3CQZJ

Crystal structure of 10 subunit rna polymerase ii in complex with the inhibitor alpha-amanitin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title The RNA Polymerase II Trigger Loop Functions in Substrate Selection and is Directly Targeted by Alpha-Amanitin.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3cqzJ00
2HXOA 2Y30A 4A3CJ 2DMNA 4A3KJ 2XB5A 4W97A 3HGGA 1JKPC 5EG0B 1GT0C 4IHYA 5IP6A 2JA6J 1IG7A 4BY1J 3TP3A 2XSDC 2R0QC 4FISA 5K7ZA 2M34A 4RBOA 4HNVA 3Q3SA 1VNDA 3S14J 2CUEA 1IUFA 2DA4A 2IAIA 2L7FP 2HQ5A 3LSRA 1I3QJ 1ORKA 1MBGA 1LFBA 5C44J 1BA5A 1AHDP 4C3IJ 2E19A 3W6VA 1PUFB 3S1RJ 3I4MJ 4A3JJ 1ITYA 2OPTA 3CQZJ 5FLVA 2WV1A 3S2HJ 1MH4A 2CU7A 1YRNA 1WH7A 1MBHA 1WCMJ 3ZQHA 2ID3A 4ABZA 4B4CA 2LFBA 5GP9A 2R5YA 2TCTA 3G1MA 3HOVJ 1ZR4A 2HOSA 3IH2A 1I50J 3BR6A 4BY7J 1JT0A 3OIOA 3JRAA 1ZTRA 5J1RA 3RZOJ 2EBIA 1W0UA 2LY9A 1LE8A 4XICA 4D5CA 3HOYJ 2XGCA 3BG3A 3PM1A 2L7ZA 4A3EJ 1GDTA 3FK7A 1OJLA 4UUSB 3HM5A 3CCYA 1DU6A 2EH3A 1VF9A 1FIPA 3BQYA 4IHWA 4XRSA 5FKMA 2LLKA 3JRGA 4JX5A 3JR9A 1A5JA 2MSYA 2MG4A 1Y1WJ 1Q1VA 3WHCA 1O4XA 1ZK8A 5GPCA 4A93J 2R93J 1WH5A 4XIDA 2EZIA 4X1EA 1RKWA 4G12A 3HOWJ 4C3JJ 4DYRA 2RAEA 2DA7A 2ECCA 1GUUA 1RKTA 2XB0X 2LKXA 3Q0UA 5JLXA 2DA1A 3MN2A 1NK3P 2KDZA 1ETXA 3B6AA 4MLOA 5EEAA 5IOYA 2X9DA 1TWGJ 5K7FA 3S15J 2QF7A 2ELKA 2HDDA 1BL0A 2NVYJ 5EYRA 1APLC 1WI3A 5F08A 1MH3A 1T56A 2HI3A 3GTKJ 2HXIA 2OF7A 5IOZA 2O8KA 2FD5A 3LSJA 1E3OC 3K7AJ 5EGOB 3QQAA 5BNGA 1ZKGA 1HF0A 3A01A 2VKEA 3ZQGA 1ETWA 4Y52J 5GPAA 1Y1VJ 1K83J 4NDLA 3HGYA 3Q0WA 4BBRJ 3QPSA 5DS9A 3ZQCA 1FIAA 1UG2A 3BTIA 1IDYA 4FCYA 1B8IA 1GVDA 2GM4A 1VI0A 3SFIA 2IEKA 4JYKA 2K9SA 3GBGA 1RPWA 2LR8A 2LVSA 2DJNA 2EQRA 3BTLA 2CUFA 4B3AA 1TWFJ 1K61A 3HOXJ 1SFOJ 1MSEC 1AKHB 5C4JJ 3S2DJ 1ETYA 3LSGA 5FKLA 4I6ZA 3BQZA 2N8GA 2G0EA 2ZB9A 2WAQN 3IH3A 2CQXA 2VKVA 5EZHA 3Q0VA 2D5VA 2H8RA 2M9HA 1POGA 1A6IA 2MGQA 1BJZA 3JRIA 3LNQA 3C2BA 3MKLA 2R5ZA 1JUMA 4UUTA 1JTYA 1TWCJ 2M8GX 3ZQLA 3PO2J 3M3YJ 1IV6A 5J1UA 5IP9J 4A3DJ 2DA5A 3TW7A 4W1UA 4QSHA 2XRLA 2E2JJ 1UHSA 3BTJA 2R7ZJ 3DEWA 2ID6A 2XPVA 2Y0SN 2NOGA 5M5YJ 1JJ8C 5F0FA 1B72B 2YU9J 2HOAA 2JA8J 4M3FA 4XK4A 1U8BA 2JA5J 1W0TA 1JJ6C 2GLOA 3HOZJ 2JK3A 2KT0A 3A03A 1JT6A 3LOCA 1LFUP 2E2IJ 5HODA 4AYBN 1X2MA 3OSGA 1MSFC 3RQIA 1GV5A 4CYCA 1ETKA 1HDDC 2GBYA 3WHBA 2DA2A 2XPUA 3JRBA 1EF4A 2EZKA 4EEFG 2FJ1A 1OCTC 1MBKA 1OFCX 5IYCJ 3GTPJ 1GV2A 1RESA 1IJWC 3LSPA 4A69C 3BR1A 3IV5A 3O8HA 2VI6A 1S7EA 5JLWA 2JN6A 1JUSA 3B6CA 4M3GA 3SDGA 2EZLA 1TC3C 1BW6A 3S17J 2NVXJ 1YRNB 4FE7A 1X58A 3GTLJ 2VPRA 2M2EA 5IPAA 1JKRC 2NVQJ 4IHXA 5EG0A 2X6OA 2E2HJ 4MO7A 1HOMA 2R5YB 3JREA 4J19A 4DZPA 2DN0A 4BBSJ 1U78A 1F36A 3QPLA 5FKOA 2ME6A 2R92J 2WB1N 1ZQ3P 4AC0A 2XPWA 1XG1A 5IP7J 4AUXA 1MBFA 1LE8B 4V2FA 3BR2A 1ETQA 1IGNA 2LP0A 1PUFA 2L0KA 4A3IJ 4X6AJ 3S16J 2L9RA 5E3MA 2CJJA 1JUPA 2COBA 4MFEA 3HBLA 2MW8A 3BR0A 1AU7A 5F0CA 3VPRA 2Y9ZA 1X2NA 4MIMA 1IC8A 2QCOA 4JX4A 2DMQA 3JRCA 5F04A 2DMPA 3O8GA 2LD5A 3H0GJ 1B72A 2JMWA 1G2HA 1ZR2A 3K2AA 1NTCA 1IRZA 4DYCA 2Y31A 1P7JA 1P7IA 5M5XJ 3GTJJ 1DU0A 2E1OA 5E3NA 4D5FA 9ANTA 3E7LA 4DYQA 3FKIJ 3S1QJ 1H8AC 3GTMJ 2I10A 3DCFA 2O7OA 2X48A 1QVTA 4A3BJ 4I76A 3M4OJ 1QVUA 4L5EA 1RR7A 4IEJA 1U9NA 2DA3A 3BT9A 3GTOJ 4C2MJ 1JKQC 4D7MA 3HEFA 2JA7J 4GFBA 5M3FJ 4UUSA 3HOUJ 4FTHA 2IBDA 4MFDA 4D7NA 1ENHA 2FQ4A 3GTGJ 3JRDA 1I6HJ 2NS7A 4QIWN 2O9LA 1JTXA 3A01B 1ETVA 3OOUA 4M6VA 2PMZN 5J3LA 5DTDA 4XRSG 4DW6A 3TEDA 4A3MJ 2NVTJ 4QTRA 3JRFA 3NARA 5C4XJ 1WGXA 5FKKA 3D1NI 3MVPA 1FTZA 3S1MJ 3L1PA 1D5YA 3HDDA 2B63J 1BW5A 2XGEA 4BXXJ 2YUSA 1Z0XA 3H3VK 2P81A 3BG5A 4JP0A 5F27A 4M3DA 1B8IB 3BG9A 2DA6A 5FKNA 3GTQJ 1U9OA 3FK6A 1ZGWA 5M3MJ 3UKGA 1XC5A 4IHVA 3HB9A 3I4NJ 3CMYA 1ETOA 4C3HJ 3IH4A 1MBEA 1OCPA 2DMTA 3OSFA 3G1LA 1QRYA 2K40A 5K7HA 2EZHA 2ECBA 4DZJA 3G1OA 5E3OA 5EGOA 1T33A 5EZGA 5EF6A 2R5ZB 5IYBJ 1Z77A 1MBJA 4B1RA 5F1JA 4M3BA 4RDUA 2NS8A 3PO3J 1JKOC 4XRMA 1IDZA 2DTZA 3CDLA 5M5WJ 2YS9A 2Y9YA 2JJ7A 1MNMC 5FJ8J 1H89C 5J1YA 2ME0A 2HYJA 5EDNA 1NK2P 4LOCA 3HKZN 5C3EJ 2AO9A 1SANA 3S1NJ 4A3LJ 2CRGA 2AHQA 2CQQA 3BR5A 2K9NA 1FTTA 3NAUA 1HCRA 5FLMJ 3TW6A 4Y7NJ 3BR3A 4JX6A 4V2GA 4A3GJ 1AKHA 1R9TJ 2M0CA 5IYDJ 3A02A 2HOTA 1FEXA 5E3LA 1WPKA 3FIWA 2LK2A 1RETA 4S0HB 2TRTA 4M3EA 2XGDA 2JWTA 2VUMJ 2FX0A 3ZQFA 4CYCB 3TP0A 3FISA 3BTCA 4A3FJ 1FJLA 3RKQA 1UMQA 4FE4A 3SJMA 2LTPA 1CQTA 1HDPA 3RZDJ 1H88C 2W48A 2DMUA 2H1KA 2K9QA 2Y2ZA 1TWHJ 3F0CA 5F0HA 3JRHA 1HLVA 4BKXA 1QPIA 1XS9A 1VFCA 2L7MP 1JGGA 1TWAJ 3ZQIA 3ZOBA 1F43A
chains in the Genus database with same CATH superfamily
1DPUA 2Y30A 4I02A 4A3KJ 5GTIC 3J80Z 3GFIA 1O3RA 2XB5A 2VL8A 2K3PA 2V6EA 3ZMTA 4PZJA 1JKPC 3CTAA 2RN7A 3H1CA 4IHYA 1RRJA 2JA6J 4BY1J 2XSDC 2HYGD 2IVMA 1Q1HA 1I39A 1ZG5A 4G6QA 1YS6A 4XLPF 1QQIA 3S14J 3DV8A 1IUFA 2IS1A 3PSFA 1T2KA 2CUJA 5LLQA 2A5YB 2H6BA 3OYCA 1SAXA 1D8JA 1HA8A 1MMDA 2P6SA 1LFBA 3TO7A 3E5QA 2DDBA 4IHTA 2P4WA 4C3IJ 3DPUA 4XRFA 3ZMUA 4KMFA 1FMVA 1FMWA 2HKXA 2L02A 1WJEA 1TQMA 4HRIA 4KNYA 1OISA 2OPTA 4NB5A 3L9FA 4BEHB 2ACJA 1S72I 5KVRA 2X51A 3GLXA 1MBHA 1WCMJ 2FOKA 2L9NA 3LSIA 3ZQHA 3J7ZI 4ABZA 5GP9A 2DFEA 1S8NA 3EQLF 3AL0C 3BJOA 1PDNC 4XQFA 3WG9A 2KIQA 5DYMA 2XV4S 4IRGA 4GO1A 1I1SA 2LSOA 4OU0A 2HOSA 1ZG1A 2JSPA 2A5WA 3IH2A 4D1QA 2V9PA 3MWMA 2R7RA 4MQ9F 2XASA 1I1GA 2KJCA 3JRAA 1ZTRA 3RZOJ 2EBIA 3C18A 2DPUA 3G4SI 3CF2A 3CD6I 2EV6A 1EH7A 1LE8A 4CH7A 2JA2A 3M7GA 4XICA 5LD2C 2HQAA 2P8TA 2K9MA 3W6JB 3J7AO 2R3SA 4M6YA 4BHPA 4UUSB 3SYTA 2ZJPF 2QKLB 1Z21A 1VF9A 1WJ5A 1FIPA 5BOXA 2KFDA 2LLKA 4BJTA 2FMYA 4JX5A 4XM3A 2OV7A 4HAMA 2XF7A 2QA4I 3LWFA 5HS8A 2JVGA 4A93J 2IS2A 1ZGAA 5FLXK 2VJJA 3OYDA 1O3QA 2PMHA 1DGRM 2DOEA 3L09A 4G12A 4G9YA 4XLCA 3CO7C 4A12A 4DYRA 4B09A 2BHYA 2HZDA 3ZQQA 1D3YA 2XB0X 3H9QA 1U5TA 2O8XA 2BV6A 2VT2A 2KDZA 3CCUI 1PP8F 3A2KA 4UHTA 5DM7F 2GOMA 3E1SA 1TWGJ 3MZYA 4RM2A 3C2HA 4CXFA 2E1CA 3GLLA 4CA0A 2GXAA 1BBYA 3MZHA 4OMYA 2PLYA 4EMSA 1BL0A 4CICA 1XMAA 5CQGA 5F08A 3WGIA 2HI3A 1K6OA 1ZELA 2BY3A 2OF7A 2QEXI 5IOZA 2FD5A 4O3MA 2BYVE 2XKOA 2Z3YA 3K1NA 4WXHA 5GTHC 4CDGA 1IN6A 4A0ZA 4A5NA 4NNJA 2Q1ZB 3P5JA 2HVQA 1XTAA 3GMEA 4BQQA 4EGZA 3CCMI 2O3FA 4JK1X 2JPBA 4NDLA 5BMZA 3HGYA 4CGZA 2QQBA 5FFZA 2L5QA 5EEHA 4OWRB 2R7TA 4XKBA 1ZREA 1IDYA 3U1DA 2ZMEA 5L3GA 1R71A 2P7CB 1VI0A 2OCCH 3WTTC 1TQPA 2NAZA 1L0OC 1USSA 4ENNA 3GBGA 1VQ4I 1WI9A 2ZNYA 4YELA 3RPUA 3DBRB 1PP7U 1A36A 1BC8C 4OOIA 1K61A 3M9AA 2JVHA 2RGVA 1KYWA 2W7NA 3LSGA 5FKLA 1R5GA 1MJAA 1R22A 3F8NA 3WTXC 3GUDA 2G0EA 2ZB9A 2WAQN 4G6TB 2CQXA 2VKVA 1DQUA 3GX4X 5EZHA 3WODF 2D5VA 2GAUA 2M9HA 3N05A 1BJZA 3C2BA 3KPHA 2R5ZA 1LEBA 2PG4A 2ZXHA 4BQAA 4UVBA 3I56I 3I0TA 5LFAA 3K1MA 3M3YJ 2A3SA 1J0RA 2B7EA 3F23A 3BTJA 2GQQA 3K4CA 3N97A 5ICEA 3MKYB 2MA3A 2EFPA 4RB0A 3WE2A 2CW7A 1LDDA 3BZKA 2NOGA 3OR2C 1UB9A 3OYMA 5TRDA 3CLOA 1B72B 1S5LC 3L2VA 1Z3XA 4KMUX 4MTDA 5DUKA 2A69F 2QSHX 3BPVA 2IGOA 2ZFWA 3JTHA 1BM9A 1JHHA 3M1CA 4XK4A 1W0TA 4I09A 1FY7A 4B48A 2GLOA 1XSVA 2JK3A 4AM3A 2CSOA 3NWTA 5E1WA 4AIJA 2GA1A 4F55A 3RQIA 2LMDA 3VYUB 1UELB 2HGCA 3I58A 3WHBA 2F4OB 4LG0B 4IF4A 4II2A 2EIKH 2CW0F 1MBKA 3AG3H 3BLYA 1OFCX 4HSRA 3U9GA 1WKMA 4BJ6C 4NC7A 1GV2A 2CS3A 3S32A 5IT3A 3ELKA 1IJWC 3P9IA 3LSPA 3IV5A 3ZPLA 2L7KA 1R49A 2CMPA 4BQOA 1BN5A 4M9ZA 3IKVA 1X1DA 4OMZA 2HPMA 3CCLI 4PJJA 2IRFG 4RB2C 3BJAA 1FOYA 1X58A 3PL8A 1MZBA 2CFOA 4NC8A 1ZN2A 2V6CA 1BOAA 3E6CC 4D9JA 2PMZA 2X6OA 3I59A 2LF8A 1KQ8A 4MO7A 1TW2A 4NQWB 5E79C 3JREA 1J2XA 4XOPA 4J19A 1D0YA 2DN0A 2E1MB 3HJEA 4BBSJ 3QP6A 3OY9A 4K2EA 1ZQ3P 5CVJA 4AC0A 4HLYA 2VXZA 4OIOF 5IP7J 1F1ZA 4GYIA 4NBQA 2DDAA 3MKZA 3ZMVA 4IX7A 1V5GA 2M5WA 1MDMB 1ETQA 2V1XA 3S3OA 3RYRA 3I64A 2LP0A 4A0YA 1PUFA 4X6AJ 5HDKA 2MD5A 4M9XA 3S16J 4PSXA 5LRSA 1FOXA 4L9NA 3SZGA 5F0CA 1KYZA 2QM3A 4AD9A 5ICFA 2QKMB 4MIMA 3T1BA 5J47A 1IC8A 3F8MA 4U0WA 3RKXA 5D4SA 2IA2A 2AS5F 3ASNH 4KFCA 3JRCA 1KA8A 2DMPA 3O8GA 3CCVI 1B72A 2JMWA 1G2HA 1IN8A 2DFIA 2OD5A 1NTCA 1IRZA 3VFZA 1B9NA 2Y31A 3R60A 1T39A 1ZHFA 1P7IA 3GFLA 4PCQA 2ICWG 4L0YB 2FE3A 4E7SA 4C30A 2IA1A 1BI3A 2L4AA 3S1QJ 4XKCA 2VT3A 3LL7A 3RI4A 3DCFA 2M7AA 1L3LA 1H8AC 4YEJA 4A3BJ 2OZUA 2HEOA 5LGUA 3J81K 1KU9A 3WTUC 1LVKA 4Z2YA 2BY2A 3TL4X 4I2OA 3DEEA 3G6EI 1V5EA 2DA3A 2VB6A 3H3ZA 1GLNA 4GXOA 1JKQC 4DBQA 2DK5A 4JQFA 2MC3A 2OBPA 4D7NA 1W5TA 1IV8A 2W84A 2XIGA 2FQ4A 4FASD 3GTGJ 3JRDA 4P1WA 4XNFA 2F5DA 2CWEA 2O9LA 1JTXA 5FD5A 3OOUA 4M6VA 5J3LA 3TEDA 5EEGA 3JRFA 2V4JC 3QPHA 5LHIA 5C4XJ 4MHGA 1D5YA 1BW5A 1TZLA 1Y6IA 3A1YA 4BXXJ 1Z0XA 2KDOA 2P81A 2X1EA 3KZYA 2FBIA 5FKNA 4NC6A 5TISC 5M3MJ 1IZ1A 3S2WA 2STWA 4IHVA 2ZXWH 1ON1A 1UAAA 3CUQC 1YHQI 1GVJA 4PJMA 4WXCA 1ETOA 3H92A 4C3HJ 1JHFA 2EB7A 3IH4A 3MQ0A 3J7AY 1MBEA 2F48A 2DMTA 3UNGC 3ABMH 2DQLA 2CYYA 3DEUA 5K7HA 3GO5A 4O5VA 1QGPA 4I0AA 4FQGA 4PJ0C 1B6AA 5EZGA 1G3SA 5EF6A 4Q47A 4B1RA 1O7LA 4A6DA 2OC6A 1X1PA 3L00A 3WTVC 1QNTA 2RQQA 4LMYA 3HPGA 2K02A 1H89C 2CQKA 2CV2A 4AIHA 1IRXA 3VEPA 2EV0A 2IJLA 1VQKI 4BUPA 2Z16A 3KLOA 4ANJA 1K4SA 2AO9A 3J7YJ 2PJRB 1H0MA 5F6FA 3M07A 1TBXA 1D1BA 2K9NA 3K69A 2GIZA 1WSUA 3NAUA 3TW6A 4A3GJ 4JX6A 4V2GA 4CHUA 5BS6A 3BOQA 5E1XA 4IQJA 1R9TJ 2VQGA 2M0CA 5IYDJ 5HLHA 4HX4A 2BY0A 4KUMA 1RETA 3TDZC 5L3FA 1E2XA 2KP6A 3F3XA 1WJBA 1R4MB 3PIOF 4RMNA 1P92A 1VQPI 3G73A 4LGWA 1CF7A 1B1BA 4UB8C 2E36A 2L01A 3SEZA 4ZTJA 3SZTA 1H9GA 3PJRA 3FBIB 3KX2A 1XMXA 5K1YA 3GEZA 2XAFA 1B9MA 2F2EA 2GXGA 2HKOA 2O0YA 3ML6A 1SEUA 1FJLA 3HXLA 1C0WA 3JSOA 4FE4A 5L3EA 1UJ8A 1XPXA 1HDPA 1BIAA 3K9TA 3IAM2 3KCCA 4BXFA 3CDHA 2Z33A 1VQMI 2VJ4A 5F0HA 2QBYA 1HLVA 2GXBA 4BKXA 2A05A 1QZYA 3ZR8X 4EJUA 5DUIA 4RA2A 4XONA 1TWAJ 2UXXA 2PI0A 3GZ5A 3CUOA 1UCRA 1X19A 2HYFA 3Q9VA 2V1NA 4E6KG 1A35A 1SFXA 2A6TA 5EG0B 5IP6A 2KL4A 4UXNA 3Q9SA 1R1TA 2DLLA 2KIMA 4FISA 2PMUA 3V8KA 2ZNZA 4HNVA 2PJPA 2Y75A 2OTJI 1XGSA 1WFXA 2L7FP 4M74A 1G4DA 1S3JA 1YYVA 3PUBA 3LSRA 1I3QJ 1ORKA 1MBGA 3CF5F 2KPMA 3K6GA 1XD7A 5C44J 1BA5A 4GRIA 3OYNA 1AHDP 1OCRH 5BPIA 2MC4A 2QENA 2QQAA 3RSNA 1VQ5I 1MW7A 5LGTA 3IP4B 3S1RJ 3I4MJ 3ABUA 4ITVA 3DLLF 2P0WA 4A3JJ 1O7FA 3M1EA 1KONA 3CC2I 1XGMA 4DGWB 3BCAA 1YRNA 4EM1A 3BZ6A 2IPQX 3V8LA 2XAJA 3KZIC 3OMYA 2R5YA 1JGSA 4NHJA 3EYYA 4UVCA 4XLFA 3RPQA 3DTKA 3I54A 2Q2EB 3G1MA 4IJAA 3DU5A 5JR3A 1T95A 1I50J 4BY7J 1Z3YA 2H6CA 5E17F 2Z5UA 1RIOH 1OYYA 4A6EA 4YRVA 4BXUA 2JRMA 2RKHA 4HX8A 2LY9A 4E7KA 1FOWA 2VBXA 4L9VA 2R7QA 4AU7A 2B0LA 3ZMSA 1ZARA 2XGCA 2XUBA 2O6GE 3PM1A 2L7ZA 4LLLA 2XGXA 1DU6A 2EH3A 2VKDA 2LKSA 2CFXA 5LHHA 2ZFUA 4IHWA 4BE0A 2FBKA 5HDGA 1IN7A 4XRSA 4IO9F 3PNTA 5FKMA 5B3SH 5BPDA 3JR9A 1A5JA 2MSYA 2LREA 3S93A 2MG4A 1Y8QB 3TBIA 2XC7A 3K70C 3K4LA 5D6EA 4HLXA 4ZZDA 2VBYA 3CLQA 3R61A 2HDCA 3CCQI 3ROUA 1ZK8A 5GPCA 5L3CA 2R93J 1WH5A 3HG9A 4XN0A 2RC4A 3UR3C 1RKWA 3GFMA 1PVEA 4MEXF 2V1UA 2DA7A 2NOJB 3F8CA 2ECCA 1GUUA 4P9UA 2MH2A 2Y69H 2K7LA 2LKXA 2NNNA 2F5FA 2PFBA 2QLZA 3FMSA 5GADJ 1NK3P 4IPAA 3B6AA 5EEAA 2A6HF 1Z67A 4WXDA 4PFPA 1W1WE 4KA4A 4EJOA 1R5HA 1YJ9I 3S15J 1RR8C 5FLXZ 1WI3A 3GF2A 4XLEA 4CUGA 1BR1A 4X0GA 2KJBA 4BDYA 4FX4A 2O8KA 2MD0A 1SFEA 1E3OC 4EGYA 1HQCA 1ZKGA 2QQ8A 3KP6A 2GIVA 2VKEA 5GPAA 2CH0A 3IWFA 1ZH5A 1Y1VJ 4PJLA 1FP2A 3QPSA 4XLNF 3K4NA 4HSTA 3VB2A 3MMYB 1Z7LA 3OYFA 3GW2A 3B02A 1XB4A 1B8IA 1GVDA 4LG3A 4CCKA 4MEYF 3EUHC 2IEKA 1S9HA 3BWGA 1K78A 2LVSA 2XKPA 2EQRA 4KN7X 2OTLI 4B3AA 2DQRA 4ZH4F 3PNVA 4GGGA 1MSEC 4XLHA 4E7ZA 3HRUA 1HW1A 2LG4A 3BQZA 1LVAA 4XOTA 2N8GA 3F22A 3FXKA 4XL9A 1MJBA 4CCNA 5E8GA 1XGNA 4H0EA 2MGQA 2A07F 3DQVC 3JRIA 3MKLA 2NNYA 2KIFA 4RAYA 4UUTA 3SXYA 2HVSA 4G6DA 1JTYA 1TWCJ 2QWWA 1TP4A 2M8GX 3OYLA 3ZQLA 5B66C 3G2BA 4RGXA 5KHDA 5IP9J 4QSHA 2XRLA 2IGKA 2E2JJ 1QO0D 2LF7A 3BY6A 1UHSA 3CMAI 3JSPA 1R36A 4L18B 1YX5A 4IQ4A 2DO7A 4L9TA 1XX5A 3DKWA 2R7ZJ 1QZEA 5M5YJ 3EETA 2EWNA 1JJ8C 1E17A 3CESA 2OAZA 5F0FA 1OCZH 1SMTA 4O6JA 4WK8F 2YU9J 2VPLA 4N9HA 1K6YA 4RM3A 4Q48A 1OR7A 2JA8J 4RB1A 2QZ8A 5FROA 2BBYA 2LNBA 4RGRA 1DUXC 2JA5J 4LLGF 2HTSA 5KCMA 1S7AA 4XSXF 3QODA 3LOCA 1LFUP 1IXCA 2LBFB 2D45A 1PUEE 3OSGA 2W00A 3KETA 3V7SA 1ETKA 5E18F 2DA2A 4PFOA 3HHGA 3V7CA 2DFFA 5J8CA 4CCMA 5FO5A 3WU0A 1I6XA 2MBFA 4QLCU 1YE9A 4A69C 1ON2A 5D5WB 3H35A 3O8HA 2VI6A 2FF4A 4P5OA 3COAC 2O61A 1IXSB 4HEA2 5JLWA 3CJRB 1YTYA 4Y17A 3BDDA 1KU3A 3DF8A 3B6CA 1PYVA 2EZLA 5CVUA 4QWQA 4KT5C 1TC3C 3S17J 3WTYC 4HX7A 4PUSA 1UHWA 2IGMA 3GTLJ 2Y0SA 2VPRA 2M2EA 1R6RA 2NVQJ 2RVCA 4IHXA 4F52A 3L2WA 2ZSHB 4U87A 5J8FA 3TGNA 3W2VA 1W36C 1S7OA 3HSRA 1HOMA 2FOWA 5D8KB 3S8PA 4DZPA 4ZYEA 1P4XA 3W6KB 4N4NB 1U78A 5A2QK 2EIJH 2LY1A 2EK5A 4CO8A 2R92J 3CCRI 3LFUA 2JZYA 4EJWA 3WE3A 3ZMZA 4QPOA 1XG1A 1AWCA 2R7XA 1F5TA 4BE2A 1MBFA 1JXSA 4AYBA 1VQ6I 3GVAA 3VYTB 3BR2A 1HKQA 4A3IJ 2DW4A 2PEXA 1TQIA 2L9RA 4ZJZA 3OYGA 1V55H 2IS6A 3ABLH 3KYCB 3RYPA 3J80K 4BEHA 3ZN0A 1VQOI 3CCJI 1NHAA 1G3YA 2F5VA 4JOMA 5D5XB 3VPRA 4KISA 3LSMA 5GAGJ 2X1CA 1TW3A 2DMQA 2D2WA 3H0GJ 4P9FA 2M4KA 4XR6A 3KZZA 4QPQA 2DT7B 2WA0A 2Y0MA 2FUG2 4DJAA 5M5XJ 3AKZA 2AQFA 2R7VA 1USTA 4CZCA 3E7LA 4DYQA 4I0BA 2EPFA 3M4OJ 2KRCA 1QVTA 4I7HA 4I76A 2K4JA 4E7LA 4U0VA 1RR7A 3QU6A 3OL3A 4B3XA 5D5UB 2FA5A 2CG4A 2Y48A 2VE8A 3FX3A 2W85A 4C2MJ 4D7MA 3HEFA 1P6RA 4GFBA 4UUSA 3T0YA 4FTHA 2IBDA 2X6XA 3RQ4A 1U5TC 4CZZA 3V4GA 1UHMA 2NS7A 3AFHA 4QIWN 2B9SA 2WAEA 3A01B 1ETVA 4DW6A 1A04A 2TDXA 2C6YA 3GFJA 2NVTJ 1W5CC 3CUQB 4QTRA 4UY8I 1B4AA 4PJNA 1WGXA 5H6RA 3CP8A 4EQQA 1TNTA 4ZYGA 1FTZA 3S1MJ 3L1PA 3HDDA 2UWMA 1SVOA 3DXJF 2YUSA 4P96A 5DD4A 3H3VK 3IRRA 4A5MA 3DPTA 2E60A 2DA6A 3K4MA 4F91B 3RDIA 3DLAA 1ZGJA 3FKJA 3I4NJ 2E7XA 2HDWA 3ABTA 5E20A 4DNCA 3H5AA 4EVIA 4YG2F 1O3TA 2ZBKA 3DFGA 4ZC3A 4IRIA 1X4PA 2R7UA 2LH9A 2YU3A 2EZHA 2CQ7A 1U8RA 3E6BA 1SD6A 5CYVA 4DZJA 1HBXG 3CO6C 5E3OA 2ZMEC 4KYWA 3FMQA 4HNUA 1Z77A 1MBJA 1BOBA 1EV7A 2E7WA 4RDUA 2NS8A 3TO9A 1ERDA 1JKOC 1P4WA 2YPRA 2ZXJA 2ESNA 1U6GA 1AA7A 1Y0UA 4E4HA 3OS1A 3I9V2 5C3EJ 1SANA 2CRGA 3BR5A 2LC2A 3OR1C 4UVAA 1FTTA 5LEJA 1P4AA 1IXRC 3HRSA 1UG0A 3JAMZ 2V7FA 3P7NA 2ZSIB 3WTWC 2HOTA 5HLGA 3QYFA 5E3LA 3FIWA 1FYMA 1DP3A 2NRAC 3FM5A 4S0HB 1T0FA 4BYYA 4M3EA 2R7OA 2D1HA 2P5VA 5IT9Z 1LKXA 2E35A 2JWTA 5JI6A 3HOSA 4OAZA 4CYCB 3VYSB 3TP0A 3FISA 4BNCA 2YSRA 3D5LA 4XN3A 1FP1D 1ZLJA 3OOPA 1DP7P 3BTCA 3I4PA 1EH6A 2DODA 2VUMJ 3NWSA 2ZJQF 3SJMA 3KE2A 5AONA 2RV8A 2EA4A 3RZDJ 5KAIC 1H88C 2CV0A 2IXSA 2K86A 4E7JA 3IWZA 4CCOA 4IRHA 3F0CA 4LD5A 2BGCA 3CUQA 3GWZA 4YFNF 3ZP5A 1XS9A 1JGGA 3RIRA 4ENJA 2IGNA 4U7BA 2HXOA 4UV8A 1ZRCA 2BY1A 2ESHA 5H20A 1T38A 4ESFA 3HGGA 2BE5F 2O5RA 1IG7A 3TP3A 3ERMA 1IAWA 4G7ZF 1V3FA 1IRGA 1HSTA 1OYWA 4LG0A 3KFWX 5CJ9A 2PQ8A 1W36D 3Q3SA 4R79A 4U7DA 1VNDA 1VQ8I 2CUEA 2DA4A 2IAIA 2MYSA 4IL6C 5HLIA 3F21A 2E34A 2HQ5A 5CVIA 3FBNB 3FXQA 3F8BA 3OYEA 5L3BA 1SVMA 3LA2A 3CDIA 4EV0A 2ISYA 4GDFA 3FWEA 3HZJA 1ITYA 2H09A 2X6WA 3KEQA 3MD2A 3T8TA 2A61A 1SMYF 5IY5H 5FLVA 4XMYA 1MD0A 4YFXF 4U0YA 1YFHA 2WV1A 3S2HJ 2CU7A 4LIUA 4AIDA 3TQNA 1WQ2A 3WU1B 1WH7A 3K1PA 4ENKA 2V9KA 2R4GA 1WWXA 1W7PD 1NG6A 3E6DA 2EJRA 4BU2A 1VTNC 1BI1A 3DKXA 4NQWA 3RCOA 1FYLA 1SD7A 4IHSA 1ZR4A 2BOLA 1VZ0A 2JRTA 3BR6A 2NYXA 1RC9A 3U1KA 2ZXIA 2IP2A 2MABA 1D0XA 2HPIA 2OQGA 1BI0A 2RDPA 2UXNA 1XMKA 1MDMA 4OINF 5CVVA 2CQNA 1Z9CA 1Y0NA 3HSEA 1GHCA 1BR4A 3WTSC 1R23A 2KKOA 1E0EA 1T08B 4L5IA 2HTJA 3EDPA 1OJLA 3FK7A 1I5ZA 3CCYA 3HM5A 1QZZA 2FBHA 5HDNA 1XDUA 3DBLB 4J01A 3S3NA 1IW7F 2IW5A 5DCMB 3JRGA 3T8RA 3BZCA 1R4NB 2COMA 1Q1VA 3TKYA 3KYDB 1FX7A 5FFXA 2VN2A 2J5OA 2M7BA 2EZIA 3OWTA 4XIDA 4WWCA 4OAYA 1Y39A 5B1BH 3Q5FA 2CW8A 2VBWA 1MNEA 3TMOA 3ERED 3F9KA 5E1ZB 3DU6A 2KISA 4IOCF 5JLXA 2H27A 5H2FC 1G6NA 3MN2A 1BIBA 2VE9A 3SEQA 2OU2A 5IOYA 2X9DA 2MH9A 1IN5A 5K7FA 2WTEA 2I8DA 4FT8A 4XKVA 2ELKA 3CCEI 1KU2A 5EYRA 1APLC 2IT0A 1MH3A 1T56A 3GTKJ 3DTIA 3LAPA 1K7AA 2HXIA 1UZCA 3GZNB 2WV0A 2YR2A 3NRVA 4XSZF 1KU7A 1FBQA 4CYDA 3K7AJ 5EGOB 1LJ9A 2BZTA 5BNGA 3AAFA 1XSXA 2FNAA 3BJ6A 1HF0A 3HUGB 2ZCWA 1QHHD 1M1EB 3ZQGA 1OLTA 2WC2A 3K2ZA 1K83J 3IAS2 4BBRJ 1Y56A 2LKPA 2KZVA 5DS9A 4L5JA 1YG2A 4A0XA 1HKTA 4PK4A 2XHKA 3RPUD 5K5RA 4FCYA 3R6SA 2GM4A 3I3LA 3QYBA 4LIVA 3AG2H 3ZMDA 3E5UA 4JYKA 3OS0A 2K9SA 3PFIA 5CPRB 1RPWA 2DJNA 5D4RA 3HPHA 4ZYDA 2GWRA 3HOXJ 4JBAA 1AKHB 5C4JJ 3S2DJ 2YX4A 3BPXA 2BW3B 2PX9A 3DWLE 4I6ZA 4KIBA 5JVTA 1YI2I 3IH3A 3FXLA 4ZYAA 2HOEA 3L2QA 4LLNA 1KQ9A 2HR3A 1POGA 1A6IA 3CMEI 5D8LB 3LNQA 3I53A 1JUMA 1FT9A 3EPZA 2HVRA 4I99C 4H4KC 2XAHA 2ZKZA 1DPRA 3KP2A 3SQNA 3O2PE 3PO2J 2Q0OA 3FHZA 1IV6A 2FSWA 5J1UA 4HW0A 1YLFA 3FMRA 3D0SA 3LA7A 3I55I 3F6OA 2WY8Q 4MTEA 5JVGF 2XPVA 3KP7A 5D5VB 2PJRA 3LSHA 3IUOA 1FLIA 5D6FA 5B1AH 4BE1A 4BL0B 3L2RA 2VQHA 1WVRA 5ILSA 3GYHX 5ED4A 1FBSA 3QRFF 3DPLC 1R00A 4XKWA 1JJ6C 2KLOA 4BACA 3HOZJ 4GCVA 5FB2A 3PQJA 1D8KA 1XN7A 4RB3C 3TOBA 3QU3A 4RGSA 2DI3A 3S3MA 1IF1A 5HODA 1EKEA 3TDUC 2DCEA 1X2MA 1MSFC 1GV5A 4FETA 5ICGA 1EF4A 2F5EA 2EZKA 3E5XA 4DOZA 4EJVA 2KMUA 4EEFG 2WAQA 4F92B 1VQ7I 2DT5A 5F64A 1OCTC 4DQ2A 4F93B 3CC4I 1ZAOA 5IYCJ 3GTPJ 3OIPA 5LRRA 4C2UA 4ENMA 3BR1A 3B73A 4UNOA 2M1BA 1SVLA 2HFHA 2HS5A 5KNLA 1ZG3A 1YW7A 3RJPA 2UUZA 4HF1A 4M3GA 2KRFA 4KIGA 4KT6A 3MEXA 3T5XA 1BW6A 4Y3OA 4FE7A 2KRHA 3VWBA 5FRMA 2JUCA 5EG0A 3MCZA 1K79A 2L54A 1QA6A 3C2GA 1IN4A 2XAQA 1STZA 1W7PB 3L2CA 2FNPA 2WB1N 2GOXB 3F6VA 5ILUA 1J09A 1HC8A 1V5FA 4BS9A 3OYKA 4YIRX 2DAOA 2VIXA 1LE8B 4V2FA 1OQYA 1IGNA 3KEOA 3LFKA 2L9SA 4U88A 5KK1A 1LB2A 1VQNI 1B59A 3HSFA 3HRMA 1FNNA 1HKSA 1JUPA 1LUJB 2COBA 4HOBA 4MFEA 3QAHA 3HBLA 2MW8A 3BR0A 1AU7A 2QGUA 3CC7I 3DP7A 3ZQ7A 2CO5A 3E97A 2H1LA 1X2NA 5LBQA 4HG2A 3FZVA 1XGOA 3SDBA 4JX4A 3SHFA 4F7ZA 1BC7C 3A4CA 3V42A 5F04A 2LD5A 4G8XA 5HS9A 3EUAA 3K2AA 1IUYA 2Q2EA 4DYCA 1X3WB 3FXJA 3VDXA 2RQPA 1ZYRF 1DU0A 3QPTA 2E1OA 5E3NA 2E5NA 4D5FA 9ANTA 1U5TB 2EFNA 1FPQA 4HA8A 4ESJA 3FKIJ 5J40A 3GTMJ 2I10A 2O7OA 1ONVA 3ZN1A 4YIIA 3E0JB 4M9SA 4RGUA 5AIPA 2IS4A 2DK8A 4C2TA 4IEJA 2P6TA 3BT9A 3HOTA 2A68F 2M45A 1P9QC 2JA7J 2VONA 2RNJA 5M3FJ 3HC7A 1YS7A 5HLTA 5B5EC 3ZGKA 4B8XA 2K85A 1RNLA 4M6XA 3C7JA 1ENHA 3BROA 1XDSA 1FYKA 3PIPF 3ASOH 3SFZA 4ASNA 2R7DA 1U3EM 2K9LA 2LY2A 2CGPA 2M4GA 1NG7A 5DTDA 3LQQA 2LRDA 3U21A 2K3FA 1PJRA 2W57A 4D0PA 1OCOH 2VQCA 4WF2A 5FKKA 3MVPA 1YITI 2ZC2A 2XAUA 3KP5A 4RLQA 2VODA 2XGEA 2JPCA 2W25A 3M8EA 2CV1A 3JCUC 4HPQA 4JP0A 5F27A 1N77A 2ZMEB 3BG9A 3FF5A 3PUFA 1VQ9I 3GTQJ 2VC0A 1Z1DA 3REOA 1XC5A 3GZ6A 3HB9A 3CMYA 2EV5A 2VC1A 3VYRB 2QYOA 3QOEA 1AOYA 3OSFA 3G1LA 4R8HA 1W7PA 2DXIA 2K40A 3IHUA 5DDGA 4LITA 4MQVA 1ULYA 2P5LC 2M3AA 3BCBA 3X2QH 5IYBJ 2R5ZB 1W4MA 4GYGA 5FD6A 4M3BA 2XAGA 3PO3J 2P5KA 4XRMA 1IDZA 2NS0A 2L3DA 1RUOA 3CDLA 1O57A 5M5WJ 3ECOA 2LDUA 1WJAA 2EFOA 1MNDA 2JJ7A 1MNMC 4HF0A 5J1YA 4ZDLA 2KZGA 2HYJA 2ME0A 4XBFA 1YJWI 4BGDA 4IVNA 3O3KA 4I98B 1NK2P 4LOCA 3HKZN 3HL2A 3FXUA 1SD5A 3AG1H 3FDYA 4EJTA 3LSTA 2KHMA 2AHQA 2CQQA 1HSJA 5JHFA 4Q4ZF 3W2WA 5FLMJ 1X1CA 3BR3A 4HQEA 3DKYA 4KITB 4S05A 1FZPB 1FWZA 4C9YA 1JI8A 5TGTA 2O03A 1WPKA 1N78A 1OCCH 1QPMA 2TRTA 3H5NA 3K0LA 2XGDA 3NQOA 2G9WA 5LGNA 1FSEA 2Z1DA 2K4BA 3F72A 1O3SA 1A31A 4HV6A 2BXYA 4L0ZB 5ILVA 1YW8A 1OR7C 2H94A 1G3WA 4DIQA 1E3PA 1YQAA 2R7WA 3RKQA 3AG4H 3K4BA 1X1AA 2LTPA 4AIKA 4E7IA 4B43A 2DMUA 2FRHA 2Y2ZA 1TWHJ 1RI7A 5E8IA 4HF2A 3JRHA 1J5YA 3D5SC 2V1DA 2JT1A 3K70D 3ZQIA 1F43A 3QP5A 2K5CA 1NH3A 4A3CJ 2OZ6A 2DMNA 2G7UA 3G3ZA 4MNUA 4N9IA 5ICCA 1GXQA 3R4KA 4KJZA 2DTRA 3V7RA 5HOOA 1T98A 4W97A 1GT0C 2LBFA 3I59B 2W24A 1V54H 1WJCA 3HTSB 1WZ2A 1Z05A 5DV5A 2R0QC 2L4MA 4CSWA 2VOOA 5K7ZA 2M34A 3VOEA 4RBOA 2HWVA 4CCLA 4M72A 3MAJA 4HV5A 3HRTA 5TJJA 3N4MA 2Z9OA 4E70A 4MGRA 3A0HC 2R7FA 3I71A 3P9CA 3ZRGA 3R0AA 2E19A 4FHTA 3J81Z 1T8IA 3W6VA 1PUFB 2XVCA 1D1AA 2CUZA 2D1VA 3ABKH 2VKHA 4G7HF 1R1UA 4KDPA 3E3VA 2DPDA 3H3UA 4Q5SF 2VQLA 3CQZJ 4G94A 1K4TA 2OCEA 1X3UA 1MH4A 1U2WA 1DDNA 4G7OF 4BDZA 1I27A 4ZDPA 5EJCA 5BQTA 2DT6A 2FU4A 2ID3A 4EATA 4B4CA 1ZLKA 2LFBA 1BI2A 3LQRA 4ZTFA 2TCTA 4Y33A 2X4HA 1J75A 1MKMA 2MFZA 4XORA 3CMMA 3VSKA 3HOVJ 2XSJC 2E5ZA 1JT0A 3A0BC 3O6BB 2EINH 3OIOA 4OIRF 5J1RA 4UV9A 3H0DA 1W0UA 2UZKA 2FQ3A 1SAUA 4ZDOA 4RAGA 1SFUA 4D5CA 3HOYJ 2V79A 3OL4A 1J59A 3BG3A 3GCMA 4HQMA 4A3EJ 1GDTA 4ZZLA 4TV7A 2M87A 3BQYA 2EFQA 4RAZA 1I3AA 2AQEA 3M8JA 2L9VA 5DD8A 1Y1WJ 4LB5A 2OA4A 3K4KA 3WHCA 4B44A 1O4XA 1V4RA 4X1EA 4ZYHA 1R58A 3DBHB 1BR2A 4LFUA 4RAFA 4HNTA 4C3JJ 3HOWJ 1R7JA 1TT5B 1J7KA 4ETSA 2X6YA 2RAEA 3PNYA 1RKTA 3Q0UA 1QBJA 2DA1A 2JSCA 3FHNA 3ONQA 4BHBA 1X3ZB 1YO5C 1ETXA 2Z99A 4MLOA 1MMGA 2MLKA 2F4MB 5GAEJ 2OUMA 3PQKA 2QF7A 1OMIA 2HDDA 1RUNA 2NVYJ 3FXMA 2WAFA 3M8FA 2UV1A 3H36A 3BG6A 3LSJA 3QQAA 5LHGA 4NUBA 3LA3A 5J6XA 2KQRA 2A6EF 4R1HA 3A01A 2X0LA 4I01A 2K27A 2DU9A 3QWLA 1ETWA 4Y52J 5HNFA 1TTYA 3Q0WA 5JFRA 1XCBA 5CQEA 3OYAA 3ZQCA 1W5SA 1REPC 1FIAA 1UG2A 2GA2A 3BTIA 3R0JA 2M8EA 4HDUA 1SD4A 2H8WA 4DBRA 4IZZA 5HVQC 1TLHB 3OYIA 1N25A 2BVMA 3SFIA 2WWYA 2LR8A 3V8JA 1ODDA 3MKWB 1TL8A 1WHUA 3BTLA 2CUFA 1TWFJ 4J00A 1SFOJ 4LK0F 2DYRH 3VODA 3OYBA 1ETYA 2M30A 2MLGA 3DTEA 3W3CA 3Q0VA 4PSWA 1D1CA 3WGGA 1F4KA 2H8RA 4UB6C 2Q8KA 1CF7B 4Y13A 3KLNA 3FM3A 4HBLA 1HW5A 4AVPA 4V19K 2OJED 3CJNA 2WB1A 3BC8A 4IXAA 1ACIA 2BXZA 4A3DJ 4YFKF 2DA5A 3TW7A 4W1UA 4Y15A 5DCFA 2I5UA 2J5PA 1EA3A 2ELJA 2ZJRF 4KIFA 1T0FC 3KP4A 3DEWA 2ID6A 1F9NA 2Y0SN 1EH8A 1G59A 4Y4RA 2QBYB 2HOAA 1X4OA 4M3FA 3OIQA 4PGHA 4LB6B 2R7SA 3ZXSA 3WTZA 2DYSH 2X85A 1U8BA 3IC7A 3K10A 1WRJA 2KT0A 3A03A 1JT6A 2LOOA 2E2IJ 2ADUA 2XF6A 1LPQA 1R1VA 2V9VA 4AYBN 3H9GA 4CYCA 3HTUA 2ZJ2A 5KAFC 2GBYA 1HDDC 2VJIA 1X1BA 2XPUA 2KIUA 3JRBA 3KYLA 4HDVA 2FJ1A 3KP3A 4M73A 3E6MA 1MIJA 5L3DA 1RESA 2EILH 3LAJA 1GXPA 1S7EA 2V26A 2WY7Q 1LNWA 2E1NA 2VBZA 3WU2C 3OYJA 3CJTB 2VASA 1E3HA 2XRNA 1YOVB 5K5OA 2JN6A 3JW4A 3JAMK 1JUSA 2ETHA 3C1DA 3NEUA 5AIQA 5DEQA 3SDGA 5CLSA 3L2UA 2NVXJ 2ELHA 3L7WA 1YRNB 4N0BA 5CVRA 4AVZA 2JQ7A 5IPAA 1JKRC 1D5VA 1LDKB 5IT9K 2E2HJ 1ZRDA 1U0JA 3PSIA 4BJ5C 2R5YB 4IKFA 1P2FA 2QSFX 2HQRA 2NVUB 2VLAA 1F36A 3QPLA 5FKOA 2DOFA 2ME6A 3TOAA 2JUGA 3HYIA 3OS2A 1UFMA 5CKTA 3P9KA 1TT0A 2DBBA 2W82A 4PDKA 3HIFA 3LMMA 3H5RA 5H6QA 1Z91A 2XPWA 1YIOA 2QVOA 3OYHA 2WADA 4AUXA 1KGSA 2HNHA 3FXRA 1LDJA 3CZ6A 2ZO4A 1MMAA 1KZHA 3H9JA 1OYIA 3EYIA 2ISZA 3D5RC 3U2RA 2G7HA 2L0KA 2LYCA 2QSGX 1J9IA 2P7VB 2E1MC 4M71A 4N4OB 1LQ1A 2DJIA 4A2UA 2Z2SB 5E3MA 2CJJA 3OV8A 2QQ9A 3ZCOA 2STTA 5J4YA 5FRNA 2Y9ZA 4HZFA 3G71I 3BP8A 2W1OA 2QCOA 2BVLA 1OPCA 3LSKA 5JHUA 3CCSI 1ZR2A 2HZTA 1LEAA 1P7JA 1WJFA 1H9TA 1Z7UA 3BG7A 3GTJJ 3VSLA 4E7HA 3RTRA 5HNHA 3HKZA 1HW2A 1N75A 2AXLA 4RS8A 4AWXB 3IKTA 1VQLI 2XDVA 2AXTC 4XLAA 1EJ9A 3RKWA 2X48A 4FX0A 1QVUA 1ZRFA 1HXDA 4L5EA 1OKRA 4PGGA 1U9NA 2IA0A 3GTOJ 3C3WA 3GXOA 1Z6TA 5DM6F 1G8XA 1YJNI 3HOUJ 4MFDA 2VXDA 5DCMA 3PFYA 3HHHA 4UUVA 4EM2A 3RKYA 4IOAF 4WX9A 1I6HJ 1IRFA 1YX3A 1Z6RA 4XRSG 2PMZN 4KICA 3TO6A 3AL0B 4A3MJ 4CCJA 3QYEA 1CGPA 1FSHA 3NARA 2BHZA 3D1NI 4RLFA 2B63J 4LK1F 4BHCA 4B47A 4OIPF 2FEZA 5FGMA 2QUFA 4BQNA 3BG5A 2FXAA 1R5ID 4M3DA 2FMLA 1S29A 1B8IB 3CP2A 1XSDA 1U9OA 3ESWB 1XCVA 3FK6A 1ZGWA 3UKGA 1MJ9A 1K78B 1QU3A 1D0ZA 1MMNA 3MFKA 3FXOA 2E71A 4L9JA 2X1DA 1LFPA 1OCPA 1QRYA 1MGTA 2RNGA 5HS7A 2ECBA 1KQ0A 2WBMA 3G1OA 3SZPA 5EGOA 2XROA 4ESBA 3EUHA 4F3QA 1T33A 2XF5A 3ISPA 4YIFA 4LJZF 2EFWA 3HUGA 1S6LA 3KEYA 2YX7A 5F1JA 4S04A 3CJQB 1YIJI 4OIQF 1MMSA 5GAHJ 2L2OA 3K4JA 2HQNA 1T6SA 2DTZA 3IL2A 2YS9A 2Y9YA 4ON0A 5FJ8J 1SC7A 3WG7H 1TNSA 1FC3A 5EDNA 2F5CA 4BAYA 3IRQA 2VOPA 2PBIA 5ERIA 1WJDA 2RREA 3WGHA 3S1NJ 4A3LJ 1G3TA 2DOAA 3ULQB 2HU9A 2W4SA 4II3A 1QHGA 1HCRA 1FOKA 3MZ8A 2F6CA 2M0MA 4P55A 4Y7NJ 1Y8RB 2BEOA 3I5UA 1AKHA 4BH9A 4KN4X 2JTVA 2VJ5A 2BW3A 3A02A 1FEXA 1BJAA 2EIMH 3KIOA 2LK2A 1IO2A 2GZWA 4WCGA 3W2AA 2FX0A 3ZQFA 3EUKL 1YW9A 2DFHA 3ECHA 4A3FJ 1SFKA 5A2QZ 1A6QA 1UMQA 4HYEA 5K5QA 3QOPA 1CQTA 6PAXA 1DGWY 2F4IA 2W48A 3F8FA 3JTGA 2H1KA 5F1RA 2K9QA 1RZ4A 5J4VA 2NXNB 1QPIA 4Z6YA 1JE8A 5LEKA 1VFCA 2PN6A 2EA2A 2L7MP 2OQRA 3ZOBA 1FBUA 4EM0B
chains in the Genus database with same CATH topology
2HXOA 2Y30A 4A3CJ 2DMNA 4A3KJ 2XB5A 4W97A 3HGGA 1JKPC 5EG0B 1GT0C 4IHYA 5IP6A 2JA6J 1IG7A 4BY1J 3TP3A 2XSDC 2R0QC 4FISA 5K7ZA 2M34A 4RBOA 4HNVA 3Q3SA 1VNDA 3S14J 2CUEA 1IUFA 2DA4A 2IAIA 2L7FP 2HQ5A 3LSRA 1I3QJ 1ORKA 1MBGA 1LFBA 5C44J 1BA5A 1AHDP 4C3IJ 2E19A 3W6VA 1PUFB 3S1RJ 3I4MJ 4A3JJ 1ITYA 2OPTA 3CQZJ 5FLVA 2WV1A 3S2HJ 1MH4A 2CU7A 1YRNA 1WH7A 1MBHA 1WCMJ 3ZQHA 2ID3A 4ABZA 4B4CA 2LFBA 5GP9A 2R5YA 2TCTA 3G1MA 3HOVJ 1ZR4A 2HOSA 3IH2A 1I50J 3BR6A 4BY7J 1JT0A 3OIOA 3JRAA 1ZTRA 5J1RA 3RZOJ 2EBIA 1W0UA 2LY9A 1LE8A 4XICA 4D5CA 3HOYJ 2XGCA 3BG3A 3PM1A 2L7ZA 4A3EJ 1GDTA 3FK7A 1OJLA 4UUSB 3HM5A 3CCYA 1DU6A 2EH3A 1VF9A 1FIPA 3BQYA 4IHWA 4XRSA 5FKMA 2LLKA 3JRGA 4JX5A 3JR9A 1A5JA 2MSYA 2MG4A 1Y1WJ 1Q1VA 3WHCA 1O4XA 1ZK8A 5GPCA 4A93J 2R93J 1WH5A 4XIDA 2EZIA 4X1EA 1RKWA 4G12A 3HOWJ 4C3JJ 4DYRA 2RAEA 2DA7A 2ECCA 1GUUA 1RKTA 2XB0X 2LKXA 3Q0UA 5JLXA 2DA1A 3MN2A 1NK3P 2KDZA 1ETXA 3B6AA 4MLOA 5EEAA 5IOYA 2X9DA 1TWGJ 5K7FA 3S15J 2QF7A 2ELKA 2HDDA 1BL0A 2NVYJ 5EYRA 1APLC 1WI3A 5F08A 1MH3A 1T56A 2HI3A 3GTKJ 2HXIA 2OF7A 5IOZA 2O8KA 2FD5A 3LSJA 1E3OC 3K7AJ 5EGOB 3QQAA 5BNGA 1ZKGA 1HF0A 3A01A 2VKEA 3ZQGA 1ETWA 4Y52J 5GPAA 1Y1VJ 1K83J 4NDLA 3HGYA 3Q0WA 4BBRJ 3QPSA 5DS9A 3ZQCA 1FIAA 1UG2A 3BTIA 1IDYA 4FCYA 1B8IA 1GVDA 2GM4A 1VI0A 3SFIA 2IEKA 4JYKA 2K9SA 3GBGA 1RPWA 2LR8A 2LVSA 2DJNA 2EQRA 3BTLA 2CUFA 4B3AA 1TWFJ 1K61A 3HOXJ 1SFOJ 1MSEC 1AKHB 5C4JJ 3S2DJ 1ETYA 3LSGA 5FKLA 4I6ZA 3BQZA 2N8GA 2G0EA 2ZB9A 2WAQN 3IH3A 2CQXA 2VKVA 5EZHA 3Q0VA 2D5VA 2H8RA 2M9HA 1POGA 1A6IA 2MGQA 1BJZA 3JRIA 3LNQA 3C2BA 3MKLA 2R5ZA 1JUMA 4UUTA 1JTYA 1TWCJ 2M8GX 3ZQLA 3PO2J 3M3YJ 1IV6A 5J1UA 5IP9J 4A3DJ 2DA5A 3TW7A 4W1UA 4QSHA 2XRLA 2E2JJ 1UHSA 3BTJA 2R7ZJ 3DEWA 2ID6A 2XPVA 2Y0SN 2NOGA 5M5YJ 1JJ8C 5F0FA 1B72B 2YU9J 2HOAA 2JA8J 4M3FA 4XK4A 1U8BA 2JA5J 1W0TA 1JJ6C 2GLOA 3HOZJ 2JK3A 2KT0A 3A03A 1JT6A 3LOCA 1LFUP 2E2IJ 5HODA 4AYBN 1X2MA 3OSGA 1MSFC 3RQIA 1GV5A 4CYCA 1ETKA 1HDDC 2GBYA 3WHBA 2DA2A 2XPUA 3JRBA 1EF4A 2EZKA 4EEFG 2FJ1A 1OCTC 1MBKA 1OFCX 5IYCJ 3GTPJ 1GV2A 1RESA 1IJWC 3LSPA 4A69C 3BR1A 3IV5A 3O8HA 2VI6A 1S7EA 5JLWA 2JN6A 1JUSA 3B6CA 4M3GA 3SDGA 2EZLA 1TC3C 1BW6A 3S17J 2NVXJ 1YRNB 4FE7A 1X58A 3GTLJ 2VPRA 2M2EA 5IPAA 1JKRC 2NVQJ 4IHXA 5EG0A 2X6OA 2E2HJ 4MO7A 1HOMA 2R5YB 3JREA 4J19A 4DZPA 2DN0A 4BBSJ 1U78A 1F36A 3QPLA 5FKOA 2ME6A 2R92J 2WB1N 1ZQ3P 4AC0A 2XPWA 1XG1A 5IP7J 4AUXA 1MBFA 1LE8B 4V2FA 3BR2A 1ETQA 1IGNA 2LP0A 1PUFA 2L0KA 4A3IJ 4X6AJ 3S16J 2L9RA 5E3MA 2CJJA 1JUPA 2COBA 4MFEA 3HBLA 2MW8A 3BR0A 1AU7A 5F0CA 3VPRA 2Y9ZA 1X2NA 4MIMA 1IC8A 2QCOA 4JX4A 2DMQA 3JRCA 5F04A 2DMPA 3O8GA 2LD5A 3H0GJ 1B72A 2JMWA 1G2HA 1ZR2A 3K2AA 1NTCA 1IRZA 4DYCA 2Y31A 1P7JA 1P7IA 5M5XJ 3GTJJ 1DU0A 2E1OA 5E3NA 4D5FA 9ANTA 3E7LA 4DYQA 3FKIJ 3S1QJ 1H8AC 3GTMJ 2I10A 3DCFA 2O7OA 2X48A 1QVTA 4A3BJ 4I76A 3M4OJ 1QVUA 4L5EA 1RR7A 4IEJA 1U9NA 2DA3A 3BT9A 3GTOJ 4C2MJ 1JKQC 4D7MA 3HEFA 2JA7J 4GFBA 5M3FJ 4UUSA 3HOUJ 4FTHA 2IBDA 4MFDA 4D7NA 1ENHA 2FQ4A 3GTGJ 3JRDA 1I6HJ 2NS7A 4QIWN 2O9LA 1JTXA 3A01B 1ETVA 3OOUA 4M6VA 2PMZN 5J3LA 5DTDA 4XRSG 4DW6A 3TEDA 4A3MJ 2NVTJ 4QTRA 3JRFA 3NARA 5C4XJ 1WGXA 5FKKA 3D1NI 3MVPA 1FTZA 3S1MJ 3L1PA 1D5YA 3HDDA 2B63J 1BW5A 2XGEA 4BXXJ 2YUSA 1Z0XA 3H3VK 2P81A 3BG5A 4JP0A 5F27A 4M3DA 1B8IB 3BG9A 2DA6A 5FKNA 3GTQJ 1U9OA 3FK6A 1ZGWA 5M3MJ 3UKGA 1XC5A 4IHVA 3HB9A 3I4NJ 3CMYA 1ETOA 4C3HJ 3IH4A 1MBEA 1OCPA 2DMTA 3OSFA 3G1LA 1QRYA 2K40A 5K7HA 2EZHA 2ECBA 4DZJA 3G1OA 5E3OA 5EGOA 1T33A 5EZGA 5EF6A 2R5ZB 5IYBJ 1Z77A 1MBJA 4B1RA 5F1JA 4M3BA 4RDUA 2NS8A 3PO3J 1JKOC 4XRMA 1IDZA 2DTZA 3CDLA 5M5WJ 2YS9A 2Y9YA 2JJ7A 1MNMC 5FJ8J 1H89C 5J1YA 2ME0A 2HYJA 5EDNA 1NK2P 4LOCA 3HKZN 5C3EJ 2AO9A 1SANA 3S1NJ 4A3LJ 2CRGA 2AHQA 2CQQA 3BR5A 2K9NA 1FTTA 3NAUA 1HCRA 5FLMJ 3TW6A 4Y7NJ 3BR3A 4JX6A 4V2GA 4A3GJ 1AKHA 1R9TJ 2M0CA 5IYDJ 3A02A 2HOTA 1FEXA 5E3LA 1WPKA 3FIWA 2LK2A 1RETA 4S0HB 2TRTA 4M3EA 2XGDA 2JWTA 2VUMJ 2FX0A 3ZQFA 4CYCB 3TP0A 3FISA 3BTCA 4A3FJ 1FJLA 3RKQA 1UMQA 4FE4A 3SJMA 2LTPA 1CQTA 1HDPA 3RZDJ 1H88C 2W48A 2DMUA 2H1KA 2K9QA 2Y2ZA 1TWHJ 3F0CA 5F0HA 3JRHA 1HLVA 4BKXA 1QPIA 1XS9A 1VFCA 2L7MP 1JGGA 1TWAJ 3ZQIA 3ZOBA 1F43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXO A;  2Y30 A;  4A3C J;  2DMN A;  4A3K J;  2XB5 A;  4W97 A;  3HGG A;  1JKP C;  5EG0 B;  1GT0 C;  4IHY A;  5IP6 A;  2JA6 J;  1IG7 A;  4BY1 J;  3TP3 A;  2XSD C;  2R0Q C;  4FIS A;  5K7Z A;  2M34 A;  4RBO A;  4HNV A;  3Q3S A;  1VND A;  3S14 J;  2CUE A;  1IUF A;  2DA4 A;  2IAI A;  2L7F P;  2HQ5 A;  3LSR A;  1I3Q J;  1ORK A;  1MBG A;  1LFB A;  5C44 J;  1BA5 A;  1AHD P;  4C3I J;  2E19 A;  3W6V A;  1PUF B;  3S1R J;  3I4M J;  4A3J J;  1ITY A;  2OPT A;  3CQZ J;  5FLV A;  2WV1 A;  3S2H J;  1MH4 A;  2CU7 A;  1YRN A;  1WH7 A;  1MBH A;  1WCM J;  3ZQH A;  2ID3 A;  4ABZ A;  4B4C A;  2LFB A;  5GP9 A;  2R5Y A;  2TCT A;  3G1M A;  3HOV J;  1ZR4 A;  2HOS A;  3IH2 A;  1I50 J;  3BR6 A;  4BY7 J;  1JT0 A;  3OIO A;  3JRA A;  1ZTR A;  5J1R A;  3RZO J;  2EBI A;  1W0U A;  2LY9 A;  1LE8 A;  4XIC A;  4D5C A;  3HOY J;  2XGC A;  3BG3 A;  3PM1 A;  2L7Z A;  4A3E J;  1GDT A;  3FK7 A;  1OJL A;  4UUS B;  3HM5 A;  3CCY A;  1DU6 A;  2EH3 A;  1VF9 A;  1FIP A;  3BQY A;  4IHW A;  4XRS A;  5FKM A;  2LLK A;  3JRG A;  4JX5 A;  3JR9 A;  1A5J A;  2MSY A;  2MG4 A;  1Y1W J;  1Q1V A;  3WHC A;  1O4X A;  1ZK8 A;  5GPC A;  4A93 J;  2R93 J;  1WH5 A;  4XID A;  2EZI A;  4X1E A;  1RKW A;  4G12 A;  3HOW J;  4C3J J;  4DYR A;  2RAE A;  2DA7 A;  2ECC A;  1GUU A;  1RKT A;  2XB0 X;  2LKX A;  3Q0U A;  5JLX A;  2DA1 A;  3MN2 A;  1NK3 P;  2KDZ A;  1ETX A;  3B6A A;  4MLO A;  5EEA A;  5IOY A;  2X9D A;  1TWG J;  5K7F A;  3S15 J;  2QF7 A;  2ELK A;  2HDD A;  1BL0 A;  2NVY J;  5EYR A;  1APL C;  1WI3 A;  5F08 A;  1MH3 A;  1T56 A;  2HI3 A;  3GTK J;  2HXI A;  2OF7 A;  5IOZ A;  2O8K A;  2FD5 A;  3LSJ A;  1E3O C;  3K7A J;  5EGO B;  3QQA A;  5BNG A;  1ZKG A;  1HF0 A;  3A01 A;  2VKE A;  3ZQG A;  1ETW A;  4Y52 J;  5GPA A;  1Y1V J;  1K83 J;  4NDL A;  3HGY A;  3Q0W A;  4BBR J;  3QPS A;  5DS9 A;  3ZQC A;  1FIA A;  1UG2 A;  3BTI A;  1IDY A;  4FCY A;  1B8I A;  1GVD A;  2GM4 A;  1VI0 A;  3SFI A;  2IEK A;  4JYK A;  2K9S A;  3GBG A;  1RPW A;  2LR8 A;  2LVS A;  2DJN A;  2EQR A;  3BTL A;  2CUF A;  4B3A A;  1TWF J;  1K61 A;  3HOX J;  1SFO J;  1MSE C;  1AKH B;  5C4J J;  3S2D J;  1ETY A;  3LSG A;  5FKL A;  4I6Z A;  3BQZ A;  2N8G A;  2G0E A;  2ZB9 A;  2WAQ N;  3IH3 A;  2CQX A;  2VKV A;  5EZH A;  3Q0V A;  2D5V A;  2H8R A;  2M9H A;  1POG A;  1A6I A;  2MGQ A;  1BJZ A;  3JRI A;  3LNQ A;  3C2B A;  3MKL A;  2R5Z A;  1JUM A;  4UUT A;  1JTY A;  1TWC J;  2M8G X;  3ZQL A;  3PO2 J;  3M3Y J;  1IV6 A;  5J1U A;  5IP9 J;  4A3D J;  2DA5 A;  3TW7 A;  4W1U A;  4QSH A;  2XRL A;  2E2J J;  1UHS A;  3BTJ A;  2R7Z J;  3DEW A;  2ID6 A;  2XPV A;  2Y0S N;  2NOG A;  5M5Y J;  1JJ8 C;  5F0F A;  1B72 B;  2YU9 J;  2HOA A;  2JA8 J;  4M3F A;  4XK4 A;  1U8B A;  2JA5 J;  1W0T A;  1JJ6 C;  2GLO A;  3HOZ J;  2JK3 A;  2KT0 A;  3A03 A;  1JT6 A;  3LOC A;  1LFU P;  2E2I J;  5HOD A;  4AYB N;  1X2M A;  3OSG A;  1MSF C;  3RQI A;  1GV5 A;  4CYC A;  1ETK A;  1HDD C;  2GBY A;  3WHB A;  2DA2 A;  2XPU A;  3JRB A;  1EF4 A;  2EZK A;  4EEF G;  2FJ1 A;  1OCT C;  1MBK A;  1OFC X;  5IYC J;  3GTP J;  1GV2 A;  1RES A;  1IJW C;  3LSP A;  4A69 C;  3BR1 A;  3IV5 A;  3O8H A;  2VI6 A;  1S7E A;  5JLW A;  2JN6 A;  1JUS A;  3B6C A;  4M3G A;  3SDG A;  2EZL A;  1TC3 C;  1BW6 A;  3S17 J;  2NVX J;  1YRN B;  4FE7 A;  1X58 A;  3GTL J;  2VPR A;  2M2E A;  5IPA A;  1JKR C;  2NVQ J;  4IHX A;  5EG0 A;  2X6O A;  2E2H J;  4MO7 A;  1HOM A;  2R5Y B;  3JRE A;  4J19 A;  4DZP A;  2DN0 A;  4BBS J;  1U78 A;  1F36 A;  3QPL A;  5FKO A;  2ME6 A;  2R92 J;  2WB1 N;  1ZQ3 P;  4AC0 A;  2XPW A;  1XG1 A;  5IP7 J;  4AUX A;  1MBF A;  1LE8 B;  4V2F A;  3BR2 A;  1ETQ A;  1IGN A;  2LP0 A;  1PUF A;  2L0K A;  4A3I J;  4X6A J;  3S16 J;  2L9R A;  5E3M A;  2CJJ A;  1JUP A;  2COB A;  4MFE A;  3HBL A;  2MW8 A;  3BR0 A;  1AU7 A;  5F0C A;  3VPR A;  2Y9Z A;  1X2N A;  4MIM A;  1IC8 A;  2QCO A;  4JX4 A;  2DMQ A;  3JRC A;  5F04 A;  2DMP A;  3O8G A;  2LD5 A;  3H0G J;  1B72 A;  2JMW A;  1G2H A;  1ZR2 A;  3K2A A;  1NTC A;  1IRZ A;  4DYC A;  2Y31 A;  1P7J A;  1P7I A;  5M5X J;  3GTJ J;  1DU0 A;  2E1O A;  5E3N A;  4D5F A;  9ANT A;  3E7L A;  4DYQ A;  3FKI J;  3S1Q J;  1H8A C;  3GTM J;  2I10 A;  3DCF A;  2O7O A;  2X48 A;  1QVT A;  4A3B J;  4I76 A;  3M4O J;  1QVU A;  4L5E A;  1RR7 A;  4IEJ A;  1U9N A;  2DA3 A;  3BT9 A;  3GTO J;  4C2M J;  1JKQ C;  4D7M A;  3HEF A;  2JA7 J;  4GFB A;  5M3F J;  4UUS A;  3HOU J;  4FTH A;  2IBD A;  4MFD A;  4D7N A;  1ENH A;  2FQ4 A;  3GTG J;  3JRD A;  1I6H J;  2NS7 A;  4QIW N;  2O9L A;  1JTX A;  3A01 B;  1ETV A;  3OOU A;  4M6V A;  2PMZ N;  5J3L A;  5DTD A;  4XRS G;  4DW6 A;  3TED A;  4A3M J;  2NVT J;  4QTR A;  3JRF A;  3NAR A;  5C4X J;  1WGX A;  5FKK A;  3D1N I;  3MVP A;  1FTZ A;  3S1M J;  3L1P A;  1D5Y A;  3HDD A;  2B63 J;  1BW5 A;  2XGE A;  4BXX J;  2YUS A;  1Z0X A;  3H3V K;  2P81 A;  3BG5 A;  4JP0 A;  5F27 A;  4M3D A;  1B8I B;  3BG9 A;  2DA6 A;  5FKN A;  3GTQ J;  1U9O A;  3FK6 A;  1ZGW A;  5M3M J;  3UKG A;  1XC5 A;  4IHV A;  3HB9 A;  3I4N J;  3CMY A;  1ETO A;  4C3H J;  3IH4 A;  1MBE A;  1OCP A;  2DMT A;  3OSF A;  3G1L A;  1QRY A;  2K40 A;  5K7H A;  2EZH A;  2ECB A;  4DZJ A;  3G1O A;  5E3O A;  5EGO A;  1T33 A;  5EZG A;  5EF6 A;  2R5Z B;  5IYB J;  1Z77 A;  1MBJ A;  4B1R A;  5F1J A;  4M3B A;  4RDU A;  2NS8 A;  3PO3 J;  1JKO C;  4XRM A;  1IDZ A;  2DTZ A;  3CDL A;  5M5W J;  2YS9 A;  2Y9Y A;  2JJ7 A;  1MNM C;  5FJ8 J;  1H89 C;  5J1Y A;  2ME0 A;  2HYJ A;  5EDN A;  1NK2 P;  4LOC A;  3HKZ N;  5C3E J;  2AO9 A;  1SAN A;  3S1N J;  4A3L J;  2CRG A;  2AHQ A;  2CQQ A;  3BR5 A;  2K9N A;  1FTT A;  3NAU A;  1HCR A;  5FLM J;  3TW6 A;  4Y7N J;  3BR3 A;  4JX6 A;  4V2G A;  4A3G J;  1AKH A;  1R9T J;  2M0C A;  5IYD J;  3A02 A;  2HOT A;  1FEX A;  5E3L A;  1WPK A;  3FIW A;  2LK2 A;  1RET A;  4S0H B;  2TRT A;  4M3E A;  2XGD A;  2JWT A;  2VUM J;  2FX0 A;  3ZQF A;  4CYC B;  3TP0 A;  3FIS A;  3BTC A;  4A3F J;  1FJL A;  3RKQ A;  1UMQ A;  4FE4 A;  3SJM A;  2LTP A;  1CQT A;  1HDP A;  3RZD J;  1H88 C;  2W48 A;  2DMU A;  2H1K A;  2K9Q A;  2Y2Z A;  1TWH J;  3F0C A;  5F0H A;  3JRH A;  1HLV A;  4BKX A;  1QPI A;  1XS9 A;  1VFC A;  2L7M P;  1JGG A;  1TWA J;  3ZQI A;  3ZOB A;  1F43 A; 
#chains in the Genus database with same CATH topology
 1DPU A;  2Y30 A;  4I02 A;  4A3K J;  5GTI C;  3J80 Z;  3GFI A;  1O3R A;  2XB5 A;  2VL8 A;  2K3P A;  2V6E A;  3ZMT A;  4PZJ A;  1JKP C;  3CTA A;  2RN7 A;  3H1C A;  4IHY A;  1RRJ A;  2JA6 J;  4BY1 J;  2XSD C;  2HYG D;  2IVM A;  1Q1H A;  1I39 A;  1ZG5 A;  4G6Q A;  1YS6 A;  4XLP F;  1QQI A;  3S14 J;  3DV8 A;  1IUF A;  2IS1 A;  3PSF A;  1T2K A;  2CUJ A;  5LLQ A;  2A5Y B;  2H6B A;  3OYC A;  1SAX A;  1D8J A;  1HA8 A;  1MMD A;  2P6S A;  1LFB A;  3TO7 A;  3E5Q A;  2DDB A;  4IHT A;  2P4W A;  4C3I J;  3DPU A;  4XRF A;  3ZMU A;  4KMF A;  1FMV A;  1FMW A;  2HKX A;  2L02 A;  1WJE A;  1TQM A;  4HRI A;  4KNY A;  1OIS A;  2OPT A;  4NB5 A;  3L9F A;  4BEH B;  2ACJ A;  1S72 I;  5KVR A;  2X51 A;  3GLX A;  1MBH A;  1WCM J;  2FOK A;  2L9N A;  3LSI A;  3ZQH A;  3J7Z I;  4ABZ A;  5GP9 A;  2DFE A;  1S8N A;  3EQL F;  3AL0 C;  3BJO A;  1PDN C;  4XQF A;  3WG9 A;  2KIQ A;  5DYM A;  2XV4 S;  4IRG A;  4GO1 A;  1I1S A;  2LSO A;  4OU0 A;  2HOS A;  1ZG1 A;  2JSP A;  2A5W A;  3IH2 A;  4D1Q A;  2V9P A;  3MWM A;  2R7R A;  4MQ9 F;  2XAS A;  1I1G A;  2KJC A;  3JRA A;  1ZTR A;  3RZO J;  2EBI A;  3C18 A;  2DPU A;  3G4S I;  3CF2 A;  3CD6 I;  2EV6 A;  1EH7 A;  1LE8 A;  4CH7 A;  2JA2 A;  3M7G A;  4XIC A;  5LD2 C;  2HQA A;  2P8T A;  2K9M A;  3W6J B;  3J7A O;  2R3S A;  4M6Y A;  4BHP A;  4UUS B;  3SYT A;  2ZJP F;  2QKL B;  1Z21 A;  1VF9 A;  1WJ5 A;  1FIP A;  5BOX A;  2KFD A;  2LLK A;  4BJT A;  2FMY A;  4JX5 A;  4XM3 A;  2OV7 A;  4HAM A;  2XF7 A;  2QA4 I;  3LWF A;  5HS8 A;  2JVG A;  4A93 J;  2IS2 A;  1ZGA A;  5FLX K;  2VJJ A;  3OYD A;  1O3Q A;  2PMH A;  1DGR M;  2DOE A;  3L09 A;  4G12 A;  4G9Y A;  4XLC A;  3CO7 C;  4A12 A;  4DYR A;  4B09 A;  2BHY A;  2HZD A;  3ZQQ A;  1D3Y A;  2XB0 X;  3H9Q A;  1U5T A;  2O8X A;  2BV6 A;  2VT2 A;  2KDZ A;  3CCU I;  1PP8 F;  3A2K A;  4UHT A;  5DM7 F;  2GOM A;  3E1S A;  1TWG J;  3MZY A;  4RM2 A;  3C2H A;  4CXF A;  2E1C A;  3GLL A;  4CA0 A;  2GXA A;  1BBY A;  3MZH A;  4OMY A;  2PLY A;  4EMS A;  1BL0 A;  4CIC A;  1XMA A;  5CQG A;  5F08 A;  3WGI A;  2HI3 A;  1K6O A;  1ZEL A;  2BY3 A;  2OF7 A;  2QEX I;  5IOZ A;  2FD5 A;  4O3M A;  2BYV E;  2XKO A;  2Z3Y A;  3K1N A;  4WXH A;  5GTH C;  4CDG A;  1IN6 A;  4A0Z A;  4A5N A;  4NNJ A;  2Q1Z B;  3P5J A;  2HVQ A;  1XTA A;  3GME A;  4BQQ A;  4EGZ A;  3CCM I;  2O3F A;  4JK1 X;  2JPB A;  4NDL A;  5BMZ A;  3HGY A;  4CGZ A;  2QQB A;  5FFZ A;  2L5Q A;  5EEH A;  4OWR B;  2R7T A;  4XKB A;  1ZRE A;  1IDY A;  3U1D A;  2ZME A;  5L3G A;  1R71 A;  2P7C B;  1VI0 A;  2OCC H;  3WTT C;  1TQP A;  2NAZ A;  1L0O C;  1USS A;  4ENN A;  3GBG A;  1VQ4 I;  1WI9 A;  2ZNY A;  4YEL A;  3RPU A;  3DBR B;  1PP7 U;  1A36 A;  1BC8 C;  4OOI A;  1K61 A;  3M9A A;  2JVH A;  2RGV A;  1KYW A;  2W7N A;  3LSG A;  5FKL A;  1R5G A;  1MJA A;  1R22 A;  3F8N A;  3WTX C;  3GUD A;  2G0E A;  2ZB9 A;  2WAQ N;  4G6T B;  2CQX A;  2VKV A;  1DQU A;  3GX4 X;  5EZH A;  3WOD F;  2D5V A;  2GAU A;  2M9H A;  3N05 A;  1BJZ A;  3C2B A;  3KPH A;  2R5Z A;  1LEB A;  2PG4 A;  2ZXH A;  4BQA A;  4UVB A;  3I56 I;  3I0T A;  5LFA A;  3K1M A;  3M3Y J;  2A3S A;  1J0R A;  2B7E A;  3F23 A;  3BTJ A;  2GQQ A;  3K4C A;  3N97 A;  5ICE A;  3MKY B;  2MA3 A;  2EFP A;  4RB0 A;  3WE2 A;  2CW7 A;  1LDD A;  3BZK A;  2NOG A;  3OR2 C;  1UB9 A;  3OYM A;  5TRD A;  3CLO A;  1B72 B;  1S5L C;  3L2V A;  1Z3X A;  4KMU X;  4MTD A;  5DUK A;  2A69 F;  2QSH X;  3BPV A;  2IGO A;  2ZFW A;  3JTH A;  1BM9 A;  1JHH A;  3M1C A;  4XK4 A;  1W0T A;  4I09 A;  1FY7 A;  4B48 A;  2GLO A;  1XSV A;  2JK3 A;  4AM3 A;  2CSO A;  3NWT A;  5E1W A;  4AIJ A;  2GA1 A;  4F55 A;  3RQI A;  2LMD A;  3VYU B;  1UEL B;  2HGC A;  3I58 A;  3WHB A;  2F4O B;  4LG0 B;  4IF4 A;  4II2 A;  2EIK H;  2CW0 F;  1MBK A;  3AG3 H;  3BLY A;  1OFC X;  4HSR A;  3U9G A;  1WKM A;  4BJ6 C;  4NC7 A;  1GV2 A;  2CS3 A;  3S32 A;  5IT3 A;  3ELK A;  1IJW C;  3P9I A;  3LSP A;  3IV5 A;  3ZPL A;  2L7K A;  1R49 A;  2CMP A;  4BQO A;  1BN5 A;  4M9Z A;  3IKV A;  1X1D A;  4OMZ A;  2HPM A;  3CCL I;  4PJJ A;  2IRF G;  4RB2 C;  3BJA A;  1FOY A;  1X58 A;  3PL8 A;  1MZB A;  2CFO A;  4NC8 A;  1ZN2 A;  2V6C A;  1BOA A;  3E6C C;  4D9J A;  2PMZ A;  2X6O A;  3I59 A;  2LF8 A;  1KQ8 A;  4MO7 A;  1TW2 A;  4NQW B;  5E79 C;  3JRE A;  1J2X A;  4XOP A;  4J19 A;  1D0Y A;  2DN0 A;  2E1M B;  3HJE A;  4BBS J;  3QP6 A;  3OY9 A;  4K2E A;  1ZQ3 P;  5CVJ A;  4AC0 A;  4HLY A;  2VXZ A;  4OIO F;  5IP7 J;  1F1Z A;  4GYI A;  4NBQ A;  2DDA A;  3MKZ A;  3ZMV A;  4IX7 A;  1V5G A;  2M5W A;  1MDM B;  1ETQ A;  2V1X A;  3S3O A;  3RYR A;  3I64 A;  2LP0 A;  4A0Y A;  1PUF A;  4X6A J;  5HDK A;  2MD5 A;  4M9X A;  3S16 J;  4PSX A;  5LRS A;  1FOX A;  4L9N A;  3SZG A;  5F0C A;  1KYZ A;  2QM3 A;  4AD9 A;  5ICF A;  2QKM B;  4MIM A;  3T1B A;  5J47 A;  1IC8 A;  3F8M A;  4U0W A;  3RKX A;  5D4S A;  2IA2 A;  2AS5 F;  3ASN H;  4KFC A;  3JRC A;  1KA8 A;  2DMP A;  3O8G A;  3CCV I;  1B72 A;  2JMW A;  1G2H A;  1IN8 A;  2DFI A;  2OD5 A;  1NTC A;  1IRZ A;  3VFZ A;  1B9N A;  2Y31 A;  3R60 A;  1T39 A;  1ZHF A;  1P7I A;  3GFL A;  4PCQ A;  2ICW G;  4L0Y B;  2FE3 A;  4E7S A;  4C30 A;  2IA1 A;  1BI3 A;  2L4A A;  3S1Q J;  4XKC A;  2VT3 A;  3LL7 A;  3RI4 A;  3DCF A;  2M7A A;  1L3L A;  1H8A C;  4YEJ A;  4A3B J;  2OZU A;  2HEO A;  5LGU A;  3J81 K;  1KU9 A;  3WTU C;  1LVK A;  4Z2Y A;  2BY2 A;  3TL4 X;  4I2O A;  3DEE A;  3G6E I;  1V5E A;  2DA3 A;  2VB6 A;  3H3Z A;  1GLN A;  4GXO A;  1JKQ C;  4DBQ A;  2DK5 A;  4JQF A;  2MC3 A;  2OBP A;  4D7N A;  1W5T A;  1IV8 A;  2W84 A;  2XIG A;  2FQ4 A;  4FAS D;  3GTG J;  3JRD A;  4P1W A;  4XNF A;  2F5D A;  2CWE A;  2O9L A;  1JTX A;  5FD5 A;  3OOU A;  4M6V A;  5J3L A;  3TED A;  5EEG A;  3JRF A;  2V4J C;  3QPH A;  5LHI A;  5C4X J;  4MHG A;  1D5Y A;  1BW5 A;  1TZL A;  1Y6I A;  3A1Y A;  4BXX J;  1Z0X A;  2KDO A;  2P81 A;  2X1E A;  3KZY A;  2FBI A;  5FKN A;  4NC6 A;  5TIS C;  5M3M J;  1IZ1 A;  3S2W A;  2STW A;  4IHV A;  2ZXW H;  1ON1 A;  1UAA A;  3CUQ C;  1YHQ I;  1GVJ A;  4PJM A;  4WXC A;  1ETO A;  3H92 A;  4C3H J;  1JHF A;  2EB7 A;  3IH4 A;  3MQ0 A;  3J7A Y;  1MBE A;  2F48 A;  2DMT A;  3UNG C;  3ABM H;  2DQL A;  2CYY A;  3DEU A;  5K7H A;  3GO5 A;  4O5V A;  1QGP A;  4I0A A;  4FQG A;  4PJ0 C;  1B6A A;  5EZG A;  1G3S A;  5EF6 A;  4Q47 A;  4B1R A;  1O7L A;  4A6D A;  2OC6 A;  1X1P A;  3L00 A;  3WTV C;  1QNT A;  2RQQ A;  4LMY A;  3HPG A;  2K02 A;  1H89 C;  2CQK A;  2CV2 A;  4AIH A;  1IRX A;  3VEP A;  2EV0 A;  2IJL A;  1VQK I;  4BUP A;  2Z16 A;  3KLO A;  4ANJ A;  1K4S A;  2AO9 A;  3J7Y J;  2PJR B;  1H0M A;  5F6F A;  3M07 A;  1TBX A;  1D1B A;  2K9N A;  3K69 A;  2GIZ A;  1WSU A;  3NAU A;  3TW6 A;  4A3G J;  4JX6 A;  4V2G A;  4CHU A;  5BS6 A;  3BOQ A;  5E1X A;  4IQJ A;  1R9T J;  2VQG A;  2M0C A;  5IYD J;  5HLH A;  4HX4 A;  2BY0 A;  4KUM A;  1RET A;  3TDZ C;  5L3F A;  1E2X A;  2KP6 A;  3F3X A;  1WJB A;  1R4M B;  3PIO F;  4RMN A;  1P92 A;  1VQP I;  3G73 A;  4LGW A;  1CF7 A;  1B1B A;  4UB8 C;  2E36 A;  2L01 A;  3SEZ A;  4ZTJ A;  3SZT A;  1H9G A;  3PJR A;  3FBI B;  3KX2 A;  1XMX A;  5K1Y A;  3GEZ A;  2XAF A;  1B9M A;  2F2E A;  2GXG A;  2HKO A;  2O0Y A;  3ML6 A;  1SEU A;  1FJL A;  3HXL A;  1C0W A;  3JSO A;  4FE4 A;  5L3E A;  1UJ8 A;  1XPX A;  1HDP A;  1BIA A;  3K9T A;  3IAM 2;  3KCC A;  4BXF A;  3CDH A;  2Z33 A;  1VQM I;  2VJ4 A;  5F0H A;  2QBY A;  1HLV A;  2GXB A;  4BKX A;  2A05 A;  1QZY A;  3ZR8 X;  4EJU A;  5DUI A;  4RA2 A;  4XON A;  1TWA J;  2UXX A;  2PI0 A;  3GZ5 A;  3CUO A;  1UCR A;  1X19 A;  2HYF A;  3Q9V A;  2V1N A;  4E6K G;  1A35 A;  1SFX A;  2A6T A;  5EG0 B;  5IP6 A;  2KL4 A;  4UXN A;  3Q9S A;  1R1T A;  2DLL A;  2KIM A;  4FIS A;  2PMU A;  3V8K A;  2ZNZ A;  4HNV A;  2PJP A;  2Y75 A;  2OTJ I;  1XGS A;  1WFX A;  2L7F P;  4M74 A;  1G4D A;  1S3J A;  1YYV A;  3PUB A;  3LSR A;  1I3Q J;  1ORK A;  1MBG A;  3CF5 F;  2KPM A;  3K6G A;  1XD7 A;  5C44 J;  1BA5 A;  4GRI A;  3OYN A;  1AHD P;  1OCR H;  5BPI A;  2MC4 A;  2QEN A;  2QQA A;  3RSN A;  1VQ5 I;  1MW7 A;  5LGT A;  3IP4 B;  3S1R J;  3I4M J;  3ABU A;  4ITV A;  3DLL F;  2P0W A;  4A3J J;  1O7F A;  3M1E A;  1KON A;  3CC2 I;  1XGM A;  4DGW B;  3BCA A;  1YRN A;  4EM1 A;  3BZ6 A;  2IPQ X;  3V8L A;  2XAJ A;  3KZI C;  3OMY A;  2R5Y A;  1JGS A;  4NHJ A;  3EYY A;  4UVC A;  4XLF A;  3RPQ A;  3DTK A;  3I54 A;  2Q2E B;  3G1M A;  4IJA A;  3DU5 A;  5JR3 A;  1T95 A;  1I50 J;  4BY7 J;  1Z3Y A;  2H6C A;  5E17 F;  2Z5U A;  1RIO H;  1OYY A;  4A6E A;  4YRV A;  4BXU A;  2JRM A;  2RKH A;  4HX8 A;  2LY9 A;  4E7K A;  1FOW A;  2VBX A;  4L9V A;  2R7Q A;  4AU7 A;  2B0L A;  3ZMS A;  1ZAR A;  2XGC A;  2XUB A;  2O6G E;  3PM1 A;  2L7Z A;  4LLL A;  2XGX A;  1DU6 A;  2EH3 A;  2VKD A;  2LKS A;  2CFX A;  5LHH A;  2ZFU A;  4IHW A;  4BE0 A;  2FBK A;  5HDG A;  1IN7 A;  4XRS A;  4IO9 F;  3PNT A;  5FKM A;  5B3S H;  5BPD A;  3JR9 A;  1A5J A;  2MSY A;  2LRE A;  3S93 A;  2MG4 A;  1Y8Q B;  3TBI A;  2XC7 A;  3K70 C;  3K4L A;  5D6E A;  4HLX A;  4ZZD A;  2VBY A;  3CLQ A;  3R61 A;  2HDC A;  3CCQ I;  3ROU A;  1ZK8 A;  5GPC A;  5L3C A;  2R93 J;  1WH5 A;  3HG9 A;  4XN0 A;  2RC4 A;  3UR3 C;  1RKW A;  3GFM A;  1PVE A;  4MEX F;  2V1U A;  2DA7 A;  2NOJ B;  3F8C A;  2ECC A;  1GUU A;  4P9U A;  2MH2 A;  2Y69 H;  2K7L A;  2LKX A;  2NNN A;  2F5F A;  2PFB A;  2QLZ A;  3FMS A;  5GAD J;  1NK3 P;  4IPA A;  3B6A A;  5EEA A;  2A6H F;  1Z67 A;  4WXD A;  4PFP A;  1W1W E;  4KA4 A;  4EJO A;  1R5H A;  1YJ9 I;  3S15 J;  1RR8 C;  5FLX Z;  1WI3 A;  3GF2 A;  4XLE A;  4CUG A;  1BR1 A;  4X0G A;  2KJB A;  4BDY A;  4FX4 A;  2O8K A;  2MD0 A;  1SFE A;  1E3O C;  4EGY A;  1HQC A;  1ZKG A;  2QQ8 A;  3KP6 A;  2GIV A;  2VKE A;  5GPA A;  2CH0 A;  3IWF A;  1ZH5 A;  1Y1V J;  4PJL A;  1FP2 A;  3QPS A;  4XLN F;  3K4N A;  4HST A;  3VB2 A;  3MMY B;  1Z7L A;  3OYF A;  3GW2 A;  3B02 A;  1XB4 A;  1B8I A;  1GVD A;  4LG3 A;  4CCK A;  4MEY F;  3EUH C;  2IEK A;  1S9H A;  3BWG A;  1K78 A;  2LVS A;  2XKP A;  2EQR A;  4KN7 X;  2OTL I;  4B3A A;  2DQR A;  4ZH4 F;  3PNV A;  4GGG A;  1MSE C;  4XLH A;  4E7Z A;  3HRU A;  1HW1 A;  2LG4 A;  3BQZ A;  1LVA A;  4XOT A;  2N8G A;  3F22 A;  3FXK A;  4XL9 A;  1MJB A;  4CCN A;  5E8G A;  1XGN A;  4H0E A;  2MGQ A;  2A07 F;  3DQV C;  3JRI A;  3MKL A;  2NNY A;  2KIF A;  4RAY A;  4UUT A;  3SXY A;  2HVS A;  4G6D A;  1JTY A;  1TWC J;  2QWW A;  1TP4 A;  2M8G X;  3OYL A;  3ZQL A;  5B66 C;  3G2B A;  4RGX A;  5KHD A;  5IP9 J;  4QSH A;  2XRL A;  2IGK A;  2E2J J;  1QO0 D;  2LF7 A;  3BY6 A;  1UHS A;  3CMA I;  3JSP A;  1R36 A;  4L18 B;  1YX5 A;  4IQ4 A;  2DO7 A;  4L9T A;  1XX5 A;  3DKW A;  2R7Z J;  1QZE A;  5M5Y J;  3EET A;  2EWN A;  1JJ8 C;  1E17 A;  3CES A;  2OAZ A;  5F0F A;  1OCZ H;  1SMT A;  4O6J A;  4WK8 F;  2YU9 J;  2VPL A;  4N9H A;  1K6Y A;  4RM3 A;  4Q48 A;  1OR7 A;  2JA8 J;  4RB1 A;  2QZ8 A;  5FRO A;  2BBY A;  2LNB A;  4RGR A;  1DUX C;  2JA5 J;  4LLG F;  2HTS A;  5KCM A;  1S7A A;  4XSX F;  3QOD A;  3LOC A;  1LFU P;  1IXC A;  2LBF B;  2D45 A;  1PUE E;  3OSG A;  2W00 A;  3KET A;  3V7S A;  1ETK A;  5E18 F;  2DA2 A;  4PFO A;  3HHG A;  3V7C A;  2DFF A;  5J8C A;  4CCM A;  5FO5 A;  3WU0 A;  1I6X A;  2MBF A;  4QLC U;  1YE9 A;  4A69 C;  1ON2 A;  5D5W B;  3H35 A;  3O8H A;  2VI6 A;  2FF4 A;  4P5O A;  3COA C;  2O61 A;  1IXS B;  4HEA 2;  5JLW A;  3CJR B;  1YTY A;  4Y17 A;  3BDD A;  1KU3 A;  3DF8 A;  3B6C A;  1PYV A;  2EZL A;  5CVU A;  4QWQ A;  4KT5 C;  1TC3 C;  3S17 J;  3WTY C;  4HX7 A;  4PUS A;  1UHW A;  2IGM A;  3GTL J;  2Y0S A;  2VPR A;  2M2E A;  1R6R A;  2NVQ J;  2RVC A;  4IHX A;  4F52 A;  3L2W A;  2ZSH B;  4U87 A;  5J8F A;  3TGN A;  3W2V A;  1W36 C;  1S7O A;  3HSR A;  1HOM A;  2FOW A;  5D8K B;  3S8P A;  4DZP A;  4ZYE A;  1P4X A;  3W6K B;  4N4N B;  1U78 A;  5A2Q K;  2EIJ H;  2LY1 A;  2EK5 A;  4CO8 A;  2R92 J;  3CCR I;  3LFU A;  2JZY A;  4EJW A;  3WE3 A;  3ZMZ A;  4QPO A;  1XG1 A;  1AWC A;  2R7X A;  1F5T A;  4BE2 A;  1MBF A;  1JXS A;  4AYB A;  1VQ6 I;  3GVA A;  3VYT B;  3BR2 A;  1HKQ A;  4A3I J;  2DW4 A;  2PEX A;  1TQI A;  2L9R A;  4ZJZ A;  3OYG A;  1V55 H;  2IS6 A;  3ABL H;  3KYC B;  3RYP A;  3J80 K;  4BEH A;  3ZN0 A;  1VQO I;  3CCJ I;  1NHA A;  1G3Y A;  2F5V A;  4JOM A;  5D5X B;  3VPR A;  4KIS A;  3LSM A;  5GAG J;  2X1C A;  1TW3 A;  2DMQ A;  2D2W A;  3H0G J;  4P9F A;  2M4K A;  4XR6 A;  3KZZ A;  4QPQ A;  2DT7 B;  2WA0 A;  2Y0M A;  2FUG 2;  4DJA A;  5M5X J;  3AKZ A;  2AQF A;  2R7V A;  1UST A;  4CZC A;  3E7L A;  4DYQ A;  4I0B A;  2EPF A;  3M4O J;  2KRC A;  1QVT A;  4I7H A;  4I76 A;  2K4J A;  4E7L A;  4U0V A;  1RR7 A;  3QU6 A;  3OL3 A;  4B3X A;  5D5U B;  2FA5 A;  2CG4 A;  2Y48 A;  2VE8 A;  3FX3 A;  2W85 A;  4C2M J;  4D7M A;  3HEF A;  1P6R A;  4GFB A;  4UUS A;  3T0Y A;  4FTH A;  2IBD A;  2X6X A;  3RQ4 A;  1U5T C;  4CZZ A;  3V4G A;  1UHM A;  2NS7 A;  3AFH A;  4QIW N;  2B9S A;  2WAE A;  3A01 B;  1ETV A;  4DW6 A;  1A04 A;  2TDX A;  2C6Y A;  3GFJ A;  2NVT J;  1W5C C;  3CUQ B;  4QTR A;  4UY8 I;  1B4A A;  4PJN A;  1WGX A;  5H6R A;  3CP8 A;  4EQQ A;  1TNT A;  4ZYG A;  1FTZ A;  3S1M J;  3L1P A;  3HDD A;  2UWM A;  1SVO A;  3DXJ F;  2YUS A;  4P96 A;  5DD4 A;  3H3V K;  3IRR A;  4A5M A;  3DPT A;  2E60 A;  2DA6 A;  3K4M A;  4F91 B;  3RDI A;  3DLA A;  1ZGJ A;  3FKJ A;  3I4N J;  2E7X A;  2HDW A;  3ABT A;  5E20 A;  4DNC A;  3H5A A;  4EVI A;  4YG2 F;  1O3T A;  2ZBK A;  3DFG A;  4ZC3 A;  4IRI A;  1X4P A;  2R7U A;  2LH9 A;  2YU3 A;  2EZH A;  2CQ7 A;  1U8R A;  3E6B A;  1SD6 A;  5CYV A;  4DZJ A;  1HBX G;  3CO6 C;  5E3O A;  2ZME C;  4KYW A;  3FMQ A;  4HNU A;  1Z77 A;  1MBJ A;  1BOB A;  1EV7 A;  2E7W A;  4RDU A;  2NS8 A;  3TO9 A;  1ERD A;  1JKO C;  1P4W A;  2YPR A;  2ZXJ A;  2ESN A;  1U6G A;  1AA7 A;  1Y0U A;  4E4H A;  3OS1 A;  3I9V 2;  5C3E J;  1SAN A;  2CRG A;  3BR5 A;  2LC2 A;  3OR1 C;  4UVA A;  1FTT A;  5LEJ A;  1P4A A;  1IXR C;  3HRS A;  1UG0 A;  3JAM Z;  2V7F A;  3P7N A;  2ZSI B;  3WTW C;  2HOT A;  5HLG A;  3QYF A;  5E3L A;  3FIW A;  1FYM A;  1DP3 A;  2NRA C;  3FM5 A;  4S0H B;  1T0F A;  4BYY A;  4M3E A;  2R7O A;  2D1H A;  2P5V A;  5IT9 Z;  1LKX A;  2E35 A;  2JWT A;  5JI6 A;  3HOS A;  4OAZ A;  4CYC B;  3VYS B;  3TP0 A;  3FIS A;  4BNC A;  2YSR A;  3D5L A;  4XN3 A;  1FP1 D;  1ZLJ A;  3OOP A;  1DP7 P;  3BTC A;  3I4P A;  1EH6 A;  2DOD A;  2VUM J;  3NWS A;  2ZJQ F;  3SJM A;  3KE2 A;  5AON A;  2RV8 A;  2EA4 A;  3RZD J;  5KAI C;  1H88 C;  2CV0 A;  2IXS A;  2K86 A;  4E7J A;  3IWZ A;  4CCO A;  4IRH A;  3F0C A;  4LD5 A;  2BGC A;  3CUQ A;  3GWZ A;  4YFN F;  3ZP5 A;  1XS9 A;  1JGG A;  3RIR A;  4ENJ A;  2IGN A;  4U7B A;  2HXO A;  4UV8 A;  1ZRC A;  2BY1 A;  2ESH A;  5H20 A;  1T38 A;  4ESF A;  3HGG A;  2BE5 F;  2O5R A;  1IG7 A;  3TP3 A;  3ERM A;  1IAW A;  4G7Z F;  1V3F A;  1IRG A;  1HST A;  1OYW A;  4LG0 A;  3KFW X;  5CJ9 A;  2PQ8 A;  1W36 D;  3Q3S A;  4R79 A;  4U7D A;  1VND A;  1VQ8 I;  2CUE A;  2DA4 A;  2IAI A;  2MYS A;  4IL6 C;  5HLI A;  3F21 A;  2E34 A;  2HQ5 A;  5CVI A;  3FBN B;  3FXQ A;  3F8B A;  3OYE A;  5L3B A;  1SVM A;  3LA2 A;  3CDI A;  4EV0 A;  2ISY A;  4GDF A;  3FWE A;  3HZJ A;  1ITY A;  2H09 A;  2X6W A;  3KEQ A;  3MD2 A;  3T8T A;  2A61 A;  1SMY F;  5IY5 H;  5FLV A;  4XMY A;  1MD0 A;  4YFX F;  4U0Y A;  1YFH A;  2WV1 A;  3S2H J;  2CU7 A;  4LIU A;  4AID A;  3TQN A;  1WQ2 A;  3WU1 B;  1WH7 A;  3K1P A;  4ENK A;  2V9K A;  2R4G A;  1WWX A;  1W7P D;  1NG6 A;  3E6D A;  2EJR A;  4BU2 A;  1VTN C;  1BI1 A;  3DKX A;  4NQW A;  3RCO A;  1FYL A;  1SD7 A;  4IHS A;  1ZR4 A;  2BOL A;  1VZ0 A;  2JRT A;  3BR6 A;  2NYX A;  1RC9 A;  3U1K A;  2ZXI A;  2IP2 A;  2MAB A;  1D0X A;  2HPI A;  2OQG A;  1BI0 A;  2RDP A;  2UXN A;  1XMK A;  1MDM A;  4OIN F;  5CVV A;  2CQN A;  1Z9C A;  1Y0N A;  3HSE A;  1GHC A;  1BR4 A;  3WTS C;  1R23 A;  2KKO A;  1E0E A;  1T08 B;  4L5I A;  2HTJ A;  3EDP A;  1OJL A;  3FK7 A;  1I5Z A;  3CCY A;  3HM5 A;  1QZZ A;  2FBH A;  5HDN A;  1XDU A;  3DBL B;  4J01 A;  3S3N A;  1IW7 F;  2IW5 A;  5DCM B;  3JRG A;  3T8R A;  3BZC A;  1R4N B;  2COM A;  1Q1V A;  3TKY A;  3KYD B;  1FX7 A;  5FFX A;  2VN2 A;  2J5O A;  2M7B A;  2EZI A;  3OWT A;  4XID A;  4WWC A;  4OAY A;  1Y39 A;  5B1B H;  3Q5F A;  2CW8 A;  2VBW A;  1MNE A;  3TMO A;  3ERE D;  3F9K A;  5E1Z B;  3DU6 A;  2KIS A;  4IOC F;  5JLX A;  2H27 A;  5H2F C;  1G6N A;  3MN2 A;  1BIB A;  2VE9 A;  3SEQ A;  2OU2 A;  5IOY A;  2X9D A;  2MH9 A;  1IN5 A;  5K7F A;  2WTE A;  2I8D A;  4FT8 A;  4XKV A;  2ELK A;  3CCE I;  1KU2 A;  5EYR A;  1APL C;  2IT0 A;  1MH3 A;  1T56 A;  3GTK J;  3DTI A;  3LAP A;  1K7A A;  2HXI A;  1UZC A;  3GZN B;  2WV0 A;  2YR2 A;  3NRV A;  4XSZ F;  1KU7 A;  1FBQ A;  4CYD A;  3K7A J;  5EGO B;  1LJ9 A;  2BZT A;  5BNG A;  3AAF A;  1XSX A;  2FNA A;  3BJ6 A;  1HF0 A;  3HUG B;  2ZCW A;  1QHH D;  1M1E B;  3ZQG A;  1OLT A;  2WC2 A;  3K2Z A;  1K83 J;  3IAS 2;  4BBR J;  1Y56 A;  2LKP A;  2KZV A;  5DS9 A;  4L5J A;  1YG2 A;  4A0X A;  1HKT A;  4PK4 A;  2XHK A;  3RPU D;  5K5R A;  4FCY A;  3R6S A;  2GM4 A;  3I3L A;  3QYB A;  4LIV A;  3AG2 H;  3ZMD A;  3E5U A;  4JYK A;  3OS0 A;  2K9S A;  3PFI A;  5CPR B;  1RPW A;  2DJN A;  5D4R A;  3HPH A;  4ZYD A;  2GWR A;  3HOX J;  4JBA A;  1AKH B;  5C4J J;  3S2D J;  2YX4 A;  3BPX A;  2BW3 B;  2PX9 A;  3DWL E;  4I6Z A;  4KIB A;  5JVT A;  1YI2 I;  3IH3 A;  3FXL A;  4ZYA A;  2HOE A;  3L2Q A;  4LLN A;  1KQ9 A;  2HR3 A;  1POG A;  1A6I A;  3CME I;  5D8L B;  3LNQ A;  3I53 A;  1JUM A;  1FT9 A;  3EPZ A;  2HVR A;  4I99 C;  4H4K C;  2XAH A;  2ZKZ A;  1DPR A;  3KP2 A;  3SQN A;  3O2P E;  3PO2 J;  2Q0O A;  3FHZ A;  1IV6 A;  2FSW A;  5J1U A;  4HW0 A;  1YLF A;  3FMR A;  3D0S A;  3LA7 A;  3I55 I;  3F6O A;  2WY8 Q;  4MTE A;  5JVG F;  2XPV A;  3KP7 A;  5D5V B;  2PJR A;  3LSH A;  3IUO A;  1FLI A;  5D6F A;  5B1A H;  4BE1 A;  4BL0 B;  3L2R A;  2VQH A;  1WVR A;  5ILS A;  3GYH X;  5ED4 A;  1FBS A;  3QRF F;  3DPL C;  1R00 A;  4XKW A;  1JJ6 C;  2KLO A;  4BAC A;  3HOZ J;  4GCV A;  5FB2 A;  3PQJ A;  1D8K A;  1XN7 A;  4RB3 C;  3TOB A;  3QU3 A;  4RGS A;  2DI3 A;  3S3M A;  1IF1 A;  5HOD A;  1EKE A;  3TDU C;  2DCE A;  1X2M A;  1MSF C;  1GV5 A;  4FET A;  5ICG A;  1EF4 A;  2F5E A;  2EZK A;  3E5X A;  4DOZ A;  4EJV A;  2KMU A;  4EEF G;  2WAQ A;  4F92 B;  1VQ7 I;  2DT5 A;  5F64 A;  1OCT C;  4DQ2 A;  4F93 B;  3CC4 I;  1ZAO A;  5IYC J;  3GTP J;  3OIP A;  5LRR A;  4C2U A;  4ENM A;  3BR1 A;  3B73 A;  4UNO A;  2M1B A;  1SVL A;  2HFH A;  2HS5 A;  5KNL A;  1ZG3 A;  1YW7 A;  3RJP A;  2UUZ A;  4HF1 A;  4M3G A;  2KRF A;  4KIG A;  4KT6 A;  3MEX A;  3T5X A;  1BW6 A;  4Y3O A;  4FE7 A;  2KRH A;  3VWB A;  5FRM A;  2JUC A;  5EG0 A;  3MCZ A;  1K79 A;  2L54 A;  1QA6 A;  3C2G A;  1IN4 A;  2XAQ A;  1STZ A;  1W7P B;  3L2C A;  2FNP A;  2WB1 N;  2GOX B;  3F6V A;  5ILU A;  1J09 A;  1HC8 A;  1V5F A;  4BS9 A;  3OYK A;  4YIR X;  2DAO A;  2VIX A;  1LE8 B;  4V2F A;  1OQY A;  1IGN A;  3KEO A;  3LFK A;  2L9S A;  4U88 A;  5KK1 A;  1LB2 A;  1VQN I;  1B59 A;  3HSF A;  3HRM A;  1FNN A;  1HKS A;  1JUP A;  1LUJ B;  2COB A;  4HOB A;  4MFE A;  3QAH A;  3HBL A;  2MW8 A;  3BR0 A;  1AU7 A;  2QGU A;  3CC7 I;  3DP7 A;  3ZQ7 A;  2CO5 A;  3E97 A;  2H1L A;  1X2N A;  5LBQ A;  4HG2 A;  3FZV A;  1XGO A;  3SDB A;  4JX4 A;  3SHF A;  4F7Z A;  1BC7 C;  3A4C A;  3V42 A;  5F04 A;  2LD5 A;  4G8X A;  5HS9 A;  3EUA A;  3K2A A;  1IUY A;  2Q2E A;  4DYC A;  1X3W B;  3FXJ A;  3VDX A;  2RQP A;  1ZYR F;  1DU0 A;  3QPT A;  2E1O A;  5E3N A;  2E5N A;  4D5F A;  9ANT A;  1U5T B;  2EFN A;  1FPQ A;  4HA8 A;  4ESJ A;  3FKI J;  5J40 A;  3GTM J;  2I10 A;  2O7O A;  1ONV A;  3ZN1 A;  4YII A;  3E0J B;  4M9S A;  4RGU A;  5AIP A;  2IS4 A;  2DK8 A;  4C2T A;  4IEJ A;  2P6T A;  3BT9 A;  3HOT A;  2A68 F;  2M45 A;  1P9Q C;  2JA7 J;  2VON A;  2RNJ A;  5M3F J;  3HC7 A;  1YS7 A;  5HLT A;  5B5E C;  3ZGK A;  4B8X A;  2K85 A;  1RNL A;  4M6X A;  3C7J A;  1ENH A;  3BRO A;  1XDS A;  1FYK A;  3PIP F;  3ASO H;  3SFZ A;  4ASN A;  2R7D A;  1U3E M;  2K9L A;  2LY2 A;  2CGP A;  2M4G A;  1NG7 A;  5DTD A;  3LQQ A;  2LRD A;  3U21 A;  2K3F A;  1PJR A;  2W57 A;  4D0P A;  1OCO H;  2VQC A;  4WF2 A;  5FKK A;  3MVP A;  1YIT I;  2ZC2 A;  2XAU A;  3KP5 A;  4RLQ A;  2VOD A;  2XGE A;  2JPC A;  2W25 A;  3M8E A;  2CV1 A;  3JCU C;  4HPQ A;  4JP0 A;  5F27 A;  1N77 A;  2ZME B;  3BG9 A;  3FF5 A;  3PUF A;  1VQ9 I;  3GTQ J;  2VC0 A;  1Z1D A;  3REO A;  1XC5 A;  3GZ6 A;  3HB9 A;  3CMY A;  2EV5 A;  2VC1 A;  3VYR B;  2QYO A;  3QOE A;  1AOY A;  3OSF A;  3G1L A;  4R8H A;  1W7P A;  2DXI A;  2K40 A;  3IHU A;  5DDG A;  4LIT A;  4MQV A;  1ULY A;  2P5L C;  2M3A A;  3BCB A;  3X2Q H;  5IYB J;  2R5Z B;  1W4M A;  4GYG A;  5FD6 A;  4M3B A;  2XAG A;  3PO3 J;  2P5K A;  4XRM A;  1IDZ A;  2NS0 A;  2L3D A;  1RUO A;  3CDL A;  1O57 A;  5M5W J;  3ECO A;  2LDU A;  1WJA A;  2EFO A;  1MND A;  2JJ7 A;  1MNM C;  4HF0 A;  5J1Y A;  4ZDL A;  2KZG A;  2HYJ A;  2ME0 A;  4XBF A;  1YJW I;  4BGD A;  4IVN A;  3O3K A;  4I98 B;  1NK2 P;  4LOC A;  3HKZ N;  3HL2 A;  3FXU A;  1SD5 A;  3AG1 H;  3FDY A;  4EJT A;  3LST A;  2KHM A;  2AHQ A;  2CQQ A;  1HSJ A;  5JHF A;  4Q4Z F;  3W2W A;  5FLM J;  1X1C A;  3BR3 A;  4HQE A;  3DKY A;  4KIT B;  4S05 A;  1FZP B;  1FWZ A;  4C9Y A;  1JI8 A;  5TGT A;  2O03 A;  1WPK A;  1N78 A;  1OCC H;  1QPM A;  2TRT A;  3H5N A;  3K0L A;  2XGD A;  3NQO A;  2G9W A;  5LGN A;  1FSE A;  2Z1D A;  2K4B A;  3F72 A;  1O3S A;  1A31 A;  4HV6 A;  2BXY A;  4L0Z B;  5ILV A;  1YW8 A;  1OR7 C;  2H94 A;  1G3W A;  4DIQ A;  1E3P A;  1YQA A;  2R7W A;  3RKQ A;  3AG4 H;  3K4B A;  1X1A A;  2LTP A;  4AIK A;  4E7I A;  4B43 A;  2DMU A;  2FRH A;  2Y2Z A;  1TWH J;  1RI7 A;  5E8I A;  4HF2 A;  3JRH A;  1J5Y A;  3D5S C;  2V1D A;  2JT1 A;  3K70 D;  3ZQI A;  1F43 A;  3QP5 A;  2K5C A;  1NH3 A;  4A3C J;  2OZ6 A;  2DMN A;  2G7U A;  3G3Z A;  4MNU A;  4N9I A;  5ICC A;  1GXQ A;  3R4K A;  4KJZ A;  2DTR A;  3V7R A;  5HOO A;  1T98 A;  4W97 A;  1GT0 C;  2LBF A;  3I59 B;  2W24 A;  1V54 H;  1WJC A;  3HTS B;  1WZ2 A;  1Z05 A;  5DV5 A;  2R0Q C;  2L4M A;  4CSW A;  2VOO A;  5K7Z A;  2M34 A;  3VOE A;  4RBO A;  2HWV A;  4CCL A;  4M72 A;  3MAJ A;  4HV5 A;  3HRT A;  5TJJ A;  3N4M A;  2Z9O A;  4E70 A;  4MGR A;  3A0H C;  2R7F A;  3I71 A;  3P9C A;  3ZRG A;  3R0A A;  2E19 A;  4FHT A;  3J81 Z;  1T8I A;  3W6V A;  1PUF B;  2XVC A;  1D1A A;  2CUZ A;  2D1V A;  3ABK H;  2VKH A;  4G7H F;  1R1U A;  4KDP A;  3E3V A;  2DPD A;  3H3U A;  4Q5S F;  2VQL A;  3CQZ J;  4G94 A;  1K4T A;  2OCE A;  1X3U A;  1MH4 A;  1U2W A;  1DDN A;  4G7O F;  4BDZ A;  1I27 A;  4ZDP A;  5EJC A;  5BQT A;  2DT6 A;  2FU4 A;  2ID3 A;  4EAT A;  4B4C A;  1ZLK A;  2LFB A;  1BI2 A;  3LQR A;  4ZTF A;  2TCT A;  4Y33 A;  2X4H A;  1J75 A;  1MKM A;  2MFZ A;  4XOR A;  3CMM A;  3VSK A;  3HOV J;  2XSJ C;  2E5Z A;  1JT0 A;  3A0B C;  3O6B B;  2EIN H;  3OIO A;  4OIR F;  5J1R A;  4UV9 A;  3H0D A;  1W0U A;  2UZK A;  2FQ3 A;  1SAU A;  4ZDO A;  4RAG A;  1SFU A;  4D5C A;  3HOY J;  2V79 A;  3OL4 A;  1J59 A;  3BG3 A;  3GCM A;  4HQM A;  4A3E J;  1GDT A;  4ZZL A;  4TV7 A;  2M87 A;  3BQY A;  2EFQ A;  4RAZ A;  1I3A A;  2AQE A;  3M8J A;  2L9V A;  5DD8 A;  1Y1W J;  4LB5 A;  2OA4 A;  3K4K A;  3WHC A;  4B44 A;  1O4X A;  1V4R A;  4X1E A;  4ZYH A;  1R58 A;  3DBH B;  1BR2 A;  4LFU A;  4RAF A;  4HNT A;  4C3J J;  3HOW J;  1R7J A;  1TT5 B;  1J7K A;  4ETS A;  2X6Y A;  2RAE A;  3PNY A;  1RKT A;  3Q0U A;  1QBJ A;  2DA1 A;  2JSC A;  3FHN A;  3ONQ A;  4BHB A;  1X3Z B;  1YO5 C;  1ETX A;  2Z99 A;  4MLO A;  1MMG A;  2MLK A;  2F4M B;  5GAE J;  2OUM A;  3PQK A;  2QF7 A;  1OMI A;  2HDD A;  1RUN A;  2NVY J;  3FXM A;  2WAF A;  3M8F A;  2UV1 A;  3H36 A;  3BG6 A;  3LSJ A;  3QQA A;  5LHG A;  4NUB A;  3LA3 A;  5J6X A;  2KQR A;  2A6E F;  4R1H A;  3A01 A;  2X0L A;  4I01 A;  2K27 A;  2DU9 A;  3QWL A;  1ETW A;  4Y52 J;  5HNF A;  1TTY A;  3Q0W A;  5JFR A;  1XCB A;  5CQE A;  3OYA A;  3ZQC A;  1W5S A;  1REP C;  1FIA A;  1UG2 A;  2GA2 A;  3BTI A;  3R0J A;  2M8E A;  4HDU A;  1SD4 A;  2H8W A;  4DBR A;  4IZZ A;  5HVQ C;  1TLH B;  3OYI A;  1N25 A;  2BVM A;  3SFI A;  2WWY A;  2LR8 A;  3V8J A;  1ODD A;  3MKW B;  1TL8 A;  1WHU A;  3BTL A;  2CUF A;  1TWF J;  4J00 A;  1SFO J;  4LK0 F;  2DYR H;  3VOD A;  3OYB A;  1ETY A;  2M30 A;  2MLG A;  3DTE A;  3W3C A;  3Q0V A;  4PSW A;  1D1C A;  3WGG A;  1F4K A;  2H8R A;  4UB6 C;  2Q8K A;  1CF7 B;  4Y13 A;  3KLN A;  3FM3 A;  4HBL A;  1HW5 A;  4AVP A;  4V19 K;  2OJE D;  3CJN A;  2WB1 A;  3BC8 A;  4IXA A;  1ACI A;  2BXZ A;  4A3D J;  4YFK F;  2DA5 A;  3TW7 A;  4W1U A;  4Y15 A;  5DCF A;  2I5U A;  2J5P A;  1EA3 A;  2ELJ A;  2ZJR F;  4KIF A;  1T0F C;  3KP4 A;  3DEW A;  2ID6 A;  1F9N A;  2Y0S N;  1EH8 A;  1G59 A;  4Y4R A;  2QBY B;  2HOA A;  1X4O A;  4M3F A;  3OIQ A;  4PGH A;  4LB6 B;  2R7S A;  3ZXS A;  3WTZ A;  2DYS H;  2X85 A;  1U8B A;  3IC7 A;  3K10 A;  1WRJ A;  2KT0 A;  3A03 A;  1JT6 A;  2LOO A;  2E2I J;  2ADU A;  2XF6 A;  1LPQ A;  1R1V A;  2V9V A;  4AYB N;  3H9G A;  4CYC A;  3HTU A;  2ZJ2 A;  5KAF C;  2GBY A;  1HDD C;  2VJI A;  1X1B A;  2XPU A;  2KIU A;  3JRB A;  3KYL A;  4HDV A;  2FJ1 A;  3KP3 A;  4M73 A;  3E6M A;  1MIJ A;  5L3D A;  1RES A;  2EIL H;  3LAJ A;  1GXP A;  1S7E A;  2V26 A;  2WY7 Q;  1LNW A;  2E1N A;  2VBZ A;  3WU2 C;  3OYJ A;  3CJT B;  2VAS A;  1E3H A;  2XRN A;  1YOV B;  5K5O A;  2JN6 A;  3JW4 A;  3JAM K;  1JUS A;  2ETH A;  3C1D A;  3NEU A;  5AIQ A;  5DEQ A;  3SDG A;  5CLS A;  3L2U A;  2NVX J;  2ELH A;  3L7W A;  1YRN B;  4N0B A;  5CVR A;  4AVZ A;  2JQ7 A;  5IPA A;  1JKR C;  1D5V A;  1LDK B;  5IT9 K;  2E2H J;  1ZRD A;  1U0J A;  3PSI A;  4BJ5 C;  2R5Y B;  4IKF A;  1P2F A;  2QSF X;  2HQR A;  2NVU B;  2VLA A;  1F36 A;  3QPL A;  5FKO A;  2DOF A;  2ME6 A;  3TOA A;  2JUG A;  3HYI A;  3OS2 A;  1UFM A;  5CKT A;  3P9K A;  1TT0 A;  2DBB A;  2W82 A;  4PDK A;  3HIF A;  3LMM A;  3H5R A;  5H6Q A;  1Z91 A;  2XPW A;  1YIO A;  2QVO A;  3OYH A;  2WAD A;  4AUX A;  1KGS A;  2HNH A;  3FXR A;  1LDJ A;  3CZ6 A;  2ZO4 A;  1MMA A;  1KZH A;  3H9J A;  1OYI A;  3EYI A;  2ISZ A;  3D5R C;  3U2R A;  2G7H A;  2L0K A;  2LYC A;  2QSG X;  1J9I A;  2P7V B;  2E1M C;  4M71 A;  4N4O B;  1LQ1 A;  2DJI A;  4A2U A;  2Z2S B;  5E3M A;  2CJJ A;  3OV8 A;  2QQ9 A;  3ZCO A;  2STT A;  5J4Y A;  5FRN A;  2Y9Z A;  4HZF A;  3G71 I;  3BP8 A;  2W1O A;  2QCO A;  2BVL A;  1OPC A;  3LSK A;  5JHU A;  3CCS I;  1ZR2 A;  2HZT A;  1LEA A;  1P7J A;  1WJF A;  1H9T A;  1Z7U A;  3BG7 A;  3GTJ J;  3VSL A;  4E7H A;  3RTR A;  5HNH A;  3HKZ A;  1HW2 A;  1N75 A;  2AXL A;  4RS8 A;  4AWX B;  3IKT A;  1VQL I;  2XDV A;  2AXT C;  4XLA A;  1EJ9 A;  3RKW A;  2X48 A;  4FX0 A;  1QVU A;  1ZRF A;  1HXD A;  4L5E A;  1OKR A;  4PGG A;  1U9N A;  2IA0 A;  3GTO J;  3C3W A;  3GXO A;  1Z6T A;  5DM6 F;  1G8X A;  1YJN I;  3HOU J;  4MFD A;  2VXD A;  5DCM A;  3PFY A;  3HHH A;  4UUV A;  4EM2 A;  3RKY A;  4IOA F;  4WX9 A;  1I6H J;  1IRF A;  1YX3 A;  1Z6R A;  4XRS G;  2PMZ N;  4KIC A;  3TO6 A;  3AL0 B;  4A3M J;  4CCJ A;  3QYE A;  1CGP A;  1FSH A;  3NAR A;  2BHZ A;  3D1N I;  4RLF A;  2B63 J;  4LK1 F;  4BHC A;  4B47 A;  4OIP F;  2FEZ A;  5FGM A;  2QUF A;  4BQN A;  3BG5 A;  2FXA A;  1R5I D;  4M3D A;  2FML A;  1S29 A;  1B8I B;  3CP2 A;  1XSD A;  1U9O A;  3ESW B;  1XCV A;  3FK6 A;  1ZGW A;  3UKG A;  1MJ9 A;  1K78 B;  1QU3 A;  1D0Z A;  1MMN A;  3MFK A;  3FXO A;  2E71 A;  4L9J A;  2X1D A;  1LFP A;  1OCP A;  1QRY A;  1MGT A;  2RNG A;  5HS7 A;  2ECB A;  1KQ0 A;  2WBM A;  3G1O A;  3SZP A;  5EGO A;  2XRO A;  4ESB A;  3EUH A;  4F3Q A;  1T33 A;  2XF5 A;  3ISP A;  4YIF A;  4LJZ F;  2EFW A;  3HUG A;  1S6L A;  3KEY A;  2YX7 A;  5F1J A;  4S04 A;  3CJQ B;  1YIJ I;  4OIQ F;  1MMS A;  5GAH J;  2L2O A;  3K4J A;  2HQN A;  1T6S A;  2DTZ A;  3IL2 A;  2YS9 A;  2Y9Y A;  4ON0 A;  5FJ8 J;  1SC7 A;  3WG7 H;  1TNS A;  1FC3 A;  5EDN A;  2F5C A;  4BAY A;  3IRQ A;  2VOP A;  2PBI A;  5ERI A;  1WJD A;  2RRE A;  3WGH A;  3S1N J;  4A3L J;  1G3T A;  2DOA A;  3ULQ B;  2HU9 A;  2W4S A;  4II3 A;  1QHG A;  1HCR A;  1FOK A;  3MZ8 A;  2F6C A;  2M0M A;  4P55 A;  4Y7N J;  1Y8R B;  2BEO A;  3I5U A;  1AKH A;  4BH9 A;  4KN4 X;  2JTV A;  2VJ5 A;  2BW3 A;  3A02 A;  1FEX A;  1BJA A;  2EIM H;  3KIO A;  2LK2 A;  1IO2 A;  2GZW A;  4WCG A;  3W2A A;  2FX0 A;  3ZQF A;  3EUK L;  1YW9 A;  2DFH A;  3ECH A;  4A3F J;  1SFK A;  5A2Q Z;  1A6Q A;  1UMQ A;  4HYE A;  5K5Q A;  3QOP A;  1CQT A;  6PAX A;  1DGW Y;  2F4I A;  2W48 A;  3F8F A;  3JTG A;  2H1K A;  5F1R A;  2K9Q A;  1RZ4 A;  5J4V A;  2NXN B;  1QPI A;  4Z6Y A;  1JE8 A;  5LEK A;  1VFC A;  2PN6 A;  2EA2 A;  2L7M P;  2OQR A;  3ZOB A;  1FBU A;  4EM0 B; 
#chains in the Genus database with same CATH homology
 2HXO A;  2Y30 A;  4A3C J;  2DMN A;  4A3K J;  2XB5 A;  4W97 A;  3HGG A;  1JKP C;  5EG0 B;  1GT0 C;  4IHY A;  5IP6 A;  2JA6 J;  1IG7 A;  4BY1 J;  3TP3 A;  2XSD C;  2R0Q C;  4FIS A;  5K7Z A;  2M34 A;  4RBO A;  4HNV A;  3Q3S A;  1VND A;  3S14 J;  2CUE A;  1IUF A;  2DA4 A;  2IAI A;  2L7F P;  2HQ5 A;  3LSR A;  1I3Q J;  1ORK A;  1MBG A;  1LFB A;  5C44 J;  1BA5 A;  1AHD P;  4C3I J;  2E19 A;  3W6V A;  1PUF B;  3S1R J;  3I4M J;  4A3J J;  1ITY A;  2OPT A;  3CQZ J;  5FLV A;  2WV1 A;  3S2H J;  1MH4 A;  2CU7 A;  1YRN A;  1WH7 A;  1MBH A;  1WCM J;  3ZQH A;  2ID3 A;  4ABZ A;  4B4C A;  2LFB A;  5GP9 A;  2R5Y A;  2TCT A;  3G1M A;  3HOV J;  1ZR4 A;  2HOS A;  3IH2 A;  1I50 J;  3BR6 A;  4BY7 J;  1JT0 A;  3OIO A;  3JRA A;  1ZTR A;  5J1R A;  3RZO J;  2EBI A;  1W0U A;  2LY9 A;  1LE8 A;  4XIC A;  4D5C A;  3HOY J;  2XGC A;  3BG3 A;  3PM1 A;  2L7Z A;  4A3E J;  1GDT A;  3FK7 A;  1OJL A;  4UUS B;  3HM5 A;  3CCY A;  1DU6 A;  2EH3 A;  1VF9 A;  1FIP A;  3BQY A;  4IHW A;  4XRS A;  5FKM A;  2LLK A;  3JRG A;  4JX5 A;  3JR9 A;  1A5J A;  2MSY A;  2MG4 A;  1Y1W J;  1Q1V A;  3WHC A;  1O4X A;  1ZK8 A;  5GPC A;  4A93 J;  2R93 J;  1WH5 A;  4XID A;  2EZI A;  4X1E A;  1RKW A;  4G12 A;  3HOW J;  4C3J J;  4DYR A;  2RAE A;  2DA7 A;  2ECC A;  1GUU A;  1RKT A;  2XB0 X;  2LKX A;  3Q0U A;  5JLX A;  2DA1 A;  3MN2 A;  1NK3 P;  2KDZ A;  1ETX A;  3B6A A;  4MLO A;  5EEA A;  5IOY A;  2X9D A;  1TWG J;  5K7F A;  3S15 J;  2QF7 A;  2ELK A;  2HDD A;  1BL0 A;  2NVY J;  5EYR A;  1APL C;  1WI3 A;  5F08 A;  1MH3 A;  1T56 A;  2HI3 A;  3GTK J;  2HXI A;  2OF7 A;  5IOZ A;  2O8K A;  2FD5 A;  3LSJ A;  1E3O C;  3K7A J;  5EGO B;  3QQA A;  5BNG A;  1ZKG A;  1HF0 A;  3A01 A;  2VKE A;  3ZQG A;  1ETW A;  4Y52 J;  5GPA A;  1Y1V J;  1K83 J;  4NDL A;  3HGY A;  3Q0W A;  4BBR J;  3QPS A;  5DS9 A;  3ZQC A;  1FIA A;  1UG2 A;  3BTI A;  1IDY A;  4FCY A;  1B8I A;  1GVD A;  2GM4 A;  1VI0 A;  3SFI A;  2IEK A;  4JYK A;  2K9S A;  3GBG A;  1RPW A;  2LR8 A;  2LVS A;  2DJN A;  2EQR A;  3BTL A;  2CUF A;  4B3A A;  1TWF J;  1K61 A;  3HOX J;  1SFO J;  1MSE C;  1AKH B;  5C4J J;  3S2D J;  1ETY A;  3LSG A;  5FKL A;  4I6Z A;  3BQZ A;  2N8G A;  2G0E A;  2ZB9 A;  2WAQ N;  3IH3 A;  2CQX A;  2VKV A;  5EZH A;  3Q0V A;  2D5V A;  2H8R A;  2M9H A;  1POG A;  1A6I A;  2MGQ A;  1BJZ A;  3JRI A;  3LNQ A;  3C2B A;  3MKL A;  2R5Z A;  1JUM A;  4UUT A;  1JTY A;  1TWC J;  2M8G X;  3ZQL A;  3PO2 J;  3M3Y J;  1IV6 A;  5J1U A;  5IP9 J;  4A3D J;  2DA5 A;  3TW7 A;  4W1U A;  4QSH A;  2XRL A;  2E2J J;  1UHS A;  3BTJ A;  2R7Z J;  3DEW A;  2ID6 A;  2XPV A;  2Y0S N;  2NOG A;  5M5Y J;  1JJ8 C;  5F0F A;  1B72 B;  2YU9 J;  2HOA A;  2JA8 J;  4M3F A;  4XK4 A;  1U8B A;  2JA5 J;  1W0T A;  1JJ6 C;  2GLO A;  3HOZ J;  2JK3 A;  2KT0 A;  3A03 A;  1JT6 A;  3LOC A;  1LFU P;  2E2I J;  5HOD A;  4AYB N;  1X2M A;  3OSG A;  1MSF C;  3RQI A;  1GV5 A;  4CYC A;  1ETK A;  1HDD C;  2GBY A;  3WHB A;  2DA2 A;  2XPU A;  3JRB A;  1EF4 A;  2EZK A;  4EEF G;  2FJ1 A;  1OCT C;  1MBK A;  1OFC X;  5IYC J;  3GTP J;  1GV2 A;  1RES A;  1IJW C;  3LSP A;  4A69 C;  3BR1 A;  3IV5 A;  3O8H A;  2VI6 A;  1S7E A;  5JLW A;  2JN6 A;  1JUS A;  3B6C A;  4M3G A;  3SDG A;  2EZL A;  1TC3 C;  1BW6 A;  3S17 J;  2NVX J;  1YRN B;  4FE7 A;  1X58 A;  3GTL J;  2VPR A;  2M2E A;  5IPA A;  1JKR C;  2NVQ J;  4IHX A;  5EG0 A;  2X6O A;  2E2H J;  4MO7 A;  1HOM A;  2R5Y B;  3JRE A;  4J19 A;  4DZP A;  2DN0 A;  4BBS J;  1U78 A;  1F36 A;  3QPL A;  5FKO A;  2ME6 A;  2R92 J;  2WB1 N;  1ZQ3 P;  4AC0 A;  2XPW A;  1XG1 A;  5IP7 J;  4AUX A;  1MBF A;  1LE8 B;  4V2F A;  3BR2 A;  1ETQ A;  1IGN A;  2LP0 A;  1PUF A;  2L0K A;  4A3I J;  4X6A J;  3S16 J;  2L9R A;  5E3M A;  2CJJ A;  1JUP A;  2COB A;  4MFE A;  3HBL A;  2MW8 A;  3BR0 A;  1AU7 A;  5F0C A;  3VPR A;  2Y9Z A;  1X2N A;  4MIM A;  1IC8 A;  2QCO A;  4JX4 A;  2DMQ A;  3JRC A;  5F04 A;  2DMP A;  3O8G A;  2LD5 A;  3H0G J;  1B72 A;  2JMW A;  1G2H A;  1ZR2 A;  3K2A A;  1NTC A;  1IRZ A;  4DYC A;  2Y31 A;  1P7J A;  1P7I A;  5M5X J;  3GTJ J;  1DU0 A;  2E1O A;  5E3N A;  4D5F A;  9ANT A;  3E7L A;  4DYQ A;  3FKI J;  3S1Q J;  1H8A C;  3GTM J;  2I10 A;  3DCF A;  2O7O A;  2X48 A;  1QVT A;  4A3B J;  4I76 A;  3M4O J;  1QVU A;  4L5E A;  1RR7 A;  4IEJ A;  1U9N A;  2DA3 A;  3BT9 A;  3GTO J;  4C2M J;  1JKQ C;  4D7M A;  3HEF A;  2JA7 J;  4GFB A;  5M3F J;  4UUS A;  3HOU J;  4FTH A;  2IBD A;  4MFD A;  4D7N A;  1ENH A;  2FQ4 A;  3GTG J;  3JRD A;  1I6H J;  2NS7 A;  4QIW N;  2O9L A;  1JTX A;  3A01 B;  1ETV A;  3OOU A;  4M6V A;  2PMZ N;  5J3L A;  5DTD A;  4XRS G;  4DW6 A;  3TED A;  4A3M J;  2NVT J;  4QTR A;  3JRF A;  3NAR A;  5C4X J;  1WGX A;  5FKK A;  3D1N I;  3MVP A;  1FTZ A;  3S1M J;  3L1P A;  1D5Y A;  3HDD A;  2B63 J;  1BW5 A;  2XGE A;  4BXX J;  2YUS A;  1Z0X A;  3H3V K;  2P81 A;  3BG5 A;  4JP0 A;  5F27 A;  4M3D A;  1B8I B;  3BG9 A;  2DA6 A;  5FKN A;  3GTQ J;  1U9O A;  3FK6 A;  1ZGW A;  5M3M J;  3UKG A;  1XC5 A;  4IHV A;  3HB9 A;  3I4N J;  3CMY A;  1ETO A;  4C3H J;  3IH4 A;  1MBE A;  1OCP A;  2DMT A;  3OSF A;  3G1L A;  1QRY A;  2K40 A;  5K7H A;  2EZH A;  2ECB A;  4DZJ A;  3G1O A;  5E3O A;  5EGO A;  1T33 A;  5EZG A;  5EF6 A;  2R5Z B;  5IYB J;  1Z77 A;  1MBJ A;  4B1R A;  5F1J A;  4M3B A;  4RDU A;  2NS8 A;  3PO3 J;  1JKO C;  4XRM A;  1IDZ A;  2DTZ A;  3CDL A;  5M5W J;  2YS9 A;  2Y9Y A;  2JJ7 A;  1MNM C;  5FJ8 J;  1H89 C;  5J1Y A;  2ME0 A;  2HYJ A;  5EDN A;  1NK2 P;  4LOC A;  3HKZ N;  5C3E J;  2AO9 A;  1SAN A;  3S1N J;  4A3L J;  2CRG A;  2AHQ A;  2CQQ A;  3BR5 A;  2K9N A;  1FTT A;  3NAU A;  1HCR A;  5FLM J;  3TW6 A;  4Y7N J;  3BR3 A;  4JX6 A;  4V2G A;  4A3G J;  1AKH A;  1R9T J;  2M0C A;  5IYD J;  3A02 A;  2HOT A;  1FEX A;  5E3L A;  1WPK A;  3FIW A;  2LK2 A;  1RET A;  4S0H B;  2TRT A;  4M3E A;  2XGD A;  2JWT A;  2VUM J;  2FX0 A;  3ZQF A;  4CYC B;  3TP0 A;  3FIS A;  3BTC A;  4A3F J;  1FJL A;  3RKQ A;  1UMQ A;  4FE4 A;  3SJM A;  2LTP A;  1CQT A;  1HDP A;  3RZD J;  1H88 C;  2W48 A;  2DMU A;  2H1K A;  2K9Q A;  2Y2Z A;  1TWH J;  3F0C A;  5F0H A;  3JRH A;  1HLV A;  4BKX A;  1QPI A;  1XS9 A;  1VFC A;  2L7M P;  1JGG A;  1TWA J;  3ZQI A;  3ZOB A;  1F43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...