2PMZN

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 7
structure length 64
sequence length 64
chains with identical sequence Y
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2pmzN00
4M3DA 4B1RA 4W97A 1IDYA 4BKXA 1HLVA 2NVTJ 2CUFA 1Q1VA 3QPSA 4BY7J 2ME0A 4X1EA 5FKNA 5FKLA 3FK7A 2FQ4A 2CU7A 3GTPJ 1WH5A 3FISA 2WV1A 1SFOJ 2MSYA 2EZLA 3CDLA 3I4MJ 1APLC 2ME6A 3RQIA 4QTRA 5IP7J 3SDGA 1GT0C 1U78A 1MNMC 1I50J 1P7JA 1PUFB 3Q0WA 3BTCA 2DA4A 2LR8A 3M3YJ 1AKHA 2FD5A 2HDDA 3ZQFA 1WCMJ 4RDUA 4JX6A 3G1OA 2M8GX 2Y9ZA 2H1KA 2NOGA 2X48A 1MH4A 1BW6A 4FE4A 1VFCA 2W48A 1JTYA 3OIOA 4M3FA 2GM4A 1MBHA 2JMWA 3BR5A 4BBRJ 1B8IA 2GBYA 2E1OA 3BTLA 3BR0A 4V2FA 1LFUP 2R7ZJ 3HEFA 2M2EA 2E2IJ 2AO9A 5F0CA 2QCOA 1RKTA 3HGGA 4S0HB 3BTJA 4DYQA 4M3GA 2QF7A 3PM1A 1CQTA 3Q0VA 2XPVA 3JRIA 3GTLJ 3WHBA 2Y2ZA 3A03A 5F08A 1UMQA 1O4XA 5IYDJ 1BA5A 4C3JJ 1AHDP 1LFBA 4A3LJ 1JT0A 3O8HA 5K7FA 1T56A 1JUMA 4FE7A 5EDNA 3E7LA 5E3OA 1ZR4A 4A3KJ 1ZGWA 2IBDA 3S17J 2Y0SN 4B3AA 1JKPC 5JLWA 3SFIA 5EG0A 3GTMJ 2MGQA 2LFBA 3BR2A 1ENHA 5BNGA 1W0UA 1X2NA 2Y30A 1FEXA 2XB0X 1TWCJ 3JRBA 3K7AJ 2O7OA 3BT9A 3SJMA 2DA3A 1B72A 2WAQN 1WGXA 5IP9J 3GTOJ 3HOVJ 1MBFA 1YRNB 1U8BA 1H8AC 3S2DJ 5F0HA 5IPAA 3JRGA 1EF4A 4B4CA 3S1RJ 2X6OA 1WPKA 5FLVA 1UG2A 2MW8A 3MVPA 2VUMJ 3HOYJ 4EEFG 4BXXJ 1X2MA 2E2HJ 3D1NI 3UKGA 2CUEA 1BJZA 3C2BA 3LSRA 1ZR2A 1ORKA 2DMQA 3HKZN 2HQ5A 5GPAA 3BTIA 2LK2A 4IHXA 4A3EJ 3TP0A 1ETKA 2GLOA 1MBGA 2JA8J 3GTGJ 1XC5A 2XGEA 5K7HA 1FIAA 2JA7J 4NDLA 1JKOC 3PO2J 1JUSA 2HXIA 3Q0UA 4MFDA 4MIMA 5EZHA 1MBEA 5EF6A 1PUFA 2KT0A 2DA5A 1JGGA 2CQXA 3O8GA 3TW7A 2PMZN 4RBOA 3ZQGA 4A3MJ 2RAEA 1WI3A 1GUUA 3BQYA 1ETVA 1F43A 1IRZA 3HGYA 2DA7A 1QVUA 5IOYA 4C3IJ 3ZOBA 3S1QJ 1H88C 1JJ6C 4D5FA 2XGDA 3S2HJ 1IC8A 5IYCJ 1IJWC 2D5VA 1K83J 3DCFA 1P7IA 1MH3A 3M4OJ 2YU9J 4FTHA 2CRGA 5EZGA 4UUSB 3FK6A 2MG4A 2HXOA 3BG5A 3QPLA 3OSGA 4GFBA 2ID3A 2CQQA 4G12A 2CJJA 1RESA 1JTXA 4XK4A 5FKKA 2VKEA 2LD5A 4QIWN 1AU7A 2OF7A 2DN0A 1RPWA 2AHQA 2LP0A 1ETQA 2L7ZA 2O8KA 1ETXA 1POGA 1ETOA 2TRTA 4A3GJ 3JRFA 3BR3A 1Z77A 5M5YJ 1F36A 2EZIA 2DA2A 5E3NA 2EBIA 2XGCA 3H0GJ 4C3HJ 1BL0A 1HDDC 5M5XJ 5EEAA 1Z0XA 1FIPA 2K9SA 1OCPA 3RKQA 3ZQIA 2ELKA 3LSGA 1IG7A 3VPRA 2NS8A 2X9DA 4M6VA 2NS7A 1SANA 3W6VA 2VKVA 3HOWJ 4UUSA 4A3IJ 3JR9A 2L7MP 2DMNA 2Y31A 3JREA 4DZPA 4IHWA 1JUPA 4MO7A 1IV6A 2O9LA 1HCRA 4M3EA 4DYRA 4DZJA 1VNDA 4A3BJ 1HDPA 2YUSA 1NK2P 1X58A 3HOUJ 2TCTA 2OPTA 1LE8A 4A69C 3G1LA 4Y7NJ 1MBJA 4IEJA 1OFCX 4MFEA 5GPCA 1TWFJ 5EG0B 5J1UA 2DTZA 4CYCB 4HNVA 4A93J 1Y1WJ 4AUXA 5DS9A 3A01B 2DJNA 3FIWA 1W0TA 3BG9A 3BR6A 3F0CA 1A5JA 1E3OC 3S16J 1QVTA 4JYKA 3RZOJ 2H8RA 2EZHA 3IH4A 3JRHA 1WH7A 2LLKA 3DEWA 3G1MA 2FX0A 1A6IA 2JN6A 2M34A 2R92J 3K2AA 3GBGA 3JRCA 2KDZA 3CMYA 4JX4A 4FCYA 9ANTA 4L5EA 4A3JJ 1IUFA 5C44J 2R0QC 4BY1J 3TEDA 3ZQLA 3GTQJ 2JJ7A 4A3CJ 1ZKGA 2Y9YA 3OSFA 1B72B 1FJLA 3IH3A 5EYRA 3HBLA 2DA6A 2LTPA 2XRLA 3CQZJ 3IV5A 5J3LA 3IH2A 2K40A 5JLXA 1H89C 1ZTRA 4XRMA 1DU0A 3BG3A 5HODA 4IHVA 1MSFC 4XIDA 1JKRC 3MN2A 3S15J 2EQRA 2LVSA 1UHSA 2ZB9A 3CCYA 3TW6A 3LSPA 2JWTA 1ETYA 3H3VK 2L7FP 2R93J 2VI6A 1I3QJ 4DW6A 1G2HA 1MSEC 4I76A 1T33A 1Y1VJ 2L9RA 2FJ1A 5M3FJ 2E19A 2ECCA 2K9QA 1R9TJ 5IOZA 2DMPA 2M9HA 1U9OA 3WHCA 2HI3A 5IYBJ 5J1YA 1HOMA 2R5ZA 4BBSJ 1QPIA 5K7ZA 3NAUA 1DU6A 2HOTA 1XS9A 5C4JJ 3S1NJ 3JRDA 3HOXJ 2L0KA 5FKOA 4ABZA 1RR7A 4FISA 2JK3A 4D7NA 2WB1N 1B8IB 5C3EJ 2IEKA 2JA5J 1FTTA 2LKXA 1MBKA 4IHYA 3OOUA 2R5ZB 5FLMJ 3HDDA 4MLOA 3GTJJ 1GV5A 1YRNA 1TWAJ 1XG1A 2YS9A 5F27A 3B6CA 3LOCA 4Y52J 2DMUA 3A01A 4XRSG 3LNQA 2HOSA 1ETWA 1FTZA 3HB9A 3LSJA 3HM5A 5M3MJ 3A02A 5FKMA 3JRAA 1TWHJ 3QQAA 4AYBN 4D5CA 2NVQJ 1NTCA 1VI0A 5DTDA 2JA6J 2HOAA 1QRYA 4JX5A 4M3BA 1JKQC 2COBA 2EZKA 2I10A 3Q3SA 4AC0A 2EH3A 1K61A 2VPRA 1VF9A 3MKLA 4XICA 1LE8B 3PO3J 4UUTA 5M5WJ 3B6AA 4V2GA 2DMTA 1IDZA 5F0FA 2XPUA 1TWGJ 2ID6A 4W1UA 1TC3C 3I4NJ 2R5YA 2XB5A 2NVXJ 1AKHB 2B63J 1GV2A 4D7MA 5E3MA 1JJ8C 4X6AJ 2N8GA 3ZQCA 2P81A 1HF0A 3BQZA 4DYCA 1IGNA 5FJ8J 5GP9A 3HOZJ 1ZQ3P 4I6ZA 3S14J 2M0CA 4QSHA 1I6HJ 5F04A 2HYJA 2R5YB 1ZK8A 5EGOA 2E2JJ 4A3DJ 3FKIJ 5E3LA 4J19A 1OJLA 2ECBA 3TP3A 3BR1A 2DA1A 5C4XJ 2LY9A 5J1RA 1U9NA 2XPWA 4C2MJ 1ITYA 1OCTC 5IP6A 4XRSA 2NVYJ 1D5YA 3GTKJ 3S1MJ 3ZQHA 4CYCA 2IAIA 3NARA 5F1JA 2XSDC 2G0EA 2K9NA 3RZDJ 1JT6A 4LOCA 1RKWA 4JP0A 1S7EA 1BW5A 1GVDA 4A3FJ 1NK3P 3L1PA 5EGOB 1GDTA 1RETA
chains in the Genus database with same CATH superfamily
4M3DA 4B1RA 3ASNH 1O7LA 3K4NA 3GZNB 1YJNI 5K5OA 1Q1VA 1LKXA 3I71A 1XB4A 2GXAA 1WHUA 4C30A 2DFHA 2OTJI 5FKNA 5FKLA 2VQCA 3FMRA 3ZMSA 1T08B 5HLTA 1R5HA 3M1EA 1WH5A 2R7QA 5FB2A 2EZLA 4PGGA 3ABTA 1G4DA 2HEOA 1KA8A 3SQNA 4XQFA 5ED4A 3SDGA 4B47A 1OKRA 1GT0C 1U78A 3ZMVA 1MNMC 1I50J 1J09A 1PUFB 2W4SA 1CF7A 4HF0A 3BTCA 3SYTA 2DA4A 4KT6A 3GX4X 3M3YJ 3OR2C 3OWTA 3ZQFA 3VSKA 2ACJA 2I8DA 3G1OA 5JVTA 2ICWG 4C9YA 2Y9ZA 2XAHA 5JFRA 4OMYA 1JHFA 4UY8I 1I5ZA 4FE4A 3AG3H 2VJ5A 2W48A 2ZXWH 3FF5A 3OIOA 1Z9CA 1R7JA 1MMGA 2RDPA 4KICA 1FP1D 2H1LA 4M3FA 2QSFX 2XKOA 2FRHA 3BR5A 1B8IA 2GBYA 1T38A 3TQNA 1TW2A 4LITA 2AQFA 2ZFWA 1I3AA 2ISZA 4EJTA 2AO9A 5F0CA 5ILSA 3TL4X 2RREA 2F5VA 3VOEA 2A07F 2QSGX 4BH9A 3AG1H 1X3WB 4DJAA 1MDMA 2WY8Q 3UNGC 3JRIA 2KDOA 3QPTA 1XCBA 4ESFA 1KU2A 1NG6A 4P1WA 2JUCA 4RAGA 3WHBA 1RRJA 5IT3A 5H6RA 4S04A 1UMQA 2COMA 1O4XA 4HZFA 4HW0A 2QM3A 3CDIA 3O8HA 4IJAA 2EPFA 4FE7A 4K2EA 3GW2A 3IC7A 1LDJA 2Q2EB 3E7LA 1AWCA 1OQYA 2HFHA 4A3KJ 3MZHA 1ZGWA 3KIOA 1J2XA 2IBDA 2Y0SN 1JKPC 3Q9SA 3S17J 3REOA 3QPHA 2DT7B 2F5DA 4HSRA 3UR3C 2LREA 3EYIA 1YX3A 2CUZA 3SFIA 5KK1A 1WSUA 3P9KA 5DCMB 4B3XA 3GTMJ 3BR2A 5BNGA 1ODDA 1H9TA 3BT9A 1LUJB 3NEUA 1X19A 3EUHA 5IP9J 2VN2A 3ZQ7A 1LVAA 3HOVJ 2IA2A 1IO2A 1U8BA 1H8AC 2RNJA 2LNBA 5F0HA 1Y8RB 3TBIA 4EGYA 1WJCA 2K4BA 1HKSA 5IPAA 1FLIA 2EINH 3JRGA 3S1RJ 1HKQA 3F3XA 1WPKA 1UG2A 3MVPA 3HOYJ 4EEFG 1SEUA 3A0BC 4OU0A 1FOYA 2CUEA 3W6JB 1SAUA 5CJ9A 1WWXA 3H5AA 3F72A 2RVCA 4NC7A 1ORKA 2L01A 1TW3A 5GPAA 1T8IA 1BC8C 1Z21A 1R23A 2BY1A 3IP4B 1Z6RA 3TP0A 3L2CA 1ETKA 2HGCA 1R4NB 4RLFA 4KIGA 3OIQA 1X1AA 2IGMA 4UB8C 1TNTA 1IXCA 2F48A 3DLLF 5K7HA 1VQPI 2VJJA 2WTEA 4NDLA 3PO2J 4BS9A 3RDIA 4IZZA 3C1DA 2PI0A 3WTTC 4MFDA 1TL8A 4MIMA 2R7WA 4V19K 1MBEA 5EF6A 2HZTA 2X51A 3BY6A 3RTRA 2IS6A 3CESA 2CQKA 5FD6A 2M4GA 1O3RA 3B73A 2BY2A 3T1BA 2NS0A 3FXRA 3QOEA 3VWBA 3HGYA 1QVUA 2AXTC 3HSEA 5BS6A 3E5UA 1FOWA 4D5FA 4XLHA 1BR4A 1SFUA 2P6SA 2JA2A 1OPCA 2RGVA 3CUOA 3M8EA 1MH3A 2Y75A 1USTA 2IGKA 3FWEA 4LK0F 2XF5A 3H92A 4OAZA 2JT1A 1FP2A 2HXOA 4UV9A 3OYJA 5HOOA 3ULQB 3CCJI 4E7HA 1RESA 2QBYB 3ZQQA 2MABA 2VKEA 2LD5A 1FX7A 1P4AA 3CP8A 1AU7A 2IXSA 4FX4A 1LPQA 1T0FA 1O3SA 1BIAA 1TTYA 1MMAA 3I4PA 2LP0A 4OOIA 3CCEI 3OYIA 1AOYA 4ASNA 3K4CA 1POGA 3LSTA 2V9KA 1U5TC 4XKWA 1WFXA 2VQGA 3BR3A 3HRTA 5FFZA 4HV6A 5JHFA 3ERED 1MZBA 1FY7A 3LFKA 1YX5A 2OD5A 1O3QA 5E3NA 1YTYA 3PUFA 3R0JA 1MW7A 3DWLE 3HG9A 4OMZA 2NNNA 4LLLA 4L5JA 1REPC 5E1WA 2K9SA 3GMEA 1PDNC 3ZQIA 3LSGA 4OIOF 3VPRA 2DFIA 3HOTA 1VQKI 3KLNA 5J47A 3W6VA 3L2RA 4XNFA 3TDZC 4CCLA 4IQJA 1E0EA 1JI8A 4G7ZF 3CMAI 4BEHA 1R1UA 2DMNA 2OC6A 2Y31A 3K1NA 3JREA 4BACA 2CW7A 1IV6A 3CCRI 1W7PD 4DZJA 1FSHA 1WI9A 2QUFA 2V1NA 4GRIA 4EJUA 4AD9A 1G59A 2ZO4A 1VQLI 2ZSIB 3J81K 3IAS2 5BOXA 1JXSA 2ISYA 3IWZA 2PG4A 3HHGA 5J1UA 1YIJI 2EFPA 5JI6A 2DTZA 3BZKA 4WXCA 2BBYA 5LRRA 4HNVA 1Y1WJ 4AUXA 1W7PA 3OYMA 4CZCA 3BR6A 3CD6I 4HF2A 2DTRA 2K27A 1RC9A 3OS1A 1E3OC 1KZHA 2O61A 3KYDB 3LQRA 3X2QH 4XMYA 2DK8A 2M0MA 5GAGJ 1S9HA 2GZWA 5BPDA 3J80Z 2BY0A 3BPVA 3RZOJ 5CLSA 1K6OA 1S5LC 2H8RA 2OUMA 3ASOH 4RAZA 3MZYA 2M34A 1WVRA 2DBBA 5L3GA 2XAUA 2X6XA 3K2AA 2ZCWA 3ZCOA 3GBGA 3JRCA 4FCYA 2HTJA 2KFDA 2D45A 1V3FA 1SD6A 2VJIA 3FMSA 3LSHA 2V1XA 2QLZA 2Y9YA 4S05A 4GXOA 1B72B 4LIVA 4Y33A 2PMUA 5JR3A 5J4VA 4M6XA 3F6VA 3HBLA 2DA6A 2LTPA 2XRLA 2Z99A 5J3LA 3IH2A 2CV1A 5LHIA 2DQLA 2K40A 2EJRA 2JPBA 4MEYF 5L3BA 2ZJ2A 4XRMA 1W7PB 4M9ZA 4GDFA 1VQMI 2BHYA 4IHSA 1VQNI 1IN5A 3QU6A 1YG2A 4IHVA 3KYLA 1QU3A 4XIDA 1BI1A 4LMYA 2ZJQF 1I6XA 3LMMA 2CFOA 4EVIA 5IT9K 2JWTA 2JSPA 1KGSA 1T39A 4DW6A 1X1PA 2LF8A 4I76A 1WJFA 1OYYA 2E19A 1WKMA 2NYXA 4CCMA 3PNTA 1IW7F 5E8GA 3F21A 1E3PA 5CVVA 2EA2A 2CSOA 3BROA 5IYBJ 1LVKA 3V42A 2E7XA 5DDGA 3K4JA 4BBSJ 3PL8A 2R7SA 5K7ZA 1K7AA 4P55A 3RQ4A 2X1CA 1I39A 2ESHA 2HOTA 1W5SA 2Z9OA 3JRDA 3HOXJ 2K5CA 4UVAA 3VODA 5DV5A 3LA3A 3EUHC 2EA4A 5DEQA 3TO6A 4L9TA 4XM3A 3DP7A 5KAFC 4IHYA 3J80K 3E5XA 1BI3A 2R5ZB 1VQ9I 2L02A 3GTJJ 2EIMH 1HQCA 2VBWA 4NNJA 4F7ZA 4IOCF 3WGHA 1XG1A 1LEBA 3LOCA 4Y52J 3A01A 4AIHA 3WTYC 4EMSA 2IS2A 2WADA 3ABKH 3WG7H 3HUGA 2GXBA 3SDBA 2ETHA 3LSJA 4GYIA 5FKMA 4IRIA 3KLOA 4AYBN 2ZXIA 1NTCA 5D8KB 5DTDA 4RS8A 1XSDA 2FF4A 1UHMA 4BQOA 5CPRB 3MFKA 4EM0B 1KU3A 3H9QA 4XLNF 3FXQA 5LD2C 1LE8B 2XF6A 5A2QK 1YOVB 2VL8A 4OIPF 3G71I 4LK1F 5FGMA 5F0FA 3BC8A 4W1UA 2ID6A 2MLGA 2R5YA 4L9JA 4A5NA 2JTVA 3ABLH 4X6AJ 3E6DA 3OR1C 1HF0A 2BZTA 1FSEA 4DYCA 5FLXK 3RIRA 1IGNA 3NWSA 1D1BA 5E1ZB 5GP9A 3GCMA 3M7GA 5D4SA 5HNHA 3W2AA 3GWZA 2NXNB 5F04A 4MHGA 2HKXA 5ILUA 2VXZA 1YW7A 3I3LA 2P0WA 3GVAA 3O2PE 3HPHA 3RJPA 3DTKA 3L2UA 3FKIJ 4CA0A 1OJLA 3H36A 2O6GE 1S6LA 2M3AA 4QPQA 1CF7B 1YFHA 3BR1A 2DA1A 2LY9A 3IAM2 1IXRC 2PJRA 1I27A 3FXJA 4XRSA 3GTKJ 3S1MJ 2CS3A 3CLQA 3MD2A 2EV5A 5F1JA 4XR6A 3PSIA 3JAMK 2K9NA 1HW2A 4LOCA 1FBUA 2QQBA 2R7XA 5HNFA 4N4NB 4LIUA 2WWYA 3WTWC 2M4KA 4KMUX 1FOKA 2F6CA 2K85A 4RGSA 4W97A 4HEA2 2ZXJA 2XAFA 3S32A 4L9VA 1HLVA 2NVTJ 3RYPA 4HV5A 1EH8A 2FBHA 2CQ7A 5EEHA 3K1PA 2LY1A 4N0BA 3FK7A 2KJBA 3OL4A 2DYSH 3K4LA 4YEJA 2WV1A 4QLCU 3CDLA 5CYVA 4IRHA 4HQMA 1DQUA 1APLC 3R60A 2MC4A 4XN3A 4HG2A 2L7KA 2QYOA 3K69A 3HRMA 1QNTA 2QENA 2BE5F 2W82A 2HTSA 3HRSA 3Q0WA 2M30A 2LR8A 3HUGB 2FD5A 2JVGA 4PCQA 3FDYA 1WCMJ 4DNCA 2EFQA 4JX6A 4RDUA 3MKYB 3L2WA 3PJRA 4E7ZA 1BW6A 3HC7A 3BP8A 1JTYA 4AIJA 2EWNA 2E7WA 2RNGA 2IPQX 2EV0A 4Y3OA 4XKCA 2JMWA 4UUVA 2DPUA 3TKYA 2XKPA 4R8HA 1YI2I 2ZFUA 5FD5A 1LDDA 1LFUP 1LB2A 3HEFA 2R7FA 3GXOA 3LAJA 5HS9A 3W2VA 2O8XA 3MZ8A 5K1YA 4F92B 3U1DA 4L0ZB 4GGGA 4S0HB 4GCVA 4DYQA 2QF7A 3P9IA 1YW8A 1CQTA 2JPCA 3Q0VA 3ISPA 3K4MA 4LLGF 2X6WA 2HYFA 3A03A 1FMVA 4BU2A 4EGZA 4KIBA 1AHDP 3CMEI 5IY5H 1T56A 4BQQA 4IQ4A 1USSA 2BY3A 1ZR4A 3OYFA 1FZPB 2KIFA 5DUKA 2OQRA 3FXLA 3WGGA 4DQ2A 2E1MC 2RN7A 4R1HA 2HVRA 5JLWA 2G9WA 2BW3A 5EG0A 1ONVA 5AIPA 3OL3A 1W0UA 1UG0A 1Z3YA 2OZUA 1X2NA 2Y30A 1OCRH 2XB0X 3RCOA 4ZYEA 1LEAA 2GA2A 2W00A 3KYCB 4O6JA 3AKZA 2DA3A 4CHUA 1B72A 1D0YA 4HSTA 3BCBA 1HKTA 1YRNB 1KQ8A 1TZLA 3S2DJ 1FYKA 2L9NA 2WAEA 4O3MA 2EIKH 2IJLA 2F4OB 4RB0A 5L3EA 4GYGA 1Y0NA 5LGTA 3GUDA 5FLXZ 1G6NA 3CJQB 2QKLB 3KP2A 3L9FA 3MMYB 3SFZA 3WG9A 1X2MA 2HQRA 3LSMA 1UCRA 1LFPA 3O3KA 1F4KA 3DQVC 2K3PA 2XAJA 4I02A 1ZR2A 4BQAA 5L3CA 1T98A 4EM2A 1D8KA 4RGRA 4IHXA 1BI2A 4C2UA 1J59A 4LB6B 2GLOA 3DFGA 4UXNA 4BJ5C 4BXFA 5B3SH 2XGEA 3C2HA 3E5QA 4CUGA 1FIAA 3EETA 3QOPA 4XONA 5GTHC 1JUSA 3I59A 3Q0UA 3I5UA 3LQQA 4F52A 3C7JA 3OYCA 2AS5F 3HSFA 2R7OA 4HX7A 2DA5A 2LYCA 1JGGA 2CQXA 3O8GA 3OIPA 4YFXF 2UXNA 2JSCA 2LOOA 4RBOA 3ZQGA 1XPXA 2WAQA 4A3MJ 2RAEA 3VYTB 1GUUA 3WTXC 2MC3A 1F43A 2HR3A 3IL2A 2DA7A 3V7CA 3V8JA 3S1QJ 2VPLA 3KP4A 2OCCH 4AVZA 4NC6A 5IYCJ 4PJMA 1F5TA 2D5VA 1FMWA 1UHWA 3KP3A 1P92A 3F8BA 1P7IA 3L2VA 3M4OJ 1YIOA 2F2EA 4PFPA 1XSVA 4WK8F 2YU9J 2F5FA 3WTSC 2CRGA 4UUSB 3FK6A 4HYEA 2IA0A 3BG5A 3QPLA 3E3VA 4XSXF 4GFBA 3WE2A 2W7NA 4EJOA 1XGOA 1SC7A 5LHGA 1IUYA 3ZMDA 1IAWA 1I1SA 3CF2A 3CCSI 5E20A 3M8JA 1KYZA 4ZYAA 2OF7A 3KP7A 3I59B 4IHTA 2AHQA 2CH0A 2STWA 3KFWX 1ETQA 2DU9A 2MH9A 2KRHA 3DEEA 1MJBA 5LGUA 3F9KA 2QBYA 3D5RC 1EH7A 3RPUA 2C6YA 1SFXA 2RV8A 1OCOH 4QWQA 5M5YJ 4FETA 3IHUA 4KJZA 4HNTA 2R7VA 5D6EA 3V8LA 2EBIA 2A68F 4PJ0C 3H0GJ 4D9JA 3CCMI 4E70A 4WX9A 2H6CA 4XBFA 5EEAA 3N05A 1FIPA 2UUZA 1OCPA 3RKQA 1IRGA 2NS8A 3BJ6A 3ZR8X 3QAHA 4XSZF 1PYVA 5CQGA 3FHNA 2VKVA 4I99C 2EIJH 2FQ3A 1NHAA 3I9V2 1HSJA 4KIFA 3FKJA 2ADUA 4EM1A 4F3QA 4U7BA 3OY9A 4DZPA 2P7CB 1RUNA 4IHWA 3TOAA 4J01A 1VZ0A 2Z2SB 1UELB 5J6XA 4A12A 2O9LA 4B09A 2VKDA 3DPUA 1HDPA 1OLTA 1VQ5I 1X58A 1WJ5A 1ZG1A 5LLQA 5ICCA 1W5TA 2CQNA 3F22A 4ESBA 2P4WA 5EG0B 3OYEA 1ZG5A 4Y4RA 5DS9A 2CV2A 4HPQA 2L9VA 4YFNF 1YITI 2PX9A 4A2UA 3J81Z 1KQ9A 2EFOA 2GWRA 2GAUA 4JK1X 2KIUA 4JYKA 1QZYA 2VBZA 1HW5A 3FXMA 4KT5C 4LGWA 2EZHA 1X3ZB 3IH4A 1WH7A 4OIRF 3G1MA 4PJNA 3HHHA 1QO0D 4RLQA 1YQAA 5FFXA 3ZN0A 3JTGA 3LWFA 2XF7A 2ZBKA 2CG4A 2GXGA 3HJEA 2R92J 3ZXSA 2W84A 1IV8A 3H9JA 4JX4A 4MGRA 3QYEA 4L5EA 4ANJA 2X6YA 4D0PA 3COAC 1A6QA 3E6MA 4WF2A 5DM6F 3TEDA 4A3CJ 3OSFA 5ILVA 2DI3A 1IF1A 1YW9A 3CQZJ 3BCAA 2RC4A 3CC7I 3M1CA 2K86A 4BHPA 2HU9A 2IW5A 1W4MA 3LAPA 3PUBA 3BG3A 4MQ9F 4KITB 1W36D 3AAFA 2WBMA 3S15J 4UVBA 2EQRA 1UHSA 4YFKF 3RKYA 3LSPA 4HF1A 4E6KG 2FMYA 2VI6A 3F6OA 2KIMA 5D6FA 2PJPA 1T33A 5M3FJ 3CC2I 3U21A 3LSKA 3MCZA 1R1VA 1QHGA 2A05A 2K9QA 3D5SC 3GFMA 2DMPA 1JGSA 3G6EI 1MGTA 1U9OA 1HOMA 5J8FA 2R5ZA 3J7AO 4LG3A 2K9LA 1R6RA 1HC8A 1G3WA 4LLNA 1OCZH 2L0KA 4ABZA 2IRFG 3TO7A 1RR7A 4D7NA 1B8IB 4IKFA 2WA0A 2E71A 2JA5J 1T2KA 3M8FA 4Z2YA 2UXXA 2LKSA 5FLMJ 1QHHD 3HDDA 4KN7X 4XLCA 3BJAA 2M5WA 1TWAJ 5F27A 1X1DA 2YX7A 3DU5A 3B6CA 3KZYA 3LSIA 3ONQA 3ZMUA 3GO5A 2DMUA 4XRSG 1JE8A 1ETWA 3I53A 4F91B 3K4BA 4OAYA 3HB9A 1M1EB 2M7AA 5M3MJ 2Y48A 4HLXA 3JRAA 3SEQA 4D5CA 4WWCA 4ENKA 2JA6J 3A4CA 4JX5A 4CSWA 1JKQC 1TLHB 2EZKA 2I10A 1EV7A 2OZ6A 3BG6A 4Q5SF 2MYSA 3GF2A 3O6BB 5HLGA 1VF9A 1ZRDA 3MKLA 4UUTA 5M5WJ 4IPAA 4CZZA 1L3LA 4KYWA 3C18A 3QWLA 3DTEA 5CQEA 2XV4S 5DCFA 4ZDLA 3I54A 2NVXJ 2A5WA 4I98B 4D7MA 4RB2C 4ZH4F 3H9GA 3EUAA 3VDXA 3BQZA 1RI7A 2Z5UA 5FJ8J 2MD5A 5LGNA 1RR8C 1X1CA 1FNNA 4HX4A 2OA4A 3S14J 4QSHA 3K70C 1ZLJA 2R5YB 2E5NA 2E1CA 3HXLA 2CW0F 4ZJZA 3CUQA 5EGOA 5KHDA 2PLYA 1DP7P 1NG7A 2I5UA 4B8XA 4A3DJ 1BM9A 2ECBA 3OS2A 3TP3A 4ENMA 4B44A 1RIOH 3CZ6A 2XPWA 4C2MJ 2M87A 3P9CA 5K5QA 2IAIA 3LFUA 4NQWA 1VQOI 5HLIA 1GVJA 3RPUD 2L4MA 1S7EA 1STZA 3HKZA 2D1VA 2IP2A 4A3FJ 1NK3P 1H9GA 3S3MA 1R5GA 4HDVA 1Y56A 5D5XB 1SVLA 4A6EA 1B4AA 4F93B 3BPXA 4RGXA 2M7BA 4BL0B 4NHJA 4BKXA 2OBPA 2DAOA 3KP6A 1X3UA 2CUFA 2F5CA 2G7UA 3QPSA 3ZGKA 2ME0A 1HXDA 4X1EA 4RB1A 1RUOA 3Q5FA 5D5VB 2CU7A 2KZGA 3GTPJ 4J00A 2IT0A 1SFOJ 3FISA 2QZ8A 2MSYA 4CCKA 5IT9Z 2VQHA 5H6QA 3CTAA 2ME6A 4HLYA 2DCEA 3RQIA 1MNEA 3W2WA 5IP7J 3RYRA 3IRRA 4XLFA 1P7JA 4YG2F 3K6GA 4CGZA 1N78A 1Y8QB 2ZSHB 3KZIC 1AKHA 2UZKA 4RAYA 2E5ZA 3CJRB 5LEJA 5HVQC 1MH4A 4MNUA 3E6CC 2WY7Q 4MEXF 1J9IA 2JQ7A 2XRNA 1BBYA 5FROA 3FM5A 5LBQA 3DPLC 1MBHA 3HSRA 2Y69H 2E1OA 3BTLA 1VQ7I 2DDBA 5HS8A 4V2FA 1ZRFA 3KEQA 2M2EA 2E2IJ 2XUBA 3FXOA 2QCOA 5TGTA 3V7RA 2XHKA 1RKTA 1DUXC 3C2GA 3OYAA 3VYSB 3TDUC 2KQRA 3BTJA 4M3GA 2KJCA 3PM1A 4ETSA 2PEXA 3FX3A 3KP5A 2GA1A 3GTLJ 1RZ4A 1G3YA 1TT0A 2R3SA 5DM7F 2IVMA 2DXIA 2CWEA 4XLAA 5F08A 2Y0SA 1MMSA 2J5OA 2MFZA 4LG0B 1BA5A 4C3JJ 3WTVC 1S72I 4A3LJ 1JT0A 1WJDA 4YRVA 5K7FA 1LJ9A 1JUMA 4OINF 5H2FC 4JOMA 5EDNA 5E3OA 4DBRA 2A3SA 2YPRA 4U0VA 3E97A 3QYBA 2DOEA 3HZJA 3ECOA 3CLOA 3R4KA 1SMYF 5LRSA 2JRTA 3KX2A 2KISA 2K02A 1QQIA 2MGQA 2LFBA 4B43A 1K4SA 2JRMA 4A0YA 5E18F 1TWCJ 3JRBA 4UVCA 3QU3A 2O7OA 3T8TA 2BVLA 2ELJA 2HQAA 1D3YA 2ZC2A 5JVGF 1D5VA 2V79A 2WAQN 1DPRA 1WGXA 3GTOJ 1YHQI 4NBQA 4N9HA 4U88A 3BDDA 4FASD 4YIIA 2MLKA 1XGMA 1YLFA 3E6BA 4B4CA 2JZYA 1Z3XA 2WV0A 5F1RA 2VUMJ 3K70D 4BXXJ 2E2HJ 3LL7A 3UKGA 3ECHA 1BJZA 4D1QA 2OV7A 1G3SA 2FNAA 1QA6A 3LSRA 1ZARA 4YIFA 2FNPA 2DMQA 2HQ5A 2FE3A 2MBFA 4I0BA 3BTIA 2R4GA 1XN7A 3ZRGA 2LK2A 4A3EJ 1ZAOA 1MMDA 4TV7A 4ZDPA 1ERDA 4C2TA 2JA8J 3CUQC 4E7IA 3KZZA 3OV8A 1R5ID 4UB6C 3S8PA 5GAEJ 4XKVA 3WU2C 3GFIA 1FBQA 2DFEA 3KE2A 2HXIA 4MTEA 3HYIA 1FBSA 3MKZA 5D8LB 5GTIC 3S3OA 1KU9A 1MDMB 2F4MB 1TT5B 2KT0A 2Q8KA 3TW7A 2PMZN 3C3WA 1S7OA 2DJIA 1ON1A 3GEZA 2P5LC 3HPGA 3SZGA 3NQOA 4LJZF 4ZYDA 3BQYA 2PBIA 1ETVA 4PUSA 2R7UA 1BC7C 3ERMA 4Y17A 2NRAC 2MA3A 2PQ8A 3I56I 1IRZA 2PN6A 4C3IJ 1T6SA 4E7SA 1JJ6C 3WE3A 1D1CA 4IRGA 3CDHA 2W85A 1IC8A 1IJWC 4A0XA 3MKWB 2VOOA 1YJWI 1QZEA 3M9AA 3NRVA 1MKMA 4XKBA 3H3ZA 2GOXB 3D0SA 3H35A 3I58A 4FT8A 3VB2A 4CO8A 3IKTA 4FTHA 4IXAA 2QQ9A 5EZGA 3VFZA 4HDUA 2MG4A 4PJJA 1XD7A 2ZMEC 1VQ4I 4G12A 4BE2A 3EUKL 1BJAA 6PAXA 4M71A 2LBFB 4QIWN 1K78A 2M8EA 2CFXA 1SAXA 2OJED 1RPWA 2FA5A 2HDWA 4ITVA 2QEXI 1U8RA 2IS1A 1GXPA 4LFUA 3DKXA 2E60A 2DOAA 4IX7A 2HNHA 4ZTFA 3JRFA 3PFYA 1Z77A 2E1NA 3T5XA 2EZIA 3K4KA 3I55I 1E2XA 4C3HJ 1WJEA 3BJOA 3GLXA 1HDDC 3HOSA 2KP6A 4PZJA 4U87A 4EJVA 5M5XJ 1SMTA 1ZGAA 3U2RA 1Z0XA 4EV0A 4UV8A 3BZCA 2PMHA 5ICGA 2ELKA 3WGIA 5E17F 2LKPA 2W24A 2PMZA 1G8XA 4I0AA 4M6VA 2NS7A 2TDXA 1B1BA 5HDNA 4HNUA 3HOWJ 4A3IJ 3JR9A 2VBYA 2FU4A 1BIBA 2DDAA 2BEOA 4Y15A 1JUPA 4MQVA 3DEUA 4MO7A 1HCRA 4DYRA 2DOFA 1VNDA 3CCLI 1VQ6I 2F4IA 2M45A 4GO1A 5CVIA 3ABUA 2H94A 5HDKA 3HOUJ 5BPIA 2TCTA 2XSJC 3V8KA 1LE8A 1GHCA 3G1LA 4Y7NJ 5LFAA 1OFCX 4DGWB 3EPZA 4MFEA 1TWFJ 1Y39A 1B9MA 2VASA 1Z05A 4CYCB 1XX5A 2NVUB 3G3ZA 3A01B 2DJNA 4I7HA 1ZHFA 1W0TA 1P4XA 3RSNA 1XMXA 3F0CA 4PSXA 3DXJF 4B48A 1A5JA 3FMQA 1MIJA 1P6RA 3HL2A 2DO7A 1ZH5A 2VIXA 2VC0A 3FZVA 4FHTA 3QP5A 3IRQA 2GOMA 3K1MA 3MWMA 5DD8A 3DEWA 2B0LA 3DTIA 3T0YA 2JN6A 3WODF 2XDVA 2EK5A 2JVHA 2L54A 1P2FA 1QGPA 2HZDA 5F6FA 2KDZA 9ANTA 3DBHB 4A3JJ 4MTDA 1ZGJA 2R0QC 3CC4I 1LNWA 1U2WA 3GLLA 1ZKGA 4RM3A 4XOTA 3CO7C 2VOPA 3IH3A 2HYGD 2V6CA 4HAMA 5D5WB 3CCVI 4AIKA 2K7LA 4M73A 3IV5A 1QBJA 3LA7A 3OMYA 3QP6A 3FBNB 2A69F 2J5PA 4XRFA 1ACIA 1KYWA 4DOZA 1OCCH 4XL9A 1YO5C 1KQ0A 1DU0A 4BNCA 1G3TA 2G7HA 5TISC 3MN2A 4DIQA 1SD4A 5KVRA 3CP2A 1ZG3A 3RPQA 3H3VK 2XAGA 2R93J 3F8NA 1R71A 1I3QJ 4L9NA 3MEXA 1FYLA 3DF8A 2B9SA 4G6TB 1Y1VJ 2L9RA 2FJ1A 3DLAA 1K6YA 4AIDA 5K5RA 1FC3A 2ECCA 5B1BH 1R49A 2JUGA 4ZC3A 1OISA 4L0YB 3WHCA 4E4HA 2HI3A 2KPMA 1C0WA 3B02A 2A6HF 1S8NA 1MJ9A 2HOEA 2KHMA 3IUOA 3S1NJ 2X0LA 4I2OA 4CYDA 1H0MA 4G7HF 4Q48A 3FXUA 4FISA 4LG0A 1V5GA 2V7FA 3KPHA 4H0EA 1FTTA 3W6KB 3L2QA 4HA8A 1MBKA 1X4PA 2OQGA 2FEZA 3G4SI 4UNOA 1RNLA 4MLOA 2ELHA 2LC2A 4ENJA 1GV5A 5CVJA 5HS7A 3SZPA 1YRNA 3J7AY 4WCGA 3PIOF 2YR2A 3LNQA 2DPDA 2HOSA 1FTZA 2V1DA 3QODA 2BHZA 3WTZA 4BJTA 2EB7A 3HM5A 5FRNA 2HKOA 5B66C 1TWHJ 1V5FA 3NWTA 4CCNA 2NVQJ 1VTNC 1VI0A 5F64A 2BW3B 2HOAA 2XIGA 4YIRX 1QRYA 4M3BA 1WRJA 4U0YA 3U9GA 3OYHA 3BOQA 2LBFA 4L18B 1OMIA 4AC0A 5DUIA 3OYKA 1K61A 2VPRA 2VONA 4IL6C 4QPOA 2O0YA 3VEPA 3PO3J 3PNVA 4BAYA 2DQRA 3B6AA 4V2GA 1B6AA 2DMTA 2W25A 4UHTA 2XPUA 1IDZA 1IN7A 1W5CC 3I4NJ 1BOBA 2XB5A 1Z7UA 1BI0A 2FOWA 3OYGA 3GFJA 1AKHB 1JJ8C 2B63J 2N8GA 3ZQCA 4OWRB 4RMNA 2KZVA 5D4RA 2ZJRF 1I1GA 3HOZJ 3R61A 1ZQ3P 1UFMA 1YS7A 1ZYRF 3BG7A 1XDSA 3CCUI 1O7FA 2O3FA 2UWMA 2VXDA 3V4GA 2E2JJ 4LB5A 1D0ZA 4NUBA 1U6GA 3ABMH 4AVPA 3CO6C 3HRUA 3EQLF 2X1DA 4CCOA 1BR2A 1SVMA 5C4XJ 1ITYA 1SD5A 1U9NA 1OCTC 5IP6A 2BXZA 2NVYJ 3L00A 1ZRCA 3NARA 2XSDC 4BQNA 2G0EA 3RZDJ 1JT6A 1S7AA 1MD0A 1RKWA 5E1XA 2VBXA 3BLYA 4CICA 1BW5A 1GVDA 3L1PA 4L5IA 1EH6A 4R79A 1GDTA 4A0ZA 3K0LA 3S93A 2HDCA 2ZJPF 2QGUA 1IDYA 1GXQA 2KMUA 2V9PA 5TRDA 1V4RA 1Q1HA 3CMMA 4BY7J 1ZN2A 3ZP5A 4JBAA 2LF7A 2FQ4A 2BYVE 4LD5A 4N4OB 1N75A 3OYDA 1A35A 3I4MJ 2FUG2 4QTRA 2L5QA 3BWGA 1EJ9A 2DT6A 5E79C 2P8TA 3ZMTA 2A6EF 2DW4A 1WZ2A 4G6QA 2CUJA 4ZTJA 3ROUA 2ZXHA 4EQQA 3PQKA 3DPTA 2HDDA 1FWZA 4BYYA 4M74A 3DV8A 2M8GX 3Q9VA 2H1KA 2NOGA 1U5TA 2K3FA 2X48A 3MAJA 3R0AA 4I01A 1F1ZA 4KDPA 1CGPA 1HW1A 3JSOA 2CV0A 2P7VB 1VFCA 1LQ1A 3TGNA 4KUMA 1BOAA 2R7RA 2BOLA 4BUPA 2LDUA 4OIQF 2FOKA 5J4YA 3FM3A 2GM4A 3ZPLA 4BBRJ 3BR0A 1S29A 3I64A 5ERIA 4M6YA 2R7ZJ 3OYBA 2LSOA 2VE9A 3N4MA 2Z33A 2VC1A 3HGGA 3E1SA 3IWFA 3QYFA 3RKWA 2VB6A 1FYMA 2GIZA 4IO9F 2XPVA 4IOAF 4P9FA 4KN4X 2D1HA 2LMDA 5CVRA 3VSLA 3QRFF 2Y2ZA 3R6SA 2HWVA 2WAFA 5GAHJ 4FQGA 5IYDJ 1LFBA 4JQFA 1SVOA 2LH9A 2HPIA 4P5OA 3ZMZA 4B3AA 4F55A 1Z91A 4BHCA 3PSFA 2QVOA 4BXUA 3W3CA 5EJCA 2XC7A 3I0TA 1ENHA 4BE0A 2V6EA 5DCMA 1FEXA 2ESNA 3KEYA 3JAMZ 2VKHA 3SZTA 2KRCA 1XGSA 3K7AJ 1IZ1A 2EILH 4U0WA 5KCMA 3SEZA 3F8CA 3OOPA 3SJMA 1N25A 5B5EC 2UV1A 3A2KA 2IS4A 1MBFA 1Z7LA 1R22A 2H27A 1XTAA 2LRDA 2L9SA 4G6DA 1WJBA 3G2BA 2Q2EA 1EF4A 3H1CA 3PNYA 3FBIB 1Y0UA 2LY2A 2X6OA 4RGUA 1PUEE 5FLVA 2HS5A 2MW8A 2KRFA 5AIQA 2P5KA 3GFLA 4II2A 2HQNA 2STTA 2VJ4A 4H4KC 1YE9A 5BMZA 1UB9A 3D1NI 3C2BA 2VT3A 2A5YB 1KU7A 4ON0A 3HKZN 2O5RA 2E34A 3L7WA 2VODA 3P7NA 1ULYA 2ZKZA 4Y13A 4WXHA 1MBGA 1R36A 3SHFA 2QKMB 4XOPA 5FRMA 3N97A 1XC5A 2DLLA 3E0JB 1MMNA 3GTGJ 3KEOA 3OYNA 2H6BA 1IXSB 2CMPA 4DBQA 2JA7J 1JKOC 1R4MB 2KKOA 1B9NA 5EZHA 2V1UA 1PUFA 2B7EA 2P6TA 5B1AH 2CGPA 2Y0MA 1UJ8A 2L3DA 2AQEA 2ZMEA 3K9TA 3WU0A 3GZ6A 3OS0A 1WI3A 3OYLA 2V9VA 2X85A 4II3A 2M1BA 4NB5A 2E35A 1XSXA 4E7KA 1ZREA 2EFWA 2CW8A 1Z1DA 1W1WE 5IOYA 1ZELA 1L0OC 3ZOBA 1WQ2A 1H88C 2OU2A 2PJRB 2XGDA 1A36A 4U7DA 2Z16A 2QA4I 4FX0A 3S2HJ 3FHZA 2MD0A 1DP3A 1K83J 3DCFA 2WC2A 4BDYA 3DBLB 4ZYHA 3TO9A 4KNYA 2FBKA 2X1EA 3JCUC 3F23A 1LDKB 5H20A 5KNLA 3OSGA 4ENNA 2ZNZA 2ID3A 2E36A 5A2QZ 2NOJB 2CQQA 2CJJA 1JTXA 4XK4A 5FKKA 2IA1A 5AONA 3ZN1A 4AWXB 3J7ZI 5J8CA 5E8IA 3K10A 1R1TA 4M72A 5JHUA 3DKYA 1AA7A 2DN0A 2PFBA 2VT2A 3EYYA 2R7TA 4A6DA 2L7ZA 2O8KA 2XASA 1ETXA 2BV6A 2XAQA 1ETOA 2TRTA 4A3GJ 2XROA 4BDZA 3AL0C 4YELA 4HX8A 1N77A 3HIFA 5FO5A 2W57A 3H5NA 4Q47A 1F36A 2ZMEB 1V54H 3FXKA 2DA2A 1K78B 2O03A 1NH3A 3H5RA 4CXFA 1HSTA 2XGCA 2R7DA 2BXYA 3H0DA 3GYHX 2V4JC 4O5VA 1BL0A 2Q1ZB 4I09A 2AXLA 3DU6A 2RKHA 1PVEA 3D5LA 3PQJA 2F5EA 4P96A 1DGRM 1IG7A 5HLHA 1J75A 3RI4A 1IRFA 1YJ9I 2X9DA 1SANA 1T0FC 4ESJA 3F8FA 5ICFA 4UUSA 4E7LA 2Q0OA 1X4OA 4KMFA 3S3NA 4NC8A 1VQ8I 2L7MP 1IN4A 1UZCA 3AG4H 1FOXA 3TMOA 3SXYA 1OYWA 3PIPF 1PP7U 1J7KA 1R00A 2QQ8A 2XVCA 4M3EA 1PJRA 4ZZLA 4XLEA 4HQEA 4A3BJ 5CKTA 1TP4A 2FSWA 2YUSA 3AL0B 3LA2A 1NK2P 2QWWA 3ESWB 2OPTA 4A69C 1MBJA 2YX4A 4IEJA 3K2ZA 3KETA 2YU3A 5GPCA 4ZDOA 3JTHA 2QSHX 1K79A 2OTLI 4A93J 1V5EA 3A0HC 3TOBA 1XDUA 3FIWA 4IVNA 3RKXA 3BG9A 5DD4A 2DYRH 1FT9A 2BGCA 4N9IA 4BE1A 3CJTB 3S16J 1F9NA 3KCCA 3WU1B 1QVTA 1SFEA 1HA8A 2CO5A 3HTUA 2HVSA 4PJLA 1GLNA 3JRHA 2LLKA 4X0GA 2FMLA 2FX0A 1A6IA 4BJ6C 5L3FA 2DK5A 2GIVA 1Z67A 4AU7A 1J5YA 1ZLKA 4IF4A 2RQQA 1OYIA 1FPQA 1O57A 3CMYA 4XN0A 1IUFA 5C44J 1OR7A 4BY1J 2MH2A 5GADJ 3ZQLA 1XGNA 2EV6A 4KFCA 2JJ7A 3GTQJ 4RM2A 2RQPA 1FJLA 2QQAA 1J0RA 5EYRA 4RAFA 1BN5A 3MQ0A 2XGXA 3A1YA 1MNDA 5JLXA 4EJWA 1YYVA 1H89C 1ZTRA 1DDNA 1IRXA 3DBRB 5LEKA 4ZYGA 1ON2A 1KONA 5HODA 5TJJA 1MSFC 1D0XA 1JKRC 1U5TB 2LVSA 2VQLA 3H3UA 2ZB9A 3CCYA 4HOBA 4WXDA 3TW6A 1ETYA 4G7OF 2L7FP 1E17A 4CH7A 1G2HA 1MSEC 2Z1DA 1YS6A 1R9TJ 4M9SA 1B59A 3GZ5A 5IOZA 4PK4A 1DPUA 2M9HA 1E3HA 1W36C 1A04A 5J1YA 1WJAA 1TQIA 2VE8A 1QPIA 5BQTA 1EKEA 1TQPA 3CJNA 3NAUA 4AYBA 1DU6A 2HVQA 4KISA 1XS9A 5C4JJ 5FKOA 1V55H 3CCQI 1SFKA 2E1MB 3U1KA 2JK3A 1U3EM 2WB1N 5C3EJ 2NAZA 3S2WA 2IEKA 1U0JA 2KLOA 1X1BA 1IN8A 2LKXA 1D1AA 2YSRA 3OOUA 1A31A 3IKVA 2GQQA 2ZNYA 5KAIC 4CDGA 1XMAA 3ML6A 2YS9A 2KIQA 1Z6TA 4ZZDA 4PGHA 4Z6YA 1QPMA 2HPMA 1XCVA 4G8XA 1QZZA 2OAZA 2D2WA 3A02A 4E7JA 3QQAA 3AFHA 4G9YA 3P5JA 2X4HA 3G73A 3HTSB 3VYUB 4PSWA 1P4WA 2COBA 5J40A 2K4JA 2KL4A 2LG4A 4BEHB 3Q3SA 5DYMA 2EH3A 1JHHA 4XICA 3AG2H 4Q4ZF 2A61A 3JW4A 3T8RA 2IGOA 1D8JA 5D5UB 1TWGJ 3DKWA 1PP8F 1HBXG 1O3TA 1TC3C 2A6TA 1TQMA 4M9XA 1GV2A 5E3MA 1OR7C 2L4AA 2P81A 4CCJA 5ICEA 1R58A 3CF5F 3M07A 3ELKA 2V26A 3PFIA 2VLAA 1P9QC 3JSPA 5L3DA 2K9MA 4PDKA 4I6ZA 2M0CA 1MJAA 4BHBA 4RB3C 1I6HJ 2NNYA 4A5MA 2HYJA 2BVMA 3WTUC 1S3JA 1ZK8A 3BZ6A 4HRIA 2OCEA 3F8MA 5EEGA 4P9UA 2DT5A 2FXAA 4NQWB 4XLPF 5E3LA 4J19A 1UAAA 1T95A 1DGWY 2P5VA 1XMKA 2WB1A 1BR1A 2FBIA 2H8WA 5J1RA 3EDPA 4BGDA 1D5YA 4PFOA 4G94A 3ZQHA 2Z3YA 4CYCA 3L09A 1IN6A 4HBLA 5HDGA 2H09A 2EFNA 1TBXA 2IGNA 4JP0A 3V7SA 4KA4A 4AM3A 5CVUA 4RA2A 2W1OA 1Y6IA 4XORA 1EA3A 3J7YJ 4EATA 5LHHA 3CUQB 3VYRB 5EGOB 1RETA 1SD7A 2DFFA 2L2OA 2DODA 1TNSA 2CYYA 1K4TA
chains in the Genus database with same CATH topology
4M3DA 4B1RA 4W97A 1IDYA 4BKXA 1HLVA 2NVTJ 2CUFA 1Q1VA 3QPSA 4BY7J 2ME0A 4X1EA 5FKNA 5FKLA 3FK7A 2FQ4A 2CU7A 3GTPJ 1WH5A 3FISA 2WV1A 1SFOJ 2MSYA 2EZLA 3CDLA 3I4MJ 1APLC 2ME6A 3RQIA 4QTRA 5IP7J 3SDGA 1GT0C 1U78A 1MNMC 1I50J 1P7JA 1PUFB 3Q0WA 3BTCA 2DA4A 2LR8A 3M3YJ 1AKHA 2FD5A 2HDDA 3ZQFA 1WCMJ 4RDUA 4JX6A 3G1OA 2M8GX 2Y9ZA 2H1KA 2NOGA 2X48A 1MH4A 1BW6A 4FE4A 1VFCA 2W48A 1JTYA 3OIOA 4M3FA 2GM4A 1MBHA 2JMWA 3BR5A 4BBRJ 1B8IA 2GBYA 2E1OA 3BTLA 3BR0A 4V2FA 1LFUP 2R7ZJ 3HEFA 2M2EA 2E2IJ 2AO9A 5F0CA 2QCOA 1RKTA 3HGGA 4S0HB 3BTJA 4DYQA 4M3GA 2QF7A 3PM1A 1CQTA 3Q0VA 2XPVA 3JRIA 3GTLJ 3WHBA 2Y2ZA 3A03A 5F08A 1UMQA 1O4XA 5IYDJ 1BA5A 4C3JJ 1AHDP 1LFBA 4A3LJ 1JT0A 3O8HA 5K7FA 1T56A 1JUMA 4FE7A 5EDNA 3E7LA 5E3OA 1ZR4A 4A3KJ 1ZGWA 2IBDA 3S17J 2Y0SN 4B3AA 1JKPC 5JLWA 3SFIA 5EG0A 3GTMJ 2MGQA 2LFBA 3BR2A 1ENHA 5BNGA 1W0UA 1X2NA 2Y30A 1FEXA 2XB0X 1TWCJ 3JRBA 3K7AJ 2O7OA 3BT9A 3SJMA 2DA3A 1B72A 2WAQN 1WGXA 5IP9J 3GTOJ 3HOVJ 1MBFA 1YRNB 1U8BA 1H8AC 3S2DJ 5F0HA 5IPAA 3JRGA 1EF4A 4B4CA 3S1RJ 2X6OA 1WPKA 5FLVA 1UG2A 2MW8A 3MVPA 2VUMJ 3HOYJ 4EEFG 4BXXJ 1X2MA 2E2HJ 3D1NI 3UKGA 2CUEA 1BJZA 3C2BA 3LSRA 1ZR2A 1ORKA 2DMQA 3HKZN 2HQ5A 5GPAA 3BTIA 2LK2A 4IHXA 4A3EJ 3TP0A 1ETKA 2GLOA 1MBGA 2JA8J 3GTGJ 1XC5A 2XGEA 5K7HA 1FIAA 2JA7J 4NDLA 1JKOC 3PO2J 1JUSA 2HXIA 3Q0UA 4MFDA 4MIMA 5EZHA 1MBEA 5EF6A 1PUFA 2KT0A 2DA5A 1JGGA 2CQXA 3O8GA 3TW7A 2PMZN 4RBOA 3ZQGA 4A3MJ 2RAEA 1WI3A 1GUUA 3BQYA 1ETVA 1F43A 1IRZA 3HGYA 2DA7A 1QVUA 5IOYA 4C3IJ 3ZOBA 3S1QJ 1H88C 1JJ6C 4D5FA 2XGDA 3S2HJ 1IC8A 5IYCJ 1IJWC 2D5VA 1K83J 3DCFA 1P7IA 1MH3A 3M4OJ 2YU9J 4FTHA 2CRGA 5EZGA 4UUSB 3FK6A 2MG4A 2HXOA 3BG5A 3QPLA 3OSGA 4GFBA 2ID3A 2CQQA 4G12A 2CJJA 1RESA 1JTXA 4XK4A 5FKKA 2VKEA 2LD5A 4QIWN 1AU7A 2OF7A 2DN0A 1RPWA 2AHQA 2LP0A 1ETQA 2L7ZA 2O8KA 1ETXA 1POGA 1ETOA 2TRTA 4A3GJ 3JRFA 3BR3A 1Z77A 5M5YJ 1F36A 2EZIA 2DA2A 5E3NA 2EBIA 2XGCA 3H0GJ 4C3HJ 1BL0A 1HDDC 5M5XJ 5EEAA 1Z0XA 1FIPA 2K9SA 1OCPA 3RKQA 3ZQIA 2ELKA 3LSGA 1IG7A 3VPRA 2NS8A 2X9DA 4M6VA 2NS7A 1SANA 3W6VA 2VKVA 3HOWJ 4UUSA 4A3IJ 3JR9A 2L7MP 2DMNA 2Y31A 3JREA 4DZPA 4IHWA 1JUPA 4MO7A 1IV6A 2O9LA 1HCRA 4M3EA 4DYRA 4DZJA 1VNDA 4A3BJ 1HDPA 2YUSA 1NK2P 1X58A 3HOUJ 2TCTA 2OPTA 1LE8A 4A69C 3G1LA 4Y7NJ 1MBJA 4IEJA 1OFCX 4MFEA 5GPCA 1TWFJ 5EG0B 5J1UA 2DTZA 4CYCB 4HNVA 4A93J 1Y1WJ 4AUXA 5DS9A 3A01B 2DJNA 3FIWA 1W0TA 3BG9A 3BR6A 3F0CA 1A5JA 1E3OC 3S16J 1QVTA 4JYKA 3RZOJ 2H8RA 2EZHA 3IH4A 3JRHA 1WH7A 2LLKA 3DEWA 3G1MA 2FX0A 1A6IA 2JN6A 2M34A 2R92J 3K2AA 3GBGA 3JRCA 2KDZA 3CMYA 4JX4A 4FCYA 9ANTA 4L5EA 4A3JJ 1IUFA 5C44J 2R0QC 4BY1J 3TEDA 3ZQLA 3GTQJ 2JJ7A 4A3CJ 1ZKGA 2Y9YA 3OSFA 1B72B 1FJLA 3IH3A 5EYRA 3HBLA 2DA6A 2LTPA 2XRLA 3CQZJ 3IV5A 5J3LA 3IH2A 2K40A 5JLXA 1H89C 1ZTRA 4XRMA 1DU0A 3BG3A 5HODA 4IHVA 1MSFC 4XIDA 1JKRC 3MN2A 3S15J 2EQRA 2LVSA 1UHSA 2ZB9A 3CCYA 3TW6A 3LSPA 2JWTA 1ETYA 3H3VK 2L7FP 2R93J 2VI6A 1I3QJ 4DW6A 1G2HA 1MSEC 4I76A 1T33A 1Y1VJ 2L9RA 2FJ1A 5M3FJ 2E19A 2ECCA 2K9QA 1R9TJ 5IOZA 2DMPA 2M9HA 1U9OA 3WHCA 2HI3A 5IYBJ 5J1YA 1HOMA 2R5ZA 4BBSJ 1QPIA 5K7ZA 3NAUA 1DU6A 2HOTA 1XS9A 5C4JJ 3S1NJ 3JRDA 3HOXJ 2L0KA 5FKOA 4ABZA 1RR7A 4FISA 2JK3A 4D7NA 2WB1N 1B8IB 5C3EJ 2IEKA 2JA5J 1FTTA 2LKXA 1MBKA 4IHYA 3OOUA 2R5ZB 5FLMJ 3HDDA 4MLOA 3GTJJ 1GV5A 1YRNA 1TWAJ 1XG1A 2YS9A 5F27A 3B6CA 3LOCA 4Y52J 2DMUA 3A01A 4XRSG 3LNQA 2HOSA 1ETWA 1FTZA 3HB9A 3LSJA 3HM5A 5M3MJ 3A02A 5FKMA 3JRAA 1TWHJ 3QQAA 4AYBN 4D5CA 2NVQJ 1NTCA 1VI0A 5DTDA 2JA6J 2HOAA 1QRYA 4JX5A 4M3BA 1JKQC 2COBA 2EZKA 2I10A 3Q3SA 4AC0A 2EH3A 1K61A 2VPRA 1VF9A 3MKLA 4XICA 1LE8B 3PO3J 4UUTA 5M5WJ 3B6AA 4V2GA 2DMTA 1IDZA 5F0FA 2XPUA 1TWGJ 2ID6A 4W1UA 1TC3C 3I4NJ 2R5YA 2XB5A 2NVXJ 1AKHB 2B63J 1GV2A 4D7MA 5E3MA 1JJ8C 4X6AJ 2N8GA 3ZQCA 2P81A 1HF0A 3BQZA 4DYCA 1IGNA 5FJ8J 5GP9A 3HOZJ 1ZQ3P 4I6ZA 3S14J 2M0CA 4QSHA 1I6HJ 5F04A 2HYJA 2R5YB 1ZK8A 5EGOA 2E2JJ 4A3DJ 3FKIJ 5E3LA 4J19A 1OJLA 2ECBA 3TP3A 3BR1A 2DA1A 5C4XJ 2LY9A 5J1RA 1U9NA 2XPWA 4C2MJ 1ITYA 1OCTC 5IP6A 4XRSA 2NVYJ 1D5YA 3GTKJ 3S1MJ 3ZQHA 4CYCA 2IAIA 3NARA 5F1JA 2XSDC 2G0EA 2K9NA 3RZDJ 1JT6A 4LOCA 1RKWA 4JP0A 1S7EA 1BW5A 1GVDA 4A3FJ 1NK3P 3L1PA 5EGOB 1GDTA 1RETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3D A;  4B1R A;  4W97 A;  1IDY A;  4BKX A;  1HLV A;  2NVT J;  2CUF A;  1Q1V A;  3QPS A;  4BY7 J;  2ME0 A;  4X1E A;  5FKN A;  5FKL A;  3FK7 A;  2FQ4 A;  2CU7 A;  3GTP J;  1WH5 A;  3FIS A;  2WV1 A;  1SFO J;  2MSY A;  2EZL A;  3CDL A;  3I4M J;  1APL C;  2ME6 A;  3RQI A;  4QTR A;  5IP7 J;  3SDG A;  1GT0 C;  1U78 A;  1MNM C;  1I50 J;  1P7J A;  1PUF B;  3Q0W A;  3BTC A;  2DA4 A;  2LR8 A;  3M3Y J;  1AKH A;  2FD5 A;  2HDD A;  3ZQF A;  1WCM J;  4RDU A;  4JX6 A;  3G1O A;  2M8G X;  2Y9Z A;  2H1K A;  2NOG A;  2X48 A;  1MH4 A;  1BW6 A;  4FE4 A;  1VFC A;  2W48 A;  1JTY A;  3OIO A;  4M3F A;  2GM4 A;  1MBH A;  2JMW A;  3BR5 A;  4BBR J;  1B8I A;  2GBY A;  2E1O A;  3BTL A;  3BR0 A;  4V2F A;  1LFU P;  2R7Z J;  3HEF A;  2M2E A;  2E2I J;  2AO9 A;  5F0C A;  2QCO A;  1RKT A;  3HGG A;  4S0H B;  3BTJ A;  4DYQ A;  4M3G A;  2QF7 A;  3PM1 A;  1CQT A;  3Q0V A;  2XPV A;  3JRI A;  3GTL J;  3WHB A;  2Y2Z A;  3A03 A;  5F08 A;  1UMQ A;  1O4X A;  5IYD J;  1BA5 A;  4C3J J;  1AHD P;  1LFB A;  4A3L J;  1JT0 A;  3O8H A;  5K7F A;  1T56 A;  1JUM A;  4FE7 A;  5EDN A;  3E7L A;  5E3O A;  1ZR4 A;  4A3K J;  1ZGW A;  2IBD A;  3S17 J;  2Y0S N;  4B3A A;  1JKP C;  5JLW A;  3SFI A;  5EG0 A;  3GTM J;  2MGQ A;  2LFB A;  3BR2 A;  1ENH A;  5BNG A;  1W0U A;  1X2N A;  2Y30 A;  1FEX A;  2XB0 X;  1TWC J;  3JRB A;  3K7A J;  2O7O A;  3BT9 A;  3SJM A;  2DA3 A;  1B72 A;  2WAQ N;  1WGX A;  5IP9 J;  3GTO J;  3HOV J;  1MBF A;  1YRN B;  1U8B A;  1H8A C;  3S2D J;  5F0H A;  5IPA A;  3JRG A;  1EF4 A;  4B4C A;  3S1R J;  2X6O A;  1WPK A;  5FLV A;  1UG2 A;  2MW8 A;  3MVP A;  2VUM J;  3HOY J;  4EEF G;  4BXX J;  1X2M A;  2E2H J;  3D1N I;  3UKG A;  2CUE A;  1BJZ A;  3C2B A;  3LSR A;  1ZR2 A;  1ORK A;  2DMQ A;  3HKZ N;  2HQ5 A;  5GPA A;  3BTI A;  2LK2 A;  4IHX A;  4A3E J;  3TP0 A;  1ETK A;  2GLO A;  1MBG A;  2JA8 J;  3GTG J;  1XC5 A;  2XGE A;  5K7H A;  1FIA A;  2JA7 J;  4NDL A;  1JKO C;  3PO2 J;  1JUS A;  2HXI A;  3Q0U A;  4MFD A;  4MIM A;  5EZH A;  1MBE A;  5EF6 A;  1PUF A;  2KT0 A;  2DA5 A;  1JGG A;  2CQX A;  3O8G A;  3TW7 A;  2PMZ N;  4RBO A;  3ZQG A;  4A3M J;  2RAE A;  1WI3 A;  1GUU A;  3BQY A;  1ETV A;  1F43 A;  1IRZ A;  3HGY A;  2DA7 A;  1QVU A;  5IOY A;  4C3I J;  3ZOB A;  3S1Q J;  1H88 C;  1JJ6 C;  4D5F A;  2XGD A;  3S2H J;  1IC8 A;  5IYC J;  1IJW C;  2D5V A;  1K83 J;  3DCF A;  1P7I A;  1MH3 A;  3M4O J;  2YU9 J;  4FTH A;  2CRG A;  5EZG A;  4UUS B;  3FK6 A;  2MG4 A;  2HXO A;  3BG5 A;  3QPL A;  3OSG A;  4GFB A;  2ID3 A;  2CQQ A;  4G12 A;  2CJJ A;  1RES A;  1JTX A;  4XK4 A;  5FKK A;  2VKE A;  2LD5 A;  4QIW N;  1AU7 A;  2OF7 A;  2DN0 A;  1RPW A;  2AHQ A;  2LP0 A;  1ETQ A;  2L7Z A;  2O8K A;  1ETX A;  1POG A;  1ETO A;  2TRT A;  4A3G J;  3JRF A;  3BR3 A;  1Z77 A;  5M5Y J;  1F36 A;  2EZI A;  2DA2 A;  5E3N A;  2EBI A;  2XGC A;  3H0G J;  4C3H J;  1BL0 A;  1HDD C;  5M5X J;  5EEA A;  1Z0X A;  1FIP A;  2K9S A;  1OCP A;  3RKQ A;  3ZQI A;  2ELK A;  3LSG A;  1IG7 A;  3VPR A;  2NS8 A;  2X9D A;  4M6V A;  2NS7 A;  1SAN A;  3W6V A;  2VKV A;  3HOW J;  4UUS A;  4A3I J;  3JR9 A;  2L7M P;  2DMN A;  2Y31 A;  3JRE A;  4DZP A;  4IHW A;  1JUP A;  4MO7 A;  1IV6 A;  2O9L A;  1HCR A;  4M3E A;  4DYR A;  4DZJ A;  1VND A;  4A3B J;  1HDP A;  2YUS A;  1NK2 P;  1X58 A;  3HOU J;  2TCT A;  2OPT A;  1LE8 A;  4A69 C;  3G1L A;  4Y7N J;  1MBJ A;  4IEJ A;  1OFC X;  4MFE A;  5GPC A;  1TWF J;  5EG0 B;  5J1U A;  2DTZ A;  4CYC B;  4HNV A;  4A93 J;  1Y1W J;  4AUX A;  5DS9 A;  3A01 B;  2DJN A;  3FIW A;  1W0T A;  3BG9 A;  3BR6 A;  3F0C A;  1A5J A;  1E3O C;  3S16 J;  1QVT A;  4JYK A;  3RZO J;  2H8R A;  2EZH A;  3IH4 A;  3JRH A;  1WH7 A;  2LLK A;  3DEW A;  3G1M A;  2FX0 A;  1A6I A;  2JN6 A;  2M34 A;  2R92 J;  3K2A A;  3GBG A;  3JRC A;  2KDZ A;  3CMY A;  4JX4 A;  4FCY A;  9ANT A;  4L5E A;  4A3J J;  1IUF A;  5C44 J;  2R0Q C;  4BY1 J;  3TED A;  3ZQL A;  3GTQ J;  2JJ7 A;  4A3C J;  1ZKG A;  2Y9Y A;  3OSF A;  1B72 B;  1FJL A;  3IH3 A;  5EYR A;  3HBL A;  2DA6 A;  2LTP A;  2XRL A;  3CQZ J;  3IV5 A;  5J3L A;  3IH2 A;  2K40 A;  5JLX A;  1H89 C;  1ZTR A;  4XRM A;  1DU0 A;  3BG3 A;  5HOD A;  4IHV A;  1MSF C;  4XID A;  1JKR C;  3MN2 A;  3S15 J;  2EQR A;  2LVS A;  1UHS A;  2ZB9 A;  3CCY A;  3TW6 A;  3LSP A;  2JWT A;  1ETY A;  3H3V K;  2L7F P;  2R93 J;  2VI6 A;  1I3Q J;  4DW6 A;  1G2H A;  1MSE C;  4I76 A;  1T33 A;  1Y1V J;  2L9R A;  2FJ1 A;  5M3F J;  2E19 A;  2ECC A;  2K9Q A;  1R9T J;  5IOZ A;  2DMP A;  2M9H A;  1U9O A;  3WHC A;  2HI3 A;  5IYB J;  5J1Y A;  1HOM A;  2R5Z A;  4BBS J;  1QPI A;  5K7Z A;  3NAU A;  1DU6 A;  2HOT A;  1XS9 A;  5C4J J;  3S1N J;  3JRD A;  3HOX J;  2L0K A;  5FKO A;  4ABZ A;  1RR7 A;  4FIS A;  2JK3 A;  4D7N A;  2WB1 N;  1B8I B;  5C3E J;  2IEK A;  2JA5 J;  1FTT A;  2LKX A;  1MBK A;  4IHY A;  3OOU A;  2R5Z B;  5FLM J;  3HDD A;  4MLO A;  3GTJ J;  1GV5 A;  1YRN A;  1TWA J;  1XG1 A;  2YS9 A;  5F27 A;  3B6C A;  3LOC A;  4Y52 J;  2DMU A;  3A01 A;  4XRS G;  3LNQ A;  2HOS A;  1ETW A;  1FTZ A;  3HB9 A;  3LSJ A;  3HM5 A;  5M3M J;  3A02 A;  5FKM A;  3JRA A;  1TWH J;  3QQA A;  4AYB N;  4D5C A;  2NVQ J;  1NTC A;  1VI0 A;  5DTD A;  2JA6 J;  2HOA A;  1QRY A;  4JX5 A;  4M3B A;  1JKQ C;  2COB A;  2EZK A;  2I10 A;  3Q3S A;  4AC0 A;  2EH3 A;  1K61 A;  2VPR A;  1VF9 A;  3MKL A;  4XIC A;  1LE8 B;  3PO3 J;  4UUT A;  5M5W J;  3B6A A;  4V2G A;  2DMT A;  1IDZ A;  5F0F A;  2XPU A;  1TWG J;  2ID6 A;  4W1U A;  1TC3 C;  3I4N J;  2R5Y A;  2XB5 A;  2NVX J;  1AKH B;  2B63 J;  1GV2 A;  4D7M A;  5E3M A;  1JJ8 C;  4X6A J;  2N8G A;  3ZQC A;  2P81 A;  1HF0 A;  3BQZ A;  4DYC A;  1IGN A;  5FJ8 J;  5GP9 A;  3HOZ J;  1ZQ3 P;  4I6Z A;  3S14 J;  2M0C A;  4QSH A;  1I6H J;  5F04 A;  2HYJ A;  2R5Y B;  1ZK8 A;  5EGO A;  2E2J J;  4A3D J;  3FKI J;  5E3L A;  4J19 A;  1OJL A;  2ECB A;  3TP3 A;  3BR1 A;  2DA1 A;  5C4X J;  2LY9 A;  5J1R A;  1U9N A;  2XPW A;  4C2M J;  1ITY A;  1OCT C;  5IP6 A;  4XRS A;  2NVY J;  1D5Y A;  3GTK J;  3S1M J;  3ZQH A;  4CYC A;  2IAI A;  3NAR A;  5F1J A;  2XSD C;  2G0E A;  2K9N A;  3RZD J;  1JT6 A;  4LOC A;  1RKW A;  4JP0 A;  1S7E A;  1BW5 A;  1GVD A;  4A3F J;  1NK3 P;  3L1P A;  5EGO B;  1GDT A;  1RET A; 
#chains in the Genus database with same CATH topology
 4M3D A;  4B1R A;  3ASN H;  1O7L A;  3K4N A;  3GZN B;  1YJN I;  5K5O A;  1Q1V A;  1LKX A;  3I71 A;  1XB4 A;  2GXA A;  1WHU A;  4C30 A;  2DFH A;  2OTJ I;  5FKN A;  5FKL A;  2VQC A;  3FMR A;  3ZMS A;  1T08 B;  5HLT A;  1R5H A;  3M1E A;  1WH5 A;  2R7Q A;  5FB2 A;  2EZL A;  4PGG A;  3ABT A;  1G4D A;  2HEO A;  1KA8 A;  3SQN A;  4XQF A;  5ED4 A;  3SDG A;  4B47 A;  1OKR A;  1GT0 C;  1U78 A;  3ZMV A;  1MNM C;  1I50 J;  1J09 A;  1PUF B;  2W4S A;  1CF7 A;  4HF0 A;  3BTC A;  3SYT A;  2DA4 A;  4KT6 A;  3GX4 X;  3M3Y J;  3OR2 C;  3OWT A;  3ZQF A;  3VSK A;  2ACJ A;  2I8D A;  3G1O A;  5JVT A;  2ICW G;  4C9Y A;  2Y9Z A;  2XAH A;  5JFR A;  4OMY A;  1JHF A;  4UY8 I;  1I5Z A;  4FE4 A;  3AG3 H;  2VJ5 A;  2W48 A;  2ZXW H;  3FF5 A;  3OIO A;  1Z9C A;  1R7J A;  1MMG A;  2RDP A;  4KIC A;  1FP1 D;  2H1L A;  4M3F A;  2QSF X;  2XKO A;  2FRH A;  3BR5 A;  1B8I A;  2GBY A;  1T38 A;  3TQN A;  1TW2 A;  4LIT A;  2AQF A;  2ZFW A;  1I3A A;  2ISZ A;  4EJT A;  2AO9 A;  5F0C A;  5ILS A;  3TL4 X;  2RRE A;  2F5V A;  3VOE A;  2A07 F;  2QSG X;  4BH9 A;  3AG1 H;  1X3W B;  4DJA A;  1MDM A;  2WY8 Q;  3UNG C;  3JRI A;  2KDO A;  3QPT A;  1XCB A;  4ESF A;  1KU2 A;  1NG6 A;  4P1W A;  2JUC A;  4RAG A;  3WHB A;  1RRJ A;  5IT3 A;  5H6R A;  4S04 A;  1UMQ A;  2COM A;  1O4X A;  4HZF A;  4HW0 A;  2QM3 A;  3CDI A;  3O8H A;  4IJA A;  2EPF A;  4FE7 A;  4K2E A;  3GW2 A;  3IC7 A;  1LDJ A;  2Q2E B;  3E7L A;  1AWC A;  1OQY A;  2HFH A;  4A3K J;  3MZH A;  1ZGW A;  3KIO A;  1J2X A;  2IBD A;  2Y0S N;  1JKP C;  3Q9S A;  3S17 J;  3REO A;  3QPH A;  2DT7 B;  2F5D A;  4HSR A;  3UR3 C;  2LRE A;  3EYI A;  1YX3 A;  2CUZ A;  3SFI A;  5KK1 A;  1WSU A;  3P9K A;  5DCM B;  4B3X A;  3GTM J;  3BR2 A;  5BNG A;  1ODD A;  1H9T A;  3BT9 A;  1LUJ B;  3NEU A;  1X19 A;  3EUH A;  5IP9 J;  2VN2 A;  3ZQ7 A;  1LVA A;  3HOV J;  2IA2 A;  1IO2 A;  1U8B A;  1H8A C;  2RNJ A;  2LNB A;  5F0H A;  1Y8R B;  3TBI A;  4EGY A;  1WJC A;  2K4B A;  1HKS A;  5IPA A;  1FLI A;  2EIN H;  3JRG A;  3S1R J;  1HKQ A;  3F3X A;  1WPK A;  1UG2 A;  3MVP A;  3HOY J;  4EEF G;  1SEU A;  3A0B C;  4OU0 A;  1FOY A;  2CUE A;  3W6J B;  1SAU A;  5CJ9 A;  1WWX A;  3H5A A;  3F72 A;  2RVC A;  4NC7 A;  1ORK A;  2L01 A;  1TW3 A;  5GPA A;  1T8I A;  1BC8 C;  1Z21 A;  1R23 A;  2BY1 A;  3IP4 B;  1Z6R A;  3TP0 A;  3L2C A;  1ETK A;  2HGC A;  1R4N B;  4RLF A;  4KIG A;  3OIQ A;  1X1A A;  2IGM A;  4UB8 C;  1TNT A;  1IXC A;  2F48 A;  3DLL F;  5K7H A;  1VQP I;  2VJJ A;  2WTE A;  4NDL A;  3PO2 J;  4BS9 A;  3RDI A;  4IZZ A;  3C1D A;  2PI0 A;  3WTT C;  4MFD A;  1TL8 A;  4MIM A;  2R7W A;  4V19 K;  1MBE A;  5EF6 A;  2HZT A;  2X51 A;  3BY6 A;  3RTR A;  2IS6 A;  3CES A;  2CQK A;  5FD6 A;  2M4G A;  1O3R A;  3B73 A;  2BY2 A;  3T1B A;  2NS0 A;  3FXR A;  3QOE A;  3VWB A;  3HGY A;  1QVU A;  2AXT C;  3HSE A;  5BS6 A;  3E5U A;  1FOW A;  4D5F A;  4XLH A;  1BR4 A;  1SFU A;  2P6S A;  2JA2 A;  1OPC A;  2RGV A;  3CUO A;  3M8E A;  1MH3 A;  2Y75 A;  1UST A;  2IGK A;  3FWE A;  4LK0 F;  2XF5 A;  3H92 A;  4OAZ A;  2JT1 A;  1FP2 A;  2HXO A;  4UV9 A;  3OYJ A;  5HOO A;  3ULQ B;  3CCJ I;  4E7H A;  1RES A;  2QBY B;  3ZQQ A;  2MAB A;  2VKE A;  2LD5 A;  1FX7 A;  1P4A A;  3CP8 A;  1AU7 A;  2IXS A;  4FX4 A;  1LPQ A;  1T0F A;  1O3S A;  1BIA A;  1TTY A;  1MMA A;  3I4P A;  2LP0 A;  4OOI A;  3CCE I;  3OYI A;  1AOY A;  4ASN A;  3K4C A;  1POG A;  3LST A;  2V9K A;  1U5T C;  4XKW A;  1WFX A;  2VQG A;  3BR3 A;  3HRT A;  5FFZ A;  4HV6 A;  5JHF A;  3ERE D;  1MZB A;  1FY7 A;  3LFK A;  1YX5 A;  2OD5 A;  1O3Q A;  5E3N A;  1YTY A;  3PUF A;  3R0J A;  1MW7 A;  3DWL E;  3HG9 A;  4OMZ A;  2NNN A;  4LLL A;  4L5J A;  1REP C;  5E1W A;  2K9S A;  3GME A;  1PDN C;  3ZQI A;  3LSG A;  4OIO F;  3VPR A;  2DFI A;  3HOT A;  1VQK I;  3KLN A;  5J47 A;  3W6V A;  3L2R A;  4XNF A;  3TDZ C;  4CCL A;  4IQJ A;  1E0E A;  1JI8 A;  4G7Z F;  3CMA I;  4BEH A;  1R1U A;  2DMN A;  2OC6 A;  2Y31 A;  3K1N A;  3JRE A;  4BAC A;  2CW7 A;  1IV6 A;  3CCR I;  1W7P D;  4DZJ A;  1FSH A;  1WI9 A;  2QUF A;  2V1N A;  4GRI A;  4EJU A;  4AD9 A;  1G59 A;  2ZO4 A;  1VQL I;  2ZSI B;  3J81 K;  3IAS 2;  5BOX A;  1JXS A;  2ISY A;  3IWZ A;  2PG4 A;  3HHG A;  5J1U A;  1YIJ I;  2EFP A;  5JI6 A;  2DTZ A;  3BZK A;  4WXC A;  2BBY A;  5LRR A;  4HNV A;  1Y1W J;  4AUX A;  1W7P A;  3OYM A;  4CZC A;  3BR6 A;  3CD6 I;  4HF2 A;  2DTR A;  2K27 A;  1RC9 A;  3OS1 A;  1E3O C;  1KZH A;  2O61 A;  3KYD B;  3LQR A;  3X2Q H;  4XMY A;  2DK8 A;  2M0M A;  5GAG J;  1S9H A;  2GZW A;  5BPD A;  3J80 Z;  2BY0 A;  3BPV A;  3RZO J;  5CLS A;  1K6O A;  1S5L C;  2H8R A;  2OUM A;  3ASO H;  4RAZ A;  3MZY A;  2M34 A;  1WVR A;  2DBB A;  5L3G A;  2XAU A;  2X6X A;  3K2A A;  2ZCW A;  3ZCO A;  3GBG A;  3JRC A;  4FCY A;  2HTJ A;  2KFD A;  2D45 A;  1V3F A;  1SD6 A;  2VJI A;  3FMS A;  3LSH A;  2V1X A;  2QLZ A;  2Y9Y A;  4S05 A;  4GXO A;  1B72 B;  4LIV A;  4Y33 A;  2PMU A;  5JR3 A;  5J4V A;  4M6X A;  3F6V A;  3HBL A;  2DA6 A;  2LTP A;  2XRL A;  2Z99 A;  5J3L A;  3IH2 A;  2CV1 A;  5LHI A;  2DQL A;  2K40 A;  2EJR A;  2JPB A;  4MEY F;  5L3B A;  2ZJ2 A;  4XRM A;  1W7P B;  4M9Z A;  4GDF A;  1VQM I;  2BHY A;  4IHS A;  1VQN I;  1IN5 A;  3QU6 A;  1YG2 A;  4IHV A;  3KYL A;  1QU3 A;  4XID A;  1BI1 A;  4LMY A;  2ZJQ F;  1I6X A;  3LMM A;  2CFO A;  4EVI A;  5IT9 K;  2JWT A;  2JSP A;  1KGS A;  1T39 A;  4DW6 A;  1X1P A;  2LF8 A;  4I76 A;  1WJF A;  1OYY A;  2E19 A;  1WKM A;  2NYX A;  4CCM A;  3PNT A;  1IW7 F;  5E8G A;  3F21 A;  1E3P A;  5CVV A;  2EA2 A;  2CSO A;  3BRO A;  5IYB J;  1LVK A;  3V42 A;  2E7X A;  5DDG A;  3K4J A;  4BBS J;  3PL8 A;  2R7S A;  5K7Z A;  1K7A A;  4P55 A;  3RQ4 A;  2X1C A;  1I39 A;  2ESH A;  2HOT A;  1W5S A;  2Z9O A;  3JRD A;  3HOX J;  2K5C A;  4UVA A;  3VOD A;  5DV5 A;  3LA3 A;  3EUH C;  2EA4 A;  5DEQ A;  3TO6 A;  4L9T A;  4XM3 A;  3DP7 A;  5KAF C;  4IHY A;  3J80 K;  3E5X A;  1BI3 A;  2R5Z B;  1VQ9 I;  2L02 A;  3GTJ J;  2EIM H;  1HQC A;  2VBW A;  4NNJ A;  4F7Z A;  4IOC F;  3WGH A;  1XG1 A;  1LEB A;  3LOC A;  4Y52 J;  3A01 A;  4AIH A;  3WTY C;  4EMS A;  2IS2 A;  2WAD A;  3ABK H;  3WG7 H;  3HUG A;  2GXB A;  3SDB A;  2ETH A;  3LSJ A;  4GYI A;  5FKM A;  4IRI A;  3KLO A;  4AYB N;  2ZXI A;  1NTC A;  5D8K B;  5DTD A;  4RS8 A;  1XSD A;  2FF4 A;  1UHM A;  4BQO A;  5CPR B;  3MFK A;  4EM0 B;  1KU3 A;  3H9Q A;  4XLN F;  3FXQ A;  5LD2 C;  1LE8 B;  2XF6 A;  5A2Q K;  1YOV B;  2VL8 A;  4OIP F;  3G71 I;  4LK1 F;  5FGM A;  5F0F A;  3BC8 A;  4W1U A;  2ID6 A;  2MLG A;  2R5Y A;  4L9J A;  4A5N A;  2JTV A;  3ABL H;  4X6A J;  3E6D A;  3OR1 C;  1HF0 A;  2BZT A;  1FSE A;  4DYC A;  5FLX K;  3RIR A;  1IGN A;  3NWS A;  1D1B A;  5E1Z B;  5GP9 A;  3GCM A;  3M7G A;  5D4S A;  5HNH A;  3W2A A;  3GWZ A;  2NXN B;  5F04 A;  4MHG A;  2HKX A;  5ILU A;  2VXZ A;  1YW7 A;  3I3L A;  2P0W A;  3GVA A;  3O2P E;  3HPH A;  3RJP A;  3DTK A;  3L2U A;  3FKI J;  4CA0 A;  1OJL A;  3H36 A;  2O6G E;  1S6L A;  2M3A A;  4QPQ A;  1CF7 B;  1YFH A;  3BR1 A;  2DA1 A;  2LY9 A;  3IAM 2;  1IXR C;  2PJR A;  1I27 A;  3FXJ A;  4XRS A;  3GTK J;  3S1M J;  2CS3 A;  3CLQ A;  3MD2 A;  2EV5 A;  5F1J A;  4XR6 A;  3PSI A;  3JAM K;  2K9N A;  1HW2 A;  4LOC A;  1FBU A;  2QQB A;  2R7X A;  5HNF A;  4N4N B;  4LIU A;  2WWY A;  3WTW C;  2M4K A;  4KMU X;  1FOK A;  2F6C A;  2K85 A;  4RGS A;  4W97 A;  4HEA 2;  2ZXJ A;  2XAF A;  3S32 A;  4L9V A;  1HLV A;  2NVT J;  3RYP A;  4HV5 A;  1EH8 A;  2FBH A;  2CQ7 A;  5EEH A;  3K1P A;  2LY1 A;  4N0B A;  3FK7 A;  2KJB A;  3OL4 A;  2DYS H;  3K4L A;  4YEJ A;  2WV1 A;  4QLC U;  3CDL A;  5CYV A;  4IRH A;  4HQM A;  1DQU A;  1APL C;  3R60 A;  2MC4 A;  4XN3 A;  4HG2 A;  2L7K A;  2QYO A;  3K69 A;  3HRM A;  1QNT A;  2QEN A;  2BE5 F;  2W82 A;  2HTS A;  3HRS A;  3Q0W A;  2M30 A;  2LR8 A;  3HUG B;  2FD5 A;  2JVG A;  4PCQ A;  3FDY A;  1WCM J;  4DNC A;  2EFQ A;  4JX6 A;  4RDU A;  3MKY B;  3L2W A;  3PJR A;  4E7Z A;  1BW6 A;  3HC7 A;  3BP8 A;  1JTY A;  4AIJ A;  2EWN A;  2E7W A;  2RNG A;  2IPQ X;  2EV0 A;  4Y3O A;  4XKC A;  2JMW A;  4UUV A;  2DPU A;  3TKY A;  2XKP A;  4R8H A;  1YI2 I;  2ZFU A;  5FD5 A;  1LDD A;  1LFU P;  1LB2 A;  3HEF A;  2R7F A;  3GXO A;  3LAJ A;  5HS9 A;  3W2V A;  2O8X A;  3MZ8 A;  5K1Y A;  4F92 B;  3U1D A;  4L0Z B;  4GGG A;  4S0H B;  4GCV A;  4DYQ A;  2QF7 A;  3P9I A;  1YW8 A;  1CQT A;  2JPC A;  3Q0V A;  3ISP A;  3K4M A;  4LLG F;  2X6W A;  2HYF A;  3A03 A;  1FMV A;  4BU2 A;  4EGZ A;  4KIB A;  1AHD P;  3CME I;  5IY5 H;  1T56 A;  4BQQ A;  4IQ4 A;  1USS A;  2BY3 A;  1ZR4 A;  3OYF A;  1FZP B;  2KIF A;  5DUK A;  2OQR A;  3FXL A;  3WGG A;  4DQ2 A;  2E1M C;  2RN7 A;  4R1H A;  2HVR A;  5JLW A;  2G9W A;  2BW3 A;  5EG0 A;  1ONV A;  5AIP A;  3OL3 A;  1W0U A;  1UG0 A;  1Z3Y A;  2OZU A;  1X2N A;  2Y30 A;  1OCR H;  2XB0 X;  3RCO A;  4ZYE A;  1LEA A;  2GA2 A;  2W00 A;  3KYC B;  4O6J A;  3AKZ A;  2DA3 A;  4CHU A;  1B72 A;  1D0Y A;  4HST A;  3BCB A;  1HKT A;  1YRN B;  1KQ8 A;  1TZL A;  3S2D J;  1FYK A;  2L9N A;  2WAE A;  4O3M A;  2EIK H;  2IJL A;  2F4O B;  4RB0 A;  5L3E A;  4GYG A;  1Y0N A;  5LGT A;  3GUD A;  5FLX Z;  1G6N A;  3CJQ B;  2QKL B;  3KP2 A;  3L9F A;  3MMY B;  3SFZ A;  3WG9 A;  1X2M A;  2HQR A;  3LSM A;  1UCR A;  1LFP A;  3O3K A;  1F4K A;  3DQV C;  2K3P A;  2XAJ A;  4I02 A;  1ZR2 A;  4BQA A;  5L3C A;  1T98 A;  4EM2 A;  1D8K A;  4RGR A;  4IHX A;  1BI2 A;  4C2U A;  1J59 A;  4LB6 B;  2GLO A;  3DFG A;  4UXN A;  4BJ5 C;  4BXF A;  5B3S H;  2XGE A;  3C2H A;  3E5Q A;  4CUG A;  1FIA A;  3EET A;  3QOP A;  4XON A;  5GTH C;  1JUS A;  3I59 A;  3Q0U A;  3I5U A;  3LQQ A;  4F52 A;  3C7J A;  3OYC A;  2AS5 F;  3HSF A;  2R7O A;  4HX7 A;  2DA5 A;  2LYC A;  1JGG A;  2CQX A;  3O8G A;  3OIP A;  4YFX F;  2UXN A;  2JSC A;  2LOO A;  4RBO A;  3ZQG A;  1XPX A;  2WAQ A;  4A3M J;  2RAE A;  3VYT B;  1GUU A;  3WTX C;  2MC3 A;  1F43 A;  2HR3 A;  3IL2 A;  2DA7 A;  3V7C A;  3V8J A;  3S1Q J;  2VPL A;  3KP4 A;  2OCC H;  4AVZ A;  4NC6 A;  5IYC J;  4PJM A;  1F5T A;  2D5V A;  1FMW A;  1UHW A;  3KP3 A;  1P92 A;  3F8B A;  1P7I A;  3L2V A;  3M4O J;  1YIO A;  2F2E A;  4PFP A;  1XSV A;  4WK8 F;  2YU9 J;  2F5F A;  3WTS C;  2CRG A;  4UUS B;  3FK6 A;  4HYE A;  2IA0 A;  3BG5 A;  3QPL A;  3E3V A;  4XSX F;  4GFB A;  3WE2 A;  2W7N A;  4EJO A;  1XGO A;  1SC7 A;  5LHG A;  1IUY A;  3ZMD A;  1IAW A;  1I1S A;  3CF2 A;  3CCS I;  5E20 A;  3M8J A;  1KYZ A;  4ZYA A;  2OF7 A;  3KP7 A;  3I59 B;  4IHT A;  2AHQ A;  2CH0 A;  2STW A;  3KFW X;  1ETQ A;  2DU9 A;  2MH9 A;  2KRH A;  3DEE A;  1MJB A;  5LGU A;  3F9K A;  2QBY A;  3D5R C;  1EH7 A;  3RPU A;  2C6Y A;  1SFX A;  2RV8 A;  1OCO H;  4QWQ A;  5M5Y J;  4FET A;  3IHU A;  4KJZ A;  4HNT A;  2R7V A;  5D6E A;  3V8L A;  2EBI A;  2A68 F;  4PJ0 C;  3H0G J;  4D9J A;  3CCM I;  4E70 A;  4WX9 A;  2H6C A;  4XBF A;  5EEA A;  3N05 A;  1FIP A;  2UUZ A;  1OCP A;  3RKQ A;  1IRG A;  2NS8 A;  3BJ6 A;  3ZR8 X;  3QAH A;  4XSZ F;  1PYV A;  5CQG A;  3FHN A;  2VKV A;  4I99 C;  2EIJ H;  2FQ3 A;  1NHA A;  3I9V 2;  1HSJ A;  4KIF A;  3FKJ A;  2ADU A;  4EM1 A;  4F3Q A;  4U7B A;  3OY9 A;  4DZP A;  2P7C B;  1RUN A;  4IHW A;  3TOA A;  4J01 A;  1VZ0 A;  2Z2S B;  1UEL B;  5J6X A;  4A12 A;  2O9L A;  4B09 A;  2VKD A;  3DPU A;  1HDP A;  1OLT A;  1VQ5 I;  1X58 A;  1WJ5 A;  1ZG1 A;  5LLQ A;  5ICC A;  1W5T A;  2CQN A;  3F22 A;  4ESB A;  2P4W A;  5EG0 B;  3OYE A;  1ZG5 A;  4Y4R A;  5DS9 A;  2CV2 A;  4HPQ A;  2L9V A;  4YFN F;  1YIT I;  2PX9 A;  4A2U A;  3J81 Z;  1KQ9 A;  2EFO A;  2GWR A;  2GAU A;  4JK1 X;  2KIU A;  4JYK A;  1QZY A;  2VBZ A;  1HW5 A;  3FXM A;  4KT5 C;  4LGW A;  2EZH A;  1X3Z B;  3IH4 A;  1WH7 A;  4OIR F;  3G1M A;  4PJN A;  3HHH A;  1QO0 D;  4RLQ A;  1YQA A;  5FFX A;  3ZN0 A;  3JTG A;  3LWF A;  2XF7 A;  2ZBK A;  2CG4 A;  2GXG A;  3HJE A;  2R92 J;  3ZXS A;  2W84 A;  1IV8 A;  3H9J A;  4JX4 A;  4MGR A;  3QYE A;  4L5E A;  4ANJ A;  2X6Y A;  4D0P A;  3COA C;  1A6Q A;  3E6M A;  4WF2 A;  5DM6 F;  3TED A;  4A3C J;  3OSF A;  5ILV A;  2DI3 A;  1IF1 A;  1YW9 A;  3CQZ J;  3BCA A;  2RC4 A;  3CC7 I;  3M1C A;  2K86 A;  4BHP A;  2HU9 A;  2IW5 A;  1W4M A;  3LAP A;  3PUB A;  3BG3 A;  4MQ9 F;  4KIT B;  1W36 D;  3AAF A;  2WBM A;  3S15 J;  4UVB A;  2EQR A;  1UHS A;  4YFK F;  3RKY A;  3LSP A;  4HF1 A;  4E6K G;  2FMY A;  2VI6 A;  3F6O A;  2KIM A;  5D6F A;  2PJP A;  1T33 A;  5M3F J;  3CC2 I;  3U21 A;  3LSK A;  3MCZ A;  1R1V A;  1QHG A;  2A05 A;  2K9Q A;  3D5S C;  3GFM A;  2DMP A;  1JGS A;  3G6E I;  1MGT A;  1U9O A;  1HOM A;  5J8F A;  2R5Z A;  3J7A O;  4LG3 A;  2K9L A;  1R6R A;  1HC8 A;  1G3W A;  4LLN A;  1OCZ H;  2L0K A;  4ABZ A;  2IRF G;  3TO7 A;  1RR7 A;  4D7N A;  1B8I B;  4IKF A;  2WA0 A;  2E71 A;  2JA5 J;  1T2K A;  3M8F A;  4Z2Y A;  2UXX A;  2LKS A;  5FLM J;  1QHH D;  3HDD A;  4KN7 X;  4XLC A;  3BJA A;  2M5W A;  1TWA J;  5F27 A;  1X1D A;  2YX7 A;  3DU5 A;  3B6C A;  3KZY A;  3LSI A;  3ONQ A;  3ZMU A;  3GO5 A;  2DMU A;  4XRS G;  1JE8 A;  1ETW A;  3I53 A;  4F91 B;  3K4B A;  4OAY A;  3HB9 A;  1M1E B;  2M7A A;  5M3M J;  2Y48 A;  4HLX A;  3JRA A;  3SEQ A;  4D5C A;  4WWC A;  4ENK A;  2JA6 J;  3A4C A;  4JX5 A;  4CSW A;  1JKQ C;  1TLH B;  2EZK A;  2I10 A;  1EV7 A;  2OZ6 A;  3BG6 A;  4Q5S F;  2MYS A;  3GF2 A;  3O6B B;  5HLG A;  1VF9 A;  1ZRD A;  3MKL A;  4UUT A;  5M5W J;  4IPA A;  4CZZ A;  1L3L A;  4KYW A;  3C18 A;  3QWL A;  3DTE A;  5CQE A;  2XV4 S;  5DCF A;  4ZDL A;  3I54 A;  2NVX J;  2A5W A;  4I98 B;  4D7M A;  4RB2 C;  4ZH4 F;  3H9G A;  3EUA A;  3VDX A;  3BQZ A;  1RI7 A;  2Z5U A;  5FJ8 J;  2MD5 A;  5LGN A;  1RR8 C;  1X1C A;  1FNN A;  4HX4 A;  2OA4 A;  3S14 J;  4QSH A;  3K70 C;  1ZLJ A;  2R5Y B;  2E5N A;  2E1C A;  3HXL A;  2CW0 F;  4ZJZ A;  3CUQ A;  5EGO A;  5KHD A;  2PLY A;  1DP7 P;  1NG7 A;  2I5U A;  4B8X A;  4A3D J;  1BM9 A;  2ECB A;  3OS2 A;  3TP3 A;  4ENM A;  4B44 A;  1RIO H;  3CZ6 A;  2XPW A;  4C2M J;  2M87 A;  3P9C A;  5K5Q A;  2IAI A;  3LFU A;  4NQW A;  1VQO I;  5HLI A;  1GVJ A;  3RPU D;  2L4M A;  1S7E A;  1STZ A;  3HKZ A;  2D1V A;  2IP2 A;  4A3F J;  1NK3 P;  1H9G A;  3S3M A;  1R5G A;  4HDV A;  1Y56 A;  5D5X B;  1SVL A;  4A6E A;  1B4A A;  4F93 B;  3BPX A;  4RGX A;  2M7B A;  4BL0 B;  4NHJ A;  4BKX A;  2OBP A;  2DAO A;  3KP6 A;  1X3U A;  2CUF A;  2F5C A;  2G7U A;  3QPS A;  3ZGK A;  2ME0 A;  1HXD A;  4X1E A;  4RB1 A;  1RUO A;  3Q5F A;  5D5V B;  2CU7 A;  2KZG A;  3GTP J;  4J00 A;  2IT0 A;  1SFO J;  3FIS A;  2QZ8 A;  2MSY A;  4CCK A;  5IT9 Z;  2VQH A;  5H6Q A;  3CTA A;  2ME6 A;  4HLY A;  2DCE A;  3RQI A;  1MNE A;  3W2W A;  5IP7 J;  3RYR A;  3IRR A;  4XLF A;  1P7J A;  4YG2 F;  3K6G A;  4CGZ A;  1N78 A;  1Y8Q B;  2ZSH B;  3KZI C;  1AKH A;  2UZK A;  4RAY A;  2E5Z A;  3CJR B;  5LEJ A;  5HVQ C;  1MH4 A;  4MNU A;  3E6C C;  2WY7 Q;  4MEX F;  1J9I A;  2JQ7 A;  2XRN A;  1BBY A;  5FRO A;  3FM5 A;  5LBQ A;  3DPL C;  1MBH A;  3HSR A;  2Y69 H;  2E1O A;  3BTL A;  1VQ7 I;  2DDB A;  5HS8 A;  4V2F A;  1ZRF A;  3KEQ A;  2M2E A;  2E2I J;  2XUB A;  3FXO A;  2QCO A;  5TGT A;  3V7R A;  2XHK A;  1RKT A;  1DUX C;  3C2G A;  3OYA A;  3VYS B;  3TDU C;  2KQR A;  3BTJ A;  4M3G A;  2KJC A;  3PM1 A;  4ETS A;  2PEX A;  3FX3 A;  3KP5 A;  2GA1 A;  3GTL J;  1RZ4 A;  1G3Y A;  1TT0 A;  2R3S A;  5DM7 F;  2IVM A;  2DXI A;  2CWE A;  4XLA A;  5F08 A;  2Y0S A;  1MMS A;  2J5O A;  2MFZ A;  4LG0 B;  1BA5 A;  4C3J J;  3WTV C;  1S72 I;  4A3L J;  1JT0 A;  1WJD A;  4YRV A;  5K7F A;  1LJ9 A;  1JUM A;  4OIN F;  5H2F C;  4JOM A;  5EDN A;  5E3O A;  4DBR A;  2A3S A;  2YPR A;  4U0V A;  3E97 A;  3QYB A;  2DOE A;  3HZJ A;  3ECO A;  3CLO A;  3R4K A;  1SMY F;  5LRS A;  2JRT A;  3KX2 A;  2KIS A;  2K02 A;  1QQI A;  2MGQ A;  2LFB A;  4B43 A;  1K4S A;  2JRM A;  4A0Y A;  5E18 F;  1TWC J;  3JRB A;  4UVC A;  3QU3 A;  2O7O A;  3T8T A;  2BVL A;  2ELJ A;  2HQA A;  1D3Y A;  2ZC2 A;  5JVG F;  1D5V A;  2V79 A;  2WAQ N;  1DPR A;  1WGX A;  3GTO J;  1YHQ I;  4NBQ A;  4N9H A;  4U88 A;  3BDD A;  4FAS D;  4YII A;  2MLK A;  1XGM A;  1YLF A;  3E6B A;  4B4C A;  2JZY A;  1Z3X A;  2WV0 A;  5F1R A;  2VUM J;  3K70 D;  4BXX J;  2E2H J;  3LL7 A;  3UKG A;  3ECH A;  1BJZ A;  4D1Q A;  2OV7 A;  1G3S A;  2FNA A;  1QA6 A;  3LSR A;  1ZAR A;  4YIF A;  2FNP A;  2DMQ A;  2HQ5 A;  2FE3 A;  2MBF A;  4I0B A;  3BTI A;  2R4G A;  1XN7 A;  3ZRG A;  2LK2 A;  4A3E J;  1ZAO A;  1MMD A;  4TV7 A;  4ZDP A;  1ERD A;  4C2T A;  2JA8 J;  3CUQ C;  4E7I A;  3KZZ A;  3OV8 A;  1R5I D;  4UB6 C;  3S8P A;  5GAE J;  4XKV A;  3WU2 C;  3GFI A;  1FBQ A;  2DFE A;  3KE2 A;  2HXI A;  4MTE A;  3HYI A;  1FBS A;  3MKZ A;  5D8L B;  5GTI C;  3S3O A;  1KU9 A;  1MDM B;  2F4M B;  1TT5 B;  2KT0 A;  2Q8K A;  3TW7 A;  2PMZ N;  3C3W A;  1S7O A;  2DJI A;  1ON1 A;  3GEZ A;  2P5L C;  3HPG A;  3SZG A;  3NQO A;  4LJZ F;  4ZYD A;  3BQY A;  2PBI A;  1ETV A;  4PUS A;  2R7U A;  1BC7 C;  3ERM A;  4Y17 A;  2NRA C;  2MA3 A;  2PQ8 A;  3I56 I;  1IRZ A;  2PN6 A;  4C3I J;  1T6S A;  4E7S A;  1JJ6 C;  3WE3 A;  1D1C A;  4IRG A;  3CDH A;  2W85 A;  1IC8 A;  1IJW C;  4A0X A;  3MKW B;  2VOO A;  1YJW I;  1QZE A;  3M9A A;  3NRV A;  1MKM A;  4XKB A;  3H3Z A;  2GOX B;  3D0S A;  3H35 A;  3I58 A;  4FT8 A;  3VB2 A;  4CO8 A;  3IKT A;  4FTH A;  4IXA A;  2QQ9 A;  5EZG A;  3VFZ A;  4HDU A;  2MG4 A;  4PJJ A;  1XD7 A;  2ZME C;  1VQ4 I;  4G12 A;  4BE2 A;  3EUK L;  1BJA A;  6PAX A;  4M71 A;  2LBF B;  4QIW N;  1K78 A;  2M8E A;  2CFX A;  1SAX A;  2OJE D;  1RPW A;  2FA5 A;  2HDW A;  4ITV A;  2QEX I;  1U8R A;  2IS1 A;  1GXP A;  4LFU A;  3DKX A;  2E60 A;  2DOA A;  4IX7 A;  2HNH A;  4ZTF A;  3JRF A;  3PFY A;  1Z77 A;  2E1N A;  3T5X A;  2EZI A;  3K4K A;  3I55 I;  1E2X A;  4C3H J;  1WJE A;  3BJO A;  3GLX A;  1HDD C;  3HOS A;  2KP6 A;  4PZJ A;  4U87 A;  4EJV A;  5M5X J;  1SMT A;  1ZGA A;  3U2R A;  1Z0X A;  4EV0 A;  4UV8 A;  3BZC A;  2PMH A;  5ICG A;  2ELK A;  3WGI A;  5E17 F;  2LKP A;  2W24 A;  2PMZ A;  1G8X A;  4I0A A;  4M6V A;  2NS7 A;  2TDX A;  1B1B A;  5HDN A;  4HNU A;  3HOW J;  4A3I J;  3JR9 A;  2VBY A;  2FU4 A;  1BIB A;  2DDA A;  2BEO A;  4Y15 A;  1JUP A;  4MQV A;  3DEU A;  4MO7 A;  1HCR A;  4DYR A;  2DOF A;  1VND A;  3CCL I;  1VQ6 I;  2F4I A;  2M45 A;  4GO1 A;  5CVI A;  3ABU A;  2H94 A;  5HDK A;  3HOU J;  5BPI A;  2TCT A;  2XSJ C;  3V8K A;  1LE8 A;  1GHC A;  3G1L A;  4Y7N J;  5LFA A;  1OFC X;  4DGW B;  3EPZ A;  4MFE A;  1TWF J;  1Y39 A;  1B9M A;  2VAS A;  1Z05 A;  4CYC B;  1XX5 A;  2NVU B;  3G3Z A;  3A01 B;  2DJN A;  4I7H A;  1ZHF A;  1W0T A;  1P4X A;  3RSN A;  1XMX A;  3F0C A;  4PSX A;  3DXJ F;  4B48 A;  1A5J A;  3FMQ A;  1MIJ A;  1P6R A;  3HL2 A;  2DO7 A;  1ZH5 A;  2VIX A;  2VC0 A;  3FZV A;  4FHT A;  3QP5 A;  3IRQ A;  2GOM A;  3K1M A;  3MWM A;  5DD8 A;  3DEW A;  2B0L A;  3DTI A;  3T0Y A;  2JN6 A;  3WOD F;  2XDV A;  2EK5 A;  2JVH A;  2L54 A;  1P2F A;  1QGP A;  2HZD A;  5F6F A;  2KDZ A;  9ANT A;  3DBH B;  4A3J J;  4MTD A;  1ZGJ A;  2R0Q C;  3CC4 I;  1LNW A;  1U2W A;  3GLL A;  1ZKG A;  4RM3 A;  4XOT A;  3CO7 C;  2VOP A;  3IH3 A;  2HYG D;  2V6C A;  4HAM A;  5D5W B;  3CCV I;  4AIK A;  2K7L A;  4M73 A;  3IV5 A;  1QBJ A;  3LA7 A;  3OMY A;  3QP6 A;  3FBN B;  2A69 F;  2J5P A;  4XRF A;  1ACI A;  1KYW A;  4DOZ A;  1OCC H;  4XL9 A;  1YO5 C;  1KQ0 A;  1DU0 A;  4BNC A;  1G3T A;  2G7H A;  5TIS C;  3MN2 A;  4DIQ A;  1SD4 A;  5KVR A;  3CP2 A;  1ZG3 A;  3RPQ A;  3H3V K;  2XAG A;  2R93 J;  3F8N A;  1R71 A;  1I3Q J;  4L9N A;  3MEX A;  1FYL A;  3DF8 A;  2B9S A;  4G6T B;  1Y1V J;  2L9R A;  2FJ1 A;  3DLA A;  1K6Y A;  4AID A;  5K5R A;  1FC3 A;  2ECC A;  5B1B H;  1R49 A;  2JUG A;  4ZC3 A;  1OIS A;  4L0Y B;  3WHC A;  4E4H A;  2HI3 A;  2KPM A;  1C0W A;  3B02 A;  2A6H F;  1S8N A;  1MJ9 A;  2HOE A;  2KHM A;  3IUO A;  3S1N J;  2X0L A;  4I2O A;  4CYD A;  1H0M A;  4G7H F;  4Q48 A;  3FXU A;  4FIS A;  4LG0 A;  1V5G A;  2V7F A;  3KPH A;  4H0E A;  1FTT A;  3W6K B;  3L2Q A;  4HA8 A;  1MBK A;  1X4P A;  2OQG A;  2FEZ A;  3G4S I;  4UNO A;  1RNL A;  4MLO A;  2ELH A;  2LC2 A;  4ENJ A;  1GV5 A;  5CVJ A;  5HS7 A;  3SZP A;  1YRN A;  3J7A Y;  4WCG A;  3PIO F;  2YR2 A;  3LNQ A;  2DPD A;  2HOS A;  1FTZ A;  2V1D A;  3QOD A;  2BHZ A;  3WTZ A;  4BJT A;  2EB7 A;  3HM5 A;  5FRN A;  2HKO A;  5B66 C;  1TWH J;  1V5F A;  3NWT A;  4CCN A;  2NVQ J;  1VTN C;  1VI0 A;  5F64 A;  2BW3 B;  2HOA A;  2XIG A;  4YIR X;  1QRY A;  4M3B A;  1WRJ A;  4U0Y A;  3U9G A;  3OYH A;  3BOQ A;  2LBF A;  4L18 B;  1OMI A;  4AC0 A;  5DUI A;  3OYK A;  1K61 A;  2VPR A;  2VON A;  4IL6 C;  4QPO A;  2O0Y A;  3VEP A;  3PO3 J;  3PNV A;  4BAY A;  2DQR A;  3B6A A;  4V2G A;  1B6A A;  2DMT A;  2W25 A;  4UHT A;  2XPU A;  1IDZ A;  1IN7 A;  1W5C C;  3I4N J;  1BOB A;  2XB5 A;  1Z7U A;  1BI0 A;  2FOW A;  3OYG A;  3GFJ A;  1AKH B;  1JJ8 C;  2B63 J;  2N8G A;  3ZQC A;  4OWR B;  4RMN A;  2KZV A;  5D4R A;  2ZJR F;  1I1G A;  3HOZ J;  3R61 A;  1ZQ3 P;  1UFM A;  1YS7 A;  1ZYR F;  3BG7 A;  1XDS A;  3CCU I;  1O7F A;  2O3F A;  2UWM A;  2VXD A;  3V4G A;  2E2J J;  4LB5 A;  1D0Z A;  4NUB A;  1U6G A;  3ABM H;  4AVP A;  3CO6 C;  3HRU A;  3EQL F;  2X1D A;  4CCO A;  1BR2 A;  1SVM A;  5C4X J;  1ITY A;  1SD5 A;  1U9N A;  1OCT C;  5IP6 A;  2BXZ A;  2NVY J;  3L00 A;  1ZRC A;  3NAR A;  2XSD C;  4BQN A;  2G0E A;  3RZD J;  1JT6 A;  1S7A A;  1MD0 A;  1RKW A;  5E1X A;  2VBX A;  3BLY A;  4CIC A;  1BW5 A;  1GVD A;  3L1P A;  4L5I A;  1EH6 A;  4R79 A;  1GDT A;  4A0Z A;  3K0L A;  3S93 A;  2HDC A;  2ZJP F;  2QGU A;  1IDY A;  1GXQ A;  2KMU A;  2V9P A;  5TRD A;  1V4R A;  1Q1H A;  3CMM A;  4BY7 J;  1ZN2 A;  3ZP5 A;  4JBA A;  2LF7 A;  2FQ4 A;  2BYV E;  4LD5 A;  4N4O B;  1N75 A;  3OYD A;  1A35 A;  3I4M J;  2FUG 2;  4QTR A;  2L5Q A;  3BWG A;  1EJ9 A;  2DT6 A;  5E79 C;  2P8T A;  3ZMT A;  2A6E F;  2DW4 A;  1WZ2 A;  4G6Q A;  2CUJ A;  4ZTJ A;  3ROU A;  2ZXH A;  4EQQ A;  3PQK A;  3DPT A;  2HDD A;  1FWZ A;  4BYY A;  4M74 A;  3DV8 A;  2M8G X;  3Q9V A;  2H1K A;  2NOG A;  1U5T A;  2K3F A;  2X48 A;  3MAJ A;  3R0A A;  4I01 A;  1F1Z A;  4KDP A;  1CGP A;  1HW1 A;  3JSO A;  2CV0 A;  2P7V B;  1VFC A;  1LQ1 A;  3TGN A;  4KUM A;  1BOA A;  2R7R A;  2BOL A;  4BUP A;  2LDU A;  4OIQ F;  2FOK A;  5J4Y A;  3FM3 A;  2GM4 A;  3ZPL A;  4BBR J;  3BR0 A;  1S29 A;  3I64 A;  5ERI A;  4M6Y A;  2R7Z J;  3OYB A;  2LSO A;  2VE9 A;  3N4M A;  2Z33 A;  2VC1 A;  3HGG A;  3E1S A;  3IWF A;  3QYF A;  3RKW A;  2VB6 A;  1FYM A;  2GIZ A;  4IO9 F;  2XPV A;  4IOA F;  4P9F A;  4KN4 X;  2D1H A;  2LMD A;  5CVR A;  3VSL A;  3QRF F;  2Y2Z A;  3R6S A;  2HWV A;  2WAF A;  5GAH J;  4FQG A;  5IYD J;  1LFB A;  4JQF A;  1SVO A;  2LH9 A;  2HPI A;  4P5O A;  3ZMZ A;  4B3A A;  4F55 A;  1Z91 A;  4BHC A;  3PSF A;  2QVO A;  4BXU A;  3W3C A;  5EJC A;  2XC7 A;  3I0T A;  1ENH A;  4BE0 A;  2V6E A;  5DCM A;  1FEX A;  2ESN A;  3KEY A;  3JAM Z;  2VKH A;  3SZT A;  2KRC A;  1XGS A;  3K7A J;  1IZ1 A;  2EIL H;  4U0W A;  5KCM A;  3SEZ A;  3F8C A;  3OOP A;  3SJM A;  1N25 A;  5B5E C;  2UV1 A;  3A2K A;  2IS4 A;  1MBF A;  1Z7L A;  1R22 A;  2H27 A;  1XTA A;  2LRD A;  2L9S A;  4G6D A;  1WJB A;  3G2B A;  2Q2E A;  1EF4 A;  3H1C A;  3PNY A;  3FBI B;  1Y0U A;  2LY2 A;  2X6O A;  4RGU A;  1PUE E;  5FLV A;  2HS5 A;  2MW8 A;  2KRF A;  5AIQ A;  2P5K A;  3GFL A;  4II2 A;  2HQN A;  2STT A;  2VJ4 A;  4H4K C;  1YE9 A;  5BMZ A;  1UB9 A;  3D1N I;  3C2B A;  2VT3 A;  2A5Y B;  1KU7 A;  4ON0 A;  3HKZ N;  2O5R A;  2E34 A;  3L7W A;  2VOD A;  3P7N A;  1ULY A;  2ZKZ A;  4Y13 A;  4WXH A;  1MBG A;  1R36 A;  3SHF A;  2QKM B;  4XOP A;  5FRM A;  3N97 A;  1XC5 A;  2DLL A;  3E0J B;  1MMN A;  3GTG J;  3KEO A;  3OYN A;  2H6B A;  1IXS B;  2CMP A;  4DBQ A;  2JA7 J;  1JKO C;  1R4M B;  2KKO A;  1B9N A;  5EZH A;  2V1U A;  1PUF A;  2B7E A;  2P6T A;  5B1A H;  2CGP A;  2Y0M A;  1UJ8 A;  2L3D A;  2AQE A;  2ZME A;  3K9T A;  3WU0 A;  3GZ6 A;  3OS0 A;  1WI3 A;  3OYL A;  2V9V A;  2X85 A;  4II3 A;  2M1B A;  4NB5 A;  2E35 A;  1XSX A;  4E7K A;  1ZRE A;  2EFW A;  2CW8 A;  1Z1D A;  1W1W E;  5IOY A;  1ZEL A;  1L0O C;  3ZOB A;  1WQ2 A;  1H88 C;  2OU2 A;  2PJR B;  2XGD A;  1A36 A;  4U7D A;  2Z16 A;  2QA4 I;  4FX0 A;  3S2H J;  3FHZ A;  2MD0 A;  1DP3 A;  1K83 J;  3DCF A;  2WC2 A;  4BDY A;  3DBL B;  4ZYH A;  3TO9 A;  4KNY A;  2FBK A;  2X1E A;  3JCU C;  3F23 A;  1LDK B;  5H20 A;  5KNL A;  3OSG A;  4ENN A;  2ZNZ A;  2ID3 A;  2E36 A;  5A2Q Z;  2NOJ B;  2CQQ A;  2CJJ A;  1JTX A;  4XK4 A;  5FKK A;  2IA1 A;  5AON A;  3ZN1 A;  4AWX B;  3J7Z I;  5J8C A;  5E8I A;  3K10 A;  1R1T A;  4M72 A;  5JHU A;  3DKY A;  1AA7 A;  2DN0 A;  2PFB A;  2VT2 A;  3EYY A;  2R7T A;  4A6D A;  2L7Z A;  2O8K A;  2XAS A;  1ETX A;  2BV6 A;  2XAQ A;  1ETO A;  2TRT A;  4A3G J;  2XRO A;  4BDZ A;  3AL0 C;  4YEL A;  4HX8 A;  1N77 A;  3HIF A;  5FO5 A;  2W57 A;  3H5N A;  4Q47 A;  1F36 A;  2ZME B;  1V54 H;  3FXK A;  2DA2 A;  1K78 B;  2O03 A;  1NH3 A;  3H5R A;  4CXF A;  1HST A;  2XGC A;  2R7D A;  2BXY A;  3H0D A;  3GYH X;  2V4J C;  4O5V A;  1BL0 A;  2Q1Z B;  4I09 A;  2AXL A;  3DU6 A;  2RKH A;  1PVE A;  3D5L A;  3PQJ A;  2F5E A;  4P96 A;  1DGR M;  1IG7 A;  5HLH A;  1J75 A;  3RI4 A;  1IRF A;  1YJ9 I;  2X9D A;  1SAN A;  1T0F C;  4ESJ A;  3F8F A;  5ICF A;  4UUS A;  4E7L A;  2Q0O A;  1X4O A;  4KMF A;  3S3N A;  4NC8 A;  1VQ8 I;  2L7M P;  1IN4 A;  1UZC A;  3AG4 H;  1FOX A;  3TMO A;  3SXY A;  1OYW A;  3PIP F;  1PP7 U;  1J7K A;  1R00 A;  2QQ8 A;  2XVC A;  4M3E A;  1PJR A;  4ZZL A;  4XLE A;  4HQE A;  4A3B J;  5CKT A;  1TP4 A;  2FSW A;  2YUS A;  3AL0 B;  3LA2 A;  1NK2 P;  2QWW A;  3ESW B;  2OPT A;  4A69 C;  1MBJ A;  2YX4 A;  4IEJ A;  3K2Z A;  3KET A;  2YU3 A;  5GPC A;  4ZDO A;  3JTH A;  2QSH X;  1K79 A;  2OTL I;  4A93 J;  1V5E A;  3A0H C;  3TOB A;  1XDU A;  3FIW A;  4IVN A;  3RKX A;  3BG9 A;  5DD4 A;  2DYR H;  1FT9 A;  2BGC A;  4N9I A;  4BE1 A;  3CJT B;  3S16 J;  1F9N A;  3KCC A;  3WU1 B;  1QVT A;  1SFE A;  1HA8 A;  2CO5 A;  3HTU A;  2HVS A;  4PJL A;  1GLN A;  3JRH A;  2LLK A;  4X0G A;  2FML A;  2FX0 A;  1A6I A;  4BJ6 C;  5L3F A;  2DK5 A;  2GIV A;  1Z67 A;  4AU7 A;  1J5Y A;  1ZLK A;  4IF4 A;  2RQQ A;  1OYI A;  1FPQ A;  1O57 A;  3CMY A;  4XN0 A;  1IUF A;  5C44 J;  1OR7 A;  4BY1 J;  2MH2 A;  5GAD J;  3ZQL A;  1XGN A;  2EV6 A;  4KFC A;  2JJ7 A;  3GTQ J;  4RM2 A;  2RQP A;  1FJL A;  2QQA A;  1J0R A;  5EYR A;  4RAF A;  1BN5 A;  3MQ0 A;  2XGX A;  3A1Y A;  1MND A;  5JLX A;  4EJW A;  1YYV A;  1H89 C;  1ZTR A;  1DDN A;  1IRX A;  3DBR B;  5LEK A;  4ZYG A;  1ON2 A;  1KON A;  5HOD A;  5TJJ A;  1MSF C;  1D0X A;  1JKR C;  1U5T B;  2LVS A;  2VQL A;  3H3U A;  2ZB9 A;  3CCY A;  4HOB A;  4WXD A;  3TW6 A;  1ETY A;  4G7O F;  2L7F P;  1E17 A;  4CH7 A;  1G2H A;  1MSE C;  2Z1D A;  1YS6 A;  1R9T J;  4M9S A;  1B59 A;  3GZ5 A;  5IOZ A;  4PK4 A;  1DPU A;  2M9H A;  1E3H A;  1W36 C;  1A04 A;  5J1Y A;  1WJA A;  1TQI A;  2VE8 A;  1QPI A;  5BQT A;  1EKE A;  1TQP A;  3CJN A;  3NAU A;  4AYB A;  1DU6 A;  2HVQ A;  4KIS A;  1XS9 A;  5C4J J;  5FKO A;  1V55 H;  3CCQ I;  1SFK A;  2E1M B;  3U1K A;  2JK3 A;  1U3E M;  2WB1 N;  5C3E J;  2NAZ A;  3S2W A;  2IEK A;  1U0J A;  2KLO A;  1X1B A;  1IN8 A;  2LKX A;  1D1A A;  2YSR A;  3OOU A;  1A31 A;  3IKV A;  2GQQ A;  2ZNY A;  5KAI C;  4CDG A;  1XMA A;  3ML6 A;  2YS9 A;  2KIQ A;  1Z6T A;  4ZZD A;  4PGH A;  4Z6Y A;  1QPM A;  2HPM A;  1XCV A;  4G8X A;  1QZZ A;  2OAZ A;  2D2W A;  3A02 A;  4E7J A;  3QQA A;  3AFH A;  4G9Y A;  3P5J A;  2X4H A;  3G73 A;  3HTS B;  3VYU B;  4PSW A;  1P4W A;  2COB A;  5J40 A;  2K4J A;  2KL4 A;  2LG4 A;  4BEH B;  3Q3S A;  5DYM A;  2EH3 A;  1JHH A;  4XIC A;  3AG2 H;  4Q4Z F;  2A61 A;  3JW4 A;  3T8R A;  2IGO A;  1D8J A;  5D5U B;  1TWG J;  3DKW A;  1PP8 F;  1HBX G;  1O3T A;  1TC3 C;  2A6T A;  1TQM A;  4M9X A;  1GV2 A;  5E3M A;  1OR7 C;  2L4A A;  2P81 A;  4CCJ A;  5ICE A;  1R58 A;  3CF5 F;  3M07 A;  3ELK A;  2V26 A;  3PFI A;  2VLA A;  1P9Q C;  3JSP A;  5L3D A;  2K9M A;  4PDK A;  4I6Z A;  2M0C A;  1MJA A;  4BHB A;  4RB3 C;  1I6H J;  2NNY A;  4A5M A;  2HYJ A;  2BVM A;  3WTU C;  1S3J A;  1ZK8 A;  3BZ6 A;  4HRI A;  2OCE A;  3F8M A;  5EEG A;  4P9U A;  2DT5 A;  2FXA A;  4NQW B;  4XLP F;  5E3L A;  4J19 A;  1UAA A;  1T95 A;  1DGW Y;  2P5V A;  1XMK A;  2WB1 A;  1BR1 A;  2FBI A;  2H8W A;  5J1R A;  3EDP A;  4BGD A;  1D5Y A;  4PFO A;  4G94 A;  3ZQH A;  2Z3Y A;  4CYC A;  3L09 A;  1IN6 A;  4HBL A;  5HDG A;  2H09 A;  2EFN A;  1TBX A;  2IGN A;  4JP0 A;  3V7S A;  4KA4 A;  4AM3 A;  5CVU A;  4RA2 A;  2W1O A;  1Y6I A;  4XOR A;  1EA3 A;  3J7Y J;  4EAT A;  5LHH A;  3CUQ B;  3VYR B;  5EGO B;  1RET A;  1SD7 A;  2DFF A;  2L2O A;  2DOD A;  1TNS A;  2CYY A;  1K4T A; 
#chains in the Genus database with same CATH homology
 4M3D A;  4B1R A;  4W97 A;  1IDY A;  4BKX A;  1HLV A;  2NVT J;  2CUF A;  1Q1V A;  3QPS A;  4BY7 J;  2ME0 A;  4X1E A;  5FKN A;  5FKL A;  3FK7 A;  2FQ4 A;  2CU7 A;  3GTP J;  1WH5 A;  3FIS A;  2WV1 A;  1SFO J;  2MSY A;  2EZL A;  3CDL A;  3I4M J;  1APL C;  2ME6 A;  3RQI A;  4QTR A;  5IP7 J;  3SDG A;  1GT0 C;  1U78 A;  1MNM C;  1I50 J;  1P7J A;  1PUF B;  3Q0W A;  3BTC A;  2DA4 A;  2LR8 A;  3M3Y J;  1AKH A;  2FD5 A;  2HDD A;  3ZQF A;  1WCM J;  4RDU A;  4JX6 A;  3G1O A;  2M8G X;  2Y9Z A;  2H1K A;  2NOG A;  2X48 A;  1MH4 A;  1BW6 A;  4FE4 A;  1VFC A;  2W48 A;  1JTY A;  3OIO A;  4M3F A;  2GM4 A;  1MBH A;  2JMW A;  3BR5 A;  4BBR J;  1B8I A;  2GBY A;  2E1O A;  3BTL A;  3BR0 A;  4V2F A;  1LFU P;  2R7Z J;  3HEF A;  2M2E A;  2E2I J;  2AO9 A;  5F0C A;  2QCO A;  1RKT A;  3HGG A;  4S0H B;  3BTJ A;  4DYQ A;  4M3G A;  2QF7 A;  3PM1 A;  1CQT A;  3Q0V A;  2XPV A;  3JRI A;  3GTL J;  3WHB A;  2Y2Z A;  3A03 A;  5F08 A;  1UMQ A;  1O4X A;  5IYD J;  1BA5 A;  4C3J J;  1AHD P;  1LFB A;  4A3L J;  1JT0 A;  3O8H A;  5K7F A;  1T56 A;  1JUM A;  4FE7 A;  5EDN A;  3E7L A;  5E3O A;  1ZR4 A;  4A3K J;  1ZGW A;  2IBD A;  3S17 J;  2Y0S N;  4B3A A;  1JKP C;  5JLW A;  3SFI A;  5EG0 A;  3GTM J;  2MGQ A;  2LFB A;  3BR2 A;  1ENH A;  5BNG A;  1W0U A;  1X2N A;  2Y30 A;  1FEX A;  2XB0 X;  1TWC J;  3JRB A;  3K7A J;  2O7O A;  3BT9 A;  3SJM A;  2DA3 A;  1B72 A;  2WAQ N;  1WGX A;  5IP9 J;  3GTO J;  3HOV J;  1MBF A;  1YRN B;  1U8B A;  1H8A C;  3S2D J;  5F0H A;  5IPA A;  3JRG A;  1EF4 A;  4B4C A;  3S1R J;  2X6O A;  1WPK A;  5FLV A;  1UG2 A;  2MW8 A;  3MVP A;  2VUM J;  3HOY J;  4EEF G;  4BXX J;  1X2M A;  2E2H J;  3D1N I;  3UKG A;  2CUE A;  1BJZ A;  3C2B A;  3LSR A;  1ZR2 A;  1ORK A;  2DMQ A;  3HKZ N;  2HQ5 A;  5GPA A;  3BTI A;  2LK2 A;  4IHX A;  4A3E J;  3TP0 A;  1ETK A;  2GLO A;  1MBG A;  2JA8 J;  3GTG J;  1XC5 A;  2XGE A;  5K7H A;  1FIA A;  2JA7 J;  4NDL A;  1JKO C;  3PO2 J;  1JUS A;  2HXI A;  3Q0U A;  4MFD A;  4MIM A;  5EZH A;  1MBE A;  5EF6 A;  1PUF A;  2KT0 A;  2DA5 A;  1JGG A;  2CQX A;  3O8G A;  3TW7 A;  2PMZ N;  4RBO A;  3ZQG A;  4A3M J;  2RAE A;  1WI3 A;  1GUU A;  3BQY A;  1ETV A;  1F43 A;  1IRZ A;  3HGY A;  2DA7 A;  1QVU A;  5IOY A;  4C3I J;  3ZOB A;  3S1Q J;  1H88 C;  1JJ6 C;  4D5F A;  2XGD A;  3S2H J;  1IC8 A;  5IYC J;  1IJW C;  2D5V A;  1K83 J;  3DCF A;  1P7I A;  1MH3 A;  3M4O J;  2YU9 J;  4FTH A;  2CRG A;  5EZG A;  4UUS B;  3FK6 A;  2MG4 A;  2HXO A;  3BG5 A;  3QPL A;  3OSG A;  4GFB A;  2ID3 A;  2CQQ A;  4G12 A;  2CJJ A;  1RES A;  1JTX A;  4XK4 A;  5FKK A;  2VKE A;  2LD5 A;  4QIW N;  1AU7 A;  2OF7 A;  2DN0 A;  1RPW A;  2AHQ A;  2LP0 A;  1ETQ A;  2L7Z A;  2O8K A;  1ETX A;  1POG A;  1ETO A;  2TRT A;  4A3G J;  3JRF A;  3BR3 A;  1Z77 A;  5M5Y J;  1F36 A;  2EZI A;  2DA2 A;  5E3N A;  2EBI A;  2XGC A;  3H0G J;  4C3H J;  1BL0 A;  1HDD C;  5M5X J;  5EEA A;  1Z0X A;  1FIP A;  2K9S A;  1OCP A;  3RKQ A;  3ZQI A;  2ELK A;  3LSG A;  1IG7 A;  3VPR A;  2NS8 A;  2X9D A;  4M6V A;  2NS7 A;  1SAN A;  3W6V A;  2VKV A;  3HOW J;  4UUS A;  4A3I J;  3JR9 A;  2L7M P;  2DMN A;  2Y31 A;  3JRE A;  4DZP A;  4IHW A;  1JUP A;  4MO7 A;  1IV6 A;  2O9L A;  1HCR A;  4M3E A;  4DYR A;  4DZJ A;  1VND A;  4A3B J;  1HDP A;  2YUS A;  1NK2 P;  1X58 A;  3HOU J;  2TCT A;  2OPT A;  1LE8 A;  4A69 C;  3G1L A;  4Y7N J;  1MBJ A;  4IEJ A;  1OFC X;  4MFE A;  5GPC A;  1TWF J;  5EG0 B;  5J1U A;  2DTZ A;  4CYC B;  4HNV A;  4A93 J;  1Y1W J;  4AUX A;  5DS9 A;  3A01 B;  2DJN A;  3FIW A;  1W0T A;  3BG9 A;  3BR6 A;  3F0C A;  1A5J A;  1E3O C;  3S16 J;  1QVT A;  4JYK A;  3RZO J;  2H8R A;  2EZH A;  3IH4 A;  3JRH A;  1WH7 A;  2LLK A;  3DEW A;  3G1M A;  2FX0 A;  1A6I A;  2JN6 A;  2M34 A;  2R92 J;  3K2A A;  3GBG A;  3JRC A;  2KDZ A;  3CMY A;  4JX4 A;  4FCY A;  9ANT A;  4L5E A;  4A3J J;  1IUF A;  5C44 J;  2R0Q C;  4BY1 J;  3TED A;  3ZQL A;  3GTQ J;  2JJ7 A;  4A3C J;  1ZKG A;  2Y9Y A;  3OSF A;  1B72 B;  1FJL A;  3IH3 A;  5EYR A;  3HBL A;  2DA6 A;  2LTP A;  2XRL A;  3CQZ J;  3IV5 A;  5J3L A;  3IH2 A;  2K40 A;  5JLX A;  1H89 C;  1ZTR A;  4XRM A;  1DU0 A;  3BG3 A;  5HOD A;  4IHV A;  1MSF C;  4XID A;  1JKR C;  3MN2 A;  3S15 J;  2EQR A;  2LVS A;  1UHS A;  2ZB9 A;  3CCY A;  3TW6 A;  3LSP A;  2JWT A;  1ETY A;  3H3V K;  2L7F P;  2R93 J;  2VI6 A;  1I3Q J;  4DW6 A;  1G2H A;  1MSE C;  4I76 A;  1T33 A;  1Y1V J;  2L9R A;  2FJ1 A;  5M3F J;  2E19 A;  2ECC A;  2K9Q A;  1R9T J;  5IOZ A;  2DMP A;  2M9H A;  1U9O A;  3WHC A;  2HI3 A;  5IYB J;  5J1Y A;  1HOM A;  2R5Z A;  4BBS J;  1QPI A;  5K7Z A;  3NAU A;  1DU6 A;  2HOT A;  1XS9 A;  5C4J J;  3S1N J;  3JRD A;  3HOX J;  2L0K A;  5FKO A;  4ABZ A;  1RR7 A;  4FIS A;  2JK3 A;  4D7N A;  2WB1 N;  1B8I B;  5C3E J;  2IEK A;  2JA5 J;  1FTT A;  2LKX A;  1MBK A;  4IHY A;  3OOU A;  2R5Z B;  5FLM J;  3HDD A;  4MLO A;  3GTJ J;  1GV5 A;  1YRN A;  1TWA J;  1XG1 A;  2YS9 A;  5F27 A;  3B6C A;  3LOC A;  4Y52 J;  2DMU A;  3A01 A;  4XRS G;  3LNQ A;  2HOS A;  1ETW A;  1FTZ A;  3HB9 A;  3LSJ A;  3HM5 A;  5M3M J;  3A02 A;  5FKM A;  3JRA A;  1TWH J;  3QQA A;  4AYB N;  4D5C A;  2NVQ J;  1NTC A;  1VI0 A;  5DTD A;  2JA6 J;  2HOA A;  1QRY A;  4JX5 A;  4M3B A;  1JKQ C;  2COB A;  2EZK A;  2I10 A;  3Q3S A;  4AC0 A;  2EH3 A;  1K61 A;  2VPR A;  1VF9 A;  3MKL A;  4XIC A;  1LE8 B;  3PO3 J;  4UUT A;  5M5W J;  3B6A A;  4V2G A;  2DMT A;  1IDZ A;  5F0F A;  2XPU A;  1TWG J;  2ID6 A;  4W1U A;  1TC3 C;  3I4N J;  2R5Y A;  2XB5 A;  2NVX J;  1AKH B;  2B63 J;  1GV2 A;  4D7M A;  5E3M A;  1JJ8 C;  4X6A J;  2N8G A;  3ZQC A;  2P81 A;  1HF0 A;  3BQZ A;  4DYC A;  1IGN A;  5FJ8 J;  5GP9 A;  3HOZ J;  1ZQ3 P;  4I6Z A;  3S14 J;  2M0C A;  4QSH A;  1I6H J;  5F04 A;  2HYJ A;  2R5Y B;  1ZK8 A;  5EGO A;  2E2J J;  4A3D J;  3FKI J;  5E3L A;  4J19 A;  1OJL A;  2ECB A;  3TP3 A;  3BR1 A;  2DA1 A;  5C4X J;  2LY9 A;  5J1R A;  1U9N A;  2XPW A;  4C2M J;  1ITY A;  1OCT C;  5IP6 A;  4XRS A;  2NVY J;  1D5Y A;  3GTK J;  3S1M J;  3ZQH A;  4CYC A;  2IAI A;  3NAR A;  5F1J A;  2XSD C;  2G0E A;  2K9N A;  3RZD J;  1JT6 A;  4LOC A;  1RKW A;  4JP0 A;  1S7E A;  1BW5 A;  1GVD A;  4A3F J;  1NK3 P;  3L1P A;  5EGO B;  1GDT A;  1RET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...