3Q5FA

Crystal structure of the salmonella transcriptional regulator slya in complex with dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
141
structure length
141
Chain Sequence
b'ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator slyA
publication title Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Transcription/dna
total genus 48
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q5fA00
3RKWA 2H6CA 2O8XA 3ULQB 3LAPA 1OYYA 3WGIA 1HQCA 1ZN2A 3WTZA 3R60A 5LBQA 1YS7A 3HOTA 2HKOA 2ZNYA 1H9TA 1TW2A 4PGHA 3L09A 3G3ZA 4P96A 1XD7A 1R00A 4L5IA 2FNPA 1LEBA 2M8EA 2W85A 3TO7A 1WI9A 4EGZA 3RPQA 1BM9A 2PQ8A 4MQ9F 3WTYC 4RGXA 3FMRA 3GLXA 1T2KA 2IA2A 1IRFA 3V7CA 2LDUA 3DV8A 4OU0A 3B73A 4DQ2A 5FLXZ 1Z91A 1OKRA 4JBAA 4PCQA 2W57A 4AIJA 4LK0F 5K5QA 3QRFF 4NHJA 1R22A 4A6DA 4QWQA 2DT5A 4EJVA 1UHMA 5E20A 1Z9CA 2MD5A 3FM5A 2DK5A 4I01A 1HXDA 2W25A 1R36A 2RNJA 2RKHA 3MZYA 3L2CA 1ON2A 5D6EA 2ISYA 1R5HA 3G73A 1ZLJA 1LJ9A 4OOIA 1UHWA 1Z6TA 4ASNA 4GYGA 1IN8A 1SFXA 3E3VA 3K1NA 2QM3A 4LG0A 3E6MA 3KP4A 3ZP5A 1W4MA 3GZ6A 3KZYA 2AXLA 1HW2A 2P6TA 3TDUC 4OINF 4ZZDA 3CUQA 2Z5UA 1YW9A 1J59A 5E1XA 2VT3A 1JGSA 2JTVA 1MJAA 5CYVA 4LG0B 1K79A 5FFZA 2MA3A 1HKQA 3FMQA 1RI7A 3KE2A 1REPC 2DQRA 1O3SA 1BC7C 2A68F 3CUQB 4KMFA 4L9JA 2QENA 1P92A 4KICA 1YO5C 4RGSA 4BHPA 2A6EF 3F6OA 4BYYA 3OV8A 3BPXA 3ZMSA 3E6CC 1C0WA 5F6FA 4EVIA 1USSA 2FMYA 3W6KB 2Y75A 3WTVC 2E7XA 2AS5F 2CFXA 2X4HA 4HF2A 3HRSA 3T0YA 2WTEA 2VBZA 2XV4S 1K7AA 2GWRA 2UXNA 5LGNA 1OYWA 1KYZA 4G6QA 4YIIA 4RGUA 1IRGA 1K78A 4MEYF 2D45A 5D5UB 3B02A 3F72A 5DCFA 3R6SA 5ICGA 3COAC 2IA1A 1G3WA 5HDNA 4U0VA 5A2QK 1T39A 4OIOF 3TGNA 2DW4A 4Y15A 4XLPF 1ONVA 1BIBA 4IF4A 3CUQC 2CSOA 1Z7UA 3O6BB 5ILSA 4A0YA 2J5PA 3LAJA 4I7HA 2XAHA 4HLXA 5JI6A 3GUDA 4S05A 2GQQA 4Q5SF 2HFHA 3GFMA 1LVAA 2YR2A 1DDNA 1KQ8A 1ZLKA 3SHFA 4BH9A 1ZRCA 2A3SA 3F8NA 2FRHA 2KRFA 2V1DA 2PLYA 2A61A 4IVNA 4G9YA 1R58A 2MH9A 4LGWA 5TRDA 5D5VB 3VFZA 3V8LA 2UWMA 4A5NA 4WX9A 4ZYGA 2MH2A 1KQ0A 1JXSA 2ESNA 2DK8A 3FHZA 4YFNF 2D1VA 3FZVA 1WKMA 2BGCA 4M9SA 1ODDA 3WODF 4A0XA 3P7NA 1GHCA 2EFOA 2ZMEA 3KLOA 1EH7A 4XRFA 3MAJA 1J75A 1YQAA 1DUXC 4G7ZF 4EM0B 1KU2A 4N0BA 2L01A 1XDSA 4L5JA 5H20A 3RPUA 2STTA 3CUOA 3J80K 1U5TA 2MC3A 2ZMEB 3W6JB 3FMSA 1LNWA 3NQOA 4O6JA 1SMTA 1W7PD 1FBQA 2DBBA 5EEGA 2XAJA 1QGPA 4WXHA 3LSTA 4P55A 5HS7A 3K1MA 1QQIA 5J8CA 2WWYA 3JAMK 3GO5A 1QNTA 4CGZA 3HYIA 2Q2EA 5ICEA 3QP6A 4I0BA 2W84A 1FBSA 1EV7A 1XSVA 2KKOA 4HX4A 1IF1A 3WGHA 4KN7X 3HHHA 1XGOA 2DQLA 5D4SA 2PN6A 1FP2A 1B59A 4EM2A 1J2XA 1WRJA 2M1BA 5DUKA 3TO6A 1FYMA 2OQGA 3IRRA 5DDGA 4UVCA 3F6VA 1BI3A 3EETA 3HRTA 3GFIA 4YIFA 2GIVA 3CO7C 1RIOH 2STWA 3BROA 2OBPA 1LB2A 1OPCA 3KP3A 1TNTA 2XKPA 2VE9A 2P4WA 4LB6B 2FQ3A 2ELHA 2GXBA 1Y0UA 3V7RA 1FT9A 3SQNA 3QAHA 2EFQA 1UFMA 5IT9Z 5HLIA 1QBJA 2ISZA 5JFRA 1U5TC 3KP6A 2VONA 1CGPA 2QLZA 2HYGD 3H3ZA 3M9AA 4FHTA 3GW2A 1AWCA 3LA2A 2EFNA 2OQRA 1MZBA 2Q8KA 2UZKA 4I09A 2BBYA 3V4GA 4G6DA 2V1XA 3MWMA 2RQPA 3I58A 5CVUA 2HDCA 2EK5A 3IC7A 2NNNA 3SFZA 1P4WA 4Q47A 1MD0A 3TOBA 1DPUA 1UB9A 2G7HA 5K5OA 4WWCA 1SD6A 4HF1A 1F9NA 1NHAA 3RDIA 4M71A 1IZ1A 5IT3A 4UNOA 2C6YA 4AIHA 3HOSA 4BNCA 4EJTA 2FU4A 4M72A 1Q1HA 1W7PB 4M9XA 1KU7A 5H6RA 4KN4X 4OIRF 2OZ6A 1K6OA 1YS6A 1FNNA 3N4MA 3J7AO 3I53A 3P9CA 5CVJA 2FMLA 3S2WA 2P5LC 2IJLA 4EJOA 1PDNC 4BQAA 1R23A 2DI3A 4GO1A 2OAZA 5D6FA 1RUOA 3KP2A 4F7ZA 2ZCWA 5LHHA 4NB5A 1PP8F 5LRSA 3CO6C 2XIGA 2P7CB 4RB0A 2Q0OA 2XHKA 3BP8A 5BS6A 1G6NA 3T5XA 1L0OC 2HTJA 1T98A 4HQMA 3L00A 3KP5A 3D0SA 4LFUA 3H3UA 4N9HA 2PFBA 5LEJA 3IL2A 4BAYA 1IUYA 4GXOA 5K1YA 3RIRA 4CYDA 2QQAA 2JRTA 2D2WA 1IXRC 4LK1F 1T0FA 3QPHA 1ZG3A 1W5SA 4UHTA 1KA8A 3FXRA 2H27A 3WTUC 2HQRA 3ZN1A 3GYHX 3SXYA 1A04A 4Q48A 4KNYA 3I59A 3MFKA 2ADUA 2FXAA 2VE8A 5CVRA 3H92A 4E70A 2X0LA 5L3DA 2QQBA 2W24A 2NS0A 1S7AA 1D8JA 2LSOA 2IA0A 1QO0D 2HS5A 3WTXC 1E17A 3RYRA 4FX0A 3I71A 4JK1X 4HLYA 4NQWA 2GA2A 3ML6A 4A0ZA 1YIOA 3L9FA 2EFPA 2EJRA 4RB2C 1U3EM 3AAFA 1V4RA 2PEXA 1S7OA 3GXOA 2VC0A 1B6AA 4IRGA 1G3SA 3VODA 1BJAA 2K27A 4YG2F 3DKWA 2GXGA 2P8TA 2Z33A 4OIPF 5DD4A 2QUFA 4B8XA 4D0PA 2F2EA 2H09A 4LLNA 1F1ZA 4I0AA 2O3FA 2XRNA 3EYIA 2LNBA 3GZ5A 5ERIA 5LHGA 4ETSA 3ZMUA 1FY7A 1G4DA 2E1CA 1LDKB 5LRRA 2JT1A 1O3RA 3VB2A 4ZH4F 3DQVC 1RUNA 1YW7A 1YYVA 1R5GA 2KIFA 5HS9A 1ON1A 1XMAA 2L4MA 4RS8A 3KZZA 3VOEA 2V79A 3TO9A 3RKYA 1O57A 4WXDA 4ENJA 3BJ6A 3RJPA 4I98B 4ESFA 3LFKA 3QU6A 2COMA 1S6LA 4EMSA 4PZJA 1YLFA 2H94A 1ZH5A 2CYYA 2VXZA 3DFGA 5DCMA 2VBWA 1STZA 2IW5A 1USTA 5E18F 4AWXB 5LLQA 1H9GA 2FE3A 2FBHA 4HBLA 1BIAA 2E7WA 4M74A 3TDZC 2F5DA 4IPAA 3FM3A 2BEOA 4JQFA 3VEPA 3I54A 3HRUA 3WU1B 3GVAA 5HLHA 5DCMB 3RTRA 2PBIA 5F64A 3KFWX 4EJWA 1JE8A 3T1BA 1XGSA 3ELKA 3DF8A 1EH6A 3IHUA 1G3TA 2GAUA 3J80Z 5BQTA 3KEQA 1EH8A 1Z1DA 1K78B 2VODA 3M7GA 2O0YA 3RKXA 2QYOA 4BHCA 2A07F 3P9IA 5CVIA 5ILVA 4OMYA 2XAGA 4QLCU 3HTSB 1T6SA 1R7JA 2NYXA 4OMZA 4R79A 4RB1A 3JAMZ 4HZFA 4HX8A 5ED4A 1J7KA 3LQRA 4P9UA 1S3JA 1ZHFA 3J81K 1X3UA 1L3LA 4KYWA 1U6GA 3LWFA 1Z05A 4UVBA 5DD8A 4GCVA 5FD5A 2VC1A 2O61A 4KIGA 3WTSC 5HS8A 1XGMA 1I1GA 2EFWA 4I2OA 5JHUA 1BN5A 2NRAC 2TDXA 5AIQA 2XKOA 2A6HF 1ZGAA 2EWNA 3IWZA 3FWEA 2ESHA 3CJNA 2CO5A 3GFJA 2GZWA 5HDGA 5L3CA 4ENMA 3U2RA 1FLIA 2BYVE 4GYIA 5TJJA 5HOOA 2M45A 2V6CA 1O7LA 3IRQA 3E97A 4RAZA 3V7SA 3R0AA 4KA4A 4U88A 3HUGA 4R8HA 3CLOA 3WG9A 1SD4A 3F8MA 4XLNF 2DPDA 4L9VA 5L3GA 3ZMZA 3REOA 4HDUA 2Z9OA 3I0TA 4KIBA 4WK8F 1U5TB 1MJ9A 5D8LB 5J6XA 1D5VA 5DEQA 3HSFA 1S29A 1ZRFA 4MHGA 1IXSB 1FSHA 1SD5A 1LEAA 3U1DA 5KK1A 2QVOA 4ON0A 1SFUA 1XGNA 3HTUA 5DUIA 4MGRA 4S04A 2OA4A 2HTSA 1R1VA 1QZYA 2PMHA 1I5ZA 2O03A 2ETHA 1BBYA 1LQ1A 3NEUA 5ICFA 3O2PE 1MDMA 4M6XA 2K86A 2V9VA 5FD6A 4CDGA 2FEZA 3DPLC 3LA7A 4EV0A 4G94A 1HKSA 2DLLA 5E8GA 4Z2YA 3KETA 4MTEA 4KFCA 3DPTA 4L9NA 1I1SA 3FX3A 2ZFWA 1MDMB 1F4KA 1RZ4A 4HV6A 2WV0A 1KYWA 1BI2A 4KUMA 1TTYA 3MQ0A 1IN6A 3O3KA 5LGTA 1KU3A 2L3DA 3E6BA 2D1HA 1GXQA 5CLSA 2IVMA 2B0LA 4MEXF 2P5VA 4N9IA 5FO5A 4B09A 1WQ2A 2PG4A 1HW1A 4ZYHA 3ERED 3K0LA 4O3MA 2VOPA 2JPCA 3WE3A 3CTAA 1MJBA 1CF7A 1XB4A 2ACJA 4TV7A 4Y13A 3RYPA 1FYLA 4R1HA 1I6XA 2FBKA 3MCZA 1J9IA 4BHBA 2HQNA 2PMUA 2JSCA 3NRVA 3WTTC 1SD7A 1B9NA 1WWXA 2VBYA 3R0JA 5CJ9A 1CF7B 5E1ZB 3D5LA 4U7DA 1DP7P 1TQPA 5AIPA 1LDDA 5E17F 3JW4A 2ZNZA 4P9FA 3E5UA 1HSJA 2Y48A 4M73A 2YSRA 2QBYA 1MKMA 3DEUA 3EUHA 1PP7U 3U9GA 3T8TA 3F23A 3WGGA 2F5CA 4ZYDA 3E6DA 1UCRA 2DU9A 1F5TA 2FA5A 1P2FA 5L3BA 3SZTA 2DO7A 1ZAOA 1KGSA 4EGYA 4HYEA 1B4AA 3SZPA 5D8KB 2QBYB 1OYIA 3OOPA 3ABTA 4HOBA 1U78A 4KT5C 2RN7A 3BZ6A 4MTDA 3LQQA 2RC4A 1FP1D 1FZPB 2ZKZA 1D8KA 1DPRA 1TNSA 5FFXA 3JTHA 4WCGA 1OR7A 3ZMTA 1SFEA 2FSWA 5AONA 5KVRA 4CO8A 1QPMA 2YX7A 3BOQA 2HR3A 3R4KA 4L9TA 2K4BA 3TQNA 1FC3A 2E1NA 2OD5A 2A69F 2MLKA 3F21A 3ZPLA 4MNUA 5HVQC 2R7DA 1XCBA 4L0YB 4EM1A 4YFXF 2P6SA 2Z3YA 2G9WA 3P9KA 4LLGF 5BPIA 4HW0A 2L54A 3I59B 5JR3A 3FXQA 1YG2A 2K4JA 1WSUA 4IXAA 2KJBA 2EB7A 2QWWA 3K1PA 4AVPA 5E8IA 2HWVA 4G8XA 5FB2A 3C7JA 4AIKA 2IPQX 4U0WA 1ZG1A 2MBFA 2M87A 3Q9SA 3ZMDA 1LDJA 4M6YA 3DXJF 2KJCA 2Y0MA 1IN5A 2LF7A 1FX7A 3GF2A 5JVTA 2UXXA 3WU0A 1XN7A 2M5WA 4FT8A 4AD9A 2HOEA 4IHSA 1RNLA 1FOKA 1B9MA 3ISPA 5D5WB 1AOYA 2KIUA 2RVCA 2R3SA 2EA4A 3BJAA 4HDVA 4LB5A 4ESJA 2DPUA 1KU9A 3V8JA 2XROA 1ZRDA 3C3WA 1XSXA 5A2QZ 4I02A 2FF4A 1HKTA 5L3FA 4RAYA 2HYFA 1TBXA 1MGTA 2EV0A 3BY6A 4LD5A 1IN4A 3M1EA 3ECOA 5EEHA 2A5YB 1TQIA 2YU3A 2CGPA 3KCCA 3JSPA 2OZUA 4PDKA 3CDHA 5K5RA 1FSEA 4KIFA 5FLXK 1HW5A 3I4PA 2BE5F 3C18A 1SAXA 3J81Z 1B1BA 3EQLF 2HZTA 3QU3A 4XSXF 1R1TA 5LEKA 3PQJA 5D5XB 2ZBKA 2FNAA 4IRHA 1O3TA 1T38A 3HSRA 4K2EA 5L3EA 4H0EA 2FOKA 1JHHA 2RDPA 3EYYA 4A5MA 1YFHA 2QZ8A 2HEOA 4A6EA 4IJAA 3WE2A 1IAWA 3K2ZA 2WC2A 4O5VA 5ILUA 3MZHA 3GFLA 5FGMA 2L02A 1XSDA 4CZZA 1IN7A 1JHFA 4HAMA 4M9ZA 5D4RA 2LF8A 3PFIA 2PI0A 3TKYA 4L18B 5F1RA 4LJZF 4RGRA 1YW8A 1FWZA 6PAXA 4G7HF 4UUVA 1QZZA 4WXCA 4A12A 1ZREA 5BOXA 3F3XA 2CWEA 4DNCA 3QP5A 3I5UA 4PGGA 4CHUA 2MLGA 3ZQ7A 4HQEA 4ENKA 2J5OA 4L0ZB 2IP2A 1P6RA 2JZYA 2ZO4A 2BV6A 1J0RA 1FBUA 1G3YA 2DFIA 2VN2A 2IT0A 1XCVA 2NAZA 1O3QA 3FF5A 2L4AA 4UV8A 1W5TA 2H6BA 3BDDA 2EV5A 2XVCA 1S8NA 1FYKA 2LKPA 3C1DA 5CVVA 5H6QA 2XASA 3QPTA 1TQMA 1R1UA 2EV6A 1VTNC 2YX4A 1YTYA 1XDUA 3MEXA 1ULYA 3KEOA 3RI4A 3IKTA 1XMKA 2F5EA 3R61A 2CW0F 3HHGA 2JPBA 2M30A 2XAQA 3HSEA 3K9TA 4HF0A 2CQKA 4IHTA 1ZGJA 2EA2A 2PJPA 2RGVA 3BPVA 2VBXA 4KDPA 3TOAA 2VOOA 1SMYF 3BWGA 1IW7F 2P5KA 4OIQF 3ABUA 1ZG5A 3Q5FA 3GX4X 4BXUA 2DTRA 3QOPA 2DAOA 3HRMA 3T8RA 4U0YA 2KIMA 2HKXA 3WTWC 3JSOA 1TW3A 4U7BA 3KP7A 1H0MA 1FPQA 1OMIA 3GWZA 1V3FA 1P4AA 1BOAA 4ZZLA 3M8FA 2R7FA 4HX7A 5HDKA 3F8CA 2XAFA 2NNYA 4XSZF 4ZYEA 4A2UA 4FX4A 1D3YA 4LLLA 1ZYRF 3K69A 3M8EA 3ZMVA 4HV5A 1HBXG 2VT2A 2GA1A 5LGUA 3IWFA 5DYMA 1BI0A 4GGGA 1I27A 3HIFA 3L7WA 3KLNA 1P4XA 2XGXA 2K7LA 2ZJ2A 2V1UA 5HLGA 2HGCA 4UV9A 1O7FA 4MQVA 2CG4A 4RB3C 2G7UA 4EQQA 4ENNA 2YPRA 1BI1A 1W7PA 1GXPA 4HA8A 2F5FA 4CICA 5LHIA 1U8RA 4XBFA 4Y17A 3LA3A 2OU2A 5DV5A 1KQ9A 2RV8A 4KMUX 2XUBA 2FBIA 1BC8C 2K02A 4YFKF 2IRFG 4P5OA 4Q4ZF 2Z99A 4G7OF 3I64A 1U2WA 3BJOA 3Q9VA 3V8KA 5E1WA 1Z6RA 3ECHA 3E5QA 1PUEE 5BPDA 2P7VB 5BMZA 3N97A 4EJUA 5J8FA 1IXCA 1TLHB 3GEZA 4CXFA 3EDPA 3JTGA 4UVAA 4LMYA 3F8FA 1HSTA 3E5XA 3F8BA 4UXNA 4ESBA 5IT9K 3F22A 5ICCA 2QQ9A 4WF2A 3ZN0A 3DP7A 1J5YA 1GVJA 1ZARA 3IKVA 3ROUA 2O6GE 1E2XA 3FXUA 4IRIA 2ZXJA 3PQKA
chains in the Genus database with same CATH superfamily
1ENHA 3RKWA 2H6CA 2O8XA 2R93J 3ULQB 3LAPA 1OYYA 3ESWB 3WGIA 1H8AC 1HQCA 1ZN2A 4DGWB 3WTZA 4B48A 2LP0A 4X6AJ 3R60A 5LBQA 4UUSB 2VQHA 2KT0A 1YS7A 5GTIC 2DOAA 3HOTA 2HKOA 3BTIA 3L2VA 3OR2C 2ZNYA 1H9TA 1TW2A 4PGHA 1Y56A 1T56A 3PUBA 4NNJA 1S72I 4ZJZA 3OS2A 4E7KA 1MBHA 3L09A 3ASOH 4HPQA 3G3ZA 2IEKA 1W0UA 3GTLJ 2IGNA 4P96A 2E71A 3GTKJ 1GV5A 1XD7A 5EJCA 3S93A 1RESA 1QHGA 2RNGA 1R00A 3DKXA 4L5IA 2FNPA 3A0HC 4CH7A 1LEBA 2M8EA 2W85A 2QGUA 1WI9A 2IXSA 3TO7A 3FXOA 4EGZA 3RPQA 1WJEA 1BM9A 1MBEA 1JTYA 1G8XA 3OSFA 2PQ8A 1X4OA 3W6VA 4MQ9F 2CS3A 4E7JA 1OCOH 4YRVA 3WTYC 1ETKA 2ZXHA 3W2VA 4RGXA 1TWFJ 3FMRA 3GLXA 3AKZA 1T2KA 2IA2A 1HDPA 1WH7A 1IRFA 3BTLA 3V7CA 2LDUA 3DV8A 4OU0A 3B73A 4DQ2A 1P9QC 4CYCB 5FLXZ 1Z91A 1OKRA 4JBAA 1ACIA 4PCQA 2W57A 3OYDA 4AIJA 3VSKA 4LK0F 5K5QA 2IGOA 1JKRC 3QRFF 5GP9A 4NHJA 2L5QA 1R22A 3ZOBA 4A6DA 4BQNA 4QWQA 2BW3A 1EKEA 1Y0NA 1G59A 2DT5A 5GTHC 1B8IA 1POGA 4EJVA 1UHMA 2L9VA 5E20A 1U0JA 1AA7A 2KQRA 4DZPA 1Z9CA 2MD5A 5FLMJ 4BE2A 4MIMA 3FM5A 1ORKA 2DK5A 4I01A 4C3HJ 1HXDA 2W25A 1R36A 1YHQI 2RNJA 2RKHA 3K70C 1APLC 3MZYA 3CC2I 4G12A 3L2CA 1ON2A 2CRGA 4IKFA 4LIUA 2LOOA 3OYCA 5D6EA 2ISYA 2KFDA 1UZCA 1VQ9I 1R5HA 4XIDA 3CJQB 1Z3YA 3G73A 1ZLJA 3ZQLA 3L2QA 4Y52J 1LJ9A 4OOIA 1UHWA 1Z6TA 4ASNA 4GYGA 1IN8A 2NVYJ 1NH3A 4FE7A 3M07A 1SFXA 3E3VA 3K1NA 2QM3A 2JVHA 3B6AA 3E6MA 5FKLA 4LG0A 1MBFA 2QSHX 3KP4A 2HU9A 3ZP5A 1W4MA 3TBIA 3GZ6A 2QSFX 3ZQFA 3KZYA 2AXLA 5KAFC 4HRIA 2LH9A 3I3LA 3ZQCA 1HW2A 2JA7J 2P6TA 1JUPA 5JLXA 4PFPA 4XKVA 3TDUC 4OINF 5F0HA 4ZZDA 3P5JA 2X6XA 3QODA 3CUQA 2Z5UA 3HZJA 1YW9A 3C2HA 3TW6A 1J59A 5E1XA 2ZXIA 3DPUA 2VT3A 3GTPJ 2A05A 1JGSA 2JTVA 5B66C 1MJAA 3PNYA 5CYVA 1TZLA 1X58A 4LG0B 1K79A 5FFZA 1M1EB 2HZDA 2MA3A 3L2UA 3CQZJ 1Q1VA 2CMPA 5EZGA 1HKQA 1RC9A 3OYMA 2QKLB 3FMQA 4L5EA 1RI7A 2DN0A 3KE2A 4DZJA 1PYVA 2ZJRF 1REPC 3VWBA 3K10A 1W0TA 3MKLA 3DEWA 2DQRA 1O3SA 1RR8C 1BC7C 2GM4A 2A68F 3CUQB 4KMFA 4L9JA 2QENA 4QTRA 3HG9A 2MSYA 2D5VA 1VI0A 3BR3A 5E79C 1P92A 4KICA 1YO5C 4RGSA 1BR2A 2CFOA 2JVGA 4BHPA 1PVEA 1VF9A 1SVOA 2AQFA 2A6EF 4Y7NJ 3F6OA 2PJRA 4BYYA 3VYTB 4EATA 3OV8A 4X0GA 4IO9F 2DA3A 3BPXA 3ZMSA 3E6CC 1UAAA 2LREA 3FBNB 1C0WA 5F6FA 4EVIA 1USSA 3S1RJ 3S2HJ 2FMYA 4J00A 3W6KB 2Y75A 3H9JA 3WTVC 2E7XA 2V9PA 2AS5F 2CFXA 2X4HA 3OY9A 4HF2A 3HRSA 1YX3A 2E60A 3T0YA 2VI6A 4BS9A 2XSDC 2WTEA 2VBZA 2XV4S 1K7AA 3KZIC 2GWRA 4EEFG 4FASD 3VYSB 2UXNA 2DCEA 4PUSA 5LGNA 1OYWA 2MABA 4IEJA 5F04A 3S32A 1KYZA 5E3LA 5FRNA 3LL7A 4G6QA 4YIIA 5IP7J 4FCYA 4RGUA 2CQXA 1S9HA 1IRGA 1K78A 1Z0XA 4MEYF 1TL8A 2D45A 1D5YA 5D5UB 3B02A 3F72A 5DCFA 3R6SA 4A3MJ 2DJIA 2LY9A 5ICGA 2NS7A 3CCSI 3COAC 4E7HA 1DP3A 1J09A 1Y1WJ 2IA1A 1G3WA 5HDNA 4U0VA 5A2QK 3VDXA 2DYRH 1T39A 4OIOF 3TGNA 1FEXA 2DW4A 1MH3A 2KMUA 2O5RA 2P0WA 2DA7A 4I99C 1TWGJ 4Y15A 4XLPF 2JK3A 1ONVA 1BIBA 2ELJA 4IF4A 4JX4A 3CUQC 2CSOA 1Z7UA 3O6BB 5ILSA 4A0YA 2LG4A 2J5PA 3PJRA 3LAJA 1A35A 2OF7A 4I7HA 3FXJA 2XAHA 4HLXA 5JI6A 3QWLA 3GUDA 3PSIA 1IV6A 4S05A 2GQQA 2X6YA 4Q5SF 2HFHA 5H2FC 3GFMA 1QU3A 2VLAA 3BG5A 1LVAA 2YR2A 1DDNA 1PUFB 2DXIA 1KQ8A 1ZLKA 3SHFA 4BH9A 1ZRCA 5CQEA 2A3SA 3F8NA 2FRHA 4M3EA 2KRFA 1VQ6I 2XRLA 5KHDA 2V1DA 1S7EA 2PLYA 2A61A 4IVNA 2VQGA 3K4NA 1R58A 3PUFA 3QYEA 4G9YA 2MH9A 2B7EA 4GRIA 5M3MJ 4LGWA 3PIPF 3SDBA 5TRDA 5D5VB 3VFZA 3V8LA 2UWMA 4A5NA 4E7ZA 2HNHA 4WX9A 5EGOA 1IJWC 3G6EI 2E19A 1IC8A 4ZYGA 2MH2A 1KQ0A 1JXSA 2ESNA 3HB9A 2DK8A 1FOYA 3FHZA 1MMNA 3V42A 4YFNF 5GPAA 4GDFA 4ITVA 1WVRA 2D1VA 3FZVA 5J1RA 3RQ4A 2K40A 2K9SA 1IG7A 1ZGWA 1JI8A 1WKMA 1Y1VJ 2BGCA 4ZDPA 4M9SA 2DT6A 1ODDA 3WODF 4A0XA 3P7NA 1GHCA 2QQ8A 2EFOA 2ZMEA 3CC4I 3KLOA 1EH7A 2L7ZA 4XR6A 2FOWA 3K2AA 5F0CA 4XRFA 4BKXA 3TEDA 3MAJA 1J75A 3BCBA 5EEAA 2Y2ZA 2MYSA 3IH3A 3TP0A 4PJ0C 3LOCA 5EGOB 2H1LA 1YQAA 4IOAF 3ONQA 1DUXC 4G7ZF 4EM0B 2VXDA 1KU2A 4N0BA 1R71A 4XLEA 1ITYA 2L01A 1XDSA 5DM6F 4L5JA 2VL8A 3BG7A 2HVQA 5H20A 3RPUA 2GLOA 2STTA 5J1YA 3Q0WA 3CUOA 3J80K 1U5TA 2MC3A 2ZMEB 4E6KG 3W6JB 3FMSA 1LNWA 2Z1DA 3NQOA 4O6JA 1SMTA 1W7PD 4B44A 3FK7A 2M3AA 3CJRB 2DMUA 1FBQA 2DBBA 5EEGA 2XAJA 2DA4A 1QGPA 4WXHA 3LSTA 4P55A 5HS7A 1K6YA 3KYDB 3K1MA 1QQIA 3PQKA 2WY7Q 1VZ0A 5J8CA 4HNVA 2WWYA 3JAMK 3GO5A 4XKCA 2R7OA 1QNTA 1QZEA 3I9V2 4CGZA 3HYIA 2Q2EA 1WJAA 5ICEA 3QP6A 3L2RA 1MSEC 4I0BA 1AKHB 2W84A 1FBSA 3H5AA 1OCZH 1XPXA 1EV7A 1XSVA 4BBRJ 2GBYA 3HOWJ 3FKJA 4BJ5C 2KKOA 3MVPA 1DU0A 3TW7A 4HX4A 4YELA 1IF1A 2NVQJ 1BR4A 3WGHA 3CCMI 3HEFA 3AG2H 3K4KA 4KN7X 2B9SA 1NTCA 2AXTC 3HHHA 1XGOA 2ZB9A 2DQLA 3PIOF 5D4SA 2PN6A 1FP2A 4PJMA 1B59A 1TP4A 4EM2A 1J2XA 2ID3A 3J7YJ 5F1JA 5E3OA 1WRJA 2M1BA 4JOMA 1VQ5I 5DUKA 4B43A 3TO6A 3A01A 1FYMA 3S17J 2OQGA 3IRRA 4ZDLA 4IQ4A 5DDGA 4UVCA 2XF7A 3F6VA 5B1BH 1BI3A 3I4MJ 3EETA 3HRTA 3H9QA 3TL4X 3OS1A 2GIZA 4YIFA 2GIVA 3GFIA 3CO7C 2Y9ZA 2A6TA 2E5NA 4UUTA 2ZMEC 1RIOH 2STWA 2X6WA 3BROA 2OBPA 1LB2A 3U1KA 3OYIA 1OPCA 4XRSG 3KP3A 4XQFA 2YU9J 1TNTA 2XKPA 3PO3J 2CW8A 2VE9A 1W36C 2P4WA 4LB6B 2F6CA 1B72A 3LSGA 3E1SA 2DTZA 2FQ3A 4U87A 3LSRA 2HI3A 3JRAA 2ELHA 2GXBA 3K70D 5M3FJ 1Y0UA 2ZSIB 3ZQQA 4XL9A 3V7RA 1OFCX 2DA5A 2LY2A 2XDVA 1A6IA 1FT9A 3QYBA 3SQNA 3QYFA 3QAHA 4BQQA 3QQAA 2EFQA 1UFMA 3D5SC 1A5JA 5IT9Z 5HLIA 2O7OA 1QBJA 2ISZA 4BY7J 5JFRA 1F43A 1LKXA 2FX0A 1U5TC 3KP6A 1IO2A 2VONA 1CGPA 5IYBJ 2QLZA 2HYGD 3KYCB 4UB6C 3H3ZA 3M9AA 2E2HJ 4FHTA 3GW2A 5F27A 1AWCA 3LA2A 2EFNA 2OQRA 1MZBA 2Q8KA 2UZKA 4I09A 1ZK8A 2BBYA 3Q0VA 3V4GA 4G6DA 2V1XA 1HA8A 2V1NA 3MWMA 2RQPA 1WJBA 3KX2A 3ASNH 1K4TA 3I58A 5CVUA 4PK4A 2HDCA 2EK5A 2HVSA 3IC7A 3KYLA 2NNNA 3HM5A 2KDZA 3SFZA 1P4WA 1WJFA 4Q47A 1MD0A 3TOBA 1DPUA 1UB9A 3BTCA 3PL8A 4JX6A 2G7HA 5TGTA 3CD6I 5K5OA 4BDYA 2X1EA 4WWCA 1SD6A 4DBRA 4HF1A 1F9NA 2JA2A 1NHAA 2DDBA 2LK2A 3WHCA 3RDIA 4M71A 1IZ1A 4DJAA 5IT3A 4UNOA 1OJLA 1HCRA 2DFFA 2C6YA 2XF5A 4QPOA 1A36A 4RBOA 4AIHA 3HOSA 4BNCA 4EJTA 3BQYA 2FU4A 4M72A 2OJED 5EG0A 1Q1HA 4XKBA 2XGDA 3OIQA 1SAUA 1W7PB 4M9XA 1KU7A 1S5LC 2X9DA 5H6RA 3M8JA 4KN4X 3G1LA 1MNMC 2RAEA 1VQOI 4OIRF 2OZ6A 4A3JJ 1K6OA 2KZGA 1YS6A 1FNNA 3N4MA 1YJWI 3J7AO 1MMDA 2UUZA 3I53A 2X85A 3P9CA 3B6CA 5CVJA 3LSMA 4YIRX 1VNDA 1BA5A 2FMLA 1BL0A 4XOTA 3S2WA 2P5LC 2IJLA 4EJOA 2W1OA 1PDNC 4BQAA 1R23A 2DI3A 4GO1A 4XLAA 2OAZA 2CUZA 5FJ8J 5D6FA 4S0HB 5CPRB 2BOLA 3MKZA 1RUOA 3KP2A 4F7ZA 4C2MJ 2ZCWA 1OCRH 1X2NA 2L9RA 5LHHA 3OIOA 4NB5A 1PP8F 1GVDA 5LRSA 3CO6C 2XIGA 2CV1A 1OLTA 2FQ4A 1X1BA 2P7CB 2E1OA 1BJZA 2ZJQF 3H36A 2Q0OA 1E3HA 4RB0A 2XHKA 3BP8A 4RM3A 5BS6A 1ETXA 1G6NA 1FMWA 3T5XA 1L0OC 4KITB 3CMEI 4KT6A 2HTJA 2BVLA 1T98A 4HQMA 3L00A 2FD5A 3KP5A 2HVRA 1Y6IA 2BVMA 1TT0A 3KIOA 3D0SA 4LFUA 2VASA 5C4JJ 3H3UA 4N9HA 4D7MA 3JRBA 3CP2A 2PFBA 5LEJA 3IL2A 2L7FP 3O8HA 3IAS2 4BAYA 4DYRA 1IUYA 3H9GA 4GXOA 3LSJA 5K1YA 3RIRA 4BJ6C 4CYDA 2KL4A 2QQAA 3BZKA 2JRTA 4LIVA 2D2WA 1IXRC 4XLHA 4LK1F 1T0FA 3QPHA 3H5NA 1ZG3A 5TISC 3OYAA 1W5SA 2QCOA 3OYBA 2XPWA 3NWSA 3LSKA 4UHTA 1KA8A 3FXRA 1UG2A 4NC6A 2H27A 2KRHA 3WTUC 2HQRA 2LLKA 1QVTA 2DMPA 3ZN1A 3GYHX 3G4SI 3SXYA 1A04A 4Q48A 4KNYA 2K9NA 3I59A 3MFKA 2ADUA 2FXAA 2DT7B 5J4VA 2VE8A 3SZGA 5CVRA 3H92A 4E70A 3JREA 4PJLA 2RREA 4I6ZA 2YUSA 2M4GA 2X0LA 5L3DA 2QQBA 2ICWG 2W24A 2NS0A 4A3DJ 1S7AA 2XSJC 1D8JA 2LSOA 1HC8A 3FXLA 2IA0A 1MBKA 1QO0D 2HS5A 2L7MP 2IBDA 3MZ8A 3WTXC 1E17A 2HOSA 2DOEA 3M1CA 3ABLH 3RYRA 3CCUI 3HBLA 4FX0A 1UELB 4ZYAA 2MFZA 3I71A 4DYCA 4JK1X 4HLYA 4NQWA 2GA2A 1R49A 2DMNA 2ME0A 3ML6A 3L2WA 4A0ZA 1YIOA 2BXYA 3L9FA 2EFPA 3RCOA 2EJRA 2ZXWH 3OYNA 3S3MA 4RB2C 1U3EM 4MFDA 2Y9YA 1KZHA 3AAFA 1V4RA 2PEXA 1S7OA 3GXOA 2VC0A 2R5YA 1B6AA 1XMXA 2JRMA 4IRGA 4JX5A 3RKQA 2DFHA 4F52A 2V26A 1G3SA 3VODA 1BJAA 2K27A 3GZNB 4YG2F 3DKWA 2GXGA 1TWCJ 2XPVA 3O8GA 2P8TA 2Z33A 1YRNA 2GOMA 1TWAJ 5FRMA 1H89C 4OIPF 3CF5F 5DD4A 2QUFA 4B8XA 2L0KA 4D0PA 4D7NA 2F2EA 2H09A 2BW3B 1F1ZA 4CCOA 3GCMA 4LLNA 2HQAA 4I0AA 1B8IB 2R7QA 2O3FA 4J01A 1Y39A 2EIMH 2R5YB 2XRNA 3EYIA 2LNBA 5EYRA 3GZ5A 5ERIA 2I10A 5LHGA 3RZDJ 4ETSA 1Z67A 2QA4I 3ZMUA 1FY7A 1G4DA 2E1CA 1LDKB 5LRRA 2JT1A 2VIXA 4RM2A 1O3RA 1T0FC 3VB2A 4M3DA 4ZH4F 3DQVC 1RUNA 2V9KA 2GXAA 3HOUJ 3S14J 1YW7A 3X2QH 2A5WA 1T33A 1YYVA 1R5GA 3OYEA 2E34A 4HEA2 2KIFA 5GAGJ 5HS9A 1ON1A 1YX5A 2E5ZA 1A31A 4BACA 1XMAA 2L4MA 5F0FA 4RS8A 3KZZA 4H4KC 3VOEA 1NG7A 2V79A 1SEUA 2E2IJ 2F4MB 3TO9A 1VFCA 3RKYA 1O57A 4WXDA 4ENJA 1ZKGA 2K9LA 4BXXJ 2KHMA 3BJ6A 4JP0A 3RJPA 4D5CA 3DCFA 5KCMA 4XORA 4I98B 4ESFA 2JWTA 2XGEA 3LFKA 4BDZA 2AHQA 4DYQA 3JRHA 2ZFUA 4I76A 3SEQA 2JUGA 1BW5A 4Y33A 3QU6A 3Q0UA 2COMA 1S6LA 4EMSA 4DIQA 4PFOA 4PZJA 1YLFA 2H94A 1ZH5A 3CCRI 2CYYA 2ECCA 2VXZA 1ZQ3P 4XMYA 1WJDA 3DFGA 2EZHA 5DCMA 2VBWA 4IHWA 1STZA 3IP4B 2IW5A 1USTA 5E18F 3HPHA 3BCAA 4AWXB 5LLQA 1H9GA 2FE3A 2FBHA 2Z16A 4HBLA 4C9YA 4F93B 1BIAA 2JA6J 1XTAA 2E7WA 1UJ8A 4M74A 1QHHD 3RZOJ 3TDZC 3DTEA 2F5DA 2X1DA 2W4SA 4IPAA 4IQJA 3FM3A 2WAQN 2Y30A 3I56I 4G6TB 5IPAA 2BEOA 2M4KA 4JQFA 3VEPA 3BZCA 3I54A 5HLTA 3HRUA 2PJRB 3L1PA 3WU1B 3GVAA 5HLHA 5DCMB 3CCLI 3RTRA 2PBIA 5F64A 2O8KA 2WY8Q 5E3NA 3HOVJ 3IH2A 3KFWX 4EJWA 4IHYA 1JE8A 3T1BA 1RKWA 1HOMA 1XGSA 2COBA 3CP8A 3CCJI 3ELKA 3DF8A 2HXIA 1EH6A 1UHSA 3IHUA 2F48A 4Z6YA 1JUMA 1G3TA 2VQCA 4B3AA 1GUUA 2GAUA 2WAFA 3CF2A 3J80Z 5BQTA 3GTGJ 3KEQA 1SC7A 4RLFA 2IS1A 1EH8A 1D1CA 3K4CA 1HLVA 1Y8QB 2FUG2 1Z1DA 1K78B 5FKMA 1ZR4A 3M7GA 2VODA 2O0YA 3RKXA 4C2TA 2DA6A 2QYOA 4BHCA 2A07F 1N77A 2F5VA 1V5GA 4GFBA 3P9IA 5CVIA 3AFHA 5ILVA 1EF4A 3OYHA 4OMYA 2XAGA 3AL0B 4QLCU 2I8DA 4LOCA 3HTSB 1T6SA 1R7JA 2NYXA 4OMZA 4R79A 2V4JC 4RB1A 5LD2C 2NVUB 3JAMZ 4HZFA 4HX8A 5ED4A 1J7KA 3LQRA 4P9UA 1Z7LA 1S3JA 1ZHFA 5FKKA 2ZSHB 1T08B 3J81K 2DMTA 3HPGA 1X3UA 3SJMA 2KDOA 1W5CC 1L3LA 2ZC2A 4KYWA 1U6GA 2BHZA 3LWFA 3QOEA 4A3BJ 2M7AA 2VB6A 5IYCJ 1Z05A 4UVBA 1FIAA 5DD8A 4C3JJ 1MMGA 1YITI 4GCVA 5FD5A 3G1OA 2JQ7A 4E7LA 2F4IA 2VC1A 3OYLA 4FISA 1LFPA 2O61A 4KIGA 3WTSC 3NARA 5HS8A 1XGMA 3H1CA 1EA3A 2CQNA 1O4XA 1H88C 1I1GA 2EFWA 4I2OA 5JHUA 1BN5A 2LYCA 3ZQHA 2NRAC 1VQ7I 2TDXA 2KPMA 5AIQA 2R7XA 2VUMJ 2HYJA 2MW8A 2XKOA 2A6HF 3M3YJ 3SEZA 1ZGAA 2ZJPF 1JUSA 3PNTA 2EWNA 5JVGF 3IWZA 2IGKA 4RDUA 3FWEA 1QPIA 4MFEA 5E3MA 2ESHA 3CJNA 2CO5A 1WGXA 2DDAA 2GZWA 3GFJA 5HDGA 5L3CA 2XC7A 4ENMA 3U2RA 1FLIA 1WCMJ 2BYVE 3C2BA 3Q3SA 5HNHA 1QA6A 1KONA 4GYIA 1XG1A 5TJJA 4CCLA 2M45A 5HOOA 4QIWN 2EIKH 2V6CA 1O7LA 1X3WB 3AL0C 3IRQA 3E97A 4RAZA 5DTDA 3V7SA 3R0AA 2IGMA 4KA4A 2X6OA 4U88A 3HUGA 3HOYJ 5K7FA 2W00A 3CLOA 4R8HA 4OAZA 3D5RC 3WG9A 2JA5J 1SD4A 5J47A 3F8MA 2L9SA 3ZQIA 4XLNF 1I39A 3ZXSA 2DPDA 4L9VA 5L3GA 5K7ZA 3OR1C 3KPHA 3ZMZA 3LMMA 3VYUB 4J19A 3REOA 2NVTJ 4HDUA 2CUJA 3BR2A 4Y4RA 2Z9OA 3FXMA 3I0TA 4KIBA 4WK8F 4CCKA 3C2GA 1U5TB 1MJ9A 1NG6A 2VKEA 5EZHA 5D8LB 5J6XA 1D5VA 5DEQA 3HSFA 1S29A 1R4MB 2DODA 2H1KA 4M3BA 4MHGA 4E7IA 3EPZA 1ZRFA 1IXSB 1FSHA 1R5ID 1SD5A 3HUGB 1LEAA 1I6HJ 3U1DA 3CMMA 1K83J 5KK1A 4M3FA 2QVOA 3BG3A 4ON0A 4XKWA 3HL2A 1SFUA 2GOXB 1XGNA 4P1WA 4W97A 3HTUA 1N25A 3GBGA 3VSLA 5DUIA 2CQQA 4MGRA 4S04A 2OA4A 2HTSA 1X19A 5J4YA 4QPQA 1R1VA 5J1UA 1QZYA 2PMHA 1I5ZA 3DBRB 4NDLA 2Q2EB 2BY1A 2O03A 2ETHA 4N4NB 4A3KJ 1WHUA 4X1EA 4D5FA 1BBYA 1XS9A 4ZTFA 4CCJA 1LQ1A 3NEUA 1FOXA 2KIQA 3O2PE 5ICFA 3HJEA 3EUKL 1MDMA 1D0YA 4M6XA 3FIWA 1YJNI 2O9LA 4BEHA 2K86A 2B63J 2V9VA 2X48A 4V2FA 3OOUA 4CDGA 5FD6A 2FEZA 4JYKA 3DPLC 1RR7A 1SVLA 4RAGA 3BLYA 4IL6C 3LA7A 4EV0A 1D1BA 4G94A 5B1AH 1HKSA 4ABZA 2DLLA 5E8GA 4Z2YA 3KETA 4MTEA 4KFCA 1X2MA 2ID6A 4FQGA 1VQKI 3GLLA 3LSHA 2XF6A 3A01B 4E4HA 3DPTA 4AC0A 4L9NA 1I1SA 3FX3A 1FTTA 2ZFWA 1MDMB 1F4KA 4XNFA 1RZ4A 4HV6A 3ZRGA 3K4JA 2WV0A 1KYWA 1BI2A 4KUMA 1TTYA 3MQ0A 5FLVA 1IN6A 3O3KA 2MGQA 5LGTA 2CUEA 2BHYA 2Y0SN 1KU3A 2L3DA 3GTOJ 3E6BA 1CQTA 1P7JA 1JT0A 2CV2A 2OCCH 2D1HA 2WB1N 1GXQA 1B72B 5CLSA 4RMNA 1T95A 2IVMA 2B0LA 4MEXF 2WA0A 2P5VA 4N9IA 5FO5A 4B09A 1WQ2A 4ZC3A 5KNLA 1MMAA 1Z21A 2EZKA 5HNFA 2PG4A 3ERMA 1HW1A 1MH4A 4B4CA 4ZYHA 3ERED 4OAYA 3HXLA 3K0LA 3ZGKA 4O3MA 5FKOA 2VOPA 1FMVA 1Z3XA 2JPCA 1GLNA 3WE3A 3CTAA 2WAEA 1MJBA 1E3PA 1CF7A 1XB4A 2ACJA 2CU7A 5JLWA 4TV7A 2VPLA 3IV5A 1DGWY 4B1RA 2K9MA 2EPFA 4PJJA 2PMZN 4Y13A 3RYPA 1FYLA 4CUGA 2X1CA 4R1HA 2EZIA 2CW7A 1I6XA 2FBKA 3ABMH 5F08A 1D0XA 3MCZA 1F36A 4AYBN 5EDNA 1J9IA 4BHBA 2HQNA 2PMUA 4W1UA 2JSCA 1P7IA 3NRVA 3MD2A 3WTTC 1SD7A 1UG0A 3WU2C 2DFEA 4BUPA 4ZDOA 1B9NA 1WWXA 2VBYA 3R0JA 5CJ9A 2HOTA 1CF7B 5E1ZB 2WAQA 3D5LA 2HPIA 2K3PA 4U7DA 1DP7P 1TQPA 5AIPA 1LDDA 5E17F 3JW4A 3JRIA 5EG0B 1NK2P 2ZNZA 1WFXA 4P9FA 2DJNA 3E5UA 5J3LA 1VQPI 2CV0A 3HDDA 2QEXI 1HSJA 2Y48A 3S15J 3DKYA 4M73A 4NC7A 3W2AA 3FK6A 2YSRA 2P81A 4KJZA 2QBYA 1U9OA 1QVUA 1MKMA 2WV1A 3SDGA 3DEUA 3EUHA 1PP7U 2PX9A 3U9GA 3T8TA 2BY3A 3F23A 3WGGA 2LKSA 2F5CA 4ZYDA 2QKMB 3DU6A 3E6DA 1UCRA 2DU9A 1F5TA 3PFYA 2FA5A 4BE0A 2BZTA 1P2FA 1LFBA 5L3BA 4UUSA 1R9TJ 1I3AA 3OL4A 3SZTA 4IOCF 2DO7A 3FBIB 3LFUA 1ZAOA 3GTJJ 1KGSA 3OSGA 1IRXA 4EGYA 4HYEA 1B4AA 3SZPA 5D8KB 2QBYB 2V6EA 4XONA 1EJ9A 1OYIA 4AUXA 3OOPA 3ABTA 2OCEA 4HOBA 3A4CA 4PJNA 1U78A 4KT5C 5M5WJ 2BY2A 4BQOA 2RN7A 3BZ6A 4MTDA 1DGRM 3LQQA 2RC4A 1FP1D 3RSNA 4B3XA 2AO9A 3HGGA 1FZPB 1MIJA 2ZKZA 1D8KA 3BR6A 1DPRA 1TNSA 2EILH 1G2HA 3H3VK 5FFXA 2R7VA 3K4LA 3J7ZI 1LFUP 2AQEA 3JTHA 3GTQJ 1IV8A 4WCGA 1OR7A 3ZMTA 1SFEA 1OCPA 2DOFA 2FSWA 5AONA 5KVRA 4DBQA 4A3CJ 3SFIA 4CO8A 4XN0A 3G71I 3VPRA 1V5EA 2JMWA 1QPMA 3A0BC 2YX7A 3BOQA 3IAM2 1A6QA 1TT5B 1WH5A 2HR3A 3R4KA 2W48A 4L9TA 2K4BA 3TQNA 3JR9A 3IH4A 3RQIA 1K4SA 4LG3A 1E3OC 1GV2A 4UB8C 1FC3A 1YOVB 1ETQA 2R7TA 2E1NA 2OD5A 2A69F 2HOAA 2MLKA 3F21A 4CYCA 2XPUA 3ZPLA 4MNUA 5HVQC 2R7DA 4CA0A 1XCBA 5FROA 1VQMI 3SYTA 4L0YB 4EM1A 4YFXF 2XB5A 4HG2A 2P6SA 4QSHA 2Z3YA 2M34A 3S3OA 1OISA 2G9WA 1SFOJ 3P9KA 4LLGF 5BPIA 4HW0A 2L54A 2K9QA 2R0QC 3I59B 5B5EC 3CMYA 5JR3A 3FXQA 1YG2A 2K4JA 1WSUA 1U9NA 1WJCA 3CZ6A 4IXAA 2KJBA 2EB7A 2K5CA 2QWWA 2CQ7A 3K1PA 1MSFC 4AVPA 5E8IA 1BW6A 3EUHC 3GTMJ 2XGCA 4XRSA 2HWVA 4G8XA 4FETA 3C7JA 5FB2A 4B47A 4AIKA 2IPQX 4U0WA 2QSGX 2HPMA 2V7FA 4E7SA 1ZG1A 2MBFA 3F9KA 2M87A 1LVKA 1R4NB 3Q9SA 5M5YJ 4XICA 2QF7A 3ZMDA 1LDJA 4M6YA 3DXJF 2KJCA 4A3GJ 2Y0MA 1IN5A 1MNDA 2LF7A 1FX7A 2VJ5A 3DLAA 3GF2A 5JVTA 3H5RA 2UXXA 4NQWB 4IHXA 3D1NI 1YI2I 1VQLI 3WU0A 1LUJB 1XN7A 2M5WA 2VKDA 4FT8A 5LFAA 4ZTJA 4AD9A 2HOEA 4IHSA 1RNLA 5C44J 1FOKA 1B9MA 3ISPA 3OWTA 2VQLA 1E0EA 3DTIA 3OIPA 2F4OB 5D5WB 1AOYA 2KIUA 1Y8RB 2RVCA 2R3SA 2EA4A 3OYKA 1D1AA 2OUMA 3BJAA 2KP6A 3CDLA 3DTKA 2LY1A 4HDVA 1YRNB 2FJ1A 4LB5A 3OL3A 2WBMA 4ESJA 2DPUA 1KU9A 3V8JA 4II3A 2EIJH 2XROA 3AG4H 2LVSA 1ZRDA 3I55I 3S1MJ 1IDZA 1DQUA 1XSXA 2KISA 1JKPC 5A2QZ 2R7RA 3S1QJ 1OR7C 4I02A 2FF4A 5IOYA 1HKTA 3F0CA 5L3FA 3LNQA 4RAYA 3OS0A 1LE8A 3S8PA 1JJ8C 2N8GA 2HYFA 4XN3A 5GAHJ 1TBXA 1QRYA 1WPKA 1Z77A 1MGTA 4XOPA 3JCUC 9ANTA 2EV0A 4IZZA 3BY6A 4LD5A 1IN4A 2JSPA 1XX5A 4HSRA 3ZCOA 5IP9J 4F91B 3M1EA 4IHVA 3M4OJ 3ECOA 2L9NA 5EEHA 2A5YB 1TQIA 2BY0A 2VJJA 2YU3A 5KAIC 4CCMA 1YJ9I 2CGPA 3KCCA 1ERDA 2E35A 3JSPA 2IS2A 2OZUA 3CESA 2L7KA 4PDKA 4HNUA 1X1PA 1I3QJ 3CDHA 2K3FA 5K5RA 1VQNI 1FSEA 4D9JA 3JRGA 2X51A 4KIFA 1LE8B 5FLXK 1HW5A 3TP3A 3CDIA 3I4PA 1VQ8I 2IAIA 3ABKH 2BE5F 3C18A 1SAXA 3J81Z 1W36D 2MG4A 1JGGA 4V19K 4DW6A 1VQ4I 1B1BA 3EQLF 4C30A 2HZTA 1ETVA 3QU3A 4XSXF 1R1TA 5LEKA 2NXNB 2E2JJ 2KZVA 2H8RA 4II2A 3OYGA 3PQJA 4XM3A 1FTZA 1RETA 2Y0SA 5D5XB 3PSFA 3RPUD 2ME6A 4Y3OA 2WB1A 3HKZN 4BBSJ 2ZBKA 1YIJI 3JRFA 2NOGA 3BG6A 4C3IJ 1V54H 3KEYA 3S16J 4A93J 1FIPA 2FNAA 4IRHA 1O3TA 1T38A 3HSRA 5IY5H 4K2EA 5L3EA 4H0EA 2FOKA 1ZELA 1JHHA 2LC2A 3JRCA 3CC7I 4CCNA 2RDPA 2M2EA 3EYYA 1BR1A 3UR3C 2LRDA 4A5MA 1YFHA 2WADA 1FJLA 2QZ8A 2HDWA 1N78A 2HEOA 2HQ5A 2EH3A 4A6EA 1LPQA 4IJAA 3CJTB 3WE2A 4XLFA 3K2ZA 2WC2A 4O5VA 1IAWA 5ILUA 3MZHA 2XB0X 3BR5A 3GFLA 5FGMA 3ZQGA 3S1NJ 2PMZA 2L02A 1D0ZA 3EUAA 1MBGA 1XSDA 4F92B 3K6GA 4CZZA 4MO7A 1IN7A 1JHFA 3OYFA 4AYBA 2YS9A 5GAEJ 4HAMA 4M9ZA 1PUFA 5D4RA 2LF8A 3PFIA 2PI0A 3TKYA 4L18B 2LR8A 3A02A 3UNGC 5F1RA 4LJZF 4RGRA 1YW8A 1FWZA 1JT6A 3GMEA 4BU2A 3IUOA 2EBIA 6PAXA 2NOJB 4G7HF 4UUVA 1QZZA 4WXCA 4A12A 1ZREA 4FE4A 3S2DJ 2ECBA 5K7HA 4NC8A 5BOXA 3F3XA 4OWRB 3AG1H 4D1QA 1SFKA 2CWEA 2L2OA 4DNCA 3QP5A 3I5UA 4BL0B 1ZR2A 3H0GJ 4PGGA 4XRMA 4CHUA 2KLOA 2MLGA 1JJ6C 3ZQ7A 1ETYA 5DM7F 2W7NA 2Q1ZB 5C3EJ 4HQEA 4ENKA 2CJJA 2J5OA 2LKXA 2R7ZJ 1MNEA 3NAUA 5M5XJ 4A3EJ 1V55H 1AHDP 2E36A 1V5FA 4L0ZB 1ETWA 1P6RA 2IP2A 2JZYA 2ZO4A 1ZTRA 2BV6A 3AG3H 2JUCA 1J0RA 1FBUA 3FISA 3NWTA 1G3YA 4HSTA 2JN6A 2M0MA 3W2WA 2IS4A 3DBLB 2R7UA 5IOZA 2DFIA 2VN2A 2IT0A 2OTLI 1XCVA 2NAZA 2VKVA 2LBFA 3HOXJ 1X1CA 1O3QA 1SANA 3FF5A 3PM1A 2L4AA 2XAUA 4UV8A 1W5TA 2H6BA 2LMDA 3BDDA 2EV5A 2XVCA 1S8NA 1FYKA 1R6RA 2LKPA 3C1DA 3N05A 5CVVA 5H6QA 2XASA 1K61A 3K4BA 4CZCA 3QPTA 2Y69H 2CH0A 2Y31A 1TQMA 1R1UA 3H35A 1NK3P 2EV6A 1VTNC 4A3FJ 2YX4A 3JRDA 1YTYA 1XDUA 5BNGA 2IS6A 3MEXA 4BJTA 1ULYA 1X4PA 3KEOA 3RI4A 3TMOA 2R92J 3IKTA 1XMKA 2F5EA 2RQQA 1MBJA 3R61A 2KRCA 2OPTA 1N75A 2VPRA 2CW0F 3HHGA 2JPBA 4A69C 1X3ZB 1AKHA 2E1MB 2LBFB 5J40A 2OV7A 2M30A 2JJ7A 2XAQA 3HSEA 3K9TA 2DMQA 2ELKA 3W3CA 2OC6A 4HF0A 2K85A 3DEEA 2CQKA 3MKWB 4IHTA 1WZ2A 3BQZA 4XK4A 1RRJA 3WHBA 4RA2A 1ZGJA 1WJ5A 2EA2A 3BR0A 2PJPA 1IGNA 3E7LA 2RGVA 3BPVA 1UMQA 4BGDA 2VBXA 4KDPA 3TOAA 5C4XJ 3E0JB 4YEJA 2VOOA 1JTXA 2VKHA 3BR1A 1SMYF 3BG9A 1SVMA 3DBHB 3I4NJ 3BWGA 1IW7F 2P5KA 3DU5A 4BXFA 1HDDC 1DU6A 3PO2J 4PSWA 4AM3A 3J7AY 4RLQA 4OIQF 3ABUA 1ZG5A 3Q5FA 3GX4X 3MKYB 2VJIA 1OQYA 4KISA 4BXUA 2DTRA 3QOPA 3FDYA 3UKGA 2DAOA 3DLLF 1GT0C 4IX7A 1XC5A 2DYSH 3FKIJ 3HRMA 4M6VA 2HDDA 3T8RA 4U0YA 3PNVA 2KIMA 1AU7A 2HKXA 3WTWC 1WI3A 3JSOA 1TW3A 4U7BA 3KP7A 4BE1A 3BTJA 2G0EA 1H0MA 1X1AA 3QPLA 5EF6A 1FPQA 1OMIA 3GWZA 1V3FA 1P4AA 1BOAA 3FXKA 4ANJA 4ZZLA 2TCTA 3M8FA 2R7FA 4HX7A 5HDKA 3F8CA 2MD0A 2XAFA 2NNYA 1T8IA 4XSZF 4ZYEA 4A2UA 4FX4A 2E1MC 1D3YA 4MLOA 4NBQA 3FHNA 4BEHB 3LSPA 4LLLA 1ZYRF 3K69A 3M8EA 3DWLE 3ZMVA 4HV5A 1HBXG 2VT2A 4F3QA 2UV1A 2GA1A 2JA8J 5LGUA 2LTPA 4RAFA 3LSIA 2R7WA 3IWFA 2OTJI 5DYMA 3K7AJ 1BI0A 3U21A 2TRTA 4N4OB 2LFBA 5GADJ 3QPSA 1JKQC 4GGGA 2M0CA 1I27A 3HIFA 3L7WA 3HGYA 3KLNA 1P4XA 2XGXA 2K7LA 5IP6A 3CCVI 2ZJ2A 3OYJA 1PJRA 1ETOA 2EQRA 2R5ZA 2V1UA 2M9HA 4CSWA 3BC8A 5HLGA 2HGCA 4UV9A 1O7FA 2NS8A 4MQVA 2CG4A 4RB3C 3A1YA 4NUBA 2G7UA 5CQGA 3G2BA 2I5UA 3HOZJ 4EQQA 4ENNA 2YPRA 4DOZA 4M3GA 1BI1A 4AIDA 3K4MA 1FOWA 1W7PA 2W82A 4HA8A 2MC4A 2F5FA 4CICA 4HNTA 5LHIA 1U8BA 1GXPA 3MN2A 5GPCA 3CCQI 1U8RA 1RPWA 3CCEI 4XBFA 1TC3C 4Y17A 3A2KA 5JHFA 4LITA 4UY8I 1IDYA 1X1DA 3LA3A 2OU2A 5DV5A 2R5ZB 1KQ9A 2RV8A 4F55A 1JKOC 3CCYA 4KMUX 2LD5A 2EZLA 2DA2A 3HC7A 2HXOA 2CUFA 2EINH 3OMYA 1W1WE 2XUBA 4AVZA 1MW7A 2FBIA 1BC8C 5DS9A 2H8WA 3ZR8X 2K02A 4YFKF 2IRFG 4AU7A 1IUFA 4P5OA 5IYDJ 3A03A 3CLQA 4Q4ZF 5HODA 4C2UA 3HKZA 2Z99A 3S3NA 4G7OF 3I64A 1U2WA 3BJOA 3Q9VA 3V8KA 1GDTA 3BT9A 5E1WA 1Z6RA 3ECHA 1HF0A 3E5QA 4FTHA 1PUEE 5CKTA 3G1MA 5BPDA 2P7VB 1BOBA 5FKNA 5BMZA 4A3IJ 3N97A 5B3SH 4EJUA 5J8FA 1IXCA 4A3LJ 1IRZA 1OCCH 1TLHB 3GEZA 2R7SA 4V2GA 2DA1A 3WG7H 4PSXA 4CXFA 3EDPA 3JTGA 4UVAA 4LMYA 3VYRB 3F8FA 1HSTA 3E5XA 3F8BA 3MMYB 4UXNA 4ESBA 2M8GX 5IT9K 3F22A 5ICCA 3H0DA 2NVXJ 2QQ9A 3CMAI 4WF2A 4BY1J 2VJ4A 3ZN0A 2Z2SB 3DP7A 1J5YA 1RKTA 1YE9A 1TWHJ 4XLCA 1I50J 1GVJA 1ZARA 3IKVA 3ROUA 2O6GE 1E2XA 3FXUA 2M7BA 4IRIA 1OCTC 2R4GA 2BXZA 2ZXJA 3C3WA 1MMSA
chains in the Genus database with same CATH topology
3RKWA 2H6CA 2O8XA 3ULQB 3LAPA 1OYYA 3WGIA 1HQCA 1ZN2A 3WTZA 3R60A 5LBQA 1YS7A 3HOTA 2HKOA 2ZNYA 1H9TA 1TW2A 4PGHA 3L09A 3G3ZA 4P96A 1XD7A 1R00A 4L5IA 2FNPA 1LEBA 2M8EA 2W85A 3TO7A 1WI9A 4EGZA 3RPQA 1BM9A 2PQ8A 4MQ9F 3WTYC 4RGXA 3FMRA 3GLXA 1T2KA 2IA2A 1IRFA 3V7CA 2LDUA 3DV8A 4OU0A 3B73A 4DQ2A 5FLXZ 1Z91A 1OKRA 4JBAA 4PCQA 2W57A 4AIJA 4LK0F 5K5QA 3QRFF 4NHJA 1R22A 4A6DA 4QWQA 2DT5A 4EJVA 1UHMA 5E20A 1Z9CA 2MD5A 3FM5A 2DK5A 4I01A 1HXDA 2W25A 1R36A 2RNJA 2RKHA 3MZYA 3L2CA 1ON2A 5D6EA 2ISYA 1R5HA 3G73A 1ZLJA 1LJ9A 4OOIA 1UHWA 1Z6TA 4ASNA 4GYGA 1IN8A 1SFXA 3E3VA 3K1NA 2QM3A 4LG0A 3E6MA 3KP4A 3ZP5A 1W4MA 3GZ6A 3KZYA 2AXLA 1HW2A 2P6TA 3TDUC 4OINF 4ZZDA 3CUQA 2Z5UA 1YW9A 1J59A 5E1XA 2VT3A 1JGSA 2JTVA 1MJAA 5CYVA 4LG0B 1K79A 5FFZA 2MA3A 1HKQA 3FMQA 1RI7A 3KE2A 1REPC 2DQRA 1O3SA 1BC7C 2A68F 3CUQB 4KMFA 4L9JA 2QENA 1P92A 4KICA 1YO5C 4RGSA 4BHPA 2A6EF 3F6OA 4BYYA 3OV8A 3BPXA 3ZMSA 3E6CC 1C0WA 5F6FA 4EVIA 1USSA 2FMYA 3W6KB 2Y75A 3WTVC 2E7XA 2AS5F 2CFXA 2X4HA 4HF2A 3HRSA 3T0YA 2WTEA 2VBZA 2XV4S 1K7AA 2GWRA 2UXNA 5LGNA 1OYWA 1KYZA 4G6QA 4YIIA 4RGUA 1IRGA 1K78A 4MEYF 2D45A 5D5UB 3B02A 3F72A 5DCFA 3R6SA 5ICGA 3COAC 2IA1A 1G3WA 5HDNA 4U0VA 5A2QK 1T39A 4OIOF 3TGNA 2DW4A 4Y15A 4XLPF 1ONVA 1BIBA 4IF4A 3CUQC 2CSOA 1Z7UA 3O6BB 5ILSA 4A0YA 2J5PA 3LAJA 4I7HA 2XAHA 4HLXA 5JI6A 3GUDA 4S05A 2GQQA 4Q5SF 2HFHA 3GFMA 1LVAA 2YR2A 1DDNA 1KQ8A 1ZLKA 3SHFA 4BH9A 1ZRCA 2A3SA 3F8NA 2FRHA 2KRFA 2V1DA 2PLYA 2A61A 4IVNA 4G9YA 1R58A 2MH9A 4LGWA 5TRDA 5D5VB 3VFZA 3V8LA 2UWMA 4A5NA 4WX9A 4ZYGA 2MH2A 1KQ0A 1JXSA 2ESNA 2DK8A 3FHZA 4YFNF 2D1VA 3FZVA 1WKMA 2BGCA 4M9SA 1ODDA 3WODF 4A0XA 3P7NA 1GHCA 2EFOA 2ZMEA 3KLOA 1EH7A 4XRFA 3MAJA 1J75A 1YQAA 1DUXC 4G7ZF 4EM0B 1KU2A 4N0BA 2L01A 1XDSA 4L5JA 5H20A 3RPUA 2STTA 3CUOA 3J80K 1U5TA 2MC3A 2ZMEB 3W6JB 3FMSA 1LNWA 3NQOA 4O6JA 1SMTA 1W7PD 1FBQA 2DBBA 5EEGA 2XAJA 1QGPA 4WXHA 3LSTA 4P55A 5HS7A 3K1MA 1QQIA 5J8CA 2WWYA 3JAMK 3GO5A 1QNTA 4CGZA 3HYIA 2Q2EA 5ICEA 3QP6A 4I0BA 2W84A 1FBSA 1EV7A 1XSVA 2KKOA 4HX4A 1IF1A 3WGHA 4KN7X 3HHHA 1XGOA 2DQLA 5D4SA 2PN6A 1FP2A 1B59A 4EM2A 1J2XA 1WRJA 2M1BA 5DUKA 3TO6A 1FYMA 2OQGA 3IRRA 5DDGA 4UVCA 3F6VA 1BI3A 3EETA 3HRTA 3GFIA 4YIFA 2GIVA 3CO7C 1RIOH 2STWA 3BROA 2OBPA 1LB2A 1OPCA 3KP3A 1TNTA 2XKPA 2VE9A 2P4WA 4LB6B 2FQ3A 2ELHA 2GXBA 1Y0UA 3V7RA 1FT9A 3SQNA 3QAHA 2EFQA 1UFMA 5IT9Z 5HLIA 1QBJA 2ISZA 5JFRA 1U5TC 3KP6A 2VONA 1CGPA 2QLZA 2HYGD 3H3ZA 3M9AA 4FHTA 3GW2A 1AWCA 3LA2A 2EFNA 2OQRA 1MZBA 2Q8KA 2UZKA 4I09A 2BBYA 3V4GA 4G6DA 2V1XA 3MWMA 2RQPA 3I58A 5CVUA 2HDCA 2EK5A 3IC7A 2NNNA 3SFZA 1P4WA 4Q47A 1MD0A 3TOBA 1DPUA 1UB9A 2G7HA 5K5OA 4WWCA 1SD6A 4HF1A 1F9NA 1NHAA 3RDIA 4M71A 1IZ1A 5IT3A 4UNOA 2C6YA 4AIHA 3HOSA 4BNCA 4EJTA 2FU4A 4M72A 1Q1HA 1W7PB 4M9XA 1KU7A 5H6RA 4KN4X 4OIRF 2OZ6A 1K6OA 1YS6A 1FNNA 3N4MA 3J7AO 3I53A 3P9CA 5CVJA 2FMLA 3S2WA 2P5LC 2IJLA 4EJOA 1PDNC 4BQAA 1R23A 2DI3A 4GO1A 2OAZA 5D6FA 1RUOA 3KP2A 4F7ZA 2ZCWA 5LHHA 4NB5A 1PP8F 5LRSA 3CO6C 2XIGA 2P7CB 4RB0A 2Q0OA 2XHKA 3BP8A 5BS6A 1G6NA 3T5XA 1L0OC 2HTJA 1T98A 4HQMA 3L00A 3KP5A 3D0SA 4LFUA 3H3UA 4N9HA 2PFBA 5LEJA 3IL2A 4BAYA 1IUYA 4GXOA 5K1YA 3RIRA 4CYDA 2QQAA 2JRTA 2D2WA 1IXRC 4LK1F 1T0FA 3QPHA 1ZG3A 1W5SA 4UHTA 1KA8A 3FXRA 2H27A 3WTUC 2HQRA 3ZN1A 3GYHX 3SXYA 1A04A 4Q48A 4KNYA 3I59A 3MFKA 2ADUA 2FXAA 2VE8A 5CVRA 3H92A 4E70A 2X0LA 5L3DA 2QQBA 2W24A 2NS0A 1S7AA 1D8JA 2LSOA 2IA0A 1QO0D 2HS5A 3WTXC 1E17A 3RYRA 4FX0A 3I71A 4JK1X 4HLYA 4NQWA 2GA2A 3ML6A 4A0ZA 1YIOA 3L9FA 2EFPA 2EJRA 4RB2C 1U3EM 3AAFA 1V4RA 2PEXA 1S7OA 3GXOA 2VC0A 1B6AA 4IRGA 1G3SA 3VODA 1BJAA 2K27A 4YG2F 3DKWA 2GXGA 2P8TA 2Z33A 4OIPF 5DD4A 2QUFA 4B8XA 4D0PA 2F2EA 2H09A 4LLNA 1F1ZA 4I0AA 2O3FA 2XRNA 3EYIA 2LNBA 3GZ5A 5ERIA 5LHGA 4ETSA 3ZMUA 1FY7A 1G4DA 2E1CA 1LDKB 5LRRA 2JT1A 1O3RA 3VB2A 4ZH4F 3DQVC 1RUNA 1YW7A 1YYVA 1R5GA 2KIFA 5HS9A 1ON1A 1XMAA 2L4MA 4RS8A 3KZZA 3VOEA 2V79A 3TO9A 3RKYA 1O57A 4WXDA 4ENJA 3BJ6A 3RJPA 4I98B 4ESFA 3LFKA 3QU6A 2COMA 1S6LA 4EMSA 4PZJA 1YLFA 2H94A 1ZH5A 2CYYA 2VXZA 3DFGA 5DCMA 2VBWA 1STZA 2IW5A 1USTA 5E18F 4AWXB 5LLQA 1H9GA 2FE3A 2FBHA 4HBLA 1BIAA 2E7WA 4M74A 3TDZC 2F5DA 4IPAA 3FM3A 2BEOA 4JQFA 3VEPA 3I54A 3HRUA 3WU1B 3GVAA 5HLHA 5DCMB 3RTRA 2PBIA 5F64A 3KFWX 4EJWA 1JE8A 3T1BA 1XGSA 3ELKA 3DF8A 1EH6A 3IHUA 1G3TA 2GAUA 3J80Z 5BQTA 3KEQA 1EH8A 1Z1DA 1K78B 2VODA 3M7GA 2O0YA 3RKXA 2QYOA 4BHCA 2A07F 3P9IA 5CVIA 5ILVA 4OMYA 2XAGA 4QLCU 3HTSB 1T6SA 1R7JA 2NYXA 4OMZA 4R79A 4RB1A 3JAMZ 4HZFA 4HX8A 5ED4A 1J7KA 3LQRA 4P9UA 1S3JA 1ZHFA 3J81K 1X3UA 1L3LA 4KYWA 1U6GA 3LWFA 1Z05A 4UVBA 5DD8A 4GCVA 5FD5A 2VC1A 2O61A 4KIGA 3WTSC 5HS8A 1XGMA 1I1GA 2EFWA 4I2OA 5JHUA 1BN5A 2NRAC 2TDXA 5AIQA 2XKOA 2A6HF 1ZGAA 2EWNA 3IWZA 3FWEA 2ESHA 3CJNA 2CO5A 3GFJA 2GZWA 5HDGA 5L3CA 4ENMA 3U2RA 1FLIA 2BYVE 4GYIA 5TJJA 5HOOA 2M45A 2V6CA 1O7LA 3IRQA 3E97A 4RAZA 3V7SA 3R0AA 4KA4A 4U88A 3HUGA 4R8HA 3CLOA 3WG9A 1SD4A 3F8MA 4XLNF 2DPDA 4L9VA 5L3GA 3ZMZA 3REOA 4HDUA 2Z9OA 3I0TA 4KIBA 4WK8F 1U5TB 1MJ9A 5D8LB 5J6XA 1D5VA 5DEQA 3HSFA 1S29A 1ZRFA 4MHGA 1IXSB 1FSHA 1SD5A 1LEAA 3U1DA 5KK1A 2QVOA 4ON0A 1SFUA 1XGNA 3HTUA 5DUIA 4MGRA 4S04A 2OA4A 2HTSA 1R1VA 1QZYA 2PMHA 1I5ZA 2O03A 2ETHA 1BBYA 1LQ1A 3NEUA 5ICFA 3O2PE 1MDMA 4M6XA 2K86A 2V9VA 5FD6A 4CDGA 2FEZA 3DPLC 3LA7A 4EV0A 4G94A 1HKSA 2DLLA 5E8GA 4Z2YA 3KETA 4MTEA 4KFCA 3DPTA 4L9NA 1I1SA 3FX3A 2ZFWA 1MDMB 1F4KA 1RZ4A 4HV6A 2WV0A 1KYWA 1BI2A 4KUMA 1TTYA 3MQ0A 1IN6A 3O3KA 5LGTA 1KU3A 2L3DA 3E6BA 2D1HA 1GXQA 5CLSA 2IVMA 2B0LA 4MEXF 2P5VA 4N9IA 5FO5A 4B09A 1WQ2A 2PG4A 1HW1A 4ZYHA 3ERED 3K0LA 4O3MA 2VOPA 2JPCA 3WE3A 3CTAA 1MJBA 1CF7A 1XB4A 2ACJA 4TV7A 4Y13A 3RYPA 1FYLA 4R1HA 1I6XA 2FBKA 3MCZA 1J9IA 4BHBA 2HQNA 2PMUA 2JSCA 3NRVA 3WTTC 1SD7A 1B9NA 1WWXA 2VBYA 3R0JA 5CJ9A 1CF7B 5E1ZB 3D5LA 4U7DA 1DP7P 1TQPA 5AIPA 1LDDA 5E17F 3JW4A 2ZNZA 4P9FA 3E5UA 1HSJA 2Y48A 4M73A 2YSRA 2QBYA 1MKMA 3DEUA 3EUHA 1PP7U 3U9GA 3T8TA 3F23A 3WGGA 2F5CA 4ZYDA 3E6DA 1UCRA 2DU9A 1F5TA 2FA5A 1P2FA 5L3BA 3SZTA 2DO7A 1ZAOA 1KGSA 4EGYA 4HYEA 1B4AA 3SZPA 5D8KB 2QBYB 1OYIA 3OOPA 3ABTA 4HOBA 1U78A 4KT5C 2RN7A 3BZ6A 4MTDA 3LQQA 2RC4A 1FP1D 1FZPB 2ZKZA 1D8KA 1DPRA 1TNSA 5FFXA 3JTHA 4WCGA 1OR7A 3ZMTA 1SFEA 2FSWA 5AONA 5KVRA 4CO8A 1QPMA 2YX7A 3BOQA 2HR3A 3R4KA 4L9TA 2K4BA 3TQNA 1FC3A 2E1NA 2OD5A 2A69F 2MLKA 3F21A 3ZPLA 4MNUA 5HVQC 2R7DA 1XCBA 4L0YB 4EM1A 4YFXF 2P6SA 2Z3YA 2G9WA 3P9KA 4LLGF 5BPIA 4HW0A 2L54A 3I59B 5JR3A 3FXQA 1YG2A 2K4JA 1WSUA 4IXAA 2KJBA 2EB7A 2QWWA 3K1PA 4AVPA 5E8IA 2HWVA 4G8XA 5FB2A 3C7JA 4AIKA 2IPQX 4U0WA 1ZG1A 2MBFA 2M87A 3Q9SA 3ZMDA 1LDJA 4M6YA 3DXJF 2KJCA 2Y0MA 1IN5A 2LF7A 1FX7A 3GF2A 5JVTA 2UXXA 3WU0A 1XN7A 2M5WA 4FT8A 4AD9A 2HOEA 4IHSA 1RNLA 1FOKA 1B9MA 3ISPA 5D5WB 1AOYA 2KIUA 2RVCA 2R3SA 2EA4A 3BJAA 4HDVA 4LB5A 4ESJA 2DPUA 1KU9A 3V8JA 2XROA 1ZRDA 3C3WA 1XSXA 5A2QZ 4I02A 2FF4A 1HKTA 5L3FA 4RAYA 2HYFA 1TBXA 1MGTA 2EV0A 3BY6A 4LD5A 1IN4A 3M1EA 3ECOA 5EEHA 2A5YB 1TQIA 2YU3A 2CGPA 3KCCA 3JSPA 2OZUA 4PDKA 3CDHA 5K5RA 1FSEA 4KIFA 5FLXK 1HW5A 3I4PA 2BE5F 3C18A 1SAXA 3J81Z 1B1BA 3EQLF 2HZTA 3QU3A 4XSXF 1R1TA 5LEKA 3PQJA 5D5XB 2ZBKA 2FNAA 4IRHA 1O3TA 1T38A 3HSRA 4K2EA 5L3EA 4H0EA 2FOKA 1JHHA 2RDPA 3EYYA 4A5MA 1YFHA 2QZ8A 2HEOA 4A6EA 4IJAA 3WE2A 1IAWA 3K2ZA 2WC2A 4O5VA 5ILUA 3MZHA 3GFLA 5FGMA 2L02A 1XSDA 4CZZA 1IN7A 1JHFA 4HAMA 4M9ZA 5D4RA 2LF8A 3PFIA 2PI0A 3TKYA 4L18B 5F1RA 4LJZF 4RGRA 1YW8A 1FWZA 6PAXA 4G7HF 4UUVA 1QZZA 4WXCA 4A12A 1ZREA 5BOXA 3F3XA 2CWEA 4DNCA 3QP5A 3I5UA 4PGGA 4CHUA 2MLGA 3ZQ7A 4HQEA 4ENKA 2J5OA 4L0ZB 2IP2A 1P6RA 2JZYA 2ZO4A 2BV6A 1J0RA 1FBUA 1G3YA 2DFIA 2VN2A 2IT0A 1XCVA 2NAZA 1O3QA 3FF5A 2L4AA 4UV8A 1W5TA 2H6BA 3BDDA 2EV5A 2XVCA 1S8NA 1FYKA 2LKPA 3C1DA 5CVVA 5H6QA 2XASA 3QPTA 1TQMA 1R1UA 2EV6A 1VTNC 2YX4A 1YTYA 1XDUA 3MEXA 1ULYA 3KEOA 3RI4A 3IKTA 1XMKA 2F5EA 3R61A 2CW0F 3HHGA 2JPBA 2M30A 2XAQA 3HSEA 3K9TA 4HF0A 2CQKA 4IHTA 1ZGJA 2EA2A 2PJPA 2RGVA 3BPVA 2VBXA 4KDPA 3TOAA 2VOOA 1SMYF 3BWGA 1IW7F 2P5KA 4OIQF 3ABUA 1ZG5A 3Q5FA 3GX4X 4BXUA 2DTRA 3QOPA 2DAOA 3HRMA 3T8RA 4U0YA 2KIMA 2HKXA 3WTWC 3JSOA 1TW3A 4U7BA 3KP7A 1H0MA 1FPQA 1OMIA 3GWZA 1V3FA 1P4AA 1BOAA 4ZZLA 3M8FA 2R7FA 4HX7A 5HDKA 3F8CA 2XAFA 2NNYA 4XSZF 4ZYEA 4A2UA 4FX4A 1D3YA 4LLLA 1ZYRF 3K69A 3M8EA 3ZMVA 4HV5A 1HBXG 2VT2A 2GA1A 5LGUA 3IWFA 5DYMA 1BI0A 4GGGA 1I27A 3HIFA 3L7WA 3KLNA 1P4XA 2XGXA 2K7LA 2ZJ2A 2V1UA 5HLGA 2HGCA 4UV9A 1O7FA 4MQVA 2CG4A 4RB3C 2G7UA 4EQQA 4ENNA 2YPRA 1BI1A 1W7PA 1GXPA 4HA8A 2F5FA 4CICA 5LHIA 1U8RA 4XBFA 4Y17A 3LA3A 2OU2A 5DV5A 1KQ9A 2RV8A 4KMUX 2XUBA 2FBIA 1BC8C 2K02A 4YFKF 2IRFG 4P5OA 4Q4ZF 2Z99A 4G7OF 3I64A 1U2WA 3BJOA 3Q9VA 3V8KA 5E1WA 1Z6RA 3ECHA 3E5QA 1PUEE 5BPDA 2P7VB 5BMZA 3N97A 4EJUA 5J8FA 1IXCA 1TLHB 3GEZA 4CXFA 3EDPA 3JTGA 4UVAA 4LMYA 3F8FA 1HSTA 3E5XA 3F8BA 4UXNA 4ESBA 5IT9K 3F22A 5ICCA 2QQ9A 4WF2A 3ZN0A 3DP7A 1J5YA 1GVJA 1ZARA 3IKVA 3ROUA 2O6GE 1E2XA 3FXUA 4IRIA 2ZXJA 3PQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKW A;  2H6C A;  2O8X A;  3ULQ B;  3LAP A;  1OYY A;  3WGI A;  1HQC A;  1ZN2 A;  3WTZ A;  3R60 A;  5LBQ A;  1YS7 A;  3HOT A;  2HKO A;  2ZNY A;  1H9T A;  1TW2 A;  4PGH A;  3L09 A;  3G3Z A;  4P96 A;  1XD7 A;  1R00 A;  4L5I A;  2FNP A;  1LEB A;  2M8E A;  2W85 A;  3TO7 A;  1WI9 A;  4EGZ A;  3RPQ A;  1BM9 A;  2PQ8 A;  4MQ9 F;  3WTY C;  4RGX A;  3FMR A;  3GLX A;  1T2K A;  2IA2 A;  1IRF A;  3V7C A;  2LDU A;  3DV8 A;  4OU0 A;  3B73 A;  4DQ2 A;  5FLX Z;  1Z91 A;  1OKR A;  4JBA A;  4PCQ A;  2W57 A;  4AIJ A;  4LK0 F;  5K5Q A;  3QRF F;  4NHJ A;  1R22 A;  4A6D A;  4QWQ A;  2DT5 A;  4EJV A;  1UHM A;  5E20 A;  1Z9C A;  2MD5 A;  3FM5 A;  2DK5 A;  4I01 A;  1HXD A;  2W25 A;  1R36 A;  2RNJ A;  2RKH A;  3MZY A;  3L2C A;  1ON2 A;  5D6E A;  2ISY A;  1R5H A;  3G73 A;  1ZLJ A;  1LJ9 A;  4OOI A;  1UHW A;  1Z6T A;  4ASN A;  4GYG A;  1IN8 A;  1SFX A;  3E3V A;  3K1N A;  2QM3 A;  4LG0 A;  3E6M A;  3KP4 A;  3ZP5 A;  1W4M A;  3GZ6 A;  3KZY A;  2AXL A;  1HW2 A;  2P6T A;  3TDU C;  4OIN F;  4ZZD A;  3CUQ A;  2Z5U A;  1YW9 A;  1J59 A;  5E1X A;  2VT3 A;  1JGS A;  2JTV A;  1MJA A;  5CYV A;  4LG0 B;  1K79 A;  5FFZ A;  2MA3 A;  1HKQ A;  3FMQ A;  1RI7 A;  3KE2 A;  1REP C;  2DQR A;  1O3S A;  1BC7 C;  2A68 F;  3CUQ B;  4KMF A;  4L9J A;  2QEN A;  1P92 A;  4KIC A;  1YO5 C;  4RGS A;  4BHP A;  2A6E F;  3F6O A;  4BYY A;  3OV8 A;  3BPX A;  3ZMS A;  3E6C C;  1C0W A;  5F6F A;  4EVI A;  1USS A;  2FMY A;  3W6K B;  2Y75 A;  3WTV C;  2E7X A;  2AS5 F;  2CFX A;  2X4H A;  4HF2 A;  3HRS A;  3T0Y A;  2WTE A;  2VBZ A;  2XV4 S;  1K7A A;  2GWR A;  2UXN A;  5LGN A;  1OYW A;  1KYZ A;  4G6Q A;  4YII A;  4RGU A;  1IRG A;  1K78 A;  4MEY F;  2D45 A;  5D5U B;  3B02 A;  3F72 A;  5DCF A;  3R6S A;  5ICG A;  3COA C;  2IA1 A;  1G3W A;  5HDN A;  4U0V A;  5A2Q K;  1T39 A;  4OIO F;  3TGN A;  2DW4 A;  4Y15 A;  4XLP F;  1ONV A;  1BIB A;  4IF4 A;  3CUQ C;  2CSO A;  1Z7U A;  3O6B B;  5ILS A;  4A0Y A;  2J5P A;  3LAJ A;  4I7H A;  2XAH A;  4HLX A;  5JI6 A;  3GUD A;  4S05 A;  2GQQ A;  4Q5S F;  2HFH A;  3GFM A;  1LVA A;  2YR2 A;  1DDN A;  1KQ8 A;  1ZLK A;  3SHF A;  4BH9 A;  1ZRC A;  2A3S A;  3F8N A;  2FRH A;  2KRF A;  2V1D A;  2PLY A;  2A61 A;  4IVN A;  4G9Y A;  1R58 A;  2MH9 A;  4LGW A;  5TRD A;  5D5V B;  3VFZ A;  3V8L A;  2UWM A;  4A5N A;  4WX9 A;  4ZYG A;  2MH2 A;  1KQ0 A;  1JXS A;  2ESN A;  2DK8 A;  3FHZ A;  4YFN F;  2D1V A;  3FZV A;  1WKM A;  2BGC A;  4M9S A;  1ODD A;  3WOD F;  4A0X A;  3P7N A;  1GHC A;  2EFO A;  2ZME A;  3KLO A;  1EH7 A;  4XRF A;  3MAJ A;  1J75 A;  1YQA A;  1DUX C;  4G7Z F;  4EM0 B;  1KU2 A;  4N0B A;  2L01 A;  1XDS A;  4L5J A;  5H20 A;  3RPU A;  2STT A;  3CUO A;  3J80 K;  1U5T A;  2MC3 A;  2ZME B;  3W6J B;  3FMS A;  1LNW A;  3NQO A;  4O6J A;  1SMT A;  1W7P D;  1FBQ A;  2DBB A;  5EEG A;  2XAJ A;  1QGP A;  4WXH A;  3LST A;  4P55 A;  5HS7 A;  3K1M A;  1QQI A;  5J8C A;  2WWY A;  3JAM K;  3GO5 A;  1QNT A;  4CGZ A;  3HYI A;  2Q2E A;  5ICE A;  3QP6 A;  4I0B A;  2W84 A;  1FBS A;  1EV7 A;  1XSV A;  2KKO A;  4HX4 A;  1IF1 A;  3WGH A;  4KN7 X;  3HHH A;  1XGO A;  2DQL A;  5D4S A;  2PN6 A;  1FP2 A;  1B59 A;  4EM2 A;  1J2X A;  1WRJ A;  2M1B A;  5DUK A;  3TO6 A;  1FYM A;  2OQG A;  3IRR A;  5DDG A;  4UVC A;  3F6V A;  1BI3 A;  3EET A;  3HRT A;  3GFI A;  4YIF A;  2GIV A;  3CO7 C;  1RIO H;  2STW A;  3BRO A;  2OBP A;  1LB2 A;  1OPC A;  3KP3 A;  1TNT A;  2XKP A;  2VE9 A;  2P4W A;  4LB6 B;  2FQ3 A;  2ELH A;  2GXB A;  1Y0U A;  3V7R A;  1FT9 A;  3SQN A;  3QAH A;  2EFQ A;  1UFM A;  5IT9 Z;  5HLI A;  1QBJ A;  2ISZ A;  5JFR A;  1U5T C;  3KP6 A;  2VON A;  1CGP A;  2QLZ A;  2HYG D;  3H3Z A;  3M9A A;  4FHT A;  3GW2 A;  1AWC A;  3LA2 A;  2EFN A;  2OQR A;  1MZB A;  2Q8K A;  2UZK A;  4I09 A;  2BBY A;  3V4G A;  4G6D A;  2V1X A;  3MWM A;  2RQP A;  3I58 A;  5CVU A;  2HDC A;  2EK5 A;  3IC7 A;  2NNN A;  3SFZ A;  1P4W A;  4Q47 A;  1MD0 A;  3TOB A;  1DPU A;  1UB9 A;  2G7H A;  5K5O A;  4WWC A;  1SD6 A;  4HF1 A;  1F9N A;  1NHA A;  3RDI A;  4M71 A;  1IZ1 A;  5IT3 A;  4UNO A;  2C6Y A;  4AIH A;  3HOS A;  4BNC A;  4EJT A;  2FU4 A;  4M72 A;  1Q1H A;  1W7P B;  4M9X A;  1KU7 A;  5H6R A;  4KN4 X;  4OIR F;  2OZ6 A;  1K6O A;  1YS6 A;  1FNN A;  3N4M A;  3J7A O;  3I53 A;  3P9C A;  5CVJ A;  2FML A;  3S2W A;  2P5L C;  2IJL A;  4EJO A;  1PDN C;  4BQA A;  1R23 A;  2DI3 A;  4GO1 A;  2OAZ A;  5D6F A;  1RUO A;  3KP2 A;  4F7Z A;  2ZCW A;  5LHH A;  4NB5 A;  1PP8 F;  5LRS A;  3CO6 C;  2XIG A;  2P7C B;  4RB0 A;  2Q0O A;  2XHK A;  3BP8 A;  5BS6 A;  1G6N A;  3T5X A;  1L0O C;  2HTJ A;  1T98 A;  4HQM A;  3L00 A;  3KP5 A;  3D0S A;  4LFU A;  3H3U A;  4N9H A;  2PFB A;  5LEJ A;  3IL2 A;  4BAY A;  1IUY A;  4GXO A;  5K1Y A;  3RIR A;  4CYD A;  2QQA A;  2JRT A;  2D2W A;  1IXR C;  4LK1 F;  1T0F A;  3QPH A;  1ZG3 A;  1W5S A;  4UHT A;  1KA8 A;  3FXR A;  2H27 A;  3WTU C;  2HQR A;  3ZN1 A;  3GYH X;  3SXY A;  1A04 A;  4Q48 A;  4KNY A;  3I59 A;  3MFK A;  2ADU A;  2FXA A;  2VE8 A;  5CVR A;  3H92 A;  4E70 A;  2X0L A;  5L3D A;  2QQB A;  2W24 A;  2NS0 A;  1S7A A;  1D8J A;  2LSO A;  2IA0 A;  1QO0 D;  2HS5 A;  3WTX C;  1E17 A;  3RYR A;  4FX0 A;  3I71 A;  4JK1 X;  4HLY A;  4NQW A;  2GA2 A;  3ML6 A;  4A0Z A;  1YIO A;  3L9F A;  2EFP A;  2EJR A;  4RB2 C;  1U3E M;  3AAF A;  1V4R A;  2PEX A;  1S7O A;  3GXO A;  2VC0 A;  1B6A A;  4IRG A;  1G3S A;  3VOD A;  1BJA A;  2K27 A;  4YG2 F;  3DKW A;  2GXG A;  2P8T A;  2Z33 A;  4OIP F;  5DD4 A;  2QUF A;  4B8X A;  4D0P A;  2F2E A;  2H09 A;  4LLN A;  1F1Z A;  4I0A A;  2O3F A;  2XRN A;  3EYI A;  2LNB A;  3GZ5 A;  5ERI A;  5LHG A;  4ETS A;  3ZMU A;  1FY7 A;  1G4D A;  2E1C A;  1LDK B;  5LRR A;  2JT1 A;  1O3R A;  3VB2 A;  4ZH4 F;  3DQV C;  1RUN A;  1YW7 A;  1YYV A;  1R5G A;  2KIF A;  5HS9 A;  1ON1 A;  1XMA A;  2L4M A;  4RS8 A;  3KZZ A;  3VOE A;  2V79 A;  3TO9 A;  3RKY A;  1O57 A;  4WXD A;  4ENJ A;  3BJ6 A;  3RJP A;  4I98 B;  4ESF A;  3LFK A;  3QU6 A;  2COM A;  1S6L A;  4EMS A;  4PZJ A;  1YLF A;  2H94 A;  1ZH5 A;  2CYY A;  2VXZ A;  3DFG A;  5DCM A;  2VBW A;  1STZ A;  2IW5 A;  1UST A;  5E18 F;  4AWX B;  5LLQ A;  1H9G A;  2FE3 A;  2FBH A;  4HBL A;  1BIA A;  2E7W A;  4M74 A;  3TDZ C;  2F5D A;  4IPA A;  3FM3 A;  2BEO A;  4JQF A;  3VEP A;  3I54 A;  3HRU A;  3WU1 B;  3GVA A;  5HLH A;  5DCM B;  3RTR A;  2PBI A;  5F64 A;  3KFW X;  4EJW A;  1JE8 A;  3T1B A;  1XGS A;  3ELK A;  3DF8 A;  1EH6 A;  3IHU A;  1G3T A;  2GAU A;  3J80 Z;  5BQT A;  3KEQ A;  1EH8 A;  1Z1D A;  1K78 B;  2VOD A;  3M7G A;  2O0Y A;  3RKX A;  2QYO A;  4BHC A;  2A07 F;  3P9I A;  5CVI A;  5ILV A;  4OMY A;  2XAG A;  4QLC U;  3HTS B;  1T6S A;  1R7J A;  2NYX A;  4OMZ A;  4R79 A;  4RB1 A;  3JAM Z;  4HZF A;  4HX8 A;  5ED4 A;  1J7K A;  3LQR A;  4P9U A;  1S3J A;  1ZHF A;  3J81 K;  1X3U A;  1L3L A;  4KYW A;  1U6G A;  3LWF A;  1Z05 A;  4UVB A;  5DD8 A;  4GCV A;  5FD5 A;  2VC1 A;  2O61 A;  4KIG A;  3WTS C;  5HS8 A;  1XGM A;  1I1G A;  2EFW A;  4I2O A;  5JHU A;  1BN5 A;  2NRA C;  2TDX A;  5AIQ A;  2XKO A;  2A6H F;  1ZGA A;  2EWN A;  3IWZ A;  3FWE A;  2ESH A;  3CJN A;  2CO5 A;  3GFJ A;  2GZW A;  5HDG A;  5L3C A;  4ENM A;  3U2R A;  1FLI A;  2BYV E;  4GYI A;  5TJJ A;  5HOO A;  2M45 A;  2V6C A;  1O7L A;  3IRQ A;  3E97 A;  4RAZ A;  3V7S A;  3R0A A;  4KA4 A;  4U88 A;  3HUG A;  4R8H A;  3CLO A;  3WG9 A;  1SD4 A;  3F8M A;  4XLN F;  2DPD A;  4L9V A;  5L3G A;  3ZMZ A;  3REO A;  4HDU A;  2Z9O A;  3I0T A;  4KIB A;  4WK8 F;  1U5T B;  1MJ9 A;  5D8L B;  5J6X A;  1D5V A;  5DEQ A;  3HSF A;  1S29 A;  1ZRF A;  4MHG A;  1IXS B;  1FSH A;  1SD5 A;  1LEA A;  3U1D A;  5KK1 A;  2QVO A;  4ON0 A;  1SFU A;  1XGN A;  3HTU A;  5DUI A;  4MGR A;  4S04 A;  2OA4 A;  2HTS A;  1R1V A;  1QZY A;  2PMH A;  1I5Z A;  2O03 A;  2ETH A;  1BBY A;  1LQ1 A;  3NEU A;  5ICF A;  3O2P E;  1MDM A;  4M6X A;  2K86 A;  2V9V A;  5FD6 A;  4CDG A;  2FEZ A;  3DPL C;  3LA7 A;  4EV0 A;  4G94 A;  1HKS A;  2DLL A;  5E8G A;  4Z2Y A;  3KET A;  4MTE A;  4KFC A;  3DPT A;  4L9N A;  1I1S A;  3FX3 A;  2ZFW A;  1MDM B;  1F4K A;  1RZ4 A;  4HV6 A;  2WV0 A;  1KYW A;  1BI2 A;  4KUM A;  1TTY A;  3MQ0 A;  1IN6 A;  3O3K A;  5LGT A;  1KU3 A;  2L3D A;  3E6B A;  2D1H A;  1GXQ A;  5CLS A;  2IVM A;  2B0L A;  4MEX F;  2P5V A;  4N9I A;  5FO5 A;  4B09 A;  1WQ2 A;  2PG4 A;  1HW1 A;  4ZYH A;  3ERE D;  3K0L A;  4O3M A;  2VOP A;  2JPC A;  3WE3 A;  3CTA A;  1MJB A;  1CF7 A;  1XB4 A;  2ACJ A;  4TV7 A;  4Y13 A;  3RYP A;  1FYL A;  4R1H A;  1I6X A;  2FBK A;  3MCZ A;  1J9I A;  4BHB A;  2HQN A;  2PMU A;  2JSC A;  3NRV A;  3WTT C;  1SD7 A;  1B9N A;  1WWX A;  2VBY A;  3R0J A;  5CJ9 A;  1CF7 B;  5E1Z B;  3D5L A;  4U7D A;  1DP7 P;  1TQP A;  5AIP A;  1LDD A;  5E17 F;  3JW4 A;  2ZNZ A;  4P9F A;  3E5U A;  1HSJ A;  2Y48 A;  4M73 A;  2YSR A;  2QBY A;  1MKM A;  3DEU A;  3EUH A;  1PP7 U;  3U9G A;  3T8T A;  3F23 A;  3WGG A;  2F5C A;  4ZYD A;  3E6D A;  1UCR A;  2DU9 A;  1F5T A;  2FA5 A;  1P2F A;  5L3B A;  3SZT A;  2DO7 A;  1ZAO A;  1KGS A;  4EGY A;  4HYE A;  1B4A A;  3SZP A;  5D8K B;  2QBY B;  1OYI A;  3OOP A;  3ABT A;  4HOB A;  1U78 A;  4KT5 C;  2RN7 A;  3BZ6 A;  4MTD A;  3LQQ A;  2RC4 A;  1FP1 D;  1FZP B;  2ZKZ A;  1D8K A;  1DPR A;  1TNS A;  5FFX A;  3JTH A;  4WCG A;  1OR7 A;  3ZMT A;  1SFE A;  2FSW A;  5AON A;  5KVR A;  4CO8 A;  1QPM A;  2YX7 A;  3BOQ A;  2HR3 A;  3R4K A;  4L9T A;  2K4B A;  3TQN A;  1FC3 A;  2E1N A;  2OD5 A;  2A69 F;  2MLK A;  3F21 A;  3ZPL A;  4MNU A;  5HVQ C;  2R7D A;  1XCB A;  4L0Y B;  4EM1 A;  4YFX F;  2P6S A;  2Z3Y A;  2G9W A;  3P9K A;  4LLG F;  5BPI A;  4HW0 A;  2L54 A;  3I59 B;  5JR3 A;  3FXQ A;  1YG2 A;  2K4J A;  1WSU A;  4IXA A;  2KJB A;  2EB7 A;  2QWW A;  3K1P A;  4AVP A;  5E8I A;  2HWV A;  4G8X A;  5FB2 A;  3C7J A;  4AIK A;  2IPQ X;  4U0W A;  1ZG1 A;  2MBF A;  2M87 A;  3Q9S A;  3ZMD A;  1LDJ A;  4M6Y A;  3DXJ F;  2KJC A;  2Y0M A;  1IN5 A;  2LF7 A;  1FX7 A;  3GF2 A;  5JVT A;  2UXX A;  3WU0 A;  1XN7 A;  2M5W A;  4FT8 A;  4AD9 A;  2HOE A;  4IHS A;  1RNL A;  1FOK A;  1B9M A;  3ISP A;  5D5W B;  1AOY A;  2KIU A;  2RVC A;  2R3S A;  2EA4 A;  3BJA A;  4HDV A;  4LB5 A;  4ESJ A;  2DPU A;  1KU9 A;  3V8J A;  2XRO A;  1ZRD A;  3C3W A;  1XSX A;  5A2Q Z;  4I02 A;  2FF4 A;  1HKT A;  5L3F A;  4RAY A;  2HYF A;  1TBX A;  1MGT A;  2EV0 A;  3BY6 A;  4LD5 A;  1IN4 A;  3M1E A;  3ECO A;  5EEH A;  2A5Y B;  1TQI A;  2YU3 A;  2CGP A;  3KCC A;  3JSP A;  2OZU A;  4PDK A;  3CDH A;  5K5R A;  1FSE A;  4KIF A;  5FLX K;  1HW5 A;  3I4P A;  2BE5 F;  3C18 A;  1SAX A;  3J81 Z;  1B1B A;  3EQL F;  2HZT A;  3QU3 A;  4XSX F;  1R1T A;  5LEK A;  3PQJ A;  5D5X B;  2ZBK A;  2FNA A;  4IRH A;  1O3T A;  1T38 A;  3HSR A;  4K2E A;  5L3E A;  4H0E A;  2FOK A;  1JHH A;  2RDP A;  3EYY A;  4A5M A;  1YFH A;  2QZ8 A;  2HEO A;  4A6E A;  4IJA A;  3WE2 A;  1IAW A;  3K2Z A;  2WC2 A;  4O5V A;  5ILU A;  3MZH A;  3GFL A;  5FGM A;  2L02 A;  1XSD A;  4CZZ A;  1IN7 A;  1JHF A;  4HAM A;  4M9Z A;  5D4R A;  2LF8 A;  3PFI A;  2PI0 A;  3TKY A;  4L18 B;  5F1R A;  4LJZ F;  4RGR A;  1YW8 A;  1FWZ A;  6PAX A;  4G7H F;  4UUV A;  1QZZ A;  4WXC A;  4A12 A;  1ZRE A;  5BOX A;  3F3X A;  2CWE A;  4DNC A;  3QP5 A;  3I5U A;  4PGG A;  4CHU A;  2MLG A;  3ZQ7 A;  4HQE A;  4ENK A;  2J5O A;  4L0Z B;  2IP2 A;  1P6R A;  2JZY A;  2ZO4 A;  2BV6 A;  1J0R A;  1FBU A;  1G3Y A;  2DFI A;  2VN2 A;  2IT0 A;  1XCV A;  2NAZ A;  1O3Q A;  3FF5 A;  2L4A A;  4UV8 A;  1W5T A;  2H6B A;  3BDD A;  2EV5 A;  2XVC A;  1S8N A;  1FYK A;  2LKP A;  3C1D A;  5CVV A;  5H6Q A;  2XAS A;  3QPT A;  1TQM A;  1R1U A;  2EV6 A;  1VTN C;  2YX4 A;  1YTY A;  1XDU A;  3MEX A;  1ULY A;  3KEO A;  3RI4 A;  3IKT A;  1XMK A;  2F5E A;  3R61 A;  2CW0 F;  3HHG A;  2JPB A;  2M30 A;  2XAQ A;  3HSE A;  3K9T A;  4HF0 A;  2CQK A;  4IHT A;  1ZGJ A;  2EA2 A;  2PJP A;  2RGV A;  3BPV A;  2VBX A;  4KDP A;  3TOA A;  2VOO A;  1SMY F;  3BWG A;  1IW7 F;  2P5K A;  4OIQ F;  3ABU A;  1ZG5 A;  3Q5F A;  3GX4 X;  4BXU A;  2DTR A;  3QOP A;  2DAO A;  3HRM A;  3T8R A;  4U0Y A;  2KIM A;  2HKX A;  3WTW C;  3JSO A;  1TW3 A;  4U7B A;  3KP7 A;  1H0M A;  1FPQ A;  1OMI A;  3GWZ A;  1V3F A;  1P4A A;  1BOA A;  4ZZL A;  3M8F A;  2R7F A;  4HX7 A;  5HDK A;  3F8C A;  2XAF A;  2NNY A;  4XSZ F;  4ZYE A;  4A2U A;  4FX4 A;  1D3Y A;  4LLL A;  1ZYR F;  3K69 A;  3M8E A;  3ZMV A;  4HV5 A;  1HBX G;  2VT2 A;  2GA1 A;  5LGU A;  3IWF A;  5DYM A;  1BI0 A;  4GGG A;  1I27 A;  3HIF A;  3L7W A;  3KLN A;  1P4X A;  2XGX A;  2K7L A;  2ZJ2 A;  2V1U A;  5HLG A;  2HGC A;  4UV9 A;  1O7F A;  4MQV A;  2CG4 A;  4RB3 C;  2G7U A;  4EQQ A;  4ENN A;  2YPR A;  1BI1 A;  1W7P A;  1GXP A;  4HA8 A;  2F5F A;  4CIC A;  5LHI A;  1U8R A;  4XBF A;  4Y17 A;  3LA3 A;  2OU2 A;  5DV5 A;  1KQ9 A;  2RV8 A;  4KMU X;  2XUB A;  2FBI A;  1BC8 C;  2K02 A;  4YFK F;  2IRF G;  4P5O A;  4Q4Z F;  2Z99 A;  4G7O F;  3I64 A;  1U2W A;  3BJO A;  3Q9V A;  3V8K A;  5E1W A;  1Z6R A;  3ECH A;  3E5Q A;  1PUE E;  5BPD A;  2P7V B;  5BMZ A;  3N97 A;  4EJU A;  5J8F A;  1IXC A;  1TLH B;  3GEZ A;  4CXF A;  3EDP A;  3JTG A;  4UVA A;  4LMY A;  3F8F A;  1HST A;  3E5X A;  3F8B A;  4UXN A;  4ESB A;  5IT9 K;  3F22 A;  5ICC A;  2QQ9 A;  4WF2 A;  3ZN0 A;  3DP7 A;  1J5Y A;  1GVJ A;  1ZAR A;  3IKV A;  3ROU A;  2O6G E;  1E2X A;  3FXU A;  4IRI A;  2ZXJ A;  3PQK A; 
#chains in the Genus database with same CATH topology
 1ENH A;  3RKW A;  2H6C A;  2O8X A;  2R93 J;  3ULQ B;  3LAP A;  1OYY A;  3ESW B;  3WGI A;  1H8A C;  1HQC A;  1ZN2 A;  4DGW B;  3WTZ A;  4B48 A;  2LP0 A;  4X6A J;  3R60 A;  5LBQ A;  4UUS B;  2VQH A;  2KT0 A;  1YS7 A;  5GTI C;  2DOA A;  3HOT A;  2HKO A;  3BTI A;  3L2V A;  3OR2 C;  2ZNY A;  1H9T A;  1TW2 A;  4PGH A;  1Y56 A;  1T56 A;  3PUB A;  4NNJ A;  1S72 I;  4ZJZ A;  3OS2 A;  4E7K A;  1MBH A;  3L09 A;  3ASO H;  4HPQ A;  3G3Z A;  2IEK A;  1W0U A;  3GTL J;  2IGN A;  4P96 A;  2E71 A;  3GTK J;  1GV5 A;  1XD7 A;  5EJC A;  3S93 A;  1RES A;  1QHG A;  2RNG A;  1R00 A;  3DKX A;  4L5I A;  2FNP A;  3A0H C;  4CH7 A;  1LEB A;  2M8E A;  2W85 A;  2QGU A;  1WI9 A;  2IXS A;  3TO7 A;  3FXO A;  4EGZ A;  3RPQ A;  1WJE A;  1BM9 A;  1MBE A;  1JTY A;  1G8X A;  3OSF A;  2PQ8 A;  1X4O A;  3W6V A;  4MQ9 F;  2CS3 A;  4E7J A;  1OCO H;  4YRV A;  3WTY C;  1ETK A;  2ZXH A;  3W2V A;  4RGX A;  1TWF J;  3FMR A;  3GLX A;  3AKZ A;  1T2K A;  2IA2 A;  1HDP A;  1WH7 A;  1IRF A;  3BTL A;  3V7C A;  2LDU A;  3DV8 A;  4OU0 A;  3B73 A;  4DQ2 A;  1P9Q C;  4CYC B;  5FLX Z;  1Z91 A;  1OKR A;  4JBA A;  1ACI A;  4PCQ A;  2W57 A;  3OYD A;  4AIJ A;  3VSK A;  4LK0 F;  5K5Q A;  2IGO A;  1JKR C;  3QRF F;  5GP9 A;  4NHJ A;  2L5Q A;  1R22 A;  3ZOB A;  4A6D A;  4BQN A;  4QWQ A;  2BW3 A;  1EKE A;  1Y0N A;  1G59 A;  2DT5 A;  5GTH C;  1B8I A;  1POG A;  4EJV A;  1UHM A;  2L9V A;  5E20 A;  1U0J A;  1AA7 A;  2KQR A;  4DZP A;  1Z9C A;  2MD5 A;  5FLM J;  4BE2 A;  4MIM A;  3FM5 A;  1ORK A;  2DK5 A;  4I01 A;  4C3H J;  1HXD A;  2W25 A;  1R36 A;  1YHQ I;  2RNJ A;  2RKH A;  3K70 C;  1APL C;  3MZY A;  3CC2 I;  4G12 A;  3L2C A;  1ON2 A;  2CRG A;  4IKF A;  4LIU A;  2LOO A;  3OYC A;  5D6E A;  2ISY A;  2KFD A;  1UZC A;  1VQ9 I;  1R5H A;  4XID A;  3CJQ B;  1Z3Y A;  3G73 A;  1ZLJ A;  3ZQL A;  3L2Q A;  4Y52 J;  1LJ9 A;  4OOI A;  1UHW A;  1Z6T A;  4ASN A;  4GYG A;  1IN8 A;  2NVY J;  1NH3 A;  4FE7 A;  3M07 A;  1SFX A;  3E3V A;  3K1N A;  2QM3 A;  2JVH A;  3B6A A;  3E6M A;  5FKL A;  4LG0 A;  1MBF A;  2QSH X;  3KP4 A;  2HU9 A;  3ZP5 A;  1W4M A;  3TBI A;  3GZ6 A;  2QSF X;  3ZQF A;  3KZY A;  2AXL A;  5KAF C;  4HRI A;  2LH9 A;  3I3L A;  3ZQC A;  1HW2 A;  2JA7 J;  2P6T A;  1JUP A;  5JLX A;  4PFP A;  4XKV A;  3TDU C;  4OIN F;  5F0H A;  4ZZD A;  3P5J A;  2X6X A;  3QOD A;  3CUQ A;  2Z5U A;  3HZJ A;  1YW9 A;  3C2H A;  3TW6 A;  1J59 A;  5E1X A;  2ZXI A;  3DPU A;  2VT3 A;  3GTP J;  2A05 A;  1JGS A;  2JTV A;  5B66 C;  1MJA A;  3PNY A;  5CYV A;  1TZL A;  1X58 A;  4LG0 B;  1K79 A;  5FFZ A;  1M1E B;  2HZD A;  2MA3 A;  3L2U A;  3CQZ J;  1Q1V A;  2CMP A;  5EZG A;  1HKQ A;  1RC9 A;  3OYM A;  2QKL B;  3FMQ A;  4L5E A;  1RI7 A;  2DN0 A;  3KE2 A;  4DZJ A;  1PYV A;  2ZJR F;  1REP C;  3VWB A;  3K10 A;  1W0T A;  3MKL A;  3DEW A;  2DQR A;  1O3S A;  1RR8 C;  1BC7 C;  2GM4 A;  2A68 F;  3CUQ B;  4KMF A;  4L9J A;  2QEN A;  4QTR A;  3HG9 A;  2MSY A;  2D5V A;  1VI0 A;  3BR3 A;  5E79 C;  1P92 A;  4KIC A;  1YO5 C;  4RGS A;  1BR2 A;  2CFO A;  2JVG A;  4BHP A;  1PVE A;  1VF9 A;  1SVO A;  2AQF A;  2A6E F;  4Y7N J;  3F6O A;  2PJR A;  4BYY A;  3VYT B;  4EAT A;  3OV8 A;  4X0G A;  4IO9 F;  2DA3 A;  3BPX A;  3ZMS A;  3E6C C;  1UAA A;  2LRE A;  3FBN B;  1C0W A;  5F6F A;  4EVI A;  1USS A;  3S1R J;  3S2H J;  2FMY A;  4J00 A;  3W6K B;  2Y75 A;  3H9J A;  3WTV C;  2E7X A;  2V9P A;  2AS5 F;  2CFX A;  2X4H A;  3OY9 A;  4HF2 A;  3HRS A;  1YX3 A;  2E60 A;  3T0Y A;  2VI6 A;  4BS9 A;  2XSD C;  2WTE A;  2VBZ A;  2XV4 S;  1K7A A;  3KZI C;  2GWR A;  4EEF G;  4FAS D;  3VYS B;  2UXN A;  2DCE A;  4PUS A;  5LGN A;  1OYW A;  2MAB A;  4IEJ A;  5F04 A;  3S32 A;  1KYZ A;  5E3L A;  5FRN A;  3LL7 A;  4G6Q A;  4YII A;  5IP7 J;  4FCY A;  4RGU A;  2CQX A;  1S9H A;  1IRG A;  1K78 A;  1Z0X A;  4MEY F;  1TL8 A;  2D45 A;  1D5Y A;  5D5U B;  3B02 A;  3F72 A;  5DCF A;  3R6S A;  4A3M J;  2DJI A;  2LY9 A;  5ICG A;  2NS7 A;  3CCS I;  3COA C;  4E7H A;  1DP3 A;  1J09 A;  1Y1W J;  2IA1 A;  1G3W A;  5HDN A;  4U0V A;  5A2Q K;  3VDX A;  2DYR H;  1T39 A;  4OIO F;  3TGN A;  1FEX A;  2DW4 A;  1MH3 A;  2KMU A;  2O5R A;  2P0W A;  2DA7 A;  4I99 C;  1TWG J;  4Y15 A;  4XLP F;  2JK3 A;  1ONV A;  1BIB A;  2ELJ A;  4IF4 A;  4JX4 A;  3CUQ C;  2CSO A;  1Z7U A;  3O6B B;  5ILS A;  4A0Y A;  2LG4 A;  2J5P A;  3PJR A;  3LAJ A;  1A35 A;  2OF7 A;  4I7H A;  3FXJ A;  2XAH A;  4HLX A;  5JI6 A;  3QWL A;  3GUD A;  3PSI A;  1IV6 A;  4S05 A;  2GQQ A;  2X6Y A;  4Q5S F;  2HFH A;  5H2F C;  3GFM A;  1QU3 A;  2VLA A;  3BG5 A;  1LVA A;  2YR2 A;  1DDN A;  1PUF B;  2DXI A;  1KQ8 A;  1ZLK A;  3SHF A;  4BH9 A;  1ZRC A;  5CQE A;  2A3S A;  3F8N A;  2FRH A;  4M3E A;  2KRF A;  1VQ6 I;  2XRL A;  5KHD A;  2V1D A;  1S7E A;  2PLY A;  2A61 A;  4IVN A;  2VQG A;  3K4N A;  1R58 A;  3PUF A;  3QYE A;  4G9Y A;  2MH9 A;  2B7E A;  4GRI A;  5M3M J;  4LGW A;  3PIP F;  3SDB A;  5TRD A;  5D5V B;  3VFZ A;  3V8L A;  2UWM A;  4A5N A;  4E7Z A;  2HNH A;  4WX9 A;  5EGO A;  1IJW C;  3G6E I;  2E19 A;  1IC8 A;  4ZYG A;  2MH2 A;  1KQ0 A;  1JXS A;  2ESN A;  3HB9 A;  2DK8 A;  1FOY A;  3FHZ A;  1MMN A;  3V42 A;  4YFN F;  5GPA A;  4GDF A;  4ITV A;  1WVR A;  2D1V A;  3FZV A;  5J1R A;  3RQ4 A;  2K40 A;  2K9S A;  1IG7 A;  1ZGW A;  1JI8 A;  1WKM A;  1Y1V J;  2BGC A;  4ZDP A;  4M9S A;  2DT6 A;  1ODD A;  3WOD F;  4A0X A;  3P7N A;  1GHC A;  2QQ8 A;  2EFO A;  2ZME A;  3CC4 I;  3KLO A;  1EH7 A;  2L7Z A;  4XR6 A;  2FOW A;  3K2A A;  5F0C A;  4XRF A;  4BKX A;  3TED A;  3MAJ A;  1J75 A;  3BCB A;  5EEA A;  2Y2Z A;  2MYS A;  3IH3 A;  3TP0 A;  4PJ0 C;  3LOC A;  5EGO B;  2H1L A;  1YQA A;  4IOA F;  3ONQ A;  1DUX C;  4G7Z F;  4EM0 B;  2VXD A;  1KU2 A;  4N0B A;  1R71 A;  4XLE A;  1ITY A;  2L01 A;  1XDS A;  5DM6 F;  4L5J A;  2VL8 A;  3BG7 A;  2HVQ A;  5H20 A;  3RPU A;  2GLO A;  2STT A;  5J1Y A;  3Q0W A;  3CUO A;  3J80 K;  1U5T A;  2MC3 A;  2ZME B;  4E6K G;  3W6J B;  3FMS A;  1LNW A;  2Z1D A;  3NQO A;  4O6J A;  1SMT A;  1W7P D;  4B44 A;  3FK7 A;  2M3A A;  3CJR B;  2DMU A;  1FBQ A;  2DBB A;  5EEG A;  2XAJ A;  2DA4 A;  1QGP A;  4WXH A;  3LST A;  4P55 A;  5HS7 A;  1K6Y A;  3KYD B;  3K1M A;  1QQI A;  3PQK A;  2WY7 Q;  1VZ0 A;  5J8C A;  4HNV A;  2WWY A;  3JAM K;  3GO5 A;  4XKC A;  2R7O A;  1QNT A;  1QZE A;  3I9V 2;  4CGZ A;  3HYI A;  2Q2E A;  1WJA A;  5ICE A;  3QP6 A;  3L2R A;  1MSE C;  4I0B A;  1AKH B;  2W84 A;  1FBS A;  3H5A A;  1OCZ H;  1XPX A;  1EV7 A;  1XSV A;  4BBR J;  2GBY A;  3HOW J;  3FKJ A;  4BJ5 C;  2KKO A;  3MVP A;  1DU0 A;  3TW7 A;  4HX4 A;  4YEL A;  1IF1 A;  2NVQ J;  1BR4 A;  3WGH A;  3CCM I;  3HEF A;  3AG2 H;  3K4K A;  4KN7 X;  2B9S A;  1NTC A;  2AXT C;  3HHH A;  1XGO A;  2ZB9 A;  2DQL A;  3PIO F;  5D4S A;  2PN6 A;  1FP2 A;  4PJM A;  1B59 A;  1TP4 A;  4EM2 A;  1J2X A;  2ID3 A;  3J7Y J;  5F1J A;  5E3O A;  1WRJ A;  2M1B A;  4JOM A;  1VQ5 I;  5DUK A;  4B43 A;  3TO6 A;  3A01 A;  1FYM A;  3S17 J;  2OQG A;  3IRR A;  4ZDL A;  4IQ4 A;  5DDG A;  4UVC A;  2XF7 A;  3F6V A;  5B1B H;  1BI3 A;  3I4M J;  3EET A;  3HRT A;  3H9Q A;  3TL4 X;  3OS1 A;  2GIZ A;  4YIF A;  2GIV A;  3GFI A;  3CO7 C;  2Y9Z A;  2A6T A;  2E5N A;  4UUT A;  2ZME C;  1RIO H;  2STW A;  2X6W A;  3BRO A;  2OBP A;  1LB2 A;  3U1K A;  3OYI A;  1OPC A;  4XRS G;  3KP3 A;  4XQF A;  2YU9 J;  1TNT A;  2XKP A;  3PO3 J;  2CW8 A;  2VE9 A;  1W36 C;  2P4W A;  4LB6 B;  2F6C A;  1B72 A;  3LSG A;  3E1S A;  2DTZ A;  2FQ3 A;  4U87 A;  3LSR A;  2HI3 A;  3JRA A;  2ELH A;  2GXB A;  3K70 D;  5M3F J;  1Y0U A;  2ZSI B;  3ZQQ A;  4XL9 A;  3V7R A;  1OFC X;  2DA5 A;  2LY2 A;  2XDV A;  1A6I A;  1FT9 A;  3QYB A;  3SQN A;  3QYF A;  3QAH A;  4BQQ A;  3QQA A;  2EFQ A;  1UFM A;  3D5S C;  1A5J A;  5IT9 Z;  5HLI A;  2O7O A;  1QBJ A;  2ISZ A;  4BY7 J;  5JFR A;  1F43 A;  1LKX A;  2FX0 A;  1U5T C;  3KP6 A;  1IO2 A;  2VON A;  1CGP A;  5IYB J;  2QLZ A;  2HYG D;  3KYC B;  4UB6 C;  3H3Z A;  3M9A A;  2E2H J;  4FHT A;  3GW2 A;  5F27 A;  1AWC A;  3LA2 A;  2EFN A;  2OQR A;  1MZB A;  2Q8K A;  2UZK A;  4I09 A;  1ZK8 A;  2BBY A;  3Q0V A;  3V4G A;  4G6D A;  2V1X A;  1HA8 A;  2V1N A;  3MWM A;  2RQP A;  1WJB A;  3KX2 A;  3ASN H;  1K4T A;  3I58 A;  5CVU A;  4PK4 A;  2HDC A;  2EK5 A;  2HVS A;  3IC7 A;  3KYL A;  2NNN A;  3HM5 A;  2KDZ A;  3SFZ A;  1P4W A;  1WJF A;  4Q47 A;  1MD0 A;  3TOB A;  1DPU A;  1UB9 A;  3BTC A;  3PL8 A;  4JX6 A;  2G7H A;  5TGT A;  3CD6 I;  5K5O A;  4BDY A;  2X1E A;  4WWC A;  1SD6 A;  4DBR A;  4HF1 A;  1F9N A;  2JA2 A;  1NHA A;  2DDB A;  2LK2 A;  3WHC A;  3RDI A;  4M71 A;  1IZ1 A;  4DJA A;  5IT3 A;  4UNO A;  1OJL A;  1HCR A;  2DFF A;  2C6Y A;  2XF5 A;  4QPO A;  1A36 A;  4RBO A;  4AIH A;  3HOS A;  4BNC A;  4EJT A;  3BQY A;  2FU4 A;  4M72 A;  2OJE D;  5EG0 A;  1Q1H A;  4XKB A;  2XGD A;  3OIQ A;  1SAU A;  1W7P B;  4M9X A;  1KU7 A;  1S5L C;  2X9D A;  5H6R A;  3M8J A;  4KN4 X;  3G1L A;  1MNM C;  2RAE A;  1VQO I;  4OIR F;  2OZ6 A;  4A3J J;  1K6O A;  2KZG A;  1YS6 A;  1FNN A;  3N4M A;  1YJW I;  3J7A O;  1MMD A;  2UUZ A;  3I53 A;  2X85 A;  3P9C A;  3B6C A;  5CVJ A;  3LSM A;  4YIR X;  1VND A;  1BA5 A;  2FML A;  1BL0 A;  4XOT A;  3S2W A;  2P5L C;  2IJL A;  4EJO A;  2W1O A;  1PDN C;  4BQA A;  1R23 A;  2DI3 A;  4GO1 A;  4XLA A;  2OAZ A;  2CUZ A;  5FJ8 J;  5D6F A;  4S0H B;  5CPR B;  2BOL A;  3MKZ A;  1RUO A;  3KP2 A;  4F7Z A;  4C2M J;  2ZCW A;  1OCR H;  1X2N A;  2L9R A;  5LHH A;  3OIO A;  4NB5 A;  1PP8 F;  1GVD A;  5LRS A;  3CO6 C;  2XIG A;  2CV1 A;  1OLT A;  2FQ4 A;  1X1B A;  2P7C B;  2E1O A;  1BJZ A;  2ZJQ F;  3H36 A;  2Q0O A;  1E3H A;  4RB0 A;  2XHK A;  3BP8 A;  4RM3 A;  5BS6 A;  1ETX A;  1G6N A;  1FMW A;  3T5X A;  1L0O C;  4KIT B;  3CME I;  4KT6 A;  2HTJ A;  2BVL A;  1T98 A;  4HQM A;  3L00 A;  2FD5 A;  3KP5 A;  2HVR A;  1Y6I A;  2BVM A;  1TT0 A;  3KIO A;  3D0S A;  4LFU A;  2VAS A;  5C4J J;  3H3U A;  4N9H A;  4D7M A;  3JRB A;  3CP2 A;  2PFB A;  5LEJ A;  3IL2 A;  2L7F P;  3O8H A;  3IAS 2;  4BAY A;  4DYR A;  1IUY A;  3H9G A;  4GXO A;  3LSJ A;  5K1Y A;  3RIR A;  4BJ6 C;  4CYD A;  2KL4 A;  2QQA A;  3BZK A;  2JRT A;  4LIV A;  2D2W A;  1IXR C;  4XLH A;  4LK1 F;  1T0F A;  3QPH A;  3H5N A;  1ZG3 A;  5TIS C;  3OYA A;  1W5S A;  2QCO A;  3OYB A;  2XPW A;  3NWS A;  3LSK A;  4UHT A;  1KA8 A;  3FXR A;  1UG2 A;  4NC6 A;  2H27 A;  2KRH A;  3WTU C;  2HQR A;  2LLK A;  1QVT A;  2DMP A;  3ZN1 A;  3GYH X;  3G4S I;  3SXY A;  1A04 A;  4Q48 A;  4KNY A;  2K9N A;  3I59 A;  3MFK A;  2ADU A;  2FXA A;  2DT7 B;  5J4V A;  2VE8 A;  3SZG A;  5CVR A;  3H92 A;  4E70 A;  3JRE A;  4PJL A;  2RRE A;  4I6Z A;  2YUS A;  2M4G A;  2X0L A;  5L3D A;  2QQB A;  2ICW G;  2W24 A;  2NS0 A;  4A3D J;  1S7A A;  2XSJ C;  1D8J A;  2LSO A;  1HC8 A;  3FXL A;  2IA0 A;  1MBK A;  1QO0 D;  2HS5 A;  2L7M P;  2IBD A;  3MZ8 A;  3WTX C;  1E17 A;  2HOS A;  2DOE A;  3M1C A;  3ABL H;  3RYR A;  3CCU I;  3HBL A;  4FX0 A;  1UEL B;  4ZYA A;  2MFZ A;  3I71 A;  4DYC A;  4JK1 X;  4HLY A;  4NQW A;  2GA2 A;  1R49 A;  2DMN A;  2ME0 A;  3ML6 A;  3L2W A;  4A0Z A;  1YIO A;  2BXY A;  3L9F A;  2EFP A;  3RCO A;  2EJR A;  2ZXW H;  3OYN A;  3S3M A;  4RB2 C;  1U3E M;  4MFD A;  2Y9Y A;  1KZH A;  3AAF A;  1V4R A;  2PEX A;  1S7O A;  3GXO A;  2VC0 A;  2R5Y A;  1B6A A;  1XMX A;  2JRM A;  4IRG A;  4JX5 A;  3RKQ A;  2DFH A;  4F52 A;  2V26 A;  1G3S A;  3VOD A;  1BJA A;  2K27 A;  3GZN B;  4YG2 F;  3DKW A;  2GXG A;  1TWC J;  2XPV A;  3O8G A;  2P8T A;  2Z33 A;  1YRN A;  2GOM A;  1TWA J;  5FRM A;  1H89 C;  4OIP F;  3CF5 F;  5DD4 A;  2QUF A;  4B8X A;  2L0K A;  4D0P A;  4D7N A;  2F2E A;  2H09 A;  2BW3 B;  1F1Z A;  4CCO A;  3GCM A;  4LLN A;  2HQA A;  4I0A A;  1B8I B;  2R7Q A;  2O3F A;  4J01 A;  1Y39 A;  2EIM H;  2R5Y B;  2XRN A;  3EYI A;  2LNB A;  5EYR A;  3GZ5 A;  5ERI A;  2I10 A;  5LHG A;  3RZD J;  4ETS A;  1Z67 A;  2QA4 I;  3ZMU A;  1FY7 A;  1G4D A;  2E1C A;  1LDK B;  5LRR A;  2JT1 A;  2VIX A;  4RM2 A;  1O3R A;  1T0F C;  3VB2 A;  4M3D A;  4ZH4 F;  3DQV C;  1RUN A;  2V9K A;  2GXA A;  3HOU J;  3S14 J;  1YW7 A;  3X2Q H;  2A5W A;  1T33 A;  1YYV A;  1R5G A;  3OYE A;  2E34 A;  4HEA 2;  2KIF A;  5GAG J;  5HS9 A;  1ON1 A;  1YX5 A;  2E5Z A;  1A31 A;  4BAC A;  1XMA A;  2L4M A;  5F0F A;  4RS8 A;  3KZZ A;  4H4K C;  3VOE A;  1NG7 A;  2V79 A;  1SEU A;  2E2I J;  2F4M B;  3TO9 A;  1VFC A;  3RKY A;  1O57 A;  4WXD A;  4ENJ A;  1ZKG A;  2K9L A;  4BXX J;  2KHM A;  3BJ6 A;  4JP0 A;  3RJP A;  4D5C A;  3DCF A;  5KCM A;  4XOR A;  4I98 B;  4ESF A;  2JWT A;  2XGE A;  3LFK A;  4BDZ A;  2AHQ A;  4DYQ A;  3JRH A;  2ZFU A;  4I76 A;  3SEQ A;  2JUG A;  1BW5 A;  4Y33 A;  3QU6 A;  3Q0U A;  2COM A;  1S6L A;  4EMS A;  4DIQ A;  4PFO A;  4PZJ A;  1YLF A;  2H94 A;  1ZH5 A;  3CCR I;  2CYY A;  2ECC A;  2VXZ A;  1ZQ3 P;  4XMY A;  1WJD A;  3DFG A;  2EZH A;  5DCM A;  2VBW A;  4IHW A;  1STZ A;  3IP4 B;  2IW5 A;  1UST A;  5E18 F;  3HPH A;  3BCA A;  4AWX B;  5LLQ A;  1H9G A;  2FE3 A;  2FBH A;  2Z16 A;  4HBL A;  4C9Y A;  4F93 B;  1BIA A;  2JA6 J;  1XTA A;  2E7W A;  1UJ8 A;  4M74 A;  1QHH D;  3RZO J;  3TDZ C;  3DTE A;  2F5D A;  2X1D A;  2W4S A;  4IPA A;  4IQJ A;  3FM3 A;  2WAQ N;  2Y30 A;  3I56 I;  4G6T B;  5IPA A;  2BEO A;  2M4K A;  4JQF A;  3VEP A;  3BZC A;  3I54 A;  5HLT A;  3HRU A;  2PJR B;  3L1P A;  3WU1 B;  3GVA A;  5HLH A;  5DCM B;  3CCL I;  3RTR A;  2PBI A;  5F64 A;  2O8K A;  2WY8 Q;  5E3N A;  3HOV J;  3IH2 A;  3KFW X;  4EJW A;  4IHY A;  1JE8 A;  3T1B A;  1RKW A;  1HOM A;  1XGS A;  2COB A;  3CP8 A;  3CCJ I;  3ELK A;  3DF8 A;  2HXI A;  1EH6 A;  1UHS A;  3IHU A;  2F48 A;  4Z6Y A;  1JUM A;  1G3T A;  2VQC A;  4B3A A;  1GUU A;  2GAU A;  2WAF A;  3CF2 A;  3J80 Z;  5BQT A;  3GTG J;  3KEQ A;  1SC7 A;  4RLF A;  2IS1 A;  1EH8 A;  1D1C A;  3K4C A;  1HLV A;  1Y8Q B;  2FUG 2;  1Z1D A;  1K78 B;  5FKM A;  1ZR4 A;  3M7G A;  2VOD A;  2O0Y A;  3RKX A;  4C2T A;  2DA6 A;  2QYO A;  4BHC A;  2A07 F;  1N77 A;  2F5V A;  1V5G A;  4GFB A;  3P9I A;  5CVI A;  3AFH A;  5ILV A;  1EF4 A;  3OYH A;  4OMY A;  2XAG A;  3AL0 B;  4QLC U;  2I8D A;  4LOC A;  3HTS B;  1T6S A;  1R7J A;  2NYX A;  4OMZ A;  4R79 A;  2V4J C;  4RB1 A;  5LD2 C;  2NVU B;  3JAM Z;  4HZF A;  4HX8 A;  5ED4 A;  1J7K A;  3LQR A;  4P9U A;  1Z7L A;  1S3J A;  1ZHF A;  5FKK A;  2ZSH B;  1T08 B;  3J81 K;  2DMT A;  3HPG A;  1X3U A;  3SJM A;  2KDO A;  1W5C C;  1L3L A;  2ZC2 A;  4KYW A;  1U6G A;  2BHZ A;  3LWF A;  3QOE A;  4A3B J;  2M7A A;  2VB6 A;  5IYC J;  1Z05 A;  4UVB A;  1FIA A;  5DD8 A;  4C3J J;  1MMG A;  1YIT I;  4GCV A;  5FD5 A;  3G1O A;  2JQ7 A;  4E7L A;  2F4I A;  2VC1 A;  3OYL A;  4FIS A;  1LFP A;  2O61 A;  4KIG A;  3WTS C;  3NAR A;  5HS8 A;  1XGM A;  3H1C A;  1EA3 A;  2CQN A;  1O4X A;  1H88 C;  1I1G A;  2EFW A;  4I2O A;  5JHU A;  1BN5 A;  2LYC A;  3ZQH A;  2NRA C;  1VQ7 I;  2TDX A;  2KPM A;  5AIQ A;  2R7X A;  2VUM J;  2HYJ A;  2MW8 A;  2XKO A;  2A6H F;  3M3Y J;  3SEZ A;  1ZGA A;  2ZJP F;  1JUS A;  3PNT A;  2EWN A;  5JVG F;  3IWZ A;  2IGK A;  4RDU A;  3FWE A;  1QPI A;  4MFE A;  5E3M A;  2ESH A;  3CJN A;  2CO5 A;  1WGX A;  2DDA A;  2GZW A;  3GFJ A;  5HDG A;  5L3C A;  2XC7 A;  4ENM A;  3U2R A;  1FLI A;  1WCM J;  2BYV E;  3C2B A;  3Q3S A;  5HNH A;  1QA6 A;  1KON A;  4GYI A;  1XG1 A;  5TJJ A;  4CCL A;  2M45 A;  5HOO A;  4QIW N;  2EIK H;  2V6C A;  1O7L A;  1X3W B;  3AL0 C;  3IRQ A;  3E97 A;  4RAZ A;  5DTD A;  3V7S A;  3R0A A;  2IGM A;  4KA4 A;  2X6O A;  4U88 A;  3HUG A;  3HOY J;  5K7F A;  2W00 A;  3CLO A;  4R8H A;  4OAZ A;  3D5R C;  3WG9 A;  2JA5 J;  1SD4 A;  5J47 A;  3F8M A;  2L9S A;  3ZQI A;  4XLN F;  1I39 A;  3ZXS A;  2DPD A;  4L9V A;  5L3G A;  5K7Z A;  3OR1 C;  3KPH A;  3ZMZ A;  3LMM A;  3VYU B;  4J19 A;  3REO A;  2NVT J;  4HDU A;  2CUJ A;  3BR2 A;  4Y4R A;  2Z9O A;  3FXM A;  3I0T A;  4KIB A;  4WK8 F;  4CCK A;  3C2G A;  1U5T B;  1MJ9 A;  1NG6 A;  2VKE A;  5EZH A;  5D8L B;  5J6X A;  1D5V A;  5DEQ A;  3HSF A;  1S29 A;  1R4M B;  2DOD A;  2H1K A;  4M3B A;  4MHG A;  4E7I A;  3EPZ A;  1ZRF A;  1IXS B;  1FSH A;  1R5I D;  1SD5 A;  3HUG B;  1LEA A;  1I6H J;  3U1D A;  3CMM A;  1K83 J;  5KK1 A;  4M3F A;  2QVO A;  3BG3 A;  4ON0 A;  4XKW A;  3HL2 A;  1SFU A;  2GOX B;  1XGN A;  4P1W A;  4W97 A;  3HTU A;  1N25 A;  3GBG A;  3VSL A;  5DUI A;  2CQQ A;  4MGR A;  4S04 A;  2OA4 A;  2HTS A;  1X19 A;  5J4Y A;  4QPQ A;  1R1V A;  5J1U A;  1QZY A;  2PMH A;  1I5Z A;  3DBR B;  4NDL A;  2Q2E B;  2BY1 A;  2O03 A;  2ETH A;  4N4N B;  4A3K J;  1WHU A;  4X1E A;  4D5F A;  1BBY A;  1XS9 A;  4ZTF A;  4CCJ A;  1LQ1 A;  3NEU A;  1FOX A;  2KIQ A;  3O2P E;  5ICF A;  3HJE A;  3EUK L;  1MDM A;  1D0Y A;  4M6X A;  3FIW A;  1YJN I;  2O9L A;  4BEH A;  2K86 A;  2B63 J;  2V9V A;  2X48 A;  4V2F A;  3OOU A;  4CDG A;  5FD6 A;  2FEZ A;  4JYK A;  3DPL C;  1RR7 A;  1SVL A;  4RAG A;  3BLY A;  4IL6 C;  3LA7 A;  4EV0 A;  1D1B A;  4G94 A;  5B1A H;  1HKS A;  4ABZ A;  2DLL A;  5E8G A;  4Z2Y A;  3KET A;  4MTE A;  4KFC A;  1X2M A;  2ID6 A;  4FQG A;  1VQK I;  3GLL A;  3LSH A;  2XF6 A;  3A01 B;  4E4H A;  3DPT A;  4AC0 A;  4L9N A;  1I1S A;  3FX3 A;  1FTT A;  2ZFW A;  1MDM B;  1F4K A;  4XNF A;  1RZ4 A;  4HV6 A;  3ZRG A;  3K4J A;  2WV0 A;  1KYW A;  1BI2 A;  4KUM A;  1TTY A;  3MQ0 A;  5FLV A;  1IN6 A;  3O3K A;  2MGQ A;  5LGT A;  2CUE A;  2BHY A;  2Y0S N;  1KU3 A;  2L3D A;  3GTO J;  3E6B A;  1CQT A;  1P7J A;  1JT0 A;  2CV2 A;  2OCC H;  2D1H A;  2WB1 N;  1GXQ A;  1B72 B;  5CLS A;  4RMN A;  1T95 A;  2IVM A;  2B0L A;  4MEX F;  2WA0 A;  2P5V A;  4N9I A;  5FO5 A;  4B09 A;  1WQ2 A;  4ZC3 A;  5KNL A;  1MMA A;  1Z21 A;  2EZK A;  5HNF A;  2PG4 A;  3ERM A;  1HW1 A;  1MH4 A;  4B4C A;  4ZYH A;  3ERE D;  4OAY A;  3HXL A;  3K0L A;  3ZGK A;  4O3M A;  5FKO A;  2VOP A;  1FMV A;  1Z3X A;  2JPC A;  1GLN A;  3WE3 A;  3CTA A;  2WAE A;  1MJB A;  1E3P A;  1CF7 A;  1XB4 A;  2ACJ A;  2CU7 A;  5JLW A;  4TV7 A;  2VPL A;  3IV5 A;  1DGW Y;  4B1R A;  2K9M A;  2EPF A;  4PJJ A;  2PMZ N;  4Y13 A;  3RYP A;  1FYL A;  4CUG A;  2X1C A;  4R1H A;  2EZI A;  2CW7 A;  1I6X A;  2FBK A;  3ABM H;  5F08 A;  1D0X A;  3MCZ A;  1F36 A;  4AYB N;  5EDN A;  1J9I A;  4BHB A;  2HQN A;  2PMU A;  4W1U A;  2JSC A;  1P7I A;  3NRV A;  3MD2 A;  3WTT C;  1SD7 A;  1UG0 A;  3WU2 C;  2DFE A;  4BUP A;  4ZDO A;  1B9N A;  1WWX A;  2VBY A;  3R0J A;  5CJ9 A;  2HOT A;  1CF7 B;  5E1Z B;  2WAQ A;  3D5L A;  2HPI A;  2K3P A;  4U7D A;  1DP7 P;  1TQP A;  5AIP A;  1LDD A;  5E17 F;  3JW4 A;  3JRI A;  5EG0 B;  1NK2 P;  2ZNZ A;  1WFX A;  4P9F A;  2DJN A;  3E5U A;  5J3L A;  1VQP I;  2CV0 A;  3HDD A;  2QEX I;  1HSJ A;  2Y48 A;  3S15 J;  3DKY A;  4M73 A;  4NC7 A;  3W2A A;  3FK6 A;  2YSR A;  2P81 A;  4KJZ A;  2QBY A;  1U9O A;  1QVU A;  1MKM A;  2WV1 A;  3SDG A;  3DEU A;  3EUH A;  1PP7 U;  2PX9 A;  3U9G A;  3T8T A;  2BY3 A;  3F23 A;  3WGG A;  2LKS A;  2F5C A;  4ZYD A;  2QKM B;  3DU6 A;  3E6D A;  1UCR A;  2DU9 A;  1F5T A;  3PFY A;  2FA5 A;  4BE0 A;  2BZT A;  1P2F A;  1LFB A;  5L3B A;  4UUS A;  1R9T J;  1I3A A;  3OL4 A;  3SZT A;  4IOC F;  2DO7 A;  3FBI B;  3LFU A;  1ZAO A;  3GTJ J;  1KGS A;  3OSG A;  1IRX A;  4EGY A;  4HYE A;  1B4A A;  3SZP A;  5D8K B;  2QBY B;  2V6E A;  4XON A;  1EJ9 A;  1OYI A;  4AUX A;  3OOP A;  3ABT A;  2OCE A;  4HOB A;  3A4C A;  4PJN A;  1U78 A;  4KT5 C;  5M5W J;  2BY2 A;  4BQO A;  2RN7 A;  3BZ6 A;  4MTD A;  1DGR M;  3LQQ A;  2RC4 A;  1FP1 D;  3RSN A;  4B3X A;  2AO9 A;  3HGG A;  1FZP B;  1MIJ A;  2ZKZ A;  1D8K A;  3BR6 A;  1DPR A;  1TNS A;  2EIL H;  1G2H A;  3H3V K;  5FFX A;  2R7V A;  3K4L A;  3J7Z I;  1LFU P;  2AQE A;  3JTH A;  3GTQ J;  1IV8 A;  4WCG A;  1OR7 A;  3ZMT A;  1SFE A;  1OCP A;  2DOF A;  2FSW A;  5AON A;  5KVR A;  4DBQ A;  4A3C J;  3SFI A;  4CO8 A;  4XN0 A;  3G71 I;  3VPR A;  1V5E A;  2JMW A;  1QPM A;  3A0B C;  2YX7 A;  3BOQ A;  3IAM 2;  1A6Q A;  1TT5 B;  1WH5 A;  2HR3 A;  3R4K A;  2W48 A;  4L9T A;  2K4B A;  3TQN A;  3JR9 A;  3IH4 A;  3RQI A;  1K4S A;  4LG3 A;  1E3O C;  1GV2 A;  4UB8 C;  1FC3 A;  1YOV B;  1ETQ A;  2R7T A;  2E1N A;  2OD5 A;  2A69 F;  2HOA A;  2MLK A;  3F21 A;  4CYC A;  2XPU A;  3ZPL A;  4MNU A;  5HVQ C;  2R7D A;  4CA0 A;  1XCB A;  5FRO A;  1VQM I;  3SYT A;  4L0Y B;  4EM1 A;  4YFX F;  2XB5 A;  4HG2 A;  2P6S A;  4QSH A;  2Z3Y A;  2M34 A;  3S3O A;  1OIS A;  2G9W A;  1SFO J;  3P9K A;  4LLG F;  5BPI A;  4HW0 A;  2L54 A;  2K9Q A;  2R0Q C;  3I59 B;  5B5E C;  3CMY A;  5JR3 A;  3FXQ A;  1YG2 A;  2K4J A;  1WSU A;  1U9N A;  1WJC A;  3CZ6 A;  4IXA A;  2KJB A;  2EB7 A;  2K5C A;  2QWW A;  2CQ7 A;  3K1P A;  1MSF C;  4AVP A;  5E8I A;  1BW6 A;  3EUH C;  3GTM J;  2XGC A;  4XRS A;  2HWV A;  4G8X A;  4FET A;  3C7J A;  5FB2 A;  4B47 A;  4AIK A;  2IPQ X;  4U0W A;  2QSG X;  2HPM A;  2V7F A;  4E7S A;  1ZG1 A;  2MBF A;  3F9K A;  2M87 A;  1LVK A;  1R4N B;  3Q9S A;  5M5Y J;  4XIC A;  2QF7 A;  3ZMD A;  1LDJ A;  4M6Y A;  3DXJ F;  2KJC A;  4A3G J;  2Y0M A;  1IN5 A;  1MND A;  2LF7 A;  1FX7 A;  2VJ5 A;  3DLA A;  3GF2 A;  5JVT A;  3H5R A;  2UXX A;  4NQW B;  4IHX A;  3D1N I;  1YI2 I;  1VQL I;  3WU0 A;  1LUJ B;  1XN7 A;  2M5W A;  2VKD A;  4FT8 A;  5LFA A;  4ZTJ A;  4AD9 A;  2HOE A;  4IHS A;  1RNL A;  5C44 J;  1FOK A;  1B9M A;  3ISP A;  3OWT A;  2VQL A;  1E0E A;  3DTI A;  3OIP A;  2F4O B;  5D5W B;  1AOY A;  2KIU A;  1Y8R B;  2RVC A;  2R3S A;  2EA4 A;  3OYK A;  1D1A A;  2OUM A;  3BJA A;  2KP6 A;  3CDL A;  3DTK A;  2LY1 A;  4HDV A;  1YRN B;  2FJ1 A;  4LB5 A;  3OL3 A;  2WBM A;  4ESJ A;  2DPU A;  1KU9 A;  3V8J A;  4II3 A;  2EIJ H;  2XRO A;  3AG4 H;  2LVS A;  1ZRD A;  3I55 I;  3S1M J;  1IDZ A;  1DQU A;  1XSX A;  2KIS A;  1JKP C;  5A2Q Z;  2R7R A;  3S1Q J;  1OR7 C;  4I02 A;  2FF4 A;  5IOY A;  1HKT A;  3F0C A;  5L3F A;  3LNQ A;  4RAY A;  3OS0 A;  1LE8 A;  3S8P A;  1JJ8 C;  2N8G A;  2HYF A;  4XN3 A;  5GAH J;  1TBX A;  1QRY A;  1WPK A;  1Z77 A;  1MGT A;  4XOP A;  3JCU C;  9ANT A;  2EV0 A;  4IZZ A;  3BY6 A;  4LD5 A;  1IN4 A;  2JSP A;  1XX5 A;  4HSR A;  3ZCO A;  5IP9 J;  4F91 B;  3M1E A;  4IHV A;  3M4O J;  3ECO A;  2L9N A;  5EEH A;  2A5Y B;  1TQI A;  2BY0 A;  2VJJ A;  2YU3 A;  5KAI C;  4CCM A;  1YJ9 I;  2CGP A;  3KCC A;  1ERD A;  2E35 A;  3JSP A;  2IS2 A;  2OZU A;  3CES A;  2L7K A;  4PDK A;  4HNU A;  1X1P A;  1I3Q J;  3CDH A;  2K3F A;  5K5R A;  1VQN I;  1FSE A;  4D9J A;  3JRG A;  2X51 A;  4KIF A;  1LE8 B;  5FLX K;  1HW5 A;  3TP3 A;  3CDI A;  3I4P A;  1VQ8 I;  2IAI A;  3ABK H;  2BE5 F;  3C18 A;  1SAX A;  3J81 Z;  1W36 D;  2MG4 A;  1JGG A;  4V19 K;  4DW6 A;  1VQ4 I;  1B1B A;  3EQL F;  4C30 A;  2HZT A;  1ETV A;  3QU3 A;  4XSX F;  1R1T A;  5LEK A;  2NXN B;  2E2J J;  2KZV A;  2H8R A;  4II2 A;  3OYG A;  3PQJ A;  4XM3 A;  1FTZ A;  1RET A;  2Y0S A;  5D5X B;  3PSF A;  3RPU D;  2ME6 A;  4Y3O A;  2WB1 A;  3HKZ N;  4BBS J;  2ZBK A;  1YIJ I;  3JRF A;  2NOG A;  3BG6 A;  4C3I J;  1V54 H;  3KEY A;  3S16 J;  4A93 J;  1FIP A;  2FNA A;  4IRH A;  1O3T A;  1T38 A;  3HSR A;  5IY5 H;  4K2E A;  5L3E A;  4H0E A;  2FOK A;  1ZEL A;  1JHH A;  2LC2 A;  3JRC A;  3CC7 I;  4CCN A;  2RDP A;  2M2E A;  3EYY A;  1BR1 A;  3UR3 C;  2LRD A;  4A5M A;  1YFH A;  2WAD A;  1FJL A;  2QZ8 A;  2HDW A;  1N78 A;  2HEO A;  2HQ5 A;  2EH3 A;  4A6E A;  1LPQ A;  4IJA A;  3CJT B;  3WE2 A;  4XLF A;  3K2Z A;  2WC2 A;  4O5V A;  1IAW A;  5ILU A;  3MZH A;  2XB0 X;  3BR5 A;  3GFL A;  5FGM A;  3ZQG A;  3S1N J;  2PMZ A;  2L02 A;  1D0Z A;  3EUA A;  1MBG A;  1XSD A;  4F92 B;  3K6G A;  4CZZ A;  4MO7 A;  1IN7 A;  1JHF A;  3OYF A;  4AYB A;  2YS9 A;  5GAE J;  4HAM A;  4M9Z A;  1PUF A;  5D4R A;  2LF8 A;  3PFI A;  2PI0 A;  3TKY A;  4L18 B;  2LR8 A;  3A02 A;  3UNG C;  5F1R A;  4LJZ F;  4RGR A;  1YW8 A;  1FWZ A;  1JT6 A;  3GME A;  4BU2 A;  3IUO A;  2EBI A;  6PAX A;  2NOJ B;  4G7H F;  4UUV A;  1QZZ A;  4WXC A;  4A12 A;  1ZRE A;  4FE4 A;  3S2D J;  2ECB A;  5K7H A;  4NC8 A;  5BOX A;  3F3X A;  4OWR B;  3AG1 H;  4D1Q A;  1SFK A;  2CWE A;  2L2O A;  4DNC A;  3QP5 A;  3I5U A;  4BL0 B;  1ZR2 A;  3H0G J;  4PGG A;  4XRM A;  4CHU A;  2KLO A;  2MLG A;  1JJ6 C;  3ZQ7 A;  1ETY A;  5DM7 F;  2W7N A;  2Q1Z B;  5C3E J;  4HQE A;  4ENK A;  2CJJ A;  2J5O A;  2LKX A;  2R7Z J;  1MNE A;  3NAU A;  5M5X J;  4A3E J;  1V55 H;  1AHD P;  2E36 A;  1V5F A;  4L0Z B;  1ETW A;  1P6R A;  2IP2 A;  2JZY A;  2ZO4 A;  1ZTR A;  2BV6 A;  3AG3 H;  2JUC A;  1J0R A;  1FBU A;  3FIS A;  3NWT A;  1G3Y A;  4HST A;  2JN6 A;  2M0M A;  3W2W A;  2IS4 A;  3DBL B;  2R7U A;  5IOZ A;  2DFI A;  2VN2 A;  2IT0 A;  2OTL I;  1XCV A;  2NAZ A;  2VKV A;  2LBF A;  3HOX J;  1X1C A;  1O3Q A;  1SAN A;  3FF5 A;  3PM1 A;  2L4A A;  2XAU A;  4UV8 A;  1W5T A;  2H6B A;  2LMD A;  3BDD A;  2EV5 A;  2XVC A;  1S8N A;  1FYK A;  1R6R A;  2LKP A;  3C1D A;  3N05 A;  5CVV A;  5H6Q A;  2XAS A;  1K61 A;  3K4B A;  4CZC A;  3QPT A;  2Y69 H;  2CH0 A;  2Y31 A;  1TQM A;  1R1U A;  3H35 A;  1NK3 P;  2EV6 A;  1VTN C;  4A3F J;  2YX4 A;  3JRD A;  1YTY A;  1XDU A;  5BNG A;  2IS6 A;  3MEX A;  4BJT A;  1ULY A;  1X4P A;  3KEO A;  3RI4 A;  3TMO A;  2R92 J;  3IKT A;  1XMK A;  2F5E A;  2RQQ A;  1MBJ A;  3R61 A;  2KRC A;  2OPT A;  1N75 A;  2VPR A;  2CW0 F;  3HHG A;  2JPB A;  4A69 C;  1X3Z B;  1AKH A;  2E1M B;  2LBF B;  5J40 A;  2OV7 A;  2M30 A;  2JJ7 A;  2XAQ A;  3HSE A;  3K9T A;  2DMQ A;  2ELK A;  3W3C A;  2OC6 A;  4HF0 A;  2K85 A;  3DEE A;  2CQK A;  3MKW B;  4IHT A;  1WZ2 A;  3BQZ A;  4XK4 A;  1RRJ A;  3WHB A;  4RA2 A;  1ZGJ A;  1WJ5 A;  2EA2 A;  3BR0 A;  2PJP A;  1IGN A;  3E7L A;  2RGV A;  3BPV A;  1UMQ A;  4BGD A;  2VBX A;  4KDP A;  3TOA A;  5C4X J;  3E0J B;  4YEJ A;  2VOO A;  1JTX A;  2VKH A;  3BR1 A;  1SMY F;  3BG9 A;  1SVM A;  3DBH B;  3I4N J;  3BWG A;  1IW7 F;  2P5K A;  3DU5 A;  4BXF A;  1HDD C;  1DU6 A;  3PO2 J;  4PSW A;  4AM3 A;  3J7A Y;  4RLQ A;  4OIQ F;  3ABU A;  1ZG5 A;  3Q5F A;  3GX4 X;  3MKY B;  2VJI A;  1OQY A;  4KIS A;  4BXU A;  2DTR A;  3QOP A;  3FDY A;  3UKG A;  2DAO A;  3DLL F;  1GT0 C;  4IX7 A;  1XC5 A;  2DYS H;  3FKI J;  3HRM A;  4M6V A;  2HDD A;  3T8R A;  4U0Y A;  3PNV A;  2KIM A;  1AU7 A;  2HKX A;  3WTW C;  1WI3 A;  3JSO A;  1TW3 A;  4U7B A;  3KP7 A;  4BE1 A;  3BTJ A;  2G0E A;  1H0M A;  1X1A A;  3QPL A;  5EF6 A;  1FPQ A;  1OMI A;  3GWZ A;  1V3F A;  1P4A A;  1BOA A;  3FXK A;  4ANJ A;  4ZZL A;  2TCT A;  3M8F A;  2R7F A;  4HX7 A;  5HDK A;  3F8C A;  2MD0 A;  2XAF A;  2NNY A;  1T8I A;  4XSZ F;  4ZYE A;  4A2U A;  4FX4 A;  2E1M C;  1D3Y A;  4MLO A;  4NBQ A;  3FHN A;  4BEH B;  3LSP A;  4LLL A;  1ZYR F;  3K69 A;  3M8E A;  3DWL E;  3ZMV A;  4HV5 A;  1HBX G;  2VT2 A;  4F3Q A;  2UV1 A;  2GA1 A;  2JA8 J;  5LGU A;  2LTP A;  4RAF A;  3LSI A;  2R7W A;  3IWF A;  2OTJ I;  5DYM A;  3K7A J;  1BI0 A;  3U21 A;  2TRT A;  4N4O B;  2LFB A;  5GAD J;  3QPS A;  1JKQ C;  4GGG A;  2M0C A;  1I27 A;  3HIF A;  3L7W A;  3HGY A;  3KLN A;  1P4X A;  2XGX A;  2K7L A;  5IP6 A;  3CCV I;  2ZJ2 A;  3OYJ A;  1PJR A;  1ETO A;  2EQR A;  2R5Z A;  2V1U A;  2M9H A;  4CSW A;  3BC8 A;  5HLG A;  2HGC A;  4UV9 A;  1O7F A;  2NS8 A;  4MQV A;  2CG4 A;  4RB3 C;  3A1Y A;  4NUB A;  2G7U A;  5CQG A;  3G2B A;  2I5U A;  3HOZ J;  4EQQ A;  4ENN A;  2YPR A;  4DOZ A;  4M3G A;  1BI1 A;  4AID A;  3K4M A;  1FOW A;  1W7P A;  2W82 A;  4HA8 A;  2MC4 A;  2F5F A;  4CIC A;  4HNT A;  5LHI A;  1U8B A;  1GXP A;  3MN2 A;  5GPC A;  3CCQ I;  1U8R A;  1RPW A;  3CCE I;  4XBF A;  1TC3 C;  4Y17 A;  3A2K A;  5JHF A;  4LIT A;  4UY8 I;  1IDY A;  1X1D A;  3LA3 A;  2OU2 A;  5DV5 A;  2R5Z B;  1KQ9 A;  2RV8 A;  4F55 A;  1JKO C;  3CCY A;  4KMU X;  2LD5 A;  2EZL A;  2DA2 A;  3HC7 A;  2HXO A;  2CUF A;  2EIN H;  3OMY A;  1W1W E;  2XUB A;  4AVZ A;  1MW7 A;  2FBI A;  1BC8 C;  5DS9 A;  2H8W A;  3ZR8 X;  2K02 A;  4YFK F;  2IRF G;  4AU7 A;  1IUF A;  4P5O A;  5IYD J;  3A03 A;  3CLQ A;  4Q4Z F;  5HOD A;  4C2U A;  3HKZ A;  2Z99 A;  3S3N A;  4G7O F;  3I64 A;  1U2W A;  3BJO A;  3Q9V A;  3V8K A;  1GDT A;  3BT9 A;  5E1W A;  1Z6R A;  3ECH A;  1HF0 A;  3E5Q A;  4FTH A;  1PUE E;  5CKT A;  3G1M A;  5BPD A;  2P7V B;  1BOB A;  5FKN A;  5BMZ A;  4A3I J;  3N97 A;  5B3S H;  4EJU A;  5J8F A;  1IXC A;  4A3L J;  1IRZ A;  1OCC H;  1TLH B;  3GEZ A;  2R7S A;  4V2G A;  2DA1 A;  3WG7 H;  4PSX A;  4CXF A;  3EDP A;  3JTG A;  4UVA A;  4LMY A;  3VYR B;  3F8F A;  1HST A;  3E5X A;  3F8B A;  3MMY B;  4UXN A;  4ESB A;  2M8G X;  5IT9 K;  3F22 A;  5ICC A;  3H0D A;  2NVX J;  2QQ9 A;  3CMA I;  4WF2 A;  4BY1 J;  2VJ4 A;  3ZN0 A;  2Z2S B;  3DP7 A;  1J5Y A;  1RKT A;  1YE9 A;  1TWH J;  4XLC A;  1I50 J;  1GVJ A;  1ZAR A;  3IKV A;  3ROU A;  2O6G E;  1E2X A;  3FXU A;  2M7B A;  4IRI A;  1OCT C;  2R4G A;  2BXZ A;  2ZXJ A;  3C3W A;  1MMS A; 
#chains in the Genus database with same CATH homology
 3RKW A;  2H6C A;  2O8X A;  3ULQ B;  3LAP A;  1OYY A;  3WGI A;  1HQC A;  1ZN2 A;  3WTZ A;  3R60 A;  5LBQ A;  1YS7 A;  3HOT A;  2HKO A;  2ZNY A;  1H9T A;  1TW2 A;  4PGH A;  3L09 A;  3G3Z A;  4P96 A;  1XD7 A;  1R00 A;  4L5I A;  2FNP A;  1LEB A;  2M8E A;  2W85 A;  3TO7 A;  1WI9 A;  4EGZ A;  3RPQ A;  1BM9 A;  2PQ8 A;  4MQ9 F;  3WTY C;  4RGX A;  3FMR A;  3GLX A;  1T2K A;  2IA2 A;  1IRF A;  3V7C A;  2LDU A;  3DV8 A;  4OU0 A;  3B73 A;  4DQ2 A;  5FLX Z;  1Z91 A;  1OKR A;  4JBA A;  4PCQ A;  2W57 A;  4AIJ A;  4LK0 F;  5K5Q A;  3QRF F;  4NHJ A;  1R22 A;  4A6D A;  4QWQ A;  2DT5 A;  4EJV A;  1UHM A;  5E20 A;  1Z9C A;  2MD5 A;  3FM5 A;  2DK5 A;  4I01 A;  1HXD A;  2W25 A;  1R36 A;  2RNJ A;  2RKH A;  3MZY A;  3L2C A;  1ON2 A;  5D6E A;  2ISY A;  1R5H A;  3G73 A;  1ZLJ A;  1LJ9 A;  4OOI A;  1UHW A;  1Z6T A;  4ASN A;  4GYG A;  1IN8 A;  1SFX A;  3E3V A;  3K1N A;  2QM3 A;  4LG0 A;  3E6M A;  3KP4 A;  3ZP5 A;  1W4M A;  3GZ6 A;  3KZY A;  2AXL A;  1HW2 A;  2P6T A;  3TDU C;  4OIN F;  4ZZD A;  3CUQ A;  2Z5U A;  1YW9 A;  1J59 A;  5E1X A;  2VT3 A;  1JGS A;  2JTV A;  1MJA A;  5CYV A;  4LG0 B;  1K79 A;  5FFZ A;  2MA3 A;  1HKQ A;  3FMQ A;  1RI7 A;  3KE2 A;  1REP C;  2DQR A;  1O3S A;  1BC7 C;  2A68 F;  3CUQ B;  4KMF A;  4L9J A;  2QEN A;  1P92 A;  4KIC A;  1YO5 C;  4RGS A;  4BHP A;  2A6E F;  3F6O A;  4BYY A;  3OV8 A;  3BPX A;  3ZMS A;  3E6C C;  1C0W A;  5F6F A;  4EVI A;  1USS A;  2FMY A;  3W6K B;  2Y75 A;  3WTV C;  2E7X A;  2AS5 F;  2CFX A;  2X4H A;  4HF2 A;  3HRS A;  3T0Y A;  2WTE A;  2VBZ A;  2XV4 S;  1K7A A;  2GWR A;  2UXN A;  5LGN A;  1OYW A;  1KYZ A;  4G6Q A;  4YII A;  4RGU A;  1IRG A;  1K78 A;  4MEY F;  2D45 A;  5D5U B;  3B02 A;  3F72 A;  5DCF A;  3R6S A;  5ICG A;  3COA C;  2IA1 A;  1G3W A;  5HDN A;  4U0V A;  5A2Q K;  1T39 A;  4OIO F;  3TGN A;  2DW4 A;  4Y15 A;  4XLP F;  1ONV A;  1BIB A;  4IF4 A;  3CUQ C;  2CSO A;  1Z7U A;  3O6B B;  5ILS A;  4A0Y A;  2J5P A;  3LAJ A;  4I7H A;  2XAH A;  4HLX A;  5JI6 A;  3GUD A;  4S05 A;  2GQQ A;  4Q5S F;  2HFH A;  3GFM A;  1LVA A;  2YR2 A;  1DDN A;  1KQ8 A;  1ZLK A;  3SHF A;  4BH9 A;  1ZRC A;  2A3S A;  3F8N A;  2FRH A;  2KRF A;  2V1D A;  2PLY A;  2A61 A;  4IVN A;  4G9Y A;  1R58 A;  2MH9 A;  4LGW A;  5TRD A;  5D5V B;  3VFZ A;  3V8L A;  2UWM A;  4A5N A;  4WX9 A;  4ZYG A;  2MH2 A;  1KQ0 A;  1JXS A;  2ESN A;  2DK8 A;  3FHZ A;  4YFN F;  2D1V A;  3FZV A;  1WKM A;  2BGC A;  4M9S A;  1ODD A;  3WOD F;  4A0X A;  3P7N A;  1GHC A;  2EFO A;  2ZME A;  3KLO A;  1EH7 A;  4XRF A;  3MAJ A;  1J75 A;  1YQA A;  1DUX C;  4G7Z F;  4EM0 B;  1KU2 A;  4N0B A;  2L01 A;  1XDS A;  4L5J A;  5H20 A;  3RPU A;  2STT A;  3CUO A;  3J80 K;  1U5T A;  2MC3 A;  2ZME B;  3W6J B;  3FMS A;  1LNW A;  3NQO A;  4O6J A;  1SMT A;  1W7P D;  1FBQ A;  2DBB A;  5EEG A;  2XAJ A;  1QGP A;  4WXH A;  3LST A;  4P55 A;  5HS7 A;  3K1M A;  1QQI A;  5J8C A;  2WWY A;  3JAM K;  3GO5 A;  1QNT A;  4CGZ A;  3HYI A;  2Q2E A;  5ICE A;  3QP6 A;  4I0B A;  2W84 A;  1FBS A;  1EV7 A;  1XSV A;  2KKO A;  4HX4 A;  1IF1 A;  3WGH A;  4KN7 X;  3HHH A;  1XGO A;  2DQL A;  5D4S A;  2PN6 A;  1FP2 A;  1B59 A;  4EM2 A;  1J2X A;  1WRJ A;  2M1B A;  5DUK A;  3TO6 A;  1FYM A;  2OQG A;  3IRR A;  5DDG A;  4UVC A;  3F6V A;  1BI3 A;  3EET A;  3HRT A;  3GFI A;  4YIF A;  2GIV A;  3CO7 C;  1RIO H;  2STW A;  3BRO A;  2OBP A;  1LB2 A;  1OPC A;  3KP3 A;  1TNT A;  2XKP A;  2VE9 A;  2P4W A;  4LB6 B;  2FQ3 A;  2ELH A;  2GXB A;  1Y0U A;  3V7R A;  1FT9 A;  3SQN A;  3QAH A;  2EFQ A;  1UFM A;  5IT9 Z;  5HLI A;  1QBJ A;  2ISZ A;  5JFR A;  1U5T C;  3KP6 A;  2VON A;  1CGP A;  2QLZ A;  2HYG D;  3H3Z A;  3M9A A;  4FHT A;  3GW2 A;  1AWC A;  3LA2 A;  2EFN A;  2OQR A;  1MZB A;  2Q8K A;  2UZK A;  4I09 A;  2BBY A;  3V4G A;  4G6D A;  2V1X A;  3MWM A;  2RQP A;  3I58 A;  5CVU A;  2HDC A;  2EK5 A;  3IC7 A;  2NNN A;  3SFZ A;  1P4W A;  4Q47 A;  1MD0 A;  3TOB A;  1DPU A;  1UB9 A;  2G7H A;  5K5O A;  4WWC A;  1SD6 A;  4HF1 A;  1F9N A;  1NHA A;  3RDI A;  4M71 A;  1IZ1 A;  5IT3 A;  4UNO A;  2C6Y A;  4AIH A;  3HOS A;  4BNC A;  4EJT A;  2FU4 A;  4M72 A;  1Q1H A;  1W7P B;  4M9X A;  1KU7 A;  5H6R A;  4KN4 X;  4OIR F;  2OZ6 A;  1K6O A;  1YS6 A;  1FNN A;  3N4M A;  3J7A O;  3I53 A;  3P9C A;  5CVJ A;  2FML A;  3S2W A;  2P5L C;  2IJL A;  4EJO A;  1PDN C;  4BQA A;  1R23 A;  2DI3 A;  4GO1 A;  2OAZ A;  5D6F A;  1RUO A;  3KP2 A;  4F7Z A;  2ZCW A;  5LHH A;  4NB5 A;  1PP8 F;  5LRS A;  3CO6 C;  2XIG A;  2P7C B;  4RB0 A;  2Q0O A;  2XHK A;  3BP8 A;  5BS6 A;  1G6N A;  3T5X A;  1L0O C;  2HTJ A;  1T98 A;  4HQM A;  3L00 A;  3KP5 A;  3D0S A;  4LFU A;  3H3U A;  4N9H A;  2PFB A;  5LEJ A;  3IL2 A;  4BAY A;  1IUY A;  4GXO A;  5K1Y A;  3RIR A;  4CYD A;  2QQA A;  2JRT A;  2D2W A;  1IXR C;  4LK1 F;  1T0F A;  3QPH A;  1ZG3 A;  1W5S A;  4UHT A;  1KA8 A;  3FXR A;  2H27 A;  3WTU C;  2HQR A;  3ZN1 A;  3GYH X;  3SXY A;  1A04 A;  4Q48 A;  4KNY A;  3I59 A;  3MFK A;  2ADU A;  2FXA A;  2VE8 A;  5CVR A;  3H92 A;  4E70 A;  2X0L A;  5L3D A;  2QQB A;  2W24 A;  2NS0 A;  1S7A A;  1D8J A;  2LSO A;  2IA0 A;  1QO0 D;  2HS5 A;  3WTX C;  1E17 A;  3RYR A;  4FX0 A;  3I71 A;  4JK1 X;  4HLY A;  4NQW A;  2GA2 A;  3ML6 A;  4A0Z A;  1YIO A;  3L9F A;  2EFP A;  2EJR A;  4RB2 C;  1U3E M;  3AAF A;  1V4R A;  2PEX A;  1S7O A;  3GXO A;  2VC0 A;  1B6A A;  4IRG A;  1G3S A;  3VOD A;  1BJA A;  2K27 A;  4YG2 F;  3DKW A;  2GXG A;  2P8T A;  2Z33 A;  4OIP F;  5DD4 A;  2QUF A;  4B8X A;  4D0P A;  2F2E A;  2H09 A;  4LLN A;  1F1Z A;  4I0A A;  2O3F A;  2XRN A;  3EYI A;  2LNB A;  3GZ5 A;  5ERI A;  5LHG A;  4ETS A;  3ZMU A;  1FY7 A;  1G4D A;  2E1C A;  1LDK B;  5LRR A;  2JT1 A;  1O3R A;  3VB2 A;  4ZH4 F;  3DQV C;  1RUN A;  1YW7 A;  1YYV A;  1R5G A;  2KIF A;  5HS9 A;  1ON1 A;  1XMA A;  2L4M A;  4RS8 A;  3KZZ A;  3VOE A;  2V79 A;  3TO9 A;  3RKY A;  1O57 A;  4WXD A;  4ENJ A;  3BJ6 A;  3RJP A;  4I98 B;  4ESF A;  3LFK A;  3QU6 A;  2COM A;  1S6L A;  4EMS A;  4PZJ A;  1YLF A;  2H94 A;  1ZH5 A;  2CYY A;  2VXZ A;  3DFG A;  5DCM A;  2VBW A;  1STZ A;  2IW5 A;  1UST A;  5E18 F;  4AWX B;  5LLQ A;  1H9G A;  2FE3 A;  2FBH A;  4HBL A;  1BIA A;  2E7W A;  4M74 A;  3TDZ C;  2F5D A;  4IPA A;  3FM3 A;  2BEO A;  4JQF A;  3VEP A;  3I54 A;  3HRU A;  3WU1 B;  3GVA A;  5HLH A;  5DCM B;  3RTR A;  2PBI A;  5F64 A;  3KFW X;  4EJW A;  1JE8 A;  3T1B A;  1XGS A;  3ELK A;  3DF8 A;  1EH6 A;  3IHU A;  1G3T A;  2GAU A;  3J80 Z;  5BQT A;  3KEQ A;  1EH8 A;  1Z1D A;  1K78 B;  2VOD A;  3M7G A;  2O0Y A;  3RKX A;  2QYO A;  4BHC A;  2A07 F;  3P9I A;  5CVI A;  5ILV A;  4OMY A;  2XAG A;  4QLC U;  3HTS B;  1T6S A;  1R7J A;  2NYX A;  4OMZ A;  4R79 A;  4RB1 A;  3JAM Z;  4HZF A;  4HX8 A;  5ED4 A;  1J7K A;  3LQR A;  4P9U A;  1S3J A;  1ZHF A;  3J81 K;  1X3U A;  1L3L A;  4KYW A;  1U6G A;  3LWF A;  1Z05 A;  4UVB A;  5DD8 A;  4GCV A;  5FD5 A;  2VC1 A;  2O61 A;  4KIG A;  3WTS C;  5HS8 A;  1XGM A;  1I1G A;  2EFW A;  4I2O A;  5JHU A;  1BN5 A;  2NRA C;  2TDX A;  5AIQ A;  2XKO A;  2A6H F;  1ZGA A;  2EWN A;  3IWZ A;  3FWE A;  2ESH A;  3CJN A;  2CO5 A;  3GFJ A;  2GZW A;  5HDG A;  5L3C A;  4ENM A;  3U2R A;  1FLI A;  2BYV E;  4GYI A;  5TJJ A;  5HOO A;  2M45 A;  2V6C A;  1O7L A;  3IRQ A;  3E97 A;  4RAZ A;  3V7S A;  3R0A A;  4KA4 A;  4U88 A;  3HUG A;  4R8H A;  3CLO A;  3WG9 A;  1SD4 A;  3F8M A;  4XLN F;  2DPD A;  4L9V A;  5L3G A;  3ZMZ A;  3REO A;  4HDU A;  2Z9O A;  3I0T A;  4KIB A;  4WK8 F;  1U5T B;  1MJ9 A;  5D8L B;  5J6X A;  1D5V A;  5DEQ A;  3HSF A;  1S29 A;  1ZRF A;  4MHG A;  1IXS B;  1FSH A;  1SD5 A;  1LEA A;  3U1D A;  5KK1 A;  2QVO A;  4ON0 A;  1SFU A;  1XGN A;  3HTU A;  5DUI A;  4MGR A;  4S04 A;  2OA4 A;  2HTS A;  1R1V A;  1QZY A;  2PMH A;  1I5Z A;  2O03 A;  2ETH A;  1BBY A;  1LQ1 A;  3NEU A;  5ICF A;  3O2P E;  1MDM A;  4M6X A;  2K86 A;  2V9V A;  5FD6 A;  4CDG A;  2FEZ A;  3DPL C;  3LA7 A;  4EV0 A;  4G94 A;  1HKS A;  2DLL A;  5E8G A;  4Z2Y A;  3KET A;  4MTE A;  4KFC A;  3DPT A;  4L9N A;  1I1S A;  3FX3 A;  2ZFW A;  1MDM B;  1F4K A;  1RZ4 A;  4HV6 A;  2WV0 A;  1KYW A;  1BI2 A;  4KUM A;  1TTY A;  3MQ0 A;  1IN6 A;  3O3K A;  5LGT A;  1KU3 A;  2L3D A;  3E6B A;  2D1H A;  1GXQ A;  5CLS A;  2IVM A;  2B0L A;  4MEX F;  2P5V A;  4N9I A;  5FO5 A;  4B09 A;  1WQ2 A;  2PG4 A;  1HW1 A;  4ZYH A;  3ERE D;  3K0L A;  4O3M A;  2VOP A;  2JPC A;  3WE3 A;  3CTA A;  1MJB A;  1CF7 A;  1XB4 A;  2ACJ A;  4TV7 A;  4Y13 A;  3RYP A;  1FYL A;  4R1H A;  1I6X A;  2FBK A;  3MCZ A;  1J9I A;  4BHB A;  2HQN A;  2PMU A;  2JSC A;  3NRV A;  3WTT C;  1SD7 A;  1B9N A;  1WWX A;  2VBY A;  3R0J A;  5CJ9 A;  1CF7 B;  5E1Z B;  3D5L A;  4U7D A;  1DP7 P;  1TQP A;  5AIP A;  1LDD A;  5E17 F;  3JW4 A;  2ZNZ A;  4P9F A;  3E5U A;  1HSJ A;  2Y48 A;  4M73 A;  2YSR A;  2QBY A;  1MKM A;  3DEU A;  3EUH A;  1PP7 U;  3U9G A;  3T8T A;  3F23 A;  3WGG A;  2F5C A;  4ZYD A;  3E6D A;  1UCR A;  2DU9 A;  1F5T A;  2FA5 A;  1P2F A;  5L3B A;  3SZT A;  2DO7 A;  1ZAO A;  1KGS A;  4EGY A;  4HYE A;  1B4A A;  3SZP A;  5D8K B;  2QBY B;  1OYI A;  3OOP A;  3ABT A;  4HOB A;  1U78 A;  4KT5 C;  2RN7 A;  3BZ6 A;  4MTD A;  3LQQ A;  2RC4 A;  1FP1 D;  1FZP B;  2ZKZ A;  1D8K A;  1DPR A;  1TNS A;  5FFX A;  3JTH A;  4WCG A;  1OR7 A;  3ZMT A;  1SFE A;  2FSW A;  5AON A;  5KVR A;  4CO8 A;  1QPM A;  2YX7 A;  3BOQ A;  2HR3 A;  3R4K A;  4L9T A;  2K4B A;  3TQN A;  1FC3 A;  2E1N A;  2OD5 A;  2A69 F;  2MLK A;  3F21 A;  3ZPL A;  4MNU A;  5HVQ C;  2R7D A;  1XCB A;  4L0Y B;  4EM1 A;  4YFX F;  2P6S A;  2Z3Y A;  2G9W A;  3P9K A;  4LLG F;  5BPI A;  4HW0 A;  2L54 A;  3I59 B;  5JR3 A;  3FXQ A;  1YG2 A;  2K4J A;  1WSU A;  4IXA A;  2KJB A;  2EB7 A;  2QWW A;  3K1P A;  4AVP A;  5E8I A;  2HWV A;  4G8X A;  5FB2 A;  3C7J A;  4AIK A;  2IPQ X;  4U0W A;  1ZG1 A;  2MBF A;  2M87 A;  3Q9S A;  3ZMD A;  1LDJ A;  4M6Y A;  3DXJ F;  2KJC A;  2Y0M A;  1IN5 A;  2LF7 A;  1FX7 A;  3GF2 A;  5JVT A;  2UXX A;  3WU0 A;  1XN7 A;  2M5W A;  4FT8 A;  4AD9 A;  2HOE A;  4IHS A;  1RNL A;  1FOK A;  1B9M A;  3ISP A;  5D5W B;  1AOY A;  2KIU A;  2RVC A;  2R3S A;  2EA4 A;  3BJA A;  4HDV A;  4LB5 A;  4ESJ A;  2DPU A;  1KU9 A;  3V8J A;  2XRO A;  1ZRD A;  3C3W A;  1XSX A;  5A2Q Z;  4I02 A;  2FF4 A;  1HKT A;  5L3F A;  4RAY A;  2HYF A;  1TBX A;  1MGT A;  2EV0 A;  3BY6 A;  4LD5 A;  1IN4 A;  3M1E A;  3ECO A;  5EEH A;  2A5Y B;  1TQI A;  2YU3 A;  2CGP A;  3KCC A;  3JSP A;  2OZU A;  4PDK A;  3CDH A;  5K5R A;  1FSE A;  4KIF A;  5FLX K;  1HW5 A;  3I4P A;  2BE5 F;  3C18 A;  1SAX A;  3J81 Z;  1B1B A;  3EQL F;  2HZT A;  3QU3 A;  4XSX F;  1R1T A;  5LEK A;  3PQJ A;  5D5X B;  2ZBK A;  2FNA A;  4IRH A;  1O3T A;  1T38 A;  3HSR A;  4K2E A;  5L3E A;  4H0E A;  2FOK A;  1JHH A;  2RDP A;  3EYY A;  4A5M A;  1YFH A;  2QZ8 A;  2HEO A;  4A6E A;  4IJA A;  3WE2 A;  1IAW A;  3K2Z A;  2WC2 A;  4O5V A;  5ILU A;  3MZH A;  3GFL A;  5FGM A;  2L02 A;  1XSD A;  4CZZ A;  1IN7 A;  1JHF A;  4HAM A;  4M9Z A;  5D4R A;  2LF8 A;  3PFI A;  2PI0 A;  3TKY A;  4L18 B;  5F1R A;  4LJZ F;  4RGR A;  1YW8 A;  1FWZ A;  6PAX A;  4G7H F;  4UUV A;  1QZZ A;  4WXC A;  4A12 A;  1ZRE A;  5BOX A;  3F3X A;  2CWE A;  4DNC A;  3QP5 A;  3I5U A;  4PGG A;  4CHU A;  2MLG A;  3ZQ7 A;  4HQE A;  4ENK A;  2J5O A;  4L0Z B;  2IP2 A;  1P6R A;  2JZY A;  2ZO4 A;  2BV6 A;  1J0R A;  1FBU A;  1G3Y A;  2DFI A;  2VN2 A;  2IT0 A;  1XCV A;  2NAZ A;  1O3Q A;  3FF5 A;  2L4A A;  4UV8 A;  1W5T A;  2H6B A;  3BDD A;  2EV5 A;  2XVC A;  1S8N A;  1FYK A;  2LKP A;  3C1D A;  5CVV A;  5H6Q A;  2XAS A;  3QPT A;  1TQM A;  1R1U A;  2EV6 A;  1VTN C;  2YX4 A;  1YTY A;  1XDU A;  3MEX A;  1ULY A;  3KEO A;  3RI4 A;  3IKT A;  1XMK A;  2F5E A;  3R61 A;  2CW0 F;  3HHG A;  2JPB A;  2M30 A;  2XAQ A;  3HSE A;  3K9T A;  4HF0 A;  2CQK A;  4IHT A;  1ZGJ A;  2EA2 A;  2PJP A;  2RGV A;  3BPV A;  2VBX A;  4KDP A;  3TOA A;  2VOO A;  1SMY F;  3BWG A;  1IW7 F;  2P5K A;  4OIQ F;  3ABU A;  1ZG5 A;  3Q5F A;  3GX4 X;  4BXU A;  2DTR A;  3QOP A;  2DAO A;  3HRM A;  3T8R A;  4U0Y A;  2KIM A;  2HKX A;  3WTW C;  3JSO A;  1TW3 A;  4U7B A;  3KP7 A;  1H0M A;  1FPQ A;  1OMI A;  3GWZ A;  1V3F A;  1P4A A;  1BOA A;  4ZZL A;  3M8F A;  2R7F A;  4HX7 A;  5HDK A;  3F8C A;  2XAF A;  2NNY A;  4XSZ F;  4ZYE A;  4A2U A;  4FX4 A;  1D3Y A;  4LLL A;  1ZYR F;  3K69 A;  3M8E A;  3ZMV A;  4HV5 A;  1HBX G;  2VT2 A;  2GA1 A;  5LGU A;  3IWF A;  5DYM A;  1BI0 A;  4GGG A;  1I27 A;  3HIF A;  3L7W A;  3KLN A;  1P4X A;  2XGX A;  2K7L A;  2ZJ2 A;  2V1U A;  5HLG A;  2HGC A;  4UV9 A;  1O7F A;  4MQV A;  2CG4 A;  4RB3 C;  2G7U A;  4EQQ A;  4ENN A;  2YPR A;  1BI1 A;  1W7P A;  1GXP A;  4HA8 A;  2F5F A;  4CIC A;  5LHI A;  1U8R A;  4XBF A;  4Y17 A;  3LA3 A;  2OU2 A;  5DV5 A;  1KQ9 A;  2RV8 A;  4KMU X;  2XUB A;  2FBI A;  1BC8 C;  2K02 A;  4YFK F;  2IRF G;  4P5O A;  4Q4Z F;  2Z99 A;  4G7O F;  3I64 A;  1U2W A;  3BJO A;  3Q9V A;  3V8K A;  5E1W A;  1Z6R A;  3ECH A;  3E5Q A;  1PUE E;  5BPD A;  2P7V B;  5BMZ A;  3N97 A;  4EJU A;  5J8F A;  1IXC A;  1TLH B;  3GEZ A;  4CXF A;  3EDP A;  3JTG A;  4UVA A;  4LMY A;  3F8F A;  1HST A;  3E5X A;  3F8B A;  4UXN A;  4ESB A;  5IT9 K;  3F22 A;  5ICC A;  2QQ9 A;  4WF2 A;  3ZN0 A;  3DP7 A;  1J5Y A;  1GVJ A;  1ZAR A;  3IKV A;  3ROU A;  2O6G E;  1E2X A;  3FXU A;  4IRI A;  2ZXJ A;  3PQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...