP4A 3ISPA 1HW1A 4KMUX 3SHFA 3J81K 2VBZA 3E6CC 3CLOA 3LAPA 3ZN0A 1ONVA 4MTDA 2HKXA 4LD5A 4BQAA 5ILUA 1W5TA 3HTSB 1SMTA 2Y75A 5BQTA 2K4JA 2PQ8A 2FEZA 4CXFA 2P4WA 1T38A 2XV4S 1I27A 5LEKA 5DEQA 1F4KA 3MQ0A 3E5UA 1LQ1A 1TW2A 3MCZA 4NQWA 3I53A 4CGZA 1MKMA 4A5MA 2DO7A 1G3TA 4AIHA 4HDUA 2UXXA 3IWZA 4M73A 1YS6A 2V9VA 5IT9Z 4CYDA 3GXOA 4KA4A 3GZ6A 1R1UA 2M1BA 4ENJA 2FXAA 3F3XA 3TGNA 1R23A 3V7SA 4FT8A 3RPUA 4GGGA 1D8KA 4ENNA 2NAZA 2O3FA 4A2UA 3DF8A 4WX9A 4MQVA 3GWZA 2IRFG 1IN5A 3KEOA 2W84A 2FBHA 1O57A 3FWEA 2VBWA 2F5CA 3BP8A 2DPUA 3E97A 2QENA 3ZMDA 2PN6A 5CVJA 1BI3A 2PLYA 4D0PA 4L0ZB 1R58A 3SXYA 2GA2A 3EDPA 3DPTA 4CDGA 3GYHX 2R7FA 3K2ZA 3ZQ7A 3E3VA 1XSXA 4F7ZA 3GEZA 3HRMA 3N4MA 3C18A 5DD4A 1FT9A 1KQ0A 4G6QA 3GF2A 4HQMA 4PDKA 2ZFWA 3OV8A 2AXLA 5LHHA 2M5WA 4Q5SF 2ETHA 2K02A 3TQNA 2BYVE 3WODF 3RTRA 1Z6TA 2OZUA
chains in the Genus database with same CATH superfamily
3GTJJ 3UKGA 2W4SA 4HW0A 3DCFA 4X6AJ 2NVYJ 3S1RJ 2XC7A 2FSWA 1WWXA 4RS8A 2X6WA 4BXUA 1B72B 3QU3A 2DMQA 2M0CA 3ROUA 3TMOA 3WGIA 3ZMVA 4A0XA 1TQMA 5E3MA 1TWFJ 5D6EA 1QGPA 2BY1A 2LBFA 4JOMA 2EPFA 3GTMJ 2DMPA 2PI0A 5FLVA 3PNTA 4W1UA 2AQEA 3HGYA 4XM3A 1ZRDA 2MLKA 3FXQA 1VQ7I 1NH3A 5IT9K 5JLWA 1MSFC 2DA4A 4ZDPA 1P9QC 4ZC3A 2W48A 2WAFA 2CV0A 1EKEA 2BEOA 3CJNA 3Q9VA 4QPOA 1F9NA 1P6RA 2QQ9A 4K2EA 1ZGWA 2IW5A 5J8FA 5LLQA 3AKZA 4I09A 1GV2A 3SEQA 4XKCA 1FOKA 4ENKA 3PJRA 3FXLA 1BW6A 1TWGJ 3TDZC 1REPC 2VE8A 3JRCA 3CCMI 3CDIA 3HRUA 4CSWA 3JRAA 2IAIA 3KETA 3H9GA 1RUOA 3CCLI 1W5CC 1Y6IA 2E2IJ 2LP0A 4IRGA 4FX4A 3QP6A 4IOCF 2K4BA 3JTHA 1K83J 1MMGA 4AYBA 2VE9A 2FX0A 2LREA 3BTLA 2ZMEA 3NWSA 4JYKA 4LG0A 2E19A 3RYPA 4ZH4F 1R49A 2ISZA 1YRNA 4LG0B 2ZMEB 2P0WA 3QPTA 2P5KA 3QYEA 1UCRA 1YRNB 4OIPF 4XONA 3H3VK 1X1AA 3ZP5A 3BG6A 3RZOJ 1ETOA 2Z5UA 3H3ZA 2BW3A 4YG2F 4L5IA 4U0VA 3CMMA 3H36A 3I3LA 2XF5A 2ZO4A 2R7QA 3KZIC 4FETA 4XORA 3EYIA 1F5TA 4UB6C 1YJNI 2LRDA 1B59A 2KIMA 2FU4A 1UZCA 2DFIA 4CCMA 2AXTC 2R5ZA 5BPDA 2W1OA 2KRFA 3K4BA 3WTXC 1DPRA 1AA7A 5A2QZ 4WWCA 2UZKA 4LJZF 3H92A 2E1OA 5ICGA 2DT7B 2ACJA 1G3SA 3SDGA 2VQHA 3ZQFA 4G7OF 2CMPA 4KN4X 3BJAA 2IS2A 2PFBA 1HBXG 2OUMA 1MBEA 4AC0A 3RPUD 1LVAA 3W3CA 5KNLA 5FJ8J 2VN2A 2VKDA 4ZZLA 2D1VA 2H09A 3BCAA 3OYHA 2B63J 2GZWA 4IRIA 4LK0F 2C6YA 3S2DJ 2W7NA 4Y52J 4AIDA 2FQ4A 2HTJA 2QKLB 3P5JA 2Q8KA 2Y0SA 3BG5A 1ETYA 1RESA 2OTLI 1FYKA 2ECCA 5FKLA 2JA7J 2JA5J 1XB4A 1YHQI 1HSJA 2HYFA 1FLIA 1EH6A 3OYNA 5D5WB 5JI6A 1R00A 4F91B 1XG1A 3ZGKA 2JSPA 3GLXA 1P4AA 1G6NA 3S93A 4E7HA 2R7SA 2MC4A 2PJRA 5F0HA 2PJRB 3BLYA 4Q4ZF 1D5YA 4B44A 1YLFA 4WXCA 3WU0A 1V4RA 3V42A 2BZTA 3AAFA 4IZZA 5J6XA 1T8IA 1FX7A 2DA6A 4BQOA 5M3MJ 2NXNB 4HRIA 3GFMA 5E8IA 4I2OA 4IXAA 2G7UA 5M5WJ 1GXQA 3O2PE 2H27A 3T1BA 2O9LA 4ASNA 3L9FA 4JK1X 2WAEA 3M9AA 3HOZJ 1KGSA 4ZYGA 2CWEA 3I5UA 5EJCA 4BS9A 4BACA 2DFHA 1N75A 1J75A 1A04A 2TCTA 4A3MJ 4RGSA 3HDDA 3QQAA 1RIOH 2ELHA 4W97A 2DDBA 1A31A 1R1TA 2CQNA 1QZYA 1ZTRA 2W24A 3G1OA 3TO7A 3ABUA 3HM5A 3BZ6A 3CTAA 3OOUA 3G3ZA 1BOBA 5JLXA 1B1BA 3CF5F 1FIAA 3V8LA 3LA2A 4JBAA 1VQLI 1FYMA 1MZBA 2HZDA 2HZTA 2V9KA 3VYUB 3N97A 1I3AA 4BH9A 2VOPA 5F0FA 1FBSA 2DYSH 5J8CA 4LLNA 1IN4A 2IP2A 3MFKA 1QU3A 2LTPA 2XGDA 1UJ8A 4BQQA 5HLGA 4MEXF 3I0TA 2DMTA 5HS8A 2VQCA 1PYVA 3HOSA 1LDJA 4D5CA 3K4MA 3RIRA 1J9IA 4PGGA 3HKZN 3ONQA 3RKXA 2EV5A 2XF6A 5C4XJ 1UG0A 4RAFA 4HQEA 2WC2A 3G1MA 1ZN2A 2QGUA 3MVPA 1HCRA 1JHHA 1U5TA 1DDNA 2VKHA 2GOMA 2M34A 4KNYA 2DT5A 1QHGA 3K4JA 1MIJA 3PFIA 3ZQIA 4A93J 4M71A 4II2A 2HU9A 3D1NI 4CZZA 3LFUA 3KYDB 4U87A 3HL2A 1K6OA 3S16J 1CGPA 4AVPA 3WHCA 5D4RA 1O3RA 3KP7A 1Z1DA 1JUSA 4B48A 2BVMA 5K5RA 2CSOA 2ESHA 3I54A 5M5XJ 3CMAI 2XAQA 4NNJA 4R79A 2EIKH 1VQKI 4IHSA 3GTQJ 2ID6A 2GM4A 5FB2A 3BTIA 1XC5A 4CCKA 2OA4A 4P96A 4ETSA 1J5YA 2XF7A 1ZG1A 2GXBA 2KFDA 1BN5A 2FUG2 2ISYA 2XVCA 1JT0A 5FKKA 5ILVA 3FMQA 3KCCA 2RQPA 3W2AA 3H9QA 2VC1A 2NNYA 1XGMA 2MYSA 4GCVA 2L9RA 3HOYJ 3T0YA 3BG3A 3R0AA 5IT3A 2DK8A 3FM5A 1U5TC 2L5QA 1UB9A 2XASA 4C30A 1GUUA 3QAHA 3GZNB 3FMRA 2VPRA 1TNSA 3OMYA 1WJCA 4HF0A 3K70C 2I5UA 1MMAA 3PUFA 3LQRA 3MKYB 3GTPJ 1SMYF 1TNTA 1NG6A 1FPQA 2J5PA 4Z6YA 3FBIB 4P55A 3F8BA 1Q1HA 3K1PA 4ESBA 1R36A 4AM3A 2D1HA 2JWTA 3OYLA 2EFWA 4IHTA 2DTZA 1MBFA 4ITVA 3CUQC 2Y9ZA 4BE0A 1K7AA 3CCJI 2L54A 3D5SC 3C2BA 4LIUA 1BR2A 1FSEA 4WK8F 4E7KA 3F0CA 1YS7A 2HFHA 3BG9A 3JREA 3D5LA 4QPQA 1ZH5A 5DD8A 1ORKA 4N9IA 1YFHA 4XLAA 4XOTA 4EV0A 3JRIA 4OMYA 5L3CA 2RVCA 1SVLA 5DS9A 3FBNB 3AG4H 4GRIA 1I1GA 3PSIA 3Q5FA 3ABMH 4YFXF 2ZKZA 5FD5A 4IJAA 1RNLA 5B1BH 2E71A 3OYMA 3HG9A 3FXKA 2IVMA 2Z1DA 3A1YA 1T39A 1SD6A 1R22A 5FRNA 2L7FP 2L7ZA 1QZEA 3M07A 1ZR2A 5LHGA 3GVAA 2QM3A 2VI6A 2BHYA 1ZARA 3GFJA 4M6XA 2HS5A 1B8IA 2DW4A 3K9TA 5C44J 4YELA 4O5VA 2XSDC 1B8IB 1QA6A 1WVRA 3S3NA 4KMFA 3J7AY 3FXUA 3DLLF 4FQGA 4EJTA 1OLTA 2VPLA 4UVCA 3X2QH 4RA2A 2IGKA 2D45A 4KIFA 1W1WE 1A35A 3S15J 3GBGA 4KDPA 4IHVA 3F23A 1BC7C 4UVBA 2M2EA 2M8GX 1ERDA 1G3YA 3OIOA 4Q47A 2CUZA 3KX2A 3ECOA 1KU3A 1ZR4A 3E6DA 1N78A 4RB2C 4XLFA 2RNJA 1RETA 3IHUA 5FD6A 2K9MA 1PP7U 4GYGA 3EPZA 4MTEA 4WXHA 3BC8A 3OIPA 3G71I 1OMIA 2KQRA 3F22A 2DK5A 5ILSA 5ICCA 1FP1D 1FWZA 2DOAA 3GCMA 2OQGA 3KP6A 2VKEA 3FZVA 3OY9A 1B4AA 2CQKA 1OPCA 2A6TA 4BJTA 3LSHA 2L2OA 2P5LC 1YIJI 1FTTA 2RGVA 1WZ2A 4A3LJ 1P7IA 2K40A 4LITA 2JA8J 4NC7A 4RM3A 1R7JA 1V54H 3LMMA 2CQXA 5DCMA 4ESFA 1QZZA 3OL4A 3VYRB 5DCMB 3L1PA 3OS0A 1U8RA 3C1DA 4LB6B 3JAMZ 3FM3A 1KU9A 1NK2P 5EYRA 1H89C 1LUJB 4CYCA 5DUIA 1BR4A 1YOVB 4P9FA 4CYCB 1S72I 2EA2A 4L9JA 2YX7A 2ZJ2A 4RAZA 2LR8A 2KIFA 2VL8A 4DIQA 3GFIA 2L3DA 1R71A 4OOIA 1LDKB 2O61A 1TT5B 3L7WA 3S2HJ 3V4GA 5K5OA 4DYCA 3J7YJ 4S04A 5F0CA 4BHBA 2E35A 2M4GA 1SANA 3AG3H 1BIBA 2QQ8A 5H2FC 3KPHA 2JJ7A 3CQZJ 1MJ9A 5E79C 2B9SA 1WJAA 3Q9SA 2ZNZA 3TL4X 5LGTA 2VT3A 1B9MA 3FISA 5FGMA 5LEJA 3KP5A 2CV2A 3CO7C 1T08B 2XHKA 1KYZA 1YG2A 2XAUA 3F8FA 4E7ZA 2Y0MA 2Z16A 4MLOA 5D5UB 3IKTA 3ULQB 3LFKA 2EZIA 4UB8C 4ZDOA 1LNWA 1H9TA 1ACIA 2QSHX 3QYFA 5HNFA 4EM0B 2ADUA 1OR7A 1MH4A 4ZYHA 2LSOA 2RNGA 1RI7A 1VQ6I 1R5HA 2L7MP 5HDGA 5E1XA 1B6AA 2KJCA 1DQUA 1JGSA 4IQJA 2WA0A 3F8CA 3L00A 3OYCA 2Z3YA 3ABLH 1XMXA 3K69A 3BQZA 3HSFA 4CCJA 3DKWA 1IRXA 2LG4A 4LLGF 3L09A 2JA2A 1MW7A 4AIKA 2A3SA 3H3UA 1RRJA 2XAHA 4ZYDA 4DGWB 1O3SA 1R4NB 4L9VA 5D8LB 2R92J 1TP4A 4JX5A 4C2MJ 3LSPA 4L0YB 2PJPA 1VQ5I 1SD5A 2QQAA 5JVTA 5DTDA 3JSOA 3J7ZI 2GBYA 1FY7A 4XN0A 1VQ9I 1MH3A 1KU7A 4OIOF 1RUNA 4ZTFA 1CF7A 3WTYC 2W25A 2OCEA 1CF7B 5ED4A 5L3GA 2XKPA 5F27A 3K1NA 4DNCA 3VSKA 1Z3YA 3L2UA 2K27A 1OYYA 2VJ4A 2ZSHB 4ZYEA 3OWTA 3WTZA 3S3OA 2EILH 3D0SA 4ZZDA 4MQ9F 2BOLA 4KITB 3IC7A 3WE3A 5HDKA 1S7AA 3PUBA 1HSTA 5HLIA 2WWYA 2LY9A 2RREA 1TBXA 3H1CA 1SAUA 4QTRA 2Q2EA 2HOEA 2DYRH 2CUJA 2BY0A 2Q2EB 1XMAA 4U0WA 3HPGA 2HDWA 3DBLB 1SFEA 1LJ9A 1IN7A 1R5GA 3HSEA 2DT6A 2JTVA 5HOOA 2CO5A 5E3OA 3P9KA 3L2VA 5ICFA 2XPWA 1I39A 2AQFA 2OQRA 2ICWG 5LHIA 1ZREA 3GUDA 5CJ9A 4HBLA 3ZXSA 3ZQQA 2EIJH 1VQ4I 4I0AA 3ZCOA 3JAMK 5DM6F 1DU0A 2XRLA 2WBMA 5K5QA 4HX7A 4B4CA 2EFQA 3FK6A 3BOQA 2KJBA 1FMVA 5FLXZ 2VT2A 1K61A 2NVTJ 3IH2A 3UNGC 1U9OA 1K79A 2UV1A 3HC7A 1QBJA 4QLCU 3QWLA 2XB5A 4P9UA 5KCMA 2JVGA 5H6RA 1HA8A 2VBYA 3IP4B 2IPQX 4AWXB 3HRSA 4FTHA 1RPWA 2R7TA 1SFXA 2EWNA 3U1DA 3TO9A 1A5JA 1IF1A 3BPXA 1Z7UA 2H8RA 2KMUA 1MBKA 3OSGA 1LEBA 2J5OA 1F36A 2OJED 4E7LA 3M7GA 1X4PA 1ULYA 5E18F 4BXFA 4IL6C 1TQPA 4XNFA 4JQFA 3VYTB 2HDCA 5F6FA 1XD7A 2R7XA 5GPAA 5IYCJ 2V1DA 1O3QA 2YSRA 4C2TA 1XCBA 3EUAA 3F6VA 1OJLA 2L9VA 4HG2A 3KP3A 1S29A 5K7FA 1ZG3A 4R8HA 3TO6A 3TEDA 1B72A 2NVXJ 3RJPA 3NQOA 3S32A 2M3AA 1FNNA 1ZLJA 4A5NA 3DLAA 1BI0A 3FDYA 3WU2C 1OFCX 2XKOA 4XSXF 1APLC 2ZSIB 3IRRA 1TZLA 2R7ZJ 3PNYA 1D8JA 4DQ2A 2EQRA 4KISA 2DDAA 2RKHA 3I9V2 2WTEA 3OS2A 1FC3A 2KKOA 4HAMA 3K4CA 4CO8A 3K1MA 2VUMJ 3JRFA 4AVZA 4FE4A 5TRDA 2DFEA 3ZMUA 2H6BA 3ZR8X 4DZJA 1PUFB 1S8NA 3IH3A 1HKSA 3H5RA 3V7CA 2HPMA 2RN7A 5HVQC 4PZJA 2ZXWH 5EZGA 2HEOA 2QZ8A 4KT6A 3S1MJ 3E6MA 3W6JB 2I8DA 3Q0UA 4D5FA 3C2GA 5CVVA 1IDZA 2IS1A 1X3ZB 1I6XA 3DTIA 5GADJ 2WAQA 3RQIA 2QSFX 4LK1F 1L3LA 3QOEA 2L7KA 2LF8A 5ERIA 2L0KA 3S2WA 3FKJA 3DQVC 2BY2A 3CF2A 5CYVA 1YO5C 2RAEA 1FSHA 1EH7A 2FBKA 1TT0A 3I4PA 5AONA 5GTIC 2XDVA 5LRRA 4HF1A 3ZMSA 4PUSA 4D1QA 1YE9A 4CHUA 3VFZA 4LMYA 5L3EA 2QEXI 2X51A 4Y3OA 5DUKA 1QQIA 3LSJA 3HIFA 1LVKA 2W57A 2DMNA 3H35A 4X1EA 3A4CA 1T6SA 3WTUC 2P8TA 3F8MA 4Y33A 2LY1A 4DYRA 4OMZA 2UUZA 4RB0A 5C4JJ 2JVHA 5FROA 2JUGA 2CFOA 2DBBA 2JRTA 1IAWA 1ON1A 4KJZA 3QPHA 2V79A 2LH9A 3A0HC 1CQTA 4HA8A 2TDXA 3QYBA 2CYYA 2KIQA 2VJIA 4BL0B 3QRFF 1G4DA 4PSXA 2IA2A 2ZBKA 2F4MB 3A2KA 5IP7J 2VJJA 2NVUB 3E5QA 3M4OJ 1BM9A 1P92A 1ETVA 2RV8A 4RDUA 1SAXA 2DPDA 4AIJA 1TQIA 1DU6A 1IN6A 3GTGJ 4I98B 2E1CA 2HYJA 2Q0OA 2YPRA 1POGA 3REOA 4LGWA 4XMYA 3GW2A 2I10A 1S5LC 1KYWA 3S8PA 3RI4A 3ZPLA 3CC7I 4ZTJA 2FA5A 1KZHA 5LGNA 2Y31A 4DW6A 4RGRA 3QOPA 2HOTA 3Q3SA 1QRYA 3PO3J 4MEYF 3CC4I 3AL0B 2H1KA 2LC2A 1S7OA 2ZMEC 2B0LA 4BE2A 3MKWB 5J4VA 1PUEE 5GAEJ 4M9XA 1U9NA 2A68F 2Y69H 5EEGA 3IRQA 1YI2I 3CMEI 2JPBA 2WV1A 4YEJA 2F2EA 4F55A 1ZRFA 3TW7A 3I71A 5FKMA 5HLHA 3S3MA 2L01A 4GXOA 5LFAA 4RAYA 1JJ6C 2VKVA 4EVIA 1F1ZA 1I1SA 2EBIA 2EZLA 1G3WA 2LLKA 1SVMA 2ID3A 2Q1ZB 3ABTA 3CCYA 4G6DA 1HC8A 1MBGA 4A3EJ 5IPAA 3CCSI 1KQ8A 3MZYA 2X6XA 1X3WB 1IO2A 2E1MB 1UAAA 4XLNF 4NC8A 4PGHA 1WJBA 1K4TA 4KFCA 2V9PA 4A3IJ 1YQAA 2CFXA 3HBLA 2QA4I 1R4MB 2Z33A 1B9NA 3Q0WA 3TBIA 2JQ7A 1HW2A 1ZELA 3E6BA 3KZYA 4BQNA 4WXDA 3ZRGA 1H9GA 2QQBA 4IO9F 1OYIA 2MFZA 2NS8A 1JT6A 1XSDA 2R7DA 4OIQF 4QIWN 2XUBA 1XGOA 1OKRA 1X58A 1ZGJA 2DQRA 1FMWA 2FF4A 2STWA 2F6CA 4PJNA 2K9NA 5BMZA 5EF6A 2OCCH 1T2KA 3CDLA 1MMNA 4JX6A 4G7ZF 1ZHFA 1YYVA 1JUMA 4A3JJ 1U6GA 1MMDA 3CD6I 5GTHC 4YFKF 3K4LA 4DZPA 2FJ1A 2V6CA 2QUFA 2OV7A 4IRHA 4V2FA 1IRGA 1T0FA 1TLHB 4A3BJ 3LL7A 1WRJA 3U1KA 1ITYA 2L4MA 4IHWA 3RSNA 2PMHA 2F48A 4A3CJ 2CQQA 2QKMB 1LEAA 4ZDLA 2VJ5A 3DEUA 4BJ6C 4YFNF 5ICEA 3FF5A 5E20A 2EIMH 1DP3A 2E5ZA 5E3NA 4XSZF 4BXXJ 2BHZA 2GXGA 3C2HA 2IXSA 5HDNA 2E7XA 1H0MA 3HGGA 3HRTA 2D2WA 4HNTA 2WV0A 2FNPA 3TW6A 4KYWA 3ZOBA 1USSA 3H0GJ 4MHGA 2IJLA 1LE8A 4B1RA 5LGUA 2DXIA 1AOYA 5BNGA 1LE8B 4QWQA 4M6YA 1OCCH 3W6VA 3OYFA 4A3DJ 5KVRA 2X1CA 1RR7A 3WTWC 1HKQA 4U88A 4RAGA 3K6GA 5J40A 1OYWA 4MNUA 5A2QK 1WJDA 1Y39A 2VOOA 1LDDA 3ZQGA 3U21A 3R0JA 4XRSG 1J7KA 1SVOA 1U78A 4AD9A 3JW4A 1BR1A 1FP2A 1U2WA 1T0FC 3KZZA 2JUCA 5CVIA 4XBFA 3JR9A 4A0YA 1GVJA 3NARA 1W0TA 2K7LA 5BPIA 4MFDA 3DKYA 3WG7H 3GZ5A 2V1XA 1LPQA 1YJWI 3LSIA 5DYMA 3H5AA 2P5VA 3CESA 4C3HJ 2K3FA 2A69F 1MNMC 1IC8A 1A36A 1HOMA 1HXDA 4IQ4A 1XPXA 1RR8C 5F04A 4I01A 1ZK8A 4IHYA 1X1CA 4JP0A 3KE2A 1J0RA 1V55H 3B73A 3U9GA 1DGWY 3AFHA 2YU3A 5FLMJ 4L18B 3R60A 5IYBJ 3DU5A 2Y30A 4HV6A 2CV1A 4R1HA 3LOCA 5CLSA 1Y8QB 2M30A 4GO1A 3T5XA 4OAZA 2BY3A 2IBDA 3O3KA 2K9QA 2VB6A 4RLFA 2Z9OA 1I50J 1HW5A 1UHWA 1Y1WJ 3HUGA 4PJJA 3I55I 3GX4X 3HUGB 1AU7A 2NYXA 4EATA 4YIIA 3IWFA 2UXNA 4NHJA 1VZ0A 4NC6A 1GV5A 3U2RA 4C2UA 1DP7P 2K5CA 2NRAC 1N25A 2E2JJ 1OCRH 3BJ6A 5JHUA 2GQQA 1ODDA 2P6SA 1SEUA 2COMA 3PNVA 4M3GA 2FE3A 2VXZA 1WSUA 1W0UA 5IP9J 5K7ZA 4I6ZA 1OCOH 3L2WA 2O5RA 2WB1A 1I5ZA 3VPRA 2XAFA 5FFZA 5J47A 4IF4A 1JKPC 4E7SA 4RBOA 4F52A 3LA3A 2M87A 2FMLA 1QVTA 4CA0A 5JR3A 1XS9A 4WF2A 4HZFA 5DV5A 1IN8A 1VQMI 2ZNYA 1BBYA 4XL9A 2Y48A 2A6EF 1MNDA 4A6EA 2D5VA 1VQOI 4DOZA 2DU9A 2DA7A 4L5EA 1G8XA 4ZYAA 3V8JA 5EGOA 2EFNA 2KL4A 3BROA 5EGOB 2DJIA 1ETXA 3VEPA 1Z91A 4IPAA 4BDYA 2ZB9A 4IHXA 1MD0A 3HHGA 1QPIA 1O7LA 3HZJA 5HS9A 4PJ0C 4EGZA 1V5GA 4BE1A 2QWWA 3FXOA 2CG4A 2ME6A 4GFBA 4Y13A 4UHTA 1YX5A 4YRVA 1NK3P 3ASOH 5J1UA 5CVRA 1FJLA 1WFXA 4RGXA 2ZJRF 3MZHA 4L5JA 3WHBA 4H4KC 2OD5A 4J01A 2V26A 2VC0A 4G94A 3KEYA 4Y7NJ 2GIZA 3OOPA 4A3FJ 1BI2A 2HXIA 2GLOA 1IXSB 1DPUA 2Z2SB 3DEWA 5FKOA 2KIUA 1V5FA 3OYGA 1OCZH 3SZGA 1WJ5A 4II3A 3KFWX 2WY7Q 3BZKA 1H88C 2EJRA 1QNTA 1VF9A 2LKXA 1SFUA 4V2GA 1E2XA 2KDOA 3WTSC 5KAFC 2R0QC 4CCLA 1K4SA 1VI0A 3OYBA 3E1SA 1KA8A 4LOCA 5GAHJ 2DLLA 4NBQA 1Y8RB 2EH3A 2GWRA 2CW8A 4ENMA 3HOXJ 1MJAA 3BDDA 3B02A 4OINF 2NVQJ 3IV5A 2H6CA 3M1CA 4LIVA 3W2WA 3CZ6A 1ZLKA 1BC8C 1YJ9I 2E1NA 2R7VA 1Z9CA 4Q48A 4XKVA 2NS0A 2CU7A 3BTCA 2K85A 4ANJA 5L3DA 2YU9J 2EINH 4I02A 4GYIA 1FYLA 3RYRA 1HDDC 3HXLA 1L0OC 4EEFG 3CCUI 3ZN1A 1EV7A 1JTXA 3LA7A 4BBSJ 1Z05A 4U0YA 3BZCA 4E7IA 1WH7A 3TP0A 3T8RA 5D4SA 1NTCA 2XGEA 4CH7A 2MD0A 2P6TA 2ESNA 3HHHA 2XGCA 2YS9A 2WAQN 2EB7A 5F64A 5F1JA 3JRDA 4N0BA 4BJ5C 3GTKJ 4IEJA 1SD4A 1X1PA 2RC4A 2W00A 5JFRA 1Y0UA 2XB0X 4E6KG 2FMYA 3OSFA 4C9YA 2H1LA 2XPUA 3KLOA 5CVUA 4AYBN 5M3FJ 2O7OA 4UY8I 2O6GE 2DQLA 3CMYA 4HOBA 1ETQA 2QBYA 4IKFA 1IRFA 4RGUA 5H20A 2QBYB 4KIBA 3BPVA 4DYQA 1BI1A 3MN2A 3LNQA 1GDTA 1JI8A 1FOYA 4HSTA 3MZ8A 5F08A 3KEQA 3A01A 2G9WA 2TRTA 5J1RA 3F8NA 2EK5A 4B47A 3A01B 1DUXC 2KISA 3MAJA 2QLZA 3PM1A 4D7NA 2P7VB 3G4SI 5IYDJ 3K4NA 4Z2YA 5FFXA 1OR7C 3VB2A 2COBA 3ZQCA 4HPQA 1X4OA 2O03A 4B3XA 5DCFA 1STZA 1EJ9A 4DBQA 2EV0A 2R7OA 1TWCJ 2DJNA 4ON0A 1O4XA 4GDFA 5IY5H 5D5VB 3CO6C 5E17F 1Z0XA 3IAM2 2LKSA 2HYGD 4IOAF 1Q1VA 1JUPA 4UV9A 1X2MA 4EJVA 1FTZA 3RKYA 3GO5A 4FX0A 3FXRA 1ETWA 2RDPA 3LWFA 2V6EA 2Y0SN 3SEZA 2BGCA 1SD7A 3VSLA 5GAGJ 2XIGA 2BXZA 4FISA 1E17A 3FMSA 3FXMA 4M3BA 3J80Z 5TJJA 2OTJI 2IGMA 4AUXA 2X48A 3LQQA 1XDSA 4M3DA 2AHQA 2FRHA 2GOXB 3EUHA 1O7FA 4S05A 2BE5F 2ME0A 3CP2A 3OYAA 1A6QA 4CCOA 1UFMA 3TDUC 2F5FA 2G7HA 4E70A 3GTLJ 3FHNA 4PFPA 3K10A 3TP3A 4RB1A 4EJUA 1NG7A 4OU0A 2DOFA 4NUBA 2LKPA 3O8HA 4LG3A 1WPKA 3AG2H 4Y15A 1V3FA 1UHMA 3OR1C 4PJMA 5M5YJ 1GLNA 1T33A 5EG0B 3PQJA 3I56I 5CQEA 2E34A 2LVSA 2JT1A 2IEKA 1TWHJ 2N8GA 1USTA 3BG7A 1BJZA 3IUOA 2E60A 6PAXA 2QSGX 3WGHA 3K2AA 4B09A 4M6VA 1S6LA 1MBHA 5TGTA 4MGRA 2PMZA 2ZFUA 1KQ9A 3DPLC 1ZG5A 1BL0A 1FIPA 4UXNA 2DOEA 1SC7A 1XGSA 1D1BA 1M1EB 4PCQA 4UUVA 5HODA 2VONA 1JTYA 2IA1A 4HNVA 2HVSA 2YX4A 3R61A 2FBIA 5LRSA 3GFLA 3JCUC 3OYEA 1T98A 2H8WA 2GXAA 2NNNA 2DN0A 2HQNA 3BTJA 5FO5A 1YW7A 2M8EA 2X1DA 1D5VA 1PUFA 3F72A 1ETKA 4OIRF 3LSRA 3IH4A 1JHFA 3SZTA 1XGNA 1QHHD 1T56A 1VQ8I 1VNDA 2IGNA 3IAS2 4BEHA 2LDUA 3FKIJ 4KUMA 3TOAA 4BEHB 3WTTC 2KP6A 3TKYA 2A07F 3V7RA 2L02A 3I4MJ 4A6DA 3O8GA 5E8GA 2LBFB 3VOEA 3HSRA 4EJWA 1ZQ3P 3AG1H 4XIDA 3QPLA 3F6OA 1GXPA 3S14J 4A3GJ 4BAYA 1J59A 1XCVA 4AU7A 4F92B 1H8AC 2ZJQF 1IW7F 1ZKGA 2IA0A 1GVDA 3NRVA 2FOKA 3ERMA 3F21A 1MGTA 2R3SA 4LB5A 4BHCA 2M0MA 4L9TA 3OR2C 1IJWC 2CW7A 3K7AJ 3ZMZA 1BA5A 3CCEI 3OYKA 2JZYA 5KK1A 3CP8A 3FX3A 5HNHA 1XN7A 2ZXIA 3DTEA 5CQGA 2ELKA 2OBPA 2EFPA 2OAZA 5L3FA 3DWLE 3GTOJ 2Y2ZA 3CUOA 2P7CB 1OISA 2MH2A 1BOAA 3MKZA 1U3EM 1P4WA 2AS5F 1P7JA 1MBJA 3CCRI 2K9LA 3QODA 2QVOA 1Z77A 4HSRA 3B6CA 2DA5A 4XICA 4N4NB 1A6IA 3A03A 4UUSA 3BT9A 3I64A 3HTUA 4UUSB 2MABA 2PX9A 3F9KA 1TC3C 2E5NA 4BY1J 3FK7A 4FE7A 3ELKA 4EGYA 2CUEA 5BOXA 3L2CA 3J80K 4E4HA 3HOVJ 3LSTA 2DTRA 3JSPA 2BVLA 3EETA 1IXRC 1P2FA 4KICA 5FLXK 1PVEA 1WGXA 2HGCA 3SZPA 1N77A 3EQLF 2BW3B 5LD2C 1YW8A 2BXYA 2R93J 4G8XA 3KP2A 4G7HF 4A3KJ 1TTYA 4MFEA 4TV7A 3QPSA 4M9ZA 1AHDP 1FOXA 1J2XA 4BKXA 1HKTA 1ON2A 4HLXA 3A02A 2CJJA 3NWTA 4U7BA 3HB9A 2R5ZB 3BR6A 1GHCA 1YIOA 2OU2A 4G6TB 1QPMA 3MWMA 3IL2A 1VQPI 2KT0A 3BR0A 3KIOA 1W4MA 9ANTA 4KN7X 5GP9A 4V19K 4HF2A 2VASA 5EZHA 1HLVA 4YIFA 2FOWA 1R6RA 2AO9A 3SFZA 1W36D 4M3EA 3G73A 3PL8A 3ERED 1Z21A 3BY6A 2ELJA 2KRCA 2ZXJA 2HQRA 4RM2A 4CCNA 2ZCWA 2W85A 1UHSA 4B43A 2WB1N 1PP8F 5HS7A 1LFPA 3BR3A 1RKWA 1WH5A 1Z7LA 2EV6A 4HNUA 3OS1A 1OCPA 3DEEA 1QO0D 2DI3A 1G59A 2FD5A 2V1NA 2MH9A 1IXCA 4DBRA 1R5ID 4F93B 2XAGA 2O0YA 2LOOA 4P1WA 4PFOA 3SFIA 4A0ZA 1BJAA 3M1EA 2O8XA 3AL0C 5L3BA 2E36A 2K9SA 2CW0F 3WTVC 4D9JA 5EEAA 1VQNI 3L2RA 3GMEA 1IZ1A 1D3YA 1UMQA 4PJLA 3QU6A 5FKNA 4N4OB 3ZQLA 4BHPA 2OC6A 3SDBA 4BY7J 2HOSA 1W7PA 3BR1A 1XDUA 3WU1B 1W7PB 3S17J 2X85A 3DBRB 5CPRB 1Z3XA 1NHAA 3P7NA 1OCTC 1I3QJ 1TW3A 1GT0C 1TL8A 2E1MC 4EM2A 2PEXA 2VQGA 3A0BC 1K6YA 1BW5A 3FXJA 3BJOA 2M7AA 1YW9A 1LFBA 3ASNH 3BWGA 5B1AH 2DA3A 4Y4RA 2MBFA 1EH8A 4X0GA 2W82A 3QP5A 4EM1A 4IX7A 2A5YB 3OYDA 2K86A 3E0JB 1WI3A 3VWBA 3SYTA 2DFFA 4UVAA 2VBXA 2HKOA 2VIXA 1D1AA 3L2QA 3HOWJ 4HLYA 2XROA 4BBRJ 1YTYA 1I6HJ 1IUYA 4S0HB 3VODA 5F1RA 3M8EA 1HDPA 1ZAOA 5J3LA 3LAJA 4QSHA 5DM7F 2LMDA 2R7RA 2PBIA 1BIAA 3DV8A 1FZPB 3BR2A 1X2NA 3JRBA 1PDNC 4ZJZA 4ABZA 5DDGA 2PG4A 2IT0A 2NS7A 2P81A 3SQNA 2OF7A 3E7LA 3COAC 3JRGA 5LBQA 4XKWA 4M74A 2JSCA 1J09A 1ZRCA 1HQCA 2ECBA 1EF4A 5IP6A 1IGNA 1U5TB 4P5OA 4B8XA 4FASD 2OZ6A 1JKOC 2IS6A 2VODA 4O3MA 4FCYA 3C7JA 2JRMA 5D5XB 3FHZA 4G9YA 3KLNA 2JK3A 2R5YA 4HDVA 2V1UA 2R5YB 4A12A 2A6HF 4XR6A 5E3LA 1QVUA 3M8JA 3NAUA 4M72A 5JVGF 4HX4A 3DXJF 1DGRM 3CUQA 1EA3A 2A61A 4FHTA 1LKXA 1X1BA 3CUQB 1U8BA 2BV6A 2LNBA 4D7MA 3RPQA 4XLCA 3PSFA 2LFBA 1KU2A 1ZGAA 2XSJC 3ECHA 2XGXA 2VXDA 1X3UA 3RDIA 2KLOA 4XN3A 1MDMA 2L4AA 2HVQA 2MLGA 3D5RC 2X1EA 1MDMB 3ML6A 2EZKA 4Y17A 1V5EA 1E3PA 2Z99A 2MD5A 2F5DA 2JMWA 3O6BB 3HEFA 5D6FA 4IVNA 2ZC2A 4DJAA 2YR2A 4M9SA 1LB2A 2V4JC 3HOTA 4I7HA 3K0LA 5EEHA 2LF7A 1X1DA 4JX4A 5B3SH 4UNOA 4N9HA 3H9JA 4O6JA 5BS6A 3W6KB 3JTGA 1WKMA 2GIVA 5E1ZB 3RKWA 5K1YA 3R4KA 3KYCB 5H6QA 3J81Z 4RB3C 4BDZA 4XOPA 2GAUA 2XRNA 3T8TA 3W2VA 3SJMA 1RC9A 1YITI 4NB5A 1MJBA 2DA2A 1IUFA 1XX5A 2DCEA 5HLTA 4BYYA 4OWRB 2EZHA 2ZJPF 2RQQA 4EMSA 2CQ7A 2FQ3A 3IKVA 3LSGA 3DBHB 3MEXA 1FBQA 2CGPA 1K78A 5J4YA 2K3PA 4BUPA 2XAJA 3TOBA 2HI3A 1K78B 1ZYRF 2JPCA 2PMUA 3PIOF 3M3YJ 2MC3A 2CS3A 2HWVA 5AIPA 2STTA 2BBYA 3S1NJ 3HYIA 1AWCA 3ZMTA 2OPTA 2E7WA 3I58A 1IV8A 3GLLA 3MKLA 3R6SA 3PIPF 4EQQA 3BCBA 1Z6RA 3P9CA 4LFUA 2MA3A 4C3JJ 1IDYA 4EJOA 3PFYA 4J19A 3B6AA 1D1CA 3DU6A 3Q0VA 2VQLA 1E0EA 1FEXA 2LYCA 4HX8A 1OQYA 1VTNC 3DP7A 4KT5C 1C0WA 5CKTA 4ESJA 4E7JA 3J7AO 4HEA2 2UWMA 4U7DA 2V7FA 2HNHA 4UV8A 5K7HA 1S9HA 3RCOA 3I4NJ 4CZCA 1JKRC 3BR5A 3M8FA 2X6YA 1Y0NA 5C3EJ 3EUKL 3H0DA 2H94A 3NEUA 2HXOA 2EA4A 2HQAA 5AIQA 3CC2I 2F5EA 2M7BA 2HR3A 4G12A 4J00A 2HVRA 1RZ4A 1W7PD 2LD5A 4C3IJ 4XRFA 2M45A 2FNAA 2X0LA 5E1WA 2F5VA 2EFOA 3WG9A 4XQFA 4XRSA 3VDXA 2QF7A 1SFOJ 5JHFA 2GA1A 3I59A 1FBUA 4I76A 2WY8Q 4MO7A 1S7EA 3G1LA 3I59B 3E5XA 2HQ5A 4L9NA 1MMSA 1UG2A 1HF0A 5GPCA 2PMZN 4LLLA 5EDNA 3EYYA 2QCOA 1XMKA 1W5SA 3CJQB 4PSWA 1WHUA 1JJ8C 2X9DA 3C3WA 3HKZA 5J1YA 2MSYA 2NOGA 4I0BA 1WQ2A 3DFGA 4M3FA 4WCGA 3WGGA 1E3HA 1JXSA 2X6OA 5IOYA 3JRHA 3WE2A 2JN6A 1D0YA 1S3JA 2QYOA 2X4HA 3RZDJ 3PQKA 4HYEA 3DKXA 4H0EA 1IG7A 4BNCA 3CJRB 2HTSA 1UELB 4KIGA 1WI9A 2HOAA 2Y9YA 3OIQA 3ESWB 1R1VA 2IGOA 3P9IA 2DAOA 4HV5A 3UR3C 4XLPF 1O3TA 4UUTA 3CJTB 3N05A 3VYSB 1ENHA 4XK4A 3CDHA 3V8KA 2MGQA 4CICA 1XSVA 2L9NA 5D8KB 1P4XA 3KYLA 1JE8A 5KAIC 1XTAA 3KP4A 2R7UA 3MMYB 2F4IA 1VFCA 2WADA 3ISPA 3K4KA 1D0ZA 1HW1A 4KMUX 1G2HA 3SHFA 3J81K 3OYIA 2M9HA 2VBZA 3E6CC 3K70D 3CLOA 3LAPA 1IV6A 3ZN0A 1ONVA 1TWAJ 4MTDA 2HKXA 4LD5A 4BGDA 2HDDA 4XKBA 2CUFA 3PO2J 4BQAA 5ILUA 1W5TA 3HTSB 2YUSA 1SMTA 2Y75A 5BQTA 2XPVA 3HOUJ 2K4JA 2PQ8A 2FEZA 4CXFA 2P4WA 1T38A 2XV4S 3BQYA 1I27A 5LEKA 2NOJB 5DEQA 1F4KA 3MQ0A 3E5UA 2MW8A 1LQ1A 1TW2A 4YIRX 1JKQC 3MCZA 4NQWA 3CCQI 3I53A 2KZGA 1WJFA 4A69C 4NQWB 4CGZA 1MKMA 1FOWA 4A5MA 2DO7A 1G3TA 1RKTA 3DTKA 4AIHA 4HDUA 2UXXA 2E2HJ 3ABKH 3IWZA 4M73A 3HJEA 1YS6A 2V9VA 5IT9Z 4CYDA 2KHMA 3GXOA 4KA4A 3DPUA 2CRGA 2B7EA 1D0XA 3GZ6A 1R1UA 2M1BA 4ENJA 2FXAA 3G6EI 3F3XA 3TGNA 1R23A 3V7SA 1R9TJ 1AKHA 1IRZA 4XLEA 1F43A 1MSEC 1AKHB 4FT8A 3RPUA 4GGGA 5B5EC 3H5NA 1D8KA 4MIMA 4ENNA 1JGGA 2NAZA 2O3FA 4A2UA 4BU2A 3DF8A 2R7WA 1WJEA 1Y56A 4WX9A 2KZVA 4MQVA 3GWZA 2IRFG 1IN5A 5IOZA 3KEOA 4RLQA 2W84A 3S1QJ 3LSMA 1KONA 1Y1VJ 2F4OB 2FBHA 2R4GA 1O57A 4OAYA 2G0EA 3FWEA 2DODA 1PJRA 2VBWA 5FRMA 3BP8A 2F5CA 2M4KA 2DA1A 2LY2A 2DPUA 2A5WA 3G2BA 3E97A 4XLHA 1LFUP 2QENA 3ZMDA 2PN6A 5CVJA 1BI3A 1E3OC 3CCVI 2PLYA 4D0PA 4L0ZB 3OYJA 1R58A 3SXYA 2L9SA 2GA2A 3EDPA 3DPTA 4CDGA 3GYHX 2R7FA 3K2ZA 4XRMA 3ZQ7A 5EG0A 3ZQHA 2O8KA 3E3VA 3LSKA 2IS4A 2A05A 3RQ4A 4CUGA 1T95A 1XSXA 2LK2A 2CH0A 1W36C 4F7ZA 5KHDA 2MG4A 3GEZA 3HRMA 3HPHA 1X19A 4I99C 3FIWA 3N4MA 4B3AA 3C18A 5DD4A 3RKQA 3CLQA 1FT9A 5B66C 1KQ0A 4G6QA 3GF2A 2JA6J 2HPIA 4HQMA 4PDKA 4PK4A 2DMUA 2ZFWA 3OV8A 4RMNA 1Z67A 2AXLA 5LHHA 2M5WA 2VLAA 4Q5SF 1SFKA 2ETHA 4NDLA 3OL3A 1U0JA 4F3QA 2KRHA 1MNEA 2KDZA 1YX3A 3EUHC 2K02A 3TQNA 5TISC 2BYVE 1WCMJ 2KPMA 2ZXHA 3MD2A 3WODF 3RTRA 1Z6TA 2OZUA
chains in the Genus database with same CATH topology
4HW0A 2FSWA 1WWXA 4RS8A 4BXUA 3QU3A 3ROUA 3WGIA 3ZMVA 4A0XA 1TQMA 5D6EA 1QGPA 2PI0A 1ZRDA 2MLKA 3FXQA 5IT9K 2BEOA 3CJNA 3Q9VA 1F9NA 1P6RA 2QQ9A 4K2EA 2IW5A 5J8FA 5LLQA 4I09A 1FOKA 4ENKA 3TDZC 1REPC 2VE8A 3HRUA 3KETA 1RUOA 4IRGA 4FX4A 3QP6A 2K4BA 3JTHA 2VE9A 4LG0A 3RYPA 2ZMEA 4ZH4F 2ISZA 4LG0B 2ZMEB 3QPTA 2P5KA 1UCRA 4OIPF 3ZP5A 2Z5UA 3H3ZA 4YG2F 4L5IA 4U0VA 3EYIA 2ZO4A 1F5TA 1B59A 2KIMA 2FU4A 2DFIA 5BPDA 2KRFA 3WTXC 1DPRA 5A2QZ 4WWCA 2UZKA 4LJZF 3H92A 5ICGA 2ACJA 1G3SA 4G7OF 4KN4X 3BJAA 2PFBA 1HBXG 1LVAA 2VN2A 4ZZLA 2D1VA 2H09A 2GZWA 4IRIA 4LK0F 2C6YA 2HTJA 2Q8KA 1FYKA 1XB4A 1HSJA 2HYFA 1FLIA 1EH6A 5D5WB 5JI6A 1R00A 3GLXA 1P4AA 1G6NA 4Q4ZF 1YLFA 4WXCA 3WU0A 1V4RA 3AAFA 5J6XA 1FX7A 3GFMA 5E8IA 4I2OA 4IXAA 2G7UA 1GXQA 3O2PE 2H27A 3T1BA 4ASNA 3L9FA 4JK1X 3M9AA 1KGSA 4ZYGA 2CWEA 3I5UA 1J75A 1A04A 4RGSA 1RIOH 2ELHA 1R1TA 1QZYA 2W24A 3TO7A 3ABUA 3BZ6A 3CTAA 3G3ZA 1B1BA 3V8LA 3LA2A 4JBAA 1FYMA 1MZBA 2HZTA 3N97A 4BH9A 2VOPA 1FBSA 5J8CA 4LLNA 1IN4A 2IP2A 3MFKA 5HLGA 4MEXF 3I0TA 5HS8A 3HOSA 1LDJA 1J9IA 3RIRA 4PGGA 3RKXA 2EV5A 4HQEA 2WC2A 1ZN2A 1JHHA 1U5TA 1DDNA 4KNYA 2DT5A 3PFIA 4M71A 4CZZA 1K6OA 1CGPA 4AVPA 1O3RA 5D4RA 3KP7A 1Z1DA 5K5RA 2CSOA 2ESHA 3I54A 2XAQA 4R79A 4IHSA 5FB2A 2OA4A 4P96A 4ETSA 1J5YA 1ZG1A 2GXBA 1BN5A 2ISYA 2XVCA 5ILVA 3FMQA 3KCCA 2RQPA 2VC1A 2NNYA 1XGMA 4GCVA 3T0YA 3R0AA 5IT3A 2DK8A 3FM5A 1U5TC 1UB9A 2XASA 3QAHA 3FMRA 1TNSA 4HF0A 3LQRA 1SMYF 1TNTA 1FPQA 2J5PA 4P55A 3F8BA 1Q1HA 3K1PA 4ESBA 1R36A 2D1HA 2EFWA 4IHTA 3CUQC 1K7AA 2L54A 1FSEA 4WK8F 1YS7A 2HFHA 3D5LA 1ZH5A 5DD8A 4N9IA 1YFHA 4EV0A 4OMYA 5L3CA 2RVCA 1I1GA 3Q5FA 4YFXF 2ZKZA 5FD5A 4IJAA 1RNLA 2IVMA 1T39A 1SD6A 1R22A 5LHGA 3GVAA 2QM3A 1ZARA 3GFJA 4M6XA 2HS5A 2DW4A 3K9TA 4O5VA 4KMFA 3FXUA 4EJTA 4UVCA 2D45A 4KIFA 4KDPA 3F23A 1BC7C 4UVBA 1G3YA 4Q47A 3ECOA 1KU3A 3E6DA 4RB2C 2RNJA 3IHUA 5FD6A 1PP7U 4GYGA 4MTEA 4WXHA 1OMIA 3F22A 2DK5A 5ILSA 5ICCA 1FP1D 1FWZA 3KP6A 2OQGA 3FZVA 1B4AA 2CQKA 1OPCA 2P5LC 2RGVA 1R7JA 5DCMA 4ESFA 1QZZA 5DCMB 1U8RA 3C1DA 4LB6B 3JAMZ 3FM3A 1KU9A 5DUIA 4P9FA 2EA2A 4L9JA 2YX7A 2ZJ2A 4RAZA 2KIFA 3GFIA 2L3DA 4OOIA 1LDKB 2O61A 3L7WA 3V4GA 5K5OA 4S04A 4BHBA 1BIBA 1MJ9A 3Q9SA 2ZNZA 5LGTA 2VT3A 1B9MA 5FGMA 5LEJA 3KP5A 3CO7C 2XHKA 1KYZA 1YG2A 3F8FA 5D5UB 2Y0MA 3IKTA 3ULQB 3LFKA 1LNWA 1H9TA 4EM0B 2ADUA 1OR7A 4ZYHA 2LSOA 1RI7A 1R5HA 5HDGA 5E1XA 1B6AA 2KJCA 1JGSA 3F8CA 3L00A 2Z3YA 3K69A 3HSFA 3DKWA 4LLGF 3L09A 4AIKA 2A3SA 3H3UA 2XAHA 4ZYDA 1O3SA 4L9VA 5D8LB 4L0YB 2PJPA 1SD5A 2QQAA 5JVTA 3JSOA 1FY7A 4OIOF 1KU7A 1RUNA 1CF7A 3WTYC 2W25A 1CF7B 5ED4A 5L3GA 2XKPA 3K1NA 4DNCA 2K27A 1OYYA 4ZYEA 3WTZA 4ZZDA 3D0SA 4MQ9F 3IC7A 3WE3A 5HDKA 1S7AA 1HSTA 5HLIA 2WWYA 1TBXA 2Q2EA 2HOEA 1XMAA 4U0WA 1SFEA 1LJ9A 1IN7A 1R5GA 3HSEA 2JTVA 5HOOA 2CO5A 3P9KA 5ICFA 2OQRA 5LHIA 1ZREA 3GUDA 5CJ9A 4HBLA 4I0AA 3JAMK 5K5QA 4HX7A 2EFQA 3BOQA 2KJBA 5FLXZ 2VT2A 1K79A 1QBJA 4QLCU 4P9UA 5H6RA 2VBYA 2IPQX 4AWXB 3HRSA 1SFXA 2EWNA 3U1DA 3TO9A 1IF1A 3BPXA 1Z7UA 1LEBA 2J5OA 3M7GA 1ULYA 5E18F 1TQPA 4JQFA 2HDCA 5F6FA 1XD7A 2V1DA 1O3QA 2YSRA 1XCBA 3F6VA 3KP3A 1S29A 1ZG3A 4R8HA 3TO6A 3RJPA 3NQOA 1FNNA 1ZLJA 4A5NA 1BI0A 2XKOA 4XSXF 3IRRA 1D8JA 4DQ2A 2RKHA 2WTEA 1FC3A 2KKOA 4HAMA 4CO8A 3K1MA 5TRDA 3ZMUA 2H6BA 1S8NA 1HKSA 3V7CA 2RN7A 5HVQC 4PZJA 2HEOA 2QZ8A 3E6MA 3W6JB 5CVVA 1I6XA 1L3LA 4LK1F 2LF8A 5ERIA 3S2WA 3DQVC 5CYVA 1FSHA 1YO5C 1EH7A 2FBKA 3I4PA 5AONA 5LRRA 4HF1A 3ZMSA 4CHUA 3VFZA 4LMYA 5L3EA 5DUKA 1QQIA 3HIFA 2W57A 1T6SA 3WTUC 2P8TA 3F8MA 4OMZA 4RB0A 2DBBA 2JRTA 1IAWA 1ON1A 3QPHA 2V79A 4HA8A 2TDXA 2CYYA 1G4DA 3QRFF 2IA2A 2ZBKA 3E5QA 1BM9A 1P92A 2RV8A 1SAXA 2DPDA 4AIJA 1TQIA 1IN6A 4I98B 2E1CA 2Q0OA 2YPRA 3REOA 4LGWA 3GW2A 1KYWA 3RI4A 3ZPLA 2FA5A 5LGNA 4RGRA 3QOPA 4MEYF 1S7OA 2B0LA 1PUEE 4M9XA 2A68F 5EEGA 3IRQA 2JPBA 2F2EA 1ZRFA 3I71A 5HLHA 2L01A 4GXOA 4RAYA 4EVIA 1F1ZA 1I1SA 1G3WA 4G6DA 3ABTA 1KQ8A 3MZYA 4XLNF 4PGHA 4KFCA 1YQAA 2CFXA 2Z33A 1B9NA 1HW2A 3E6BA 3KZYA 4WXDA 1H9GA 2QQBA 1OYIA 1XSDA 2R7DA 4OIQF 2XUBA 1XGOA 1OKRA 1ZGJA 2DQRA 2FF4A 2STWA 5BMZA 1T2KA 4G7ZF 1ZHFA 1YYVA 1U6GA 4YFKF 2V6CA 2QUFA 4IRHA 1IRGA 1T0FA 1TLHB 1WRJA 2L4MA 2PMHA 1LEAA 3DEUA 4YFNF 5ICEA 3FF5A 5E20A 4XSZF 2GXGA 5HDNA 2E7XA 1H0MA 3HRTA 2D2WA 2WV0A 2FNPA 4KYWA 1USSA 4MHGA 2IJLA 1AOYA 5LGUA 4QWQA 4M6YA 5KVRA 3WTWC 1HKQA 4U88A 1OYWA 4MNUA 5A2QK 2VOOA 1LDDA 3R0JA 1J7KA 1U78A 4AD9A 3JW4A 1FP2A 1U2WA 3KZZA 5CVIA 4XBFA 4A0YA 1GVJA 2K7LA 5BPIA 3GZ5A 2V1XA 5DYMA 2P5VA 2A69F 1HXDA 4I01A 3KE2A 1J0RA 3B73A 3U9GA 2YU3A 4L18B 3R60A 4HV6A 4R1HA 5CLSA 2M30A 4GO1A 3T5XA 3O3KA 2Z9OA 1HW5A 1UHWA 3HUGA 3GX4X 2NYXA 4YIIA 3IWFA 2UXNA 4NHJA 3U2RA 1DP7P 2NRAC 3BJ6A 5JHUA 2GQQA 1ODDA 2P6SA 2COMA 2FE3A 2VXZA 1WSUA 1I5ZA 2XAFA 5FFZA 4IF4A 3LA3A 2M87A 2FMLA 5JR3A 4WF2A 4HZFA 5DV5A 1IN8A 2ZNYA 1BBYA 2Y48A 2A6EF 4A6EA 2DU9A 3V8JA 2EFNA 3BROA 3VEPA 1Z91A 4IPAA 1MD0A 3HHGA 1O7LA 4EGZA 5HS9A 2QWWA 2CG4A 4Y13A 4UHTA 5CVRA 4RGXA 3MZHA 4L5JA 2OD5A 2VC0A 4G94A 3OOPA 1BI2A 1IXSB 1DPUA 2KIUA 3KFWX 2EJRA 1QNTA 1SFUA 1E2XA 3WTSC 1KA8A 2DLLA 2GWRA 4ENMA 1MJAA 3BDDA 3B02A 4OINF 2H6CA 1ZLKA 1BC8C 2E1NA 1Z9CA 4Q48A 2NS0A 5L3DA 4I02A 4GYIA 1FYLA 3RYRA 1L0OC 3ZN1A 1EV7A 3LA7A 1Z05A 4U0YA 3T8RA 5D4SA 2P6TA 2ESNA 3HHHA 2EB7A 5F64A 4N0BA 1SD4A 2RC4A 5JFRA 1Y0UA 2FMYA 5CVUA 3KLOA 2O6GE 2DQLA 4HOBA 2QBYA 1IRFA 4RGUA 5H20A 2QBYB 4KIBA 3BPVA 1BI1A 3KEQA 2G9WA 3F8NA 2EK5A 1DUXC 3MAJA 2QLZA 2P7VB 4Z2YA 5FFXA 3VB2A 2O03A 5DCFA 1STZA 2EV0A 4ON0A 5D5VB 3CO6C 5E17F 2HYGD 4UV9A 4EJVA 3RKYA 3GO5A 4FX0A 3FXRA 3LWFA 2RDPA 2BGCA 1SD7A 2XIGA 1E17A 3FMSA 3J80Z 5TJJA 3LQQA 1XDSA 2FRHA 3EUHA 1O7FA 4S05A 2BE5F 1UFMA 3TDUC 2F5FA 2G7HA 4E70A 4RB1A 4EJUA 4OU0A 2LKPA 4Y15A 1V3FA 1UHMA 3PQJA 2JT1A 1USTA 6PAXA 3WGHA 4B09A 1S6LA 4MGRA 3DPLC 1KQ9A 1ZG5A 4UXNA 1XGSA 4PCQA 4UUVA 2VONA 2IA1A 2YX4A 3R61A 2FBIA 5LRSA 3GFLA 1T98A 2NNNA 2HQNA 5FO5A 1YW7A 2M8EA 1D5VA 3F72A 4OIRF 1JHFA 3SZTA 1XGNA 2LDUA 4KUMA 3TOAA 3WTTC 3TKYA 2A07F 3V7RA 2L02A 4A6DA 5E8GA 3VOEA 3HSRA 4EJWA 1GXPA 3F6OA 4BAYA 1J59A 1XCVA 1IW7F 2IA0A 3NRVA 2FOKA 3F21A 1MGTA 2R3SA 4LB5A 4BHCA 4L9TA 3ZMZA 2JZYA 5KK1A 3FX3A 1XN7A 2OBPA 2EFPA 2OAZA 5L3FA 3CUOA 2P7CB 2MH2A 1BOAA 1U3EM 1P4WA 2AS5F 2QVOA 3I64A 3HTUA 3ELKA 4EGYA 5BOXA 3L2CA 3J80K 3LSTA 2DTRA 3JSPA 3EETA 1IXRC 1P2FA 4KICA 5FLXK 2HGCA 3SZPA 3EQLF 1YW8A 4G8XA 3KP2A 4G7HF 1TTYA 4TV7A 4M9ZA 1J2XA 1HKTA 1ON2A 4HLXA 4U7BA 1GHCA 1YIOA 2OU2A 1QPMA 3MWMA 3IL2A 1W4MA 4KN7X 4HF2A 4YIFA 3SFZA 3G73A 3ERED 3BY6A 2ZXJA 2HQRA 2ZCWA 2W85A 1PP8F 5HS7A 2EV6A 1QO0D 2DI3A 2MH9A 1IXCA 2XAGA 2O0YA 4A0ZA 1BJAA 3M1EA 2O8XA 5L3BA 2CW0F 3WTVC 1IZ1A 1D3YA 3QU6A 4BHPA 1W7PA 1XDUA 3WU1B 1W7PB 1NHAA 3P7NA 1TW3A 4EM2A 2PEXA 3BJOA 1YW9A 3BWGA 2MBFA 1EH8A 3QP5A 4EM1A 2A5YB 2K86A 4UVAA 2VBXA 2HKOA 4HLYA 2XROA 1YTYA 1IUYA 3VODA 5F1RA 3M8EA 1ZAOA 3LAJA 2PBIA 1BIAA 3DV8A 1FZPB 1PDNC 5DDGA 2PG4A 2IT0A 3SQNA 3COAC 5LBQA 4M74A 2JSCA 1ZRCA 1HQCA 1U5TB 4P5OA 4B8XA 2OZ6A 2VODA 4O3MA 3C7JA 5D5XB 3FHZA 4G9YA 3KLNA 4HDVA 2V1UA 4A12A 2A6HF 4M72A 4HX4A 3DXJF 3CUQA 2A61A 4FHTA 3CUQB 2BV6A 2LNBA 3RPQA 1KU2A 1ZGAA 3ECHA 2XGXA 3RDIA 1X3UA 1MDMA 2L4AA 2MLGA 1MDMB 3ML6A 4Y17A 2Z99A 2MD5A 2F5DA 3O6BB 5D6FA 4IVNA 1LB2A 2YR2A 4M9SA 3HOTA 4I7HA 3K0LA 5EEHA 2LF7A 4UNOA 4N9HA 4O6JA 5BS6A 3W6KB 3JTGA 1WKMA 2GIVA 5E1ZB 3RKWA 5K1YA 3R4KA 5H6QA 3J81Z 4RB3C 2GAUA 2XRNA 3T8TA 4NB5A 1MJBA 4BYYA 4EMSA 2FQ3A 3IKVA 3MEXA 1FBQA 2CGPA 1K78A 2XAJA 3TOBA 1K78B 1ZYRF 2JPCA 2PMUA 2MC3A 2HWVA 5AIPA 2STTA 2BBYA 3HYIA 1AWCA 3ZMTA 2E7WA 3I58A 3R6SA 4EQQA 1Z6RA 3P9CA 4LFUA 2MA3A 4EJOA 4HX8A 1VTNC 3DP7A 4KT5C 1C0WA 4ESJA 3J7AO 2UWMA 4U7DA 4UV8A 3M8FA 2H94A 3NEUA 2EA4A 5AIQA 2F5EA 2HR3A 1RZ4A 1W7PD 4XRFA 2M45A 2FNAA 2X0LA 5E1WA 2EFOA 3WG9A 2GA1A 3I59A 1FBUA 3I59B 3E5XA 4L9NA 4LLLA 3EYYA 1XMKA 1W5SA 3C3WA 4WCGA 4I0BA 1WQ2A 3DFGA 3WGGA 1JXSA 3WE2A 2X4HA 1S3JA 2QYOA 3PQKA 4HYEA 4H0EA 4BNCA 2HTSA 4KIGA 1WI9A 1R1VA 3P9IA 2DAOA 4HV5A 4XLPF 1O3TA 3CDHA 3V8KA 4CICA 1XSVA 5D8KB 1P4XA 1JE8A 3KP4A 3ISPA 1HW1A 4KMUX 3SHFA 3J81K 2VBZA 3E6CC 3CLOA 3LAPA 3ZN0A 1ONVA 4MTDA 2HKXA 4LD5A 4BQAA 5ILUA 1W5TA 3HTSB 1SMTA 2Y75A 5BQTA 2K4JA 2PQ8A 2FEZA 4CXFA 2P4WA 1T38A 2XV4S 1I27A 5LEKA 5DEQA 1F4KA 3MQ0A 3E5UA 1LQ1A 1TW2A 3MCZA 4NQWA 3I53A 4CGZA 1MKMA 4A5MA 2DO7A 1G3TA 4AIHA 4HDUA 2UXXA 3IWZA 4M73A 1YS6A 2V9VA 5IT9Z 4CYDA 3GXOA 4KA4A 3GZ6A 1R1UA 2M1BA 4ENJA 2FXAA 3F3XA 3TGNA 1R23A 3V7SA 4FT8A 3RPUA 4GGGA 1D8KA 4ENNA 2NAZA 2O3FA 4A2UA 3DF8A 4WX9A 4MQVA 3GWZA 2IRFG 1IN5A 3KEOA 2W84A 2FBHA 1O57A 3FWEA 2VBWA 2F5CA 3BP8A 2DPUA 3E97A 2QENA 3ZMDA 2PN6A 5CVJA 1BI3A 2PLYA 4D0PA 4L0ZB 1R58A 3SXYA 2GA2A 3EDPA 3DPTA 4CDGA 3GYHX 2R7FA 3K2ZA 3ZQ7A 3E3VA 1XSXA 4F7ZA 3GEZA 3HRMA 3N4MA 3C18A 5DD4A 1FT9A 1KQ0A 4G6QA 3GF2A 4HQMA 4PDKA 2ZFWA 3OV8A 2AXLA 5LHHA 2M5WA 4Q5SF 2ETHA 2K02A 3TQNA 2BYVE 3WODF 3RTRA 1Z6TA 2OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HW0 A;  2FSW A;  1WWX A;  4RS8 A;  4BXU A;  3QU3 A;  3ROU A;  3WGI A;  3ZMV A;  4A0X A;  1TQM A;  5D6E A;  1QGP A;  2PI0 A;  1ZRD A;  2MLK A;  3FXQ A;  5IT9 K;  2BEO A;  3CJN A;  3Q9V A;  1F9N A;  1P6R A;  2QQ9 A;  4K2E A;  2IW5 A;  5J8F A;  5LLQ A;  4I09 A;  1FOK A;  4ENK A;  3TDZ C;  1REP C;  2VE8 A;  3HRU A;  3KET A;  1RUO A;  4IRG A;  4FX4 A;  3QP6 A;  2K4B A;  3JTH A;  2VE9 A;  4LG0 A;  3RYP A;  2ZME A;  4ZH4 F;  2ISZ A;  4LG0 B;  2ZME B;  3QPT A;  2P5K A;  1UCR A;  4OIP F;  3ZP5 A;  2Z5U A;  3H3Z A;  4YG2 F;  4L5I A;  4U0V A;  3EYI A;  2ZO4 A;  1F5T A;  1B59 A;  2KIM A;  2FU4 A;  2DFI A;  5BPD A;  2KRF A;  3WTX C;  1DPR A;  5A2Q Z;  4WWC A;  2UZK A;  4LJZ F;  3H92 A;  5ICG A;  2ACJ A;  1G3S A;  4G7O F;  4KN4 X;  3BJA A;  2PFB A;  1HBX G;  1LVA A;  2VN2 A;  4ZZL A;  2D1V A;  2H09 A;  2GZW A;  4IRI A;  4LK0 F;  2C6Y A;  2HTJ A;  2Q8K A;  1FYK A;  1XB4 A;  1HSJ A;  2HYF A;  1FLI A;  1EH6 A;  5D5W B;  5JI6 A;  1R00 A;  3GLX A;  1P4A A;  1G6N A;  4Q4Z F;  1YLF A;  4WXC A;  3WU0 A;  1V4R A;  3AAF A;  5J6X A;  1FX7 A;  3GFM A;  5E8I A;  4I2O A;  4IXA A;  2G7U A;  1GXQ A;  3O2P E;  2H27 A;  3T1B A;  4ASN A;  3L9F A;  4JK1 X;  3M9A A;  1KGS A;  4ZYG A;  2CWE A;  3I5U A;  1J75 A;  1A04 A;  4RGS A;  1RIO H;  2ELH A;  1R1T A;  1QZY A;  2W24 A;  3TO7 A;  3ABU A;  3BZ6 A;  3CTA A;  3G3Z A;  1B1B A;  3V8L A;  3LA2 A;  4JBA A;  1FYM A;  1MZB A;  2HZT A;  3N97 A;  4BH9 A;  2VOP A;  1FBS A;  5J8C A;  4LLN A;  1IN4 A;  2IP2 A;  3MFK A;  5HLG A;  4MEX F;  3I0T A;  5HS8 A;  3HOS A;  1LDJ A;  1J9I A;  3RIR A;  4PGG A;  3RKX A;  2EV5 A;  4HQE A;  2WC2 A;  1ZN2 A;  1JHH A;  1U5T A;  1DDN A;  4KNY A;  2DT5 A;  3PFI A;  4M71 A;  4CZZ A;  1K6O A;  1CGP A;  4AVP A;  1O3R A;  5D4R A;  3KP7 A;  1Z1D A;  5K5R A;  2CSO A;  2ESH A;  3I54 A;  2XAQ A;  4R79 A;  4IHS A;  5FB2 A;  2OA4 A;  4P96 A;  4ETS A;  1J5Y A;  1ZG1 A;  2GXB A;  1BN5 A;  2ISY A;  2XVC A;  5ILV A;  3FMQ A;  3KCC A;  2RQP A;  2VC1 A;  2NNY A;  1XGM A;  4GCV A;  3T0Y A;  3R0A A;  5IT3 A;  2DK8 A;  3FM5 A;  1U5T C;  1UB9 A;  2XAS A;  3QAH A;  3FMR A;  1TNS A;  4HF0 A;  3LQR A;  1SMY F;  1TNT A;  1FPQ A;  2J5P A;  4P55 A;  3F8B A;  1Q1H A;  3K1P A;  4ESB A;  1R36 A;  2D1H A;  2EFW A;  4IHT A;  3CUQ C;  1K7A A;  2L54 A;  1FSE A;  4WK8 F;  1YS7 A;  2HFH A;  3D5L A;  1ZH5 A;  5DD8 A;  4N9I A;  1YFH A;  4EV0 A;  4OMY A;  5L3C A;  2RVC A;  1I1G A;  3Q5F A;  4YFX F;  2ZKZ A;  5FD5 A;  4IJA A;  1RNL A;  2IVM A;  1T39 A;  1SD6 A;  1R22 A;  5LHG A;  3GVA A;  2QM3 A;  1ZAR A;  3GFJ A;  4M6X A;  2HS5 A;  2DW4 A;  3K9T A;  4O5V A;  4KMF A;  3FXU A;  4EJT A;  4UVC A;  2D45 A;  4KIF A;  4KDP A;  3F23 A;  1BC7 C;  4UVB A;  1G3Y A;  4Q47 A;  3ECO A;  1KU3 A;  3E6D A;  4RB2 C;  2RNJ A;  3IHU A;  5FD6 A;  1PP7 U;  4GYG A;  4MTE A;  4WXH A;  1OMI A;  3F22 A;  2DK5 A;  5ILS A;  5ICC A;  1FP1 D;  1FWZ A;  3KP6 A;  2OQG A;  3FZV A;  1B4A A;  2CQK A;  1OPC A;  2P5L C;  2RGV A;  1R7J A;  5DCM A;  4ESF A;  1QZZ A;  5DCM B;  1U8R A;  3C1D A;  4LB6 B;  3JAM Z;  3FM3 A;  1KU9 A;  5DUI A;  4P9F A;  2EA2 A;  4L9J A;  2YX7 A;  2ZJ2 A;  4RAZ A;  2KIF A;  3GFI A;  2L3D A;  4OOI A;  1LDK B;  2O61 A;  3L7W A;  3V4G A;  5K5O A;  4S04 A;  4BHB A;  1BIB A;  1MJ9 A;  3Q9S A;  2ZNZ A;  5LGT A;  2VT3 A;  1B9M A;  5FGM A;  5LEJ A;  3KP5 A;  3CO7 C;  2XHK A;  1KYZ A;  1YG2 A;  3F8F A;  5D5U B;  2Y0M A;  3IKT A;  3ULQ B;  3LFK A;  1LNW A;  1H9T A;  4EM0 B;  2ADU A;  1OR7 A;  4ZYH A;  2LSO A;  1RI7 A;  1R5H A;  5HDG A;  5E1X A;  1B6A A;  2KJC A;  1JGS A;  3F8C A;  3L00 A;  2Z3Y A;  3K69 A;  3HSF A;  3DKW A;  4LLG F;  3L09 A;  4AIK A;  2A3S A;  3H3U A;  2XAH A;  4ZYD A;  1O3S A;  4L9V A;  5D8L B;  4L0Y B;  2PJP A;  1SD5 A;  2QQA A;  5JVT A;  3JSO A;  1FY7 A;  4OIO F;  1KU7 A;  1RUN A;  1CF7 A;  3WTY C;  2W25 A;  1CF7 B;  5ED4 A;  5L3G A;  2XKP A;  3K1N A;  4DNC A;  2K27 A;  1OYY A;  4ZYE A;  3WTZ A;  4ZZD A;  3D0S A;  4MQ9 F;  3IC7 A;  3WE3 A;  5HDK A;  1S7A A;  1HST A;  5HLI A;  2WWY A;  1TBX A;  2Q2E A;  2HOE A;  1XMA A;  4U0W A;  1SFE A;  1LJ9 A;  1IN7 A;  1R5G A;  3HSE A;  2JTV A;  5HOO A;  2CO5 A;  3P9K A;  5ICF A;  2OQR A;  5LHI A;  1ZRE A;  3GUD A;  5CJ9 A;  4HBL A;  4I0A A;  3JAM K;  5K5Q A;  4HX7 A;  2EFQ A;  3BOQ A;  2KJB A;  5FLX Z;  2VT2 A;  1K79 A;  1QBJ A;  4QLC U;  4P9U A;  5H6R A;  2VBY A;  2IPQ X;  4AWX B;  3HRS A;  1SFX A;  2EWN A;  3U1D A;  3TO9 A;  1IF1 A;  3BPX A;  1Z7U A;  1LEB A;  2J5O A;  3M7G A;  1ULY A;  5E18 F;  1TQP A;  4JQF A;  2HDC A;  5F6F A;  1XD7 A;  2V1D A;  1O3Q A;  2YSR A;  1XCB A;  3F6V A;  3KP3 A;  1S29 A;  1ZG3 A;  4R8H A;  3TO6 A;  3RJP A;  3NQO A;  1FNN A;  1ZLJ A;  4A5N A;  1BI0 A;  2XKO A;  4XSX F;  3IRR A;  1D8J A;  4DQ2 A;  2RKH A;  2WTE A;  1FC3 A;  2KKO A;  4HAM A;  4CO8 A;  3K1M A;  5TRD A;  3ZMU A;  2H6B A;  1S8N A;  1HKS A;  3V7C A;  2RN7 A;  5HVQ C;  4PZJ A;  2HEO A;  2QZ8 A;  3E6M A;  3W6J B;  5CVV A;  1I6X A;  1L3L A;  4LK1 F;  2LF8 A;  5ERI A;  3S2W A;  3DQV C;  5CYV A;  1FSH A;  1YO5 C;  1EH7 A;  2FBK A;  3I4P A;  5AON A;  5LRR A;  4HF1 A;  3ZMS A;  4CHU A;  3VFZ A;  4LMY A;  5L3E A;  5DUK A;  1QQI A;  3HIF A;  2W57 A;  1T6S A;  3WTU C;  2P8T A;  3F8M A;  4OMZ A;  4RB0 A;  2DBB A;  2JRT A;  1IAW A;  1ON1 A;  3QPH A;  2V79 A;  4HA8 A;  2TDX A;  2CYY A;  1G4D A;  3QRF F;  2IA2 A;  2ZBK A;  3E5Q A;  1BM9 A;  1P92 A;  2RV8 A;  1SAX A;  2DPD A;  4AIJ A;  1TQI A;  1IN6 A;  4I98 B;  2E1C A;  2Q0O A;  2YPR A;  3REO A;  4LGW A;  3GW2 A;  1KYW A;  3RI4 A;  3ZPL A;  2FA5 A;  5LGN A;  4RGR A;  3QOP A;  4MEY F;  1S7O A;  2B0L A;  1PUE E;  4M9X A;  2A68 F;  5EEG A;  3IRQ A;  2JPB A;  2F2E A;  1ZRF A;  3I71 A;  5HLH A;  2L01 A;  4GXO A;  4RAY A;  4EVI A;  1F1Z A;  1I1S A;  1G3W A;  4G6D A;  3ABT A;  1KQ8 A;  3MZY A;  4XLN F;  4PGH A;  4KFC A;  1YQA A;  2CFX A;  2Z33 A;  1B9N A;  1HW2 A;  3E6B A;  3KZY A;  4WXD A;  1H9G A;  2QQB A;  1OYI A;  1XSD A;  2R7D A;  4OIQ F;  2XUB A;  1XGO A;  1OKR A;  1ZGJ A;  2DQR A;  2FF4 A;  2STW A;  5BMZ A;  1T2K A;  4G7Z F;  1ZHF A;  1YYV A;  1U6G A;  4YFK F;  2V6C A;  2QUF A;  4IRH A;  1IRG A;  1T0F A;  1TLH B;  1WRJ A;  2L4M A;  2PMH A;  1LEA A;  3DEU A;  4YFN F;  5ICE A;  3FF5 A;  5E20 A;  4XSZ F;  2GXG A;  5HDN A;  2E7X A;  1H0M A;  3HRT A;  2D2W A;  2WV0 A;  2FNP A;  4KYW A;  1USS A;  4MHG A;  2IJL A;  1AOY A;  5LGU A;  4QWQ A;  4M6Y A;  5KVR A;  3WTW C;  1HKQ A;  4U88 A;  1OYW A;  4MNU A;  5A2Q K;  2VOO A;  1LDD A;  3R0J A;  1J7K A;  1U78 A;  4AD9 A;  3JW4 A;  1FP2 A;  1U2W A;  3KZZ A;  5CVI A;  4XBF A;  4A0Y A;  1GVJ A;  2K7L A;  5BPI A;  3GZ5 A;  2V1X A;  5DYM A;  2P5V A;  2A69 F;  1HXD A;  4I01 A;  3KE2 A;  1J0R A;  3B73 A;  3U9G A;  2YU3 A;  4L18 B;  3R60 A;  4HV6 A;  4R1H A;  5CLS A;  2M30 A;  4GO1 A;  3T5X A;  3O3K A;  2Z9O A;  1HW5 A;  1UHW A;  3HUG A;  3GX4 X;  2NYX A;  4YII A;  3IWF A;  2UXN A;  4NHJ A;  3U2R A;  1DP7 P;  2NRA C;  3BJ6 A;  5JHU A;  2GQQ A;  1ODD A;  2P6S A;  2COM A;  2FE3 A;  2VXZ A;  1WSU A;  1I5Z A;  2XAF A;  5FFZ A;  4IF4 A;  3LA3 A;  2M87 A;  2FML A;  5JR3 A;  4WF2 A;  4HZF A;  5DV5 A;  1IN8 A;  2ZNY A;  1BBY A;  2Y48 A;  2A6E F;  4A6E A;  2DU9 A;  3V8J A;  2EFN A;  3BRO A;  3VEP A;  1Z91 A;  4IPA A;  1MD0 A;  3HHG A;  1O7L A;  4EGZ A;  5HS9 A;  2QWW A;  2CG4 A;  4Y13 A;  4UHT A;  5CVR A;  4RGX A;  3MZH A;  4L5J A;  2OD5 A;  2VC0 A;  4G94 A;  3OOP A;  1BI2 A;  1IXS B;  1DPU A;  2KIU A;  3KFW X;  2EJR A;  1QNT A;  1SFU A;  1E2X A;  3WTS C;  1KA8 A;  2DLL A;  2GWR A;  4ENM A;  1MJA A;  3BDD A;  3B02 A;  4OIN F;  2H6C A;  1ZLK A;  1BC8 C;  2E1N A;  1Z9C A;  4Q48 A;  2NS0 A;  5L3D A;  4I02 A;  4GYI A;  1FYL A;  3RYR A;  1L0O C;  3ZN1 A;  1EV7 A;  3LA7 A;  1Z05 A;  4U0Y A;  3T8R A;  5D4S A;  2P6T A;  2ESN A;  3HHH A;  2EB7 A;  5F64 A;  4N0B A;  1SD4 A;  2RC4 A;  5JFR A;  1Y0U A;  2FMY A;  5CVU A;  3KLO A;  2O6G E;  2DQL A;  4HOB A;  2QBY A;  1IRF A;  4RGU A;  5H20 A;  2QBY B;  4KIB A;  3BPV A;  1BI1 A;  3KEQ A;  2G9W A;  3F8N A;  2EK5 A;  1DUX C;  3MAJ A;  2QLZ A;  2P7V B;  4Z2Y A;  5FFX A;  3VB2 A;  2O03 A;  5DCF A;  1STZ A;  2EV0 A;  4ON0 A;  5D5V B;  3CO6 C;  5E17 F;  2HYG D;  4UV9 A;  4EJV A;  3RKY A;  3GO5 A;  4FX0 A;  3FXR A;  3LWF A;  2RDP A;  2BGC A;  1SD7 A;  2XIG A;  1E17 A;  3FMS A;  3J80 Z;  5TJJ A;  3LQQ A;  1XDS A;  2FRH A;  3EUH A;  1O7F A;  4S05 A;  2BE5 F;  1UFM A;  3TDU C;  2F5F A;  2G7H A;  4E70 A;  4RB1 A;  4EJU A;  4OU0 A;  2LKP A;  4Y15 A;  1V3F A;  1UHM A;  3PQJ A;  2JT1 A;  1UST A;  6PAX A;  3WGH A;  4B09 A;  1S6L A;  4MGR A;  3DPL C;  1KQ9 A;  1ZG5 A;  4UXN A;  1XGS A;  4PCQ A;  4UUV A;  2VON A;  2IA1 A;  2YX4 A;  3R61 A;  2FBI A;  5LRS A;  3GFL A;  1T98 A;  2NNN A;  2HQN A;  5FO5 A;  1YW7 A;  2M8E A;  1D5V A;  3F72 A;  4OIR F;  1JHF A;  3SZT A;  1XGN A;  2LDU A;  4KUM A;  3TOA A;  3WTT C;  3TKY A;  2A07 F;  3V7R A;  2L02 A;  4A6D A;  5E8G A;  3VOE A;  3HSR A;  4EJW A;  1GXP A;  3F6O A;  4BAY A;  1J59 A;  1XCV A;  1IW7 F;  2IA0 A;  3NRV A;  2FOK A;  3F21 A;  1MGT A;  2R3S A;  4LB5 A;  4BHC A;  4L9T A;  3ZMZ A;  2JZY A;  5KK1 A;  3FX3 A;  1XN7 A;  2OBP A;  2EFP A;  2OAZ A;  5L3F A;  3CUO A;  2P7C B;  2MH2 A;  1BOA A;  1U3E M;  1P4W A;  2AS5 F;  2QVO A;  3I64 A;  3HTU A;  3ELK A;  4EGY A;  5BOX A;  3L2C A;  3J80 K;  3LST A;  2DTR A;  3JSP A;  3EET A;  1IXR C;  1P2F A;  4KIC A;  5FLX K;  2HGC A;  3SZP A;  3EQL F;  1YW8 A;  4G8X A;  3KP2 A;  4G7H F;  1TTY A;  4TV7 A;  4M9Z A;  1J2X A;  1HKT A;  1ON2 A;  4HLX A;  4U7B A;  1GHC A;  1YIO A;  2OU2 A;  1QPM A;  3MWM A;  3IL2 A;  1W4M A;  4KN7 X;  4HF2 A;  4YIF A;  3SFZ A;  3G73 A;  3ERE D;  3BY6 A;  2ZXJ A;  2HQR A;  2ZCW A;  2W85 A;  1PP8 F;  5HS7 A;  2EV6 A;  1QO0 D;  2DI3 A;  2MH9 A;  1IXC A;  2XAG A;  2O0Y A;  4A0Z A;  1BJA A;  3M1E A;  2O8X A;  5L3B A;  2CW0 F;  3WTV C;  1IZ1 A;  1D3Y A;  3QU6 A;  4BHP A;  1W7P A;  1XDU A;  3WU1 B;  1W7P B;  1NHA A;  3P7N A;  1TW3 A;  4EM2 A;  2PEX A;  3BJO A;  1YW9 A;  3BWG A;  2MBF A;  1EH8 A;  3QP5 A;  4EM1 A;  2A5Y B;  2K86 A;  4UVA A;  2VBX A;  2HKO A;  4HLY A;  2XRO A;  1YTY A;  1IUY A;  3VOD A;  5F1R A;  3M8E A;  1ZAO A;  3LAJ A;  2PBI A;  1BIA A;  3DV8 A;  1FZP B;  1PDN C;  5DDG A;  2PG4 A;  2IT0 A;  3SQN A;  3COA C;  5LBQ A;  4M74 A;  2JSC A;  1ZRC A;  1HQC A;  1U5T B;  4P5O A;  4B8X A;  2OZ6 A;  2VOD A;  4O3M A;  3C7J A;  5D5X B;  3FHZ A;  4G9Y A;  3KLN A;  4HDV A;  2V1U A;  4A12 A;  2A6H F;  4M72 A;  4HX4 A;  3DXJ F;  3CUQ A;  2A61 A;  4FHT A;  3CUQ B;  2BV6 A;  2LNB A;  3RPQ A;  1KU2 A;  1ZGA A;  3ECH A;  2XGX A;  3RDI A;  1X3U A;  1MDM A;  2L4A A;  2MLG A;  1MDM B;  3ML6 A;  4Y17 A;  2Z99 A;  2MD5 A;  2F5D A;  3O6B B;  5D6F A;  4IVN A;  1LB2 A;  2YR2 A;  4M9S A;  3HOT A;  4I7H A;  3K0L A;  5EEH A;  2LF7 A;  4UNO A;  4N9H A;  4O6J A;  5BS6 A;  3W6K B;  3JTG A;  1WKM A;  2GIV A;  5E1Z B;  3RKW A;  5K1Y A;  3R4K A;  5H6Q A;  3J81 Z;  4RB3 C;  2GAU A;  2XRN A;  3T8T A;  4NB5 A;  1MJB A;  4BYY A;  4EMS A;  2FQ3 A;  3IKV A;  3MEX A;  1FBQ A;  2CGP A;  1K78 A;  2XAJ A;  3TOB A;  1K78 B;  1ZYR F;  2JPC A;  2PMU A;  2MC3 A;  2HWV A;  5AIP A;  2STT A;  2BBY A;  3HYI A;  1AWC A;  3ZMT A;  2E7W A;  3I58 A;  3R6S A;  4EQQ A;  1Z6R A;  3P9C A;  4LFU A;  2MA3 A;  4EJO A;  4HX8 A;  1VTN C;  3DP7 A;  4KT5 C;  1C0W A;  4ESJ A;  3J7A O;  2UWM A;  4U7D A;  4UV8 A;  3M8F A;  2H94 A;  3NEU A;  2EA4 A;  5AIQ A;  2F5E A;  2HR3 A;  1RZ4 A;  1W7P D;  4XRF A;  2M45 A;  2FNA A;  2X0L A;  5E1W A;  2EFO A;  3WG9 A;  2GA1 A;  3I59 A;  1FBU A;  3I59 B;  3E5X A;  4L9N A;  4LLL A;  3EYY A;  1XMK A;  1W5S A;  3C3W A;  4WCG A;  4I0B A;  1WQ2 A;  3DFG A;  3WGG A;  1JXS A;  3WE2 A;  2X4H A;  1S3J A;  2QYO A;  3PQK A;  4HYE A;  4H0E A;  4BNC A;  2HTS A;  4KIG A;  1WI9 A;  1R1V A;  3P9I A;  2DAO A;  4HV5 A;  4XLP F;  1O3T A;  3CDH A;  3V8K A;  4CIC A;  1XSV A;  5D8K B;  1P4X A;  1JE8 A;  3KP4 A;  3ISP A;  1HW1 A;  4KMU X;  3SHF A;  3J81 K;  2VBZ A;  3E6C C;  3CLO A;  3LAP A;  3ZN0 A;  1ONV A;  4MTD A;  2HKX A;  4LD5 A;  4BQA A;  5ILU A;  1W5T A;  3HTS B;  1SMT A;  2Y75 A;  5BQT A;  2K4J A;  2PQ8 A;  2FEZ A;  4CXF A;  2P4W A;  1T38 A;  2XV4 S;  1I27 A;  5LEK A;  5DEQ A;  1F4K A;  3MQ0 A;  3E5U A;  1LQ1 A;  1TW2 A;  3MCZ A;  4NQW A;  3I53 A;  4CGZ A;  1MKM A;  4A5M A;  2DO7 A;  1G3T A;  4AIH A;  4HDU A;  2UXX A;  3IWZ A;  4M73 A;  1YS6 A;  2V9V A;  5IT9 Z;  4CYD A;  3GXO A;  4KA4 A;  3GZ6 A;  1R1U A;  2M1B A;  4ENJ A;  2FXA A;  3F3X A;  3TGN A;  1R23 A;  3V7S A;  4FT8 A;  3RPU A;  4GGG A;  1D8K A;  4ENN A;  2NAZ A;  2O3F A;  4A2U A;  3DF8 A;  4WX9 A;  4MQV A;  3GWZ A;  2IRF G;  1IN5 A;  3KEO A;  2W84 A;  2FBH A;  1O57 A;  3FWE A;  2VBW A;  2F5C A;  3BP8 A;  2DPU A;  3E97 A;  2QEN A;  3ZMD A;  2PN6 A;  5CVJ A;  1BI3 A;  2PLY A;  4D0P A;  4L0Z B;  1R58 A;  3SXY A;  2GA2 A;  3EDP A;  3DPT A;  4CDG A;  3GYH X;  2R7F A;  3K2Z A;  3ZQ7 A;  3E3V A;  1XSX A;  4F7Z A;  3GEZ A;  3HRM A;  3N4M A;  3C18 A;  5DD4 A;  1FT9 A;  1KQ0 A;  4G6Q A;  3GF2 A;  4HQM A;  4PDK A;  2ZFW A;  3OV8 A;  2AXL A;  5LHH A;  2M5W A;  4Q5S F;  2ETH A;  2K02 A;  3TQN A;  2BYV E;  3WOD F;  3RTR A;  1Z6T A;  2OZU A; 
#chains in the Genus database with same CATH topology
 3GTJ J;  3UKG A;  2W4S A;  4HW0 A;  3DCF A;  4X6A J;  2NVY J;  3S1R J;  2XC7 A;  2FSW A;  1WWX A;  4RS8 A;  2X6W A;  4BXU A;  1B72 B;  3QU3 A;  2DMQ A;  2M0C A;  3ROU A;  3TMO A;  3WGI A;  3ZMV A;  4A0X A;  1TQM A;  5E3M A;  1TWF J;  5D6E A;  1QGP A;  2BY1 A;  2LBF A;  4JOM A;  2EPF A;  3GTM J;  2DMP A;  2PI0 A;  5FLV A;  3PNT A;  4W1U A;  2AQE A;  3HGY A;  4XM3 A;  1ZRD A;  2MLK A;  3FXQ A;  1VQ7 I;  1NH3 A;  5IT9 K;  5JLW A;  1MSF C;  2DA4 A;  4ZDP A;  1P9Q C;  4ZC3 A;  2W48 A;  2WAF A;  2CV0 A;  1EKE A;  2BEO A;  3CJN A;  3Q9V A;  4QPO A;  1F9N A;  1P6R A;  2QQ9 A;  4K2E A;  1ZGW A;  2IW5 A;  5J8F A;  5LLQ A;  3AKZ A;  4I09 A;  1GV2 A;  3SEQ A;  4XKC A;  1FOK A;  4ENK A;  3PJR A;  3FXL A;  1BW6 A;  1TWG J;  3TDZ C;  1REP C;  2VE8 A;  3JRC A;  3CCM I;  3CDI A;  3HRU A;  4CSW A;  3JRA A;  2IAI A;  3KET A;  3H9G A;  1RUO A;  3CCL I;  1W5C C;  1Y6I A;  2E2I J;  2LP0 A;  4IRG A;  4FX4 A;  3QP6 A;  4IOC F;  2K4B A;  3JTH A;  1K83 J;  1MMG A;  4AYB A;  2VE9 A;  2FX0 A;  2LRE A;  3BTL A;  2ZME A;  3NWS A;  4JYK A;  4LG0 A;  2E19 A;  3RYP A;  4ZH4 F;  1R49 A;  2ISZ A;  1YRN A;  4LG0 B;  2ZME B;  2P0W A;  3QPT A;  2P5K A;  3QYE A;  1UCR A;  1YRN B;  4OIP F;  4XON A;  3H3V K;  1X1A A;  3ZP5 A;  3BG6 A;  3RZO J;  1ETO A;  2Z5U A;  3H3Z A;  2BW3 A;  4YG2 F;  4L5I A;  4U0V A;  3CMM A;  3H36 A;  3I3L A;  2XF5 A;  2ZO4 A;  2R7Q A;  3KZI C;  4FET A;  4XOR A;  3EYI A;  1F5T A;  4UB6 C;  1YJN I;  2LRD A;  1B59 A;  2KIM A;  2FU4 A;  1UZC A;  2DFI A;  4CCM A;  2AXT C;  2R5Z A;  5BPD A;  2W1O A;  2KRF A;  3K4B A;  3WTX C;  1DPR A;  1AA7 A;  5A2Q Z;  4WWC A;  2UZK A;  4LJZ F;  3H92 A;  2E1O A;  5ICG A;  2DT7 B;  2ACJ A;  1G3S A;  3SDG A;  2VQH A;  3ZQF A;  4G7O F;  2CMP A;  4KN4 X;  3BJA A;  2IS2 A;  2PFB A;  1HBX G;  2OUM A;  1MBE A;  4AC0 A;  3RPU D;  1LVA A;  3W3C A;  5KNL A;  5FJ8 J;  2VN2 A;  2VKD A;  4ZZL A;  2D1V A;  2H09 A;  3BCA A;  3OYH A;  2B63 J;  2GZW A;  4IRI A;  4LK0 F;  2C6Y A;  3S2D J;  2W7N A;  4Y52 J;  4AID A;  2FQ4 A;  2HTJ A;  2QKL B;  3P5J A;  2Q8K A;  2Y0S A;  3BG5 A;  1ETY A;  1RES A;  2OTL I;  1FYK A;  2ECC A;  5FKL A;  2JA7 J;  2JA5 J;  1XB4 A;  1YHQ I;  1HSJ A;  2HYF A;  1FLI A;  1EH6 A;  3OYN A;  5D5W B;  5JI6 A;  1R00 A;  4F91 B;  1XG1 A;  3ZGK A;  2JSP A;  3GLX A;  1P4A A;  1G6N A;  3S93 A;  4E7H A;  2R7S A;  2MC4 A;  2PJR A;  5F0H A;  2PJR B;  3BLY A;  4Q4Z F;  1D5Y A;  4B44 A;  1YLF A;  4WXC A;  3WU0 A;  1V4R A;  3V42 A;  2BZT A;  3AAF A;  4IZZ A;  5J6X A;  1T8I A;  1FX7 A;  2DA6 A;  4BQO A;  5M3M J;  2NXN B;  4HRI A;  3GFM A;  5E8I A;  4I2O A;  4IXA A;  2G7U A;  5M5W J;  1GXQ A;  3O2P E;  2H27 A;  3T1B A;  2O9L A;  4ASN A;  3L9F A;  4JK1 X;  2WAE A;  3M9A A;  3HOZ J;  1KGS A;  4ZYG A;  2CWE A;  3I5U A;  5EJC A;  4BS9 A;  4BAC A;  2DFH A;  1N75 A;  1J75 A;  1A04 A;  2TCT A;  4A3M J;  4RGS A;  3HDD A;  3QQA A;  1RIO H;  2ELH A;  4W97 A;  2DDB A;  1A31 A;  1R1T A;  2CQN A;  1QZY A;  1ZTR A;  2W24 A;  3G1O A;  3TO7 A;  3ABU A;  3HM5 A;  3BZ6 A;  3CTA A;  3OOU A;  3G3Z A;  1BOB A;  5JLX A;  1B1B A;  3CF5 F;  1FIA A;  3V8L A;  3LA2 A;  4JBA A;  1VQL I;  1FYM A;  1MZB A;  2HZD A;  2HZT A;  2V9K A;  3VYU B;  3N97 A;  1I3A A;  4BH9 A;  2VOP A;  5F0F A;  1FBS A;  2DYS H;  5J8C A;  4LLN A;  1IN4 A;  2IP2 A;  3MFK A;  1QU3 A;  2LTP A;  2XGD A;  1UJ8 A;  4BQQ A;  5HLG A;  4MEX F;  3I0T A;  2DMT A;  5HS8 A;  2VQC A;  1PYV A;  3HOS A;  1LDJ A;  4D5C A;  3K4M A;  3RIR A;  1J9I A;  4PGG A;  3HKZ N;  3ONQ A;  3RKX A;  2EV5 A;  2XF6 A;  5C4X J;  1UG0 A;  4RAF A;  4HQE A;  2WC2 A;  3G1M A;  1ZN2 A;  2QGU A;  3MVP A;  1HCR A;  1JHH A;  1U5T A;  1DDN A;  2VKH A;  2GOM A;  2M34 A;  4KNY A;  2DT5 A;  1QHG A;  3K4J A;  1MIJ A;  3PFI A;  3ZQI A;  4A93 J;  4M71 A;  4II2 A;  2HU9 A;  3D1N I;  4CZZ A;  3LFU A;  3KYD B;  4U87 A;  3HL2 A;  1K6O A;  3S16 J;  1CGP A;  4AVP A;  3WHC A;  5D4R A;  1O3R A;  3KP7 A;  1Z1D A;  1JUS A;  4B48 A;  2BVM A;  5K5R A;  2CSO A;  2ESH A;  3I54 A;  5M5X J;  3CMA I;  2XAQ A;  4NNJ A;  4R79 A;  2EIK H;  1VQK I;  4IHS A;  3GTQ J;  2ID6 A;  2GM4 A;  5FB2 A;  3BTI A;  1XC5 A;  4CCK A;  2OA4 A;  4P96 A;  4ETS A;  1J5Y A;  2XF7 A;  1ZG1 A;  2GXB A;  2KFD A;  1BN5 A;  2FUG 2;  2ISY A;  2XVC A;  1JT0 A;  5FKK A;  5ILV A;  3FMQ A;  3KCC A;  2RQP A;  3W2A A;  3H9Q A;  2VC1 A;  2NNY A;  1XGM A;  2MYS A;  4GCV A;  2L9R A;  3HOY J;  3T0Y A;  3BG3 A;  3R0A A;  5IT3 A;  2DK8 A;  3FM5 A;  1U5T C;  2L5Q A;  1UB9 A;  2XAS A;  4C30 A;  1GUU A;  3QAH A;  3GZN B;  3FMR A;  2VPR A;  1TNS A;  3OMY A;  1WJC A;  4HF0 A;  3K70 C;  2I5U A;  1MMA A;  3PUF A;  3LQR A;  3MKY B;  3GTP J;  1SMY F;  1TNT A;  1NG6 A;  1FPQ A;  2J5P A;  4Z6Y A;  3FBI B;  4P55 A;  3F8B A;  1Q1H A;  3K1P A;  4ESB A;  1R36 A;  4AM3 A;  2D1H A;  2JWT A;  3OYL A;  2EFW A;  4IHT A;  2DTZ A;  1MBF A;  4ITV A;  3CUQ C;  2Y9Z A;  4BE0 A;  1K7A A;  3CCJ I;  2L54 A;  3D5S C;  3C2B A;  4LIU A;  1BR2 A;  1FSE A;  4WK8 F;  4E7K A;  3F0C A;  1YS7 A;  2HFH A;  3BG9 A;  3JRE A;  3D5L A;  4QPQ A;  1ZH5 A;  5DD8 A;  1ORK A;  4N9I A;  1YFH A;  4XLA A;  4XOT A;  4EV0 A;  3JRI A;  4OMY A;  5L3C A;  2RVC A;  1SVL A;  5DS9 A;  3FBN B;  3AG4 H;  4GRI A;  1I1G A;  3PSI A;  3Q5F A;  3ABM H;  4YFX F;  2ZKZ A;  5FD5 A;  4IJA A;  1RNL A;  5B1B H;  2E71 A;  3OYM A;  3HG9 A;  3FXK A;  2IVM A;  2Z1D A;  3A1Y A;  1T39 A;  1SD6 A;  1R22 A;  5FRN A;  2L7F P;  2L7Z A;  1QZE A;  3M07 A;  1ZR2 A;  5LHG A;  3GVA A;  2QM3 A;  2VI6 A;  2BHY A;  1ZAR A;  3GFJ A;  4M6X A;  2HS5 A;  1B8I A;  2DW4 A;  3K9T A;  5C44 J;  4YEL A;  4O5V A;  2XSD C;  1B8I B;  1QA6 A;  1WVR A;  3S3N A;  4KMF A;  3J7A Y;  3FXU A;  3DLL F;  4FQG A;  4EJT A;  1OLT A;  2VPL A;  4UVC A;  3X2Q H;  4RA2 A;  2IGK A;  2D45 A;  4KIF A;  1W1W E;  1A35 A;  3S15 J;  3GBG A;  4KDP A;  4IHV A;  3F23 A;  1BC7 C;  4UVB A;  2M2E A;  2M8G X;  1ERD A;  1G3Y A;  3OIO A;  4Q47 A;  2CUZ A;  3KX2 A;  3ECO A;  1KU3 A;  1ZR4 A;  3E6D A;  1N78 A;  4RB2 C;  4XLF A;  2RNJ A;  1RET A;  3IHU A;  5FD6 A;  2K9M A;  1PP7 U;  4GYG A;  3EPZ A;  4MTE A;  4WXH A;  3BC8 A;  3OIP A;  3G71 I;  1OMI A;  2KQR A;  3F22 A;  2DK5 A;  5ILS A;  5ICC A;  1FP1 D;  1FWZ A;  2DOA A;  3GCM A;  2OQG A;  3KP6 A;  2VKE A;  3FZV A;  3OY9 A;  1B4A A;  2CQK A;  1OPC A;  2A6T A;  4BJT A;  3LSH A;  2L2O A;  2P5L C;  1YIJ I;  1FTT A;  2RGV A;  1WZ2 A;  4A3L J;  1P7I A;  2K40 A;  4LIT A;  2JA8 J;  4NC7 A;  4RM3 A;  1R7J A;  1V54 H;  3LMM A;  2CQX A;  5DCM A;  4ESF A;  1QZZ A;  3OL4 A;  3VYR B;  5DCM B;  3L1P A;  3OS0 A;  1U8R A;  3C1D A;  4LB6 B;  3JAM Z;  3FM3 A;  1KU9 A;  1NK2 P;  5EYR A;  1H89 C;  1LUJ B;  4CYC A;  5DUI A;  1BR4 A;  1YOV B;  4P9F A;  4CYC B;  1S72 I;  2EA2 A;  4L9J A;  2YX7 A;  2ZJ2 A;  4RAZ A;  2LR8 A;  2KIF A;  2VL8 A;  4DIQ A;  3GFI A;  2L3D A;  1R71 A;  4OOI A;  1LDK B;  2O61 A;  1TT5 B;  3L7W A;  3S2H J;  3V4G A;  5K5O A;  4DYC A;  3J7Y J;  4S04 A;  5F0C A;  4BHB A;  2E35 A;  2M4G A;  1SAN A;  3AG3 H;  1BIB A;  2QQ8 A;  5H2F C;  3KPH A;  2JJ7 A;  3CQZ J;  1MJ9 A;  5E79 C;  2B9S A;  1WJA A;  3Q9S A;  2ZNZ A;  3TL4 X;  5LGT A;  2VT3 A;  1B9M A;  3FIS A;  5FGM A;  5LEJ A;  3KP5 A;  2CV2 A;  3CO7 C;  1T08 B;  2XHK A;  1KYZ A;  1YG2 A;  2XAU A;  3F8F A;  4E7Z A;  2Y0M A;  2Z16 A;  4MLO A;  5D5U B;  3IKT A;  3ULQ B;  3LFK A;  2EZI A;  4UB8 C;  4ZDO A;  1LNW A;  1H9T A;  1ACI A;  2QSH X;  3QYF A;  5HNF A;  4EM0 B;  2ADU A;  1OR7 A;  1MH4 A;  4ZYH A;  2LSO A;  2RNG A;  1RI7 A;  1VQ6 I;  1R5H A;  2L7M P;  5HDG A;  5E1X A;  1B6A A;  2KJC A;  1DQU A;  1JGS A;  4IQJ A;  2WA0 A;  3F8C A;  3L00 A;  3OYC A;  2Z3Y A;  3ABL H;  1XMX A;  3K69 A;  3BQZ A;  3HSF A;  4CCJ A;  3DKW A;  1IRX A;  2LG4 A;  4LLG F;  3L09 A;  2JA2 A;  1MW7 A;  4AIK A;  2A3S A;  3H3U A;  1RRJ A;  2XAH A;  4ZYD A;  4DGW B;  1O3S A;  1R4N B;  4L9V A;  5D8L B;  2R92 J;  1TP4 A;  4JX5 A;  4C2M J;  3LSP A;  4L0Y B;  2PJP A;  1VQ5 I;  1SD5 A;  2QQA A;  5JVT A;  5DTD A;  3JSO A;  3J7Z I;  2GBY A;  1FY7 A;  4XN0 A;  1VQ9 I;  1MH3 A;  1KU7 A;  4OIO F;  1RUN A;  4ZTF A;  1CF7 A;  3WTY C;  2W25 A;  2OCE A;  1CF7 B;  5ED4 A;  5L3G A;  2XKP A;  5F27 A;  3K1N A;  4DNC A;  3VSK A;  1Z3Y A;  3L2U A;  2K27 A;  1OYY A;  2VJ4 A;  2ZSH B;  4ZYE A;  3OWT A;  3WTZ A;  3S3O A;  2EIL H;  3D0S A;  4ZZD A;  4MQ9 F;  2BOL A;  4KIT B;  3IC7 A;  3WE3 A;  5HDK A;  1S7A A;  3PUB A;  1HST A;  5HLI A;  2WWY A;  2LY9 A;  2RRE A;  1TBX A;  3H1C A;  1SAU A;  4QTR A;  2Q2E A;  2HOE A;  2DYR H;  2CUJ A;  2BY0 A;  2Q2E B;  1XMA A;  4U0W A;  3HPG A;  2HDW A;  3DBL B;  1SFE A;  1LJ9 A;  1IN7 A;  1R5G A;  3HSE A;  2DT6 A;  2JTV A;  5HOO A;  2CO5 A;  5E3O A;  3P9K A;  3L2V A;  5ICF A;  2XPW A;  1I39 A;  2AQF A;  2OQR A;  2ICW G;  5LHI A;  1ZRE A;  3GUD A;  5CJ9 A;  4HBL A;  3ZXS A;  3ZQQ A;  2EIJ H;  1VQ4 I;  4I0A A;  3ZCO A;  3JAM K;  5DM6 F;  1DU0 A;  2XRL A;  2WBM A;  5K5Q A;  4HX7 A;  4B4C A;  2EFQ A;  3FK6 A;  3BOQ A;  2KJB A;  1FMV A;  5FLX Z;  2VT2 A;  1K61 A;  2NVT J;  3IH2 A;  3UNG C;  1U9O A;  1K79 A;  2UV1 A;  3HC7 A;  1QBJ A;  4QLC U;  3QWL A;  2XB5 A;  4P9U A;  5KCM A;  2JVG A;  5H6R A;  1HA8 A;  2VBY A;  3IP4 B;  2IPQ X;  4AWX B;  3HRS A;  4FTH A;  1RPW A;  2R7T A;  1SFX A;  2EWN A;  3U1D A;  3TO9 A;  1A5J A;  1IF1 A;  3BPX A;  1Z7U A;  2H8R A;  2KMU A;  1MBK A;  3OSG A;  1LEB A;  2J5O A;  1F36 A;  2OJE D;  4E7L A;  3M7G A;  1X4P A;  1ULY A;  5E18 F;  4BXF A;  4IL6 C;  1TQP A;  4XNF A;  4JQF A;  3VYT B;  2HDC A;  5F6F A;  1XD7 A;  2R7X A;  5GPA A;  5IYC J;  2V1D A;  1O3Q A;  2YSR A;  4C2T A;  1XCB A;  3EUA A;  3F6V A;  1OJL A;  2L9V A;  4HG2 A;  3KP3 A;  1S29 A;  5K7F A;  1ZG3 A;  4R8H A;  3TO6 A;  3TED A;  1B72 A;  2NVX J;  3RJP A;  3NQO A;  3S32 A;  2M3A A;  1FNN A;  1ZLJ A;  4A5N A;  3DLA A;  1BI0 A;  3FDY A;  3WU2 C;  1OFC X;  2XKO A;  4XSX F;  1APL C;  2ZSI B;  3IRR A;  1TZL A;  2R7Z J;  3PNY A;  1D8J A;  4DQ2 A;  2EQR A;  4KIS A;  2DDA A;  2RKH A;  3I9V 2;  2WTE A;  3OS2 A;  1FC3 A;  2KKO A;  4HAM A;  3K4C A;  4CO8 A;  3K1M A;  2VUM J;  3JRF A;  4AVZ A;  4FE4 A;  5TRD A;  2DFE A;  3ZMU A;  2H6B A;  3ZR8 X;  4DZJ A;  1PUF B;  1S8N A;  3IH3 A;  1HKS A;  3H5R A;  3V7C A;  2HPM A;  2RN7 A;  5HVQ C;  4PZJ A;  2ZXW H;  5EZG A;  2HEO A;  2QZ8 A;  4KT6 A;  3S1M J;  3E6M A;  3W6J B;  2I8D A;  3Q0U A;  4D5F A;  3C2G A;  5CVV A;  1IDZ A;  2IS1 A;  1X3Z B;  1I6X A;  3DTI A;  5GAD J;  2WAQ A;  3RQI A;  2QSF X;  4LK1 F;  1L3L A;  3QOE A;  2L7K A;  2LF8 A;  5ERI A;  2L0K A;  3S2W A;  3FKJ A;  3DQV C;  2BY2 A;  3CF2 A;  5CYV A;  1YO5 C;  2RAE A;  1FSH A;  1EH7 A;  2FBK A;  1TT0 A;  3I4P A;  5AON A;  5GTI C;  2XDV A;  5LRR A;  4HF1 A;  3ZMS A;  4PUS A;  4D1Q A;  1YE9 A;  4CHU A;  3VFZ A;  4LMY A;  5L3E A;  2QEX I;  2X51 A;  4Y3O A;  5DUK A;  1QQI A;  3LSJ A;  3HIF A;  1LVK A;  2W57 A;  2DMN A;  3H35 A;  4X1E A;  3A4C A;  1T6S A;  3WTU C;  2P8T A;  3F8M A;  4Y33 A;  2LY1 A;  4DYR A;  4OMZ A;  2UUZ A;  4RB0 A;  5C4J J;  2JVH A;  5FRO A;  2JUG A;  2CFO A;  2DBB A;  2JRT A;  1IAW A;  1ON1 A;  4KJZ A;  3QPH A;  2V79 A;  2LH9 A;  3A0H C;  1CQT A;  4HA8 A;  2TDX A;  3QYB A;  2CYY A;  2KIQ A;  2VJI A;  4BL0 B;  3QRF F;  1G4D A;  4PSX A;  2IA2 A;  2ZBK A;  2F4M B;  3A2K A;  5IP7 J;  2VJJ A;  2NVU B;  3E5Q A;  3M4O J;  1BM9 A;  1P92 A;  1ETV A;  2RV8 A;  4RDU A;  1SAX A;  2DPD A;  4AIJ A;  1TQI A;  1DU6 A;  1IN6 A;  3GTG J;  4I98 B;  2E1C A;  2HYJ A;  2Q0O A;  2YPR A;  1POG A;  3REO A;  4LGW A;  4XMY A;  3GW2 A;  2I10 A;  1S5L C;  1KYW A;  3S8P A;  3RI4 A;  3ZPL A;  3CC7 I;  4ZTJ A;  2FA5 A;  1KZH A;  5LGN A;  2Y31 A;  4DW6 A;  4RGR A;  3QOP A;  2HOT A;  3Q3S A;  1QRY A;  3PO3 J;  4MEY F;  3CC4 I;  3AL0 B;  2H1K A;  2LC2 A;  1S7O A;  2ZME C;  2B0L A;  4BE2 A;  3MKW B;  5J4V A;  1PUE E;  5GAE J;  4M9X A;  1U9N A;  2A68 F;  2Y69 H;  5EEG A;  3IRQ A;  1YI2 I;  3CME I;  2JPB A;  2WV1 A;  4YEJ A;  2F2E A;  4F55 A;  1ZRF A;  3TW7 A;  3I71 A;  5FKM A;  5HLH A;  3S3M A;  2L01 A;  4GXO A;  5LFA A;  4RAY A;  1JJ6 C;  2VKV A;  4EVI A;  1F1Z A;  1I1S A;  2EBI A;  2EZL A;  1G3W A;  2LLK A;  1SVM A;  2ID3 A;  2Q1Z B;  3ABT A;  3CCY A;  4G6D A;  1HC8 A;  1MBG A;  4A3E J;  5IPA A;  3CCS I;  1KQ8 A;  3MZY A;  2X6X A;  1X3W B;  1IO2 A;  2E1M B;  1UAA A;  4XLN F;  4NC8 A;  4PGH A;  1WJB A;  1K4T A;  4KFC A;  2V9P A;  4A3I J;  1YQA A;  2CFX A;  3HBL A;  2QA4 I;  1R4M B;  2Z33 A;  1B9N A;  3Q0W A;  3TBI A;  2JQ7 A;  1HW2 A;  1ZEL A;  3E6B A;  3KZY A;  4BQN A;  4WXD A;  3ZRG A;  1H9G A;  2QQB A;  4IO9 F;  1OYI A;  2MFZ A;  2NS8 A;  1JT6 A;  1XSD A;  2R7D A;  4OIQ F;  4QIW N;  2XUB A;  1XGO A;  1OKR A;  1X58 A;  1ZGJ A;  2DQR A;  1FMW A;  2FF4 A;  2STW A;  2F6C A;  4PJN A;  2K9N A;  5BMZ A;  5EF6 A;  2OCC H;  1T2K A;  3CDL A;  1MMN A;  4JX6 A;  4G7Z F;  1ZHF A;  1YYV A;  1JUM A;  4A3J J;  1U6G A;  1MMD A;  3CD6 I;  5GTH C;  4YFK F;  3K4L A;  4DZP A;  2FJ1 A;  2V6C A;  2QUF A;  2OV7 A;  4IRH A;  4V2F A;  1IRG A;  1T0F A;  1TLH B;  4A3B J;  3LL7 A;  1WRJ A;  3U1K A;  1ITY A;  2L4M A;  4IHW A;  3RSN A;  2PMH A;  2F48 A;  4A3C J;  2CQQ A;  2QKM B;  1LEA A;  4ZDL A;  2VJ5 A;  3DEU A;  4BJ6 C;  4YFN F;  5ICE A;  3FF5 A;  5E20 A;  2EIM H;  1DP3 A;  2E5Z A;  5E3N A;  4XSZ F;  4BXX J;  2BHZ A;  2GXG A;  3C2H A;  2IXS A;  5HDN A;  2E7X A;  1H0M A;  3HGG A;  3HRT A;  2D2W A;  4HNT A;  2WV0 A;  2FNP A;  3TW6 A;  4KYW A;  3ZOB A;  1USS A;  3H0G J;  4MHG A;  2IJL A;  1LE8 A;  4B1R A;  5LGU A;  2DXI A;  1AOY A;  5BNG A;  1LE8 B;  4QWQ A;  4M6Y A;  1OCC H;  3W6V A;  3OYF A;  4A3D J;  5KVR A;  2X1C A;  1RR7 A;  3WTW C;  1HKQ A;  4U88 A;  4RAG A;  3K6G A;  5J40 A;  1OYW A;  4MNU A;  5A2Q K;  1WJD A;  1Y39 A;  2VOO A;  1LDD A;  3ZQG A;  3U21 A;  3R0J A;  4XRS G;  1J7K A;  1SVO A;  1U78 A;  4AD9 A;  3JW4 A;  1BR1 A;  1FP2 A;  1U2W A;  1T0F C;  3KZZ A;  2JUC A;  5CVI A;  4XBF A;  3JR9 A;  4A0Y A;  1GVJ A;  3NAR A;  1W0T A;  2K7L A;  5BPI A;  4MFD A;  3DKY A;  3WG7 H;  3GZ5 A;  2V1X A;  1LPQ A;  1YJW I;  3LSI A;  5DYM A;  3H5A A;  2P5V A;  3CES A;  4C3H J;  2K3F A;  2A69 F;  1MNM C;  1IC8 A;  1A36 A;  1HOM A;  1HXD A;  4IQ4 A;  1XPX A;  1RR8 C;  5F04 A;  4I01 A;  1ZK8 A;  4IHY A;  1X1C A;  4JP0 A;  3KE2 A;  1J0R A;  1V55 H;  3B73 A;  3U9G A;  1DGW Y;  3AFH A;  2YU3 A;  5FLM J;  4L18 B;  3R60 A;  5IYB J;  3DU5 A;  2Y30 A;  4HV6 A;  2CV1 A;  4R1H A;  3LOC A;  5CLS A;  1Y8Q B;  2M30 A;  4GO1 A;  3T5X A;  4OAZ A;  2BY3 A;  2IBD A;  3O3K A;  2K9Q A;  2VB6 A;  4RLF A;  2Z9O A;  1I50 J;  1HW5 A;  1UHW A;  1Y1W J;  3HUG A;  4PJJ A;  3I55 I;  3GX4 X;  3HUG B;  1AU7 A;  2NYX A;  4EAT A;  4YII A;  3IWF A;  2UXN A;  4NHJ A;  1VZ0 A;  4NC6 A;  1GV5 A;  3U2R A;  4C2U A;  1DP7 P;  2K5C A;  2NRA C;  1N25 A;  2E2J J;  1OCR H;  3BJ6 A;  5JHU A;  2GQQ A;  1ODD A;  2P6S A;  1SEU A;  2COM A;  3PNV A;  4M3G A;  2FE3 A;  2VXZ A;  1WSU A;  1W0U A;  5IP9 J;  5K7Z A;  4I6Z A;  1OCO H;  3L2W A;  2O5R A;  2WB1 A;  1I5Z A;  3VPR A;  2XAF A;  5FFZ A;  5J47 A;  4IF4 A;  1JKP C;  4E7S A;  4RBO A;  4F52 A;  3LA3 A;  2M87 A;  2FML A;  1QVT A;  4CA0 A;  5JR3 A;  1XS9 A;  4WF2 A;  4HZF A;  5DV5 A;  1IN8 A;  1VQM I;  2ZNY A;  1BBY A;  4XL9 A;  2Y48 A;  2A6E F;  1MND A;  4A6E A;  2D5V A;  1VQO I;  4DOZ A;  2DU9 A;  2DA7 A;  4L5E A;  1G8X A;  4ZYA A;  3V8J A;  5EGO A;  2EFN A;  2KL4 A;  3BRO A;  5EGO B;  2DJI A;  1ETX A;  3VEP A;  1Z91 A;  4IPA A;  4BDY A;  2ZB9 A;  4IHX A;  1MD0 A;  3HHG A;  1QPI A;  1O7L A;  3HZJ A;  5HS9 A;  4PJ0 C;  4EGZ A;  1V5G A;  4BE1 A;  2QWW A;  3FXO A;  2CG4 A;  2ME6 A;  4GFB A;  4Y13 A;  4UHT A;  1YX5 A;  4YRV A;  1NK3 P;  3ASO H;  5J1U A;  5CVR A;  1FJL A;  1WFX A;  4RGX A;  2ZJR F;  3MZH A;  4L5J A;  3WHB A;  4H4K C;  2OD5 A;  4J01 A;  2V26 A;  2VC0 A;  4G94 A;  3KEY A;  4Y7N J;  2GIZ A;  3OOP A;  4A3F J;  1BI2 A;  2HXI A;  2GLO A;  1IXS B;  1DPU A;  2Z2S B;  3DEW A;  5FKO A;  2KIU A;  1V5F A;  3OYG A;  1OCZ H;  3SZG A;  1WJ5 A;  4II3 A;  3KFW X;  2WY7 Q;  3BZK A;  1H88 C;  2EJR A;  1QNT A;  1VF9 A;  2LKX A;  1SFU A;  4V2G A;  1E2X A;  2KDO A;  3WTS C;  5KAF C;  2R0Q C;  4CCL A;  1K4S A;  1VI0 A;  3OYB A;  3E1S A;  1KA8 A;  4LOC A;  5GAH J;  2DLL A;  4NBQ A;  1Y8R B;  2EH3 A;  2GWR A;  2CW8 A;  4ENM A;  3HOX J;  1MJA A;  3BDD A;  3B02 A;  4OIN F;  2NVQ J;  3IV5 A;  2H6C A;  3M1C A;  4LIV A;  3W2W A;  3CZ6 A;  1ZLK A;  1BC8 C;  1YJ9 I;  2E1N A;  2R7V A;  1Z9C A;  4Q48 A;  4XKV A;  2NS0 A;  2CU7 A;  3BTC A;  2K85 A;  4ANJ A;  5L3D A;  2YU9 J;  2EIN H;  4I02 A;  4GYI A;  1FYL A;  3RYR A;  1HDD C;  3HXL A;  1L0O C;  4EEF G;  3CCU I;  3ZN1 A;  1EV7 A;  1JTX A;  3LA7 A;  4BBS J;  1Z05 A;  4U0Y A;  3BZC A;  4E7I A;  1WH7 A;  3TP0 A;  3T8R A;  5D4S A;  1NTC A;  2XGE A;  4CH7 A;  2MD0 A;  2P6T A;  2ESN A;  3HHH A;  2XGC A;  2YS9 A;  2WAQ N;  2EB7 A;  5F64 A;  5F1J A;  3JRD A;  4N0B A;  4BJ5 C;  3GTK J;  4IEJ A;  1SD4 A;  1X1P A;  2RC4 A;  2W00 A;  5JFR A;  1Y0U A;  2XB0 X;  4E6K G;  2FMY A;  3OSF A;  4C9Y A;  2H1L A;  2XPU A;  3KLO A;  5CVU A;  4AYB N;  5M3F J;  2O7O A;  4UY8 I;  2O6G E;  2DQL A;  3CMY A;  4HOB A;  1ETQ A;  2QBY A;  4IKF A;  1IRF A;  4RGU A;  5H20 A;  2QBY B;  4KIB A;  3BPV A;  4DYQ A;  1BI1 A;  3MN2 A;  3LNQ A;  1GDT A;  1JI8 A;  1FOY A;  4HST A;  3MZ8 A;  5F08 A;  3KEQ A;  3A01 A;  2G9W A;  2TRT A;  5J1R A;  3F8N A;  2EK5 A;  4B47 A;  3A01 B;  1DUX C;  2KIS A;  3MAJ A;  2QLZ A;  3PM1 A;  4D7N A;  2P7V B;  3G4S I;  5IYD J;  3K4N A;  4Z2Y A;  5FFX A;  1OR7 C;  3VB2 A;  2COB A;  3ZQC A;  4HPQ A;  1X4O A;  2O03 A;  4B3X A;  5DCF A;  1STZ A;  1EJ9 A;  4DBQ A;  2EV0 A;  2R7O A;  1TWC J;  2DJN A;  4ON0 A;  1O4X A;  4GDF A;  5IY5 H;  5D5V B;  3CO6 C;  5E17 F;  1Z0X A;  3IAM 2;  2LKS A;  2HYG D;  4IOA F;  1Q1V A;  1JUP A;  4UV9 A;  1X2M A;  4EJV A;  1FTZ A;  3RKY A;  3GO5 A;  4FX0 A;  3FXR A;  1ETW A;  2RDP A;  3LWF A;  2V6E A;  2Y0S N;  3SEZ A;  2BGC A;  1SD7 A;  3VSL A;  5GAG J;  2XIG A;  2BXZ A;  4FIS A;  1E17 A;  3FMS A;  3FXM A;  4M3B A;  3J80 Z;  5TJJ A;  2OTJ I;  2IGM A;  4AUX A;  2X48 A;  3LQQ A;  1XDS A;  4M3D A;  2AHQ A;  2FRH A;  2GOX B;  3EUH A;  1O7F A;  4S05 A;  2BE5 F;  2ME0 A;  3CP2 A;  3OYA A;  1A6Q A;  4CCO A;  1UFM A;  3TDU C;  2F5F A;  2G7H A;  4E70 A;  3GTL J;  3FHN A;  4PFP A;  3K10 A;  3TP3 A;  4RB1 A;  4EJU A;  1NG7 A;  4OU0 A;  2DOF A;  4NUB A;  2LKP A;  3O8H A;  4LG3 A;  1WPK A;  3AG2 H;  4Y15 A;  1V3F A;  1UHM A;  3OR1 C;  4PJM A;  5M5Y J;  1GLN A;  1T33 A;  5EG0 B;  3PQJ A;  3I56 I;  5CQE A;  2E34 A;  2LVS A;  2JT1 A;  2IEK A;  1TWH J;  2N8G A;  1UST A;  3BG7 A;  1BJZ A;  3IUO A;  2E60 A;  6PAX A;  2QSG X;  3WGH A;  3K2A A;  4B09 A;  4M6V A;  1S6L A;  1MBH A;  5TGT A;  4MGR A;  2PMZ A;  2ZFU A;  1KQ9 A;  3DPL C;  1ZG5 A;  1BL0 A;  1FIP A;  4UXN A;  2DOE A;  1SC7 A;  1XGS A;  1D1B A;  1M1E B;  4PCQ A;  4UUV A;  5HOD A;  2VON A;  1JTY A;  2IA1 A;  4HNV A;  2HVS A;  2YX4 A;  3R61 A;  2FBI A;  5LRS A;  3GFL A;  3JCU C;  3OYE A;  1T98 A;  2H8W A;  2GXA A;  2NNN A;  2DN0 A;  2HQN A;  3BTJ A;  5FO5 A;  1YW7 A;  2M8E A;  2X1D A;  1D5V A;  1PUF A;  3F72 A;  1ETK A;  4OIR F;  3LSR A;  3IH4 A;  1JHF A;  3SZT A;  1XGN A;  1QHH D;  1T56 A;  1VQ8 I;  1VND A;  2IGN A;  3IAS 2;  4BEH A;  2LDU A;  3FKI J;  4KUM A;  3TOA A;  4BEH B;  3WTT C;  2KP6 A;  3TKY A;  2A07 F;  3V7R A;  2L02 A;  3I4M J;  4A6D A;  3O8G A;  5E8G A;  2LBF B;  3VOE A;  3HSR A;  4EJW A;  1ZQ3 P;  3AG1 H;  4XID A;  3QPL A;  3F6O A;  1GXP A;  3S14 J;  4A3G J;  4BAY A;  1J59 A;  1XCV A;  4AU7 A;  4F92 B;  1H8A C;  2ZJQ F;  1IW7 F;  1ZKG A;  2IA0 A;  1GVD A;  3NRV A;  2FOK A;  3ERM A;  3F21 A;  1MGT A;  2R3S A;  4LB5 A;  4BHC A;  2M0M A;  4L9T A;  3OR2 C;  1IJW C;  2CW7 A;  3K7A J;  3ZMZ A;  1BA5 A;  3CCE I;  3OYK A;  2JZY A;  5KK1 A;  3CP8 A;  3FX3 A;  5HNH A;  1XN7 A;  2ZXI A;  3DTE A;  5CQG A;  2ELK A;  2OBP A;  2EFP A;  2OAZ A;  5L3F A;  3DWL E;  3GTO J;  2Y2Z A;  3CUO A;  2P7C B;  1OIS A;  2MH2 A;  1BOA A;  3MKZ A;  1U3E M;  1P4W A;  2AS5 F;  1P7J A;  1MBJ A;  3CCR I;  2K9L A;  3QOD A;  2QVO A;  1Z77 A;  4HSR A;  3B6C A;  2DA5 A;  4XIC A;  4N4N B;  1A6I A;  3A03 A;  4UUS A;  3BT9 A;  3I64 A;  3HTU A;  4UUS B;  2MAB A;  2PX9 A;  3F9K A;  1TC3 C;  2E5N A;  4BY1 J;  3FK7 A;  4FE7 A;  3ELK A;  4EGY A;  2CUE A;  5BOX A;  3L2C A;  3J80 K;  4E4H A;  3HOV J;  3LST A;  2DTR A;  3JSP A;  2BVL A;  3EET A;  1IXR C;  1P2F A;  4KIC A;  5FLX K;  1PVE A;  1WGX A;  2HGC A;  3SZP A;  1N77 A;  3EQL F;  2BW3 B;  5LD2 C;  1YW8 A;  2BXY A;  2R93 J;  4G8X A;  3KP2 A;  4G7H F;  4A3K J;  1TTY A;  4MFE A;  4TV7 A;  3QPS A;  4M9Z A;  1AHD P;  1FOX A;  1J2X A;  4BKX A;  1HKT A;  1ON2 A;  4HLX A;  3A02 A;  2CJJ A;  3NWT A;  4U7B A;  3HB9 A;  2R5Z B;  3BR6 A;  1GHC A;  1YIO A;  2OU2 A;  4G6T B;  1QPM A;  3MWM A;  3IL2 A;  1VQP I;  2KT0 A;  3BR0 A;  3KIO A;  1W4M A;  9ANT A;  4KN7 X;  5GP9 A;  4V19 K;  4HF2 A;  2VAS A;  5EZH A;  1HLV A;  4YIF A;  2FOW A;  1R6R A;  2AO9 A;  3SFZ A;  1W36 D;  4M3E A;  3G73 A;  3PL8 A;  3ERE D;  1Z21 A;  3BY6 A;  2ELJ A;  2KRC A;  2ZXJ A;  2HQR A;  4RM2 A;  4CCN A;  2ZCW A;  2W85 A;  1UHS A;  4B43 A;  2WB1 N;  1PP8 F;  5HS7 A;  1LFP A;  3BR3 A;  1RKW A;  1WH5 A;  1Z7L A;  2EV6 A;  4HNU A;  3OS1 A;  1OCP A;  3DEE A;  1QO0 D;  2DI3 A;  1G59 A;  2FD5 A;  2V1N A;  2MH9 A;  1IXC A;  4DBR A;  1R5I D;  4F93 B;  2XAG A;  2O0Y A;  2LOO A;  4P1W A;  4PFO A;  3SFI A;  4A0Z A;  1BJA A;  3M1E A;  2O8X A;  3AL0 C;  5L3B A;  2E36 A;  2K9S A;  2CW0 F;  3WTV C;  4D9J A;  5EEA A;  1VQN I;  3L2R A;  3GME A;  1IZ1 A;  1D3Y A;  1UMQ A;  4PJL A;  3QU6 A;  5FKN A;  4N4O B;  3ZQL A;  4BHP A;  2OC6 A;  3SDB A;  4BY7 J;  2HOS A;  1W7P A;  3BR1 A;  1XDU A;  3WU1 B;  1W7P B;  3S17 J;  2X85 A;  3DBR B;  5CPR B;  1Z3X A;  1NHA A;  3P7N A;  1OCT C;  1I3Q J;  1TW3 A;  1GT0 C;  1TL8 A;  2E1M C;  4EM2 A;  2PEX A;  2VQG A;  3A0B C;  1K6Y A;  1BW5 A;  3FXJ A;  3BJO A;  2M7A A;  1YW9 A;  1LFB A;  3ASN H;  3BWG A;  5B1A H;  2DA3 A;  4Y4R A;  2MBF A;  1EH8 A;  4X0G A;  2W82 A;  3QP5 A;  4EM1 A;  4IX7 A;  2A5Y B;  3OYD A;  2K86 A;  3E0J B;  1WI3 A;  3VWB A;  3SYT A;  2DFF A;  4UVA A;  2VBX A;  2HKO A;  2VIX A;  1D1A A;  3L2Q A;  3HOW J;  4HLY A;  2XRO A;  4BBR J;  1YTY A;  1I6H J;  1IUY A;  4S0H B;  3VOD A;  5F1R A;  3M8E A;  1HDP A;  1ZAO A;  5J3L A;  3LAJ A;  4QSH A;  5DM7 F;  2LMD A;  2R7R A;  2PBI A;  1BIA A;  3DV8 A;  1FZP B;  3BR2 A;  1X2N A;  3JRB A;  1PDN C;  4ZJZ A;  4ABZ A;  5DDG A;  2PG4 A;  2IT0 A;  2NS7 A;  2P81 A;  3SQN A;  2OF7 A;  3E7L A;  3COA C;  3JRG A;  5LBQ A;  4XKW A;  4M74 A;  2JSC A;  1J09 A;  1ZRC A;  1HQC A;  2ECB A;  1EF4 A;  5IP6 A;  1IGN A;  1U5T B;  4P5O A;  4B8X A;  4FAS D;  2OZ6 A;  1JKO C;  2IS6 A;  2VOD A;  4O3M A;  4FCY A;  3C7J A;  2JRM A;  5D5X B;  3FHZ A;  4G9Y A;  3KLN A;  2JK3 A;  2R5Y A;  4HDV A;  2V1U A;  2R5Y B;  4A12 A;  2A6H F;  4XR6 A;  5E3L A;  1QVU A;  3M8J A;  3NAU A;  4M72 A;  5JVG F;  4HX4 A;  3DXJ F;  1DGR M;  3CUQ A;  1EA3 A;  2A61 A;  4FHT A;  1LKX A;  1X1B A;  3CUQ B;  1U8B A;  2BV6 A;  2LNB A;  4D7M A;  3RPQ A;  4XLC A;  3PSF A;  2LFB A;  1KU2 A;  1ZGA A;  2XSJ C;  3ECH A;  2XGX A;  2VXD A;  1X3U A;  3RDI A;  2KLO A;  4XN3 A;  1MDM A;  2L4A A;  2HVQ A;  2MLG A;  3D5R C;  2X1E A;  1MDM B;  3ML6 A;  2EZK A;  4Y17 A;  1V5E A;  1E3P A;  2Z99 A;  2MD5 A;  2F5D A;  2JMW A;  3O6B B;  3HEF A;  5D6F A;  4IVN A;  2ZC2 A;  4DJA A;  2YR2 A;  4M9S A;  1LB2 A;  2V4J C;  3HOT A;  4I7H A;  3K0L A;  5EEH A;  2LF7 A;  1X1D A;  4JX4 A;  5B3S H;  4UNO A;  4N9H A;  3H9J A;  4O6J A;  5BS6 A;  3W6K B;  3JTG A;  1WKM A;  2GIV A;  5E1Z B;  3RKW A;  5K1Y A;  3R4K A;  3KYC B;  5H6Q A;  3J81 Z;  4RB3 C;  4BDZ A;  4XOP A;  2GAU A;  2XRN A;  3T8T A;  3W2V A;  3SJM A;  1RC9 A;  1YIT I;  4NB5 A;  1MJB A;  2DA2 A;  1IUF A;  1XX5 A;  2DCE A;  5HLT A;  4BYY A;  4OWR B;  2EZH A;  2ZJP F;  2RQQ A;  4EMS A;  2CQ7 A;  2FQ3 A;  3IKV A;  3LSG A;  3DBH B;  3MEX A;  1FBQ A;  2CGP A;  1K78 A;  5J4Y A;  2K3P A;  4BUP A;  2XAJ A;  3TOB A;  2HI3 A;  1K78 B;  1ZYR F;  2JPC A;  2PMU A;  3PIO F;  3M3Y J;  2MC3 A;  2CS3 A;  2HWV A;  5AIP A;  2STT A;  2BBY A;  3S1N J;  3HYI A;  1AWC A;  3ZMT A;  2OPT A;  2E7W A;  3I58 A;  1IV8 A;  3GLL A;  3MKL A;  3R6S A;  3PIP F;  4EQQ A;  3BCB A;  1Z6R A;  3P9C A;  4LFU A;  2MA3 A;  4C3J J;  1IDY A;  4EJO A;  3PFY A;  4J19 A;  3B6A A;  1D1C A;  3DU6 A;  3Q0V A;  2VQL A;  1E0E A;  1FEX A;  2LYC A;  4HX8 A;  1OQY A;  1VTN C;  3DP7 A;  4KT5 C;  1C0W A;  5CKT A;  4ESJ A;  4E7J A;  3J7A O;  4HEA 2;  2UWM A;  4U7D A;  2V7F A;  2HNH A;  4UV8 A;  5K7H A;  1S9H A;  3RCO A;  3I4N J;  4CZC A;  1JKR C;  3BR5 A;  3M8F A;  2X6Y A;  1Y0N A;  5C3E J;  3EUK L;  3H0D A;  2H94 A;  3NEU A;  2HXO A;  2EA4 A;  2HQA A;  5AIQ A;  3CC2 I;  2F5E A;  2M7B A;  2HR3 A;  4G12 A;  4J00 A;  2HVR A;  1RZ4 A;  1W7P D;  2LD5 A;  4C3I J;  4XRF A;  2M45 A;  2FNA A;  2X0L A;  5E1W A;  2F5V A;  2EFO A;  3WG9 A;  4XQF A;  4XRS A;  3VDX A;  2QF7 A;  1SFO J;  5JHF A;  2GA1 A;  3I59 A;  1FBU A;  4I76 A;  2WY8 Q;  4MO7 A;  1S7E A;  3G1L A;  3I59 B;  3E5X A;  2HQ5 A;  4L9N A;  1MMS A;  1UG2 A;  1HF0 A;  5GPC A;  2PMZ N;  4LLL A;  5EDN A;  3EYY A;  2QCO A;  1XMK A;  1W5S A;  3CJQ B;  4PSW A;  1WHU A;  1JJ8 C;  2X9D A;  3C3W A;  3HKZ A;  5J1Y A;  2MSY A;  2NOG A;  4I0B A;  1WQ2 A;  3DFG A;  4M3F A;  4WCG A;  3WGG A;  1E3H A;  1JXS A;  2X6O A;  5IOY A;  3JRH A;  3WE2 A;  2JN6 A;  1D0Y A;  1S3J A;  2QYO A;  2X4H A;  3RZD J;  3PQK A;  4HYE A;  3DKX A;  4H0E A;  1IG7 A;  4BNC A;  3CJR B;  2HTS A;  1UEL B;  4KIG A;  1WI9 A;  2HOA A;  2Y9Y A;  3OIQ A;  3ESW B;  1R1V A;  2IGO A;  3P9I A;  2DAO A;  4HV5 A;  3UR3 C;  4XLP F;  1O3T A;  4UUT A;  3CJT B;  3N05 A;  3VYS B;  1ENH A;  4XK4 A;  3CDH A;  3V8K A;  2MGQ A;  4CIC A;  1XSV A;  2L9N A;  5D8K B;  1P4X A;  3KYL A;  1JE8 A;  5KAI C;  1XTA A;  3KP4 A;  2R7U A;  3MMY B;  2F4I A;  1VFC A;  2WAD A;  3ISP A;  3K4K A;  1D0Z A;  1HW1 A;  4KMU X;  1G2H A;  3SHF A;  3J81 K;  3OYI A;  2M9H A;  2VBZ A;  3E6C C;  3K70 D;  3CLO A;  3LAP A;  1IV6 A;  3ZN0 A;  1ONV A;  1TWA J;  4MTD A;  2HKX A;  4LD5 A;  4BGD A;  2HDD A;  4XKB A;  2CUF A;  3PO2 J;  4BQA A;  5ILU A;  1W5T A;  3HTS B;  2YUS A;  1SMT A;  2Y75 A;  5BQT A;  2XPV A;  3HOU J;  2K4J A;  2PQ8 A;  2FEZ A;  4CXF A;  2P4W A;  1T38 A;  2XV4 S;  3BQY A;  1I27 A;  5LEK A;  2NOJ B;  5DEQ A;  1F4K A;  3MQ0 A;  3E5U A;  2MW8 A;  1LQ1 A;  1TW2 A;  4YIR X;  1JKQ C;  3MCZ A;  4NQW A;  3CCQ I;  3I53 A;  2KZG A;  1WJF A;  4A69 C;  4NQW B;  4CGZ A;  1MKM A;  1FOW A;  4A5M A;  2DO7 A;  1G3T A;  1RKT A;  3DTK A;  4AIH A;  4HDU A;  2UXX A;  2E2H J;  3ABK H;  3IWZ A;  4M73 A;  3HJE A;  1YS6 A;  2V9V A;  5IT9 Z;  4CYD A;  2KHM A;  3GXO A;  4KA4 A;  3DPU A;  2CRG A;  2B7E A;  1D0X A;  3GZ6 A;  1R1U A;  2M1B A;  4ENJ A;  2FXA A;  3G6E I;  3F3X A;  3TGN A;  1R23 A;  3V7S A;  1R9T J;  1AKH A;  1IRZ A;  4XLE A;  1F43 A;  1MSE C;  1AKH B;  4FT8 A;  3RPU A;  4GGG A;  5B5E C;  3H5N A;  1D8K A;  4MIM A;  4ENN A;  1JGG A;  2NAZ A;  2O3F A;  4A2U A;  4BU2 A;  3DF8 A;  2R7W A;  1WJE A;  1Y56 A;  4WX9 A;  2KZV A;  4MQV A;  3GWZ A;  2IRF G;  1IN5 A;  5IOZ A;  3KEO A;  4RLQ A;  2W84 A;  3S1Q J;  3LSM A;  1KON A;  1Y1V J;  2F4O B;  2FBH A;  2R4G A;  1O57 A;  4OAY A;  2G0E A;  3FWE A;  2DOD A;  1PJR A;  2VBW A;  5FRM A;  3BP8 A;  2F5C A;  2M4K A;  2DA1 A;  2LY2 A;  2DPU A;  2A5W A;  3G2B A;  3E97 A;  4XLH A;  1LFU P;  2QEN A;  3ZMD A;  2PN6 A;  5CVJ A;  1BI3 A;  1E3O C;  3CCV I;  2PLY A;  4D0P A;  4L0Z B;  3OYJ A;  1R58 A;  3SXY A;  2L9S A;  2GA2 A;  3EDP A;  3DPT A;  4CDG A;  3GYH X;  2R7F A;  3K2Z A;  4XRM A;  3ZQ7 A;  5EG0 A;  3ZQH A;  2O8K A;  3E3V A;  3LSK A;  2IS4 A;  2A05 A;  3RQ4 A;  4CUG A;  1T95 A;  1XSX A;  2LK2 A;  2CH0 A;  1W36 C;  4F7Z A;  5KHD A;  2MG4 A;  3GEZ A;  3HRM A;  3HPH A;  1X19 A;  4I99 C;  3FIW A;  3N4M A;  4B3A A;  3C18 A;  5DD4 A;  3RKQ A;  3CLQ A;  1FT9 A;  5B66 C;  1KQ0 A;  4G6Q A;  3GF2 A;  2JA6 J;  2HPI A;  4HQM A;  4PDK A;  4PK4 A;  2DMU A;  2ZFW A;  3OV8 A;  4RMN A;  1Z67 A;  2AXL A;  5LHH A;  2M5W A;  2VLA A;  4Q5S F;  1SFK A;  2ETH A;  4NDL A;  3OL3 A;  1U0J A;  4F3Q A;  2KRH A;  1MNE A;  2KDZ A;  1YX3 A;  3EUH C;  2K02 A;  3TQN A;  5TIS C;  2BYV E;  1WCM J;  2KPM A;  2ZXH A;  3MD2 A;  3WOD F;  3RTR A;  1Z6T A;  2OZU A; 
#chains in the Genus database with same CATH homology
 4HW0 A;  2FSW A;  1WWX A;  4RS8 A;  4BXU A;  3QU3 A;  3ROU A;  3WGI A;  3ZMV A;  4A0X A;  1TQM A;  5D6E A;  1QGP A;  2PI0 A;  1ZRD A;  2MLK A;  3FXQ A;  5IT9 K;  2BEO A;  3CJN A;  3Q9V A;  1F9N A;  1P6R A;  2QQ9 A;  4K2E A;  2IW5 A;  5J8F A;  5LLQ A;  4I09 A;  1FOK A;  4ENK A;  3TDZ C;  1REP C;  2VE8 A;  3HRU A;  3KET A;  1RUO A;  4IRG A;  4FX4 A;  3QP6 A;  2K4B A;  3JTH A;  2VE9 A;  4LG0 A;  3RYP A;  2ZME A;  4ZH4 F;  2ISZ A;  4LG0 B;  2ZME B;  3QPT A;  2P5K A;  1UCR A;  4OIP F;  3ZP5 A;  2Z5U A;  3H3Z A;  4YG2 F;  4L5I A;  4U0V A;  3EYI A;  2ZO4 A;  1F5T A;  1B59 A;  2KIM A;  2FU4 A;  2DFI A;  5BPD A;  2KRF A;  3WTX C;  1DPR A;  5A2Q Z;  4WWC A;  2UZK A;  4LJZ F;  3H92 A;  5ICG A;  2ACJ A;  1G3S A;  4G7O F;  4KN4 X;  3BJA A;  2PFB A;  1HBX G;  1LVA A;  2VN2 A;  4ZZL A;  2D1V A;  2H09 A;  2GZW A;  4IRI A;  4LK0 F;  2C6Y A;  2HTJ A;  2Q8K A;  1FYK A;  1XB4 A;  1HSJ A;  2HYF A;  1FLI A;  1EH6 A;  5D5W B;  5JI6 A;  1R00 A;  3GLX A;  1P4A A;  1G6N A;  4Q4Z F;  1YLF A;  4WXC A;  3WU0 A;  1V4R A;  3AAF A;  5J6X A;  1FX7 A;  3GFM A;  5E8I A;  4I2O A;  4IXA A;  2G7U A;  1GXQ A;  3O2P E;  2H27 A;  3T1B A;  4ASN A;  3L9F A;  4JK1 X;  3M9A A;  1KGS A;  4ZYG A;  2CWE A;  3I5U A;  1J75 A;  1A04 A;  4RGS A;  1RIO H;  2ELH A;  1R1T A;  1QZY A;  2W24 A;  3TO7 A;  3ABU A;  3BZ6 A;  3CTA A;  3G3Z A;  1B1B A;  3V8L A;  3LA2 A;  4JBA A;  1FYM A;  1MZB A;  2HZT A;  3N97 A;  4BH9 A;  2VOP A;  1FBS A;  5J8C A;  4LLN A;  1IN4 A;  2IP2 A;  3MFK A;  5HLG A;  4MEX F;  3I0T A;  5HS8 A;  3HOS A;  1LDJ A;  1J9I A;  3RIR A;  4PGG A;  3RKX A;  2EV5 A;  4HQE A;  2WC2 A;  1ZN2 A;  1JHH A;  1U5T A;  1DDN A;  4KNY A;  2DT5 A;  3PFI A;  4M71 A;  4CZZ A;  1K6O A;  1CGP A;  4AVP A;  1O3R A;  5D4R A;  3KP7 A;  1Z1D A;  5K5R A;  2CSO A;  2ESH A;  3I54 A;  2XAQ A;  4R79 A;  4IHS A;  5FB2 A;  2OA4 A;  4P96 A;  4ETS A;  1J5Y A;  1ZG1 A;  2GXB A;  1BN5 A;  2ISY A;  2XVC A;  5ILV A;  3FMQ A;  3KCC A;  2RQP A;  2VC1 A;  2NNY A;  1XGM A;  4GCV A;  3T0Y A;  3R0A A;  5IT3 A;  2DK8 A;  3FM5 A;  1U5T C;  1UB9 A;  2XAS A;  3QAH A;  3FMR A;  1TNS A;  4HF0 A;  3LQR A;  1SMY F;  1TNT A;  1FPQ A;  2J5P A;  4P55 A;  3F8B A;  1Q1H A;  3K1P A;  4ESB A;  1R36 A;  2D1H A;  2EFW A;  4IHT A;  3CUQ C;  1K7A A;  2L54 A;  1FSE A;  4WK8 F;  1YS7 A;  2HFH A;  3D5L A;  1ZH5 A;  5DD8 A;  4N9I A;  1YFH A;  4EV0 A;  4OMY A;  5L3C A;  2RVC A;  1I1G A;  3Q5F A;  4YFX F;  2ZKZ A;  5FD5 A;  4IJA A;  1RNL A;  2IVM A;  1T39 A;  1SD6 A;  1R22 A;  5LHG A;  3GVA A;  2QM3 A;  1ZAR A;  3GFJ A;  4M6X A;  2HS5 A;  2DW4 A;  3K9T A;  4O5V A;  4KMF A;  3FXU A;  4EJT A;  4UVC A;  2D45 A;  4KIF A;  4KDP A;  3F23 A;  1BC7 C;  4UVB A;  1G3Y A;  4Q47 A;  3ECO A;  1KU3 A;  3E6D A;  4RB2 C;  2RNJ A;  3IHU A;  5FD6 A;  1PP7 U;  4GYG A;  4MTE A;  4WXH A;  1OMI A;  3F22 A;  2DK5 A;  5ILS A;  5ICC A;  1FP1 D;  1FWZ A;  3KP6 A;  2OQG A;  3FZV A;  1B4A A;  2CQK A;  1OPC A;  2P5L C;  2RGV A;  1R7J A;  5DCM A;  4ESF A;  1QZZ A;  5DCM B;  1U8R A;  3C1D A;  4LB6 B;  3JAM Z;  3FM3 A;  1KU9 A;  5DUI A;  4P9F A;  2EA2 A;  4L9J A;  2YX7 A;  2ZJ2 A;  4RAZ A;  2KIF A;  3GFI A;  2L3D A;  4OOI A;  1LDK B;  2O61 A;  3L7W A;  3V4G A;  5K5O A;  4S04 A;  4BHB A;  1BIB A;  1MJ9 A;  3Q9S A;  2ZNZ A;  5LGT A;  2VT3 A;  1B9M A;  5FGM A;  5LEJ A;  3KP5 A;  3CO7 C;  2XHK A;  1KYZ A;  1YG2 A;  3F8F A;  5D5U B;  2Y0M A;  3IKT A;  3ULQ B;  3LFK A;  1LNW A;  1H9T A;  4EM0 B;  2ADU A;  1OR7 A;  4ZYH A;  2LSO A;  1RI7 A;  1R5H A;  5HDG A;  5E1X A;  1B6A A;  2KJC A;  1JGS A;  3F8C A;  3L00 A;  2Z3Y A;  3K69 A;  3HSF A;  3DKW A;  4LLG F;  3L09 A;  4AIK A;  2A3S A;  3H3U A;  2XAH A;  4ZYD A;  1O3S A;  4L9V A;  5D8L B;  4L0Y B;  2PJP A;  1SD5 A;  2QQA A;  5JVT A;  3JSO A;  1FY7 A;  4OIO F;  1KU7 A;  1RUN A;  1CF7 A;  3WTY C;  2W25 A;  1CF7 B;  5ED4 A;  5L3G A;  2XKP A;  3K1N A;  4DNC A;  2K27 A;  1OYY A;  4ZYE A;  3WTZ A;  4ZZD A;  3D0S A;  4MQ9 F;  3IC7 A;  3WE3 A;  5HDK A;  1S7A A;  1HST A;  5HLI A;  2WWY A;  1TBX A;  2Q2E A;  2HOE A;  1XMA A;  4U0W A;  1SFE A;  1LJ9 A;  1IN7 A;  1R5G A;  3HSE A;  2JTV A;  5HOO A;  2CO5 A;  3P9K A;  5ICF A;  2OQR A;  5LHI A;  1ZRE A;  3GUD A;  5CJ9 A;  4HBL A;  4I0A A;  3JAM K;  5K5Q A;  4HX7 A;  2EFQ A;  3BOQ A;  2KJB A;  5FLX Z;  2VT2 A;  1K79 A;  1QBJ A;  4QLC U;  4P9U A;  5H6R A;  2VBY A;  2IPQ X;  4AWX B;  3HRS A;  1SFX A;  2EWN A;  3U1D A;  3TO9 A;  1IF1 A;  3BPX A;  1Z7U A;  1LEB A;  2J5O A;  3M7G A;  1ULY A;  5E18 F;  1TQP A;  4JQF A;  2HDC A;  5F6F A;  1XD7 A;  2V1D A;  1O3Q A;  2YSR A;  1XCB A;  3F6V A;  3KP3 A;  1S29 A;  1ZG3 A;  4R8H A;  3TO6 A;  3RJP A;  3NQO A;  1FNN A;  1ZLJ A;  4A5N A;  1BI0 A;  2XKO A;  4XSX F;  3IRR A;  1D8J A;  4DQ2 A;  2RKH A;  2WTE A;  1FC3 A;  2KKO A;  4HAM A;  4CO8 A;  3K1M A;  5TRD A;  3ZMU A;  2H6B A;  1S8N A;  1HKS A;  3V7C A;  2RN7 A;  5HVQ C;  4PZJ A;  2HEO A;  2QZ8 A;  3E6M A;  3W6J B;  5CVV A;  1I6X A;  1L3L A;  4LK1 F;  2LF8 A;  5ERI A;  3S2W A;  3DQV C;  5CYV A;  1FSH A;  1YO5 C;  1EH7 A;  2FBK A;  3I4P A;  5AON A;  5LRR A;  4HF1 A;  3ZMS A;  4CHU A;  3VFZ A;  4LMY A;  5L3E A;  5DUK A;  1QQI A;  3HIF A;  2W57 A;  1T6S A;  3WTU C;  2P8T A;  3F8M A;  4OMZ A;  4RB0 A;  2DBB A;  2JRT A;  1IAW A;  1ON1 A;  3QPH A;  2V79 A;  4HA8 A;  2TDX A;  2CYY A;  1G4D A;  3QRF F;  2IA2 A;  2ZBK A;  3E5Q A;  1BM9 A;  1P92 A;  2RV8 A;  1SAX A;  2DPD A;  4AIJ A;  1TQI A;  1IN6 A;  4I98 B;  2E1C A;  2Q0O A;  2YPR A;  3REO A;  4LGW A;  3GW2 A;  1KYW A;  3RI4 A;  3ZPL A;  2FA5 A;  5LGN A;  4RGR A;  3QOP A;  4MEY F;  1S7O A;  2B0L A;  1PUE E;  4M9X A;  2A68 F;  5EEG A;  3IRQ A;  2JPB A;  2F2E A;  1ZRF A;  3I71 A;  5HLH A;  2L01 A;  4GXO A;  4RAY A;  4EVI A;  1F1Z A;  1I1S A;  1G3W A;  4G6D A;  3ABT A;  1KQ8 A;  3MZY A;  4XLN F;  4PGH A;  4KFC A;  1YQA A;  2CFX A;  2Z33 A;  1B9N A;  1HW2 A;  3E6B A;  3KZY A;  4WXD A;  1H9G A;  2QQB A;  1OYI A;  1XSD A;  2R7D A;  4OIQ F;  2XUB A;  1XGO A;  1OKR A;  1ZGJ A;  2DQR A;  2FF4 A;  2STW A;  5BMZ A;  1T2K A;  4G7Z F;  1ZHF A;  1YYV A;  1U6G A;  4YFK F;  2V6C A;  2QUF A;  4IRH A;  1IRG A;  1T0F A;  1TLH B;  1WRJ A;  2L4M A;  2PMH A;  1LEA A;  3DEU A;  4YFN F;  5ICE A;  3FF5 A;  5E20 A;  4XSZ F;  2GXG A;  5HDN A;  2E7X A;  1H0M A;  3HRT A;  2D2W A;  2WV0 A;  2FNP A;  4KYW A;  1USS A;  4MHG A;  2IJL A;  1AOY A;  5LGU A;  4QWQ A;  4M6Y A;  5KVR A;  3WTW C;  1HKQ A;  4U88 A;  1OYW A;  4MNU A;  5A2Q K;  2VOO A;  1LDD A;  3R0J A;  1J7K A;  1U78 A;  4AD9 A;  3JW4 A;  1FP2 A;  1U2W A;  3KZZ A;  5CVI A;  4XBF A;  4A0Y A;  1GVJ A;  2K7L A;  5BPI A;  3GZ5 A;  2V1X A;  5DYM A;  2P5V A;  2A69 F;  1HXD A;  4I01 A;  3KE2 A;  1J0R A;  3B73 A;  3U9G A;  2YU3 A;  4L18 B;  3R60 A;  4HV6 A;  4R1H A;  5CLS A;  2M30 A;  4GO1 A;  3T5X A;  3O3K A;  2Z9O A;  1HW5 A;  1UHW A;  3HUG A;  3GX4 X;  2NYX A;  4YII A;  3IWF A;  2UXN A;  4NHJ A;  3U2R A;  1DP7 P;  2NRA C;  3BJ6 A;  5JHU A;  2GQQ A;  1ODD A;  2P6S A;  2COM A;  2FE3 A;  2VXZ A;  1WSU A;  1I5Z A;  2XAF A;  5FFZ A;  4IF4 A;  3LA3 A;  2M87 A;  2FML A;  5JR3 A;  4WF2 A;  4HZF A;  5DV5 A;  1IN8 A;  2ZNY A;  1BBY A;  2Y48 A;  2A6E F;  4A6E A;  2DU9 A;  3V8J A;  2EFN A;  3BRO A;  3VEP A;  1Z91 A;  4IPA A;  1MD0 A;  3HHG A;  1O7L A;  4EGZ A;  5HS9 A;  2QWW A;  2CG4 A;  4Y13 A;  4UHT A;  5CVR A;  4RGX A;  3MZH A;  4L5J A;  2OD5 A;  2VC0 A;  4G94 A;  3OOP A;  1BI2 A;  1IXS B;  1DPU A;  2KIU A;  3KFW X;  2EJR A;  1QNT A;  1SFU A;  1E2X A;  3WTS C;  1KA8 A;  2DLL A;  2GWR A;  4ENM A;  1MJA A;  3BDD A;  3B02 A;  4OIN F;  2H6C A;  1ZLK A;  1BC8 C;  2E1N A;  1Z9C A;  4Q48 A;  2NS0 A;  5L3D A;  4I02 A;  4GYI A;  1FYL A;  3RYR A;  1L0O C;  3ZN1 A;  1EV7 A;  3LA7 A;  1Z05 A;  4U0Y A;  3T8R A;  5D4S A;  2P6T A;  2ESN A;  3HHH A;  2EB7 A;  5F64 A;  4N0B A;  1SD4 A;  2RC4 A;  5JFR A;  1Y0U A;  2FMY A;  5CVU A;  3KLO A;  2O6G E;  2DQL A;  4HOB A;  2QBY A;  1IRF A;  4RGU A;  5H20 A;  2QBY B;  4KIB A;  3BPV A;  1BI1 A;  3KEQ A;  2G9W A;  3F8N A;  2EK5 A;  1DUX C;  3MAJ A;  2QLZ A;  2P7V B;  4Z2Y A;  5FFX A;  3VB2 A;  2O03 A;  5DCF A;  1STZ A;  2EV0 A;  4ON0 A;  5D5V B;  3CO6 C;  5E17 F;  2HYG D;  4UV9 A;  4EJV A;  3RKY A;  3GO5 A;  4FX0 A;  3FXR A;  3LWF A;  2RDP A;  2BGC A;  1SD7 A;  2XIG A;  1E17 A;  3FMS A;  3J80 Z;  5TJJ A;  3LQQ A;  1XDS A;  2FRH A;  3EUH A;  1O7F A;  4S05 A;  2BE5 F;  1UFM A;  3TDU C;  2F5F A;  2G7H A;  4E70 A;  4RB1 A;  4EJU A;  4OU0 A;  2LKP A;  4Y15 A;  1V3F A;  1UHM A;  3PQJ A;  2JT1 A;  1UST A;  6PAX A;  3WGH A;  4B09 A;  1S6L A;  4MGR A;  3DPL C;  1KQ9 A;  1ZG5 A;  4UXN A;  1XGS A;  4PCQ A;  4UUV A;  2VON A;  2IA1 A;  2YX4 A;  3R61 A;  2FBI A;  5LRS A;  3GFL A;  1T98 A;  2NNN A;  2HQN A;  5FO5 A;  1YW7 A;  2M8E A;  1D5V A;  3F72 A;  4OIR F;  1JHF A;  3SZT A;  1XGN A;  2LDU A;  4KUM A;  3TOA A;  3WTT C;  3TKY A;  2A07 F;  3V7R A;  2L02 A;  4A6D A;  5E8G A;  3VOE A;  3HSR A;  4EJW A;  1GXP A;  3F6O A;  4BAY A;  1J59 A;  1XCV A;  1IW7 F;  2IA0 A;  3NRV A;  2FOK A;  3F21 A;  1MGT A;  2R3S A;  4LB5 A;  4BHC A;  4L9T A;  3ZMZ A;  2JZY A;  5KK1 A;  3FX3 A;  1XN7 A;  2OBP A;  2EFP A;  2OAZ A;  5L3F A;  3CUO A;  2P7C B;  2MH2 A;  1BOA A;  1U3E M;  1P4W A;  2AS5 F;  2QVO A;  3I64 A;  3HTU A;  3ELK A;  4EGY A;  5BOX A;  3L2C A;  3J80 K;  3LST A;  2DTR A;  3JSP A;  3EET A;  1IXR C;  1P2F A;  4KIC A;  5FLX K;  2HGC A;  3SZP A;  3EQL F;  1YW8 A;  4G8X A;  3KP2 A;  4G7H F;  1TTY A;  4TV7 A;  4M9Z A;  1J2X A;  1HKT A;  1ON2 A;  4HLX A;  4U7B A;  1GHC A;  1YIO A;  2OU2 A;  1QPM A;  3MWM A;  3IL2 A;  1W4M A;  4KN7 X;  4HF2 A;  4YIF A;  3SFZ A;  3G73 A;  3ERE D;  3BY6 A;  2ZXJ A;  2HQR A;  2ZCW A;  2W85 A;  1PP8 F;  5HS7 A;  2EV6 A;  1QO0 D;  2DI3 A;  2MH9 A;  1IXC A;  2XAG A;  2O0Y A;  4A0Z A;  1BJA A;  3M1E A;  2O8X A;  5L3B A;  2CW0 F;  3WTV C;  1IZ1 A;  1D3Y A;  3QU6 A;  4BHP A;  1W7P A;  1XDU A;  3WU1 B;  1W7P B;  1NHA A;  3P7N A;  1TW3 A;  4EM2 A;  2PEX A;  3BJO A;  1YW9 A;  3BWG A;  2MBF A;  1EH8 A;  3QP5 A;  4EM1 A;  2A5Y B;  2K86 A;  4UVA A;  2VBX A;  2HKO A;  4HLY A;  2XRO A;  1YTY A;  1IUY A;  3VOD A;  5F1R A;  3M8E A;  1ZAO A;  3LAJ A;  2PBI A;  1BIA A;  3DV8 A;  1FZP B;  1PDN C;  5DDG A;  2PG4 A;  2IT0 A;  3SQN A;  3COA C;  5LBQ A;  4M74 A;  2JSC A;  1ZRC A;  1HQC A;  1U5T B;  4P5O A;  4B8X A;  2OZ6 A;  2VOD A;  4O3M A;  3C7J A;  5D5X B;  3FHZ A;  4G9Y A;  3KLN A;  4HDV A;  2V1U A;  4A12 A;  2A6H F;  4M72 A;  4HX4 A;  3DXJ F;  3CUQ A;  2A61 A;  4FHT A;  3CUQ B;  2BV6 A;  2LNB A;  3RPQ A;  1KU2 A;  1ZGA A;  3ECH A;  2XGX A;  3RDI A;  1X3U A;  1MDM A;  2L4A A;  2MLG A;  1MDM B;  3ML6 A;  4Y17 A;  2Z99 A;  2MD5 A;  2F5D A;  3O6B B;  5D6F A;  4IVN A;  1LB2 A;  2YR2 A;  4M9S A;  3HOT A;  4I7H A;  3K0L A;  5EEH A;  2LF7 A;  4UNO A;  4N9H A;  4O6J A;  5BS6 A;  3W6K B;  3JTG A;  1WKM A;  2GIV A;  5E1Z B;  3RKW A;  5K1Y A;  3R4K A;  5H6Q A;  3J81 Z;  4RB3 C;  2GAU A;  2XRN A;  3T8T A;  4NB5 A;  1MJB A;  4BYY A;  4EMS A;  2FQ3 A;  3IKV A;  3MEX A;  1FBQ A;  2CGP A;  1K78 A;  2XAJ A;  3TOB A;  1K78 B;  1ZYR F;  2JPC A;  2PMU A;  2MC3 A;  2HWV A;  5AIP A;  2STT A;  2BBY A;  3HYI A;  1AWC A;  3ZMT A;  2E7W A;  3I58 A;  3R6S A;  4EQQ A;  1Z6R A;  3P9C A;  4LFU A;  2MA3 A;  4EJO A;  4HX8 A;  1VTN C;  3DP7 A;  4KT5 C;  1C0W A;  4ESJ A;  3J7A O;  2UWM A;  4U7D A;  4UV8 A;  3M8F A;  2H94 A;  3NEU A;  2EA4 A;  5AIQ A;  2F5E A;  2HR3 A;  1RZ4 A;  1W7P D;  4XRF A;  2M45 A;  2FNA A;  2X0L A;  5E1W A;  2EFO A;  3WG9 A;  2GA1 A;  3I59 A;  1FBU A;  3I59 B;  3E5X A;  4L9N A;  4LLL A;  3EYY A;  1XMK A;  1W5S A;  3C3W A;  4WCG A;  4I0B A;  1WQ2 A;  3DFG A;  3WGG A;  1JXS A;  3WE2 A;  2X4H A;  1S3J A;  2QYO A;  3PQK A;  4HYE A;  4H0E A;  4BNC A;  2HTS A;  4KIG A;  1WI9 A;  1R1V A;  3P9I A;  2DAO A;  4HV5 A;  4XLP F;  1O3T A;  3CDH A;  3V8K A;  4CIC A;  1XSV A;  5D8K B;  1P4X A;  1JE8 A;  3KP4 A;  3ISP A;  1HW1 A;  4KMU X;  3SHF A;  3J81 K;  2VBZ A;  3E6C C;  3CLO A;  3LAP A;  3ZN0 A;  1ONV A;  4MTD A;  2HKX A;  4LD5 A;  4BQA A;  5ILU A;  1W5T A;  3HTS B;  1SMT A;  2Y75 A;  5BQT A;  2K4J A;  2PQ8 A;  2FEZ A;  4CXF A;  2P4W A;  1T38 A;  2XV4 S;  1I27 A;  5LEK A;  5DEQ A;  1F4K A;  3MQ0 A;  3E5U A;  1LQ1 A;  1TW2 A;  3MCZ A;  4NQW A;  3I53 A;  4CGZ A;  1MKM A;  4A5M A;  2DO7 A;  1G3T A;  4AIH A;  4HDU A;  2UXX A;  3IWZ A;  4M73 A;  1YS6 A;  2V9V A;  5IT9 Z;  4CYD A;  3GXO A;  4KA4 A;  3GZ6 A;  1R1U A;  2M1B A;  4ENJ A;  2FXA A;  3F3X A;  3TGN A;  1R23 A;  3V7S A;  4FT8 A;  3RPU A;  4GGG A;  1D8K A;  4ENN A;  2NAZ A;  2O3F A;  4A2U A;  3DF8 A;  4WX9 A;  4MQV A;  3GWZ A;  2IRF G;  1IN5 A;  3KEO A;  2W84 A;  2FBH A;  1O57 A;  3FWE A;  2VBW A;  2F5C A;  3BP8 A;  2DPU A;  3E97 A;  2QEN A;  3ZMD A;  2PN6 A;  5CVJ A;  1BI3 A;  2PLY A;  4D0P A;  4L0Z B;  1R58 A;  3SXY A;  2GA2 A;  3EDP A;  3DPT A;  4CDG A;  3GYH X;  2R7F A;  3K2Z A;  3ZQ7 A;  3E3V A;  1XSX A;  4F7Z A;  3GEZ A;  3HRM A;  3N4M A;  3C18 A;  5DD4 A;  1FT9 A;  1KQ0 A;  4G6Q A;  3GF2 A;  4HQM A;  4PDK A;  2ZFW A;  3OV8 A;  2AXL A;  5LHH A;  2M5W A;  4Q5S F;  2ETH A;  2K02 A;  3TQN A;  2BYV E;  3WOD F;  3RTR A;  1Z6T A;  2OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...