2JSPA

The prokaryotic cys2his2 zinc finger adopts a novel fold as revealed by the nmr structure of a. tumefaciens ros dna binding domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVAPAYAEARSRLAKEMGLGQRRKANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein ros
publication title The prokaryotic Cys2His2 zinc-finger adopts a novel fold as revealed by the NMR structure of Agrobacterium tumefaciens Ros DNA-binding domain.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Gene regulation
total genus 11
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1550 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2jspA01
2JSPA
chains in the Genus database with same CATH superfamily
1W4MA 2H8RA 1WPKA 3OYEA 4IHVA 1A6IA 4L9TA 3LSRA 3A2KA 4XIDA 2QWWA 4O3MA 3S17J 5FFZA 3KIOA 3QU3A 4X0GA 2X1CA 1OYYA 2W57A 1E17A 3ECHA 2JTVA 3GUDA 2L9SA 2EFPA 4S0HB 1ERDA 2E34A 4JK1X 5E1ZB 1YYVA 4BE1A 4IO9F 3O8HA 2LMDA 3H3UA 1BR1A 4KNYA 3K10A 4MNUA 4OMZA 3I58A 1JJ6C 5HVQC 4UUVA 1TT0A 2PLYA 1WWXA 3DKWA 4F7ZA 1FEXA 1J9IA 5LEJA 3IC7A 3L2WA 1IN5A 2M34A 1LEAA 1B72B 3B6AA 3ZQQA 3FDYA 5J1YA 3WGIA 2CRGA 4RM2A 1XMXA 3M1EA 4BJ6C 2HS5A 3REOA 2BY3A 2LRDA 2IA0A 1T98A 1LB2A 2DT6A 1FZPB 2VBWA 1CQTA 4L9NA 1XX5A 4LMYA 1PDNC 3L2RA 3HRMA 4II3A 1TT5B 2HU9A 2IA2A 3LAPA 3CC2I 2DQRA 5EF6A 4M3GA 1TNTA 2H1LA 4E4HA 3L1PA 2E19A 4O6JA 3L00A 3G4SI 5LD2C 5IP7J 1IV8A 1HLVA 3AL0C 4DGWB 1XC5A 1BW6A 2MH9A 4YFXF 5J1RA 4A93J 2O8XA 1OYWA 4HX8A 4BNCA 3AFHA 3MKLA 5HS9A 1IRXA 3A01A 4KYWA 3OS1A 2HPMA 2DT7B 3LMMA 2M8EA 3NQOA 1B9NA 1EH7A 2A5WA 1W5TA 2BV6A 2KRHA 4P96A 2BY2A 1D8JA 1IXCA 1MMAA 3CP8A 1GV5A 3WGGA 3G6EI 2CWEA 3J80K 4ESJA 4BXXJ 3TKYA 4G94A 3OYNA 1UHMA 1CGPA 1Y39A 4KIFA 4JP0A 2PMUA 4PJNA 2QZ8A 1FP2A 3BY6A 2WBMA 3BR6A 2DFHA 2BW3A 5BNGA 2DTZA 1X1AA 1YE9A 3M4OJ 4WF2A 2XGDA 3LSKA 4Y4RA 3WHCA 2RV8A 4BUPA 4M3DA 3W2VA 3CUOA 2CUFA 5JLWA 3V4GA 1MH3A 3X2QH 3OYJA 4ZJZA 2G7HA 2RREA 1R71A 1FLIA 2L9VA 1MBKA 2QKLB 3SYTA 3HZJA 3JRFA 4DYRA 3M07A 4E7SA 3S2WA 2F5VA 1FBUA 2DT5A 1SD5A 2A69F 2VQGA 2ZMEA 2A68F 2L7FP 3WG9A 2KRCA 3OYMA 1FT9A 2RGVA 3ZQFA 4R8HA 2PMZN 1VF9A 4HRIA 1TL8A 1EV7A 4PDKA 4PZJA 1ZLJA 1RZ4A 2AO9A 5GAGJ 1MH4A 4A3IJ 2GLOA 5F0FA 2EIKH 4G6TB 4CA0A 3J80Z 2FOKA 2VASA 3HEFA 4A3KJ 5BMZA 2HQAA 4HNVA 2K3FA 3GZNB 4UXNA 4BKXA 4KITB 2UZKA 3A03A 3WTYC 4PJJA 1JGGA 1NTCA 2K9QA 4ASNA 3L7WA 1A35A 4BJ5C 3MD2A 1R23A 1LFPA 2M0CA 2A6EF 5FD6A 4ENMA 5FLVA 2VBYA 4D5FA 2A6HF 3HL2A 1G4DA 3A4CA 2XAQA 2K7LA 3QPSA 5GPCA 5GAHJ 2NXNB 4WK8F 2HZDA 2HQ5A 5E8IA 4M6VA 3CO6C 1XSXA 2CSOA 2QVOA 3FXJA 3ZMUA 4C30A 3GFLA 2CQXA 1RUNA 3I56I 2CFOA 5DM7F 4IHSA 2CFXA 5FKMA 4X1EA 3VYSB 2DK5A 5L3GA 2WV1A 3TP0A 3M9AA 5J40A 5B66C 2KKOA 3CD6I 1T6SA 2GXAA 3F22A 1JT6A 2V1XA 1SMTA 2ID3A 4A3JJ 1Z7LA 2H8WA 2KDOA 4XK4A 3FHZA 4GCVA 2GA2A 3C2BA 3S3NA 2XDVA 4D9JA 2EZIA 3LA2A 3OSFA 3CMAI 2E1MB 3PNVA 2IS1A 3IWZA 3VEPA 2MA3A 1J59A 2RQQA 4EM2A 5IY5H 3IKTA 4K2EA 1A6QA 2DJIA 3HKZA 3LQQA 4NC6A 5FKOA 1IAWA 3MMYB 2ZXHA 2MG4A 3WU2C 1R58A 3SDBA 3ABUA 3CDIA 2RAEA 4XORA 2HVSA 3E5XA 4MFDA 1W0TA 2QF7A 3ELKA 3FMQA 2O3FA 2FNPA 3KX2A 4IRGA 3CJQB 1A36A 2PJRB 3BR3A 1VQ9I 2LVSA 1RUOA 3FBIB 3BTLA 1W0UA 4HBLA 1WI3A 5LEKA 1Y6IA 1PUFB 2PN6A 3RQIA 4B4CA 2D1VA 3JRBA 3WGHA 2ZMEC 4Y33A 3K7AJ 3T8RA 3IRRA 4XSZF 1LEBA 4NQWA 3PSFA 3JTGA 1MBHA 1FMVA 2DW4A 1RPWA 1XSVA 2BHYA 2JT1A 1AKHA 1P9QC 1Z0XA 2JUGA 3BJ6A 3HC7A 3EPZA 3ZMSA 2LKXA 1DUXC 4XOPA 3A02A 3CUQB 5KHDA 3GWZA 2DFEA 3KCCA 3I53A 3G1LA 2FOWA 3I4NJ 5H6RA 2W4SA 1WJFA 3OYAA 1SFOJ 1IG7A 2R7WA 3LSJA 3DEEA 2XASA 3CQZJ 3D5SC 3PIPF 2X4HA 3O8GA 2Q0OA 1ENHA 4UB6C 3DFGA 1FOKA 2NVYJ 1TWGJ 2X0LA 4IL6C 3KP7A 4W1UA 1XMAA 1TBXA 3H5AA 1ZG1A 1LUJB 4RAYA 1QQIA 4IQ4A 3K4CA 4DBRA 4QLCU 4A12A 4XL9A 1HSTA 3CCEI 4HSRA 2R3SA 5CVVA 3BCBA 3O2PE 4BBSJ 3VDXA 4IHYA 2KMUA 1U5TA 1OMIA 5A2QK 1QGPA 4CZCA 2YX7A 3OS2A 3TBIA 3WTVC 2YU3A 2DO7A 2LP0A 3RPUA 4BL0B 4DQ2A 2DPDA 4OIPF 1WCMJ 2DMPA 2F5FA 5ED4A 1SD6A 2M1BA 1EH6A 2QQ9A 3BG7A 2EK5A 4F55A 3CMEI 3S15J 4Y52J 2L3DA 2ID6A 1BW5A 1JKOC 2E7WA 3HUGB 3ONQA 1DP3A 2P6SA 2OZ6A 4CHUA 1OFCX 1QVTA 2HVQA 2DDBA 4MFEA 4BGDA 1RR7A 4E7IA 2R5YA 2KFDA 2CV0A 2VXZA 2UXNA 4JX5A 4PSWA 1X58A 3Q0UA 3QQAA 4E7HA 4G6QA 1XGSA 2E5ZA 3QYBA 1H89C 1UHWA 2FEZA 1GVDA 2IGNA 4RLFA 3U9GA 1XB4A 3P5JA 4EM1A 2LNBA 4ESBA 1Q1HA 1ZK8A 4B09A 3FK7A 4C2TA 3RQ4A 3S16J 3RCOA 1UJ8A 1BI2A 3RSNA 2VOPA 1DPUA 5EG0B 1E0EA 2FA5A 3HDDA 5L3CA 2R7DA 2FD5A 3PFYA 4AIJA 2UWMA 1QPMA 5HLGA 3LSGA 2VONA 1O3QA 3JRCA 3COAC 3CMMA 1EH8A 2E5NA 3GTJJ 5E17F 2VT2A 1ZGJA 4LB5A 3KFWX 4V2GA 2CQQA 3ZMZA 3RIRA 4KDPA 3S2HJ 4ENKA 4F92B 2M4GA 5IYBJ 2EB7A 2F4MB 3CTAA 2CH0A 1U9NA 4FX4A 2X51A 3TOAA 3DLLF 3OWTA 3H36A 4YEJA 2HQNA 3VSLA 4PJ0C 3HYIA 1YS7A 2XC7A 1IJWC 1ZREA 1B1BA 2MW8A 2JRTA 3GTLJ 3W6KB 4PGHA 3MKWB 2HYJA 1NK3P 5J8CA 3MN2A 1YTYA 5DV5A 2DCEA 1JE8A 4LGWA 4LG0B 2BXZA 1X3ZB 3GX4X 1R5HA 5HDKA 4YIIA 4OIOF 1FYMA 1GXPA 3AKZA 4BY1J 1DQUA 3WU0A 1R1UA 3V8JA 4IEJA 2RNGA 4GO1A 2LD5A 2XGXA 2Z2SB 4GGGA 4HPQA 4OAZA 3GBGA 4XKCA 3VYTB 4ZH4F 2WB1A 5LRRA 3E3VA 5ILVA 5IOYA 2DOEA 2HNHA 1BC8C 1K61A 1QHGA 4MEXF 1U5TC 2OTLI 3IKVA 4A0YA 2WAQN 3D5RC 3E5QA 1MZBA 1USSA 1PUEE 1FOXA 4CCLA 4HV5A 4LIVA 1XGNA 4UNOA 1MMSA 3GZ6A 2GM4A 5DUKA 2GWRA 4XSXF 2KQRA 4LOCA 3GTMJ 4I0AA 1BI0A 3DPUA 5ILUA 4BHBA 2EPFA 3J7ZI 4BJTA 1G59A 4IHTA 2R7TA 5M5WJ 1KU9A 4CCNA 4HV6A 1WJAA 4XKWA 2PX9A 1VQ6I 3FBNB 1TWHJ 3Q0VA 4CCOA 4RDUA 1ETXA 2BVMA 1AOYA 4UB8C 4MIMA 3RKQA 1ZRDA 3QPTA 2NS0A 5FB2A 4A69C 2COMA 3P7NA 2PBIA 1VFCA 4HX4A 2LSOA 3FXMA 1AA7A 1Y56A 4AVZA 1XD7A 5K7HA 5K5RA 1TWFJ 2ZO4A 3BPXA 5AIPA 1XTAA 1E3PA 3RTRA 4A6DA 2PJPA 1BJAA 3VYRB 1X19A 3F21A 4A3BJ 1VQMI 2AXLA 2OAZA 3HTSB 5DD8A 2HYGD 3TO7A 3GTOJ 2JWTA 2YPRA 3VSKA 2DYRH 2DLLA 2GZWA 3GYHX 2WWYA 1FX7A 2ZCWA 3WTSC 1MDMA 2DA7A 4KJZA 5CVRA 1V5EA 2R7OA 3BP8A 3J7AY 4C2MJ 1EKEA 2ADUA 2KIFA 5KNLA 2VPLA 2OTJI 3FXQA 3S1MJ 3RYRA 5C4JJ 4LIUA 2DA4A 3HB9A 2E71A 2OQRA 4N4NB 1SFEA 5C3EJ 3RI4A 3JRGA 2R5ZB 4BQQA 2AHQA 5H20A 2JMWA 4OWRB 2R7ZJ 3IP4B 3HXLA 5DCMA 4JBAA 2QCOA 2DN0A 2XRLA 3JAMK 5TRDA 3KE2A 4RA2A 3WHBA 1FTTA 4XLCA 2K85A 1P4XA 3ABKH 3IV5A 3RDIA 2JA8J 4HDUA 2J5PA 4L5IA 1CF7A 1O3TA 2ZNYA 2IGMA 3LFKA 1YLFA 2R0QC 2VI6A 3F23A 3R0AA 3L2UA 1RKWA 3CCSI 2Z5UA 4DYCA 1TLHB 1RESA 2EZHA 3ABLH 3DCFA 4MQ9F 2ISYA 4JX4A 2OV7A 3GZ5A 1YIJI 1UG0A 3SJMA 4D7MA 2V9VA 3LQRA 4M72A 2J5OA 4L5EA 1LVKA 3PO2J 1W5SA 1JHHA 3JW4A 4M71A 1ZRCA 2BOLA 2OCCH 4HDVA 3ASNH 2F4IA 3ZN1A 1ETOA 2VQHA 1QVUA 1T95A 2LY9A 1OISA 3HGYA 1MW7A 2ZBKA 4RS8A 5EYRA 4A0ZA 4ZZLA 1W1WE 1HW5A 4HF2A 2OF7A 3I9V2 2GOMA 1ZRFA 1ZAOA 3BG3A 2O8KA 5EZHA 5ICEA 2JQ7A 5FKKA 2XV4S 2EIJH 2YU9J 1IGNA 2XRNA 3QPLA 1BR4A 2DA3A 5F0HA 1EJ9A 3V42A 2XB0X 1TWAJ 1FNNA 1I50J 3DQVC 2EFNA 4BDYA 1YFHA 1OCZH 2KIQA 3JAMZ 3T5XA 2IAIA 1D1BA 2QSGX 1N75A 2A6TA 2NAZA 4NUBA 3LSTA 1QO0D 2LH9A 1WJCA 3GFIA 5E18F 1DPRA 5FGMA 2JK3A 2P7CB 3R60A 1F36A 3BLYA 1JKPC 3EUKL 2WAFA 1FTZA 3KYDB 3T0YA 5H6QA 1U6GA 1V3FA 3L09A 2B9SA 2LF7A 2PQ8A 1X3UA 4CCJA 5GADJ 1LNWA 3K1MA 3K4KA 3I59A 5HNFA 1MNEA 1QPIA 5BQTA 1QU3A 2KJBA 3G2BA 2E1OA 1P7JA 5EEAA 3SEZA 3FX3A 1F43A 4EJWA 2STTA 1BOBA 1BL0A 1D5VA 1SFUA 4FCYA 1B59A 2X6WA 3FM3A 3IAM2 1UELB 2M7AA 4MLOA 2F5DA 3HSEA 5CYVA 3CCUI 4J00A 2Y9ZA 2O7OA 1TNSA 5D8LB 2GAUA 3W3CA 2COBA 3HSRA 5CLSA 3CF5F 2FNAA 5HS7A 3K2ZA 5FLMJ 1UG2A 2O03A 2L9RA 5FJ8J 5ILSA 4G7ZF 2XPUA 2F48A 5CVUA 2R7RA 2NVUB 3ERMA 1YOVB 4ZYGA 3VPRA 2BGCA 3CESA 2V6CA 1APLC 3F72A 3MAJA 2ZSIB 3K9TA 4KUMA 4PGGA 4AM3A 2GA1A 2M0MA 3B02A 4P5OA 1H9TA 4AYBN 1M1EB 2OD5A 3M8JA 4BYYA 3U2RA 2LREA 2XPWA 2UV1A 5F08A 3MZHA 4XKVA 3L9FA 2IVMA 5KVRA 2X85A 1P92A 3KP5A 1UFMA 2GXBA 4HZFA 2QSFX 2MYSA 1T08B 2FXAA 4I01A 1FPQA 2BYVE 3F6VA 3B6CA 3AG1H 4D7NA 1YS6A 1U8BA 4NDLA 1X4OA 2PG4A 1MJAA 1B8IA 3BC8A 1ZKGA 2H6CA 2VJIA 5AIQA 1N78A 1K78B 3BZCA 1P2FA 3OYIA 4FE7A 1H9GA 3RZDJ 2CUJA 4PFOA 1S3JA 3H5RA 4ABZA 4DBQA 3QAHA 2ESNA 4F52A 3VWBA 2QBYA 1HOMA 2HYFA 1MBGA 1LFBA 1OYIA 4E70A 4DYQA 1FIPA 3K4JA 5CPRB 2L7KA 4OU0A 4J01A 1T0FA 3CP2A 3P9IA 3TP3A 2EZLA 3CLQA 2L4MA 3LOCA 1K79A 1T8IA 5K7FA 3TW6A 1J0RA 2DTRA 5DD4A 3DTKA 4ZC3A 1Y0NA 4MTEA 3VB2A 3DBRB 3QP5A 1FBQA 3HOUJ 2CW7A 2AXTC 4BE0A 1MSEC 5DYMA 1IN6A 1O57A 2Q2EA 2K02A 4ZYHA 1RR8C 4GXOA 4IQJA 5EGOB 1JHFA 1KZHA 1D1AA 2KISA 1TQMA 2D2WA 5D5WB 3ULQB 1IDZA 3R0JA 3TW7A 1ZR2A 3KP3A 1D5YA 4XN0A 3RJPA 3FXRA 3OV8A 5KK1A 4HSTA 3QYFA 4IX7A 1OCCH 3KPHA 4X6AJ 1YW9A 4CYCB 4HLYA 3DU6A 3V7RA 1X4PA 4HA8A 4ZTFA 1P4AA 1X3WB 3CJTB 3V8KA 2LFBA 2KLOA 4RB1A 1BIBA 3FXKA 4YELA 1EA3A 3DKXA 2PI0A 3MEXA 2DJNA 4AUXA 3ZQIA 3G3ZA 3BTCA 1W7PA 1HBXG 5EZGA 1POGA 2EH3A 3GLLA 3OYGA 5BPDA 4M3EA 1D0XA 1R4NB 5D4SA 1K7AA 1Y1WJ 4MO7A 4IJAA 3SFIA 3I54A 4ZYAA 1RI7A 2H09A 4MTDA 2LG4A 4UUSA 5J6XA 2G9WA 1LQ1A 3CCRI 1LDDA 2H94A 1IO2A 5TGTA 2WAEA 3PIOF 3ZQHA 1A04A 4GYIA 4BBRJ 2JJ7A 2F2EA 2DMUA 3O6BB 2ICWG 5HLTA 2HTSA 1WFXA 3EETA 2QQAA 1TWCJ 3JREA 2BBYA 5KAIC 1Z3XA 3BZ6A 3HOYJ 2P6TA 2P8TA 5F27A 3FWEA 2EA2A 1QRYA 4CICA 2FQ3A 1WHUA 2VXDA 2IW5A 2M8GX 4PFPA 4HNTA 4NBQA 5FO5A 2F4OB 2HZTA 3TGNA 3HRTA 3FMSA 1HW1A 4QTRA 4KA4A 2VBZA 3AAFA 2OA4A 1Q1VA 1OKRA 4DIQA 4N9IA 3U1KA 1YJ9I 3K1NA 4FE4A 1VQNI 3ZMVA 4JX6A 1RETA 4NC8A 3OYKA 1R5GA 1ETQA 3K4BA 4FISA 1XGOA 4XLNF 3CCMI 1T0FC 3IUOA 5B1BH 5L3BA 3E1SA 3QODA 2MLGA 1OR7C 1NK2P 4IOAF 1H88C 2GBYA 4XLPF 2R7VA 3CJRB 2X1EA 1Z91A 2FJ1A 4Y3OA 4AIHA 2DQLA 2HWVA 4XRFA 3VFZA 4LITA 1XG1A 1F4KA 2DK8A 3TMOA 2HXIA 4PCQA 2XF6A 3FKJA 3M1CA 2IS2A 2RQPA 1JGSA 3IH4A 5FD5A 3C3WA 3CJNA 5J8FA 1GVJA 1NG6A 3KLNA 2XAHA 2XF7A 5E1WA 3ZPLA 1RC9A 1VQKI 3DBHB 4G12A 1G3SA 1V4RA 3V7CA 4XR6A 3DWLE 3BQZA 3PJRA 1G3TA 3CZ6A 1SAUA 2MD0A 3BG9A 4I98B 3PQJA 1ETYA 3CO7C 5K5QA 2ETHA 2Y48A 3JSPA 2MABA 3BR0A 1B72A 1S8NA 1KGSA 1N25A 2CUZA 3S93A 3DPTA 2ZJQF 1FOWA 3FXUA 1K6OA 3GCMA 3I3LA 3LSHA 4BXFA 2QSHX 1J5YA 4LK0F 4XM3A 1I5ZA 4E6KG 2H1KA 2IPQX 5D8KB 3IHUA 1LE8B 1V5GA 3OIQA 1J2XA 2A05A 1IW7F 1LKXA 2NYXA 4XQFA 3H3VK 4JQFA 3I0TA 5D5UB 4A3CJ 2KP6A 1R5ID 4KT5C 3V8LA 4IKFA 2GIZA 3KEQA 5F04A 4XN3A 2CYYA 4ZZDA 4PUSA 4MGRA 2Z99A 3F0CA 3HOVJ 1BI3A 1S7EA 3C2HA 2R4GA 4E7KA 2R7QA 5DCMB 1I1SA 2OJED 2FE3A 4IRHA 3MKYB 2JA5J 3ZXSA 2XAJA 2ZC2A 2CUEA 4OMYA 3KLOA 4A3EJ 2EILH 1LFUP 3J7YJ 1RNLA 3HM5A 3WTUC 3C7JA 3PQKA 2L02A 2M45A 2KRFA 3PUBA 1XN7A 4OOIA 1U0JA 1I6XA 5D6EA 4UUTA 2XKPA 3HJEA 3H0DA 1O7LA 2HVRA 2R92J 2WAQA 2CW8A 3M8EA 2M9HA 3S3OA 1KQ0A 4F91B 2QENA 4BEHB 4I02A 2OCEA 1Z1DA 1I1GA 2DPUA 3K70C 4BACA 2LK2A 4LK1F 3WTTC 4N9HA 2CGPA 3SDGA 1WJEA 2VN2A 1ZTRA 5E1XA 2ECCA 1Z3YA 4XMYA 5HLHA 2XAFA 4WXHA 3WE3A 4P1WA 2LY1A 2YR2A 1LPQA 1J7KA 3SXYA 4D0PA 3E6MA 3F8FA 3LNQA 3RKWA 2TRTA 2K9MA 3SEQA 4BS9A 1X2NA 3BTIA 3PNTA 3AL0B 1KQ9A 4HQEA 3FXLA 3ZQCA 1W7PD 1GT0C 5JR3A 2L0KA 2EZKA 5EEHA 1W36C 3BR2A 2DA2A 1YW8A 3O3KA 1T56A 1GV2A 4Z6YA 2LKPA 2E36A 2XPVA 3BCAA 5F1RA 2M3AA 1VQOI 4EV0A 2LBFA 1S72I 4QIWN 3ZQGA 2VKVA 1MBJA 3CMYA 4QSHA 3GVAA 2P4WA 1S5LC 2FUG2 4U0WA 4C2UA 2MD5A 4UVBA 4DW6A 3GTPJ 5LLQA 3EDPA 5JVTA 3Q9VA 4DJAA 4RGSA 2HOEA 2V6EA 3I5UA 4RGXA 2BY1A 2MC3A 1HDDC 1Z67A 1QZYA 4B48A 3W2AA 4RAFA 2MLKA 4CCKA 3QPHA 1BA5A 1Z77A 2OZUA 2E1CA 1X1PA 1ZGWA 5IOZA 3CDHA 4EATA 3K6GA 3JRIA 2HOTA 1S9HA 2E2HJ 1R22A 2K27A 2KHMA 3M3YJ 1IZ1A 5LGTA 5ERIA 2FRHA 2WA0A 2QQ8A 2JSPA 4L9JA 3CC4I 1UAAA 5FLXZ 5FRNA 3CCVI 4E7JA 2FU4A 4U87A 3G73A 1FOYA 1U9OA 2R7UA 1YW7A 3D0SA 3K70D 2IGKA 2QA4I 3CCYA 3BOQA 4ANJA 1HKQA 2XAGA 1LJ9A 1SFKA 3BQYA 3MVPA 3RPQA 4OINF 3OR1C 4UV8A 3BZKA 3Q3SA 5E79C 4XICA 2LDUA 2NOJB 1WH7A 3Q5FA 2JZYA 3TEDA 2A5YB 2CQKA 5GPAA 3LFUA 2PJRA 4GRIA 2L7ZA 4U7DA 3OYFA 1ON1A 3R61A 1C0WA 1ETWA 2RVCA 2R7FA 5GP9A 3ECOA 1YQAA 2XSJC 2ZSHB 3H3ZA 5J1UA 3UKGA 2F6CA 4L0ZB 3BG6A 1NHAA 2IBDA 1W36D 2GXGA 1K6YA 4TV7A 3OR2C 4M3BA 5J3LA 3R6SA 4PSXA 2ZB9A 2ZFUA 4CGZA 4Y13A 4XLHA 1OCTC 3A1YA 1L0OC 3BDDA 1TW3A 4YIRX 4EJVA 4IPAA 1E2XA 4RGRA 3A01B 5CVJA 2TDXA 1R36A 5LRSA 1VQ8I 2VJ5A 3PNYA 2Y0SN 2ZKZA 1ZGAA 1B6AA 3CUQA 1N77A 5BOXA 4H0EA 2QKMB 2HDDA 1S29A 2DMNA 2VC1A 1V54H 4E7ZA 3FZVA 2ELKA 5JVGF 4KFCA 2VUMJ 2TCTA 4RB0A 3TQNA 1XS9A 3JRDA 1D1CA 2HTJA 3OL3A 1PJRA 4AWXB 3OYHA 2XAUA 4FQGA 2BY0A 1WGXA 4QPQA 4B44A 4E7LA 3WU1B 2I10A 2CV1A 2O5RA 4IZZA 4ENJA 5C4XJ 4Q5SF 4CSWA 1IUFA 2H27A 3QOPA 1R4MB 2BW3B 4GFBA 1FYLA 4ENNA 4JYKA 3CCLI 2L01A 2YUSA 4FHTA 1U2WA 3VOEA 4HAMA 3E0JB 2W84A 2OC6A 1A5JA 4J19A 4B1RA 3J81Z 3HGGA 2M2EA 3ASOH 2GIVA 5AONA 5EEGA 2I8DA 4EMSA 2V1UA 3I71A 1IN7A 2W48A 3U21A 1XCBA 4CO8A 3MZ8A 2DXIA 1E3OC 1MNMC 2QUFA 1REPC 2EV5A 1VQ4I 2L2OA 3S2DJ 2G0EA 2FX0A 1ZYRF 4NNJA 5E3LA 3GF2A 2ZMEB 3CLOA 3H1CA 5IP9J 1GXQA 1TTYA 2W82A 4L9VA 5M5YJ 2R7XA 2K4BA 1S7AA 2E1MC 1OCRH 3HUGA 1K4TA 3H92A 2D5VA 2JA6J 2JN6A 6PAXA 1TC3C 2Z16A 4FX0A 1WVRA 2MH2A 4LG3A 4N0BA 2DODA 2PFBA 3U1DA 1KU3A 1ODDA 3AG3H 4ETSA 3D1NI 1VQ5I 1Y1VJ 3JR9A 5F6FA 4CUGA 4IF4A 4ZYDA 3D5LA 2EV0A 2JVGA 3ML6A 1JUSA 2UUZA 1ACIA 2DBBA 1SANA 1OLTA 2KL4A 2ZJPF 1G2HA 4I09A 1X2MA 2ZJ2A 3EUHA 3CDLA 4A5MA 2KIUA 4S05A 5BPIA 1ITYA 2WY8Q 1BOAA 2FMYA 5DUIA 1GDTA 2KT0A 5EG0A 2OPTA 3MQ0A 3CCQI 2XKOA 1H0MA 2DFFA 2STWA 1ZLKA 4LLLA 3OOPA 1USTA 2F5CA 2MBFA 5JHFA 2JVHA 2KZVA 2P5VA 1O7FA 2LKSA 3NWSA 3P9KA 1WJBA 3T1BA 4NHJA 1FSHA 5B1AH 2IJLA 3ZQLA 5D4RA 1LDJA 3FIWA 2HFHA 4WXDA 1JUPA 4XRSA 5EDNA 4A3DJ 2M30A 2RNJA 3GTQJ 2NRAC 1R6RA 5HLIA 3DEUA 1YIOA 3RKXA 1UZCA 1AHDP 1I39A 2CQ7A 5D5VB 2DA6A 4I6ZA 3A0BC 3ZRGA 3CUQC 1V5FA 4UY8I 2XB5A 1FWZA 4CZZA 2ME6A 2Y9YA 2Y75A 2O6GE 2GQQA 2K5CA 1WJ5A 3NRVA 1FIAA 4O5VA 1YX5A 2HGCA 1BC7C 2Y31A 3K2AA 2FBHA 3BR5A 2E2IJ 4C9YA 1BJZA 2YS9A 5IT9Z 4LG0A 1RKTA 2ZXIA 1BIAA 1JUMA 1SFXA 2VQCA 3EYYA 3GMEA 1O3SA 2EFQA 5DDGA 4WWCA 1MMNA 3N05A 2K9NA 1PP7U 2X6XA 5E3MA 1FSEA 3MKZA 4PJLA 3PSIA 3W6JB 3S8PA 3BROA 5LHGA 3S32A 2PEXA 1JTYA 2E1NA 3EUAA 3QP6A 2VJJA 5DEQA 4DOZA 3ABTA 4Q4ZF 2ACJA 3ZCOA 4FT8A 2EV6A 4I7HA 4A6EA 1I6HJ 1KYZA 2DFIA 3DU5A 1X1CA 2V9KA 3F8BA 2RN7A 4BDZA 3P9CA 1WH5A 1KU7A 4A3GJ 2VL8A 3KP6A 1A31A 1YJWI 4H4KC 2I5UA 3IH3A 4EJOA 3EQLF 4IVNA 1QNTA 5LHHA 4A2UA 4LLNA 2O61A 2VKEA 4ZYEA 2PMZA 2E60A 2FMLA 4BE2A 1KU2A 4KMUX 4M6YA 1I3QJ 2FF4A 2AQFA 3IAS2 5D5XB 4NQWB 5GTHC 1ZHFA 4LFUA 5HDGA 5HS8A 1AKHB 2QLZA 5IYCJ 1F5TA 1JKQC 2HKOA 1SVOA 2QYOA 3WTWC 3UNGC 3FHNA 2D1HA 5E3OA 2KZGA 1IV6A 3GO5A 5DTDA 1XDSA 2WY7Q 1T2KA 4ZDPA 1IC8A 4ZDOA 3C18A 2HQRA 3IH2A 3WG7H 4RB3C 2Q8KA 5IT3A 1YX3A 4HOBA 4XOTA 2DI3A 3EUHC 1HSJA 2ELJA 2R93J 1IRFA 1S6LA 3A0HC 3HPHA 5LGUA 1R49A 3OIOA 4F3QA 1S7OA 3KZIC 1D0YA 4XLFA 1YRNA 3ZMDA 2XROA 2DYSH 2EA4A 1STZA 1ZN2A 3HRSA 4RAZA 2HEOA 5E3NA 4CDGA 2DOAA 1YJNI 3ESWB 4LLGF 5K7ZA 1R9TJ 1OR7A 1XGMA 3HG9A 3KZYA 3WE2A 2K9SA 1ZARA 1EF4A 2KDZA 1U5TB 4YRVA 1VQPI 1HKSA 2W7NA 4HYEA 3ZR8X 1YI2I 4OIRF 1HW2A 3OYBA 4HEA2 3L2QA 2R5ZA 2W00A 1SC7A 1NH3A 2JA7J 3KZZA 3AG4H 1QHHD 4A3MJ 5J4VA 3MCZA 4G8XA 2IRFG 3ABMH 1DGWY 3RKYA 3VODA 2CV2A 3FM5A 2M87A 1R1VA 2P5LC 2Q1ZB 2IT0A 1GUUA 3BG5A 3NARA 5C44J 2XUBA 1FJLA 3Q0WA 3ZMTA 2RDPA 2OUMA 2DA5A 1ZQ3P 2DAOA 2VJ4A 2FBKA 2ZNZA 2LTPA 2R5YB 2IXSA 2V79A 2CMPA 4M3FA 2LC2A 4CXFA 5GAEJ 3T8TA 1DU6A 1QZEA 2JPCA 1HXDA 1SAXA 4WXCA 3BJAA 4XLEA 2KPMA 5KCMA 4V2FA 4BQOA 2VBXA 3LSIA 4U0YA 3E7LA 3I64A 3RZOJ 3N4MA 5B5EC 2HDCA 1J75A 3GFMA 4FTHA 3HOWJ 3J7AO 3BT9A 4BU2A 2K4JA 2CO5A 1Y8RB 4P9UA 5JHUA 2X6OA 3S1RJ 2E35A 4C3IJ 1G6NA 3BTJA 4QWQA 3TO9A 2M4KA 5H2FC 4CYDA 3KEOA 2IGOA 2VKDA 3MFKA 4KN4X 2VQLA 4D5CA 4C3HJ 2VKHA 4EVIA 2BE5F 1MJBA 2LBFB 2YX4A 9ANTA 2W85A 2IA1A 5ICCA 4RAGA 1FC3A 3ERED 3QU6A 4YIFA 2HDWA 2BZTA 2CQNA 2AS5F 4V19K 2EBIA 1AU7A 3N97A 4EGYA 2KJCA 3BPVA 3SZPA 3JRHA 5B3SH 3GXOA 5LBQA 3HOXJ 2V9PA 3GLXA 2IS4A 1MMGA 4AVPA 1BBYA 3JSOA 4XNFA 2P81A 1O3RA 5J47A 2W1OA 3HBLA 2AQEA 2V1NA 3IRQA 2N8GA 4M74A 2E7XA 1FY7A 2LF8A 1P7IA 2ME0A 1TQIA 5L3FA 3B73A 1ZELA 4KICA 4HLXA 2DU9A 3WTZA 4M9SA 5IYDJ 3LSMA 3QRFF 2WTEA 4FASD 2A07F 2XVCA 4A3LJ 1ONVA 4CCMA 2Z33A 4ON0A 2VIXA 1MKMA 1WJDA 5CJ9A 2CW0F 3E97A 2LR8A 1BI1A 4A3FJ 4RM3A 5HOOA 2WV0A 3HIFA 4U88A 3L2CA 2FQ4A 5DM6F 2A61A 3HSFA 2B63J 2XHKA 2XGCA 1HA8A 1W5CC 2JPBA 3DTIA 3DTEA 2B0LA 3GFJA 4B43A 1ON2A 1X1DA 4WCGA 1TW2A 5M3MJ 1ZH5A 3ZOBA 4AIDA 3SHFA 2XIGA 1DP7P 3FKIJ 4I99C 1UHSA 4PK4A 4EM0B 3FXOA 2ESHA 2EFWA 5M3FJ 5LFAA 2PMHA 3GW2A 1YG2A 1B4AA 4EJTA 5E8GA 4HF1A 1WZ2A 3VYUB 4I76A 4AIKA 3LA3A 2BXYA 3BWGA 5IPAA 3SQNA 3E6BA 4RB2C 3QOEA 3H0GJ 1IF1A 1MSFC 1U78A 1XPXA 3DKYA 1VTNC 4KIBA 2DDAA 4G7OF 4Y17A 4RMNA 2HOAA 1KQ8A 1UB9A 4B3AA 4XRMA 5LGNA 1RIOH 4ZTJA 1R7JA 3BJOA 4JOMA 1I3AA 2BEOA 1GLNA 3DLAA 1HKTA 2VE8A 1MDMB 1Z6TA 3OIPA 1ORKA 4HX7A 3OYLA 1G8XA 2D45A 1IRZA 4EGZA 2CU7A 2QM3A 3PFIA 1HCRA 2DA1A 2XF5A 1OQYA 3JCUC 3KETA 3S3MA 2XGEA 3OY9A 1B9MA 2JRMA 4ESFA 2IP2A 2O9LA 1Z9CA 1IXRC 2K86A 4LD5A 1P6RA 1JKRC 3K0LA 2X9DA 1K78A 3G1OA 3SZTA 3RYPA 1HC8A 4AD9A 1BR2A 3ZN0A 1VQ7I 3HOZJ 2V26A 1T39A 2NVQJ 3S1QJ 2VOOA 1QA6A 4BQNA 1R00A 3F8NA 2VE9A 4HNUA 1KA8A 5ICFA 5D6FA 4DZJA 2V4JC 3DXJF 4BY7J 4U7BA 1OPCA 2K40A 1HF0A 2L54A 5BS6A 1SD7A 1V55H 5DCFA 3W2WA 1CF7B 1WSUA 4KN7X 1WQ2A 2GOXB 2EWNA 2HI3A 2DOFA 5CQEA 4XBFA 3C1DA 4M6XA 4S04A 2MFZA 2VC0A 3HKZN 4XKBA 3OSGA 3V7SA 3KYLA 1YITI 5EGOA 1LVAA 3MZYA 3I4PA 1RRJA 1LDKB 1BN5A 4U0VA 5CQGA 2L5QA 4Y7NJ 2FBIA 4DZPA 5HNHA 4OIQF 1FP1D 3K4MA 2EJRA 3DBLB 4CYCA 2MC4A 2V7FA 1QBJA 3DF8A 3DV8A 4Q47A 2Y30A 3HHHA 5DS9A 3H9QA 5FLXK 4A0XA 3FK6A 3G71I 1IRGA 3K69A 1JT0A 2JUCA 3WODF 1PYVA 5M5XJ 5K1YA 1XMKA 1SMYF 4RLQA 2JA2A 3OOUA 3CF2A 4XONA 3R4KA 4IOCF 5HDNA 1OCOH 4HF0A 2LOOA 5HODA 2CS3A 1SVLA 4N4OB 4XLAA 5E20A 2Z3YA 3HRUA 1JI8A 2VT3A 2DMTA 3UR3C 1D0ZA 2QEXI 3CCJI 2L7MP 1VQLI 5J4YA 5JFRA 1H8AC 1K4SA 4UVCA 3QWLA 5A2QZ 3ZGKA 2CG4A 3QYEA 2EQRA 4IHXA 3E6CC 4EQQA 3I55I 2LYCA 4KISA 2Y0SA 1DGRM 1Z6RA 5GTIC 2L4AA 3JRAA 1T33A 3Q9SA 4BXUA 1U3EM 4G7HF 3I59B 3I4MJ 1Z7UA 4R1HA 4AC0A 4MHGA 3F6OA 4YFKF 1X1BA 1IUYA 3TL4X 5FKNA 2W24A 5F0CA 2ZXWH 4B47A 2M7BA 4M73A 4B8XA 2XSDC 3HHGA 4YG2F 3K4NA 3OL4A 1Z05A 2ZFWA 2ISZA 2V1DA 2P7VB 5FRMA 4FETA 4WX9A 1ETKA 2JSCA 1YHQI 2HXOA 5LHIA 1MBFA 2ELHA 1G3YA 2NVXJ 2O0YA 1Z21A 1SD4A 4Z2YA 3H9JA 1TQPA 2WADA 2EIMH 3KP4A 1AWCA 3ROUA 4HG2A 1DDNA 2HOSA 3AG2H 3DPLC 4P9FA 3C2GA 2EINH 4IXAA 3FMRA 4OAYA 3NEUA 5IP6A 3PO3J 1IN8A 1PVEA 4MEYF 4QPOA 3LA7A 1DU0A 2Y0MA 1MMDA 2IEKA 5JLXA 1MNDA 3K4LA 3LWFA 3OMYA 4HQMA 4B3XA 3J81K 1PUFA 1OJLA 4P55A 4Y15A 1Y0UA 1MBEA 1MGTA 2L9NA 4EJUA 1OCPA 2NS8A 4YFNF 3F9KA 4I2OA 1MD0A 4KMFA 3OYCA 2Y69H 4KIGA 3DP7A 4I0BA 3TDUC 2MSYA 2VB6A 4AU7A 5CKTA 4C3JJ 2K3PA 1Y8QB 1UCRA 1B8IB 4DNCA 4F93B 2HR3A 4IHWA 2NNYA 3KP2A 3EYIA 3HOTA 1VNDA 3BR1A 1D3YA 3LSPA 3H9GA 4BAYA 2EFOA 3GTGJ 2P5KA 5L3DA 1FBSA 1TP4A 2HKXA 3OYDA 3E6DA 3F3XA 1LE8A 1YO5C 2QBYB 1FMWA 1HDPA 1KONA 1YRNB 1E3HA 2VODA 5TJJA 3KYCB 1G3WA 2KIMA 1NG7A 3TOBA 3E5UA 2OQGA 1O4XA 3GTKJ 4M9ZA 1ZR4A 3ISPA 4PJMA 4M9XA 2FSWA 1J09A 3F8CA 2RKHA 5FFXA 2Y2ZA 1WRJA 3FF5A 4KT6A 3TDZC 1JTXA 1QZZA 3KEYA 2Q2EB 3G1MA 2R7SA 2NVTJ 3SZGA 1K83J 2ZXJA 2WB1N 2QGUA 4II2A 1WKMA 3K1PA 3ZQ7A 4BHPA 2ZJRF 1VI0A 4GDFA 3IL2A 1IDYA 1T38A 1ETVA 1ULYA 2CJJA 2DMQA 2LY2A 4BQAA 3DEWA 1WI9A 2NNNA 1IXSB 4NC7A 1XSDA 2LLKA 4L5JA 4RGUA 2VPRA 2YSRA 2Z9OA 1JJ8C 3HOSA 4RBOA 2Z1DA 3RPUD 2WC2A 1R1TA 3PM1A 5CVIA 4IRIA 2P0WA 4NB5A 2BHZA 4BEHA 1I27A 4G6DA 4Q48A 4BHCA 3M8FA 1ZG5A 2E2JJ 5IT9K 1MJ9A 4UVAA 1W7PB 5JI6A 2OBPA 4GYGA 2H6BA 2X6YA 3LL7A 3PUFA 3TO6A 3LAJA 1SEUA 4L18B 4MQVA 2A3SA 2C6YA 4AYBA 3H5NA 3M7GA 3PL8A 5KAFC 4G9YA 1D8KA 1TZLA 1XCVA 4UV9A 4UUSB 3L2VA 4W97A 5ICGA 1IN4A 1MIJA 3H35A 1UMQA 2F5EA 4BH9A 3NWTA 2K9LA 1ZG3A 4L0YB 5FKLA 2W25A 3HPGA 4CH7A 3MWMA 2B7EA 1GHCA 1JXSA 1F1ZA 3SFZA 2VLAA 2IS6A 1HQCA 3ZP5A 2RC4A 1VZ0A 2G7UA 4ZDLA 2M5WA 2HPIA 2UXXA 4A5NA 4LJZF 5F1JA 4LB6B 4HW0A 1P4WA 3W6VA 1KYWA 3NAUA 5TISC 3F8MA 2X48A 1PP8F 3WTXC 1BM9A 5FROA 2ECBA 1U8RA 3GEZA 3S14J 4UHTA 3OS0A 1F9NA 2MGQA 2X1DA 5EJCA 4ITVA 2OU2A 5K5OA 5L3EA 2NS7A 1L3LA 1FYKA 3S1NJ 4R79A 2NOGA 3HTUA 5F64A 1XDUA 4D1QA 2BVLA 2QQBA 4EEFG 4XRSG 3FISA 3IWFA 3JTHA 3CC7I 1SVMA
chains in the Genus database with same CATH topology
4AVZA 2M4KA 3OYEA 2IGOA 2VKDA 3RTRA 2VQLA 3VYRB 1X19A 3A2KA 2VKHA 3PUBA 2LBFB 4X0GA 1U0JA 2X1CA 3VSKA 3H0DA 2HVRA 2WAQA 2CW8A 2HDWA 2L9SA 3S3OA 1ERDA 4F91B 4KJZA 4BEHB 1V5EA 2R7OA 4BE1A 3J7AY 3K70C 1BR1A 4BACA 3K10A 5KNLA 2VPLA 1WJEA 4LIUA 1Z3YA 4XMYA 5HVQC 1TT0A 2IS4A 1MMGA 4N4NB 4P1WA 2LY1A 4XNFA 4BQQA 3L2WA 2W1OA 4OWRB 3ZQQA 3IP4B 3FDYA 2AQEA 3HXLA 2V1NA 4RM2A 4BJ6C 3SEQA 2K9MA 4BS9A 3AL0B 3PNTA 4XLCA 2LRDA 1ZELA 2DT6A 3LSMA 1W36C 4FASD 2IGMA 3L2RA 4CCMA 4II3A 2HU9A 2VIXA 1WJDA 3BCAA 2M3AA 3L2UA 2LBFA 4E4HA 4RM3A 5HOOA 5LD2C 2FUG2 3AL0C 2OV7A 4DGWB 4C2UA 1UG0A 1HA8A 3DTIA 3DTEA 4B43A 1X1DA 3AFHA 1LVKA 1IRXA 3OS1A 2HPMA 2DT7B 3LMMA 4DJAA 2BOLA 2F4IA 2A5WA 2V6EA 2VQHA 2KRHA 1T95A 1MW7A 4PK4A 4B48A 1MMAA 3I9V2 3CP8A 5LFAA 2GOMA 3W2AA 3VYUB 3OYNA 4CCKA 4PJNA 3QOEA 1BR4A 4EATA 3DKYA 3V42A 3K6GA 2WBMA 1S9HA 4RMNA 2KHMA 2BW3A 2WA0A 2JSPA 1X1AA 1YE9A 3DQVC 4BDYA 4ZTJA 1UAAA 3LSKA 4Y4RA 4JOMA 1D1BA 1GLNA 3DLAA 5FRNA 4BUPA 3OIPA 3W2VA 4E7JA 1N75A 2A6TA 3OYLA 1G8XA 4NUBA 4U87A 3OYJA 4ZJZA 2RREA 2R7UA 2LH9A 1WJCA 2XF5A 3K70D 2IGKA 2QKLB 3S3MA 3SYTA 4E7SA 3OY9A 3BLYA 4ANJA 2F5VA 3EUKL 2WAFA 1SFKA 2VQGA 3OR1C 1BR2A 4CCJA 2KRCA 3OYMA 2NOJB 2V26A 3LFUA 4BQNA 2PJRA 3K4KA 5HNFA 4HNUA 1MNEA 4GRIA 3OYFA 4HRIA 2V4JC 1QU3A 2XSJC 2ZSHB 3G2BA 4U7BA 2F6CA 4G6TB 4CA0A 3SEZA 3BG6A 3W2WA 1W36D 1BOBA 1K6YA 2VASA 2GOXB 2X6WA 3OR2C 3IAM2 1UELB 2M7AA 5CQEA 4PSXA 2HQAA 4MLOA 2ZFUA 4KITB 4J00A 2MFZA 4XLHA 4XKBA 3A1YA 4PJJA 3W3CA 3KYLA 4BJ5C 3MD2A 1LFPA 2VJ5A 3PNYA 1LDKB 1N77A 2QKMB 5CQGA 2L5QA 3HL2A 4E7ZA 5HNHA 3A4CA 2R7RA 3K4MA 1D1CA 3OL3A 1PJRA 3CESA 2HZDA 2MC4A 2V7FA 3OYHA 2XAUA 2ZSIB 4QPQA 4C30A 4B44A 4E7LA 2CV1A 2O5RA 4IZZA 2CFOA 3H9QA 3VYSB 4CSWA 2M0MA 4P5OA 1PYVA 4RLQA 2JA2A 2BW3B 3M8JA 3OOUA 3CF2A 4XONA 1Z7LA 2LREA 2KDOA 2UV1A 4XKVA 3S3NA 2XDVA 2LOOA 4D9JA 3E0JB 2X85A 2E1MB 2OC6A 3PNVA 2CS3A 2IS1A 4N4OB 4XLAA 2MYSA 1JI8A 2RQQA 3UR3C 1D0ZA 2I8DA 3HKZA 2DJIA 1X4OA 3U21A 3BC8A 3MMYB 2ZXHA 2DXIA 3ZGKA 3QYEA 2VJIA 2L2OA 3SDBA 4NNJA 1N78A 2LYCA 4XORA 3OYIA 2Y0SA 2HVSA 4KISA 1DGRM 2W82A 2CUJA 2R7XA 2E1MC 4PFOA 3H5RA 3KX2A 3CJQB 2PJRB 4DBQA 2Z16A 4F52A 3VWBA 3FBIB 4LG3A 3K4JA 5CPRB 2L7KA 1X1BA 4CUGA 1Y6IA 4J01A 3CP2A 3TL4X 3D5LA 2JVGA 4B47A 2M7BA 2UUZA 1OLTA 3DTKA 4Y33A 4ZC3A 2KL4A 3K4NA 3OL4A 2CW7A 4BE0A 2WY8Q 3PSFA 5FRMA 4FETA 1FMVA 4IQJA 1P9QC 2JUGA 3HC7A 3EPZA 1D1AA 4XOPA 1Z21A 5JHFA 5KHDA 2JVHA 2KZVA 3NWSA 1WJBA 4XN0A 3H9JA 2WADA 4HSTA 2W4SA 1WJFA 3QYFA 3OYAA 4IX7A 4HG2A 2R7WA 3DEEA 3DU6A 3DPLC 1X4PA 4ZTFA 3C2GA 3D5SC 4OAYA 1R6RA 2KLOA 4YELA 4QPOA 1EA3A 3DKXA 1MMDA 3ZRGA 3H5AA 1MNDA 1V5FA 3K4LA 3OMYA 4IQ4A 3K4CA 4DBRA 4B3XA 4XL9A 2K5CA 1WJ5A 3OYGA 4HSRA 1YX5A 1D0XA 2L9NA 3BCBA 3VDXA 2KMUA 3F9KA 4C9YA 3OYCA 4ZYAA 2ZXIA 4CZCA 3OS2A 2LG4A 2VB6A 3TBIA 2VQCA 4AU7A 5CKTA 2K3PA 4BL0B 1MMNA 3N05A 4F93B 2X6XA 3MKZA 5TGTA 2WAEA 4PJLA 3PSIA 3S8PA 3HOTA 3S32A 3EUAA 3H9GA 2VJJA 4DOZA 3BG7A 4F55A 5HLTA 1WFXA 3ZCOA 3DU5A 3HUGB 3ONQA 1DP3A 1X1CA 2V9KA 1Z3XA 3OYDA 4BDZA 1FMWA 2HVQA 1KONA 4BGDA 2VL8A 4E7IA 2CV0A 4H4KC 2VXDA 2VXZA 4PSWA 1NG7A 4E7HA 4HNTA 4PFPA 2E5ZA 3QYBA 4PJMA 2PMZA 2IGNA 2E60A 4RLFA 4BE2A 1J09A 4DIQA 2AQFA 3IAS2 4C2TA 4KT6A 3RQ4A 4NQWB 3RCOA 3RSNA 3KEYA 2Q2EB 4NC8A 3OYKA 1E0EA 2R7SA 3UNGC 3FHNA 3K4BA 3PFYA 2UWMA 3SZGA 4II2A 1T0FC 3IUOA 3LSGA 3E1SA 2WY7Q 3QODA 1OR7C 3CMMA 4ZDPA 4ZDOA 2E5NA 1YX3A 2R7VA 3CJRB 4XOTA 2LY2A 2X1EA 3EUHC 4Y3OA 4NC7A 2ELJA 4F92B 2M4GA 3HPHA 2CH0A 4LITA 3HOSA 2X51A 2Z1DA 3OWTA 4F3QA 3RPUD 3TMOA 2P0WA 1D0YA 2XF6A 3FKJA 3M1CA 4YEJA 2IS2A 4XLFA 3VSLA 4BEHA 2XC7A 1NG6A 2DOAA 2X6YA 2XF7A 3LL7A 3MKWB 3HG9A 2DCEA 4AYBA 3H5NA 4XR6A 3DWLE 3PL8A 3PJRA 4YRVA 2W7NA 3ZR8X 3CZ6A 1SAUA 2MD0A 3OYBA 4HEA2 1TZLA 3L2QA 3L2VA 2W00A 2MABA 3AKZA 1DQUA 3H35A 1QHHD 2CUZA 3S93A 2RNGA 3DPTA 3NWTA 1DGWY 2K9LA 2Z2SB 4HPQA 4OAZA 3I3LA 2CV2A 3GBGA 3HPGA 3LSHA 4CH7A 4XKCA 4BXFA 3VYTB 2WB1A 2Q1ZB 2HNHA 4XM3A 2VLAA 1QHGA 4E6KG 2IS6A 1VZ0A 3D5RC 4ZDLA 2HPIA 2OUMA 1V5GA 4CCLA 3OIQA 4LIVA 2VJ4A 1LKXA 2IXSA 4XQFA 4JQFA 2CMPA 2KQRA 2LC2A 3DPUA 2KP6A 4BJTA 1G59A 4IKFA 2R7TA 5FROA 4XLEA 4CCNA 2KPMA 5KCMA 1WJAA 4XKWA 4XN3A 4BQOA 3FBNB 3LSIA 4CCOA 3OS0A 4PUSA 2BVMA 2X1DA 4ITVA 3C2HA 2R4GA 4BU2A 4E7KA 2R7QA 4R79A 4D1QA 3MKYB 3ZXSA 2BVLA 1AA7A 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSP A; 
#chains in the Genus database with same CATH topology
 1W4M A;  2H8R A;  1WPK A;  3OYE A;  4IHV A;  1A6I A;  4L9T A;  3LSR A;  3A2K A;  4XID A;  2QWW A;  4O3M A;  3S17 J;  5FFZ A;  3KIO A;  3QU3 A;  4X0G A;  2X1C A;  1OYY A;  2W57 A;  1E17 A;  3ECH A;  2JTV A;  3GUD A;  2L9S A;  2EFP A;  4S0H B;  1ERD A;  2E34 A;  4JK1 X;  5E1Z B;  1YYV A;  4BE1 A;  4IO9 F;  3O8H A;  2LMD A;  3H3U A;  1BR1 A;  4KNY A;  3K10 A;  4MNU A;  4OMZ A;  3I58 A;  1JJ6 C;  5HVQ C;  4UUV A;  1TT0 A;  2PLY A;  1WWX A;  3DKW A;  4F7Z A;  1FEX A;  1J9I A;  5LEJ A;  3IC7 A;  3L2W A;  1IN5 A;  2M34 A;  1LEA A;  1B72 B;  3B6A A;  3ZQQ A;  3FDY A;  5J1Y A;  3WGI A;  2CRG A;  4RM2 A;  1XMX A;  3M1E A;  4BJ6 C;  2HS5 A;  3REO A;  2BY3 A;  2LRD A;  2IA0 A;  1T98 A;  1LB2 A;  2DT6 A;  1FZP B;  2VBW A;  1CQT A;  4L9N A;  1XX5 A;  4LMY A;  1PDN C;  3L2R A;  3HRM A;  4II3 A;  1TT5 B;  2HU9 A;  2IA2 A;  3LAP A;  3CC2 I;  2DQR A;  5EF6 A;  4M3G A;  1TNT A;  2H1L A;  4E4H A;  3L1P A;  2E19 A;  4O6J A;  3L00 A;  3G4S I;  5LD2 C;  5IP7 J;  1IV8 A;  1HLV A;  3AL0 C;  4DGW B;  1XC5 A;  1BW6 A;  2MH9 A;  4YFX F;  5J1R A;  4A93 J;  2O8X A;  1OYW A;  4HX8 A;  4BNC A;  3AFH A;  3MKL A;  5HS9 A;  1IRX A;  3A01 A;  4KYW A;  3OS1 A;  2HPM A;  2DT7 B;  3LMM A;  2M8E A;  3NQO A;  1B9N A;  1EH7 A;  2A5W A;  1W5T A;  2BV6 A;  2KRH A;  4P96 A;  2BY2 A;  1D8J A;  1IXC A;  1MMA A;  3CP8 A;  1GV5 A;  3WGG A;  3G6E I;  2CWE A;  3J80 K;  4ESJ A;  4BXX J;  3TKY A;  4G94 A;  3OYN A;  1UHM A;  1CGP A;  1Y39 A;  4KIF A;  4JP0 A;  2PMU A;  4PJN A;  2QZ8 A;  1FP2 A;  3BY6 A;  2WBM A;  3BR6 A;  2DFH A;  2BW3 A;  5BNG A;  2DTZ A;  1X1A A;  1YE9 A;  3M4O J;  4WF2 A;  2XGD A;  3LSK A;  4Y4R A;  3WHC A;  2RV8 A;  4BUP A;  4M3D A;  3W2V A;  3CUO A;  2CUF A;  5JLW A;  3V4G A;  1MH3 A;  3X2Q H;  3OYJ A;  4ZJZ A;  2G7H A;  2RRE A;  1R71 A;  1FLI A;  2L9V A;  1MBK A;  2QKL B;  3SYT A;  3HZJ A;  3JRF A;  4DYR A;  3M07 A;  4E7S A;  3S2W A;  2F5V A;  1FBU A;  2DT5 A;  1SD5 A;  2A69 F;  2VQG A;  2ZME A;  2A68 F;  2L7F P;  3WG9 A;  2KRC A;  3OYM A;  1FT9 A;  2RGV A;  3ZQF A;  4R8H A;  2PMZ N;  1VF9 A;  4HRI A;  1TL8 A;  1EV7 A;  4PDK A;  4PZJ A;  1ZLJ A;  1RZ4 A;  2AO9 A;  5GAG J;  1MH4 A;  4A3I J;  2GLO A;  5F0F A;  2EIK H;  4G6T B;  4CA0 A;  3J80 Z;  2FOK A;  2VAS A;  3HEF A;  4A3K J;  5BMZ A;  2HQA A;  4HNV A;  2K3F A;  3GZN B;  4UXN A;  4BKX A;  4KIT B;  2UZK A;  3A03 A;  3WTY C;  4PJJ A;  1JGG A;  1NTC A;  2K9Q A;  4ASN A;  3L7W A;  1A35 A;  4BJ5 C;  3MD2 A;  1R23 A;  1LFP A;  2M0C A;  2A6E F;  5FD6 A;  4ENM A;  5FLV A;  2VBY A;  4D5F A;  2A6H F;  3HL2 A;  1G4D A;  3A4C A;  2XAQ A;  2K7L A;  3QPS A;  5GPC A;  5GAH J;  2NXN B;  4WK8 F;  2HZD A;  2HQ5 A;  5E8I A;  4M6V A;  3CO6 C;  1XSX A;  2CSO A;  2QVO A;  3FXJ A;  3ZMU A;  4C30 A;  3GFL A;  2CQX A;  1RUN A;  3I56 I;  2CFO A;  5DM7 F;  4IHS A;  2CFX A;  5FKM A;  4X1E A;  3VYS B;  2DK5 A;  5L3G A;  2WV1 A;  3TP0 A;  3M9A A;  5J40 A;  5B66 C;  2KKO A;  3CD6 I;  1T6S A;  2GXA A;  3F22 A;  1JT6 A;  2V1X A;  1SMT A;  2ID3 A;  4A3J J;  1Z7L A;  2H8W A;  2KDO A;  4XK4 A;  3FHZ A;  4GCV A;  2GA2 A;  3C2B A;  3S3N A;  2XDV A;  4D9J A;  2EZI A;  3LA2 A;  3OSF A;  3CMA I;  2E1M B;  3PNV A;  2IS1 A;  3IWZ A;  3VEP A;  2MA3 A;  1J59 A;  2RQQ A;  4EM2 A;  5IY5 H;  3IKT A;  4K2E A;  1A6Q A;  2DJI A;  3HKZ A;  3LQQ A;  4NC6 A;  5FKO A;  1IAW A;  3MMY B;  2ZXH A;  2MG4 A;  3WU2 C;  1R58 A;  3SDB A;  3ABU A;  3CDI A;  2RAE A;  4XOR A;  2HVS A;  3E5X A;  4MFD A;  1W0T A;  2QF7 A;  3ELK A;  3FMQ A;  2O3F A;  2FNP A;  3KX2 A;  4IRG A;  3CJQ B;  1A36 A;  2PJR B;  3BR3 A;  1VQ9 I;  2LVS A;  1RUO A;  3FBI B;  3BTL A;  1W0U A;  4HBL A;  1WI3 A;  5LEK A;  1Y6I A;  1PUF B;  2PN6 A;  3RQI A;  4B4C A;  2D1V A;  3JRB A;  3WGH A;  2ZME C;  4Y33 A;  3K7A J;  3T8R A;  3IRR A;  4XSZ F;  1LEB A;  4NQW A;  3PSF A;  3JTG A;  1MBH A;  1FMV A;  2DW4 A;  1RPW A;  1XSV A;  2BHY A;  2JT1 A;  1AKH A;  1P9Q C;  1Z0X A;  2JUG A;  3BJ6 A;  3HC7 A;  3EPZ A;  3ZMS A;  2LKX A;  1DUX C;  4XOP A;  3A02 A;  3CUQ B;  5KHD A;  3GWZ A;  2DFE A;  3KCC A;  3I53 A;  3G1L A;  2FOW A;  3I4N J;  5H6R A;  2W4S A;  1WJF A;  3OYA A;  1SFO J;  1IG7 A;  2R7W A;  3LSJ A;  3DEE A;  2XAS A;  3CQZ J;  3D5S C;  3PIP F;  2X4H A;  3O8G A;  2Q0O A;  1ENH A;  4UB6 C;  3DFG A;  1FOK A;  2NVY J;  1TWG J;  2X0L A;  4IL6 C;  3KP7 A;  4W1U A;  1XMA A;  1TBX A;  3H5A A;  1ZG1 A;  1LUJ B;  4RAY A;  1QQI A;  4IQ4 A;  3K4C A;  4DBR A;  4QLC U;  4A12 A;  4XL9 A;  1HST A;  3CCE I;  4HSR A;  2R3S A;  5CVV A;  3BCB A;  3O2P E;  4BBS J;  3VDX A;  4IHY A;  2KMU A;  1U5T A;  1OMI A;  5A2Q K;  1QGP A;  4CZC A;  2YX7 A;  3OS2 A;  3TBI A;  3WTV C;  2YU3 A;  2DO7 A;  2LP0 A;  3RPU A;  4BL0 B;  4DQ2 A;  2DPD A;  4OIP F;  1WCM J;  2DMP A;  2F5F A;  5ED4 A;  1SD6 A;  2M1B A;  1EH6 A;  2QQ9 A;  3BG7 A;  2EK5 A;  4F55 A;  3CME I;  3S15 J;  4Y52 J;  2L3D A;  2ID6 A;  1BW5 A;  1JKO C;  2E7W A;  3HUG B;  3ONQ A;  1DP3 A;  2P6S A;  2OZ6 A;  4CHU A;  1OFC X;  1QVT A;  2HVQ A;  2DDB A;  4MFE A;  4BGD A;  1RR7 A;  4E7I A;  2R5Y A;  2KFD A;  2CV0 A;  2VXZ A;  2UXN A;  4JX5 A;  4PSW A;  1X58 A;  3Q0U A;  3QQA A;  4E7H A;  4G6Q A;  1XGS A;  2E5Z A;  3QYB A;  1H89 C;  1UHW A;  2FEZ A;  1GVD A;  2IGN A;  4RLF A;  3U9G A;  1XB4 A;  3P5J A;  4EM1 A;  2LNB A;  4ESB A;  1Q1H A;  1ZK8 A;  4B09 A;  3FK7 A;  4C2T A;  3RQ4 A;  3S16 J;  3RCO A;  1UJ8 A;  1BI2 A;  3RSN A;  2VOP A;  1DPU A;  5EG0 B;  1E0E A;  2FA5 A;  3HDD A;  5L3C A;  2R7D A;  2FD5 A;  3PFY A;  4AIJ A;  2UWM A;  1QPM A;  5HLG A;  3LSG A;  2VON A;  1O3Q A;  3JRC A;  3COA C;  3CMM A;  1EH8 A;  2E5N A;  3GTJ J;  5E17 F;  2VT2 A;  1ZGJ A;  4LB5 A;  3KFW X;  4V2G A;  2CQQ A;  3ZMZ A;  3RIR A;  4KDP A;  3S2H J;  4ENK A;  4F92 B;  2M4G A;  5IYB J;  2EB7 A;  2F4M B;  3CTA A;  2CH0 A;  1U9N A;  4FX4 A;  2X51 A;  3TOA A;  3DLL F;  3OWT A;  3H36 A;  4YEJ A;  2HQN A;  3VSL A;  4PJ0 C;  3HYI A;  1YS7 A;  2XC7 A;  1IJW C;  1ZRE A;  1B1B A;  2MW8 A;  2JRT A;  3GTL J;  3W6K B;  4PGH A;  3MKW B;  2HYJ A;  1NK3 P;  5J8C A;  3MN2 A;  1YTY A;  5DV5 A;  2DCE A;  1JE8 A;  4LGW A;  4LG0 B;  2BXZ A;  1X3Z B;  3GX4 X;  1R5H A;  5HDK A;  4YII A;  4OIO F;  1FYM A;  1GXP A;  3AKZ A;  4BY1 J;  1DQU A;  3WU0 A;  1R1U A;  3V8J A;  4IEJ A;  2RNG A;  4GO1 A;  2LD5 A;  2XGX A;  2Z2S B;  4GGG A;  4HPQ A;  4OAZ A;  3GBG A;  4XKC A;  3VYT B;  4ZH4 F;  2WB1 A;  5LRR A;  3E3V A;  5ILV A;  5IOY A;  2DOE A;  2HNH A;  1BC8 C;  1K61 A;  1QHG A;  4MEX F;  1U5T C;  2OTL I;  3IKV A;  4A0Y A;  2WAQ N;  3D5R C;  3E5Q A;  1MZB A;  1USS A;  1PUE E;  1FOX A;  4CCL A;  4HV5 A;  4LIV A;  1XGN A;  4UNO A;  1MMS A;  3GZ6 A;  2GM4 A;  5DUK A;  2GWR A;  4XSX F;  2KQR A;  4LOC A;  3GTM J;  4I0A A;  1BI0 A;  3DPU A;  5ILU A;  4BHB A;  2EPF A;  3J7Z I;  4BJT A;  1G59 A;  4IHT A;  2R7T A;  5M5W J;  1KU9 A;  4CCN A;  4HV6 A;  1WJA A;  4XKW A;  2PX9 A;  1VQ6 I;  3FBN B;  1TWH J;  3Q0V A;  4CCO A;  4RDU A;  1ETX A;  2BVM A;  1AOY A;  4UB8 C;  4MIM A;  3RKQ A;  1ZRD A;  3QPT A;  2NS0 A;  5FB2 A;  4A69 C;  2COM A;  3P7N A;  2PBI A;  1VFC A;  4HX4 A;  2LSO A;  3FXM A;  1AA7 A;  1Y56 A;  4AVZ A;  1XD7 A;  5K7H A;  5K5R A;  1TWF J;  2ZO4 A;  3BPX A;  5AIP A;  1XTA A;  1E3P A;  3RTR A;  4A6D A;  2PJP A;  1BJA A;  3VYR B;  1X19 A;  3F21 A;  4A3B J;  1VQM I;  2AXL A;  2OAZ A;  3HTS B;  5DD8 A;  2HYG D;  3TO7 A;  3GTO J;  2JWT A;  2YPR A;  3VSK A;  2DYR H;  2DLL A;  2GZW A;  3GYH X;  2WWY A;  1FX7 A;  2ZCW A;  3WTS C;  1MDM A;  2DA7 A;  4KJZ A;  5CVR A;  1V5E A;  2R7O A;  3BP8 A;  3J7A Y;  4C2M J;  1EKE A;  2ADU A;  2KIF A;  5KNL A;  2VPL A;  2OTJ I;  3FXQ A;  3S1M J;  3RYR A;  5C4J J;  4LIU A;  2DA4 A;  3HB9 A;  2E71 A;  2OQR A;  4N4N B;  1SFE A;  5C3E J;  3RI4 A;  3JRG A;  2R5Z B;  4BQQ A;  2AHQ A;  5H20 A;  2JMW A;  4OWR B;  2R7Z J;  3IP4 B;  3HXL A;  5DCM A;  4JBA A;  2QCO A;  2DN0 A;  2XRL A;  3JAM K;  5TRD A;  3KE2 A;  4RA2 A;  3WHB A;  1FTT A;  4XLC A;  2K85 A;  1P4X A;  3ABK H;  3IV5 A;  3RDI A;  2JA8 J;  4HDU A;  2J5P A;  4L5I A;  1CF7 A;  1O3T A;  2ZNY A;  2IGM A;  3LFK A;  1YLF A;  2R0Q C;  2VI6 A;  3F23 A;  3R0A A;  3L2U A;  1RKW A;  3CCS I;  2Z5U A;  4DYC A;  1TLH B;  1RES A;  2EZH A;  3ABL H;  3DCF A;  4MQ9 F;  2ISY A;  4JX4 A;  2OV7 A;  3GZ5 A;  1YIJ I;  1UG0 A;  3SJM A;  4D7M A;  2V9V A;  3LQR A;  4M72 A;  2J5O A;  4L5E A;  1LVK A;  3PO2 J;  1W5S A;  1JHH A;  3JW4 A;  4M71 A;  1ZRC A;  2BOL A;  2OCC H;  4HDV A;  3ASN H;  2F4I A;  3ZN1 A;  1ETO A;  2VQH A;  1QVU A;  1T95 A;  2LY9 A;  1OIS A;  3HGY A;  1MW7 A;  2ZBK A;  4RS8 A;  5EYR A;  4A0Z A;  4ZZL A;  1W1W E;  1HW5 A;  4HF2 A;  2OF7 A;  3I9V 2;  2GOM A;  1ZRF A;  1ZAO A;  3BG3 A;  2O8K A;  5EZH A;  5ICE A;  2JQ7 A;  5FKK A;  2XV4 S;  2EIJ H;  2YU9 J;  1IGN A;  2XRN A;  3QPL A;  1BR4 A;  2DA3 A;  5F0H A;  1EJ9 A;  3V42 A;  2XB0 X;  1TWA J;  1FNN A;  1I50 J;  3DQV C;  2EFN A;  4BDY A;  1YFH A;  1OCZ H;  2KIQ A;  3JAM Z;  3T5X A;  2IAI A;  1D1B A;  2QSG X;  1N75 A;  2A6T A;  2NAZ A;  4NUB A;  3LST A;  1QO0 D;  2LH9 A;  1WJC A;  3GFI A;  5E18 F;  1DPR A;  5FGM A;  2JK3 A;  2P7C B;  3R60 A;  1F36 A;  3BLY A;  1JKP C;  3EUK L;  2WAF A;  1FTZ A;  3KYD B;  3T0Y A;  5H6Q A;  1U6G A;  1V3F A;  3L09 A;  2B9S A;  2LF7 A;  2PQ8 A;  1X3U A;  4CCJ A;  5GAD J;  1LNW A;  3K1M A;  3K4K A;  3I59 A;  5HNF A;  1MNE A;  1QPI A;  5BQT A;  1QU3 A;  2KJB A;  3G2B A;  2E1O A;  1P7J A;  5EEA A;  3SEZ A;  3FX3 A;  1F43 A;  4EJW A;  2STT A;  1BOB A;  1BL0 A;  1D5V A;  1SFU A;  4FCY A;  1B59 A;  2X6W A;  3FM3 A;  3IAM 2;  1UEL B;  2M7A A;  4MLO A;  2F5D A;  3HSE A;  5CYV A;  3CCU I;  4J00 A;  2Y9Z A;  2O7O A;  1TNS A;  5D8L B;  2GAU A;  3W3C A;  2COB A;  3HSR A;  5CLS A;  3CF5 F;  2FNA A;  5HS7 A;  3K2Z A;  5FLM J;  1UG2 A;  2O03 A;  2L9R A;  5FJ8 J;  5ILS A;  4G7Z F;  2XPU A;  2F48 A;  5CVU A;  2R7R A;  2NVU B;  3ERM A;  1YOV B;  4ZYG A;  3VPR A;  2BGC A;  3CES A;  2V6C A;  1APL C;  3F72 A;  3MAJ A;  2ZSI B;  3K9T A;  4KUM A;  4PGG A;  4AM3 A;  2GA1 A;  2M0M A;  3B02 A;  4P5O A;  1H9T A;  4AYB N;  1M1E B;  2OD5 A;  3M8J A;  4BYY A;  3U2R A;  2LRE A;  2XPW A;  2UV1 A;  5F08 A;  3MZH A;  4XKV A;  3L9F A;  2IVM A;  5KVR A;  2X85 A;  1P92 A;  3KP5 A;  1UFM A;  2GXB A;  4HZF A;  2QSF X;  2MYS A;  1T08 B;  2FXA A;  4I01 A;  1FPQ A;  2BYV E;  3F6V A;  3B6C A;  3AG1 H;  4D7N A;  1YS6 A;  1U8B A;  4NDL A;  1X4O A;  2PG4 A;  1MJA A;  1B8I A;  3BC8 A;  1ZKG A;  2H6C A;  2VJI A;  5AIQ A;  1N78 A;  1K78 B;  3BZC A;  1P2F A;  3OYI A;  4FE7 A;  1H9G A;  3RZD J;  2CUJ A;  4PFO A;  1S3J A;  3H5R A;  4ABZ A;  4DBQ A;  3QAH A;  2ESN A;  4F52 A;  3VWB A;  2QBY A;  1HOM A;  2HYF A;  1MBG A;  1LFB A;  1OYI A;  4E70 A;  4DYQ A;  1FIP A;  3K4J A;  5CPR B;  2L7K A;  4OU0 A;  4J01 A;  1T0F A;  3CP2 A;  3P9I A;  3TP3 A;  2EZL A;  3CLQ A;  2L4M A;  3LOC A;  1K79 A;  1T8I A;  5K7F A;  3TW6 A;  1J0R A;  2DTR A;  5DD4 A;  3DTK A;  4ZC3 A;  1Y0N A;  4MTE A;  3VB2 A;  3DBR B;  3QP5 A;  1FBQ A;  3HOU J;  2CW7 A;  2AXT C;  4BE0 A;  1MSE C;  5DYM A;  1IN6 A;  1O57 A;  2Q2E A;  2K02 A;  4ZYH A;  1RR8 C;  4GXO A;  4IQJ A;  5EGO B;  1JHF A;  1KZH A;  1D1A A;  2KIS A;  1TQM A;  2D2W A;  5D5W B;  3ULQ B;  1IDZ A;  3R0J A;  3TW7 A;  1ZR2 A;  3KP3 A;  1D5Y A;  4XN0 A;  3RJP A;  3FXR A;  3OV8 A;  5KK1 A;  4HST A;  3QYF A;  4IX7 A;  1OCC H;  3KPH A;  4X6A J;  1YW9 A;  4CYC B;  4HLY A;  3DU6 A;  3V7R A;  1X4P A;  4HA8 A;  4ZTF A;  1P4A A;  1X3W B;  3CJT B;  3V8K A;  2LFB A;  2KLO A;  4RB1 A;  1BIB A;  3FXK A;  4YEL A;  1EA3 A;  3DKX A;  2PI0 A;  3MEX A;  2DJN A;  4AUX A;  3ZQI A;  3G3Z A;  3BTC A;  1W7P A;  1HBX G;  5EZG A;  1POG A;  2EH3 A;  3GLL A;  3OYG A;  5BPD A;  4M3E A;  1D0X A;  1R4N B;  5D4S A;  1K7A A;  1Y1W J;  4MO7 A;  4IJA A;  3SFI A;  3I54 A;  4ZYA A;  1RI7 A;  2H09 A;  4MTD A;  2LG4 A;  4UUS A;  5J6X A;  2G9W A;  1LQ1 A;  3CCR I;  1LDD A;  2H94 A;  1IO2 A;  5TGT A;  2WAE A;  3PIO F;  3ZQH A;  1A04 A;  4GYI A;  4BBR J;  2JJ7 A;  2F2E A;  2DMU A;  3O6B B;  2ICW G;  5HLT A;  2HTS A;  1WFX A;  3EET A;  2QQA A;  1TWC J;  3JRE A;  2BBY A;  5KAI C;  1Z3X A;  3BZ6 A;  3HOY J;  2P6T A;  2P8T A;  5F27 A;  3FWE A;  2EA2 A;  1QRY A;  4CIC A;  2FQ3 A;  1WHU A;  2VXD A;  2IW5 A;  2M8G X;  4PFP A;  4HNT A;  4NBQ A;  5FO5 A;  2F4O B;  2HZT A;  3TGN A;  3HRT A;  3FMS A;  1HW1 A;  4QTR A;  4KA4 A;  2VBZ A;  3AAF A;  2OA4 A;  1Q1V A;  1OKR A;  4DIQ A;  4N9I A;  3U1K A;  1YJ9 I;  3K1N A;  4FE4 A;  1VQN I;  3ZMV A;  4JX6 A;  1RET A;  4NC8 A;  3OYK A;  1R5G A;  1ETQ A;  3K4B A;  4FIS A;  1XGO A;  4XLN F;  3CCM I;  1T0F C;  3IUO A;  5B1B H;  5L3B A;  3E1S A;  3QOD A;  2MLG A;  1OR7 C;  1NK2 P;  4IOA F;  1H88 C;  2GBY A;  4XLP F;  2R7V A;  3CJR B;  2X1E A;  1Z91 A;  2FJ1 A;  4Y3O A;  4AIH A;  2DQL A;  2HWV A;  4XRF A;  3VFZ A;  4LIT A;  1XG1 A;  1F4K A;  2DK8 A;  3TMO A;  2HXI A;  4PCQ A;  2XF6 A;  3FKJ A;  3M1C A;  2IS2 A;  2RQP A;  1JGS A;  3IH4 A;  5FD5 A;  3C3W A;  3CJN A;  5J8F A;  1GVJ A;  1NG6 A;  3KLN A;  2XAH A;  2XF7 A;  5E1W A;  3ZPL A;  1RC9 A;  1VQK I;  3DBH B;  4G12 A;  1G3S A;  1V4R A;  3V7C A;  4XR6 A;  3DWL E;  3BQZ A;  3PJR A;  1G3T A;  3CZ6 A;  1SAU A;  2MD0 A;  3BG9 A;  4I98 B;  3PQJ A;  1ETY A;  3CO7 C;  5K5Q A;  2ETH A;  2Y48 A;  3JSP A;  2MAB A;  3BR0 A;  1B72 A;  1S8N A;  1KGS A;  1N25 A;  2CUZ A;  3S93 A;  3DPT A;  2ZJQ F;  1FOW A;  3FXU A;  1K6O A;  3GCM A;  3I3L A;  3LSH A;  4BXF A;  2QSH X;  1J5Y A;  4LK0 F;  4XM3 A;  1I5Z A;  4E6K G;  2H1K A;  2IPQ X;  5D8K B;  3IHU A;  1LE8 B;  1V5G A;  3OIQ A;  1J2X A;  2A05 A;  1IW7 F;  1LKX A;  2NYX A;  4XQF A;  3H3V K;  4JQF A;  3I0T A;  5D5U B;  4A3C J;  2KP6 A;  1R5I D;  4KT5 C;  3V8L A;  4IKF A;  2GIZ A;  3KEQ A;  5F04 A;  4XN3 A;  2CYY A;  4ZZD A;  4PUS A;  4MGR A;  2Z99 A;  3F0C A;  3HOV J;  1BI3 A;  1S7E A;  3C2H A;  2R4G A;  4E7K A;  2R7Q A;  5DCM B;  1I1S A;  2OJE D;  2FE3 A;  4IRH A;  3MKY B;  2JA5 J;  3ZXS A;  2XAJ A;  2ZC2 A;  2CUE A;  4OMY A;  3KLO A;  4A3E J;  2EIL H;  1LFU P;  3J7Y J;  1RNL A;  3HM5 A;  3WTU C;  3C7J A;  3PQK A;  2L02 A;  2M45 A;  2KRF A;  3PUB A;  1XN7 A;  4OOI A;  1U0J A;  1I6X A;  5D6E A;  4UUT A;  2XKP A;  3HJE A;  3H0D A;  1O7L A;  2HVR A;  2R92 J;  2WAQ A;  2CW8 A;  3M8E A;  2M9H A;  3S3O A;  1KQ0 A;  4F91 B;  2QEN A;  4BEH B;  4I02 A;  2OCE A;  1Z1D A;  1I1G A;  2DPU A;  3K70 C;  4BAC A;  2LK2 A;  4LK1 F;  3WTT C;  4N9H A;  2CGP A;  3SDG A;  1WJE A;  2VN2 A;  1ZTR A;  5E1X A;  2ECC A;  1Z3Y A;  4XMY A;  5HLH A;  2XAF A;  4WXH A;  3WE3 A;  4P1W A;  2LY1 A;  2YR2 A;  1LPQ A;  1J7K A;  3SXY A;  4D0P A;  3E6M A;  3F8F A;  3LNQ A;  3RKW A;  2TRT A;  2K9M A;  3SEQ A;  4BS9 A;  1X2N A;  3BTI A;  3PNT A;  3AL0 B;  1KQ9 A;  4HQE A;  3FXL A;  3ZQC A;  1W7P D;  1GT0 C;  5JR3 A;  2L0K A;  2EZK A;  5EEH A;  1W36 C;  3BR2 A;  2DA2 A;  1YW8 A;  3O3K A;  1T56 A;  1GV2 A;  4Z6Y A;  2LKP A;  2E36 A;  2XPV A;  3BCA A;  5F1R A;  2M3A A;  1VQO I;  4EV0 A;  2LBF A;  1S72 I;  4QIW N;  3ZQG A;  2VKV A;  1MBJ A;  3CMY A;  4QSH A;  3GVA A;  2P4W A;  1S5L C;  2FUG 2;  4U0W A;  4C2U A;  2MD5 A;  4UVB A;  4DW6 A;  3GTP J;  5LLQ A;  3EDP A;  5JVT A;  3Q9V A;  4DJA A;  4RGS A;  2HOE A;  2V6E A;  3I5U A;  4RGX A;  2BY1 A;  2MC3 A;  1HDD C;  1Z67 A;  1QZY A;  4B48 A;  3W2A A;  4RAF A;  2MLK A;  4CCK A;  3QPH A;  1BA5 A;  1Z77 A;  2OZU A;  2E1C A;  1X1P A;  1ZGW A;  5IOZ A;  3CDH A;  4EAT A;  3K6G A;  3JRI A;  2HOT A;  1S9H A;  2E2H J;  1R22 A;  2K27 A;  2KHM A;  3M3Y J;  1IZ1 A;  5LGT A;  5ERI A;  2FRH A;  2WA0 A;  2QQ8 A;  2JSP A;  4L9J A;  3CC4 I;  1UAA A;  5FLX Z;  5FRN A;  3CCV I;  4E7J A;  2FU4 A;  4U87 A;  3G73 A;  1FOY A;  1U9O A;  2R7U A;  1YW7 A;  3D0S A;  3K70 D;  2IGK A;  2QA4 I;  3CCY A;  3BOQ A;  4ANJ A;  1HKQ A;  2XAG A;  1LJ9 A;  1SFK A;  3BQY A;  3MVP A;  3RPQ A;  4OIN F;  3OR1 C;  4UV8 A;  3BZK A;  3Q3S A;  5E79 C;  4XIC A;  2LDU A;  2NOJ B;  1WH7 A;  3Q5F A;  2JZY A;  3TED A;  2A5Y B;  2CQK A;  5GPA A;  3LFU A;  2PJR A;  4GRI A;  2L7Z A;  4U7D A;  3OYF A;  1ON1 A;  3R61 A;  1C0W A;  1ETW A;  2RVC A;  2R7F A;  5GP9 A;  3ECO A;  1YQA A;  2XSJ C;  2ZSH B;  3H3Z A;  5J1U A;  3UKG A;  2F6C A;  4L0Z B;  3BG6 A;  1NHA A;  2IBD A;  1W36 D;  2GXG A;  1K6Y A;  4TV7 A;  3OR2 C;  4M3B A;  5J3L A;  3R6S A;  4PSX A;  2ZB9 A;  2ZFU A;  4CGZ A;  4Y13 A;  4XLH A;  1OCT C;  3A1Y A;  1L0O C;  3BDD A;  1TW3 A;  4YIR X;  4EJV A;  4IPA A;  1E2X A;  4RGR A;  3A01 B;  5CVJ A;  2TDX A;  1R36 A;  5LRS A;  1VQ8 I;  2VJ5 A;  3PNY A;  2Y0S N;  2ZKZ A;  1ZGA A;  1B6A A;  3CUQ A;  1N77 A;  5BOX A;  4H0E A;  2QKM B;  2HDD A;  1S29 A;  2DMN A;  2VC1 A;  1V54 H;  4E7Z A;  3FZV A;  2ELK A;  5JVG F;  4KFC A;  2VUM J;  2TCT A;  4RB0 A;  3TQN A;  1XS9 A;  3JRD A;  1D1C A;  2HTJ A;  3OL3 A;  1PJR A;  4AWX B;  3OYH A;  2XAU A;  4FQG A;  2BY0 A;  1WGX A;  4QPQ A;  4B44 A;  4E7L A;  3WU1 B;  2I10 A;  2CV1 A;  2O5R A;  4IZZ A;  4ENJ A;  5C4X J;  4Q5S F;  4CSW A;  1IUF A;  2H27 A;  3QOP A;  1R4M B;  2BW3 B;  4GFB A;  1FYL A;  4ENN A;  4JYK A;  3CCL I;  2L01 A;  2YUS A;  4FHT A;  1U2W A;  3VOE A;  4HAM A;  3E0J B;  2W84 A;  2OC6 A;  1A5J A;  4J19 A;  4B1R A;  3J81 Z;  3HGG A;  2M2E A;  3ASO H;  2GIV A;  5AON A;  5EEG A;  2I8D A;  4EMS A;  2V1U A;  3I71 A;  1IN7 A;  2W48 A;  3U21 A;  1XCB A;  4CO8 A;  3MZ8 A;  2DXI A;  1E3O C;  1MNM C;  2QUF A;  1REP C;  2EV5 A;  1VQ4 I;  2L2O A;  3S2D J;  2G0E A;  2FX0 A;  1ZYR F;  4NNJ A;  5E3L A;  3GF2 A;  2ZME B;  3CLO A;  3H1C A;  5IP9 J;  1GXQ A;  1TTY A;  2W82 A;  4L9V A;  5M5Y J;  2R7X A;  2K4B A;  1S7A A;  2E1M C;  1OCR H;  3HUG A;  1K4T A;  3H92 A;  2D5V A;  2JA6 J;  2JN6 A;  6PAX A;  1TC3 C;  2Z16 A;  4FX0 A;  1WVR A;  2MH2 A;  4LG3 A;  4N0B A;  2DOD A;  2PFB A;  3U1D A;  1KU3 A;  1ODD A;  3AG3 H;  4ETS A;  3D1N I;  1VQ5 I;  1Y1V J;  3JR9 A;  5F6F A;  4CUG A;  4IF4 A;  4ZYD A;  3D5L A;  2EV0 A;  2JVG A;  3ML6 A;  1JUS A;  2UUZ A;  1ACI A;  2DBB A;  1SAN A;  1OLT A;  2KL4 A;  2ZJP F;  1G2H A;  4I09 A;  1X2M A;  2ZJ2 A;  3EUH A;  3CDL A;  4A5M A;  2KIU A;  4S05 A;  5BPI A;  1ITY A;  2WY8 Q;  1BOA A;  2FMY A;  5DUI A;  1GDT A;  2KT0 A;  5EG0 A;  2OPT A;  3MQ0 A;  3CCQ I;  2XKO A;  1H0M A;  2DFF A;  2STW A;  1ZLK A;  4LLL A;  3OOP A;  1UST A;  2F5C A;  2MBF A;  5JHF A;  2JVH A;  2KZV A;  2P5V A;  1O7F A;  2LKS A;  3NWS A;  3P9K A;  1WJB A;  3T1B A;  4NHJ A;  1FSH A;  5B1A H;  2IJL A;  3ZQL A;  5D4R A;  1LDJ A;  3FIW A;  2HFH A;  4WXD A;  1JUP A;  4XRS A;  5EDN A;  4A3D J;  2M30 A;  2RNJ A;  3GTQ J;  2NRA C;  1R6R A;  5HLI A;  3DEU A;  1YIO A;  3RKX A;  1UZC A;  1AHD P;  1I39 A;  2CQ7 A;  5D5V B;  2DA6 A;  4I6Z A;  3A0B C;  3ZRG A;  3CUQ C;  1V5F A;  4UY8 I;  2XB5 A;  1FWZ A;  4CZZ A;  2ME6 A;  2Y9Y A;  2Y75 A;  2O6G E;  2GQQ A;  2K5C A;  1WJ5 A;  3NRV A;  1FIA A;  4O5V A;  1YX5 A;  2HGC A;  1BC7 C;  2Y31 A;  3K2A A;  2FBH A;  3BR5 A;  2E2I J;  4C9Y A;  1BJZ A;  2YS9 A;  5IT9 Z;  4LG0 A;  1RKT A;  2ZXI A;  1BIA A;  1JUM A;  1SFX A;  2VQC A;  3EYY A;  3GME A;  1O3S A;  2EFQ A;  5DDG A;  4WWC A;  1MMN A;  3N05 A;  2K9N A;  1PP7 U;  2X6X A;  5E3M A;  1FSE A;  3MKZ A;  4PJL A;  3PSI A;  3W6J B;  3S8P A;  3BRO A;  5LHG A;  3S32 A;  2PEX A;  1JTY A;  2E1N A;  3EUA A;  3QP6 A;  2VJJ A;  5DEQ A;  4DOZ A;  3ABT A;  4Q4Z F;  2ACJ A;  3ZCO A;  4FT8 A;  2EV6 A;  4I7H A;  4A6E A;  1I6H J;  1KYZ A;  2DFI A;  3DU5 A;  1X1C A;  2V9K A;  3F8B A;  2RN7 A;  4BDZ A;  3P9C A;  1WH5 A;  1KU7 A;  4A3G J;  2VL8 A;  3KP6 A;  1A31 A;  1YJW I;  4H4K C;  2I5U A;  3IH3 A;  4EJO A;  3EQL F;  4IVN A;  1QNT A;  5LHH A;  4A2U A;  4LLN A;  2O61 A;  2VKE A;  4ZYE A;  2PMZ A;  2E60 A;  2FML A;  4BE2 A;  1KU2 A;  4KMU X;  4M6Y A;  1I3Q J;  2FF4 A;  2AQF A;  3IAS 2;  5D5X B;  4NQW B;  5GTH C;  1ZHF A;  4LFU A;  5HDG A;  5HS8 A;  1AKH B;  2QLZ A;  5IYC J;  1F5T A;  1JKQ C;  2HKO A;  1SVO A;  2QYO A;  3WTW C;  3UNG C;  3FHN A;  2D1H A;  5E3O A;  2KZG A;  1IV6 A;  3GO5 A;  5DTD A;  1XDS A;  2WY7 Q;  1T2K A;  4ZDP A;  1IC8 A;  4ZDO A;  3C18 A;  2HQR A;  3IH2 A;  3WG7 H;  4RB3 C;  2Q8K A;  5IT3 A;  1YX3 A;  4HOB A;  4XOT A;  2DI3 A;  3EUH C;  1HSJ A;  2ELJ A;  2R93 J;  1IRF A;  1S6L A;  3A0H C;  3HPH A;  5LGU A;  1R49 A;  3OIO A;  4F3Q A;  1S7O A;  3KZI C;  1D0Y A;  4XLF A;  1YRN A;  3ZMD A;  2XRO A;  2DYS H;  2EA4 A;  1STZ A;  1ZN2 A;  3HRS A;  4RAZ A;  2HEO A;  5E3N A;  4CDG A;  2DOA A;  1YJN I;  3ESW B;  4LLG F;  5K7Z A;  1R9T J;  1OR7 A;  1XGM A;  3HG9 A;  3KZY A;  3WE2 A;  2K9S A;  1ZAR A;  1EF4 A;  2KDZ A;  1U5T B;  4YRV A;  1VQP I;  1HKS A;  2W7N A;  4HYE A;  3ZR8 X;  1YI2 I;  4OIR F;  1HW2 A;  3OYB A;  4HEA 2;  3L2Q A;  2R5Z A;  2W00 A;  1SC7 A;  1NH3 A;  2JA7 J;  3KZZ A;  3AG4 H;  1QHH D;  4A3M J;  5J4V A;  3MCZ A;  4G8X A;  2IRF G;  3ABM H;  1DGW Y;  3RKY A;  3VOD A;  2CV2 A;  3FM5 A;  2M87 A;  1R1V A;  2P5L C;  2Q1Z B;  2IT0 A;  1GUU A;  3BG5 A;  3NAR A;  5C44 J;  2XUB A;  1FJL A;  3Q0W A;  3ZMT A;  2RDP A;  2OUM A;  2DA5 A;  1ZQ3 P;  2DAO A;  2VJ4 A;  2FBK A;  2ZNZ A;  2LTP A;  2R5Y B;  2IXS A;  2V79 A;  2CMP A;  4M3F A;  2LC2 A;  4CXF A;  5GAE J;  3T8T A;  1DU6 A;  1QZE A;  2JPC A;  1HXD A;  1SAX A;  4WXC A;  3BJA A;  4XLE A;  2KPM A;  5KCM A;  4V2F A;  4BQO A;  2VBX A;  3LSI A;  4U0Y A;  3E7L A;  3I64 A;  3RZO J;  3N4M A;  5B5E C;  2HDC A;  1J75 A;  3GFM A;  4FTH A;  3HOW J;  3J7A O;  3BT9 A;  4BU2 A;  2K4J A;  2CO5 A;  1Y8R B;  4P9U A;  5JHU A;  2X6O A;  3S1R J;  2E35 A;  4C3I J;  1G6N A;  3BTJ A;  4QWQ A;  3TO9 A;  2M4K A;  5H2F C;  4CYD A;  3KEO A;  2IGO A;  2VKD A;  3MFK A;  4KN4 X;  2VQL A;  4D5C A;  4C3H J;  2VKH A;  4EVI A;  2BE5 F;  1MJB A;  2LBF B;  2YX4 A;  9ANT A;  2W85 A;  2IA1 A;  5ICC A;  4RAG A;  1FC3 A;  3ERE D;  3QU6 A;  4YIF A;  2HDW A;  2BZT A;  2CQN A;  2AS5 F;  4V19 K;  2EBI A;  1AU7 A;  3N97 A;  4EGY A;  2KJC A;  3BPV A;  3SZP A;  3JRH A;  5B3S H;  3GXO A;  5LBQ A;  3HOX J;  2V9P A;  3GLX A;  2IS4 A;  1MMG A;  4AVP A;  1BBY A;  3JSO A;  4XNF A;  2P81 A;  1O3R A;  5J47 A;  2W1O A;  3HBL A;  2AQE A;  2V1N A;  3IRQ A;  2N8G A;  4M74 A;  2E7X A;  1FY7 A;  2LF8 A;  1P7I A;  2ME0 A;  1TQI A;  5L3F A;  3B73 A;  1ZEL A;  4KIC A;  4HLX A;  2DU9 A;  3WTZ A;  4M9S A;  5IYD J;  3LSM A;  3QRF F;  2WTE A;  4FAS D;  2A07 F;  2XVC A;  4A3L J;  1ONV A;  4CCM A;  2Z33 A;  4ON0 A;  2VIX A;  1MKM A;  1WJD A;  5CJ9 A;  2CW0 F;  3E97 A;  2LR8 A;  1BI1 A;  4A3F J;  4RM3 A;  5HOO A;  2WV0 A;  3HIF A;  4U88 A;  3L2C A;  2FQ4 A;  5DM6 F;  2A61 A;  3HSF A;  2B63 J;  2XHK A;  2XGC A;  1HA8 A;  1W5C C;  2JPB A;  3DTI A;  3DTE A;  2B0L A;  3GFJ A;  4B43 A;  1ON2 A;  1X1D A;  4WCG A;  1TW2 A;  5M3M J;  1ZH5 A;  3ZOB A;  4AID A;  3SHF A;  2XIG A;  1DP7 P;  3FKI J;  4I99 C;  1UHS A;  4PK4 A;  4EM0 B;  3FXO A;  2ESH A;  2EFW A;  5M3F J;  5LFA A;  2PMH A;  3GW2 A;  1YG2 A;  1B4A A;  4EJT A;  5E8G A;  4HF1 A;  1WZ2 A;  3VYU B;  4I76 A;  4AIK A;  3LA3 A;  2BXY A;  3BWG A;  5IPA A;  3SQN A;  3E6B A;  4RB2 C;  3QOE A;  3H0G J;  1IF1 A;  1MSF C;  1U78 A;  1XPX A;  3DKY A;  1VTN C;  4KIB A;  2DDA A;  4G7O F;  4Y17 A;  4RMN A;  2HOA A;  1KQ8 A;  1UB9 A;  4B3A A;  4XRM A;  5LGN A;  1RIO H;  4ZTJ A;  1R7J A;  3BJO A;  4JOM A;  1I3A A;  2BEO A;  1GLN A;  3DLA A;  1HKT A;  2VE8 A;  1MDM B;  1Z6T A;  3OIP A;  1ORK A;  4HX7 A;  3OYL A;  1G8X A;  2D45 A;  1IRZ A;  4EGZ A;  2CU7 A;  2QM3 A;  3PFI A;  1HCR A;  2DA1 A;  2XF5 A;  1OQY A;  3JCU C;  3KET A;  3S3M A;  2XGE A;  3OY9 A;  1B9M A;  2JRM A;  4ESF A;  2IP2 A;  2O9L A;  1Z9C A;  1IXR C;  2K86 A;  4LD5 A;  1P6R A;  1JKR C;  3K0L A;  2X9D A;  1K78 A;  3G1O A;  3SZT A;  3RYP A;  1HC8 A;  4AD9 A;  1BR2 A;  3ZN0 A;  1VQ7 I;  3HOZ J;  2V26 A;  1T39 A;  2NVQ J;  3S1Q J;  2VOO A;  1QA6 A;  4BQN A;  1R00 A;  3F8N A;  2VE9 A;  4HNU A;  1KA8 A;  5ICF A;  5D6F A;  4DZJ A;  2V4J C;  3DXJ F;  4BY7 J;  4U7B A;  1OPC A;  2K40 A;  1HF0 A;  2L54 A;  5BS6 A;  1SD7 A;  1V55 H;  5DCF A;  3W2W A;  1CF7 B;  1WSU A;  4KN7 X;  1WQ2 A;  2GOX B;  2EWN A;  2HI3 A;  2DOF A;  5CQE A;  4XBF A;  3C1D A;  4M6X A;  4S04 A;  2MFZ A;  2VC0 A;  3HKZ N;  4XKB A;  3OSG A;  3V7S A;  3KYL A;  1YIT I;  5EGO A;  1LVA A;  3MZY A;  3I4P A;  1RRJ A;  1LDK B;  1BN5 A;  4U0V A;  5CQG A;  2L5Q A;  4Y7N J;  2FBI A;  4DZP A;  5HNH A;  4OIQ F;  1FP1 D;  3K4M A;  2EJR A;  3DBL B;  4CYC A;  2MC4 A;  2V7F A;  1QBJ A;  3DF8 A;  3DV8 A;  4Q47 A;  2Y30 A;  3HHH A;  5DS9 A;  3H9Q A;  5FLX K;  4A0X A;  3FK6 A;  3G71 I;  1IRG A;  3K69 A;  1JT0 A;  2JUC A;  3WOD F;  1PYV A;  5M5X J;  5K1Y A;  1XMK A;  1SMY F;  4RLQ A;  2JA2 A;  3OOU A;  3CF2 A;  4XON A;  3R4K A;  4IOC F;  5HDN A;  1OCO H;  4HF0 A;  2LOO A;  5HOD A;  2CS3 A;  1SVL A;  4N4O B;  4XLA A;  5E20 A;  2Z3Y A;  3HRU A;  1JI8 A;  2VT3 A;  2DMT A;  3UR3 C;  1D0Z A;  2QEX I;  3CCJ I;  2L7M P;  1VQL I;  5J4Y A;  5JFR A;  1H8A C;  1K4S A;  4UVC A;  3QWL A;  5A2Q Z;  3ZGK A;  2CG4 A;  3QYE A;  2EQR A;  4IHX A;  3E6C C;  4EQQ A;  3I55 I;  2LYC A;  4KIS A;  2Y0S A;  1DGR M;  1Z6R A;  5GTI C;  2L4A A;  3JRA A;  1T33 A;  3Q9S A;  4BXU A;  1U3E M;  4G7H F;  3I59 B;  3I4M J;  1Z7U A;  4R1H A;  4AC0 A;  4MHG A;  3F6O A;  4YFK F;  1X1B A;  1IUY A;  3TL4 X;  5FKN A;  2W24 A;  5F0C A;  2ZXW H;  4B47 A;  2M7B A;  4M73 A;  4B8X A;  2XSD C;  3HHG A;  4YG2 F;  3K4N A;  3OL4 A;  1Z05 A;  2ZFW A;  2ISZ A;  2V1D A;  2P7V B;  5FRM A;  4FET A;  4WX9 A;  1ETK A;  2JSC A;  1YHQ I;  2HXO A;  5LHI A;  1MBF A;  2ELH A;  1G3Y A;  2NVX J;  2O0Y A;  1Z21 A;  1SD4 A;  4Z2Y A;  3H9J A;  1TQP A;  2WAD A;  2EIM H;  3KP4 A;  1AWC A;  3ROU A;  4HG2 A;  1DDN A;  2HOS A;  3AG2 H;  3DPL C;  4P9F A;  3C2G A;  2EIN H;  4IXA A;  3FMR A;  4OAY A;  3NEU A;  5IP6 A;  3PO3 J;  1IN8 A;  1PVE A;  4MEY F;  4QPO A;  3LA7 A;  1DU0 A;  2Y0M A;  1MMD A;  2IEK A;  5JLX A;  1MND A;  3K4L A;  3LWF A;  3OMY A;  4HQM A;  4B3X A;  3J81 K;  1PUF A;  1OJL A;  4P55 A;  4Y15 A;  1Y0U A;  1MBE A;  1MGT A;  2L9N A;  4EJU A;  1OCP A;  2NS8 A;  4YFN F;  3F9K A;  4I2O A;  1MD0 A;  4KMF A;  3OYC A;  2Y69 H;  4KIG A;  3DP7 A;  4I0B A;  3TDU C;  2MSY A;  2VB6 A;  4AU7 A;  5CKT A;  4C3J J;  2K3P A;  1Y8Q B;  1UCR A;  1B8I B;  4DNC A;  4F93 B;  2HR3 A;  4IHW A;  2NNY A;  3KP2 A;  3EYI A;  3HOT A;  1VND A;  3BR1 A;  1D3Y A;  3LSP A;  3H9G A;  4BAY A;  2EFO A;  3GTG J;  2P5K A;  5L3D A;  1FBS A;  1TP4 A;  2HKX A;  3OYD A;  3E6D A;  3F3X A;  1LE8 A;  1YO5 C;  2QBY B;  1FMW A;  1HDP A;  1KON A;  1YRN B;  1E3H A;  2VOD A;  5TJJ A;  3KYC B;  1G3W A;  2KIM A;  1NG7 A;  3TOB A;  3E5U A;  2OQG A;  1O4X A;  3GTK J;  4M9Z A;  1ZR4 A;  3ISP A;  4PJM A;  4M9X A;  2FSW A;  1J09 A;  3F8C A;  2RKH A;  5FFX A;  2Y2Z A;  1WRJ A;  3FF5 A;  4KT6 A;  3TDZ C;  1JTX A;  1QZZ A;  3KEY A;  2Q2E B;  3G1M A;  2R7S A;  2NVT J;  3SZG A;  1K83 J;  2ZXJ A;  2WB1 N;  2QGU A;  4II2 A;  1WKM A;  3K1P A;  3ZQ7 A;  4BHP A;  2ZJR F;  1VI0 A;  4GDF A;  3IL2 A;  1IDY A;  1T38 A;  1ETV A;  1ULY A;  2CJJ A;  2DMQ A;  2LY2 A;  4BQA A;  3DEW A;  1WI9 A;  2NNN A;  1IXS B;  4NC7 A;  1XSD A;  2LLK A;  4L5J A;  4RGU A;  2VPR A;  2YSR A;  2Z9O A;  1JJ8 C;  3HOS A;  4RBO A;  2Z1D A;  3RPU D;  2WC2 A;  1R1T A;  3PM1 A;  5CVI A;  4IRI A;  2P0W A;  4NB5 A;  2BHZ A;  4BEH A;  1I27 A;  4G6D A;  4Q48 A;  4BHC A;  3M8F A;  1ZG5 A;  2E2J J;  5IT9 K;  1MJ9 A;  4UVA A;  1W7P B;  5JI6 A;  2OBP A;  4GYG A;  2H6B A;  2X6Y A;  3LL7 A;  3PUF A;  3TO6 A;  3LAJ A;  1SEU A;  4L18 B;  4MQV A;  2A3S A;  2C6Y A;  4AYB A;  3H5N A;  3M7G A;  3PL8 A;  5KAF C;  4G9Y A;  1D8K A;  1TZL A;  1XCV A;  4UV9 A;  4UUS B;  3L2V A;  4W97 A;  5ICG A;  1IN4 A;  1MIJ A;  3H35 A;  1UMQ A;  2F5E A;  4BH9 A;  3NWT A;  2K9L A;  1ZG3 A;  4L0Y B;  5FKL A;  2W25 A;  3HPG A;  4CH7 A;  3MWM A;  2B7E A;  1GHC A;  1JXS A;  1F1Z A;  3SFZ A;  2VLA A;  2IS6 A;  1HQC A;  3ZP5 A;  2RC4 A;  1VZ0 A;  2G7U A;  4ZDL A;  2M5W A;  2HPI A;  2UXX A;  4A5N A;  4LJZ F;  5F1J A;  4LB6 B;  4HW0 A;  1P4W A;  3W6V A;  1KYW A;  3NAU A;  5TIS C;  3F8M A;  2X48 A;  1PP8 F;  3WTX C;  1BM9 A;  5FRO A;  2ECB A;  1U8R A;  3GEZ A;  3S14 J;  4UHT A;  3OS0 A;  1F9N A;  2MGQ A;  2X1D A;  5EJC A;  4ITV A;  2OU2 A;  5K5O A;  5L3E A;  2NS7 A;  1L3L A;  1FYK A;  3S1N J;  4R79 A;  2NOG A;  3HTU A;  5F64 A;  1XDU A;  4D1Q A;  2BVL A;  2QQB A;  4EEF G;  4XRS G;  3FIS A;  3IWF A;  3JTH A;  3CC7 I;  1SVM A; 
#chains in the Genus database with same CATH homology
 4AVZ A;  2M4K A;  3OYE A;  2IGO A;  2VKD A;  3RTR A;  2VQL A;  3VYR B;  1X19 A;  3A2K A;  2VKH A;  3PUB A;  2LBF B;  4X0G A;  1U0J A;  2X1C A;  3VSK A;  3H0D A;  2HVR A;  2WAQ A;  2CW8 A;  2HDW A;  2L9S A;  3S3O A;  1ERD A;  4F91 B;  4KJZ A;  4BEH B;  1V5E A;  2R7O A;  4BE1 A;  3J7A Y;  3K70 C;  1BR1 A;  4BAC A;  3K10 A;  5KNL A;  2VPL A;  1WJE A;  4LIU A;  1Z3Y A;  4XMY A;  5HVQ C;  1TT0 A;  2IS4 A;  1MMG A;  4N4N B;  4P1W A;  2LY1 A;  4XNF A;  4BQQ A;  3L2W A;  2W1O A;  4OWR B;  3ZQQ A;  3IP4 B;  3FDY A;  2AQE A;  3HXL A;  2V1N A;  4RM2 A;  4BJ6 C;  3SEQ A;  2K9M A;  4BS9 A;  3AL0 B;  3PNT A;  4XLC A;  2LRD A;  1ZEL A;  2DT6 A;  3LSM A;  1W36 C;  4FAS D;  2IGM A;  3L2R A;  4CCM A;  4II3 A;  2HU9 A;  2VIX A;  1WJD A;  3BCA A;  2M3A A;  3L2U A;  2LBF A;  4E4H A;  4RM3 A;  5HOO A;  5LD2 C;  2FUG 2;  3AL0 C;  2OV7 A;  4DGW B;  4C2U A;  1UG0 A;  1HA8 A;  3DTI A;  3DTE A;  4B43 A;  1X1D A;  3AFH A;  1LVK A;  1IRX A;  3OS1 A;  2HPM A;  2DT7 B;  3LMM A;  4DJA A;  2BOL A;  2F4I A;  2A5W A;  2V6E A;  2VQH A;  2KRH A;  1T95 A;  1MW7 A;  4PK4 A;  4B48 A;  1MMA A;  3I9V 2;  3CP8 A;  5LFA A;  2GOM A;  3W2A A;  3VYU B;  3OYN A;  4CCK A;  4PJN A;  3QOE A;  1BR4 A;  4EAT A;  3DKY A;  3V42 A;  3K6G A;  2WBM A;  1S9H A;  4RMN A;  2KHM A;  2BW3 A;  2WA0 A;  2JSP A;  1X1A A;  1YE9 A;  3DQV C;  4BDY A;  4ZTJ A;  1UAA A;  3LSK A;  4Y4R A;  4JOM A;  1D1B A;  1GLN A;  3DLA A;  5FRN A;  4BUP A;  3OIP A;  3W2V A;  4E7J A;  1N75 A;  2A6T A;  3OYL A;  1G8X A;  4NUB A;  4U87 A;  3OYJ A;  4ZJZ A;  2RRE A;  2R7U A;  2LH9 A;  1WJC A;  2XF5 A;  3K70 D;  2IGK A;  2QKL B;  3S3M A;  3SYT A;  4E7S A;  3OY9 A;  3BLY A;  4ANJ A;  2F5V A;  3EUK L;  2WAF A;  1SFK A;  2VQG A;  3OR1 C;  1BR2 A;  4CCJ A;  2KRC A;  3OYM A;  2NOJ B;  2V26 A;  3LFU A;  4BQN A;  2PJR A;  3K4K A;  5HNF A;  4HNU A;  1MNE A;  4GRI A;  3OYF A;  4HRI A;  2V4J C;  1QU3 A;  2XSJ C;  2ZSH B;  3G2B A;  4U7B A;  2F6C A;  4G6T B;  4CA0 A;  3SEZ A;  3BG6 A;  3W2W A;  1W36 D;  1BOB A;  1K6Y A;  2VAS A;  2GOX B;  2X6W A;  3OR2 C;  3IAM 2;  1UEL B;  2M7A A;  5CQE A;  4PSX A;  2HQA A;  4MLO A;  2ZFU A;  4KIT B;  4J00 A;  2MFZ A;  4XLH A;  4XKB A;  3A1Y A;  4PJJ A;  3W3C A;  3KYL A;  4BJ5 C;  3MD2 A;  1LFP A;  2VJ5 A;  3PNY A;  1LDK B;  1N77 A;  2QKM B;  5CQG A;  2L5Q A;  3HL2 A;  4E7Z A;  5HNH A;  3A4C A;  2R7R A;  3K4M A;  1D1C A;  3OL3 A;  1PJR A;  3CES A;  2HZD A;  2MC4 A;  2V7F A;  3OYH A;  2XAU A;  2ZSI B;  4QPQ A;  4C30 A;  4B44 A;  4E7L A;  2CV1 A;  2O5R A;  4IZZ A;  2CFO A;  3H9Q A;  3VYS B;  4CSW A;  2M0M A;  4P5O A;  1PYV A;  4RLQ A;  2JA2 A;  2BW3 B;  3M8J A;  3OOU A;  3CF2 A;  4XON A;  1Z7L A;  2LRE A;  2KDO A;  2UV1 A;  4XKV A;  3S3N A;  2XDV A;  2LOO A;  4D9J A;  3E0J B;  2X85 A;  2E1M B;  2OC6 A;  3PNV A;  2CS3 A;  2IS1 A;  4N4O B;  4XLA A;  2MYS A;  1JI8 A;  2RQQ A;  3UR3 C;  1D0Z A;  2I8D A;  3HKZ A;  2DJI A;  1X4O A;  3U21 A;  3BC8 A;  3MMY B;  2ZXH A;  2DXI A;  3ZGK A;  3QYE A;  2VJI A;  2L2O A;  3SDB A;  4NNJ A;  1N78 A;  2LYC A;  4XOR A;  3OYI A;  2Y0S A;  2HVS A;  4KIS A;  1DGR M;  2W82 A;  2CUJ A;  2R7X A;  2E1M C;  4PFO A;  3H5R A;  3KX2 A;  3CJQ B;  2PJR B;  4DBQ A;  2Z16 A;  4F52 A;  3VWB A;  3FBI B;  4LG3 A;  3K4J A;  5CPR B;  2L7K A;  1X1B A;  4CUG A;  1Y6I A;  4J01 A;  3CP2 A;  3TL4 X;  3D5L A;  2JVG A;  4B47 A;  2M7B A;  2UUZ A;  1OLT A;  3DTK A;  4Y33 A;  4ZC3 A;  2KL4 A;  3K4N A;  3OL4 A;  2CW7 A;  4BE0 A;  2WY8 Q;  3PSF A;  5FRM A;  4FET A;  1FMV A;  4IQJ A;  1P9Q C;  2JUG A;  3HC7 A;  3EPZ A;  1D1A A;  4XOP A;  1Z21 A;  5JHF A;  5KHD A;  2JVH A;  2KZV A;  3NWS A;  1WJB A;  4XN0 A;  3H9J A;  2WAD A;  4HST A;  2W4S A;  1WJF A;  3QYF A;  3OYA A;  4IX7 A;  4HG2 A;  2R7W A;  3DEE A;  3DU6 A;  3DPL C;  1X4P A;  4ZTF A;  3C2G A;  3D5S C;  4OAY A;  1R6R A;  2KLO A;  4YEL A;  4QPO A;  1EA3 A;  3DKX A;  1MMD A;  3ZRG A;  3H5A A;  1MND A;  1V5F A;  3K4L A;  3OMY A;  4IQ4 A;  3K4C A;  4DBR A;  4B3X A;  4XL9 A;  2K5C A;  1WJ5 A;  3OYG A;  4HSR A;  1YX5 A;  1D0X A;  2L9N A;  3BCB A;  3VDX A;  2KMU A;  3F9K A;  4C9Y A;  3OYC A;  4ZYA A;  2ZXI A;  4CZC A;  3OS2 A;  2LG4 A;  2VB6 A;  3TBI A;  2VQC A;  4AU7 A;  5CKT A;  2K3P A;  4BL0 B;  1MMN A;  3N05 A;  4F93 B;  2X6X A;  3MKZ A;  5TGT A;  2WAE A;  4PJL A;  3PSI A;  3S8P A;  3HOT A;  3S32 A;  3EUA A;  3H9G A;  2VJJ A;  4DOZ A;  3BG7 A;  4F55 A;  5HLT A;  1WFX A;  3ZCO A;  3DU5 A;  3HUG B;  3ONQ A;  1DP3 A;  1X1C A;  2V9K A;  1Z3X A;  3OYD A;  4BDZ A;  1FMW A;  2HVQ A;  1KON A;  4BGD A;  2VL8 A;  4E7I A;  2CV0 A;  4H4K C;  2VXD A;  2VXZ A;  4PSW A;  1NG7 A;  4E7H A;  4HNT A;  4PFP A;  2E5Z A;  3QYB A;  4PJM A;  2PMZ A;  2IGN A;  2E60 A;  4RLF A;  4BE2 A;  1J09 A;  4DIQ A;  2AQF A;  3IAS 2;  4C2T A;  4KT6 A;  3RQ4 A;  4NQW B;  3RCO A;  3RSN A;  3KEY A;  2Q2E B;  4NC8 A;  3OYK A;  1E0E A;  2R7S A;  3UNG C;  3FHN A;  3K4B A;  3PFY A;  2UWM A;  3SZG A;  4II2 A;  1T0F C;  3IUO A;  3LSG A;  3E1S A;  2WY7 Q;  3QOD A;  1OR7 C;  3CMM A;  4ZDP A;  4ZDO A;  2E5N A;  1YX3 A;  2R7V A;  3CJR B;  4XOT A;  2LY2 A;  2X1E A;  3EUH C;  4Y3O A;  4NC7 A;  2ELJ A;  4F92 B;  2M4G A;  3HPH A;  2CH0 A;  4LIT A;  3HOS A;  2X51 A;  2Z1D A;  3OWT A;  4F3Q A;  3RPU D;  3TMO A;  2P0W A;  1D0Y A;  2XF6 A;  3FKJ A;  3M1C A;  4YEJ A;  2IS2 A;  4XLF A;  3VSL A;  4BEH A;  2XC7 A;  1NG6 A;  2DOA A;  2X6Y A;  2XF7 A;  3LL7 A;  3MKW B;  3HG9 A;  2DCE A;  4AYB A;  3H5N A;  4XR6 A;  3DWL E;  3PL8 A;  3PJR A;  4YRV A;  2W7N A;  3ZR8 X;  3CZ6 A;  1SAU A;  2MD0 A;  3OYB A;  4HEA 2;  1TZL A;  3L2Q A;  3L2V A;  2W00 A;  2MAB A;  3AKZ A;  1DQU A;  3H35 A;  1QHH D;  2CUZ A;  3S93 A;  2RNG A;  3DPT A;  3NWT A;  1DGW Y;  2K9L A;  2Z2S B;  4HPQ A;  4OAZ A;  3I3L A;  2CV2 A;  3GBG A;  3HPG A;  3LSH A;  4CH7 A;  4XKC A;  4BXF A;  3VYT B;  2WB1 A;  2Q1Z B;  2HNH A;  4XM3 A;  2VLA A;  1QHG A;  4E6K G;  2IS6 A;  1VZ0 A;  3D5R C;  4ZDL A;  2HPI A;  2OUM A;  1V5G A;  4CCL A;  3OIQ A;  4LIV A;  2VJ4 A;  1LKX A;  2IXS A;  4XQF A;  4JQF A;  2CMP A;  2KQR A;  2LC2 A;  3DPU A;  2KP6 A;  4BJT A;  1G59 A;  4IKF A;  2R7T A;  5FRO A;  4XLE A;  4CCN A;  2KPM A;  5KCM A;  1WJA A;  4XKW A;  4XN3 A;  4BQO A;  3FBN B;  3LSI A;  4CCO A;  3OS0 A;  4PUS A;  2BVM A;  2X1D A;  4ITV A;  3C2H A;  2R4G A;  4BU2 A;  4E7K A;  2R7Q A;  4R79 A;  4D1Q A;  3MKY B;  3ZXS A;  2BVL A;  1AA7 A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...