2K4JA

Arsr dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
GSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRGIGYKLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TRANSCRIPTIONAL REGULATOR
publication title ArsR DNA Binding Domain
rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4jA00
1I1GA 3I59B 4UHTA 2D45A 1ZGAA 2DAOA 2QENA 1UFMA 4EJWA 3O3KA 2IA0A 1IW7F 3RKYA 2O8XA 3I4PA 2CGPA 1ULYA 3J80K 3KP7A 4A12A 5KK1A 3NQOA 3LQQA 3JAMK 2STTA 1P4WA 2H94A 3N97A 1UB9A 3GFLA 4ESBA 5H20A 1OPCA 4WK8F 2V6CA 4R8HA 5ICCA 2F5EA 4AIJA 1XGMA 2P7VB 1E17A 3GFMA 1I1SA 3ZMSA 2IA2A 3LAPA 3DXJF 2DO7A 1KU9A 3I59A 5ICGA 3RYPA 1LNWA 2GXGA 2Y75A 1K7AA 3WTWC 4IVNA 4L5JA 4NB5A 6PAXA 3OV8A 5H6RA 3T0YA 4WXDA 4M9XA 5LRSA 1TW2A 1ZGJA 2EFPA 5HVQC 1Q1HA 3FX3A 3I71A 2HTSA 2RKHA 4U0YA 2F5DA 1O3SA 4HLXA 2PMHA 1A04A 3BJ6A 3KP2A 1QBJA 2FNAA 1S3JA 2ADUA 1XGNA 5IT3A 3KP3A 1R7JA 3GF2A 2DI3A 5DCMA 3TDZC 1KQ8A 5JFRA 2P8TA 4LLNA 5DD8A 3KZZA 1O57A 4TV7A 2EV0A 5E1XA 3Q9SA 2ZXJA 4KT5C 4RS8A 3WTYC 3BJOA 3EQLF 1TNSA 4HAMA 3BP8A 3SXYA 3K1NA 5H6QA 2BEOA 3F22A 4Q5SF 5LRRA 3RJPA 1O7LA 2CO5A 1P92A 4N9HA 4I2OA 1OYYA 4R79A 1YW8A 1FZPB 5JHUA 3COAC 3I58A 4P55A 4U7DA 1EH7A 5FO5A 2VODA 5E8IA 3HOTA 2O61A 1K78A 1KQ9A 4OIPF 2IVMA 2BYVE 1FLIA 5DUIA 3V7SA 2K02A 4HA8A 5DCFA 2XGXA 1MJAA 3H3UA 2GA2A 3F6OA 2PQ8A 4LD5A 4LB6B 2ESNA 1QZYA 3M9AA 3CO7C 3V7RA 1IN8A 2ISYA 2W85A 3GW2A 4BHPA 3FMRA 3GLXA 2P6TA 1WWXA 2RC4A 2HQRA 5BQTA 2IA1A 5D8KB 4HF2A 3T5XA 2Y0MA 5FLXK 2L01A 3BY6A 5L3CA 5LEKA 3BROA 1LJ9A 1FOKA 5ED4A 2QBYB 1LDJA 1IAWA 1W7PD 4EJTA 3LWFA 4IRIA 1HW5A 4Z2YA 2YU3A 4MTEA 4GO1A 1FPQA 1LDDA 4AIKA 4NQWA 2PN6A 1QQIA 2HEOA 5LLQA 3GEZA 5ILSA 4XLNF 3WODF 1XSDA 1XGSA 3LA7A 4RGRA 4IHTA 1ZHFA 4GYIA 5FFXA 5E1ZB 3CJNA 1DUXC 3TO9A 5HDGA 2MC3A 4FX4A 5LGUA 1PP7U 2XAJA 5LHHA 1B1BA 4RAYA 1YIOA 1BBYA 2QBYA 2AS5F 3CLOA 2ZJ2A 2E7WA 3G73A 5BOXA 3C7JA 2H6BA 3JSPA 5CVUA 2KRFA 5FD6A 4KA4A 1J75A 1ZRFA 1WRJA 2A07F 4G7OF 1V3FA 1IN4A 3IHUA 4G7HF 1YLFA 4BNCA 4MQVA 3GYHX 3T8TA 4EM0B 3IKVA 3SHFA 1FNNA 1Z1DA 2LSOA 4GGGA 3FXUA 1OMIA 1ZRDA 1OR7A 2M87A 2ELHA 2VN2A 1W5SA 1FSHA 2MLGA 3BPVA 4IPAA 4M6YA 2VT2A 4A0ZA 1AOYA 5F64A 4I7HA 1LEBA 2FBHA 2M30A 3SQNA 3HHGA 2HZTA 4L18B 1T98A 3DQVC 2H6CA 1L0OC 1IN6A 2PEXA 3R0AA 3DFGA 2LNBA 1FT9A 5BMZA 5ILVA 3ECHA 1S8NA 2TDXA 1HKTA 3WE2A 4NHJA 5HDKA 1WI9A 3DV8A 4O6JA 4CZZA 1U6GA 1G3WA 3E6BA 1G3TA 2FRHA 3K1MA 1FYKA 2OU2A 2XAFA 1U8RA 4U88A 3ECOA 2ZNZA 3LQRA 2X4HA 5JI6A 4KN7X 5A2QK 4K2EA 2GXBA 2H27A 2EK5A 3MZHA 3C1DA 3IRRA 1FY7A 2W84A 4UVBA 2EB7A 4EM2A 5LHIA 3FM5A 1RIOH 1R22A 1IRGA 4M6XA 3E97A 2FF4A 3WTXC 1TQIA 1RUOA 5DV5A 3V8JA 3F8CA 5HS9A 4GXOA 2HDCA 1P4XA 2BV6A 1W4MA 2HGCA 3RDIA 1IN5A 3GZ5A 4ZYGA 2V1DA 1W5TA 2YPRA 4MEXF 1G4DA 2LF7A 3HSRA 4U0WA 3VOEA 1ZG5A 2OA4A 2VBWA 2GWRA 3P9CA 1X3UA 5IT9K 2O0YA 2ACJA 3C18A 4Y13A 4A0XA 1Y0UA 1ZREA 1YFHA 4P9FA 2KJBA 3NEUA 1W7PB 1TW3A 3DEUA 2VE8A 4KN4X 4MEYF 5FD5A 1MD0A 2JPBA 4KUMA 1MDMA 3K9TA 4MTDA 1T2KA 4WWCA 2PI0A 5TRDA 5CVJA 3ZMUA 4CO8A 3O6BB 2VBYA 1MZBA 4P96A 3RTRA 3PQKA 2JSCA 2ZFWA 3K69A 2IRFG 2G7HA 5HOOA 2ETHA 3KE2A 3L09A 2M8EA 3KEOA 2A61A 3KLNA 3IWFA 4IRHA 4H0EA 3TO6A 1RNLA 4HBLA 2CFXA 2MLKA 5D5WB 3TGNA 1LVAA 1QO0D 1XGOA 4G6QA 3D0SA 1PP8F 3WG9A 2R3SA 2DBBA 2A69F 2ZMEA 1IXCA 4MHGA 5HLIA 4IRGA 4HX8A 1R1UA 5EEGA 1J9IA 2FNPA 3FWEA 4U7BA 3WTVC 4EV0A 1I5ZA 1YW9A 4L9JA 4Q48A 2R7DA 4BHCA 3HTSB 1IXSB 3RPUA 3CTAA 4ENMA 3EDPA 1JE8A 1XDSA 2IP2A 3TQNA 2LF8A 3LFKA 5L3FA 3HSFA 3E6CC 3J80Z 3W6KB 5LEJA 3GX4X 1J59A 1IUYA 2FEZA 1R1TA 3JAMZ 4I01A 1OYIA 2PFBA 2NYXA 2DT5A 3WU0A 3FF5A 5AONA 2FA5A 2CQKA 4HZFA 3ZPLA 2L4AA 4AIHA 3CUQB 1U78A 2MH9A 1ODDA 5D5XB 3V8KA 2Z99A 4N0BA 4A6EA 2YR2A 3SFZA 1TBXA 4ZYEA 4LGWA 5CJ9A 3HRTA 1SMTA 1ZG3A 2ZO4A 4KIFA 3I54A 4B09A 4BH9A 1FSEA 3GFJA 4OU0A 2FXAA 5E8GA 4HF1A 1Z9CA 2MD5A 4UV8A 2VT3A 4IXAA 4O5VA 2LDUA 4EJOA 4PGGA 1RUNA 1D8KA 2CSOA 1FYLA 1D8JA 2XV4S 4XSXF 3TDUC 4KIGA 2GIVA 1G6NA 5D4RA 4M71A 3U1DA 2OBPA 4JBAA 1BOAA 1RZ4A 5HS7A 5L3DA 2V1UA 5TJJA 1KQ0A 4OMZA 3RPQA 2VXZA 3MWMA 1WKMA 4Q47A 5K5RA 2ZBKA 5EEHA 4LLGF 4OINF 3R6SA 3MAJA 3F8FA 1J7KA 1IZ1A 3DF8A 3RYRA 1YG2A 1ZYRF 5CVVA 1Z6RA 2HYFA 3FZVA 2K86A 1ON1A 1MJ9A 4MGRA 1TTYA 4FT8A 2K4BA 1P6RA 1F9NA 1FP1D 2EA4A 2Q2EA 4OIOF 3RI4A 1JXSA 2E7XA 5BPIA 3QOPA 1S7OA 3B02A 3DPLC 1R00A 5DD4A 3QU6A 4YG2F 3EETA 4WCGA 2A3SA 4HDVA 4EQQA 3ROUA 3J7AO 2QYOA 1U5TB 3HRUA 4Q4ZF 2YX4A 2DQLA 2KIUA 4XLPF 4YIFA 2E1CA 2RNJA 3WGIA 2XAQA 2C6YA 3Q9VA 1GXQA 1SD4A 3ABUA 4G6DA 4YFXF 4DQ2A 5BS6A 5K1YA 1HQCA 1REPC 2VE9A 3OOPA 5LBQA 3D5LA 1IF1A 2HOEA 2QM3A 5LHGA 2LKPA 3BOQA 1KYWA 5F1RA 1ZAOA 2DQRA 2QWWA 4AWXB 4HQEA 5FLXZ 3HSEA 4YFNF 4RB2C 4S04A 2RV8A 4HW0A 1YW7A 1JHFA 4IJAA 1QPMA 2UWMA 1XSVA 2QUFA 4I98B 3CUQC 2NRAC 2K7LA 4A2UA 3KFWX 3ML6A 5AIQA 3L7WA 3M8FA 3H92A 4A5NA 2RDPA 1V4RA 3IL2A 4ESFA 2G7UA 3N4MA 5HS8A 3F21A 2Z9OA 3KZYA 3JTGA 2P5LC 4RGSA 1XMKA 1S7AA 1VTNC 2OAZA 2DK8A 2F2EA 1I27A 3CO6C 3F8MA 4RGUA 1HKQA 1EH6A 3P7NA 1TLHB 2BBYA 5JR3A 3ZMVA 3IKTA 5HLGA 3R4KA 1RI7A 3QP6A 2Q8KA 3E6MA 3ZMDA 1BI1A 3HRMA 1FX7A 1F4KA 4L0ZB 1EH8A 4HX4A 1YS7A 1TQPA 4KIBA 4EMSA 3MQ0A 4BHBA 1ZLKA 1R58A 2L54A 1NHAA 2IJLA 2XASA 4B8XA 4PGHA 5DEQA 3T8RA 3ZP5A 1R23A 3I64A 3CDHA 2FQ3A 4UV9A 5L3GA 3H3ZA 1IXRC 4BQAA 1FWZA 3V4GA 2XVCA 4RB0A 4OMYA 2V79A 2KJCA 3RIRA 1USSA 3GXOA 1ZG1A 1T0FA 2M1BA 2PLYA 1GVJA 3K1PA 3WU1B 1P2FA 1MKMA 1PDNC 4G8XA 3VODA 5CVRA 4LK0F 2ISZA 2EV5A 1IRFA 1U5TC 1YS6A 1WSUA 4QLCU 2W24A 4L5IA 1SFXA 1XN7A 2IPQX 3P9IA 1L3LA 4CXFA 1KU7A 3DKWA 1Z7UA 2CWEA 1B4AA 2Q0OA 1DP7P 3QP5A 2HS5A 1D5VA 1QNTA 3TOAA 4G7ZF 3FMSA 1BI0A 1MGTA 1XB4A 2OQGA 1R5GA 4ESJA 3FXQA 4HOBA 5A2QZ 2PG4A 1R36A 4OIRF 3T1BA 4HX7A 3DP7A 4EGZA 3F72A 2XIGA 3EUHA 1LQ1A 3WTSC 3MCZA 2Z33A 1AWCA 2QVOA 2G9WA 2E1NA 4LLLA 3F3XA 4MQ9F 4L0YB 3IWZA 2MA3A 4RB1A 3M1EA 5DYMA 3JTHA 3FM3A 1EV7A 2VOPA 3QPTA 4XRFA 2GQQA 3WTTC 5L3EA 1Z91A 4FX0A 3GFIA 5IT9Z 1BC7C 3BJAA 1QZZA 2RGVA 4PCQA 2J5OA 2M45A 2P5VA 3F23A 1HW1A 3J81K 1SFUA 4KFCA 3WGGA 4L9VA 1K6OA 3REOA 5FB2A 2ESHA 1HXDA 1KU3A 2KKOA 5ICEA 2L3DA 2K27A 3U2RA 3V8LA 1YQAA 4M73A 1B9MA 2HKXA 5E20A 2D1HA 3F8NA 2XAHA 2MBFA 2YX7A 1B9NA 1FBSA 3IRQA 3TOBA 4D0PA 1BN5A 2NAZA 2P7CB 2Y48A 4DNCA 2A6EF 4L9NA 1W7PA 1LEAA 1FBUA 5F6FA 3ABTA 4ON0A 1J2XA 1R1VA 4XBFA 4RB3C 4I09A 5K5OA 2QQ9A 2YSRA 1Z05A 2CYYA 1JHHA 3M8EA 1DPRA 4I02A 3KP6A 3R60A 1LB2A 3I0TA 2X0LA 4WXHA 2ZKZA 2F5CA 1HSJA 1SD6A 4LG0B 3Q5FA 2FSWA 3BPXA 2DLLA 4PDKA 3VFZA 4IHSA 3S2WA 2XKOA 5D5VB 4GYGA 4UXNA 2XAGA 3HOSA 2DTRA 2H09A 4ENNA 4CDGA 4OIQF 1ONVA 4HLYA 1O3QA 2OZ6A 5D8LB 2DU9A 2FOKA 4HF0A 4KICA 2DK5A 5DCMB 2FBIA 3ISPA 5KVRA 4ZZDA 4IF4A 2CW0F 1OYWA 2J5PA 3WGHA 2QLZA 3HRSA 4A6DA 2VOOA 3LAJA 4WF2A 2STWA 1XD7A 1J5YA 4AVPA 3LSTA 2OQRA 4ZYDA 2FU4A 2IT0A 4I0BA 3GZ6A 4LG0A 2QQBA 2PJPA 2FBKA 2COMA 5E18F 5CVIA 3BWGA 2L02A 4U0VA 1FC3A 2P4WA 4A5MA 1MJBA 2O6GE 2EFQA 2XHKA 1ZARA 3E3VA 3VB2A 5D4SA 1KA8A 1BI3A 3CUQA 2GZWA 2D2WA 1XSXA 5HLHA 4M9SA 1K78B 4JK1X 3SZPA 4QWQA 2ZNYA 2OZUA 2DFIA 1J0RA 2MH2A 2P6SA 3ZQ7A 2A6HF 4I0AA 5JVTA 1OKRA 1UHMA 3FXRA 3R0JA 3RKXA 3LA3A 1BI2A 3BDDA 2EV6A 1BC8C 2JTVA 3KP4A 1G3SA 4P5OA 1BM9A 2D1VA 2PBIA 1SD5A 2VONA 1GXPA 1Z6TA 2UZKA 2VC0A 4RGXA 4ZZLA 1ZH5A 5D5UB 1TQMA 3K2ZA 4UVCA 2JZYA 3ZMTA 2GA1A 3QPHA 1H0MA 4Y17A 2RQPA 4ASNA 3NRVA 1F5TA 1C0WA 4GCVA 4G9YA 3E6DA 4O3MA 1TNTA 2EJRA 1T39A 3SZTA 3ZN0A 3LA2A 3U9GA 1HKSA 1SMYF 3KEQA 5D6EA 3MZYA 1O7FA 1YTYA 4HDUA 1O3TA 1YO5C 2NS0A 1XCVA 2R7FA 2JT1A 2EWNA 3KP5A 4N9IA 5K5QA 4BXUA 2WC2A 1XCBA 3I5UA 3RKWA 1ZN2A 2UXXA 4UUVA 3E5UA 1B6AA 3ZN1A 3HYIA 3BZ6A 1BIBA 2AXLA 2EFNA 2W25A 4S05A 2GAUA 3KLOA 3V7CA 5CLSA 1USTA 3QU3A 3EYIA 4LB5A 3E5XA 3O2PE 4EGYA 1U5TA 2XRNA 2WWYA 4P9UA 4UNOA 1HBXG 1U2WA 3KCCA 2VC1A 1I6XA 4EJVA 3JSOA 2W57A 5HDNA 2JPCA 3IC7A 4LK1F 1FP2A 4HV5A 5FGMA 2FE3A 2HQNA 3K0LA 2EA2A 5BPDA 1D3YA 4G94A 2A5YB 4HV6A 1B59A 4WX9A 2OD5A 2VBZA 5E1WA 3HTUA 1BJAA 1T6SA 5D6FA 3F6VA 2QZ8A 3HHHA 3ELKA 1DDNA 2O03A 1FYMA 2P5KA 3ERED 1YYVA 4YFKF 1HSTA 1UHWA 1R5HA 1H9TA 3EYYA 4HQMA 3M7GA 1F1ZA 4UVAA 3G3ZA 5J6XA 4CGZA 4ENKA 4F7ZA 3MFKA 3JW4A 3L2CA 5DUKA 2XKPA 2BE5F 4E70A 4LFUA 2O3FA 2HR3A 4OOIA 3WTZA 3ULQB 3WTUC 1SD7A 1P4AA 2A68F 2HFHA 3C3WA 4BYYA 4KNYA 3WE3A 5J8CA 2CG4A 1H9GA 4BAYA 4CICA 2NNYA 4AD9A 3HIFA 4RAZA 3GO5A 2WV0A 2V9VA 4YIIA 2KIFA 3QAHA 5E17F 4KYWA 1GHCA 1IN7A 3PFIA 1QGPA 2M5WA 4CYDA 1S6LA 1KYZA 2JRTA 4EM1A 1T38A 4LMYA 1U3EM 5LGTA 3R61A 4KDPA 3GUDA 1LDKB 3TKYA 3GVAA 2B0LA 3P9KA 4EVIA 5ILUA 5FFZA 4A0YA 1XMAA 3W6JB 2XUBA 2XROA 1JGSA 1O3RA 2Z3YA 4ZH4F 1ZLJA 1WQ2A 2HWVA 2L4MA 1BIAA 5ICFA 3ZMZA 1ZRCA 3AAFA 3F8BA 2IW5A 1ON2A 3B73A 2ZCWA 3FMQA 5LGNA 4WXCA 4ZYHA 2BGCA 3FHZA 4Y15A 3KETA 2F5FA 4M74A 2DPDA 4EJUA 4HYEA 2RN7A 1CF7B 1MDMB 1K79A 4JQFA 2UXNA 1PUEE 4M9ZA 1G3YA 3PQJA 2HKOA 4M72A 5ERIA 4CHUA 2DW4A 2NNNA 2QQAA 4R1HA 1SAXA 1KU2A 1CGPA 5J8FA 5CYVA 4XSZF 2VBXA 3HUGA 2HYGD 3VEPA 4ETSA 1HW2A 1UCRA 2RVCA 4PZJA 2HTJA 4ENJA 1E2XA 3DPTA 1FBQA 2WTEA 4KMFA 2ZMEB 5AIPA 2DPUA 3I53A 3MEXA 1KGSA 2FMYA 1CF7A 1DPUA 4KMUX 3L9FA 2Z5UA 1SFEA 2FMLA 2KIMA 3J81Z 3CUOA 4LJZF 5L3BA 4L9TA 3GWZA 2EFOA 2V1XA 2K4JA 3E5QA 1STZA 2EFWA 3L00A 2PMUA 1S29A 3TO7A 5DDGA 4FHTA 1XDUA 4MNUA 3QRFF
chains in the Genus database with same CATH superfamily
1IUFA 1I1GA 1VQ8I 1T33A 3I59B 2M7BA 3I3LA 4CCKA 2CUZA 4UHTA 2D45A 4S0HB 1ZGAA 1NK3P 2E5ZA 2DAOA 2QENA 3FDYA 1UFMA 4RMNA 4EJWA 3O3KA 2IA0A 1IW7F 2KQRA 1Y6IA 1ZR2A 4NC8A 3H36A 3RKYA 1FOXA 1MMNA 4AYBA 2VJ5A 3HPHA 1E3OC 5EG0A 2O8XA 3H5AA 3I4PA 2CGPA 2HDWA 1ULYA 2HVRA 2F4MB 1FOWA 3J80K 1WGXA 2W00A 3KP7A 4A12A 2VJ4A 5KK1A 1Z3XA 3TW7A 3K4KA 3NQOA 1HC8A 3PSFA 2K3FA 3LQQA 3JAMK 2STTA 1P4WA 2H94A 1YJ9I 5TISC 3N97A 2AHQA 3OYHA 2KDZA 1UB9A 3GFLA 4ESBA 4XKCA 5H20A 5FLMJ 5C44J 1OPCA 4WK8F 4GFBA 3WHBA 1JKPC 2V6CA 2QKLB 1SFOJ 4R8HA 1R4NB 1IDYA 5ICCA 2F5EA 3CJQB 2LBFA 4AIJA 1VQ7I 1MH3A 2DT7B 1XGMA 2P7VB 4IHXA 1E17A 3GFMA 1RR7A 4IZZA 5CQEA 2IBDA 1I1SA 5GP9A 2OCEA 3CESA 3ZMSA 2IA2A 3LAPA 3OR2C 3DXJF 2DO7A 1MSFC 1KU9A 3I59A 1SANA 5ICGA 4HG2A 3RYPA 3OS0A 1LNWA 3DLLF 2GXGA 4FETA 1JGGA 3QWLA 2K85A 1FEXA 4XM3A 2Y75A 1R5ID 1K7AA 1TWHJ 5IP9J 3WTWC 3BG6A 4IVNA 2W1OA 4RM3A 4L5JA 4NB5A 3HGGA 2HI3A 6PAXA 3OV8A 5H6RA 4CCLA 3T0YA 4WXDA 3M07A 4M9XA 5LRSA 2PX9A 1TW2A 2VASA 3DEWA 1ZGJA 2EFPA 5HVQC 1GV2A 1Q1HA 3FX3A 3I71A 3Q0UA 3W2WA 2HTSA 2RKHA 3PNVA 4U0YA 2F5DA 1O3SA 4UB6C 4HLXA 2VJIA 2PMHA 1W0UA 3S8PA 1A04A 3BJ6A 3ZQQA 1I50J 2EIMH 1IV6A 3KP2A 1QBJA 2FNAA 1VQKI 5FKKA 2KL4A 1S3JA 2ADUA 2Q2EB 1XGNA 5IT3A 3KP3A 2E2JJ 1R7JA 3GF2A 2DI3A 5IPAA 2ID6A 5DCMA 2EINH 3TDZC 1KQ8A 3S2HJ 5JFRA 2CW7A 2DA7A 2P8TA 2K3PA 3O8HA 5GADJ 2R0QC 2IGKA 3LL7A 4ANJA 4J19A 4LLNA 5DD8A 3KZZA 1O57A 4IQ4A 4TV7A 2EV0A 4B48A 1RESA 3I55I 1TC3C 5E1XA 3OYJA 1UELB 3Q9SA 4C2TA 3NWTA 2ZXJA 2HOTA 1SVMA 1WJBA 1X2NA 4KT5C 4RS8A 3WTYC 3HOWJ 2KT0A 4U87A 2KRHA 3BJOA 3EQLF 1TNSA 5IOYA 4HAMA 1ZK8A 3BP8A 3SXYA 1U9NA 3K1NA 2CQ7A 3AG2H 5H6QA 1O4XA 5CQGA 1X2MA 2HOAA 2BEOA 3F22A 1Z67A 2M0CA 4FE4A 1OCCH 2ZMEC 4Q5SF 5LRRA 3RJPA 2KZVA 3UKGA 2VQGA 1O7LA 2CO5A 4NC6A 3A01B 1P92A 4N9HA 4I2OA 3LMMA 3ZGKA 1OYYA 2LKXA 5FKNA 3M8JA 2ZSHB 2VB6A 4R79A 1YW8A 1FZPB 4C3HJ 1BR1A 4BDZA 5JHUA 2CV1A 1ETYA 2CQQA 3COAC 3I58A 2QKMB 4P55A 4U7DA 2E2HJ 1EH7A 1N25A 1YX3A 4C9YA 1PVEA 5FO5A 2VODA 5E8IA 3HOTA 5KAIC 4KISA 2X6OA 2O61A 1K78A 1KQ9A 1W5CC 4OIPF 1OLTA 4LOCA 2IVMA 2BYVE 3V42A 1FLIA 3S3NA 2MGQA 3FISA 5DUIA 3V7SA 3BTLA 2K02A 1X4OA 2X1CA 2HDDA 1ITYA 4HA8A 3ZQGA 3QRFF 5DCFA 2XGXA 1MJAA 3BR3A 2R5YB 2R7WA 2JUCA 3H3UA 3VWBA 3CP2A 2O5RA 2NOGA 3BR6A 2GA2A 3DTIA 3HKZA 3F6OA 3H9GA 3W2VA 2PQ8A 4LD5A 4LB6B 4BUPA 2ESNA 2VKVA 3MZ8A 4BJ6C 3W3CA 2JRMA 2BXZA 1QZYA 3M9AA 3TMOA 3CO7C 4L5EA 3V7RA 3CC2I 2X6YA 1IN8A 4BBSJ 2ISYA 2MABA 3B6AA 2A6TA 2W85A 3W6VA 1JKQC 3GW2A 4BHPA 2D5VA 1AA7A 2FJ1A 3FMRA 3GLXA 2P6TA 1WWXA 2PMZA 2RC4A 2HQRA 1UJ8A 5BQTA 2IA1A 5D8KB 4HF2A 3KX2A 3T5XA 2Y0MA 5J3LA 2Q1ZB 2W48A 4ZYAA 2V9KA 2L01A 5FLXK 3BY6A 5L3CA 5LEKA 3BROA 2RREA 2QQ8A 1LJ9A 1FOKA 5ED4A 2QBYB 1LDJA 1IAWA 1VQ5I 2WBMA 1W7PD 4EJTA 3LWFA 4IRIA 3CD6I 2W7NA 1HW5A 4Z2YA 5GPAA 2YU3A 4MTEA 4GO1A 1U8BA 1FPQA 1LDDA 4AIKA 4NQWA 4HNTA 3DBRB 2PN6A 1QQIA 2HEOA 5LLQA 3GEZA 5DM7F 2I10A 5ILSA 4XLNF 1MBJA 3WODF 1XSDA 2A5WA 3LSMA 3GTJJ 1XGSA 3LA7A 1YIJI 3RQ4A 4RGRA 4IHTA 5FROA 2VXDA 4BY7J 3BT9A 1ZHFA 4GYIA 1T08B 1IRXA 5FFXA 4PJLA 5E1ZB 2CFOA 3CJNA 1DUXC 3TO9A 2HVSA 5HDGA 3S14J 2MC3A 4BJ5C 1D0XA 4FX4A 5LGUA 1PP7U 2XAJA 1D5YA 2QSHX 2GLOA 5LHHA 1B1BA 1OFCX 2GBYA 3L2WA 2V26A 2L7FP 3MKWB 2KPMA 2DA2A 4RAYA 1YIOA 2L2OA 1QVTA 1BBYA 1A6IA 4DOZA 4YIRX 2QBYA 3D1NI 1WJEA 2P0WA 3RZDJ 2AS5F 3CLOA 1T95A 1XC5A 3NWSA 2ZJ2A 4CSWA 4XLAA 2E7WA 3OYLA 3G73A 2R7RA 5BOXA 3C7JA 2H6BA 1Y56A 3Q0WA 3JSPA 5CVUA 2X1EA 4PUSA 2KRFA 3CLQA 5FD6A 3OYAA 4KA4A 3ASOH 1J75A 1HCRA 2R7ZJ 3OOUA 2UV1A 3QODA 5E3OA 1ZRFA 3IAS2 1WRJA 2DFEA 2A07F 4G7OF 1V3FA 3S15J 5C4XJ 1IN4A 3IHUA 3QQAA 4B1RA 4G7HF 1YLFA 4BNCA 4MQVA 3GYHX 3T8TA 4EM0B 3IKVA 3SHFA 1VQPI 1FNNA 1Z1DA 4ABZA 4NDLA 3OIPA 2LSOA 4GGGA 2DMQA 3FXUA 1OMIA 1ZRDA 2OV7A 1OR7A 2JA6J 3RSNA 1ERDA 3SFIA 2M87A 2ELHA 2VN2A 3CF5F 1W5SA 1FSHA 1JKRC 1MBGA 3H35A 4A3GJ 4BKXA 1A36A 2MLGA 3BPVA 3H9QA 2BY2A 4IPAA 3GBGA 4M6YA 4D1QA 2VT2A 4A0ZA 3F9KA 1AOYA 4MLOA 5F64A 3JRHA 4I7HA 5EF6A 5JVGF 3JRGA 3I56I 2DOAA 5FRNA 2FBHA 1RKTA 2M30A 3GTMJ 1LEBA 3SQNA 2BXYA 2F48A 3HHGA 3K10A 1JJ6C 1IRZA 2HZTA 4W97A 1BA5A 5J47A 4L18B 5IP7J 1T98A 3DQVC 2V4JC 2H6CA 1WFXA 1L0OC 2O7OA 1V5FA 4RA2A 1IN6A 2PEXA 3R0AA 2VL8A 2K9NA 3DFGA 5B1AH 2LNBA 1FT9A 5BMZA 1Q1VA 5ILVA 3ECHA 1S8NA 2TDXA 4RLFA 3PO3J 1HKTA 3WE2A 1J09A 4NHJA 5HDKA 1WI9A 4BBRJ 3DV8A 3O8GA 4O6JA 4CZZA 1U9OA 2WV1A 2Y69H 3PIPF 1U6GA 1G3WA 2CW8A 1VQLI 2XRLA 3E6BA 3QPSA 1G3TA 2FRHA 3K1MA 1FYKA 2OU2A 2XAFA 1U8RA 4U88A 3ECOA 1TZLA 2Y31A 4E7HA 3MN2A 2ZNZA 1UHSA 3LQRA 2LLKA 2JWTA 2X4HA 4KN7X 2DODA 4D5FA 5JI6A 5A2QK 4K2EA 2GXBA 1P9QC 2H27A 4V19K 2EK5A 3CCSI 2Y30A 2IXSA 3C1DA 3MZHA 3J7ZI 2EH3A 3AL0B 3IRRA 1FY7A 2ZXHA 2W84A 1NH3A 3G2BA 4UVBA 2EB7A 4EM2A 5LHIA 3FM5A 3CZ6A 1RIOH 1R22A 1IRGA 2VKDA 4M6XA 3E97A 2OF7A 3ZQIA 3S3OA 3DBLB 2XF5A 4I99C 4FCYA 3EUAA 2E60A 2FF4A 2WAQN 1FTZA 3L1PA 5J40A 1TQIA 3WTXC 1B8IB 1RUOA 5DV5A 3V8JA 2R7UA 3DTEA 3F8CA 1QPIA 5HS9A 4GXOA 1WJFA 1PUFA 3S3MA 2HDCA 5E3NA 1FMVA 1P4XA 1ZR4A 2BV6A 1TWFJ 1W4MA 2HGCA 4LG3A 3RDIA 1IN5A 3GZ5A 4ZYGA 1MBFA 2OCCH 2V1DA 1W5TA 2YPRA 4MEXF 1Y0NA 3GZNB 1G4DA 2LF7A 3HSRA 1Z0XA 4D7NA 4U0WA 4DBQA 3VOEA 1ZG5A 2OA4A 3QYFA 2VBWA 2CV0A 2GWRA 3P9CA 1X3UA 5IT9K 2LR8A 2O0YA 2ACJA 3C18A 1HF0A 4Y13A 2P81A 2E19A 3M3YJ 1P7JA 4HEA2 3TBIA 4A0XA 1Y0UA 1YHQI 3ERMA 1ZREA 1YFHA 4IEJA 3CF2A 1AKHA 4P9FA 4A93J 2WA0A 1WH5A 2KJBA 1W7PB 3NEUA 1TW3A 3IUOA 2BY0A 3DEUA 2VE8A 2FD5A 1HOMA 4KN4X 4MEYF 5FD5A 1MD0A 5FLVA 2JPBA 1P7IA 4KUMA 1MDMA 3K9TA 2IGOA 3IAM2 5F1JA 4MTDA 1T2KA 4WWCA 2PI0A 1WJCA 5TRDA 2DMPA 5CVJA 2QGUA 1X3ZB 3QYEA 3H0GJ 3ZMUA 4BS9A 3AFHA 4CO8A 3JRIA 3O6BB 1TWGJ 2VBYA 1MZBA 3K4MA 1A5JA 4P96A 1LE8B 3RTRA 4G6TB 3TEDA 2I8DA 1EA3A 3LFUA 3ZCOA 2BZTA 2DN0A 3BQZA 3HJEA 1V54H 3PQKA 5LFAA 1G2HA 2LTPA 2JSCA 2ZFWA 3K69A 2IRFG 2G7HA 5IY5H 4FTHA 5HOOA 2ETHA 4XLFA 3KE2A 1TWAJ 2XPWA 3L09A 4BL0B 2M8EA 3KEOA 4PJJA 2A61A 3KLNA 1ZKGA 4IOCF 2LREA 2WB1N 2Y2ZA 2KLOA 3IWFA 4IRHA 4H0EA 3TO6A 1RNLA 1T0FC 4HBLA 3SDGA 2CFXA 2MLKA 2LP0A 3M1CA 5D5WB 4PFPA 3TGNA 1LVAA 1QO0D 1XGOA 2XF7A 3HG9A 2XSJC 5EZGA 4G6QA 2CS3A 5J4YA 3A1YA 2OTJI 2I5UA 3D0SA 4OAYA 1PP8F 3G71I 4IKFA 1I3AA 5KAFC 1WJDA 3WG9A 2R3SA 2DBBA 1S72I 3BCBA 1YJWI 3ASNH 2A69F 2ZMEA 3CDLA 1IXCA 3OYKA 4V2GA 2CUEA 4MHGA 2QEXI 1N75A 5HLIA 4IRGA 2ID3A 1R1UA 4HX8A 5EGOB 1X1AA 3BZKA 5EEGA 1J9IA 1IDZA 2FNPA 4E7LA 3FWEA 4U7BA 4HSTA 3WTVC 4EV0A 1I5ZA 1YW9A 4L9JA 4AUXA 4Q48A 2R7DA 4UUSA 4BHCA 3HTSB 1IXSB 3RPUA 3CTAA 2EILH 4ENMA 3EDPA 4XN0A 1JE8A 2XGDA 3SZGA 1XDSA 2IP2A 3KZIC 3TQNA 2LF8A 3LFKA 5L3FA 3CCRI 1XMXA 2H1LA 3HSFA 3E6CC 1ETKA 4BEHB 2CUFA 5HODA 3J80Z 2KMUA 3W6KB 5LEJA 3X2QH 3GX4X 1GVDA 3CCLI 1J59A 3CCEI 1IUYA 2FEZA 4B44A 5LD2C 1R1TA 1EJ9A 4C3IJ 3W2AA 4A3KJ 3HL2A 3JAMZ 4I01A 4XORA 3EUHC 1OYIA 1ETXA 5JLXA 2PFBA 3PUBA 1MNDA 2NYXA 3DWLE 2DT5A 5HLTA 2LOOA 1SFKA 3WU0A 3FF5A 5AONA 3CQZJ 2FA5A 1R49A 2CQKA 1GDTA 2NVTJ 2W4SA 4HZFA 3A0HC 3FXLA 3C2HA 2BY1A 3FXJA 3BR1A 3ZPLA 2EZKA 2AXTC 3ABKH 3VYUB 3CCJI 2L4AA 2E36A 4AIHA 1OCRH 3CUQB 1U78A 2MH9A 5EGOA 1ODDA 1UG0A 1OCTC 4DBRA 5D5XB 1F43A 3MVPA 3V8KA 2Z99A 4N0BA 3GCMA 4A6EA 4ZDPA 2YR2A 2VPRA 3SFZA 1TBXA 1Y1VJ 2Y0SA 1VQMI 2WY7Q 3SYTA 4XRSG 4QTRA 4ZYEA 4A3CJ 4LGWA 3AL0C 4V2FA 2BY3A 2LY9A 5CJ9A 3HRTA 1SMTA 1ZG3A 2EZHA 2M0MA 2ZO4A 3DTKA 2VPLA 2XB0X 1WHUA 3D5SC 4KIFA 2LMDA 5E3LA 1LUJB 3I54A 3LSHA 4B09A 1MMSA 4BH9A 2W82A 4B4CA 1A6QA 1FSEA 3A4CA 3GFJA 4OU0A 2FXAA 2ICWG 5E8GA 4HF1A 1MSEC 5FKLA 3OYEA 2CH0A 3HXLA 1IG7A 1Z9CA 2CQNA 2MD5A 4UV8A 2VT3A 3S17J 4XL9A 2QSFX 4IXAA 3G6EI 2A05A 2HPMA 3E1SA 1QU3A 4O5VA 4NUBA 2LDUA 4EJOA 4PGGA 1RUNA 1D8KA 2CV2A 2CSOA 4XKBA 1FYLA 1E3PA 1LFUP 3QYBA 1D8JA 2XV4S 2EZLA 4XSXF 3TDUC 4KIGA 4BY1J 2MFZA 2GIVA 1G6NA 4A3EJ 5D4RA 2PJRB 4M71A 3U1DA 2NS8A 2OBPA 2ECCA 5B66C 4JBAA 1BOAA 2X9DA 1VQOI 3MKLA 4Y4RA 2E5NA 1RZ4A 1ETWA 2BOLA 5HS7A 5L3DA 2V1UA 4YEJA 2JA2A 4F3QA 5TJJA 1KQ0A 4YRVA 4OMZA 3RPQA 1I39A 2VXZA 4FE7A 3MWMA 2GXAA 1WKMA 2GOMA 1DQUA 4Q47A 2DDBA 3JRAA 2L9RA 4PSWA 5K5RA 2DFHA 1MBEA 1LKXA 2WADA 2ZBKA 5EEHA 1ZELA 4LLGF 4OINF 2NVQJ 1OQYA 3R6SA 4ZDOA 4M3EA 3MAJA 3F8FA 1J7KA 1IZ1A 2RAEA 3DF8A 1FTTA 3RYRA 1YG2A 1ZYRF 5CVVA 3K4CA 1Z6RA 2HYFA 3FZVA 3JREA 2K86A 4HSRA 1ON1A 4BU2A 1MJ9A 1SC7A 4MGRA 1TTYA 4FT8A 4AYBN 2K4BA 1P6RA 1F9NA 1FP1D 2EA4A 4CYCB 2DJIA 2Q2EA 4OIOF 3RI4A 1JXSA 4I76A 2E7XA 2AQFA 2V6EA 5BPIA 3QOPA 1S7OA 3B02A 3DPLC 1R00A 2EZIA 3DU5A 3I4MJ 1V55H 5GTHC 4OWRB 1D0YA 2L9SA 3PUFA 2JK3A 2HZDA 4XKWA 3N05A 5DD4A 2DDAA 3QU6A 3PFYA 3S2DJ 4YG2F 4FQGA 3EETA 4JX4A 4CCJA 1Z77A 3A0BC 1UAAA 2H1KA 4WCGA 1ETOA 2A3SA 4QPOA 5J4VA 4EQQA 4HDVA 3E7LA 4XICA 3ROUA 3J7AO 2QYOA 1U5TB 2ELKA 1DGWY 3HRUA 1W1WE 4Q4ZF 2YX4A 2DQLA 2X6XA 2XGCA 2KIUA 1I3QJ 2NOJB 4YIFA 4XLPF 3HOXJ 3HEFA 3I4NJ 4GRIA 2E1CA 1FMWA 3A01A 2R92J 4B43A 2RNJA 5DS9A 2XAQA 2DOEA 3WGIA 2DXIA 5JLWA 3EUKL 2C6YA 4II3A 3Q9VA 5DTDA 1GXQA 2GOXB 1SD4A 3ABUA 1BL0A 5E79C 3PNTA 2LRDA 4G6DA 4YFXF 1BW6A 4DQ2A 5BS6A 5K1YA 2IS2A 1HQCA 1REPC 1R6RA 2VE9A 1OCZH 2FX0A 1G8XA 3H9JA 3OOPA 5LBQA 3D5LA 4F93B 3L2UA 1IF1A 2HOEA 1YJNI 4XLHA 2XF6A 1JTXA 2QM3A 4KITB 3KYCB 3ABLH 5LHGA 2LKPA 3BOQA 3TW6A 4J01A 1KYWA 4E4HA 5F1RA 1ZAOA 3K7AJ 2DQRA 3QOEA 4B3XA 2QWWA 3BQYA 4AWXB 4HQEA 4JX5A 1X3WB 2DA4A 3HOZJ 1BW5A 1GLNA 5FLXZ 3FXKA 1JJ8C 2R5YA 1QA6A 3HSEA 4M6VA 4YFNF 4RB2C 2G0EA 4CCNA 3CCQI 1LVKA 4S04A 1XPXA 2RV8A 2R7XA 4XRSA 2FOWA 3K70D 2R5ZB 4HW0A 1YW7A 1WPKA 1JHFA 4IJAA 1QPMA 2UWMA 1XSVA 2QUFA 4I98B 3K4LA 3CUQC 2NRAC 2K7LA 1SVLA 4A2UA 3KFWX 3LSPA 1DGRM 1KONA 3ML6A 1NTCA 4PJNA 3L7WA 5AIQA 3M8FA 1X4PA 4Y3OA 3H92A 4A5NA 2RDPA 3AKZA 3IP4B 1V4RA 5B3SH 3A02A 3IL2A 4P1WA 4ESFA 2G7UA 3N4MA 5HS8A 3F21A 2M4KA 2Z9OA 3KZYA 1IV8A 3JR9A 3JTGA 1S9HA 2P5LC 2NVXJ 4RGSA 3RCOA 3S1NJ 2TCTA 5F0CA 4ZTFA 1WH7A 1XMKA 2KIQA 5IYCJ 4F92B 2L7MP 3L2VA 1S7AA 1VTNC 1N77A 1H88C 2O9LA 3GTKJ 2OAZA 2DK8A 2F2EA 1I27A 3BR0A 4Y7NJ 2OC6A 3CO6C 3F8MA 1ACIA 2IEKA 4RGUA 3VYSB 2ZJQF 1HKQA 1XS9A 1GT0C 4LIVA 2IAIA 1EH6A 3P7NA 2HOSA 3VYRB 4CCMA 2X48A 1TLHB 2M4GA 2BBYA 5JR3A 2V7FA 4RM2A 3ZMVA 1Y8RB 3IKTA 5HLGA 3R4KA 1XG1A 2K9SA 9ANTA 1RI7A 3QP6A 5J1RA 1XX5A 2Q8KA 3TL4X 3E6MA 3ZMDA 1BI1A 2JA7J 2R7OA 2RNGA 1D0ZA 2JVHA 4N4OB 3HRMA 1FX7A 1F4KA 4L0ZB 5HNFA 2EQRA 2K9MA 1EH8A 1VI0A 4HX4A 1YS7A 2NS7A 1TQPA 4XMYA 4KIBA 4EMSA 5HNHA 1LFPA 3MQ0A 1YI2I 2XGEA 4BHBA 3UNGC 1ZLKA 2BW3B 3CDIA 1R58A 5M5YJ 3FHNA 1UZCA 3DU6A 2L54A 3CC7I 1NHAA 2Y9YA 4EATA 3S1MJ 2LFBA 2E1MB 2IJLA 2XASA 3ABMH 4B8XA 3HKZN 2DTZA 4PGHA 5JHFA 3BG9A 1DU0A 4XKVA 5DEQA 2L9VA 3T8RA 3ZP5A 1R23A 3I64A 3OMYA 3CDHA 4RAFA 3JRCA 2FQ3A 4UV9A 5L3GA 3H3ZA 1IXRC 3OYMA 3VDXA 4BQAA 1FWZA 3V4GA 2JQ7A 4CUGA 5F08A 4A3LJ 3FIWA 3OYIA 2XVCA 4RB0A 4OMYA 4UB8C 2V79A 3DKXA 5IP6A 2KJCA 4PK4A 1AU7A 5FKOA 3RIRA 1ENHA 2PMZN 3OS2A 1USSA 2LH9A 3GXOA 1ZG1A 1X19A 3Q3SA 2E34A 1T0FA 1A31A 2M1BA 2PLYA 1H8AC 1GVJA 3K1PA 2DFFA 3WU1B 1P2FA 5CKTA 4IQJA 3QPLA 4X0GA 1MKMA 3L2QA 1PDNC 2CRGA 4G8XA 3VODA 5CVRA 4LK0F 3PJRA 2ISZA 2CUJA 1Z3YA 2EV5A 1IRFA 1U5TC 2F4OB 4X1EA 1YS6A 3RZOJ 1WSUA 2LY2A 1JTYA 4QLCU 3ZXSA 1W36D 2W24A 4Y52J 4C3JJ 4L5IA 2JA8J 2MSYA 1IC8A 1SFXA 1XN7A 2IPQX 1A35A 1H89C 2L0KA 3P9IA 4Y33A 2DMTA 2FQ4A 3BTCA 4CXFA 1L3LA 1KU7A 3DKWA 4BQOA 4A3DJ 1Z7UA 2CWEA 1B4AA 2Q0OA 1DP7P 1MMDA 3QP5A 2HS5A 3LSKA 1D5VA 2MW8A 1QNTA 3TOAA 5GPCA 4G7ZF 3FMSA 1Y8QB 1BI0A 1MGTA 5KHDA 1XB4A 2OUMA 2OQGA 1R5GA 3JRFA 3L2RA 5C4JJ 2NVYJ 4ESJA 3FXQA 2DA1A 2IGNA 2OPTA 4HOBA 1DU6A 5A2QZ 2PG4A 1R36A 4OIRF 3T1BA 3K4JA 4HX7A 4RAGA 3DP7A 4EGZA 3F72A 2ZJPF 2XIGA 3EUHA 2V9PA 3ZRGA 1K61A 1S5LC 2L7KA 1ZQ3P 2O8KA 4A3IJ 2HXIA 1LQ1A 2QF7A 4DGWB 3WTSC 3MCZA 2Z33A 1AWCA 2QVOA 2G9WA 3FXMA 2ZFUA 2R7TA 2E1NA 3S1QJ 2LG4A 2VKHA 4LLLA 3F3XA 3DKYA 4MQ9F 4PFOA 3KYLA 4L0YB 1MMAA 3IWZA 2MA3A 4RB1A 2YU9J 3M1EA 3K4NA 5DYMA 3JTHA 3FM3A 1JUPA 4D5CA 3VYTB 3VPRA 1EV7A 2ECBA 2VOPA 3FK6A 3QPTA 1JUSA 5F0HA 4XRFA 1ZGWA 4XK4A 2GQQA 3WTTC 1N78A 2JVGA 5L3EA 1RETA 3H5NA 1Z91A 4AC0A 1MNMC 1SVOA 4FX0A 4DZPA 1R9TJ 4HPQA 4CA0A 3GFIA 1BC7C 5IT9Z 3BJAA 2DA6A 1QZZA 2RGVA 4PCQA 2YS9A 2HU9A 3GTQJ 2J5OA 2M45A 5B5EC 1V5GA 1B8IA 4QPQA 2P5VA 3NARA 3F23A 1HW1A 2BVMA 3J81K 3RKQA 3WGGA 1SFUA 4KFCA 3OWTA 2M2EA 4A69C 2AO9A 4ZDLA 4L9VA 1K6OA 3REOA 5FB2A 4M3DA 2ESHA 1HXDA 4BQQA 2LD5A 2CJJA 1KU3A 1V5EA 5EG0B 4E7SA 2KKOA 1APLC 5E3MA 4Z6YA 4PJMA 5ICEA 2L3DA 2K27A 4XONA 4XOPA 4HNVA 3G1OA 3U2RA 3V8LA 1YQAA 4M73A 1B9MA 2HKXA 5E20A 5FRMA 2D1HA 1ETVA 3F8NA 2XAHA 4BXFA 4X6AJ 1CQTA 1GUUA 2MBFA 4HNUA 3OL3A 2YX7A 2YUSA 1B9NA 1FBSA 3BCAA 2ZXWH 3IRQA 3TOBA 2ZSIB 1BN5A 2NAZA 4D0PA 2P7CB 1LPQA 2LBFB 1MH4A 2Y48A 1XTAA 4DNCA 2FUG2 4IO9F 4E6KG 3OS1A 2A6EF 5J1YA 2KDOA 4L9NA 1W7PA 2RQQA 1EKEA 3WG7H 3SEQA 1W0TA 1LEAA 1FBUA 2QCOA 2L9NA 4J00A 2DOFA 5F6FA 2XAUA 3ABTA 2DA3A 4ON0A 2HQAA 2B63J 1J2XA 1R1VA 4XBFA 2E1MC 4RB3C 4I09A 2WAFA 5K5OA 4AM3A 1WI3A 3I9V2 2QQ9A 2YSRA 1LE8A 1Z05A 2CYYA 1JHHA 3M8EA 1DPRA 4I02A 4A3BJ 2DYRH 3KP6A 3R60A 1LB2A 3I0TA 2X0LA 4WXHA 2ZKZA 2F5CA 4GDFA 1HSJA 2DMNA 2VQHA 1SD6A 1TT5B 4LG0B 1Z7LA 3Q5FA 2VQLA 3P5JA 2FSWA 3BPXA 3LSGA 2KFDA 2DLLA 4PDKA 1BOBA 3VFZA 3ZQHA 4IHSA 1WJAA 2XKOA 3S2WA 4BQNA 5D5VB 4GYGA 4UXNA 5M3MJ 1JT0A 2XAGA 3FK7A 3HOSA 4C30A 1Y39A 3OYNA 1U0JA 2DTRA 2H09A 5IOZA 4DYQA 4ENNA 4CDGA 1NG6A 4OIQF 2OJED 4DYRA 3FBIB 3H0DA 1OCPA 5M3FJ 1ONVA 1X1PA 2CMPA 4HLYA 2ELJA 1O3QA 2OZ6A 5D8LB 2DU9A 4DZJA 2FOKA 4HF0A 2XB5A 3GTLJ 4KICA 2DK5A 2FBIA 5DCMB 3ISPA 2WAEA 3GTPJ 3FBNB 5KVRA 1K83J 3A03A 4ZZDA 4IF4A 1F36A 2LY1A 2R4GA 2EBIA 2CW0F 2QSGX 1OYWA 2J5PA 2L5QA 4KT6A 3WGHA 1YOVB 2QLZA 3HRSA 4A6DA 3FXOA 2VOOA 3LAJA 2MD0A 4WF2A 1R4MB 4XLCA 1TP4A 4A3JJ 2STWA 2BVLA 3K4BA 1XD7A 2COBA 2VI6A 2LKSA 3LOCA 1VFCA 1J5YA 3OYFA 4AVPA 3S16J 1NG7A 4XOTA 3LSTA 2OQRA 3LSRA 4OAZA 4IHWA 4BEHA 2DA5A 4ZYDA 2FU4A 3A2KA 4XN3A 2IT0A 1VQNI 4I0BA 3GZ6A 1AHDP 4C2MJ 4LG0A 3HOVJ 2QQBA 1YITI 3LSJA 2CU7A 2PJPA 3PNYA 2FBKA 3MKYB 5EYRA 2JJ7A 3HOUJ 3H1CA 3KYDB 2COMA 2ME0A 5E18F 4RBOA 5CVIA 3BWGA 3CC4I 2L02A 4U0VA 3U1KA 2X6WA 1FC3A 2P4WA 4A5MA 3K6GA 1IO2A 1DP3A 1MJBA 2O6GE 2HXOA 4MIMA 2EFQA 5F04A 5FJ8J 4A3MJ 2XHKA 2DJNA 1ZARA 3E3VA 3SEZA 3VB2A 5F0FA 1KA8A 5D4SA 4BACA 2L7ZA 1BI3A 3BG5A 3HM5A 3S32A 3CUQA 2GZWA 2D2WA 1XSXA 5HLHA 1X1CA 4E7ZA 2IS4A 2MG4A 3MKZA 3H5RA 1UG2A 5K7ZA 4M9SA 1K78B 4JK1X 1HDPA 3SZPA 2KP6A 4QWQA 3HOYJ 2ZNYA 5C3EJ 2OZUA 2DFIA 1J0RA 2MH2A 2EPFA 3LNQA 2IS1A 5K7HA 2P6SA 3PM1A 3DCFA 3ZQ7A 2A6HF 4I0AA 5JVTA 3SJMA 1OKRA 1UHMA 2HVQA 3FXRA 3R0JA 4ZTJA 3RKXA 5KNLA 2M7AA 2UUZA 3LA3A 1BI2A 1ETQA 5EJCA 3BDDA 2EV6A 1BC8C 2VLAA 1TL8A 1MBHA 2V1NA 4DIQA 2JTVA 3KP4A 3IH2A 1BR2A 1G3SA 2R93J 4BDYA 1K4TA 4P5OA 3BG7A 4ZJZA 1BM9A 2D1VA 2PBIA 3E0JB 3NAUA 1SD5A 2N8GA 5GAHJ 2VONA 4II2A 1GXPA 1Z6TA 2XDVA 2VC0A 4N4NB 3PL8A 4RGXA 3ZQFA 3K70C 2UZKA 2E1OA 4ZZLA 2DMUA 5GTIC 2ZC2A 1ZH5A 5IYDJ 1D1CA 2E35A 2M3AA 4QSHA 5D5UB 4A3FJ 1NK2P 1FIPA 1TQMA 3K2ZA 4UVCA 2JZYA 3ZMTA 3J7AY 2GA1A 2PJRA 3QPHA 1H0MA 5M5XJ 4Y17A 2MYSA 1HA8A 1OJLA 2RQPA 3TP0A 3CJRB 4ASNA 3NRVA 1F5TA 1FIAA 3BR2A 1C0WA 4GCVA 4FASD 4G9YA 3E6DA 4XLEA 3CMEI 4AIDA 4O3MA 1TNTA 4D7MA 4E7IA 2EJRA 1T39A 3SZTA 3ZN0A 3OY9A 3LA2A 3U9GA 1HKSA 1FOYA 1SMYF 3KEQA 1I6HJ 5D6EA 2KZGA 1QRYA 4H4KC 1M1EB 4DJAA 3S1RJ 2GM4A 3MZYA 2DYSH 1O7FA 2ZB9A 1YTYA 2H8WA 2LYCA 4NQWB 1HLVA 3ONQA 2B9SA 4HDUA 4HRIA 3GTGJ 3U21A 3CMAI 1O3TA 1YO5C 1X58A 2NS0A 1MW7A 3OYGA 1WZ2A 1XCVA 2R7FA 2JT1A 2EWNA 3GMEA 3D5RC 2MC4A 3KP5A 4N9IA 5K5QA 4CYCA 4BXUA 3LSIA 2WC2A 1XCBA 3I5UA 3RKWA 4QIWN 3K2AA 1ZN2A 1D1BA 2BHYA 1E3HA 3PO2J 2UXXA 2IS6A 2R7QA 4UUVA 3TP3A 3E5UA 4M3FA 1B6AA 3CP8A 2NVUB 3WU2C 3MD2A 2Y0SN 3FKJA 3ZN1A 1R71A 3HYIA 3BZ6A 1BIBA 2EIJH 2AXLA 2EFNA 4BGDA 2W25A 5TGTA 2M9HA 2LC2A 4S05A 4EEFG 2GAUA 5M5WJ 4NBQA 3KLOA 3V7CA 2R7SA 2VIXA 1GV5A 4ITVA 3PIOF 3BR5A 5CLSA 1USTA 3QU3A 3EYIA 3BC8A 1JKOC 4LB5A 1VQ4I 3E5XA 2BHZA 3ZR8X 3O2PE 4EGYA 1U5TA 3AG3H 2X1DA 2XRNA 2WWYA 4P9UA 3OL4A 4UNOA 1HBXG 1U2WA 1X1BA 3KCCA 2VC1A 1I6XA 2VQCA 4EJVA 3JSOA 4XQFA 2W57A 2B7EA 1IJWC 1Z21A 2LVSA 5IYBJ 2JA5J 5HDNA 2JPCA 3IC7A 4I6ZA 4LK1F 3HB9A 1FP2A 4HV5A 4BJTA 5FGMA 1MNEA 2FE3A 2HQNA 3JCUC 2WY8Q 4BE0A 2HNHA 3K0LA 2EA2A 5BPDA 1D3YA 4G94A 1RR8C 4FISA 3RPUD 2Z16A 2A5YB 4KJZA 1TT0A 4HV6A 3HPGA 1B59A 5EZHA 4WX9A 3G4SI 2OD5A 2VBZA 1RC9A 4BXXJ 3ESWB 5E1WA 4PSXA 2KRCA 2OTLI 3HTUA 4IHYA 3AG4H 1BJAA 1T6SA 5D6FA 1FJLA 3F6VA 2QZ8A 5H2FC 2WAQA 3HHHA 4AVZA 2NXNB 2K5CA 3DEEA 3ELKA 1WJ5A 2CQXA 4IL6C 4CH7A 4M3BA 1DDNA 3ZQLA 2O03A 1FYMA 4F52A 3M4OJ 2P5KA 3ERED 4PJ0C 1W36C 1YYVA 4YFKF 1HSTA 3CCVI 1UHWA 3KEYA 1R5HA 3CMMA 1H9TA 3EYYA 4HQMA 3M7GA 4E7JA 2R5ZA 2R7VA 3GLLA 1F1ZA 1PYVA 4XRMA 4UVAA 3G3ZA 5J6XA 4CGZA 4ENKA 3GTOJ 4JX6A 4F7ZA 3MFKA 3JW4A 2E2IJ 3L2CA 1PJRA 2DCEA 5DUKA 2XKPA 3HBLA 4XNFA 3CMYA 1IGNA 2BE5F 4E70A 3OYBA 4LFUA 3MMYB 4ZC3A 1OISA 2O3FA 1ZTRA 4G12A 1LFBA 2HR3A 4OOIA 3WTZA 2Z1DA 3ULQB 1K4SA 3WTUC 1SD7A 4NC7A 1P4AA 2TRTA 4C2UA 1VNDA 1X1DA 2A68F 2HFHA 3C3WA 4BYYA 2X51A 4KNYA 3WE3A 5J8CA 3FKIJ 2CG4A 3DBHB 2JSPA 1H9GA 2JMWA 1S7EA 4BAYA 4CICA 1G59A 1JUMA 3IH3A 2NNYA 4AD9A 4UY8I 1JT6A 1ORKA 3HIFA 4RAZA 3GO5A 3SDBA 2WV0A 2XPVA 5DM6F 2V9VA 4YIIA 4F91B 1VF9A 1SEUA 4UUTA 2KIFA 3BG3A 3QAHA 5E17F 2Z2SB 5CPRB 5J1UA 4JYKA 4KYWA 2QA4I 1GHCA 1B72B 1IN7A 3OSGA 4RLQA 3OYDA 3DLAA 3CCMI 3PFIA 1QGPA 2M5WA 3F0CA 3ZOBA 4CYDA 2WB1A 4M3GA 1S6LA 1KYZA 2JRTA 4EM1A 2VJJA 2LK2A 3BZCA 2H8RA 1T38A 4LMYA 3J7YJ 1U3EM 1UMQA 5LGTA 2M34A 3R61A 4MFEA 2ZJRF 1EF4A 5EEAA 4KDPA 3GUDA 1LDKB 1QHGA 3B6CA 5GAEJ 3TKYA 1PUFB 1T56A 2BW3A 3G1LA 3RQIA 3GVAA 2B0LA 2F4IA 3C2BA 3P9KA 4EVIA 5ILUA 1RRJA 5FFZA 4A0YA 5EDNA 1XMAA 3W6JB 2XUBA 1BJZA 2XROA 1K6YA 3HC7A 1JGSA 3S93A 2K40A 1MBKA 3EPZA 5K7FA 1O3RA 3Q0VA 4F55A 2Z3YA 4DYCA 4ZH4F 1ZLJA 4CZCA 1WQ2A 2HWVA 2JN6A 2L4MA 3HUGB 1BIAA 3HZJA 5ICFA 3ZMZA 4D9JA 1ZRCA 1TWCJ 3AAFA 3BLYA 2K9QA 2Y9ZA 3F8BA 2DT6A 1VQ9I 1MMGA 2IW5A 4MO7A 4IX7A 1QVUA 1ON2A 1JI8A 3B73A 2ZCWA 3C2GA 3FMQA 5BNGA 5LGNA 4WXCA 4ZYHA 5KCMA 2HYJA 1B72A 3UR3C 1AKHB 2BGCA 3FHZA 4Y15A 3KETA 4BE2A 2KHMA 3IV5A 4JP0A 2F5FA 4M74A 3OR1C 2DPDA 4EJUA 1BR4A 4HYEA 3PSIA 2RN7A 1CF7B 1MDMB 1K79A 1POGA 3BTJA 1RPWA 3WHCA 4MFDA 1WCMJ 4JQFA 2XSDC 1MIJA 2UXNA 3HGYA 4B47A 4XIDA 1PUEE 4M9ZA 2ME6A 1G3YA 3PQJA 3KIOA 2HKOA 4M72A 5ERIA 3OIQA 2KISA 4CHUA 3OYCA 2DW4A 3VSLA 3BTIA 2NNNA 1Y1WJ 2QQAA 4R1HA 1SAXA 1KU2A 1VZ0A 2HQ5A 2M8GX 1YRNB 2VUMJ 1CGPA 2AQEA 5J8FA 3JRDA 2VKEA 5CYVA 4E7KA 4XSZF 2VBXA 4LIUA 3VSKA 3HUGA 4IHVA 2XC7A 4XR6A 5F27A 4IOAF 2HYGD 2E71A 2K9LA 3VEPA 4ETSA 1SAUA 1HW2A 1UCRA 2RVCA 3IH4A 4BE1A 3OIOA 4PZJA 2HTJA 2ZXIA 4JOMA 4W1UA 3JRBA 4ENJA 1T8IA 1VQ6I 2EIKH 1OR7C 1E2XA 3DPTA 1FBQA 2WTEA 4KMFA 3H3VK 2IGMA 2ZMEB 4YELA 5AIPA 2DPUA 3HDDA 3I53A 2F5VA 3MEXA 3CJTB 1QHHD 1E0EA 1KGSA 2FMYA 3DPUA 1OCOH 1CF7A 3AG1H 5FKMA 1DPUA 4KMUX 3L9FA 4DW6A 2Z5UA 1SFEA 4UUSB 2HPIA 2FMLA 5GAGJ 2KIMA 3KPHA 2F6CA 1QZEA 3J81Z 3CUOA 3ZQCA 2X85A 4LITA 2GIZA 4LJZF 5L3BA 4L9TA 1YX5A 3GWZA 2EFOA 1WVRA 2V1XA 2K4JA 3E5QA 1STZA 3CCUI 2EFWA 4CCOA 1D1AA 3L00A 2PMUA 1S29A 2XPUA 3TO7A 1YE9A 1YRNA 4NNJA 5DDGA 1HDDC 3G1MA 3OSFA 4FHTA 1KZHA 4B3AA 1XDUA 2JUGA 4AU7A 4RDUA 5B1BH 4MNUA 3CCYA 1RKWA
chains in the Genus database with same CATH topology
1I1GA 3I59B 4UHTA 2D45A 1ZGAA 2DAOA 2QENA 1UFMA 4EJWA 3O3KA 2IA0A 1IW7F 3RKYA 2O8XA 3I4PA 2CGPA 1ULYA 3J80K 3KP7A 4A12A 5KK1A 3NQOA 3LQQA 3JAMK 2STTA 1P4WA 2H94A 3N97A 1UB9A 3GFLA 4ESBA 5H20A 1OPCA 4WK8F 2V6CA 4R8HA 5ICCA 2F5EA 4AIJA 1XGMA 2P7VB 1E17A 3GFMA 1I1SA 3ZMSA 2IA2A 3LAPA 3DXJF 2DO7A 1KU9A 3I59A 5ICGA 3RYPA 1LNWA 2GXGA 2Y75A 1K7AA 3WTWC 4IVNA 4L5JA 4NB5A 6PAXA 3OV8A 5H6RA 3T0YA 4WXDA 4M9XA 5LRSA 1TW2A 1ZGJA 2EFPA 5HVQC 1Q1HA 3FX3A 3I71A 2HTSA 2RKHA 4U0YA 2F5DA 1O3SA 4HLXA 2PMHA 1A04A 3BJ6A 3KP2A 1QBJA 2FNAA 1S3JA 2ADUA 1XGNA 5IT3A 3KP3A 1R7JA 3GF2A 2DI3A 5DCMA 3TDZC 1KQ8A 5JFRA 2P8TA 4LLNA 5DD8A 3KZZA 1O57A 4TV7A 2EV0A 5E1XA 3Q9SA 2ZXJA 4KT5C 4RS8A 3WTYC 3BJOA 3EQLF 1TNSA 4HAMA 3BP8A 3SXYA 3K1NA 5H6QA 2BEOA 3F22A 4Q5SF 5LRRA 3RJPA 1O7LA 2CO5A 1P92A 4N9HA 4I2OA 1OYYA 4R79A 1YW8A 1FZPB 5JHUA 3COAC 3I58A 4P55A 4U7DA 1EH7A 5FO5A 2VODA 5E8IA 3HOTA 2O61A 1K78A 1KQ9A 4OIPF 2IVMA 2BYVE 1FLIA 5DUIA 3V7SA 2K02A 4HA8A 5DCFA 2XGXA 1MJAA 3H3UA 2GA2A 3F6OA 2PQ8A 4LD5A 4LB6B 2ESNA 1QZYA 3M9AA 3CO7C 3V7RA 1IN8A 2ISYA 2W85A 3GW2A 4BHPA 3FMRA 3GLXA 2P6TA 1WWXA 2RC4A 2HQRA 5BQTA 2IA1A 5D8KB 4HF2A 3T5XA 2Y0MA 5FLXK 2L01A 3BY6A 5L3CA 5LEKA 3BROA 1LJ9A 1FOKA 5ED4A 2QBYB 1LDJA 1IAWA 1W7PD 4EJTA 3LWFA 4IRIA 1HW5A 4Z2YA 2YU3A 4MTEA 4GO1A 1FPQA 1LDDA 4AIKA 4NQWA 2PN6A 1QQIA 2HEOA 5LLQA 3GEZA 5ILSA 4XLNF 3WODF 1XSDA 1XGSA 3LA7A 4RGRA 4IHTA 1ZHFA 4GYIA 5FFXA 5E1ZB 3CJNA 1DUXC 3TO9A 5HDGA 2MC3A 4FX4A 5LGUA 1PP7U 2XAJA 5LHHA 1B1BA 4RAYA 1YIOA 1BBYA 2QBYA 2AS5F 3CLOA 2ZJ2A 2E7WA 3G73A 5BOXA 3C7JA 2H6BA 3JSPA 5CVUA 2KRFA 5FD6A 4KA4A 1J75A 1ZRFA 1WRJA 2A07F 4G7OF 1V3FA 1IN4A 3IHUA 4G7HF 1YLFA 4BNCA 4MQVA 3GYHX 3T8TA 4EM0B 3IKVA 3SHFA 1FNNA 1Z1DA 2LSOA 4GGGA 3FXUA 1OMIA 1ZRDA 1OR7A 2M87A 2ELHA 2VN2A 1W5SA 1FSHA 2MLGA 3BPVA 4IPAA 4M6YA 2VT2A 4A0ZA 1AOYA 5F64A 4I7HA 1LEBA 2FBHA 2M30A 3SQNA 3HHGA 2HZTA 4L18B 1T98A 3DQVC 2H6CA 1L0OC 1IN6A 2PEXA 3R0AA 3DFGA 2LNBA 1FT9A 5BMZA 5ILVA 3ECHA 1S8NA 2TDXA 1HKTA 3WE2A 4NHJA 5HDKA 1WI9A 3DV8A 4O6JA 4CZZA 1U6GA 1G3WA 3E6BA 1G3TA 2FRHA 3K1MA 1FYKA 2OU2A 2XAFA 1U8RA 4U88A 3ECOA 2ZNZA 3LQRA 2X4HA 5JI6A 4KN7X 5A2QK 4K2EA 2GXBA 2H27A 2EK5A 3MZHA 3C1DA 3IRRA 1FY7A 2W84A 4UVBA 2EB7A 4EM2A 5LHIA 3FM5A 1RIOH 1R22A 1IRGA 4M6XA 3E97A 2FF4A 3WTXC 1TQIA 1RUOA 5DV5A 3V8JA 3F8CA 5HS9A 4GXOA 2HDCA 1P4XA 2BV6A 1W4MA 2HGCA 3RDIA 1IN5A 3GZ5A 4ZYGA 2V1DA 1W5TA 2YPRA 4MEXF 1G4DA 2LF7A 3HSRA 4U0WA 3VOEA 1ZG5A 2OA4A 2VBWA 2GWRA 3P9CA 1X3UA 5IT9K 2O0YA 2ACJA 3C18A 4Y13A 4A0XA 1Y0UA 1ZREA 1YFHA 4P9FA 2KJBA 3NEUA 1W7PB 1TW3A 3DEUA 2VE8A 4KN4X 4MEYF 5FD5A 1MD0A 2JPBA 4KUMA 1MDMA 3K9TA 4MTDA 1T2KA 4WWCA 2PI0A 5TRDA 5CVJA 3ZMUA 4CO8A 3O6BB 2VBYA 1MZBA 4P96A 3RTRA 3PQKA 2JSCA 2ZFWA 3K69A 2IRFG 2G7HA 5HOOA 2ETHA 3KE2A 3L09A 2M8EA 3KEOA 2A61A 3KLNA 3IWFA 4IRHA 4H0EA 3TO6A 1RNLA 4HBLA 2CFXA 2MLKA 5D5WB 3TGNA 1LVAA 1QO0D 1XGOA 4G6QA 3D0SA 1PP8F 3WG9A 2R3SA 2DBBA 2A69F 2ZMEA 1IXCA 4MHGA 5HLIA 4IRGA 4HX8A 1R1UA 5EEGA 1J9IA 2FNPA 3FWEA 4U7BA 3WTVC 4EV0A 1I5ZA 1YW9A 4L9JA 4Q48A 2R7DA 4BHCA 3HTSB 1IXSB 3RPUA 3CTAA 4ENMA 3EDPA 1JE8A 1XDSA 2IP2A 3TQNA 2LF8A 3LFKA 5L3FA 3HSFA 3E6CC 3J80Z 3W6KB 5LEJA 3GX4X 1J59A 1IUYA 2FEZA 1R1TA 3JAMZ 4I01A 1OYIA 2PFBA 2NYXA 2DT5A 3WU0A 3FF5A 5AONA 2FA5A 2CQKA 4HZFA 3ZPLA 2L4AA 4AIHA 3CUQB 1U78A 2MH9A 1ODDA 5D5XB 3V8KA 2Z99A 4N0BA 4A6EA 2YR2A 3SFZA 1TBXA 4ZYEA 4LGWA 5CJ9A 3HRTA 1SMTA 1ZG3A 2ZO4A 4KIFA 3I54A 4B09A 4BH9A 1FSEA 3GFJA 4OU0A 2FXAA 5E8GA 4HF1A 1Z9CA 2MD5A 4UV8A 2VT3A 4IXAA 4O5VA 2LDUA 4EJOA 4PGGA 1RUNA 1D8KA 2CSOA 1FYLA 1D8JA 2XV4S 4XSXF 3TDUC 4KIGA 2GIVA 1G6NA 5D4RA 4M71A 3U1DA 2OBPA 4JBAA 1BOAA 1RZ4A 5HS7A 5L3DA 2V1UA 5TJJA 1KQ0A 4OMZA 3RPQA 2VXZA 3MWMA 1WKMA 4Q47A 5K5RA 2ZBKA 5EEHA 4LLGF 4OINF 3R6SA 3MAJA 3F8FA 1J7KA 1IZ1A 3DF8A 3RYRA 1YG2A 1ZYRF 5CVVA 1Z6RA 2HYFA 3FZVA 2K86A 1ON1A 1MJ9A 4MGRA 1TTYA 4FT8A 2K4BA 1P6RA 1F9NA 1FP1D 2EA4A 2Q2EA 4OIOF 3RI4A 1JXSA 2E7XA 5BPIA 3QOPA 1S7OA 3B02A 3DPLC 1R00A 5DD4A 3QU6A 4YG2F 3EETA 4WCGA 2A3SA 4HDVA 4EQQA 3ROUA 3J7AO 2QYOA 1U5TB 3HRUA 4Q4ZF 2YX4A 2DQLA 2KIUA 4XLPF 4YIFA 2E1CA 2RNJA 3WGIA 2XAQA 2C6YA 3Q9VA 1GXQA 1SD4A 3ABUA 4G6DA 4YFXF 4DQ2A 5BS6A 5K1YA 1HQCA 1REPC 2VE9A 3OOPA 5LBQA 3D5LA 1IF1A 2HOEA 2QM3A 5LHGA 2LKPA 3BOQA 1KYWA 5F1RA 1ZAOA 2DQRA 2QWWA 4AWXB 4HQEA 5FLXZ 3HSEA 4YFNF 4RB2C 4S04A 2RV8A 4HW0A 1YW7A 1JHFA 4IJAA 1QPMA 2UWMA 1XSVA 2QUFA 4I98B 3CUQC 2NRAC 2K7LA 4A2UA 3KFWX 3ML6A 5AIQA 3L7WA 3M8FA 3H92A 4A5NA 2RDPA 1V4RA 3IL2A 4ESFA 2G7UA 3N4MA 5HS8A 3F21A 2Z9OA 3KZYA 3JTGA 2P5LC 4RGSA 1XMKA 1S7AA 1VTNC 2OAZA 2DK8A 2F2EA 1I27A 3CO6C 3F8MA 4RGUA 1HKQA 1EH6A 3P7NA 1TLHB 2BBYA 5JR3A 3ZMVA 3IKTA 5HLGA 3R4KA 1RI7A 3QP6A 2Q8KA 3E6MA 3ZMDA 1BI1A 3HRMA 1FX7A 1F4KA 4L0ZB 1EH8A 4HX4A 1YS7A 1TQPA 4KIBA 4EMSA 3MQ0A 4BHBA 1ZLKA 1R58A 2L54A 1NHAA 2IJLA 2XASA 4B8XA 4PGHA 5DEQA 3T8RA 3ZP5A 1R23A 3I64A 3CDHA 2FQ3A 4UV9A 5L3GA 3H3ZA 1IXRC 4BQAA 1FWZA 3V4GA 2XVCA 4RB0A 4OMYA 2V79A 2KJCA 3RIRA 1USSA 3GXOA 1ZG1A 1T0FA 2M1BA 2PLYA 1GVJA 3K1PA 3WU1B 1P2FA 1MKMA 1PDNC 4G8XA 3VODA 5CVRA 4LK0F 2ISZA 2EV5A 1IRFA 1U5TC 1YS6A 1WSUA 4QLCU 2W24A 4L5IA 1SFXA 1XN7A 2IPQX 3P9IA 1L3LA 4CXFA 1KU7A 3DKWA 1Z7UA 2CWEA 1B4AA 2Q0OA 1DP7P 3QP5A 2HS5A 1D5VA 1QNTA 3TOAA 4G7ZF 3FMSA 1BI0A 1MGTA 1XB4A 2OQGA 1R5GA 4ESJA 3FXQA 4HOBA 5A2QZ 2PG4A 1R36A 4OIRF 3T1BA 4HX7A 3DP7A 4EGZA 3F72A 2XIGA 3EUHA 1LQ1A 3WTSC 3MCZA 2Z33A 1AWCA 2QVOA 2G9WA 2E1NA 4LLLA 3F3XA 4MQ9F 4L0YB 3IWZA 2MA3A 4RB1A 3M1EA 5DYMA 3JTHA 3FM3A 1EV7A 2VOPA 3QPTA 4XRFA 2GQQA 3WTTC 5L3EA 1Z91A 4FX0A 3GFIA 5IT9Z 1BC7C 3BJAA 1QZZA 2RGVA 4PCQA 2J5OA 2M45A 2P5VA 3F23A 1HW1A 3J81K 1SFUA 4KFCA 3WGGA 4L9VA 1K6OA 3REOA 5FB2A 2ESHA 1HXDA 1KU3A 2KKOA 5ICEA 2L3DA 2K27A 3U2RA 3V8LA 1YQAA 4M73A 1B9MA 2HKXA 5E20A 2D1HA 3F8NA 2XAHA 2MBFA 2YX7A 1B9NA 1FBSA 3IRQA 3TOBA 4D0PA 1BN5A 2NAZA 2P7CB 2Y48A 4DNCA 2A6EF 4L9NA 1W7PA 1LEAA 1FBUA 5F6FA 3ABTA 4ON0A 1J2XA 1R1VA 4XBFA 4RB3C 4I09A 5K5OA 2QQ9A 2YSRA 1Z05A 2CYYA 1JHHA 3M8EA 1DPRA 4I02A 3KP6A 3R60A 1LB2A 3I0TA 2X0LA 4WXHA 2ZKZA 2F5CA 1HSJA 1SD6A 4LG0B 3Q5FA 2FSWA 3BPXA 2DLLA 4PDKA 3VFZA 4IHSA 3S2WA 2XKOA 5D5VB 4GYGA 4UXNA 2XAGA 3HOSA 2DTRA 2H09A 4ENNA 4CDGA 4OIQF 1ONVA 4HLYA 1O3QA 2OZ6A 5D8LB 2DU9A 2FOKA 4HF0A 4KICA 2DK5A 5DCMB 2FBIA 3ISPA 5KVRA 4ZZDA 4IF4A 2CW0F 1OYWA 2J5PA 3WGHA 2QLZA 3HRSA 4A6DA 2VOOA 3LAJA 4WF2A 2STWA 1XD7A 1J5YA 4AVPA 3LSTA 2OQRA 4ZYDA 2FU4A 2IT0A 4I0BA 3GZ6A 4LG0A 2QQBA 2PJPA 2FBKA 2COMA 5E18F 5CVIA 3BWGA 2L02A 4U0VA 1FC3A 2P4WA 4A5MA 1MJBA 2O6GE 2EFQA 2XHKA 1ZARA 3E3VA 3VB2A 5D4SA 1KA8A 1BI3A 3CUQA 2GZWA 2D2WA 1XSXA 5HLHA 4M9SA 1K78B 4JK1X 3SZPA 4QWQA 2ZNYA 2OZUA 2DFIA 1J0RA 2MH2A 2P6SA 3ZQ7A 2A6HF 4I0AA 5JVTA 1OKRA 1UHMA 3FXRA 3R0JA 3RKXA 3LA3A 1BI2A 3BDDA 2EV6A 1BC8C 2JTVA 3KP4A 1G3SA 4P5OA 1BM9A 2D1VA 2PBIA 1SD5A 2VONA 1GXPA 1Z6TA 2UZKA 2VC0A 4RGXA 4ZZLA 1ZH5A 5D5UB 1TQMA 3K2ZA 4UVCA 2JZYA 3ZMTA 2GA1A 3QPHA 1H0MA 4Y17A 2RQPA 4ASNA 3NRVA 1F5TA 1C0WA 4GCVA 4G9YA 3E6DA 4O3MA 1TNTA 2EJRA 1T39A 3SZTA 3ZN0A 3LA2A 3U9GA 1HKSA 1SMYF 3KEQA 5D6EA 3MZYA 1O7FA 1YTYA 4HDUA 1O3TA 1YO5C 2NS0A 1XCVA 2R7FA 2JT1A 2EWNA 3KP5A 4N9IA 5K5QA 4BXUA 2WC2A 1XCBA 3I5UA 3RKWA 1ZN2A 2UXXA 4UUVA 3E5UA 1B6AA 3ZN1A 3HYIA 3BZ6A 1BIBA 2AXLA 2EFNA 2W25A 4S05A 2GAUA 3KLOA 3V7CA 5CLSA 1USTA 3QU3A 3EYIA 4LB5A 3E5XA 3O2PE 4EGYA 1U5TA 2XRNA 2WWYA 4P9UA 4UNOA 1HBXG 1U2WA 3KCCA 2VC1A 1I6XA 4EJVA 3JSOA 2W57A 5HDNA 2JPCA 3IC7A 4LK1F 1FP2A 4HV5A 5FGMA 2FE3A 2HQNA 3K0LA 2EA2A 5BPDA 1D3YA 4G94A 2A5YB 4HV6A 1B59A 4WX9A 2OD5A 2VBZA 5E1WA 3HTUA 1BJAA 1T6SA 5D6FA 3F6VA 2QZ8A 3HHHA 3ELKA 1DDNA 2O03A 1FYMA 2P5KA 3ERED 1YYVA 4YFKF 1HSTA 1UHWA 1R5HA 1H9TA 3EYYA 4HQMA 3M7GA 1F1ZA 4UVAA 3G3ZA 5J6XA 4CGZA 4ENKA 4F7ZA 3MFKA 3JW4A 3L2CA 5DUKA 2XKPA 2BE5F 4E70A 4LFUA 2O3FA 2HR3A 4OOIA 3WTZA 3ULQB 3WTUC 1SD7A 1P4AA 2A68F 2HFHA 3C3WA 4BYYA 4KNYA 3WE3A 5J8CA 2CG4A 1H9GA 4BAYA 4CICA 2NNYA 4AD9A 3HIFA 4RAZA 3GO5A 2WV0A 2V9VA 4YIIA 2KIFA 3QAHA 5E17F 4KYWA 1GHCA 1IN7A 3PFIA 1QGPA 2M5WA 4CYDA 1S6LA 1KYZA 2JRTA 4EM1A 1T38A 4LMYA 1U3EM 5LGTA 3R61A 4KDPA 3GUDA 1LDKB 3TKYA 3GVAA 2B0LA 3P9KA 4EVIA 5ILUA 5FFZA 4A0YA 1XMAA 3W6JB 2XUBA 2XROA 1JGSA 1O3RA 2Z3YA 4ZH4F 1ZLJA 1WQ2A 2HWVA 2L4MA 1BIAA 5ICFA 3ZMZA 1ZRCA 3AAFA 3F8BA 2IW5A 1ON2A 3B73A 2ZCWA 3FMQA 5LGNA 4WXCA 4ZYHA 2BGCA 3FHZA 4Y15A 3KETA 2F5FA 4M74A 2DPDA 4EJUA 4HYEA 2RN7A 1CF7B 1MDMB 1K79A 4JQFA 2UXNA 1PUEE 4M9ZA 1G3YA 3PQJA 2HKOA 4M72A 5ERIA 4CHUA 2DW4A 2NNNA 2QQAA 4R1HA 1SAXA 1KU2A 1CGPA 5J8FA 5CYVA 4XSZF 2VBXA 3HUGA 2HYGD 3VEPA 4ETSA 1HW2A 1UCRA 2RVCA 4PZJA 2HTJA 4ENJA 1E2XA 3DPTA 1FBQA 2WTEA 4KMFA 2ZMEB 5AIPA 2DPUA 3I53A 3MEXA 1KGSA 2FMYA 1CF7A 1DPUA 4KMUX 3L9FA 2Z5UA 1SFEA 2FMLA 2KIMA 3J81Z 3CUOA 4LJZF 5L3BA 4L9TA 3GWZA 2EFOA 2V1XA 2K4JA 3E5QA 1STZA 2EFWA 3L00A 2PMUA 1S29A 3TO7A 5DDGA 4FHTA 1XDUA 4MNUA 3QRFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1G A;  3I59 B;  4UHT A;  2D45 A;  1ZGA A;  2DAO A;  2QEN A;  1UFM A;  4EJW A;  3O3K A;  2IA0 A;  1IW7 F;  3RKY A;  2O8X A;  3I4P A;  2CGP A;  1ULY A;  3J80 K;  3KP7 A;  4A12 A;  5KK1 A;  3NQO A;  3LQQ A;  3JAM K;  2STT A;  1P4W A;  2H94 A;  3N97 A;  1UB9 A;  3GFL A;  4ESB A;  5H20 A;  1OPC A;  4WK8 F;  2V6C A;  4R8H A;  5ICC A;  2F5E A;  4AIJ A;  1XGM A;  2P7V B;  1E17 A;  3GFM A;  1I1S A;  3ZMS A;  2IA2 A;  3LAP A;  3DXJ F;  2DO7 A;  1KU9 A;  3I59 A;  5ICG A;  3RYP A;  1LNW A;  2GXG A;  2Y75 A;  1K7A A;  3WTW C;  4IVN A;  4L5J A;  4NB5 A;  6PAX A;  3OV8 A;  5H6R A;  3T0Y A;  4WXD A;  4M9X A;  5LRS A;  1TW2 A;  1ZGJ A;  2EFP A;  5HVQ C;  1Q1H A;  3FX3 A;  3I71 A;  2HTS A;  2RKH A;  4U0Y A;  2F5D A;  1O3S A;  4HLX A;  2PMH A;  1A04 A;  3BJ6 A;  3KP2 A;  1QBJ A;  2FNA A;  1S3J A;  2ADU A;  1XGN A;  5IT3 A;  3KP3 A;  1R7J A;  3GF2 A;  2DI3 A;  5DCM A;  3TDZ C;  1KQ8 A;  5JFR A;  2P8T A;  4LLN A;  5DD8 A;  3KZZ A;  1O57 A;  4TV7 A;  2EV0 A;  5E1X A;  3Q9S A;  2ZXJ A;  4KT5 C;  4RS8 A;  3WTY C;  3BJO A;  3EQL F;  1TNS A;  4HAM A;  3BP8 A;  3SXY A;  3K1N A;  5H6Q A;  2BEO A;  3F22 A;  4Q5S F;  5LRR A;  3RJP A;  1O7L A;  2CO5 A;  1P92 A;  4N9H A;  4I2O A;  1OYY A;  4R79 A;  1YW8 A;  1FZP B;  5JHU A;  3COA C;  3I58 A;  4P55 A;  4U7D A;  1EH7 A;  5FO5 A;  2VOD A;  5E8I A;  3HOT A;  2O61 A;  1K78 A;  1KQ9 A;  4OIP F;  2IVM A;  2BYV E;  1FLI A;  5DUI A;  3V7S A;  2K02 A;  4HA8 A;  5DCF A;  2XGX A;  1MJA A;  3H3U A;  2GA2 A;  3F6O A;  2PQ8 A;  4LD5 A;  4LB6 B;  2ESN A;  1QZY A;  3M9A A;  3CO7 C;  3V7R A;  1IN8 A;  2ISY A;  2W85 A;  3GW2 A;  4BHP A;  3FMR A;  3GLX A;  2P6T A;  1WWX A;  2RC4 A;  2HQR A;  5BQT A;  2IA1 A;  5D8K B;  4HF2 A;  3T5X A;  2Y0M A;  5FLX K;  2L01 A;  3BY6 A;  5L3C A;  5LEK A;  3BRO A;  1LJ9 A;  1FOK A;  5ED4 A;  2QBY B;  1LDJ A;  1IAW A;  1W7P D;  4EJT A;  3LWF A;  4IRI A;  1HW5 A;  4Z2Y A;  2YU3 A;  4MTE A;  4GO1 A;  1FPQ A;  1LDD A;  4AIK A;  4NQW A;  2PN6 A;  1QQI A;  2HEO A;  5LLQ A;  3GEZ A;  5ILS A;  4XLN F;  3WOD F;  1XSD A;  1XGS A;  3LA7 A;  4RGR A;  4IHT A;  1ZHF A;  4GYI A;  5FFX A;  5E1Z B;  3CJN A;  1DUX C;  3TO9 A;  5HDG A;  2MC3 A;  4FX4 A;  5LGU A;  1PP7 U;  2XAJ A;  5LHH A;  1B1B A;  4RAY A;  1YIO A;  1BBY A;  2QBY A;  2AS5 F;  3CLO A;  2ZJ2 A;  2E7W A;  3G73 A;  5BOX A;  3C7J A;  2H6B A;  3JSP A;  5CVU A;  2KRF A;  5FD6 A;  4KA4 A;  1J75 A;  1ZRF A;  1WRJ A;  2A07 F;  4G7O F;  1V3F A;  1IN4 A;  3IHU A;  4G7H F;  1YLF A;  4BNC A;  4MQV A;  3GYH X;  3T8T A;  4EM0 B;  3IKV A;  3SHF A;  1FNN A;  1Z1D A;  2LSO A;  4GGG A;  3FXU A;  1OMI A;  1ZRD A;  1OR7 A;  2M87 A;  2ELH A;  2VN2 A;  1W5S A;  1FSH A;  2MLG A;  3BPV A;  4IPA A;  4M6Y A;  2VT2 A;  4A0Z A;  1AOY A;  5F64 A;  4I7H A;  1LEB A;  2FBH A;  2M30 A;  3SQN A;  3HHG A;  2HZT A;  4L18 B;  1T98 A;  3DQV C;  2H6C A;  1L0O C;  1IN6 A;  2PEX A;  3R0A A;  3DFG A;  2LNB A;  1FT9 A;  5BMZ A;  5ILV A;  3ECH A;  1S8N A;  2TDX A;  1HKT A;  3WE2 A;  4NHJ A;  5HDK A;  1WI9 A;  3DV8 A;  4O6J A;  4CZZ A;  1U6G A;  1G3W A;  3E6B A;  1G3T A;  2FRH A;  3K1M A;  1FYK A;  2OU2 A;  2XAF A;  1U8R A;  4U88 A;  3ECO A;  2ZNZ A;  3LQR A;  2X4H A;  5JI6 A;  4KN7 X;  5A2Q K;  4K2E A;  2GXB A;  2H27 A;  2EK5 A;  3MZH A;  3C1D A;  3IRR A;  1FY7 A;  2W84 A;  4UVB A;  2EB7 A;  4EM2 A;  5LHI A;  3FM5 A;  1RIO H;  1R22 A;  1IRG A;  4M6X A;  3E97 A;  2FF4 A;  3WTX C;  1TQI A;  1RUO A;  5DV5 A;  3V8J A;  3F8C A;  5HS9 A;  4GXO A;  2HDC A;  1P4X A;  2BV6 A;  1W4M A;  2HGC A;  3RDI A;  1IN5 A;  3GZ5 A;  4ZYG A;  2V1D A;  1W5T A;  2YPR A;  4MEX F;  1G4D A;  2LF7 A;  3HSR A;  4U0W A;  3VOE A;  1ZG5 A;  2OA4 A;  2VBW A;  2GWR A;  3P9C A;  1X3U A;  5IT9 K;  2O0Y A;  2ACJ A;  3C18 A;  4Y13 A;  4A0X A;  1Y0U A;  1ZRE A;  1YFH A;  4P9F A;  2KJB A;  3NEU A;  1W7P B;  1TW3 A;  3DEU A;  2VE8 A;  4KN4 X;  4MEY F;  5FD5 A;  1MD0 A;  2JPB A;  4KUM A;  1MDM A;  3K9T A;  4MTD A;  1T2K A;  4WWC A;  2PI0 A;  5TRD A;  5CVJ A;  3ZMU A;  4CO8 A;  3O6B B;  2VBY A;  1MZB A;  4P96 A;  3RTR A;  3PQK A;  2JSC A;  2ZFW A;  3K69 A;  2IRF G;  2G7H A;  5HOO A;  2ETH A;  3KE2 A;  3L09 A;  2M8E A;  3KEO A;  2A61 A;  3KLN A;  3IWF A;  4IRH A;  4H0E A;  3TO6 A;  1RNL A;  4HBL A;  2CFX A;  2MLK A;  5D5W B;  3TGN A;  1LVA A;  1QO0 D;  1XGO A;  4G6Q A;  3D0S A;  1PP8 F;  3WG9 A;  2R3S A;  2DBB A;  2A69 F;  2ZME A;  1IXC A;  4MHG A;  5HLI A;  4IRG A;  4HX8 A;  1R1U A;  5EEG A;  1J9I A;  2FNP A;  3FWE A;  4U7B A;  3WTV C;  4EV0 A;  1I5Z A;  1YW9 A;  4L9J A;  4Q48 A;  2R7D A;  4BHC A;  3HTS B;  1IXS B;  3RPU A;  3CTA A;  4ENM A;  3EDP A;  1JE8 A;  1XDS A;  2IP2 A;  3TQN A;  2LF8 A;  3LFK A;  5L3F A;  3HSF A;  3E6C C;  3J80 Z;  3W6K B;  5LEJ A;  3GX4 X;  1J59 A;  1IUY A;  2FEZ A;  1R1T A;  3JAM Z;  4I01 A;  1OYI A;  2PFB A;  2NYX A;  2DT5 A;  3WU0 A;  3FF5 A;  5AON A;  2FA5 A;  2CQK A;  4HZF A;  3ZPL A;  2L4A A;  4AIH A;  3CUQ B;  1U78 A;  2MH9 A;  1ODD A;  5D5X B;  3V8K A;  2Z99 A;  4N0B A;  4A6E A;  2YR2 A;  3SFZ A;  1TBX A;  4ZYE A;  4LGW A;  5CJ9 A;  3HRT A;  1SMT A;  1ZG3 A;  2ZO4 A;  4KIF A;  3I54 A;  4B09 A;  4BH9 A;  1FSE A;  3GFJ A;  4OU0 A;  2FXA A;  5E8G A;  4HF1 A;  1Z9C A;  2MD5 A;  4UV8 A;  2VT3 A;  4IXA A;  4O5V A;  2LDU A;  4EJO A;  4PGG A;  1RUN A;  1D8K A;  2CSO A;  1FYL A;  1D8J A;  2XV4 S;  4XSX F;  3TDU C;  4KIG A;  2GIV A;  1G6N A;  5D4R A;  4M71 A;  3U1D A;  2OBP A;  4JBA A;  1BOA A;  1RZ4 A;  5HS7 A;  5L3D A;  2V1U A;  5TJJ A;  1KQ0 A;  4OMZ A;  3RPQ A;  2VXZ A;  3MWM A;  1WKM A;  4Q47 A;  5K5R A;  2ZBK A;  5EEH A;  4LLG F;  4OIN F;  3R6S A;  3MAJ A;  3F8F A;  1J7K A;  1IZ1 A;  3DF8 A;  3RYR A;  1YG2 A;  1ZYR F;  5CVV A;  1Z6R A;  2HYF A;  3FZV A;  2K86 A;  1ON1 A;  1MJ9 A;  4MGR A;  1TTY A;  4FT8 A;  2K4B A;  1P6R A;  1F9N A;  1FP1 D;  2EA4 A;  2Q2E A;  4OIO F;  3RI4 A;  1JXS A;  2E7X A;  5BPI A;  3QOP A;  1S7O A;  3B02 A;  3DPL C;  1R00 A;  5DD4 A;  3QU6 A;  4YG2 F;  3EET A;  4WCG A;  2A3S A;  4HDV A;  4EQQ A;  3ROU A;  3J7A O;  2QYO A;  1U5T B;  3HRU A;  4Q4Z F;  2YX4 A;  2DQL A;  2KIU A;  4XLP F;  4YIF A;  2E1C A;  2RNJ A;  3WGI A;  2XAQ A;  2C6Y A;  3Q9V A;  1GXQ A;  1SD4 A;  3ABU A;  4G6D A;  4YFX F;  4DQ2 A;  5BS6 A;  5K1Y A;  1HQC A;  1REP C;  2VE9 A;  3OOP A;  5LBQ A;  3D5L A;  1IF1 A;  2HOE A;  2QM3 A;  5LHG A;  2LKP A;  3BOQ A;  1KYW A;  5F1R A;  1ZAO A;  2DQR A;  2QWW A;  4AWX B;  4HQE A;  5FLX Z;  3HSE A;  4YFN F;  4RB2 C;  4S04 A;  2RV8 A;  4HW0 A;  1YW7 A;  1JHF A;  4IJA A;  1QPM A;  2UWM A;  1XSV A;  2QUF A;  4I98 B;  3CUQ C;  2NRA C;  2K7L A;  4A2U A;  3KFW X;  3ML6 A;  5AIQ A;  3L7W A;  3M8F A;  3H92 A;  4A5N A;  2RDP A;  1V4R A;  3IL2 A;  4ESF A;  2G7U A;  3N4M A;  5HS8 A;  3F21 A;  2Z9O A;  3KZY A;  3JTG A;  2P5L C;  4RGS A;  1XMK A;  1S7A A;  1VTN C;  2OAZ A;  2DK8 A;  2F2E A;  1I27 A;  3CO6 C;  3F8M A;  4RGU A;  1HKQ A;  1EH6 A;  3P7N A;  1TLH B;  2BBY A;  5JR3 A;  3ZMV A;  3IKT A;  5HLG A;  3R4K A;  1RI7 A;  3QP6 A;  2Q8K A;  3E6M A;  3ZMD A;  1BI1 A;  3HRM A;  1FX7 A;  1F4K A;  4L0Z B;  1EH8 A;  4HX4 A;  1YS7 A;  1TQP A;  4KIB A;  4EMS A;  3MQ0 A;  4BHB A;  1ZLK A;  1R58 A;  2L54 A;  1NHA A;  2IJL A;  2XAS A;  4B8X A;  4PGH A;  5DEQ A;  3T8R A;  3ZP5 A;  1R23 A;  3I64 A;  3CDH A;  2FQ3 A;  4UV9 A;  5L3G A;  3H3Z A;  1IXR C;  4BQA A;  1FWZ A;  3V4G A;  2XVC A;  4RB0 A;  4OMY A;  2V79 A;  2KJC A;  3RIR A;  1USS A;  3GXO A;  1ZG1 A;  1T0F A;  2M1B A;  2PLY A;  1GVJ A;  3K1P A;  3WU1 B;  1P2F A;  1MKM A;  1PDN C;  4G8X A;  3VOD A;  5CVR A;  4LK0 F;  2ISZ A;  2EV5 A;  1IRF A;  1U5T C;  1YS6 A;  1WSU A;  4QLC U;  2W24 A;  4L5I A;  1SFX A;  1XN7 A;  2IPQ X;  3P9I A;  1L3L A;  4CXF A;  1KU7 A;  3DKW A;  1Z7U A;  2CWE A;  1B4A A;  2Q0O A;  1DP7 P;  3QP5 A;  2HS5 A;  1D5V A;  1QNT A;  3TOA A;  4G7Z F;  3FMS A;  1BI0 A;  1MGT A;  1XB4 A;  2OQG A;  1R5G A;  4ESJ A;  3FXQ A;  4HOB A;  5A2Q Z;  2PG4 A;  1R36 A;  4OIR F;  3T1B A;  4HX7 A;  3DP7 A;  4EGZ A;  3F72 A;  2XIG A;  3EUH A;  1LQ1 A;  3WTS C;  3MCZ A;  2Z33 A;  1AWC A;  2QVO A;  2G9W A;  2E1N A;  4LLL A;  3F3X A;  4MQ9 F;  4L0Y B;  3IWZ A;  2MA3 A;  4RB1 A;  3M1E A;  5DYM A;  3JTH A;  3FM3 A;  1EV7 A;  2VOP A;  3QPT A;  4XRF A;  2GQQ A;  3WTT C;  5L3E A;  1Z91 A;  4FX0 A;  3GFI A;  5IT9 Z;  1BC7 C;  3BJA A;  1QZZ A;  2RGV A;  4PCQ A;  2J5O A;  2M45 A;  2P5V A;  3F23 A;  1HW1 A;  3J81 K;  1SFU A;  4KFC A;  3WGG A;  4L9V A;  1K6O A;  3REO A;  5FB2 A;  2ESH A;  1HXD A;  1KU3 A;  2KKO A;  5ICE A;  2L3D A;  2K27 A;  3U2R A;  3V8L A;  1YQA A;  4M73 A;  1B9M A;  2HKX A;  5E20 A;  2D1H A;  3F8N A;  2XAH A;  2MBF A;  2YX7 A;  1B9N A;  1FBS A;  3IRQ A;  3TOB A;  4D0P A;  1BN5 A;  2NAZ A;  2P7C B;  2Y48 A;  4DNC A;  2A6E F;  4L9N A;  1W7P A;  1LEA A;  1FBU A;  5F6F A;  3ABT A;  4ON0 A;  1J2X A;  1R1V A;  4XBF A;  4RB3 C;  4I09 A;  5K5O A;  2QQ9 A;  2YSR A;  1Z05 A;  2CYY A;  1JHH A;  3M8E A;  1DPR A;  4I02 A;  3KP6 A;  3R60 A;  1LB2 A;  3I0T A;  2X0L A;  4WXH A;  2ZKZ A;  2F5C A;  1HSJ A;  1SD6 A;  4LG0 B;  3Q5F A;  2FSW A;  3BPX A;  2DLL A;  4PDK A;  3VFZ A;  4IHS A;  3S2W A;  2XKO A;  5D5V B;  4GYG A;  4UXN A;  2XAG A;  3HOS A;  2DTR A;  2H09 A;  4ENN A;  4CDG A;  4OIQ F;  1ONV A;  4HLY A;  1O3Q A;  2OZ6 A;  5D8L B;  2DU9 A;  2FOK A;  4HF0 A;  4KIC A;  2DK5 A;  5DCM B;  2FBI A;  3ISP A;  5KVR A;  4ZZD A;  4IF4 A;  2CW0 F;  1OYW A;  2J5P A;  3WGH A;  2QLZ A;  3HRS A;  4A6D A;  2VOO A;  3LAJ A;  4WF2 A;  2STW A;  1XD7 A;  1J5Y A;  4AVP A;  3LST A;  2OQR A;  4ZYD A;  2FU4 A;  2IT0 A;  4I0B A;  3GZ6 A;  4LG0 A;  2QQB A;  2PJP A;  2FBK A;  2COM A;  5E18 F;  5CVI A;  3BWG A;  2L02 A;  4U0V A;  1FC3 A;  2P4W A;  4A5M A;  1MJB A;  2O6G E;  2EFQ A;  2XHK A;  1ZAR A;  3E3V A;  3VB2 A;  5D4S A;  1KA8 A;  1BI3 A;  3CUQ A;  2GZW A;  2D2W A;  1XSX A;  5HLH A;  4M9S A;  1K78 B;  4JK1 X;  3SZP A;  4QWQ A;  2ZNY A;  2OZU A;  2DFI A;  1J0R A;  2MH2 A;  2P6S A;  3ZQ7 A;  2A6H F;  4I0A A;  5JVT A;  1OKR A;  1UHM A;  3FXR A;  3R0J A;  3RKX A;  3LA3 A;  1BI2 A;  3BDD A;  2EV6 A;  1BC8 C;  2JTV A;  3KP4 A;  1G3S A;  4P5O A;  1BM9 A;  2D1V A;  2PBI A;  1SD5 A;  2VON A;  1GXP A;  1Z6T A;  2UZK A;  2VC0 A;  4RGX A;  4ZZL A;  1ZH5 A;  5D5U B;  1TQM A;  3K2Z A;  4UVC A;  2JZY A;  3ZMT A;  2GA1 A;  3QPH A;  1H0M A;  4Y17 A;  2RQP A;  4ASN A;  3NRV A;  1F5T A;  1C0W A;  4GCV A;  4G9Y A;  3E6D A;  4O3M A;  1TNT A;  2EJR A;  1T39 A;  3SZT A;  3ZN0 A;  3LA2 A;  3U9G A;  1HKS A;  1SMY F;  3KEQ A;  5D6E A;  3MZY A;  1O7F A;  1YTY A;  4HDU A;  1O3T A;  1YO5 C;  2NS0 A;  1XCV A;  2R7F A;  2JT1 A;  2EWN A;  3KP5 A;  4N9I A;  5K5Q A;  4BXU A;  2WC2 A;  1XCB A;  3I5U A;  3RKW A;  1ZN2 A;  2UXX A;  4UUV A;  3E5U A;  1B6A A;  3ZN1 A;  3HYI A;  3BZ6 A;  1BIB A;  2AXL A;  2EFN A;  2W25 A;  4S05 A;  2GAU A;  3KLO A;  3V7C A;  5CLS A;  1UST A;  3QU3 A;  3EYI A;  4LB5 A;  3E5X A;  3O2P E;  4EGY A;  1U5T A;  2XRN A;  2WWY A;  4P9U A;  4UNO A;  1HBX G;  1U2W A;  3KCC A;  2VC1 A;  1I6X A;  4EJV A;  3JSO A;  2W57 A;  5HDN A;  2JPC A;  3IC7 A;  4LK1 F;  1FP2 A;  4HV5 A;  5FGM A;  2FE3 A;  2HQN A;  3K0L A;  2EA2 A;  5BPD A;  1D3Y A;  4G94 A;  2A5Y B;  4HV6 A;  1B59 A;  4WX9 A;  2OD5 A;  2VBZ A;  5E1W A;  3HTU A;  1BJA A;  1T6S A;  5D6F A;  3F6V A;  2QZ8 A;  3HHH A;  3ELK A;  1DDN A;  2O03 A;  1FYM A;  2P5K A;  3ERE D;  1YYV A;  4YFK F;  1HST A;  1UHW A;  1R5H A;  1H9T A;  3EYY A;  4HQM A;  3M7G A;  1F1Z A;  4UVA A;  3G3Z A;  5J6X A;  4CGZ A;  4ENK A;  4F7Z A;  3MFK A;  3JW4 A;  3L2C A;  5DUK A;  2XKP A;  2BE5 F;  4E70 A;  4LFU A;  2O3F A;  2HR3 A;  4OOI A;  3WTZ A;  3ULQ B;  3WTU C;  1SD7 A;  1P4A A;  2A68 F;  2HFH A;  3C3W A;  4BYY A;  4KNY A;  3WE3 A;  5J8C A;  2CG4 A;  1H9G A;  4BAY A;  4CIC A;  2NNY A;  4AD9 A;  3HIF A;  4RAZ A;  3GO5 A;  2WV0 A;  2V9V A;  4YII A;  2KIF A;  3QAH A;  5E17 F;  4KYW A;  1GHC A;  1IN7 A;  3PFI A;  1QGP A;  2M5W A;  4CYD A;  1S6L A;  1KYZ A;  2JRT A;  4EM1 A;  1T38 A;  4LMY A;  1U3E M;  5LGT A;  3R61 A;  4KDP A;  3GUD A;  1LDK B;  3TKY A;  3GVA A;  2B0L A;  3P9K A;  4EVI A;  5ILU A;  5FFZ A;  4A0Y A;  1XMA A;  3W6J B;  2XUB A;  2XRO A;  1JGS A;  1O3R A;  2Z3Y A;  4ZH4 F;  1ZLJ A;  1WQ2 A;  2HWV A;  2L4M A;  1BIA A;  5ICF A;  3ZMZ A;  1ZRC A;  3AAF A;  3F8B A;  2IW5 A;  1ON2 A;  3B73 A;  2ZCW A;  3FMQ A;  5LGN A;  4WXC A;  4ZYH A;  2BGC A;  3FHZ A;  4Y15 A;  3KET A;  2F5F A;  4M74 A;  2DPD A;  4EJU A;  4HYE A;  2RN7 A;  1CF7 B;  1MDM B;  1K79 A;  4JQF A;  2UXN A;  1PUE E;  4M9Z A;  1G3Y A;  3PQJ A;  2HKO A;  4M72 A;  5ERI A;  4CHU A;  2DW4 A;  2NNN A;  2QQA A;  4R1H A;  1SAX A;  1KU2 A;  1CGP A;  5J8F A;  5CYV A;  4XSZ F;  2VBX A;  3HUG A;  2HYG D;  3VEP A;  4ETS A;  1HW2 A;  1UCR A;  2RVC A;  4PZJ A;  2HTJ A;  4ENJ A;  1E2X A;  3DPT A;  1FBQ A;  2WTE A;  4KMF A;  2ZME B;  5AIP A;  2DPU A;  3I53 A;  3MEX A;  1KGS A;  2FMY A;  1CF7 A;  1DPU A;  4KMU X;  3L9F A;  2Z5U A;  1SFE A;  2FML A;  2KIM A;  3J81 Z;  3CUO A;  4LJZ F;  5L3B A;  4L9T A;  3GWZ A;  2EFO A;  2V1X A;  2K4J A;  3E5Q A;  1STZ A;  2EFW A;  3L00 A;  2PMU A;  1S29 A;  3TO7 A;  5DDG A;  4FHT A;  1XDU A;  4MNU A;  3QRF F; 
#chains in the Genus database with same CATH topology
 1IUF A;  1I1G A;  1VQ8 I;  1T33 A;  3I59 B;  2M7B A;  3I3L A;  4CCK A;  2CUZ A;  4UHT A;  2D45 A;  4S0H B;  1ZGA A;  1NK3 P;  2E5Z A;  2DAO A;  2QEN A;  3FDY A;  1UFM A;  4RMN A;  4EJW A;  3O3K A;  2IA0 A;  1IW7 F;  2KQR A;  1Y6I A;  1ZR2 A;  4NC8 A;  3H36 A;  3RKY A;  1FOX A;  1MMN A;  4AYB A;  2VJ5 A;  3HPH A;  1E3O C;  5EG0 A;  2O8X A;  3H5A A;  3I4P A;  2CGP A;  2HDW A;  1ULY A;  2HVR A;  2F4M B;  1FOW A;  3J80 K;  1WGX A;  2W00 A;  3KP7 A;  4A12 A;  2VJ4 A;  5KK1 A;  1Z3X A;  3TW7 A;  3K4K A;  3NQO A;  1HC8 A;  3PSF A;  2K3F A;  3LQQ A;  3JAM K;  2STT A;  1P4W A;  2H94 A;  1YJ9 I;  5TIS C;  3N97 A;  2AHQ A;  3OYH A;  2KDZ A;  1UB9 A;  3GFL A;  4ESB A;  4XKC A;  5H20 A;  5FLM J;  5C44 J;  1OPC A;  4WK8 F;  4GFB A;  3WHB A;  1JKP C;  2V6C A;  2QKL B;  1SFO J;  4R8H A;  1R4N B;  1IDY A;  5ICC A;  2F5E A;  3CJQ B;  2LBF A;  4AIJ A;  1VQ7 I;  1MH3 A;  2DT7 B;  1XGM A;  2P7V B;  4IHX A;  1E17 A;  3GFM A;  1RR7 A;  4IZZ A;  5CQE A;  2IBD A;  1I1S A;  5GP9 A;  2OCE A;  3CES A;  3ZMS A;  2IA2 A;  3LAP A;  3OR2 C;  3DXJ F;  2DO7 A;  1MSF C;  1KU9 A;  3I59 A;  1SAN A;  5ICG A;  4HG2 A;  3RYP A;  3OS0 A;  1LNW A;  3DLL F;  2GXG A;  4FET A;  1JGG A;  3QWL A;  2K85 A;  1FEX A;  4XM3 A;  2Y75 A;  1R5I D;  1K7A A;  1TWH J;  5IP9 J;  3WTW C;  3BG6 A;  4IVN A;  2W1O A;  4RM3 A;  4L5J A;  4NB5 A;  3HGG A;  2HI3 A;  6PAX A;  3OV8 A;  5H6R A;  4CCL A;  3T0Y A;  4WXD A;  3M07 A;  4M9X A;  5LRS A;  2PX9 A;  1TW2 A;  2VAS A;  3DEW A;  1ZGJ A;  2EFP A;  5HVQ C;  1GV2 A;  1Q1H A;  3FX3 A;  3I71 A;  3Q0U A;  3W2W A;  2HTS A;  2RKH A;  3PNV A;  4U0Y A;  2F5D A;  1O3S A;  4UB6 C;  4HLX A;  2VJI A;  2PMH A;  1W0U A;  3S8P A;  1A04 A;  3BJ6 A;  3ZQQ A;  1I50 J;  2EIM H;  1IV6 A;  3KP2 A;  1QBJ A;  2FNA A;  1VQK I;  5FKK A;  2KL4 A;  1S3J A;  2ADU A;  2Q2E B;  1XGN A;  5IT3 A;  3KP3 A;  2E2J J;  1R7J A;  3GF2 A;  2DI3 A;  5IPA A;  2ID6 A;  5DCM A;  2EIN H;  3TDZ C;  1KQ8 A;  3S2H J;  5JFR A;  2CW7 A;  2DA7 A;  2P8T A;  2K3P A;  3O8H A;  5GAD J;  2R0Q C;  2IGK A;  3LL7 A;  4ANJ A;  4J19 A;  4LLN A;  5DD8 A;  3KZZ A;  1O57 A;  4IQ4 A;  4TV7 A;  2EV0 A;  4B48 A;  1RES A;  3I55 I;  1TC3 C;  5E1X A;  3OYJ A;  1UEL B;  3Q9S A;  4C2T A;  3NWT A;  2ZXJ A;  2HOT A;  1SVM A;  1WJB A;  1X2N A;  4KT5 C;  4RS8 A;  3WTY C;  3HOW J;  2KT0 A;  4U87 A;  2KRH A;  3BJO A;  3EQL F;  1TNS A;  5IOY A;  4HAM A;  1ZK8 A;  3BP8 A;  3SXY A;  1U9N A;  3K1N A;  2CQ7 A;  3AG2 H;  5H6Q A;  1O4X A;  5CQG A;  1X2M A;  2HOA A;  2BEO A;  3F22 A;  1Z67 A;  2M0C A;  4FE4 A;  1OCC H;  2ZME C;  4Q5S F;  5LRR A;  3RJP A;  2KZV A;  3UKG A;  2VQG A;  1O7L A;  2CO5 A;  4NC6 A;  3A01 B;  1P92 A;  4N9H A;  4I2O A;  3LMM A;  3ZGK A;  1OYY A;  2LKX A;  5FKN A;  3M8J A;  2ZSH B;  2VB6 A;  4R79 A;  1YW8 A;  1FZP B;  4C3H J;  1BR1 A;  4BDZ A;  5JHU A;  2CV1 A;  1ETY A;  2CQQ A;  3COA C;  3I58 A;  2QKM B;  4P55 A;  4U7D A;  2E2H J;  1EH7 A;  1N25 A;  1YX3 A;  4C9Y A;  1PVE A;  5FO5 A;  2VOD A;  5E8I A;  3HOT A;  5KAI C;  4KIS A;  2X6O A;  2O61 A;  1K78 A;  1KQ9 A;  1W5C C;  4OIP F;  1OLT A;  4LOC A;  2IVM A;  2BYV E;  3V42 A;  1FLI A;  3S3N A;  2MGQ A;  3FIS A;  5DUI A;  3V7S A;  3BTL A;  2K02 A;  1X4O A;  2X1C A;  2HDD A;  1ITY A;  4HA8 A;  3ZQG A;  3QRF F;  5DCF A;  2XGX A;  1MJA A;  3BR3 A;  2R5Y B;  2R7W A;  2JUC A;  3H3U A;  3VWB A;  3CP2 A;  2O5R A;  2NOG A;  3BR6 A;  2GA2 A;  3DTI A;  3HKZ A;  3F6O A;  3H9G A;  3W2V A;  2PQ8 A;  4LD5 A;  4LB6 B;  4BUP A;  2ESN A;  2VKV A;  3MZ8 A;  4BJ6 C;  3W3C A;  2JRM A;  2BXZ A;  1QZY A;  3M9A A;  3TMO A;  3CO7 C;  4L5E A;  3V7R A;  3CC2 I;  2X6Y A;  1IN8 A;  4BBS J;  2ISY A;  2MAB A;  3B6A A;  2A6T A;  2W85 A;  3W6V A;  1JKQ C;  3GW2 A;  4BHP A;  2D5V A;  1AA7 A;  2FJ1 A;  3FMR A;  3GLX A;  2P6T A;  1WWX A;  2PMZ A;  2RC4 A;  2HQR A;  1UJ8 A;  5BQT A;  2IA1 A;  5D8K B;  4HF2 A;  3KX2 A;  3T5X A;  2Y0M A;  5J3L A;  2Q1Z B;  2W48 A;  4ZYA A;  2V9K A;  2L01 A;  5FLX K;  3BY6 A;  5L3C A;  5LEK A;  3BRO A;  2RRE A;  2QQ8 A;  1LJ9 A;  1FOK A;  5ED4 A;  2QBY B;  1LDJ A;  1IAW A;  1VQ5 I;  2WBM A;  1W7P D;  4EJT A;  3LWF A;  4IRI A;  3CD6 I;  2W7N A;  1HW5 A;  4Z2Y A;  5GPA A;  2YU3 A;  4MTE A;  4GO1 A;  1U8B A;  1FPQ A;  1LDD A;  4AIK A;  4NQW A;  4HNT A;  3DBR B;  2PN6 A;  1QQI A;  2HEO A;  5LLQ A;  3GEZ A;  5DM7 F;  2I10 A;  5ILS A;  4XLN F;  1MBJ A;  3WOD F;  1XSD A;  2A5W A;  3LSM A;  3GTJ J;  1XGS A;  3LA7 A;  1YIJ I;  3RQ4 A;  4RGR A;  4IHT A;  5FRO A;  2VXD A;  4BY7 J;  3BT9 A;  1ZHF A;  4GYI A;  1T08 B;  1IRX A;  5FFX A;  4PJL A;  5E1Z B;  2CFO A;  3CJN A;  1DUX C;  3TO9 A;  2HVS A;  5HDG A;  3S14 J;  2MC3 A;  4BJ5 C;  1D0X A;  4FX4 A;  5LGU A;  1PP7 U;  2XAJ A;  1D5Y A;  2QSH X;  2GLO A;  5LHH A;  1B1B A;  1OFC X;  2GBY A;  3L2W A;  2V26 A;  2L7F P;  3MKW B;  2KPM A;  2DA2 A;  4RAY A;  1YIO A;  2L2O A;  1QVT A;  1BBY A;  1A6I A;  4DOZ A;  4YIR X;  2QBY A;  3D1N I;  1WJE A;  2P0W A;  3RZD J;  2AS5 F;  3CLO A;  1T95 A;  1XC5 A;  3NWS A;  2ZJ2 A;  4CSW A;  4XLA A;  2E7W A;  3OYL A;  3G73 A;  2R7R A;  5BOX A;  3C7J A;  2H6B A;  1Y56 A;  3Q0W A;  3JSP A;  5CVU A;  2X1E A;  4PUS A;  2KRF A;  3CLQ A;  5FD6 A;  3OYA A;  4KA4 A;  3ASO H;  1J75 A;  1HCR A;  2R7Z J;  3OOU A;  2UV1 A;  3QOD A;  5E3O A;  1ZRF A;  3IAS 2;  1WRJ A;  2DFE A;  2A07 F;  4G7O F;  1V3F A;  3S15 J;  5C4X J;  1IN4 A;  3IHU A;  3QQA A;  4B1R A;  4G7H F;  1YLF A;  4BNC A;  4MQV A;  3GYH X;  3T8T A;  4EM0 B;  3IKV A;  3SHF A;  1VQP I;  1FNN A;  1Z1D A;  4ABZ A;  4NDL A;  3OIP A;  2LSO A;  4GGG A;  2DMQ A;  3FXU A;  1OMI A;  1ZRD A;  2OV7 A;  1OR7 A;  2JA6 J;  3RSN A;  1ERD A;  3SFI A;  2M87 A;  2ELH A;  2VN2 A;  3CF5 F;  1W5S A;  1FSH A;  1JKR C;  1MBG A;  3H35 A;  4A3G J;  4BKX A;  1A36 A;  2MLG A;  3BPV A;  3H9Q A;  2BY2 A;  4IPA A;  3GBG A;  4M6Y A;  4D1Q A;  2VT2 A;  4A0Z A;  3F9K A;  1AOY A;  4MLO A;  5F64 A;  3JRH A;  4I7H A;  5EF6 A;  5JVG F;  3JRG A;  3I56 I;  2DOA A;  5FRN A;  2FBH A;  1RKT A;  2M30 A;  3GTM J;  1LEB A;  3SQN A;  2BXY A;  2F48 A;  3HHG A;  3K10 A;  1JJ6 C;  1IRZ A;  2HZT A;  4W97 A;  1BA5 A;  5J47 A;  4L18 B;  5IP7 J;  1T98 A;  3DQV C;  2V4J C;  2H6C A;  1WFX A;  1L0O C;  2O7O A;  1V5F A;  4RA2 A;  1IN6 A;  2PEX A;  3R0A A;  2VL8 A;  2K9N A;  3DFG A;  5B1A H;  2LNB A;  1FT9 A;  5BMZ A;  1Q1V A;  5ILV A;  3ECH A;  1S8N A;  2TDX A;  4RLF A;  3PO3 J;  1HKT A;  3WE2 A;  1J09 A;  4NHJ A;  5HDK A;  1WI9 A;  4BBR J;  3DV8 A;  3O8G A;  4O6J A;  4CZZ A;  1U9O A;  2WV1 A;  2Y69 H;  3PIP F;  1U6G A;  1G3W A;  2CW8 A;  1VQL I;  2XRL A;  3E6B A;  3QPS A;  1G3T A;  2FRH A;  3K1M A;  1FYK A;  2OU2 A;  2XAF A;  1U8R A;  4U88 A;  3ECO A;  1TZL A;  2Y31 A;  4E7H A;  3MN2 A;  2ZNZ A;  1UHS A;  3LQR A;  2LLK A;  2JWT A;  2X4H A;  4KN7 X;  2DOD A;  4D5F A;  5JI6 A;  5A2Q K;  4K2E A;  2GXB A;  1P9Q C;  2H27 A;  4V19 K;  2EK5 A;  3CCS I;  2Y30 A;  2IXS A;  3C1D A;  3MZH A;  3J7Z I;  2EH3 A;  3AL0 B;  3IRR A;  1FY7 A;  2ZXH A;  2W84 A;  1NH3 A;  3G2B A;  4UVB A;  2EB7 A;  4EM2 A;  5LHI A;  3FM5 A;  3CZ6 A;  1RIO H;  1R22 A;  1IRG A;  2VKD A;  4M6X A;  3E97 A;  2OF7 A;  3ZQI A;  3S3O A;  3DBL B;  2XF5 A;  4I99 C;  4FCY A;  3EUA A;  2E60 A;  2FF4 A;  2WAQ N;  1FTZ A;  3L1P A;  5J40 A;  1TQI A;  3WTX C;  1B8I B;  1RUO A;  5DV5 A;  3V8J A;  2R7U A;  3DTE A;  3F8C A;  1QPI A;  5HS9 A;  4GXO A;  1WJF A;  1PUF A;  3S3M A;  2HDC A;  5E3N A;  1FMV A;  1P4X A;  1ZR4 A;  2BV6 A;  1TWF J;  1W4M A;  2HGC A;  4LG3 A;  3RDI A;  1IN5 A;  3GZ5 A;  4ZYG A;  1MBF A;  2OCC H;  2V1D A;  1W5T A;  2YPR A;  4MEX F;  1Y0N A;  3GZN B;  1G4D A;  2LF7 A;  3HSR A;  1Z0X A;  4D7N A;  4U0W A;  4DBQ A;  3VOE A;  1ZG5 A;  2OA4 A;  3QYF A;  2VBW A;  2CV0 A;  2GWR A;  3P9C A;  1X3U A;  5IT9 K;  2LR8 A;  2O0Y A;  2ACJ A;  3C18 A;  1HF0 A;  4Y13 A;  2P81 A;  2E19 A;  3M3Y J;  1P7J A;  4HEA 2;  3TBI A;  4A0X A;  1Y0U A;  1YHQ I;  3ERM A;  1ZRE A;  1YFH A;  4IEJ A;  3CF2 A;  1AKH A;  4P9F A;  4A93 J;  2WA0 A;  1WH5 A;  2KJB A;  1W7P B;  3NEU A;  1TW3 A;  3IUO A;  2BY0 A;  3DEU A;  2VE8 A;  2FD5 A;  1HOM A;  4KN4 X;  4MEY F;  5FD5 A;  1MD0 A;  5FLV A;  2JPB A;  1P7I A;  4KUM A;  1MDM A;  3K9T A;  2IGO A;  3IAM 2;  5F1J A;  4MTD A;  1T2K A;  4WWC A;  2PI0 A;  1WJC A;  5TRD A;  2DMP A;  5CVJ A;  2QGU A;  1X3Z B;  3QYE A;  3H0G J;  3ZMU A;  4BS9 A;  3AFH A;  4CO8 A;  3JRI A;  3O6B B;  1TWG J;  2VBY A;  1MZB A;  3K4M A;  1A5J A;  4P96 A;  1LE8 B;  3RTR A;  4G6T B;  3TED A;  2I8D A;  1EA3 A;  3LFU A;  3ZCO A;  2BZT A;  2DN0 A;  3BQZ A;  3HJE A;  1V54 H;  3PQK A;  5LFA A;  1G2H A;  2LTP A;  2JSC A;  2ZFW A;  3K69 A;  2IRF G;  2G7H A;  5IY5 H;  4FTH A;  5HOO A;  2ETH A;  4XLF A;  3KE2 A;  1TWA J;  2XPW A;  3L09 A;  4BL0 B;  2M8E A;  3KEO A;  4PJJ A;  2A61 A;  3KLN A;  1ZKG A;  4IOC F;  2LRE A;  2WB1 N;  2Y2Z A;  2KLO A;  3IWF A;  4IRH A;  4H0E A;  3TO6 A;  1RNL A;  1T0F C;  4HBL A;  3SDG A;  2CFX A;  2MLK A;  2LP0 A;  3M1C A;  5D5W B;  4PFP A;  3TGN A;  1LVA A;  1QO0 D;  1XGO A;  2XF7 A;  3HG9 A;  2XSJ C;  5EZG A;  4G6Q A;  2CS3 A;  5J4Y A;  3A1Y A;  2OTJ I;  2I5U A;  3D0S A;  4OAY A;  1PP8 F;  3G71 I;  4IKF A;  1I3A A;  5KAF C;  1WJD A;  3WG9 A;  2R3S A;  2DBB A;  1S72 I;  3BCB A;  1YJW I;  3ASN H;  2A69 F;  2ZME A;  3CDL A;  1IXC A;  3OYK A;  4V2G A;  2CUE A;  4MHG A;  2QEX I;  1N75 A;  5HLI A;  4IRG A;  2ID3 A;  1R1U A;  4HX8 A;  5EGO B;  1X1A A;  3BZK A;  5EEG A;  1J9I A;  1IDZ A;  2FNP A;  4E7L A;  3FWE A;  4U7B A;  4HST A;  3WTV C;  4EV0 A;  1I5Z A;  1YW9 A;  4L9J A;  4AUX A;  4Q48 A;  2R7D A;  4UUS A;  4BHC A;  3HTS B;  1IXS B;  3RPU A;  3CTA A;  2EIL H;  4ENM A;  3EDP A;  4XN0 A;  1JE8 A;  2XGD A;  3SZG A;  1XDS A;  2IP2 A;  3KZI C;  3TQN A;  2LF8 A;  3LFK A;  5L3F A;  3CCR I;  1XMX A;  2H1L A;  3HSF A;  3E6C C;  1ETK A;  4BEH B;  2CUF A;  5HOD A;  3J80 Z;  2KMU A;  3W6K B;  5LEJ A;  3X2Q H;  3GX4 X;  1GVD A;  3CCL I;  1J59 A;  3CCE I;  1IUY A;  2FEZ A;  4B44 A;  5LD2 C;  1R1T A;  1EJ9 A;  4C3I J;  3W2A A;  4A3K J;  3HL2 A;  3JAM Z;  4I01 A;  4XOR A;  3EUH C;  1OYI A;  1ETX A;  5JLX A;  2PFB A;  3PUB A;  1MND A;  2NYX A;  3DWL E;  2DT5 A;  5HLT A;  2LOO A;  1SFK A;  3WU0 A;  3FF5 A;  5AON A;  3CQZ J;  2FA5 A;  1R49 A;  2CQK A;  1GDT A;  2NVT J;  2W4S A;  4HZF A;  3A0H C;  3FXL A;  3C2H A;  2BY1 A;  3FXJ A;  3BR1 A;  3ZPL A;  2EZK A;  2AXT C;  3ABK H;  3VYU B;  3CCJ I;  2L4A A;  2E36 A;  4AIH A;  1OCR H;  3CUQ B;  1U78 A;  2MH9 A;  5EGO A;  1ODD A;  1UG0 A;  1OCT C;  4DBR A;  5D5X B;  1F43 A;  3MVP A;  3V8K A;  2Z99 A;  4N0B A;  3GCM A;  4A6E A;  4ZDP A;  2YR2 A;  2VPR A;  3SFZ A;  1TBX A;  1Y1V J;  2Y0S A;  1VQM I;  2WY7 Q;  3SYT A;  4XRS G;  4QTR A;  4ZYE A;  4A3C J;  4LGW A;  3AL0 C;  4V2F A;  2BY3 A;  2LY9 A;  5CJ9 A;  3HRT A;  1SMT A;  1ZG3 A;  2EZH A;  2M0M A;  2ZO4 A;  3DTK A;  2VPL A;  2XB0 X;  1WHU A;  3D5S C;  4KIF A;  2LMD A;  5E3L A;  1LUJ B;  3I54 A;  3LSH A;  4B09 A;  1MMS A;  4BH9 A;  2W82 A;  4B4C A;  1A6Q A;  1FSE A;  3A4C A;  3GFJ A;  4OU0 A;  2FXA A;  2ICW G;  5E8G A;  4HF1 A;  1MSE C;  5FKL A;  3OYE A;  2CH0 A;  3HXL A;  1IG7 A;  1Z9C A;  2CQN A;  2MD5 A;  4UV8 A;  2VT3 A;  3S17 J;  4XL9 A;  2QSF X;  4IXA A;  3G6E I;  2A05 A;  2HPM A;  3E1S A;  1QU3 A;  4O5V A;  4NUB A;  2LDU A;  4EJO A;  4PGG A;  1RUN A;  1D8K A;  2CV2 A;  2CSO A;  4XKB A;  1FYL A;  1E3P A;  1LFU P;  3QYB A;  1D8J A;  2XV4 S;  2EZL A;  4XSX F;  3TDU C;  4KIG A;  4BY1 J;  2MFZ A;  2GIV A;  1G6N A;  4A3E J;  5D4R A;  2PJR B;  4M71 A;  3U1D A;  2NS8 A;  2OBP A;  2ECC A;  5B66 C;  4JBA A;  1BOA A;  2X9D A;  1VQO I;  3MKL A;  4Y4R A;  2E5N A;  1RZ4 A;  1ETW A;  2BOL A;  5HS7 A;  5L3D A;  2V1U A;  4YEJ A;  2JA2 A;  4F3Q A;  5TJJ A;  1KQ0 A;  4YRV A;  4OMZ A;  3RPQ A;  1I39 A;  2VXZ A;  4FE7 A;  3MWM A;  2GXA A;  1WKM A;  2GOM A;  1DQU A;  4Q47 A;  2DDB A;  3JRA A;  2L9R A;  4PSW A;  5K5R A;  2DFH A;  1MBE A;  1LKX A;  2WAD A;  2ZBK A;  5EEH A;  1ZEL A;  4LLG F;  4OIN F;  2NVQ J;  1OQY A;  3R6S A;  4ZDO A;  4M3E A;  3MAJ A;  3F8F A;  1J7K A;  1IZ1 A;  2RAE A;  3DF8 A;  1FTT A;  3RYR A;  1YG2 A;  1ZYR F;  5CVV A;  3K4C A;  1Z6R A;  2HYF A;  3FZV A;  3JRE A;  2K86 A;  4HSR A;  1ON1 A;  4BU2 A;  1MJ9 A;  1SC7 A;  4MGR A;  1TTY A;  4FT8 A;  4AYB N;  2K4B A;  1P6R A;  1F9N A;  1FP1 D;  2EA4 A;  4CYC B;  2DJI A;  2Q2E A;  4OIO F;  3RI4 A;  1JXS A;  4I76 A;  2E7X A;  2AQF A;  2V6E A;  5BPI A;  3QOP A;  1S7O A;  3B02 A;  3DPL C;  1R00 A;  2EZI A;  3DU5 A;  3I4M J;  1V55 H;  5GTH C;  4OWR B;  1D0Y A;  2L9S A;  3PUF A;  2JK3 A;  2HZD A;  4XKW A;  3N05 A;  5DD4 A;  2DDA A;  3QU6 A;  3PFY A;  3S2D J;  4YG2 F;  4FQG A;  3EET A;  4JX4 A;  4CCJ A;  1Z77 A;  3A0B C;  1UAA A;  2H1K A;  4WCG A;  1ETO A;  2A3S A;  4QPO A;  5J4V A;  4EQQ A;  4HDV A;  3E7L A;  4XIC A;  3ROU A;  3J7A O;  2QYO A;  1U5T B;  2ELK A;  1DGW Y;  3HRU A;  1W1W E;  4Q4Z F;  2YX4 A;  2DQL A;  2X6X A;  2XGC A;  2KIU A;  1I3Q J;  2NOJ B;  4YIF A;  4XLP F;  3HOX J;  3HEF A;  3I4N J;  4GRI A;  2E1C A;  1FMW A;  3A01 A;  2R92 J;  4B43 A;  2RNJ A;  5DS9 A;  2XAQ A;  2DOE A;  3WGI A;  2DXI A;  5JLW A;  3EUK L;  2C6Y A;  4II3 A;  3Q9V A;  5DTD A;  1GXQ A;  2GOX B;  1SD4 A;  3ABU A;  1BL0 A;  5E79 C;  3PNT A;  2LRD A;  4G6D A;  4YFX F;  1BW6 A;  4DQ2 A;  5BS6 A;  5K1Y A;  2IS2 A;  1HQC A;  1REP C;  1R6R A;  2VE9 A;  1OCZ H;  2FX0 A;  1G8X A;  3H9J A;  3OOP A;  5LBQ A;  3D5L A;  4F93 B;  3L2U A;  1IF1 A;  2HOE A;  1YJN I;  4XLH A;  2XF6 A;  1JTX A;  2QM3 A;  4KIT B;  3KYC B;  3ABL H;  5LHG A;  2LKP A;  3BOQ A;  3TW6 A;  4J01 A;  1KYW A;  4E4H A;  5F1R A;  1ZAO A;  3K7A J;  2DQR A;  3QOE A;  4B3X A;  2QWW A;  3BQY A;  4AWX B;  4HQE A;  4JX5 A;  1X3W B;  2DA4 A;  3HOZ J;  1BW5 A;  1GLN A;  5FLX Z;  3FXK A;  1JJ8 C;  2R5Y A;  1QA6 A;  3HSE A;  4M6V A;  4YFN F;  4RB2 C;  2G0E A;  4CCN A;  3CCQ I;  1LVK A;  4S04 A;  1XPX A;  2RV8 A;  2R7X A;  4XRS A;  2FOW A;  3K70 D;  2R5Z B;  4HW0 A;  1YW7 A;  1WPK A;  1JHF A;  4IJA A;  1QPM A;  2UWM A;  1XSV A;  2QUF A;  4I98 B;  3K4L A;  3CUQ C;  2NRA C;  2K7L A;  1SVL A;  4A2U A;  3KFW X;  3LSP A;  1DGR M;  1KON A;  3ML6 A;  1NTC A;  4PJN A;  3L7W A;  5AIQ A;  3M8F A;  1X4P A;  4Y3O A;  3H92 A;  4A5N A;  2RDP A;  3AKZ A;  3IP4 B;  1V4R A;  5B3S H;  3A02 A;  3IL2 A;  4P1W A;  4ESF A;  2G7U A;  3N4M A;  5HS8 A;  3F21 A;  2M4K A;  2Z9O A;  3KZY A;  1IV8 A;  3JR9 A;  3JTG A;  1S9H A;  2P5L C;  2NVX J;  4RGS A;  3RCO A;  3S1N J;  2TCT A;  5F0C A;  4ZTF A;  1WH7 A;  1XMK A;  2KIQ A;  5IYC J;  4F92 B;  2L7M P;  3L2V A;  1S7A A;  1VTN C;  1N77 A;  1H88 C;  2O9L A;  3GTK J;  2OAZ A;  2DK8 A;  2F2E A;  1I27 A;  3BR0 A;  4Y7N J;  2OC6 A;  3CO6 C;  3F8M A;  1ACI A;  2IEK A;  4RGU A;  3VYS B;  2ZJQ F;  1HKQ A;  1XS9 A;  1GT0 C;  4LIV A;  2IAI A;  1EH6 A;  3P7N A;  2HOS A;  3VYR B;  4CCM A;  2X48 A;  1TLH B;  2M4G A;  2BBY A;  5JR3 A;  2V7F A;  4RM2 A;  3ZMV A;  1Y8R B;  3IKT A;  5HLG A;  3R4K A;  1XG1 A;  2K9S A;  9ANT A;  1RI7 A;  3QP6 A;  5J1R A;  1XX5 A;  2Q8K A;  3TL4 X;  3E6M A;  3ZMD A;  1BI1 A;  2JA7 J;  2R7O A;  2RNG A;  1D0Z A;  2JVH A;  4N4O B;  3HRM A;  1FX7 A;  1F4K A;  4L0Z B;  5HNF A;  2EQR A;  2K9M A;  1EH8 A;  1VI0 A;  4HX4 A;  1YS7 A;  2NS7 A;  1TQP A;  4XMY A;  4KIB A;  4EMS A;  5HNH A;  1LFP A;  3MQ0 A;  1YI2 I;  2XGE A;  4BHB A;  3UNG C;  1ZLK A;  2BW3 B;  3CDI A;  1R58 A;  5M5Y J;  3FHN A;  1UZC A;  3DU6 A;  2L54 A;  3CC7 I;  1NHA A;  2Y9Y A;  4EAT A;  3S1M J;  2LFB A;  2E1M B;  2IJL A;  2XAS A;  3ABM H;  4B8X A;  3HKZ N;  2DTZ A;  4PGH A;  5JHF A;  3BG9 A;  1DU0 A;  4XKV A;  5DEQ A;  2L9V A;  3T8R A;  3ZP5 A;  1R23 A;  3I64 A;  3OMY A;  3CDH A;  4RAF A;  3JRC A;  2FQ3 A;  4UV9 A;  5L3G A;  3H3Z A;  1IXR C;  3OYM A;  3VDX A;  4BQA A;  1FWZ A;  3V4G A;  2JQ7 A;  4CUG A;  5F08 A;  4A3L J;  3FIW A;  3OYI A;  2XVC A;  4RB0 A;  4OMY A;  4UB8 C;  2V79 A;  3DKX A;  5IP6 A;  2KJC A;  4PK4 A;  1AU7 A;  5FKO A;  3RIR A;  1ENH A;  2PMZ N;  3OS2 A;  1USS A;  2LH9 A;  3GXO A;  1ZG1 A;  1X19 A;  3Q3S A;  2E34 A;  1T0F A;  1A31 A;  2M1B A;  2PLY A;  1H8A C;  1GVJ A;  3K1P A;  2DFF A;  3WU1 B;  1P2F A;  5CKT A;  4IQJ A;  3QPL A;  4X0G A;  1MKM A;  3L2Q A;  1PDN C;  2CRG A;  4G8X A;  3VOD A;  5CVR A;  4LK0 F;  3PJR A;  2ISZ A;  2CUJ A;  1Z3Y A;  2EV5 A;  1IRF A;  1U5T C;  2F4O B;  4X1E A;  1YS6 A;  3RZO J;  1WSU A;  2LY2 A;  1JTY A;  4QLC U;  3ZXS A;  1W36 D;  2W24 A;  4Y52 J;  4C3J J;  4L5I A;  2JA8 J;  2MSY A;  1IC8 A;  1SFX A;  1XN7 A;  2IPQ X;  1A35 A;  1H89 C;  2L0K A;  3P9I A;  4Y33 A;  2DMT A;  2FQ4 A;  3BTC A;  4CXF A;  1L3L A;  1KU7 A;  3DKW A;  4BQO A;  4A3D J;  1Z7U A;  2CWE A;  1B4A A;  2Q0O A;  1DP7 P;  1MMD A;  3QP5 A;  2HS5 A;  3LSK A;  1D5V A;  2MW8 A;  1QNT A;  3TOA A;  5GPC A;  4G7Z F;  3FMS A;  1Y8Q B;  1BI0 A;  1MGT A;  5KHD A;  1XB4 A;  2OUM A;  2OQG A;  1R5G A;  3JRF A;  3L2R A;  5C4J J;  2NVY J;  4ESJ A;  3FXQ A;  2DA1 A;  2IGN A;  2OPT A;  4HOB A;  1DU6 A;  5A2Q Z;  2PG4 A;  1R36 A;  4OIR F;  3T1B A;  3K4J A;  4HX7 A;  4RAG A;  3DP7 A;  4EGZ A;  3F72 A;  2ZJP F;  2XIG A;  3EUH A;  2V9P A;  3ZRG A;  1K61 A;  1S5L C;  2L7K A;  1ZQ3 P;  2O8K A;  4A3I J;  2HXI A;  1LQ1 A;  2QF7 A;  4DGW B;  3WTS C;  3MCZ A;  2Z33 A;  1AWC A;  2QVO A;  2G9W A;  3FXM A;  2ZFU A;  2R7T A;  2E1N A;  3S1Q J;  2LG4 A;  2VKH A;  4LLL A;  3F3X A;  3DKY A;  4MQ9 F;  4PFO A;  3KYL A;  4L0Y B;  1MMA A;  3IWZ A;  2MA3 A;  4RB1 A;  2YU9 J;  3M1E A;  3K4N A;  5DYM A;  3JTH A;  3FM3 A;  1JUP A;  4D5C A;  3VYT B;  3VPR A;  1EV7 A;  2ECB A;  2VOP A;  3FK6 A;  3QPT A;  1JUS A;  5F0H A;  4XRF A;  1ZGW A;  4XK4 A;  2GQQ A;  3WTT C;  1N78 A;  2JVG A;  5L3E A;  1RET A;  3H5N A;  1Z91 A;  4AC0 A;  1MNM C;  1SVO A;  4FX0 A;  4DZP A;  1R9T J;  4HPQ A;  4CA0 A;  3GFI A;  1BC7 C;  5IT9 Z;  3BJA A;  2DA6 A;  1QZZ A;  2RGV A;  4PCQ A;  2YS9 A;  2HU9 A;  3GTQ J;  2J5O A;  2M45 A;  5B5E C;  1V5G A;  1B8I A;  4QPQ A;  2P5V A;  3NAR A;  3F23 A;  1HW1 A;  2BVM A;  3J81 K;  3RKQ A;  3WGG A;  1SFU A;  4KFC A;  3OWT A;  2M2E A;  4A69 C;  2AO9 A;  4ZDL A;  4L9V A;  1K6O A;  3REO A;  5FB2 A;  4M3D A;  2ESH A;  1HXD A;  4BQQ A;  2LD5 A;  2CJJ A;  1KU3 A;  1V5E A;  5EG0 B;  4E7S A;  2KKO A;  1APL C;  5E3M A;  4Z6Y A;  4PJM A;  5ICE A;  2L3D A;  2K27 A;  4XON A;  4XOP A;  4HNV A;  3G1O A;  3U2R A;  3V8L A;  1YQA A;  4M73 A;  1B9M A;  2HKX A;  5E20 A;  5FRM A;  2D1H A;  1ETV A;  3F8N A;  2XAH A;  4BXF A;  4X6A J;  1CQT A;  1GUU A;  2MBF A;  4HNU A;  3OL3 A;  2YX7 A;  2YUS A;  1B9N A;  1FBS A;  3BCA A;  2ZXW H;  3IRQ A;  3TOB A;  2ZSI B;  1BN5 A;  2NAZ A;  4D0P A;  2P7C B;  1LPQ A;  2LBF B;  1MH4 A;  2Y48 A;  1XTA A;  4DNC A;  2FUG 2;  4IO9 F;  4E6K G;  3OS1 A;  2A6E F;  5J1Y A;  2KDO A;  4L9N A;  1W7P A;  2RQQ A;  1EKE A;  3WG7 H;  3SEQ A;  1W0T A;  1LEA A;  1FBU A;  2QCO A;  2L9N A;  4J00 A;  2DOF A;  5F6F A;  2XAU A;  3ABT A;  2DA3 A;  4ON0 A;  2HQA A;  2B63 J;  1J2X A;  1R1V A;  4XBF A;  2E1M C;  4RB3 C;  4I09 A;  2WAF A;  5K5O A;  4AM3 A;  1WI3 A;  3I9V 2;  2QQ9 A;  2YSR A;  1LE8 A;  1Z05 A;  2CYY A;  1JHH A;  3M8E A;  1DPR A;  4I02 A;  4A3B J;  2DYR H;  3KP6 A;  3R60 A;  1LB2 A;  3I0T A;  2X0L A;  4WXH A;  2ZKZ A;  2F5C A;  4GDF A;  1HSJ A;  2DMN A;  2VQH A;  1SD6 A;  1TT5 B;  4LG0 B;  1Z7L A;  3Q5F A;  2VQL A;  3P5J A;  2FSW A;  3BPX A;  3LSG A;  2KFD A;  2DLL A;  4PDK A;  1BOB A;  3VFZ A;  3ZQH A;  4IHS A;  1WJA A;  2XKO A;  3S2W A;  4BQN A;  5D5V B;  4GYG A;  4UXN A;  5M3M J;  1JT0 A;  2XAG A;  3FK7 A;  3HOS A;  4C30 A;  1Y39 A;  3OYN A;  1U0J A;  2DTR A;  2H09 A;  5IOZ A;  4DYQ A;  4ENN A;  4CDG A;  1NG6 A;  4OIQ F;  2OJE D;  4DYR A;  3FBI B;  3H0D A;  1OCP A;  5M3F J;  1ONV A;  1X1P A;  2CMP A;  4HLY A;  2ELJ A;  1O3Q A;  2OZ6 A;  5D8L B;  2DU9 A;  4DZJ A;  2FOK A;  4HF0 A;  2XB5 A;  3GTL J;  4KIC A;  2DK5 A;  2FBI A;  5DCM B;  3ISP A;  2WAE A;  3GTP J;  3FBN B;  5KVR A;  1K83 J;  3A03 A;  4ZZD A;  4IF4 A;  1F36 A;  2LY1 A;  2R4G A;  2EBI A;  2CW0 F;  2QSG X;  1OYW A;  2J5P A;  2L5Q A;  4KT6 A;  3WGH A;  1YOV B;  2QLZ A;  3HRS A;  4A6D A;  3FXO A;  2VOO A;  3LAJ A;  2MD0 A;  4WF2 A;  1R4M B;  4XLC A;  1TP4 A;  4A3J J;  2STW A;  2BVL A;  3K4B A;  1XD7 A;  2COB A;  2VI6 A;  2LKS A;  3LOC A;  1VFC A;  1J5Y A;  3OYF A;  4AVP A;  3S16 J;  1NG7 A;  4XOT A;  3LST A;  2OQR A;  3LSR A;  4OAZ A;  4IHW A;  4BEH A;  2DA5 A;  4ZYD A;  2FU4 A;  3A2K A;  4XN3 A;  2IT0 A;  1VQN I;  4I0B A;  3GZ6 A;  1AHD P;  4C2M J;  4LG0 A;  3HOV J;  2QQB A;  1YIT I;  3LSJ A;  2CU7 A;  2PJP A;  3PNY A;  2FBK A;  3MKY B;  5EYR A;  2JJ7 A;  3HOU J;  3H1C A;  3KYD B;  2COM A;  2ME0 A;  5E18 F;  4RBO A;  5CVI A;  3BWG A;  3CC4 I;  2L02 A;  4U0V A;  3U1K A;  2X6W A;  1FC3 A;  2P4W A;  4A5M A;  3K6G A;  1IO2 A;  1DP3 A;  1MJB A;  2O6G E;  2HXO A;  4MIM A;  2EFQ A;  5F04 A;  5FJ8 J;  4A3M J;  2XHK A;  2DJN A;  1ZAR A;  3E3V A;  3SEZ A;  3VB2 A;  5F0F A;  1KA8 A;  5D4S A;  4BAC A;  2L7Z A;  1BI3 A;  3BG5 A;  3HM5 A;  3S32 A;  3CUQ A;  2GZW A;  2D2W A;  1XSX A;  5HLH A;  1X1C A;  4E7Z A;  2IS4 A;  2MG4 A;  3MKZ A;  3H5R A;  1UG2 A;  5K7Z A;  4M9S A;  1K78 B;  4JK1 X;  1HDP A;  3SZP A;  2KP6 A;  4QWQ A;  3HOY J;  2ZNY A;  5C3E J;  2OZU A;  2DFI A;  1J0R A;  2MH2 A;  2EPF A;  3LNQ A;  2IS1 A;  5K7H A;  2P6S A;  3PM1 A;  3DCF A;  3ZQ7 A;  2A6H F;  4I0A A;  5JVT A;  3SJM A;  1OKR A;  1UHM A;  2HVQ A;  3FXR A;  3R0J A;  4ZTJ A;  3RKX A;  5KNL A;  2M7A A;  2UUZ A;  3LA3 A;  1BI2 A;  1ETQ A;  5EJC A;  3BDD A;  2EV6 A;  1BC8 C;  2VLA A;  1TL8 A;  1MBH A;  2V1N A;  4DIQ A;  2JTV A;  3KP4 A;  3IH2 A;  1BR2 A;  1G3S A;  2R93 J;  4BDY A;  1K4T A;  4P5O A;  3BG7 A;  4ZJZ A;  1BM9 A;  2D1V A;  2PBI A;  3E0J B;  3NAU A;  1SD5 A;  2N8G A;  5GAH J;  2VON A;  4II2 A;  1GXP A;  1Z6T A;  2XDV A;  2VC0 A;  4N4N B;  3PL8 A;  4RGX A;  3ZQF A;  3K70 C;  2UZK A;  2E1O A;  4ZZL A;  2DMU A;  5GTI C;  2ZC2 A;  1ZH5 A;  5IYD J;  1D1C A;  2E35 A;  2M3A A;  4QSH A;  5D5U B;  4A3F J;  1NK2 P;  1FIP A;  1TQM A;  3K2Z A;  4UVC A;  2JZY A;  3ZMT A;  3J7A Y;  2GA1 A;  2PJR A;  3QPH A;  1H0M A;  5M5X J;  4Y17 A;  2MYS A;  1HA8 A;  1OJL A;  2RQP A;  3TP0 A;  3CJR B;  4ASN A;  3NRV A;  1F5T A;  1FIA A;  3BR2 A;  1C0W A;  4GCV A;  4FAS D;  4G9Y A;  3E6D A;  4XLE A;  3CME I;  4AID A;  4O3M A;  1TNT A;  4D7M A;  4E7I A;  2EJR A;  1T39 A;  3SZT A;  3ZN0 A;  3OY9 A;  3LA2 A;  3U9G A;  1HKS A;  1FOY A;  1SMY F;  3KEQ A;  1I6H J;  5D6E A;  2KZG A;  1QRY A;  4H4K C;  1M1E B;  4DJA A;  3S1R J;  2GM4 A;  3MZY A;  2DYS H;  1O7F A;  2ZB9 A;  1YTY A;  2H8W A;  2LYC A;  4NQW B;  1HLV A;  3ONQ A;  2B9S A;  4HDU A;  4HRI A;  3GTG J;  3U21 A;  3CMA I;  1O3T A;  1YO5 C;  1X58 A;  2NS0 A;  1MW7 A;  3OYG A;  1WZ2 A;  1XCV A;  2R7F A;  2JT1 A;  2EWN A;  3GME A;  3D5R C;  2MC4 A;  3KP5 A;  4N9I A;  5K5Q A;  4CYC A;  4BXU A;  3LSI A;  2WC2 A;  1XCB A;  3I5U A;  3RKW A;  4QIW N;  3K2A A;  1ZN2 A;  1D1B A;  2BHY A;  1E3H A;  3PO2 J;  2UXX A;  2IS6 A;  2R7Q A;  4UUV A;  3TP3 A;  3E5U A;  4M3F A;  1B6A A;  3CP8 A;  2NVU B;  3WU2 C;  3MD2 A;  2Y0S N;  3FKJ A;  3ZN1 A;  1R71 A;  3HYI A;  3BZ6 A;  1BIB A;  2EIJ H;  2AXL A;  2EFN A;  4BGD A;  2W25 A;  5TGT A;  2M9H A;  2LC2 A;  4S05 A;  4EEF G;  2GAU A;  5M5W J;  4NBQ A;  3KLO A;  3V7C A;  2R7S A;  2VIX A;  1GV5 A;  4ITV A;  3PIO F;  3BR5 A;  5CLS A;  1UST A;  3QU3 A;  3EYI A;  3BC8 A;  1JKO C;  4LB5 A;  1VQ4 I;  3E5X A;  2BHZ A;  3ZR8 X;  3O2P E;  4EGY A;  1U5T A;  3AG3 H;  2X1D A;  2XRN A;  2WWY A;  4P9U A;  3OL4 A;  4UNO A;  1HBX G;  1U2W A;  1X1B A;  3KCC A;  2VC1 A;  1I6X A;  2VQC A;  4EJV A;  3JSO A;  4XQF A;  2W57 A;  2B7E A;  1IJW C;  1Z21 A;  2LVS A;  5IYB J;  2JA5 J;  5HDN A;  2JPC A;  3IC7 A;  4I6Z A;  4LK1 F;  3HB9 A;  1FP2 A;  4HV5 A;  4BJT A;  5FGM A;  1MNE A;  2FE3 A;  2HQN A;  3JCU C;  2WY8 Q;  4BE0 A;  2HNH A;  3K0L A;  2EA2 A;  5BPD A;  1D3Y A;  4G94 A;  1RR8 C;  4FIS A;  3RPU D;  2Z16 A;  2A5Y B;  4KJZ A;  1TT0 A;  4HV6 A;  3HPG A;  1B59 A;  5EZH A;  4WX9 A;  3G4S I;  2OD5 A;  2VBZ A;  1RC9 A;  4BXX J;  3ESW B;  5E1W A;  4PSX A;  2KRC A;  2OTL I;  3HTU A;  4IHY A;  3AG4 H;  1BJA A;  1T6S A;  5D6F A;  1FJL A;  3F6V A;  2QZ8 A;  5H2F C;  2WAQ A;  3HHH A;  4AVZ A;  2NXN B;  2K5C A;  3DEE A;  3ELK A;  1WJ5 A;  2CQX A;  4IL6 C;  4CH7 A;  4M3B A;  1DDN A;  3ZQL A;  2O03 A;  1FYM A;  4F52 A;  3M4O J;  2P5K A;  3ERE D;  4PJ0 C;  1W36 C;  1YYV A;  4YFK F;  1HST A;  3CCV I;  1UHW A;  3KEY A;  1R5H A;  3CMM A;  1H9T A;  3EYY A;  4HQM A;  3M7G A;  4E7J A;  2R5Z A;  2R7V A;  3GLL A;  1F1Z A;  1PYV A;  4XRM A;  4UVA A;  3G3Z A;  5J6X A;  4CGZ A;  4ENK A;  3GTO J;  4JX6 A;  4F7Z A;  3MFK A;  3JW4 A;  2E2I J;  3L2C A;  1PJR A;  2DCE A;  5DUK A;  2XKP A;  3HBL A;  4XNF A;  3CMY A;  1IGN A;  2BE5 F;  4E70 A;  3OYB A;  4LFU A;  3MMY B;  4ZC3 A;  1OIS A;  2O3F A;  1ZTR A;  4G12 A;  1LFB A;  2HR3 A;  4OOI A;  3WTZ A;  2Z1D A;  3ULQ B;  1K4S A;  3WTU C;  1SD7 A;  4NC7 A;  1P4A A;  2TRT A;  4C2U A;  1VND A;  1X1D A;  2A68 F;  2HFH A;  3C3W A;  4BYY A;  2X51 A;  4KNY A;  3WE3 A;  5J8C A;  3FKI J;  2CG4 A;  3DBH B;  2JSP A;  1H9G A;  2JMW A;  1S7E A;  4BAY A;  4CIC A;  1G59 A;  1JUM A;  3IH3 A;  2NNY A;  4AD9 A;  4UY8 I;  1JT6 A;  1ORK A;  3HIF A;  4RAZ A;  3GO5 A;  3SDB A;  2WV0 A;  2XPV A;  5DM6 F;  2V9V A;  4YII A;  4F91 B;  1VF9 A;  1SEU A;  4UUT A;  2KIF A;  3BG3 A;  3QAH A;  5E17 F;  2Z2S B;  5CPR B;  5J1U A;  4JYK A;  4KYW A;  2QA4 I;  1GHC A;  1B72 B;  1IN7 A;  3OSG A;  4RLQ A;  3OYD A;  3DLA A;  3CCM I;  3PFI A;  1QGP A;  2M5W A;  3F0C A;  3ZOB A;  4CYD A;  2WB1 A;  4M3G A;  1S6L A;  1KYZ A;  2JRT A;  4EM1 A;  2VJJ A;  2LK2 A;  3BZC A;  2H8R A;  1T38 A;  4LMY A;  3J7Y J;  1U3E M;  1UMQ A;  5LGT A;  2M34 A;  3R61 A;  4MFE A;  2ZJR F;  1EF4 A;  5EEA A;  4KDP A;  3GUD A;  1LDK B;  1QHG A;  3B6C A;  5GAE J;  3TKY A;  1PUF B;  1T56 A;  2BW3 A;  3G1L A;  3RQI A;  3GVA A;  2B0L A;  2F4I A;  3C2B A;  3P9K A;  4EVI A;  5ILU A;  1RRJ A;  5FFZ A;  4A0Y A;  5EDN A;  1XMA A;  3W6J B;  2XUB A;  1BJZ A;  2XRO A;  1K6Y A;  3HC7 A;  1JGS A;  3S93 A;  2K40 A;  1MBK A;  3EPZ A;  5K7F A;  1O3R A;  3Q0V A;  4F55 A;  2Z3Y A;  4DYC A;  4ZH4 F;  1ZLJ A;  4CZC A;  1WQ2 A;  2HWV A;  2JN6 A;  2L4M A;  3HUG B;  1BIA A;  3HZJ A;  5ICF A;  3ZMZ A;  4D9J A;  1ZRC A;  1TWC J;  3AAF A;  3BLY A;  2K9Q A;  2Y9Z A;  3F8B A;  2DT6 A;  1VQ9 I;  1MMG A;  2IW5 A;  4MO7 A;  4IX7 A;  1QVU A;  1ON2 A;  1JI8 A;  3B73 A;  2ZCW A;  3C2G A;  3FMQ A;  5BNG A;  5LGN A;  4WXC A;  4ZYH A;  5KCM A;  2HYJ A;  1B72 A;  3UR3 C;  1AKH B;  2BGC A;  3FHZ A;  4Y15 A;  3KET A;  4BE2 A;  2KHM A;  3IV5 A;  4JP0 A;  2F5F A;  4M74 A;  3OR1 C;  2DPD A;  4EJU A;  1BR4 A;  4HYE A;  3PSI A;  2RN7 A;  1CF7 B;  1MDM B;  1K79 A;  1POG A;  3BTJ A;  1RPW A;  3WHC A;  4MFD A;  1WCM J;  4JQF A;  2XSD C;  1MIJ A;  2UXN A;  3HGY A;  4B47 A;  4XID A;  1PUE E;  4M9Z A;  2ME6 A;  1G3Y A;  3PQJ A;  3KIO A;  2HKO A;  4M72 A;  5ERI A;  3OIQ A;  2KIS A;  4CHU A;  3OYC A;  2DW4 A;  3VSL A;  3BTI A;  2NNN A;  1Y1W J;  2QQA A;  4R1H A;  1SAX A;  1KU2 A;  1VZ0 A;  2HQ5 A;  2M8G X;  1YRN B;  2VUM J;  1CGP A;  2AQE A;  5J8F A;  3JRD A;  2VKE A;  5CYV A;  4E7K A;  4XSZ F;  2VBX A;  4LIU A;  3VSK A;  3HUG A;  4IHV A;  2XC7 A;  4XR6 A;  5F27 A;  4IOA F;  2HYG D;  2E71 A;  2K9L A;  3VEP A;  4ETS A;  1SAU A;  1HW2 A;  1UCR A;  2RVC A;  3IH4 A;  4BE1 A;  3OIO A;  4PZJ A;  2HTJ A;  2ZXI A;  4JOM A;  4W1U A;  3JRB A;  4ENJ A;  1T8I A;  1VQ6 I;  2EIK H;  1OR7 C;  1E2X A;  3DPT A;  1FBQ A;  2WTE A;  4KMF A;  3H3V K;  2IGM A;  2ZME B;  4YEL A;  5AIP A;  2DPU A;  3HDD A;  3I53 A;  2F5V A;  3MEX A;  3CJT B;  1QHH D;  1E0E A;  1KGS A;  2FMY A;  3DPU A;  1OCO H;  1CF7 A;  3AG1 H;  5FKM A;  1DPU A;  4KMU X;  3L9F A;  4DW6 A;  2Z5U A;  1SFE A;  4UUS B;  2HPI A;  2FML A;  5GAG J;  2KIM A;  3KPH A;  2F6C A;  1QZE A;  3J81 Z;  3CUO A;  3ZQC A;  2X85 A;  4LIT A;  2GIZ A;  4LJZ F;  5L3B A;  4L9T A;  1YX5 A;  3GWZ A;  2EFO A;  1WVR A;  2V1X A;  2K4J A;  3E5Q A;  1STZ A;  3CCU I;  2EFW A;  4CCO A;  1D1A A;  3L00 A;  2PMU A;  1S29 A;  2XPU A;  3TO7 A;  1YE9 A;  1YRN A;  4NNJ A;  5DDG A;  1HDD C;  3G1M A;  3OSF A;  4FHT A;  1KZH A;  4B3A A;  1XDU A;  2JUG A;  4AU7 A;  4RDU A;  5B1B H;  4MNU A;  3CCY A;  1RKW A; 
#chains in the Genus database with same CATH homology
 1I1G A;  3I59 B;  4UHT A;  2D45 A;  1ZGA A;  2DAO A;  2QEN A;  1UFM A;  4EJW A;  3O3K A;  2IA0 A;  1IW7 F;  3RKY A;  2O8X A;  3I4P A;  2CGP A;  1ULY A;  3J80 K;  3KP7 A;  4A12 A;  5KK1 A;  3NQO A;  3LQQ A;  3JAM K;  2STT A;  1P4W A;  2H94 A;  3N97 A;  1UB9 A;  3GFL A;  4ESB A;  5H20 A;  1OPC A;  4WK8 F;  2V6C A;  4R8H A;  5ICC A;  2F5E A;  4AIJ A;  1XGM A;  2P7V B;  1E17 A;  3GFM A;  1I1S A;  3ZMS A;  2IA2 A;  3LAP A;  3DXJ F;  2DO7 A;  1KU9 A;  3I59 A;  5ICG A;  3RYP A;  1LNW A;  2GXG A;  2Y75 A;  1K7A A;  3WTW C;  4IVN A;  4L5J A;  4NB5 A;  6PAX A;  3OV8 A;  5H6R A;  3T0Y A;  4WXD A;  4M9X A;  5LRS A;  1TW2 A;  1ZGJ A;  2EFP A;  5HVQ C;  1Q1H A;  3FX3 A;  3I71 A;  2HTS A;  2RKH A;  4U0Y A;  2F5D A;  1O3S A;  4HLX A;  2PMH A;  1A04 A;  3BJ6 A;  3KP2 A;  1QBJ A;  2FNA A;  1S3J A;  2ADU A;  1XGN A;  5IT3 A;  3KP3 A;  1R7J A;  3GF2 A;  2DI3 A;  5DCM A;  3TDZ C;  1KQ8 A;  5JFR A;  2P8T A;  4LLN A;  5DD8 A;  3KZZ A;  1O57 A;  4TV7 A;  2EV0 A;  5E1X A;  3Q9S A;  2ZXJ A;  4KT5 C;  4RS8 A;  3WTY C;  3BJO A;  3EQL F;  1TNS A;  4HAM A;  3BP8 A;  3SXY A;  3K1N A;  5H6Q A;  2BEO A;  3F22 A;  4Q5S F;  5LRR A;  3RJP A;  1O7L A;  2CO5 A;  1P92 A;  4N9H A;  4I2O A;  1OYY A;  4R79 A;  1YW8 A;  1FZP B;  5JHU A;  3COA C;  3I58 A;  4P55 A;  4U7D A;  1EH7 A;  5FO5 A;  2VOD A;  5E8I A;  3HOT A;  2O61 A;  1K78 A;  1KQ9 A;  4OIP F;  2IVM A;  2BYV E;  1FLI A;  5DUI A;  3V7S A;  2K02 A;  4HA8 A;  5DCF A;  2XGX A;  1MJA A;  3H3U A;  2GA2 A;  3F6O A;  2PQ8 A;  4LD5 A;  4LB6 B;  2ESN A;  1QZY A;  3M9A A;  3CO7 C;  3V7R A;  1IN8 A;  2ISY A;  2W85 A;  3GW2 A;  4BHP A;  3FMR A;  3GLX A;  2P6T A;  1WWX A;  2RC4 A;  2HQR A;  5BQT A;  2IA1 A;  5D8K B;  4HF2 A;  3T5X A;  2Y0M A;  5FLX K;  2L01 A;  3BY6 A;  5L3C A;  5LEK A;  3BRO A;  1LJ9 A;  1FOK A;  5ED4 A;  2QBY B;  1LDJ A;  1IAW A;  1W7P D;  4EJT A;  3LWF A;  4IRI A;  1HW5 A;  4Z2Y A;  2YU3 A;  4MTE A;  4GO1 A;  1FPQ A;  1LDD A;  4AIK A;  4NQW A;  2PN6 A;  1QQI A;  2HEO A;  5LLQ A;  3GEZ A;  5ILS A;  4XLN F;  3WOD F;  1XSD A;  1XGS A;  3LA7 A;  4RGR A;  4IHT A;  1ZHF A;  4GYI A;  5FFX A;  5E1Z B;  3CJN A;  1DUX C;  3TO9 A;  5HDG A;  2MC3 A;  4FX4 A;  5LGU A;  1PP7 U;  2XAJ A;  5LHH A;  1B1B A;  4RAY A;  1YIO A;  1BBY A;  2QBY A;  2AS5 F;  3CLO A;  2ZJ2 A;  2E7W A;  3G73 A;  5BOX A;  3C7J A;  2H6B A;  3JSP A;  5CVU A;  2KRF A;  5FD6 A;  4KA4 A;  1J75 A;  1ZRF A;  1WRJ A;  2A07 F;  4G7O F;  1V3F A;  1IN4 A;  3IHU A;  4G7H F;  1YLF A;  4BNC A;  4MQV A;  3GYH X;  3T8T A;  4EM0 B;  3IKV A;  3SHF A;  1FNN A;  1Z1D A;  2LSO A;  4GGG A;  3FXU A;  1OMI A;  1ZRD A;  1OR7 A;  2M87 A;  2ELH A;  2VN2 A;  1W5S A;  1FSH A;  2MLG A;  3BPV A;  4IPA A;  4M6Y A;  2VT2 A;  4A0Z A;  1AOY A;  5F64 A;  4I7H A;  1LEB A;  2FBH A;  2M30 A;  3SQN A;  3HHG A;  2HZT A;  4L18 B;  1T98 A;  3DQV C;  2H6C A;  1L0O C;  1IN6 A;  2PEX A;  3R0A A;  3DFG A;  2LNB A;  1FT9 A;  5BMZ A;  5ILV A;  3ECH A;  1S8N A;  2TDX A;  1HKT A;  3WE2 A;  4NHJ A;  5HDK A;  1WI9 A;  3DV8 A;  4O6J A;  4CZZ A;  1U6G A;  1G3W A;  3E6B A;  1G3T A;  2FRH A;  3K1M A;  1FYK A;  2OU2 A;  2XAF A;  1U8R A;  4U88 A;  3ECO A;  2ZNZ A;  3LQR A;  2X4H A;  5JI6 A;  4KN7 X;  5A2Q K;  4K2E A;  2GXB A;  2H27 A;  2EK5 A;  3MZH A;  3C1D A;  3IRR A;  1FY7 A;  2W84 A;  4UVB A;  2EB7 A;  4EM2 A;  5LHI A;  3FM5 A;  1RIO H;  1R22 A;  1IRG A;  4M6X A;  3E97 A;  2FF4 A;  3WTX C;  1TQI A;  1RUO A;  5DV5 A;  3V8J A;  3F8C A;  5HS9 A;  4GXO A;  2HDC A;  1P4X A;  2BV6 A;  1W4M A;  2HGC A;  3RDI A;  1IN5 A;  3GZ5 A;  4ZYG A;  2V1D A;  1W5T A;  2YPR A;  4MEX F;  1G4D A;  2LF7 A;  3HSR A;  4U0W A;  3VOE A;  1ZG5 A;  2OA4 A;  2VBW A;  2GWR A;  3P9C A;  1X3U A;  5IT9 K;  2O0Y A;  2ACJ A;  3C18 A;  4Y13 A;  4A0X A;  1Y0U A;  1ZRE A;  1YFH A;  4P9F A;  2KJB A;  3NEU A;  1W7P B;  1TW3 A;  3DEU A;  2VE8 A;  4KN4 X;  4MEY F;  5FD5 A;  1MD0 A;  2JPB A;  4KUM A;  1MDM A;  3K9T A;  4MTD A;  1T2K A;  4WWC A;  2PI0 A;  5TRD A;  5CVJ A;  3ZMU A;  4CO8 A;  3O6B B;  2VBY A;  1MZB A;  4P96 A;  3RTR A;  3PQK A;  2JSC A;  2ZFW A;  3K69 A;  2IRF G;  2G7H A;  5HOO A;  2ETH A;  3KE2 A;  3L09 A;  2M8E A;  3KEO A;  2A61 A;  3KLN A;  3IWF A;  4IRH A;  4H0E A;  3TO6 A;  1RNL A;  4HBL A;  2CFX A;  2MLK A;  5D5W B;  3TGN A;  1LVA A;  1QO0 D;  1XGO A;  4G6Q A;  3D0S A;  1PP8 F;  3WG9 A;  2R3S A;  2DBB A;  2A69 F;  2ZME A;  1IXC A;  4MHG A;  5HLI A;  4IRG A;  4HX8 A;  1R1U A;  5EEG A;  1J9I A;  2FNP A;  3FWE A;  4U7B A;  3WTV C;  4EV0 A;  1I5Z A;  1YW9 A;  4L9J A;  4Q48 A;  2R7D A;  4BHC A;  3HTS B;  1IXS B;  3RPU A;  3CTA A;  4ENM A;  3EDP A;  1JE8 A;  1XDS A;  2IP2 A;  3TQN A;  2LF8 A;  3LFK A;  5L3F A;  3HSF A;  3E6C C;  3J80 Z;  3W6K B;  5LEJ A;  3GX4 X;  1J59 A;  1IUY A;  2FEZ A;  1R1T A;  3JAM Z;  4I01 A;  1OYI A;  2PFB A;  2NYX A;  2DT5 A;  3WU0 A;  3FF5 A;  5AON A;  2FA5 A;  2CQK A;  4HZF A;  3ZPL A;  2L4A A;  4AIH A;  3CUQ B;  1U78 A;  2MH9 A;  1ODD A;  5D5X B;  3V8K A;  2Z99 A;  4N0B A;  4A6E A;  2YR2 A;  3SFZ A;  1TBX A;  4ZYE A;  4LGW A;  5CJ9 A;  3HRT A;  1SMT A;  1ZG3 A;  2ZO4 A;  4KIF A;  3I54 A;  4B09 A;  4BH9 A;  1FSE A;  3GFJ A;  4OU0 A;  2FXA A;  5E8G A;  4HF1 A;  1Z9C A;  2MD5 A;  4UV8 A;  2VT3 A;  4IXA A;  4O5V A;  2LDU A;  4EJO A;  4PGG A;  1RUN A;  1D8K A;  2CSO A;  1FYL A;  1D8J A;  2XV4 S;  4XSX F;  3TDU C;  4KIG A;  2GIV A;  1G6N A;  5D4R A;  4M71 A;  3U1D A;  2OBP A;  4JBA A;  1BOA A;  1RZ4 A;  5HS7 A;  5L3D A;  2V1U A;  5TJJ A;  1KQ0 A;  4OMZ A;  3RPQ A;  2VXZ A;  3MWM A;  1WKM A;  4Q47 A;  5K5R A;  2ZBK A;  5EEH A;  4LLG F;  4OIN F;  3R6S A;  3MAJ A;  3F8F A;  1J7K A;  1IZ1 A;  3DF8 A;  3RYR A;  1YG2 A;  1ZYR F;  5CVV A;  1Z6R A;  2HYF A;  3FZV A;  2K86 A;  1ON1 A;  1MJ9 A;  4MGR A;  1TTY A;  4FT8 A;  2K4B A;  1P6R A;  1F9N A;  1FP1 D;  2EA4 A;  2Q2E A;  4OIO F;  3RI4 A;  1JXS A;  2E7X A;  5BPI A;  3QOP A;  1S7O A;  3B02 A;  3DPL C;  1R00 A;  5DD4 A;  3QU6 A;  4YG2 F;  3EET A;  4WCG A;  2A3S A;  4HDV A;  4EQQ A;  3ROU A;  3J7A O;  2QYO A;  1U5T B;  3HRU A;  4Q4Z F;  2YX4 A;  2DQL A;  2KIU A;  4XLP F;  4YIF A;  2E1C A;  2RNJ A;  3WGI A;  2XAQ A;  2C6Y A;  3Q9V A;  1GXQ A;  1SD4 A;  3ABU A;  4G6D A;  4YFX F;  4DQ2 A;  5BS6 A;  5K1Y A;  1HQC A;  1REP C;  2VE9 A;  3OOP A;  5LBQ A;  3D5L A;  1IF1 A;  2HOE A;  2QM3 A;  5LHG A;  2LKP A;  3BOQ A;  1KYW A;  5F1R A;  1ZAO A;  2DQR A;  2QWW A;  4AWX B;  4HQE A;  5FLX Z;  3HSE A;  4YFN F;  4RB2 C;  4S04 A;  2RV8 A;  4HW0 A;  1YW7 A;  1JHF A;  4IJA A;  1QPM A;  2UWM A;  1XSV A;  2QUF A;  4I98 B;  3CUQ C;  2NRA C;  2K7L A;  4A2U A;  3KFW X;  3ML6 A;  5AIQ A;  3L7W A;  3M8F A;  3H92 A;  4A5N A;  2RDP A;  1V4R A;  3IL2 A;  4ESF A;  2G7U A;  3N4M A;  5HS8 A;  3F21 A;  2Z9O A;  3KZY A;  3JTG A;  2P5L C;  4RGS A;  1XMK A;  1S7A A;  1VTN C;  2OAZ A;  2DK8 A;  2F2E A;  1I27 A;  3CO6 C;  3F8M A;  4RGU A;  1HKQ A;  1EH6 A;  3P7N A;  1TLH B;  2BBY A;  5JR3 A;  3ZMV A;  3IKT A;  5HLG A;  3R4K A;  1RI7 A;  3QP6 A;  2Q8K A;  3E6M A;  3ZMD A;  1BI1 A;  3HRM A;  1FX7 A;  1F4K A;  4L0Z B;  1EH8 A;  4HX4 A;  1YS7 A;  1TQP A;  4KIB A;  4EMS A;  3MQ0 A;  4BHB A;  1ZLK A;  1R58 A;  2L54 A;  1NHA A;  2IJL A;  2XAS A;  4B8X A;  4PGH A;  5DEQ A;  3T8R A;  3ZP5 A;  1R23 A;  3I64 A;  3CDH A;  2FQ3 A;  4UV9 A;  5L3G A;  3H3Z A;  1IXR C;  4BQA A;  1FWZ A;  3V4G A;  2XVC A;  4RB0 A;  4OMY A;  2V79 A;  2KJC A;  3RIR A;  1USS A;  3GXO A;  1ZG1 A;  1T0F A;  2M1B A;  2PLY A;  1GVJ A;  3K1P A;  3WU1 B;  1P2F A;  1MKM A;  1PDN C;  4G8X A;  3VOD A;  5CVR A;  4LK0 F;  2ISZ A;  2EV5 A;  1IRF A;  1U5T C;  1YS6 A;  1WSU A;  4QLC U;  2W24 A;  4L5I A;  1SFX A;  1XN7 A;  2IPQ X;  3P9I A;  1L3L A;  4CXF A;  1KU7 A;  3DKW A;  1Z7U A;  2CWE A;  1B4A A;  2Q0O A;  1DP7 P;  3QP5 A;  2HS5 A;  1D5V A;  1QNT A;  3TOA A;  4G7Z F;  3FMS A;  1BI0 A;  1MGT A;  1XB4 A;  2OQG A;  1R5G A;  4ESJ A;  3FXQ A;  4HOB A;  5A2Q Z;  2PG4 A;  1R36 A;  4OIR F;  3T1B A;  4HX7 A;  3DP7 A;  4EGZ A;  3F72 A;  2XIG A;  3EUH A;  1LQ1 A;  3WTS C;  3MCZ A;  2Z33 A;  1AWC A;  2QVO A;  2G9W A;  2E1N A;  4LLL A;  3F3X A;  4MQ9 F;  4L0Y B;  3IWZ A;  2MA3 A;  4RB1 A;  3M1E A;  5DYM A;  3JTH A;  3FM3 A;  1EV7 A;  2VOP A;  3QPT A;  4XRF A;  2GQQ A;  3WTT C;  5L3E A;  1Z91 A;  4FX0 A;  3GFI A;  5IT9 Z;  1BC7 C;  3BJA A;  1QZZ A;  2RGV A;  4PCQ A;  2J5O A;  2M45 A;  2P5V A;  3F23 A;  1HW1 A;  3J81 K;  1SFU A;  4KFC A;  3WGG A;  4L9V A;  1K6O A;  3REO A;  5FB2 A;  2ESH A;  1HXD A;  1KU3 A;  2KKO A;  5ICE A;  2L3D A;  2K27 A;  3U2R A;  3V8L A;  1YQA A;  4M73 A;  1B9M A;  2HKX A;  5E20 A;  2D1H A;  3F8N A;  2XAH A;  2MBF A;  2YX7 A;  1B9N A;  1FBS A;  3IRQ A;  3TOB A;  4D0P A;  1BN5 A;  2NAZ A;  2P7C B;  2Y48 A;  4DNC A;  2A6E F;  4L9N A;  1W7P A;  1LEA A;  1FBU A;  5F6F A;  3ABT A;  4ON0 A;  1J2X A;  1R1V A;  4XBF A;  4RB3 C;  4I09 A;  5K5O A;  2QQ9 A;  2YSR A;  1Z05 A;  2CYY A;  1JHH A;  3M8E A;  1DPR A;  4I02 A;  3KP6 A;  3R60 A;  1LB2 A;  3I0T A;  2X0L A;  4WXH A;  2ZKZ A;  2F5C A;  1HSJ A;  1SD6 A;  4LG0 B;  3Q5F A;  2FSW A;  3BPX A;  2DLL A;  4PDK A;  3VFZ A;  4IHS A;  3S2W A;  2XKO A;  5D5V B;  4GYG A;  4UXN A;  2XAG A;  3HOS A;  2DTR A;  2H09 A;  4ENN A;  4CDG A;  4OIQ F;  1ONV A;  4HLY A;  1O3Q A;  2OZ6 A;  5D8L B;  2DU9 A;  2FOK A;  4HF0 A;  4KIC A;  2DK5 A;  5DCM B;  2FBI A;  3ISP A;  5KVR A;  4ZZD A;  4IF4 A;  2CW0 F;  1OYW A;  2J5P A;  3WGH A;  2QLZ A;  3HRS A;  4A6D A;  2VOO A;  3LAJ A;  4WF2 A;  2STW A;  1XD7 A;  1J5Y A;  4AVP A;  3LST A;  2OQR A;  4ZYD A;  2FU4 A;  2IT0 A;  4I0B A;  3GZ6 A;  4LG0 A;  2QQB A;  2PJP A;  2FBK A;  2COM A;  5E18 F;  5CVI A;  3BWG A;  2L02 A;  4U0V A;  1FC3 A;  2P4W A;  4A5M A;  1MJB A;  2O6G E;  2EFQ A;  2XHK A;  1ZAR A;  3E3V A;  3VB2 A;  5D4S A;  1KA8 A;  1BI3 A;  3CUQ A;  2GZW A;  2D2W A;  1XSX A;  5HLH A;  4M9S A;  1K78 B;  4JK1 X;  3SZP A;  4QWQ A;  2ZNY A;  2OZU A;  2DFI A;  1J0R A;  2MH2 A;  2P6S A;  3ZQ7 A;  2A6H F;  4I0A A;  5JVT A;  1OKR A;  1UHM A;  3FXR A;  3R0J A;  3RKX A;  3LA3 A;  1BI2 A;  3BDD A;  2EV6 A;  1BC8 C;  2JTV A;  3KP4 A;  1G3S A;  4P5O A;  1BM9 A;  2D1V A;  2PBI A;  1SD5 A;  2VON A;  1GXP A;  1Z6T A;  2UZK A;  2VC0 A;  4RGX A;  4ZZL A;  1ZH5 A;  5D5U B;  1TQM A;  3K2Z A;  4UVC A;  2JZY A;  3ZMT A;  2GA1 A;  3QPH A;  1H0M A;  4Y17 A;  2RQP A;  4ASN A;  3NRV A;  1F5T A;  1C0W A;  4GCV A;  4G9Y A;  3E6D A;  4O3M A;  1TNT A;  2EJR A;  1T39 A;  3SZT A;  3ZN0 A;  3LA2 A;  3U9G A;  1HKS A;  1SMY F;  3KEQ A;  5D6E A;  3MZY A;  1O7F A;  1YTY A;  4HDU A;  1O3T A;  1YO5 C;  2NS0 A;  1XCV A;  2R7F A;  2JT1 A;  2EWN A;  3KP5 A;  4N9I A;  5K5Q A;  4BXU A;  2WC2 A;  1XCB A;  3I5U A;  3RKW A;  1ZN2 A;  2UXX A;  4UUV A;  3E5U A;  1B6A A;  3ZN1 A;  3HYI A;  3BZ6 A;  1BIB A;  2AXL A;  2EFN A;  2W25 A;  4S05 A;  2GAU A;  3KLO A;  3V7C A;  5CLS A;  1UST A;  3QU3 A;  3EYI A;  4LB5 A;  3E5X A;  3O2P E;  4EGY A;  1U5T A;  2XRN A;  2WWY A;  4P9U A;  4UNO A;  1HBX G;  1U2W A;  3KCC A;  2VC1 A;  1I6X A;  4EJV A;  3JSO A;  2W57 A;  5HDN A;  2JPC A;  3IC7 A;  4LK1 F;  1FP2 A;  4HV5 A;  5FGM A;  2FE3 A;  2HQN A;  3K0L A;  2EA2 A;  5BPD A;  1D3Y A;  4G94 A;  2A5Y B;  4HV6 A;  1B59 A;  4WX9 A;  2OD5 A;  2VBZ A;  5E1W A;  3HTU A;  1BJA A;  1T6S A;  5D6F A;  3F6V A;  2QZ8 A;  3HHH A;  3ELK A;  1DDN A;  2O03 A;  1FYM A;  2P5K A;  3ERE D;  1YYV A;  4YFK F;  1HST A;  1UHW A;  1R5H A;  1H9T A;  3EYY A;  4HQM A;  3M7G A;  1F1Z A;  4UVA A;  3G3Z A;  5J6X A;  4CGZ A;  4ENK A;  4F7Z A;  3MFK A;  3JW4 A;  3L2C A;  5DUK A;  2XKP A;  2BE5 F;  4E70 A;  4LFU A;  2O3F A;  2HR3 A;  4OOI A;  3WTZ A;  3ULQ B;  3WTU C;  1SD7 A;  1P4A A;  2A68 F;  2HFH A;  3C3W A;  4BYY A;  4KNY A;  3WE3 A;  5J8C A;  2CG4 A;  1H9G A;  4BAY A;  4CIC A;  2NNY A;  4AD9 A;  3HIF A;  4RAZ A;  3GO5 A;  2WV0 A;  2V9V A;  4YII A;  2KIF A;  3QAH A;  5E17 F;  4KYW A;  1GHC A;  1IN7 A;  3PFI A;  1QGP A;  2M5W A;  4CYD A;  1S6L A;  1KYZ A;  2JRT A;  4EM1 A;  1T38 A;  4LMY A;  1U3E M;  5LGT A;  3R61 A;  4KDP A;  3GUD A;  1LDK B;  3TKY A;  3GVA A;  2B0L A;  3P9K A;  4EVI A;  5ILU A;  5FFZ A;  4A0Y A;  1XMA A;  3W6J B;  2XUB A;  2XRO A;  1JGS A;  1O3R A;  2Z3Y A;  4ZH4 F;  1ZLJ A;  1WQ2 A;  2HWV A;  2L4M A;  1BIA A;  5ICF A;  3ZMZ A;  1ZRC A;  3AAF A;  3F8B A;  2IW5 A;  1ON2 A;  3B73 A;  2ZCW A;  3FMQ A;  5LGN A;  4WXC A;  4ZYH A;  2BGC A;  3FHZ A;  4Y15 A;  3KET A;  2F5F A;  4M74 A;  2DPD A;  4EJU A;  4HYE A;  2RN7 A;  1CF7 B;  1MDM B;  1K79 A;  4JQF A;  2UXN A;  1PUE E;  4M9Z A;  1G3Y A;  3PQJ A;  2HKO A;  4M72 A;  5ERI A;  4CHU A;  2DW4 A;  2NNN A;  2QQA A;  4R1H A;  1SAX A;  1KU2 A;  1CGP A;  5J8F A;  5CYV A;  4XSZ F;  2VBX A;  3HUG A;  2HYG D;  3VEP A;  4ETS A;  1HW2 A;  1UCR A;  2RVC A;  4PZJ A;  2HTJ A;  4ENJ A;  1E2X A;  3DPT A;  1FBQ A;  2WTE A;  4KMF A;  2ZME B;  5AIP A;  2DPU A;  3I53 A;  3MEX A;  1KGS A;  2FMY A;  1CF7 A;  1DPU A;  4KMU X;  3L9F A;  2Z5U A;  1SFE A;  2FML A;  2KIM A;  3J81 Z;  3CUO A;  4LJZ F;  5L3B A;  4L9T A;  3GWZ A;  2EFO A;  2V1X A;  2K4J A;  3E5Q A;  1STZ A;  2EFW A;  3L00 A;  2PMU A;  1S29 A;  3TO7 A;  5DDG A;  4FHT A;  1XDU A;  4MNU A;  3QRF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...