3VB2A

Crystal structure of the reduced form of marr from e.coli
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Multiple antibiotic resistance protein marR
publication title The reduced form of MarR structure
rcsb
source organism Escherichia coli
total genus 46
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vb2A00
2O03A 1J7KA 2QM3A 2FSWA 2P5VA 1YYVA 3TO6A 3MZHA 2ACJA 3GFJA 3N4MA 1IXRC 4KA4A 1O7FA 3M9AA 3ECHA 1J5YA 4Q47A 3E6BA 2HR3A 2R7DA 2XAHA 5CVRA 2HTJA 5DCMB 2O3FA 3TQNA 2Z9OA 2PFBA 4JQFA 1IRFA 5JFRA 3F23A 3T0YA 1K78A 4O5VA 1FOKA 2Z5UA 3BJAA 1DUXC 5H20A 3ABTA 3IL2A 3QU3A 3IRRA 4ESFA 2E1NA 3T8TA 2D45A 1SD4A 4M73A 1BJAA 5F1RA 4EM2A 2C6YA 4DNCA 3DP7A 3ERED 4MGRA 1QPMA 2OA4A 3SFZA 3GX4X 3E6MA 1BI2A 3IHUA 3ZN0A 1XSDA 3H3UA 1XDUA 2JPBA 1G3TA 3KP2A 4CGZA 3BY6A 1USTA 3KLNA 4UUVA 2XAGA 2VBXA 4NQWA 3KETA 4EJTA 5L3DA 3F21A 2HDCA 1LEAA 4UXNA 3QPTA 3R61A 4HOBA 1REPC 4HYEA 2E7WA 1S3JA 4FHTA 3SXYA 3BDDA 3V8JA 2JRTA 3TOAA 4Q5SF 4I2OA 3KP3A 3F6OA 3ML6A 4G94A 4IRHA 3J81K 3LAJA 2LF7A 4KMFA 5LGTA 3FM5A 3N97A 3EQLF 4AIJA 1RIOH 5JHUA 4QLCU 3HSEA 3FZVA 3P9IA 3HHGA 1QZZA 3FMRA 2O8XA 4B8XA 3KZYA 1LEBA 1I1SA 4L18B 4GO1A 2CWEA 2ZO4A 2LSOA 1A04A 2NNNA 4HZFA 1LVAA 3MFKA 2E1CA 4KYWA 3L00A 4HV5A 4UVAA 2G7HA 4Y17A 3M8FA 2XASA 1FPQA 2P7CB 1IW7F 1BI0A 5FB2A 4XBFA 2RGVA 5E8GA 2IP2A 3I58A 3ZPLA 4EM1A 2EFOA 4UVCA 2XKPA 2CGPA 2OU2A 4LB5A 4G7OF 3ABUA 1FLIA 2ZMEA 2KIUA 2DU9A 1R5GA 2V1XA 2YSRA 3FMSA 4BH9A 3WU1B 1TNSA 2MLKA 5FD5A 2ELHA 2ZNYA 2FQ3A 4BAYA 3V7SA 5F64A 4I0BA 1MZBA 4ZYGA 3GW2A 3PQJA 1J59A 2Y75A 3GVAA 2QBYA 5JI6A 1ZRCA 3GZ6A 4OINF 3RKXA 2CSOA 5HVQC 4BHBA 3DFGA 1IXCA 2GIVA 2IA0A 1MJBA 2FA5A 5J6XA 2M8EA 1B59A 2BBYA 4BHCA 1ON1A 1ZLJA 4EM0B 5HS9A 1HSTA 3MQ0A 4ON0A 4K2EA 4YIFA 1CGPA 1MJAA 2FU4A 1KQ9A 4HX8A 5A2QZ 4P96A 3TGNA 1L0OC 2F5FA 1IN7A 2VN2A 3TO7A 4MHGA 5ICGA 2FBHA 4U88A 1H9TA 2DQLA 2Y48A 2IJLA 4XLNF 4RB0A 1E17A 1HKSA 4N9IA 5HDNA 2O6GE 2VE8A 4ENMA 5J8CA 1P4XA 3WU0A 3E5QA 4GYGA 1G3SA 2FNAA 2KIMA 3RKWA 3SHFA 3KE2A 3F3XA 3WGHA 1UCRA 1LNWA 5CVVA 5FGMA 2RKHA 3P9CA 1OYYA 1T6SA 4OU0A 1ZAOA 1T0FA 1P4AA 1XCBA 4KUMA 4RS8A 1R36A 3E6CC 1T39A 2WV0A 1IAWA 1IF1A 2DK8A 1FSEA 1J75A 2H6BA 1R23A 1KGSA 3GZ5A 4NHJA 1U8RA 1B4AA 5LEJA 4M71A 4MEXF 4XSZF 1OPCA 1BIAA 4WK8F 1WRJA 5ILUA 3WTZA 4KIGA 1XB4A 1IN4A 3HHHA 4HV6A 2LDUA 1D3YA 3VEPA 4U0VA 2RDPA 1U5TB 4KIFA 4N9HA 1OYIA 1FY7A 1ON2A 5JR3A 1KQ8A 3R0JA 4EVIA 2V79A 5DCMA 4XSXF 1KU2A 1SFXA 2QUFA 2FBIA 2PG4A 3I59B 3EYYA 1BBYA 3M8EA 4AIHA 5DV5A 2HKOA 2PQ8A 5IT9K 5HLHA 2VC0A 2Z3YA 4AIKA 2FXAA 2V1UA 1IRGA 4KMUX 1FT9A 1BM9A 3ROUA 1YS7A 4HA8A 5DD4A 4A0XA 1SMTA 1YFHA 1UFMA 1YLFA 1RZ4A 5K1YA 4RB1A 5H6RA 1Q1HA 3BPVA 3RIRA 2XKOA 1FNNA 3L9FA 3FXRA 2XAFA 3PQKA 1TLHB 3HRSA 4FT8A 2OQRA 1X3UA 4OIPF 1ONVA 1EV7A 3H3ZA 2IW5A 1TBXA 3JTGA 2YR2A 3R60A 2P6TA 1XGMA 3MCZA 3P9KA 5CYVA 3GXOA 4L5JA 2A3SA 2HYGD 3FM3A 3J80Z 4KT5C 1SMYF 4MEYF 3O3KA 2GZWA 1B9NA 4RB2C 3K1PA 1ZRFA 2HWVA 3V7RA 2P8TA 5E17F 4PZJA 2IA1A 3WTWC 1ZARA 5D5WB 2PLYA 1ZYRF 1O3TA 1P4WA 4XLPF 2UZKA 2EV5A 3EYIA 4FX0A 3BPXA 2KIFA 4L9TA 3NQOA 3EETA 3SQNA 1ZRDA 4YFNF 3G73A 2L54A 2GA1A 4D0PA 1HBXG 1TNTA 1BIBA 5FO5A 3HSFA 3HYIA 2ESNA 3KP7A 1BI3A 3ZMZA 4G7ZF 2VBYA 1FBUA 3ISPA 4PGHA 5LEKA 2FMLA 1WQ2A 2H6CA 4AWXB 1J9IA 3DF8A 2OZUA 3JTHA 2DFIA 4U7DA 4WX9A 2V1DA 2VOPA 1FSHA 3K69A 1I5ZA 2XIGA 4FX4A 1UB9A 4UHTA 2GAUA 1HXDA 1LQ1A 4UNOA 3DKWA 2EJRA 5LHHA 2W24A 2IA2A 3KP4A 5FLXK 3C3WA 3ZMTA 1XSXA 5HS8A 4G6QA 1ZG5A 1R22A 3U1DA 4OOIA 3L7WA 1KYZA 1XGNA 1PUEE 4RAZA 1L3LA 4ESJA 1Z7UA 5L3BA 1ZG1A 4S05A 5BPDA 5D6FA 2AXLA 1TQIA 1KU7A 4Y13A 2LF8A 4BHPA 4N0BA 3I64A 5HLIA 3KP5A 3LA7A 4O3MA 2MD5A 1R1UA 3C1DA 2L3DA 1Y0UA 2MA3A 1SFEA 4BXUA 2A6HF 2V9VA 1HKTA 3IRQA 4A0ZA 1QBJA 3ZMDA 1DP7P 3PFIA 2GXBA 2CQKA 5ERIA 4BNCA 2F5EA 5EEGA 4MTDA 1O7LA 4M9ZA 4LMYA 1U78A 1STZA 2VOOA 4HLXA 4RAYA 1H9GA 4LK1F 4IJAA 3E97A 2ZBKA 4MQVA 2BE5F 3F8NA 2A5YB 1R00A 4LB6B 4I7HA 5D5UB 3F22A 1MKMA 1O3QA 3LAPA 5LGNA 5DYMA 2XGXA 1R58A 3CUQC 4EQQA 2OAZA 3U2RA 2WWYA 2OZ6A 4I98B 2HEOA 5DDGA 1QNTA 3LQRA 4AVPA 3JAMZ 2Q2EA 3R0AA 3D0SA 1PDNC 1QZYA 2ZKZA 1UHMA 1FYLA 2NRAC 3NEUA 2YX7A 4YG2F 3BP8A 3DQVC 3MAJA 4R1HA 4HQMA 1J2XA 1D8KA 3IWFA 2MH9A 1S29A 4CDGA 4HAMA 2X4HA 3IKTA 3ECOA 3WG9A 3RYPA 1YTYA 5DD8A 5AIQA 2LKPA 4IRIA 2FOKA 2BGCA 1P2FA 3DPTA 3DPLC 1K79A 5ED4A 1SD7A 5TJJA 2A69F 3GFIA 4WXHA 3R4KA 2Q8KA 4EJWA 3R6SA 1U5TA 1E2XA 3RYRA 1B6AA 1W7PB 1FX7A 4OIOF 1FP2A 1LB2A 1K6OA 4G9YA 2L4MA 4HW0A 1ZLKA 5CVIA 4GXOA 2HKXA 2DQRA 3CTAA 2IPQX 5D8LB 3I59A 3F8BA 4IHSA 4UV9A 1LDKB 2DPUA 3ZP5A 1RUNA 1FWZA 1MD0A 4E70A 4EJUA 5FFXA 1W7PD 4CICA 2KJBA 3GF2A 1F5TA 3GEZA 3KEQA 4U7BA 5LHGA 1SD5A 2B0LA 2GQQA 3VB2A 3CJNA 3GUDA 2CO5A 1Z6RA 1HQCA 2W85A 1PP7U 2BYVE 5LLQA 2YX4A 3DV8A 2Z33A 1D5VA 2ISYA 3VOEA 1BOAA 1YS6A 1HSJA 3WTTC 2HTSA 1RUOA 4JK1X 3CLOA 2BEOA 3Q9SA 4S04A 5HLGA 1KA8A 5LGUA 2QQAA 3Q5FA 2KJCA 2DBBA 1R5HA 3F72A 1W4MA 4P55A 5DCFA 1CF7B 2W57A 4M72A 1XGSA 2JTVA 1LDDA 2VT2A 3ZMUA 1IN6A 5L3GA 1G6NA 2EFWA 1ZN2A 2OD5A 2ZFWA 5BS6A 1ZREA 2VXZA 2K4JA 2NS0A 4LLLA 2FBKA 4GCVA 5H6QA 5ILSA 1XGOA 5BOXA 3F6VA 2EFPA 4P5OA 2Q0OA 4WWCA 2HOEA 3ELKA 2IRFG 1MGTA 2E7XA 1ZG3A 1FZPB 1FYKA 3FMQA 1IUYA 4HX7A 3SZTA 2J5OA 1TTYA 3E3VA 3LQQA 5K5QA 2CFXA 2RN7A 1K7AA 3F8FA 5E1WA 3DXJF 4CYDA 2ZJ2A 4L0ZB 4KN4X 1F1ZA 2DW4A 2FRHA 1YQAA 2XHKA 2P5LC 4LLNA 1QO0D 2STTA 4OMZA 4A0YA 3FXQA 2YPRA 1XSVA 2NNYA 2D1HA 4U0YA 3KEOA 1W5TA 2HS5A 4EJVA 4MTEA 5D4SA 3RKYA 4I09A 1U6GA 5AIPA 2FE3A 2X0LA 4OIRF 4Y15A 3AAFA 3B02A 4IXAA 1S7OA 4L5IA 2MLGA 3J81Z 1T38A 3ZMSA 3GFMA 4LLGF 5EEHA 1T2KA 4I02A 3L2CA 2EB7A 3QU6A 2A07F 2K27A 1V4RA 3K9TA 3NRVA 5AONA 2HZTA 2QENA 2P6SA 2EFNA 3GO5A 4HF0A 1SD6A 2EK5A 2K4BA 3S2WA 1AWCA 3QOPA 2F5CA 4L9NA 3WGIA 2YU3A 1FYMA 2O0YA 3BZ6A 5HOOA 1GXPA 4A6EA 1Z1DA 4M74A 1YO5C 2V6CA 3B73A 3RI4A 2R7FA 2PJPA 4HDUA 4HLYA 2XVCA 3QAHA 4EMSA 4R79A 1JHHA 2L01A 3M7GA 4F7ZA 2JSCA 2GWRA 1TQPA 1TW2A 1S8NA 5E1ZB 5A2QK 3Q9VA 3BJOA 1H0MA 1WI9A 4ENKA 1W5SA 4WF2A 2P4WA 1MJ9A 2MC3A 4A5NA 2EA4A 2STWA 1YG2A 4PGGA 5L3FA 3IWZA 1FC3A 1S7AA 4IPAA 4RGXA 1FP1D 3RJPA 2EWNA 2ETHA 2J5PA 4LG0B 3K2ZA 2F5DA 2ADUA 1IN8A 5JVTA 2HQNA 5FFZA 2JT1A 2DK5A 2M45A 1R1TA 4CHUA 5BPIA 2CYYA 3JSOA 3I4PA 3I71A 2A68F 2PN6A 3QP5A 2ZXJA 2NAZA 4IF4A 3RDIA 3K1MA 4ZZDA 4QWQA 1NHAA 4M9SA 3LWFA 4Q48A 5DUIA 1EH7A 1SAXA 3CUQB 1W7PA 2W25A 4ENJA 3KZZA 2FNPA 3U9GA 3LA3A 4JBAA 3W6KB 5D4RA 2MH2A 2JPCA 2G9WA 5E8IA 3I53A 1D8JA 3T5XA 2VBZA 1ODDA 1Z6TA 2P7VB 2DI3A 2L02A 4EV0A 3D5LA 1I27A 1KQ0A 1GXQA 3HTUA 4B09A 5K5OA 3F8CA 5D8KB 1XN7A 3BWGA 1O3RA 3GLXA 2IT0A 3KP6A 2CG4A 2HYFA 5HDKA 3HUGA 2QYOA 5ICCA 2Y0MA 4IVNA 5LRRA 1GVJA 1BC8C 2FEZA 5FD6A 1RNLA 4IRGA 5DUKA 4ZYEA 1F4KA 1OKRA 3TKYA 2QQ9A 1FBSA 3MEXA 4G6DA 3WTUC 4R8HA 3V7CA 3FF5A 4CZZA 4ASNA 4OMYA 3HOSA 3E6DA 1EH8A 2A61A 4I01A 5L3CA 4UV8A 2DTRA 4UVBA 2HGCA 2DLLA 4P9UA 5E18F 1MDMB 5CLSA 3RPUA 5IT3A 3JSPA 1IZ1A 2ESHA 5BQTA 2GXGA 2QZ8A 2RC4A 4KN7X 4LFUA 4YFXF 1JE8A 4HF1A 1YIOA 3H92A 1O57A 4LGWA 3I0TA 3VFZA 3REOA 2XAJA 5L3EA 1HW2A 2QVOA 3FWEA 1CF7A 2P5KA 3HRMA 2H09A 3K0LA 4M6YA 1USSA 4ZZLA 3CO7C 3MWMA 3JW4A 3BOQA 4PDKA 2G7UA 2K7LA 4GGGA 3FHZA 2RQPA 2VE9A 3WODF 3COAC 3QPHA 3WTYC 3P7NA 5IT9Z 3J80K 2FF4A 3HRTA 3QP6A 6PAXA 4EGYA 3VODA 3LA2A 5KK1A 3ZN1A 4KNYA 1QQIA 5CVJA 1ZGJA 2F2EA 1HW5A 1RI7A 2VBWA 1DPRA 4A2UA 1K78B 5HDGA 1P6RA 1VTNC 5ILVA 2CW0F 1XMAA 3LSTA 3TDZC 5BMZA 1C0WA 1I1GA 2MBFA 2R3SA 1ZH5A 5LHIA 1Z9CA 4RGUA 5J8FA 1I6XA 4KIBA 1B9MA 5D6EA 4TV7A 4BQAA 4MQ9F 1LJ9A 2TDXA 1OYWA 4O6JA 3IKVA 3T8RA 1U2WA 4ZH4F 1GHCA 2AS5F 2XUBA 2EA2A 3W6JB 1UHWA 3SZPA 1EH6A 2KKOA 2PMHA 2H94A 5ICFA 1IXSB 2NYXA 1V3FA 5KVRA 4WXDA 2PBIA 4RB3C 3I5UA 2XROA 3WTSC 4I0AA 2XV4S 2K86A 4KDPA 4RGSA 4LK0F 2HFHA 1ZHFA 2ZNZA 4LD5A 1P92A 3BJ6A 1PP8F 1JHFA 5K5RA 1XMKA 4ZYDA 4EGZA 1BN5A 4KFCA 2D2WA 1KYWA 2EFQA 2PI0A 1XDSA 4HBLA 1R7JA 1U3EM 4Q4ZF 5TRDA 3V4GA 5D5XB 3K1NA 3ZMVA 3RPQA 2K02A 2UWMA 3EDPA 2PEXA 3CO6C 1YW9A 2COMA 3ZQ7A 3QRFF 2DO7A 4A5MA 1FBQA 3I54A 5LBQA 2WC2A 3HTSB 3HOTA 3C18A 2BV6A 1J0RA 3BROA 1IN5A 1YW7A 2Z99A 3E5XA 1JXSA 3WGGA 1F9NA 1AOYA 1JGSA 3GWZA 3CDHA 1ZGAA 3T1BA 2QWWA 2RNJA 3LFKA 3O2PE 3V8KA 2M30A 3FXUA 3RTRA 4WXCA 5HS7A 5FLXZ 2LNBA 2ZMEB 3WE3A 4IHTA 3EUHA 3G3ZA 4LG0A 4MNUA 2DAOA 2KRFA 2JZYA 3KLOA 4LJZF 2VONA 3JAMK 4XRFA 3GFLA 4ETSA 1DPUA 1R1VA 2GA2A 1S6LA 4HDVA 2VODA 1QGPA 1KU3A 1YW8A 4U0WA 4H0EA 2QQBA 1T98A 3E5UA 2RVCA 4YFKF 3CUOA 1HKQA 2VC1A 2HQRA 2XRNA 2WTEA 3OV8A 2QBYB 5LRSA 1TW3A 1WKMA 4CO8A 3CUQA 4HQEA 4AD9A 3WE2A 4Z2YA 5D5VB 2M87A 4CXFA 3ULQB 1WWXA 3L09A 2UXXA 1DDNA 2EV6A 4A6DA 2W84A 2A6EF 2OQGA 3GYHX 1G4DA 5E1XA 3HIFA 4M9XA 5CVUA 1WSUA 4ENNA 4L9VA 3M1EA 4M6XA 4BYYA 1LDJA 1Z05A 2XAQA 1XCVA 5DEQA 2VT3A 4ESBA 2UXNA 4PCQA 1TQMA 1BC7C 3WTVC 4YIIA 1G3YA 2ZCWA 3FX3A 4A12A 2H27A 3KFWX 2M1BA 1G3WA 4EJOA 2IVMA 4HF2A 2D1VA 2L4AA 2EV0A 2O61A 1Z91A 2PMUA 4KICA 2ISZA 4P9FA 3J7AO 1OR7A 4WCGA 4L9JA 5E20A 2RV8A 5ICEA 1U5TC 3HSRA 3WTXC 4OIQF 3TO9A 3TOBA 3KCCA 3TDUC 2FMYA 2DT5A 1MDMA 4ZYHA 1XD7A 1B1BA 1HW1A 1SFUA 3O6BB 3IC7A 1BI1A 2QLZA 4HX4A 4G8XA 2M5WA 2OBPA 3HRUA 4RGRA 3DEUA 4G7HF 1ULYA 1O3SA 4NB5A 4GYIA 4L0YB 5CJ9A 3V8LA 1KU9A 4DQ2A 3MZYA 3C7JA 2DPDA 5F6FA 1OMIA 3F8MA 3OOPA
chains in the Genus database with same CATH superfamily
2F48A 2O03A 1J7KA 3CLQA 2QM3A 1HDDC 2FSWA 2P5VA 2KRHA 1IG7A 3L2WA 4ZDOA 1YYVA 3TO6A 3MZHA 3IP4B 4ANJA 1TWCJ 4IHVA 2WB1N 2ACJA 3JR9A 3GZNB 3GFJA 1Z77A 4HG2A 3N4MA 1IXRC 4KA4A 2E60A 1VQ9I 1O7FA 1W0UA 3HJEA 3M9AA 3OSFA 3ECHA 1J5YA 3J7ZI 4Q47A 3E6BA 2HR3A 3H36A 2R7DA 2XAHA 2WAQA 2X6YA 3DPUA 5CVRA 2HTJA 5DCMB 2ZC2A 2B63J 1ETWA 2O3FA 3TQNA 2L9VA 2Z9OA 4A3LJ 2PFBA 2AXTC 1MNDA 4JQFA 3FKIJ 1IRFA 5JFRA 3F23A 4V2FA 3SDBA 3T0YA 4D1QA 3B6CA 1K78A 4O5VA 3VWBA 1FOKA 3BZKA 2Z5UA 3BJAA 1EA3A 2EZLA 3GBGA 1DUXC 5H20A 3ABTA 3IL2A 3QU3A 3IRRA 4IKFA 2OV7A 4ESFA 2E1NA 4BDZA 4CCOA 4KISA 1UELB 3T8TA 2D45A 3MKZA 3OMYA 1MIJA 4C2UA 1SD4A 4M73A 2X1DA 2LMDA 1BJAA 1YX5A 5F1RA 1D0ZA 3K70D 1RR7A 2WY8Q 4EM2A 4CZCA 2C6YA 4DNCA 3DP7A 4IX7A 1NTCA 3ERED 3BG6A 2WY7Q 4MGRA 1QPMA 2OA4A 4U87A 2MABA 3J7AY 3SFZA 1BL0A 1T08B 3E6MA 3GX4X 1BI2A 3IHUA 3ZN0A 1XSDA 3H3UA 2O7OA 1MBFA 1XDUA 4A3EJ 2JPBA 4XKCA 1G3TA 1MBEA 3KP2A 2HDWA 4CGZA 3I4MJ 2LFBA 2LVSA 2O5RA 3BY6A 1QRYA 4XIDA 2ZJRF 4JX6A 4XRMA 2L0KA 1USTA 3KLNA 5F27A 3FXJA 1VNDA 4UUVA 2KIQA 2N8GA 2XAGA 2VBXA 1A6IA 2XSJC 2CW7A 4NQWA 4XKBA 3KETA 4EJTA 2R7ZJ 5L3DA 3D5SC 3F21A 1TWAJ 1BR1A 1IJWC 2X6OA 2HDCA 1LEAA 2WADA 4UXNA 3QPTA 1QVUA 3HB9A 1LFBA 2JMWA 3X2QH 3QODA 3R61A 4C2MJ 4HOBA 1REPC 4HYEA 1SFOJ 2E7WA 3OYKA 1S3JA 3H5RA 4FHTA 4PJLA 3SXYA 3BDDA 2BHZA 2JRTA 3TOAA 3V8JA 1WZ2A 1YE9A 3BT9A 4I2OA 4HNUA 4Q5SF 3KP3A 4DZJA 1BR2A 2BHYA 3HOZJ 4DW6A 3F6OA 3ML6A 4G94A 1N75A 4IRHA 3J81K 2RNGA 2HZDA 1Y1WJ 3A0BC 3LAJA 2LF7A 4KMFA 5LGTA 3C2GA 1YRNA 1XX5A 4G12A 4FASD 3FM5A 2NS8A 3GMEA 3N97A 1K83J 3EQLF 4AIJA 4HPQA 1RIOH 3AG1H 5JHUA 4QLCU 4II2A 2DDAA 3HSEA 3FZVA 2X1CA 4B3XA 2Y9YA 3ABLH 3P9IA 4RBOA 3W2AA 4PJ0C 5GPCA 1HA8A 1UG0A 3S3OA 4M3GA 3HHGA 2BW3A 2GM4A 1QZZA 2MSYA 2O8XA 3FMRA 3KZYA 4B8XA 2M2EA 1LEBA 1I1SA 4IHYA 4L18B 4BDYA 2X6XA 4XICA 2JVGA 1LE8A 4GO1A 2CWEA 2ZO4A 2LSOA 1A04A 2CS3A 2NNNA 4HZFA 1LVAA 3MFKA 1IV6A 2E1CA 4KYWA 3S15J 3L00A 2M34A 2M4GA 2XF7A 4HV5A 2E5ZA 1NK2P 4UVAA 1FTZA 3H3VK 2MFZA 1DGWY 1OISA 2G7HA 1UHSA 3OYLA 4M6VA 3HGYA 4D5FA 1ETXA 1I50J 3G1MA 3M8FA 4Y17A 2XASA 1XTAA 3J7YJ 2FJ1A 4OAYA 1FPQA 2P7CB 2RREA 2JRMA 3GTMJ 1QA6A 1IW7F 1BI0A 3CP2A 4BXXJ 5FB2A 4XBFA 4E7LA 2RGVA 5E8GA 4XN0A 2IP2A 1B72B 3I58A 4UUTA 3ZPLA 2DOFA 4EM1A 2EFOA 1H88C 1H8AC 2GOMA 4UVCA 2IGNA 2XKPA 4RMNA 2DFHA 2CGPA 3BCBA 5C4JJ 3HOWJ 2OU2A 4LB5A 1XPXA 1FIPA 4BE2A 4G7OF 1ZKGA 1G2HA 3ABUA 5HODA 1FLIA 2ZMEA 2KIUA 2DU9A 3OIPA 1R5GA 2V1XA 1A5JA 2YSRA 3BQYA 1LPQA 2L7ZA 3FMSA 1QHGA 4BH9A 3WU1B 2DFFA 2ME0A 1FMWA 2NVXJ 1TNSA 1JKOC 1Z67A 1VQLI 2MLKA 2E1MB 1NH3A 5FD5A 2ELHA 3OYDA 1UAAA 4BEHB 1VQ4I 2HXIA 2ZNYA 3MMYB 2VL8A 3CC4I 2W00A 2FQ3A 3K7AJ 3RQ4A 4BAYA 3ESWB 5F04A 3V7SA 5FKLA 4CH7A 5F64A 3P5JA 3CCUI 4I0BA 1MZBA 4ZYGA 3GW2A 3PQJA 4PJNA 1BW6A 1J59A 2Y75A 3QYBA 3GVAA 2QBYA 5JI6A 1ZRCA 3GZ6A 4OINF 2E34A 3RKXA 2CSOA 2EIKH 2QSFX 2LKXA 5HVQC 2DXIA 5JHFA 4FTHA 3CC7I 4MLOA 2HI3A 4BHBA 3DFGA 1IXCA 2GIVA 2IA0A 3H0GJ 2K9MA 1MJBA 2FA5A 5J6XA 2M8EA 1GV2A 1B59A 2BBYA 4BHCA 1ON1A 3FK6A 1ZLJA 2KP6A 4EM0B 2IAIA 5HS9A 2K9SA 1HSTA 2CU7A 4XOTA 3C2BA 3MQ0A 4ON0A 4K2EA 4YIFA 3CMAI 4FE4A 1BJZA 1CGPA 2V7FA 2VQGA 3CF5F 2VQHA 1MJAA 2FU4A 4NC8A 4C3IJ 1KQ9A 4HX8A 5A2QZ 2E5NA 1R6RA 4P96A 3TGNA 1K4TA 1APLC 2XGDA 2L7MP 2XB5A 1L0OC 1V5GA 3FKJA 3Q3SA 3CZ6A 2VKEA 2F5FA 3PNTA 3L2QA 1U0JA 3BC8A 4A3MJ 1IN7A 2DYSH 2DN0A 2VN2A 4W1UA 3TO7A 3M4OJ 4MHGA 2VIXA 5M3MJ 1MBJA 3CCQI 2I8DA 5ICGA 1QHHD 3H1CA 5FLMJ 2FBHA 2X85A 4U88A 1H9TA 3AFHA 2DQLA 2Y48A 2IJLA 5GAHJ 5E3MA 4XLNF 2GBYA 4RB0A 1E17A 4A3GJ 2R5YB 1HKSA 4N9IA 2ELKA 4PK4A 5HDNA 2W48A 2O6GE 2E2IJ 4IOAF 2VE8A 4ENMA 3K4BA 1D5YA 5J8CA 1P4XA 3WU0A 2I10A 1HLVA 3E5QA 2V4JC 4BBRJ 1R4MB 4GYGA 3UNGC 1G3SA 2FNAA 2KIMA 2Q2EB 3RKWA 5DS9A 3SHFA 3KE2A 2F4OB 2I5UA 4UB6C 3F3XA 3WGHA 1UCRA 1LNWA 3ZR8X 5CVVA 5FGMA 5GADJ 2RKHA 3P9CA 2R5ZA 1OYYA 3A4CA 1T6SA 4OU0A 1SVMA 1ZAOA 1T0FA 3I4NJ 1RPWA 1AHDP 1P4AA 1XCBA 5DM7F 4CYCB 3H0DA 4KUMA 4RS8A 2LBFA 1R36A 3E6CC 1T39A 1X4OA 2WV0A 3RZOJ 1ZK8A 1JKQC 2EZHA 2KRCA 4XONA 1IAWA 2BY0A 3AG3H 1IF1A 2DK8A 1FSEA 1J75A 2H6BA 1R23A 5FRNA 1KGSA 3GZ5A 2QGUA 3LL7A 4NHJA 5EGOA 1U8RA 1B4AA 1JUMA 1X1PA 3ABMH 2CQ7A 2COBA 4RM3A 4M71A 5CPRB 5LEJA 4MEXF 2IBDA 4XSZF 3WG7H 3ASNH 1OPCA 2XC7A 1BIAA 4WK8F 1WRJA 2PMZA 5ILUA 3WTZA 3CMYA 4KIGA 1XB4A 2O8KA 1ENHA 1IN4A 3LNQA 3HHHA 4DYRA 4HV6A 2LDUA 5LFAA 3TL4X 4AIDA 1D3YA 2KL4A 3VEPA 2DMPA 2NS7A 4U0VA 5HNFA 2RDPA 3F9KA 1U5TB 2V6EA 2O9LA 3A02A 4KIFA 1LFUP 4N9HA 4E7KA 1OYIA 1FY7A 1ON2A 3OL4A 2YUSA 2OC6A 3OWTA 5JR3A 1KQ8A 1V5EA 3R0JA 1WHUA 3EUKL 3HOVJ 4MFDA 3BTJA 4EVIA 2V79A 5DCMA 4XSXF 4A93J 1KU2A 1R9TJ 1SFXA 3S1RJ 2QUFA 1I3QJ 4MO7A 2FBIA 2PG4A 4I6ZA 5FLVA 3I59B 3EYYA 1BBYA 3M8EA 2IGMA 1MMSA 2GIZA 4AIHA 5DV5A 1HOMA 2JA5J 2HKOA 2PQ8A 5IT9K 5HLHA 3AL0B 2VC0A 3KYCB 2Z3YA 4AIKA 5CQGA 3PNVA 1VQMI 2EQRA 3BQZA 2FXAA 2V1UA 1IRGA 4KMUX 4J01A 1FT9A 3H9JA 1BM9A 2JVHA 1YS7A 3ROUA 4FISA 4HA8A 5DD4A 1GT0C 2CV2A 4A0XA 2PMZN 3G4SI 2IS1A 4I76A 1TWGJ 1FJLA 1SMTA 1YFHA 1UFMA 4LITA 1YLFA 1RZ4A 2R7RA 1OCCH 2OJED 4RA2A 3W2WA 1VQ8I 4ITVA 1BA5A 3OYHA 2TCTA 1IDZA 5K1YA 4RB1A 5H6RA 1Q1HA 3BPVA 3RIRA 2XKOA 4OWRB 3GLLA 3F0CA 2CQNA 1TZLA 1DGRM 1FNNA 3L9FA 3FXRA 3LOCA 2XAFA 3PQKA 2H1LA 2JWTA 1VQ6I 1TLHB 3HRSA 4FT8A 1FOWA 2OQRA 3HM5A 3DLAA 1X3UA 4AYBA 1UZCA 3G71I 4OIPF 1ONVA 1EV7A 2LRDA 1TWFJ 3H3ZA 2Z16A 2IW5A 2YS9A 2HYJA 1TBXA 3JTGA 2YR2A 3R60A 2R7SA 4FETA 1IRZA 2P6TA 1XGMA 3H9GA 2EBIA 1MSEC 2DCEA 3MCZA 3P9KA 3MKWB 3U21A 1Q1VA 4IOCF 5C4XJ 2HOSA 3JREA 5CYVA 3GXOA 4L5JA 3TBIA 2A3SA 1V5FA 2HYGD 3FM3A 3J80Z 3S17J 2OTLI 4XL9A 4KT5C 3B6AA 2KDOA 1SMYF 4MEYF 5FKOA 3O3KA 4CCLA 2HPMA 2GZWA 1B9NA 2XGEA 4RB2C 3K1PA 1ZRFA 5KHDA 3RKQA 2HWVA 1K6YA 3S3NA 4XMYA 1R71A 3V7RA 1LFPA 5GP9A 2P8TA 3BR3A 4PZJA 5E17F 1OCZH 2IA1A 4BJ6C 3WTWC 1BR4A 1ZARA 3S93A 5J47A 5D5WB 2PLYA 1M1EB 1SVLA 1ZYRF 2ZSHB 1O3TA 3SDGA 3DBLB 4RLQA 1P4WA 4XLPF 3PM1A 2UZKA 2EV5A 3EYIA 2F4MB 4FX0A 1QPIA 3BPXA 2IGKA 4AYBN 1ZTRA 4Y7NJ 2KIFA 2E2JJ 4L9TA 3NQOA 3EETA 3JCUC 4XLEA 3SQNA 1ZRDA 4YFNF 2VB6A 3HZJA 3S8PA 3G73A 2EZKA 2L54A 2GA1A 4B47A 4FCYA 4D0PA 1HBXG 1TNTA 1BIBA 5FO5A 2EIMH 3MVPA 1FTTA 3HSFA 3HYIA 4XOPA 2ESNA 2VLAA 3RZDJ 3KP7A 3GTLJ 1BI3A 3ZMZA 1T8IA 3G2BA 2HPIA 4G7ZF 3FBNB 2VBYA 1N77A 1FBUA 1WJCA 1B72A 4FE7A 3ISPA 4HRIA 4PGHA 4JX5A 5LEKA 2LOOA 5K7FA 1LVKA 5EYRA 5J4YA 2FMLA 1WQ2A 2H6CA 4AWXB 3W6VA 2RQQA 1J9IA 3BTLA 3DF8A 3LFUA 2OZUA 3JTHA 2DFIA 4U7DA 3GTGJ 3OL3A 4WX9A 2FUG2 2V1DA 2VOPA 3K69A 1FSHA 3H5AA 1I5ZA 2L9SA 2XIGA 4FX4A 1UB9A 3HC7A 2DYRH 3FXLA 4UHTA 1ACIA 2GAUA 5J1YA 1HXDA 3BR1A 1LQ1A 4UNOA 5TGTA 2JQ7A 3PNYA 4BEHA 3DKWA 3CQZJ 2EJRA 3S3MA 3SJMA 5LHHA 2W24A 2IA2A 3KP4A 5FLXK 3HL2A 3C3WA 3ZMTA 1XSXA 2LH9A 5HS8A 4G6QA 4CCJA 2BY3A 1ZG5A 1R22A 3U1DA 4OOIA 3L7WA 1KYZA 1XGNA 1PUEE 4RAZA 1L3LA 4ESJA 3DEWA 1Z7UA 2FOWA 5L3BA 2ZXIA 1ZG1A 2Y30A 3QPLA 4S05A 5BPDA 2Q1ZB 3FDYA 3OYMA 5D6FA 3K4CA 1ZR2A 2AXLA 1TQIA 4AU7A 1KU7A 4Y13A 2V9PA 2LF8A 4BHPA 4N0BA 3I64A 4LIUA 5HLIA 1ITYA 3KP5A 3LA7A 4O3MA 1P7IA 4DIQA 2MD5A 4A3KJ 1R1UA 2D5VA 3C1DA 1AU7A 2L3DA 2HVRA 1EF4A 1Y0UA 2MA3A 1SFEA 4BXUA 2A6HF 2V9VA 1HKTA 3IRQA 4A0ZA 2A05A 1QBJA 3ZMDA 3KX2A 2L7KA 1DP7P 3PFIA 3BTCA 3FBIB 5IYDJ 2QSHX 4E7HA 2GXBA 2R92J 5GTIC 5M5YJ 2CQKA 4II3A 3EUHC 1XS9A 5ERIA 4YELA 2BY1A 2EPFA 2DJNA 2CQXA 4BNCA 2HOTA 2F5EA 2DT7B 3K4KA 5EEGA 4RDUA 4KJZA 2HXOA 2XRLA 1ZR4A 2DA5A 5EJCA 4D5CA 4MTDA 1D0YA 1O7LA 2Y31A 4M9ZA 4C9YA 4LMYA 3ZQFA 1UJ8A 2CRGA 4PUSA 1U78A 1STZA 2MC4A 2VOOA 4IZZA 4HLXA 4HEA2 3HEFA 1ZQ3P 1WJ5A 3KZIC 1H9GA 4RAYA 4LK1F 5GPAA 3K70C 3E0JB 1ZELA 4IJAA 1S72I 3E97A 2R5YA 3W3CA 2IS4A 2ZBKA 4MQVA 2BE5F 3F8NA 2A5YB 3GTPJ 1R00A 4LB6B 2GOXB 4I7HA 1TL8A 5D5UB 3OIOA 2FX0A 1MKMA 2LY2A 1YX3A 3OS2A 3F22A 1O3QA 2R93J 3K4LA 3LAPA 4XKVA 5LGNA 5DYMA 2XGXA 4XM3A 1R58A 3CUQC 4EQQA 2OAZA 5EF6A 2E19A 3U2RA 2WWYA 2OZ6A 3KYDB 4I98B 1U9NA 2W82A 2HEOA 2QQ8A 4BXFA 5DDGA 1QNTA 3LQRA 1MBKA 1RESA 4AVPA 3L1PA 3JAMZ 2Q2EA 3R0AA 3D0SA 1YI2I 2L9RA 3I3LA 2X48A 3IAM2 1QZYA 5B66C 4UB8C 4I99C 4RAFA 4M3FA 3ZOBA 2ZKZA 2YU9J 4XN3A 1Y56A 2F5VA 5EEAA 1UHMA 5FRMA 2DODA 3IH4A 1FYLA 2NRAC 3NEUA 1X3WB 2YX7A 4YG2F 3BP8A 3MZ8A 3WHBA 4CYCA 3DQVC 4XK4A 3MAJA 2XPWA 3M07A 4R1HA 4HQMA 1J2XA 1D8KA 1VQ5I 3IWFA 1K61A 2MH9A 1S29A 4CDGA 4HAMA 2X4HA 3IKTA 3ECOA 3NAUA 3WG9A 3RYPA 2Y0SA 3A0HC 2E1OA 1YTYA 4X1EA 5AIQA 5DD8A 1DU6A 2LKPA 2M7BA 4IRIA 3LSMA 3IV5A 2FOKA 4BE0A 3OOUA 4DBRA 2BGCA 1P2FA 3DPTA 3DPLC 5IY5H 3OS0A 1K79A 5ED4A 3SYTA 1SD7A 2AHQA 5TJJA 3CDIA 2A69F 2CV1A 2L9NA 3GFIA 4WXHA 3R4KA 2HVQA 1RKTA 1OR7C 2Q8KA 4EJWA 1MH4A 2KMUA 3R6SA 2X1EA 1U5TA 1G8XA 3BG7A 1E2XA 3ONQA 3RYRA 1B6AA 2UUZA 3BLYA 1W7PB 1FX7A 4AUXA 4OIOF 1MSFC 4A3BJ 1E3PA 1GUUA 4XLFA 1FP2A 1LB2A 2WBMA 3PFYA 3TMOA 3MD2A 1K6OA 3TP0A 1X4PA 3DWLE 4G9YA 2L4MA 4M3BA 2MGQA 2R7UA 2M4KA 2H8WA 4HW0A 1ZLKA 2ZJPF 1R5ID 5CVIA 4GXOA 1YOVB 4HSTA 4BE1A 2HKXA 2DQRA 3CTAA 2M0CA 2IPQX 1VQNI 5D8LB 3I59A 3F8BA 4IHSA 2H8RA 4UV9A 1OLTA 1LDKB 2DPUA 1W1WE 1JTYA 3GCMA 3ZP5A 1RUNA 2CFOA 1VQKI 4ZTJA 1OCOH 1FWZA 3IH2A 1FIAA 1MD0A 4AM3A 3OR1C 4E70A 3RQIA 4EJUA 3HUGB 5FFXA 5J40A 1W7PD 4Y52J 2Y0SN 4F3QA 3KPHA 4CICA 1D1BA 2KJBA 3GF2A 1YIJI 3DBHB 1F5TA 3GEZA 3KEQA 4U7BA 3CCMI 2AQEA 2IXSA 2BXYA 3OR2C 5EZHA 5LHGA 1SD5A 4XKWA 2ICWG 2B0LA 2GQQA 2L2OA 3ZQHA 2KISA 3W2VA 3VB2A 3CJNA 4XQFA 2BVMA 4YEJA 3GUDA 2CO5A 3HXLA 1Z6RA 1HQCA 3DCFA 2W85A 2BZTA 2NOJB 3OSGA 1PP7U 1AKHB 2K5CA 1SAUA 3NWTA 2BYVE 4Y4RA 5FKNA 2WAFA 4CSWA 2V9KA 3OYIA 5JLWA 4HNTA 5LLQA 2CW8A 2YX4A 3DV8A 1SC7A 1VQOI 1UMQA 2Z33A 1WI3A 1D5VA 3PL8A 4IL6C 4BQQA 2ISYA 1ETYA 2LY9A 1BOAA 1YS6A 3VOEA 2VJ4A 1HSJA 3WTTC 2BVLA 4BJ5C 1NK3P 3LSIA 5HNHA 2HTSA 1RUOA 4JK1X 3CLOA 1Z3XA 2B7EA 2BEOA 1H89C 3CD6I 4UUSB 2QCOA 5DM6F 1FEXA 3CESA 3Q9SA 5HLGA 4S04A 2R7OA 3HOUJ 2ECBA 3K6GA 1GVDA 1KA8A 5LGUA 2QQAA 3SEQA 3Q5FA 2KJCA 2DBBA 1S9HA 3TW7A 1NG6A 2M0MA 4FQGA 1R5HA 3F72A 1W4MA 3BR6A 4P55A 5DCFA 1UG2A 3ZGKA 4IQJA 1CF7B 1F36A 2W57A 2B9SA 1OFCX 4M72A 2EIJH 1XGSA 5B1BH 2JTVA 2AQFA 3CJRB 1LDDA 3VYRB 3I56I 3SEZA 2VT2A 3ZMUA 2NXNB 1IN6A 4L5EA 3D1NI 5L3GA 1G6NA 2NVUB 3RCOA 2EFWA 1RKWA 1ZN2A 2OD5A 2ZFWA 5BS6A 4DBQA 2Y9ZA 3JRDA 1ZREA 2VXZA 2K4JA 5GAGJ 4NDLA 2KQRA 3JRCA 3CCYA 2NS0A 4LLLA 3CC2I 2FBKA 4GCVA 5H6QA 5ILSA 1XGOA 4Z6YA 5BOXA 3F6VA 2EFPA 1Y39A 4P5OA 3NWSA 1ETQA 1SEUA 2Q0OA 4WWCA 2HOEA 1B8IB 1W36D 4GFBA 3ELKA 2DT6A 2IRFG 3HDDA 1MGTA 2VI6A 2E7XA 5FJ8J 1ZG3A 1FZPB 1FYKA 3FMQA 1IUYA 4N4NB 4Y3OA 2CUZA 4HX7A 2LLKA 3SZTA 2DFEA 2J5OA 3DTIA 2LP0A 3PUFA 4ABZA 2OF7A 3OYEA 1TTYA 3BTIA 1F43A 1AA7A 3E3VA 3LQQA 5IOYA 2ZSIB 4M3EA 4V19K 5K5QA 1U9OA 2DA6A 2CFXA 4XLAA 2RN7A 1K7AA 3L2RA 4XR6A 3F8FA 5E1WA 3DXJF 4CYDA 2P0WA 5IP7J 3UR3C 2ZJ2A 3FXKA 4L0ZB 4KN4X 1F1ZA 2DW4A 2MD0A 2HOAA 2FRHA 1YQAA 2WV1A 2XHKA 2P5LC 4IHWA 4LLNA 2HQAA 1QO0D 1IV8A 9ANTA 2STTA 4OMZA 4A0YA 1D1AA 2R7VA 3FXQA 2FQ4A 2P81A 1HF0A 2YPRA 1XSVA 3QOEA 3JRIA 4C30A 2NNYA 2KZVA 5F0CA 5EZGA 2X51A 4AVZA 2D1HA 4U0YA 4P1WA 3MKLA 2XGCA 3KEOA 1SANA 4DYQA 1X1CA 2LK2A 2VJ5A 4BUPA 1W5TA 1WH5A 3DLLF 2HS5A 4EJVA 3VDXA 4MTEA 3BR2A 2DMUA 5D4SA 5F0FA 3RKYA 2IGOA 3HG9A 4I09A 1U6GA 3SZGA 4X6AJ 1TWHJ 3TW6A 1WJBA 2DMTA 5AIPA 4A3JJ 2FE3A 2X0LA 4OIRF 2L5QA 4B3AA 4Y15A 4RM2A 3FXOA 3AAFA 1BW5A 3B02A 4IXAA 4QSHA 1S7OA 4L5IA 2MLGA 1I6HJ 4PSWA 3J81Z 2JJ7A 1T38A 3ZMSA 3GFMA 4LLGF 5EEHA 1T2KA 4I02A 1YJ9I 3L2CA 3S16J 2EB7A 3QU6A 2A07F 3JRAA 5IP6A 2K27A 1V4RA 4MIMA 5E79C 1RC9A 2IS2A 1TT0A 5B1AH 3K9TA 3NRVA 5AONA 2HZTA 4ZTFA 1JTXA 2QENA 3H35A 3JRBA 2P6SA 1E3OC 1Y6IA 2EFNA 3GO5A 4HF0A 1SD6A 2EK5A 2K4BA 3S2WA 1AWCA 2CUEA 1X3ZB 3Q0WA 3LSGA 3L2VA 1OCTC 4CCMA 2ME6A 2KLOA 3QOPA 2F5CA 4L9NA 3HKZA 2OPTA 2ZMEC 2XSDC 2HDDA 3WGIA 2CUFA 2YU3A 1FYMA 2E35A 1V54H 2O0YA 3BZ6A 3PSFA 3ZCOA 5C44J 3CCEI 5HOOA 4J19A 5GAEJ 1WVRA 1GXPA 2ID3A 1Z1DA 4A6EA 4BQOA 2JA7J 4M74A 3CDLA 1DP3A 4N4OB 1YO5C 2V6CA 3B73A 3OYFA 2JUCA 3RI4A 2R7FA 2PJPA 2LTPA 4HDUA 4HLYA 2XVCA 3QAHA 1IO2A 1Z7LA 4EMSA 1D0XA 4R79A 1JHHA 2PJRB 2L01A 3M7GA 4F7ZA 1YITI 2JSCA 2DMNA 2GWRA 2MYSA 3OYJA 1TQPA 1TW2A 1S8NA 5E1ZB 5A2QK 2ZB9A 3E1SA 1E3HA 2LD5A 3Q9VA 3HOXJ 4BJTA 3BJOA 1I3AA 1H0MA 1QU3A 2A5WA 3DKXA 1MBGA 1WI9A 1XG1A 4ENKA 1JJ8C 2CH0A 1W5SA 2QEXI 2VUMJ 1RRJA 1A36A 4WF2A 1HDPA 1Z3YA 2P4WA 1VZ0A 1MJ9A 1QZEA 2MC3A 2R7QA 2EA4A 1WGXA 3BR5A 4A5NA 1CQTA 2STWA 1VQ7I 4PFOA 1YG2A 4PGGA 4ZJZA 2M3AA 3VPRA 3HKZN 5L3FA 3IWZA 1FC3A 1MH3A 1S7AA 3M8JA 3CJTB 1OJLA 4IPAA 4RGXA 1FP1D 3RJPA 4DOZA 4XRSA 2EWNA 2MW8A 2ETHA 2J5PA 5KCMA 5F0HA 2DMQA 2KHMA 5DTDA 4LG0B 1GV5A 3K2ZA 2OTJI 5FROA 4DYCA 2F5DA 2ADUA 1IN8A 3K4MA 5JVTA 2HQNA 5KAFC 5FFZA 2JT1A 4RLFA 1MW7A 1T95A 2DK5A 1Z21A 2WA0A 2FD5A 2JK3A 2LC2A 2M45A 1R1TA 5EG0B 4CHUA 2HVSA 5BPIA 2CYYA 1N25A 3JSOA 2CJJA 3I4PA 1FMVA 1P9QC 3G6EI 3I71A 2A68F 2PN6A 2XDVA 2F6CA 3QP5A 2ZXJA 3ASOH 1MNMC 4S0HB 2NAZA 4IF4A 4E4HA 2VJJA 3RDIA 3ZRGA 3K1MA 3JRHA 2BOLA 2E71A 3TP3A 2KPMA 4ZZDA 1TC3C 1JI8A 4QIWN 2UV1A 4QWQA 1WH7A 1NHAA 2K9LA 4M9SA 3LWFA 4IO9F 2GXAA 4Q48A 2OCEA 5DUIA 1EH7A 1X1DA 4CCKA 1SAXA 2AO9A 3CUQB 1PUFB 1W7PA 2W25A 4ENJA 2PX9A 2FNPA 3KZZA 3U9GA 3A01B 3LA3A 4JBAA 3W6KB 5D4RA 5JLXA 2MH2A 3FISA 2JPCA 2DTZA 3AG2H 4B1RA 2G9WA 5E8IA 3I53A 1D8JA 1MNEA 2VBZA 3T5XA 1ODDA 1Z6TA 2P7VB 2NVTJ 3PIPF 4BL0B 4NBQA 2DI3A 3G1OA 1QVTA 2L02A 3S14J 4EV0A 3D5LA 2VASA 5IOZA 2JN6A 1I27A 2IEKA 1ZGWA 3DU6A 2VPRA 4XLCA 3KYLA 4XLHA 1T0FC 1KQ0A 1GXQA 2XPVA 1S7EA 3HTUA 2LREA 4B09A 5K5OA 3F8CA 5D8KB 2DOEA 1XN7A 3BWGA 1O3RA 3GLXA 3AKZA 2IT0A 2DOAA 3KP6A 2CG4A 2HYFA 4YIRX 3WU2C 2VQLA 5HDKA 1Y0NA 3HUGA 3LSRA 2QYOA 4F91B 5ICCA 4ZC3A 2Y0MA 3OYNA 4IVNA 2H1KA 5LRRA 1GVJA 4XORA 4QPQA 3WHCA 1Y8RB 1BC8C 3S2HJ 1PYVA 4PSXA 2DJIA 2WAQN 3PUBA 2FEZA 1DU0A 5FD6A 1ETVA 1RNLA 4C3JJ 4IRGA 2DA7A 4JX4A 3DEEA 5DUKA 4ZYEA 1F4KA 4F92B 3GTOJ 1OKRA 3TKYA 2QQ9A 2K9QA 4G6TB 1FBSA 3MEXA 4G6DA 2ECCA 3WTUC 3LSJA 4R8HA 3V7CA 5E3OA 3FF5A 4CZZA 4E7SA 4ASNA 1AKHA 3ZQLA 4OMYA 3HOSA 3E6DA 4AC0A 4B43A 5K7HA 3CCSI 5CQEA 3PO2J 1EH8A 2A61A 4I01A 5J3LA 5L3CA 1TT5B 4UV8A 1PJRA 2DTRA 4UVBA 3H5NA 2HGCA 2DLLA 1YHQI 2DA1A 4P9UA 5E18F 1MDMB 2VKVA 3AG4H 5CLSA 1D1CA 4D9JA 3KEYA 3RPUA 5IT3A 3JSPA 4UUSA 3ZQCA 1IZ1A 4OAZA 2ESHA 3DTEA 5BQTA 1JJ6C 2EINH 1JT0A 4RAGA 2GXGA 2QKMB 2QZ8A 2RC4A 3EUAA 4KN7X 4LFUA 4H4KC 4HSRA 2KZGA 3HPHA 2XF6A 2VKDA 4YFXF 3GTJJ 1JE8A 4HF1A 1YIOA 3H92A 2A6TA 1O57A 2DA2A 3VYSB 1X2MA 4LGWA 4PJJA 1A6QA 3I0TA 3VFZA 3REOA 2XAJA 5L3EA 5IPAA 3L2UA 1HW2A 2QVOA 4B44A 4D7MA 3FWEA 1CF7A 2P5KA 3HRMA 4D7NA 1SFKA 2H09A 2DDBA 3K0LA 4KT6A 4M6YA 2Y69H 4PFPA 1USSA 4ZZLA 5F1JA 2CUJA 2NVQJ 3K4NA 4PJMA 3CO7C 3MWMA 3M3YJ 2ID6A 3JW4A 3QQAA 2EZIA 3BOQA 4BY1J 4PDKA 2G7UA 5TISC 1T56A 2K7LA 4GGGA 3FHZA 3O8HA 2RQPA 3UKGA 2HNHA 5H2FC 2VE9A 2XAUA 3WODF 2QKLB 3OS1A 3COAC 2X6WA 3QPHA 3WTYC 1XC5A 4HNVA 4BACA 3P7NA 4XNFA 3CCLI 1B8IA 1BOBA 3J80K 5IT9Z 2FF4A 3HRTA 1LKXA 3QP6A 6PAXA 3CCVI 2Z1DA 3IH3A 5M5WJ 1JUPA 5HLTA 1R4NB 4EGYA 3VODA 3VSKA 3CMEI 3LA2A 3DKYA 4BGDA 5KK1A 5E3LA 4CA0A 3ZQQA 2QF7A 3BG9A 3ZN1A 4KNYA 1QQIA 5CVJA 1ZGJA 2F2EA 3FXMA 3V42A 3ZXSA 1HW5A 1RI7A 2VBWA 4CCNA 1W5CC 1DPRA 2ZXHA 4A2UA 1K78B 1VQPI 4E6KG 5HDGA 2QA4I 1P6RA 1VTNC 1MMAA 5ILVA 5C3EJ 4A3IJ 3LSPA 4W97A 2R4GA 2CW0F 3JRFA 3A1YA 2VXDA 1KZHA 4EATA 1XMAA 1Y1VJ 3EPZA 3BR0A 3LSTA 3TDZC 5BMZA 1C0WA 1I1GA 2MBFA 3S1MJ 3OIQA 4JP0A 1DQUA 2R3SA 1ZH5A 5LHIA 3OYCA 1I39A 1X2NA 1Z9CA 3DU5A 2MG4A 2V1NA 1EJ9A 3QPSA 1IRXA 4RGUA 1P7JA 5J8FA 2IS6A 1JKPC 1RR8C 1ERDA 1I6XA 4KIBA 3K4JA 4BQNA 1B9MA 5D6EA 2M7AA 4TV7A 4BQAA 4MQ9F 5LD2C 1G59A 3NARA 3BG5A 4E7ZA 1LJ9A 2TDXA 1OYWA 4O6JA 2KT0A 2F4IA 3IKVA 4ZDPA 3T8RA 1U2WA 4ZH4F 1GHCA 4GRIA 2AS5F 2XUBA 3KIOA 2EA2A 3W6JB 1UHWA 3SZPA 4NQWB 1EH6A 4A3FJ 2JA2A 2KKOA 2PMHA 2H94A 5ICFA 1WPKA 1NG7A 5M3FJ 1IXSB 2NYXA 3A03A 2K85A 3H9QA 1V3FA 1VFCA 3HOYJ 4MFEA 4WXDA 5KVRA 4LG3A 3C2HA 4QPOA 2PBIA 4BU2A 4RB3C 2ZXWH 3I5UA 2M8GX 2XROA 3WTSC 2XF5A 4I0AA 1MMDA 2XV4S 2K86A 2CV0A 2Y2ZA 1PVEA 4KDPA 4RGSA 4JOMA 1JT6A 2XB0X 1VF9A 3QYEA 4LK0F 3S1NJ 3BZCA 1MMGA 2HFHA 1ZHFA 2ZNZA 4YRVA 3DTKA 4LD5A 1N78A 1P92A 3G1LA 4BBSJ 3BJ6A 1PP8F 1JHFA 5K5RA 1XMKA 2GLOA 1YRNB 3FIWA 4ZYDA 3OYGA 4EGZA 1BN5A 2R0QC 2D2WA 5K7ZA 1RETA 3U1KA 5E3NA 4KFCA 1HC8A 1KYWA 3S2DJ 1HCRA 2BY2A 3K2AA 2EFQA 2W7NA 2PI0A 1XDSA 5J1RA 2LYCA 5EDNA 4HBLA 4NUBA 1R7JA 2BW3B 3MKYB 2E1MC 1U3EM 3LSHA 2K3FA 4Q4ZF 5TRDA 3V4GA 2R7TA 5D5XB 4IHXA 3A2KA 1LE8B 3K1NA 3ZMVA 3RPQA 4X0GA 2LKSA 5BNGA 2K02A 3RPUD 2UWMA 3K10A 3EDPA 2W1OA 2PEXA 2PJRA 3CO6C 1YW9A 2COMA 3ZQ7A 4F93B 3QRFF 2DO7A 3VSLA 5FKKA 3VYTB 4A5MA 1FBQA 3I54A 5B5EC 5LBQA 2VKHA 2WC2A 3HTSB 5FKMA 4KITB 1EKEA 3HOTA 3C18A 2BV6A 4A69C 1JGGA 1J0RA 2ZFUA 2CQQA 3BROA 3CF2A 1IN5A 1YW7A 2Z99A 3E5XA 3CP8A 4CUGA 5GTHC 3ERMA 1JXSA 3WGGA 1F9NA 1GDTA 1JKRC 1OCPA 1AOYA 3FK7A 5KAIC 3OYBA 1JGSA 3QWLA 1YJNI 4LOCA 1ORKA 3GWZA 2K9NA 3CDHA 2K40A 1KONA 2ELJA 1ZGAA 4E7JA 3T1BA 2QWWA 2RNJA 3LFKA 3O2PE 3V8KA 4F52A 3QYFA 3JRGA 2M30A 3FXUA 3RTRA 3CCJI 4WXCA 5HS7A 3RSNA 3PO3J 1E0EA 4B48A 5FLXZ 2X9DA 1IGNA 2LNBA 4B4CA 1OQYA 3E7LA 2ZMEB 1WJEA 3WE3A 4IHTA 3EUHA 2NVYJ 3CCRI 3Q0VA 3G3ZA 4LG0A 4MNUA 2DAOA 2KRFA 1W0TA 3GTKJ 2LG4A 2JZYA 1JUSA 3KLOA 3LSKA 3Q0UA 4LJZF 5F08A 2JSPA 3IUOA 2XPUA 2VONA 3JAMK 3DBRB 4XRFA 5EG0A 3GFLA 4ETSA 2NOGA 1Z0XA 1DPUA 1R1VA 1WJFA 2GA2A 4A3CJ 1S6LA 3M1CA 4HDVA 2VODA 2V26A 2JA6J 1QGPA 1KU3A 1SVOA 1YW8A 4U0WA 2VJIA 4H0EA 2QQBA 1T98A 3E5UA 2RVCA 4YFKF 2KDZA 1LUJB 1YJWI 3CUOA 2Z2SB 1HKQA 2VC1A 1MBHA 2HQRA 2XRNA 2WTEA 3OV8A 2QBYB 3D5RC 4Y33A 2EH3A 5LRSA 1TW3A 1WKMA 4CO8A 1K4SA 1VI0A 1WCMJ 4XRSG 1IC8A 1IUFA 2OCCH 3BG3A 3IAS2 3CUQA 4HQEA 4AD9A 3WE2A 1PUFA 5CKTA 4Z2YA 5D5VB 1FOXA 2M87A 4CXFA 3OY9A 3A01A 1ETOA 3ULQB 2HQ5A 2DA4A 4M3DA 1WWXA 2W4SA 3L09A 1W36C 4JYKA 2UXXA 4NC6A 1V55H 3N05A 2LY1A 1DDNA 2EV6A 4A6DA 1PDNC 2W84A 2A6EF 2OQGA 2M9HA 3GYHX 2E2HJ 4UY8I 5JVGF 1G4DA 2RAEA 5E1XA 3HIFA 4M9XA 5CVUA 2JUGA 5IP9J 4ENNA 1WSUA 1GLNA 4L9VA 4NNJA 3HGGA 4ZYAA 2CMPA 3S32A 1U8BA 1X58A 3M1EA 1XMXA 1X1BA 3BCAA 1LDJA 1Z05A 2XAQA 4M6XA 4BYYA 4C3HJ 2ZJQF 4DJAA 1A31A 2JA8J 4A3DJ 1XCVA 5DEQA 2VT3A 2QSGX 4ESBA 2DA3A 2UXNA 3I9V2 4PCQA 1FOYA 3TEDA 1TQMA 2TRTA 1BC7C 1Y8QB 1S5LC 2OUMA 3PIOF 3WTVC 4YIIA 1G3YA 2ZCWA 1MMNA 3FX3A 4A12A 1WJDA 2H27A 4J00A 3LMMA 3I55I 3KFWX 1T33A 2M1BA 1G3WA 3MN2A 4EJOA 2IVMA 5J4VA 4DGWB 4HF2A 4F55A 2D1VA 2L4AA 2EV0A 3SFIA 2O61A 1Z91A 2PMUA 3ZQGA 4KICA 4ZDLA 3CMMA 2ISZA 4P9FA 3J7AO 1OR7A 4WCGA 2LR8A 3O8GA 4L9JA 5E20A 4BS9A 3S1QJ 2RV8A 5ICEA 5KNLA 2R7WA 1U5TC 2WB1A 1WJAA 3CJQB 3HSRA 3WTXC 4OIQF 3TO9A 3TOBA 2HU9A 3KCCA 4C2TA 2KFDA 4QTRA 2WAEA 3TDUC 2BXZA 4IEJA 2FMYA 2DT5A 4EEFG 1MDMA 2K3PA 4ZYHA 1XD7A 3HBLA 1B1BA 4V2GA 3ABKH 1HW1A 1TP4A 3O6BB 1SFUA 3IC7A 1BI1A 1X19A 2QLZA 4HX4A 3OYAA 4G8XA 5J1UA 2M5WA 2OBPA 2R5ZB 4LIVA 3HRUA 2G0EA 4RGRA 4BY7J 3DEUA 4BKXA 1ETKA 1WFXA 5IYCJ 3VYUB 4G7HF 5B3SH 2EILH 1ULYA 1POGA 3FHNA 3HPGA 1J09A 2LBFB 1O3SA 4NB5A 4GYIA 5IYBJ 5M5XJ 1X1AA 4L0YB 5CJ9A 1OCRH 3AL0C 4NC7A 3V8LA 2VPLA 1R49A 1KU9A 4E7IA 3PSIA 4DQ2A 2VQCA 3C7JA 3MZYA 4IQ4A 2E36A 3PJRA 4DZPA 2DPDA 5F6FA 5EGOB 3GTQJ 2L7FP 3ZQIA 1OMIA 3F8MA 2R7XA 1IDYA 1O4XA 3OOPA 1A35A 4GDFA
chains in the Genus database with same CATH topology
2O03A 1J7KA 2QM3A 2FSWA 2P5VA 1YYVA 3TO6A 3MZHA 2ACJA 3GFJA 3N4MA 1IXRC 4KA4A 1O7FA 3M9AA 3ECHA 1J5YA 4Q47A 3E6BA 2HR3A 2R7DA 2XAHA 5CVRA 2HTJA 5DCMB 2O3FA 3TQNA 2Z9OA 2PFBA 4JQFA 1IRFA 5JFRA 3F23A 3T0YA 1K78A 4O5VA 1FOKA 2Z5UA 3BJAA 1DUXC 5H20A 3ABTA 3IL2A 3QU3A 3IRRA 4ESFA 2E1NA 3T8TA 2D45A 1SD4A 4M73A 1BJAA 5F1RA 4EM2A 2C6YA 4DNCA 3DP7A 3ERED 4MGRA 1QPMA 2OA4A 3SFZA 3GX4X 3E6MA 1BI2A 3IHUA 3ZN0A 1XSDA 3H3UA 1XDUA 2JPBA 1G3TA 3KP2A 4CGZA 3BY6A 1USTA 3KLNA 4UUVA 2XAGA 2VBXA 4NQWA 3KETA 4EJTA 5L3DA 3F21A 2HDCA 1LEAA 4UXNA 3QPTA 3R61A 4HOBA 1REPC 4HYEA 2E7WA 1S3JA 4FHTA 3SXYA 3BDDA 3V8JA 2JRTA 3TOAA 4Q5SF 4I2OA 3KP3A 3F6OA 3ML6A 4G94A 4IRHA 3J81K 3LAJA 2LF7A 4KMFA 5LGTA 3FM5A 3N97A 3EQLF 4AIJA 1RIOH 5JHUA 4QLCU 3HSEA 3FZVA 3P9IA 3HHGA 1QZZA 3FMRA 2O8XA 4B8XA 3KZYA 1LEBA 1I1SA 4L18B 4GO1A 2CWEA 2ZO4A 2LSOA 1A04A 2NNNA 4HZFA 1LVAA 3MFKA 2E1CA 4KYWA 3L00A 4HV5A 4UVAA 2G7HA 4Y17A 3M8FA 2XASA 1FPQA 2P7CB 1IW7F 1BI0A 5FB2A 4XBFA 2RGVA 5E8GA 2IP2A 3I58A 3ZPLA 4EM1A 2EFOA 4UVCA 2XKPA 2CGPA 2OU2A 4LB5A 4G7OF 3ABUA 1FLIA 2ZMEA 2KIUA 2DU9A 1R5GA 2V1XA 2YSRA 3FMSA 4BH9A 3WU1B 1TNSA 2MLKA 5FD5A 2ELHA 2ZNYA 2FQ3A 4BAYA 3V7SA 5F64A 4I0BA 1MZBA 4ZYGA 3GW2A 3PQJA 1J59A 2Y75A 3GVAA 2QBYA 5JI6A 1ZRCA 3GZ6A 4OINF 3RKXA 2CSOA 5HVQC 4BHBA 3DFGA 1IXCA 2GIVA 2IA0A 1MJBA 2FA5A 5J6XA 2M8EA 1B59A 2BBYA 4BHCA 1ON1A 1ZLJA 4EM0B 5HS9A 1HSTA 3MQ0A 4ON0A 4K2EA 4YIFA 1CGPA 1MJAA 2FU4A 1KQ9A 4HX8A 5A2QZ 4P96A 3TGNA 1L0OC 2F5FA 1IN7A 2VN2A 3TO7A 4MHGA 5ICGA 2FBHA 4U88A 1H9TA 2DQLA 2Y48A 2IJLA 4XLNF 4RB0A 1E17A 1HKSA 4N9IA 5HDNA 2O6GE 2VE8A 4ENMA 5J8CA 1P4XA 3WU0A 3E5QA 4GYGA 1G3SA 2FNAA 2KIMA 3RKWA 3SHFA 3KE2A 3F3XA 3WGHA 1UCRA 1LNWA 5CVVA 5FGMA 2RKHA 3P9CA 1OYYA 1T6SA 4OU0A 1ZAOA 1T0FA 1P4AA 1XCBA 4KUMA 4RS8A 1R36A 3E6CC 1T39A 2WV0A 1IAWA 1IF1A 2DK8A 1FSEA 1J75A 2H6BA 1R23A 1KGSA 3GZ5A 4NHJA 1U8RA 1B4AA 5LEJA 4M71A 4MEXF 4XSZF 1OPCA 1BIAA 4WK8F 1WRJA 5ILUA 3WTZA 4KIGA 1XB4A 1IN4A 3HHHA 4HV6A 2LDUA 1D3YA 3VEPA 4U0VA 2RDPA 1U5TB 4KIFA 4N9HA 1OYIA 1FY7A 1ON2A 5JR3A 1KQ8A 3R0JA 4EVIA 2V79A 5DCMA 4XSXF 1KU2A 1SFXA 2QUFA 2FBIA 2PG4A 3I59B 3EYYA 1BBYA 3M8EA 4AIHA 5DV5A 2HKOA 2PQ8A 5IT9K 5HLHA 2VC0A 2Z3YA 4AIKA 2FXAA 2V1UA 1IRGA 4KMUX 1FT9A 1BM9A 3ROUA 1YS7A 4HA8A 5DD4A 4A0XA 1SMTA 1YFHA 1UFMA 1YLFA 1RZ4A 5K1YA 4RB1A 5H6RA 1Q1HA 3BPVA 3RIRA 2XKOA 1FNNA 3L9FA 3FXRA 2XAFA 3PQKA 1TLHB 3HRSA 4FT8A 2OQRA 1X3UA 4OIPF 1ONVA 1EV7A 3H3ZA 2IW5A 1TBXA 3JTGA 2YR2A 3R60A 2P6TA 1XGMA 3MCZA 3P9KA 5CYVA 3GXOA 4L5JA 2A3SA 2HYGD 3FM3A 3J80Z 4KT5C 1SMYF 4MEYF 3O3KA 2GZWA 1B9NA 4RB2C 3K1PA 1ZRFA 2HWVA 3V7RA 2P8TA 5E17F 4PZJA 2IA1A 3WTWC 1ZARA 5D5WB 2PLYA 1ZYRF 1O3TA 1P4WA 4XLPF 2UZKA 2EV5A 3EYIA 4FX0A 3BPXA 2KIFA 4L9TA 3NQOA 3EETA 3SQNA 1ZRDA 4YFNF 3G73A 2L54A 2GA1A 4D0PA 1HBXG 1TNTA 1BIBA 5FO5A 3HSFA 3HYIA 2ESNA 3KP7A 1BI3A 3ZMZA 4G7ZF 2VBYA 1FBUA 3ISPA 4PGHA 5LEKA 2FMLA 1WQ2A 2H6CA 4AWXB 1J9IA 3DF8A 2OZUA 3JTHA 2DFIA 4U7DA 4WX9A 2V1DA 2VOPA 1FSHA 3K69A 1I5ZA 2XIGA 4FX4A 1UB9A 4UHTA 2GAUA 1HXDA 1LQ1A 4UNOA 3DKWA 2EJRA 5LHHA 2W24A 2IA2A 3KP4A 5FLXK 3C3WA 3ZMTA 1XSXA 5HS8A 4G6QA 1ZG5A 1R22A 3U1DA 4OOIA 3L7WA 1KYZA 1XGNA 1PUEE 4RAZA 1L3LA 4ESJA 1Z7UA 5L3BA 1ZG1A 4S05A 5BPDA 5D6FA 2AXLA 1TQIA 1KU7A 4Y13A 2LF8A 4BHPA 4N0BA 3I64A 5HLIA 3KP5A 3LA7A 4O3MA 2MD5A 1R1UA 3C1DA 2L3DA 1Y0UA 2MA3A 1SFEA 4BXUA 2A6HF 2V9VA 1HKTA 3IRQA 4A0ZA 1QBJA 3ZMDA 1DP7P 3PFIA 2GXBA 2CQKA 5ERIA 4BNCA 2F5EA 5EEGA 4MTDA 1O7LA 4M9ZA 4LMYA 1U78A 1STZA 2VOOA 4HLXA 4RAYA 1H9GA 4LK1F 4IJAA 3E97A 2ZBKA 4MQVA 2BE5F 3F8NA 2A5YB 1R00A 4LB6B 4I7HA 5D5UB 3F22A 1MKMA 1O3QA 3LAPA 5LGNA 5DYMA 2XGXA 1R58A 3CUQC 4EQQA 2OAZA 3U2RA 2WWYA 2OZ6A 4I98B 2HEOA 5DDGA 1QNTA 3LQRA 4AVPA 3JAMZ 2Q2EA 3R0AA 3D0SA 1PDNC 1QZYA 2ZKZA 1UHMA 1FYLA 2NRAC 3NEUA 2YX7A 4YG2F 3BP8A 3DQVC 3MAJA 4R1HA 4HQMA 1J2XA 1D8KA 3IWFA 2MH9A 1S29A 4CDGA 4HAMA 2X4HA 3IKTA 3ECOA 3WG9A 3RYPA 1YTYA 5DD8A 5AIQA 2LKPA 4IRIA 2FOKA 2BGCA 1P2FA 3DPTA 3DPLC 1K79A 5ED4A 1SD7A 5TJJA 2A69F 3GFIA 4WXHA 3R4KA 2Q8KA 4EJWA 3R6SA 1U5TA 1E2XA 3RYRA 1B6AA 1W7PB 1FX7A 4OIOF 1FP2A 1LB2A 1K6OA 4G9YA 2L4MA 4HW0A 1ZLKA 5CVIA 4GXOA 2HKXA 2DQRA 3CTAA 2IPQX 5D8LB 3I59A 3F8BA 4IHSA 4UV9A 1LDKB 2DPUA 3ZP5A 1RUNA 1FWZA 1MD0A 4E70A 4EJUA 5FFXA 1W7PD 4CICA 2KJBA 3GF2A 1F5TA 3GEZA 3KEQA 4U7BA 5LHGA 1SD5A 2B0LA 2GQQA 3VB2A 3CJNA 3GUDA 2CO5A 1Z6RA 1HQCA 2W85A 1PP7U 2BYVE 5LLQA 2YX4A 3DV8A 2Z33A 1D5VA 2ISYA 3VOEA 1BOAA 1YS6A 1HSJA 3WTTC 2HTSA 1RUOA 4JK1X 3CLOA 2BEOA 3Q9SA 4S04A 5HLGA 1KA8A 5LGUA 2QQAA 3Q5FA 2KJCA 2DBBA 1R5HA 3F72A 1W4MA 4P55A 5DCFA 1CF7B 2W57A 4M72A 1XGSA 2JTVA 1LDDA 2VT2A 3ZMUA 1IN6A 5L3GA 1G6NA 2EFWA 1ZN2A 2OD5A 2ZFWA 5BS6A 1ZREA 2VXZA 2K4JA 2NS0A 4LLLA 2FBKA 4GCVA 5H6QA 5ILSA 1XGOA 5BOXA 3F6VA 2EFPA 4P5OA 2Q0OA 4WWCA 2HOEA 3ELKA 2IRFG 1MGTA 2E7XA 1ZG3A 1FZPB 1FYKA 3FMQA 1IUYA 4HX7A 3SZTA 2J5OA 1TTYA 3E3VA 3LQQA 5K5QA 2CFXA 2RN7A 1K7AA 3F8FA 5E1WA 3DXJF 4CYDA 2ZJ2A 4L0ZB 4KN4X 1F1ZA 2DW4A 2FRHA 1YQAA 2XHKA 2P5LC 4LLNA 1QO0D 2STTA 4OMZA 4A0YA 3FXQA 2YPRA 1XSVA 2NNYA 2D1HA 4U0YA 3KEOA 1W5TA 2HS5A 4EJVA 4MTEA 5D4SA 3RKYA 4I09A 1U6GA 5AIPA 2FE3A 2X0LA 4OIRF 4Y15A 3AAFA 3B02A 4IXAA 1S7OA 4L5IA 2MLGA 3J81Z 1T38A 3ZMSA 3GFMA 4LLGF 5EEHA 1T2KA 4I02A 3L2CA 2EB7A 3QU6A 2A07F 2K27A 1V4RA 3K9TA 3NRVA 5AONA 2HZTA 2QENA 2P6SA 2EFNA 3GO5A 4HF0A 1SD6A 2EK5A 2K4BA 3S2WA 1AWCA 3QOPA 2F5CA 4L9NA 3WGIA 2YU3A 1FYMA 2O0YA 3BZ6A 5HOOA 1GXPA 4A6EA 1Z1DA 4M74A 1YO5C 2V6CA 3B73A 3RI4A 2R7FA 2PJPA 4HDUA 4HLYA 2XVCA 3QAHA 4EMSA 4R79A 1JHHA 2L01A 3M7GA 4F7ZA 2JSCA 2GWRA 1TQPA 1TW2A 1S8NA 5E1ZB 5A2QK 3Q9VA 3BJOA 1H0MA 1WI9A 4ENKA 1W5SA 4WF2A 2P4WA 1MJ9A 2MC3A 4A5NA 2EA4A 2STWA 1YG2A 4PGGA 5L3FA 3IWZA 1FC3A 1S7AA 4IPAA 4RGXA 1FP1D 3RJPA 2EWNA 2ETHA 2J5PA 4LG0B 3K2ZA 2F5DA 2ADUA 1IN8A 5JVTA 2HQNA 5FFZA 2JT1A 2DK5A 2M45A 1R1TA 4CHUA 5BPIA 2CYYA 3JSOA 3I4PA 3I71A 2A68F 2PN6A 3QP5A 2ZXJA 2NAZA 4IF4A 3RDIA 3K1MA 4ZZDA 4QWQA 1NHAA 4M9SA 3LWFA 4Q48A 5DUIA 1EH7A 1SAXA 3CUQB 1W7PA 2W25A 4ENJA 3KZZA 2FNPA 3U9GA 3LA3A 4JBAA 3W6KB 5D4RA 2MH2A 2JPCA 2G9WA 5E8IA 3I53A 1D8JA 3T5XA 2VBZA 1ODDA 1Z6TA 2P7VB 2DI3A 2L02A 4EV0A 3D5LA 1I27A 1KQ0A 1GXQA 3HTUA 4B09A 5K5OA 3F8CA 5D8KB 1XN7A 3BWGA 1O3RA 3GLXA 2IT0A 3KP6A 2CG4A 2HYFA 5HDKA 3HUGA 2QYOA 5ICCA 2Y0MA 4IVNA 5LRRA 1GVJA 1BC8C 2FEZA 5FD6A 1RNLA 4IRGA 5DUKA 4ZYEA 1F4KA 1OKRA 3TKYA 2QQ9A 1FBSA 3MEXA 4G6DA 3WTUC 4R8HA 3V7CA 3FF5A 4CZZA 4ASNA 4OMYA 3HOSA 3E6DA 1EH8A 2A61A 4I01A 5L3CA 4UV8A 2DTRA 4UVBA 2HGCA 2DLLA 4P9UA 5E18F 1MDMB 5CLSA 3RPUA 5IT3A 3JSPA 1IZ1A 2ESHA 5BQTA 2GXGA 2QZ8A 2RC4A 4KN7X 4LFUA 4YFXF 1JE8A 4HF1A 1YIOA 3H92A 1O57A 4LGWA 3I0TA 3VFZA 3REOA 2XAJA 5L3EA 1HW2A 2QVOA 3FWEA 1CF7A 2P5KA 3HRMA 2H09A 3K0LA 4M6YA 1USSA 4ZZLA 3CO7C 3MWMA 3JW4A 3BOQA 4PDKA 2G7UA 2K7LA 4GGGA 3FHZA 2RQPA 2VE9A 3WODF 3COAC 3QPHA 3WTYC 3P7NA 5IT9Z 3J80K 2FF4A 3HRTA 3QP6A 6PAXA 4EGYA 3VODA 3LA2A 5KK1A 3ZN1A 4KNYA 1QQIA 5CVJA 1ZGJA 2F2EA 1HW5A 1RI7A 2VBWA 1DPRA 4A2UA 1K78B 5HDGA 1P6RA 1VTNC 5ILVA 2CW0F 1XMAA 3LSTA 3TDZC 5BMZA 1C0WA 1I1GA 2MBFA 2R3SA 1ZH5A 5LHIA 1Z9CA 4RGUA 5J8FA 1I6XA 4KIBA 1B9MA 5D6EA 4TV7A 4BQAA 4MQ9F 1LJ9A 2TDXA 1OYWA 4O6JA 3IKVA 3T8RA 1U2WA 4ZH4F 1GHCA 2AS5F 2XUBA 2EA2A 3W6JB 1UHWA 3SZPA 1EH6A 2KKOA 2PMHA 2H94A 5ICFA 1IXSB 2NYXA 1V3FA 5KVRA 4WXDA 2PBIA 4RB3C 3I5UA 2XROA 3WTSC 4I0AA 2XV4S 2K86A 4KDPA 4RGSA 4LK0F 2HFHA 1ZHFA 2ZNZA 4LD5A 1P92A 3BJ6A 1PP8F 1JHFA 5K5RA 1XMKA 4ZYDA 4EGZA 1BN5A 4KFCA 2D2WA 1KYWA 2EFQA 2PI0A 1XDSA 4HBLA 1R7JA 1U3EM 4Q4ZF 5TRDA 3V4GA 5D5XB 3K1NA 3ZMVA 3RPQA 2K02A 2UWMA 3EDPA 2PEXA 3CO6C 1YW9A 2COMA 3ZQ7A 3QRFF 2DO7A 4A5MA 1FBQA 3I54A 5LBQA 2WC2A 3HTSB 3HOTA 3C18A 2BV6A 1J0RA 3BROA 1IN5A 1YW7A 2Z99A 3E5XA 1JXSA 3WGGA 1F9NA 1AOYA 1JGSA 3GWZA 3CDHA 1ZGAA 3T1BA 2QWWA 2RNJA 3LFKA 3O2PE 3V8KA 2M30A 3FXUA 3RTRA 4WXCA 5HS7A 5FLXZ 2LNBA 2ZMEB 3WE3A 4IHTA 3EUHA 3G3ZA 4LG0A 4MNUA 2DAOA 2KRFA 2JZYA 3KLOA 4LJZF 2VONA 3JAMK 4XRFA 3GFLA 4ETSA 1DPUA 1R1VA 2GA2A 1S6LA 4HDVA 2VODA 1QGPA 1KU3A 1YW8A 4U0WA 4H0EA 2QQBA 1T98A 3E5UA 2RVCA 4YFKF 3CUOA 1HKQA 2VC1A 2HQRA 2XRNA 2WTEA 3OV8A 2QBYB 5LRSA 1TW3A 1WKMA 4CO8A 3CUQA 4HQEA 4AD9A 3WE2A 4Z2YA 5D5VB 2M87A 4CXFA 3ULQB 1WWXA 3L09A 2UXXA 1DDNA 2EV6A 4A6DA 2W84A 2A6EF 2OQGA 3GYHX 1G4DA 5E1XA 3HIFA 4M9XA 5CVUA 1WSUA 4ENNA 4L9VA 3M1EA 4M6XA 4BYYA 1LDJA 1Z05A 2XAQA 1XCVA 5DEQA 2VT3A 4ESBA 2UXNA 4PCQA 1TQMA 1BC7C 3WTVC 4YIIA 1G3YA 2ZCWA 3FX3A 4A12A 2H27A 3KFWX 2M1BA 1G3WA 4EJOA 2IVMA 4HF2A 2D1VA 2L4AA 2EV0A 2O61A 1Z91A 2PMUA 4KICA 2ISZA 4P9FA 3J7AO 1OR7A 4WCGA 4L9JA 5E20A 2RV8A 5ICEA 1U5TC 3HSRA 3WTXC 4OIQF 3TO9A 3TOBA 3KCCA 3TDUC 2FMYA 2DT5A 1MDMA 4ZYHA 1XD7A 1B1BA 1HW1A 1SFUA 3O6BB 3IC7A 1BI1A 2QLZA 4HX4A 4G8XA 2M5WA 2OBPA 3HRUA 4RGRA 3DEUA 4G7HF 1ULYA 1O3SA 4NB5A 4GYIA 4L0YB 5CJ9A 3V8LA 1KU9A 4DQ2A 3MZYA 3C7JA 2DPDA 5F6FA 1OMIA 3F8MA 3OOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O03 A;  1J7K A;  2QM3 A;  2FSW A;  2P5V A;  1YYV A;  3TO6 A;  3MZH A;  2ACJ A;  3GFJ A;  3N4M A;  1IXR C;  4KA4 A;  1O7F A;  3M9A A;  3ECH A;  1J5Y A;  4Q47 A;  3E6B A;  2HR3 A;  2R7D A;  2XAH A;  5CVR A;  2HTJ A;  5DCM B;  2O3F A;  3TQN A;  2Z9O A;  2PFB A;  4JQF A;  1IRF A;  5JFR A;  3F23 A;  3T0Y A;  1K78 A;  4O5V A;  1FOK A;  2Z5U A;  3BJA A;  1DUX C;  5H20 A;  3ABT A;  3IL2 A;  3QU3 A;  3IRR A;  4ESF A;  2E1N A;  3T8T A;  2D45 A;  1SD4 A;  4M73 A;  1BJA A;  5F1R A;  4EM2 A;  2C6Y A;  4DNC A;  3DP7 A;  3ERE D;  4MGR A;  1QPM A;  2OA4 A;  3SFZ A;  3GX4 X;  3E6M A;  1BI2 A;  3IHU A;  3ZN0 A;  1XSD A;  3H3U A;  1XDU A;  2JPB A;  1G3T A;  3KP2 A;  4CGZ A;  3BY6 A;  1UST A;  3KLN A;  4UUV A;  2XAG A;  2VBX A;  4NQW A;  3KET A;  4EJT A;  5L3D A;  3F21 A;  2HDC A;  1LEA A;  4UXN A;  3QPT A;  3R61 A;  4HOB A;  1REP C;  4HYE A;  2E7W A;  1S3J A;  4FHT A;  3SXY A;  3BDD A;  3V8J A;  2JRT A;  3TOA A;  4Q5S F;  4I2O A;  3KP3 A;  3F6O A;  3ML6 A;  4G94 A;  4IRH A;  3J81 K;  3LAJ A;  2LF7 A;  4KMF A;  5LGT A;  3FM5 A;  3N97 A;  3EQL F;  4AIJ A;  1RIO H;  5JHU A;  4QLC U;  3HSE A;  3FZV A;  3P9I A;  3HHG A;  1QZZ A;  3FMR A;  2O8X A;  4B8X A;  3KZY A;  1LEB A;  1I1S A;  4L18 B;  4GO1 A;  2CWE A;  2ZO4 A;  2LSO A;  1A04 A;  2NNN A;  4HZF A;  1LVA A;  3MFK A;  2E1C A;  4KYW A;  3L00 A;  4HV5 A;  4UVA A;  2G7H A;  4Y17 A;  3M8F A;  2XAS A;  1FPQ A;  2P7C B;  1IW7 F;  1BI0 A;  5FB2 A;  4XBF A;  2RGV A;  5E8G A;  2IP2 A;  3I58 A;  3ZPL A;  4EM1 A;  2EFO A;  4UVC A;  2XKP A;  2CGP A;  2OU2 A;  4LB5 A;  4G7O F;  3ABU A;  1FLI A;  2ZME A;  2KIU A;  2DU9 A;  1R5G A;  2V1X A;  2YSR A;  3FMS A;  4BH9 A;  3WU1 B;  1TNS A;  2MLK A;  5FD5 A;  2ELH A;  2ZNY A;  2FQ3 A;  4BAY A;  3V7S A;  5F64 A;  4I0B A;  1MZB A;  4ZYG A;  3GW2 A;  3PQJ A;  1J59 A;  2Y75 A;  3GVA A;  2QBY A;  5JI6 A;  1ZRC A;  3GZ6 A;  4OIN F;  3RKX A;  2CSO A;  5HVQ C;  4BHB A;  3DFG A;  1IXC A;  2GIV A;  2IA0 A;  1MJB A;  2FA5 A;  5J6X A;  2M8E A;  1B59 A;  2BBY A;  4BHC A;  1ON1 A;  1ZLJ A;  4EM0 B;  5HS9 A;  1HST A;  3MQ0 A;  4ON0 A;  4K2E A;  4YIF A;  1CGP A;  1MJA A;  2FU4 A;  1KQ9 A;  4HX8 A;  5A2Q Z;  4P96 A;  3TGN A;  1L0O C;  2F5F A;  1IN7 A;  2VN2 A;  3TO7 A;  4MHG A;  5ICG A;  2FBH A;  4U88 A;  1H9T A;  2DQL A;  2Y48 A;  2IJL A;  4XLN F;  4RB0 A;  1E17 A;  1HKS A;  4N9I A;  5HDN A;  2O6G E;  2VE8 A;  4ENM A;  5J8C A;  1P4X A;  3WU0 A;  3E5Q A;  4GYG A;  1G3S A;  2FNA A;  2KIM A;  3RKW A;  3SHF A;  3KE2 A;  3F3X A;  3WGH A;  1UCR A;  1LNW A;  5CVV A;  5FGM A;  2RKH A;  3P9C A;  1OYY A;  1T6S A;  4OU0 A;  1ZAO A;  1T0F A;  1P4A A;  1XCB A;  4KUM A;  4RS8 A;  1R36 A;  3E6C C;  1T39 A;  2WV0 A;  1IAW A;  1IF1 A;  2DK8 A;  1FSE A;  1J75 A;  2H6B A;  1R23 A;  1KGS A;  3GZ5 A;  4NHJ A;  1U8R A;  1B4A A;  5LEJ A;  4M71 A;  4MEX F;  4XSZ F;  1OPC A;  1BIA A;  4WK8 F;  1WRJ A;  5ILU A;  3WTZ A;  4KIG A;  1XB4 A;  1IN4 A;  3HHH A;  4HV6 A;  2LDU A;  1D3Y A;  3VEP A;  4U0V A;  2RDP A;  1U5T B;  4KIF A;  4N9H A;  1OYI A;  1FY7 A;  1ON2 A;  5JR3 A;  1KQ8 A;  3R0J A;  4EVI A;  2V79 A;  5DCM A;  4XSX F;  1KU2 A;  1SFX A;  2QUF A;  2FBI A;  2PG4 A;  3I59 B;  3EYY A;  1BBY A;  3M8E A;  4AIH A;  5DV5 A;  2HKO A;  2PQ8 A;  5IT9 K;  5HLH A;  2VC0 A;  2Z3Y A;  4AIK A;  2FXA A;  2V1U A;  1IRG A;  4KMU X;  1FT9 A;  1BM9 A;  3ROU A;  1YS7 A;  4HA8 A;  5DD4 A;  4A0X A;  1SMT A;  1YFH A;  1UFM A;  1YLF A;  1RZ4 A;  5K1Y A;  4RB1 A;  5H6R A;  1Q1H A;  3BPV A;  3RIR A;  2XKO A;  1FNN A;  3L9F A;  3FXR A;  2XAF A;  3PQK A;  1TLH B;  3HRS A;  4FT8 A;  2OQR A;  1X3U A;  4OIP F;  1ONV A;  1EV7 A;  3H3Z A;  2IW5 A;  1TBX A;  3JTG A;  2YR2 A;  3R60 A;  2P6T A;  1XGM A;  3MCZ A;  3P9K A;  5CYV A;  3GXO A;  4L5J A;  2A3S A;  2HYG D;  3FM3 A;  3J80 Z;  4KT5 C;  1SMY F;  4MEY F;  3O3K A;  2GZW A;  1B9N A;  4RB2 C;  3K1P A;  1ZRF A;  2HWV A;  3V7R A;  2P8T A;  5E17 F;  4PZJ A;  2IA1 A;  3WTW C;  1ZAR A;  5D5W B;  2PLY A;  1ZYR F;  1O3T A;  1P4W A;  4XLP F;  2UZK A;  2EV5 A;  3EYI A;  4FX0 A;  3BPX A;  2KIF A;  4L9T A;  3NQO A;  3EET A;  3SQN A;  1ZRD A;  4YFN F;  3G73 A;  2L54 A;  2GA1 A;  4D0P A;  1HBX G;  1TNT A;  1BIB A;  5FO5 A;  3HSF A;  3HYI A;  2ESN A;  3KP7 A;  1BI3 A;  3ZMZ A;  4G7Z F;  2VBY A;  1FBU A;  3ISP A;  4PGH A;  5LEK A;  2FML A;  1WQ2 A;  2H6C A;  4AWX B;  1J9I A;  3DF8 A;  2OZU A;  3JTH A;  2DFI A;  4U7D A;  4WX9 A;  2V1D A;  2VOP A;  1FSH A;  3K69 A;  1I5Z A;  2XIG A;  4FX4 A;  1UB9 A;  4UHT A;  2GAU A;  1HXD A;  1LQ1 A;  4UNO A;  3DKW A;  2EJR A;  5LHH A;  2W24 A;  2IA2 A;  3KP4 A;  5FLX K;  3C3W A;  3ZMT A;  1XSX A;  5HS8 A;  4G6Q A;  1ZG5 A;  1R22 A;  3U1D A;  4OOI A;  3L7W A;  1KYZ A;  1XGN A;  1PUE E;  4RAZ A;  1L3L A;  4ESJ A;  1Z7U A;  5L3B A;  1ZG1 A;  4S05 A;  5BPD A;  5D6F A;  2AXL A;  1TQI A;  1KU7 A;  4Y13 A;  2LF8 A;  4BHP A;  4N0B A;  3I64 A;  5HLI A;  3KP5 A;  3LA7 A;  4O3M A;  2MD5 A;  1R1U A;  3C1D A;  2L3D A;  1Y0U A;  2MA3 A;  1SFE A;  4BXU A;  2A6H F;  2V9V A;  1HKT A;  3IRQ A;  4A0Z A;  1QBJ A;  3ZMD A;  1DP7 P;  3PFI A;  2GXB A;  2CQK A;  5ERI A;  4BNC A;  2F5E A;  5EEG A;  4MTD A;  1O7L A;  4M9Z A;  4LMY A;  1U78 A;  1STZ A;  2VOO A;  4HLX A;  4RAY A;  1H9G A;  4LK1 F;  4IJA A;  3E97 A;  2ZBK A;  4MQV A;  2BE5 F;  3F8N A;  2A5Y B;  1R00 A;  4LB6 B;  4I7H A;  5D5U B;  3F22 A;  1MKM A;  1O3Q A;  3LAP A;  5LGN A;  5DYM A;  2XGX A;  1R58 A;  3CUQ C;  4EQQ A;  2OAZ A;  3U2R A;  2WWY A;  2OZ6 A;  4I98 B;  2HEO A;  5DDG A;  1QNT A;  3LQR A;  4AVP A;  3JAM Z;  2Q2E A;  3R0A A;  3D0S A;  1PDN C;  1QZY A;  2ZKZ A;  1UHM A;  1FYL A;  2NRA C;  3NEU A;  2YX7 A;  4YG2 F;  3BP8 A;  3DQV C;  3MAJ A;  4R1H A;  4HQM A;  1J2X A;  1D8K A;  3IWF A;  2MH9 A;  1S29 A;  4CDG A;  4HAM A;  2X4H A;  3IKT A;  3ECO A;  3WG9 A;  3RYP A;  1YTY A;  5DD8 A;  5AIQ A;  2LKP A;  4IRI A;  2FOK A;  2BGC A;  1P2F A;  3DPT A;  3DPL C;  1K79 A;  5ED4 A;  1SD7 A;  5TJJ A;  2A69 F;  3GFI A;  4WXH A;  3R4K A;  2Q8K A;  4EJW A;  3R6S A;  1U5T A;  1E2X A;  3RYR A;  1B6A A;  1W7P B;  1FX7 A;  4OIO F;  1FP2 A;  1LB2 A;  1K6O A;  4G9Y A;  2L4M A;  4HW0 A;  1ZLK A;  5CVI A;  4GXO A;  2HKX A;  2DQR A;  3CTA A;  2IPQ X;  5D8L B;  3I59 A;  3F8B A;  4IHS A;  4UV9 A;  1LDK B;  2DPU A;  3ZP5 A;  1RUN A;  1FWZ A;  1MD0 A;  4E70 A;  4EJU A;  5FFX A;  1W7P D;  4CIC A;  2KJB A;  3GF2 A;  1F5T A;  3GEZ A;  3KEQ A;  4U7B A;  5LHG A;  1SD5 A;  2B0L A;  2GQQ A;  3VB2 A;  3CJN A;  3GUD A;  2CO5 A;  1Z6R A;  1HQC A;  2W85 A;  1PP7 U;  2BYV E;  5LLQ A;  2YX4 A;  3DV8 A;  2Z33 A;  1D5V A;  2ISY A;  3VOE A;  1BOA A;  1YS6 A;  1HSJ A;  3WTT C;  2HTS A;  1RUO A;  4JK1 X;  3CLO A;  2BEO A;  3Q9S A;  4S04 A;  5HLG A;  1KA8 A;  5LGU A;  2QQA A;  3Q5F A;  2KJC A;  2DBB A;  1R5H A;  3F72 A;  1W4M A;  4P55 A;  5DCF A;  1CF7 B;  2W57 A;  4M72 A;  1XGS A;  2JTV A;  1LDD A;  2VT2 A;  3ZMU A;  1IN6 A;  5L3G A;  1G6N A;  2EFW A;  1ZN2 A;  2OD5 A;  2ZFW A;  5BS6 A;  1ZRE A;  2VXZ A;  2K4J A;  2NS0 A;  4LLL A;  2FBK A;  4GCV A;  5H6Q A;  5ILS A;  1XGO A;  5BOX A;  3F6V A;  2EFP A;  4P5O A;  2Q0O A;  4WWC A;  2HOE A;  3ELK A;  2IRF G;  1MGT A;  2E7X A;  1ZG3 A;  1FZP B;  1FYK A;  3FMQ A;  1IUY A;  4HX7 A;  3SZT A;  2J5O A;  1TTY A;  3E3V A;  3LQQ A;  5K5Q A;  2CFX A;  2RN7 A;  1K7A A;  3F8F A;  5E1W A;  3DXJ F;  4CYD A;  2ZJ2 A;  4L0Z B;  4KN4 X;  1F1Z A;  2DW4 A;  2FRH A;  1YQA A;  2XHK A;  2P5L C;  4LLN A;  1QO0 D;  2STT A;  4OMZ A;  4A0Y A;  3FXQ A;  2YPR A;  1XSV A;  2NNY A;  2D1H A;  4U0Y A;  3KEO A;  1W5T A;  2HS5 A;  4EJV A;  4MTE A;  5D4S A;  3RKY A;  4I09 A;  1U6G A;  5AIP A;  2FE3 A;  2X0L A;  4OIR F;  4Y15 A;  3AAF A;  3B02 A;  4IXA A;  1S7O A;  4L5I A;  2MLG A;  3J81 Z;  1T38 A;  3ZMS A;  3GFM A;  4LLG F;  5EEH A;  1T2K A;  4I02 A;  3L2C A;  2EB7 A;  3QU6 A;  2A07 F;  2K27 A;  1V4R A;  3K9T A;  3NRV A;  5AON A;  2HZT A;  2QEN A;  2P6S A;  2EFN A;  3GO5 A;  4HF0 A;  1SD6 A;  2EK5 A;  2K4B A;  3S2W A;  1AWC A;  3QOP A;  2F5C A;  4L9N A;  3WGI A;  2YU3 A;  1FYM A;  2O0Y A;  3BZ6 A;  5HOO A;  1GXP A;  4A6E A;  1Z1D A;  4M74 A;  1YO5 C;  2V6C A;  3B73 A;  3RI4 A;  2R7F A;  2PJP A;  4HDU A;  4HLY A;  2XVC A;  3QAH A;  4EMS A;  4R79 A;  1JHH A;  2L01 A;  3M7G A;  4F7Z A;  2JSC A;  2GWR A;  1TQP A;  1TW2 A;  1S8N A;  5E1Z B;  5A2Q K;  3Q9V A;  3BJO A;  1H0M A;  1WI9 A;  4ENK A;  1W5S A;  4WF2 A;  2P4W A;  1MJ9 A;  2MC3 A;  4A5N A;  2EA4 A;  2STW A;  1YG2 A;  4PGG A;  5L3F A;  3IWZ A;  1FC3 A;  1S7A A;  4IPA A;  4RGX A;  1FP1 D;  3RJP A;  2EWN A;  2ETH A;  2J5P A;  4LG0 B;  3K2Z A;  2F5D A;  2ADU A;  1IN8 A;  5JVT A;  2HQN A;  5FFZ A;  2JT1 A;  2DK5 A;  2M45 A;  1R1T A;  4CHU A;  5BPI A;  2CYY A;  3JSO A;  3I4P A;  3I71 A;  2A68 F;  2PN6 A;  3QP5 A;  2ZXJ A;  2NAZ A;  4IF4 A;  3RDI A;  3K1M A;  4ZZD A;  4QWQ A;  1NHA A;  4M9S A;  3LWF A;  4Q48 A;  5DUI A;  1EH7 A;  1SAX A;  3CUQ B;  1W7P A;  2W25 A;  4ENJ A;  3KZZ A;  2FNP A;  3U9G A;  3LA3 A;  4JBA A;  3W6K B;  5D4R A;  2MH2 A;  2JPC A;  2G9W A;  5E8I A;  3I53 A;  1D8J A;  3T5X A;  2VBZ A;  1ODD A;  1Z6T A;  2P7V B;  2DI3 A;  2L02 A;  4EV0 A;  3D5L A;  1I27 A;  1KQ0 A;  1GXQ A;  3HTU A;  4B09 A;  5K5O A;  3F8C A;  5D8K B;  1XN7 A;  3BWG A;  1O3R A;  3GLX A;  2IT0 A;  3KP6 A;  2CG4 A;  2HYF A;  5HDK A;  3HUG A;  2QYO A;  5ICC A;  2Y0M A;  4IVN A;  5LRR A;  1GVJ A;  1BC8 C;  2FEZ A;  5FD6 A;  1RNL A;  4IRG A;  5DUK A;  4ZYE A;  1F4K A;  1OKR A;  3TKY A;  2QQ9 A;  1FBS A;  3MEX A;  4G6D A;  3WTU C;  4R8H A;  3V7C A;  3FF5 A;  4CZZ A;  4ASN A;  4OMY A;  3HOS A;  3E6D A;  1EH8 A;  2A61 A;  4I01 A;  5L3C A;  4UV8 A;  2DTR A;  4UVB A;  2HGC A;  2DLL A;  4P9U A;  5E18 F;  1MDM B;  5CLS A;  3RPU A;  5IT3 A;  3JSP A;  1IZ1 A;  2ESH A;  5BQT A;  2GXG A;  2QZ8 A;  2RC4 A;  4KN7 X;  4LFU A;  4YFX F;  1JE8 A;  4HF1 A;  1YIO A;  3H92 A;  1O57 A;  4LGW A;  3I0T A;  3VFZ A;  3REO A;  2XAJ A;  5L3E A;  1HW2 A;  2QVO A;  3FWE A;  1CF7 A;  2P5K A;  3HRM A;  2H09 A;  3K0L A;  4M6Y A;  1USS A;  4ZZL A;  3CO7 C;  3MWM A;  3JW4 A;  3BOQ A;  4PDK A;  2G7U A;  2K7L A;  4GGG A;  3FHZ A;  2RQP A;  2VE9 A;  3WOD F;  3COA C;  3QPH A;  3WTY C;  3P7N A;  5IT9 Z;  3J80 K;  2FF4 A;  3HRT A;  3QP6 A;  6PAX A;  4EGY A;  3VOD A;  3LA2 A;  5KK1 A;  3ZN1 A;  4KNY A;  1QQI A;  5CVJ A;  1ZGJ A;  2F2E A;  1HW5 A;  1RI7 A;  2VBW A;  1DPR A;  4A2U A;  1K78 B;  5HDG A;  1P6R A;  1VTN C;  5ILV A;  2CW0 F;  1XMA A;  3LST A;  3TDZ C;  5BMZ A;  1C0W A;  1I1G A;  2MBF A;  2R3S A;  1ZH5 A;  5LHI A;  1Z9C A;  4RGU A;  5J8F A;  1I6X A;  4KIB A;  1B9M A;  5D6E A;  4TV7 A;  4BQA A;  4MQ9 F;  1LJ9 A;  2TDX A;  1OYW A;  4O6J A;  3IKV A;  3T8R A;  1U2W A;  4ZH4 F;  1GHC A;  2AS5 F;  2XUB A;  2EA2 A;  3W6J B;  1UHW A;  3SZP A;  1EH6 A;  2KKO A;  2PMH A;  2H94 A;  5ICF A;  1IXS B;  2NYX A;  1V3F A;  5KVR A;  4WXD A;  2PBI A;  4RB3 C;  3I5U A;  2XRO A;  3WTS C;  4I0A A;  2XV4 S;  2K86 A;  4KDP A;  4RGS A;  4LK0 F;  2HFH A;  1ZHF A;  2ZNZ A;  4LD5 A;  1P92 A;  3BJ6 A;  1PP8 F;  1JHF A;  5K5R A;  1XMK A;  4ZYD A;  4EGZ A;  1BN5 A;  4KFC A;  2D2W A;  1KYW A;  2EFQ A;  2PI0 A;  1XDS A;  4HBL A;  1R7J A;  1U3E M;  4Q4Z F;  5TRD A;  3V4G A;  5D5X B;  3K1N A;  3ZMV A;  3RPQ A;  2K02 A;  2UWM A;  3EDP A;  2PEX A;  3CO6 C;  1YW9 A;  2COM A;  3ZQ7 A;  3QRF F;  2DO7 A;  4A5M A;  1FBQ A;  3I54 A;  5LBQ A;  2WC2 A;  3HTS B;  3HOT A;  3C18 A;  2BV6 A;  1J0R A;  3BRO A;  1IN5 A;  1YW7 A;  2Z99 A;  3E5X A;  1JXS A;  3WGG A;  1F9N A;  1AOY A;  1JGS A;  3GWZ A;  3CDH A;  1ZGA A;  3T1B A;  2QWW A;  2RNJ A;  3LFK A;  3O2P E;  3V8K A;  2M30 A;  3FXU A;  3RTR A;  4WXC A;  5HS7 A;  5FLX Z;  2LNB A;  2ZME B;  3WE3 A;  4IHT A;  3EUH A;  3G3Z A;  4LG0 A;  4MNU A;  2DAO A;  2KRF A;  2JZY A;  3KLO A;  4LJZ F;  2VON A;  3JAM K;  4XRF A;  3GFL A;  4ETS A;  1DPU A;  1R1V A;  2GA2 A;  1S6L A;  4HDV A;  2VOD A;  1QGP A;  1KU3 A;  1YW8 A;  4U0W A;  4H0E A;  2QQB A;  1T98 A;  3E5U A;  2RVC A;  4YFK F;  3CUO A;  1HKQ A;  2VC1 A;  2HQR A;  2XRN A;  2WTE A;  3OV8 A;  2QBY B;  5LRS A;  1TW3 A;  1WKM A;  4CO8 A;  3CUQ A;  4HQE A;  4AD9 A;  3WE2 A;  4Z2Y A;  5D5V B;  2M87 A;  4CXF A;  3ULQ B;  1WWX A;  3L09 A;  2UXX A;  1DDN A;  2EV6 A;  4A6D A;  2W84 A;  2A6E F;  2OQG A;  3GYH X;  1G4D A;  5E1X A;  3HIF A;  4M9X A;  5CVU A;  1WSU A;  4ENN A;  4L9V A;  3M1E A;  4M6X A;  4BYY A;  1LDJ A;  1Z05 A;  2XAQ A;  1XCV A;  5DEQ A;  2VT3 A;  4ESB A;  2UXN A;  4PCQ A;  1TQM A;  1BC7 C;  3WTV C;  4YII A;  1G3Y A;  2ZCW A;  3FX3 A;  4A12 A;  2H27 A;  3KFW X;  2M1B A;  1G3W A;  4EJO A;  2IVM A;  4HF2 A;  2D1V A;  2L4A A;  2EV0 A;  2O61 A;  1Z91 A;  2PMU A;  4KIC A;  2ISZ A;  4P9F A;  3J7A O;  1OR7 A;  4WCG A;  4L9J A;  5E20 A;  2RV8 A;  5ICE A;  1U5T C;  3HSR A;  3WTX C;  4OIQ F;  3TO9 A;  3TOB A;  3KCC A;  3TDU C;  2FMY A;  2DT5 A;  1MDM A;  4ZYH A;  1XD7 A;  1B1B A;  1HW1 A;  1SFU A;  3O6B B;  3IC7 A;  1BI1 A;  2QLZ A;  4HX4 A;  4G8X A;  2M5W A;  2OBP A;  3HRU A;  4RGR A;  3DEU A;  4G7H F;  1ULY A;  1O3S A;  4NB5 A;  4GYI A;  4L0Y B;  5CJ9 A;  3V8L A;  1KU9 A;  4DQ2 A;  3MZY A;  3C7J A;  2DPD A;  5F6F A;  1OMI A;  3F8M A;  3OOP A; 
#chains in the Genus database with same CATH topology
 2F48 A;  2O03 A;  1J7K A;  3CLQ A;  2QM3 A;  1HDD C;  2FSW A;  2P5V A;  2KRH A;  1IG7 A;  3L2W A;  4ZDO A;  1YYV A;  3TO6 A;  3MZH A;  3IP4 B;  4ANJ A;  1TWC J;  4IHV A;  2WB1 N;  2ACJ A;  3JR9 A;  3GZN B;  3GFJ A;  1Z77 A;  4HG2 A;  3N4M A;  1IXR C;  4KA4 A;  2E60 A;  1VQ9 I;  1O7F A;  1W0U A;  3HJE A;  3M9A A;  3OSF A;  3ECH A;  1J5Y A;  3J7Z I;  4Q47 A;  3E6B A;  2HR3 A;  3H36 A;  2R7D A;  2XAH A;  2WAQ A;  2X6Y A;  3DPU A;  5CVR A;  2HTJ A;  5DCM B;  2ZC2 A;  2B63 J;  1ETW A;  2O3F A;  3TQN A;  2L9V A;  2Z9O A;  4A3L J;  2PFB A;  2AXT C;  1MND A;  4JQF A;  3FKI J;  1IRF A;  5JFR A;  3F23 A;  4V2F A;  3SDB A;  3T0Y A;  4D1Q A;  3B6C A;  1K78 A;  4O5V A;  3VWB A;  1FOK A;  3BZK A;  2Z5U A;  3BJA A;  1EA3 A;  2EZL A;  3GBG A;  1DUX C;  5H20 A;  3ABT A;  3IL2 A;  3QU3 A;  3IRR A;  4IKF A;  2OV7 A;  4ESF A;  2E1N A;  4BDZ A;  4CCO A;  4KIS A;  1UEL B;  3T8T A;  2D45 A;  3MKZ A;  3OMY A;  1MIJ A;  4C2U A;  1SD4 A;  4M73 A;  2X1D A;  2LMD A;  1BJA A;  1YX5 A;  5F1R A;  1D0Z A;  3K70 D;  1RR7 A;  2WY8 Q;  4EM2 A;  4CZC A;  2C6Y A;  4DNC A;  3DP7 A;  4IX7 A;  1NTC A;  3ERE D;  3BG6 A;  2WY7 Q;  4MGR A;  1QPM A;  2OA4 A;  4U87 A;  2MAB A;  3J7A Y;  3SFZ A;  1BL0 A;  1T08 B;  3E6M A;  3GX4 X;  1BI2 A;  3IHU A;  3ZN0 A;  1XSD A;  3H3U A;  2O7O A;  1MBF A;  1XDU A;  4A3E J;  2JPB A;  4XKC A;  1G3T A;  1MBE A;  3KP2 A;  2HDW A;  4CGZ A;  3I4M J;  2LFB A;  2LVS A;  2O5R A;  3BY6 A;  1QRY A;  4XID A;  2ZJR F;  4JX6 A;  4XRM A;  2L0K A;  1UST A;  3KLN A;  5F27 A;  3FXJ A;  1VND A;  4UUV A;  2KIQ A;  2N8G A;  2XAG A;  2VBX A;  1A6I A;  2XSJ C;  2CW7 A;  4NQW A;  4XKB A;  3KET A;  4EJT A;  2R7Z J;  5L3D A;  3D5S C;  3F21 A;  1TWA J;  1BR1 A;  1IJW C;  2X6O A;  2HDC A;  1LEA A;  2WAD A;  4UXN A;  3QPT A;  1QVU A;  3HB9 A;  1LFB A;  2JMW A;  3X2Q H;  3QOD A;  3R61 A;  4C2M J;  4HOB A;  1REP C;  4HYE A;  1SFO J;  2E7W A;  3OYK A;  1S3J A;  3H5R A;  4FHT A;  4PJL A;  3SXY A;  3BDD A;  2BHZ A;  2JRT A;  3TOA A;  3V8J A;  1WZ2 A;  1YE9 A;  3BT9 A;  4I2O A;  4HNU A;  4Q5S F;  3KP3 A;  4DZJ A;  1BR2 A;  2BHY A;  3HOZ J;  4DW6 A;  3F6O A;  3ML6 A;  4G94 A;  1N75 A;  4IRH A;  3J81 K;  2RNG A;  2HZD A;  1Y1W J;  3A0B C;  3LAJ A;  2LF7 A;  4KMF A;  5LGT A;  3C2G A;  1YRN A;  1XX5 A;  4G12 A;  4FAS D;  3FM5 A;  2NS8 A;  3GME A;  3N97 A;  1K83 J;  3EQL F;  4AIJ A;  4HPQ A;  1RIO H;  3AG1 H;  5JHU A;  4QLC U;  4II2 A;  2DDA A;  3HSE A;  3FZV A;  2X1C A;  4B3X A;  2Y9Y A;  3ABL H;  3P9I A;  4RBO A;  3W2A A;  4PJ0 C;  5GPC A;  1HA8 A;  1UG0 A;  3S3O A;  4M3G A;  3HHG A;  2BW3 A;  2GM4 A;  1QZZ A;  2MSY A;  2O8X A;  3FMR A;  3KZY A;  4B8X A;  2M2E A;  1LEB A;  1I1S A;  4IHY A;  4L18 B;  4BDY A;  2X6X A;  4XIC A;  2JVG A;  1LE8 A;  4GO1 A;  2CWE A;  2ZO4 A;  2LSO A;  1A04 A;  2CS3 A;  2NNN A;  4HZF A;  1LVA A;  3MFK A;  1IV6 A;  2E1C A;  4KYW A;  3S15 J;  3L00 A;  2M34 A;  2M4G A;  2XF7 A;  4HV5 A;  2E5Z A;  1NK2 P;  4UVA A;  1FTZ A;  3H3V K;  2MFZ A;  1DGW Y;  1OIS A;  2G7H A;  1UHS A;  3OYL A;  4M6V A;  3HGY A;  4D5F A;  1ETX A;  1I50 J;  3G1M A;  3M8F A;  4Y17 A;  2XAS A;  1XTA A;  3J7Y J;  2FJ1 A;  4OAY A;  1FPQ A;  2P7C B;  2RRE A;  2JRM A;  3GTM J;  1QA6 A;  1IW7 F;  1BI0 A;  3CP2 A;  4BXX J;  5FB2 A;  4XBF A;  4E7L A;  2RGV A;  5E8G A;  4XN0 A;  2IP2 A;  1B72 B;  3I58 A;  4UUT A;  3ZPL A;  2DOF A;  4EM1 A;  2EFO A;  1H88 C;  1H8A C;  2GOM A;  4UVC A;  2IGN A;  2XKP A;  4RMN A;  2DFH A;  2CGP A;  3BCB A;  5C4J J;  3HOW J;  2OU2 A;  4LB5 A;  1XPX A;  1FIP A;  4BE2 A;  4G7O F;  1ZKG A;  1G2H A;  3ABU A;  5HOD A;  1FLI A;  2ZME A;  2KIU A;  2DU9 A;  3OIP A;  1R5G A;  2V1X A;  1A5J A;  2YSR A;  3BQY A;  1LPQ A;  2L7Z A;  3FMS A;  1QHG A;  4BH9 A;  3WU1 B;  2DFF A;  2ME0 A;  1FMW A;  2NVX J;  1TNS A;  1JKO C;  1Z67 A;  1VQL I;  2MLK A;  2E1M B;  1NH3 A;  5FD5 A;  2ELH A;  3OYD A;  1UAA A;  4BEH B;  1VQ4 I;  2HXI A;  2ZNY A;  3MMY B;  2VL8 A;  3CC4 I;  2W00 A;  2FQ3 A;  3K7A J;  3RQ4 A;  4BAY A;  3ESW B;  5F04 A;  3V7S A;  5FKL A;  4CH7 A;  5F64 A;  3P5J A;  3CCU I;  4I0B A;  1MZB A;  4ZYG A;  3GW2 A;  3PQJ A;  4PJN A;  1BW6 A;  1J59 A;  2Y75 A;  3QYB A;  3GVA A;  2QBY A;  5JI6 A;  1ZRC A;  3GZ6 A;  4OIN F;  2E34 A;  3RKX A;  2CSO A;  2EIK H;  2QSF X;  2LKX A;  5HVQ C;  2DXI A;  5JHF A;  4FTH A;  3CC7 I;  4MLO A;  2HI3 A;  4BHB A;  3DFG A;  1IXC A;  2GIV A;  2IA0 A;  3H0G J;  2K9M A;  1MJB A;  2FA5 A;  5J6X A;  2M8E A;  1GV2 A;  1B59 A;  2BBY A;  4BHC A;  1ON1 A;  3FK6 A;  1ZLJ A;  2KP6 A;  4EM0 B;  2IAI A;  5HS9 A;  2K9S A;  1HST A;  2CU7 A;  4XOT A;  3C2B A;  3MQ0 A;  4ON0 A;  4K2E A;  4YIF A;  3CMA I;  4FE4 A;  1BJZ A;  1CGP A;  2V7F A;  2VQG A;  3CF5 F;  2VQH A;  1MJA A;  2FU4 A;  4NC8 A;  4C3I J;  1KQ9 A;  4HX8 A;  5A2Q Z;  2E5N A;  1R6R A;  4P96 A;  3TGN A;  1K4T A;  1APL C;  2XGD A;  2L7M P;  2XB5 A;  1L0O C;  1V5G A;  3FKJ A;  3Q3S A;  3CZ6 A;  2VKE A;  2F5F A;  3PNT A;  3L2Q A;  1U0J A;  3BC8 A;  4A3M J;  1IN7 A;  2DYS H;  2DN0 A;  2VN2 A;  4W1U A;  3TO7 A;  3M4O J;  4MHG A;  2VIX A;  5M3M J;  1MBJ A;  3CCQ I;  2I8D A;  5ICG A;  1QHH D;  3H1C A;  5FLM J;  2FBH A;  2X85 A;  4U88 A;  1H9T A;  3AFH A;  2DQL A;  2Y48 A;  2IJL A;  5GAH J;  5E3M A;  4XLN F;  2GBY A;  4RB0 A;  1E17 A;  4A3G J;  2R5Y B;  1HKS A;  4N9I A;  2ELK A;  4PK4 A;  5HDN A;  2W48 A;  2O6G E;  2E2I J;  4IOA F;  2VE8 A;  4ENM A;  3K4B A;  1D5Y A;  5J8C A;  1P4X A;  3WU0 A;  2I10 A;  1HLV A;  3E5Q A;  2V4J C;  4BBR J;  1R4M B;  4GYG A;  3UNG C;  1G3S A;  2FNA A;  2KIM A;  2Q2E B;  3RKW A;  5DS9 A;  3SHF A;  3KE2 A;  2F4O B;  2I5U A;  4UB6 C;  3F3X A;  3WGH A;  1UCR A;  1LNW A;  3ZR8 X;  5CVV A;  5FGM A;  5GAD J;  2RKH A;  3P9C A;  2R5Z A;  1OYY A;  3A4C A;  1T6S A;  4OU0 A;  1SVM A;  1ZAO A;  1T0F A;  3I4N J;  1RPW A;  1AHD P;  1P4A A;  1XCB A;  5DM7 F;  4CYC B;  3H0D A;  4KUM A;  4RS8 A;  2LBF A;  1R36 A;  3E6C C;  1T39 A;  1X4O A;  2WV0 A;  3RZO J;  1ZK8 A;  1JKQ C;  2EZH A;  2KRC A;  4XON A;  1IAW A;  2BY0 A;  3AG3 H;  1IF1 A;  2DK8 A;  1FSE A;  1J75 A;  2H6B A;  1R23 A;  5FRN A;  1KGS A;  3GZ5 A;  2QGU A;  3LL7 A;  4NHJ A;  5EGO A;  1U8R A;  1B4A A;  1JUM A;  1X1P A;  3ABM H;  2CQ7 A;  2COB A;  4RM3 A;  4M71 A;  5CPR B;  5LEJ A;  4MEX F;  2IBD A;  4XSZ F;  3WG7 H;  3ASN H;  1OPC A;  2XC7 A;  1BIA A;  4WK8 F;  1WRJ A;  2PMZ A;  5ILU A;  3WTZ A;  3CMY A;  4KIG A;  1XB4 A;  2O8K A;  1ENH A;  1IN4 A;  3LNQ A;  3HHH A;  4DYR A;  4HV6 A;  2LDU A;  5LFA A;  3TL4 X;  4AID A;  1D3Y A;  2KL4 A;  3VEP A;  2DMP A;  2NS7 A;  4U0V A;  5HNF A;  2RDP A;  3F9K A;  1U5T B;  2V6E A;  2O9L A;  3A02 A;  4KIF A;  1LFU P;  4N9H A;  4E7K A;  1OYI A;  1FY7 A;  1ON2 A;  3OL4 A;  2YUS A;  2OC6 A;  3OWT A;  5JR3 A;  1KQ8 A;  1V5E A;  3R0J A;  1WHU A;  3EUK L;  3HOV J;  4MFD A;  3BTJ A;  4EVI A;  2V79 A;  5DCM A;  4XSX F;  4A93 J;  1KU2 A;  1R9T J;  1SFX A;  3S1R J;  2QUF A;  1I3Q J;  4MO7 A;  2FBI A;  2PG4 A;  4I6Z A;  5FLV A;  3I59 B;  3EYY A;  1BBY A;  3M8E A;  2IGM A;  1MMS A;  2GIZ A;  4AIH A;  5DV5 A;  1HOM A;  2JA5 J;  2HKO A;  2PQ8 A;  5IT9 K;  5HLH A;  3AL0 B;  2VC0 A;  3KYC B;  2Z3Y A;  4AIK A;  5CQG A;  3PNV A;  1VQM I;  2EQR A;  3BQZ A;  2FXA A;  2V1U A;  1IRG A;  4KMU X;  4J01 A;  1FT9 A;  3H9J A;  1BM9 A;  2JVH A;  1YS7 A;  3ROU A;  4FIS A;  4HA8 A;  5DD4 A;  1GT0 C;  2CV2 A;  4A0X A;  2PMZ N;  3G4S I;  2IS1 A;  4I76 A;  1TWG J;  1FJL A;  1SMT A;  1YFH A;  1UFM A;  4LIT A;  1YLF A;  1RZ4 A;  2R7R A;  1OCC H;  2OJE D;  4RA2 A;  3W2W A;  1VQ8 I;  4ITV A;  1BA5 A;  3OYH A;  2TCT A;  1IDZ A;  5K1Y A;  4RB1 A;  5H6R A;  1Q1H A;  3BPV A;  3RIR A;  2XKO A;  4OWR B;  3GLL A;  3F0C A;  2CQN A;  1TZL A;  1DGR M;  1FNN A;  3L9F A;  3FXR A;  3LOC A;  2XAF A;  3PQK A;  2H1L A;  2JWT A;  1VQ6 I;  1TLH B;  3HRS A;  4FT8 A;  1FOW A;  2OQR A;  3HM5 A;  3DLA A;  1X3U A;  4AYB A;  1UZC A;  3G71 I;  4OIP F;  1ONV A;  1EV7 A;  2LRD A;  1TWF J;  3H3Z A;  2Z16 A;  2IW5 A;  2YS9 A;  2HYJ A;  1TBX A;  3JTG A;  2YR2 A;  3R60 A;  2R7S A;  4FET A;  1IRZ A;  2P6T A;  1XGM A;  3H9G A;  2EBI A;  1MSE C;  2DCE A;  3MCZ A;  3P9K A;  3MKW B;  3U21 A;  1Q1V A;  4IOC F;  5C4X J;  2HOS A;  3JRE A;  5CYV A;  3GXO A;  4L5J A;  3TBI A;  2A3S A;  1V5F A;  2HYG D;  3FM3 A;  3J80 Z;  3S17 J;  2OTL I;  4XL9 A;  4KT5 C;  3B6A A;  2KDO A;  1SMY F;  4MEY F;  5FKO A;  3O3K A;  4CCL A;  2HPM A;  2GZW A;  1B9N A;  2XGE A;  4RB2 C;  3K1P A;  1ZRF A;  5KHD A;  3RKQ A;  2HWV A;  1K6Y A;  3S3N A;  4XMY A;  1R71 A;  3V7R A;  1LFP A;  5GP9 A;  2P8T A;  3BR3 A;  4PZJ A;  5E17 F;  1OCZ H;  2IA1 A;  4BJ6 C;  3WTW C;  1BR4 A;  1ZAR A;  3S93 A;  5J47 A;  5D5W B;  2PLY A;  1M1E B;  1SVL A;  1ZYR F;  2ZSH B;  1O3T A;  3SDG A;  3DBL B;  4RLQ A;  1P4W A;  4XLP F;  3PM1 A;  2UZK A;  2EV5 A;  3EYI A;  2F4M B;  4FX0 A;  1QPI A;  3BPX A;  2IGK A;  4AYB N;  1ZTR A;  4Y7N J;  2KIF A;  2E2J J;  4L9T A;  3NQO A;  3EET A;  3JCU C;  4XLE A;  3SQN A;  1ZRD A;  4YFN F;  2VB6 A;  3HZJ A;  3S8P A;  3G73 A;  2EZK A;  2L54 A;  2GA1 A;  4B47 A;  4FCY A;  4D0P A;  1HBX G;  1TNT A;  1BIB A;  5FO5 A;  2EIM H;  3MVP A;  1FTT A;  3HSF A;  3HYI A;  4XOP A;  2ESN A;  2VLA A;  3RZD J;  3KP7 A;  3GTL J;  1BI3 A;  3ZMZ A;  1T8I A;  3G2B A;  2HPI A;  4G7Z F;  3FBN B;  2VBY A;  1N77 A;  1FBU A;  1WJC A;  1B72 A;  4FE7 A;  3ISP A;  4HRI A;  4PGH A;  4JX5 A;  5LEK A;  2LOO A;  5K7F A;  1LVK A;  5EYR A;  5J4Y A;  2FML A;  1WQ2 A;  2H6C A;  4AWX B;  3W6V A;  2RQQ A;  1J9I A;  3BTL A;  3DF8 A;  3LFU A;  2OZU A;  3JTH A;  2DFI A;  4U7D A;  3GTG J;  3OL3 A;  4WX9 A;  2FUG 2;  2V1D A;  2VOP A;  3K69 A;  1FSH A;  3H5A A;  1I5Z A;  2L9S A;  2XIG A;  4FX4 A;  1UB9 A;  3HC7 A;  2DYR H;  3FXL A;  4UHT A;  1ACI A;  2GAU A;  5J1Y A;  1HXD A;  3BR1 A;  1LQ1 A;  4UNO A;  5TGT A;  2JQ7 A;  3PNY A;  4BEH A;  3DKW A;  3CQZ J;  2EJR A;  3S3M A;  3SJM A;  5LHH A;  2W24 A;  2IA2 A;  3KP4 A;  5FLX K;  3HL2 A;  3C3W A;  3ZMT A;  1XSX A;  2LH9 A;  5HS8 A;  4G6Q A;  4CCJ A;  2BY3 A;  1ZG5 A;  1R22 A;  3U1D A;  4OOI A;  3L7W A;  1KYZ A;  1XGN A;  1PUE E;  4RAZ A;  1L3L A;  4ESJ A;  3DEW A;  1Z7U A;  2FOW A;  5L3B A;  2ZXI A;  1ZG1 A;  2Y30 A;  3QPL A;  4S05 A;  5BPD A;  2Q1Z B;  3FDY A;  3OYM A;  5D6F A;  3K4C A;  1ZR2 A;  2AXL A;  1TQI A;  4AU7 A;  1KU7 A;  4Y13 A;  2V9P A;  2LF8 A;  4BHP A;  4N0B A;  3I64 A;  4LIU A;  5HLI A;  1ITY A;  3KP5 A;  3LA7 A;  4O3M A;  1P7I A;  4DIQ A;  2MD5 A;  4A3K J;  1R1U A;  2D5V A;  3C1D A;  1AU7 A;  2L3D A;  2HVR A;  1EF4 A;  1Y0U A;  2MA3 A;  1SFE A;  4BXU A;  2A6H F;  2V9V A;  1HKT A;  3IRQ A;  4A0Z A;  2A05 A;  1QBJ A;  3ZMD A;  3KX2 A;  2L7K A;  1DP7 P;  3PFI A;  3BTC A;  3FBI B;  5IYD J;  2QSH X;  4E7H A;  2GXB A;  2R92 J;  5GTI C;  5M5Y J;  2CQK A;  4II3 A;  3EUH C;  1XS9 A;  5ERI A;  4YEL A;  2BY1 A;  2EPF A;  2DJN A;  2CQX A;  4BNC A;  2HOT A;  2F5E A;  2DT7 B;  3K4K A;  5EEG A;  4RDU A;  4KJZ A;  2HXO A;  2XRL A;  1ZR4 A;  2DA5 A;  5EJC A;  4D5C A;  4MTD A;  1D0Y A;  1O7L A;  2Y31 A;  4M9Z A;  4C9Y A;  4LMY A;  3ZQF A;  1UJ8 A;  2CRG A;  4PUS A;  1U78 A;  1STZ A;  2MC4 A;  2VOO A;  4IZZ A;  4HLX A;  4HEA 2;  3HEF A;  1ZQ3 P;  1WJ5 A;  3KZI C;  1H9G A;  4RAY A;  4LK1 F;  5GPA A;  3K70 C;  3E0J B;  1ZEL A;  4IJA A;  1S72 I;  3E97 A;  2R5Y A;  3W3C A;  2IS4 A;  2ZBK A;  4MQV A;  2BE5 F;  3F8N A;  2A5Y B;  3GTP J;  1R00 A;  4LB6 B;  2GOX B;  4I7H A;  1TL8 A;  5D5U B;  3OIO A;  2FX0 A;  1MKM A;  2LY2 A;  1YX3 A;  3OS2 A;  3F22 A;  1O3Q A;  2R93 J;  3K4L A;  3LAP A;  4XKV A;  5LGN A;  5DYM A;  2XGX A;  4XM3 A;  1R58 A;  3CUQ C;  4EQQ A;  2OAZ A;  5EF6 A;  2E19 A;  3U2R A;  2WWY A;  2OZ6 A;  3KYD B;  4I98 B;  1U9N A;  2W82 A;  2HEO A;  2QQ8 A;  4BXF A;  5DDG A;  1QNT A;  3LQR A;  1MBK A;  1RES A;  4AVP A;  3L1P A;  3JAM Z;  2Q2E A;  3R0A A;  3D0S A;  1YI2 I;  2L9R A;  3I3L A;  2X48 A;  3IAM 2;  1QZY A;  5B66 C;  4UB8 C;  4I99 C;  4RAF A;  4M3F A;  3ZOB A;  2ZKZ A;  2YU9 J;  4XN3 A;  1Y56 A;  2F5V A;  5EEA A;  1UHM A;  5FRM A;  2DOD A;  3IH4 A;  1FYL A;  2NRA C;  3NEU A;  1X3W B;  2YX7 A;  4YG2 F;  3BP8 A;  3MZ8 A;  3WHB A;  4CYC A;  3DQV C;  4XK4 A;  3MAJ A;  2XPW A;  3M07 A;  4R1H A;  4HQM A;  1J2X A;  1D8K A;  1VQ5 I;  3IWF A;  1K61 A;  2MH9 A;  1S29 A;  4CDG A;  4HAM A;  2X4H A;  3IKT A;  3ECO A;  3NAU A;  3WG9 A;  3RYP A;  2Y0S A;  3A0H C;  2E1O A;  1YTY A;  4X1E A;  5AIQ A;  5DD8 A;  1DU6 A;  2LKP A;  2M7B A;  4IRI A;  3LSM A;  3IV5 A;  2FOK A;  4BE0 A;  3OOU A;  4DBR A;  2BGC A;  1P2F A;  3DPT A;  3DPL C;  5IY5 H;  3OS0 A;  1K79 A;  5ED4 A;  3SYT A;  1SD7 A;  2AHQ A;  5TJJ A;  3CDI A;  2A69 F;  2CV1 A;  2L9N A;  3GFI A;  4WXH A;  3R4K A;  2HVQ A;  1RKT A;  1OR7 C;  2Q8K A;  4EJW A;  1MH4 A;  2KMU A;  3R6S A;  2X1E A;  1U5T A;  1G8X A;  3BG7 A;  1E2X A;  3ONQ A;  3RYR A;  1B6A A;  2UUZ A;  3BLY A;  1W7P B;  1FX7 A;  4AUX A;  4OIO F;  1MSF C;  4A3B J;  1E3P A;  1GUU A;  4XLF A;  1FP2 A;  1LB2 A;  2WBM A;  3PFY A;  3TMO A;  3MD2 A;  1K6O A;  3TP0 A;  1X4P A;  3DWL E;  4G9Y A;  2L4M A;  4M3B A;  2MGQ A;  2R7U A;  2M4K A;  2H8W A;  4HW0 A;  1ZLK A;  2ZJP F;  1R5I D;  5CVI A;  4GXO A;  1YOV B;  4HST A;  4BE1 A;  2HKX A;  2DQR A;  3CTA A;  2M0C A;  2IPQ X;  1VQN I;  5D8L B;  3I59 A;  3F8B A;  4IHS A;  2H8R A;  4UV9 A;  1OLT A;  1LDK B;  2DPU A;  1W1W E;  1JTY A;  3GCM A;  3ZP5 A;  1RUN A;  2CFO A;  1VQK I;  4ZTJ A;  1OCO H;  1FWZ A;  3IH2 A;  1FIA A;  1MD0 A;  4AM3 A;  3OR1 C;  4E70 A;  3RQI A;  4EJU A;  3HUG B;  5FFX A;  5J40 A;  1W7P D;  4Y52 J;  2Y0S N;  4F3Q A;  3KPH A;  4CIC A;  1D1B A;  2KJB A;  3GF2 A;  1YIJ I;  3DBH B;  1F5T A;  3GEZ A;  3KEQ A;  4U7B A;  3CCM I;  2AQE A;  2IXS A;  2BXY A;  3OR2 C;  5EZH A;  5LHG A;  1SD5 A;  4XKW A;  2ICW G;  2B0L A;  2GQQ A;  2L2O A;  3ZQH A;  2KIS A;  3W2V A;  3VB2 A;  3CJN A;  4XQF A;  2BVM A;  4YEJ A;  3GUD A;  2CO5 A;  3HXL A;  1Z6R A;  1HQC A;  3DCF A;  2W85 A;  2BZT A;  2NOJ B;  3OSG A;  1PP7 U;  1AKH B;  2K5C A;  1SAU A;  3NWT A;  2BYV E;  4Y4R A;  5FKN A;  2WAF A;  4CSW A;  2V9K A;  3OYI A;  5JLW A;  4HNT A;  5LLQ A;  2CW8 A;  2YX4 A;  3DV8 A;  1SC7 A;  1VQO I;  1UMQ A;  2Z33 A;  1WI3 A;  1D5V A;  3PL8 A;  4IL6 C;  4BQQ A;  2ISY A;  1ETY A;  2LY9 A;  1BOA A;  1YS6 A;  3VOE A;  2VJ4 A;  1HSJ A;  3WTT C;  2BVL A;  4BJ5 C;  1NK3 P;  3LSI A;  5HNH A;  2HTS A;  1RUO A;  4JK1 X;  3CLO A;  1Z3X A;  2B7E A;  2BEO A;  1H89 C;  3CD6 I;  4UUS B;  2QCO A;  5DM6 F;  1FEX A;  3CES A;  3Q9S A;  5HLG A;  4S04 A;  2R7O A;  3HOU J;  2ECB A;  3K6G A;  1GVD A;  1KA8 A;  5LGU A;  2QQA A;  3SEQ A;  3Q5F A;  2KJC A;  2DBB A;  1S9H A;  3TW7 A;  1NG6 A;  2M0M A;  4FQG A;  1R5H A;  3F72 A;  1W4M A;  3BR6 A;  4P55 A;  5DCF A;  1UG2 A;  3ZGK A;  4IQJ A;  1CF7 B;  1F36 A;  2W57 A;  2B9S A;  1OFC X;  4M72 A;  2EIJ H;  1XGS A;  5B1B H;  2JTV A;  2AQF A;  3CJR B;  1LDD A;  3VYR B;  3I56 I;  3SEZ A;  2VT2 A;  3ZMU A;  2NXN B;  1IN6 A;  4L5E A;  3D1N I;  5L3G A;  1G6N A;  2NVU B;  3RCO A;  2EFW A;  1RKW A;  1ZN2 A;  2OD5 A;  2ZFW A;  5BS6 A;  4DBQ A;  2Y9Z A;  3JRD A;  1ZRE A;  2VXZ A;  2K4J A;  5GAG J;  4NDL A;  2KQR A;  3JRC A;  3CCY A;  2NS0 A;  4LLL A;  3CC2 I;  2FBK A;  4GCV A;  5H6Q A;  5ILS A;  1XGO A;  4Z6Y A;  5BOX A;  3F6V A;  2EFP A;  1Y39 A;  4P5O A;  3NWS A;  1ETQ A;  1SEU A;  2Q0O A;  4WWC A;  2HOE A;  1B8I B;  1W36 D;  4GFB A;  3ELK A;  2DT6 A;  2IRF G;  3HDD A;  1MGT A;  2VI6 A;  2E7X A;  5FJ8 J;  1ZG3 A;  1FZP B;  1FYK A;  3FMQ A;  1IUY A;  4N4N B;  4Y3O A;  2CUZ A;  4HX7 A;  2LLK A;  3SZT A;  2DFE A;  2J5O A;  3DTI A;  2LP0 A;  3PUF A;  4ABZ A;  2OF7 A;  3OYE A;  1TTY A;  3BTI A;  1F43 A;  1AA7 A;  3E3V A;  3LQQ A;  5IOY A;  2ZSI B;  4M3E A;  4V19 K;  5K5Q A;  1U9O A;  2DA6 A;  2CFX A;  4XLA A;  2RN7 A;  1K7A A;  3L2R A;  4XR6 A;  3F8F A;  5E1W A;  3DXJ F;  4CYD A;  2P0W A;  5IP7 J;  3UR3 C;  2ZJ2 A;  3FXK A;  4L0Z B;  4KN4 X;  1F1Z A;  2DW4 A;  2MD0 A;  2HOA A;  2FRH A;  1YQA A;  2WV1 A;  2XHK A;  2P5L C;  4IHW A;  4LLN A;  2HQA A;  1QO0 D;  1IV8 A;  9ANT A;  2STT A;  4OMZ A;  4A0Y A;  1D1A A;  2R7V A;  3FXQ A;  2FQ4 A;  2P81 A;  1HF0 A;  2YPR A;  1XSV A;  3QOE A;  3JRI A;  4C30 A;  2NNY A;  2KZV A;  5F0C A;  5EZG A;  2X51 A;  4AVZ A;  2D1H A;  4U0Y A;  4P1W A;  3MKL A;  2XGC A;  3KEO A;  1SAN A;  4DYQ A;  1X1C A;  2LK2 A;  2VJ5 A;  4BUP A;  1W5T A;  1WH5 A;  3DLL F;  2HS5 A;  4EJV A;  3VDX A;  4MTE A;  3BR2 A;  2DMU A;  5D4S A;  5F0F A;  3RKY A;  2IGO A;  3HG9 A;  4I09 A;  1U6G A;  3SZG A;  4X6A J;  1TWH J;  3TW6 A;  1WJB A;  2DMT A;  5AIP A;  4A3J J;  2FE3 A;  2X0L A;  4OIR F;  2L5Q A;  4B3A A;  4Y15 A;  4RM2 A;  3FXO A;  3AAF A;  1BW5 A;  3B02 A;  4IXA A;  4QSH A;  1S7O A;  4L5I A;  2MLG A;  1I6H J;  4PSW A;  3J81 Z;  2JJ7 A;  1T38 A;  3ZMS A;  3GFM A;  4LLG F;  5EEH A;  1T2K A;  4I02 A;  1YJ9 I;  3L2C A;  3S16 J;  2EB7 A;  3QU6 A;  2A07 F;  3JRA A;  5IP6 A;  2K27 A;  1V4R A;  4MIM A;  5E79 C;  1RC9 A;  2IS2 A;  1TT0 A;  5B1A H;  3K9T A;  3NRV A;  5AON A;  2HZT A;  4ZTF A;  1JTX A;  2QEN A;  3H35 A;  3JRB A;  2P6S A;  1E3O C;  1Y6I A;  2EFN A;  3GO5 A;  4HF0 A;  1SD6 A;  2EK5 A;  2K4B A;  3S2W A;  1AWC A;  2CUE A;  1X3Z B;  3Q0W A;  3LSG A;  3L2V A;  1OCT C;  4CCM A;  2ME6 A;  2KLO A;  3QOP A;  2F5C A;  4L9N A;  3HKZ A;  2OPT A;  2ZME C;  2XSD C;  2HDD A;  3WGI A;  2CUF A;  2YU3 A;  1FYM A;  2E35 A;  1V54 H;  2O0Y A;  3BZ6 A;  3PSF A;  3ZCO A;  5C44 J;  3CCE I;  5HOO A;  4J19 A;  5GAE J;  1WVR A;  1GXP A;  2ID3 A;  1Z1D A;  4A6E A;  4BQO A;  2JA7 J;  4M74 A;  3CDL A;  1DP3 A;  4N4O B;  1YO5 C;  2V6C A;  3B73 A;  3OYF A;  2JUC A;  3RI4 A;  2R7F A;  2PJP A;  2LTP A;  4HDU A;  4HLY A;  2XVC A;  3QAH A;  1IO2 A;  1Z7L A;  4EMS A;  1D0X A;  4R79 A;  1JHH A;  2PJR B;  2L01 A;  3M7G A;  4F7Z A;  1YIT I;  2JSC A;  2DMN A;  2GWR A;  2MYS A;  3OYJ A;  1TQP A;  1TW2 A;  1S8N A;  5E1Z B;  5A2Q K;  2ZB9 A;  3E1S A;  1E3H A;  2LD5 A;  3Q9V A;  3HOX J;  4BJT A;  3BJO A;  1I3A A;  1H0M A;  1QU3 A;  2A5W A;  3DKX A;  1MBG A;  1WI9 A;  1XG1 A;  4ENK A;  1JJ8 C;  2CH0 A;  1W5S A;  2QEX I;  2VUM J;  1RRJ A;  1A36 A;  4WF2 A;  1HDP A;  1Z3Y A;  2P4W A;  1VZ0 A;  1MJ9 A;  1QZE A;  2MC3 A;  2R7Q A;  2EA4 A;  1WGX A;  3BR5 A;  4A5N A;  1CQT A;  2STW A;  1VQ7 I;  4PFO A;  1YG2 A;  4PGG A;  4ZJZ A;  2M3A A;  3VPR A;  3HKZ N;  5L3F A;  3IWZ A;  1FC3 A;  1MH3 A;  1S7A A;  3M8J A;  3CJT B;  1OJL A;  4IPA A;  4RGX A;  1FP1 D;  3RJP A;  4DOZ A;  4XRS A;  2EWN A;  2MW8 A;  2ETH A;  2J5P A;  5KCM A;  5F0H A;  2DMQ A;  2KHM A;  5DTD A;  4LG0 B;  1GV5 A;  3K2Z A;  2OTJ I;  5FRO A;  4DYC A;  2F5D A;  2ADU A;  1IN8 A;  3K4M A;  5JVT A;  2HQN A;  5KAF C;  5FFZ A;  2JT1 A;  4RLF A;  1MW7 A;  1T95 A;  2DK5 A;  1Z21 A;  2WA0 A;  2FD5 A;  2JK3 A;  2LC2 A;  2M45 A;  1R1T A;  5EG0 B;  4CHU A;  2HVS A;  5BPI A;  2CYY A;  1N25 A;  3JSO A;  2CJJ A;  3I4P A;  1FMV A;  1P9Q C;  3G6E I;  3I71 A;  2A68 F;  2PN6 A;  2XDV A;  2F6C A;  3QP5 A;  2ZXJ A;  3ASO H;  1MNM C;  4S0H B;  2NAZ A;  4IF4 A;  4E4H A;  2VJJ A;  3RDI A;  3ZRG A;  3K1M A;  3JRH A;  2BOL A;  2E71 A;  3TP3 A;  2KPM A;  4ZZD A;  1TC3 C;  1JI8 A;  4QIW N;  2UV1 A;  4QWQ A;  1WH7 A;  1NHA A;  2K9L A;  4M9S A;  3LWF A;  4IO9 F;  2GXA A;  4Q48 A;  2OCE A;  5DUI A;  1EH7 A;  1X1D A;  4CCK A;  1SAX A;  2AO9 A;  3CUQ B;  1PUF B;  1W7P A;  2W25 A;  4ENJ A;  2PX9 A;  2FNP A;  3KZZ A;  3U9G A;  3A01 B;  3LA3 A;  4JBA A;  3W6K B;  5D4R A;  5JLX A;  2MH2 A;  3FIS A;  2JPC A;  2DTZ A;  3AG2 H;  4B1R A;  2G9W A;  5E8I A;  3I53 A;  1D8J A;  1MNE A;  2VBZ A;  3T5X A;  1ODD A;  1Z6T A;  2P7V B;  2NVT J;  3PIP F;  4BL0 B;  4NBQ A;  2DI3 A;  3G1O A;  1QVT A;  2L02 A;  3S14 J;  4EV0 A;  3D5L A;  2VAS A;  5IOZ A;  2JN6 A;  1I27 A;  2IEK A;  1ZGW A;  3DU6 A;  2VPR A;  4XLC A;  3KYL A;  4XLH A;  1T0F C;  1KQ0 A;  1GXQ A;  2XPV A;  1S7E A;  3HTU A;  2LRE A;  4B09 A;  5K5O A;  3F8C A;  5D8K B;  2DOE A;  1XN7 A;  3BWG A;  1O3R A;  3GLX A;  3AKZ A;  2IT0 A;  2DOA A;  3KP6 A;  2CG4 A;  2HYF A;  4YIR X;  3WU2 C;  2VQL A;  5HDK A;  1Y0N A;  3HUG A;  3LSR A;  2QYO A;  4F91 B;  5ICC A;  4ZC3 A;  2Y0M A;  3OYN A;  4IVN A;  2H1K A;  5LRR A;  1GVJ A;  4XOR A;  4QPQ A;  3WHC A;  1Y8R B;  1BC8 C;  3S2H J;  1PYV A;  4PSX A;  2DJI A;  2WAQ N;  3PUB A;  2FEZ A;  1DU0 A;  5FD6 A;  1ETV A;  1RNL A;  4C3J J;  4IRG A;  2DA7 A;  4JX4 A;  3DEE A;  5DUK A;  4ZYE A;  1F4K A;  4F92 B;  3GTO J;  1OKR A;  3TKY A;  2QQ9 A;  2K9Q A;  4G6T B;  1FBS A;  3MEX A;  4G6D A;  2ECC A;  3WTU C;  3LSJ A;  4R8H A;  3V7C A;  5E3O A;  3FF5 A;  4CZZ A;  4E7S A;  4ASN A;  1AKH A;  3ZQL A;  4OMY A;  3HOS A;  3E6D A;  4AC0 A;  4B43 A;  5K7H A;  3CCS I;  5CQE A;  3PO2 J;  1EH8 A;  2A61 A;  4I01 A;  5J3L A;  5L3C A;  1TT5 B;  4UV8 A;  1PJR A;  2DTR A;  4UVB A;  3H5N A;  2HGC A;  2DLL A;  1YHQ I;  2DA1 A;  4P9U A;  5E18 F;  1MDM B;  2VKV A;  3AG4 H;  5CLS A;  1D1C A;  4D9J A;  3KEY A;  3RPU A;  5IT3 A;  3JSP A;  4UUS A;  3ZQC A;  1IZ1 A;  4OAZ A;  2ESH A;  3DTE A;  5BQT A;  1JJ6 C;  2EIN H;  1JT0 A;  4RAG A;  2GXG A;  2QKM B;  2QZ8 A;  2RC4 A;  3EUA A;  4KN7 X;  4LFU A;  4H4K C;  4HSR A;  2KZG A;  3HPH A;  2XF6 A;  2VKD A;  4YFX F;  3GTJ J;  1JE8 A;  4HF1 A;  1YIO A;  3H92 A;  2A6T A;  1O57 A;  2DA2 A;  3VYS B;  1X2M A;  4LGW A;  4PJJ A;  1A6Q A;  3I0T A;  3VFZ A;  3REO A;  2XAJ A;  5L3E A;  5IPA A;  3L2U A;  1HW2 A;  2QVO A;  4B44 A;  4D7M A;  3FWE A;  1CF7 A;  2P5K A;  3HRM A;  4D7N A;  1SFK A;  2H09 A;  2DDB A;  3K0L A;  4KT6 A;  4M6Y A;  2Y69 H;  4PFP A;  1USS A;  4ZZL A;  5F1J A;  2CUJ A;  2NVQ J;  3K4N A;  4PJM A;  3CO7 C;  3MWM A;  3M3Y J;  2ID6 A;  3JW4 A;  3QQA A;  2EZI A;  3BOQ A;  4BY1 J;  4PDK A;  2G7U A;  5TIS C;  1T56 A;  2K7L A;  4GGG A;  3FHZ A;  3O8H A;  2RQP A;  3UKG A;  2HNH A;  5H2F C;  2VE9 A;  2XAU A;  3WOD F;  2QKL B;  3OS1 A;  3COA C;  2X6W A;  3QPH A;  3WTY C;  1XC5 A;  4HNV A;  4BAC A;  3P7N A;  4XNF A;  3CCL I;  1B8I A;  1BOB A;  3J80 K;  5IT9 Z;  2FF4 A;  3HRT A;  1LKX A;  3QP6 A;  6PAX A;  3CCV I;  2Z1D A;  3IH3 A;  5M5W J;  1JUP A;  5HLT A;  1R4N B;  4EGY A;  3VOD A;  3VSK A;  3CME I;  3LA2 A;  3DKY A;  4BGD A;  5KK1 A;  5E3L A;  4CA0 A;  3ZQQ A;  2QF7 A;  3BG9 A;  3ZN1 A;  4KNY A;  1QQI A;  5CVJ A;  1ZGJ A;  2F2E A;  3FXM A;  3V42 A;  3ZXS A;  1HW5 A;  1RI7 A;  2VBW A;  4CCN A;  1W5C C;  1DPR A;  2ZXH A;  4A2U A;  1K78 B;  1VQP I;  4E6K G;  5HDG A;  2QA4 I;  1P6R A;  1VTN C;  1MMA A;  5ILV A;  5C3E J;  4A3I J;  3LSP A;  4W97 A;  2R4G A;  2CW0 F;  3JRF A;  3A1Y A;  2VXD A;  1KZH A;  4EAT A;  1XMA A;  1Y1V J;  3EPZ A;  3BR0 A;  3LST A;  3TDZ C;  5BMZ A;  1C0W A;  1I1G A;  2MBF A;  3S1M J;  3OIQ A;  4JP0 A;  1DQU A;  2R3S A;  1ZH5 A;  5LHI A;  3OYC A;  1I39 A;  1X2N A;  1Z9C A;  3DU5 A;  2MG4 A;  2V1N A;  1EJ9 A;  3QPS A;  1IRX A;  4RGU A;  1P7J A;  5J8F A;  2IS6 A;  1JKP C;  1RR8 C;  1ERD A;  1I6X A;  4KIB A;  3K4J A;  4BQN A;  1B9M A;  5D6E A;  2M7A A;  4TV7 A;  4BQA A;  4MQ9 F;  5LD2 C;  1G59 A;  3NAR A;  3BG5 A;  4E7Z A;  1LJ9 A;  2TDX A;  1OYW A;  4O6J A;  2KT0 A;  2F4I A;  3IKV A;  4ZDP A;  3T8R A;  1U2W A;  4ZH4 F;  1GHC A;  4GRI A;  2AS5 F;  2XUB A;  3KIO A;  2EA2 A;  3W6J B;  1UHW A;  3SZP A;  4NQW B;  1EH6 A;  4A3F J;  2JA2 A;  2KKO A;  2PMH A;  2H94 A;  5ICF A;  1WPK A;  1NG7 A;  5M3F J;  1IXS B;  2NYX A;  3A03 A;  2K85 A;  3H9Q A;  1V3F A;  1VFC A;  3HOY J;  4MFE A;  4WXD A;  5KVR A;  4LG3 A;  3C2H A;  4QPO A;  2PBI A;  4BU2 A;  4RB3 C;  2ZXW H;  3I5U A;  2M8G X;  2XRO A;  3WTS C;  2XF5 A;  4I0A A;  1MMD A;  2XV4 S;  2K86 A;  2CV0 A;  2Y2Z A;  1PVE A;  4KDP A;  4RGS A;  4JOM A;  1JT6 A;  2XB0 X;  1VF9 A;  3QYE A;  4LK0 F;  3S1N J;  3BZC A;  1MMG A;  2HFH A;  1ZHF A;  2ZNZ A;  4YRV A;  3DTK A;  4LD5 A;  1N78 A;  1P92 A;  3G1L A;  4BBS J;  3BJ6 A;  1PP8 F;  1JHF A;  5K5R A;  1XMK A;  2GLO A;  1YRN B;  3FIW A;  4ZYD A;  3OYG A;  4EGZ A;  1BN5 A;  2R0Q C;  2D2W A;  5K7Z A;  1RET A;  3U1K A;  5E3N A;  4KFC A;  1HC8 A;  1KYW A;  3S2D J;  1HCR A;  2BY2 A;  3K2A A;  2EFQ A;  2W7N A;  2PI0 A;  1XDS A;  5J1R A;  2LYC A;  5EDN A;  4HBL A;  4NUB A;  1R7J A;  2BW3 B;  3MKY B;  2E1M C;  1U3E M;  3LSH A;  2K3F A;  4Q4Z F;  5TRD A;  3V4G A;  2R7T A;  5D5X B;  4IHX A;  3A2K A;  1LE8 B;  3K1N A;  3ZMV A;  3RPQ A;  4X0G A;  2LKS A;  5BNG A;  2K02 A;  3RPU D;  2UWM A;  3K10 A;  3EDP A;  2W1O A;  2PEX A;  2PJR A;  3CO6 C;  1YW9 A;  2COM A;  3ZQ7 A;  4F93 B;  3QRF F;  2DO7 A;  3VSL A;  5FKK A;  3VYT B;  4A5M A;  1FBQ A;  3I54 A;  5B5E C;  5LBQ A;  2VKH A;  2WC2 A;  3HTS B;  5FKM A;  4KIT B;  1EKE A;  3HOT A;  3C18 A;  2BV6 A;  4A69 C;  1JGG A;  1J0R A;  2ZFU A;  2CQQ A;  3BRO A;  3CF2 A;  1IN5 A;  1YW7 A;  2Z99 A;  3E5X A;  3CP8 A;  4CUG A;  5GTH C;  3ERM A;  1JXS A;  3WGG A;  1F9N A;  1GDT A;  1JKR C;  1OCP A;  1AOY A;  3FK7 A;  5KAI C;  3OYB A;  1JGS A;  3QWL A;  1YJN I;  4LOC A;  1ORK A;  3GWZ A;  2K9N A;  3CDH A;  2K40 A;  1KON A;  2ELJ A;  1ZGA A;  4E7J A;  3T1B A;  2QWW A;  2RNJ A;  3LFK A;  3O2P E;  3V8K A;  4F52 A;  3QYF A;  3JRG A;  2M30 A;  3FXU A;  3RTR A;  3CCJ I;  4WXC A;  5HS7 A;  3RSN A;  3PO3 J;  1E0E A;  4B48 A;  5FLX Z;  2X9D A;  1IGN A;  2LNB A;  4B4C A;  1OQY A;  3E7L A;  2ZME B;  1WJE A;  3WE3 A;  4IHT A;  3EUH A;  2NVY J;  3CCR I;  3Q0V A;  3G3Z A;  4LG0 A;  4MNU A;  2DAO A;  2KRF A;  1W0T A;  3GTK J;  2LG4 A;  2JZY A;  1JUS A;  3KLO A;  3LSK A;  3Q0U A;  4LJZ F;  5F08 A;  2JSP A;  3IUO A;  2XPU A;  2VON A;  3JAM K;  3DBR B;  4XRF A;  5EG0 A;  3GFL A;  4ETS A;  2NOG A;  1Z0X A;  1DPU A;  1R1V A;  1WJF A;  2GA2 A;  4A3C J;  1S6L A;  3M1C A;  4HDV A;  2VOD A;  2V26 A;  2JA6 J;  1QGP A;  1KU3 A;  1SVO A;  1YW8 A;  4U0W A;  2VJI A;  4H0E A;  2QQB A;  1T98 A;  3E5U A;  2RVC A;  4YFK F;  2KDZ A;  1LUJ B;  1YJW I;  3CUO A;  2Z2S B;  1HKQ A;  2VC1 A;  1MBH A;  2HQR A;  2XRN A;  2WTE A;  3OV8 A;  2QBY B;  3D5R C;  4Y33 A;  2EH3 A;  5LRS A;  1TW3 A;  1WKM A;  4CO8 A;  1K4S A;  1VI0 A;  1WCM J;  4XRS G;  1IC8 A;  1IUF A;  2OCC H;  3BG3 A;  3IAS 2;  3CUQ A;  4HQE A;  4AD9 A;  3WE2 A;  1PUF A;  5CKT A;  4Z2Y A;  5D5V B;  1FOX A;  2M87 A;  4CXF A;  3OY9 A;  3A01 A;  1ETO A;  3ULQ B;  2HQ5 A;  2DA4 A;  4M3D A;  1WWX A;  2W4S A;  3L09 A;  1W36 C;  4JYK A;  2UXX A;  4NC6 A;  1V55 H;  3N05 A;  2LY1 A;  1DDN A;  2EV6 A;  4A6D A;  1PDN C;  2W84 A;  2A6E F;  2OQG A;  2M9H A;  3GYH X;  2E2H J;  4UY8 I;  5JVG F;  1G4D A;  2RAE A;  5E1X A;  3HIF A;  4M9X A;  5CVU A;  2JUG A;  5IP9 J;  4ENN A;  1WSU A;  1GLN A;  4L9V A;  4NNJ A;  3HGG A;  4ZYA A;  2CMP A;  3S32 A;  1U8B A;  1X58 A;  3M1E A;  1XMX A;  1X1B A;  3BCA A;  1LDJ A;  1Z05 A;  2XAQ A;  4M6X A;  4BYY A;  4C3H J;  2ZJQ F;  4DJA A;  1A31 A;  2JA8 J;  4A3D J;  1XCV A;  5DEQ A;  2VT3 A;  2QSG X;  4ESB A;  2DA3 A;  2UXN A;  3I9V 2;  4PCQ A;  1FOY A;  3TED A;  1TQM A;  2TRT A;  1BC7 C;  1Y8Q B;  1S5L C;  2OUM A;  3PIO F;  3WTV C;  4YII A;  1G3Y A;  2ZCW A;  1MMN A;  3FX3 A;  4A12 A;  1WJD A;  2H27 A;  4J00 A;  3LMM A;  3I55 I;  3KFW X;  1T33 A;  2M1B A;  1G3W A;  3MN2 A;  4EJO A;  2IVM A;  5J4V A;  4DGW B;  4HF2 A;  4F55 A;  2D1V A;  2L4A A;  2EV0 A;  3SFI A;  2O61 A;  1Z91 A;  2PMU A;  3ZQG A;  4KIC A;  4ZDL A;  3CMM A;  2ISZ A;  4P9F A;  3J7A O;  1OR7 A;  4WCG A;  2LR8 A;  3O8G A;  4L9J A;  5E20 A;  4BS9 A;  3S1Q J;  2RV8 A;  5ICE A;  5KNL A;  2R7W A;  1U5T C;  2WB1 A;  1WJA A;  3CJQ B;  3HSR A;  3WTX C;  4OIQ F;  3TO9 A;  3TOB A;  2HU9 A;  3KCC A;  4C2T A;  2KFD A;  4QTR A;  2WAE A;  3TDU C;  2BXZ A;  4IEJ A;  2FMY A;  2DT5 A;  4EEF G;  1MDM A;  2K3P A;  4ZYH A;  1XD7 A;  3HBL A;  1B1B A;  4V2G A;  3ABK H;  1HW1 A;  1TP4 A;  3O6B B;  1SFU A;  3IC7 A;  1BI1 A;  1X19 A;  2QLZ A;  4HX4 A;  3OYA A;  4G8X A;  5J1U A;  2M5W A;  2OBP A;  2R5Z B;  4LIV A;  3HRU A;  2G0E A;  4RGR A;  4BY7 J;  3DEU A;  4BKX A;  1ETK A;  1WFX A;  5IYC J;  3VYU B;  4G7H F;  5B3S H;  2EIL H;  1ULY A;  1POG A;  3FHN A;  3HPG A;  1J09 A;  2LBF B;  1O3S A;  4NB5 A;  4GYI A;  5IYB J;  5M5X J;  1X1A A;  4L0Y B;  5CJ9 A;  1OCR H;  3AL0 C;  4NC7 A;  3V8L A;  2VPL A;  1R49 A;  1KU9 A;  4E7I A;  3PSI A;  4DQ2 A;  2VQC A;  3C7J A;  3MZY A;  4IQ4 A;  2E36 A;  3PJR A;  4DZP A;  2DPD A;  5F6F A;  5EGO B;  3GTQ J;  2L7F P;  3ZQI A;  1OMI A;  3F8M A;  2R7X A;  1IDY A;  1O4X A;  3OOP A;  1A35 A;  4GDF A; 
#chains in the Genus database with same CATH homology
 2O03 A;  1J7K A;  2QM3 A;  2FSW A;  2P5V A;  1YYV A;  3TO6 A;  3MZH A;  2ACJ A;  3GFJ A;  3N4M A;  1IXR C;  4KA4 A;  1O7F A;  3M9A A;  3ECH A;  1J5Y A;  4Q47 A;  3E6B A;  2HR3 A;  2R7D A;  2XAH A;  5CVR A;  2HTJ A;  5DCM B;  2O3F A;  3TQN A;  2Z9O A;  2PFB A;  4JQF A;  1IRF A;  5JFR A;  3F23 A;  3T0Y A;  1K78 A;  4O5V A;  1FOK A;  2Z5U A;  3BJA A;  1DUX C;  5H20 A;  3ABT A;  3IL2 A;  3QU3 A;  3IRR A;  4ESF A;  2E1N A;  3T8T A;  2D45 A;  1SD4 A;  4M73 A;  1BJA A;  5F1R A;  4EM2 A;  2C6Y A;  4DNC A;  3DP7 A;  3ERE D;  4MGR A;  1QPM A;  2OA4 A;  3SFZ A;  3GX4 X;  3E6M A;  1BI2 A;  3IHU A;  3ZN0 A;  1XSD A;  3H3U A;  1XDU A;  2JPB A;  1G3T A;  3KP2 A;  4CGZ A;  3BY6 A;  1UST A;  3KLN A;  4UUV A;  2XAG A;  2VBX A;  4NQW A;  3KET A;  4EJT A;  5L3D A;  3F21 A;  2HDC A;  1LEA A;  4UXN A;  3QPT A;  3R61 A;  4HOB A;  1REP C;  4HYE A;  2E7W A;  1S3J A;  4FHT A;  3SXY A;  3BDD A;  3V8J A;  2JRT A;  3TOA A;  4Q5S F;  4I2O A;  3KP3 A;  3F6O A;  3ML6 A;  4G94 A;  4IRH A;  3J81 K;  3LAJ A;  2LF7 A;  4KMF A;  5LGT A;  3FM5 A;  3N97 A;  3EQL F;  4AIJ A;  1RIO H;  5JHU A;  4QLC U;  3HSE A;  3FZV A;  3P9I A;  3HHG A;  1QZZ A;  3FMR A;  2O8X A;  4B8X A;  3KZY A;  1LEB A;  1I1S A;  4L18 B;  4GO1 A;  2CWE A;  2ZO4 A;  2LSO A;  1A04 A;  2NNN A;  4HZF A;  1LVA A;  3MFK A;  2E1C A;  4KYW A;  3L00 A;  4HV5 A;  4UVA A;  2G7H A;  4Y17 A;  3M8F A;  2XAS A;  1FPQ A;  2P7C B;  1IW7 F;  1BI0 A;  5FB2 A;  4XBF A;  2RGV A;  5E8G A;  2IP2 A;  3I58 A;  3ZPL A;  4EM1 A;  2EFO A;  4UVC A;  2XKP A;  2CGP A;  2OU2 A;  4LB5 A;  4G7O F;  3ABU A;  1FLI A;  2ZME A;  2KIU A;  2DU9 A;  1R5G A;  2V1X A;  2YSR A;  3FMS A;  4BH9 A;  3WU1 B;  1TNS A;  2MLK A;  5FD5 A;  2ELH A;  2ZNY A;  2FQ3 A;  4BAY A;  3V7S A;  5F64 A;  4I0B A;  1MZB A;  4ZYG A;  3GW2 A;  3PQJ A;  1J59 A;  2Y75 A;  3GVA A;  2QBY A;  5JI6 A;  1ZRC A;  3GZ6 A;  4OIN F;  3RKX A;  2CSO A;  5HVQ C;  4BHB A;  3DFG A;  1IXC A;  2GIV A;  2IA0 A;  1MJB A;  2FA5 A;  5J6X A;  2M8E A;  1B59 A;  2BBY A;  4BHC A;  1ON1 A;  1ZLJ A;  4EM0 B;  5HS9 A;  1HST A;  3MQ0 A;  4ON0 A;  4K2E A;  4YIF A;  1CGP A;  1MJA A;  2FU4 A;  1KQ9 A;  4HX8 A;  5A2Q Z;  4P96 A;  3TGN A;  1L0O C;  2F5F A;  1IN7 A;  2VN2 A;  3TO7 A;  4MHG A;  5ICG A;  2FBH A;  4U88 A;  1H9T A;  2DQL A;  2Y48 A;  2IJL A;  4XLN F;  4RB0 A;  1E17 A;  1HKS A;  4N9I A;  5HDN A;  2O6G E;  2VE8 A;  4ENM A;  5J8C A;  1P4X A;  3WU0 A;  3E5Q A;  4GYG A;  1G3S A;  2FNA A;  2KIM A;  3RKW A;  3SHF A;  3KE2 A;  3F3X A;  3WGH A;  1UCR A;  1LNW A;  5CVV A;  5FGM A;  2RKH A;  3P9C A;  1OYY A;  1T6S A;  4OU0 A;  1ZAO A;  1T0F A;  1P4A A;  1XCB A;  4KUM A;  4RS8 A;  1R36 A;  3E6C C;  1T39 A;  2WV0 A;  1IAW A;  1IF1 A;  2DK8 A;  1FSE A;  1J75 A;  2H6B A;  1R23 A;  1KGS A;  3GZ5 A;  4NHJ A;  1U8R A;  1B4A A;  5LEJ A;  4M71 A;  4MEX F;  4XSZ F;  1OPC A;  1BIA A;  4WK8 F;  1WRJ A;  5ILU A;  3WTZ A;  4KIG A;  1XB4 A;  1IN4 A;  3HHH A;  4HV6 A;  2LDU A;  1D3Y A;  3VEP A;  4U0V A;  2RDP A;  1U5T B;  4KIF A;  4N9H A;  1OYI A;  1FY7 A;  1ON2 A;  5JR3 A;  1KQ8 A;  3R0J A;  4EVI A;  2V79 A;  5DCM A;  4XSX F;  1KU2 A;  1SFX A;  2QUF A;  2FBI A;  2PG4 A;  3I59 B;  3EYY A;  1BBY A;  3M8E A;  4AIH A;  5DV5 A;  2HKO A;  2PQ8 A;  5IT9 K;  5HLH A;  2VC0 A;  2Z3Y A;  4AIK A;  2FXA A;  2V1U A;  1IRG A;  4KMU X;  1FT9 A;  1BM9 A;  3ROU A;  1YS7 A;  4HA8 A;  5DD4 A;  4A0X A;  1SMT A;  1YFH A;  1UFM A;  1YLF A;  1RZ4 A;  5K1Y A;  4RB1 A;  5H6R A;  1Q1H A;  3BPV A;  3RIR A;  2XKO A;  1FNN A;  3L9F A;  3FXR A;  2XAF A;  3PQK A;  1TLH B;  3HRS A;  4FT8 A;  2OQR A;  1X3U A;  4OIP F;  1ONV A;  1EV7 A;  3H3Z A;  2IW5 A;  1TBX A;  3JTG A;  2YR2 A;  3R60 A;  2P6T A;  1XGM A;  3MCZ A;  3P9K A;  5CYV A;  3GXO A;  4L5J A;  2A3S A;  2HYG D;  3FM3 A;  3J80 Z;  4KT5 C;  1SMY F;  4MEY F;  3O3K A;  2GZW A;  1B9N A;  4RB2 C;  3K1P A;  1ZRF A;  2HWV A;  3V7R A;  2P8T A;  5E17 F;  4PZJ A;  2IA1 A;  3WTW C;  1ZAR A;  5D5W B;  2PLY A;  1ZYR F;  1O3T A;  1P4W A;  4XLP F;  2UZK A;  2EV5 A;  3EYI A;  4FX0 A;  3BPX A;  2KIF A;  4L9T A;  3NQO A;  3EET A;  3SQN A;  1ZRD A;  4YFN F;  3G73 A;  2L54 A;  2GA1 A;  4D0P A;  1HBX G;  1TNT A;  1BIB A;  5FO5 A;  3HSF A;  3HYI A;  2ESN A;  3KP7 A;  1BI3 A;  3ZMZ A;  4G7Z F;  2VBY A;  1FBU A;  3ISP A;  4PGH A;  5LEK A;  2FML A;  1WQ2 A;  2H6C A;  4AWX B;  1J9I A;  3DF8 A;  2OZU A;  3JTH A;  2DFI A;  4U7D A;  4WX9 A;  2V1D A;  2VOP A;  1FSH A;  3K69 A;  1I5Z A;  2XIG A;  4FX4 A;  1UB9 A;  4UHT A;  2GAU A;  1HXD A;  1LQ1 A;  4UNO A;  3DKW A;  2EJR A;  5LHH A;  2W24 A;  2IA2 A;  3KP4 A;  5FLX K;  3C3W A;  3ZMT A;  1XSX A;  5HS8 A;  4G6Q A;  1ZG5 A;  1R22 A;  3U1D A;  4OOI A;  3L7W A;  1KYZ A;  1XGN A;  1PUE E;  4RAZ A;  1L3L A;  4ESJ A;  1Z7U A;  5L3B A;  1ZG1 A;  4S05 A;  5BPD A;  5D6F A;  2AXL A;  1TQI A;  1KU7 A;  4Y13 A;  2LF8 A;  4BHP A;  4N0B A;  3I64 A;  5HLI A;  3KP5 A;  3LA7 A;  4O3M A;  2MD5 A;  1R1U A;  3C1D A;  2L3D A;  1Y0U A;  2MA3 A;  1SFE A;  4BXU A;  2A6H F;  2V9V A;  1HKT A;  3IRQ A;  4A0Z A;  1QBJ A;  3ZMD A;  1DP7 P;  3PFI A;  2GXB A;  2CQK A;  5ERI A;  4BNC A;  2F5E A;  5EEG A;  4MTD A;  1O7L A;  4M9Z A;  4LMY A;  1U78 A;  1STZ A;  2VOO A;  4HLX A;  4RAY A;  1H9G A;  4LK1 F;  4IJA A;  3E97 A;  2ZBK A;  4MQV A;  2BE5 F;  3F8N A;  2A5Y B;  1R00 A;  4LB6 B;  4I7H A;  5D5U B;  3F22 A;  1MKM A;  1O3Q A;  3LAP A;  5LGN A;  5DYM A;  2XGX A;  1R58 A;  3CUQ C;  4EQQ A;  2OAZ A;  3U2R A;  2WWY A;  2OZ6 A;  4I98 B;  2HEO A;  5DDG A;  1QNT A;  3LQR A;  4AVP A;  3JAM Z;  2Q2E A;  3R0A A;  3D0S A;  1PDN C;  1QZY A;  2ZKZ A;  1UHM A;  1FYL A;  2NRA C;  3NEU A;  2YX7 A;  4YG2 F;  3BP8 A;  3DQV C;  3MAJ A;  4R1H A;  4HQM A;  1J2X A;  1D8K A;  3IWF A;  2MH9 A;  1S29 A;  4CDG A;  4HAM A;  2X4H A;  3IKT A;  3ECO A;  3WG9 A;  3RYP A;  1YTY A;  5DD8 A;  5AIQ A;  2LKP A;  4IRI A;  2FOK A;  2BGC A;  1P2F A;  3DPT A;  3DPL C;  1K79 A;  5ED4 A;  1SD7 A;  5TJJ A;  2A69 F;  3GFI A;  4WXH A;  3R4K A;  2Q8K A;  4EJW A;  3R6S A;  1U5T A;  1E2X A;  3RYR A;  1B6A A;  1W7P B;  1FX7 A;  4OIO F;  1FP2 A;  1LB2 A;  1K6O A;  4G9Y A;  2L4M A;  4HW0 A;  1ZLK A;  5CVI A;  4GXO A;  2HKX A;  2DQR A;  3CTA A;  2IPQ X;  5D8L B;  3I59 A;  3F8B A;  4IHS A;  4UV9 A;  1LDK B;  2DPU A;  3ZP5 A;  1RUN A;  1FWZ A;  1MD0 A;  4E70 A;  4EJU A;  5FFX A;  1W7P D;  4CIC A;  2KJB A;  3GF2 A;  1F5T A;  3GEZ A;  3KEQ A;  4U7B A;  5LHG A;  1SD5 A;  2B0L A;  2GQQ A;  3VB2 A;  3CJN A;  3GUD A;  2CO5 A;  1Z6R A;  1HQC A;  2W85 A;  1PP7 U;  2BYV E;  5LLQ A;  2YX4 A;  3DV8 A;  2Z33 A;  1D5V A;  2ISY A;  3VOE A;  1BOA A;  1YS6 A;  1HSJ A;  3WTT C;  2HTS A;  1RUO A;  4JK1 X;  3CLO A;  2BEO A;  3Q9S A;  4S04 A;  5HLG A;  1KA8 A;  5LGU A;  2QQA A;  3Q5F A;  2KJC A;  2DBB A;  1R5H A;  3F72 A;  1W4M A;  4P55 A;  5DCF A;  1CF7 B;  2W57 A;  4M72 A;  1XGS A;  2JTV A;  1LDD A;  2VT2 A;  3ZMU A;  1IN6 A;  5L3G A;  1G6N A;  2EFW A;  1ZN2 A;  2OD5 A;  2ZFW A;  5BS6 A;  1ZRE A;  2VXZ A;  2K4J A;  2NS0 A;  4LLL A;  2FBK A;  4GCV A;  5H6Q A;  5ILS A;  1XGO A;  5BOX A;  3F6V A;  2EFP A;  4P5O A;  2Q0O A;  4WWC A;  2HOE A;  3ELK A;  2IRF G;  1MGT A;  2E7X A;  1ZG3 A;  1FZP B;  1FYK A;  3FMQ A;  1IUY A;  4HX7 A;  3SZT A;  2J5O A;  1TTY A;  3E3V A;  3LQQ A;  5K5Q A;  2CFX A;  2RN7 A;  1K7A A;  3F8F A;  5E1W A;  3DXJ F;  4CYD A;  2ZJ2 A;  4L0Z B;  4KN4 X;  1F1Z A;  2DW4 A;  2FRH A;  1YQA A;  2XHK A;  2P5L C;  4LLN A;  1QO0 D;  2STT A;  4OMZ A;  4A0Y A;  3FXQ A;  2YPR A;  1XSV A;  2NNY A;  2D1H A;  4U0Y A;  3KEO A;  1W5T A;  2HS5 A;  4EJV A;  4MTE A;  5D4S A;  3RKY A;  4I09 A;  1U6G A;  5AIP A;  2FE3 A;  2X0L A;  4OIR F;  4Y15 A;  3AAF A;  3B02 A;  4IXA A;  1S7O A;  4L5I A;  2MLG A;  3J81 Z;  1T38 A;  3ZMS A;  3GFM A;  4LLG F;  5EEH A;  1T2K A;  4I02 A;  3L2C A;  2EB7 A;  3QU6 A;  2A07 F;  2K27 A;  1V4R A;  3K9T A;  3NRV A;  5AON A;  2HZT A;  2QEN A;  2P6S A;  2EFN A;  3GO5 A;  4HF0 A;  1SD6 A;  2EK5 A;  2K4B A;  3S2W A;  1AWC A;  3QOP A;  2F5C A;  4L9N A;  3WGI A;  2YU3 A;  1FYM A;  2O0Y A;  3BZ6 A;  5HOO A;  1GXP A;  4A6E A;  1Z1D A;  4M74 A;  1YO5 C;  2V6C A;  3B73 A;  3RI4 A;  2R7F A;  2PJP A;  4HDU A;  4HLY A;  2XVC A;  3QAH A;  4EMS A;  4R79 A;  1JHH A;  2L01 A;  3M7G A;  4F7Z A;  2JSC A;  2GWR A;  1TQP A;  1TW2 A;  1S8N A;  5E1Z B;  5A2Q K;  3Q9V A;  3BJO A;  1H0M A;  1WI9 A;  4ENK A;  1W5S A;  4WF2 A;  2P4W A;  1MJ9 A;  2MC3 A;  4A5N A;  2EA4 A;  2STW A;  1YG2 A;  4PGG A;  5L3F A;  3IWZ A;  1FC3 A;  1S7A A;  4IPA A;  4RGX A;  1FP1 D;  3RJP A;  2EWN A;  2ETH A;  2J5P A;  4LG0 B;  3K2Z A;  2F5D A;  2ADU A;  1IN8 A;  5JVT A;  2HQN A;  5FFZ A;  2JT1 A;  2DK5 A;  2M45 A;  1R1T A;  4CHU A;  5BPI A;  2CYY A;  3JSO A;  3I4P A;  3I71 A;  2A68 F;  2PN6 A;  3QP5 A;  2ZXJ A;  2NAZ A;  4IF4 A;  3RDI A;  3K1M A;  4ZZD A;  4QWQ A;  1NHA A;  4M9S A;  3LWF A;  4Q48 A;  5DUI A;  1EH7 A;  1SAX A;  3CUQ B;  1W7P A;  2W25 A;  4ENJ A;  3KZZ A;  2FNP A;  3U9G A;  3LA3 A;  4JBA A;  3W6K B;  5D4R A;  2MH2 A;  2JPC A;  2G9W A;  5E8I A;  3I53 A;  1D8J A;  3T5X A;  2VBZ A;  1ODD A;  1Z6T A;  2P7V B;  2DI3 A;  2L02 A;  4EV0 A;  3D5L A;  1I27 A;  1KQ0 A;  1GXQ A;  3HTU A;  4B09 A;  5K5O A;  3F8C A;  5D8K B;  1XN7 A;  3BWG A;  1O3R A;  3GLX A;  2IT0 A;  3KP6 A;  2CG4 A;  2HYF A;  5HDK A;  3HUG A;  2QYO A;  5ICC A;  2Y0M A;  4IVN A;  5LRR A;  1GVJ A;  1BC8 C;  2FEZ A;  5FD6 A;  1RNL A;  4IRG A;  5DUK A;  4ZYE A;  1F4K A;  1OKR A;  3TKY A;  2QQ9 A;  1FBS A;  3MEX A;  4G6D A;  3WTU C;  4R8H A;  3V7C A;  3FF5 A;  4CZZ A;  4ASN A;  4OMY A;  3HOS A;  3E6D A;  1EH8 A;  2A61 A;  4I01 A;  5L3C A;  4UV8 A;  2DTR A;  4UVB A;  2HGC A;  2DLL A;  4P9U A;  5E18 F;  1MDM B;  5CLS A;  3RPU A;  5IT3 A;  3JSP A;  1IZ1 A;  2ESH A;  5BQT A;  2GXG A;  2QZ8 A;  2RC4 A;  4KN7 X;  4LFU A;  4YFX F;  1JE8 A;  4HF1 A;  1YIO A;  3H92 A;  1O57 A;  4LGW A;  3I0T A;  3VFZ A;  3REO A;  2XAJ A;  5L3E A;  1HW2 A;  2QVO A;  3FWE A;  1CF7 A;  2P5K A;  3HRM A;  2H09 A;  3K0L A;  4M6Y A;  1USS A;  4ZZL A;  3CO7 C;  3MWM A;  3JW4 A;  3BOQ A;  4PDK A;  2G7U A;  2K7L A;  4GGG A;  3FHZ A;  2RQP A;  2VE9 A;  3WOD F;  3COA C;  3QPH A;  3WTY C;  3P7N A;  5IT9 Z;  3J80 K;  2FF4 A;  3HRT A;  3QP6 A;  6PAX A;  4EGY A;  3VOD A;  3LA2 A;  5KK1 A;  3ZN1 A;  4KNY A;  1QQI A;  5CVJ A;  1ZGJ A;  2F2E A;  1HW5 A;  1RI7 A;  2VBW A;  1DPR A;  4A2U A;  1K78 B;  5HDG A;  1P6R A;  1VTN C;  5ILV A;  2CW0 F;  1XMA A;  3LST A;  3TDZ C;  5BMZ A;  1C0W A;  1I1G A;  2MBF A;  2R3S A;  1ZH5 A;  5LHI A;  1Z9C A;  4RGU A;  5J8F A;  1I6X A;  4KIB A;  1B9M A;  5D6E A;  4TV7 A;  4BQA A;  4MQ9 F;  1LJ9 A;  2TDX A;  1OYW A;  4O6J A;  3IKV A;  3T8R A;  1U2W A;  4ZH4 F;  1GHC A;  2AS5 F;  2XUB A;  2EA2 A;  3W6J B;  1UHW A;  3SZP A;  1EH6 A;  2KKO A;  2PMH A;  2H94 A;  5ICF A;  1IXS B;  2NYX A;  1V3F A;  5KVR A;  4WXD A;  2PBI A;  4RB3 C;  3I5U A;  2XRO A;  3WTS C;  4I0A A;  2XV4 S;  2K86 A;  4KDP A;  4RGS A;  4LK0 F;  2HFH A;  1ZHF A;  2ZNZ A;  4LD5 A;  1P92 A;  3BJ6 A;  1PP8 F;  1JHF A;  5K5R A;  1XMK A;  4ZYD A;  4EGZ A;  1BN5 A;  4KFC A;  2D2W A;  1KYW A;  2EFQ A;  2PI0 A;  1XDS A;  4HBL A;  1R7J A;  1U3E M;  4Q4Z F;  5TRD A;  3V4G A;  5D5X B;  3K1N A;  3ZMV A;  3RPQ A;  2K02 A;  2UWM A;  3EDP A;  2PEX A;  3CO6 C;  1YW9 A;  2COM A;  3ZQ7 A;  3QRF F;  2DO7 A;  4A5M A;  1FBQ A;  3I54 A;  5LBQ A;  2WC2 A;  3HTS B;  3HOT A;  3C18 A;  2BV6 A;  1J0R A;  3BRO A;  1IN5 A;  1YW7 A;  2Z99 A;  3E5X A;  1JXS A;  3WGG A;  1F9N A;  1AOY A;  1JGS A;  3GWZ A;  3CDH A;  1ZGA A;  3T1B A;  2QWW A;  2RNJ A;  3LFK A;  3O2P E;  3V8K A;  2M30 A;  3FXU A;  3RTR A;  4WXC A;  5HS7 A;  5FLX Z;  2LNB A;  2ZME B;  3WE3 A;  4IHT A;  3EUH A;  3G3Z A;  4LG0 A;  4MNU A;  2DAO A;  2KRF A;  2JZY A;  3KLO A;  4LJZ F;  2VON A;  3JAM K;  4XRF A;  3GFL A;  4ETS A;  1DPU A;  1R1V A;  2GA2 A;  1S6L A;  4HDV A;  2VOD A;  1QGP A;  1KU3 A;  1YW8 A;  4U0W A;  4H0E A;  2QQB A;  1T98 A;  3E5U A;  2RVC A;  4YFK F;  3CUO A;  1HKQ A;  2VC1 A;  2HQR A;  2XRN A;  2WTE A;  3OV8 A;  2QBY B;  5LRS A;  1TW3 A;  1WKM A;  4CO8 A;  3CUQ A;  4HQE A;  4AD9 A;  3WE2 A;  4Z2Y A;  5D5V B;  2M87 A;  4CXF A;  3ULQ B;  1WWX A;  3L09 A;  2UXX A;  1DDN A;  2EV6 A;  4A6D A;  2W84 A;  2A6E F;  2OQG A;  3GYH X;  1G4D A;  5E1X A;  3HIF A;  4M9X A;  5CVU A;  1WSU A;  4ENN A;  4L9V A;  3M1E A;  4M6X A;  4BYY A;  1LDJ A;  1Z05 A;  2XAQ A;  1XCV A;  5DEQ A;  2VT3 A;  4ESB A;  2UXN A;  4PCQ A;  1TQM A;  1BC7 C;  3WTV C;  4YII A;  1G3Y A;  2ZCW A;  3FX3 A;  4A12 A;  2H27 A;  3KFW X;  2M1B A;  1G3W A;  4EJO A;  2IVM A;  4HF2 A;  2D1V A;  2L4A A;  2EV0 A;  2O61 A;  1Z91 A;  2PMU A;  4KIC A;  2ISZ A;  4P9F A;  3J7A O;  1OR7 A;  4WCG A;  4L9J A;  5E20 A;  2RV8 A;  5ICE A;  1U5T C;  3HSR A;  3WTX C;  4OIQ F;  3TO9 A;  3TOB A;  3KCC A;  3TDU C;  2FMY A;  2DT5 A;  1MDM A;  4ZYH A;  1XD7 A;  1B1B A;  1HW1 A;  1SFU A;  3O6B B;  3IC7 A;  1BI1 A;  2QLZ A;  4HX4 A;  4G8X A;  2M5W A;  2OBP A;  3HRU A;  4RGR A;  3DEU A;  4G7H F;  1ULY A;  1O3S A;  4NB5 A;  4GYI A;  4L0Y B;  5CJ9 A;  3V8L A;  1KU9 A;  4DQ2 A;  3MZY A;  3C7J A;  2DPD A;  5F6F A;  1OMI A;  3F8M A;  3OOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...