2K4JA

Arsr dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
GSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRGIGYKLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative TRANSCRIPTIONAL REGULATOR
publication title ArsR DNA Binding Domain
rcsb
source organism Helicobacter pylori
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4jA00
4AVPA 4P9UA 3E5QA 2DPUA 3E6DA 2QWWA 2XRNA 2P7CB 1TNTA 5L3FA 5TJJA 1K79A 3KLNA 2MLKA 3GLXA 5FLXK 3RKXA 1W5TA 2M1BA 2F5DA 4CXFA 3LSTA 2VN2A 1ZG1A 1BIAA 3RKWA 1XGMA 2HEOA 4WXDA 1KQ9A 4YFKF 3K1PA 3V8JA 3WTWC 1GXPA 2L54A 3O3KA 5DUKA 1FP1D 2ISZA 3V8KA 4RGXA 2HZTA 4IVNA 5L3GA 2WV0A 1DP7P 2LF8A 3RTRA 2Z33A 4AIJA 2ISYA 3ISPA 3G3ZA 1O3RA 5LHGA 1MKMA 5DDGA 2V79A 3F6VA 3QU3A 1IN7A 2XGXA 2L01A 4HZFA 2DPDA 3HTUA 2YSRA 3PQJA 3V7SA 1Z91A 3TO7A 4WWCA 3SHFA 1Z6RA 2DFIA 4P96A 3JSPA 1Z9CA 3RDIA 1U8RA 3T0YA 2R3SA 2RGVA 5DD8A 2OQGA 2VBWA 1B1BA 2NYXA 4L9JA 3KP2A 2XAQA 2M8EA 1G4DA 2A6HF 1ZRCA 1W7PA 1O57A 2ZNZA 2OAZA 2EK5A 1J5YA 1Z1DA 4H0EA 1KGSA 4KYWA 3J80Z 1CF7B 3B02A 1HBXG 2HDCA 5EEGA 2XVCA 1WKMA 3HIFA 4XSXF 2PFBA 1R58A 3HSFA 1HSJA 4JK1X 1SFUA 2KJBA 1SD5A 5FD6A 3ZPLA 2EV6A 4RGSA 4I98B 2F5CA 3FMQA 4EM2A 1ZGJA 1YLFA 1KU9A 3J81K 3E5XA 1TNSA 2Q8KA 1XMAA 4FX0A 3K9TA 1FP2A 3SZTA 1BBYA 4I02A 2GIVA 2V1DA 1T0FA 3Q5FA 1SAXA 1I27A 1FOKA 5DV5A 3JAMK 5IT9Z 1XGNA 3KFWX 4BHBA 3KP3A 2FSWA 3GFMA 2E1NA 6PAXA 4GYIA 4JBAA 1XSXA 4Z2YA 3HSEA 3D5LA 1YS7A 4KNYA 1HW5A 1ZRDA 4WCGA 4PGGA 3K69A 2XKPA 1YS6A 4UNOA 3D0SA 3JTHA 2ESHA 3TOAA 2HYGD 5J8FA 4U7DA 1DPRA 1R5HA 5K5QA 1IXRC 2HTSA 2DBBA 2JTVA 4UV8A 4A5NA 1S6LA 3RPUA 2VC1A 4HA8A 4GYGA 2E7WA 4LG0B 4O5VA 1ZRFA 5ILUA 4KICA 2Y75A 3HRMA 2IA1A 4M9XA 4IF4A 1LEBA 1LDKB 4G7OF 4ZZDA 4EGYA 3FXQA 5LGNA 3FF5A 1D8JA 3BY6A 4U0WA 1MJBA 2VBXA 3F23A 4L9TA 4AIHA 3QPTA 5LLQA 2K7LA 3L09A 3ZN1A 1U78A 2O61A 2FBIA 4LLGF 5LEKA 2R7FA 2Y0MA 2NNYA 3W6KB 4LGWA 2HOEA 2FXAA 2GXBA 4AWXB 2JRTA 4ZZLA 3K2ZA 3TGNA 2X4HA 5BPDA 4BH9A 3KE2A 4HV5A 1SD4A 1WI9A 1USSA 3HHHA 3F8CA 4HBLA 1HXDA 4M6YA 5LEJA 2VBYA 5LHHA 1P4WA 1GXQA 2FQ3A 4BQAA 3TKYA 3ZMSA 2ZMEA 4M9SA 3CO6C 2BYVE 3H3UA 1BOAA 4MTEA 2FEZA 4Q47A 2A68F 2W85A 3CJNA 2F5EA 4NQWA 1QPMA 1KYZA 2RNJA 1LDJA 3QRFF 1U6GA 3F8MA 5H6QA 3H3ZA 4HQMA 1FX7A 3HRTA 4UVCA 3BDDA 5CVIA 5LGTA 4WF2A 4K2EA 1B6AA 2R7DA 1RUNA 4HX7A 2KIUA 2NAZA 3IRQA 3KZYA 4CYDA 1S7AA 3F8NA 3HHGA 3L9FA 2VE8A 3CUQC 4S05A 1YYVA 3E3VA 3VEPA 3LA2A 4HX4A 2OZUA 4WXCA 4UHTA 1Z05A 3K1NA 1LDDA 1PUEE 3QP6A 2FE3A 2EV5A 2FMYA 2EWNA 1UB9A 4RB1A 5F6FA 2PBIA 1JXSA 3HUGA 2Y48A 2QENA 1MGTA 1IN8A 1FBUA 1TQMA 2D1HA 2ZO4A 1G6NA 1IN6A 3E97A 3F21A 3WGHA 4FT8A 1WSUA 4KT5C 3K0LA 1IRFA 5D6EA 4MQVA 3WTTC 2FBKA 3GFIA 1OYWA 5FB2A 4ESJA 4XRFA 2B0LA 1AOYA 2M45A 1Z6TA 4YIIA 3GUDA 2ZCWA 5HS9A 1FYLA 4OIRF 3FXRA 1IN5A 1FNNA 2ZXJA 3WGGA 5HOOA 4DQ2A 1KQ8A 1HQCA 2F5FA 4MTDA 4L5JA 2DT5A 2XAHA 1R22A 3CUQA 4LJZF 5F64A 1BN5A 3LAPA 1G3YA 1B4AA 2FF4A 2CFXA 1FZPB 1R5GA 3ABUA 2VT2A 1FYMA 1ULYA 4KN4X 3FMSA 1HW2A 3CO7C 3K1MA 5E20A 1U3EM 1SFXA 2LDUA 1U5TA 1KU3A 2PEXA 3WTVC 3W6JB 1WWXA 3O6BB 2XASA 2IVMA 3MZHA 5CVRA 2RKHA 4MNUA 1SMTA 2OA4A 4PCQA 2HWVA 1HSTA 1A04A 4EJUA 1LB2A 2G7UA 5D5WB 3F8FA 4EMSA 4LB6B 3WGIA 3V7CA 3IHUA 3FHZA 2QQ9A 3ERED 2DU9A 4OIPF 2P7VB 2XUBA 5DD4A 4IPAA 4EM0B 3GEZA 4G7ZF 3WODF 2LNBA 4WXHA 1YW7A 1B9MA 3R60A 1G3SA 3R4KA 2AXLA 1ZG3A 2A69F 2PMHA 1BM9A 4I0BA 5FFZA 1E17A 1JE8A 2L4AA 2W24A 2QUFA 2V6CA 3EUHA 4ZYHA 1SD7A 3I59B 4OINF 1R23A 1F1ZA 5D5XB 1G3TA 4IRHA 4A5MA 5K5RA 3ZQ7A 2EFQA 2O3FA 4N0BA 4BYYA 3GZ5A 5DYMA 1PDNC 3ZMUA 2K4BA 1I1GA 5CVUA 2JPCA 3GFJA 1ONVA 2CGPA 4Q48A 1LVAA 3ZN0A 3LQRA 5HDGA 1OPCA 1ZAOA 3IRRA 3TO9A 2DQRA 3WTSC 3RI4A 1J59A 1ZN2A 2EFPA 3DPTA 1D3YA 5HDNA 1P92A 2VOOA 3KETA 2P5VA 4RB3C 3M9AA 3I5UA 4ESBA 4LLNA 4OMYA 4D0PA 2A3SA 5L3EA 4I7HA 3F72A 4OIQF 1OKRA 3HYIA 2KJCA 4JQFA 4FX4A 3WU1B 1JGSA 2ZJ2A 1WRJA 3DF8A 3WTUC 1V3FA 3GF2A 1ZG5A 2IW5A 4EJWA 4DNCA 3BJ6A 1L3LA 4YIFA 2CSOA 4MEYF 2DTRA 3I4PA 1FYKA 2DAOA 2EA4A 2JSCA 1TBXA 3GFLA 5JI6A 1KU2A 5DCMB 2HKXA 1BC8C 4KIBA 4CO8A 1MDMB 4HF2A 1TQIA 5EEHA 1CGPA 1YFHA 1MJAA 1XD7A 1BIBA 4A12A 3KP6A 4KFCA 3QP5A 3U2RA 1O3QA 2QBYB 2MD5A 2Z9OA 1HW1A 3O2PE 1DUXC 2ELHA 3RIRA 2BE5F 1SD6A 4Q4ZF 4XBFA 1R1TA 1YO5C 3MEXA 1S29A 2PLYA 1BI3A 2O8XA 3TQNA 1O7LA 3CLOA 2YU3A 4M9ZA 1CF7A 3L2CA 4RAYA 4BHPA 1SFEA 5FO5A 2RN7A 2QBYA 4P9FA 3IL2A 2IA0A 4HF1A 3BROA 2DO7A 2Z99A 4A6EA 4RGRA 5E8IA 1O7FA 5JR3A 3I71A 1XCBA 2EB7A 3GO5A 1K7AA 3IWFA 4IHSA 4G8XA 2QM3A 4MQ9F 1IRGA 3MAJA 3Q9SA 3IKVA 4A0XA 4KIFA 4ASNA 3JTGA 1H0MA 3HSRA 2QQBA 5CYVA 1FBQA 2XIGA 4HOBA 1FPQA 4QWQA 1H9TA 4IRIA 4U0VA 2UXNA 1KQ0A 3N97A 4GCVA 4IXAA 4KMUX 3RKYA 3WE3A 1Z7UA 3WG9A 4G6DA 2HYFA 2WC2A 5BMZA 1OYIA 1GHCA 2GWRA 2QVOA 3VB2A 1QZZA 4LK0F 3FZVA 4LG0A 1UHWA 4NB5A 1IF1A 4KMFA 1WQ2A 4KIGA 2RC4A 3R0AA 5K1YA 1HKSA 1IAWA 3FM5A 2D2WA 3MZYA 5ICEA 2RQPA 3WTYC 5KVRA 3GVAA 1XDUA 4EQQA 2YX7A 2PG4A 1YG2A 5BS6A 3GWZA 4IJAA 5LGUA 1FSEA 2YPRA 1ZARA 4HX8A 1ON2A 2HTJA 2VC0A 1XN7A 3EDPA 2MLGA 1U2WA 2D1VA 5BQTA 2EJRA 1Q1HA 2EFOA 3C18A 3HOTA 3REOA 4P55A 3Q9VA 4UUVA 5H6RA 4ZYDA 2M87A 3FXUA 4ENJA 3SFZA 4HDUA 2LKPA 4L5IA 3DEUA 3LA3A 4Q5SF 3HOSA 1H9GA 1LJ9A 4PZJA 2H27A 3EETA 4OOIA 3HRSA 5FLXZ 5ILSA 1TW3A 5ERIA 5L3BA 2FBHA 2Z5UA 3GZ6A 2MC3A 3P9CA 1B59A 4ZH4F 2A5YB 3RYPA 1BI0A 2VXZA 4OIOF 1XSDA 1MZBA 1ON1A 4O3MA 3J80K 5AONA 4KN7X 4EJOA 2PJPA 3HTSB 3BPVA 2ZFWA 3M7GA 1YW8A 3T5XA 5TRDA 3EYYA 5L3DA 2XAFA 1LEAA 4I2OA 1KU7A 3M8FA 2XROA 2JT1A 2RV8A 1K78B 3DKWA 2QLZA 1HKTA 1D8KA 4RB0A 5J8CA 3DFGA 2J5OA 2RDPA 3ROUA 1P4AA 3C1DA 1FC3A 2QYOA 2VODA 5A2QZ 3DQVC 4I01A 4YG2F 2EFNA 2V9VA 3VFZA 1ZGAA 4FHTA 4LLLA 2WWYA 2K86A 5IT9K 4TV7A 2Z3YA 5BPIA 3MWMA 5ILVA 2IPQX 4N9HA 4PGHA 4XSZF 3LWFA 2OD5A 2CYYA 2ADUA 2IT0A 1TW2A 1S3JA 2CW0F 2HQRA 3R6SA 3VODA 2STWA 3B73A 3M8EA 4G6QA 4I09A 3MQ0A 3J7AO 2W57A 3I54A 2P5KA 5HLGA 5E17F 4EGZA 1R1VA 2HFHA 4CZZA 3EYIA 1QBJA 1UCRA 3OOPA 1FBSA 1ZH5A 4M72A 3ZMVA 2ACJA 2Q2EA 5E1XA 1KA8A 1I1SA 2TDXA 4L9NA 2MH2A 4L0YB 2M30A 3KZZA 3C3WA 4ENKA 3J81Z 1RUOA 2PN6A 4GGGA 3I58A 2OZ6A 1FWZA 3E6MA 4L0ZB 4Y15A 3GXOA 1J7KA 1USTA 4LB5A 4RAZA 1EH7A 2YR2A 3R61A 3LQQA 2PMUA 4HLXA 5BOXA 3LFKA 4HAMA 5E1WA 3JAMZ 3P9KA 4G9YA 2K02A 2CQKA 2Q0OA 4M73A 1HKQA 4UVBA 3KP7A 4A0ZA 5HS7A 1XB4A 2FRHA 4UVAA 3I64A 3ECHA 1P2FA 3QOPA 3KLOA 4P5OA 3IKTA 3OV8A 3ELKA 2UXXA 4UV9A 3E6BA 4RB2C 5DCFA 2HKOA 4XLPF 2O03A 2WTEA 2H94A 3BWGA 2FU4A 2HS5A 4G7HF 4HW0A 3T8TA 2CG4A 3GW2A 4NHJA 1FY7A 3I59A 3BJAA 2IA2A 3U9GA 2ZBKA 1J9IA 5JVTA 5DUIA 2DQLA 2P8TA 1L0OC 4EV0A 3KP4A 4OU0A 1O3TA 2CWEA 2BEOA 3AAFA 3V4GA 3FMRA 2PQ8A 4G94A 4CICA 3SQNA 5CLSA 3S2WA 2EA2A 3I53A 1ZYRF 5JFRA 5A2QK 2E1CA 1T2KA 2ETHA 1R00A 2COMA 1T98A 2GA1A 3E5UA 5AIQA 1W7PB 2D45A 1AWCA 1VTNC 1QO0D 2A07F 3DPLC 2HQNA 5ED4A 2H6BA 2GZWA 3GX4X 3P7NA 1V4RA 1W4MA 3QPHA 2J5PA 4LD5A 1P6RA 4CGZA 3V7RA 1RZ4A 3ULQB 4KDPA 4GO1A 5IT3A 5HDKA 1IUYA 1R36A 1EH8A 4OMZA 4BHCA 5DCMA 5KK1A 4ZYEA 3ECOA 2P5LC 4HQEA 1BJAA 2VBZA 1B9NA 3TO6A 1OMIA 1ZREA 1MDMA 1IZ1A 2E7XA 1T39A 3CDHA 4N9IA 3CTAA 1YTYA 3BPXA 2IJLA 4AIKA 1W5SA 4B09A 3TDZC 3BZ6A 1C0WA 2ZNYA 3F22A 3NQOA 4GXOA 4ETSA 2VT3A 1F5TA 2STTA 1IXCA 5HS8A 1BI1A 3L00A 4ENNA 4A6DA 2FNAA 5LHIA 4XLNF 4CDGA 1RI7A 4QLCU 5LRSA 2KKOA 4BXUA 4EVIA 3PFIA 2GQQA 4R8HA 5ICCA 1S7OA 2NS0A 1XGOA 2IRFG 5E8GA 1ODDA 1J2XA 2RVCA 1O3SA 2A61A 1FSHA 4IHTA 2ESNA 3N4MA 3EQLF 1IN4A 2BGCA 5D5VB 3RJPA 2EV0A 4MHGA 2FA5A 3RYRA 3LA7A 1QNTA 2CO5A 1PP8F 1XDSA 1S8NA 1J75A 4ON0A 1ZLKA 1P4XA 3VOEA 4IRGA 2GA2A 3QU6A 5LBQA 2VOPA 2DI3A 3DP7A 5CVVA 4HF0A 3WE2A 1EV7A 1XMKA 2KRFA 3PQKA 3ABTA 2W84A 2QZ8A 3BOQA 5D5UB 4F7ZA 4RS8A 4E70A 4WK8F 3IWZA 4YFXF 1BI2A 4LK1F 3COAC 3M1EA 1IXSB 2HGCA 3ZP5A 5AIPA 3KEOA 2L02A 1SMYF 2X0LA 1E2XA 2LF7A 3KEQA 3BJOA 3ZMTA 2PI0A 2NRAC 2NNNA 3V8LA 1TLHB 4MGRA 2HR3A 3F8BA 1W7PD 2K4JA 2KIFA 2VE9A 1I5ZA 2GXGA 2F2EA 3ZMDA 1K6OA 5H20A 5J6XA 3JW4A 2XV4S 4KA4A 2O0YA 2ZMEB 4U88A 2A6EF 3LAJA 3ZMZA 2BV6A 2IP2A 2O6GE 1PP7U 1ZLJA 1NHAA 1F9NA 2XAJA 4I0AA 4RGUA 2OQRA 1YW9A 5FFXA 4BAYA 2P6TA 2DK5A 4S04A 2MBFA 2FOKA 5F1RA 1OR7A 2W25A 4M74A 1YIOA 1STZA 4EJVA 2M5WA 3H92A 2EFWA 1QQIA 2MA3A 2XKOA 4UXNA 1BC7C 2OU2A 2DW4A 5LRRA 1R7JA 4A0YA 1MJ9A 2AS5F 2ZKZA 1TQPA 1XGSA 3F6OA 3SZPA 1EH6A 4HV6A 4BNCA 5CVJA 1OYYA 4A2UA 5FGMA 4U0YA 1I6XA 4MEXF 5K5OA 1ZHFA 3FWEA 1KYWA 5D4RA 4AD9A 1LQ1A 3TOBA 4HYEA 4KUMA 3MCZA 5L3CA 4L9VA 3TDUC 4WX9A 2C6YA 2FNPA 2XHKA 2JPBA 3F3XA 3QAHA 1DDNA 3KP5A 4M71A 3MFKA 2FMLA 1UHMA 3WTXC 3I0TA 4R1HA 3T8RA 1REPC 4CHUA 3E6CC 1K78A 3DXJF 5FD5A 2P6SA 3C7JA 1FT9A 2OBPA 1F4KA 4O6JA 2P4WA 4ESFA 1JHFA 4Y17A 1UFMA 2V1XA 5HVQC 3HRUA 2JZYA 2UWMA 4U7BA 4LFUA 3CUOA 4HDVA 1JHHA 1X3UA 5D6FA 1RIOH 1GVJA 3FM3A 1U5TC 3IC7A 3WTZA 1XCVA 4M6XA 5E1ZB 3CUQB 4R79A 2H09A 3JSOA 1XSVA 2KIMA 3GYHX 3SXYA 3R0JA 3NEUA 1J0RA 1TTYA 1QZYA 1D5VA 3BP8A 3KCCA 1FLIA 1T38A 2H6CA 2BBYA 1G3WA 2YX4A 3RPQA 4EM1A 4PDKA 5DEQA 1DPUA 5E18F 1U5TB 3WU0A 4ZYGA 2DLLA 5ICFA 3DV8A 2UZKA 4B8XA 5CJ9A 5JHUA 2VONA 2G9WA 5HLIA 2K27A 4HLYA 3G73A 1T6SA 5D8KB 2MH9A 3FX3A 3NRVA 3ML6A 2LSOA 2L4MA 5ICGA 3P9IA 4Y13A 4YFNF 1QGPA 2L3DA 5D8LB 5D4SA 2V1UA 1MD0A 4LMYA 2QQAA 2G7HA 1Y0UA 2DK8A 3T1BA 5HLHA 4L18B 3U1DA 1R1UA 1LNWA 2XAGA 1IW7F 3L7WA 1YQAA 1RNLA 2GAUA 4ENMA 4EJTA
chains in the Genus database with same CATH superfamily
4AVPA 2LLKA 4P9UA 3QYFA 2GLOA 2R92J 3E5QA 2DPUA 3E6DA 2R5YA 4B1RA 1IGNA 1TWFJ 2QWWA 2XRNA 2P7CB 5DM6F 1TNTA 5L3FA 3U1KA 3KYDB 5TJJA 1K79A 3KLNA 2MLKA 3GLXA 5FLXK 3RKXA 1TZLA 1W5TA 1QHGA 4M6VA 3G1MA 1Y1WJ 2FUG2 2M1BA 2F5DA 1JKOC 4CXFA 2ID3A 3L2RA 3LSTA 2LREA 3U21A 2VN2A 2BXZA 1BIAA 3DU6A 2LY1A 3RKWA 3HPHA 4AU7A 2OJED 4DGWB 3JRDA 1XGMA 4NC6A 4WXDA 5FKMA 1KQ9A 2HEOA 2F4MB 4UB8C 2EZKA 4YFKF 1SANA 3CD6I 3OYHA 3K1PA 3V8JA 3BR3A 2ECBA 4CCMA 3WTWC 1GXPA 2L54A 3O3KA 5DUKA 1FP1D 2ISZA 3V8KA 4XOPA 2VQCA 2ZXWH 3S3MA 4RGXA 2HZTA 4XLHA 4IVNA 1ETXA 5L3GA 2WV0A 1DP7P 3N05A 2LF8A 3GTPJ 1I3AA 3CF2A 1GLNA 3RTRA 2Z33A 4BBSJ 3RZOJ 4AIJA 4IX7A 1FIAA 1D0YA 2ISYA 3ISPA 4XRSG 3G3ZA 1O3RA 2M4GA 5LHGA 1MKMA 5DDGA 2V79A 1X58A 3F6VA 3S15J 3GBGA 3S3NA 3QU3A 3PUBA 2OF7A 1IN7A 2XGXA 2AO9A 2L01A 1Y6IA 5J1UA 3K4LA 4HZFA 2DPDA 3HTUA 1IRXA 2YSRA 2V6EA 3PQJA 3TL4X 2CJJA 3CCQI 4B48A 3DWLE 1WZ2A 1MBJA 2EQRA 2GXAA 3S1QJ 4BJ5C 3OS2A 3V7SA 4BJTA 1Z91A 4BDYA 3DEWA 3TO7A 4WWCA 3SHFA 2K9LA 1VQ7I 1Z6RA 2LG4A 1ITYA 3ABKH 4BE2A 2R5ZB 2PJRB 2DFIA 2WY7Q 1K83J 4P96A 3JSPA 4A3JJ 2CV0A 3BQYA 1Z9CA 3S93A 3RDIA 1U8RA 1W1WE 1IV6A 4BQNA 3BR1A 3T0YA 3AG1H 1B8IB 5TISC 5GPCA 4ZDLA 1T0FC 4RAGA 1DP3A 3KYCB 4II2A 3W3CA 5CQEA 2R3SA 2RGVA 3CP2A 4JYKA 2O7OA 5DD8A 1NG7A 2OQGA 2VBWA 4AIDA 1B1BA 3FIWA 2NYXA 4AYBA 1OISA 2KZGA 3KP2A 4L9JA 2XAQA 3OIOA 2M8EA 1G4DA 2A6HF 1ZRCA 1W7PA 1O57A 2ZNZA 2IAIA 3BTIA 1W0UA 2OAZA 3FK7A 2EK5A 3I56I 1J5YA 1Z1DA 1QU3A 3BC8A 4H0EA 4AM3A 3QYBA 1KGSA 4HRIA 1ZGWA 3GTMJ 2W48A 2X6YA 4KYWA 3J80Z 1CF7B 1S7EA 2BHYA 2LY9A 3UR3C 2KRCA 3B02A 1HBXG 4IOAF 2JA6J 3QOEA 3PO2J 2HDCA 1UZCA 5EEGA 1WJBA 2XVCA 2L0KA 1X1AA 2EBIA 3OIPA 1WKMA 3HIFA 4XSXF 2PFBA 2B9SA 1R58A 2EIMH 3HSFA 2PMZA 4OAZA 2L9SA 1HSJA 4JK1X 4PJMA 1GVDA 3K4BA 5K7HA 1SFUA 2QSGX 2KJBA 2A5WA 2M3AA 3HBLA 1SD5A 5FD6A 3ZPLA 2IGKA 2YUSA 2EV6A 1ENHA 2F4IA 4CSWA 4RGSA 4B3XA 4I98B 2F5CA 1DGRM 3FMQA 4EM2A 1S9HA 1YLFA 1KU9A 1ZGJA 3J81K 2OTJI 3LNQA 1FEXA 2E2IJ 2WY8Q 3E5XA 1MNEA 1YHQI 1TNSA 3DU5A 3SEZA 1IC8A 4GDFA 1FTZA 1A35A 1XPXA 1MNDA 3AFHA 1ETWA 1ORKA 1RR8C 2Q8KA 3OYAA 4YELA 2NVXJ 3SEQA 1XMAA 4FX0A 5J4VA 3K9TA 4MFEA 5J40A 1FP2A 3SZTA 1BBYA 4CCOA 4I02A 2GIVA 2V1DA 3K4MA 1T0FA 3Q5FA 1SAXA 1I27A 2RREA 4MLOA 1FOKA 4BY1J 3JRHA 5DV5A 3JAMK 2QGUA 5IT9Z 3QYEA 1I3QJ 1XGNA 3BG6A 4UUSA 3KFWX 1XG1A 4BHBA 2OTLI 2QF7A 3KP3A 2FSWA 3CCLI 3GFMA 2E1NA 1RRJA 4E7KA 4Y52J 3GTOJ 6PAXA 3H9JA 1LE8B 4GYIA 4JBAA 1XSXA 4Z2YA 3HSEA 3D5LA 1YS7A 1Y8QB 1HW5A 4KNYA 3CJQB 1MBFA 2K85A 4BUPA 1ZRDA 4IHWA 4C3HJ 3ZCOA 2MW8A 4WCGA 4PGGA 3K69A 2XKPA 1YS6A 2DOEA 3Q0VA 4UNOA 1SAUA 3D0SA 3JTHA 2ESHA 3TOAA 2HYGD 5J8FA 2VASA 3BTCA 5FKKA 4E7IA 4U7DA 1DPRA 1R5HA 5K5QA 2X1DA 1SVLA 2E1OA 1WFXA 1IXRC 1DU0A 2HTSA 2DBBA 2JTVA 4UV8A 4A3MJ 4A5NA 1S6LA 3RPUA 2VJJA 1SFOJ 3HOVJ 1N75A 2JVHA 2VC1A 2BY0A 4HA8A 4GYGA 2BOLA 1YOVB 2E7WA 4LG0B 4O5VA 1ZRFA 3PNYA 5ILUA 2O9LA 4KICA 2HQAA 2Y75A 3HRMA 4XR6A 2IA1A 4M9XA 4IF4A 1LEBA 2MG4A 1LDKB 4G7OF 4ZZDA 4EGYA 4D5CA 3FXQA 5LGNA 2ZMEC 3FF5A 1D8JA 3MVPA 3BY6A 3PL8A 2HU9A 4U0WA 1MJBA 3ZQFA 3CC4I 3MD2A 2VBXA 5TGTA 3F23A 3CCUI 3SJMA 1BL0A 4L9TA 2E35A 4AIHA 2JJ7A 3QPTA 5LLQA 2K7LA 3L09A 3ZN1A 1U78A 2O61A 3I3LA 2FBIA 1UAAA 2JRMA 4LLGF 4JX4A 5LEKA 5IP9J 5KCMA 2R7FA 3BT9A 5EG0A 2H1KA 2EINH 4AYBN 3ZQLA 2Y0MA 3E7LA 2NNYA 2R7UA 1YJNI 3W6KB 2L5QA 4LGWA 3A2KA 1I39A 2HOEA 4IHYA 1MH3A 4JX5A 4A3LJ 2FXAA 1JT0A 4BKXA 2GXBA 4AWXB 2JRTA 4ZZLA 1LFBA 3K2ZA 3TGNA 3OYBA 2X4HA 4XK4A 5BPDA 4BH9A 3CP8A 3FBNB 2K9SA 3KIOA 3KE2A 2E71A 4HV5A 5J4YA 3OMYA 1SD4A 4LG3A 1ZKGA 2VKHA 1WI9A 1USSA 1MBEA 3HHHA 1RESA 3F8CA 2PMZN 1VNDA 4HBLA 1XMXA 4E7LA 1HXDA 4M6YA 5LEJA 2VBYA 2M4KA 3ABMH 3MMYB 3TW7A 2I5UA 4FETA 1W5CC 2Y9ZA 4J01A 5LHHA 2CUEA 1P4WA 2W1OA 1GXQA 2FQ3A 3LSMA 3K6GA 4XMYA 5GAEJ 3TKYA 4BQAA 3LL7A 1OCOH 3ZMSA 3TEDA 2ZMEA 3DBHB 2OC6A 4M9SA 1HLVA 3TP0A 4BJ6C 1TWGJ 3CO6C 4QPQA 5K7ZA 2BYVE 3H3UA 1BOAA 2GBYA 2FEZA 4MTEA 4Q47A 3JRIA 4IL6C 3S14J 4A93J 2A68F 2ME0A 2B7EA 2W85A 2F5EA 3CJNA 4NQWA 2LRDA 3ASNH 2HOAA 1QPMA 1KYZA 2RNJA 3K4CA 1LDJA 4E7SA 5J47A 2H1LA 2E34A 4HPQA 1T56A 2LFBA 4XM3A 3QRFF 2E1MB 2OV7A 3BZKA 3CCRI 1YE9A 1U6GA 4BXXJ 3F8MA 2NS8A 5H6QA 3A01B 3PNVA 2X6WA 3H3ZA 4HQMA 3AG4H 1FX7A 3HRTA 4KISA 4UVCA 3BDDA 5CVIA 5LGTA 3GTQJ 1XC5A 2QSFX 3OYNA 4WF2A 4NDLA 4K2EA 1B6AA 2R7DA 3SYTA 1APLC 2HOTA 4HG2A 1RUNA 4HX7A 2KIUA 4RAFA 2NAZA 4BS9A 2KRHA 2K40A 4OWRB 3IRQA 3D5RC 4ZC3A 3KZYA 4CYDA 1JGGA 2GOXB 1S7AA 3F8NA 3RPUD 3HHGA 1EJ9A 3L9FA 2VE8A 2ZC2A 3DKYA 5FKLA 3CUQC 3LSKA 1YYVA 3E3VA 3VEPA 4S05A 3G4SI 3LA2A 1IJWC 3LSIA 3HL2A 4HX4A 3HGYA 2OZUA 4WXCA 5FKOA 4AC0A 2QKLB 2E2HJ 2DA3A 4UHTA 1Z05A 3K1NA 1LDDA 1WH5A 1PUEE 3QP6A 2V7FA 3FDYA 2FE3A 2JMWA 3ZQGA 2LKSA 1LPQA 2EV5A 2FMYA 1Z77A 2EWNA 4Y4RA 1UB9A 4RB1A 5F6FA 2PBIA 4D7MA 2B63J 3CCSI 2KP6A 5CKTA 2KDZA 1JXSA 3HUGA 2Y48A 2HXIA 2QENA 1MGTA 4GFBA 1IN8A 4Y7NJ 1FBUA 1TQMA 5E3NA 2MGQA 3H3VK 1JI8A 2D1HA 2ZO4A 4P1WA 1SVOA 1G6NA 1IN6A 3E97A 1FTTA 3F21A 3WGHA 4D5FA 5HNHA 4FT8A 1B72B 1WSUA 4EEFG 4KT5C 3K0LA 1IRFA 1X1BA 2HYJA 2MC4A 3G2BA 1WJAA 5D6EA 4MQVA 3WTTC 2FBKA 2Q2EB 2KL4A 3PIPF 3GFIA 1OYWA 5FB2A 3S1RJ 4ESJA 9ANTA 3AKZA 4XRFA 2B0LA 1OCCH 4CCJA 2M45A 1Z6TA 1AOYA 1E0EA 4YIIA 3GUDA 2ZCWA 1TP4A 5HS9A 1ETKA 4PJ0C 1FYLA 4OIRF 3FXRA 1IN5A 2D5VA 1FNNA 2GIZA 2LY2A 4C2TA 2ZXJA 3FHNA 3FXLA 1AKHB 3WGGA 5HOOA 2QCOA 4ANJA 1UELB 4DQ2A 1KQ8A 1HQCA 2YU9J 2F5FA 2IEKA 4MTDA 1E3HA 4L5JA 2O5RA 1ZR2A 1VQ8I 2DT5A 1EKEA 2XAHA 1R22A 2IXSA 2VXDA 3CUQA 4LJZF 1Z7LA 5F64A 1BN5A 5KAFC 3LAPA 3W2AA 1G3YA 1B4AA 4DBRA 2FF4A 3EUHC 2CFXA 3O8GA 1FZPB 4IZZA 4IHXA 1R5GA 5GP9A 3ABUA 2V4JC 3QQAA 3BR5A 2VT2A 1FYMA 1ULYA 4KN4X 1YRNB 3FMSA 2M0CA 1HW2A 3H5NA 2EIJH 4HSRA 1PUFB 4PJJA 3CO7C 3K1MA 5E20A 1U3EM 1SFXA 2LDUA 1ZTRA 1U5TA 1P9QC 5EEAA 1KU3A 2PEXA 3WTVC 3W6JB 1T33A 3C2BA 1WWXA 3S32A 1S5LC 3IP4B 3O6BB 1X4PA 2XASA 2IVMA 2IBDA 2P0WA 3MZHA 5CVRA 4FE7A 2RKHA 1MMGA 4MNUA 1SMTA 2H8WA 2OA4A 2ELKA 2Z16A 4PCQA 2R4GA 4X0GA 1G2HA 2HWVA 5C44J 1HSTA 1A04A 4EJUA 3HGGA 3M3YJ 5HLTA 4BQQA 1LB2A 4E7HA 2HQ5A 2G7UA 3VPRA 5D5WB 1JUMA 3F8FA 4EMSA 5KHDA 4I99C 4LB6B 3WGIA 3V7CA 3IHUA 3FHZA 2JA8J 2KQRA 2QQ9A 3ERED 2DU9A 1IDZA 5GAGJ 2TRTA 2V9KA 1AU7A 1IG7A 3OR1C 4OIPF 2P7VB 2XUBA 5DD4A 1VQMI 1BR2A 1SC7A 4IPAA 4EM0B 2M0MA 3GEZA 4G7ZF 1JJ8C 3WODF 2LNBA 4WXHA 1YW7A 5IOZA 1B9MA 2IS2A 2CW8A 3R60A 1G3SA 4RA2A 3R4KA 3M4OJ 2AXLA 1ZG3A 4BL0B 4RLQA 3OWTA 3FKJA 2A69F 1UG0A 2HVSA 5B1BH 1OCPA 3M8JA 2PMHA 1MSFC 4RM3A 5FRNA 1BM9A 1ETVA 4I0BA 5FFZA 1E17A 1A31A 3JRGA 5FRMA 1JE8A 3KX2A 2L4AA 2KDOA 2DFEA 4M3BA 2W24A 2F4OB 4RLFA 2QUFA 4V2GA 2V6CA 4BE0A 3S2DJ 2AXTC 4DZPA 4DZJA 5GADJ 3EUHA 4JOMA 4ZYHA 1SD7A 3I59B 4OINF 1R23A 2R0QC 2DMUA 1F1ZA 3PM1A 5D5XB 1EA3A 1G3TA 4BXFA 4IRHA 1TC3C 5B5EC 4A5MA 4QIWN 5K5RA 3A0HC 3ZQ7A 1K61A 2GM4A 2EFQA 2O3FA 2IGNA 4N0BA 4BYYA 3GZ5A 3DKXA 5CQGA 5DYMA 1PDNC 3ZMUA 4XONA 3X2QH 1TWHJ 2DDAA 1O4XA 2K4BA 2PX9A 3LSRA 3H0GJ 1H88C 1I1GA 1POGA 5CVUA 4XQFA 2JPCA 1ETYA 3GFJA 5K7FA 5F27A 1ONVA 2CGPA 1P7IA 4Q48A 1LVAA 3ZN0A 3LQRA 5HDGA 1OPCA 1ZAOA 3EUAA 3S1NJ 2CUJA 2JA5J 3IRRA 1QRYA 3L2VA 3TO9A 2DQRA 5E79C 3WTSC 1MBKA 3RI4A 1J59A 1ZN2A 2EFPA 3DPTA 1D3YA 1SVMA 3RQIA 5HDNA 4FE4A 2VQGA 3H9GA 2X6XA 2M34A 1P92A 2M9HA 2VKDA 4ZTJA 2VOOA 3EUKL 2R7ZJ 3KETA 1XX5A 2P5VA 4RB3C 3M9AA 3I5UA 4ESBA 4LLNA 4OMYA 4XLCA 4D0PA 2A3SA 5L3EA 4I7HA 3F72A 5J1YA 4OIQF 1I6HJ 1OKRA 3HYIA 2KJCA 4JQFA 4FX4A 3KPHA 4MO7A 3WU1B 1WPKA 1JGSA 1Y1VJ 2DA1A 4ZDPA 3WHBA 2ZJ2A 1GV2A 2NVQJ 3QODA 1WRJA 4C3IJ 2L7KA 2WAFA 3DF8A 3WTUC 3O8HA 1V3FA 3QPSA 2V9PA 3GF2A 1ZG5A 5JHFA 4F52A 2IW5A 1TT0A 3VDXA 3VYTB 4EJWA 3J7YJ 2DDBA 1LFPA 3TP3A 4DNCA 3BJ6A 1L3LA 2EPFA 1G8XA 1E3OC 3HC7A 4YIFA 3GLLA 1DU6A 4A3BJ 2CSOA 4A3CJ 3BG9A 1J09A 2ZJPF 4MEYF 2E60A 2DTRA 3OYCA 3I4PA 3CMYA 1FYKA 2DAOA 2KFDA 2EA4A 5GTHC 2R7SA 2JSCA 2FJ1A 2DA5A 1TBXA 3GFLA 5JI6A 2VQLA 1KU2A 5C4XJ 3F9KA 4XNFA 4II3A 1YJWI 5DCMB 2HKXA 1BC8C 4KIBA 4XKVA 2XPUA 2R5ZA 2PJRA 4CO8A 4E4HA 1VQPI 1MDMB 2OPTA 1LFUP 4HF2A 3PO3J 1TQIA 2VJ4A 2CUZA 2FD5A 2CUFA 2DYRH 5EEHA 2MFZA 5E3LA 1CGPA 2R7VA 2EZLA 1YIJI 1B8IA 1YFHA 1UHSA 1MJAA 1XD7A 1BIBA 4A12A 3KP6A 4CUGA 3QP5A 4M3GA 4KFCA 3FXMA 3U2RA 2DA6A 3CESA 1O3QA 2QBYB 3L2WA 2MD5A 5IOYA 2Z9OA 1HW1A 2JUGA 3O2PE 1D1AA 1DUXC 2ELHA 2HVQA 2CQXA 4YRVA 2BXYA 3RIRA 2BE5F 1SD6A 3OL4A 4NUBA 3RKQA 3LOCA 4Q4ZF 4XBFA 4A3EJ 4BY7J 4D9JA 1A36A 3OY9A 1R1TA 1YO5C 2HI3A 3MEXA 1S29A 3OYIA 1LKXA 2PLYA 1BI3A 2N8GA 2O8XA 3TQNA 1O7LA 3CLOA 2XF5A 2YU3A 3OR2C 2Q1ZB 5B3SH 4CZCA 4M9ZA 1CF7A 4D1QA 3L2CA 4BE1A 1U8BA 4RAYA 4B47A 4BHPA 1SFEA 5FO5A 2RN7A 2QBYA 4P9FA 2LOOA 1WVRA 3IL2A 1R6RA 1D0XA 1V5GA 2IA0A 2VL8A 1WJDA 4HF1A 3UKGA 3OS1A 3BROA 2DO7A 2Z99A 3H36A 4A6EA 1FOXA 2HDWA 4RGRA 5E8IA 3K2AA 1O7FA 2HNHA 3I4NJ 2COBA 5JR3A 3I71A 3SDGA 1XCBA 2V1NA 2EB7A 3GO5A 1K7AA 3IWFA 4IHSA 4G8XA 2QM3A 4MQ9F 3B6CA 1IRGA 5BNGA 3MAJA 4HEA2 2X85A 3Q9SA 3IKVA 4A0XA 2R7WA 3MN2A 5B66C 4KIFA 1M1EB 1VQ6I 2R93J 4ASNA 3JTGA 4NBQA 1H0MA 5IYDJ 2QKMB 2FX0A 3HSRA 2QQBA 5CYVA 1FBQA 4DBQA 3LSPA 5GTIC 2XIGA 2Z1DA 3K4NA 4HOBA 1FPQA 1NG6A 4XKCA 4A3GJ 5JLXA 4QWQA 2LR8A 1H9TA 3JRAA 2ECCA 4IRIA 2X6OA 1MMSA 4U0VA 2UXNA 2LKXA 4KJZA 1KZHA 2F5VA 1KQ0A 3FXOA 3N97A 1LE8A 3CMMA 3OOUA 3ZRGA 4GCVA 3HDDA 1HA8A 4IXAA 4XIDA 1FOYA 2MYSA 4KMUX 3RKYA 3WE3A 1Z7UA 3WG9A 4G6DA 3JREA 1R49A 1YITI 1GT0C 4F92B 2HYFA 2X48A 3W2WA 2AHQA 2WC2A 3PNTA 1JT6A 5BMZA 1RKWA 1OYIA 1GHCA 2K9NA 2QSHX 2R7XA 2GWRA 2QVOA 2RAEA 3VB2A 1KONA 5IY5H 1QZZA 4NC8A 4LK0F 2NOJB 2Y2ZA 3GTLJ 2VJIA 1UG2A 3FZVA 4LG0A 3H0DA 1UHWA 1V55H 4NB5A 3A4CA 3ZGKA 3HB9A 5EZHA 4RDUA 2E19A 4XLAA 1IF1A 4KMFA 1OLTA 3PUFA 1WQ2A 3S2HJ 2XSJC 4KIGA 2VIXA 2RC4A 3R0AA 1FOWA 5K1YA 2IS6A 3KEYA 1HKSA 1IAWA 3FM5A 2DODA 3HG9A 2D2WA 3MZYA 5ICEA 2RQPA 4YEJA 1X2NA 3TW6A 2NOGA 1JUSA 3WTYC 4ZDOA 1D1BA 5KVRA 3GVAA 1ZELA 2DA4A 1XDUA 4ITVA 5EZGA 4EQQA 2YX7A 2QEXI 2PG4A 1YG2A 4W1UA 5BS6A 3BTLA 2DFFA 3RQ4A 1QVTA 3GWZA 4IJAA 1V54H 2ZSIB 5LGUA 1X3WB 1FSEA 2KIQA 2YPRA 5F0CA 3ZQQA 1ZARA 2E1MC 3S3OA 2Y9YA 4HX8A 3WHCA 1ON2A 2HTJA 3MKWB 2CU7A 2VC0A 1XN7A 3EDPA 2MLGA 1U2WA 2D1VA 5E3OA 5BQTA 2EJRA 1Q1HA 2EFOA 2ZSHB 3C18A 2DOAA 3HOTA 3IV5A 3REOA 3FKIJ 4P55A 4MIMA 3Q9VA 4UUVA 2KISA 4BACA 5H6RA 4ZYDA 3L2UA 2M87A 3FXUA 1QA6A 4ENJA 3HOXJ 3SFZA 3TBIA 1MIJA 2BY2A 4UY8I 4HDUA 5IYBJ 4B43A 2LKPA 4L5IA 3DEUA 3LA3A 4Q5SF 3ZQCA 4RBOA 3HOSA 1H9GA 1LJ9A 4PZJA 4DIQA 3EETA 4OOIA 1QPIA 2H27A 3GTGJ 2DMPA 3HRSA 2BHZA 3PFYA 5FLXZ 1JTYA 3K70C 5ILSA 2ID6A 2NVUB 2RQQA 3IUOA 1TW3A 1ZK8A 5ERIA 5L3BA 2FBHA 2L7FP 2Z5UA 3GZ6A 2BVMA 2MC3A 3P9CA 5EJCA 3ERMA 1B59A 4ZH4F 2A5YB 4GRIA 3RYPA 1JKQC 1BI0A 2VXZA 4OIOF 1XSDA 3H9QA 1MZBA 2CQNA 1ON1A 1VI0A 4O3MA 3J80K 5AONA 4C3JJ 2HXOA 3A0BC 2XC7A 1QHHD 4KN7X 5FJ8J 2XGDA 4EJOA 2PJPA 3CCYA 3HTSB 3BPVA 2ZFWA 3M7GA 2IS1A 1YW8A 4HSTA 3T5XA 5TRDA 1I50J 3EYYA 5GPAA 4AUXA 1IV8A 5L3DA 2XAFA 1LEAA 3ESWB 4D7NA 5B1AH 4I2OA 1KU7A 3M8FA 4OAYA 2XROA 2WADA 3BR2A 2JT1A 2RV8A 3C2HA 1K78B 3DKWA 2QLZA 1HKTA 3A01A 1D8KA 4RB0A 5J8CA 3DFGA 2J5OA 3HOZJ 3NWSA 4HNVA 1SFKA 1ZQ3P 2RDPA 3ROUA 1P4AA 1DGWY 4CA0A 2CV2A 3C1DA 1FC3A 2QYOA 2VODA 2EH3A 4FISA 3LFUA 5A2QZ 3BLYA 1FMVA 3DQVC 4I01A 1MBHA 4X6AJ 4YG2F 4C9YA 2EFNA 1F36A 2V9VA 4XKBA 2LBFB 2NS7A 3VFZA 1ZGAA 4FHTA 3UNGC 4LLLA 5EF6A 4ZTFA 1R71A 2WWYA 3W6VA 3IH4A 2K86A 1ZR4A 4KITB 5IT9K 2W00A 1Z3XA 3JRCA 4TV7A 2Z3YA 3LMMA 1BR4A 2K9MA 5BPIA 3MWMA 5ILVA 2IPQX 1HOMA 4N9HA 5KAIC 1U0JA 2TCTA 3J7ZI 2XRLA 4PGHA 4XSZF 2VKEA 3DCFA 4DYCA 3LWFA 2OD5A 2CYYA 2DN0A 2ADUA 2IT0A 1TW2A 1RC9A 2XGEA 1X2MA 3OIQA 1S3JA 2CW0F 2HQRA 3I4MJ 3M07A 3R6SA 3VODA 2STWA 5F04A 1IRZA 2LBFA 4Z6YA 2A05A 3B73A 5EGOB 3M8EA 4G6QA 2JA2A 4C30A 4I09A 1K4SA 4CCNA 3MQ0A 4IHVA 3J7AO 2DJIA 4NC7A 3WG7H 1W36C 2W57A 3MZ8A 3I54A 3OSFA 1X19A 3SDBA 4CH7A 2P5KA 4ZYAA 1HDDC 4BU2A 1OFCX 2QQ8A 5F0HA 5HLGA 2P81A 5E17F 4EGZA 1HC8A 1R1VA 4CCKA 1JKRC 3G71I 2HFHA 4CZZA 3EYIA 1QBJA 2ZFUA 1B72A 1UCRA 2DFHA 3VYUB 3OYMA 1EF4A 3FBIB 1WCMJ 1LVKA 1FBSA 2XF7A 3OOPA 4M72A 1PYVA 2BVLA 2EIKH 3ZMVA 1ZH5A 2ACJA 4KT6A 4BEHB 3VWBA 4XN3A 2Q2EA 2HZDA 3AG3H 5E1XA 4Y3OA 1KA8A 3ABLH 3C2GA 1BOBA 1I1SA 2X1EA 2TDXA 4L9NA 2MH2A 2LP0A 1VQNI 4BQOA 1W0TA 1H89C 4L0YB 1MH4A 2M30A 4A3IJ 4J19A 3KZZA 3C3WA 4B4CA 4ENKA 3J81Z 1G59A 1RUOA 2PN6A 1Q1VA 2DMTA 4GGGA 1AKHA 3OL3A 3I58A 2OZ6A 1VFCA 1FWZA 2CMPA 3E6MA 3VSLA 4L0ZB 2JK3A 4F93B 4Y15A 3GXOA 1J7KA 3G6EI 1USTA 2ZB9A 3A03A 2BW3B 1HF0A 4LB5A 4QSHA 4RAZA 1EH7A 2YR2A 3R61A 1A6QA 4PSWA 3LQQA 3RCOA 2Y31A 2PMUA 4HLXA 5BOXA 3LFKA 4HAMA 5E1WA 5KNLA 2DCEA 5LFAA 2R7QA 3JAMZ 4CYCB 1YRNA 3P9KA 4G9YA 4LOCA 2K02A 3CJTB 1BW5A 1OJLA 2CQKA 4DJAA 1N25A 2Q0OA 3S16J 4M73A 1PUFA 1HKQA 4UVBA 3KP7A 2R5YB 2BY3A 2EZHA 3MKLA 4A0ZA 3GCMA 5HS7A 1XB4A 3AL0B 2R7TA 2FRHA 1Z21A 3OSGA 2X1CA 4UVAA 3L2QA 4IQJA 5FROA 2W4SA 2NVTJ 4I6ZA 1MW7A 3CZ6A 3I64A 3ECHA 1K6YA 1P2FA 3QOPA 3KLOA 4XICA 4P5OA 3IKTA 3OV8A 3ELKA 5CPRB 2UXXA 4UV9A 2XB5A 3E6BA 2I10A 4XOTA 4RB2C 2WBMA 2DXIA 5DCFA 2HKOA 4BGDA 2WAEA 3OS0A 2BZTA 2ZXHA 3AG2H 4XLPF 2O03A 3SZGA 4XLEA 1BJZA 1Z3YA 2WTEA 2H94A 2L2OA 3BWGA 1NTCA 2FU4A 2HS5A 5IPAA 2LVSA 2LH9A 4F55A 4BDZA 3E1SA 2E5NA 4G7HF 3CJRB 3IAS2 5F08A 4HW0A 3T8TA 2CG4A 3K70D 5M5WJ 3BTJA 3OYKA 1BA5A 1MMAA 3GW2A 4E6KG 3OYLA 5M5XJ 1TL8A 4NHJA 2CQ7A 4LIUA 2W7NA 1MMNA 1FY7A 4QPOA 3I59A 3BJAA 2IA2A 4PUSA 3U9GA 2ZBKA 3DTKA 2XB0X 1J9IA 5JVTA 3OYGA 2CV1A 2IGOA 4A3DJ 5DUIA 3S8PA 5EDNA 2DQLA 2P8TA 2DMNA 3Q0UA 3CLQA 3D5SC 2OCCH 1L0OC 4EV0A 3KP4A 2XF6A 1X4OA 2KZVA 5F0FA 3GMEA 1ZG1A 4OU0A 1O3TA 2CWEA 2BEOA 2CH0A 3GTKJ 3DPUA 3CDLA 5M5YJ 3AAFA 3BG7A 3V4GA 2HOSA 1F43A 2JA7J 3FMRA 1PVEA 2PQ8A 4G94A 2M7BA 5C3EJ 4CICA 3SQNA 2KLOA 2HVRA 5CLSA 1WJ5A 4V2FA 3I9V2 1Y0NA 3S2WA 2DJNA 3OYFA 3ASOH 2EA2A 3I53A 1ZYRF 5JFRA 5A2QK 4IO9F 1HCRA 2E1CA 2ZXIA 1T2KA 2ETHA 2DA2A 3P5JA 3RSNA 2G0EA 4PJNA 1R00A 2COMA 1T98A 2Y0SA 2GA1A 3E5UA 5AIQA 1W7PB 4G12A 2D45A 2Y30A 1AWCA 4RMNA 1X1PA 1WI3A 1VTNC 2K3FA 1QO0D 2K9QA 2A07F 3DPLC 1FMWA 1XS9A 2HQNA 5ED4A 2H6BA 2GZWA 1IUFA 3DLAA 2OUMA 3FK6A 3GX4X 3P7NA 3L1PA 1V4RA 1W4MA 3QPHA 1AA7A 2J5PA 4LD5A 3HPGA 1P6RA 4CGZA 3V7RA 1RZ4A 1PJRA 3ULQB 5IP6A 4KDPA 4GO1A 5IT3A 5HDKA 5DTDA 1IUYA 4XL9A 1R36A 3HOWJ 2X51A 1W36D 1EH8A 2EZIA 4H4KC 4OMZA 4W97A 3K4KA 2LK2A 3DBRB 4BHCA 5DCMA 5KK1A 3CCVI 4ZYEA 3ECOA 2P5LC 4HQEA 1BJAA 1MBGA 2A6TA 2VBZA 1B9NA 3CF5F 4FTHA 3DTEA 3TO6A 1OMIA 3KZIC 1ZREA 1MDMA 1IZ1A 1TWCJ 2E7XA 5J3LA 1T39A 2L9NA 4DW6A 3CDHA 4N9IA 2FQ4A 2NXNB 3CTAA 5FLMJ 1YTYA 3BPXA 3G1OA 1A6IA 2IJLA 4AIKA 1W5SA 4B09A 2XGCA 3PIOF 1JTXA 3TDZC 3BZ6A 1C0WA 2ZNYA 2JWTA 3F22A 3NQOA 4DYQA 3BG5A 4GXOA 2WV1A 2HDDA 2L9RA 4UUSB 4ETSA 2VT3A 1WJCA 3IAM2 1F5TA 2STTA 1IXCA 5HS8A 1RKTA 2H8RA 1BI1A 3L00A 3DEEA 4ENNA 4RM2A 1V5EA 4A6DA 2FNAA 2FOWA 5LHIA 4XLNF 4CDGA 1RI7A 4QLCU 3JRFA 5LRSA 4CCLA 5DS9A 2KKOA 5HODA 4BXUA 1P7JA 3HKZA 4EVIA 5M3FJ 1T08B 3PFIA 2GQQA 4R8HA 5ICCA 2XPVA 1HDPA 1S7OA 1A5JA 4XN0A 1MMDA 4ABZA 1OCTC 2NS0A 4S0HB 1FIPA 1XGOA 3CCMI 5J1RA 2IRFG 5E8GA 1ODDA 1J2XA 2I8DA 2W82A 2RVCA 2GOMA 2M2EA 1O3SA 2A61A 1FSHA 4IHTA 2E36A 2ESNA 3G1LA 3N4MA 5EYRA 3JRBA 3EQLF 4FASD 1IN4A 4F3QA 2BGCA 3K7AJ 5D5VB 4C2MJ 2KMUA 3RJPA 2VI6A 4U87A 1WJFA 1VQOI 5IYCJ 2OCEA 1OCZH 2DTZA 4A3KJ 2F48A 2EV0A 4MHGA 4HNTA 2FA5A 3RYRA 3LA7A 1QNTA 1WHUA 2CO5A 3DTIA 3K4JA 1PP8F 2JQ7A 3CCEI 1XDSA 3F0CA 1S8NA 3S17J 1TWAJ 1D5YA 1FJLA 1ERDA 2LYCA 1J75A 4ON0A 2UUZA 1CQTA 1ZLKA 1P4XA 3VOEA 4IRGA 2GA2A 3BR6A 3QU6A 1AHDP 1E3PA 5LBQA 3PSFA 3OYJA 2VQHA 5E3MA 1SEUA 1VQKI 3S1MJ 5C4JJ 2VOPA 3CCJI 2IGMA 1VQLI 2DI3A 3DP7A 5CVVA 2ME6A 4HF0A 3WE2A 1EV7A 1XMKA 4L5EA 2KRFA 3PQKA 3ABTA 2W84A 3LSGA 2QZ8A 2ELJA 2MABA 4PK4A 3BOQA 5D5UB 4F7ZA 3CMEI 4RS8A 4B44A 2JSPA 3GTJJ 4E70A 4WK8F 1Y8RB 3IWZA 4YFXF 5EG0B 4IEJA 1V5FA 2Y0SN 1BI2A 1WJEA 4LK1F 1TT5B 4F91B 3COAC 1VQ5I 3M1EA 1IXSB 3Q3SA 1OR7C 2HGCA 3ZP5A 2WB1A 1N78A 3FXJA 5AIPA 5M3MJ 3VYSB 3KEOA 4X1EA 2L02A 3H35A 2WAQA 4C2UA 1SMYF 1GUUA 3LSHA 2CS3A 2VLAA 3GZNB 2X0LA 2ZJRF 2JVGA 1E2XA 2LF7A 3KEQA 3BJOA 3ZMTA 3CMAI 2PI0A 2M8GX 2MSYA 2XDVA 3JR9A 2NRAC 1X1CA 1JJ6C 4QTRA 1DQUA 2AQEA 2VJ5A 2NNNA 2ZJQF 3V8LA 1TLHB 4DYRA 4MGRA 2HR3A 4PFOA 3F8BA 5GAHJ 3MKZA 1W7PD 2K4JA 2KIFA 2VE9A 4UUTA 3HXLA 1I5ZA 2GXGA 1H8AC 1X3ZB 2F2EA 2O8KA 3VSKA 3ZMDA 3BCBA 1K6OA 2DT6A 5H20A 5J6XA 2DYSH 5FKNA 4IQ4A 1R4NB 4EATA 3M1CA 2LTPA 4NNJA 1UMQA 2WA0A 3JW4A 3NWTA 3Q0WA 3CC7I 2XV4S 4KA4A 2O0YA 2ZMEB 4U88A 2MD0A 2A6EF 3WU2C 3LAJA 1ACIA 4I76A 3K10A 3ZMZA 3HJEA 2BV6A 2IP2A 2XAUA 2O6GE 1PP7U 2KHMA 3D1NI 1ZLJA 4NQWB 4A69C 3H5AA 1NHAA 1F9NA 2XAJA 4I0AA 4RGUA 2OQRA 1YW9A 3ZOBA 1Z0XA 5FFXA 4BAYA 2P6TA 2DK5A 3PJRA 4S04A 4LITA 1R5ID 2MBFA 4J00A 1U9NA 2FOKA 4PFPA 1WH7A 5F1RA 2CQQA 2VUMJ 1OR7A 2W25A 2K3PA 4JP0A 4M74A 2K5CA 3ZXSA 5H2FC 1YIOA 1STZA 4EJVA 2M5WA 1VZ0A 3H92A 2EFWA 1QQIA 1VF9A 2MA3A 3HKZN 2XKOA 4UXNA 3VYRB 1BC7C 3J7AY 1T95A 2HPMA 2HPIA 2OU2A 4HNUA 2DW4A 1D1CA 5LRRA 1NH3A 3CC2I 4M3FA 3BQZA 1R7JA 1BR1A 1D0ZA 3A1YA 4A0YA 1VQ9I 3HOYJ 1MJ9A 1K4TA 2AS5F 1ETOA 2ZKZA 1TQPA 1XGSA 2L9VA 3F6OA 3ZQIA 3SZPA 3FXKA 1EH6A 1OCRH 3ZQHA 4HV6A 4B3AA 4BNCA 5CVJA 1OYYA 4A2UA 2JN6A 1NK2P 5FGMA 3IH2A 4U0YA 1XTAA 2R7OA 4M3EA 1I6XA 4E7ZA 5K5OA 4MEXF 1ZHFA 1IDYA 3FWEA 1Y39A 1KYWA 5D4RA 2KT0A 4AD9A 2VB6A 4HYEA 3TOBA 4KUMA 1LQ1A 3MCZA 2CFOA 1RPWA 1Y56A 3PSIA 5L3CA 5JLWA 4L9VA 3TDUC 4WX9A 3OYDA 1T8IA 2C6YA 2V26A 1ETQA 2FNPA 2XHKA 3FISA 3MKYB 1NK3P 2EILH 2JPBA 1R4MB 3F3XA 3QAHA 3KP5A 4M71A 1DDNA 2LC2A 3MFKA 1LUJB 2R7RA 4XRMA 3HUGB 2FMLA 1UHMA 2DA7A 3KYLA 3WTXC 4FQGA 2AQFA 4XKWA 3I0TA 4R1HA 3T8RA 1REPC 4CHUA 3E6CC 4AVZA 1K78A 3DXJF 5FD5A 2BY1A 3I55I 1MNMC 2P6SA 1JKPC 4M3DA 2L7MP 3C7JA 1FT9A 2OBPA 3QWLA 3OYEA 4E7JA 1F4KA 5F1JA 4O6JA 2JUCA 5HNFA 2P4WA 4ESFA 2XSDC 1R9TJ 1JHFA 3CQZJ 4Y17A 1UFMA 5IP7J 2V1XA 3SFIA 5HVQC 4IOCF 3HRUA 2JZYA 2UWMA 3QPLA 4U7BA 4LFUA 3CUOA 4HDVA 1JHHA 1QZEA 2L7ZA 1X3UA 2WB1N 2Y69H 5D6FA 1RIOH 1GVJA 2VPRA 4LIVA 3FM3A 1U5TC 2WAQN 2VKVA 2CRGA 3IC7A 3WTZA 4JX6A 1XCVA 2LD5A 1BW6A 4M6XA 2XPWA 1QVUA 1VQ4I 1UJ8A 4FCYA 3CDIA 1JUPA 5E1ZB 3NARA 3CUQB 2CW7A 2VPLA 4R79A 3HM5A 2H09A 3JSOA 1XSVA 1X1DA 2E2JJ 2KIMA 4BBRJ 4PSXA 3SXYA 3R0JA 3ZR8X 1OQYA 3GYHX 3NEUA 1J0RA 1TTYA 1QZYA 3BR0A 4UB6C 2DMQA 1D5VA 3BP8A 2ICWG 3EPZA 3KCCA 1FLIA 4DOZA 2X9DA 5EGOA 3JCUC 1T38A 1RETA 2H6CA 2BBYA 2F6CA 4PJLA 2DT7B 1G3WA 2YX4A 3RPQA 4EM1A 3HEFA 4PDKA 5DEQA 4N4OB 2E5ZA 4N4NB 4G6TB 5E18F 1U5TB 3WU0A 1DPUA 4ZYGA 2DLLA 2RNGA 5ICFA 1YX5A 5JVGF 2NVYJ 3RZDJ 3BCAA 3E0JB 3AL0C 1IO2A 4YIRX 4MFDA 3DV8A 2UZKA 4B8XA 5CJ9A 5JHUA 3B6AA 2VONA 3H1CA 3BG3A 5LD2C 2G9WA 5FLVA 5HLIA 4XRSA 2K27A 1YX3A 2Z2SB 4IKFA 4Y33A 4HLYA 1YI2I 4BEHA 4A3FJ 3LSJA 4ZJZA 3G73A 1T6SA 5D8KB 2DOFA 2MH9A 3V42A 4V19K 2LMDA 3FX3A 3NRVA 3ML6A 3DBLB 2LSOA 2L4MA 3A02A 5ICGA 3P9IA 2UV1A 1YJ9I 1S72I 1Z67A 3HZJA 2YS9A 1MSEC 4Y13A 3H5RA 4YFNF 1U9OA 3ONQA 1GDTA 1QGPA 2L3DA 5D8LB 5D4SA 2V1UA 1MD0A 1WGXA 4LMYA 1N77A 2QQAA 2QA4I 2G7HA 3BZCA 2BW3A 3IH3A 3W2VA 3TMOA 2IS4A 1Y0UA 3HOUJ 2DK8A 4XLFA 3T1BA 5HLHA 2M7AA 5DM7F 4L18B 3U1DA 3NAUA 3DLLF 4XORA 2KPMA 1R1UA 1LNWA 4CYCA 1RR7A 1GV5A 2XAGA 1IW7F 3L7WA 1YQAA 1RNLA 2GAUA 4ENMA 4EJTA
chains in the Genus database with same CATH topology
4AVPA 4P9UA 3E5QA 2DPUA 3E6DA 2QWWA 2XRNA 2P7CB 1TNTA 5L3FA 5TJJA 1K79A 3KLNA 2MLKA 3GLXA 5FLXK 3RKXA 1W5TA 2M1BA 2F5DA 4CXFA 3LSTA 2VN2A 1ZG1A 1BIAA 3RKWA 1XGMA 2HEOA 4WXDA 1KQ9A 4YFKF 3K1PA 3V8JA 3WTWC 1GXPA 2L54A 3O3KA 5DUKA 1FP1D 2ISZA 3V8KA 4RGXA 2HZTA 4IVNA 5L3GA 2WV0A 1DP7P 2LF8A 3RTRA 2Z33A 4AIJA 2ISYA 3ISPA 3G3ZA 1O3RA 5LHGA 1MKMA 5DDGA 2V79A 3F6VA 3QU3A 1IN7A 2XGXA 2L01A 4HZFA 2DPDA 3HTUA 2YSRA 3PQJA 3V7SA 1Z91A 3TO7A 4WWCA 3SHFA 1Z6RA 2DFIA 4P96A 3JSPA 1Z9CA 3RDIA 1U8RA 3T0YA 2R3SA 2RGVA 5DD8A 2OQGA 2VBWA 1B1BA 2NYXA 4L9JA 3KP2A 2XAQA 2M8EA 1G4DA 2A6HF 1ZRCA 1W7PA 1O57A 2ZNZA 2OAZA 2EK5A 1J5YA 1Z1DA 4H0EA 1KGSA 4KYWA 3J80Z 1CF7B 3B02A 1HBXG 2HDCA 5EEGA 2XVCA 1WKMA 3HIFA 4XSXF 2PFBA 1R58A 3HSFA 1HSJA 4JK1X 1SFUA 2KJBA 1SD5A 5FD6A 3ZPLA 2EV6A 4RGSA 4I98B 2F5CA 3FMQA 4EM2A 1ZGJA 1YLFA 1KU9A 3J81K 3E5XA 1TNSA 2Q8KA 1XMAA 4FX0A 3K9TA 1FP2A 3SZTA 1BBYA 4I02A 2GIVA 2V1DA 1T0FA 3Q5FA 1SAXA 1I27A 1FOKA 5DV5A 3JAMK 5IT9Z 1XGNA 3KFWX 4BHBA 3KP3A 2FSWA 3GFMA 2E1NA 6PAXA 4GYIA 4JBAA 1XSXA 4Z2YA 3HSEA 3D5LA 1YS7A 4KNYA 1HW5A 1ZRDA 4WCGA 4PGGA 3K69A 2XKPA 1YS6A 4UNOA 3D0SA 3JTHA 2ESHA 3TOAA 2HYGD 5J8FA 4U7DA 1DPRA 1R5HA 5K5QA 1IXRC 2HTSA 2DBBA 2JTVA 4UV8A 4A5NA 1S6LA 3RPUA 2VC1A 4HA8A 4GYGA 2E7WA 4LG0B 4O5VA 1ZRFA 5ILUA 4KICA 2Y75A 3HRMA 2IA1A 4M9XA 4IF4A 1LEBA 1LDKB 4G7OF 4ZZDA 4EGYA 3FXQA 5LGNA 3FF5A 1D8JA 3BY6A 4U0WA 1MJBA 2VBXA 3F23A 4L9TA 4AIHA 3QPTA 5LLQA 2K7LA 3L09A 3ZN1A 1U78A 2O61A 2FBIA 4LLGF 5LEKA 2R7FA 2Y0MA 2NNYA 3W6KB 4LGWA 2HOEA 2FXAA 2GXBA 4AWXB 2JRTA 4ZZLA 3K2ZA 3TGNA 2X4HA 5BPDA 4BH9A 3KE2A 4HV5A 1SD4A 1WI9A 1USSA 3HHHA 3F8CA 4HBLA 1HXDA 4M6YA 5LEJA 2VBYA 5LHHA 1P4WA 1GXQA 2FQ3A 4BQAA 3TKYA 3ZMSA 2ZMEA 4M9SA 3CO6C 2BYVE 3H3UA 1BOAA 4MTEA 2FEZA 4Q47A 2A68F 2W85A 3CJNA 2F5EA 4NQWA 1QPMA 1KYZA 2RNJA 1LDJA 3QRFF 1U6GA 3F8MA 5H6QA 3H3ZA 4HQMA 1FX7A 3HRTA 4UVCA 3BDDA 5CVIA 5LGTA 4WF2A 4K2EA 1B6AA 2R7DA 1RUNA 4HX7A 2KIUA 2NAZA 3IRQA 3KZYA 4CYDA 1S7AA 3F8NA 3HHGA 3L9FA 2VE8A 3CUQC 4S05A 1YYVA 3E3VA 3VEPA 3LA2A 4HX4A 2OZUA 4WXCA 4UHTA 1Z05A 3K1NA 1LDDA 1PUEE 3QP6A 2FE3A 2EV5A 2FMYA 2EWNA 1UB9A 4RB1A 5F6FA 2PBIA 1JXSA 3HUGA 2Y48A 2QENA 1MGTA 1IN8A 1FBUA 1TQMA 2D1HA 2ZO4A 1G6NA 1IN6A 3E97A 3F21A 3WGHA 4FT8A 1WSUA 4KT5C 3K0LA 1IRFA 5D6EA 4MQVA 3WTTC 2FBKA 3GFIA 1OYWA 5FB2A 4ESJA 4XRFA 2B0LA 1AOYA 2M45A 1Z6TA 4YIIA 3GUDA 2ZCWA 5HS9A 1FYLA 4OIRF 3FXRA 1IN5A 1FNNA 2ZXJA 3WGGA 5HOOA 4DQ2A 1KQ8A 1HQCA 2F5FA 4MTDA 4L5JA 2DT5A 2XAHA 1R22A 3CUQA 4LJZF 5F64A 1BN5A 3LAPA 1G3YA 1B4AA 2FF4A 2CFXA 1FZPB 1R5GA 3ABUA 2VT2A 1FYMA 1ULYA 4KN4X 3FMSA 1HW2A 3CO7C 3K1MA 5E20A 1U3EM 1SFXA 2LDUA 1U5TA 1KU3A 2PEXA 3WTVC 3W6JB 1WWXA 3O6BB 2XASA 2IVMA 3MZHA 5CVRA 2RKHA 4MNUA 1SMTA 2OA4A 4PCQA 2HWVA 1HSTA 1A04A 4EJUA 1LB2A 2G7UA 5D5WB 3F8FA 4EMSA 4LB6B 3WGIA 3V7CA 3IHUA 3FHZA 2QQ9A 3ERED 2DU9A 4OIPF 2P7VB 2XUBA 5DD4A 4IPAA 4EM0B 3GEZA 4G7ZF 3WODF 2LNBA 4WXHA 1YW7A 1B9MA 3R60A 1G3SA 3R4KA 2AXLA 1ZG3A 2A69F 2PMHA 1BM9A 4I0BA 5FFZA 1E17A 1JE8A 2L4AA 2W24A 2QUFA 2V6CA 3EUHA 4ZYHA 1SD7A 3I59B 4OINF 1R23A 1F1ZA 5D5XB 1G3TA 4IRHA 4A5MA 5K5RA 3ZQ7A 2EFQA 2O3FA 4N0BA 4BYYA 3GZ5A 5DYMA 1PDNC 3ZMUA 2K4BA 1I1GA 5CVUA 2JPCA 3GFJA 1ONVA 2CGPA 4Q48A 1LVAA 3ZN0A 3LQRA 5HDGA 1OPCA 1ZAOA 3IRRA 3TO9A 2DQRA 3WTSC 3RI4A 1J59A 1ZN2A 2EFPA 3DPTA 1D3YA 5HDNA 1P92A 2VOOA 3KETA 2P5VA 4RB3C 3M9AA 3I5UA 4ESBA 4LLNA 4OMYA 4D0PA 2A3SA 5L3EA 4I7HA 3F72A 4OIQF 1OKRA 3HYIA 2KJCA 4JQFA 4FX4A 3WU1B 1JGSA 2ZJ2A 1WRJA 3DF8A 3WTUC 1V3FA 3GF2A 1ZG5A 2IW5A 4EJWA 4DNCA 3BJ6A 1L3LA 4YIFA 2CSOA 4MEYF 2DTRA 3I4PA 1FYKA 2DAOA 2EA4A 2JSCA 1TBXA 3GFLA 5JI6A 1KU2A 5DCMB 2HKXA 1BC8C 4KIBA 4CO8A 1MDMB 4HF2A 1TQIA 5EEHA 1CGPA 1YFHA 1MJAA 1XD7A 1BIBA 4A12A 3KP6A 4KFCA 3QP5A 3U2RA 1O3QA 2QBYB 2MD5A 2Z9OA 1HW1A 3O2PE 1DUXC 2ELHA 3RIRA 2BE5F 1SD6A 4Q4ZF 4XBFA 1R1TA 1YO5C 3MEXA 1S29A 2PLYA 1BI3A 2O8XA 3TQNA 1O7LA 3CLOA 2YU3A 4M9ZA 1CF7A 3L2CA 4RAYA 4BHPA 1SFEA 5FO5A 2RN7A 2QBYA 4P9FA 3IL2A 2IA0A 4HF1A 3BROA 2DO7A 2Z99A 4A6EA 4RGRA 5E8IA 1O7FA 5JR3A 3I71A 1XCBA 2EB7A 3GO5A 1K7AA 3IWFA 4IHSA 4G8XA 2QM3A 4MQ9F 1IRGA 3MAJA 3Q9SA 3IKVA 4A0XA 4KIFA 4ASNA 3JTGA 1H0MA 3HSRA 2QQBA 5CYVA 1FBQA 2XIGA 4HOBA 1FPQA 4QWQA 1H9TA 4IRIA 4U0VA 2UXNA 1KQ0A 3N97A 4GCVA 4IXAA 4KMUX 3RKYA 3WE3A 1Z7UA 3WG9A 4G6DA 2HYFA 2WC2A 5BMZA 1OYIA 1GHCA 2GWRA 2QVOA 3VB2A 1QZZA 4LK0F 3FZVA 4LG0A 1UHWA 4NB5A 1IF1A 4KMFA 1WQ2A 4KIGA 2RC4A 3R0AA 5K1YA 1HKSA 1IAWA 3FM5A 2D2WA 3MZYA 5ICEA 2RQPA 3WTYC 5KVRA 3GVAA 1XDUA 4EQQA 2YX7A 2PG4A 1YG2A 5BS6A 3GWZA 4IJAA 5LGUA 1FSEA 2YPRA 1ZARA 4HX8A 1ON2A 2HTJA 2VC0A 1XN7A 3EDPA 2MLGA 1U2WA 2D1VA 5BQTA 2EJRA 1Q1HA 2EFOA 3C18A 3HOTA 3REOA 4P55A 3Q9VA 4UUVA 5H6RA 4ZYDA 2M87A 3FXUA 4ENJA 3SFZA 4HDUA 2LKPA 4L5IA 3DEUA 3LA3A 4Q5SF 3HOSA 1H9GA 1LJ9A 4PZJA 2H27A 3EETA 4OOIA 3HRSA 5FLXZ 5ILSA 1TW3A 5ERIA 5L3BA 2FBHA 2Z5UA 3GZ6A 2MC3A 3P9CA 1B59A 4ZH4F 2A5YB 3RYPA 1BI0A 2VXZA 4OIOF 1XSDA 1MZBA 1ON1A 4O3MA 3J80K 5AONA 4KN7X 4EJOA 2PJPA 3HTSB 3BPVA 2ZFWA 3M7GA 1YW8A 3T5XA 5TRDA 3EYYA 5L3DA 2XAFA 1LEAA 4I2OA 1KU7A 3M8FA 2XROA 2JT1A 2RV8A 1K78B 3DKWA 2QLZA 1HKTA 1D8KA 4RB0A 5J8CA 3DFGA 2J5OA 2RDPA 3ROUA 1P4AA 3C1DA 1FC3A 2QYOA 2VODA 5A2QZ 3DQVC 4I01A 4YG2F 2EFNA 2V9VA 3VFZA 1ZGAA 4FHTA 4LLLA 2WWYA 2K86A 5IT9K 4TV7A 2Z3YA 5BPIA 3MWMA 5ILVA 2IPQX 4N9HA 4PGHA 4XSZF 3LWFA 2OD5A 2CYYA 2ADUA 2IT0A 1TW2A 1S3JA 2CW0F 2HQRA 3R6SA 3VODA 2STWA 3B73A 3M8EA 4G6QA 4I09A 3MQ0A 3J7AO 2W57A 3I54A 2P5KA 5HLGA 5E17F 4EGZA 1R1VA 2HFHA 4CZZA 3EYIA 1QBJA 1UCRA 3OOPA 1FBSA 1ZH5A 4M72A 3ZMVA 2ACJA 2Q2EA 5E1XA 1KA8A 1I1SA 2TDXA 4L9NA 2MH2A 4L0YB 2M30A 3KZZA 3C3WA 4ENKA 3J81Z 1RUOA 2PN6A 4GGGA 3I58A 2OZ6A 1FWZA 3E6MA 4L0ZB 4Y15A 3GXOA 1J7KA 1USTA 4LB5A 4RAZA 1EH7A 2YR2A 3R61A 3LQQA 2PMUA 4HLXA 5BOXA 3LFKA 4HAMA 5E1WA 3JAMZ 3P9KA 4G9YA 2K02A 2CQKA 2Q0OA 4M73A 1HKQA 4UVBA 3KP7A 4A0ZA 5HS7A 1XB4A 2FRHA 4UVAA 3I64A 3ECHA 1P2FA 3QOPA 3KLOA 4P5OA 3IKTA 3OV8A 3ELKA 2UXXA 4UV9A 3E6BA 4RB2C 5DCFA 2HKOA 4XLPF 2O03A 2WTEA 2H94A 3BWGA 2FU4A 2HS5A 4G7HF 4HW0A 3T8TA 2CG4A 3GW2A 4NHJA 1FY7A 3I59A 3BJAA 2IA2A 3U9GA 2ZBKA 1J9IA 5JVTA 5DUIA 2DQLA 2P8TA 1L0OC 4EV0A 3KP4A 4OU0A 1O3TA 2CWEA 2BEOA 3AAFA 3V4GA 3FMRA 2PQ8A 4G94A 4CICA 3SQNA 5CLSA 3S2WA 2EA2A 3I53A 1ZYRF 5JFRA 5A2QK 2E1CA 1T2KA 2ETHA 1R00A 2COMA 1T98A 2GA1A 3E5UA 5AIQA 1W7PB 2D45A 1AWCA 1VTNC 1QO0D 2A07F 3DPLC 2HQNA 5ED4A 2H6BA 2GZWA 3GX4X 3P7NA 1V4RA 1W4MA 3QPHA 2J5PA 4LD5A 1P6RA 4CGZA 3V7RA 1RZ4A 3ULQB 4KDPA 4GO1A 5IT3A 5HDKA 1IUYA 1R36A 1EH8A 4OMZA 4BHCA 5DCMA 5KK1A 4ZYEA 3ECOA 2P5LC 4HQEA 1BJAA 2VBZA 1B9NA 3TO6A 1OMIA 1ZREA 1MDMA 1IZ1A 2E7XA 1T39A 3CDHA 4N9IA 3CTAA 1YTYA 3BPXA 2IJLA 4AIKA 1W5SA 4B09A 3TDZC 3BZ6A 1C0WA 2ZNYA 3F22A 3NQOA 4GXOA 4ETSA 2VT3A 1F5TA 2STTA 1IXCA 5HS8A 1BI1A 3L00A 4ENNA 4A6DA 2FNAA 5LHIA 4XLNF 4CDGA 1RI7A 4QLCU 5LRSA 2KKOA 4BXUA 4EVIA 3PFIA 2GQQA 4R8HA 5ICCA 1S7OA 2NS0A 1XGOA 2IRFG 5E8GA 1ODDA 1J2XA 2RVCA 1O3SA 2A61A 1FSHA 4IHTA 2ESNA 3N4MA 3EQLF 1IN4A 2BGCA 5D5VB 3RJPA 2EV0A 4MHGA 2FA5A 3RYRA 3LA7A 1QNTA 2CO5A 1PP8F 1XDSA 1S8NA 1J75A 4ON0A 1ZLKA 1P4XA 3VOEA 4IRGA 2GA2A 3QU6A 5LBQA 2VOPA 2DI3A 3DP7A 5CVVA 4HF0A 3WE2A 1EV7A 1XMKA 2KRFA 3PQKA 3ABTA 2W84A 2QZ8A 3BOQA 5D5UB 4F7ZA 4RS8A 4E70A 4WK8F 3IWZA 4YFXF 1BI2A 4LK1F 3COAC 3M1EA 1IXSB 2HGCA 3ZP5A 5AIPA 3KEOA 2L02A 1SMYF 2X0LA 1E2XA 2LF7A 3KEQA 3BJOA 3ZMTA 2PI0A 2NRAC 2NNNA 3V8LA 1TLHB 4MGRA 2HR3A 3F8BA 1W7PD 2K4JA 2KIFA 2VE9A 1I5ZA 2GXGA 2F2EA 3ZMDA 1K6OA 5H20A 5J6XA 3JW4A 2XV4S 4KA4A 2O0YA 2ZMEB 4U88A 2A6EF 3LAJA 3ZMZA 2BV6A 2IP2A 2O6GE 1PP7U 1ZLJA 1NHAA 1F9NA 2XAJA 4I0AA 4RGUA 2OQRA 1YW9A 5FFXA 4BAYA 2P6TA 2DK5A 4S04A 2MBFA 2FOKA 5F1RA 1OR7A 2W25A 4M74A 1YIOA 1STZA 4EJVA 2M5WA 3H92A 2EFWA 1QQIA 2MA3A 2XKOA 4UXNA 1BC7C 2OU2A 2DW4A 5LRRA 1R7JA 4A0YA 1MJ9A 2AS5F 2ZKZA 1TQPA 1XGSA 3F6OA 3SZPA 1EH6A 4HV6A 4BNCA 5CVJA 1OYYA 4A2UA 5FGMA 4U0YA 1I6XA 4MEXF 5K5OA 1ZHFA 3FWEA 1KYWA 5D4RA 4AD9A 1LQ1A 3TOBA 4HYEA 4KUMA 3MCZA 5L3CA 4L9VA 3TDUC 4WX9A 2C6YA 2FNPA 2XHKA 2JPBA 3F3XA 3QAHA 1DDNA 3KP5A 4M71A 3MFKA 2FMLA 1UHMA 3WTXC 3I0TA 4R1HA 3T8RA 1REPC 4CHUA 3E6CC 1K78A 3DXJF 5FD5A 2P6SA 3C7JA 1FT9A 2OBPA 1F4KA 4O6JA 2P4WA 4ESFA 1JHFA 4Y17A 1UFMA 2V1XA 5HVQC 3HRUA 2JZYA 2UWMA 4U7BA 4LFUA 3CUOA 4HDVA 1JHHA 1X3UA 5D6FA 1RIOH 1GVJA 3FM3A 1U5TC 3IC7A 3WTZA 1XCVA 4M6XA 5E1ZB 3CUQB 4R79A 2H09A 3JSOA 1XSVA 2KIMA 3GYHX 3SXYA 3R0JA 3NEUA 1J0RA 1TTYA 1QZYA 1D5VA 3BP8A 3KCCA 1FLIA 1T38A 2H6CA 2BBYA 1G3WA 2YX4A 3RPQA 4EM1A 4PDKA 5DEQA 1DPUA 5E18F 1U5TB 3WU0A 4ZYGA 2DLLA 5ICFA 3DV8A 2UZKA 4B8XA 5CJ9A 5JHUA 2VONA 2G9WA 5HLIA 2K27A 4HLYA 3G73A 1T6SA 5D8KB 2MH9A 3FX3A 3NRVA 3ML6A 2LSOA 2L4MA 5ICGA 3P9IA 4Y13A 4YFNF 1QGPA 2L3DA 5D8LB 5D4SA 2V1UA 1MD0A 4LMYA 2QQAA 2G7HA 1Y0UA 2DK8A 3T1BA 5HLHA 4L18B 3U1DA 1R1UA 1LNWA 2XAGA 1IW7F 3L7WA 1YQAA 1RNLA 2GAUA 4ENMA 4EJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVP A;  4P9U A;  3E5Q A;  2DPU A;  3E6D A;  2QWW A;  2XRN A;  2P7C B;  1TNT A;  5L3F A;  5TJJ A;  1K79 A;  3KLN A;  2MLK A;  3GLX A;  5FLX K;  3RKX A;  1W5T A;  2M1B A;  2F5D A;  4CXF A;  3LST A;  2VN2 A;  1ZG1 A;  1BIA A;  3RKW A;  1XGM A;  2HEO A;  4WXD A;  1KQ9 A;  4YFK F;  3K1P A;  3V8J A;  3WTW C;  1GXP A;  2L54 A;  3O3K A;  5DUK A;  1FP1 D;  2ISZ A;  3V8K A;  4RGX A;  2HZT A;  4IVN A;  5L3G A;  2WV0 A;  1DP7 P;  2LF8 A;  3RTR A;  2Z33 A;  4AIJ A;  2ISY A;  3ISP A;  3G3Z A;  1O3R A;  5LHG A;  1MKM A;  5DDG A;  2V79 A;  3F6V A;  3QU3 A;  1IN7 A;  2XGX A;  2L01 A;  4HZF A;  2DPD A;  3HTU A;  2YSR A;  3PQJ A;  3V7S A;  1Z91 A;  3TO7 A;  4WWC A;  3SHF A;  1Z6R A;  2DFI A;  4P96 A;  3JSP A;  1Z9C A;  3RDI A;  1U8R A;  3T0Y A;  2R3S A;  2RGV A;  5DD8 A;  2OQG A;  2VBW A;  1B1B A;  2NYX A;  4L9J A;  3KP2 A;  2XAQ A;  2M8E A;  1G4D A;  2A6H F;  1ZRC A;  1W7P A;  1O57 A;  2ZNZ A;  2OAZ A;  2EK5 A;  1J5Y A;  1Z1D A;  4H0E A;  1KGS A;  4KYW A;  3J80 Z;  1CF7 B;  3B02 A;  1HBX G;  2HDC A;  5EEG A;  2XVC A;  1WKM A;  3HIF A;  4XSX F;  2PFB A;  1R58 A;  3HSF A;  1HSJ A;  4JK1 X;  1SFU A;  2KJB A;  1SD5 A;  5FD6 A;  3ZPL A;  2EV6 A;  4RGS A;  4I98 B;  2F5C A;  3FMQ A;  4EM2 A;  1ZGJ A;  1YLF A;  1KU9 A;  3J81 K;  3E5X A;  1TNS A;  2Q8K A;  1XMA A;  4FX0 A;  3K9T A;  1FP2 A;  3SZT A;  1BBY A;  4I02 A;  2GIV A;  2V1D A;  1T0F A;  3Q5F A;  1SAX A;  1I27 A;  1FOK A;  5DV5 A;  3JAM K;  5IT9 Z;  1XGN A;  3KFW X;  4BHB A;  3KP3 A;  2FSW A;  3GFM A;  2E1N A;  6PAX A;  4GYI A;  4JBA A;  1XSX A;  4Z2Y A;  3HSE A;  3D5L A;  1YS7 A;  4KNY A;  1HW5 A;  1ZRD A;  4WCG A;  4PGG A;  3K69 A;  2XKP A;  1YS6 A;  4UNO A;  3D0S A;  3JTH A;  2ESH A;  3TOA A;  2HYG D;  5J8F A;  4U7D A;  1DPR A;  1R5H A;  5K5Q A;  1IXR C;  2HTS A;  2DBB A;  2JTV A;  4UV8 A;  4A5N A;  1S6L A;  3RPU A;  2VC1 A;  4HA8 A;  4GYG A;  2E7W A;  4LG0 B;  4O5V A;  1ZRF A;  5ILU A;  4KIC A;  2Y75 A;  3HRM A;  2IA1 A;  4M9X A;  4IF4 A;  1LEB A;  1LDK B;  4G7O F;  4ZZD A;  4EGY A;  3FXQ A;  5LGN A;  3FF5 A;  1D8J A;  3BY6 A;  4U0W A;  1MJB A;  2VBX A;  3F23 A;  4L9T A;  4AIH A;  3QPT A;  5LLQ A;  2K7L A;  3L09 A;  3ZN1 A;  1U78 A;  2O61 A;  2FBI A;  4LLG F;  5LEK A;  2R7F A;  2Y0M A;  2NNY A;  3W6K B;  4LGW A;  2HOE A;  2FXA A;  2GXB A;  4AWX B;  2JRT A;  4ZZL A;  3K2Z A;  3TGN A;  2X4H A;  5BPD A;  4BH9 A;  3KE2 A;  4HV5 A;  1SD4 A;  1WI9 A;  1USS A;  3HHH A;  3F8C A;  4HBL A;  1HXD A;  4M6Y A;  5LEJ A;  2VBY A;  5LHH A;  1P4W A;  1GXQ A;  2FQ3 A;  4BQA A;  3TKY A;  3ZMS A;  2ZME A;  4M9S A;  3CO6 C;  2BYV E;  3H3U A;  1BOA A;  4MTE A;  2FEZ A;  4Q47 A;  2A68 F;  2W85 A;  3CJN A;  2F5E A;  4NQW A;  1QPM A;  1KYZ A;  2RNJ A;  1LDJ A;  3QRF F;  1U6G A;  3F8M A;  5H6Q A;  3H3Z A;  4HQM A;  1FX7 A;  3HRT A;  4UVC A;  3BDD A;  5CVI A;  5LGT A;  4WF2 A;  4K2E A;  1B6A A;  2R7D A;  1RUN A;  4HX7 A;  2KIU A;  2NAZ A;  3IRQ A;  3KZY A;  4CYD A;  1S7A A;  3F8N A;  3HHG A;  3L9F A;  2VE8 A;  3CUQ C;  4S05 A;  1YYV A;  3E3V A;  3VEP A;  3LA2 A;  4HX4 A;  2OZU A;  4WXC A;  4UHT A;  1Z05 A;  3K1N A;  1LDD A;  1PUE E;  3QP6 A;  2FE3 A;  2EV5 A;  2FMY A;  2EWN A;  1UB9 A;  4RB1 A;  5F6F A;  2PBI A;  1JXS A;  3HUG A;  2Y48 A;  2QEN A;  1MGT A;  1IN8 A;  1FBU A;  1TQM A;  2D1H A;  2ZO4 A;  1G6N A;  1IN6 A;  3E97 A;  3F21 A;  3WGH A;  4FT8 A;  1WSU A;  4KT5 C;  3K0L A;  1IRF A;  5D6E A;  4MQV A;  3WTT C;  2FBK A;  3GFI A;  1OYW A;  5FB2 A;  4ESJ A;  4XRF A;  2B0L A;  1AOY A;  2M45 A;  1Z6T A;  4YII A;  3GUD A;  2ZCW A;  5HS9 A;  1FYL A;  4OIR F;  3FXR A;  1IN5 A;  1FNN A;  2ZXJ A;  3WGG A;  5HOO A;  4DQ2 A;  1KQ8 A;  1HQC A;  2F5F A;  4MTD A;  4L5J A;  2DT5 A;  2XAH A;  1R22 A;  3CUQ A;  4LJZ F;  5F64 A;  1BN5 A;  3LAP A;  1G3Y A;  1B4A A;  2FF4 A;  2CFX A;  1FZP B;  1R5G A;  3ABU A;  2VT2 A;  1FYM A;  1ULY A;  4KN4 X;  3FMS A;  1HW2 A;  3CO7 C;  3K1M A;  5E20 A;  1U3E M;  1SFX A;  2LDU A;  1U5T A;  1KU3 A;  2PEX A;  3WTV C;  3W6J B;  1WWX A;  3O6B B;  2XAS A;  2IVM A;  3MZH A;  5CVR A;  2RKH A;  4MNU A;  1SMT A;  2OA4 A;  4PCQ A;  2HWV A;  1HST A;  1A04 A;  4EJU A;  1LB2 A;  2G7U A;  5D5W B;  3F8F A;  4EMS A;  4LB6 B;  3WGI A;  3V7C A;  3IHU A;  3FHZ A;  2QQ9 A;  3ERE D;  2DU9 A;  4OIP F;  2P7V B;  2XUB A;  5DD4 A;  4IPA A;  4EM0 B;  3GEZ A;  4G7Z F;  3WOD F;  2LNB A;  4WXH A;  1YW7 A;  1B9M A;  3R60 A;  1G3S A;  3R4K A;  2AXL A;  1ZG3 A;  2A69 F;  2PMH A;  1BM9 A;  4I0B A;  5FFZ A;  1E17 A;  1JE8 A;  2L4A A;  2W24 A;  2QUF A;  2V6C A;  3EUH A;  4ZYH A;  1SD7 A;  3I59 B;  4OIN F;  1R23 A;  1F1Z A;  5D5X B;  1G3T A;  4IRH A;  4A5M A;  5K5R A;  3ZQ7 A;  2EFQ A;  2O3F A;  4N0B A;  4BYY A;  3GZ5 A;  5DYM A;  1PDN C;  3ZMU A;  2K4B A;  1I1G A;  5CVU A;  2JPC A;  3GFJ A;  1ONV A;  2CGP A;  4Q48 A;  1LVA A;  3ZN0 A;  3LQR A;  5HDG A;  1OPC A;  1ZAO A;  3IRR A;  3TO9 A;  2DQR A;  3WTS C;  3RI4 A;  1J59 A;  1ZN2 A;  2EFP A;  3DPT A;  1D3Y A;  5HDN A;  1P92 A;  2VOO A;  3KET A;  2P5V A;  4RB3 C;  3M9A A;  3I5U A;  4ESB A;  4LLN A;  4OMY A;  4D0P A;  2A3S A;  5L3E A;  4I7H A;  3F72 A;  4OIQ F;  1OKR A;  3HYI A;  2KJC A;  4JQF A;  4FX4 A;  3WU1 B;  1JGS A;  2ZJ2 A;  1WRJ A;  3DF8 A;  3WTU C;  1V3F A;  3GF2 A;  1ZG5 A;  2IW5 A;  4EJW A;  4DNC A;  3BJ6 A;  1L3L A;  4YIF A;  2CSO A;  4MEY F;  2DTR A;  3I4P A;  1FYK A;  2DAO A;  2EA4 A;  2JSC A;  1TBX A;  3GFL A;  5JI6 A;  1KU2 A;  5DCM B;  2HKX A;  1BC8 C;  4KIB A;  4CO8 A;  1MDM B;  4HF2 A;  1TQI A;  5EEH A;  1CGP A;  1YFH A;  1MJA A;  1XD7 A;  1BIB A;  4A12 A;  3KP6 A;  4KFC A;  3QP5 A;  3U2R A;  1O3Q A;  2QBY B;  2MD5 A;  2Z9O A;  1HW1 A;  3O2P E;  1DUX C;  2ELH A;  3RIR A;  2BE5 F;  1SD6 A;  4Q4Z F;  4XBF A;  1R1T A;  1YO5 C;  3MEX A;  1S29 A;  2PLY A;  1BI3 A;  2O8X A;  3TQN A;  1O7L A;  3CLO A;  2YU3 A;  4M9Z A;  1CF7 A;  3L2C A;  4RAY A;  4BHP A;  1SFE A;  5FO5 A;  2RN7 A;  2QBY A;  4P9F A;  3IL2 A;  2IA0 A;  4HF1 A;  3BRO A;  2DO7 A;  2Z99 A;  4A6E A;  4RGR A;  5E8I A;  1O7F A;  5JR3 A;  3I71 A;  1XCB A;  2EB7 A;  3GO5 A;  1K7A A;  3IWF A;  4IHS A;  4G8X A;  2QM3 A;  4MQ9 F;  1IRG A;  3MAJ A;  3Q9S A;  3IKV A;  4A0X A;  4KIF A;  4ASN A;  3JTG A;  1H0M A;  3HSR A;  2QQB A;  5CYV A;  1FBQ A;  2XIG A;  4HOB A;  1FPQ A;  4QWQ A;  1H9T A;  4IRI A;  4U0V A;  2UXN A;  1KQ0 A;  3N97 A;  4GCV A;  4IXA A;  4KMU X;  3RKY A;  3WE3 A;  1Z7U A;  3WG9 A;  4G6D A;  2HYF A;  2WC2 A;  5BMZ A;  1OYI A;  1GHC A;  2GWR A;  2QVO A;  3VB2 A;  1QZZ A;  4LK0 F;  3FZV A;  4LG0 A;  1UHW A;  4NB5 A;  1IF1 A;  4KMF A;  1WQ2 A;  4KIG A;  2RC4 A;  3R0A A;  5K1Y A;  1HKS A;  1IAW A;  3FM5 A;  2D2W A;  3MZY A;  5ICE A;  2RQP A;  3WTY C;  5KVR A;  3GVA A;  1XDU A;  4EQQ A;  2YX7 A;  2PG4 A;  1YG2 A;  5BS6 A;  3GWZ A;  4IJA A;  5LGU A;  1FSE A;  2YPR A;  1ZAR A;  4HX8 A;  1ON2 A;  2HTJ A;  2VC0 A;  1XN7 A;  3EDP A;  2MLG A;  1U2W A;  2D1V A;  5BQT A;  2EJR A;  1Q1H A;  2EFO A;  3C18 A;  3HOT A;  3REO A;  4P55 A;  3Q9V A;  4UUV A;  5H6R A;  4ZYD A;  2M87 A;  3FXU A;  4ENJ A;  3SFZ A;  4HDU A;  2LKP A;  4L5I A;  3DEU A;  3LA3 A;  4Q5S F;  3HOS A;  1H9G A;  1LJ9 A;  4PZJ A;  2H27 A;  3EET A;  4OOI A;  3HRS A;  5FLX Z;  5ILS A;  1TW3 A;  5ERI A;  5L3B A;  2FBH A;  2Z5U A;  3GZ6 A;  2MC3 A;  3P9C A;  1B59 A;  4ZH4 F;  2A5Y B;  3RYP A;  1BI0 A;  2VXZ A;  4OIO F;  1XSD A;  1MZB A;  1ON1 A;  4O3M A;  3J80 K;  5AON A;  4KN7 X;  4EJO A;  2PJP A;  3HTS B;  3BPV A;  2ZFW A;  3M7G A;  1YW8 A;  3T5X A;  5TRD A;  3EYY A;  5L3D A;  2XAF A;  1LEA A;  4I2O A;  1KU7 A;  3M8F A;  2XRO A;  2JT1 A;  2RV8 A;  1K78 B;  3DKW A;  2QLZ A;  1HKT A;  1D8K A;  4RB0 A;  5J8C A;  3DFG A;  2J5O A;  2RDP A;  3ROU A;  1P4A A;  3C1D A;  1FC3 A;  2QYO A;  2VOD A;  5A2Q Z;  3DQV C;  4I01 A;  4YG2 F;  2EFN A;  2V9V A;  3VFZ A;  1ZGA A;  4FHT A;  4LLL A;  2WWY A;  2K86 A;  5IT9 K;  4TV7 A;  2Z3Y A;  5BPI A;  3MWM A;  5ILV A;  2IPQ X;  4N9H A;  4PGH A;  4XSZ F;  3LWF A;  2OD5 A;  2CYY A;  2ADU A;  2IT0 A;  1TW2 A;  1S3J A;  2CW0 F;  2HQR A;  3R6S A;  3VOD A;  2STW A;  3B73 A;  3M8E A;  4G6Q A;  4I09 A;  3MQ0 A;  3J7A O;  2W57 A;  3I54 A;  2P5K A;  5HLG A;  5E17 F;  4EGZ A;  1R1V A;  2HFH A;  4CZZ A;  3EYI A;  1QBJ A;  1UCR A;  3OOP A;  1FBS A;  1ZH5 A;  4M72 A;  3ZMV A;  2ACJ A;  2Q2E A;  5E1X A;  1KA8 A;  1I1S A;  2TDX A;  4L9N A;  2MH2 A;  4L0Y B;  2M30 A;  3KZZ A;  3C3W A;  4ENK A;  3J81 Z;  1RUO A;  2PN6 A;  4GGG A;  3I58 A;  2OZ6 A;  1FWZ A;  3E6M A;  4L0Z B;  4Y15 A;  3GXO A;  1J7K A;  1UST A;  4LB5 A;  4RAZ A;  1EH7 A;  2YR2 A;  3R61 A;  3LQQ A;  2PMU A;  4HLX A;  5BOX A;  3LFK A;  4HAM A;  5E1W A;  3JAM Z;  3P9K A;  4G9Y A;  2K02 A;  2CQK A;  2Q0O A;  4M73 A;  1HKQ A;  4UVB A;  3KP7 A;  4A0Z A;  5HS7 A;  1XB4 A;  2FRH A;  4UVA A;  3I64 A;  3ECH A;  1P2F A;  3QOP A;  3KLO A;  4P5O A;  3IKT A;  3OV8 A;  3ELK A;  2UXX A;  4UV9 A;  3E6B A;  4RB2 C;  5DCF A;  2HKO A;  4XLP F;  2O03 A;  2WTE A;  2H94 A;  3BWG A;  2FU4 A;  2HS5 A;  4G7H F;  4HW0 A;  3T8T A;  2CG4 A;  3GW2 A;  4NHJ A;  1FY7 A;  3I59 A;  3BJA A;  2IA2 A;  3U9G A;  2ZBK A;  1J9I A;  5JVT A;  5DUI A;  2DQL A;  2P8T A;  1L0O C;  4EV0 A;  3KP4 A;  4OU0 A;  1O3T A;  2CWE A;  2BEO A;  3AAF A;  3V4G A;  3FMR A;  2PQ8 A;  4G94 A;  4CIC A;  3SQN A;  5CLS A;  3S2W A;  2EA2 A;  3I53 A;  1ZYR F;  5JFR A;  5A2Q K;  2E1C A;  1T2K A;  2ETH A;  1R00 A;  2COM A;  1T98 A;  2GA1 A;  3E5U A;  5AIQ A;  1W7P B;  2D45 A;  1AWC A;  1VTN C;  1QO0 D;  2A07 F;  3DPL C;  2HQN A;  5ED4 A;  2H6B A;  2GZW A;  3GX4 X;  3P7N A;  1V4R A;  1W4M A;  3QPH A;  2J5P A;  4LD5 A;  1P6R A;  4CGZ A;  3V7R A;  1RZ4 A;  3ULQ B;  4KDP A;  4GO1 A;  5IT3 A;  5HDK A;  1IUY A;  1R36 A;  1EH8 A;  4OMZ A;  4BHC A;  5DCM A;  5KK1 A;  4ZYE A;  3ECO A;  2P5L C;  4HQE A;  1BJA A;  2VBZ A;  1B9N A;  3TO6 A;  1OMI A;  1ZRE A;  1MDM A;  1IZ1 A;  2E7X A;  1T39 A;  3CDH A;  4N9I A;  3CTA A;  1YTY A;  3BPX A;  2IJL A;  4AIK A;  1W5S A;  4B09 A;  3TDZ C;  3BZ6 A;  1C0W A;  2ZNY A;  3F22 A;  3NQO A;  4GXO A;  4ETS A;  2VT3 A;  1F5T A;  2STT A;  1IXC A;  5HS8 A;  1BI1 A;  3L00 A;  4ENN A;  4A6D A;  2FNA A;  5LHI A;  4XLN F;  4CDG A;  1RI7 A;  4QLC U;  5LRS A;  2KKO A;  4BXU A;  4EVI A;  3PFI A;  2GQQ A;  4R8H A;  5ICC A;  1S7O A;  2NS0 A;  1XGO A;  2IRF G;  5E8G A;  1ODD A;  1J2X A;  2RVC A;  1O3S A;  2A61 A;  1FSH A;  4IHT A;  2ESN A;  3N4M A;  3EQL F;  1IN4 A;  2BGC A;  5D5V B;  3RJP A;  2EV0 A;  4MHG A;  2FA5 A;  3RYR A;  3LA7 A;  1QNT A;  2CO5 A;  1PP8 F;  1XDS A;  1S8N A;  1J75 A;  4ON0 A;  1ZLK A;  1P4X A;  3VOE A;  4IRG A;  2GA2 A;  3QU6 A;  5LBQ A;  2VOP A;  2DI3 A;  3DP7 A;  5CVV A;  4HF0 A;  3WE2 A;  1EV7 A;  1XMK A;  2KRF A;  3PQK A;  3ABT A;  2W84 A;  2QZ8 A;  3BOQ A;  5D5U B;  4F7Z A;  4RS8 A;  4E70 A;  4WK8 F;  3IWZ A;  4YFX F;  1BI2 A;  4LK1 F;  3COA C;  3M1E A;  1IXS B;  2HGC A;  3ZP5 A;  5AIP A;  3KEO A;  2L02 A;  1SMY F;  2X0L A;  1E2X A;  2LF7 A;  3KEQ A;  3BJO A;  3ZMT A;  2PI0 A;  2NRA C;  2NNN A;  3V8L A;  1TLH B;  4MGR A;  2HR3 A;  3F8B A;  1W7P D;  2K4J A;  2KIF A;  2VE9 A;  1I5Z A;  2GXG A;  2F2E A;  3ZMD A;  1K6O A;  5H20 A;  5J6X A;  3JW4 A;  2XV4 S;  4KA4 A;  2O0Y A;  2ZME B;  4U88 A;  2A6E F;  3LAJ A;  3ZMZ A;  2BV6 A;  2IP2 A;  2O6G E;  1PP7 U;  1ZLJ A;  1NHA A;  1F9N A;  2XAJ A;  4I0A A;  4RGU A;  2OQR A;  1YW9 A;  5FFX A;  4BAY A;  2P6T A;  2DK5 A;  4S04 A;  2MBF A;  2FOK A;  5F1R A;  1OR7 A;  2W25 A;  4M74 A;  1YIO A;  1STZ A;  4EJV A;  2M5W A;  3H92 A;  2EFW A;  1QQI A;  2MA3 A;  2XKO A;  4UXN A;  1BC7 C;  2OU2 A;  2DW4 A;  5LRR A;  1R7J A;  4A0Y A;  1MJ9 A;  2AS5 F;  2ZKZ A;  1TQP A;  1XGS A;  3F6O A;  3SZP A;  1EH6 A;  4HV6 A;  4BNC A;  5CVJ A;  1OYY A;  4A2U A;  5FGM A;  4U0Y A;  1I6X A;  4MEX F;  5K5O A;  1ZHF A;  3FWE A;  1KYW A;  5D4R A;  4AD9 A;  1LQ1 A;  3TOB A;  4HYE A;  4KUM A;  3MCZ A;  5L3C A;  4L9V A;  3TDU C;  4WX9 A;  2C6Y A;  2FNP A;  2XHK A;  2JPB A;  3F3X A;  3QAH A;  1DDN A;  3KP5 A;  4M71 A;  3MFK A;  2FML A;  1UHM A;  3WTX C;  3I0T A;  4R1H A;  3T8R A;  1REP C;  4CHU A;  3E6C C;  1K78 A;  3DXJ F;  5FD5 A;  2P6S A;  3C7J A;  1FT9 A;  2OBP A;  1F4K A;  4O6J A;  2P4W A;  4ESF A;  1JHF A;  4Y17 A;  1UFM A;  2V1X A;  5HVQ C;  3HRU A;  2JZY A;  2UWM A;  4U7B A;  4LFU A;  3CUO A;  4HDV A;  1JHH A;  1X3U A;  5D6F A;  1RIO H;  1GVJ A;  3FM3 A;  1U5T C;  3IC7 A;  3WTZ A;  1XCV A;  4M6X A;  5E1Z B;  3CUQ B;  4R79 A;  2H09 A;  3JSO A;  1XSV A;  2KIM A;  3GYH X;  3SXY A;  3R0J A;  3NEU A;  1J0R A;  1TTY A;  1QZY A;  1D5V A;  3BP8 A;  3KCC A;  1FLI A;  1T38 A;  2H6C A;  2BBY A;  1G3W A;  2YX4 A;  3RPQ A;  4EM1 A;  4PDK A;  5DEQ A;  1DPU A;  5E18 F;  1U5T B;  3WU0 A;  4ZYG A;  2DLL A;  5ICF A;  3DV8 A;  2UZK A;  4B8X A;  5CJ9 A;  5JHU A;  2VON A;  2G9W A;  5HLI A;  2K27 A;  4HLY A;  3G73 A;  1T6S A;  5D8K B;  2MH9 A;  3FX3 A;  3NRV A;  3ML6 A;  2LSO A;  2L4M A;  5ICG A;  3P9I A;  4Y13 A;  4YFN F;  1QGP A;  2L3D A;  5D8L B;  5D4S A;  2V1U A;  1MD0 A;  4LMY A;  2QQA A;  2G7H A;  1Y0U A;  2DK8 A;  3T1B A;  5HLH A;  4L18 B;  3U1D A;  1R1U A;  1LNW A;  2XAG A;  1IW7 F;  3L7W A;  1YQA A;  1RNL A;  2GAU A;  4ENM A;  4EJT A; 
#chains in the Genus database with same CATH topology
 4AVP A;  2LLK A;  4P9U A;  3QYF A;  2GLO A;  2R92 J;  3E5Q A;  2DPU A;  3E6D A;  2R5Y A;  4B1R A;  1IGN A;  1TWF J;  2QWW A;  2XRN A;  2P7C B;  5DM6 F;  1TNT A;  5L3F A;  3U1K A;  3KYD B;  5TJJ A;  1K79 A;  3KLN A;  2MLK A;  3GLX A;  5FLX K;  3RKX A;  1TZL A;  1W5T A;  1QHG A;  4M6V A;  3G1M A;  1Y1W J;  2FUG 2;  2M1B A;  2F5D A;  1JKO C;  4CXF A;  2ID3 A;  3L2R A;  3LST A;  2LRE A;  3U21 A;  2VN2 A;  2BXZ A;  1BIA A;  3DU6 A;  2LY1 A;  3RKW A;  3HPH A;  4AU7 A;  2OJE D;  4DGW B;  3JRD A;  1XGM A;  4NC6 A;  4WXD A;  5FKM A;  1KQ9 A;  2HEO A;  2F4M B;  4UB8 C;  2EZK A;  4YFK F;  1SAN A;  3CD6 I;  3OYH A;  3K1P A;  3V8J A;  3BR3 A;  2ECB A;  4CCM A;  3WTW C;  1GXP A;  2L54 A;  3O3K A;  5DUK A;  1FP1 D;  2ISZ A;  3V8K A;  4XOP A;  2VQC A;  2ZXW H;  3S3M A;  4RGX A;  2HZT A;  4XLH A;  4IVN A;  1ETX A;  5L3G A;  2WV0 A;  1DP7 P;  3N05 A;  2LF8 A;  3GTP J;  1I3A A;  3CF2 A;  1GLN A;  3RTR A;  2Z33 A;  4BBS J;  3RZO J;  4AIJ A;  4IX7 A;  1FIA A;  1D0Y A;  2ISY A;  3ISP A;  4XRS G;  3G3Z A;  1O3R A;  2M4G A;  5LHG A;  1MKM A;  5DDG A;  2V79 A;  1X58 A;  3F6V A;  3S15 J;  3GBG A;  3S3N A;  3QU3 A;  3PUB A;  2OF7 A;  1IN7 A;  2XGX A;  2AO9 A;  2L01 A;  1Y6I A;  5J1U A;  3K4L A;  4HZF A;  2DPD A;  3HTU A;  1IRX A;  2YSR A;  2V6E A;  3PQJ A;  3TL4 X;  2CJJ A;  3CCQ I;  4B48 A;  3DWL E;  1WZ2 A;  1MBJ A;  2EQR A;  2GXA A;  3S1Q J;  4BJ5 C;  3OS2 A;  3V7S A;  4BJT A;  1Z91 A;  4BDY A;  3DEW A;  3TO7 A;  4WWC A;  3SHF A;  2K9L A;  1VQ7 I;  1Z6R A;  2LG4 A;  1ITY A;  3ABK H;  4BE2 A;  2R5Z B;  2PJR B;  2DFI A;  2WY7 Q;  1K83 J;  4P96 A;  3JSP A;  4A3J J;  2CV0 A;  3BQY A;  1Z9C A;  3S93 A;  3RDI A;  1U8R A;  1W1W E;  1IV6 A;  4BQN A;  3BR1 A;  3T0Y A;  3AG1 H;  1B8I B;  5TIS C;  5GPC A;  4ZDL A;  1T0F C;  4RAG A;  1DP3 A;  3KYC B;  4II2 A;  3W3C A;  5CQE A;  2R3S A;  2RGV A;  3CP2 A;  4JYK A;  2O7O A;  5DD8 A;  1NG7 A;  2OQG A;  2VBW A;  4AID A;  1B1B A;  3FIW A;  2NYX A;  4AYB A;  1OIS A;  2KZG A;  3KP2 A;  4L9J A;  2XAQ A;  3OIO A;  2M8E A;  1G4D A;  2A6H F;  1ZRC A;  1W7P A;  1O57 A;  2ZNZ A;  2IAI A;  3BTI A;  1W0U A;  2OAZ A;  3FK7 A;  2EK5 A;  3I56 I;  1J5Y A;  1Z1D A;  1QU3 A;  3BC8 A;  4H0E A;  4AM3 A;  3QYB A;  1KGS A;  4HRI A;  1ZGW A;  3GTM J;  2W48 A;  2X6Y A;  4KYW A;  3J80 Z;  1CF7 B;  1S7E A;  2BHY A;  2LY9 A;  3UR3 C;  2KRC A;  3B02 A;  1HBX G;  4IOA F;  2JA6 J;  3QOE A;  3PO2 J;  2HDC A;  1UZC A;  5EEG A;  1WJB A;  2XVC A;  2L0K A;  1X1A A;  2EBI A;  3OIP A;  1WKM A;  3HIF A;  4XSX F;  2PFB A;  2B9S A;  1R58 A;  2EIM H;  3HSF A;  2PMZ A;  4OAZ A;  2L9S A;  1HSJ A;  4JK1 X;  4PJM A;  1GVD A;  3K4B A;  5K7H A;  1SFU A;  2QSG X;  2KJB A;  2A5W A;  2M3A A;  3HBL A;  1SD5 A;  5FD6 A;  3ZPL A;  2IGK A;  2YUS A;  2EV6 A;  1ENH A;  2F4I A;  4CSW A;  4RGS A;  4B3X A;  4I98 B;  2F5C A;  1DGR M;  3FMQ A;  4EM2 A;  1S9H A;  1YLF A;  1KU9 A;  1ZGJ A;  3J81 K;  2OTJ I;  3LNQ A;  1FEX A;  2E2I J;  2WY8 Q;  3E5X A;  1MNE A;  1YHQ I;  1TNS A;  3DU5 A;  3SEZ A;  1IC8 A;  4GDF A;  1FTZ A;  1A35 A;  1XPX A;  1MND A;  3AFH A;  1ETW A;  1ORK A;  1RR8 C;  2Q8K A;  3OYA A;  4YEL A;  2NVX J;  3SEQ A;  1XMA A;  4FX0 A;  5J4V A;  3K9T A;  4MFE A;  5J40 A;  1FP2 A;  3SZT A;  1BBY A;  4CCO A;  4I02 A;  2GIV A;  2V1D A;  3K4M A;  1T0F A;  3Q5F A;  1SAX A;  1I27 A;  2RRE A;  4MLO A;  1FOK A;  4BY1 J;  3JRH A;  5DV5 A;  3JAM K;  2QGU A;  5IT9 Z;  3QYE A;  1I3Q J;  1XGN A;  3BG6 A;  4UUS A;  3KFW X;  1XG1 A;  4BHB A;  2OTL I;  2QF7 A;  3KP3 A;  2FSW A;  3CCL I;  3GFM A;  2E1N A;  1RRJ A;  4E7K A;  4Y52 J;  3GTO J;  6PAX A;  3H9J A;  1LE8 B;  4GYI A;  4JBA A;  1XSX A;  4Z2Y A;  3HSE A;  3D5L A;  1YS7 A;  1Y8Q B;  1HW5 A;  4KNY A;  3CJQ B;  1MBF A;  2K85 A;  4BUP A;  1ZRD A;  4IHW A;  4C3H J;  3ZCO A;  2MW8 A;  4WCG A;  4PGG A;  3K69 A;  2XKP A;  1YS6 A;  2DOE A;  3Q0V A;  4UNO A;  1SAU A;  3D0S A;  3JTH A;  2ESH A;  3TOA A;  2HYG D;  5J8F A;  2VAS A;  3BTC A;  5FKK A;  4E7I A;  4U7D A;  1DPR A;  1R5H A;  5K5Q A;  2X1D A;  1SVL A;  2E1O A;  1WFX A;  1IXR C;  1DU0 A;  2HTS A;  2DBB A;  2JTV A;  4UV8 A;  4A3M J;  4A5N A;  1S6L A;  3RPU A;  2VJJ A;  1SFO J;  3HOV J;  1N75 A;  2JVH A;  2VC1 A;  2BY0 A;  4HA8 A;  4GYG A;  2BOL A;  1YOV B;  2E7W A;  4LG0 B;  4O5V A;  1ZRF A;  3PNY A;  5ILU A;  2O9L A;  4KIC A;  2HQA A;  2Y75 A;  3HRM A;  4XR6 A;  2IA1 A;  4M9X A;  4IF4 A;  1LEB A;  2MG4 A;  1LDK B;  4G7O F;  4ZZD A;  4EGY A;  4D5C A;  3FXQ A;  5LGN A;  2ZME C;  3FF5 A;  1D8J A;  3MVP A;  3BY6 A;  3PL8 A;  2HU9 A;  4U0W A;  1MJB A;  3ZQF A;  3CC4 I;  3MD2 A;  2VBX A;  5TGT A;  3F23 A;  3CCU I;  3SJM A;  1BL0 A;  4L9T A;  2E35 A;  4AIH A;  2JJ7 A;  3QPT A;  5LLQ A;  2K7L A;  3L09 A;  3ZN1 A;  1U78 A;  2O61 A;  3I3L A;  2FBI A;  1UAA A;  2JRM A;  4LLG F;  4JX4 A;  5LEK A;  5IP9 J;  5KCM A;  2R7F A;  3BT9 A;  5EG0 A;  2H1K A;  2EIN H;  4AYB N;  3ZQL A;  2Y0M A;  3E7L A;  2NNY A;  2R7U A;  1YJN I;  3W6K B;  2L5Q A;  4LGW A;  3A2K A;  1I39 A;  2HOE A;  4IHY A;  1MH3 A;  4JX5 A;  4A3L J;  2FXA A;  1JT0 A;  4BKX A;  2GXB A;  4AWX B;  2JRT A;  4ZZL A;  1LFB A;  3K2Z A;  3TGN A;  3OYB A;  2X4H A;  4XK4 A;  5BPD A;  4BH9 A;  3CP8 A;  3FBN B;  2K9S A;  3KIO A;  3KE2 A;  2E71 A;  4HV5 A;  5J4Y A;  3OMY A;  1SD4 A;  4LG3 A;  1ZKG A;  2VKH A;  1WI9 A;  1USS A;  1MBE A;  3HHH A;  1RES A;  3F8C A;  2PMZ N;  1VND A;  4HBL A;  1XMX A;  4E7L A;  1HXD A;  4M6Y A;  5LEJ A;  2VBY A;  2M4K A;  3ABM H;  3MMY B;  3TW7 A;  2I5U A;  4FET A;  1W5C C;  2Y9Z A;  4J01 A;  5LHH A;  2CUE A;  1P4W A;  2W1O A;  1GXQ A;  2FQ3 A;  3LSM A;  3K6G A;  4XMY A;  5GAE J;  3TKY A;  4BQA A;  3LL7 A;  1OCO H;  3ZMS A;  3TED A;  2ZME A;  3DBH B;  2OC6 A;  4M9S A;  1HLV A;  3TP0 A;  4BJ6 C;  1TWG J;  3CO6 C;  4QPQ A;  5K7Z A;  2BYV E;  3H3U A;  1BOA A;  2GBY A;  2FEZ A;  4MTE A;  4Q47 A;  3JRI A;  4IL6 C;  3S14 J;  4A93 J;  2A68 F;  2ME0 A;  2B7E A;  2W85 A;  2F5E A;  3CJN A;  4NQW A;  2LRD A;  3ASN H;  2HOA A;  1QPM A;  1KYZ A;  2RNJ A;  3K4C A;  1LDJ A;  4E7S A;  5J47 A;  2H1L A;  2E34 A;  4HPQ A;  1T56 A;  2LFB A;  4XM3 A;  3QRF F;  2E1M B;  2OV7 A;  3BZK A;  3CCR I;  1YE9 A;  1U6G A;  4BXX J;  3F8M A;  2NS8 A;  5H6Q A;  3A01 B;  3PNV A;  2X6W A;  3H3Z A;  4HQM A;  3AG4 H;  1FX7 A;  3HRT A;  4KIS A;  4UVC A;  3BDD A;  5CVI A;  5LGT A;  3GTQ J;  1XC5 A;  2QSF X;  3OYN A;  4WF2 A;  4NDL A;  4K2E A;  1B6A A;  2R7D A;  3SYT A;  1APL C;  2HOT A;  4HG2 A;  1RUN A;  4HX7 A;  2KIU A;  4RAF A;  2NAZ A;  4BS9 A;  2KRH A;  2K40 A;  4OWR B;  3IRQ A;  3D5R C;  4ZC3 A;  3KZY A;  4CYD A;  1JGG A;  2GOX B;  1S7A A;  3F8N A;  3RPU D;  3HHG A;  1EJ9 A;  3L9F A;  2VE8 A;  2ZC2 A;  3DKY A;  5FKL A;  3CUQ C;  3LSK A;  1YYV A;  3E3V A;  3VEP A;  4S05 A;  3G4S I;  3LA2 A;  1IJW C;  3LSI A;  3HL2 A;  4HX4 A;  3HGY A;  2OZU A;  4WXC A;  5FKO A;  4AC0 A;  2QKL B;  2E2H J;  2DA3 A;  4UHT A;  1Z05 A;  3K1N A;  1LDD A;  1WH5 A;  1PUE E;  3QP6 A;  2V7F A;  3FDY A;  2FE3 A;  2JMW A;  3ZQG A;  2LKS A;  1LPQ A;  2EV5 A;  2FMY A;  1Z77 A;  2EWN A;  4Y4R A;  1UB9 A;  4RB1 A;  5F6F A;  2PBI A;  4D7M A;  2B63 J;  3CCS I;  2KP6 A;  5CKT A;  2KDZ A;  1JXS A;  3HUG A;  2Y48 A;  2HXI A;  2QEN A;  1MGT A;  4GFB A;  1IN8 A;  4Y7N J;  1FBU A;  1TQM A;  5E3N A;  2MGQ A;  3H3V K;  1JI8 A;  2D1H A;  2ZO4 A;  4P1W A;  1SVO A;  1G6N A;  1IN6 A;  3E97 A;  1FTT A;  3F21 A;  3WGH A;  4D5F A;  5HNH A;  4FT8 A;  1B72 B;  1WSU A;  4EEF G;  4KT5 C;  3K0L A;  1IRF A;  1X1B A;  2HYJ A;  2MC4 A;  3G2B A;  1WJA A;  5D6E A;  4MQV A;  3WTT C;  2FBK A;  2Q2E B;  2KL4 A;  3PIP F;  3GFI A;  1OYW A;  5FB2 A;  3S1R J;  4ESJ A;  9ANT A;  3AKZ A;  4XRF A;  2B0L A;  1OCC H;  4CCJ A;  2M45 A;  1Z6T A;  1AOY A;  1E0E A;  4YII A;  3GUD A;  2ZCW A;  1TP4 A;  5HS9 A;  1ETK A;  4PJ0 C;  1FYL A;  4OIR F;  3FXR A;  1IN5 A;  2D5V A;  1FNN A;  2GIZ A;  2LY2 A;  4C2T A;  2ZXJ A;  3FHN A;  3FXL A;  1AKH B;  3WGG A;  5HOO A;  2QCO A;  4ANJ A;  1UEL B;  4DQ2 A;  1KQ8 A;  1HQC A;  2YU9 J;  2F5F A;  2IEK A;  4MTD A;  1E3H A;  4L5J A;  2O5R A;  1ZR2 A;  1VQ8 I;  2DT5 A;  1EKE A;  2XAH A;  1R22 A;  2IXS A;  2VXD A;  3CUQ A;  4LJZ F;  1Z7L A;  5F64 A;  1BN5 A;  5KAF C;  3LAP A;  3W2A A;  1G3Y A;  1B4A A;  4DBR A;  2FF4 A;  3EUH C;  2CFX A;  3O8G A;  1FZP B;  4IZZ A;  4IHX A;  1R5G A;  5GP9 A;  3ABU A;  2V4J C;  3QQA A;  3BR5 A;  2VT2 A;  1FYM A;  1ULY A;  4KN4 X;  1YRN B;  3FMS A;  2M0C A;  1HW2 A;  3H5N A;  2EIJ H;  4HSR A;  1PUF B;  4PJJ A;  3CO7 C;  3K1M A;  5E20 A;  1U3E M;  1SFX A;  2LDU A;  1ZTR A;  1U5T A;  1P9Q C;  5EEA A;  1KU3 A;  2PEX A;  3WTV C;  3W6J B;  1T33 A;  3C2B A;  1WWX A;  3S32 A;  1S5L C;  3IP4 B;  3O6B B;  1X4P A;  2XAS A;  2IVM A;  2IBD A;  2P0W A;  3MZH A;  5CVR A;  4FE7 A;  2RKH A;  1MMG A;  4MNU A;  1SMT A;  2H8W A;  2OA4 A;  2ELK A;  2Z16 A;  4PCQ A;  2R4G A;  4X0G A;  1G2H A;  2HWV A;  5C44 J;  1HST A;  1A04 A;  4EJU A;  3HGG A;  3M3Y J;  5HLT A;  4BQQ A;  1LB2 A;  4E7H A;  2HQ5 A;  2G7U A;  3VPR A;  5D5W B;  1JUM A;  3F8F A;  4EMS A;  5KHD A;  4I99 C;  4LB6 B;  3WGI A;  3V7C A;  3IHU A;  3FHZ A;  2JA8 J;  2KQR A;  2QQ9 A;  3ERE D;  2DU9 A;  1IDZ A;  5GAG J;  2TRT A;  2V9K A;  1AU7 A;  1IG7 A;  3OR1 C;  4OIP F;  2P7V B;  2XUB A;  5DD4 A;  1VQM I;  1BR2 A;  1SC7 A;  4IPA A;  4EM0 B;  2M0M A;  3GEZ A;  4G7Z F;  1JJ8 C;  3WOD F;  2LNB A;  4WXH A;  1YW7 A;  5IOZ A;  1B9M A;  2IS2 A;  2CW8 A;  3R60 A;  1G3S A;  4RA2 A;  3R4K A;  3M4O J;  2AXL A;  1ZG3 A;  4BL0 B;  4RLQ A;  3OWT A;  3FKJ A;  2A69 F;  1UG0 A;  2HVS A;  5B1B H;  1OCP A;  3M8J A;  2PMH A;  1MSF C;  4RM3 A;  5FRN A;  1BM9 A;  1ETV A;  4I0B A;  5FFZ A;  1E17 A;  1A31 A;  3JRG A;  5FRM A;  1JE8 A;  3KX2 A;  2L4A A;  2KDO A;  2DFE A;  4M3B A;  2W24 A;  2F4O B;  4RLF A;  2QUF A;  4V2G A;  2V6C A;  4BE0 A;  3S2D J;  2AXT C;  4DZP A;  4DZJ A;  5GAD J;  3EUH A;  4JOM A;  4ZYH A;  1SD7 A;  3I59 B;  4OIN F;  1R23 A;  2R0Q C;  2DMU A;  1F1Z A;  3PM1 A;  5D5X B;  1EA3 A;  1G3T A;  4BXF A;  4IRH A;  1TC3 C;  5B5E C;  4A5M A;  4QIW N;  5K5R A;  3A0H C;  3ZQ7 A;  1K61 A;  2GM4 A;  2EFQ A;  2O3F A;  2IGN A;  4N0B A;  4BYY A;  3GZ5 A;  3DKX A;  5CQG A;  5DYM A;  1PDN C;  3ZMU A;  4XON A;  3X2Q H;  1TWH J;  2DDA A;  1O4X A;  2K4B A;  2PX9 A;  3LSR A;  3H0G J;  1H88 C;  1I1G A;  1POG A;  5CVU A;  4XQF A;  2JPC A;  1ETY A;  3GFJ A;  5K7F A;  5F27 A;  1ONV A;  2CGP A;  1P7I A;  4Q48 A;  1LVA A;  3ZN0 A;  3LQR A;  5HDG A;  1OPC A;  1ZAO A;  3EUA A;  3S1N J;  2CUJ A;  2JA5 J;  3IRR A;  1QRY A;  3L2V A;  3TO9 A;  2DQR A;  5E79 C;  3WTS C;  1MBK A;  3RI4 A;  1J59 A;  1ZN2 A;  2EFP A;  3DPT A;  1D3Y A;  1SVM A;  3RQI A;  5HDN A;  4FE4 A;  2VQG A;  3H9G A;  2X6X A;  2M34 A;  1P92 A;  2M9H A;  2VKD A;  4ZTJ A;  2VOO A;  3EUK L;  2R7Z J;  3KET A;  1XX5 A;  2P5V A;  4RB3 C;  3M9A A;  3I5U A;  4ESB A;  4LLN A;  4OMY A;  4XLC A;  4D0P A;  2A3S A;  5L3E A;  4I7H A;  3F72 A;  5J1Y A;  4OIQ F;  1I6H J;  1OKR A;  3HYI A;  2KJC A;  4JQF A;  4FX4 A;  3KPH A;  4MO7 A;  3WU1 B;  1WPK A;  1JGS A;  1Y1V J;  2DA1 A;  4ZDP A;  3WHB A;  2ZJ2 A;  1GV2 A;  2NVQ J;  3QOD A;  1WRJ A;  4C3I J;  2L7K A;  2WAF A;  3DF8 A;  3WTU C;  3O8H A;  1V3F A;  3QPS A;  2V9P A;  3GF2 A;  1ZG5 A;  5JHF A;  4F52 A;  2IW5 A;  1TT0 A;  3VDX A;  3VYT B;  4EJW A;  3J7Y J;  2DDB A;  1LFP A;  3TP3 A;  4DNC A;  3BJ6 A;  1L3L A;  2EPF A;  1G8X A;  1E3O C;  3HC7 A;  4YIF A;  3GLL A;  1DU6 A;  4A3B J;  2CSO A;  4A3C J;  3BG9 A;  1J09 A;  2ZJP F;  4MEY F;  2E60 A;  2DTR A;  3OYC A;  3I4P A;  3CMY A;  1FYK A;  2DAO A;  2KFD A;  2EA4 A;  5GTH C;  2R7S A;  2JSC A;  2FJ1 A;  2DA5 A;  1TBX A;  3GFL A;  5JI6 A;  2VQL A;  1KU2 A;  5C4X J;  3F9K A;  4XNF A;  4II3 A;  1YJW I;  5DCM B;  2HKX A;  1BC8 C;  4KIB A;  4XKV A;  2XPU A;  2R5Z A;  2PJR A;  4CO8 A;  4E4H A;  1VQP I;  1MDM B;  2OPT A;  1LFU P;  4HF2 A;  3PO3 J;  1TQI A;  2VJ4 A;  2CUZ A;  2FD5 A;  2CUF A;  2DYR H;  5EEH A;  2MFZ A;  5E3L A;  1CGP A;  2R7V A;  2EZL A;  1YIJ I;  1B8I A;  1YFH A;  1UHS A;  1MJA A;  1XD7 A;  1BIB A;  4A12 A;  3KP6 A;  4CUG A;  3QP5 A;  4M3G A;  4KFC A;  3FXM A;  3U2R A;  2DA6 A;  3CES A;  1O3Q A;  2QBY B;  3L2W A;  2MD5 A;  5IOY A;  2Z9O A;  1HW1 A;  2JUG A;  3O2P E;  1D1A A;  1DUX C;  2ELH A;  2HVQ A;  2CQX A;  4YRV A;  2BXY A;  3RIR A;  2BE5 F;  1SD6 A;  3OL4 A;  4NUB A;  3RKQ A;  3LOC A;  4Q4Z F;  4XBF A;  4A3E J;  4BY7 J;  4D9J A;  1A36 A;  3OY9 A;  1R1T A;  1YO5 C;  2HI3 A;  3MEX A;  1S29 A;  3OYI A;  1LKX A;  2PLY A;  1BI3 A;  2N8G A;  2O8X A;  3TQN A;  1O7L A;  3CLO A;  2XF5 A;  2YU3 A;  3OR2 C;  2Q1Z B;  5B3S H;  4CZC A;  4M9Z A;  1CF7 A;  4D1Q A;  3L2C A;  4BE1 A;  1U8B A;  4RAY A;  4B47 A;  4BHP A;  1SFE A;  5FO5 A;  2RN7 A;  2QBY A;  4P9F A;  2LOO A;  1WVR A;  3IL2 A;  1R6R A;  1D0X A;  1V5G A;  2IA0 A;  2VL8 A;  1WJD A;  4HF1 A;  3UKG A;  3OS1 A;  3BRO A;  2DO7 A;  2Z99 A;  3H36 A;  4A6E A;  1FOX A;  2HDW A;  4RGR A;  5E8I A;  3K2A A;  1O7F A;  2HNH A;  3I4N J;  2COB A;  5JR3 A;  3I71 A;  3SDG A;  1XCB A;  2V1N A;  2EB7 A;  3GO5 A;  1K7A A;  3IWF A;  4IHS A;  4G8X A;  2QM3 A;  4MQ9 F;  3B6C A;  1IRG A;  5BNG A;  3MAJ A;  4HEA 2;  2X85 A;  3Q9S A;  3IKV A;  4A0X A;  2R7W A;  3MN2 A;  5B66 C;  4KIF A;  1M1E B;  1VQ6 I;  2R93 J;  4ASN A;  3JTG A;  4NBQ A;  1H0M A;  5IYD J;  2QKM B;  2FX0 A;  3HSR A;  2QQB A;  5CYV A;  1FBQ A;  4DBQ A;  3LSP A;  5GTI C;  2XIG A;  2Z1D A;  3K4N A;  4HOB A;  1FPQ A;  1NG6 A;  4XKC A;  4A3G J;  5JLX A;  4QWQ A;  2LR8 A;  1H9T A;  3JRA A;  2ECC A;  4IRI A;  2X6O A;  1MMS A;  4U0V A;  2UXN A;  2LKX A;  4KJZ A;  1KZH A;  2F5V A;  1KQ0 A;  3FXO A;  3N97 A;  1LE8 A;  3CMM A;  3OOU A;  3ZRG A;  4GCV A;  3HDD A;  1HA8 A;  4IXA A;  4XID A;  1FOY A;  2MYS A;  4KMU X;  3RKY A;  3WE3 A;  1Z7U A;  3WG9 A;  4G6D A;  3JRE A;  1R49 A;  1YIT I;  1GT0 C;  4F92 B;  2HYF A;  2X48 A;  3W2W A;  2AHQ A;  2WC2 A;  3PNT A;  1JT6 A;  5BMZ A;  1RKW A;  1OYI A;  1GHC A;  2K9N A;  2QSH X;  2R7X A;  2GWR A;  2QVO A;  2RAE A;  3VB2 A;  1KON A;  5IY5 H;  1QZZ A;  4NC8 A;  4LK0 F;  2NOJ B;  2Y2Z A;  3GTL J;  2VJI A;  1UG2 A;  3FZV A;  4LG0 A;  3H0D A;  1UHW A;  1V55 H;  4NB5 A;  3A4C A;  3ZGK A;  3HB9 A;  5EZH A;  4RDU A;  2E19 A;  4XLA A;  1IF1 A;  4KMF A;  1OLT A;  3PUF A;  1WQ2 A;  3S2H J;  2XSJ C;  4KIG A;  2VIX A;  2RC4 A;  3R0A A;  1FOW A;  5K1Y A;  2IS6 A;  3KEY A;  1HKS A;  1IAW A;  3FM5 A;  2DOD A;  3HG9 A;  2D2W A;  3MZY A;  5ICE A;  2RQP A;  4YEJ A;  1X2N A;  3TW6 A;  2NOG A;  1JUS A;  3WTY C;  4ZDO A;  1D1B A;  5KVR A;  3GVA A;  1ZEL A;  2DA4 A;  1XDU A;  4ITV A;  5EZG A;  4EQQ A;  2YX7 A;  2QEX I;  2PG4 A;  1YG2 A;  4W1U A;  5BS6 A;  3BTL A;  2DFF A;  3RQ4 A;  1QVT A;  3GWZ A;  4IJA A;  1V54 H;  2ZSI B;  5LGU A;  1X3W B;  1FSE A;  2KIQ A;  2YPR A;  5F0C A;  3ZQQ A;  1ZAR A;  2E1M C;  3S3O A;  2Y9Y A;  4HX8 A;  3WHC A;  1ON2 A;  2HTJ A;  3MKW B;  2CU7 A;  2VC0 A;  1XN7 A;  3EDP A;  2MLG A;  1U2W A;  2D1V A;  5E3O A;  5BQT A;  2EJR A;  1Q1H A;  2EFO A;  2ZSH B;  3C18 A;  2DOA A;  3HOT A;  3IV5 A;  3REO A;  3FKI J;  4P55 A;  4MIM A;  3Q9V A;  4UUV A;  2KIS A;  4BAC A;  5H6R A;  4ZYD A;  3L2U A;  2M87 A;  3FXU A;  1QA6 A;  4ENJ A;  3HOX J;  3SFZ A;  3TBI A;  1MIJ A;  2BY2 A;  4UY8 I;  4HDU A;  5IYB J;  4B43 A;  2LKP A;  4L5I A;  3DEU A;  3LA3 A;  4Q5S F;  3ZQC A;  4RBO A;  3HOS A;  1H9G A;  1LJ9 A;  4PZJ A;  4DIQ A;  3EET A;  4OOI A;  1QPI A;  2H27 A;  3GTG J;  2DMP A;  3HRS A;  2BHZ A;  3PFY A;  5FLX Z;  1JTY A;  3K70 C;  5ILS A;  2ID6 A;  2NVU B;  2RQQ A;  3IUO A;  1TW3 A;  1ZK8 A;  5ERI A;  5L3B A;  2FBH A;  2L7F P;  2Z5U A;  3GZ6 A;  2BVM A;  2MC3 A;  3P9C A;  5EJC A;  3ERM A;  1B59 A;  4ZH4 F;  2A5Y B;  4GRI A;  3RYP A;  1JKQ C;  1BI0 A;  2VXZ A;  4OIO F;  1XSD A;  3H9Q A;  1MZB A;  2CQN A;  1ON1 A;  1VI0 A;  4O3M A;  3J80 K;  5AON A;  4C3J J;  2HXO A;  3A0B C;  2XC7 A;  1QHH D;  4KN7 X;  5FJ8 J;  2XGD A;  4EJO A;  2PJP A;  3CCY A;  3HTS B;  3BPV A;  2ZFW A;  3M7G A;  2IS1 A;  1YW8 A;  4HST A;  3T5X A;  5TRD A;  1I50 J;  3EYY A;  5GPA A;  4AUX A;  1IV8 A;  5L3D A;  2XAF A;  1LEA A;  3ESW B;  4D7N A;  5B1A H;  4I2O A;  1KU7 A;  3M8F A;  4OAY A;  2XRO A;  2WAD A;  3BR2 A;  2JT1 A;  2RV8 A;  3C2H A;  1K78 B;  3DKW A;  2QLZ A;  1HKT A;  3A01 A;  1D8K A;  4RB0 A;  5J8C A;  3DFG A;  2J5O A;  3HOZ J;  3NWS A;  4HNV A;  1SFK A;  1ZQ3 P;  2RDP A;  3ROU A;  1P4A A;  1DGW Y;  4CA0 A;  2CV2 A;  3C1D A;  1FC3 A;  2QYO A;  2VOD A;  2EH3 A;  4FIS A;  3LFU A;  5A2Q Z;  3BLY A;  1FMV A;  3DQV C;  4I01 A;  1MBH A;  4X6A J;  4YG2 F;  4C9Y A;  2EFN A;  1F36 A;  2V9V A;  4XKB A;  2LBF B;  2NS7 A;  3VFZ A;  1ZGA A;  4FHT A;  3UNG C;  4LLL A;  5EF6 A;  4ZTF A;  1R71 A;  2WWY A;  3W6V A;  3IH4 A;  2K86 A;  1ZR4 A;  4KIT B;  5IT9 K;  2W00 A;  1Z3X A;  3JRC A;  4TV7 A;  2Z3Y A;  3LMM A;  1BR4 A;  2K9M A;  5BPI A;  3MWM A;  5ILV A;  2IPQ X;  1HOM A;  4N9H A;  5KAI C;  1U0J A;  2TCT A;  3J7Z I;  2XRL A;  4PGH A;  4XSZ F;  2VKE A;  3DCF A;  4DYC A;  3LWF A;  2OD5 A;  2CYY A;  2DN0 A;  2ADU A;  2IT0 A;  1TW2 A;  1RC9 A;  2XGE A;  1X2M A;  3OIQ A;  1S3J A;  2CW0 F;  2HQR A;  3I4M J;  3M07 A;  3R6S A;  3VOD A;  2STW A;  5F04 A;  1IRZ A;  2LBF A;  4Z6Y A;  2A05 A;  3B73 A;  5EGO B;  3M8E A;  4G6Q A;  2JA2 A;  4C30 A;  4I09 A;  1K4S A;  4CCN A;  3MQ0 A;  4IHV A;  3J7A O;  2DJI A;  4NC7 A;  3WG7 H;  1W36 C;  2W57 A;  3MZ8 A;  3I54 A;  3OSF A;  1X19 A;  3SDB A;  4CH7 A;  2P5K A;  4ZYA A;  1HDD C;  4BU2 A;  1OFC X;  2QQ8 A;  5F0H A;  5HLG A;  2P81 A;  5E17 F;  4EGZ A;  1HC8 A;  1R1V A;  4CCK A;  1JKR C;  3G71 I;  2HFH A;  4CZZ A;  3EYI A;  1QBJ A;  2ZFU A;  1B72 A;  1UCR A;  2DFH A;  3VYU B;  3OYM A;  1EF4 A;  3FBI B;  1WCM J;  1LVK A;  1FBS A;  2XF7 A;  3OOP A;  4M72 A;  1PYV A;  2BVL A;  2EIK H;  3ZMV A;  1ZH5 A;  2ACJ A;  4KT6 A;  4BEH B;  3VWB A;  4XN3 A;  2Q2E A;  2HZD A;  3AG3 H;  5E1X A;  4Y3O A;  1KA8 A;  3ABL H;  3C2G A;  1BOB A;  1I1S A;  2X1E A;  2TDX A;  4L9N A;  2MH2 A;  2LP0 A;  1VQN I;  4BQO A;  1W0T A;  1H89 C;  4L0Y B;  1MH4 A;  2M30 A;  4A3I J;  4J19 A;  3KZZ A;  3C3W A;  4B4C A;  4ENK A;  3J81 Z;  1G59 A;  1RUO A;  2PN6 A;  1Q1V A;  2DMT A;  4GGG A;  1AKH A;  3OL3 A;  3I58 A;  2OZ6 A;  1VFC A;  1FWZ A;  2CMP A;  3E6M A;  3VSL A;  4L0Z B;  2JK3 A;  4F93 B;  4Y15 A;  3GXO A;  1J7K A;  3G6E I;  1UST A;  2ZB9 A;  3A03 A;  2BW3 B;  1HF0 A;  4LB5 A;  4QSH A;  4RAZ A;  1EH7 A;  2YR2 A;  3R61 A;  1A6Q A;  4PSW A;  3LQQ A;  3RCO A;  2Y31 A;  2PMU A;  4HLX A;  5BOX A;  3LFK A;  4HAM A;  5E1W A;  5KNL A;  2DCE A;  5LFA A;  2R7Q A;  3JAM Z;  4CYC B;  1YRN A;  3P9K A;  4G9Y A;  4LOC A;  2K02 A;  3CJT B;  1BW5 A;  1OJL A;  2CQK A;  4DJA A;  1N25 A;  2Q0O A;  3S16 J;  4M73 A;  1PUF A;  1HKQ A;  4UVB A;  3KP7 A;  2R5Y B;  2BY3 A;  2EZH A;  3MKL A;  4A0Z A;  3GCM A;  5HS7 A;  1XB4 A;  3AL0 B;  2R7T A;  2FRH A;  1Z21 A;  3OSG A;  2X1C A;  4UVA A;  3L2Q A;  4IQJ A;  5FRO A;  2W4S A;  2NVT J;  4I6Z A;  1MW7 A;  3CZ6 A;  3I64 A;  3ECH A;  1K6Y A;  1P2F A;  3QOP A;  3KLO A;  4XIC A;  4P5O A;  3IKT A;  3OV8 A;  3ELK A;  5CPR B;  2UXX A;  4UV9 A;  2XB5 A;  3E6B A;  2I10 A;  4XOT A;  4RB2 C;  2WBM A;  2DXI A;  5DCF A;  2HKO A;  4BGD A;  2WAE A;  3OS0 A;  2BZT A;  2ZXH A;  3AG2 H;  4XLP F;  2O03 A;  3SZG A;  4XLE A;  1BJZ A;  1Z3Y A;  2WTE A;  2H94 A;  2L2O A;  3BWG A;  1NTC A;  2FU4 A;  2HS5 A;  5IPA A;  2LVS A;  2LH9 A;  4F55 A;  4BDZ A;  3E1S A;  2E5N A;  4G7H F;  3CJR B;  3IAS 2;  5F08 A;  4HW0 A;  3T8T A;  2CG4 A;  3K70 D;  5M5W J;  3BTJ A;  3OYK A;  1BA5 A;  1MMA A;  3GW2 A;  4E6K G;  3OYL A;  5M5X J;  1TL8 A;  4NHJ A;  2CQ7 A;  4LIU A;  2W7N A;  1MMN A;  1FY7 A;  4QPO A;  3I59 A;  3BJA A;  2IA2 A;  4PUS A;  3U9G A;  2ZBK A;  3DTK A;  2XB0 X;  1J9I A;  5JVT A;  3OYG A;  2CV1 A;  2IGO A;  4A3D J;  5DUI A;  3S8P A;  5EDN A;  2DQL A;  2P8T A;  2DMN A;  3Q0U A;  3CLQ A;  3D5S C;  2OCC H;  1L0O C;  4EV0 A;  3KP4 A;  2XF6 A;  1X4O A;  2KZV A;  5F0F A;  3GME A;  1ZG1 A;  4OU0 A;  1O3T A;  2CWE A;  2BEO A;  2CH0 A;  3GTK J;  3DPU A;  3CDL A;  5M5Y J;  3AAF A;  3BG7 A;  3V4G A;  2HOS A;  1F43 A;  2JA7 J;  3FMR A;  1PVE A;  2PQ8 A;  4G94 A;  2M7B A;  5C3E J;  4CIC A;  3SQN A;  2KLO A;  2HVR A;  5CLS A;  1WJ5 A;  4V2F A;  3I9V 2;  1Y0N A;  3S2W A;  2DJN A;  3OYF A;  3ASO H;  2EA2 A;  3I53 A;  1ZYR F;  5JFR A;  5A2Q K;  4IO9 F;  1HCR A;  2E1C A;  2ZXI A;  1T2K A;  2ETH A;  2DA2 A;  3P5J A;  3RSN A;  2G0E A;  4PJN A;  1R00 A;  2COM A;  1T98 A;  2Y0S A;  2GA1 A;  3E5U A;  5AIQ A;  1W7P B;  4G12 A;  2D45 A;  2Y30 A;  1AWC A;  4RMN A;  1X1P A;  1WI3 A;  1VTN C;  2K3F A;  1QO0 D;  2K9Q A;  2A07 F;  3DPL C;  1FMW A;  1XS9 A;  2HQN A;  5ED4 A;  2H6B A;  2GZW A;  1IUF A;  3DLA A;  2OUM A;  3FK6 A;  3GX4 X;  3P7N A;  3L1P A;  1V4R A;  1W4M A;  3QPH A;  1AA7 A;  2J5P A;  4LD5 A;  3HPG A;  1P6R A;  4CGZ A;  3V7R A;  1RZ4 A;  1PJR A;  3ULQ B;  5IP6 A;  4KDP A;  4GO1 A;  5IT3 A;  5HDK A;  5DTD A;  1IUY A;  4XL9 A;  1R36 A;  3HOW J;  2X51 A;  1W36 D;  1EH8 A;  2EZI A;  4H4K C;  4OMZ A;  4W97 A;  3K4K A;  2LK2 A;  3DBR B;  4BHC A;  5DCM A;  5KK1 A;  3CCV I;  4ZYE A;  3ECO A;  2P5L C;  4HQE A;  1BJA A;  1MBG A;  2A6T A;  2VBZ A;  1B9N A;  3CF5 F;  4FTH A;  3DTE A;  3TO6 A;  1OMI A;  3KZI C;  1ZRE A;  1MDM A;  1IZ1 A;  1TWC J;  2E7X A;  5J3L A;  1T39 A;  2L9N A;  4DW6 A;  3CDH A;  4N9I A;  2FQ4 A;  2NXN B;  3CTA A;  5FLM J;  1YTY A;  3BPX A;  3G1O A;  1A6I A;  2IJL A;  4AIK A;  1W5S A;  4B09 A;  2XGC A;  3PIO F;  1JTX A;  3TDZ C;  3BZ6 A;  1C0W A;  2ZNY A;  2JWT A;  3F22 A;  3NQO A;  4DYQ A;  3BG5 A;  4GXO A;  2WV1 A;  2HDD A;  2L9R A;  4UUS B;  4ETS A;  2VT3 A;  1WJC A;  3IAM 2;  1F5T A;  2STT A;  1IXC A;  5HS8 A;  1RKT A;  2H8R A;  1BI1 A;  3L00 A;  3DEE A;  4ENN A;  4RM2 A;  1V5E A;  4A6D A;  2FNA A;  2FOW A;  5LHI A;  4XLN F;  4CDG A;  1RI7 A;  4QLC U;  3JRF A;  5LRS A;  4CCL A;  5DS9 A;  2KKO A;  5HOD A;  4BXU A;  1P7J A;  3HKZ A;  4EVI A;  5M3F J;  1T08 B;  3PFI A;  2GQQ A;  4R8H A;  5ICC A;  2XPV A;  1HDP A;  1S7O A;  1A5J A;  4XN0 A;  1MMD A;  4ABZ A;  1OCT C;  2NS0 A;  4S0H B;  1FIP A;  1XGO A;  3CCM I;  5J1R A;  2IRF G;  5E8G A;  1ODD A;  1J2X A;  2I8D A;  2W82 A;  2RVC A;  2GOM A;  2M2E A;  1O3S A;  2A61 A;  1FSH A;  4IHT A;  2E36 A;  2ESN A;  3G1L A;  3N4M A;  5EYR A;  3JRB A;  3EQL F;  4FAS D;  1IN4 A;  4F3Q A;  2BGC A;  3K7A J;  5D5V B;  4C2M J;  2KMU A;  3RJP A;  2VI6 A;  4U87 A;  1WJF A;  1VQO I;  5IYC J;  2OCE A;  1OCZ H;  2DTZ A;  4A3K J;  2F48 A;  2EV0 A;  4MHG A;  4HNT A;  2FA5 A;  3RYR A;  3LA7 A;  1QNT A;  1WHU A;  2CO5 A;  3DTI A;  3K4J A;  1PP8 F;  2JQ7 A;  3CCE I;  1XDS A;  3F0C A;  1S8N A;  3S17 J;  1TWA J;  1D5Y A;  1FJL A;  1ERD A;  2LYC A;  1J75 A;  4ON0 A;  2UUZ A;  1CQT A;  1ZLK A;  1P4X A;  3VOE A;  4IRG A;  2GA2 A;  3BR6 A;  3QU6 A;  1AHD P;  1E3P A;  5LBQ A;  3PSF A;  3OYJ A;  2VQH A;  5E3M A;  1SEU A;  1VQK I;  3S1M J;  5C4J J;  2VOP A;  3CCJ I;  2IGM A;  1VQL I;  2DI3 A;  3DP7 A;  5CVV A;  2ME6 A;  4HF0 A;  3WE2 A;  1EV7 A;  1XMK A;  4L5E A;  2KRF A;  3PQK A;  3ABT A;  2W84 A;  3LSG A;  2QZ8 A;  2ELJ A;  2MAB A;  4PK4 A;  3BOQ A;  5D5U B;  4F7Z A;  3CME I;  4RS8 A;  4B44 A;  2JSP A;  3GTJ J;  4E70 A;  4WK8 F;  1Y8R B;  3IWZ A;  4YFX F;  5EG0 B;  4IEJ A;  1V5F A;  2Y0S N;  1BI2 A;  1WJE A;  4LK1 F;  1TT5 B;  4F91 B;  3COA C;  1VQ5 I;  3M1E A;  1IXS B;  3Q3S A;  1OR7 C;  2HGC A;  3ZP5 A;  2WB1 A;  1N78 A;  3FXJ A;  5AIP A;  5M3M J;  3VYS B;  3KEO A;  4X1E A;  2L02 A;  3H35 A;  2WAQ A;  4C2U A;  1SMY F;  1GUU A;  3LSH A;  2CS3 A;  2VLA A;  3GZN B;  2X0L A;  2ZJR F;  2JVG A;  1E2X A;  2LF7 A;  3KEQ A;  3BJO A;  3ZMT A;  3CMA I;  2PI0 A;  2M8G X;  2MSY A;  2XDV A;  3JR9 A;  2NRA C;  1X1C A;  1JJ6 C;  4QTR A;  1DQU A;  2AQE A;  2VJ5 A;  2NNN A;  2ZJQ F;  3V8L A;  1TLH B;  4DYR A;  4MGR A;  2HR3 A;  4PFO A;  3F8B A;  5GAH J;  3MKZ A;  1W7P D;  2K4J A;  2KIF A;  2VE9 A;  4UUT A;  3HXL A;  1I5Z A;  2GXG A;  1H8A C;  1X3Z B;  2F2E A;  2O8K A;  3VSK A;  3ZMD A;  3BCB A;  1K6O A;  2DT6 A;  5H20 A;  5J6X A;  2DYS H;  5FKN A;  4IQ4 A;  1R4N B;  4EAT A;  3M1C A;  2LTP A;  4NNJ A;  1UMQ A;  2WA0 A;  3JW4 A;  3NWT A;  3Q0W A;  3CC7 I;  2XV4 S;  4KA4 A;  2O0Y A;  2ZME B;  4U88 A;  2MD0 A;  2A6E F;  3WU2 C;  3LAJ A;  1ACI A;  4I76 A;  3K10 A;  3ZMZ A;  3HJE A;  2BV6 A;  2IP2 A;  2XAU A;  2O6G E;  1PP7 U;  2KHM A;  3D1N I;  1ZLJ A;  4NQW B;  4A69 C;  3H5A A;  1NHA A;  1F9N A;  2XAJ A;  4I0A A;  4RGU A;  2OQR A;  1YW9 A;  3ZOB A;  1Z0X A;  5FFX A;  4BAY A;  2P6T A;  2DK5 A;  3PJR A;  4S04 A;  4LIT A;  1R5I D;  2MBF A;  4J00 A;  1U9N A;  2FOK A;  4PFP A;  1WH7 A;  5F1R A;  2CQQ A;  2VUM J;  1OR7 A;  2W25 A;  2K3P A;  4JP0 A;  4M74 A;  2K5C A;  3ZXS A;  5H2F C;  1YIO A;  1STZ A;  4EJV A;  2M5W A;  1VZ0 A;  3H92 A;  2EFW A;  1QQI A;  1VF9 A;  2MA3 A;  3HKZ N;  2XKO A;  4UXN A;  3VYR B;  1BC7 C;  3J7A Y;  1T95 A;  2HPM A;  2HPI A;  2OU2 A;  4HNU A;  2DW4 A;  1D1C A;  5LRR A;  1NH3 A;  3CC2 I;  4M3F A;  3BQZ A;  1R7J A;  1BR1 A;  1D0Z A;  3A1Y A;  4A0Y A;  1VQ9 I;  3HOY J;  1MJ9 A;  1K4T A;  2AS5 F;  1ETO A;  2ZKZ A;  1TQP A;  1XGS A;  2L9V A;  3F6O A;  3ZQI A;  3SZP A;  3FXK A;  1EH6 A;  1OCR H;  3ZQH A;  4HV6 A;  4B3A A;  4BNC A;  5CVJ A;  1OYY A;  4A2U A;  2JN6 A;  1NK2 P;  5FGM A;  3IH2 A;  4U0Y A;  1XTA A;  2R7O A;  4M3E A;  1I6X A;  4E7Z A;  5K5O A;  4MEX F;  1ZHF A;  1IDY A;  3FWE A;  1Y39 A;  1KYW A;  5D4R A;  2KT0 A;  4AD9 A;  2VB6 A;  4HYE A;  3TOB A;  4KUM A;  1LQ1 A;  3MCZ A;  2CFO A;  1RPW A;  1Y56 A;  3PSI A;  5L3C A;  5JLW A;  4L9V A;  3TDU C;  4WX9 A;  3OYD A;  1T8I A;  2C6Y A;  2V26 A;  1ETQ A;  2FNP A;  2XHK A;  3FIS A;  3MKY B;  1NK3 P;  2EIL H;  2JPB A;  1R4M B;  3F3X A;  3QAH A;  3KP5 A;  4M71 A;  1DDN A;  2LC2 A;  3MFK A;  1LUJ B;  2R7R A;  4XRM A;  3HUG B;  2FML A;  1UHM A;  2DA7 A;  3KYL A;  3WTX C;  4FQG A;  2AQF A;  4XKW A;  3I0T A;  4R1H A;  3T8R A;  1REP C;  4CHU A;  3E6C C;  4AVZ A;  1K78 A;  3DXJ F;  5FD5 A;  2BY1 A;  3I55 I;  1MNM C;  2P6S A;  1JKP C;  4M3D A;  2L7M P;  3C7J A;  1FT9 A;  2OBP A;  3QWL A;  3OYE A;  4E7J A;  1F4K A;  5F1J A;  4O6J A;  2JUC A;  5HNF A;  2P4W A;  4ESF A;  2XSD C;  1R9T J;  1JHF A;  3CQZ J;  4Y17 A;  1UFM A;  5IP7 J;  2V1X A;  3SFI A;  5HVQ C;  4IOC F;  3HRU A;  2JZY A;  2UWM A;  3QPL A;  4U7B A;  4LFU A;  3CUO A;  4HDV A;  1JHH A;  1QZE A;  2L7Z A;  1X3U A;  2WB1 N;  2Y69 H;  5D6F A;  1RIO H;  1GVJ A;  2VPR A;  4LIV A;  3FM3 A;  1U5T C;  2WAQ N;  2VKV A;  2CRG A;  3IC7 A;  3WTZ A;  4JX6 A;  1XCV A;  2LD5 A;  1BW6 A;  4M6X A;  2XPW A;  1QVU A;  1VQ4 I;  1UJ8 A;  4FCY A;  3CDI A;  1JUP A;  5E1Z B;  3NAR A;  3CUQ B;  2CW7 A;  2VPL A;  4R79 A;  3HM5 A;  2H09 A;  3JSO A;  1XSV A;  1X1D A;  2E2J J;  2KIM A;  4BBR J;  4PSX A;  3SXY A;  3R0J A;  3ZR8 X;  1OQY A;  3GYH X;  3NEU A;  1J0R A;  1TTY A;  1QZY A;  3BR0 A;  4UB6 C;  2DMQ A;  1D5V A;  3BP8 A;  2ICW G;  3EPZ A;  3KCC A;  1FLI A;  4DOZ A;  2X9D A;  5EGO A;  3JCU C;  1T38 A;  1RET A;  2H6C A;  2BBY A;  2F6C A;  4PJL A;  2DT7 B;  1G3W A;  2YX4 A;  3RPQ A;  4EM1 A;  3HEF A;  4PDK A;  5DEQ A;  4N4O B;  2E5Z A;  4N4N B;  4G6T B;  5E18 F;  1U5T B;  3WU0 A;  1DPU A;  4ZYG A;  2DLL A;  2RNG A;  5ICF A;  1YX5 A;  5JVG F;  2NVY J;  3RZD J;  3BCA A;  3E0J B;  3AL0 C;  1IO2 A;  4YIR X;  4MFD A;  3DV8 A;  2UZK A;  4B8X A;  5CJ9 A;  5JHU A;  3B6A A;  2VON A;  3H1C A;  3BG3 A;  5LD2 C;  2G9W A;  5FLV A;  5HLI A;  4XRS A;  2K27 A;  1YX3 A;  2Z2S B;  4IKF A;  4Y33 A;  4HLY A;  1YI2 I;  4BEH A;  4A3F J;  3LSJ A;  4ZJZ A;  3G73 A;  1T6S A;  5D8K B;  2DOF A;  2MH9 A;  3V42 A;  4V19 K;  2LMD A;  3FX3 A;  3NRV A;  3ML6 A;  3DBL B;  2LSO A;  2L4M A;  3A02 A;  5ICG A;  3P9I A;  2UV1 A;  1YJ9 I;  1S72 I;  1Z67 A;  3HZJ A;  2YS9 A;  1MSE C;  4Y13 A;  3H5R A;  4YFN F;  1U9O A;  3ONQ A;  1GDT A;  1QGP A;  2L3D A;  5D8L B;  5D4S A;  2V1U A;  1MD0 A;  1WGX A;  4LMY A;  1N77 A;  2QQA A;  2QA4 I;  2G7H A;  3BZC A;  2BW3 A;  3IH3 A;  3W2V A;  3TMO A;  2IS4 A;  1Y0U A;  3HOU J;  2DK8 A;  4XLF A;  3T1B A;  5HLH A;  2M7A A;  5DM7 F;  4L18 B;  3U1D A;  3NAU A;  3DLL F;  4XOR A;  2KPM A;  1R1U A;  1LNW A;  4CYC A;  1RR7 A;  1GV5 A;  2XAG A;  1IW7 F;  3L7W A;  1YQA A;  1RNL A;  2GAU A;  4ENM A;  4EJT A; 
#chains in the Genus database with same CATH homology
 4AVP A;  4P9U A;  3E5Q A;  2DPU A;  3E6D A;  2QWW A;  2XRN A;  2P7C B;  1TNT A;  5L3F A;  5TJJ A;  1K79 A;  3KLN A;  2MLK A;  3GLX A;  5FLX K;  3RKX A;  1W5T A;  2M1B A;  2F5D A;  4CXF A;  3LST A;  2VN2 A;  1ZG1 A;  1BIA A;  3RKW A;  1XGM A;  2HEO A;  4WXD A;  1KQ9 A;  4YFK F;  3K1P A;  3V8J A;  3WTW C;  1GXP A;  2L54 A;  3O3K A;  5DUK A;  1FP1 D;  2ISZ A;  3V8K A;  4RGX A;  2HZT A;  4IVN A;  5L3G A;  2WV0 A;  1DP7 P;  2LF8 A;  3RTR A;  2Z33 A;  4AIJ A;  2ISY A;  3ISP A;  3G3Z A;  1O3R A;  5LHG A;  1MKM A;  5DDG A;  2V79 A;  3F6V A;  3QU3 A;  1IN7 A;  2XGX A;  2L01 A;  4HZF A;  2DPD A;  3HTU A;  2YSR A;  3PQJ A;  3V7S A;  1Z91 A;  3TO7 A;  4WWC A;  3SHF A;  1Z6R A;  2DFI A;  4P96 A;  3JSP A;  1Z9C A;  3RDI A;  1U8R A;  3T0Y A;  2R3S A;  2RGV A;  5DD8 A;  2OQG A;  2VBW A;  1B1B A;  2NYX A;  4L9J A;  3KP2 A;  2XAQ A;  2M8E A;  1G4D A;  2A6H F;  1ZRC A;  1W7P A;  1O57 A;  2ZNZ A;  2OAZ A;  2EK5 A;  1J5Y A;  1Z1D A;  4H0E A;  1KGS A;  4KYW A;  3J80 Z;  1CF7 B;  3B02 A;  1HBX G;  2HDC A;  5EEG A;  2XVC A;  1WKM A;  3HIF A;  4XSX F;  2PFB A;  1R58 A;  3HSF A;  1HSJ A;  4JK1 X;  1SFU A;  2KJB A;  1SD5 A;  5FD6 A;  3ZPL A;  2EV6 A;  4RGS A;  4I98 B;  2F5C A;  3FMQ A;  4EM2 A;  1ZGJ A;  1YLF A;  1KU9 A;  3J81 K;  3E5X A;  1TNS A;  2Q8K A;  1XMA A;  4FX0 A;  3K9T A;  1FP2 A;  3SZT A;  1BBY A;  4I02 A;  2GIV A;  2V1D A;  1T0F A;  3Q5F A;  1SAX A;  1I27 A;  1FOK A;  5DV5 A;  3JAM K;  5IT9 Z;  1XGN A;  3KFW X;  4BHB A;  3KP3 A;  2FSW A;  3GFM A;  2E1N A;  6PAX A;  4GYI A;  4JBA A;  1XSX A;  4Z2Y A;  3HSE A;  3D5L A;  1YS7 A;  4KNY A;  1HW5 A;  1ZRD A;  4WCG A;  4PGG A;  3K69 A;  2XKP A;  1YS6 A;  4UNO A;  3D0S A;  3JTH A;  2ESH A;  3TOA A;  2HYG D;  5J8F A;  4U7D A;  1DPR A;  1R5H A;  5K5Q A;  1IXR C;  2HTS A;  2DBB A;  2JTV A;  4UV8 A;  4A5N A;  1S6L A;  3RPU A;  2VC1 A;  4HA8 A;  4GYG A;  2E7W A;  4LG0 B;  4O5V A;  1ZRF A;  5ILU A;  4KIC A;  2Y75 A;  3HRM A;  2IA1 A;  4M9X A;  4IF4 A;  1LEB A;  1LDK B;  4G7O F;  4ZZD A;  4EGY A;  3FXQ A;  5LGN A;  3FF5 A;  1D8J A;  3BY6 A;  4U0W A;  1MJB A;  2VBX A;  3F23 A;  4L9T A;  4AIH A;  3QPT A;  5LLQ A;  2K7L A;  3L09 A;  3ZN1 A;  1U78 A;  2O61 A;  2FBI A;  4LLG F;  5LEK A;  2R7F A;  2Y0M A;  2NNY A;  3W6K B;  4LGW A;  2HOE A;  2FXA A;  2GXB A;  4AWX B;  2JRT A;  4ZZL A;  3K2Z A;  3TGN A;  2X4H A;  5BPD A;  4BH9 A;  3KE2 A;  4HV5 A;  1SD4 A;  1WI9 A;  1USS A;  3HHH A;  3F8C A;  4HBL A;  1HXD A;  4M6Y A;  5LEJ A;  2VBY A;  5LHH A;  1P4W A;  1GXQ A;  2FQ3 A;  4BQA A;  3TKY A;  3ZMS A;  2ZME A;  4M9S A;  3CO6 C;  2BYV E;  3H3U A;  1BOA A;  4MTE A;  2FEZ A;  4Q47 A;  2A68 F;  2W85 A;  3CJN A;  2F5E A;  4NQW A;  1QPM A;  1KYZ A;  2RNJ A;  1LDJ A;  3QRF F;  1U6G A;  3F8M A;  5H6Q A;  3H3Z A;  4HQM A;  1FX7 A;  3HRT A;  4UVC A;  3BDD A;  5CVI A;  5LGT A;  4WF2 A;  4K2E A;  1B6A A;  2R7D A;  1RUN A;  4HX7 A;  2KIU A;  2NAZ A;  3IRQ A;  3KZY A;  4CYD A;  1S7A A;  3F8N A;  3HHG A;  3L9F A;  2VE8 A;  3CUQ C;  4S05 A;  1YYV A;  3E3V A;  3VEP A;  3LA2 A;  4HX4 A;  2OZU A;  4WXC A;  4UHT A;  1Z05 A;  3K1N A;  1LDD A;  1PUE E;  3QP6 A;  2FE3 A;  2EV5 A;  2FMY A;  2EWN A;  1UB9 A;  4RB1 A;  5F6F A;  2PBI A;  1JXS A;  3HUG A;  2Y48 A;  2QEN A;  1MGT A;  1IN8 A;  1FBU A;  1TQM A;  2D1H A;  2ZO4 A;  1G6N A;  1IN6 A;  3E97 A;  3F21 A;  3WGH A;  4FT8 A;  1WSU A;  4KT5 C;  3K0L A;  1IRF A;  5D6E A;  4MQV A;  3WTT C;  2FBK A;  3GFI A;  1OYW A;  5FB2 A;  4ESJ A;  4XRF A;  2B0L A;  1AOY A;  2M45 A;  1Z6T A;  4YII A;  3GUD A;  2ZCW A;  5HS9 A;  1FYL A;  4OIR F;  3FXR A;  1IN5 A;  1FNN A;  2ZXJ A;  3WGG A;  5HOO A;  4DQ2 A;  1KQ8 A;  1HQC A;  2F5F A;  4MTD A;  4L5J A;  2DT5 A;  2XAH A;  1R22 A;  3CUQ A;  4LJZ F;  5F64 A;  1BN5 A;  3LAP A;  1G3Y A;  1B4A A;  2FF4 A;  2CFX A;  1FZP B;  1R5G A;  3ABU A;  2VT2 A;  1FYM A;  1ULY A;  4KN4 X;  3FMS A;  1HW2 A;  3CO7 C;  3K1M A;  5E20 A;  1U3E M;  1SFX A;  2LDU A;  1U5T A;  1KU3 A;  2PEX A;  3WTV C;  3W6J B;  1WWX A;  3O6B B;  2XAS A;  2IVM A;  3MZH A;  5CVR A;  2RKH A;  4MNU A;  1SMT A;  2OA4 A;  4PCQ A;  2HWV A;  1HST A;  1A04 A;  4EJU A;  1LB2 A;  2G7U A;  5D5W B;  3F8F A;  4EMS A;  4LB6 B;  3WGI A;  3V7C A;  3IHU A;  3FHZ A;  2QQ9 A;  3ERE D;  2DU9 A;  4OIP F;  2P7V B;  2XUB A;  5DD4 A;  4IPA A;  4EM0 B;  3GEZ A;  4G7Z F;  3WOD F;  2LNB A;  4WXH A;  1YW7 A;  1B9M A;  3R60 A;  1G3S A;  3R4K A;  2AXL A;  1ZG3 A;  2A69 F;  2PMH A;  1BM9 A;  4I0B A;  5FFZ A;  1E17 A;  1JE8 A;  2L4A A;  2W24 A;  2QUF A;  2V6C A;  3EUH A;  4ZYH A;  1SD7 A;  3I59 B;  4OIN F;  1R23 A;  1F1Z A;  5D5X B;  1G3T A;  4IRH A;  4A5M A;  5K5R A;  3ZQ7 A;  2EFQ A;  2O3F A;  4N0B A;  4BYY A;  3GZ5 A;  5DYM A;  1PDN C;  3ZMU A;  2K4B A;  1I1G A;  5CVU A;  2JPC A;  3GFJ A;  1ONV A;  2CGP A;  4Q48 A;  1LVA A;  3ZN0 A;  3LQR A;  5HDG A;  1OPC A;  1ZAO A;  3IRR A;  3TO9 A;  2DQR A;  3WTS C;  3RI4 A;  1J59 A;  1ZN2 A;  2EFP A;  3DPT A;  1D3Y A;  5HDN A;  1P92 A;  2VOO A;  3KET A;  2P5V A;  4RB3 C;  3M9A A;  3I5U A;  4ESB A;  4LLN A;  4OMY A;  4D0P A;  2A3S A;  5L3E A;  4I7H A;  3F72 A;  4OIQ F;  1OKR A;  3HYI A;  2KJC A;  4JQF A;  4FX4 A;  3WU1 B;  1JGS A;  2ZJ2 A;  1WRJ A;  3DF8 A;  3WTU C;  1V3F A;  3GF2 A;  1ZG5 A;  2IW5 A;  4EJW A;  4DNC A;  3BJ6 A;  1L3L A;  4YIF A;  2CSO A;  4MEY F;  2DTR A;  3I4P A;  1FYK A;  2DAO A;  2EA4 A;  2JSC A;  1TBX A;  3GFL A;  5JI6 A;  1KU2 A;  5DCM B;  2HKX A;  1BC8 C;  4KIB A;  4CO8 A;  1MDM B;  4HF2 A;  1TQI A;  5EEH A;  1CGP A;  1YFH A;  1MJA A;  1XD7 A;  1BIB A;  4A12 A;  3KP6 A;  4KFC A;  3QP5 A;  3U2R A;  1O3Q A;  2QBY B;  2MD5 A;  2Z9O A;  1HW1 A;  3O2P E;  1DUX C;  2ELH A;  3RIR A;  2BE5 F;  1SD6 A;  4Q4Z F;  4XBF A;  1R1T A;  1YO5 C;  3MEX A;  1S29 A;  2PLY A;  1BI3 A;  2O8X A;  3TQN A;  1O7L A;  3CLO A;  2YU3 A;  4M9Z A;  1CF7 A;  3L2C A;  4RAY A;  4BHP A;  1SFE A;  5FO5 A;  2RN7 A;  2QBY A;  4P9F A;  3IL2 A;  2IA0 A;  4HF1 A;  3BRO A;  2DO7 A;  2Z99 A;  4A6E A;  4RGR A;  5E8I A;  1O7F A;  5JR3 A;  3I71 A;  1XCB A;  2EB7 A;  3GO5 A;  1K7A A;  3IWF A;  4IHS A;  4G8X A;  2QM3 A;  4MQ9 F;  1IRG A;  3MAJ A;  3Q9S A;  3IKV A;  4A0X A;  4KIF A;  4ASN A;  3JTG A;  1H0M A;  3HSR A;  2QQB A;  5CYV A;  1FBQ A;  2XIG A;  4HOB A;  1FPQ A;  4QWQ A;  1H9T A;  4IRI A;  4U0V A;  2UXN A;  1KQ0 A;  3N97 A;  4GCV A;  4IXA A;  4KMU X;  3RKY A;  3WE3 A;  1Z7U A;  3WG9 A;  4G6D A;  2HYF A;  2WC2 A;  5BMZ A;  1OYI A;  1GHC A;  2GWR A;  2QVO A;  3VB2 A;  1QZZ A;  4LK0 F;  3FZV A;  4LG0 A;  1UHW A;  4NB5 A;  1IF1 A;  4KMF A;  1WQ2 A;  4KIG A;  2RC4 A;  3R0A A;  5K1Y A;  1HKS A;  1IAW A;  3FM5 A;  2D2W A;  3MZY A;  5ICE A;  2RQP A;  3WTY C;  5KVR A;  3GVA A;  1XDU A;  4EQQ A;  2YX7 A;  2PG4 A;  1YG2 A;  5BS6 A;  3GWZ A;  4IJA A;  5LGU A;  1FSE A;  2YPR A;  1ZAR A;  4HX8 A;  1ON2 A;  2HTJ A;  2VC0 A;  1XN7 A;  3EDP A;  2MLG A;  1U2W A;  2D1V A;  5BQT A;  2EJR A;  1Q1H A;  2EFO A;  3C18 A;  3HOT A;  3REO A;  4P55 A;  3Q9V A;  4UUV A;  5H6R A;  4ZYD A;  2M87 A;  3FXU A;  4ENJ A;  3SFZ A;  4HDU A;  2LKP A;  4L5I A;  3DEU A;  3LA3 A;  4Q5S F;  3HOS A;  1H9G A;  1LJ9 A;  4PZJ A;  2H27 A;  3EET A;  4OOI A;  3HRS A;  5FLX Z;  5ILS A;  1TW3 A;  5ERI A;  5L3B A;  2FBH A;  2Z5U A;  3GZ6 A;  2MC3 A;  3P9C A;  1B59 A;  4ZH4 F;  2A5Y B;  3RYP A;  1BI0 A;  2VXZ A;  4OIO F;  1XSD A;  1MZB A;  1ON1 A;  4O3M A;  3J80 K;  5AON A;  4KN7 X;  4EJO A;  2PJP A;  3HTS B;  3BPV A;  2ZFW A;  3M7G A;  1YW8 A;  3T5X A;  5TRD A;  3EYY A;  5L3D A;  2XAF A;  1LEA A;  4I2O A;  1KU7 A;  3M8F A;  2XRO A;  2JT1 A;  2RV8 A;  1K78 B;  3DKW A;  2QLZ A;  1HKT A;  1D8K A;  4RB0 A;  5J8C A;  3DFG A;  2J5O A;  2RDP A;  3ROU A;  1P4A A;  3C1D A;  1FC3 A;  2QYO A;  2VOD A;  5A2Q Z;  3DQV C;  4I01 A;  4YG2 F;  2EFN A;  2V9V A;  3VFZ A;  1ZGA A;  4FHT A;  4LLL A;  2WWY A;  2K86 A;  5IT9 K;  4TV7 A;  2Z3Y A;  5BPI A;  3MWM A;  5ILV A;  2IPQ X;  4N9H A;  4PGH A;  4XSZ F;  3LWF A;  2OD5 A;  2CYY A;  2ADU A;  2IT0 A;  1TW2 A;  1S3J A;  2CW0 F;  2HQR A;  3R6S A;  3VOD A;  2STW A;  3B73 A;  3M8E A;  4G6Q A;  4I09 A;  3MQ0 A;  3J7A O;  2W57 A;  3I54 A;  2P5K A;  5HLG A;  5E17 F;  4EGZ A;  1R1V A;  2HFH A;  4CZZ A;  3EYI A;  1QBJ A;  1UCR A;  3OOP A;  1FBS A;  1ZH5 A;  4M72 A;  3ZMV A;  2ACJ A;  2Q2E A;  5E1X A;  1KA8 A;  1I1S A;  2TDX A;  4L9N A;  2MH2 A;  4L0Y B;  2M30 A;  3KZZ A;  3C3W A;  4ENK A;  3J81 Z;  1RUO A;  2PN6 A;  4GGG A;  3I58 A;  2OZ6 A;  1FWZ A;  3E6M A;  4L0Z B;  4Y15 A;  3GXO A;  1J7K A;  1UST A;  4LB5 A;  4RAZ A;  1EH7 A;  2YR2 A;  3R61 A;  3LQQ A;  2PMU A;  4HLX A;  5BOX A;  3LFK A;  4HAM A;  5E1W A;  3JAM Z;  3P9K A;  4G9Y A;  2K02 A;  2CQK A;  2Q0O A;  4M73 A;  1HKQ A;  4UVB A;  3KP7 A;  4A0Z A;  5HS7 A;  1XB4 A;  2FRH A;  4UVA A;  3I64 A;  3ECH A;  1P2F A;  3QOP A;  3KLO A;  4P5O A;  3IKT A;  3OV8 A;  3ELK A;  2UXX A;  4UV9 A;  3E6B A;  4RB2 C;  5DCF A;  2HKO A;  4XLP F;  2O03 A;  2WTE A;  2H94 A;  3BWG A;  2FU4 A;  2HS5 A;  4G7H F;  4HW0 A;  3T8T A;  2CG4 A;  3GW2 A;  4NHJ A;  1FY7 A;  3I59 A;  3BJA A;  2IA2 A;  3U9G A;  2ZBK A;  1J9I A;  5JVT A;  5DUI A;  2DQL A;  2P8T A;  1L0O C;  4EV0 A;  3KP4 A;  4OU0 A;  1O3T A;  2CWE A;  2BEO A;  3AAF A;  3V4G A;  3FMR A;  2PQ8 A;  4G94 A;  4CIC A;  3SQN A;  5CLS A;  3S2W A;  2EA2 A;  3I53 A;  1ZYR F;  5JFR A;  5A2Q K;  2E1C A;  1T2K A;  2ETH A;  1R00 A;  2COM A;  1T98 A;  2GA1 A;  3E5U A;  5AIQ A;  1W7P B;  2D45 A;  1AWC A;  1VTN C;  1QO0 D;  2A07 F;  3DPL C;  2HQN A;  5ED4 A;  2H6B A;  2GZW A;  3GX4 X;  3P7N A;  1V4R A;  1W4M A;  3QPH A;  2J5P A;  4LD5 A;  1P6R A;  4CGZ A;  3V7R A;  1RZ4 A;  3ULQ B;  4KDP A;  4GO1 A;  5IT3 A;  5HDK A;  1IUY A;  1R36 A;  1EH8 A;  4OMZ A;  4BHC A;  5DCM A;  5KK1 A;  4ZYE A;  3ECO A;  2P5L C;  4HQE A;  1BJA A;  2VBZ A;  1B9N A;  3TO6 A;  1OMI A;  1ZRE A;  1MDM A;  1IZ1 A;  2E7X A;  1T39 A;  3CDH A;  4N9I A;  3CTA A;  1YTY A;  3BPX A;  2IJL A;  4AIK A;  1W5S A;  4B09 A;  3TDZ C;  3BZ6 A;  1C0W A;  2ZNY A;  3F22 A;  3NQO A;  4GXO A;  4ETS A;  2VT3 A;  1F5T A;  2STT A;  1IXC A;  5HS8 A;  1BI1 A;  3L00 A;  4ENN A;  4A6D A;  2FNA A;  5LHI A;  4XLN F;  4CDG A;  1RI7 A;  4QLC U;  5LRS A;  2KKO A;  4BXU A;  4EVI A;  3PFI A;  2GQQ A;  4R8H A;  5ICC A;  1S7O A;  2NS0 A;  1XGO A;  2IRF G;  5E8G A;  1ODD A;  1J2X A;  2RVC A;  1O3S A;  2A61 A;  1FSH A;  4IHT A;  2ESN A;  3N4M A;  3EQL F;  1IN4 A;  2BGC A;  5D5V B;  3RJP A;  2EV0 A;  4MHG A;  2FA5 A;  3RYR A;  3LA7 A;  1QNT A;  2CO5 A;  1PP8 F;  1XDS A;  1S8N A;  1J75 A;  4ON0 A;  1ZLK A;  1P4X A;  3VOE A;  4IRG A;  2GA2 A;  3QU6 A;  5LBQ A;  2VOP A;  2DI3 A;  3DP7 A;  5CVV A;  4HF0 A;  3WE2 A;  1EV7 A;  1XMK A;  2KRF A;  3PQK A;  3ABT A;  2W84 A;  2QZ8 A;  3BOQ A;  5D5U B;  4F7Z A;  4RS8 A;  4E70 A;  4WK8 F;  3IWZ A;  4YFX F;  1BI2 A;  4LK1 F;  3COA C;  3M1E A;  1IXS B;  2HGC A;  3ZP5 A;  5AIP A;  3KEO A;  2L02 A;  1SMY F;  2X0L A;  1E2X A;  2LF7 A;  3KEQ A;  3BJO A;  3ZMT A;  2PI0 A;  2NRA C;  2NNN A;  3V8L A;  1TLH B;  4MGR A;  2HR3 A;  3F8B A;  1W7P D;  2K4J A;  2KIF A;  2VE9 A;  1I5Z A;  2GXG A;  2F2E A;  3ZMD A;  1K6O A;  5H20 A;  5J6X A;  3JW4 A;  2XV4 S;  4KA4 A;  2O0Y A;  2ZME B;  4U88 A;  2A6E F;  3LAJ A;  3ZMZ A;  2BV6 A;  2IP2 A;  2O6G E;  1PP7 U;  1ZLJ A;  1NHA A;  1F9N A;  2XAJ A;  4I0A A;  4RGU A;  2OQR A;  1YW9 A;  5FFX A;  4BAY A;  2P6T A;  2DK5 A;  4S04 A;  2MBF A;  2FOK A;  5F1R A;  1OR7 A;  2W25 A;  4M74 A;  1YIO A;  1STZ A;  4EJV A;  2M5W A;  3H92 A;  2EFW A;  1QQI A;  2MA3 A;  2XKO A;  4UXN A;  1BC7 C;  2OU2 A;  2DW4 A;  5LRR A;  1R7J A;  4A0Y A;  1MJ9 A;  2AS5 F;  2ZKZ A;  1TQP A;  1XGS A;  3F6O A;  3SZP A;  1EH6 A;  4HV6 A;  4BNC A;  5CVJ A;  1OYY A;  4A2U A;  5FGM A;  4U0Y A;  1I6X A;  4MEX F;  5K5O A;  1ZHF A;  3FWE A;  1KYW A;  5D4R A;  4AD9 A;  1LQ1 A;  3TOB A;  4HYE A;  4KUM A;  3MCZ A;  5L3C A;  4L9V A;  3TDU C;  4WX9 A;  2C6Y A;  2FNP A;  2XHK A;  2JPB A;  3F3X A;  3QAH A;  1DDN A;  3KP5 A;  4M71 A;  3MFK A;  2FML A;  1UHM A;  3WTX C;  3I0T A;  4R1H A;  3T8R A;  1REP C;  4CHU A;  3E6C C;  1K78 A;  3DXJ F;  5FD5 A;  2P6S A;  3C7J A;  1FT9 A;  2OBP A;  1F4K A;  4O6J A;  2P4W A;  4ESF A;  1JHF A;  4Y17 A;  1UFM A;  2V1X A;  5HVQ C;  3HRU A;  2JZY A;  2UWM A;  4U7B A;  4LFU A;  3CUO A;  4HDV A;  1JHH A;  1X3U A;  5D6F A;  1RIO H;  1GVJ A;  3FM3 A;  1U5T C;  3IC7 A;  3WTZ A;  1XCV A;  4M6X A;  5E1Z B;  3CUQ B;  4R79 A;  2H09 A;  3JSO A;  1XSV A;  2KIM A;  3GYH X;  3SXY A;  3R0J A;  3NEU A;  1J0R A;  1TTY A;  1QZY A;  1D5V A;  3BP8 A;  3KCC A;  1FLI A;  1T38 A;  2H6C A;  2BBY A;  1G3W A;  2YX4 A;  3RPQ A;  4EM1 A;  4PDK A;  5DEQ A;  1DPU A;  5E18 F;  1U5T B;  3WU0 A;  4ZYG A;  2DLL A;  5ICF A;  3DV8 A;  2UZK A;  4B8X A;  5CJ9 A;  5JHU A;  2VON A;  2G9W A;  5HLI A;  2K27 A;  4HLY A;  3G73 A;  1T6S A;  5D8K B;  2MH9 A;  3FX3 A;  3NRV A;  3ML6 A;  2LSO A;  2L4M A;  5ICG A;  3P9I A;  4Y13 A;  4YFN F;  1QGP A;  2L3D A;  5D8L B;  5D4S A;  2V1U A;  1MD0 A;  4LMY A;  2QQA A;  2G7H A;  1Y0U A;  2DK8 A;  3T1B A;  5HLH A;  4L18 B;  3U1D A;  1R1U A;  1LNW A;  2XAG A;  1IW7 F;  3L7W A;  1YQA A;  1RNL A;  2GAU A;  4ENM A;  4EJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...