2PMZN

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
total genus 7
structure length 64
sequence length 64
chains with identical sequence Y
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2pmzN00
3GBGA 1JUPA 4FTHA 2E1OA 3BQYA 1D5YA 3BG5A 2Y2ZA 2NVXJ 2K9SA 1ITYA 2KDZA 4AC0A 3G1MA 1IRZA 1PUFB 2M8GX 2K9QA 1R9TJ 1P7IA 4C3IJ 3IV5A 1A5JA 1ZKGA 4RBOA 1X2MA 2DMPA 1BW6A 5C44J 1WCMJ 5M3MJ 3M3YJ 4AUXA 1DU0A 3PO2J 2JWTA 3GTGJ 1ETVA 5IOYA 3OSFA 4CYCB 5GPCA 2M34A 1BA5A 5IYCJ 1GT0C 3GTJJ 3LNQA 2IEKA 4S0HB 3S1RJ 1ZTRA 5F04A 1SANA 3ZQLA 2HXIA 3JRIA 1WPKA 1WH7A 4IHWA 3CCYA 2VPRA 5F0FA 2HOSA 4J19A 5EG0B 5EYRA 3ZOBA 2WAQN 2MGQA 2Y31A 4XIDA 3ZQCA 3S14J 1MBGA 3HOZJ 2E19A 2R5YB 2L7ZA 2X48A 2LR8A 2TRTA 1QVUA 4M6VA 1GVDA 1ZR4A 1HDPA 1MNMC 4A3GJ 3CDLA 3FKIJ 3GTPJ 2JA7J 2VKVA 4A3KJ 4I6ZA 2VI6A 1LE8A 2IBDA 4Y52J 1RETA 5F0HA 1GV2A 3QQAA 3JRBA 2LFBA 2P81A 1IGNA 2OPTA 3RKQA 3BG3A 1TWCJ 3K2AA 1ZGWA 5IP9J 4MO7A 2FJ1A 4M3EA 1I50J 1VFCA 1APLC 4A3BJ 1AKHB 2R7ZJ 2O7OA 4IHYA 1TC3C 1AHDP 4NDLA 3BQZA 2ZB9A 3LOCA 4B1RA 3GTMJ 2EZKA 3C2BA 1MBKA 2FQ4A 5GP9A 3MN2A 3GTKJ 2M2EA 3Q0WA 2O9LA 3S1MJ 3TP3A 1U9NA 3BTJA 4QSHA 1XC5A 2XPVA 3I4NJ 1JJ8C 3HM5A 4DZPA 3D1NI 1BJZA 3LSJA 2PMZN 3BT9A 1JTXA 2XPWA 1OCTC 2Y9ZA 3B6CA 2HOAA 4GFBA 2H1KA 1F36A 5M5YJ 1BW5A 4UUSA 3Q3SA 3K7AJ 4A3FJ 2ECBA 1ETXA 2LKXA 3JRCA 5FKMA 4BY7J 4MLOA 2O8KA 4BY1J 4MIMA 4A3CJ 3G1OA 4DYCA 1B72A 1IDYA 3HGYA 1IUFA 4HNVA 5F27A 1ETQA 4FE4A 1FEXA 3LSRA 2DMQA 3FK6A 2ME0A 5J1YA 1K61A 1JKQC 5FLVA 2JA5J 1WH5A 5K7HA 2JJ7A 5IOZA 1QPIA 2EQRA 2I10A 3CMYA 3VPRA 3I4MJ 1U78A 4EEFG 1MBJA 2XGCA 2D5VA 2X9DA 2COBA 1JUSA 2EZHA 1T33A 4DYRA 4A93J 4M3FA 5FKNA 3QPLA 5F0CA 2ID6A 1TWAJ 1Z0XA 2LK2A 2LP0A 2L7MP 3BR1A 3BTLA 1QRYA 1QVTA 1ENHA 2CQXA 2GBYA 3FIWA 1W0UA 1DU6A 4C3HJ 1RESA 2RAEA 2DMTA 4XK4A 3BR0A 1BL0A 1T56A 1MSFC 4A3EJ 4LOCA 3F0CA 3WHCA 4M3GA 1FTTA 4XRMA 2ECCA 3S17J 1K83J 2GLOA 2DMNA 2N8GA 5F08A 2MG4A 4BKXA 1RR7A 2LVSA 1ETOA 3FISA 2Y9YA 1HLVA 4MFEA 1LE8B 2HDDA 1GV5A 3HOVJ 2DJNA 5FKKA 5FKLA 3JRFA 1MBHA 5EZGA 5J1RA 2HXOA 1FIPA 2DN0A 4X1EA 1U8BA 3S15J 1JT6A 1AU7A 1MH4A 1NTCA 4UUTA 1FTZA 5IP7J 1P7JA 2CU7A 2M9HA 4JYKA 2ME6A 1H88C 1GDTA 5M5WJ 1CQTA 4L5EA 1YRNA 1ZK8A 1TWHJ 1H8AC 2QF7A 2DA6A 5BNGA 3HOUJ 3JRDA 1JKRC 1ORKA 4M3BA 2X6OA 3LSPA 4ABZA 3S16J 2JMWA 1FJLA 2WB1N 4FE7A 1UG2A 3O8GA 1ZQ3P 2GM4A 3A02A 4QIWN 3JREA 1X58A 1U9OA 4M3DA 2CJJA 2DA4A 5FLMJ 2XPUA 5E3NA 4UUSB 2K40A 3TEDA 1IG7A 1HF0A 3IH3A 3RQIA 2YU9J 3DEWA 2CRGA 4XRSG 2NVTJ 5IYDJ 4A3LJ 2IAIA 4FISA 3HB9A 3LSGA 1B72B 4D5CA 4IHXA 4DW6A 3HGGA 1Y1WJ 1POGA 1S7EA 4A3DJ 5EEAA 2DA2A 2EZIA 5JLXA 2JK3A 3DCFA 4C3JJ 2NVQJ 3HOYJ 2XRLA 3MKLA 2HQ5A 3GTOJ 1Q1VA 1XG1A 4I76A 1LFBA 1JTYA 1SFOJ 4A3JJ 4D5FA 2CQQA 2B63J 3ZQGA 2L0KA 5GPAA 1MH3A 5EGOA 2NS7A 5EF6A 2E2HJ 1B8IA 4V2GA 1JJ6C 3O8HA 3H3VK 3NAUA 2AO9A 5IP6A 2EH3A 2LLKA 1VF9A 4W97A 4FCYA 1FIAA 3TW7A 3FK7A 2QCOA 1UMQA 2JA6J 4B3AA 2Y0SN 4B4CA 3BR3A 9ANTA 2AHQA 3Q0UA 1A6IA 3RZDJ 2MW8A 5M3FJ 4D7NA 3IH4A 5C4JJ 2LY9A 3TW6A 1RKWA 4D7MA 1GUUA 2MSYA 5F1JA 5FKOA 1JT0A 1MBFA 1RPWA 1IC8A 1HCRA 3BR2A 1ETKA 1VNDA 3SJMA 2H8RA 2XGDA 3A01A 1UHSA 2TCTA 5HODA 2DA5A 2XB5A 4G12A 3S2DJ 1JKOC 1Z77A 4W1UA 2YUSA 3G1LA 4Y7NJ 1YRNB 4XICA 2DA7A 1WGXA 2E2JJ 1HDDC 2HOTA 3JRHA 1EF4A 2NOGA 3BR5A 3W6VA 5J3LA 5JLWA 1F43A 3JRGA 4XRSA 3GTQJ 2FD5A 1OJLA 3BG9A 1ETYA 2M0CA 3OIOA 3ZQHA 3A03A 1MSEC 3GTLJ 2R93J 3OOUA 2R5ZA 3E7LA 3JRAA 3HBLA 1I6HJ 3B6AA 4IEJA 3UKGA 5K7FA 3HOXJ 3ZQFA 2WV1A 1JKPC 2KT0A 2G0EA 1OCPA 2ELKA 5E3LA 2DMUA 4JX6A 5E3MA 2EZLA 1PUFA 4DYQA 3OSGA 3BTIA 4A3MJ 4IHVA 1XS9A 5EDNA 1O4XA 5J1UA 2JA8J 4MFDA 4CYCA 2DA1A 2L7FP 4QTRA 3TP0A 1I3QJ 1W0TA 2ID3A 1IV6A 4BXXJ 5EGOB 1B8IB 2XGEA 2R0QC 5FJ8J 4RDUA 3SFIA 2Y30A 3MVPA 3S1NJ 5EG0A 3BR6A 3NARA 5C4XJ 1LFUP 2CUFA 3M4OJ 3S2HJ 3WHBA 2R5YA 2XB0X 4JX5A 2CUEA 1NK3P 2R92J 1OFCX 3RZOJ 2OF7A 4C2MJ 4JX4A 2FX0A 3L1PA 5EZHA 2LTPA 2W48A 1IDZA 1JGGA 4JP0A 2HYJA 3SDGA 4BBSJ 1VI0A 3H0GJ 4X6AJ 3BTCA 1TWGJ 5IPAA 3JR9A 1IJWC 5DTDA 5C3EJ 3A01B 3HDDA 3HKZN 2VUMJ 2NVYJ 4AYBN 1Y1VJ 1WI3A 2JN6A 2NS8A 1AKHA 3ZQIA 5E3OA 2DA3A 1X2NA 5K7ZA 1JUMA 1E3OC 4A3IJ 3S1QJ 2EBIA 2VKEA 1HOMA 5DS9A 1TWFJ 3HOWJ 2L9RA 1H89C 5IYBJ 4DZJA 4A69C 3PM1A 2E2IJ 1RKTA 2HI3A 3HEFA 4BBRJ 3IH2A 3PO3J 1ZR2A 1MBEA 2DTZA 2YS9A 2K9NA 3CQZJ 2LD5A 2XSDC 1ETWA 5M5XJ 1G2HA 4V2FA 2R5ZB 3QPSA 1NK2P 3Q0VA
chains in the Genus database with same CATH superfamily
2A5YB 4FTHA 1D5YA 2HWVA 2NVXJ 1J7KA 5LHHA 3K4JA 1HW2A 2DU9A 2OCEA 1SAUA 4ZYAA 4C3IJ 2GAUA 3QAHA 3KX2A 4EV0A 4KMUX 2DMPA 5DCFA 2FEZA 1KYZA 2A61A 1BBYA 2ZBKA 1WCMJ 3S3MA 4E4HA 4EJUA 3CF5F 2ZNZA 3PO2J 3KP4A 1E3PA 1DP3A 2NNYA 1W7PD 4B44A 3DPTA 5CVVA 3LAJA 2ZO4A 1OMIA 3HRTA 2M34A 3H36A 3WTWC 1IXRC 4IOAF 2K85A 3MMYB 5IYCJ 4PUSA 1GT0C 2KISA 2L01A 1FYKA 3LFKA 4FASD 1VQMI 1RUOA 5E18F 3ERED 4YFKF 2VPRA 3O6BB 1HC8A 2OA4A 2W00A 5GAHJ 2UXNA 4R8HA 4XIDA 1IRFA 4G7OF 1FMWA 3S14J 3HOZJ 1D3YA 4BL0B 2OQGA 3GFMA 1QVUA 4UNOA 4CH7A 1PJRA 1GVDA 2VKDA 1FYLA 2WC2A 4PFOA 4PGHA 2PJRB 2JA7J 1OISA 4I6ZA 2VI6A 3DKYA 4OINF 1KYWA 2DTRA 4MQ9F 5LHIA 1VQ6I 1RETA 4MNUA 2VE8A 1X3WB 2P7CB 2O0YA 2W85A 2OU2A 1TWCJ 2HFHA 1BOBA 4M6YA 2FMLA 5IP9J 1BI2A 4M3EA 3RPUA 1VFCA 1AOYA 2HQRA 1KU7A 1I39A 2MFZA 2XF7A 3CO6C 3RPQA 2X0LA 1UAAA 2M7AA 3GTMJ 5GTHC 2EZKA 2E1MC 5BOXA 5L3GA 1WI9A 4BE1A 5D4SA 4G8XA 2FQ4A 5GP9A 3S93A 1BN5A 2O9LA 3JCUC 3S1MJ 1U9NA 4QSHA 3PFIA 2XPVA 2R7RA 1JJ8C 3SFZA 3I4NJ 4DZPA 4ZH4F 5ILSA 4L0ZB 2PMZN 1IAWA 2GIZA 3L2UA 3B6CA 4GFBA 1FBSA 3QP5A 1GXQA 1V54H 5M5YJ 3L2CA 3Q3SA 4KMFA 1Z6TA 3PNTA 3V4GA 5AIPA 1SD7A 2QSFX 3OYHA 4KIGA 5D8KB 2K5CA 4MLOA 5H6QA 4HA8A 1JE8A 4BY1J 4MIMA 4UHTA 4DYCA 1B72A 2VQHA 2G9WA 2DQRA 4HNVA 2ZMEC 5F27A 3G6EI 4E7KA 1FOWA 4FE4A 2IJLA 2QQBA 2BGCA 2RN7A 3F8FA 3FK6A 4HSTA 4ITVA 5J1YA 4NB5A 1K61A 4Y15A 3QOPA 1QQIA 1MKMA 4U7DA 4Q48A 5K7HA 1QPIA 1NG7A 2HTSA 2F5CA 1W7PA 2IXSA 4BACA 2PJPA 3I4MJ 1RIOH 4EEFG 4EGYA 1YS6A 4U7BA 3F8NA 4HDUA 1G3TA 2COBA 5DM7F 1JUSA 4AIJA 1T33A 1KQ8A 4BDYA 1L0OC 4M3FA 4U0WA 2OJED 5F0CA 2XROA 2CFXA 1Z0XA 2LK2A 1I27A 1F9NA 4CZZA 1UFMA 3BTLA 3Q9VA 1DU6A 3CJQB 2GBYA 5B1AH 3CO7C 4C3HJ 1ACIA 5BPIA 2V6EA 4MGRA 1T6SA 3F6OA 2OD5A 1YE9A 1MSFC 4LOCA 3F0CA 1DPUA 2FNPA 2P6SA 3KYLA 1WKMA 1HSJA 1NG6A 4U0VA 2CV1A 1K83J 4HX4A 1G8XA 3KE2A 5CVIA 1Q1HA 3RYPA 1ZHFA 1ZELA 1B1BA 4CSWA 2V1UA 1XD7A 3OYLA 2MD5A 3CF2A 2VQGA 1GV5A 2DJNA 5FKKA 2HKOA 5FKLA 3WG7H 3JRFA 3GFLA 1FIPA 1Z91A 4U0YA 2H6CA 2ZFUA 1MH4A 4PJJA 1X1CA 4BYYA 5EEHA 4AIDA 1D0XA 1OCOH 1P7JA 2CU7A 2ESHA 3I58A 4KISA 2DYRH 4A5MA 4Q47A 1ZK8A 1KU9A 2F5VA 2DA6A 3WU1B 4MTEA 1WSUA 5D5VB 1FYMA 3L7WA 1FJLA 4ZYEA 2DFFA 3O8GA 4GO1A 2K9LA 3BJ6A 5E17F 3AKZA 4GCVA 1X58A 3GCMA 4N9IA 3F23A 2CJJA 3DTKA 2XPUA 4GXOA 1YTYA 3QU3A 3JSPA 2XHKA 1JGSA 2CQKA 3TEDA 3W3CA 4P5OA 1HF0A 2CRGA 5L3BA 2MBFA 1B72B 1ZRCA 1V5FA 4O6JA 4I09A 5HDNA 4CCKA 3F9KA 3HGGA 3KP7A 3PIPF 2VODA 2P8TA 1PP7U 3NWSA 3OS2A 2D1HA 3J81K 4ZTJA 3ZRGA 5HNFA 1S7EA 4A0XA 3U2RA 5EEAA 1U6GA 2EZIA 2NVQJ 3IHUA 5ICCA 2CH0A 2LMDA 3CLQA 3FF5A 1VQ8I 4OIQF 2HQ5A 3GTOJ 3GLLA 4HDVA 1ZYRF 1W7PB 1WJBA 3HRMA 1D1CA 4P55A 1U5TC 2ZJPF 1U3EM 2NXNB 5DCMA 3X2QH 2B63J 2W4SA 1MH3A 5EGOA 5EF6A 3PJRA 1Y56A 3WE3A 1QZYA 2E35A 3O8HA 5JHFA 2M4GA 2Y0SA 5IP6A 4W97A 1G3WA 3U1DA 1D1AA 4IKFA 2AS5F 3FX3A 3TW7A 1RUNA 1IN8A 1B9MA 1UMQA 2JA6J 3W6JB 3ZMTA 4QPOA 5D5XB 4B4CA 1AA7A 3GUDA 2NAZA 3Q0UA 3OYAA 2M7BA 1MMGA 2F48A 3U9GA 3EUHC 5M3FJ 3O3KA 4D7NA 2OBPA 3H3UA 2CYYA 2E34A 1B4AA 1R4NB 2R4GA 3P9IA 2HYFA 4EVIA 2R7TA 2HVQA 2K86A 3LQQA 4BUPA 2A05A 3BR2A 1N75A 3EYIA 1IV8A 1WQ2A 3ZR8X 5LBQA 2E1MB 3OS0A 4C2UA 3FDYA 3H9JA 3SJMA 5H20A 3CP2A 1JHFA 5GADJ 5D6FA 1J09A 4NNJA 1UHSA 4XORA 3AG3H 4IQ4A 2KIMA 4DGWB 4OMZA 2DA5A 1SMTA 2H8WA 4G12A 1Z77A 3J7AY 2UUZA 2X6YA 2MYSA 3KIOA 5JI6A 1BJAA 1R5GA 2DA7A 3GZNB 4B43A 3BR5A 4CHUA 1XGSA 6PAXA 4ENMA 3I55I 3CDHA 1R71A 3HRSA 4DBQA 4OIPF 2MH9A 3FM5A 3CDIA 1F4KA 2AQFA 2GXGA 1ETYA 2CUJA 1O3SA 3K4KA 1KA8A 5JVGF 3UNGC 1MSEC 3QYFA 4G6QA 1MNEA 1U2WA 1S7AA 3CCLI 2ZCWA 4DBRA 3VSLA 3HBLA 3R4KA 3UKGA 5L3CA 3WU0A 4LJZF 2QSGX 1QGPA 3I0TA 1OCPA 2HEOA 2IVMA 2VQLA 5FD5A 2BXYA 4I01A 4DYQA 1U5TA 4IHSA 1A36A 3QYEA 1O4XA 3BPVA 1SD5A 4ZYHA 1HQCA 2B9SA 2FUG2 3E6CC 1OYIA 3T8TA 1XDUA 2ISYA 3CUQC 1YW7A 3M07A 4MFDA 4MHGA 2XSJC 4HQEA 2WY8Q 4CYCA 1FOYA 5DCMB 1I3QJ 2NVUB 5K5RA 1WZ2A 3MZHA 1IV6A 4BXXJ 2VC1A 3BY6A 5EGOB 1I5ZA 2R0QC 1X1BA 1FOXA 3BLYA 3EUHA 3FZVA 2KRFA 5EG0A 1MW7A 4F92B 3BR6A 3PNYA 1CGPA 5CLSA 1V3FA 2XAGA 1J0RA 5HS7A 2X4HA 5DM6F 4JX5A 1NK3P 4NC6A 1Y0UA 5D8LB 1R1TA 2WY7Q 4ASNA 4JX4A 5A2QZ 2KZVA 2LTPA 2W48A 3HTUA 4E7JA 2BXZA 4J01A 3DP7A 2LKPA 1SEUA 4PJ0C 1UHWA 3WE2A 4ENNA 4X6AJ 1STZA 1P2FA 3GFJA 5E1XA 1QPMA 4FX0A 4ENJA 3BTCA 4QWQA 1TWGJ 3N97A 4I99C 1WWXA 3DBLB 4DJAA 4I0BA 3HDDA 1YG2A 4Y17A 3WTSC 2KFDA 2ZC2A 1AKHA 4UY8I 2DA3A 3H1CA 2WTEA 2GZWA 4G7ZF 1OR7C 1VTNC 3S1QJ 2FU4A 3QPTA 2VKEA 4CCMA 4GGGA 3TO9A 2L9RA 2OAZA 3EQLF 3K4NA 3HOSA 2VOPA 3EUAA 3QRFF 4RLFA 1FLIA 4UUVA 2Q1ZB 3IH2A 2HVSA 3PO3J 4UB6C 2DTZA 2KLOA 3CQZJ 3FKJA 1IXCA 2LD5A 3H5NA 4FQGA 2ACJA 1G2HA 1PP8F 3RJPA 1L3LA 3GWZA 3GBGA 4P96A 2Q0OA 3CUQA 3K0LA 2Y2ZA 3OR2C 2GXBA 1D1BA 4EMSA 3I56I 1SVOA 1D8JA 1U5TB 2UWMA 3DFGA 4HYEA 1A5JA 4MEXF 3COAC 2AXTC 2Z2SB 2XRNA 1XX5A 3LWFA 5KK1A 3M3YJ 2OC6A 4AUXA 1RC9A 4LITA 1SAXA 1G4DA 1Z9CA 5J47A 5IOYA 3OSFA 4CYCB 1VQ9I 4OOIA 3ECHA 4CYDA 5GPCA 4ENKA 1YW8A 5TGTA 2JT1A 4BH9A 1RI7A 1XTAA 3GTJJ 4E7LA 3LMMA 3M8FA 2XF5A 1TLHB 2DT6A 1SANA 3M7GA 2HXIA 3JRIA 4MTDA 1VQOI 3SEQA 5KCMA 2ELJA 3GLXA 4IHWA 1YLFA 2HOSA 4J19A 5EG0B 2ADUA 3GFIA 2EV0A 5EYRA 2W1OA 1EH7A 2WAQN 2GOMA 3Q9SA 5K5OA 3KCCA 3ZGKA 4A6EA 4G6DA 1MBGA 2E19A 2L7ZA 1YI2I 2CQ7A 2LR8A 3T8RA 2KZGA 3DV8A 3MWMA 4KIFA 2DFHA 1FSEA 3TQNA 3K70D 3GO5A 2VKVA 3GW2A 3CESA 2CW8A 1OR7A 5IT9K 4AVZA 2P81A 2OPTA 2HQNA 3K2AA 2H09A 2FJ1A 3I9V2 2VT2A 1AKHB 5LFAA 2BW3A 1K6OA 2DPUA 2R7ZJ 3FXRA 2P5LC 4NDLA 4JQFA 3BQZA 3L00A 3R0JA 1LUJB 1NH3A 1H9GA 2ZB9A 2VBXA 3LOCA 3K1NA 3LL7A 5LEJA 2Z3YA 4XLNF 1VQNI 2R7WA 3R6SA 3Q0WA 2QSHX 3I64A 5CVJA 3TBIA 4BJ5C 2HTJA 1XSXA 2LY1A 4UB8C 3BTJA 3SEZA 1O57A 3LSJA 3BT9A 1OCTC 2CW7A 4XBFA 2EA4A 3S3OA 2H1KA 2BOLA 4YIFA 4G6TB 1F36A 4PDKA 4CUGA 4D1QA 4UUSA 3OYEA 3K7AJ 2Z99A 2DK8A 2VL8A 4A3FJ 2ECBA 3M8EA 3CUQB 5DUKA 3HPHA 2O8KA 3VB2A 4A3CJ 2J5OA 2MABA 3D5SC 1SD4A 2TDXA 1ZG3A 1T39A 4TV7A 4XOTA 2XVCA 4IHTA 2FBKA 3RDIA 4RB1A 2W7NA 5FLVA 1WH5A 3WTZA 4BEHA 3GZ5A 1LDJA 4A2UA 2PFBA 2I10A 3KP2A 3CMYA 3VPRA 2FXAA 3DU5A 4LG3A 1MBJA 2FBHA 2XGCA 2X9DA 4WXCA 5LGUA 1O3TA 3TO6A 4ZC3A 2ICWG 4A93J 2VLAA 5FKNA 2JVHA 4G94A 2Q8KA 3KEQA 2R7XA 3K4MA 3VDXA 5L3FA 3FIWA 2LBFA 4X0GA 4LLGF 1KZHA 2X51A 1T95A 2RAEA 3VSKA 5LGNA 4GRIA 1YQAA 1D0ZA 3RCOA 3NRVA 4YFXF 1BL0A 2IT0A 2M4KA 2DOFA 5DEQA 3TOBA 1T56A 3WHCA 4M3GA 1OKRA 3JW4A 1FBQA 2OZUA 2JQ7A 2ECCA 5HS9A 3BWGA 4WWCA 4KNYA 1FZPB 3J80Z 2GLOA 3OYKA 3A0HC 2MC3A 5F08A 5CQGA 4KDPA 5LLQA 4HPQA 4RAZA 5ICFA 1RR7A 5ERIA 1QBJA 2NNNA 2X1DA 1K4TA 2Y0MA 1MDMA 3CZ6A 3LSTA 2ZJ2A 3TGNA 2HDDA 1EV7A 2RGVA 4G7HF 4CGZA 1TTYA 2V9PA 4BS9A 5J1RA 1JT6A 3B02A 4XLEA 4KFCA 3MKYB 1Z3YA 1QO0D 3AG1H 2BW3B 4WK8F 2ZKZA 2QQAA 2M87A 2M30A 2IS1A 4I98B 2MLGA 4JYKA 1GDTA 1QHGA 4IQJA 1CQTA 4L5EA 4LIUA 3WTXC 4E7ZA 1S29A 4D9JA 1GHCA 1H8AC 4AVPA 3HOUJ 1TNSA 3JRDA 1ORKA 1S5LC 1MJBA 2BZTA 1MD0A 4HG2A 3C7JA 3TDZC 4ABZA 2R7UA 1UG2A 2DT5A 5DYMA 1ZQ3P 1G6NA 2JVGA 2C6YA 3JREA 2IA0A 4R79A 3BPXA 2A6EF 1JXSA 3DBRB 4UUSB 4KUMA 1ZH5A 4NC7A 3KP5A 4HNUA 1IG7A 5GAGJ 3TMOA 1VQ4I 2J5PA 3IAS2 3WTTC 4OIRF 1X1AA 2YPRA 3LSGA 4PJLA 4LG0A 4RGRA 1FC3A 3OYCA 1POGA 3LQRA 2ETHA 2ZXJA 4A3DJ 2DA2A 5JLXA 2JK3A 3DCFA 3E6BA 3ZPLA 2XRLA 3IWZA 4BEHB 4XSXF 1DGRM 3ABMH 4B47A 1RR8C 4FHTA 1Q1VA 1XG1A 3P9CA 4I76A 1JTYA 1KQ9A 4A3JJ 4D5FA 2CQQA 2RREA 3ZQGA 5GPAA 1XCBA 2BHZA 2E2HJ 1B8IA 5AIQA 1G3SA 1E17A 2L9NA 2M1BA 2D45A 2QLZA 3OMYA 4HLXA 4AYBA 2EH3A 2LLKA 2EFPA 3CCRI 1DQUA 2DCEA 2LBFB 2DFEA 2RQQA 3WODF 3FK7A 4IO9F 5FLXK 4B3AA 4P1WA 2FRHA 4L0YB 2DO7A 3CJRB 2AHQA 1A6IA 2K9MA 3RZDJ 2MW8A 2HPMA 1R36A 3J7AO 4L9TA 3TW6A 3P5JA 3AG4H 1Z6RA 3I3LA 4KN4X 2MSYA 2H27A 1W5CC 1RPWA 2I5UA 5JVTA 1F1ZA 1MDMB 1IC8A 2IW5A 3OOPA 1IN7A 2JPBA 1BI3A 1ETKA 2WADA 1I6XA 2H8RA 2XC7A 2PBIA 1XSDA 4RM2A 5HDGA 3HJEA 5J8FA 3A01A 3ZN1A 1SFKA 2WV0A 3BCBA 1RRJA 4A0ZA 4WXHA 2EPFA 1JKOC 4LIVA 1OCZH 3OV8A 3KZYA 3G1LA 4Y7NJ 1WJCA 1E2XA 4XICA 1WGXA 2E2JJ 4B8XA 3H9GA 2XAFA 4XRFA 3AAFA 2XKOA 4XKWA 2P5VA 3R60A 5JLWA 1MMSA 3GTQJ 3NEUA 3FBIB 5J40A 1BIAA 3PSFA 3HSFA 3MEXA 2K4JA 2M0CA 3DBHB 3FXJA 3OIOA 4HF2A 1R6RA 1OQYA 2ZXWH 3A03A 4E7SA 1HA8A 3GX4X 2R93J 4OMYA 4LLLA 3LA3A 4HAMA 4C2TA 2ZSIB 5HLHA 1ERDA 2LSOA 4IEJA 5FO5A 2VASA 3ZQFA 2WV1A 2DOEA 1LNWA 5BPDA 1K4SA 3LSMA 3ASOH 1FP2A 3CCVI 2QA4I 4A3MJ 1YJWI 3R0AA 3F8CA 4J00A 2QBYA 2EIKH 4ZZDA 2D1VA 4IF4A 2HQAA 5D4RA 3RKXA 5J1UA 4DIQA 2ZMEA 3DLLF 4FETA 2ELHA 3ISPA 2L9VA 2ZNYA 4XM3A 4F55A 2L7FP 5B1BH 4QTRA 2XKPA 3KPHA 4KN7X 1SD6A 1LVAA 1B8IB 3K1PA 2L4MA 5FJ8J 2DLLA 5LRRA 3K4LA 1P9QC 2K4BA 3MKZA 2Y30A 3RKYA 3QP6A 4HZFA 3MVPA 3VEPA 3W2AA 4RM3A 3W6KB 5C4XJ 4H4KC 3FXQA 1LFUP 1LPQA 3LAPA 4CCLA 4AM3A 3GF2A 2XB0X 1I1GA 1OFCX 4GYGA 2OF7A 3OL4A 4UV9A 2R92J 3IAM2 2DQLA 3IRQA 2G7UA 4IRGA 3L1PA 4HEA2 1JGGA 2BE5F 2HYJA 3S3NA 4M9SA 3EPZA 3WG9A 4CDGA 3H0GJ 5B5EC 3H5RA 1X3UA 1XMXA 3SZGA 4L5JA 1LDDA 3FMSA 2E36A 5DTDA 3A01B 4H0EA 1X1DA 3RSNA 1USTA 4N4OB 1MJAA 3ROUA 2NVYJ 4AYBN 2KJCA 2KRCA 2JN6A 1BR2A 3AL0B 5LGTA 5LHGA 1J2XA 1TP4A 2GQQA 3FHZA 3QODA 1E3OC 5CVRA 3CMAI 1B9NA 4RMNA 3QOEA 1YX5A 4XLPF 3F3XA 4WXDA 4M74A 4ZZLA 2Y75A 4A69C 1O3RA 3IC7A 2LF8A 3WTUC 2IS2A 3GEZA 2F6CA 4BBRJ 4YIRX 3E3VA 1ULYA 1FBUA 2YS9A 4XKBA 2P0WA 3VYSB 2KIUA 4A0YA 5H2FC 4BJ6C 1ETWA 3QPSA 4PSWA 2E71A 3ECOA 4M6XA 3I59A 3Q0VA 2L2OA 1H88C 1NK2P 3DPLC 2E1OA 3CCJI 3BG5A 2BHYA 1UG0A 2XIGA 4AC0A 1DPRA 2KDZA 2RNGA 4CCNA 2M8GX 3BG7A 1ZREA 2K9QA 2ISZA 1P7IA 2QBYB 3IV5A 4BQAA 2QKLB 1ZKGA 4RBOA 4YIIA 1X2MA 1BW6A 5C44J 5M3MJ 1HKTA 1QZEA 1R1UA 2HU9A 3JAMK 1IO2A 2JWTA 1W1WE 3GTGJ 2ZMEB 2VJJA 3AFHA 2H94A 1BC8C 1BA5A 1Y39A 4CA0A 4ZJZA 3HSRA 2IEKA 4S0HB 2A3SA 3LNQA 1ZTRA 5F04A 3PL8A 3S32A 2HOEA 2Q2EA 2CW0F 2WAQA 3OYGA 1WPKA 1WH7A 2DFIA 2RC4A 2KP6A 1XGOA 1HW5A 3BZKA 4XKVA 5F0FA 4YG2F 5HNHA 5K1YA 3WTYC 1I3AA 3M9AA 3ZOBA 4EJVA 3N4MA 2EWNA 2MGQA 2Y31A 4OU0A 2VXZA 4BE0A 2KL4A 1R58A 4E6KG 3BP8A 4RGSA 5FD6A 2F5EA 3QWLA 2Z9OA 4ESBA 2QVOA 4LLNA 1A31A 3GMEA 3JTGA 1KGSA 5HVQC 1ZR4A 1H0MA 3CCSI 4A3GJ 1XCVA 3CLOA 2DK5A 3FKIJ 3TO7A 5J6XA 1TW3A 5DD4A 4A3KJ 1ZN2A 3DEUA 2KRHA 1SVMA 4BAYA 5L3EA 5KHDA 2IBDA 2VJ5A 3PSIA 5AONA 1KQ0A 4IX7A 4Y52J 1GV2A 3RIRA 3JRBA 2LFBA 2X85A 3E97A 4XOPA 4FT8A 4HSRA 1Y6IA 2RDPA 1FX7A 4MO7A 2V79A 1WJAA 2P6TA 1APLC 4A3BJ 4PZJA 2X1CA 5IT3A 5E8IA 4WX9A 2P4WA 2ZSHB 2XUBA 3G71I 2B7EA 2QENA 2M45A 4XN3A 3DWLE 3SYTA 4AD9A 2R7FA 4KA4A 1XGNA 3PQKA 2DOAA 3C2BA 2EK5A 1M1EB 1FWZA 1R5ID 4Z2YA 3MN2A 4O3MA 4UVCA 1S6LA 3CCEI 5ILVA 3ABUA 3TP3A 4L9JA 3CC7I 1XC5A 2FNAA 1TZLA 3T0YA 1BJZA 3BDDA 1GXPA 2XPWA 1KU2A 2LNBA 2Y9ZA 2GA1A 4RGXA 2HOAA 4XQFA 3HHGA 2EFOA 1UHMA 4IVNA 1UCRA 5EJCA 3F22A 3E5QA 3I59B 5FFZA 3MCZA 1X4OA 4IXAA 2O8XA 5FKMA 4BY7J 4BU2A 3JRCA 3K4CA 5JR3A 3CUOA 3TL4X 3V42A 2BY0A 1IUFA 3HYIA 4HLYA 2WWYA 1ETQA 2NOJB 3HZJA 1FEXA 1R4MB 2F5FA 3LSRA 2ME0A 2M3AA 1BR4A 2YR2A 1HW1A 2JA5J 3ZN0A 2PEXA 1TNTA 5E20A 4KYWA 2JJ7A 2R7SA 1BOAA 2EQRA 2UXXA 2X1EA 4HV6A 2F4IA 3HSEA 4EJTA 1U78A 3AL0C 2D5VA 1PUEE 2AXLA 2EZHA 2IGNA 3FXLA 2HDCA 2Q2EB 2L7KA 3QPLA 1QHHD 2ID6A 4IJAA 1YHQI 1YITI 1TWAJ 5DV5A 5HS8A 4NC8A 1IRGA 3IUOA 1FY7A 4RS8A 3ZMZA 1ENHA 2CQXA 4BE2A 1LFPA 2FOWA 3IWFA 1RESA 2FE3A 4BQNA 5F1RA 4HF0A 2D2WA 4KITB 2DMTA 4XK4A 3BR0A 3JTHA 2VJIA 3OYDA 2HYGD 5CJ9A 4LFUA 3W2VA 3OL3A 3CC4I 3VWBA 4WF2A 4HQMA 5E8GA 1FTTA 3DLAA 4F93B 1RNLA 4XRMA 3VYUB 2P5KA 3OIPA 1P4WA 4HNTA 2MG4A 3PUFA 3KEOA 1S3JA 2NYXA 2PLYA 2LVSA 1WFXA 3FISA 1HLVA 4MFEA 3BG6A 2XGXA 3HOVJ 2FQ3A 3HG9A 3HL2A 3S15J 1EA3A 1U8BA 2DN0A 1IN4A 1AU7A 1YO5C 5FROA 1LQ1A 3O2PE 1NTCA 4II3A 4UUTA 5ED4A 3IKVA 5IP7J 2NRAC 1FTZA 1VQPI 3HC7A 4UVBA 3HIFA 2FF4A 3G3ZA 3U21A 2R7OA 3H5AA 5GAEJ 1KU3A 2OTLI 1YRNA 1Z67A 1ONVA 1TWHJ 1VQLI 1TQPA 3UR3C 4Y3OA 2A5WA 4M3BA 3LSPA 2DDBA 2F4OB 1NHAA 4XN0A 5GTIC 3CCMI 3L2RA 3WTVC 1H9TA 1J59A 3ZQQA 2K3FA 2DA4A 3SDBA 2H6BA 5FLMJ 5E3NA 3E5XA 3IH3A 5HOOA 2CFOA 2UZKA 5E79C 2YU9J 4XRSG 3KYCB 5IYDJ 3ULQB 4A3LJ 4DQ2A 3HB9A 1ZAOA 1G59A 4D5CA 4A6DA 4BGDA 4DW6A 3ZXSA 3GZ6A 1BR1A 1X4PA 2JRTA 4UXNA 5D5WB 1D5VA 4E70A 2IS4A 4QLCU 2XASA 1LB2A 1TQIA 4C3JJ 2G7HA 2WAFA 3HOYJ 3MKLA 1VQKI 2CQNA 1VQ5I 1X1PA 3G73A 4CO8A 2EA2A 2E5ZA 1SVLA 1S7OA 5ICGA 4B48A 2MH2A 2EJRA 1K7AA 1X19A 2LKSA 2Y69H 2NS7A 4V2GA 1TL8A 2VBWA 1JJ6C 3H3VK 3NAUA 3K2ZA 2AO9A 3CMEI 3R61A 2OTJI 1VF9A 4FCYA 1UELB 5FB2A 2WAEA 1WJFA 3BC8A 5B3SH 2BV6A 2E5NA 2VBZA 9ANTA 3V8LA 3J7ZI 3OYMA 1REPC 1R1VA 1XB4A 2DW4A 1F5TA 4B3XA 2LC2A 2LY9A 5JFRA 2VIXA 1GUUA 3I53A 5FKOA 1N25A 1FMVA 1MBFA 5B66C 3CP8A 1T0FC 4XMYA 3L2WA 2XGDA 5KNLA 5A2QK 1JI8A 4A12A 2MLKA 2DAOA 4NQWA 4L18B 2V6CA 4LB5A 5HODA 3WGGA 4AIHA 3HUGA 1EH8A 2XB5A 1XGMA 3S2DJ 4XLFA 3E5UA 4XSZF 2JPCA 2YUSA 1YRNB 4EATA 2FBIA 1S72I 1HDDC 2W57A 3JRHA 3FXOA 4YELA 4RB2C 2NOGA 1T08B 3W6VA 1ON1A 1T98A 1IN5A 1F43A 5J4VA 3I5UA 1WJDA 4XRSA 3U1KA 2DPDA 2FD5A 1OJLA 3BG9A 4KICA 4BNCA 2V26A 1MIJA 3DF8A 1D8KA 2R5ZA 3E7LA 1X3ZB 3J81Z 3JRAA 4OAZA 5KAFC 1I6HJ 2L3DA 5BS6A 2QYOA 2KT0A 2H1LA 2OUMA 2ELKA 5D6EA 5E3LA 2DMUA 4JX6A 1XMKA 2Z5UA 2EZLA 1W5SA 2W84A 2KIFA 3EETA 2V1NA 3LSKA 5E1WA 5LRSA 5H6RA 1PUFA 2IRFG 1E3HA 5EDNA 1MMNA 2HVRA 1P4XA 1R22A 2GA2A 2E60A 5IY5H 3N05A 1GLNA 1WHUA 2IP2A 3CCQI 3K10A 2V4JC 2XV4S 2KKOA 1HSTA 3IP4B 1SFXA 3GYHX 3BZCA 2K7LA 3FBNB 2BYVE 3RYRA 1C0WA 1W0TA 2ID3A 3V7SA 1YJ9I 3D5RC 3GVAA 2VT3A 5EEGA 5E1ZB 4P9UA 4RDUA 5HLGA 3K69A 2BY2A 1U0JA 3SFIA 2E7WA 1ZRFA 4HBLA 2LYCA 1IRXA 2VC0A 3A4CA 4BQQA 2E7XA 4LGWA 2IA1A 3ASNH 3CMMA 1LKXA 2CUFA 4XL9A 2CV2A 2IS6A 1I1SA 3PUBA 3S2HJ 2R3SA 2EFNA 5DD8A 4BQOA 2R5YA 1T0FA 3G2BA 5CYVA 3SZTA 1WJEA 4C2MJ 4CXFA 1QNTA 1SMYF 3QYBA 2O5RA 3C3WA 2STTA 4GDFA 2FX0A 5EZHA 1HBXG 3DEEA 1IDZA 1MGTA 2LH9A 3ABLH 3PQJA 1WRJA 4JP0A 2LY2A 4PJMA 1BM9A 2VXDA 1EJ9A 1VI0A 2PMHA 3TOAA 2W24A 1ON2A 4BXUA 3ELKA 3JR9A 4N0BA 5ICEA 3W2WA 3HPGA 4EM2A 4NQWB 2VUMJ 3OYBA 1P92A 2Z33A 3HUGB 1N77A 4LK0F 2NS8A 4N4NB 3ZQIA 5E3OA 2HPIA 4IRHA 5K7ZA 3G4SI 1JUMA 1Z7UA 2CMPA 1K78A 2QM3A 2A07F 2EBIA 3JAMZ 3KYDB 4BXFA 1DDNA 1IXSB 2PX9A 5DS9A 1TWFJ 2L02A 3ZCOA 4JOMA 4R1HA 5IYBJ 2DT7B 3V7CA 2XDVA 1ZG5A 2E2IJ 1RKTA 2IPQX 2HI3A 3TDUC 4F91B 2K9NA 2LRDA 1OYYA 1A6QA 1WVRA 4Y33A 2XSDC 5M5XJ 2DYSH 4RGUA 2B0LA 4II2A 2R5ZB 4XNFA 4RA2A 3ML6A 2KQRA 1JUPA 2IA2A 3BQYA 3DTEA 3K4BA 3F8BA 1IW7F 2XAHA 2VB6A 5TISC 5TRDA 1J75A 2K9SA 1ITYA 3ZMUA 3G1MA 1IRZA 1PUFB 2CSOA 3DU6A 3MFKA 1R9TJ 2RNJA 3MD2A 4ZDLA 3SXYA 4Q4ZF 1QZZA 2BY1A 2A68F 2PQ8A 1FNNA 2OZ6A 2GOXB 5FRMA 2V1DA 1DU0A 1MMAA 4BHPA 2CV0A 3SHFA 1ETVA 3LA2A 5ILUA 3ZQ7A 2EILH 4PSXA 5HLIA 4L5IA 2GXAA 4XR6A 3HHHA 3H35A 3C2HA 3S1RJ 2E1CA 3ZQLA 4LG0B 1FP1D 2IGMA 1TQMA 1ODDA 3CCYA 3ESWB 1FSHA 4XLHA 1SC7A 1A35A 4V19K 5L3DA 2EB7A 1VQ7I 3ZQCA 1OPCA 4YEJA 2EINH 2LF7A 2VQCA 2UV1A 2R5YB 2X48A 1V55H 4KJZA 2TRTA 3F21A 4M6VA 4Z6YA 2WB1A 3A1YA 4XONA 3DTIA 1B59A 1HDPA 3WGIA 1MNMC 4N9HA 3CDLA 1R7JA 3IL2A 4E7HA 3GTPJ 4EM0B 3F6VA 1XMAA 1LE8A 1FPQA 5F0HA 1FOKA 1D0YA 3QQAA 3J80K 2DDAA 2OCCH 1IGNA 1YYVA 3M1CA 3BG3A 3RKQA 1ZGWA 1DP7P 4P9FA 3KLNA 1I50J 1P6RA 4HRIA 4PGGA 2LOOA 1QA6A 2QKMB 2O7OA 2JUCA 4IHYA 1TC3C 1AHDP 2STWA 3L2QA 5CPRB 4B1RA 1K78B 5FRNA 2EV6A 2QEXI 1U8RA 4I02A 2ESNA 2LREA 1MBKA 3GTKJ 2M2EA 3FXKA 4MEYF 1V5GA 3ABKH 4AU7A 1Y0NA 4M73A 3HM5A 2VN2A 3D1NI 1R00A 1JTXA 4AIKA 1UB9A 1BI1A 3MZYA 2W25A 5F6FA 3KZZA 3OYIA 3MAJA 1LEBA 1BW5A 1YIOA 4G9YA 4YRVA 3OYFA 2KIQA 3EUKL 1T2KA 1ETXA 1GVJA 5CQEA 2LKXA 2BVMA 3F8MA 2O6GE 1IZ1A 4IRIA 3G1OA 2HZDA 1IDYA 3HGYA 2R7QA 5HLTA 2LDUA 2R7VA 2DMQA 4JK1X 2GIVA 5KAIC 1JKQC 4GYIA 2I8DA 2X6WA 3GXOA 3I4PA 3HTSB 3IKTA 4XKCA 5CKTA 5IOZA 1KONA 1ZLKA 2F5DA 3B73A 3FM3A 4I7HA 2BEOA 3HXLA 1SFUA 3L2VA 4BDZA 3PFYA 2OQRA 4K2EA 2KHMA 3H0DA 1Z7LA 3SZPA 4WCGA 4LB6B 4DYRA 2HGCA 4AWXB 5DUIA 3MZ8A 3ZMDA 1TW2A 2F2EA 1SFEA 2LP0A 1W4MA 1HKQA 2L7MP 3BR1A 4NHJA 3ABTA 4ETSA 4HX7A 1G3YA 1QRYA 1QVTA 5LD2C 1W0UA 3REOA 1OYWA 4NUBA 5BQTA 1R5HA 3NQOA 4BJTA 3PNVA 4A3EJ 1YX3A 2BVLA 2V7FA 1V5EA 1IN6A 2MA3A 2Z16A 3E6DA 4DOZA 2RQPA 2YX7A 3S17J 3CC2I 5IT9Z 4L9VA 1RZ4A 2DMNA 2QZ8A 2N8GA 2W82A 4A5NA 4BKXA 5BMZA 1P4AA 4ANJA 1ETOA 2BBYA 2Y9YA 3HOTA 1LE8B 2A6TA 4UV8A 3J7YJ 3SQNA 4PFPA 3E1SA 1MBHA 2EIJH 3K1MA 2HXOA 1K6YA 5EZGA 1YS7A 4X1EA 3S2WA 2DXIA 2FA5A 3KZIC 1BIBA 3E6MA 3OR1C 2P7VB 2ZJQF 4ZTFA 1CF7A 2HZTA 3A2KA 2ZXHA 2M9HA 3EDPA 2ME6A 2RKHA 4LK1F 3LSIA 5M5WJ 2R7DA 3QPHA 1W36D 3ZMSA 2AQEA 1XSVA 5KVRA 4F52A 4D0PA 1S9HA 2QF7A 3F72A 5BNGA 1JKRC 4RB3C 2X6OA 5HDKA 3S16J 2JMWA 2CUZA 2WB1N 4ZYDA 4FE7A 2V1XA 1ZLJA 5FGMA 4ESJA 2GM4A 2QGUA 3A02A 3RQ4A 4QIWN 5LEKA 5JHUA 3DKXA 3DKWA 4IOCF 3C2GA 1ZARA 1U9OA 4M72A 4PCQA 4M3DA 1W36C 2VKHA 3T1BA 2KMUA 4I0AA 2K40A 3ZMVA 1BC7C 2K27A 2M8EA 4EGZA 1YFHA 1EKEA 3C18A 4KT6A 3OY9A 3CJNA 3RQIA 3DEWA 2NVTJ 2IAIA 3LSHA 4FISA 4MQVA 4IHXA 1FT9A 1Y1WJ 2JSPA 2HDWA 3P7NA 3BZ6A 2MC4A 2JA2A 4YFNF 1AWCA 1DGWY 2K02A 2OV7A 4ON0A 1N78A 5F64A 4M71A 1LFBA 1TT5B 2K3PA 4ZDPA 2HKXA 1SFOJ 3KP6A 1V4RA 2M0MA 2L0KA 1BI0A 1R49A 4BHCA 2V9KA 3BCAA 3HKZA 4M9ZA 4KIBA 3OWTA 3A0BC 2XAJA 2MD0A 3KP3A 5CVUA 4E7IA 3L09A 2EV5A 1FIAA 2VBYA 1IUYA 5TJJA 1Z21A 2JTVA 2KPMA 2QCOA 4XLAA 4EJOA 2VJ4A 3I54A 4NBQA 4OIOF 4ESFA 4CZCA 4CICA 2CS3A 1YOVB 2Y0SN 2O61A 2RVCA 3BR3A 3LA7A 2PG4A 1QU3A 3JSOA 1ZGJA 1DUXC 2M5WA 2A6HF 1Y8QB 3BJOA 3IH4A 5C4JJ 1MNDA 5FFXA 1RKWA 3LFUA 4PK4A 4D7MA 5F1JA 1JT0A 4EM1A 1VZ0A 4FX4A 1HCRA 2JUGA 5D5UB 3CD6I 3WGHA 3AG2H 3FMRA 4Y4RA 1VNDA 3QU6A 1Y8RB 4KT5C 4RAGA 2EIMH 2TCTA 3H92A 1CF7B 1T38A 3P9KA 4F7ZA 2F4MB 4W1UA 2KDOA 4EJWA 2L5QA 1PVEA 1OLTA 2YU3A 2E1NA 2HOTA 4OAYA 1EF4A 4HOBA 3VYRB 3ERMA 3CJTB 4M9XA 3ONQA 2YX4A 2FOKA 1WJ5A 5J3LA 4C9YA 2CO5A 1PYVA 2QQ8A 2EFQA 3JRGA 3OIQA 3RI4A 3WU2C 4C30A 3V8KA 3VFZA 1O3QA 4IPAA 3ZQHA 3V8JA 2Z1DA 3GTLJ 1Z05A 3OOUA 1TT0A 4U87A 2HS5A 3FHNA 2RV8A 3VOEA 1Z1DA 4EQQA 3B6AA 4ZYGA 5K7FA 3HOXJ 2HNHA 2XAUA 1JKPC 1R23A 2G0EA 2ZJRF 2QUFA 1Z3XA 1B6AA 2WA0A 2O3FA 3Q5FA 2DI3A 5E3MA 3RKWA 1ZG1A 2V9VA 2QQ9A 3OSGA 3BTIA 4RB0A 4IHVA 2VOOA 3BJAA 1XS9A 2LG4A 1JHHA 2COMA 2YSRA 3FWEA 5J8CA 2FMYA 4DNCA 4F3QA 1LVKA 1K79A 3C1DA 1XN7A 3CTAA 3PIOF 2ZFWA 2PI0A 4CCOA 2JA8J 3NWTA 2KJBA 1W5TA 4CCJA 2L54A 1ZGAA 2CG4A 2DA1A 3H3ZA 1LJ9A 1J9IA 2VPLA 2DODA 3TP0A 1XPXA 2PMUA 1MJ9A 4Y13A 3DXJF 1T8IA 2DJIA 1MZBA 5FLXZ 2XGEA 2HR3A 5J4YA 2JZYA 1LEAA 4XLCA 4LMYA 1YIJI 3EYYA 4ZDOA 1HXDA 3DQVC 3OYJA 1A04A 3T5XA 3M1EA 1YJNI 3S1NJ 2DBBA 3NARA 1MMDA 4B09A 2X6XA 1PDNC 4L9NA 3M4OJ 1S8NA 3WHBA 3K6GA 2EFWA 2ZXIA 4S05A 3CCUI 2CUEA 3M8JA 3TKYA 2XF6A 3K70C 3RZOJ 3ZP5A 2IGOA 3BROA 2Y48A 2PN6A 4BHBA 1HKSA 4RAFA 3OS1A 2PMZA 2XAQA 2GWRA 3SDGA 3KETA 2PJRA 4BBSJ 1EH6A 2VONA 2IGKA 2VE9A 5IPAA 1TBXA 1IJWC 2CGPA 1UJ8A 1ZRDA 5C3EJ 3H9QA 1O7FA 3HKZN 3RPUD 3S8PA 4HW0A 3L9FA 4U88A 4IZZA 4RAYA 1Y1VJ 1O7LA 3DPUA 1WI3A 4S04A 1LDKB 3MKWB 1OCRH 4OWRB 2BY3A 1J5YA 1XDSA 4HX8A 5DDGA 5K5QA 1X2NA 3V7RA 3E0JB 4UVAA 4IL6C 3BOQA 2NS0A 3KFWX 4QPQA 4A3IJ 2JRMA 3HRUA 2CWEA 4PJNA 1HOMA 2FSWA 4HV5A 2QWWA 3FMQA 3MQ0A 3RTRA 3VYTB 3HOWJ 1H89C 1USSA 2JSCA 3D0SA 1YW9A 3VODA 4DZJA 2L9SA 4HF1A 3FXUA 4Q5SF 2WBMA 1UZCA 3PM1A 1IF1A 4LD5A 2L4AA 3HEFA 3KEYA 4JBAA 1ZR2A 1MBEA 2O03A 1OCCH 3K9TA 3D5LA 2A69F 4I2OA 3FXMA 4RLQA 3KLOA 3IRRA 3I71A 4O5VA 1E0EA 4V2FA 3OYNA
chains in the Genus database with same CATH topology
3GBGA 1JUPA 4FTHA 2E1OA 3BQYA 1D5YA 3BG5A 2Y2ZA 2NVXJ 2K9SA 1ITYA 2KDZA 4AC0A 3G1MA 1IRZA 1PUFB 2M8GX 2K9QA 1R9TJ 1P7IA 4C3IJ 3IV5A 1A5JA 1ZKGA 4RBOA 1X2MA 2DMPA 1BW6A 5C44J 1WCMJ 5M3MJ 3M3YJ 4AUXA 1DU0A 3PO2J 2JWTA 3GTGJ 1ETVA 5IOYA 3OSFA 4CYCB 5GPCA 2M34A 1BA5A 5IYCJ 1GT0C 3GTJJ 3LNQA 2IEKA 4S0HB 3S1RJ 1ZTRA 5F04A 1SANA 3ZQLA 2HXIA 3JRIA 1WPKA 1WH7A 4IHWA 3CCYA 2VPRA 5F0FA 2HOSA 4J19A 5EG0B 5EYRA 3ZOBA 2WAQN 2MGQA 2Y31A 4XIDA 3ZQCA 3S14J 1MBGA 3HOZJ 2E19A 2R5YB 2L7ZA 2X48A 2LR8A 2TRTA 1QVUA 4M6VA 1GVDA 1ZR4A 1HDPA 1MNMC 4A3GJ 3CDLA 3FKIJ 3GTPJ 2JA7J 2VKVA 4A3KJ 4I6ZA 2VI6A 1LE8A 2IBDA 4Y52J 1RETA 5F0HA 1GV2A 3QQAA 3JRBA 2LFBA 2P81A 1IGNA 2OPTA 3RKQA 3BG3A 1TWCJ 3K2AA 1ZGWA 5IP9J 4MO7A 2FJ1A 4M3EA 1I50J 1VFCA 1APLC 4A3BJ 1AKHB 2R7ZJ 2O7OA 4IHYA 1TC3C 1AHDP 4NDLA 3BQZA 2ZB9A 3LOCA 4B1RA 3GTMJ 2EZKA 3C2BA 1MBKA 2FQ4A 5GP9A 3MN2A 3GTKJ 2M2EA 3Q0WA 2O9LA 3S1MJ 3TP3A 1U9NA 3BTJA 4QSHA 1XC5A 2XPVA 3I4NJ 1JJ8C 3HM5A 4DZPA 3D1NI 1BJZA 3LSJA 2PMZN 3BT9A 1JTXA 2XPWA 1OCTC 2Y9ZA 3B6CA 2HOAA 4GFBA 2H1KA 1F36A 5M5YJ 1BW5A 4UUSA 3Q3SA 3K7AJ 4A3FJ 2ECBA 1ETXA 2LKXA 3JRCA 5FKMA 4BY7J 4MLOA 2O8KA 4BY1J 4MIMA 4A3CJ 3G1OA 4DYCA 1B72A 1IDYA 3HGYA 1IUFA 4HNVA 5F27A 1ETQA 4FE4A 1FEXA 3LSRA 2DMQA 3FK6A 2ME0A 5J1YA 1K61A 1JKQC 5FLVA 2JA5J 1WH5A 5K7HA 2JJ7A 5IOZA 1QPIA 2EQRA 2I10A 3CMYA 3VPRA 3I4MJ 1U78A 4EEFG 1MBJA 2XGCA 2D5VA 2X9DA 2COBA 1JUSA 2EZHA 1T33A 4DYRA 4A93J 4M3FA 5FKNA 3QPLA 5F0CA 2ID6A 1TWAJ 1Z0XA 2LK2A 2LP0A 2L7MP 3BR1A 3BTLA 1QRYA 1QVTA 1ENHA 2CQXA 2GBYA 3FIWA 1W0UA 1DU6A 4C3HJ 1RESA 2RAEA 2DMTA 4XK4A 3BR0A 1BL0A 1T56A 1MSFC 4A3EJ 4LOCA 3F0CA 3WHCA 4M3GA 1FTTA 4XRMA 2ECCA 3S17J 1K83J 2GLOA 2DMNA 2N8GA 5F08A 2MG4A 4BKXA 1RR7A 2LVSA 1ETOA 3FISA 2Y9YA 1HLVA 4MFEA 1LE8B 2HDDA 1GV5A 3HOVJ 2DJNA 5FKKA 5FKLA 3JRFA 1MBHA 5EZGA 5J1RA 2HXOA 1FIPA 2DN0A 4X1EA 1U8BA 3S15J 1JT6A 1AU7A 1MH4A 1NTCA 4UUTA 1FTZA 5IP7J 1P7JA 2CU7A 2M9HA 4JYKA 2ME6A 1H88C 1GDTA 5M5WJ 1CQTA 4L5EA 1YRNA 1ZK8A 1TWHJ 1H8AC 2QF7A 2DA6A 5BNGA 3HOUJ 3JRDA 1JKRC 1ORKA 4M3BA 2X6OA 3LSPA 4ABZA 3S16J 2JMWA 1FJLA 2WB1N 4FE7A 1UG2A 3O8GA 1ZQ3P 2GM4A 3A02A 4QIWN 3JREA 1X58A 1U9OA 4M3DA 2CJJA 2DA4A 5FLMJ 2XPUA 5E3NA 4UUSB 2K40A 3TEDA 1IG7A 1HF0A 3IH3A 3RQIA 2YU9J 3DEWA 2CRGA 4XRSG 2NVTJ 5IYDJ 4A3LJ 2IAIA 4FISA 3HB9A 3LSGA 1B72B 4D5CA 4IHXA 4DW6A 3HGGA 1Y1WJ 1POGA 1S7EA 4A3DJ 5EEAA 2DA2A 2EZIA 5JLXA 2JK3A 3DCFA 4C3JJ 2NVQJ 3HOYJ 2XRLA 3MKLA 2HQ5A 3GTOJ 1Q1VA 1XG1A 4I76A 1LFBA 1JTYA 1SFOJ 4A3JJ 4D5FA 2CQQA 2B63J 3ZQGA 2L0KA 5GPAA 1MH3A 5EGOA 2NS7A 5EF6A 2E2HJ 1B8IA 4V2GA 1JJ6C 3O8HA 3H3VK 3NAUA 2AO9A 5IP6A 2EH3A 2LLKA 1VF9A 4W97A 4FCYA 1FIAA 3TW7A 3FK7A 2QCOA 1UMQA 2JA6J 4B3AA 2Y0SN 4B4CA 3BR3A 9ANTA 2AHQA 3Q0UA 1A6IA 3RZDJ 2MW8A 5M3FJ 4D7NA 3IH4A 5C4JJ 2LY9A 3TW6A 1RKWA 4D7MA 1GUUA 2MSYA 5F1JA 5FKOA 1JT0A 1MBFA 1RPWA 1IC8A 1HCRA 3BR2A 1ETKA 1VNDA 3SJMA 2H8RA 2XGDA 3A01A 1UHSA 2TCTA 5HODA 2DA5A 2XB5A 4G12A 3S2DJ 1JKOC 1Z77A 4W1UA 2YUSA 3G1LA 4Y7NJ 1YRNB 4XICA 2DA7A 1WGXA 2E2JJ 1HDDC 2HOTA 3JRHA 1EF4A 2NOGA 3BR5A 3W6VA 5J3LA 5JLWA 1F43A 3JRGA 4XRSA 3GTQJ 2FD5A 1OJLA 3BG9A 1ETYA 2M0CA 3OIOA 3ZQHA 3A03A 1MSEC 3GTLJ 2R93J 3OOUA 2R5ZA 3E7LA 3JRAA 3HBLA 1I6HJ 3B6AA 4IEJA 3UKGA 5K7FA 3HOXJ 3ZQFA 2WV1A 1JKPC 2KT0A 2G0EA 1OCPA 2ELKA 5E3LA 2DMUA 4JX6A 5E3MA 2EZLA 1PUFA 4DYQA 3OSGA 3BTIA 4A3MJ 4IHVA 1XS9A 5EDNA 1O4XA 5J1UA 2JA8J 4MFDA 4CYCA 2DA1A 2L7FP 4QTRA 3TP0A 1I3QJ 1W0TA 2ID3A 1IV6A 4BXXJ 5EGOB 1B8IB 2XGEA 2R0QC 5FJ8J 4RDUA 3SFIA 2Y30A 3MVPA 3S1NJ 5EG0A 3BR6A 3NARA 5C4XJ 1LFUP 2CUFA 3M4OJ 3S2HJ 3WHBA 2R5YA 2XB0X 4JX5A 2CUEA 1NK3P 2R92J 1OFCX 3RZOJ 2OF7A 4C2MJ 4JX4A 2FX0A 3L1PA 5EZHA 2LTPA 2W48A 1IDZA 1JGGA 4JP0A 2HYJA 3SDGA 4BBSJ 1VI0A 3H0GJ 4X6AJ 3BTCA 1TWGJ 5IPAA 3JR9A 1IJWC 5DTDA 5C3EJ 3A01B 3HDDA 3HKZN 2VUMJ 2NVYJ 4AYBN 1Y1VJ 1WI3A 2JN6A 2NS8A 1AKHA 3ZQIA 5E3OA 2DA3A 1X2NA 5K7ZA 1JUMA 1E3OC 4A3IJ 3S1QJ 2EBIA 2VKEA 1HOMA 5DS9A 1TWFJ 3HOWJ 2L9RA 1H89C 5IYBJ 4DZJA 4A69C 3PM1A 2E2IJ 1RKTA 2HI3A 3HEFA 4BBRJ 3IH2A 3PO3J 1ZR2A 1MBEA 2DTZA 2YS9A 2K9NA 3CQZJ 2LD5A 2XSDC 1ETWA 5M5XJ 1G2HA 4V2FA 2R5ZB 3QPSA 1NK2P 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBG A;  1JUP A;  4FTH A;  2E1O A;  3BQY A;  1D5Y A;  3BG5 A;  2Y2Z A;  2NVX J;  2K9S A;  1ITY A;  2KDZ A;  4AC0 A;  3G1M A;  1IRZ A;  1PUF B;  2M8G X;  2K9Q A;  1R9T J;  1P7I A;  4C3I J;  3IV5 A;  1A5J A;  1ZKG A;  4RBO A;  1X2M A;  2DMP A;  1BW6 A;  5C44 J;  1WCM J;  5M3M J;  3M3Y J;  4AUX A;  1DU0 A;  3PO2 J;  2JWT A;  3GTG J;  1ETV A;  5IOY A;  3OSF A;  4CYC B;  5GPC A;  2M34 A;  1BA5 A;  5IYC J;  1GT0 C;  3GTJ J;  3LNQ A;  2IEK A;  4S0H B;  3S1R J;  1ZTR A;  5F04 A;  1SAN A;  3ZQL A;  2HXI A;  3JRI A;  1WPK A;  1WH7 A;  4IHW A;  3CCY A;  2VPR A;  5F0F A;  2HOS A;  4J19 A;  5EG0 B;  5EYR A;  3ZOB A;  2WAQ N;  2MGQ A;  2Y31 A;  4XID A;  3ZQC A;  3S14 J;  1MBG A;  3HOZ J;  2E19 A;  2R5Y B;  2L7Z A;  2X48 A;  2LR8 A;  2TRT A;  1QVU A;  4M6V A;  1GVD A;  1ZR4 A;  1HDP A;  1MNM C;  4A3G J;  3CDL A;  3FKI J;  3GTP J;  2JA7 J;  2VKV A;  4A3K J;  4I6Z A;  2VI6 A;  1LE8 A;  2IBD A;  4Y52 J;  1RET A;  5F0H A;  1GV2 A;  3QQA A;  3JRB A;  2LFB A;  2P81 A;  1IGN A;  2OPT A;  3RKQ A;  3BG3 A;  1TWC J;  3K2A A;  1ZGW A;  5IP9 J;  4MO7 A;  2FJ1 A;  4M3E A;  1I50 J;  1VFC A;  1APL C;  4A3B J;  1AKH B;  2R7Z J;  2O7O A;  4IHY A;  1TC3 C;  1AHD P;  4NDL A;  3BQZ A;  2ZB9 A;  3LOC A;  4B1R A;  3GTM J;  2EZK A;  3C2B A;  1MBK A;  2FQ4 A;  5GP9 A;  3MN2 A;  3GTK J;  2M2E A;  3Q0W A;  2O9L A;  3S1M J;  3TP3 A;  1U9N A;  3BTJ A;  4QSH A;  1XC5 A;  2XPV A;  3I4N J;  1JJ8 C;  3HM5 A;  4DZP A;  3D1N I;  1BJZ A;  3LSJ A;  2PMZ N;  3BT9 A;  1JTX A;  2XPW A;  1OCT C;  2Y9Z A;  3B6C A;  2HOA A;  4GFB A;  2H1K A;  1F36 A;  5M5Y J;  1BW5 A;  4UUS A;  3Q3S A;  3K7A J;  4A3F J;  2ECB A;  1ETX A;  2LKX A;  3JRC A;  5FKM A;  4BY7 J;  4MLO A;  2O8K A;  4BY1 J;  4MIM A;  4A3C J;  3G1O A;  4DYC A;  1B72 A;  1IDY A;  3HGY A;  1IUF A;  4HNV A;  5F27 A;  1ETQ A;  4FE4 A;  1FEX A;  3LSR A;  2DMQ A;  3FK6 A;  2ME0 A;  5J1Y A;  1K61 A;  1JKQ C;  5FLV A;  2JA5 J;  1WH5 A;  5K7H A;  2JJ7 A;  5IOZ A;  1QPI A;  2EQR A;  2I10 A;  3CMY A;  3VPR A;  3I4M J;  1U78 A;  4EEF G;  1MBJ A;  2XGC A;  2D5V A;  2X9D A;  2COB A;  1JUS A;  2EZH A;  1T33 A;  4DYR A;  4A93 J;  4M3F A;  5FKN A;  3QPL A;  5F0C A;  2ID6 A;  1TWA J;  1Z0X A;  2LK2 A;  2LP0 A;  2L7M P;  3BR1 A;  3BTL A;  1QRY A;  1QVT A;  1ENH A;  2CQX A;  2GBY A;  3FIW A;  1W0U A;  1DU6 A;  4C3H J;  1RES A;  2RAE A;  2DMT A;  4XK4 A;  3BR0 A;  1BL0 A;  1T56 A;  1MSF C;  4A3E J;  4LOC A;  3F0C A;  3WHC A;  4M3G A;  1FTT A;  4XRM A;  2ECC A;  3S17 J;  1K83 J;  2GLO A;  2DMN A;  2N8G A;  5F08 A;  2MG4 A;  4BKX A;  1RR7 A;  2LVS A;  1ETO A;  3FIS A;  2Y9Y A;  1HLV A;  4MFE A;  1LE8 B;  2HDD A;  1GV5 A;  3HOV J;  2DJN A;  5FKK A;  5FKL A;  3JRF A;  1MBH A;  5EZG A;  5J1R A;  2HXO A;  1FIP A;  2DN0 A;  4X1E A;  1U8B A;  3S15 J;  1JT6 A;  1AU7 A;  1MH4 A;  1NTC A;  4UUT A;  1FTZ A;  5IP7 J;  1P7J A;  2CU7 A;  2M9H A;  4JYK A;  2ME6 A;  1H88 C;  1GDT A;  5M5W J;  1CQT A;  4L5E A;  1YRN A;  1ZK8 A;  1TWH J;  1H8A C;  2QF7 A;  2DA6 A;  5BNG A;  3HOU J;  3JRD A;  1JKR C;  1ORK A;  4M3B A;  2X6O A;  3LSP A;  4ABZ A;  3S16 J;  2JMW A;  1FJL A;  2WB1 N;  4FE7 A;  1UG2 A;  3O8G A;  1ZQ3 P;  2GM4 A;  3A02 A;  4QIW N;  3JRE A;  1X58 A;  1U9O A;  4M3D A;  2CJJ A;  2DA4 A;  5FLM J;  2XPU A;  5E3N A;  4UUS B;  2K40 A;  3TED A;  1IG7 A;  1HF0 A;  3IH3 A;  3RQI A;  2YU9 J;  3DEW A;  2CRG A;  4XRS G;  2NVT J;  5IYD J;  4A3L J;  2IAI A;  4FIS A;  3HB9 A;  3LSG A;  1B72 B;  4D5C A;  4IHX A;  4DW6 A;  3HGG A;  1Y1W J;  1POG A;  1S7E A;  4A3D J;  5EEA A;  2DA2 A;  2EZI A;  5JLX A;  2JK3 A;  3DCF A;  4C3J J;  2NVQ J;  3HOY J;  2XRL A;  3MKL A;  2HQ5 A;  3GTO J;  1Q1V A;  1XG1 A;  4I76 A;  1LFB A;  1JTY A;  1SFO J;  4A3J J;  4D5F A;  2CQQ A;  2B63 J;  3ZQG A;  2L0K A;  5GPA A;  1MH3 A;  5EGO A;  2NS7 A;  5EF6 A;  2E2H J;  1B8I A;  4V2G A;  1JJ6 C;  3O8H A;  3H3V K;  3NAU A;  2AO9 A;  5IP6 A;  2EH3 A;  2LLK A;  1VF9 A;  4W97 A;  4FCY A;  1FIA A;  3TW7 A;  3FK7 A;  2QCO A;  1UMQ A;  2JA6 J;  4B3A A;  2Y0S N;  4B4C A;  3BR3 A;  9ANT A;  2AHQ A;  3Q0U A;  1A6I A;  3RZD J;  2MW8 A;  5M3F J;  4D7N A;  3IH4 A;  5C4J J;  2LY9 A;  3TW6 A;  1RKW A;  4D7M A;  1GUU A;  2MSY A;  5F1J A;  5FKO A;  1JT0 A;  1MBF A;  1RPW A;  1IC8 A;  1HCR A;  3BR2 A;  1ETK A;  1VND A;  3SJM A;  2H8R A;  2XGD A;  3A01 A;  1UHS A;  2TCT A;  5HOD A;  2DA5 A;  2XB5 A;  4G12 A;  3S2D J;  1JKO C;  1Z77 A;  4W1U A;  2YUS A;  3G1L A;  4Y7N J;  1YRN B;  4XIC A;  2DA7 A;  1WGX A;  2E2J J;  1HDD C;  2HOT A;  3JRH A;  1EF4 A;  2NOG A;  3BR5 A;  3W6V A;  5J3L A;  5JLW A;  1F43 A;  3JRG A;  4XRS A;  3GTQ J;  2FD5 A;  1OJL A;  3BG9 A;  1ETY A;  2M0C A;  3OIO A;  3ZQH A;  3A03 A;  1MSE C;  3GTL J;  2R93 J;  3OOU A;  2R5Z A;  3E7L A;  3JRA A;  3HBL A;  1I6H J;  3B6A A;  4IEJ A;  3UKG A;  5K7F A;  3HOX J;  3ZQF A;  2WV1 A;  1JKP C;  2KT0 A;  2G0E A;  1OCP A;  2ELK A;  5E3L A;  2DMU A;  4JX6 A;  5E3M A;  2EZL A;  1PUF A;  4DYQ A;  3OSG A;  3BTI A;  4A3M J;  4IHV A;  1XS9 A;  5EDN A;  1O4X A;  5J1U A;  2JA8 J;  4MFD A;  4CYC A;  2DA1 A;  2L7F P;  4QTR A;  3TP0 A;  1I3Q J;  1W0T A;  2ID3 A;  1IV6 A;  4BXX J;  5EGO B;  1B8I B;  2XGE A;  2R0Q C;  5FJ8 J;  4RDU A;  3SFI A;  2Y30 A;  3MVP A;  3S1N J;  5EG0 A;  3BR6 A;  3NAR A;  5C4X J;  1LFU P;  2CUF A;  3M4O J;  3S2H J;  3WHB A;  2R5Y A;  2XB0 X;  4JX5 A;  2CUE A;  1NK3 P;  2R92 J;  1OFC X;  3RZO J;  2OF7 A;  4C2M J;  4JX4 A;  2FX0 A;  3L1P A;  5EZH A;  2LTP A;  2W48 A;  1IDZ A;  1JGG A;  4JP0 A;  2HYJ A;  3SDG A;  4BBS J;  1VI0 A;  3H0G J;  4X6A J;  3BTC A;  1TWG J;  5IPA A;  3JR9 A;  1IJW C;  5DTD A;  5C3E J;  3A01 B;  3HDD A;  3HKZ N;  2VUM J;  2NVY J;  4AYB N;  1Y1V J;  1WI3 A;  2JN6 A;  2NS8 A;  1AKH A;  3ZQI A;  5E3O A;  2DA3 A;  1X2N A;  5K7Z A;  1JUM A;  1E3O C;  4A3I J;  3S1Q J;  2EBI A;  2VKE A;  1HOM A;  5DS9 A;  1TWF J;  3HOW J;  2L9R A;  1H89 C;  5IYB J;  4DZJ A;  4A69 C;  3PM1 A;  2E2I J;  1RKT A;  2HI3 A;  3HEF A;  4BBR J;  3IH2 A;  3PO3 J;  1ZR2 A;  1MBE A;  2DTZ A;  2YS9 A;  2K9N A;  3CQZ J;  2LD5 A;  2XSD C;  1ETW A;  5M5X J;  1G2H A;  4V2F A;  2R5Z B;  3QPS A;  1NK2 P;  3Q0V A; 
#chains in the Genus database with same CATH topology
 2A5Y B;  4FTH A;  1D5Y A;  2HWV A;  2NVX J;  1J7K A;  5LHH A;  3K4J A;  1HW2 A;  2DU9 A;  2OCE A;  1SAU A;  4ZYA A;  4C3I J;  2GAU A;  3QAH A;  3KX2 A;  4EV0 A;  4KMU X;  2DMP A;  5DCF A;  2FEZ A;  1KYZ A;  2A61 A;  1BBY A;  2ZBK A;  1WCM J;  3S3M A;  4E4H A;  4EJU A;  3CF5 F;  2ZNZ A;  3PO2 J;  3KP4 A;  1E3P A;  1DP3 A;  2NNY A;  1W7P D;  4B44 A;  3DPT A;  5CVV A;  3LAJ A;  2ZO4 A;  1OMI A;  3HRT A;  2M34 A;  3H36 A;  3WTW C;  1IXR C;  4IOA F;  2K85 A;  3MMY B;  5IYC J;  4PUS A;  1GT0 C;  2KIS A;  2L01 A;  1FYK A;  3LFK A;  4FAS D;  1VQM I;  1RUO A;  5E18 F;  3ERE D;  4YFK F;  2VPR A;  3O6B B;  1HC8 A;  2OA4 A;  2W00 A;  5GAH J;  2UXN A;  4R8H A;  4XID A;  1IRF A;  4G7O F;  1FMW A;  3S14 J;  3HOZ J;  1D3Y A;  4BL0 B;  2OQG A;  3GFM A;  1QVU A;  4UNO A;  4CH7 A;  1PJR A;  1GVD A;  2VKD A;  1FYL A;  2WC2 A;  4PFO A;  4PGH A;  2PJR B;  2JA7 J;  1OIS A;  4I6Z A;  2VI6 A;  3DKY A;  4OIN F;  1KYW A;  2DTR A;  4MQ9 F;  5LHI A;  1VQ6 I;  1RET A;  4MNU A;  2VE8 A;  1X3W B;  2P7C B;  2O0Y A;  2W85 A;  2OU2 A;  1TWC J;  2HFH A;  1BOB A;  4M6Y A;  2FML A;  5IP9 J;  1BI2 A;  4M3E A;  3RPU A;  1VFC A;  1AOY A;  2HQR A;  1KU7 A;  1I39 A;  2MFZ A;  2XF7 A;  3CO6 C;  3RPQ A;  2X0L A;  1UAA A;  2M7A A;  3GTM J;  5GTH C;  2EZK A;  2E1M C;  5BOX A;  5L3G A;  1WI9 A;  4BE1 A;  5D4S A;  4G8X A;  2FQ4 A;  5GP9 A;  3S93 A;  1BN5 A;  2O9L A;  3JCU C;  3S1M J;  1U9N A;  4QSH A;  3PFI A;  2XPV A;  2R7R A;  1JJ8 C;  3SFZ A;  3I4N J;  4DZP A;  4ZH4 F;  5ILS A;  4L0Z B;  2PMZ N;  1IAW A;  2GIZ A;  3L2U A;  3B6C A;  4GFB A;  1FBS A;  3QP5 A;  1GXQ A;  1V54 H;  5M5Y J;  3L2C A;  3Q3S A;  4KMF A;  1Z6T A;  3PNT A;  3V4G A;  5AIP A;  1SD7 A;  2QSF X;  3OYH A;  4KIG A;  5D8K B;  2K5C A;  4MLO A;  5H6Q A;  4HA8 A;  1JE8 A;  4BY1 J;  4MIM A;  4UHT A;  4DYC A;  1B72 A;  2VQH A;  2G9W A;  2DQR A;  4HNV A;  2ZME C;  5F27 A;  3G6E I;  4E7K A;  1FOW A;  4FE4 A;  2IJL A;  2QQB A;  2BGC A;  2RN7 A;  3F8F A;  3FK6 A;  4HST A;  4ITV A;  5J1Y A;  4NB5 A;  1K61 A;  4Y15 A;  3QOP A;  1QQI A;  1MKM A;  4U7D A;  4Q48 A;  5K7H A;  1QPI A;  1NG7 A;  2HTS A;  2F5C A;  1W7P A;  2IXS A;  4BAC A;  2PJP A;  3I4M J;  1RIO H;  4EEF G;  4EGY A;  1YS6 A;  4U7B A;  3F8N A;  4HDU A;  1G3T A;  2COB A;  5DM7 F;  1JUS A;  4AIJ A;  1T33 A;  1KQ8 A;  4BDY A;  1L0O C;  4M3F A;  4U0W A;  2OJE D;  5F0C A;  2XRO A;  2CFX A;  1Z0X A;  2LK2 A;  1I27 A;  1F9N A;  4CZZ A;  1UFM A;  3BTL A;  3Q9V A;  1DU6 A;  3CJQ B;  2GBY A;  5B1A H;  3CO7 C;  4C3H J;  1ACI A;  5BPI A;  2V6E A;  4MGR A;  1T6S A;  3F6O A;  2OD5 A;  1YE9 A;  1MSF C;  4LOC A;  3F0C A;  1DPU A;  2FNP A;  2P6S A;  3KYL A;  1WKM A;  1HSJ A;  1NG6 A;  4U0V A;  2CV1 A;  1K83 J;  4HX4 A;  1G8X A;  3KE2 A;  5CVI A;  1Q1H A;  3RYP A;  1ZHF A;  1ZEL A;  1B1B A;  4CSW A;  2V1U A;  1XD7 A;  3OYL A;  2MD5 A;  3CF2 A;  2VQG A;  1GV5 A;  2DJN A;  5FKK A;  2HKO A;  5FKL A;  3WG7 H;  3JRF A;  3GFL A;  1FIP A;  1Z91 A;  4U0Y A;  2H6C A;  2ZFU A;  1MH4 A;  4PJJ A;  1X1C A;  4BYY A;  5EEH A;  4AID A;  1D0X A;  1OCO H;  1P7J A;  2CU7 A;  2ESH A;  3I58 A;  4KIS A;  2DYR H;  4A5M A;  4Q47 A;  1ZK8 A;  1KU9 A;  2F5V A;  2DA6 A;  3WU1 B;  4MTE A;  1WSU A;  5D5V B;  1FYM A;  3L7W A;  1FJL A;  4ZYE A;  2DFF A;  3O8G A;  4GO1 A;  2K9L A;  3BJ6 A;  5E17 F;  3AKZ A;  4GCV A;  1X58 A;  3GCM A;  4N9I A;  3F23 A;  2CJJ A;  3DTK A;  2XPU A;  4GXO A;  1YTY A;  3QU3 A;  3JSP A;  2XHK A;  1JGS A;  2CQK A;  3TED A;  3W3C A;  4P5O A;  1HF0 A;  2CRG A;  5L3B A;  2MBF A;  1B72 B;  1ZRC A;  1V5F A;  4O6J A;  4I09 A;  5HDN A;  4CCK A;  3F9K A;  3HGG A;  3KP7 A;  3PIP F;  2VOD A;  2P8T A;  1PP7 U;  3NWS A;  3OS2 A;  2D1H A;  3J81 K;  4ZTJ A;  3ZRG A;  5HNF A;  1S7E A;  4A0X A;  3U2R A;  5EEA A;  1U6G A;  2EZI A;  2NVQ J;  3IHU A;  5ICC A;  2CH0 A;  2LMD A;  3CLQ A;  3FF5 A;  1VQ8 I;  4OIQ F;  2HQ5 A;  3GTO J;  3GLL A;  4HDV A;  1ZYR F;  1W7P B;  1WJB A;  3HRM A;  1D1C A;  4P55 A;  1U5T C;  2ZJP F;  1U3E M;  2NXN B;  5DCM A;  3X2Q H;  2B63 J;  2W4S A;  1MH3 A;  5EGO A;  5EF6 A;  3PJR A;  1Y56 A;  3WE3 A;  1QZY A;  2E35 A;  3O8H A;  5JHF A;  2M4G A;  2Y0S A;  5IP6 A;  4W97 A;  1G3W A;  3U1D A;  1D1A A;  4IKF A;  2AS5 F;  3FX3 A;  3TW7 A;  1RUN A;  1IN8 A;  1B9M A;  1UMQ A;  2JA6 J;  3W6J B;  3ZMT A;  4QPO A;  5D5X B;  4B4C A;  1AA7 A;  3GUD A;  2NAZ A;  3Q0U A;  3OYA A;  2M7B A;  1MMG A;  2F48 A;  3U9G A;  3EUH C;  5M3F J;  3O3K A;  4D7N A;  2OBP A;  3H3U A;  2CYY A;  2E34 A;  1B4A A;  1R4N B;  2R4G A;  3P9I A;  2HYF A;  4EVI A;  2R7T A;  2HVQ A;  2K86 A;  3LQQ A;  4BUP A;  2A05 A;  3BR2 A;  1N75 A;  3EYI A;  1IV8 A;  1WQ2 A;  3ZR8 X;  5LBQ A;  2E1M B;  3OS0 A;  4C2U A;  3FDY A;  3H9J A;  3SJM A;  5H20 A;  3CP2 A;  1JHF A;  5GAD J;  5D6F A;  1J09 A;  4NNJ A;  1UHS A;  4XOR A;  3AG3 H;  4IQ4 A;  2KIM A;  4DGW B;  4OMZ A;  2DA5 A;  1SMT A;  2H8W A;  4G12 A;  1Z77 A;  3J7A Y;  2UUZ A;  2X6Y A;  2MYS A;  3KIO A;  5JI6 A;  1BJA A;  1R5G A;  2DA7 A;  3GZN B;  4B43 A;  3BR5 A;  4CHU A;  1XGS A;  6PAX A;  4ENM A;  3I55 I;  3CDH A;  1R71 A;  3HRS A;  4DBQ A;  4OIP F;  2MH9 A;  3FM5 A;  3CDI A;  1F4K A;  2AQF A;  2GXG A;  1ETY A;  2CUJ A;  1O3S A;  3K4K A;  1KA8 A;  5JVG F;  3UNG C;  1MSE C;  3QYF A;  4G6Q A;  1MNE A;  1U2W A;  1S7A A;  3CCL I;  2ZCW A;  4DBR A;  3VSL A;  3HBL A;  3R4K A;  3UKG A;  5L3C A;  3WU0 A;  4LJZ F;  2QSG X;  1QGP A;  3I0T A;  1OCP A;  2HEO A;  2IVM A;  2VQL A;  5FD5 A;  2BXY A;  4I01 A;  4DYQ A;  1U5T A;  4IHS A;  1A36 A;  3QYE A;  1O4X A;  3BPV A;  1SD5 A;  4ZYH A;  1HQC A;  2B9S A;  2FUG 2;  3E6C C;  1OYI A;  3T8T A;  1XDU A;  2ISY A;  3CUQ C;  1YW7 A;  3M07 A;  4MFD A;  4MHG A;  2XSJ C;  4HQE A;  2WY8 Q;  4CYC A;  1FOY A;  5DCM B;  1I3Q J;  2NVU B;  5K5R A;  1WZ2 A;  3MZH A;  1IV6 A;  4BXX J;  2VC1 A;  3BY6 A;  5EGO B;  1I5Z A;  2R0Q C;  1X1B A;  1FOX A;  3BLY A;  3EUH A;  3FZV A;  2KRF A;  5EG0 A;  1MW7 A;  4F92 B;  3BR6 A;  3PNY A;  1CGP A;  5CLS A;  1V3F A;  2XAG A;  1J0R A;  5HS7 A;  2X4H A;  5DM6 F;  4JX5 A;  1NK3 P;  4NC6 A;  1Y0U A;  5D8L B;  1R1T A;  2WY7 Q;  4ASN A;  4JX4 A;  5A2Q Z;  2KZV A;  2LTP A;  2W48 A;  3HTU A;  4E7J A;  2BXZ A;  4J01 A;  3DP7 A;  2LKP A;  1SEU A;  4PJ0 C;  1UHW A;  3WE2 A;  4ENN A;  4X6A J;  1STZ A;  1P2F A;  3GFJ A;  5E1X A;  1QPM A;  4FX0 A;  4ENJ A;  3BTC A;  4QWQ A;  1TWG J;  3N97 A;  4I99 C;  1WWX A;  3DBL B;  4DJA A;  4I0B A;  3HDD A;  1YG2 A;  4Y17 A;  3WTS C;  2KFD A;  2ZC2 A;  1AKH A;  4UY8 I;  2DA3 A;  3H1C A;  2WTE A;  2GZW A;  4G7Z F;  1OR7 C;  1VTN C;  3S1Q J;  2FU4 A;  3QPT A;  2VKE A;  4CCM A;  4GGG A;  3TO9 A;  2L9R A;  2OAZ A;  3EQL F;  3K4N A;  3HOS A;  2VOP A;  3EUA A;  3QRF F;  4RLF A;  1FLI A;  4UUV A;  2Q1Z B;  3IH2 A;  2HVS A;  3PO3 J;  4UB6 C;  2DTZ A;  2KLO A;  3CQZ J;  3FKJ A;  1IXC A;  2LD5 A;  3H5N A;  4FQG A;  2ACJ A;  1G2H A;  1PP8 F;  3RJP A;  1L3L A;  3GWZ A;  3GBG A;  4P96 A;  2Q0O A;  3CUQ A;  3K0L A;  2Y2Z A;  3OR2 C;  2GXB A;  1D1B A;  4EMS A;  3I56 I;  1SVO A;  1D8J A;  1U5T B;  2UWM A;  3DFG A;  4HYE A;  1A5J A;  4MEX F;  3COA C;  2AXT C;  2Z2S B;  2XRN A;  1XX5 A;  3LWF A;  5KK1 A;  3M3Y J;  2OC6 A;  4AUX A;  1RC9 A;  4LIT A;  1SAX A;  1G4D A;  1Z9C A;  5J47 A;  5IOY A;  3OSF A;  4CYC B;  1VQ9 I;  4OOI A;  3ECH A;  4CYD A;  5GPC A;  4ENK A;  1YW8 A;  5TGT A;  2JT1 A;  4BH9 A;  1RI7 A;  1XTA A;  3GTJ J;  4E7L A;  3LMM A;  3M8F A;  2XF5 A;  1TLH B;  2DT6 A;  1SAN A;  3M7G A;  2HXI A;  3JRI A;  4MTD A;  1VQO I;  3SEQ A;  5KCM A;  2ELJ A;  3GLX A;  4IHW A;  1YLF A;  2HOS A;  4J19 A;  5EG0 B;  2ADU A;  3GFI A;  2EV0 A;  5EYR A;  2W1O A;  1EH7 A;  2WAQ N;  2GOM A;  3Q9S A;  5K5O A;  3KCC A;  3ZGK A;  4A6E A;  4G6D A;  1MBG A;  2E19 A;  2L7Z A;  1YI2 I;  2CQ7 A;  2LR8 A;  3T8R A;  2KZG A;  3DV8 A;  3MWM A;  4KIF A;  2DFH A;  1FSE A;  3TQN A;  3K70 D;  3GO5 A;  2VKV A;  3GW2 A;  3CES A;  2CW8 A;  1OR7 A;  5IT9 K;  4AVZ A;  2P81 A;  2OPT A;  2HQN A;  3K2A A;  2H09 A;  2FJ1 A;  3I9V 2;  2VT2 A;  1AKH B;  5LFA A;  2BW3 A;  1K6O A;  2DPU A;  2R7Z J;  3FXR A;  2P5L C;  4NDL A;  4JQF A;  3BQZ A;  3L00 A;  3R0J A;  1LUJ B;  1NH3 A;  1H9G A;  2ZB9 A;  2VBX A;  3LOC A;  3K1N A;  3LL7 A;  5LEJ A;  2Z3Y A;  4XLN F;  1VQN I;  2R7W A;  3R6S A;  3Q0W A;  2QSH X;  3I64 A;  5CVJ A;  3TBI A;  4BJ5 C;  2HTJ A;  1XSX A;  2LY1 A;  4UB8 C;  3BTJ A;  3SEZ A;  1O57 A;  3LSJ A;  3BT9 A;  1OCT C;  2CW7 A;  4XBF A;  2EA4 A;  3S3O A;  2H1K A;  2BOL A;  4YIF A;  4G6T B;  1F36 A;  4PDK A;  4CUG A;  4D1Q A;  4UUS A;  3OYE A;  3K7A J;  2Z99 A;  2DK8 A;  2VL8 A;  4A3F J;  2ECB A;  3M8E A;  3CUQ B;  5DUK A;  3HPH A;  2O8K A;  3VB2 A;  4A3C J;  2J5O A;  2MAB A;  3D5S C;  1SD4 A;  2TDX A;  1ZG3 A;  1T39 A;  4TV7 A;  4XOT A;  2XVC A;  4IHT A;  2FBK A;  3RDI A;  4RB1 A;  2W7N A;  5FLV A;  1WH5 A;  3WTZ A;  4BEH A;  3GZ5 A;  1LDJ A;  4A2U A;  2PFB A;  2I10 A;  3KP2 A;  3CMY A;  3VPR A;  2FXA A;  3DU5 A;  4LG3 A;  1MBJ A;  2FBH A;  2XGC A;  2X9D A;  4WXC A;  5LGU A;  1O3T A;  3TO6 A;  4ZC3 A;  2ICW G;  4A93 J;  2VLA A;  5FKN A;  2JVH A;  4G94 A;  2Q8K A;  3KEQ A;  2R7X A;  3K4M A;  3VDX A;  5L3F A;  3FIW A;  2LBF A;  4X0G A;  4LLG F;  1KZH A;  2X51 A;  1T95 A;  2RAE A;  3VSK A;  5LGN A;  4GRI A;  1YQA A;  1D0Z A;  3RCO A;  3NRV A;  4YFX F;  1BL0 A;  2IT0 A;  2M4K A;  2DOF A;  5DEQ A;  3TOB A;  1T56 A;  3WHC A;  4M3G A;  1OKR A;  3JW4 A;  1FBQ A;  2OZU A;  2JQ7 A;  2ECC A;  5HS9 A;  3BWG A;  4WWC A;  4KNY A;  1FZP B;  3J80 Z;  2GLO A;  3OYK A;  3A0H C;  2MC3 A;  5F08 A;  5CQG A;  4KDP A;  5LLQ A;  4HPQ A;  4RAZ A;  5ICF A;  1RR7 A;  5ERI A;  1QBJ A;  2NNN A;  2X1D A;  1K4T A;  2Y0M A;  1MDM A;  3CZ6 A;  3LST A;  2ZJ2 A;  3TGN A;  2HDD A;  1EV7 A;  2RGV A;  4G7H F;  4CGZ A;  1TTY A;  2V9P A;  4BS9 A;  5J1R A;  1JT6 A;  3B02 A;  4XLE A;  4KFC A;  3MKY B;  1Z3Y A;  1QO0 D;  3AG1 H;  2BW3 B;  4WK8 F;  2ZKZ A;  2QQA A;  2M87 A;  2M30 A;  2IS1 A;  4I98 B;  2MLG A;  4JYK A;  1GDT A;  1QHG A;  4IQJ A;  1CQT A;  4L5E A;  4LIU A;  3WTX C;  4E7Z A;  1S29 A;  4D9J A;  1GHC A;  1H8A C;  4AVP A;  3HOU J;  1TNS A;  3JRD A;  1ORK A;  1S5L C;  1MJB A;  2BZT A;  1MD0 A;  4HG2 A;  3C7J A;  3TDZ C;  4ABZ A;  2R7U A;  1UG2 A;  2DT5 A;  5DYM A;  1ZQ3 P;  1G6N A;  2JVG A;  2C6Y A;  3JRE A;  2IA0 A;  4R79 A;  3BPX A;  2A6E F;  1JXS A;  3DBR B;  4UUS B;  4KUM A;  1ZH5 A;  4NC7 A;  3KP5 A;  4HNU A;  1IG7 A;  5GAG J;  3TMO A;  1VQ4 I;  2J5P A;  3IAS 2;  3WTT C;  4OIR F;  1X1A A;  2YPR A;  3LSG A;  4PJL A;  4LG0 A;  4RGR A;  1FC3 A;  3OYC A;  1POG A;  3LQR A;  2ETH A;  2ZXJ A;  4A3D J;  2DA2 A;  5JLX A;  2JK3 A;  3DCF A;  3E6B A;  3ZPL A;  2XRL A;  3IWZ A;  4BEH B;  4XSX F;  1DGR M;  3ABM H;  4B47 A;  1RR8 C;  4FHT A;  1Q1V A;  1XG1 A;  3P9C A;  4I76 A;  1JTY A;  1KQ9 A;  4A3J J;  4D5F A;  2CQQ A;  2RRE A;  3ZQG A;  5GPA A;  1XCB A;  2BHZ A;  2E2H J;  1B8I A;  5AIQ A;  1G3S A;  1E17 A;  2L9N A;  2M1B A;  2D45 A;  2QLZ A;  3OMY A;  4HLX A;  4AYB A;  2EH3 A;  2LLK A;  2EFP A;  3CCR I;  1DQU A;  2DCE A;  2LBF B;  2DFE A;  2RQQ A;  3WOD F;  3FK7 A;  4IO9 F;  5FLX K;  4B3A A;  4P1W A;  2FRH A;  4L0Y B;  2DO7 A;  3CJR B;  2AHQ A;  1A6I A;  2K9M A;  3RZD J;  2MW8 A;  2HPM A;  1R36 A;  3J7A O;  4L9T A;  3TW6 A;  3P5J A;  3AG4 H;  1Z6R A;  3I3L A;  4KN4 X;  2MSY A;  2H27 A;  1W5C C;  1RPW A;  2I5U A;  5JVT A;  1F1Z A;  1MDM B;  1IC8 A;  2IW5 A;  3OOP A;  1IN7 A;  2JPB A;  1BI3 A;  1ETK A;  2WAD A;  1I6X A;  2H8R A;  2XC7 A;  2PBI A;  1XSD A;  4RM2 A;  5HDG A;  3HJE A;  5J8F A;  3A01 A;  3ZN1 A;  1SFK A;  2WV0 A;  3BCB A;  1RRJ A;  4A0Z A;  4WXH A;  2EPF A;  1JKO C;  4LIV A;  1OCZ H;  3OV8 A;  3KZY A;  3G1L A;  4Y7N J;  1WJC A;  1E2X A;  4XIC A;  1WGX A;  2E2J J;  4B8X A;  3H9G A;  2XAF A;  4XRF A;  3AAF A;  2XKO A;  4XKW A;  2P5V A;  3R60 A;  5JLW A;  1MMS A;  3GTQ J;  3NEU A;  3FBI B;  5J40 A;  1BIA A;  3PSF A;  3HSF A;  3MEX A;  2K4J A;  2M0C A;  3DBH B;  3FXJ A;  3OIO A;  4HF2 A;  1R6R A;  1OQY A;  2ZXW H;  3A03 A;  4E7S A;  1HA8 A;  3GX4 X;  2R93 J;  4OMY A;  4LLL A;  3LA3 A;  4HAM A;  4C2T A;  2ZSI B;  5HLH A;  1ERD A;  2LSO A;  4IEJ A;  5FO5 A;  2VAS A;  3ZQF A;  2WV1 A;  2DOE A;  1LNW A;  5BPD A;  1K4S A;  3LSM A;  3ASO H;  1FP2 A;  3CCV I;  2QA4 I;  4A3M J;  1YJW I;  3R0A A;  3F8C A;  4J00 A;  2QBY A;  2EIK H;  4ZZD A;  2D1V A;  4IF4 A;  2HQA A;  5D4R A;  3RKX A;  5J1U A;  4DIQ A;  2ZME A;  3DLL F;  4FET A;  2ELH A;  3ISP A;  2L9V A;  2ZNY A;  4XM3 A;  4F55 A;  2L7F P;  5B1B H;  4QTR A;  2XKP A;  3KPH A;  4KN7 X;  1SD6 A;  1LVA A;  1B8I B;  3K1P A;  2L4M A;  5FJ8 J;  2DLL A;  5LRR A;  3K4L A;  1P9Q C;  2K4B A;  3MKZ A;  2Y30 A;  3RKY A;  3QP6 A;  4HZF A;  3MVP A;  3VEP A;  3W2A A;  4RM3 A;  3W6K B;  5C4X J;  4H4K C;  3FXQ A;  1LFU P;  1LPQ A;  3LAP A;  4CCL A;  4AM3 A;  3GF2 A;  2XB0 X;  1I1G A;  1OFC X;  4GYG A;  2OF7 A;  3OL4 A;  4UV9 A;  2R92 J;  3IAM 2;  2DQL A;  3IRQ A;  2G7U A;  4IRG A;  3L1P A;  4HEA 2;  1JGG A;  2BE5 F;  2HYJ A;  3S3N A;  4M9S A;  3EPZ A;  3WG9 A;  4CDG A;  3H0G J;  5B5E C;  3H5R A;  1X3U A;  1XMX A;  3SZG A;  4L5J A;  1LDD A;  3FMS A;  2E36 A;  5DTD A;  3A01 B;  4H0E A;  1X1D A;  3RSN A;  1UST A;  4N4O B;  1MJA A;  3ROU A;  2NVY J;  4AYB N;  2KJC A;  2KRC A;  2JN6 A;  1BR2 A;  3AL0 B;  5LGT A;  5LHG A;  1J2X A;  1TP4 A;  2GQQ A;  3FHZ A;  3QOD A;  1E3O C;  5CVR A;  3CMA I;  1B9N A;  4RMN A;  3QOE A;  1YX5 A;  4XLP F;  3F3X A;  4WXD A;  4M74 A;  4ZZL A;  2Y75 A;  4A69 C;  1O3R A;  3IC7 A;  2LF8 A;  3WTU C;  2IS2 A;  3GEZ A;  2F6C A;  4BBR J;  4YIR X;  3E3V A;  1ULY A;  1FBU A;  2YS9 A;  4XKB A;  2P0W A;  3VYS B;  2KIU A;  4A0Y A;  5H2F C;  4BJ6 C;  1ETW A;  3QPS A;  4PSW A;  2E71 A;  3ECO A;  4M6X A;  3I59 A;  3Q0V A;  2L2O A;  1H88 C;  1NK2 P;  3DPL C;  2E1O A;  3CCJ I;  3BG5 A;  2BHY A;  1UG0 A;  2XIG A;  4AC0 A;  1DPR A;  2KDZ A;  2RNG A;  4CCN A;  2M8G X;  3BG7 A;  1ZRE A;  2K9Q A;  2ISZ A;  1P7I A;  2QBY B;  3IV5 A;  4BQA A;  2QKL B;  1ZKG A;  4RBO A;  4YII A;  1X2M A;  1BW6 A;  5C44 J;  5M3M J;  1HKT A;  1QZE A;  1R1U A;  2HU9 A;  3JAM K;  1IO2 A;  2JWT A;  1W1W E;  3GTG J;  2ZME B;  2VJJ A;  3AFH A;  2H94 A;  1BC8 C;  1BA5 A;  1Y39 A;  4CA0 A;  4ZJZ A;  3HSR A;  2IEK A;  4S0H B;  2A3S A;  3LNQ A;  1ZTR A;  5F04 A;  3PL8 A;  3S32 A;  2HOE A;  2Q2E A;  2CW0 F;  2WAQ A;  3OYG A;  1WPK A;  1WH7 A;  2DFI A;  2RC4 A;  2KP6 A;  1XGO A;  1HW5 A;  3BZK A;  4XKV A;  5F0F A;  4YG2 F;  5HNH A;  5K1Y A;  3WTY C;  1I3A A;  3M9A A;  3ZOB A;  4EJV A;  3N4M A;  2EWN A;  2MGQ A;  2Y31 A;  4OU0 A;  2VXZ A;  4BE0 A;  2KL4 A;  1R58 A;  4E6K G;  3BP8 A;  4RGS A;  5FD6 A;  2F5E A;  3QWL A;  2Z9O A;  4ESB A;  2QVO A;  4LLN A;  1A31 A;  3GME A;  3JTG A;  1KGS A;  5HVQ C;  1ZR4 A;  1H0M A;  3CCS I;  4A3G J;  1XCV A;  3CLO A;  2DK5 A;  3FKI J;  3TO7 A;  5J6X A;  1TW3 A;  5DD4 A;  4A3K J;  1ZN2 A;  3DEU A;  2KRH A;  1SVM A;  4BAY A;  5L3E A;  5KHD A;  2IBD A;  2VJ5 A;  3PSI A;  5AON A;  1KQ0 A;  4IX7 A;  4Y52 J;  1GV2 A;  3RIR A;  3JRB A;  2LFB A;  2X85 A;  3E97 A;  4XOP A;  4FT8 A;  4HSR A;  1Y6I A;  2RDP A;  1FX7 A;  4MO7 A;  2V79 A;  1WJA A;  2P6T A;  1APL C;  4A3B J;  4PZJ A;  2X1C A;  5IT3 A;  5E8I A;  4WX9 A;  2P4W A;  2ZSH B;  2XUB A;  3G71 I;  2B7E A;  2QEN A;  2M45 A;  4XN3 A;  3DWL E;  3SYT A;  4AD9 A;  2R7F A;  4KA4 A;  1XGN A;  3PQK A;  2DOA A;  3C2B A;  2EK5 A;  1M1E B;  1FWZ A;  1R5I D;  4Z2Y A;  3MN2 A;  4O3M A;  4UVC A;  1S6L A;  3CCE I;  5ILV A;  3ABU A;  3TP3 A;  4L9J A;  3CC7 I;  1XC5 A;  2FNA A;  1TZL A;  3T0Y A;  1BJZ A;  3BDD A;  1GXP A;  2XPW A;  1KU2 A;  2LNB A;  2Y9Z A;  2GA1 A;  4RGX A;  2HOA A;  4XQF A;  3HHG A;  2EFO A;  1UHM A;  4IVN A;  1UCR A;  5EJC A;  3F22 A;  3E5Q A;  3I59 B;  5FFZ A;  3MCZ A;  1X4O A;  4IXA A;  2O8X A;  5FKM A;  4BY7 J;  4BU2 A;  3JRC A;  3K4C A;  5JR3 A;  3CUO A;  3TL4 X;  3V42 A;  2BY0 A;  1IUF A;  3HYI A;  4HLY A;  2WWY A;  1ETQ A;  2NOJ B;  3HZJ A;  1FEX A;  1R4M B;  2F5F A;  3LSR A;  2ME0 A;  2M3A A;  1BR4 A;  2YR2 A;  1HW1 A;  2JA5 J;  3ZN0 A;  2PEX A;  1TNT A;  5E20 A;  4KYW A;  2JJ7 A;  2R7S A;  1BOA A;  2EQR A;  2UXX A;  2X1E A;  4HV6 A;  2F4I A;  3HSE A;  4EJT A;  1U78 A;  3AL0 C;  2D5V A;  1PUE E;  2AXL A;  2EZH A;  2IGN A;  3FXL A;  2HDC A;  2Q2E B;  2L7K A;  3QPL A;  1QHH D;  2ID6 A;  4IJA A;  1YHQ I;  1YIT I;  1TWA J;  5DV5 A;  5HS8 A;  4NC8 A;  1IRG A;  3IUO A;  1FY7 A;  4RS8 A;  3ZMZ A;  1ENH A;  2CQX A;  4BE2 A;  1LFP A;  2FOW A;  3IWF A;  1RES A;  2FE3 A;  4BQN A;  5F1R A;  4HF0 A;  2D2W A;  4KIT B;  2DMT A;  4XK4 A;  3BR0 A;  3JTH A;  2VJI A;  3OYD A;  2HYG D;  5CJ9 A;  4LFU A;  3W2V A;  3OL3 A;  3CC4 I;  3VWB A;  4WF2 A;  4HQM A;  5E8G A;  1FTT A;  3DLA A;  4F93 B;  1RNL A;  4XRM A;  3VYU B;  2P5K A;  3OIP A;  1P4W A;  4HNT A;  2MG4 A;  3PUF A;  3KEO A;  1S3J A;  2NYX A;  2PLY A;  2LVS A;  1WFX A;  3FIS A;  1HLV A;  4MFE A;  3BG6 A;  2XGX A;  3HOV J;  2FQ3 A;  3HG9 A;  3HL2 A;  3S15 J;  1EA3 A;  1U8B A;  2DN0 A;  1IN4 A;  1AU7 A;  1YO5 C;  5FRO A;  1LQ1 A;  3O2P E;  1NTC A;  4II3 A;  4UUT A;  5ED4 A;  3IKV A;  5IP7 J;  2NRA C;  1FTZ A;  1VQP I;  3HC7 A;  4UVB A;  3HIF A;  2FF4 A;  3G3Z A;  3U21 A;  2R7O A;  3H5A A;  5GAE J;  1KU3 A;  2OTL I;  1YRN A;  1Z67 A;  1ONV A;  1TWH J;  1VQL I;  1TQP A;  3UR3 C;  4Y3O A;  2A5W A;  4M3B A;  3LSP A;  2DDB A;  2F4O B;  1NHA A;  4XN0 A;  5GTI C;  3CCM I;  3L2R A;  3WTV C;  1H9T A;  1J59 A;  3ZQQ A;  2K3F A;  2DA4 A;  3SDB A;  2H6B A;  5FLM J;  5E3N A;  3E5X A;  3IH3 A;  5HOO A;  2CFO A;  2UZK A;  5E79 C;  2YU9 J;  4XRS G;  3KYC B;  5IYD J;  3ULQ B;  4A3L J;  4DQ2 A;  3HB9 A;  1ZAO A;  1G59 A;  4D5C A;  4A6D A;  4BGD A;  4DW6 A;  3ZXS A;  3GZ6 A;  1BR1 A;  1X4P A;  2JRT A;  4UXN A;  5D5W B;  1D5V A;  4E70 A;  2IS4 A;  4QLC U;  2XAS A;  1LB2 A;  1TQI A;  4C3J J;  2G7H A;  2WAF A;  3HOY J;  3MKL A;  1VQK I;  2CQN A;  1VQ5 I;  1X1P A;  3G73 A;  4CO8 A;  2EA2 A;  2E5Z A;  1SVL A;  1S7O A;  5ICG A;  4B48 A;  2MH2 A;  2EJR A;  1K7A A;  1X19 A;  2LKS A;  2Y69 H;  2NS7 A;  4V2G A;  1TL8 A;  2VBW A;  1JJ6 C;  3H3V K;  3NAU A;  3K2Z A;  2AO9 A;  3CME I;  3R61 A;  2OTJ I;  1VF9 A;  4FCY A;  1UEL B;  5FB2 A;  2WAE A;  1WJF A;  3BC8 A;  5B3S H;  2BV6 A;  2E5N A;  2VBZ A;  9ANT A;  3V8L A;  3J7Z I;  3OYM A;  1REP C;  1R1V A;  1XB4 A;  2DW4 A;  1F5T A;  4B3X A;  2LC2 A;  2LY9 A;  5JFR A;  2VIX A;  1GUU A;  3I53 A;  5FKO A;  1N25 A;  1FMV A;  1MBF A;  5B66 C;  3CP8 A;  1T0F C;  4XMY A;  3L2W A;  2XGD A;  5KNL A;  5A2Q K;  1JI8 A;  4A12 A;  2MLK A;  2DAO A;  4NQW A;  4L18 B;  2V6C A;  4LB5 A;  5HOD A;  3WGG A;  4AIH A;  3HUG A;  1EH8 A;  2XB5 A;  1XGM A;  3S2D J;  4XLF A;  3E5U A;  4XSZ F;  2JPC A;  2YUS A;  1YRN B;  4EAT A;  2FBI A;  1S72 I;  1HDD C;  2W57 A;  3JRH A;  3FXO A;  4YEL A;  4RB2 C;  2NOG A;  1T08 B;  3W6V A;  1ON1 A;  1T98 A;  1IN5 A;  1F43 A;  5J4V A;  3I5U A;  1WJD A;  4XRS A;  3U1K A;  2DPD A;  2FD5 A;  1OJL A;  3BG9 A;  4KIC A;  4BNC A;  2V26 A;  1MIJ A;  3DF8 A;  1D8K A;  2R5Z A;  3E7L A;  1X3Z B;  3J81 Z;  3JRA A;  4OAZ A;  5KAF C;  1I6H J;  2L3D A;  5BS6 A;  2QYO A;  2KT0 A;  2H1L A;  2OUM A;  2ELK A;  5D6E A;  5E3L A;  2DMU A;  4JX6 A;  1XMK A;  2Z5U A;  2EZL A;  1W5S A;  2W84 A;  2KIF A;  3EET A;  2V1N A;  3LSK A;  5E1W A;  5LRS A;  5H6R A;  1PUF A;  2IRF G;  1E3H A;  5EDN A;  1MMN A;  2HVR A;  1P4X A;  1R22 A;  2GA2 A;  2E60 A;  5IY5 H;  3N05 A;  1GLN A;  1WHU A;  2IP2 A;  3CCQ I;  3K10 A;  2V4J C;  2XV4 S;  2KKO A;  1HST A;  3IP4 B;  1SFX A;  3GYH X;  3BZC A;  2K7L A;  3FBN B;  2BYV E;  3RYR A;  1C0W A;  1W0T A;  2ID3 A;  3V7S A;  1YJ9 I;  3D5R C;  3GVA A;  2VT3 A;  5EEG A;  5E1Z B;  4P9U A;  4RDU A;  5HLG A;  3K69 A;  2BY2 A;  1U0J A;  3SFI A;  2E7W A;  1ZRF A;  4HBL A;  2LYC A;  1IRX A;  2VC0 A;  3A4C A;  4BQQ A;  2E7X A;  4LGW A;  2IA1 A;  3ASN H;  3CMM A;  1LKX A;  2CUF A;  4XL9 A;  2CV2 A;  2IS6 A;  1I1S A;  3PUB A;  3S2H J;  2R3S A;  2EFN A;  5DD8 A;  4BQO A;  2R5Y A;  1T0F A;  3G2B A;  5CYV A;  3SZT A;  1WJE A;  4C2M J;  4CXF A;  1QNT A;  1SMY F;  3QYB A;  2O5R A;  3C3W A;  2STT A;  4GDF A;  2FX0 A;  5EZH A;  1HBX G;  3DEE A;  1IDZ A;  1MGT A;  2LH9 A;  3ABL H;  3PQJ A;  1WRJ A;  4JP0 A;  2LY2 A;  4PJM A;  1BM9 A;  2VXD A;  1EJ9 A;  1VI0 A;  2PMH A;  3TOA A;  2W24 A;  1ON2 A;  4BXU A;  3ELK A;  3JR9 A;  4N0B A;  5ICE A;  3W2W A;  3HPG A;  4EM2 A;  4NQW B;  2VUM J;  3OYB A;  1P92 A;  2Z33 A;  3HUG B;  1N77 A;  4LK0 F;  2NS8 A;  4N4N B;  3ZQI A;  5E3O A;  2HPI A;  4IRH A;  5K7Z A;  3G4S I;  1JUM A;  1Z7U A;  2CMP A;  1K78 A;  2QM3 A;  2A07 F;  2EBI A;  3JAM Z;  3KYD B;  4BXF A;  1DDN A;  1IXS B;  2PX9 A;  5DS9 A;  1TWF J;  2L02 A;  3ZCO A;  4JOM A;  4R1H A;  5IYB J;  2DT7 B;  3V7C A;  2XDV A;  1ZG5 A;  2E2I J;  1RKT A;  2IPQ X;  2HI3 A;  3TDU C;  4F91 B;  2K9N A;  2LRD A;  1OYY A;  1A6Q A;  1WVR A;  4Y33 A;  2XSD C;  5M5X J;  2DYS H;  4RGU A;  2B0L A;  4II2 A;  2R5Z B;  4XNF A;  4RA2 A;  3ML6 A;  2KQR A;  1JUP A;  2IA2 A;  3BQY A;  3DTE A;  3K4B A;  3F8B A;  1IW7 F;  2XAH A;  2VB6 A;  5TIS C;  5TRD A;  1J75 A;  2K9S A;  1ITY A;  3ZMU A;  3G1M A;  1IRZ A;  1PUF B;  2CSO A;  3DU6 A;  3MFK A;  1R9T J;  2RNJ A;  3MD2 A;  4ZDL A;  3SXY A;  4Q4Z F;  1QZZ A;  2BY1 A;  2A68 F;  2PQ8 A;  1FNN A;  2OZ6 A;  2GOX B;  5FRM A;  2V1D A;  1DU0 A;  1MMA A;  4BHP A;  2CV0 A;  3SHF A;  1ETV A;  3LA2 A;  5ILU A;  3ZQ7 A;  2EIL H;  4PSX A;  5HLI A;  4L5I A;  2GXA A;  4XR6 A;  3HHH A;  3H35 A;  3C2H A;  3S1R J;  2E1C A;  3ZQL A;  4LG0 B;  1FP1 D;  2IGM A;  1TQM A;  1ODD A;  3CCY A;  3ESW B;  1FSH A;  4XLH A;  1SC7 A;  1A35 A;  4V19 K;  5L3D A;  2EB7 A;  1VQ7 I;  3ZQC A;  1OPC A;  4YEJ A;  2EIN H;  2LF7 A;  2VQC A;  2UV1 A;  2R5Y B;  2X48 A;  1V55 H;  4KJZ A;  2TRT A;  3F21 A;  4M6V A;  4Z6Y A;  2WB1 A;  3A1Y A;  4XON A;  3DTI A;  1B59 A;  1HDP A;  3WGI A;  1MNM C;  4N9H A;  3CDL A;  1R7J A;  3IL2 A;  4E7H A;  3GTP J;  4EM0 B;  3F6V A;  1XMA A;  1LE8 A;  1FPQ A;  5F0H A;  1FOK A;  1D0Y A;  3QQA A;  3J80 K;  2DDA A;  2OCC H;  1IGN A;  1YYV A;  3M1C A;  3BG3 A;  3RKQ A;  1ZGW A;  1DP7 P;  4P9F A;  3KLN A;  1I50 J;  1P6R A;  4HRI A;  4PGG A;  2LOO A;  1QA6 A;  2QKM B;  2O7O A;  2JUC A;  4IHY A;  1TC3 C;  1AHD P;  2STW A;  3L2Q A;  5CPR B;  4B1R A;  1K78 B;  5FRN A;  2EV6 A;  2QEX I;  1U8R A;  4I02 A;  2ESN A;  2LRE A;  1MBK A;  3GTK J;  2M2E A;  3FXK A;  4MEY F;  1V5G A;  3ABK H;  4AU7 A;  1Y0N A;  4M73 A;  3HM5 A;  2VN2 A;  3D1N I;  1R00 A;  1JTX A;  4AIK A;  1UB9 A;  1BI1 A;  3MZY A;  2W25 A;  5F6F A;  3KZZ A;  3OYI A;  3MAJ A;  1LEB A;  1BW5 A;  1YIO A;  4G9Y A;  4YRV A;  3OYF A;  2KIQ A;  3EUK L;  1T2K A;  1ETX A;  1GVJ A;  5CQE A;  2LKX A;  2BVM A;  3F8M A;  2O6G E;  1IZ1 A;  4IRI A;  3G1O A;  2HZD A;  1IDY A;  3HGY A;  2R7Q A;  5HLT A;  2LDU A;  2R7V A;  2DMQ A;  4JK1 X;  2GIV A;  5KAI C;  1JKQ C;  4GYI A;  2I8D A;  2X6W A;  3GXO A;  3I4P A;  3HTS B;  3IKT A;  4XKC A;  5CKT A;  5IOZ A;  1KON A;  1ZLK A;  2F5D A;  3B73 A;  3FM3 A;  4I7H A;  2BEO A;  3HXL A;  1SFU A;  3L2V A;  4BDZ A;  3PFY A;  2OQR A;  4K2E A;  2KHM A;  3H0D A;  1Z7L A;  3SZP A;  4WCG A;  4LB6 B;  4DYR A;  2HGC A;  4AWX B;  5DUI A;  3MZ8 A;  3ZMD A;  1TW2 A;  2F2E A;  1SFE A;  2LP0 A;  1W4M A;  1HKQ A;  2L7M P;  3BR1 A;  4NHJ A;  3ABT A;  4ETS A;  4HX7 A;  1G3Y A;  1QRY A;  1QVT A;  5LD2 C;  1W0U A;  3REO A;  1OYW A;  4NUB A;  5BQT A;  1R5H A;  3NQO A;  4BJT A;  3PNV A;  4A3E J;  1YX3 A;  2BVL A;  2V7F A;  1V5E A;  1IN6 A;  2MA3 A;  2Z16 A;  3E6D A;  4DOZ A;  2RQP A;  2YX7 A;  3S17 J;  3CC2 I;  5IT9 Z;  4L9V A;  1RZ4 A;  2DMN A;  2QZ8 A;  2N8G A;  2W82 A;  4A5N A;  4BKX A;  5BMZ A;  1P4A A;  4ANJ A;  1ETO A;  2BBY A;  2Y9Y A;  3HOT A;  1LE8 B;  2A6T A;  4UV8 A;  3J7Y J;  3SQN A;  4PFP A;  3E1S A;  1MBH A;  2EIJ H;  3K1M A;  2HXO A;  1K6Y A;  5EZG A;  1YS7 A;  4X1E A;  3S2W A;  2DXI A;  2FA5 A;  3KZI C;  1BIB A;  3E6M A;  3OR1 C;  2P7V B;  2ZJQ F;  4ZTF A;  1CF7 A;  2HZT A;  3A2K A;  2ZXH A;  2M9H A;  3EDP A;  2ME6 A;  2RKH A;  4LK1 F;  3LSI A;  5M5W J;  2R7D A;  3QPH A;  1W36 D;  3ZMS A;  2AQE A;  1XSV A;  5KVR A;  4F52 A;  4D0P A;  1S9H A;  2QF7 A;  3F72 A;  5BNG A;  1JKR C;  4RB3 C;  2X6O A;  5HDK A;  3S16 J;  2JMW A;  2CUZ A;  2WB1 N;  4ZYD A;  4FE7 A;  2V1X A;  1ZLJ A;  5FGM A;  4ESJ A;  2GM4 A;  2QGU A;  3A02 A;  3RQ4 A;  4QIW N;  5LEK A;  5JHU A;  3DKX A;  3DKW A;  4IOC F;  3C2G A;  1ZAR A;  1U9O A;  4M72 A;  4PCQ A;  4M3D A;  1W36 C;  2VKH A;  3T1B A;  2KMU A;  4I0A A;  2K40 A;  3ZMV A;  1BC7 C;  2K27 A;  2M8E A;  4EGZ A;  1YFH A;  1EKE A;  3C18 A;  4KT6 A;  3OY9 A;  3CJN A;  3RQI A;  3DEW A;  2NVT J;  2IAI A;  3LSH A;  4FIS A;  4MQV A;  4IHX A;  1FT9 A;  1Y1W J;  2JSP A;  2HDW A;  3P7N A;  3BZ6 A;  2MC4 A;  2JA2 A;  4YFN F;  1AWC A;  1DGW Y;  2K02 A;  2OV7 A;  4ON0 A;  1N78 A;  5F64 A;  4M71 A;  1LFB A;  1TT5 B;  2K3P A;  4ZDP A;  2HKX A;  1SFO J;  3KP6 A;  1V4R A;  2M0M A;  2L0K A;  1BI0 A;  1R49 A;  4BHC A;  2V9K A;  3BCA A;  3HKZ A;  4M9Z A;  4KIB A;  3OWT A;  3A0B C;  2XAJ A;  2MD0 A;  3KP3 A;  5CVU A;  4E7I A;  3L09 A;  2EV5 A;  1FIA A;  2VBY A;  1IUY A;  5TJJ A;  1Z21 A;  2JTV A;  2KPM A;  2QCO A;  4XLA A;  4EJO A;  2VJ4 A;  3I54 A;  4NBQ A;  4OIO F;  4ESF A;  4CZC A;  4CIC A;  2CS3 A;  1YOV B;  2Y0S N;  2O61 A;  2RVC A;  3BR3 A;  3LA7 A;  2PG4 A;  1QU3 A;  3JSO A;  1ZGJ A;  1DUX C;  2M5W A;  2A6H F;  1Y8Q B;  3BJO A;  3IH4 A;  5C4J J;  1MND A;  5FFX A;  1RKW A;  3LFU A;  4PK4 A;  4D7M A;  5F1J A;  1JT0 A;  4EM1 A;  1VZ0 A;  4FX4 A;  1HCR A;  2JUG A;  5D5U B;  3CD6 I;  3WGH A;  3AG2 H;  3FMR A;  4Y4R A;  1VND A;  3QU6 A;  1Y8R B;  4KT5 C;  4RAG A;  2EIM H;  2TCT A;  3H92 A;  1CF7 B;  1T38 A;  3P9K A;  4F7Z A;  2F4M B;  4W1U A;  2KDO A;  4EJW A;  2L5Q A;  1PVE A;  1OLT A;  2YU3 A;  2E1N A;  2HOT A;  4OAY A;  1EF4 A;  4HOB A;  3VYR B;  3ERM A;  3CJT B;  4M9X A;  3ONQ A;  2YX4 A;  2FOK A;  1WJ5 A;  5J3L A;  4C9Y A;  2CO5 A;  1PYV A;  2QQ8 A;  2EFQ A;  3JRG A;  3OIQ A;  3RI4 A;  3WU2 C;  4C30 A;  3V8K A;  3VFZ A;  1O3Q A;  4IPA A;  3ZQH A;  3V8J A;  2Z1D A;  3GTL J;  1Z05 A;  3OOU A;  1TT0 A;  4U87 A;  2HS5 A;  3FHN A;  2RV8 A;  3VOE A;  1Z1D A;  4EQQ A;  3B6A A;  4ZYG A;  5K7F A;  3HOX J;  2HNH A;  2XAU A;  1JKP C;  1R23 A;  2G0E A;  2ZJR F;  2QUF A;  1Z3X A;  1B6A A;  2WA0 A;  2O3F A;  3Q5F A;  2DI3 A;  5E3M A;  3RKW A;  1ZG1 A;  2V9V A;  2QQ9 A;  3OSG A;  3BTI A;  4RB0 A;  4IHV A;  2VOO A;  3BJA A;  1XS9 A;  2LG4 A;  1JHH A;  2COM A;  2YSR A;  3FWE A;  5J8C A;  2FMY A;  4DNC A;  4F3Q A;  1LVK A;  1K79 A;  3C1D A;  1XN7 A;  3CTA A;  3PIO F;  2ZFW A;  2PI0 A;  4CCO A;  2JA8 J;  3NWT A;  2KJB A;  1W5T A;  4CCJ A;  2L54 A;  1ZGA A;  2CG4 A;  2DA1 A;  3H3Z A;  1LJ9 A;  1J9I A;  2VPL A;  2DOD A;  3TP0 A;  1XPX A;  2PMU A;  1MJ9 A;  4Y13 A;  3DXJ F;  1T8I A;  2DJI A;  1MZB A;  5FLX Z;  2XGE A;  2HR3 A;  5J4Y A;  2JZY A;  1LEA A;  4XLC A;  4LMY A;  1YIJ I;  3EYY A;  4ZDO A;  1HXD A;  3DQV C;  3OYJ A;  1A04 A;  3T5X A;  3M1E A;  1YJN I;  3S1N J;  2DBB A;  3NAR A;  1MMD A;  4B09 A;  2X6X A;  1PDN C;  4L9N A;  3M4O J;  1S8N A;  3WHB A;  3K6G A;  2EFW A;  2ZXI A;  4S05 A;  3CCU I;  2CUE A;  3M8J A;  3TKY A;  2XF6 A;  3K70 C;  3RZO J;  3ZP5 A;  2IGO A;  3BRO A;  2Y48 A;  2PN6 A;  4BHB A;  1HKS A;  4RAF A;  3OS1 A;  2PMZ A;  2XAQ A;  2GWR A;  3SDG A;  3KET A;  2PJR A;  4BBS J;  1EH6 A;  2VON A;  2IGK A;  2VE9 A;  5IPA A;  1TBX A;  1IJW C;  2CGP A;  1UJ8 A;  1ZRD A;  5C3E J;  3H9Q A;  1O7F A;  3HKZ N;  3RPU D;  3S8P A;  4HW0 A;  3L9F A;  4U88 A;  4IZZ A;  4RAY A;  1Y1V J;  1O7L A;  3DPU A;  1WI3 A;  4S04 A;  1LDK B;  3MKW B;  1OCR H;  4OWR B;  2BY3 A;  1J5Y A;  1XDS A;  4HX8 A;  5DDG A;  5K5Q A;  1X2N A;  3V7R A;  3E0J B;  4UVA A;  4IL6 C;  3BOQ A;  2NS0 A;  3KFW X;  4QPQ A;  4A3I J;  2JRM A;  3HRU A;  2CWE A;  4PJN A;  1HOM A;  2FSW A;  4HV5 A;  2QWW A;  3FMQ A;  3MQ0 A;  3RTR A;  3VYT B;  3HOW J;  1H89 C;  1USS A;  2JSC A;  3D0S A;  1YW9 A;  3VOD A;  4DZJ A;  2L9S A;  4HF1 A;  3FXU A;  4Q5S F;  2WBM A;  1UZC A;  3PM1 A;  1IF1 A;  4LD5 A;  2L4A A;  3HEF A;  3KEY A;  4JBA A;  1ZR2 A;  1MBE A;  2O03 A;  1OCC H;  3K9T A;  3D5L A;  2A69 F;  4I2O A;  3FXM A;  4RLQ A;  3KLO A;  3IRR A;  3I71 A;  4O5V A;  1E0E A;  4V2F A;  3OYN A; 
#chains in the Genus database with same CATH homology
 3GBG A;  1JUP A;  4FTH A;  2E1O A;  3BQY A;  1D5Y A;  3BG5 A;  2Y2Z A;  2NVX J;  2K9S A;  1ITY A;  2KDZ A;  4AC0 A;  3G1M A;  1IRZ A;  1PUF B;  2M8G X;  2K9Q A;  1R9T J;  1P7I A;  4C3I J;  3IV5 A;  1A5J A;  1ZKG A;  4RBO A;  1X2M A;  2DMP A;  1BW6 A;  5C44 J;  1WCM J;  5M3M J;  3M3Y J;  4AUX A;  1DU0 A;  3PO2 J;  2JWT A;  3GTG J;  1ETV A;  5IOY A;  3OSF A;  4CYC B;  5GPC A;  2M34 A;  1BA5 A;  5IYC J;  1GT0 C;  3GTJ J;  3LNQ A;  2IEK A;  4S0H B;  3S1R J;  1ZTR A;  5F04 A;  1SAN A;  3ZQL A;  2HXI A;  3JRI A;  1WPK A;  1WH7 A;  4IHW A;  3CCY A;  2VPR A;  5F0F A;  2HOS A;  4J19 A;  5EG0 B;  5EYR A;  3ZOB A;  2WAQ N;  2MGQ A;  2Y31 A;  4XID A;  3ZQC A;  3S14 J;  1MBG A;  3HOZ J;  2E19 A;  2R5Y B;  2L7Z A;  2X48 A;  2LR8 A;  2TRT A;  1QVU A;  4M6V A;  1GVD A;  1ZR4 A;  1HDP A;  1MNM C;  4A3G J;  3CDL A;  3FKI J;  3GTP J;  2JA7 J;  2VKV A;  4A3K J;  4I6Z A;  2VI6 A;  1LE8 A;  2IBD A;  4Y52 J;  1RET A;  5F0H A;  1GV2 A;  3QQA A;  3JRB A;  2LFB A;  2P81 A;  1IGN A;  2OPT A;  3RKQ A;  3BG3 A;  1TWC J;  3K2A A;  1ZGW A;  5IP9 J;  4MO7 A;  2FJ1 A;  4M3E A;  1I50 J;  1VFC A;  1APL C;  4A3B J;  1AKH B;  2R7Z J;  2O7O A;  4IHY A;  1TC3 C;  1AHD P;  4NDL A;  3BQZ A;  2ZB9 A;  3LOC A;  4B1R A;  3GTM J;  2EZK A;  3C2B A;  1MBK A;  2FQ4 A;  5GP9 A;  3MN2 A;  3GTK J;  2M2E A;  3Q0W A;  2O9L A;  3S1M J;  3TP3 A;  1U9N A;  3BTJ A;  4QSH A;  1XC5 A;  2XPV A;  3I4N J;  1JJ8 C;  3HM5 A;  4DZP A;  3D1N I;  1BJZ A;  3LSJ A;  2PMZ N;  3BT9 A;  1JTX A;  2XPW A;  1OCT C;  2Y9Z A;  3B6C A;  2HOA A;  4GFB A;  2H1K A;  1F36 A;  5M5Y J;  1BW5 A;  4UUS A;  3Q3S A;  3K7A J;  4A3F J;  2ECB A;  1ETX A;  2LKX A;  3JRC A;  5FKM A;  4BY7 J;  4MLO A;  2O8K A;  4BY1 J;  4MIM A;  4A3C J;  3G1O A;  4DYC A;  1B72 A;  1IDY A;  3HGY A;  1IUF A;  4HNV A;  5F27 A;  1ETQ A;  4FE4 A;  1FEX A;  3LSR A;  2DMQ A;  3FK6 A;  2ME0 A;  5J1Y A;  1K61 A;  1JKQ C;  5FLV A;  2JA5 J;  1WH5 A;  5K7H A;  2JJ7 A;  5IOZ A;  1QPI A;  2EQR A;  2I10 A;  3CMY A;  3VPR A;  3I4M J;  1U78 A;  4EEF G;  1MBJ A;  2XGC A;  2D5V A;  2X9D A;  2COB A;  1JUS A;  2EZH A;  1T33 A;  4DYR A;  4A93 J;  4M3F A;  5FKN A;  3QPL A;  5F0C A;  2ID6 A;  1TWA J;  1Z0X A;  2LK2 A;  2LP0 A;  2L7M P;  3BR1 A;  3BTL A;  1QRY A;  1QVT A;  1ENH A;  2CQX A;  2GBY A;  3FIW A;  1W0U A;  1DU6 A;  4C3H J;  1RES A;  2RAE A;  2DMT A;  4XK4 A;  3BR0 A;  1BL0 A;  1T56 A;  1MSF C;  4A3E J;  4LOC A;  3F0C A;  3WHC A;  4M3G A;  1FTT A;  4XRM A;  2ECC A;  3S17 J;  1K83 J;  2GLO A;  2DMN A;  2N8G A;  5F08 A;  2MG4 A;  4BKX A;  1RR7 A;  2LVS A;  1ETO A;  3FIS A;  2Y9Y A;  1HLV A;  4MFE A;  1LE8 B;  2HDD A;  1GV5 A;  3HOV J;  2DJN A;  5FKK A;  5FKL A;  3JRF A;  1MBH A;  5EZG A;  5J1R A;  2HXO A;  1FIP A;  2DN0 A;  4X1E A;  1U8B A;  3S15 J;  1JT6 A;  1AU7 A;  1MH4 A;  1NTC A;  4UUT A;  1FTZ A;  5IP7 J;  1P7J A;  2CU7 A;  2M9H A;  4JYK A;  2ME6 A;  1H88 C;  1GDT A;  5M5W J;  1CQT A;  4L5E A;  1YRN A;  1ZK8 A;  1TWH J;  1H8A C;  2QF7 A;  2DA6 A;  5BNG A;  3HOU J;  3JRD A;  1JKR C;  1ORK A;  4M3B A;  2X6O A;  3LSP A;  4ABZ A;  3S16 J;  2JMW A;  1FJL A;  2WB1 N;  4FE7 A;  1UG2 A;  3O8G A;  1ZQ3 P;  2GM4 A;  3A02 A;  4QIW N;  3JRE A;  1X58 A;  1U9O A;  4M3D A;  2CJJ A;  2DA4 A;  5FLM J;  2XPU A;  5E3N A;  4UUS B;  2K40 A;  3TED A;  1IG7 A;  1HF0 A;  3IH3 A;  3RQI A;  2YU9 J;  3DEW A;  2CRG A;  4XRS G;  2NVT J;  5IYD J;  4A3L J;  2IAI A;  4FIS A;  3HB9 A;  3LSG A;  1B72 B;  4D5C A;  4IHX A;  4DW6 A;  3HGG A;  1Y1W J;  1POG A;  1S7E A;  4A3D J;  5EEA A;  2DA2 A;  2EZI A;  5JLX A;  2JK3 A;  3DCF A;  4C3J J;  2NVQ J;  3HOY J;  2XRL A;  3MKL A;  2HQ5 A;  3GTO J;  1Q1V A;  1XG1 A;  4I76 A;  1LFB A;  1JTY A;  1SFO J;  4A3J J;  4D5F A;  2CQQ A;  2B63 J;  3ZQG A;  2L0K A;  5GPA A;  1MH3 A;  5EGO A;  2NS7 A;  5EF6 A;  2E2H J;  1B8I A;  4V2G A;  1JJ6 C;  3O8H A;  3H3V K;  3NAU A;  2AO9 A;  5IP6 A;  2EH3 A;  2LLK A;  1VF9 A;  4W97 A;  4FCY A;  1FIA A;  3TW7 A;  3FK7 A;  2QCO A;  1UMQ A;  2JA6 J;  4B3A A;  2Y0S N;  4B4C A;  3BR3 A;  9ANT A;  2AHQ A;  3Q0U A;  1A6I A;  3RZD J;  2MW8 A;  5M3F J;  4D7N A;  3IH4 A;  5C4J J;  2LY9 A;  3TW6 A;  1RKW A;  4D7M A;  1GUU A;  2MSY A;  5F1J A;  5FKO A;  1JT0 A;  1MBF A;  1RPW A;  1IC8 A;  1HCR A;  3BR2 A;  1ETK A;  1VND A;  3SJM A;  2H8R A;  2XGD A;  3A01 A;  1UHS A;  2TCT A;  5HOD A;  2DA5 A;  2XB5 A;  4G12 A;  3S2D J;  1JKO C;  1Z77 A;  4W1U A;  2YUS A;  3G1L A;  4Y7N J;  1YRN B;  4XIC A;  2DA7 A;  1WGX A;  2E2J J;  1HDD C;  2HOT A;  3JRH A;  1EF4 A;  2NOG A;  3BR5 A;  3W6V A;  5J3L A;  5JLW A;  1F43 A;  3JRG A;  4XRS A;  3GTQ J;  2FD5 A;  1OJL A;  3BG9 A;  1ETY A;  2M0C A;  3OIO A;  3ZQH A;  3A03 A;  1MSE C;  3GTL J;  2R93 J;  3OOU A;  2R5Z A;  3E7L A;  3JRA A;  3HBL A;  1I6H J;  3B6A A;  4IEJ A;  3UKG A;  5K7F A;  3HOX J;  3ZQF A;  2WV1 A;  1JKP C;  2KT0 A;  2G0E A;  1OCP A;  2ELK A;  5E3L A;  2DMU A;  4JX6 A;  5E3M A;  2EZL A;  1PUF A;  4DYQ A;  3OSG A;  3BTI A;  4A3M J;  4IHV A;  1XS9 A;  5EDN A;  1O4X A;  5J1U A;  2JA8 J;  4MFD A;  4CYC A;  2DA1 A;  2L7F P;  4QTR A;  3TP0 A;  1I3Q J;  1W0T A;  2ID3 A;  1IV6 A;  4BXX J;  5EGO B;  1B8I B;  2XGE A;  2R0Q C;  5FJ8 J;  4RDU A;  3SFI A;  2Y30 A;  3MVP A;  3S1N J;  5EG0 A;  3BR6 A;  3NAR A;  5C4X J;  1LFU P;  2CUF A;  3M4O J;  3S2H J;  3WHB A;  2R5Y A;  2XB0 X;  4JX5 A;  2CUE A;  1NK3 P;  2R92 J;  1OFC X;  3RZO J;  2OF7 A;  4C2M J;  4JX4 A;  2FX0 A;  3L1P A;  5EZH A;  2LTP A;  2W48 A;  1IDZ A;  1JGG A;  4JP0 A;  2HYJ A;  3SDG A;  4BBS J;  1VI0 A;  3H0G J;  4X6A J;  3BTC A;  1TWG J;  5IPA A;  3JR9 A;  1IJW C;  5DTD A;  5C3E J;  3A01 B;  3HDD A;  3HKZ N;  2VUM J;  2NVY J;  4AYB N;  1Y1V J;  1WI3 A;  2JN6 A;  2NS8 A;  1AKH A;  3ZQI A;  5E3O A;  2DA3 A;  1X2N A;  5K7Z A;  1JUM A;  1E3O C;  4A3I J;  3S1Q J;  2EBI A;  2VKE A;  1HOM A;  5DS9 A;  1TWF J;  3HOW J;  2L9R A;  1H89 C;  5IYB J;  4DZJ A;  4A69 C;  3PM1 A;  2E2I J;  1RKT A;  2HI3 A;  3HEF A;  4BBR J;  3IH2 A;  3PO3 J;  1ZR2 A;  1MBE A;  2DTZ A;  2YS9 A;  2K9N A;  3CQZ J;  2LD5 A;  2XSD C;  1ETW A;  5M5X J;  1G2H A;  4V2F A;  2R5Z B;  3QPS A;  1NK2 P;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...