3VB2A

Crystal structure of the reduced form of marr from e.coli
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
136
structure length
136
Chain Sequence
b'NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multiple antibiotic resistance protein marR
publication title The reduced form of MarR structure
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 46
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3vb2A00
3L7WA 4KN7X 5IT9K 4BHBA 2W24A 4UVAA 2DAOA 5CVRA 3H3ZA 1AWCA 2VN2A 2O0YA 3P9CA 5D5XB 4WXHA 2PI0A 2EK5A 3GVAA 3HTUA 2IVMA 3WU1B 2HZTA 1E17A 3E5XA 2Z33A 2XAFA 1D3YA 2H6CA 1R36A 1QPMA 2MH9A 1F5TA 5HLGA 2ZJ2A 2CGPA 3IKVA 2QBYA 3BJ6A 4BAYA 5FLXZ 3ULQB 3EYIA 3LA3A 1PDNC 3IWZA 3LAJA 4ZYGA 3Q5FA 1MDMB 1MGTA 2HTJA 2OZ6A 4PGHA 1BI3A 3M1EA 3WGHA 4HOBA 2Y48A 5CVUA 4KIGA 2BBYA 3D5LA 3HUGA 1HKSA 3KP7A 1BIAA 1IXSB 2XRNA 2EJRA 1O3SA 5TJJA 1IAWA 5LEKA 4OMZA 2O3FA 5H6QA 3J81K 3TDUC 3T1BA 3SZTA 1XGOA 1S6LA 4HAMA 4WF2A 3PFIA 3I58A 3F8MA 3CO6C 2CFXA 3ZMVA 5D8KB 5HDGA 2MBFA 3RTRA 2QWWA 3V7RA 5L3BA 5FD6A 2ZCWA 1PP7U 1IZ1A 2JSCA 1D8KA 1K78B 3JW4A 2XAJA 1LJ9A 4QLCU 2PFBA 2OA4A 2EV0A 4S04A 2LDUA 4JQFA 5HDNA 4IJAA 2X4HA 1P2FA 3BJAA 2FQ3A 5D8LB 3F21A 3C3WA 1BI0A 1WSUA 3ZPLA 5E17F 2JPBA 4KT5C 2ISYA 4CICA 3DP7A 2D2WA 2IA0A 1STZA 1HKQA 3HSEA 5BS6A 2VE9A 1B59A 1W7PB 3BOQA 4WCGA 1G3SA 3O6BB 4M74A 1FYKA 1XGNA 5FLXK 2W85A 1FYLA 1Z6RA 2LSOA 3B73A 2FXAA 1K7AA 2DTRA 2NNNA 3T8RA 4YG2F 2P7VB 3F6VA 4P55A 2G7UA 2PBIA 3FM3A 1O3QA 1HBXG 1R58A 1KQ0A 3MQ0A 3C1DA 4WXDA 3F22A 1RUOA 3K69A 4FT8A 4EJVA 4AIHA 3KP4A 4ENMA 3V7SA 3SXYA 4OIPF 1SFEA 4JK1X 2QBYB 1P4WA 2STTA 3I0TA 2DK8A 4BYYA 3SQNA 1XGSA 4CGZA 3T0YA 1NHAA 3ISPA 3V8LA 4XSXF 2QENA 3E6DA 4HYEA 2DBBA 1J0RA 4GCVA 2F5DA 4U0VA 3TDZC 3GXOA 5J8CA 2M87A 3H3UA 3ROUA 5LGTA 2M45A 3LAPA 2FBHA 2K4BA 3CO7C 4OIOF 5AONA 2XHKA 3KLOA 2L02A 2DQLA 3D0SA 1B6AA 2EFOA 5A2QZ 2PEXA 3ABTA 3I5UA 3RIRA 1LVAA 2GA2A 2JRTA 2FOKA 2GXGA 3DF8A 2D45A 2A68F 3I54A 2FMYA 3IRQA 3Q9VA 1QQIA 3ZMUA 3RPUA 2HFHA 3BP8A 1FLIA 1IN8A 3VB2A 5BOXA 3G3ZA 1F1ZA 1TNSA 1CGPA 1W7PD 1GHCA 3I59B 2CQKA 4Y17A 2RQPA 3GFJA 4A0XA 1T6SA 1KU9A 4A0YA 5E1ZB 5HOOA 1R1UA 1S7AA 3K1PA 3LA7A 1R1TA 3WG9A 2J5PA 5D5WB 4DQ2A 4R1HA 3DFGA 4R8HA 3RPQA 2BEOA 1U2WA 2H27A 1J2XA 5F6FA 4G7ZF 2E1NA 3WTWC 3DQVC 3AAFA 4LLLA 2EV5A 2EWNA 1XDUA 3F3XA 3LSTA 1BI2A 4ZYHA 2COMA 1FPQA 1YS7A 2XV4S 5LEJA 4HF1A 4XBFA 2PG4A 4IRIA 1QBJA 5D6EA 3HHGA 2V6CA 5HS7A 2P5VA 5A2QK 5LHIA 4LLNA 1I1SA 5HLIA 2OU2A 4IPAA 4U88A 4LGWA 5JVTA 1KYWA 2UXNA 2XGXA 2HWVA 4CDGA 3QPTA 3M8EA 1UCRA 4M9ZA 1IUYA 3L9FA 4L9JA 4FX4A 4MQ9F 1BJAA 2V9VA 4ENNA 1B1BA 3SFZA 3S2WA 4Y13A 2VOOA 5LRRA 1LQ1A 3IL2A 1TTYA 1BC7C 4FX0A 1SFUA 3KP3A 3M7GA 1ZARA 4GO1A 4A5NA 3OOPA 1KU3A 2P4WA 1XN7A 3RKWA 5L3EA 5K5OA 2HTSA 2FBKA 4KMUX 1BIBA 1T39A 3KP6A 5AIPA 2EFPA 2RNJA 3LQRA 2FNAA 1CF7A 2QM3A 3J7AO 4A5MA 1I6XA 2QQAA 3IHUA 1U8RA 3EUHA 3SHFA 3FXQA 4G94A 3V8KA 5LLQA 1LDKB 2OQRA 1FSHA 4WX9A 2BYVE 1XD7A 1LEBA 2GWRA 2E7XA 4CXFA 3KLNA 1XCVA 5CLSA 4I02A 2IA2A 2G9WA 1RUNA 4FHTA 4AWXB 1SMTA 2Z5UA 3HRUA 4TV7A 1KGSA 3GF2A 4P96A 3E5UA 2HGCA 4HV6A 1Z6TA 4ZH4F 3LA2A 4NHJA 2XIGA 1YQAA 3QU3A 2ZKZA 1MJBA 1YFHA 2CSOA 1HSTA 1Q1HA 1R7JA 4N9IA 1XMAA 5BQTA 2OD5A 3ECOA 1R5GA 5HVQC 4M6XA 4A12A 2QQBA 1RNLA 2GA1A 1HW1A 1U78A 4G8XA 3DPLC 4MTDA 4NQWA 1S29A 5K1YA 4LB5A 2RN7A 5L3GA 1G4DA 1IXRC 4K2EA 2Q8KA 3FMQA 2EA2A 1DUXC 4HBLA 1W5SA 1R5HA 2EA4A 1RIOH 3QP5A 3HSFA 2L54A 4YFXF 2V79A 4PCQA 3DEUA 1EH7A 3V7CA 1V3FA 3BPVA 5FFZA 3LFKA 5J8FA 5BPIA 4A6DA 5BPDA 2KIMA 4PZJA 2JTVA 1HXDA 4EVIA 1XSDA 4KIBA 1A04A 1FC3A 1MD0A 4H0EA 3EQLF 4UVCA 4BNCA 5AIQA 4IXAA 3LWFA 4M9SA 2FU4A 2DPDA 2FEZA 4Y15A 4AVPA 1FP1D 4ESFA 2XAGA 5FFXA 1Z9CA 5ILUA 4LK1F 3GZ5A 1S8NA 2EV6A 5E18F 3FMRA 3CTAA 3E97A 2VOPA 4OOIA 4OIQF 3KZZA 4UVBA 1USTA 3TO6A 5FO5A 1CF7B 3DPTA 3WTSC 2XAQA 3KEQA 4BHPA 1OMIA 1TW3A 2CO5A 4RS8A 5D5UB 1HKTA 1B9MA 3ABUA 4BXUA 2UXXA 5DCMA 1J5YA 2EFWA 4A6EA 3R4KA 2GQQA 3F6OA 2Z3YA 1YW8A 1PP8F 3N97A 4RGRA 2A6HF 3FX3A 1G3WA 2RDPA 3CUOA 3KE2A 1YW7A 1P4XA 4O5VA 1G3TA 3RKYA 3VOEA 5ILVA 4HQEA 4GYGA 2PMUA 5DCFA 1YLFA 3JSOA 1WRJA 3N4MA 4L5IA 5JFRA 1IRFA 5E8IA 1REPC 4L9VA 3L09A 4UV9A 3M8FA 1R23A 1HW2A 3GFLA 2MC3A 3IRRA 1I5ZA 1ON1A 3FXUA 4Q4ZF 1ZG5A 5HDKA 2IRFG 3EYYA 2PMHA 5DUKA 3MWMA 1TLHB 3FZVA 4IRGA 3PQJA 3O3KA 2ETHA 2P6SA 3F8BA 2VT2A 5L3CA 1SD4A 2P6TA 1YW9A 5DDGA 4GYIA 3EETA 1MZBA 4LMYA 2Y75A 4N9HA 1FZPB 3GW2A 2ESNA 3GX4X 1KU2A 2ADUA 1U5TA 3E6CC 3T5XA 4U7BA 2F5CA 2XAHA 1FNNA 2MA3A 3HOTA 4HX4A 1TW2A 2KIFA 3V4GA 1S7OA 3JTGA 5HS8A 4EGYA 2W25A 3M9AA 4LLGF 3HSRA 2QVOA 1YO5C 5FGMA 3ECHA 5ICCA 3U1DA 3DV8A 4I98B 3H92A 3IC7A 4IVNA 3L2CA 4XRFA 1ZRFA 1QGPA 4G7OF 1DDNA 3BROA 3WE2A 3ZMTA 5ERIA 1O57A 5F64A 1ON2A 2D1VA 1FY7A 3BWGA 2K02A 2LF8A 5LBQA 1ZGJA 3KETA 2DQRA 5D5VB 2O6GE 1WKMA 4MEYF 4YFNF 2QQ9A 2XUBA 4XSZF 1LDDA 5JHUA 2P8TA 1HW5A 3F23A 4KYWA 2VBXA 2HYGD 4A2UA 2RGVA 1P4AA 2ZNZA 2ZNYA 3MCZA 1ULYA 4RB3C 1MJAA 4U0YA 2G7HA 3CDHA 5CJ9A 1O7LA 2D1HA 4M73A 1ZG1A 1FT9A 1TNTA 4M9XA 5D6FA 2WWYA 4GGGA 3V8JA 2C6YA 2ZMEA 4YFKF 5ICEA 5LRSA 3WTXC 1J7KA 3QPHA 1J9IA 4RB1A 2NRAC 1H9GA 4EJUA 1KQ8A 4P9FA 4WXCA 2K86A 1KYZA 5HS9A 1H0MA 3OV8A 3K1NA 2VONA 2QLZA 4IRHA 1XSXA 3HIFA 5FD5A 2NAZA 4ZZDA 1RZ4A 1DPUA 3ML6A 2F2EA 2Y0MA 5E8GA 2NS0A 5E20A 3KP2A 1LNWA 4HX8A 4KA4A 3P9KA 2P5KA 2IA1A 1I27A 3ZQ7A 4KDPA 4ETSA 4RB2C 4ENJA 3ERED 4L0YB 5CVVA 2A69F 1BM9A 3GUDA 2FA5A 3MAJA 1K79A 4RAYA 2ESHA 5CYVA 3NEUA 1Z91A 4ON0A 1DPRA 1TQMA 4KFCA 3ZMSA 4UUVA 1JHFA 3P7NA 2VBYA 2F5FA 2YPRA 3R60A 4UNOA 1ZGAA 3O2PE 4AIKA 1WWXA 2HDCA 1LB2A 3HHHA 5KVRA 5D4RA 2L3DA 1IN5A 2E1CA 2Q2EA 3I53A 2J5OA 5K5QA 2VC1A 3VFZA 1R22A 4I01A 2YX4A 4M6YA 4N0BA 4EMSA 3TKYA 1BC8C 1XDSA 1G6NA 4EJTA 4OINF 1P92A 1OKRA 2F5EA 4Z2YA 2HKXA 1T38A 1KQ9A 2V1UA 3JAMZ 3HRMA 3IWFA 3NQOA 1OR7A 4F7ZA 4MHGA 2DK5A 1YTYA 1XMKA 2IW5A 2H09A 1V4RA 2CW0F 3QRFF 1ZLKA 1J75A 2K27A 4EJOA 1FBSA 3ZMZA 3K2ZA 2MH2A 1E2XA 3RJPA 2ZMEB 1UFMA 4EM1A 4HDUA 1O3RA 1ODDA 2HEOA 5EEGA 2R3SA 4P5OA 5TRDA 4E70A 1VTNC 1O3TA 4LG0A 1K6OA 3QU6A 1W5TA 1ZYRF 5DYMA 4L5JA 2PN6A 2DPUA 4AD9A 2CG4A 4I7HA 1IXCA 2YX7A 4L9TA 4HF0A 3WTVC 2O61A 3ZP5A 3BZ6A 3I71A 1BI1A 1FOKA 2DW4A 3I4PA 2WC2A 1EV7A 1ZG3A 3KEOA 2VC0A 2VBZA 4RGXA 5FB2A 2XKOA 3WTZA 2LKPA 3QAHA 1Y0UA 3U2RA 2MLGA 2A6EF 4HV5A 5IT3A 4LB6B 3LQQA 2DU9A 4U0WA 2FBIA 2QUFA 1TQIA 2XVCA 2ELHA 5LHHA 4B09A 4LJZF 5E1XA 2HYFA 3RI4A 1B4AA 1L3LA 1BOAA 5JR3A 2KJBA 5DV5A 2A61A 4Q5SF 3JAMK 1R1VA 2FMLA 2MD5A 4B8XA 5LHGA 4YIIA 1W4MA 5F1RA 3F8FA 1SAXA 1OYYA 3G73A 3R0JA 3DXJF 2FRHA 1GVJA 1OPCA 2XKPA 3MZHA 2VBWA 5L3DA 2BV6A 3RYRA 3HYIA 4RB0A 3E6MA 1TQPA 1WQ2A 2ZBKA 4UXNA 1FSEA 2KRFA 4RGUA 1ZREA 3TGNA 4DNCA 3BDDA 1Z1DA 2IT0A 2FNPA 3U9GA 2A5YB 3KFWX 3C18A 5EEHA 3GLXA 4L0ZB 3HRSA 2M8EA 1XCBA 5DD4A 4HLXA 1C0WA 1WI9A 1U6GA 4IF4A 4PGGA 3CJNA 1SD6A 2V1XA 5LGUA 5L3FA 4I09A 1UHWA 5K5RA 5CVJA 4I0BA 3J80Z 2ZFWA 3MEXA 2NNYA 4JBAA 2B0LA 2PLYA 2V1DA 4EV0A 1DP7P 1F9NA 3I59A 1QZZA 1EH8A 4M71A 1FBQA 4KICA 1F4KA 1UB9A 4IHSA 3R0AA 2IJLA 3ZN0A 2M1BA 3WODF 3GFMA 1YIOA 3BJOA 1IRGA 1IN4A 4LG0B 2HS5A 2JT1A 5ICGA 2RV8A 1IF1A 2GAUA 4EM2A 2ZO4A 5H20A 6PAXA 3HOSA 3KCCA 3CUQA 2YR2A 5ILSA 1USSA 2XASA 3FF5A 4P9UA 4NB5A 4L18B 3RYPA 4U7DA 2M5WA 4KMFA 3WU0A 3WGGA 2DFIA 2IP2A 4R79A 4AIJA 4QWQA 2OQGA 2AXLA 4BQAA 3ELKA 4RGSA 1FP2A 3TO9A 1JHHA 2ZXJA 3GWZA 4EM0B 2P5LC 1QNTA 5HLHA 3WGIA 5LGNA 3W6JB 1ONVA 4IHTA 2H6BA 4KN4X 3WTTC 3E6BA 2GZWA 1P6RA 4YIFA 2PQ8A 4O6JA 3K9TA 2RC4A 1SD5A 2JPCA 3K1MA 3F72A 3BPXA 4KIFA 1QO0D 1FYMA 2P7CB 2L4MA 1T2KA 5J6XA 5ICFA 4OIRF 2GXBA 1FX7A 2L4AA 3IKTA 1JXSA 2MLKA 1PUEE 4ESJA 3J80K 1Z7UA 4EQQA 5DD8A 4RAZA 3NRVA 2JZYA 3TOAA 3GZ6A 1XGMA 3P9IA 2HR3A 1D8JA 2Z9OA 1O7FA 1BN5A 2YSRA 2AS5F 2KKOA 3SZPA 2K4JA 3CLOA 3QP6A 2GIVA 4LFUA 2EFNA 4G7HF 5E1WA 3GFIA 3ZN1A 5H6RA 2CYYA 1I1GA 2HOEA 2FE3A 1IW7F 4HX7A 4WWCA 2H94A 5DCMB 1OYWA 3EDPA 2OBPA 4LD5A 1H9TA 3T8TA 2KJCA 1AOYA 2WTEA 2HQNA 3WTUC 1T0FA 4I2OA 1Z05A 4HF2A 3TOBA 2L01A 4BHCA 3E3VA 1JE8A 2QZ8A 1X3UA 2RKHA 4ZZLA 2DI3A 3Q9SA 2W84A 3FM5A 2UZKA 4BH9A 2XROA 5CVIA 3HRTA 4ASNA 2DO7A 3R6SA 2CWEA 3L00A 1ZN2A 1RI7A 1ZAOA 1FBUA 2Q0OA 3CUQB 4XLPF 1U3EM 1T98A 3VODA 3RKXA 3F8NA 5D4SA 2YU3A 4A0ZA 2OAZA 1OYIA 3WE3A 4MEXF 4KUMA 4G9YA 4CYDA 2BE5F 3KZYA 2EFQA 1HSJA 2R7FA 5JI6A 1MKMA 3COAC 1HQCA 2ACJA 4MTEA 3B02A 4HLYA 4CHUA 2O8XA 2A07F 3FHZA 2QYOA 1XB4A 3VEPA 3RDIA 2O03A 1U5TB 2VE8A 2WV0A 3FWEA 2IPQX 4S05A 1ZRDA 4WK8F 2DLLA 3QOPA 2LNBA 2HKOA 3C7JA 4L9NA 4PDKA 1LEAA 1GXPA 3F8CA 3HTSB 1ZH5A 2LF7A 1BBYA 1LDJA 1MDMA 2EB7A 2K7LA 3E5QA 1IN6A 5DEQA 1QZYA 2PJPA 3MFKA 3GO5A 5KK1A 4G6QA 4MQVA 3R61A 3KP5A 5IT9Z 4G6DA 3MZYA 1D5VA 3JSPA 2HQRA 4HA8A 1YYVA 4OU0A 3K0LA 1YG2A 1ZLJA 1G3YA 4ENKA 4Q48A 2R7DA 1IN7A 3I64A 1L0OC 2Z99A 2NYXA 2RVCA 4HW0A 1SFXA 3GYHX 1TBXA 5BMZA 4O3MA 2STWA 2X0LA 1KU7A 4ZYEA 1JGSA 2W57A 2ISZA 1ZRCA 4OMYA 4EGZA 1K78A 1B9NA 4GXOA 4XLNF 2VT3A 3WTYC 4HDVA 4HQMA 4EJWA 3W6KB 1KA8A 5DUIA 3CUQC 1ZHFA 2FF4A 3PQKA 3TO7A 4I0AA 1R00A 3JTHA 3GEZA 4ESBA 3FXRA 3J81Z 4CZZA 1SMYF 2KIUA 4M72A 3TQNA 1YS6A 1XSVA 2BGCA 1SD7A 2VXZA 4Q47A 1GXQA 1MJ9A 4KNYA 4HZFA 2UWMA 1W7PA 1U5TC 2M30A 4UV8A 4MNUA 2DT5A 2FSWA 2E7WA 3BY6A 4ZYDA 1S3JA 5ED4A 1UHMA 4CO8A 4MGRA 2VODA 3DKWA 2A3SA 1EH6A 2OZUA 1J59A 2TDXA 3REOA 1FWZA 4D0PA 4UHTA 4LK0F 3ZMDA 3FMSA
chains in the Genus database with same CATH superfamily
3L7WA 4KN7X 5IT9K 4BHBA 3KZIC 2OC6A 2W24A 4UVAA 4XQFA 1ETWA 2DAOA 5CVRA 3H3ZA 3CCUI 2EZHA 1AWCA 2VN2A 3K4MA 2O0YA 3P9CA 5D5XB 4WXHA 4Y4RA 2PI0A 3TL4X 1IUFA 1UMQA 2EK5A 1XX5A 3GVAA 3HGYA 3HTUA 2IVMA 3WU1B 4BDZA 2HZTA 1E17A 2F5VA 3E5XA 2Z33A 1BW6A 2XAFA 1D3YA 2H6CA 2XGEA 1R36A 3DPUA 1QPMA 2MH9A 2WV1A 4ZDLA 3Q0UA 4XLAA 1F5TA 5HLGA 5CKTA 2ZJ2A 3TBIA 1RPWA 2CGPA 3IKVA 4XOPA 2QBYA 3BJ6A 4BAYA 5FLXZ 2LKSA 3ULQB 3EYIA 9ANTA 4ANJA 3LA3A 4BL0B 1PDNC 3IWZA 5B1AH 3LAJA 5M5YJ 4ZYGA 3Q5FA 2KL4A 1MDMB 1MGTA 2HTJA 1TWCJ 1JUMA 2OZ6A 2BY3A 4PGHA 1BI3A 5CQGA 3M1EA 2B9SA 1PYVA 3LOCA 3WGHA 4HOBA 2Y48A 5CVUA 4KIGA 2BBYA 3D5LA 1SEUA 3HUGA 2OV7A 2KDZA 1HKSA 1T56A 3BTCA 2DOFA 3KP7A 3U21A 1BIAA 1IXSB 2XRNA 2R7UA 2EJRA 3PNYA 1O3SA 5TJJA 2WAQA 1IAWA 5LEKA 4OMZA 3L1PA 2R7TA 1WJAA 5TGTA 3AFHA 1SVLA 2O3FA 5H6QA 3J81K 3BR1A 2KLOA 3TDUC 3T1BA 3SZTA 1XGOA 4NUBA 1S6LA 4HAMA 2VQGA 3FXMA 3PFIA 4WF2A 2VPRA 4KISA 2LMDA 2XPWA 3I58A 3F8MA 3FIWA 3J7AY 3CO6C 5HODA 2JSPA 3PUFA 2X6OA 2CFXA 2I10A 3ZMVA 2CV0A 5D8KB 5HDGA 2MBFA 3UKGA 3BG6A 3RTRA 2QWWA 3V7RA 5L3BA 1FOXA 5FD6A 2ZCWA 2W82A 1X4PA 1PP7U 1IZ1A 2JSCA 1D8KA 1K78B 2ZXHA 1A31A 2M8GX 3JW4A 2XAJA 2NVUB 3VPRA 1LJ9A 2HVQA 1Y1VJ 3CCRI 4QLCU 2PFBA 1EF4A 4A3BJ 2OA4A 2EV0A 4S04A 1R9TJ 2LDUA 2N8GA 2K40A 4PFPA 1VQ8I 4JQFA 5HDNA 4IJAA 5KCMA 2X4HA 1P2FA 3BJAA 2FQ3A 2BY2A 5D8LB 3F21A 2ZSHB 3C3WA 1ACIA 2BW3B 1LE8A 1NTCA 5IOYA 4CH7A 5FLMJ 1BI0A 1Y56A 2XPVA 1WSUA 3PM1A 3ZPLA 5E17F 2JPBA 5EGOA 4KT5C 2Y2ZA 2ISYA 3RZOJ 4HPQA 4CICA 3DP7A 2D2WA 2JVHA 2IA0A 2R4GA 4Y33A 3LSKA 1STZA 1HKQA 4E7JA 3HSEA 3GTQJ 5BS6A 2VE9A 1SANA 1V5EA 4UB6C 3B6CA 4DYQA 5FROA 1Z0XA 4XRMA 3HB9A 2CV1A 2VUMJ 1B59A 1W7PB 3BOQA 1DU6A 4WCGA 3HPHA 3MVPA 1G3SA 3O6BB 4II3A 4M74A 1FYKA 1XGNA 2V6EA 5FLXK 4CCOA 2W85A 4NDLA 1FYLA 1VQ5I 3H1CA 1Z6RA 4DZPA 1V5GA 2LSOA 2X6XA 1P9QC 2KPMA 1W0UA 3B73A 2LBFA 1X4OA 5JVGF 2OTLI 1SVMA 2FXAA 1K7AA 2DTRA 1WJFA 5DM6F 2NNNA 3BTJA 2GM4A 3T8RA 4YG2F 2P7VB 3F6VA 3CZ6A 3QWLA 1XG1A 4CCKA 4P55A 4UUSA 2G7UA 2R5ZA 2PBIA 3FM3A 1O3QA 4AYBA 4ZDOA 1HBXG 1R58A 2IS2A 1KQ0A 4PJMA 1IC8A 3GTMJ 2QGUA 3MQ0A 3C1DA 4WXDA 2I5UA 4BJ5C 3F22A 1WJ5A 1RUOA 3K69A 4FT8A 5B66C 3PO2J 5F08A 4EJVA 3OYCA 1H8AC 4HG2A 5K7ZA 1LPQA 1MMDA 2E2JJ 4AIHA 3CJRB 3KP4A 1D1CA 4CUGA 4ENMA 3V7SA 1T8IA 3SXYA 5J4VA 4OIPF 1SFEA 3S15J 4A3JJ 2DTZA 4JK1X 3W2WA 3KX2A 2HOSA 2QBYB 1P4WA 1RR7A 2STTA 3I0TA 2DK8A 2E35A 4BYYA 3SQNA 1XGSA 3QYFA 2VB6A 3T0YA 3OS1A 3JREA 4AU7A 5TISC 4CGZA 1NHAA 2HVRA 3ISPA 3V8LA 3PO3J 5FJ8J 3G2BA 4XSXF 2QENA 3E6DA 4HYEA 1WH7A 1AKHB 1A6IA 1OJLA 2DBBA 3HBLA 1J0RA 4ZYAA 3HUGB 4GCVA 2F5DA 3RQ4A 1MMSA 4U0VA 3TDZC 3GXOA 3ZCOA 3IAM2 5J8CA 2DMPA 1YX3A 3CMAI 2M87A 3H3UA 3LSMA 2PX9A 3ROUA 3ZRGA 3F0CA 4BJ6C 5LGTA 2JMWA 2M45A 3LAPA 1W36C 2FBHA 3K6GA 2K4BA 3CO7C 4OIOF 5AONA 2XHKA 3KLOA 2L02A 2VJ4A 4F92B 1VQLI 5IYDJ 2DQLA 3D0SA 1B6AA 2EFOA 2X6YA 5A2QZ 2PEXA 3S1QJ 2AO9A 3ABTA 3I5UA 3RIRA 1UZCA 1W36D 4IEJA 4D1QA 1LVAA 2GA2A 2JRTA 2FOKA 4C2UA 2GXGA 4YIRX 3DF8A 2D45A 5GADJ 2TRTA 2A68F 1V55H 3LNQA 3M1CA 2MG4A 4GRIA 4G6TB 3I54A 2FMYA 5FRMA 3M3YJ 4BS9A 3IRQA 2YU9J 4B4CA 2H1KA 3Q9VA 1QQIA 3ZMUA 3RPUA 1DGWY 2KRHA 2ZSIB 1FTTA 2HFHA 3BP8A 3K4CA 3ZOBA 1FLIA 1IN8A 4HNVA 3VB2A 5BOXA 3G3ZA 1F1ZA 1TNSA 2IGOA 2IGKA 4XICA 2LK2A 1CGPA 1W7PD 3OWTA 2DMQA 2VQCA 1GHCA 2DCEA 4ZC3A 3I59B 2CQKA 3A4CA 4Y17A 3BZKA 2RQPA 3LSRA 1HC8A 3ESWB 3GFJA 4A0XA 4PJLA 4LIVA 1T6SA 3G1MA 3CP8A 1KU9A 2L5QA 5E1ZB 4A0YA 1LE8B 5HOOA 1R1UA 1ETVA 2R7XA 5DM7F 4KITB 4FCYA 4BGDA 3RQIA 1S7AA 3K1PA 5EGOB 2WA0A 3LA7A 1R1TA 2KP6A 3EPZA 5M3MJ 3KYLA 2WAEA 5J1YA 1JJ8C 2O9LA 2BZTA 1X1DA 4XLCA 3WG9A 4ZTJA 2J5PA 2DDBA 2IGMA 3FK7A 3IUOA 2HXOA 1PUFA 5D5WB 1X58A 4IQJA 4DQ2A 2BHYA 4R1HA 2AQEA 3H9JA 2X1EA 3DFGA 3CF2A 4R8HA 1GVDA 3DU5A 3CESA 4FTHA 2M7AA 3RPQA 1POGA 2BEOA 4RLFA 3JRAA 2LD5A 1FTZA 3HM5A 4ZJZA 1U2WA 1W5CC 3H3VK 2XPUA 3I9V2 1ZGWA 2XB5A 2H27A 1J2XA 2LBFB 5F6FA 2QEXI 2LKXA 4G7ZF 2E1NA 2VJIA 3DQVC 3WTWC 3AAFA 4LLLA 2BXYA 2DFHA 2EINH 2EV5A 2EWNA 1T08B 3I56I 3OL4A 1XDUA 3F3XA 3LSTA 1BI2A 4ZYHA 2COMA 1FPQA 2VKVA 1YS7A 1ZELA 2XV4S 5LEJA 2AHQA 4HF1A 4M3BA 2IGNA 4XBFA 3S1MJ 5EG0A 2PG4A 4IRIA 1RR8C 1QBJA 2VPLA 4B44A 4XKWA 5B3SH 2QSGX 5D6EA 2X9DA 3HHGA 2NVYJ 2V6CA 4QPQA 1ETYA 5HS7A 1E3OC 2P5VA 2WB1N 5A2QK 1R71A 5LHIA 4LLNA 3NWSA 2L0KA 2DA4A 2DN0A 3BG5A 1I1SA 5HLIA 2OU2A 3K7AJ 2M4GA 4IPAA 4U88A 5JLXA 4LGWA 5JVTA 1SFKA 1KYWA 2UXNA 4PSXA 2DJIA 2XGXA 2M7BA 2HWVA 3OYIA 4CDGA 4RMNA 5EYRA 3QPTA 3M8EA 1UCRA 4M9ZA 2ECCA 1MSEC 1IUYA 3L9FA 4L9JA 4I76A 4MQ9F 4FX4A 1BJAA 2V9VA 4ENNA 2ZJRF 1HF0A 1B1BA 3W6VA 3SFZA 2IS6A 1DQUA 4FASD 3S2WA 4Y13A 2VOOA 5LRRA 1LQ1A 3IL2A 1PVEA 1TTYA 1BC7C 2L9RA 4FX0A 2DT6A 1SFUA 2DA7A 3KP3A 5F04A 1J09A 1D0ZA 1OCOH 2MSYA 1ZARA 3M7GA 1AHDP 4GO1A 4BBSJ 1R4MB 3M8JA 2E34A 4I6ZA 4A5NA 3HOWJ 3OOPA 1GUUA 1KU3A 2P4WA 5FKOA 1XN7A 3RKWA 5L3EA 5K5OA 2HTSA 2FBKA 1X3WB 3DBRB 4AC0A 5JHFA 4KMUX 1K4TA 1BIBA 2HU9A 2LY2A 3CMEI 1T39A 3KP6A 3KPHA 1YJNI 5AIPA 2EFPA 2JWTA 2RNJA 4JYKA 3K70C 3LQRA 2M4KA 4XONA 2FNAA 3GLLA 1CF7A 2QM3A 5B1BH 3J7AO 4A5MA 1I6XA 1FMWA 2QQAA 1H88C 2HDDA 3IHUA 2LFBA 4BKXA 1U8RA 3IP4B 4NBQA 4FETA 3EUHA 3A2KA 3SHFA 3BCAA 3FXQA 4G94A 1LKXA 3CCEI 4BE1A 3V8KA 4XN3A 1NK3P 1D1BA 3MZ8A 3HPGA 5LLQA 1LDKB 2OQRA 2JA5J 3I4MJ 2CUFA 1FSHA 4WX9A 3V42A 4D9JA 1WJBA 2BYVE 1XD7A 2X48A 1LEBA 2IS4A 4QSHA 1JTXA 2GWRA 3MMYB 1JKPC 2E7XA 4CXFA 4JX4A 3S16J 3KLNA 1XCVA 3ABKH 5CLSA 4I02A 3KIOA 2IA2A 3JR9A 3QOEA 2G9WA 1RUNA 3OIOA 4FHTA 4AWXB 1SMTA 2Z5UA 3P5JA 1WGXA 2E36A 3HRUA 3QYEA 4CYCA 4D7MA 2GOMA 3C2BA 3OSGA 4TV7A 1KGSA 3GF2A 3HZJA 4P96A 2OUMA 4N4NB 3E5UA 3ZQHA 2HGCA 3ERMA 2HXIA 5IP9J 1TWGJ 2A05A 2XB0X 4HV6A 1Z6TA 4ZH4F 4RBOA 4IHWA 3LA2A 4NHJA 2XIGA 1YQAA 3QU3A 1PUFB 2ZKZA 1MJBA 1XC5A 1ZK8A 1YFHA 2FJ1A 2CSOA 1HSTA 1DGRM 1Q1HA 3SYTA 3VSKA 1R7JA 4N9IA 2E2HJ 1PJRA 1XMAA 1IV6A 5BQTA 2TCTA 4XR6A 2OD5A 1A36A 3ECOA 3BG3A 3FXOA 1R5GA 5HVQC 3BCBA 3SZGA 4M6XA 4A12A 5KNLA 2QQBA 1RNLA 2GA1A 2VJJA 1HW1A 1U78A 3PL8A 4G8XA 3DPLC 4MTDA 4NQWA 4BEHA 1S29A 4A69C 5K1YA 4LB5A 2RN7A 2H8WA 2W1OA 2VQHA 5L3GA 2CH0A 1G4DA 4B43A 1ZR4A 1IXRC 1WCMJ 4IOCF 4BQQA 4K2EA 2Q8KA 3FMQA 1ORKA 2E5NA 1UHSA 2DYSH 2EA2A 4H4KC 1DUXC 4HBLA 1W5SA 3CCLI 1R5HA 2YUSA 2EA4A 1RIOH 1NG6A 3QP5A 2KT0A 3HSFA 2L54A 2EQRA 4YFXF 2JK3A 2V79A 4PCQA 3DEUA 1EH7A 3V7CA 2PMZN 2H8RA 1V3FA 3BPVA 3RCOA 5FFZA 2DYRH 4XOTA 3HG9A 3TW6A 4JX5A 3LFKA 5J8FA 2DOAA 5BPIA 2V1NA 1Z67A 2ID6A 3OYJA 4A6DA 2XF5A 5BPDA 2KIMA 4PZJA 2JTVA 3GBGA 2X51A 2HPMA 4V19K 1HXDA 1S9HA 2R93J 1EKEA 1YOVB 4BXXJ 3E7LA 4GFBA 2JUCA 4EVIA 1QA6A 1XSDA 4KIBA 1D1AA 2P81A 5GP9A 1A04A 1FC3A 1MD0A 4H0EA 2UV1A 3TP0A 3EQLF 4UVCA 3ZQGA 1HDDC 1VQKI 2Q1ZB 3FXJA 4BNCA 5AIQA 4IXAA 3ZGKA 3LWFA 5HLTA 2NVTJ 1GV2A 4C2TA 3GCMA 2GLOA 2CW8A 3M07A 4NC7A 4M9SA 1ERDA 1T0FC 2H1LA 2FU4A 2DPDA 2FEZA 2QCOA 4Y15A 4AVPA 1K61A 1FP1D 3S93A 4Y7NJ 5J1RA 4ESFA 3RPUD 3K2AA 2XAGA 5FFXA 2XF7A 3F9KA 1Z9CA 4E7KA 5ILUA 3FDYA 4LK1F 1RETA 1MBFA 2NVXJ 3BR6A 3GZ5A 1S8NA 2EV6A 2IEKA 1TT0A 5E18F 3FMRA 3CTAA 3MKZA 3QQAA 2XC7A 4DYCA 3E97A 5E3NA 2KQRA 2VOPA 4OOIA 3BTLA 4UUTA 4OIQF 3OL3A 2V4JC 4GDFA 3KZZA 4UVBA 2ME6A 3H36A 4C3IJ 1USTA 5GAHJ 3TO6A 5FO5A 3PIPF 2LLKA 3HOYJ 3VSLA 1CF7B 3DPTA 3HC7A 1MBHA 2NS8A 1VF9A 3WTSC 3ASOH 1Z3XA 1S5LC 1TL8A 2XAQA 3ZXSA 3KEQA 4BHPA 1OMIA 1TW3A 2EZIA 2CO5A 4RS8A 1F36A 2CQNA 5D5UB 3IV5A 1HKTA 1B9MA 2L9NA 1ZQ3P 3ABUA 4BXUA 2UXXA 5DCMA 3ZR8X 1Y8QB 4A3EJ 3KEYA 3HL2A 1BA5A 1J5YA 2EFWA 4OAZA 4A6EA 1T95A 2BOLA 3R4KA 3KYCB 2FOWA 2GQQA 3F6OA 1UELB 2Z3YA 5DTDA 1YW8A 2GIZA 5EJCA 1PP8F 3N97A 4RGRA 2A6HF 3FKIJ 1E3PA 4UB8C 3MKLA 3FX3A 1G3WA 2RDPA 3CUOA 3KE2A 4XKBA 1YW7A 2JA8J 1P4XA 1WHUA 4O5VA 1RKTA 3PFYA 3RZDJ 4DZJA 1G3TA 1ZTRA 3RKYA 2K85A 3VOEA 5ILVA 3K4KA 4HQEA 4CYCB 1MIJA 4GYGA 2PMUA 5DCFA 4B1RA 4ZTFA 1YLFA 3JSOA 3L2QA 2XGCA 5F0FA 1WRJA 3N4MA 4L5IA 1Q1VA 1NK2P 5JFRA 3CCYA 4F52A 1G2HA 3ZQCA 2LG4A 2OF7A 1OFCX 2RNGA 1IRFA 1H89C 1E3HA 3I3LA 5E8IA 1REPC 4L9VA 3L09A 4UV9A 1ZKGA 2CUJA 2HYJA 3JRIA 3M8FA 1R23A 2EIJH 1HW2A 3GFLA 2MC3A 1V5FA 3IRRA 1I5ZA 4IQ4A 2B7EA 2X6WA 1ON1A 2KRCA 3FXUA 1FJLA 3CC7I 4Q4ZF 2QQ8A 1ZG5A 5HDKA 2M0MA 1GT0C 2IRFG 3EYYA 3D1NI 2PMHA 5DUKA 3BTIA 3LSHA 3MWMA 1TLHB 2BY1A 3FZVA 4IRGA 3PQJA 1CQTA 1MMAA 3O3KA 1MNMC 4NQWB 1FIAA 2ETHA 2K9SA 2P6SA 3F8BA 3W2VA 2VT2A 3DU6A 5L3CA 1SD4A 2P6TA 1YW9A 3QPSA 2K3PA 5DDGA 2QKLB 2KMUA 4GYIA 3DTEA 2HOTA 3LSJA 3EETA 1MZBA 4LMYA 2Y75A 3HEFA 4N9HA 1FZPB 3GW2A 4LIUA 2ESNA 3DBHB 3GX4X 1KU2A 2ADUA 2VXDA 2GOXB 1U5TA 3E6CC 3T5XA 4U7BA 2F5CA 2WADA 1XMXA 2XAHA 4QPOA 1FNNA 1SVOA 3NAUA 2MA3A 1QVUA 3WG7H 2VJ5A 3HOTA 4HX4A 1VQNI 4RAGA 1TW2A 2DJNA 2KIFA 3V4GA 2Z2SB 1KONA 2R7VA 1N75A 2CQXA 3PIOF 1V54H 3MD2A 1G8XA 4IOAF 3DEEA 2EIKH 1S7OA 3G1OA 3JTGA 5HS8A 4EGYA 2W25A 3M9AA 4LLGF 3HSRA 2QVOA 4W1UA 5FGMA 1YO5C 3LSGA 3EUHC 3HKZA 1WH5A 3C2GA 3ECHA 4RLQA 3GTGJ 5FKLA 5ICCA 4BACA 3U1DA 2LR8A 1VQ7I 2MW8A 3DV8A 4LG3A 4I98B 1K6YA 3H92A 3IC7A 4IVNA 3L2CA 4DW6A 4XRFA 1ZRFA 1QGPA 4G7OF 4XNFA 1DDNA 4BBRJ 3BROA 3SEZA 3WE2A 3ZMTA 4DJAA 5ERIA 1O57A 3OYAA 5F64A 3BLYA 1ON2A 2D1VA 1FY7A 1N78A 3BWGA 2F48A 2K02A 2LF8A 5LBQA 1VQOI 1ZGJA 3KETA 2DQRA 2QKMB 5D5VB 3W2AA 1RESA 1Z21A 2O6GE 2EILH 2OJED 1FOWA 1WKMA 3HDDA 4MEYF 4YFNF 2QQ9A 2X1DA 2XUBA 4XSZF 3CCQI 1LDDA 2Y69H 5JHUA 2P8TA 2XSDC 3VYRB 1HW5A 1RKWA 3AG4H 3F23A 2L9VA 2VBXA 2HYGD 4KYWA 4A2UA 2IS1A 2RGVA 4B3XA 1P4AA 1D0XA 2DA6A 2JVGA 2ZNZA 2F4OB 1X19A 4BUPA 2ZNYA 3MCZA 1ULYA 4RB3C 3SJMA 5J3LA 4PUSA 1MJAA 4U0YA 4XRSA 2G7HA 2EZKA 2VASA 2K9LA 3CDHA 4OWRB 5CJ9A 2EH3A 2JA2A 1O7LA 2D1HA 3DLAA 4M73A 1ZG1A 2BXZA 1WJDA 2ZFUA 1FT9A 1TNTA 4M9XA 5D6FA 3OYLA 2WWYA 4GGGA 3SDGA 3V8JA 2X1CA 1JI8A 2LRDA 1BOBA 2C6YA 5LD2C 2ZMEA 4YFKF 3OYHA 4AM3A 5ICEA 5LRSA 3BG9A 3WTXC 2NXNB 2LY9A 2BVMA 1J7KA 1NH3A 3QPHA 5F0CA 3L2WA 1J9IA 3OIQA 1Y8RB 4RB1A 1S72I 4F93B 1N77A 2NRAC 1A5JA 1BJZA 3M4OJ 1H9GA 4V2GA 4EJUA 1KQ8A 4RA2A 3DWLE 4P9FA 4WXCA 2K86A 1KYZA 5HS9A 1H0MA 3OV8A 2WAQN 2LYCA 4BJTA 3JRHA 4DBQA 1IG7A 3K1NA 2VONA 2QLZA 3H9GA 3SEQA 1ITYA 4IRHA 1XSXA 3BZCA 1TP4A 3HIFA 5FD5A 2W00A 2FQ4A 2NAZA 2O7OA 1TWHJ 4ZZDA 3A0HC 4A3CJ 1RZ4A 3A03A 4E7LA 2B63J 4S0HB 4UUSB 2GBYA 3AG2H 2DDAA 3ML6A 2R5ZB 1DPUA 2Y30A 2F2EA 4E6KG 3JCUC 2R7SA 2DFEA 2Y0MA 2NS0A 5E8GA 3S32A 3S8PA 5E20A 3K10A 3H0DA 1JKOC 2KFDA 5IPAA 3OYMA 4CSWA 3BG7A 3KP2A 1LNWA 4HX8A 4KA4A 4BXFA 4P1WA 3G1LA 3P9KA 2NS7A 2P5KA 3IH3A 1E0EA 4J19A 2IA1A 2OCCH 4D5CA 1I50J 1I27A 1I3AA 3ZQ7A 4KDPA 4ETSA 2EBIA 2NOJB 3CC2I 1TZLA 1JKRC 4RB2C 4ENJA 3ERED 4L0YB 5CVVA 2A69F 2HOAA 1BM9A 4QTRA 1UJ8A 3GUDA 2FA5A 3MAJA 1K79A 1IDYA 2ZXIA 1GV5A 4XK4A 4PFOA 3PSFA 4RAYA 4BE0A 3AL0C 4AVZA 1Y6IA 2ESHA 2FUG2 3NEUA 1Z91A 5CYVA 4ON0A 1DPRA 1TQMA 4KFCA 3ZMSA 2HZDA 3QODA 5C3EJ 2MABA 3AG1H 4UUVA 1JHFA 5KAFC 1IDZA 2ELJA 3P7NA 5EF6A 3IH2A 1BR4A 2VBYA 2F5FA 2YPRA 2ZC2A 4CCMA 4PJNA 3Q0WA 1BW5A 1WVRA 4FE7A 3B6AA 5F27A 4JP0A 3VYTB 3PJRA 3R60A 1SC7A 2DFFA 3OY9A 4UNOA 1ZGAA 3O2PE 4AIKA 3GTPJ 2DMTA 1WWXA 4PK4A 5K7FA 2VIXA 2HDCA 4RM2A 1LB2A 2LOOA 3HHHA 1FEXA 3E1SA 1ETOA 1I3QJ 5KVRA 4B47A 4DOZA 2CU7A 4BDYA 5D4RA 1IRZA 2K9QA 2L3DA 1IN5A 2E1CA 2Q2EA 3I53A 3CJTB 4C3JJ 1IO2A 3CDIA 5E3LA 2J5OA 3VYSB 4KJZA 2RAEA 2HVSA 4CCNA 1VI0A 1VZ0A 2VC1A 3VFZA 5K5QA 1R22A 2KIQA 4I01A 2YX4A 4E7HA 5FLVA 4M6YA 4C3HJ 4N0BA 3OYBA 4EMSA 3VDXA 2CW7A 3TKYA 1BC8C 1XDSA 2Y0SA 1UG2A 1G6NA 4E7ZA 4EJTA 4OINF 3JRBA 1YI2I 1P92A 1OKRA 2F5EA 4Z2YA 2HKXA 1GLNA 1T38A 4AYBN 1KQ9A 2V1UA 3JAMZ 1F43A 3HRMA 1QPIA 3IWFA 3NQOA 1OR7A 1WJCA 4MHGA 4F7ZA 2DK5A 2VKDA 4QIWN 1YTYA 1VFCA 3AG3H 2CS3A 5LFAA 2FD5A 3J7YJ 1XMKA 2IW5A 2H09A 1V4RA 1MBEA 2QSHX 2CW0F 3DBLB 1I6HJ 3ZQQA 1JTYA 1ETQA 5GTHC 5J4YA 3QRFF 3HOXJ 3RSNA 1ZLKA 1YITI 4XM3A 1J75A 4CCLA 2K27A 4EJOA 1FBSA 3NWTA 3ZMZA 3K2ZA 1YRNA 2AQFA 3CMMA 2MH2A 2CRGA 1E2XA 1KZHA 3RJPA 2ZMEB 1UFMA 4EM1A 4HDUA 1O3RA 4XIDA 1MSFC 1ODDA 1X3ZB 5EEGA 2HEOA 2R3SA 4MO7A 4P5OA 3ONQA 2O5RA 4XKVA 5TRDA 4MFEA 4A3GJ 3FBNB 1OISA 1VQ6I 4E70A 1VTNC 4M3DA 1O3TA 4LG0A 2CJJA 1Z3YA 1K6OA 3QU6A 5EDNA 4XLEA 2LVSA 3H35A 1W5TA 3ZQFA 4AUXA 1ZYRF 5DYMA 4L5JA 1M1EB 4ABZA 2YS9A 2PN6A 5E3MA 1MW7A 1DP3A 2DPUA 4AD9A 2CG4A 4I7HA 1IXCA 2HI3A 2YX7A 4II2A 4L9TA 4HF0A 3S3NA 1UG0A 2L7ZA 3DLLF 3WTVC 2O61A 1O4XA 3ZP5A 3BZ6A 4NNJA 4AIDA 3DTIA 3I71A 2ID3A 3DKXA 1BI1A 1FOKA 2DW4A 1P7JA 3I4PA 4ZDPA 2Z16A 2WC2A 3VYUB 1EV7A 4XLHA 3JRGA 3A1YA 4G12A 1ZG3A 5M5XJ 4M6VA 3KEOA 4A3KJ 2VC0A 2VBZA 4RGXA 3J7ZI 5EG0B 3O8GA 5FB2A 4IHXA 3PNTA 5J1UA 1JGGA 4F3QA 1P7IA 3CCVI 4BY7J 1HDPA 2XKOA 2XRLA 3WTZA 2LKPA 1WZ2A 3QAHA 1Y1WJ 1Y0UA 1W0TA 3U2RA 4MFDA 2MLGA 2A6EF 4HV5A 5IT3A 4LB6B 3LQQA 2DU9A 4U0WA 2FBIA 2WBMA 2QUFA 1TQIA 3ZQIA 2CQQA 2XVCA 3HOVJ 2E5ZA 3X2QH 4B48A 2WY8Q 2ELHA 3BQZA 4XN0A 3BR0A 5LHHA 4B09A 4LJZF 5E1XA 2HYFA 3RI4A 1B4AA 1L3LA 3TEDA 3H5RA 1BOAA 3LL7A 5JR3A 2KJBA 1XS9A 5DV5A 3H9QA 3EUKL 1JT6A 2A61A 2EZLA 4Q5SF 3JAMK 1R1VA 3GTJJ 2FMLA 2NVQJ 2MD5A 4B8XA 1UAAA 5LHGA 1IGNA 3TMOA 3QYBA 4YIIA 4DIQA 1W4MA 5F1RA 3F8FA 1SAXA 1OYYA 3HOUJ 1YX5A 2JRMA 3GTLJ 3G73A 3R0JA 3DEWA 3BR2A 3DXJF 3FHNA 4A3IJ 2FRHA 1AKHA 2HDWA 1GVJA 1OPCA 3CQZJ 2LTPA 2XKPA 2VI6A 3MZHA 1R49A 2ICWG 2VBWA 1LUJB 2CMPA 4HSRA 3SDBA 5L3DA 2QA4I 2BV6A 3RYRA 1FIPA 3HYIA 4RB0A 1LFUP 1B72A 3E6MA 1TQPA 1WQ2A 2ZBKA 4PJJA 4M3EA 4UXNA 1FSEA 2Q2EB 4IX7A 2KRFA 4RGUA 1ZREA 1R5ID 3TGNA 3BDDA 1Z1DA 4BU2A 4DNCA 5EEAA 3CCJI 2IT0A 2FNPA 4XORA 3U9GA 1JT0A 2A5YB 2XSJC 2MD0A 2ZMEC 1HLVA 1QVTA 4FQGA 3KFWX 2M9HA 3C18A 3GLXA 5EEHA 1AA7A 4L0ZB 3K4LA 3HRSA 2M8EA 1XCBA 3JRFA 2ZJPF 5DD4A 4EATA 4HLXA 1BR1A 1C0WA 1WI9A 1U9OA 1U6GA 4XL9A 3HOZJ 4IF4A 4PGGA 2CUZA 4MIMA 5M3FJ 3CJNA 1SD6A 1XTAA 3HJEA 2V1XA 3FISA 4F55A 4F91B 2OCEA 4I99C 5LGUA 5L3FA 5C44J 4IL6C 4I09A 1UHWA 3BR5A 5J40A 5K5RA 2WB1A 4C2MJ 1HCRA 5CVJA 4I0BA 3CCMI 4D5FA 3J80Z 2R7WA 2ZFWA 3MEXA 4BQNA 2NNYA 1GDTA 4JBAA 3VWBA 2B0LA 3OYDA 4BQOA 3G4SI 2PLYA 2UUZA 2V1DA 5GPCA 2AXTC 4EV0A 3S3MA 1DP7P 1ETXA 1F9NA 2DA5A 2M34A 2XGDA 1IV8A 3I59A 1QZZA 4HEA2 1EH8A 2VL8A 1YRNB 2ME0A 1FBQA 4M71A 4KICA 1F4KA 3HXLA 1UB9A 4IHSA 3R0AA 3FBIB 1VNDA 2IJLA 3ZN0A 3CLQA 3BQYA 2M1BA 3WODF 3GFMA 1YIOA 2L9SA 3A0BC 1ENHA 2R5YA 1SFOJ 3BJOA 4BE2A 1Y39A 2K9MA 2EPFA 2XAUA 1IRGA 2A5WA 2L7FP 1IN4A 4ITVA 4LG0B 3D5RC 2HS5A 4IHVA 3ASNH 2JT1A 5ICGA 2RV8A 1IF1A 1HOMA 4UY8I 2GAUA 4EM2A 2ZO4A 3W3CA 4HNTA 3MKYB 5H20A 1K4SA 6PAXA 3HGGA 3KCCA 3HOSA 3CUQA 2HQAA 2YR2A 1NG7A 5ILSA 2DA2A 4BY1J 1WJEA 4IO9F 5IYBJ 4LITA 2Z1DA 4CCJA 1USSA 2XASA 1QU3A 2BY0A 3FF5A 1X1CA 4P9UA 2BHZA 2KZGA 2MGQA 4NB5A 4BEHB 4A3DJ 4L18B 3K4JA 3RYPA 4U7DA 2M5WA 1OCPA 3CP2A 3K4NA 3WU0A 4EEFG 4KMFA 3WGGA 2DFIA 2IP2A 4R79A 4E4HA 4AIJA 4QWQA 2OQGA 2AXLA 1VQMI 1RC9A 4BQAA 3OYGA 3UNGC 3ELKA 2MC4A 4DBRA 4RGSA 1FP2A 2L7KA 3TO9A 3O8HA 5FKNA 1A35A 2Y0SN 2R7OA 4PJ0C 1JHHA 2ZXJA 3JRDA 3ABMH 1JUSA 3GWZA 4EM0B 2P5LC 2D5VA 1QNTA 1TWAJ 5HLHA 3WGIA 2W4SA 3S14J 5LGNA 3W6JB 1ONVA 4HNUA 4YELA 4IHTA 2H6BA 3WU2C 4KN4X 3WTTC 2LY1A 3E6BA 2GZWA 1OCRH 2LREA 1P6RA 3A01A 3BR3A 1MNDA 3FK6A 2DODA 1LFBA 3ZQLA 1K83J 4YIFA 2PQ8A 2FX0A 4O6JA 3K9TA 2RC4A 3S2DJ 1SD5A 1IJWC 4RDUA 2JPCA 3K1MA 3F72A 3BPXA 3L2RA 4FISA 5B5EC 4KIFA 3S1RJ 1QO0D 1FYMA 2P7CB 2KDOA 2L4MA 3OYFA 5J6XA 5ICFA 4OIRF 1T2KA 1LFPA 2GXBA 1FX7A 2L4AA 3IKTA 4J01A 1MBJA 2MLKA 1JXSA 1OCCH 1PUEE 4ESJA 3J80K 1Z7UA 4IHYA 4EQQA 5DD8A 4RAZA 3MKWB 3NRVA 1OR7C 2JZYA 3QPLA 3TOAA 3GZ6A 1ZR2A 1XGMA 3S3OA 4FE4A 3P9IA 5JLWA 2HR3A 4XLFA 4IKFA 2R7RA 1D8JA 2Z9OA 5GAEJ 3CDLA 1O7FA 1BN5A 5FKKA 1WFXA 2JA6J 5GAGJ 2YSRA 2AS5F 4A3LJ 2KKOA 1ETKA 2COBA 1B72B 5IP7J 3SZPA 2ZB9A 2K4JA 3AL0B 3CLOA 3QP6A 2GIVA 3I4NJ 3H5NA 4LFUA 3LSIA 3CC4I 2EFNA 4G7HF 5E1WA 3KYDB 3GFIA 3OYKA 1B8IA 3DCFA 3ZN1A 3CMYA 1R4NB 3S17J 3A02A 5H6RA 2CYYA 1I1GA 2HOEA 4XMYA 2DA3A 2FE3A 2L2OA 1YIJI 2VQLA 4RM3A 4X0GA 2W48A 3GTKJ 2NOGA 1IW7F 2Y9YA 4HX7A 5EZGA 4WWCA 4DGWB 1N25A 1TWFJ 2H94A 5DCMB 4CA0A 2R0QC 1OYWA 3EDPA 2OBPA 2K3FA 2M2EA 4LD5A 2M3AA 1R6RA 1VQ4I 2JJ7A 2PMZA 3T8TA 3OMYA 1H9TA 2KJCA 1AOYA 5C4JJ 2WTEA 5FKMA 2HQNA 3WTUC 3FKJA 1T0FA 4M3GA 3G6EI 4I2OA 2IAIA 1Z05A 3OR2C 2PJRA 2E19A 1OCTC 3L2UA 4HF2A 3TOBA 2WY7Q 2M0CA 2L01A 2VLAA 4BHCA 3WHBA 4Y52J 4YEJA 3D5SC 1QRYA 3E3VA 3OS2A 1JE8A 2QZ8A 1EA3A 4M3FA 1X3UA 3OR1C 2RKHA 3OYEA 4ZZLA 2DI3A 3Q9SA 2W84A 3FM5A 2UZKA 1DU0A 4BH9A 3TW7A 5IYCJ 2XROA 2R5YB 5CVIA 3OOUA 1IRXA 5C4XJ 3HRTA 2F4IA 2E60A 2DO7A 4ASNA 2DXIA 3R6SA 1MMGA 2CWEA 2VKHA 3IAS2 3L00A 4MLOA 5EZHA 2P0WA 1MBKA 1ZN2A 1RI7A 2E1MB 1ZAOA 3WHCA 4IZZA 1Y0NA 1FBUA 5M5WJ 1X2NA 4XRSG 2RREA 5CPRB 5CQEA 2E1OA 5KAIC 5DS9A 3OYNA 3CF5F 3FXLA 2Q0OA 3CUQB 2V9KA 4XLPF 1U3EM 1YE9A 1T98A 3VODA 4NC6A 2MYSA 3RKXA 5GTIC 1XPXA 2LH9A 3E0JB 5BNGA 1RRJA 1JKQC 4OAYA 4J00A 3F8NA 5D4SA 1OQYA 2F4MB 2YU3A 2CFOA 4A0ZA 2OAZA 1OYIA 1D0YA 3WE3A 1U0JA 4KUMA 4MEXF 2JQ7A 2OTJI 4G9YA 4CYDA 2BE5F 2QF7A 3Q3SA 3KZYA 2EFQA 1HSJA 2R7FA 5JI6A 1VQ9I 1MKMA 3GMEA 3COAC 1HQCA 3JRCA 2ACJA 1LVKA 3EUAA 3U1KA 4MTEA 3B02A 1TC3C 4HLYA 1MNEA 2GXAA 3ABLH 2RQQA 4CHUA 2O8XA 2A07F 3CCSI 3FHZA 4RAFA 2QYOA 3L2VA 4XKCA 1G59A 1XB4A 3VEPA 1BR2A 2O03A 3N05A 3RDIA 1U5TB 2VE8A 2WV0A 2QSFX 4N4OB 1Z7LA 2JUGA 3FWEA 2IPQX 4S05A 2KZVA 2O8KA 1ZRDA 4WK8F 2DLLA 3QOPA 2LNBA 2HKOA 2CUEA 3C7JA 4L9NA 4PDKA 1LEAA 1GXPA 3A01B 3F8CA 1X1BA 3HTSB 1ZH5A 1A6QA 2LF7A 4C9YA 1BBYA 3OS0A 1LDJA 4Z6YA 1OLTA 1OCZH 1WPKA 4W97A 1MDMA 1I39A 1WI3A 1MH3A 2EB7A 2LC2A 1X2MA 2K7LA 3E5QA 1IN6A 3I55I 2IBDA 3TP3A 5DEQA 1QZYA 2PJPA 2Y9ZA 3GTOJ 2IXSA 2L7MP 1QZEA 1TT5B 3Q0VA 3MFKA 1QHHD 3GO5A 5KK1A 2KISA 1APLC 4JOMA 4A3MJ 4G6QA 4MQVA 2DOEA 3R61A 2JA7J 2DT7B 3KP5A 5IT9Z 3DKYA 1X1PA 4G6DA 4NC8A 3NARA 3RKQA 3MZYA 1D5VA 2R7QA 2F6CA 3JSPA 2HQRA 2MFZA 4HA8A 2HPIA 2HQ5A 1YYVA 3OIPA 1T33A 2V26A 2Y31A 4OU0A 3S1NJ 3K0LA 1YG2A 1HA8A 1ZLJA 1G3YA 4D7NA 4ENKA 1U9NA 4Q48A 2CV2A 2R7DA 1IN7A 3I64A 1L0OC 2W7NA 5H2FC 1S7EA 2ECBA 1MH4A 1B8IB 2Z99A 2DMNA 2E2IJ 2NYXA 2RVCA 4HW0A 1SFXA 3BT9A 1TBXA 3GYHX 5BMZA 3GZNB 4KT6A 2A6TA 2V9PA 4E7SA 4PSWA 2STWA 4O3MA 2X0LA 3CD6I 5HNFA 1KU7A 5J47A 4ZYEA 1JGSA 2VKEA 2W57A 2G0EA 4E7IA 3IH4A 4LOCA 1ZRCA 3CJQB 3LSPA 2ISZA 4OMYA 4EGZA 2ELKA 1K78A 1FOYA 1B9NA 4Y3OA 4GXOA 4XLNF 5KHDA 2VT3A 5GPAA 3WTYC 1D5YA 4HDVA 2E1MC 4HQMA 3BC8A 4EJWA 3W6KB 4YRVA 1KA8A 2OPTA 5IY5H 5DUIA 1YJ9I 1W1WE 5F1JA 3OSFA 3K70D 3CUQC 1AU7A 2XDVA 3PNVA 5IOZA 4V2FA 4U87A 1ZHFA 2FF4A 3PQKA 3G71I 1YHQI 4A93J 1BL0A 2I8DA 3TO7A 4I0AA 1R00A 2KHMA 3GEZA 2BW3A 3JTHA 4HSTA 4ESBA 3UR3C 2PJRB 3FXRA 3K4BA 3S2HJ 3J81Z 3DTKA 4CZZA 1SMYF 2DMUA 5E79C 2KIUA 4M72A 5K7HA 4X1EA 3TQNA 4A3FJ 1EJ9A 5IP6A 1YS6A 1XSVA 3C2HA 4C30A 4X6AJ 3FXKA 2E71A 1YJWI 1Z77A 2BGCA 1SD7A 2VXZA 2K9NA 4HRIA 4Q47A 1GXQA 3H0GJ 1JUPA 4B3AA 1MJ9A 2EIMH 4L5EA 3SFIA 3MN2A 4KNYA 4HZFA 2ZJQF 2LP0A 2UWMA 1SAUA 1W7PA 2X85A 1VQPI 3HKZN 4CZCA 1U5TC 2JN6A 2M30A 4UV8A 4MNUA 2HNHA 1JJ6C 2CQ7A 2K5CA 3PUBA 3AKZA 2ZXWH 2DT5A 2FSWA 1MBGA 2E7WA 3BY6A 2BVLA 4ZYDA 4DYRA 1S3JA 2DA1A 1UHMA 4CO8A 5ED4A 1U8BA 4MGRA 5FRNA 1QHGA 5E3OA 1X1AA 5HNHA 2VODA 3LFUA 2R92J 3DKWA 3PSIA 2WAFA 4JX6A 1MMNA 3H5AA 3LMMA 2A3SA 2V7FA 1EH6A 2XF6A 2OZUA 1FMVA 1J59A 2R7ZJ 2TDXA 3REOA 1FWZA 5F0HA 4D0PA 4UHTA 4LK0F 3ZMDA 3FMSA
chains in the Genus database with same CATH topology
3L7WA 4KN7X 5IT9K 4BHBA 2W24A 4UVAA 2DAOA 5CVRA 3H3ZA 1AWCA 2VN2A 2O0YA 3P9CA 5D5XB 4WXHA 2PI0A 2EK5A 3GVAA 3HTUA 2IVMA 3WU1B 2HZTA 1E17A 3E5XA 2Z33A 2XAFA 1D3YA 2H6CA 1R36A 1QPMA 2MH9A 1F5TA 5HLGA 2ZJ2A 2CGPA 3IKVA 2QBYA 3BJ6A 4BAYA 5FLXZ 3ULQB 3EYIA 3LA3A 1PDNC 3IWZA 3LAJA 4ZYGA 3Q5FA 1MDMB 1MGTA 2HTJA 2OZ6A 4PGHA 1BI3A 3M1EA 3WGHA 4HOBA 2Y48A 5CVUA 4KIGA 2BBYA 3D5LA 3HUGA 1HKSA 3KP7A 1BIAA 1IXSB 2XRNA 2EJRA 1O3SA 5TJJA 1IAWA 5LEKA 4OMZA 2O3FA 5H6QA 3J81K 3TDUC 3T1BA 3SZTA 1XGOA 1S6LA 4HAMA 4WF2A 3PFIA 3I58A 3F8MA 3CO6C 2CFXA 3ZMVA 5D8KB 5HDGA 2MBFA 3RTRA 2QWWA 3V7RA 5L3BA 5FD6A 2ZCWA 1PP7U 1IZ1A 2JSCA 1D8KA 1K78B 3JW4A 2XAJA 1LJ9A 4QLCU 2PFBA 2OA4A 2EV0A 4S04A 2LDUA 4JQFA 5HDNA 4IJAA 2X4HA 1P2FA 3BJAA 2FQ3A 5D8LB 3F21A 3C3WA 1BI0A 1WSUA 3ZPLA 5E17F 2JPBA 4KT5C 2ISYA 4CICA 3DP7A 2D2WA 2IA0A 1STZA 1HKQA 3HSEA 5BS6A 2VE9A 1B59A 1W7PB 3BOQA 4WCGA 1G3SA 3O6BB 4M74A 1FYKA 1XGNA 5FLXK 2W85A 1FYLA 1Z6RA 2LSOA 3B73A 2FXAA 1K7AA 2DTRA 2NNNA 3T8RA 4YG2F 2P7VB 3F6VA 4P55A 2G7UA 2PBIA 3FM3A 1O3QA 1HBXG 1R58A 1KQ0A 3MQ0A 3C1DA 4WXDA 3F22A 1RUOA 3K69A 4FT8A 4EJVA 4AIHA 3KP4A 4ENMA 3V7SA 3SXYA 4OIPF 1SFEA 4JK1X 2QBYB 1P4WA 2STTA 3I0TA 2DK8A 4BYYA 3SQNA 1XGSA 4CGZA 3T0YA 1NHAA 3ISPA 3V8LA 4XSXF 2QENA 3E6DA 4HYEA 2DBBA 1J0RA 4GCVA 2F5DA 4U0VA 3TDZC 3GXOA 5J8CA 2M87A 3H3UA 3ROUA 5LGTA 2M45A 3LAPA 2FBHA 2K4BA 3CO7C 4OIOF 5AONA 2XHKA 3KLOA 2L02A 2DQLA 3D0SA 1B6AA 2EFOA 5A2QZ 2PEXA 3ABTA 3I5UA 3RIRA 1LVAA 2GA2A 2JRTA 2FOKA 2GXGA 3DF8A 2D45A 2A68F 3I54A 2FMYA 3IRQA 3Q9VA 1QQIA 3ZMUA 3RPUA 2HFHA 3BP8A 1FLIA 1IN8A 3VB2A 5BOXA 3G3ZA 1F1ZA 1TNSA 1CGPA 1W7PD 1GHCA 3I59B 2CQKA 4Y17A 2RQPA 3GFJA 4A0XA 1T6SA 1KU9A 4A0YA 5E1ZB 5HOOA 1R1UA 1S7AA 3K1PA 3LA7A 1R1TA 3WG9A 2J5PA 5D5WB 4DQ2A 4R1HA 3DFGA 4R8HA 3RPQA 2BEOA 1U2WA 2H27A 1J2XA 5F6FA 4G7ZF 2E1NA 3WTWC 3DQVC 3AAFA 4LLLA 2EV5A 2EWNA 1XDUA 3F3XA 3LSTA 1BI2A 4ZYHA 2COMA 1FPQA 1YS7A 2XV4S 5LEJA 4HF1A 4XBFA 2PG4A 4IRIA 1QBJA 5D6EA 3HHGA 2V6CA 5HS7A 2P5VA 5A2QK 5LHIA 4LLNA 1I1SA 5HLIA 2OU2A 4IPAA 4U88A 4LGWA 5JVTA 1KYWA 2UXNA 2XGXA 2HWVA 4CDGA 3QPTA 3M8EA 1UCRA 4M9ZA 1IUYA 3L9FA 4L9JA 4FX4A 4MQ9F 1BJAA 2V9VA 4ENNA 1B1BA 3SFZA 3S2WA 4Y13A 2VOOA 5LRRA 1LQ1A 3IL2A 1TTYA 1BC7C 4FX0A 1SFUA 3KP3A 3M7GA 1ZARA 4GO1A 4A5NA 3OOPA 1KU3A 2P4WA 1XN7A 3RKWA 5L3EA 5K5OA 2HTSA 2FBKA 4KMUX 1BIBA 1T39A 3KP6A 5AIPA 2EFPA 2RNJA 3LQRA 2FNAA 1CF7A 2QM3A 3J7AO 4A5MA 1I6XA 2QQAA 3IHUA 1U8RA 3EUHA 3SHFA 3FXQA 4G94A 3V8KA 5LLQA 1LDKB 2OQRA 1FSHA 4WX9A 2BYVE 1XD7A 1LEBA 2GWRA 2E7XA 4CXFA 3KLNA 1XCVA 5CLSA 4I02A 2IA2A 2G9WA 1RUNA 4FHTA 4AWXB 1SMTA 2Z5UA 3HRUA 4TV7A 1KGSA 3GF2A 4P96A 3E5UA 2HGCA 4HV6A 1Z6TA 4ZH4F 3LA2A 4NHJA 2XIGA 1YQAA 3QU3A 2ZKZA 1MJBA 1YFHA 2CSOA 1HSTA 1Q1HA 1R7JA 4N9IA 1XMAA 5BQTA 2OD5A 3ECOA 1R5GA 5HVQC 4M6XA 4A12A 2QQBA 1RNLA 2GA1A 1HW1A 1U78A 4G8XA 3DPLC 4MTDA 4NQWA 1S29A 5K1YA 4LB5A 2RN7A 5L3GA 1G4DA 1IXRC 4K2EA 2Q8KA 3FMQA 2EA2A 1DUXC 4HBLA 1W5SA 1R5HA 2EA4A 1RIOH 3QP5A 3HSFA 2L54A 4YFXF 2V79A 4PCQA 3DEUA 1EH7A 3V7CA 1V3FA 3BPVA 5FFZA 3LFKA 5J8FA 5BPIA 4A6DA 5BPDA 2KIMA 4PZJA 2JTVA 1HXDA 4EVIA 1XSDA 4KIBA 1A04A 1FC3A 1MD0A 4H0EA 3EQLF 4UVCA 4BNCA 5AIQA 4IXAA 3LWFA 4M9SA 2FU4A 2DPDA 2FEZA 4Y15A 4AVPA 1FP1D 4ESFA 2XAGA 5FFXA 1Z9CA 5ILUA 4LK1F 3GZ5A 1S8NA 2EV6A 5E18F 3FMRA 3CTAA 3E97A 2VOPA 4OOIA 4OIQF 3KZZA 4UVBA 1USTA 3TO6A 5FO5A 1CF7B 3DPTA 3WTSC 2XAQA 3KEQA 4BHPA 1OMIA 1TW3A 2CO5A 4RS8A 5D5UB 1HKTA 1B9MA 3ABUA 4BXUA 2UXXA 5DCMA 1J5YA 2EFWA 4A6EA 3R4KA 2GQQA 3F6OA 2Z3YA 1YW8A 1PP8F 3N97A 4RGRA 2A6HF 3FX3A 1G3WA 2RDPA 3CUOA 3KE2A 1YW7A 1P4XA 4O5VA 1G3TA 3RKYA 3VOEA 5ILVA 4HQEA 4GYGA 2PMUA 5DCFA 1YLFA 3JSOA 1WRJA 3N4MA 4L5IA 5JFRA 1IRFA 5E8IA 1REPC 4L9VA 3L09A 4UV9A 3M8FA 1R23A 1HW2A 3GFLA 2MC3A 3IRRA 1I5ZA 1ON1A 3FXUA 4Q4ZF 1ZG5A 5HDKA 2IRFG 3EYYA 2PMHA 5DUKA 3MWMA 1TLHB 3FZVA 4IRGA 3PQJA 3O3KA 2ETHA 2P6SA 3F8BA 2VT2A 5L3CA 1SD4A 2P6TA 1YW9A 5DDGA 4GYIA 3EETA 1MZBA 4LMYA 2Y75A 4N9HA 1FZPB 3GW2A 2ESNA 3GX4X 1KU2A 2ADUA 1U5TA 3E6CC 3T5XA 4U7BA 2F5CA 2XAHA 1FNNA 2MA3A 3HOTA 4HX4A 1TW2A 2KIFA 3V4GA 1S7OA 3JTGA 5HS8A 4EGYA 2W25A 3M9AA 4LLGF 3HSRA 2QVOA 1YO5C 5FGMA 3ECHA 5ICCA 3U1DA 3DV8A 4I98B 3H92A 3IC7A 4IVNA 3L2CA 4XRFA 1ZRFA 1QGPA 4G7OF 1DDNA 3BROA 3WE2A 3ZMTA 5ERIA 1O57A 5F64A 1ON2A 2D1VA 1FY7A 3BWGA 2K02A 2LF8A 5LBQA 1ZGJA 3KETA 2DQRA 5D5VB 2O6GE 1WKMA 4MEYF 4YFNF 2QQ9A 2XUBA 4XSZF 1LDDA 5JHUA 2P8TA 1HW5A 3F23A 4KYWA 2VBXA 2HYGD 4A2UA 2RGVA 1P4AA 2ZNZA 2ZNYA 3MCZA 1ULYA 4RB3C 1MJAA 4U0YA 2G7HA 3CDHA 5CJ9A 1O7LA 2D1HA 4M73A 1ZG1A 1FT9A 1TNTA 4M9XA 5D6FA 2WWYA 4GGGA 3V8JA 2C6YA 2ZMEA 4YFKF 5ICEA 5LRSA 3WTXC 1J7KA 3QPHA 1J9IA 4RB1A 2NRAC 1H9GA 4EJUA 1KQ8A 4P9FA 4WXCA 2K86A 1KYZA 5HS9A 1H0MA 3OV8A 3K1NA 2VONA 2QLZA 4IRHA 1XSXA 3HIFA 5FD5A 2NAZA 4ZZDA 1RZ4A 1DPUA 3ML6A 2F2EA 2Y0MA 5E8GA 2NS0A 5E20A 3KP2A 1LNWA 4HX8A 4KA4A 3P9KA 2P5KA 2IA1A 1I27A 3ZQ7A 4KDPA 4ETSA 4RB2C 4ENJA 3ERED 4L0YB 5CVVA 2A69F 1BM9A 3GUDA 2FA5A 3MAJA 1K79A 4RAYA 2ESHA 5CYVA 3NEUA 1Z91A 4ON0A 1DPRA 1TQMA 4KFCA 3ZMSA 4UUVA 1JHFA 3P7NA 2VBYA 2F5FA 2YPRA 3R60A 4UNOA 1ZGAA 3O2PE 4AIKA 1WWXA 2HDCA 1LB2A 3HHHA 5KVRA 5D4RA 2L3DA 1IN5A 2E1CA 2Q2EA 3I53A 2J5OA 5K5QA 2VC1A 3VFZA 1R22A 4I01A 2YX4A 4M6YA 4N0BA 4EMSA 3TKYA 1BC8C 1XDSA 1G6NA 4EJTA 4OINF 1P92A 1OKRA 2F5EA 4Z2YA 2HKXA 1T38A 1KQ9A 2V1UA 3JAMZ 3HRMA 3IWFA 3NQOA 1OR7A 4F7ZA 4MHGA 2DK5A 1YTYA 1XMKA 2IW5A 2H09A 1V4RA 2CW0F 3QRFF 1ZLKA 1J75A 2K27A 4EJOA 1FBSA 3ZMZA 3K2ZA 2MH2A 1E2XA 3RJPA 2ZMEB 1UFMA 4EM1A 4HDUA 1O3RA 1ODDA 2HEOA 5EEGA 2R3SA 4P5OA 5TRDA 4E70A 1VTNC 1O3TA 4LG0A 1K6OA 3QU6A 1W5TA 1ZYRF 5DYMA 4L5JA 2PN6A 2DPUA 4AD9A 2CG4A 4I7HA 1IXCA 2YX7A 4L9TA 4HF0A 3WTVC 2O61A 3ZP5A 3BZ6A 3I71A 1BI1A 1FOKA 2DW4A 3I4PA 2WC2A 1EV7A 1ZG3A 3KEOA 2VC0A 2VBZA 4RGXA 5FB2A 2XKOA 3WTZA 2LKPA 3QAHA 1Y0UA 3U2RA 2MLGA 2A6EF 4HV5A 5IT3A 4LB6B 3LQQA 2DU9A 4U0WA 2FBIA 2QUFA 1TQIA 2XVCA 2ELHA 5LHHA 4B09A 4LJZF 5E1XA 2HYFA 3RI4A 1B4AA 1L3LA 1BOAA 5JR3A 2KJBA 5DV5A 2A61A 4Q5SF 3JAMK 1R1VA 2FMLA 2MD5A 4B8XA 5LHGA 4YIIA 1W4MA 5F1RA 3F8FA 1SAXA 1OYYA 3G73A 3R0JA 3DXJF 2FRHA 1GVJA 1OPCA 2XKPA 3MZHA 2VBWA 5L3DA 2BV6A 3RYRA 3HYIA 4RB0A 3E6MA 1TQPA 1WQ2A 2ZBKA 4UXNA 1FSEA 2KRFA 4RGUA 1ZREA 3TGNA 4DNCA 3BDDA 1Z1DA 2IT0A 2FNPA 3U9GA 2A5YB 3KFWX 3C18A 5EEHA 3GLXA 4L0ZB 3HRSA 2M8EA 1XCBA 5DD4A 4HLXA 1C0WA 1WI9A 1U6GA 4IF4A 4PGGA 3CJNA 1SD6A 2V1XA 5LGUA 5L3FA 4I09A 1UHWA 5K5RA 5CVJA 4I0BA 3J80Z 2ZFWA 3MEXA 2NNYA 4JBAA 2B0LA 2PLYA 2V1DA 4EV0A 1DP7P 1F9NA 3I59A 1QZZA 1EH8A 4M71A 1FBQA 4KICA 1F4KA 1UB9A 4IHSA 3R0AA 2IJLA 3ZN0A 2M1BA 3WODF 3GFMA 1YIOA 3BJOA 1IRGA 1IN4A 4LG0B 2HS5A 2JT1A 5ICGA 2RV8A 1IF1A 2GAUA 4EM2A 2ZO4A 5H20A 6PAXA 3HOSA 3KCCA 3CUQA 2YR2A 5ILSA 1USSA 2XASA 3FF5A 4P9UA 4NB5A 4L18B 3RYPA 4U7DA 2M5WA 4KMFA 3WU0A 3WGGA 2DFIA 2IP2A 4R79A 4AIJA 4QWQA 2OQGA 2AXLA 4BQAA 3ELKA 4RGSA 1FP2A 3TO9A 1JHHA 2ZXJA 3GWZA 4EM0B 2P5LC 1QNTA 5HLHA 3WGIA 5LGNA 3W6JB 1ONVA 4IHTA 2H6BA 4KN4X 3WTTC 3E6BA 2GZWA 1P6RA 4YIFA 2PQ8A 4O6JA 3K9TA 2RC4A 1SD5A 2JPCA 3K1MA 3F72A 3BPXA 4KIFA 1QO0D 1FYMA 2P7CB 2L4MA 1T2KA 5J6XA 5ICFA 4OIRF 2GXBA 1FX7A 2L4AA 3IKTA 1JXSA 2MLKA 1PUEE 4ESJA 3J80K 1Z7UA 4EQQA 5DD8A 4RAZA 3NRVA 2JZYA 3TOAA 3GZ6A 1XGMA 3P9IA 2HR3A 1D8JA 2Z9OA 1O7FA 1BN5A 2YSRA 2AS5F 2KKOA 3SZPA 2K4JA 3CLOA 3QP6A 2GIVA 4LFUA 2EFNA 4G7HF 5E1WA 3GFIA 3ZN1A 5H6RA 2CYYA 1I1GA 2HOEA 2FE3A 1IW7F 4HX7A 4WWCA 2H94A 5DCMB 1OYWA 3EDPA 2OBPA 4LD5A 1H9TA 3T8TA 2KJCA 1AOYA 2WTEA 2HQNA 3WTUC 1T0FA 4I2OA 1Z05A 4HF2A 3TOBA 2L01A 4BHCA 3E3VA 1JE8A 2QZ8A 1X3UA 2RKHA 4ZZLA 2DI3A 3Q9SA 2W84A 3FM5A 2UZKA 4BH9A 2XROA 5CVIA 3HRTA 4ASNA 2DO7A 3R6SA 2CWEA 3L00A 1ZN2A 1RI7A 1ZAOA 1FBUA 2Q0OA 3CUQB 4XLPF 1U3EM 1T98A 3VODA 3RKXA 3F8NA 5D4SA 2YU3A 4A0ZA 2OAZA 1OYIA 3WE3A 4MEXF 4KUMA 4G9YA 4CYDA 2BE5F 3KZYA 2EFQA 1HSJA 2R7FA 5JI6A 1MKMA 3COAC 1HQCA 2ACJA 4MTEA 3B02A 4HLYA 4CHUA 2O8XA 2A07F 3FHZA 2QYOA 1XB4A 3VEPA 3RDIA 2O03A 1U5TB 2VE8A 2WV0A 3FWEA 2IPQX 4S05A 1ZRDA 4WK8F 2DLLA 3QOPA 2LNBA 2HKOA 3C7JA 4L9NA 4PDKA 1LEAA 1GXPA 3F8CA 3HTSB 1ZH5A 2LF7A 1BBYA 1LDJA 1MDMA 2EB7A 2K7LA 3E5QA 1IN6A 5DEQA 1QZYA 2PJPA 3MFKA 3GO5A 5KK1A 4G6QA 4MQVA 3R61A 3KP5A 5IT9Z 4G6DA 3MZYA 1D5VA 3JSPA 2HQRA 4HA8A 1YYVA 4OU0A 3K0LA 1YG2A 1ZLJA 1G3YA 4ENKA 4Q48A 2R7DA 1IN7A 3I64A 1L0OC 2Z99A 2NYXA 2RVCA 4HW0A 1SFXA 3GYHX 1TBXA 5BMZA 4O3MA 2STWA 2X0LA 1KU7A 4ZYEA 1JGSA 2W57A 2ISZA 1ZRCA 4OMYA 4EGZA 1K78A 1B9NA 4GXOA 4XLNF 2VT3A 3WTYC 4HDVA 4HQMA 4EJWA 3W6KB 1KA8A 5DUIA 3CUQC 1ZHFA 2FF4A 3PQKA 3TO7A 4I0AA 1R00A 3JTHA 3GEZA 4ESBA 3FXRA 3J81Z 4CZZA 1SMYF 2KIUA 4M72A 3TQNA 1YS6A 1XSVA 2BGCA 1SD7A 2VXZA 4Q47A 1GXQA 1MJ9A 4KNYA 4HZFA 2UWMA 1W7PA 1U5TC 2M30A 4UV8A 4MNUA 2DT5A 2FSWA 2E7WA 3BY6A 4ZYDA 1S3JA 5ED4A 1UHMA 4CO8A 4MGRA 2VODA 3DKWA 2A3SA 1EH6A 2OZUA 1J59A 2TDXA 3REOA 1FWZA 4D0PA 4UHTA 4LK0F 3ZMDA 3FMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7W A;  4KN7 X;  5IT9 K;  4BHB A;  2W24 A;  4UVA A;  2DAO A;  5CVR A;  3H3Z A;  1AWC A;  2VN2 A;  2O0Y A;  3P9C A;  5D5X B;  4WXH A;  2PI0 A;  2EK5 A;  3GVA A;  3HTU A;  2IVM A;  3WU1 B;  2HZT A;  1E17 A;  3E5X A;  2Z33 A;  2XAF A;  1D3Y A;  2H6C A;  1R36 A;  1QPM A;  2MH9 A;  1F5T A;  5HLG A;  2ZJ2 A;  2CGP A;  3IKV A;  2QBY A;  3BJ6 A;  4BAY A;  5FLX Z;  3ULQ B;  3EYI A;  3LA3 A;  1PDN C;  3IWZ A;  3LAJ A;  4ZYG A;  3Q5F A;  1MDM B;  1MGT A;  2HTJ A;  2OZ6 A;  4PGH A;  1BI3 A;  3M1E A;  3WGH A;  4HOB A;  2Y48 A;  5CVU A;  4KIG A;  2BBY A;  3D5L A;  3HUG A;  1HKS A;  3KP7 A;  1BIA A;  1IXS B;  2XRN A;  2EJR A;  1O3S A;  5TJJ A;  1IAW A;  5LEK A;  4OMZ A;  2O3F A;  5H6Q A;  3J81 K;  3TDU C;  3T1B A;  3SZT A;  1XGO A;  1S6L A;  4HAM A;  4WF2 A;  3PFI A;  3I58 A;  3F8M A;  3CO6 C;  2CFX A;  3ZMV A;  5D8K B;  5HDG A;  2MBF A;  3RTR A;  2QWW A;  3V7R A;  5L3B A;  5FD6 A;  2ZCW A;  1PP7 U;  1IZ1 A;  2JSC A;  1D8K A;  1K78 B;  3JW4 A;  2XAJ A;  1LJ9 A;  4QLC U;  2PFB A;  2OA4 A;  2EV0 A;  4S04 A;  2LDU A;  4JQF A;  5HDN A;  4IJA A;  2X4H A;  1P2F A;  3BJA A;  2FQ3 A;  5D8L B;  3F21 A;  3C3W A;  1BI0 A;  1WSU A;  3ZPL A;  5E17 F;  2JPB A;  4KT5 C;  2ISY A;  4CIC A;  3DP7 A;  2D2W A;  2IA0 A;  1STZ A;  1HKQ A;  3HSE A;  5BS6 A;  2VE9 A;  1B59 A;  1W7P B;  3BOQ A;  4WCG A;  1G3S A;  3O6B B;  4M74 A;  1FYK A;  1XGN A;  5FLX K;  2W85 A;  1FYL A;  1Z6R A;  2LSO A;  3B73 A;  2FXA A;  1K7A A;  2DTR A;  2NNN A;  3T8R A;  4YG2 F;  2P7V B;  3F6V A;  4P55 A;  2G7U A;  2PBI A;  3FM3 A;  1O3Q A;  1HBX G;  1R58 A;  1KQ0 A;  3MQ0 A;  3C1D A;  4WXD A;  3F22 A;  1RUO A;  3K69 A;  4FT8 A;  4EJV A;  4AIH A;  3KP4 A;  4ENM A;  3V7S A;  3SXY A;  4OIP F;  1SFE A;  4JK1 X;  2QBY B;  1P4W A;  2STT A;  3I0T A;  2DK8 A;  4BYY A;  3SQN A;  1XGS A;  4CGZ A;  3T0Y A;  1NHA A;  3ISP A;  3V8L A;  4XSX F;  2QEN A;  3E6D A;  4HYE A;  2DBB A;  1J0R A;  4GCV A;  2F5D A;  4U0V A;  3TDZ C;  3GXO A;  5J8C A;  2M87 A;  3H3U A;  3ROU A;  5LGT A;  2M45 A;  3LAP A;  2FBH A;  2K4B A;  3CO7 C;  4OIO F;  5AON A;  2XHK A;  3KLO A;  2L02 A;  2DQL A;  3D0S A;  1B6A A;  2EFO A;  5A2Q Z;  2PEX A;  3ABT A;  3I5U A;  3RIR A;  1LVA A;  2GA2 A;  2JRT A;  2FOK A;  2GXG A;  3DF8 A;  2D45 A;  2A68 F;  3I54 A;  2FMY A;  3IRQ A;  3Q9V A;  1QQI A;  3ZMU A;  3RPU A;  2HFH A;  3BP8 A;  1FLI A;  1IN8 A;  3VB2 A;  5BOX A;  3G3Z A;  1F1Z A;  1TNS A;  1CGP A;  1W7P D;  1GHC A;  3I59 B;  2CQK A;  4Y17 A;  2RQP A;  3GFJ A;  4A0X A;  1T6S A;  1KU9 A;  4A0Y A;  5E1Z B;  5HOO A;  1R1U A;  1S7A A;  3K1P A;  3LA7 A;  1R1T A;  3WG9 A;  2J5P A;  5D5W B;  4DQ2 A;  4R1H A;  3DFG A;  4R8H A;  3RPQ A;  2BEO A;  1U2W A;  2H27 A;  1J2X A;  5F6F A;  4G7Z F;  2E1N A;  3WTW C;  3DQV C;  3AAF A;  4LLL A;  2EV5 A;  2EWN A;  1XDU A;  3F3X A;  3LST A;  1BI2 A;  4ZYH A;  2COM A;  1FPQ A;  1YS7 A;  2XV4 S;  5LEJ A;  4HF1 A;  4XBF A;  2PG4 A;  4IRI A;  1QBJ A;  5D6E A;  3HHG A;  2V6C A;  5HS7 A;  2P5V A;  5A2Q K;  5LHI A;  4LLN A;  1I1S A;  5HLI A;  2OU2 A;  4IPA A;  4U88 A;  4LGW A;  5JVT A;  1KYW A;  2UXN A;  2XGX A;  2HWV A;  4CDG A;  3QPT A;  3M8E A;  1UCR A;  4M9Z A;  1IUY A;  3L9F A;  4L9J A;  4FX4 A;  4MQ9 F;  1BJA A;  2V9V A;  4ENN A;  1B1B A;  3SFZ A;  3S2W A;  4Y13 A;  2VOO A;  5LRR A;  1LQ1 A;  3IL2 A;  1TTY A;  1BC7 C;  4FX0 A;  1SFU A;  3KP3 A;  3M7G A;  1ZAR A;  4GO1 A;  4A5N A;  3OOP A;  1KU3 A;  2P4W A;  1XN7 A;  3RKW A;  5L3E A;  5K5O A;  2HTS A;  2FBK A;  4KMU X;  1BIB A;  1T39 A;  3KP6 A;  5AIP A;  2EFP A;  2RNJ A;  3LQR A;  2FNA A;  1CF7 A;  2QM3 A;  3J7A O;  4A5M A;  1I6X A;  2QQA A;  3IHU A;  1U8R A;  3EUH A;  3SHF A;  3FXQ A;  4G94 A;  3V8K A;  5LLQ A;  1LDK B;  2OQR A;  1FSH A;  4WX9 A;  2BYV E;  1XD7 A;  1LEB A;  2GWR A;  2E7X A;  4CXF A;  3KLN A;  1XCV A;  5CLS A;  4I02 A;  2IA2 A;  2G9W A;  1RUN A;  4FHT A;  4AWX B;  1SMT A;  2Z5U A;  3HRU A;  4TV7 A;  1KGS A;  3GF2 A;  4P96 A;  3E5U A;  2HGC A;  4HV6 A;  1Z6T A;  4ZH4 F;  3LA2 A;  4NHJ A;  2XIG A;  1YQA A;  3QU3 A;  2ZKZ A;  1MJB A;  1YFH A;  2CSO A;  1HST A;  1Q1H A;  1R7J A;  4N9I A;  1XMA A;  5BQT A;  2OD5 A;  3ECO A;  1R5G A;  5HVQ C;  4M6X A;  4A12 A;  2QQB A;  1RNL A;  2GA1 A;  1HW1 A;  1U78 A;  4G8X A;  3DPL C;  4MTD A;  4NQW A;  1S29 A;  5K1Y A;  4LB5 A;  2RN7 A;  5L3G A;  1G4D A;  1IXR C;  4K2E A;  2Q8K A;  3FMQ A;  2EA2 A;  1DUX C;  4HBL A;  1W5S A;  1R5H A;  2EA4 A;  1RIO H;  3QP5 A;  3HSF A;  2L54 A;  4YFX F;  2V79 A;  4PCQ A;  3DEU A;  1EH7 A;  3V7C A;  1V3F A;  3BPV A;  5FFZ A;  3LFK A;  5J8F A;  5BPI A;  4A6D A;  5BPD A;  2KIM A;  4PZJ A;  2JTV A;  1HXD A;  4EVI A;  1XSD A;  4KIB A;  1A04 A;  1FC3 A;  1MD0 A;  4H0E A;  3EQL F;  4UVC A;  4BNC A;  5AIQ A;  4IXA A;  3LWF A;  4M9S A;  2FU4 A;  2DPD A;  2FEZ A;  4Y15 A;  4AVP A;  1FP1 D;  4ESF A;  2XAG A;  5FFX A;  1Z9C A;  5ILU A;  4LK1 F;  3GZ5 A;  1S8N A;  2EV6 A;  5E18 F;  3FMR A;  3CTA A;  3E97 A;  2VOP A;  4OOI A;  4OIQ F;  3KZZ A;  4UVB A;  1UST A;  3TO6 A;  5FO5 A;  1CF7 B;  3DPT A;  3WTS C;  2XAQ A;  3KEQ A;  4BHP A;  1OMI A;  1TW3 A;  2CO5 A;  4RS8 A;  5D5U B;  1HKT A;  1B9M A;  3ABU A;  4BXU A;  2UXX A;  5DCM A;  1J5Y A;  2EFW A;  4A6E A;  3R4K A;  2GQQ A;  3F6O A;  2Z3Y A;  1YW8 A;  1PP8 F;  3N97 A;  4RGR A;  2A6H F;  3FX3 A;  1G3W A;  2RDP A;  3CUO A;  3KE2 A;  1YW7 A;  1P4X A;  4O5V A;  1G3T A;  3RKY A;  3VOE A;  5ILV A;  4HQE A;  4GYG A;  2PMU A;  5DCF A;  1YLF A;  3JSO A;  1WRJ A;  3N4M A;  4L5I A;  5JFR A;  1IRF A;  5E8I A;  1REP C;  4L9V A;  3L09 A;  4UV9 A;  3M8F A;  1R23 A;  1HW2 A;  3GFL A;  2MC3 A;  3IRR A;  1I5Z A;  1ON1 A;  3FXU A;  4Q4Z F;  1ZG5 A;  5HDK A;  2IRF G;  3EYY A;  2PMH A;  5DUK A;  3MWM A;  1TLH B;  3FZV A;  4IRG A;  3PQJ A;  3O3K A;  2ETH A;  2P6S A;  3F8B A;  2VT2 A;  5L3C A;  1SD4 A;  2P6T A;  1YW9 A;  5DDG A;  4GYI A;  3EET A;  1MZB A;  4LMY A;  2Y75 A;  4N9H A;  1FZP B;  3GW2 A;  2ESN A;  3GX4 X;  1KU2 A;  2ADU A;  1U5T A;  3E6C C;  3T5X A;  4U7B A;  2F5C A;  2XAH A;  1FNN A;  2MA3 A;  3HOT A;  4HX4 A;  1TW2 A;  2KIF A;  3V4G A;  1S7O A;  3JTG A;  5HS8 A;  4EGY A;  2W25 A;  3M9A A;  4LLG F;  3HSR A;  2QVO A;  1YO5 C;  5FGM A;  3ECH A;  5ICC A;  3U1D A;  3DV8 A;  4I98 B;  3H92 A;  3IC7 A;  4IVN A;  3L2C A;  4XRF A;  1ZRF A;  1QGP A;  4G7O F;  1DDN A;  3BRO A;  3WE2 A;  3ZMT A;  5ERI A;  1O57 A;  5F64 A;  1ON2 A;  2D1V A;  1FY7 A;  3BWG A;  2K02 A;  2LF8 A;  5LBQ A;  1ZGJ A;  3KET A;  2DQR A;  5D5V B;  2O6G E;  1WKM A;  4MEY F;  4YFN F;  2QQ9 A;  2XUB A;  4XSZ F;  1LDD A;  5JHU A;  2P8T A;  1HW5 A;  3F23 A;  4KYW A;  2VBX A;  2HYG D;  4A2U A;  2RGV A;  1P4A A;  2ZNZ A;  2ZNY A;  3MCZ A;  1ULY A;  4RB3 C;  1MJA A;  4U0Y A;  2G7H A;  3CDH A;  5CJ9 A;  1O7L A;  2D1H A;  4M73 A;  1ZG1 A;  1FT9 A;  1TNT A;  4M9X A;  5D6F A;  2WWY A;  4GGG A;  3V8J A;  2C6Y A;  2ZME A;  4YFK F;  5ICE A;  5LRS A;  3WTX C;  1J7K A;  3QPH A;  1J9I A;  4RB1 A;  2NRA C;  1H9G A;  4EJU A;  1KQ8 A;  4P9F A;  4WXC A;  2K86 A;  1KYZ A;  5HS9 A;  1H0M A;  3OV8 A;  3K1N A;  2VON A;  2QLZ A;  4IRH A;  1XSX A;  3HIF A;  5FD5 A;  2NAZ A;  4ZZD A;  1RZ4 A;  1DPU A;  3ML6 A;  2F2E A;  2Y0M A;  5E8G A;  2NS0 A;  5E20 A;  3KP2 A;  1LNW A;  4HX8 A;  4KA4 A;  3P9K A;  2P5K A;  2IA1 A;  1I27 A;  3ZQ7 A;  4KDP A;  4ETS A;  4RB2 C;  4ENJ A;  3ERE D;  4L0Y B;  5CVV A;  2A69 F;  1BM9 A;  3GUD A;  2FA5 A;  3MAJ A;  1K79 A;  4RAY A;  2ESH A;  5CYV A;  3NEU A;  1Z91 A;  4ON0 A;  1DPR A;  1TQM A;  4KFC A;  3ZMS A;  4UUV A;  1JHF A;  3P7N A;  2VBY A;  2F5F A;  2YPR A;  3R60 A;  4UNO A;  1ZGA A;  3O2P E;  4AIK A;  1WWX A;  2HDC A;  1LB2 A;  3HHH A;  5KVR A;  5D4R A;  2L3D A;  1IN5 A;  2E1C A;  2Q2E A;  3I53 A;  2J5O A;  5K5Q A;  2VC1 A;  3VFZ A;  1R22 A;  4I01 A;  2YX4 A;  4M6Y A;  4N0B A;  4EMS A;  3TKY A;  1BC8 C;  1XDS A;  1G6N A;  4EJT A;  4OIN F;  1P92 A;  1OKR A;  2F5E A;  4Z2Y A;  2HKX A;  1T38 A;  1KQ9 A;  2V1U A;  3JAM Z;  3HRM A;  3IWF A;  3NQO A;  1OR7 A;  4F7Z A;  4MHG A;  2DK5 A;  1YTY A;  1XMK A;  2IW5 A;  2H09 A;  1V4R A;  2CW0 F;  3QRF F;  1ZLK A;  1J75 A;  2K27 A;  4EJO A;  1FBS A;  3ZMZ A;  3K2Z A;  2MH2 A;  1E2X A;  3RJP A;  2ZME B;  1UFM A;  4EM1 A;  4HDU A;  1O3R A;  1ODD A;  2HEO A;  5EEG A;  2R3S A;  4P5O A;  5TRD A;  4E70 A;  1VTN C;  1O3T A;  4LG0 A;  1K6O A;  3QU6 A;  1W5T A;  1ZYR F;  5DYM A;  4L5J A;  2PN6 A;  2DPU A;  4AD9 A;  2CG4 A;  4I7H A;  1IXC A;  2YX7 A;  4L9T A;  4HF0 A;  3WTV C;  2O61 A;  3ZP5 A;  3BZ6 A;  3I71 A;  1BI1 A;  1FOK A;  2DW4 A;  3I4P A;  2WC2 A;  1EV7 A;  1ZG3 A;  3KEO A;  2VC0 A;  2VBZ A;  4RGX A;  5FB2 A;  2XKO A;  3WTZ A;  2LKP A;  3QAH A;  1Y0U A;  3U2R A;  2MLG A;  2A6E F;  4HV5 A;  5IT3 A;  4LB6 B;  3LQQ A;  2DU9 A;  4U0W A;  2FBI A;  2QUF A;  1TQI A;  2XVC A;  2ELH A;  5LHH A;  4B09 A;  4LJZ F;  5E1X A;  2HYF A;  3RI4 A;  1B4A A;  1L3L A;  1BOA A;  5JR3 A;  2KJB A;  5DV5 A;  2A61 A;  4Q5S F;  3JAM K;  1R1V A;  2FML A;  2MD5 A;  4B8X A;  5LHG A;  4YII A;  1W4M A;  5F1R A;  3F8F A;  1SAX A;  1OYY A;  3G73 A;  3R0J A;  3DXJ F;  2FRH A;  1GVJ A;  1OPC A;  2XKP A;  3MZH A;  2VBW A;  5L3D A;  2BV6 A;  3RYR A;  3HYI A;  4RB0 A;  3E6M A;  1TQP A;  1WQ2 A;  2ZBK A;  4UXN A;  1FSE A;  2KRF A;  4RGU A;  1ZRE A;  3TGN A;  4DNC A;  3BDD A;  1Z1D A;  2IT0 A;  2FNP A;  3U9G A;  2A5Y B;  3KFW X;  3C18 A;  5EEH A;  3GLX A;  4L0Z B;  3HRS A;  2M8E A;  1XCB A;  5DD4 A;  4HLX A;  1C0W A;  1WI9 A;  1U6G A;  4IF4 A;  4PGG A;  3CJN A;  1SD6 A;  2V1X A;  5LGU A;  5L3F A;  4I09 A;  1UHW A;  5K5R A;  5CVJ A;  4I0B A;  3J80 Z;  2ZFW A;  3MEX A;  2NNY A;  4JBA A;  2B0L A;  2PLY A;  2V1D A;  4EV0 A;  1DP7 P;  1F9N A;  3I59 A;  1QZZ A;  1EH8 A;  4M71 A;  1FBQ A;  4KIC A;  1F4K A;  1UB9 A;  4IHS A;  3R0A A;  2IJL A;  3ZN0 A;  2M1B A;  3WOD F;  3GFM A;  1YIO A;  3BJO A;  1IRG A;  1IN4 A;  4LG0 B;  2HS5 A;  2JT1 A;  5ICG A;  2RV8 A;  1IF1 A;  2GAU A;  4EM2 A;  2ZO4 A;  5H20 A;  6PAX A;  3HOS A;  3KCC A;  3CUQ A;  2YR2 A;  5ILS A;  1USS A;  2XAS A;  3FF5 A;  4P9U A;  4NB5 A;  4L18 B;  3RYP A;  4U7D A;  2M5W A;  4KMF A;  3WU0 A;  3WGG A;  2DFI A;  2IP2 A;  4R79 A;  4AIJ A;  4QWQ A;  2OQG A;  2AXL A;  4BQA A;  3ELK A;  4RGS A;  1FP2 A;  3TO9 A;  1JHH A;  2ZXJ A;  3GWZ A;  4EM0 B;  2P5L C;  1QNT A;  5HLH A;  3WGI A;  5LGN A;  3W6J B;  1ONV A;  4IHT A;  2H6B A;  4KN4 X;  3WTT C;  3E6B A;  2GZW A;  1P6R A;  4YIF A;  2PQ8 A;  4O6J A;  3K9T A;  2RC4 A;  1SD5 A;  2JPC A;  3K1M A;  3F72 A;  3BPX A;  4KIF A;  1QO0 D;  1FYM A;  2P7C B;  2L4M A;  1T2K A;  5J6X A;  5ICF A;  4OIR F;  2GXB A;  1FX7 A;  2L4A A;  3IKT A;  1JXS A;  2MLK A;  1PUE E;  4ESJ A;  3J80 K;  1Z7U A;  4EQQ A;  5DD8 A;  4RAZ A;  3NRV A;  2JZY A;  3TOA A;  3GZ6 A;  1XGM A;  3P9I A;  2HR3 A;  1D8J A;  2Z9O A;  1O7F A;  1BN5 A;  2YSR A;  2AS5 F;  2KKO A;  3SZP A;  2K4J A;  3CLO A;  3QP6 A;  2GIV A;  4LFU A;  2EFN A;  4G7H F;  5E1W A;  3GFI A;  3ZN1 A;  5H6R A;  2CYY A;  1I1G A;  2HOE A;  2FE3 A;  1IW7 F;  4HX7 A;  4WWC A;  2H94 A;  5DCM B;  1OYW A;  3EDP A;  2OBP A;  4LD5 A;  1H9T A;  3T8T A;  2KJC A;  1AOY A;  2WTE A;  2HQN A;  3WTU C;  1T0F A;  4I2O A;  1Z05 A;  4HF2 A;  3TOB A;  2L01 A;  4BHC A;  3E3V A;  1JE8 A;  2QZ8 A;  1X3U A;  2RKH A;  4ZZL A;  2DI3 A;  3Q9S A;  2W84 A;  3FM5 A;  2UZK A;  4BH9 A;  2XRO A;  5CVI A;  3HRT A;  4ASN A;  2DO7 A;  3R6S A;  2CWE A;  3L00 A;  1ZN2 A;  1RI7 A;  1ZAO A;  1FBU A;  2Q0O A;  3CUQ B;  4XLP F;  1U3E M;  1T98 A;  3VOD A;  3RKX A;  3F8N A;  5D4S A;  2YU3 A;  4A0Z A;  2OAZ A;  1OYI A;  3WE3 A;  4MEX F;  4KUM A;  4G9Y A;  4CYD A;  2BE5 F;  3KZY A;  2EFQ A;  1HSJ A;  2R7F A;  5JI6 A;  1MKM A;  3COA C;  1HQC A;  2ACJ A;  4MTE A;  3B02 A;  4HLY A;  4CHU A;  2O8X A;  2A07 F;  3FHZ A;  2QYO A;  1XB4 A;  3VEP A;  3RDI A;  2O03 A;  1U5T B;  2VE8 A;  2WV0 A;  3FWE A;  2IPQ X;  4S05 A;  1ZRD A;  4WK8 F;  2DLL A;  3QOP A;  2LNB A;  2HKO A;  3C7J A;  4L9N A;  4PDK A;  1LEA A;  1GXP A;  3F8C A;  3HTS B;  1ZH5 A;  2LF7 A;  1BBY A;  1LDJ A;  1MDM A;  2EB7 A;  2K7L A;  3E5Q A;  1IN6 A;  5DEQ A;  1QZY A;  2PJP A;  3MFK A;  3GO5 A;  5KK1 A;  4G6Q A;  4MQV A;  3R61 A;  3KP5 A;  5IT9 Z;  4G6D A;  3MZY A;  1D5V A;  3JSP A;  2HQR A;  4HA8 A;  1YYV A;  4OU0 A;  3K0L A;  1YG2 A;  1ZLJ A;  1G3Y A;  4ENK A;  4Q48 A;  2R7D A;  1IN7 A;  3I64 A;  1L0O C;  2Z99 A;  2NYX A;  2RVC A;  4HW0 A;  1SFX A;  3GYH X;  1TBX A;  5BMZ A;  4O3M A;  2STW A;  2X0L A;  1KU7 A;  4ZYE A;  1JGS A;  2W57 A;  2ISZ A;  1ZRC A;  4OMY A;  4EGZ A;  1K78 A;  1B9N A;  4GXO A;  4XLN F;  2VT3 A;  3WTY C;  4HDV A;  4HQM A;  4EJW A;  3W6K B;  1KA8 A;  5DUI A;  3CUQ C;  1ZHF A;  2FF4 A;  3PQK A;  3TO7 A;  4I0A A;  1R00 A;  3JTH A;  3GEZ A;  4ESB A;  3FXR A;  3J81 Z;  4CZZ A;  1SMY F;  2KIU A;  4M72 A;  3TQN A;  1YS6 A;  1XSV A;  2BGC A;  1SD7 A;  2VXZ A;  4Q47 A;  1GXQ A;  1MJ9 A;  4KNY A;  4HZF A;  2UWM A;  1W7P A;  1U5T C;  2M30 A;  4UV8 A;  4MNU A;  2DT5 A;  2FSW A;  2E7W A;  3BY6 A;  4ZYD A;  1S3J A;  5ED4 A;  1UHM A;  4CO8 A;  4MGR A;  2VOD A;  3DKW A;  2A3S A;  1EH6 A;  2OZU A;  1J59 A;  2TDX A;  3REO A;  1FWZ A;  4D0P A;  4UHT A;  4LK0 F;  3ZMD A;  3FMS A; 
#chains in the Genus database with same CATH topology
 3L7W A;  4KN7 X;  5IT9 K;  4BHB A;  3KZI C;  2OC6 A;  2W24 A;  4UVA A;  4XQF A;  1ETW A;  2DAO A;  5CVR A;  3H3Z A;  3CCU I;  2EZH A;  1AWC A;  2VN2 A;  3K4M A;  2O0Y A;  3P9C A;  5D5X B;  4WXH A;  4Y4R A;  2PI0 A;  3TL4 X;  1IUF A;  1UMQ A;  2EK5 A;  1XX5 A;  3GVA A;  3HGY A;  3HTU A;  2IVM A;  3WU1 B;  4BDZ A;  2HZT A;  1E17 A;  2F5V A;  3E5X A;  2Z33 A;  1BW6 A;  2XAF A;  1D3Y A;  2H6C A;  2XGE A;  1R36 A;  3DPU A;  1QPM A;  2MH9 A;  2WV1 A;  4ZDL A;  3Q0U A;  4XLA A;  1F5T A;  5HLG A;  5CKT A;  2ZJ2 A;  3TBI A;  1RPW A;  2CGP A;  3IKV A;  4XOP A;  2QBY A;  3BJ6 A;  4BAY A;  5FLX Z;  2LKS A;  3ULQ B;  3EYI A;  9ANT A;  4ANJ A;  3LA3 A;  4BL0 B;  1PDN C;  3IWZ A;  5B1A H;  3LAJ A;  5M5Y J;  4ZYG A;  3Q5F A;  2KL4 A;  1MDM B;  1MGT A;  2HTJ A;  1TWC J;  1JUM A;  2OZ6 A;  2BY3 A;  4PGH A;  1BI3 A;  5CQG A;  3M1E A;  2B9S A;  1PYV A;  3LOC A;  3WGH A;  4HOB A;  2Y48 A;  5CVU A;  4KIG A;  2BBY A;  3D5L A;  1SEU A;  3HUG A;  2OV7 A;  2KDZ A;  1HKS A;  1T56 A;  3BTC A;  2DOF A;  3KP7 A;  3U21 A;  1BIA A;  1IXS B;  2XRN A;  2R7U A;  2EJR A;  3PNY A;  1O3S A;  5TJJ A;  2WAQ A;  1IAW A;  5LEK A;  4OMZ A;  3L1P A;  2R7T A;  1WJA A;  5TGT A;  3AFH A;  1SVL A;  2O3F A;  5H6Q A;  3J81 K;  3BR1 A;  2KLO A;  3TDU C;  3T1B A;  3SZT A;  1XGO A;  4NUB A;  1S6L A;  4HAM A;  2VQG A;  3FXM A;  3PFI A;  4WF2 A;  2VPR A;  4KIS A;  2LMD A;  2XPW A;  3I58 A;  3F8M A;  3FIW A;  3J7A Y;  3CO6 C;  5HOD A;  2JSP A;  3PUF A;  2X6O A;  2CFX A;  2I10 A;  3ZMV A;  2CV0 A;  5D8K B;  5HDG A;  2MBF A;  3UKG A;  3BG6 A;  3RTR A;  2QWW A;  3V7R A;  5L3B A;  1FOX A;  5FD6 A;  2ZCW A;  2W82 A;  1X4P A;  1PP7 U;  1IZ1 A;  2JSC A;  1D8K A;  1K78 B;  2ZXH A;  1A31 A;  2M8G X;  3JW4 A;  2XAJ A;  2NVU B;  3VPR A;  1LJ9 A;  2HVQ A;  1Y1V J;  3CCR I;  4QLC U;  2PFB A;  1EF4 A;  4A3B J;  2OA4 A;  2EV0 A;  4S04 A;  1R9T J;  2LDU A;  2N8G A;  2K40 A;  4PFP A;  1VQ8 I;  4JQF A;  5HDN A;  4IJA A;  5KCM A;  2X4H A;  1P2F A;  3BJA A;  2FQ3 A;  2BY2 A;  5D8L B;  3F21 A;  2ZSH B;  3C3W A;  1ACI A;  2BW3 B;  1LE8 A;  1NTC A;  5IOY A;  4CH7 A;  5FLM J;  1BI0 A;  1Y56 A;  2XPV A;  1WSU A;  3PM1 A;  3ZPL A;  5E17 F;  2JPB A;  5EGO A;  4KT5 C;  2Y2Z A;  2ISY A;  3RZO J;  4HPQ A;  4CIC A;  3DP7 A;  2D2W A;  2JVH A;  2IA0 A;  2R4G A;  4Y33 A;  3LSK A;  1STZ A;  1HKQ A;  4E7J A;  3HSE A;  3GTQ J;  5BS6 A;  2VE9 A;  1SAN A;  1V5E A;  4UB6 C;  3B6C A;  4DYQ A;  5FRO A;  1Z0X A;  4XRM A;  3HB9 A;  2CV1 A;  2VUM J;  1B59 A;  1W7P B;  3BOQ A;  1DU6 A;  4WCG A;  3HPH A;  3MVP A;  1G3S A;  3O6B B;  4II3 A;  4M74 A;  1FYK A;  1XGN A;  2V6E A;  5FLX K;  4CCO A;  2W85 A;  4NDL A;  1FYL A;  1VQ5 I;  3H1C A;  1Z6R A;  4DZP A;  1V5G A;  2LSO A;  2X6X A;  1P9Q C;  2KPM A;  1W0U A;  3B73 A;  2LBF A;  1X4O A;  5JVG F;  2OTL I;  1SVM A;  2FXA A;  1K7A A;  2DTR A;  1WJF A;  5DM6 F;  2NNN A;  3BTJ A;  2GM4 A;  3T8R A;  4YG2 F;  2P7V B;  3F6V A;  3CZ6 A;  3QWL A;  1XG1 A;  4CCK A;  4P55 A;  4UUS A;  2G7U A;  2R5Z A;  2PBI A;  3FM3 A;  1O3Q A;  4AYB A;  4ZDO A;  1HBX G;  1R58 A;  2IS2 A;  1KQ0 A;  4PJM A;  1IC8 A;  3GTM J;  2QGU A;  3MQ0 A;  3C1D A;  4WXD A;  2I5U A;  4BJ5 C;  3F22 A;  1WJ5 A;  1RUO A;  3K69 A;  4FT8 A;  5B66 C;  3PO2 J;  5F08 A;  4EJV A;  3OYC A;  1H8A C;  4HG2 A;  5K7Z A;  1LPQ A;  1MMD A;  2E2J J;  4AIH A;  3CJR B;  3KP4 A;  1D1C A;  4CUG A;  4ENM A;  3V7S A;  1T8I A;  3SXY A;  5J4V A;  4OIP F;  1SFE A;  3S15 J;  4A3J J;  2DTZ A;  4JK1 X;  3W2W A;  3KX2 A;  2HOS A;  2QBY B;  1P4W A;  1RR7 A;  2STT A;  3I0T A;  2DK8 A;  2E35 A;  4BYY A;  3SQN A;  1XGS A;  3QYF A;  2VB6 A;  3T0Y A;  3OS1 A;  3JRE A;  4AU7 A;  5TIS C;  4CGZ A;  1NHA A;  2HVR A;  3ISP A;  3V8L A;  3PO3 J;  5FJ8 J;  3G2B A;  4XSX F;  2QEN A;  3E6D A;  4HYE A;  1WH7 A;  1AKH B;  1A6I A;  1OJL A;  2DBB A;  3HBL A;  1J0R A;  4ZYA A;  3HUG B;  4GCV A;  2F5D A;  3RQ4 A;  1MMS A;  4U0V A;  3TDZ C;  3GXO A;  3ZCO A;  3IAM 2;  5J8C A;  2DMP A;  1YX3 A;  3CMA I;  2M87 A;  3H3U A;  3LSM A;  2PX9 A;  3ROU A;  3ZRG A;  3F0C A;  4BJ6 C;  5LGT A;  2JMW A;  2M45 A;  3LAP A;  1W36 C;  2FBH A;  3K6G A;  2K4B A;  3CO7 C;  4OIO F;  5AON A;  2XHK A;  3KLO A;  2L02 A;  2VJ4 A;  4F92 B;  1VQL I;  5IYD J;  2DQL A;  3D0S A;  1B6A A;  2EFO A;  2X6Y A;  5A2Q Z;  2PEX A;  3S1Q J;  2AO9 A;  3ABT A;  3I5U A;  3RIR A;  1UZC A;  1W36 D;  4IEJ A;  4D1Q A;  1LVA A;  2GA2 A;  2JRT A;  2FOK A;  4C2U A;  2GXG A;  4YIR X;  3DF8 A;  2D45 A;  5GAD J;  2TRT A;  2A68 F;  1V55 H;  3LNQ A;  3M1C A;  2MG4 A;  4GRI A;  4G6T B;  3I54 A;  2FMY A;  5FRM A;  3M3Y J;  4BS9 A;  3IRQ A;  2YU9 J;  4B4C A;  2H1K A;  3Q9V A;  1QQI A;  3ZMU A;  3RPU A;  1DGW Y;  2KRH A;  2ZSI B;  1FTT A;  2HFH A;  3BP8 A;  3K4C A;  3ZOB A;  1FLI A;  1IN8 A;  4HNV A;  3VB2 A;  5BOX A;  3G3Z A;  1F1Z A;  1TNS A;  2IGO A;  2IGK A;  4XIC A;  2LK2 A;  1CGP A;  1W7P D;  3OWT A;  2DMQ A;  2VQC A;  1GHC A;  2DCE A;  4ZC3 A;  3I59 B;  2CQK A;  3A4C A;  4Y17 A;  3BZK A;  2RQP A;  3LSR A;  1HC8 A;  3ESW B;  3GFJ A;  4A0X A;  4PJL A;  4LIV A;  1T6S A;  3G1M A;  3CP8 A;  1KU9 A;  2L5Q A;  5E1Z B;  4A0Y A;  1LE8 B;  5HOO A;  1R1U A;  1ETV A;  2R7X A;  5DM7 F;  4KIT B;  4FCY A;  4BGD A;  3RQI A;  1S7A A;  3K1P A;  5EGO B;  2WA0 A;  3LA7 A;  1R1T A;  2KP6 A;  3EPZ A;  5M3M J;  3KYL A;  2WAE A;  5J1Y A;  1JJ8 C;  2O9L A;  2BZT A;  1X1D A;  4XLC A;  3WG9 A;  4ZTJ A;  2J5P A;  2DDB A;  2IGM A;  3FK7 A;  3IUO A;  2HXO A;  1PUF A;  5D5W B;  1X58 A;  4IQJ A;  4DQ2 A;  2BHY A;  4R1H A;  2AQE A;  3H9J A;  2X1E A;  3DFG A;  3CF2 A;  4R8H A;  1GVD A;  3DU5 A;  3CES A;  4FTH A;  2M7A A;  3RPQ A;  1POG A;  2BEO A;  4RLF A;  3JRA A;  2LD5 A;  1FTZ A;  3HM5 A;  4ZJZ A;  1U2W A;  1W5C C;  3H3V K;  2XPU A;  3I9V 2;  1ZGW A;  2XB5 A;  2H27 A;  1J2X A;  2LBF B;  5F6F A;  2QEX I;  2LKX A;  4G7Z F;  2E1N A;  2VJI A;  3DQV C;  3WTW C;  3AAF A;  4LLL A;  2BXY A;  2DFH A;  2EIN H;  2EV5 A;  2EWN A;  1T08 B;  3I56 I;  3OL4 A;  1XDU A;  3F3X A;  3LST A;  1BI2 A;  4ZYH A;  2COM A;  1FPQ A;  2VKV A;  1YS7 A;  1ZEL A;  2XV4 S;  5LEJ A;  2AHQ A;  4HF1 A;  4M3B A;  2IGN A;  4XBF A;  3S1M J;  5EG0 A;  2PG4 A;  4IRI A;  1RR8 C;  1QBJ A;  2VPL A;  4B44 A;  4XKW A;  5B3S H;  2QSG X;  5D6E A;  2X9D A;  3HHG A;  2NVY J;  2V6C A;  4QPQ A;  1ETY A;  5HS7 A;  1E3O C;  2P5V A;  2WB1 N;  5A2Q K;  1R71 A;  5LHI A;  4LLN A;  3NWS A;  2L0K A;  2DA4 A;  2DN0 A;  3BG5 A;  1I1S A;  5HLI A;  2OU2 A;  3K7A J;  2M4G A;  4IPA A;  4U88 A;  5JLX A;  4LGW A;  5JVT A;  1SFK A;  1KYW A;  2UXN A;  4PSX A;  2DJI A;  2XGX A;  2M7B A;  2HWV A;  3OYI A;  4CDG A;  4RMN A;  5EYR A;  3QPT A;  3M8E A;  1UCR A;  4M9Z A;  2ECC A;  1MSE C;  1IUY A;  3L9F A;  4L9J A;  4I76 A;  4MQ9 F;  4FX4 A;  1BJA A;  2V9V A;  4ENN A;  2ZJR F;  1HF0 A;  1B1B A;  3W6V A;  3SFZ A;  2IS6 A;  1DQU A;  4FAS D;  3S2W A;  4Y13 A;  2VOO A;  5LRR A;  1LQ1 A;  3IL2 A;  1PVE A;  1TTY A;  1BC7 C;  2L9R A;  4FX0 A;  2DT6 A;  1SFU A;  2DA7 A;  3KP3 A;  5F04 A;  1J09 A;  1D0Z A;  1OCO H;  2MSY A;  1ZAR A;  3M7G A;  1AHD P;  4GO1 A;  4BBS J;  1R4M B;  3M8J A;  2E34 A;  4I6Z A;  4A5N A;  3HOW J;  3OOP A;  1GUU A;  1KU3 A;  2P4W A;  5FKO A;  1XN7 A;  3RKW A;  5L3E A;  5K5O A;  2HTS A;  2FBK A;  1X3W B;  3DBR B;  4AC0 A;  5JHF A;  4KMU X;  1K4T A;  1BIB A;  2HU9 A;  2LY2 A;  3CME I;  1T39 A;  3KP6 A;  3KPH A;  1YJN I;  5AIP A;  2EFP A;  2JWT A;  2RNJ A;  4JYK A;  3K70 C;  3LQR A;  2M4K A;  4XON A;  2FNA A;  3GLL A;  1CF7 A;  2QM3 A;  5B1B H;  3J7A O;  4A5M A;  1I6X A;  1FMW A;  2QQA A;  1H88 C;  2HDD A;  3IHU A;  2LFB A;  4BKX A;  1U8R A;  3IP4 B;  4NBQ A;  4FET A;  3EUH A;  3A2K A;  3SHF A;  3BCA A;  3FXQ A;  4G94 A;  1LKX A;  3CCE I;  4BE1 A;  3V8K A;  4XN3 A;  1NK3 P;  1D1B A;  3MZ8 A;  3HPG A;  5LLQ A;  1LDK B;  2OQR A;  2JA5 J;  3I4M J;  2CUF A;  1FSH A;  4WX9 A;  3V42 A;  4D9J A;  1WJB A;  2BYV E;  1XD7 A;  2X48 A;  1LEB A;  2IS4 A;  4QSH A;  1JTX A;  2GWR A;  3MMY B;  1JKP C;  2E7X A;  4CXF A;  4JX4 A;  3S16 J;  3KLN A;  1XCV A;  3ABK H;  5CLS A;  4I02 A;  3KIO A;  2IA2 A;  3JR9 A;  3QOE A;  2G9W A;  1RUN A;  3OIO A;  4FHT A;  4AWX B;  1SMT A;  2Z5U A;  3P5J A;  1WGX A;  2E36 A;  3HRU A;  3QYE A;  4CYC A;  4D7M A;  2GOM A;  3C2B A;  3OSG A;  4TV7 A;  1KGS A;  3GF2 A;  3HZJ A;  4P96 A;  2OUM A;  4N4N B;  3E5U A;  3ZQH A;  2HGC A;  3ERM A;  2HXI A;  5IP9 J;  1TWG J;  2A05 A;  2XB0 X;  4HV6 A;  1Z6T A;  4ZH4 F;  4RBO A;  4IHW A;  3LA2 A;  4NHJ A;  2XIG A;  1YQA A;  3QU3 A;  1PUF B;  2ZKZ A;  1MJB A;  1XC5 A;  1ZK8 A;  1YFH A;  2FJ1 A;  2CSO A;  1HST A;  1DGR M;  1Q1H A;  3SYT A;  3VSK A;  1R7J A;  4N9I A;  2E2H J;  1PJR A;  1XMA A;  1IV6 A;  5BQT A;  2TCT A;  4XR6 A;  2OD5 A;  1A36 A;  3ECO A;  3BG3 A;  3FXO A;  1R5G A;  5HVQ C;  3BCB A;  3SZG A;  4M6X A;  4A12 A;  5KNL A;  2QQB A;  1RNL A;  2GA1 A;  2VJJ A;  1HW1 A;  1U78 A;  3PL8 A;  4G8X A;  3DPL C;  4MTD A;  4NQW A;  4BEH A;  1S29 A;  4A69 C;  5K1Y A;  4LB5 A;  2RN7 A;  2H8W A;  2W1O A;  2VQH A;  5L3G A;  2CH0 A;  1G4D A;  4B43 A;  1ZR4 A;  1IXR C;  1WCM J;  4IOC F;  4BQQ A;  4K2E A;  2Q8K A;  3FMQ A;  1ORK A;  2E5N A;  1UHS A;  2DYS H;  2EA2 A;  4H4K C;  1DUX C;  4HBL A;  1W5S A;  3CCL I;  1R5H A;  2YUS A;  2EA4 A;  1RIO H;  1NG6 A;  3QP5 A;  2KT0 A;  3HSF A;  2L54 A;  2EQR A;  4YFX F;  2JK3 A;  2V79 A;  4PCQ A;  3DEU A;  1EH7 A;  3V7C A;  2PMZ N;  2H8R A;  1V3F A;  3BPV A;  3RCO A;  5FFZ A;  2DYR H;  4XOT A;  3HG9 A;  3TW6 A;  4JX5 A;  3LFK A;  5J8F A;  2DOA A;  5BPI A;  2V1N A;  1Z67 A;  2ID6 A;  3OYJ A;  4A6D A;  2XF5 A;  5BPD A;  2KIM A;  4PZJ A;  2JTV A;  3GBG A;  2X51 A;  2HPM A;  4V19 K;  1HXD A;  1S9H A;  2R93 J;  1EKE A;  1YOV B;  4BXX J;  3E7L A;  4GFB A;  2JUC A;  4EVI A;  1QA6 A;  1XSD A;  4KIB A;  1D1A A;  2P81 A;  5GP9 A;  1A04 A;  1FC3 A;  1MD0 A;  4H0E A;  2UV1 A;  3TP0 A;  3EQL F;  4UVC A;  3ZQG A;  1HDD C;  1VQK I;  2Q1Z B;  3FXJ A;  4BNC A;  5AIQ A;  4IXA A;  3ZGK A;  3LWF A;  5HLT A;  2NVT J;  1GV2 A;  4C2T A;  3GCM A;  2GLO A;  2CW8 A;  3M07 A;  4NC7 A;  4M9S A;  1ERD A;  1T0F C;  2H1L A;  2FU4 A;  2DPD A;  2FEZ A;  2QCO A;  4Y15 A;  4AVP A;  1K61 A;  1FP1 D;  3S93 A;  4Y7N J;  5J1R A;  4ESF A;  3RPU D;  3K2A A;  2XAG A;  5FFX A;  2XF7 A;  3F9K A;  1Z9C A;  4E7K A;  5ILU A;  3FDY A;  4LK1 F;  1RET A;  1MBF A;  2NVX J;  3BR6 A;  3GZ5 A;  1S8N A;  2EV6 A;  2IEK A;  1TT0 A;  5E18 F;  3FMR A;  3CTA A;  3MKZ A;  3QQA A;  2XC7 A;  4DYC A;  3E97 A;  5E3N A;  2KQR A;  2VOP A;  4OOI A;  3BTL A;  4UUT A;  4OIQ F;  3OL3 A;  2V4J C;  4GDF A;  3KZZ A;  4UVB A;  2ME6 A;  3H36 A;  4C3I J;  1UST A;  5GAH J;  3TO6 A;  5FO5 A;  3PIP F;  2LLK A;  3HOY J;  3VSL A;  1CF7 B;  3DPT A;  3HC7 A;  1MBH A;  2NS8 A;  1VF9 A;  3WTS C;  3ASO H;  1Z3X A;  1S5L C;  1TL8 A;  2XAQ A;  3ZXS A;  3KEQ A;  4BHP A;  1OMI A;  1TW3 A;  2EZI A;  2CO5 A;  4RS8 A;  1F36 A;  2CQN A;  5D5U B;  3IV5 A;  1HKT A;  1B9M A;  2L9N A;  1ZQ3 P;  3ABU A;  4BXU A;  2UXX A;  5DCM A;  3ZR8 X;  1Y8Q B;  4A3E J;  3KEY A;  3HL2 A;  1BA5 A;  1J5Y A;  2EFW A;  4OAZ A;  4A6E A;  1T95 A;  2BOL A;  3R4K A;  3KYC B;  2FOW A;  2GQQ A;  3F6O A;  1UEL B;  2Z3Y A;  5DTD A;  1YW8 A;  2GIZ A;  5EJC A;  1PP8 F;  3N97 A;  4RGR A;  2A6H F;  3FKI J;  1E3P A;  4UB8 C;  3MKL A;  3FX3 A;  1G3W A;  2RDP A;  3CUO A;  3KE2 A;  4XKB A;  1YW7 A;  2JA8 J;  1P4X A;  1WHU A;  4O5V A;  1RKT A;  3PFY A;  3RZD J;  4DZJ A;  1G3T A;  1ZTR A;  3RKY A;  2K85 A;  3VOE A;  5ILV A;  3K4K A;  4HQE A;  4CYC B;  1MIJ A;  4GYG A;  2PMU A;  5DCF A;  4B1R A;  4ZTF A;  1YLF A;  3JSO A;  3L2Q A;  2XGC A;  5F0F A;  1WRJ A;  3N4M A;  4L5I A;  1Q1V A;  1NK2 P;  5JFR A;  3CCY A;  4F52 A;  1G2H A;  3ZQC A;  2LG4 A;  2OF7 A;  1OFC X;  2RNG A;  1IRF A;  1H89 C;  1E3H A;  3I3L A;  5E8I A;  1REP C;  4L9V A;  3L09 A;  4UV9 A;  1ZKG A;  2CUJ A;  2HYJ A;  3JRI A;  3M8F A;  1R23 A;  2EIJ H;  1HW2 A;  3GFL A;  2MC3 A;  1V5F A;  3IRR A;  1I5Z A;  4IQ4 A;  2B7E A;  2X6W A;  1ON1 A;  2KRC A;  3FXU A;  1FJL A;  3CC7 I;  4Q4Z F;  2QQ8 A;  1ZG5 A;  5HDK A;  2M0M A;  1GT0 C;  2IRF G;  3EYY A;  3D1N I;  2PMH A;  5DUK A;  3BTI A;  3LSH A;  3MWM A;  1TLH B;  2BY1 A;  3FZV A;  4IRG A;  3PQJ A;  1CQT A;  1MMA A;  3O3K A;  1MNM C;  4NQW B;  1FIA A;  2ETH A;  2K9S A;  2P6S A;  3F8B A;  3W2V A;  2VT2 A;  3DU6 A;  5L3C A;  1SD4 A;  2P6T A;  1YW9 A;  3QPS A;  2K3P A;  5DDG A;  2QKL B;  2KMU A;  4GYI A;  3DTE A;  2HOT A;  3LSJ A;  3EET A;  1MZB A;  4LMY A;  2Y75 A;  3HEF A;  4N9H A;  1FZP B;  3GW2 A;  4LIU A;  2ESN A;  3DBH B;  3GX4 X;  1KU2 A;  2ADU A;  2VXD A;  2GOX B;  1U5T A;  3E6C C;  3T5X A;  4U7B A;  2F5C A;  2WAD A;  1XMX A;  2XAH A;  4QPO A;  1FNN A;  1SVO A;  3NAU A;  2MA3 A;  1QVU A;  3WG7 H;  2VJ5 A;  3HOT A;  4HX4 A;  1VQN I;  4RAG A;  1TW2 A;  2DJN A;  2KIF A;  3V4G A;  2Z2S B;  1KON A;  2R7V A;  1N75 A;  2CQX A;  3PIO F;  1V54 H;  3MD2 A;  1G8X A;  4IOA F;  3DEE A;  2EIK H;  1S7O A;  3G1O A;  3JTG A;  5HS8 A;  4EGY A;  2W25 A;  3M9A A;  4LLG F;  3HSR A;  2QVO A;  4W1U A;  5FGM A;  1YO5 C;  3LSG A;  3EUH C;  3HKZ A;  1WH5 A;  3C2G A;  3ECH A;  4RLQ A;  3GTG J;  5FKL A;  5ICC A;  4BAC A;  3U1D A;  2LR8 A;  1VQ7 I;  2MW8 A;  3DV8 A;  4LG3 A;  4I98 B;  1K6Y A;  3H92 A;  3IC7 A;  4IVN A;  3L2C A;  4DW6 A;  4XRF A;  1ZRF A;  1QGP A;  4G7O F;  4XNF A;  1DDN A;  4BBR J;  3BRO A;  3SEZ A;  3WE2 A;  3ZMT A;  4DJA A;  5ERI A;  1O57 A;  3OYA A;  5F64 A;  3BLY A;  1ON2 A;  2D1V A;  1FY7 A;  1N78 A;  3BWG A;  2F48 A;  2K02 A;  2LF8 A;  5LBQ A;  1VQO I;  1ZGJ A;  3KET A;  2DQR A;  2QKM B;  5D5V B;  3W2A A;  1RES A;  1Z21 A;  2O6G E;  2EIL H;  2OJE D;  1FOW A;  1WKM A;  3HDD A;  4MEY F;  4YFN F;  2QQ9 A;  2X1D A;  2XUB A;  4XSZ F;  3CCQ I;  1LDD A;  2Y69 H;  5JHU A;  2P8T A;  2XSD C;  3VYR B;  1HW5 A;  1RKW A;  3AG4 H;  3F23 A;  2L9V A;  2VBX A;  2HYG D;  4KYW A;  4A2U A;  2IS1 A;  2RGV A;  4B3X A;  1P4A A;  1D0X A;  2DA6 A;  2JVG A;  2ZNZ A;  2F4O B;  1X19 A;  4BUP A;  2ZNY A;  3MCZ A;  1ULY A;  4RB3 C;  3SJM A;  5J3L A;  4PUS A;  1MJA A;  4U0Y A;  4XRS A;  2G7H A;  2EZK A;  2VAS A;  2K9L A;  3CDH A;  4OWR B;  5CJ9 A;  2EH3 A;  2JA2 A;  1O7L A;  2D1H A;  3DLA A;  4M73 A;  1ZG1 A;  2BXZ A;  1WJD A;  2ZFU A;  1FT9 A;  1TNT A;  4M9X A;  5D6F A;  3OYL A;  2WWY A;  4GGG A;  3SDG A;  3V8J A;  2X1C A;  1JI8 A;  2LRD A;  1BOB A;  2C6Y A;  5LD2 C;  2ZME A;  4YFK F;  3OYH A;  4AM3 A;  5ICE A;  5LRS A;  3BG9 A;  3WTX C;  2NXN B;  2LY9 A;  2BVM A;  1J7K A;  1NH3 A;  3QPH A;  5F0C A;  3L2W A;  1J9I A;  3OIQ A;  1Y8R B;  4RB1 A;  1S72 I;  4F93 B;  1N77 A;  2NRA C;  1A5J A;  1BJZ A;  3M4O J;  1H9G A;  4V2G A;  4EJU A;  1KQ8 A;  4RA2 A;  3DWL E;  4P9F A;  4WXC A;  2K86 A;  1KYZ A;  5HS9 A;  1H0M A;  3OV8 A;  2WAQ N;  2LYC A;  4BJT A;  3JRH A;  4DBQ A;  1IG7 A;  3K1N A;  2VON A;  2QLZ A;  3H9G A;  3SEQ A;  1ITY A;  4IRH A;  1XSX A;  3BZC A;  1TP4 A;  3HIF A;  5FD5 A;  2W00 A;  2FQ4 A;  2NAZ A;  2O7O A;  1TWH J;  4ZZD A;  3A0H C;  4A3C J;  1RZ4 A;  3A03 A;  4E7L A;  2B63 J;  4S0H B;  4UUS B;  2GBY A;  3AG2 H;  2DDA A;  3ML6 A;  2R5Z B;  1DPU A;  2Y30 A;  2F2E A;  4E6K G;  3JCU C;  2R7S A;  2DFE A;  2Y0M A;  2NS0 A;  5E8G A;  3S32 A;  3S8P A;  5E20 A;  3K10 A;  3H0D A;  1JKO C;  2KFD A;  5IPA A;  3OYM A;  4CSW A;  3BG7 A;  3KP2 A;  1LNW A;  4HX8 A;  4KA4 A;  4BXF A;  4P1W A;  3G1L A;  3P9K A;  2NS7 A;  2P5K A;  3IH3 A;  1E0E A;  4J19 A;  2IA1 A;  2OCC H;  4D5C A;  1I50 J;  1I27 A;  1I3A A;  3ZQ7 A;  4KDP A;  4ETS A;  2EBI A;  2NOJ B;  3CC2 I;  1TZL A;  1JKR C;  4RB2 C;  4ENJ A;  3ERE D;  4L0Y B;  5CVV A;  2A69 F;  2HOA A;  1BM9 A;  4QTR A;  1UJ8 A;  3GUD A;  2FA5 A;  3MAJ A;  1K79 A;  1IDY A;  2ZXI A;  1GV5 A;  4XK4 A;  4PFO A;  3PSF A;  4RAY A;  4BE0 A;  3AL0 C;  4AVZ A;  1Y6I A;  2ESH A;  2FUG 2;  3NEU A;  1Z91 A;  5CYV A;  4ON0 A;  1DPR A;  1TQM A;  4KFC A;  3ZMS A;  2HZD A;  3QOD A;  5C3E J;  2MAB A;  3AG1 H;  4UUV A;  1JHF A;  5KAF C;  1IDZ A;  2ELJ A;  3P7N A;  5EF6 A;  3IH2 A;  1BR4 A;  2VBY A;  2F5F A;  2YPR A;  2ZC2 A;  4CCM A;  4PJN A;  3Q0W A;  1BW5 A;  1WVR A;  4FE7 A;  3B6A A;  5F27 A;  4JP0 A;  3VYT B;  3PJR A;  3R60 A;  1SC7 A;  2DFF A;  3OY9 A;  4UNO A;  1ZGA A;  3O2P E;  4AIK A;  3GTP J;  2DMT A;  1WWX A;  4PK4 A;  5K7F A;  2VIX A;  2HDC A;  4RM2 A;  1LB2 A;  2LOO A;  3HHH A;  1FEX A;  3E1S A;  1ETO A;  1I3Q J;  5KVR A;  4B47 A;  4DOZ A;  2CU7 A;  4BDY A;  5D4R A;  1IRZ A;  2K9Q A;  2L3D A;  1IN5 A;  2E1C A;  2Q2E A;  3I53 A;  3CJT B;  4C3J J;  1IO2 A;  3CDI A;  5E3L A;  2J5O A;  3VYS B;  4KJZ A;  2RAE A;  2HVS A;  4CCN A;  1VI0 A;  1VZ0 A;  2VC1 A;  3VFZ A;  5K5Q A;  1R22 A;  2KIQ A;  4I01 A;  2YX4 A;  4E7H A;  5FLV A;  4M6Y A;  4C3H J;  4N0B A;  3OYB A;  4EMS A;  3VDX A;  2CW7 A;  3TKY A;  1BC8 C;  1XDS A;  2Y0S A;  1UG2 A;  1G6N A;  4E7Z A;  4EJT A;  4OIN F;  3JRB A;  1YI2 I;  1P92 A;  1OKR A;  2F5E A;  4Z2Y A;  2HKX A;  1GLN A;  1T38 A;  4AYB N;  1KQ9 A;  2V1U A;  3JAM Z;  1F43 A;  3HRM A;  1QPI A;  3IWF A;  3NQO A;  1OR7 A;  1WJC A;  4MHG A;  4F7Z A;  2DK5 A;  2VKD A;  4QIW N;  1YTY A;  1VFC A;  3AG3 H;  2CS3 A;  5LFA A;  2FD5 A;  3J7Y J;  1XMK A;  2IW5 A;  2H09 A;  1V4R A;  1MBE A;  2QSH X;  2CW0 F;  3DBL B;  1I6H J;  3ZQQ A;  1JTY A;  1ETQ A;  5GTH C;  5J4Y A;  3QRF F;  3HOX J;  3RSN A;  1ZLK A;  1YIT I;  4XM3 A;  1J75 A;  4CCL A;  2K27 A;  4EJO A;  1FBS A;  3NWT A;  3ZMZ A;  3K2Z A;  1YRN A;  2AQF A;  3CMM A;  2MH2 A;  2CRG A;  1E2X A;  1KZH A;  3RJP A;  2ZME B;  1UFM A;  4EM1 A;  4HDU A;  1O3R A;  4XID A;  1MSF C;  1ODD A;  1X3Z B;  5EEG A;  2HEO A;  2R3S A;  4MO7 A;  4P5O A;  3ONQ A;  2O5R A;  4XKV A;  5TRD A;  4MFE A;  4A3G J;  3FBN B;  1OIS A;  1VQ6 I;  4E70 A;  1VTN C;  4M3D A;  1O3T A;  4LG0 A;  2CJJ A;  1Z3Y A;  1K6O A;  3QU6 A;  5EDN A;  4XLE A;  2LVS A;  3H35 A;  1W5T A;  3ZQF A;  4AUX A;  1ZYR F;  5DYM A;  4L5J A;  1M1E B;  4ABZ A;  2YS9 A;  2PN6 A;  5E3M A;  1MW7 A;  1DP3 A;  2DPU A;  4AD9 A;  2CG4 A;  4I7H A;  1IXC A;  2HI3 A;  2YX7 A;  4II2 A;  4L9T A;  4HF0 A;  3S3N A;  1UG0 A;  2L7Z A;  3DLL F;  3WTV C;  2O61 A;  1O4X A;  3ZP5 A;  3BZ6 A;  4NNJ A;  4AID A;  3DTI A;  3I71 A;  2ID3 A;  3DKX A;  1BI1 A;  1FOK A;  2DW4 A;  1P7J A;  3I4P A;  4ZDP A;  2Z16 A;  2WC2 A;  3VYU B;  1EV7 A;  4XLH A;  3JRG A;  3A1Y A;  4G12 A;  1ZG3 A;  5M5X J;  4M6V A;  3KEO A;  4A3K J;  2VC0 A;  2VBZ A;  4RGX A;  3J7Z I;  5EG0 B;  3O8G A;  5FB2 A;  4IHX A;  3PNT A;  5J1U A;  1JGG A;  4F3Q A;  1P7I A;  3CCV I;  4BY7 J;  1HDP A;  2XKO A;  2XRL A;  3WTZ A;  2LKP A;  1WZ2 A;  3QAH A;  1Y1W J;  1Y0U A;  1W0T A;  3U2R A;  4MFD A;  2MLG A;  2A6E F;  4HV5 A;  5IT3 A;  4LB6 B;  3LQQ A;  2DU9 A;  4U0W A;  2FBI A;  2WBM A;  2QUF A;  1TQI A;  3ZQI A;  2CQQ A;  2XVC A;  3HOV J;  2E5Z A;  3X2Q H;  4B48 A;  2WY8 Q;  2ELH A;  3BQZ A;  4XN0 A;  3BR0 A;  5LHH A;  4B09 A;  4LJZ F;  5E1X A;  2HYF A;  3RI4 A;  1B4A A;  1L3L A;  3TED A;  3H5R A;  1BOA A;  3LL7 A;  5JR3 A;  2KJB A;  1XS9 A;  5DV5 A;  3H9Q A;  3EUK L;  1JT6 A;  2A61 A;  2EZL A;  4Q5S F;  3JAM K;  1R1V A;  3GTJ J;  2FML A;  2NVQ J;  2MD5 A;  4B8X A;  1UAA A;  5LHG A;  1IGN A;  3TMO A;  3QYB A;  4YII A;  4DIQ A;  1W4M A;  5F1R A;  3F8F A;  1SAX A;  1OYY A;  3HOU J;  1YX5 A;  2JRM A;  3GTL J;  3G73 A;  3R0J A;  3DEW A;  3BR2 A;  3DXJ F;  3FHN A;  4A3I J;  2FRH A;  1AKH A;  2HDW A;  1GVJ A;  1OPC A;  3CQZ J;  2LTP A;  2XKP A;  2VI6 A;  3MZH A;  1R49 A;  2ICW G;  2VBW A;  1LUJ B;  2CMP A;  4HSR A;  3SDB A;  5L3D A;  2QA4 I;  2BV6 A;  3RYR A;  1FIP A;  3HYI A;  4RB0 A;  1LFU P;  1B72 A;  3E6M A;  1TQP A;  1WQ2 A;  2ZBK A;  4PJJ A;  4M3E A;  4UXN A;  1FSE A;  2Q2E B;  4IX7 A;  2KRF A;  4RGU A;  1ZRE A;  1R5I D;  3TGN A;  3BDD A;  1Z1D A;  4BU2 A;  4DNC A;  5EEA A;  3CCJ I;  2IT0 A;  2FNP A;  4XOR A;  3U9G A;  1JT0 A;  2A5Y B;  2XSJ C;  2MD0 A;  2ZME C;  1HLV A;  1QVT A;  4FQG A;  3KFW X;  2M9H A;  3C18 A;  3GLX A;  5EEH A;  1AA7 A;  4L0Z B;  3K4L A;  3HRS A;  2M8E A;  1XCB A;  3JRF A;  2ZJP F;  5DD4 A;  4EAT A;  4HLX A;  1BR1 A;  1C0W A;  1WI9 A;  1U9O A;  1U6G A;  4XL9 A;  3HOZ J;  4IF4 A;  4PGG A;  2CUZ A;  4MIM A;  5M3F J;  3CJN A;  1SD6 A;  1XTA A;  3HJE A;  2V1X A;  3FIS A;  4F55 A;  4F91 B;  2OCE A;  4I99 C;  5LGU A;  5L3F A;  5C44 J;  4IL6 C;  4I09 A;  1UHW A;  3BR5 A;  5J40 A;  5K5R A;  2WB1 A;  4C2M J;  1HCR A;  5CVJ A;  4I0B A;  3CCM I;  4D5F A;  3J80 Z;  2R7W A;  2ZFW A;  3MEX A;  4BQN A;  2NNY A;  1GDT A;  4JBA A;  3VWB A;  2B0L A;  3OYD A;  4BQO A;  3G4S I;  2PLY A;  2UUZ A;  2V1D A;  5GPC A;  2AXT C;  4EV0 A;  3S3M A;  1DP7 P;  1ETX A;  1F9N A;  2DA5 A;  2M34 A;  2XGD A;  1IV8 A;  3I59 A;  1QZZ A;  4HEA 2;  1EH8 A;  2VL8 A;  1YRN B;  2ME0 A;  1FBQ A;  4M71 A;  4KIC A;  1F4K A;  3HXL A;  1UB9 A;  4IHS A;  3R0A A;  3FBI B;  1VND A;  2IJL A;  3ZN0 A;  3CLQ A;  3BQY A;  2M1B A;  3WOD F;  3GFM A;  1YIO A;  2L9S A;  3A0B C;  1ENH A;  2R5Y A;  1SFO J;  3BJO A;  4BE2 A;  1Y39 A;  2K9M A;  2EPF A;  2XAU A;  1IRG A;  2A5W A;  2L7F P;  1IN4 A;  4ITV A;  4LG0 B;  3D5R C;  2HS5 A;  4IHV A;  3ASN H;  2JT1 A;  5ICG A;  2RV8 A;  1IF1 A;  1HOM A;  4UY8 I;  2GAU A;  4EM2 A;  2ZO4 A;  3W3C A;  4HNT A;  3MKY B;  5H20 A;  1K4S A;  6PAX A;  3HGG A;  3KCC A;  3HOS A;  3CUQ A;  2HQA A;  2YR2 A;  1NG7 A;  5ILS A;  2DA2 A;  4BY1 J;  1WJE A;  4IO9 F;  5IYB J;  4LIT A;  2Z1D A;  4CCJ A;  1USS A;  2XAS A;  1QU3 A;  2BY0 A;  3FF5 A;  1X1C A;  4P9U A;  2BHZ A;  2KZG A;  2MGQ A;  4NB5 A;  4BEH B;  4A3D J;  4L18 B;  3K4J A;  3RYP A;  4U7D A;  2M5W A;  1OCP A;  3CP2 A;  3K4N A;  3WU0 A;  4EEF G;  4KMF A;  3WGG A;  2DFI A;  2IP2 A;  4R79 A;  4E4H A;  4AIJ A;  4QWQ A;  2OQG A;  2AXL A;  1VQM I;  1RC9 A;  4BQA A;  3OYG A;  3UNG C;  3ELK A;  2MC4 A;  4DBR A;  4RGS A;  1FP2 A;  2L7K A;  3TO9 A;  3O8H A;  5FKN A;  1A35 A;  2Y0S N;  2R7O A;  4PJ0 C;  1JHH A;  2ZXJ A;  3JRD A;  3ABM H;  1JUS A;  3GWZ A;  4EM0 B;  2P5L C;  2D5V A;  1QNT A;  1TWA J;  5HLH A;  3WGI A;  2W4S A;  3S14 J;  5LGN A;  3W6J B;  1ONV A;  4HNU A;  4YEL A;  4IHT A;  2H6B A;  3WU2 C;  4KN4 X;  3WTT C;  2LY1 A;  3E6B A;  2GZW A;  1OCR H;  2LRE A;  1P6R A;  3A01 A;  3BR3 A;  1MND A;  3FK6 A;  2DOD A;  1LFB A;  3ZQL A;  1K83 J;  4YIF A;  2PQ8 A;  2FX0 A;  4O6J A;  3K9T A;  2RC4 A;  3S2D J;  1SD5 A;  1IJW C;  4RDU A;  2JPC A;  3K1M A;  3F72 A;  3BPX A;  3L2R A;  4FIS A;  5B5E C;  4KIF A;  3S1R J;  1QO0 D;  1FYM A;  2P7C B;  2KDO A;  2L4M A;  3OYF A;  5J6X A;  5ICF A;  4OIR F;  1T2K A;  1LFP A;  2GXB A;  1FX7 A;  2L4A A;  3IKT A;  4J01 A;  1MBJ A;  2MLK A;  1JXS A;  1OCC H;  1PUE E;  4ESJ A;  3J80 K;  1Z7U A;  4IHY A;  4EQQ A;  5DD8 A;  4RAZ A;  3MKW B;  3NRV A;  1OR7 C;  2JZY A;  3QPL A;  3TOA A;  3GZ6 A;  1ZR2 A;  1XGM A;  3S3O A;  4FE4 A;  3P9I A;  5JLW A;  2HR3 A;  4XLF A;  4IKF A;  2R7R A;  1D8J A;  2Z9O A;  5GAE J;  3CDL A;  1O7F A;  1BN5 A;  5FKK A;  1WFX A;  2JA6 J;  5GAG J;  2YSR A;  2AS5 F;  4A3L J;  2KKO A;  1ETK A;  2COB A;  1B72 B;  5IP7 J;  3SZP A;  2ZB9 A;  2K4J A;  3AL0 B;  3CLO A;  3QP6 A;  2GIV A;  3I4N J;  3H5N A;  4LFU A;  3LSI A;  3CC4 I;  2EFN A;  4G7H F;  5E1W A;  3KYD B;  3GFI A;  3OYK A;  1B8I A;  3DCF A;  3ZN1 A;  3CMY A;  1R4N B;  3S17 J;  3A02 A;  5H6R A;  2CYY A;  1I1G A;  2HOE A;  4XMY A;  2DA3 A;  2FE3 A;  2L2O A;  1YIJ I;  2VQL A;  4RM3 A;  4X0G A;  2W48 A;  3GTK J;  2NOG A;  1IW7 F;  2Y9Y A;  4HX7 A;  5EZG A;  4WWC A;  4DGW B;  1N25 A;  1TWF J;  2H94 A;  5DCM B;  4CA0 A;  2R0Q C;  1OYW A;  3EDP A;  2OBP A;  2K3F A;  2M2E A;  4LD5 A;  2M3A A;  1R6R A;  1VQ4 I;  2JJ7 A;  2PMZ A;  3T8T A;  3OMY A;  1H9T A;  2KJC A;  1AOY A;  5C4J J;  2WTE A;  5FKM A;  2HQN A;  3WTU C;  3FKJ A;  1T0F A;  4M3G A;  3G6E I;  4I2O A;  2IAI A;  1Z05 A;  3OR2 C;  2PJR A;  2E19 A;  1OCT C;  3L2U A;  4HF2 A;  3TOB A;  2WY7 Q;  2M0C A;  2L01 A;  2VLA A;  4BHC A;  3WHB A;  4Y52 J;  4YEJ A;  3D5S C;  1QRY A;  3E3V A;  3OS2 A;  1JE8 A;  2QZ8 A;  1EA3 A;  4M3F A;  1X3U A;  3OR1 C;  2RKH A;  3OYE A;  4ZZL A;  2DI3 A;  3Q9S A;  2W84 A;  3FM5 A;  2UZK A;  1DU0 A;  4BH9 A;  3TW7 A;  5IYC J;  2XRO A;  2R5Y B;  5CVI A;  3OOU A;  1IRX A;  5C4X J;  3HRT A;  2F4I A;  2E60 A;  2DO7 A;  4ASN A;  2DXI A;  3R6S A;  1MMG A;  2CWE A;  2VKH A;  3IAS 2;  3L00 A;  4MLO A;  5EZH A;  2P0W A;  1MBK A;  1ZN2 A;  1RI7 A;  2E1M B;  1ZAO A;  3WHC A;  4IZZ A;  1Y0N A;  1FBU A;  5M5W J;  1X2N A;  4XRS G;  2RRE A;  5CPR B;  5CQE A;  2E1O A;  5KAI C;  5DS9 A;  3OYN A;  3CF5 F;  3FXL A;  2Q0O A;  3CUQ B;  2V9K A;  4XLP F;  1U3E M;  1YE9 A;  1T98 A;  3VOD A;  4NC6 A;  2MYS A;  3RKX A;  5GTI C;  1XPX A;  2LH9 A;  3E0J B;  5BNG A;  1RRJ A;  1JKQ C;  4OAY A;  4J00 A;  3F8N A;  5D4S A;  1OQY A;  2F4M B;  2YU3 A;  2CFO A;  4A0Z A;  2OAZ A;  1OYI A;  1D0Y A;  3WE3 A;  1U0J A;  4KUM A;  4MEX F;  2JQ7 A;  2OTJ I;  4G9Y A;  4CYD A;  2BE5 F;  2QF7 A;  3Q3S A;  3KZY A;  2EFQ A;  1HSJ A;  2R7F A;  5JI6 A;  1VQ9 I;  1MKM A;  3GME A;  3COA C;  1HQC A;  3JRC A;  2ACJ A;  1LVK A;  3EUA A;  3U1K A;  4MTE A;  3B02 A;  1TC3 C;  4HLY A;  1MNE A;  2GXA A;  3ABL H;  2RQQ A;  4CHU A;  2O8X A;  2A07 F;  3CCS I;  3FHZ A;  4RAF A;  2QYO A;  3L2V A;  4XKC A;  1G59 A;  1XB4 A;  3VEP A;  1BR2 A;  2O03 A;  3N05 A;  3RDI A;  1U5T B;  2VE8 A;  2WV0 A;  2QSF X;  4N4O B;  1Z7L A;  2JUG A;  3FWE A;  2IPQ X;  4S05 A;  2KZV A;  2O8K A;  1ZRD A;  4WK8 F;  2DLL A;  3QOP A;  2LNB A;  2HKO A;  2CUE A;  3C7J A;  4L9N A;  4PDK A;  1LEA A;  1GXP A;  3A01 B;  3F8C A;  1X1B A;  3HTS B;  1ZH5 A;  1A6Q A;  2LF7 A;  4C9Y A;  1BBY A;  3OS0 A;  1LDJ A;  4Z6Y A;  1OLT A;  1OCZ H;  1WPK A;  4W97 A;  1MDM A;  1I39 A;  1WI3 A;  1MH3 A;  2EB7 A;  2LC2 A;  1X2M A;  2K7L A;  3E5Q A;  1IN6 A;  3I55 I;  2IBD A;  3TP3 A;  5DEQ A;  1QZY A;  2PJP A;  2Y9Z A;  3GTO J;  2IXS A;  2L7M P;  1QZE A;  1TT5 B;  3Q0V A;  3MFK A;  1QHH D;  3GO5 A;  5KK1 A;  2KIS A;  1APL C;  4JOM A;  4A3M J;  4G6Q A;  4MQV A;  2DOE A;  3R61 A;  2JA7 J;  2DT7 B;  3KP5 A;  5IT9 Z;  3DKY A;  1X1P A;  4G6D A;  4NC8 A;  3NAR A;  3RKQ A;  3MZY A;  1D5V A;  2R7Q A;  2F6C A;  3JSP A;  2HQR A;  2MFZ A;  4HA8 A;  2HPI A;  2HQ5 A;  1YYV A;  3OIP A;  1T33 A;  2V26 A;  2Y31 A;  4OU0 A;  3S1N J;  3K0L A;  1YG2 A;  1HA8 A;  1ZLJ A;  1G3Y A;  4D7N A;  4ENK A;  1U9N A;  4Q48 A;  2CV2 A;  2R7D A;  1IN7 A;  3I64 A;  1L0O C;  2W7N A;  5H2F C;  1S7E A;  2ECB A;  1MH4 A;  1B8I B;  2Z99 A;  2DMN A;  2E2I J;  2NYX A;  2RVC A;  4HW0 A;  1SFX A;  3BT9 A;  1TBX A;  3GYH X;  5BMZ A;  3GZN B;  4KT6 A;  2A6T A;  2V9P A;  4E7S A;  4PSW A;  2STW A;  4O3M A;  2X0L A;  3CD6 I;  5HNF A;  1KU7 A;  5J47 A;  4ZYE A;  1JGS A;  2VKE A;  2W57 A;  2G0E A;  4E7I A;  3IH4 A;  4LOC A;  1ZRC A;  3CJQ B;  3LSP A;  2ISZ A;  4OMY A;  4EGZ A;  2ELK A;  1K78 A;  1FOY A;  1B9N A;  4Y3O A;  4GXO A;  4XLN F;  5KHD A;  2VT3 A;  5GPA A;  3WTY C;  1D5Y A;  4HDV A;  2E1M C;  4HQM A;  3BC8 A;  4EJW A;  3W6K B;  4YRV A;  1KA8 A;  2OPT A;  5IY5 H;  5DUI A;  1YJ9 I;  1W1W E;  5F1J A;  3OSF A;  3K70 D;  3CUQ C;  1AU7 A;  2XDV A;  3PNV A;  5IOZ A;  4V2F A;  4U87 A;  1ZHF A;  2FF4 A;  3PQK A;  3G71 I;  1YHQ I;  4A93 J;  1BL0 A;  2I8D A;  3TO7 A;  4I0A A;  1R00 A;  2KHM A;  3GEZ A;  2BW3 A;  3JTH A;  4HST A;  4ESB A;  3UR3 C;  2PJR B;  3FXR A;  3K4B A;  3S2H J;  3J81 Z;  3DTK A;  4CZZ A;  1SMY F;  2DMU A;  5E79 C;  2KIU A;  4M72 A;  5K7H A;  4X1E A;  3TQN A;  4A3F J;  1EJ9 A;  5IP6 A;  1YS6 A;  1XSV A;  3C2H A;  4C30 A;  4X6A J;  3FXK A;  2E71 A;  1YJW I;  1Z77 A;  2BGC A;  1SD7 A;  2VXZ A;  2K9N A;  4HRI A;  4Q47 A;  1GXQ A;  3H0G J;  1JUP A;  4B3A A;  1MJ9 A;  2EIM H;  4L5E A;  3SFI A;  3MN2 A;  4KNY A;  4HZF A;  2ZJQ F;  2LP0 A;  2UWM A;  1SAU A;  1W7P A;  2X85 A;  1VQP I;  3HKZ N;  4CZC A;  1U5T C;  2JN6 A;  2M30 A;  4UV8 A;  4MNU A;  2HNH A;  1JJ6 C;  2CQ7 A;  2K5C A;  3PUB A;  3AKZ A;  2ZXW H;  2DT5 A;  2FSW A;  1MBG A;  2E7W A;  3BY6 A;  2BVL A;  4ZYD A;  4DYR A;  1S3J A;  2DA1 A;  1UHM A;  4CO8 A;  5ED4 A;  1U8B A;  4MGR A;  5FRN A;  1QHG A;  5E3O A;  1X1A A;  5HNH A;  2VOD A;  3LFU A;  2R92 J;  3DKW A;  3PSI A;  2WAF A;  4JX6 A;  1MMN A;  3H5A A;  3LMM A;  2A3S A;  2V7F A;  1EH6 A;  2XF6 A;  2OZU A;  1FMV A;  1J59 A;  2R7Z J;  2TDX A;  3REO A;  1FWZ A;  5F0H A;  4D0P A;  4UHT A;  4LK0 F;  3ZMD A;  3FMS A; 
#chains in the Genus database with same CATH homology
 3L7W A;  4KN7 X;  5IT9 K;  4BHB A;  2W24 A;  4UVA A;  2DAO A;  5CVR A;  3H3Z A;  1AWC A;  2VN2 A;  2O0Y A;  3P9C A;  5D5X B;  4WXH A;  2PI0 A;  2EK5 A;  3GVA A;  3HTU A;  2IVM A;  3WU1 B;  2HZT A;  1E17 A;  3E5X A;  2Z33 A;  2XAF A;  1D3Y A;  2H6C A;  1R36 A;  1QPM A;  2MH9 A;  1F5T A;  5HLG A;  2ZJ2 A;  2CGP A;  3IKV A;  2QBY A;  3BJ6 A;  4BAY A;  5FLX Z;  3ULQ B;  3EYI A;  3LA3 A;  1PDN C;  3IWZ A;  3LAJ A;  4ZYG A;  3Q5F A;  1MDM B;  1MGT A;  2HTJ A;  2OZ6 A;  4PGH A;  1BI3 A;  3M1E A;  3WGH A;  4HOB A;  2Y48 A;  5CVU A;  4KIG A;  2BBY A;  3D5L A;  3HUG A;  1HKS A;  3KP7 A;  1BIA A;  1IXS B;  2XRN A;  2EJR A;  1O3S A;  5TJJ A;  1IAW A;  5LEK A;  4OMZ A;  2O3F A;  5H6Q A;  3J81 K;  3TDU C;  3T1B A;  3SZT A;  1XGO A;  1S6L A;  4HAM A;  4WF2 A;  3PFI A;  3I58 A;  3F8M A;  3CO6 C;  2CFX A;  3ZMV A;  5D8K B;  5HDG A;  2MBF A;  3RTR A;  2QWW A;  3V7R A;  5L3B A;  5FD6 A;  2ZCW A;  1PP7 U;  1IZ1 A;  2JSC A;  1D8K A;  1K78 B;  3JW4 A;  2XAJ A;  1LJ9 A;  4QLC U;  2PFB A;  2OA4 A;  2EV0 A;  4S04 A;  2LDU A;  4JQF A;  5HDN A;  4IJA A;  2X4H A;  1P2F A;  3BJA A;  2FQ3 A;  5D8L B;  3F21 A;  3C3W A;  1BI0 A;  1WSU A;  3ZPL A;  5E17 F;  2JPB A;  4KT5 C;  2ISY A;  4CIC A;  3DP7 A;  2D2W A;  2IA0 A;  1STZ A;  1HKQ A;  3HSE A;  5BS6 A;  2VE9 A;  1B59 A;  1W7P B;  3BOQ A;  4WCG A;  1G3S A;  3O6B B;  4M74 A;  1FYK A;  1XGN A;  5FLX K;  2W85 A;  1FYL A;  1Z6R A;  2LSO A;  3B73 A;  2FXA A;  1K7A A;  2DTR A;  2NNN A;  3T8R A;  4YG2 F;  2P7V B;  3F6V A;  4P55 A;  2G7U A;  2PBI A;  3FM3 A;  1O3Q A;  1HBX G;  1R58 A;  1KQ0 A;  3MQ0 A;  3C1D A;  4WXD A;  3F22 A;  1RUO A;  3K69 A;  4FT8 A;  4EJV A;  4AIH A;  3KP4 A;  4ENM A;  3V7S A;  3SXY A;  4OIP F;  1SFE A;  4JK1 X;  2QBY B;  1P4W A;  2STT A;  3I0T A;  2DK8 A;  4BYY A;  3SQN A;  1XGS A;  4CGZ A;  3T0Y A;  1NHA A;  3ISP A;  3V8L A;  4XSX F;  2QEN A;  3E6D A;  4HYE A;  2DBB A;  1J0R A;  4GCV A;  2F5D A;  4U0V A;  3TDZ C;  3GXO A;  5J8C A;  2M87 A;  3H3U A;  3ROU A;  5LGT A;  2M45 A;  3LAP A;  2FBH A;  2K4B A;  3CO7 C;  4OIO F;  5AON A;  2XHK A;  3KLO A;  2L02 A;  2DQL A;  3D0S A;  1B6A A;  2EFO A;  5A2Q Z;  2PEX A;  3ABT A;  3I5U A;  3RIR A;  1LVA A;  2GA2 A;  2JRT A;  2FOK A;  2GXG A;  3DF8 A;  2D45 A;  2A68 F;  3I54 A;  2FMY A;  3IRQ A;  3Q9V A;  1QQI A;  3ZMU A;  3RPU A;  2HFH A;  3BP8 A;  1FLI A;  1IN8 A;  3VB2 A;  5BOX A;  3G3Z A;  1F1Z A;  1TNS A;  1CGP A;  1W7P D;  1GHC A;  3I59 B;  2CQK A;  4Y17 A;  2RQP A;  3GFJ A;  4A0X A;  1T6S A;  1KU9 A;  4A0Y A;  5E1Z B;  5HOO A;  1R1U A;  1S7A A;  3K1P A;  3LA7 A;  1R1T A;  3WG9 A;  2J5P A;  5D5W B;  4DQ2 A;  4R1H A;  3DFG A;  4R8H A;  3RPQ A;  2BEO A;  1U2W A;  2H27 A;  1J2X A;  5F6F A;  4G7Z F;  2E1N A;  3WTW C;  3DQV C;  3AAF A;  4LLL A;  2EV5 A;  2EWN A;  1XDU A;  3F3X A;  3LST A;  1BI2 A;  4ZYH A;  2COM A;  1FPQ A;  1YS7 A;  2XV4 S;  5LEJ A;  4HF1 A;  4XBF A;  2PG4 A;  4IRI A;  1QBJ A;  5D6E A;  3HHG A;  2V6C A;  5HS7 A;  2P5V A;  5A2Q K;  5LHI A;  4LLN A;  1I1S A;  5HLI A;  2OU2 A;  4IPA A;  4U88 A;  4LGW A;  5JVT A;  1KYW A;  2UXN A;  2XGX A;  2HWV A;  4CDG A;  3QPT A;  3M8E A;  1UCR A;  4M9Z A;  1IUY A;  3L9F A;  4L9J A;  4FX4 A;  4MQ9 F;  1BJA A;  2V9V A;  4ENN A;  1B1B A;  3SFZ A;  3S2W A;  4Y13 A;  2VOO A;  5LRR A;  1LQ1 A;  3IL2 A;  1TTY A;  1BC7 C;  4FX0 A;  1SFU A;  3KP3 A;  3M7G A;  1ZAR A;  4GO1 A;  4A5N A;  3OOP A;  1KU3 A;  2P4W A;  1XN7 A;  3RKW A;  5L3E A;  5K5O A;  2HTS A;  2FBK A;  4KMU X;  1BIB A;  1T39 A;  3KP6 A;  5AIP A;  2EFP A;  2RNJ A;  3LQR A;  2FNA A;  1CF7 A;  2QM3 A;  3J7A O;  4A5M A;  1I6X A;  2QQA A;  3IHU A;  1U8R A;  3EUH A;  3SHF A;  3FXQ A;  4G94 A;  3V8K A;  5LLQ A;  1LDK B;  2OQR A;  1FSH A;  4WX9 A;  2BYV E;  1XD7 A;  1LEB A;  2GWR A;  2E7X A;  4CXF A;  3KLN A;  1XCV A;  5CLS A;  4I02 A;  2IA2 A;  2G9W A;  1RUN A;  4FHT A;  4AWX B;  1SMT A;  2Z5U A;  3HRU A;  4TV7 A;  1KGS A;  3GF2 A;  4P96 A;  3E5U A;  2HGC A;  4HV6 A;  1Z6T A;  4ZH4 F;  3LA2 A;  4NHJ A;  2XIG A;  1YQA A;  3QU3 A;  2ZKZ A;  1MJB A;  1YFH A;  2CSO A;  1HST A;  1Q1H A;  1R7J A;  4N9I A;  1XMA A;  5BQT A;  2OD5 A;  3ECO A;  1R5G A;  5HVQ C;  4M6X A;  4A12 A;  2QQB A;  1RNL A;  2GA1 A;  1HW1 A;  1U78 A;  4G8X A;  3DPL C;  4MTD A;  4NQW A;  1S29 A;  5K1Y A;  4LB5 A;  2RN7 A;  5L3G A;  1G4D A;  1IXR C;  4K2E A;  2Q8K A;  3FMQ A;  2EA2 A;  1DUX C;  4HBL A;  1W5S A;  1R5H A;  2EA4 A;  1RIO H;  3QP5 A;  3HSF A;  2L54 A;  4YFX F;  2V79 A;  4PCQ A;  3DEU A;  1EH7 A;  3V7C A;  1V3F A;  3BPV A;  5FFZ A;  3LFK A;  5J8F A;  5BPI A;  4A6D A;  5BPD A;  2KIM A;  4PZJ A;  2JTV A;  1HXD A;  4EVI A;  1XSD A;  4KIB A;  1A04 A;  1FC3 A;  1MD0 A;  4H0E A;  3EQL F;  4UVC A;  4BNC A;  5AIQ A;  4IXA A;  3LWF A;  4M9S A;  2FU4 A;  2DPD A;  2FEZ A;  4Y15 A;  4AVP A;  1FP1 D;  4ESF A;  2XAG A;  5FFX A;  1Z9C A;  5ILU A;  4LK1 F;  3GZ5 A;  1S8N A;  2EV6 A;  5E18 F;  3FMR A;  3CTA A;  3E97 A;  2VOP A;  4OOI A;  4OIQ F;  3KZZ A;  4UVB A;  1UST A;  3TO6 A;  5FO5 A;  1CF7 B;  3DPT A;  3WTS C;  2XAQ A;  3KEQ A;  4BHP A;  1OMI A;  1TW3 A;  2CO5 A;  4RS8 A;  5D5U B;  1HKT A;  1B9M A;  3ABU A;  4BXU A;  2UXX A;  5DCM A;  1J5Y A;  2EFW A;  4A6E A;  3R4K A;  2GQQ A;  3F6O A;  2Z3Y A;  1YW8 A;  1PP8 F;  3N97 A;  4RGR A;  2A6H F;  3FX3 A;  1G3W A;  2RDP A;  3CUO A;  3KE2 A;  1YW7 A;  1P4X A;  4O5V A;  1G3T A;  3RKY A;  3VOE A;  5ILV A;  4HQE A;  4GYG A;  2PMU A;  5DCF A;  1YLF A;  3JSO A;  1WRJ A;  3N4M A;  4L5I A;  5JFR A;  1IRF A;  5E8I A;  1REP C;  4L9V A;  3L09 A;  4UV9 A;  3M8F A;  1R23 A;  1HW2 A;  3GFL A;  2MC3 A;  3IRR A;  1I5Z A;  1ON1 A;  3FXU A;  4Q4Z F;  1ZG5 A;  5HDK A;  2IRF G;  3EYY A;  2PMH A;  5DUK A;  3MWM A;  1TLH B;  3FZV A;  4IRG A;  3PQJ A;  3O3K A;  2ETH A;  2P6S A;  3F8B A;  2VT2 A;  5L3C A;  1SD4 A;  2P6T A;  1YW9 A;  5DDG A;  4GYI A;  3EET A;  1MZB A;  4LMY A;  2Y75 A;  4N9H A;  1FZP B;  3GW2 A;  2ESN A;  3GX4 X;  1KU2 A;  2ADU A;  1U5T A;  3E6C C;  3T5X A;  4U7B A;  2F5C A;  2XAH A;  1FNN A;  2MA3 A;  3HOT A;  4HX4 A;  1TW2 A;  2KIF A;  3V4G A;  1S7O A;  3JTG A;  5HS8 A;  4EGY A;  2W25 A;  3M9A A;  4LLG F;  3HSR A;  2QVO A;  1YO5 C;  5FGM A;  3ECH A;  5ICC A;  3U1D A;  3DV8 A;  4I98 B;  3H92 A;  3IC7 A;  4IVN A;  3L2C A;  4XRF A;  1ZRF A;  1QGP A;  4G7O F;  1DDN A;  3BRO A;  3WE2 A;  3ZMT A;  5ERI A;  1O57 A;  5F64 A;  1ON2 A;  2D1V A;  1FY7 A;  3BWG A;  2K02 A;  2LF8 A;  5LBQ A;  1ZGJ A;  3KET A;  2DQR A;  5D5V B;  2O6G E;  1WKM A;  4MEY F;  4YFN F;  2QQ9 A;  2XUB A;  4XSZ F;  1LDD A;  5JHU A;  2P8T A;  1HW5 A;  3F23 A;  4KYW A;  2VBX A;  2HYG D;  4A2U A;  2RGV A;  1P4A A;  2ZNZ A;  2ZNY A;  3MCZ A;  1ULY A;  4RB3 C;  1MJA A;  4U0Y A;  2G7H A;  3CDH A;  5CJ9 A;  1O7L A;  2D1H A;  4M73 A;  1ZG1 A;  1FT9 A;  1TNT A;  4M9X A;  5D6F A;  2WWY A;  4GGG A;  3V8J A;  2C6Y A;  2ZME A;  4YFK F;  5ICE A;  5LRS A;  3WTX C;  1J7K A;  3QPH A;  1J9I A;  4RB1 A;  2NRA C;  1H9G A;  4EJU A;  1KQ8 A;  4P9F A;  4WXC A;  2K86 A;  1KYZ A;  5HS9 A;  1H0M A;  3OV8 A;  3K1N A;  2VON A;  2QLZ A;  4IRH A;  1XSX A;  3HIF A;  5FD5 A;  2NAZ A;  4ZZD A;  1RZ4 A;  1DPU A;  3ML6 A;  2F2E A;  2Y0M A;  5E8G A;  2NS0 A;  5E20 A;  3KP2 A;  1LNW A;  4HX8 A;  4KA4 A;  3P9K A;  2P5K A;  2IA1 A;  1I27 A;  3ZQ7 A;  4KDP A;  4ETS A;  4RB2 C;  4ENJ A;  3ERE D;  4L0Y B;  5CVV A;  2A69 F;  1BM9 A;  3GUD A;  2FA5 A;  3MAJ A;  1K79 A;  4RAY A;  2ESH A;  5CYV A;  3NEU A;  1Z91 A;  4ON0 A;  1DPR A;  1TQM A;  4KFC A;  3ZMS A;  4UUV A;  1JHF A;  3P7N A;  2VBY A;  2F5F A;  2YPR A;  3R60 A;  4UNO A;  1ZGA A;  3O2P E;  4AIK A;  1WWX A;  2HDC A;  1LB2 A;  3HHH A;  5KVR A;  5D4R A;  2L3D A;  1IN5 A;  2E1C A;  2Q2E A;  3I53 A;  2J5O A;  5K5Q A;  2VC1 A;  3VFZ A;  1R22 A;  4I01 A;  2YX4 A;  4M6Y A;  4N0B A;  4EMS A;  3TKY A;  1BC8 C;  1XDS A;  1G6N A;  4EJT A;  4OIN F;  1P92 A;  1OKR A;  2F5E A;  4Z2Y A;  2HKX A;  1T38 A;  1KQ9 A;  2V1U A;  3JAM Z;  3HRM A;  3IWF A;  3NQO A;  1OR7 A;  4F7Z A;  4MHG A;  2DK5 A;  1YTY A;  1XMK A;  2IW5 A;  2H09 A;  1V4R A;  2CW0 F;  3QRF F;  1ZLK A;  1J75 A;  2K27 A;  4EJO A;  1FBS A;  3ZMZ A;  3K2Z A;  2MH2 A;  1E2X A;  3RJP A;  2ZME B;  1UFM A;  4EM1 A;  4HDU A;  1O3R A;  1ODD A;  2HEO A;  5EEG A;  2R3S A;  4P5O A;  5TRD A;  4E70 A;  1VTN C;  1O3T A;  4LG0 A;  1K6O A;  3QU6 A;  1W5T A;  1ZYR F;  5DYM A;  4L5J A;  2PN6 A;  2DPU A;  4AD9 A;  2CG4 A;  4I7H A;  1IXC A;  2YX7 A;  4L9T A;  4HF0 A;  3WTV C;  2O61 A;  3ZP5 A;  3BZ6 A;  3I71 A;  1BI1 A;  1FOK A;  2DW4 A;  3I4P A;  2WC2 A;  1EV7 A;  1ZG3 A;  3KEO A;  2VC0 A;  2VBZ A;  4RGX A;  5FB2 A;  2XKO A;  3WTZ A;  2LKP A;  3QAH A;  1Y0U A;  3U2R A;  2MLG A;  2A6E F;  4HV5 A;  5IT3 A;  4LB6 B;  3LQQ A;  2DU9 A;  4U0W A;  2FBI A;  2QUF A;  1TQI A;  2XVC A;  2ELH A;  5LHH A;  4B09 A;  4LJZ F;  5E1X A;  2HYF A;  3RI4 A;  1B4A A;  1L3L A;  1BOA A;  5JR3 A;  2KJB A;  5DV5 A;  2A61 A;  4Q5S F;  3JAM K;  1R1V A;  2FML A;  2MD5 A;  4B8X A;  5LHG A;  4YII A;  1W4M A;  5F1R A;  3F8F A;  1SAX A;  1OYY A;  3G73 A;  3R0J A;  3DXJ F;  2FRH A;  1GVJ A;  1OPC A;  2XKP A;  3MZH A;  2VBW A;  5L3D A;  2BV6 A;  3RYR A;  3HYI A;  4RB0 A;  3E6M A;  1TQP A;  1WQ2 A;  2ZBK A;  4UXN A;  1FSE A;  2KRF A;  4RGU A;  1ZRE A;  3TGN A;  4DNC A;  3BDD A;  1Z1D A;  2IT0 A;  2FNP A;  3U9G A;  2A5Y B;  3KFW X;  3C18 A;  5EEH A;  3GLX A;  4L0Z B;  3HRS A;  2M8E A;  1XCB A;  5DD4 A;  4HLX A;  1C0W A;  1WI9 A;  1U6G A;  4IF4 A;  4PGG A;  3CJN A;  1SD6 A;  2V1X A;  5LGU A;  5L3F A;  4I09 A;  1UHW A;  5K5R A;  5CVJ A;  4I0B A;  3J80 Z;  2ZFW A;  3MEX A;  2NNY A;  4JBA A;  2B0L A;  2PLY A;  2V1D A;  4EV0 A;  1DP7 P;  1F9N A;  3I59 A;  1QZZ A;  1EH8 A;  4M71 A;  1FBQ A;  4KIC A;  1F4K A;  1UB9 A;  4IHS A;  3R0A A;  2IJL A;  3ZN0 A;  2M1B A;  3WOD F;  3GFM A;  1YIO A;  3BJO A;  1IRG A;  1IN4 A;  4LG0 B;  2HS5 A;  2JT1 A;  5ICG A;  2RV8 A;  1IF1 A;  2GAU A;  4EM2 A;  2ZO4 A;  5H20 A;  6PAX A;  3HOS A;  3KCC A;  3CUQ A;  2YR2 A;  5ILS A;  1USS A;  2XAS A;  3FF5 A;  4P9U A;  4NB5 A;  4L18 B;  3RYP A;  4U7D A;  2M5W A;  4KMF A;  3WU0 A;  3WGG A;  2DFI A;  2IP2 A;  4R79 A;  4AIJ A;  4QWQ A;  2OQG A;  2AXL A;  4BQA A;  3ELK A;  4RGS A;  1FP2 A;  3TO9 A;  1JHH A;  2ZXJ A;  3GWZ A;  4EM0 B;  2P5L C;  1QNT A;  5HLH A;  3WGI A;  5LGN A;  3W6J B;  1ONV A;  4IHT A;  2H6B A;  4KN4 X;  3WTT C;  3E6B A;  2GZW A;  1P6R A;  4YIF A;  2PQ8 A;  4O6J A;  3K9T A;  2RC4 A;  1SD5 A;  2JPC A;  3K1M A;  3F72 A;  3BPX A;  4KIF A;  1QO0 D;  1FYM A;  2P7C B;  2L4M A;  1T2K A;  5J6X A;  5ICF A;  4OIR F;  2GXB A;  1FX7 A;  2L4A A;  3IKT A;  1JXS A;  2MLK A;  1PUE E;  4ESJ A;  3J80 K;  1Z7U A;  4EQQ A;  5DD8 A;  4RAZ A;  3NRV A;  2JZY A;  3TOA A;  3GZ6 A;  1XGM A;  3P9I A;  2HR3 A;  1D8J A;  2Z9O A;  1O7F A;  1BN5 A;  2YSR A;  2AS5 F;  2KKO A;  3SZP A;  2K4J A;  3CLO A;  3QP6 A;  2GIV A;  4LFU A;  2EFN A;  4G7H F;  5E1W A;  3GFI A;  3ZN1 A;  5H6R A;  2CYY A;  1I1G A;  2HOE A;  2FE3 A;  1IW7 F;  4HX7 A;  4WWC A;  2H94 A;  5DCM B;  1OYW A;  3EDP A;  2OBP A;  4LD5 A;  1H9T A;  3T8T A;  2KJC A;  1AOY A;  2WTE A;  2HQN A;  3WTU C;  1T0F A;  4I2O A;  1Z05 A;  4HF2 A;  3TOB A;  2L01 A;  4BHC A;  3E3V A;  1JE8 A;  2QZ8 A;  1X3U A;  2RKH A;  4ZZL A;  2DI3 A;  3Q9S A;  2W84 A;  3FM5 A;  2UZK A;  4BH9 A;  2XRO A;  5CVI A;  3HRT A;  4ASN A;  2DO7 A;  3R6S A;  2CWE A;  3L00 A;  1ZN2 A;  1RI7 A;  1ZAO A;  1FBU A;  2Q0O A;  3CUQ B;  4XLP F;  1U3E M;  1T98 A;  3VOD A;  3RKX A;  3F8N A;  5D4S A;  2YU3 A;  4A0Z A;  2OAZ A;  1OYI A;  3WE3 A;  4MEX F;  4KUM A;  4G9Y A;  4CYD A;  2BE5 F;  3KZY A;  2EFQ A;  1HSJ A;  2R7F A;  5JI6 A;  1MKM A;  3COA C;  1HQC A;  2ACJ A;  4MTE A;  3B02 A;  4HLY A;  4CHU A;  2O8X A;  2A07 F;  3FHZ A;  2QYO A;  1XB4 A;  3VEP A;  3RDI A;  2O03 A;  1U5T B;  2VE8 A;  2WV0 A;  3FWE A;  2IPQ X;  4S05 A;  1ZRD A;  4WK8 F;  2DLL A;  3QOP A;  2LNB A;  2HKO A;  3C7J A;  4L9N A;  4PDK A;  1LEA A;  1GXP A;  3F8C A;  3HTS B;  1ZH5 A;  2LF7 A;  1BBY A;  1LDJ A;  1MDM A;  2EB7 A;  2K7L A;  3E5Q A;  1IN6 A;  5DEQ A;  1QZY A;  2PJP A;  3MFK A;  3GO5 A;  5KK1 A;  4G6Q A;  4MQV A;  3R61 A;  3KP5 A;  5IT9 Z;  4G6D A;  3MZY A;  1D5V A;  3JSP A;  2HQR A;  4HA8 A;  1YYV A;  4OU0 A;  3K0L A;  1YG2 A;  1ZLJ A;  1G3Y A;  4ENK A;  4Q48 A;  2R7D A;  1IN7 A;  3I64 A;  1L0O C;  2Z99 A;  2NYX A;  2RVC A;  4HW0 A;  1SFX A;  3GYH X;  1TBX A;  5BMZ A;  4O3M A;  2STW A;  2X0L A;  1KU7 A;  4ZYE A;  1JGS A;  2W57 A;  2ISZ A;  1ZRC A;  4OMY A;  4EGZ A;  1K78 A;  1B9N A;  4GXO A;  4XLN F;  2VT3 A;  3WTY C;  4HDV A;  4HQM A;  4EJW A;  3W6K B;  1KA8 A;  5DUI A;  3CUQ C;  1ZHF A;  2FF4 A;  3PQK A;  3TO7 A;  4I0A A;  1R00 A;  3JTH A;  3GEZ A;  4ESB A;  3FXR A;  3J81 Z;  4CZZ A;  1SMY F;  2KIU A;  4M72 A;  3TQN A;  1YS6 A;  1XSV A;  2BGC A;  1SD7 A;  2VXZ A;  4Q47 A;  1GXQ A;  1MJ9 A;  4KNY A;  4HZF A;  2UWM A;  1W7P A;  1U5T C;  2M30 A;  4UV8 A;  4MNU A;  2DT5 A;  2FSW A;  2E7W A;  3BY6 A;  4ZYD A;  1S3J A;  5ED4 A;  1UHM A;  4CO8 A;  4MGR A;  2VOD A;  3DKW A;  2A3S A;  1EH6 A;  2OZU A;  1J59 A;  2TDX A;  3REO A;  1FWZ A;  4D0P A;  4UHT A;  4LK0 F;  3ZMD A;  3FMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...