2JSPA

The prokaryotic cys2his2 zinc finger adopts a novel fold as revealed by the nmr structure of a. tumefaciens ros dna binding domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLGQRRKANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein ros
publication title The prokaryotic Cys2His2 zinc-finger adopts a novel fold as revealed by the NMR structure of Agrobacterium tumefaciens Ros DNA-binding domain.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Gene regulation
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1550 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jspA01
2JSPA
chains in the Genus database with same CATH superfamily
3SDGA 4XLEA 5L3EA 1JT6A 4B47A 2WB1A 3OS2A 1KU2A 3LSGA 1MMAA 2RVCA 4DOZA 2LKPA 1YW7A 3NQOA 3C2BA 2P5VA 3BP8A 3BTCA 2L02A 4U0VA 3V8LA 3FWEA 3ZQQA 1WJCA 3F8CA 5IYBJ 1Z6RA 1UZCA 4IHSA 3CDLA 4RB1A 3IRRA 1F4KA 3GXOA 3T0YA 4Y3OA 2O7OA 3DKXA 5BPDA 3KLNA 3WGHA 5D5VB 1R23A 4KMUX 2LSOA 4B4CA 2NOJB 2GZWA 2RNJA 4LD5A 3K1MA 2BVLA 2EINH 4MIMA 4BS9A 5K5QA 1RUOA 5E8IA 4FX0A 2OZUA 5HDGA 1OCZH 1A04A 1S7EA 2CUJA 3F9KA 2VC1A 1Y0UA 5FD6A 3R4KA 1ZR4A 5LEKA 1LKXA 3F3XA 3KYCB 2X0LA 3LOCA 4EJWA 3EUAA 3IWZA 3FXLA 1S7OA 3TKYA 1QRYA 2KJCA 1WJFA 3OYFA 2DA3A 1MBKA 2WV1A 4MTDA 2K02A 1TWFJ 3KEYA 4I7HA 1KZHA 1JGGA 3LQQA 1R9TJ 3TEDA 1LVKA 2O8KA 3HSEA 3HKZN 1QPMA 5D6FA 4E7KA 5CVVA 3RIRA 1HSTA 1RESA 1YOVB 2JVHA 2KRHA 5ICCA 2Y31A 1M1EB 1OPCA 2DAOA 2PFBA 2QENA 4GFBA 2WAFA 2IA0A 2O61A 1BI2A 4JP0A 2E2HJ 3G73A 3ERED 4ON0A 2L7ZA 2XGCA 2R5YB 3ABMH 4CYDA 1S7AA 1BOBA 1MH4A 1U2WA 3S1NJ 4A12A 3AFHA 5LGUA 4XORA 4EJOA 1FBSA 3WTSC 2PI0A 3G4SI 2I8DA 1N77A 1H9TA 3Q9SA 4M71A 4OAZA 4HLXA 2V6CA 5D6EA 4CUGA 2IA2A 5FKOA 4AC0A 2VOPA 1T98A 3WTUC 3ZR8X 1QZYA 3MFKA 2VQHA 1XGSA 2XV4S 2LYCA 4PCQA 5DM7F 4IPAA 2XKPA 2LF8A 2HOSA 3ZQCA 2GWRA 4G6QA 4V2FA 1STZA 5IOZA 1WGXA 1D1BA 2DA4A 2F5VA 2K3PA 2WADA 2KISA 3QPHA 3DFGA 2E36A 4Y15A 1IV8A 1YW8A 2ZSIB 1A6QA 2TRTA 1RRJA 4DNCA 2XASA 2MSYA 2KZVA 2I10A 4XMYA 3SEQA 1JUSA 2HFHA 4HAMA 2O5RA 3E6BA 5CLSA 4ZC3A 1MDMB 4E7IA 1QVTA 4EV0A 2FMYA 1EF4A 3WODF 5L3DA 2BV6A 4RAZA 5EZGA 2K9SA 2TCTA 3HIFA 2IVMA 4MEYF 3U1KA 3OL3A 4D5FA 3BZ6A 3PUBA 1FBUA 3S2HJ 1R36A 4A3KJ 3RQIA 3K4BA 4ZZLA 2OQRA 2JK3A 4TV7A 2RN7A 3KP5A 1G3TA 3ASOH 3ZQFA 4UXNA 5DYMA 1R6RA 4Y33A 3F6OA 2R0QC 1J75A 2JVGA 2QVOA 2MA3A 3IAM2 1EJ9A 4WXDA 2EZIA 5FLXZ 4LITA 4KA4A 2F6CA 2Q0OA 4YFXF 1FZPB 4ZYDA 3WTZA 1MW7A 2VXDA 1X58A 4IOCF 1X3WB 3HOYJ 4CCNA 2XUBA 4B48A 2NVQJ 2LMDA 1X1BA 4BL0B 2HDCA 2KRCA 5B66C 2Y2ZA 1BN5A 2EA4A 2HI3A 5KAIC 5C44J 1WJBA 5JI6A 4CO8A 3C1DA 1D5VA 1IV6A 3ASNH 4IRIA 1YLFA 2BXZA 1Y8RB 1O3RA 3RDIA 1LFPA 4BQNA 1L3LA 2EFPA 1P4AA 2Y0SN 1YS7A 3KP7A 2K7LA 3FK7A 2X4HA 2M2EA 4AUXA 2BHYA 3IWFA 4E7SA 3D5SC 4N0BA 3WHCA 4ZTJA 3WU2C 3TO9A 2HS5A 5B1BH 5D8LB 3HL2A 4EQQA 4DYQA 3RKYA 3I4NJ 1MH3A 2Z9OA 1J0RA 3AL0C 4XICA 1WKMA 1X1AA 3E3VA 2FBIA 4HA8A 4UUSA 2EIMH 4JX4A 3K4LA 3J7AY 3FHZA 3E6DA 5K5RA 5BS6A 2HQRA 4WK8F 4G6DA 1B1BA 5DS9A 5HS7A 5EJCA 1RC9A 2K86A 4L5JA 1BJAA 3CF2A 3ZMZA 2HU9A 3L00A 1XGMA 2HTSA 2P81A 3U2RA 2DCEA 1ETXA 4BQQA 1BI1A 3BR0A 4P55A 1MSFC 3FMSA 2PBIA 1MMDA 2NNYA 3H0GJ 4G6TB 1F1ZA 1B72A 5BNGA 4XNFA 4D5CA 4DW6A 1G3YA 2QGUA 1JHFA 3OYMA 3TP0A 1JKPC 2BOLA 2QLZA 5HLHA 3ECHA 1XGOA 2BY3A 2R7UA 4ZDOA 3EQLF 4M72A 5CKTA 1U9NA 3SYTA 1TWAJ 2L7MP 2RQQA 2EK5A 2X48A 1AHDP 1JT0A 3S1RJ 2A5YB 1Z0XA 3LSPA 1DDNA 2H6BA 1IRZA 2L9VA 5FLVA 4AVZA 4XKBA 2GXBA 1LFUP 4KN7X 3COAC 1T2KA 1AU7A 5LRSA 3ABUA 2FEZA 3HRTA 3G71I 2E5NA 4I0AA 4KIGA 2L5QA 4BJ5C 2LNBA 1MIJA 2DTZA 2IPQX 2DA7A 1LJ9A 1W7PA 5CYVA 1Y1WJ 3C2GA 3HSFA 4ABZA 1MMNA 3OWTA 3F6VA 1N75A 1XDUA 1KYWA 4DGWB 3PSIA 2JTVA 3E5QA 2X1CA 2A5WA 4HG2A 3V7RA 2XPUA 3CMYA 1DU6A 4A2UA 4B1RA 2KJBA 4BJ6C 4D0PA 1ONVA 2NVTJ 2UWMA 2K9NA 2XDVA 1W0UA 3A2KA 3QWLA 2VJ4A 1U78A 5FO5A 1LDJA 2E7XA 1HDDC 3CUOA 4HF2A 1G6NA 1USTA 2E35A 2ZJRF 4KUMA 1LFBA 5J40A 1R71A 2ID3A 3TGNA 3KZZA 1NK2P 3IL2A 4EEFG 2XAQA 3WHBA 5B3SH 2FOKA 5DUKA 3BJ6A 3LFKA 4HLYA 1UCRA 2MGQA 3JRIA 1E3PA 3RPUD 2CMPA 3OYAA 1Z21A 3OOPA 3RKWA 2BGCA 4C9YA 5ICEA 2M30A 3HC7A 3R0JA 5E1WA 4QSHA 3HOVJ 2ZKZA 1H9GA 2DTRA 1K6OA 2M0MA 3I55I 1KONA 2H1LA 3O2PE 4W97A 1E0EA 1KQ8A 5F64A 4ASNA 2DW4A 1OCTC 3QYEA 1TWHJ 2X1DA 1XB4A 5LHGA 4C2TA 1WI9A 4JX5A 5FLXK 2A61A 1AKHA 3ZQGA 1Y56A 1P7IA 4EJVA 4EMSA 2JRTA 3MWMA 4RA2A 1I27A 1MZBA 2G7HA 1LQ1A 1GVJA 2BEOA 2QEXI 3M4OJ 1ENHA 1JTYA 4ENJA 3ABKH 1ZAOA 4PGGA 1J09A 1UB9A 2V9KA 4RB0A 2LH9A 2JT1A 2CS3A 5ERIA 4DBRA 1EA3A 2EZHA 1DU0A 3KZYA 3E7LA 4HQMA 3QOEA 1BR1A 3AG3H 3ZN1A 3KIOA 2L0KA 2R92J 1A36A 1YX5A 1RNLA 1WH7A 3WTTC 2Y69H 3JSPA 3VYTB 1MMGA 2XB0X 1OYIA 3JW4A 1OCRH 4CZCA 4JOMA 4XM3A 3SZGA 3GTJJ 3HBLA 4AVPA 1O3TA 1LNWA 3C2HA 2JRMA 5LEJA 2MC3A 3F8FA 2GM4A 2ICWG 3FMQA 3QQAA 4OIPF 2ZO4A 4H4KC 3CC2I 1QQIA 1T0FC 1HSJA 4CICA 3I58A 1HKTA 3JTHA 3CC4I 1ZLKA 2RC4A 2PLYA 2LG4A 4Q4ZF 2GQQA 2DMNA 4BE0A 1MNEA 1WJAA 1X1PA 2QA4I 1Y6IA 3BROA 2CFXA 3E6MA 2EA2A 4HNTA 2EBIA 4EJTA 4B43A 2VI6A 1B59A 5M3MJ 3QAHA 2VN2A 1R00A 1ERDA 1TQIA 2A05A 2M7AA 5TJJA 3RYRA 4YG2F 2W7NA 2DT6A 3R0AA 3IRQA 3G6EI 2L7KA 5J1RA 2RQPA 1O7FA 3FXRA 2L3DA 3MKZA 4MEXF 3RCOA 3KEQA 3LA3A 3QYFA 2G9WA 2QQ9A 4XK4A 3S8PA 3WG9A 5ED4A 4BNCA 4M3GA 4XLNF 2FE3A 4F93B 1NG6A 3FZVA 2J5OA 2V4JC 3M07A 3DPTA 4DJAA 4LLNA 1IXSB 2FU4A 2Z33A 2R93J 1P4XA 2YPRA 5FKLA 1H8AC 1T6SA 3AG1H 1DGWY 1IO2A 3GFMA 3V4GA 2HQ5A 2VBWA 4F92B 3C7JA 3H3ZA 1QO0D 4FCYA 2NS7A 5IP7J 3KE2A 1IC8A 5LHHA 4M6XA 1W5SA 4P1WA 5M5WJ 1UELB 3V8JA 1Z7UA 2HYFA 4CCLA 4KNYA 3E5XA 5IYDJ 1SD7A 5BMZA 5LRRA 1KU7A 4XOPA 1TL8A 1SFOJ 2LOOA 2BY2A 4KYWA 2CQ7A 1U8BA 4NC6A 2L9SA 3FM3A 2ECCA 4A3IJ 4UV9A 2R7QA 1FEXA 3JRGA 3DKWA 3PFIA 4IX7A 4XLFA 3OYBA 1MNDA 2HYJA 3DEEA 2X6WA 3CF5F 3JRBA 2V9PA 3GMEA 3AKZA 3M8FA 1XGNA 2GXAA 2MYSA 1A35A 3CDIA 2XAJA 4XL9A 2M4KA 1FOYA 2CW0F 1EH7A 2LDUA 2VT3A 4XKCA 3TOAA 1QPIA 1YS6A 3GFIA 1ZN2A 2DA1A 4KIFA 3L7WA 2LFBA 5HVQC 2YS9A 2B63J 3GO5A 2WBMA 4KJZA 3ZMTA 2CH0A 3QRFF 1W4MA 3MD2A 4B3XA 3DF8A 2M0CA 1Z77A 1D5YA 1J9IA 4R79A 2OPTA 2QYOA 4NQWB 4PFOA 2RREA 4GRIA 5E3OA 4P9UA 4FETA 4DIQA 1NH3A 5IPAA 3GCMA 3QPSA 1UG2A 5BOXA 2FOWA 4DYRA 1R4NB 3GF2A 1TW2A 2JMWA 2WC2A 1TNSA 2O8XA 3L2UA 3K4KA 3I4PA 4UB6C 2R5ZB 1O57A 2QWWA 1YTYA 3WTVC 4DQ2A 2HKOA 2M1BA 1ITYA 4EM1A 3HOSA 2NOGA 2OTJI 2OA4A 4MTEA 4M9ZA 5HODA 5AIQA 4OIRF 1R58A 2HVQA 3CMEI 1BIAA 1YIJI 3SFZA 1BJZA 1WPKA 2ZJPF 1I5ZA 3EYYA 3KLOA 3JAMZ 1T33A 1YE9A 3CUQC 2GOXB 2AQFA 4UUSB 2QKMB 4HNVA 3FDYA 2STTA 3OIQA 3B73A 5FFXA 2V6EA 4A3GJ 5GP9A 1ON2A 2CU7A 4BYYA 2QQAA 2BY1A 1X3ZB 3W3CA 4PSWA 4PJNA 5FGMA 3T1BA 4IKFA 3HOUJ 3IC7A 1Z7LA 2FRHA 3H5AA 1K7AA 2L9RA 2NRAC 3CC7I 4E7JA 1MMSA 4RLFA 2X51A 4LJZF 4LG0B 1SANA 3K1PA 1KQ9A 4MQVA 3T5XA 5K1YA 5DEQA 2EFWA 1ZTRA 1AWCA 2ZXJA 1B72B 4BXFA 1T8IA 1IW7F 3LA2A 2WB1N 3LFUA 4IVNA 1ETQA 3OS0A 2KRFA 2XF7A 5FB2A 3FXOA 2HTJA 1A5JA 3A01B 3TBIA 3TW6A 2R7OA 5ILSA 3LL7A 1K4TA 3K70C 2HNHA 3HEFA 2HVSA 1F43A 4FE4A 3QP6A 2JSPA 3P5JA 4C3HJ 4KT5C 2OBPA 4YIRX 3DCFA 2DN0A 1FYKA 2E1CA 4I2OA 1BL0A 1D8JA 3R61A 1E2XA 4I02A 6PAXA 1VZ0A 4LK1F 2V1NA 3DBLB 1O3SA 4F52A 3A0HC 4MFEA 1I39A 1G59A 4KFCA 2VKVA 3CJNA 4B09A 1KQ0A 1W7PB 1UAAA 4UUVA 3H35A 3D1NI 4Q47A 2W00A 4BEHA 1LPQA 3DPUA 4G7HF 1RIOH 3BJAA 2CQXA 3PO3J 1IN7A 2VIXA 1HA8A 3K2ZA 4XRFA 3J7YJ 1TZLA 5CVUA 3RPUA 3ERMA 1V54H 1I1SA 2R7SA 1WRJA 3VYSB 3N4MA 1ZRFA 2DOFA 5FJ8J 3BG7A 2DA6A 2VKHA 4MO7A 5EZHA 1FIAA 5B5EC 1TNTA 1YJWI 1O7LA 1ZYRF 2H8WA 2VJJA 1RPWA 1SD5A 2MG4A 4PGHA 2XPVA 4BU2A 3H0DA 3FKIJ 3MQ0A 5JHUA 1G3SA 3GBGA 5B1AH 2HR3A 1WH5A 3S2DJ 2M3AA 1GV2A 2DOEA 3E97A 2XF5A 4O5VA 5HLIA 2ADUA 2DFEA 3CLQA 5DCFA 2PMZA 2GXGA 3BLYA 3EDPA 2CV1A 4Y13A 1FMVA 1B8IA 2QM3A 3AAFA 2BHZA 4F55A 4E7LA 2XSDC 3CJRB 1R5HA 4GGGA 2EFOA 1OFCX 3CCQI 1VQ5I 1QBJA 2QF7A 5GAEJ 2WY7Q 2DXIA 2CW7A 5J8FA 3DLAA 3HTSB 2K27A 2DOAA 2L54A 2MFZA 2B9SA 1QVUA 2D45A 1AKHB 1YJ9I 2P6TA 1FYMA 3OYNA 1Z6TA 4I6ZA 1K83J 2OAZA 1MBEA 3DQVC 1H89C 4ENKA 4CSWA 3ZCOA 3K70D 1WJDA 3LSKA 3HZJA 4NB5A 2JSCA 3QODA 1VNDA 5GAGJ 2PJRA 3H9GA 2XAGA 3OOUA 1D0XA 2FSWA 4EATA 5K7FA 1FSEA 4BDZA 1FBQA 2FX0A 4OIQF 1VQ6I 5AONA 2PG4A 2VPLA 3QPTA 4ZYHA 5ICGA 1K79A 1MJBA 4RMNA 2XHKA 2ELJA 3BZKA 3GW2A 5FRMA 3ONQA 2MW8A 4P9FA 1R1UA 3CJQB 1FP1D 1E3HA 3ZMVA 1IDYA 3P7NA 4QPOA 3CCEI 5CJ9A 2GA1A 2NNNA 5FD5A 5HS8A 3G3ZA 1J7KA 5DV5A 2LBFA 3I3LA 3V42A 2CQKA 3MKWB 2WY8Q 2XAHA 5E3LA 3WE3A 4PJMA 5DM6F 1XX5A 3JRFA 1VQ9I 3ZQHA 1GUUA 2O9LA 1ACIA 2F2EA 1S5LC 3JAMK 1RR8C 2XGEA 4YRVA 3V7SA 2A07F 1HDPA 2HZTA 2XGXA 2P5KA 2QSHX 1FOXA 1EH6A 1I3QJ 1WWXA 3H92A 2K9QA 3HPHA 1HF0A 5EYRA 1YW9A 4U0WA 3IV5A 1XC5A 2QZ8A 2DI3A 4KT6A 4FASD 1UHSA 4A0YA 1FPQA 2IGNA 2XC7A 1LB2A 3PUFA 4XLCA 5EEHA 1U3EM 4OWRB 1Z67A 3O3KA 3OYEA 3LNQA 4MGRA 1JE8A 4A3EJ 1BIBA 1NK3P 4A3JJ 3PFYA 1IN5A 3MZYA 3BG6A 5F27A 2E19A 2E1MC 1EV7A 1S3JA 1X4PA 3W6KB 4G12A 4YELA 1VQOI 3TDUC 2JPBA 2MD5A 3CCVI 2DODA 3IKTA 2HQNA 2DFIA 4XN3A 1APLC 4XIDA 1V5EA 2MLKA 5KCMA 1HOMA 1S9HA 3A03A 2OV7A 3N05A 5C4JJ 3JTGA 2BE5F 2I5UA 2NS0A 4HSRA 5K7ZA 2L4MA 2KDOA 5TISC 3M8JA 5E3MA 5IP9J 4OOIA 2CYYA 5GAHJ 3LSHA 4J01A 4PJ0C 3HG9A 1T0FA 1P4WA 3DPLC 1WHUA 3MZHA 4GDFA 2COBA 2WTEA 2KPMA 4M9XA 5D5XB 4LIUA 4J19A 2XKOA 4XR6A 3DP7A 3H3UA 2Z99A 2HDWA 1JKRC 3JRAA 3AG4H 3I0TA 2CQNA 2M8EA 3OYKA 2FBHA 4JK1X 4M3FA 2ZB9A 4IEJA 1YG2A 3EUHA 4IJAA 1TT0A 4HSTA 1ZQ3P 1IJWC 1OISA 2PQ8A 2CJJA 4PJLA 4LB6B 3WGGA 5F0HA 3Q0VA 3F72A 1UHWA 3O8HA 4BHBA 5LGNA 1YI2I 2V7FA 1ZRDA 1ZHFA 2W57A 3MN2A 5A2QZ 2BW3B 2KKOA 4RGSA 2EFQA 9ANTA 2HGCA 3FF5A 2ME0A 3OYJA 3RZDJ 2ZMEA 2BY0A 4ZZDA 5F08A 1LE8A 4A69C 2ZC2A 1IXCA 1X4OA 1FWZA 5HDKA 4HDVA 3QU6A 4I99C 2E34A 4XSZF 1FSHA 2M45A 5J4YA 4GXOA 2O03A 2FQ3A 2F4IA 4R8HA 3I4MJ 3HRUA 3DTIA 2QKLB 4OMYA 2MH9A 3ABTA 1USSA 4B44A 2UZKA 1PVEA 3TOBA 2JN6A 3SDBA 2HDDA 2JZYA 2BZTA 2J5PA 4IQJA 3GTMJ 2KMUA 4XONA 2K40A 1YX3A 2WAQN 4S05A 4BAYA 3TO6A 4I76A 1ZRCA 2XSJC 2LD5A 3FBIB 4EJUA 3HOTA 1Y0NA 2ECBA 4A93J 2VT2A 1X2MA 3PM1A 4GYGA 1TC3C 3PJRA 4BBRJ 3FXMA 2UV1A 5J1YA 5GTHC 3BTIA 4RM3A 4HDUA 1BC7C 2CWEA 1YIOA 2IXSA 3SEZA 1IDZA 2DJNA 1Z3YA 3CCMI 2F48A 1W0TA 2Y0SA 2ISZA 2VL8A 2VONA 3F0CA 2K9LA 3GYHX 3DKYA 4P5OA 3S14J 5E1XA 3HOWJ 1R5ID 1HW1A 4IQ4A 4AD9A 2NS8A 5KK1A 1JJ6C 3FK6A 2UXXA 3IHUA 4AIHA 1HXDA 1FTTA 2ID6A 5FKMA 3HDDA 1LDDA 1MNMC 3K2AA 2CV2A 4OU0A 4OINF 3J7ZI 2DPDA 4XRSA 3BT9A 2V9VA 4YEJA 1ZR2A 3SZTA 1Z05A 4DZJA 1YRNA 3M1EA 4JBAA 1PDNC 1GXQA 5D8KB 4ESBA 4LB5A 4IF4A 1XPXA 2EZKA 1D1CA 4N4OB 3ZQIA 3R60A 1MBJA 2XGDA 4CCOA 1MKMA 1KU3A 2GAUA 2RKHA 4WXHA 2VLAA 2IW5A 4G7ZF 4XLAA 1JI8A 4QIWN 2DMUA 3AL0B 1D0ZA 1B4AA 3CUQA 3Q0UA 2Q1ZB 2QQ8A 1OKRA 5FKNA 3I71A 1Z3XA 3SXYA 4ZJZA 3H36A 3A0BC 1XMXA 3F8MA 4IOAF 2NYXA 5AIPA 1KA8A 3TDZC 2DMTA 3CP2A 3ZN0A 3WU1B 2CW8A 2P4WA 3OR2C 5E79C 2OJED 2DBBA 2X9DA 3X2QH 1DPRA 2K3FA 1ETKA 3GLLA 4MFDA 4PK4A 4RAYA 4HPQA 1LDKB 2M9HA 4I0BA 2EPFA 4W1UA 1HBXG 4N9HA 3RJPA 3FXQA 3WU0A 1U0JA 2IA1A 1VQPI 2OUMA 1DGRM 3A02A 2YX7A 1Y1VJ 2M4GA 2OCCH 3RKXA 1NHAA 4D7NA 3HJEA 5JFRA 5D4RA 2HEOA 1IRGA 3PNVA 5E17F 3H9JA 5IT3A 4LG3A 4C3IJ 3FMRA 3NEUA 2RDPA 1B8IB 1ORKA 5L3CA 2W48A 3CMMA 4RGUA 1N25A 1IN8A 3FKJA 4A0ZA 1Y39A 1U8RA 2JUCA 3K0LA 1RKWA 4U0YA 3H5RA 1SMYF 1QHHD 2VE9A 4XLPF 5TGTA 4M9SA 1GT0C 2O3FA 1YFHA 1XCBA 3I5UA 4ITVA 2CSOA 2CUFA 3W6VA 2FMLA 3IAS2 3FIWA 2H09A 2HOAA 3DBRB 4KN4X 1ETYA 3E0JB 1BW5A 2R7ZJ 2B7EA 1BW6A 1WVRA 1FC3A 2KP6A 2VE8A 4E7ZA 5CVJA 2YSRA 4DYCA 4A5MA 2OTLI 2NVYJ 4IRHA 2RV8A 5A2QK 4J00A 1PJRA 1YYVA 2HPIA 4II3A 3BG9A 2X6XA 3FBNB 4M6VA 1SFUA 4CCMA 1BA5A 4S0HB 4NHJA 4Y7NJ 1YITI 4LOCA 1DP3A 4A3BJ 2LK2A 1ETVA 4UUTA 4GO1A 1DUXC 4IHVA 3EUHC 3QYBA 4Y52J 1VQ7I 1WI3A 3BG3A 1IRXA 3K4MA 3PL8A 2E2IJ 3ZPLA 3BWGA 3BCAA 1MGTA 2DT5A 3L09A 3FHNA 3S17J 4C2MJ 3Q9VA 1IN4A 2KIQA 4B8XA 1N78A 2XAFA 2CO5A 4Y17A 2JA8J 3KP6A 5HS9A 3V8KA 1SEUA 1B9NA 5DTDA 2ZMEC 4IL6C 3U1DA 1XS9A 1FNNA 4JYKA 1XMKA 4U88A 1R49A 2YU3A 3HHHA 2UUZA 1FX7A 1VQLI 2JQ7A 2D1VA 5J8CA 3CO7C 1FOWA 2W24A 1MDMA 3J80Z 2CRGA 3VYUB 5FLMJ 2L2OA 4ANJA 2BYVE 3BR2A 3M7GA 2H8RA 2QQBA 3LSRA 3SHFA 4AYBN 3KFWX 4KICA 2AXLA 4X6AJ 3EUKL 1FY7A 3HSRA 2HVRA 2F5FA 4RGRA 3KCCA 2LC2A 4KMFA 4PUSA 2VBZA 4D7MA 4BXXJ 2ISYA 2ZXIA 3UKGA 1E17A 4BY7J 4ENNA 1R1VA 2QBYA 1SC7A 1IRFA 3JRDA 1BI3A 4YIFA 3GZNB 5ICFA 2X6OA 1XSXA 2F5EA 4Q48A 5HNHA 3GFLA 2ACJA 2DDAA 2HPMA 2Z3YA 4UNOA 2P6SA 4V2GA 3DTEA 2ZXHA 4JQFA 5J4VA 4BHPA 4CZZA 2XROA 2EIJH 3L1PA 1A31A 1S29A 4CGZA 3L9FA 1MBGA 3BPXA 2HOTA 4UB8C 3M3YJ 2M34A 3ELKA 3VOEA 4G8XA 5KHDA 2DPUA 4NDLA 4HX4A 4QTRA 2DYRH 2EB7A 2F4OB 2EFNA 1X2NA 4BE1A 1U6GA 2Y0MA 5BPIA 3K4NA 2IGKA 4KDPA 3VDXA 1PUFA 1F5TA 2V26A 3ZXSA 1GVDA 4Z2YA 3GTKJ 5H2FC 5FKKA 1FYLA 3GVAA 4IXAA 1T39A 1JJ8C 3HOXJ 1BC8C 3CDHA 3KP3A 4RM2A 3CCYA 1NG7A 5LD2C 4BDYA 4GYIA 3K9TA 1H0MA 1WJ5A 1O4XA 1JUMA 3TMOA 1I3AA 3CESA 3PQKA 2LRDA 3S2WA 2KIFA 1LE8B 1PP7U 1V4RA 1P92A 2IS4A 4GCVA 2Y9ZA 2Z16A 3DTKA 3OYCA 4HX7A 3JR9A 4A0XA 4CCJA 1JTXA 1BM9A 2DA2A 3WGIA 5F0FA 3VWBA 4CH7A 1R7JA 3FXKA 2ELKA 4B3AA 1I6HJ 3HRMA 4QLCU 3K1NA 3BQYA 5FFZA 1JKOC 3RI4A 2JA5J 1J59A 3U21A 3DXJF 1BBYA 3NRVA 2PMUA 3SZPA 5F1JA 2IJLA 2CFOA 3PSFA 4IZZA 2NXNB 5J1UA 2ME6A 2XPWA 2PX9A 2Y30A 4HRIA 2EILH 3BOQA 4ZYEA 5LFAA 1OYWA 1IN6A 3C3WA 5J47A 4BKXA 1FOKA 3I54A 3H1CA 2VKDA 3TP3A 1K6YA 2QSGX 1MJ9A 2JJ7A 4UVCA 3I9V2 1ZG1A 4NBQA 4A6DA 3BPVA 2PMZN 5EEGA 3GTGJ 1SFXA 5HLTA 3CMAI 2AXTC 4FTHA 3R6SA 3DLLF 3K4JA 2DT7B 4CA0A 3DEUA 4ZTFA 5E8GA 2D1HA 1WCMJ 2PN6A 1TTYA 5DCMA 5KNLA 2C6YA 3DU6A 5E20A 1LUJB 4QPQA 1RUNA 1OLTA 1T08B 3OS1A 2L7FP 2G0EA 1HCRA 1ULYA 2IAIA 4RS8A 4BHCA 1Q1VA 4L18B 1MBFA 1FLIA 4BGDA 3U9GA 4RBOA 2L4AA 2XRNA 3BR1A 3F8BA 4XSXF 3W2VA 3QU3A 4HX8A 3F21A 1K4SA 2BXYA 4XRSG 4IHXA 2LY2A 3J80K 3CUQB 2EQRA 2VQGA 4IHYA 3OIPA 2R7VA 1L0OC 2DK8A 5D5UB 3RPQA 2E1NA 1HKSA 2PEXA 3OMYA 1QU3A 4UVAA 3S15J 1KU9A 4G94A 4CXFA 2VPRA 2R7DA 1UHMA 3W2AA 1HQCA 2B0LA 4G9YA 3GWZA 1FT9A 5M5XJ 5L3GA 2JPCA 1AOYA 2DFFA 2EJRA 3M9AA 3HGGA 1IG7A 2D5VA 1HW5A 2DMQA 1R1TA 1J5YA 1BR2A 4F91B 1HLVA 2MLGA 3F22A 1SVMA 2R3SA 2VQLA 5CQGA 4M6YA 4C3JJ 2N8GA 3D5LA 3CD6I 3JCUC 3L2WA 1XDSA 3WTXC 2E60A 2EWNA 4XKWA 3RTRA 3PO2J 4LFUA 4IHTA 1WSUA 1WZ2A 1WFXA 1BOAA 2K4BA 3GTOJ 5DUIA 3T8RA 1VF9A 3FM5A 1ZK8A 3GFJA 3B6CA 2IS2A 2DU9A 2LKSA 4I98B 2KIUA 4HF1A 2OQGA 1GXPA 1G8XA 2YR2A 3DBHB 5BQTA 4XQFA 4YFNF 4QWQA 5LBQA 3ECOA 1Y8QB 3OYHA 1SMTA 1SD6A 1K78A 2AQEA 5GPAA 1Z91A 2VKEA 4UHTA 2VJIA 4X0GA 2Z1DA 3GUDA 4PDKA 2V1UA 3S1MJ 3K69A 3FISA 5IY5H 1Z9CA 3HTUA 2GIZA 3G1MA 3PQJA 4E70A 2RGVA 1QHGA 1DQUA 5KVRA 1R5GA 3ZMUA 1TW3A 3K4CA 5DD4A 1KGSA 5D5WB 1ZREA 3OSGA 2W25A 2LREA 3E6CC 3MKYB 4ZYAA 3L2CA 4M74A 5L3FA 1VQ4I 2VODA 2A6TA 2EV5A 5EGOA 4HEA2 4L5EA 2XVCA 2FNPA 4FX4A 3S93A 5F1RA 3LWFA 3HKZA 5H20A 3WTWC 3AG2H 3LSTA 3ML6A 3DEWA 1JGSA 1OYYA 3BC8A 1FMWA 3CCRI 2VASA 5EG0A 3F8NA 3OYDA 2KDZA 4ETSA 2VC0A 2ZXWH 2V79A 2D2WA 3BTJA 3CZ6A 3CCUI 3G2BA 4BQAA 1W5TA 1B9MA 4M73A 3DU5A 4LIVA 4LLGF 1TP4A 1RI7A 4ZYGA 5CVRA 4CHUA 4H0EA 2MD0A 4OAYA 2WV0A 3SJMA 4MNUA 4ZH4F 3GEZA 5DDGA 3SQNA 4NNJA 2QBYB 4A3CJ 2HQAA 2E1OA 3KPHA 4RAFA 4YFKF 2R7XA 1GDTA 2IGMA 2F4MB 2HYGD 2X6YA 3HGYA 3WE2A 2CG4A 3ABLH 5EDNA 4AIJA 2EV6A 1MBHA 2GA2A 4XRMA 1SFKA 3LSMA 1XMAA 3B02A 3LSJA 4E6KG 1QA6A 1TQPA 2O6GE 2K85A 1RETA 3EPZA 4M3DA 3HYIA 4M3BA 3WG7H 5H6QA 5K7HA 2E5ZA 2M7BA 2A6EF 3A4CA 3UNGC 2KT0A 4UY8I 2E71A 4A6EA 2LY1A 4NQWA 2LY9A 4AWXB 1EKEA 2KL4A 5M5YJ 2FUG2 2DMPA 2IS1A 5LHIA 1UMQA 1IUYA 1TWGJ 3VEPA 4EM2A 3HUGA 3LSIA 4BQOA 3VFZA 3CP8A 3KP4A 1OJLA 4ENMA 2R5ZA 1PUFB 4EGZA 1MD0A 4OMZA 1ZG5A 1W36C 3I53A 2XB5A 2ELHA 1D0YA 1D1AA 2W82A 2BVMA 3TQNA 2ZBKA 4C30A 2K5CA 1TWCJ 2R4GA 2A3SA 1IZ1A 4LGWA 5TRDA 4A3LJ 2W1OA 1IGNA 4AIDA 1WQ2A 2VBYA 3IH2A 1S6LA 1PP8F 3ZMDA 2KZGA 1OQYA 3O8GA 2E1MB 2M87A 2ZNYA 4U87A 3TL4X 1GHCA 4LMYA 3VSLA 2X1EA 3MMYB 1P2FA 3GLXA 4NC8A 1T38A 3ZOBA 4MHGA 2FF4A 3ZGKA 3RKQA 4LG0A 2HXIA 1ZGWA 1FP2A 1MJAA 1QNTA 4HZFA 1LVAA 1JHHA 4R1HA 1XN7A 4OIOF 4E7HA 1IF1A 5E3NA 4U7BA 3B6AA 1CF7A 2EH3A 2W84A 1P7JA 4PZJA 2XIGA 3K6GA 3ZQ7A 4L0ZB 5DD8A 3JSOA 3CJTB 4KISA 3GTLJ 5IYCJ 2OD5A 3A01A 4FT8A 1SD4A 1TT5B 3QOPA 4O3MA 3I59A 1I1GA 1ETOA 3HPGA 5L3BA 4HOBA 4AM3A 2R7TA 3BTLA 3A1YA 1ETWA 1UG0A 1P6RA 2LR8A 4CYCA 3K7AJ 1UJ8A 2F5DA 2QCOA 1X19A 2LVSA 2OF7A 3LMMA 5K5OA 4WWCA 2JUGA 2YU9J 2COMA 3S3NA 3H9QA 3HHGA 5CPRB 2CV0A 3LAJA 1U5TA 2G7UA 4HF0A 1ZKGA 3CTAA 2KHMA 2JWTA 2AS5F 2P5LC 3GZ5A 5E18F 3KYLA 1S72I 1RKTA 4LK0F 1VQMI 2CGPA 4L5IA 3S32A 3IH4A 5DCMB 1IXRC 4BEHB 2YX4A 2Q2EA 4HQEA 2ZSHB 1NTCA 2DQLA 3ROUA 1P9QC 3HOZJ 3TW7A 1W36D 1B6AA 2MC4A 5M3FJ 4Y4RA 2M8GX 4NC7A 4P96A 4WF2A 4HNUA 2KQRA 2VJ5A 2WAQA 2VBXA 4JX6A 1CGPA 2FXAA 1JXSA 2W85A 3S16J 4X1EA 1R4MB 1D8KA 4A3MJ 1SAUA 5FROA 3IKVA 2R7FA 2V1DA 2K9MA 1V5FA 2P7VB 2A69F 3BG5A 3HM5A 3CCLI 3CCSI 3LAPA 3D0SA 3VSKA 1X3UA 4AU7A 1I50J 1TBXA 1OR7A 3MVPA 5GTIC 4XLHA 4WX9A 2LF7A 4NUBA 2H6CA 1E3OC 2H27A 1VI0A 2H94A 1DP7P 1S8NA 1ZGJA 5LLQA 3RSNA 4Z6YA 3WTYC 3ZMSA 3OY9A 3JRHA 2AO9A 3UR3C 3VODA 3ZQLA 3RYPA 2FA5A 2A6HF 1PYVA 1IAWA 1W5CC 2HWVA 4E4HA 3W6JB 4RAGA 5E1ZB 3P9KA 2DO7A 4ZDPA 4F3QA 1I6XA 1ZLJA 4L9TA 2OCEA 4RB3C 3BZCA 5JLXA 5JLWA 3Q0WA 3CCJI 1YJNI 3D5RC 2P8TA 1RZ4A 3KX2A 3L2QA 2PJPA 2DQRA 1G4DA 1LEBA 3ZP5A 1H88C 4BBSJ 2L9NA 4A5NA 3BCBA 1QGPA 1SAXA 2WAEA 5F6FA 3J81Z 4C2UA 3C18A 2DK5A 3OYGA 2JA2A 3REOA 1HKQA 1REPC 2ESNA 2PJRB 3FXJA 3GZ6A 2HXOA 2VB6A 1QZEA 3OSFA 2MBFA 3BJOA 3I64A 5C3EJ 2R5YA 1OCOH 3QP5A 3TO7A 2IBDA 1QZZA 1FIPA 2DJIA 2FQ4A 2OU2A 4DZPA 1TQMA 4O6JA 4RB2C 5H6RA 4WCGA 1G3WA 2DYSH 5HNFA 2ESHA 3VYRB 3M8EA 4G7OF 3K10A 3F23A 4N9IA 3P9IA 5J3LA 3BQZA 1K78B 4KITB 4A3FJ 2LBFB 2EIKH 4I01A 4II2A 5HDNA 3G1OA 4A3DJ 2FJ1A 1XCVA 1T56A 3ZRGA 4DBQA 5EF6A 5IT9Z 3KETA 2GOMA 3HRSA 1POGA 2OZ6A 3EETA 1ZH5A 2ETHA 2R7RA 2HZDA 4BXUA 2ZNZA 4FQGA 3RQ4A 2F5CA 2Q8KA 5GPCA 1XSDA 3NAUA 3PNYA 2EZLA 5HLGA 1Q1HA 4ESJA 2PMHA 5F0CA 4FE7A 2IP2A 3BR5A 2UXNA 2FD5A 2NAZA 2VQCA 2Z2SB 3LA7A 4K2EA 2QSFX 2X85A 3OL4A 4IO9F 4L9JA 4HW0A 2HOEA 1LEAA 3BY6A 3H5NA 3W2WA 5J6XA 2QUFA 2R7WA 1OCPA 1XTAA 3BR6A 1PUEE 3M1CA 5EGOB 2ZJ2A 3H3VK 1X1CA 3ESWB 4XOTA 1FJLA 5LGTA 2W4SA 1VQNI 2Y75A 1KYZA 1TLHB 1BI0A 4F7ZA 2XAUA 4YIIA 2LKXA 4AIKA 1XG1A 3BDDA 3EYIA 5HOOA 2O0YA 2P0WA 4BUPA 2BBYA 2KIMA 2CUZA 4BACA 1IUFA 3Q5FA 1ZELA 5EG0B 3O6BB 2P7CB 3T8TA 5JHFA 1ZG3A 5CVIA 4L0YB 2IS6A 1HW2A 2JA6J 4WXCA 4HV5A 4RLQA 3ISPA 3OR1C 5IOYA 3MZ8A 4N4NB 1VTNC 1VFCA 1VQ8I 3NWSA 2FNAA 2STWA 2AHQA 3KZIC 3VPRA 2NVXJ 1WJEA 1ZARA 2DLLA 4ESFA 4PJJA 2WA0A 2RNGA 3PIOF 2V1XA 1HC8A 1C0WA 3J7AO 4MLOA 1Z1DA 3HB9A 3S3MA 5ILUA 1CQTA 2Y9YA 3DWLE 2Y48A 2ZFUA 3G1LA 2MABA 3OYLA 2LLKA 4BY1J 4MQ9F 1YHQI 1ODDA 3LQRA 3HXLA 5ILVA 4HYEA 2GBYA 3NARA 1ON1A 2ZFWA 3BR3A 4KIBA 1XSVA 1G2HA 3MKLA 4HBLA 5JVGF 1OMIA 3ULQB 4S04A 3L2RA 4ZDLA 3P9CA 2BW3A 4EGYA 1JKQC 3CO6C 1U5TC 4AYBA 4BJTA 3PIPF 1F36A 2MH2A 2IT0A 3HUGB 4FHTA 5KAFC 1D3YA 2HKXA 2DDBA 4CDGA 5EEAA 2GLOA 2ZMEB 3CLOA 4PFPA 3DV8A 2YUSA 2Z5UA 2ZCWA 3OIOA 1A6IA 3E1SA 2KFDA 1SVOA 1YO5C 3V7CA 4LLLA 3VB2A 2A68F 4Q5SF 1R22A 3MAJA 3FXUA 4IRGA 1BR4A 4V19K 2XF6A 4EM0B 4M3EA 3NWTA 4PSXA 1J2XA 1OCCH 3CQZJ 3S3OA 2LP0A 3IUOA 2WWYA 2DFHA 2RAEA 1JUPA 3JRCA 5FRNA 1X1DA 1DPUA 1OR7C 4FISA 3MCZA 4EVIA 1F9NA 2M5WA 4XN0A 4RDUA 5F04A 1AA7A 2CQQA 3N97A 3KP2A 2ZJQF 4CCKA 5C4XJ 5GADJ 5IP6A 4XBFA 1RR7A 3J81K 3Q3SA 1K61A 3JREA 2OC6A 1U9OA 4I09A 2DA5A 2GIVA 4IHWA 3PNTA 3KYDB 3GTQJ 4U7DA 1CF7B 2E2JJ 1T95A 4L9VA 2IRFG 2IGOA 1GLNA 2XRLA 1XD7A 2VXZA 3SFIA 3QPLA 5JVTA 3S1QJ 3I59B 3I56I 1V55H 3RZOJ 3FX3A 2L01A 4BH9A 4D1QA 3E5UA 1MSEC 1YRNB 2VUMJ 3GX4X 3GTPJ 4CYCB 1GV5A 1UFMA 5IT9K 4D9JA 1VQKI 1YQAA 2E7WA 1V3FA 3IP4B 4UVBA 2KLOA 2LTPA 2FBKA 4L9NA 2IEKA 2TDXA 4HV6A 1U5TB 5CQEA 1FTZA 1W7PD 1ZGAA 1EH8A 1W1WE 2EV0A 3IH3A 3MEXA 4RGXA 2VOOA 1SFEA 5JR3A 2JA7J 4UV8A 5D4SA 4BE2A 1O3QA 3OV8A 2Q2EB 2NVUB 2CUEA 3OYIA 3L2VA 4XKVA 2K4JA 1V5GA 3KEOA 1SVLA 2H1KA
chains in the Genus database with same CATH topology
3CP2A 3AKZA 2CW8A 2R7XA 2IGMA 3OR2C 2X6YA 4XLEA 2MYSA 4B47A 2WB1A 3OS2A 3LSGA 4XL9A 2M4KA 4PK4A 1MMAA 4HPQA 4DOZA 1LDKB 1SFKA 4XKCA 3LSMA 3ZQQA 1U0JA 1WJCA 4E6KG 5HVQC 3EPZA 2WBMA 4KJZA 2OUMA 1DGRM 2CH0A 2E5ZA 2M7BA 2M4GA 3MD2A 3A4CA 4Y3OA 3UNGC 4B3XA 3DKXA 4R79A 2LY1A 2NOJB 3PNVA 4NQWB 4PFOA 2RREA 4GRIA 2BVLA 3H9JA 4FETA 2KL4A 4LG3A 4BS9A 2FUG2 4DIQA 2IS1A 2CUJA 3F9KA 3LSIA 4BQOA 3CMMA 3CP8A 3L2UA 3K4KA 3FKJA 1LKXA 1W36C 3EUAA 3HOSA 1D0YA 1D1AA 1WJFA 2BVMA 2W82A 3H5RA 3OYFA 1QHHD 4C30A 2K5CA 2HVQA 5TGTA 2R4GA 3KEYA 4ITVA 3IAS2 1LVKA 2W1OA 3E0JB 4E7KA 1YE9A 2GOXB 2AQFA 2KP6A 4E7ZA 2E1MB 2JVHA 2KRHA 2QKMB 4U87A 3TL4X 3FDYA 3OIQA 3VSLA 2X1EA 2WAFA 3MMYB 4J00A 2V6EA 1PJRA 2HPIA 4II3A 2X6XA 3FBNB 4NC8A 1BOBA 4PSWA 4PJNA 3W3CA 4IKFA 4CCMA 1Z7LA 3H5AA 3AFHA 4XORA 4E7JA 4RLFA 3ZGKA 2I8DA 2X51A 1N77A 1DP3A 4OAZA 4CUGA 3EUHC 3QYBA 4E7HA 4U7BA 3K4MA 1IRXA 3PL8A 3ZR8X 4BXFA 3BCAA 3K6GA 2VQHA 3LFUA 3FHNA 3OS0A 4KISA 2LYCA 2XF7A 1N78A 3TBIA 2R7OA 3HPGA 3LL7A 1D1BA 2K3PA 2F5VA 2WADA 3K70C 2R7TA 2HNHA 3A1YA 2HVSA 1UG0A 2JSPA 2ZSIB 2UUZA 2KZVA 1X19A 4XMYA 3SEQA 3LMMA 2O5RA 2JUGA 4ZC3A 3VYUB 4E7IA 2L2OA 4ANJA 1VZ0A 2V1NA 3S3NA 3H9QA 5CPRB 3EUKL 4F52A 2CV0A 1G59A 2HVRA 2KHMA 2LC2A 4PUSA 1UAAA 3OL3A 3KYLA 3H35A 3PUBA 2ZXIA 2W00A 4BEHA 3S32A 4BEHB 3DPUA 2ZSHB 3K4BA 1P9QC 1W36D 2VIXA 5HNHA 1HA8A 2MC4A 4Y4RA 1R6RA 1TZLA 4NC7A 4Y33A 4HNUA 2HPMA 2KQRA 2VJ5A 2WAQA 2JVGA 2R7SA 3IAM2 3VYSB 4LITA 3BG7A 3DTEA 2VKHA 2F6CA 2ZXHA 4JQFA 1SAUA 5FROA 4BU2A 2VJJA 1MW7A 2K9MA 2VXDA 3H0DA 1V5FA 4CCNA 3GBGA 4B48A 3VSKA 1X1BA 4BL0B 2M3AA 2XF5A 4AU7A 2KRCA 4XLHA 5KHDA 2PMZA 4NUBA 3BLYA 2CV1A 1WJBA 1FMVA 3RSNA 3OY9A 3UR3C 4F55A 4E7LA 4BE1A 3CJRB 1LFPA 4BQNA 1PYVA 3K4NA 2IGKA 4E4HA 3VDXA 4F3QA 4ZDPA 2V26A 3ZXSA 2WY7Q 2DXIA 2CW7A 3DLAA 3D5RC 4E7SA 4ZTJA 2DOAA 2MFZA 3D5SC 3KX2A 3L2QA 3HL2A 3OYNA 4RM2A 1NG7A 5LD2C 4BDYA 2L9NA 3DQVC 3BCBA 4CSWA 1WJ5A 3AL0C 3ZCOA 3K70D 1WJDA 1X1AA 3CESA 3LSKA 3TMOA 2LRDA 2WAEA 4C2UA 3OYGA 3K4LA 3QODA 2PJRA 2JA2A 3J7AY 3H9GA 2PJRB 3OOUA 1D0XA 2VB6A 4EATA 2IS4A 4BDZA 2VPLA 2Z16A 3DTKA 3OYCA 3CF2A 2HU9A 4CCJA 2DJIA 4RMNA 2ELJA 3VWBA 4CH7A 2DCEA 5FRMA 3ONQA 4BQQA 3CJQB 5HNFA 4QPOA 1MMDA 3VYRB 4G6TB 3U21A 3K10A 2LBFA 3I3LA 4KITB 3V42A 2LBFB 3MKWB 2WY8Q 4XNFA 4II2A 4IZZA 2CFOA 3PSFA 3ZRGA 4PJMA 3OYMA 2BOLA 4DBQA 4HRIA 2GOMA 2R7UA 4ZDOA 5CKTA 5LFAA 3SYTA 4YRVA 2R7RA 2HZDA 2RQQA 3RQ4A 2VKDA 3HPHA 3PNYA 1K6YA 4AVZA 4XKBA 3I9V2 2VQCA 2Z2SB 2X85A 3OL4A 2E5NA 3H5NA 3W2WA 4KT6A 4FASD 2L5QA 2R7WA 5HLTA 2IGNA 2XC7A 4XLCA 3M1CA 4BJ5C 4OWRB 3OYEA 3K4JA 1X1CA 4XOTA 2DT7B 4CA0A 3C2GA 4ZTFA 1MMNA 2W4SA 3OWTA 3PFYA 1N75A 5KNLA 3BG6A 3DU6A 4QPQA 4DGWB 2E1MC 2XAUA 3PSIA 1X4PA 5HOOA 1OLTA 2X1CA 2A5WA 2P0WA 4YELA 4BUPA 4HG2A 3OS1A 2CUZA 4BACA 1ZELA 4BJ6C 4XN3A 2UWMA 1V5EA 2XDVA 5KCMA 5JHFA 3A2KA 1S9HA 2IS6A 4BGDA 2OV7A 2VJ4A 3N05A 4RLQA 4HSRA 3OR1C 3W2VA 4N4NB 2KDOA 3M8JA 3NWSA 3LSHA 4J01A 2LY2A 3HG9A 1WJEA 2VQGA 3DPLC 4PJJA 3OIPA 2WA0A 2KPMA 2RNGA 2R7VA 4LIUA 4MLOA 4XR6A 3RPUD 2HDWA 3S3MA 2CMPA 3OMYA 3OYAA 1QU3A 1Z21A 3DWLE 2ZFUA 4C9YA 3OYLA 2MABA 3HC7A 3W2AA 2M0MA 3OYKA 1KONA 3HXLA 1E0EA 1TT0A 3QYEA 4HSTA 2X1DA 4C2TA 4PJLA 3L2RA 4ZDLA 2V7FA 2BW3A 1BR2A 4F91B 1Y56A 2BW3B 4AYBA 4BJTA 3OYJA 2VQLA 3HUGB 5CQGA 3D5LA 1J09A 2V9KA 3L2WA 4PFPA 2LH9A 2CS3A 4DBRA 1EA3A 1X4OA 2E60A 4XKWA 3RTRA 3QOEA 1BR1A 3E1SA 1WFXA 1YX5A 2F4IA 3VYTB 1MMGA 3DTIA 2QKLB 4CZCA 4JOMA 4XM3A 4B44A 3SZGA 1BR4A 2IS2A 2XF6A 3C2HA 3SDBA 1G8XA 4XQFA 3NWTA 4PSXA 4H4KC 4IQJA 1T0FC 3S3OA 3IUOA 3OYHA 2KMUA 4XONA 2AQEA 2LG4A 5FRNA 1X1DA 4BE0A 1MNEA 1YX3A 1OR7C 1WJAA 1Y6IA 2VJIA 4X0GA 2Z1DA 4HNTA 4XN0A 2XSJC 4B43A 3FBIB 1AA7A 3HOTA 1ERDA 4CCKA 2M7AA 3PJRA 2W7NA 2DT6A 2L7KA 2UV1A 1QHGA 1DQUA 4RM3A 2OC6A 3MKZA 3K4CA 3RCOA 2IXSA 3SEZA 3QYFA 3PNTA 3S8PA 4F93B 1Z3YA 1NG6A 2LREA 3MKYB 4ZYAA 2V4JC 2Y0SA 1T95A 3DPTA 2VL8A 2IGOA 2K9LA 4DJAA 1GLNA 3DKYA 4P5OA 4IQ4A 2A6TA 2VXZA 4HEA2 1DGWY 2CV2A 3S93A 4F92B 4YEJA 3HKZA 4D1QA 4P1WA 3BC8A 1UELB 4CCLA 1FMWA 4D9JA 2VASA 3IP4B 2KLOA 3OYDA 1D1CA 4N4OB 4XOPA 2LOOA 3CZ6A 3G2BA 2L9SA 4CCOA 3DU5A 4LIVA 5CQEA 2VLAA 1JI8A 4XLAA 2R7QA 2MD0A 4OAYA 3AL0B 1D0ZA 4BE2A 2Q1ZB 4IX7A 2Q2EB 1Z3XA 4XLFA 4ZJZA 3OYBA 4NNJA 3OYIA 1MNDA 3L2VA 3DEEA 2HQAA 4XKVA 1V5GA 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSP A; 
#chains in the Genus database with same CATH topology
 3SDG A;  4XLE A;  5L3E A;  1JT6 A;  4B47 A;  2WB1 A;  3OS2 A;  1KU2 A;  3LSG A;  1MMA A;  2RVC A;  4DOZ A;  2LKP A;  1YW7 A;  3NQO A;  3C2B A;  2P5V A;  3BP8 A;  3BTC A;  2L02 A;  4U0V A;  3V8L A;  3FWE A;  3ZQQ A;  1WJC A;  3F8C A;  5IYB J;  1Z6R A;  1UZC A;  4IHS A;  3CDL A;  4RB1 A;  3IRR A;  1F4K A;  3GXO A;  3T0Y A;  4Y3O A;  2O7O A;  3DKX A;  5BPD A;  3KLN A;  3WGH A;  5D5V B;  1R23 A;  4KMU X;  2LSO A;  4B4C A;  2NOJ B;  2GZW A;  2RNJ A;  4LD5 A;  3K1M A;  2BVL A;  2EIN H;  4MIM A;  4BS9 A;  5K5Q A;  1RUO A;  5E8I A;  4FX0 A;  2OZU A;  5HDG A;  1OCZ H;  1A04 A;  1S7E A;  2CUJ A;  3F9K A;  2VC1 A;  1Y0U A;  5FD6 A;  3R4K A;  1ZR4 A;  5LEK A;  1LKX A;  3F3X A;  3KYC B;  2X0L A;  3LOC A;  4EJW A;  3EUA A;  3IWZ A;  3FXL A;  1S7O A;  3TKY A;  1QRY A;  2KJC A;  1WJF A;  3OYF A;  2DA3 A;  1MBK A;  2WV1 A;  4MTD A;  2K02 A;  1TWF J;  3KEY A;  4I7H A;  1KZH A;  1JGG A;  3LQQ A;  1R9T J;  3TED A;  1LVK A;  2O8K A;  3HSE A;  3HKZ N;  1QPM A;  5D6F A;  4E7K A;  5CVV A;  3RIR A;  1HST A;  1RES A;  1YOV B;  2JVH A;  2KRH A;  5ICC A;  2Y31 A;  1M1E B;  1OPC A;  2DAO A;  2PFB A;  2QEN A;  4GFB A;  2WAF A;  2IA0 A;  2O61 A;  1BI2 A;  4JP0 A;  2E2H J;  3G73 A;  3ERE D;  4ON0 A;  2L7Z A;  2XGC A;  2R5Y B;  3ABM H;  4CYD A;  1S7A A;  1BOB A;  1MH4 A;  1U2W A;  3S1N J;  4A12 A;  3AFH A;  5LGU A;  4XOR A;  4EJO A;  1FBS A;  3WTS C;  2PI0 A;  3G4S I;  2I8D A;  1N77 A;  1H9T A;  3Q9S A;  4M71 A;  4OAZ A;  4HLX A;  2V6C A;  5D6E A;  4CUG A;  2IA2 A;  5FKO A;  4AC0 A;  2VOP A;  1T98 A;  3WTU C;  3ZR8 X;  1QZY A;  3MFK A;  2VQH A;  1XGS A;  2XV4 S;  2LYC A;  4PCQ A;  5DM7 F;  4IPA A;  2XKP A;  2LF8 A;  2HOS A;  3ZQC A;  2GWR A;  4G6Q A;  4V2F A;  1STZ A;  5IOZ A;  1WGX A;  1D1B A;  2DA4 A;  2F5V A;  2K3P A;  2WAD A;  2KIS A;  3QPH A;  3DFG A;  2E36 A;  4Y15 A;  1IV8 A;  1YW8 A;  2ZSI B;  1A6Q A;  2TRT A;  1RRJ A;  4DNC A;  2XAS A;  2MSY A;  2KZV A;  2I10 A;  4XMY A;  3SEQ A;  1JUS A;  2HFH A;  4HAM A;  2O5R A;  3E6B A;  5CLS A;  4ZC3 A;  1MDM B;  4E7I A;  1QVT A;  4EV0 A;  2FMY A;  1EF4 A;  3WOD F;  5L3D A;  2BV6 A;  4RAZ A;  5EZG A;  2K9S A;  2TCT A;  3HIF A;  2IVM A;  4MEY F;  3U1K A;  3OL3 A;  4D5F A;  3BZ6 A;  3PUB A;  1FBU A;  3S2H J;  1R36 A;  4A3K J;  3RQI A;  3K4B A;  4ZZL A;  2OQR A;  2JK3 A;  4TV7 A;  2RN7 A;  3KP5 A;  1G3T A;  3ASO H;  3ZQF A;  4UXN A;  5DYM A;  1R6R A;  4Y33 A;  3F6O A;  2R0Q C;  1J75 A;  2JVG A;  2QVO A;  2MA3 A;  3IAM 2;  1EJ9 A;  4WXD A;  2EZI A;  5FLX Z;  4LIT A;  4KA4 A;  2F6C A;  2Q0O A;  4YFX F;  1FZP B;  4ZYD A;  3WTZ A;  1MW7 A;  2VXD A;  1X58 A;  4IOC F;  1X3W B;  3HOY J;  4CCN A;  2XUB A;  4B48 A;  2NVQ J;  2LMD A;  1X1B A;  4BL0 B;  2HDC A;  2KRC A;  5B66 C;  2Y2Z A;  1BN5 A;  2EA4 A;  2HI3 A;  5KAI C;  5C44 J;  1WJB A;  5JI6 A;  4CO8 A;  3C1D A;  1D5V A;  1IV6 A;  3ASN H;  4IRI A;  1YLF A;  2BXZ A;  1Y8R B;  1O3R A;  3RDI A;  1LFP A;  4BQN A;  1L3L A;  2EFP A;  1P4A A;  2Y0S N;  1YS7 A;  3KP7 A;  2K7L A;  3FK7 A;  2X4H A;  2M2E A;  4AUX A;  2BHY A;  3IWF A;  4E7S A;  3D5S C;  4N0B A;  3WHC A;  4ZTJ A;  3WU2 C;  3TO9 A;  2HS5 A;  5B1B H;  5D8L B;  3HL2 A;  4EQQ A;  4DYQ A;  3RKY A;  3I4N J;  1MH3 A;  2Z9O A;  1J0R A;  3AL0 C;  4XIC A;  1WKM A;  1X1A A;  3E3V A;  2FBI A;  4HA8 A;  4UUS A;  2EIM H;  4JX4 A;  3K4L A;  3J7A Y;  3FHZ A;  3E6D A;  5K5R A;  5BS6 A;  2HQR A;  4WK8 F;  4G6D A;  1B1B A;  5DS9 A;  5HS7 A;  5EJC A;  1RC9 A;  2K86 A;  4L5J A;  1BJA A;  3CF2 A;  3ZMZ A;  2HU9 A;  3L00 A;  1XGM A;  2HTS A;  2P81 A;  3U2R A;  2DCE A;  1ETX A;  4BQQ A;  1BI1 A;  3BR0 A;  4P55 A;  1MSF C;  3FMS A;  2PBI A;  1MMD A;  2NNY A;  3H0G J;  4G6T B;  1F1Z A;  1B72 A;  5BNG A;  4XNF A;  4D5C A;  4DW6 A;  1G3Y A;  2QGU A;  1JHF A;  3OYM A;  3TP0 A;  1JKP C;  2BOL A;  2QLZ A;  5HLH A;  3ECH A;  1XGO A;  2BY3 A;  2R7U A;  4ZDO A;  3EQL F;  4M72 A;  5CKT A;  1U9N A;  3SYT A;  1TWA J;  2L7M P;  2RQQ A;  2EK5 A;  2X48 A;  1AHD P;  1JT0 A;  3S1R J;  2A5Y B;  1Z0X A;  3LSP A;  1DDN A;  2H6B A;  1IRZ A;  2L9V A;  5FLV A;  4AVZ A;  4XKB A;  2GXB A;  1LFU P;  4KN7 X;  3COA C;  1T2K A;  1AU7 A;  5LRS A;  3ABU A;  2FEZ A;  3HRT A;  3G71 I;  2E5N A;  4I0A A;  4KIG A;  2L5Q A;  4BJ5 C;  2LNB A;  1MIJ A;  2DTZ A;  2IPQ X;  2DA7 A;  1LJ9 A;  1W7P A;  5CYV A;  1Y1W J;  3C2G A;  3HSF A;  4ABZ A;  1MMN A;  3OWT A;  3F6V A;  1N75 A;  1XDU A;  1KYW A;  4DGW B;  3PSI A;  2JTV A;  3E5Q A;  2X1C A;  2A5W A;  4HG2 A;  3V7R A;  2XPU A;  3CMY A;  1DU6 A;  4A2U A;  4B1R A;  2KJB A;  4BJ6 C;  4D0P A;  1ONV A;  2NVT J;  2UWM A;  2K9N A;  2XDV A;  1W0U A;  3A2K A;  3QWL A;  2VJ4 A;  1U78 A;  5FO5 A;  1LDJ A;  2E7X A;  1HDD C;  3CUO A;  4HF2 A;  1G6N A;  1UST A;  2E35 A;  2ZJR F;  4KUM A;  1LFB A;  5J40 A;  1R71 A;  2ID3 A;  3TGN A;  3KZZ A;  1NK2 P;  3IL2 A;  4EEF G;  2XAQ A;  3WHB A;  5B3S H;  2FOK A;  5DUK A;  3BJ6 A;  3LFK A;  4HLY A;  1UCR A;  2MGQ A;  3JRI A;  1E3P A;  3RPU D;  2CMP A;  3OYA A;  1Z21 A;  3OOP A;  3RKW A;  2BGC A;  4C9Y A;  5ICE A;  2M30 A;  3HC7 A;  3R0J A;  5E1W A;  4QSH A;  3HOV J;  2ZKZ A;  1H9G A;  2DTR A;  1K6O A;  2M0M A;  3I55 I;  1KON A;  2H1L A;  3O2P E;  4W97 A;  1E0E A;  1KQ8 A;  5F64 A;  4ASN A;  2DW4 A;  1OCT C;  3QYE A;  1TWH J;  2X1D A;  1XB4 A;  5LHG A;  4C2T A;  1WI9 A;  4JX5 A;  5FLX K;  2A61 A;  1AKH A;  3ZQG A;  1Y56 A;  1P7I A;  4EJV A;  4EMS A;  2JRT A;  3MWM A;  4RA2 A;  1I27 A;  1MZB A;  2G7H A;  1LQ1 A;  1GVJ A;  2BEO A;  2QEX I;  3M4O J;  1ENH A;  1JTY A;  4ENJ A;  3ABK H;  1ZAO A;  4PGG A;  1J09 A;  1UB9 A;  2V9K A;  4RB0 A;  2LH9 A;  2JT1 A;  2CS3 A;  5ERI A;  4DBR A;  1EA3 A;  2EZH A;  1DU0 A;  3KZY A;  3E7L A;  4HQM A;  3QOE A;  1BR1 A;  3AG3 H;  3ZN1 A;  3KIO A;  2L0K A;  2R92 J;  1A36 A;  1YX5 A;  1RNL A;  1WH7 A;  3WTT C;  2Y69 H;  3JSP A;  3VYT B;  1MMG A;  2XB0 X;  1OYI A;  3JW4 A;  1OCR H;  4CZC A;  4JOM A;  4XM3 A;  3SZG A;  3GTJ J;  3HBL A;  4AVP A;  1O3T A;  1LNW A;  3C2H A;  2JRM A;  5LEJ A;  2MC3 A;  3F8F A;  2GM4 A;  2ICW G;  3FMQ A;  3QQA A;  4OIP F;  2ZO4 A;  4H4K C;  3CC2 I;  1QQI A;  1T0F C;  1HSJ A;  4CIC A;  3I58 A;  1HKT A;  3JTH A;  3CC4 I;  1ZLK A;  2RC4 A;  2PLY A;  2LG4 A;  4Q4Z F;  2GQQ A;  2DMN A;  4BE0 A;  1MNE A;  1WJA A;  1X1P A;  2QA4 I;  1Y6I A;  3BRO A;  2CFX A;  3E6M A;  2EA2 A;  4HNT A;  2EBI A;  4EJT A;  4B43 A;  2VI6 A;  1B59 A;  5M3M J;  3QAH A;  2VN2 A;  1R00 A;  1ERD A;  1TQI A;  2A05 A;  2M7A A;  5TJJ A;  3RYR A;  4YG2 F;  2W7N A;  2DT6 A;  3R0A A;  3IRQ A;  3G6E I;  2L7K A;  5J1R A;  2RQP A;  1O7F A;  3FXR A;  2L3D A;  3MKZ A;  4MEX F;  3RCO A;  3KEQ A;  3LA3 A;  3QYF A;  2G9W A;  2QQ9 A;  4XK4 A;  3S8P A;  3WG9 A;  5ED4 A;  4BNC A;  4M3G A;  4XLN F;  2FE3 A;  4F93 B;  1NG6 A;  3FZV A;  2J5O A;  2V4J C;  3M07 A;  3DPT A;  4DJA A;  4LLN A;  1IXS B;  2FU4 A;  2Z33 A;  2R93 J;  1P4X A;  2YPR A;  5FKL A;  1H8A C;  1T6S A;  3AG1 H;  1DGW Y;  1IO2 A;  3GFM A;  3V4G A;  2HQ5 A;  2VBW A;  4F92 B;  3C7J A;  3H3Z A;  1QO0 D;  4FCY A;  2NS7 A;  5IP7 J;  3KE2 A;  1IC8 A;  5LHH A;  4M6X A;  1W5S A;  4P1W A;  5M5W J;  1UEL B;  3V8J A;  1Z7U A;  2HYF A;  4CCL A;  4KNY A;  3E5X A;  5IYD J;  1SD7 A;  5BMZ A;  5LRR A;  1KU7 A;  4XOP A;  1TL8 A;  1SFO J;  2LOO A;  2BY2 A;  4KYW A;  2CQ7 A;  1U8B A;  4NC6 A;  2L9S A;  3FM3 A;  2ECC A;  4A3I J;  4UV9 A;  2R7Q A;  1FEX A;  3JRG A;  3DKW A;  3PFI A;  4IX7 A;  4XLF A;  3OYB A;  1MND A;  2HYJ A;  3DEE A;  2X6W A;  3CF5 F;  3JRB A;  2V9P A;  3GME A;  3AKZ A;  3M8F A;  1XGN A;  2GXA A;  2MYS A;  1A35 A;  3CDI A;  2XAJ A;  4XL9 A;  2M4K A;  1FOY A;  2CW0 F;  1EH7 A;  2LDU A;  2VT3 A;  4XKC A;  3TOA A;  1QPI A;  1YS6 A;  3GFI A;  1ZN2 A;  2DA1 A;  4KIF A;  3L7W A;  2LFB A;  5HVQ C;  2YS9 A;  2B63 J;  3GO5 A;  2WBM A;  4KJZ A;  3ZMT A;  2CH0 A;  3QRF F;  1W4M A;  3MD2 A;  4B3X A;  3DF8 A;  2M0C A;  1Z77 A;  1D5Y A;  1J9I A;  4R79 A;  2OPT A;  2QYO A;  4NQW B;  4PFO A;  2RRE A;  4GRI A;  5E3O A;  4P9U A;  4FET A;  4DIQ A;  1NH3 A;  5IPA A;  3GCM A;  3QPS A;  1UG2 A;  5BOX A;  2FOW A;  4DYR A;  1R4N B;  3GF2 A;  1TW2 A;  2JMW A;  2WC2 A;  1TNS A;  2O8X A;  3L2U A;  3K4K A;  3I4P A;  4UB6 C;  2R5Z B;  1O57 A;  2QWW A;  1YTY A;  3WTV C;  4DQ2 A;  2HKO A;  2M1B A;  1ITY A;  4EM1 A;  3HOS A;  2NOG A;  2OTJ I;  2OA4 A;  4MTE A;  4M9Z A;  5HOD A;  5AIQ A;  4OIR F;  1R58 A;  2HVQ A;  3CME I;  1BIA A;  1YIJ I;  3SFZ A;  1BJZ A;  1WPK A;  2ZJP F;  1I5Z A;  3EYY A;  3KLO A;  3JAM Z;  1T33 A;  1YE9 A;  3CUQ C;  2GOX B;  2AQF A;  4UUS B;  2QKM B;  4HNV A;  3FDY A;  2STT A;  3OIQ A;  3B73 A;  5FFX A;  2V6E A;  4A3G J;  5GP9 A;  1ON2 A;  2CU7 A;  4BYY A;  2QQA A;  2BY1 A;  1X3Z B;  3W3C A;  4PSW A;  4PJN A;  5FGM A;  3T1B A;  4IKF A;  3HOU J;  3IC7 A;  1Z7L A;  2FRH A;  3H5A A;  1K7A A;  2L9R A;  2NRA C;  3CC7 I;  4E7J A;  1MMS A;  4RLF A;  2X51 A;  4LJZ F;  4LG0 B;  1SAN A;  3K1P A;  1KQ9 A;  4MQV A;  3T5X A;  5K1Y A;  5DEQ A;  2EFW A;  1ZTR A;  1AWC A;  2ZXJ A;  1B72 B;  4BXF A;  1T8I A;  1IW7 F;  3LA2 A;  2WB1 N;  3LFU A;  4IVN A;  1ETQ A;  3OS0 A;  2KRF A;  2XF7 A;  5FB2 A;  3FXO A;  2HTJ A;  1A5J A;  3A01 B;  3TBI A;  3TW6 A;  2R7O A;  5ILS A;  3LL7 A;  1K4T A;  3K70 C;  2HNH A;  3HEF A;  2HVS A;  1F43 A;  4FE4 A;  3QP6 A;  2JSP A;  3P5J A;  4C3H J;  4KT5 C;  2OBP A;  4YIR X;  3DCF A;  2DN0 A;  1FYK A;  2E1C A;  4I2O A;  1BL0 A;  1D8J A;  3R61 A;  1E2X A;  4I02 A;  6PAX A;  1VZ0 A;  4LK1 F;  2V1N A;  3DBL B;  1O3S A;  4F52 A;  3A0H C;  4MFE A;  1I39 A;  1G59 A;  4KFC A;  2VKV A;  3CJN A;  4B09 A;  1KQ0 A;  1W7P B;  1UAA A;  4UUV A;  3H35 A;  3D1N I;  4Q47 A;  2W00 A;  4BEH A;  1LPQ A;  3DPU A;  4G7H F;  1RIO H;  3BJA A;  2CQX A;  3PO3 J;  1IN7 A;  2VIX A;  1HA8 A;  3K2Z A;  4XRF A;  3J7Y J;  1TZL A;  5CVU A;  3RPU A;  3ERM A;  1V54 H;  1I1S A;  2R7S A;  1WRJ A;  3VYS B;  3N4M A;  1ZRF A;  2DOF A;  5FJ8 J;  3BG7 A;  2DA6 A;  2VKH A;  4MO7 A;  5EZH A;  1FIA A;  5B5E C;  1TNT A;  1YJW I;  1O7L A;  1ZYR F;  2H8W A;  2VJJ A;  1RPW A;  1SD5 A;  2MG4 A;  4PGH A;  2XPV A;  4BU2 A;  3H0D A;  3FKI J;  3MQ0 A;  5JHU A;  1G3S A;  3GBG A;  5B1A H;  2HR3 A;  1WH5 A;  3S2D J;  2M3A A;  1GV2 A;  2DOE A;  3E97 A;  2XF5 A;  4O5V A;  5HLI A;  2ADU A;  2DFE A;  3CLQ A;  5DCF A;  2PMZ A;  2GXG A;  3BLY A;  3EDP A;  2CV1 A;  4Y13 A;  1FMV A;  1B8I A;  2QM3 A;  3AAF A;  2BHZ A;  4F55 A;  4E7L A;  2XSD C;  3CJR B;  1R5H A;  4GGG A;  2EFO A;  1OFC X;  3CCQ I;  1VQ5 I;  1QBJ A;  2QF7 A;  5GAE J;  2WY7 Q;  2DXI A;  2CW7 A;  5J8F A;  3DLA A;  3HTS B;  2K27 A;  2DOA A;  2L54 A;  2MFZ A;  2B9S A;  1QVU A;  2D45 A;  1AKH B;  1YJ9 I;  2P6T A;  1FYM A;  3OYN A;  1Z6T A;  4I6Z A;  1K83 J;  2OAZ A;  1MBE A;  3DQV C;  1H89 C;  4ENK A;  4CSW A;  3ZCO A;  3K70 D;  1WJD A;  3LSK A;  3HZJ A;  4NB5 A;  2JSC A;  3QOD A;  1VND A;  5GAG J;  2PJR A;  3H9G A;  2XAG A;  3OOU A;  1D0X A;  2FSW A;  4EAT A;  5K7F A;  1FSE A;  4BDZ A;  1FBQ A;  2FX0 A;  4OIQ F;  1VQ6 I;  5AON A;  2PG4 A;  2VPL A;  3QPT A;  4ZYH A;  5ICG A;  1K79 A;  1MJB A;  4RMN A;  2XHK A;  2ELJ A;  3BZK A;  3GW2 A;  5FRM A;  3ONQ A;  2MW8 A;  4P9F A;  1R1U A;  3CJQ B;  1FP1 D;  1E3H A;  3ZMV A;  1IDY A;  3P7N A;  4QPO A;  3CCE I;  5CJ9 A;  2GA1 A;  2NNN A;  5FD5 A;  5HS8 A;  3G3Z A;  1J7K A;  5DV5 A;  2LBF A;  3I3L A;  3V42 A;  2CQK A;  3MKW B;  2WY8 Q;  2XAH A;  5E3L A;  3WE3 A;  4PJM A;  5DM6 F;  1XX5 A;  3JRF A;  1VQ9 I;  3ZQH A;  1GUU A;  2O9L A;  1ACI A;  2F2E A;  1S5L C;  3JAM K;  1RR8 C;  2XGE A;  4YRV A;  3V7S A;  2A07 F;  1HDP A;  2HZT A;  2XGX A;  2P5K A;  2QSH X;  1FOX A;  1EH6 A;  1I3Q J;  1WWX A;  3H92 A;  2K9Q A;  3HPH A;  1HF0 A;  5EYR A;  1YW9 A;  4U0W A;  3IV5 A;  1XC5 A;  2QZ8 A;  2DI3 A;  4KT6 A;  4FAS D;  1UHS A;  4A0Y A;  1FPQ A;  2IGN A;  2XC7 A;  1LB2 A;  3PUF A;  4XLC A;  5EEH A;  1U3E M;  4OWR B;  1Z67 A;  3O3K A;  3OYE A;  3LNQ A;  4MGR A;  1JE8 A;  4A3E J;  1BIB A;  1NK3 P;  4A3J J;  3PFY A;  1IN5 A;  3MZY A;  3BG6 A;  5F27 A;  2E19 A;  2E1M C;  1EV7 A;  1S3J A;  1X4P A;  3W6K B;  4G12 A;  4YEL A;  1VQO I;  3TDU C;  2JPB A;  2MD5 A;  3CCV I;  2DOD A;  3IKT A;  2HQN A;  2DFI A;  4XN3 A;  1APL C;  4XID A;  1V5E A;  2MLK A;  5KCM A;  1HOM A;  1S9H A;  3A03 A;  2OV7 A;  3N05 A;  5C4J J;  3JTG A;  2BE5 F;  2I5U A;  2NS0 A;  4HSR A;  5K7Z A;  2L4M A;  2KDO A;  5TIS C;  3M8J A;  5E3M A;  5IP9 J;  4OOI A;  2CYY A;  5GAH J;  3LSH A;  4J01 A;  4PJ0 C;  3HG9 A;  1T0F A;  1P4W A;  3DPL C;  1WHU A;  3MZH A;  4GDF A;  2COB A;  2WTE A;  2KPM A;  4M9X A;  5D5X B;  4LIU A;  4J19 A;  2XKO A;  4XR6 A;  3DP7 A;  3H3U A;  2Z99 A;  2HDW A;  1JKR C;  3JRA A;  3AG4 H;  3I0T A;  2CQN A;  2M8E A;  3OYK A;  2FBH A;  4JK1 X;  4M3F A;  2ZB9 A;  4IEJ A;  1YG2 A;  3EUH A;  4IJA A;  1TT0 A;  4HST A;  1ZQ3 P;  1IJW C;  1OIS A;  2PQ8 A;  2CJJ A;  4PJL A;  4LB6 B;  3WGG A;  5F0H A;  3Q0V A;  3F72 A;  1UHW A;  3O8H A;  4BHB A;  5LGN A;  1YI2 I;  2V7F A;  1ZRD A;  1ZHF A;  2W57 A;  3MN2 A;  5A2Q Z;  2BW3 B;  2KKO A;  4RGS A;  2EFQ A;  9ANT A;  2HGC A;  3FF5 A;  2ME0 A;  3OYJ A;  3RZD J;  2ZME A;  2BY0 A;  4ZZD A;  5F08 A;  1LE8 A;  4A69 C;  2ZC2 A;  1IXC A;  1X4O A;  1FWZ A;  5HDK A;  4HDV A;  3QU6 A;  4I99 C;  2E34 A;  4XSZ F;  1FSH A;  2M45 A;  5J4Y A;  4GXO A;  2O03 A;  2FQ3 A;  2F4I A;  4R8H A;  3I4M J;  3HRU A;  3DTI A;  2QKL B;  4OMY A;  2MH9 A;  3ABT A;  1USS A;  4B44 A;  2UZK A;  1PVE A;  3TOB A;  2JN6 A;  3SDB A;  2HDD A;  2JZY A;  2BZT A;  2J5P A;  4IQJ A;  3GTM J;  2KMU A;  4XON A;  2K40 A;  1YX3 A;  2WAQ N;  4S05 A;  4BAY A;  3TO6 A;  4I76 A;  1ZRC A;  2XSJ C;  2LD5 A;  3FBI B;  4EJU A;  3HOT A;  1Y0N A;  2ECB A;  4A93 J;  2VT2 A;  1X2M A;  3PM1 A;  4GYG A;  1TC3 C;  3PJR A;  4BBR J;  3FXM A;  2UV1 A;  5J1Y A;  5GTH C;  3BTI A;  4RM3 A;  4HDU A;  1BC7 C;  2CWE A;  1YIO A;  2IXS A;  3SEZ A;  1IDZ A;  2DJN A;  1Z3Y A;  3CCM I;  2F48 A;  1W0T A;  2Y0S A;  2ISZ A;  2VL8 A;  2VON A;  3F0C A;  2K9L A;  3GYH X;  3DKY A;  4P5O A;  3S14 J;  5E1X A;  3HOW J;  1R5I D;  1HW1 A;  4IQ4 A;  4AD9 A;  2NS8 A;  5KK1 A;  1JJ6 C;  3FK6 A;  2UXX A;  3IHU A;  4AIH A;  1HXD A;  1FTT A;  2ID6 A;  5FKM A;  3HDD A;  1LDD A;  1MNM C;  3K2A A;  2CV2 A;  4OU0 A;  4OIN F;  3J7Z I;  2DPD A;  4XRS A;  3BT9 A;  2V9V A;  4YEJ A;  1ZR2 A;  3SZT A;  1Z05 A;  4DZJ A;  1YRN A;  3M1E A;  4JBA A;  1PDN C;  1GXQ A;  5D8K B;  4ESB A;  4LB5 A;  4IF4 A;  1XPX A;  2EZK A;  1D1C A;  4N4O B;  3ZQI A;  3R60 A;  1MBJ A;  2XGD A;  4CCO A;  1MKM A;  1KU3 A;  2GAU A;  2RKH A;  4WXH A;  2VLA A;  2IW5 A;  4G7Z F;  4XLA A;  1JI8 A;  4QIW N;  2DMU A;  3AL0 B;  1D0Z A;  1B4A A;  3CUQ A;  3Q0U A;  2Q1Z B;  2QQ8 A;  1OKR A;  5FKN A;  3I71 A;  1Z3X A;  3SXY A;  4ZJZ A;  3H36 A;  3A0B C;  1XMX A;  3F8M A;  4IOA F;  2NYX A;  5AIP A;  1KA8 A;  3TDZ C;  2DMT A;  3CP2 A;  3ZN0 A;  3WU1 B;  2CW8 A;  2P4W A;  3OR2 C;  5E79 C;  2OJE D;  2DBB A;  2X9D A;  3X2Q H;  1DPR A;  2K3F A;  1ETK A;  3GLL A;  4MFD A;  4PK4 A;  4RAY A;  4HPQ A;  1LDK B;  2M9H A;  4I0B A;  2EPF A;  4W1U A;  1HBX G;  4N9H A;  3RJP A;  3FXQ A;  3WU0 A;  1U0J A;  2IA1 A;  1VQP I;  2OUM A;  1DGR M;  3A02 A;  2YX7 A;  1Y1V J;  2M4G A;  2OCC H;  3RKX A;  1NHA A;  4D7N A;  3HJE A;  5JFR A;  5D4R A;  2HEO A;  1IRG A;  3PNV A;  5E17 F;  3H9J A;  5IT3 A;  4LG3 A;  4C3I J;  3FMR A;  3NEU A;  2RDP A;  1B8I B;  1ORK A;  5L3C A;  2W48 A;  3CMM A;  4RGU A;  1N25 A;  1IN8 A;  3FKJ A;  4A0Z A;  1Y39 A;  1U8R A;  2JUC A;  3K0L A;  1RKW A;  4U0Y A;  3H5R A;  1SMY F;  1QHH D;  2VE9 A;  4XLP F;  5TGT A;  4M9S A;  1GT0 C;  2O3F A;  1YFH A;  1XCB A;  3I5U A;  4ITV A;  2CSO A;  2CUF A;  3W6V A;  2FML A;  3IAS 2;  3FIW A;  2H09 A;  2HOA A;  3DBR B;  4KN4 X;  1ETY A;  3E0J B;  1BW5 A;  2R7Z J;  2B7E A;  1BW6 A;  1WVR A;  1FC3 A;  2KP6 A;  2VE8 A;  4E7Z A;  5CVJ A;  2YSR A;  4DYC A;  4A5M A;  2OTL I;  2NVY J;  4IRH A;  2RV8 A;  5A2Q K;  4J00 A;  1PJR A;  1YYV A;  2HPI A;  4II3 A;  3BG9 A;  2X6X A;  3FBN B;  4M6V A;  1SFU A;  4CCM A;  1BA5 A;  4S0H B;  4NHJ A;  4Y7N J;  1YIT I;  4LOC A;  1DP3 A;  4A3B J;  2LK2 A;  1ETV A;  4UUT A;  4GO1 A;  1DUX C;  4IHV A;  3EUH C;  3QYB A;  4Y52 J;  1VQ7 I;  1WI3 A;  3BG3 A;  1IRX A;  3K4M A;  3PL8 A;  2E2I J;  3ZPL A;  3BWG A;  3BCA A;  1MGT A;  2DT5 A;  3L09 A;  3FHN A;  3S17 J;  4C2M J;  3Q9V A;  1IN4 A;  2KIQ A;  4B8X A;  1N78 A;  2XAF A;  2CO5 A;  4Y17 A;  2JA8 J;  3KP6 A;  5HS9 A;  3V8K A;  1SEU A;  1B9N A;  5DTD A;  2ZME C;  4IL6 C;  3U1D A;  1XS9 A;  1FNN A;  4JYK A;  1XMK A;  4U88 A;  1R49 A;  2YU3 A;  3HHH A;  2UUZ A;  1FX7 A;  1VQL I;  2JQ7 A;  2D1V A;  5J8C A;  3CO7 C;  1FOW A;  2W24 A;  1MDM A;  3J80 Z;  2CRG A;  3VYU B;  5FLM J;  2L2O A;  4ANJ A;  2BYV E;  3BR2 A;  3M7G A;  2H8R A;  2QQB A;  3LSR A;  3SHF A;  4AYB N;  3KFW X;  4KIC A;  2AXL A;  4X6A J;  3EUK L;  1FY7 A;  3HSR A;  2HVR A;  2F5F A;  4RGR A;  3KCC A;  2LC2 A;  4KMF A;  4PUS A;  2VBZ A;  4D7M A;  4BXX J;  2ISY A;  2ZXI A;  3UKG A;  1E17 A;  4BY7 J;  4ENN A;  1R1V A;  2QBY A;  1SC7 A;  1IRF A;  3JRD A;  1BI3 A;  4YIF A;  3GZN B;  5ICF A;  2X6O A;  1XSX A;  2F5E A;  4Q48 A;  5HNH A;  3GFL A;  2ACJ A;  2DDA A;  2HPM A;  2Z3Y A;  4UNO A;  2P6S A;  4V2G A;  3DTE A;  2ZXH A;  4JQF A;  5J4V A;  4BHP A;  4CZZ A;  2XRO A;  2EIJ H;  3L1P A;  1A31 A;  1S29 A;  4CGZ A;  3L9F A;  1MBG A;  3BPX A;  2HOT A;  4UB8 C;  3M3Y J;  2M34 A;  3ELK A;  3VOE A;  4G8X A;  5KHD A;  2DPU A;  4NDL A;  4HX4 A;  4QTR A;  2DYR H;  2EB7 A;  2F4O B;  2EFN A;  1X2N A;  4BE1 A;  1U6G A;  2Y0M A;  5BPI A;  3K4N A;  2IGK A;  4KDP A;  3VDX A;  1PUF A;  1F5T A;  2V26 A;  3ZXS A;  1GVD A;  4Z2Y A;  3GTK J;  5H2F C;  5FKK A;  1FYL A;  3GVA A;  4IXA A;  1T39 A;  1JJ8 C;  3HOX J;  1BC8 C;  3CDH A;  3KP3 A;  4RM2 A;  3CCY A;  1NG7 A;  5LD2 C;  4BDY A;  4GYI A;  3K9T A;  1H0M A;  1WJ5 A;  1O4X A;  1JUM A;  3TMO A;  1I3A A;  3CES A;  3PQK A;  2LRD A;  3S2W A;  2KIF A;  1LE8 B;  1PP7 U;  1V4R A;  1P92 A;  2IS4 A;  4GCV A;  2Y9Z A;  2Z16 A;  3DTK A;  3OYC A;  4HX7 A;  3JR9 A;  4A0X A;  4CCJ A;  1JTX A;  1BM9 A;  2DA2 A;  3WGI A;  5F0F A;  3VWB A;  4CH7 A;  1R7J A;  3FXK A;  2ELK A;  4B3A A;  1I6H J;  3HRM A;  4QLC U;  3K1N A;  3BQY A;  5FFZ A;  1JKO C;  3RI4 A;  2JA5 J;  1J59 A;  3U21 A;  3DXJ F;  1BBY A;  3NRV A;  2PMU A;  3SZP A;  5F1J A;  2IJL A;  2CFO A;  3PSF A;  4IZZ A;  2NXN B;  5J1U A;  2ME6 A;  2XPW A;  2PX9 A;  2Y30 A;  4HRI A;  2EIL H;  3BOQ A;  4ZYE A;  5LFA A;  1OYW A;  1IN6 A;  3C3W A;  5J47 A;  4BKX A;  1FOK A;  3I54 A;  3H1C A;  2VKD A;  3TP3 A;  1K6Y A;  2QSG X;  1MJ9 A;  2JJ7 A;  4UVC A;  3I9V 2;  1ZG1 A;  4NBQ A;  4A6D A;  3BPV A;  2PMZ N;  5EEG A;  3GTG J;  1SFX A;  5HLT A;  3CMA I;  2AXT C;  4FTH A;  3R6S A;  3DLL F;  3K4J A;  2DT7 B;  4CA0 A;  3DEU A;  4ZTF A;  5E8G A;  2D1H A;  1WCM J;  2PN6 A;  1TTY A;  5DCM A;  5KNL A;  2C6Y A;  3DU6 A;  5E20 A;  1LUJ B;  4QPQ A;  1RUN A;  1OLT A;  1T08 B;  3OS1 A;  2L7F P;  2G0E A;  1HCR A;  1ULY A;  2IAI A;  4RS8 A;  4BHC A;  1Q1V A;  4L18 B;  1MBF A;  1FLI A;  4BGD A;  3U9G A;  4RBO A;  2L4A A;  2XRN A;  3BR1 A;  3F8B A;  4XSX F;  3W2V A;  3QU3 A;  4HX8 A;  3F21 A;  1K4S A;  2BXY A;  4XRS G;  4IHX A;  2LY2 A;  3J80 K;  3CUQ B;  2EQR A;  2VQG A;  4IHY A;  3OIP A;  2R7V A;  1L0O C;  2DK8 A;  5D5U B;  3RPQ A;  2E1N A;  1HKS A;  2PEX A;  3OMY A;  1QU3 A;  4UVA A;  3S15 J;  1KU9 A;  4G94 A;  4CXF A;  2VPR A;  2R7D A;  1UHM A;  3W2A A;  1HQC A;  2B0L A;  4G9Y A;  3GWZ A;  1FT9 A;  5M5X J;  5L3G A;  2JPC A;  1AOY A;  2DFF A;  2EJR A;  3M9A A;  3HGG A;  1IG7 A;  2D5V A;  1HW5 A;  2DMQ A;  1R1T A;  1J5Y A;  1BR2 A;  4F91 B;  1HLV A;  2MLG A;  3F22 A;  1SVM A;  2R3S A;  2VQL A;  5CQG A;  4M6Y A;  4C3J J;  2N8G A;  3D5L A;  3CD6 I;  3JCU C;  3L2W A;  1XDS A;  3WTX C;  2E60 A;  2EWN A;  4XKW A;  3RTR A;  3PO2 J;  4LFU A;  4IHT A;  1WSU A;  1WZ2 A;  1WFX A;  1BOA A;  2K4B A;  3GTO J;  5DUI A;  3T8R A;  1VF9 A;  3FM5 A;  1ZK8 A;  3GFJ A;  3B6C A;  2IS2 A;  2DU9 A;  2LKS A;  4I98 B;  2KIU A;  4HF1 A;  2OQG A;  1GXP A;  1G8X A;  2YR2 A;  3DBH B;  5BQT A;  4XQF A;  4YFN F;  4QWQ A;  5LBQ A;  3ECO A;  1Y8Q B;  3OYH A;  1SMT A;  1SD6 A;  1K78 A;  2AQE A;  5GPA A;  1Z91 A;  2VKE A;  4UHT A;  2VJI A;  4X0G A;  2Z1D A;  3GUD A;  4PDK A;  2V1U A;  3S1M J;  3K69 A;  3FIS A;  5IY5 H;  1Z9C A;  3HTU A;  2GIZ A;  3G1M A;  3PQJ A;  4E70 A;  2RGV A;  1QHG A;  1DQU A;  5KVR A;  1R5G A;  3ZMU A;  1TW3 A;  3K4C A;  5DD4 A;  1KGS A;  5D5W B;  1ZRE A;  3OSG A;  2W25 A;  2LRE A;  3E6C C;  3MKY B;  4ZYA A;  3L2C A;  4M74 A;  5L3F A;  1VQ4 I;  2VOD A;  2A6T A;  2EV5 A;  5EGO A;  4HEA 2;  4L5E A;  2XVC A;  2FNP A;  4FX4 A;  3S93 A;  5F1R A;  3LWF A;  3HKZ A;  5H20 A;  3WTW C;  3AG2 H;  3LST A;  3ML6 A;  3DEW A;  1JGS A;  1OYY A;  3BC8 A;  1FMW A;  3CCR I;  2VAS A;  5EG0 A;  3F8N A;  3OYD A;  2KDZ A;  4ETS A;  2VC0 A;  2ZXW H;  2V79 A;  2D2W A;  3BTJ A;  3CZ6 A;  3CCU I;  3G2B A;  4BQA A;  1W5T A;  1B9M A;  4M73 A;  3DU5 A;  4LIV A;  4LLG F;  1TP4 A;  1RI7 A;  4ZYG A;  5CVR A;  4CHU A;  4H0E A;  2MD0 A;  4OAY A;  2WV0 A;  3SJM A;  4MNU A;  4ZH4 F;  3GEZ A;  5DDG A;  3SQN A;  4NNJ A;  2QBY B;  4A3C J;  2HQA A;  2E1O A;  3KPH A;  4RAF A;  4YFK F;  2R7X A;  1GDT A;  2IGM A;  2F4M B;  2HYG D;  2X6Y A;  3HGY A;  3WE2 A;  2CG4 A;  3ABL H;  5EDN A;  4AIJ A;  2EV6 A;  1MBH A;  2GA2 A;  4XRM A;  1SFK A;  3LSM A;  1XMA A;  3B02 A;  3LSJ A;  4E6K G;  1QA6 A;  1TQP A;  2O6G E;  2K85 A;  1RET A;  3EPZ A;  4M3D A;  3HYI A;  4M3B A;  3WG7 H;  5H6Q A;  5K7H A;  2E5Z A;  2M7B A;  2A6E F;  3A4C A;  3UNG C;  2KT0 A;  4UY8 I;  2E71 A;  4A6E A;  2LY1 A;  4NQW A;  2LY9 A;  4AWX B;  1EKE A;  2KL4 A;  5M5Y J;  2FUG 2;  2DMP A;  2IS1 A;  5LHI A;  1UMQ A;  1IUY A;  1TWG J;  3VEP A;  4EM2 A;  3HUG A;  3LSI A;  4BQO A;  3VFZ A;  3CP8 A;  3KP4 A;  1OJL A;  4ENM A;  2R5Z A;  1PUF B;  4EGZ A;  1MD0 A;  4OMZ A;  1ZG5 A;  1W36 C;  3I53 A;  2XB5 A;  2ELH A;  1D0Y A;  1D1A A;  2W82 A;  2BVM A;  3TQN A;  2ZBK A;  4C30 A;  2K5C A;  1TWC J;  2R4G A;  2A3S A;  1IZ1 A;  4LGW A;  5TRD A;  4A3L J;  2W1O A;  1IGN A;  4AID A;  1WQ2 A;  2VBY A;  3IH2 A;  1S6L A;  1PP8 F;  3ZMD A;  2KZG A;  1OQY A;  3O8G A;  2E1M B;  2M87 A;  2ZNY A;  4U87 A;  3TL4 X;  1GHC A;  4LMY A;  3VSL A;  2X1E A;  3MMY B;  1P2F A;  3GLX A;  4NC8 A;  1T38 A;  3ZOB A;  4MHG A;  2FF4 A;  3ZGK A;  3RKQ A;  4LG0 A;  2HXI A;  1ZGW A;  1FP2 A;  1MJA A;  1QNT A;  4HZF A;  1LVA A;  1JHH A;  4R1H A;  1XN7 A;  4OIO F;  4E7H A;  1IF1 A;  5E3N A;  4U7B A;  3B6A A;  1CF7 A;  2EH3 A;  2W84 A;  1P7J A;  4PZJ A;  2XIG A;  3K6G A;  3ZQ7 A;  4L0Z B;  5DD8 A;  3JSO A;  3CJT B;  4KIS A;  3GTL J;  5IYC J;  2OD5 A;  3A01 A;  4FT8 A;  1SD4 A;  1TT5 B;  3QOP A;  4O3M A;  3I59 A;  1I1G A;  1ETO A;  3HPG A;  5L3B A;  4HOB A;  4AM3 A;  2R7T A;  3BTL A;  3A1Y A;  1ETW A;  1UG0 A;  1P6R A;  2LR8 A;  4CYC A;  3K7A J;  1UJ8 A;  2F5D A;  2QCO A;  1X19 A;  2LVS A;  2OF7 A;  3LMM A;  5K5O A;  4WWC A;  2JUG A;  2YU9 J;  2COM A;  3S3N A;  3H9Q A;  3HHG A;  5CPR B;  2CV0 A;  3LAJ A;  1U5T A;  2G7U A;  4HF0 A;  1ZKG A;  3CTA A;  2KHM A;  2JWT A;  2AS5 F;  2P5L C;  3GZ5 A;  5E18 F;  3KYL A;  1S72 I;  1RKT A;  4LK0 F;  1VQM I;  2CGP A;  4L5I A;  3S32 A;  3IH4 A;  5DCM B;  1IXR C;  4BEH B;  2YX4 A;  2Q2E A;  4HQE A;  2ZSH B;  1NTC A;  2DQL A;  3ROU A;  1P9Q C;  3HOZ J;  3TW7 A;  1W36 D;  1B6A A;  2MC4 A;  5M3F J;  4Y4R A;  2M8G X;  4NC7 A;  4P96 A;  4WF2 A;  4HNU A;  2KQR A;  2VJ5 A;  2WAQ A;  2VBX A;  4JX6 A;  1CGP A;  2FXA A;  1JXS A;  2W85 A;  3S16 J;  4X1E A;  1R4M B;  1D8K A;  4A3M J;  1SAU A;  5FRO A;  3IKV A;  2R7F A;  2V1D A;  2K9M A;  1V5F A;  2P7V B;  2A69 F;  3BG5 A;  3HM5 A;  3CCL I;  3CCS I;  3LAP A;  3D0S A;  3VSK A;  1X3U A;  4AU7 A;  1I50 J;  1TBX A;  1OR7 A;  3MVP A;  5GTI C;  4XLH A;  4WX9 A;  2LF7 A;  4NUB A;  2H6C A;  1E3O C;  2H27 A;  1VI0 A;  2H94 A;  1DP7 P;  1S8N A;  1ZGJ A;  5LLQ A;  3RSN A;  4Z6Y A;  3WTY C;  3ZMS A;  3OY9 A;  3JRH A;  2AO9 A;  3UR3 C;  3VOD A;  3ZQL A;  3RYP A;  2FA5 A;  2A6H F;  1PYV A;  1IAW A;  1W5C C;  2HWV A;  4E4H A;  3W6J B;  4RAG A;  5E1Z B;  3P9K A;  2DO7 A;  4ZDP A;  4F3Q A;  1I6X A;  1ZLJ A;  4L9T A;  2OCE A;  4RB3 C;  3BZC A;  5JLX A;  5JLW A;  3Q0W A;  3CCJ I;  1YJN I;  3D5R C;  2P8T A;  1RZ4 A;  3KX2 A;  3L2Q A;  2PJP A;  2DQR A;  1G4D A;  1LEB A;  3ZP5 A;  1H88 C;  4BBS J;  2L9N A;  4A5N A;  3BCB A;  1QGP A;  1SAX A;  2WAE A;  5F6F A;  3J81 Z;  4C2U A;  3C18 A;  2DK5 A;  3OYG A;  2JA2 A;  3REO A;  1HKQ A;  1REP C;  2ESN A;  2PJR B;  3FXJ A;  3GZ6 A;  2HXO A;  2VB6 A;  1QZE A;  3OSF A;  2MBF A;  3BJO A;  3I64 A;  5C3E J;  2R5Y A;  1OCO H;  3QP5 A;  3TO7 A;  2IBD A;  1QZZ A;  1FIP A;  2DJI A;  2FQ4 A;  2OU2 A;  4DZP A;  1TQM A;  4O6J A;  4RB2 C;  5H6R A;  4WCG A;  1G3W A;  2DYS H;  5HNF A;  2ESH A;  3VYR B;  3M8E A;  4G7O F;  3K10 A;  3F23 A;  4N9I A;  3P9I A;  5J3L A;  3BQZ A;  1K78 B;  4KIT B;  4A3F J;  2LBF B;  2EIK H;  4I01 A;  4II2 A;  5HDN A;  3G1O A;  4A3D J;  2FJ1 A;  1XCV A;  1T56 A;  3ZRG A;  4DBQ A;  5EF6 A;  5IT9 Z;  3KET A;  2GOM A;  3HRS A;  1POG A;  2OZ6 A;  3EET A;  1ZH5 A;  2ETH A;  2R7R A;  2HZD A;  4BXU A;  2ZNZ A;  4FQG A;  3RQ4 A;  2F5C A;  2Q8K A;  5GPC A;  1XSD A;  3NAU A;  3PNY A;  2EZL A;  5HLG A;  1Q1H A;  4ESJ A;  2PMH A;  5F0C A;  4FE7 A;  2IP2 A;  3BR5 A;  2UXN A;  2FD5 A;  2NAZ A;  2VQC A;  2Z2S B;  3LA7 A;  4K2E A;  2QSF X;  2X85 A;  3OL4 A;  4IO9 F;  4L9J A;  4HW0 A;  2HOE A;  1LEA A;  3BY6 A;  3H5N A;  3W2W A;  5J6X A;  2QUF A;  2R7W A;  1OCP A;  1XTA A;  3BR6 A;  1PUE E;  3M1C A;  5EGO B;  2ZJ2 A;  3H3V K;  1X1C A;  3ESW B;  4XOT A;  1FJL A;  5LGT A;  2W4S A;  1VQN I;  2Y75 A;  1KYZ A;  1TLH B;  1BI0 A;  4F7Z A;  2XAU A;  4YII A;  2LKX A;  4AIK A;  1XG1 A;  3BDD A;  3EYI A;  5HOO A;  2O0Y A;  2P0W A;  4BUP A;  2BBY A;  2KIM A;  2CUZ A;  4BAC A;  1IUF A;  3Q5F A;  1ZEL A;  5EG0 B;  3O6B B;  2P7C B;  3T8T A;  5JHF A;  1ZG3 A;  5CVI A;  4L0Y B;  2IS6 A;  1HW2 A;  2JA6 J;  4WXC A;  4HV5 A;  4RLQ A;  3ISP A;  3OR1 C;  5IOY A;  3MZ8 A;  4N4N B;  1VTN C;  1VFC A;  1VQ8 I;  3NWS A;  2FNA A;  2STW A;  2AHQ A;  3KZI C;  3VPR A;  2NVX J;  1WJE A;  1ZAR A;  2DLL A;  4ESF A;  4PJJ A;  2WA0 A;  2RNG A;  3PIO F;  2V1X A;  1HC8 A;  1C0W A;  3J7A O;  4MLO A;  1Z1D A;  3HB9 A;  3S3M A;  5ILU A;  1CQT A;  2Y9Y A;  3DWL E;  2Y48 A;  2ZFU A;  3G1L A;  2MAB A;  3OYL A;  2LLK A;  4BY1 J;  4MQ9 F;  1YHQ I;  1ODD A;  3LQR A;  3HXL A;  5ILV A;  4HYE A;  2GBY A;  3NAR A;  1ON1 A;  2ZFW A;  3BR3 A;  4KIB A;  1XSV A;  1G2H A;  3MKL A;  4HBL A;  5JVG F;  1OMI A;  3ULQ B;  4S04 A;  3L2R A;  4ZDL A;  3P9C A;  2BW3 A;  4EGY A;  1JKQ C;  3CO6 C;  1U5T C;  4AYB A;  4BJT A;  3PIP F;  1F36 A;  2MH2 A;  2IT0 A;  3HUG B;  4FHT A;  5KAF C;  1D3Y A;  2HKX A;  2DDB A;  4CDG A;  5EEA A;  2GLO A;  2ZME B;  3CLO A;  4PFP A;  3DV8 A;  2YUS A;  2Z5U A;  2ZCW A;  3OIO A;  1A6I A;  3E1S A;  2KFD A;  1SVO A;  1YO5 C;  3V7C A;  4LLL A;  3VB2 A;  2A68 F;  4Q5S F;  1R22 A;  3MAJ A;  3FXU A;  4IRG A;  1BR4 A;  4V19 K;  2XF6 A;  4EM0 B;  4M3E A;  3NWT A;  4PSX A;  1J2X A;  1OCC H;  3CQZ J;  3S3O A;  2LP0 A;  3IUO A;  2WWY A;  2DFH A;  2RAE A;  1JUP A;  3JRC A;  5FRN A;  1X1D A;  1DPU A;  1OR7 C;  4FIS A;  3MCZ A;  4EVI A;  1F9N A;  2M5W A;  4XN0 A;  4RDU A;  5F04 A;  1AA7 A;  2CQQ A;  3N97 A;  3KP2 A;  2ZJQ F;  4CCK A;  5C4X J;  5GAD J;  5IP6 A;  4XBF A;  1RR7 A;  3J81 K;  3Q3S A;  1K61 A;  3JRE A;  2OC6 A;  1U9O A;  4I09 A;  2DA5 A;  2GIV A;  4IHW A;  3PNT A;  3KYD B;  3GTQ J;  4U7D A;  1CF7 B;  2E2J J;  1T95 A;  4L9V A;  2IRF G;  2IGO A;  1GLN A;  2XRL A;  1XD7 A;  2VXZ A;  3SFI A;  3QPL A;  5JVT A;  3S1Q J;  3I59 B;  3I56 I;  1V55 H;  3RZO J;  3FX3 A;  2L01 A;  4BH9 A;  4D1Q A;  3E5U A;  1MSE C;  1YRN B;  2VUM J;  3GX4 X;  3GTP J;  4CYC B;  1GV5 A;  1UFM A;  5IT9 K;  4D9J A;  1VQK I;  1YQA A;  2E7W A;  1V3F A;  3IP4 B;  4UVB A;  2KLO A;  2LTP A;  2FBK A;  4L9N A;  2IEK A;  2TDX A;  4HV6 A;  1U5T B;  5CQE A;  1FTZ A;  1W7P D;  1ZGA A;  1EH8 A;  1W1W E;  2EV0 A;  3IH3 A;  3MEX A;  4RGX A;  2VOO A;  1SFE A;  5JR3 A;  2JA7 J;  4UV8 A;  5D4S A;  4BE2 A;  1O3Q A;  3OV8 A;  2Q2E B;  2NVU B;  2CUE A;  3OYI A;  3L2V A;  4XKV A;  2K4J A;  1V5G A;  3KEO A;  1SVL A;  2H1K A; 
#chains in the Genus database with same CATH homology
 3CP2 A;  3AKZ A;  2CW8 A;  2R7X A;  2IGM A;  3OR2 C;  2X6Y A;  4XLE A;  2MYS A;  4B47 A;  2WB1 A;  3OS2 A;  3LSG A;  4XL9 A;  2M4K A;  4PK4 A;  1MMA A;  4HPQ A;  4DOZ A;  1LDK B;  1SFK A;  4XKC A;  3LSM A;  3ZQQ A;  1U0J A;  1WJC A;  4E6K G;  5HVQ C;  3EPZ A;  2WBM A;  4KJZ A;  2OUM A;  1DGR M;  2CH0 A;  2E5Z A;  2M7B A;  2M4G A;  3MD2 A;  3A4C A;  4Y3O A;  3UNG C;  4B3X A;  3DKX A;  4R79 A;  2LY1 A;  2NOJ B;  3PNV A;  4NQW B;  4PFO A;  2RRE A;  4GRI A;  2BVL A;  3H9J A;  4FET A;  2KL4 A;  4LG3 A;  4BS9 A;  2FUG 2;  4DIQ A;  2IS1 A;  2CUJ A;  3F9K A;  3LSI A;  4BQO A;  3CMM A;  3CP8 A;  3L2U A;  3K4K A;  3FKJ A;  1LKX A;  1W36 C;  3EUA A;  3HOS A;  1D0Y A;  1D1A A;  1WJF A;  2BVM A;  2W82 A;  3H5R A;  3OYF A;  1QHH D;  4C30 A;  2K5C A;  2HVQ A;  5TGT A;  2R4G A;  3KEY A;  4ITV A;  3IAS 2;  1LVK A;  2W1O A;  3E0J B;  4E7K A;  1YE9 A;  2GOX B;  2AQF A;  2KP6 A;  4E7Z A;  2E1M B;  2JVH A;  2KRH A;  2QKM B;  4U87 A;  3TL4 X;  3FDY A;  3OIQ A;  3VSL A;  2X1E A;  2WAF A;  3MMY B;  4J00 A;  2V6E A;  1PJR A;  2HPI A;  4II3 A;  2X6X A;  3FBN B;  4NC8 A;  1BOB A;  4PSW A;  4PJN A;  3W3C A;  4IKF A;  4CCM A;  1Z7L A;  3H5A A;  3AFH A;  4XOR A;  4E7J A;  4RLF A;  3ZGK A;  2I8D A;  2X51 A;  1N77 A;  1DP3 A;  4OAZ A;  4CUG A;  3EUH C;  3QYB A;  4E7H A;  4U7B A;  3K4M A;  1IRX A;  3PL8 A;  3ZR8 X;  4BXF A;  3BCA A;  3K6G A;  2VQH A;  3LFU A;  3FHN A;  3OS0 A;  4KIS A;  2LYC A;  2XF7 A;  1N78 A;  3TBI A;  2R7O A;  3HPG A;  3LL7 A;  1D1B A;  2K3P A;  2F5V A;  2WAD A;  3K70 C;  2R7T A;  2HNH A;  3A1Y A;  2HVS A;  1UG0 A;  2JSP A;  2ZSI B;  2UUZ A;  2KZV A;  1X19 A;  4XMY A;  3SEQ A;  3LMM A;  2O5R A;  2JUG A;  4ZC3 A;  3VYU B;  4E7I A;  2L2O A;  4ANJ A;  1VZ0 A;  2V1N A;  3S3N A;  3H9Q A;  5CPR B;  3EUK L;  4F52 A;  2CV0 A;  1G59 A;  2HVR A;  2KHM A;  2LC2 A;  4PUS A;  1UAA A;  3OL3 A;  3KYL A;  3H35 A;  3PUB A;  2ZXI A;  2W00 A;  4BEH A;  3S32 A;  4BEH B;  3DPU A;  2ZSH B;  3K4B A;  1P9Q C;  1W36 D;  2VIX A;  5HNH A;  1HA8 A;  2MC4 A;  4Y4R A;  1R6R A;  1TZL A;  4NC7 A;  4Y33 A;  4HNU A;  2HPM A;  2KQR A;  2VJ5 A;  2WAQ A;  2JVG A;  2R7S A;  3IAM 2;  3VYS B;  4LIT A;  3BG7 A;  3DTE A;  2VKH A;  2F6C A;  2ZXH A;  4JQF A;  1SAU A;  5FRO A;  4BU2 A;  2VJJ A;  1MW7 A;  2K9M A;  2VXD A;  3H0D A;  1V5F A;  4CCN A;  3GBG A;  4B48 A;  3VSK A;  1X1B A;  4BL0 B;  2M3A A;  2XF5 A;  4AU7 A;  2KRC A;  4XLH A;  5KHD A;  2PMZ A;  4NUB A;  3BLY A;  2CV1 A;  1WJB A;  1FMV A;  3RSN A;  3OY9 A;  3UR3 C;  4F55 A;  4E7L A;  4BE1 A;  3CJR B;  1LFP A;  4BQN A;  1PYV A;  3K4N A;  2IGK A;  4E4H A;  3VDX A;  4F3Q A;  4ZDP A;  2V26 A;  3ZXS A;  2WY7 Q;  2DXI A;  2CW7 A;  3DLA A;  3D5R C;  4E7S A;  4ZTJ A;  2DOA A;  2MFZ A;  3D5S C;  3KX2 A;  3L2Q A;  3HL2 A;  3OYN A;  4RM2 A;  1NG7 A;  5LD2 C;  4BDY A;  2L9N A;  3DQV C;  3BCB A;  4CSW A;  1WJ5 A;  3AL0 C;  3ZCO A;  3K70 D;  1WJD A;  1X1A A;  3CES A;  3LSK A;  3TMO A;  2LRD A;  2WAE A;  4C2U A;  3OYG A;  3K4L A;  3QOD A;  2PJR A;  2JA2 A;  3J7A Y;  3H9G A;  2PJR B;  3OOU A;  1D0X A;  2VB6 A;  4EAT A;  2IS4 A;  4BDZ A;  2VPL A;  2Z16 A;  3DTK A;  3OYC A;  3CF2 A;  2HU9 A;  4CCJ A;  2DJI A;  4RMN A;  2ELJ A;  3VWB A;  4CH7 A;  2DCE A;  5FRM A;  3ONQ A;  4BQQ A;  3CJQ B;  5HNF A;  4QPO A;  1MMD A;  3VYR B;  4G6T B;  3U21 A;  3K10 A;  2LBF A;  3I3L A;  4KIT B;  3V42 A;  2LBF B;  3MKW B;  2WY8 Q;  4XNF A;  4II2 A;  4IZZ A;  2CFO A;  3PSF A;  3ZRG A;  4PJM A;  3OYM A;  2BOL A;  4DBQ A;  4HRI A;  2GOM A;  2R7U A;  4ZDO A;  5CKT A;  5LFA A;  3SYT A;  4YRV A;  2R7R A;  2HZD A;  2RQQ A;  3RQ4 A;  2VKD A;  3HPH A;  3PNY A;  1K6Y A;  4AVZ A;  4XKB A;  3I9V 2;  2VQC A;  2Z2S B;  2X85 A;  3OL4 A;  2E5N A;  3H5N A;  3W2W A;  4KT6 A;  4FAS D;  2L5Q A;  2R7W A;  5HLT A;  2IGN A;  2XC7 A;  4XLC A;  3M1C A;  4BJ5 C;  4OWR B;  3OYE A;  3K4J A;  1X1C A;  4XOT A;  2DT7 B;  4CA0 A;  3C2G A;  4ZTF A;  1MMN A;  2W4S A;  3OWT A;  3PFY A;  1N75 A;  5KNL A;  3BG6 A;  3DU6 A;  4QPQ A;  4DGW B;  2E1M C;  2XAU A;  3PSI A;  1X4P A;  5HOO A;  1OLT A;  2X1C A;  2A5W A;  2P0W A;  4YEL A;  4BUP A;  4HG2 A;  3OS1 A;  2CUZ A;  4BAC A;  1ZEL A;  4BJ6 C;  4XN3 A;  2UWM A;  1V5E A;  2XDV A;  5KCM A;  5JHF A;  3A2K A;  1S9H A;  2IS6 A;  4BGD A;  2OV7 A;  2VJ4 A;  3N05 A;  4RLQ A;  4HSR A;  3OR1 C;  3W2V A;  4N4N B;  2KDO A;  3M8J A;  3NWS A;  3LSH A;  4J01 A;  2LY2 A;  3HG9 A;  1WJE A;  2VQG A;  3DPL C;  4PJJ A;  3OIP A;  2WA0 A;  2KPM A;  2RNG A;  2R7V A;  4LIU A;  4MLO A;  4XR6 A;  3RPU D;  2HDW A;  3S3M A;  2CMP A;  3OMY A;  3OYA A;  1QU3 A;  1Z21 A;  3DWL E;  2ZFU A;  4C9Y A;  3OYL A;  2MAB A;  3HC7 A;  3W2A A;  2M0M A;  3OYK A;  1KON A;  3HXL A;  1E0E A;  1TT0 A;  3QYE A;  4HST A;  2X1D A;  4C2T A;  4PJL A;  3L2R A;  4ZDL A;  2V7F A;  2BW3 A;  1BR2 A;  4F91 B;  1Y56 A;  2BW3 B;  4AYB A;  4BJT A;  3OYJ A;  2VQL A;  3HUG B;  5CQG A;  3D5L A;  1J09 A;  2V9K A;  3L2W A;  4PFP A;  2LH9 A;  2CS3 A;  4DBR A;  1EA3 A;  1X4O A;  2E60 A;  4XKW A;  3RTR A;  3QOE A;  1BR1 A;  3E1S A;  1WFX A;  1YX5 A;  2F4I A;  3VYT B;  1MMG A;  3DTI A;  2QKL B;  4CZC A;  4JOM A;  4XM3 A;  4B44 A;  3SZG A;  1BR4 A;  2IS2 A;  2XF6 A;  3C2H A;  3SDB A;  1G8X A;  4XQF A;  3NWT A;  4PSX A;  4H4K C;  4IQJ A;  1T0F C;  3S3O A;  3IUO A;  3OYH A;  2KMU A;  4XON A;  2AQE A;  2LG4 A;  5FRN A;  1X1D A;  4BE0 A;  1MNE A;  1YX3 A;  1OR7 C;  1WJA A;  1Y6I A;  2VJI A;  4X0G A;  2Z1D A;  4HNT A;  4XN0 A;  2XSJ C;  4B43 A;  3FBI B;  1AA7 A;  3HOT A;  1ERD A;  4CCK A;  2M7A A;  3PJR A;  2W7N A;  2DT6 A;  2L7K A;  2UV1 A;  1QHG A;  1DQU A;  4RM3 A;  2OC6 A;  3MKZ A;  3K4C A;  3RCO A;  2IXS A;  3SEZ A;  3QYF A;  3PNT A;  3S8P A;  4F93 B;  1Z3Y A;  1NG6 A;  2LRE A;  3MKY B;  4ZYA A;  2V4J C;  2Y0S A;  1T95 A;  3DPT A;  2VL8 A;  2IGO A;  2K9L A;  4DJA A;  1GLN A;  3DKY A;  4P5O A;  4IQ4 A;  2A6T A;  2VXZ A;  4HEA 2;  1DGW Y;  2CV2 A;  3S93 A;  4F92 B;  4YEJ A;  3HKZ A;  4D1Q A;  4P1W A;  3BC8 A;  1UEL B;  4CCL A;  1FMW A;  4D9J A;  2VAS A;  3IP4 B;  2KLO A;  3OYD A;  1D1C A;  4N4O B;  4XOP A;  2LOO A;  3CZ6 A;  3G2B A;  2L9S A;  4CCO A;  3DU5 A;  4LIV A;  5CQE A;  2VLA A;  1JI8 A;  4XLA A;  2R7Q A;  2MD0 A;  4OAY A;  3AL0 B;  1D0Z A;  4BE2 A;  2Q1Z B;  4IX7 A;  2Q2E B;  1Z3X A;  4XLF A;  4ZJZ A;  3OYB A;  4NNJ A;  3OYI A;  1MND A;  3L2V A;  3DEE A;  2HQA A;  4XKV A;  1V5G A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...