2WB1N

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
total genus 8
structure length 64
sequence length 64
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2wb1N00
2JA7J 1HOMA 4BBRJ 5FJ8J 2NVQJ 1B8IB 5FKOA 5C4XJ 1VI0A 1VNDA 4Y7NJ 2WAQN 1Y1WJ 1OCTC 1QRYA 1AHDP 1WH5A 4RBOA 1OCPA 4GFBA 1MSEC 1BL0A 1EF4A 2L0KA 3Q3SA 2L7ZA 1U9NA 3QPSA 2GBYA 4A3GJ 1FIAA 2CQQA 4V2FA 4G12A 2W48A 4XRMA 5C3EJ 1DU6A 1A6IA 2N8GA 2WV1A 4B1RA 1QPIA 3RZDJ 3S1RJ 2D5VA 2FQ4A 1W0UA 2IAIA 2VPRA 1R9TJ 2X6OA 1GV2A 2JA5J 4IHWA 3OSGA 4MIMA 1Q1VA 1LE8B 1F36A 2JWTA 2M8GX 4BKXA 3JRCA 3UKGA 2GM4A 1WPKA 1TWHJ 3ZQFA 1ZR2A 4FISA 3I4NJ 1PUFB 1ZQ3P 2DMQA 2CU7A 2P81A 4QTRA 1XS9A 2CUFA 1Y1VJ 2FD5A 2XGCA 3IH3A 4S0HB 3MN2A 1SFOJ 3IH4A 4I6ZA 2HQ5A 2Y30A 1X2NA 2YU9J 1ETQA 2M34A 5IPAA 4NDLA 4L5EA 1ITYA 2HXOA 1MBKA 1I3QJ 5M5XJ 2NVTJ 2VKEA 2DA6A 3GBGA 1IG7A 5EG0B 3S14J 1Z0XA 1IC8A 2XGEA 5IP9J 1ZGWA 3BR2A 5EEAA 3IV5A 1H89C 5F08A 2K9QA 2EH3A 1IUFA 1ZTRA 2B63J 4CYCA 3GTLJ 4W1UA 4XRSG 1JKRC 3E7LA 4UUSA 2XPVA 2G0EA 4IHYA 5FKNA 5GP9A 1CQTA 1MBHA 3CQZJ 5IP6A 3JRDA 4A3JJ 4FTHA 4CYCB 2L7MP 3HEFA 3HOUJ 2VUMJ 2EZIA 2DA7A 5C44J 1FIPA 4QSHA 3A03A 4DYQA 1JTXA 2AHQA 1GV5A 1HDPA 2K9NA 1JT6A 2M9HA 3OSFA 3S1NJ 3A01A 1ZK8A 4A3CJ 2HYJA 3GTKJ 1AU7A 2AO9A 2DA4A 3A02A 5M3MJ 1W0TA 2EZHA 2ZB9A 2XSDC 1GVDA 3FIWA 3LNQA 3HOZJ 1JKOC 1BW6A 1IDYA 2LY9A 1QVTA 3H3VK 3FK6A 3GTMJ 1U8BA 5EZHA 1B8IA 2E2JJ 3D1NI 4JX6A 1TWAJ 4D7NA 2YS9A 2HXIA 1MBGA 1O4XA 2R0QC 2R5ZB 3TEDA 2CQXA 4A93J 1ENHA 5DTDA 3M3YJ 1G2HA 4FCYA 1OFCX 2O7OA 5EDNA 5M5WJ 3VPRA 2K40A 3S17J 2LFBA 3GTQJ 3JRIA 1TC3C 3BTCA 5DS9A 2VKVA 1TWFJ 3S15J 4FE7A 3HOXJ 4JX5A 2HDDA 5F0FA 2QF7A 4RDUA 3SDGA 1ZR4A 3I4MJ 5F0CA 3HOWJ 1LE8A 5IYCJ 4XK4A 3ZQGA 3G1OA 2DMTA 2FJ1A 4DZPA 1NTCA 2L7FP 1PUFA 2JJ7A 2EQRA 4XICA 1MH4A 2YUSA 3TP3A 1UMQA 3ZQHA 3S1MJ 1D5YA 1LFUP 3G1MA 4D5CA 2XPWA 4A3DJ 1JGGA 3K2AA 1VFCA 2L9RA 3MKLA 1ZKGA 3BR6A 3BTLA 1B72B 4IHXA 4B3AA 5EGOB 2MG4A 2LK2A 3BQYA 4M3EA 5GPAA 2XB5A 4A3LJ 4MFDA 2HOSA 3BR0A 3JREA 2ID3A 1WI3A 2Y9YA 3LSGA 5EG0A 4UUTA 5EF6A 1ETVA 2TRTA 2LTPA 3CCYA 3H0GJ 1ETKA 2HOAA 4MO7A 1MBEA 5F0HA 4C3JJ 1T56A 2LP0A 3BTIA 4V2GA 5K7FA 2NOGA 3ZQCA 2JA6J 2E19A 5K7HA 1APLC 2DJNA 1ORKA 2NVYJ 3FISA 1GUUA 2ECBA 2KDZA 2E1OA 3HKZN 3LSJA 2LVSA 4M3BA 4X6AJ 2EBIA 2M2EA 1BA5A 1GT0C 5E3OA 1K83J 3O8HA 2R93J 2DA1A 2IBDA 3GTOJ 2NS8A 2I10A 2R7ZJ 4DW6A 3NARA 3JRBA 2XPUA 1VF9A 1QVUA 3SFIA 3GTPJ 1ETOA 4EEFG 4MFEA 1MH3A 3QPLA 4AUXA 5F04A 1JUSA 2JA8J 2DA2A 3BG9A 1RR7A 3RQIA 5IOZA 1SANA 3RZOJ 5K7ZA 2GLOA 2FX0A 2OF7A 1IDZA 5FKKA 3BG3A 3GTJJ 1I6HJ 1GDTA 1A5JA 1F43A 1IGNA 1JJ6C 3ZOBA 1BW5A 2E2IJ 1IRZA 2MW8A 5J3LA 2R5ZA 5JLWA 2EZLA 2R92J 3LSRA 1FTZA 1XC5A 5F27A 4C3HJ 1JUPA 4J19A 1S7EA 3BQZA 1HDDC 2HOTA 3HOVJ 1XG1A 1H8AC 1WCMJ 1K61A 3F0CA 4W97A 5E3NA 3O8GA 4JP0A 1X58A 3L1PA 3CDLA 4FE4A 1NK2P 2NS7A 4JYKA 3JRFA 2DA3A 1JUMA 4IEJA 3LOCA 3JRGA 3JR9A 4HNVA 2MGQA 1E3OC 2O9LA 3GTGJ 3HBLA 1RESA 4JX4A 3Q0VA 3S16J 3K7AJ 1AKHB 2DMUA 5IP7J 1ETWA 3HGGA 1H88C 4A3BJ 4BBSJ 3TP0A 3FK7A 3ZQIA 3HOYJ 3HM5A 3M4OJ 2LR8A 1MSFC 2IEKA 2JK3A 4D5FA 9ANTA 1DU0A 5BNGA 3BTJA 2H1KA 3W6VA 1U9OA 2R5YB 2ID6A 1I50J 1B72A 4DYRA 4XIDA 5FKMA 5EGOA 5M5YJ 2LD5A 1JTYA 1IJWC 5FLMJ 1TWCJ 4A3EJ 4AC0A 4DYCA 2X48A 3PO3J 3PO2J 5C4JJ 2JN6A 3NAUA 1T33A 4A3IJ 1NK3P 4M3GA 1JKQC 3G1LA 1P7JA 5IYBJ 5JLXA 5IYDJ 2RAEA 4ABZA 2X9DA 5FKLA 1YRNA 3BR5A 3Q0UA 1JKPC 1HCRA 2Y0SN 2JMWA 3TW6A 1OJLA 1MBJA 1IV6A 2DMNA 2TCTA 2NVXJ 2XB0X 3S2DJ 5HODA 3HDDA 2COBA 1YRNB 2Y2ZA 4M6VA 5E3LA 3JRHA 2XGDA 2M0CA 2CRGA 2DMPA 3BR3A 4BXXJ 2QCOA 1RETA 5J1YA 4M3FA 1WH7A 2MSYA 1LFBA 3BG5A 2Y31A 3ZQLA 1MNMC 3IH2A 1FJLA 1MBFA 1UHSA 4A69C 4A3MJ 2DA5A 2LLKA 1RKTA 1UG2A 2E2HJ 2DN0A 2EZKA 1TWGJ 3FKIJ 4DZJA 1RKWA 4IHVA 5EYRA 3JRAA 1RPWA 5FLVA 5GPCA 3OIOA 3HB9A 4A3KJ 2PMZN 3B6AA 4C2MJ 4M3DA 3HGYA 3PM1A 1JJ8C 2WB1N 3DCFA 1ETYA 2OPTA 5J1RA 1JT0A 1BJZA 4D7MA 3CMYA 3BR1A 2ECCA 4B4CA 4QIWN 3B6CA 2O8KA 1POGA 1ETXA 2DTZA 4MLOA 1FTTA 2KT0A 3BT9A 3TW7A 2ME0A 3WHCA 4LOCA 4UUSB 4XRSA 1Z77A 3MVPA 1HLVA 3WHBA 3DEWA 4X1EA 5E3MA 1WGXA 3S1QJ 4BY7J 5M3FJ 4Y52J 2Y9ZA 5J1UA 5IOYA 2H8RA 4I76A 3QQAA 1FEXA 2CUEA 5F1JA 4A3FJ 3C2BA 5EZGA 1AKHA 2VI6A 3Q0WA 3OOUA 3A01B 2ELKA 2XRLA 1X2MA 4C3IJ 1P7IA 1U78A 3RKQA 2ME6A 3SJMA 2HI3A 2CJJA 4AYBN 2K9SA 2R5YA 3S2HJ 1HF0A 3LSPA 4BY1J 2LKXA
chains in the Genus database with same CATH superfamily
2AQEA 1IV8A 1FSHA 1HOMA 4RAYA 2JRMA 2DU9A 4F93B 1XMKA 2EFOA 4Y4RA 1A6QA 1XSXA 3TMOA 1Z3XA 2ELHA 3W2AA 1WH5A 1K4TA 1G3YA 4XKWA 1MSEC 3OYGA 3FM5A 1E17A 2QKLB 2VJIA 2DI3A 5BQTA 5J40A 3GZNB 4XOPA 5AIPA 4KT5C 1T38A 1OYIA 1XGNA 4UVAA 3EUHC 3MKZA 2GBYA 3ASNH 1FIAA 1LVAA 2W48A 2ZXHA 4PK4A 2A6TA 1KU9A 2A61A 2WV1A 3WTUC 1TQPA 4FX0A 3OYHA 2FQ4A 4XLAA 2D2WA 4UVBA 2VPRA 1R9TJ 4KIGA 1GV2A 1T0FC 2CFOA 2MBFA 1B59A 4XBFA 1Q1VA 1F36A 2NAZA 1R1UA 2COMA 1LB2A 1G8XA 1T6SA 1XS9A 2CUFA 3BZCA 3O3KA 4AD9A 1Y1VJ 2P7VB 2JUGA 2WADA 3PFIA 2GA2A 2WB1A 4J01A 3ASOH 2R7XA 3GLXA 5D6EA 4BQNA 3EYIA 2GIZA 3C18A 4I6ZA 4EJWA 1YX3A 5HNFA 2XAQA 4IF4A 4NDLA 1MMDA 2HXOA 3T1BA 1D0XA 3P9CA 2VKEA 2QQ9A 4NNJA 1ZLJA 2ZMEC 3G3ZA 2BHYA 5LGUA 1Z0XA 1IC8A 2D1VA 3BR2A 2BY0A 2X6XA 2FE3A 3DP7A 4X0GA 3FBNB 3RKWA 4DJAA 4MNUA 1BIAA 2V1XA 1R23A 4HW0A 1WJAA 1BI2A 3GTLJ 5GAGJ 1XMAA 4JQFA 2ISYA 4W1UA 1N78A 1XB4A 4A6EA 4NC6A 5EJCA 3RSNA 2RVCA 4UUSA 4RB3C 2G0EA 2F48A 2VODA 4RMNA 5IP6A 2XDVA 4A3JJ 4WXCA 4DNCA 3VYSB 3M8FA 3E6CC 3R0AA 2EFPA 4XSXF 2VUMJ 3V7CA 5C44J 3WG9A 2ZBKA 5DV5A 1J75A 2FNAA 4G7ZF 1HDPA 3L00A 3D0SA 2EV5A 1JT6A 1JHFA 3ML6A 4E7KA 4XLCA 3OSFA 2M8EA 2JTVA 1ZK8A 1BN5A 3F72A 4A3CJ 2XKOA 3GTKJ 5D5XB 2VBYA 4OMYA 4EV0A 1BR2A 4UV8A 1RIOH 2GXBA 3CF2A 2RQQA 1IN7A 1NG7A 1AU7A 3CO7C 3ABMH 5FD6A 5M3MJ 1W0TA 4G6DA 2ZB9A 2F4MB 1ODDA 2WAQA 3BPXA 2V1DA 3JSPA 3FIWA 3K2ZA 1KA8A 2Q1ZB 2BZTA 4PZJA 2W00A 4BE2A 1ACIA 2VBXA 2ZXWH 2ZKZA 2XAUA 3T5XA 3FK6A 3KYCB 3S32A 5ICEA 2VONA 4HOBA 3OYMA 1B8IA 2ZXIA 1HQCA 2GWRA 1QPMA 2UV1A 2RQPA 2CQXA 3HYIA 4F52A 2JPCA 3S93A 3FMQA 1G2HA 2LKPA 2ZFUA 1OFCX 5EDNA 2WWYA 2QSFX 1R58A 3VPRA 2OU2A 3S17J 3H9GA 3E5UA 5DS9A 3S15J 2FBKA 4BS9A 4L5JA 2VJ4A 2OZUA 3N05A 2FBHA 1V55H 5KAIC 3NWTA 2KJCA 3SDGA 1O7FA 1LE8A 3WE2A 3CUOA 5IYCJ 3I5UA 5FB2A 2DMTA 2FJ1A 1FSEA 4DZPA 1NTCA 4IZZA 1KYZA 2DO7A 1PUFA 2EQRA 2R7VA 1QHGA 4D1QA 2QENA 5H20A 3EUAA 5B1BH 4D5CA 1Z3YA 1JGGA 1M1EB 2L9RA 3MKLA 1K78B 4Y13A 2P5LC 1BBYA 1B72B 4RS8A 1X4OA 4ZYGA 2FQ3A 2MG4A 4ZZDA 1S9HA 4A3LJ 4E7LA 2VJJA 1YHQI 2HOSA 3G6EI 3PJRA 3VYTB 1WI3A 4BEHB 4CH7A 3V8JA 4BYYA 5EF6A 2TRTA 2QWWA 1SAXA 3F9KA 1ETKA 5KK1A 2Z2SB 3S3OA 2QSHX 1KU2A 2HQAA 4C3JJ 4V2GA 2MYSA 2XAHA 2NOGA 5J8FA 2CQNA 3MFKA 4CGZA 5CJ9A 1R1TA 1YW8A 3VSLA 1K6OA 2KRHA 2E1OA 2VXDA 5CYVA 4ZYDA 2OC6A 5LD2C 4M3BA 2VB6A 3LA2A 2M2EA 3U1KA 1MMAA 3U2RA 3ABTA 3CP2A 4GO1A 3FXRA 1XMXA 4CZZA 2R93J 2DA1A 1KONA 1W7PB 1YJNI 1SMTA 2NS8A 4DW6A 1X1PA 2K4JA 1R22A 1FMWA 3GF2A 4XM3A 2XPUA 4OOIA 4LIUA 3GTPJ 2KIFA 3U21A 5HOOA 2EA2A 3CP8A 1HW1A 5TRDA 1MH3A 3QPLA 3MQ0A 4HF1A 4AUXA 5F04A 2EB7A 2MFZA 4RM3A 2M7AA 3PNYA 3RQIA 5IOZA 3RZOJ 1WJ5A 4II3A 4DQ2A 1O3QA 3R61A 3W6KB 1IDZA 5FKKA 1LKXA 1O3RA 1YS6A 4MQ9F 2A6HF 2P7CB 1TT5B 1FPQA 1SD4A 2DYSH 1I6HJ 3L7WA 4NC8A 1ZHFA 3MKYB 4ZYHA 2BHZA 3IL2A 1IGNA 1VQLI 3ZMVA 1DDNA 4GYIA 1BW5A 3IRQA 3GLLA 1YYVA 3BDDA 2FOKA 3PNTA 2Z9OA 3T0YA 3OYNA 3K6GA 5J3LA 1HKTA 2V4JC 4YFXF 3LSRA 1RUNA 2A69F 3J7AY 1XC5A 3M7GA 2IW5A 3BQZA 1R1VA 5F64A 4YIRX 2HOTA 3EYYA 1ZG5A 5HS8A 1MDMA 2STTA 2XUBA 2VPLA 1YO5C 4KISA 4P55A 4AVPA 2E5NA 3L1PA 2KKOA 2CQKA 1LDKB 3JRFA 3DV8A 1HBXG 1OCRH 3CD6I 4BUPA 3S3MA 4RAFA 2DDAA 2O9LA 3GTGJ 5LHGA 3DBHB 3MCZA 1MMSA 1WVRA 3H3UA 3M9AA 1AKHB 4CCMA 1VQOI 2K3FA 5IP7J 4RAGA 2K02A 4LLNA 1H88C 3LSMA 2M87A 3I59A 3FK7A 3TP0A 1K6YA 2EFWA 3I53A 3OYJA 2H8WA 4D5FA 3CC4I 4RGUA 1EA3A 1G59A 4BQAA 3QODA 5BNGA 1U9OA 3O2PE 2IS1A 2Z1DA 2DFEA 4G94A 1V4RA 5FKMA 2QEXI 3V42A 4AC0A 4EVIA 2ZO4A 3FF5A 1V5FA 3PO2J 1MMNA 1YOVB 2DQRA 2W57A 1WKMA 1T33A 4A3IJ 1UHWA 1NK3P 3K0LA 3VODA 3CCUI 3FDYA 3G1LA 2QM3A 5JLXA 2OTJI 2RAEA 4ABZA 3ZR8X 1D5VA 2X85A 5HNHA 1HCRA 2CUJA 1JKPC 2DFIA 3Q5FA 2FRHA 1TW2A 3FXOA 2XB0X 5FD5A 2FMLA 4XLNF 3SZTA 2COBA 2PQ8A 5E17F 4M6VA 4PSWA 2NS0A 2X51A 2XGDA 2BVLA 2DT5A 1R4MB 2M0CA 2CRGA 3GYHX 2DMPA 3BJ6A 1LEBA 1LFBA 2MC3A 5HLHA 4BJ5C 3LSIA 4ZDOA 1FJLA 3R0JA 1UHSA 4A69C 1RRJA 2FMYA 2KHMA 1UG2A 1W7PD 1D1BA 3FKIJ 4ITVA 4L9VA 3LMMA 5ILSA 4AIJA 2M45A 1RKWA 5FLVA 5KCMA 3JRAA 2DBBA 4I0AA 1OISA 2PMZN 4UVCA 4M3DA 3OWTA 4L9NA 4R1HA 3HGYA 2BY1A 1OKRA 2WB1N 1ETYA 2OPTA 2M30A 5D6FA 2BXYA 2CYYA 1E3PA 2ECCA 5H2FC 2FOWA 3BG6A 3CCRI 2ZSIB 3GWZA 1L0OC 5E20A 1FYLA 1ETXA 3I55I 3MAJA 1PP7U 1YTYA 1FTTA 1IN4A 4GGGA 3KLNA 2F5FA 1BC7C 2HYFA 4L0YB 3NQOA 1YS7A 3ZGKA 5D5UB 2H6BA 4M74A 4XKVA 1XTAA 2VKDA 3A1YA 2H94A 1Z77A 1HLVA 3K4MA 3QOPA 1BM9A 4X1EA 1FMVA 1SEUA 2NOJB 2H1LA 1XCVA 4P96A 5E3MA 2DYRH 2CFXA 4KYWA 5J1UA 5IOYA 4F55A 4ESJA 1OR7A 4I76A 4LGWA 2CUEA 1T0FA 3C2BA 3ZN1A 4YELA 2OA4A 2VI6A 3OOUA 1YX5A 1Z67A 1GVJA 1X3ZB 2BV6A 1D8KA 4RB2C 3G71I 3FXLA 2VE8A 4HA8A 2ISZA 3CJRB 5ICCA 3N97A 3SJMA 4BJ6C 2CJJA 3R4KA 4EJTA 4AYBN 2R5YA 2JUCA 1D0YA 5A2QK 4EGYA 2OZ6A 2V9KA 3HIFA 3F8NA 3WU1B 2XASA 1SFXA 5D4SA 1S7AA 1UG0A 4OMZA 5JVGF 1W4MA 5FJ8J 3OYDA 4CUGA 3CLOA 1VNDA 4IQJA 3TL4X 3BZ6A 2WAQN 2ZCWA 3A4CA 1QRYA 2ZMEA 3ABUA 3H3ZA 1OCPA 5EEHA 2IT0A 2L3DA 1BL0A 2LY1A 1K4SA 3T8RA 3CCVI 1BOBA 2VQHA 2HOEA 4KIFA 3IP4B 3CUQB 1F1ZA 5CPRB 3F8BA 1ULYA 3HXLA 3FM3A 4A3GJ 3FXJA 2CV0A 3K4LA 2IXSA 5LHHA 1DU6A 1A6IA 3H0DA 3ZMTA 5CLSA 1W0UA 1R5HA 5CVRA 2R4GA 2ETHA 2JA5J 4IHWA 4WCGA 3P5JA 3WTYC 4ENMA 2K4BA 3KETA 3OYCA 2GM4A 3UKGA 1FP1D 1ZGJA 4XNFA 4A5NA 1EH7A 1TWHJ 1WPKA 3ZQFA 4FISA 4ZJZA 3R60A 1E0EA 1ZQ3P 2W25A 1P4XA 4QTRA 4EGZA 2DCEA 3J7YJ 1W1WE 3HOTA 5D5VB 4KNYA 4C2TA 5E79C 4E7SA 3S3NA 2JSCA 4S0HB 1SFOJ 3W2WA 3DLLF 2QQBA 3CF5F 1Z7UA 4FT8A 1USTA 3IH4A 2R7TA 1LEAA 4F7ZA 4IXAA 5E1ZB 2M34A 4M6YA 3FWEA 1R36A 2VC0A 3S2WA 1DP7P 1P4AA 3H5NA 4L5EA 1ITYA 3E6MA 1I3QJ 3GFJA 1HW5A 2P5VA 2HZDA 2QBYA 2NVTJ 3BROA 3DFGA 3S14J 1KGSA 4NBQA 3HRTA 3M07A 3IV5A 4A0ZA 2B0LA 1H89C 4FQGA 4G7OF 1WZ2A 3ELKA 4UV9A 5F08A 3IKTA 2QBYB 1IN6A 1WRJA 2LC2A 1ZTRA 3LFUA 2B63J 4CYCA 1FBSA 1VZ0A 2HTJA 5LHIA 3PIPF 3E7LA 4E7IA 2H27A 4IHYA 4AVZA 4EMSA 3COAC 2JT1A 5DD8A 1MBHA 3QU6A 1EJ9A 3I71A 1N75A 4PFOA 1VQ9I 4CYCB 1LJ9A 2L7MP 3HEFA 3HOUJ 1RNLA 3V4GA 5FRNA 3LAJA 4F3QA 3H9JA 3HL2A 1FIPA 4QSHA 4DYQA 3TOAA 1GV5A 2MC4A 4LJZF 2M9HA 3GX4X 3A01A 2PMUA 2PI0A 3VDXA 4B44A 3FXUA 4U0YA 3A02A 3AL0B 2EIMH 1FY7A 3KP4A 1IZ1A 3RCOA 4ANJA 3V8KA 2ZXJA 1J59A 1JKOC 1FBUA 1BW6A 2QYOA 2K7LA 3H3VK 2KIMA 3GZ5A 2YR2A 2AXLA 3D1NI 2QZ8A 4E7ZA 2JRTA 4HNTA 3L2WA 2EFQA 1N77A 4M9ZA 2BGCA 4B48A 4UY8I 1O4XA 2MLKA 2R5ZB 3JW4A 4G8XA 5LEKA 1ENHA 2HZTA 4XKBA 3F22A 2CW0F 1H9TA 1OQYA 3M3YJ 2CWEA 4LK1F 2QVOA 3PFYA 2CG4A 2O7OA 2K40A 2YU3A 2YX7A 5JR3A 3GTQJ 1PDNC 1TC3C 1TQIA 1Z7LA 4FE7A 4JX5A 4M73A 2HTSA 4CICA 4ZTJA 2QF7A 2WY7Q 3CTAA 4RDUA 4A12A 1ZR4A 3I4MJ 2VE9A 3HOWJ 3Q9SA 2E1MB 3U1DA 2L7FP 1ZH5A 4PCQA 1Z6RA 1U6GA 1MH4A 2O5RA 3FBIB 2R7FA 3TP3A 4C9YA 1OR7C 4BNCA 3S1MJ 1IO2A 1LFUP 3G1MA 3HG9A 4ENNA 3C7JA 4ENKA 1VFCA 2NNYA 1O57A 2MH9A 1ZKGA 4N4NB 4IHXA 4B3AA 2LK2A 2OUMA 3HPHA 4XLEA 1SVOA 2KP6A 2RKHA 4K2EA 5GPAA 1FC3A 4G6TB 3SDBA 3JREA 3OR2C 2Y9YA 2R3SA 3X2QH 2LTPA 5B1AH 2QGUA 3CC2I 3H0GJ 3DKWA 4B43A 3OYFA 1Q1HA 4LD5A 1IN5A 2K9MA 5D4RA 2X1DA 2LP0A 2HPIA 2IA1A 3CUQC 3ZMSA 3CJNA 5DUKA 3F8FA 2JA2A 4WXHA 1D8JA 2E19A 2EIJH 2NVYJ 3TQNA 3WTTC 4L5IA 1GUUA 3DBLB 3PQJA 2EILH 2KDZA 1J5YA 2O03A 4HNUA 1S7OA 5DD4A 5J47A 2X1EA 4RB0A 3V7RA 1GHCA 4CZCA 2PN6A 2CUZA 2X6WA 1BA5A 5E1WA 1S29A 4QPOA 2DAOA 3L2CA 2VN2A 3GFIA 2I10A 3ZN0A 3AG4H 3H5RA 1Y39A 3NARA 1QVUA 2F5VA 2H09A 2VLAA 3ZXSA 1N25A 2XF7A 5JI6A 1ETOA 4U87A 3U9GA 3FKJA 1JUSA 2DA2A 1FOKA 1RR7A 4LK0F 3JAMZ 2GLOA 1VQ8I 5J4VA 2G9WA 4KFCA 5E8GA 4XONA 3ECOA 2K86A 2F4OB 3ZOBA 1NG6A 2E2IJ 1ZLKA 4ENJA 2XAJA 3MZYA 4F92B 1Y56A 2HWVA 2QQAA 5HDGA 3M8JA 1FTZA 5B66C 3C3WA 4J19A 3HOVJ 1S7EA 5DCFA 1ZAOA 1H8AC 2XROA 3W6JB 1WCMJ 3QYFA 1K61A 1OYWA 4O6JA 2IVMA 3RI4A 5E3NA 3O8GA 5HLTA 5FLXK 4CDGA 2Q2EA 5J4YA 1YITI 4IVNA 1CGPA 4FE4A 5ERIA 2NS7A 3LA7A 4BHBA 2WY8Q 4KIBA 2XKPA 2DA3A 4B47A 3IAS2 5F1RA 4BH9A 3ZQQA 3JR9A 1VQNI 5FFXA 4D0PA 2MGQA 4PJLA 5AONA 4JX4A 2Q2EB 3Q0VA 1TTYA 1BI0A 3J81K 3K7AJ 2EK5A 3S16J 3HGGA 4R8HA 4A3BJ 1Y8RB 1UFMA 3HOYJ 2L9NA 3M1CA 4O5VA 1QGPA 1TZLA 2VQGA 3KEYA 1MSFC 9ANTA 3KZYA 2V9PA 1V54H 1X1BA 1BIBA 2GOXB 1K78A 2A07F 6PAXA 3AAFA 1F5TA 3W6VA 3OR1C 4Y17A 1B72A 4XIDA 2LD5A 5M5YJ 1DPUA 1WJBA 1V3FA 4ESBA 4WK8F 2RNGA 2NNNA 3PO3J 4BEHA 3NAUA 1A35A 5D5WB 2I8DA 1WSUA 1YIJI 3BJOA 2E71A 3A0HC 4M3GA 2DODA 1B9MA 1OMIA 4LLLA 2WBMA 3HKZA 1HSTA 3MWMA 1KQ9A 5B3SH 1MD0A 2Z3YA 4DIQA 3TDUC 4AIDA 2L2OA 3TOBA 1OJLA 2F5CA 2IA2A 3RYPA 3B73A 2TCTA 2K85A 2NVXJ 3S2DJ 2QUFA 4M71A 3OL3A 3LSHA 5DUIA 5E8IA 2E1MC 4NQWA 2GA1A 3IC7A 4BAYA 2QLZA 3UR3C 3K1PA 3OYKA 3GCMA 4M3FA 4IRHA 2MSYA 5DEQA 2G7HA 3K9TA 3DU5A 3OYBA 3ZQLA 1W7PA 3CCMI 1GXPA 2KDOA 3IH2A 2V26A 2LG4A 1IRGA 1HC8A 4NQWB 1KU3A 2DA5A 3DKXA 2RV8A 2ADUA 1R5ID 2BEOA 4Z2YA 3F23A 2E2HJ 3D5LA 2MLGA 1V5EA 4YFKF 4N0BA 5HDNA 3EUKL 3OIOA 1SVLA 4S05A 3M1EA 3L09A 3WU2C 2KISA 2WA0A 5HLIA 1USSA 2WAFA 2FEZA 4OIRF 2AS5F 3BP8A 1MNDA 1QZYA 5J1RA 1C0WA 4FETA 4N9HA 1SAUA 2VL8A 4D7MA 4N4OB 3CMYA 4GRIA 1JT0A 4I02A 2JVHA 1POGA 2BW3A 3QWLA 4CHUA 2DTZA 1D1CA 2ZNZA 2M5WA 3BT9A 1OLTA 1X3UA 4KT6A 4ASNA 4CCKA 4NC7A 4I09A 1B4AA 1J09A 3MZHA 3CDIA 2HQNA 2BW3B 4XRSA 3EQLF 5LRRA 4I2OA 2KRFA 5IY5H 3QPTA 1IW7F 3DEWA 4L9JA 1LDDA 1WGXA 3ISPA 4RGXA 4GDFA 2HQRA 1JI8A 4DOZA 2L01A 3S1QJ 5M3FJ 2Y9ZA 4Q47A 2H8RA 1B6AA 1HA8A 3REOA 3MEXA 1U5TB 4A5MA 5EZGA 1AKHA 4P9FA 2HPMA 5CQGA 3L9FA 2RC4A 3RPUA 5LRSA 4BDYA 2HI3A 3CCQI 3E97A 1FWZA 2GIVA 1TQMA 3S2HJ 1HF0A 4IPAA 1IXRC 5LGNA 4S04A 2R7WA 2HKOA 3MZ8A 4LG0B 2CO5A 4TV7A 4BBRJ 4D9JA 5CVVA 2NVQJ 3E5XA 5FKOA 5C4XJ 1VI0A 2YSRA 5FO5A 1Y1WJ 4DBRA 2HR3A 2MD0A 4HLXA 1AHDP 1WI9A 4RBOA 4LMYA 3G4SI 2Z16A 1VQ7I 4C30A 1EF4A 2L0KA 1HW2A 1PP8F 1U9NA 2WAEA 3IHUA 2LOOA 1ON2A 4HSRA 4HV6A 1QZEA 3BJAA 1ERDA 1Z21A 4V2FA 4G12A 3TGNA 5C3EJ 1QPIA 2N8GA 4B1RA 4IKFA 3RZDJ 2IAIA 2DOAA 1BOAA 3I4PA 1IXSB 4MIMA 2M8GX 3JRCA 2VT3A 4BKXA 4XN3A 3I4NJ 3ESWB 3RKXA 3KX2A 3HSEA 2DMQA 2CU7A 1Z9CA 2HDWA 2E1NA 2V79A 2XGCA 3CCJI 1GXQA 2KLOA 3G2BA 2E7WA 3GEZA 3LSTA 3IH3A 4L18B 2OD5A 1LQ1A 2XSJC 3HRSA 4DGWB 4RA2A 2M4GA 2HQ5A 1MNEA 1JGSA 2YU9J 1ETQA 2B9SA 3EETA 2ZC2A 3E5QA 1MBKA 3IAM2 2V1UA 5M5XJ 1MIJA 5EG0B 3BLYA 3KFWX 4UNOA 2MA3A 1BC8C 4BQOA 1PUEE 2ESNA 3A0BC 5IP9J 1ZGWA 3FZVA 5EEAA 2R7QA 1WHUA 4WX9A 1DQUA 2O61A 4HV5A 1XCBA 2K9QA 2EH3A 2W24A 3DTIA 2TDXA 1E3HA 1LFPA 4E4HA 3KP7A 5L3GA 4XRSG 2R7UA 4PDKA 3SEQA 4HAMA 3W2VA 4G7HF 2XPVA 3EDPA 2M1BA 5FKNA 1CQTA 3O6BB 4YIIA 3ZMZA 2O3FA 4E7JA 5CVUA 3KCCA 2EFNA 2L9SA 2OQGA 1TW3A 4YFNF 2X1CA 3LA3A 1ON1A 3A03A 3RJPA 5L3CA 2K9NA 3B02A 4M9SA 3ECHA 2KRCA 1V5GA 1YLFA 2OCCH 4P5OA 3S1NJ 4Q4ZF 2LNBA 3GW2A 1TLHB 2VKHA 4HX7A 2EZHA 2XSDC 2CH0A 4HF2A 1QBJA 3K69A 3F3XA 2DLLA 4OAYA 4ZZLA 3HOZJ 1S6LA 3G73A 2M3AA 1IDYA 4WWCA 5GAEJ 3SQNA 3DQVC 1U8BA 5EZHA 4E6KG 1ZELA 2E2JJ 4JX6A 3RPUD 5LFAA 4HX4A 1W36D 2XAFA 2HFHA 2HXIA 1MBGA 1W5TA 2R0QC 3R6SA 3TKYA 4HG2A 2EV6A 2DXIA 4IJAA 5DTDA 4FCYA 3CESA 5M5WJ 2R7OA 3CUQA 2LFBA 3JRIA 3BTCA 2VKVA 2I5UA 5JVTA 2RDPA 1OYYA 1TWFJ 4CO8A 5LLQA 1XPXA 2D1HA 3ERED 1J2XA 5BOXA 5F0FA 2DPDA 2BYVE 2MH2A 3RTRA 2QA4I 4L0ZB 2VOOA 3WGGA 3H92A 4YEJA 4KA4A 1QHHD 4XK4A 3VFZA 1FBQA 3DXJF 2B7EA 3ZMDA 4U0WA 3BPVA 2YUSA 1L3LA 1S72I 1UB9A 1PVEA 1LDJA 5HLGA 4QWQA 1RI7A 4PJMA 4Y33A 1VQMI 4HBLA 2PBIA 3I58A 5CKTA 2E5ZA 5EGOB 1W36C 2EPFA 4EM1A 3BQYA 4IX7A 4ETSA 2IS6A 2XB5A 4B8XA 2IP2A 3NEUA 1SD5A 4MFDA 3BR0A 3MKWB 4UB6C 1J7KA 4NUBA 1PJRA 1CF7B 4EATA 2IGOA 3OY9A 4OAZA 4IHTA 3H9QA 2HOAA 3IKVA 4MO7A 1YQAA 1T56A 3BTIA 5K7FA 4HSTA 1YJWI 1X4PA 2JZYA 3E6DA 1Z1DA 2P6TA 3PUFA 3ZQCA 1G4DA 3CJTB 4P9UA 2XC7A 1MJ9A 3RQ4A 2LDUA 4CCJA 1T39A 1APLC 1ORKA 3FISA 3FXMA 2MABA 4JBAA 2ECBA 5CVIA 2KQRA 2RNJA 4ZDLA 2HEOA 3HHGA 3HKZN 5BMZA 2NXNB 4OWRB 4E7HA 4LG3A 2EBIA 4HQEA 3IRRA 2VBWA 1ZGAA 4UXNA 2XVCA 3HRUA 2ZSHB 5E3OA 1K83J 3O8HA 3OS2A 1XDSA 2XGXA 4B09A 2R7ZJ 3HOSA 3WTVC 2AQFA 4Z6YA 3HC7A 4CA0A 3JRBA 1VF9A 3SZGA 1B9NA 2P0WA 3CLQA 1O3TA 3JCUC 4BE1A 4EEFG 3WODF 4MFEA 3DTKA 3J80Z 1FOWA 3KYDB 2JA8J 4NB5A 3OIQA 1B1BA 2DOEA 1X1CA 2UXNA 3K1MA 1FOXA 4IOCF 2J5PA 2FX0A 2OF7A 2R7DA 3DEEA 3MD2A 1VQPI 3VSKA 2YPRA 2LF8A 3LQRA 1F4KA 3I9V2 4M6XA 3T8TA 3FMSA 4XLPF 1A5JA 1ZYRF 2JVGA 3AFHA 2MW8A 2R5ZA 5ILVA 2R92J 4EM2A 1TNSA 2E36A 1I1SA 4C3HJ 1HDDC 3QU3A 4AIHA 2XV4S 2OAZA 1XG1A 4XR6A 3OIPA 1E2XA 2KL4A 2A5YB 4W97A 4JP0A 1I39A 2PG4A 3WE3A 5J6XA 2CV2A 1YW9A 1YIOA 4JYKA 2V7FA 2XF5A 1UELB 4HYEA 3K4KA 3OYLA 1NK2P 2VXZA 1DP3A 1JUMA 3VYRB 1UCRA 1Z05A 4HNVA 1XGOA 1E3OC 2HS5A 3AG2H 4I99C 5LBQA 4MTEA 2DMUA 1O3SA 4U88A 1ETWA 3HUGA 3ZQIA 3DEUA 3HM5A 4ZDPA 3Q9VA 2LR8A 2JK3A 2CW7A 3VOEA 4XLHA 4IQ4A 3GFMA 3KE2A 4XLFA 1A31A 3BTJA 2H1KA 4I98B 2ID6A 1I50J 4U7BA 1IF1A 1IJWC 1JTYA 2O8XA 5FLMJ 3HUGB 4I01A 4HDVA 2XIGA 1TWCJ 3PUBA 3RIRA 4BE0A 3HPGA 1Y6IA 3HSFA 4GCVA 3F21A 4DYCA 1NH3A 1KYWA 2CV1A 3OL4A 5IT3A 2PJPA 1T95A 1X1AA 5A2QZ 4O3MA 1REPC 1JKQC 1HKQA 3L2UA 5D8LB 2DDBA 4EJOA 5IYDJ 4C2UA 5KHDA 1YRNA 1G3WA 3Q0UA 1FZPB 3QP5A 4M72A 4OIPF 3ROUA 2JMWA 2XRNA 2X0LA 4I0BA 1MBJA 4RGSA 1IV6A 2X4HA 2DMNA 3CDHA 3I54A 1YRNB 2Y2ZA 5E3LA 3KEQA 2PMZA 3JRHA 2A3SA 4LITA 3TO7A 2D45A 1KQ8A 3F6OA 4KN7X 3IWFA 2YX4A 4XOTA 4JK1X 3BR3A 3TDZC 3DF8A 2BY2A 2FSWA 1WH7A 2VASA 3BG5A 1Y0UA 2ICWG 2Y31A 5K5RA 1QQIA 3ZMUA 1MNMC 2ZFWA 4HDUA 1ZRCA 3AG1H 2Z5UA 1MJBA 3N4MA 2CQ7A 1VQ6I 4M9XA 2E60A 1RKTA 3WTWC 3JSOA 2EZKA 4N9IA 4RLQA 4DZJA 4HX8A 5EYRA 3GXOA 1RPWA 3P7NA 3SYTA 1ZARA 4LFUA 5DM7F 2PJRA 4CCOA 4EJVA 3HB9A 4A3KJ 4FASD 1Z91A 4C2MJ 5IT9Z 1PYVA 2UXXA 1UHMA 2GOMA 1SFEA 3PM1A 1Y0NA 4RGRA 3DCFA 2PJRB 2DK8A 2FXAA 1U2WA 1S5LC 3TBIA 2GZWA 3BR1A 3ZRGA 2O8KA 4FHTA 2L7KA 1ZG1A 1BI3A 3DBRB 2Y69H 4PJ0C 1IAWA 2JPBA 3LSKA 4UHTA 4MLOA 3ZP5A 2HVSA 3C1DA 2JSPA 2A05A 3TW7A 4BHCA 2PFBA 4OU0A 2IS4A 4LOCA 4UUSB 3GVAA 4AYBA 3P9IA 3FXKA 2Q0OA 3I0TA 5DYMA 3L2QA 1WJFA 2IGNA 3MVPA 4EQQA 5DM6F 3WGIA 2GAUA 2RN7A 4XL9A 1ZRDA 4ZYAA 3OS1A 3FHNA 5J8CA 2OJED 3HRMA 2ACJA 4CSWA 4IRIA 2ZNYA 1FEXA 3QRFF 3H35A 4A3FJ 3KLOA 2IGKA 3Q0WA 2ELKA 5TGTA 2BY3A 2EV0A 2VBZA 2XRLA 4C3IJ 5GTIC 5E18F 1P7IA 2Z33A 1U78A 3KP3A 1WJEA 3RKQA 1F9NA 3K4NA 3H5AA 1AA7A 2K9SA 2FNPA 3H36A 4ZH4F 3KP6A 3C2HA 1FLIA 2WC2A 4PFPA 4LB6B 2OTLI 2W4SA 1WJCA 4BACA 1I1GA 3AL0C 5HDKA 3SFZA 1YI2I 2Y0SA 2JQ7A 3DPTA 2JA7J 1BJAA 2W82A 2BE5F 3H1CA 3ERMA 3TO6A 2IPQX 5DDGA 1B8IB 4Y3OA 3C2GA 4Y7NJ 3WGHA 1VQ5I 1OCTC 2FA5A 3JTGA 2FBIA 2E34A 3ULQB 5GTHC 2E35A 2R7SA 3LL7A 1J0RA 2KZGA 1P6RA 2W85A 3VB2A 4GFBA 4BDZA 2BOLA 5BPIA 2G7UA 2W1OA 3BCAA 1TT0A 1QO0D 3CCLI 3Q3SA 2L7ZA 2HDCA 4NHJA 4ZYEA 3PQKA 3QPSA 1Y8QB 1DGWY 2OBPA 4ESFA 2CQQA 1P92A 1HXDA 1SVMA 1I3AA 4XRMA 1KZHA 1ZRFA 2DFFA 3S1RJ 2D5VA 1ZREA 2LKSA 2X6OA 2P4WA 3OSGA 1UAAA 1H9GA 5KAFC 1LE8B 2JWTA 1JE8A 4H4KC 1ZR2A 4BQQA 1PUFB 1X19A 1I6XA 2P81A 2DOFA 3VWBA 4KMFA 1SFUA 2E7XA 2M0MA 2FD5A 4G6QA 3EPZA 1AWCA 5HVQC 3AG3H 1G3TA 2OCEA 3MN2A 2HU9A 1EH8A 3HHHA 3QP6A 1XGMA 3PIOF 5L3FA 3E1SA 3DKYA 2EWNA 2NVUB 3RDIA 4CCNA 4YRVA 2Y30A 1D1AA 1U0JA 1X2NA 2PEXA 3GUDA 3KYLA 2GXGA 5IPAA 3GFLA 2V9VA 2DA6A 3GBGA 3KZIC 2MD5A 3DWLE 5FROA 1IG7A 2PX9A 3I64A 5TJJA 1D0ZA 1RUOA 1YW7A 2QSGX 1R5GA 2XGEA 2F5DA 4MQVA 1Z6TA 3IUOA 1IUYA 2F6CA 2CMPA 2DT7B 3IWZA 3ZCOA 2L4AA 2DQLA 4YG2F 1TBXA 1IUFA 1A04A 1XGSA 1MMGA 1JKRC 1S3JA 5GP9A 3CQZJ 5E1XA 1A36A 3JRDA 4I7HA 2ZJQF 4FTHA 3FMRA 5ICFA 2GXAA 2XAGA 2EZIA 5FFZA 2DA7A 2O0YA 1TP4A 3I3LA 3VEPA 1JTXA 2A5WA 2AHQA 3FXQA 4HQMA 1XD7A 1QA6A 2C6YA 4QPQA 1U5TA 1YJ9I 2ZJPF 1U3EM 1KQ0A 1T2KA 1JHHA 1FT9A 3HZJA 2H6CA 5H6RA 3KZZA 3LWFA 2HYJA 2P6SA 1QU3A 1MW7A 2KPMA 2P5KA 3KPHA 1OCZH 2IGMA 4XSZF 1MJAA 5ICGA 3ZQ7A 2V6EA 2AO9A 2DA4A 5CQEA 3BC8A 2LSOA 1TNTA 4V19K 5KVRA 2HYGD 1J9IA 2M4KA 4CCLA 2L54A 4F91B 2L9VA 1GVDA 3E3VA 3LNQA 1RC9A 5EEGA 3LQQA 2HVRA 3NRVA 1T08B 1LVKA 3CZ6A 2QQ8A 4LG0A 1R00A 1I5ZA 4HZFA 2VQLA 2LY9A 1EKEA 1QVTA 3GTMJ 5D8KB 1TWAJ 4D7NA 1FYMA 2YS9A 3QYEA 2PMHA 1FYKA 3J7AO 4Q48A 2XF6A 4BU2A 3K70D 2HVQA 2LBFA 4G9YA 4KITB 4A6DA 4MEYF 3TEDA 3K4CA 4A93J 1EH6A 1SMYF 2LREA 5K5OA 3KP2A 1MDMB 3OYEA 1XN7A 4UB8C 2K3PA 2LBFB 4Q5SF 3PSIA 5JHFA 3HOXJ 2HDDA 4RB1A 4HF0A 3QOEA 5F0CA 2VJ5A 2UWMA 4L9TA 1OCOH 3ZQGA 3G1OA 3BZKA 2KZVA 1ZG3A 3QYBA 5FLXZ 2JJ7A 4XICA 4RM2A 2Y75A 2F5EA 2W84A 4BXFA 1LNWA 1UMQA 3ZQHA 3WTSC 5BPDA 3ABKH 3I59B 3WG7H 1WWXA 1D5YA 2XPWA 3DLAA 4A3DJ 3CMMA 3K2AA 2STWA 2A68F 2GQQA 1FP2A 3BR6A 3BTLA 1BI1A 1O7LA 4ZC3A 3J81Z 1HSJA 1YE9A 3K70C 2QKMB 4M3EA 1R6RA 2KIUA 2Z99A 3MMYB 2K5CA 5BS6A 5FRMA 2ID3A 1RZ4A 2J5OA 4LIVA 5GADJ 2KFDA 4Y15A 4KN4X 3V8LA 2BXZA 1SD6A 4AM3A 3LSGA 3GZ6A 5EG0A 4UUTA 4GYGA 1ETVA 5HS7A 1R7JA 2XHKA 3CCYA 2ZJRF 1LPQA 2L5QA 3W3CA 3BOQA 1G3SA 2FU4A 1R4NB 1MBEA 5F0HA 3CCSI 3WTZA 3K4JA 4QLCU 3CCEI 3M8EA 4CXFA 4HEA2 4BJTA 3OV8A 4KICA 2JA6J 4XN0A 1STZA 5K7HA 4PJNA 2DJNA 2V1NA 1WJDA 3OOPA 3J80K 2Q8KA 3KEOA 1FOYA 5L3EA 5ED4A 2EA4A 2KIQA 3S8PA 4IO9F 3CMAI 5AIQA 1WFXA 3OS0A 2LVSA 3LSJA 4J00A 3OYAA 4X6AJ 4WF2A 2DTRA 2PLYA 2RGVA 4MTDA 1GT0C 3BWGA 3KIOA 1QZZA 1W5CC 3DPLC 2CS3A 1VQKI 2IBDA 1IRXA 1UJ8A 4HPQA 3GTOJ 4LLGF 2DPUA 1AOYA 2KMUA 4FX4A 3SFIA 3HTSB 1XSDA 2L4MA 1IRFA 2V6CA 4EM0B 4E70A 4PSXA 3I56I 3K4BA 4A0YA 2DFHA 1P9QC 2IRFG 3HSRA 3BG9A 5H6QA 1SANA 2LH9A 1RR8C 5K7ZA 2CW8A 3BG3A 5JHUA 4PJJA 2IS2A 3GTJJ 3RPQA 1P2FA 3QPHA 1DUXC 2NYXA 3P9KA 1GDTA 2P8TA 1F43A 3HTUA 1JJ6C 4AWXB 1QNTA 2BBYA 1T98A 4LB5A 4XQFA 1IRZA 3D5RC 3CC7I 4GXOA 5JLWA 2EZLA 2VC1A 5KNLA 3KP5A 4II2A 2OV7A 3ONQA 3EUHA 5F27A 1JUPA 2ZJ2A 3E0JB 4ZTFA 4RAZA 1MZBA 2LRDA 3V7SA 1W5SA 2IA0A 3F0CA 4PUSA 5LGTA 1IXCA 1XDUA 1R49A 1X58A 4XORA 3CDLA 3LAPA 2VIXA 4P1WA 2LY2A 4OIQF 3SZPA 5K5QA 5GAHJ 1SC7A 4IEJA 1JXSA 3LOCA 3JRGA 4OINF 3VYUB 1DPRA 4H0EA 4BHPA 5K1YA 3HBLA 1H0MA 2ESHA 1RESA 3QAHA 3ZPLA 5JFRA 3DPUA 1YFHA 3K1NA 4OIOF 3F8MA 1U5TC 4BBSJ 1XSVA 3NWSA 3J7ZI 3M4OJ 5DCMA 2IEKA 4IL6C 3GO5A 4KUMA 4ON0A 1DU0A 2NRAC 2R5YB 4DYRA 5EGOA 4KMUX 5HS9A 3SHFA 4PGHA 2BVMA 2IJLA 4KDPA 4A3EJ 4WXDA 4JOMA 3CMEI 5DCMB 1NHAA 2X48A 1T8IA 4IHSA 1WQ2A 5C4JJ 2JN6A 2OQRA 2E1CA 2FF4A 4BGDA 1CF7A 4MGRA 2F4IA 3PL8A 1U8RA 1P7JA 3BY6A 5IYBJ 4DBQA 5TISC 2ZMEB 2HGCA 2LF7A 2X9DA 5FKLA 4XKCA 1DGRM 4EJUA 2KJBA 3BR5A 1S8NA 4BXUA 2EINH 2Y0SN 1G6NA 3FHZA 3L2VA 3TW6A 5ILUA 2AXTC 1X3WB 1BR1A 4MHGA 4IOAF 1IN8A 5HODA 3HDDA 4A0XA 4BL0B 3GMEA 3A2KA 2VT2A 3OYIA 3PNVA 2CGPA 2CSOA 5IT9K 1ONVA 3DTEA 2HKXA 2O6GE 4BXXJ 2QCOA 1RETA 5J1YA 1KU7A 4MEXF 2L02A 2WV0A 2HNHA 1D3YA 3L2RA 3JAMK 3AKZA 1MBFA 4UUVA 3SXYA 3OMYA 2VOPA 2VQCA 4A3MJ 2EIKH 2LLKA 3WU0A 2DN0A 1TWGJ 3JTHA 4YIFA 3PSFA 3FX3A 1SFKA 4IHVA 5GPCA 3TO9A 1K7AA 4KJZA 3B6AA 1JJ8C 3K10A 3RKYA 5L3BA 1YG2A 3CO6C 2K9LA 1X1DA 5FGMA 1R71A 1TL8A 2EJRA 3CJQB 2UUZA 1BJZA 3UNGC 2LMDA 4B4CA 4QIWN 3B6CA 1FNNA 5L3DA 4A2UA 4HLYA 4R79A 1VQ4I 2KT0A 2WTEA 3HJEA 2DT6A 2F2EA 2W7NA 1XX5A 2ME0A 3F6VA 1SD7A 5CVJA 3WHCA 1MKMA 1LUJB 2R7RA 3RYRA 3LFKA 4B3XA 2UZKA 2FUG2 3WHBA 3ABLH 2M7BA 4XMYA 1P4WA 4XRFA 2DW4A 1GLNA 1ZN2A 4BY7J 3D5SC 3DU6A 4RLFA 4U0VA 5LEJA 4Y52J 1MGTA 2RREA 2K27A 3QQAA 1OCCH 5F1JA 2A6EF 4HRIA 3BCBA 2X6YA 5F6FA 3SEZA 1OPCA 3A01B 4AIKA 3BG7A 4U7DA 1X2MA 3WTXC 4CYDA 1EV7A 5B5EC 1VTNC 1UZCA 4IRGA 1FX7A 1HKSA 2ME6A 1K79A 1I27A 4AU7A 2LYCA 2DK5A 2Y0MA 1BR4A 2ELJA 3E6BA 3LSPA 3F8CA 4BY1J 2DJIA 2Y48A 2LKXA 4PGGA
chains in the Genus database with same CATH topology
2JA7J 1HOMA 4BBRJ 5FJ8J 2NVQJ 1B8IB 5FKOA 5C4XJ 1VI0A 1VNDA 4Y7NJ 2WAQN 1Y1WJ 1OCTC 1QRYA 1AHDP 1WH5A 4RBOA 1OCPA 4GFBA 1MSEC 1BL0A 1EF4A 2L0KA 3Q3SA 2L7ZA 1U9NA 3QPSA 2GBYA 4A3GJ 1FIAA 2CQQA 4V2FA 4G12A 2W48A 4XRMA 5C3EJ 1DU6A 1A6IA 2N8GA 2WV1A 4B1RA 1QPIA 3RZDJ 3S1RJ 2D5VA 2FQ4A 1W0UA 2IAIA 2VPRA 1R9TJ 2X6OA 1GV2A 2JA5J 4IHWA 3OSGA 4MIMA 1Q1VA 1LE8B 1F36A 2JWTA 2M8GX 4BKXA 3JRCA 3UKGA 2GM4A 1WPKA 1TWHJ 3ZQFA 1ZR2A 4FISA 3I4NJ 1PUFB 1ZQ3P 2DMQA 2CU7A 2P81A 4QTRA 1XS9A 2CUFA 1Y1VJ 2FD5A 2XGCA 3IH3A 4S0HB 3MN2A 1SFOJ 3IH4A 4I6ZA 2HQ5A 2Y30A 1X2NA 2YU9J 1ETQA 2M34A 5IPAA 4NDLA 4L5EA 1ITYA 2HXOA 1MBKA 1I3QJ 5M5XJ 2NVTJ 2VKEA 2DA6A 3GBGA 1IG7A 5EG0B 3S14J 1Z0XA 1IC8A 2XGEA 5IP9J 1ZGWA 3BR2A 5EEAA 3IV5A 1H89C 5F08A 2K9QA 2EH3A 1IUFA 1ZTRA 2B63J 4CYCA 3GTLJ 4W1UA 4XRSG 1JKRC 3E7LA 4UUSA 2XPVA 2G0EA 4IHYA 5FKNA 5GP9A 1CQTA 1MBHA 3CQZJ 5IP6A 3JRDA 4A3JJ 4FTHA 4CYCB 2L7MP 3HEFA 3HOUJ 2VUMJ 2EZIA 2DA7A 5C44J 1FIPA 4QSHA 3A03A 4DYQA 1JTXA 2AHQA 1GV5A 1HDPA 2K9NA 1JT6A 2M9HA 3OSFA 3S1NJ 3A01A 1ZK8A 4A3CJ 2HYJA 3GTKJ 1AU7A 2AO9A 2DA4A 3A02A 5M3MJ 1W0TA 2EZHA 2ZB9A 2XSDC 1GVDA 3FIWA 3LNQA 3HOZJ 1JKOC 1BW6A 1IDYA 2LY9A 1QVTA 3H3VK 3FK6A 3GTMJ 1U8BA 5EZHA 1B8IA 2E2JJ 3D1NI 4JX6A 1TWAJ 4D7NA 2YS9A 2HXIA 1MBGA 1O4XA 2R0QC 2R5ZB 3TEDA 2CQXA 4A93J 1ENHA 5DTDA 3M3YJ 1G2HA 4FCYA 1OFCX 2O7OA 5EDNA 5M5WJ 3VPRA 2K40A 3S17J 2LFBA 3GTQJ 3JRIA 1TC3C 3BTCA 5DS9A 2VKVA 1TWFJ 3S15J 4FE7A 3HOXJ 4JX5A 2HDDA 5F0FA 2QF7A 4RDUA 3SDGA 1ZR4A 3I4MJ 5F0CA 3HOWJ 1LE8A 5IYCJ 4XK4A 3ZQGA 3G1OA 2DMTA 2FJ1A 4DZPA 1NTCA 2L7FP 1PUFA 2JJ7A 2EQRA 4XICA 1MH4A 2YUSA 3TP3A 1UMQA 3ZQHA 3S1MJ 1D5YA 1LFUP 3G1MA 4D5CA 2XPWA 4A3DJ 1JGGA 3K2AA 1VFCA 2L9RA 3MKLA 1ZKGA 3BR6A 3BTLA 1B72B 4IHXA 4B3AA 5EGOB 2MG4A 2LK2A 3BQYA 4M3EA 5GPAA 2XB5A 4A3LJ 4MFDA 2HOSA 3BR0A 3JREA 2ID3A 1WI3A 2Y9YA 3LSGA 5EG0A 4UUTA 5EF6A 1ETVA 2TRTA 2LTPA 3CCYA 3H0GJ 1ETKA 2HOAA 4MO7A 1MBEA 5F0HA 4C3JJ 1T56A 2LP0A 3BTIA 4V2GA 5K7FA 2NOGA 3ZQCA 2JA6J 2E19A 5K7HA 1APLC 2DJNA 1ORKA 2NVYJ 3FISA 1GUUA 2ECBA 2KDZA 2E1OA 3HKZN 3LSJA 2LVSA 4M3BA 4X6AJ 2EBIA 2M2EA 1BA5A 1GT0C 5E3OA 1K83J 3O8HA 2R93J 2DA1A 2IBDA 3GTOJ 2NS8A 2I10A 2R7ZJ 4DW6A 3NARA 3JRBA 2XPUA 1VF9A 1QVUA 3SFIA 3GTPJ 1ETOA 4EEFG 4MFEA 1MH3A 3QPLA 4AUXA 5F04A 1JUSA 2JA8J 2DA2A 3BG9A 1RR7A 3RQIA 5IOZA 1SANA 3RZOJ 5K7ZA 2GLOA 2FX0A 2OF7A 1IDZA 5FKKA 3BG3A 3GTJJ 1I6HJ 1GDTA 1A5JA 1F43A 1IGNA 1JJ6C 3ZOBA 1BW5A 2E2IJ 1IRZA 2MW8A 5J3LA 2R5ZA 5JLWA 2EZLA 2R92J 3LSRA 1FTZA 1XC5A 5F27A 4C3HJ 1JUPA 4J19A 1S7EA 3BQZA 1HDDC 2HOTA 3HOVJ 1XG1A 1H8AC 1WCMJ 1K61A 3F0CA 4W97A 5E3NA 3O8GA 4JP0A 1X58A 3L1PA 3CDLA 4FE4A 1NK2P 2NS7A 4JYKA 3JRFA 2DA3A 1JUMA 4IEJA 3LOCA 3JRGA 3JR9A 4HNVA 2MGQA 1E3OC 2O9LA 3GTGJ 3HBLA 1RESA 4JX4A 3Q0VA 3S16J 3K7AJ 1AKHB 2DMUA 5IP7J 1ETWA 3HGGA 1H88C 4A3BJ 4BBSJ 3TP0A 3FK7A 3ZQIA 3HOYJ 3HM5A 3M4OJ 2LR8A 1MSFC 2IEKA 2JK3A 4D5FA 9ANTA 1DU0A 5BNGA 3BTJA 2H1KA 3W6VA 1U9OA 2R5YB 2ID6A 1I50J 1B72A 4DYRA 4XIDA 5FKMA 5EGOA 5M5YJ 2LD5A 1JTYA 1IJWC 5FLMJ 1TWCJ 4A3EJ 4AC0A 4DYCA 2X48A 3PO3J 3PO2J 5C4JJ 2JN6A 3NAUA 1T33A 4A3IJ 1NK3P 4M3GA 1JKQC 3G1LA 1P7JA 5IYBJ 5JLXA 5IYDJ 2RAEA 4ABZA 2X9DA 5FKLA 1YRNA 3BR5A 3Q0UA 1JKPC 1HCRA 2Y0SN 2JMWA 3TW6A 1OJLA 1MBJA 1IV6A 2DMNA 2TCTA 2NVXJ 2XB0X 3S2DJ 5HODA 3HDDA 2COBA 1YRNB 2Y2ZA 4M6VA 5E3LA 3JRHA 2XGDA 2M0CA 2CRGA 2DMPA 3BR3A 4BXXJ 2QCOA 1RETA 5J1YA 4M3FA 1WH7A 2MSYA 1LFBA 3BG5A 2Y31A 3ZQLA 1MNMC 3IH2A 1FJLA 1MBFA 1UHSA 4A69C 4A3MJ 2DA5A 2LLKA 1RKTA 1UG2A 2E2HJ 2DN0A 2EZKA 1TWGJ 3FKIJ 4DZJA 1RKWA 4IHVA 5EYRA 3JRAA 1RPWA 5FLVA 5GPCA 3OIOA 3HB9A 4A3KJ 2PMZN 3B6AA 4C2MJ 4M3DA 3HGYA 3PM1A 1JJ8C 2WB1N 3DCFA 1ETYA 2OPTA 5J1RA 1JT0A 1BJZA 4D7MA 3CMYA 3BR1A 2ECCA 4B4CA 4QIWN 3B6CA 2O8KA 1POGA 1ETXA 2DTZA 4MLOA 1FTTA 2KT0A 3BT9A 3TW7A 2ME0A 3WHCA 4LOCA 4UUSB 4XRSA 1Z77A 3MVPA 1HLVA 3WHBA 3DEWA 4X1EA 5E3MA 1WGXA 3S1QJ 4BY7J 5M3FJ 4Y52J 2Y9ZA 5J1UA 5IOYA 2H8RA 4I76A 3QQAA 1FEXA 2CUEA 5F1JA 4A3FJ 3C2BA 5EZGA 1AKHA 2VI6A 3Q0WA 3OOUA 3A01B 2ELKA 2XRLA 1X2MA 4C3IJ 1P7IA 1U78A 3RKQA 2ME6A 3SJMA 2HI3A 2CJJA 4AYBN 2K9SA 2R5YA 3S2HJ 1HF0A 3LSPA 4BY1J 2LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 J;  1HOM A;  4BBR J;  5FJ8 J;  2NVQ J;  1B8I B;  5FKO A;  5C4X J;  1VI0 A;  1VND A;  4Y7N J;  2WAQ N;  1Y1W J;  1OCT C;  1QRY A;  1AHD P;  1WH5 A;  4RBO A;  1OCP A;  4GFB A;  1MSE C;  1BL0 A;  1EF4 A;  2L0K A;  3Q3S A;  2L7Z A;  1U9N A;  3QPS A;  2GBY A;  4A3G J;  1FIA A;  2CQQ A;  4V2F A;  4G12 A;  2W48 A;  4XRM A;  5C3E J;  1DU6 A;  1A6I A;  2N8G A;  2WV1 A;  4B1R A;  1QPI A;  3RZD J;  3S1R J;  2D5V A;  2FQ4 A;  1W0U A;  2IAI A;  2VPR A;  1R9T J;  2X6O A;  1GV2 A;  2JA5 J;  4IHW A;  3OSG A;  4MIM A;  1Q1V A;  1LE8 B;  1F36 A;  2JWT A;  2M8G X;  4BKX A;  3JRC A;  3UKG A;  2GM4 A;  1WPK A;  1TWH J;  3ZQF A;  1ZR2 A;  4FIS A;  3I4N J;  1PUF B;  1ZQ3 P;  2DMQ A;  2CU7 A;  2P81 A;  4QTR A;  1XS9 A;  2CUF A;  1Y1V J;  2FD5 A;  2XGC A;  3IH3 A;  4S0H B;  3MN2 A;  1SFO J;  3IH4 A;  4I6Z A;  2HQ5 A;  2Y30 A;  1X2N A;  2YU9 J;  1ETQ A;  2M34 A;  5IPA A;  4NDL A;  4L5E A;  1ITY A;  2HXO A;  1MBK A;  1I3Q J;  5M5X J;  2NVT J;  2VKE A;  2DA6 A;  3GBG A;  1IG7 A;  5EG0 B;  3S14 J;  1Z0X A;  1IC8 A;  2XGE A;  5IP9 J;  1ZGW A;  3BR2 A;  5EEA A;  3IV5 A;  1H89 C;  5F08 A;  2K9Q A;  2EH3 A;  1IUF A;  1ZTR A;  2B63 J;  4CYC A;  3GTL J;  4W1U A;  4XRS G;  1JKR C;  3E7L A;  4UUS A;  2XPV A;  2G0E A;  4IHY A;  5FKN A;  5GP9 A;  1CQT A;  1MBH A;  3CQZ J;  5IP6 A;  3JRD A;  4A3J J;  4FTH A;  4CYC B;  2L7M P;  3HEF A;  3HOU J;  2VUM J;  2EZI A;  2DA7 A;  5C44 J;  1FIP A;  4QSH A;  3A03 A;  4DYQ A;  1JTX A;  2AHQ A;  1GV5 A;  1HDP A;  2K9N A;  1JT6 A;  2M9H A;  3OSF A;  3S1N J;  3A01 A;  1ZK8 A;  4A3C J;  2HYJ A;  3GTK J;  1AU7 A;  2AO9 A;  2DA4 A;  3A02 A;  5M3M J;  1W0T A;  2EZH A;  2ZB9 A;  2XSD C;  1GVD A;  3FIW A;  3LNQ A;  3HOZ J;  1JKO C;  1BW6 A;  1IDY A;  2LY9 A;  1QVT A;  3H3V K;  3FK6 A;  3GTM J;  1U8B A;  5EZH A;  1B8I A;  2E2J J;  3D1N I;  4JX6 A;  1TWA J;  4D7N A;  2YS9 A;  2HXI A;  1MBG A;  1O4X A;  2R0Q C;  2R5Z B;  3TED A;  2CQX A;  4A93 J;  1ENH A;  5DTD A;  3M3Y J;  1G2H A;  4FCY A;  1OFC X;  2O7O A;  5EDN A;  5M5W J;  3VPR A;  2K40 A;  3S17 J;  2LFB A;  3GTQ J;  3JRI A;  1TC3 C;  3BTC A;  5DS9 A;  2VKV A;  1TWF J;  3S15 J;  4FE7 A;  3HOX J;  4JX5 A;  2HDD A;  5F0F A;  2QF7 A;  4RDU A;  3SDG A;  1ZR4 A;  3I4M J;  5F0C A;  3HOW J;  1LE8 A;  5IYC J;  4XK4 A;  3ZQG A;  3G1O A;  2DMT A;  2FJ1 A;  4DZP A;  1NTC A;  2L7F P;  1PUF A;  2JJ7 A;  2EQR A;  4XIC A;  1MH4 A;  2YUS A;  3TP3 A;  1UMQ A;  3ZQH A;  3S1M J;  1D5Y A;  1LFU P;  3G1M A;  4D5C A;  2XPW A;  4A3D J;  1JGG A;  3K2A A;  1VFC A;  2L9R A;  3MKL A;  1ZKG A;  3BR6 A;  3BTL A;  1B72 B;  4IHX A;  4B3A A;  5EGO B;  2MG4 A;  2LK2 A;  3BQY A;  4M3E A;  5GPA A;  2XB5 A;  4A3L J;  4MFD A;  2HOS A;  3BR0 A;  3JRE A;  2ID3 A;  1WI3 A;  2Y9Y A;  3LSG A;  5EG0 A;  4UUT A;  5EF6 A;  1ETV A;  2TRT A;  2LTP A;  3CCY A;  3H0G J;  1ETK A;  2HOA A;  4MO7 A;  1MBE A;  5F0H A;  4C3J J;  1T56 A;  2LP0 A;  3BTI A;  4V2G A;  5K7F A;  2NOG A;  3ZQC A;  2JA6 J;  2E19 A;  5K7H A;  1APL C;  2DJN A;  1ORK A;  2NVY J;  3FIS A;  1GUU A;  2ECB A;  2KDZ A;  2E1O A;  3HKZ N;  3LSJ A;  2LVS A;  4M3B A;  4X6A J;  2EBI A;  2M2E A;  1BA5 A;  1GT0 C;  5E3O A;  1K83 J;  3O8H A;  2R93 J;  2DA1 A;  2IBD A;  3GTO J;  2NS8 A;  2I10 A;  2R7Z J;  4DW6 A;  3NAR A;  3JRB A;  2XPU A;  1VF9 A;  1QVU A;  3SFI A;  3GTP J;  1ETO A;  4EEF G;  4MFE A;  1MH3 A;  3QPL A;  4AUX A;  5F04 A;  1JUS A;  2JA8 J;  2DA2 A;  3BG9 A;  1RR7 A;  3RQI A;  5IOZ A;  1SAN A;  3RZO J;  5K7Z A;  2GLO A;  2FX0 A;  2OF7 A;  1IDZ A;  5FKK A;  3BG3 A;  3GTJ J;  1I6H J;  1GDT A;  1A5J A;  1F43 A;  1IGN A;  1JJ6 C;  3ZOB A;  1BW5 A;  2E2I J;  1IRZ A;  2MW8 A;  5J3L A;  2R5Z A;  5JLW A;  2EZL A;  2R92 J;  3LSR A;  1FTZ A;  1XC5 A;  5F27 A;  4C3H J;  1JUP A;  4J19 A;  1S7E A;  3BQZ A;  1HDD C;  2HOT A;  3HOV J;  1XG1 A;  1H8A C;  1WCM J;  1K61 A;  3F0C A;  4W97 A;  5E3N A;  3O8G A;  4JP0 A;  1X58 A;  3L1P A;  3CDL A;  4FE4 A;  1NK2 P;  2NS7 A;  4JYK A;  3JRF A;  2DA3 A;  1JUM A;  4IEJ A;  3LOC A;  3JRG A;  3JR9 A;  4HNV A;  2MGQ A;  1E3O C;  2O9L A;  3GTG J;  3HBL A;  1RES A;  4JX4 A;  3Q0V A;  3S16 J;  3K7A J;  1AKH B;  2DMU A;  5IP7 J;  1ETW A;  3HGG A;  1H88 C;  4A3B J;  4BBS J;  3TP0 A;  3FK7 A;  3ZQI A;  3HOY J;  3HM5 A;  3M4O J;  2LR8 A;  1MSF C;  2IEK A;  2JK3 A;  4D5F A;  9ANT A;  1DU0 A;  5BNG A;  3BTJ A;  2H1K A;  3W6V A;  1U9O A;  2R5Y B;  2ID6 A;  1I50 J;  1B72 A;  4DYR A;  4XID A;  5FKM A;  5EGO A;  5M5Y J;  2LD5 A;  1JTY A;  1IJW C;  5FLM J;  1TWC J;  4A3E J;  4AC0 A;  4DYC A;  2X48 A;  3PO3 J;  3PO2 J;  5C4J J;  2JN6 A;  3NAU A;  1T33 A;  4A3I J;  1NK3 P;  4M3G A;  1JKQ C;  3G1L A;  1P7J A;  5IYB J;  5JLX A;  5IYD J;  2RAE A;  4ABZ A;  2X9D A;  5FKL A;  1YRN A;  3BR5 A;  3Q0U A;  1JKP C;  1HCR A;  2Y0S N;  2JMW A;  3TW6 A;  1OJL A;  1MBJ A;  1IV6 A;  2DMN A;  2TCT A;  2NVX J;  2XB0 X;  3S2D J;  5HOD A;  3HDD A;  2COB A;  1YRN B;  2Y2Z A;  4M6V A;  5E3L A;  3JRH A;  2XGD A;  2M0C A;  2CRG A;  2DMP A;  3BR3 A;  4BXX J;  2QCO A;  1RET A;  5J1Y A;  4M3F A;  1WH7 A;  2MSY A;  1LFB A;  3BG5 A;  2Y31 A;  3ZQL A;  1MNM C;  3IH2 A;  1FJL A;  1MBF A;  1UHS A;  4A69 C;  4A3M J;  2DA5 A;  2LLK A;  1RKT A;  1UG2 A;  2E2H J;  2DN0 A;  2EZK A;  1TWG J;  3FKI J;  4DZJ A;  1RKW A;  4IHV A;  5EYR A;  3JRA A;  1RPW A;  5FLV A;  5GPC A;  3OIO A;  3HB9 A;  4A3K J;  2PMZ N;  3B6A A;  4C2M J;  4M3D A;  3HGY A;  3PM1 A;  1JJ8 C;  2WB1 N;  3DCF A;  1ETY A;  2OPT A;  5J1R A;  1JT0 A;  1BJZ A;  4D7M A;  3CMY A;  3BR1 A;  2ECC A;  4B4C A;  4QIW N;  3B6C A;  2O8K A;  1POG A;  1ETX A;  2DTZ A;  4MLO A;  1FTT A;  2KT0 A;  3BT9 A;  3TW7 A;  2ME0 A;  3WHC A;  4LOC A;  4UUS B;  4XRS A;  1Z77 A;  3MVP A;  1HLV A;  3WHB A;  3DEW A;  4X1E A;  5E3M A;  1WGX A;  3S1Q J;  4BY7 J;  5M3F J;  4Y52 J;  2Y9Z A;  5J1U A;  5IOY A;  2H8R A;  4I76 A;  3QQA A;  1FEX A;  2CUE A;  5F1J A;  4A3F J;  3C2B A;  5EZG A;  1AKH A;  2VI6 A;  3Q0W A;  3OOU A;  3A01 B;  2ELK A;  2XRL A;  1X2M A;  4C3I J;  1P7I A;  1U78 A;  3RKQ A;  2ME6 A;  3SJM A;  2HI3 A;  2CJJ A;  4AYB N;  2K9S A;  2R5Y A;  3S2H J;  1HF0 A;  3LSP A;  4BY1 J;  2LKX A; 
#chains in the Genus database with same CATH topology
 2AQE A;  1IV8 A;  1FSH A;  1HOM A;  4RAY A;  2JRM A;  2DU9 A;  4F93 B;  1XMK A;  2EFO A;  4Y4R A;  1A6Q A;  1XSX A;  3TMO A;  1Z3X A;  2ELH A;  3W2A A;  1WH5 A;  1K4T A;  1G3Y A;  4XKW A;  1MSE C;  3OYG A;  3FM5 A;  1E17 A;  2QKL B;  2VJI A;  2DI3 A;  5BQT A;  5J40 A;  3GZN B;  4XOP A;  5AIP A;  4KT5 C;  1T38 A;  1OYI A;  1XGN A;  4UVA A;  3EUH C;  3MKZ A;  2GBY A;  3ASN H;  1FIA A;  1LVA A;  2W48 A;  2ZXH A;  4PK4 A;  2A6T A;  1KU9 A;  2A61 A;  2WV1 A;  3WTU C;  1TQP A;  4FX0 A;  3OYH A;  2FQ4 A;  4XLA A;  2D2W A;  4UVB A;  2VPR A;  1R9T J;  4KIG A;  1GV2 A;  1T0F C;  2CFO A;  2MBF A;  1B59 A;  4XBF A;  1Q1V A;  1F36 A;  2NAZ A;  1R1U A;  2COM A;  1LB2 A;  1G8X A;  1T6S A;  1XS9 A;  2CUF A;  3BZC A;  3O3K A;  4AD9 A;  1Y1V J;  2P7V B;  2JUG A;  2WAD A;  3PFI A;  2GA2 A;  2WB1 A;  4J01 A;  3ASO H;  2R7X A;  3GLX A;  5D6E A;  4BQN A;  3EYI A;  2GIZ A;  3C18 A;  4I6Z A;  4EJW A;  1YX3 A;  5HNF A;  2XAQ A;  4IF4 A;  4NDL A;  1MMD A;  2HXO A;  3T1B A;  1D0X A;  3P9C A;  2VKE A;  2QQ9 A;  4NNJ A;  1ZLJ A;  2ZME C;  3G3Z A;  2BHY A;  5LGU A;  1Z0X A;  1IC8 A;  2D1V A;  3BR2 A;  2BY0 A;  2X6X A;  2FE3 A;  3DP7 A;  4X0G A;  3FBN B;  3RKW A;  4DJA A;  4MNU A;  1BIA A;  2V1X A;  1R23 A;  4HW0 A;  1WJA A;  1BI2 A;  3GTL J;  5GAG J;  1XMA A;  4JQF A;  2ISY A;  4W1U A;  1N78 A;  1XB4 A;  4A6E A;  4NC6 A;  5EJC A;  3RSN A;  2RVC A;  4UUS A;  4RB3 C;  2G0E A;  2F48 A;  2VOD A;  4RMN A;  5IP6 A;  2XDV A;  4A3J J;  4WXC A;  4DNC A;  3VYS B;  3M8F A;  3E6C C;  3R0A A;  2EFP A;  4XSX F;  2VUM J;  3V7C A;  5C44 J;  3WG9 A;  2ZBK A;  5DV5 A;  1J75 A;  2FNA A;  4G7Z F;  1HDP A;  3L00 A;  3D0S A;  2EV5 A;  1JT6 A;  1JHF A;  3ML6 A;  4E7K A;  4XLC A;  3OSF A;  2M8E A;  2JTV A;  1ZK8 A;  1BN5 A;  3F72 A;  4A3C J;  2XKO A;  3GTK J;  5D5X B;  2VBY A;  4OMY A;  4EV0 A;  1BR2 A;  4UV8 A;  1RIO H;  2GXB A;  3CF2 A;  2RQQ A;  1IN7 A;  1NG7 A;  1AU7 A;  3CO7 C;  3ABM H;  5FD6 A;  5M3M J;  1W0T A;  4G6D A;  2ZB9 A;  2F4M B;  1ODD A;  2WAQ A;  3BPX A;  2V1D A;  3JSP A;  3FIW A;  3K2Z A;  1KA8 A;  2Q1Z B;  2BZT A;  4PZJ A;  2W00 A;  4BE2 A;  1ACI A;  2VBX A;  2ZXW H;  2ZKZ A;  2XAU A;  3T5X A;  3FK6 A;  3KYC B;  3S32 A;  5ICE A;  2VON A;  4HOB A;  3OYM A;  1B8I A;  2ZXI A;  1HQC A;  2GWR A;  1QPM A;  2UV1 A;  2RQP A;  2CQX A;  3HYI A;  4F52 A;  2JPC A;  3S93 A;  3FMQ A;  1G2H A;  2LKP A;  2ZFU A;  1OFC X;  5EDN A;  2WWY A;  2QSF X;  1R58 A;  3VPR A;  2OU2 A;  3S17 J;  3H9G A;  3E5U A;  5DS9 A;  3S15 J;  2FBK A;  4BS9 A;  4L5J A;  2VJ4 A;  2OZU A;  3N05 A;  2FBH A;  1V55 H;  5KAI C;  3NWT A;  2KJC A;  3SDG A;  1O7F A;  1LE8 A;  3WE2 A;  3CUO A;  5IYC J;  3I5U A;  5FB2 A;  2DMT A;  2FJ1 A;  1FSE A;  4DZP A;  1NTC A;  4IZZ A;  1KYZ A;  2DO7 A;  1PUF A;  2EQR A;  2R7V A;  1QHG A;  4D1Q A;  2QEN A;  5H20 A;  3EUA A;  5B1B H;  4D5C A;  1Z3Y A;  1JGG A;  1M1E B;  2L9R A;  3MKL A;  1K78 B;  4Y13 A;  2P5L C;  1BBY A;  1B72 B;  4RS8 A;  1X4O A;  4ZYG A;  2FQ3 A;  2MG4 A;  4ZZD A;  1S9H A;  4A3L J;  4E7L A;  2VJJ A;  1YHQ I;  2HOS A;  3G6E I;  3PJR A;  3VYT B;  1WI3 A;  4BEH B;  4CH7 A;  3V8J A;  4BYY A;  5EF6 A;  2TRT A;  2QWW A;  1SAX A;  3F9K A;  1ETK A;  5KK1 A;  2Z2S B;  3S3O A;  2QSH X;  1KU2 A;  2HQA A;  4C3J J;  4V2G A;  2MYS A;  2XAH A;  2NOG A;  5J8F A;  2CQN A;  3MFK A;  4CGZ A;  5CJ9 A;  1R1T A;  1YW8 A;  3VSL A;  1K6O A;  2KRH A;  2E1O A;  2VXD A;  5CYV A;  4ZYD A;  2OC6 A;  5LD2 C;  4M3B A;  2VB6 A;  3LA2 A;  2M2E A;  3U1K A;  1MMA A;  3U2R A;  3ABT A;  3CP2 A;  4GO1 A;  3FXR A;  1XMX A;  4CZZ A;  2R93 J;  2DA1 A;  1KON A;  1W7P B;  1YJN I;  1SMT A;  2NS8 A;  4DW6 A;  1X1P A;  2K4J A;  1R22 A;  1FMW A;  3GF2 A;  4XM3 A;  2XPU A;  4OOI A;  4LIU A;  3GTP J;  2KIF A;  3U21 A;  5HOO A;  2EA2 A;  3CP8 A;  1HW1 A;  5TRD A;  1MH3 A;  3QPL A;  3MQ0 A;  4HF1 A;  4AUX A;  5F04 A;  2EB7 A;  2MFZ A;  4RM3 A;  2M7A A;  3PNY A;  3RQI A;  5IOZ A;  3RZO J;  1WJ5 A;  4II3 A;  4DQ2 A;  1O3Q A;  3R61 A;  3W6K B;  1IDZ A;  5FKK A;  1LKX A;  1O3R A;  1YS6 A;  4MQ9 F;  2A6H F;  2P7C B;  1TT5 B;  1FPQ A;  1SD4 A;  2DYS H;  1I6H J;  3L7W A;  4NC8 A;  1ZHF A;  3MKY B;  4ZYH A;  2BHZ A;  3IL2 A;  1IGN A;  1VQL I;  3ZMV A;  1DDN A;  4GYI A;  1BW5 A;  3IRQ A;  3GLL A;  1YYV A;  3BDD A;  2FOK A;  3PNT A;  2Z9O A;  3T0Y A;  3OYN A;  3K6G A;  5J3L A;  1HKT A;  2V4J C;  4YFX F;  3LSR A;  1RUN A;  2A69 F;  3J7A Y;  1XC5 A;  3M7G A;  2IW5 A;  3BQZ A;  1R1V A;  5F64 A;  4YIR X;  2HOT A;  3EYY A;  1ZG5 A;  5HS8 A;  1MDM A;  2STT A;  2XUB A;  2VPL A;  1YO5 C;  4KIS A;  4P55 A;  4AVP A;  2E5N A;  3L1P A;  2KKO A;  2CQK A;  1LDK B;  3JRF A;  3DV8 A;  1HBX G;  1OCR H;  3CD6 I;  4BUP A;  3S3M A;  4RAF A;  2DDA A;  2O9L A;  3GTG J;  5LHG A;  3DBH B;  3MCZ A;  1MMS A;  1WVR A;  3H3U A;  3M9A A;  1AKH B;  4CCM A;  1VQO I;  2K3F A;  5IP7 J;  4RAG A;  2K02 A;  4LLN A;  1H88 C;  3LSM A;  2M87 A;  3I59 A;  3FK7 A;  3TP0 A;  1K6Y A;  2EFW A;  3I53 A;  3OYJ A;  2H8W A;  4D5F A;  3CC4 I;  4RGU A;  1EA3 A;  1G59 A;  4BQA A;  3QOD A;  5BNG A;  1U9O A;  3O2P E;  2IS1 A;  2Z1D A;  2DFE A;  4G94 A;  1V4R A;  5FKM A;  2QEX I;  3V42 A;  4AC0 A;  4EVI A;  2ZO4 A;  3FF5 A;  1V5F A;  3PO2 J;  1MMN A;  1YOV B;  2DQR A;  2W57 A;  1WKM A;  1T33 A;  4A3I J;  1UHW A;  1NK3 P;  3K0L A;  3VOD A;  3CCU I;  3FDY A;  3G1L A;  2QM3 A;  5JLX A;  2OTJ I;  2RAE A;  4ABZ A;  3ZR8 X;  1D5V A;  2X85 A;  5HNH A;  1HCR A;  2CUJ A;  1JKP C;  2DFI A;  3Q5F A;  2FRH A;  1TW2 A;  3FXO A;  2XB0 X;  5FD5 A;  2FML A;  4XLN F;  3SZT A;  2COB A;  2PQ8 A;  5E17 F;  4M6V A;  4PSW A;  2NS0 A;  2X51 A;  2XGD A;  2BVL A;  2DT5 A;  1R4M B;  2M0C A;  2CRG A;  3GYH X;  2DMP A;  3BJ6 A;  1LEB A;  1LFB A;  2MC3 A;  5HLH A;  4BJ5 C;  3LSI A;  4ZDO A;  1FJL A;  3R0J A;  1UHS A;  4A69 C;  1RRJ A;  2FMY A;  2KHM A;  1UG2 A;  1W7P D;  1D1B A;  3FKI J;  4ITV A;  4L9V A;  3LMM A;  5ILS A;  4AIJ A;  2M45 A;  1RKW A;  5FLV A;  5KCM A;  3JRA A;  2DBB A;  4I0A A;  1OIS A;  2PMZ N;  4UVC A;  4M3D A;  3OWT A;  4L9N A;  4R1H A;  3HGY A;  2BY1 A;  1OKR A;  2WB1 N;  1ETY A;  2OPT A;  2M30 A;  5D6F A;  2BXY A;  2CYY A;  1E3P A;  2ECC A;  5H2F C;  2FOW A;  3BG6 A;  3CCR I;  2ZSI B;  3GWZ A;  1L0O C;  5E20 A;  1FYL A;  1ETX A;  3I55 I;  3MAJ A;  1PP7 U;  1YTY A;  1FTT A;  1IN4 A;  4GGG A;  3KLN A;  2F5F A;  1BC7 C;  2HYF A;  4L0Y B;  3NQO A;  1YS7 A;  3ZGK A;  5D5U B;  2H6B A;  4M74 A;  4XKV A;  1XTA A;  2VKD A;  3A1Y A;  2H94 A;  1Z77 A;  1HLV A;  3K4M A;  3QOP A;  1BM9 A;  4X1E A;  1FMV A;  1SEU A;  2NOJ B;  2H1L A;  1XCV A;  4P96 A;  5E3M A;  2DYR H;  2CFX A;  4KYW A;  5J1U A;  5IOY A;  4F55 A;  4ESJ A;  1OR7 A;  4I76 A;  4LGW A;  2CUE A;  1T0F A;  3C2B A;  3ZN1 A;  4YEL A;  2OA4 A;  2VI6 A;  3OOU A;  1YX5 A;  1Z67 A;  1GVJ A;  1X3Z B;  2BV6 A;  1D8K A;  4RB2 C;  3G71 I;  3FXL A;  2VE8 A;  4HA8 A;  2ISZ A;  3CJR B;  5ICC A;  3N97 A;  3SJM A;  4BJ6 C;  2CJJ A;  3R4K A;  4EJT A;  4AYB N;  2R5Y A;  2JUC A;  1D0Y A;  5A2Q K;  4EGY A;  2OZ6 A;  2V9K A;  3HIF A;  3F8N A;  3WU1 B;  2XAS A;  1SFX A;  5D4S A;  1S7A A;  1UG0 A;  4OMZ A;  5JVG F;  1W4M A;  5FJ8 J;  3OYD A;  4CUG A;  3CLO A;  1VND A;  4IQJ A;  3TL4 X;  3BZ6 A;  2WAQ N;  2ZCW A;  3A4C A;  1QRY A;  2ZME A;  3ABU A;  3H3Z A;  1OCP A;  5EEH A;  2IT0 A;  2L3D A;  1BL0 A;  2LY1 A;  1K4S A;  3T8R A;  3CCV I;  1BOB A;  2VQH A;  2HOE A;  4KIF A;  3IP4 B;  3CUQ B;  1F1Z A;  5CPR B;  3F8B A;  1ULY A;  3HXL A;  3FM3 A;  4A3G J;  3FXJ A;  2CV0 A;  3K4L A;  2IXS A;  5LHH A;  1DU6 A;  1A6I A;  3H0D A;  3ZMT A;  5CLS A;  1W0U A;  1R5H A;  5CVR A;  2R4G A;  2ETH A;  2JA5 J;  4IHW A;  4WCG A;  3P5J A;  3WTY C;  4ENM A;  2K4B A;  3KET A;  3OYC A;  2GM4 A;  3UKG A;  1FP1 D;  1ZGJ A;  4XNF A;  4A5N A;  1EH7 A;  1TWH J;  1WPK A;  3ZQF A;  4FIS A;  4ZJZ A;  3R60 A;  1E0E A;  1ZQ3 P;  2W25 A;  1P4X A;  4QTR A;  4EGZ A;  2DCE A;  3J7Y J;  1W1W E;  3HOT A;  5D5V B;  4KNY A;  4C2T A;  5E79 C;  4E7S A;  3S3N A;  2JSC A;  4S0H B;  1SFO J;  3W2W A;  3DLL F;  2QQB A;  3CF5 F;  1Z7U A;  4FT8 A;  1UST A;  3IH4 A;  2R7T A;  1LEA A;  4F7Z A;  4IXA A;  5E1Z B;  2M34 A;  4M6Y A;  3FWE A;  1R36 A;  2VC0 A;  3S2W A;  1DP7 P;  1P4A A;  3H5N A;  4L5E A;  1ITY A;  3E6M A;  1I3Q J;  3GFJ A;  1HW5 A;  2P5V A;  2HZD A;  2QBY A;  2NVT J;  3BRO A;  3DFG A;  3S14 J;  1KGS A;  4NBQ A;  3HRT A;  3M07 A;  3IV5 A;  4A0Z A;  2B0L A;  1H89 C;  4FQG A;  4G7O F;  1WZ2 A;  3ELK A;  4UV9 A;  5F08 A;  3IKT A;  2QBY B;  1IN6 A;  1WRJ A;  2LC2 A;  1ZTR A;  3LFU A;  2B63 J;  4CYC A;  1FBS A;  1VZ0 A;  2HTJ A;  5LHI A;  3PIP F;  3E7L A;  4E7I A;  2H27 A;  4IHY A;  4AVZ A;  4EMS A;  3COA C;  2JT1 A;  5DD8 A;  1MBH A;  3QU6 A;  1EJ9 A;  3I71 A;  1N75 A;  4PFO A;  1VQ9 I;  4CYC B;  1LJ9 A;  2L7M P;  3HEF A;  3HOU J;  1RNL A;  3V4G A;  5FRN A;  3LAJ A;  4F3Q A;  3H9J A;  3HL2 A;  1FIP A;  4QSH A;  4DYQ A;  3TOA A;  1GV5 A;  2MC4 A;  4LJZ F;  2M9H A;  3GX4 X;  3A01 A;  2PMU A;  2PI0 A;  3VDX A;  4B44 A;  3FXU A;  4U0Y A;  3A02 A;  3AL0 B;  2EIM H;  1FY7 A;  3KP4 A;  1IZ1 A;  3RCO A;  4ANJ A;  3V8K A;  2ZXJ A;  1J59 A;  1JKO C;  1FBU A;  1BW6 A;  2QYO A;  2K7L A;  3H3V K;  2KIM A;  3GZ5 A;  2YR2 A;  2AXL A;  3D1N I;  2QZ8 A;  4E7Z A;  2JRT A;  4HNT A;  3L2W A;  2EFQ A;  1N77 A;  4M9Z A;  2BGC A;  4B48 A;  4UY8 I;  1O4X A;  2MLK A;  2R5Z B;  3JW4 A;  4G8X A;  5LEK A;  1ENH A;  2HZT A;  4XKB A;  3F22 A;  2CW0 F;  1H9T A;  1OQY A;  3M3Y J;  2CWE A;  4LK1 F;  2QVO A;  3PFY A;  2CG4 A;  2O7O A;  2K40 A;  2YU3 A;  2YX7 A;  5JR3 A;  3GTQ J;  1PDN C;  1TC3 C;  1TQI A;  1Z7L A;  4FE7 A;  4JX5 A;  4M73 A;  2HTS A;  4CIC A;  4ZTJ A;  2QF7 A;  2WY7 Q;  3CTA A;  4RDU A;  4A12 A;  1ZR4 A;  3I4M J;  2VE9 A;  3HOW J;  3Q9S A;  2E1M B;  3U1D A;  2L7F P;  1ZH5 A;  4PCQ A;  1Z6R A;  1U6G A;  1MH4 A;  2O5R A;  3FBI B;  2R7F A;  3TP3 A;  4C9Y A;  1OR7 C;  4BNC A;  3S1M J;  1IO2 A;  1LFU P;  3G1M A;  3HG9 A;  4ENN A;  3C7J A;  4ENK A;  1VFC A;  2NNY A;  1O57 A;  2MH9 A;  1ZKG A;  4N4N B;  4IHX A;  4B3A A;  2LK2 A;  2OUM A;  3HPH A;  4XLE A;  1SVO A;  2KP6 A;  2RKH A;  4K2E A;  5GPA A;  1FC3 A;  4G6T B;  3SDB A;  3JRE A;  3OR2 C;  2Y9Y A;  2R3S A;  3X2Q H;  2LTP A;  5B1A H;  2QGU A;  3CC2 I;  3H0G J;  3DKW A;  4B43 A;  3OYF A;  1Q1H A;  4LD5 A;  1IN5 A;  2K9M A;  5D4R A;  2X1D A;  2LP0 A;  2HPI A;  2IA1 A;  3CUQ C;  3ZMS A;  3CJN A;  5DUK A;  3F8F A;  2JA2 A;  4WXH A;  1D8J A;  2E19 A;  2EIJ H;  2NVY J;  3TQN A;  3WTT C;  4L5I A;  1GUU A;  3DBL B;  3PQJ A;  2EIL H;  2KDZ A;  1J5Y A;  2O03 A;  4HNU A;  1S7O A;  5DD4 A;  5J47 A;  2X1E A;  4RB0 A;  3V7R A;  1GHC A;  4CZC A;  2PN6 A;  2CUZ A;  2X6W A;  1BA5 A;  5E1W A;  1S29 A;  4QPO A;  2DAO A;  3L2C A;  2VN2 A;  3GFI A;  2I10 A;  3ZN0 A;  3AG4 H;  3H5R A;  1Y39 A;  3NAR A;  1QVU A;  2F5V A;  2H09 A;  2VLA A;  3ZXS A;  1N25 A;  2XF7 A;  5JI6 A;  1ETO A;  4U87 A;  3U9G A;  3FKJ A;  1JUS A;  2DA2 A;  1FOK A;  1RR7 A;  4LK0 F;  3JAM Z;  2GLO A;  1VQ8 I;  5J4V A;  2G9W A;  4KFC A;  5E8G A;  4XON A;  3ECO A;  2K86 A;  2F4O B;  3ZOB A;  1NG6 A;  2E2I J;  1ZLK A;  4ENJ A;  2XAJ A;  3MZY A;  4F92 B;  1Y56 A;  2HWV A;  2QQA A;  5HDG A;  3M8J A;  1FTZ A;  5B66 C;  3C3W A;  4J19 A;  3HOV J;  1S7E A;  5DCF A;  1ZAO A;  1H8A C;  2XRO A;  3W6J B;  1WCM J;  3QYF A;  1K61 A;  1OYW A;  4O6J A;  2IVM A;  3RI4 A;  5E3N A;  3O8G A;  5HLT A;  5FLX K;  4CDG A;  2Q2E A;  5J4Y A;  1YIT I;  4IVN A;  1CGP A;  4FE4 A;  5ERI A;  2NS7 A;  3LA7 A;  4BHB A;  2WY8 Q;  4KIB A;  2XKP A;  2DA3 A;  4B47 A;  3IAS 2;  5F1R A;  4BH9 A;  3ZQQ A;  3JR9 A;  1VQN I;  5FFX A;  4D0P A;  2MGQ A;  4PJL A;  5AON A;  4JX4 A;  2Q2E B;  3Q0V A;  1TTY A;  1BI0 A;  3J81 K;  3K7A J;  2EK5 A;  3S16 J;  3HGG A;  4R8H A;  4A3B J;  1Y8R B;  1UFM A;  3HOY J;  2L9N A;  3M1C A;  4O5V A;  1QGP A;  1TZL A;  2VQG A;  3KEY A;  1MSF C;  9ANT A;  3KZY A;  2V9P A;  1V54 H;  1X1B A;  1BIB A;  2GOX B;  1K78 A;  2A07 F;  6PAX A;  3AAF A;  1F5T A;  3W6V A;  3OR1 C;  4Y17 A;  1B72 A;  4XID A;  2LD5 A;  5M5Y J;  1DPU A;  1WJB A;  1V3F A;  4ESB A;  4WK8 F;  2RNG A;  2NNN A;  3PO3 J;  4BEH A;  3NAU A;  1A35 A;  5D5W B;  2I8D A;  1WSU A;  1YIJ I;  3BJO A;  2E71 A;  3A0H C;  4M3G A;  2DOD A;  1B9M A;  1OMI A;  4LLL A;  2WBM A;  3HKZ A;  1HST A;  3MWM A;  1KQ9 A;  5B3S H;  1MD0 A;  2Z3Y A;  4DIQ A;  3TDU C;  4AID A;  2L2O A;  3TOB A;  1OJL A;  2F5C A;  2IA2 A;  3RYP A;  3B73 A;  2TCT A;  2K85 A;  2NVX J;  3S2D J;  2QUF A;  4M71 A;  3OL3 A;  3LSH A;  5DUI A;  5E8I A;  2E1M C;  4NQW A;  2GA1 A;  3IC7 A;  4BAY A;  2QLZ A;  3UR3 C;  3K1P A;  3OYK A;  3GCM A;  4M3F A;  4IRH A;  2MSY A;  5DEQ A;  2G7H A;  3K9T A;  3DU5 A;  3OYB A;  3ZQL A;  1W7P A;  3CCM I;  1GXP A;  2KDO A;  3IH2 A;  2V26 A;  2LG4 A;  1IRG A;  1HC8 A;  4NQW B;  1KU3 A;  2DA5 A;  3DKX A;  2RV8 A;  2ADU A;  1R5I D;  2BEO A;  4Z2Y A;  3F23 A;  2E2H J;  3D5L A;  2MLG A;  1V5E A;  4YFK F;  4N0B A;  5HDN A;  3EUK L;  3OIO A;  1SVL A;  4S05 A;  3M1E A;  3L09 A;  3WU2 C;  2KIS A;  2WA0 A;  5HLI A;  1USS A;  2WAF A;  2FEZ A;  4OIR F;  2AS5 F;  3BP8 A;  1MND A;  1QZY A;  5J1R A;  1C0W A;  4FET A;  4N9H A;  1SAU A;  2VL8 A;  4D7M A;  4N4O B;  3CMY A;  4GRI A;  1JT0 A;  4I02 A;  2JVH A;  1POG A;  2BW3 A;  3QWL A;  4CHU A;  2DTZ A;  1D1C A;  2ZNZ A;  2M5W A;  3BT9 A;  1OLT A;  1X3U A;  4KT6 A;  4ASN A;  4CCK A;  4NC7 A;  4I09 A;  1B4A A;  1J09 A;  3MZH A;  3CDI A;  2HQN A;  2BW3 B;  4XRS A;  3EQL F;  5LRR A;  4I2O A;  2KRF A;  5IY5 H;  3QPT A;  1IW7 F;  3DEW A;  4L9J A;  1LDD A;  1WGX A;  3ISP A;  4RGX A;  4GDF A;  2HQR A;  1JI8 A;  4DOZ A;  2L01 A;  3S1Q J;  5M3F J;  2Y9Z A;  4Q47 A;  2H8R A;  1B6A A;  1HA8 A;  3REO A;  3MEX A;  1U5T B;  4A5M A;  5EZG A;  1AKH A;  4P9F A;  2HPM A;  5CQG A;  3L9F A;  2RC4 A;  3RPU A;  5LRS A;  4BDY A;  2HI3 A;  3CCQ I;  3E97 A;  1FWZ A;  2GIV A;  1TQM A;  3S2H J;  1HF0 A;  4IPA A;  1IXR C;  5LGN A;  4S04 A;  2R7W A;  2HKO A;  3MZ8 A;  4LG0 B;  2CO5 A;  4TV7 A;  4BBR J;  4D9J A;  5CVV A;  2NVQ J;  3E5X A;  5FKO A;  5C4X J;  1VI0 A;  2YSR A;  5FO5 A;  1Y1W J;  4DBR A;  2HR3 A;  2MD0 A;  4HLX A;  1AHD P;  1WI9 A;  4RBO A;  4LMY A;  3G4S I;  2Z16 A;  1VQ7 I;  4C30 A;  1EF4 A;  2L0K A;  1HW2 A;  1PP8 F;  1U9N A;  2WAE A;  3IHU A;  2LOO A;  1ON2 A;  4HSR A;  4HV6 A;  1QZE A;  3BJA A;  1ERD A;  1Z21 A;  4V2F A;  4G12 A;  3TGN A;  5C3E J;  1QPI A;  2N8G A;  4B1R A;  4IKF A;  3RZD J;  2IAI A;  2DOA A;  1BOA A;  3I4P A;  1IXS B;  4MIM A;  2M8G X;  3JRC A;  2VT3 A;  4BKX A;  4XN3 A;  3I4N J;  3ESW B;  3RKX A;  3KX2 A;  3HSE A;  2DMQ A;  2CU7 A;  1Z9C A;  2HDW A;  2E1N A;  2V79 A;  2XGC A;  3CCJ I;  1GXQ A;  2KLO A;  3G2B A;  2E7W A;  3GEZ A;  3LST A;  3IH3 A;  4L18 B;  2OD5 A;  1LQ1 A;  2XSJ C;  3HRS A;  4DGW B;  4RA2 A;  2M4G A;  2HQ5 A;  1MNE A;  1JGS A;  2YU9 J;  1ETQ A;  2B9S A;  3EET A;  2ZC2 A;  3E5Q A;  1MBK A;  3IAM 2;  2V1U A;  5M5X J;  1MIJ A;  5EG0 B;  3BLY A;  3KFW X;  4UNO A;  2MA3 A;  1BC8 C;  4BQO A;  1PUE E;  2ESN A;  3A0B C;  5IP9 J;  1ZGW A;  3FZV A;  5EEA A;  2R7Q A;  1WHU A;  4WX9 A;  1DQU A;  2O61 A;  4HV5 A;  1XCB A;  2K9Q A;  2EH3 A;  2W24 A;  3DTI A;  2TDX A;  1E3H A;  1LFP A;  4E4H A;  3KP7 A;  5L3G A;  4XRS G;  2R7U A;  4PDK A;  3SEQ A;  4HAM A;  3W2V A;  4G7H F;  2XPV A;  3EDP A;  2M1B A;  5FKN A;  1CQT A;  3O6B B;  4YII A;  3ZMZ A;  2O3F A;  4E7J A;  5CVU A;  3KCC A;  2EFN A;  2L9S A;  2OQG A;  1TW3 A;  4YFN F;  2X1C A;  3LA3 A;  1ON1 A;  3A03 A;  3RJP A;  5L3C A;  2K9N A;  3B02 A;  4M9S A;  3ECH A;  2KRC A;  1V5G A;  1YLF A;  2OCC H;  4P5O A;  3S1N J;  4Q4Z F;  2LNB A;  3GW2 A;  1TLH B;  2VKH A;  4HX7 A;  2EZH A;  2XSD C;  2CH0 A;  4HF2 A;  1QBJ A;  3K69 A;  3F3X A;  2DLL A;  4OAY A;  4ZZL A;  3HOZ J;  1S6L A;  3G73 A;  2M3A A;  1IDY A;  4WWC A;  5GAE J;  3SQN A;  3DQV C;  1U8B A;  5EZH A;  4E6K G;  1ZEL A;  2E2J J;  4JX6 A;  3RPU D;  5LFA A;  4HX4 A;  1W36 D;  2XAF A;  2HFH A;  2HXI A;  1MBG A;  1W5T A;  2R0Q C;  3R6S A;  3TKY A;  4HG2 A;  2EV6 A;  2DXI A;  4IJA A;  5DTD A;  4FCY A;  3CES A;  5M5W J;  2R7O A;  3CUQ A;  2LFB A;  3JRI A;  3BTC A;  2VKV A;  2I5U A;  5JVT A;  2RDP A;  1OYY A;  1TWF J;  4CO8 A;  5LLQ A;  1XPX A;  2D1H A;  3ERE D;  1J2X A;  5BOX A;  5F0F A;  2DPD A;  2BYV E;  2MH2 A;  3RTR A;  2QA4 I;  4L0Z B;  2VOO A;  3WGG A;  3H92 A;  4YEJ A;  4KA4 A;  1QHH D;  4XK4 A;  3VFZ A;  1FBQ A;  3DXJ F;  2B7E A;  3ZMD A;  4U0W A;  3BPV A;  2YUS A;  1L3L A;  1S72 I;  1UB9 A;  1PVE A;  1LDJ A;  5HLG A;  4QWQ A;  1RI7 A;  4PJM A;  4Y33 A;  1VQM I;  4HBL A;  2PBI A;  3I58 A;  5CKT A;  2E5Z A;  5EGO B;  1W36 C;  2EPF A;  4EM1 A;  3BQY A;  4IX7 A;  4ETS A;  2IS6 A;  2XB5 A;  4B8X A;  2IP2 A;  3NEU A;  1SD5 A;  4MFD A;  3BR0 A;  3MKW B;  4UB6 C;  1J7K A;  4NUB A;  1PJR A;  1CF7 B;  4EAT A;  2IGO A;  3OY9 A;  4OAZ A;  4IHT A;  3H9Q A;  2HOA A;  3IKV A;  4MO7 A;  1YQA A;  1T56 A;  3BTI A;  5K7F A;  4HST A;  1YJW I;  1X4P A;  2JZY A;  3E6D A;  1Z1D A;  2P6T A;  3PUF A;  3ZQC A;  1G4D A;  3CJT B;  4P9U A;  2XC7 A;  1MJ9 A;  3RQ4 A;  2LDU A;  4CCJ A;  1T39 A;  1APL C;  1ORK A;  3FIS A;  3FXM A;  2MAB A;  4JBA A;  2ECB A;  5CVI A;  2KQR A;  2RNJ A;  4ZDL A;  2HEO A;  3HHG A;  3HKZ N;  5BMZ A;  2NXN B;  4OWR B;  4E7H A;  4LG3 A;  2EBI A;  4HQE A;  3IRR A;  2VBW A;  1ZGA A;  4UXN A;  2XVC A;  3HRU A;  2ZSH B;  5E3O A;  1K83 J;  3O8H A;  3OS2 A;  1XDS A;  2XGX A;  4B09 A;  2R7Z J;  3HOS A;  3WTV C;  2AQF A;  4Z6Y A;  3HC7 A;  4CA0 A;  3JRB A;  1VF9 A;  3SZG A;  1B9N A;  2P0W A;  3CLQ A;  1O3T A;  3JCU C;  4BE1 A;  4EEF G;  3WOD F;  4MFE A;  3DTK A;  3J80 Z;  1FOW A;  3KYD B;  2JA8 J;  4NB5 A;  3OIQ A;  1B1B A;  2DOE A;  1X1C A;  2UXN A;  3K1M A;  1FOX A;  4IOC F;  2J5P A;  2FX0 A;  2OF7 A;  2R7D A;  3DEE A;  3MD2 A;  1VQP I;  3VSK A;  2YPR A;  2LF8 A;  3LQR A;  1F4K A;  3I9V 2;  4M6X A;  3T8T A;  3FMS A;  4XLP F;  1A5J A;  1ZYR F;  2JVG A;  3AFH A;  2MW8 A;  2R5Z A;  5ILV A;  2R92 J;  4EM2 A;  1TNS A;  2E36 A;  1I1S A;  4C3H J;  1HDD C;  3QU3 A;  4AIH A;  2XV4 S;  2OAZ A;  1XG1 A;  4XR6 A;  3OIP A;  1E2X A;  2KL4 A;  2A5Y B;  4W97 A;  4JP0 A;  1I39 A;  2PG4 A;  3WE3 A;  5J6X A;  2CV2 A;  1YW9 A;  1YIO A;  4JYK A;  2V7F A;  2XF5 A;  1UEL B;  4HYE A;  3K4K A;  3OYL A;  1NK2 P;  2VXZ A;  1DP3 A;  1JUM A;  3VYR B;  1UCR A;  1Z05 A;  4HNV A;  1XGO A;  1E3O C;  2HS5 A;  3AG2 H;  4I99 C;  5LBQ A;  4MTE A;  2DMU A;  1O3S A;  4U88 A;  1ETW A;  3HUG A;  3ZQI A;  3DEU A;  3HM5 A;  4ZDP A;  3Q9V A;  2LR8 A;  2JK3 A;  2CW7 A;  3VOE A;  4XLH A;  4IQ4 A;  3GFM A;  3KE2 A;  4XLF A;  1A31 A;  3BTJ A;  2H1K A;  4I98 B;  2ID6 A;  1I50 J;  4U7B A;  1IF1 A;  1IJW C;  1JTY A;  2O8X A;  5FLM J;  3HUG B;  4I01 A;  4HDV A;  2XIG A;  1TWC J;  3PUB A;  3RIR A;  4BE0 A;  3HPG A;  1Y6I A;  3HSF A;  4GCV A;  3F21 A;  4DYC A;  1NH3 A;  1KYW A;  2CV1 A;  3OL4 A;  5IT3 A;  2PJP A;  1T95 A;  1X1A A;  5A2Q Z;  4O3M A;  1REP C;  1JKQ C;  1HKQ A;  3L2U A;  5D8L B;  2DDB A;  4EJO A;  5IYD J;  4C2U A;  5KHD A;  1YRN A;  1G3W A;  3Q0U A;  1FZP B;  3QP5 A;  4M72 A;  4OIP F;  3ROU A;  2JMW A;  2XRN A;  2X0L A;  4I0B A;  1MBJ A;  4RGS A;  1IV6 A;  2X4H A;  2DMN A;  3CDH A;  3I54 A;  1YRN B;  2Y2Z A;  5E3L A;  3KEQ A;  2PMZ A;  3JRH A;  2A3S A;  4LIT A;  3TO7 A;  2D45 A;  1KQ8 A;  3F6O A;  4KN7 X;  3IWF A;  2YX4 A;  4XOT A;  4JK1 X;  3BR3 A;  3TDZ C;  3DF8 A;  2BY2 A;  2FSW A;  1WH7 A;  2VAS A;  3BG5 A;  1Y0U A;  2ICW G;  2Y31 A;  5K5R A;  1QQI A;  3ZMU A;  1MNM C;  2ZFW A;  4HDU A;  1ZRC A;  3AG1 H;  2Z5U A;  1MJB A;  3N4M A;  2CQ7 A;  1VQ6 I;  4M9X A;  2E60 A;  1RKT A;  3WTW C;  3JSO A;  2EZK A;  4N9I A;  4RLQ A;  4DZJ A;  4HX8 A;  5EYR A;  3GXO A;  1RPW A;  3P7N A;  3SYT A;  1ZAR A;  4LFU A;  5DM7 F;  2PJR A;  4CCO A;  4EJV A;  3HB9 A;  4A3K J;  4FAS D;  1Z91 A;  4C2M J;  5IT9 Z;  1PYV A;  2UXX A;  1UHM A;  2GOM A;  1SFE A;  3PM1 A;  1Y0N A;  4RGR A;  3DCF A;  2PJR B;  2DK8 A;  2FXA A;  1U2W A;  1S5L C;  3TBI A;  2GZW A;  3BR1 A;  3ZRG A;  2O8K A;  4FHT A;  2L7K A;  1ZG1 A;  1BI3 A;  3DBR B;  2Y69 H;  4PJ0 C;  1IAW A;  2JPB A;  3LSK A;  4UHT A;  4MLO A;  3ZP5 A;  2HVS A;  3C1D A;  2JSP A;  2A05 A;  3TW7 A;  4BHC A;  2PFB A;  4OU0 A;  2IS4 A;  4LOC A;  4UUS B;  3GVA A;  4AYB A;  3P9I A;  3FXK A;  2Q0O A;  3I0T A;  5DYM A;  3L2Q A;  1WJF A;  2IGN A;  3MVP A;  4EQQ A;  5DM6 F;  3WGI A;  2GAU A;  2RN7 A;  4XL9 A;  1ZRD A;  4ZYA A;  3OS1 A;  3FHN A;  5J8C A;  2OJE D;  3HRM A;  2ACJ A;  4CSW A;  4IRI A;  2ZNY A;  1FEX A;  3QRF F;  3H35 A;  4A3F J;  3KLO A;  2IGK A;  3Q0W A;  2ELK A;  5TGT A;  2BY3 A;  2EV0 A;  2VBZ A;  2XRL A;  4C3I J;  5GTI C;  5E18 F;  1P7I A;  2Z33 A;  1U78 A;  3KP3 A;  1WJE A;  3RKQ A;  1F9N A;  3K4N A;  3H5A A;  1AA7 A;  2K9S A;  2FNP A;  3H36 A;  4ZH4 F;  3KP6 A;  3C2H A;  1FLI A;  2WC2 A;  4PFP A;  4LB6 B;  2OTL I;  2W4S A;  1WJC A;  4BAC A;  1I1G A;  3AL0 C;  5HDK A;  3SFZ A;  1YI2 I;  2Y0S A;  2JQ7 A;  3DPT A;  2JA7 J;  1BJA A;  2W82 A;  2BE5 F;  3H1C A;  3ERM A;  3TO6 A;  2IPQ X;  5DDG A;  1B8I B;  4Y3O A;  3C2G A;  4Y7N J;  3WGH A;  1VQ5 I;  1OCT C;  2FA5 A;  3JTG A;  2FBI A;  2E34 A;  3ULQ B;  5GTH C;  2E35 A;  2R7S A;  3LL7 A;  1J0R A;  2KZG A;  1P6R A;  2W85 A;  3VB2 A;  4GFB A;  4BDZ A;  2BOL A;  5BPI A;  2G7U A;  2W1O A;  3BCA A;  1TT0 A;  1QO0 D;  3CCL I;  3Q3S A;  2L7Z A;  2HDC A;  4NHJ A;  4ZYE A;  3PQK A;  3QPS A;  1Y8Q B;  1DGW Y;  2OBP A;  4ESF A;  2CQQ A;  1P92 A;  1HXD A;  1SVM A;  1I3A A;  4XRM A;  1KZH A;  1ZRF A;  2DFF A;  3S1R J;  2D5V A;  1ZRE A;  2LKS A;  2X6O A;  2P4W A;  3OSG A;  1UAA A;  1H9G A;  5KAF C;  1LE8 B;  2JWT A;  1JE8 A;  4H4K C;  1ZR2 A;  4BQQ A;  1PUF B;  1X19 A;  1I6X A;  2P81 A;  2DOF A;  3VWB A;  4KMF A;  1SFU A;  2E7X A;  2M0M A;  2FD5 A;  4G6Q A;  3EPZ A;  1AWC A;  5HVQ C;  3AG3 H;  1G3T A;  2OCE A;  3MN2 A;  2HU9 A;  1EH8 A;  3HHH A;  3QP6 A;  1XGM A;  3PIO F;  5L3F A;  3E1S A;  3DKY A;  2EWN A;  2NVU B;  3RDI A;  4CCN A;  4YRV A;  2Y30 A;  1D1A A;  1U0J A;  1X2N A;  2PEX A;  3GUD A;  3KYL A;  2GXG A;  5IPA A;  3GFL A;  2V9V A;  2DA6 A;  3GBG A;  3KZI C;  2MD5 A;  3DWL E;  5FRO A;  1IG7 A;  2PX9 A;  3I64 A;  5TJJ A;  1D0Z A;  1RUO A;  1YW7 A;  2QSG X;  1R5G A;  2XGE A;  2F5D A;  4MQV A;  1Z6T A;  3IUO A;  1IUY A;  2F6C A;  2CMP A;  2DT7 B;  3IWZ A;  3ZCO A;  2L4A A;  2DQL A;  4YG2 F;  1TBX A;  1IUF A;  1A04 A;  1XGS A;  1MMG A;  1JKR C;  1S3J A;  5GP9 A;  3CQZ J;  5E1X A;  1A36 A;  3JRD A;  4I7H A;  2ZJQ F;  4FTH A;  3FMR A;  5ICF A;  2GXA A;  2XAG A;  2EZI A;  5FFZ A;  2DA7 A;  2O0Y A;  1TP4 A;  3I3L A;  3VEP A;  1JTX A;  2A5W A;  2AHQ A;  3FXQ A;  4HQM A;  1XD7 A;  1QA6 A;  2C6Y A;  4QPQ A;  1U5T A;  1YJ9 I;  2ZJP F;  1U3E M;  1KQ0 A;  1T2K A;  1JHH A;  1FT9 A;  3HZJ A;  2H6C A;  5H6R A;  3KZZ A;  3LWF A;  2HYJ A;  2P6S A;  1QU3 A;  1MW7 A;  2KPM A;  2P5K A;  3KPH A;  1OCZ H;  2IGM A;  4XSZ F;  1MJA A;  5ICG A;  3ZQ7 A;  2V6E A;  2AO9 A;  2DA4 A;  5CQE A;  3BC8 A;  2LSO A;  1TNT A;  4V19 K;  5KVR A;  2HYG D;  1J9I A;  2M4K A;  4CCL A;  2L54 A;  4F91 B;  2L9V A;  1GVD A;  3E3V A;  3LNQ A;  1RC9 A;  5EEG A;  3LQQ A;  2HVR A;  3NRV A;  1T08 B;  1LVK A;  3CZ6 A;  2QQ8 A;  4LG0 A;  1R00 A;  1I5Z A;  4HZF A;  2VQL A;  2LY9 A;  1EKE A;  1QVT A;  3GTM J;  5D8K B;  1TWA J;  4D7N A;  1FYM A;  2YS9 A;  3QYE A;  2PMH A;  1FYK A;  3J7A O;  4Q48 A;  2XF6 A;  4BU2 A;  3K70 D;  2HVQ A;  2LBF A;  4G9Y A;  4KIT B;  4A6D A;  4MEY F;  3TED A;  3K4C A;  4A93 J;  1EH6 A;  1SMY F;  2LRE A;  5K5O A;  3KP2 A;  1MDM B;  3OYE A;  1XN7 A;  4UB8 C;  2K3P A;  2LBF B;  4Q5S F;  3PSI A;  5JHF A;  3HOX J;  2HDD A;  4RB1 A;  4HF0 A;  3QOE A;  5F0C A;  2VJ5 A;  2UWM A;  4L9T A;  1OCO H;  3ZQG A;  3G1O A;  3BZK A;  2KZV A;  1ZG3 A;  3QYB A;  5FLX Z;  2JJ7 A;  4XIC A;  4RM2 A;  2Y75 A;  2F5E A;  2W84 A;  4BXF A;  1LNW A;  1UMQ A;  3ZQH A;  3WTS C;  5BPD A;  3ABK H;  3I59 B;  3WG7 H;  1WWX A;  1D5Y A;  2XPW A;  3DLA A;  4A3D J;  3CMM A;  3K2A A;  2STW A;  2A68 F;  2GQQ A;  1FP2 A;  3BR6 A;  3BTL A;  1BI1 A;  1O7L A;  4ZC3 A;  3J81 Z;  1HSJ A;  1YE9 A;  3K70 C;  2QKM B;  4M3E A;  1R6R A;  2KIU A;  2Z99 A;  3MMY B;  2K5C A;  5BS6 A;  5FRM A;  2ID3 A;  1RZ4 A;  2J5O A;  4LIV A;  5GAD J;  2KFD A;  4Y15 A;  4KN4 X;  3V8L A;  2BXZ A;  1SD6 A;  4AM3 A;  3LSG A;  3GZ6 A;  5EG0 A;  4UUT A;  4GYG A;  1ETV A;  5HS7 A;  1R7J A;  2XHK A;  3CCY A;  2ZJR F;  1LPQ A;  2L5Q A;  3W3C A;  3BOQ A;  1G3S A;  2FU4 A;  1R4N B;  1MBE A;  5F0H A;  3CCS I;  3WTZ A;  3K4J A;  4QLC U;  3CCE I;  3M8E A;  4CXF A;  4HEA 2;  4BJT A;  3OV8 A;  4KIC A;  2JA6 J;  4XN0 A;  1STZ A;  5K7H A;  4PJN A;  2DJN A;  2V1N A;  1WJD A;  3OOP A;  3J80 K;  2Q8K A;  3KEO A;  1FOY A;  5L3E A;  5ED4 A;  2EA4 A;  2KIQ A;  3S8P A;  4IO9 F;  3CMA I;  5AIQ A;  1WFX A;  3OS0 A;  2LVS A;  3LSJ A;  4J00 A;  3OYA A;  4X6A J;  4WF2 A;  2DTR A;  2PLY A;  2RGV A;  4MTD A;  1GT0 C;  3BWG A;  3KIO A;  1QZZ A;  1W5C C;  3DPL C;  2CS3 A;  1VQK I;  2IBD A;  1IRX A;  1UJ8 A;  4HPQ A;  3GTO J;  4LLG F;  2DPU A;  1AOY A;  2KMU A;  4FX4 A;  3SFI A;  3HTS B;  1XSD A;  2L4M A;  1IRF A;  2V6C A;  4EM0 B;  4E70 A;  4PSX A;  3I56 I;  3K4B A;  4A0Y A;  2DFH A;  1P9Q C;  2IRF G;  3HSR A;  3BG9 A;  5H6Q A;  1SAN A;  2LH9 A;  1RR8 C;  5K7Z A;  2CW8 A;  3BG3 A;  5JHU A;  4PJJ A;  2IS2 A;  3GTJ J;  3RPQ A;  1P2F A;  3QPH A;  1DUX C;  2NYX A;  3P9K A;  1GDT A;  2P8T A;  1F43 A;  3HTU A;  1JJ6 C;  4AWX B;  1QNT A;  2BBY A;  1T98 A;  4LB5 A;  4XQF A;  1IRZ A;  3D5R C;  3CC7 I;  4GXO A;  5JLW A;  2EZL A;  2VC1 A;  5KNL A;  3KP5 A;  4II2 A;  2OV7 A;  3ONQ A;  3EUH A;  5F27 A;  1JUP A;  2ZJ2 A;  3E0J B;  4ZTF A;  4RAZ A;  1MZB A;  2LRD A;  3V7S A;  1W5S A;  2IA0 A;  3F0C A;  4PUS A;  5LGT A;  1IXC A;  1XDU A;  1R49 A;  1X58 A;  4XOR A;  3CDL A;  3LAP A;  2VIX A;  4P1W A;  2LY2 A;  4OIQ F;  3SZP A;  5K5Q A;  5GAH J;  1SC7 A;  4IEJ A;  1JXS A;  3LOC A;  3JRG A;  4OIN F;  3VYU B;  1DPR A;  4H0E A;  4BHP A;  5K1Y A;  3HBL A;  1H0M A;  2ESH A;  1RES A;  3QAH A;  3ZPL A;  5JFR A;  3DPU A;  1YFH A;  3K1N A;  4OIO F;  3F8M A;  1U5T C;  4BBS J;  1XSV A;  3NWS A;  3J7Z I;  3M4O J;  5DCM A;  2IEK A;  4IL6 C;  3GO5 A;  4KUM A;  4ON0 A;  1DU0 A;  2NRA C;  2R5Y B;  4DYR A;  5EGO A;  4KMU X;  5HS9 A;  3SHF A;  4PGH A;  2BVM A;  2IJL A;  4KDP A;  4A3E J;  4WXD A;  4JOM A;  3CME I;  5DCM B;  1NHA A;  2X48 A;  1T8I A;  4IHS A;  1WQ2 A;  5C4J J;  2JN6 A;  2OQR A;  2E1C A;  2FF4 A;  4BGD A;  1CF7 A;  4MGR A;  2F4I A;  3PL8 A;  1U8R A;  1P7J A;  3BY6 A;  5IYB J;  4DBQ A;  5TIS C;  2ZME B;  2HGC A;  2LF7 A;  2X9D A;  5FKL A;  4XKC A;  1DGR M;  4EJU A;  2KJB A;  3BR5 A;  1S8N A;  4BXU A;  2EIN H;  2Y0S N;  1G6N A;  3FHZ A;  3L2V A;  3TW6 A;  5ILU A;  2AXT C;  1X3W B;  1BR1 A;  4MHG A;  4IOA F;  1IN8 A;  5HOD A;  3HDD A;  4A0X A;  4BL0 B;  3GME A;  3A2K A;  2VT2 A;  3OYI A;  3PNV A;  2CGP A;  2CSO A;  5IT9 K;  1ONV A;  3DTE A;  2HKX A;  2O6G E;  4BXX J;  2QCO A;  1RET A;  5J1Y A;  1KU7 A;  4MEX F;  2L02 A;  2WV0 A;  2HNH A;  1D3Y A;  3L2R A;  3JAM K;  3AKZ A;  1MBF A;  4UUV A;  3SXY A;  3OMY A;  2VOP A;  2VQC A;  4A3M J;  2EIK H;  2LLK A;  3WU0 A;  2DN0 A;  1TWG J;  3JTH A;  4YIF A;  3PSF A;  3FX3 A;  1SFK A;  4IHV A;  5GPC A;  3TO9 A;  1K7A A;  4KJZ A;  3B6A A;  1JJ8 C;  3K10 A;  3RKY A;  5L3B A;  1YG2 A;  3CO6 C;  2K9L A;  1X1D A;  5FGM A;  1R71 A;  1TL8 A;  2EJR A;  3CJQ B;  2UUZ A;  1BJZ A;  3UNG C;  2LMD A;  4B4C A;  4QIW N;  3B6C A;  1FNN A;  5L3D A;  4A2U A;  4HLY A;  4R79 A;  1VQ4 I;  2KT0 A;  2WTE A;  3HJE A;  2DT6 A;  2F2E A;  2W7N A;  1XX5 A;  2ME0 A;  3F6V A;  1SD7 A;  5CVJ A;  3WHC A;  1MKM A;  1LUJ B;  2R7R A;  3RYR A;  3LFK A;  4B3X A;  2UZK A;  2FUG 2;  3WHB A;  3ABL H;  2M7B A;  4XMY A;  1P4W A;  4XRF A;  2DW4 A;  1GLN A;  1ZN2 A;  4BY7 J;  3D5S C;  3DU6 A;  4RLF A;  4U0V A;  5LEJ A;  4Y52 J;  1MGT A;  2RRE A;  2K27 A;  3QQA A;  1OCC H;  5F1J A;  2A6E F;  4HRI A;  3BCB A;  2X6Y A;  5F6F A;  3SEZ A;  1OPC A;  3A01 B;  4AIK A;  3BG7 A;  4U7D A;  1X2M A;  3WTX C;  4CYD A;  1EV7 A;  5B5E C;  1VTN C;  1UZC A;  4IRG A;  1FX7 A;  1HKS A;  2ME6 A;  1K79 A;  1I27 A;  4AU7 A;  2LYC A;  2DK5 A;  2Y0M A;  1BR4 A;  2ELJ A;  3E6B A;  3LSP A;  3F8C A;  4BY1 J;  2DJI A;  2Y48 A;  2LKX A;  4PGG A; 
#chains in the Genus database with same CATH homology
 2JA7 J;  1HOM A;  4BBR J;  5FJ8 J;  2NVQ J;  1B8I B;  5FKO A;  5C4X J;  1VI0 A;  1VND A;  4Y7N J;  2WAQ N;  1Y1W J;  1OCT C;  1QRY A;  1AHD P;  1WH5 A;  4RBO A;  1OCP A;  4GFB A;  1MSE C;  1BL0 A;  1EF4 A;  2L0K A;  3Q3S A;  2L7Z A;  1U9N A;  3QPS A;  2GBY A;  4A3G J;  1FIA A;  2CQQ A;  4V2F A;  4G12 A;  2W48 A;  4XRM A;  5C3E J;  1DU6 A;  1A6I A;  2N8G A;  2WV1 A;  4B1R A;  1QPI A;  3RZD J;  3S1R J;  2D5V A;  2FQ4 A;  1W0U A;  2IAI A;  2VPR A;  1R9T J;  2X6O A;  1GV2 A;  2JA5 J;  4IHW A;  3OSG A;  4MIM A;  1Q1V A;  1LE8 B;  1F36 A;  2JWT A;  2M8G X;  4BKX A;  3JRC A;  3UKG A;  2GM4 A;  1WPK A;  1TWH J;  3ZQF A;  1ZR2 A;  4FIS A;  3I4N J;  1PUF B;  1ZQ3 P;  2DMQ A;  2CU7 A;  2P81 A;  4QTR A;  1XS9 A;  2CUF A;  1Y1V J;  2FD5 A;  2XGC A;  3IH3 A;  4S0H B;  3MN2 A;  1SFO J;  3IH4 A;  4I6Z A;  2HQ5 A;  2Y30 A;  1X2N A;  2YU9 J;  1ETQ A;  2M34 A;  5IPA A;  4NDL A;  4L5E A;  1ITY A;  2HXO A;  1MBK A;  1I3Q J;  5M5X J;  2NVT J;  2VKE A;  2DA6 A;  3GBG A;  1IG7 A;  5EG0 B;  3S14 J;  1Z0X A;  1IC8 A;  2XGE A;  5IP9 J;  1ZGW A;  3BR2 A;  5EEA A;  3IV5 A;  1H89 C;  5F08 A;  2K9Q A;  2EH3 A;  1IUF A;  1ZTR A;  2B63 J;  4CYC A;  3GTL J;  4W1U A;  4XRS G;  1JKR C;  3E7L A;  4UUS A;  2XPV A;  2G0E A;  4IHY A;  5FKN A;  5GP9 A;  1CQT A;  1MBH A;  3CQZ J;  5IP6 A;  3JRD A;  4A3J J;  4FTH A;  4CYC B;  2L7M P;  3HEF A;  3HOU J;  2VUM J;  2EZI A;  2DA7 A;  5C44 J;  1FIP A;  4QSH A;  3A03 A;  4DYQ A;  1JTX A;  2AHQ A;  1GV5 A;  1HDP A;  2K9N A;  1JT6 A;  2M9H A;  3OSF A;  3S1N J;  3A01 A;  1ZK8 A;  4A3C J;  2HYJ A;  3GTK J;  1AU7 A;  2AO9 A;  2DA4 A;  3A02 A;  5M3M J;  1W0T A;  2EZH A;  2ZB9 A;  2XSD C;  1GVD A;  3FIW A;  3LNQ A;  3HOZ J;  1JKO C;  1BW6 A;  1IDY A;  2LY9 A;  1QVT A;  3H3V K;  3FK6 A;  3GTM J;  1U8B A;  5EZH A;  1B8I A;  2E2J J;  3D1N I;  4JX6 A;  1TWA J;  4D7N A;  2YS9 A;  2HXI A;  1MBG A;  1O4X A;  2R0Q C;  2R5Z B;  3TED A;  2CQX A;  4A93 J;  1ENH A;  5DTD A;  3M3Y J;  1G2H A;  4FCY A;  1OFC X;  2O7O A;  5EDN A;  5M5W J;  3VPR A;  2K40 A;  3S17 J;  2LFB A;  3GTQ J;  3JRI A;  1TC3 C;  3BTC A;  5DS9 A;  2VKV A;  1TWF J;  3S15 J;  4FE7 A;  3HOX J;  4JX5 A;  2HDD A;  5F0F A;  2QF7 A;  4RDU A;  3SDG A;  1ZR4 A;  3I4M J;  5F0C A;  3HOW J;  1LE8 A;  5IYC J;  4XK4 A;  3ZQG A;  3G1O A;  2DMT A;  2FJ1 A;  4DZP A;  1NTC A;  2L7F P;  1PUF A;  2JJ7 A;  2EQR A;  4XIC A;  1MH4 A;  2YUS A;  3TP3 A;  1UMQ A;  3ZQH A;  3S1M J;  1D5Y A;  1LFU P;  3G1M A;  4D5C A;  2XPW A;  4A3D J;  1JGG A;  3K2A A;  1VFC A;  2L9R A;  3MKL A;  1ZKG A;  3BR6 A;  3BTL A;  1B72 B;  4IHX A;  4B3A A;  5EGO B;  2MG4 A;  2LK2 A;  3BQY A;  4M3E A;  5GPA A;  2XB5 A;  4A3L J;  4MFD A;  2HOS A;  3BR0 A;  3JRE A;  2ID3 A;  1WI3 A;  2Y9Y A;  3LSG A;  5EG0 A;  4UUT A;  5EF6 A;  1ETV A;  2TRT A;  2LTP A;  3CCY A;  3H0G J;  1ETK A;  2HOA A;  4MO7 A;  1MBE A;  5F0H A;  4C3J J;  1T56 A;  2LP0 A;  3BTI A;  4V2G A;  5K7F A;  2NOG A;  3ZQC A;  2JA6 J;  2E19 A;  5K7H A;  1APL C;  2DJN A;  1ORK A;  2NVY J;  3FIS A;  1GUU A;  2ECB A;  2KDZ A;  2E1O A;  3HKZ N;  3LSJ A;  2LVS A;  4M3B A;  4X6A J;  2EBI A;  2M2E A;  1BA5 A;  1GT0 C;  5E3O A;  1K83 J;  3O8H A;  2R93 J;  2DA1 A;  2IBD A;  3GTO J;  2NS8 A;  2I10 A;  2R7Z J;  4DW6 A;  3NAR A;  3JRB A;  2XPU A;  1VF9 A;  1QVU A;  3SFI A;  3GTP J;  1ETO A;  4EEF G;  4MFE A;  1MH3 A;  3QPL A;  4AUX A;  5F04 A;  1JUS A;  2JA8 J;  2DA2 A;  3BG9 A;  1RR7 A;  3RQI A;  5IOZ A;  1SAN A;  3RZO J;  5K7Z A;  2GLO A;  2FX0 A;  2OF7 A;  1IDZ A;  5FKK A;  3BG3 A;  3GTJ J;  1I6H J;  1GDT A;  1A5J A;  1F43 A;  1IGN A;  1JJ6 C;  3ZOB A;  1BW5 A;  2E2I J;  1IRZ A;  2MW8 A;  5J3L A;  2R5Z A;  5JLW A;  2EZL A;  2R92 J;  3LSR A;  1FTZ A;  1XC5 A;  5F27 A;  4C3H J;  1JUP A;  4J19 A;  1S7E A;  3BQZ A;  1HDD C;  2HOT A;  3HOV J;  1XG1 A;  1H8A C;  1WCM J;  1K61 A;  3F0C A;  4W97 A;  5E3N A;  3O8G A;  4JP0 A;  1X58 A;  3L1P A;  3CDL A;  4FE4 A;  1NK2 P;  2NS7 A;  4JYK A;  3JRF A;  2DA3 A;  1JUM A;  4IEJ A;  3LOC A;  3JRG A;  3JR9 A;  4HNV A;  2MGQ A;  1E3O C;  2O9L A;  3GTG J;  3HBL A;  1RES A;  4JX4 A;  3Q0V A;  3S16 J;  3K7A J;  1AKH B;  2DMU A;  5IP7 J;  1ETW A;  3HGG A;  1H88 C;  4A3B J;  4BBS J;  3TP0 A;  3FK7 A;  3ZQI A;  3HOY J;  3HM5 A;  3M4O J;  2LR8 A;  1MSF C;  2IEK A;  2JK3 A;  4D5F A;  9ANT A;  1DU0 A;  5BNG A;  3BTJ A;  2H1K A;  3W6V A;  1U9O A;  2R5Y B;  2ID6 A;  1I50 J;  1B72 A;  4DYR A;  4XID A;  5FKM A;  5EGO A;  5M5Y J;  2LD5 A;  1JTY A;  1IJW C;  5FLM J;  1TWC J;  4A3E J;  4AC0 A;  4DYC A;  2X48 A;  3PO3 J;  3PO2 J;  5C4J J;  2JN6 A;  3NAU A;  1T33 A;  4A3I J;  1NK3 P;  4M3G A;  1JKQ C;  3G1L A;  1P7J A;  5IYB J;  5JLX A;  5IYD J;  2RAE A;  4ABZ A;  2X9D A;  5FKL A;  1YRN A;  3BR5 A;  3Q0U A;  1JKP C;  1HCR A;  2Y0S N;  2JMW A;  3TW6 A;  1OJL A;  1MBJ A;  1IV6 A;  2DMN A;  2TCT A;  2NVX J;  2XB0 X;  3S2D J;  5HOD A;  3HDD A;  2COB A;  1YRN B;  2Y2Z A;  4M6V A;  5E3L A;  3JRH A;  2XGD A;  2M0C A;  2CRG A;  2DMP A;  3BR3 A;  4BXX J;  2QCO A;  1RET A;  5J1Y A;  4M3F A;  1WH7 A;  2MSY A;  1LFB A;  3BG5 A;  2Y31 A;  3ZQL A;  1MNM C;  3IH2 A;  1FJL A;  1MBF A;  1UHS A;  4A69 C;  4A3M J;  2DA5 A;  2LLK A;  1RKT A;  1UG2 A;  2E2H J;  2DN0 A;  2EZK A;  1TWG J;  3FKI J;  4DZJ A;  1RKW A;  4IHV A;  5EYR A;  3JRA A;  1RPW A;  5FLV A;  5GPC A;  3OIO A;  3HB9 A;  4A3K J;  2PMZ N;  3B6A A;  4C2M J;  4M3D A;  3HGY A;  3PM1 A;  1JJ8 C;  2WB1 N;  3DCF A;  1ETY A;  2OPT A;  5J1R A;  1JT0 A;  1BJZ A;  4D7M A;  3CMY A;  3BR1 A;  2ECC A;  4B4C A;  4QIW N;  3B6C A;  2O8K A;  1POG A;  1ETX A;  2DTZ A;  4MLO A;  1FTT A;  2KT0 A;  3BT9 A;  3TW7 A;  2ME0 A;  3WHC A;  4LOC A;  4UUS B;  4XRS A;  1Z77 A;  3MVP A;  1HLV A;  3WHB A;  3DEW A;  4X1E A;  5E3M A;  1WGX A;  3S1Q J;  4BY7 J;  5M3F J;  4Y52 J;  2Y9Z A;  5J1U A;  5IOY A;  2H8R A;  4I76 A;  3QQA A;  1FEX A;  2CUE A;  5F1J A;  4A3F J;  3C2B A;  5EZG A;  1AKH A;  2VI6 A;  3Q0W A;  3OOU A;  3A01 B;  2ELK A;  2XRL A;  1X2M A;  4C3I J;  1P7I A;  1U78 A;  3RKQ A;  2ME6 A;  3SJM A;  2HI3 A;  2CJJ A;  4AYB N;  2K9S A;  2R5Y A;  3S2H J;  1HF0 A;  3LSP A;  4BY1 J;  2LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...