2JSPA

The prokaryotic cys2his2 zinc finger adopts a novel fold as revealed by the nmr structure of a. tumefaciens ros dna binding domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLGQRRKANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Transcriptional regulatory protein ros
publication title The prokaryotic Cys2His2 zinc-finger adopts a novel fold as revealed by the NMR structure of Agrobacterium tumefaciens Ros DNA-binding domain.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1550 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jspA01
2JSPA
chains in the Genus database with same CATH superfamily
2V1NA 2DQLA 2HTSA 5EZHA 2J5OA 4I98B 2N8GA 1C0WA 1XMXA 3RI4A 2E1MB 3VDXA 1ON2A 3I56I 2VC1A 3W2AA 3S3MA 1Y1VJ 1ZHFA 3RKWA 2EFWA 1FP1D 5IYDJ 1XC5A 3S1QJ 5HLHA 1SD5A 4IX7A 3WGHA 3EQLF 4UY8I 1JGSA 1UFMA 3HXLA 2ZNYA 4WXHA 2YU9J 3H3VK 3Q3SA 3GTOJ 4QSHA 1POGA 1YS6A 2R92J 2WV1A 2VKDA 4E7IA 5BQTA 3M8FA 1FSEA 4HZFA 5EYRA 2K9NA 2Y31A 1ETXA 1LDJA 3FMSA 2ID3A 1GT0C 3PM1A 2NVUB 1JT6A 4OMYA 4NUBA 2CQKA 1QHHD 2DU9A 3R0AA 1OQYA 2AXTC 3D0SA 1R7JA 2DN0A 5LBQA 1WGXA 2KZVA 3A01A 2CYYA 3BDDA 4CO8A 1JHFA 1DPRA 1ZRFA 1WZ2A 1O3QA 4MNUA 4II2A 1MNEA 5F27A 2MABA 2DAOA 3BCBA 3GW2A 2Q8KA 1D1CA 4Q48A 5A2QK 1Y1WJ 1MW7A 1BC8C 5GADJ 2KJBA 4IOAF 4XLEA 1SAXA 1IN5A 2IT0A 1Z6RA 1QHGA 1LQ1A 2OCEA 3HJEA 1YS7A 3ZGKA 2F2EA 1SD6A 5F0FA 2LKXA 3K2AA 3ABKH 1MMGA 1RKWA 5B1BH 4FASD 1P7JA 2A6TA 4D9JA 5JVGF 2LKSA 4FHTA 1ZN2A 4EATA 2VB6A 3MEXA 2LF8A 2PMHA 3DTEA 4A5NA 5LHIA 1Y8QB 4JQFA 3C3WA 4CSWA 4Y15A 4AWXB 3I58A 4UV9A 2OUMA 4E7ZA 3DBRB 2DLLA 1IV6A 2F4IA 2MSYA 2ZXHA 5IYCJ 2H94A 2DODA 3LQQA 4HLYA 4BGDA 3KZYA 3F8FA 2HOEA 5DD4A 1YE9A 1L0OC 2TRTA 2EWNA 1DPUA 1HXDA 2GXAA 1ZQ3P 5IP6A 4PCQA 3QPTA 3NAUA 3I0TA 2FNAA 1Z6TA 2QBYB 2AXLA 1VF9A 1YJWI 2DMPA 2JTVA 3BWGA 4BHPA 1BI1A 2DFFA 2CFOA 1OCOH 1JT0A 1MJ9A 1LDKB 3F0CA 4BS9A 1XMAA 1F1ZA 5K5QA 3JSOA 3GTQJ 2QEXI 3DP7A 1RESA 5K7ZA 2E7WA 2XIGA 3EUHC 3Q0VA 4V2GA 4I2OA 1SMYF 4FTHA 2PQ8A 4IKFA 5BNGA 3PFYA 3JTGA 2IP2A 2LYCA 4HV6A 4OWRB 3K7AJ 3V8LA 1NH3A 2PJRA 1RC9A 4G12A 4I7HA 1J75A 1WWXA 2IGMA 2VKVA 2KRFA 4HV5A 3E7LA 4BEHA 2CW8A 3S2HJ 3BR6A 3FXRA 3OYKA 4UXNA 3J80K 1TTYA 1T98A 1FTZA 1ULYA 3L7WA 1U3EM 2WADA 3SXYA 1WPKA 5K7HA 5EEHA 1BJZA 2L7KA 3CDHA 4L5EA 2Y30A 1KONA 5F1JA 3S2DJ 1XGSA 1Z67A 2X9DA 5IT9Z 3CCUI 2DQRA 2CFXA 3HGYA 2RNJA 3CCRI 2G7HA 3A02A 2G9WA 3A0HC 2HR3A 2QKLB 4ASNA 5JR3A 2OAZA 1OCPA 1IXRC 4HX8A 2JA8J 3GF2A 1X2NA 1I3AA 3U21A 3RZOJ 4BQQA 1O3SA 3GX4X 1A04A 4AIJA 1FEXA 2FMYA 1TT0A 2A05A 3KLNA 2Y0SA 4K2EA 1ZAOA 1PVEA 3BZ6A 3FDYA 4E7SA 3C7JA 3CLOA 5DCMA 1VNDA 2QWWA 2M7BA 2DA2A 3SFIA 5L3GA 4IO9F 3FIWA 1R5HA 3OL4A 1U5TB 3I64A 3ECHA 2M4KA 1FC3A 2IEKA 2XDVA 2Q2EB 4M6YA 1I50J 2X6YA 1Y6IA 2DMUA 3HSEA 3ESWB 4IRGA 4EEFG 3KE2A 3G1OA 3GWZA 2K4JA 2ZFUA 2MGQA 3LWFA 4BDYA 4EV0A 5FKOA 2BY1A 1MBJA 4M3DA 4B43A 1TQPA 5J4YA 3HTSB 1QPIA 4C2TA 1QQIA 1FPQA 1VTNC 3N4MA 2E1NA 1NHAA 4RLQA 4XLHA 4XRSA 1G3SA 2OZ6A 4KDPA 4RBOA 2DT7B 4A3CJ 2WB1A 2CSOA 4Y7NJ 2EIKH 3H92A 2VPRA 3PUBA 5LRRA 4BHBA 2VASA 2M87A 5H6QA 1RETA 2ZJPF 1O3RA 1PUEE 3DBLB 1A31A 5LRSA 2ELKA 3BJAA 4N9HA 1JKRC 2BXYA 3K1NA 4JP0A 1JTXA 4B8XA 4I01A 3A1YA 4GYGA 1YQAA 3L09A 4DYQA 2KIUA 5EDNA 1H89C 2RQPA 4RAZA 3RSNA 3O3KA 4B44A 3L9FA 2VPLA 1GLNA 2XB0X 4KMFA 3WTYC 1AOYA 1WI9A 1K6YA 3MD2A 2F4OB 4OIRF 5EJCA 5LGTA 3CCEI 1PJRA 3DKXA 4H0EA 2DA7A 2OPTA 3CO6C 3BR3A 3V7SA 4BACA 1BI0A 1QVUA 1VQMI 4XMYA 3WTSC 3WHBA 4Z6YA 1SFXA 1B72A 2EZLA 1QZZA 5M5XJ 2L9SA 1SFEA 4UNOA 2P5KA 3WE2A 3VFZA 5DM6F 3RIRA 1ZELA 5B1AH 2HGCA 5FLVA 2K7LA 3HSRA 4Q47A 2FOKA 3K69A 4YEJA 3ABLH 5CVJA 1HSJA 4BUPA 3QRFF 4ENKA 2DO7A 3SJMA 4OU0A 3M7GA 3PSIA 1K7AA 2R7VA 1IZ1A 4XORA 4PUSA 5IP7J 3B6AA 2RC4A 4R1HA 5CQEA 2GA2A 3OYHA 1QU3A 2R7QA 3OYGA 3VWBA 4G6TB 5D8KB 4UVBA 2Z33A 4JX4A 4E7KA 4UB6C 4BQOA 2MLKA 4ZDLA 1BJAA 1XGOA 4I0BA 1XTAA 4Y52J 1OR7C 2CGPA 1TWGJ 3DTKA 2HVRA 2IGKA 5HNFA 1ONVA 1HQCA 3DBHB 3P9CA 1D0ZA 4ZDPA 2P7CB 2QQ8A 1OMIA 4LMYA 4EJTA 4I99C 2EFNA 4G8XA 3WODF 1JJ8C 1MDMB 1OPCA 4XM3A 4F91B 2V6EA 2DI3A 4FQGA 3DFGA 2ACJA 2GBYA 1X1PA 2QQAA 4UVCA 2GLOA 2RV8A 1BI2A 3AL0C 3WTXC 1XSDA 2GWRA 5IP9J 3C1DA 2MC4A 4MTDA 1A35A 5BOXA 1T39A 2A68F 4LK0F 3BLYA 3JRAA 1R5GA 1REPC 1LFBA 2NOJB 2JVHA 3CO7C 3O8GA 3ZXSA 3SYTA 1YYVA 2Z99A 1J5YA 3G3ZA 4BDZA 2F48A 3I4NJ 2MG4A 3LL7A 3CCYA 3DV8A 3TEDA 4IHVA 1YOVB 5GAHJ 2DA5A 1FBUA 2L9VA 2BXZA 1R49A 2Z9OA 3D5SC 4MTEA 5LHGA 3J81Z 2O61A 2LY2A 2E7XA 3M8EA 1RR8C 2M0CA 3LA3A 4E7LA 4L0YB 2COBA 5H6RA 2X48A 1N25A 1X3UA 3ZQIA 1KA8A 5E3OA 1FX7A 1O4XA 3LSTA 3I4MJ 3NWSA 2FJ1A 5B66C 1YLFA 1VQ4I 1V55H 3BG9A 4N9IA 1G8XA 2AHQA 6PAXA 3LFUA 4YIRX 3SZTA 1ZRCA 1KZHA 4BY7J 3HTUA 4XRSG 5J3LA 3ZQFA 3AG2H 3BTJA 2LG4A 4B47A 3O8HA 1GV2A 1MBFA 4F7ZA 1ERDA 3KPHA 3DTIA 2CW7A 4BE2A 3UNGC 1GV5A 4EVIA 4LD5A 4XN0A 3ZQGA 5M5YJ 1CF7B 3DCFA 3ERED 4I09A 3CP8A 4F55A 5FLXK 2HYFA 3BJOA 3HUGA 4GRIA 4HQMA 3GCMA 1X1CA 2PBIA 2ZSHB 2H1LA 4KIGA 4A3GJ 3DEEA 3GLXA 4FX4A 3A0BC 3A03A 2LTPA 3TO7A 3I5UA 2L2OA 3RKYA 2LR8A 2WAQN 1X1BA 4LG0A 4BJTA 2Q1ZB 3R6SA 4CA0A 4AD9A 1PUFB 3TO9A 4A5MA 2W84A 1B8IB 2RKHA 2K02A 3JAMK 3BG3A 3LA2A 1FMWA 5HOOA 4KYWA 1VQOI 1KYZA 4CCNA 1LEAA 1R9TJ 1BOAA 2ISYA 4FE7A 3HRUA 4L0ZB 4EMSA 1VQKI 2MH9A 3FX3A 4ZYHA 3QP6A 2O5RA 2VT3A 3IH2A 2LRDA 1YRNA 1KU2A 3WG7H 1N77A 3U1DA 4QWQA 2STTA 2CG4A 4IVNA 4BQAA 4NHJA 3BQYA 5M3FJ 4ITVA 3K2ZA 4F3QA 5GAGJ 1PYVA 3K4JA 4YFXF 2OCCH 3L1PA 2C6YA 4L5JA 3PQKA 4Y3OA 4JYKA 5ILUA 5FO5A 3LMMA 1P4XA 3TMOA 2Y69H 4O5VA 1UHWA 1M1EB 2ZXIA 3LOCA 4AIDA 2OTLI 3CUQB 5LD2C 5LEJA 1G3TA 4IJAA 4BE1A 5GPCA 2XB5A 3CCMI 1IRGA 1RPWA 4Y13A 2KFDA 3DLAA 1O3TA 2KDOA 4XL9A 1G59A 1FTTA 4O6JA 1W7PA 2GA1A 1R22A 1WJEA 3DU5A 3U9GA 3F8NA 4JBAA 2CU7A 2IS6A 1YJNI 1HW5A 2V79A 5D6EA 1SD7A 5KAFC 3S14J 2GM4A 2E34A 1KGSA 5JLWA 1LNWA 2Y75A 2D45A 2V9PA 4DGWB 3F23A 3HM5A 5HS7A 4A3KJ 4ZC3A 1G2HA 4ZYAA 3F6VA 4FISA 4IHTA 3FF5A 4W1UA 3TKYA 1HC8A 1TL8A 4BNCA 1ODDA 3GYHX 1NK3P 4XOTA 3OYCA 4HG2A 2GAUA 2AS5F 4IHXA 1RUNA 3F6OA 2P0WA 1S7EA 3Q0UA 3MFKA 1P2FA 1RUOA 1FT9A 2F5FA 2KRCA 3GFMA 3OIOA 2JWTA 2I10A 4QLCU 2NVTJ 1P9QC 2FBKA 5J8CA 5GAEJ 3M1CA 3K4KA 2VUMJ 1O57A 2H27A 2EK5A 1IUFA 2X1EA 1L3LA 4PJ0C 2A5WA 5GP9A 1NG6A 3M1EA 5FFZA 2QQ9A 4KMUX 2P5VA 1IGNA 3R60A 1EKEA 1UJ8A 2A3SA 3TP0A 4A93J 1SFOJ 2HDWA 4MFEA 3QPLA 5GTHC 2FMLA 2M2EA 3OYIA 1W1WE 1TBXA 1AKHA 3ZQHA 4HAMA 5HDKA 1YG2A 3KLOA 5DUKA 3WGGA 1UG0A 2V4JC 1D8JA 4RB3C 5M5WJ 4LOCA 3ZMZA 2MLGA 2HOAA 3ZMSA 2DK8A 2MFZA 2Z16A 2F5VA 5K5RA 3VYSB 2DA3A 2P6TA 1MMNA 5B5EC 1ZG1A 1OYYA 2Z5UA 4KNYA 2HNHA 2LK2A 1RIOH 4RB1A 3JRHA 5ICFA 3Q0WA 1GHCA 3CCSI 1MBKA 3E6MA 4PDKA 3K4CA 1EA3A 1OR7A 1Q1VA 4CZCA 1ETVA 2VQHA 5HNHA 5J1UA 3NWTA 3JCUC 4XLFA 4XSZF 2QENA 2XPUA 4R79A 3CMEI 5EZGA 3BC8A 4XKCA 3J7YJ 3PNVA 3K70C 4ZH4F 1ZARA 4PJNA 2FNPA 3HOZJ 3IKVA 3K4NA 3LFKA 4HBLA 2ZC2A 5K5OA 3B02A 4Q4ZF 2JA5J 2QGUA 2VBXA 3F22A 3CC2I 1LKXA 3OOPA 5D4RA 4CZZA 3DLLF 2E19A 3JTHA 2ZFWA 4B09A 3ZPLA 5F64A 3GVAA 4E4HA 3LSGA 2K9QA 3IWZA 5EG0A 1B9NA 3CC7I 2LBFA 4AM3A 3DEWA 4RS8A 1E0EA 2X4HA 4N4OB 2HKXA 4ENMA 1MKMA 5F08A 2DPDA 3QAHA 3LSHA 1FBQA 1QPMA 2VE8A 2L9NA 2LC2A 4CYCB 1U5TC 2G7UA 3FBNB 3HRMA 3PIOF 4ESFA 2O0YA 2IJLA 1IDZA 1XDUA 2PI0A 2R93J 3PFIA 5J8FA 3TGNA 1A6QA 3MWMA 4PFPA 1XG1A 4F52A 1Z7LA 3RZDJ 4HQEA 3ISPA 1KQ8A 2DOEA 2W25A 3EETA 3SDGA 3I59A 3RPUA 2DYSH 4E7JA 4OIPF 2HEOA 2EH3A 2YX4A 3KX2A 2F4MB 1X3ZB 4RDUA 1G6NA 3BR0A 3E0JB 1K78B 2B63J 2K85A 3IAM2 4QIWN 1UHMA 2W24A 4XICA 1LB2A 3BG7A 2JMWA 2VE9A 4CUGA 3H9JA 1DDNA 3Q9VA 3ASNH 4LLGF 3L2CA 4YG2F 2FQ3A 2QSGX 1RZ4A 2ADUA 1HW1A 2IS1A 1JUSA 5CPRB 4XIDA 2OQGA 4KFCA 1P6RA 2X0LA 4WXDA 1MMSA 5BS6A 2K9MA 5E3LA 4A6DA 2MW8A 1R1TA 3V42A 2ZBKA 2HQAA 3C2HA 1YIOA 2H09A 2IVMA 1MBEA 3MKLA 2QSHX 4FCYA 2W1OA 4NNJA 2XAGA 1HKSA 1WHUA 3EYIA 2PJRB 1WJAA 4P9FA 4WX9A 1QBJA 2JA7J 4AYBA 4CCOA 4Q5SF 3FHZA 3V8JA 4DYRA 4KISA 3E97A 2UZKA 2FE3A 2LD5A 2WV0A 3SZGA 2ESNA 4AUXA 2Z3YA 3FBIB 3DQVC 1JJ6C 4V2FA 4C2MJ 2AQFA 4CCLA 2O9LA 4RGUA 2ETHA 2VBYA 1Z3YA 1YI2I 4WWCA 2HDCA 1VFCA 2UWMA 3F8BA 4B48A 2CJJA 1R4MB 4EGYA 1YTYA 5FB2A 1X3WB 2HXOA 1XPXA 4CCMA 3J80Z 2P6SA 3G73A 4XK4A 2FSWA 1XDSA 1ZYRF 2Y0SN 2FU4A 1WVRA 3FZVA 2JA2A 3HOSA 2FXAA 4N4NB 2VXZA 4S04A 5E20A 3S1NJ 4N0BA 5JI6A 1BIBA 3OS0A 4WF2A 4IQ4A 2HZTA 1K61A 5E17F 3S17J 4ESJA 4OIOF 2L4AA 3M8JA 3FISA 4KN4X 3E3VA 2QYOA 4HA8A 3T1BA 4LB6B 2Y2ZA 2VL8A 2WAEA 1Z05A 2XPVA 1AHDP 3JR9A 1QO0D 2MA3A 3TP3A 3GFJA 5IY5H 1MMAA 1P7IA 2XGXA 5D5VB 4P5OA 2R5YA 2NXNB 3K1MA 1R5ID 1OJLA 4Z2YA 4FT8A 1PP7U 5E3MA 2FX0A 3S2WA 5D5XB 1ZGWA 4FX0A 1R71A 2WTEA 3K1PA 1HBXG 1W5TA 4WK8F 2JJ7A 2J5PA 1T08B 2DA1A 1SC7A 3KYDB 1HOMA 3U1KA 3L2WA 1S72I 3ML6A 4RAYA 2LY1A 2ZSIB 1ETKA 3J7AO 3JRDA 2IA0A 2ID6A 3QOPA 3V7CA 2WB1N 2O6GE 2P8TA 4GCVA 2Z2SB 4UUVA 5LHHA 2LVSA 1WSUA 2JRMA 2COMA 1X4PA 2R7OA 2BY3A 2KKOA 3I71A 1IUYA 3QP5A 2CH0A 5C3EJ 4X0GA 1YITI 3VB2A 3H5NA 2IPQX 3FXOA 2QBYA 3I53A 1FBSA 2DJNA 3MMYB 2R7TA 1E3PA 5E79C 5L3EA 1BC7C 3FKIJ 3HYIA 2EJRA 2ZJRF 3ERMA 1SVLA 1B4AA 1RI7A 1XB4A 1U6GA 2LY9A 3F9KA 3CF2A 2WAFA 3PL8A 3KFWX 1D1BA 2VQCA 3WU0A 5TISC 2XSDC 2QLZA 2JPBA 2XF6A 4XQFA 4UB8C 1SAUA 4MFDA 2KT0A 1SFKA 1IXSB 1OCCH 2A6EF 3V4GA 2BEOA 2IRFG 1ZKGA 3OWTA 1O7LA 1QZYA 5FKMA 3HOWJ 1IN6A 4G7OF 1MNDA 3WHCA 3T8TA 3RYRA 1ZR4A 2IXSA 2ME0A 5B3SH 2X1CA 2EV0A 4GO1A 3Q5FA 4D5FA 2L4MA 4RLFA 4IPAA 3G71I 1VQ9I 2XVCA 3GMEA 3HHHA 4IRHA 2KL4A 2DTZA 3TW6A 2XAQA 4HW0A 5DM7F 2QZ8A 3M07A 3DU6A 4NQWB 3J7AY 1K6OA 4XRFA 1V5GA 1D0XA 4IHSA 3EUAA 4XKBA 4IOCF 1LUJB 5FKKA 1SFUA 2W82A 1BN5A 3QYEA 4PSXA 3SHFA 4AU7A 5FRNA 4BH9A 2KP6A 1VQ6I 3AG4H 3E6BA 2R7SA 3FM5A 4GDFA 2DPUA 2CS3A 3QODA 1RRJA 1I5ZA 2JSPA 2EPFA 2HQNA 2HI3A 2L0KA 3FMQA 1MH3A 4HSTA 3OSGA 1GUUA 3SEQA 4BY1J 1H8AC 4ON0A 1U5TA 2R3SA 5LGUA 4LLLA 2Q2EA 1WH5A 2M4GA 2QF7A 2E36A 5DV5A 4IF4A 5ILSA 3ZMVA 1HCRA 1TNSA 2R7RA 3PSFA 5M3MJ 2JRTA 3CDLA 4U7BA 3G4SI 1G4DA 1BW5A 3CZ6A 3MKWB 2D1HA 1Z21A 4HLXA 1N75A 3CF5F 1U8RA 3HPGA 5D4SA 5BPDA 2FEZA 4UHTA 1WRJA 3WTWC 4I02A 3LSJA 1Z77A 4D7MA 2JA6J 1S29A 4PJJA 2F5CA 2L02A 3KEOA 1FSHA 4I76A 2IGNA 2JK3A 3BTCA 2FUG2 5HODA 1HW2A 2O03A 4ZZLA 4WXCA 3GTKJ 4HNVA 1E3OC 4BJ6C 3QOEA 3QPSA 1FYKA 1RR7A 4AVZA 3BPVA 1S8NA 1ZGJA 3CESA 2CWEA 2GQQA 3DKWA 3OIQA 2A69F 1W4MA 2X85A 4EJUA 4O3MA 2FRHA 3BR1A 3ZQQA 1TWHJ 2PMZA 4MEYF 3NQOA 2ZNZA 3LA7A 2DOFA 2K4BA 1K79A 1I6HJ 2KQRA 3VYTB 1WJDA 2BV6A 3CCVI 5HLIA 1MBGA 1TC3C 3BTLA 4LB5A 2JT1A 1F43A 2BW3B 3BZKA 2KDZA 2CRGA 4XLPF 4RM2A 3LAPA 1HKQA 4PSWA 1YHQI 2X6WA 2V26A 2NS7A 5GTIC 3E5QA 1X4OA 4UUSB 3GO5A 4S0HB 4IHWA 2DMQA 1IRXA 4U0VA 1JKQC 5CVVA 1LE8B 3O2PE 2Y48A 2HFHA 2ZXWH 1AWCA 3KP4A 3GTGJ 1NG7A 3N97A 3TOBA 3HBLA 5HS8A 1W5SA 4YIFA 3MQ0A 2XASA 2HPIA 1EF4A 1U8BA 2ZXJA 2LF7A 4H4KC 2EV5A 4HF0A 3RKQA 2XGCA 2IA1A 1JE8A 2GZWA 3C18A 1B6AA 5LEKA 5FLXZ 4A6EA 1T0FC 2ICWG 3H3UA 3CC4I 2I5UA 2V9KA 3GBGA 1WH7A 4A3FJ 3MZYA 4HEA2 3H5RA 1XX5A 4GXOA 3ZR8X 2CQQA 2DT6A 2EZKA 2FBIA 2XV4S 1SD4A 2NNNA 3SDBA 4CH7A 4U7DA 4ZYGA 1I6XA 3TO6A 5IT3A 4G7HF 1X1AA 5EGOB 2HTJA 3L00A 4B1RA 3JRBA 2HOTA 2ZJQF 5L3CA 3HIFA 1JUPA 5ERIA 3JAMZ 5K7FA 4M72A 1TW2A 3EYYA 1XMKA 3IC7A 2EFQA 2K9LA 5JVTA 1WKMA 3CD6I 2A5YB 4U87A 1BL0A 4C3HJ 2EV6A 2IA2A 3BQZA 3JSPA 3H35A 2GXGA 2DOAA 3RKXA 2MD0A 2O7OA 1MDMA 3EUKL 5HS9A 4EJVA 4G9YA 1X2MA 5LFAA 1LPQA 4RAFA 3OYEA 3KZZA 4PJMA 3ZCOA 3IH3A 3WTTC 3I55I 2HVSA 1P92A 3NRVA 2M7AA 3K10A 1H0MA 4U88A 2XF7A 4GYIA 4DZJA 2ZB9A 2VKHA 3QPHA 4CHUA 1X58A 3ZQCA 4RGRA 3GEZA 5E1WA 5GPAA 2FF4A 2E1MC 2ISZA 2KZGA 4ZYEA 2XC7A 3WU1B 4G94A 5IOZA 1ENHA 2LMDA 2NYXA 3GZ5A 1KQ9A 5L3BA 5HLGA 2YU3A 2BBYA 1LDDA 4E7HA 3MN2A 3HPHA 1IDYA 3MVPA 5FLMJ 1W0TA 1XCBA 1DUXC 2E1CA 5CQGA 3GZ6A 1I3QJ 2LREA 3QU3A 4JOMA 1VQLI 1USSA 2I8DA 5DS9A 2EA2A 2KIQA 1WJCA 1IN7A 2KRHA 1DGRM 3Q9SA 2HYJA 2XHKA 2UXXA 4M6VA 1ON1A 3CQZJ 3FXUA 1JKPC 3KEQA 4AC0A 3JRGA 1Z91A 5D5WB 1IW7F 2CUZA 2M30A 2VN2A 2WA0A 4DYCA 5JHFA 4M74A 2WC2A 1NK2P 2VJIA 2XGEA 4EJOA 3JREA 2E1OA 3IUOA 2QUFA 5ICGA 4C9YA 3LSRA 3HC7A 2O3FA 3HDDA 3BOQA 2ZMEB 5KHDA 4HX4A 1CF7A 1ZREA 2JPCA 5KCMA 5FJ8J 1D8KA 1I39A 2MH2A 2NAZA 3HOUJ 3AKZA 4MGRA 4FE4A 1APLC 4BJ5C 3G2BA 1UCRA 1XGNA 2JZYA 5D6FA 2DMNA 3HKZA 1EH7A 2KIFA 2K40A 3IRRA 5J1RA 4HOBA 2CV0A 1FYMA 2STWA 1TW3A 1R4NB 4A12A 2ZKZA 5ICCA 1B8IA 2M3AA 4CGZA 4DW6A 1W36D 3HG9A 5F6FA 1PP8F 1USTA 3GUDA 3MZHA 1QA6A 1J0RA 3BCAA 2M8EA 3X2QH 4A3BJ 1Y0NA 3L2RA 4F93B 2LFBA 3G1MA 4KICA 5J1YA 2F5EA 1F9NA 2FA5A 3D5RC 5D5UB 4RM3A 2R5ZB 2UUZA 2XRNA 2JN6A 3D5LA 3I54A 2CV2A 1F5TA 3ZMDA 4X6AJ 3GXOA 1W0UA 3OMYA 4LIVA 4L9NA 1UMQA 4OAZA 3HEFA 3OR1C 1WJBA 3CP2A 5KNLA 3OYFA 3HOXJ 4XBFA 3GZNB 3EPZA 1VZ0A 4ETSA 1HSTA 3T5XA 3W6JB 1IO2A 3FXKA 3TL4X 4XRMA 1J09A 3CDIA 4LITA 3VSLA 2E5NA 2O8KA 4D7NA 1FOWA 2PJPA 2L54A 3N05A 3C2GA 4GFBA 1BR2A 3L2UA 3S3NA 1MJBA 1UZCA 4RB2C 3CUQA 1ZLKA 2XF5A 5C4JJ 2EQRA 3BG6A 2RAEA 5HVQC 2MD5A 4CICA 1MH4A 2XKOA 3VODA 4KT5C 2BE5F 4A3IJ 3QWLA 4RAGA 1ZH5A 2OBPA 2ELHA 3S8PA 4DOZA 2A07F 2V1DA 4M71A 2VOPA 3FK7A 3BJ6A 1LJ9A 1ZG5A 3JW4A 4HF2A 1J2XA 4JX5A 1FWZA 3KIOA 3TDUC 2E2HJ 2LNBA 4YIIA 4B4CA 4BQNA 4KA4A 1KQ0A 3SZPA 5CYVA 3RJPA 5TRDA 4L9VA 2CQXA 3DWLE 1TNTA 2EBIA 5IPAA 2H1KA 5AIPA 3LSIA 5F0CA 1BI3A 1OLTA 3V8KA 3E5XA 1GDTA 2W57A 4YRVA 3ABMH 3PQJA 2VI6A 3O6BB 3OR2C 3KETA 3OY9A 1S3JA 1XN7A 3I59B 2XGDA 3JRFA 1FIPA 2IAIA 5IOYA 2NS0A 3CJNA 3A4CA 2BOLA 2ECCA 4Y4RA 2ELJA 4I6ZA 1T6SA 3A01B 1DP3A 4ZTJA 3W3CA 3HOYJ 2LH9A 2HVQA 3LSKA 3K4BA 3K0LA 3ZP5A 5CVIA 2EFPA 2EA4A 4LGWA 1D5VA 2VIXA 5BMZA 5KAIC 2VJ5A 1BOBA 2IBDA 2L3DA 3CJQB 2M45A 5K1YA 2W48A 1JUMA 1F4KA 5HDGA 3HOTA 1U9OA 4P55A 4RA2A 4AYBN 1T0FA 4EM1A 3S15J 4GGGA 1E3HA 2GXBA 2CMPA 3ULQB 2NRAC 2HQRA 4CCJA 4M73A 1FNNA 5A2QZ 3JRCA 2LSOA 3OS1A 3ZMTA 4EM0B 1RKTA 3HOVJ 4L5IA 4IRIA 3UR3C 3LAJA 4YFNF 1LEBA 3WGIA 3S32A 3JRIA 3GFIA 2X6XA 2PG4A 1RNLA 4KUMA 4OOIA 4D5CA 1FMVA 4ZJZA 2UXNA 2DFHA 1PDNC 3BY6A 1YJ9I 2RVCA 1QGPA 4P1WA 2B0LA 1LVAA 3VPRA 1J7KA 2L5QA 3PJRA 3M3YJ 1JI8A 3G6EI 3R4KA 1R58A 2LOOA 2XROA 2DW4A 5F0HA 3SEZA 1ETQA 1GXQA 4RMNA 5H2FC 4PK4A 3IL2A 2PFBA 3H9GA 3WU2C 5L3FA 4HRIA 3R0JA 1TWFJ 2R4GA 4ESBA 4U0WA 1JTYA 5C4XJ 4D1QA 1WFXA 4M9SA 1BM9A 5DUIA 4DNCA 2A6HF 3P9IA 3M4OJ 3PNYA 3CTAA 3OS2A 1QNTA 5HLTA 1T95A 5DTDA 1SANA 2X6OA 1R6RA 1LFPA 2PX9A 4FETA 4MQVA 2RGVA 5E8IA 3L2VA 2EB7A 4LG3A 1XCVA 2R7ZJ 2RNGA 2R7WA 4LLNA 1BBYA 3H5AA 5FRMA 2R5YB 4BEHB 2EFOA 5FROA 4DBRA 4AIHA 4ZDOA 1IF1A 3ELKA 3W6KB 2PN6A 4CYCA 2XSJC 2IS4A 2DXIA 1WI3A 1HLVA 1V4RA 2XPWA 4IHYA 1Y8RB 3H1CA 1BIAA 4MHGA 4HDUA 3HB9A 4WCGA 3WG9A 2ME6A 3TQNA 4BE0A 2NNYA 3LSMA 2JSCA 3OYMA 1ETWA 1U78A 4B3AA 4BBRJ 3MKZA 3G1LA 2ZCWA 4X1EA 5DEQA 5TJJA 1K78A 4NC8A 3FXQA 3KYCB 3CMYA 3UKGA 1TLHB 2ZJ2A 3R61A 3GTJJ 1Z3XA 3BROA 2JVGA 4IQJA 2QCOA 2TDXA 4HYEA 1EH8A 3CUOA 1IAWA 1BR1A 4F92B 1OYIA 4XLCA 1TWAJ 3W2WA 3OYJA 1OISA 2YSRA 2CQNA 5DCMB 1VQPI 1IN4A 2RN7A 1YW7A 2PLYA 2DYRH 3HL2A 2R7FA 4EJWA 2HU9A 3KCCA 3GTPJ 3RTRA 2XAJA 3VEPA 2DA4A 3F8CA 3RYPA 4MQ9F 3F8MA 2CV1A 2OV7A 1Q1HA 3RDIA 1HDDC 1BW6A 3E6CC 2W00A 1P4WA 5TGTA 3OSFA 2WWYA 2G0EA 1T33A 3QYBA 1UHSA 1MIJA 5FD5A 4BAYA 1Y0UA 5E1XA 1H9GA 1E17A 1YO5C 2CUFA 2LKPA 1MSEC 2V1UA 3CCQI 4HDVA 2XUBA 4G6QA 1Y56A 1FZPB 2DTRA 1TQMA 3MKYB 2GIZA 2VOOA 2M9HA 4G6DA 3TBIA 1IRZA 3K70D 2R7UA 4PGHA 3GTLJ 2E5ZA 4OINF 1ZRDA 1T38A 1UAAA 1AA7A 3SQNA 2Y9YA 2L9RA 2M34A 1MBHA 5KK1A 1U0JA 1DP7P 2BYVE 2DMTA 3WTUC 3BTIA 3V7RA 1ZR2A 1FP2A 4MIMA 4S05A 1F36A 1VI0A 5D8LB 3KYLA 1K4TA 3GTMJ 2HXIA 1XGMA 5FKLA 3ZQLA 3K9TA 2XAHA 1IRFA 2HYGD 4XKVA 5AIQA 3CCLI 2BHYA 1Z9CA 1MMDA 1KYWA 3CJRB 1STZA 2OA4A 1UELB 4P96A 4ZZDA 3F3XA 2KJCA 1A36A 1QZEA 3VYUB 5CVRA 5IT9K 5F1RA 5ICEA 4J19A 4OAYA 3KP2A 3OYNA 2BZTA 2QKMB 2OC6A 3ABUA 1B72B 4XN3A 1VQ7I 3LSPA 1GVJA 1JGGA 3GFLA 2K3FA 3QYFA 1U9NA 4LIUA 1Y39A 3FMRA 3KP6A 5ED4A 1D5YA 1IN8A 3FXJA 4OIQF 2TCTA 1YX3A 3DPUA 3PO3J 4UUTA 2EIMH 2DK5A 3OYDA 1UB9A 4TV7A 1DU6A 4L9TA 1I1GA 3MCZA 3M9AA 2VXDA 2NVYJ 2O8XA 1S7OA 3OIPA 2W7NA 4XSXF 4M3EA 3WTZA 3F21A 1SVOA 2M5WA 1FYLA 2HDDA 2M1BA 3ZQ7A 3WE3A 3ABTA 4QTRA 3ZOBA 2DBBA 2NOGA 2PMZN 3IRQA 3BG5A 4W97A 4CCKA 4HNUA 2BHZA 1MSFC 4RGXA 2JQ7A 3ROUA 3K4LA 2M8GX 1U2WA 3DPLC 1IG7A 4EQQA 2DFEA 5CKTA 2E71A 1S9HA 3TW7A 2QQBA 1R1UA 2M0MA 2WBMA 3AAFA 2K27A 1VQNI 4C30A 4A2UA 1T56A 4ABZA 5FGMA 1IJWC 3IP4B 2QVOA 1XSXA 3KEYA 2R7XA 1FIAA 3RPQA 2B9SA 3PNTA 3DEUA 1B1BA 4ZTFA 1HKTA 3AFHA 3TOAA 1HF0A 2HWVA 4NB5A 2MBFA 2QA4I 1QVTA 3BPXA 2A61A 3CUQC 3FKJA 4LJZF 3QQAA 3BZCA 4A3EJ 1ZK8A 4KJZA 1OCRH 2LLKA 2XAUA 2ZMEC 3HGGA 1EH6A 2DDBA 1YFHA 3E5UA 4BBSJ 2ESHA 3GLLA 2D1VA 2V1XA 4IEJA 1V54H 2BGCA 5EEAA 3H0DA 2VONA 1JXSA 1LVKA 4IL6C 1MJAA 1R00A 4KN7X 2OD5A 1TQIA 1XSVA 1ZLJA 4YFKF 4M3BA 3ONQA 2W85A 5H20A 1D3YA 1ZG3A 4JK1X 3F72A 4NQWA 4AVPA 1G3YA 2FD5A 3IH4A 2PEXA 2X1DA 4J01A 1CGPA 2IS2A 2OTJI 3E1SA 3SFZA 2NS8A 1OCTC 4CYDA 1NTCA 2OF7A 3ECOA 3DKYA 2FBHA 2RREA 3TDZC 2E35A 3HZJA 2V6CA 5CLSA 1W36C 2L7ZA 3MZ8A 2DA6A 1JHHA 2OZUA 5E18F 2H6BA 2VC0A 3DPTA 3P5JA 1K83J 2DFIA 2GOMA 3S3OA 2CO5A 3CMAI 4OMZA 3AG3H 4L9JA 4XOPA 2L7MP 3ASOH 4CXFA 4HSRA 5C44J 4XKWA 2VBZA 3KP7A 1SMTA 3CJTB 2EILH 3PUFA 2CQ7A 4II3A 3IV5A 2Y9ZA 2L01A 1ORKA 1ACIA 3HUGB 5CVUA 2EZHA 4BL0B 4M3FA 2EZIA 2YX7A 4MLOA 5F04A 2L7FP 3BR2A 4YELA 2DJIA 2RQQA 2BVMA 2GOXB 4LG0B 4G7ZF 1KU7A 1FY7A 2KLOA 5EEGA 1R1VA 1OFCX 2K9SA 5FD6A 2F6CA 1DGWY 4XLNF 2H8WA 3FXLA 5AONA 3IAS2 1A6IA 1S7AA 1V5EA 2F5DA 4A0YA 1DQUA 1FOYA 4C3IJ 4E6KG 2HS5A 2V9VA 4U0YA 4HNTA 4Y17A 2P5LC 3P7NA 2XRLA 4A69C 3OOUA 3K6GA 1SEUA 1YRNB 1GXPA 5E8GA 3VSKA 1TP4A 1EJ9A 2KIMA 4A0XA 2BY0A 5JHUA 3BR5A 4KITB 2OJED 2VJJA 1MNMC 3KP5A 5FFXA 1VQ5I 5DD8A 4NBQA 4KIBA 3OYBA 3ZRGA 2LP0A 3EUHA 4B3XA 2YS9A 4XNFA 2K86A 1I1SA 2DT5A 2R7DA 1CQTA 5JLXA 2BW3A 3REOA 3HHGA 3OYLA 4PJLA 5L3DA 3T0YA 4UUSA 2Z1DA 3H36A 2IW5A 2E2IJ 1W7PD 5IYBJ 2BVLA 4BKXA 3WTVC 3P9KA 3VYRB 2W4SA 1ZTRA 3J81K 2H8RA 1LE8A 2KPMA 3HKZN 4HX7A 1T2KA 4V19K 1W7PB 3U2RA 1O7FA 5E1ZB 1KU3A 1WJ5A 2IGOA 4NC6A 3FHNA 4PGGA 1TWCJ 3NEUA 2HOSA 2VBWA 1MZBA 1DU0A 3BT9A 4QPOA 1QRYA 1R23A 5BPIA 2LDUA 3IWFA 1S5LC 3I3LA 1N78A 3D1NI 3OYAA 1J59A 2EINH 3KZIC 2RDPA 4JX6A 4KT6A 4IXAA 3RCOA 3ZN1A 3PIPF 1IXCA 1V3FA 1XS9A 3W6VA 1B59A 4DJAA 1EV7A 4E70A 2KMUA 1JKOC 1OYWA 3FXMA 1FOXA 3KP3A 4BXFA 4KIFA 2DDAA 4XLAA 1GVDA 3I4PA 5J4VA 4J00A 5HDNA 4ZYDA 4A3MJ 4M9ZA 5KVRA 3CCJI 4XR6A 5EGOA 4BXUA 2K3PA 3B73A 1YX5A 1Z0XA 1OCZH 4LFUA 2OQRA 1XD7A 5LLQA 3E6DA 5DYMA 3FM3A 4EM2A 2D5VA 2JUGA 1IC8A 2R0QC 2K5CA 3H9QA 1KU9A 4ANJA 5J6XA 4NDLA 9ANTA 1YW8A 3RQIA 3A2KA 4XONA 5DDGA 1AKHB 2VKEA 3HRTA 3S1RJ 2B7EA 3FWEA 3K4MA 2CUJA 4HF1A 1J9IA 4DBQA 1PUFA 4DZPA 3W2VA 3FK6A 4IZZA 3PO2J 1X1DA 1AU7A 1WCMJ 2VODA 1WJFA 2WAQA 1B9MA 2E60A 4MEXF 2WY8Q 2P81A 5J40A 2VT2A 2KHMA 1BR4A 1IV8A 3DXJF 4I0AA 2X51A 5EF6A 3LNQA 3DF8A 3COAC 4HPQA 2HKOA 4NC7A 4A0ZA 3HRSA 3C2BA 4DIQA 3B6CA 2QM3A 4C3JJ 2NVQJ 4A3DJ 1Z7UA 1A5JA 1OKRA 1T8IA 1D0YA 4RGSA 3VOEA 3LQRA 5JFRA 2VQLA 1H88C 1W5CC 1WQ2A 2ZO4A 3IKTA 2JUCA 4BXXJ 3J7ZI 2YUSA 5J47A 1HA8A 3I9V2 1K4SA 1P4AA 1MD0A 2Y0MA 1ITYA 1VQ8I 3QU6A 3AL0B 1D1AA 1MGTA 4L18B 3S93A 1X19A 2VLAA 4M9XA 2NVXJ 3HSFA 5ILVA 3T8RA 2CW0F 2ZMEA 4C2UA 1LFUP 5EG0B 3ZN0A 2BY2A 2FQ4A 3NARA 2LBFB 1H9TA 2Q0OA 3ZMUA 4MO7A 2VJ4A 3S16J 4EGZA 3CMMA 4BHCA 4BU2A 4A3JJ 4CDGA 3AG1H 5FKNA 3OL3A 1TT5B 1BA5A 2ECBA 1S6LA 4A3LJ 4Y33A 4PZJA 5E3NA 3IHUA 2AQEA 3MAJA 2KISA 4ENNA 3BP8A 2HQ5A 3CLQA 3RPUD 1E2XA 2DCEA 2VQGA 1ZGAA 3EDPA 1HDPA 2PMUA 5CJ9A 1FJLA 1G3WA 3H0GJ 4QPQA 2XAFA 2XKPA 4BYYA 4LK1F 2D2WA 1YIJI 2R5ZA 2MC3A 2MYSA 2YPRA 4RB0A 3L2QA 2HPMA 1I27A 1R36A 1Z1DA 1FOKA 2FOWA 1TZLA 4UV8A 2WY7Q 2CUEA 2UV1A 4M6XA 4R8HA 1SVMA 4UVAA 1ETOA 4DQ2A 5LGNA 1V5FA 3H3ZA 3RQ4A 2OU2A 1UG2A 2AO9A 4P9UA 1YW9A 2GIVA 4D0PA 3S1MJ 2EIJH 1FLIA 2QSFX 2P4WA 2H6CA 2YR2A 4M3GA 1ETYA 3OV8A 4PFOA 4AIKA 2HZDA 4ENJA 2V7FA 2P7VB 2E2JJ 5DCFA
chains in the Genus database with same CATH topology
4F3QA 3QYBA 1PYVA 3K4JA 4BJ6C 3QOEA 2V1NA 4Y3OA 4AVZA 2E1MB 3VDXA 3CESA 3W2AA 3S3MA 3LMMA 3OIQA 2X85A 3TMOA 1Y56A 3ZQQA 3MKYB 2ZXIA 3TBIA 3K70D 2R7UA 2PMZA 5LD2C 4IX7A 2E5ZA 4BE1A 1UAAA 1AA7A 3DLAA 3HXLA 2KDOA 2KQRA 3VYTB 1U0JA 1WJDA 4XL9A 1G59A 2BW3B 1WJEA 3DU5A 4RM2A 2VKDA 4E7IA 4PSWA 3KYLA 2X6WA 2V26A 2IS6A 1X4OA 1IRXA 4NUBA 4XKVA 1QHHD 4DGWB 1MMDA 3CJRB 4ZC3A 4ZYAA 1UELB 1NG7A 3VYUB 2KZVA 2HPIA 4OAYA 4H4KC 4XOTA 4HG2A 3OYCA 3OYNA 2P0WA 4II2A 1MNEA 2QKMB 2MABA 3BCBA 2OC6A 2KRCA 1D1CA 1T0FC 4XN3A 1MW7A 2V9KA 3GBGA 1P9QC 4HEA2 3QYFA 4LIUA 3H5RA 3ZR8X 4XLEA 3M1CA 3K4KA 2DT6A 1YX3A 2X1EA 3DPUA 1QHGA 2A5WA 3SDBA 4CH7A 1NG6A 3ZGKA 3OYDA 1X1AA 4FASD 1MMGA 2HDWA 2VXDA 2A6TA 3OIPA 4D9JA 2W7NA 3OYIA 4EATA 2VB6A 2K9LA 3DTEA 4JQFA 4CCKA 4CSWA 4U87A 4HNUA 2OUMA 3K4LA 1UG0A 3DPLC 4E7ZA 3H35A 2V4JC 2F4IA 2ZXHA 2DOAA 2MD0A 5CKTA 3EUKL 4BGDA 5LFAA 1YE9A 2MFZA 2Z16A 3OYEA 1S9HA 2F5VA 3VYSB 4PJMA 3ZCOA 1MMNA 2M0MA 2WBMA 2HVSA 4C30A 2HNHA 2M7AA 3K10A 2XF7A 3IP4B 2VKHA 3K4CA 3KEYA 1EA3A 2R7XA 4CZCA 2CFOA 2E1MC 3PNTA 2VQHA 5HNHA 2XC7A 4ZTFA 1LDKB 4BS9A 3AFHA 3NWTA 4XLFA 4R79A 3BC8A 4XKCA 4E7HA 3FKJA 3EUHC 4KJZA 3PNVA 4IKFA 2XAUA 3HPHA 3PFYA 3K70C 2LYCA 4PJNA 4OWRB 2PJRA 3K4NA 5CQGA 2LREA 4JOMA 2IGMA 2I8DA 3H0DA 1WJCA 4BEHA 1LVKA 2KRHA 2CW8A 1LKXA 1DGRM 3OYKA 3ONQA 2WADA 4E4HA 3LSGA 2LBFA 4J01A 2X1DA 2CUZA 2WA0A 2IS2A 1E0EA 5JHFA 2L7KA 3E1SA 2VJIA 1KONA 4N4OB 3IUOA 4C9YA 3HC7A 5KHDA 3DKYA 3LSHA 2RREA 5KCMA 2L9NA 2LC2A 3FBNB 1W36C 2QKLB 3AKZA 3DPTA 2GOMA 4BJ5C 3S3OA 4PFPA 3U21A 3G2BA 1Z7LA 4F52A 4BQQA 4XOPA 3HKZA 4HSRA 4XKWA 4E7JA 4II3A 1TT0A 2CV0A 2Y0SA 3HUGB 3KX2A 2M3AA 4BL0B 1W36D 3HG9A 3E0JB 3FDYA 4E7SA 4MLOA 3BCAA 3IAM2 2M7BA 4YELA 2DJIA 2RQQA 2BVMA 2GOXB 3BG7A 3OL4A 4CUGA 3H9JA 4F93B 3L2RA 2M4KA 2KLOA 2XDVA 2Q2EB 2F6CA 1DGWY 2X6YA 1Y6IA 3D5RC 4RM3A 2CV2A 2UUZA 3D5LA 3IAS2 1V5EA 3OMYA 4LIVA 5CPRB 2IS1A 4OAZA 2ZFUA 1DQUA 3OR1C 1WJBA 3CP2A 5KNLA 3OYFA 2K9MA 4E6KG 4BDYA 3EPZA 1VZ0A 3V42A 4HNTA 2HQAA 3C2HA 4B43A 3TL4X 1J09A 3OOUA 3VSLA 3K6GA 4LITA 2E5NA 4C2TA 3VSKA 2W1OA 4NNJA 3N05A 3C2GA 1BR2A 4RLQA 4KITB 3L2UA 3S3NA 2PJRB 1WJAA 2VJJA 4XLHA 4AYBA 4CCOA 2XF5A 3BG6A 2DT7B 3ZRGA 3OYBA 4KISA 4B3XA 2WB1A 5HVQC 4XNFA 3SZGA 3PUBA 2VASA 3FBIB 3DQVC 2BW3A 3OYLA 2AQFA 4PJLA 3S8PA 4CCLA 4DOZA 2Z1DA 1Z3YA 2UWMA 4B48A 3A1YA 2BVLA 3RSNA 3VYRB 4BQNA 2W4SA 4B44A 2VPLA 2KPMA 4CCMA 1GLNA 3DWLE 1K6YA 1WJ5A 2JA2A 3LSIA 2IGOA 3MD2A 1OLTA 3FHNA 4N4NB 3HOSA 2VXZA 1PJRA 3OS0A 3DKXA 4IQ4A 4YRVA 4QPOA 3OR2C 3OY9A 4BACA 3M8JA 4XMYA 1N78A 3I3LA 3A4CA 2VL8A 2WAEA 3OYAA 2BOLA 4KT6A 2L9SA 4Y4RA 3RCOA 2ELJA 1MMAA 4DJAA 1DP3A 4ZTJA 4P5OA 2KMUA 3W3CA 4BXFA 1ZELA 2LH9A 4XLAA 2HVQA 3LSKA 4J00A 4YEJA 3K4BA 4XR6A 4BUPA 2K3PA 1YX5A 2VIXA 2VJ5A 1BOBA 3PSIA 2R7VA 4XORA 3CJQB 3L2WA 3HOTA 4PUSA 2LY1A 2JUGA 2ZSIB 2K5CA 3H9QA 5CQEA 3OYHA 4ANJA 1QU3A 2CMPA 2R7QA 3OYGA 3VWBA 4G6TB 4CCJA 3A2KA 4XONA 4E7KA 2Z2SB 4BQOA 3OS1A 4ZDLA 1OR7C 3DTKA 2HVRA 3K4MA 2IGKA 1X4PA 2CUJA 2R7OA 3UR3C 5HNFA 3S32A 1D0ZA 4DBQA 4ZDPA 2CH0A 2X6XA 4X0GA 3H5NA 1FMVA 3W2VA 4ZJZA 4IZZA 1X1DA 4F91B 3MMYB 4XM3A 2R7TA 2V6EA 1WJFA 2WAQA 4P1WA 2E60A 2WY8Q 2KHMA 1BR4A 2X51A 3AL0C 3F9KA 3CF2A 2WAFA 3PL8A 2L5QA 4ITVA 3PJRA 4HPQA 1JI8A 4NC7A 1D1BA 2MC4A 2VQCA 2LOOA 4DIQA 3BLYA 3SEZA 2NOJB 2XF6A 4XQFA 4RMNA 2JVHA 1SAUA 4PK4A 3ZXSA 1SFKA 3H9GA 1D0YA 3SYTA 4HRIA 2R4GA 4BDZA 3OWTA 2VQLA 4D1QA 3LL7A 1WFXA 1MNDA 3PNYA 3OS2A 3D5SC 5HLTA 1T95A 1HA8A 3I9V2 1R6RA 1LFPA 2LY2A 2IXSA 4FETA 3L2VA 4LG3A 2X1CA 4E7LA 3AL0B 1D1AA 2RNGA 2R7WA 5FRMA 3H5AA 3S93A 1X19A 3NWSA 4RLFA 2VLAA 4BEHB 1G8XA 3LFUA 2KL4A 5FROA 4DBRA 4ZDOA 4C2UA 2LG4A 4NQWB 3DU6A 4B47A 2LBFB 3J7AY 2XSJC 2IS4A 2DXIA 1V5GA 1D0XA 2VJ4A 1ERDA 3DTIA 2CW7A 3EUAA 4XKBA 4BE2A 3CMMA 3UNGC 4BU2A 2W82A 3QYEA 4PSXA 4XN0A 4AU7A 3OL3A 4BE0A 5FRNA 3LSMA 2KP6A 3OYMA 3CP8A 4F55A 2R7SA 4Y33A 4GRIA 2AQEA 1X1CA 2CS3A 2ZSHB 3QODA 3MKZA 2JSPA 3DEEA 3RPUD 4NC8A 2L2OA 4HSTA 2DCEA 2VQGA 3SEQA 1X1BA 1Z3XA 2Q1ZB 4BJTA 4CA0A 2JVGA 4QPQA 4IQJA 2M4GA 1BR1A 4F92B 2MYSA 4XLCA 3L2QA 3W2WA 3OYJA 2HPMA 1FMWA 5HOOA 1TZLA 2WY7Q 3PSFA 2R7RA 4U7BA 4CCNA 2UV1A 3CZ6A 3MKWB 1Z21A 3HL2A 1N75A 2HU9A 3RTRA 1V5FA 3HPGA 3RQ4A 2O5RA 2CV1A 2LRDA 2OV7A 1N77A 4PJJA 2W00A 4PFOA 2HZDA 5TGTA 2IGNA 2V7FA 2FUG2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSP A; 
#chains in the Genus database with same CATH topology
 2V1N A;  2DQL A;  2HTS A;  5EZH A;  2J5O A;  4I98 B;  2N8G A;  1C0W A;  1XMX A;  3RI4 A;  2E1M B;  3VDX A;  1ON2 A;  3I56 I;  2VC1 A;  3W2A A;  3S3M A;  1Y1V J;  1ZHF A;  3RKW A;  2EFW A;  1FP1 D;  5IYD J;  1XC5 A;  3S1Q J;  5HLH A;  1SD5 A;  4IX7 A;  3WGH A;  3EQL F;  4UY8 I;  1JGS A;  1UFM A;  3HXL A;  2ZNY A;  4WXH A;  2YU9 J;  3H3V K;  3Q3S A;  3GTO J;  4QSH A;  1POG A;  1YS6 A;  2R92 J;  2WV1 A;  2VKD A;  4E7I A;  5BQT A;  3M8F A;  1FSE A;  4HZF A;  5EYR A;  2K9N A;  2Y31 A;  1ETX A;  1LDJ A;  3FMS A;  2ID3 A;  1GT0 C;  3PM1 A;  2NVU B;  1JT6 A;  4OMY A;  4NUB A;  2CQK A;  1QHH D;  2DU9 A;  3R0A A;  1OQY A;  2AXT C;  3D0S A;  1R7J A;  2DN0 A;  5LBQ A;  1WGX A;  2KZV A;  3A01 A;  2CYY A;  3BDD A;  4CO8 A;  1JHF A;  1DPR A;  1ZRF A;  1WZ2 A;  1O3Q A;  4MNU A;  4II2 A;  1MNE A;  5F27 A;  2MAB A;  2DAO A;  3BCB A;  3GW2 A;  2Q8K A;  1D1C A;  4Q48 A;  5A2Q K;  1Y1W J;  1MW7 A;  1BC8 C;  5GAD J;  2KJB A;  4IOA F;  4XLE A;  1SAX A;  1IN5 A;  2IT0 A;  1Z6R A;  1QHG A;  1LQ1 A;  2OCE A;  3HJE A;  1YS7 A;  3ZGK A;  2F2E A;  1SD6 A;  5F0F A;  2LKX A;  3K2A A;  3ABK H;  1MMG A;  1RKW A;  5B1B H;  4FAS D;  1P7J A;  2A6T A;  4D9J A;  5JVG F;  2LKS A;  4FHT A;  1ZN2 A;  4EAT A;  2VB6 A;  3MEX A;  2LF8 A;  2PMH A;  3DTE A;  4A5N A;  5LHI A;  1Y8Q B;  4JQF A;  3C3W A;  4CSW A;  4Y15 A;  4AWX B;  3I58 A;  4UV9 A;  2OUM A;  4E7Z A;  3DBR B;  2DLL A;  1IV6 A;  2F4I A;  2MSY A;  2ZXH A;  5IYC J;  2H94 A;  2DOD A;  3LQQ A;  4HLY A;  4BGD A;  3KZY A;  3F8F A;  2HOE A;  5DD4 A;  1YE9 A;  1L0O C;  2TRT A;  2EWN A;  1DPU A;  1HXD A;  2GXA A;  1ZQ3 P;  5IP6 A;  4PCQ A;  3QPT A;  3NAU A;  3I0T A;  2FNA A;  1Z6T A;  2QBY B;  2AXL A;  1VF9 A;  1YJW I;  2DMP A;  2JTV A;  3BWG A;  4BHP A;  1BI1 A;  2DFF A;  2CFO A;  1OCO H;  1JT0 A;  1MJ9 A;  1LDK B;  3F0C A;  4BS9 A;  1XMA A;  1F1Z A;  5K5Q A;  3JSO A;  3GTQ J;  2QEX I;  3DP7 A;  1RES A;  5K7Z A;  2E7W A;  2XIG A;  3EUH C;  3Q0V A;  4V2G A;  4I2O A;  1SMY F;  4FTH A;  2PQ8 A;  4IKF A;  5BNG A;  3PFY A;  3JTG A;  2IP2 A;  2LYC A;  4HV6 A;  4OWR B;  3K7A J;  3V8L A;  1NH3 A;  2PJR A;  1RC9 A;  4G12 A;  4I7H A;  1J75 A;  1WWX A;  2IGM A;  2VKV A;  2KRF A;  4HV5 A;  3E7L A;  4BEH A;  2CW8 A;  3S2H J;  3BR6 A;  3FXR A;  3OYK A;  4UXN A;  3J80 K;  1TTY A;  1T98 A;  1FTZ A;  1ULY A;  3L7W A;  1U3E M;  2WAD A;  3SXY A;  1WPK A;  5K7H A;  5EEH A;  1BJZ A;  2L7K A;  3CDH A;  4L5E A;  2Y30 A;  1KON A;  5F1J A;  3S2D J;  1XGS A;  1Z67 A;  2X9D A;  5IT9 Z;  3CCU I;  2DQR A;  2CFX A;  3HGY A;  2RNJ A;  3CCR I;  2G7H A;  3A02 A;  2G9W A;  3A0H C;  2HR3 A;  2QKL B;  4ASN A;  5JR3 A;  2OAZ A;  1OCP A;  1IXR C;  4HX8 A;  2JA8 J;  3GF2 A;  1X2N A;  1I3A A;  3U21 A;  3RZO J;  4BQQ A;  1O3S A;  3GX4 X;  1A04 A;  4AIJ A;  1FEX A;  2FMY A;  1TT0 A;  2A05 A;  3KLN A;  2Y0S A;  4K2E A;  1ZAO A;  1PVE A;  3BZ6 A;  3FDY A;  4E7S A;  3C7J A;  3CLO A;  5DCM A;  1VND A;  2QWW A;  2M7B A;  2DA2 A;  3SFI A;  5L3G A;  4IO9 F;  3FIW A;  1R5H A;  3OL4 A;  1U5T B;  3I64 A;  3ECH A;  2M4K A;  1FC3 A;  2IEK A;  2XDV A;  2Q2E B;  4M6Y A;  1I50 J;  2X6Y A;  1Y6I A;  2DMU A;  3HSE A;  3ESW B;  4IRG A;  4EEF G;  3KE2 A;  3G1O A;  3GWZ A;  2K4J A;  2ZFU A;  2MGQ A;  3LWF A;  4BDY A;  4EV0 A;  5FKO A;  2BY1 A;  1MBJ A;  4M3D A;  4B43 A;  1TQP A;  5J4Y A;  3HTS B;  1QPI A;  4C2T A;  1QQI A;  1FPQ A;  1VTN C;  3N4M A;  2E1N A;  1NHA A;  4RLQ A;  4XLH A;  4XRS A;  1G3S A;  2OZ6 A;  4KDP A;  4RBO A;  2DT7 B;  4A3C J;  2WB1 A;  2CSO A;  4Y7N J;  2EIK H;  3H92 A;  2VPR A;  3PUB A;  5LRR A;  4BHB A;  2VAS A;  2M87 A;  5H6Q A;  1RET A;  2ZJP F;  1O3R A;  1PUE E;  3DBL B;  1A31 A;  5LRS A;  2ELK A;  3BJA A;  4N9H A;  1JKR C;  2BXY A;  3K1N A;  4JP0 A;  1JTX A;  4B8X A;  4I01 A;  3A1Y A;  4GYG A;  1YQA A;  3L09 A;  4DYQ A;  2KIU A;  5EDN A;  1H89 C;  2RQP A;  4RAZ A;  3RSN A;  3O3K A;  4B44 A;  3L9F A;  2VPL A;  1GLN A;  2XB0 X;  4KMF A;  3WTY C;  1AOY A;  1WI9 A;  1K6Y A;  3MD2 A;  2F4O B;  4OIR F;  5EJC A;  5LGT A;  3CCE I;  1PJR A;  3DKX A;  4H0E A;  2DA7 A;  2OPT A;  3CO6 C;  3BR3 A;  3V7S A;  4BAC A;  1BI0 A;  1QVU A;  1VQM I;  4XMY A;  3WTS C;  3WHB A;  4Z6Y A;  1SFX A;  1B72 A;  2EZL A;  1QZZ A;  5M5X J;  2L9S A;  1SFE A;  4UNO A;  2P5K A;  3WE2 A;  3VFZ A;  5DM6 F;  3RIR A;  1ZEL A;  5B1A H;  2HGC A;  5FLV A;  2K7L A;  3HSR A;  4Q47 A;  2FOK A;  3K69 A;  4YEJ A;  3ABL H;  5CVJ A;  1HSJ A;  4BUP A;  3QRF F;  4ENK A;  2DO7 A;  3SJM A;  4OU0 A;  3M7G A;  3PSI A;  1K7A A;  2R7V A;  1IZ1 A;  4XOR A;  4PUS A;  5IP7 J;  3B6A A;  2RC4 A;  4R1H A;  5CQE A;  2GA2 A;  3OYH A;  1QU3 A;  2R7Q A;  3OYG A;  3VWB A;  4G6T B;  5D8K B;  4UVB A;  2Z33 A;  4JX4 A;  4E7K A;  4UB6 C;  4BQO A;  2MLK A;  4ZDL A;  1BJA A;  1XGO A;  4I0B A;  1XTA A;  4Y52 J;  1OR7 C;  2CGP A;  1TWG J;  3DTK A;  2HVR A;  2IGK A;  5HNF A;  1ONV A;  1HQC A;  3DBH B;  3P9C A;  1D0Z A;  4ZDP A;  2P7C B;  2QQ8 A;  1OMI A;  4LMY A;  4EJT A;  4I99 C;  2EFN A;  4G8X A;  3WOD F;  1JJ8 C;  1MDM B;  1OPC A;  4XM3 A;  4F91 B;  2V6E A;  2DI3 A;  4FQG A;  3DFG A;  2ACJ A;  2GBY A;  1X1P A;  2QQA A;  4UVC A;  2GLO A;  2RV8 A;  1BI2 A;  3AL0 C;  3WTX C;  1XSD A;  2GWR A;  5IP9 J;  3C1D A;  2MC4 A;  4MTD A;  1A35 A;  5BOX A;  1T39 A;  2A68 F;  4LK0 F;  3BLY A;  3JRA A;  1R5G A;  1REP C;  1LFB A;  2NOJ B;  2JVH A;  3CO7 C;  3O8G A;  3ZXS A;  3SYT A;  1YYV A;  2Z99 A;  1J5Y A;  3G3Z A;  4BDZ A;  2F48 A;  3I4N J;  2MG4 A;  3LL7 A;  3CCY A;  3DV8 A;  3TED A;  4IHV A;  1YOV B;  5GAH J;  2DA5 A;  1FBU A;  2L9V A;  2BXZ A;  1R49 A;  2Z9O A;  3D5S C;  4MTE A;  5LHG A;  3J81 Z;  2O61 A;  2LY2 A;  2E7X A;  3M8E A;  1RR8 C;  2M0C A;  3LA3 A;  4E7L A;  4L0Y B;  2COB A;  5H6R A;  2X48 A;  1N25 A;  1X3U A;  3ZQI A;  1KA8 A;  5E3O A;  1FX7 A;  1O4X A;  3LST A;  3I4M J;  3NWS A;  2FJ1 A;  5B66 C;  1YLF A;  1VQ4 I;  1V55 H;  3BG9 A;  4N9I A;  1G8X A;  2AHQ A;  6PAX A;  3LFU A;  4YIR X;  3SZT A;  1ZRC A;  1KZH A;  4BY7 J;  3HTU A;  4XRS G;  5J3L A;  3ZQF A;  3AG2 H;  3BTJ A;  2LG4 A;  4B47 A;  3O8H A;  1GV2 A;  1MBF A;  4F7Z A;  1ERD A;  3KPH A;  3DTI A;  2CW7 A;  4BE2 A;  3UNG C;  1GV5 A;  4EVI A;  4LD5 A;  4XN0 A;  3ZQG A;  5M5Y J;  1CF7 B;  3DCF A;  3ERE D;  4I09 A;  3CP8 A;  4F55 A;  5FLX K;  2HYF A;  3BJO A;  3HUG A;  4GRI A;  4HQM A;  3GCM A;  1X1C A;  2PBI A;  2ZSH B;  2H1L A;  4KIG A;  4A3G J;  3DEE A;  3GLX A;  4FX4 A;  3A0B C;  3A03 A;  2LTP A;  3TO7 A;  3I5U A;  2L2O A;  3RKY A;  2LR8 A;  2WAQ N;  1X1B A;  4LG0 A;  4BJT A;  2Q1Z B;  3R6S A;  4CA0 A;  4AD9 A;  1PUF B;  3TO9 A;  4A5M A;  2W84 A;  1B8I B;  2RKH A;  2K02 A;  3JAM K;  3BG3 A;  3LA2 A;  1FMW A;  5HOO A;  4KYW A;  1VQO I;  1KYZ A;  4CCN A;  1LEA A;  1R9T J;  1BOA A;  2ISY A;  4FE7 A;  3HRU A;  4L0Z B;  4EMS A;  1VQK I;  2MH9 A;  3FX3 A;  4ZYH A;  3QP6 A;  2O5R A;  2VT3 A;  3IH2 A;  2LRD A;  1YRN A;  1KU2 A;  3WG7 H;  1N77 A;  3U1D A;  4QWQ A;  2STT A;  2CG4 A;  4IVN A;  4BQA A;  4NHJ A;  3BQY A;  5M3F J;  4ITV A;  3K2Z A;  4F3Q A;  5GAG J;  1PYV A;  3K4J A;  4YFX F;  2OCC H;  3L1P A;  2C6Y A;  4L5J A;  3PQK A;  4Y3O A;  4JYK A;  5ILU A;  5FO5 A;  3LMM A;  1P4X A;  3TMO A;  2Y69 H;  4O5V A;  1UHW A;  1M1E B;  2ZXI A;  3LOC A;  4AID A;  2OTL I;  3CUQ B;  5LD2 C;  5LEJ A;  1G3T A;  4IJA A;  4BE1 A;  5GPC A;  2XB5 A;  3CCM I;  1IRG A;  1RPW A;  4Y13 A;  2KFD A;  3DLA A;  1O3T A;  2KDO A;  4XL9 A;  1G59 A;  1FTT A;  4O6J A;  1W7P A;  2GA1 A;  1R22 A;  1WJE A;  3DU5 A;  3U9G A;  3F8N A;  4JBA A;  2CU7 A;  2IS6 A;  1YJN I;  1HW5 A;  2V79 A;  5D6E A;  1SD7 A;  5KAF C;  3S14 J;  2GM4 A;  2E34 A;  1KGS A;  5JLW A;  1LNW A;  2Y75 A;  2D45 A;  2V9P A;  4DGW B;  3F23 A;  3HM5 A;  5HS7 A;  4A3K J;  4ZC3 A;  1G2H A;  4ZYA A;  3F6V A;  4FIS A;  4IHT A;  3FF5 A;  4W1U A;  3TKY A;  1HC8 A;  1TL8 A;  4BNC A;  1ODD A;  3GYH X;  1NK3 P;  4XOT A;  3OYC A;  4HG2 A;  2GAU A;  2AS5 F;  4IHX A;  1RUN A;  3F6O A;  2P0W A;  1S7E A;  3Q0U A;  3MFK A;  1P2F A;  1RUO A;  1FT9 A;  2F5F A;  2KRC A;  3GFM A;  3OIO A;  2JWT A;  2I10 A;  4QLC U;  2NVT J;  1P9Q C;  2FBK A;  5J8C A;  5GAE J;  3M1C A;  3K4K A;  2VUM J;  1O57 A;  2H27 A;  2EK5 A;  1IUF A;  2X1E A;  1L3L A;  4PJ0 C;  2A5W A;  5GP9 A;  1NG6 A;  3M1E A;  5FFZ A;  2QQ9 A;  4KMU X;  2P5V A;  1IGN A;  3R60 A;  1EKE A;  1UJ8 A;  2A3S A;  3TP0 A;  4A93 J;  1SFO J;  2HDW A;  4MFE A;  3QPL A;  5GTH C;  2FML A;  2M2E A;  3OYI A;  1W1W E;  1TBX A;  1AKH A;  3ZQH A;  4HAM A;  5HDK A;  1YG2 A;  3KLO A;  5DUK A;  3WGG A;  1UG0 A;  2V4J C;  1D8J A;  4RB3 C;  5M5W J;  4LOC A;  3ZMZ A;  2MLG A;  2HOA A;  3ZMS A;  2DK8 A;  2MFZ A;  2Z16 A;  2F5V A;  5K5R A;  3VYS B;  2DA3 A;  2P6T A;  1MMN A;  5B5E C;  1ZG1 A;  1OYY A;  2Z5U A;  4KNY A;  2HNH A;  2LK2 A;  1RIO H;  4RB1 A;  3JRH A;  5ICF A;  3Q0W A;  1GHC A;  3CCS I;  1MBK A;  3E6M A;  4PDK A;  3K4C A;  1EA3 A;  1OR7 A;  1Q1V A;  4CZC A;  1ETV A;  2VQH A;  5HNH A;  5J1U A;  3NWT A;  3JCU C;  4XLF A;  4XSZ F;  2QEN A;  2XPU A;  4R79 A;  3CME I;  5EZG A;  3BC8 A;  4XKC A;  3J7Y J;  3PNV A;  3K70 C;  4ZH4 F;  1ZAR A;  4PJN A;  2FNP A;  3HOZ J;  3IKV A;  3K4N A;  3LFK A;  4HBL A;  2ZC2 A;  5K5O A;  3B02 A;  4Q4Z F;  2JA5 J;  2QGU A;  2VBX A;  3F22 A;  3CC2 I;  1LKX A;  3OOP A;  5D4R A;  4CZZ A;  3DLL F;  2E19 A;  3JTH A;  2ZFW A;  4B09 A;  3ZPL A;  5F64 A;  3GVA A;  4E4H A;  3LSG A;  2K9Q A;  3IWZ A;  5EG0 A;  1B9N A;  3CC7 I;  2LBF A;  4AM3 A;  3DEW A;  4RS8 A;  1E0E A;  2X4H A;  4N4O B;  2HKX A;  4ENM A;  1MKM A;  5F08 A;  2DPD A;  3QAH A;  3LSH A;  1FBQ A;  1QPM A;  2VE8 A;  2L9N A;  2LC2 A;  4CYC B;  1U5T C;  2G7U A;  3FBN B;  3HRM A;  3PIO F;  4ESF A;  2O0Y A;  2IJL A;  1IDZ A;  1XDU A;  2PI0 A;  2R93 J;  3PFI A;  5J8F A;  3TGN A;  1A6Q A;  3MWM A;  4PFP A;  1XG1 A;  4F52 A;  1Z7L A;  3RZD J;  4HQE A;  3ISP A;  1KQ8 A;  2DOE A;  2W25 A;  3EET A;  3SDG A;  3I59 A;  3RPU A;  2DYS H;  4E7J A;  4OIP F;  2HEO A;  2EH3 A;  2YX4 A;  3KX2 A;  2F4M B;  1X3Z B;  4RDU A;  1G6N A;  3BR0 A;  3E0J B;  1K78 B;  2B63 J;  2K85 A;  3IAM 2;  4QIW N;  1UHM A;  2W24 A;  4XIC A;  1LB2 A;  3BG7 A;  2JMW A;  2VE9 A;  4CUG A;  3H9J A;  1DDN A;  3Q9V A;  3ASN H;  4LLG F;  3L2C A;  4YG2 F;  2FQ3 A;  2QSG X;  1RZ4 A;  2ADU A;  1HW1 A;  2IS1 A;  1JUS A;  5CPR B;  4XID A;  2OQG A;  4KFC A;  1P6R A;  2X0L A;  4WXD A;  1MMS A;  5BS6 A;  2K9M A;  5E3L A;  4A6D A;  2MW8 A;  1R1T A;  3V42 A;  2ZBK A;  2HQA A;  3C2H A;  1YIO A;  2H09 A;  2IVM A;  1MBE A;  3MKL A;  2QSH X;  4FCY A;  2W1O A;  4NNJ A;  2XAG A;  1HKS A;  1WHU A;  3EYI A;  2PJR B;  1WJA A;  4P9F A;  4WX9 A;  1QBJ A;  2JA7 J;  4AYB A;  4CCO A;  4Q5S F;  3FHZ A;  3V8J A;  4DYR A;  4KIS A;  3E97 A;  2UZK A;  2FE3 A;  2LD5 A;  2WV0 A;  3SZG A;  2ESN A;  4AUX A;  2Z3Y A;  3FBI B;  3DQV C;  1JJ6 C;  4V2F A;  4C2M J;  2AQF A;  4CCL A;  2O9L A;  4RGU A;  2ETH A;  2VBY A;  1Z3Y A;  1YI2 I;  4WWC A;  2HDC A;  1VFC A;  2UWM A;  3F8B A;  4B48 A;  2CJJ A;  1R4M B;  4EGY A;  1YTY A;  5FB2 A;  1X3W B;  2HXO A;  1XPX A;  4CCM A;  3J80 Z;  2P6S A;  3G73 A;  4XK4 A;  2FSW A;  1XDS A;  1ZYR F;  2Y0S N;  2FU4 A;  1WVR A;  3FZV A;  2JA2 A;  3HOS A;  2FXA A;  4N4N B;  2VXZ A;  4S04 A;  5E20 A;  3S1N J;  4N0B A;  5JI6 A;  1BIB A;  3OS0 A;  4WF2 A;  4IQ4 A;  2HZT A;  1K61 A;  5E17 F;  3S17 J;  4ESJ A;  4OIO F;  2L4A A;  3M8J A;  3FIS A;  4KN4 X;  3E3V A;  2QYO A;  4HA8 A;  3T1B A;  4LB6 B;  2Y2Z A;  2VL8 A;  2WAE A;  1Z05 A;  2XPV A;  1AHD P;  3JR9 A;  1QO0 D;  2MA3 A;  3TP3 A;  3GFJ A;  5IY5 H;  1MMA A;  1P7I A;  2XGX A;  5D5V B;  4P5O A;  2R5Y A;  2NXN B;  3K1M A;  1R5I D;  1OJL A;  4Z2Y A;  4FT8 A;  1PP7 U;  5E3M A;  2FX0 A;  3S2W A;  5D5X B;  1ZGW A;  4FX0 A;  1R71 A;  2WTE A;  3K1P A;  1HBX G;  1W5T A;  4WK8 F;  2JJ7 A;  2J5P A;  1T08 B;  2DA1 A;  1SC7 A;  3KYD B;  1HOM A;  3U1K A;  3L2W A;  1S72 I;  3ML6 A;  4RAY A;  2LY1 A;  2ZSI B;  1ETK A;  3J7A O;  3JRD A;  2IA0 A;  2ID6 A;  3QOP A;  3V7C A;  2WB1 N;  2O6G E;  2P8T A;  4GCV A;  2Z2S B;  4UUV A;  5LHH A;  2LVS A;  1WSU A;  2JRM A;  2COM A;  1X4P A;  2R7O A;  2BY3 A;  2KKO A;  3I71 A;  1IUY A;  3QP5 A;  2CH0 A;  5C3E J;  4X0G A;  1YIT I;  3VB2 A;  3H5N A;  2IPQ X;  3FXO A;  2QBY A;  3I53 A;  1FBS A;  2DJN A;  3MMY B;  2R7T A;  1E3P A;  5E79 C;  5L3E A;  1BC7 C;  3FKI J;  3HYI A;  2EJR A;  2ZJR F;  3ERM A;  1SVL A;  1B4A A;  1RI7 A;  1XB4 A;  1U6G A;  2LY9 A;  3F9K A;  3CF2 A;  2WAF A;  3PL8 A;  3KFW X;  1D1B A;  2VQC A;  3WU0 A;  5TIS C;  2XSD C;  2QLZ A;  2JPB A;  2XF6 A;  4XQF A;  4UB8 C;  1SAU A;  4MFD A;  2KT0 A;  1SFK A;  1IXS B;  1OCC H;  2A6E F;  3V4G A;  2BEO A;  2IRF G;  1ZKG A;  3OWT A;  1O7L A;  1QZY A;  5FKM A;  3HOW J;  1IN6 A;  4G7O F;  1MND A;  3WHC A;  3T8T A;  3RYR A;  1ZR4 A;  2IXS A;  2ME0 A;  5B3S H;  2X1C A;  2EV0 A;  4GO1 A;  3Q5F A;  4D5F A;  2L4M A;  4RLF A;  4IPA A;  3G71 I;  1VQ9 I;  2XVC A;  3GME A;  3HHH A;  4IRH A;  2KL4 A;  2DTZ A;  3TW6 A;  2XAQ A;  4HW0 A;  5DM7 F;  2QZ8 A;  3M07 A;  3DU6 A;  4NQW B;  3J7A Y;  1K6O A;  4XRF A;  1V5G A;  1D0X A;  4IHS A;  3EUA A;  4XKB A;  4IOC F;  1LUJ B;  5FKK A;  1SFU A;  2W82 A;  1BN5 A;  3QYE A;  4PSX A;  3SHF A;  4AU7 A;  5FRN A;  4BH9 A;  2KP6 A;  1VQ6 I;  3AG4 H;  3E6B A;  2R7S A;  3FM5 A;  4GDF A;  2DPU A;  2CS3 A;  3QOD A;  1RRJ A;  1I5Z A;  2JSP A;  2EPF A;  2HQN A;  2HI3 A;  2L0K A;  3FMQ A;  1MH3 A;  4HST A;  3OSG A;  1GUU A;  3SEQ A;  4BY1 J;  1H8A C;  4ON0 A;  1U5T A;  2R3S A;  5LGU A;  4LLL A;  2Q2E A;  1WH5 A;  2M4G A;  2QF7 A;  2E36 A;  5DV5 A;  4IF4 A;  5ILS A;  3ZMV A;  1HCR A;  1TNS A;  2R7R A;  3PSF A;  5M3M J;  2JRT A;  3CDL A;  4U7B A;  3G4S I;  1G4D A;  1BW5 A;  3CZ6 A;  3MKW B;  2D1H A;  1Z21 A;  4HLX A;  1N75 A;  3CF5 F;  1U8R A;  3HPG A;  5D4S A;  5BPD A;  2FEZ A;  4UHT A;  1WRJ A;  3WTW C;  4I02 A;  3LSJ A;  1Z77 A;  4D7M A;  2JA6 J;  1S29 A;  4PJJ A;  2F5C A;  2L02 A;  3KEO A;  1FSH A;  4I76 A;  2IGN A;  2JK3 A;  3BTC A;  2FUG 2;  5HOD A;  1HW2 A;  2O03 A;  4ZZL A;  4WXC A;  3GTK J;  4HNV A;  1E3O C;  4BJ6 C;  3QOE A;  3QPS A;  1FYK A;  1RR7 A;  4AVZ A;  3BPV A;  1S8N A;  1ZGJ A;  3CES A;  2CWE A;  2GQQ A;  3DKW A;  3OIQ A;  2A69 F;  1W4M A;  2X85 A;  4EJU A;  4O3M A;  2FRH A;  3BR1 A;  3ZQQ A;  1TWH J;  2PMZ A;  4MEY F;  3NQO A;  2ZNZ A;  3LA7 A;  2DOF A;  2K4B A;  1K79 A;  1I6H J;  2KQR A;  3VYT B;  1WJD A;  2BV6 A;  3CCV I;  5HLI A;  1MBG A;  1TC3 C;  3BTL A;  4LB5 A;  2JT1 A;  1F43 A;  2BW3 B;  3BZK A;  2KDZ A;  2CRG A;  4XLP F;  4RM2 A;  3LAP A;  1HKQ A;  4PSW A;  1YHQ I;  2X6W A;  2V26 A;  2NS7 A;  5GTI C;  3E5Q A;  1X4O A;  4UUS B;  3GO5 A;  4S0H B;  4IHW A;  2DMQ A;  1IRX A;  4U0V A;  1JKQ C;  5CVV A;  1LE8 B;  3O2P E;  2Y48 A;  2HFH A;  2ZXW H;  1AWC A;  3KP4 A;  3GTG J;  1NG7 A;  3N97 A;  3TOB A;  3HBL A;  5HS8 A;  1W5S A;  4YIF A;  3MQ0 A;  2XAS A;  2HPI A;  1EF4 A;  1U8B A;  2ZXJ A;  2LF7 A;  4H4K C;  2EV5 A;  4HF0 A;  3RKQ A;  2XGC A;  2IA1 A;  1JE8 A;  2GZW A;  3C18 A;  1B6A A;  5LEK A;  5FLX Z;  4A6E A;  1T0F C;  2ICW G;  3H3U A;  3CC4 I;  2I5U A;  2V9K A;  3GBG A;  1WH7 A;  4A3F J;  3MZY A;  4HEA 2;  3H5R A;  1XX5 A;  4GXO A;  3ZR8 X;  2CQQ A;  2DT6 A;  2EZK A;  2FBI A;  2XV4 S;  1SD4 A;  2NNN A;  3SDB A;  4CH7 A;  4U7D A;  4ZYG A;  1I6X A;  3TO6 A;  5IT3 A;  4G7H F;  1X1A A;  5EGO B;  2HTJ A;  3L00 A;  4B1R A;  3JRB A;  2HOT A;  2ZJQ F;  5L3C A;  3HIF A;  1JUP A;  5ERI A;  3JAM Z;  5K7F A;  4M72 A;  1TW2 A;  3EYY A;  1XMK A;  3IC7 A;  2EFQ A;  2K9L A;  5JVT A;  1WKM A;  3CD6 I;  2A5Y B;  4U87 A;  1BL0 A;  4C3H J;  2EV6 A;  2IA2 A;  3BQZ A;  3JSP A;  3H35 A;  2GXG A;  2DOA A;  3RKX A;  2MD0 A;  2O7O A;  1MDM A;  3EUK L;  5HS9 A;  4EJV A;  4G9Y A;  1X2M A;  5LFA A;  1LPQ A;  4RAF A;  3OYE A;  3KZZ A;  4PJM A;  3ZCO A;  3IH3 A;  3WTT C;  3I55 I;  2HVS A;  1P92 A;  3NRV A;  2M7A A;  3K10 A;  1H0M A;  4U88 A;  2XF7 A;  4GYI A;  4DZJ A;  2ZB9 A;  2VKH A;  3QPH A;  4CHU A;  1X58 A;  3ZQC A;  4RGR A;  3GEZ A;  5E1W A;  5GPA A;  2FF4 A;  2E1M C;  2ISZ A;  2KZG A;  4ZYE A;  2XC7 A;  3WU1 B;  4G94 A;  5IOZ A;  1ENH A;  2LMD A;  2NYX A;  3GZ5 A;  1KQ9 A;  5L3B A;  5HLG A;  2YU3 A;  2BBY A;  1LDD A;  4E7H A;  3MN2 A;  3HPH A;  1IDY A;  3MVP A;  5FLM J;  1W0T A;  1XCB A;  1DUX C;  2E1C A;  5CQG A;  3GZ6 A;  1I3Q J;  2LRE A;  3QU3 A;  4JOM A;  1VQL I;  1USS A;  2I8D A;  5DS9 A;  2EA2 A;  2KIQ A;  1WJC A;  1IN7 A;  2KRH A;  1DGR M;  3Q9S A;  2HYJ A;  2XHK A;  2UXX A;  4M6V A;  1ON1 A;  3CQZ J;  3FXU A;  1JKP C;  3KEQ A;  4AC0 A;  3JRG A;  1Z91 A;  5D5W B;  1IW7 F;  2CUZ A;  2M30 A;  2VN2 A;  2WA0 A;  4DYC A;  5JHF A;  4M74 A;  2WC2 A;  1NK2 P;  2VJI A;  2XGE A;  4EJO A;  3JRE A;  2E1O A;  3IUO A;  2QUF A;  5ICG A;  4C9Y A;  3LSR A;  3HC7 A;  2O3F A;  3HDD A;  3BOQ A;  2ZME B;  5KHD A;  4HX4 A;  1CF7 A;  1ZRE A;  2JPC A;  5KCM A;  5FJ8 J;  1D8K A;  1I39 A;  2MH2 A;  2NAZ A;  3HOU J;  3AKZ A;  4MGR A;  4FE4 A;  1APL C;  4BJ5 C;  3G2B A;  1UCR A;  1XGN A;  2JZY A;  5D6F A;  2DMN A;  3HKZ A;  1EH7 A;  2KIF A;  2K40 A;  3IRR A;  5J1R A;  4HOB A;  2CV0 A;  1FYM A;  2STW A;  1TW3 A;  1R4N B;  4A12 A;  2ZKZ A;  5ICC A;  1B8I A;  2M3A A;  4CGZ A;  4DW6 A;  1W36 D;  3HG9 A;  5F6F A;  1PP8 F;  1UST A;  3GUD A;  3MZH A;  1QA6 A;  1J0R A;  3BCA A;  2M8E A;  3X2Q H;  4A3B J;  1Y0N A;  3L2R A;  4F93 B;  2LFB A;  3G1M A;  4KIC A;  5J1Y A;  2F5E A;  1F9N A;  2FA5 A;  3D5R C;  5D5U B;  4RM3 A;  2R5Z B;  2UUZ A;  2XRN A;  2JN6 A;  3D5L A;  3I54 A;  2CV2 A;  1F5T A;  3ZMD A;  4X6A J;  3GXO A;  1W0U A;  3OMY A;  4LIV A;  4L9N A;  1UMQ A;  4OAZ A;  3HEF A;  3OR1 C;  1WJB A;  3CP2 A;  5KNL A;  3OYF A;  3HOX J;  4XBF A;  3GZN B;  3EPZ A;  1VZ0 A;  4ETS A;  1HST A;  3T5X A;  3W6J B;  1IO2 A;  3FXK A;  3TL4 X;  4XRM A;  1J09 A;  3CDI A;  4LIT A;  3VSL A;  2E5N A;  2O8K A;  4D7N A;  1FOW A;  2PJP A;  2L54 A;  3N05 A;  3C2G A;  4GFB A;  1BR2 A;  3L2U A;  3S3N A;  1MJB A;  1UZC A;  4RB2 C;  3CUQ A;  1ZLK A;  2XF5 A;  5C4J J;  2EQR A;  3BG6 A;  2RAE A;  5HVQ C;  2MD5 A;  4CIC A;  1MH4 A;  2XKO A;  3VOD A;  4KT5 C;  2BE5 F;  4A3I J;  3QWL A;  4RAG A;  1ZH5 A;  2OBP A;  2ELH A;  3S8P A;  4DOZ A;  2A07 F;  2V1D A;  4M71 A;  2VOP A;  3FK7 A;  3BJ6 A;  1LJ9 A;  1ZG5 A;  3JW4 A;  4HF2 A;  1J2X A;  4JX5 A;  1FWZ A;  3KIO A;  3TDU C;  2E2H J;  2LNB A;  4YII A;  4B4C A;  4BQN A;  4KA4 A;  1KQ0 A;  3SZP A;  5CYV A;  3RJP A;  5TRD A;  4L9V A;  2CQX A;  3DWL E;  1TNT A;  2EBI A;  5IPA A;  2H1K A;  5AIP A;  3LSI A;  5F0C A;  1BI3 A;  1OLT A;  3V8K A;  3E5X A;  1GDT A;  2W57 A;  4YRV A;  3ABM H;  3PQJ A;  2VI6 A;  3O6B B;  3OR2 C;  3KET A;  3OY9 A;  1S3J A;  1XN7 A;  3I59 B;  2XGD A;  3JRF A;  1FIP A;  2IAI A;  5IOY A;  2NS0 A;  3CJN A;  3A4C A;  2BOL A;  2ECC A;  4Y4R A;  2ELJ A;  4I6Z A;  1T6S A;  3A01 B;  1DP3 A;  4ZTJ A;  3W3C A;  3HOY J;  2LH9 A;  2HVQ A;  3LSK A;  3K4B A;  3K0L A;  3ZP5 A;  5CVI A;  2EFP A;  2EA4 A;  4LGW A;  1D5V A;  2VIX A;  5BMZ A;  5KAI C;  2VJ5 A;  1BOB A;  2IBD A;  2L3D A;  3CJQ B;  2M45 A;  5K1Y A;  2W48 A;  1JUM A;  1F4K A;  5HDG A;  3HOT A;  1U9O A;  4P55 A;  4RA2 A;  4AYB N;  1T0F A;  4EM1 A;  3S15 J;  4GGG A;  1E3H A;  2GXB A;  2CMP A;  3ULQ B;  2NRA C;  2HQR A;  4CCJ A;  4M73 A;  1FNN A;  5A2Q Z;  3JRC A;  2LSO A;  3OS1 A;  3ZMT A;  4EM0 B;  1RKT A;  3HOV J;  4L5I A;  4IRI A;  3UR3 C;  3LAJ A;  4YFN F;  1LEB A;  3WGI A;  3S32 A;  3JRI A;  3GFI A;  2X6X A;  2PG4 A;  1RNL A;  4KUM A;  4OOI A;  4D5C A;  1FMV A;  4ZJZ A;  2UXN A;  2DFH A;  1PDN C;  3BY6 A;  1YJ9 I;  2RVC A;  1QGP A;  4P1W A;  2B0L A;  1LVA A;  3VPR A;  1J7K A;  2L5Q A;  3PJR A;  3M3Y J;  1JI8 A;  3G6E I;  3R4K A;  1R58 A;  2LOO A;  2XRO A;  2DW4 A;  5F0H A;  3SEZ A;  1ETQ A;  1GXQ A;  4RMN A;  5H2F C;  4PK4 A;  3IL2 A;  2PFB A;  3H9G A;  3WU2 C;  5L3F A;  4HRI A;  3R0J A;  1TWF J;  2R4G A;  4ESB A;  4U0W A;  1JTY A;  5C4X J;  4D1Q A;  1WFX A;  4M9S A;  1BM9 A;  5DUI A;  4DNC A;  2A6H F;  3P9I A;  3M4O J;  3PNY A;  3CTA A;  3OS2 A;  1QNT A;  5HLT A;  1T95 A;  5DTD A;  1SAN A;  2X6O A;  1R6R A;  1LFP A;  2PX9 A;  4FET A;  4MQV A;  2RGV A;  5E8I A;  3L2V A;  2EB7 A;  4LG3 A;  1XCV A;  2R7Z J;  2RNG A;  2R7W A;  4LLN A;  1BBY A;  3H5A A;  5FRM A;  2R5Y B;  4BEH B;  2EFO A;  5FRO A;  4DBR A;  4AIH A;  4ZDO A;  1IF1 A;  3ELK A;  3W6K B;  2PN6 A;  4CYC A;  2XSJ C;  2IS4 A;  2DXI A;  1WI3 A;  1HLV A;  1V4R A;  2XPW A;  4IHY A;  1Y8R B;  3H1C A;  1BIA A;  4MHG A;  4HDU A;  3HB9 A;  4WCG A;  3WG9 A;  2ME6 A;  3TQN A;  4BE0 A;  2NNY A;  3LSM A;  2JSC A;  3OYM A;  1ETW A;  1U78 A;  4B3A A;  4BBR J;  3MKZ A;  3G1L A;  2ZCW A;  4X1E A;  5DEQ A;  5TJJ A;  1K78 A;  4NC8 A;  3FXQ A;  3KYC B;  3CMY A;  3UKG A;  1TLH B;  2ZJ2 A;  3R61 A;  3GTJ J;  1Z3X A;  3BRO A;  2JVG A;  4IQJ A;  2QCO A;  2TDX A;  4HYE A;  1EH8 A;  3CUO A;  1IAW A;  1BR1 A;  4F92 B;  1OYI A;  4XLC A;  1TWA J;  3W2W A;  3OYJ A;  1OIS A;  2YSR A;  2CQN A;  5DCM B;  1VQP I;  1IN4 A;  2RN7 A;  1YW7 A;  2PLY A;  2DYR H;  3HL2 A;  2R7F A;  4EJW A;  2HU9 A;  3KCC A;  3GTP J;  3RTR A;  2XAJ A;  3VEP A;  2DA4 A;  3F8C A;  3RYP A;  4MQ9 F;  3F8M A;  2CV1 A;  2OV7 A;  1Q1H A;  3RDI A;  1HDD C;  1BW6 A;  3E6C C;  2W00 A;  1P4W A;  5TGT A;  3OSF A;  2WWY A;  2G0E A;  1T33 A;  3QYB A;  1UHS A;  1MIJ A;  5FD5 A;  4BAY A;  1Y0U A;  5E1X A;  1H9G A;  1E17 A;  1YO5 C;  2CUF A;  2LKP A;  1MSE C;  2V1U A;  3CCQ I;  4HDV A;  2XUB A;  4G6Q A;  1Y56 A;  1FZP B;  2DTR A;  1TQM A;  3MKY B;  2GIZ A;  2VOO A;  2M9H A;  4G6D A;  3TBI A;  1IRZ A;  3K70 D;  2R7U A;  4PGH A;  3GTL J;  2E5Z A;  4OIN F;  1ZRD A;  1T38 A;  1UAA A;  1AA7 A;  3SQN A;  2Y9Y A;  2L9R A;  2M34 A;  1MBH A;  5KK1 A;  1U0J A;  1DP7 P;  2BYV E;  2DMT A;  3WTU C;  3BTI A;  3V7R A;  1ZR2 A;  1FP2 A;  4MIM A;  4S05 A;  1F36 A;  1VI0 A;  5D8L B;  3KYL A;  1K4T A;  3GTM J;  2HXI A;  1XGM A;  5FKL A;  3ZQL A;  3K9T A;  2XAH A;  1IRF A;  2HYG D;  4XKV A;  5AIQ A;  3CCL I;  2BHY A;  1Z9C A;  1MMD A;  1KYW A;  3CJR B;  1STZ A;  2OA4 A;  1UEL B;  4P96 A;  4ZZD A;  3F3X A;  2KJC A;  1A36 A;  1QZE A;  3VYU B;  5CVR A;  5IT9 K;  5F1R A;  5ICE A;  4J19 A;  4OAY A;  3KP2 A;  3OYN A;  2BZT A;  2QKM B;  2OC6 A;  3ABU A;  1B72 B;  4XN3 A;  1VQ7 I;  3LSP A;  1GVJ A;  1JGG A;  3GFL A;  2K3F A;  3QYF A;  1U9N A;  4LIU A;  1Y39 A;  3FMR A;  3KP6 A;  5ED4 A;  1D5Y A;  1IN8 A;  3FXJ A;  4OIQ F;  2TCT A;  1YX3 A;  3DPU A;  3PO3 J;  4UUT A;  2EIM H;  2DK5 A;  3OYD A;  1UB9 A;  4TV7 A;  1DU6 A;  4L9T A;  1I1G A;  3MCZ A;  3M9A A;  2VXD A;  2NVY J;  2O8X A;  1S7O A;  3OIP A;  2W7N A;  4XSX F;  4M3E A;  3WTZ A;  3F21 A;  1SVO A;  2M5W A;  1FYL A;  2HDD A;  2M1B A;  3ZQ7 A;  3WE3 A;  3ABT A;  4QTR A;  3ZOB A;  2DBB A;  2NOG A;  2PMZ N;  3IRQ A;  3BG5 A;  4W97 A;  4CCK A;  4HNU A;  2BHZ A;  1MSF C;  4RGX A;  2JQ7 A;  3ROU A;  3K4L A;  2M8G X;  1U2W A;  3DPL C;  1IG7 A;  4EQQ A;  2DFE A;  5CKT A;  2E71 A;  1S9H A;  3TW7 A;  2QQB A;  1R1U A;  2M0M A;  2WBM A;  3AAF A;  2K27 A;  1VQN I;  4C30 A;  4A2U A;  1T56 A;  4ABZ A;  5FGM A;  1IJW C;  3IP4 B;  2QVO A;  1XSX A;  3KEY A;  2R7X A;  1FIA A;  3RPQ A;  2B9S A;  3PNT A;  3DEU A;  1B1B A;  4ZTF A;  1HKT A;  3AFH A;  3TOA A;  1HF0 A;  2HWV A;  4NB5 A;  2MBF A;  2QA4 I;  1QVT A;  3BPX A;  2A61 A;  3CUQ C;  3FKJ A;  4LJZ F;  3QQA A;  3BZC A;  4A3E J;  1ZK8 A;  4KJZ A;  1OCR H;  2LLK A;  2XAU A;  2ZME C;  3HGG A;  1EH6 A;  2DDB A;  1YFH A;  3E5U A;  4BBS J;  2ESH A;  3GLL A;  2D1V A;  2V1X A;  4IEJ A;  1V54 H;  2BGC A;  5EEA A;  3H0D A;  2VON A;  1JXS A;  1LVK A;  4IL6 C;  1MJA A;  1R00 A;  4KN7 X;  2OD5 A;  1TQI A;  1XSV A;  1ZLJ A;  4YFK F;  4M3B A;  3ONQ A;  2W85 A;  5H20 A;  1D3Y A;  1ZG3 A;  4JK1 X;  3F72 A;  4NQW A;  4AVP A;  1G3Y A;  2FD5 A;  3IH4 A;  2PEX A;  2X1D A;  4J01 A;  1CGP A;  2IS2 A;  2OTJ I;  3E1S A;  3SFZ A;  2NS8 A;  1OCT C;  4CYD A;  1NTC A;  2OF7 A;  3ECO A;  3DKY A;  2FBH A;  2RRE A;  3TDZ C;  2E35 A;  3HZJ A;  2V6C A;  5CLS A;  1W36 C;  2L7Z A;  3MZ8 A;  2DA6 A;  1JHH A;  2OZU A;  5E18 F;  2H6B A;  2VC0 A;  3DPT A;  3P5J A;  1K83 J;  2DFI A;  2GOM A;  3S3O A;  2CO5 A;  3CMA I;  4OMZ A;  3AG3 H;  4L9J A;  4XOP A;  2L7M P;  3ASO H;  4CXF A;  4HSR A;  5C44 J;  4XKW A;  2VBZ A;  3KP7 A;  1SMT A;  3CJT B;  2EIL H;  3PUF A;  2CQ7 A;  4II3 A;  3IV5 A;  2Y9Z A;  2L01 A;  1ORK A;  1ACI A;  3HUG B;  5CVU A;  2EZH A;  4BL0 B;  4M3F A;  2EZI A;  2YX7 A;  4MLO A;  5F04 A;  2L7F P;  3BR2 A;  4YEL A;  2DJI A;  2RQQ A;  2BVM A;  2GOX B;  4LG0 B;  4G7Z F;  1KU7 A;  1FY7 A;  2KLO A;  5EEG A;  1R1V A;  1OFC X;  2K9S A;  5FD6 A;  2F6C A;  1DGW Y;  4XLN F;  2H8W A;  3FXL A;  5AON A;  3IAS 2;  1A6I A;  1S7A A;  1V5E A;  2F5D A;  4A0Y A;  1DQU A;  1FOY A;  4C3I J;  4E6K G;  2HS5 A;  2V9V A;  4U0Y A;  4HNT A;  4Y17 A;  2P5L C;  3P7N A;  2XRL A;  4A69 C;  3OOU A;  3K6G A;  1SEU A;  1YRN B;  1GXP A;  5E8G A;  3VSK A;  1TP4 A;  1EJ9 A;  2KIM A;  4A0X A;  2BY0 A;  5JHU A;  3BR5 A;  4KIT B;  2OJE D;  2VJJ A;  1MNM C;  3KP5 A;  5FFX A;  1VQ5 I;  5DD8 A;  4NBQ A;  4KIB A;  3OYB A;  3ZRG A;  2LP0 A;  3EUH A;  4B3X A;  2YS9 A;  4XNF A;  2K86 A;  1I1S A;  2DT5 A;  2R7D A;  1CQT A;  5JLX A;  2BW3 A;  3REO A;  3HHG A;  3OYL A;  4PJL A;  5L3D A;  3T0Y A;  4UUS A;  2Z1D A;  3H36 A;  2IW5 A;  2E2I J;  1W7P D;  5IYB J;  2BVL A;  4BKX A;  3WTV C;  3P9K A;  3VYR B;  2W4S A;  1ZTR A;  3J81 K;  2H8R A;  1LE8 A;  2KPM A;  3HKZ N;  4HX7 A;  1T2K A;  4V19 K;  1W7P B;  3U2R A;  1O7F A;  5E1Z B;  1KU3 A;  1WJ5 A;  2IGO A;  4NC6 A;  3FHN A;  4PGG A;  1TWC J;  3NEU A;  2HOS A;  2VBW A;  1MZB A;  1DU0 A;  3BT9 A;  4QPO A;  1QRY A;  1R23 A;  5BPI A;  2LDU A;  3IWF A;  1S5L C;  3I3L A;  1N78 A;  3D1N I;  3OYA A;  1J59 A;  2EIN H;  3KZI C;  2RDP A;  4JX6 A;  4KT6 A;  4IXA A;  3RCO A;  3ZN1 A;  3PIP F;  1IXC A;  1V3F A;  1XS9 A;  3W6V A;  1B59 A;  4DJA A;  1EV7 A;  4E70 A;  2KMU A;  1JKO C;  1OYW A;  3FXM A;  1FOX A;  3KP3 A;  4BXF A;  4KIF A;  2DDA A;  4XLA A;  1GVD A;  3I4P A;  5J4V A;  4J00 A;  5HDN A;  4ZYD A;  4A3M J;  4M9Z A;  5KVR A;  3CCJ I;  4XR6 A;  5EGO A;  4BXU A;  2K3P A;  3B73 A;  1YX5 A;  1Z0X A;  1OCZ H;  4LFU A;  2OQR A;  1XD7 A;  5LLQ A;  3E6D A;  5DYM A;  3FM3 A;  4EM2 A;  2D5V A;  2JUG A;  1IC8 A;  2R0Q C;  2K5C A;  3H9Q A;  1KU9 A;  4ANJ A;  5J6X A;  4NDL A;  9ANT A;  1YW8 A;  3RQI A;  3A2K A;  4XON A;  5DDG A;  1AKH B;  2VKE A;  3HRT A;  3S1R J;  2B7E A;  3FWE A;  3K4M A;  2CUJ A;  4HF1 A;  1J9I A;  4DBQ A;  1PUF A;  4DZP A;  3W2V A;  3FK6 A;  4IZZ A;  3PO2 J;  1X1D A;  1AU7 A;  1WCM J;  2VOD A;  1WJF A;  2WAQ A;  1B9M A;  2E60 A;  4MEX F;  2WY8 Q;  2P81 A;  5J40 A;  2VT2 A;  2KHM A;  1BR4 A;  1IV8 A;  3DXJ F;  4I0A A;  2X51 A;  5EF6 A;  3LNQ A;  3DF8 A;  3COA C;  4HPQ A;  2HKO A;  4NC7 A;  4A0Z A;  3HRS A;  3C2B A;  4DIQ A;  3B6C A;  2QM3 A;  4C3J J;  2NVQ J;  4A3D J;  1Z7U A;  1A5J A;  1OKR A;  1T8I A;  1D0Y A;  4RGS A;  3VOE A;  3LQR A;  5JFR A;  2VQL A;  1H88 C;  1W5C C;  1WQ2 A;  2ZO4 A;  3IKT A;  2JUC A;  4BXX J;  3J7Z I;  2YUS A;  5J47 A;  1HA8 A;  3I9V 2;  1K4S A;  1P4A A;  1MD0 A;  2Y0M A;  1ITY A;  1VQ8 I;  3QU6 A;  3AL0 B;  1D1A A;  1MGT A;  4L18 B;  3S93 A;  1X19 A;  2VLA A;  4M9X A;  2NVX J;  3HSF A;  5ILV A;  3T8R A;  2CW0 F;  2ZME A;  4C2U A;  1LFU P;  5EG0 B;  3ZN0 A;  2BY2 A;  2FQ4 A;  3NAR A;  2LBF B;  1H9T A;  2Q0O A;  3ZMU A;  4MO7 A;  2VJ4 A;  3S16 J;  4EGZ A;  3CMM A;  4BHC A;  4BU2 A;  4A3J J;  4CDG A;  3AG1 H;  5FKN A;  3OL3 A;  1TT5 B;  1BA5 A;  2ECB A;  1S6L A;  4A3L J;  4Y33 A;  4PZJ A;  5E3N A;  3IHU A;  2AQE A;  3MAJ A;  2KIS A;  4ENN A;  3BP8 A;  2HQ5 A;  3CLQ A;  3RPU D;  1E2X A;  2DCE A;  2VQG A;  1ZGA A;  3EDP A;  1HDP A;  2PMU A;  5CJ9 A;  1FJL A;  1G3W A;  3H0G J;  4QPQ A;  2XAF A;  2XKP A;  4BYY A;  4LK1 F;  2D2W A;  1YIJ I;  2R5Z A;  2MC3 A;  2MYS A;  2YPR A;  4RB0 A;  3L2Q A;  2HPM A;  1I27 A;  1R36 A;  1Z1D A;  1FOK A;  2FOW A;  1TZL A;  4UV8 A;  2WY7 Q;  2CUE A;  2UV1 A;  4M6X A;  4R8H A;  1SVM A;  4UVA A;  1ETO A;  4DQ2 A;  5LGN A;  1V5F A;  3H3Z A;  3RQ4 A;  2OU2 A;  1UG2 A;  2AO9 A;  4P9U A;  1YW9 A;  2GIV A;  4D0P A;  3S1M J;  2EIJ H;  1FLI A;  2QSF X;  2P4W A;  2H6C A;  2YR2 A;  4M3G A;  1ETY A;  3OV8 A;  4PFO A;  4AIK A;  2HZD A;  4ENJ A;  2V7F A;  2P7V B;  2E2J J;  5DCF A; 
#chains in the Genus database with same CATH homology
 4F3Q A;  3QYB A;  1PYV A;  3K4J A;  4BJ6 C;  3QOE A;  2V1N A;  4Y3O A;  4AVZ A;  2E1M B;  3VDX A;  3CES A;  3W2A A;  3S3M A;  3LMM A;  3OIQ A;  2X85 A;  3TMO A;  1Y56 A;  3ZQQ A;  3MKY B;  2ZXI A;  3TBI A;  3K70 D;  2R7U A;  2PMZ A;  5LD2 C;  4IX7 A;  2E5Z A;  4BE1 A;  1UAA A;  1AA7 A;  3DLA A;  3HXL A;  2KDO A;  2KQR A;  3VYT B;  1U0J A;  1WJD A;  4XL9 A;  1G59 A;  2BW3 B;  1WJE A;  3DU5 A;  4RM2 A;  2VKD A;  4E7I A;  4PSW A;  3KYL A;  2X6W A;  2V26 A;  2IS6 A;  1X4O A;  1IRX A;  4NUB A;  4XKV A;  1QHH D;  4DGW B;  1MMD A;  3CJR B;  4ZC3 A;  4ZYA A;  1UEL B;  1NG7 A;  3VYU B;  2KZV A;  2HPI A;  4OAY A;  4H4K C;  4XOT A;  4HG2 A;  3OYC A;  3OYN A;  2P0W A;  4II2 A;  1MNE A;  2QKM B;  2MAB A;  3BCB A;  2OC6 A;  2KRC A;  1D1C A;  1T0F C;  4XN3 A;  1MW7 A;  2V9K A;  3GBG A;  1P9Q C;  4HEA 2;  3QYF A;  4LIU A;  3H5R A;  3ZR8 X;  4XLE A;  3M1C A;  3K4K A;  2DT6 A;  1YX3 A;  2X1E A;  3DPU A;  1QHG A;  2A5W A;  3SDB A;  4CH7 A;  1NG6 A;  3ZGK A;  3OYD A;  1X1A A;  4FAS D;  1MMG A;  2HDW A;  2VXD A;  2A6T A;  3OIP A;  4D9J A;  2W7N A;  3OYI A;  4EAT A;  2VB6 A;  2K9L A;  3DTE A;  4JQF A;  4CCK A;  4CSW A;  4U87 A;  4HNU A;  2OUM A;  3K4L A;  1UG0 A;  3DPL C;  4E7Z A;  3H35 A;  2V4J C;  2F4I A;  2ZXH A;  2DOA A;  2MD0 A;  5CKT A;  3EUK L;  4BGD A;  5LFA A;  1YE9 A;  2MFZ A;  2Z16 A;  3OYE A;  1S9H A;  2F5V A;  3VYS B;  4PJM A;  3ZCO A;  1MMN A;  2M0M A;  2WBM A;  2HVS A;  4C30 A;  2HNH A;  2M7A A;  3K10 A;  2XF7 A;  3IP4 B;  2VKH A;  3K4C A;  3KEY A;  1EA3 A;  2R7X A;  4CZC A;  2CFO A;  2E1M C;  3PNT A;  2VQH A;  5HNH A;  2XC7 A;  4ZTF A;  1LDK B;  4BS9 A;  3AFH A;  3NWT A;  4XLF A;  4R79 A;  3BC8 A;  4XKC A;  4E7H A;  3FKJ A;  3EUH C;  4KJZ A;  3PNV A;  4IKF A;  2XAU A;  3HPH A;  3PFY A;  3K70 C;  2LYC A;  4PJN A;  4OWR B;  2PJR A;  3K4N A;  5CQG A;  2LRE A;  4JOM A;  2IGM A;  2I8D A;  3H0D A;  1WJC A;  4BEH A;  1LVK A;  2KRH A;  2CW8 A;  1LKX A;  1DGR M;  3OYK A;  3ONQ A;  2WAD A;  4E4H A;  3LSG A;  2LBF A;  4J01 A;  2X1D A;  2CUZ A;  2WA0 A;  2IS2 A;  1E0E A;  5JHF A;  2L7K A;  3E1S A;  2VJI A;  1KON A;  4N4O B;  3IUO A;  4C9Y A;  3HC7 A;  5KHD A;  3DKY A;  3LSH A;  2RRE A;  5KCM A;  2L9N A;  2LC2 A;  3FBN B;  1W36 C;  2QKL B;  3AKZ A;  3DPT A;  2GOM A;  4BJ5 C;  3S3O A;  4PFP A;  3U21 A;  3G2B A;  1Z7L A;  4F52 A;  4BQQ A;  4XOP A;  3HKZ A;  4HSR A;  4XKW A;  4E7J A;  4II3 A;  1TT0 A;  2CV0 A;  2Y0S A;  3HUG B;  3KX2 A;  2M3A A;  4BL0 B;  1W36 D;  3HG9 A;  3E0J B;  3FDY A;  4E7S A;  4MLO A;  3BCA A;  3IAM 2;  2M7B A;  4YEL A;  2DJI A;  2RQQ A;  2BVM A;  2GOX B;  3BG7 A;  3OL4 A;  4CUG A;  3H9J A;  4F93 B;  3L2R A;  2M4K A;  2KLO A;  2XDV A;  2Q2E B;  2F6C A;  1DGW Y;  2X6Y A;  1Y6I A;  3D5R C;  4RM3 A;  2CV2 A;  2UUZ A;  3D5L A;  3IAS 2;  1V5E A;  3OMY A;  4LIV A;  5CPR B;  2IS1 A;  4OAZ A;  2ZFU A;  1DQU A;  3OR1 C;  1WJB A;  3CP2 A;  5KNL A;  3OYF A;  2K9M A;  4E6K G;  4BDY A;  3EPZ A;  1VZ0 A;  3V42 A;  4HNT A;  2HQA A;  3C2H A;  4B43 A;  3TL4 X;  1J09 A;  3OOU A;  3VSL A;  3K6G A;  4LIT A;  2E5N A;  4C2T A;  3VSK A;  2W1O A;  4NNJ A;  3N05 A;  3C2G A;  1BR2 A;  4RLQ A;  4KIT B;  3L2U A;  3S3N A;  2PJR B;  1WJA A;  2VJJ A;  4XLH A;  4AYB A;  4CCO A;  2XF5 A;  3BG6 A;  2DT7 B;  3ZRG A;  3OYB A;  4KIS A;  4B3X A;  2WB1 A;  5HVQ C;  4XNF A;  3SZG A;  3PUB A;  2VAS A;  3FBI B;  3DQV C;  2BW3 A;  3OYL A;  2AQF A;  4PJL A;  3S8P A;  4CCL A;  4DOZ A;  2Z1D A;  1Z3Y A;  2UWM A;  4B48 A;  3A1Y A;  2BVL A;  3RSN A;  3VYR B;  4BQN A;  2W4S A;  4B44 A;  2VPL A;  2KPM A;  4CCM A;  1GLN A;  3DWL E;  1K6Y A;  1WJ5 A;  2JA2 A;  3LSI A;  2IGO A;  3MD2 A;  1OLT A;  3FHN A;  4N4N B;  3HOS A;  2VXZ A;  1PJR A;  3OS0 A;  3DKX A;  4IQ4 A;  4YRV A;  4QPO A;  3OR2 C;  3OY9 A;  4BAC A;  3M8J A;  4XMY A;  1N78 A;  3I3L A;  3A4C A;  2VL8 A;  2WAE A;  3OYA A;  2BOL A;  4KT6 A;  2L9S A;  4Y4R A;  3RCO A;  2ELJ A;  1MMA A;  4DJA A;  1DP3 A;  4ZTJ A;  4P5O A;  2KMU A;  3W3C A;  4BXF A;  1ZEL A;  2LH9 A;  4XLA A;  2HVQ A;  3LSK A;  4J00 A;  4YEJ A;  3K4B A;  4XR6 A;  4BUP A;  2K3P A;  1YX5 A;  2VIX A;  2VJ5 A;  1BOB A;  3PSI A;  2R7V A;  4XOR A;  3CJQ B;  3L2W A;  3HOT A;  4PUS A;  2LY1 A;  2JUG A;  2ZSI B;  2K5C A;  3H9Q A;  5CQE A;  3OYH A;  4ANJ A;  1QU3 A;  2CMP A;  2R7Q A;  3OYG A;  3VWB A;  4G6T B;  4CCJ A;  3A2K A;  4XON A;  4E7K A;  2Z2S B;  4BQO A;  3OS1 A;  4ZDL A;  1OR7 C;  3DTK A;  2HVR A;  3K4M A;  2IGK A;  1X4P A;  2CUJ A;  2R7O A;  3UR3 C;  5HNF A;  3S32 A;  1D0Z A;  4DBQ A;  4ZDP A;  2CH0 A;  2X6X A;  4X0G A;  3H5N A;  1FMV A;  3W2V A;  4ZJZ A;  4IZZ A;  1X1D A;  4F91 B;  3MMY B;  4XM3 A;  2R7T A;  2V6E A;  1WJF A;  2WAQ A;  4P1W A;  2E60 A;  2WY8 Q;  2KHM A;  1BR4 A;  2X51 A;  3AL0 C;  3F9K A;  3CF2 A;  2WAF A;  3PL8 A;  2L5Q A;  4ITV A;  3PJR A;  4HPQ A;  1JI8 A;  4NC7 A;  1D1B A;  2MC4 A;  2VQC A;  2LOO A;  4DIQ A;  3BLY A;  3SEZ A;  2NOJ B;  2XF6 A;  4XQF A;  4RMN A;  2JVH A;  1SAU A;  4PK4 A;  3ZXS A;  1SFK A;  3H9G A;  1D0Y A;  3SYT A;  4HRI A;  2R4G A;  4BDZ A;  3OWT A;  2VQL A;  4D1Q A;  3LL7 A;  1WFX A;  1MND A;  3PNY A;  3OS2 A;  3D5S C;  5HLT A;  1T95 A;  1HA8 A;  3I9V 2;  1R6R A;  1LFP A;  2LY2 A;  2IXS A;  4FET A;  3L2V A;  4LG3 A;  2X1C A;  4E7L A;  3AL0 B;  1D1A A;  2RNG A;  2R7W A;  5FRM A;  3H5A A;  3S93 A;  1X19 A;  3NWS A;  4RLF A;  2VLA A;  4BEH B;  1G8X A;  3LFU A;  2KL4 A;  5FRO A;  4DBR A;  4ZDO A;  4C2U A;  2LG4 A;  4NQW B;  3DU6 A;  4B47 A;  2LBF B;  3J7A Y;  2XSJ C;  2IS4 A;  2DXI A;  1V5G A;  1D0X A;  2VJ4 A;  1ERD A;  3DTI A;  2CW7 A;  3EUA A;  4XKB A;  4BE2 A;  3CMM A;  3UNG C;  4BU2 A;  2W82 A;  3QYE A;  4PSX A;  4XN0 A;  4AU7 A;  3OL3 A;  4BE0 A;  5FRN A;  3LSM A;  2KP6 A;  3OYM A;  3CP8 A;  4F55 A;  2R7S A;  4Y33 A;  4GRI A;  2AQE A;  1X1C A;  2CS3 A;  2ZSH B;  3QOD A;  3MKZ A;  2JSP A;  3DEE A;  3RPU D;  4NC8 A;  2L2O A;  4HST A;  2DCE A;  2VQG A;  3SEQ A;  1X1B A;  1Z3X A;  2Q1Z B;  4BJT A;  4CA0 A;  2JVG A;  4QPQ A;  4IQJ A;  2M4G A;  1BR1 A;  4F92 B;  2MYS A;  4XLC A;  3L2Q A;  3W2W A;  3OYJ A;  2HPM A;  1FMW A;  5HOO A;  1TZL A;  2WY7 Q;  3PSF A;  2R7R A;  4U7B A;  4CCN A;  2UV1 A;  3CZ6 A;  3MKW B;  1Z21 A;  3HL2 A;  1N75 A;  2HU9 A;  3RTR A;  1V5F A;  3HPG A;  3RQ4 A;  2O5R A;  2CV1 A;  2LRD A;  2OV7 A;  1N77 A;  4PJJ A;  2W00 A;  4PFO A;  2HZD A;  5TGT A;  2IGN A;  2V7F A;  2FUG 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...