2PMZN

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 7
structure length 64
sequence length 64
chains with identical sequence Y
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2pmzN00
1X2NA 3M3YJ 2DTZA 2CQQA 5IYDJ 3JRHA 5FKOA 4A3BJ 1ETXA 1IDZA 4XRMA 1FTTA 2M2EA 3O8GA 1ETQA 2ZB9A 1WH5A 4M3DA 4IHYA 3GTPJ 3RKQA 2K9QA 1TWHJ 1WCMJ 2QF7A 3CQZJ 3E7LA 2L9RA 3NARA 1H88C 1ITYA 5M3MJ 4I76A 5E3OA 3CMYA 4L5EA 1X2MA 1W0UA 1T33A 5M5WJ 2DMUA 2R92J 3JRBA 2JA5J 3S17J 2XSDC 2H8RA 1P7JA 2M9HA 1QPIA 3HOXJ 5M3FJ 2R5ZA 4C3IJ 3S15J 4C3JJ 1B8IB 5K7HA 1ZQ3P 2EZLA 2WAQN 4W97A 1MNMC 2KT0A 1I3QJ 2JK3A 4D5CA 4A3CJ 1HDPA 1UMQA 4Y52J 3OSFA 4LOCA 1GDTA 1E3OC 1BJZA 1I6HJ 5J1YA 2LK2A 1ZGWA 2EZIA 3JRDA 1LE8A 1QVTA 1XS9A 3FK7A 1JUSA 1OCTC 2HOTA 2XB0X 2NS8A 3A03A 5C44J 1R9TJ 3BR2A 3TW6A 1D5YA 1B72A 1FIAA 4A3DJ 2Y9ZA 2XPVA 3MVPA 3A01B 1ZR2A 3JREA 5J1UA 4QTRA 1APLC 2AO9A 5F1JA 2HYJA 3BG5A 2GM4A 1XC5A 4JYKA 1ETYA 4M6VA 5FKLA 2O7OA 4CYCB 5BNGA 5EGOA 4BY7J 3LNQA 1TWAJ 2Y2ZA 1VF9A 1GV2A 2LR8A 3ZQFA 4MIMA 5F0FA 1MH4A 4DYRA 3SFIA 1W0TA 1ETKA 1MSFC 2EH3A 1ETVA 5DS9A 4B1RA 3F0CA 4XRSA 5IYBJ 1JGGA 2JA6J 1UHSA 2M8GX 1XG1A 2E2IJ 2DA7A 2QCOA 2R7ZJ 3IH3A 1ZTRA 3LSGA 2FQ4A 1DU6A 1Y1WJ 4JX5A 5EZGA 3S16J 4MFDA 5IYCJ 1HLVA 1VNDA 1WH7A 5IP6A 2LD5A 2DA6A 4DZPA 4B4CA 1AU7A 3S1RJ 5EYRA 1ENHA 4MLOA 3BTIA 3HBLA 5K7FA 5FKNA 2IBDA 4JX6A 1JJ6C 4X1EA 1VI0A 2XPWA 5C4JJ 1MBHA 5FLVA 2MGQA 1PUFA 4C2MJ 1RPWA 1ETWA 2K9SA 4XRSG 3I4MJ 3S1NJ 1A5JA 3GTKJ 4BXXJ 5F08A 4EEFG 2VI6A 2E1OA 2WB1N 3TP0A 4M3GA 1JT0A 3BG3A 1IV6A 2MW8A 4XIDA 3GTQJ 1JTYA 3HKZN 1MSEC 5FJ8J 2L7ZA 4DW6A 5JLWA 4A3LJ 3DEWA 2L7FP 1Q1VA 2DMPA 3IH4A 5J3LA 2CQXA 5F27A 2R5YB 1IUFA 4M3FA 2JMWA 4FCYA 3DCFA 4A69C 3LSRA 1Y1VJ 3VPRA 1JJ8C 1I50J 1IC8A 3HEFA 2TCTA 1B72B 2MSYA 3HGGA 1TWCJ 2Y9YA 3BQYA 5IOYA 1U9NA 3ZOBA 3W6VA 2H1KA 3JR9A 2YU9J 4QSHA 1HOMA 2HI3A 2E19A 2FJ1A 1IRZA 1ZR4A 4FE4A 3IV5A 1P7IA 3BR3A 4V2GA 3ZQHA 5E3LA 4IHXA 5F0CA 1IDYA 2M34A 3SDGA 3CDLA 1RETA 3A02A 3OOUA 5IP7J 3BR1A 2O8KA 3S1MJ 2G0EA 5DTDA 1O4XA 2VKEA 1FEXA 2Y0SN 3FIWA 5C4XJ 4V2FA 2JN6A 4D7MA 1MBKA 4QIWN 1JKOC 1IG7A 1ORKA 3BR6A 2MG4A 4A3EJ 3GTGJ 2AHQA 1WPKA 2P81A 5FKMA 1WGXA 5E3NA 4AC0A 1EF4A 1QRYA 3GTLJ 3ZQLA 3K7AJ 2LLKA 5EG0A 3LOCA 3GBGA 3I4NJ 3D1NI 2JJ7A 2X48A 2LP0A 3BTCA 2LY9A 5EEAA 4HNVA 3BQZA 1OJLA 1OCPA 2DJNA 2EZKA 3MKLA 1PUFB 2D5VA 1MBFA 1LFUP 3HOYJ 4M3EA 2JA7J 3B6AA 4DYQA 2E2HJ 1H8AC 2TRTA 4FISA 3BTLA 5IOZA 2YUSA 3JRAA 2DMTA 3C2BA 3GTMJ 1G2HA 2XGDA 1B8IA 2HQ5A 2DA4A 3FK6A 5HODA 4IHVA 3HGYA 3RZDJ 2L0KA 1JUPA 2HDDA 1HF0A 2PMZN 4NDLA 3OIOA 4A3IJ 3LSJA 2RAEA 4FTHA 4RDUA 1BW5A 1JUMA 1HCRA 4G12A 5F0HA 2NVQJ 2LFBA 1IGNA 3CCYA 1MH3A 1SFOJ 5JLXA 9ANTA 1FTZA 3WHBA 2HXIA 2R5ZB 2CUEA 2EBIA 4BY1J 2EZHA 1POGA 2JA8J 5M5YJ 4AUXA 1RR7A 4M3BA 4RBOA 1CQTA 3GTOJ 1ZKGA 2DMNA 2M0CA 5K7ZA 2HOAA 5FKKA 3H0GJ 3FISA 2VKVA 5GPAA 1ETOA 2LTPA 2NVTJ 1YRNA 2K40A 3ZQCA 4BKXA 4A3FJ 1IJWC 1NK3P 2XRLA 3PM1A 1GT0C 1LE8B 2OF7A 3QPLA 3WHCA 1JTXA 3MN2A 2DMQA 4UUSA 5M5XJ 3O8HA 5EZHA 3JRFA 4IEJA 1BL0A 2XPUA 3Q3SA 2ME0A 3BG9A 4MO7A 2EQRA 2VPRA 4A3GJ 3B6CA 1GV5A 2R93J 2NVXJ 1S7EA 5IP9J 1A6IA 1RKTA 3K2AA 3TW7A 5EG0B 5EGOB 4UUTA 2NVYJ 4S0HB 1RKWA 4B3AA 4BBRJ 3QPSA 1AKHA 4X6AJ 3JRIA 2XB5A 3HOWJ 5E3MA 4I6ZA 2ID6A 1Z77A 3GTJJ 1BW6A 3SJMA 2YS9A 3S14J 1ZK8A 3S1QJ 3HB9A 3BR0A 1RESA 3BTJA 3NAUA 4ABZA 4AYBN 4A93J 3M4OJ 2I10A 3FKIJ 1JT6A 3G1MA 2X6OA 3Q0VA 4GFBA 3UKGA 1DU0A 1K83J 5F04A 3HOUJ 3IH2A 1WI3A 1JKQC 5GPCA 1K61A 2XGCA 4C3HJ 5J1RA 1NK2P 1TWGJ 1UG2A 3H3VK 1OFCX 1NTCA 5IPAA 2CUFA 1T56A 3RQIA 3L1PA 4A3MJ 2E2JJ 3S2DJ 2HXOA 1JKPC 1GVDA 2K9NA 3HM5A 2R0QC 2FD5A 1U78A 1MBEA 2NOGA 2DA3A 3JRGA 2O9LA 2R5YA 2KDZA 1GUUA 1FIPA 1MBJA 1MBGA 2L7MP 3PO2J 1TWFJ 2WV1A 5EDNA 2B63J 2IAIA 3JRCA 3LSPA 2FX0A 2DA2A 5C3EJ 4Y7NJ 5FLMJ 1BA5A 3QQAA 2HOSA 4IHWA 2CRGA 3PO3J 1U8BA 2DA1A 3ZQGA 2ECBA 2DA5A 4A3KJ 4FE7A 1QVUA 4DYCA 2XGEA 4XICA 1HDDC 2ECCA 3TP3A 1F36A 1YRNB 4J19A 1LFBA 2COBA 2ME6A 2NS7A 4XK4A 2LVSA 3HOVJ 3HOZJ 1TC3C 3BT9A 4D7NA 2IEKA 4MFEA 1Z0XA 2W48A 2CJJA 4A3JJ 1F43A 2CU7A 2ELKA 4UUSB 2LKXA 1AHDP 2X9DA 3RZOJ 1FJLA 3OSGA 1U9OA 3G1LA 5EF6A 3TEDA 2N8GA 1H89C 4D5FA 4JX4A 4DZJA 4BBSJ 3G1OA 3Q0WA 3ZQIA 3HDDA 2ID3A 1AKHB 4W1UA 2Y30A 5GP9A 3A01A 2VUMJ 2JWTA 2GBYA 2Y31A 4JP0A 3Q0UA 1X58A 4CYCA 1SANA 1JKRC 2GLOA 3S2HJ 2OPTA 1VFCA 2DN0A 3BR5A
chains in the Genus database with same CATH superfamily
4NQWB 4XM3A 3S8PA 5FROA 5ED4A 1H9TA 3FXUA 3R0JA 3MD2A 3A1YA 1YO5C 5FKOA 2ZSHB 1B1BA 2AXTC 2D2WA 2WBMA 4PGHA 2CGPA 4M6YA 1IDZA 2BE5F 4A2UA 2P5LC 3OYBA 3J7AY 4WXCA 4KN7X 4M3DA 1YJWI 3VYUB 1LNWA 4A6EA 4OOIA 2ZXHA 3AG2H 2QF7A 1YIOA 4L5IA 5TJJA 2OTLI 4YIRX 2ZNZA 4I76A 3CMYA 4XLCA 2A6TA 2YU3A 2PBIA 1XPXA 2BW3A 2K9LA 1NHAA 2DK5A 5IY5H 2PFBA 3K1NA 1SVLA 3K2ZA 3JRBA 3Q5FA 1ZRFA 5DUIA 1OCCH 3AKZA 1P7JA 1TZLA 2VXDA 3I9V2 1E3PA 3RSNA 2MC4A 1QPIA 3HOXJ 3KIOA 4ZJZA 1R7JA 2R5ZA 2XAJA 4IL6C 3HSEA 1B8IB 2Z3YA 1KONA 1WHUA 1XCBA 4BQAA 2L9NA 4LB5A 2WAQN 1EH7A 1MNMC 2IS1A 3S2WA 2KT0A 1I3QJ 4BUPA 4A3CJ 1UMQA 3H3ZA 5CYVA 2KISA 3NQOA 1BJZA 1E3OC 3R4KA 4BDYA 4CGZA 1I6HJ 2CQ7A 1BI3A 5K5QA 1U6GA 4ESFA 1LE8A 1G59A 2FQ3A 1FYLA 4NC7A 5JR3A 3FK7A 3L2QA 2QKMB 2NS8A 3A03A 4PFOA 4XMYA 2RNJA 3BR2A 2X1DA 1ZELA 3KLOA 4A3DJ 4I2OA 4GDFA 1QBJA 2O8XA 1FLIA 3QOEA 3R6SA 3A01B 1ZR2A 4QTRA 3F6OA 4HZFA 4EM0B 1JXSA 3MEXA 2GM4A 3A2KA 2HNHA 2QZ8A 4A0ZA 4JYKA 3F8BA 4XLAA 5J8CA 1HW2A 2O7OA 3GFMA 5BNGA 5EGOA 2W57A 4QPOA 5JFRA 2DFIA 1K4SA 4DYRA 5FO5A 3SFIA 3QU6A 3COAC 1IF1A 2LKPA 1D5VA 2EH3A 1ETVA 1T2KA 5DS9A 3QP5A 3G71I 4XRSA 5IYBJ 2E7WA 2M8GX 1J09A 4M71A 3QODA 4R8HA 1XG1A 3F23A 2JTVA 2DA7A 5LGTA 1HA8A 2R7ZJ 2WB1A 1TW3A 3LSGA 4EGZA 3U21A 5KVRA 4U88A 5CVJA 5J40A 3S16J 1V5GA 2WADA 3VOEA 2LD5A 2DA6A 2P5VA 1J5YA 4AVZA 1MW7A 4G7ZF 3CMAI 3IC7A 4D1QA 3BG6A 4XLNF 1I1SA 1F1ZA 3LSTA 5FKNA 2QUFA 5KK1A 3K9TA 4LG0A 1VI0A 1BOAA 2K3FA 3MMYB 3RJPA 3NRVA 2E34A 2EV5A 2F6CA 2OZUA 1ZGJA 2MGQA 4ON0A 3U9GA 4DGWB 3IKTA 3K70C 2NRAC 4XRSG 2EV0A 3S1NJ 3I71A 3GTKJ 1HSJA 2F5FA 4EMSA 3TP0A 4M3GA 3BG3A 2ZC2A 3J81Z 2H1LA 4HRIA 2RV8A 2E5ZA 2M4GA 4V19K 1MSEC 2QYOA 5FJ8J 5JLWA 2GOXB 2L7FP 2X51A 3F21A 2XVCA 2CQXA 1EH8A 5F27A 2JA2A 1IUFA 3FXKA 1TBXA 4PSXA 2BXZA 1O57A 3BPXA 4LLGF 1Y1VJ 3S3MA 5FFZA 2JRMA 2TCTA 5HS8A 1A31A 3EUKL 3MZHA 2KFDA 2FOKA 2MSYA 2Y0SA 1E17A 3AG1H 5H2FC 2BY0A 3BQYA 4Y3OA 1U9NA 4LK1F 3ZOBA 1R5ID 1YX3A 2H1KA 2YR2A 4IHSA 4WF2A 1N77A 3K6GA 1PVEA 2GIVA 2HI3A 3O2PE 1I1GA 4RB3C 3M07A 3C2HA 5HNHA 3IV5A 1ZR4A 2MH2A 4EJTA 2DTRA 4HF0A 4EQQA 1NG7A 5L3CA 4ZTJA 5FLXZ 3I0TA 1BJAA 4JOMA 1J0RA 2X4HA 4P96A 1T95A 2O8KA 1KYWA 1L0OC 2VKEA 4IQ4A 2VIXA 1OPCA 2E71A 2OJED 3FIWA 4Q4ZF 1H0MA 2WC2A 5F64A 4DBQA 3AL0B 1R23A 3BR6A 2HZDA 2MG4A 4UV9A 5JHUA 4XLPF 3M1EA 4A3EJ 2GA2A 2O6GE 1CGPA 1HKSA 3WGHA 3OS2A 4AC0A 1EF4A 3GTLJ 1F9NA 2FRHA 4L9VA 1REPC 2JSPA 3LOCA 2CW8A 1J7KA 3I4NJ 3D1NI 2L54A 2X48A 2LP0A 1D0ZA 1OCOH 3D5SC 5D8LB 3ZMZA 4EJOA 1K78B 1PUFB 2D5VA 3BG7A 1WQ2A 4M3EA 1KYZA 1KGSA 2GXGA 2JA7J 3QYFA 1HKTA 1R1TA 2CQNA 4ZC3A 3PUBA 4FISA 3BTLA 2DPDA 4U0YA 1X4PA 2MBFA 4XL9A 3GTMJ 3J81K 3ZQ7A 2XGDA 2OBPA 5FRMA 4BXUA 2DA4A 1XX5A 3KYCB 5HODA 4AIHA 1ZN2A 3L09A 2IJLA 3G4SI 3CJQB 4OIOF 1B59A 3OIOA 4FTHA 4M73A 4HF1A 1IXRC 1T08B 2UXNA 3M7GA 5CVUA 1R22A 1BW5A 3ZQQA 2CG4A 5CKTA 1VQNI 5F0HA 2LFBA 2DW4A 2QBYB 5TRDA 1SFOJ 5JLXA 5JVGF 5IT9Z 4ENNA 3L7WA 3DPTA 2CO5A 2HXIA 4BY1J 2EZHA 3KX2A 3M9AA 4M3BA 3GTOJ 3ECOA 1O3SA 4G94A 2B0LA 1HXDA 2NS0A 5J4VA 2DMNA 1KA8A 3V8JA 5GPAA 4G7HF 2G9WA 2BY2A 3TO9A 2BBYA 3GXOA 4CCNA 4HBLA 2A07F 2E1NA 2NNNA 4BDZA 2PG4A 2K40A 4BKXA 1DPRA 5LLQA 1R6RA 3I54A 1YLFA 3RI4A 1HKQA 3VSLA 3WTYC 4Q5SF 2STWA 1MZBA 2XAFA 5FLXK 3REOA 2Z99A 1U5TB 5FD6A 1SD5A 1OISA 2ZMEA 4ESJA 3MN2A 2Y0MA 2DMQA 1S8NA 3KP3A 3O8HA 3JRFA 1UJ8A 1F4KA 3K1MA 1BL0A 5CVVA 2XPUA 2A69F 1FBSA 2ME0A 1WWXA 2EQRA 2IP2A 3S2DJ 3KP2A 1GV5A 2DXIA 4LGWA 1D3YA 1WKMA 4S04A 1FX7A 3BP8A 3T5XA 4RB2C 2KDOA 4XKBA 1YFHA 1E0EA 3I59B 3R61A 1VQ4I 1LUJB 2NXNB 4AIKA 1X1PA 3GTJJ 1BW6A 2F5EA 2ADUA 1R49A 1ZK8A 2R7RA 2P5KA 2GXBA 4K2EA 3HG9A 3HB9A 4LITA 1RESA 3RPUA 1RIOH 2KZGA 3GUDA 3CD6I 2PJRA 4ZZDA 3C3WA 2IW5A 1JT6A 1XTAA 3FKIJ 3UKGA 1K83J 3K4KA 3A4CA 1PP8F 1TTYA 4HX7A 3EUHA 4XN3A 2VC0A 2KMUA 5IT3A 1XGNA 1JKQC 3MKZA 4C3HJ 4IOAF 1UB9A 3ZMVA 1TWGJ 3HTSB 1V5EA 1NTCA 2IA2A 3B73A 1T56A 3RQIA 3PFIA 2E2JJ 4ZYAA 5TISC 2XDVA 1JKPC 2K9NA 3HM5A 2NOGA 2VQCA 3F3XA 2R5YA 3ABTA 1MBJA 3PO2J 2WV1A 5EDNA 3JRCA 1V5FA 5IT9K 2FX0A 1O3TA 4BEHB 2DA2A 2Q2EA 2COMA 3QQAA 4TV7A 3FMRA 1D1BA 3G73A 1QVUA 3A0BC 4DYCA 4XICA 1YX5A 1F36A 4HYEA 4IQJA 3ZXSA 4YG2F 3HOZJ 4YFXF 2EFQA 2FE3A 2IS4A 2CQKA 1TQIA 1S29A 2EA4A 5HLHA 1Z0XA 2M4KA 1YOVB 2ZKZA 1FSHA 1F43A 2OZ6A 2CU7A 2MABA 4PGGA 4HV5A 5F1RA 2BY1A 4RB1A 1ZHFA 4AWXB 3CC7I 3HSFA 4E7SA 1SD4A 3H5RA 2W4SA 1VQ9I 1EH6A 2MFZA 4BS9A 2GQQA 4GRIA 2VBXA 3CCEI 1MGTA 4J01A 4XLFA 2BZTA 3F8NA 4DZJA 3HC7A 1DUXC 3TO6A 3Q0WA 3CJNA 3FM3A 4BJ6C 3PJRA 2ZFWA 1ZRDA 2MD5A 1QO0D 2BVLA 5TGTA 3CUOA 3C7JA 2V1NA 3D5LA 3FXRA 5E18F 1FPQA 4OMZA 5BMZA 1SVMA 4JP0A 3Q0UA 1SANA 2UWMA 2HEOA 4M74A 3SXYA 2VBZA 4BE2A 4LJZF 2LY1A 2IGMA 1QQIA 2DTZA 1R5GA 1UELB 4A6DA 3JRHA 3CCRI 2K5CA 2ZXWH 4A3BJ 4G8XA 2E1CA 1XSDA 4XRMA 3BCBA 3KFWX 3F6VA 3TBIA 4IVNA 4BHBA 1ETQA 2QSFX 2ZB9A 2R7TA 1WH5A 1ZREA 1OR7C 3GTPJ 2WAFA 1W5TA 1VQ5I 3IWFA 3RKQA 2K9QA 1TWHJ 1D1CA 4HSRA 4CCOA 3ROUA 3DPLC 1ITYA 4L18B 1LKXA 1S9HA 5E3OA 4L5EA 1G3YA 1T0FA 2FMYA 1V4RA 3KZYA 3V8LA 1T33A 5CVRA 2DMUA 5M5WJ 3H36A 1U8RA 1MMSA 5E8IA 3WGIA 2JA5J 4XSZF 1USTA 4L9JA 3F8FA 2H8RA 3GMEA 4HNUA 4GXOA 1JE8A 3A0HC 5M3FJ 4C3IJ 4F93B 5FFXA 4IOCF 2Z33A 5BOXA 2AS5F 1YW7A 3FXLA 4BXFA 2ACJA 2FA5A 1AA7A 1QU3A 4I0BA 5HLTA 4IZZA 2R7QA 1ZGAA 2X6WA 1I39A 3CUQB 4HDVA 3L2UA 4HDUA 4E7IA 4BQQA 5AONA 3LSIA 4LOCA 3OSFA 2P7CB 2QWWA 3I64A 5J1YA 2VJIA 1ZGWA 2PQ8A 4OAYA 4ITVA 2FBIA 1R71A 1DPUA 1IZ1A 2VQHA 1ON1A 1QVTA 3EDPA 2OQRA 2XAGA 2HOTA 2HS5A 4B44A 3FDYA 2RQPA 4KIGA 5CPRB 1D5YA 2L02A 2MA3A 1FY7A 1B72A 1OR7A 3J7YJ 2XPVA 2YSRA 4E70A 4I99C 3PNTA 5EEGA 1XMKA 3I56I 4B43A 1ACIA 2E60A 3I55I 1LB2A 4B3XA 3BG5A 2A6EF 2PN6A 1FC3A 3FF5A 4XONA 4BY7J 3PUFA 3BJOA 2KIQA 3LNQA 2RQQA 4RMNA 4Y15A 3QAHA 1TWAJ 2Y2ZA 4XORA 5B1AH 2LR8A 3SFZA 1MH4A 5ICEA 2RKHA 1ETKA 1TW2A 4R1HA 4RGSA 3JTHA 4B1RA 1BOBA 2DYSH 3GZ5A 4GO1A 5DD8A 3ULQB 1UHSA 2JA6J 4G6QA 1W1WE 2IT0A 4MQVA 1ZTRA 1S7AA 5CQEA 3BC8A 4QPQA 3IAS2 4HPQA 3ZPLA 4WXDA 3RIRA 4JX5A 2LBFA 5EZGA 3MZ8A 2QVOA 1HLVA 3K4CA 1XCVA 1VNDA 2V1DA 3EETA 5IP6A 2OU2A 1K79A 1ZG3A 4XKWA 3C18A 1P9QC 2V26A 2BW3B 5D5WB 1XGSA 2PMUA 1Z05A 3DEEA 3S1RJ 5E17F 5HS9A 1SD7A 1ENHA 3LSMA 1BIAA 2HTSA 2H27A 2OA4A 1W36D 4CCJA 3ERED 3W2AA 4MQ9F 2F4IA 3OS0A 1E3HA 2WV0A 4BU2A 3QYEA 4F92B 4P55A 5BS6A 4ZDOA 2NVUB 5C4JJ 2VC1A 2DDBA 1JI8A 1IN7A 1TL8A 1UCRA 3I4MJ 2LDUA 4BXXJ 4EEFG 2VI6A 1SD6A 4PCQA 3HUGA 2E1OA 2WB1N 2L9SA 1H9GA 1JT0A 1XN7A 1QA6A 5LEKA 5K1YA 3VYSB 1XMAA 4DW6A 3DEWA 1WZ2A 2Q1ZB 2DMPA 1R5HA 4I01A 4M6XA 4YFNF 4ENJA 4GCVA 2W85A 3VFZA 3I4PA 4D0PA 3IP4B 1Y56A 4M3FA 4FCYA 3GX4X 1X3ZB 3K4NA 4A69C 5J47A 1WJBA 1I50J 2IVMA 3WG7H 2XASA 1WJ5A 2X1CA 4Y17A 4YFKF 3EQLF 1X1CA 5A2QZ 1KQ9A 2ZJQF 3CTAA 3SYTA 2WTEA 3FBNB 3HHHA 1Z6TA 4NUBA 3TOAA 4KT6A 3L9FA 1B6AA 3JR9A 3OYKA 4QSHA 3WGGA 3OYHA 1YG2A 2BOLA 2E19A 2FJ1A 3LA3A 5LGNA 1IRZA 2VJ4A 3OL4A 4ENMA 3BR3A 3OWTA 2FBKA 3FX3A 1V55H 3ZQHA 2XF6A 5E3LA 4EM1A 2OTJI 1MMGA 2I8DA 1LEBA 1WJFA 5F0CA 2M1BA 2HFHA 4LK0F 3KP4A 2ZXJA 1RETA 4Q47A 4IHTA 4NQWA 2LY2A 3VODA 2XROA 4IKFA 1O4XA 1Z1DA 1WJEA 4Y4RA 1FEXA 2Y0SN 2JVHA 2VODA 5C4XJ 4V2FA 2GXAA 2FNPA 3ISPA 1JKOC 4HF2A 4BYYA 1IG7A 1ORKA 1FBQA 2DLLA 3JAMZ 1WPKA 2CYYA 3I5UA 1QRYA 3TDZC 3K7AJ 2LLKA 1QHGA 1PP7U 1AOYA 1EKEA 2M3AA 3GBGA 1W7PA 4UB8C 2LRDA 2JJ7A 2WWYA 5JI6A 3ZCOA 1S6LA 3WE3A 1OJLA 1OCPA 2DJNA 1LFUP 4C30A 1WJCA 2LREA 1OYYA 4ZZLA 1HBXG 3H9JA 5E1WA 4CCMA 2MD0A 5IOZA 1P4AA 1IUYA 2DFHA 4RAFA 2MH9A 4OIRF 3J80Z 2M5WA 3JRAA 2DMTA 4XOPA 4IX7A 1G2HA 2DO7A 3V7SA 4DNCA 1B8IA 2D1VA 1M1EB 3FK6A 1VQ7I 2XF5A 4ETSA 1JUPA 5L3BA 2HDDA 1FBUA 3OYJA 1JGSA 4NDLA 4R79A 5L3DA 4U87A 3OR1C 1LFPA 2RAEA 2LG4A 4RDUA 4KFCA 1JUMA 2ISZA 2A05A 1XDUA 4PDKA 1OCRH 2JRTA 1MH3A 4D9JA 9ANTA 4LB6B 1IN4A 1FTZA 1MJAA 2AQEA 3WHBA 2CUJA 5A2QK 1XB4A 4KMUX 4RS8A 3EYIA 3P5JA 1FP2A 4P9UA 5JVTA 2HYGD 1X4OA 3ABMH 1G8XA 3E5XA 2BYVE 4A0YA 3LSHA 1HSTA 1ZKGA 2JSCA 4CO8A 2BEOA 2HOAA 3TL4X 1S3JA 4E6KG 1FOKA 3H0GJ 3TMOA 1WJDA 5LHHA 5D6FA 3RPQA 2EB7A 1HC8A 3E0JB 4ANJA 2PMHA 5E1XA 4A3FJ 3OIPA 4RA2A 1NK3P 2XRLA 3FBIB 1Z91A 2OF7A 2VKDA 3QPLA 4A0XA 5H6QA 1ZH5A 4B47A 4A5NA 4WXHA 1ERDA 5M5XJ 2EIMH 2P4WA 5EZHA 3D0SA 1C0WA 4IEJA 1R1UA 3ERMA 3LQRA 4UXNA 4E7LA 3Q3SA 5AIQA 1LDKB 2KRHA 4KN4X 2BGCA 2GOMA 1S7EA 2DT5A 5IP9J 1A6IA 2F5VA 3JAMK 3MKYB 1RKTA 3K2AA 3TW7A 2EILH 2CWEA 4S0HB 1AKHA 1CF7B 4X6AJ 4PFPA 3JRIA 5J6XA 5E3MA 2A61A 2ID6A 2XSJC 3QWLA 2L7KA 3SJMA 3S14J 1Y8QB 2EPFA 1D0XA 3DU6A 3BR0A 2ZBKA 3NAUA 3BWGA 4GYGA 1BC7C 2PEXA 3M4OJ 2K9MA 1F5TA 3G1MA 4PJMA 2X6OA 1SMTA 3BZKA 3Q0VA 5J4YA 4GFBA 4XLEA 3KYLA 2NAZA 3J80K 2V1UA 3HOUJ 3OYCA 2Y48A 1WI3A 4KYWA 1EJ9A 4I98B 3OYAA 5J1RA 2MYSA 3QRFF 1UG2A 3H3VK 4XBFA 3IUOA 4A3MJ 2QQ9A 2QM3A 4RB0A 2OV7A 2RN7A 2FD5A 2B9SA 3HZJA 3W3CA 3FHZA 2AXLA 4GYIA 5F6FA 2KDZA 4Y33A 1GUUA 2AQFA 3ABLH 3NWSA 1MBGA 3L2VA 1MMAA 1QZZA 1T39A 1W5SA 2B63J 3HPHA 1IN8A 1Y0NA 1YQAA 4Y7NJ 1BA5A 1YTYA 5ERIA 5LBQA 4HQMA 3WU2C 2DA1A 2QQAA 2ZMEC 5K5RA 1U8BA 4WWCA 2VONA 1DP7P 2DAOA 4OIPF 2DA5A 4A3KJ 4L0ZB 3FXJA 1QZEA 3BJ6A 2V7FA 5DCMA 3KETA 2FNAA 2L4AA 2XGEA 2J5OA 2JT1A 3SHFA 2EFNA 1BI1A 1P6RA 2QA4I 4LMYA 3UNGC 2NS7A 3M1CA 3CF5F 2LVSA 3E6DA 3HOVJ 3K4JA 3HL2A 3VB2A 4BJTA 4CCLA 4HSTA 1XGOA 2W48A 4A3JJ 1NH3A 2JUCA 1AHDP 3H1CA 1DGWY 2G7HA 4XKVA 4IRIA 1FJLA 3OSGA 1U9OA 2KP6A 3G1LA 2JPBA 1JHHA 1R00A 3M8EA 1T8IA 3ZRGA 1SVOA 4CICA 4JX4A 1J9IA 5DV5A 1WRJA 5D4RA 3RQ4A 5H6RA 2YPRA 1ONVA 2ZNYA 5HNFA 2KIMA 2Q8KA 2GA1A 5ILVA 4MHGA 4IJAA 2HPMA 1SFKA 3TQNA 2Y30A 3E5UA 1X1DA 1N75A 4JK1X 2GBYA 3EUHC 1QHHD 1D8JA 4UNOA 3L2RA 2CV1A 3WTSC 4CYCA 5E20A 2GLOA 4FT8A 3ZP5A 2OPTA 1VFCA 3BDDA 2DN0A 3W6JB 4AIDA 2PJRB 3GFIA 5CQGA 4UB6C 1K6OA 3M3YJ 4MNUA 3TOBA 2XHKA 3CLOA 3E6MA 2BV6A 2CQQA 4FQGA 5IYDJ 1OLTA 2O61A 2KRFA 3OYFA 2E1MC 4NB5A 2DOEA 4DOZA 5LD2C 5CVIA 3E6CC 2EFPA 3T0YA 4IHYA 4N9IA 3OL3A 1OKRA 4HG2A 4F55A 3KP5A 2V6CA 5KHDA 3H5AA 3NARA 2DK8A 3W2WA 4LIVA 3L00A 1FP1D 1KU7A 1X2MA 3NWTA 1V54H 2IXSA 1W0UA 2PX9A 2Q2EB 2K85A 2DOFA 4P9FA 3BROA 2P6SA 3PQJA 2BXYA 4WK8F 1LVKA 2FSWA 3S17J 2K7LA 2IGNA 3O6BB 2M9HA 2B7EA 3VWBA 3CZ6A 2ESHA 4H4KC 2XAQA 1IW7F 4C3JJ 2UXXA 1QNTA 1V3FA 5K7HA 1SEUA 2P7VB 2FF4A 1ZQ3P 2EZLA 4W97A 3U1DA 2CFXA 3OS1A 5AIPA 1IN5A 2UUZA 1YIJI 4AVPA 4D5CA 5E8GA 5KAIC 3AAFA 3CMEI 3UR3C 2BHZA 1GDTA 4CH7A 1XD7A 2LK2A 2M0MA 3S32A 5D4SA 4IRGA 3RYPA 2EZIA 2W24A 2DT6A 2VBWA 2VQLA 1QZYA 2DDAA 2OCEA 1R58A 1BM9A 4DIQA 1XS9A 1JUSA 3DP7A 2STTA 4N9HA 2DQRA 1R9TJ 3C2GA 4ZYHA 1I5ZA 3GW2A 2Y9ZA 3LA7A 5D5XB 4BL0B 1A36A 3MVPA 4S05A 1LJ9A 1MJBA 1RZ4A 2K02A 1APLC 3I3LA 2AO9A 1WJAA 5F1JA 2HYJA 3DFGA 2VJJA 1ETYA 4M6VA 5FKLA 1LPQA 2PI0A 4M9ZA 4KIBA 1X1BA 3ASNH 1G6NA 3PNVA 4P1WA 1T6SA 1ZRCA 2Z5UA 1VF9A 2H6BA 3I59A 1O7FA 1FOYA 2DODA 3X2QH 1VTNC 1MSFC 4EJWA 1OQYA 4FETA 3F0CA 3CP8A 3H35A 4G6TB 2FOWA 1JGGA 3PIPF 3G2BA 1T0FC 1BBYA 1KU9A 3PNYA 3HXLA 2QCOA 1FSEA 3IH3A 3DQVC 3QYBA 1D8KA 2FQ4A 1UG0A 3ABKH 1Y8RB 3HKZA 3DXJF 4HX4A 4UUVA 5IYCJ 3WODF 2BY3A 2M45A 1ZYRF 2FXAA 3ZMUA 2ZSIB 4DZPA 2R7VA 2JQ7A 1VQOI 2KHMA 2LNBA 3DWLE 3OMYA 4XR6A 4QLCU 1DQUA 4MLOA 1TQPA 4YIFA 5K7FA 2IBDA 1FNNA 2H8WA 5LGUA 3FXOA 4F52A 2OC6A 4JX6A 4ASNA 2D45A 3RYRA 3CJRB 4DQ2A 4CZCA 1JJ6C 3DBLB 3J7ZI 3HRTA 1Z3YA 3DLLF 4G9YA 1EV7A 2DYRH 1Z9CA 3MZYA 3QPTA 4C2MJ 2CFOA 4ZH4F 1MIJA 2QSGX 2GZWA 1B9MA 2M7BA 5E79C 3FMQA 1GXPA 1A5JA 4CSWA 2M8EA 4AD9A 4EVIA 2HVRA 2LH9A 1IV6A 3ELKA 1BR1A 2E5NA 3DTIA 2MW8A 1Z3XA 2M87A 4IO9F 4A3LJ 4UHTA 5J3LA 2CSOA 4ZYDA 3S93A 2HU9A 2JMWA 2X85A 1SFXA 3SEQA 1MDMA 2O0YA 3DCFA 3K69A 3VPRA 1JJ8C 3HYIA 3OYEA 3CC2I 1B72B 3LFKA 2OCCH 2PJPA 1QGPA 1FOXA 3PQKA 1YJ9I 2LYCA 2R7XA 2Y9YA 3W6VA 2YU9J 5DUKA 1Z67A 4XSXF 1P7IA 3HIFA 4ENKA 2FU4A 1R1VA 1BC8C 2DQLA 3N97A 4V2GA 3V7CA 1USSA 3L2WA 1PUEE 2VBYA 2L2OA 2HKXA 1FYKA 1OMIA 2M34A 2IRFG 2L01A 3CDLA 2QSHX 3CUQC 2V9PA 2QENA 3A02A 3BJAA 4EJUA 5GTIC 5IP7J 1RC9A 3BR1A 3ESWB 3S1MJ 2G0EA 4BGDA 2LMDA 1YITI 3FKJA 2JN6A 4L9TA 1MBKA 2LBFB 4QIWN 2R3SA 1G3TA 5DEQA 1W5CC 3P9IA 2VOPA 3GZNB 4I09A 4B09A 4NBQA 4BQNA 4PSWA 3VDXA 2AHQA 3BLYA 2EV6A 3WTVC 2PMZA 3N4MA 5LRRA 2QKLB 2W7NA 4E7HA 5EG0A 4NC6A 3D5RC 1P4XA 2V1XA 3BTCA 2LY9A 3G3ZA 5EEAA 3DLAA 5DYMA 3CCMI 3GEZA 1YS6A 4HNVA 2EZKA 2VE8A 2W00A 2ESNA 1MBFA 4JBAA 3GFJA 4RM3A 1KQ0A 3H9QA 4EJVA 4O5VA 2K27A 4DYQA 4FX4A 2TRTA 3HRUA 1H8AC 1LQ1A 2E2HJ 1D1AA 1DGRM 3L2CA 1STZA 4ZTFA 3ZGKA 4J00A 4CDGA 4AM3A 3GFLA 2ZFUA 3JCUC 4IHVA 3ZN0A 2M30A 3HGYA 2JVGA 3RZDJ 2L0KA 5H20A 4XQFA 2RGVA 1E2XA 3AG4H 4HA8A 2C6YA 3CUQA 4OIQF 1JHFA 4U0WA 1HCRA 4G12A 3KE2A 3W2VA 2NVQJ 1S7OA 3CCYA 2HOEA 5J8FA 1N25A 1KZHA 2VXZA 2KIFA 3CP2A 1ZARA 1PYVA 2R5ZB 2IA0A 2KIUA 3OYNA 3K0LA 3DPUA 4N0BA 1P4WA 5M5YJ 3WTTC 4RBOA 1CQTA 5B66C 1X1AA 3OYDA 2L4MA 2LSOA 2P6TA 1R4NB 1ZG1A 1MD0A 3FISA 3CO7C 2XC7A 3QOPA 4A12A 4E7ZA 2NVTJ 4RGXA 2VL8A 3ZQCA 1VQMI 1YRNA 4LLNA 4RGUA 4HAMA 1IN6A 1GT0C 1FZPB 1LE8B 4MEXF 5DDGA 2KRCA 2ICWG 3CLQA 1G4DA 2BHYA 3FHNA 1FT9A 4AYBA 5KNLA 3VYRB 4UUSA 3H5NA 2JUGA 4Z2YA 3ASOH 3K4BA 1XDSA 4MO7A 2VPRA 2XF7A 1RUNA 4A3GJ 4ZYEA 3Q9SA 3B6CA 2R93J 2UV1A 2NVXJ 3G6EI 4CXFA 1VZ0A 1WVRA 4L0YB 4KDPA 4FASD 1MMDA 5ICCA 5EGOB 4UUTA 1PDNC 1RKWA 1W7PB 2LF7A 3MCZA 4BBRJ 1XSVA 2E35A 3IRQA 2ZCWA 3GCMA 4BE1A 4YRVA 4I6ZA 2WAEA 1FMWA 3IHUA 3W6KB 3R0AA 4LLLA 3F22A 2HTJA 1SC7A 5GAEJ 2ZXIA 4ABZA 1YW9A 3U1KA 1P92A 4NC8A 3EPZA 1DU0A 2XIGA 5F04A 4PJNA 4C2TA 3IH2A 3AFHA 3DKYA 6PAXA 1J2XA 5GPCA 2DT7B 2XGCA 3B02A 1OFCX 5E1ZB 2F4MB 2CUFA 2E36A 3ONQA 1W4MA 2XAUA 3F9KA 3L1PA 2K4JA 1G3WA 2EFOA 5KCMA 1U78A 1L3LA 4G6DA 3SDBA 2O9LA 4KNYA 2VE9A 1X3UA 1FIPA 1Q1HA 2NNYA 4LG0B 3IL2A 1IRFA 3KEQA 2F4OB 2IAIA 3SZGA 2HR3A 3LWFA 1TP4A 3T1BA 3TDUC 5FLMJ 3ZMSA 4M9SA 1S5LC 2JPCA 3GVAA 2Z16A 3WU1B 2CRGA 4RLFA 3PO3J 3ZQGA 3P9CA 1YS7A 4BJ5C 2OD5A 3CC4I 1W7PD 2HDWA 2CH0A 5EEHA 3GLXA 5FRNA 4C2UA 3BY6A 4YEJA 2YX7A 1MNDA 2ECCA 1S72I 2HQNA 4HX8A 2W1OA 5GAGJ 4II3A 4XK4A 4D7NA 2R7SA 4MFEA 1YW8A 5DD4A 1FYMA 4PZJA 3DTKA 4Y13A 1P2FA 2ELKA 4OWRB 2LKXA 1MNEA 4OMYA 1I3AA 1BI2A 1Z7UA 3RZOJ 2VLAA 3KEYA 1X3WB 5EF6A 2HGCA 1H89C 4D5FA 3RKYA 1UFMA 1XGMA 3CDIA 1ON2A 2O5RA 3ZQIA 5B3SH 4CA0A 3GLLA 3S3NA 3HDDA 1YE9A 1AKHB 2MC3A 2OQGA 4W1UA 4BNCA 4EM2A 5GP9A 3A01A 1J75A 2JWTA 1BR2A 3EYYA 4UVCA 2VUMJ 2IA1A 2L5QA 2NOJB 2VQGA 1U2WA 3WTUC 3GWZA 4QWQA 1I6XA 1OCZH 3KLNA 3S2HJ 2R7DA 3FWEA 1ZG5A 1X2NA 4RM2A 4BHCA 2V9VA 2R7FA 4XNFA 2Z2SB 3HJEA 1ETXA 2I5UA 1FTTA 1R4MB 2M2EA 4AU7A 3O8GA 2VASA 3JW4A 2WAQA 3OOPA 1LDDA 3SZTA 3LQQA 1LEAA 2EA2A 5BQTA 2K4BA 2K3PA 4EV0A 5DCFA 1WCMJ 2GAUA 2VN2A 3CQZJ 3K4LA 3E7LA 5JHFA 2L9RA 4ZDPA 4GGGA 4MEYF 1RNLA 1H88C 5M3MJ 1BR4A 1IO2A 2ZJ2A 3H0DA 1Y39A 4E7JA 2H09A 1VQKI 4KT5C 2DOAA 4FHTA 4N4NB 4I02A 2GWRA 4U7DA 2R92J 3FXMA 2OAZA 2KQRA 3KP7A 4HNTA 2XSDC 3SQNA 1ZLKA 1KU3A 5DCMB 3S15J 3HPGA 1O3RA 3F72A 3DF8A 2LF8A 3LSKA 5FGMA 3CMMA 4XRFA 5GADJ 3V8KA 2HKOA 3GZ6A 3H3UA 2RVCA 1KU2A 3MAJA 3MQ0A 4M9XA 3C1DA 4OU0A 2KJCA 3BZCA 2XV4S 4A5MA 3E5QA 5ICGA 2JK3A 3K70D 1IXSB 1HDPA 1HW1A 2JZYA 4Y52J 4LFUA 1T38A 2VB6A 1DP3A 3AL0C 1Y6IA 1J59A 5LFAA 2G7UA 3GF2A 4MTDA 1BI0A 3LA2A 4PUSA 3M8FA 5D5VB 3JRDA 3PIOF 3JSPA 1OCTC 2WY7Q 4LIUA 2HVSA 2XB0X 5C44J 3TKYA 4XN0A 2O03A 1IRGA 3TW6A 1FIAA 2KL4A 2X6YA 3Q9VA 3OYLA 4U0VA 2HDCA 1TT0A 2MLKA 2OUMA 2VPLA 3JREA 5J1UA 1Z7LA 3OYMA 4PJ0C 5HLIA 1XC5A 2RREA 4U7BA 5HLGA 4N4OB 5D6EA 2Z1DA 4CYCB 2X1EA 5L3GA 4KUMA 2FUG2 2KKOA 1CF7A 3TGNA 3PSIA 4RAZA 4UY8I 1GV2A 4CHUA 3ZQFA 2DPUA 4MIMA 5F0FA 2ZMEB 3U2RA 1YI2I 3WTZA 1W0TA 3VSKA 2V9KA 2FEZA 4F3QA 2DU9A 4NNJA 1MKMA 4I0AA 1YYVA 1A35A 2F2EA 1MMNA 2E2IJ 4JQFA 2DFEA 1DU6A 1Y1WJ 2R7WA 4O6JA 2A6HF 4HW0A 2P0WA 3KP6A 4MFDA 1WH7A 1IXCA 1WI9A 1U0JA 2W82A 2EIJH 4CZZA 4B4CA 1AU7A 3JTGA 3MWMA 2XGXA 2HZTA 5EYRA 3PL8A 3BTIA 3HBLA 3P7NA 5L3EA 4RGRA 4PJLA 3F8CA 2F5DA 3KEOA 1SFEA 4X1EA 2Y75A 4HEA2 2W84A 2XPWA 2D1HA 2YX4A 3WG9A 4IPAA 2VT2A 1MBHA 1K78A 5FLVA 1PUFA 3LAPA 3T8RA 3HOTA 2W25A 1RPWA 1ETWA 2HQAA 2K9SA 4KMFA 2ELHA 2O3FA 1K6YA 1U5TC 2CW7A 2M7AA 5F08A 1K4TA 3KYDB 2H94A 5HDGA 2ZJPF 2H6CA 1GXQA 4RAGA 4XIDA 3GTQJ 1JTYA 3HKZN 4AIJA 3CCSI 2L7ZA 3MKWB 1GHCA 5DM6F 1A6QA 3LFUA 1Q1VA 4L9NA 3QPHA 3IH4A 3LAJA 2R5YB 3PSFA 3JSOA 2XKOA 2E1MB 2EIKH 4C9YA 3M8JA 3ZR8X 3R60A 4IXAA 1HQCA 3LSRA 1IC8A 4CYDA 1OYIA 3HEFA 3CCLI 2RC4A 1LDJA 4BAYA 1R36A 2QBYA 3HGGA 2CUZA 2X6XA 3WE2A 1TWCJ 2V6EA 4CCKA 3HSRA 4BH9A 2HPIA 1D0YA 5IOYA 1FOWA 4UV8A 4UVAA 5KAFC 3V7RA 1HOMA 1TQMA 4FE4A 3BPVA 2L3DA 4BE0A 1OYWA 2TDXA 3KZZA 3RPUD 3CESA 4IHXA 1YJNI 1ULYA 2P8TA 1IDYA 2LKSA 4HOBA 3SDGA 5ILUA 2HWVA 3FM5A 3OOUA 2ZJRF 1U5TA 3IKVA 3ZMTA 2HQRA 2WA0A 5DTDA 1Z6RA 2QQ8A 2VJ5A 4PK4A 3OV8A 1BIBA 3OYIA 4D7MA 4FX0A 2QGUA 4NHJA 2CV0A 3OYGA 2HVQA 2KJBA 2IGOA 3GTGJ 4HLYA 2P81A 5FKMA 3K10A 3CCQI 3WU0A 1UHWA 1WGXA 3LL7A 5E3NA 1K7AA 3ZQLA 3T8TA 3OIQA 4RLQA 2ZO4A 2F48A 2CV2A 2EK5A 3SEZA 5GAHJ 5FD5A 1RI7A 3IRRA 3BQZA 1IRXA 3F8MA 3MKLA 5EJCA 3OY9A 3WTXC 2Z9OA 3HOYJ 5HOOA 2CS3A 3B6AA 2Y69H 2ETHA 2L9VA 3E3VA 2IS2A 1TNTA 3ZMDA 2YUSA 5LHIA 2XKPA 2UZKA 3I53A 3C2BA 1XMXA 3ZN1A 3ECHA 5B5EC 1VQ8I 2HQ5A 1FMVA 4HV6A 4LG3A 3ML6A 4XLHA 4MTEA 1ODDA 2R7UA 1HF0A 2PMZN 1MDMB 1TLHB 4A3IJ 1Z21A 3LSJA 2IS6A 4HLXA 2QEXI 1LVAA 5LHGA 1SMYF 1AWCA 3VYTB 5DM7F 4L5JA 1IGNA 2KPMA 3DKXA 5D8KB 3KZIC 3CJTB 4E4HA 3AG3H 2GIZA 5HDKA 4KIFA 2QQBA 2CMPA 1RRJA 3FMSA 4EATA 2CUEA 2EBIA 4XKCA 1B4AA 1WFXA 4BEHA 2MLGA 1POGA 2JA8J 2VT3A 5HS7A 3BCAA 4AUXA 1RR7A 3DBRB 3V4GA 3OR2C 2DFFA 3V42A 2M0CA 2RNGA 5K7ZA 4EGYA 4O3MA 4UVBA 5FKKA 1X19A 2VKVA 3CCVI 1I27A 1ETOA 5HDNA 3E6BA 5B1BH 2LTPA 3FZVA 2A5WA 3BZ6A 1DDNA 1A04A 1IJWC 3CO6C 1MJ9A 3PM1A 1SAXA 2R4GA 1VQ6I 1G3SA 3HHGA 2EWNA 4II2A 3WHCA 4P5OA 4KA4A 1JTXA 1VQPI 2HYFA 1TNSA 4BQOA 1GLNA 4F7ZA 4X0GA 2EINH 1HW5A 5GTHC 3RCOA 5K5OA 1SAUA 3BG9A 5FB2A 3DEUA 5HVQC 3I58A 2KLOA 2PLYA 4OAZA 2EJRA 3HOSA 2R7OA 3KPHA 2BVMA 1UAAA 1UHMA 5EG0B 3TO7A 2NVYJ 2E7XA 4I7HA 3RKXA 4B3AA 3QPSA 3DV8A 5ICFA 5LEJA 1FWZA 2XB5A 3HOWJ 3IWZA 5BPIA 1Z77A 4KJZA 1RR8C 3EUAA 1SFUA 2YS9A 5BPDA 1PJRA 1IV8A 1GVJA 3S1QJ 3K4MA 5CLSA 3FXQA 4RAYA 1UZCA 3BTJA 1ZAOA 3H92A 3GYHX 1N78A 2QLZA 4AYBN 1BN5A 4A93J 2I10A 4MGRA 3GO5A 4KICA 1B9NA 3LMMA 2DBBA 2CW0F 2EFWA 3CDHA 4H0EA 2FMLA 1TT5B 2LC2A 4B48A 1K61A 2A68F 1NK2P 5D5UB 1W36C 4ESBA 5IPAA 4KITB 4LD5A 4F91B 2XUBA 3HTUA 4Q48A 2FBHA 2HXOA 1GVDA 2R0QC 1U3EM 4KISA 1EA3A 2K86A 4CUGA 1MBEA 4WCGA 3CCUI 3JRGA 2DA3A 3PFYA 3QU3A 4WX9A 4Z6YA 3HRMA 1RUOA 3NEUA 3RDIA 4DBRA 4G7OF 2L7MP 2DCEA 1TWFJ 2VKHA 4YELA 1KQ8A 3LSPA 2Q0OA 1Y0UA 3SZPA 5C3EJ 1XSXA 4YIIA 1O7LA 3N05A 1YHQI 3KCCA 2RDPA 3DTEA 4B8XA 3MFKA 2HOSA 4IHWA 4XOTA 2A3SA 2DI3A 2J5PA 3DBHB 3HUGB 2ECBA 2KZVA 3S3OA 2XAHA 3CCJI 2V79A 4FE7A 2WY8Q 3K1PA 4M72A 1QPMA 1ZLJA 5L3FA 3RKWA 1HDDC 3DKWA 3CF2A 3TP3A 1YRNB 1IAWA 2IPQX 4PJJA 4J19A 2VOOA 1LFBA 2COBA 2ME6A 4HQEA 3E1SA 2ISYA 1TC3C 3BT9A 3BOQA 2F5CA 2IEKA 2X0LA 2ELJA 3HRSA 5ILSA 4IRHA 2V4JC 2CJJA 3DU5A 2LOOA 4UUSB 2X9DA 3VEPA 2NYXA 1O3QA 3TEDA 5LRSA 2N8GA 4BACA 2XRNA 3QP6A 4ZYGA 1NG6A 4ZDLA 4BBSJ 2A5YB 3G1OA 5CJ9A 3H9GA 2ID3A 3ABUA 3IAM2 3RTRA 2DJIA 3O3KA 2Y31A 2IGKA 3P9KA 4E7KA 3J7AO 3WTWC 4OINF 3E97A 4BHPA 1JKRC 1X58A 1VQLI 1T98A 4DJAA 1WSUA 4IF4A 3BR5A
chains in the Genus database with same CATH topology
1X2NA 3M3YJ 2DTZA 2CQQA 5IYDJ 3JRHA 5FKOA 4A3BJ 1ETXA 1IDZA 4XRMA 1FTTA 2M2EA 3O8GA 1ETQA 2ZB9A 1WH5A 4M3DA 4IHYA 3GTPJ 3RKQA 2K9QA 1TWHJ 1WCMJ 2QF7A 3CQZJ 3E7LA 2L9RA 3NARA 1H88C 1ITYA 5M3MJ 4I76A 5E3OA 3CMYA 4L5EA 1X2MA 1W0UA 1T33A 5M5WJ 2DMUA 2R92J 3JRBA 2JA5J 3S17J 2XSDC 2H8RA 1P7JA 2M9HA 1QPIA 3HOXJ 5M3FJ 2R5ZA 4C3IJ 3S15J 4C3JJ 1B8IB 5K7HA 1ZQ3P 2EZLA 2WAQN 4W97A 1MNMC 2KT0A 1I3QJ 2JK3A 4D5CA 4A3CJ 1HDPA 1UMQA 4Y52J 3OSFA 4LOCA 1GDTA 1E3OC 1BJZA 1I6HJ 5J1YA 2LK2A 1ZGWA 2EZIA 3JRDA 1LE8A 1QVTA 1XS9A 3FK7A 1JUSA 1OCTC 2HOTA 2XB0X 2NS8A 3A03A 5C44J 1R9TJ 3BR2A 3TW6A 1D5YA 1B72A 1FIAA 4A3DJ 2Y9ZA 2XPVA 3MVPA 3A01B 1ZR2A 3JREA 5J1UA 4QTRA 1APLC 2AO9A 5F1JA 2HYJA 3BG5A 2GM4A 1XC5A 4JYKA 1ETYA 4M6VA 5FKLA 2O7OA 4CYCB 5BNGA 5EGOA 4BY7J 3LNQA 1TWAJ 2Y2ZA 1VF9A 1GV2A 2LR8A 3ZQFA 4MIMA 5F0FA 1MH4A 4DYRA 3SFIA 1W0TA 1ETKA 1MSFC 2EH3A 1ETVA 5DS9A 4B1RA 3F0CA 4XRSA 5IYBJ 1JGGA 2JA6J 1UHSA 2M8GX 1XG1A 2E2IJ 2DA7A 2QCOA 2R7ZJ 3IH3A 1ZTRA 3LSGA 2FQ4A 1DU6A 1Y1WJ 4JX5A 5EZGA 3S16J 4MFDA 5IYCJ 1HLVA 1VNDA 1WH7A 5IP6A 2LD5A 2DA6A 4DZPA 4B4CA 1AU7A 3S1RJ 5EYRA 1ENHA 4MLOA 3BTIA 3HBLA 5K7FA 5FKNA 2IBDA 4JX6A 1JJ6C 4X1EA 1VI0A 2XPWA 5C4JJ 1MBHA 5FLVA 2MGQA 1PUFA 4C2MJ 1RPWA 1ETWA 2K9SA 4XRSG 3I4MJ 3S1NJ 1A5JA 3GTKJ 4BXXJ 5F08A 4EEFG 2VI6A 2E1OA 2WB1N 3TP0A 4M3GA 1JT0A 3BG3A 1IV6A 2MW8A 4XIDA 3GTQJ 1JTYA 3HKZN 1MSEC 5FJ8J 2L7ZA 4DW6A 5JLWA 4A3LJ 3DEWA 2L7FP 1Q1VA 2DMPA 3IH4A 5J3LA 2CQXA 5F27A 2R5YB 1IUFA 4M3FA 2JMWA 4FCYA 3DCFA 4A69C 3LSRA 1Y1VJ 3VPRA 1JJ8C 1I50J 1IC8A 3HEFA 2TCTA 1B72B 2MSYA 3HGGA 1TWCJ 2Y9YA 3BQYA 5IOYA 1U9NA 3ZOBA 3W6VA 2H1KA 3JR9A 2YU9J 4QSHA 1HOMA 2HI3A 2E19A 2FJ1A 1IRZA 1ZR4A 4FE4A 3IV5A 1P7IA 3BR3A 4V2GA 3ZQHA 5E3LA 4IHXA 5F0CA 1IDYA 2M34A 3SDGA 3CDLA 1RETA 3A02A 3OOUA 5IP7J 3BR1A 2O8KA 3S1MJ 2G0EA 5DTDA 1O4XA 2VKEA 1FEXA 2Y0SN 3FIWA 5C4XJ 4V2FA 2JN6A 4D7MA 1MBKA 4QIWN 1JKOC 1IG7A 1ORKA 3BR6A 2MG4A 4A3EJ 3GTGJ 2AHQA 1WPKA 2P81A 5FKMA 1WGXA 5E3NA 4AC0A 1EF4A 1QRYA 3GTLJ 3ZQLA 3K7AJ 2LLKA 5EG0A 3LOCA 3GBGA 3I4NJ 3D1NI 2JJ7A 2X48A 2LP0A 3BTCA 2LY9A 5EEAA 4HNVA 3BQZA 1OJLA 1OCPA 2DJNA 2EZKA 3MKLA 1PUFB 2D5VA 1MBFA 1LFUP 3HOYJ 4M3EA 2JA7J 3B6AA 4DYQA 2E2HJ 1H8AC 2TRTA 4FISA 3BTLA 5IOZA 2YUSA 3JRAA 2DMTA 3C2BA 3GTMJ 1G2HA 2XGDA 1B8IA 2HQ5A 2DA4A 3FK6A 5HODA 4IHVA 3HGYA 3RZDJ 2L0KA 1JUPA 2HDDA 1HF0A 2PMZN 4NDLA 3OIOA 4A3IJ 3LSJA 2RAEA 4FTHA 4RDUA 1BW5A 1JUMA 1HCRA 4G12A 5F0HA 2NVQJ 2LFBA 1IGNA 3CCYA 1MH3A 1SFOJ 5JLXA 9ANTA 1FTZA 3WHBA 2HXIA 2R5ZB 2CUEA 2EBIA 4BY1J 2EZHA 1POGA 2JA8J 5M5YJ 4AUXA 1RR7A 4M3BA 4RBOA 1CQTA 3GTOJ 1ZKGA 2DMNA 2M0CA 5K7ZA 2HOAA 5FKKA 3H0GJ 3FISA 2VKVA 5GPAA 1ETOA 2LTPA 2NVTJ 1YRNA 2K40A 3ZQCA 4BKXA 4A3FJ 1IJWC 1NK3P 2XRLA 3PM1A 1GT0C 1LE8B 2OF7A 3QPLA 3WHCA 1JTXA 3MN2A 2DMQA 4UUSA 5M5XJ 3O8HA 5EZHA 3JRFA 4IEJA 1BL0A 2XPUA 3Q3SA 2ME0A 3BG9A 4MO7A 2EQRA 2VPRA 4A3GJ 3B6CA 1GV5A 2R93J 2NVXJ 1S7EA 5IP9J 1A6IA 1RKTA 3K2AA 3TW7A 5EG0B 5EGOB 4UUTA 2NVYJ 4S0HB 1RKWA 4B3AA 4BBRJ 3QPSA 1AKHA 4X6AJ 3JRIA 2XB5A 3HOWJ 5E3MA 4I6ZA 2ID6A 1Z77A 3GTJJ 1BW6A 3SJMA 2YS9A 3S14J 1ZK8A 3S1QJ 3HB9A 3BR0A 1RESA 3BTJA 3NAUA 4ABZA 4AYBN 4A93J 3M4OJ 2I10A 3FKIJ 1JT6A 3G1MA 2X6OA 3Q0VA 4GFBA 3UKGA 1DU0A 1K83J 5F04A 3HOUJ 3IH2A 1WI3A 1JKQC 5GPCA 1K61A 2XGCA 4C3HJ 5J1RA 1NK2P 1TWGJ 1UG2A 3H3VK 1OFCX 1NTCA 5IPAA 2CUFA 1T56A 3RQIA 3L1PA 4A3MJ 2E2JJ 3S2DJ 2HXOA 1JKPC 1GVDA 2K9NA 3HM5A 2R0QC 2FD5A 1U78A 1MBEA 2NOGA 2DA3A 3JRGA 2O9LA 2R5YA 2KDZA 1GUUA 1FIPA 1MBJA 1MBGA 2L7MP 3PO2J 1TWFJ 2WV1A 5EDNA 2B63J 2IAIA 3JRCA 3LSPA 2FX0A 2DA2A 5C3EJ 4Y7NJ 5FLMJ 1BA5A 3QQAA 2HOSA 4IHWA 2CRGA 3PO3J 1U8BA 2DA1A 3ZQGA 2ECBA 2DA5A 4A3KJ 4FE7A 1QVUA 4DYCA 2XGEA 4XICA 1HDDC 2ECCA 3TP3A 1F36A 1YRNB 4J19A 1LFBA 2COBA 2ME6A 2NS7A 4XK4A 2LVSA 3HOVJ 3HOZJ 1TC3C 3BT9A 4D7NA 2IEKA 4MFEA 1Z0XA 2W48A 2CJJA 4A3JJ 1F43A 2CU7A 2ELKA 4UUSB 2LKXA 1AHDP 2X9DA 3RZOJ 1FJLA 3OSGA 1U9OA 3G1LA 5EF6A 3TEDA 2N8GA 1H89C 4D5FA 4JX4A 4DZJA 4BBSJ 3G1OA 3Q0WA 3ZQIA 3HDDA 2ID3A 1AKHB 4W1UA 2Y30A 5GP9A 3A01A 2VUMJ 2JWTA 2GBYA 2Y31A 4JP0A 3Q0UA 1X58A 4CYCA 1SANA 1JKRC 2GLOA 3S2HJ 2OPTA 1VFCA 2DN0A 3BR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2N A;  3M3Y J;  2DTZ A;  2CQQ A;  5IYD J;  3JRH A;  5FKO A;  4A3B J;  1ETX A;  1IDZ A;  4XRM A;  1FTT A;  2M2E A;  3O8G A;  1ETQ A;  2ZB9 A;  1WH5 A;  4M3D A;  4IHY A;  3GTP J;  3RKQ A;  2K9Q A;  1TWH J;  1WCM J;  2QF7 A;  3CQZ J;  3E7L A;  2L9R A;  3NAR A;  1H88 C;  1ITY A;  5M3M J;  4I76 A;  5E3O A;  3CMY A;  4L5E A;  1X2M A;  1W0U A;  1T33 A;  5M5W J;  2DMU A;  2R92 J;  3JRB A;  2JA5 J;  3S17 J;  2XSD C;  2H8R A;  1P7J A;  2M9H A;  1QPI A;  3HOX J;  5M3F J;  2R5Z A;  4C3I J;  3S15 J;  4C3J J;  1B8I B;  5K7H A;  1ZQ3 P;  2EZL A;  2WAQ N;  4W97 A;  1MNM C;  2KT0 A;  1I3Q J;  2JK3 A;  4D5C A;  4A3C J;  1HDP A;  1UMQ A;  4Y52 J;  3OSF A;  4LOC A;  1GDT A;  1E3O C;  1BJZ A;  1I6H J;  5J1Y A;  2LK2 A;  1ZGW A;  2EZI A;  3JRD A;  1LE8 A;  1QVT A;  1XS9 A;  3FK7 A;  1JUS A;  1OCT C;  2HOT A;  2XB0 X;  2NS8 A;  3A03 A;  5C44 J;  1R9T J;  3BR2 A;  3TW6 A;  1D5Y A;  1B72 A;  1FIA A;  4A3D J;  2Y9Z A;  2XPV A;  3MVP A;  3A01 B;  1ZR2 A;  3JRE A;  5J1U A;  4QTR A;  1APL C;  2AO9 A;  5F1J A;  2HYJ A;  3BG5 A;  2GM4 A;  1XC5 A;  4JYK A;  1ETY A;  4M6V A;  5FKL A;  2O7O A;  4CYC B;  5BNG A;  5EGO A;  4BY7 J;  3LNQ A;  1TWA J;  2Y2Z A;  1VF9 A;  1GV2 A;  2LR8 A;  3ZQF A;  4MIM A;  5F0F A;  1MH4 A;  4DYR A;  3SFI A;  1W0T A;  1ETK A;  1MSF C;  2EH3 A;  1ETV A;  5DS9 A;  4B1R A;  3F0C A;  4XRS A;  5IYB J;  1JGG A;  2JA6 J;  1UHS A;  2M8G X;  1XG1 A;  2E2I J;  2DA7 A;  2QCO A;  2R7Z J;  3IH3 A;  1ZTR A;  3LSG A;  2FQ4 A;  1DU6 A;  1Y1W J;  4JX5 A;  5EZG A;  3S16 J;  4MFD A;  5IYC J;  1HLV A;  1VND A;  1WH7 A;  5IP6 A;  2LD5 A;  2DA6 A;  4DZP A;  4B4C A;  1AU7 A;  3S1R J;  5EYR A;  1ENH A;  4MLO A;  3BTI A;  3HBL A;  5K7F A;  5FKN A;  2IBD A;  4JX6 A;  1JJ6 C;  4X1E A;  1VI0 A;  2XPW A;  5C4J J;  1MBH A;  5FLV A;  2MGQ A;  1PUF A;  4C2M J;  1RPW A;  1ETW A;  2K9S A;  4XRS G;  3I4M J;  3S1N J;  1A5J A;  3GTK J;  4BXX J;  5F08 A;  4EEF G;  2VI6 A;  2E1O A;  2WB1 N;  3TP0 A;  4M3G A;  1JT0 A;  3BG3 A;  1IV6 A;  2MW8 A;  4XID A;  3GTQ J;  1JTY A;  3HKZ N;  1MSE C;  5FJ8 J;  2L7Z A;  4DW6 A;  5JLW A;  4A3L J;  3DEW A;  2L7F P;  1Q1V A;  2DMP A;  3IH4 A;  5J3L A;  2CQX A;  5F27 A;  2R5Y B;  1IUF A;  4M3F A;  2JMW A;  4FCY A;  3DCF A;  4A69 C;  3LSR A;  1Y1V J;  3VPR A;  1JJ8 C;  1I50 J;  1IC8 A;  3HEF A;  2TCT A;  1B72 B;  2MSY A;  3HGG A;  1TWC J;  2Y9Y A;  3BQY A;  5IOY A;  1U9N A;  3ZOB A;  3W6V A;  2H1K A;  3JR9 A;  2YU9 J;  4QSH A;  1HOM A;  2HI3 A;  2E19 A;  2FJ1 A;  1IRZ A;  1ZR4 A;  4FE4 A;  3IV5 A;  1P7I A;  3BR3 A;  4V2G A;  3ZQH A;  5E3L A;  4IHX A;  5F0C A;  1IDY A;  2M34 A;  3SDG A;  3CDL A;  1RET A;  3A02 A;  3OOU A;  5IP7 J;  3BR1 A;  2O8K A;  3S1M J;  2G0E A;  5DTD A;  1O4X A;  2VKE A;  1FEX A;  2Y0S N;  3FIW A;  5C4X J;  4V2F A;  2JN6 A;  4D7M A;  1MBK A;  4QIW N;  1JKO C;  1IG7 A;  1ORK A;  3BR6 A;  2MG4 A;  4A3E J;  3GTG J;  2AHQ A;  1WPK A;  2P81 A;  5FKM A;  1WGX A;  5E3N A;  4AC0 A;  1EF4 A;  1QRY A;  3GTL J;  3ZQL A;  3K7A J;  2LLK A;  5EG0 A;  3LOC A;  3GBG A;  3I4N J;  3D1N I;  2JJ7 A;  2X48 A;  2LP0 A;  3BTC A;  2LY9 A;  5EEA A;  4HNV A;  3BQZ A;  1OJL A;  1OCP A;  2DJN A;  2EZK A;  3MKL A;  1PUF B;  2D5V A;  1MBF A;  1LFU P;  3HOY J;  4M3E A;  2JA7 J;  3B6A A;  4DYQ A;  2E2H J;  1H8A C;  2TRT A;  4FIS A;  3BTL A;  5IOZ A;  2YUS A;  3JRA A;  2DMT A;  3C2B A;  3GTM J;  1G2H A;  2XGD A;  1B8I A;  2HQ5 A;  2DA4 A;  3FK6 A;  5HOD A;  4IHV A;  3HGY A;  3RZD J;  2L0K A;  1JUP A;  2HDD A;  1HF0 A;  2PMZ N;  4NDL A;  3OIO A;  4A3I J;  3LSJ A;  2RAE A;  4FTH A;  4RDU A;  1BW5 A;  1JUM A;  1HCR A;  4G12 A;  5F0H A;  2NVQ J;  2LFB A;  1IGN A;  3CCY A;  1MH3 A;  1SFO J;  5JLX A;  9ANT A;  1FTZ A;  3WHB A;  2HXI A;  2R5Z B;  2CUE A;  2EBI A;  4BY1 J;  2EZH A;  1POG A;  2JA8 J;  5M5Y J;  4AUX A;  1RR7 A;  4M3B A;  4RBO A;  1CQT A;  3GTO J;  1ZKG A;  2DMN A;  2M0C A;  5K7Z A;  2HOA A;  5FKK A;  3H0G J;  3FIS A;  2VKV A;  5GPA A;  1ETO A;  2LTP A;  2NVT J;  1YRN A;  2K40 A;  3ZQC A;  4BKX A;  4A3F J;  1IJW C;  1NK3 P;  2XRL A;  3PM1 A;  1GT0 C;  1LE8 B;  2OF7 A;  3QPL A;  3WHC A;  1JTX A;  3MN2 A;  2DMQ A;  4UUS A;  5M5X J;  3O8H A;  5EZH A;  3JRF A;  4IEJ A;  1BL0 A;  2XPU A;  3Q3S A;  2ME0 A;  3BG9 A;  4MO7 A;  2EQR A;  2VPR A;  4A3G J;  3B6C A;  1GV5 A;  2R93 J;  2NVX J;  1S7E A;  5IP9 J;  1A6I A;  1RKT A;  3K2A A;  3TW7 A;  5EG0 B;  5EGO B;  4UUT A;  2NVY J;  4S0H B;  1RKW A;  4B3A A;  4BBR J;  3QPS A;  1AKH A;  4X6A J;  3JRI A;  2XB5 A;  3HOW J;  5E3M A;  4I6Z A;  2ID6 A;  1Z77 A;  3GTJ J;  1BW6 A;  3SJM A;  2YS9 A;  3S14 J;  1ZK8 A;  3S1Q J;  3HB9 A;  3BR0 A;  1RES A;  3BTJ A;  3NAU A;  4ABZ A;  4AYB N;  4A93 J;  3M4O J;  2I10 A;  3FKI J;  1JT6 A;  3G1M A;  2X6O A;  3Q0V A;  4GFB A;  3UKG A;  1DU0 A;  1K83 J;  5F04 A;  3HOU J;  3IH2 A;  1WI3 A;  1JKQ C;  5GPC A;  1K61 A;  2XGC A;  4C3H J;  5J1R A;  1NK2 P;  1TWG J;  1UG2 A;  3H3V K;  1OFC X;  1NTC A;  5IPA A;  2CUF A;  1T56 A;  3RQI A;  3L1P A;  4A3M J;  2E2J J;  3S2D J;  2HXO A;  1JKP C;  1GVD A;  2K9N A;  3HM5 A;  2R0Q C;  2FD5 A;  1U78 A;  1MBE A;  2NOG A;  2DA3 A;  3JRG A;  2O9L A;  2R5Y A;  2KDZ A;  1GUU A;  1FIP A;  1MBJ A;  1MBG A;  2L7M P;  3PO2 J;  1TWF J;  2WV1 A;  5EDN A;  2B63 J;  2IAI A;  3JRC A;  3LSP A;  2FX0 A;  2DA2 A;  5C3E J;  4Y7N J;  5FLM J;  1BA5 A;  3QQA A;  2HOS A;  4IHW A;  2CRG A;  3PO3 J;  1U8B A;  2DA1 A;  3ZQG A;  2ECB A;  2DA5 A;  4A3K J;  4FE7 A;  1QVU A;  4DYC A;  2XGE A;  4XIC A;  1HDD C;  2ECC A;  3TP3 A;  1F36 A;  1YRN B;  4J19 A;  1LFB A;  2COB A;  2ME6 A;  2NS7 A;  4XK4 A;  2LVS A;  3HOV J;  3HOZ J;  1TC3 C;  3BT9 A;  4D7N A;  2IEK A;  4MFE A;  1Z0X A;  2W48 A;  2CJJ A;  4A3J J;  1F43 A;  2CU7 A;  2ELK A;  4UUS B;  2LKX A;  1AHD P;  2X9D A;  3RZO J;  1FJL A;  3OSG A;  1U9O A;  3G1L A;  5EF6 A;  3TED A;  2N8G A;  1H89 C;  4D5F A;  4JX4 A;  4DZJ A;  4BBS J;  3G1O A;  3Q0W A;  3ZQI A;  3HDD A;  2ID3 A;  1AKH B;  4W1U A;  2Y30 A;  5GP9 A;  3A01 A;  2VUM J;  2JWT A;  2GBY A;  2Y31 A;  4JP0 A;  3Q0U A;  1X58 A;  4CYC A;  1SAN A;  1JKR C;  2GLO A;  3S2H J;  2OPT A;  1VFC A;  2DN0 A;  3BR5 A; 
#chains in the Genus database with same CATH topology
 4NQW B;  4XM3 A;  3S8P A;  5FRO A;  5ED4 A;  1H9T A;  3FXU A;  3R0J A;  3MD2 A;  3A1Y A;  1YO5 C;  5FKO A;  2ZSH B;  1B1B A;  2AXT C;  2D2W A;  2WBM A;  4PGH A;  2CGP A;  4M6Y A;  1IDZ A;  2BE5 F;  4A2U A;  2P5L C;  3OYB A;  3J7A Y;  4WXC A;  4KN7 X;  4M3D A;  1YJW I;  3VYU B;  1LNW A;  4A6E A;  4OOI A;  2ZXH A;  3AG2 H;  2QF7 A;  1YIO A;  4L5I A;  5TJJ A;  2OTL I;  4YIR X;  2ZNZ A;  4I76 A;  3CMY A;  4XLC A;  2A6T A;  2YU3 A;  2PBI A;  1XPX A;  2BW3 A;  2K9L A;  1NHA A;  2DK5 A;  5IY5 H;  2PFB A;  3K1N A;  1SVL A;  3K2Z A;  3JRB A;  3Q5F A;  1ZRF A;  5DUI A;  1OCC H;  3AKZ A;  1P7J A;  1TZL A;  2VXD A;  3I9V 2;  1E3P A;  3RSN A;  2MC4 A;  1QPI A;  3HOX J;  3KIO A;  4ZJZ A;  1R7J A;  2R5Z A;  2XAJ A;  4IL6 C;  3HSE A;  1B8I B;  2Z3Y A;  1KON A;  1WHU A;  1XCB A;  4BQA A;  2L9N A;  4LB5 A;  2WAQ N;  1EH7 A;  1MNM C;  2IS1 A;  3S2W A;  2KT0 A;  1I3Q J;  4BUP A;  4A3C J;  1UMQ A;  3H3Z A;  5CYV A;  2KIS A;  3NQO A;  1BJZ A;  1E3O C;  3R4K A;  4BDY A;  4CGZ A;  1I6H J;  2CQ7 A;  1BI3 A;  5K5Q A;  1U6G A;  4ESF A;  1LE8 A;  1G59 A;  2FQ3 A;  1FYL A;  4NC7 A;  5JR3 A;  3FK7 A;  3L2Q A;  2QKM B;  2NS8 A;  3A03 A;  4PFO A;  4XMY A;  2RNJ A;  3BR2 A;  2X1D A;  1ZEL A;  3KLO A;  4A3D J;  4I2O A;  4GDF A;  1QBJ A;  2O8X A;  1FLI A;  3QOE A;  3R6S A;  3A01 B;  1ZR2 A;  4QTR A;  3F6O A;  4HZF A;  4EM0 B;  1JXS A;  3MEX A;  2GM4 A;  3A2K A;  2HNH A;  2QZ8 A;  4A0Z A;  4JYK A;  3F8B A;  4XLA A;  5J8C A;  1HW2 A;  2O7O A;  3GFM A;  5BNG A;  5EGO A;  2W57 A;  4QPO A;  5JFR A;  2DFI A;  1K4S A;  4DYR A;  5FO5 A;  3SFI A;  3QU6 A;  3COA C;  1IF1 A;  2LKP A;  1D5V A;  2EH3 A;  1ETV A;  1T2K A;  5DS9 A;  3QP5 A;  3G71 I;  4XRS A;  5IYB J;  2E7W A;  2M8G X;  1J09 A;  4M71 A;  3QOD A;  4R8H A;  1XG1 A;  3F23 A;  2JTV A;  2DA7 A;  5LGT A;  1HA8 A;  2R7Z J;  2WB1 A;  1TW3 A;  3LSG A;  4EGZ A;  3U21 A;  5KVR A;  4U88 A;  5CVJ A;  5J40 A;  3S16 J;  1V5G A;  2WAD A;  3VOE A;  2LD5 A;  2DA6 A;  2P5V A;  1J5Y A;  4AVZ A;  1MW7 A;  4G7Z F;  3CMA I;  3IC7 A;  4D1Q A;  3BG6 A;  4XLN F;  1I1S A;  1F1Z A;  3LST A;  5FKN A;  2QUF A;  5KK1 A;  3K9T A;  4LG0 A;  1VI0 A;  1BOA A;  2K3F A;  3MMY B;  3RJP A;  3NRV A;  2E34 A;  2EV5 A;  2F6C A;  2OZU A;  1ZGJ A;  2MGQ A;  4ON0 A;  3U9G A;  4DGW B;  3IKT A;  3K70 C;  2NRA C;  4XRS G;  2EV0 A;  3S1N J;  3I71 A;  3GTK J;  1HSJ A;  2F5F A;  4EMS A;  3TP0 A;  4M3G A;  3BG3 A;  2ZC2 A;  3J81 Z;  2H1L A;  4HRI A;  2RV8 A;  2E5Z A;  2M4G A;  4V19 K;  1MSE C;  2QYO A;  5FJ8 J;  5JLW A;  2GOX B;  2L7F P;  2X51 A;  3F21 A;  2XVC A;  2CQX A;  1EH8 A;  5F27 A;  2JA2 A;  1IUF A;  3FXK A;  1TBX A;  4PSX A;  2BXZ A;  1O57 A;  3BPX A;  4LLG F;  1Y1V J;  3S3M A;  5FFZ A;  2JRM A;  2TCT A;  5HS8 A;  1A31 A;  3EUK L;  3MZH A;  2KFD A;  2FOK A;  2MSY A;  2Y0S A;  1E17 A;  3AG1 H;  5H2F C;  2BY0 A;  3BQY A;  4Y3O A;  1U9N A;  4LK1 F;  3ZOB A;  1R5I D;  1YX3 A;  2H1K A;  2YR2 A;  4IHS A;  4WF2 A;  1N77 A;  3K6G A;  1PVE A;  2GIV A;  2HI3 A;  3O2P E;  1I1G A;  4RB3 C;  3M07 A;  3C2H A;  5HNH A;  3IV5 A;  1ZR4 A;  2MH2 A;  4EJT A;  2DTR A;  4HF0 A;  4EQQ A;  1NG7 A;  5L3C A;  4ZTJ A;  5FLX Z;  3I0T A;  1BJA A;  4JOM A;  1J0R A;  2X4H A;  4P96 A;  1T95 A;  2O8K A;  1KYW A;  1L0O C;  2VKE A;  4IQ4 A;  2VIX A;  1OPC A;  2E71 A;  2OJE D;  3FIW A;  4Q4Z F;  1H0M A;  2WC2 A;  5F64 A;  4DBQ A;  3AL0 B;  1R23 A;  3BR6 A;  2HZD A;  2MG4 A;  4UV9 A;  5JHU A;  4XLP F;  3M1E A;  4A3E J;  2GA2 A;  2O6G E;  1CGP A;  1HKS A;  3WGH A;  3OS2 A;  4AC0 A;  1EF4 A;  3GTL J;  1F9N A;  2FRH A;  4L9V A;  1REP C;  2JSP A;  3LOC A;  2CW8 A;  1J7K A;  3I4N J;  3D1N I;  2L54 A;  2X48 A;  2LP0 A;  1D0Z A;  1OCO H;  3D5S C;  5D8L B;  3ZMZ A;  4EJO A;  1K78 B;  1PUF B;  2D5V A;  3BG7 A;  1WQ2 A;  4M3E A;  1KYZ A;  1KGS A;  2GXG A;  2JA7 J;  3QYF A;  1HKT A;  1R1T A;  2CQN A;  4ZC3 A;  3PUB A;  4FIS A;  3BTL A;  2DPD A;  4U0Y A;  1X4P A;  2MBF A;  4XL9 A;  3GTM J;  3J81 K;  3ZQ7 A;  2XGD A;  2OBP A;  5FRM A;  4BXU A;  2DA4 A;  1XX5 A;  3KYC B;  5HOD A;  4AIH A;  1ZN2 A;  3L09 A;  2IJL A;  3G4S I;  3CJQ B;  4OIO F;  1B59 A;  3OIO A;  4FTH A;  4M73 A;  4HF1 A;  1IXR C;  1T08 B;  2UXN A;  3M7G A;  5CVU A;  1R22 A;  1BW5 A;  3ZQQ A;  2CG4 A;  5CKT A;  1VQN I;  5F0H A;  2LFB A;  2DW4 A;  2QBY B;  5TRD A;  1SFO J;  5JLX A;  5JVG F;  5IT9 Z;  4ENN A;  3L7W A;  3DPT A;  2CO5 A;  2HXI A;  4BY1 J;  2EZH A;  3KX2 A;  3M9A A;  4M3B A;  3GTO J;  3ECO A;  1O3S A;  4G94 A;  2B0L A;  1HXD A;  2NS0 A;  5J4V A;  2DMN A;  1KA8 A;  3V8J A;  5GPA A;  4G7H F;  2G9W A;  2BY2 A;  3TO9 A;  2BBY A;  3GXO A;  4CCN A;  4HBL A;  2A07 F;  2E1N A;  2NNN A;  4BDZ A;  2PG4 A;  2K40 A;  4BKX A;  1DPR A;  5LLQ A;  1R6R A;  3I54 A;  1YLF A;  3RI4 A;  1HKQ A;  3VSL A;  3WTY C;  4Q5S F;  2STW A;  1MZB A;  2XAF A;  5FLX K;  3REO A;  2Z99 A;  1U5T B;  5FD6 A;  1SD5 A;  1OIS A;  2ZME A;  4ESJ A;  3MN2 A;  2Y0M A;  2DMQ A;  1S8N A;  3KP3 A;  3O8H A;  3JRF A;  1UJ8 A;  1F4K A;  3K1M A;  1BL0 A;  5CVV A;  2XPU A;  2A69 F;  1FBS A;  2ME0 A;  1WWX A;  2EQR A;  2IP2 A;  3S2D J;  3KP2 A;  1GV5 A;  2DXI A;  4LGW A;  1D3Y A;  1WKM A;  4S04 A;  1FX7 A;  3BP8 A;  3T5X A;  4RB2 C;  2KDO A;  4XKB A;  1YFH A;  1E0E A;  3I59 B;  3R61 A;  1VQ4 I;  1LUJ B;  2NXN B;  4AIK A;  1X1P A;  3GTJ J;  1BW6 A;  2F5E A;  2ADU A;  1R49 A;  1ZK8 A;  2R7R A;  2P5K A;  2GXB A;  4K2E A;  3HG9 A;  3HB9 A;  4LIT A;  1RES A;  3RPU A;  1RIO H;  2KZG A;  3GUD A;  3CD6 I;  2PJR A;  4ZZD A;  3C3W A;  2IW5 A;  1JT6 A;  1XTA A;  3FKI J;  3UKG A;  1K83 J;  3K4K A;  3A4C A;  1PP8 F;  1TTY A;  4HX7 A;  3EUH A;  4XN3 A;  2VC0 A;  2KMU A;  5IT3 A;  1XGN A;  1JKQ C;  3MKZ A;  4C3H J;  4IOA F;  1UB9 A;  3ZMV A;  1TWG J;  3HTS B;  1V5E A;  1NTC A;  2IA2 A;  3B73 A;  1T56 A;  3RQI A;  3PFI A;  2E2J J;  4ZYA A;  5TIS C;  2XDV A;  1JKP C;  2K9N A;  3HM5 A;  2NOG A;  2VQC A;  3F3X A;  2R5Y A;  3ABT A;  1MBJ A;  3PO2 J;  2WV1 A;  5EDN A;  3JRC A;  1V5F A;  5IT9 K;  2FX0 A;  1O3T A;  4BEH B;  2DA2 A;  2Q2E A;  2COM A;  3QQA A;  4TV7 A;  3FMR A;  1D1B A;  3G73 A;  1QVU A;  3A0B C;  4DYC A;  4XIC A;  1YX5 A;  1F36 A;  4HYE A;  4IQJ A;  3ZXS A;  4YG2 F;  3HOZ J;  4YFX F;  2EFQ A;  2FE3 A;  2IS4 A;  2CQK A;  1TQI A;  1S29 A;  2EA4 A;  5HLH A;  1Z0X A;  2M4K A;  1YOV B;  2ZKZ A;  1FSH A;  1F43 A;  2OZ6 A;  2CU7 A;  2MAB A;  4PGG A;  4HV5 A;  5F1R A;  2BY1 A;  4RB1 A;  1ZHF A;  4AWX B;  3CC7 I;  3HSF A;  4E7S A;  1SD4 A;  3H5R A;  2W4S A;  1VQ9 I;  1EH6 A;  2MFZ A;  4BS9 A;  2GQQ A;  4GRI A;  2VBX A;  3CCE I;  1MGT A;  4J01 A;  4XLF A;  2BZT A;  3F8N A;  4DZJ A;  3HC7 A;  1DUX C;  3TO6 A;  3Q0W A;  3CJN A;  3FM3 A;  4BJ6 C;  3PJR A;  2ZFW A;  1ZRD A;  2MD5 A;  1QO0 D;  2BVL A;  5TGT A;  3CUO A;  3C7J A;  2V1N A;  3D5L A;  3FXR A;  5E18 F;  1FPQ A;  4OMZ A;  5BMZ A;  1SVM A;  4JP0 A;  3Q0U A;  1SAN A;  2UWM A;  2HEO A;  4M74 A;  3SXY A;  2VBZ A;  4BE2 A;  4LJZ F;  2LY1 A;  2IGM A;  1QQI A;  2DTZ A;  1R5G A;  1UEL B;  4A6D A;  3JRH A;  3CCR I;  2K5C A;  2ZXW H;  4A3B J;  4G8X A;  2E1C A;  1XSD A;  4XRM A;  3BCB A;  3KFW X;  3F6V A;  3TBI A;  4IVN A;  4BHB A;  1ETQ A;  2QSF X;  2ZB9 A;  2R7T A;  1WH5 A;  1ZRE A;  1OR7 C;  3GTP J;  2WAF A;  1W5T A;  1VQ5 I;  3IWF A;  3RKQ A;  2K9Q A;  1TWH J;  1D1C A;  4HSR A;  4CCO A;  3ROU A;  3DPL C;  1ITY A;  4L18 B;  1LKX A;  1S9H A;  5E3O A;  4L5E A;  1G3Y A;  1T0F A;  2FMY A;  1V4R A;  3KZY A;  3V8L A;  1T33 A;  5CVR A;  2DMU A;  5M5W J;  3H36 A;  1U8R A;  1MMS A;  5E8I A;  3WGI A;  2JA5 J;  4XSZ F;  1UST A;  4L9J A;  3F8F A;  2H8R A;  3GME A;  4HNU A;  4GXO A;  1JE8 A;  3A0H C;  5M3F J;  4C3I J;  4F93 B;  5FFX A;  4IOC F;  2Z33 A;  5BOX A;  2AS5 F;  1YW7 A;  3FXL A;  4BXF A;  2ACJ A;  2FA5 A;  1AA7 A;  1QU3 A;  4I0B A;  5HLT A;  4IZZ A;  2R7Q A;  1ZGA A;  2X6W A;  1I39 A;  3CUQ B;  4HDV A;  3L2U A;  4HDU A;  4E7I A;  4BQQ A;  5AON A;  3LSI A;  4LOC A;  3OSF A;  2P7C B;  2QWW A;  3I64 A;  5J1Y A;  2VJI A;  1ZGW A;  2PQ8 A;  4OAY A;  4ITV A;  2FBI A;  1R71 A;  1DPU A;  1IZ1 A;  2VQH A;  1ON1 A;  1QVT A;  3EDP A;  2OQR A;  2XAG A;  2HOT A;  2HS5 A;  4B44 A;  3FDY A;  2RQP A;  4KIG A;  5CPR B;  1D5Y A;  2L02 A;  2MA3 A;  1FY7 A;  1B72 A;  1OR7 A;  3J7Y J;  2XPV A;  2YSR A;  4E70 A;  4I99 C;  3PNT A;  5EEG A;  1XMK A;  3I56 I;  4B43 A;  1ACI A;  2E60 A;  3I55 I;  1LB2 A;  4B3X A;  3BG5 A;  2A6E F;  2PN6 A;  1FC3 A;  3FF5 A;  4XON A;  4BY7 J;  3PUF A;  3BJO A;  2KIQ A;  3LNQ A;  2RQQ A;  4RMN A;  4Y15 A;  3QAH A;  1TWA J;  2Y2Z A;  4XOR A;  5B1A H;  2LR8 A;  3SFZ A;  1MH4 A;  5ICE A;  2RKH A;  1ETK A;  1TW2 A;  4R1H A;  4RGS A;  3JTH A;  4B1R A;  1BOB A;  2DYS H;  3GZ5 A;  4GO1 A;  5DD8 A;  3ULQ B;  1UHS A;  2JA6 J;  4G6Q A;  1W1W E;  2IT0 A;  4MQV A;  1ZTR A;  1S7A A;  5CQE A;  3BC8 A;  4QPQ A;  3IAS 2;  4HPQ A;  3ZPL A;  4WXD A;  3RIR A;  4JX5 A;  2LBF A;  5EZG A;  3MZ8 A;  2QVO A;  1HLV A;  3K4C A;  1XCV A;  1VND A;  2V1D A;  3EET A;  5IP6 A;  2OU2 A;  1K79 A;  1ZG3 A;  4XKW A;  3C18 A;  1P9Q C;  2V26 A;  2BW3 B;  5D5W B;  1XGS A;  2PMU A;  1Z05 A;  3DEE A;  3S1R J;  5E17 F;  5HS9 A;  1SD7 A;  1ENH A;  3LSM A;  1BIA A;  2HTS A;  2H27 A;  2OA4 A;  1W36 D;  4CCJ A;  3ERE D;  3W2A A;  4MQ9 F;  2F4I A;  3OS0 A;  1E3H A;  2WV0 A;  4BU2 A;  3QYE A;  4F92 B;  4P55 A;  5BS6 A;  4ZDO A;  2NVU B;  5C4J J;  2VC1 A;  2DDB A;  1JI8 A;  1IN7 A;  1TL8 A;  1UCR A;  3I4M J;  2LDU A;  4BXX J;  4EEF G;  2VI6 A;  1SD6 A;  4PCQ A;  3HUG A;  2E1O A;  2WB1 N;  2L9S A;  1H9G A;  1JT0 A;  1XN7 A;  1QA6 A;  5LEK A;  5K1Y A;  3VYS B;  1XMA A;  4DW6 A;  3DEW A;  1WZ2 A;  2Q1Z B;  2DMP A;  1R5H A;  4I01 A;  4M6X A;  4YFN F;  4ENJ A;  4GCV A;  2W85 A;  3VFZ A;  3I4P A;  4D0P A;  3IP4 B;  1Y56 A;  4M3F A;  4FCY A;  3GX4 X;  1X3Z B;  3K4N A;  4A69 C;  5J47 A;  1WJB A;  1I50 J;  2IVM A;  3WG7 H;  2XAS A;  1WJ5 A;  2X1C A;  4Y17 A;  4YFK F;  3EQL F;  1X1C A;  5A2Q Z;  1KQ9 A;  2ZJQ F;  3CTA A;  3SYT A;  2WTE A;  3FBN B;  3HHH A;  1Z6T A;  4NUB A;  3TOA A;  4KT6 A;  3L9F A;  1B6A A;  3JR9 A;  3OYK A;  4QSH A;  3WGG A;  3OYH A;  1YG2 A;  2BOL A;  2E19 A;  2FJ1 A;  3LA3 A;  5LGN A;  1IRZ A;  2VJ4 A;  3OL4 A;  4ENM A;  3BR3 A;  3OWT A;  2FBK A;  3FX3 A;  1V55 H;  3ZQH A;  2XF6 A;  5E3L A;  4EM1 A;  2OTJ I;  1MMG A;  2I8D A;  1LEB A;  1WJF A;  5F0C A;  2M1B A;  2HFH A;  4LK0 F;  3KP4 A;  2ZXJ A;  1RET A;  4Q47 A;  4IHT A;  4NQW A;  2LY2 A;  3VOD A;  2XRO A;  4IKF A;  1O4X A;  1Z1D A;  1WJE A;  4Y4R A;  1FEX A;  2Y0S N;  2JVH A;  2VOD A;  5C4X J;  4V2F A;  2GXA A;  2FNP A;  3ISP A;  1JKO C;  4HF2 A;  4BYY A;  1IG7 A;  1ORK A;  1FBQ A;  2DLL A;  3JAM Z;  1WPK A;  2CYY A;  3I5U A;  1QRY A;  3TDZ C;  3K7A J;  2LLK A;  1QHG A;  1PP7 U;  1AOY A;  1EKE A;  2M3A A;  3GBG A;  1W7P A;  4UB8 C;  2LRD A;  2JJ7 A;  2WWY A;  5JI6 A;  3ZCO A;  1S6L A;  3WE3 A;  1OJL A;  1OCP A;  2DJN A;  1LFU P;  4C30 A;  1WJC A;  2LRE A;  1OYY A;  4ZZL A;  1HBX G;  3H9J A;  5E1W A;  4CCM A;  2MD0 A;  5IOZ A;  1P4A A;  1IUY A;  2DFH A;  4RAF A;  2MH9 A;  4OIR F;  3J80 Z;  2M5W A;  3JRA A;  2DMT A;  4XOP A;  4IX7 A;  1G2H A;  2DO7 A;  3V7S A;  4DNC A;  1B8I A;  2D1V A;  1M1E B;  3FK6 A;  1VQ7 I;  2XF5 A;  4ETS A;  1JUP A;  5L3B A;  2HDD A;  1FBU A;  3OYJ A;  1JGS A;  4NDL A;  4R79 A;  5L3D A;  4U87 A;  3OR1 C;  1LFP A;  2RAE A;  2LG4 A;  4RDU A;  4KFC A;  1JUM A;  2ISZ A;  2A05 A;  1XDU A;  4PDK A;  1OCR H;  2JRT A;  1MH3 A;  4D9J A;  9ANT A;  4LB6 B;  1IN4 A;  1FTZ A;  1MJA A;  2AQE A;  3WHB A;  2CUJ A;  5A2Q K;  1XB4 A;  4KMU X;  4RS8 A;  3EYI A;  3P5J A;  1FP2 A;  4P9U A;  5JVT A;  2HYG D;  1X4O A;  3ABM H;  1G8X A;  3E5X A;  2BYV E;  4A0Y A;  3LSH A;  1HST A;  1ZKG A;  2JSC A;  4CO8 A;  2BEO A;  2HOA A;  3TL4 X;  1S3J A;  4E6K G;  1FOK A;  3H0G J;  3TMO A;  1WJD A;  5LHH A;  5D6F A;  3RPQ A;  2EB7 A;  1HC8 A;  3E0J B;  4ANJ A;  2PMH A;  5E1X A;  4A3F J;  3OIP A;  4RA2 A;  1NK3 P;  2XRL A;  3FBI B;  1Z91 A;  2OF7 A;  2VKD A;  3QPL A;  4A0X A;  5H6Q A;  1ZH5 A;  4B47 A;  4A5N A;  4WXH A;  1ERD A;  5M5X J;  2EIM H;  2P4W A;  5EZH A;  3D0S A;  1C0W A;  4IEJ A;  1R1U A;  3ERM A;  3LQR A;  4UXN A;  4E7L A;  3Q3S A;  5AIQ A;  1LDK B;  2KRH A;  4KN4 X;  2BGC A;  2GOM A;  1S7E A;  2DT5 A;  5IP9 J;  1A6I A;  2F5V A;  3JAM K;  3MKY B;  1RKT A;  3K2A A;  3TW7 A;  2EIL H;  2CWE A;  4S0H B;  1AKH A;  1CF7 B;  4X6A J;  4PFP A;  3JRI A;  5J6X A;  5E3M A;  2A61 A;  2ID6 A;  2XSJ C;  3QWL A;  2L7K A;  3SJM A;  3S14 J;  1Y8Q B;  2EPF A;  1D0X A;  3DU6 A;  3BR0 A;  2ZBK A;  3NAU A;  3BWG A;  4GYG A;  1BC7 C;  2PEX A;  3M4O J;  2K9M A;  1F5T A;  3G1M A;  4PJM A;  2X6O A;  1SMT A;  3BZK A;  3Q0V A;  5J4Y A;  4GFB A;  4XLE A;  3KYL A;  2NAZ A;  3J80 K;  2V1U A;  3HOU J;  3OYC A;  2Y48 A;  1WI3 A;  4KYW A;  1EJ9 A;  4I98 B;  3OYA A;  5J1R A;  2MYS A;  3QRF F;  1UG2 A;  3H3V K;  4XBF A;  3IUO A;  4A3M J;  2QQ9 A;  2QM3 A;  4RB0 A;  2OV7 A;  2RN7 A;  2FD5 A;  2B9S A;  3HZJ A;  3W3C A;  3FHZ A;  2AXL A;  4GYI A;  5F6F A;  2KDZ A;  4Y33 A;  1GUU A;  2AQF A;  3ABL H;  3NWS A;  1MBG A;  3L2V A;  1MMA A;  1QZZ A;  1T39 A;  1W5S A;  2B63 J;  3HPH A;  1IN8 A;  1Y0N A;  1YQA A;  4Y7N J;  1BA5 A;  1YTY A;  5ERI A;  5LBQ A;  4HQM A;  3WU2 C;  2DA1 A;  2QQA A;  2ZME C;  5K5R A;  1U8B A;  4WWC A;  2VON A;  1DP7 P;  2DAO A;  4OIP F;  2DA5 A;  4A3K J;  4L0Z B;  3FXJ A;  1QZE A;  3BJ6 A;  2V7F A;  5DCM A;  3KET A;  2FNA A;  2L4A A;  2XGE A;  2J5O A;  2JT1 A;  3SHF A;  2EFN A;  1BI1 A;  1P6R A;  2QA4 I;  4LMY A;  3UNG C;  2NS7 A;  3M1C A;  3CF5 F;  2LVS A;  3E6D A;  3HOV J;  3K4J A;  3HL2 A;  3VB2 A;  4BJT A;  4CCL A;  4HST A;  1XGO A;  2W48 A;  4A3J J;  1NH3 A;  2JUC A;  1AHD P;  3H1C A;  1DGW Y;  2G7H A;  4XKV A;  4IRI A;  1FJL A;  3OSG A;  1U9O A;  2KP6 A;  3G1L A;  2JPB A;  1JHH A;  1R00 A;  3M8E A;  1T8I A;  3ZRG A;  1SVO A;  4CIC A;  4JX4 A;  1J9I A;  5DV5 A;  1WRJ A;  5D4R A;  3RQ4 A;  5H6R A;  2YPR A;  1ONV A;  2ZNY A;  5HNF A;  2KIM A;  2Q8K A;  2GA1 A;  5ILV A;  4MHG A;  4IJA A;  2HPM A;  1SFK A;  3TQN A;  2Y30 A;  3E5U A;  1X1D A;  1N75 A;  4JK1 X;  2GBY A;  3EUH C;  1QHH D;  1D8J A;  4UNO A;  3L2R A;  2CV1 A;  3WTS C;  4CYC A;  5E20 A;  2GLO A;  4FT8 A;  3ZP5 A;  2OPT A;  1VFC A;  3BDD A;  2DN0 A;  3W6J B;  4AID A;  2PJR B;  3GFI A;  5CQG A;  4UB6 C;  1K6O A;  3M3Y J;  4MNU A;  3TOB A;  2XHK A;  3CLO A;  3E6M A;  2BV6 A;  2CQQ A;  4FQG A;  5IYD J;  1OLT A;  2O61 A;  2KRF A;  3OYF A;  2E1M C;  4NB5 A;  2DOE A;  4DOZ A;  5LD2 C;  5CVI A;  3E6C C;  2EFP A;  3T0Y A;  4IHY A;  4N9I A;  3OL3 A;  1OKR A;  4HG2 A;  4F55 A;  3KP5 A;  2V6C A;  5KHD A;  3H5A A;  3NAR A;  2DK8 A;  3W2W A;  4LIV A;  3L00 A;  1FP1 D;  1KU7 A;  1X2M A;  3NWT A;  1V54 H;  2IXS A;  1W0U A;  2PX9 A;  2Q2E B;  2K85 A;  2DOF A;  4P9F A;  3BRO A;  2P6S A;  3PQJ A;  2BXY A;  4WK8 F;  1LVK A;  2FSW A;  3S17 J;  2K7L A;  2IGN A;  3O6B B;  2M9H A;  2B7E A;  3VWB A;  3CZ6 A;  2ESH A;  4H4K C;  2XAQ A;  1IW7 F;  4C3J J;  2UXX A;  1QNT A;  1V3F A;  5K7H A;  1SEU A;  2P7V B;  2FF4 A;  1ZQ3 P;  2EZL A;  4W97 A;  3U1D A;  2CFX A;  3OS1 A;  5AIP A;  1IN5 A;  2UUZ A;  1YIJ I;  4AVP A;  4D5C A;  5E8G A;  5KAI C;  3AAF A;  3CME I;  3UR3 C;  2BHZ A;  1GDT A;  4CH7 A;  1XD7 A;  2LK2 A;  2M0M A;  3S32 A;  5D4S A;  4IRG A;  3RYP A;  2EZI A;  2W24 A;  2DT6 A;  2VBW A;  2VQL A;  1QZY A;  2DDA A;  2OCE A;  1R58 A;  1BM9 A;  4DIQ A;  1XS9 A;  1JUS A;  3DP7 A;  2STT A;  4N9H A;  2DQR A;  1R9T J;  3C2G A;  4ZYH A;  1I5Z A;  3GW2 A;  2Y9Z A;  3LA7 A;  5D5X B;  4BL0 B;  1A36 A;  3MVP A;  4S05 A;  1LJ9 A;  1MJB A;  1RZ4 A;  2K02 A;  1APL C;  3I3L A;  2AO9 A;  1WJA A;  5F1J A;  2HYJ A;  3DFG A;  2VJJ A;  1ETY A;  4M6V A;  5FKL A;  1LPQ A;  2PI0 A;  4M9Z A;  4KIB A;  1X1B A;  3ASN H;  1G6N A;  3PNV A;  4P1W A;  1T6S A;  1ZRC A;  2Z5U A;  1VF9 A;  2H6B A;  3I59 A;  1O7F A;  1FOY A;  2DOD A;  3X2Q H;  1VTN C;  1MSF C;  4EJW A;  1OQY A;  4FET A;  3F0C A;  3CP8 A;  3H35 A;  4G6T B;  2FOW A;  1JGG A;  3PIP F;  3G2B A;  1T0F C;  1BBY A;  1KU9 A;  3PNY A;  3HXL A;  2QCO A;  1FSE A;  3IH3 A;  3DQV C;  3QYB A;  1D8K A;  2FQ4 A;  1UG0 A;  3ABK H;  1Y8R B;  3HKZ A;  3DXJ F;  4HX4 A;  4UUV A;  5IYC J;  3WOD F;  2BY3 A;  2M45 A;  1ZYR F;  2FXA A;  3ZMU A;  2ZSI B;  4DZP A;  2R7V A;  2JQ7 A;  1VQO I;  2KHM A;  2LNB A;  3DWL E;  3OMY A;  4XR6 A;  4QLC U;  1DQU A;  4MLO A;  1TQP A;  4YIF A;  5K7F A;  2IBD A;  1FNN A;  2H8W A;  5LGU A;  3FXO A;  4F52 A;  2OC6 A;  4JX6 A;  4ASN A;  2D45 A;  3RYR A;  3CJR B;  4DQ2 A;  4CZC A;  1JJ6 C;  3DBL B;  3J7Z I;  3HRT A;  1Z3Y A;  3DLL F;  4G9Y A;  1EV7 A;  2DYR H;  1Z9C A;  3MZY A;  3QPT A;  4C2M J;  2CFO A;  4ZH4 F;  1MIJ A;  2QSG X;  2GZW A;  1B9M A;  2M7B A;  5E79 C;  3FMQ A;  1GXP A;  1A5J A;  4CSW A;  2M8E A;  4AD9 A;  4EVI A;  2HVR A;  2LH9 A;  1IV6 A;  3ELK A;  1BR1 A;  2E5N A;  3DTI A;  2MW8 A;  1Z3X A;  2M87 A;  4IO9 F;  4A3L J;  4UHT A;  5J3L A;  2CSO A;  4ZYD A;  3S93 A;  2HU9 A;  2JMW A;  2X85 A;  1SFX A;  3SEQ A;  1MDM A;  2O0Y A;  3DCF A;  3K69 A;  3VPR A;  1JJ8 C;  3HYI A;  3OYE A;  3CC2 I;  1B72 B;  3LFK A;  2OCC H;  2PJP A;  1QGP A;  1FOX A;  3PQK A;  1YJ9 I;  2LYC A;  2R7X A;  2Y9Y A;  3W6V A;  2YU9 J;  5DUK A;  1Z67 A;  4XSX F;  1P7I A;  3HIF A;  4ENK A;  2FU4 A;  1R1V A;  1BC8 C;  2DQL A;  3N97 A;  4V2G A;  3V7C A;  1USS A;  3L2W A;  1PUE E;  2VBY A;  2L2O A;  2HKX A;  1FYK A;  1OMI A;  2M34 A;  2IRF G;  2L01 A;  3CDL A;  2QSH X;  3CUQ C;  2V9P A;  2QEN A;  3A02 A;  3BJA A;  4EJU A;  5GTI C;  5IP7 J;  1RC9 A;  3BR1 A;  3ESW B;  3S1M J;  2G0E A;  4BGD A;  2LMD A;  1YIT I;  3FKJ A;  2JN6 A;  4L9T A;  1MBK A;  2LBF B;  4QIW N;  2R3S A;  1G3T A;  5DEQ A;  1W5C C;  3P9I A;  2VOP A;  3GZN B;  4I09 A;  4B09 A;  4NBQ A;  4BQN A;  4PSW A;  3VDX A;  2AHQ A;  3BLY A;  2EV6 A;  3WTV C;  2PMZ A;  3N4M A;  5LRR A;  2QKL B;  2W7N A;  4E7H A;  5EG0 A;  4NC6 A;  3D5R C;  1P4X A;  2V1X A;  3BTC A;  2LY9 A;  3G3Z A;  5EEA A;  3DLA A;  5DYM A;  3CCM I;  3GEZ A;  1YS6 A;  4HNV A;  2EZK A;  2VE8 A;  2W00 A;  2ESN A;  1MBF A;  4JBA A;  3GFJ A;  4RM3 A;  1KQ0 A;  3H9Q A;  4EJV A;  4O5V A;  2K27 A;  4DYQ A;  4FX4 A;  2TRT A;  3HRU A;  1H8A C;  1LQ1 A;  2E2H J;  1D1A A;  1DGR M;  3L2C A;  1STZ A;  4ZTF A;  3ZGK A;  4J00 A;  4CDG A;  4AM3 A;  3GFL A;  2ZFU A;  3JCU C;  4IHV A;  3ZN0 A;  2M30 A;  3HGY A;  2JVG A;  3RZD J;  2L0K A;  5H20 A;  4XQF A;  2RGV A;  1E2X A;  3AG4 H;  4HA8 A;  2C6Y A;  3CUQ A;  4OIQ F;  1JHF A;  4U0W A;  1HCR A;  4G12 A;  3KE2 A;  3W2V A;  2NVQ J;  1S7O A;  3CCY A;  2HOE A;  5J8F A;  1N25 A;  1KZH A;  2VXZ A;  2KIF A;  3CP2 A;  1ZAR A;  1PYV A;  2R5Z B;  2IA0 A;  2KIU A;  3OYN A;  3K0L A;  3DPU A;  4N0B A;  1P4W A;  5M5Y J;  3WTT C;  4RBO A;  1CQT A;  5B66 C;  1X1A A;  3OYD A;  2L4M A;  2LSO A;  2P6T A;  1R4N B;  1ZG1 A;  1MD0 A;  3FIS A;  3CO7 C;  2XC7 A;  3QOP A;  4A12 A;  4E7Z A;  2NVT J;  4RGX A;  2VL8 A;  3ZQC A;  1VQM I;  1YRN A;  4LLN A;  4RGU A;  4HAM A;  1IN6 A;  1GT0 C;  1FZP B;  1LE8 B;  4MEX F;  5DDG A;  2KRC A;  2ICW G;  3CLQ A;  1G4D A;  2BHY A;  3FHN A;  1FT9 A;  4AYB A;  5KNL A;  3VYR B;  4UUS A;  3H5N A;  2JUG A;  4Z2Y A;  3ASO H;  3K4B A;  1XDS A;  4MO7 A;  2VPR A;  2XF7 A;  1RUN A;  4A3G J;  4ZYE A;  3Q9S A;  3B6C A;  2R93 J;  2UV1 A;  2NVX J;  3G6E I;  4CXF A;  1VZ0 A;  1WVR A;  4L0Y B;  4KDP A;  4FAS D;  1MMD A;  5ICC A;  5EGO B;  4UUT A;  1PDN C;  1RKW A;  1W7P B;  2LF7 A;  3MCZ A;  4BBR J;  1XSV A;  2E35 A;  3IRQ A;  2ZCW A;  3GCM A;  4BE1 A;  4YRV A;  4I6Z A;  2WAE A;  1FMW A;  3IHU A;  3W6K B;  3R0A A;  4LLL A;  3F22 A;  2HTJ A;  1SC7 A;  5GAE J;  2ZXI A;  4ABZ A;  1YW9 A;  3U1K A;  1P92 A;  4NC8 A;  3EPZ A;  1DU0 A;  2XIG A;  5F04 A;  4PJN A;  4C2T A;  3IH2 A;  3AFH A;  3DKY A;  6PAX A;  1J2X A;  5GPC A;  2DT7 B;  2XGC A;  3B02 A;  1OFC X;  5E1Z B;  2F4M B;  2CUF A;  2E36 A;  3ONQ A;  1W4M A;  2XAU A;  3F9K A;  3L1P A;  2K4J A;  1G3W A;  2EFO A;  5KCM A;  1U78 A;  1L3L A;  4G6D A;  3SDB A;  2O9L A;  4KNY A;  2VE9 A;  1X3U A;  1FIP A;  1Q1H A;  2NNY A;  4LG0 B;  3IL2 A;  1IRF A;  3KEQ A;  2F4O B;  2IAI A;  3SZG A;  2HR3 A;  3LWF A;  1TP4 A;  3T1B A;  3TDU C;  5FLM J;  3ZMS A;  4M9S A;  1S5L C;  2JPC A;  3GVA A;  2Z16 A;  3WU1 B;  2CRG A;  4RLF A;  3PO3 J;  3ZQG A;  3P9C A;  1YS7 A;  4BJ5 C;  2OD5 A;  3CC4 I;  1W7P D;  2HDW A;  2CH0 A;  5EEH A;  3GLX A;  5FRN A;  4C2U A;  3BY6 A;  4YEJ A;  2YX7 A;  1MND A;  2ECC A;  1S72 I;  2HQN A;  4HX8 A;  2W1O A;  5GAG J;  4II3 A;  4XK4 A;  4D7N A;  2R7S A;  4MFE A;  1YW8 A;  5DD4 A;  1FYM A;  4PZJ A;  3DTK A;  4Y13 A;  1P2F A;  2ELK A;  4OWR B;  2LKX A;  1MNE A;  4OMY A;  1I3A A;  1BI2 A;  1Z7U A;  3RZO J;  2VLA A;  3KEY A;  1X3W B;  5EF6 A;  2HGC A;  1H89 C;  4D5F A;  3RKY A;  1UFM A;  1XGM A;  3CDI A;  1ON2 A;  2O5R A;  3ZQI A;  5B3S H;  4CA0 A;  3GLL A;  3S3N A;  3HDD A;  1YE9 A;  1AKH B;  2MC3 A;  2OQG A;  4W1U A;  4BNC A;  4EM2 A;  5GP9 A;  3A01 A;  1J75 A;  2JWT A;  1BR2 A;  3EYY A;  4UVC A;  2VUM J;  2IA1 A;  2L5Q A;  2NOJ B;  2VQG A;  1U2W A;  3WTU C;  3GWZ A;  4QWQ A;  1I6X A;  1OCZ H;  3KLN A;  3S2H J;  2R7D A;  3FWE A;  1ZG5 A;  1X2N A;  4RM2 A;  4BHC A;  2V9V A;  2R7F A;  4XNF A;  2Z2S B;  3HJE A;  1ETX A;  2I5U A;  1FTT A;  1R4M B;  2M2E A;  4AU7 A;  3O8G A;  2VAS A;  3JW4 A;  2WAQ A;  3OOP A;  1LDD A;  3SZT A;  3LQQ A;  1LEA A;  2EA2 A;  5BQT A;  2K4B A;  2K3P A;  4EV0 A;  5DCF A;  1WCM J;  2GAU A;  2VN2 A;  3CQZ J;  3K4L A;  3E7L A;  5JHF A;  2L9R A;  4ZDP A;  4GGG A;  4MEY F;  1RNL A;  1H88 C;  5M3M J;  1BR4 A;  1IO2 A;  2ZJ2 A;  3H0D A;  1Y39 A;  4E7J A;  2H09 A;  1VQK I;  4KT5 C;  2DOA A;  4FHT A;  4N4N B;  4I02 A;  2GWR A;  4U7D A;  2R92 J;  3FXM A;  2OAZ A;  2KQR A;  3KP7 A;  4HNT A;  2XSD C;  3SQN A;  1ZLK A;  1KU3 A;  5DCM B;  3S15 J;  3HPG A;  1O3R A;  3F72 A;  3DF8 A;  2LF8 A;  3LSK A;  5FGM A;  3CMM A;  4XRF A;  5GAD J;  3V8K A;  2HKO A;  3GZ6 A;  3H3U A;  2RVC A;  1KU2 A;  3MAJ A;  3MQ0 A;  4M9X A;  3C1D A;  4OU0 A;  2KJC A;  3BZC A;  2XV4 S;  4A5M A;  3E5Q A;  5ICG A;  2JK3 A;  3K70 D;  1IXS B;  1HDP A;  1HW1 A;  2JZY A;  4Y52 J;  4LFU A;  1T38 A;  2VB6 A;  1DP3 A;  3AL0 C;  1Y6I A;  1J59 A;  5LFA A;  2G7U A;  3GF2 A;  4MTD A;  1BI0 A;  3LA2 A;  4PUS A;  3M8F A;  5D5V B;  3JRD A;  3PIO F;  3JSP A;  1OCT C;  2WY7 Q;  4LIU A;  2HVS A;  2XB0 X;  5C44 J;  3TKY A;  4XN0 A;  2O03 A;  1IRG A;  3TW6 A;  1FIA A;  2KL4 A;  2X6Y A;  3Q9V A;  3OYL A;  4U0V A;  2HDC A;  1TT0 A;  2MLK A;  2OUM A;  2VPL A;  3JRE A;  5J1U A;  1Z7L A;  3OYM A;  4PJ0 C;  5HLI A;  1XC5 A;  2RRE A;  4U7B A;  5HLG A;  4N4O B;  5D6E A;  2Z1D A;  4CYC B;  2X1E A;  5L3G A;  4KUM A;  2FUG 2;  2KKO A;  1CF7 A;  3TGN A;  3PSI A;  4RAZ A;  4UY8 I;  1GV2 A;  4CHU A;  3ZQF A;  2DPU A;  4MIM A;  5F0F A;  2ZME B;  3U2R A;  1YI2 I;  3WTZ A;  1W0T A;  3VSK A;  2V9K A;  2FEZ A;  4F3Q A;  2DU9 A;  4NNJ A;  1MKM A;  4I0A A;  1YYV A;  1A35 A;  2F2E A;  1MMN A;  2E2I J;  4JQF A;  2DFE A;  1DU6 A;  1Y1W J;  2R7W A;  4O6J A;  2A6H F;  4HW0 A;  2P0W A;  3KP6 A;  4MFD A;  1WH7 A;  1IXC A;  1WI9 A;  1U0J A;  2W82 A;  2EIJ H;  4CZZ A;  4B4C A;  1AU7 A;  3JTG A;  3MWM A;  2XGX A;  2HZT A;  5EYR A;  3PL8 A;  3BTI A;  3HBL A;  3P7N A;  5L3E A;  4RGR A;  4PJL A;  3F8C A;  2F5D A;  3KEO A;  1SFE A;  4X1E A;  2Y75 A;  4HEA 2;  2W84 A;  2XPW A;  2D1H A;  2YX4 A;  3WG9 A;  4IPA A;  2VT2 A;  1MBH A;  1K78 A;  5FLV A;  1PUF A;  3LAP A;  3T8R A;  3HOT A;  2W25 A;  1RPW A;  1ETW A;  2HQA A;  2K9S A;  4KMF A;  2ELH A;  2O3F A;  1K6Y A;  1U5T C;  2CW7 A;  2M7A A;  5F08 A;  1K4T A;  3KYD B;  2H94 A;  5HDG A;  2ZJP F;  2H6C A;  1GXQ A;  4RAG A;  4XID A;  3GTQ J;  1JTY A;  3HKZ N;  4AIJ A;  3CCS I;  2L7Z A;  3MKW B;  1GHC A;  5DM6 F;  1A6Q A;  3LFU A;  1Q1V A;  4L9N A;  3QPH A;  3IH4 A;  3LAJ A;  2R5Y B;  3PSF A;  3JSO A;  2XKO A;  2E1M B;  2EIK H;  4C9Y A;  3M8J A;  3ZR8 X;  3R60 A;  4IXA A;  1HQC A;  3LSR A;  1IC8 A;  4CYD A;  1OYI A;  3HEF A;  3CCL I;  2RC4 A;  1LDJ A;  4BAY A;  1R36 A;  2QBY A;  3HGG A;  2CUZ A;  2X6X A;  3WE2 A;  1TWC J;  2V6E A;  4CCK A;  3HSR A;  4BH9 A;  2HPI A;  1D0Y A;  5IOY A;  1FOW A;  4UV8 A;  4UVA A;  5KAF C;  3V7R A;  1HOM A;  1TQM A;  4FE4 A;  3BPV A;  2L3D A;  4BE0 A;  1OYW A;  2TDX A;  3KZZ A;  3RPU D;  3CES A;  4IHX A;  1YJN I;  1ULY A;  2P8T A;  1IDY A;  2LKS A;  4HOB A;  3SDG A;  5ILU A;  2HWV A;  3FM5 A;  3OOU A;  2ZJR F;  1U5T A;  3IKV A;  3ZMT A;  2HQR A;  2WA0 A;  5DTD A;  1Z6R A;  2QQ8 A;  2VJ5 A;  4PK4 A;  3OV8 A;  1BIB A;  3OYI A;  4D7M A;  4FX0 A;  2QGU A;  4NHJ A;  2CV0 A;  3OYG A;  2HVQ A;  2KJB A;  2IGO A;  3GTG J;  4HLY A;  2P81 A;  5FKM A;  3K10 A;  3CCQ I;  3WU0 A;  1UHW A;  1WGX A;  3LL7 A;  5E3N A;  1K7A A;  3ZQL A;  3T8T A;  3OIQ A;  4RLQ A;  2ZO4 A;  2F48 A;  2CV2 A;  2EK5 A;  3SEZ A;  5GAH J;  5FD5 A;  1RI7 A;  3IRR A;  3BQZ A;  1IRX A;  3F8M A;  3MKL A;  5EJC A;  3OY9 A;  3WTX C;  2Z9O A;  3HOY J;  5HOO A;  2CS3 A;  3B6A A;  2Y69 H;  2ETH A;  2L9V A;  3E3V A;  2IS2 A;  1TNT A;  3ZMD A;  2YUS A;  5LHI A;  2XKP A;  2UZK A;  3I53 A;  3C2B A;  1XMX A;  3ZN1 A;  3ECH A;  5B5E C;  1VQ8 I;  2HQ5 A;  1FMV A;  4HV6 A;  4LG3 A;  3ML6 A;  4XLH A;  4MTE A;  1ODD A;  2R7U A;  1HF0 A;  2PMZ N;  1MDM B;  1TLH B;  4A3I J;  1Z21 A;  3LSJ A;  2IS6 A;  4HLX A;  2QEX I;  1LVA A;  5LHG A;  1SMY F;  1AWC A;  3VYT B;  5DM7 F;  4L5J A;  1IGN A;  2KPM A;  3DKX A;  5D8K B;  3KZI C;  3CJT B;  4E4H A;  3AG3 H;  2GIZ A;  5HDK A;  4KIF A;  2QQB A;  2CMP A;  1RRJ A;  3FMS A;  4EAT A;  2CUE A;  2EBI A;  4XKC A;  1B4A A;  1WFX A;  4BEH A;  2MLG A;  1POG A;  2JA8 J;  2VT3 A;  5HS7 A;  3BCA A;  4AUX A;  1RR7 A;  3DBR B;  3V4G A;  3OR2 C;  2DFF A;  3V42 A;  2M0C A;  2RNG A;  5K7Z A;  4EGY A;  4O3M A;  4UVB A;  5FKK A;  1X19 A;  2VKV A;  3CCV I;  1I27 A;  1ETO A;  5HDN A;  3E6B A;  5B1B H;  2LTP A;  3FZV A;  2A5W A;  3BZ6 A;  1DDN A;  1A04 A;  1IJW C;  3CO6 C;  1MJ9 A;  3PM1 A;  1SAX A;  2R4G A;  1VQ6 I;  1G3S A;  3HHG A;  2EWN A;  4II2 A;  3WHC A;  4P5O A;  4KA4 A;  1JTX A;  1VQP I;  2HYF A;  1TNS A;  4BQO A;  1GLN A;  4F7Z A;  4X0G A;  2EIN H;  1HW5 A;  5GTH C;  3RCO A;  5K5O A;  1SAU A;  3BG9 A;  5FB2 A;  3DEU A;  5HVQ C;  3I58 A;  2KLO A;  2PLY A;  4OAZ A;  2EJR A;  3HOS A;  2R7O A;  3KPH A;  2BVM A;  1UAA A;  1UHM A;  5EG0 B;  3TO7 A;  2NVY J;  2E7X A;  4I7H A;  3RKX A;  4B3A A;  3QPS A;  3DV8 A;  5ICF A;  5LEJ A;  1FWZ A;  2XB5 A;  3HOW J;  3IWZ A;  5BPI A;  1Z77 A;  4KJZ A;  1RR8 C;  3EUA A;  1SFU A;  2YS9 A;  5BPD A;  1PJR A;  1IV8 A;  1GVJ A;  3S1Q J;  3K4M A;  5CLS A;  3FXQ A;  4RAY A;  1UZC A;  3BTJ A;  1ZAO A;  3H92 A;  3GYH X;  1N78 A;  2QLZ A;  4AYB N;  1BN5 A;  4A93 J;  2I10 A;  4MGR A;  3GO5 A;  4KIC A;  1B9N A;  3LMM A;  2DBB A;  2CW0 F;  2EFW A;  3CDH A;  4H0E A;  2FML A;  1TT5 B;  2LC2 A;  4B48 A;  1K61 A;  2A68 F;  1NK2 P;  5D5U B;  1W36 C;  4ESB A;  5IPA A;  4KIT B;  4LD5 A;  4F91 B;  2XUB A;  3HTU A;  4Q48 A;  2FBH A;  2HXO A;  1GVD A;  2R0Q C;  1U3E M;  4KIS A;  1EA3 A;  2K86 A;  4CUG A;  1MBE A;  4WCG A;  3CCU I;  3JRG A;  2DA3 A;  3PFY A;  3QU3 A;  4WX9 A;  4Z6Y A;  3HRM A;  1RUO A;  3NEU A;  3RDI A;  4DBR A;  4G7O F;  2L7M P;  2DCE A;  1TWF J;  2VKH A;  4YEL A;  1KQ8 A;  3LSP A;  2Q0O A;  1Y0U A;  3SZP A;  5C3E J;  1XSX A;  4YII A;  1O7L A;  3N05 A;  1YHQ I;  3KCC A;  2RDP A;  3DTE A;  4B8X A;  3MFK A;  2HOS A;  4IHW A;  4XOT A;  2A3S A;  2DI3 A;  2J5P A;  3DBH B;  3HUG B;  2ECB A;  2KZV A;  3S3O A;  2XAH A;  3CCJ I;  2V79 A;  4FE7 A;  2WY8 Q;  3K1P A;  4M72 A;  1QPM A;  1ZLJ A;  5L3F A;  3RKW A;  1HDD C;  3DKW A;  3CF2 A;  3TP3 A;  1YRN B;  1IAW A;  2IPQ X;  4PJJ A;  4J19 A;  2VOO A;  1LFB A;  2COB A;  2ME6 A;  4HQE A;  3E1S A;  2ISY A;  1TC3 C;  3BT9 A;  3BOQ A;  2F5C A;  2IEK A;  2X0L A;  2ELJ A;  3HRS A;  5ILS A;  4IRH A;  2V4J C;  2CJJ A;  3DU5 A;  2LOO A;  4UUS B;  2X9D A;  3VEP A;  2NYX A;  1O3Q A;  3TED A;  5LRS A;  2N8G A;  4BAC A;  2XRN A;  3QP6 A;  4ZYG A;  1NG6 A;  4ZDL A;  4BBS J;  2A5Y B;  3G1O A;  5CJ9 A;  3H9G A;  2ID3 A;  3ABU A;  3IAM 2;  3RTR A;  2DJI A;  3O3K A;  2Y31 A;  2IGK A;  3P9K A;  4E7K A;  3J7A O;  3WTW C;  4OIN F;  3E97 A;  4BHP A;  1JKR C;  1X58 A;  1VQL I;  1T98 A;  4DJA A;  1WSU A;  4IF4 A;  3BR5 A; 
#chains in the Genus database with same CATH homology
 1X2N A;  3M3Y J;  2DTZ A;  2CQQ A;  5IYD J;  3JRH A;  5FKO A;  4A3B J;  1ETX A;  1IDZ A;  4XRM A;  1FTT A;  2M2E A;  3O8G A;  1ETQ A;  2ZB9 A;  1WH5 A;  4M3D A;  4IHY A;  3GTP J;  3RKQ A;  2K9Q A;  1TWH J;  1WCM J;  2QF7 A;  3CQZ J;  3E7L A;  2L9R A;  3NAR A;  1H88 C;  1ITY A;  5M3M J;  4I76 A;  5E3O A;  3CMY A;  4L5E A;  1X2M A;  1W0U A;  1T33 A;  5M5W J;  2DMU A;  2R92 J;  3JRB A;  2JA5 J;  3S17 J;  2XSD C;  2H8R A;  1P7J A;  2M9H A;  1QPI A;  3HOX J;  5M3F J;  2R5Z A;  4C3I J;  3S15 J;  4C3J J;  1B8I B;  5K7H A;  1ZQ3 P;  2EZL A;  2WAQ N;  4W97 A;  1MNM C;  2KT0 A;  1I3Q J;  2JK3 A;  4D5C A;  4A3C J;  1HDP A;  1UMQ A;  4Y52 J;  3OSF A;  4LOC A;  1GDT A;  1E3O C;  1BJZ A;  1I6H J;  5J1Y A;  2LK2 A;  1ZGW A;  2EZI A;  3JRD A;  1LE8 A;  1QVT A;  1XS9 A;  3FK7 A;  1JUS A;  1OCT C;  2HOT A;  2XB0 X;  2NS8 A;  3A03 A;  5C44 J;  1R9T J;  3BR2 A;  3TW6 A;  1D5Y A;  1B72 A;  1FIA A;  4A3D J;  2Y9Z A;  2XPV A;  3MVP A;  3A01 B;  1ZR2 A;  3JRE A;  5J1U A;  4QTR A;  1APL C;  2AO9 A;  5F1J A;  2HYJ A;  3BG5 A;  2GM4 A;  1XC5 A;  4JYK A;  1ETY A;  4M6V A;  5FKL A;  2O7O A;  4CYC B;  5BNG A;  5EGO A;  4BY7 J;  3LNQ A;  1TWA J;  2Y2Z A;  1VF9 A;  1GV2 A;  2LR8 A;  3ZQF A;  4MIM A;  5F0F A;  1MH4 A;  4DYR A;  3SFI A;  1W0T A;  1ETK A;  1MSF C;  2EH3 A;  1ETV A;  5DS9 A;  4B1R A;  3F0C A;  4XRS A;  5IYB J;  1JGG A;  2JA6 J;  1UHS A;  2M8G X;  1XG1 A;  2E2I J;  2DA7 A;  2QCO A;  2R7Z J;  3IH3 A;  1ZTR A;  3LSG A;  2FQ4 A;  1DU6 A;  1Y1W J;  4JX5 A;  5EZG A;  3S16 J;  4MFD A;  5IYC J;  1HLV A;  1VND A;  1WH7 A;  5IP6 A;  2LD5 A;  2DA6 A;  4DZP A;  4B4C A;  1AU7 A;  3S1R J;  5EYR A;  1ENH A;  4MLO A;  3BTI A;  3HBL A;  5K7F A;  5FKN A;  2IBD A;  4JX6 A;  1JJ6 C;  4X1E A;  1VI0 A;  2XPW A;  5C4J J;  1MBH A;  5FLV A;  2MGQ A;  1PUF A;  4C2M J;  1RPW A;  1ETW A;  2K9S A;  4XRS G;  3I4M J;  3S1N J;  1A5J A;  3GTK J;  4BXX J;  5F08 A;  4EEF G;  2VI6 A;  2E1O A;  2WB1 N;  3TP0 A;  4M3G A;  1JT0 A;  3BG3 A;  1IV6 A;  2MW8 A;  4XID A;  3GTQ J;  1JTY A;  3HKZ N;  1MSE C;  5FJ8 J;  2L7Z A;  4DW6 A;  5JLW A;  4A3L J;  3DEW A;  2L7F P;  1Q1V A;  2DMP A;  3IH4 A;  5J3L A;  2CQX A;  5F27 A;  2R5Y B;  1IUF A;  4M3F A;  2JMW A;  4FCY A;  3DCF A;  4A69 C;  3LSR A;  1Y1V J;  3VPR A;  1JJ8 C;  1I50 J;  1IC8 A;  3HEF A;  2TCT A;  1B72 B;  2MSY A;  3HGG A;  1TWC J;  2Y9Y A;  3BQY A;  5IOY A;  1U9N A;  3ZOB A;  3W6V A;  2H1K A;  3JR9 A;  2YU9 J;  4QSH A;  1HOM A;  2HI3 A;  2E19 A;  2FJ1 A;  1IRZ A;  1ZR4 A;  4FE4 A;  3IV5 A;  1P7I A;  3BR3 A;  4V2G A;  3ZQH A;  5E3L A;  4IHX A;  5F0C A;  1IDY A;  2M34 A;  3SDG A;  3CDL A;  1RET A;  3A02 A;  3OOU A;  5IP7 J;  3BR1 A;  2O8K A;  3S1M J;  2G0E A;  5DTD A;  1O4X A;  2VKE A;  1FEX A;  2Y0S N;  3FIW A;  5C4X J;  4V2F A;  2JN6 A;  4D7M A;  1MBK A;  4QIW N;  1JKO C;  1IG7 A;  1ORK A;  3BR6 A;  2MG4 A;  4A3E J;  3GTG J;  2AHQ A;  1WPK A;  2P81 A;  5FKM A;  1WGX A;  5E3N A;  4AC0 A;  1EF4 A;  1QRY A;  3GTL J;  3ZQL A;  3K7A J;  2LLK A;  5EG0 A;  3LOC A;  3GBG A;  3I4N J;  3D1N I;  2JJ7 A;  2X48 A;  2LP0 A;  3BTC A;  2LY9 A;  5EEA A;  4HNV A;  3BQZ A;  1OJL A;  1OCP A;  2DJN A;  2EZK A;  3MKL A;  1PUF B;  2D5V A;  1MBF A;  1LFU P;  3HOY J;  4M3E A;  2JA7 J;  3B6A A;  4DYQ A;  2E2H J;  1H8A C;  2TRT A;  4FIS A;  3BTL A;  5IOZ A;  2YUS A;  3JRA A;  2DMT A;  3C2B A;  3GTM J;  1G2H A;  2XGD A;  1B8I A;  2HQ5 A;  2DA4 A;  3FK6 A;  5HOD A;  4IHV A;  3HGY A;  3RZD J;  2L0K A;  1JUP A;  2HDD A;  1HF0 A;  2PMZ N;  4NDL A;  3OIO A;  4A3I J;  3LSJ A;  2RAE A;  4FTH A;  4RDU A;  1BW5 A;  1JUM A;  1HCR A;  4G12 A;  5F0H A;  2NVQ J;  2LFB A;  1IGN A;  3CCY A;  1MH3 A;  1SFO J;  5JLX A;  9ANT A;  1FTZ A;  3WHB A;  2HXI A;  2R5Z B;  2CUE A;  2EBI A;  4BY1 J;  2EZH A;  1POG A;  2JA8 J;  5M5Y J;  4AUX A;  1RR7 A;  4M3B A;  4RBO A;  1CQT A;  3GTO J;  1ZKG A;  2DMN A;  2M0C A;  5K7Z A;  2HOA A;  5FKK A;  3H0G J;  3FIS A;  2VKV A;  5GPA A;  1ETO A;  2LTP A;  2NVT J;  1YRN A;  2K40 A;  3ZQC A;  4BKX A;  4A3F J;  1IJW C;  1NK3 P;  2XRL A;  3PM1 A;  1GT0 C;  1LE8 B;  2OF7 A;  3QPL A;  3WHC A;  1JTX A;  3MN2 A;  2DMQ A;  4UUS A;  5M5X J;  3O8H A;  5EZH A;  3JRF A;  4IEJ A;  1BL0 A;  2XPU A;  3Q3S A;  2ME0 A;  3BG9 A;  4MO7 A;  2EQR A;  2VPR A;  4A3G J;  3B6C A;  1GV5 A;  2R93 J;  2NVX J;  1S7E A;  5IP9 J;  1A6I A;  1RKT A;  3K2A A;  3TW7 A;  5EG0 B;  5EGO B;  4UUT A;  2NVY J;  4S0H B;  1RKW A;  4B3A A;  4BBR J;  3QPS A;  1AKH A;  4X6A J;  3JRI A;  2XB5 A;  3HOW J;  5E3M A;  4I6Z A;  2ID6 A;  1Z77 A;  3GTJ J;  1BW6 A;  3SJM A;  2YS9 A;  3S14 J;  1ZK8 A;  3S1Q J;  3HB9 A;  3BR0 A;  1RES A;  3BTJ A;  3NAU A;  4ABZ A;  4AYB N;  4A93 J;  3M4O J;  2I10 A;  3FKI J;  1JT6 A;  3G1M A;  2X6O A;  3Q0V A;  4GFB A;  3UKG A;  1DU0 A;  1K83 J;  5F04 A;  3HOU J;  3IH2 A;  1WI3 A;  1JKQ C;  5GPC A;  1K61 A;  2XGC A;  4C3H J;  5J1R A;  1NK2 P;  1TWG J;  1UG2 A;  3H3V K;  1OFC X;  1NTC A;  5IPA A;  2CUF A;  1T56 A;  3RQI A;  3L1P A;  4A3M J;  2E2J J;  3S2D J;  2HXO A;  1JKP C;  1GVD A;  2K9N A;  3HM5 A;  2R0Q C;  2FD5 A;  1U78 A;  1MBE A;  2NOG A;  2DA3 A;  3JRG A;  2O9L A;  2R5Y A;  2KDZ A;  1GUU A;  1FIP A;  1MBJ A;  1MBG A;  2L7M P;  3PO2 J;  1TWF J;  2WV1 A;  5EDN A;  2B63 J;  2IAI A;  3JRC A;  3LSP A;  2FX0 A;  2DA2 A;  5C3E J;  4Y7N J;  5FLM J;  1BA5 A;  3QQA A;  2HOS A;  4IHW A;  2CRG A;  3PO3 J;  1U8B A;  2DA1 A;  3ZQG A;  2ECB A;  2DA5 A;  4A3K J;  4FE7 A;  1QVU A;  4DYC A;  2XGE A;  4XIC A;  1HDD C;  2ECC A;  3TP3 A;  1F36 A;  1YRN B;  4J19 A;  1LFB A;  2COB A;  2ME6 A;  2NS7 A;  4XK4 A;  2LVS A;  3HOV J;  3HOZ J;  1TC3 C;  3BT9 A;  4D7N A;  2IEK A;  4MFE A;  1Z0X A;  2W48 A;  2CJJ A;  4A3J J;  1F43 A;  2CU7 A;  2ELK A;  4UUS B;  2LKX A;  1AHD P;  2X9D A;  3RZO J;  1FJL A;  3OSG A;  1U9O A;  3G1L A;  5EF6 A;  3TED A;  2N8G A;  1H89 C;  4D5F A;  4JX4 A;  4DZJ A;  4BBS J;  3G1O A;  3Q0W A;  3ZQI A;  3HDD A;  2ID3 A;  1AKH B;  4W1U A;  2Y30 A;  5GP9 A;  3A01 A;  2VUM J;  2JWT A;  2GBY A;  2Y31 A;  4JP0 A;  3Q0U A;  1X58 A;  4CYC A;  1SAN A;  1JKR C;  2GLO A;  3S2H J;  2OPT A;  1VFC A;  2DN0 A;  3BR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...