2K4JA

Arsr dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
GSEEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRGIGYKLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ArsR DNA Binding Domain
rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords Putative TRANSCRIPTIONAL REGULATOR
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4jA00
4UXNA 2XASA 2X0LA 3BZ6A 1SFXA 5FO5A 5A2QK 4LG0B 1D8JA 1PP7U 1IXCA 1ZHFA 1JE8A 1Z7UA 1P4WA 1WQ2A 3GLXA 4AWXB 1MD0A 4EGYA 3J80K 3ECHA 1FSHA 1UHWA 4YFKF 2XGXA 1A04A 3V8JA 2K27A 3R60A 2P7CB 1PUEE 4I98B 2P5KA 4M72A 1R1VA 1SD5A 1EH8A 1K6OA 5TJJA 3I59B 3C18A 4ZYEA 1XGOA 4OIRF 2XROA 3G3ZA 4I02A 1ZRFA 5BPDA 1UHMA 2A68F 4LB5A 2F5DA 1LJ9A 3GZ5A 5BPIA 3KEOA 5K5OA 2R7FA 4LGWA 3WE3A 3I53A 3H3UA 1YO5C 1KU7A 4KUMA 4YIFA 2VBYA 3TOAA 2CYYA 5D8KB 4KIBA 2HZTA 3B02A 1BN5A 3PFIA 3ZQ7A 3HRTA 5ILUA 1FBUA 2VE8A 4ENMA 4L9VA 3FHZA 5HDGA 4EM2A 4OOIA 5FFZA 2YX7A 3KP4A 3SQNA 4HQEA 4S04A 3TO9A 1YW9A 4BNCA 1R5HA 1IN4A 4KMFA 1L0OC 5F64A 2FE3A 4N0BA 1ZLJA 3O2PE 3W6KB 4GGGA 3KP2A 1RZ4A 2YU3A 2HKXA 3QPHA 1SFEA 4L9NA 3R4KA 3HTUA 5BQTA 4G8XA 2LKPA 2EK5A 5ICEA 3HSEA 4U0VA 2MH2A 4UVBA 2XAQA 5CYVA 3Q9VA 3L2CA 4JBAA 5FD6A 3BDDA 3ISPA 4WXHA 2NYXA 3CLOA 2DI3A 3HHGA 1KYZA 4S05A 1B1BA 4AVPA 2P4WA 3EUHA 3V7SA 4IVNA 2HFHA 3JSOA 1BI2A 2IT0A 4HF1A 4HYEA 1I5ZA 2WTEA 2K86A 1FPQA 4P9FA 2OZUA 2NNYA 5E8GA 4AIJA 5LHHA 1HW1A 3R61A 4Q5SF 3ZP5A 2QQAA 3E6BA 1MZBA 5FGMA 2FF4A 4RGSA 3L7WA 2W25A 2H09A 3S2WA 4UV8A 4L5IA 2LSOA 2P5VA 5BOXA 2CWEA 2EFOA 3V7RA 1JXSA 5F6FA 4EJWA 3KZZA 1T2KA 2Y48A 2W57A 5D6EA 2Y0MA 3HOSA 1G4DA 2PMHA 4NHJA 4UUVA 5D5XB 4XSZF 2JPBA 2HDCA 3P9IA 4ESJA 1TQMA 4M9ZA 5HLHA 5IT9K 2BE5F 4CDGA 3DV8A 5ICCA 3RYPA 2TDXA 2QUFA 2RNJA 4LFUA 4O5VA 1D8KA 1W7PB 2IP2A 5J8CA 1G3YA 5FLXZ 1TBXA 5HOOA 4TV7A 3WODF 2M87A 2M5WA 1XB4A 2DW4A 2QBYA 3RIRA 4RB3C 3HSFA 4IRIA 1QGPA 3TDUC 4IPAA 4I09A 5E1ZB 2HYFA 1HKTA 4A12A 3ZMVA 4KFCA 1H9TA 5DD4A 1QNTA 1FC3A 5JVTA 1MDMB 3BJ6A 3U1DA 3ERED 1R36A 3RDIA 3K2ZA 1I27A 3V8KA 1JGSA 2R3SA 3K69A 2E1CA 3HUGA 2D2WA 3JSPA 5J8FA 2M1BA 3E5QA 1KYWA 4G94A 5DCFA 4Z2YA 1BIBA 3K0LA 1GXQA 4CGZA 1HW5A 5BMZA 1V4RA 2QZ8A 4WCGA 2L4MA 3F8NA 3P7NA 4U0YA 1FNNA 1RUNA 4XLPF 2XAGA 1WWXA 1O3SA 4HW0A 3T8TA 3NRVA 3HRMA 2JPCA 3CJNA 3PQJA 2WC2A 3KP6A 1QZZA 2Z5UA 3O3KA 5D4RA 1FP2A 2DO7A 5AIQA 1BC8C 2OA4A 1V3FA 4KICA 4LLLA 4HLXA 4U88A 2O8XA 2Q8KA 4PCQA 3RPQA 1JHHA 5L3DA 3H3ZA 4WXDA 4OIPF 1S7OA 2LDUA 5K5QA 3N97A 4L18B 2QENA 4M71A 2XRNA 1VTNC 4G9YA 1GHCA 3DEUA 3ULQB 2DPUA 2V6CA 4G7HF 1AWCA 3VOEA 3E5UA 2GXBA 4OU0A 4BQAA 5FB2A 1X3UA 3JAMZ 1DUXC 3W6JB 1K78A 3FZVA 1OYWA 2F2EA 3WGHA 5D4SA 2EV6A 3EQLF 2QVOA 3WTXC 5LGTA 1XGMA 3CO7C 3R0AA 2Q2EA 2YSRA 4H0EA 5HDKA 4P55A 5JFRA 4Q47A 2PLYA 5HS7A 3GEZA 3COAC 5KVRA 1SAXA 1MJ9A 2OD5A 4FX4A 1BOAA 2UZKA 2VC0A 2EFWA 1P2FA 4I0AA 3IC7A 4MGRA 2DK5A 4MNUA 2DQLA 5L3EA 1H0MA 1SD4A 2HR3A 5LLQA 4MTDA 1R58A 1KGSA 2PFBA 4P96A 3MZYA 1O3RA 4RB2C 4UNOA 4A6DA 1ZG3A 3KCCA 4BAYA 2O6GE 1YG2A 4A5MA 3SZTA 5JI6A 3M9AA 2CG4A 2EV0A 1B4AA 4I7HA 3FXUA 1KQ8A 3H92A 5LRSA 2HOEA 1E17A 1KA8A 4A6EA 1W5TA 1EV7A 3C3WA 4KYWA 3V7CA 3CUOA 3K1NA 5DEQA 2ISZA 3JTGA 2ZMEA 4MEYF 1MKMA 3J81Z 5LGNA 4IRGA 1B9MA 5DDGA 1AOYA 1BBYA 2ZFWA 4A0ZA 3I59A 4P5OA 2BEOA 3DPTA 2VODA 3HIFA 4HBLA 3RPUA 3I58A 1U5TC 1P4AA 2ACJA 2P5LC 3T1BA 1R1TA 3M8EA 5LHIA 1ZN2A 2K7LA 1OMIA 4RB0A 2XUBA 2DT5A 4BXUA 1KQ9A 2PN6A 2DTRA 2FU4A 3GWZA 1QQIA 3U9GA 3IHUA 1U8RA 4YIIA 5F1RA 2L4AA 2RVCA 4M74A 2QQBA 5E20A 2VC1A 4EJUA 1ZYRF 1MJBA 3IL2A 2RN7A 1YTYA 3FWEA 2P6SA 1USTA 4IF4A 4B09A 3LQQA 4WF2A 4WX9A 5H20A 5LBQA 3TO6A 4ENKA 4M6XA 1IF1A 4PGGA 4ZZDA 3GYHX 4M9XA 1ZLKA 1BIAA 1IUYA 2ADUA 1MJAA 4GXOA 1P4XA 5DUIA 5CLSA 4KN4X 5AONA 3M7GA 3D5LA 1IW7F 4XLNF 5D6FA 3RKYA 2KRFA 2CSOA 3F3XA 1I1SA 3DXJF 4D0PA 2E7XA 3V4GA 1J9IA 3CUQA 2DLLA 1DP7P 4EJTA 3WTYC 4EMSA 3GZ6A 4R8HA 2GXGA 2JRTA 5CVUA 4F7ZA 1HBXG 3DF8A 3F6OA 2MLGA 3WU0A 5E17F 1T98A 3JTHA 4CZZA 1U5TB 1O7FA 3QOPA 1WKMA 3E3VA 4ZYGA 1YS6A 3T5XA 3L09A 2EA2A 2EV5A 2EFPA 1BI3A 5HS9A 4WWCA 3LWFA 2D1HA 4BHPA 2DK8A 1YW7A 3ROUA 2PQ8A 3KETA 2ZJ2A 4O6JA 2A07F 3GW2A 1Z6RA 3AAFA 4KIGA 1BJAA 3BJAA 2JZYA 4PZJA 4ESFA 1T6SA 2YX4A 2GWRA 3R0JA 2COMA 1STZA 1XN7A 4ZZLA 3EETA 4BHBA 1TTYA 4N9IA 4RGUA 2A69F 2V1UA 2K4BA 5JR3A 1IN7A 2W85A 3QP5A 3TOBA 3BJOA 3FM5A 4M6YA 5EEGA 4MQVA 5DCMA 2MLKA 2EWNA 2QBYB 2HTJA 2IA1A 4OIQF 4XRFA 1ZRDA 2M8EA 4XSXF 5KK1A 1O3TA 1FLIA 3M8FA 3F8MA 2FNPA 2V1DA 3KFWX 4HDVA 1FT9A 1W5SA 5LHGA 2OQGA 4G6DA 2VONA 2KJCA 3I71A 5FLXK 3RI4A 2D1VA 1J7KA 4LK1F 3ZMUA 2KKOA 2ZNYA 2IVMA 3JW4A 3D0SA 1FX7A 2DFIA 1R23A 2DAOA 4L0YB 3KE2A 4EJOA 4HDUA 5D8LB 3BP8A 1YIOA 2OQRA 4L9JA 2HS5A 1SMYF 4BHCA 5HLIA 2PI0A 2KIMA 1B6AA 2VOPA 1ULYA 2A3SA 2J5OA 4HOBA 4ZYHA 1R1UA 5HS8A 1Z91A 3I4PA 4Q48A 1LDDA 1NHAA 1SMTA 3WTWC 4BYYA 4LMYA 3RYRA 5L3GA 1IN6A 3F8CA 3FMSA 3WE2A 3O6BB 2XAJA 2XV4S 1TNSA 4ZH4F 3FMRA 1IRGA 1EH7A 3FF5A 1K7AA 5FD5A 2HQNA 2B0LA 2NS0A 3ELKA 4GYIA 1R00A 2G7UA 1ZG1A 2A5YB 3LAPA 2ZXJA 4GO1A 1KQ0A 3RKXA 4KMUX 2FA5A 5BS6A 1J59A 4CXFA 5J6XA 3WTTC 3L00A 1F9NA 2VOOA 3NQOA 2C6YA 3SZPA 1W7PA 3ZMZA 4ENJA 2A6HF 5JHUA 3GVAA 3ZMTA 2O3FA 4L9TA 2O0YA 1YLFA 3KP3A 3BY6A 2BV6A 1USSA 4ENNA 3WTZA 4CICA 1BI0A 6PAXA 3F6VA 1GVJA 2VT2A 4DNCA 2Z3YA 3CUQC 3F8BA 2LNBA 2XAHA 4Y15A 4KA4A 1ZRCA 2IPQX 2QQ9A 1PP8F 4FT8A 4HZFA 3MEXA 1ON1A 4RAYA 1J5YA 2L3DA 1XCBA 2YR2A 3E6DA 3L9FA 2K4JA 2H27A 5CVJA 4QWQA 1XGSA 1H9GA 3HRSA 3ZMSA 4HX7A 2GZWA 4K2EA 2RGVA 4WXCA 1WI9A 4A0YA 1FY7A 3LA2A 4EM0B 1G6NA 2W84A 3TGNA 1J75A 2GA2A 2EFNA 2H6BA 2O61A 3SFZA 3IRRA 1TW2A 5ILVA 2FBIA 2W24A 5IT9Z 2LF8A 4IRHA 3CTAA 1RUOA 1I1GA 5D5UB 4OMYA 1SD6A 4E70A 5K1YA 2OBPA 1T39A 1Z1DA 4HX8A 1HSJA 1YQAA 3ABTA 1O7LA 1SD7A 1CGPA 3VFZA 3GFLA 3ECOA 2ISYA 4LD5A 2OU2A 3KZYA 3EDPA 4L0ZB 4FX0A 5K5RA 1TW3A 1ON2A 2VT3A 3MCZA 4MQ9F 1KU2A 2FOKA 4R1HA 3HRUA 2CQKA 5E8IA 1ZREA 3J80Z 1P92A 2NNNA 4A2UA 2QLZA 3P9KA 2LF7A 2MA3A 2CO5A 1OYYA 4XBFA 5IT3A 4I0BA 4Q4ZF 1LNWA 2Q0OA 1CF7A 3DQVC 1K78B 3I0TA 2EA4A 1EH6A 1FBSA 5DD8A 1QPMA 5L3CA 3LA3A 1FYKA 2ESHA 4U7BA 2GIVA 4P9UA 3VODA 2BGCA 3Q5FA 2J5PA 3CUQB 4RGXA 1T0FA 4ESBA 1J2XA 1Q1HA 1ZH5A 5L3BA 4QLCU 3LQRA 3E6MA 4LK0F 1TQPA 1HSTA 1DPUA 3HSRA 1HKQA 5E1WA 2RDPA 1BI1A 3QU3A 3TKYA 5EEHA 2JT1A 2NRAC 1IZ1A 1T38A 1FWZA 1U5TA 2YPRA 3KEQA 4LJZF 3IKVA 3VB2A 2H6CA 2VN2A 1BM9A 2CFXA 2L54A 5ICGA 4HF0A 4EV0A 1XSVA 4G6QA 4JQFA 1G3TA 3TDZC 2F5FA 2DBBA 3FXRA 3BPXA 1S8NA 5FFXA 3OV8A 2XHKA 4HLYA 2XAFA 2ELHA 3WTSC 3KLNA 4HV6A 2H94A 4AD9A 4Y17A 1JHFA 2XVCA 5LRRA 2JTVA 1YS7A 1HXDA 5DUKA 1OR7A 4MHGA 2VBXA 2QYOA 1L3LA 3HHHA 3E6CC 2DPDA 1REPC 2P7VB 3GXOA 4IJAA 3K9TA 4LG0A 1CF7B 1PDNC 3GF2A 1FBQA 5TRDA 2DU9A 3PQKA 3SXYA 4G7OF 1HW2A 3WGGA 1IXRC 4EGZA 1G3WA 1XDUA 4EM1A 4HX4A 1C0WA 3CDHA 4B8XA 3I64A 2PJPA 4KDPA 1XGNA 4ZYDA 3OOPA 1S7AA 2ETHA 2CW0F 2RV8A 3M1EA 4HV5A 2V9VA 2HYGD 2AS5F 1RI7A 1IN8A 1KU9A 3RJPA 3SHFA 1ONVA 1LQ1A 2ZMEB 5ERIA 1GXPA 1IXSB 2Y75A 3RKWA 2P8TA 4EVIA 2KIUA 3KLOA 3ZN1A 3TQNA 4UVCA 1WSUA 4FHTA 2MC3A 3U2RA 2MBFA 3HOTA 3KP7A 3N4MA 1IAWA 2EJRA 4GCVA 3WTVC 2ZKZA 4L5JA 1IN5A 4UVAA 4NB5A 4EJVA 1WRJA 2IW5A 4M73A 3GFIA 3JAMK 2FSWA 3ZN0A 2ESNA 2A61A 4HA8A 2HEOA 2X4HA 2FMLA 1HKSA 2M45A 2RC4A 2XKOA 2AXLA 3KP5A 4ETSA 4CHUA 4R79A 3E97A 4KT5C 1XDSA 3DP7A 4IXAA 3IWFA 2OAZA 1U3EM 1HQCA 3LSTA 3F8FA 3IWZA 4IHTA 2FEZA 1S6LA 1OKRA 2F5EA 5ED4A 4MEXF 2OZ6A 5DV5A 3ZPLA 3FM3A 1P6RA 4N9HA 2VXZA 2Z99A 3J7AO 3GO5A 1K79A 3B73A 1U78A 4PGHA 1U6GA 4OMZA 3P9CA 3T8RA 3EYYA 4ON0A 2VBZA 2HQRA 1G3SA 2FNAA 2RQPA 2VE9A 3CO6C 4GYGA 2BBYA 1YW8A 1XD7A 2HGCA 1D5VA 3GUDA 1UB9A 1B59A 2KIFA 4ASNA 1R22A 4YFXF 5DYMA 4A0XA 3ZMDA 3LA7A 2V1XA 5D5VB 4HQMA 3FX3A 1SFUA 2CGPA 4HAMA 4BH9A 1ODDA 4O3MA 2A6EF 4M9SA 4UV9A 1O57A 5E1XA 3BWGA 5CVVA 2IA0A 5LEJA 3DKWA 3V8LA 1F5TA 1W7PD 4LLGF 5LGUA 3GFMA 4U0WA 3EYIA 3RTRA 2G7HA 1FP1D 2FBHA 1UCRA 1Z05A 4I2OA 3I54A 2WV0A 1XMAA 2UXXA 3LAJA 2IRFG 2GQQA 1YYVA 1F1ZA 1ZGJA 3MWMA 1DDNA 3LFKA 4U7DA 3DPLC 1LEAA 3WTUC 3QPTA 1LB2A 3MQ0A 1BC7C 4EQQA 5E18F 1ZGAA 5LEKA 1W4MA 1QBJA 1LDKB 1MGTA 1F4KA 3QU6A 4NQWA 1Y0UA 5DCMB 1S3JA 2FRHA 3BPVA 4RS8A 3QRFF 1TQIA 5ICFA 1DPRA 2ZCWA 2ZO4A 1OYIA 1S29A 2KJBA 4OIOF 5H6RA 2HTSA 3WU1B 1XSDA 4G7ZF 1FSEA 1FZPB 4YG2F 5CVRA 2GAUA 2STTA 2QWWA 4CO8A 4KNYA 3F21A 1OPCA 3ABUA 3BOQA 2PG4A 4YFNF 5ILSA 2ZNZA 3J81K 2R7DA 4I01A 3IKTA 5HVQC 2L01A 4PDKA 2NAZA 2E7WA 1E2XA 1U2WA 3QAHA 2IA2A 2V79A 1O3QA 2XKPA 1ZG5A 2D45A 1LVAA 2HKOA 4RGRA 4JK1X 1RNLA 1MDMA 3ML6A 4HF2A 1B9NA 1R5GA 1FYLA 1YFHA 3K1PA 4A5NA 3FMQA 2VBWA 3FXQA 2G9WA 3QP6A 1TNTA 1XCVA 2UXNA 3K1MA 5HLGA 4KN7X 4AIHA 3F23A 1Z6TA 2M30A 2FQ3A 2UWMA 2PEXA 2Z9OA 3HTSB 3DFGA 2FXAA 2EFQA 5AIPA 3R6SA 1KU3A 3GFJA 2PMUA 2IJLA 4OINF 3F72A 3NEUA 4MTEA 4IHSA 1QO0D 3F22A 2DQRA 3WG9A 2F5CA 3MAJA 2GA1A 3GX4X 3T0YA 4Y13A 1Z9CA 3HYIA 3BROA 1XSXA 1FOKA 1LEBA 3VEPA 2QM3A 3MZHA 1D3YA 2JSCA 4AIKA 4UHTA 1I6XA 2MH9A 3C1DA 2Z33A 4WK8F 1RIOH 2MD5A 4RAZA 3Q9SA 2XIGA 5A2QZ 1ZARA 3TO7A 2BYVE 4DQ2A 2WWYA 2FBKA 2L02A 1IRFA 4KIFA 4RB1A 4LLNA 1FYMA 1LDJA 2E1NA 2K02A 2O03A 3IRQA 2P6TA 2PBIA 4CYDA 1QZYA 2EB7A 5CVIA 2HWVA 5D5WB 3E5XA 2STWA 1TLHB 5H6QA 5HDNA 1XMKA 3C7JA 3WGIA 3MFKA 1ZAOA 2FMYA 3REOA 5CJ9A 2RKHA 1UFMA 2ZBKA 3I5UA 3G73A 4LB6B 1R7JA 1J0RA 5L3FA
chains in the Genus database with same CATH superfamily
4UXNA 2XASA 2X0LA 3BZ6A 4DGWB 3FISA 2KLOA 4N4NB 1SFXA 5FO5A 4PJ0C 5A2QK 1TP4A 3SEQA 4LG0B 1D8JA 2IAIA 1PP7U 5C3EJ 3BG6A 3E1SA 4HNTA 1YX5A 1IXCA 4ZDOA 1ZHFA 3I56I 1JE8A 3TL4X 1Z7UA 1P4WA 4FQGA 1RRJA 2I8DA 3OOUA 2LD5A 4RM2A 1WQ2A 5LD2C 2X1DA 2R0QC 3U1KA 5FKOA 4MO7A 3GLXA 3SZGA 1F36A 4AWXB 1MD0A 4EGYA 5GPAA 3MKLA 4UUSA 2MSYA 3J80K 3IAM2 3ECHA 1FSHA 4EATA 1UHWA 5GTIC 4B44A 2XGXA 4YFKF 1A04A 4II2A 3V8JA 4PSWA 2K27A 3OYLA 2DMPA 4CYCB 1XMXA 1K83J 3IH2A 1D0ZA 2M34A 3JCUC 3ASOH 4J01A 3R60A 3CESA 2P7CB 1FTTA 1PUEE 1YJNI 3ZQLA 4I98B 1A35A 2P5KA 4M72A 1R1VA 1ZR2A 1SD5A 3M3YJ 2OJED 1R5ID 4JP0A 2QGUA 1EH8A 2JQ7A 3HJEA 1HF0A 1K6OA 3BR0A 4IQ4A 5TJJA 3G71I 3I59B 5GP9A 3C18A 3L2VA 3ASNH 4ZYEA 1X1CA 1XGOA 4CUGA 4OIRF 2XROA 3G3ZA 4I02A 3BZKA 5BPDA 1VQ7I 1UHMA 1ZRFA 2A68F 4GFBA 9ANTA 4LB5A 4U87A 2F5DA 1LJ9A 3G6EI 2H1KA 3GZ5A 3WG7H 5BPIA 3KEOA 5K5OA 2LFBA 2R7FA 4XIDA 3OMYA 4LGWA 4PJLA 3WE3A 3I53A 3H3UA 5F0FA 2R7ZJ 2K3PA 1YO5C 1KU7A 4KUMA 4YIFA 2VBYA 1ETKA 3TOAA 1UJ8A 1RESA 1QVTA 2CYYA 5D8KB 4KIBA 2Z1DA 2AQFA 2HZTA 3B02A 2NVYJ 1GV2A 1TC3C 4IQJA 2PMZN 1MBEA 1BN5A 2KDOA 3PFIA 3ZQ7A 5C4JJ 3HRTA 4LG3A 5ILUA 3CCMI 4JYKA 3ZRGA 3AKZA 4QPOA 1FBUA 1RR8C 2WAQA 2VE8A 4ENMA 4DZJA 2VL8A 4L9VA 4XMYA 3FHZA 1X2MA 3OSFA 1ZELA 2XB0X 2XPWA 5HDGA 2Y9YA 4EM2A 5EF6A 1MSFC 4OOIA 5FFZA 2YX7A 3KP4A 3SQNA 1ZGWA 1ETWA 4HQEA 1WFXA 4S04A 1ENHA 3QQAA 4XNFA 3TO9A 5F0HA 1YW9A 4BNCA 1R5HA 1IN4A 4KMFA 2O8KA 1L0OC 2V9KA 5F64A 2FE3A 4N0BA 1ZLJA 2DA5A 1R71A 2L7MP 3GMEA 3O2PE 3W6KB 2VQGA 4IHWA 4GGGA 3D5SC 3KP2A 3QPLA 1RZ4A 2ME0A 2YU3A 4NC7A 2HKXA 3QPHA 1SFEA 4L9NA 3JRFA 1WJCA 3R4KA 2ZXIA 3HTUA 4ZYAA 5BQTA 3JRCA 2OCEA 2CW8A 4G8XA 2LKPA 2Y0SN 2EK5A 3W2VA 2MC4A 2JN6A 2X1CA 3CCYA 1DP3A 5ICEA 3HSEA 4U0VA 2WBMA 2MH2A 3KIOA 1YIJI 2XDVA 4UVBA 1JKOC 1YITI 2XAQA 3KEYA 5CYVA 1OCPA 1POGA 3Q9VA 3L2CA 3SEZA 4JBAA 5FD6A 4UUSB 3OYDA 3BDDA 3ISPA 4WXHA 2NYXA 3CLOA 2DI3A 3HHGA 1QA6A 3GCMA 1KYZA 4KISA 2CQQA 1UMQA 1K4SA 4S05A 2HOAA 3M8JA 1K61A 2LK2A 1B1BA 4AVPA 2P4WA 3EUHA 3V7SA 4IKFA 4IVNA 3ESWB 2HFHA 2PX9A 3JSOA 1BI2A 2IT0A 3TW7A 4HF1A 1MMGA 1IG7A 4HNVA 2OC6A 3PSIA 5JHFA 1WZ2A 4Y4RA 2BHZA 3HOZJ 4HYEA 3PNTA 5LFAA 5K7ZA 1I5ZA 2FOWA 2WTEA 4D5FA 2K86A 4X0GA 1FPQA 4P9FA 2OZUA 2NNYA 3PFYA 5E8GA 4AIJA 5LHHA 1HW1A 3G1OA 2GXAA 2PJRA 2R92J 2BXZA 3R61A 4Q5SF 1VF9A 3ZP5A 1FEXA 2QQAA 3E6BA 1ZK8A 3A1YA 1MZBA 2WV1A 1JUPA 5H2FC 5FGMA 2E1MC 2FF4A 2ZSHB 4RGSA 2HXIA 2W25A 3L7WA 4XLCA 3J7YJ 3M1CA 5B3SH 1A6QA 4FE7A 4CYCA 2H09A 5IOZA 1NK2P 3S2WA 1DU0A 2HXOA 4UV8A 4IOAF 4II3A 4L5IA 2LSOA 3LSKA 1VQ6I 2P5VA 5BOXA 1NH3A 4W1UA 2NS7A 3HUGB 2CWEA 4AM3A 2EFOA 3V7RA 1JXSA 5F6FA 4EJWA 1QZEA 3KZZA 2XPUA 1T2KA 1XX5A 2Y48A 2W57A 5D6EA 2B9SA 2Y0MA 3M4OJ 4G12A 4UUTA 3HOSA 4ZTFA 1G4DA 2PMHA 4NHJA 4UUVA 5D5XB 4XSZF 4N4OB 2E2JJ 4ZTJA 3Q0WA 5FKNA 2JPBA 4NNJA 2HDCA 2EILH 2HPIA 2DN0A 3P9IA 4ESJA 1TQMA 1MMSA 3HPHA 4M9ZA 5HLHA 5IT9K 1OR7C 2BE5F 2X6YA 2XAUA 5FRNA 4CDGA 3DV8A 3BTCA 5ICCA 3RYPA 2TDXA 2QUFA 2VI6A 2RNJA 4LFUA 4O5VA 1D8KA 1W7PB 2IP2A 5J8CA 1G3YA 5FLXZ 1TBXA 2ZB9A 5HOOA 4TV7A 2RNGA 3WODF 2M87A 2M5WA 1XB4A 2DMQA 2DW4A 3C2HA 3RIRA 4RB3C 1XC5A 3HSFA 2VQCA 4F91B 2QBYA 4IRIA 1B72B 2DA1A 1QGPA 2M0CA 3TDUC 5IP7J 2YUSA 2H8WA 2L9RA 4IPAA 4I09A 5E1ZB 5F08A 2HYFA 3NAUA 1HKTA 4A12A 3ZMVA 4KFCA 4XORA 5DD4A 1H9TA 2DFEA 1QNTA 1FC3A 4B48A 5JVTA 1MDMB 3BJ6A 3U1DA 3ERED 1R36A 3RDIA 3K2ZA 1I27A 3V8KA 1I3AA 2LMDA 4FISA 1RPWA 1JGSA 2R3SA 3K69A 2KQRA 2E1CA 3HUGA 3S1RJ 3Q0UA 2D2WA 4XLEA 1VFCA 3JSPA 1N77A 5J8FA 2M1BA 3E5QA 1KYWA 4G94A 1Y56A 5DCFA 4Z2YA 1W36D 1BIBA 4BQQA 2BY2A 3K0LA 1GXQA 4PUSA 4CGZA 1IDYA 2GIZA 1HW5A 1ETVA 5BMZA 1V4RA 2QZ8A 3FIWA 3IUOA 4WCGA 3OYEA 3JRHA 3GTQJ 2K5CA 3TP3A 2L4MA 2VQHA 3F8NA 2W1OA 3P7NA 4U0YA 1FNNA 1RUNA 4XLPF 2XAGA 1WWXA 1O3SA 4HW0A 2CW7A 3T8TA 2A5WA 3NRVA 4CCLA 2O7OA 3HRMA 2JPCA 3CJNA 3PQJA 2BOLA 2WC2A 3KP6A 3V42A 1QZZA 3J7ZI 3L2WA 2Z5UA 2E2IJ 2Q2EB 3O3KA 5D4RA 2E60A 1FP2A 2DO7A 5CPRB 5AIQA 1BC8C 2OA4A 1V3FA 4KICA 4LLLA 2JA7J 1OCOH 4HLXA 4QSHA 4U88A 2O8XA 3BTJA 2Q8KA 1SANA 4PCQA 4V2FA 3RPQA 1JHHA 5L3DA 3H3ZA 4BS9A 2OTLI 3DEWA 3BR3A 3LSRA 1MNDA 4GRIA 4WXDA 4LITA 2UV1A 3PNVA 4OIPF 1S7OA 2LDUA 4BUPA 5K5QA 2VXDA 3N97A 1FJLA 4L18B 2QENA 1LFPA 4M71A 2XRNA 1H8AC 3ONQA 4HNUA 3HG9A 1VTNC 3A01B 1QHGA 1BL0A 4G9YA 3CMMA 1Q1VA 1GHCA 3DEUA 1P9QC 3ULQB 1EF4A 2DPUA 2V6CA 3UKGA 3LSJA 4G7HF 1R49A 3BC8A 1AWCA 3VOEA 2HDDA 2WAQN 3E5UA 4BACA 2GXBA 4OU0A 4BQAA 1AKHB 1FOWA 4IX7A 5FB2A 1UG2A 1X3UA 1LUJB 3JAMZ 2L0KA 1DUXC 3W6JB 3HGYA 1K78A 3BR2A 3FZVA 1OYWA 2F2EA 4M6VA 3WGHA 2EV6A 5D4SA 3EQLF 2QVOA 4D7MA 2VJ4A 3WTXC 3OS2A 3TW6A 4RM3A 4BEHB 2VASA 5LGTA 1BA5A 1VZ0A 1XGMA 5EG0A 3CO7C 4FETA 3R0AA 2Q2EA 2YSRA 4H0EA 5HDKA 3HGGA 2CQNA 3GBGA 4DOZA 4P55A 5JFRA 4A3DJ 4Q47A 4C3IJ 2PLYA 5HS7A 4W97A 1NG7A 5DM6F 3GEZA 3COAC 5KVRA 1SAXA 3TP0A 1VI0A 1MJ9A 4CCMA 1H88C 2OD5A 1PUFB 4FX4A 1BOAA 4E6KG 2UZKA 2VC0A 3IH3A 2EFWA 1P2FA 5TGTA 4I0AA 1JTYA 4BXXJ 3OYBA 3IC7A 4MGRA 1S5LC 2DK5A 2JJ7A 4MNUA 4AYBA 4CCOA 3TMOA 1TT0A 4EEFG 5GAGJ 2DQLA 4DIQA 2VJ5A 2V7FA 2DFFA 5L3EA 1H0MA 1DGWY 4XRMA 2RQQA 3VSKA 3OYJA 1SD4A 1WCMJ 3BQZA 2HR3A 5LLQA 4MTDA 3CJRB 4DYQA 3MKYB 1SVOA 2KZGA 5B1BH 1R58A 5EZHA 1KGSA 2PFBA 4P96A 3MZYA 1O3RA 1MBGA 4KT6A 4BY1J 4RB2C 5J4YA 4UNOA 5BNGA 4A6DA 2ECBA 2XF5A 1ZG3A 4S0HB 3KCCA 1MBFA 2N8GA 4BAYA 2O6GE 1YG2A 2IGNA 4A5MA 3SZTA 3N05A 2XB5A 3MMYB 5JI6A 1H89C 3M9AA 3H9JA 3GTJJ 1S9HA 4E7IA 2CG4A 2M7BA 2DTZA 3CLQA 4B47A 2EV0A 1B4AA 4I7HA 3FXUA 4RDUA 5GAHJ 1KQ8A 3H92A 5LRSA 5IOYA 4XQFA 1ETYA 2HOEA 1E17A 2XRLA 1KA8A 1W0TA 2DJIA 1W5TA 3DU6A 4A6EA 4DZPA 2V4JC 1EV7A 1XPXA 3HZJA 3C3WA 3CJQB 4KYWA 3BR5A 3V7CA 3JRDA 3CUOA 3K1NA 2Y69H 5DEQA 2ISZA 2DA3A 3JTGA 2HVQA 2LTPA 3K70D 2ZMEA 4MEYF 2W00A 1MKMA 3J81Z 5LGNA 4IRGA 1B9MA 2NOJB 5DDGA 3OYAA 1AOYA 1BBYA 2ZFWA 4A0ZA 5E3NA 3I59A 1WJ5A 2ID6A 4P5OA 4E7SA 3CF5F 2BEOA 3DPTA 3CMEI 2VODA 2L9VA 3HIFA 3K4NA 4HBLA 3RPUA 5M5YJ 2ID3A 3I58A 3BG7A 1U5TC 1P4AA 3K4BA 2P5LC 2ACJA 2R4GA 3T1BA 1R1TA 1TZLA 3M8EA 3LMMA 5LHIA 3CC7I 1N78A 1ZN2A 2K7LA 5F0CA 4F52A 4JX4A 3F0CA 1OMIA 4RB0A 3QPSA 2XUBA 2DT5A 4BXUA 1KQ9A 2PN6A 1LE8B 2R5YB 4DBQA 2F4MB 2E19A 3M07A 3OR1C 1ETQA 3J7AO 2DTRA 4AUXA 2FU4A 2KT0A 3GWZA 1QQIA 3SDBA 2G0EA 3U9GA 3IHUA 1E3PA 1U8RA 1GT0C 3HPGA 3A01A 5E3MA 2E5NA 4YIIA 4QIWN 5F1RA 2L4AA 2HNHA 2RVCA 2HYJA 4PSXA 2HVSA 4M74A 2QQBA 2Y30A 3FXOA 4M3FA 5E20A 1RKTA 1OLTA 2VC1A 3HBLA 4EJUA 1ZYRF 3FXMA 3GLLA 1MJBA 3IL2A 2RN7A 1YTYA 3FWEA 2EPFA 3BR1A 2P6SA 1TWCJ 1USTA 4IF4A 5C44J 4B09A 2E5ZA 2WB1A 3LQQA 4WF2A 2HDWA 3BG9A 4WX9A 5J4VA 4ZJZA 1V54H 5H20A 5LBQA 3TO6A 4ENKA 4BJ5C 1VQ8I 3VDXA 4M6XA 1IF1A 3MN2A 4PGGA 3QYBA 4ZZDA 2JA8J 3GYHX 3RKQA 4M9XA 3DCFA 1ZLKA 3OYGA 2M4GA 1BIAA 1FMWA 2WY8Q 1IUYA 2CV0A 2ADUA 3K10A 1MJAA 4GXOA 1BR4A 4XONA 1P4XA 3UR3C 5DUIA 5CLSA 4KN4X 5AONA 3M7GA 3D5LA 5GTHC 3ZR8X 1TT5B 1IW7F 4XLNF 1ETOA 1V5GA 2P0WA 1U9NA 2JVGA 3FHNA 5D6FA 3RKYA 1UHSA 2E71A 3F3XA 2CSOA 2KRFA 4ZDLA 1I1SA 3DXJF 4D0PA 4C2MJ 5FLMJ 2E7XA 2XF7A 5J1UA 3V4GA 3VYRB 4FTHA 1J9IA 3CUQA 3G1LA 1I50J 2M4KA 2CUFA 2M8GX 2DLLA 1IUFA 3OWTA 1P7IA 3DTEA 3K2AA 1DP7P 2HQ5A 2K9QA 3WTYC 4KITB 4EJTA 4EMSA 5IP6A 3GZ6A 4BQNA 3MVPA 4R8HA 2YU9J 2NS8A 4CZCA 2GXGA 2JRTA 5CVUA 4BU2A 4F7ZA 2W4SA 3DF8A 3SJMA 1HBXG 1X1PA 3F6OA 1VQPI 2MLGA 3WU0A 5E17F 1T98A 3C2BA 2DCEA 3JTHA 4CZZA 1U5TB 1YX3A 2CV2A 1O7FA 4E7ZA 1BJZA 3QOPA 2F4OB 1WKMA 2LRDA 3E3VA 4GDFA 3W6VA 4ZYGA 1IC8A 1YS6A 3T5XA 3L09A 2ECCA 1AU7A 2Q1ZB 2EA2A 4A3LJ 3H0GJ 2KDZA 2EZIA 3FKJA 2EV5A 3H5RA 1AHDP 2EFPA 1JUMA 2LKSA 2R93J 3LSIA 1BI3A 2IEKA 1TL8A 3MKWB 5HS9A 4WWCA 2R5ZA 2XSDC 5FROA 3LWFA 2D1HA 4BHPA 2R7VA 2CUJA 2DK8A 3DTKA 1YW7A 4BE1A 3ROUA 2PQ8A 3OYFA 3KETA 4XLHA 2ZJ2A 4O6JA 2A07F 3GW2A 2X85A 5IY5H 1Z6RA 3HC7A 1XG1A 3AAFA 4XKCA 1ZR4A 4KIGA 3DLAA 1BJAA 3BJAA 1WJFA 3KZIC 2ELJA 4I76A 2HZDA 2JZYA 2Y2ZA 3VYSB 3CMAI 1YRNB 3NWSA 4PZJA 4ESFA 1IRZA 2BY1A 2DFHA 2WY7Q 3K70C 2LY1A 5FRMA 3FXKA 1T6SA 4YELA 1R4NB 2W82A 5GADJ 2YX4A 5HNFA 2GWRA 1MH4A 3R0JA 4B3XA 2COMA 1STZA 1RC9A 1YJWI 1XN7A 4OAYA 4ZZLA 3EETA 4BHBA 4F55A 3S17J 1TTYA 1QU3A 4N9IA 2NXNB 2R7XA 4RGUA 1V5FA 2FD5A 2A69F 2IS1A 2V1UA 3I4MJ 3DWLE 2K4BA 1T0FC 4XLAA 2PJRB 5JR3A 1IN7A 1X3ZB 3DLLF 2HOSA 1OCZH 3I3LA 3OYIA 2HU9A 2W85A 3QP5A 3TOBA 1Y6IA 3BJOA 3FM5A 4OAZA 4M6YA 2E36A 3CJTB 1BR2A 4MQVA 5DCMA 5EEGA 4AIDA 2MLKA 2EWNA 4DYRA 3QYEA 1AKHA 1W36C 3AL0B 2QBYB 2HTJA 2IGKA 2IA1A 4OIQF 1Z67A 4XRFA 1IV8A 1ZRDA 3QOEA 2M8EA 4CA0A 2HPMA 4XSXF 5KK1A 1O3TA 2H8RA 1FLIA 2P81A 3M8FA 3F8MA 2FNPA 3RCOA 5IP9J 2V1DA 3KFWX 4HDVA 1EKEA 1FT9A 1W5SA 5LHGA 4OWRB 2OQGA 2CRGA 3H3VK 1SVLA 4G6DA 2VONA 2KJCA 3I71A 3NARA 5FLXK 3RI4A 2D1VA 1J7KA 4LK1F 3ZMUA 4CCJA 4IHVA 2ZMEC 2KKOA 3BZCA 2OTJI 3BR6A 2CUEA 2EIKH 2ZNYA 2IVMA 3JW4A 3D0SA 1FX7A 3OR2C 2LBFB 2DFIA 4A3JJ 1ETXA 3OIQA 4XOTA 3OSGA 1I6HJ 1R23A 3ZQGA 2DAOA 4L0YB 5B5EC 5J1RA 3KE2A 3Q3SA 4EJOA 5CQEA 1A6IA 4HDUA 2NVTJ 5D8LB 2OV7A 2VIXA 3BP8A 5K7FA 2OCCH 4BBSJ 2QSGX 1Y1VJ 1YIOA 1MBHA 3W2WA 4JX5A 2OQRA 3GTMJ 1U9OA 4L9JA 3FBNB 2LYCA 2HS5A 2QKLB 1RETA 1SMYF 5DS9A 4BHCA 5HLIA 2EIJH 2PI0A 2JSPA 2KIMA 1B6AA 2BHYA 1Y8QB 2CFOA 1ULYA 2VOPA 2L2OA 3H9GA 5GAEJ 2A3SA 2J5OA 3HOXJ 2ZJPF 3CC4I 4HOBA 4PJNA 4Y33A 4ZYHA 1NK3P 2NVUB 1Y1WJ 1R1UA 1Z21A 5HS8A 1VQLI 4AC0A 1Z91A 2E2HJ 1XTAA 3I4PA 3NWTA 1R4MB 4Q48A 4YRVA 1LDDA 1NHAA 1SMTA 5B1AH 3WTWC 2WA0A 4BYYA 2ZXWH 1MW7A 3OL3A 3S1MJ 2BY3A 4LMYA 3HB9A 3RYRA 4NUBA 1SEUA 2K9SA 5L3GA 1IN6A 3F8CA 3FMSA 3WE2A 1JGGA 1VQOI 3O6BB 2XAJA 2XV4S 1JJ6C 1D1AA 3SDGA 1BW5A 3WHCA 3ZXSA 1FIAA 2VPRA 1TNSA 4FE4A 4ZH4F 3FMRA 1IRGA 1MSEC 5FKLA 3LSPA 3HOVJ 1JTXA 1EH7A 5FLVA 3W2AA 3FF5A 1K7AA 5FD5A 2HQNA 4A93J 5CQGA 2B0LA 3ZCOA 3A2KA 3KX2A 2NS0A 3ELKA 4BEHA 4GYIA 1BW6A 1R00A 2GM4A 2G7UA 1ZG1A 2JUCA 2X9DA 3PUFA 3UNGC 3I4NJ 3OS1A 1GUUA 2O9LA 2A5YB 3LAPA 1WGXA 2ZXJA 4GO1A 3S2HJ 1KQ0A 3WU2C 3RKXA 4NBQA 4KMUX 2FA5A 5BS6A 4PJMA 3RSNA 4D7NA 1FOXA 4IZZA 2VKEA 1J59A 4CXFA 5J6XA 4XK4A 3WTTC 3L00A 5KAIC 3CCVI 1IRXA 1F9NA 4B43A 2VOOA 3BG3A 4XLFA 2R5YA 1Y8RB 1GDTA 3NQOA 2C6YA 3SZPA 1W7PA 3QWLA 1N75A 3ZMZA 1CQTA 4ENJA 2A6HF 5JHUA 1OCCH 3GVAA 4ZDPA 3I55I 2IS4A 3CDIA 3AG1H 3E0JB 3ZMTA 2WAEA 2D5VA 2O3FA 4L9TA 2ICWG 2O0YA 1YLFA 3KP3A 3Q0VA 2Y9ZA 2EZLA 3BY6A 5EZGA 2BV6A 1USSA 4KJZA 4ENNA 3WTZA 4CICA 1X4OA 4RAFA 1BI0A 6PAXA 3F6VA 1GVJA 1E3HA 4C3JJ 1I39A 2VT2A 2Z3YA 3CUQC 3F8BA 5F04A 4DNCA 2F5VA 2LNBA 2XAHA 2BVMA 2ME6A 4D5CA 2EQRA 2KZVA 2MFZA 4Y15A 4KA4A 1ZRCA 2IPQX 2LG4A 2QQ9A 1PP8F 2DJNA 2KPMA 2W48A 2R7QA 1IGNA 4FT8A 4HZFA 3HXLA 3MEXA 2PMZA 1ON1A 4RAYA 4Y3OA 2L7KA 1J5YA 2HI3A 2DMNA 5EGOB 2L3DA 4C2UA 4A3BJ 3H0DA 2DA4A 1XCBA 2YR2A 3E6DA 2V1NA 3L9FA 2K4JA 2H27A 5CVJA 3H36A 3BTLA 4P1WA 4QWQA 1XGSA 5FKKA 5M5WJ 2LP0A 2XF6A 4E7HA 1H9GA 1X58A 1E3OC 5IYBJ 4B1RA 2JK3A 2OPTA 3HRSA 1MMAA 3ZMSA 3CCRI 4HX7A 2GZWA 4K2EA 1DU6A 1X4PA 2CUZA 1YHQI 2RGVA 4WXCA 5KHDA 1WI9A 4A0YA 2EIMH 5HODA 1FY7A 3LA2A 4EM0B 1G6NA 2W84A 3TGNA 1T8IA 1J75A 2XPVA 2VQLA 1VQ9I 1HDDC 2GA2A 5E79C 2EFNA 2WAFA 3ERMA 2KP6A 2WADA 1JJ8C 1VQNI 4C2TA 2H6BA 1EJ9A 2O61A 3SFZA 3IRRA 1TW2A 5ILVA 3CD6I 2FBIA 2W24A 5IT9Z 3EUAA 3S14J 3F9KA 2CQXA 4E7JA 1E0EA 2LF8A 4RBOA 4IHXA 1AA7A 4A69C 4PJJA 1OQYA 4IRHA 4A3CJ 3CTAA 1RUOA 1I1GA 1Z77A 5D5UB 4OMYA 1SD6A 1T33A 4E70A 5K1YA 2OBPA 1T56A 4DJAA 4HRIA 3C2GA 2R7WA 1T39A 2ZSIB 2KRCA 1Z1DA 4HX8A 1YE9A 3CCEI 2DT6A 1HSJA 4CCKA 1YQAA 1Y0NA 5JLWA 2CJJA 3ABTA 3DKYA 1O7LA 1SD7A 2RREA 1CGPA 3VFZA 4A3FJ 2MABA 1V5EA 3GFLA 3ECOA 2QCOA 2FX0A 3D1NI 2ISYA 1FMVA 4LD5A 2OU2A 3KZYA 3EDPA 4L0ZB 1WHUA 4FX0A 3OIOA 5K5RA 1TW3A 2K85A 4DYCA 1ON2A 1B72A 2VT3A 2ZC2A 3MCZA 1RR7A 4MQ9F 1KU2A 2FOKA 5DTDA 3P5JA 4R1HA 3HRUA 2CQKA 4BBRJ 3LSGA 4XM3A 5E8IA 3ZQHA 3HL2A 1YOVB 1ZREA 2FQ4A 3AG3H 3S2DJ 2QSFX 3J80Z 1P92A 2NNNA 4A2UA 4B3AA 2QLZA 3P9KA 2LF7A 3CMYA 2JUGA 4F92B 2MA3A 2CO5A 4XR6A 1OYYA 3L2QA 4XBFA 2DOEA 2ZFUA 5IT3A 2TRTA 4I0BA 2JA2A 2JMWA 4Q4ZF 2A05A 1LNWA 2Q0OA 5DM7F 1OJLA 1CF7A 2HQAA 4V2GA 4I6ZA 3DQVC 3TBIA 1K78B 3I0TA 2EA4A 1EH6A 1JKQC 2CS3A 1FBSA 5DD8A 1QPMA 1SFOJ 5L3CA 2DMUA 3LA3A 1FYKA 2ESHA 3PM1A 3I9V2 4U7BA 1A36A 2GIVA 4P9UA 3VODA 2M2EA 3MZ8A 2X6OA 2BGCA 4YIRX 3OS0A 3Q5FA 3FK7A 3FKIJ 2J5PA 3CUQB 4RGXA 1T0FA 2DOAA 3VYUB 4B4CA 4ESBA 4V19K 1J2XA 1Q1HA 1K6YA 3GZNB 2DA6A 1U0JA 3CCJI 1ZH5A 2JRMA 5L3BA 1X3WB 3AG4H 2ELKA 5B66C 4CH7A 3LQRA 3E6MA 3FXJA 2IBDA 4QLCU 4LK0F 2VJIA 1TQPA 3H35A 1HSTA 1DPUA 2VKVA 3HSRA 1HKQA 2MW8A 1LPQA 2KIQA 2B7EA 5M3MJ 1MIJA 5E1WA 3RQIA 2RDPA 4A3EJ 3J7AY 1BI1A 3QU3A 3TKYA 1IDZA 5EEHA 2JT1A 2NRAC 1IZ1A 2EZKA 2F48A 4BE2A 1T38A 3PO2J 1FWZA 1LVKA 1EA3A 1U5TA 2GLOA 2YPRA 3KEQA 4LJZF 3IKVA 3U21A 3VB2A 2H6CA 2VN2A 1BM9A 2CFXA 2X1EA 2L54A 5ICGA 2Z2SB 4HF0A 1PYVA 4EV0A 2KHMA 1K4TA 4FCYA 1XSVA 4G6QA 2BZTA 2DMTA 4FASD 3A03A 1I3QJ 4JQFA 4DBRA 1G3TA 3TDZC 2DA2A 4BKXA 2F5FA 2DBBA 3FXRA 1SVMA 2R7UA 3BPXA 1S8NA 5FFXA 3A0BC 3S16J 5EYRA 3OV8A 3HKZA 2XHKA 4HLYA 2VB6A 2XAFA 3X2QH 4Y52J 2ELHA 3S8PA 2A6TA 3WTSC 3JREA 2QF7A 3KLNA 4HV6A 5M3FJ 1QHHD 4BL0B 2F6CA 3OYCA 2H94A 1JUSA 3L1PA 1WH5A 4AD9A 1MBJA 1FIPA 2DDBA 3VWBA 4Y17A 5KNLA 3GTLJ 2BVLA 1APLC 1TWHJ 1W5CC 1SAUA 1D0XA 3QYFA 1JHFA 2XVCA 5LRRA 1VNDA 1WJAA 2K9LA 1YJ9I 2JTVA 1YS7A 1HXDA 5DUKA 3S3OA 1OR7A 4MLOA 4MHGA 3K6GA 2NVXJ 3HOUJ 1VQ5I 2VBXA 4PFOA 4Z6YA 2X6XA 1G59A 1SC7A 2LOOA 2X48A 3K4KA 4HPQA 2VUMJ 2QYOA 4BJTA 3PJRA 1L3LA 2V6EA 3HHHA 3E6CC 2DPDA 3VYTB 1REPC 4IO9F 4HSRA 1VQMI 2P7VB 3GXOA 4IJAA 4XKWA 2IXSA 3K9TA 4LG0A 5HNHA 3G4SI 1CF7B 1PDNC 4MIMA 3GF2A 1DQUA 1FBQA 5TRDA 2DU9A 3PQKA 3SXYA 4G7OF 1HW2A 3WGGA 4A3GJ 4IHYA 2MYSA 1IXRC 4EGZA 3DPUA 1YI2I 4LOCA 1G3WA 3JRAA 1XDUA 2K9NA 2DT7B 1G2HA 3DEEA 4A3IJ 4EM1A 1ACIA 5M5XJ 4HX4A 1C0WA 3CDHA 4B8XA 3IH4A 2L7ZA 3I64A 3RQ4A 2PJPA 3GTGJ 5CKTA 5EJCA 3ZQQA 4KDPA 1XGNA 4ZYDA 3OOPA 1S7AA 3E7LA 2ETHA 2CW0F 2RV8A 3M1EA 4HV5A 2V9VA 3CC2I 2HYGD 4M3DA 2AS5F 1RI7A 3OYNA 1ZTRA 1IN8A 1KU9A 3BT9A 3RJPA 2VPLA 3SHFA 1QRYA 1ONVA 1Z0XA 2DDAA 1LQ1A 2ZMEB 3PIPF 5ERIA 1GXPA 1IXSB 1MMDA 2Y75A 3DTIA 3BLYA 3RKWA 5EEAA 2P8TA 3CDLA 4EVIA 2KIUA 4XRSA 1QPIA 1Z3XA 3KLOA 3ZN1A 3OYKA 3TQNA 1T95A 1B8IA 4UVCA 1WSUA 4CCNA 4FHTA 2MC3A 2MBFA 3U2RA 2NOGA 3HOTA 3KP7A 3N4MA 4GCVA 2EJRA 1IAWA 3WTVC 2ZKZA 4BE0A 4L5JA 2HVRA 1IN5A 4MFDA 3ZQIA 4UVAA 4NB5A 5JVGF 1N25A 4EJVA 1WRJA 2IW5A 4M73A 4AVZA 1RKWA 3GFIA 3JAMK 2FSWA 3A0HC 3KYDB 1HDPA 5EG0B 3ZN0A 1GLNA 2ESNA 2A61A 4HA8A 3CCSI 2HEOA 2QA4I 2X4HA 3LL7A 5KCMA 1Z3YA 2FMLA 2CMPA 1HKSA 3A02A 2M45A 1BR1A 2RC4A 2XKOA 2AXLA 3KP5A 4ETSA 2M3AA 1X19A 4CHUA 4RMNA 4R79A 1X1AA 2H1LA 3E97A 1JKRC 2E1MB 4KT5C 1XDSA 3DP7A 2BY0A 3ZGKA 4IXAA 3IWFA 2OAZA 3HDDA 1BOBA 1WJDA 2M0MA 3H1CA 3HOWJ 1U3EM 3ZOBA 1HQCA 1HCRA 3TEDA 1UAAA 1UG0A 2EINH 5IPAA 2W7NA 2CV1A 2LLKA 4XICA 3D5RC 3CZ6A 3LSTA 3LNQA 3F8FA 4RLQA 4UB6C 4DW6A 3IWZA 4IHTA 2FEZA 2L5QA 3DBRB 4IL6C 3H9QA 1S6LA 2Y31A 1OKRA 2F5EA 5IYCJ 5EGOA 1FTZA 5ED4A 4MEXF 2TCTA 2MG4A 2OZ6A 3K4JA 5DV5A 3ZPLA 4Y7NJ 3FM3A 4A3KJ 1P6RA 4N9HA 2VXZA 2Z99A 1B8IB 2MGQA 4E7KA 1ORKA 3GO5A 3O8GA 1UZCA 4XOPA 1K79A 3B73A 4IEJA 5J3LA 1U78A 4PGHA 1LKXA 1U6GA 2LY9A 2K3FA 4OMZA 4C30A 3S1NJ 1HA8A 3P9CA 3IP4B 2E1OA 3T8RA 3EYYA 4ON0A 2VBZA 3SYTA 1LFBA 2HQRA 1YRNA 1VQ4I 4AYBN 3S32A 5J1YA 1G3SA 1DGRM 2FNAA 1X1BA 2RQPA 2VE9A 3CO6C 4GYGA 2KMUA 3JRGA 4F3QA 1R9TJ 1HLVA 1MMNA 5C4XJ 2VLAA 2QKMB 2BBYA 1YW8A 2LC2A 2GBYA 2BW3A 1XD7A 2HGCA 1D5VA 1HC8A 3GUDA 1UB9A 1B59A 3B6CA 1PUFA 3H5AA 2KIFA 4QTRA 3OYHA 4ASNA 2K40A 1LFUP 1R22A 4YFXF 5DYMA 4A0XA 4A3MJ 2L7FP 4H4KC 3ZMDA 1G8XA 3LA7A 1WVRA 2V1XA 5D5VB 1ZKGA 1M1EB 4HQMA 3FX3A 1SFUA 2CGPA 1VQKI 3GTOJ 4HAMA 4BH9A 1NTCA 2I10A 2DXIA 4C9YA 1ODDA 3FXLA 4O3MA 2A6EF 4XN0A 4M9SA 4UV9A 1O57A 5E1XA 4RAGA 2EBIA 3BWGA 4G6TB 5CVVA 4LIVA 3OYMA 1QVUA 2IA0A 2LH9A 3BCAA 5LEJA 2OUMA 3DKWA 3PO3J 3V8LA 3PSFA 2CQ7A 1WH7A 3EUKL 4HG2A 1F5TA 1W7PD 1W1WE 4LLGF 2EZHA 1OISA 2XGEA 1LE8A 5LGUA 2AHQA 5GPCA 1IO2A 2GOMA 4BDYA 3GFMA 4U0WA 5FJ8J 1XS9A 3EYIA 3A4CA 1MH3A 3RTRA 3K4MA 1WJEA 2G7HA 1FP1D 1FOYA 2FBHA 3RZOJ 1UCRA 1Z05A 2DYSH 2XSJC 1D5YA 2R7RA 2COBA 3KYCB 4I2OA 2LBFA 3I54A 4BGDA 2QEXI 2WV0A 4XKVA 2XGCA 3PNYA 4NDLA 1KONA 1XMAA 3FK6A 2JA6J 2UXXA 4BQOA 4XRSG 3LAJA 2IRFG 3CQZJ 2GQQA 1YYVA 3PL8A 1F1ZA 3O8HA 3ABKH 2LR8A 1ZGJA 3MWMA 1DDNA 2QSHX 2HOTA 2JVHA 2KISA 3LFKA 4U7DA 3DPLC 2JA5J 5FKMA 2ZJQF 3JRIA 1LEAA 3WTUC 2V9PA 3QPTA 1LB2A 3B6AA 1ITYA 3MQ0A 2QQ8A 1BC7C 3CF2A 2RAEA 4D9JA 4EQQA 5E18F 1ZGAA 5LEKA 1ERDA 2E35A 1W4MA 1QBJA 1LDKB 3SFIA 2E34A 3L2RA 1NG6A 3IV5A 3BTIA 5IYDJ 3LSMA 3ABLH 1MGTA 4QPQA 1P7JA 2VJJA 2Z16A 1UELB 3K7AJ 1JKPC 1F4KA 4L5EA 3QU6A 2DYRH 3S93A 4NQWA 2UUZA 3HM5A 1Y0UA 2BXYA 3FBIB 1SFKA 1S3JA 3AG2H 5DCMB 3S1QJ 3L2UA 1WI3A 2FRHA 2K9MA 3BQYA 3BPVA 4RS8A 5EDNA 3ABMH 3QRFF 1TQIA 4NC6A 5ICFA 3S3MA 3DKXA 2OF7A 1DPRA 2ZCWA 2ZO4A 1W0UA 2AXTC 1OYIA 1OCRH 5F1JA 1JI8A 1S29A 3CCQI 2KJBA 4OIOF 2KL4A 5H6RA 1MBKA 2HTSA 3WU1B 3ZQCA 1A31A 1XSDA 4G7ZF 1FSEA 1FZPB 1J09A 4BXFA 1D0YA 4YG2F 5CVRA 1X2NA 2GAUA 3AFHA 2STTA 1X1DA 1D1CA 2QWWA 4CO8A 4M3GA 4KNYA 3F21A 1OPCA 3ABUA 3BOQA 3KYLA 2PG4A 2B63J 2BW3B 4YFNF 3MD2A 5ILSA 1GVDA 2ZNZA 4BDZA 4ZC3A 3J81K 1Y39A 2KRHA 2R7DA 4I01A 3IKTA 5HVQC 2YS9A 2L01A 2L9SA 4PDKA 4X1EA 2NAZA 3IAS2 1KZHA 3QODA 2E7WA 1E2XA 3S15J 2XC7A 3LSHA 1TWGJ 1T08B 1U2WA 3H5NA 3QAHA 3PIOF 3EPZA 3K4LA 2IA2A 1ZQ3P 2V79A 1IJWC 4M3BA 1O3QA 1HOMA 2XKPA 1ZG5A 2D45A 1GV5A 2IGOA 1LVAA 3OY9A 2HKOA 4RGRA 4JK1X 5JLXA 1U8BA 2LKXA 2R7SA 1RNLA 2DA7A 2MD0A 1MDMA 2IS2A 2CU7A 1PJRA 3OIPA 2LVSA 3ML6A 4J00A 1WJBA 4ITVA 1B9NA 4M3EA 4HF2A 1R5GA 2F4IA 1D1BA 1FYLA 5J47A 4AU7A 1S72I 3GTKJ 4JX6A 1YFHA 3K1PA 2AQEA 2X6WA 4A5NA 3FMQA 2KFDA 3JR9A 2VBWA 3FXQA 2G9WA 3QP6A 3ZQFA 5HLTA 4NC8A 2XGDA 3GTPJ 1TNTA 2UXNA 1R6RA 1XCVA 3K1MA 5HLGA 4KN7X 4AIHA 3BCBA 4I99C 3F23A 1Z6TA 3VPRA 4E7LA 2M30A 3LOCA 2FQ3A 1V55H 2UWMA 2PEXA 2Z9OA 1JT0A 3CP8A 3HTSB 3DFGA 3EUHC 2FXAA 2EFQA 3HKZN 5AIPA 2IS6A 3R6SA 4ANJA 4MFEA 1KU3A 3GFJA 2DODA 2PMUA 1WPKA 1A5JA 2ZJRF 4YEJA 2IJLA 3AL0C 4RA2A 2LY2A 4OINF 5E3OA 3F72A 4F93B 1Z7LA 3NEUA 2ZXHA 4MTEA 4IHSA 1QO0D 4XL9A 2M7AA 2LREA 3F22A 1TWAJ 2VKDA 3RZDJ 2DQRA 5J40A 4IOCF 1TWFJ 1IV6A 1JT6A 3OL4A 3PUBA 3S3NA 3WG9A 2F5CA 2WB1N 3MAJA 2L9NA 3JRBA 3RPUD 2GA1A 3GX4X 3T0YA 2M9HA 4Y13A 1Z9CA 1MNMC 5E3LA 4XN3A 3HYIA 3BROA 3CCUI 1PVEA 1XSXA 3BG5A 1FOKA 1LEBA 3HEFA 3CCLI 2R7OA 3G1MA 3LFUA 4UY8I 3W3CA 2AO9A 3VEPA 3K4CA 2QM3A 4ABZA 3MZHA 1D3YA 1OFCX 2CH0A 2JSCA 4AIKA 3MKZA 2Y0SA 4UB8C 2V26A 4UHTA 1I6XA 4HEA2 4NQWB 2MH9A 3C1DA 4BJ6C 2Z33A 4WK8F 4HSTA 1RIOH 2FUG2 2MD5A 1OCTC 2NVQJ 4RAZA 3DBHB 3Q9SA 4BY7J 2XIGA 1MNEA 5A2QZ 1ZARA 5F27A 5K7HA 2EH3A 3KPHA 3TO7A 3DBLB 2BYVE 4DQ2A 2WWYA 2FBKA 2R5ZB 5KAFC 2L02A 2I5UA 1IRFA 4KIFA 4CSWA 4E4HA 4RB1A 4LLNA 1F43A 1LDJA 1FYMA 2E1NA 4JOMA 2K02A 4J19A 4X6AJ 2O03A 4LIUA 2P6TA 3IRQA 2PBIA 4CYDA 4C3HJ 2VKHA 1QZYA 2EB7A 4RLFA 5CVIA 2HWVA 4D1QA 2FJ1A 5D5WB 3E5XA 2STWA 1TLHB 5H6QA 5HDNA 1O4XA 3VSLA 1XMKA 3C7JA 2JWTA 3DU5A 4PK4A 1S7EA 3WGIA 3MFKA 2O5RA 3HOYJ 1ZAOA 2FMYA 3REOA 5CJ9A 2X51A 4XKBA 2RKHA 1UFMA 2IGMA 2GOXB 2ZBKA 3I5UA 3CP2A 3G73A 4LB6B 4PFPA 3FDYA 3WHBA 2R7TA 1R7JA 2DOFA 3G2BA 5TISC 1J0RA 5L3FA
chains in the Genus database with same CATH topology
4UXNA 2XASA 2X0LA 3BZ6A 1SFXA 5FO5A 5A2QK 4LG0B 1D8JA 1PP7U 1IXCA 1ZHFA 1JE8A 1Z7UA 1P4WA 1WQ2A 3GLXA 4AWXB 1MD0A 4EGYA 3J80K 3ECHA 1FSHA 1UHWA 4YFKF 2XGXA 1A04A 3V8JA 2K27A 3R60A 2P7CB 1PUEE 4I98B 2P5KA 4M72A 1R1VA 1SD5A 1EH8A 1K6OA 5TJJA 3I59B 3C18A 4ZYEA 1XGOA 4OIRF 2XROA 3G3ZA 4I02A 1ZRFA 5BPDA 1UHMA 2A68F 4LB5A 2F5DA 1LJ9A 3GZ5A 5BPIA 3KEOA 5K5OA 2R7FA 4LGWA 3WE3A 3I53A 3H3UA 1YO5C 1KU7A 4KUMA 4YIFA 2VBYA 3TOAA 2CYYA 5D8KB 4KIBA 2HZTA 3B02A 1BN5A 3PFIA 3ZQ7A 3HRTA 5ILUA 1FBUA 2VE8A 4ENMA 4L9VA 3FHZA 5HDGA 4EM2A 4OOIA 5FFZA 2YX7A 3KP4A 3SQNA 4HQEA 4S04A 3TO9A 1YW9A 4BNCA 1R5HA 1IN4A 4KMFA 1L0OC 5F64A 2FE3A 4N0BA 1ZLJA 3O2PE 3W6KB 4GGGA 3KP2A 1RZ4A 2YU3A 2HKXA 3QPHA 1SFEA 4L9NA 3R4KA 3HTUA 5BQTA 4G8XA 2LKPA 2EK5A 5ICEA 3HSEA 4U0VA 2MH2A 4UVBA 2XAQA 5CYVA 3Q9VA 3L2CA 4JBAA 5FD6A 3BDDA 3ISPA 4WXHA 2NYXA 3CLOA 2DI3A 3HHGA 1KYZA 4S05A 1B1BA 4AVPA 2P4WA 3EUHA 3V7SA 4IVNA 2HFHA 3JSOA 1BI2A 2IT0A 4HF1A 4HYEA 1I5ZA 2WTEA 2K86A 1FPQA 4P9FA 2OZUA 2NNYA 5E8GA 4AIJA 5LHHA 1HW1A 3R61A 4Q5SF 3ZP5A 2QQAA 3E6BA 1MZBA 5FGMA 2FF4A 4RGSA 3L7WA 2W25A 2H09A 3S2WA 4UV8A 4L5IA 2LSOA 2P5VA 5BOXA 2CWEA 2EFOA 3V7RA 1JXSA 5F6FA 4EJWA 3KZZA 1T2KA 2Y48A 2W57A 5D6EA 2Y0MA 3HOSA 1G4DA 2PMHA 4NHJA 4UUVA 5D5XB 4XSZF 2JPBA 2HDCA 3P9IA 4ESJA 1TQMA 4M9ZA 5HLHA 5IT9K 2BE5F 4CDGA 3DV8A 5ICCA 3RYPA 2TDXA 2QUFA 2RNJA 4LFUA 4O5VA 1D8KA 1W7PB 2IP2A 5J8CA 1G3YA 5FLXZ 1TBXA 5HOOA 4TV7A 3WODF 2M87A 2M5WA 1XB4A 2DW4A 2QBYA 3RIRA 4RB3C 3HSFA 4IRIA 1QGPA 3TDUC 4IPAA 4I09A 5E1ZB 2HYFA 1HKTA 4A12A 3ZMVA 4KFCA 1H9TA 5DD4A 1QNTA 1FC3A 5JVTA 1MDMB 3BJ6A 3U1DA 3ERED 1R36A 3RDIA 3K2ZA 1I27A 3V8KA 1JGSA 2R3SA 3K69A 2E1CA 3HUGA 2D2WA 3JSPA 5J8FA 2M1BA 3E5QA 1KYWA 4G94A 5DCFA 4Z2YA 1BIBA 3K0LA 1GXQA 4CGZA 1HW5A 5BMZA 1V4RA 2QZ8A 4WCGA 2L4MA 3F8NA 3P7NA 4U0YA 1FNNA 1RUNA 4XLPF 2XAGA 1WWXA 1O3SA 4HW0A 3T8TA 3NRVA 3HRMA 2JPCA 3CJNA 3PQJA 2WC2A 3KP6A 1QZZA 2Z5UA 3O3KA 5D4RA 1FP2A 2DO7A 5AIQA 1BC8C 2OA4A 1V3FA 4KICA 4LLLA 4HLXA 4U88A 2O8XA 2Q8KA 4PCQA 3RPQA 1JHHA 5L3DA 3H3ZA 4WXDA 4OIPF 1S7OA 2LDUA 5K5QA 3N97A 4L18B 2QENA 4M71A 2XRNA 1VTNC 4G9YA 1GHCA 3DEUA 3ULQB 2DPUA 2V6CA 4G7HF 1AWCA 3VOEA 3E5UA 2GXBA 4OU0A 4BQAA 5FB2A 1X3UA 3JAMZ 1DUXC 3W6JB 1K78A 3FZVA 1OYWA 2F2EA 3WGHA 5D4SA 2EV6A 3EQLF 2QVOA 3WTXC 5LGTA 1XGMA 3CO7C 3R0AA 2Q2EA 2YSRA 4H0EA 5HDKA 4P55A 5JFRA 4Q47A 2PLYA 5HS7A 3GEZA 3COAC 5KVRA 1SAXA 1MJ9A 2OD5A 4FX4A 1BOAA 2UZKA 2VC0A 2EFWA 1P2FA 4I0AA 3IC7A 4MGRA 2DK5A 4MNUA 2DQLA 5L3EA 1H0MA 1SD4A 2HR3A 5LLQA 4MTDA 1R58A 1KGSA 2PFBA 4P96A 3MZYA 1O3RA 4RB2C 4UNOA 4A6DA 1ZG3A 3KCCA 4BAYA 2O6GE 1YG2A 4A5MA 3SZTA 5JI6A 3M9AA 2CG4A 2EV0A 1B4AA 4I7HA 3FXUA 1KQ8A 3H92A 5LRSA 2HOEA 1E17A 1KA8A 4A6EA 1W5TA 1EV7A 3C3WA 4KYWA 3V7CA 3CUOA 3K1NA 5DEQA 2ISZA 3JTGA 2ZMEA 4MEYF 1MKMA 3J81Z 5LGNA 4IRGA 1B9MA 5DDGA 1AOYA 1BBYA 2ZFWA 4A0ZA 3I59A 4P5OA 2BEOA 3DPTA 2VODA 3HIFA 4HBLA 3RPUA 3I58A 1U5TC 1P4AA 2ACJA 2P5LC 3T1BA 1R1TA 3M8EA 5LHIA 1ZN2A 2K7LA 1OMIA 4RB0A 2XUBA 2DT5A 4BXUA 1KQ9A 2PN6A 2DTRA 2FU4A 3GWZA 1QQIA 3U9GA 3IHUA 1U8RA 4YIIA 5F1RA 2L4AA 2RVCA 4M74A 2QQBA 5E20A 2VC1A 4EJUA 1ZYRF 1MJBA 3IL2A 2RN7A 1YTYA 3FWEA 2P6SA 1USTA 4IF4A 4B09A 3LQQA 4WF2A 4WX9A 5H20A 5LBQA 3TO6A 4ENKA 4M6XA 1IF1A 4PGGA 4ZZDA 3GYHX 4M9XA 1ZLKA 1BIAA 1IUYA 2ADUA 1MJAA 4GXOA 1P4XA 5DUIA 5CLSA 4KN4X 5AONA 3M7GA 3D5LA 1IW7F 4XLNF 5D6FA 3RKYA 2KRFA 2CSOA 3F3XA 1I1SA 3DXJF 4D0PA 2E7XA 3V4GA 1J9IA 3CUQA 2DLLA 1DP7P 4EJTA 3WTYC 4EMSA 3GZ6A 4R8HA 2GXGA 2JRTA 5CVUA 4F7ZA 1HBXG 3DF8A 3F6OA 2MLGA 3WU0A 5E17F 1T98A 3JTHA 4CZZA 1U5TB 1O7FA 3QOPA 1WKMA 3E3VA 4ZYGA 1YS6A 3T5XA 3L09A 2EA2A 2EV5A 2EFPA 1BI3A 5HS9A 4WWCA 3LWFA 2D1HA 4BHPA 2DK8A 1YW7A 3ROUA 2PQ8A 3KETA 2ZJ2A 4O6JA 2A07F 3GW2A 1Z6RA 3AAFA 4KIGA 1BJAA 3BJAA 2JZYA 4PZJA 4ESFA 1T6SA 2YX4A 2GWRA 3R0JA 2COMA 1STZA 1XN7A 4ZZLA 3EETA 4BHBA 1TTYA 4N9IA 4RGUA 2A69F 2V1UA 2K4BA 5JR3A 1IN7A 2W85A 3QP5A 3TOBA 3BJOA 3FM5A 4M6YA 5EEGA 4MQVA 5DCMA 2MLKA 2EWNA 2QBYB 2HTJA 2IA1A 4OIQF 4XRFA 1ZRDA 2M8EA 4XSXF 5KK1A 1O3TA 1FLIA 3M8FA 3F8MA 2FNPA 2V1DA 3KFWX 4HDVA 1FT9A 1W5SA 5LHGA 2OQGA 4G6DA 2VONA 2KJCA 3I71A 5FLXK 3RI4A 2D1VA 1J7KA 4LK1F 3ZMUA 2KKOA 2ZNYA 2IVMA 3JW4A 3D0SA 1FX7A 2DFIA 1R23A 2DAOA 4L0YB 3KE2A 4EJOA 4HDUA 5D8LB 3BP8A 1YIOA 2OQRA 4L9JA 2HS5A 1SMYF 4BHCA 5HLIA 2PI0A 2KIMA 1B6AA 2VOPA 1ULYA 2A3SA 2J5OA 4HOBA 4ZYHA 1R1UA 5HS8A 1Z91A 3I4PA 4Q48A 1LDDA 1NHAA 1SMTA 3WTWC 4BYYA 4LMYA 3RYRA 5L3GA 1IN6A 3F8CA 3FMSA 3WE2A 3O6BB 2XAJA 2XV4S 1TNSA 4ZH4F 3FMRA 1IRGA 1EH7A 3FF5A 1K7AA 5FD5A 2HQNA 2B0LA 2NS0A 3ELKA 4GYIA 1R00A 2G7UA 1ZG1A 2A5YB 3LAPA 2ZXJA 4GO1A 1KQ0A 3RKXA 4KMUX 2FA5A 5BS6A 1J59A 4CXFA 5J6XA 3WTTC 3L00A 1F9NA 2VOOA 3NQOA 2C6YA 3SZPA 1W7PA 3ZMZA 4ENJA 2A6HF 5JHUA 3GVAA 3ZMTA 2O3FA 4L9TA 2O0YA 1YLFA 3KP3A 3BY6A 2BV6A 1USSA 4ENNA 3WTZA 4CICA 1BI0A 6PAXA 3F6VA 1GVJA 2VT2A 4DNCA 2Z3YA 3CUQC 3F8BA 2LNBA 2XAHA 4Y15A 4KA4A 1ZRCA 2IPQX 2QQ9A 1PP8F 4FT8A 4HZFA 3MEXA 1ON1A 4RAYA 1J5YA 2L3DA 1XCBA 2YR2A 3E6DA 3L9FA 2K4JA 2H27A 5CVJA 4QWQA 1XGSA 1H9GA 3HRSA 3ZMSA 4HX7A 2GZWA 4K2EA 2RGVA 4WXCA 1WI9A 4A0YA 1FY7A 3LA2A 4EM0B 1G6NA 2W84A 3TGNA 1J75A 2GA2A 2EFNA 2H6BA 2O61A 3SFZA 3IRRA 1TW2A 5ILVA 2FBIA 2W24A 5IT9Z 2LF8A 4IRHA 3CTAA 1RUOA 1I1GA 5D5UB 4OMYA 1SD6A 4E70A 5K1YA 2OBPA 1T39A 1Z1DA 4HX8A 1HSJA 1YQAA 3ABTA 1O7LA 1SD7A 1CGPA 3VFZA 3GFLA 3ECOA 2ISYA 4LD5A 2OU2A 3KZYA 3EDPA 4L0ZB 4FX0A 5K5RA 1TW3A 1ON2A 2VT3A 3MCZA 4MQ9F 1KU2A 2FOKA 4R1HA 3HRUA 2CQKA 5E8IA 1ZREA 3J80Z 1P92A 2NNNA 4A2UA 2QLZA 3P9KA 2LF7A 2MA3A 2CO5A 1OYYA 4XBFA 5IT3A 4I0BA 4Q4ZF 1LNWA 2Q0OA 1CF7A 3DQVC 1K78B 3I0TA 2EA4A 1EH6A 1FBSA 5DD8A 1QPMA 5L3CA 3LA3A 1FYKA 2ESHA 4U7BA 2GIVA 4P9UA 3VODA 2BGCA 3Q5FA 2J5PA 3CUQB 4RGXA 1T0FA 4ESBA 1J2XA 1Q1HA 1ZH5A 5L3BA 4QLCU 3LQRA 3E6MA 4LK0F 1TQPA 1HSTA 1DPUA 3HSRA 1HKQA 5E1WA 2RDPA 1BI1A 3QU3A 3TKYA 5EEHA 2JT1A 2NRAC 1IZ1A 1T38A 1FWZA 1U5TA 2YPRA 3KEQA 4LJZF 3IKVA 3VB2A 2H6CA 2VN2A 1BM9A 2CFXA 2L54A 5ICGA 4HF0A 4EV0A 1XSVA 4G6QA 4JQFA 1G3TA 3TDZC 2F5FA 2DBBA 3FXRA 3BPXA 1S8NA 5FFXA 3OV8A 2XHKA 4HLYA 2XAFA 2ELHA 3WTSC 3KLNA 4HV6A 2H94A 4AD9A 4Y17A 1JHFA 2XVCA 5LRRA 2JTVA 1YS7A 1HXDA 5DUKA 1OR7A 4MHGA 2VBXA 2QYOA 1L3LA 3HHHA 3E6CC 2DPDA 1REPC 2P7VB 3GXOA 4IJAA 3K9TA 4LG0A 1CF7B 1PDNC 3GF2A 1FBQA 5TRDA 2DU9A 3PQKA 3SXYA 4G7OF 1HW2A 3WGGA 1IXRC 4EGZA 1G3WA 1XDUA 4EM1A 4HX4A 1C0WA 3CDHA 4B8XA 3I64A 2PJPA 4KDPA 1XGNA 4ZYDA 3OOPA 1S7AA 2ETHA 2CW0F 2RV8A 3M1EA 4HV5A 2V9VA 2HYGD 2AS5F 1RI7A 1IN8A 1KU9A 3RJPA 3SHFA 1ONVA 1LQ1A 2ZMEB 5ERIA 1GXPA 1IXSB 2Y75A 3RKWA 2P8TA 4EVIA 2KIUA 3KLOA 3ZN1A 3TQNA 4UVCA 1WSUA 4FHTA 2MC3A 3U2RA 2MBFA 3HOTA 3KP7A 3N4MA 1IAWA 2EJRA 4GCVA 3WTVC 2ZKZA 4L5JA 1IN5A 4UVAA 4NB5A 4EJVA 1WRJA 2IW5A 4M73A 3GFIA 3JAMK 2FSWA 3ZN0A 2ESNA 2A61A 4HA8A 2HEOA 2X4HA 2FMLA 1HKSA 2M45A 2RC4A 2XKOA 2AXLA 3KP5A 4ETSA 4CHUA 4R79A 3E97A 4KT5C 1XDSA 3DP7A 4IXAA 3IWFA 2OAZA 1U3EM 1HQCA 3LSTA 3F8FA 3IWZA 4IHTA 2FEZA 1S6LA 1OKRA 2F5EA 5ED4A 4MEXF 2OZ6A 5DV5A 3ZPLA 3FM3A 1P6RA 4N9HA 2VXZA 2Z99A 3J7AO 3GO5A 1K79A 3B73A 1U78A 4PGHA 1U6GA 4OMZA 3P9CA 3T8RA 3EYYA 4ON0A 2VBZA 2HQRA 1G3SA 2FNAA 2RQPA 2VE9A 3CO6C 4GYGA 2BBYA 1YW8A 1XD7A 2HGCA 1D5VA 3GUDA 1UB9A 1B59A 2KIFA 4ASNA 1R22A 4YFXF 5DYMA 4A0XA 3ZMDA 3LA7A 2V1XA 5D5VB 4HQMA 3FX3A 1SFUA 2CGPA 4HAMA 4BH9A 1ODDA 4O3MA 2A6EF 4M9SA 4UV9A 1O57A 5E1XA 3BWGA 5CVVA 2IA0A 5LEJA 3DKWA 3V8LA 1F5TA 1W7PD 4LLGF 5LGUA 3GFMA 4U0WA 3EYIA 3RTRA 2G7HA 1FP1D 2FBHA 1UCRA 1Z05A 4I2OA 3I54A 2WV0A 1XMAA 2UXXA 3LAJA 2IRFG 2GQQA 1YYVA 1F1ZA 1ZGJA 3MWMA 1DDNA 3LFKA 4U7DA 3DPLC 1LEAA 3WTUC 3QPTA 1LB2A 3MQ0A 1BC7C 4EQQA 5E18F 1ZGAA 5LEKA 1W4MA 1QBJA 1LDKB 1MGTA 1F4KA 3QU6A 4NQWA 1Y0UA 5DCMB 1S3JA 2FRHA 3BPVA 4RS8A 3QRFF 1TQIA 5ICFA 1DPRA 2ZCWA 2ZO4A 1OYIA 1S29A 2KJBA 4OIOF 5H6RA 2HTSA 3WU1B 1XSDA 4G7ZF 1FSEA 1FZPB 4YG2F 5CVRA 2GAUA 2STTA 2QWWA 4CO8A 4KNYA 3F21A 1OPCA 3ABUA 3BOQA 2PG4A 4YFNF 5ILSA 2ZNZA 3J81K 2R7DA 4I01A 3IKTA 5HVQC 2L01A 4PDKA 2NAZA 2E7WA 1E2XA 1U2WA 3QAHA 2IA2A 2V79A 1O3QA 2XKPA 1ZG5A 2D45A 1LVAA 2HKOA 4RGRA 4JK1X 1RNLA 1MDMA 3ML6A 4HF2A 1B9NA 1R5GA 1FYLA 1YFHA 3K1PA 4A5NA 3FMQA 2VBWA 3FXQA 2G9WA 3QP6A 1TNTA 1XCVA 2UXNA 3K1MA 5HLGA 4KN7X 4AIHA 3F23A 1Z6TA 2M30A 2FQ3A 2UWMA 2PEXA 2Z9OA 3HTSB 3DFGA 2FXAA 2EFQA 5AIPA 3R6SA 1KU3A 3GFJA 2PMUA 2IJLA 4OINF 3F72A 3NEUA 4MTEA 4IHSA 1QO0D 3F22A 2DQRA 3WG9A 2F5CA 3MAJA 2GA1A 3GX4X 3T0YA 4Y13A 1Z9CA 3HYIA 3BROA 1XSXA 1FOKA 1LEBA 3VEPA 2QM3A 3MZHA 1D3YA 2JSCA 4AIKA 4UHTA 1I6XA 2MH9A 3C1DA 2Z33A 4WK8F 1RIOH 2MD5A 4RAZA 3Q9SA 2XIGA 5A2QZ 1ZARA 3TO7A 2BYVE 4DQ2A 2WWYA 2FBKA 2L02A 1IRFA 4KIFA 4RB1A 4LLNA 1FYMA 1LDJA 2E1NA 2K02A 2O03A 3IRQA 2P6TA 2PBIA 4CYDA 1QZYA 2EB7A 5CVIA 2HWVA 5D5WB 3E5XA 2STWA 1TLHB 5H6QA 5HDNA 1XMKA 3C7JA 3WGIA 3MFKA 1ZAOA 2FMYA 3REOA 5CJ9A 2RKHA 1UFMA 2ZBKA 3I5UA 3G73A 4LB6B 1R7JA 1J0RA 5L3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXN A;  2XAS A;  2X0L A;  3BZ6 A;  1SFX A;  5FO5 A;  5A2Q K;  4LG0 B;  1D8J A;  1PP7 U;  1IXC A;  1ZHF A;  1JE8 A;  1Z7U A;  1P4W A;  1WQ2 A;  3GLX A;  4AWX B;  1MD0 A;  4EGY A;  3J80 K;  3ECH A;  1FSH A;  1UHW A;  4YFK F;  2XGX A;  1A04 A;  3V8J A;  2K27 A;  3R60 A;  2P7C B;  1PUE E;  4I98 B;  2P5K A;  4M72 A;  1R1V A;  1SD5 A;  1EH8 A;  1K6O A;  5TJJ A;  3I59 B;  3C18 A;  4ZYE A;  1XGO A;  4OIR F;  2XRO A;  3G3Z A;  4I02 A;  1ZRF A;  5BPD A;  1UHM A;  2A68 F;  4LB5 A;  2F5D A;  1LJ9 A;  3GZ5 A;  5BPI A;  3KEO A;  5K5O A;  2R7F A;  4LGW A;  3WE3 A;  3I53 A;  3H3U A;  1YO5 C;  1KU7 A;  4KUM A;  4YIF A;  2VBY A;  3TOA A;  2CYY A;  5D8K B;  4KIB A;  2HZT A;  3B02 A;  1BN5 A;  3PFI A;  3ZQ7 A;  3HRT A;  5ILU A;  1FBU A;  2VE8 A;  4ENM A;  4L9V A;  3FHZ A;  5HDG A;  4EM2 A;  4OOI A;  5FFZ A;  2YX7 A;  3KP4 A;  3SQN A;  4HQE A;  4S04 A;  3TO9 A;  1YW9 A;  4BNC A;  1R5H A;  1IN4 A;  4KMF A;  1L0O C;  5F64 A;  2FE3 A;  4N0B A;  1ZLJ A;  3O2P E;  3W6K B;  4GGG A;  3KP2 A;  1RZ4 A;  2YU3 A;  2HKX A;  3QPH A;  1SFE A;  4L9N A;  3R4K A;  3HTU A;  5BQT A;  4G8X A;  2LKP A;  2EK5 A;  5ICE A;  3HSE A;  4U0V A;  2MH2 A;  4UVB A;  2XAQ A;  5CYV A;  3Q9V A;  3L2C A;  4JBA A;  5FD6 A;  3BDD A;  3ISP A;  4WXH A;  2NYX A;  3CLO A;  2DI3 A;  3HHG A;  1KYZ A;  4S05 A;  1B1B A;  4AVP A;  2P4W A;  3EUH A;  3V7S A;  4IVN A;  2HFH A;  3JSO A;  1BI2 A;  2IT0 A;  4HF1 A;  4HYE A;  1I5Z A;  2WTE A;  2K86 A;  1FPQ A;  4P9F A;  2OZU A;  2NNY A;  5E8G A;  4AIJ A;  5LHH A;  1HW1 A;  3R61 A;  4Q5S F;  3ZP5 A;  2QQA A;  3E6B A;  1MZB A;  5FGM A;  2FF4 A;  4RGS A;  3L7W A;  2W25 A;  2H09 A;  3S2W A;  4UV8 A;  4L5I A;  2LSO A;  2P5V A;  5BOX A;  2CWE A;  2EFO A;  3V7R A;  1JXS A;  5F6F A;  4EJW A;  3KZZ A;  1T2K A;  2Y48 A;  2W57 A;  5D6E A;  2Y0M A;  3HOS A;  1G4D A;  2PMH A;  4NHJ A;  4UUV A;  5D5X B;  4XSZ F;  2JPB A;  2HDC A;  3P9I A;  4ESJ A;  1TQM A;  4M9Z A;  5HLH A;  5IT9 K;  2BE5 F;  4CDG A;  3DV8 A;  5ICC A;  3RYP A;  2TDX A;  2QUF A;  2RNJ A;  4LFU A;  4O5V A;  1D8K A;  1W7P B;  2IP2 A;  5J8C A;  1G3Y A;  5FLX Z;  1TBX A;  5HOO A;  4TV7 A;  3WOD F;  2M87 A;  2M5W A;  1XB4 A;  2DW4 A;  2QBY A;  3RIR A;  4RB3 C;  3HSF A;  4IRI A;  1QGP A;  3TDU C;  4IPA A;  4I09 A;  5E1Z B;  2HYF A;  1HKT A;  4A12 A;  3ZMV A;  4KFC A;  1H9T A;  5DD4 A;  1QNT A;  1FC3 A;  5JVT A;  1MDM B;  3BJ6 A;  3U1D A;  3ERE D;  1R36 A;  3RDI A;  3K2Z A;  1I27 A;  3V8K A;  1JGS A;  2R3S A;  3K69 A;  2E1C A;  3HUG A;  2D2W A;  3JSP A;  5J8F A;  2M1B A;  3E5Q A;  1KYW A;  4G94 A;  5DCF A;  4Z2Y A;  1BIB A;  3K0L A;  1GXQ A;  4CGZ A;  1HW5 A;  5BMZ A;  1V4R A;  2QZ8 A;  4WCG A;  2L4M A;  3F8N A;  3P7N A;  4U0Y A;  1FNN A;  1RUN A;  4XLP F;  2XAG A;  1WWX A;  1O3S A;  4HW0 A;  3T8T A;  3NRV A;  3HRM A;  2JPC A;  3CJN A;  3PQJ A;  2WC2 A;  3KP6 A;  1QZZ A;  2Z5U A;  3O3K A;  5D4R A;  1FP2 A;  2DO7 A;  5AIQ A;  1BC8 C;  2OA4 A;  1V3F A;  4KIC A;  4LLL A;  4HLX A;  4U88 A;  2O8X A;  2Q8K A;  4PCQ A;  3RPQ A;  1JHH A;  5L3D A;  3H3Z A;  4WXD A;  4OIP F;  1S7O A;  2LDU A;  5K5Q A;  3N97 A;  4L18 B;  2QEN A;  4M71 A;  2XRN A;  1VTN C;  4G9Y A;  1GHC A;  3DEU A;  3ULQ B;  2DPU A;  2V6C A;  4G7H F;  1AWC A;  3VOE A;  3E5U A;  2GXB A;  4OU0 A;  4BQA A;  5FB2 A;  1X3U A;  3JAM Z;  1DUX C;  3W6J B;  1K78 A;  3FZV A;  1OYW A;  2F2E A;  3WGH A;  5D4S A;  2EV6 A;  3EQL F;  2QVO A;  3WTX C;  5LGT A;  1XGM A;  3CO7 C;  3R0A A;  2Q2E A;  2YSR A;  4H0E A;  5HDK A;  4P55 A;  5JFR A;  4Q47 A;  2PLY A;  5HS7 A;  3GEZ A;  3COA C;  5KVR A;  1SAX A;  1MJ9 A;  2OD5 A;  4FX4 A;  1BOA A;  2UZK A;  2VC0 A;  2EFW A;  1P2F A;  4I0A A;  3IC7 A;  4MGR A;  2DK5 A;  4MNU A;  2DQL A;  5L3E A;  1H0M A;  1SD4 A;  2HR3 A;  5LLQ A;  4MTD A;  1R58 A;  1KGS A;  2PFB A;  4P96 A;  3MZY A;  1O3R A;  4RB2 C;  4UNO A;  4A6D A;  1ZG3 A;  3KCC A;  4BAY A;  2O6G E;  1YG2 A;  4A5M A;  3SZT A;  5JI6 A;  3M9A A;  2CG4 A;  2EV0 A;  1B4A A;  4I7H A;  3FXU A;  1KQ8 A;  3H92 A;  5LRS A;  2HOE A;  1E17 A;  1KA8 A;  4A6E A;  1W5T A;  1EV7 A;  3C3W A;  4KYW A;  3V7C A;  3CUO A;  3K1N A;  5DEQ A;  2ISZ A;  3JTG A;  2ZME A;  4MEY F;  1MKM A;  3J81 Z;  5LGN A;  4IRG A;  1B9M A;  5DDG A;  1AOY A;  1BBY A;  2ZFW A;  4A0Z A;  3I59 A;  4P5O A;  2BEO A;  3DPT A;  2VOD A;  3HIF A;  4HBL A;  3RPU A;  3I58 A;  1U5T C;  1P4A A;  2ACJ A;  2P5L C;  3T1B A;  1R1T A;  3M8E A;  5LHI A;  1ZN2 A;  2K7L A;  1OMI A;  4RB0 A;  2XUB A;  2DT5 A;  4BXU A;  1KQ9 A;  2PN6 A;  2DTR A;  2FU4 A;  3GWZ A;  1QQI A;  3U9G A;  3IHU A;  1U8R A;  4YII A;  5F1R A;  2L4A A;  2RVC A;  4M74 A;  2QQB A;  5E20 A;  2VC1 A;  4EJU A;  1ZYR F;  1MJB A;  3IL2 A;  2RN7 A;  1YTY A;  3FWE A;  2P6S A;  1UST A;  4IF4 A;  4B09 A;  3LQQ A;  4WF2 A;  4WX9 A;  5H20 A;  5LBQ A;  3TO6 A;  4ENK A;  4M6X A;  1IF1 A;  4PGG A;  4ZZD A;  3GYH X;  4M9X A;  1ZLK A;  1BIA A;  1IUY A;  2ADU A;  1MJA A;  4GXO A;  1P4X A;  5DUI A;  5CLS A;  4KN4 X;  5AON A;  3M7G A;  3D5L A;  1IW7 F;  4XLN F;  5D6F A;  3RKY A;  2KRF A;  2CSO A;  3F3X A;  1I1S A;  3DXJ F;  4D0P A;  2E7X A;  3V4G A;  1J9I A;  3CUQ A;  2DLL A;  1DP7 P;  4EJT A;  3WTY C;  4EMS A;  3GZ6 A;  4R8H A;  2GXG A;  2JRT A;  5CVU A;  4F7Z A;  1HBX G;  3DF8 A;  3F6O A;  2MLG A;  3WU0 A;  5E17 F;  1T98 A;  3JTH A;  4CZZ A;  1U5T B;  1O7F A;  3QOP A;  1WKM A;  3E3V A;  4ZYG A;  1YS6 A;  3T5X A;  3L09 A;  2EA2 A;  2EV5 A;  2EFP A;  1BI3 A;  5HS9 A;  4WWC A;  3LWF A;  2D1H A;  4BHP A;  2DK8 A;  1YW7 A;  3ROU A;  2PQ8 A;  3KET A;  2ZJ2 A;  4O6J A;  2A07 F;  3GW2 A;  1Z6R A;  3AAF A;  4KIG A;  1BJA A;  3BJA A;  2JZY A;  4PZJ A;  4ESF A;  1T6S A;  2YX4 A;  2GWR A;  3R0J A;  2COM A;  1STZ A;  1XN7 A;  4ZZL A;  3EET A;  4BHB A;  1TTY A;  4N9I A;  4RGU A;  2A69 F;  2V1U A;  2K4B A;  5JR3 A;  1IN7 A;  2W85 A;  3QP5 A;  3TOB A;  3BJO A;  3FM5 A;  4M6Y A;  5EEG A;  4MQV A;  5DCM A;  2MLK A;  2EWN A;  2QBY B;  2HTJ A;  2IA1 A;  4OIQ F;  4XRF A;  1ZRD A;  2M8E A;  4XSX F;  5KK1 A;  1O3T A;  1FLI A;  3M8F A;  3F8M A;  2FNP A;  2V1D A;  3KFW X;  4HDV A;  1FT9 A;  1W5S A;  5LHG A;  2OQG A;  4G6D A;  2VON A;  2KJC A;  3I71 A;  5FLX K;  3RI4 A;  2D1V A;  1J7K A;  4LK1 F;  3ZMU A;  2KKO A;  2ZNY A;  2IVM A;  3JW4 A;  3D0S A;  1FX7 A;  2DFI A;  1R23 A;  2DAO A;  4L0Y B;  3KE2 A;  4EJO A;  4HDU A;  5D8L B;  3BP8 A;  1YIO A;  2OQR A;  4L9J A;  2HS5 A;  1SMY F;  4BHC A;  5HLI A;  2PI0 A;  2KIM A;  1B6A A;  2VOP A;  1ULY A;  2A3S A;  2J5O A;  4HOB A;  4ZYH A;  1R1U A;  5HS8 A;  1Z91 A;  3I4P A;  4Q48 A;  1LDD A;  1NHA A;  1SMT A;  3WTW C;  4BYY A;  4LMY A;  3RYR A;  5L3G A;  1IN6 A;  3F8C A;  3FMS A;  3WE2 A;  3O6B B;  2XAJ A;  2XV4 S;  1TNS A;  4ZH4 F;  3FMR A;  1IRG A;  1EH7 A;  3FF5 A;  1K7A A;  5FD5 A;  2HQN A;  2B0L A;  2NS0 A;  3ELK A;  4GYI A;  1R00 A;  2G7U A;  1ZG1 A;  2A5Y B;  3LAP A;  2ZXJ A;  4GO1 A;  1KQ0 A;  3RKX A;  4KMU X;  2FA5 A;  5BS6 A;  1J59 A;  4CXF A;  5J6X A;  3WTT C;  3L00 A;  1F9N A;  2VOO A;  3NQO A;  2C6Y A;  3SZP A;  1W7P A;  3ZMZ A;  4ENJ A;  2A6H F;  5JHU A;  3GVA A;  3ZMT A;  2O3F A;  4L9T A;  2O0Y A;  1YLF A;  3KP3 A;  3BY6 A;  2BV6 A;  1USS A;  4ENN A;  3WTZ A;  4CIC A;  1BI0 A;  6PAX A;  3F6V A;  1GVJ A;  2VT2 A;  4DNC A;  2Z3Y A;  3CUQ C;  3F8B A;  2LNB A;  2XAH A;  4Y15 A;  4KA4 A;  1ZRC A;  2IPQ X;  2QQ9 A;  1PP8 F;  4FT8 A;  4HZF A;  3MEX A;  1ON1 A;  4RAY A;  1J5Y A;  2L3D A;  1XCB A;  2YR2 A;  3E6D A;  3L9F A;  2K4J A;  2H27 A;  5CVJ A;  4QWQ A;  1XGS A;  1H9G A;  3HRS A;  3ZMS A;  4HX7 A;  2GZW A;  4K2E A;  2RGV A;  4WXC A;  1WI9 A;  4A0Y A;  1FY7 A;  3LA2 A;  4EM0 B;  1G6N A;  2W84 A;  3TGN A;  1J75 A;  2GA2 A;  2EFN A;  2H6B A;  2O61 A;  3SFZ A;  3IRR A;  1TW2 A;  5ILV A;  2FBI A;  2W24 A;  5IT9 Z;  2LF8 A;  4IRH A;  3CTA A;  1RUO A;  1I1G A;  5D5U B;  4OMY A;  1SD6 A;  4E70 A;  5K1Y A;  2OBP A;  1T39 A;  1Z1D A;  4HX8 A;  1HSJ A;  1YQA A;  3ABT A;  1O7L A;  1SD7 A;  1CGP A;  3VFZ A;  3GFL A;  3ECO A;  2ISY A;  4LD5 A;  2OU2 A;  3KZY A;  3EDP A;  4L0Z B;  4FX0 A;  5K5R A;  1TW3 A;  1ON2 A;  2VT3 A;  3MCZ A;  4MQ9 F;  1KU2 A;  2FOK A;  4R1H A;  3HRU A;  2CQK A;  5E8I A;  1ZRE A;  3J80 Z;  1P92 A;  2NNN A;  4A2U A;  2QLZ A;  3P9K A;  2LF7 A;  2MA3 A;  2CO5 A;  1OYY A;  4XBF A;  5IT3 A;  4I0B A;  4Q4Z F;  1LNW A;  2Q0O A;  1CF7 A;  3DQV C;  1K78 B;  3I0T A;  2EA4 A;  1EH6 A;  1FBS A;  5DD8 A;  1QPM A;  5L3C A;  3LA3 A;  1FYK A;  2ESH A;  4U7B A;  2GIV A;  4P9U A;  3VOD A;  2BGC A;  3Q5F A;  2J5P A;  3CUQ B;  4RGX A;  1T0F A;  4ESB A;  1J2X A;  1Q1H A;  1ZH5 A;  5L3B A;  4QLC U;  3LQR A;  3E6M A;  4LK0 F;  1TQP A;  1HST A;  1DPU A;  3HSR A;  1HKQ A;  5E1W A;  2RDP A;  1BI1 A;  3QU3 A;  3TKY A;  5EEH A;  2JT1 A;  2NRA C;  1IZ1 A;  1T38 A;  1FWZ A;  1U5T A;  2YPR A;  3KEQ A;  4LJZ F;  3IKV A;  3VB2 A;  2H6C A;  2VN2 A;  1BM9 A;  2CFX A;  2L54 A;  5ICG A;  4HF0 A;  4EV0 A;  1XSV A;  4G6Q A;  4JQF A;  1G3T A;  3TDZ C;  2F5F A;  2DBB A;  3FXR A;  3BPX A;  1S8N A;  5FFX A;  3OV8 A;  2XHK A;  4HLY A;  2XAF A;  2ELH A;  3WTS C;  3KLN A;  4HV6 A;  2H94 A;  4AD9 A;  4Y17 A;  1JHF A;  2XVC A;  5LRR A;  2JTV A;  1YS7 A;  1HXD A;  5DUK A;  1OR7 A;  4MHG A;  2VBX A;  2QYO A;  1L3L A;  3HHH A;  3E6C C;  2DPD A;  1REP C;  2P7V B;  3GXO A;  4IJA A;  3K9T A;  4LG0 A;  1CF7 B;  1PDN C;  3GF2 A;  1FBQ A;  5TRD A;  2DU9 A;  3PQK A;  3SXY A;  4G7O F;  1HW2 A;  3WGG A;  1IXR C;  4EGZ A;  1G3W A;  1XDU A;  4EM1 A;  4HX4 A;  1C0W A;  3CDH A;  4B8X A;  3I64 A;  2PJP A;  4KDP A;  1XGN A;  4ZYD A;  3OOP A;  1S7A A;  2ETH A;  2CW0 F;  2RV8 A;  3M1E A;  4HV5 A;  2V9V A;  2HYG D;  2AS5 F;  1RI7 A;  1IN8 A;  1KU9 A;  3RJP A;  3SHF A;  1ONV A;  1LQ1 A;  2ZME B;  5ERI A;  1GXP A;  1IXS B;  2Y75 A;  3RKW A;  2P8T A;  4EVI A;  2KIU A;  3KLO A;  3ZN1 A;  3TQN A;  4UVC A;  1WSU A;  4FHT A;  2MC3 A;  3U2R A;  2MBF A;  3HOT A;  3KP7 A;  3N4M A;  1IAW A;  2EJR A;  4GCV A;  3WTV C;  2ZKZ A;  4L5J A;  1IN5 A;  4UVA A;  4NB5 A;  4EJV A;  1WRJ A;  2IW5 A;  4M73 A;  3GFI A;  3JAM K;  2FSW A;  3ZN0 A;  2ESN A;  2A61 A;  4HA8 A;  2HEO A;  2X4H A;  2FML A;  1HKS A;  2M45 A;  2RC4 A;  2XKO A;  2AXL A;  3KP5 A;  4ETS A;  4CHU A;  4R79 A;  3E97 A;  4KT5 C;  1XDS A;  3DP7 A;  4IXA A;  3IWF A;  2OAZ A;  1U3E M;  1HQC A;  3LST A;  3F8F A;  3IWZ A;  4IHT A;  2FEZ A;  1S6L A;  1OKR A;  2F5E A;  5ED4 A;  4MEX F;  2OZ6 A;  5DV5 A;  3ZPL A;  3FM3 A;  1P6R A;  4N9H A;  2VXZ A;  2Z99 A;  3J7A O;  3GO5 A;  1K79 A;  3B73 A;  1U78 A;  4PGH A;  1U6G A;  4OMZ A;  3P9C A;  3T8R A;  3EYY A;  4ON0 A;  2VBZ A;  2HQR A;  1G3S A;  2FNA A;  2RQP A;  2VE9 A;  3CO6 C;  4GYG A;  2BBY A;  1YW8 A;  1XD7 A;  2HGC A;  1D5V A;  3GUD A;  1UB9 A;  1B59 A;  2KIF A;  4ASN A;  1R22 A;  4YFX F;  5DYM A;  4A0X A;  3ZMD A;  3LA7 A;  2V1X A;  5D5V B;  4HQM A;  3FX3 A;  1SFU A;  2CGP A;  4HAM A;  4BH9 A;  1ODD A;  4O3M A;  2A6E F;  4M9S A;  4UV9 A;  1O57 A;  5E1X A;  3BWG A;  5CVV A;  2IA0 A;  5LEJ A;  3DKW A;  3V8L A;  1F5T A;  1W7P D;  4LLG F;  5LGU A;  3GFM A;  4U0W A;  3EYI A;  3RTR A;  2G7H A;  1FP1 D;  2FBH A;  1UCR A;  1Z05 A;  4I2O A;  3I54 A;  2WV0 A;  1XMA A;  2UXX A;  3LAJ A;  2IRF G;  2GQQ A;  1YYV A;  1F1Z A;  1ZGJ A;  3MWM A;  1DDN A;  3LFK A;  4U7D A;  3DPL C;  1LEA A;  3WTU C;  3QPT A;  1LB2 A;  3MQ0 A;  1BC7 C;  4EQQ A;  5E18 F;  1ZGA A;  5LEK A;  1W4M A;  1QBJ A;  1LDK B;  1MGT A;  1F4K A;  3QU6 A;  4NQW A;  1Y0U A;  5DCM B;  1S3J A;  2FRH A;  3BPV A;  4RS8 A;  3QRF F;  1TQI A;  5ICF A;  1DPR A;  2ZCW A;  2ZO4 A;  1OYI A;  1S29 A;  2KJB A;  4OIO F;  5H6R A;  2HTS A;  3WU1 B;  1XSD A;  4G7Z F;  1FSE A;  1FZP B;  4YG2 F;  5CVR A;  2GAU A;  2STT A;  2QWW A;  4CO8 A;  4KNY A;  3F21 A;  1OPC A;  3ABU A;  3BOQ A;  2PG4 A;  4YFN F;  5ILS A;  2ZNZ A;  3J81 K;  2R7D A;  4I01 A;  3IKT A;  5HVQ C;  2L01 A;  4PDK A;  2NAZ A;  2E7W A;  1E2X A;  1U2W A;  3QAH A;  2IA2 A;  2V79 A;  1O3Q A;  2XKP A;  1ZG5 A;  2D45 A;  1LVA A;  2HKO A;  4RGR A;  4JK1 X;  1RNL A;  1MDM A;  3ML6 A;  4HF2 A;  1B9N A;  1R5G A;  1FYL A;  1YFH A;  3K1P A;  4A5N A;  3FMQ A;  2VBW A;  3FXQ A;  2G9W A;  3QP6 A;  1TNT A;  1XCV A;  2UXN A;  3K1M A;  5HLG A;  4KN7 X;  4AIH A;  3F23 A;  1Z6T A;  2M30 A;  2FQ3 A;  2UWM A;  2PEX A;  2Z9O A;  3HTS B;  3DFG A;  2FXA A;  2EFQ A;  5AIP A;  3R6S A;  1KU3 A;  3GFJ A;  2PMU A;  2IJL A;  4OIN F;  3F72 A;  3NEU A;  4MTE A;  4IHS A;  1QO0 D;  3F22 A;  2DQR A;  3WG9 A;  2F5C A;  3MAJ A;  2GA1 A;  3GX4 X;  3T0Y A;  4Y13 A;  1Z9C A;  3HYI A;  3BRO A;  1XSX A;  1FOK A;  1LEB A;  3VEP A;  2QM3 A;  3MZH A;  1D3Y A;  2JSC A;  4AIK A;  4UHT A;  1I6X A;  2MH9 A;  3C1D A;  2Z33 A;  4WK8 F;  1RIO H;  2MD5 A;  4RAZ A;  3Q9S A;  2XIG A;  5A2Q Z;  1ZAR A;  3TO7 A;  2BYV E;  4DQ2 A;  2WWY A;  2FBK A;  2L02 A;  1IRF A;  4KIF A;  4RB1 A;  4LLN A;  1FYM A;  1LDJ A;  2E1N A;  2K02 A;  2O03 A;  3IRQ A;  2P6T A;  2PBI A;  4CYD A;  1QZY A;  2EB7 A;  5CVI A;  2HWV A;  5D5W B;  3E5X A;  2STW A;  1TLH B;  5H6Q A;  5HDN A;  1XMK A;  3C7J A;  3WGI A;  3MFK A;  1ZAO A;  2FMY A;  3REO A;  5CJ9 A;  2RKH A;  1UFM A;  2ZBK A;  3I5U A;  3G73 A;  4LB6 B;  1R7J A;  1J0R A;  5L3F A; 
#chains in the Genus database with same CATH topology
 4UXN A;  2XAS A;  2X0L A;  3BZ6 A;  4DGW B;  3FIS A;  2KLO A;  4N4N B;  1SFX A;  5FO5 A;  4PJ0 C;  5A2Q K;  1TP4 A;  3SEQ A;  4LG0 B;  1D8J A;  2IAI A;  1PP7 U;  5C3E J;  3BG6 A;  3E1S A;  4HNT A;  1YX5 A;  1IXC A;  4ZDO A;  1ZHF A;  3I56 I;  1JE8 A;  3TL4 X;  1Z7U A;  1P4W A;  4FQG A;  1RRJ A;  2I8D A;  3OOU A;  2LD5 A;  4RM2 A;  1WQ2 A;  5LD2 C;  2X1D A;  2R0Q C;  3U1K A;  5FKO A;  4MO7 A;  3GLX A;  3SZG A;  1F36 A;  4AWX B;  1MD0 A;  4EGY A;  5GPA A;  3MKL A;  4UUS A;  2MSY A;  3J80 K;  3IAM 2;  3ECH A;  1FSH A;  4EAT A;  1UHW A;  5GTI C;  4B44 A;  2XGX A;  4YFK F;  1A04 A;  4II2 A;  3V8J A;  4PSW A;  2K27 A;  3OYL A;  2DMP A;  4CYC B;  1XMX A;  1K83 J;  3IH2 A;  1D0Z A;  2M34 A;  3JCU C;  3ASO H;  4J01 A;  3R60 A;  3CES A;  2P7C B;  1FTT A;  1PUE E;  1YJN I;  3ZQL A;  4I98 B;  1A35 A;  2P5K A;  4M72 A;  1R1V A;  1ZR2 A;  1SD5 A;  3M3Y J;  2OJE D;  1R5I D;  4JP0 A;  2QGU A;  1EH8 A;  2JQ7 A;  3HJE A;  1HF0 A;  1K6O A;  3BR0 A;  4IQ4 A;  5TJJ A;  3G71 I;  3I59 B;  5GP9 A;  3C18 A;  3L2V A;  3ASN H;  4ZYE A;  1X1C A;  1XGO A;  4CUG A;  4OIR F;  2XRO A;  3G3Z A;  4I02 A;  3BZK A;  5BPD A;  1VQ7 I;  1UHM A;  1ZRF A;  2A68 F;  4GFB A;  9ANT A;  4LB5 A;  4U87 A;  2F5D A;  1LJ9 A;  3G6E I;  2H1K A;  3GZ5 A;  3WG7 H;  5BPI A;  3KEO A;  5K5O A;  2LFB A;  2R7F A;  4XID A;  3OMY A;  4LGW A;  4PJL A;  3WE3 A;  3I53 A;  3H3U A;  5F0F A;  2R7Z J;  2K3P A;  1YO5 C;  1KU7 A;  4KUM A;  4YIF A;  2VBY A;  1ETK A;  3TOA A;  1UJ8 A;  1RES A;  1QVT A;  2CYY A;  5D8K B;  4KIB A;  2Z1D A;  2AQF A;  2HZT A;  3B02 A;  2NVY J;  1GV2 A;  1TC3 C;  4IQJ A;  2PMZ N;  1MBE A;  1BN5 A;  2KDO A;  3PFI A;  3ZQ7 A;  5C4J J;  3HRT A;  4LG3 A;  5ILU A;  3CCM I;  4JYK A;  3ZRG A;  3AKZ A;  4QPO A;  1FBU A;  1RR8 C;  2WAQ A;  2VE8 A;  4ENM A;  4DZJ A;  2VL8 A;  4L9V A;  4XMY A;  3FHZ A;  1X2M A;  3OSF A;  1ZEL A;  2XB0 X;  2XPW A;  5HDG A;  2Y9Y A;  4EM2 A;  5EF6 A;  1MSF C;  4OOI A;  5FFZ A;  2YX7 A;  3KP4 A;  3SQN A;  1ZGW A;  1ETW A;  4HQE A;  1WFX A;  4S04 A;  1ENH A;  3QQA A;  4XNF A;  3TO9 A;  5F0H A;  1YW9 A;  4BNC A;  1R5H A;  1IN4 A;  4KMF A;  2O8K A;  1L0O C;  2V9K A;  5F64 A;  2FE3 A;  4N0B A;  1ZLJ A;  2DA5 A;  1R71 A;  2L7M P;  3GME A;  3O2P E;  3W6K B;  2VQG A;  4IHW A;  4GGG A;  3D5S C;  3KP2 A;  3QPL A;  1RZ4 A;  2ME0 A;  2YU3 A;  4NC7 A;  2HKX A;  3QPH A;  1SFE A;  4L9N A;  3JRF A;  1WJC A;  3R4K A;  2ZXI A;  3HTU A;  4ZYA A;  5BQT A;  3JRC A;  2OCE A;  2CW8 A;  4G8X A;  2LKP A;  2Y0S N;  2EK5 A;  3W2V A;  2MC4 A;  2JN6 A;  2X1C A;  3CCY A;  1DP3 A;  5ICE A;  3HSE A;  4U0V A;  2WBM A;  2MH2 A;  3KIO A;  1YIJ I;  2XDV A;  4UVB A;  1JKO C;  1YIT I;  2XAQ A;  3KEY A;  5CYV A;  1OCP A;  1POG A;  3Q9V A;  3L2C A;  3SEZ A;  4JBA A;  5FD6 A;  4UUS B;  3OYD A;  3BDD A;  3ISP A;  4WXH A;  2NYX A;  3CLO A;  2DI3 A;  3HHG A;  1QA6 A;  3GCM A;  1KYZ A;  4KIS A;  2CQQ A;  1UMQ A;  1K4S A;  4S05 A;  2HOA A;  3M8J A;  1K61 A;  2LK2 A;  1B1B A;  4AVP A;  2P4W A;  3EUH A;  3V7S A;  4IKF A;  4IVN A;  3ESW B;  2HFH A;  2PX9 A;  3JSO A;  1BI2 A;  2IT0 A;  3TW7 A;  4HF1 A;  1MMG A;  1IG7 A;  4HNV A;  2OC6 A;  3PSI A;  5JHF A;  1WZ2 A;  4Y4R A;  2BHZ A;  3HOZ J;  4HYE A;  3PNT A;  5LFA A;  5K7Z A;  1I5Z A;  2FOW A;  2WTE A;  4D5F A;  2K86 A;  4X0G A;  1FPQ A;  4P9F A;  2OZU A;  2NNY A;  3PFY A;  5E8G A;  4AIJ A;  5LHH A;  1HW1 A;  3G1O A;  2GXA A;  2PJR A;  2R92 J;  2BXZ A;  3R61 A;  4Q5S F;  1VF9 A;  3ZP5 A;  1FEX A;  2QQA A;  3E6B A;  1ZK8 A;  3A1Y A;  1MZB A;  2WV1 A;  1JUP A;  5H2F C;  5FGM A;  2E1M C;  2FF4 A;  2ZSH B;  4RGS A;  2HXI A;  2W25 A;  3L7W A;  4XLC A;  3J7Y J;  3M1C A;  5B3S H;  1A6Q A;  4FE7 A;  4CYC A;  2H09 A;  5IOZ A;  1NK2 P;  3S2W A;  1DU0 A;  2HXO A;  4UV8 A;  4IOA F;  4II3 A;  4L5I A;  2LSO A;  3LSK A;  1VQ6 I;  2P5V A;  5BOX A;  1NH3 A;  4W1U A;  2NS7 A;  3HUG B;  2CWE A;  4AM3 A;  2EFO A;  3V7R A;  1JXS A;  5F6F A;  4EJW A;  1QZE A;  3KZZ A;  2XPU A;  1T2K A;  1XX5 A;  2Y48 A;  2W57 A;  5D6E A;  2B9S A;  2Y0M A;  3M4O J;  4G12 A;  4UUT A;  3HOS A;  4ZTF A;  1G4D A;  2PMH A;  4NHJ A;  4UUV A;  5D5X B;  4XSZ F;  4N4O B;  2E2J J;  4ZTJ A;  3Q0W A;  5FKN A;  2JPB A;  4NNJ A;  2HDC A;  2EIL H;  2HPI A;  2DN0 A;  3P9I A;  4ESJ A;  1TQM A;  1MMS A;  3HPH A;  4M9Z A;  5HLH A;  5IT9 K;  1OR7 C;  2BE5 F;  2X6Y A;  2XAU A;  5FRN A;  4CDG A;  3DV8 A;  3BTC A;  5ICC A;  3RYP A;  2TDX A;  2QUF A;  2VI6 A;  2RNJ A;  4LFU A;  4O5V A;  1D8K A;  1W7P B;  2IP2 A;  5J8C A;  1G3Y A;  5FLX Z;  1TBX A;  2ZB9 A;  5HOO A;  4TV7 A;  2RNG A;  3WOD F;  2M87 A;  2M5W A;  1XB4 A;  2DMQ A;  2DW4 A;  3C2H A;  3RIR A;  4RB3 C;  1XC5 A;  3HSF A;  2VQC A;  4F91 B;  2QBY A;  4IRI A;  1B72 B;  2DA1 A;  1QGP A;  2M0C A;  3TDU C;  5IP7 J;  2YUS A;  2H8W A;  2L9R A;  4IPA A;  4I09 A;  5E1Z B;  5F08 A;  2HYF A;  3NAU A;  1HKT A;  4A12 A;  3ZMV A;  4KFC A;  4XOR A;  5DD4 A;  1H9T A;  2DFE A;  1QNT A;  1FC3 A;  4B48 A;  5JVT A;  1MDM B;  3BJ6 A;  3U1D A;  3ERE D;  1R36 A;  3RDI A;  3K2Z A;  1I27 A;  3V8K A;  1I3A A;  2LMD A;  4FIS A;  1RPW A;  1JGS A;  2R3S A;  3K69 A;  2KQR A;  2E1C A;  3HUG A;  3S1R J;  3Q0U A;  2D2W A;  4XLE A;  1VFC A;  3JSP A;  1N77 A;  5J8F A;  2M1B A;  3E5Q A;  1KYW A;  4G94 A;  1Y56 A;  5DCF A;  4Z2Y A;  1W36 D;  1BIB A;  4BQQ A;  2BY2 A;  3K0L A;  1GXQ A;  4PUS A;  4CGZ A;  1IDY A;  2GIZ A;  1HW5 A;  1ETV A;  5BMZ A;  1V4R A;  2QZ8 A;  3FIW A;  3IUO A;  4WCG A;  3OYE A;  3JRH A;  3GTQ J;  2K5C A;  3TP3 A;  2L4M A;  2VQH A;  3F8N A;  2W1O A;  3P7N A;  4U0Y A;  1FNN A;  1RUN A;  4XLP F;  2XAG A;  1WWX A;  1O3S A;  4HW0 A;  2CW7 A;  3T8T A;  2A5W A;  3NRV A;  4CCL A;  2O7O A;  3HRM A;  2JPC A;  3CJN A;  3PQJ A;  2BOL A;  2WC2 A;  3KP6 A;  3V42 A;  1QZZ A;  3J7Z I;  3L2W A;  2Z5U A;  2E2I J;  2Q2E B;  3O3K A;  5D4R A;  2E60 A;  1FP2 A;  2DO7 A;  5CPR B;  5AIQ A;  1BC8 C;  2OA4 A;  1V3F A;  4KIC A;  4LLL A;  2JA7 J;  1OCO H;  4HLX A;  4QSH A;  4U88 A;  2O8X A;  3BTJ A;  2Q8K A;  1SAN A;  4PCQ A;  4V2F A;  3RPQ A;  1JHH A;  5L3D A;  3H3Z A;  4BS9 A;  2OTL I;  3DEW A;  3BR3 A;  3LSR A;  1MND A;  4GRI A;  4WXD A;  4LIT A;  2UV1 A;  3PNV A;  4OIP F;  1S7O A;  2LDU A;  4BUP A;  5K5Q A;  2VXD A;  3N97 A;  1FJL A;  4L18 B;  2QEN A;  1LFP A;  4M71 A;  2XRN A;  1H8A C;  3ONQ A;  4HNU A;  3HG9 A;  1VTN C;  3A01 B;  1QHG A;  1BL0 A;  4G9Y A;  3CMM A;  1Q1V A;  1GHC A;  3DEU A;  1P9Q C;  3ULQ B;  1EF4 A;  2DPU A;  2V6C A;  3UKG A;  3LSJ A;  4G7H F;  1R49 A;  3BC8 A;  1AWC A;  3VOE A;  2HDD A;  2WAQ N;  3E5U A;  4BAC A;  2GXB A;  4OU0 A;  4BQA A;  1AKH B;  1FOW A;  4IX7 A;  5FB2 A;  1UG2 A;  1X3U A;  1LUJ B;  3JAM Z;  2L0K A;  1DUX C;  3W6J B;  3HGY A;  1K78 A;  3BR2 A;  3FZV A;  1OYW A;  2F2E A;  4M6V A;  3WGH A;  2EV6 A;  5D4S A;  3EQL F;  2QVO A;  4D7M A;  2VJ4 A;  3WTX C;  3OS2 A;  3TW6 A;  4RM3 A;  4BEH B;  2VAS A;  5LGT A;  1BA5 A;  1VZ0 A;  1XGM A;  5EG0 A;  3CO7 C;  4FET A;  3R0A A;  2Q2E A;  2YSR A;  4H0E A;  5HDK A;  3HGG A;  2CQN A;  3GBG A;  4DOZ A;  4P55 A;  5JFR A;  4A3D J;  4Q47 A;  4C3I J;  2PLY A;  5HS7 A;  4W97 A;  1NG7 A;  5DM6 F;  3GEZ A;  3COA C;  5KVR A;  1SAX A;  3TP0 A;  1VI0 A;  1MJ9 A;  4CCM A;  1H88 C;  2OD5 A;  1PUF B;  4FX4 A;  1BOA A;  4E6K G;  2UZK A;  2VC0 A;  3IH3 A;  2EFW A;  1P2F A;  5TGT A;  4I0A A;  1JTY A;  4BXX J;  3OYB A;  3IC7 A;  4MGR A;  1S5L C;  2DK5 A;  2JJ7 A;  4MNU A;  4AYB A;  4CCO A;  3TMO A;  1TT0 A;  4EEF G;  5GAG J;  2DQL A;  4DIQ A;  2VJ5 A;  2V7F A;  2DFF A;  5L3E A;  1H0M A;  1DGW Y;  4XRM A;  2RQQ A;  3VSK A;  3OYJ A;  1SD4 A;  1WCM J;  3BQZ A;  2HR3 A;  5LLQ A;  4MTD A;  3CJR B;  4DYQ A;  3MKY B;  1SVO A;  2KZG A;  5B1B H;  1R58 A;  5EZH A;  1KGS A;  2PFB A;  4P96 A;  3MZY A;  1O3R A;  1MBG A;  4KT6 A;  4BY1 J;  4RB2 C;  5J4Y A;  4UNO A;  5BNG A;  4A6D A;  2ECB A;  2XF5 A;  1ZG3 A;  4S0H B;  3KCC A;  1MBF A;  2N8G A;  4BAY A;  2O6G E;  1YG2 A;  2IGN A;  4A5M A;  3SZT A;  3N05 A;  2XB5 A;  3MMY B;  5JI6 A;  1H89 C;  3M9A A;  3H9J A;  3GTJ J;  1S9H A;  4E7I A;  2CG4 A;  2M7B A;  2DTZ A;  3CLQ A;  4B47 A;  2EV0 A;  1B4A A;  4I7H A;  3FXU A;  4RDU A;  5GAH J;  1KQ8 A;  3H92 A;  5LRS A;  5IOY A;  4XQF A;  1ETY A;  2HOE A;  1E17 A;  2XRL A;  1KA8 A;  1W0T A;  2DJI A;  1W5T A;  3DU6 A;  4A6E A;  4DZP A;  2V4J C;  1EV7 A;  1XPX A;  3HZJ A;  3C3W A;  3CJQ B;  4KYW A;  3BR5 A;  3V7C A;  3JRD A;  3CUO A;  3K1N A;  2Y69 H;  5DEQ A;  2ISZ A;  2DA3 A;  3JTG A;  2HVQ A;  2LTP A;  3K70 D;  2ZME A;  4MEY F;  2W00 A;  1MKM A;  3J81 Z;  5LGN A;  4IRG A;  1B9M A;  2NOJ B;  5DDG A;  3OYA A;  1AOY A;  1BBY A;  2ZFW A;  4A0Z A;  5E3N A;  3I59 A;  1WJ5 A;  2ID6 A;  4P5O A;  4E7S A;  3CF5 F;  2BEO A;  3DPT A;  3CME I;  2VOD A;  2L9V A;  3HIF A;  3K4N A;  4HBL A;  3RPU A;  5M5Y J;  2ID3 A;  3I58 A;  3BG7 A;  1U5T C;  1P4A A;  3K4B A;  2P5L C;  2ACJ A;  2R4G A;  3T1B A;  1R1T A;  1TZL A;  3M8E A;  3LMM A;  5LHI A;  3CC7 I;  1N78 A;  1ZN2 A;  2K7L A;  5F0C A;  4F52 A;  4JX4 A;  3F0C A;  1OMI A;  4RB0 A;  3QPS A;  2XUB A;  2DT5 A;  4BXU A;  1KQ9 A;  2PN6 A;  1LE8 B;  2R5Y B;  4DBQ A;  2F4M B;  2E19 A;  3M07 A;  3OR1 C;  1ETQ A;  3J7A O;  2DTR A;  4AUX A;  2FU4 A;  2KT0 A;  3GWZ A;  1QQI A;  3SDB A;  2G0E A;  3U9G A;  3IHU A;  1E3P A;  1U8R A;  1GT0 C;  3HPG A;  3A01 A;  5E3M A;  2E5N A;  4YII A;  4QIW N;  5F1R A;  2L4A A;  2HNH A;  2RVC A;  2HYJ A;  4PSX A;  2HVS A;  4M74 A;  2QQB A;  2Y30 A;  3FXO A;  4M3F A;  5E20 A;  1RKT A;  1OLT A;  2VC1 A;  3HBL A;  4EJU A;  1ZYR F;  3FXM A;  3GLL A;  1MJB A;  3IL2 A;  2RN7 A;  1YTY A;  3FWE A;  2EPF A;  3BR1 A;  2P6S A;  1TWC J;  1UST A;  4IF4 A;  5C44 J;  4B09 A;  2E5Z A;  2WB1 A;  3LQQ A;  4WF2 A;  2HDW A;  3BG9 A;  4WX9 A;  5J4V A;  4ZJZ A;  1V54 H;  5H20 A;  5LBQ A;  3TO6 A;  4ENK A;  4BJ5 C;  1VQ8 I;  3VDX A;  4M6X A;  1IF1 A;  3MN2 A;  4PGG A;  3QYB A;  4ZZD A;  2JA8 J;  3GYH X;  3RKQ A;  4M9X A;  3DCF A;  1ZLK A;  3OYG A;  2M4G A;  1BIA A;  1FMW A;  2WY8 Q;  1IUY A;  2CV0 A;  2ADU A;  3K10 A;  1MJA A;  4GXO A;  1BR4 A;  4XON A;  1P4X A;  3UR3 C;  5DUI A;  5CLS A;  4KN4 X;  5AON A;  3M7G A;  3D5L A;  5GTH C;  3ZR8 X;  1TT5 B;  1IW7 F;  4XLN F;  1ETO A;  1V5G A;  2P0W A;  1U9N A;  2JVG A;  3FHN A;  5D6F A;  3RKY A;  1UHS A;  2E71 A;  3F3X A;  2CSO A;  2KRF A;  4ZDL A;  1I1S A;  3DXJ F;  4D0P A;  4C2M J;  5FLM J;  2E7X A;  2XF7 A;  5J1U A;  3V4G A;  3VYR B;  4FTH A;  1J9I A;  3CUQ A;  3G1L A;  1I50 J;  2M4K A;  2CUF A;  2M8G X;  2DLL A;  1IUF A;  3OWT A;  1P7I A;  3DTE A;  3K2A A;  1DP7 P;  2HQ5 A;  2K9Q A;  3WTY C;  4KIT B;  4EJT A;  4EMS A;  5IP6 A;  3GZ6 A;  4BQN A;  3MVP A;  4R8H A;  2YU9 J;  2NS8 A;  4CZC A;  2GXG A;  2JRT A;  5CVU A;  4BU2 A;  4F7Z A;  2W4S A;  3DF8 A;  3SJM A;  1HBX G;  1X1P A;  3F6O A;  1VQP I;  2MLG A;  3WU0 A;  5E17 F;  1T98 A;  3C2B A;  2DCE A;  3JTH A;  4CZZ A;  1U5T B;  1YX3 A;  2CV2 A;  1O7F A;  4E7Z A;  1BJZ A;  3QOP A;  2F4O B;  1WKM A;  2LRD A;  3E3V A;  4GDF A;  3W6V A;  4ZYG A;  1IC8 A;  1YS6 A;  3T5X A;  3L09 A;  2ECC A;  1AU7 A;  2Q1Z B;  2EA2 A;  4A3L J;  3H0G J;  2KDZ A;  2EZI A;  3FKJ A;  2EV5 A;  3H5R A;  1AHD P;  2EFP A;  1JUM A;  2LKS A;  2R93 J;  3LSI A;  1BI3 A;  2IEK A;  1TL8 A;  3MKW B;  5HS9 A;  4WWC A;  2R5Z A;  2XSD C;  5FRO A;  3LWF A;  2D1H A;  4BHP A;  2R7V A;  2CUJ A;  2DK8 A;  3DTK A;  1YW7 A;  4BE1 A;  3ROU A;  2PQ8 A;  3OYF A;  3KET A;  4XLH A;  2ZJ2 A;  4O6J A;  2A07 F;  3GW2 A;  2X85 A;  5IY5 H;  1Z6R A;  3HC7 A;  1XG1 A;  3AAF A;  4XKC A;  1ZR4 A;  4KIG A;  3DLA A;  1BJA A;  3BJA A;  1WJF A;  3KZI C;  2ELJ A;  4I76 A;  2HZD A;  2JZY A;  2Y2Z A;  3VYS B;  3CMA I;  1YRN B;  3NWS A;  4PZJ A;  4ESF A;  1IRZ A;  2BY1 A;  2DFH A;  2WY7 Q;  3K70 C;  2LY1 A;  5FRM A;  3FXK A;  1T6S A;  4YEL A;  1R4N B;  2W82 A;  5GAD J;  2YX4 A;  5HNF A;  2GWR A;  1MH4 A;  3R0J A;  4B3X A;  2COM A;  1STZ A;  1RC9 A;  1YJW I;  1XN7 A;  4OAY A;  4ZZL A;  3EET A;  4BHB A;  4F55 A;  3S17 J;  1TTY A;  1QU3 A;  4N9I A;  2NXN B;  2R7X A;  4RGU A;  1V5F A;  2FD5 A;  2A69 F;  2IS1 A;  2V1U A;  3I4M J;  3DWL E;  2K4B A;  1T0F C;  4XLA A;  2PJR B;  5JR3 A;  1IN7 A;  1X3Z B;  3DLL F;  2HOS A;  1OCZ H;  3I3L A;  3OYI A;  2HU9 A;  2W85 A;  3QP5 A;  3TOB A;  1Y6I A;  3BJO A;  3FM5 A;  4OAZ A;  4M6Y A;  2E36 A;  3CJT B;  1BR2 A;  4MQV A;  5DCM A;  5EEG A;  4AID A;  2MLK A;  2EWN A;  4DYR A;  3QYE A;  1AKH A;  1W36 C;  3AL0 B;  2QBY B;  2HTJ A;  2IGK A;  2IA1 A;  4OIQ F;  1Z67 A;  4XRF A;  1IV8 A;  1ZRD A;  3QOE A;  2M8E A;  4CA0 A;  2HPM A;  4XSX F;  5KK1 A;  1O3T A;  2H8R A;  1FLI A;  2P81 A;  3M8F A;  3F8M A;  2FNP A;  3RCO A;  5IP9 J;  2V1D A;  3KFW X;  4HDV A;  1EKE A;  1FT9 A;  1W5S A;  5LHG A;  4OWR B;  2OQG A;  2CRG A;  3H3V K;  1SVL A;  4G6D A;  2VON A;  2KJC A;  3I71 A;  3NAR A;  5FLX K;  3RI4 A;  2D1V A;  1J7K A;  4LK1 F;  3ZMU A;  4CCJ A;  4IHV A;  2ZME C;  2KKO A;  3BZC A;  2OTJ I;  3BR6 A;  2CUE A;  2EIK H;  2ZNY A;  2IVM A;  3JW4 A;  3D0S A;  1FX7 A;  3OR2 C;  2LBF B;  2DFI A;  4A3J J;  1ETX A;  3OIQ A;  4XOT A;  3OSG A;  1I6H J;  1R23 A;  3ZQG A;  2DAO A;  4L0Y B;  5B5E C;  5J1R A;  3KE2 A;  3Q3S A;  4EJO A;  5CQE A;  1A6I A;  4HDU A;  2NVT J;  5D8L B;  2OV7 A;  2VIX A;  3BP8 A;  5K7F A;  2OCC H;  4BBS J;  2QSG X;  1Y1V J;  1YIO A;  1MBH A;  3W2W A;  4JX5 A;  2OQR A;  3GTM J;  1U9O A;  4L9J A;  3FBN B;  2LYC A;  2HS5 A;  2QKL B;  1RET A;  1SMY F;  5DS9 A;  4BHC A;  5HLI A;  2EIJ H;  2PI0 A;  2JSP A;  2KIM A;  1B6A A;  2BHY A;  1Y8Q B;  2CFO A;  1ULY A;  2VOP A;  2L2O A;  3H9G A;  5GAE J;  2A3S A;  2J5O A;  3HOX J;  2ZJP F;  3CC4 I;  4HOB A;  4PJN A;  4Y33 A;  4ZYH A;  1NK3 P;  2NVU B;  1Y1W J;  1R1U A;  1Z21 A;  5HS8 A;  1VQL I;  4AC0 A;  1Z91 A;  2E2H J;  1XTA A;  3I4P A;  3NWT A;  1R4M B;  4Q48 A;  4YRV A;  1LDD A;  1NHA A;  1SMT A;  5B1A H;  3WTW C;  2WA0 A;  4BYY A;  2ZXW H;  1MW7 A;  3OL3 A;  3S1M J;  2BY3 A;  4LMY A;  3HB9 A;  3RYR A;  4NUB A;  1SEU A;  2K9S A;  5L3G A;  1IN6 A;  3F8C A;  3FMS A;  3WE2 A;  1JGG A;  1VQO I;  3O6B B;  2XAJ A;  2XV4 S;  1JJ6 C;  1D1A A;  3SDG A;  1BW5 A;  3WHC A;  3ZXS A;  1FIA A;  2VPR A;  1TNS A;  4FE4 A;  4ZH4 F;  3FMR A;  1IRG A;  1MSE C;  5FKL A;  3LSP A;  3HOV J;  1JTX A;  1EH7 A;  5FLV A;  3W2A A;  3FF5 A;  1K7A A;  5FD5 A;  2HQN A;  4A93 J;  5CQG A;  2B0L A;  3ZCO A;  3A2K A;  3KX2 A;  2NS0 A;  3ELK A;  4BEH A;  4GYI A;  1BW6 A;  1R00 A;  2GM4 A;  2G7U A;  1ZG1 A;  2JUC A;  2X9D A;  3PUF A;  3UNG C;  3I4N J;  3OS1 A;  1GUU A;  2O9L A;  2A5Y B;  3LAP A;  1WGX A;  2ZXJ A;  4GO1 A;  3S2H J;  1KQ0 A;  3WU2 C;  3RKX A;  4NBQ A;  4KMU X;  2FA5 A;  5BS6 A;  4PJM A;  3RSN A;  4D7N A;  1FOX A;  4IZZ A;  2VKE A;  1J59 A;  4CXF A;  5J6X A;  4XK4 A;  3WTT C;  3L00 A;  5KAI C;  3CCV I;  1IRX A;  1F9N A;  4B43 A;  2VOO A;  3BG3 A;  4XLF A;  2R5Y A;  1Y8R B;  1GDT A;  3NQO A;  2C6Y A;  3SZP A;  1W7P A;  3QWL A;  1N75 A;  3ZMZ A;  1CQT A;  4ENJ A;  2A6H F;  5JHU A;  1OCC H;  3GVA A;  4ZDP A;  3I55 I;  2IS4 A;  3CDI A;  3AG1 H;  3E0J B;  3ZMT A;  2WAE A;  2D5V A;  2O3F A;  4L9T A;  2ICW G;  2O0Y A;  1YLF A;  3KP3 A;  3Q0V A;  2Y9Z A;  2EZL A;  3BY6 A;  5EZG A;  2BV6 A;  1USS A;  4KJZ A;  4ENN A;  3WTZ A;  4CIC A;  1X4O A;  4RAF A;  1BI0 A;  6PAX A;  3F6V A;  1GVJ A;  1E3H A;  4C3J J;  1I39 A;  2VT2 A;  2Z3Y A;  3CUQ C;  3F8B A;  5F04 A;  4DNC A;  2F5V A;  2LNB A;  2XAH A;  2BVM A;  2ME6 A;  4D5C A;  2EQR A;  2KZV A;  2MFZ A;  4Y15 A;  4KA4 A;  1ZRC A;  2IPQ X;  2LG4 A;  2QQ9 A;  1PP8 F;  2DJN A;  2KPM A;  2W48 A;  2R7Q A;  1IGN A;  4FT8 A;  4HZF A;  3HXL A;  3MEX A;  2PMZ A;  1ON1 A;  4RAY A;  4Y3O A;  2L7K A;  1J5Y A;  2HI3 A;  2DMN A;  5EGO B;  2L3D A;  4C2U A;  4A3B J;  3H0D A;  2DA4 A;  1XCB A;  2YR2 A;  3E6D A;  2V1N A;  3L9F A;  2K4J A;  2H27 A;  5CVJ A;  3H36 A;  3BTL A;  4P1W A;  4QWQ A;  1XGS A;  5FKK A;  5M5W J;  2LP0 A;  2XF6 A;  4E7H A;  1H9G A;  1X58 A;  1E3O C;  5IYB J;  4B1R A;  2JK3 A;  2OPT A;  3HRS A;  1MMA A;  3ZMS A;  3CCR I;  4HX7 A;  2GZW A;  4K2E A;  1DU6 A;  1X4P A;  2CUZ A;  1YHQ I;  2RGV A;  4WXC A;  5KHD A;  1WI9 A;  4A0Y A;  2EIM H;  5HOD A;  1FY7 A;  3LA2 A;  4EM0 B;  1G6N A;  2W84 A;  3TGN A;  1T8I A;  1J75 A;  2XPV A;  2VQL A;  1VQ9 I;  1HDD C;  2GA2 A;  5E79 C;  2EFN A;  2WAF A;  3ERM A;  2KP6 A;  2WAD A;  1JJ8 C;  1VQN I;  4C2T A;  2H6B A;  1EJ9 A;  2O61 A;  3SFZ A;  3IRR A;  1TW2 A;  5ILV A;  3CD6 I;  2FBI A;  2W24 A;  5IT9 Z;  3EUA A;  3S14 J;  3F9K A;  2CQX A;  4E7J A;  1E0E A;  2LF8 A;  4RBO A;  4IHX A;  1AA7 A;  4A69 C;  4PJJ A;  1OQY A;  4IRH A;  4A3C J;  3CTA A;  1RUO A;  1I1G A;  1Z77 A;  5D5U B;  4OMY A;  1SD6 A;  1T33 A;  4E70 A;  5K1Y A;  2OBP A;  1T56 A;  4DJA A;  4HRI A;  3C2G A;  2R7W A;  1T39 A;  2ZSI B;  2KRC A;  1Z1D A;  4HX8 A;  1YE9 A;  3CCE I;  2DT6 A;  1HSJ A;  4CCK A;  1YQA A;  1Y0N A;  5JLW A;  2CJJ A;  3ABT A;  3DKY A;  1O7L A;  1SD7 A;  2RRE A;  1CGP A;  3VFZ A;  4A3F J;  2MAB A;  1V5E A;  3GFL A;  3ECO A;  2QCO A;  2FX0 A;  3D1N I;  2ISY A;  1FMV A;  4LD5 A;  2OU2 A;  3KZY A;  3EDP A;  4L0Z B;  1WHU A;  4FX0 A;  3OIO A;  5K5R A;  1TW3 A;  2K85 A;  4DYC A;  1ON2 A;  1B72 A;  2VT3 A;  2ZC2 A;  3MCZ A;  1RR7 A;  4MQ9 F;  1KU2 A;  2FOK A;  5DTD A;  3P5J A;  4R1H A;  3HRU A;  2CQK A;  4BBR J;  3LSG A;  4XM3 A;  5E8I A;  3ZQH A;  3HL2 A;  1YOV B;  1ZRE A;  2FQ4 A;  3AG3 H;  3S2D J;  2QSF X;  3J80 Z;  1P92 A;  2NNN A;  4A2U A;  4B3A A;  2QLZ A;  3P9K A;  2LF7 A;  3CMY A;  2JUG A;  4F92 B;  2MA3 A;  2CO5 A;  4XR6 A;  1OYY A;  3L2Q A;  4XBF A;  2DOE A;  2ZFU A;  5IT3 A;  2TRT A;  4I0B A;  2JA2 A;  2JMW A;  4Q4Z F;  2A05 A;  1LNW A;  2Q0O A;  5DM7 F;  1OJL A;  1CF7 A;  2HQA A;  4V2G A;  4I6Z A;  3DQV C;  3TBI A;  1K78 B;  3I0T A;  2EA4 A;  1EH6 A;  1JKQ C;  2CS3 A;  1FBS A;  5DD8 A;  1QPM A;  1SFO J;  5L3C A;  2DMU A;  3LA3 A;  1FYK A;  2ESH A;  3PM1 A;  3I9V 2;  4U7B A;  1A36 A;  2GIV A;  4P9U A;  3VOD A;  2M2E A;  3MZ8 A;  2X6O A;  2BGC A;  4YIR X;  3OS0 A;  3Q5F A;  3FK7 A;  3FKI J;  2J5P A;  3CUQ B;  4RGX A;  1T0F A;  2DOA A;  3VYU B;  4B4C A;  4ESB A;  4V19 K;  1J2X A;  1Q1H A;  1K6Y A;  3GZN B;  2DA6 A;  1U0J A;  3CCJ I;  1ZH5 A;  2JRM A;  5L3B A;  1X3W B;  3AG4 H;  2ELK A;  5B66 C;  4CH7 A;  3LQR A;  3E6M A;  3FXJ A;  2IBD A;  4QLC U;  4LK0 F;  2VJI A;  1TQP A;  3H35 A;  1HST A;  1DPU A;  2VKV A;  3HSR A;  1HKQ A;  2MW8 A;  1LPQ A;  2KIQ A;  2B7E A;  5M3M J;  1MIJ A;  5E1W A;  3RQI A;  2RDP A;  4A3E J;  3J7A Y;  1BI1 A;  3QU3 A;  3TKY A;  1IDZ A;  5EEH A;  2JT1 A;  2NRA C;  1IZ1 A;  2EZK A;  2F48 A;  4BE2 A;  1T38 A;  3PO2 J;  1FWZ A;  1LVK A;  1EA3 A;  1U5T A;  2GLO A;  2YPR A;  3KEQ A;  4LJZ F;  3IKV A;  3U21 A;  3VB2 A;  2H6C A;  2VN2 A;  1BM9 A;  2CFX A;  2X1E A;  2L54 A;  5ICG A;  2Z2S B;  4HF0 A;  1PYV A;  4EV0 A;  2KHM A;  1K4T A;  4FCY A;  1XSV A;  4G6Q A;  2BZT A;  2DMT A;  4FAS D;  3A03 A;  1I3Q J;  4JQF A;  4DBR A;  1G3T A;  3TDZ C;  2DA2 A;  4BKX A;  2F5F A;  2DBB A;  3FXR A;  1SVM A;  2R7U A;  3BPX A;  1S8N A;  5FFX A;  3A0B C;  3S16 J;  5EYR A;  3OV8 A;  3HKZ A;  2XHK A;  4HLY A;  2VB6 A;  2XAF A;  3X2Q H;  4Y52 J;  2ELH A;  3S8P A;  2A6T A;  3WTS C;  3JRE A;  2QF7 A;  3KLN A;  4HV6 A;  5M3F J;  1QHH D;  4BL0 B;  2F6C A;  3OYC A;  2H94 A;  1JUS A;  3L1P A;  1WH5 A;  4AD9 A;  1MBJ A;  1FIP A;  2DDB A;  3VWB A;  4Y17 A;  5KNL A;  3GTL J;  2BVL A;  1APL C;  1TWH J;  1W5C C;  1SAU A;  1D0X A;  3QYF A;  1JHF A;  2XVC A;  5LRR A;  1VND A;  1WJA A;  2K9L A;  1YJ9 I;  2JTV A;  1YS7 A;  1HXD A;  5DUK A;  3S3O A;  1OR7 A;  4MLO A;  4MHG A;  3K6G A;  2NVX J;  3HOU J;  1VQ5 I;  2VBX A;  4PFO A;  4Z6Y A;  2X6X A;  1G59 A;  1SC7 A;  2LOO A;  2X48 A;  3K4K A;  4HPQ A;  2VUM J;  2QYO A;  4BJT A;  3PJR A;  1L3L A;  2V6E A;  3HHH A;  3E6C C;  2DPD A;  3VYT B;  1REP C;  4IO9 F;  4HSR A;  1VQM I;  2P7V B;  3GXO A;  4IJA A;  4XKW A;  2IXS A;  3K9T A;  4LG0 A;  5HNH A;  3G4S I;  1CF7 B;  1PDN C;  4MIM A;  3GF2 A;  1DQU A;  1FBQ A;  5TRD A;  2DU9 A;  3PQK A;  3SXY A;  4G7O F;  1HW2 A;  3WGG A;  4A3G J;  4IHY A;  2MYS A;  1IXR C;  4EGZ A;  3DPU A;  1YI2 I;  4LOC A;  1G3W A;  3JRA A;  1XDU A;  2K9N A;  2DT7 B;  1G2H A;  3DEE A;  4A3I J;  4EM1 A;  1ACI A;  5M5X J;  4HX4 A;  1C0W A;  3CDH A;  4B8X A;  3IH4 A;  2L7Z A;  3I64 A;  3RQ4 A;  2PJP A;  3GTG J;  5CKT A;  5EJC A;  3ZQQ A;  4KDP A;  1XGN A;  4ZYD A;  3OOP A;  1S7A A;  3E7L A;  2ETH A;  2CW0 F;  2RV8 A;  3M1E A;  4HV5 A;  2V9V A;  3CC2 I;  2HYG D;  4M3D A;  2AS5 F;  1RI7 A;  3OYN A;  1ZTR A;  1IN8 A;  1KU9 A;  3BT9 A;  3RJP A;  2VPL A;  3SHF A;  1QRY A;  1ONV A;  1Z0X A;  2DDA A;  1LQ1 A;  2ZME B;  3PIP F;  5ERI A;  1GXP A;  1IXS B;  1MMD A;  2Y75 A;  3DTI A;  3BLY A;  3RKW A;  5EEA A;  2P8T A;  3CDL A;  4EVI A;  2KIU A;  4XRS A;  1QPI A;  1Z3X A;  3KLO A;  3ZN1 A;  3OYK A;  3TQN A;  1T95 A;  1B8I A;  4UVC A;  1WSU A;  4CCN A;  4FHT A;  2MC3 A;  2MBF A;  3U2R A;  2NOG A;  3HOT A;  3KP7 A;  3N4M A;  4GCV A;  2EJR A;  1IAW A;  3WTV C;  2ZKZ A;  4BE0 A;  4L5J A;  2HVR A;  1IN5 A;  4MFD A;  3ZQI A;  4UVA A;  4NB5 A;  5JVG F;  1N25 A;  4EJV A;  1WRJ A;  2IW5 A;  4M73 A;  4AVZ A;  1RKW A;  3GFI A;  3JAM K;  2FSW A;  3A0H C;  3KYD B;  1HDP A;  5EG0 B;  3ZN0 A;  1GLN A;  2ESN A;  2A61 A;  4HA8 A;  3CCS I;  2HEO A;  2QA4 I;  2X4H A;  3LL7 A;  5KCM A;  1Z3Y A;  2FML A;  2CMP A;  1HKS A;  3A02 A;  2M45 A;  1BR1 A;  2RC4 A;  2XKO A;  2AXL A;  3KP5 A;  4ETS A;  2M3A A;  1X19 A;  4CHU A;  4RMN A;  4R79 A;  1X1A A;  2H1L A;  3E97 A;  1JKR C;  2E1M B;  4KT5 C;  1XDS A;  3DP7 A;  2BY0 A;  3ZGK A;  4IXA A;  3IWF A;  2OAZ A;  3HDD A;  1BOB A;  1WJD A;  2M0M A;  3H1C A;  3HOW J;  1U3E M;  3ZOB A;  1HQC A;  1HCR A;  3TED A;  1UAA A;  1UG0 A;  2EIN H;  5IPA A;  2W7N A;  2CV1 A;  2LLK A;  4XIC A;  3D5R C;  3CZ6 A;  3LST A;  3LNQ A;  3F8F A;  4RLQ A;  4UB6 C;  4DW6 A;  3IWZ A;  4IHT A;  2FEZ A;  2L5Q A;  3DBR B;  4IL6 C;  3H9Q A;  1S6L A;  2Y31 A;  1OKR A;  2F5E A;  5IYC J;  5EGO A;  1FTZ A;  5ED4 A;  4MEX F;  2TCT A;  2MG4 A;  2OZ6 A;  3K4J A;  5DV5 A;  3ZPL A;  4Y7N J;  3FM3 A;  4A3K J;  1P6R A;  4N9H A;  2VXZ A;  2Z99 A;  1B8I B;  2MGQ A;  4E7K A;  1ORK A;  3GO5 A;  3O8G A;  1UZC A;  4XOP A;  1K79 A;  3B73 A;  4IEJ A;  5J3L A;  1U78 A;  4PGH A;  1LKX A;  1U6G A;  2LY9 A;  2K3F A;  4OMZ A;  4C30 A;  3S1N J;  1HA8 A;  3P9C A;  3IP4 B;  2E1O A;  3T8R A;  3EYY A;  4ON0 A;  2VBZ A;  3SYT A;  1LFB A;  2HQR A;  1YRN A;  1VQ4 I;  4AYB N;  3S32 A;  5J1Y A;  1G3S A;  1DGR M;  2FNA A;  1X1B A;  2RQP A;  2VE9 A;  3CO6 C;  4GYG A;  2KMU A;  3JRG A;  4F3Q A;  1R9T J;  1HLV A;  1MMN A;  5C4X J;  2VLA A;  2QKM B;  2BBY A;  1YW8 A;  2LC2 A;  2GBY A;  2BW3 A;  1XD7 A;  2HGC A;  1D5V A;  1HC8 A;  3GUD A;  1UB9 A;  1B59 A;  3B6C A;  1PUF A;  3H5A A;  2KIF A;  4QTR A;  3OYH A;  4ASN A;  2K40 A;  1LFU P;  1R22 A;  4YFX F;  5DYM A;  4A0X A;  4A3M J;  2L7F P;  4H4K C;  3ZMD A;  1G8X A;  3LA7 A;  1WVR A;  2V1X A;  5D5V B;  1ZKG A;  1M1E B;  4HQM A;  3FX3 A;  1SFU A;  2CGP A;  1VQK I;  3GTO J;  4HAM A;  4BH9 A;  1NTC A;  2I10 A;  2DXI A;  4C9Y A;  1ODD A;  3FXL A;  4O3M A;  2A6E F;  4XN0 A;  4M9S A;  4UV9 A;  1O57 A;  5E1X A;  4RAG A;  2EBI A;  3BWG A;  4G6T B;  5CVV A;  4LIV A;  3OYM A;  1QVU A;  2IA0 A;  2LH9 A;  3BCA A;  5LEJ A;  2OUM A;  3DKW A;  3PO3 J;  3V8L A;  3PSF A;  2CQ7 A;  1WH7 A;  3EUK L;  4HG2 A;  1F5T A;  1W7P D;  1W1W E;  4LLG F;  2EZH A;  1OIS A;  2XGE A;  1LE8 A;  5LGU A;  2AHQ A;  5GPC A;  1IO2 A;  2GOM A;  4BDY A;  3GFM A;  4U0W A;  5FJ8 J;  1XS9 A;  3EYI A;  3A4C A;  1MH3 A;  3RTR A;  3K4M A;  1WJE A;  2G7H A;  1FP1 D;  1FOY A;  2FBH A;  3RZO J;  1UCR A;  1Z05 A;  2DYS H;  2XSJ C;  1D5Y A;  2R7R A;  2COB A;  3KYC B;  4I2O A;  2LBF A;  3I54 A;  4BGD A;  2QEX I;  2WV0 A;  4XKV A;  2XGC A;  3PNY A;  4NDL A;  1KON A;  1XMA A;  3FK6 A;  2JA6 J;  2UXX A;  4BQO A;  4XRS G;  3LAJ A;  2IRF G;  3CQZ J;  2GQQ A;  1YYV A;  3PL8 A;  1F1Z A;  3O8H A;  3ABK H;  2LR8 A;  1ZGJ A;  3MWM A;  1DDN A;  2QSH X;  2HOT A;  2JVH A;  2KIS A;  3LFK A;  4U7D A;  3DPL C;  2JA5 J;  5FKM A;  2ZJQ F;  3JRI A;  1LEA A;  3WTU C;  2V9P A;  3QPT A;  1LB2 A;  3B6A A;  1ITY A;  3MQ0 A;  2QQ8 A;  1BC7 C;  3CF2 A;  2RAE A;  4D9J A;  4EQQ A;  5E18 F;  1ZGA A;  5LEK A;  1ERD A;  2E35 A;  1W4M A;  1QBJ A;  1LDK B;  3SFI A;  2E34 A;  3L2R A;  1NG6 A;  3IV5 A;  3BTI A;  5IYD J;  3LSM A;  3ABL H;  1MGT A;  4QPQ A;  1P7J A;  2VJJ A;  2Z16 A;  1UEL B;  3K7A J;  1JKP C;  1F4K A;  4L5E A;  3QU6 A;  2DYR H;  3S93 A;  4NQW A;  2UUZ A;  3HM5 A;  1Y0U A;  2BXY A;  3FBI B;  1SFK A;  1S3J A;  3AG2 H;  5DCM B;  3S1Q J;  3L2U A;  1WI3 A;  2FRH A;  2K9M A;  3BQY A;  3BPV A;  4RS8 A;  5EDN A;  3ABM H;  3QRF F;  1TQI A;  4NC6 A;  5ICF A;  3S3M A;  3DKX A;  2OF7 A;  1DPR A;  2ZCW A;  2ZO4 A;  1W0U A;  2AXT C;  1OYI A;  1OCR H;  5F1J A;  1JI8 A;  1S29 A;  3CCQ I;  2KJB A;  4OIO F;  2KL4 A;  5H6R A;  1MBK A;  2HTS A;  3WU1 B;  3ZQC A;  1A31 A;  1XSD A;  4G7Z F;  1FSE A;  1FZP B;  1J09 A;  4BXF A;  1D0Y A;  4YG2 F;  5CVR A;  1X2N A;  2GAU A;  3AFH A;  2STT A;  1X1D A;  1D1C A;  2QWW A;  4CO8 A;  4M3G A;  4KNY A;  3F21 A;  1OPC A;  3ABU A;  3BOQ A;  3KYL A;  2PG4 A;  2B63 J;  2BW3 B;  4YFN F;  3MD2 A;  5ILS A;  1GVD A;  2ZNZ A;  4BDZ A;  4ZC3 A;  3J81 K;  1Y39 A;  2KRH A;  2R7D A;  4I01 A;  3IKT A;  5HVQ C;  2YS9 A;  2L01 A;  2L9S A;  4PDK A;  4X1E A;  2NAZ A;  3IAS 2;  1KZH A;  3QOD A;  2E7W A;  1E2X A;  3S15 J;  2XC7 A;  3LSH A;  1TWG J;  1T08 B;  1U2W A;  3H5N A;  3QAH A;  3PIO F;  3EPZ A;  3K4L A;  2IA2 A;  1ZQ3 P;  2V79 A;  1IJW C;  4M3B A;  1O3Q A;  1HOM A;  2XKP A;  1ZG5 A;  2D45 A;  1GV5 A;  2IGO A;  1LVA A;  3OY9 A;  2HKO A;  4RGR A;  4JK1 X;  5JLX A;  1U8B A;  2LKX A;  2R7S A;  1RNL A;  2DA7 A;  2MD0 A;  1MDM A;  2IS2 A;  2CU7 A;  1PJR A;  3OIP A;  2LVS A;  3ML6 A;  4J00 A;  1WJB A;  4ITV A;  1B9N A;  4M3E A;  4HF2 A;  1R5G A;  2F4I A;  1D1B A;  1FYL A;  5J47 A;  4AU7 A;  1S72 I;  3GTK J;  4JX6 A;  1YFH A;  3K1P A;  2AQE A;  2X6W A;  4A5N A;  3FMQ A;  2KFD A;  3JR9 A;  2VBW A;  3FXQ A;  2G9W A;  3QP6 A;  3ZQF A;  5HLT A;  4NC8 A;  2XGD A;  3GTP J;  1TNT A;  2UXN A;  1R6R A;  1XCV A;  3K1M A;  5HLG A;  4KN7 X;  4AIH A;  3BCB A;  4I99 C;  3F23 A;  1Z6T A;  3VPR A;  4E7L A;  2M30 A;  3LOC A;  2FQ3 A;  1V55 H;  2UWM A;  2PEX A;  2Z9O A;  1JT0 A;  3CP8 A;  3HTS B;  3DFG A;  3EUH C;  2FXA A;  2EFQ A;  3HKZ N;  5AIP A;  2IS6 A;  3R6S A;  4ANJ A;  4MFE A;  1KU3 A;  3GFJ A;  2DOD A;  2PMU A;  1WPK A;  1A5J A;  2ZJR F;  4YEJ A;  2IJL A;  3AL0 C;  4RA2 A;  2LY2 A;  4OIN F;  5E3O A;  3F72 A;  4F93 B;  1Z7L A;  3NEU A;  2ZXH A;  4MTE A;  4IHS A;  1QO0 D;  4XL9 A;  2M7A A;  2LRE A;  3F22 A;  1TWA J;  2VKD A;  3RZD J;  2DQR A;  5J40 A;  4IOC F;  1TWF J;  1IV6 A;  1JT6 A;  3OL4 A;  3PUB A;  3S3N A;  3WG9 A;  2F5C A;  2WB1 N;  3MAJ A;  2L9N A;  3JRB A;  3RPU D;  2GA1 A;  3GX4 X;  3T0Y A;  2M9H A;  4Y13 A;  1Z9C A;  1MNM C;  5E3L A;  4XN3 A;  3HYI A;  3BRO A;  3CCU I;  1PVE A;  1XSX A;  3BG5 A;  1FOK A;  1LEB A;  3HEF A;  3CCL I;  2R7O A;  3G1M A;  3LFU A;  4UY8 I;  3W3C A;  2AO9 A;  3VEP A;  3K4C A;  2QM3 A;  4ABZ A;  3MZH A;  1D3Y A;  1OFC X;  2CH0 A;  2JSC A;  4AIK A;  3MKZ A;  2Y0S A;  4UB8 C;  2V26 A;  4UHT A;  1I6X A;  4HEA 2;  4NQW B;  2MH9 A;  3C1D A;  4BJ6 C;  2Z33 A;  4WK8 F;  4HST A;  1RIO H;  2FUG 2;  2MD5 A;  1OCT C;  2NVQ J;  4RAZ A;  3DBH B;  3Q9S A;  4BY7 J;  2XIG A;  1MNE A;  5A2Q Z;  1ZAR A;  5F27 A;  5K7H A;  2EH3 A;  3KPH A;  3TO7 A;  3DBL B;  2BYV E;  4DQ2 A;  2WWY A;  2FBK A;  2R5Z B;  5KAF C;  2L02 A;  2I5U A;  1IRF A;  4KIF A;  4CSW A;  4E4H A;  4RB1 A;  4LLN A;  1F43 A;  1LDJ A;  1FYM A;  2E1N A;  4JOM A;  2K02 A;  4J19 A;  4X6A J;  2O03 A;  4LIU A;  2P6T A;  3IRQ A;  2PBI A;  4CYD A;  4C3H J;  2VKH A;  1QZY A;  2EB7 A;  4RLF A;  5CVI A;  2HWV A;  4D1Q A;  2FJ1 A;  5D5W B;  3E5X A;  2STW A;  1TLH B;  5H6Q A;  5HDN A;  1O4X A;  3VSL A;  1XMK A;  3C7J A;  2JWT A;  3DU5 A;  4PK4 A;  1S7E A;  3WGI A;  3MFK A;  2O5R A;  3HOY J;  1ZAO A;  2FMY A;  3REO A;  5CJ9 A;  2X51 A;  4XKB A;  2RKH A;  1UFM A;  2IGM A;  2GOX B;  2ZBK A;  3I5U A;  3CP2 A;  3G73 A;  4LB6 B;  4PFP A;  3FDY A;  3WHB A;  2R7T A;  1R7J A;  2DOF A;  3G2B A;  5TIS C;  1J0R A;  5L3F A; 
#chains in the Genus database with same CATH homology
 4UXN A;  2XAS A;  2X0L A;  3BZ6 A;  1SFX A;  5FO5 A;  5A2Q K;  4LG0 B;  1D8J A;  1PP7 U;  1IXC A;  1ZHF A;  1JE8 A;  1Z7U A;  1P4W A;  1WQ2 A;  3GLX A;  4AWX B;  1MD0 A;  4EGY A;  3J80 K;  3ECH A;  1FSH A;  1UHW A;  4YFK F;  2XGX A;  1A04 A;  3V8J A;  2K27 A;  3R60 A;  2P7C B;  1PUE E;  4I98 B;  2P5K A;  4M72 A;  1R1V A;  1SD5 A;  1EH8 A;  1K6O A;  5TJJ A;  3I59 B;  3C18 A;  4ZYE A;  1XGO A;  4OIR F;  2XRO A;  3G3Z A;  4I02 A;  1ZRF A;  5BPD A;  1UHM A;  2A68 F;  4LB5 A;  2F5D A;  1LJ9 A;  3GZ5 A;  5BPI A;  3KEO A;  5K5O A;  2R7F A;  4LGW A;  3WE3 A;  3I53 A;  3H3U A;  1YO5 C;  1KU7 A;  4KUM A;  4YIF A;  2VBY A;  3TOA A;  2CYY A;  5D8K B;  4KIB A;  2HZT A;  3B02 A;  1BN5 A;  3PFI A;  3ZQ7 A;  3HRT A;  5ILU A;  1FBU A;  2VE8 A;  4ENM A;  4L9V A;  3FHZ A;  5HDG A;  4EM2 A;  4OOI A;  5FFZ A;  2YX7 A;  3KP4 A;  3SQN A;  4HQE A;  4S04 A;  3TO9 A;  1YW9 A;  4BNC A;  1R5H A;  1IN4 A;  4KMF A;  1L0O C;  5F64 A;  2FE3 A;  4N0B A;  1ZLJ A;  3O2P E;  3W6K B;  4GGG A;  3KP2 A;  1RZ4 A;  2YU3 A;  2HKX A;  3QPH A;  1SFE A;  4L9N A;  3R4K A;  3HTU A;  5BQT A;  4G8X A;  2LKP A;  2EK5 A;  5ICE A;  3HSE A;  4U0V A;  2MH2 A;  4UVB A;  2XAQ A;  5CYV A;  3Q9V A;  3L2C A;  4JBA A;  5FD6 A;  3BDD A;  3ISP A;  4WXH A;  2NYX A;  3CLO A;  2DI3 A;  3HHG A;  1KYZ A;  4S05 A;  1B1B A;  4AVP A;  2P4W A;  3EUH A;  3V7S A;  4IVN A;  2HFH A;  3JSO A;  1BI2 A;  2IT0 A;  4HF1 A;  4HYE A;  1I5Z A;  2WTE A;  2K86 A;  1FPQ A;  4P9F A;  2OZU A;  2NNY A;  5E8G A;  4AIJ A;  5LHH A;  1HW1 A;  3R61 A;  4Q5S F;  3ZP5 A;  2QQA A;  3E6B A;  1MZB A;  5FGM A;  2FF4 A;  4RGS A;  3L7W A;  2W25 A;  2H09 A;  3S2W A;  4UV8 A;  4L5I A;  2LSO A;  2P5V A;  5BOX A;  2CWE A;  2EFO A;  3V7R A;  1JXS A;  5F6F A;  4EJW A;  3KZZ A;  1T2K A;  2Y48 A;  2W57 A;  5D6E A;  2Y0M A;  3HOS A;  1G4D A;  2PMH A;  4NHJ A;  4UUV A;  5D5X B;  4XSZ F;  2JPB A;  2HDC A;  3P9I A;  4ESJ A;  1TQM A;  4M9Z A;  5HLH A;  5IT9 K;  2BE5 F;  4CDG A;  3DV8 A;  5ICC A;  3RYP A;  2TDX A;  2QUF A;  2RNJ A;  4LFU A;  4O5V A;  1D8K A;  1W7P B;  2IP2 A;  5J8C A;  1G3Y A;  5FLX Z;  1TBX A;  5HOO A;  4TV7 A;  3WOD F;  2M87 A;  2M5W A;  1XB4 A;  2DW4 A;  2QBY A;  3RIR A;  4RB3 C;  3HSF A;  4IRI A;  1QGP A;  3TDU C;  4IPA A;  4I09 A;  5E1Z B;  2HYF A;  1HKT A;  4A12 A;  3ZMV A;  4KFC A;  1H9T A;  5DD4 A;  1QNT A;  1FC3 A;  5JVT A;  1MDM B;  3BJ6 A;  3U1D A;  3ERE D;  1R36 A;  3RDI A;  3K2Z A;  1I27 A;  3V8K A;  1JGS A;  2R3S A;  3K69 A;  2E1C A;  3HUG A;  2D2W A;  3JSP A;  5J8F A;  2M1B A;  3E5Q A;  1KYW A;  4G94 A;  5DCF A;  4Z2Y A;  1BIB A;  3K0L A;  1GXQ A;  4CGZ A;  1HW5 A;  5BMZ A;  1V4R A;  2QZ8 A;  4WCG A;  2L4M A;  3F8N A;  3P7N A;  4U0Y A;  1FNN A;  1RUN A;  4XLP F;  2XAG A;  1WWX A;  1O3S A;  4HW0 A;  3T8T A;  3NRV A;  3HRM A;  2JPC A;  3CJN A;  3PQJ A;  2WC2 A;  3KP6 A;  1QZZ A;  2Z5U A;  3O3K A;  5D4R A;  1FP2 A;  2DO7 A;  5AIQ A;  1BC8 C;  2OA4 A;  1V3F A;  4KIC A;  4LLL A;  4HLX A;  4U88 A;  2O8X A;  2Q8K A;  4PCQ A;  3RPQ A;  1JHH A;  5L3D A;  3H3Z A;  4WXD A;  4OIP F;  1S7O A;  2LDU A;  5K5Q A;  3N97 A;  4L18 B;  2QEN A;  4M71 A;  2XRN A;  1VTN C;  4G9Y A;  1GHC A;  3DEU A;  3ULQ B;  2DPU A;  2V6C A;  4G7H F;  1AWC A;  3VOE A;  3E5U A;  2GXB A;  4OU0 A;  4BQA A;  5FB2 A;  1X3U A;  3JAM Z;  1DUX C;  3W6J B;  1K78 A;  3FZV A;  1OYW A;  2F2E A;  3WGH A;  5D4S A;  2EV6 A;  3EQL F;  2QVO A;  3WTX C;  5LGT A;  1XGM A;  3CO7 C;  3R0A A;  2Q2E A;  2YSR A;  4H0E A;  5HDK A;  4P55 A;  5JFR A;  4Q47 A;  2PLY A;  5HS7 A;  3GEZ A;  3COA C;  5KVR A;  1SAX A;  1MJ9 A;  2OD5 A;  4FX4 A;  1BOA A;  2UZK A;  2VC0 A;  2EFW A;  1P2F A;  4I0A A;  3IC7 A;  4MGR A;  2DK5 A;  4MNU A;  2DQL A;  5L3E A;  1H0M A;  1SD4 A;  2HR3 A;  5LLQ A;  4MTD A;  1R58 A;  1KGS A;  2PFB A;  4P96 A;  3MZY A;  1O3R A;  4RB2 C;  4UNO A;  4A6D A;  1ZG3 A;  3KCC A;  4BAY A;  2O6G E;  1YG2 A;  4A5M A;  3SZT A;  5JI6 A;  3M9A A;  2CG4 A;  2EV0 A;  1B4A A;  4I7H A;  3FXU A;  1KQ8 A;  3H92 A;  5LRS A;  2HOE A;  1E17 A;  1KA8 A;  4A6E A;  1W5T A;  1EV7 A;  3C3W A;  4KYW A;  3V7C A;  3CUO A;  3K1N A;  5DEQ A;  2ISZ A;  3JTG A;  2ZME A;  4MEY F;  1MKM A;  3J81 Z;  5LGN A;  4IRG A;  1B9M A;  5DDG A;  1AOY A;  1BBY A;  2ZFW A;  4A0Z A;  3I59 A;  4P5O A;  2BEO A;  3DPT A;  2VOD A;  3HIF A;  4HBL A;  3RPU A;  3I58 A;  1U5T C;  1P4A A;  2ACJ A;  2P5L C;  3T1B A;  1R1T A;  3M8E A;  5LHI A;  1ZN2 A;  2K7L A;  1OMI A;  4RB0 A;  2XUB A;  2DT5 A;  4BXU A;  1KQ9 A;  2PN6 A;  2DTR A;  2FU4 A;  3GWZ A;  1QQI A;  3U9G A;  3IHU A;  1U8R A;  4YII A;  5F1R A;  2L4A A;  2RVC A;  4M74 A;  2QQB A;  5E20 A;  2VC1 A;  4EJU A;  1ZYR F;  1MJB A;  3IL2 A;  2RN7 A;  1YTY A;  3FWE A;  2P6S A;  1UST A;  4IF4 A;  4B09 A;  3LQQ A;  4WF2 A;  4WX9 A;  5H20 A;  5LBQ A;  3TO6 A;  4ENK A;  4M6X A;  1IF1 A;  4PGG A;  4ZZD A;  3GYH X;  4M9X A;  1ZLK A;  1BIA A;  1IUY A;  2ADU A;  1MJA A;  4GXO A;  1P4X A;  5DUI A;  5CLS A;  4KN4 X;  5AON A;  3M7G A;  3D5L A;  1IW7 F;  4XLN F;  5D6F A;  3RKY A;  2KRF A;  2CSO A;  3F3X A;  1I1S A;  3DXJ F;  4D0P A;  2E7X A;  3V4G A;  1J9I A;  3CUQ A;  2DLL A;  1DP7 P;  4EJT A;  3WTY C;  4EMS A;  3GZ6 A;  4R8H A;  2GXG A;  2JRT A;  5CVU A;  4F7Z A;  1HBX G;  3DF8 A;  3F6O A;  2MLG A;  3WU0 A;  5E17 F;  1T98 A;  3JTH A;  4CZZ A;  1U5T B;  1O7F A;  3QOP A;  1WKM A;  3E3V A;  4ZYG A;  1YS6 A;  3T5X A;  3L09 A;  2EA2 A;  2EV5 A;  2EFP A;  1BI3 A;  5HS9 A;  4WWC A;  3LWF A;  2D1H A;  4BHP A;  2DK8 A;  1YW7 A;  3ROU A;  2PQ8 A;  3KET A;  2ZJ2 A;  4O6J A;  2A07 F;  3GW2 A;  1Z6R A;  3AAF A;  4KIG A;  1BJA A;  3BJA A;  2JZY A;  4PZJ A;  4ESF A;  1T6S A;  2YX4 A;  2GWR A;  3R0J A;  2COM A;  1STZ A;  1XN7 A;  4ZZL A;  3EET A;  4BHB A;  1TTY A;  4N9I A;  4RGU A;  2A69 F;  2V1U A;  2K4B A;  5JR3 A;  1IN7 A;  2W85 A;  3QP5 A;  3TOB A;  3BJO A;  3FM5 A;  4M6Y A;  5EEG A;  4MQV A;  5DCM A;  2MLK A;  2EWN A;  2QBY B;  2HTJ A;  2IA1 A;  4OIQ F;  4XRF A;  1ZRD A;  2M8E A;  4XSX F;  5KK1 A;  1O3T A;  1FLI A;  3M8F A;  3F8M A;  2FNP A;  2V1D A;  3KFW X;  4HDV A;  1FT9 A;  1W5S A;  5LHG A;  2OQG A;  4G6D A;  2VON A;  2KJC A;  3I71 A;  5FLX K;  3RI4 A;  2D1V A;  1J7K A;  4LK1 F;  3ZMU A;  2KKO A;  2ZNY A;  2IVM A;  3JW4 A;  3D0S A;  1FX7 A;  2DFI A;  1R23 A;  2DAO A;  4L0Y B;  3KE2 A;  4EJO A;  4HDU A;  5D8L B;  3BP8 A;  1YIO A;  2OQR A;  4L9J A;  2HS5 A;  1SMY F;  4BHC A;  5HLI A;  2PI0 A;  2KIM A;  1B6A A;  2VOP A;  1ULY A;  2A3S A;  2J5O A;  4HOB A;  4ZYH A;  1R1U A;  5HS8 A;  1Z91 A;  3I4P A;  4Q48 A;  1LDD A;  1NHA A;  1SMT A;  3WTW C;  4BYY A;  4LMY A;  3RYR A;  5L3G A;  1IN6 A;  3F8C A;  3FMS A;  3WE2 A;  3O6B B;  2XAJ A;  2XV4 S;  1TNS A;  4ZH4 F;  3FMR A;  1IRG A;  1EH7 A;  3FF5 A;  1K7A A;  5FD5 A;  2HQN A;  2B0L A;  2NS0 A;  3ELK A;  4GYI A;  1R00 A;  2G7U A;  1ZG1 A;  2A5Y B;  3LAP A;  2ZXJ A;  4GO1 A;  1KQ0 A;  3RKX A;  4KMU X;  2FA5 A;  5BS6 A;  1J59 A;  4CXF A;  5J6X A;  3WTT C;  3L00 A;  1F9N A;  2VOO A;  3NQO A;  2C6Y A;  3SZP A;  1W7P A;  3ZMZ A;  4ENJ A;  2A6H F;  5JHU A;  3GVA A;  3ZMT A;  2O3F A;  4L9T A;  2O0Y A;  1YLF A;  3KP3 A;  3BY6 A;  2BV6 A;  1USS A;  4ENN A;  3WTZ A;  4CIC A;  1BI0 A;  6PAX A;  3F6V A;  1GVJ A;  2VT2 A;  4DNC A;  2Z3Y A;  3CUQ C;  3F8B A;  2LNB A;  2XAH A;  4Y15 A;  4KA4 A;  1ZRC A;  2IPQ X;  2QQ9 A;  1PP8 F;  4FT8 A;  4HZF A;  3MEX A;  1ON1 A;  4RAY A;  1J5Y A;  2L3D A;  1XCB A;  2YR2 A;  3E6D A;  3L9F A;  2K4J A;  2H27 A;  5CVJ A;  4QWQ A;  1XGS A;  1H9G A;  3HRS A;  3ZMS A;  4HX7 A;  2GZW A;  4K2E A;  2RGV A;  4WXC A;  1WI9 A;  4A0Y A;  1FY7 A;  3LA2 A;  4EM0 B;  1G6N A;  2W84 A;  3TGN A;  1J75 A;  2GA2 A;  2EFN A;  2H6B A;  2O61 A;  3SFZ A;  3IRR A;  1TW2 A;  5ILV A;  2FBI A;  2W24 A;  5IT9 Z;  2LF8 A;  4IRH A;  3CTA A;  1RUO A;  1I1G A;  5D5U B;  4OMY A;  1SD6 A;  4E70 A;  5K1Y A;  2OBP A;  1T39 A;  1Z1D A;  4HX8 A;  1HSJ A;  1YQA A;  3ABT A;  1O7L A;  1SD7 A;  1CGP A;  3VFZ A;  3GFL A;  3ECO A;  2ISY A;  4LD5 A;  2OU2 A;  3KZY A;  3EDP A;  4L0Z B;  4FX0 A;  5K5R A;  1TW3 A;  1ON2 A;  2VT3 A;  3MCZ A;  4MQ9 F;  1KU2 A;  2FOK A;  4R1H A;  3HRU A;  2CQK A;  5E8I A;  1ZRE A;  3J80 Z;  1P92 A;  2NNN A;  4A2U A;  2QLZ A;  3P9K A;  2LF7 A;  2MA3 A;  2CO5 A;  1OYY A;  4XBF A;  5IT3 A;  4I0B A;  4Q4Z F;  1LNW A;  2Q0O A;  1CF7 A;  3DQV C;  1K78 B;  3I0T A;  2EA4 A;  1EH6 A;  1FBS A;  5DD8 A;  1QPM A;  5L3C A;  3LA3 A;  1FYK A;  2ESH A;  4U7B A;  2GIV A;  4P9U A;  3VOD A;  2BGC A;  3Q5F A;  2J5P A;  3CUQ B;  4RGX A;  1T0F A;  4ESB A;  1J2X A;  1Q1H A;  1ZH5 A;  5L3B A;  4QLC U;  3LQR A;  3E6M A;  4LK0 F;  1TQP A;  1HST A;  1DPU A;  3HSR A;  1HKQ A;  5E1W A;  2RDP A;  1BI1 A;  3QU3 A;  3TKY A;  5EEH A;  2JT1 A;  2NRA C;  1IZ1 A;  1T38 A;  1FWZ A;  1U5T A;  2YPR A;  3KEQ A;  4LJZ F;  3IKV A;  3VB2 A;  2H6C A;  2VN2 A;  1BM9 A;  2CFX A;  2L54 A;  5ICG A;  4HF0 A;  4EV0 A;  1XSV A;  4G6Q A;  4JQF A;  1G3T A;  3TDZ C;  2F5F A;  2DBB A;  3FXR A;  3BPX A;  1S8N A;  5FFX A;  3OV8 A;  2XHK A;  4HLY A;  2XAF A;  2ELH A;  3WTS C;  3KLN A;  4HV6 A;  2H94 A;  4AD9 A;  4Y17 A;  1JHF A;  2XVC A;  5LRR A;  2JTV A;  1YS7 A;  1HXD A;  5DUK A;  1OR7 A;  4MHG A;  2VBX A;  2QYO A;  1L3L A;  3HHH A;  3E6C C;  2DPD A;  1REP C;  2P7V B;  3GXO A;  4IJA A;  3K9T A;  4LG0 A;  1CF7 B;  1PDN C;  3GF2 A;  1FBQ A;  5TRD A;  2DU9 A;  3PQK A;  3SXY A;  4G7O F;  1HW2 A;  3WGG A;  1IXR C;  4EGZ A;  1G3W A;  1XDU A;  4EM1 A;  4HX4 A;  1C0W A;  3CDH A;  4B8X A;  3I64 A;  2PJP A;  4KDP A;  1XGN A;  4ZYD A;  3OOP A;  1S7A A;  2ETH A;  2CW0 F;  2RV8 A;  3M1E A;  4HV5 A;  2V9V A;  2HYG D;  2AS5 F;  1RI7 A;  1IN8 A;  1KU9 A;  3RJP A;  3SHF A;  1ONV A;  1LQ1 A;  2ZME B;  5ERI A;  1GXP A;  1IXS B;  2Y75 A;  3RKW A;  2P8T A;  4EVI A;  2KIU A;  3KLO A;  3ZN1 A;  3TQN A;  4UVC A;  1WSU A;  4FHT A;  2MC3 A;  3U2R A;  2MBF A;  3HOT A;  3KP7 A;  3N4M A;  1IAW A;  2EJR A;  4GCV A;  3WTV C;  2ZKZ A;  4L5J A;  1IN5 A;  4UVA A;  4NB5 A;  4EJV A;  1WRJ A;  2IW5 A;  4M73 A;  3GFI A;  3JAM K;  2FSW A;  3ZN0 A;  2ESN A;  2A61 A;  4HA8 A;  2HEO A;  2X4H A;  2FML A;  1HKS A;  2M45 A;  2RC4 A;  2XKO A;  2AXL A;  3KP5 A;  4ETS A;  4CHU A;  4R79 A;  3E97 A;  4KT5 C;  1XDS A;  3DP7 A;  4IXA A;  3IWF A;  2OAZ A;  1U3E M;  1HQC A;  3LST A;  3F8F A;  3IWZ A;  4IHT A;  2FEZ A;  1S6L A;  1OKR A;  2F5E A;  5ED4 A;  4MEX F;  2OZ6 A;  5DV5 A;  3ZPL A;  3FM3 A;  1P6R A;  4N9H A;  2VXZ A;  2Z99 A;  3J7A O;  3GO5 A;  1K79 A;  3B73 A;  1U78 A;  4PGH A;  1U6G A;  4OMZ A;  3P9C A;  3T8R A;  3EYY A;  4ON0 A;  2VBZ A;  2HQR A;  1G3S A;  2FNA A;  2RQP A;  2VE9 A;  3CO6 C;  4GYG A;  2BBY A;  1YW8 A;  1XD7 A;  2HGC A;  1D5V A;  3GUD A;  1UB9 A;  1B59 A;  2KIF A;  4ASN A;  1R22 A;  4YFX F;  5DYM A;  4A0X A;  3ZMD A;  3LA7 A;  2V1X A;  5D5V B;  4HQM A;  3FX3 A;  1SFU A;  2CGP A;  4HAM A;  4BH9 A;  1ODD A;  4O3M A;  2A6E F;  4M9S A;  4UV9 A;  1O57 A;  5E1X A;  3BWG A;  5CVV A;  2IA0 A;  5LEJ A;  3DKW A;  3V8L A;  1F5T A;  1W7P D;  4LLG F;  5LGU A;  3GFM A;  4U0W A;  3EYI A;  3RTR A;  2G7H A;  1FP1 D;  2FBH A;  1UCR A;  1Z05 A;  4I2O A;  3I54 A;  2WV0 A;  1XMA A;  2UXX A;  3LAJ A;  2IRF G;  2GQQ A;  1YYV A;  1F1Z A;  1ZGJ A;  3MWM A;  1DDN A;  3LFK A;  4U7D A;  3DPL C;  1LEA A;  3WTU C;  3QPT A;  1LB2 A;  3MQ0 A;  1BC7 C;  4EQQ A;  5E18 F;  1ZGA A;  5LEK A;  1W4M A;  1QBJ A;  1LDK B;  1MGT A;  1F4K A;  3QU6 A;  4NQW A;  1Y0U A;  5DCM B;  1S3J A;  2FRH A;  3BPV A;  4RS8 A;  3QRF F;  1TQI A;  5ICF A;  1DPR A;  2ZCW A;  2ZO4 A;  1OYI A;  1S29 A;  2KJB A;  4OIO F;  5H6R A;  2HTS A;  3WU1 B;  1XSD A;  4G7Z F;  1FSE A;  1FZP B;  4YG2 F;  5CVR A;  2GAU A;  2STT A;  2QWW A;  4CO8 A;  4KNY A;  3F21 A;  1OPC A;  3ABU A;  3BOQ A;  2PG4 A;  4YFN F;  5ILS A;  2ZNZ A;  3J81 K;  2R7D A;  4I01 A;  3IKT A;  5HVQ C;  2L01 A;  4PDK A;  2NAZ A;  2E7W A;  1E2X A;  1U2W A;  3QAH A;  2IA2 A;  2V79 A;  1O3Q A;  2XKP A;  1ZG5 A;  2D45 A;  1LVA A;  2HKO A;  4RGR A;  4JK1 X;  1RNL A;  1MDM A;  3ML6 A;  4HF2 A;  1B9N A;  1R5G A;  1FYL A;  1YFH A;  3K1P A;  4A5N A;  3FMQ A;  2VBW A;  3FXQ A;  2G9W A;  3QP6 A;  1TNT A;  1XCV A;  2UXN A;  3K1M A;  5HLG A;  4KN7 X;  4AIH A;  3F23 A;  1Z6T A;  2M30 A;  2FQ3 A;  2UWM A;  2PEX A;  2Z9O A;  3HTS B;  3DFG A;  2FXA A;  2EFQ A;  5AIP A;  3R6S A;  1KU3 A;  3GFJ A;  2PMU A;  2IJL A;  4OIN F;  3F72 A;  3NEU A;  4MTE A;  4IHS A;  1QO0 D;  3F22 A;  2DQR A;  3WG9 A;  2F5C A;  3MAJ A;  2GA1 A;  3GX4 X;  3T0Y A;  4Y13 A;  1Z9C A;  3HYI A;  3BRO A;  1XSX A;  1FOK A;  1LEB A;  3VEP A;  2QM3 A;  3MZH A;  1D3Y A;  2JSC A;  4AIK A;  4UHT A;  1I6X A;  2MH9 A;  3C1D A;  2Z33 A;  4WK8 F;  1RIO H;  2MD5 A;  4RAZ A;  3Q9S A;  2XIG A;  5A2Q Z;  1ZAR A;  3TO7 A;  2BYV E;  4DQ2 A;  2WWY A;  2FBK A;  2L02 A;  1IRF A;  4KIF A;  4RB1 A;  4LLN A;  1FYM A;  1LDJ A;  2E1N A;  2K02 A;  2O03 A;  3IRQ A;  2P6T A;  2PBI A;  4CYD A;  1QZY A;  2EB7 A;  5CVI A;  2HWV A;  5D5W B;  3E5X A;  2STW A;  1TLH B;  5H6Q A;  5HDN A;  1XMK A;  3C7J A;  3WGI A;  3MFK A;  1ZAO A;  2FMY A;  3REO A;  5CJ9 A;  2RKH A;  1UFM A;  2ZBK A;  3I5U A;  3G73 A;  4LB6 B;  1R7J A;  1J0R A;  5L3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...