2PMZN

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
b'MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 7
structure length 64
sequence length 64
chains with identical sequence Y
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2pmzN00
2DN0A 5C44J 2FQ4A 2AO9A 2X6OA 2HOAA 2EZKA 3LSRA 5K7FA 2H8RA 3G1OA 1RESA 4GFBA 3HOXJ 1JJ6C 1OJLA 4JYKA 2Y0SN 3I4MJ 3LNQA 5M3FJ 5M5YJ 4D5FA 2DMUA 1ENHA 2M2EA 2JWTA 3Q0UA 4DYQA 1LFUP 3OOUA 1GV5A 2DA1A 1WH5A 4XK4A 1POGA 2QCOA 4A3CJ 3HEFA 3S14J 2O8KA 1HLVA 2ME0A 4JP0A 5EG0A 3TP0A 1MSFC 2MW8A 4IHYA 4QIWN 1IJWC 4XICA 5EGOA 5C3EJ 5DS9A 3HDDA 3FK6A 4IEJA 1EF4A 4FCYA 1LFBA 2L9RA 2ME6A 3QPSA 1WPKA 4LOCA 3QQAA 4IHVA 2ECBA 1QPIA 1IGNA 3BQZA 3LOCA 2FX0A 2NS7A 3ZQCA 2DA4A 4JX4A 4A69C 2WAQN 4QTRA 1S7EA 2JJ7A 3HOWJ 1UHSA 1I3QJ 3JRDA 1I50J 1W0TA 1ETQA 3A01A 1ZR2A 2XSDC 3RKQA 1JT6A 3B6AA 1ZR4A 5HODA 4C3JJ 1PUFB 3Q0VA 2NVXJ 2E2IJ 1MH3A 3NAUA 2X48A 1MH4A 3PO2J 2DMQA 1OFCX 3JREA 2XB5A 4B3AA 5IP9J 2CQQA 5JLXA 1R9TJ 4HNVA 1Y1VJ 3LSPA 1HDDC 1U9OA 4A3BJ 3D1NI 1BJZA 3S2HJ 4Y52J 1OCPA 3S17J 2XGCA 2WB1N 3K7AJ 5FKLA 2EZHA 1MBKA 4DZPA 1XC5A 3S15J 3BG5A 2EBIA 3PO3J 4AC0A 1JKOC 2E2JJ 1TWFJ 1WH7A 1JTXA 2Y31A 1MNMC 4MFEA 5FJ8J 2M34A 5E3OA 4NDLA 2WV1A 1JJ8C 4A3EJ 2LY9A 3M4OJ 1AKHA 2ECCA 2Y2ZA 1I6HJ 2CUEA 2I10A 4MFDA 2R7ZJ 4DW6A 2Y9ZA 3GTQJ 1TC3C 1XG1A 3I4NJ 3HBLA 3BT9A 2Y30A 2NS8A 4IHWA 5M5XJ 3TW7A 3RQIA 1VI0A 3CCYA 1MBFA 1BL0A 2R5YA 3HOVJ 2TCTA 2AHQA 5IYBJ 2PMZN 3VPRA 3S1MJ 2M9HA 1JKRC 1WCMJ 3Q0WA 1T33A 3FK7A 5GPCA 5IYDJ 2K40A 4BKXA 1VF9A 2RAEA 3NARA 3PM1A 1U9NA 2LR8A 9ANTA 2HOTA 4M3BA 4DYRA 1JKPC 1AKHB 3ZQHA 3DEWA 5FLVA 3BTCA 4XIDA 3SJMA 3RZDJ 1IG7A 5FKKA 1X2NA 5M5WJ 1WI3A 3G1MA 1RKWA 1JUSA 5GPAA 2IBDA 2YU9J 4QSHA 3BR3A 1FTTA 1IV6A 3BR5A 2XPUA 2R5YB 4ABZA 1PUFA 5IOZA 3ZQFA 1UG2A 5GP9A 5BNGA 5J1RA 3A02A 2XGEA 5E3NA 1MBHA 1IDYA 3E7LA 3L1PA 3JR9A 1SFOJ 1JUMA 4M3GA 3JRFA 2DMTA 1U8BA 1RR7A 3IV5A 2HXIA 2HYJA 1W0UA 1Q1VA 3MKLA 1HOMA 2JA8J 3DCFA 4V2FA 5F0FA 1AU7A 2LVSA 1GT0C 1D5YA 3JRAA 2FD5A 5C4JJ 1AHDP 4BBRJ 5F04A 1ETKA 2HDDA 3H3VK 3TEDA 1YRNA 3S1QJ 2HOSA 5K7ZA 4M3DA 2IEKA 4XRMA 5M3MJ 1T56A 4JX6A 1F36A 2GBYA 3OSGA 3TP3A 4DZJA 3JRHA 4A3IJ 1HCRA 1ETWA 3GTKJ 3BR2A 2W48A 2CU7A 2GM4A 3IH3A 4D5CA 3FIWA 3BG9A 2TRTA 1Z0XA 3HKZN 2G0EA 4S0HB 2NVQJ 3BR1A 1ZKGA 2DMNA 4CYCB 1BW5A 1B72A 3SDGA 2VKEA 2L0KA 4FTHA 1RKTA 3Q3SA 3QPLA 3JRIA 1FIPA 4A3KJ 3BR6A 2ID3A 2JK3A 1TWHJ 3GBGA 2HXOA 4BBSJ 3MVPA 1VFCA 2CJJA 2DA7A 1QVTA 1RETA 3SFIA 1YRNB 3HOZJ 4A3JJ 1HF0A 1TWGJ 1Z77A 2OF7A 4MIMA 1JKQC 3FISA 5IP6A 1MBGA 2XGDA 4G12A 3GTLJ 1DU0A 3HOYJ 1MBJA 4I76A 5K7HA 3JRCA 1E3OC 3M3YJ 2P81A 3BTJA 3G1LA 4A3LJ 4M6VA 1IDZA 3WHBA 2O9LA 2DA6A 2M0CA 5EZHA 3BTLA 1DU6A 2JA5J 2M8GX 4RDUA 3S2DJ 5IPAA 1B72B 2R93J 4J19A 4AUXA 2MGQA 2B63J 4L5EA 1TWCJ 1VNDA 4IHXA 3IH2A 4C2MJ 3MN2A 1UMQA 5F1JA 1GDTA 3ZOBA 5DTDA 3CDLA 4FE7A 3HGGA 3O8GA 4EEFG 2R5ZA 3HGYA 4D7MA 1WGXA 3F0CA 4W1UA 3FKIJ 1ETYA 2MG4A 4UUSA 3S16J 1K61A 2N8GA 1QRYA 3GTJJ 4AYBN 4X1EA 2ELKA 2O7OA 3ZQIA 5EF6A 2EH3A 5F0CA 2JA6J 4XRSA 3GTGJ 1JGGA 3TW6A 2H1KA 4RBOA 4BXXJ 1FIAA 3BR0A 4FISA 3LSJA 5E3MA 4W97A 2L7MP 2CQXA 5IP7J 4A3MJ 4A3DJ 3JRGA 1H8AC 5FKNA 2LK2A 3UKGA 4Y7NJ 1B8IA 1F43A 1GUUA 3H0GJ 2XPVA 1JTYA 1RPWA 3W6VA 2VPRA 3B6CA 2R5ZB 2DA5A 5EEAA 1ZQ3P 1BA5A 1ETXA 3HM5A 5J1YA 2X9DA 4M3EA 2DMPA 3WHCA 4UUSB 1U78A 4MO7A 5F0HA 3GTOJ 2NVYJ 2DTZA 2YS9A 3C2BA 2E19A 3K2AA 3BQYA 1APLC 4CYCA 1CQTA 3HB9A 2Y9YA 1IRZA 5F08A 4A3GJ 2KDZA 2VKVA 5F27A 2L7FP 3GTPJ 3HOUJ 5EYRA 2LD5A 5EZGA 1ETOA 2EQRA 3S1NJ 1B8IB 2YUSA 1ZGWA 1GVDA 1MSEC 2K9NA 1K83J 4A93J 3CQZJ 4C3HJ 2LP0A 4X6AJ 1H88C 4FE4A 3GTMJ 2COBA 2CRGA 1NK3P 1ETVA 3JRBA 1TWAJ 4DYCA 1FJLA 2QF7A 1ORKA 1O4XA 1OCTC 4V2GA 2NOGA 3O8HA 1JT0A 2EZLA 4JX5A 3OIOA 1MBEA 2KT0A 2NVTJ 2DA2A 4I6ZA 3IH4A 5C4XJ 1FTZA 3OSFA 2L7ZA 2ZB9A 5EG0B 4B4CA 2JMWA 2ID6A 4C3IJ 3S1RJ 5EGOB 2GLOA 5EDNA 5J3LA 4D7NA 5E3LA 5FKMA 2OPTA 1IUFA 4BY7J 2LKXA 5FLMJ 1LE8A 1HDPA 1QVUA 3ZQLA 1G2HA 4M3FA 2HI3A 5J1UA 2CUFA 1A6IA 1P7JA 3A01B 3BG3A 3ZQGA 1Y1WJ 4BY1J 2MSYA 1H89C 2D5VA 2JN6A 2R0QC 4A3FJ 2LTPA 2XRLA 2FJ1A 3RZOJ 5IYCJ 1ZTRA 1X58A 2K9SA 2K9QA 2VI6A 1ITYA 4B1RA 5FKOA 2LLKA 1NTCA 1IC8A 1NK2P 2HQ5A 1X2MA 4MLOA 2JA7J 2R92J 1BW6A 1SANA 2E2HJ 2EZIA 2LFBA 1XS9A 1JUPA 1LE8B 1ZK8A 3BTIA 5IOYA 4UUTA 1P7IA 2XPWA 3A03A 5JLWA 2VUMJ 2DA3A 3LSGA 2IAIA 1A5JA 2DJNA 4XRSG 3CMYA 2XB0X 1GV2A 2E1OA 1FEXA
chains in the Genus database with same CATH superfamily
1OQYA 2VT3A 3KYCB 5D5UB 2AO9A 3OYMA 3AFHA 4E7HA 4EGZA 1BN5A 1YTYA 1K78B 3G1OA 4GFBA 3LAPA 1OJLA 5EEGA 3VYRB 2DT7B 4NC6A 3K6GA 2MFZA 1VQ5I 2PJRB 2DMUA 3Q0UA 3V8JA 2VONA 2OCEA 3LAJA 2JQ7A 5FD5A 1IV8A 4WXCA 1S5LC 1B59A 3ASNH 2G7HA 3AL0B 5FROA 2M0MA 1YG2A 3I53A 2M45A 3O3KA 2FXAA 5FO5A 3U2RA 3GMEA 4JP0A 5J47A 2DFEA 2HPMA 5CLSA 2KJBA 4WXHA 1MMGA 3S8PA 1IJWC 5C3EJ 2EIKH 3HDDA 4IEJA 4PJJA 2W84A 1LFBA 1Z67A 2JZYA 3QPSA 1DUXC 3LFUA 5HNFA 2ECBA 2XHKA 1QPIA 4AYBA 2FX0A 3CJRB 3IKTA 4HRIA 1WVRA 2QQBA 5J4YA 1P9QC 1A04A 2L7KA 5HVQC 1MD0A 5BPIA 3HOWJ 1MJBA 1I3QJ 2KLOA 1K6OA 4HBLA 3B6AA 3FBNB 5HODA 5DCMA 1LVKA 1ZHFA 3Q0VA 2RNJA 2X6XA 1IN8A 4UB8C 2R3SA 2QGUA 1ZG1A 3PO2J 2XSJC 3JREA 1PDNC 3PSIA 1D3YA 2CQQA 5JLXA 4QWQA 3K70C 2QVOA 1FZPB 4II2A 3CUQC 1OCPA 2GA2A 2WY7Q 2A6EF 5E1XA 1U6GA 2O3FA 2AQEA 4Y3OA 1O3SA 3B02A 3BG5A 4KT6A 1FX7A 3RIRA 3PO3J 2NAZA 2OA4A 4A0YA 3TO6A 2E7WA 1JKOC 3QOPA 2DCEA 3T8RA 2LDUA 4FX0A 1OR7C 2Y31A 5LHHA 4MFEA 3KX2A 1FC3A 1MNMC 5E3OA 3TQNA 3PIPF 5KK1A 1D8JA 2K3FA 1JJ8C 4RGRA 2RKHA 2RQPA 4A3EJ 2LY9A 2ZSHB 4HLXA 1I6HJ 5E18F 4HF1A 2UZKA 1OPCA 2FE3A 3KZIC 2EV6A 3ZMZA 1S9HA 2C6YA 3R0AA 4WX9A 1YFHA 3LSKA 5E17F 3KYLA 2NS8A 3OYGA 2VPLA 3TW7A 5HS8A 1X1CA 5L3EA 5EJCA 3RQIA 4L9VA 4PFOA 1BL0A 2FF4A 2L4MA 3CC7I 1VQ6I 2FOWA 4HF0A 3KZZA 3PNYA 2WY8Q 1WCMJ 2XDVA 4EJWA 4NUBA 1Z05A 3WGIA 2IA1A 2RAEA 2K4JA 3AAFA 3NARA 4F93B 4HYEA 4BDZA 3Q9VA 1U9NA 2LR8A 5KAFC 4EVIA 5E79C 2Y48A 5B66C 5FLVA 2L9NA 4HEA2 3RZDJ 3E97A 2ZNZA 3OYDA 1FNNA 2PQ8A 1R1TA 5CVUA 5DM6F 1OKRA 3K4MA 1IN4A 1WI3A 4PGHA 1JUSA 5GPAA 3RPUD 3LSIA 2YU9J 4IHSA 2RNGA 2XKPA 4N0BA 4F92B 2PMUA 2CGPA 2BXYA 3ZQFA 3K1NA 5J1RA 1VQNI 2K27A 3BOQA 2E60A 2GXGA 3F6OA 4LD5A 3ULQB 1IDYA 4BQNA 2ELJA 3L1PA 4X0GA 4M3GA 4F3QA 1D1AA 4KT5C 1JHFA 3JRFA 2DMTA 3KP3A 4HZFA 1U8BA 2Z99A 2HXIA 2CV1A 1S7AA 2H6BA 4RAGA 4KUMA 2HFHA 3K70D 4IQ4A 3E0JB 3ZMUA 2MC4A 2W4SA 2A69F 1BI0A 5F0FA 1J09A 3K69A 1TLHB 4UHTA 4BJTA 1STZA 1FOXA 1BIAA 3F6VA 2L2OA 4E7KA 1WQ2A 1P4AA 1R6RA 2ETHA 3L2RA 1OYYA 3ZR8X 4PSWA 3QYBA 5LEJA 2ZMEC 2BGCA 4IL6C 3JAMZ 2HVQA 1IAWA 2JSCA 2HOSA 4LFUA 3C2HA 4K2EA 1U3EM 3F9KA 4DJAA 2LRDA 2MLKA 4KIBA 3OSGA 2R7UA 3QP6A 2X4HA 2MLGA 4RGXA 1I6XA 2GM4A 4UVAA 5D5WB 3IH3A 4MEXF 4OMYA 4ZDOA 3WTVC 4D5CA 2O5RA 2WAFA 3BG9A 4S0HB 2G0EA 3F72A 5D8KB 4MQVA 1ZKGA 3SHFA 4CYCB 4CA0A 1B72A 3L2CA 2W1OA 5D5XB 1RKTA 3CLQA 1XGMA 1LPQA 5E8GA 3DPLC 1JE8A 1FIPA 4A3KJ 3WG9A 2M4KA 1LVAA 1H0MA 2FMLA 3BR6A 3VSKA 4QLCU 2GIVA 5LGTA 4IX7A 4XN3A 3MVPA 1FY7A 3K4JA 3ZGKA 4EJOA 2PMHA 2F5EA 1VFCA 1RETA 4LLLA 2CO5A 3HOZJ 1TWGJ 1X1BA 2OC6A 2OF7A 3OOPA 1YYVA 1Y8QB 2KDOA 4CCLA 3KCCA 3HOYJ 4I76A 4HSTA 4KJZA 1HKSA 3WE3A 4MGRA 1IDZA 4AIKA 3U9GA 2O9LA 4AIDA 3FXLA 1UAAA 1AA7A 1B72B 1FT9A 4A0XA 2OU2A 2R93J 2LH9A 4L5EA 2NNYA 2QENA 2V7FA 4IHXA 3SQNA 3RYPA 3SFZA 4C2MJ 3J81Z 1G59A 1ACIA 1VZ0A 1WJFA 2HQNA 3ZCOA 1FOWA 1GDTA 1Z7LA 5LD2C 3WGHA 3T1BA 2L5QA 1IO2A 4ESBA 3HGGA 3O8GA 1SD5A 3KIOA 4AU7A 2BXZA 3DWLE 4PGGA 1V54H 1ETYA 4UUSA 1MNDA 5FD6A 4AYBN 3OYNA 4ENKA 3H5RA 3JW4A 3CESA 4HX8A 4AIHA 4BYYA 4DGWB 4CZCA 5LGUA 2FQ3A 3HYIA 4HQMA 1J75A 4XRSA 1JGGA 2L54A 2HZDA 3BR0A 4FISA 3LSJA 2KMUA 1OYWA 2OQRA 4ZZDA 4DOZA 5L3FA 4A5NA 3L2UA 3AKZA 1H8AC 5FKNA 2HS5A 4CCMA 3VFZA 1GUUA 3KZYA 2ELHA 2PBIA 3DKXA 3VSLA 1JTYA 3V7SA 2VPRA 4LG0B 3ECHA 5EEAA 1BA5A 2ESNA 1IRFA 2QKMB 5D8LB 1ZRCA 3S2WA 5J1YA 2VXZA 2X9DA 3U21A 4EJTA 4UUSB 5CQEA 2E34A 4MO7A 4BXFA 3DEUA 2QSGX 3VYUB 1TTYA 1WI9A 2BW3A 2E19A 4N9HA 3MKZA 1APLC 2EB7A 3C3WA 1Z6TA 2KDZA 4P5OA 2M4GA 4P1WA 2HEOA 5HOOA 3M9AA 4GCVA 5BQTA 1BR1A 1YS6A 2PJPA 3S1NJ 3RKYA 1SMTA 2V1XA 3P5JA 2XF6A 2BE5F 2K9NA 3DBRB 4HSRA 3WTSC 3FXQA 3H9QA 2RC4A 1BR4A 3CQZJ 2M5WA 1DP7P 1XPXA 2FNPA 3WGGA 4XN0A 3GW2A 5F1RA 3H35A 4XLCA 1NK3P 3JRBA 1TWAJ 3BWGA 2BW3B 1LUJB 1ORKA 3MWMA 4Q47A 4V2GA 3HSFA 2P5VA 3FHNA 1N78A 1WJAA 4JX5A 4UV8A 1WJBA 3TGNA 2KT0A 1IUYA 4V19K 4IRGA 4RGUA 2BY3A 3E6CC 1D1BA 4M6XA 1YIJI 1UELB 4RB3C 4LIUA 4EJUA 1YQAA 3FHZA 4HQEA 3O6BB 3RKXA 1YHQI 3A1YA 5EGOB 3CDHA 4GYIA 1BI2A 1KU9A 2GLOA 4KICA 5EDNA 4D7NA 1UFMA 4CGZA 3EPZA 3MQ0A 2EJRA 1X1DA 3CJQB 2A6HF 4B8XA 2QEXI 1LE8A 3OS2A 4Y17A 3JSOA 5HS9A 3BCAA 3SEZA 2BVLA 3DLAA 1A6IA 5J4VA 2K4BA 2ZC2A 3A01B 2M87A 3W3CA 1H89C 3CCRI 2O03A 2JN6A 4UV9A 2RREA 3DPUA 3ROUA 4ZZLA 3CCMI 4ASNA 1W7PD 2DDBA 3RZOJ 5IYCJ 1ZTRA 1SMYF 1X58A 3M07A 1BM9A 2EFQA 2LLKA 4RAFA 4BEHA 1PUEE 2CFOA 1SANA 5GAEJ 4BJ6C 3SYTA 3H0DA 1E3HA 5JVGF 1MW7A 4B09A 3HKZA 2LOOA 1LE8B 3J7ZI 1ZK8A 3KP2A 3G4SI 1VQ9I 2EFOA 2KQRA 3JSPA 2XPWA 3KEYA 2DA3A 5CVRA 1BOAA 2YSRA 1E3PA 1OCCH 2CG4A 2IAIA 2F48A 4UVCA 2E1OA 4LLGF 3KEOA 2J5PA 4AVZA 3BC8A 3FXUA 1KYZA 5C44J 4XLHA 2X6OA 2OTLI 3S32A 1XD7A 2HOAA 3ABLH 2EZKA 3LSRA 3ABKH 5K7FA 5ICCA 4A0ZA 4B44A 2BY0A 1RESA 4OAZA 4BEHB 4NQWA 3OS1A 3H9JA 3I4MJ 3LNQA 5M5YJ 2WTEA 1VTNC 2E1CA 3KE2A 4XRFA 1KU2A 1U2WA 2JWTA 3F8BA 1USTA 4KA4A 1GV5A 2HDWA 3PFIA 2Q1ZB 4MTEA 3F21A 2CWEA 3I59B 1Z21A 2G7UA 1POGA 2VJIA 2F5FA 2DAOA 2LBFA 1TQMA 1YS7A 1I1GA 4WF2A 3HC7A 2XIGA 3RSNA 3QOEA 2A5WA 1IN5A 1X4OA 5EG0A 3WTWC 1ZH5A 4IRHA 3CD6I 2EK5A 6PAXA 1R4NB 1AOYA 3GZ5A 1TNTA 1WRJA 3LSTA 4HPQA 3FK6A 3I55I 4FCYA 4D0PA 4RM2A 1RI7A 2HNHA 2M8EA 2L9RA 5BOXA 3QYFA 4NQWB 1W36C 1HW1A 2CSOA 2IVMA 3LOCA 3OIQA 1V5FA 5FRNA 4XSXF 3ZQCA 4JX4A 3KYDB 3FXMA 2VQGA 1M1EB 1S7EA 2JJ7A 1W5SA 2UUZA 2XC7A 1W0TA 2HDCA 2W82A 1ZR2A 5L3CA 2P0WA 2FU4A 3CMEI 1JT6A 2LBFB 4XL9A 2HKOA 1XMXA 3LL7A 4L9TA 4C2TA 1IN6A 5JHUA 3H1CA 1XMAA 1YX3A 1MH3A 3NAUA 1MH4A 2DMQA 4O5VA 5F6FA 2MABA 1G8XA 1X3UA 4B3AA 3F8MA 5HDKA 3HL2A 2ICWG 3QRFF 4HNVA 1Y1VJ 1OCOH 4A3BJ 3D1NI 1HA8A 2FSWA 1BJZA 4BGDA 4CCKA 3V8KA 3S17J 3Q9SA 2AQFA 4I02A 3HZJA 3I71A 2R7WA 1KZHA 2EZHA 1MBKA 3S15J 5BS6A 2EBIA 2K3PA 3TDZC 2VBXA 4Q4ZF 2H1LA 3IRRA 2E2JJ 1YW9A 4H0EA 1P92A 3EUHA 4RAZA 3M8JA 1P4XA 4S05A 1XSVA 1DP3A 5FJ8J 2M34A 2M1BA 3COAC 3RCOA 2XASA 2F4IA 1D0XA 1FSHA 1ON2A 2DQLA 3LFKA 4B48A 2Y2ZA 4GGGA 4ETSA 4LJZF 4HNTA 4WCGA 3OYJA 3CLOA 3G6EI 2I10A 4DW6A 1R1UA 3GTQJ 1PYVA 1XG1A 2E1MB 3I4NJ 5ILUA 3BT9A 4LB5A 3EETA 4ZYEA 5IT9K 3DTKA 2ZNYA 3CJNA 3OYKA 1ZG3A 1VI0A 3CCYA 2B9SA 1SD6A 1WJDA 5IYBJ 1HC8A 1ONVA 2L3DA 5B5EC 3S1MJ 4XM3A 2M9HA 3V42A 2O0YA 3U1KA 1JKRC 3GZ6A 2RDPA 3Q0WA 1KU7A 3FK7A 2IS2A 3JCUC 1R23A 2KIUA 1VF9A 1O3TA 3K9TA 2LMDA 5HLTA 4YEJA 3ABUA 2JVGA 5CVVA 9ANTA 4AM3A 2HOTA 4M3BA 1O7LA 3C2GA 1JKPC 2CUZA 3UR3C 3GO5A 3DEWA 2VBZA 3BTCA 1XB4A 2JSPA 4D1QA 1X2NA 2DJIA 1QGPA 4HDVA 3I56I 1OCRH 4OMZA 1RKWA 3GWZA 2IBDA 2CQNA 3BR3A 1R71A 1IV6A 1JXSA 1H9TA 1IRXA 5FFZA 5IOZA 1LDDA 5GP9A 2MD0A 5HNHA 2CV0A 3RPUA 4I2OA 1VQ7I 2XGEA 4KMUX 2EILH 3H3ZA 3KLNA 4EQQA 2X1DA 3E5UA 5H20A 4PSXA 3L2QA 3AL0C 1QZEA 4XORA 1KQ8A 4PZJA 1T6SA 2LKSA 3HXLA 1Q1VA 1HOMA 5BPDA 4UVBA 4A12A 4NNJA 4XKCA 1SAXA 3GUDA 1AU7A 2L01A 1ZAOA 3LMMA 5H2FC 2FD5A 3DQVC 5C4JJ 4DNCA 4OIRF 2HZTA 3CP2A 3HG9A 2GQQA 2AXTC 1ETKA 2LKPA 4IXAA 5F04A 3IUOA 1YRNA 5K7ZA 3WG7H 2DQRA 2IEKA 3E6BA 3QP5A 2F4MB 1T56A 5D4SA 2GBYA 4LMYA 3I54A 4DIQA 3GTKJ 1T39A 3QU3A 1WFXA 3BR2A 3PSFA 1FMVA 4RLQA 2WC2A 2B0LA 4KN4X 4KITB 2Z9OA 2NVQJ 1Z0XA 3HKZN 3BR1A 3K4BA 3NWSA 1ERDA 3DXJF 3ZMSA 1KQ0A 4Q48A 3SDGA 4P96A 4FTHA 4HV6A 5GAGJ 2K02A 2KFDA 4YFKF 3QPLA 2H09A 2V6EA 3JRIA 3LQQA 5D4RA 4XNFA 1O57A 2WA0A 1ZARA 1R5HA 2JK3A 1TWHJ 4WWCA 3GBGA 2HXOA 2JVHA 4BBSJ 1U0JA 4HDUA 2VB6A 1YRNB 5L3DA 2RN7A 1HF0A 1Z77A 3HOSA 4XMYA 3HRUA 3FZVA 4MIMA 2PX9A 3GTLJ 1DU0A 3JRCA 3KP6A 3ZRGA 4A3LJ 2JRMA 2MYSA 2GIZA 1XX5A 1LEAA 2CQ7A 5EZHA 3BTLA 3P7NA 5B1AH 2Z16A 3S2DJ 3HOTA 1RRJA 2EV5A 4HV5A 2HVSA 4BJ5C 4IOCF 2WAQA 4Y13A 1MMNA 1OCZH 2OCCH 4F91B 2Z5UA 3MN2A 5E1ZB 3ZOBA 4AD9A 1OISA 2EA2A 3TMOA 3ZPLA 4M72A 2QBYA 2VBYA 2VASA 2A05A 3HGYA 4D7MA 1L0OC 2A5YB 4II3A 3F0CA 3OL4A 4OWRB 1SD4A 4W1UA 2MG4A 1C0WA 3S16J 4KNYA 3T0YA 2L4AA 3K4NA 3AG3H 3E3VA 2BY1A 2ELKA 4X1EA 4I7HA 3MCZA 2EH3A 5F0CA 4L9NA 4B43A 1UHWA 2KISA 3S3OA 1IXRC 3GTGJ 1F9NA 1DGWY 1XTAA 3HRMA 1FIAA 1J59A 2EPFA 2BY2A 2DFHA 3PJRA 3UNGC 2KRHA 1DDNA 1XGNA 4W97A 2Z33A 1SFKA 5IP7J 2WB1A 2BVMA 4M71A 3JRGA 3BPXA 3DKWA 4Y7NJ 1B8IA 1F43A 5DEQA 2Y69H 2X1CA 1SFXA 1V3FA 2R7RA 3K2ZA 3I0TA 2QBYB 2LG4A 1EH7A 1ETXA 2ZJPF 2Z2SB 3VODA 3PUBA 1ZG5A 1HSJA 3PL8A 1G4DA 5DV5A 4M3EA 2I8DA 3DKYA 4U88A 3RPQA 3OYCA 2UWMA 5F0HA 3F8NA 3GX4X 2DTZA 1GHCA 4NC7A 1V55H 2QZ8A 3S3MA 4CYCA 3HB9A 5IT9Z 3EUKL 1J5YA 2OV7A 5F08A 5L3GA 3BCBA 3WU1B 1IRZA 4Q5SF 2H94A 2VKVA 5F27A 2YR2A 3HOUJ 5EYRA 2JUGA 3H5AA 1HBXG 1IN7A 3ML6A 1UCRA 4Z2YA 4G7HF 3D0SA 1HQCA 3CCLI 1MMDA 1D1CA 3P9KA 3ABTA 1S72I 1B8IB 2ZJRF 2PG4A 2PMZA 2W85A 2YUSA 3ZQQA 1ZGWA 1GVDA 2J5OA 3LSHA 2ISYA 1MGTA 4QPQA 1KU3A 1MSEC 4AVPA 3TBIA 3ZMTA 5H6RA 4NHJA 1HSTA 2LP0A 1H88C 1K4SA 3DBHB 5KAIC 4EM1A 1I1SA 4G94A 4BS9A 3BZKA 2CRGA 1MDMA 3HRSA 2CW7A 5DDGA 2ZXIA 4XBFA 4DYCA 2MC3A 1O4XA 1OCTC 1R5ID 4BE0A 3O8HA 2EZLA 2YU3A 3OIOA 2NOJB 2F5VA 1BI3A 1WZ2A 4GRIA 2TDXA 5LGNA 2OBPA 3D5RC 1Y8RB 5C4XJ 4OIOF 4OINF 4IJAA 1REPC 2M30A 2FBKA 2JMWA 3MEXA 3S1RJ 1TQIA 1Z1DA 3KEQA 5J8CA 4CCOA 1N75A 5AIQA 5J3LA 3K1MA 4YFNF 4FX4A 1QPMA 2OPTA 3IAM2 1IUFA 3SZTA 2B7EA 4BY7J 1MDMB 3ZMDA 2QYOA 2Z1DA 3I58A 3J7AY 2HI3A 3W6KB 3C18A 5J1UA 2F4OB 2NRAC 1CF7A 2DT6A 5DYMA 1R5GA 3ZQGA 2D1VA 1TQPA 1FBQA 3DF8A 2XRLA 1SVLA 2ZSIB 1X4PA 2K9SA 4XOPA 4LG0A 2VI6A 1QHGA 2ZBKA 4XSZF 2FA5A 4B1RA 1EH6A 2HQ5A 1W7PA 4MLOA 3LQRA 1Y0UA 4R1HA 4PUSA 3WU0A 3OYEA 1QQIA 1R36A 1NG7A 3FF5A 2E2HJ 2XAHA 2D2WA 2LC2A 2IA2A 4NC8A 2VE9A 4ZTJA 1T0FA 5KVRA 5IOYA 4UUTA 4CH7A 2XKOA 1ZN2A 3LSGA 1FBUA 1CF7B 1LDKB 1A5JA 3CMYA 3IAS2 1GV2A 3V7RA 4E7JA 1FEXA 3IWZA 1YX5A 3RI4A 4UY8I 5DUIA 2X51A 1W4MA 2DFIA 2P7VB 2DN0A 3PUFA 4G6DA 3EUAA 2VLAA 3E6MA 3SXYA 1HXDA 3R6SA 2E5NA 2KJCA 1W1WE 2H8RA 3OV8A 4RS8A 2ZCWA 1R49A 3IP4B 3HOXJ 3CTAA 1JJ6C 1W7PB 4ZH4F 2KZVA 3GLXA 3F3XA 4B47A 3V7CA 5M3FJ 3MZHA 2L9SA 2DK8A 2PN6A 3BJAA 5TGTA 1ENHA 2M2EA 4DYQA 4XKVA 1B4AA 1YLFA 3OOUA 4Z6YA 3L7WA 2DA1A 2E71A 4ZYGA 2GOMA 4CXFA 3R61A 3OS0A 2PEXA 2QCOA 2OZ6A 3ERED 3N97A 1F5TA 4HOBA 2EFPA 4RB1A 3X2QH 3I3LA 3L2VA 2WV0A 1P6RA 2HQRA 5LHGA 2HQAA 1X19A 4G9YA 2O8KA 1S3JA 3ONQA 3PQKA 1T0FC 2F5CA 4O3MA 2EA4A 3TP0A 5JI6A 1MSFC 2IS4A 2STTA 1JI8A 2QWWA 4QIWN 2Y0MA 4YELA 5EGOA 3CO6C 1FMWA 2XAJA 4J00A 3RTRA 2ME6A 3FMRA 4LOCA 4I01A 2HTSA 4F55A 3CCVI 3BQZA 1IGNA 2NS7A 1SC7A 3FWEA 2DA4A 4L18B 4A69C 2WAQN 3E1SA 4UXNA 5LLQA 3ECOA 1UHSA 3JRDA 1I50J 1ETQA 3A01A 2RQQA 2JT1A 3OL3A 3GFIA 2EIJH 4B3XA 4C3JJ 5AIPA 1PUFB 2E2IJ 3QAHA 3CO7C 2HOEA 1NH3A 3OY9A 4CSWA 2VIXA 2VN2A 2STWA 3KLOA 5DUKA 4FT8A 2W24A 5IP9J 3Q5FA 1YJNI 3FXRA 4XLPF 2P5LC 3E5QA 4YG2F 3R0JA 3SZPA 4L0ZB 2R7VA 3A4CA 3LSPA 4U7BA 2G9WA 4CCJA 3GYHX 4XLEA 3S2HJ 3DTEA 5BMZA 2XRNA 4Y52J 2XAGA 3GFLA 2JPBA 2WBMA 2WB1N 3LA3A 4BACA 3HPHA 4PJNA 4M9XA 2OJED 4DBQA 3CC2I 1TWFJ 1WH7A 1JTXA 2M7BA 3DV8A 5E1WA 1SVMA 3CCJI 4BE2A 1BC7C 2WV1A 3BZCA 1S29A 1U5TA 3HTSB 1SAUA 3M4OJ 3JTGA 1OMIA 1AKHA 2L9VA 2LSOA 4MFDA 2R7ZJ 1BIBA 1T8IA 1XSDA 2XUBA 4GO1A 2K7LA 1XN7A 1J0RA 1J9IA 2M7AA 2W25A 5JVTA 2Y30A 5EEHA 2Q2EB 1R1VA 5M5XJ 4IHWA 2BEOA 3I59A 2YPRA 3WTXC 1RUOA 3ZP5A 3GFMA 3U1DA 1LB2A 2DFFA 2Q0OA 2TCTA 2AHQA 3VEPA 2R5YA 2PMZN 3B73A 3VPRA 3HOVJ 3BPVA 3M1EA 2X6YA 4BHBA 1T33A 4M73A 4E4HA 1J7KA 1VQPI 1EJ9A 2K40A 3ABMH 4BKXA 4PJLA 1FYMA 3GXOA 1U5TB 1Z9CA 4DYRA 2FBHA 4ITVA 5CQGA 3SEQA 1AKHB 3ZQHA 2NXNB 4PDKA 4OIQF 2JPCA 2VJJA 1TZLA 3IL2A 2XVCA 4KISA 2EINH 5FKKA 4EV0A 1TW2A 2EFWA 1BR2A 2XAFA 1FTTA 3BR5A 2XPUA 2R5YB 3QPTA 3L00A 4ABZA 3LA2A 4IHTA 3NEUA 5ILSA 5B3SH 1KQ9A 3GZNB 4KMFA 5E3NA 1K6YA 1MBHA 2CW8A 1Z3YA 1S7OA 3JR9A 3CF2A 3CMAI 2ZJQF 3PNTA 4U0VA 1P4WA 1RR7A 2HYJA 1MNEA 1UHMA 4WK8F 1EKEA 2F2EA 2V1DA 4BU2A 1G3YA 1IXSB 3CC4I 1QHHD 3NQOA 3LWFA 4KFCA 2LVSA 3CDIA 3EYYA 1D5YA 4U0WA 2VE8A 3JRAA 2D1HA 1AHDP 2MA3A 4BBRJ 4I0AA 3H5NA 4P55A 4YIFA 4HX7A 3H3VK 2WWYA 2HKXA 2CFXA 3RKWA 4ZYAA 1F36A 1HCRA 1ETWA 1E2XA 4L0YB 2W48A 3FKJA 1W5TA 2BHZA 5TISC 1Y6IA 2QLZA 3LA7A 3FIWA 3AG4H 2TRTA 1K7AA 3A2KA 2DMNA 2ISZA 4Y15A 3S93A 2VKEA 5FFXA 1NHAA 4LK1F 5CJ9A 4AWXB 1A6QA 5HLGA 2HYGD 2R7DA 1FLIA 3IWFA 4H4KC 3VYTB 2ID3A 1YW8A 3MZYA 2VQHA 1FBSA 5TRDA 5ILVA 3I4PA 3PFYA 2LREA 3TKYA 1ZRFA 1GVJA 3ZN1A 4EATA 4ZYHA 1XCVA 4A3JJ 2V1UA 4LK0F 2JUCA 1JKQC 4J01A 4PCQA 3W6JB 1MBJA 2QM3A 1K79A 1E3OC 2ESHA 2P81A 4M6VA 2BV6A 3BP8A 3WHBA 1E0EA 2M0CA 2PLYA 1YW7A 2O8XA 3T8TA 5K5RA 1EH8A 2GA1A 2M8GX 3AG2H 2KRCA 2IGNA 2LF8A 2QUFA 2B63J 1TWCJ 1VNDA 3IH2A 1VQLI 1HW5A 4ZJZA 2P5KA 3IC7A 2DOEA 4YIRX 2R7TA 3A0HC 1ZRDA 5DTDA 2QQ8A 2E36A 3BJOA 3CDLA 4RLFA 4FE7A 4FHTA 1Z6RA 2H27A 1PP7U 4BAYA 2R5ZA 4JK1X 1S6LA 4CZZA 5JR3A 2E1MC 1G3TA 1ON1A 1B6AA 1WGXA 3WTTC 3FKIJ 1WJ5A 2KIMA 3H36A 1K61A 1QRYA 2BBYA 3GTJJ 3W2AA 2K85A 2O7OA 1MZBA 3HRTA 2KRFA 2VJ4A 4A6DA 2ZFWA 2JA6J 3PIOF 2O61A 3EUHC 2H8WA 2GWRA 2KPMA 2H1KA 4RBOA 1WWXA 1W36D 2DPDA 3MD2A 4LLNA 2OZUA 3J7AO 1B1BA 1WHUA 3HUGB 1S8NA 4HLYA 2HTJA 3DU6A 4OU0A 3KP4A 4XLFA 1I5ZA 3JAMK 2XROA 3H0GJ 3QWLA 3W6VA 3NRVA 3KP5A 2R5ZB 1JGSA 4I09A 1ZQ3P 3HM5A 5HS7A 3ZQ7A 2DW4A 1U78A 3OR2C 5J8FA 5FRMA 2NVYJ 1W5CC 5KNLA 3MZ8A 3CMMA 4BL0B 3C2BA 3DP7A 4HA8A 3SZGA 2P4WA 4HF2A 3K2AA 5LBQA 1YITI 2FBIA 2ZXHA 2Y9YA 1F4KA 2DBBA 4A3GJ 4ENNA 1T38A 3E6DA 2COMA 1R22A 3GTPJ 1G3SA 2VJ5A 2OQGA 5FGMA 2HWVA 2FNAA 5HDGA 2LD5A 3DBLB 1TP4A 2JRTA 3W2VA 3CUQA 3TOBA 3TOAA 3F23A 1IZ1A 1VQ4I 2ZFUA 2OTJI 3AG1H 5DCFA 1RC9A 1UZCA 2IGOA 3GFJA 3C7JA 4M9ZA 3FM3A 1SFEA 1YIOA 2XF5A 4X6AJ 1FSEA 3G73A 2XAUA 3M8FA 4BQOA 4FE4A 2COBA 2CMPA 4GYGA 1QZYA 1OR7A 2XAQA 2NOGA 1R7JA 4BQAA 2NVUB 1MBEA 1DQUA 3WTYC 5LFAA 4JOMA 3J81K 3BG7A 2DA2A 2HVRA 4I6ZA 2R7QA 3R60A 4CICA 3OSFA 2IJLA 3CUQB 2ZB9A 2VOPA 2NS0A 4ZTFA 2GAUA 3ZXSA 1TW3A 2CQKA 4C3IJ 3F22A 1DPUA 3BDDA 2V9VA 1WKMA 3EQLF 2A6TA 2W7NA 5E3LA 5D5VB 5FKMA 1ZYRF 4RA2A 2NYXA 3N05A 1O3QA 1TBXA 3GF2A 5FLMJ 1HDPA 4RB2C 2AXLA 3TO7A 1RNLA 4M3FA 4RAYA 3ZQLA 2DPUA 4C2UA 4KYWA 3GLLA 3MMYB 2CUFA 2PI0A 2VQCA 3WU2C 2VC0A 1R58A 3FX3A 1Y56A 1VQ8I 3BG3A 2A07F 4MEYF 4TV7A 2MSYA 3PQJA 1A31A 2V1NA 3TO9A 4ZC3A 2VKDA 2GXBA 3ISPA 5DCMB 4A3FJ 2MBFA 2LTPA 2KL4A 1XDSA 1QNTA 2FMYA 4IQJA 4G6TB 2FRHA 5JHFA 1Q1HA 2DODA 1ITYA 2R7XA 2CV2A 1NK2P 2JA7J 2E35A 4PK4A 1BW6A 1ZREA 2CS3A 2K86A 3M1CA 2LFBA 1XS9A 1JUPA 4U0YA 4CDGA 2IS6A 1R00A 5J40A 2ZXJA 1X1AA 1J2XA 3BTIA 5AONA 4BNCA 4DBRA 1LQ1A 1YJ9I 5JLWA 3A03A 2VUMJ 1LJ9A 3CZ6A 1QBJA 3I9V2 5DD8A 3D5LA 2DJNA 3W2WA 1SEUA 3J7YJ 1T98A 2BYVE 4E7SA 2OAZA 1QO0D 5KCMA 2FQ4A 4BH9A 2AS5F 4OIPF 3OYIA 3ESWB 4M6YA 2ZMEA 2MH9A 4JYKA 5ERIA 2Y0SN 2LY1A 2V4JC 4D5FA 4CCNA 4D9JA 4JQFA 1LFUP 3WTZA 2BHYA 1WH5A 1P2FA 1KGSA 4XK4A 3DU5A 3VOEA 2HYFA 4DQ2A 2LY2A 4A6EA 4A3CJ 3ZN0A 4S04A 4UB6C 1FOKA 1SVOA 3HEFA 3T5XA 3S14J 3HJEA 4IVNA 1HLVA 2ME0A 3FXOA 1D8KA 1A36A 3J80K 5LEKA 2MW8A 5L3BA 4IHYA 1FYKA 4IO9F 3C1DA 4XICA 3L09A 5DS9A 5JFRA 1EF4A 4U7DA 3K4CA 2E7XA 1WPKA 3QQAA 4IHVA 2ZMEB 4F52A 5ICFA 3FDYA 2VKHA 4IPAA 1RIOH 3G2BA 4Y4RA 1BC8C 3FMQA 1OYIA 4G7OF 2I5UA 4QTRA 3BROA 1XCBA 1USSA 5E20A 4MNUA 3IRQA 2XSDC 3E5XA 3MFKA 1X1PA 3RKQA 1LKXA 2P8TA 3G71I 1ZR4A 3FM5A 2VQLA 2H6CA 2NVXJ 1BJAA 4XKWA 4AIJA 1HKQA 2X48A 1RR8C 2V79A 4N9IA 4LG3A 1OFCX 2KHMA 2XB5A 3ASOH 4U87A 1YO5C 1R9TJ 4KN7X 2A68F 4FASD 2EWNA 4GXOA 1HDDC 1U9OA 1GXPA 1XDUA 2V9KA 2ZO4A 3CCQI 2E1NA 4M74A 1BOBA 1MJAA 1TT5B 1NG6A 3G3ZA 1ZLKA 2WAEA 3F8FA 1QU3A 2XGCA 2OUMA 2O6GE 2HR3A 2JTVA 2RVCA 2IT0A 3K7AJ 5FKLA 2VODA 2EIMH 4GDFA 4DZPA 1XC5A 4JBAA 1IW7F 4ESJA 3L9FA 4ESFA 4LB6B 2IRFG 1KA8A 3VWBA 4AC0A 5FLXK 2K9MA 2DU9A 4HAMA 1V5GA 3EDPA 3H3UA 4BUPA 2R7OA 4NDLA 2JA2A 4CO8A 4BE1A 4CHUA 1VQKI 1FP1D 3WTUC 2ECCA 2CUEA 2DT5A 1T95A 4WXDA 2Y9ZA 2UXXA 3CCEI 1DGRM 1TC3C 3VB2A 2CYYA 5DD4A 4P9FA 3HBLA 3CCSI 2FUG2 3CUOA 3HSRA 4MTDA 1MBFA 5D6FA 1A35A 3KFWX 2K9LA 2Z3YA 4I98B 3V8LA 2EV0A 1FP2A 4G7ZF 2BZTA 2QQAA 5K5QA 1UB9A 1BBYA 3DPTA 5GPCA 1L3LA 4HW0A 3L2WA 5IYDJ 1VQMI 3DFGA 3PM1A 5TJJA 4L5IA 3P9CA 4XONA 1Z91A 3O2PE 3QPHA 1YE9A 1TNSA 2KZGA 3OYBA 1GXQA 4E70A 4ON0A 2A61A 2VL8A 4XIDA 3SJMA 3BLYA 1IG7A 3CJTB 4G6QA 3VYSB 5LRSA 5M5WJ 3REOA 3G1MA 5CVJA 2ZJ2A 4C30A 4QSHA 1XGOA 2P7CB 2FEZA 2HGCA 2A3SA 3GVAA 2UV1A 1IXCA 1ULYA 3ELKA 1PUFA 1UG2A 5BNGA 3SDBA 3A02A 3K4KA 4F7ZA 3DLLF 3E7LA 1N77A 4BDYA 2HU9A 1SFOJ 1JUMA 4ZDLA 2K5CA 3H9GA 4IKFA 3IV5A 1W0UA 4IOAF 5IT3A 3IKVA 1LEBA 2DLLA 3I64A 3MKLA 2JA8J 1WJCA 4FETA 4EM0B 3DCFA 4V2FA 4C9YA 2QA4I 2Q8KA 1YJWI 3OYAA 1GT0C 1FYLA 4I99C 2VC1A 2EFNA 3DTIA 2IGKA 3QODA 2F6CA 2HDDA 1SFUA 1GLNA 1G3WA 4RGSA 3TEDA 3S1QJ 4M3DA 1V5EA 1FWZA 3BY6A 4XRMA 3FBIB 5M3MJ 4JX6A 5J6XA 3M7GA 3TP3A 4DZJA 5DM7F 2FOKA 2NNNA 3OMYA 4P9UA 5A2QK 3JRHA 4EM2A 1T08B 3OIPA 2CU7A 4E7LA 3OYLA 1FPQA 3EYIA 2V6CA 4XLAA 3BG6A 1LNWA 2DO7A 3BZ6A 2IP2A 2QSHX 3OR1C 1BW5A 1Y39A 2L0KA 1VQOI 4ANJA 2VBWA 3R4KA 3Q3SA 4ENJA 3MAJA 2VXDA 1H9GA 2Q2EA 1D0ZA 5IY5H 2DDAA 1Z3XA 4G8XA 1XGSA 2IPQX 1TL8A 1O7FA 1Y0NA 4E7ZA 1MJ9A 3J80Z 2CJJA 2DA7A 1QVTA 3SFIA 3ZMVA 1YI2I 3HTUA 3CCUI 3I5UA 2KKOA 5LRRA 2DI3A 3FISA 4A2UA 2X6WA 1E17A 1XSXA 4LGWA 2X1EA 4BHCA 5IP6A 1MBGA 5ED4A 2XGDA 4G12A 2PFBA 2QQ9A 5K7HA 4L5JA 4PJ0C 4BXUA 3M3YJ 1N25A 3BTJA 2E5ZA 3FMSA 3G1LA 2IS1A 4RMNA 5ICEA 5GADJ 5KHDA 2DA6A 3LSMA 4MHGA 4XR6A 4LITA 3RQ4A 1UG0A 2JA5J 1DU6A 3S3NA 2DOAA 4RDUA 1IF1A 5IPAA 4J19A 1ZELA 4AUXA 1PP8F 2MGQA 3P9IA 3OWTA 4IRIA 4XLNF 3FXJA 1QZZA 3FXKA 1D0YA 4A5MA 1AWCA 1UMQA 1EV7A 1X3WB 3A0BC 3RJPA 4XQFA 5F1JA 5ICGA 4FQGA 2ZXWH 2W57A 5HLHA 4EEFG 4YRVA 3DEEA 3HSEA 3K4LA 1PJRA 2IXSA 2LNBA 4Y33A 1ODDA 4R8HA 2CW0F 1CGPA 1T2KA 2HPIA 1WSUA 4IF4A 2N8GA 3RYRA 3MKYB 3ZQIA 5EF6A 3TDUC 2RV8A 3TW6A 4BXXJ 2IGMA 3CF5F 2ADUA 2KIQA 1MMSA 2F5DA 5E3MA 5FLXZ 1U5TC 2L7MP 2CQXA 2OD5A 5LHIA 4A3MJ 4A3DJ 1QA6A 2QSFX 1SD7A 2LK2A 3UKGA 4OOIA 1ZGJA 2GOXB 4KIGA 4CYDA 1WJEA 4M9SA 2XPVA 4YIIA 1RPWA 4YFXF 2DTRA 3B6CA 2DA5A 2DYRH 1O3RA 4EJVA 1LDJA 1IRGA 1B9NA 1BI1A 2DMPA 3WHCA 5CPRB 3GTOJ 5E8IA 2YS9A 3JTHA 4N4NB 2BOLA 4XKBA 3BQYA 4UUVA 1CQTA 3HIFA 1I39A 5F64A 2R4GA 2X85A 2IA0A 2UXNA 2V26A 4EGYA 1LFPA 2L7FP 2R7FA 4A3IJ 1B9MA 1MIJA 4HX4A 3QU6A 4HNUA 4ENMA 5EZGA 2GZWA 3PNVA 1ETOA 1UJ8A 2EQRA 2MH2A 4IZZA 2M3AA 1HKTA 5D6EA 4MQ9F 1X3ZB 1K83J 1PVEA 4A93J 3QYEA 3N4MA 2LF7A 4C3HJ 5B1BH 2W00A 3F8CA 3MKWB 3CP8A 5FB2A 5HDNA 3KETA 1TT0A 1YOVB 3GTMJ 1ETVA 5GAHJ 1FJLA 5K5OA 2QF7A 2CUJA 3WE2A 2KIFA 3HHHA 2Y0SA 1I27A 4ZDPA 3OYHA 1JT0A 2DYSH 4EMSA 1MKMA 5HLIA 3ERMA 1I3AA 4L9JA 4NBQA 2MD5A 2NVTJ 1ZGAA 4PJMA 3IH4A 1FTZA 1K4TA 2D45A 2RGVA 2L7ZA 2P6SA 2IW5A 5EG0B 1RZ4A 2DOFA 3H92A 3HHGA 3K10A 5K1YA 2P6TA 4B4CA 2ID6A 1EA3A 1G6NA 4OAYA 2DXIA 2V9PA 5CYVA 1KONA 2Y75A 1Z7UA 4BHPA 2X0LA 5CVIA 2QKLB 4UNOA 3HPGA 1XMKA 4LIVA 3GCMA 2GXAA 2KP6A 3V4GA 1RUNA 2LKXA 2CH0A 3KP7A 4ZYDA 1MMAA 1QVUA 1G2HA 2YX7A 5GTHC 5H6QA 2YX4A 1P7JA 3HUGA 1Y1WJ 2LYCA 2L02A 1KYWA 2XGXA 4BY1J 3VDXA 5GTIC 1DPRA 2XV4S 3K0LA 2D5VA 1V4RA 2R0QC 4HG2A 3K1PA 2ZKZA 2FJ1A 4RM3A 2ACJA 1OLTA 4O6JA 4R79A 5A2QZ 2K9QA 3TL4X 1FOYA 5CKTA 2DK5A 1K78A 3M8EA 4I0BA 3WODF 5FKOA 1IC8A 1NTCA 2VOOA 3IHUA 1X2MA 3KPHA 2R92J 2XF7A 4BQQA 4NB5A 3D5SC 2VT2A 2EZIA 3OYFA 4XOTA 2PJRA 3NWTA 1U8RA 2WADA 3GEZA 4CUGA 4E7IA 1JHHA 1HW2A 4KDPA 4PFPA 3BJ6A 4N4OB 4E6KG 1P7IA 1F1ZA 4RB0A 4QPOA 3RDIA 1R4MB 4XRSG 2XB0X 1D5VA 1ZLJA 2R7SA 4KIFA
chains in the Genus database with same CATH topology
2DN0A 5C44J 2FQ4A 2AO9A 2X6OA 2HOAA 2EZKA 3LSRA 5K7FA 2H8RA 3G1OA 1RESA 4GFBA 3HOXJ 1JJ6C 1OJLA 4JYKA 2Y0SN 3I4MJ 3LNQA 5M3FJ 5M5YJ 4D5FA 2DMUA 1ENHA 2M2EA 2JWTA 3Q0UA 4DYQA 1LFUP 3OOUA 1GV5A 2DA1A 1WH5A 4XK4A 1POGA 2QCOA 4A3CJ 3HEFA 3S14J 2O8KA 1HLVA 2ME0A 4JP0A 5EG0A 3TP0A 1MSFC 2MW8A 4IHYA 4QIWN 1IJWC 4XICA 5EGOA 5C3EJ 5DS9A 3HDDA 3FK6A 4IEJA 1EF4A 4FCYA 1LFBA 2L9RA 2ME6A 3QPSA 1WPKA 4LOCA 3QQAA 4IHVA 2ECBA 1QPIA 1IGNA 3BQZA 3LOCA 2FX0A 2NS7A 3ZQCA 2DA4A 4JX4A 4A69C 2WAQN 4QTRA 1S7EA 2JJ7A 3HOWJ 1UHSA 1I3QJ 3JRDA 1I50J 1W0TA 1ETQA 3A01A 1ZR2A 2XSDC 3RKQA 1JT6A 3B6AA 1ZR4A 5HODA 4C3JJ 1PUFB 3Q0VA 2NVXJ 2E2IJ 1MH3A 3NAUA 2X48A 1MH4A 3PO2J 2DMQA 1OFCX 3JREA 2XB5A 4B3AA 5IP9J 2CQQA 5JLXA 1R9TJ 4HNVA 1Y1VJ 3LSPA 1HDDC 1U9OA 4A3BJ 3D1NI 1BJZA 3S2HJ 4Y52J 1OCPA 3S17J 2XGCA 2WB1N 3K7AJ 5FKLA 2EZHA 1MBKA 4DZPA 1XC5A 3S15J 3BG5A 2EBIA 3PO3J 4AC0A 1JKOC 2E2JJ 1TWFJ 1WH7A 1JTXA 2Y31A 1MNMC 4MFEA 5FJ8J 2M34A 5E3OA 4NDLA 2WV1A 1JJ8C 4A3EJ 2LY9A 3M4OJ 1AKHA 2ECCA 2Y2ZA 1I6HJ 2CUEA 2I10A 4MFDA 2R7ZJ 4DW6A 2Y9ZA 3GTQJ 1TC3C 1XG1A 3I4NJ 3HBLA 3BT9A 2Y30A 2NS8A 4IHWA 5M5XJ 3TW7A 3RQIA 1VI0A 3CCYA 1MBFA 1BL0A 2R5YA 3HOVJ 2TCTA 2AHQA 5IYBJ 2PMZN 3VPRA 3S1MJ 2M9HA 1JKRC 1WCMJ 3Q0WA 1T33A 3FK7A 5GPCA 5IYDJ 2K40A 4BKXA 1VF9A 2RAEA 3NARA 3PM1A 1U9NA 2LR8A 9ANTA 2HOTA 4M3BA 4DYRA 1JKPC 1AKHB 3ZQHA 3DEWA 5FLVA 3BTCA 4XIDA 3SJMA 3RZDJ 1IG7A 5FKKA 1X2NA 5M5WJ 1WI3A 3G1MA 1RKWA 1JUSA 5GPAA 2IBDA 2YU9J 4QSHA 3BR3A 1FTTA 1IV6A 3BR5A 2XPUA 2R5YB 4ABZA 1PUFA 5IOZA 3ZQFA 1UG2A 5GP9A 5BNGA 5J1RA 3A02A 2XGEA 5E3NA 1MBHA 1IDYA 3E7LA 3L1PA 3JR9A 1SFOJ 1JUMA 4M3GA 3JRFA 2DMTA 1U8BA 1RR7A 3IV5A 2HXIA 2HYJA 1W0UA 1Q1VA 3MKLA 1HOMA 2JA8J 3DCFA 4V2FA 5F0FA 1AU7A 2LVSA 1GT0C 1D5YA 3JRAA 2FD5A 5C4JJ 1AHDP 4BBRJ 5F04A 1ETKA 2HDDA 3H3VK 3TEDA 1YRNA 3S1QJ 2HOSA 5K7ZA 4M3DA 2IEKA 4XRMA 5M3MJ 1T56A 4JX6A 1F36A 2GBYA 3OSGA 3TP3A 4DZJA 3JRHA 4A3IJ 1HCRA 1ETWA 3GTKJ 3BR2A 2W48A 2CU7A 2GM4A 3IH3A 4D5CA 3FIWA 3BG9A 2TRTA 1Z0XA 3HKZN 2G0EA 4S0HB 2NVQJ 3BR1A 1ZKGA 2DMNA 4CYCB 1BW5A 1B72A 3SDGA 2VKEA 2L0KA 4FTHA 1RKTA 3Q3SA 3QPLA 3JRIA 1FIPA 4A3KJ 3BR6A 2ID3A 2JK3A 1TWHJ 3GBGA 2HXOA 4BBSJ 3MVPA 1VFCA 2CJJA 2DA7A 1QVTA 1RETA 3SFIA 1YRNB 3HOZJ 4A3JJ 1HF0A 1TWGJ 1Z77A 2OF7A 4MIMA 1JKQC 3FISA 5IP6A 1MBGA 2XGDA 4G12A 3GTLJ 1DU0A 3HOYJ 1MBJA 4I76A 5K7HA 3JRCA 1E3OC 3M3YJ 2P81A 3BTJA 3G1LA 4A3LJ 4M6VA 1IDZA 3WHBA 2O9LA 2DA6A 2M0CA 5EZHA 3BTLA 1DU6A 2JA5J 2M8GX 4RDUA 3S2DJ 5IPAA 1B72B 2R93J 4J19A 4AUXA 2MGQA 2B63J 4L5EA 1TWCJ 1VNDA 4IHXA 3IH2A 4C2MJ 3MN2A 1UMQA 5F1JA 1GDTA 3ZOBA 5DTDA 3CDLA 4FE7A 3HGGA 3O8GA 4EEFG 2R5ZA 3HGYA 4D7MA 1WGXA 3F0CA 4W1UA 3FKIJ 1ETYA 2MG4A 4UUSA 3S16J 1K61A 2N8GA 1QRYA 3GTJJ 4AYBN 4X1EA 2ELKA 2O7OA 3ZQIA 5EF6A 2EH3A 5F0CA 2JA6J 4XRSA 3GTGJ 1JGGA 3TW6A 2H1KA 4RBOA 4BXXJ 1FIAA 3BR0A 4FISA 3LSJA 5E3MA 4W97A 2L7MP 2CQXA 5IP7J 4A3MJ 4A3DJ 3JRGA 1H8AC 5FKNA 2LK2A 3UKGA 4Y7NJ 1B8IA 1F43A 1GUUA 3H0GJ 2XPVA 1JTYA 1RPWA 3W6VA 2VPRA 3B6CA 2R5ZB 2DA5A 5EEAA 1ZQ3P 1BA5A 1ETXA 3HM5A 5J1YA 2X9DA 4M3EA 2DMPA 3WHCA 4UUSB 1U78A 4MO7A 5F0HA 3GTOJ 2NVYJ 2DTZA 2YS9A 3C2BA 2E19A 3K2AA 3BQYA 1APLC 4CYCA 1CQTA 3HB9A 2Y9YA 1IRZA 5F08A 4A3GJ 2KDZA 2VKVA 5F27A 2L7FP 3GTPJ 3HOUJ 5EYRA 2LD5A 5EZGA 1ETOA 2EQRA 3S1NJ 1B8IB 2YUSA 1ZGWA 1GVDA 1MSEC 2K9NA 1K83J 4A93J 3CQZJ 4C3HJ 2LP0A 4X6AJ 1H88C 4FE4A 3GTMJ 2COBA 2CRGA 1NK3P 1ETVA 3JRBA 1TWAJ 4DYCA 1FJLA 2QF7A 1ORKA 1O4XA 1OCTC 4V2GA 2NOGA 3O8HA 1JT0A 2EZLA 4JX5A 3OIOA 1MBEA 2KT0A 2NVTJ 2DA2A 4I6ZA 3IH4A 5C4XJ 1FTZA 3OSFA 2L7ZA 2ZB9A 5EG0B 4B4CA 2JMWA 2ID6A 4C3IJ 3S1RJ 5EGOB 2GLOA 5EDNA 5J3LA 4D7NA 5E3LA 5FKMA 2OPTA 1IUFA 4BY7J 2LKXA 5FLMJ 1LE8A 1HDPA 1QVUA 3ZQLA 1G2HA 4M3FA 2HI3A 5J1UA 2CUFA 1A6IA 1P7JA 3A01B 3BG3A 3ZQGA 1Y1WJ 4BY1J 2MSYA 1H89C 2D5VA 2JN6A 2R0QC 4A3FJ 2LTPA 2XRLA 2FJ1A 3RZOJ 5IYCJ 1ZTRA 1X58A 2K9SA 2K9QA 2VI6A 1ITYA 4B1RA 5FKOA 2LLKA 1NTCA 1IC8A 1NK2P 2HQ5A 1X2MA 4MLOA 2JA7J 2R92J 1BW6A 1SANA 2E2HJ 2EZIA 2LFBA 1XS9A 1JUPA 1LE8B 1ZK8A 3BTIA 5IOYA 4UUTA 1P7IA 2XPWA 3A03A 5JLWA 2VUMJ 2DA3A 3LSGA 2IAIA 1A5JA 2DJNA 4XRSG 3CMYA 2XB0X 1GV2A 2E1OA 1FEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN0 A;  5C44 J;  2FQ4 A;  2AO9 A;  2X6O A;  2HOA A;  2EZK A;  3LSR A;  5K7F A;  2H8R A;  3G1O A;  1RES A;  4GFB A;  3HOX J;  1JJ6 C;  1OJL A;  4JYK A;  2Y0S N;  3I4M J;  3LNQ A;  5M3F J;  5M5Y J;  4D5F A;  2DMU A;  1ENH A;  2M2E A;  2JWT A;  3Q0U A;  4DYQ A;  1LFU P;  3OOU A;  1GV5 A;  2DA1 A;  1WH5 A;  4XK4 A;  1POG A;  2QCO A;  4A3C J;  3HEF A;  3S14 J;  2O8K A;  1HLV A;  2ME0 A;  4JP0 A;  5EG0 A;  3TP0 A;  1MSF C;  2MW8 A;  4IHY A;  4QIW N;  1IJW C;  4XIC A;  5EGO A;  5C3E J;  5DS9 A;  3HDD A;  3FK6 A;  4IEJ A;  1EF4 A;  4FCY A;  1LFB A;  2L9R A;  2ME6 A;  3QPS A;  1WPK A;  4LOC A;  3QQA A;  4IHV A;  2ECB A;  1QPI A;  1IGN A;  3BQZ A;  3LOC A;  2FX0 A;  2NS7 A;  3ZQC A;  2DA4 A;  4JX4 A;  4A69 C;  2WAQ N;  4QTR A;  1S7E A;  2JJ7 A;  3HOW J;  1UHS A;  1I3Q J;  3JRD A;  1I50 J;  1W0T A;  1ETQ A;  3A01 A;  1ZR2 A;  2XSD C;  3RKQ A;  1JT6 A;  3B6A A;  1ZR4 A;  5HOD A;  4C3J J;  1PUF B;  3Q0V A;  2NVX J;  2E2I J;  1MH3 A;  3NAU A;  2X48 A;  1MH4 A;  3PO2 J;  2DMQ A;  1OFC X;  3JRE A;  2XB5 A;  4B3A A;  5IP9 J;  2CQQ A;  5JLX A;  1R9T J;  4HNV A;  1Y1V J;  3LSP A;  1HDD C;  1U9O A;  4A3B J;  3D1N I;  1BJZ A;  3S2H J;  4Y52 J;  1OCP A;  3S17 J;  2XGC A;  2WB1 N;  3K7A J;  5FKL A;  2EZH A;  1MBK A;  4DZP A;  1XC5 A;  3S15 J;  3BG5 A;  2EBI A;  3PO3 J;  4AC0 A;  1JKO C;  2E2J J;  1TWF J;  1WH7 A;  1JTX A;  2Y31 A;  1MNM C;  4MFE A;  5FJ8 J;  2M34 A;  5E3O A;  4NDL A;  2WV1 A;  1JJ8 C;  4A3E J;  2LY9 A;  3M4O J;  1AKH A;  2ECC A;  2Y2Z A;  1I6H J;  2CUE A;  2I10 A;  4MFD A;  2R7Z J;  4DW6 A;  2Y9Z A;  3GTQ J;  1TC3 C;  1XG1 A;  3I4N J;  3HBL A;  3BT9 A;  2Y30 A;  2NS8 A;  4IHW A;  5M5X J;  3TW7 A;  3RQI A;  1VI0 A;  3CCY A;  1MBF A;  1BL0 A;  2R5Y A;  3HOV J;  2TCT A;  2AHQ A;  5IYB J;  2PMZ N;  3VPR A;  3S1M J;  2M9H A;  1JKR C;  1WCM J;  3Q0W A;  1T33 A;  3FK7 A;  5GPC A;  5IYD J;  2K40 A;  4BKX A;  1VF9 A;  2RAE A;  3NAR A;  3PM1 A;  1U9N A;  2LR8 A;  9ANT A;  2HOT A;  4M3B A;  4DYR A;  1JKP C;  1AKH B;  3ZQH A;  3DEW A;  5FLV A;  3BTC A;  4XID A;  3SJM A;  3RZD J;  1IG7 A;  5FKK A;  1X2N A;  5M5W J;  1WI3 A;  3G1M A;  1RKW A;  1JUS A;  5GPA A;  2IBD A;  2YU9 J;  4QSH A;  3BR3 A;  1FTT A;  1IV6 A;  3BR5 A;  2XPU A;  2R5Y B;  4ABZ A;  1PUF A;  5IOZ A;  3ZQF A;  1UG2 A;  5GP9 A;  5BNG A;  5J1R A;  3A02 A;  2XGE A;  5E3N A;  1MBH A;  1IDY A;  3E7L A;  3L1P A;  3JR9 A;  1SFO J;  1JUM A;  4M3G A;  3JRF A;  2DMT A;  1U8B A;  1RR7 A;  3IV5 A;  2HXI A;  2HYJ A;  1W0U A;  1Q1V A;  3MKL A;  1HOM A;  2JA8 J;  3DCF A;  4V2F A;  5F0F A;  1AU7 A;  2LVS A;  1GT0 C;  1D5Y A;  3JRA A;  2FD5 A;  5C4J J;  1AHD P;  4BBR J;  5F04 A;  1ETK A;  2HDD A;  3H3V K;  3TED A;  1YRN A;  3S1Q J;  2HOS A;  5K7Z A;  4M3D A;  2IEK A;  4XRM A;  5M3M J;  1T56 A;  4JX6 A;  1F36 A;  2GBY A;  3OSG A;  3TP3 A;  4DZJ A;  3JRH A;  4A3I J;  1HCR A;  1ETW A;  3GTK J;  3BR2 A;  2W48 A;  2CU7 A;  2GM4 A;  3IH3 A;  4D5C A;  3FIW A;  3BG9 A;  2TRT A;  1Z0X A;  3HKZ N;  2G0E A;  4S0H B;  2NVQ J;  3BR1 A;  1ZKG A;  2DMN A;  4CYC B;  1BW5 A;  1B72 A;  3SDG A;  2VKE A;  2L0K A;  4FTH A;  1RKT A;  3Q3S A;  3QPL A;  3JRI A;  1FIP A;  4A3K J;  3BR6 A;  2ID3 A;  2JK3 A;  1TWH J;  3GBG A;  2HXO A;  4BBS J;  3MVP A;  1VFC A;  2CJJ A;  2DA7 A;  1QVT A;  1RET A;  3SFI A;  1YRN B;  3HOZ J;  4A3J J;  1HF0 A;  1TWG J;  1Z77 A;  2OF7 A;  4MIM A;  1JKQ C;  3FIS A;  5IP6 A;  1MBG A;  2XGD A;  4G12 A;  3GTL J;  1DU0 A;  3HOY J;  1MBJ A;  4I76 A;  5K7H A;  3JRC A;  1E3O C;  3M3Y J;  2P81 A;  3BTJ A;  3G1L A;  4A3L J;  4M6V A;  1IDZ A;  3WHB A;  2O9L A;  2DA6 A;  2M0C A;  5EZH A;  3BTL A;  1DU6 A;  2JA5 J;  2M8G X;  4RDU A;  3S2D J;  5IPA A;  1B72 B;  2R93 J;  4J19 A;  4AUX A;  2MGQ A;  2B63 J;  4L5E A;  1TWC J;  1VND A;  4IHX A;  3IH2 A;  4C2M J;  3MN2 A;  1UMQ A;  5F1J A;  1GDT A;  3ZOB A;  5DTD A;  3CDL A;  4FE7 A;  3HGG A;  3O8G A;  4EEF G;  2R5Z A;  3HGY A;  4D7M A;  1WGX A;  3F0C A;  4W1U A;  3FKI J;  1ETY A;  2MG4 A;  4UUS A;  3S16 J;  1K61 A;  2N8G A;  1QRY A;  3GTJ J;  4AYB N;  4X1E A;  2ELK A;  2O7O A;  3ZQI A;  5EF6 A;  2EH3 A;  5F0C A;  2JA6 J;  4XRS A;  3GTG J;  1JGG A;  3TW6 A;  2H1K A;  4RBO A;  4BXX J;  1FIA A;  3BR0 A;  4FIS A;  3LSJ A;  5E3M A;  4W97 A;  2L7M P;  2CQX A;  5IP7 J;  4A3M J;  4A3D J;  3JRG A;  1H8A C;  5FKN A;  2LK2 A;  3UKG A;  4Y7N J;  1B8I A;  1F43 A;  1GUU A;  3H0G J;  2XPV A;  1JTY A;  1RPW A;  3W6V A;  2VPR A;  3B6C A;  2R5Z B;  2DA5 A;  5EEA A;  1ZQ3 P;  1BA5 A;  1ETX A;  3HM5 A;  5J1Y A;  2X9D A;  4M3E A;  2DMP A;  3WHC A;  4UUS B;  1U78 A;  4MO7 A;  5F0H A;  3GTO J;  2NVY J;  2DTZ A;  2YS9 A;  3C2B A;  2E19 A;  3K2A A;  3BQY A;  1APL C;  4CYC A;  1CQT A;  3HB9 A;  2Y9Y A;  1IRZ A;  5F08 A;  4A3G J;  2KDZ A;  2VKV A;  5F27 A;  2L7F P;  3GTP J;  3HOU J;  5EYR A;  2LD5 A;  5EZG A;  1ETO A;  2EQR A;  3S1N J;  1B8I B;  2YUS A;  1ZGW A;  1GVD A;  1MSE C;  2K9N A;  1K83 J;  4A93 J;  3CQZ J;  4C3H J;  2LP0 A;  4X6A J;  1H88 C;  4FE4 A;  3GTM J;  2COB A;  2CRG A;  1NK3 P;  1ETV A;  3JRB A;  1TWA J;  4DYC A;  1FJL A;  2QF7 A;  1ORK A;  1O4X A;  1OCT C;  4V2G A;  2NOG A;  3O8H A;  1JT0 A;  2EZL A;  4JX5 A;  3OIO A;  1MBE A;  2KT0 A;  2NVT J;  2DA2 A;  4I6Z A;  3IH4 A;  5C4X J;  1FTZ A;  3OSF A;  2L7Z A;  2ZB9 A;  5EG0 B;  4B4C A;  2JMW A;  2ID6 A;  4C3I J;  3S1R J;  5EGO B;  2GLO A;  5EDN A;  5J3L A;  4D7N A;  5E3L A;  5FKM A;  2OPT A;  1IUF A;  4BY7 J;  2LKX A;  5FLM J;  1LE8 A;  1HDP A;  1QVU A;  3ZQL A;  1G2H A;  4M3F A;  2HI3 A;  5J1U A;  2CUF A;  1A6I A;  1P7J A;  3A01 B;  3BG3 A;  3ZQG A;  1Y1W J;  4BY1 J;  2MSY A;  1H89 C;  2D5V A;  2JN6 A;  2R0Q C;  4A3F J;  2LTP A;  2XRL A;  2FJ1 A;  3RZO J;  5IYC J;  1ZTR A;  1X58 A;  2K9S A;  2K9Q A;  2VI6 A;  1ITY A;  4B1R A;  5FKO A;  2LLK A;  1NTC A;  1IC8 A;  1NK2 P;  2HQ5 A;  1X2M A;  4MLO A;  2JA7 J;  2R92 J;  1BW6 A;  1SAN A;  2E2H J;  2EZI A;  2LFB A;  1XS9 A;  1JUP A;  1LE8 B;  1ZK8 A;  3BTI A;  5IOY A;  4UUT A;  1P7I A;  2XPW A;  3A03 A;  5JLW A;  2VUM J;  2DA3 A;  3LSG A;  2IAI A;  1A5J A;  2DJN A;  4XRS G;  3CMY A;  2XB0 X;  1GV2 A;  2E1O A;  1FEX A; 
#chains in the Genus database with same CATH topology
 1OQY A;  2VT3 A;  3KYC B;  5D5U B;  2AO9 A;  3OYM A;  3AFH A;  4E7H A;  4EGZ A;  1BN5 A;  1YTY A;  1K78 B;  3G1O A;  4GFB A;  3LAP A;  1OJL A;  5EEG A;  3VYR B;  2DT7 B;  4NC6 A;  3K6G A;  2MFZ A;  1VQ5 I;  2PJR B;  2DMU A;  3Q0U A;  3V8J A;  2VON A;  2OCE A;  3LAJ A;  2JQ7 A;  5FD5 A;  1IV8 A;  4WXC A;  1S5L C;  1B59 A;  3ASN H;  2G7H A;  3AL0 B;  5FRO A;  2M0M A;  1YG2 A;  3I53 A;  2M45 A;  3O3K A;  2FXA A;  5FO5 A;  3U2R A;  3GME A;  4JP0 A;  5J47 A;  2DFE A;  2HPM A;  5CLS A;  2KJB A;  4WXH A;  1MMG A;  3S8P A;  1IJW C;  5C3E J;  2EIK H;  3HDD A;  4IEJ A;  4PJJ A;  2W84 A;  1LFB A;  1Z67 A;  2JZY A;  3QPS A;  1DUX C;  3LFU A;  5HNF A;  2ECB A;  2XHK A;  1QPI A;  4AYB A;  2FX0 A;  3CJR B;  3IKT A;  4HRI A;  1WVR A;  2QQB A;  5J4Y A;  1P9Q C;  1A04 A;  2L7K A;  5HVQ C;  1MD0 A;  5BPI A;  3HOW J;  1MJB A;  1I3Q J;  2KLO A;  1K6O A;  4HBL A;  3B6A A;  3FBN B;  5HOD A;  5DCM A;  1LVK A;  1ZHF A;  3Q0V A;  2RNJ A;  2X6X A;  1IN8 A;  4UB8 C;  2R3S A;  2QGU A;  1ZG1 A;  3PO2 J;  2XSJ C;  3JRE A;  1PDN C;  3PSI A;  1D3Y A;  2CQQ A;  5JLX A;  4QWQ A;  3K70 C;  2QVO A;  1FZP B;  4II2 A;  3CUQ C;  1OCP A;  2GA2 A;  2WY7 Q;  2A6E F;  5E1X A;  1U6G A;  2O3F A;  2AQE A;  4Y3O A;  1O3S A;  3B02 A;  3BG5 A;  4KT6 A;  1FX7 A;  3RIR A;  3PO3 J;  2NAZ A;  2OA4 A;  4A0Y A;  3TO6 A;  2E7W A;  1JKO C;  3QOP A;  2DCE A;  3T8R A;  2LDU A;  4FX0 A;  1OR7 C;  2Y31 A;  5LHH A;  4MFE A;  3KX2 A;  1FC3 A;  1MNM C;  5E3O A;  3TQN A;  3PIP F;  5KK1 A;  1D8J A;  2K3F A;  1JJ8 C;  4RGR A;  2RKH A;  2RQP A;  4A3E J;  2LY9 A;  2ZSH B;  4HLX A;  1I6H J;  5E18 F;  4HF1 A;  2UZK A;  1OPC A;  2FE3 A;  3KZI C;  2EV6 A;  3ZMZ A;  1S9H A;  2C6Y A;  3R0A A;  4WX9 A;  1YFH A;  3LSK A;  5E17 F;  3KYL A;  2NS8 A;  3OYG A;  2VPL A;  3TW7 A;  5HS8 A;  1X1C A;  5L3E A;  5EJC A;  3RQI A;  4L9V A;  4PFO A;  1BL0 A;  2FF4 A;  2L4M A;  3CC7 I;  1VQ6 I;  2FOW A;  4HF0 A;  3KZZ A;  3PNY A;  2WY8 Q;  1WCM J;  2XDV A;  4EJW A;  4NUB A;  1Z05 A;  3WGI A;  2IA1 A;  2RAE A;  2K4J A;  3AAF A;  3NAR A;  4F93 B;  4HYE A;  4BDZ A;  3Q9V A;  1U9N A;  2LR8 A;  5KAF C;  4EVI A;  5E79 C;  2Y48 A;  5B66 C;  5FLV A;  2L9N A;  4HEA 2;  3RZD J;  3E97 A;  2ZNZ A;  3OYD A;  1FNN A;  2PQ8 A;  1R1T A;  5CVU A;  5DM6 F;  1OKR A;  3K4M A;  1IN4 A;  1WI3 A;  4PGH A;  1JUS A;  5GPA A;  3RPU D;  3LSI A;  2YU9 J;  4IHS A;  2RNG A;  2XKP A;  4N0B A;  4F92 B;  2PMU A;  2CGP A;  2BXY A;  3ZQF A;  3K1N A;  5J1R A;  1VQN I;  2K27 A;  3BOQ A;  2E60 A;  2GXG A;  3F6O A;  4LD5 A;  3ULQ B;  1IDY A;  4BQN A;  2ELJ A;  3L1P A;  4X0G A;  4M3G A;  4F3Q A;  1D1A A;  4KT5 C;  1JHF A;  3JRF A;  2DMT A;  3KP3 A;  4HZF A;  1U8B A;  2Z99 A;  2HXI A;  2CV1 A;  1S7A A;  2H6B A;  4RAG A;  4KUM A;  2HFH A;  3K70 D;  4IQ4 A;  3E0J B;  3ZMU A;  2MC4 A;  2W4S A;  2A69 F;  1BI0 A;  5F0F A;  1J09 A;  3K69 A;  1TLH B;  4UHT A;  4BJT A;  1STZ A;  1FOX A;  1BIA A;  3F6V A;  2L2O A;  4E7K A;  1WQ2 A;  1P4A A;  1R6R A;  2ETH A;  3L2R A;  1OYY A;  3ZR8 X;  4PSW A;  3QYB A;  5LEJ A;  2ZME C;  2BGC A;  4IL6 C;  3JAM Z;  2HVQ A;  1IAW A;  2JSC A;  2HOS A;  4LFU A;  3C2H A;  4K2E A;  1U3E M;  3F9K A;  4DJA A;  2LRD A;  2MLK A;  4KIB A;  3OSG A;  2R7U A;  3QP6 A;  2X4H A;  2MLG A;  4RGX A;  1I6X A;  2GM4 A;  4UVA A;  5D5W B;  3IH3 A;  4MEX F;  4OMY A;  4ZDO A;  3WTV C;  4D5C A;  2O5R A;  2WAF A;  3BG9 A;  4S0H B;  2G0E A;  3F72 A;  5D8K B;  4MQV A;  1ZKG A;  3SHF A;  4CYC B;  4CA0 A;  1B72 A;  3L2C A;  2W1O A;  5D5X B;  1RKT A;  3CLQ A;  1XGM A;  1LPQ A;  5E8G A;  3DPL C;  1JE8 A;  1FIP A;  4A3K J;  3WG9 A;  2M4K A;  1LVA A;  1H0M A;  2FML A;  3BR6 A;  3VSK A;  4QLC U;  2GIV A;  5LGT A;  4IX7 A;  4XN3 A;  3MVP A;  1FY7 A;  3K4J A;  3ZGK A;  4EJO A;  2PMH A;  2F5E A;  1VFC A;  1RET A;  4LLL A;  2CO5 A;  3HOZ J;  1TWG J;  1X1B A;  2OC6 A;  2OF7 A;  3OOP A;  1YYV A;  1Y8Q B;  2KDO A;  4CCL A;  3KCC A;  3HOY J;  4I76 A;  4HST A;  4KJZ A;  1HKS A;  3WE3 A;  4MGR A;  1IDZ A;  4AIK A;  3U9G A;  2O9L A;  4AID A;  3FXL A;  1UAA A;  1AA7 A;  1B72 B;  1FT9 A;  4A0X A;  2OU2 A;  2R93 J;  2LH9 A;  4L5E A;  2NNY A;  2QEN A;  2V7F A;  4IHX A;  3SQN A;  3RYP A;  3SFZ A;  4C2M J;  3J81 Z;  1G59 A;  1ACI A;  1VZ0 A;  1WJF A;  2HQN A;  3ZCO A;  1FOW A;  1GDT A;  1Z7L A;  5LD2 C;  3WGH A;  3T1B A;  2L5Q A;  1IO2 A;  4ESB A;  3HGG A;  3O8G A;  1SD5 A;  3KIO A;  4AU7 A;  2BXZ A;  3DWL E;  4PGG A;  1V54 H;  1ETY A;  4UUS A;  1MND A;  5FD6 A;  4AYB N;  3OYN A;  4ENK A;  3H5R A;  3JW4 A;  3CES A;  4HX8 A;  4AIH A;  4BYY A;  4DGW B;  4CZC A;  5LGU A;  2FQ3 A;  3HYI A;  4HQM A;  1J75 A;  4XRS A;  1JGG A;  2L54 A;  2HZD A;  3BR0 A;  4FIS A;  3LSJ A;  2KMU A;  1OYW A;  2OQR A;  4ZZD A;  4DOZ A;  5L3F A;  4A5N A;  3L2U A;  3AKZ A;  1H8A C;  5FKN A;  2HS5 A;  4CCM A;  3VFZ A;  1GUU A;  3KZY A;  2ELH A;  2PBI A;  3DKX A;  3VSL A;  1JTY A;  3V7S A;  2VPR A;  4LG0 B;  3ECH A;  5EEA A;  1BA5 A;  2ESN A;  1IRF A;  2QKM B;  5D8L B;  1ZRC A;  3S2W A;  5J1Y A;  2VXZ A;  2X9D A;  3U21 A;  4EJT A;  4UUS B;  5CQE A;  2E34 A;  4MO7 A;  4BXF A;  3DEU A;  2QSG X;  3VYU B;  1TTY A;  1WI9 A;  2BW3 A;  2E19 A;  4N9H A;  3MKZ A;  1APL C;  2EB7 A;  3C3W A;  1Z6T A;  2KDZ A;  4P5O A;  2M4G A;  4P1W A;  2HEO A;  5HOO A;  3M9A A;  4GCV A;  5BQT A;  1BR1 A;  1YS6 A;  2PJP A;  3S1N J;  3RKY A;  1SMT A;  2V1X A;  3P5J A;  2XF6 A;  2BE5 F;  2K9N A;  3DBR B;  4HSR A;  3WTS C;  3FXQ A;  3H9Q A;  2RC4 A;  1BR4 A;  3CQZ J;  2M5W A;  1DP7 P;  1XPX A;  2FNP A;  3WGG A;  4XN0 A;  3GW2 A;  5F1R A;  3H35 A;  4XLC A;  1NK3 P;  3JRB A;  1TWA J;  3BWG A;  2BW3 B;  1LUJ B;  1ORK A;  3MWM A;  4Q47 A;  4V2G A;  3HSF A;  2P5V A;  3FHN A;  1N78 A;  1WJA A;  4JX5 A;  4UV8 A;  1WJB A;  3TGN A;  2KT0 A;  1IUY A;  4V19 K;  4IRG A;  4RGU A;  2BY3 A;  3E6C C;  1D1B A;  4M6X A;  1YIJ I;  1UEL B;  4RB3 C;  4LIU A;  4EJU A;  1YQA A;  3FHZ A;  4HQE A;  3O6B B;  3RKX A;  1YHQ I;  3A1Y A;  5EGO B;  3CDH A;  4GYI A;  1BI2 A;  1KU9 A;  2GLO A;  4KIC A;  5EDN A;  4D7N A;  1UFM A;  4CGZ A;  3EPZ A;  3MQ0 A;  2EJR A;  1X1D A;  3CJQ B;  2A6H F;  4B8X A;  2QEX I;  1LE8 A;  3OS2 A;  4Y17 A;  3JSO A;  5HS9 A;  3BCA A;  3SEZ A;  2BVL A;  3DLA A;  1A6I A;  5J4V A;  2K4B A;  2ZC2 A;  3A01 B;  2M87 A;  3W3C A;  1H89 C;  3CCR I;  2O03 A;  2JN6 A;  4UV9 A;  2RRE A;  3DPU A;  3ROU A;  4ZZL A;  3CCM I;  4ASN A;  1W7P D;  2DDB A;  3RZO J;  5IYC J;  1ZTR A;  1SMY F;  1X58 A;  3M07 A;  1BM9 A;  2EFQ A;  2LLK A;  4RAF A;  4BEH A;  1PUE E;  2CFO A;  1SAN A;  5GAE J;  4BJ6 C;  3SYT A;  3H0D A;  1E3H A;  5JVG F;  1MW7 A;  4B09 A;  3HKZ A;  2LOO A;  1LE8 B;  3J7Z I;  1ZK8 A;  3KP2 A;  3G4S I;  1VQ9 I;  2EFO A;  2KQR A;  3JSP A;  2XPW A;  3KEY A;  2DA3 A;  5CVR A;  1BOA A;  2YSR A;  1E3P A;  1OCC H;  2CG4 A;  2IAI A;  2F48 A;  4UVC A;  2E1O A;  4LLG F;  3KEO A;  2J5P A;  4AVZ A;  3BC8 A;  3FXU A;  1KYZ A;  5C44 J;  4XLH A;  2X6O A;  2OTL I;  3S32 A;  1XD7 A;  2HOA A;  3ABL H;  2EZK A;  3LSR A;  3ABK H;  5K7F A;  5ICC A;  4A0Z A;  4B44 A;  2BY0 A;  1RES A;  4OAZ A;  4BEH B;  4NQW A;  3OS1 A;  3H9J A;  3I4M J;  3LNQ A;  5M5Y J;  2WTE A;  1VTN C;  2E1C A;  3KE2 A;  4XRF A;  1KU2 A;  1U2W A;  2JWT A;  3F8B A;  1UST A;  4KA4 A;  1GV5 A;  2HDW A;  3PFI A;  2Q1Z B;  4MTE A;  3F21 A;  2CWE A;  3I59 B;  1Z21 A;  2G7U A;  1POG A;  2VJI A;  2F5F A;  2DAO A;  2LBF A;  1TQM A;  1YS7 A;  1I1G A;  4WF2 A;  3HC7 A;  2XIG A;  3RSN A;  3QOE A;  2A5W A;  1IN5 A;  1X4O A;  5EG0 A;  3WTW C;  1ZH5 A;  4IRH A;  3CD6 I;  2EK5 A;  6PAX A;  1R4N B;  1AOY A;  3GZ5 A;  1TNT A;  1WRJ A;  3LST A;  4HPQ A;  3FK6 A;  3I55 I;  4FCY A;  4D0P A;  4RM2 A;  1RI7 A;  2HNH A;  2M8E A;  2L9R A;  5BOX A;  3QYF A;  4NQW B;  1W36 C;  1HW1 A;  2CSO A;  2IVM A;  3LOC A;  3OIQ A;  1V5F A;  5FRN A;  4XSX F;  3ZQC A;  4JX4 A;  3KYD B;  3FXM A;  2VQG A;  1M1E B;  1S7E A;  2JJ7 A;  1W5S A;  2UUZ A;  2XC7 A;  1W0T A;  2HDC A;  2W82 A;  1ZR2 A;  5L3C A;  2P0W A;  2FU4 A;  3CME I;  1JT6 A;  2LBF B;  4XL9 A;  2HKO A;  1XMX A;  3LL7 A;  4L9T A;  4C2T A;  1IN6 A;  5JHU A;  3H1C A;  1XMA A;  1YX3 A;  1MH3 A;  3NAU A;  1MH4 A;  2DMQ A;  4O5V A;  5F6F A;  2MAB A;  1G8X A;  1X3U A;  4B3A A;  3F8M A;  5HDK A;  3HL2 A;  2ICW G;  3QRF F;  4HNV A;  1Y1V J;  1OCO H;  4A3B J;  3D1N I;  1HA8 A;  2FSW A;  1BJZ A;  4BGD A;  4CCK A;  3V8K A;  3S17 J;  3Q9S A;  2AQF A;  4I02 A;  3HZJ A;  3I71 A;  2R7W A;  1KZH A;  2EZH A;  1MBK A;  3S15 J;  5BS6 A;  2EBI A;  2K3P A;  3TDZ C;  2VBX A;  4Q4Z F;  2H1L A;  3IRR A;  2E2J J;  1YW9 A;  4H0E A;  1P92 A;  3EUH A;  4RAZ A;  3M8J A;  1P4X A;  4S05 A;  1XSV A;  1DP3 A;  5FJ8 J;  2M34 A;  2M1B A;  3COA C;  3RCO A;  2XAS A;  2F4I A;  1D0X A;  1FSH A;  1ON2 A;  2DQL A;  3LFK A;  4B48 A;  2Y2Z A;  4GGG A;  4ETS A;  4LJZ F;  4HNT A;  4WCG A;  3OYJ A;  3CLO A;  3G6E I;  2I10 A;  4DW6 A;  1R1U A;  3GTQ J;  1PYV A;  1XG1 A;  2E1M B;  3I4N J;  5ILU A;  3BT9 A;  4LB5 A;  3EET A;  4ZYE A;  5IT9 K;  3DTK A;  2ZNY A;  3CJN A;  3OYK A;  1ZG3 A;  1VI0 A;  3CCY A;  2B9S A;  1SD6 A;  1WJD A;  5IYB J;  1HC8 A;  1ONV A;  2L3D A;  5B5E C;  3S1M J;  4XM3 A;  2M9H A;  3V42 A;  2O0Y A;  3U1K A;  1JKR C;  3GZ6 A;  2RDP A;  3Q0W A;  1KU7 A;  3FK7 A;  2IS2 A;  3JCU C;  1R23 A;  2KIU A;  1VF9 A;  1O3T A;  3K9T A;  2LMD A;  5HLT A;  4YEJ A;  3ABU A;  2JVG A;  5CVV A;  9ANT A;  4AM3 A;  2HOT A;  4M3B A;  1O7L A;  3C2G A;  1JKP C;  2CUZ A;  3UR3 C;  3GO5 A;  3DEW A;  2VBZ A;  3BTC A;  1XB4 A;  2JSP A;  4D1Q A;  1X2N A;  2DJI A;  1QGP A;  4HDV A;  3I56 I;  1OCR H;  4OMZ A;  1RKW A;  3GWZ A;  2IBD A;  2CQN A;  3BR3 A;  1R71 A;  1IV6 A;  1JXS A;  1H9T A;  1IRX A;  5FFZ A;  5IOZ A;  1LDD A;  5GP9 A;  2MD0 A;  5HNH A;  2CV0 A;  3RPU A;  4I2O A;  1VQ7 I;  2XGE A;  4KMU X;  2EIL H;  3H3Z A;  3KLN A;  4EQQ A;  2X1D A;  3E5U A;  5H20 A;  4PSX A;  3L2Q A;  3AL0 C;  1QZE A;  4XOR A;  1KQ8 A;  4PZJ A;  1T6S A;  2LKS A;  3HXL A;  1Q1V A;  1HOM A;  5BPD A;  4UVB A;  4A12 A;  4NNJ A;  4XKC A;  1SAX A;  3GUD A;  1AU7 A;  2L01 A;  1ZAO A;  3LMM A;  5H2F C;  2FD5 A;  3DQV C;  5C4J J;  4DNC A;  4OIR F;  2HZT A;  3CP2 A;  3HG9 A;  2GQQ A;  2AXT C;  1ETK A;  2LKP A;  4IXA A;  5F04 A;  3IUO A;  1YRN A;  5K7Z A;  3WG7 H;  2DQR A;  2IEK A;  3E6B A;  3QP5 A;  2F4M B;  1T56 A;  5D4S A;  2GBY A;  4LMY A;  3I54 A;  4DIQ A;  3GTK J;  1T39 A;  3QU3 A;  1WFX A;  3BR2 A;  3PSF A;  1FMV A;  4RLQ A;  2WC2 A;  2B0L A;  4KN4 X;  4KIT B;  2Z9O A;  2NVQ J;  1Z0X A;  3HKZ N;  3BR1 A;  3K4B A;  3NWS A;  1ERD A;  3DXJ F;  3ZMS A;  1KQ0 A;  4Q48 A;  3SDG A;  4P96 A;  4FTH A;  4HV6 A;  5GAG J;  2K02 A;  2KFD A;  4YFK F;  3QPL A;  2H09 A;  2V6E A;  3JRI A;  3LQQ A;  5D4R A;  4XNF A;  1O57 A;  2WA0 A;  1ZAR A;  1R5H A;  2JK3 A;  1TWH J;  4WWC A;  3GBG A;  2HXO A;  2JVH A;  4BBS J;  1U0J A;  4HDU A;  2VB6 A;  1YRN B;  5L3D A;  2RN7 A;  1HF0 A;  1Z77 A;  3HOS A;  4XMY A;  3HRU A;  3FZV A;  4MIM A;  2PX9 A;  3GTL J;  1DU0 A;  3JRC A;  3KP6 A;  3ZRG A;  4A3L J;  2JRM A;  2MYS A;  2GIZ A;  1XX5 A;  1LEA A;  2CQ7 A;  5EZH A;  3BTL A;  3P7N A;  5B1A H;  2Z16 A;  3S2D J;  3HOT A;  1RRJ A;  2EV5 A;  4HV5 A;  2HVS A;  4BJ5 C;  4IOC F;  2WAQ A;  4Y13 A;  1MMN A;  1OCZ H;  2OCC H;  4F91 B;  2Z5U A;  3MN2 A;  5E1Z B;  3ZOB A;  4AD9 A;  1OIS A;  2EA2 A;  3TMO A;  3ZPL A;  4M72 A;  2QBY A;  2VBY A;  2VAS A;  2A05 A;  3HGY A;  4D7M A;  1L0O C;  2A5Y B;  4II3 A;  3F0C A;  3OL4 A;  4OWR B;  1SD4 A;  4W1U A;  2MG4 A;  1C0W A;  3S16 J;  4KNY A;  3T0Y A;  2L4A A;  3K4N A;  3AG3 H;  3E3V A;  2BY1 A;  2ELK A;  4X1E A;  4I7H A;  3MCZ A;  2EH3 A;  5F0C A;  4L9N A;  4B43 A;  1UHW A;  2KIS A;  3S3O A;  1IXR C;  3GTG J;  1F9N A;  1DGW Y;  1XTA A;  3HRM A;  1FIA A;  1J59 A;  2EPF A;  2BY2 A;  2DFH A;  3PJR A;  3UNG C;  2KRH A;  1DDN A;  1XGN A;  4W97 A;  2Z33 A;  1SFK A;  5IP7 J;  2WB1 A;  2BVM A;  4M71 A;  3JRG A;  3BPX A;  3DKW A;  4Y7N J;  1B8I A;  1F43 A;  5DEQ A;  2Y69 H;  2X1C A;  1SFX A;  1V3F A;  2R7R A;  3K2Z A;  3I0T A;  2QBY B;  2LG4 A;  1EH7 A;  1ETX A;  2ZJP F;  2Z2S B;  3VOD A;  3PUB A;  1ZG5 A;  1HSJ A;  3PL8 A;  1G4D A;  5DV5 A;  4M3E A;  2I8D A;  3DKY A;  4U88 A;  3RPQ A;  3OYC A;  2UWM A;  5F0H A;  3F8N A;  3GX4 X;  2DTZ A;  1GHC A;  4NC7 A;  1V55 H;  2QZ8 A;  3S3M A;  4CYC A;  3HB9 A;  5IT9 Z;  3EUK L;  1J5Y A;  2OV7 A;  5F08 A;  5L3G A;  3BCB A;  3WU1 B;  1IRZ A;  4Q5S F;  2H94 A;  2VKV A;  5F27 A;  2YR2 A;  3HOU J;  5EYR A;  2JUG A;  3H5A A;  1HBX G;  1IN7 A;  3ML6 A;  1UCR A;  4Z2Y A;  4G7H F;  3D0S A;  1HQC A;  3CCL I;  1MMD A;  1D1C A;  3P9K A;  3ABT A;  1S72 I;  1B8I B;  2ZJR F;  2PG4 A;  2PMZ A;  2W85 A;  2YUS A;  3ZQQ A;  1ZGW A;  1GVD A;  2J5O A;  3LSH A;  2ISY A;  1MGT A;  4QPQ A;  1KU3 A;  1MSE C;  4AVP A;  3TBI A;  3ZMT A;  5H6R A;  4NHJ A;  1HST A;  2LP0 A;  1H88 C;  1K4S A;  3DBH B;  5KAI C;  4EM1 A;  1I1S A;  4G94 A;  4BS9 A;  3BZK A;  2CRG A;  1MDM A;  3HRS A;  2CW7 A;  5DDG A;  2ZXI A;  4XBF A;  4DYC A;  2MC3 A;  1O4X A;  1OCT C;  1R5I D;  4BE0 A;  3O8H A;  2EZL A;  2YU3 A;  3OIO A;  2NOJ B;  2F5V A;  1BI3 A;  1WZ2 A;  4GRI A;  2TDX A;  5LGN A;  2OBP A;  3D5R C;  1Y8R B;  5C4X J;  4OIO F;  4OIN F;  4IJA A;  1REP C;  2M30 A;  2FBK A;  2JMW A;  3MEX A;  3S1R J;  1TQI A;  1Z1D A;  3KEQ A;  5J8C A;  4CCO A;  1N75 A;  5AIQ A;  5J3L A;  3K1M A;  4YFN F;  4FX4 A;  1QPM A;  2OPT A;  3IAM 2;  1IUF A;  3SZT A;  2B7E A;  4BY7 J;  1MDM B;  3ZMD A;  2QYO A;  2Z1D A;  3I58 A;  3J7A Y;  2HI3 A;  3W6K B;  3C18 A;  5J1U A;  2F4O B;  2NRA C;  1CF7 A;  2DT6 A;  5DYM A;  1R5G A;  3ZQG A;  2D1V A;  1TQP A;  1FBQ A;  3DF8 A;  2XRL A;  1SVL A;  2ZSI B;  1X4P A;  2K9S A;  4XOP A;  4LG0 A;  2VI6 A;  1QHG A;  2ZBK A;  4XSZ F;  2FA5 A;  4B1R A;  1EH6 A;  2HQ5 A;  1W7P A;  4MLO A;  3LQR A;  1Y0U A;  4R1H A;  4PUS A;  3WU0 A;  3OYE A;  1QQI A;  1R36 A;  1NG7 A;  3FF5 A;  2E2H J;  2XAH A;  2D2W A;  2LC2 A;  2IA2 A;  4NC8 A;  2VE9 A;  4ZTJ A;  1T0F A;  5KVR A;  5IOY A;  4UUT A;  4CH7 A;  2XKO A;  1ZN2 A;  3LSG A;  1FBU A;  1CF7 B;  1LDK B;  1A5J A;  3CMY A;  3IAS 2;  1GV2 A;  3V7R A;  4E7J A;  1FEX A;  3IWZ A;  1YX5 A;  3RI4 A;  4UY8 I;  5DUI A;  2X51 A;  1W4M A;  2DFI A;  2P7V B;  2DN0 A;  3PUF A;  4G6D A;  3EUA A;  2VLA A;  3E6M A;  3SXY A;  1HXD A;  3R6S A;  2E5N A;  2KJC A;  1W1W E;  2H8R A;  3OV8 A;  4RS8 A;  2ZCW A;  1R49 A;  3IP4 B;  3HOX J;  3CTA A;  1JJ6 C;  1W7P B;  4ZH4 F;  2KZV A;  3GLX A;  3F3X A;  4B47 A;  3V7C A;  5M3F J;  3MZH A;  2L9S A;  2DK8 A;  2PN6 A;  3BJA A;  5TGT A;  1ENH A;  2M2E A;  4DYQ A;  4XKV A;  1B4A A;  1YLF A;  3OOU A;  4Z6Y A;  3L7W A;  2DA1 A;  2E71 A;  4ZYG A;  2GOM A;  4CXF A;  3R61 A;  3OS0 A;  2PEX A;  2QCO A;  2OZ6 A;  3ERE D;  3N97 A;  1F5T A;  4HOB A;  2EFP A;  4RB1 A;  3X2Q H;  3I3L A;  3L2V A;  2WV0 A;  1P6R A;  2HQR A;  5LHG A;  2HQA A;  1X19 A;  4G9Y A;  2O8K A;  1S3J A;  3ONQ A;  3PQK A;  1T0F C;  2F5C A;  4O3M A;  2EA4 A;  3TP0 A;  5JI6 A;  1MSF C;  2IS4 A;  2STT A;  1JI8 A;  2QWW A;  4QIW N;  2Y0M A;  4YEL A;  5EGO A;  3CO6 C;  1FMW A;  2XAJ A;  4J00 A;  3RTR A;  2ME6 A;  3FMR A;  4LOC A;  4I01 A;  2HTS A;  4F55 A;  3CCV I;  3BQZ A;  1IGN A;  2NS7 A;  1SC7 A;  3FWE A;  2DA4 A;  4L18 B;  4A69 C;  2WAQ N;  3E1S A;  4UXN A;  5LLQ A;  3ECO A;  1UHS A;  3JRD A;  1I50 J;  1ETQ A;  3A01 A;  2RQQ A;  2JT1 A;  3OL3 A;  3GFI A;  2EIJ H;  4B3X A;  4C3J J;  5AIP A;  1PUF B;  2E2I J;  3QAH A;  3CO7 C;  2HOE A;  1NH3 A;  3OY9 A;  4CSW A;  2VIX A;  2VN2 A;  2STW A;  3KLO A;  5DUK A;  4FT8 A;  2W24 A;  5IP9 J;  3Q5F A;  1YJN I;  3FXR A;  4XLP F;  2P5L C;  3E5Q A;  4YG2 F;  3R0J A;  3SZP A;  4L0Z B;  2R7V A;  3A4C A;  3LSP A;  4U7B A;  2G9W A;  4CCJ A;  3GYH X;  4XLE A;  3S2H J;  3DTE A;  5BMZ A;  2XRN A;  4Y52 J;  2XAG A;  3GFL A;  2JPB A;  2WBM A;  2WB1 N;  3LA3 A;  4BAC A;  3HPH A;  4PJN A;  4M9X A;  2OJE D;  4DBQ A;  3CC2 I;  1TWF J;  1WH7 A;  1JTX A;  2M7B A;  3DV8 A;  5E1W A;  1SVM A;  3CCJ I;  4BE2 A;  1BC7 C;  2WV1 A;  3BZC A;  1S29 A;  1U5T A;  3HTS B;  1SAU A;  3M4O J;  3JTG A;  1OMI A;  1AKH A;  2L9V A;  2LSO A;  4MFD A;  2R7Z J;  1BIB A;  1T8I A;  1XSD A;  2XUB A;  4GO1 A;  2K7L A;  1XN7 A;  1J0R A;  1J9I A;  2M7A A;  2W25 A;  5JVT A;  2Y30 A;  5EEH A;  2Q2E B;  1R1V A;  5M5X J;  4IHW A;  2BEO A;  3I59 A;  2YPR A;  3WTX C;  1RUO A;  3ZP5 A;  3GFM A;  3U1D A;  1LB2 A;  2DFF A;  2Q0O A;  2TCT A;  2AHQ A;  3VEP A;  2R5Y A;  2PMZ N;  3B73 A;  3VPR A;  3HOV J;  3BPV A;  3M1E A;  2X6Y A;  4BHB A;  1T33 A;  4M73 A;  4E4H A;  1J7K A;  1VQP I;  1EJ9 A;  2K40 A;  3ABM H;  4BKX A;  4PJL A;  1FYM A;  3GXO A;  1U5T B;  1Z9C A;  4DYR A;  2FBH A;  4ITV A;  5CQG A;  3SEQ A;  1AKH B;  3ZQH A;  2NXN B;  4PDK A;  4OIQ F;  2JPC A;  2VJJ A;  1TZL A;  3IL2 A;  2XVC A;  4KIS A;  2EIN H;  5FKK A;  4EV0 A;  1TW2 A;  2EFW A;  1BR2 A;  2XAF A;  1FTT A;  3BR5 A;  2XPU A;  2R5Y B;  3QPT A;  3L00 A;  4ABZ A;  3LA2 A;  4IHT A;  3NEU A;  5ILS A;  5B3S H;  1KQ9 A;  3GZN B;  4KMF A;  5E3N A;  1K6Y A;  1MBH A;  2CW8 A;  1Z3Y A;  1S7O A;  3JR9 A;  3CF2 A;  3CMA I;  2ZJQ F;  3PNT A;  4U0V A;  1P4W A;  1RR7 A;  2HYJ A;  1MNE A;  1UHM A;  4WK8 F;  1EKE A;  2F2E A;  2V1D A;  4BU2 A;  1G3Y A;  1IXS B;  3CC4 I;  1QHH D;  3NQO A;  3LWF A;  4KFC A;  2LVS A;  3CDI A;  3EYY A;  1D5Y A;  4U0W A;  2VE8 A;  3JRA A;  2D1H A;  1AHD P;  2MA3 A;  4BBR J;  4I0A A;  3H5N A;  4P55 A;  4YIF A;  4HX7 A;  3H3V K;  2WWY A;  2HKX A;  2CFX A;  3RKW A;  4ZYA A;  1F36 A;  1HCR A;  1ETW A;  1E2X A;  4L0Y B;  2W48 A;  3FKJ A;  1W5T A;  2BHZ A;  5TIS C;  1Y6I A;  2QLZ A;  3LA7 A;  3FIW A;  3AG4 H;  2TRT A;  1K7A A;  3A2K A;  2DMN A;  2ISZ A;  4Y15 A;  3S93 A;  2VKE A;  5FFX A;  1NHA A;  4LK1 F;  5CJ9 A;  4AWX B;  1A6Q A;  5HLG A;  2HYG D;  2R7D A;  1FLI A;  3IWF A;  4H4K C;  3VYT B;  2ID3 A;  1YW8 A;  3MZY A;  2VQH A;  1FBS A;  5TRD A;  5ILV A;  3I4P A;  3PFY A;  2LRE A;  3TKY A;  1ZRF A;  1GVJ A;  3ZN1 A;  4EAT A;  4ZYH A;  1XCV A;  4A3J J;  2V1U A;  4LK0 F;  2JUC A;  1JKQ C;  4J01 A;  4PCQ A;  3W6J B;  1MBJ A;  2QM3 A;  1K79 A;  1E3O C;  2ESH A;  2P81 A;  4M6V A;  2BV6 A;  3BP8 A;  3WHB A;  1E0E A;  2M0C A;  2PLY A;  1YW7 A;  2O8X A;  3T8T A;  5K5R A;  1EH8 A;  2GA1 A;  2M8G X;  3AG2 H;  2KRC A;  2IGN A;  2LF8 A;  2QUF A;  2B63 J;  1TWC J;  1VND A;  3IH2 A;  1VQL I;  1HW5 A;  4ZJZ A;  2P5K A;  3IC7 A;  2DOE A;  4YIR X;  2R7T A;  3A0H C;  1ZRD A;  5DTD A;  2QQ8 A;  2E36 A;  3BJO A;  3CDL A;  4RLF A;  4FE7 A;  4FHT A;  1Z6R A;  2H27 A;  1PP7 U;  4BAY A;  2R5Z A;  4JK1 X;  1S6L A;  4CZZ A;  5JR3 A;  2E1M C;  1G3T A;  1ON1 A;  1B6A A;  1WGX A;  3WTT C;  3FKI J;  1WJ5 A;  2KIM A;  3H36 A;  1K61 A;  1QRY A;  2BBY A;  3GTJ J;  3W2A A;  2K85 A;  2O7O A;  1MZB A;  3HRT A;  2KRF A;  2VJ4 A;  4A6D A;  2ZFW A;  2JA6 J;  3PIO F;  2O61 A;  3EUH C;  2H8W A;  2GWR A;  2KPM A;  2H1K A;  4RBO A;  1WWX A;  1W36 D;  2DPD A;  3MD2 A;  4LLN A;  2OZU A;  3J7A O;  1B1B A;  1WHU A;  3HUG B;  1S8N A;  4HLY A;  2HTJ A;  3DU6 A;  4OU0 A;  3KP4 A;  4XLF A;  1I5Z A;  3JAM K;  2XRO A;  3H0G J;  3QWL A;  3W6V A;  3NRV A;  3KP5 A;  2R5Z B;  1JGS A;  4I09 A;  1ZQ3 P;  3HM5 A;  5HS7 A;  3ZQ7 A;  2DW4 A;  1U78 A;  3OR2 C;  5J8F A;  5FRM A;  2NVY J;  1W5C C;  5KNL A;  3MZ8 A;  3CMM A;  4BL0 B;  3C2B A;  3DP7 A;  4HA8 A;  3SZG A;  2P4W A;  4HF2 A;  3K2A A;  5LBQ A;  1YIT I;  2FBI A;  2ZXH A;  2Y9Y A;  1F4K A;  2DBB A;  4A3G J;  4ENN A;  1T38 A;  3E6D A;  2COM A;  1R22 A;  3GTP J;  1G3S A;  2VJ5 A;  2OQG A;  5FGM A;  2HWV A;  2FNA A;  5HDG A;  2LD5 A;  3DBL B;  1TP4 A;  2JRT A;  3W2V A;  3CUQ A;  3TOB A;  3TOA A;  3F23 A;  1IZ1 A;  1VQ4 I;  2ZFU A;  2OTJ I;  3AG1 H;  5DCF A;  1RC9 A;  1UZC A;  2IGO A;  3GFJ A;  3C7J A;  4M9Z A;  3FM3 A;  1SFE A;  1YIO A;  2XF5 A;  4X6A J;  1FSE A;  3G73 A;  2XAU A;  3M8F A;  4BQO A;  4FE4 A;  2COB A;  2CMP A;  4GYG A;  1QZY A;  1OR7 A;  2XAQ A;  2NOG A;  1R7J A;  4BQA A;  2NVU B;  1MBE A;  1DQU A;  3WTY C;  5LFA A;  4JOM A;  3J81 K;  3BG7 A;  2DA2 A;  2HVR A;  4I6Z A;  2R7Q A;  3R60 A;  4CIC A;  3OSF A;  2IJL A;  3CUQ B;  2ZB9 A;  2VOP A;  2NS0 A;  4ZTF A;  2GAU A;  3ZXS A;  1TW3 A;  2CQK A;  4C3I J;  3F22 A;  1DPU A;  3BDD A;  2V9V A;  1WKM A;  3EQL F;  2A6T A;  2W7N A;  5E3L A;  5D5V B;  5FKM A;  1ZYR F;  4RA2 A;  2NYX A;  3N05 A;  1O3Q A;  1TBX A;  3GF2 A;  5FLM J;  1HDP A;  4RB2 C;  2AXL A;  3TO7 A;  1RNL A;  4M3F A;  4RAY A;  3ZQL A;  2DPU A;  4C2U A;  4KYW A;  3GLL A;  3MMY B;  2CUF A;  2PI0 A;  2VQC A;  3WU2 C;  2VC0 A;  1R58 A;  3FX3 A;  1Y56 A;  1VQ8 I;  3BG3 A;  2A07 F;  4MEY F;  4TV7 A;  2MSY A;  3PQJ A;  1A31 A;  2V1N A;  3TO9 A;  4ZC3 A;  2VKD A;  2GXB A;  3ISP A;  5DCM B;  4A3F J;  2MBF A;  2LTP A;  2KL4 A;  1XDS A;  1QNT A;  2FMY A;  4IQJ A;  4G6T B;  2FRH A;  5JHF A;  1Q1H A;  2DOD A;  1ITY A;  2R7X A;  2CV2 A;  1NK2 P;  2JA7 J;  2E35 A;  4PK4 A;  1BW6 A;  1ZRE A;  2CS3 A;  2K86 A;  3M1C A;  2LFB A;  1XS9 A;  1JUP A;  4U0Y A;  4CDG A;  2IS6 A;  1R00 A;  5J40 A;  2ZXJ A;  1X1A A;  1J2X A;  3BTI A;  5AON A;  4BNC A;  4DBR A;  1LQ1 A;  1YJ9 I;  5JLW A;  3A03 A;  2VUM J;  1LJ9 A;  3CZ6 A;  1QBJ A;  3I9V 2;  5DD8 A;  3D5L A;  2DJN A;  3W2W A;  1SEU A;  3J7Y J;  1T98 A;  2BYV E;  4E7S A;  2OAZ A;  1QO0 D;  5KCM A;  2FQ4 A;  4BH9 A;  2AS5 F;  4OIP F;  3OYI A;  3ESW B;  4M6Y A;  2ZME A;  2MH9 A;  4JYK A;  5ERI A;  2Y0S N;  2LY1 A;  2V4J C;  4D5F A;  4CCN A;  4D9J A;  4JQF A;  1LFU P;  3WTZ A;  2BHY A;  1WH5 A;  1P2F A;  1KGS A;  4XK4 A;  3DU5 A;  3VOE A;  2HYF A;  4DQ2 A;  2LY2 A;  4A6E A;  4A3C J;  3ZN0 A;  4S04 A;  4UB6 C;  1FOK A;  1SVO A;  3HEF A;  3T5X A;  3S14 J;  3HJE A;  4IVN A;  1HLV A;  2ME0 A;  3FXO A;  1D8K A;  1A36 A;  3J80 K;  5LEK A;  2MW8 A;  5L3B A;  4IHY A;  1FYK A;  4IO9 F;  3C1D A;  4XIC A;  3L09 A;  5DS9 A;  5JFR A;  1EF4 A;  4U7D A;  3K4C A;  2E7X A;  1WPK A;  3QQA A;  4IHV A;  2ZME B;  4F52 A;  5ICF A;  3FDY A;  2VKH A;  4IPA A;  1RIO H;  3G2B A;  4Y4R A;  1BC8 C;  3FMQ A;  1OYI A;  4G7O F;  2I5U A;  4QTR A;  3BRO A;  1XCB A;  1USS A;  5E20 A;  4MNU A;  3IRQ A;  2XSD C;  3E5X A;  3MFK A;  1X1P A;  3RKQ A;  1LKX A;  2P8T A;  3G71 I;  1ZR4 A;  3FM5 A;  2VQL A;  2H6C A;  2NVX J;  1BJA A;  4XKW A;  4AIJ A;  1HKQ A;  2X48 A;  1RR8 C;  2V79 A;  4N9I A;  4LG3 A;  1OFC X;  2KHM A;  2XB5 A;  3ASO H;  4U87 A;  1YO5 C;  1R9T J;  4KN7 X;  2A68 F;  4FAS D;  2EWN A;  4GXO A;  1HDD C;  1U9O A;  1GXP A;  1XDU A;  2V9K A;  2ZO4 A;  3CCQ I;  2E1N A;  4M74 A;  1BOB A;  1MJA A;  1TT5 B;  1NG6 A;  3G3Z A;  1ZLK A;  2WAE A;  3F8F A;  1QU3 A;  2XGC A;  2OUM A;  2O6G E;  2HR3 A;  2JTV A;  2RVC A;  2IT0 A;  3K7A J;  5FKL A;  2VOD A;  2EIM H;  4GDF A;  4DZP A;  1XC5 A;  4JBA A;  1IW7 F;  4ESJ A;  3L9F A;  4ESF A;  4LB6 B;  2IRF G;  1KA8 A;  3VWB A;  4AC0 A;  5FLX K;  2K9M A;  2DU9 A;  4HAM A;  1V5G A;  3EDP A;  3H3U A;  4BUP A;  2R7O A;  4NDL A;  2JA2 A;  4CO8 A;  4BE1 A;  4CHU A;  1VQK I;  1FP1 D;  3WTU C;  2ECC A;  2CUE A;  2DT5 A;  1T95 A;  4WXD A;  2Y9Z A;  2UXX A;  3CCE I;  1DGR M;  1TC3 C;  3VB2 A;  2CYY A;  5DD4 A;  4P9F A;  3HBL A;  3CCS I;  2FUG 2;  3CUO A;  3HSR A;  4MTD A;  1MBF A;  5D6F A;  1A35 A;  3KFW X;  2K9L A;  2Z3Y A;  4I98 B;  3V8L A;  2EV0 A;  1FP2 A;  4G7Z F;  2BZT A;  2QQA A;  5K5Q A;  1UB9 A;  1BBY A;  3DPT A;  5GPC A;  1L3L A;  4HW0 A;  3L2W A;  5IYD J;  1VQM I;  3DFG A;  3PM1 A;  5TJJ A;  4L5I A;  3P9C A;  4XON A;  1Z91 A;  3O2P E;  3QPH A;  1YE9 A;  1TNS A;  2KZG A;  3OYB A;  1GXQ A;  4E70 A;  4ON0 A;  2A61 A;  2VL8 A;  4XID A;  3SJM A;  3BLY A;  1IG7 A;  3CJT B;  4G6Q A;  3VYS B;  5LRS A;  5M5W J;  3REO A;  3G1M A;  5CVJ A;  2ZJ2 A;  4C30 A;  4QSH A;  1XGO A;  2P7C B;  2FEZ A;  2HGC A;  2A3S A;  3GVA A;  2UV1 A;  1IXC A;  1ULY A;  3ELK A;  1PUF A;  1UG2 A;  5BNG A;  3SDB A;  3A02 A;  3K4K A;  4F7Z A;  3DLL F;  3E7L A;  1N77 A;  4BDY A;  2HU9 A;  1SFO J;  1JUM A;  4ZDL A;  2K5C A;  3H9G A;  4IKF A;  3IV5 A;  1W0U A;  4IOA F;  5IT3 A;  3IKV A;  1LEB A;  2DLL A;  3I64 A;  3MKL A;  2JA8 J;  1WJC A;  4FET A;  4EM0 B;  3DCF A;  4V2F A;  4C9Y A;  2QA4 I;  2Q8K A;  1YJW I;  3OYA A;  1GT0 C;  1FYL A;  4I99 C;  2VC1 A;  2EFN A;  3DTI A;  2IGK A;  3QOD A;  2F6C A;  2HDD A;  1SFU A;  1GLN A;  1G3W A;  4RGS A;  3TED A;  3S1Q J;  4M3D A;  1V5E A;  1FWZ A;  3BY6 A;  4XRM A;  3FBI B;  5M3M J;  4JX6 A;  5J6X A;  3M7G A;  3TP3 A;  4DZJ A;  5DM7 F;  2FOK A;  2NNN A;  3OMY A;  4P9U A;  5A2Q K;  3JRH A;  4EM2 A;  1T08 B;  3OIP A;  2CU7 A;  4E7L A;  3OYL A;  1FPQ A;  3EYI A;  2V6C A;  4XLA A;  3BG6 A;  1LNW A;  2DO7 A;  3BZ6 A;  2IP2 A;  2QSH X;  3OR1 C;  1BW5 A;  1Y39 A;  2L0K A;  1VQO I;  4ANJ A;  2VBW A;  3R4K A;  3Q3S A;  4ENJ A;  3MAJ A;  2VXD A;  1H9G A;  2Q2E A;  1D0Z A;  5IY5 H;  2DDA A;  1Z3X A;  4G8X A;  1XGS A;  2IPQ X;  1TL8 A;  1O7F A;  1Y0N A;  4E7Z A;  1MJ9 A;  3J80 Z;  2CJJ A;  2DA7 A;  1QVT A;  3SFI A;  3ZMV A;  1YI2 I;  3HTU A;  3CCU I;  3I5U A;  2KKO A;  5LRR A;  2DI3 A;  3FIS A;  4A2U A;  2X6W A;  1E17 A;  1XSX A;  4LGW A;  2X1E A;  4BHC A;  5IP6 A;  1MBG A;  5ED4 A;  2XGD A;  4G12 A;  2PFB A;  2QQ9 A;  5K7H A;  4L5J A;  4PJ0 C;  4BXU A;  3M3Y J;  1N25 A;  3BTJ A;  2E5Z A;  3FMS A;  3G1L A;  2IS1 A;  4RMN A;  5ICE A;  5GAD J;  5KHD A;  2DA6 A;  3LSM A;  4MHG A;  4XR6 A;  4LIT A;  3RQ4 A;  1UG0 A;  2JA5 J;  1DU6 A;  3S3N A;  2DOA A;  4RDU A;  1IF1 A;  5IPA A;  4J19 A;  1ZEL A;  4AUX A;  1PP8 F;  2MGQ A;  3P9I A;  3OWT A;  4IRI A;  4XLN F;  3FXJ A;  1QZZ A;  3FXK A;  1D0Y A;  4A5M A;  1AWC A;  1UMQ A;  1EV7 A;  1X3W B;  3A0B C;  3RJP A;  4XQF A;  5F1J A;  5ICG A;  4FQG A;  2ZXW H;  2W57 A;  5HLH A;  4EEF G;  4YRV A;  3DEE A;  3HSE A;  3K4L A;  1PJR A;  2IXS A;  2LNB A;  4Y33 A;  1ODD A;  4R8H A;  2CW0 F;  1CGP A;  1T2K A;  2HPI A;  1WSU A;  4IF4 A;  2N8G A;  3RYR A;  3MKY B;  3ZQI A;  5EF6 A;  3TDU C;  2RV8 A;  3TW6 A;  4BXX J;  2IGM A;  3CF5 F;  2ADU A;  2KIQ A;  1MMS A;  2F5D A;  5E3M A;  5FLX Z;  1U5T C;  2L7M P;  2CQX A;  2OD5 A;  5LHI A;  4A3M J;  4A3D J;  1QA6 A;  2QSF X;  1SD7 A;  2LK2 A;  3UKG A;  4OOI A;  1ZGJ A;  2GOX B;  4KIG A;  4CYD A;  1WJE A;  4M9S A;  2XPV A;  4YII A;  1RPW A;  4YFX F;  2DTR A;  3B6C A;  2DA5 A;  2DYR H;  1O3R A;  4EJV A;  1LDJ A;  1IRG A;  1B9N A;  1BI1 A;  2DMP A;  3WHC A;  5CPR B;  3GTO J;  5E8I A;  2YS9 A;  3JTH A;  4N4N B;  2BOL A;  4XKB A;  3BQY A;  4UUV A;  1CQT A;  3HIF A;  1I39 A;  5F64 A;  2R4G A;  2X85 A;  2IA0 A;  2UXN A;  2V26 A;  4EGY A;  1LFP A;  2L7F P;  2R7F A;  4A3I J;  1B9M A;  1MIJ A;  4HX4 A;  3QU6 A;  4HNU A;  4ENM A;  5EZG A;  2GZW A;  3PNV A;  1ETO A;  1UJ8 A;  2EQR A;  2MH2 A;  4IZZ A;  2M3A A;  1HKT A;  5D6E A;  4MQ9 F;  1X3Z B;  1K83 J;  1PVE A;  4A93 J;  3QYE A;  3N4M A;  2LF7 A;  4C3H J;  5B1B H;  2W00 A;  3F8C A;  3MKW B;  3CP8 A;  5FB2 A;  5HDN A;  3KET A;  1TT0 A;  1YOV B;  3GTM J;  1ETV A;  5GAH J;  1FJL A;  5K5O A;  2QF7 A;  2CUJ A;  3WE2 A;  2KIF A;  3HHH A;  2Y0S A;  1I27 A;  4ZDP A;  3OYH A;  1JT0 A;  2DYS H;  4EMS A;  1MKM A;  5HLI A;  3ERM A;  1I3A A;  4L9J A;  4NBQ A;  2MD5 A;  2NVT J;  1ZGA A;  4PJM A;  3IH4 A;  1FTZ A;  1K4T A;  2D45 A;  2RGV A;  2L7Z A;  2P6S A;  2IW5 A;  5EG0 B;  1RZ4 A;  2DOF A;  3H92 A;  3HHG A;  3K10 A;  5K1Y A;  2P6T A;  4B4C A;  2ID6 A;  1EA3 A;  1G6N A;  4OAY A;  2DXI A;  2V9P A;  5CYV A;  1KON A;  2Y75 A;  1Z7U A;  4BHP A;  2X0L A;  5CVI A;  2QKL B;  4UNO A;  3HPG A;  1XMK A;  4LIV A;  3GCM A;  2GXA A;  2KP6 A;  3V4G A;  1RUN A;  2LKX A;  2CH0 A;  3KP7 A;  4ZYD A;  1MMA A;  1QVU A;  1G2H A;  2YX7 A;  5GTH C;  5H6Q A;  2YX4 A;  1P7J A;  3HUG A;  1Y1W J;  2LYC A;  2L02 A;  1KYW A;  2XGX A;  4BY1 J;  3VDX A;  5GTI C;  1DPR A;  2XV4 S;  3K0L A;  2D5V A;  1V4R A;  2R0Q C;  4HG2 A;  3K1P A;  2ZKZ A;  2FJ1 A;  4RM3 A;  2ACJ A;  1OLT A;  4O6J A;  4R79 A;  5A2Q Z;  2K9Q A;  3TL4 X;  1FOY A;  5CKT A;  2DK5 A;  1K78 A;  3M8E A;  4I0B A;  3WOD F;  5FKO A;  1IC8 A;  1NTC A;  2VOO A;  3IHU A;  1X2M A;  3KPH A;  2R92 J;  2XF7 A;  4BQQ A;  4NB5 A;  3D5S C;  2VT2 A;  2EZI A;  3OYF A;  4XOT A;  2PJR A;  3NWT A;  1U8R A;  2WAD A;  3GEZ A;  4CUG A;  4E7I A;  1JHH A;  1HW2 A;  4KDP A;  4PFP A;  3BJ6 A;  4N4O B;  4E6K G;  1P7I A;  1F1Z A;  4RB0 A;  4QPO A;  3RDI A;  1R4M B;  4XRS G;  2XB0 X;  1D5V A;  1ZLJ A;  2R7S A;  4KIF A; 
#chains in the Genus database with same CATH homology
 2DN0 A;  5C44 J;  2FQ4 A;  2AO9 A;  2X6O A;  2HOA A;  2EZK A;  3LSR A;  5K7F A;  2H8R A;  3G1O A;  1RES A;  4GFB A;  3HOX J;  1JJ6 C;  1OJL A;  4JYK A;  2Y0S N;  3I4M J;  3LNQ A;  5M3F J;  5M5Y J;  4D5F A;  2DMU A;  1ENH A;  2M2E A;  2JWT A;  3Q0U A;  4DYQ A;  1LFU P;  3OOU A;  1GV5 A;  2DA1 A;  1WH5 A;  4XK4 A;  1POG A;  2QCO A;  4A3C J;  3HEF A;  3S14 J;  2O8K A;  1HLV A;  2ME0 A;  4JP0 A;  5EG0 A;  3TP0 A;  1MSF C;  2MW8 A;  4IHY A;  4QIW N;  1IJW C;  4XIC A;  5EGO A;  5C3E J;  5DS9 A;  3HDD A;  3FK6 A;  4IEJ A;  1EF4 A;  4FCY A;  1LFB A;  2L9R A;  2ME6 A;  3QPS A;  1WPK A;  4LOC A;  3QQA A;  4IHV A;  2ECB A;  1QPI A;  1IGN A;  3BQZ A;  3LOC A;  2FX0 A;  2NS7 A;  3ZQC A;  2DA4 A;  4JX4 A;  4A69 C;  2WAQ N;  4QTR A;  1S7E A;  2JJ7 A;  3HOW J;  1UHS A;  1I3Q J;  3JRD A;  1I50 J;  1W0T A;  1ETQ A;  3A01 A;  1ZR2 A;  2XSD C;  3RKQ A;  1JT6 A;  3B6A A;  1ZR4 A;  5HOD A;  4C3J J;  1PUF B;  3Q0V A;  2NVX J;  2E2I J;  1MH3 A;  3NAU A;  2X48 A;  1MH4 A;  3PO2 J;  2DMQ A;  1OFC X;  3JRE A;  2XB5 A;  4B3A A;  5IP9 J;  2CQQ A;  5JLX A;  1R9T J;  4HNV A;  1Y1V J;  3LSP A;  1HDD C;  1U9O A;  4A3B J;  3D1N I;  1BJZ A;  3S2H J;  4Y52 J;  1OCP A;  3S17 J;  2XGC A;  2WB1 N;  3K7A J;  5FKL A;  2EZH A;  1MBK A;  4DZP A;  1XC5 A;  3S15 J;  3BG5 A;  2EBI A;  3PO3 J;  4AC0 A;  1JKO C;  2E2J J;  1TWF J;  1WH7 A;  1JTX A;  2Y31 A;  1MNM C;  4MFE A;  5FJ8 J;  2M34 A;  5E3O A;  4NDL A;  2WV1 A;  1JJ8 C;  4A3E J;  2LY9 A;  3M4O J;  1AKH A;  2ECC A;  2Y2Z A;  1I6H J;  2CUE A;  2I10 A;  4MFD A;  2R7Z J;  4DW6 A;  2Y9Z A;  3GTQ J;  1TC3 C;  1XG1 A;  3I4N J;  3HBL A;  3BT9 A;  2Y30 A;  2NS8 A;  4IHW A;  5M5X J;  3TW7 A;  3RQI A;  1VI0 A;  3CCY A;  1MBF A;  1BL0 A;  2R5Y A;  3HOV J;  2TCT A;  2AHQ A;  5IYB J;  2PMZ N;  3VPR A;  3S1M J;  2M9H A;  1JKR C;  1WCM J;  3Q0W A;  1T33 A;  3FK7 A;  5GPC A;  5IYD J;  2K40 A;  4BKX A;  1VF9 A;  2RAE A;  3NAR A;  3PM1 A;  1U9N A;  2LR8 A;  9ANT A;  2HOT A;  4M3B A;  4DYR A;  1JKP C;  1AKH B;  3ZQH A;  3DEW A;  5FLV A;  3BTC A;  4XID A;  3SJM A;  3RZD J;  1IG7 A;  5FKK A;  1X2N A;  5M5W J;  1WI3 A;  3G1M A;  1RKW A;  1JUS A;  5GPA A;  2IBD A;  2YU9 J;  4QSH A;  3BR3 A;  1FTT A;  1IV6 A;  3BR5 A;  2XPU A;  2R5Y B;  4ABZ A;  1PUF A;  5IOZ A;  3ZQF A;  1UG2 A;  5GP9 A;  5BNG A;  5J1R A;  3A02 A;  2XGE A;  5E3N A;  1MBH A;  1IDY A;  3E7L A;  3L1P A;  3JR9 A;  1SFO J;  1JUM A;  4M3G A;  3JRF A;  2DMT A;  1U8B A;  1RR7 A;  3IV5 A;  2HXI A;  2HYJ A;  1W0U A;  1Q1V A;  3MKL A;  1HOM A;  2JA8 J;  3DCF A;  4V2F A;  5F0F A;  1AU7 A;  2LVS A;  1GT0 C;  1D5Y A;  3JRA A;  2FD5 A;  5C4J J;  1AHD P;  4BBR J;  5F04 A;  1ETK A;  2HDD A;  3H3V K;  3TED A;  1YRN A;  3S1Q J;  2HOS A;  5K7Z A;  4M3D A;  2IEK A;  4XRM A;  5M3M J;  1T56 A;  4JX6 A;  1F36 A;  2GBY A;  3OSG A;  3TP3 A;  4DZJ A;  3JRH A;  4A3I J;  1HCR A;  1ETW A;  3GTK J;  3BR2 A;  2W48 A;  2CU7 A;  2GM4 A;  3IH3 A;  4D5C A;  3FIW A;  3BG9 A;  2TRT A;  1Z0X A;  3HKZ N;  2G0E A;  4S0H B;  2NVQ J;  3BR1 A;  1ZKG A;  2DMN A;  4CYC B;  1BW5 A;  1B72 A;  3SDG A;  2VKE A;  2L0K A;  4FTH A;  1RKT A;  3Q3S A;  3QPL A;  3JRI A;  1FIP A;  4A3K J;  3BR6 A;  2ID3 A;  2JK3 A;  1TWH J;  3GBG A;  2HXO A;  4BBS J;  3MVP A;  1VFC A;  2CJJ A;  2DA7 A;  1QVT A;  1RET A;  3SFI A;  1YRN B;  3HOZ J;  4A3J J;  1HF0 A;  1TWG J;  1Z77 A;  2OF7 A;  4MIM A;  1JKQ C;  3FIS A;  5IP6 A;  1MBG A;  2XGD A;  4G12 A;  3GTL J;  1DU0 A;  3HOY J;  1MBJ A;  4I76 A;  5K7H A;  3JRC A;  1E3O C;  3M3Y J;  2P81 A;  3BTJ A;  3G1L A;  4A3L J;  4M6V A;  1IDZ A;  3WHB A;  2O9L A;  2DA6 A;  2M0C A;  5EZH A;  3BTL A;  1DU6 A;  2JA5 J;  2M8G X;  4RDU A;  3S2D J;  5IPA A;  1B72 B;  2R93 J;  4J19 A;  4AUX A;  2MGQ A;  2B63 J;  4L5E A;  1TWC J;  1VND A;  4IHX A;  3IH2 A;  4C2M J;  3MN2 A;  1UMQ A;  5F1J A;  1GDT A;  3ZOB A;  5DTD A;  3CDL A;  4FE7 A;  3HGG A;  3O8G A;  4EEF G;  2R5Z A;  3HGY A;  4D7M A;  1WGX A;  3F0C A;  4W1U A;  3FKI J;  1ETY A;  2MG4 A;  4UUS A;  3S16 J;  1K61 A;  2N8G A;  1QRY A;  3GTJ J;  4AYB N;  4X1E A;  2ELK A;  2O7O A;  3ZQI A;  5EF6 A;  2EH3 A;  5F0C A;  2JA6 J;  4XRS A;  3GTG J;  1JGG A;  3TW6 A;  2H1K A;  4RBO A;  4BXX J;  1FIA A;  3BR0 A;  4FIS A;  3LSJ A;  5E3M A;  4W97 A;  2L7M P;  2CQX A;  5IP7 J;  4A3M J;  4A3D J;  3JRG A;  1H8A C;  5FKN A;  2LK2 A;  3UKG A;  4Y7N J;  1B8I A;  1F43 A;  1GUU A;  3H0G J;  2XPV A;  1JTY A;  1RPW A;  3W6V A;  2VPR A;  3B6C A;  2R5Z B;  2DA5 A;  5EEA A;  1ZQ3 P;  1BA5 A;  1ETX A;  3HM5 A;  5J1Y A;  2X9D A;  4M3E A;  2DMP A;  3WHC A;  4UUS B;  1U78 A;  4MO7 A;  5F0H A;  3GTO J;  2NVY J;  2DTZ A;  2YS9 A;  3C2B A;  2E19 A;  3K2A A;  3BQY A;  1APL C;  4CYC A;  1CQT A;  3HB9 A;  2Y9Y A;  1IRZ A;  5F08 A;  4A3G J;  2KDZ A;  2VKV A;  5F27 A;  2L7F P;  3GTP J;  3HOU J;  5EYR A;  2LD5 A;  5EZG A;  1ETO A;  2EQR A;  3S1N J;  1B8I B;  2YUS A;  1ZGW A;  1GVD A;  1MSE C;  2K9N A;  1K83 J;  4A93 J;  3CQZ J;  4C3H J;  2LP0 A;  4X6A J;  1H88 C;  4FE4 A;  3GTM J;  2COB A;  2CRG A;  1NK3 P;  1ETV A;  3JRB A;  1TWA J;  4DYC A;  1FJL A;  2QF7 A;  1ORK A;  1O4X A;  1OCT C;  4V2G A;  2NOG A;  3O8H A;  1JT0 A;  2EZL A;  4JX5 A;  3OIO A;  1MBE A;  2KT0 A;  2NVT J;  2DA2 A;  4I6Z A;  3IH4 A;  5C4X J;  1FTZ A;  3OSF A;  2L7Z A;  2ZB9 A;  5EG0 B;  4B4C A;  2JMW A;  2ID6 A;  4C3I J;  3S1R J;  5EGO B;  2GLO A;  5EDN A;  5J3L A;  4D7N A;  5E3L A;  5FKM A;  2OPT A;  1IUF A;  4BY7 J;  2LKX A;  5FLM J;  1LE8 A;  1HDP A;  1QVU A;  3ZQL A;  1G2H A;  4M3F A;  2HI3 A;  5J1U A;  2CUF A;  1A6I A;  1P7J A;  3A01 B;  3BG3 A;  3ZQG A;  1Y1W J;  4BY1 J;  2MSY A;  1H89 C;  2D5V A;  2JN6 A;  2R0Q C;  4A3F J;  2LTP A;  2XRL A;  2FJ1 A;  3RZO J;  5IYC J;  1ZTR A;  1X58 A;  2K9S A;  2K9Q A;  2VI6 A;  1ITY A;  4B1R A;  5FKO A;  2LLK A;  1NTC A;  1IC8 A;  1NK2 P;  2HQ5 A;  1X2M A;  4MLO A;  2JA7 J;  2R92 J;  1BW6 A;  1SAN A;  2E2H J;  2EZI A;  2LFB A;  1XS9 A;  1JUP A;  1LE8 B;  1ZK8 A;  3BTI A;  5IOY A;  4UUT A;  1P7I A;  2XPW A;  3A03 A;  5JLW A;  2VUM J;  2DA3 A;  3LSG A;  2IAI A;  1A5J A;  2DJN A;  4XRS G;  3CMY A;  2XB0 X;  1GV2 A;  2E1O A;  1FEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...