3CQZJ

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3cqzJ00
1U9OA 3BTLA 4IHYA 2R0QC 3BQYA 4QIWN 2QCOA 2DA5A 3HGGA 5F1JA 4UUTA 3PO2J 4CYCA 3WHCA 4A3FJ 3FIWA 1MNMC 2M0CA 1ZQ3P 3BR3A 4MLOA 2E19A 3ZQIA 5EF6A 5FLVA 3BQZA 2JN6A 3LSJA 3TW7A 4C3IJ 1MH3A 2K9NA 1UHSA 2DA1A 2VI6A 2Y9ZA 1JT0A 3CQZJ 3G1MA 2X6OA 4JX5A 3I4MJ 1ORKA 2O9LA 3HM5A 3L1PA 2EZKA 2ID6A 3IH2A 1IRZA 4BBRJ 3DEWA 2LD5A 1ETOA 1U8BA 3SDGA 2W48A 3D1NI 3MVPA 5F0FA 3GTJJ 1Z77A 3FK7A 3OSGA 3GTGJ 2LFBA 1AU7A 2O7OA 1ZR2A 2FD5A 5K7FA 1F43A 1MBEA 4FE7A 1JKOC 1JGGA 2NVTJ 1Y1WJ 4RDUA 2Y9YA 3FK6A 4QTRA 5F27A 1AKHA 4ABZA 1TWAJ 5C4JJ 3JRFA 2O8KA 3HOVJ 1I6HJ 3TW6A 5M5XJ 3W6VA 1K83J 1IJWC 1MBJA 1ETKA 1GDTA 3JREA 1G2HA 2HOAA 5EYRA 5IP7J 3S1RJ 1YRNB 2HXOA 1VNDA 2JA8J 4M3BA 4A69C 1OFCX 3S2HJ 1B72B 2FX0A 3LSRA 5EGOA 2GM4A 2K9SA 3E7LA 3GTLJ 2OF7A 3A01A 1QPIA 2MGQA 1FTZA 1NK3P 2EH3A 4M3EA 2CQQA 2DA4A 2JMWA 2HYJA 4A3EJ 2VKVA 5EDNA 1IGNA 1IG7A 4AC0A 3JRDA 1VI0A 5EZGA 3HOYJ 3O8GA 4FCYA 3GTMJ 4D7NA 1ZR4A 4G12A 1P7JA 2LTPA 2XB5A 4JX4A 1FIPA 1JTXA 2R5YA 2NVQJ 3HOUJ 3DCFA 1WCMJ 3RKQA 1APLC 2H8RA 3HOWJ 2DMNA 1TWCJ 2E2JJ 2E2HJ 4A3MJ 2XPVA 2JA6J 2GBYA 5IYDJ 3BR2A 2WAQN 1ZTRA 1ENHA 4J19A 2X48A 1QRYA 3ZQFA 5GPCA 1ETWA 4MFDA 3PM1A 1X58A 1W0TA 2DN0A 1RETA 3BR5A 4A3IJ 3H3VK 4D5FA 1SANA 4IEJA 2VKEA 4MIMA 4M3GA 2MW8A 2I10A 2B63J 3I4NJ 4XRSG 1RESA 2DA6A 3BR6A 5E3OA 3O8HA 4DYRA 4Y7NJ 1W0UA 1OJLA 2L0KA 4IHXA 1X2NA 4UUSB 4B3AA 1LE8B 1LFUP 3BTJA 5J1RA 2EZIA 5K7HA 5FKOA 1MSFC 3IH3A 3ZQLA 2ME0A 2L9RA 1RKWA 4NDLA 1XS9A 2EBIA 3HKZN 4X6AJ 2PMZN 4V2FA 3A02A 4C3JJ 2CJJA 2K9QA 1UMQA 2ME6A 5J1YA 4XK4A 4MFEA 2M2EA 5FKLA 4DW6A 2XPWA 2HDDA 2CUEA 2ELKA 5FKKA 2CUFA 2DMQA 5HODA 1DU6A 4GFBA 2Y0SN 4JYKA 9ANTA 2L7ZA 3NARA 4D7MA 1JJ6C 1RKTA 2DMPA 4XRSA 3BG3A 3A03A 1F36A 1QVUA 4I6ZA 3HBLA 3JRBA 3RZOJ 5DS9A 5FKMA 3F0CA 3ZQHA 1GVDA 2H1KA 1MBKA 2LLKA 5EZHA 5IP9J 1JJ8C 2R93J 1B8IB 1WH5A 3IH4A 2R92J 2KT0A 2XB0X 1R9TJ 1MBGA 2LP0A 1JKQC 1H89C 1YRNA 3S17J 2AO9A 2ID3A 4A3LJ 4HNVA 1ETXA 4Y52J 1HDPA 3B6CA 2MG4A 1B72A 2NS8A 5EG0A 1TWGJ 4X1EA 4XIDA 1PUFB 3CMYA 1RR7A 3Q0UA 3RQIA 4BBSJ 2MSYA 4A3GJ 3M3YJ 4IHVA 3JR9A 5GPAA 2NVXJ 3BR1A 1ETVA 1EF4A 1JT6A 1I50J 1JUSA 4JP0A 2XGDA 1JTYA 1FEXA 1MBHA 3H0GJ 2EQRA 1GUUA 3OSFA 5IYBJ 2JK3A 2E2IJ 3S15J 1XG1A 2DTZA 2LR8A 1FJLA 3FKIJ 3HOXJ 1ZK8A 2R5ZB 3HOZJ 1SFOJ 2CU7A 1H8AC 1MSEC 3K2AA 3JRIA 4LOCA 1K61A 3Q0VA 2RAEA 1ITYA 2YUSA 5JLWA 2ECCA 3S1MJ 1BL0A 3JRAA 3PO3J 3S14J 5J1UA 5E3MA 3FISA 4BXXJ 2DMTA 1IV6A 5F0HA 1HDDC 5IOYA 2FJ1A 1CQTA 1Z0XA 4XRMA 4BY1J 1IDZA 1JKPC 1OCTC 2IEKA 2KDZA 2E1OA 3CDLA 3K7AJ 1O4XA 4AYBN 2TRTA 4FISA 3MN2A 5DTDA 2XGEA 3C2BA 5E3NA 4UUSA 3NAUA 1IDYA 1LE8A 3MKLA 3TP3A 3S16J 3BG5A 2XRLA 2ZB9A 3ZQGA 2TCTA 1MBFA 1X2MA 4M3DA 3S1QJ 3Q3SA 4V2GA 5M5WJ 3LSGA 2OPTA 5E3LA 2EZLA 5EEAA 3GTPJ 4EEFG 1HF0A 3HB9A 2CQXA 4A3JJ 2ECBA 1VFCA 3QQAA 4L5EA 3GTKJ 5IYCJ 3GTQJ 5F04A 2X9DA 1ZGWA 2XGCA 4C3HJ 5IP6A 1D5YA 1TC3C 1XC5A 1E3OC 1FIAA 3LNQA 2G0EA 2AHQA 5C4XJ 4S0HB 2D5VA 4B1RA 5F08A 1JKRC 2HQ5A 5BNGA 4CYCB 3LOCA 2N8GA 2R7ZJ 2CRGA 4XICA 3JRCA 1GT0C 1AHDP 2NS7A 3HDDA 1WGXA 3BTCA 1ZKGA 1FTTA 1I3QJ 2NVYJ 3G1LA 5M3MJ 3HGYA 1LFBA 1B8IA 2JA5J 1T33A 4MO7A 3OOUA 2XPUA 5M5YJ 3OIOA 2YU9J 4M6VA 4DZJA 1HCRA 1P7IA 3BR0A 3JRGA 1H88C 1OCPA 2LK2A 2LKXA 2M8GX 2LVSA 1GV5A 1DU0A 2EZHA 2HI3A 4AUXA 1PUFA 2GLOA 1BJZA 1ETYA 4DYQA 2HOTA 2M9HA 3M4OJ 5C44J 2VPRA 2DJNA 3SJMA 5C3EJ 1IC8A 4BY7J 2Y2ZA 2WV1A 1S7EA 2YS9A 1ETQA 2IBDA 5F0CA 5FLMJ 1A6IA 1HLVA 3BT9A 1BW6A 1AKHB 3B6AA 2HXIA 2QF7A 4QSHA 2DA7A 2JJ7A 2IAIA 3QPLA 3BG9A 1T56A 2HOSA 3TP0A 4JX6A 5JLXA 2R5ZA 5GP9A 4A3CJ 1MH4A 3HEFA 3BTIA 4I76A 3GTOJ 1Y1VJ 5EG0B 1WH7A 3SFIA 3CCYA 1POGA 4C2MJ 3LSPA 3IV5A 3UKGA 1NK2P 2M34A 1BA5A 2FQ4A 5EGOB 1TWFJ 4FE4A 2LY9A 1Q1VA 5FKNA 1JUPA 3A01B 3ZOBA 3Q0WA 2JWTA 2K40A 2L7FP 1GV2A 2WB1N 4A3DJ 3QPSA 4FTHA 5FJ8J 3JRHA 2NOGA 5IOZA 1A5JA 3G1OA 5J3LA 3VPRA 3S2DJ 1HOMA 1U9NA 2DA2A 2DMUA 2Y30A 1NTCA 1IUFA 2Y31A 2R5YB 2VUMJ 4W1UA 1RPWA 1UG2A 2L7MP 4IHWA 4B4CA 2P81A 4DYCA 5IPAA 5M3FJ 3WHBA 4BKXA 4A3KJ 4M3FA 1WI3A 3RZDJ 5K7ZA 2COBA 4W97A 3GBGA 2DA3A 1TWHJ 2JA7J 2XSDC 4DZPA 3ZQCA 4A3BJ 1VF9A 1JUMA 4D5CA 1WPKA 4A93J 1U78A 4RBOA 1QVTA 3TEDA 1BW5A 3S1NJ
chains in the Genus database with same CATH superfamily
2E35A 4Y17A 3VYTB 2P0WA 2ZO4A 3CLQA 4RGXA 4BE1A 2QBYA 2LRDA 3BQYA 2XGXA 2VONA 4D9JA 2GOMA 4BXFA 2E1NA 1IRFA 2AQEA 3PO2J 1S29A 4UV8A 3JTGA 2VB6A 5D6FA 3WHCA 2QGUA 4HYEA 2M7BA 1FPQA 1ZQ3P 4IX7A 2ZNZA 1IXRC 3DBHB 5FLVA 1HW1A 3TW7A 4ESBA 3AFHA 1UHSA 3RKYA 2M7AA 4OAZA 1PYVA 4YRVA 3QYFA 3W6KB 2NOJB 2X6OA 4BL0B 3WTXC 3G6EI 1T08B 4PCQA 2O9LA 4PGHA 4IRHA 3IRQA 4BEHB 3IH2A 3L7WA 1SD6A 1P9QC 2LD5A 3JAMZ 2D1HA 1YW8A 1D5VA 4ENNA 1KU3A 2K4JA 4A5NA 3FK7A 1FYLA 2X6WA 2DO7A 2PG4A 2LFBA 3OSGA 3GTGJ 2O7OA 2FD5A 4Y13A 2FNPA 3CP2A 4Q4ZF 1MBEA 3ZRGA 2DOFA 5TGTA 2HZTA 4RDUA 1QU3A 2E60A 2Y9YA 3FK6A 4EM2A 2VL8A 5F27A 1AKHA 5C4JJ 2I5UA 3JRFA 3TGNA 1NH3A 2QWWA 3IHUA 2O8KA 2M4KA 4U0YA 3HOVJ 1IJWC 2LF7A 2XRNA 2DXIA 5KAIC 2B0LA 1G2HA 1R1UA 5EYRA 1UG0A 3J7ZI 3LL7A 3MEXA 3S1RJ 1FBUA 1T2KA 4G6DA 4BE0A 4C2TA 2J5PA 2COMA 2V1DA 5HNFA 2VT3A 1KONA 4HOBA 4B3XA 3K0LA 2FX0A 4CSWA 2GM4A 4FQGA 2K9SA 3AG1H 5ICEA 2IP2A 3BJOA 3C3WA 1K7AA 3GTLJ 3PIOF 3FXLA 4E7KA 1HC8A 2EH3A 3CUQC 4CA0A 4P55A 5CKTA 3M8FA 2P7CB 2UXNA 5LRRA 3F8NA 2FBIA 2L01A 4FCYA 3GTMJ 4L9NA 2XF5A 1P7JA 2LTPA 2Z3YA 2VQHA 2XB5A 5LEJA 1JTXA 3FMRA 2VBXA 3TO6A 3LQRA 1WWXA 2H8RA 1BJAA 1W5SA 3E5UA 2MLGA 2XPVA 1S7OA 3V7SA 3CCSI 3JTHA 2EFNA 2WAQN 1MJAA 1ENHA 2D45A 5FFZA 4LB5A 1ZGJA 4PJ0C 3PIPF 3H5NA 3K4LA 3JCUC 1HKTA 1OLTA 4LLNA 3E6DA 3GMEA 1XSXA 4HNTA 3GFLA 5CVRA 1RETA 3LQQA 3BR5A 1E2XA 4IRGA 1E17A 1YFHA 3BC8A 4IQ4A 2JPBA 2MBFA 1Q1HA 1QHGA 2MW8A 1A6QA 2NS0A 3KP7A 3VODA 1S9HA 2B63J 1DQUA 1W7PB 2DA6A 1Z1DA 5E3OA 1MNEA 2ZC2A 4DYRA 2O6GE 1W0UA 2Z33A 2VOOA 1QPMA 1LE8B 2EIMH 1LFUP 2YX7A 5L3DA 2BXZA 3CUOA 5J1RA 5LBQA 3L2WA 2EZIA 4KNYA 1SFKA 3DPTA 4B09A 3DP7A 3ZQLA 1BI1A 3HOTA 2L9RA 2W57A 4UY8I 2QUFA 3BZ6A 2H6BA 3HKZN 1Y56A 2KISA 2QQAA 1KU2A 1YLFA 2HVSA 1D0ZA 2X1CA 4C3JJ 2ZNYA 3MMYB 3OV8A 5KCMA 2HNHA 3F6VA 3K1PA 4XKBA 4KA4A 3AL0C 4WXDA 2V9VA 3H3ZA 3U9GA 1G8XA 2ME6A 5J1YA 3OYBA 1O57A 3DLLF 3P9CA 2OD5A 5ICCA 3EDPA 2WY7Q 5FKKA 2FMYA 2DPUA 1TZLA 2CUFA 3M8JA 4OINF 3EUKL 2A5WA 2R7FA 4DBQA 1A04A 2M1BA 4F92B 1MDMA 3BZCA 4NC6A 3K70D 2LREA 3A03A 3SQNA 1C0WA 2E34A 3D5SC 3WU2C 4I6ZA 2M87A 4RS8A 1A36A 4RM2A 1VZ0A 2CV0A 3LA3A 3P9KA 4P96A 4WXHA 4O6JA 2UUZA 1JJ8C 2P8TA 5IP9J 4BNCA 5J4YA 5J8CA 1WH5A 3JW4A 2R92J 1YX3A 1W1WE 3X2QH 2RNJA 2XAGA 4FX0A 4RAZA 2LP0A 5GTIC 5LLQA 3E0JB 4A3LJ 1XX5A 4MTDA 1ETXA 3PFIA 1J7KA 5ICGA 2LF8A 2MG4A 2ZSHB 3OS1A 5IT9Z 5FB2A 1B72A 4ZYAA 5EG0A 1PUFB 1REPC 2ZMEB 2YSRA 4P5OA 3E5QA 1RR7A 1X3ZB 4XLCA 4PK4A 3WU0A 1W4MA 1IN4A 4Q47A 1JT6A 3WGHA 4BUPA 2PI0A 4U0WA 4JP0A 2HQNA 2XGDA 2DLLA 3I54A 2WA0A 4CO8A 4YEJA 1HQCA 1NG7A 1GUUA 4EMSA 4OIPF 1N78A 2JK3A 3TBIA 3OYIA 2E2IJ 4IRIA 2K9LA 2DTZA 1Z21A 4PSXA 5B5EC 3FKIJ 2FRHA 2HOEA 1T39A 3HOZJ 2KDOA 4BGDA 2IS4A 1MSEC 3CF2A 1K6OA 4HF1A 1DPUA 1ODDA 1WRJA 4LD5A 4HLYA 3LWFA 1EJ9A 3Q9SA 1ITYA 2YUSA 5JLWA 3ISPA 4JQFA 5KAFC 4BHCA 3S14J 3RQ4A 3PNVA 3WU1B 2ADUA 1J5YA 2DMTA 3T8RA 3LSTA 4XLEA 3CO7C 1IV6A 4XLNF 1Z9CA 3J81Z 1L3LA 1B9NA 2HR3A 3VYUB 4OMYA 1CQTA 1CGPA 1Z0XA 2R7OA 1IDZA 1SAXA 3GXOA 1G3WA 3CJQB 3REOA 1V55H 5F1RA 1O4XA 4EM1A 1V54H 4PJLA 2TRTA 4Q48A 3WGGA 4FISA 4EM0B 2PQ8A 5LEKA 1BR2A 1U0JA 3MN2A 1MMGA 3QOEA 3NQOA 2QYOA 5E3NA 1H9GA 1IDYA 3HSEA 4I09A 2EWNA 2OTJI 5CQGA 1WJBA 3I71A 3IC7A 2VQCA 3CLOA 3LSGA 2O61A 2I8DA 5E1WA 4M6YA 4UVCA 2EZLA 1HF0A 2M45A 1ZN2A 2XV4S 1MKMA 2CQXA 4A3JJ 3TQNA 2DQRA 3QYEA 1VFCA 3H5AA 2VPLA 2PX9A 5HS8A 4OAYA 4BE2A 3GTKJ 2KJCA 2OZ6A 3W2VA 3OYCA 2STWA 5E8GA 4IL6C 1SC7A 4JK1X 5IP6A 4R8HA 1F4KA 1XC5A 3U1KA 3WTUC 2IGMA 3H3UA 4OMZA 2BVMA 2QBYB 2FUG2 5C4XJ 1ZRCA 3K9TA 2LY2A 2V79A 3GZ5A 1JHFA 2BOLA 2R7SA 4AVPA 2CRGA 4XICA 3CCJI 4HF2A 1ON2A 1R1VA 5LHHA 3BTCA 1B6AA 3DV8A 2CV2A 3OYFA 2J5OA 1KQ8A 1I3QJ 1T0FC 2Y48A 2EINH 3HGYA 4L9VA 3BCAA 2QQBA 2WBMA 2GZWA 2LH9A 3H9QA 2CFOA 2JA5J 4ETSA 3OOUA 2DK5A 5L3CA 2DAOA 3HYIA 2FF4A 4NNJA 5DYMA 1H88C 2LSOA 3HRUA 2HVQA 1FY7A 3SYTA 1EKEA 2DT7B 3SZPA 4YFXF 5ERIA 1PVEA 5DV5A 1GV5A 1OYIA 5KHDA 2HI3A 1BBYA 3H0DA 2GLOA 1BC7C 1ETYA 2NRAC 2HOTA 3TO9A 5HDNA 3ZPLA 2ZJRF 3OL3A 5C3EJ 5D8KB 2HDCA 1S7EA 2PMUA 2QQ9A 1PP8F 3TO7A 5FLMJ 1A6IA 2GIZA 4II2A 2FE3A 1AKHB 1X1DA 3CCEI 4LG3A 4LITA 2HXIA 2QF7A 4QSHA 1LJ9A 2JJ7A 3E5XA 4NC8A 3HZJA 2KIQA 4OIOF 2Y0MA 2BXYA 4BQOA 2HOSA 2VJJA 1ZGAA 2R5ZA 1RNLA 2UV1A 2JRMA 5HS7A 4I98B 1MH4A 2V6EA 3HEFA 2DT5A 2JA2A 4KJZA 3LSPA 1NK2P 3UKGA 3MZYA 2VC1A 3KPHA 1BA5A 4N4NB 5LGTA 1SFEA 4FE4A 4L0YB 4OIQF 3DTEA 3ESWB 5FKNA 2YPRA 5F64A 2RGVA 3ECHA 3F8BA 1A31A 3KEQA 4ON0A 1TP4A 2KJBA 1Z6RA 4YIIA 1Z7UA 4HAMA 5E18F 2XSJC 3CMAI 3PNYA 2Z9OA 3HXLA 4G8XA 3BPVA 2IS2A 1W7PA 2WB1A 1U9NA 1RI7A 3OIPA 1IUFA 2VUMJ 1Z05A 4P9UA 3ZMVA 1DP7P 2NVUB 3OIQA 3C18A 3VYRB 2P81A 4CUGA 4I02A 3EQLF 4M3FA 1IRGA 3GBGA 1JGSA 2H1LA 4PUSA 5JHUA 3QWLA 2P5LC 2XSDC 2JA7J 1VF9A 1XGOA 5J4VA 3CJTB 1VQOI 3H9GA 4E6KG 2E7XA 2DOAA 4M72A 2WAFA 4RM3A 1HA8A 3KZYA 3RPUA 3QOPA 1RUNA 5TJJA 4IHYA 1VQMI 4CYDA 5K5QA 5CPRB 1VTNC 1OCOH 2V7FA 2DA5A 1J2XA 2CSOA 4UUTA 5GTHC 1N75A 2RN7A 3GX4X 1GXQA 3A2KA 4A3FJ 2F5VA 5BQTA 1KZHA 4XN3A 1MW7A 4NQWA 4MHGA 3EETA 2WADA 3BR3A 1QA6A 2E19A 5EF6A 3HIFA 2GOXB 4BQQA 2K9NA 3ML6A 2DCEA 3CMMA 3OMYA 2VI6A 2Y9ZA 1DGWY 1WKMA 3DF8A 3MCZA 4IKFA 4KDPA 1KGSA 4JX5A 4D0PA 2LG4A 2BE5F 3FXKA 1IF1A 2DYSH 3HM5A 3L1PA 2ID6A 2V9KA 4BBRJ 4HNUA 3DEWA 1HXDA 3FBNB 1ZREA 4KYWA 2GQQA 3D1NI 1OPCA 3WTWC 2W85A 1XCVA 5F0FA 2HKXA 1MDMB 1ZR2A 4RGSA 1HSJA 5K7FA 2Y69H 4KMFA 3S3NA 3HRSA 2CW7A 2NVTJ 2K02A 5A2QK 1Y1WJ 1V3FA 2EPFA 2H09A 5DDGA 2W7NA 4ABZA 1QHHD 1YG2A 2FMLA 3C1DA 4HDVA 3HPHA 2BGCA 1UAAA 2FBKA 2OC6A 4IOCF 1R58A 1GXPA 4B48A 2G7UA 2HOAA 2L54A 3I5UA 5DM7F 2R4GA 2LC2A 4KIBA 4M3BA 5BMZA 3S2HJ 1B72B 1V5FA 2BY1A 4RB1A 3JSOA 4Y33A 3SZTA 5EGOA 2MC3A 3GFMA 4LJZF 1JXSA 3E7LA 1ZLJA 2OF7A 1LVKA 4IHTA 4XNFA 2VODA 4DGWB 2L9SA 3OR2C 4ANJA 1NK3P 2W4SA 3LA2A 3KZZA 1Z3YA 2CQQA 2KZGA 4OU0A 1ZRDA 3LSMA 2R7UA 2GXBA 3EUHA 5EDNA 1IGNA 4AC0A 2F5FA 3AKZA 4A0XA 2KRFA 5EZGA 4AM3A 2H94A 2EA4A 3QRFF 2OCCH 4CZCA 1FIPA 4ZTFA 2LKPA 3HOUJ 1OYWA 2JVHA 2LBFA 5L3BA 1FNNA 3HOWJ 3ROUA 4CXFA 2ESHA 2Q1ZB 3DBRB 2E2HJ 2E2JJ 3L2UA 2GBYA 5D4RA 2CUJA 3R61A 1ZTRA 5AIPA 2LY1A 1QRYA 5GPCA 4L9TA 3V7CA 3PM1A 2KLOA 3NWSA 3VSLA 4B43A 1X58A 2DN0A 1IN7A 3CDIA 3KP6A 4YG2F 6PAXA 1WJAA 2XASA 1W36C 4A3IJ 3H3VK 2NNNA 3ZQ7A 1BR1A 1G6NA 2WAQA 4ZJZA 1R4NB 2F2EA 2OQGA 4M3GA 1Y39A 5H2FC 3CC2I 2I10A 1F1ZA 2ZJPF 3BR6A 5HLTA 3O8HA 1IRXA 3TMOA 2CFXA 3HRTA 1X2NA 1IN6A 1QBJA 1G3SA 2VC0A 4Z6YA 2KRHA 1ZG1A 3I64A 4CHUA 1YTYA 5FKOA 1O7LA 4CCKA 5GAEJ 2ME0A 5F6FA 1LEBA 4NDLA 1XS9A 4X6AJ 4XLAA 4GYGA 2EA2A 3A02A 4U88A 2A68F 1U5TA 2K3PA 1UHWA 2ZBKA 3KP3A 4AIHA 4CICA 2QSGX 2K9QA 3GLLA 1ACIA 1UMQA 4DOZA 2LNBA 3GWZA 2ESNA 3HKZA 4AIJA 3DBLB 4MFEA 3VSKA 5BPIA 1H9TA 4EJOA 1IN5A 3KZIC 2XPWA 2HDDA 3FX3A 2VQLA 1FSEA 4RAGA 1JHHA 2XDVA 2DMQA 3ASNH 4GFBA 4KUMA 4U7DA 2DOEA 2Y0SN 4JYKA 3NARA 3V8KA 4D7MA 2E1CA 3ABUA 1RKTA 4XRSA 2F4MB 3BG3A 3HTUA 5FROA 4HV6A 1QVUA 2QZ8A 3JRBA 1B59A 5LHGA 2IA0A 4EGYA 3RZOJ 1YJ9I 5FKMA 3AG3H 1EA3A 3F0CA 2H1KA 4KMUX 2F6CA 1SVMA 2LLKA 4BJTA 3L2QA 4PFPA 3PFYA 2KT0A 2XIGA 4CDGA 1R9TJ 4XKCA 1MBGA 4H0EA 4M9SA 4HNVA 4YELA 1H0MA 1J09A 4Y52J 4L18B 1VQKI 4DBRA 2NS8A 1MMDA 2CUZA 2KZVA 4X1EA 3ZMDA 2JZYA 1BI3A 2V6CA 4KIGA 5DCFA 3CMYA 4X0GA 3J80K 3Q0UA 4BBSJ 2GXGA 2MSYA 2F4IA 3KEYA 3JR9A 5GAGJ 5AONA 3EYIA 1ETVA 3L00A 1I50J 3L2CA 1JUSA 3P7NA 4XBFA 1VQ6I 1MIJA 4BJ6C 3R0AA 1R22A 3DKXA 5LD2C 1XDUA 4EJTA 1PP7U 1LFPA 3QAHA 4HZFA 3A0HC 4DQ2A 1USSA 2G9WA 1K4SA 3S15J 1XG1A 2LR8A 2FU4A 2Z1DA 1XGNA 2BW3A 4LK0F 2E71A 2KMUA 3C2HA 3RKXA 2R5ZB 1D3YA 1SFOJ 4HLXA 3K2AA 1YW7A 4EQQA 4G7HF 1WHUA 4XKVA 5DD4A 5E17F 3I58A 2ZFWA 4UHTA 2KL4A 2RAEA 4LB6B 3RIRA 2MFZA 3S1MJ 3ZMUA 3JRAA 3PO3J 4I01A 1K78A 2WAEA 3IKTA 4OWRB 5JR3A 3MKYB 1P6RA 3CC4I 2L02A 4BQAA 2DBBA 1U3EM 1KYWA 2EV0A 4IXAA 2OV7A 3CUQA 3G2BA 4BS9A 5IOYA 4XRMA 4PSWA 3F23A 3Q5FA 1TLHB 4GRIA 3HHHA 1JKPC 2F5CA 3S2WA 2O5RA 1OCTC 1U8RA 1XCBA 3K7AJ 1E3PA 4AYBN 4HQMA 3ZMSA 2R7DA 1SD5A 2XGEA 3C2BA 4UUSA 4MEXF 3NAUA 2IGKA 3SDBA 4DIQA 4AVZA 3MKLA 3TP3A 3BG5A 3P9IA 2XRLA 2EB7A 2EIJH 2TCTA 1MBFA 1ON1A 4E7IA 3A1YA 4XQFA 4V2GA 1FBSA 4PJMA 1DPRA 4BXUA 2X4HA 1TL8A 1UJ8A 1BM9A 4EEFG 3D0SA 3GTPJ 1LDDA 3DQVC 3FHNA 4NBQA 2FOWA 3K10A 5GADJ 1T98A 2GIVA 4EGZA 4YIRX 2E1MB 4L5EA 2ACJA 2KFDA 1F5TA 1B4AA 3H9JA 5TRDA 1TC3C 1FIAA 4WK8F 1SVOA 4HA8A 2P6TA 1XGSA 4O3MA 3F8FA 2AHQA 2QM3A 3WODF 2V26A 3N97A 3LFUA 4KICA 1NG6A 4BDZA 1QQIA 2D5VA 3DLAA 1JKRC 2FBHA 3E1SA 2JSPA 3LOCA 2N8GA 2VE9A 3S3OA 2R7ZJ 1OCRH 1UCRA 1BI2A 4NQWB 1WJDA 2K85A 1Z3XA 3I53A 5CVIA 4HRIA 1TBXA 4CCNA 1LFBA 3K2ZA 4M71A 5EJCA 2ZCWA 2B7EA 4WX9A 3ERED 1B8IA 1T33A 4MO7A 1OCCH 4XR6A 4HEA2 1ZRFA 3OOPA 2XPUA 1I27A 4EJWA 1R49A 1HCRA 1P4XA 1P7IA 2IGOA 3BY6A 3QYBA 3OY9A 1GLNA 4C30A 5JI6A 1S5LC 4NHJA 3FHZA 2LKXA 2M8GX 2BHZA 4HX7A 2EZHA 2X6YA 1SFXA 1VQ7I 3K4JA 1BJZA 2CS3A 3DXJF 1K4TA 4DYQA 3JAMK 2M9HA 5C44J 1Y0UA 1W7PD 2VPRA 2DJNA 1IC8A 2X1EA 2IBDA 5F0CA 2KIFA 4MGRA 2VIXA 5ICFA 4L5IA 1E3HA 3B6AA 3QU6A 5E79C 3T0YA 3GFIA 1QNTA 5K5RA 3F3XA 4XLPF 5D5UB 3F8CA 4A6DA 3BG9A 1T56A 3B73A 1YIJI 2VBYA 5HS9A 1LDJA 1WJEA 1XSVA 4JX6A 5JLXA 4XORA 1BIBA 4M74A 3FXMA 1OYYA 2IA1A 3BCBA 2NYXA 3TDZC 1KQ0A 1R23A 4I76A 4E7HA 3RPQA 1Y1VJ 3AG4H 2HTSA 1RZ4A 1OR7C 3LSIA 1N25A 2M34A 3RPUD 2BVLA 4WF2A 2FQ4A 4BJ5C 5EGOB 1TWFJ 4ZYGA 2BZTA 4OOIA 1FMWA 2GAUA 3MWMA 4RLFA 1B1BA 3W3CA 3LMMA 4O5VA 3MFKA 4N4OB 5FJ8J 3ABTA 1SMTA 4AD9A 1JE8A 3ULQB 2FOKA 3KEOA 2MC4A 3HRMA 2LOOA 5AIQA 1Y0NA 2BHYA 4A12A 4A0ZA 3FXOA 5LGUA 4AWXB 4GXOA 2DFHA 5J3LA 2B9SA 1DUXC 4PDKA 1NHAA 1X1AA 1HOMA 3MZ8A 3KYCB 2DPDA 3K69A 4W1UA 2IVMA 1I39A 4I2OA 3GVAA 4LLLA 2LBFB 5CVJA 4ZDPA 1FYKA 4QLCU 1R5GA 1ZHFA 4NC7A 2L7MP 4OIRF 1IUYA 4ASNA 3BWGA 4KITB 3NEUA 1WI3A 4RMNA 5K7ZA 2COBA 2DA3A 3NRVA 1R4MB 3WTVC 3ZQCA 4DZPA 2K27A 1JUMA 2ISYA 4D5CA 4GGGA 3IWZA 5J47A 1U78A 4RBOA 1SFUA 3TEDA 2A5YB 3FXUA 1BW5A 3BP8A 2KQRA 4BDYA 4AU7A 1VQ5I 3FXQA 4QIWN 1D1CA 2PMHA 1VQPI 5DCMA 2CV1A 2QCOA 3HGGA 1WJ5A 5F1JA 2CQ7A 1PUEE 2RVCA 3E6MA 4ITVA 2JQ7A 3I59A 2M30A 1MNMC 2Y75A 3J7AO 3UNGC 5H6RA 5FLXZ 1P4WA 1MMSA 3BJ6A 4E7LA 2JN6A 1EH8A 2RKHA 4C3IJ 1K79A 1MH3A 1MNDA 2AXLA 4XOPA 5KVRA 1JT0A 4HX8A 1V5GA 1R36A 1S7AA 1U5TB 1UHMA 2YX4A 4E70A 2H8WA 1S72I 1G3TA 1BI0A 1P4AA 4JBAA 2QQ8A 3CCRI 3EPZA 4ZC3A 1YQAA 1Z67A 3H92A 3PUBA 1IRZA 2R7XA 1GHCA 2L7KA 4J01A 5HLHA 1U8BA 3MVPA 3R0JA 4B44A 3MKZA 3K1NA 3GTJJ 4E4HA 2QVOA 1AU7A 4FETA 1WI9A 1DP3A 2W84A 4FE7A 2VJ4A 2FSWA 2GXAA 2NXNB 3T5XA 4Z2YA 3WTZA 2VN2A 2L5QA 4F3QA 2FA5A 1TWAJ 3LA7A 1I6HJ 1E0EA 1T0FA 1FBQA 1FP1D 1K83J 5LFAA 3OYMA 3W6VA 1W5CC 2HQRA 4F93B 3K70C 1G59A 1ETKA 1GDTA 1LB2A 5IP7J 3G4SI 3D5LA 4Y15A 4U87A 2PJPA 3ABMH 1ZYRF 2QSFX 1VNDA 4HBLA 2A3SA 2JA8J 5D6EA 3ZN1A 4A69C 4G94A 3LSRA 2BY3A 3GZ6A 3EYYA 3FXJA 4RB2C 2MABA 2VASA 5IT9K 3A01A 1HKSA 3OYJA 1FTZA 1A35A 4PZJA 3S8PA 3TL4X 3BG6A 1XTAA 4M3EA 1QO0D 2HFHA 5TISC 2JMWA 2HYJA 5D4SA 3O3KA 4CCLA 4A3EJ 2RREA 2VKVA 1MJ9A 3JRDA 4CZZA 1XPXA 1VI0A 2JUCA 5HDKA 2HPMA 3HOYJ 1I1GA 3O8GA 5D8LB 3D5RC 1L0OC 3H5RA 4KN7X 2KIUA 3O2PE 2NAZA 4JX4A 4BU2A 2BW3B 2OU2A 3DU5A 4E7JA 3RKQA 1APLC 2A05A 2DDAA 1HSTA 2DMNA 2OQRA 4PFOA 1TWCJ 3KP2A 3T8TA 4A3MJ 4PJNA 2JA6J 5IYDJ 2IRFG 3BR2A 4WCGA 3PQKA 4CGZA 2X48A 2AQFA 3ONQA 1K78B 3BG7A 2W00A 4KFCA 1W0TA 4BH9A 1BC8C 4D5FA 3CCQI 4IEJA 4G9YA 3CUQB 2VKEA 4MIMA 5HLIA 1D1AA 3CCLI 3H36A 2DTRA 3ZMZA 3I4NJ 3J81K 4XRSG 1M1EB 2O3FA 3OS0A 3K4KA 4I99C 2ETHA 2EIKH 1OJLA 1YJNI 2JPCA 3OYEA 4XONA 3H1CA 1BOAA 5H20A 4B3AA 4UUSB 3LAJA 4IHSA 5K7HA 1EV7A 1TW2A 3K6GA 2HPIA 1TNTA 1X4PA 3IH3A 2GA1A 2IW5A 4ZZDA 2EBIA 3ZXSA 2EJRA 5B3SH 2PMZN 4V2FA 2GA2A 1TT5B 3CF5F 1G4DA 2CJJA 3DU6A 1OISA 2DYRH 5CVVA 2FQ3A 2A6EF 5FGMA 2MD5A 3M7GA 2VBZA 5FKLA 3FBIB 3G73A 2DQLA 1ERDA 2ZMEC 4GDFA 4G7ZF 3CDHA 5JFRA 4R1HA 3QP6A 9ANTA 4HG2A 4IOAF 2L7ZA 5E1ZB 2E5NA 1KQ9A 2VKDA 3AAFA 1YE9A 2DMPA 4FT8A 4XN0A 2F48A 5HNHA 2BV6A 2EV6A 3HBLA 1TQPA 1SAUA 3LAPA 2HWVA 2OJED 1FOYA 3FDYA 2Y0SA 5EEHA 3ZQHA 5HLGA 4IPAA 2GWRA 1WZ2A 1MBKA 1HBXG 4XL9A 5EZHA 2IT0A 1X1CA 3JSPA 1B8IB 2HVRA 2R93J 3COAC 1ZARA 3KP4A 1YHQI 3LSHA 5J40A 3SHFA 4R79A 1O3TA 3AL0B 2R7TA 4BQNA 1JKQC 1YRNA 5FFXA 2QSHX 1YX5A 2QKLB 3MKWB 1HDPA 2BEOA 3B6CA 2XUBA 2BY0A 3VFZA 2F5EA 1TWGJ 3RTRA 2EFPA 3PUFA 3PNTA 1YO5C 1EH7A 4A3GJ 1V4RA 5FO5A 3M3YJ 5JVTA 3BR1A 2AXTC 4RB3C 1S8NA 3GLXA 1JTYA 1CF7A 1FEXA 4BACA 3ELKA 4M73A 2Z16A 1MBHA 3V8LA 5LGNA 4B47A 1RRJA 2FNAA 3OSFA 1XGMA 5IYBJ 2KHMA 4ZH4F 3KYLA 3HOXJ 1R5HA 2IJLA 2CU7A 4RB0A 5GAHJ 2HKOA 3RKWA 4A5MA 1X1BA 4C2UA 3GO5A 3DEEA 3ZR8X 2A69F 3Q0VA 3ZCOA 2ECCA 2ZSIB 2WC2A 3KFWX 3VB2A 4FHTA 1SMYF 5E3MA 3U2RA 2CH0A 4AIDA 1IW7F 2JSCA 2O03A 2DU9A 4UXNA 3V7RA 5F0HA 1HDDC 3E6BA 1QZEA 2XC7A 3KP5A 2P5VA 2PEXA 2QA4I 2IEKA 1VQ9I 2RV8A 1BR4A 3FMQA 3CDLA 3IKVA 2DW4A 3CJNA 4A2UA 2LMDA 1X1PA 2P5KA 1SEUA 4RGUA 4G6QA 3I9V2 2OA4A 1D1BA 4F52A 3S16J 1AOYA 1O3QA 2JTVA 4BAYA 2A61A 2VJIA 1X2MA 4AYBA 3S1QJ 3Q3SA 1D8KA 2R7RA 2OPTA 3FM5A 4M9XA 5EEAA 4U7BA 1O3RA 2KIMA 1MMNA 5D5VB 2PJRA 1QZYA 4KT6A 3F22A 4HDUA 1B9MA 3QQAA 2BYVE 4J00A 3BPXA 4U0VA 2ELHA 3GTQJ 5F04A 2BBYA 2P6SA 4S05A 2O8XA 2W24A 4Q5SF 3SEQA 3HL2A 3LNQA 3OYAA 2G0EA 1UZCA 1ZAOA 4DNCA 5DCMB 2V1UA 4B1RA 2L2OA 1I3AA 2V1XA 2DFIA 3I59B 2CWEA 2OCEA 3JRCA 4N0BA 1ZG5A 1GT0C 1AHDP 1OCZH 2NS7A 2JVGA 3HSRA 3VEPA 1WGXA 1ZKGA 4N9IA 3CCMI 4XKWA 1FTTA 1VQ4I 1SVLA 3M07A 1LKXA 2VXDA 5M3MJ 1Z7LA 1T6SA 4UV9A 2P7VB 1UELB 4GO1A 2G7HA 2DK8A 1ZG3A 2DDBA 3L9FA 1X3WB 2XKOA 1FT9A 5H6QA 4DZJA 1FP2A 2ZXHA 2A6HF 1O7FA 3BR0A 3KE2A 3LSKA 5DEQA 3F21A 3MD2A 3GF2A 2KRCA 1MMAA 2JUGA 1LPQA 2DODA 5B66C 3CCUI 2EFOA 5E1XA 4EJUA 3OYDA 1KU9A 2W25A 2A07F 3IAS2 1RR8C 1Y6IA 5CVUA 3QPHA 2HQAA 3SJMA 1PDNC 2WV1A 2YS9A 5D5WB 3F72A 1HLVA 1BW6A 2C6YA 2LDUA 3H35A 4II3A 2DA7A 3OYHA 4FASD 2IAIA 4BYYA 3QPLA 1R00A 4LLGF 3TP0A 4IJAA 1FZPB 1YS7A 4FX4A 1YYVA 3J7AY 5DUKA 4ZZLA 3WTTC 3HHGA 3CCYA 1POGA 4C2MJ 3IV5A 3OL4A 5CLSA 3CZ6A 3DPLC 2ZXIA 1TW3A 3N4MA 1Q1VA 3B02A 4IVNA 3A01B 3W2AA 2XF7A 1TNSA 3ZOBA 1W5TA 1R5ID 1Z91A 2JWTA 2L7FP 1GV2A 2EK5A 3QPSA 4MEYF 1YI2I 1LVAA 3JRHA 1FLIA 1WJCA 3J7YJ 2NOGA 2M5WA 2MH2A 2XAQA 3CO6C 5IOZA 4LIUA 3G1OA 1MGTA 3GW2A 2XKPA 3L2RA 3V8JA 1IN8A 5EEGA 3S2DJ 2DA2A 4CCOA 2DMUA 2Y30A 3S3MA 3A4CA 2R3SA 5B1BH 2XROA 3V4GA 3L09A 2IS1A 4BHPA 1RPWA 2HS5A 4IO9F 1FWZA 5ILSA 3DPUA 4IHWA 5IPAA 4RAYA 5M3FJ 2K5CA 1T95A 1IO2A 1LDKB 1Z6TA 4A3KJ 3FMSA 1FMVA 3OYKA 2CMPA 4W97A 1D0XA 3OS2A 2K9MA 3HOSA 3RDIA 2CW0F 1OKRA 2Z2SB 4UVBA 1WPKA 5ILUA 1FOKA 4A93J 1QVTA 2V9PA 2JRTA 1XN7A 2EFWA 4ENMA 2KP6A 1U9OA 1STZA 5HDGA 3RCOA 3BTLA 2W1OA 5K5OA 2R0QC 5JVGF 2LYCA 3I4PA 1YJWI 4L9JA 1X4OA 1Y8QB 4P9FA 3VDXA 2EFQA 3FZVA 4WXCA 4CYCA 3HSFA 1F9NA 3FIWA 4KN4X 2UXXA 3BOQA 3DKYA 2M0CA 3TDUC 4I0AA 3CP8A 5KNLA 1GVJA 2V4JC 4MLOA 3ZQIA 5L3EA 2STTA 5LRSA 3BQZA 3PL8A 3WTSC 3LSJA 3OYNA 2M8EA 2DA1A 2CO5A 3U21A 3CQZJ 4N9HA 5IT3A 3G1MA 2L4MA 3ECOA 3I4MJ 1ORKA 4C9YA 4LG0A 4ZYDA 2EZKA 3DWLE 2R7QA 2PFBA 3KCCA 2HU9A 2X0LA 1ETOA 1WVRA 3SDGA 2W48A 5CJ9A 2M0MA 1ZLKA 1Z77A 3FXRA 2A6TA 2E5ZA 3BJAA 5FD5A 3K1MA 3GYHX 1F43A 1JGGA 1JKOC 1X3UA 1MD0A 2K4BA 3OYLA 3UR3C 4XRFA 4RA2A 3N05A 2XAHA 4QTRA 1D8JA 2WTEA 2RQQA 1O3SA 4EATA 3EUAA 3TW6A 3GUDA 5JHFA 5M5XJ 2VKHA 2R7WA 1MBJA 2IPQX 3JREA 2X1DA 4RAFA 1QZZA 2WWYA 2E36A 2FEZA 4H4KC 5D5XB 4WWCA 1R1TA 3ASOH 1YRNB 5FRNA 5FRMA 2HXOA 1OFCX 2X6XA 2DI3A 1J75A 3CESA 2PLYA 2M4GA 2RC4A 1QPIA 2MGQA 4EVIA 3FKJA 3PQJA 1D0YA 1ONVA 2DA4A 2MA3A 3GZNB 5L3FA 5B1AH 4AIKA 1CF7B 1I1SA 4PGGA 3M8EA 2CQNA 2QLZA 2VBWA 3QODA 5BPDA 1IG7A 3WG7H 1DGRM 2L9VA 2XAUA 3RSNA 4ZTJA 4D7NA 1ZR4A 4G12A 1P92A 3TOAA 2R5YA 2NVQJ 2CQKA 3DCFA 3G71I 1WCMJ 2X51A 1KA8A 2Q8KA 5DM6F 1USTA 4ZYEA 2Q2EA 3SEZA 4GCVA 2D1VA 5DUIA 2MLKA 4YFKF 1OR7A 3A0BC 4J19A 4KISA 3ZQFA 1ETWA 1I5ZA 1ULYA 4MFDA 4EJVA 3ZGKA 2ELJA 2CYYA 3HUGA 4HQEA 1SANA 3VOEA 4L5JA 4ZYHA 2QKMB 4F55A 3ZN0A 5IY5H 2XHKA 2PBIA 3IRRA 2ZJ2A 3HG9A 3ZQQA 3M1CA 2X85A 4UUVA 4CCJA 3FF5A 2F5DA 2HZDA 5ILVA 3ZP5A 1RESA 2KPMA 1R7JA 2VQGA 4Y7NJ 2HDWA 2L0KA 5CYVA 4IHXA 3RJPA 4CH7A 3TOBA 1MZBA 1FOXA 3BTJA 4HX4A 1YIOA 3ZMTA 4DJAA 1MSFC 1WQ2A 4HPQA 3SFZA 2TDXA 4B8XA 1N77A 4LGWA 1HKQA 1RKWA 2HGCA 2YR2A 2W82A 3WE2A 3OR1C 4TV7A 3GEZA 2NNYA 1ZH5A 2PJRB 1R71A 2L9NA 3PSFA 3S93A 2IXSA 4LIVA 4EV0A 4M9ZA 3FWEA 3PJRA 4XK4A 3K4BA 2PMZA 2M2EA 4BEHA 3WTYC 4DW6A 2DT6A 1P2FA 2CUEA 1TQMA 1XDSA 2ELKA 2RDPA 4ZDOA 2IGNA 3G3ZA 5HODA 1DU6A 5A2QZ 1TT0A 1LEAA 2CW8A 2XAJA 2VJ5A 1JJ6C 1BIAA 3RI4A 1FYMA 1F36A 4LK1F 3V42A 1U6GA 1J0RA 3K4CA 3R60A 5DS9A 1XMKA 3QPTA 3SXYA 4IF4A 1RUOA 1AWCA 1GVDA 3IL2A 5FD6A 5K1YA 4UVAA 3IH4A 1FC3A 3BDDA 2IA2A 2O0YA 2ZKZA 2XB0X 2ICWG 2ZXJA 1T8IA 1IXCA 1VQLI 1H89C 1BOBA 3S17J 2AO9A 2ID3A 4HSTA 3ABKH 1MJBA 2LKSA 5HVQC 3U1DA 1XMAA 4UB6C 3DEUA 3CCVI 3KX2A 4I0BA 4HSRA 3W6JB 4XIDA 3GFJA 2XF6A 3SZGA 5BOXA 1X19A 3RQIA 2CG4A 2HYGD 2JT1A 2XVCA 1G3YA 4IHVA 4UNOA 5GPAA 1SD7A 5LHIA 1TQIA 2NVXJ 4P1WA 1EF4A 3R6SA 4I7HA 3ERMA 4F91B 4K2EA 3DFGA 4S04A 2OTLI 2VE8A 3RYRA 3H0GJ 3WG9A 2ISZA 1SD4A 4L0ZB 2EQRA 1XSDA 2K7LA 4E7SA 3E3VA 1FJLA 1DDNA 3K4NA 4A0YA 1ZK8A 3CTAA 3IWFA 3TKYA 1H8AC 2MD0A 1WJFA 4LOCA 3JRIA 1W36D 1K61A 2IS6A 3L2VA 4D1QA 1RC9A 4LMYA 1YITI 5KK1A 4G7OF 1BL0A 4XSZF 2K86A 5J1UA 1LUJB 3DTKA 3FISA 4BXXJ 1JI8A 3CJRB 2E1MC 4HV5A 2UWMA 4PJJA 3C2GA 3S32A 3MAJA 4YFNF 2Z5UA 3W2WA 1ZELA 4LFUA 2FJ1A 4IQJA 4BY1J 1UB9A 4BHBA 2KDZA 2E1OA 3E97A 2EILH 1VQ8I 2ZJQF 3I3LA 2OZUA 5DTDA 3F9KA 1I6XA 1LE8A 3IP4B 1LNWA 2MYSA 2OBPA 3CMEI 4GYIA 4ENKA 2ZB9A 1EH6A 3ZQGA 2KKOA 4M3DA 2H6CA 5M5WJ 2HTJA 3WGIA 1FX7A 3KLNA 3O6BB 4RLQA 5E3LA 3ABLH 3HB9A 2ZXWH 2ECBA 3KLOA 1KU7A 3T1BA 3QP5A 2HEOA 5E20A 5IYCJ 3I0TA 2X9DA 2Z99A 3K4MA 4HF0A 1ZGWA 3KYDB 4NB5A 2XGCA 4C3HJ 1D5YA 3I55I 1E3OC 3E6CC 4XLFA 2YU3A 2CGPA 4KIFA 3BROA 3IUOA 3M1EA 4XLHA 4HW0A 4S0HB 3VWBA 4XM3A 2E7WA 5F08A 1OQYA 2HQ5A 5BNGA 4CYCB 1HW5A 4MQ9F 3HDDA 2DFFA 3LFKA 1T38A 1OMIA 4MTEA 2ZFUA 2NVYJ 3G1LA 3I56I 3QU3A 1LQ1A 1BN5A 1XD7A 2DJIA 3IAM2 4QPQA 5FLXK 4XSXF 5M5YJ 3OIOA 1IV8A 3P5JA 3WE3A 1RIOH 3PSIA 2YU9J 1IAWA 4M6VA 3C7JA 2PN6A 3JRGA 1OCPA 2LK2A 4LG0B 1VQNI 3HJEA 3M9AA 5DD8A 3J80Z 4RGRA 1YW9A 2LVSA 2P4WA 2OUMA 3R4KA 4IZZA 1IZ1A 1DU0A 2F4OB 2MH9A 2WV0A 2VT2A 4AUXA 1PUFA 1WSUA 2ZMEA 4MNUA 2WY8Q 2VXZA 5L3GA 3BZKA 3M4OJ 1FSHA 3MQ0A 4A6EA 3GCMA 4JOMA 5J8FA 4M6XA 3FM3A 4BY7J 2Y2ZA 2EV5A 2M3AA 3KIOA 3CC7I 1ETQA 3EUHC 1R6RA 4QPOA 5J6XA 3BT9A 2HYFA 3MZHA 1S3JA 2RQPA 2VLAA 2QENA 3BLYA 4XMYA 1YOVB 1S6LA 3HC7A 3DKWA 1J59A 2K3FA 4ENJA 1XB4A 2Q0OA 5GP9A 4A3CJ 1XMXA 4NUBA 4G6TB 2XAFA 4Y3OA 2AS5F 3BTIA 2BY2A 1K6YA 4V19K 3GTOJ 5EG0B 1WH7A 3SFIA 1HW2A 4E7ZA 3Q9VA 2FXAA 2V1NA 4YIFA 2RNGA 5BS6A 3CD6I 3F6OA 1UFMA 4XOTA 2LY9A 3KETA 1JUPA 4MQVA 1KYZA 3Q0WA 2K40A 4A3DJ 2WB1N 4FTHA 2VOPA 4KT5C 1PJRA 1FOWA 2H27A 1A5JA 3OYGA 2R7VA 2DFEA 1V5EA 3VPRA 2UZKA 4UB8C 2L3DA 5ED4A 1QGPA 1Y8RB 1NTCA 2R5YB 2Y31A 3DTIA 1U2WA 4ESFA 3VYSB 5HOOA 4F7ZA 4CCMA 4ZDLA 1TTYA 2Q2EB 2L4AA 1UG2A 4B4CA 4DYCA 3WHBA 4BKXA 1YS6A 5CQEA 3RYPA 3RZDJ 1AA7A 1U5TC 2QEXI 1TWHJ 3AG2H 2OAZA 1WFXA 3OWTA 3HPGA 3F8MA 4A3BJ 4Y4RA 4ESJA 2D2WA 3HUGB 3HTSB 5E8IA 1J9IA 3NWTA 1IXSB 4QWQA 3S1NJ
chains in the Genus database with same CATH topology
1U9OA 3BTLA 4IHYA 2R0QC 3BQYA 4QIWN 2QCOA 2DA5A 3HGGA 5F1JA 4UUTA 3PO2J 4CYCA 3WHCA 4A3FJ 3FIWA 1MNMC 2M0CA 1ZQ3P 3BR3A 4MLOA 2E19A 3ZQIA 5EF6A 5FLVA 3BQZA 2JN6A 3LSJA 3TW7A 4C3IJ 1MH3A 2K9NA 1UHSA 2DA1A 2VI6A 2Y9ZA 1JT0A 3CQZJ 3G1MA 2X6OA 4JX5A 3I4MJ 1ORKA 2O9LA 3HM5A 3L1PA 2EZKA 2ID6A 3IH2A 1IRZA 4BBRJ 3DEWA 2LD5A 1ETOA 1U8BA 3SDGA 2W48A 3D1NI 3MVPA 5F0FA 3GTJJ 1Z77A 3FK7A 3OSGA 3GTGJ 2LFBA 1AU7A 2O7OA 1ZR2A 2FD5A 5K7FA 1F43A 1MBEA 4FE7A 1JKOC 1JGGA 2NVTJ 1Y1WJ 4RDUA 2Y9YA 3FK6A 4QTRA 5F27A 1AKHA 4ABZA 1TWAJ 5C4JJ 3JRFA 2O8KA 3HOVJ 1I6HJ 3TW6A 5M5XJ 3W6VA 1K83J 1IJWC 1MBJA 1ETKA 1GDTA 3JREA 1G2HA 2HOAA 5EYRA 5IP7J 3S1RJ 1YRNB 2HXOA 1VNDA 2JA8J 4M3BA 4A69C 1OFCX 3S2HJ 1B72B 2FX0A 3LSRA 5EGOA 2GM4A 2K9SA 3E7LA 3GTLJ 2OF7A 3A01A 1QPIA 2MGQA 1FTZA 1NK3P 2EH3A 4M3EA 2CQQA 2DA4A 2JMWA 2HYJA 4A3EJ 2VKVA 5EDNA 1IGNA 1IG7A 4AC0A 3JRDA 1VI0A 5EZGA 3HOYJ 3O8GA 4FCYA 3GTMJ 4D7NA 1ZR4A 4G12A 1P7JA 2LTPA 2XB5A 4JX4A 1FIPA 1JTXA 2R5YA 2NVQJ 3HOUJ 3DCFA 1WCMJ 3RKQA 1APLC 2H8RA 3HOWJ 2DMNA 1TWCJ 2E2JJ 2E2HJ 4A3MJ 2XPVA 2JA6J 2GBYA 5IYDJ 3BR2A 2WAQN 1ZTRA 1ENHA 4J19A 2X48A 1QRYA 3ZQFA 5GPCA 1ETWA 4MFDA 3PM1A 1X58A 1W0TA 2DN0A 1RETA 3BR5A 4A3IJ 3H3VK 4D5FA 1SANA 4IEJA 2VKEA 4MIMA 4M3GA 2MW8A 2I10A 2B63J 3I4NJ 4XRSG 1RESA 2DA6A 3BR6A 5E3OA 3O8HA 4DYRA 4Y7NJ 1W0UA 1OJLA 2L0KA 4IHXA 1X2NA 4UUSB 4B3AA 1LE8B 1LFUP 3BTJA 5J1RA 2EZIA 5K7HA 5FKOA 1MSFC 3IH3A 3ZQLA 2ME0A 2L9RA 1RKWA 4NDLA 1XS9A 2EBIA 3HKZN 4X6AJ 2PMZN 4V2FA 3A02A 4C3JJ 2CJJA 2K9QA 1UMQA 2ME6A 5J1YA 4XK4A 4MFEA 2M2EA 5FKLA 4DW6A 2XPWA 2HDDA 2CUEA 2ELKA 5FKKA 2CUFA 2DMQA 5HODA 1DU6A 4GFBA 2Y0SN 4JYKA 9ANTA 2L7ZA 3NARA 4D7MA 1JJ6C 1RKTA 2DMPA 4XRSA 3BG3A 3A03A 1F36A 1QVUA 4I6ZA 3HBLA 3JRBA 3RZOJ 5DS9A 5FKMA 3F0CA 3ZQHA 1GVDA 2H1KA 1MBKA 2LLKA 5EZHA 5IP9J 1JJ8C 2R93J 1B8IB 1WH5A 3IH4A 2R92J 2KT0A 2XB0X 1R9TJ 1MBGA 2LP0A 1JKQC 1H89C 1YRNA 3S17J 2AO9A 2ID3A 4A3LJ 4HNVA 1ETXA 4Y52J 1HDPA 3B6CA 2MG4A 1B72A 2NS8A 5EG0A 1TWGJ 4X1EA 4XIDA 1PUFB 3CMYA 1RR7A 3Q0UA 3RQIA 4BBSJ 2MSYA 4A3GJ 3M3YJ 4IHVA 3JR9A 5GPAA 2NVXJ 3BR1A 1ETVA 1EF4A 1JT6A 1I50J 1JUSA 4JP0A 2XGDA 1JTYA 1FEXA 1MBHA 3H0GJ 2EQRA 1GUUA 3OSFA 5IYBJ 2JK3A 2E2IJ 3S15J 1XG1A 2DTZA 2LR8A 1FJLA 3FKIJ 3HOXJ 1ZK8A 2R5ZB 3HOZJ 1SFOJ 2CU7A 1H8AC 1MSEC 3K2AA 3JRIA 4LOCA 1K61A 3Q0VA 2RAEA 1ITYA 2YUSA 5JLWA 2ECCA 3S1MJ 1BL0A 3JRAA 3PO3J 3S14J 5J1UA 5E3MA 3FISA 4BXXJ 2DMTA 1IV6A 5F0HA 1HDDC 5IOYA 2FJ1A 1CQTA 1Z0XA 4XRMA 4BY1J 1IDZA 1JKPC 1OCTC 2IEKA 2KDZA 2E1OA 3CDLA 3K7AJ 1O4XA 4AYBN 2TRTA 4FISA 3MN2A 5DTDA 2XGEA 3C2BA 5E3NA 4UUSA 3NAUA 1IDYA 1LE8A 3MKLA 3TP3A 3S16J 3BG5A 2XRLA 2ZB9A 3ZQGA 2TCTA 1MBFA 1X2MA 4M3DA 3S1QJ 3Q3SA 4V2GA 5M5WJ 3LSGA 2OPTA 5E3LA 2EZLA 5EEAA 3GTPJ 4EEFG 1HF0A 3HB9A 2CQXA 4A3JJ 2ECBA 1VFCA 3QQAA 4L5EA 3GTKJ 5IYCJ 3GTQJ 5F04A 2X9DA 1ZGWA 2XGCA 4C3HJ 5IP6A 1D5YA 1TC3C 1XC5A 1E3OC 1FIAA 3LNQA 2G0EA 2AHQA 5C4XJ 4S0HB 2D5VA 4B1RA 5F08A 1JKRC 2HQ5A 5BNGA 4CYCB 3LOCA 2N8GA 2R7ZJ 2CRGA 4XICA 3JRCA 1GT0C 1AHDP 2NS7A 3HDDA 1WGXA 3BTCA 1ZKGA 1FTTA 1I3QJ 2NVYJ 3G1LA 5M3MJ 3HGYA 1LFBA 1B8IA 2JA5J 1T33A 4MO7A 3OOUA 2XPUA 5M5YJ 3OIOA 2YU9J 4M6VA 4DZJA 1HCRA 1P7IA 3BR0A 3JRGA 1H88C 1OCPA 2LK2A 2LKXA 2M8GX 2LVSA 1GV5A 1DU0A 2EZHA 2HI3A 4AUXA 1PUFA 2GLOA 1BJZA 1ETYA 4DYQA 2HOTA 2M9HA 3M4OJ 5C44J 2VPRA 2DJNA 3SJMA 5C3EJ 1IC8A 4BY7J 2Y2ZA 2WV1A 1S7EA 2YS9A 1ETQA 2IBDA 5F0CA 5FLMJ 1A6IA 1HLVA 3BT9A 1BW6A 1AKHB 3B6AA 2HXIA 2QF7A 4QSHA 2DA7A 2JJ7A 2IAIA 3QPLA 3BG9A 1T56A 2HOSA 3TP0A 4JX6A 5JLXA 2R5ZA 5GP9A 4A3CJ 1MH4A 3HEFA 3BTIA 4I76A 3GTOJ 1Y1VJ 5EG0B 1WH7A 3SFIA 3CCYA 1POGA 4C2MJ 3LSPA 3IV5A 3UKGA 1NK2P 2M34A 1BA5A 2FQ4A 5EGOB 1TWFJ 4FE4A 2LY9A 1Q1VA 5FKNA 1JUPA 3A01B 3ZOBA 3Q0WA 2JWTA 2K40A 2L7FP 1GV2A 2WB1N 4A3DJ 3QPSA 4FTHA 5FJ8J 3JRHA 2NOGA 5IOZA 1A5JA 3G1OA 5J3LA 3VPRA 3S2DJ 1HOMA 1U9NA 2DA2A 2DMUA 2Y30A 1NTCA 1IUFA 2Y31A 2R5YB 2VUMJ 4W1UA 1RPWA 1UG2A 2L7MP 4IHWA 4B4CA 2P81A 4DYCA 5IPAA 5M3FJ 3WHBA 4BKXA 4A3KJ 4M3FA 1WI3A 3RZDJ 5K7ZA 2COBA 4W97A 3GBGA 2DA3A 1TWHJ 2JA7J 2XSDC 4DZPA 3ZQCA 4A3BJ 1VF9A 1JUMA 4D5CA 1WPKA 4A93J 1U78A 4RBOA 1QVTA 3TEDA 1BW5A 3S1NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9O A;  3BTL A;  4IHY A;  2R0Q C;  3BQY A;  4QIW N;  2QCO A;  2DA5 A;  3HGG A;  5F1J A;  4UUT A;  3PO2 J;  4CYC A;  3WHC A;  4A3F J;  3FIW A;  1MNM C;  2M0C A;  1ZQ3 P;  3BR3 A;  4MLO A;  2E19 A;  3ZQI A;  5EF6 A;  5FLV A;  3BQZ A;  2JN6 A;  3LSJ A;  3TW7 A;  4C3I J;  1MH3 A;  2K9N A;  1UHS A;  2DA1 A;  2VI6 A;  2Y9Z A;  1JT0 A;  3CQZ J;  3G1M A;  2X6O A;  4JX5 A;  3I4M J;  1ORK A;  2O9L A;  3HM5 A;  3L1P A;  2EZK A;  2ID6 A;  3IH2 A;  1IRZ A;  4BBR J;  3DEW A;  2LD5 A;  1ETO A;  1U8B A;  3SDG A;  2W48 A;  3D1N I;  3MVP A;  5F0F A;  3GTJ J;  1Z77 A;  3FK7 A;  3OSG A;  3GTG J;  2LFB A;  1AU7 A;  2O7O A;  1ZR2 A;  2FD5 A;  5K7F A;  1F43 A;  1MBE A;  4FE7 A;  1JKO C;  1JGG A;  2NVT J;  1Y1W J;  4RDU A;  2Y9Y A;  3FK6 A;  4QTR A;  5F27 A;  1AKH A;  4ABZ A;  1TWA J;  5C4J J;  3JRF A;  2O8K A;  3HOV J;  1I6H J;  3TW6 A;  5M5X J;  3W6V A;  1K83 J;  1IJW C;  1MBJ A;  1ETK A;  1GDT A;  3JRE A;  1G2H A;  2HOA A;  5EYR A;  5IP7 J;  3S1R J;  1YRN B;  2HXO A;  1VND A;  2JA8 J;  4M3B A;  4A69 C;  1OFC X;  3S2H J;  1B72 B;  2FX0 A;  3LSR A;  5EGO A;  2GM4 A;  2K9S A;  3E7L A;  3GTL J;  2OF7 A;  3A01 A;  1QPI A;  2MGQ A;  1FTZ A;  1NK3 P;  2EH3 A;  4M3E A;  2CQQ A;  2DA4 A;  2JMW A;  2HYJ A;  4A3E J;  2VKV A;  5EDN A;  1IGN A;  1IG7 A;  4AC0 A;  3JRD A;  1VI0 A;  5EZG A;  3HOY J;  3O8G A;  4FCY A;  3GTM J;  4D7N A;  1ZR4 A;  4G12 A;  1P7J A;  2LTP A;  2XB5 A;  4JX4 A;  1FIP A;  1JTX A;  2R5Y A;  2NVQ J;  3HOU J;  3DCF A;  1WCM J;  3RKQ A;  1APL C;  2H8R A;  3HOW J;  2DMN A;  1TWC J;  2E2J J;  2E2H J;  4A3M J;  2XPV A;  2JA6 J;  2GBY A;  5IYD J;  3BR2 A;  2WAQ N;  1ZTR A;  1ENH A;  4J19 A;  2X48 A;  1QRY A;  3ZQF A;  5GPC A;  1ETW A;  4MFD A;  3PM1 A;  1X58 A;  1W0T A;  2DN0 A;  1RET A;  3BR5 A;  4A3I J;  3H3V K;  4D5F A;  1SAN A;  4IEJ A;  2VKE A;  4MIM A;  4M3G A;  2MW8 A;  2I10 A;  2B63 J;  3I4N J;  4XRS G;  1RES A;  2DA6 A;  3BR6 A;  5E3O A;  3O8H A;  4DYR A;  4Y7N J;  1W0U A;  1OJL A;  2L0K A;  4IHX A;  1X2N A;  4UUS B;  4B3A A;  1LE8 B;  1LFU P;  3BTJ A;  5J1R A;  2EZI A;  5K7H A;  5FKO A;  1MSF C;  3IH3 A;  3ZQL A;  2ME0 A;  2L9R A;  1RKW A;  4NDL A;  1XS9 A;  2EBI A;  3HKZ N;  4X6A J;  2PMZ N;  4V2F A;  3A02 A;  4C3J J;  2CJJ A;  2K9Q A;  1UMQ A;  2ME6 A;  5J1Y A;  4XK4 A;  4MFE A;  2M2E A;  5FKL A;  4DW6 A;  2XPW A;  2HDD A;  2CUE A;  2ELK A;  5FKK A;  2CUF A;  2DMQ A;  5HOD A;  1DU6 A;  4GFB A;  2Y0S N;  4JYK A;  9ANT A;  2L7Z A;  3NAR A;  4D7M A;  1JJ6 C;  1RKT A;  2DMP A;  4XRS A;  3BG3 A;  3A03 A;  1F36 A;  1QVU A;  4I6Z A;  3HBL A;  3JRB A;  3RZO J;  5DS9 A;  5FKM A;  3F0C A;  3ZQH A;  1GVD A;  2H1K A;  1MBK A;  2LLK A;  5EZH A;  5IP9 J;  1JJ8 C;  2R93 J;  1B8I B;  1WH5 A;  3IH4 A;  2R92 J;  2KT0 A;  2XB0 X;  1R9T J;  1MBG A;  2LP0 A;  1JKQ C;  1H89 C;  1YRN A;  3S17 J;  2AO9 A;  2ID3 A;  4A3L J;  4HNV A;  1ETX A;  4Y52 J;  1HDP A;  3B6C A;  2MG4 A;  1B72 A;  2NS8 A;  5EG0 A;  1TWG J;  4X1E A;  4XID A;  1PUF B;  3CMY A;  1RR7 A;  3Q0U A;  3RQI A;  4BBS J;  2MSY A;  4A3G J;  3M3Y J;  4IHV A;  3JR9 A;  5GPA A;  2NVX J;  3BR1 A;  1ETV A;  1EF4 A;  1JT6 A;  1I50 J;  1JUS A;  4JP0 A;  2XGD A;  1JTY A;  1FEX A;  1MBH A;  3H0G J;  2EQR A;  1GUU A;  3OSF A;  5IYB J;  2JK3 A;  2E2I J;  3S15 J;  1XG1 A;  2DTZ A;  2LR8 A;  1FJL A;  3FKI J;  3HOX J;  1ZK8 A;  2R5Z B;  3HOZ J;  1SFO J;  2CU7 A;  1H8A C;  1MSE C;  3K2A A;  3JRI A;  4LOC A;  1K61 A;  3Q0V A;  2RAE A;  1ITY A;  2YUS A;  5JLW A;  2ECC A;  3S1M J;  1BL0 A;  3JRA A;  3PO3 J;  3S14 J;  5J1U A;  5E3M A;  3FIS A;  4BXX J;  2DMT A;  1IV6 A;  5F0H A;  1HDD C;  5IOY A;  2FJ1 A;  1CQT A;  1Z0X A;  4XRM A;  4BY1 J;  1IDZ A;  1JKP C;  1OCT C;  2IEK A;  2KDZ A;  2E1O A;  3CDL A;  3K7A J;  1O4X A;  4AYB N;  2TRT A;  4FIS A;  3MN2 A;  5DTD A;  2XGE A;  3C2B A;  5E3N A;  4UUS A;  3NAU A;  1IDY A;  1LE8 A;  3MKL A;  3TP3 A;  3S16 J;  3BG5 A;  2XRL A;  2ZB9 A;  3ZQG A;  2TCT A;  1MBF A;  1X2M A;  4M3D A;  3S1Q J;  3Q3S A;  4V2G A;  5M5W J;  3LSG A;  2OPT A;  5E3L A;  2EZL A;  5EEA A;  3GTP J;  4EEF G;  1HF0 A;  3HB9 A;  2CQX A;  4A3J J;  2ECB A;  1VFC A;  3QQA A;  4L5E A;  3GTK J;  5IYC J;  3GTQ J;  5F04 A;  2X9D A;  1ZGW A;  2XGC A;  4C3H J;  5IP6 A;  1D5Y A;  1TC3 C;  1XC5 A;  1E3O C;  1FIA A;  3LNQ A;  2G0E A;  2AHQ A;  5C4X J;  4S0H B;  2D5V A;  4B1R A;  5F08 A;  1JKR C;  2HQ5 A;  5BNG A;  4CYC B;  3LOC A;  2N8G A;  2R7Z J;  2CRG A;  4XIC A;  3JRC A;  1GT0 C;  1AHD P;  2NS7 A;  3HDD A;  1WGX A;  3BTC A;  1ZKG A;  1FTT A;  1I3Q J;  2NVY J;  3G1L A;  5M3M J;  3HGY A;  1LFB A;  1B8I A;  2JA5 J;  1T33 A;  4MO7 A;  3OOU A;  2XPU A;  5M5Y J;  3OIO A;  2YU9 J;  4M6V A;  4DZJ A;  1HCR A;  1P7I A;  3BR0 A;  3JRG A;  1H88 C;  1OCP A;  2LK2 A;  2LKX A;  2M8G X;  2LVS A;  1GV5 A;  1DU0 A;  2EZH A;  2HI3 A;  4AUX A;  1PUF A;  2GLO A;  1BJZ A;  1ETY A;  4DYQ A;  2HOT A;  2M9H A;  3M4O J;  5C44 J;  2VPR A;  2DJN A;  3SJM A;  5C3E J;  1IC8 A;  4BY7 J;  2Y2Z A;  2WV1 A;  1S7E A;  2YS9 A;  1ETQ A;  2IBD A;  5F0C A;  5FLM J;  1A6I A;  1HLV A;  3BT9 A;  1BW6 A;  1AKH B;  3B6A A;  2HXI A;  2QF7 A;  4QSH A;  2DA7 A;  2JJ7 A;  2IAI A;  3QPL A;  3BG9 A;  1T56 A;  2HOS A;  3TP0 A;  4JX6 A;  5JLX A;  2R5Z A;  5GP9 A;  4A3C J;  1MH4 A;  3HEF A;  3BTI A;  4I76 A;  3GTO J;  1Y1V J;  5EG0 B;  1WH7 A;  3SFI A;  3CCY A;  1POG A;  4C2M J;  3LSP A;  3IV5 A;  3UKG A;  1NK2 P;  2M34 A;  1BA5 A;  2FQ4 A;  5EGO B;  1TWF J;  4FE4 A;  2LY9 A;  1Q1V A;  5FKN A;  1JUP A;  3A01 B;  3ZOB A;  3Q0W A;  2JWT A;  2K40 A;  2L7F P;  1GV2 A;  2WB1 N;  4A3D J;  3QPS A;  4FTH A;  5FJ8 J;  3JRH A;  2NOG A;  5IOZ A;  1A5J A;  3G1O A;  5J3L A;  3VPR A;  3S2D J;  1HOM A;  1U9N A;  2DA2 A;  2DMU A;  2Y30 A;  1NTC A;  1IUF A;  2Y31 A;  2R5Y B;  2VUM J;  4W1U A;  1RPW A;  1UG2 A;  2L7M P;  4IHW A;  4B4C A;  2P81 A;  4DYC A;  5IPA A;  5M3F J;  3WHB A;  4BKX A;  4A3K J;  4M3F A;  1WI3 A;  3RZD J;  5K7Z A;  2COB A;  4W97 A;  3GBG A;  2DA3 A;  1TWH J;  2JA7 J;  2XSD C;  4DZP A;  3ZQC A;  4A3B J;  1VF9 A;  1JUM A;  4D5C A;  1WPK A;  4A93 J;  1U78 A;  4RBO A;  1QVT A;  3TED A;  1BW5 A;  3S1N J; 
#chains in the Genus database with same CATH topology
 2E35 A;  4Y17 A;  3VYT B;  2P0W A;  2ZO4 A;  3CLQ A;  4RGX A;  4BE1 A;  2QBY A;  2LRD A;  3BQY A;  2XGX A;  2VON A;  4D9J A;  2GOM A;  4BXF A;  2E1N A;  1IRF A;  2AQE A;  3PO2 J;  1S29 A;  4UV8 A;  3JTG A;  2VB6 A;  5D6F A;  3WHC A;  2QGU A;  4HYE A;  2M7B A;  1FPQ A;  1ZQ3 P;  4IX7 A;  2ZNZ A;  1IXR C;  3DBH B;  5FLV A;  1HW1 A;  3TW7 A;  4ESB A;  3AFH A;  1UHS A;  3RKY A;  2M7A A;  4OAZ A;  1PYV A;  4YRV A;  3QYF A;  3W6K B;  2NOJ B;  2X6O A;  4BL0 B;  3WTX C;  3G6E I;  1T08 B;  4PCQ A;  2O9L A;  4PGH A;  4IRH A;  3IRQ A;  4BEH B;  3IH2 A;  3L7W A;  1SD6 A;  1P9Q C;  2LD5 A;  3JAM Z;  2D1H A;  1YW8 A;  1D5V A;  4ENN A;  1KU3 A;  2K4J A;  4A5N A;  3FK7 A;  1FYL A;  2X6W A;  2DO7 A;  2PG4 A;  2LFB A;  3OSG A;  3GTG J;  2O7O A;  2FD5 A;  4Y13 A;  2FNP A;  3CP2 A;  4Q4Z F;  1MBE A;  3ZRG A;  2DOF A;  5TGT A;  2HZT A;  4RDU A;  1QU3 A;  2E60 A;  2Y9Y A;  3FK6 A;  4EM2 A;  2VL8 A;  5F27 A;  1AKH A;  5C4J J;  2I5U A;  3JRF A;  3TGN A;  1NH3 A;  2QWW A;  3IHU A;  2O8K A;  2M4K A;  4U0Y A;  3HOV J;  1IJW C;  2LF7 A;  2XRN A;  2DXI A;  5KAI C;  2B0L A;  1G2H A;  1R1U A;  5EYR A;  1UG0 A;  3J7Z I;  3LL7 A;  3MEX A;  3S1R J;  1FBU A;  1T2K A;  4G6D A;  4BE0 A;  4C2T A;  2J5P A;  2COM A;  2V1D A;  5HNF A;  2VT3 A;  1KON A;  4HOB A;  4B3X A;  3K0L A;  2FX0 A;  4CSW A;  2GM4 A;  4FQG A;  2K9S A;  3AG1 H;  5ICE A;  2IP2 A;  3BJO A;  3C3W A;  1K7A A;  3GTL J;  3PIO F;  3FXL A;  4E7K A;  1HC8 A;  2EH3 A;  3CUQ C;  4CA0 A;  4P55 A;  5CKT A;  3M8F A;  2P7C B;  2UXN A;  5LRR A;  3F8N A;  2FBI A;  2L01 A;  4FCY A;  3GTM J;  4L9N A;  2XF5 A;  1P7J A;  2LTP A;  2Z3Y A;  2VQH A;  2XB5 A;  5LEJ A;  1JTX A;  3FMR A;  2VBX A;  3TO6 A;  3LQR A;  1WWX A;  2H8R A;  1BJA A;  1W5S A;  3E5U A;  2MLG A;  2XPV A;  1S7O A;  3V7S A;  3CCS I;  3JTH A;  2EFN A;  2WAQ N;  1MJA A;  1ENH A;  2D45 A;  5FFZ A;  4LB5 A;  1ZGJ A;  4PJ0 C;  3PIP F;  3H5N A;  3K4L A;  3JCU C;  1HKT A;  1OLT A;  4LLN A;  3E6D A;  3GME A;  1XSX A;  4HNT A;  3GFL A;  5CVR A;  1RET A;  3LQQ A;  3BR5 A;  1E2X A;  4IRG A;  1E17 A;  1YFH A;  3BC8 A;  4IQ4 A;  2JPB A;  2MBF A;  1Q1H A;  1QHG A;  2MW8 A;  1A6Q A;  2NS0 A;  3KP7 A;  3VOD A;  1S9H A;  2B63 J;  1DQU A;  1W7P B;  2DA6 A;  1Z1D A;  5E3O A;  1MNE A;  2ZC2 A;  4DYR A;  2O6G E;  1W0U A;  2Z33 A;  2VOO A;  1QPM A;  1LE8 B;  2EIM H;  1LFU P;  2YX7 A;  5L3D A;  2BXZ A;  3CUO A;  5J1R A;  5LBQ A;  3L2W A;  2EZI A;  4KNY A;  1SFK A;  3DPT A;  4B09 A;  3DP7 A;  3ZQL A;  1BI1 A;  3HOT A;  2L9R A;  2W57 A;  4UY8 I;  2QUF A;  3BZ6 A;  2H6B A;  3HKZ N;  1Y56 A;  2KIS A;  2QQA A;  1KU2 A;  1YLF A;  2HVS A;  1D0Z A;  2X1C A;  4C3J J;  2ZNY A;  3MMY B;  3OV8 A;  5KCM A;  2HNH A;  3F6V A;  3K1P A;  4XKB A;  4KA4 A;  3AL0 C;  4WXD A;  2V9V A;  3H3Z A;  3U9G A;  1G8X A;  2ME6 A;  5J1Y A;  3OYB A;  1O57 A;  3DLL F;  3P9C A;  2OD5 A;  5ICC A;  3EDP A;  2WY7 Q;  5FKK A;  2FMY A;  2DPU A;  1TZL A;  2CUF A;  3M8J A;  4OIN F;  3EUK L;  2A5W A;  2R7F A;  4DBQ A;  1A04 A;  2M1B A;  4F92 B;  1MDM A;  3BZC A;  4NC6 A;  3K70 D;  2LRE A;  3A03 A;  3SQN A;  1C0W A;  2E34 A;  3D5S C;  3WU2 C;  4I6Z A;  2M87 A;  4RS8 A;  1A36 A;  4RM2 A;  1VZ0 A;  2CV0 A;  3LA3 A;  3P9K A;  4P96 A;  4WXH A;  4O6J A;  2UUZ A;  1JJ8 C;  2P8T A;  5IP9 J;  4BNC A;  5J4Y A;  5J8C A;  1WH5 A;  3JW4 A;  2R92 J;  1YX3 A;  1W1W E;  3X2Q H;  2RNJ A;  2XAG A;  4FX0 A;  4RAZ A;  2LP0 A;  5GTI C;  5LLQ A;  3E0J B;  4A3L J;  1XX5 A;  4MTD A;  1ETX A;  3PFI A;  1J7K A;  5ICG A;  2LF8 A;  2MG4 A;  2ZSH B;  3OS1 A;  5IT9 Z;  5FB2 A;  1B72 A;  4ZYA A;  5EG0 A;  1PUF B;  1REP C;  2ZME B;  2YSR A;  4P5O A;  3E5Q A;  1RR7 A;  1X3Z B;  4XLC A;  4PK4 A;  3WU0 A;  1W4M A;  1IN4 A;  4Q47 A;  1JT6 A;  3WGH A;  4BUP A;  2PI0 A;  4U0W A;  4JP0 A;  2HQN A;  2XGD A;  2DLL A;  3I54 A;  2WA0 A;  4CO8 A;  4YEJ A;  1HQC A;  1NG7 A;  1GUU A;  4EMS A;  4OIP F;  1N78 A;  2JK3 A;  3TBI A;  3OYI A;  2E2I J;  4IRI A;  2K9L A;  2DTZ A;  1Z21 A;  4PSX A;  5B5E C;  3FKI J;  2FRH A;  2HOE A;  1T39 A;  3HOZ J;  2KDO A;  4BGD A;  2IS4 A;  1MSE C;  3CF2 A;  1K6O A;  4HF1 A;  1DPU A;  1ODD A;  1WRJ A;  4LD5 A;  4HLY A;  3LWF A;  1EJ9 A;  3Q9S A;  1ITY A;  2YUS A;  5JLW A;  3ISP A;  4JQF A;  5KAF C;  4BHC A;  3S14 J;  3RQ4 A;  3PNV A;  3WU1 B;  2ADU A;  1J5Y A;  2DMT A;  3T8R A;  3LST A;  4XLE A;  3CO7 C;  1IV6 A;  4XLN F;  1Z9C A;  3J81 Z;  1L3L A;  1B9N A;  2HR3 A;  3VYU B;  4OMY A;  1CQT A;  1CGP A;  1Z0X A;  2R7O A;  1IDZ A;  1SAX A;  3GXO A;  1G3W A;  3CJQ B;  3REO A;  1V55 H;  5F1R A;  1O4X A;  4EM1 A;  1V54 H;  4PJL A;  2TRT A;  4Q48 A;  3WGG A;  4FIS A;  4EM0 B;  2PQ8 A;  5LEK A;  1BR2 A;  1U0J A;  3MN2 A;  1MMG A;  3QOE A;  3NQO A;  2QYO A;  5E3N A;  1H9G A;  1IDY A;  3HSE A;  4I09 A;  2EWN A;  2OTJ I;  5CQG A;  1WJB A;  3I71 A;  3IC7 A;  2VQC A;  3CLO A;  3LSG A;  2O61 A;  2I8D A;  5E1W A;  4M6Y A;  4UVC A;  2EZL A;  1HF0 A;  2M45 A;  1ZN2 A;  2XV4 S;  1MKM A;  2CQX A;  4A3J J;  3TQN A;  2DQR A;  3QYE A;  1VFC A;  3H5A A;  2VPL A;  2PX9 A;  5HS8 A;  4OAY A;  4BE2 A;  3GTK J;  2KJC A;  2OZ6 A;  3W2V A;  3OYC A;  2STW A;  5E8G A;  4IL6 C;  1SC7 A;  4JK1 X;  5IP6 A;  4R8H A;  1F4K A;  1XC5 A;  3U1K A;  3WTU C;  2IGM A;  3H3U A;  4OMZ A;  2BVM A;  2QBY B;  2FUG 2;  5C4X J;  1ZRC A;  3K9T A;  2LY2 A;  2V79 A;  3GZ5 A;  1JHF A;  2BOL A;  2R7S A;  4AVP A;  2CRG A;  4XIC A;  3CCJ I;  4HF2 A;  1ON2 A;  1R1V A;  5LHH A;  3BTC A;  1B6A A;  3DV8 A;  2CV2 A;  3OYF A;  2J5O A;  1KQ8 A;  1I3Q J;  1T0F C;  2Y48 A;  2EIN H;  3HGY A;  4L9V A;  3BCA A;  2QQB A;  2WBM A;  2GZW A;  2LH9 A;  3H9Q A;  2CFO A;  2JA5 J;  4ETS A;  3OOU A;  2DK5 A;  5L3C A;  2DAO A;  3HYI A;  2FF4 A;  4NNJ A;  5DYM A;  1H88 C;  2LSO A;  3HRU A;  2HVQ A;  1FY7 A;  3SYT A;  1EKE A;  2DT7 B;  3SZP A;  4YFX F;  5ERI A;  1PVE A;  5DV5 A;  1GV5 A;  1OYI A;  5KHD A;  2HI3 A;  1BBY A;  3H0D A;  2GLO A;  1BC7 C;  1ETY A;  2NRA C;  2HOT A;  3TO9 A;  5HDN A;  3ZPL A;  2ZJR F;  3OL3 A;  5C3E J;  5D8K B;  2HDC A;  1S7E A;  2PMU A;  2QQ9 A;  1PP8 F;  3TO7 A;  5FLM J;  1A6I A;  2GIZ A;  4II2 A;  2FE3 A;  1AKH B;  1X1D A;  3CCE I;  4LG3 A;  4LIT A;  2HXI A;  2QF7 A;  4QSH A;  1LJ9 A;  2JJ7 A;  3E5X A;  4NC8 A;  3HZJ A;  2KIQ A;  4OIO F;  2Y0M A;  2BXY A;  4BQO A;  2HOS A;  2VJJ A;  1ZGA A;  2R5Z A;  1RNL A;  2UV1 A;  2JRM A;  5HS7 A;  4I98 B;  1MH4 A;  2V6E A;  3HEF A;  2DT5 A;  2JA2 A;  4KJZ A;  3LSP A;  1NK2 P;  3UKG A;  3MZY A;  2VC1 A;  3KPH A;  1BA5 A;  4N4N B;  5LGT A;  1SFE A;  4FE4 A;  4L0Y B;  4OIQ F;  3DTE A;  3ESW B;  5FKN A;  2YPR A;  5F64 A;  2RGV A;  3ECH A;  3F8B A;  1A31 A;  3KEQ A;  4ON0 A;  1TP4 A;  2KJB A;  1Z6R A;  4YII A;  1Z7U A;  4HAM A;  5E18 F;  2XSJ C;  3CMA I;  3PNY A;  2Z9O A;  3HXL A;  4G8X A;  3BPV A;  2IS2 A;  1W7P A;  2WB1 A;  1U9N A;  1RI7 A;  3OIP A;  1IUF A;  2VUM J;  1Z05 A;  4P9U A;  3ZMV A;  1DP7 P;  2NVU B;  3OIQ A;  3C18 A;  3VYR B;  2P81 A;  4CUG A;  4I02 A;  3EQL F;  4M3F A;  1IRG A;  3GBG A;  1JGS A;  2H1L A;  4PUS A;  5JHU A;  3QWL A;  2P5L C;  2XSD C;  2JA7 J;  1VF9 A;  1XGO A;  5J4V A;  3CJT B;  1VQO I;  3H9G A;  4E6K G;  2E7X A;  2DOA A;  4M72 A;  2WAF A;  4RM3 A;  1HA8 A;  3KZY A;  3RPU A;  3QOP A;  1RUN A;  5TJJ A;  4IHY A;  1VQM I;  4CYD A;  5K5Q A;  5CPR B;  1VTN C;  1OCO H;  2V7F A;  2DA5 A;  1J2X A;  2CSO A;  4UUT A;  5GTH C;  1N75 A;  2RN7 A;  3GX4 X;  1GXQ A;  3A2K A;  4A3F J;  2F5V A;  5BQT A;  1KZH A;  4XN3 A;  1MW7 A;  4NQW A;  4MHG A;  3EET A;  2WAD A;  3BR3 A;  1QA6 A;  2E19 A;  5EF6 A;  3HIF A;  2GOX B;  4BQQ A;  2K9N A;  3ML6 A;  2DCE A;  3CMM A;  3OMY A;  2VI6 A;  2Y9Z A;  1DGW Y;  1WKM A;  3DF8 A;  3MCZ A;  4IKF A;  4KDP A;  1KGS A;  4JX5 A;  4D0P A;  2LG4 A;  2BE5 F;  3FXK A;  1IF1 A;  2DYS H;  3HM5 A;  3L1P A;  2ID6 A;  2V9K A;  4BBR J;  4HNU A;  3DEW A;  1HXD A;  3FBN B;  1ZRE A;  4KYW A;  2GQQ A;  3D1N I;  1OPC A;  3WTW C;  2W85 A;  1XCV A;  5F0F A;  2HKX A;  1MDM B;  1ZR2 A;  4RGS A;  1HSJ A;  5K7F A;  2Y69 H;  4KMF A;  3S3N A;  3HRS A;  2CW7 A;  2NVT J;  2K02 A;  5A2Q K;  1Y1W J;  1V3F A;  2EPF A;  2H09 A;  5DDG A;  2W7N A;  4ABZ A;  1QHH D;  1YG2 A;  2FML A;  3C1D A;  4HDV A;  3HPH A;  2BGC A;  1UAA A;  2FBK A;  2OC6 A;  4IOC F;  1R58 A;  1GXP A;  4B48 A;  2G7U A;  2HOA A;  2L54 A;  3I5U A;  5DM7 F;  2R4G A;  2LC2 A;  4KIB A;  4M3B A;  5BMZ A;  3S2H J;  1B72 B;  1V5F A;  2BY1 A;  4RB1 A;  3JSO A;  4Y33 A;  3SZT A;  5EGO A;  2MC3 A;  3GFM A;  4LJZ F;  1JXS A;  3E7L A;  1ZLJ A;  2OF7 A;  1LVK A;  4IHT A;  4XNF A;  2VOD A;  4DGW B;  2L9S A;  3OR2 C;  4ANJ A;  1NK3 P;  2W4S A;  3LA2 A;  3KZZ A;  1Z3Y A;  2CQQ A;  2KZG A;  4OU0 A;  1ZRD A;  3LSM A;  2R7U A;  2GXB A;  3EUH A;  5EDN A;  1IGN A;  4AC0 A;  2F5F A;  3AKZ A;  4A0X A;  2KRF A;  5EZG A;  4AM3 A;  2H94 A;  2EA4 A;  3QRF F;  2OCC H;  4CZC A;  1FIP A;  4ZTF A;  2LKP A;  3HOU J;  1OYW A;  2JVH A;  2LBF A;  5L3B A;  1FNN A;  3HOW J;  3ROU A;  4CXF A;  2ESH A;  2Q1Z B;  3DBR B;  2E2H J;  2E2J J;  3L2U A;  2GBY A;  5D4R A;  2CUJ A;  3R61 A;  1ZTR A;  5AIP A;  2LY1 A;  1QRY A;  5GPC A;  4L9T A;  3V7C A;  3PM1 A;  2KLO A;  3NWS A;  3VSL A;  4B43 A;  1X58 A;  2DN0 A;  1IN7 A;  3CDI A;  3KP6 A;  4YG2 F;  6PAX A;  1WJA A;  2XAS A;  1W36 C;  4A3I J;  3H3V K;  2NNN A;  3ZQ7 A;  1BR1 A;  1G6N A;  2WAQ A;  4ZJZ A;  1R4N B;  2F2E A;  2OQG A;  4M3G A;  1Y39 A;  5H2F C;  3CC2 I;  2I10 A;  1F1Z A;  2ZJP F;  3BR6 A;  5HLT A;  3O8H A;  1IRX A;  3TMO A;  2CFX A;  3HRT A;  1X2N A;  1IN6 A;  1QBJ A;  1G3S A;  2VC0 A;  4Z6Y A;  2KRH A;  1ZG1 A;  3I64 A;  4CHU A;  1YTY A;  5FKO A;  1O7L A;  4CCK A;  5GAE J;  2ME0 A;  5F6F A;  1LEB A;  4NDL A;  1XS9 A;  4X6A J;  4XLA A;  4GYG A;  2EA2 A;  3A02 A;  4U88 A;  2A68 F;  1U5T A;  2K3P A;  1UHW A;  2ZBK A;  3KP3 A;  4AIH A;  4CIC A;  2QSG X;  2K9Q A;  3GLL A;  1ACI A;  1UMQ A;  4DOZ A;  2LNB A;  3GWZ A;  2ESN A;  3HKZ A;  4AIJ A;  3DBL B;  4MFE A;  3VSK A;  5BPI A;  1H9T A;  4EJO A;  1IN5 A;  3KZI C;  2XPW A;  2HDD A;  3FX3 A;  2VQL A;  1FSE A;  4RAG A;  1JHH A;  2XDV A;  2DMQ A;  3ASN H;  4GFB A;  4KUM A;  4U7D A;  2DOE A;  2Y0S N;  4JYK A;  3NAR A;  3V8K A;  4D7M A;  2E1C A;  3ABU A;  1RKT A;  4XRS A;  2F4M B;  3BG3 A;  3HTU A;  5FRO A;  4HV6 A;  1QVU A;  2QZ8 A;  3JRB A;  1B59 A;  5LHG A;  2IA0 A;  4EGY A;  3RZO J;  1YJ9 I;  5FKM A;  3AG3 H;  1EA3 A;  3F0C A;  2H1K A;  4KMU X;  2F6C A;  1SVM A;  2LLK A;  4BJT A;  3L2Q A;  4PFP A;  3PFY A;  2KT0 A;  2XIG A;  4CDG A;  1R9T J;  4XKC A;  1MBG A;  4H0E A;  4M9S A;  4HNV A;  4YEL A;  1H0M A;  1J09 A;  4Y52 J;  4L18 B;  1VQK I;  4DBR A;  2NS8 A;  1MMD A;  2CUZ A;  2KZV A;  4X1E A;  3ZMD A;  2JZY A;  1BI3 A;  2V6C A;  4KIG A;  5DCF A;  3CMY A;  4X0G A;  3J80 K;  3Q0U A;  4BBS J;  2GXG A;  2MSY A;  2F4I A;  3KEY A;  3JR9 A;  5GAG J;  5AON A;  3EYI A;  1ETV A;  3L00 A;  1I50 J;  3L2C A;  1JUS A;  3P7N A;  4XBF A;  1VQ6 I;  1MIJ A;  4BJ6 C;  3R0A A;  1R22 A;  3DKX A;  5LD2 C;  1XDU A;  4EJT A;  1PP7 U;  1LFP A;  3QAH A;  4HZF A;  3A0H C;  4DQ2 A;  1USS A;  2G9W A;  1K4S A;  3S15 J;  1XG1 A;  2LR8 A;  2FU4 A;  2Z1D A;  1XGN A;  2BW3 A;  4LK0 F;  2E71 A;  2KMU A;  3C2H A;  3RKX A;  2R5Z B;  1D3Y A;  1SFO J;  4HLX A;  3K2A A;  1YW7 A;  4EQQ A;  4G7H F;  1WHU A;  4XKV A;  5DD4 A;  5E17 F;  3I58 A;  2ZFW A;  4UHT A;  2KL4 A;  2RAE A;  4LB6 B;  3RIR A;  2MFZ A;  3S1M J;  3ZMU A;  3JRA A;  3PO3 J;  4I01 A;  1K78 A;  2WAE A;  3IKT A;  4OWR B;  5JR3 A;  3MKY B;  1P6R A;  3CC4 I;  2L02 A;  4BQA A;  2DBB A;  1U3E M;  1KYW A;  2EV0 A;  4IXA A;  2OV7 A;  3CUQ A;  3G2B A;  4BS9 A;  5IOY A;  4XRM A;  4PSW A;  3F23 A;  3Q5F A;  1TLH B;  4GRI A;  3HHH A;  1JKP C;  2F5C A;  3S2W A;  2O5R A;  1OCT C;  1U8R A;  1XCB A;  3K7A J;  1E3P A;  4AYB N;  4HQM A;  3ZMS A;  2R7D A;  1SD5 A;  2XGE A;  3C2B A;  4UUS A;  4MEX F;  3NAU A;  2IGK A;  3SDB A;  4DIQ A;  4AVZ A;  3MKL A;  3TP3 A;  3BG5 A;  3P9I A;  2XRL A;  2EB7 A;  2EIJ H;  2TCT A;  1MBF A;  1ON1 A;  4E7I A;  3A1Y A;  4XQF A;  4V2G A;  1FBS A;  4PJM A;  1DPR A;  4BXU A;  2X4H A;  1TL8 A;  1UJ8 A;  1BM9 A;  4EEF G;  3D0S A;  3GTP J;  1LDD A;  3DQV C;  3FHN A;  4NBQ A;  2FOW A;  3K10 A;  5GAD J;  1T98 A;  2GIV A;  4EGZ A;  4YIR X;  2E1M B;  4L5E A;  2ACJ A;  2KFD A;  1F5T A;  1B4A A;  3H9J A;  5TRD A;  1TC3 C;  1FIA A;  4WK8 F;  1SVO A;  4HA8 A;  2P6T A;  1XGS A;  4O3M A;  3F8F A;  2AHQ A;  2QM3 A;  3WOD F;  2V26 A;  3N97 A;  3LFU A;  4KIC A;  1NG6 A;  4BDZ A;  1QQI A;  2D5V A;  3DLA A;  1JKR C;  2FBH A;  3E1S A;  2JSP A;  3LOC A;  2N8G A;  2VE9 A;  3S3O A;  2R7Z J;  1OCR H;  1UCR A;  1BI2 A;  4NQW B;  1WJD A;  2K85 A;  1Z3X A;  3I53 A;  5CVI A;  4HRI A;  1TBX A;  4CCN A;  1LFB A;  3K2Z A;  4M71 A;  5EJC A;  2ZCW A;  2B7E A;  4WX9 A;  3ERE D;  1B8I A;  1T33 A;  4MO7 A;  1OCC H;  4XR6 A;  4HEA 2;  1ZRF A;  3OOP A;  2XPU A;  1I27 A;  4EJW A;  1R49 A;  1HCR A;  1P4X A;  1P7I A;  2IGO A;  3BY6 A;  3QYB A;  3OY9 A;  1GLN A;  4C30 A;  5JI6 A;  1S5L C;  4NHJ A;  3FHZ A;  2LKX A;  2M8G X;  2BHZ A;  4HX7 A;  2EZH A;  2X6Y A;  1SFX A;  1VQ7 I;  3K4J A;  1BJZ A;  2CS3 A;  3DXJ F;  1K4T A;  4DYQ A;  3JAM K;  2M9H A;  5C44 J;  1Y0U A;  1W7P D;  2VPR A;  2DJN A;  1IC8 A;  2X1E A;  2IBD A;  5F0C A;  2KIF A;  4MGR A;  2VIX A;  5ICF A;  4L5I A;  1E3H A;  3B6A A;  3QU6 A;  5E79 C;  3T0Y A;  3GFI A;  1QNT A;  5K5R A;  3F3X A;  4XLP F;  5D5U B;  3F8C A;  4A6D A;  3BG9 A;  1T56 A;  3B73 A;  1YIJ I;  2VBY A;  5HS9 A;  1LDJ A;  1WJE A;  1XSV A;  4JX6 A;  5JLX A;  4XOR A;  1BIB A;  4M74 A;  3FXM A;  1OYY A;  2IA1 A;  3BCB A;  2NYX A;  3TDZ C;  1KQ0 A;  1R23 A;  4I76 A;  4E7H A;  3RPQ A;  1Y1V J;  3AG4 H;  2HTS A;  1RZ4 A;  1OR7 C;  3LSI A;  1N25 A;  2M34 A;  3RPU D;  2BVL A;  4WF2 A;  2FQ4 A;  4BJ5 C;  5EGO B;  1TWF J;  4ZYG A;  2BZT A;  4OOI A;  1FMW A;  2GAU A;  3MWM A;  4RLF A;  1B1B A;  3W3C A;  3LMM A;  4O5V A;  3MFK A;  4N4O B;  5FJ8 J;  3ABT A;  1SMT A;  4AD9 A;  1JE8 A;  3ULQ B;  2FOK A;  3KEO A;  2MC4 A;  3HRM A;  2LOO A;  5AIQ A;  1Y0N A;  2BHY A;  4A12 A;  4A0Z A;  3FXO A;  5LGU A;  4AWX B;  4GXO A;  2DFH A;  5J3L A;  2B9S A;  1DUX C;  4PDK A;  1NHA A;  1X1A A;  1HOM A;  3MZ8 A;  3KYC B;  2DPD A;  3K69 A;  4W1U A;  2IVM A;  1I39 A;  4I2O A;  3GVA A;  4LLL A;  2LBF B;  5CVJ A;  4ZDP A;  1FYK A;  4QLC U;  1R5G A;  1ZHF A;  4NC7 A;  2L7M P;  4OIR F;  1IUY A;  4ASN A;  3BWG A;  4KIT B;  3NEU A;  1WI3 A;  4RMN A;  5K7Z A;  2COB A;  2DA3 A;  3NRV A;  1R4M B;  3WTV C;  3ZQC A;  4DZP A;  2K27 A;  1JUM A;  2ISY A;  4D5C A;  4GGG A;  3IWZ A;  5J47 A;  1U78 A;  4RBO A;  1SFU A;  3TED A;  2A5Y B;  3FXU A;  1BW5 A;  3BP8 A;  2KQR A;  4BDY A;  4AU7 A;  1VQ5 I;  3FXQ A;  4QIW N;  1D1C A;  2PMH A;  1VQP I;  5DCM A;  2CV1 A;  2QCO A;  3HGG A;  1WJ5 A;  5F1J A;  2CQ7 A;  1PUE E;  2RVC A;  3E6M A;  4ITV A;  2JQ7 A;  3I59 A;  2M30 A;  1MNM C;  2Y75 A;  3J7A O;  3UNG C;  5H6R A;  5FLX Z;  1P4W A;  1MMS A;  3BJ6 A;  4E7L A;  2JN6 A;  1EH8 A;  2RKH A;  4C3I J;  1K79 A;  1MH3 A;  1MND A;  2AXL A;  4XOP A;  5KVR A;  1JT0 A;  4HX8 A;  1V5G A;  1R36 A;  1S7A A;  1U5T B;  1UHM A;  2YX4 A;  4E70 A;  2H8W A;  1S72 I;  1G3T A;  1BI0 A;  1P4A A;  4JBA A;  2QQ8 A;  3CCR I;  3EPZ A;  4ZC3 A;  1YQA A;  1Z67 A;  3H92 A;  3PUB A;  1IRZ A;  2R7X A;  1GHC A;  2L7K A;  4J01 A;  5HLH A;  1U8B A;  3MVP A;  3R0J A;  4B44 A;  3MKZ A;  3K1N A;  3GTJ J;  4E4H A;  2QVO A;  1AU7 A;  4FET A;  1WI9 A;  1DP3 A;  2W84 A;  4FE7 A;  2VJ4 A;  2FSW A;  2GXA A;  2NXN B;  3T5X A;  4Z2Y A;  3WTZ A;  2VN2 A;  2L5Q A;  4F3Q A;  2FA5 A;  1TWA J;  3LA7 A;  1I6H J;  1E0E A;  1T0F A;  1FBQ A;  1FP1 D;  1K83 J;  5LFA A;  3OYM A;  3W6V A;  1W5C C;  2HQR A;  4F93 B;  3K70 C;  1G59 A;  1ETK A;  1GDT A;  1LB2 A;  5IP7 J;  3G4S I;  3D5L A;  4Y15 A;  4U87 A;  2PJP A;  3ABM H;  1ZYR F;  2QSF X;  1VND A;  4HBL A;  2A3S A;  2JA8 J;  5D6E A;  3ZN1 A;  4A69 C;  4G94 A;  3LSR A;  2BY3 A;  3GZ6 A;  3EYY A;  3FXJ A;  4RB2 C;  2MAB A;  2VAS A;  5IT9 K;  3A01 A;  1HKS A;  3OYJ A;  1FTZ A;  1A35 A;  4PZJ A;  3S8P A;  3TL4 X;  3BG6 A;  1XTA A;  4M3E A;  1QO0 D;  2HFH A;  5TIS C;  2JMW A;  2HYJ A;  5D4S A;  3O3K A;  4CCL A;  4A3E J;  2RRE A;  2VKV A;  1MJ9 A;  3JRD A;  4CZZ A;  1XPX A;  1VI0 A;  2JUC A;  5HDK A;  2HPM A;  3HOY J;  1I1G A;  3O8G A;  5D8L B;  3D5R C;  1L0O C;  3H5R A;  4KN7 X;  2KIU A;  3O2P E;  2NAZ A;  4JX4 A;  4BU2 A;  2BW3 B;  2OU2 A;  3DU5 A;  4E7J A;  3RKQ A;  1APL C;  2A05 A;  2DDA A;  1HST A;  2DMN A;  2OQR A;  4PFO A;  1TWC J;  3KP2 A;  3T8T A;  4A3M J;  4PJN A;  2JA6 J;  5IYD J;  2IRF G;  3BR2 A;  4WCG A;  3PQK A;  4CGZ A;  2X48 A;  2AQF A;  3ONQ A;  1K78 B;  3BG7 A;  2W00 A;  4KFC A;  1W0T A;  4BH9 A;  1BC8 C;  4D5F A;  3CCQ I;  4IEJ A;  4G9Y A;  3CUQ B;  2VKE A;  4MIM A;  5HLI A;  1D1A A;  3CCL I;  3H36 A;  2DTR A;  3ZMZ A;  3I4N J;  3J81 K;  4XRS G;  1M1E B;  2O3F A;  3OS0 A;  3K4K A;  4I99 C;  2ETH A;  2EIK H;  1OJL A;  1YJN I;  2JPC A;  3OYE A;  4XON A;  3H1C A;  1BOA A;  5H20 A;  4B3A A;  4UUS B;  3LAJ A;  4IHS A;  5K7H A;  1EV7 A;  1TW2 A;  3K6G A;  2HPI A;  1TNT A;  1X4P A;  3IH3 A;  2GA1 A;  2IW5 A;  4ZZD A;  2EBI A;  3ZXS A;  2EJR A;  5B3S H;  2PMZ N;  4V2F A;  2GA2 A;  1TT5 B;  3CF5 F;  1G4D A;  2CJJ A;  3DU6 A;  1OIS A;  2DYR H;  5CVV A;  2FQ3 A;  2A6E F;  5FGM A;  2MD5 A;  3M7G A;  2VBZ A;  5FKL A;  3FBI B;  3G73 A;  2DQL A;  1ERD A;  2ZME C;  4GDF A;  4G7Z F;  3CDH A;  5JFR A;  4R1H A;  3QP6 A;  9ANT A;  4HG2 A;  4IOA F;  2L7Z A;  5E1Z B;  2E5N A;  1KQ9 A;  2VKD A;  3AAF A;  1YE9 A;  2DMP A;  4FT8 A;  4XN0 A;  2F48 A;  5HNH A;  2BV6 A;  2EV6 A;  3HBL A;  1TQP A;  1SAU A;  3LAP A;  2HWV A;  2OJE D;  1FOY A;  3FDY A;  2Y0S A;  5EEH A;  3ZQH A;  5HLG A;  4IPA A;  2GWR A;  1WZ2 A;  1MBK A;  1HBX G;  4XL9 A;  5EZH A;  2IT0 A;  1X1C A;  3JSP A;  1B8I B;  2HVR A;  2R93 J;  3COA C;  1ZAR A;  3KP4 A;  1YHQ I;  3LSH A;  5J40 A;  3SHF A;  4R79 A;  1O3T A;  3AL0 B;  2R7T A;  4BQN A;  1JKQ C;  1YRN A;  5FFX A;  2QSH X;  1YX5 A;  2QKL B;  3MKW B;  1HDP A;  2BEO A;  3B6C A;  2XUB A;  2BY0 A;  3VFZ A;  2F5E A;  1TWG J;  3RTR A;  2EFP A;  3PUF A;  3PNT A;  1YO5 C;  1EH7 A;  4A3G J;  1V4R A;  5FO5 A;  3M3Y J;  5JVT A;  3BR1 A;  2AXT C;  4RB3 C;  1S8N A;  3GLX A;  1JTY A;  1CF7 A;  1FEX A;  4BAC A;  3ELK A;  4M73 A;  2Z16 A;  1MBH A;  3V8L A;  5LGN A;  4B47 A;  1RRJ A;  2FNA A;  3OSF A;  1XGM A;  5IYB J;  2KHM A;  4ZH4 F;  3KYL A;  3HOX J;  1R5H A;  2IJL A;  2CU7 A;  4RB0 A;  5GAH J;  2HKO A;  3RKW A;  4A5M A;  1X1B A;  4C2U A;  3GO5 A;  3DEE A;  3ZR8 X;  2A69 F;  3Q0V A;  3ZCO A;  2ECC A;  2ZSI B;  2WC2 A;  3KFW X;  3VB2 A;  4FHT A;  1SMY F;  5E3M A;  3U2R A;  2CH0 A;  4AID A;  1IW7 F;  2JSC A;  2O03 A;  2DU9 A;  4UXN A;  3V7R A;  5F0H A;  1HDD C;  3E6B A;  1QZE A;  2XC7 A;  3KP5 A;  2P5V A;  2PEX A;  2QA4 I;  2IEK A;  1VQ9 I;  2RV8 A;  1BR4 A;  3FMQ A;  3CDL A;  3IKV A;  2DW4 A;  3CJN A;  4A2U A;  2LMD A;  1X1P A;  2P5K A;  1SEU A;  4RGU A;  4G6Q A;  3I9V 2;  2OA4 A;  1D1B A;  4F52 A;  3S16 J;  1AOY A;  1O3Q A;  2JTV A;  4BAY A;  2A61 A;  2VJI A;  1X2M A;  4AYB A;  3S1Q J;  3Q3S A;  1D8K A;  2R7R A;  2OPT A;  3FM5 A;  4M9X A;  5EEA A;  4U7B A;  1O3R A;  2KIM A;  1MMN A;  5D5V B;  2PJR A;  1QZY A;  4KT6 A;  3F22 A;  4HDU A;  1B9M A;  3QQA A;  2BYV E;  4J00 A;  3BPX A;  4U0V A;  2ELH A;  3GTQ J;  5F04 A;  2BBY A;  2P6S A;  4S05 A;  2O8X A;  2W24 A;  4Q5S F;  3SEQ A;  3HL2 A;  3LNQ A;  3OYA A;  2G0E A;  1UZC A;  1ZAO A;  4DNC A;  5DCM B;  2V1U A;  4B1R A;  2L2O A;  1I3A A;  2V1X A;  2DFI A;  3I59 B;  2CWE A;  2OCE A;  3JRC A;  4N0B A;  1ZG5 A;  1GT0 C;  1AHD P;  1OCZ H;  2NS7 A;  2JVG A;  3HSR A;  3VEP A;  1WGX A;  1ZKG A;  4N9I A;  3CCM I;  4XKW A;  1FTT A;  1VQ4 I;  1SVL A;  3M07 A;  1LKX A;  2VXD A;  5M3M J;  1Z7L A;  1T6S A;  4UV9 A;  2P7V B;  1UEL B;  4GO1 A;  2G7H A;  2DK8 A;  1ZG3 A;  2DDB A;  3L9F A;  1X3W B;  2XKO A;  1FT9 A;  5H6Q A;  4DZJ A;  1FP2 A;  2ZXH A;  2A6H F;  1O7F A;  3BR0 A;  3KE2 A;  3LSK A;  5DEQ A;  3F21 A;  3MD2 A;  3GF2 A;  2KRC A;  1MMA A;  2JUG A;  1LPQ A;  2DOD A;  5B66 C;  3CCU I;  2EFO A;  5E1X A;  4EJU A;  3OYD A;  1KU9 A;  2W25 A;  2A07 F;  3IAS 2;  1RR8 C;  1Y6I A;  5CVU A;  3QPH A;  2HQA A;  3SJM A;  1PDN C;  2WV1 A;  2YS9 A;  5D5W B;  3F72 A;  1HLV A;  1BW6 A;  2C6Y A;  2LDU A;  3H35 A;  4II3 A;  2DA7 A;  3OYH A;  4FAS D;  2IAI A;  4BYY A;  3QPL A;  1R00 A;  4LLG F;  3TP0 A;  4IJA A;  1FZP B;  1YS7 A;  4FX4 A;  1YYV A;  3J7A Y;  5DUK A;  4ZZL A;  3WTT C;  3HHG A;  3CCY A;  1POG A;  4C2M J;  3IV5 A;  3OL4 A;  5CLS A;  3CZ6 A;  3DPL C;  2ZXI A;  1TW3 A;  3N4M A;  1Q1V A;  3B02 A;  4IVN A;  3A01 B;  3W2A A;  2XF7 A;  1TNS A;  3ZOB A;  1W5T A;  1R5I D;  1Z91 A;  2JWT A;  2L7F P;  1GV2 A;  2EK5 A;  3QPS A;  4MEY F;  1YI2 I;  1LVA A;  3JRH A;  1FLI A;  1WJC A;  3J7Y J;  2NOG A;  2M5W A;  2MH2 A;  2XAQ A;  3CO6 C;  5IOZ A;  4LIU A;  3G1O A;  1MGT A;  3GW2 A;  2XKP A;  3L2R A;  3V8J A;  1IN8 A;  5EEG A;  3S2D J;  2DA2 A;  4CCO A;  2DMU A;  2Y30 A;  3S3M A;  3A4C A;  2R3S A;  5B1B H;  2XRO A;  3V4G A;  3L09 A;  2IS1 A;  4BHP A;  1RPW A;  2HS5 A;  4IO9 F;  1FWZ A;  5ILS A;  3DPU A;  4IHW A;  5IPA A;  4RAY A;  5M3F J;  2K5C A;  1T95 A;  1IO2 A;  1LDK B;  1Z6T A;  4A3K J;  3FMS A;  1FMV A;  3OYK A;  2CMP A;  4W97 A;  1D0X A;  3OS2 A;  2K9M A;  3HOS A;  3RDI A;  2CW0 F;  1OKR A;  2Z2S B;  4UVB A;  1WPK A;  5ILU A;  1FOK A;  4A93 J;  1QVT A;  2V9P A;  2JRT A;  1XN7 A;  2EFW A;  4ENM A;  2KP6 A;  1U9O A;  1STZ A;  5HDG A;  3RCO A;  3BTL A;  2W1O A;  5K5O A;  2R0Q C;  5JVG F;  2LYC A;  3I4P A;  1YJW I;  4L9J A;  1X4O A;  1Y8Q B;  4P9F A;  3VDX A;  2EFQ A;  3FZV A;  4WXC A;  4CYC A;  3HSF A;  1F9N A;  3FIW A;  4KN4 X;  2UXX A;  3BOQ A;  3DKY A;  2M0C A;  3TDU C;  4I0A A;  3CP8 A;  5KNL A;  1GVJ A;  2V4J C;  4MLO A;  3ZQI A;  5L3E A;  2STT A;  5LRS A;  3BQZ A;  3PL8 A;  3WTS C;  3LSJ A;  3OYN A;  2M8E A;  2DA1 A;  2CO5 A;  3U21 A;  3CQZ J;  4N9H A;  5IT3 A;  3G1M A;  2L4M A;  3ECO A;  3I4M J;  1ORK A;  4C9Y A;  4LG0 A;  4ZYD A;  2EZK A;  3DWL E;  2R7Q A;  2PFB A;  3KCC A;  2HU9 A;  2X0L A;  1ETO A;  1WVR A;  3SDG A;  2W48 A;  5CJ9 A;  2M0M A;  1ZLK A;  1Z77 A;  3FXR A;  2A6T A;  2E5Z A;  3BJA A;  5FD5 A;  3K1M A;  3GYH X;  1F43 A;  1JGG A;  1JKO C;  1X3U A;  1MD0 A;  2K4B A;  3OYL A;  3UR3 C;  4XRF A;  4RA2 A;  3N05 A;  2XAH A;  4QTR A;  1D8J A;  2WTE A;  2RQQ A;  1O3S A;  4EAT A;  3EUA A;  3TW6 A;  3GUD A;  5JHF A;  5M5X J;  2VKH A;  2R7W A;  1MBJ A;  2IPQ X;  3JRE A;  2X1D A;  4RAF A;  1QZZ A;  2WWY A;  2E36 A;  2FEZ A;  4H4K C;  5D5X B;  4WWC A;  1R1T A;  3ASO H;  1YRN B;  5FRN A;  5FRM A;  2HXO A;  1OFC X;  2X6X A;  2DI3 A;  1J75 A;  3CES A;  2PLY A;  2M4G A;  2RC4 A;  1QPI A;  2MGQ A;  4EVI A;  3FKJ A;  3PQJ A;  1D0Y A;  1ONV A;  2DA4 A;  2MA3 A;  3GZN B;  5L3F A;  5B1A H;  4AIK A;  1CF7 B;  1I1S A;  4PGG A;  3M8E A;  2CQN A;  2QLZ A;  2VBW A;  3QOD A;  5BPD A;  1IG7 A;  3WG7 H;  1DGR M;  2L9V A;  2XAU A;  3RSN A;  4ZTJ A;  4D7N A;  1ZR4 A;  4G12 A;  1P92 A;  3TOA A;  2R5Y A;  2NVQ J;  2CQK A;  3DCF A;  3G71 I;  1WCM J;  2X51 A;  1KA8 A;  2Q8K A;  5DM6 F;  1UST A;  4ZYE A;  2Q2E A;  3SEZ A;  4GCV A;  2D1V A;  5DUI A;  2MLK A;  4YFK F;  1OR7 A;  3A0B C;  4J19 A;  4KIS A;  3ZQF A;  1ETW A;  1I5Z A;  1ULY A;  4MFD A;  4EJV A;  3ZGK A;  2ELJ A;  2CYY A;  3HUG A;  4HQE A;  1SAN A;  3VOE A;  4L5J A;  4ZYH A;  2QKM B;  4F55 A;  3ZN0 A;  5IY5 H;  2XHK A;  2PBI A;  3IRR A;  2ZJ2 A;  3HG9 A;  3ZQQ A;  3M1C A;  2X85 A;  4UUV A;  4CCJ A;  3FF5 A;  2F5D A;  2HZD A;  5ILV A;  3ZP5 A;  1RES A;  2KPM A;  1R7J A;  2VQG A;  4Y7N J;  2HDW A;  2L0K A;  5CYV A;  4IHX A;  3RJP A;  4CH7 A;  3TOB A;  1MZB A;  1FOX A;  3BTJ A;  4HX4 A;  1YIO A;  3ZMT A;  4DJA A;  1MSF C;  1WQ2 A;  4HPQ A;  3SFZ A;  2TDX A;  4B8X A;  1N77 A;  4LGW A;  1HKQ A;  1RKW A;  2HGC A;  2YR2 A;  2W82 A;  3WE2 A;  3OR1 C;  4TV7 A;  3GEZ A;  2NNY A;  1ZH5 A;  2PJR B;  1R71 A;  2L9N A;  3PSF A;  3S93 A;  2IXS A;  4LIV A;  4EV0 A;  4M9Z A;  3FWE A;  3PJR A;  4XK4 A;  3K4B A;  2PMZ A;  2M2E A;  4BEH A;  3WTY C;  4DW6 A;  2DT6 A;  1P2F A;  2CUE A;  1TQM A;  1XDS A;  2ELK A;  2RDP A;  4ZDO A;  2IGN A;  3G3Z A;  5HOD A;  1DU6 A;  5A2Q Z;  1TT0 A;  1LEA A;  2CW8 A;  2XAJ A;  2VJ5 A;  1JJ6 C;  1BIA A;  3RI4 A;  1FYM A;  1F36 A;  4LK1 F;  3V42 A;  1U6G A;  1J0R A;  3K4C A;  3R60 A;  5DS9 A;  1XMK A;  3QPT A;  3SXY A;  4IF4 A;  1RUO A;  1AWC A;  1GVD A;  3IL2 A;  5FD6 A;  5K1Y A;  4UVA A;  3IH4 A;  1FC3 A;  3BDD A;  2IA2 A;  2O0Y A;  2ZKZ A;  2XB0 X;  2ICW G;  2ZXJ A;  1T8I A;  1IXC A;  1VQL I;  1H89 C;  1BOB A;  3S17 J;  2AO9 A;  2ID3 A;  4HST A;  3ABK H;  1MJB A;  2LKS A;  5HVQ C;  3U1D A;  1XMA A;  4UB6 C;  3DEU A;  3CCV I;  3KX2 A;  4I0B A;  4HSR A;  3W6J B;  4XID A;  3GFJ A;  2XF6 A;  3SZG A;  5BOX A;  1X19 A;  3RQI A;  2CG4 A;  2HYG D;  2JT1 A;  2XVC A;  1G3Y A;  4IHV A;  4UNO A;  5GPA A;  1SD7 A;  5LHI A;  1TQI A;  2NVX J;  4P1W A;  1EF4 A;  3R6S A;  4I7H A;  3ERM A;  4F91 B;  4K2E A;  3DFG A;  4S04 A;  2OTL I;  2VE8 A;  3RYR A;  3H0G J;  3WG9 A;  2ISZ A;  1SD4 A;  4L0Z B;  2EQR A;  1XSD A;  2K7L A;  4E7S A;  3E3V A;  1FJL A;  1DDN A;  3K4N A;  4A0Y A;  1ZK8 A;  3CTA A;  3IWF A;  3TKY A;  1H8A C;  2MD0 A;  1WJF A;  4LOC A;  3JRI A;  1W36 D;  1K61 A;  2IS6 A;  3L2V A;  4D1Q A;  1RC9 A;  4LMY A;  1YIT I;  5KK1 A;  4G7O F;  1BL0 A;  4XSZ F;  2K86 A;  5J1U A;  1LUJ B;  3DTK A;  3FIS A;  4BXX J;  1JI8 A;  3CJR B;  2E1M C;  4HV5 A;  2UWM A;  4PJJ A;  3C2G A;  3S32 A;  3MAJ A;  4YFN F;  2Z5U A;  3W2W A;  1ZEL A;  4LFU A;  2FJ1 A;  4IQJ A;  4BY1 J;  1UB9 A;  4BHB A;  2KDZ A;  2E1O A;  3E97 A;  2EIL H;  1VQ8 I;  2ZJQ F;  3I3L A;  2OZU A;  5DTD A;  3F9K A;  1I6X A;  1LE8 A;  3IP4 B;  1LNW A;  2MYS A;  2OBP A;  3CME I;  4GYI A;  4ENK A;  2ZB9 A;  1EH6 A;  3ZQG A;  2KKO A;  4M3D A;  2H6C A;  5M5W J;  2HTJ A;  3WGI A;  1FX7 A;  3KLN A;  3O6B B;  4RLQ A;  5E3L A;  3ABL H;  3HB9 A;  2ZXW H;  2ECB A;  3KLO A;  1KU7 A;  3T1B A;  3QP5 A;  2HEO A;  5E20 A;  5IYC J;  3I0T A;  2X9D A;  2Z99 A;  3K4M A;  4HF0 A;  1ZGW A;  3KYD B;  4NB5 A;  2XGC A;  4C3H J;  1D5Y A;  3I55 I;  1E3O C;  3E6C C;  4XLF A;  2YU3 A;  2CGP A;  4KIF A;  3BRO A;  3IUO A;  3M1E A;  4XLH A;  4HW0 A;  4S0H B;  3VWB A;  4XM3 A;  2E7W A;  5F08 A;  1OQY A;  2HQ5 A;  5BNG A;  4CYC B;  1HW5 A;  4MQ9 F;  3HDD A;  2DFF A;  3LFK A;  1T38 A;  1OMI A;  4MTE A;  2ZFU A;  2NVY J;  3G1L A;  3I56 I;  3QU3 A;  1LQ1 A;  1BN5 A;  1XD7 A;  2DJI A;  3IAM 2;  4QPQ A;  5FLX K;  4XSX F;  5M5Y J;  3OIO A;  1IV8 A;  3P5J A;  3WE3 A;  1RIO H;  3PSI A;  2YU9 J;  1IAW A;  4M6V A;  3C7J A;  2PN6 A;  3JRG A;  1OCP A;  2LK2 A;  4LG0 B;  1VQN I;  3HJE A;  3M9A A;  5DD8 A;  3J80 Z;  4RGR A;  1YW9 A;  2LVS A;  2P4W A;  2OUM A;  3R4K A;  4IZZ A;  1IZ1 A;  1DU0 A;  2F4O B;  2MH9 A;  2WV0 A;  2VT2 A;  4AUX A;  1PUF A;  1WSU A;  2ZME A;  4MNU A;  2WY8 Q;  2VXZ A;  5L3G A;  3BZK A;  3M4O J;  1FSH A;  3MQ0 A;  4A6E A;  3GCM A;  4JOM A;  5J8F A;  4M6X A;  3FM3 A;  4BY7 J;  2Y2Z A;  2EV5 A;  2M3A A;  3KIO A;  3CC7 I;  1ETQ A;  3EUH C;  1R6R A;  4QPO A;  5J6X A;  3BT9 A;  2HYF A;  3MZH A;  1S3J A;  2RQP A;  2VLA A;  2QEN A;  3BLY A;  4XMY A;  1YOV B;  1S6L A;  3HC7 A;  3DKW A;  1J59 A;  2K3F A;  4ENJ A;  1XB4 A;  2Q0O A;  5GP9 A;  4A3C J;  1XMX A;  4NUB A;  4G6T B;  2XAF A;  4Y3O A;  2AS5 F;  3BTI A;  2BY2 A;  1K6Y A;  4V19 K;  3GTO J;  5EG0 B;  1WH7 A;  3SFI A;  1HW2 A;  4E7Z A;  3Q9V A;  2FXA A;  2V1N A;  4YIF A;  2RNG A;  5BS6 A;  3CD6 I;  3F6O A;  1UFM A;  4XOT A;  2LY9 A;  3KET A;  1JUP A;  4MQV A;  1KYZ A;  3Q0W A;  2K40 A;  4A3D J;  2WB1 N;  4FTH A;  2VOP A;  4KT5 C;  1PJR A;  1FOW A;  2H27 A;  1A5J A;  3OYG A;  2R7V A;  2DFE A;  1V5E A;  3VPR A;  2UZK A;  4UB8 C;  2L3D A;  5ED4 A;  1QGP A;  1Y8R B;  1NTC A;  2R5Y B;  2Y31 A;  3DTI A;  1U2W A;  4ESF A;  3VYS B;  5HOO A;  4F7Z A;  4CCM A;  4ZDL A;  1TTY A;  2Q2E B;  2L4A A;  1UG2 A;  4B4C A;  4DYC A;  3WHB A;  4BKX A;  1YS6 A;  5CQE A;  3RYP A;  3RZD J;  1AA7 A;  1U5T C;  2QEX I;  1TWH J;  3AG2 H;  2OAZ A;  1WFX A;  3OWT A;  3HPG A;  3F8M A;  4A3B J;  4Y4R A;  4ESJ A;  2D2W A;  3HUG B;  3HTS B;  5E8I A;  1J9I A;  3NWT A;  1IXS B;  4QWQ A;  3S1N J; 
#chains in the Genus database with same CATH homology
 1U9O A;  3BTL A;  4IHY A;  2R0Q C;  3BQY A;  4QIW N;  2QCO A;  2DA5 A;  3HGG A;  5F1J A;  4UUT A;  3PO2 J;  4CYC A;  3WHC A;  4A3F J;  3FIW A;  1MNM C;  2M0C A;  1ZQ3 P;  3BR3 A;  4MLO A;  2E19 A;  3ZQI A;  5EF6 A;  5FLV A;  3BQZ A;  2JN6 A;  3LSJ A;  3TW7 A;  4C3I J;  1MH3 A;  2K9N A;  1UHS A;  2DA1 A;  2VI6 A;  2Y9Z A;  1JT0 A;  3CQZ J;  3G1M A;  2X6O A;  4JX5 A;  3I4M J;  1ORK A;  2O9L A;  3HM5 A;  3L1P A;  2EZK A;  2ID6 A;  3IH2 A;  1IRZ A;  4BBR J;  3DEW A;  2LD5 A;  1ETO A;  1U8B A;  3SDG A;  2W48 A;  3D1N I;  3MVP A;  5F0F A;  3GTJ J;  1Z77 A;  3FK7 A;  3OSG A;  3GTG J;  2LFB A;  1AU7 A;  2O7O A;  1ZR2 A;  2FD5 A;  5K7F A;  1F43 A;  1MBE A;  4FE7 A;  1JKO C;  1JGG A;  2NVT J;  1Y1W J;  4RDU A;  2Y9Y A;  3FK6 A;  4QTR A;  5F27 A;  1AKH A;  4ABZ A;  1TWA J;  5C4J J;  3JRF A;  2O8K A;  3HOV J;  1I6H J;  3TW6 A;  5M5X J;  3W6V A;  1K83 J;  1IJW C;  1MBJ A;  1ETK A;  1GDT A;  3JRE A;  1G2H A;  2HOA A;  5EYR A;  5IP7 J;  3S1R J;  1YRN B;  2HXO A;  1VND A;  2JA8 J;  4M3B A;  4A69 C;  1OFC X;  3S2H J;  1B72 B;  2FX0 A;  3LSR A;  5EGO A;  2GM4 A;  2K9S A;  3E7L A;  3GTL J;  2OF7 A;  3A01 A;  1QPI A;  2MGQ A;  1FTZ A;  1NK3 P;  2EH3 A;  4M3E A;  2CQQ A;  2DA4 A;  2JMW A;  2HYJ A;  4A3E J;  2VKV A;  5EDN A;  1IGN A;  1IG7 A;  4AC0 A;  3JRD A;  1VI0 A;  5EZG A;  3HOY J;  3O8G A;  4FCY A;  3GTM J;  4D7N A;  1ZR4 A;  4G12 A;  1P7J A;  2LTP A;  2XB5 A;  4JX4 A;  1FIP A;  1JTX A;  2R5Y A;  2NVQ J;  3HOU J;  3DCF A;  1WCM J;  3RKQ A;  1APL C;  2H8R A;  3HOW J;  2DMN A;  1TWC J;  2E2J J;  2E2H J;  4A3M J;  2XPV A;  2JA6 J;  2GBY A;  5IYD J;  3BR2 A;  2WAQ N;  1ZTR A;  1ENH A;  4J19 A;  2X48 A;  1QRY A;  3ZQF A;  5GPC A;  1ETW A;  4MFD A;  3PM1 A;  1X58 A;  1W0T A;  2DN0 A;  1RET A;  3BR5 A;  4A3I J;  3H3V K;  4D5F A;  1SAN A;  4IEJ A;  2VKE A;  4MIM A;  4M3G A;  2MW8 A;  2I10 A;  2B63 J;  3I4N J;  4XRS G;  1RES A;  2DA6 A;  3BR6 A;  5E3O A;  3O8H A;  4DYR A;  4Y7N J;  1W0U A;  1OJL A;  2L0K A;  4IHX A;  1X2N A;  4UUS B;  4B3A A;  1LE8 B;  1LFU P;  3BTJ A;  5J1R A;  2EZI A;  5K7H A;  5FKO A;  1MSF C;  3IH3 A;  3ZQL A;  2ME0 A;  2L9R A;  1RKW A;  4NDL A;  1XS9 A;  2EBI A;  3HKZ N;  4X6A J;  2PMZ N;  4V2F A;  3A02 A;  4C3J J;  2CJJ A;  2K9Q A;  1UMQ A;  2ME6 A;  5J1Y A;  4XK4 A;  4MFE A;  2M2E A;  5FKL A;  4DW6 A;  2XPW A;  2HDD A;  2CUE A;  2ELK A;  5FKK A;  2CUF A;  2DMQ A;  5HOD A;  1DU6 A;  4GFB A;  2Y0S N;  4JYK A;  9ANT A;  2L7Z A;  3NAR A;  4D7M A;  1JJ6 C;  1RKT A;  2DMP A;  4XRS A;  3BG3 A;  3A03 A;  1F36 A;  1QVU A;  4I6Z A;  3HBL A;  3JRB A;  3RZO J;  5DS9 A;  5FKM A;  3F0C A;  3ZQH A;  1GVD A;  2H1K A;  1MBK A;  2LLK A;  5EZH A;  5IP9 J;  1JJ8 C;  2R93 J;  1B8I B;  1WH5 A;  3IH4 A;  2R92 J;  2KT0 A;  2XB0 X;  1R9T J;  1MBG A;  2LP0 A;  1JKQ C;  1H89 C;  1YRN A;  3S17 J;  2AO9 A;  2ID3 A;  4A3L J;  4HNV A;  1ETX A;  4Y52 J;  1HDP A;  3B6C A;  2MG4 A;  1B72 A;  2NS8 A;  5EG0 A;  1TWG J;  4X1E A;  4XID A;  1PUF B;  3CMY A;  1RR7 A;  3Q0U A;  3RQI A;  4BBS J;  2MSY A;  4A3G J;  3M3Y J;  4IHV A;  3JR9 A;  5GPA A;  2NVX J;  3BR1 A;  1ETV A;  1EF4 A;  1JT6 A;  1I50 J;  1JUS A;  4JP0 A;  2XGD A;  1JTY A;  1FEX A;  1MBH A;  3H0G J;  2EQR A;  1GUU A;  3OSF A;  5IYB J;  2JK3 A;  2E2I J;  3S15 J;  1XG1 A;  2DTZ A;  2LR8 A;  1FJL A;  3FKI J;  3HOX J;  1ZK8 A;  2R5Z B;  3HOZ J;  1SFO J;  2CU7 A;  1H8A C;  1MSE C;  3K2A A;  3JRI A;  4LOC A;  1K61 A;  3Q0V A;  2RAE A;  1ITY A;  2YUS A;  5JLW A;  2ECC A;  3S1M J;  1BL0 A;  3JRA A;  3PO3 J;  3S14 J;  5J1U A;  5E3M A;  3FIS A;  4BXX J;  2DMT A;  1IV6 A;  5F0H A;  1HDD C;  5IOY A;  2FJ1 A;  1CQT A;  1Z0X A;  4XRM A;  4BY1 J;  1IDZ A;  1JKP C;  1OCT C;  2IEK A;  2KDZ A;  2E1O A;  3CDL A;  3K7A J;  1O4X A;  4AYB N;  2TRT A;  4FIS A;  3MN2 A;  5DTD A;  2XGE A;  3C2B A;  5E3N A;  4UUS A;  3NAU A;  1IDY A;  1LE8 A;  3MKL A;  3TP3 A;  3S16 J;  3BG5 A;  2XRL A;  2ZB9 A;  3ZQG A;  2TCT A;  1MBF A;  1X2M A;  4M3D A;  3S1Q J;  3Q3S A;  4V2G A;  5M5W J;  3LSG A;  2OPT A;  5E3L A;  2EZL A;  5EEA A;  3GTP J;  4EEF G;  1HF0 A;  3HB9 A;  2CQX A;  4A3J J;  2ECB A;  1VFC A;  3QQA A;  4L5E A;  3GTK J;  5IYC J;  3GTQ J;  5F04 A;  2X9D A;  1ZGW A;  2XGC A;  4C3H J;  5IP6 A;  1D5Y A;  1TC3 C;  1XC5 A;  1E3O C;  1FIA A;  3LNQ A;  2G0E A;  2AHQ A;  5C4X J;  4S0H B;  2D5V A;  4B1R A;  5F08 A;  1JKR C;  2HQ5 A;  5BNG A;  4CYC B;  3LOC A;  2N8G A;  2R7Z J;  2CRG A;  4XIC A;  3JRC A;  1GT0 C;  1AHD P;  2NS7 A;  3HDD A;  1WGX A;  3BTC A;  1ZKG A;  1FTT A;  1I3Q J;  2NVY J;  3G1L A;  5M3M J;  3HGY A;  1LFB A;  1B8I A;  2JA5 J;  1T33 A;  4MO7 A;  3OOU A;  2XPU A;  5M5Y J;  3OIO A;  2YU9 J;  4M6V A;  4DZJ A;  1HCR A;  1P7I A;  3BR0 A;  3JRG A;  1H88 C;  1OCP A;  2LK2 A;  2LKX A;  2M8G X;  2LVS A;  1GV5 A;  1DU0 A;  2EZH A;  2HI3 A;  4AUX A;  1PUF A;  2GLO A;  1BJZ A;  1ETY A;  4DYQ A;  2HOT A;  2M9H A;  3M4O J;  5C44 J;  2VPR A;  2DJN A;  3SJM A;  5C3E J;  1IC8 A;  4BY7 J;  2Y2Z A;  2WV1 A;  1S7E A;  2YS9 A;  1ETQ A;  2IBD A;  5F0C A;  5FLM J;  1A6I A;  1HLV A;  3BT9 A;  1BW6 A;  1AKH B;  3B6A A;  2HXI A;  2QF7 A;  4QSH A;  2DA7 A;  2JJ7 A;  2IAI A;  3QPL A;  3BG9 A;  1T56 A;  2HOS A;  3TP0 A;  4JX6 A;  5JLX A;  2R5Z A;  5GP9 A;  4A3C J;  1MH4 A;  3HEF A;  3BTI A;  4I76 A;  3GTO J;  1Y1V J;  5EG0 B;  1WH7 A;  3SFI A;  3CCY A;  1POG A;  4C2M J;  3LSP A;  3IV5 A;  3UKG A;  1NK2 P;  2M34 A;  1BA5 A;  2FQ4 A;  5EGO B;  1TWF J;  4FE4 A;  2LY9 A;  1Q1V A;  5FKN A;  1JUP A;  3A01 B;  3ZOB A;  3Q0W A;  2JWT A;  2K40 A;  2L7F P;  1GV2 A;  2WB1 N;  4A3D J;  3QPS A;  4FTH A;  5FJ8 J;  3JRH A;  2NOG A;  5IOZ A;  1A5J A;  3G1O A;  5J3L A;  3VPR A;  3S2D J;  1HOM A;  1U9N A;  2DA2 A;  2DMU A;  2Y30 A;  1NTC A;  1IUF A;  2Y31 A;  2R5Y B;  2VUM J;  4W1U A;  1RPW A;  1UG2 A;  2L7M P;  4IHW A;  4B4C A;  2P81 A;  4DYC A;  5IPA A;  5M3F J;  3WHB A;  4BKX A;  4A3K J;  4M3F A;  1WI3 A;  3RZD J;  5K7Z A;  2COB A;  4W97 A;  3GBG A;  2DA3 A;  1TWH J;  2JA7 J;  2XSD C;  4DZP A;  3ZQC A;  4A3B J;  1VF9 A;  1JUM A;  4D5C A;  1WPK A;  4A93 J;  1U78 A;  4RBO A;  1QVT A;  3TED A;  1BW5 A;  3S1N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...