2PMZN

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 7
structure length 64
sequence length 64
chains with identical sequence Y
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2pmzN00
1R9TJ 3W6VA 3S1MJ 5M5WJ 1DU6A 2YS9A 2O8KA 4EEFG 3A01B 3HEFA 2XSDC 3M3YJ 3RQIA 2EZKA 5EDNA 1NTCA 4XRSA 3GTQJ 1IDZA 2ID3A 4B4CA 4MO7A 3ZQHA 5J1YA 4S0HB 1MBKA 2RAEA 3GTPJ 2LTPA 1JJ6C 4JX6A 4AUXA 5BNGA 2PMZN 2R5YA 1HOMA 2QF7A 2DA3A 3FK6A 3Q0UA 1E3OC 4A3LJ 5FKLA 2MSYA 2LKXA 2LVSA 3DEWA 2FJ1A 2JN6A 5EF6A 2XB5A 5EGOA 3SJMA 2NS7A 3BR3A 1FIAA 2AHQA 3GTJJ 1MSFC 2L9RA 1U9OA 1IG7A 2EZLA 1RPWA 3RZOJ 1VI0A 2CUEA 3O8GA 1TWFJ 5IYDJ 4M3DA 4BY7J 2R5ZA 5IOYA 1JUSA 2G0EA 3LSPA 1AHDP 2FQ4A 1ZGWA 3TW7A 1MH3A 1ETQA 1APLC 3BTJA 1ITYA 1HLVA 2VKVA 1MBHA 3HB9A 2MGQA 4XIDA 4JX4A 3G1LA 2DA4A 3BT9A 3FK7A 5EG0A 2DA5A 2JWTA 5EGOB 3S1NJ 2NS8A 1LFBA 1DU0A 4FE4A 5FLVA 3QQAA 1B8IA 1TWCJ 1I6HJ 3JREA 3S15J 3LSGA 2R0QC 2K9NA 3BG3A 5GPCA 2HDDA 4Y7NJ 2R5ZB 3H0GJ 4BXXJ 1ZR2A 3WHBA 2E2HJ 3GTKJ 3O8HA 3NARA 1X58A 4V2FA 5M5YJ 3LNQA 2L7ZA 3HOZJ 4A3MJ 3A03A 2ME0A 2IEKA 4L5EA 2XRLA 4XICA 5F0FA 2OF7A 2L7MP 1RR7A 3BQYA 2GBYA 2HQ5A 5FKMA 2GM4A 1LE8A 3HM5A 1JJ8C 1BA5A 1MBGA 1AU7A 1F43A 5EYRA 1JKQC 3K7AJ 4D5CA 2DMQA 4J19A 4MFDA 4A3KJ 2QCOA 1QPIA 1OFCX 1B8IB 9ANTA 3K2AA 1OCPA 4M6VA 5FKOA 2Y9YA 5FKNA 4M3EA 3S17J 1OJLA 3TP3A 4QTRA 1HCRA 1HDDC 2EH3A 5GPAA 2JMWA 3CDLA 2LR8A 4DW6A 4IHWA 2CQQA 4RBOA 4IHXA 2E1OA 1ETYA 3OIOA 5IP7J 5E3NA 3S16J 2XPWA 1T56A 1H89C 4BKXA 2DMUA 5K7ZA 2N8GA 5J3LA 1FIPA 4A3GJ 1LE8B 3GBGA 4JYKA 2X9DA 4X1EA 1ZQ3P 4A3EJ 1P7JA 1UHSA 3BTIA 1B72A 4UUTA 2XGCA 3BG5A 2DJNA 3IH3A 1HDPA 1JKOC 3BR5A 2NVYJ 1F36A 1ENHA 2TCTA 2HYJA 2OPTA 2ID6A 4IHYA 2DA2A 4C3JJ 3HBLA 3S2DJ 5E3OA 5F27A 1A6IA 1ETVA 5IP6A 3Q3SA 2I10A 1A5JA 4XRSG 3ZQIA 3BTCA 2X48A 2NVXJ 2IBDA 1G2HA 3MKLA 3SFIA 1RETA 2WB1N 3MN2A 2X6OA 1UMQA 3HOXJ 4BBSJ 1WGXA 3PO2J 2H8RA 2DTZA 4AC0A 4X6AJ 1NK2P 2Y31A 1JT0A 1GDTA 2VI6A 3ZQGA 1VF9A 2E2IJ 4GFBA 3GTMJ 1TWAJ 3SDGA 1ZK8A 1QRYA 1B72B 2E2JJ 1QVTA 2DMTA 1SFOJ 2ECCA 5F0HA 4A3JJ 1X2MA 5IP9J 1UG2A 5IYBJ 2R92J 3LOCA 2Y30A 3TP0A 3S1RJ 2R93J 1I3QJ 2LLKA 5IYCJ 2CQXA 3NAUA 1LFUP 3JR9A 3HOUJ 1GUUA 4A69C 1GT0C 1W0TA 3M4OJ 1ETOA 2M0CA 2VKEA 1U8BA 1Y1WJ 2L7FP 2CUFA 1VNDA 4FE7A 1XC5A 5EZHA 2WAQN 5C44J 3L1PA 3JRHA 3BR2A 1YRNA 4A3DJ 1HF0A 2Y0SN 3TEDA 3D1NI 5FLMJ 2NOGA 1TWGJ 2EBIA 4I76A 4ABZA 2LY9A 1FTTA 2ME6A 2K9SA 5K7HA 4LOCA 5EEAA 2W48A 2VPRA 1JTYA 2TRTA 3E7LA 2JA8J 3ZQCA 2JA6J 3RZDJ 2JJ7A 2Y2ZA 3OOUA 4DZJA 2O7OA 4M3BA 1W0UA 1MBEA 1ZTRA 2MW8A 2GLOA 4IEJA 4AYBN 2IAIA 4C2MJ 2LFBA 4QIWN 3VPRA 1TWHJ 4C3HJ 2NVTJ 2M2EA 1ETWA 1RESA 3S1QJ 3HGGA 1YRNB 1IV6A 1MBFA 4W1UA 3A02A 2CU7A 4A3IJ 3IH2A 2P81A 1ETKA 3TW6A 3JRAA 2XB0X 1POGA 1BJZA 4JP0A 1T33A 1GV5A 2DA6A 1MSEC 2HOAA 3JRIA 1Z77A 1FJLA 3GTGJ 5M5XJ 3BR6A 3BQZA 4M3GA 3LSJA 1FTZA 1P7IA 1IC8A 1JTXA 4A3CJ 1U9NA 1K83J 3GTLJ 3S14J 2KT0A 1AKHA 4MFEA 4XK4A 5M3MJ 1IGNA 2EZIA 4FTHA 4IHVA 3BR0A 3G1MA 1CQTA 4G12A 3HOYJ 3GTOJ 3I4MJ 4FCYA 5J1UA 2XGDA 1H8AC 2YUSA 3CMYA 1PUFA 1D5YA 3S2HJ 2K9QA 1IRZA 3C2BA 5FKKA 5K7FA 2LK2A 1Z0XA 5EZGA 4JX5A 2LD5A 2AO9A 2XPUA 3PM1A 5C4XJ 1QVUA 2FD5A 2M34A 1OCTC 1WI3A 5HODA 1WCMJ 4CYCA 2KDZA 1BL0A 2B63J 4V2GA 1O4XA 4A3BJ 2HOSA 3JRBA 3PO3J 2DN0A 2NVQJ 5DS9A 5C4JJ 2HXIA 3HGYA 1MNMC 4DZPA 5F0CA 1WH5A 1GV2A 1IUFA 4DYCA 1JUMA 1AKHB 4B1RA 1ORKA 2DMNA 1NK3P 1TC3C 2R7ZJ 3QPSA 4A93J 1WH7A 2M8GX 2XGEA 5JLXA 1JT6A 4HNVA 5J1RA 2EQRA 3HOVJ 4MLOA 5JLWA 3Q0WA 1XS9A 1MBJA 5E3LA 3OSFA 1PUFB 5M3FJ 2JK3A 2L0KA 1Q1VA 2ECBA 4C3IJ 4I6ZA 1BW5A 1ETXA 1S7EA 3MVPA 5E3MA 3CQZJ 3JRFA 2FX0A 5F1JA 4RDUA 4D7NA 4CYCB 3IV5A 3B6AA 3HOWJ 3G1OA 2HXOA 2R5YB 3OSGA 1EF4A 5DTDA 5IPAA 4D5FA 2VUMJ 1XG1A 1JKPC 2CJJA 3JRCA 4D7MA 1GVDA 2O9LA 5F04A 2DA1A 3FKIJ 1IDYA 1JKRC 4DYRA 3LSRA 4NDLA 2YU9J 3FIWA 4BBRJ 2CRGA 1ZKGA 2JA7J 1U78A 4A3FJ 4BY1J 3JRGA 1I50J 4Y52J 2HI3A 4B3AA 2Y9ZA 2DMPA 4UUSA 3ZQFA 5IOZA 4FISA 1SANA 1ZR4A 4M3FA 1K61A 2DA7A 3F0CA 1Y1VJ 3BTLA 4MIMA 2JA5J 3HDDA 3BR1A 3IH4A 1IJWC 2MG4A 3DCFA 2COBA 2XPVA 3ZQLA 1FEXA 3BG9A 1WPKA 5C3EJ 3ZOBA 3I4NJ 1JUPA 2ELKA 3FISA 3A01A 1BW6A 3WHCA 3CCYA 3RKQA 5GP9A 5F08A 5EG0B 2WV1A 3UKGA 1VFCA 1RKTA 4W97A 1MH4A 3QPLA 2D5VA 2M9HA 2K40A 4UUSB 3B6CA 1JGGA 4XRMA 3Q0VA 4DYQA 2HOTA 1RKWA 2EZHA 5FJ8J 2H1KA 2ZB9A 3H3VK 2LP0A 1H88C 4QSHA 1X2NA 2E19A 3JRDA 3HKZN
chains in the Genus database with same CATH superfamily
3W6VA 1XTAA 1AWCA 3LWFA 3AG2H 3HUGA 2MA3A 4XLNF 4B48A 2V9PA 2O8KA 3M8FA 4EEFG 1Q1HA 2WV0A 2XSDC 4MNUA 4BXFA 2EK5A 4RGUA 3ZR8X 3OS0A 5EDNA 2AQFA 3OYJA 5ERIA 2P5VA 5KAIC 3DTEA 1WVRA 4ZYDA 1BN5A 3COAC 2HS5A 4E7HA 1FMVA 1YYVA 2HGCA 2R7OA 2XV4S 3VWBA 2XHKA 4HQEA 1MJAA 2EWNA 2R7FA 2VKHA 4I98B 2VJIA 3FK6A 2K02A 3K9TA 4L18B 1XSXA 3GXOA 4IOAF 3D5LA 1G3TA 1USSA 2AXLA 3AAFA 4HYEA 2X6XA 3ESWB 3R0JA 1X3WB 2JN6A 4A6DA 4BQQA 1P9QC 5LEJA 1LNWA 2LH9A 4EV0A 2DFEA 1D5VA 1EH7A 1FSHA 3GFIA 5EGOA 3SJMA 4G8XA 5FGMA 2WADA 4EQQA 2K7LA 2WC2A 3R61A 2FA5A 2EINH 1VI0A 1MMDA 3O8GA 3K4MA 1DPRA 3P7NA 4KMFA 2B7EA 3G3ZA 2CFXA 4RMNA 4XN3A 5IYDJ 2VQHA 4MTEA 2R5ZA 2KRHA 1TL8A 2VXDA 3V42A 3I9V2 3OMYA 3H36A 3ECHA 3OYIA 2G0EA 1YQAA 1D0ZA 2XAGA 3TW7A 1DGWY 1MH3A 1SFEA 3OYKA 2QQ8A 2E1MB 3GFMA 3D5SC 2ELHA 1WJCA 2NNYA 4O3MA 3HB9A 2MGQA 2DOAA 1Z21A 5CJ9A 3BT9A 4OMZA 3AKZA 5E17F 3E6MA 4A12A 3ELKA 2FNAA 4PFPA 1N75A 2RV8A 4KITB 2W00A 5IT9K 1TWCJ 2W82A 3L00A 4ZDPA 2FNPA 2KZVA 3BG3A 4LLGF 1T95A 1YS6A 4ENJA 3QP5A 4CZZA 3H0GJ 2Z2SB 3KP5A 3QOPA 1BI1A 3PIOF 4R79A 3MMYB 2UV1A 1D1AA 1YTYA 3HOZJ 4ASNA 2STTA 5L3DA 3TDUC 2ME0A 3GZ6A 2IEKA 4XICA 3F8NA 3HG9A 4F7ZA 2L7MP 5F6FA 4M9ZA 2ESNA 4D1QA 2HQ5A 3JW4A 2IRFG 3TO6A 3R60A 1X1AA 3I3LA 3EYYA 4GGGA 4RM2A 3HM5A 1BA5A 1OR7C 4XM3A 3QOEA 1F43A 3SYTA 5EYRA 1JKQC 1K79A 4D5CA 2DMQA 1S29A 1OQYA 2ETHA 1B9MA 4PGHA 4A3KJ 2JSCA 1B8IB 5FKOA 2M30A 4ZH4F 1QHHD 5CVJA 1I6XA 3TMOA 1FP2A 4EM0B 3I55I 3KLOA 1HDDC 2EH3A 3N05A 3ULQB 3CCSI 3F22A 3ABKH 3SEQA 2JMWA 3CDLA 2LR8A 3ABUA 4DW6A 4RBOA 3JSOA 2M1BA 2VE8A 1LPQA 2XPWA 1T56A 3KEOA 1NG6A 3GLXA 3HPGA 3ABTA 5DUIA 1H9TA 4BJ6C 4ZYHA 3H5RA 5ILVA 4EVIA 4HBLA 4V19K 2DLLA 2LOOA 5J3LA 1PJRA 1LE8B 2X9DA 1ZQ3P 1UHSA 2Y75A 4XNFA 2OBPA 3K1NA 1CGPA 4BXUA 4PFOA 2BZTA 3BR5A 2VIXA 2H94A 2NVYJ 2HZTA 4B44A 3QPTA 2MFZA 1IN6A 4HZFA 3KP2A 2GOMA 1J5YA 5E79C 2X1EA 2XC7A 4M6YA 4C3JJ 1W36C 1YX5A 5E3OA 3BCBA 5F27A 1SVLA 5IP6A 2I10A 1A5JA 3QWLA 3ZQIA 3BTCA 3KP7A 3CCJI 2NVXJ 2IBDA 3R6SA 4E7LA 4UV9A 2ZMEC 1R5ID 2WB1N 2DJIA 1R1UA 2EA2A 4BBSJ 1QZZA 1OYWA 2PJPA 1BBYA 1G4DA 4IHTA 1EKEA 4CHUA 4XN0A 4I0AA 1WQ2A 3IL2A 4IOCF 1S5LC 3KFWX 1J7KA 4RGXA 3VYUB 2E2JJ 3H3ZA 4FHTA 1QVTA 5J8FA 2HVSA 3E5UA 2ISZA 3DPUA 2ECCA 2OV7A 1X2MA 1UG2A 2F5DA 5DM7F 3TKYA 4I09A 2Z3YA 4M73A 4YEJA 3L7WA 5HS9A 3OYAA 2LLKA 3KCCA 4UHTA 3HOUJ 2OCCH 2CV2A 2XASA 4HNTA 1DP7P 4HX8A 2A6EF 3VOEA 2VKEA 1U8BA 2L7FP 1YG2A 3U1KA 4Y33A 4FE7A 2A61A 2WAQN 5C44J 1B1BA 1HKTA 2EFOA 2XIGA 3UR3C 3OYHA 3I56I 3BWGA 1P6RA 3PQJA 5FLMJ 3D1NI 2NOGA 4BACA 2HTJA 2EBIA 3EDPA 2QSFX 2K9SA 2DAOA 3DTKA 5GTHC 3FX3A 3PUBA 1TT5B 3BJAA 4D0PA 4ZC3A 1R22A 2IXSA 5EEHA 2JA8J 1ZRDA 5B3SH 5JFRA 1IF1A 2JA6J 3RZDJ 3UNGC 4IL6C 1VTNC 2R7XA 3KPHA 2KIFA 2W57A 2JJ7A 5CKTA 4EGZA 3A2KA 4BNCA 3RKYA 3ZMTA 2IA2A 4LJZF 1GHCA 5LHIA 1SMYF 3MKZA 3OR2C 3H35A 4AYBN 4BE1A 2F5VA 3F21A 3HZJA 2IGNA 2GXAA 3GF2A 3J7AO 1TWHJ 2KZGA 3B02A 4C3HJ 3C3WA 2GXGA 4U7DA 2AQEA 4GCVA 4A5NA 2X1CA 4C30A 2BHYA 1DUXC 1OLTA 3IH2A 4XQFA 3JSPA 1PDNC 1DGRM 3MFKA 3DV8A 2DOFA 2LMDA 1LDDA 5AIQA 2ZXJA 1IV8A 2Y48A 2RNJA 3LL7A 1MNEA 4I7HA 3RSNA 1T33A 4BDZA 1NH3A 2MBFA 2DA6A 4B8XA 5HLGA 3ISPA 3JRIA 1Z77A 1ZLKA 3CP2A 2ZFWA 3PSFA 1IW7F 3LSJA 1FTZA 5FLXK 2IS4A 1MW7A 5D5VB 2ZMEB 1Z9CA 1W4MA 4E7JA 2G9WA 1U9NA 5FRMA 1HKQA 3W6KB 3S14J 1AKHA 4XORA 1ZGJA 4ZYGA 1QPMA 4OIRF 1XSVA 1SD6A 1CQTA 1IRFA 3GTOJ 1VQ7I 4FCYA 5J1UA 3RKXA 3OR1C 2QLZA 5EJCA 1CF7B 2GAUA 4HX7A 3FXQA 5D8KB 1PUFA 2HPMA 1YX3A 4F3QA 2K9QA 3CJTB 4RGRA 1IRZA 1QU3A 3I58A 5HDNA 5K7FA 2FQ3A 5FD5A 2EIJH 2LREA 4JX5A 4S04A 1SEUA 2BY3A 2IT0A 1OPCA 3EUAA 2M0MA 2HOSA 3JRBA 4B47A 3CUQC 2A6TA 1FMWA 3GUDA 5D6EA 3M8JA 3CCLI 1IAWA 4DZPA 2PMZA 1IUFA 5B66C 1JUMA 4HSTA 2L4MA 3DBRB 1OCCH 4B1RA 2ZJRF 3DBHB 3NWSA 2XGEA 4HNVA 2EQRA 3HOVJ 2WA0A 5JLWA 3K70C 4ENMA 3Q0WA 4S05A 1XS9A 2MD0A 2CFOA 2HWVA 1HKSA 2L0KA 3GLLA 2K4JA 1Q1VA 4C3IJ 3KETA 4I6ZA 1T98A 5J4YA 4LITA 5E3MA 3CQZJ 4AVZA 1BR1A 3JRFA 4BJ5C 1V5FA 3BC8A 1DPUA 2E1CA 4XKVA 4C9YA 4CYCB 1WKMA 5EEGA 2H8WA 5JR3A 4BQNA 4NNJA 2JUGA 4HF2A 1YI2I 2R5YB 2BY1A 1GVJA 3MAJA 3LSKA 4CCJA 5IPAA 1KONA 2MD5A 5LD2C 3JRCA 4D7MA 2XUBA 3OYNA 2CQNA 4DYRA 2YU9J 2VJJA 3LFKA 2W4SA 2PG4A 4BBRJ 3CO7C 1TP4A 2VPLA 3ERMA 4CA0A 2HI3A 2Y9ZA 4L9NA 1FBUA 5IOZA 1D8JA 4HV6A 1WSUA 3K2ZA 1SANA 3CMAI 3U1DA 2DA7A 3A4CA 4Z6YA 2D45A 4GRIA 3BTLA 4ZZDA 2R7QA 2OUMA 1LQ1A 3HRMA 2GA2A 2KRCA 1FYMA 3MCZA 1IJWC 4GDFA 2JA2A 1KA8A 2A3SA 2COBA 3EQLF 3ZQLA 4RAZA 3BG9A 1V55H 1YS7A 3PNVA 4WXCA 5DYMA 4G7ZF 2MC4A 1J0RA 1CF7A 3DQVC 1SC7A 1P4AA 1BW6A 2X51A 5GP9A 1KU2A 4FETA 3H0DA 3PNTA 4EJVA 2M87A 1VFCA 1RKTA 4NC6A 2D1HA 3CJRB 3EUHC 3HRTA 2HU9A 4IF4A 3KYDB 1TNSA 3OYBA 3HXLA 1R23A 3BPXA 2Q1ZB 3SZTA 2NXNB 4ITVA 3OS2A 2HOTA 2E5NA 1T39A 5FJ8J 3S3MA 2DCEA 4IX7A 3CUQB 2BEOA 3C18A 3T8TA 3F8MA 1H88C 4NB5A 4QSHA 3VSLA 1MMSA 5AIPA 1XPXA 3RPQA 3JRDA 4D9JA 3HKZN 1K6OA 2BBYA 3KIOA 3M1EA 1R9TJ 4G9YA 3S1MJ 5FFZA 3QP6A 1O3SA 1S6LA 5L3EA 2P6TA 5KK1A 2K5CA 4F52A 3A01B 3HEFA 3I54A 3CC7I 3M3YJ 4EM2A 3RQIA 1WFXA 2WAFA 2XAUA 4X0GA 4HDUA 1HBXG 3IAS2 4M9XA 2EJRA 3HPHA 3J80Z 1G3YA 3NRVA 2F4MB 2CYYA 3FXMA 4BAYA 3ZQHA 3H9JA 3BROA 5J1YA 4S0HB 2PQ8A 1BR4A 5HDGA 3GTPJ 1MZBA 1KQ8A 1JJ6C 2AXTC 4NQWA 1Z1DA 5BNGA 3CCQI 2R5YA 2V9VA 4EMSA 1JHHA 1NHAA 1K78A 4WF2A 4A3LJ 4ZDOA 1E3PA 5J8CA 3I4PA 3EUKL 5EF6A 3NEUA 1K4SA 4DOZA 4KT5C 5TISC 5LHGA 4HF0A 2AHQA 3OS1A 5H20A 1MSFC 1LJ9A 2L9RA 3R0AA 2HYGD 5ICCA 4AU7A 4OIQF 2FSWA 4HLXA 2TDXA 1ZRFA 1FLIA 4UY8I 3C2HA 1MDMA 3WODF 2V1NA 3V7SA 1E3HA 4WCGA 1EV7A 1DP3A 3CC2I 1ERDA 1RC9A 4XKCA 1JUSA 4Q5SF 1QO0D 4AVPA 4LFUA 1ZGWA 4I0BA 1YOVB 3K1MA 4A2UA 4CDGA 1R71A 4IQ4A 1QA6A 1NG7A 2RREA 3QU6A 2KRFA 4U7BA 4DQ2A 1ITYA 2VKVA 3O6BB 3BCAA 4Y17A 1MBHA 1I5ZA 1X4OA 3ECOA 4OAZA 2WY7Q 2CW8A 2ZJ2A 5AONA 5BPIA 2A07F 2XRNA 2F5EA 4CYDA 1BJAA 5F64A 3G1LA 4HOBA 4CICA 4TV7A 4WXDA 5EGOB 2DBBA 2NS8A 4KDPA 2F6CA 4LK0F 1DU0A 2EB7A 5E1WA 1WJDA 4FX4A 1D0YA 3JREA 2VXZA 2H6CA 2QZ8A 4ZYEA 2IS6A 2R0QC 1RNLA 2IS2A 2CO5A 1XMXA 2QQ9A 2Y0SA 4AIHA 4CCLA 2R5ZB 3CUQA 1W7PA 3TO7A 2ZNZA 3O8HA 1XMKA 2VN2A 5M5YJ 2BHZA 1AA7A 1QNTA 2IVMA 1GXPA 5D5XB 4RB2C 2K85A 3BG7A 1RR7A 1U2WA 2GBYA 3BQYA 3DTIA 3FHZA 5FKMA 2GM4A 1Y8QB 3CJQB 2OJED 2R7DA 1B9NA 1KU3A 3DPTA 2XROA 1JJ8C 3RTRA 2KIQA 1YO5C 3WTVC 2M3AA 1LKXA 3K7AJ 4MFDA 2CQ7A 2R3SA 4CCMA 3ZGKA 3LQQA 5ED4A 2XF7A 4M6VA 4RLFA 2VBYA 1TLHB 2P5LC 2GWRA 1OJLA 1V54H 3TP3A 2E7WA 1HCRA 1O7LA 5J40A 3MQ0A 2B0LA 3FBNB 3NWTA 4KJZA 3T1BA 4L5IA 4IHWA 2CQQA 4U0VA 4E70A 4EATA 1ETYA 3F3XA 1QHGA 3REOA 2IP2A 3FMSA 3S16J 3DXJF 4Z2YA 4C2UA 2I8DA 5A2QK 2ZXIA 3U2RA 2N8GA 2XAJA 2J5PA 2LF8A 2COMA 4A3GJ 3GBGA 1WRJA 2YSRA 2ZBKA 4A3EJ 4LLNA 1P7JA 3E6CC 1ZELA 1FZPB 2DW4A 5IT3A 3BG5A 2DJNA 1LB2A 4FQGA 3WG7H 1FNNA 2LF7A 2WWYA 2LKPA 3TQNA 4F92B 3VYTB 1ENHA 2TCTA 2VKDA 1SAXA 3RDIA 1T38A 2ID6A 4IHYA 2E34A 2CQKA 5D4SA 3HBLA 2KQRA 2LKSA 1MD0A 3CC4I 2Q0OA 1J2XA 3FWEA 4XLEA 2HYFA 2V4JC 2F4OB 3MKLA 4F91B 1D1CA 1SFUA 1J9IA 2X6OA 5IY5H 3HOXJ 1WWXA 1BM9A 2K9LA 1J09A 4X6AJ 3MEXA 4AC0A 2Y31A 4OIPF 4IRIA 2VOOA 1GDTA 3ZQGA 1VF9A 2E2IJ 3EUHA 1X1BA 3I71A 2VBXA 5CVVA 3GTMJ 3AG1H 2KHMA 2ZO4A 2OC6A 1ZK8A 5B1AH 1X1PA 4XSZF 1SFKA 2DMTA 2VJ5A 1SFOJ 3CF2A 4N4NB 4BH9A 3QYFA 2MABA 2P6SA 4U88A 1BR2A 4XLHA 3FXRA 3HSEA 3LOCA 2XAFA 3RI4A 4LK1F 2OZ6A 3ZCOA 2CQXA 4RB1A 5E8IA 5JHUA 5KNLA 2Z16A 5K1YA 3TDZC 4A69C 1GT0C 2IA0A 1N25A 4NC7A 1Y1WJ 4G7HF 1Y39A 4J00A 2JPBA 1VNDA 3PIPF 1XC5A 2X4HA 1IRXA 1GLNA 1BI0A 2K86A 1T0FA 3A0BC 3JAMZ 3L1PA 3JRHA 4KIBA 3RJPA 5BS6A 4A3DJ 1HF0A 3VDXA 2V1XA 4OMYA 2H6BA 1JGSA 1UELB 2DOEA 4ABZA 4QLCU 1FTTA 1U6GA 2OQRA 2V9KA 1ZN2A 2P8TA 2CH0A 5K7HA 3V4GA 4LOCA 3OWTA 5EEAA 2W48A 1FOWA 2VPRA 3RPUA 1O3QA 1R36A 2O3FA 1TQMA 3E7LA 4PZJA 3QRFF 4M72A 2J5OA 1IN8A 4HLYA 3ZQCA 1LEBA 4XONA 2AS5F 2Y2ZA 4DZJA 1HW2A 4B3XA 1ZTRA 4WX9A 3FM5A 2IW5A 4E7SA 2GLOA 1SD5A 4LG3A 4KIGA 1E2XA 2VQGA 4C2MJ 2QSHX 2LFBA 4EJTA 2EFPA 2M4GA 5J47A 2NVTJ 2M2EA 2QGUA 3KLNA 1RESA 2V6CA 2VODA 4HF1A 5FB2A 4KNYA 4OIOF 2VT2A 3FKJA 2X6YA 3QYBA 3E5QA 3K10A 3DKYA 3TW6A 1IN7A 2XB0X 4BQOA 2EV6A 1G6NA 3J81K 2L5QA 3WE2A 1BOBA 3CCVI 1FPQA 1TW2A 2E1NA 2KDOA 3L2QA 4MQ9F 3LQRA 1MSEC 4PJNA 1E17A 5M5XJ 3BQZA 1R7JA 1P7IA 2CS3A 3PJRA 4KICA 3K4NA 1UJ8A 4RS8A 4A3CJ 2QQBA 3OY9A 1J75A 1O3TA 2E7XA 2NYXA 3OL4A 1HC8A 4XK4A 3NQOA 2EZIA 2V1DA 4IHVA 3G1MA 3HHGA 2XDVA 4KUMA 4BQAA 3I4MJ 2XGDA 1H8AC 3H92A 1UG0A 1D5YA 1BIBA 1YJWI 4DJAA 3H5NA 3FF5A 3W3CA 5D4RA 5E1XA 1HW1A 2CV0A 5EZGA 5ILUA 1IXCA 2AO9A 1BI3A 3PM1A 3K4KA 4M71A 1QVUA 1OCTC 1WI3A 2VASA 1WCMJ 2KDZA 2FOWA 3K0LA 1O4XA 4XLPF 2K4BA 3IWFA 3Q5FA 3M7GA 3WU2C 3DEEA 2CWEA 2Z9OA 3TBIA 4I2OA 1MNMC 2YX4A 4WK8F 3J7YJ 1AKHB 3F6VA 3HIFA 1ORKA 2A5YB 1NK3P 1BC7C 4KYWA 2GXBA 4A93J 1WH7A 4C2TA 3Q9VA 1FX7A 2PN6A 5J1RA 2MH2A 1AOYA 1KYWA 4MLOA 2JVGA 4L0YB 1H0MA 3OSFA 4BUPA 2PJRB 1PUFB 1FBSA 1LVKA 2PFBA 5M3FJ 1VQ4I 1WJBA 1ETXA 2VC0A 3LSIA 1OMIA 5ICFA 1PP7U 2M7AA 5CLSA 5CQEA 2DK5A 2V26A 3ZQQA 4JBAA 3KZIC 1F1ZA 3E0JB 4IZZA 2VE9A 4D5FA 5HNHA 3GMEA 1JKPC 1ONVA 4RB0A 1GVDA 2UXXA 4B09A 3HL2A 2HKXA 3FKIJ 3ZMDA 4OOIA 1JKRC 4A0ZA 2DO7A 3T5XA 3MZHA 4MTDA 3LSRA 4NDLA 1R00A 1LFPA 1W36D 4LMYA 3WGGA 3D0SA 3KX2A 1KQ9A 1ZKGA 2BV6A 3JRGA 4WWCA 2K27A 4LB6B 2HNHA 2VQLA 4BS9A 4Y52J 2FU4A 3VODA 1EJ9A 2DMPA 4P9FA 4EJUA 4UUSA 2PLYA 5BOXA 5JHFA 2PBIA 1K61A 1P2FA 1PP8F 4XOPA 1LUJB 4MIMA 1R4NB 2VBWA 1B59A 3BR1A 5LEKA 1RIOH 2KJBA 2DK8A 3F23A 1U0JA 4R8HA 1IUYA 4NBQA 4UNOA 1VZ0A 3H9QA 1WJ5A 4KIFA 2ELKA 5E8GA 3FISA 5D5UB 3V8JA 2VONA 4NUBA 4Q4ZF 3N97A 1YJ9I 1PVEA 2ISYA 4HDVA 2F48A 4I01A 5EG0B 1R4MB 2Q8KA 4W97A 3V7CA 1DDNA 5LBQA 1TNTA 5B5EC 3V8LA 2IA1A 1MH4A 2BW3A 3I5UA 3QPLA 4PSWA 1N78A 3RKWA 3CCMI 2Z33A 2K40A 3DKWA 3B6CA 2DPDA 2BY2A 3KP4A 3ZXSA 4AIJA 4P1WA 4DYQA 1U3EM 2H1KA 4G6QA 1VQ8I 3H3VK 2UZKA 3WU1B 4OU0A 3ZP5A 3KYLA 1X2NA 2E19A 1EH6A 2KFDA 2KP6A 2JZYA 3GZ5A 2VL8A 4HG2A 5D8LB 2HDWA 4II2A 4BGDA 3LSHA 1DU6A 2A5WA 4QPQA 3WGHA 2PJRA 2DYSH 4ENNA 2ZCWA 3RYRA 1G3SA 2XAHA 2EZKA 4YIIA 4LGWA 3TL4X 1WJAA 2ZXHA 1IDZA 3EETA 1T2KA 4B4CA 3ABMH 2LY2A 3FXJA 3QYEA 3VEPA 1FY7A 2WAEA 1MBKA 2RAEA 2YR2A 4UUVA 2LTPA 2M8EA 4G7OF 3BLYA 1IN4A 1Y6IA 2PMZN 1ZRCA 1HOMA 3I53A 2QM3A 3HTSB 2DA3A 4ZZLA 1XGNA 5CVRA 1FSEA 1KU7A 4LG0A 3W2AA 1VQMI 1E3OC 4ZJZA 3EPZA 5FKLA 2MSYA 2D2WA 3F8FA 4XOTA 5CVIA 4BE2A 3DEWA 4QPOA 2LKXA 4ETSA 2FJ1A 3CF5F 2CSOA 1Z05A 2XB5A 2NS7A 3BR3A 4PUSA 1V3FA 1BIAA 1IG7A 2EZLA 2XAQA 5E18F 3P9CA 4GYIA 3DFGA 3G6EI 4XLCA 1TWFJ 3BP8A 2JTVA 4M3DA 4CUGA 1IN5A 2W85A 4B43A 1YLFA 1YITI 4BU2A 1W1WE 1OYYA 2DDBA 4NQWB 4Y15A 5IT9Z 3WTZA 1D1BA 3GO5A 2Q2EA 1APLC 4OINF 6PAXA 1HLVA 2DYRH 1K78B 2CW7A 3DLAA 2FBIA 3KP6A 4G94A 4Q47A 5EG0A 5H6QA 3W2WA 2DA5A 3CP8A 4UVBA 1LFBA 4BHCA 2RGVA 3GFJA 2HTSA 4N0BA 2K3PA 1I6HJ 3S93A 1XDUA 2LRDA 3FXKA 3LSGA 1MDMB 5GPCA 1W7PD 5DDGA 3PFIA 1Z3YA 1UHWA 1XX5A 2DODA 3F6OA 4G6DA 3W2VA 1I27A 3GTKJ 1V5EA 5LRSA 2RKHA 2OTJI 2EPFA 3LNQA 1SD4A 2L7ZA 2OD5A 3A03A 1XCBA 2M5WA 4QWQA 2XRLA 4HAMA 4RAFA 2JRMA 3K70D 1VQKI 4KT6A 1JXSA 5F1RA 3JTHA 2CUZA 5HLHA 4AIKA 1U5TC 3WTSC 3BPVA 1EA3A 4BHPA 1S8NA 1W5TA 3GZNB 3WTYC 2ACJA 1XSDA 1PYVA 3BDDA 1ZGAA 2O6GE 4R1HA 2QCOA 1OFCX 3MZYA 5FKNA 1HXDA 1E0EA 2C6YA 3S17J 2FE3A 1UHMA 2ELJA 4QTRA 2FBKA 1QQIA 2L3DA 1W7PB 2RC4A 1A31A 2HZDA 3C1DA 4IHXA 4MGRA 2E1OA 1F9NA 3OIOA 3V8KA 1ZG3A 2QEXI 2QENA 4FT8A 3RIRA 2R7UA 4HEA2 1V4RA 2KKOA 3ML6A 1R49A 1H89C 4N4OB 2DMUA 4RAGA 3CJNA 2HOEA 4BHBA 3D5RC 5K7ZA 1F5TA 2HVRA 4JOMA 1TW3A 2QUFA 4JYKA 3ZMUA 1T0FC 1XD7A 3KP3A 4ZYAA 5HOOA 3DKXA 2EV5A 3BTIA 2MLGA 1FP1D 2O8XA 1B72A 4UUTA 3K69A 3CDHA 2P7CB 3PQKA 2RQPA 1OISA 1F36A 2DU9A 4L9TA 5FROA 4A0XA 2W24A 3VYRB 2HYJA 2OPTA 2X1DA 3HKZA 3K4BA 5CYVA 3WE3A 5GAGJ 3CMEI 2DA2A 1S3JA 3E6BA 3S2DJ 1WI9A 4BJTA 2FUG2 1T08B 1ETVA 1V5GA 4KN7X 1A04A 3JTGA 3SEZA 2HPIA 2X48A 2R7VA 1G2HA 3SFIA 4RAYA 2OAZA 2RNGA 3MN2A 4NHJA 1UMQA 4LIUA 2WY8Q 1D3YA 5LLQA 1WGXA 2H8RA 2DTZA 2VI6A 1HSTA 2A68F 4GFBA 2L9SA 5HLIA 2FEZA 3SDGA 1W5CC 5D5WB 3F8BA 2JUCA 2E71A 1QRYA 3ERED 2M45A 3F9KA 3WTXC 4L5JA 4A3JJ 4PK4A 4LD5A 5IYBJ 2E36A 3QPHA 3FDYA 3ZN1A 4KISA 4YG2F 3TP0A 1LEAA 2FOKA 2LG4A 1I3QJ 5IYCJ 2DI3A 2FF4A 4RLQA 3FXOA 3I0TA 3NAUA 1X19A 2ZC2A 4A5MA 1W0TA 3ASOH 2L7KA 2EA4A 3P5JA 4HNUA 1S72I 2KISA 1U5TB 2FRHA 4CH7A 2QVOA 3DLLF 1YRNA 3BR2A 1I1SA 2Y0SN 3TEDA 3OYFA 2RN7A 3SZPA 2O0YA 2ME6A 1X3ZB 2DFHA 1S7AA 2EILH 4DGWB 3GX4X 3RPUD 4E7ZA 2ZJQF 1JTYA 3E6DA 1OCZH 3OIPA 2L9VA 1KGSA 3ZN0A 1KQ0A 2HFHA 2OQGA 3QAHA 4I99C 3P9KA 5FD6A 3IRRA 3FZVA 1RUNA 3OOUA 4GO1A 2KL4A 2O7OA 4M3BA 5H6RA 1MBEA 2MW8A 3KEQA 3OIQA 3L9FA 4IEJA 1X1DA 3AFHA 4O5VA 2MC3A 4L0ZB 2IAIA 3IHUA 2W1OA 4QIWN 1Y8RB 3VPRA 1WJEA 2MH9A 2GIVA 1ETWA 4O6JA 3S1QJ 5LHHA 4W1UA 4IRHA 1YIOA 3E1SA 3A02A 2A05A 5FLXZ 2CU7A 4IO9F 3N4MA 4PDKA 1MGTA 3LA2A 2O5RA 2BYVE 4JP0A 1XB4A 3TOBA 4EGYA 1U8RA 3GFLA 2NRAC 2HOAA 2ICWG 3ZQ7A 4OWRB 1FJLA 3GTGJ 4EJOA 4U0YA 3M07A 4M3GA 5ICGA 3CCRI 1IC8A 1JTXA 4BEHA 3OYGA 1I1GA 3MKYB 4PJMA 4MFEA 2E35A 3O2PE 3BG6A 1IGNA 4FTHA 3CD6I 4UB8C 3A1YA 4G12A 3HOYJ 1YE9A 2W25A 2DXIA 1VQPI 3CMYA 2MYSA 2OTLI 3LAPA 3S2HJ 5FKKA 3MWMA 5KHDA 1XDSA 2LK2A 3I59A 2KLOA 1Z0XA 5BQTA 2LD5A 3L2VA 4LB5A 2QYOA 2XPUA 1GXQA 2LSOA 2M34A 4PJ0C 2X0LA 1U5TA 1YW8A 2B63J 4PSXA 2KMUA 4V2GA 2Z99A 3S3OA 2DN0A 4HRIA 2NVQJ 1UZCA 4GXOA 5DS9A 5C4JJ 4BYYA 1X3UA 3HGYA 1J59A 5DCMA 3GWZA 4DYCA 4BDYA 4KMUX 5HVQC 3FMQA 2VT3A 2DMNA 3IP4B 2R7WA 1TC3C 1WZ2A 3QPSA 2R7ZJ 1ODDA 2M8GX 3CDIA 2UUZA 2VQCA 2QSGX 3HOTA 1JT6A 3F8CA 3LSMA 4XKWA 3L09A 3DPLC 5LGNA 2EFWA 3LSTA 1L0OC 1MBJA 3BY6A 1L3LA 3DEUA 3VB2A 3PL8A 3L2WA 1ON1A 2XKOA 1FBQA 3DU6A 2R4GA 1S7EA 4XLFA 2FX0A 1VQ9I 1ZG1A 2ZFUA 4RDUA 3GEZA 2PEXA 4D7NA 1VQLI 1G8XA 1ZLJA 2I5UA 3IV5A 2HDCA 1BI2A 1X1CA 1FYKA 4A6EA 3L2UA 3PUFA 2HXOA 4ZDLA 2Y69H 2E5ZA 3K4CA 5DTDA 2VUMJ 2CJJA 2NS0A 2CMPA 1Z67A 4UVAA 3SXYA 2XF5A 3QODA 3ZMZA 4DBRA 1YHQI 2ZJPF 3ONQA 2CRGA 2YX7A 4BL0B 1QZEA 4A3FJ 4BY1J 1T6SA 2ZXWH 2BGCA 2PX9A 4B3AA 2HKOA 4KN4X 1OCOH 1MMGA 1QZYA 4J01A 1ZHFA 3P9IA 3KE2A 3M1CA 4FISA 1JE8A 3HJEA 5TJJA 1BOAA 4EJWA 3CCEI 3TO9A 3F0CA 1Y1VJ 3PNYA 2BVMA 3J7ZI 2JA5J 1X4PA 3GW2A 3HDDA 3J7AY 1MNDA 3IH4A 2IJLA 1YW7A 2ZSHB 5TRDA 3DCFA 3IAM2 1K6YA 5C3EJ 4F93B 3OYMA 5DD4A 4M6XA 4CO8A 2M7BA 4ESJA 3I4NJ 1YJNI 2XF6A 1JUPA 3A0HC 3WHCA 1OKRA 1XMAA 3RKQA 3K4LA 3G4SI 2KIUA 2WV1A 4XR6A 4H4KC 3UKGA 4F55A 1W5SA 1ON2A 2D5VA 3HC7A 4AIDA 2M9HA 2EIKH 2NVUB 4UUSB 3Q0VA 2P5KA 3DP7A 1O3RA 1IXRC 2ZB9A 2DDAA 2LP0A 3FM3A 2LBFB 3OYEA 1S9HA 1FOYA 4Q48A 5HNFA 2OA4A 2UXNA 3H3UA 2NOJB 2DTRA 3KEYA 5M5WJ 5E1ZB 3OYLA 2YS9A 4MEXF 1ACIA 4N9IA 1SFXA 3K6GA 5HS8A 5LFAA 1NTCA 2FXAA 4XRSA 4E7IA 2E60A 3GTQJ 1UFMA 2FMLA 3CLQA 4WXHA 1RZ4A 2P7VB 2ID3A 1MJ9A 5LGTA 4MO7A 2BW3B 1UB9A 3OYDA 3BZ6A 4JX6A 4AUXA 2CGPA 3IC7A 2QF7A 3DWLE 4ANJA 3O3KA 3S8PA 3Q0UA 2R7TA 2LVSA 4M9SA 1FT9A 2LYCA 2LNBA 3J80K 2ZSIB 1P92A 3ABLH 2YPRA 2CG4A 2O03A 4HPQA 1FIAA 5DV5A 3GTJJ 3HYIA 1U9OA 3BZCA 4JK1X 3RZOJ 1RPWA 3DBLB 2CUEA 2WB1A 1QBJA 5DD8A 5KVRA 2DT6A 2EV0A 1WHUA 4BY7J 2QWWA 1A6QA 3W6JB 4Y13A 3S2WA 2P4WA 5IOYA 3G71I 1XGMA 1AHDP 2Z1DA 3LSPA 2LDUA 5JVTA 2FQ4A 2GQQA 5K5QA 2W7NA 1IRGA 4CCOA 5CVUA 3HRUA 3WTWC 1ETQA 3BTJA 2JQ7A 3OV8A 1YIJI 4YIFA 4PJJA 4LG0B 5D6FA 4L9VA 3RQ4A 4XIDA 4RGSA 4JX4A 2X6WA 4P55A 2DA4A 3FK7A 1ULYA 3M9AA 2JWTA 3S1NJ 2OCEA 1ZG5A 4FE4A 5CQGA 5FLVA 4II3A 1R5HA 1R1TA 3QQAA 5L3CA 1B8IA 3S15J 5HLTA 3E3VA 3SDBA 3HSFA 4FX0A 2K9NA 2WAQA 3V7RA 2HDDA 4NC8A 4YFNF 5JI6A 4G6TB 1HSJA 4Y7NJ 1IO2A 3T8RA 1ZH5A 4BXXJ 1ZR2A 2CV1A 3WHBA 2E2HJ 4U0WA 1LDKB 2LY1A 4ENKA 4CSWA 2LBFA 3NARA 1X58A 4PGGA 4V2FA 1FWZA 4A3MJ 4DNCA 2QQAA 3CZ6A 2VLAA 3LMMA 4L5EA 1MJBA 2Q2EB 3HTUA 1XGSA 5F0FA 2OF7A 1MKMA 1DQUA 2JRTA 1PUEE 1TQIA 3H1CA 2Y0MA 5GAHJ 1LE8A 2H09A 3L2RA 1MBGA 4ESBA 3M8EA 2VC1A 1AU7A 3VSKA 3DF8A 1TTYA 4AYBA 4PJLA 4J19A 2V1UA 2WTEA 3JCUC 5B1BH 1QPIA 9ANTA 1FC3A 3K2AA 1OCPA 3OOPA 3Q9SA 2Y9YA 3PSIA 3RYPA 1OCRH 4M3EA 4UV8A 5A2QZ 3GCMA 4ZTJA 4DBQA 4E4HA 4XLAA 5GPAA 4IQJA 3U9GA 4K2EA 5IP7J 4HSRA 1USTA 2CW0F 5E3NA 2DFFA 4BKXA 1Z7LA 3SFZA 4XL9A 2IPQX 3BOQA 3TOAA 3FBIB 3VFZA 3G73A 4P9UA 3CESA 4E7KA 4HA8A 5K5OA 1A36A 1FIPA 3CMMA 4XSXF 4X1EA 2PMHA 4RB3C 4MEYF 3FHNA 1I3AA 2XGCA 3IH3A 4FASD 2GA1A 1HDPA 1JKOC 2WBMA 1R5GA 3CUOA 3H9GA 5BMZA 2MLKA 1MMAA 1VQOI 4GYGA 4Y3OA 4KA4A 2R7RA 4YFKF 2QKMB 4CZCA 2V7FA 4LLLA 1A6IA 3Q3SA 2QBYB 3TGNA 4XRSG 1B6AA 1Z6RA 1YW9A 2HQRA 1P4WA 2PI0A 2JVHA 1FOKA 1RETA 1SD7A 4LIVA 3PO2J 1OR7A 2JSPA 1NK2P 1JT0A 2F5FA 2G7UA 2K3FA 1TWAJ 1N77A 1XN7A 4AM3A 4CGZA 1BC8C 4AD9A 1B72B 5ICEA 1A35A 3E5XA 4M74A 3C7JA 5HS7A 1HA8A 5F0HA 1FOXA 2VJ4A 2A6HF 2EFNA 3ASNH 1O7FA 5IP9J 2Z5UA 2RQQA 2L02A 2R92J 4YIRX 1EH8A 2Y30A 3HSRA 3S1RJ 1IXSB 3AL0C 2GZWA 2DT5A 2R93J 1RR8C 3JR9A 1LFUP 1MIJA 1GUUA 1TBXA 3EYIA 1R6RA 1ETOA 3M4OJ 2M0CA 4L9JA 4IJAA 4E6KG 2XGXA 2CUFA 1LDJA 2JPCA 1C0WA 1IZ1A 5EZHA 1OYIA 1K4TA 2IGOA 1FYLA 4IVNA 2QA4I 1TWGJ 4I76A 2LY9A 4IRGA 2PMUA 2XVCA 3SZGA 2NAZA 2DPUA 4N9HA 1VQ6I 5DCFA 2BE5F 3HHHA 1KYZA 4H0EA 2B9SA 2TRTA 3K1PA 3ZPLA 3IKTA 1M1EB 5L3GA 3JAMK 4HQMA 4AWXB 2BY0A 2VOPA 3HRSA 3KYCB 1YFHA 1W0UA 3IWZA 2M4KA 4IPAA 5DEQA 3LFUA 1ZREA 2ZMEA 3LA7A 1T8IA 4IHSA 4ESFA 1TT0A 4JQFA 1SVMA 3DU5A 5LRRA 3IRQA 2W84A 3J81Z 1G59A 5KCMA 3FXUA 1ZYRF 2YU3A 3HGGA 5J6XA 1YRNB 2RVCA 1IV6A 2UWMA 1MBFA 2F5CA 2L4AA 5DM6F 3LAJA 4A3IJ 1Y0UA 2P81A 2V79A 1ETKA 1SAUA 3JRAA 2BOLA 2HEOA 1POGA 2QBYA 1BJZA 3PFYA 3L2CA 2KIMA 4P96A 4XRFA 2F4IA 3WG9A 1GV5A 1XCVA 2VBZA 4UXNA 1MMNA 3HOSA 2KJCA 3BR6A 1UAAA 2BXZA 4HW0A 3ROUA 4YFXF 3WU0A 4A0YA 4CXFA 5BPDA 1K83J 5K5RA 3GTLJ 3MD2A 1VQNI 1R1VA 2KT0A 3OL3A 1REPC 5M3MJ 1HQCA 5JVGF 3BR0A 4DIQA 3S32A 1Z7UA 3WTTC 5LGUA 3SHFA 5E20A 3WTUC 3E97A 3CTAA 2YUSA 4PCQA 1JHFA 2DQRA 1H9GA 3C2BA 2LC2A 3K4JA 1XGOA 5CPRB 3AL0B 2IS1A 3C2GA 2QKLB 3AG3H 2FMYA 5C4XJ 3BJ6A 2FD5A 2DQLA 2L9NA 5HODA 4CYCA 2F2EA 3KZZA 3IKVA 2ZNYA 4ON0A 2NNNA 4A3BJ 3PO3J 1STZA 4IXAA 2HXIA 2OZUA 4BEHB 1WJFA 2ESHA 1UCRA 5F0CA 2XKPA 1Z91A 1SVOA 1GV2A 1WH5A 2BVLA 1Y0NA 3FXLA 3CO6C 4CCKA 2L2OA 2DT7B 5JLXA 4KFCA 3CLOA 2K9MA 5H2FC 1KZHA 1Z6TA 3HUGB 3IUOA 4UB6C 1RRJA 2GOXB 5E3LA 2JK3A 3MKWB 4YELA 4MHGA 3I59B 2ECBA 1BW5A 3I64A 3MVPA 1S7OA 1HW5A 5L3FA 4XMYA 1D0XA 5FFXA 5F1JA 3R4KA 1Z3XA 2HQNA 3SQNA 2BXYA 3B6AA 1B4AA 2ADUA 2XSJC 3HOWJ 2EIMH 3G1OA 5GAEJ 1F4KA 1EF4A 3CCUI 3OSGA 2H27A 2HVQA 1XG1A 5J4VA 1QGPA 5DCMB 4XBFA 5DUKA 2O9LA 5F04A 2DA1A 3S3NA 3KZYA 3AG4H 1IDYA 1O57A 2EFQA 4P5OA 2STWA 3FIWA 5ILSA 1P4XA 2JA7J 1U78A 2IGKA 2RDPA 1I50J 3VYSB 4HX4A 1ZAOA 5FO5A 2JT1A 3ZQFA 2D1VA 3BZKA 2H1LA 2OU2A 4RM3A 3ZMSA 3B73A 2ZKZA 5KAFC 1ZR4A 4M3FA 4HV5A 3ZMVA 1TZLA 3G2BA 3OYCA 1LVAA 1ZARA 3WGIA 1G3WA 2E1MC 3FMRA 2MG4A 1D8KA 3ZRGA 2XPVA 1FEXA 1WPKA 3F72A 2HQAA 3ZOBA 4Y4RA 3GVAA 2HR3A 3RCOA 3A01A 2L01A 4ZTFA 3CCYA 3BJOA 5GADJ 1RI7A 4IKFA 5F08A 4U87A 3T0YA 2CUJA 2V6EA 3QU3A 2VB6A 3LA3A 4UVCA 1R58A 4CCNA 1JI8A 2X85A 5GTIC 4MQVA 2FBHA 4XKBA 2P0WA 4I02A 2O61A 3H5AA 3X2QH 3MZ8A 4YRVA 1JGGA 5TGTA 4XRMA 2IGMA 2L54A 5L3BA 1RKWA 4EM1A 3GYHX 5FRNA 2DFIA 2EZHA 1VQ5I 5HDKA 2G7HA 1K7AA 4OAYA 3U21A 1TQPA 1SMTA 2KPMA 2A69F 4RA2A 1RUOA 1KU9A 4BE0A 2GIZA 1Y56A 2R7SA 1BL0A 1I39A
chains in the Genus database with same CATH topology
1R9TJ 3W6VA 3S1MJ 5M5WJ 1DU6A 2YS9A 2O8KA 4EEFG 3A01B 3HEFA 2XSDC 3M3YJ 3RQIA 2EZKA 5EDNA 1NTCA 4XRSA 3GTQJ 1IDZA 2ID3A 4B4CA 4MO7A 3ZQHA 5J1YA 4S0HB 1MBKA 2RAEA 3GTPJ 2LTPA 1JJ6C 4JX6A 4AUXA 5BNGA 2PMZN 2R5YA 1HOMA 2QF7A 2DA3A 3FK6A 3Q0UA 1E3OC 4A3LJ 5FKLA 2MSYA 2LKXA 2LVSA 3DEWA 2FJ1A 2JN6A 5EF6A 2XB5A 5EGOA 3SJMA 2NS7A 3BR3A 1FIAA 2AHQA 3GTJJ 1MSFC 2L9RA 1U9OA 1IG7A 2EZLA 1RPWA 3RZOJ 1VI0A 2CUEA 3O8GA 1TWFJ 5IYDJ 4M3DA 4BY7J 2R5ZA 5IOYA 1JUSA 2G0EA 3LSPA 1AHDP 2FQ4A 1ZGWA 3TW7A 1MH3A 1ETQA 1APLC 3BTJA 1ITYA 1HLVA 2VKVA 1MBHA 3HB9A 2MGQA 4XIDA 4JX4A 3G1LA 2DA4A 3BT9A 3FK7A 5EG0A 2DA5A 2JWTA 5EGOB 3S1NJ 2NS8A 1LFBA 1DU0A 4FE4A 5FLVA 3QQAA 1B8IA 1TWCJ 1I6HJ 3JREA 3S15J 3LSGA 2R0QC 2K9NA 3BG3A 5GPCA 2HDDA 4Y7NJ 2R5ZB 3H0GJ 4BXXJ 1ZR2A 3WHBA 2E2HJ 3GTKJ 3O8HA 3NARA 1X58A 4V2FA 5M5YJ 3LNQA 2L7ZA 3HOZJ 4A3MJ 3A03A 2ME0A 2IEKA 4L5EA 2XRLA 4XICA 5F0FA 2OF7A 2L7MP 1RR7A 3BQYA 2GBYA 2HQ5A 5FKMA 2GM4A 1LE8A 3HM5A 1JJ8C 1BA5A 1MBGA 1AU7A 1F43A 5EYRA 1JKQC 3K7AJ 4D5CA 2DMQA 4J19A 4MFDA 4A3KJ 2QCOA 1QPIA 1OFCX 1B8IB 9ANTA 3K2AA 1OCPA 4M6VA 5FKOA 2Y9YA 5FKNA 4M3EA 3S17J 1OJLA 3TP3A 4QTRA 1HCRA 1HDDC 2EH3A 5GPAA 2JMWA 3CDLA 2LR8A 4DW6A 4IHWA 2CQQA 4RBOA 4IHXA 2E1OA 1ETYA 3OIOA 5IP7J 5E3NA 3S16J 2XPWA 1T56A 1H89C 4BKXA 2DMUA 5K7ZA 2N8GA 5J3LA 1FIPA 4A3GJ 1LE8B 3GBGA 4JYKA 2X9DA 4X1EA 1ZQ3P 4A3EJ 1P7JA 1UHSA 3BTIA 1B72A 4UUTA 2XGCA 3BG5A 2DJNA 3IH3A 1HDPA 1JKOC 3BR5A 2NVYJ 1F36A 1ENHA 2TCTA 2HYJA 2OPTA 2ID6A 4IHYA 2DA2A 4C3JJ 3HBLA 3S2DJ 5E3OA 5F27A 1A6IA 1ETVA 5IP6A 3Q3SA 2I10A 1A5JA 4XRSG 3ZQIA 3BTCA 2X48A 2NVXJ 2IBDA 1G2HA 3MKLA 3SFIA 1RETA 2WB1N 3MN2A 2X6OA 1UMQA 3HOXJ 4BBSJ 1WGXA 3PO2J 2H8RA 2DTZA 4AC0A 4X6AJ 1NK2P 2Y31A 1JT0A 1GDTA 2VI6A 3ZQGA 1VF9A 2E2IJ 4GFBA 3GTMJ 1TWAJ 3SDGA 1ZK8A 1QRYA 1B72B 2E2JJ 1QVTA 2DMTA 1SFOJ 2ECCA 5F0HA 4A3JJ 1X2MA 5IP9J 1UG2A 5IYBJ 2R92J 3LOCA 2Y30A 3TP0A 3S1RJ 2R93J 1I3QJ 2LLKA 5IYCJ 2CQXA 3NAUA 1LFUP 3JR9A 3HOUJ 1GUUA 4A69C 1GT0C 1W0TA 3M4OJ 1ETOA 2M0CA 2VKEA 1U8BA 1Y1WJ 2L7FP 2CUFA 1VNDA 4FE7A 1XC5A 5EZHA 2WAQN 5C44J 3L1PA 3JRHA 3BR2A 1YRNA 4A3DJ 1HF0A 2Y0SN 3TEDA 3D1NI 5FLMJ 2NOGA 1TWGJ 2EBIA 4I76A 4ABZA 2LY9A 1FTTA 2ME6A 2K9SA 5K7HA 4LOCA 5EEAA 2W48A 2VPRA 1JTYA 2TRTA 3E7LA 2JA8J 3ZQCA 2JA6J 3RZDJ 2JJ7A 2Y2ZA 3OOUA 4DZJA 2O7OA 4M3BA 1W0UA 1MBEA 1ZTRA 2MW8A 2GLOA 4IEJA 4AYBN 2IAIA 4C2MJ 2LFBA 4QIWN 3VPRA 1TWHJ 4C3HJ 2NVTJ 2M2EA 1ETWA 1RESA 3S1QJ 3HGGA 1YRNB 1IV6A 1MBFA 4W1UA 3A02A 2CU7A 4A3IJ 3IH2A 2P81A 1ETKA 3TW6A 3JRAA 2XB0X 1POGA 1BJZA 4JP0A 1T33A 1GV5A 2DA6A 1MSEC 2HOAA 3JRIA 1Z77A 1FJLA 3GTGJ 5M5XJ 3BR6A 3BQZA 4M3GA 3LSJA 1FTZA 1P7IA 1IC8A 1JTXA 4A3CJ 1U9NA 1K83J 3GTLJ 3S14J 2KT0A 1AKHA 4MFEA 4XK4A 5M3MJ 1IGNA 2EZIA 4FTHA 4IHVA 3BR0A 3G1MA 1CQTA 4G12A 3HOYJ 3GTOJ 3I4MJ 4FCYA 5J1UA 2XGDA 1H8AC 2YUSA 3CMYA 1PUFA 1D5YA 3S2HJ 2K9QA 1IRZA 3C2BA 5FKKA 5K7FA 2LK2A 1Z0XA 5EZGA 4JX5A 2LD5A 2AO9A 2XPUA 3PM1A 5C4XJ 1QVUA 2FD5A 2M34A 1OCTC 1WI3A 5HODA 1WCMJ 4CYCA 2KDZA 1BL0A 2B63J 4V2GA 1O4XA 4A3BJ 2HOSA 3JRBA 3PO3J 2DN0A 2NVQJ 5DS9A 5C4JJ 2HXIA 3HGYA 1MNMC 4DZPA 5F0CA 1WH5A 1GV2A 1IUFA 4DYCA 1JUMA 1AKHB 4B1RA 1ORKA 2DMNA 1NK3P 1TC3C 2R7ZJ 3QPSA 4A93J 1WH7A 2M8GX 2XGEA 5JLXA 1JT6A 4HNVA 5J1RA 2EQRA 3HOVJ 4MLOA 5JLWA 3Q0WA 1XS9A 1MBJA 5E3LA 3OSFA 1PUFB 5M3FJ 2JK3A 2L0KA 1Q1VA 2ECBA 4C3IJ 4I6ZA 1BW5A 1ETXA 1S7EA 3MVPA 5E3MA 3CQZJ 3JRFA 2FX0A 5F1JA 4RDUA 4D7NA 4CYCB 3IV5A 3B6AA 3HOWJ 3G1OA 2HXOA 2R5YB 3OSGA 1EF4A 5DTDA 5IPAA 4D5FA 2VUMJ 1XG1A 1JKPC 2CJJA 3JRCA 4D7MA 1GVDA 2O9LA 5F04A 2DA1A 3FKIJ 1IDYA 1JKRC 4DYRA 3LSRA 4NDLA 2YU9J 3FIWA 4BBRJ 2CRGA 1ZKGA 2JA7J 1U78A 4A3FJ 4BY1J 3JRGA 1I50J 4Y52J 2HI3A 4B3AA 2Y9ZA 2DMPA 4UUSA 3ZQFA 5IOZA 4FISA 1SANA 1ZR4A 4M3FA 1K61A 2DA7A 3F0CA 1Y1VJ 3BTLA 4MIMA 2JA5J 3HDDA 3BR1A 3IH4A 1IJWC 2MG4A 3DCFA 2COBA 2XPVA 3ZQLA 1FEXA 3BG9A 1WPKA 5C3EJ 3ZOBA 3I4NJ 1JUPA 2ELKA 3FISA 3A01A 1BW6A 3WHCA 3CCYA 3RKQA 5GP9A 5F08A 5EG0B 2WV1A 3UKGA 1VFCA 1RKTA 4W97A 1MH4A 3QPLA 2D5VA 2M9HA 2K40A 4UUSB 3B6CA 1JGGA 4XRMA 3Q0VA 4DYQA 2HOTA 1RKWA 2EZHA 5FJ8J 2H1KA 2ZB9A 3H3VK 2LP0A 1H88C 4QSHA 1X2NA 2E19A 3JRDA 3HKZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T J;  3W6V A;  3S1M J;  5M5W J;  1DU6 A;  2YS9 A;  2O8K A;  4EEF G;  3A01 B;  3HEF A;  2XSD C;  3M3Y J;  3RQI A;  2EZK A;  5EDN A;  1NTC A;  4XRS A;  3GTQ J;  1IDZ A;  2ID3 A;  4B4C A;  4MO7 A;  3ZQH A;  5J1Y A;  4S0H B;  1MBK A;  2RAE A;  3GTP J;  2LTP A;  1JJ6 C;  4JX6 A;  4AUX A;  5BNG A;  2PMZ N;  2R5Y A;  1HOM A;  2QF7 A;  2DA3 A;  3FK6 A;  3Q0U A;  1E3O C;  4A3L J;  5FKL A;  2MSY A;  2LKX A;  2LVS A;  3DEW A;  2FJ1 A;  2JN6 A;  5EF6 A;  2XB5 A;  5EGO A;  3SJM A;  2NS7 A;  3BR3 A;  1FIA A;  2AHQ A;  3GTJ J;  1MSF C;  2L9R A;  1U9O A;  1IG7 A;  2EZL A;  1RPW A;  3RZO J;  1VI0 A;  2CUE A;  3O8G A;  1TWF J;  5IYD J;  4M3D A;  4BY7 J;  2R5Z A;  5IOY A;  1JUS A;  2G0E A;  3LSP A;  1AHD P;  2FQ4 A;  1ZGW A;  3TW7 A;  1MH3 A;  1ETQ A;  1APL C;  3BTJ A;  1ITY A;  1HLV A;  2VKV A;  1MBH A;  3HB9 A;  2MGQ A;  4XID A;  4JX4 A;  3G1L A;  2DA4 A;  3BT9 A;  3FK7 A;  5EG0 A;  2DA5 A;  2JWT A;  5EGO B;  3S1N J;  2NS8 A;  1LFB A;  1DU0 A;  4FE4 A;  5FLV A;  3QQA A;  1B8I A;  1TWC J;  1I6H J;  3JRE A;  3S15 J;  3LSG A;  2R0Q C;  2K9N A;  3BG3 A;  5GPC A;  2HDD A;  4Y7N J;  2R5Z B;  3H0G J;  4BXX J;  1ZR2 A;  3WHB A;  2E2H J;  3GTK J;  3O8H A;  3NAR A;  1X58 A;  4V2F A;  5M5Y J;  3LNQ A;  2L7Z A;  3HOZ J;  4A3M J;  3A03 A;  2ME0 A;  2IEK A;  4L5E A;  2XRL A;  4XIC A;  5F0F A;  2OF7 A;  2L7M P;  1RR7 A;  3BQY A;  2GBY A;  2HQ5 A;  5FKM A;  2GM4 A;  1LE8 A;  3HM5 A;  1JJ8 C;  1BA5 A;  1MBG A;  1AU7 A;  1F43 A;  5EYR A;  1JKQ C;  3K7A J;  4D5C A;  2DMQ A;  4J19 A;  4MFD A;  4A3K J;  2QCO A;  1QPI A;  1OFC X;  1B8I B;  9ANT A;  3K2A A;  1OCP A;  4M6V A;  5FKO A;  2Y9Y A;  5FKN A;  4M3E A;  3S17 J;  1OJL A;  3TP3 A;  4QTR A;  1HCR A;  1HDD C;  2EH3 A;  5GPA A;  2JMW A;  3CDL A;  2LR8 A;  4DW6 A;  4IHW A;  2CQQ A;  4RBO A;  4IHX A;  2E1O A;  1ETY A;  3OIO A;  5IP7 J;  5E3N A;  3S16 J;  2XPW A;  1T56 A;  1H89 C;  4BKX A;  2DMU A;  5K7Z A;  2N8G A;  5J3L A;  1FIP A;  4A3G J;  1LE8 B;  3GBG A;  4JYK A;  2X9D A;  4X1E A;  1ZQ3 P;  4A3E J;  1P7J A;  1UHS A;  3BTI A;  1B72 A;  4UUT A;  2XGC A;  3BG5 A;  2DJN A;  3IH3 A;  1HDP A;  1JKO C;  3BR5 A;  2NVY J;  1F36 A;  1ENH A;  2TCT A;  2HYJ A;  2OPT A;  2ID6 A;  4IHY A;  2DA2 A;  4C3J J;  3HBL A;  3S2D J;  5E3O A;  5F27 A;  1A6I A;  1ETV A;  5IP6 A;  3Q3S A;  2I10 A;  1A5J A;  4XRS G;  3ZQI A;  3BTC A;  2X48 A;  2NVX J;  2IBD A;  1G2H A;  3MKL A;  3SFI A;  1RET A;  2WB1 N;  3MN2 A;  2X6O A;  1UMQ A;  3HOX J;  4BBS J;  1WGX A;  3PO2 J;  2H8R A;  2DTZ A;  4AC0 A;  4X6A J;  1NK2 P;  2Y31 A;  1JT0 A;  1GDT A;  2VI6 A;  3ZQG A;  1VF9 A;  2E2I J;  4GFB A;  3GTM J;  1TWA J;  3SDG A;  1ZK8 A;  1QRY A;  1B72 B;  2E2J J;  1QVT A;  2DMT A;  1SFO J;  2ECC A;  5F0H A;  4A3J J;  1X2M A;  5IP9 J;  1UG2 A;  5IYB J;  2R92 J;  3LOC A;  2Y30 A;  3TP0 A;  3S1R J;  2R93 J;  1I3Q J;  2LLK A;  5IYC J;  2CQX A;  3NAU A;  1LFU P;  3JR9 A;  3HOU J;  1GUU A;  4A69 C;  1GT0 C;  1W0T A;  3M4O J;  1ETO A;  2M0C A;  2VKE A;  1U8B A;  1Y1W J;  2L7F P;  2CUF A;  1VND A;  4FE7 A;  1XC5 A;  5EZH A;  2WAQ N;  5C44 J;  3L1P A;  3JRH A;  3BR2 A;  1YRN A;  4A3D J;  1HF0 A;  2Y0S N;  3TED A;  3D1N I;  5FLM J;  2NOG A;  1TWG J;  2EBI A;  4I76 A;  4ABZ A;  2LY9 A;  1FTT A;  2ME6 A;  2K9S A;  5K7H A;  4LOC A;  5EEA A;  2W48 A;  2VPR A;  1JTY A;  2TRT A;  3E7L A;  2JA8 J;  3ZQC A;  2JA6 J;  3RZD J;  2JJ7 A;  2Y2Z A;  3OOU A;  4DZJ A;  2O7O A;  4M3B A;  1W0U A;  1MBE A;  1ZTR A;  2MW8 A;  2GLO A;  4IEJ A;  4AYB N;  2IAI A;  4C2M J;  2LFB A;  4QIW N;  3VPR A;  1TWH J;  4C3H J;  2NVT J;  2M2E A;  1ETW A;  1RES A;  3S1Q J;  3HGG A;  1YRN B;  1IV6 A;  1MBF A;  4W1U A;  3A02 A;  2CU7 A;  4A3I J;  3IH2 A;  2P81 A;  1ETK A;  3TW6 A;  3JRA A;  2XB0 X;  1POG A;  1BJZ A;  4JP0 A;  1T33 A;  1GV5 A;  2DA6 A;  1MSE C;  2HOA A;  3JRI A;  1Z77 A;  1FJL A;  3GTG J;  5M5X J;  3BR6 A;  3BQZ A;  4M3G A;  3LSJ A;  1FTZ A;  1P7I A;  1IC8 A;  1JTX A;  4A3C J;  1U9N A;  1K83 J;  3GTL J;  3S14 J;  2KT0 A;  1AKH A;  4MFE A;  4XK4 A;  5M3M J;  1IGN A;  2EZI A;  4FTH A;  4IHV A;  3BR0 A;  3G1M A;  1CQT A;  4G12 A;  3HOY J;  3GTO J;  3I4M J;  4FCY A;  5J1U A;  2XGD A;  1H8A C;  2YUS A;  3CMY A;  1PUF A;  1D5Y A;  3S2H J;  2K9Q A;  1IRZ A;  3C2B A;  5FKK A;  5K7F A;  2LK2 A;  1Z0X A;  5EZG A;  4JX5 A;  2LD5 A;  2AO9 A;  2XPU A;  3PM1 A;  5C4X J;  1QVU A;  2FD5 A;  2M34 A;  1OCT C;  1WI3 A;  5HOD A;  1WCM J;  4CYC A;  2KDZ A;  1BL0 A;  2B63 J;  4V2G A;  1O4X A;  4A3B J;  2HOS A;  3JRB A;  3PO3 J;  2DN0 A;  2NVQ J;  5DS9 A;  5C4J J;  2HXI A;  3HGY A;  1MNM C;  4DZP A;  5F0C A;  1WH5 A;  1GV2 A;  1IUF A;  4DYC A;  1JUM A;  1AKH B;  4B1R A;  1ORK A;  2DMN A;  1NK3 P;  1TC3 C;  2R7Z J;  3QPS A;  4A93 J;  1WH7 A;  2M8G X;  2XGE A;  5JLX A;  1JT6 A;  4HNV A;  5J1R A;  2EQR A;  3HOV J;  4MLO A;  5JLW A;  3Q0W A;  1XS9 A;  1MBJ A;  5E3L A;  3OSF A;  1PUF B;  5M3F J;  2JK3 A;  2L0K A;  1Q1V A;  2ECB A;  4C3I J;  4I6Z A;  1BW5 A;  1ETX A;  1S7E A;  3MVP A;  5E3M A;  3CQZ J;  3JRF A;  2FX0 A;  5F1J A;  4RDU A;  4D7N A;  4CYC B;  3IV5 A;  3B6A A;  3HOW J;  3G1O A;  2HXO A;  2R5Y B;  3OSG A;  1EF4 A;  5DTD A;  5IPA A;  4D5F A;  2VUM J;  1XG1 A;  1JKP C;  2CJJ A;  3JRC A;  4D7M A;  1GVD A;  2O9L A;  5F04 A;  2DA1 A;  3FKI J;  1IDY A;  1JKR C;  4DYR A;  3LSR A;  4NDL A;  2YU9 J;  3FIW A;  4BBR J;  2CRG A;  1ZKG A;  2JA7 J;  1U78 A;  4A3F J;  4BY1 J;  3JRG A;  1I50 J;  4Y52 J;  2HI3 A;  4B3A A;  2Y9Z A;  2DMP A;  4UUS A;  3ZQF A;  5IOZ A;  4FIS A;  1SAN A;  1ZR4 A;  4M3F A;  1K61 A;  2DA7 A;  3F0C A;  1Y1V J;  3BTL A;  4MIM A;  2JA5 J;  3HDD A;  3BR1 A;  3IH4 A;  1IJW C;  2MG4 A;  3DCF A;  2COB A;  2XPV A;  3ZQL A;  1FEX A;  3BG9 A;  1WPK A;  5C3E J;  3ZOB A;  3I4N J;  1JUP A;  2ELK A;  3FIS A;  3A01 A;  1BW6 A;  3WHC A;  3CCY A;  3RKQ A;  5GP9 A;  5F08 A;  5EG0 B;  2WV1 A;  3UKG A;  1VFC A;  1RKT A;  4W97 A;  1MH4 A;  3QPL A;  2D5V A;  2M9H A;  2K40 A;  4UUS B;  3B6C A;  1JGG A;  4XRM A;  3Q0V A;  4DYQ A;  2HOT A;  1RKW A;  2EZH A;  5FJ8 J;  2H1K A;  2ZB9 A;  3H3V K;  2LP0 A;  1H88 C;  4QSH A;  1X2N A;  2E19 A;  3JRD A;  3HKZ N; 
#chains in the Genus database with same CATH topology
 3W6V A;  1XTA A;  1AWC A;  3LWF A;  3AG2 H;  3HUG A;  2MA3 A;  4XLN F;  4B48 A;  2V9P A;  2O8K A;  3M8F A;  4EEF G;  1Q1H A;  2WV0 A;  2XSD C;  4MNU A;  4BXF A;  2EK5 A;  4RGU A;  3ZR8 X;  3OS0 A;  5EDN A;  2AQF A;  3OYJ A;  5ERI A;  2P5V A;  5KAI C;  3DTE A;  1WVR A;  4ZYD A;  1BN5 A;  3COA C;  2HS5 A;  4E7H A;  1FMV A;  1YYV A;  2HGC A;  2R7O A;  2XV4 S;  3VWB A;  2XHK A;  4HQE A;  1MJA A;  2EWN A;  2R7F A;  2VKH A;  4I98 B;  2VJI A;  3FK6 A;  2K02 A;  3K9T A;  4L18 B;  1XSX A;  3GXO A;  4IOA F;  3D5L A;  1G3T A;  1USS A;  2AXL A;  3AAF A;  4HYE A;  2X6X A;  3ESW B;  3R0J A;  1X3W B;  2JN6 A;  4A6D A;  4BQQ A;  1P9Q C;  5LEJ A;  1LNW A;  2LH9 A;  4EV0 A;  2DFE A;  1D5V A;  1EH7 A;  1FSH A;  3GFI A;  5EGO A;  3SJM A;  4G8X A;  5FGM A;  2WAD A;  4EQQ A;  2K7L A;  2WC2 A;  3R61 A;  2FA5 A;  2EIN H;  1VI0 A;  1MMD A;  3O8G A;  3K4M A;  1DPR A;  3P7N A;  4KMF A;  2B7E A;  3G3Z A;  2CFX A;  4RMN A;  4XN3 A;  5IYD J;  2VQH A;  4MTE A;  2R5Z A;  2KRH A;  1TL8 A;  2VXD A;  3V42 A;  3I9V 2;  3OMY A;  3H36 A;  3ECH A;  3OYI A;  2G0E A;  1YQA A;  1D0Z A;  2XAG A;  3TW7 A;  1DGW Y;  1MH3 A;  1SFE A;  3OYK A;  2QQ8 A;  2E1M B;  3GFM A;  3D5S C;  2ELH A;  1WJC A;  2NNY A;  4O3M A;  3HB9 A;  2MGQ A;  2DOA A;  1Z21 A;  5CJ9 A;  3BT9 A;  4OMZ A;  3AKZ A;  5E17 F;  3E6M A;  4A12 A;  3ELK A;  2FNA A;  4PFP A;  1N75 A;  2RV8 A;  4KIT B;  2W00 A;  5IT9 K;  1TWC J;  2W82 A;  3L00 A;  4ZDP A;  2FNP A;  2KZV A;  3BG3 A;  4LLG F;  1T95 A;  1YS6 A;  4ENJ A;  3QP5 A;  4CZZ A;  3H0G J;  2Z2S B;  3KP5 A;  3QOP A;  1BI1 A;  3PIO F;  4R79 A;  3MMY B;  2UV1 A;  1D1A A;  1YTY A;  3HOZ J;  4ASN A;  2STT A;  5L3D A;  3TDU C;  2ME0 A;  3GZ6 A;  2IEK A;  4XIC A;  3F8N A;  3HG9 A;  4F7Z A;  2L7M P;  5F6F A;  4M9Z A;  2ESN A;  4D1Q A;  2HQ5 A;  3JW4 A;  2IRF G;  3TO6 A;  3R60 A;  1X1A A;  3I3L A;  3EYY A;  4GGG A;  4RM2 A;  3HM5 A;  1BA5 A;  1OR7 C;  4XM3 A;  3QOE A;  1F43 A;  3SYT A;  5EYR A;  1JKQ C;  1K79 A;  4D5C A;  2DMQ A;  1S29 A;  1OQY A;  2ETH A;  1B9M A;  4PGH A;  4A3K J;  2JSC A;  1B8I B;  5FKO A;  2M30 A;  4ZH4 F;  1QHH D;  5CVJ A;  1I6X A;  3TMO A;  1FP2 A;  4EM0 B;  3I55 I;  3KLO A;  1HDD C;  2EH3 A;  3N05 A;  3ULQ B;  3CCS I;  3F22 A;  3ABK H;  3SEQ A;  2JMW A;  3CDL A;  2LR8 A;  3ABU A;  4DW6 A;  4RBO A;  3JSO A;  2M1B A;  2VE8 A;  1LPQ A;  2XPW A;  1T56 A;  3KEO A;  1NG6 A;  3GLX A;  3HPG A;  3ABT A;  5DUI A;  1H9T A;  4BJ6 C;  4ZYH A;  3H5R A;  5ILV A;  4EVI A;  4HBL A;  4V19 K;  2DLL A;  2LOO A;  5J3L A;  1PJR A;  1LE8 B;  2X9D A;  1ZQ3 P;  1UHS A;  2Y75 A;  4XNF A;  2OBP A;  3K1N A;  1CGP A;  4BXU A;  4PFO A;  2BZT A;  3BR5 A;  2VIX A;  2H94 A;  2NVY J;  2HZT A;  4B44 A;  3QPT A;  2MFZ A;  1IN6 A;  4HZF A;  3KP2 A;  2GOM A;  1J5Y A;  5E79 C;  2X1E A;  2XC7 A;  4M6Y A;  4C3J J;  1W36 C;  1YX5 A;  5E3O A;  3BCB A;  5F27 A;  1SVL A;  5IP6 A;  2I10 A;  1A5J A;  3QWL A;  3ZQI A;  3BTC A;  3KP7 A;  3CCJ I;  2NVX J;  2IBD A;  3R6S A;  4E7L A;  4UV9 A;  2ZME C;  1R5I D;  2WB1 N;  2DJI A;  1R1U A;  2EA2 A;  4BBS J;  1QZZ A;  1OYW A;  2PJP A;  1BBY A;  1G4D A;  4IHT A;  1EKE A;  4CHU A;  4XN0 A;  4I0A A;  1WQ2 A;  3IL2 A;  4IOC F;  1S5L C;  3KFW X;  1J7K A;  4RGX A;  3VYU B;  2E2J J;  3H3Z A;  4FHT A;  1QVT A;  5J8F A;  2HVS A;  3E5U A;  2ISZ A;  3DPU A;  2ECC A;  2OV7 A;  1X2M A;  1UG2 A;  2F5D A;  5DM7 F;  3TKY A;  4I09 A;  2Z3Y A;  4M73 A;  4YEJ A;  3L7W A;  5HS9 A;  3OYA A;  2LLK A;  3KCC A;  4UHT A;  3HOU J;  2OCC H;  2CV2 A;  2XAS A;  4HNT A;  1DP7 P;  4HX8 A;  2A6E F;  3VOE A;  2VKE A;  1U8B A;  2L7F P;  1YG2 A;  3U1K A;  4Y33 A;  4FE7 A;  2A61 A;  2WAQ N;  5C44 J;  1B1B A;  1HKT A;  2EFO A;  2XIG A;  3UR3 C;  3OYH A;  3I56 I;  3BWG A;  1P6R A;  3PQJ A;  5FLM J;  3D1N I;  2NOG A;  4BAC A;  2HTJ A;  2EBI A;  3EDP A;  2QSF X;  2K9S A;  2DAO A;  3DTK A;  5GTH C;  3FX3 A;  3PUB A;  1TT5 B;  3BJA A;  4D0P A;  4ZC3 A;  1R22 A;  2IXS A;  5EEH A;  2JA8 J;  1ZRD A;  5B3S H;  5JFR A;  1IF1 A;  2JA6 J;  3RZD J;  3UNG C;  4IL6 C;  1VTN C;  2R7X A;  3KPH A;  2KIF A;  2W57 A;  2JJ7 A;  5CKT A;  4EGZ A;  3A2K A;  4BNC A;  3RKY A;  3ZMT A;  2IA2 A;  4LJZ F;  1GHC A;  5LHI A;  1SMY F;  3MKZ A;  3OR2 C;  3H35 A;  4AYB N;  4BE1 A;  2F5V A;  3F21 A;  3HZJ A;  2IGN A;  2GXA A;  3GF2 A;  3J7A O;  1TWH J;  2KZG A;  3B02 A;  4C3H J;  3C3W A;  2GXG A;  4U7D A;  2AQE A;  4GCV A;  4A5N A;  2X1C A;  4C30 A;  2BHY A;  1DUX C;  1OLT A;  3IH2 A;  4XQF A;  3JSP A;  1PDN C;  1DGR M;  3MFK A;  3DV8 A;  2DOF A;  2LMD A;  1LDD A;  5AIQ A;  2ZXJ A;  1IV8 A;  2Y48 A;  2RNJ A;  3LL7 A;  1MNE A;  4I7H A;  3RSN A;  1T33 A;  4BDZ A;  1NH3 A;  2MBF A;  2DA6 A;  4B8X A;  5HLG A;  3ISP A;  3JRI A;  1Z77 A;  1ZLK A;  3CP2 A;  2ZFW A;  3PSF A;  1IW7 F;  3LSJ A;  1FTZ A;  5FLX K;  2IS4 A;  1MW7 A;  5D5V B;  2ZME B;  1Z9C A;  1W4M A;  4E7J A;  2G9W A;  1U9N A;  5FRM A;  1HKQ A;  3W6K B;  3S14 J;  1AKH A;  4XOR A;  1ZGJ A;  4ZYG A;  1QPM A;  4OIR F;  1XSV A;  1SD6 A;  1CQT A;  1IRF A;  3GTO J;  1VQ7 I;  4FCY A;  5J1U A;  3RKX A;  3OR1 C;  2QLZ A;  5EJC A;  1CF7 B;  2GAU A;  4HX7 A;  3FXQ A;  5D8K B;  1PUF A;  2HPM A;  1YX3 A;  4F3Q A;  2K9Q A;  3CJT B;  4RGR A;  1IRZ A;  1QU3 A;  3I58 A;  5HDN A;  5K7F A;  2FQ3 A;  5FD5 A;  2EIJ H;  2LRE A;  4JX5 A;  4S04 A;  1SEU A;  2BY3 A;  2IT0 A;  1OPC A;  3EUA A;  2M0M A;  2HOS A;  3JRB A;  4B47 A;  3CUQ C;  2A6T A;  1FMW A;  3GUD A;  5D6E A;  3M8J A;  3CCL I;  1IAW A;  4DZP A;  2PMZ A;  1IUF A;  5B66 C;  1JUM A;  4HST A;  2L4M A;  3DBR B;  1OCC H;  4B1R A;  2ZJR F;  3DBH B;  3NWS A;  2XGE A;  4HNV A;  2EQR A;  3HOV J;  2WA0 A;  5JLW A;  3K70 C;  4ENM A;  3Q0W A;  4S05 A;  1XS9 A;  2MD0 A;  2CFO A;  2HWV A;  1HKS A;  2L0K A;  3GLL A;  2K4J A;  1Q1V A;  4C3I J;  3KET A;  4I6Z A;  1T98 A;  5J4Y A;  4LIT A;  5E3M A;  3CQZ J;  4AVZ A;  1BR1 A;  3JRF A;  4BJ5 C;  1V5F A;  3BC8 A;  1DPU A;  2E1C A;  4XKV A;  4C9Y A;  4CYC B;  1WKM A;  5EEG A;  2H8W A;  5JR3 A;  4BQN A;  4NNJ A;  2JUG A;  4HF2 A;  1YI2 I;  2R5Y B;  2BY1 A;  1GVJ A;  3MAJ A;  3LSK A;  4CCJ A;  5IPA A;  1KON A;  2MD5 A;  5LD2 C;  3JRC A;  4D7M A;  2XUB A;  3OYN A;  2CQN A;  4DYR A;  2YU9 J;  2VJJ A;  3LFK A;  2W4S A;  2PG4 A;  4BBR J;  3CO7 C;  1TP4 A;  2VPL A;  3ERM A;  4CA0 A;  2HI3 A;  2Y9Z A;  4L9N A;  1FBU A;  5IOZ A;  1D8J A;  4HV6 A;  1WSU A;  3K2Z A;  1SAN A;  3CMA I;  3U1D A;  2DA7 A;  3A4C A;  4Z6Y A;  2D45 A;  4GRI A;  3BTL A;  4ZZD A;  2R7Q A;  2OUM A;  1LQ1 A;  3HRM A;  2GA2 A;  2KRC A;  1FYM A;  3MCZ A;  1IJW C;  4GDF A;  2JA2 A;  1KA8 A;  2A3S A;  2COB A;  3EQL F;  3ZQL A;  4RAZ A;  3BG9 A;  1V55 H;  1YS7 A;  3PNV A;  4WXC A;  5DYM A;  4G7Z F;  2MC4 A;  1J0R A;  1CF7 A;  3DQV C;  1SC7 A;  1P4A A;  1BW6 A;  2X51 A;  5GP9 A;  1KU2 A;  4FET A;  3H0D A;  3PNT A;  4EJV A;  2M87 A;  1VFC A;  1RKT A;  4NC6 A;  2D1H A;  3CJR B;  3EUH C;  3HRT A;  2HU9 A;  4IF4 A;  3KYD B;  1TNS A;  3OYB A;  3HXL A;  1R23 A;  3BPX A;  2Q1Z B;  3SZT A;  2NXN B;  4ITV A;  3OS2 A;  2HOT A;  2E5N A;  1T39 A;  5FJ8 J;  3S3M A;  2DCE A;  4IX7 A;  3CUQ B;  2BEO A;  3C18 A;  3T8T A;  3F8M A;  1H88 C;  4NB5 A;  4QSH A;  3VSL A;  1MMS A;  5AIP A;  1XPX A;  3RPQ A;  3JRD A;  4D9J A;  3HKZ N;  1K6O A;  2BBY A;  3KIO A;  3M1E A;  1R9T J;  4G9Y A;  3S1M J;  5FFZ A;  3QP6 A;  1O3S A;  1S6L A;  5L3E A;  2P6T A;  5KK1 A;  2K5C A;  4F52 A;  3A01 B;  3HEF A;  3I54 A;  3CC7 I;  3M3Y J;  4EM2 A;  3RQI A;  1WFX A;  2WAF A;  2XAU A;  4X0G A;  4HDU A;  1HBX G;  3IAS 2;  4M9X A;  2EJR A;  3HPH A;  3J80 Z;  1G3Y A;  3NRV A;  2F4M B;  2CYY A;  3FXM A;  4BAY A;  3ZQH A;  3H9J A;  3BRO A;  5J1Y A;  4S0H B;  2PQ8 A;  1BR4 A;  5HDG A;  3GTP J;  1MZB A;  1KQ8 A;  1JJ6 C;  2AXT C;  4NQW A;  1Z1D A;  5BNG A;  3CCQ I;  2R5Y A;  2V9V A;  4EMS A;  1JHH A;  1NHA A;  1K78 A;  4WF2 A;  4A3L J;  4ZDO A;  1E3P A;  5J8C A;  3I4P A;  3EUK L;  5EF6 A;  3NEU A;  1K4S A;  4DOZ A;  4KT5 C;  5TIS C;  5LHG A;  4HF0 A;  2AHQ A;  3OS1 A;  5H20 A;  1MSF C;  1LJ9 A;  2L9R A;  3R0A A;  2HYG D;  5ICC A;  4AU7 A;  4OIQ F;  2FSW A;  4HLX A;  2TDX A;  1ZRF A;  1FLI A;  4UY8 I;  3C2H A;  1MDM A;  3WOD F;  2V1N A;  3V7S A;  1E3H A;  4WCG A;  1EV7 A;  1DP3 A;  3CC2 I;  1ERD A;  1RC9 A;  4XKC A;  1JUS A;  4Q5S F;  1QO0 D;  4AVP A;  4LFU A;  1ZGW A;  4I0B A;  1YOV B;  3K1M A;  4A2U A;  4CDG A;  1R71 A;  4IQ4 A;  1QA6 A;  1NG7 A;  2RRE A;  3QU6 A;  2KRF A;  4U7B A;  4DQ2 A;  1ITY A;  2VKV A;  3O6B B;  3BCA A;  4Y17 A;  1MBH A;  1I5Z A;  1X4O A;  3ECO A;  4OAZ A;  2WY7 Q;  2CW8 A;  2ZJ2 A;  5AON A;  5BPI A;  2A07 F;  2XRN A;  2F5E A;  4CYD A;  1BJA A;  5F64 A;  3G1L A;  4HOB A;  4CIC A;  4TV7 A;  4WXD A;  5EGO B;  2DBB A;  2NS8 A;  4KDP A;  2F6C A;  4LK0 F;  1DU0 A;  2EB7 A;  5E1W A;  1WJD A;  4FX4 A;  1D0Y A;  3JRE A;  2VXZ A;  2H6C A;  2QZ8 A;  4ZYE A;  2IS6 A;  2R0Q C;  1RNL A;  2IS2 A;  2CO5 A;  1XMX A;  2QQ9 A;  2Y0S A;  4AIH A;  4CCL A;  2R5Z B;  3CUQ A;  1W7P A;  3TO7 A;  2ZNZ A;  3O8H A;  1XMK A;  2VN2 A;  5M5Y J;  2BHZ A;  1AA7 A;  1QNT A;  2IVM A;  1GXP A;  5D5X B;  4RB2 C;  2K85 A;  3BG7 A;  1RR7 A;  1U2W A;  2GBY A;  3BQY A;  3DTI A;  3FHZ A;  5FKM A;  2GM4 A;  1Y8Q B;  3CJQ B;  2OJE D;  2R7D A;  1B9N A;  1KU3 A;  3DPT A;  2XRO A;  1JJ8 C;  3RTR A;  2KIQ A;  1YO5 C;  3WTV C;  2M3A A;  1LKX A;  3K7A J;  4MFD A;  2CQ7 A;  2R3S A;  4CCM A;  3ZGK A;  3LQQ A;  5ED4 A;  2XF7 A;  4M6V A;  4RLF A;  2VBY A;  1TLH B;  2P5L C;  2GWR A;  1OJL A;  1V54 H;  3TP3 A;  2E7W A;  1HCR A;  1O7L A;  5J40 A;  3MQ0 A;  2B0L A;  3FBN B;  3NWT A;  4KJZ A;  3T1B A;  4L5I A;  4IHW A;  2CQQ A;  4U0V A;  4E70 A;  4EAT A;  1ETY A;  3F3X A;  1QHG A;  3REO A;  2IP2 A;  3FMS A;  3S16 J;  3DXJ F;  4Z2Y A;  4C2U A;  2I8D A;  5A2Q K;  2ZXI A;  3U2R A;  2N8G A;  2XAJ A;  2J5P A;  2LF8 A;  2COM A;  4A3G J;  3GBG A;  1WRJ A;  2YSR A;  2ZBK A;  4A3E J;  4LLN A;  1P7J A;  3E6C C;  1ZEL A;  1FZP B;  2DW4 A;  5IT3 A;  3BG5 A;  2DJN A;  1LB2 A;  4FQG A;  3WG7 H;  1FNN A;  2LF7 A;  2WWY A;  2LKP A;  3TQN A;  4F92 B;  3VYT B;  1ENH A;  2TCT A;  2VKD A;  1SAX A;  3RDI A;  1T38 A;  2ID6 A;  4IHY A;  2E34 A;  2CQK A;  5D4S A;  3HBL A;  2KQR A;  2LKS A;  1MD0 A;  3CC4 I;  2Q0O A;  1J2X A;  3FWE A;  4XLE A;  2HYF A;  2V4J C;  2F4O B;  3MKL A;  4F91 B;  1D1C A;  1SFU A;  1J9I A;  2X6O A;  5IY5 H;  3HOX J;  1WWX A;  1BM9 A;  2K9L A;  1J09 A;  4X6A J;  3MEX A;  4AC0 A;  2Y31 A;  4OIP F;  4IRI A;  2VOO A;  1GDT A;  3ZQG A;  1VF9 A;  2E2I J;  3EUH A;  1X1B A;  3I71 A;  2VBX A;  5CVV A;  3GTM J;  3AG1 H;  2KHM A;  2ZO4 A;  2OC6 A;  1ZK8 A;  5B1A H;  1X1P A;  4XSZ F;  1SFK A;  2DMT A;  2VJ5 A;  1SFO J;  3CF2 A;  4N4N B;  4BH9 A;  3QYF A;  2MAB A;  2P6S A;  4U88 A;  1BR2 A;  4XLH A;  3FXR A;  3HSE A;  3LOC A;  2XAF A;  3RI4 A;  4LK1 F;  2OZ6 A;  3ZCO A;  2CQX A;  4RB1 A;  5E8I A;  5JHU A;  5KNL A;  2Z16 A;  5K1Y A;  3TDZ C;  4A69 C;  1GT0 C;  2IA0 A;  1N25 A;  4NC7 A;  1Y1W J;  4G7H F;  1Y39 A;  4J00 A;  2JPB A;  1VND A;  3PIP F;  1XC5 A;  2X4H A;  1IRX A;  1GLN A;  1BI0 A;  2K86 A;  1T0F A;  3A0B C;  3JAM Z;  3L1P A;  3JRH A;  4KIB A;  3RJP A;  5BS6 A;  4A3D J;  1HF0 A;  3VDX A;  2V1X A;  4OMY A;  2H6B A;  1JGS A;  1UEL B;  2DOE A;  4ABZ A;  4QLC U;  1FTT A;  1U6G A;  2OQR A;  2V9K A;  1ZN2 A;  2P8T A;  2CH0 A;  5K7H A;  3V4G A;  4LOC A;  3OWT A;  5EEA A;  2W48 A;  1FOW A;  2VPR A;  3RPU A;  1O3Q A;  1R36 A;  2O3F A;  1TQM A;  3E7L A;  4PZJ A;  3QRF F;  4M72 A;  2J5O A;  1IN8 A;  4HLY A;  3ZQC A;  1LEB A;  4XON A;  2AS5 F;  2Y2Z A;  4DZJ A;  1HW2 A;  4B3X A;  1ZTR A;  4WX9 A;  3FM5 A;  2IW5 A;  4E7S A;  2GLO A;  1SD5 A;  4LG3 A;  4KIG A;  1E2X A;  2VQG A;  4C2M J;  2QSH X;  2LFB A;  4EJT A;  2EFP A;  2M4G A;  5J47 A;  2NVT J;  2M2E A;  2QGU A;  3KLN A;  1RES A;  2V6C A;  2VOD A;  4HF1 A;  5FB2 A;  4KNY A;  4OIO F;  2VT2 A;  3FKJ A;  2X6Y A;  3QYB A;  3E5Q A;  3K10 A;  3DKY A;  3TW6 A;  1IN7 A;  2XB0 X;  4BQO A;  2EV6 A;  1G6N A;  3J81 K;  2L5Q A;  3WE2 A;  1BOB A;  3CCV I;  1FPQ A;  1TW2 A;  2E1N A;  2KDO A;  3L2Q A;  4MQ9 F;  3LQR A;  1MSE C;  4PJN A;  1E17 A;  5M5X J;  3BQZ A;  1R7J A;  1P7I A;  2CS3 A;  3PJR A;  4KIC A;  3K4N A;  1UJ8 A;  4RS8 A;  4A3C J;  2QQB A;  3OY9 A;  1J75 A;  1O3T A;  2E7X A;  2NYX A;  3OL4 A;  1HC8 A;  4XK4 A;  3NQO A;  2EZI A;  2V1D A;  4IHV A;  3G1M A;  3HHG A;  2XDV A;  4KUM A;  4BQA A;  3I4M J;  2XGD A;  1H8A C;  3H92 A;  1UG0 A;  1D5Y A;  1BIB A;  1YJW I;  4DJA A;  3H5N A;  3FF5 A;  3W3C A;  5D4R A;  5E1X A;  1HW1 A;  2CV0 A;  5EZG A;  5ILU A;  1IXC A;  2AO9 A;  1BI3 A;  3PM1 A;  3K4K A;  4M71 A;  1QVU A;  1OCT C;  1WI3 A;  2VAS A;  1WCM J;  2KDZ A;  2FOW A;  3K0L A;  1O4X A;  4XLP F;  2K4B A;  3IWF A;  3Q5F A;  3M7G A;  3WU2 C;  3DEE A;  2CWE A;  2Z9O A;  3TBI A;  4I2O A;  1MNM C;  2YX4 A;  4WK8 F;  3J7Y J;  1AKH B;  3F6V A;  3HIF A;  1ORK A;  2A5Y B;  1NK3 P;  1BC7 C;  4KYW A;  2GXB A;  4A93 J;  1WH7 A;  4C2T A;  3Q9V A;  1FX7 A;  2PN6 A;  5J1R A;  2MH2 A;  1AOY A;  1KYW A;  4MLO A;  2JVG A;  4L0Y B;  1H0M A;  3OSF A;  4BUP A;  2PJR B;  1PUF B;  1FBS A;  1LVK A;  2PFB A;  5M3F J;  1VQ4 I;  1WJB A;  1ETX A;  2VC0 A;  3LSI A;  1OMI A;  5ICF A;  1PP7 U;  2M7A A;  5CLS A;  5CQE A;  2DK5 A;  2V26 A;  3ZQQ A;  4JBA A;  3KZI C;  1F1Z A;  3E0J B;  4IZZ A;  2VE9 A;  4D5F A;  5HNH A;  3GME A;  1JKP C;  1ONV A;  4RB0 A;  1GVD A;  2UXX A;  4B09 A;  3HL2 A;  2HKX A;  3FKI J;  3ZMD A;  4OOI A;  1JKR C;  4A0Z A;  2DO7 A;  3T5X A;  3MZH A;  4MTD A;  3LSR A;  4NDL A;  1R00 A;  1LFP A;  1W36 D;  4LMY A;  3WGG A;  3D0S A;  3KX2 A;  1KQ9 A;  1ZKG A;  2BV6 A;  3JRG A;  4WWC A;  2K27 A;  4LB6 B;  2HNH A;  2VQL A;  4BS9 A;  4Y52 J;  2FU4 A;  3VOD A;  1EJ9 A;  2DMP A;  4P9F A;  4EJU A;  4UUS A;  2PLY A;  5BOX A;  5JHF A;  2PBI A;  1K61 A;  1P2F A;  1PP8 F;  4XOP A;  1LUJ B;  4MIM A;  1R4N B;  2VBW A;  1B59 A;  3BR1 A;  5LEK A;  1RIO H;  2KJB A;  2DK8 A;  3F23 A;  1U0J A;  4R8H A;  1IUY A;  4NBQ A;  4UNO A;  1VZ0 A;  3H9Q A;  1WJ5 A;  4KIF A;  2ELK A;  5E8G A;  3FIS A;  5D5U B;  3V8J A;  2VON A;  4NUB A;  4Q4Z F;  3N97 A;  1YJ9 I;  1PVE A;  2ISY A;  4HDV A;  2F48 A;  4I01 A;  5EG0 B;  1R4M B;  2Q8K A;  4W97 A;  3V7C A;  1DDN A;  5LBQ A;  1TNT A;  5B5E C;  3V8L A;  2IA1 A;  1MH4 A;  2BW3 A;  3I5U A;  3QPL A;  4PSW A;  1N78 A;  3RKW A;  3CCM I;  2Z33 A;  2K40 A;  3DKW A;  3B6C A;  2DPD A;  2BY2 A;  3KP4 A;  3ZXS A;  4AIJ A;  4P1W A;  4DYQ A;  1U3E M;  2H1K A;  4G6Q A;  1VQ8 I;  3H3V K;  2UZK A;  3WU1 B;  4OU0 A;  3ZP5 A;  3KYL A;  1X2N A;  2E19 A;  1EH6 A;  2KFD A;  2KP6 A;  2JZY A;  3GZ5 A;  2VL8 A;  4HG2 A;  5D8L B;  2HDW A;  4II2 A;  4BGD A;  3LSH A;  1DU6 A;  2A5W A;  4QPQ A;  3WGH A;  2PJR A;  2DYS H;  4ENN A;  2ZCW A;  3RYR A;  1G3S A;  2XAH A;  2EZK A;  4YII A;  4LGW A;  3TL4 X;  1WJA A;  2ZXH A;  1IDZ A;  3EET A;  1T2K A;  4B4C A;  3ABM H;  2LY2 A;  3FXJ A;  3QYE A;  3VEP A;  1FY7 A;  2WAE A;  1MBK A;  2RAE A;  2YR2 A;  4UUV A;  2LTP A;  2M8E A;  4G7O F;  3BLY A;  1IN4 A;  1Y6I A;  2PMZ N;  1ZRC A;  1HOM A;  3I53 A;  2QM3 A;  3HTS B;  2DA3 A;  4ZZL A;  1XGN A;  5CVR A;  1FSE A;  1KU7 A;  4LG0 A;  3W2A A;  1VQM I;  1E3O C;  4ZJZ A;  3EPZ A;  5FKL A;  2MSY A;  2D2W A;  3F8F A;  4XOT A;  5CVI A;  4BE2 A;  3DEW A;  4QPO A;  2LKX A;  4ETS A;  2FJ1 A;  3CF5 F;  2CSO A;  1Z05 A;  2XB5 A;  2NS7 A;  3BR3 A;  4PUS A;  1V3F A;  1BIA A;  1IG7 A;  2EZL A;  2XAQ A;  5E18 F;  3P9C A;  4GYI A;  3DFG A;  3G6E I;  4XLC A;  1TWF J;  3BP8 A;  2JTV A;  4M3D A;  4CUG A;  1IN5 A;  2W85 A;  4B43 A;  1YLF A;  1YIT I;  4BU2 A;  1W1W E;  1OYY A;  2DDB A;  4NQW B;  4Y15 A;  5IT9 Z;  3WTZ A;  1D1B A;  3GO5 A;  2Q2E A;  1APL C;  4OIN F;  6PAX A;  1HLV A;  2DYR H;  1K78 B;  2CW7 A;  3DLA A;  2FBI A;  3KP6 A;  4G94 A;  4Q47 A;  5EG0 A;  5H6Q A;  3W2W A;  2DA5 A;  3CP8 A;  4UVB A;  1LFB A;  4BHC A;  2RGV A;  3GFJ A;  2HTS A;  4N0B A;  2K3P A;  1I6H J;  3S93 A;  1XDU A;  2LRD A;  3FXK A;  3LSG A;  1MDM B;  5GPC A;  1W7P D;  5DDG A;  3PFI A;  1Z3Y A;  1UHW A;  1XX5 A;  2DOD A;  3F6O A;  4G6D A;  3W2V A;  1I27 A;  3GTK J;  1V5E A;  5LRS A;  2RKH A;  2OTJ I;  2EPF A;  3LNQ A;  1SD4 A;  2L7Z A;  2OD5 A;  3A03 A;  1XCB A;  2M5W A;  4QWQ A;  2XRL A;  4HAM A;  4RAF A;  2JRM A;  3K70 D;  1VQK I;  4KT6 A;  1JXS A;  5F1R A;  3JTH A;  2CUZ A;  5HLH A;  4AIK A;  1U5T C;  3WTS C;  3BPV A;  1EA3 A;  4BHP A;  1S8N A;  1W5T A;  3GZN B;  3WTY C;  2ACJ A;  1XSD A;  1PYV A;  3BDD A;  1ZGA A;  2O6G E;  4R1H A;  2QCO A;  1OFC X;  3MZY A;  5FKN A;  1HXD A;  1E0E A;  2C6Y A;  3S17 J;  2FE3 A;  1UHM A;  2ELJ A;  4QTR A;  2FBK A;  1QQI A;  2L3D A;  1W7P B;  2RC4 A;  1A31 A;  2HZD A;  3C1D A;  4IHX A;  4MGR A;  2E1O A;  1F9N A;  3OIO A;  3V8K A;  1ZG3 A;  2QEX I;  2QEN A;  4FT8 A;  3RIR A;  2R7U A;  4HEA 2;  1V4R A;  2KKO A;  3ML6 A;  1R49 A;  1H89 C;  4N4O B;  2DMU A;  4RAG A;  3CJN A;  2HOE A;  4BHB A;  3D5R C;  5K7Z A;  1F5T A;  2HVR A;  4JOM A;  1TW3 A;  2QUF A;  4JYK A;  3ZMU A;  1T0F C;  1XD7 A;  3KP3 A;  4ZYA A;  5HOO A;  3DKX A;  2EV5 A;  3BTI A;  2MLG A;  1FP1 D;  2O8X A;  1B72 A;  4UUT A;  3K69 A;  3CDH A;  2P7C B;  3PQK A;  2RQP A;  1OIS A;  1F36 A;  2DU9 A;  4L9T A;  5FRO A;  4A0X A;  2W24 A;  3VYR B;  2HYJ A;  2OPT A;  2X1D A;  3HKZ A;  3K4B A;  5CYV A;  3WE3 A;  5GAG J;  3CME I;  2DA2 A;  1S3J A;  3E6B A;  3S2D J;  1WI9 A;  4BJT A;  2FUG 2;  1T08 B;  1ETV A;  1V5G A;  4KN7 X;  1A04 A;  3JTG A;  3SEZ A;  2HPI A;  2X48 A;  2R7V A;  1G2H A;  3SFI A;  4RAY A;  2OAZ A;  2RNG A;  3MN2 A;  4NHJ A;  1UMQ A;  4LIU A;  2WY8 Q;  1D3Y A;  5LLQ A;  1WGX A;  2H8R A;  2DTZ A;  2VI6 A;  1HST A;  2A68 F;  4GFB A;  2L9S A;  5HLI A;  2FEZ A;  3SDG A;  1W5C C;  5D5W B;  3F8B A;  2JUC A;  2E71 A;  1QRY A;  3ERE D;  2M45 A;  3F9K A;  3WTX C;  4L5J A;  4A3J J;  4PK4 A;  4LD5 A;  5IYB J;  2E36 A;  3QPH A;  3FDY A;  3ZN1 A;  4KIS A;  4YG2 F;  3TP0 A;  1LEA A;  2FOK A;  2LG4 A;  1I3Q J;  5IYC J;  2DI3 A;  2FF4 A;  4RLQ A;  3FXO A;  3I0T A;  3NAU A;  1X19 A;  2ZC2 A;  4A5M A;  1W0T A;  3ASO H;  2L7K A;  2EA4 A;  3P5J A;  4HNU A;  1S72 I;  2KIS A;  1U5T B;  2FRH A;  4CH7 A;  2QVO A;  3DLL F;  1YRN A;  3BR2 A;  1I1S A;  2Y0S N;  3TED A;  3OYF A;  2RN7 A;  3SZP A;  2O0Y A;  2ME6 A;  1X3Z B;  2DFH A;  1S7A A;  2EIL H;  4DGW B;  3GX4 X;  3RPU D;  4E7Z A;  2ZJQ F;  1JTY A;  3E6D A;  1OCZ H;  3OIP A;  2L9V A;  1KGS A;  3ZN0 A;  1KQ0 A;  2HFH A;  2OQG A;  3QAH A;  4I99 C;  3P9K A;  5FD6 A;  3IRR A;  3FZV A;  1RUN A;  3OOU A;  4GO1 A;  2KL4 A;  2O7O A;  4M3B A;  5H6R A;  1MBE A;  2MW8 A;  3KEQ A;  3OIQ A;  3L9F A;  4IEJ A;  1X1D A;  3AFH A;  4O5V A;  2MC3 A;  4L0Z B;  2IAI A;  3IHU A;  2W1O A;  4QIW N;  1Y8R B;  3VPR A;  1WJE A;  2MH9 A;  2GIV A;  1ETW A;  4O6J A;  3S1Q J;  5LHH A;  4W1U A;  4IRH A;  1YIO A;  3E1S A;  3A02 A;  2A05 A;  5FLX Z;  2CU7 A;  4IO9 F;  3N4M A;  4PDK A;  1MGT A;  3LA2 A;  2O5R A;  2BYV E;  4JP0 A;  1XB4 A;  3TOB A;  4EGY A;  1U8R A;  3GFL A;  2NRA C;  2HOA A;  2ICW G;  3ZQ7 A;  4OWR B;  1FJL A;  3GTG J;  4EJO A;  4U0Y A;  3M07 A;  4M3G A;  5ICG A;  3CCR I;  1IC8 A;  1JTX A;  4BEH A;  3OYG A;  1I1G A;  3MKY B;  4PJM A;  4MFE A;  2E35 A;  3O2P E;  3BG6 A;  1IGN A;  4FTH A;  3CD6 I;  4UB8 C;  3A1Y A;  4G12 A;  3HOY J;  1YE9 A;  2W25 A;  2DXI A;  1VQP I;  3CMY A;  2MYS A;  2OTL I;  3LAP A;  3S2H J;  5FKK A;  3MWM A;  5KHD A;  1XDS A;  2LK2 A;  3I59 A;  2KLO A;  1Z0X A;  5BQT A;  2LD5 A;  3L2V A;  4LB5 A;  2QYO A;  2XPU A;  1GXQ A;  2LSO A;  2M34 A;  4PJ0 C;  2X0L A;  1U5T A;  1YW8 A;  2B63 J;  4PSX A;  2KMU A;  4V2G A;  2Z99 A;  3S3O A;  2DN0 A;  4HRI A;  2NVQ J;  1UZC A;  4GXO A;  5DS9 A;  5C4J J;  4BYY A;  1X3U A;  3HGY A;  1J59 A;  5DCM A;  3GWZ A;  4DYC A;  4BDY A;  4KMU X;  5HVQ C;  3FMQ A;  2VT3 A;  2DMN A;  3IP4 B;  2R7W A;  1TC3 C;  1WZ2 A;  3QPS A;  2R7Z J;  1ODD A;  2M8G X;  3CDI A;  2UUZ A;  2VQC A;  2QSG X;  3HOT A;  1JT6 A;  3F8C A;  3LSM A;  4XKW A;  3L09 A;  3DPL C;  5LGN A;  2EFW A;  3LST A;  1L0O C;  1MBJ A;  3BY6 A;  1L3L A;  3DEU A;  3VB2 A;  3PL8 A;  3L2W A;  1ON1 A;  2XKO A;  1FBQ A;  3DU6 A;  2R4G A;  1S7E A;  4XLF A;  2FX0 A;  1VQ9 I;  1ZG1 A;  2ZFU A;  4RDU A;  3GEZ A;  2PEX A;  4D7N A;  1VQL I;  1G8X A;  1ZLJ A;  2I5U A;  3IV5 A;  2HDC A;  1BI2 A;  1X1C A;  1FYK A;  4A6E A;  3L2U A;  3PUF A;  2HXO A;  4ZDL A;  2Y69 H;  2E5Z A;  3K4C A;  5DTD A;  2VUM J;  2CJJ A;  2NS0 A;  2CMP A;  1Z67 A;  4UVA A;  3SXY A;  2XF5 A;  3QOD A;  3ZMZ A;  4DBR A;  1YHQ I;  2ZJP F;  3ONQ A;  2CRG A;  2YX7 A;  4BL0 B;  1QZE A;  4A3F J;  4BY1 J;  1T6S A;  2ZXW H;  2BGC A;  2PX9 A;  4B3A A;  2HKO A;  4KN4 X;  1OCO H;  1MMG A;  1QZY A;  4J01 A;  1ZHF A;  3P9I A;  3KE2 A;  3M1C A;  4FIS A;  1JE8 A;  3HJE A;  5TJJ A;  1BOA A;  4EJW A;  3CCE I;  3TO9 A;  3F0C A;  1Y1V J;  3PNY A;  2BVM A;  3J7Z I;  2JA5 J;  1X4P A;  3GW2 A;  3HDD A;  3J7A Y;  1MND A;  3IH4 A;  2IJL A;  1YW7 A;  2ZSH B;  5TRD A;  3DCF A;  3IAM 2;  1K6Y A;  5C3E J;  4F93 B;  3OYM A;  5DD4 A;  4M6X A;  4CO8 A;  2M7B A;  4ESJ A;  3I4N J;  1YJN I;  2XF6 A;  1JUP A;  3A0H C;  3WHC A;  1OKR A;  1XMA A;  3RKQ A;  3K4L A;  3G4S I;  2KIU A;  2WV1 A;  4XR6 A;  4H4K C;  3UKG A;  4F55 A;  1W5S A;  1ON2 A;  2D5V A;  3HC7 A;  4AID A;  2M9H A;  2EIK H;  2NVU B;  4UUS B;  3Q0V A;  2P5K A;  3DP7 A;  1O3R A;  1IXR C;  2ZB9 A;  2DDA A;  2LP0 A;  3FM3 A;  2LBF B;  3OYE A;  1S9H A;  1FOY A;  4Q48 A;  5HNF A;  2OA4 A;  2UXN A;  3H3U A;  2NOJ B;  2DTR A;  3KEY A;  5M5W J;  5E1Z B;  3OYL A;  2YS9 A;  4MEX F;  1ACI A;  4N9I A;  1SFX A;  3K6G A;  5HS8 A;  5LFA A;  1NTC A;  2FXA A;  4XRS A;  4E7I A;  2E60 A;  3GTQ J;  1UFM A;  2FML A;  3CLQ A;  4WXH A;  1RZ4 A;  2P7V B;  2ID3 A;  1MJ9 A;  5LGT A;  4MO7 A;  2BW3 B;  1UB9 A;  3OYD A;  3BZ6 A;  4JX6 A;  4AUX A;  2CGP A;  3IC7 A;  2QF7 A;  3DWL E;  4ANJ A;  3O3K A;  3S8P A;  3Q0U A;  2R7T A;  2LVS A;  4M9S A;  1FT9 A;  2LYC A;  2LNB A;  3J80 K;  2ZSI B;  1P92 A;  3ABL H;  2YPR A;  2CG4 A;  2O03 A;  4HPQ A;  1FIA A;  5DV5 A;  3GTJ J;  3HYI A;  1U9O A;  3BZC A;  4JK1 X;  3RZO J;  1RPW A;  3DBL B;  2CUE A;  2WB1 A;  1QBJ A;  5DD8 A;  5KVR A;  2DT6 A;  2EV0 A;  1WHU A;  4BY7 J;  2QWW A;  1A6Q A;  3W6J B;  4Y13 A;  3S2W A;  2P4W A;  5IOY A;  3G71 I;  1XGM A;  1AHD P;  2Z1D A;  3LSP A;  2LDU A;  5JVT A;  2FQ4 A;  2GQQ A;  5K5Q A;  2W7N A;  1IRG A;  4CCO A;  5CVU A;  3HRU A;  3WTW C;  1ETQ A;  3BTJ A;  2JQ7 A;  3OV8 A;  1YIJ I;  4YIF A;  4PJJ A;  4LG0 B;  5D6F A;  4L9V A;  3RQ4 A;  4XID A;  4RGS A;  4JX4 A;  2X6W A;  4P55 A;  2DA4 A;  3FK7 A;  1ULY A;  3M9A A;  2JWT A;  3S1N J;  2OCE A;  1ZG5 A;  4FE4 A;  5CQG A;  5FLV A;  4II3 A;  1R5H A;  1R1T A;  3QQA A;  5L3C A;  1B8I A;  3S15 J;  5HLT A;  3E3V A;  3SDB A;  3HSF A;  4FX0 A;  2K9N A;  2WAQ A;  3V7R A;  2HDD A;  4NC8 A;  4YFN F;  5JI6 A;  4G6T B;  1HSJ A;  4Y7N J;  1IO2 A;  3T8R A;  1ZH5 A;  4BXX J;  1ZR2 A;  2CV1 A;  3WHB A;  2E2H J;  4U0W A;  1LDK B;  2LY1 A;  4ENK A;  4CSW A;  2LBF A;  3NAR A;  1X58 A;  4PGG A;  4V2F A;  1FWZ A;  4A3M J;  4DNC A;  2QQA A;  3CZ6 A;  2VLA A;  3LMM A;  4L5E A;  1MJB A;  2Q2E B;  3HTU A;  1XGS A;  5F0F A;  2OF7 A;  1MKM A;  1DQU A;  2JRT A;  1PUE E;  1TQI A;  3H1C A;  2Y0M A;  5GAH J;  1LE8 A;  2H09 A;  3L2R A;  1MBG A;  4ESB A;  3M8E A;  2VC1 A;  1AU7 A;  3VSK A;  3DF8 A;  1TTY A;  4AYB A;  4PJL A;  4J19 A;  2V1U A;  2WTE A;  3JCU C;  5B1B H;  1QPI A;  9ANT A;  1FC3 A;  3K2A A;  1OCP A;  3OOP A;  3Q9S A;  2Y9Y A;  3PSI A;  3RYP A;  1OCR H;  4M3E A;  4UV8 A;  5A2Q Z;  3GCM A;  4ZTJ A;  4DBQ A;  4E4H A;  4XLA A;  5GPA A;  4IQJ A;  3U9G A;  4K2E A;  5IP7 J;  4HSR A;  1UST A;  2CW0 F;  5E3N A;  2DFF A;  4BKX A;  1Z7L A;  3SFZ A;  4XL9 A;  2IPQ X;  3BOQ A;  3TOA A;  3FBI B;  3VFZ A;  3G73 A;  4P9U A;  3CES A;  4E7K A;  4HA8 A;  5K5O A;  1A36 A;  1FIP A;  3CMM A;  4XSX F;  4X1E A;  2PMH A;  4RB3 C;  4MEY F;  3FHN A;  1I3A A;  2XGC A;  3IH3 A;  4FAS D;  2GA1 A;  1HDP A;  1JKO C;  2WBM A;  1R5G A;  3CUO A;  3H9G A;  5BMZ A;  2MLK A;  1MMA A;  1VQO I;  4GYG A;  4Y3O A;  4KA4 A;  2R7R A;  4YFK F;  2QKM B;  4CZC A;  2V7F A;  4LLL A;  1A6I A;  3Q3S A;  2QBY B;  3TGN A;  4XRS G;  1B6A A;  1Z6R A;  1YW9 A;  2HQR A;  1P4W A;  2PI0 A;  2JVH A;  1FOK A;  1RET A;  1SD7 A;  4LIV A;  3PO2 J;  1OR7 A;  2JSP A;  1NK2 P;  1JT0 A;  2F5F A;  2G7U A;  2K3F A;  1TWA J;  1N77 A;  1XN7 A;  4AM3 A;  4CGZ A;  1BC8 C;  4AD9 A;  1B72 B;  5ICE A;  1A35 A;  3E5X A;  4M74 A;  3C7J A;  5HS7 A;  1HA8 A;  5F0H A;  1FOX A;  2VJ4 A;  2A6H F;  2EFN A;  3ASN H;  1O7F A;  5IP9 J;  2Z5U A;  2RQQ A;  2L02 A;  2R92 J;  4YIR X;  1EH8 A;  2Y30 A;  3HSR A;  3S1R J;  1IXS B;  3AL0 C;  2GZW A;  2DT5 A;  2R93 J;  1RR8 C;  3JR9 A;  1LFU P;  1MIJ A;  1GUU A;  1TBX A;  3EYI A;  1R6R A;  1ETO A;  3M4O J;  2M0C A;  4L9J A;  4IJA A;  4E6K G;  2XGX A;  2CUF A;  1LDJ A;  2JPC A;  1C0W A;  1IZ1 A;  5EZH A;  1OYI A;  1K4T A;  2IGO A;  1FYL A;  4IVN A;  2QA4 I;  1TWG J;  4I76 A;  2LY9 A;  4IRG A;  2PMU A;  2XVC A;  3SZG A;  2NAZ A;  2DPU A;  4N9H A;  1VQ6 I;  5DCF A;  2BE5 F;  3HHH A;  1KYZ A;  4H0E A;  2B9S A;  2TRT A;  3K1P A;  3ZPL A;  3IKT A;  1M1E B;  5L3G A;  3JAM K;  4HQM A;  4AWX B;  2BY0 A;  2VOP A;  3HRS A;  3KYC B;  1YFH A;  1W0U A;  3IWZ A;  2M4K A;  4IPA A;  5DEQ A;  3LFU A;  1ZRE A;  2ZME A;  3LA7 A;  1T8I A;  4IHS A;  4ESF A;  1TT0 A;  4JQF A;  1SVM A;  3DU5 A;  5LRR A;  3IRQ A;  2W84 A;  3J81 Z;  1G59 A;  5KCM A;  3FXU A;  1ZYR F;  2YU3 A;  3HGG A;  5J6X A;  1YRN B;  2RVC A;  1IV6 A;  2UWM A;  1MBF A;  2F5C A;  2L4A A;  5DM6 F;  3LAJ A;  4A3I J;  1Y0U A;  2P81 A;  2V79 A;  1ETK A;  1SAU A;  3JRA A;  2BOL A;  2HEO A;  1POG A;  2QBY A;  1BJZ A;  3PFY A;  3L2C A;  2KIM A;  4P96 A;  4XRF A;  2F4I A;  3WG9 A;  1GV5 A;  1XCV A;  2VBZ A;  4UXN A;  1MMN A;  3HOS A;  2KJC A;  3BR6 A;  1UAA A;  2BXZ A;  4HW0 A;  3ROU A;  4YFX F;  3WU0 A;  4A0Y A;  4CXF A;  5BPD A;  1K83 J;  5K5R A;  3GTL J;  3MD2 A;  1VQN I;  1R1V A;  2KT0 A;  3OL3 A;  1REP C;  5M3M J;  1HQC A;  5JVG F;  3BR0 A;  4DIQ A;  3S32 A;  1Z7U A;  3WTT C;  5LGU A;  3SHF A;  5E20 A;  3WTU C;  3E97 A;  3CTA A;  2YUS A;  4PCQ A;  1JHF A;  2DQR A;  1H9G A;  3C2B A;  2LC2 A;  3K4J A;  1XGO A;  5CPR B;  3AL0 B;  2IS1 A;  3C2G A;  2QKL B;  3AG3 H;  2FMY A;  5C4X J;  3BJ6 A;  2FD5 A;  2DQL A;  2L9N A;  5HOD A;  4CYC A;  2F2E A;  3KZZ A;  3IKV A;  2ZNY A;  4ON0 A;  2NNN A;  4A3B J;  3PO3 J;  1STZ A;  4IXA A;  2HXI A;  2OZU A;  4BEH B;  1WJF A;  2ESH A;  1UCR A;  5F0C A;  2XKP A;  1Z91 A;  1SVO A;  1GV2 A;  1WH5 A;  2BVL A;  1Y0N A;  3FXL A;  3CO6 C;  4CCK A;  2L2O A;  2DT7 B;  5JLX A;  4KFC A;  3CLO A;  2K9M A;  5H2F C;  1KZH A;  1Z6T A;  3HUG B;  3IUO A;  4UB6 C;  1RRJ A;  2GOX B;  5E3L A;  2JK3 A;  3MKW B;  4YEL A;  4MHG A;  3I59 B;  2ECB A;  1BW5 A;  3I64 A;  3MVP A;  1S7O A;  1HW5 A;  5L3F A;  4XMY A;  1D0X A;  5FFX A;  5F1J A;  3R4K A;  1Z3X A;  2HQN A;  3SQN A;  2BXY A;  3B6A A;  1B4A A;  2ADU A;  2XSJ C;  3HOW J;  2EIM H;  3G1O A;  5GAE J;  1F4K A;  1EF4 A;  3CCU I;  3OSG A;  2H27 A;  2HVQ A;  1XG1 A;  5J4V A;  1QGP A;  5DCM B;  4XBF A;  5DUK A;  2O9L A;  5F04 A;  2DA1 A;  3S3N A;  3KZY A;  3AG4 H;  1IDY A;  1O57 A;  2EFQ A;  4P5O A;  2STW A;  3FIW A;  5ILS A;  1P4X A;  2JA7 J;  1U78 A;  2IGK A;  2RDP A;  1I50 J;  3VYS B;  4HX4 A;  1ZAO A;  5FO5 A;  2JT1 A;  3ZQF A;  2D1V A;  3BZK A;  2H1L A;  2OU2 A;  4RM3 A;  3ZMS A;  3B73 A;  2ZKZ A;  5KAF C;  1ZR4 A;  4M3F A;  4HV5 A;  3ZMV A;  1TZL A;  3G2B A;  3OYC A;  1LVA A;  1ZAR A;  3WGI A;  1G3W A;  2E1M C;  3FMR A;  2MG4 A;  1D8K A;  3ZRG A;  2XPV A;  1FEX A;  1WPK A;  3F72 A;  2HQA A;  3ZOB A;  4Y4R A;  3GVA A;  2HR3 A;  3RCO A;  3A01 A;  2L01 A;  4ZTF A;  3CCY A;  3BJO A;  5GAD J;  1RI7 A;  4IKF A;  5F08 A;  4U87 A;  3T0Y A;  2CUJ A;  2V6E A;  3QU3 A;  2VB6 A;  3LA3 A;  4UVC A;  1R58 A;  4CCN A;  1JI8 A;  2X85 A;  5GTI C;  4MQV A;  2FBH A;  4XKB A;  2P0W A;  4I02 A;  2O61 A;  3H5A A;  3X2Q H;  3MZ8 A;  4YRV A;  1JGG A;  5TGT A;  4XRM A;  2IGM A;  2L54 A;  5L3B A;  1RKW A;  4EM1 A;  3GYH X;  5FRN A;  2DFI A;  2EZH A;  1VQ5 I;  5HDK A;  2G7H A;  1K7A A;  4OAY A;  3U21 A;  1TQP A;  1SMT A;  2KPM A;  2A69 F;  4RA2 A;  1RUO A;  1KU9 A;  4BE0 A;  2GIZ A;  1Y56 A;  2R7S A;  1BL0 A;  1I39 A; 
#chains in the Genus database with same CATH homology
 1R9T J;  3W6V A;  3S1M J;  5M5W J;  1DU6 A;  2YS9 A;  2O8K A;  4EEF G;  3A01 B;  3HEF A;  2XSD C;  3M3Y J;  3RQI A;  2EZK A;  5EDN A;  1NTC A;  4XRS A;  3GTQ J;  1IDZ A;  2ID3 A;  4B4C A;  4MO7 A;  3ZQH A;  5J1Y A;  4S0H B;  1MBK A;  2RAE A;  3GTP J;  2LTP A;  1JJ6 C;  4JX6 A;  4AUX A;  5BNG A;  2PMZ N;  2R5Y A;  1HOM A;  2QF7 A;  2DA3 A;  3FK6 A;  3Q0U A;  1E3O C;  4A3L J;  5FKL A;  2MSY A;  2LKX A;  2LVS A;  3DEW A;  2FJ1 A;  2JN6 A;  5EF6 A;  2XB5 A;  5EGO A;  3SJM A;  2NS7 A;  3BR3 A;  1FIA A;  2AHQ A;  3GTJ J;  1MSF C;  2L9R A;  1U9O A;  1IG7 A;  2EZL A;  1RPW A;  3RZO J;  1VI0 A;  2CUE A;  3O8G A;  1TWF J;  5IYD J;  4M3D A;  4BY7 J;  2R5Z A;  5IOY A;  1JUS A;  2G0E A;  3LSP A;  1AHD P;  2FQ4 A;  1ZGW A;  3TW7 A;  1MH3 A;  1ETQ A;  1APL C;  3BTJ A;  1ITY A;  1HLV A;  2VKV A;  1MBH A;  3HB9 A;  2MGQ A;  4XID A;  4JX4 A;  3G1L A;  2DA4 A;  3BT9 A;  3FK7 A;  5EG0 A;  2DA5 A;  2JWT A;  5EGO B;  3S1N J;  2NS8 A;  1LFB A;  1DU0 A;  4FE4 A;  5FLV A;  3QQA A;  1B8I A;  1TWC J;  1I6H J;  3JRE A;  3S15 J;  3LSG A;  2R0Q C;  2K9N A;  3BG3 A;  5GPC A;  2HDD A;  4Y7N J;  2R5Z B;  3H0G J;  4BXX J;  1ZR2 A;  3WHB A;  2E2H J;  3GTK J;  3O8H A;  3NAR A;  1X58 A;  4V2F A;  5M5Y J;  3LNQ A;  2L7Z A;  3HOZ J;  4A3M J;  3A03 A;  2ME0 A;  2IEK A;  4L5E A;  2XRL A;  4XIC A;  5F0F A;  2OF7 A;  2L7M P;  1RR7 A;  3BQY A;  2GBY A;  2HQ5 A;  5FKM A;  2GM4 A;  1LE8 A;  3HM5 A;  1JJ8 C;  1BA5 A;  1MBG A;  1AU7 A;  1F43 A;  5EYR A;  1JKQ C;  3K7A J;  4D5C A;  2DMQ A;  4J19 A;  4MFD A;  4A3K J;  2QCO A;  1QPI A;  1OFC X;  1B8I B;  9ANT A;  3K2A A;  1OCP A;  4M6V A;  5FKO A;  2Y9Y A;  5FKN A;  4M3E A;  3S17 J;  1OJL A;  3TP3 A;  4QTR A;  1HCR A;  1HDD C;  2EH3 A;  5GPA A;  2JMW A;  3CDL A;  2LR8 A;  4DW6 A;  4IHW A;  2CQQ A;  4RBO A;  4IHX A;  2E1O A;  1ETY A;  3OIO A;  5IP7 J;  5E3N A;  3S16 J;  2XPW A;  1T56 A;  1H89 C;  4BKX A;  2DMU A;  5K7Z A;  2N8G A;  5J3L A;  1FIP A;  4A3G J;  1LE8 B;  3GBG A;  4JYK A;  2X9D A;  4X1E A;  1ZQ3 P;  4A3E J;  1P7J A;  1UHS A;  3BTI A;  1B72 A;  4UUT A;  2XGC A;  3BG5 A;  2DJN A;  3IH3 A;  1HDP A;  1JKO C;  3BR5 A;  2NVY J;  1F36 A;  1ENH A;  2TCT A;  2HYJ A;  2OPT A;  2ID6 A;  4IHY A;  2DA2 A;  4C3J J;  3HBL A;  3S2D J;  5E3O A;  5F27 A;  1A6I A;  1ETV A;  5IP6 A;  3Q3S A;  2I10 A;  1A5J A;  4XRS G;  3ZQI A;  3BTC A;  2X48 A;  2NVX J;  2IBD A;  1G2H A;  3MKL A;  3SFI A;  1RET A;  2WB1 N;  3MN2 A;  2X6O A;  1UMQ A;  3HOX J;  4BBS J;  1WGX A;  3PO2 J;  2H8R A;  2DTZ A;  4AC0 A;  4X6A J;  1NK2 P;  2Y31 A;  1JT0 A;  1GDT A;  2VI6 A;  3ZQG A;  1VF9 A;  2E2I J;  4GFB A;  3GTM J;  1TWA J;  3SDG A;  1ZK8 A;  1QRY A;  1B72 B;  2E2J J;  1QVT A;  2DMT A;  1SFO J;  2ECC A;  5F0H A;  4A3J J;  1X2M A;  5IP9 J;  1UG2 A;  5IYB J;  2R92 J;  3LOC A;  2Y30 A;  3TP0 A;  3S1R J;  2R93 J;  1I3Q J;  2LLK A;  5IYC J;  2CQX A;  3NAU A;  1LFU P;  3JR9 A;  3HOU J;  1GUU A;  4A69 C;  1GT0 C;  1W0T A;  3M4O J;  1ETO A;  2M0C A;  2VKE A;  1U8B A;  1Y1W J;  2L7F P;  2CUF A;  1VND A;  4FE7 A;  1XC5 A;  5EZH A;  2WAQ N;  5C44 J;  3L1P A;  3JRH A;  3BR2 A;  1YRN A;  4A3D J;  1HF0 A;  2Y0S N;  3TED A;  3D1N I;  5FLM J;  2NOG A;  1TWG J;  2EBI A;  4I76 A;  4ABZ A;  2LY9 A;  1FTT A;  2ME6 A;  2K9S A;  5K7H A;  4LOC A;  5EEA A;  2W48 A;  2VPR A;  1JTY A;  2TRT A;  3E7L A;  2JA8 J;  3ZQC A;  2JA6 J;  3RZD J;  2JJ7 A;  2Y2Z A;  3OOU A;  4DZJ A;  2O7O A;  4M3B A;  1W0U A;  1MBE A;  1ZTR A;  2MW8 A;  2GLO A;  4IEJ A;  4AYB N;  2IAI A;  4C2M J;  2LFB A;  4QIW N;  3VPR A;  1TWH J;  4C3H J;  2NVT J;  2M2E A;  1ETW A;  1RES A;  3S1Q J;  3HGG A;  1YRN B;  1IV6 A;  1MBF A;  4W1U A;  3A02 A;  2CU7 A;  4A3I J;  3IH2 A;  2P81 A;  1ETK A;  3TW6 A;  3JRA A;  2XB0 X;  1POG A;  1BJZ A;  4JP0 A;  1T33 A;  1GV5 A;  2DA6 A;  1MSE C;  2HOA A;  3JRI A;  1Z77 A;  1FJL A;  3GTG J;  5M5X J;  3BR6 A;  3BQZ A;  4M3G A;  3LSJ A;  1FTZ A;  1P7I A;  1IC8 A;  1JTX A;  4A3C J;  1U9N A;  1K83 J;  3GTL J;  3S14 J;  2KT0 A;  1AKH A;  4MFE A;  4XK4 A;  5M3M J;  1IGN A;  2EZI A;  4FTH A;  4IHV A;  3BR0 A;  3G1M A;  1CQT A;  4G12 A;  3HOY J;  3GTO J;  3I4M J;  4FCY A;  5J1U A;  2XGD A;  1H8A C;  2YUS A;  3CMY A;  1PUF A;  1D5Y A;  3S2H J;  2K9Q A;  1IRZ A;  3C2B A;  5FKK A;  5K7F A;  2LK2 A;  1Z0X A;  5EZG A;  4JX5 A;  2LD5 A;  2AO9 A;  2XPU A;  3PM1 A;  5C4X J;  1QVU A;  2FD5 A;  2M34 A;  1OCT C;  1WI3 A;  5HOD A;  1WCM J;  4CYC A;  2KDZ A;  1BL0 A;  2B63 J;  4V2G A;  1O4X A;  4A3B J;  2HOS A;  3JRB A;  3PO3 J;  2DN0 A;  2NVQ J;  5DS9 A;  5C4J J;  2HXI A;  3HGY A;  1MNM C;  4DZP A;  5F0C A;  1WH5 A;  1GV2 A;  1IUF A;  4DYC A;  1JUM A;  1AKH B;  4B1R A;  1ORK A;  2DMN A;  1NK3 P;  1TC3 C;  2R7Z J;  3QPS A;  4A93 J;  1WH7 A;  2M8G X;  2XGE A;  5JLX A;  1JT6 A;  4HNV A;  5J1R A;  2EQR A;  3HOV J;  4MLO A;  5JLW A;  3Q0W A;  1XS9 A;  1MBJ A;  5E3L A;  3OSF A;  1PUF B;  5M3F J;  2JK3 A;  2L0K A;  1Q1V A;  2ECB A;  4C3I J;  4I6Z A;  1BW5 A;  1ETX A;  1S7E A;  3MVP A;  5E3M A;  3CQZ J;  3JRF A;  2FX0 A;  5F1J A;  4RDU A;  4D7N A;  4CYC B;  3IV5 A;  3B6A A;  3HOW J;  3G1O A;  2HXO A;  2R5Y B;  3OSG A;  1EF4 A;  5DTD A;  5IPA A;  4D5F A;  2VUM J;  1XG1 A;  1JKP C;  2CJJ A;  3JRC A;  4D7M A;  1GVD A;  2O9L A;  5F04 A;  2DA1 A;  3FKI J;  1IDY A;  1JKR C;  4DYR A;  3LSR A;  4NDL A;  2YU9 J;  3FIW A;  4BBR J;  2CRG A;  1ZKG A;  2JA7 J;  1U78 A;  4A3F J;  4BY1 J;  3JRG A;  1I50 J;  4Y52 J;  2HI3 A;  4B3A A;  2Y9Z A;  2DMP A;  4UUS A;  3ZQF A;  5IOZ A;  4FIS A;  1SAN A;  1ZR4 A;  4M3F A;  1K61 A;  2DA7 A;  3F0C A;  1Y1V J;  3BTL A;  4MIM A;  2JA5 J;  3HDD A;  3BR1 A;  3IH4 A;  1IJW C;  2MG4 A;  3DCF A;  2COB A;  2XPV A;  3ZQL A;  1FEX A;  3BG9 A;  1WPK A;  5C3E J;  3ZOB A;  3I4N J;  1JUP A;  2ELK A;  3FIS A;  3A01 A;  1BW6 A;  3WHC A;  3CCY A;  3RKQ A;  5GP9 A;  5F08 A;  5EG0 B;  2WV1 A;  3UKG A;  1VFC A;  1RKT A;  4W97 A;  1MH4 A;  3QPL A;  2D5V A;  2M9H A;  2K40 A;  4UUS B;  3B6C A;  1JGG A;  4XRM A;  3Q0V A;  4DYQ A;  2HOT A;  1RKW A;  2EZH A;  5FJ8 J;  2H1K A;  2ZB9 A;  3H3V K;  2LP0 A;  1H88 C;  4QSH A;  1X2N A;  2E19 A;  3JRD A;  3HKZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...