2STWA

Solution nmr structure of the human ets1/dna complex, restrained regularized mean structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correction of the NMR structure of the ETS1/DNA complex.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2stwA00
1W4MA 1AWCA 4LGWA 1Z6TA 3E6MA 1I5ZA 4KYWA 4HV6A 2MLGA 3KP7A 5FD5A 1SD6A 3ZMVA 3F23A 1Z05A 4LMYA 4AVPA 3ROUA 3O2PE 1IW7F 1T0FA 2EK5A 4U88A 3DXJF 1KQ8A 2ZMEA 5HDKA 5DEQA 4KA4A 5LHIA 4I02A 1BIAA 2L01A 2VN2A 1R58A 1G3SA 1LDJA 3JAMK 2PG4A 1R1TA 3P9KA 3HHGA 3HRTA 1O7FA 3KP6A 4KMFA 2YU3A 4MQ9F 3C18A 4A0YA 2RKHA 1BI0A 3RKYA 2OA4A 1H9TA 4A5MA 2WTEA 1DPRA 5CVVA 3V8KA 4L9NA 1BI2A 3V7RA 5D6FA 1SFEA 2H27A 2GAUA 2E7WA 5LBQA 5F64A 1LNWA 1T39A 4GO1A 3FMRA 4G7OF 3AAFA 1TW3A 3Q9SA 4MEYF 4G6QA 2F2EA 3RDIA 4ENJA 3I0TA 3RKXA 3MZHA 1Z6RA 4UVAA 5HVQC 2IA2A 4CXFA 2VOOA 1XN7A 3HSRA 2D45A 4A2UA 2UZKA 5AIPA 3HIFA 3V4GA 1IXCA 5D4SA 1E2XA 1UHWA 4WXHA 4A12A 2LSOA 3S2WA 2CQKA 4HAMA 3FX3A 2XAGA 3E6BA 2EFWA 2VOPA 3ULQB 1Z1DA 3HOTA 4Y17A 3ERED 3KZZA 5TRDA 3GFLA 1BI3A 3E5XA 4JK1X 1UCRA 2FMYA 1BBYA 3I4PA 3ZMDA 3QP5A 3RJPA 5DV5A 1FWZA 3BROA 4M9ZA 4LJZF 3T1BA 3G73A 5HLGA 2RV8A 1I6XA 4ON0A 2W24A 4UNOA 3ML6A 4KT5C 1FP1D 1YW7A 3ECOA 4HV5A 2GXBA 2BGCA 1STZA 2M8EA 3FXRA 3IWZA 3V8LA 2MH9A 3FWEA 3G3ZA 3KZYA 4MNUA 2YR2A 5D6EA 2NNYA 2V1XA 4L0ZB 2V9VA 3EQLF 2V79A 2KJBA 3CTAA 1DP7P 2CWEA 2IW5A 3KP2A 2DFIA 4ESJA 5LHHA 3RYRA 3Q9VA 1ZG1A 5FO5A 1GXQA 4D0PA 2HFHA 2ZO4A 2MBFA 1Z91A 4P9FA 2D1VA 5LEJA 3RKWA 2FNAA 4M74A 4MTDA 4Y15A 5F6FA 3V7CA 4Q48A 1BC8C 2VC1A 2DO7A 1EV7A 1J5YA 3IRQA 4RB2C 2LF8A 4N9HA 2OZ6A 2BV6A 1WKMA 2VC0A 4KN4X 4GCVA 3WTWC 4BAYA 2M45A 4HDUA 2R3SA 1RUNA 1USSA 2EFNA 5HS9A 4RB1A 2CG4A 1K79A 1TQIA 2ZXJA 1KU3A 3LAPA 3C7JA 1PP8F 1R7JA 1XCVA 3E3VA 4HX4A 1E17A 3QP6A 3R0JA 1D8JA 2ZJ2A 4CYDA 5JFRA 4P5OA 5L3DA 2MA3A 2EJRA 4YFNF 2M5WA 4XSXF 3F6VA 2Q0OA 2VONA 4WWCA 2ESHA 3ZMZA 2DQLA 2IA1A 2FQ3A 2E1CA 4Q5SF 2NNNA 3IC7A 1FOKA 2RQPA 3LQRA 4IRHA 3CLOA 3SHFA 1YW8A 1JHHA 2PQ8A 1ZG3A 2HYFA 2NS0A 3IWFA 1MGTA 2UXNA 1B4AA 3HTSB 2P5KA 4OOIA 4XRFA 1Z7UA 3J7AO 1ZG5A 2D1HA 1QPMA 1QQIA 2FXAA 1XGNA 4ZYGA 3EETA 4A6EA 2W25A 2JTVA 5E18F 2IVMA 4I0BA 1MDMA 5FGMA 1K78B 1KU9A 3O3KA 4RGUA 1S8NA 4RGXA 3CUQB 4Y13A 3HRMA 4ESBA 3LAJA 1GVJA 1BJAA 4ASNA 1LVAA 1U5TA 3D5LA 3F72A 2VODA 2EA4A 2Q8KA 1O7LA 3FZVA 4IXAA 4IHSA 3BDDA 4RGSA 4KNYA 4HQEA 3CUOA 2MD5A 2Z9OA 4WXDA 4MHGA 4F7ZA 2VBZA 3BOQA 1ON2A 3VFZA 1XDUA 2OQGA 2HZTA 2FF4A 4LK1F 1FBUA 3K9TA 1SMYF 3MCZA 4IRIA 1YTYA 1P92A 3ZMTA 3IKVA 1F9NA 2P7CB 4IVNA 3LSTA 5KK1A 1MJ9A 5JI6A 1HSJA 1CF7A 5K5QA 2YX7A 3RYPA 3EDPA 1SFXA 2FSWA 2ELHA 1KYZA 2HKXA 1YS7A 2FOKA 2H94A 3WGGA 6PAXA 2HR3A 4BXUA 2HTSA 3GEZA 1YLFA 2QBYA 3T0YA 5H6RA 3DQVC 1EH7A 2L54A 1ZGAA 5AIQA 1Z9CA 4E70A 1MZBA 3H3UA 4RAYA 3TO9A 1ZRDA 5DCMA 3L00A 1QGPA 3MZYA 2H6CA 1ZN2A 4EMSA 4DQ2A 1U8RA 1J2XA 5FD6A 3WTVC 3COAC 1B6AA 5HS8A 1FC3A 4I98B 4HX8A 3VOEA 2XGXA 5HDGA 2G7UA 5ILVA 3MFKA 3LWFA 2XAQA 5K1YA 4CZZA 3NEUA 3GZ6A 1T6SA 1S7AA 1C0WA 5CYVA 4ESFA 5HLIA 5HOOA 1BOAA 3HUGA 3GLXA 4L18B 1QZZA 1W7PA 5CLSA 4N9IA 4LK0F 1KQ0A 5ILUA 3GO5A 2A6EF 4OIOF 4K2EA 4ENKA 3L9FA 2NRAC 3P9IA 5CVJA 3RPUA 5E20A 2CYYA 4GGGA 4Q4ZF 3I5UA 5ICCA 3VODA 2KIFA 1ZRCA 3LA7A 3TO7A 2Z99A 3BJOA 3HYIA 5K5OA 5ICEA 1KU7A 3I71A 4MQVA 1I27A 3W6JB 5JR3A 1Y0UA 2VT3A 1MD0A 1PP7U 2WWYA 1MJAA 4G7HF 2COMA 4EVIA 4RB0A 3F8NA 2M1BA 1U5TC 4G8XA 2UXXA 2EB7A 3F21A 4FX0A 1TBXA 4G7ZF 2BYVE 2QWWA 3F8FA 2P5VA 4HLYA 1XGSA 1JE8A 3R61A 1D5VA 1G3WA 4KDPA 2EFQA 4ZH4F 3I64A 4M73A 1W5TA 2QQ9A 5L3BA 4RB3C 2P6TA 4XLPF 1HQCA 2A6HF 2JSCA 4OINF 2BE5F 3LFKA 2MH2A 4I2OA 3JTHA 2H09A 1U6GA 4FX4A 1JXSA 4GYGA 3E6DA 2OAZA 3ZN0A 3CJNA 4N0BA 5BPIA 1S6LA 4YIFA 3DFGA 3N4MA 1R00A 3C1DA 3KEOA 2J5OA 2VXZA 4P9UA 4BHPA 4EJWA 2GA1A 3ECHA 1B1BA 4LLNA 2YPRA 3Q5FA 5CVUA 2GZWA 1OYIA 1TQPA 4ETSA 2F5EA 2K4JA 5L3EA 4O6JA 3WTSC 4U0WA 4CDGA 5IT9K 5ERIA 3J80K 4UVCA 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 3GUDA 2DPDA 3MEXA 5BOXA 4O5VA 3FM3A 1P4XA 4Q47A 4WX9A 1ON1A 3IL2A 1RNLA 4H0EA 1P6RA 5HDNA 2ZFWA 1J59A 1FYLA 4LD5A 4I09A 2CFXA 2H6BA 1G4DA 1FBQA 2NYXA 3F8CA 3GZ5A 3MAJA 5AONA 2F5CA 1EH6A 2ZBKA 4IPAA 2W57A 2PMUA 2CW0F 3R6SA 2XRNA 3H3ZA 3DP7A 1IN4A 2XHKA 1Q1HA 5LGTA 1ULYA 2M30A 3GVAA 4RAZA 3K1MA 1ZRFA 1DPUA 2VBWA 1FBSA 1IN6A 2DU9A 4UV9A 2EWNA 2EFOA 2PFBA 2OQRA 3P9CA 3PQJA 1FPQA 2K86A 2FBKA 3IHUA 3E97A 1L3LA 2ZKZA 1HW1A 1R5HA 5DCMB 5IT9Z 2ZNYA 4BHBA 1V3FA 4L5IA 2L3DA 2FRHA 2XAJA 1J9IA 1SMTA 5FFXA 3WTZA 2RNJA 4UHTA 4BQAA 5E1ZB 1IAWA 4KUMA 5ICGA 2Z33A 2P7VB 4HQMA 2HQRA 4EM1A 1LB2A 3QU6A 3WTUC 4M71A 3JSPA 1J0RA 3REOA 2R7DA 2FBIA 5BPDA 1RZ4A 1KU2A 2VE9A 1R1UA 1ZAOA 3HRSA 3T8TA 1RIOH 5HLHA 1F5TA 2UWMA 1KYWA 3K0LA 1XSDA 1D3YA 2GQQA 1PDNC 2OU2A 3JAMZ 5L3FA 1IUYA 1T38A 3KETA 1FT9A 1GHCA 2FEZA 2JPBA 2GWRA 3TDUC 1U78A 1ZARA 4OIPF 3V7SA 2XKOA 4XLNF 2A68F 4KIBA 2HGCA 3HSFA 1S29A 4B8XA 2EV0A 2VT2A 5LGUA 3LA2A 4HZFA 2XROA 5FB2A 3BP8A 3QPHA 3BJ6A 5JHUA 3SQNA 1G6NA 2VBYA 3W6KB 1UFMA 4M9XA 3GFJA 4HW0A 2ZMEB 5KVRA 2G9WA 1DUXC 2DT5A 4OMYA 3OOPA 2DI3A 2L4MA 1IN5A 4TV7A 3K2ZA 3F8BA 2FU4A 1RI7A 1BN5A 4MGRA 1R36A 1JGSA 1FYKA 3PQKA 2IJLA 4ENNA 1XB4A 3EYYA 1UHMA 3WGHA 1K78A 2K27A 4EGZA 3KP5A 1FLIA 3RPQA 2FE3A 1A04A 1CGPA 1IXSB 2HYGD 4EM0B 1B9NA 3WTTC 2PN6A 3T8RA 3FM5A 3GFMA 3ZMUA 1GXPA 2TDXA 5H20A 3E5UA 3FXQA 5DDGA 3CO6C 1XCBA 4PCQA 2HTJA 2FBHA 1U2WA 2Y48A 1DDNA 3CUQA 3H92A 4HOBA 2C6YA 2QQBA 4HX7A 3RTRA 5BQTA 4AWXB 3BPXA 3WE3A 1XGOA 5D5VB 1ZYRF 3JSOA 1SD5A 5E8GA 3BPVA 4S04A 1O3SA 2DTRA 4L9VA 4MEXF 4OMZA 1CF7B 5DD4A 3I54A 4AIKA 1I1GA 4GXOA 2PLYA 1IN7A 3O6BB 1FZPB 1SFUA 1QBJA 3ZN1A 5D5XB 3F6OA 5K5RA 2V1UA 4U7DA 2X4HA 3EYIA 4NQWA 3GWZA 5D8KB 5ICFA 2HWVA 2L02A 1ZLJA 3KP3A 1YG2A 2E7XA 3K1PA 2YSRA 1PUEE 5DUIA 4QLCU 5D5WB 3TOAA 4YIIA 2LDUA 2JZYA 2E1NA 4P96A 3I58A 1MDMB 1S3JA 3TGNA 4OIQF 2RN7A 1BC7C 4KMUX 1MJBA 1G3YA 2O0YA 4U7BA 1TNTA 4YG2F 2Z5UA 5FFZA 3U9GA 2FNPA 2F5DA 3TOBA 4ZYDA 3KEQA 5LGNA 1W7PD 4KIGA 4R1HA 5A2QZ 1SAXA 3DEUA 5BMZA 1YFHA 2QLZA 3M7GA 5CJ9A 3WU1B 2D2WA 2J5PA 3VB2A 2AXLA 3TKYA 1YQAA 5L3CA 1WRJA 3WTYC 1YW9A 5E1WA 4EV0A 3ZQ7A 4A0ZA 1NHAA 1H0MA 1LJ9A 2A61A 4UVBA 4IHTA 1WWXA 1JHFA 5EEGA 4G94A 1HW5A 1TTYA 3EUHA 3J80Z 3U2RA 1I1SA 2K4BA 3B73A 2EV6A 3KP4A 4KN7X 1BIBA 2BBYA 1XGMA 1FSHA 3BY6A 3MWMA 4UXNA 4EJVA 2O3FA 2O8XA 2HOEA 1G3TA 4HBLA 1WQ2A 2GXGA 4I7HA 2A5YB 1HKTA 1R5GA 3DPTA 4XSZF 4UV8A 1OPCA 1R1VA 3FMSA 1B9MA 4M6YA 1U5TB 5FLXK 2W85A 4CICA 2ZCWA 5J8CA 2ACJA 2XKPA 3R4KA 2ISYA 5L3GA 2PI0A 4M72A 1YS6A 2O6GE 2MLKA 2XAHA 4G6DA 4EM2A 1VTNC 3L2CA 4ZZLA 2AS5F 4LFUA 2QM3A 1SD7A 5LEKA 3E5QA 4A6DA 1F4KA 1P4AA 4M6XA 2FMLA 5LRSA 2HEOA 2IRFG 4BNCA 3GFIA 4UUVA 2XASA 4RGRA 4PGGA 3ZPLA 5DUKA 1HBXG 1EH8A 2JT1A 5DCFA 1O3RA 1ZREA 1H9GA 3M8FA 2XVCA 2P4WA 3WODF 3M1EA 2HDCA 4A0XA 4LG0B 4PZJA 4JQFA 2JRTA 5J8FA 2PJPA 3QPTA 5HS7A 5FLXZ 1IZ1A 4LB6B 5JVTA 2A3SA 1LDKB 2DPUA 3ELKA 3MQ0A 4U0VA 1AOYA 2MC3A 2DQRA 3CUQC 3KCCA 4I0AA 3I59A 2W84A 4NHJA 4LG0A 2EV5A 1T2KA 4EQQA 1FX7A 1IN8A 1XMAA 2R7FA 2CSOA 2ZNZA 1HSTA 4U0YA 5LLQA 1ZHFA 2YX4A 2STTA 2ESNA 2QVOA 4KICA 4ENMA 2QUFA 1WSUA 1XDSA 1OMIA 2OBPA 1XD7A 2PMHA 4FHTA 3OV8A 5DYMA 1K6OA 3FXUA 2HKOA 5H6QA 3SZTA 4PDKA 1FY7A 2WC2A 3L7WA 1ONVA 1OYWA 1T98A 5E8IA 4ZZDA 4S05A 4ZYHA 2KIMA 2Z3YA 5D4RA 5ED4A 2STWA 3HTUA 1R23A 5ILSA 1KQ9A 3FF5A 4LLLA 1LDDA 2RC4A 3CDHA 3M9AA 4JBAA 4LB5A 2K02A 2A69F 1KGSA 2B0LA 3F8MA 3CO7C 2F5FA 2ADUA 1J7KA 1USTA 1WI9A 1TQMA 3R60A 1YO5C 3TO6A 2EA2A 5D8LB 1TW2A 3JW4A 4EGYA 2EFPA 2NAZA 2QBYB 2OZUA 5BS6A 1TLHB 3QU3A 2DBBA 2X0LA 3SZPA 2DK5A 4EJTA 3DF8A 4XBFA 1FNNA 3SFZA 3U1DA 4B09A 2V6CA 4IF4A 5A2QK 1HKSA 1YIOA 1XSXA 4R8HA 5IT3A 4RS8A 4MTEA 3T5XA 2XIGA 2DW4A 3HSEA 3GYHX 5DD8A 2LF7A 4HA8A 3K1NA 3IRRA 2RGVA 3PFIA 3ZMSA 2HQNA 4L0YB 2IPQX 3WG9A 1OR7A 1SD4A 4L9TA 1REPC 4EJOA 2VE8A 3QOPA 2O61A 1S7OA 4CHUA 1ZGJA 1IF1A 3LA3A 4P55A 5E1XA 3JTGA 1P4WA 3ISPA 3RIRA 3BWGA 4G9YA 2LNBA 2QZ8A 1ODDA 3D0SA 4O3MA 1QZYA 4WXCA 2GA2A 3WU0A 1X3UA 4DNCA 5D5UB 2KRFA 5E17F 2M87A 5F1RA 3VEPA 3BJAA 5CVRA 3ZP5A 2QYOA 1W7PB 3N97A 1LEAA 4PGHA 3DKWA 1LEBA 2IT0A 4WF2A 2BEOA 2Y0MA 3NRVA 4L5JA 2IP2A 3TQNA 3HRUA 3ABUA 2LKPA 4AD9A 2PEXA 4IRGA 3F3XA 4HF1A 3WGIA 3FMQA 4YFKF 4BHCA 3J81Z 2KJCA 4AIHA 4EJUA 3P7NA 1KA8A 2DAOA 1ZLKA 3I59B 3F22A 4NB5A 4OIRF 1P2FA 3WE2A 4R79A 3HHHA 3K69A 2RVCA 2WV0A 5EEHA 3KFWX 1HKQA 3KLOA 4HF2A 4A5NA 1HW2A 2DLLA 3L09A 2QQAA 3GXOA 4Z2YA 2L4AA 3SXYA 4HDVA 2ISZA 3GX4X 1MKMA 2KKOA 4QWQA 4CGZA 2IA0A 4HF0A 4HLXA 2RDPA 1IRFA 4KFCA 3E6CC 1O57A 2O03A 1W5SA 3DV8A 1BM9A 4L9JA 2CGPA 1YYVA 5CVIA 1FSEA 1LQ1A 2JPCA 2OD5A 2P8TA 2K7LA 3QRFF 2XAFA 2V1DA 1XMKA 2CO5A 4HYEA 1IRGA 3QAHA 4WCGA 2Q2EA 2PBIA 4GYIA 3B02A 3LQQA 2QENA 3KE2A 1ZH5A 4M9SA 1V4RA 3M8EA 4CO8A 3DPLC 4LLGF 2P5LC 2A07F 1O3QA 3KLNA 3V8JA 4IJAA 1U3EM 2Y75A 1F1ZA 1K7AA 3TDZC 1L0OC 2KIUA 4I01A 4WK8F 1FP2A 2DK8A 4FT8A 1IXRC 3C3WA 4BH9A 2P6SA 3BZ6A 1J75A 4ZYEA 1RUOA 1OKRA 5LRRA 3WTXC 3FHZA 2GIVA 3GW2A 1R22A 1D8KA 3I53A 1HXDA 1UB9A 1FYMA 4BYYA 3IKTA 1BI1A 5TJJA 5LHGA 4AIJA 2FA5A 3R0AA 1XSVA 4KIFA 3J81K 4OU0A 1B59A 4YFXF 2XV4S 1QO0D 1QNTA 2XUBA 3NQOA 5J6XA 2ETHA 2HS5A 2VBXA 1TNSA 1O3TA 3ABTA
chains in the Genus database with same CATH superfamily
2NRAC 1W4MA 1AWCA 4LGWA 1Z6TA 3E6MA 1I5ZA 2JWTA 4KYWA 4HPQA 5CKTA 4KT6A 5DS9A 4HV6A 3GTJJ 3A2KA 2MLGA 4ZTJA 1SAUA 4N4OB 1KZHA 3KP7A 1NG7A 4HNVA 5FD5A 4PJLA 3GLLA 3E1SA 1SD6A 5B66C 2CMPA 3ZMVA 3F23A 1Z05A 4PFOA 4LMYA 4BY1J 2L7MP 4RBOA 4AVPA 3ROUA 3O2PE 1IW7F 2K3PA 5CPRB 1T0FA 2EK5A 4U88A 2KLOA 3DXJF 1KQ8A 2ZMEA 5HDKA 5DEQA 4B1RA 4KA4A 4KISA 4AIDA 4PJMA 5LHIA 4I02A 2B7EA 3LNQA 1BIAA 2L01A 1EJ9A 2DOEA 2VN2A 3O8GA 1WJEA 4EATA 1HA8A 1R58A 1G3SA 1BR4A 1LDJA 3DLAA 3JAMK 2CQQA 2PG4A 1R1TA 2NOJB 3OL3A 1YIJI 3P9KA 1RKTA 3HHGA 2V9PA 3IH4A 3HRTA 1O7FA 3KP6A 4KMFA 2YU3A 1X19A 3HB9A 4MQ9F 3C18A 4B4CA 4FASD 1OCOH 1POGA 3BG5A 4A0YA 2GXAA 2HPMA 2RKHA 1WJCA 1BI0A 3RKYA 2AQEA 4ZYAA 2OA4A 4DBQA 1H9TA 2XSDC 4A5MA 5J1UA 1JTXA 4BUPA 4E7KA 2WTEA 1BL0A 1DPRA 5CVVA 3V8KA 4L9NA 2R92J 3CCJI 1BI2A 2E60A 3PIOF 3V7RA 5D6FA 4CCJA 4XLFA 4A3EJ 2VUMJ 1SFEA 2EBIA 2H27A 2GAUA 1FOYA 4JYKA 2E7WA 3JRBA 5LBQA 5F64A 1LNWA 2L9SA 3CMYA 4GO1A 3FMRA 1T39A 4G7OF 1QHHD 1E0EA 3CCYA 3AAFA 1TW3A 2HQ5A 2MW8A 3Q9SA 4HG2A 4MEYF 4G6QA 3GBGA 2F2EA 4PUSA 2EPFA 4NC7A 3RDIA 2K5CA 4ENJA 2R7VA 3I0TA 2XGCA 3IUOA 4E7HA 3RKXA 2R5YA 1Z6RA 3MZHA 2JUGA 3ASNH 2EH3A 2XPWA 4UVAA 3LFUA 2VPRA 5HVQC 2IA2A 4CXFA 1R4MB 5M3FJ 2VOOA 5J1YA 1XN7A 3HSRA 5HLTA 2F4OB 3OYDA 2D45A 4NBQA 4A2UA 2UZKA 3AG2H 5AIPA 1AKHA 1GV2A 1LE8B 3HIFA 4LIVA 2TRTA 4QSHA 1G8XA 3V4GA 1ETKA 1IXCA 5D4SA 1E2XA 3AG1H 4A3CJ 1UHWA 4WXHA 3DBHB 1PUFB 1Z3YA 4A12A 3QWLA 2JK3A 2LSOA 4B43A 3S2WA 1FTTA 1XPXA 4BY7J 2CQKA 4HAMA 4NQWB 2H1LA 3FX3A 4NC6A 2XAGA 3E6BA 2EFWA 2VOPA 5FKNA 4D7NA 3ULQB 1Z1DA 3HOTA 3QYFA 3RPUD 3S1RJ 4Y17A 9ANTA 3V42A 3HBLA 3ERED 3KZZA 4M3FA 3PIPF 5TRDA 4JP0A 2GOMA 3GFLA 2HPIA 2DYRH 1RKWA 1BI3A 3E5XA 4PSWA 4JK1X 1VQPI 4XLHA 1ZR4A 4PJNA 5F0FA 4DIQA 1UCRA 2FMYA 2AXTC 1BBYA 3I4PA 4IX7A 3ERMA 3ZMDA 3QP5A 3RJPA 1LFUP 5DV5A 1FWZA 2IEKA 3BROA 4XN0A 1YOVB 4M9ZA 4LJZF 3CCUI 3FHNA 3M1CA 1R5ID 3T1BA 3HDDA 1YX5A 3J7AY 4DYQA 3G73A 2JMWA 5HLGA 3I56I 3JRCA 1IC8A 2RV8A 1I6XA 4ON0A 1VQ5I 2KRHA 1JJ6C 1WI3A 2W24A 5EG0B 4UNOA 4XK4A 4OAZA 1R9TJ 3ML6A 4KT5C 4UUTA 1FP1D 1YW7A 2PMZN 3ECOA 4HV5A 2GXBA 2BGCA 1STZA 2M8EA 3FXRA 3IWZA 1G2HA 3V8LA 3H35A 2MH9A 1MW7A 1E3OC 3FWEA 3HG9A 3G3ZA 2K9QA 3KZYA 4A3BJ 4MNUA 4BJ5C 2YR2A 5D6EA 2NNYA 4A3LJ 2V1XA 2E34A 4L0ZB 2KZVA 2NXNB 2RQQA 3K2AA 3TW7A 3JR9A 1O4XA 1RR8C 4D9JA 2QQ8A 1MNEA 2V9VA 2WB1N 3DEWA 3Q0VA 2GLOA 2KDZA 3FKIJ 1GVDA 4XL9A 2ME6A 4KJZA 1B72B 3K7AJ 3EQLF 2V79A 4BGDA 1D0ZA 2PJRA 2DDAA 3BZCA 2KJBA 2X1EA 3CTAA 2DTZA 1DP7P 3OS2A 4FQGA 2LREA 2CWEA 2IW5A 3TL4X 2EIJH 2Q1ZB 4B47A 3KP2A 4RM3A 2R7SA 4BDZA 3CJTB 2VIXA 4CH7A 3H0DA 3BTIA 3WHBA 5M5YJ 2DFIA 3LL7A 2IXSA 3JRGA 4ESJA 2DCEA 2M7AA 5LHHA 3FXMA 3RYRA 5GAHJ 5FJ8J 2QSHX 1X1AA 3Q9VA 1TT0A 1ZG1A 3PO3J 3EPZA 5FO5A 1D5YA 1Y1VJ 2BHZA 1GXQA 4I6ZA 3E0JB 4D0PA 5EDNA 2HFHA 2ZO4A 3CCRI 2MBFA 1Z91A 4P9FA 2D1VA 5LEJA 4YIRX 5F27A 2ZJRF 1W0UA 2QCOA 3A4CA 1Y39A 1V5FA 2DA2A 1H89C 4BXXJ 1VQKI 1MMGA 1ZQ3P 3RKWA 2NVXJ 2FNAA 4M74A 2M4GA 1X1BA 2O8KA 4MTDA 4Y15A 5F6FA 3V7CA 2IGKA 4Q48A 5EGOB 2WAFA 4LOCA 1BC8C 2VC1A 4HNTA 2DO7A 3NWTA 2B9SA 1EV7A 1J5YA 3IRQA 4RB2C 2PX9A 2KISA 1Y56A 2LF8A 4N9HA 4A69C 2OZ6A 4FTHA 2JA2A 2BV6A 2I10A 5C44J 3W3CA 4H4KC 4XLEA 1WKMA 2MABA 2VC0A 3BG9A 4A3KJ 4KN4X 1IRXA 4GFBA 1WCMJ 4GCVA 3WTWC 5DTDA 3PNVA 4BAYA 5EF6A 3IAM2 2M45A 3HOZJ 3H9QA 5DM7F 1IV6A 4HDUA 1UZCA 2R3SA 2R4GA 1RUNA 5FKMA 2LOOA 1USSA 2EFNA 5HS9A 4RB1A 2CG4A 1K79A 4A3MJ 4BJ6C 2R7TA 1TQIA 2ZXJA 1KU3A 2DOFA 3C7JA 2E71A 3LAPA 1PP8F 1R7JA 1XCVA 3E3VA 4HX4A 2D5VA 1E17A 3QP6A 1N25A 3R0JA 4CCNA 2JA6J 1D8JA 2ZJ2A 2X6XA 3OIPA 4CYDA 5JFRA 1GLNA 4P5OA 2R5YB 3KX2A 5L3DA 1A6IA 1JT0A 1VQNI 2MA3A 1K6YA 2EJRA 2NS7A 3A01B 4YFNF 4NUBA 3VSKA 4Z6YA 2M5WA 4IO9F 4XSXF 3F6VA 2Q0OA 2VONA 3AG3H 4WWCA 2ESHA 4J19A 1LUJB 1D1AA 3ZMZA 3S3NA 2DMPA 3F9KA 2DQLA 2IA1A 2FQ3A 2E1CA 4Q5SF 2NNNA 2K9NA 3CC2I 3IC7A 5IYBJ 2RQPA 2DODA 5FKKA 3LQRA 1FOKA 4IRHA 1IDZA 3CLOA 4CYCB 3SHFA 1YW8A 5IYDJ 1JHHA 2PQ8A 1ZG3A 3GTPJ 2HYFA 2NS0A 2EIKH 3IWFA 4DZJA 3IAS2 1R49A 4AUXA 1MGTA 2UXNA 1B4AA 3AL0C 3HTSB 2P5KA 4OOIA 5FRNA 1RETA 4XRFA 1X3WB 1Z7UA 3J7AO 1JGGA 1ZG5A 2JA8J 3HL2A 1QA6A 5IYCJ 2D1HA 3DTEA 1QPMA 4YRVA 1QQIA 3OIQA 3PL8A 2FXAA 3HGGA 3S93A 1XGNA 1ZELA 4EEFG 4ZYGA 3EETA 4BQNA 4A6EA 4X0GA 4U87A 3JCUC 2W25A 2JTVA 5E18F 2IVMA 4JX5A 2XF6A 4I0BA 1MDMA 5FGMA 1K78B 1KU9A 3O3KA 4ZTFA 2OJED 4RGUA 5B1AH 1S8NA 2EZHA 2RAEA 3CMAI 2R5ZB 4RGXA 3CUQB 4M3EA 4Y13A 2IS4A 3HRMA 4ESBA 5J4YA 3LAJA 1GVJA 5C4JJ 1BJAA 4C9YA 4ASNA 1LVAA 3F72A 1U5TA 3D5LA 2VODA 3DWLE 2EA4A 2TCTA 2Q8KA 4BJTA 1D1CA 3RQ4A 1O7LA 2LBFB 3FZVA 3MKZA 3A03A 4C2UA 4IXAA 4IHSA 3BDDA 1IDYA 4UB8C 4RGSA 4KNYA 4HQEA 1Y8QB 2UV1A 2MD5A 3CUOA 3GTQJ 2Z9OA 4WXDA 3DBLB 4MHGA 2HNHA 2VBZA 3SFIA 4F7ZA 2QGUA 3BOQA 3HKZA 3HJEA 1ON2A 3VFZA 3ZQHA 1XDUA 2OQGA 2HXIA 3HOUJ 2IBDA 1DGRM 2HZTA 1T0FC 2FD5A 1WJFA 1FBUA 2FF4A 2OCEA 3K9TA 4LK1F 1K83J 2LKXA 1YJ9I 1SMYF 3MCZA 1V5EA 4IRIA 3B6AA 4DZPA 1YTYA 1A35A 1P92A 1VQ7I 2M2EA 3ZMTA 3IKVA 1F9NA 2GIZA 2WADA 2P7CB 1VNDA 4PK4A 4IVNA 3LSTA 1YRNA 5KK1A 1MJ9A 1VQMI 4C3IJ 1T33A 4XRMA 1SFOJ 5JI6A 1HSJA 3I55I 1CF7A 2HOSA 4RMNA 5K5QA 2VXDA 2YX7A 3RYPA 5GPAA 3EDPA 1Y0NA 1SFXA 4DW6A 2ELHA 1KYZA 2FSWA 5JHFA 2HKXA 1YS7A 2FOKA 3CCEI 2VL8A 2H94A 3WGGA 6PAXA 1IUFA 2HR3A 4BXUA 4PFPA 2HTSA 3GEZA 1R71A 3K70C 3OYBA 1YLFA 2XSJC 3D5SC 2OUMA 1JT6A 2BHYA 4BBSJ 2QBYA 1UAAA 2X1CA 3T0YA 3PNYA 4M3GA 3H36A 3S1QJ 4Y52J 5H6RA 3DQVC 3OR2C 1EH7A 1RPWA 1ZGAA 2L54A 5AIQA 5B5EC 4ITVA 1Z9CA 1Y1WJ 2X6OA 4E70A 1MZBA 3H3UA 2ZMEC 3I4MJ 4RAYA 3CCQI 3TO9A 1ZRDA 3Q0WA 2XB5A 5DCMA 3G71I 3L00A 2V7FA 1YX3A 1QGPA 3MZYA 4IL6C 2H6CA 1ZN2A 4EMSA 4DQ2A 3S8PA 3OYGA 1U8RA 1J2XA 5IP6A 2VQHA 3DCFA 2DYSH 5FD6A 3WTVC 3COAC 4Y33A 2DFEA 1T95A 1E3PA 1B6AA 1OR7C 5HS8A 1X3ZB 4II2A 3G2BA 1FC3A 4I98B 4HX8A 3VOEA 4UUSA 2R5ZA 1BW6A 2XGXA 5K7FA 5HDGA 2G7UA 1IJWC 5ILVA 3MFKA 3LWFA 1JI8A 2KMUA 2R7OA 1EA3A 2XAQA 5K1YA 1R4NB 1WVRA 4CZZA 4DBRA 1MNMC 3NEUA 3BTCA 3GZ6A 1QU3A 1T6SA 1S7AA 1C0WA 5CYVA 1S9HA 4ESFA 4E7JA 5HLIA 5HOOA 5J4VA 3OSFA 3HXLA 3ABLH 1QVTA 1BOAA 3HUGA 4GRIA 4QPQA 4C2TA 1H88C 2KHMA 3GLXA 1Z3XA 4L18B 1QZZA 1W7PA 5CLSA 2QSFX 3BR2A 4AM3A 4N9IA 4LK0F 1KQ0A 5ILUA 3GO5A 2A6EF 3K4BA 1BA5A 4OIOF 4K2EA 4ENKA 4NNJA 1S72I 2CQXA 2LKSA 4F52A 1FIAA 1TWFJ 3L9FA 3P9IA 5CVJA 1X4OA 3RPUA 1ETYA 2CYYA 2M34A 4GGGA 5E20A 4XRSA 1W36D 3WG7H 2XGEA 4Q4ZF 3I5UA 3QODA 5ICCA 3VODA 2KIFA 1ZRCA 3LA7A 1B72A 2E2HJ 3TO7A 1I6HJ 5IOZA 2Z99A 3CESA 1BOBA 2A5WA 1OLTA 3BJOA 3HYIA 2CFOA 3C2GA 4P1WA 5K5OA 5ICEA 2ICWG 1KU7A 3I71A 4MQVA 1I27A 3W6JB 5JR3A 1DP3A 1TP4A 1X1DA 2DOAA 1Y0UA 1YITI 2VT3A 1MD0A 2BVMA 1ZR2A 1PP7U 2WWYA 2KPMA 4A3FJ 1MJAA 4PJJA 4V2FA 4G7HF 4A93J 2B63J 2XGDA 1X1CA 2COMA 4EVIA 3G4SI 2M9HA 4RB0A 3F8NA 2M1BA 1U5TC 4G8XA 2UXXA 2EB7A 1Z67A 3F21A 2CV1A 4FX0A 1TBXA 2Z1DA 1P7JA 4G7ZF 4BE1A 2BYVE 1XMXA 2QWWA 1JKQC 2XC7A 4JX6A 4Y4RA 4BL0B 3F8FA 2P5VA 2M0MA 3BTJA 4MFEA 4HLYA 4QTRA 3FKJA 4FCYA 1XGSA 1DU6A 1JE8A 2OV7A 3R61A 1TT5B 2MGQA 3VYUB 2XDVA 3M07A 5IOYA 1D5VA 1G3WA 4KDPA 2CQNA 2EFQA 2LYCA 4ZH4F 3I64A 3BQYA 4M73A 5F1JA 1W5TA 1QZEA 2MSYA 2QQ9A 3FXLA 3C2BA 2JSPA 5L3BA 4RB3C 2P6TA 3MKLA 3RZOJ 5M5XJ 4XLPF 1HQCA 2A6HF 2KQRA 3WHCA 5HNFA 2JSCA 4OINF 2BE5F 1A6QA 3LFKA 2MH2A 4I2OA 2KDOA 1AHDP 2E2JJ 3VYRB 3JTHA 2H09A 1U6GA 4FX4A 4RLFA 3MN2A 1JXSA 4GYGA 3E6DA 2OAZA 1SFKA 4CYCA 2LLKA 3ZN0A 1VQ6I 1A31A 1TWGJ 3IH3A 3A1YA 3CJNA 4N0BA 1YI2I 5BPIA 1S6LA 4YIFA 2XRLA 4OAYA 3DFGA 2ZXWH 3N4MA 3LSJA 3NWSA 1JUPA 2HOAA 5FLMJ 1R00A 1D0YA 3C1DA 3KEOA 1XG1A 2J5OA 2I5UA 2JVGA 1IRZA 2VXZA 4P9UA 1PUFA 4XKBA 1E3HA 4BHPA 2CRGA 4EJWA 3D1NI 2GA1A 4B48A 1X2NA 3ECHA 2KL4A 1B1BA 1SEUA 4LLNA 3W2VA 2YPRA 3ZQLA 3Q5FA 3BR5A 5CQEA 5CVUA 3PUBA 1ACIA 2GZWA 1OYIA 1TQPA 4IOCF 3M8JA 4ETSA 4MO7A 2F5EA 2K4JA 2N8GA 5L3EA 5F08A 2ELKA 3RKQA 4O6JA 3MZ8A 2Y9ZA 1FOXA 3WTSC 4U0WA 4RAGA 4CDGA 5IT9K 3KYDB 5ERIA 5IY5H 3J80K 4UVCA 1GV5A 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 3GUDA 2DPDA 3MEXA 3K4CA 2O7OA 5BOXA 3A0BC 4O5VA 2BY2A 3OYAA 1IG7A 4V19K 3FM3A 3UNGC 1KONA 1P4XA 2BW3A 4Q47A 5TGTA 4WX9A 1ON1A 3SDGA 3OS1A 3IL2A 1RNLA 4XORA 1I50J 4H0EA 1P6RA 5J40A 5HDNA 2ZFWA 1J59A 3CJRB 1R6RA 1FYLA 4LD5A 3MD2A 4I09A 3BCAA 1RC9A 2CFXA 2K9LA 4B3XA 2H6BA 3OL4A 4IEJA 4AC0A 1G4DA 1FBQA 2NYXA 3F8CA 3GZ5A 3MAJA 5AONA 2DJNA 2F5CA 1EH6A 2ZBKA 4IPAA 3DKYA 2V4JC 2W57A 2QEXI 2PMUA 2CW0F 3R6SA 2XRNA 3H3ZA 3DP7A 2XPVA 3CC7I 2F5VA 1IN4A 4RLQA 2XHKA 1Q1HA 3RZDJ 3CMMA 4V2GA 5LGTA 5FKOA 1X1PA 1ULYA 2M30A 3GVAA 2E5ZA 4RAZA 3K1MA 3BR3A 2V26A 1ZRFA 2IS1A 4HRIA 1DPUA 1OCRH 1MMSA 2VBWA 4YELA 2O5RA 1FBSA 2R7XA 1IN6A 1TC3C 5B1BH 2DU9A 3KYLA 3HOVJ 4UV9A 5EYRA 3VSLA 5J3LA 2EWNA 2EFOA 2WAQN 4J00A 4MLOA 3HOXJ 2PFBA 2OQRA 1HDPA 3W2WA 3P9CA 2ZJPF 1K4SA 2HOTA 3ZGKA 3FIWA 3SYTA 4XNFA 3PQJA 2M0CA 3LSPA 1FPQA 1W0TA 3QOEA 2K86A 2FBKA 4FETA 3IHUA 1F43A 4DOZA 3E97A 1MBFA 1ZKGA 1L3LA 2ZKZA 1HW1A 5TISC 1R5HA 5DCMB 2W1OA 5IT9Z 3JRHA 2ZNYA 4CCOA 3BG6A 3J7ZI 4BHBA 2DDBA 1XTAA 4HEA2 1WJDA 3BCBA 2VJ4A 1V3FA 2CUEA 4L5IA 2XAJA 2FRHA 2L3DA 2VJ5A 3L2VA 1MH4A 1JKPC 1J9IA 3BR6A 4LIUA 4GDFA 3L2UA 5JLWA 2LY9A 1SMTA 1MNDA 5FFXA 4CUGA 3WTZA 1M1EB 2RNJA 1FMWA 2DA7A 4MFDA 4UHTA 3VWBA 4BQAA 1N77A 5E1ZB 4F91B 2H8WA 2WAEA 1IAWA 4KUMA 5ICGA 2Z33A 2P7VB 4HQMA 2HQRA 3SDBA 4EM1A 3QU6A 1LB2A 2CUZA 5FKLA 5E3NA 3WTUC 4M71A 3JSPA 1VI0A 1J0RA 2XF5A 2R7DA 3REOA 1GDTA 1VQ9I 2FBIA 5BPDA 1OCPA 2XB0X 1VF9A 1RZ4A 1KU2A 2VE9A 3BQZA 1R1UA 1ZAOA 2DMUA 4D7MA 3LSKA 3HRSA 3MKWB 4IHWA 4W97A 1YE9A 1WHUA 3T8TA 1RIOH 5GAGJ 5HLHA 1YRNB 3GTOJ 3ZQQA 1F5TA 2UWMA 4NDLA 1KYWA 3K0LA 1RR7A 1XSDA 1D3YA 2VB6A 4G12A 3KIOA 3BZKA 2GOXB 1T56A 2GQQA 1PDNC 3PJRA 2OU2A 3OOUA 1P9QC 2EIMH 3JAMZ 2VKVA 4XOPA 5L3FA 2CV0A 3H5AA 2YUSA 1IUYA 1T38A 3KETA 4XIDA 1FT9A 1GHCA 3I3LA 2FEZA 2JPBA 3FK6A 3HPHA 2GWRA 3B6CA 3TDUC 1U78A 1LKXA 2MD0A 1ZARA 4OIPF 3V7SA 4BU2A 3MKYB 5E3OA 2OCCH 3H0GJ 4N4NB 2XKOA 4PSXA 4XLNF 2A68F 2X48A 2DMTA 4KIBA 2HGCA 3DTIA 3H1CA 2VQCA 1S29A 1F36A 2XAUA 3HSFA 4B8XA 2EV0A 2M4KA 2KP6A 2VT2A 5E3MA 2JJ7A 5LGUA 3LA2A 4HSTA 4HZFA 3IH2A 3ZR8X 2XROA 5FB2A 3VYSB 1MBGA 3BP8A 3QPHA 3BJ6A 3A0HC 5JHUA 3SQNA 1G6NA 2X51A 2VBYA 1U9NA 2H8RA 2Y0SA 1WJAA 3ZQIA 2WAQA 3W6KB 4RM2A 1UFMA 4M9XA 5JVGF 3GFJA 2BY0A 4HW0A 1Z77A 2ZMEB 5KVRA 3S14J 5JLXA 1LVKA 2G9WA 1DUXC 2DT5A 1HDDC 4OMYA 5BNGA 2KZGA 3OOPA 2VJIA 2DI3A 2L4MA 5DM6F 3L2RA 2VLAA 5CQGA 3HOWJ 1X2MA 2IAIA 1IN5A 4TV7A 3K2ZA 3F8BA 3QYBA 4AYBA 2FU4A 4IHXA 3RQIA 4A3DJ 2VKDA 1RI7A 3PUFA 3TBIA 1BN5A 4MGRA 4ZDLA 1R36A 1VFCA 1JGSA 1JUSA 2V6EA 1ITYA 3AKZA 1G59A 1FYKA 2IS2A 3ONQA 4S0HB 1HF0A 3PQKA 2ZJQF 1U9OA 3S17J 4A3IJ 3TMOA 2IS6A 4IHVA 2IJLA 4ENNA 3OYCA 1XB4A 2P81A 3EYYA 2L7KA 3X2QH 3PNTA 1UHMA 3WGHA 2CV2A 4XQFA 1K78A 2K27A 4EGZA 3KP5A 1FLIA 3RPQA 3CMEI 2FE3A 1A04A 3OYIA 3HOYJ 1CGPA 1IXSB 3HC7A 2HYGD 3MVPA 1ZGWA 4EM0B 2JN6A 2HDDA 2W48A 1B9NA 3WTTC 3BG7A 1RESA 2PN6A 4BS9A 4Y7NJ 3T8RA 3FM5A 2CS3A 2BY3A 3L2WA 5EJCA 3GFMA 1MMNA 3ZMUA 1GXPA 2TDXA 1APLC 2R7ZJ 5H20A 3E5UA 3FXQA 5DDGA 2Y69H 3CO6C 2WB1A 1XCBA 4PCQA 2HTJA 3L1PA 2EINH 2FBHA 1U2WA 2JQ7A 3HZJA 4YEJA 2WY8Q 1MH3A 1BR1A 1D1BA 1QHGA 2QF7A 2KIQA 2Y48A 4F55A 1DDNA 2ID3A 3CUQA 3H92A 4HOBA 2EZLA 2K85A 2C6YA 2QQBA 5KNLA 4HX7A 3RTRA 3CCMI 4ZC3A 3OSGA 1XX5A 5BQTA 4AWXB 3BPXA 3G1OA 3ABKH 3WE3A 1XGOA 5D5VB 1ZYRF 3JSOA 3ZOBA 5J47A 1SD5A 5E8GA 3BPVA 4S04A 1O3SA 1MSEC 2DTRA 4L9VA 2QA4I 4OMZA 4MEXF 1CF7B 1WH7A 3TP3A 1MMDA 5DD4A 1CQTA 3I54A 4W1UA 1AKHB 4AIKA 4II3A 1Q1VA 3L2QA 1I1GA 2KT0A 2XPUA 4GXOA 2PLYA 1IN7A 2X6WA 3O6BB 1FZPB 5LD2C 1SFUA 4C3HJ 1QBJA 3CCVI 3ZN1A 2NVQJ 5C3EJ 2BXZA 5D5XB 4L5EA 1HLVA 3F6OA 2ZB9A 5K5RA 1U8BA 2CH0A 3H9JA 2V1UA 4U7DA 2X4HA 3EYIA 4NQWA 2NOGA 2LC2A 4AYBN 1ETQA 3GWZA 3K4NA 5D8KB 1B8IA 2VKHA 2WBMA 5ICFA 2HWVA 2L02A 3UKGA 3GTGJ 2OPTA 3RSNA 1ZLJA 1WJBA 1UG2A 1P7IA 4DJAA 1Z0XA 3KP3A 1ETVA 1YG2A 2F4MB 2LRDA 2ZSHB 2DJIA 2E7XA 3S3MA 3OYLA 2M3AA 2L2OA 4C3JJ 4J01A 3K1PA 1XC5A 4IOAF 2YSRA 1PUEE 5DUIA 2E1MC 4QLCU 5D5WB 3TOAA 2WV1A 4YIIA 2LDUA 1WJ5A 2X6YA 2JZYA 2ZFUA 2E1NA 2DA6A 4E4HA 4P96A 3I58A 1MDMB 1S3JA 3TGNA 2DMNA 2YS9A 4OIQF 4HSRA 1A5JA 3ZQFA 2RN7A 3OIOA 3K4LA 3M3YJ 1N75A 4C30A 1BC7C 1Y8RB 4KMUX 1K4TA 3BC8A 3PSIA 2K3FA 3VPRA 1MJBA 5F04A 1V55H 3TW6A 2CU7A 2L9RA 1G3YA 3G1MA 4E7ZA 1LE8A 2O0YA 4U7BA 1TNTA 2F4IA 4YG2F 2Z5UA 5FFZA 3CF2A 3FBNB 4C2MJ 3U9GA 2FNPA 3Q3SA 3PSFA 2F5DA 3TOBA 4ZYDA 3KEQA 5LGNA 1W7PD 4KIGA 2FUG2 4R1HA 5A2QZ 3IV5A 4UUSB 1FMVA 3ZRGA 2NS8A 1SAXA 3DEUA 5BMZA 1YFHA 2QLZA 3M7GA 5CJ9A 3K4JA 1JKOC 3WU1B 2D2WA 2J5PA 3VB2A 3H9GA 1FOWA 2AXLA 2HI3A 3TKYA 1YQAA 5L3CA 3VYTB 2VASA 1WRJA 3WTYC 2QKLB 2DA3A 3OYEA 1YW9A 5E1WA 4IQJA 4EV0A 3ZQ7A 3OR1C 4ABZA 4KITB 1W36C 4A0ZA 2R0QC 3MMYB 1QRYA 4DGWB 1NHAA 3C2HA 1H0MA 1LJ9A 2A61A 2HQAA 3DTKA 4UVBA 2HVQA 4QPOA 2Z2SB 4IHTA 1WWXA 2HDWA 1JHFA 2JUCA 5EEGA 4G94A 3DU5A 1HW5A 1TTYA 2UUZA 3EUHA 3FDYA 3KZIC 4M6VA 3U2RA 3J80Z 1YJNI 1EF4A 2BXYA 4BKXA 2K4BA 4CCKA 5EEAA 1I1SA 3B73A 2EV6A 4F3QA 3KP4A 4KN7X 1WZ2A 3S3OA 1UHSA 1BIBA 1TWAJ 3TEDA 3Q0UA 2BBYA 1XGMA 1FSHA 3BY6A 3MWMA 1K61A 4UXNA 4EJVA 1V5GA 2O3FA 4A3GJ 1VQ8I 2O8XA 2HOEA 1G3TA 4HBLA 1WQ2A 2GXGA 4I7HA 2DXIA 2A5YB 2DFHA 5GAEJ 3H5NA 4ZDPA 2BVLA 1NG6A 1HKTA 3FXOA 1R5GA 2L9VA 3DPTA 4RDUA 4XSZF 1DU0A 4UV8A 2F48A 1OPCA 1R1VA 3FMSA 1B9MA 2NVTJ 4XLAA 4M6YA 2O9LA 1X58A 3UR3C 2R93J 4CCMA 1U5TB 2Z16A 2ID6A 3S2HJ 3EUKL 4LG3A 5FLXK 4M3DA 2Q2EB 4CCLA 3M4OJ 2W85A 4CICA 2NVUB 2ZCWA 5J8CA 1TWCJ 2ACJA 2MYSA 3ZCOA 2BY1A 2XKPA 4XMYA 3OWTA 2FQ4A 3FXJA 3WU2C 3R4KA 1A36A 3EUAA 2ISYA 4X1EA 5L3GA 2PI0A 4M72A 1YS6A 2MLKA 2Y2ZA 5E79C 2XAHA 2O6GE 1OISA 4UY8I 1V54H 4G6DA 4EM2A 3OS0A 1VTNC 2DT6A 3L2CA 4ZZLA 1MMAA 2AS5F 4LFUA 3OYFA 2XF7A 4B3AA 2QM3A 1SD7A 2GBYA 5LEKA 3VDXA 3E5QA 2X85A 3ZXSA 4A6DA 1F4KA 1P4AA 3K70D 4M6XA 2FMLA 5LRSA 2HEOA 2IRFG 2JA5J 4BNCA 4M3BA 2JRMA 3QQAA 3GFIA 4UUVA 2XASA 2K40A 4PGGA 4RGRA 3JRAA 1NH3A 1MBEA 4UB6C 5DUKA 3ZPLA 4BE2A 1ETOA 4F93B 1HBXG 4IKFA 3QPLA 1EH8A 2JT1A 3OYJA 3DPUA 3S15J 5DCFA 1O3RA 1WPKA 1ZREA 1H9GA 3M8FA 2XVCA 2P4WA 3FK7A 2L0KA 3WODF 3M1EA 4XICA 2AO9A 2HDCA 4A0XA 4LG0B 4PZJA 4JQFA 2JRTA 2LTPA 5J8FA 2JVHA 3O8HA 2PJPA 3QPTA 1IO2A 5HS7A 1VQ4I 1HOMA 5FLXZ 1IZ1A 4LB6B 2LH9A 5JVTA 3GTKJ 2A3SA 1LDKB 3EUHC 1OCTC 2ECBA 2DPUA 3CLQA 3LSRA 1N78A 2E1MB 2V1NA 3ELKA 3MQ0A 4U0VA 3U21A 1W5CC 1AOYA 2MC3A 2DQRA 2L5QA 3CUQC 3DKXA 3KCCA 2W82A 2HVSA 1TWHJ 4I0AA 2EZKA 3I59A 2W84A 4NHJA 4ANJA 4LG0A 3K6GA 2EV5A 1T2KA 4EQQA 3CQZJ 1T8IA 3W2AA 1FX7A 1IN8A 2M8GX 1XMAA 2R7FA 2CSOA 1MBJA 2ZNZA 2X9DA 3AG4H 1HSTA 2MC4A 5KCMA 1WH5A 3LMMA 1FJLA 4U0YA 1U0JA 4XRSG 5LLQA 1ZHFA 2YX4A 1OFCX 2STTA 5FROA 3G6EI 2ESNA 2QVOA 4KICA 4AVZA 4ENMA 2QUFA 1WSUA 1JUMA 1XDSA 1OMIA 2DN0A 2OBPA 1XD7A 2PMHA 4FHTA 3OV8A 5DYMA 5K7ZA 5GTHC 2ME0A 3FXUA 5KAFC 2HKOA 2HZDA 1K6OA 2HXOA 5H6QA 3SZTA 4PDKA 2FOWA 1FY7A 2WC2A 3L7WA 1ONVA 1OYWA 1T98A 5E8IA 2BZTA 4ZZDA 1Z7LA 4ZYHA 4S05A 2KIMA 1Y6IA 1GUUA 2Z3YA 4F92B 1ETXA 5D4RA 1JTYA 5ED4A 2MFZA 2STWA 4D5CA 3HTUA 3BR0A 1R23A 5ILSA 1KQ9A 2VI6A 2R7WA 3FF5A 4NC8A 1FTZA 4LLLA 4BQOA 4IZZA 1LDDA 4OWRB 2R7QA 3SEQA 2RC4A 1VZ0A 3CDHA 3M9AA 4JBAA 4BQQA 4LB5A 2DA4A 2K02A 2X1DA 2A69F 3ESWB 4BE0A 4BXFA 1KGSA 1ORKA 2B0LA 3F8MA 3CO7C 2F5FA 4RAFA 5EG0A 2A05A 2ADUA 3LSHA 1HCRA 1PVEA 1J7KA 1USTA 3SEZA 2GM4A 4FE7A 2E35A 1WI9A 1YHQI 5FLVA 3F0CA 1TQMA 3R60A 1MBHA 2VQGA 3KPHA 5KAIC 1YO5C 2LY2A 3TO6A 3S16J 1ENHA 2EA2A 2P0WA 2W7NA 3PFYA 5D8LB 1TW2A 3GTLJ 3CJQB 1X4PA 4BEHB 3AL0B 3JW4A 4EGYA 2CJJA 2EFPA 4D1QA 3FXKA 3KYCB 3S2DJ 2NAZA 2LFBA 2E36A 2ECCA 2QBYB 3LOCA 3HKZN 2L7FP 2OZUA 5BS6A 4MIMA 1TLHB 2IGOA 3QU3A 5HODA 2DBBA 4BACA 3OMYA 2X0LA 1UELB 3SZPA 4QIWN 2DK5A 4EJTA 3DF8A 5GPCA 2CW8A 1GT0C 2AHQA 2PMZA 4XBFA 1FNNA 3KEYA 3SFZA 3U1DA 4AU7A 4B09A 1BJZA 2V6CA 5EGOA 1AA7A 4XKCA 2RNGA 4IF4A 2L9NA 5A2QK 1HKSA 2LD5A 2ZC2A 3S1MJ 1YIOA 1VQOI 4XR6A 2A6TA 1XSXA 2KFDA 3HEFA 4XLCA 4R8HA 5IT3A 4RS8A 5FRMA 2DFFA 5EZHA 4MTEA 3ASOH 2VKEA 3P5JA 4XONA 3T5XA 3W6VA 1D0XA 2XIGA 1DQUA 2DW4A 3HSEA 3GYHX 5DD8A 1OCZH 1ZTRA 2LF7A 2ZXIA 2W4SA 4HA8A 1HC8A 3K1NA 3IRRA 3BLYA 3ABMH 2Y0SN 3CZ6A 3CP2A 2RGVA 3PFIA 3ZMSA 5M3MJ 2KRCA 2HQNA 3LSIA 4L0YB 2IPQX 3WG9A 3GTMJ 4ZJZA 2Y31A 1OR7A 3PM1A 1SD4A 4L9TA 1REPC 1S5LC 4EJOA 2DA5A 2VE8A 4BEHA 2WY7Q 3QOPA 2O61A 5KHDA 1S7OA 4CHUA 2BW3B 1ZGJA 2V9KA 1IF1A 2HVRA 3HM5A 3LA3A 2VPLA 1PJRA 4P55A 5E1XA 1ERDA 2IGMA 3JTGA 1IGNA 1P4WA 1JJ8C 2DMQA 2OF7A 3ISPA 3RIRA 3BWGA 2JA7J 4G9YA 2LNBA 2QZ8A 4IHYA 1ODDA 2IGNA 2YU9J 3D0SA 4O3MA 4E7SA 1QZYA 4WXCA 4X6AJ 3S32A 1TL8A 1QPIA 3IP4B 2GA2A 4JOMA 1DGWY 3WU0A 1X3UA 4DNCA 5H2FC 5K7HA 5IP9J 5D5UB 2KRFA 5E17F 4CZCA 2M87A 5F1RA 3GMEA 3VEPA 1LPQA 2PJRB 3BJAA 5CVRA 3CCSI 3ZP5A 2OTLI 2QYOA 3DEEA 1W7PB 3N97A 3SZGA 1LEAA 3OYNA 1TZLA 4PGHA 4IQ4A 2DT7B 3DKWA 1LEBA 2IT0A 1SVLA 1SC7A 3D5RC 1SANA 3U1KA 2LG4A 4WF2A 2BEOA 1MIJA 1OQYA 2Y0MA 3NRVA 5C4XJ 4BDYA 1WGXA 4L5JA 4ZDOA 2IP2A 3TQNA 3HRUA 3ABUA 2W00A 3DLLF 2LKPA 1SVOA 4AD9A 2PEXA 4IRGA 1ZK8A 4LITA 1WFXA 3F3XA 2E19A 4E7LA 4HF1A 3WGIA 3FMQA 3GZNB 5F0CA 4BHCA 4YFKF 3J81Z 2KJCA 1MSFC 4D5FA 1SVMA 3N05A 4AIHA 4EJUA 3JRFA 3P7NA 1KA8A 3SJMA 3PO2J 1FEXA 2DAOA 3LSMA 2AQFA 4G6TB 2H1KA 3CDIA 1ZLKA 3I59B 3FBIB 1I39A 5E3LA 3I4NJ 3F22A 4XKWA 2EILH 4NB5A 4DYRA 1JKRC 2HU9A 1VQLI 2FX0A 3NAUA 1YJWI 4OIRF 2DA1A 1P2FA 2K9SA 4I99C 3WE2A 3HHHA 4R79A 3CCLI 3K69A 3CC4I 2QSGX 1EKEA 2RVCA 2COBA 4BBRJ 3HUGB 2WV0A 5EEHA 3KFWX 3JRDA 1HKQA 3KLOA 4HF2A 4A5NA 1I3AA 2EZIA 1HW2A 2DLLA 3L09A 3H5RA 2QQAA 3GXOA 4Z2YA 2L4AA 1RRJA 1H8AC 3JRIA 3SXYA 2MG4A 4HDVA 2ISZA 3GX4X 1NK2P 1MKMA 2KKOA 4PJ0C 4QWQA 4JX4A 2OC6A 4XOTA 4B44A 5IPAA 1J09A 4CGZA 2G0EA 2IA0A 4HF0A 1IV8A 4HLXA 3AFHA 3G1LA 2RDPA 1IRFA 3HGYA 4KFCA 3E6CC 1BW5A 1O57A 1OJLA 2O03A 4A3JJ 3K10A 3ZQCA 1W5SA 2FJ1A 3DV8A 1BM9A 4CSWA 4L9JA 2CGPA 1YYVA 1FIPA 2QKMB 5CVIA 3A02A 2OTJI 3CP8A 5HNHA 1FSEA 2LY1A 3HPGA 1LQ1A 2JPCA 2OD5A 2F6CA 1UMQA 2P8TA 2K7LA 5LFAA 3QRFF 2XAFA 2V1DA 2I8DA 4Y3OA 1XMKA 4I76A 2CO5A 2NVYJ 4HYEA 4CA0A 1IRGA 3J7YJ 5B3SH 1NK3P 3QAHA 1XS9A 4WCGA 2Q2EA 2PBIA 2LK2A 3OYMA 4GYIA 3LSGA 3OYHA 2RREA 4XN3A 3B02A 3LQQA 2QENA 4XM3A 3KE2A 1ZH5A 3FISA 3QYEA 2VJJA 3RCOA 4M9SA 1V4RA 3M8EA 4CO8A 5M5WJ 3DPLC 4LLGF 2P5LC 2LVSA 2CW7A 2A07F 1O3QA 3DU6A 3KLNA 3H3VK 3V8JA 4IJAA 1OCCH 1U3EM 2R7UA 5F0HA 3BG3A 2Y75A 2VQLA 1B8IB 1F1ZA 1K7AA 3TDZC 2E1OA 1L0OC 2KIUA 1NTCA 2EQRA 4I01A 2M7BA 4WK8F 1T08B 4HNUA 1FP2A 1Z21A 2R7RA 2DK8A 4E6KG 3BT9A 1I3QJ 2Y30A 2HYJA 4FT8A 4FE4A 2E5NA 1IXRC 3C3WA 1W1WE 1ETWA 4BH9A 2ZXHA 3OYKA 2L7ZA 3QPSA 1QVUA 2WA0A 3E7LA 2P6SA 4XKVA 4DYCA 5J1RA 3GCMA 5GP9A 3BZ6A 3JREA 1J75A 4ZYEA 1RUOA 1OKRA 5LRRA 4E7IA 5GADJ 3WTXC 3FHZA 5EZGA 2GIVA 1LFPA 2ZSIB 4FISA 3GW2A 3NARA 1LFBA 1R22A 1BR2A 1D8KA 3I53A 3CF5F 1UJ8A 3BR1A 1HXDA 1UB9A 2LR8A 2CUFA 3ZQGA 3S1NJ 2LBFA 1FYMA 2CQ7A 2CUJA 3I9V2 4BYYA 3OY9A 3IKTA 5GTIC 3A01A 1BI1A 5TJJA 5LHGA 4AIJA 2BOLA 2FA5A 2ELJA 3R0AA 1XSVA 2LP0A 1UG0A 3BTLA 4KIFA 2E2IJ 2LMDA 4OU0A 3CDLA 3J81K 1B59A 4YFXF 2XV4S 1QO0D 1QNTA 3CD6I 2XUBA 3NQOA 3TP0A 2Y9YA 3K4KA 5J6XA 1AU7A 1S7EA 2K9MA 3K4MA 5IP7J 1PYVA 4RA2A 2ETHA 2HS5A 3DBRB 2VBXA 1TNSA 1O3TA 1MBKA 3ABTA
chains in the Genus database with same CATH topology
1W4MA 1AWCA 4LGWA 1Z6TA 3E6MA 1I5ZA 4KYWA 4HV6A 2MLGA 3KP7A 5FD5A 1SD6A 3ZMVA 3F23A 1Z05A 4LMYA 4AVPA 3ROUA 3O2PE 1IW7F 1T0FA 2EK5A 4U88A 3DXJF 1KQ8A 2ZMEA 5HDKA 5DEQA 4KA4A 5LHIA 4I02A 1BIAA 2L01A 2VN2A 1R58A 1G3SA 1LDJA 3JAMK 2PG4A 1R1TA 3P9KA 3HHGA 3HRTA 1O7FA 3KP6A 4KMFA 2YU3A 4MQ9F 3C18A 4A0YA 2RKHA 1BI0A 3RKYA 2OA4A 1H9TA 4A5MA 2WTEA 1DPRA 5CVVA 3V8KA 4L9NA 1BI2A 3V7RA 5D6FA 1SFEA 2H27A 2GAUA 2E7WA 5LBQA 5F64A 1LNWA 1T39A 4GO1A 3FMRA 4G7OF 3AAFA 1TW3A 3Q9SA 4MEYF 4G6QA 2F2EA 3RDIA 4ENJA 3I0TA 3RKXA 3MZHA 1Z6RA 4UVAA 5HVQC 2IA2A 4CXFA 2VOOA 1XN7A 3HSRA 2D45A 4A2UA 2UZKA 5AIPA 3HIFA 3V4GA 1IXCA 5D4SA 1E2XA 1UHWA 4WXHA 4A12A 2LSOA 3S2WA 2CQKA 4HAMA 3FX3A 2XAGA 3E6BA 2EFWA 2VOPA 3ULQB 1Z1DA 3HOTA 4Y17A 3ERED 3KZZA 5TRDA 3GFLA 1BI3A 3E5XA 4JK1X 1UCRA 2FMYA 1BBYA 3I4PA 3ZMDA 3QP5A 3RJPA 5DV5A 1FWZA 3BROA 4M9ZA 4LJZF 3T1BA 3G73A 5HLGA 2RV8A 1I6XA 4ON0A 2W24A 4UNOA 3ML6A 4KT5C 1FP1D 1YW7A 3ECOA 4HV5A 2GXBA 2BGCA 1STZA 2M8EA 3FXRA 3IWZA 3V8LA 2MH9A 3FWEA 3G3ZA 3KZYA 4MNUA 2YR2A 5D6EA 2NNYA 2V1XA 4L0ZB 2V9VA 3EQLF 2V79A 2KJBA 3CTAA 1DP7P 2CWEA 2IW5A 3KP2A 2DFIA 4ESJA 5LHHA 3RYRA 3Q9VA 1ZG1A 5FO5A 1GXQA 4D0PA 2HFHA 2ZO4A 2MBFA 1Z91A 4P9FA 2D1VA 5LEJA 3RKWA 2FNAA 4M74A 4MTDA 4Y15A 5F6FA 3V7CA 4Q48A 1BC8C 2VC1A 2DO7A 1EV7A 1J5YA 3IRQA 4RB2C 2LF8A 4N9HA 2OZ6A 2BV6A 1WKMA 2VC0A 4KN4X 4GCVA 3WTWC 4BAYA 2M45A 4HDUA 2R3SA 1RUNA 1USSA 2EFNA 5HS9A 4RB1A 2CG4A 1K79A 1TQIA 2ZXJA 1KU3A 3LAPA 3C7JA 1PP8F 1R7JA 1XCVA 3E3VA 4HX4A 1E17A 3QP6A 3R0JA 1D8JA 2ZJ2A 4CYDA 5JFRA 4P5OA 5L3DA 2MA3A 2EJRA 4YFNF 2M5WA 4XSXF 3F6VA 2Q0OA 2VONA 4WWCA 2ESHA 3ZMZA 2DQLA 2IA1A 2FQ3A 2E1CA 4Q5SF 2NNNA 3IC7A 1FOKA 2RQPA 3LQRA 4IRHA 3CLOA 3SHFA 1YW8A 1JHHA 2PQ8A 1ZG3A 2HYFA 2NS0A 3IWFA 1MGTA 2UXNA 1B4AA 3HTSB 2P5KA 4OOIA 4XRFA 1Z7UA 3J7AO 1ZG5A 2D1HA 1QPMA 1QQIA 2FXAA 1XGNA 4ZYGA 3EETA 4A6EA 2W25A 2JTVA 5E18F 2IVMA 4I0BA 1MDMA 5FGMA 1K78B 1KU9A 3O3KA 4RGUA 1S8NA 4RGXA 3CUQB 4Y13A 3HRMA 4ESBA 3LAJA 1GVJA 1BJAA 4ASNA 1LVAA 1U5TA 3D5LA 3F72A 2VODA 2EA4A 2Q8KA 1O7LA 3FZVA 4IXAA 4IHSA 3BDDA 4RGSA 4KNYA 4HQEA 3CUOA 2MD5A 2Z9OA 4WXDA 4MHGA 4F7ZA 2VBZA 3BOQA 1ON2A 3VFZA 1XDUA 2OQGA 2HZTA 2FF4A 4LK1F 1FBUA 3K9TA 1SMYF 3MCZA 4IRIA 1YTYA 1P92A 3ZMTA 3IKVA 1F9NA 2P7CB 4IVNA 3LSTA 5KK1A 1MJ9A 5JI6A 1HSJA 1CF7A 5K5QA 2YX7A 3RYPA 3EDPA 1SFXA 2FSWA 2ELHA 1KYZA 2HKXA 1YS7A 2FOKA 2H94A 3WGGA 6PAXA 2HR3A 4BXUA 2HTSA 3GEZA 1YLFA 2QBYA 3T0YA 5H6RA 3DQVC 1EH7A 2L54A 1ZGAA 5AIQA 1Z9CA 4E70A 1MZBA 3H3UA 4RAYA 3TO9A 1ZRDA 5DCMA 3L00A 1QGPA 3MZYA 2H6CA 1ZN2A 4EMSA 4DQ2A 1U8RA 1J2XA 5FD6A 3WTVC 3COAC 1B6AA 5HS8A 1FC3A 4I98B 4HX8A 3VOEA 2XGXA 5HDGA 2G7UA 5ILVA 3MFKA 3LWFA 2XAQA 5K1YA 4CZZA 3NEUA 3GZ6A 1T6SA 1S7AA 1C0WA 5CYVA 4ESFA 5HLIA 5HOOA 1BOAA 3HUGA 3GLXA 4L18B 1QZZA 1W7PA 5CLSA 4N9IA 4LK0F 1KQ0A 5ILUA 3GO5A 2A6EF 4OIOF 4K2EA 4ENKA 3L9FA 2NRAC 3P9IA 5CVJA 3RPUA 5E20A 2CYYA 4GGGA 4Q4ZF 3I5UA 5ICCA 3VODA 2KIFA 1ZRCA 3LA7A 3TO7A 2Z99A 3BJOA 3HYIA 5K5OA 5ICEA 1KU7A 3I71A 4MQVA 1I27A 3W6JB 5JR3A 1Y0UA 2VT3A 1MD0A 1PP7U 2WWYA 1MJAA 4G7HF 2COMA 4EVIA 4RB0A 3F8NA 2M1BA 1U5TC 4G8XA 2UXXA 2EB7A 3F21A 4FX0A 1TBXA 4G7ZF 2BYVE 2QWWA 3F8FA 2P5VA 4HLYA 1XGSA 1JE8A 3R61A 1D5VA 1G3WA 4KDPA 2EFQA 4ZH4F 3I64A 4M73A 1W5TA 2QQ9A 5L3BA 4RB3C 2P6TA 4XLPF 1HQCA 2A6HF 2JSCA 4OINF 2BE5F 3LFKA 2MH2A 4I2OA 3JTHA 2H09A 1U6GA 4FX4A 1JXSA 4GYGA 3E6DA 2OAZA 3ZN0A 3CJNA 4N0BA 5BPIA 1S6LA 4YIFA 3DFGA 3N4MA 1R00A 3C1DA 3KEOA 2J5OA 2VXZA 4P9UA 4BHPA 4EJWA 2GA1A 3ECHA 1B1BA 4LLNA 2YPRA 3Q5FA 5CVUA 2GZWA 1OYIA 1TQPA 4ETSA 2F5EA 2K4JA 5L3EA 4O6JA 3WTSC 4U0WA 4CDGA 5IT9K 5ERIA 3J80K 4UVCA 3GF2A 3RI4A 3HOSA 2G7HA 1OYYA 3GUDA 2DPDA 3MEXA 5BOXA 4O5VA 3FM3A 1P4XA 4Q47A 4WX9A 1ON1A 3IL2A 1RNLA 4H0EA 1P6RA 5HDNA 2ZFWA 1J59A 1FYLA 4LD5A 4I09A 2CFXA 2H6BA 1G4DA 1FBQA 2NYXA 3F8CA 3GZ5A 3MAJA 5AONA 2F5CA 1EH6A 2ZBKA 4IPAA 2W57A 2PMUA 2CW0F 3R6SA 2XRNA 3H3ZA 3DP7A 1IN4A 2XHKA 1Q1HA 5LGTA 1ULYA 2M30A 3GVAA 4RAZA 3K1MA 1ZRFA 1DPUA 2VBWA 1FBSA 1IN6A 2DU9A 4UV9A 2EWNA 2EFOA 2PFBA 2OQRA 3P9CA 3PQJA 1FPQA 2K86A 2FBKA 3IHUA 3E97A 1L3LA 2ZKZA 1HW1A 1R5HA 5DCMB 5IT9Z 2ZNYA 4BHBA 1V3FA 4L5IA 2L3DA 2FRHA 2XAJA 1J9IA 1SMTA 5FFXA 3WTZA 2RNJA 4UHTA 4BQAA 5E1ZB 1IAWA 4KUMA 5ICGA 2Z33A 2P7VB 4HQMA 2HQRA 4EM1A 1LB2A 3QU6A 3WTUC 4M71A 3JSPA 1J0RA 3REOA 2R7DA 2FBIA 5BPDA 1RZ4A 1KU2A 2VE9A 1R1UA 1ZAOA 3HRSA 3T8TA 1RIOH 5HLHA 1F5TA 2UWMA 1KYWA 3K0LA 1XSDA 1D3YA 2GQQA 1PDNC 2OU2A 3JAMZ 5L3FA 1IUYA 1T38A 3KETA 1FT9A 1GHCA 2FEZA 2JPBA 2GWRA 3TDUC 1U78A 1ZARA 4OIPF 3V7SA 2XKOA 4XLNF 2A68F 4KIBA 2HGCA 3HSFA 1S29A 4B8XA 2EV0A 2VT2A 5LGUA 3LA2A 4HZFA 2XROA 5FB2A 3BP8A 3QPHA 3BJ6A 5JHUA 3SQNA 1G6NA 2VBYA 3W6KB 1UFMA 4M9XA 3GFJA 4HW0A 2ZMEB 5KVRA 2G9WA 1DUXC 2DT5A 4OMYA 3OOPA 2DI3A 2L4MA 1IN5A 4TV7A 3K2ZA 3F8BA 2FU4A 1RI7A 1BN5A 4MGRA 1R36A 1JGSA 1FYKA 3PQKA 2IJLA 4ENNA 1XB4A 3EYYA 1UHMA 3WGHA 1K78A 2K27A 4EGZA 3KP5A 1FLIA 3RPQA 2FE3A 1A04A 1CGPA 1IXSB 2HYGD 4EM0B 1B9NA 3WTTC 2PN6A 3T8RA 3FM5A 3GFMA 3ZMUA 1GXPA 2TDXA 5H20A 3E5UA 3FXQA 5DDGA 3CO6C 1XCBA 4PCQA 2HTJA 2FBHA 1U2WA 2Y48A 1DDNA 3CUQA 3H92A 4HOBA 2C6YA 2QQBA 4HX7A 3RTRA 5BQTA 4AWXB 3BPXA 3WE3A 1XGOA 5D5VB 1ZYRF 3JSOA 1SD5A 5E8GA 3BPVA 4S04A 1O3SA 2DTRA 4L9VA 4MEXF 4OMZA 1CF7B 5DD4A 3I54A 4AIKA 1I1GA 4GXOA 2PLYA 1IN7A 3O6BB 1FZPB 1SFUA 1QBJA 3ZN1A 5D5XB 3F6OA 5K5RA 2V1UA 4U7DA 2X4HA 3EYIA 4NQWA 3GWZA 5D8KB 5ICFA 2HWVA 2L02A 1ZLJA 3KP3A 1YG2A 2E7XA 3K1PA 2YSRA 1PUEE 5DUIA 4QLCU 5D5WB 3TOAA 4YIIA 2LDUA 2JZYA 2E1NA 4P96A 3I58A 1MDMB 1S3JA 3TGNA 4OIQF 2RN7A 1BC7C 4KMUX 1MJBA 1G3YA 2O0YA 4U7BA 1TNTA 4YG2F 2Z5UA 5FFZA 3U9GA 2FNPA 2F5DA 3TOBA 4ZYDA 3KEQA 5LGNA 1W7PD 4KIGA 4R1HA 5A2QZ 1SAXA 3DEUA 5BMZA 1YFHA 2QLZA 3M7GA 5CJ9A 3WU1B 2D2WA 2J5PA 3VB2A 2AXLA 3TKYA 1YQAA 5L3CA 1WRJA 3WTYC 1YW9A 5E1WA 4EV0A 3ZQ7A 4A0ZA 1NHAA 1H0MA 1LJ9A 2A61A 4UVBA 4IHTA 1WWXA 1JHFA 5EEGA 4G94A 1HW5A 1TTYA 3EUHA 3J80Z 3U2RA 1I1SA 2K4BA 3B73A 2EV6A 3KP4A 4KN7X 1BIBA 2BBYA 1XGMA 1FSHA 3BY6A 3MWMA 4UXNA 4EJVA 2O3FA 2O8XA 2HOEA 1G3TA 4HBLA 1WQ2A 2GXGA 4I7HA 2A5YB 1HKTA 1R5GA 3DPTA 4XSZF 4UV8A 1OPCA 1R1VA 3FMSA 1B9MA 4M6YA 1U5TB 5FLXK 2W85A 4CICA 2ZCWA 5J8CA 2ACJA 2XKPA 3R4KA 2ISYA 5L3GA 2PI0A 4M72A 1YS6A 2O6GE 2MLKA 2XAHA 4G6DA 4EM2A 1VTNC 3L2CA 4ZZLA 2AS5F 4LFUA 2QM3A 1SD7A 5LEKA 3E5QA 4A6DA 1F4KA 1P4AA 4M6XA 2FMLA 5LRSA 2HEOA 2IRFG 4BNCA 3GFIA 4UUVA 2XASA 4RGRA 4PGGA 3ZPLA 5DUKA 1HBXG 1EH8A 2JT1A 5DCFA 1O3RA 1ZREA 1H9GA 3M8FA 2XVCA 2P4WA 3WODF 3M1EA 2HDCA 4A0XA 4LG0B 4PZJA 4JQFA 2JRTA 5J8FA 2PJPA 3QPTA 5HS7A 5FLXZ 1IZ1A 4LB6B 5JVTA 2A3SA 1LDKB 2DPUA 3ELKA 3MQ0A 4U0VA 1AOYA 2MC3A 2DQRA 3CUQC 3KCCA 4I0AA 3I59A 2W84A 4NHJA 4LG0A 2EV5A 1T2KA 4EQQA 1FX7A 1IN8A 1XMAA 2R7FA 2CSOA 2ZNZA 1HSTA 4U0YA 5LLQA 1ZHFA 2YX4A 2STTA 2ESNA 2QVOA 4KICA 4ENMA 2QUFA 1WSUA 1XDSA 1OMIA 2OBPA 1XD7A 2PMHA 4FHTA 3OV8A 5DYMA 1K6OA 3FXUA 2HKOA 5H6QA 3SZTA 4PDKA 1FY7A 2WC2A 3L7WA 1ONVA 1OYWA 1T98A 5E8IA 4ZZDA 4S05A 4ZYHA 2KIMA 2Z3YA 5D4RA 5ED4A 2STWA 3HTUA 1R23A 5ILSA 1KQ9A 3FF5A 4LLLA 1LDDA 2RC4A 3CDHA 3M9AA 4JBAA 4LB5A 2K02A 2A69F 1KGSA 2B0LA 3F8MA 3CO7C 2F5FA 2ADUA 1J7KA 1USTA 1WI9A 1TQMA 3R60A 1YO5C 3TO6A 2EA2A 5D8LB 1TW2A 3JW4A 4EGYA 2EFPA 2NAZA 2QBYB 2OZUA 5BS6A 1TLHB 3QU3A 2DBBA 2X0LA 3SZPA 2DK5A 4EJTA 3DF8A 4XBFA 1FNNA 3SFZA 3U1DA 4B09A 2V6CA 4IF4A 5A2QK 1HKSA 1YIOA 1XSXA 4R8HA 5IT3A 4RS8A 4MTEA 3T5XA 2XIGA 2DW4A 3HSEA 3GYHX 5DD8A 2LF7A 4HA8A 3K1NA 3IRRA 2RGVA 3PFIA 3ZMSA 2HQNA 4L0YB 2IPQX 3WG9A 1OR7A 1SD4A 4L9TA 1REPC 4EJOA 2VE8A 3QOPA 2O61A 1S7OA 4CHUA 1ZGJA 1IF1A 3LA3A 4P55A 5E1XA 3JTGA 1P4WA 3ISPA 3RIRA 3BWGA 4G9YA 2LNBA 2QZ8A 1ODDA 3D0SA 4O3MA 1QZYA 4WXCA 2GA2A 3WU0A 1X3UA 4DNCA 5D5UB 2KRFA 5E17F 2M87A 5F1RA 3VEPA 3BJAA 5CVRA 3ZP5A 2QYOA 1W7PB 3N97A 1LEAA 4PGHA 3DKWA 1LEBA 2IT0A 4WF2A 2BEOA 2Y0MA 3NRVA 4L5JA 2IP2A 3TQNA 3HRUA 3ABUA 2LKPA 4AD9A 2PEXA 4IRGA 3F3XA 4HF1A 3WGIA 3FMQA 4YFKF 4BHCA 3J81Z 2KJCA 4AIHA 4EJUA 3P7NA 1KA8A 2DAOA 1ZLKA 3I59B 3F22A 4NB5A 4OIRF 1P2FA 3WE2A 4R79A 3HHHA 3K69A 2RVCA 2WV0A 5EEHA 3KFWX 1HKQA 3KLOA 4HF2A 4A5NA 1HW2A 2DLLA 3L09A 2QQAA 3GXOA 4Z2YA 2L4AA 3SXYA 4HDVA 2ISZA 3GX4X 1MKMA 2KKOA 4QWQA 4CGZA 2IA0A 4HF0A 4HLXA 2RDPA 1IRFA 4KFCA 3E6CC 1O57A 2O03A 1W5SA 3DV8A 1BM9A 4L9JA 2CGPA 1YYVA 5CVIA 1FSEA 1LQ1A 2JPCA 2OD5A 2P8TA 2K7LA 3QRFF 2XAFA 2V1DA 1XMKA 2CO5A 4HYEA 1IRGA 3QAHA 4WCGA 2Q2EA 2PBIA 4GYIA 3B02A 3LQQA 2QENA 3KE2A 1ZH5A 4M9SA 1V4RA 3M8EA 4CO8A 3DPLC 4LLGF 2P5LC 2A07F 1O3QA 3KLNA 3V8JA 4IJAA 1U3EM 2Y75A 1F1ZA 1K7AA 3TDZC 1L0OC 2KIUA 4I01A 4WK8F 1FP2A 2DK8A 4FT8A 1IXRC 3C3WA 4BH9A 2P6SA 3BZ6A 1J75A 4ZYEA 1RUOA 1OKRA 5LRRA 3WTXC 3FHZA 2GIVA 3GW2A 1R22A 1D8KA 3I53A 1HXDA 1UB9A 1FYMA 4BYYA 3IKTA 1BI1A 5TJJA 5LHGA 4AIJA 2FA5A 3R0AA 1XSVA 4KIFA 3J81K 4OU0A 1B59A 4YFXF 2XV4S 1QO0D 1QNTA 2XUBA 3NQOA 5J6XA 2ETHA 2HS5A 2VBXA 1TNSA 1O3TA 3ABTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4M A;  1AWC A;  4LGW A;  1Z6T A;  3E6M A;  1I5Z A;  4KYW A;  4HV6 A;  2MLG A;  3KP7 A;  5FD5 A;  1SD6 A;  3ZMV A;  3F23 A;  1Z05 A;  4LMY A;  4AVP A;  3ROU A;  3O2P E;  1IW7 F;  1T0F A;  2EK5 A;  4U88 A;  3DXJ F;  1KQ8 A;  2ZME A;  5HDK A;  5DEQ A;  4KA4 A;  5LHI A;  4I02 A;  1BIA A;  2L01 A;  2VN2 A;  1R58 A;  1G3S A;  1LDJ A;  3JAM K;  2PG4 A;  1R1T A;  3P9K A;  3HHG A;  3HRT A;  1O7F A;  3KP6 A;  4KMF A;  2YU3 A;  4MQ9 F;  3C18 A;  4A0Y A;  2RKH A;  1BI0 A;  3RKY A;  2OA4 A;  1H9T A;  4A5M A;  2WTE A;  1DPR A;  5CVV A;  3V8K A;  4L9N A;  1BI2 A;  3V7R A;  5D6F A;  1SFE A;  2H27 A;  2GAU A;  2E7W A;  5LBQ A;  5F64 A;  1LNW A;  1T39 A;  4GO1 A;  3FMR A;  4G7O F;  3AAF A;  1TW3 A;  3Q9S A;  4MEY F;  4G6Q A;  2F2E A;  3RDI A;  4ENJ A;  3I0T A;  3RKX A;  3MZH A;  1Z6R A;  4UVA A;  5HVQ C;  2IA2 A;  4CXF A;  2VOO A;  1XN7 A;  3HSR A;  2D45 A;  4A2U A;  2UZK A;  5AIP A;  3HIF A;  3V4G A;  1IXC A;  5D4S A;  1E2X A;  1UHW A;  4WXH A;  4A12 A;  2LSO A;  3S2W A;  2CQK A;  4HAM A;  3FX3 A;  2XAG A;  3E6B A;  2EFW A;  2VOP A;  3ULQ B;  1Z1D A;  3HOT A;  4Y17 A;  3ERE D;  3KZZ A;  5TRD A;  3GFL A;  1BI3 A;  3E5X A;  4JK1 X;  1UCR A;  2FMY A;  1BBY A;  3I4P A;  3ZMD A;  3QP5 A;  3RJP A;  5DV5 A;  1FWZ A;  3BRO A;  4M9Z A;  4LJZ F;  3T1B A;  3G73 A;  5HLG A;  2RV8 A;  1I6X A;  4ON0 A;  2W24 A;  4UNO A;  3ML6 A;  4KT5 C;  1FP1 D;  1YW7 A;  3ECO A;  4HV5 A;  2GXB A;  2BGC A;  1STZ A;  2M8E A;  3FXR A;  3IWZ A;  3V8L A;  2MH9 A;  3FWE A;  3G3Z A;  3KZY A;  4MNU A;  2YR2 A;  5D6E A;  2NNY A;  2V1X A;  4L0Z B;  2V9V A;  3EQL F;  2V79 A;  2KJB A;  3CTA A;  1DP7 P;  2CWE A;  2IW5 A;  3KP2 A;  2DFI A;  4ESJ A;  5LHH A;  3RYR A;  3Q9V A;  1ZG1 A;  5FO5 A;  1GXQ A;  4D0P A;  2HFH A;  2ZO4 A;  2MBF A;  1Z91 A;  4P9F A;  2D1V A;  5LEJ A;  3RKW A;  2FNA A;  4M74 A;  4MTD A;  4Y15 A;  5F6F A;  3V7C A;  4Q48 A;  1BC8 C;  2VC1 A;  2DO7 A;  1EV7 A;  1J5Y A;  3IRQ A;  4RB2 C;  2LF8 A;  4N9H A;  2OZ6 A;  2BV6 A;  1WKM A;  2VC0 A;  4KN4 X;  4GCV A;  3WTW C;  4BAY A;  2M45 A;  4HDU A;  2R3S A;  1RUN A;  1USS A;  2EFN A;  5HS9 A;  4RB1 A;  2CG4 A;  1K79 A;  1TQI A;  2ZXJ A;  1KU3 A;  3LAP A;  3C7J A;  1PP8 F;  1R7J A;  1XCV A;  3E3V A;  4HX4 A;  1E17 A;  3QP6 A;  3R0J A;  1D8J A;  2ZJ2 A;  4CYD A;  5JFR A;  4P5O A;  5L3D A;  2MA3 A;  2EJR A;  4YFN F;  2M5W A;  4XSX F;  3F6V A;  2Q0O A;  2VON A;  4WWC A;  2ESH A;  3ZMZ A;  2DQL A;  2IA1 A;  2FQ3 A;  2E1C A;  4Q5S F;  2NNN A;  3IC7 A;  1FOK A;  2RQP A;  3LQR A;  4IRH A;  3CLO A;  3SHF A;  1YW8 A;  1JHH A;  2PQ8 A;  1ZG3 A;  2HYF A;  2NS0 A;  3IWF A;  1MGT A;  2UXN A;  1B4A A;  3HTS B;  2P5K A;  4OOI A;  4XRF A;  1Z7U A;  3J7A O;  1ZG5 A;  2D1H A;  1QPM A;  1QQI A;  2FXA A;  1XGN A;  4ZYG A;  3EET A;  4A6E A;  2W25 A;  2JTV A;  5E18 F;  2IVM A;  4I0B A;  1MDM A;  5FGM A;  1K78 B;  1KU9 A;  3O3K A;  4RGU A;  1S8N A;  4RGX A;  3CUQ B;  4Y13 A;  3HRM A;  4ESB A;  3LAJ A;  1GVJ A;  1BJA A;  4ASN A;  1LVA A;  1U5T A;  3D5L A;  3F72 A;  2VOD A;  2EA4 A;  2Q8K A;  1O7L A;  3FZV A;  4IXA A;  4IHS A;  3BDD A;  4RGS A;  4KNY A;  4HQE A;  3CUO A;  2MD5 A;  2Z9O A;  4WXD A;  4MHG A;  4F7Z A;  2VBZ A;  3BOQ A;  1ON2 A;  3VFZ A;  1XDU A;  2OQG A;  2HZT A;  2FF4 A;  4LK1 F;  1FBU A;  3K9T A;  1SMY F;  3MCZ A;  4IRI A;  1YTY A;  1P92 A;  3ZMT A;  3IKV A;  1F9N A;  2P7C B;  4IVN A;  3LST A;  5KK1 A;  1MJ9 A;  5JI6 A;  1HSJ A;  1CF7 A;  5K5Q A;  2YX7 A;  3RYP A;  3EDP A;  1SFX A;  2FSW A;  2ELH A;  1KYZ A;  2HKX A;  1YS7 A;  2FOK A;  2H94 A;  3WGG A;  6PAX A;  2HR3 A;  4BXU A;  2HTS A;  3GEZ A;  1YLF A;  2QBY A;  3T0Y A;  5H6R A;  3DQV C;  1EH7 A;  2L54 A;  1ZGA A;  5AIQ A;  1Z9C A;  4E70 A;  1MZB A;  3H3U A;  4RAY A;  3TO9 A;  1ZRD A;  5DCM A;  3L00 A;  1QGP A;  3MZY A;  2H6C A;  1ZN2 A;  4EMS A;  4DQ2 A;  1U8R A;  1J2X A;  5FD6 A;  3WTV C;  3COA C;  1B6A A;  5HS8 A;  1FC3 A;  4I98 B;  4HX8 A;  3VOE A;  2XGX A;  5HDG A;  2G7U A;  5ILV A;  3MFK A;  3LWF A;  2XAQ A;  5K1Y A;  4CZZ A;  3NEU A;  3GZ6 A;  1T6S A;  1S7A A;  1C0W A;  5CYV A;  4ESF A;  5HLI A;  5HOO A;  1BOA A;  3HUG A;  3GLX A;  4L18 B;  1QZZ A;  1W7P A;  5CLS A;  4N9I A;  4LK0 F;  1KQ0 A;  5ILU A;  3GO5 A;  2A6E F;  4OIO F;  4K2E A;  4ENK A;  3L9F A;  2NRA C;  3P9I A;  5CVJ A;  3RPU A;  5E20 A;  2CYY A;  4GGG A;  4Q4Z F;  3I5U A;  5ICC A;  3VOD A;  2KIF A;  1ZRC A;  3LA7 A;  3TO7 A;  2Z99 A;  3BJO A;  3HYI A;  5K5O A;  5ICE A;  1KU7 A;  3I71 A;  4MQV A;  1I27 A;  3W6J B;  5JR3 A;  1Y0U A;  2VT3 A;  1MD0 A;  1PP7 U;  2WWY A;  1MJA A;  4G7H F;  2COM A;  4EVI A;  4RB0 A;  3F8N A;  2M1B A;  1U5T C;  4G8X A;  2UXX A;  2EB7 A;  3F21 A;  4FX0 A;  1TBX A;  4G7Z F;  2BYV E;  2QWW A;  3F8F A;  2P5V A;  4HLY A;  1XGS A;  1JE8 A;  3R61 A;  1D5V A;  1G3W A;  4KDP A;  2EFQ A;  4ZH4 F;  3I64 A;  4M73 A;  1W5T A;  2QQ9 A;  5L3B A;  4RB3 C;  2P6T A;  4XLP F;  1HQC A;  2A6H F;  2JSC A;  4OIN F;  2BE5 F;  3LFK A;  2MH2 A;  4I2O A;  3JTH A;  2H09 A;  1U6G A;  4FX4 A;  1JXS A;  4GYG A;  3E6D A;  2OAZ A;  3ZN0 A;  3CJN A;  4N0B A;  5BPI A;  1S6L A;  4YIF A;  3DFG A;  3N4M A;  1R00 A;  3C1D A;  3KEO A;  2J5O A;  2VXZ A;  4P9U A;  4BHP A;  4EJW A;  2GA1 A;  3ECH A;  1B1B A;  4LLN A;  2YPR A;  3Q5F A;  5CVU A;  2GZW A;  1OYI A;  1TQP A;  4ETS A;  2F5E A;  2K4J A;  5L3E A;  4O6J A;  3WTS C;  4U0W A;  4CDG A;  5IT9 K;  5ERI A;  3J80 K;  4UVC A;  3GF2 A;  3RI4 A;  3HOS A;  2G7H A;  1OYY A;  3GUD A;  2DPD A;  3MEX A;  5BOX A;  4O5V A;  3FM3 A;  1P4X A;  4Q47 A;  4WX9 A;  1ON1 A;  3IL2 A;  1RNL A;  4H0E A;  1P6R A;  5HDN A;  2ZFW A;  1J59 A;  1FYL A;  4LD5 A;  4I09 A;  2CFX A;  2H6B A;  1G4D A;  1FBQ A;  2NYX A;  3F8C A;  3GZ5 A;  3MAJ A;  5AON A;  2F5C A;  1EH6 A;  2ZBK A;  4IPA A;  2W57 A;  2PMU A;  2CW0 F;  3R6S A;  2XRN A;  3H3Z A;  3DP7 A;  1IN4 A;  2XHK A;  1Q1H A;  5LGT A;  1ULY A;  2M30 A;  3GVA A;  4RAZ A;  3K1M A;  1ZRF A;  1DPU A;  2VBW A;  1FBS A;  1IN6 A;  2DU9 A;  4UV9 A;  2EWN A;  2EFO A;  2PFB A;  2OQR A;  3P9C A;  3PQJ A;  1FPQ A;  2K86 A;  2FBK A;  3IHU A;  3E97 A;  1L3L A;  2ZKZ A;  1HW1 A;  1R5H A;  5DCM B;  5IT9 Z;  2ZNY A;  4BHB A;  1V3F A;  4L5I A;  2L3D A;  2FRH A;  2XAJ A;  1J9I A;  1SMT A;  5FFX A;  3WTZ A;  2RNJ A;  4UHT A;  4BQA A;  5E1Z B;  1IAW A;  4KUM A;  5ICG A;  2Z33 A;  2P7V B;  4HQM A;  2HQR A;  4EM1 A;  1LB2 A;  3QU6 A;  3WTU C;  4M71 A;  3JSP A;  1J0R A;  3REO A;  2R7D A;  2FBI A;  5BPD A;  1RZ4 A;  1KU2 A;  2VE9 A;  1R1U A;  1ZAO A;  3HRS A;  3T8T A;  1RIO H;  5HLH A;  1F5T A;  2UWM A;  1KYW A;  3K0L A;  1XSD A;  1D3Y A;  2GQQ A;  1PDN C;  2OU2 A;  3JAM Z;  5L3F A;  1IUY A;  1T38 A;  3KET A;  1FT9 A;  1GHC A;  2FEZ A;  2JPB A;  2GWR A;  3TDU C;  1U78 A;  1ZAR A;  4OIP F;  3V7S A;  2XKO A;  4XLN F;  2A68 F;  4KIB A;  2HGC A;  3HSF A;  1S29 A;  4B8X A;  2EV0 A;  2VT2 A;  5LGU A;  3LA2 A;  4HZF A;  2XRO A;  5FB2 A;  3BP8 A;  3QPH A;  3BJ6 A;  5JHU A;  3SQN A;  1G6N A;  2VBY A;  3W6K B;  1UFM A;  4M9X A;  3GFJ A;  4HW0 A;  2ZME B;  5KVR A;  2G9W A;  1DUX C;  2DT5 A;  4OMY A;  3OOP A;  2DI3 A;  2L4M A;  1IN5 A;  4TV7 A;  3K2Z A;  3F8B A;  2FU4 A;  1RI7 A;  1BN5 A;  4MGR A;  1R36 A;  1JGS A;  1FYK A;  3PQK A;  2IJL A;  4ENN A;  1XB4 A;  3EYY A;  1UHM A;  3WGH A;  1K78 A;  2K27 A;  4EGZ A;  3KP5 A;  1FLI A;  3RPQ A;  2FE3 A;  1A04 A;  1CGP A;  1IXS B;  2HYG D;  4EM0 B;  1B9N A;  3WTT C;  2PN6 A;  3T8R A;  3FM5 A;  3GFM A;  3ZMU A;  1GXP A;  2TDX A;  5H20 A;  3E5U A;  3FXQ A;  5DDG A;  3CO6 C;  1XCB A;  4PCQ A;  2HTJ A;  2FBH A;  1U2W A;  2Y48 A;  1DDN A;  3CUQ A;  3H92 A;  4HOB A;  2C6Y A;  2QQB A;  4HX7 A;  3RTR A;  5BQT A;  4AWX B;  3BPX A;  3WE3 A;  1XGO A;  5D5V B;  1ZYR F;  3JSO A;  1SD5 A;  5E8G A;  3BPV A;  4S04 A;  1O3S A;  2DTR A;  4L9V A;  4MEX F;  4OMZ A;  1CF7 B;  5DD4 A;  3I54 A;  4AIK A;  1I1G A;  4GXO A;  2PLY A;  1IN7 A;  3O6B B;  1FZP B;  1SFU A;  1QBJ A;  3ZN1 A;  5D5X B;  3F6O A;  5K5R A;  2V1U A;  4U7D A;  2X4H A;  3EYI A;  4NQW A;  3GWZ A;  5D8K B;  5ICF A;  2HWV A;  2L02 A;  1ZLJ A;  3KP3 A;  1YG2 A;  2E7X A;  3K1P A;  2YSR A;  1PUE E;  5DUI A;  4QLC U;  5D5W B;  3TOA A;  4YII A;  2LDU A;  2JZY A;  2E1N A;  4P96 A;  3I58 A;  1MDM B;  1S3J A;  3TGN A;  4OIQ F;  2RN7 A;  1BC7 C;  4KMU X;  1MJB A;  1G3Y A;  2O0Y A;  4U7B A;  1TNT A;  4YG2 F;  2Z5U A;  5FFZ A;  3U9G A;  2FNP A;  2F5D A;  3TOB A;  4ZYD A;  3KEQ A;  5LGN A;  1W7P D;  4KIG A;  4R1H A;  5A2Q Z;  1SAX A;  3DEU A;  5BMZ A;  1YFH A;  2QLZ A;  3M7G A;  5CJ9 A;  3WU1 B;  2D2W A;  2J5P A;  3VB2 A;  2AXL A;  3TKY A;  1YQA A;  5L3C A;  1WRJ A;  3WTY C;  1YW9 A;  5E1W A;  4EV0 A;  3ZQ7 A;  4A0Z A;  1NHA A;  1H0M A;  1LJ9 A;  2A61 A;  4UVB A;  4IHT A;  1WWX A;  1JHF A;  5EEG A;  4G94 A;  1HW5 A;  1TTY A;  3EUH A;  3J80 Z;  3U2R A;  1I1S A;  2K4B A;  3B73 A;  2EV6 A;  3KP4 A;  4KN7 X;  1BIB A;  2BBY A;  1XGM A;  1FSH A;  3BY6 A;  3MWM A;  4UXN A;  4EJV A;  2O3F A;  2O8X A;  2HOE A;  1G3T A;  4HBL A;  1WQ2 A;  2GXG A;  4I7H A;  2A5Y B;  1HKT A;  1R5G A;  3DPT A;  4XSZ F;  4UV8 A;  1OPC A;  1R1V A;  3FMS A;  1B9M A;  4M6Y A;  1U5T B;  5FLX K;  2W85 A;  4CIC A;  2ZCW A;  5J8C A;  2ACJ A;  2XKP A;  3R4K A;  2ISY A;  5L3G A;  2PI0 A;  4M72 A;  1YS6 A;  2O6G E;  2MLK A;  2XAH A;  4G6D A;  4EM2 A;  1VTN C;  3L2C A;  4ZZL A;  2AS5 F;  4LFU A;  2QM3 A;  1SD7 A;  5LEK A;  3E5Q A;  4A6D A;  1F4K A;  1P4A A;  4M6X A;  2FML A;  5LRS A;  2HEO A;  2IRF G;  4BNC A;  3GFI A;  4UUV A;  2XAS A;  4RGR A;  4PGG A;  3ZPL A;  5DUK A;  1HBX G;  1EH8 A;  2JT1 A;  5DCF A;  1O3R A;  1ZRE A;  1H9G A;  3M8F A;  2XVC A;  2P4W A;  3WOD F;  3M1E A;  2HDC A;  4A0X A;  4LG0 B;  4PZJ A;  4JQF A;  2JRT A;  5J8F A;  2PJP A;  3QPT A;  5HS7 A;  5FLX Z;  1IZ1 A;  4LB6 B;  5JVT A;  2A3S A;  1LDK B;  2DPU A;  3ELK A;  3MQ0 A;  4U0V A;  1AOY A;  2MC3 A;  2DQR A;  3CUQ C;  3KCC A;  4I0A A;  3I59 A;  2W84 A;  4NHJ A;  4LG0 A;  2EV5 A;  1T2K A;  4EQQ A;  1FX7 A;  1IN8 A;  1XMA A;  2R7F A;  2CSO A;  2ZNZ A;  1HST A;  4U0Y A;  5LLQ A;  1ZHF A;  2YX4 A;  2STT A;  2ESN A;  2QVO A;  4KIC A;  4ENM A;  2QUF A;  1WSU A;  1XDS A;  1OMI A;  2OBP A;  1XD7 A;  2PMH A;  4FHT A;  3OV8 A;  5DYM A;  1K6O A;  3FXU A;  2HKO A;  5H6Q A;  3SZT A;  4PDK A;  1FY7 A;  2WC2 A;  3L7W A;  1ONV A;  1OYW A;  1T98 A;  5E8I A;  4ZZD A;  4S05 A;  4ZYH A;  2KIM A;  2Z3Y A;  5D4R A;  5ED4 A;  2STW A;  3HTU A;  1R23 A;  5ILS A;  1KQ9 A;  3FF5 A;  4LLL A;  1LDD A;  2RC4 A;  3CDH A;  3M9A A;  4JBA A;  4LB5 A;  2K02 A;  2A69 F;  1KGS A;  2B0L A;  3F8M A;  3CO7 C;  2F5F A;  2ADU A;  1J7K A;  1UST A;  1WI9 A;  1TQM A;  3R60 A;  1YO5 C;  3TO6 A;  2EA2 A;  5D8L B;  1TW2 A;  3JW4 A;  4EGY A;  2EFP A;  2NAZ A;  2QBY B;  2OZU A;  5BS6 A;  1TLH B;  3QU3 A;  2DBB A;  2X0L A;  3SZP A;  2DK5 A;  4EJT A;  3DF8 A;  4XBF A;  1FNN A;  3SFZ A;  3U1D A;  4B09 A;  2V6C A;  4IF4 A;  5A2Q K;  1HKS A;  1YIO A;  1XSX A;  4R8H A;  5IT3 A;  4RS8 A;  4MTE A;  3T5X A;  2XIG A;  2DW4 A;  3HSE A;  3GYH X;  5DD8 A;  2LF7 A;  4HA8 A;  3K1N A;  3IRR A;  2RGV A;  3PFI A;  3ZMS A;  2HQN A;  4L0Y B;  2IPQ X;  3WG9 A;  1OR7 A;  1SD4 A;  4L9T A;  1REP C;  4EJO A;  2VE8 A;  3QOP A;  2O61 A;  1S7O A;  4CHU A;  1ZGJ A;  1IF1 A;  3LA3 A;  4P55 A;  5E1X A;  3JTG A;  1P4W A;  3ISP A;  3RIR A;  3BWG A;  4G9Y A;  2LNB A;  2QZ8 A;  1ODD A;  3D0S A;  4O3M A;  1QZY A;  4WXC A;  2GA2 A;  3WU0 A;  1X3U A;  4DNC A;  5D5U B;  2KRF A;  5E17 F;  2M87 A;  5F1R A;  3VEP A;  3BJA A;  5CVR A;  3ZP5 A;  2QYO A;  1W7P B;  3N97 A;  1LEA A;  4PGH A;  3DKW A;  1LEB A;  2IT0 A;  4WF2 A;  2BEO A;  2Y0M A;  3NRV A;  4L5J A;  2IP2 A;  3TQN A;  3HRU A;  3ABU A;  2LKP A;  4AD9 A;  2PEX A;  4IRG A;  3F3X A;  4HF1 A;  3WGI A;  3FMQ A;  4YFK F;  4BHC A;  3J81 Z;  2KJC A;  4AIH A;  4EJU A;  3P7N A;  1KA8 A;  2DAO A;  1ZLK A;  3I59 B;  3F22 A;  4NB5 A;  4OIR F;  1P2F A;  3WE2 A;  4R79 A;  3HHH A;  3K69 A;  2RVC A;  2WV0 A;  5EEH A;  3KFW X;  1HKQ A;  3KLO A;  4HF2 A;  4A5N A;  1HW2 A;  2DLL A;  3L09 A;  2QQA A;  3GXO A;  4Z2Y A;  2L4A A;  3SXY A;  4HDV A;  2ISZ A;  3GX4 X;  1MKM A;  2KKO A;  4QWQ A;  4CGZ A;  2IA0 A;  4HF0 A;  4HLX A;  2RDP A;  1IRF A;  4KFC A;  3E6C C;  1O57 A;  2O03 A;  1W5S A;  3DV8 A;  1BM9 A;  4L9J A;  2CGP A;  1YYV A;  5CVI A;  1FSE A;  1LQ1 A;  2JPC A;  2OD5 A;  2P8T A;  2K7L A;  3QRF F;  2XAF A;  2V1D A;  1XMK A;  2CO5 A;  4HYE A;  1IRG A;  3QAH A;  4WCG A;  2Q2E A;  2PBI A;  4GYI A;  3B02 A;  3LQQ A;  2QEN A;  3KE2 A;  1ZH5 A;  4M9S A;  1V4R A;  3M8E A;  4CO8 A;  3DPL C;  4LLG F;  2P5L C;  2A07 F;  1O3Q A;  3KLN A;  3V8J A;  4IJA A;  1U3E M;  2Y75 A;  1F1Z A;  1K7A A;  3TDZ C;  1L0O C;  2KIU A;  4I01 A;  4WK8 F;  1FP2 A;  2DK8 A;  4FT8 A;  1IXR C;  3C3W A;  4BH9 A;  2P6S A;  3BZ6 A;  1J75 A;  4ZYE A;  1RUO A;  1OKR A;  5LRR A;  3WTX C;  3FHZ A;  2GIV A;  3GW2 A;  1R22 A;  1D8K A;  3I53 A;  1HXD A;  1UB9 A;  1FYM A;  4BYY A;  3IKT A;  1BI1 A;  5TJJ A;  5LHG A;  4AIJ A;  2FA5 A;  3R0A A;  1XSV A;  4KIF A;  3J81 K;  4OU0 A;  1B59 A;  4YFX F;  2XV4 S;  1QO0 D;  1QNT A;  2XUB A;  3NQO A;  5J6X A;  2ETH A;  2HS5 A;  2VBX A;  1TNS A;  1O3T A;  3ABT A; 
#chains in the Genus database with same CATH topology
 2NRA C;  1W4M A;  1AWC A;  4LGW A;  1Z6T A;  3E6M A;  1I5Z A;  2JWT A;  4KYW A;  4HPQ A;  5CKT A;  4KT6 A;  5DS9 A;  4HV6 A;  3GTJ J;  3A2K A;  2MLG A;  4ZTJ A;  1SAU A;  4N4O B;  1KZH A;  3KP7 A;  1NG7 A;  4HNV A;  5FD5 A;  4PJL A;  3GLL A;  3E1S A;  1SD6 A;  5B66 C;  2CMP A;  3ZMV A;  3F23 A;  1Z05 A;  4PFO A;  4LMY A;  4BY1 J;  2L7M P;  4RBO A;  4AVP A;  3ROU A;  3O2P E;  1IW7 F;  2K3P A;  5CPR B;  1T0F A;  2EK5 A;  4U88 A;  2KLO A;  3DXJ F;  1KQ8 A;  2ZME A;  5HDK A;  5DEQ A;  4B1R A;  4KA4 A;  4KIS A;  4AID A;  4PJM A;  5LHI A;  4I02 A;  2B7E A;  3LNQ A;  1BIA A;  2L01 A;  1EJ9 A;  2DOE A;  2VN2 A;  3O8G A;  1WJE A;  4EAT A;  1HA8 A;  1R58 A;  1G3S A;  1BR4 A;  1LDJ A;  3DLA A;  3JAM K;  2CQQ A;  2PG4 A;  1R1T A;  2NOJ B;  3OL3 A;  1YIJ I;  3P9K A;  1RKT A;  3HHG A;  2V9P A;  3IH4 A;  3HRT A;  1O7F A;  3KP6 A;  4KMF A;  2YU3 A;  1X19 A;  3HB9 A;  4MQ9 F;  3C18 A;  4B4C A;  4FAS D;  1OCO H;  1POG A;  3BG5 A;  4A0Y A;  2GXA A;  2HPM A;  2RKH A;  1WJC A;  1BI0 A;  3RKY A;  2AQE A;  4ZYA A;  2OA4 A;  4DBQ A;  1H9T A;  2XSD C;  4A5M A;  5J1U A;  1JTX A;  4BUP A;  4E7K A;  2WTE A;  1BL0 A;  1DPR A;  5CVV A;  3V8K A;  4L9N A;  2R92 J;  3CCJ I;  1BI2 A;  2E60 A;  3PIO F;  3V7R A;  5D6F A;  4CCJ A;  4XLF A;  4A3E J;  2VUM J;  1SFE A;  2EBI A;  2H27 A;  2GAU A;  1FOY A;  4JYK A;  2E7W A;  3JRB A;  5LBQ A;  5F64 A;  1LNW A;  2L9S A;  3CMY A;  4GO1 A;  3FMR A;  1T39 A;  4G7O F;  1QHH D;  1E0E A;  3CCY A;  3AAF A;  1TW3 A;  2HQ5 A;  2MW8 A;  3Q9S A;  4HG2 A;  4MEY F;  4G6Q A;  3GBG A;  2F2E A;  4PUS A;  2EPF A;  4NC7 A;  3RDI A;  2K5C A;  4ENJ A;  2R7V A;  3I0T A;  2XGC A;  3IUO A;  4E7H A;  3RKX A;  2R5Y A;  1Z6R A;  3MZH A;  2JUG A;  3ASN H;  2EH3 A;  2XPW A;  4UVA A;  3LFU A;  2VPR A;  5HVQ C;  2IA2 A;  4CXF A;  1R4M B;  5M3F J;  2VOO A;  5J1Y A;  1XN7 A;  3HSR A;  5HLT A;  2F4O B;  3OYD A;  2D45 A;  4NBQ A;  4A2U A;  2UZK A;  3AG2 H;  5AIP A;  1AKH A;  1GV2 A;  1LE8 B;  3HIF A;  4LIV A;  2TRT A;  4QSH A;  1G8X A;  3V4G A;  1ETK A;  1IXC A;  5D4S A;  1E2X A;  3AG1 H;  4A3C J;  1UHW A;  4WXH A;  3DBH B;  1PUF B;  1Z3Y A;  4A12 A;  3QWL A;  2JK3 A;  2LSO A;  4B43 A;  3S2W A;  1FTT A;  1XPX A;  4BY7 J;  2CQK A;  4HAM A;  4NQW B;  2H1L A;  3FX3 A;  4NC6 A;  2XAG A;  3E6B A;  2EFW A;  2VOP A;  5FKN A;  4D7N A;  3ULQ B;  1Z1D A;  3HOT A;  3QYF A;  3RPU D;  3S1R J;  4Y17 A;  9ANT A;  3V42 A;  3HBL A;  3ERE D;  3KZZ A;  4M3F A;  3PIP F;  5TRD A;  4JP0 A;  2GOM A;  3GFL A;  2HPI A;  2DYR H;  1RKW A;  1BI3 A;  3E5X A;  4PSW A;  4JK1 X;  1VQP I;  4XLH A;  1ZR4 A;  4PJN A;  5F0F A;  4DIQ A;  1UCR A;  2FMY A;  2AXT C;  1BBY A;  3I4P A;  4IX7 A;  3ERM A;  3ZMD A;  3QP5 A;  3RJP A;  1LFU P;  5DV5 A;  1FWZ A;  2IEK A;  3BRO A;  4XN0 A;  1YOV B;  4M9Z A;  4LJZ F;  3CCU I;  3FHN A;  3M1C A;  1R5I D;  3T1B A;  3HDD A;  1YX5 A;  3J7A Y;  4DYQ A;  3G73 A;  2JMW A;  5HLG A;  3I56 I;  3JRC A;  1IC8 A;  2RV8 A;  1I6X A;  4ON0 A;  1VQ5 I;  2KRH A;  1JJ6 C;  1WI3 A;  2W24 A;  5EG0 B;  4UNO A;  4XK4 A;  4OAZ A;  1R9T J;  3ML6 A;  4KT5 C;  4UUT A;  1FP1 D;  1YW7 A;  2PMZ N;  3ECO A;  4HV5 A;  2GXB A;  2BGC A;  1STZ A;  2M8E A;  3FXR A;  3IWZ A;  1G2H A;  3V8L A;  3H35 A;  2MH9 A;  1MW7 A;  1E3O C;  3FWE A;  3HG9 A;  3G3Z A;  2K9Q A;  3KZY A;  4A3B J;  4MNU A;  4BJ5 C;  2YR2 A;  5D6E A;  2NNY A;  4A3L J;  2V1X A;  2E34 A;  4L0Z B;  2KZV A;  2NXN B;  2RQQ A;  3K2A A;  3TW7 A;  3JR9 A;  1O4X A;  1RR8 C;  4D9J A;  2QQ8 A;  1MNE A;  2V9V A;  2WB1 N;  3DEW A;  3Q0V A;  2GLO A;  2KDZ A;  3FKI J;  1GVD A;  4XL9 A;  2ME6 A;  4KJZ A;  1B72 B;  3K7A J;  3EQL F;  2V79 A;  4BGD A;  1D0Z A;  2PJR A;  2DDA A;  3BZC A;  2KJB A;  2X1E A;  3CTA A;  2DTZ A;  1DP7 P;  3OS2 A;  4FQG A;  2LRE A;  2CWE A;  2IW5 A;  3TL4 X;  2EIJ H;  2Q1Z B;  4B47 A;  3KP2 A;  4RM3 A;  2R7S A;  4BDZ A;  3CJT B;  2VIX A;  4CH7 A;  3H0D A;  3BTI A;  3WHB A;  5M5Y J;  2DFI A;  3LL7 A;  2IXS A;  3JRG A;  4ESJ A;  2DCE A;  2M7A A;  5LHH A;  3FXM A;  3RYR A;  5GAH J;  5FJ8 J;  2QSH X;  1X1A A;  3Q9V A;  1TT0 A;  1ZG1 A;  3PO3 J;  3EPZ A;  5FO5 A;  1D5Y A;  1Y1V J;  2BHZ A;  1GXQ A;  4I6Z A;  3E0J B;  4D0P A;  5EDN A;  2HFH A;  2ZO4 A;  3CCR I;  2MBF A;  1Z91 A;  4P9F A;  2D1V A;  5LEJ A;  4YIR X;  5F27 A;  2ZJR F;  1W0U A;  2QCO A;  3A4C A;  1Y39 A;  1V5F A;  2DA2 A;  1H89 C;  4BXX J;  1VQK I;  1MMG A;  1ZQ3 P;  3RKW A;  2NVX J;  2FNA A;  4M74 A;  2M4G A;  1X1B A;  2O8K A;  4MTD A;  4Y15 A;  5F6F A;  3V7C A;  2IGK A;  4Q48 A;  5EGO B;  2WAF A;  4LOC A;  1BC8 C;  2VC1 A;  4HNT A;  2DO7 A;  3NWT A;  2B9S A;  1EV7 A;  1J5Y A;  3IRQ A;  4RB2 C;  2PX9 A;  2KIS A;  1Y56 A;  2LF8 A;  4N9H A;  4A69 C;  2OZ6 A;  4FTH A;  2JA2 A;  2BV6 A;  2I10 A;  5C44 J;  3W3C A;  4H4K C;  4XLE A;  1WKM A;  2MAB A;  2VC0 A;  3BG9 A;  4A3K J;  4KN4 X;  1IRX A;  4GFB A;  1WCM J;  4GCV A;  3WTW C;  5DTD A;  3PNV A;  4BAY A;  5EF6 A;  3IAM 2;  2M45 A;  3HOZ J;  3H9Q A;  5DM7 F;  1IV6 A;  4HDU A;  1UZC A;  2R3S A;  2R4G A;  1RUN A;  5FKM A;  2LOO A;  1USS A;  2EFN A;  5HS9 A;  4RB1 A;  2CG4 A;  1K79 A;  4A3M J;  4BJ6 C;  2R7T A;  1TQI A;  2ZXJ A;  1KU3 A;  2DOF A;  3C7J A;  2E71 A;  3LAP A;  1PP8 F;  1R7J A;  1XCV A;  3E3V A;  4HX4 A;  2D5V A;  1E17 A;  3QP6 A;  1N25 A;  3R0J A;  4CCN A;  2JA6 J;  1D8J A;  2ZJ2 A;  2X6X A;  3OIP A;  4CYD A;  5JFR A;  1GLN A;  4P5O A;  2R5Y B;  3KX2 A;  5L3D A;  1A6I A;  1JT0 A;  1VQN I;  2MA3 A;  1K6Y A;  2EJR A;  2NS7 A;  3A01 B;  4YFN F;  4NUB A;  3VSK A;  4Z6Y A;  2M5W A;  4IO9 F;  4XSX F;  3F6V A;  2Q0O A;  2VON A;  3AG3 H;  4WWC A;  2ESH A;  4J19 A;  1LUJ B;  1D1A A;  3ZMZ A;  3S3N A;  2DMP A;  3F9K A;  2DQL A;  2IA1 A;  2FQ3 A;  2E1C A;  4Q5S F;  2NNN A;  2K9N A;  3CC2 I;  3IC7 A;  5IYB J;  2RQP A;  2DOD A;  5FKK A;  3LQR A;  1FOK A;  4IRH A;  1IDZ A;  3CLO A;  4CYC B;  3SHF A;  1YW8 A;  5IYD J;  1JHH A;  2PQ8 A;  1ZG3 A;  3GTP J;  2HYF A;  2NS0 A;  2EIK H;  3IWF A;  4DZJ A;  3IAS 2;  1R49 A;  4AUX A;  1MGT A;  2UXN A;  1B4A A;  3AL0 C;  3HTS B;  2P5K A;  4OOI A;  5FRN A;  1RET A;  4XRF A;  1X3W B;  1Z7U A;  3J7A O;  1JGG A;  1ZG5 A;  2JA8 J;  3HL2 A;  1QA6 A;  5IYC J;  2D1H A;  3DTE A;  1QPM A;  4YRV A;  1QQI A;  3OIQ A;  3PL8 A;  2FXA A;  3HGG A;  3S93 A;  1XGN A;  1ZEL A;  4EEF G;  4ZYG A;  3EET A;  4BQN A;  4A6E A;  4X0G A;  4U87 A;  3JCU C;  2W25 A;  2JTV A;  5E18 F;  2IVM A;  4JX5 A;  2XF6 A;  4I0B A;  1MDM A;  5FGM A;  1K78 B;  1KU9 A;  3O3K A;  4ZTF A;  2OJE D;  4RGU A;  5B1A H;  1S8N A;  2EZH A;  2RAE A;  3CMA I;  2R5Z B;  4RGX A;  3CUQ B;  4M3E A;  4Y13 A;  2IS4 A;  3HRM A;  4ESB A;  5J4Y A;  3LAJ A;  1GVJ A;  5C4J J;  1BJA A;  4C9Y A;  4ASN A;  1LVA A;  3F72 A;  1U5T A;  3D5L A;  2VOD A;  3DWL E;  2EA4 A;  2TCT A;  2Q8K A;  4BJT A;  1D1C A;  3RQ4 A;  1O7L A;  2LBF B;  3FZV A;  3MKZ A;  3A03 A;  4C2U A;  4IXA A;  4IHS A;  3BDD A;  1IDY A;  4UB8 C;  4RGS A;  4KNY A;  4HQE A;  1Y8Q B;  2UV1 A;  2MD5 A;  3CUO A;  3GTQ J;  2Z9O A;  4WXD A;  3DBL B;  4MHG A;  2HNH A;  2VBZ A;  3SFI A;  4F7Z A;  2QGU A;  3BOQ A;  3HKZ A;  3HJE A;  1ON2 A;  3VFZ A;  3ZQH A;  1XDU A;  2OQG A;  2HXI A;  3HOU J;  2IBD A;  1DGR M;  2HZT A;  1T0F C;  2FD5 A;  1WJF A;  1FBU A;  2FF4 A;  2OCE A;  3K9T A;  4LK1 F;  1K83 J;  2LKX A;  1YJ9 I;  1SMY F;  3MCZ A;  1V5E A;  4IRI A;  3B6A A;  4DZP A;  1YTY A;  1A35 A;  1P92 A;  1VQ7 I;  2M2E A;  3ZMT A;  3IKV A;  1F9N A;  2GIZ A;  2WAD A;  2P7C B;  1VND A;  4PK4 A;  4IVN A;  3LST A;  1YRN A;  5KK1 A;  1MJ9 A;  1VQM I;  4C3I J;  1T33 A;  4XRM A;  1SFO J;  5JI6 A;  1HSJ A;  3I55 I;  1CF7 A;  2HOS A;  4RMN A;  5K5Q A;  2VXD A;  2YX7 A;  3RYP A;  5GPA A;  3EDP A;  1Y0N A;  1SFX A;  4DW6 A;  2ELH A;  1KYZ A;  2FSW A;  5JHF A;  2HKX A;  1YS7 A;  2FOK A;  3CCE I;  2VL8 A;  2H94 A;  3WGG A;  6PAX A;  1IUF A;  2HR3 A;  4BXU A;  4PFP A;  2HTS A;  3GEZ A;  1R71 A;  3K70 C;  3OYB A;  1YLF A;  2XSJ C;  3D5S C;  2OUM A;  1JT6 A;  2BHY A;  4BBS J;  2QBY A;  1UAA A;  2X1C A;  3T0Y A;  3PNY A;  4M3G A;  3H36 A;  3S1Q J;  4Y52 J;  5H6R A;  3DQV C;  3OR2 C;  1EH7 A;  1RPW A;  1ZGA A;  2L54 A;  5AIQ A;  5B5E C;  4ITV A;  1Z9C A;  1Y1W J;  2X6O A;  4E70 A;  1MZB A;  3H3U A;  2ZME C;  3I4M J;  4RAY A;  3CCQ I;  3TO9 A;  1ZRD A;  3Q0W A;  2XB5 A;  5DCM A;  3G71 I;  3L00 A;  2V7F A;  1YX3 A;  1QGP A;  3MZY A;  4IL6 C;  2H6C A;  1ZN2 A;  4EMS A;  4DQ2 A;  3S8P A;  3OYG A;  1U8R A;  1J2X A;  5IP6 A;  2VQH A;  3DCF A;  2DYS H;  5FD6 A;  3WTV C;  3COA C;  4Y33 A;  2DFE A;  1T95 A;  1E3P A;  1B6A A;  1OR7 C;  5HS8 A;  1X3Z B;  4II2 A;  3G2B A;  1FC3 A;  4I98 B;  4HX8 A;  3VOE A;  4UUS A;  2R5Z A;  1BW6 A;  2XGX A;  5K7F A;  5HDG A;  2G7U A;  1IJW C;  5ILV A;  3MFK A;  3LWF A;  1JI8 A;  2KMU A;  2R7O A;  1EA3 A;  2XAQ A;  5K1Y A;  1R4N B;  1WVR A;  4CZZ A;  4DBR A;  1MNM C;  3NEU A;  3BTC A;  3GZ6 A;  1QU3 A;  1T6S A;  1S7A A;  1C0W A;  5CYV A;  1S9H A;  4ESF A;  4E7J A;  5HLI A;  5HOO A;  5J4V A;  3OSF A;  3HXL A;  3ABL H;  1QVT A;  1BOA A;  3HUG A;  4GRI A;  4QPQ A;  4C2T A;  1H88 C;  2KHM A;  3GLX A;  1Z3X A;  4L18 B;  1QZZ A;  1W7P A;  5CLS A;  2QSF X;  3BR2 A;  4AM3 A;  4N9I A;  4LK0 F;  1KQ0 A;  5ILU A;  3GO5 A;  2A6E F;  3K4B A;  1BA5 A;  4OIO F;  4K2E A;  4ENK A;  4NNJ A;  1S72 I;  2CQX A;  2LKS A;  4F52 A;  1FIA A;  1TWF J;  3L9F A;  3P9I A;  5CVJ A;  1X4O A;  3RPU A;  1ETY A;  2CYY A;  2M34 A;  4GGG A;  5E20 A;  4XRS A;  1W36 D;  3WG7 H;  2XGE A;  4Q4Z F;  3I5U A;  3QOD A;  5ICC A;  3VOD A;  2KIF A;  1ZRC A;  3LA7 A;  1B72 A;  2E2H J;  3TO7 A;  1I6H J;  5IOZ A;  2Z99 A;  3CES A;  1BOB A;  2A5W A;  1OLT A;  3BJO A;  3HYI A;  2CFO A;  3C2G A;  4P1W A;  5K5O A;  5ICE A;  2ICW G;  1KU7 A;  3I71 A;  4MQV A;  1I27 A;  3W6J B;  5JR3 A;  1DP3 A;  1TP4 A;  1X1D A;  2DOA A;  1Y0U A;  1YIT I;  2VT3 A;  1MD0 A;  2BVM A;  1ZR2 A;  1PP7 U;  2WWY A;  2KPM A;  4A3F J;  1MJA A;  4PJJ A;  4V2F A;  4G7H F;  4A93 J;  2B63 J;  2XGD A;  1X1C A;  2COM A;  4EVI A;  3G4S I;  2M9H A;  4RB0 A;  3F8N A;  2M1B A;  1U5T C;  4G8X A;  2UXX A;  2EB7 A;  1Z67 A;  3F21 A;  2CV1 A;  4FX0 A;  1TBX A;  2Z1D A;  1P7J A;  4G7Z F;  4BE1 A;  2BYV E;  1XMX A;  2QWW A;  1JKQ C;  2XC7 A;  4JX6 A;  4Y4R A;  4BL0 B;  3F8F A;  2P5V A;  2M0M A;  3BTJ A;  4MFE A;  4HLY A;  4QTR A;  3FKJ A;  4FCY A;  1XGS A;  1DU6 A;  1JE8 A;  2OV7 A;  3R61 A;  1TT5 B;  2MGQ A;  3VYU B;  2XDV A;  3M07 A;  5IOY A;  1D5V A;  1G3W A;  4KDP A;  2CQN A;  2EFQ A;  2LYC A;  4ZH4 F;  3I64 A;  3BQY A;  4M73 A;  5F1J A;  1W5T A;  1QZE A;  2MSY A;  2QQ9 A;  3FXL A;  3C2B A;  2JSP A;  5L3B A;  4RB3 C;  2P6T A;  3MKL A;  3RZO J;  5M5X J;  4XLP F;  1HQC A;  2A6H F;  2KQR A;  3WHC A;  5HNF A;  2JSC A;  4OIN F;  2BE5 F;  1A6Q A;  3LFK A;  2MH2 A;  4I2O A;  2KDO A;  1AHD P;  2E2J J;  3VYR B;  3JTH A;  2H09 A;  1U6G A;  4FX4 A;  4RLF A;  3MN2 A;  1JXS A;  4GYG A;  3E6D A;  2OAZ A;  1SFK A;  4CYC A;  2LLK A;  3ZN0 A;  1VQ6 I;  1A31 A;  1TWG J;  3IH3 A;  3A1Y A;  3CJN A;  4N0B A;  1YI2 I;  5BPI A;  1S6L A;  4YIF A;  2XRL A;  4OAY A;  3DFG A;  2ZXW H;  3N4M A;  3LSJ A;  3NWS A;  1JUP A;  2HOA A;  5FLM J;  1R00 A;  1D0Y A;  3C1D A;  3KEO A;  1XG1 A;  2J5O A;  2I5U A;  2JVG A;  1IRZ A;  2VXZ A;  4P9U A;  1PUF A;  4XKB A;  1E3H A;  4BHP A;  2CRG A;  4EJW A;  3D1N I;  2GA1 A;  4B48 A;  1X2N A;  3ECH A;  2KL4 A;  1B1B A;  1SEU A;  4LLN A;  3W2V A;  2YPR A;  3ZQL A;  3Q5F A;  3BR5 A;  5CQE A;  5CVU A;  3PUB A;  1ACI A;  2GZW A;  1OYI A;  1TQP A;  4IOC F;  3M8J A;  4ETS A;  4MO7 A;  2F5E A;  2K4J A;  2N8G A;  5L3E A;  5F08 A;  2ELK A;  3RKQ A;  4O6J A;  3MZ8 A;  2Y9Z A;  1FOX A;  3WTS C;  4U0W A;  4RAG A;  4CDG A;  5IT9 K;  3KYD B;  5ERI A;  5IY5 H;  3J80 K;  4UVC A;  1GV5 A;  3GF2 A;  3RI4 A;  3HOS A;  2G7H A;  1OYY A;  3GUD A;  2DPD A;  3MEX A;  3K4C A;  2O7O A;  5BOX A;  3A0B C;  4O5V A;  2BY2 A;  3OYA A;  1IG7 A;  4V19 K;  3FM3 A;  3UNG C;  1KON A;  1P4X A;  2BW3 A;  4Q47 A;  5TGT A;  4WX9 A;  1ON1 A;  3SDG A;  3OS1 A;  3IL2 A;  1RNL A;  4XOR A;  1I50 J;  4H0E A;  1P6R A;  5J40 A;  5HDN A;  2ZFW A;  1J59 A;  3CJR B;  1R6R A;  1FYL A;  4LD5 A;  3MD2 A;  4I09 A;  3BCA A;  1RC9 A;  2CFX A;  2K9L A;  4B3X A;  2H6B A;  3OL4 A;  4IEJ A;  4AC0 A;  1G4D A;  1FBQ A;  2NYX A;  3F8C A;  3GZ5 A;  3MAJ A;  5AON A;  2DJN A;  2F5C A;  1EH6 A;  2ZBK A;  4IPA A;  3DKY A;  2V4J C;  2W57 A;  2QEX I;  2PMU A;  2CW0 F;  3R6S A;  2XRN A;  3H3Z A;  3DP7 A;  2XPV A;  3CC7 I;  2F5V A;  1IN4 A;  4RLQ A;  2XHK A;  1Q1H A;  3RZD J;  3CMM A;  4V2G A;  5LGT A;  5FKO A;  1X1P A;  1ULY A;  2M30 A;  3GVA A;  2E5Z A;  4RAZ A;  3K1M A;  3BR3 A;  2V26 A;  1ZRF A;  2IS1 A;  4HRI A;  1DPU A;  1OCR H;  1MMS A;  2VBW A;  4YEL A;  2O5R A;  1FBS A;  2R7X A;  1IN6 A;  1TC3 C;  5B1B H;  2DU9 A;  3KYL A;  3HOV J;  4UV9 A;  5EYR A;  3VSL A;  5J3L A;  2EWN A;  2EFO A;  2WAQ N;  4J00 A;  4MLO A;  3HOX J;  2PFB A;  2OQR A;  1HDP A;  3W2W A;  3P9C A;  2ZJP F;  1K4S A;  2HOT A;  3ZGK A;  3FIW A;  3SYT A;  4XNF A;  3PQJ A;  2M0C A;  3LSP A;  1FPQ A;  1W0T A;  3QOE A;  2K86 A;  2FBK A;  4FET A;  3IHU A;  1F43 A;  4DOZ A;  3E97 A;  1MBF A;  1ZKG A;  1L3L A;  2ZKZ A;  1HW1 A;  5TIS C;  1R5H A;  5DCM B;  2W1O A;  5IT9 Z;  3JRH A;  2ZNY A;  4CCO A;  3BG6 A;  3J7Z I;  4BHB A;  2DDB A;  1XTA A;  4HEA 2;  1WJD A;  3BCB A;  2VJ4 A;  1V3F A;  2CUE A;  4L5I A;  2XAJ A;  2FRH A;  2L3D A;  2VJ5 A;  3L2V A;  1MH4 A;  1JKP C;  1J9I A;  3BR6 A;  4LIU A;  4GDF A;  3L2U A;  5JLW A;  2LY9 A;  1SMT A;  1MND A;  5FFX A;  4CUG A;  3WTZ A;  1M1E B;  2RNJ A;  1FMW A;  2DA7 A;  4MFD A;  4UHT A;  3VWB A;  4BQA A;  1N77 A;  5E1Z B;  4F91 B;  2H8W A;  2WAE A;  1IAW A;  4KUM A;  5ICG A;  2Z33 A;  2P7V B;  4HQM A;  2HQR A;  3SDB A;  4EM1 A;  3QU6 A;  1LB2 A;  2CUZ A;  5FKL A;  5E3N A;  3WTU C;  4M71 A;  3JSP A;  1VI0 A;  1J0R A;  2XF5 A;  2R7D A;  3REO A;  1GDT A;  1VQ9 I;  2FBI A;  5BPD A;  1OCP A;  2XB0 X;  1VF9 A;  1RZ4 A;  1KU2 A;  2VE9 A;  3BQZ A;  1R1U A;  1ZAO A;  2DMU A;  4D7M A;  3LSK A;  3HRS A;  3MKW B;  4IHW A;  4W97 A;  1YE9 A;  1WHU A;  3T8T A;  1RIO H;  5GAG J;  5HLH A;  1YRN B;  3GTO J;  3ZQQ A;  1F5T A;  2UWM A;  4NDL A;  1KYW A;  3K0L A;  1RR7 A;  1XSD A;  1D3Y A;  2VB6 A;  4G12 A;  3KIO A;  3BZK A;  2GOX B;  1T56 A;  2GQQ A;  1PDN C;  3PJR A;  2OU2 A;  3OOU A;  1P9Q C;  2EIM H;  3JAM Z;  2VKV A;  4XOP A;  5L3F A;  2CV0 A;  3H5A A;  2YUS A;  1IUY A;  1T38 A;  3KET A;  4XID A;  1FT9 A;  1GHC A;  3I3L A;  2FEZ A;  2JPB A;  3FK6 A;  3HPH A;  2GWR A;  3B6C A;  3TDU C;  1U78 A;  1LKX A;  2MD0 A;  1ZAR A;  4OIP F;  3V7S A;  4BU2 A;  3MKY B;  5E3O A;  2OCC H;  3H0G J;  4N4N B;  2XKO A;  4PSX A;  4XLN F;  2A68 F;  2X48 A;  2DMT A;  4KIB A;  2HGC A;  3DTI A;  3H1C A;  2VQC A;  1S29 A;  1F36 A;  2XAU A;  3HSF A;  4B8X A;  2EV0 A;  2M4K A;  2KP6 A;  2VT2 A;  5E3M A;  2JJ7 A;  5LGU A;  3LA2 A;  4HST A;  4HZF A;  3IH2 A;  3ZR8 X;  2XRO A;  5FB2 A;  3VYS B;  1MBG A;  3BP8 A;  3QPH A;  3BJ6 A;  3A0H C;  5JHU A;  3SQN A;  1G6N A;  2X51 A;  2VBY A;  1U9N A;  2H8R A;  2Y0S A;  1WJA A;  3ZQI A;  2WAQ A;  3W6K B;  4RM2 A;  1UFM A;  4M9X A;  5JVG F;  3GFJ A;  2BY0 A;  4HW0 A;  1Z77 A;  2ZME B;  5KVR A;  3S14 J;  5JLX A;  1LVK A;  2G9W A;  1DUX C;  2DT5 A;  1HDD C;  4OMY A;  5BNG A;  2KZG A;  3OOP A;  2VJI A;  2DI3 A;  2L4M A;  5DM6 F;  3L2R A;  2VLA A;  5CQG A;  3HOW J;  1X2M A;  2IAI A;  1IN5 A;  4TV7 A;  3K2Z A;  3F8B A;  3QYB A;  4AYB A;  2FU4 A;  4IHX A;  3RQI A;  4A3D J;  2VKD A;  1RI7 A;  3PUF A;  3TBI A;  1BN5 A;  4MGR A;  4ZDL A;  1R36 A;  1VFC A;  1JGS A;  1JUS A;  2V6E A;  1ITY A;  3AKZ A;  1G59 A;  1FYK A;  2IS2 A;  3ONQ A;  4S0H B;  1HF0 A;  3PQK A;  2ZJQ F;  1U9O A;  3S17 J;  4A3I J;  3TMO A;  2IS6 A;  4IHV A;  2IJL A;  4ENN A;  3OYC A;  1XB4 A;  2P81 A;  3EYY A;  2L7K A;  3X2Q H;  3PNT A;  1UHM A;  3WGH A;  2CV2 A;  4XQF A;  1K78 A;  2K27 A;  4EGZ A;  3KP5 A;  1FLI A;  3RPQ A;  3CME I;  2FE3 A;  1A04 A;  3OYI A;  3HOY J;  1CGP A;  1IXS B;  3HC7 A;  2HYG D;  3MVP A;  1ZGW A;  4EM0 B;  2JN6 A;  2HDD A;  2W48 A;  1B9N A;  3WTT C;  3BG7 A;  1RES A;  2PN6 A;  4BS9 A;  4Y7N J;  3T8R A;  3FM5 A;  2CS3 A;  2BY3 A;  3L2W A;  5EJC A;  3GFM A;  1MMN A;  3ZMU A;  1GXP A;  2TDX A;  1APL C;  2R7Z J;  5H20 A;  3E5U A;  3FXQ A;  5DDG A;  2Y69 H;  3CO6 C;  2WB1 A;  1XCB A;  4PCQ A;  2HTJ A;  3L1P A;  2EIN H;  2FBH A;  1U2W A;  2JQ7 A;  3HZJ A;  4YEJ A;  2WY8 Q;  1MH3 A;  1BR1 A;  1D1B A;  1QHG A;  2QF7 A;  2KIQ A;  2Y48 A;  4F55 A;  1DDN A;  2ID3 A;  3CUQ A;  3H92 A;  4HOB A;  2EZL A;  2K85 A;  2C6Y A;  2QQB A;  5KNL A;  4HX7 A;  3RTR A;  3CCM I;  4ZC3 A;  3OSG A;  1XX5 A;  5BQT A;  4AWX B;  3BPX A;  3G1O A;  3ABK H;  3WE3 A;  1XGO A;  5D5V B;  1ZYR F;  3JSO A;  3ZOB A;  5J47 A;  1SD5 A;  5E8G A;  3BPV A;  4S04 A;  1O3S A;  1MSE C;  2DTR A;  4L9V A;  2QA4 I;  4OMZ A;  4MEX F;  1CF7 B;  1WH7 A;  3TP3 A;  1MMD A;  5DD4 A;  1CQT A;  3I54 A;  4W1U A;  1AKH B;  4AIK A;  4II3 A;  1Q1V A;  3L2Q A;  1I1G A;  2KT0 A;  2XPU A;  4GXO A;  2PLY A;  1IN7 A;  2X6W A;  3O6B B;  1FZP B;  5LD2 C;  1SFU A;  4C3H J;  1QBJ A;  3CCV I;  3ZN1 A;  2NVQ J;  5C3E J;  2BXZ A;  5D5X B;  4L5E A;  1HLV A;  3F6O A;  2ZB9 A;  5K5R A;  1U8B A;  2CH0 A;  3H9J A;  2V1U A;  4U7D A;  2X4H A;  3EYI A;  4NQW A;  2NOG A;  2LC2 A;  4AYB N;  1ETQ A;  3GWZ A;  3K4N A;  5D8K B;  1B8I A;  2VKH A;  2WBM A;  5ICF A;  2HWV A;  2L02 A;  3UKG A;  3GTG J;  2OPT A;  3RSN A;  1ZLJ A;  1WJB A;  1UG2 A;  1P7I A;  4DJA A;  1Z0X A;  3KP3 A;  1ETV A;  1YG2 A;  2F4M B;  2LRD A;  2ZSH B;  2DJI A;  2E7X A;  3S3M A;  3OYL A;  2M3A A;  2L2O A;  4C3J J;  4J01 A;  3K1P A;  1XC5 A;  4IOA F;  2YSR A;  1PUE E;  5DUI A;  2E1M C;  4QLC U;  5D5W B;  3TOA A;  2WV1 A;  4YII A;  2LDU A;  1WJ5 A;  2X6Y A;  2JZY A;  2ZFU A;  2E1N A;  2DA6 A;  4E4H A;  4P96 A;  3I58 A;  1MDM B;  1S3J A;  3TGN A;  2DMN A;  2YS9 A;  4OIQ F;  4HSR A;  1A5J A;  3ZQF A;  2RN7 A;  3OIO A;  3K4L A;  3M3Y J;  1N75 A;  4C30 A;  1BC7 C;  1Y8R B;  4KMU X;  1K4T A;  3BC8 A;  3PSI A;  2K3F A;  3VPR A;  1MJB A;  5F04 A;  1V55 H;  3TW6 A;  2CU7 A;  2L9R A;  1G3Y A;  3G1M A;  4E7Z A;  1LE8 A;  2O0Y A;  4U7B A;  1TNT A;  2F4I A;  4YG2 F;  2Z5U A;  5FFZ A;  3CF2 A;  3FBN B;  4C2M J;  3U9G A;  2FNP A;  3Q3S A;  3PSF A;  2F5D A;  3TOB A;  4ZYD A;  3KEQ A;  5LGN A;  1W7P D;  4KIG A;  2FUG 2;  4R1H A;  5A2Q Z;  3IV5 A;  4UUS B;  1FMV A;  3ZRG A;  2NS8 A;  1SAX A;  3DEU A;  5BMZ A;  1YFH A;  2QLZ A;  3M7G A;  5CJ9 A;  3K4J A;  1JKO C;  3WU1 B;  2D2W A;  2J5P A;  3VB2 A;  3H9G A;  1FOW A;  2AXL A;  2HI3 A;  3TKY A;  1YQA A;  5L3C A;  3VYT B;  2VAS A;  1WRJ A;  3WTY C;  2QKL B;  2DA3 A;  3OYE A;  1YW9 A;  5E1W A;  4IQJ A;  4EV0 A;  3ZQ7 A;  3OR1 C;  4ABZ A;  4KIT B;  1W36 C;  4A0Z A;  2R0Q C;  3MMY B;  1QRY A;  4DGW B;  1NHA A;  3C2H A;  1H0M A;  1LJ9 A;  2A61 A;  2HQA A;  3DTK A;  4UVB A;  2HVQ A;  4QPO A;  2Z2S B;  4IHT A;  1WWX A;  2HDW A;  1JHF A;  2JUC A;  5EEG A;  4G94 A;  3DU5 A;  1HW5 A;  1TTY A;  2UUZ A;  3EUH A;  3FDY A;  3KZI C;  4M6V A;  3U2R A;  3J80 Z;  1YJN I;  1EF4 A;  2BXY A;  4BKX A;  2K4B A;  4CCK A;  5EEA A;  1I1S A;  3B73 A;  2EV6 A;  4F3Q A;  3KP4 A;  4KN7 X;  1WZ2 A;  3S3O A;  1UHS A;  1BIB A;  1TWA J;  3TED A;  3Q0U A;  2BBY A;  1XGM A;  1FSH A;  3BY6 A;  3MWM A;  1K61 A;  4UXN A;  4EJV A;  1V5G A;  2O3F A;  4A3G J;  1VQ8 I;  2O8X A;  2HOE A;  1G3T A;  4HBL A;  1WQ2 A;  2GXG A;  4I7H A;  2DXI A;  2A5Y B;  2DFH A;  5GAE J;  3H5N A;  4ZDP A;  2BVL A;  1NG6 A;  1HKT A;  3FXO A;  1R5G A;  2L9V A;  3DPT A;  4RDU A;  4XSZ F;  1DU0 A;  4UV8 A;  2F48 A;  1OPC A;  1R1V A;  3FMS A;  1B9M A;  2NVT J;  4XLA A;  4M6Y A;  2O9L A;  1X58 A;  3UR3 C;  2R93 J;  4CCM A;  1U5T B;  2Z16 A;  2ID6 A;  3S2H J;  3EUK L;  4LG3 A;  5FLX K;  4M3D A;  2Q2E B;  4CCL A;  3M4O J;  2W85 A;  4CIC A;  2NVU B;  2ZCW A;  5J8C A;  1TWC J;  2ACJ A;  2MYS A;  3ZCO A;  2BY1 A;  2XKP A;  4XMY A;  3OWT A;  2FQ4 A;  3FXJ A;  3WU2 C;  3R4K A;  1A36 A;  3EUA A;  2ISY A;  4X1E A;  5L3G A;  2PI0 A;  4M72 A;  1YS6 A;  2MLK A;  2Y2Z A;  5E79 C;  2XAH A;  2O6G E;  1OIS A;  4UY8 I;  1V54 H;  4G6D A;  4EM2 A;  3OS0 A;  1VTN C;  2DT6 A;  3L2C A;  4ZZL A;  1MMA A;  2AS5 F;  4LFU A;  3OYF A;  2XF7 A;  4B3A A;  2QM3 A;  1SD7 A;  2GBY A;  5LEK A;  3VDX A;  3E5Q A;  2X85 A;  3ZXS A;  4A6D A;  1F4K A;  1P4A A;  3K70 D;  4M6X A;  2FML A;  5LRS A;  2HEO A;  2IRF G;  2JA5 J;  4BNC A;  4M3B A;  2JRM A;  3QQA A;  3GFI A;  4UUV A;  2XAS A;  2K40 A;  4PGG A;  4RGR A;  3JRA A;  1NH3 A;  1MBE A;  4UB6 C;  5DUK A;  3ZPL A;  4BE2 A;  1ETO A;  4F93 B;  1HBX G;  4IKF A;  3QPL A;  1EH8 A;  2JT1 A;  3OYJ A;  3DPU A;  3S15 J;  5DCF A;  1O3R A;  1WPK A;  1ZRE A;  1H9G A;  3M8F A;  2XVC A;  2P4W A;  3FK7 A;  2L0K A;  3WOD F;  3M1E A;  4XIC A;  2AO9 A;  2HDC A;  4A0X A;  4LG0 B;  4PZJ A;  4JQF A;  2JRT A;  2LTP A;  5J8F A;  2JVH A;  3O8H A;  2PJP A;  3QPT A;  1IO2 A;  5HS7 A;  1VQ4 I;  1HOM A;  5FLX Z;  1IZ1 A;  4LB6 B;  2LH9 A;  5JVT A;  3GTK J;  2A3S A;  1LDK B;  3EUH C;  1OCT C;  2ECB A;  2DPU A;  3CLQ A;  3LSR A;  1N78 A;  2E1M B;  2V1N A;  3ELK A;  3MQ0 A;  4U0V A;  3U21 A;  1W5C C;  1AOY A;  2MC3 A;  2DQR A;  2L5Q A;  3CUQ C;  3DKX A;  3KCC A;  2W82 A;  2HVS A;  1TWH J;  4I0A A;  2EZK A;  3I59 A;  2W84 A;  4NHJ A;  4ANJ A;  4LG0 A;  3K6G A;  2EV5 A;  1T2K A;  4EQQ A;  3CQZ J;  1T8I A;  3W2A A;  1FX7 A;  1IN8 A;  2M8G X;  1XMA A;  2R7F A;  2CSO A;  1MBJ A;  2ZNZ A;  2X9D A;  3AG4 H;  1HST A;  2MC4 A;  5KCM A;  1WH5 A;  3LMM A;  1FJL A;  4U0Y A;  1U0J A;  4XRS G;  5LLQ A;  1ZHF A;  2YX4 A;  1OFC X;  2STT A;  5FRO A;  3G6E I;  2ESN A;  2QVO A;  4KIC A;  4AVZ A;  4ENM A;  2QUF A;  1WSU A;  1JUM A;  1XDS A;  1OMI A;  2DN0 A;  2OBP A;  1XD7 A;  2PMH A;  4FHT A;  3OV8 A;  5DYM A;  5K7Z A;  5GTH C;  2ME0 A;  3FXU A;  5KAF C;  2HKO A;  2HZD A;  1K6O A;  2HXO A;  5H6Q A;  3SZT A;  4PDK A;  2FOW A;  1FY7 A;  2WC2 A;  3L7W A;  1ONV A;  1OYW A;  1T98 A;  5E8I A;  2BZT A;  4ZZD A;  1Z7L A;  4ZYH A;  4S05 A;  2KIM A;  1Y6I A;  1GUU A;  2Z3Y A;  4F92 B;  1ETX A;  5D4R A;  1JTY A;  5ED4 A;  2MFZ A;  2STW A;  4D5C A;  3HTU A;  3BR0 A;  1R23 A;  5ILS A;  1KQ9 A;  2VI6 A;  2R7W A;  3FF5 A;  4NC8 A;  1FTZ A;  4LLL A;  4BQO A;  4IZZ A;  1LDD A;  4OWR B;  2R7Q A;  3SEQ A;  2RC4 A;  1VZ0 A;  3CDH A;  3M9A A;  4JBA A;  4BQQ A;  4LB5 A;  2DA4 A;  2K02 A;  2X1D A;  2A69 F;  3ESW B;  4BE0 A;  4BXF A;  1KGS A;  1ORK A;  2B0L A;  3F8M A;  3CO7 C;  2F5F A;  4RAF A;  5EG0 A;  2A05 A;  2ADU A;  3LSH A;  1HCR A;  1PVE A;  1J7K A;  1UST A;  3SEZ A;  2GM4 A;  4FE7 A;  2E35 A;  1WI9 A;  1YHQ I;  5FLV A;  3F0C A;  1TQM A;  3R60 A;  1MBH A;  2VQG A;  3KPH A;  5KAI C;  1YO5 C;  2LY2 A;  3TO6 A;  3S16 J;  1ENH A;  2EA2 A;  2P0W A;  2W7N A;  3PFY A;  5D8L B;  1TW2 A;  3GTL J;  3CJQ B;  1X4P A;  4BEH B;  3AL0 B;  3JW4 A;  4EGY A;  2CJJ A;  2EFP A;  4D1Q A;  3FXK A;  3KYC B;  3S2D J;  2NAZ A;  2LFB A;  2E36 A;  2ECC A;  2QBY B;  3LOC A;  3HKZ N;  2L7F P;  2OZU A;  5BS6 A;  4MIM A;  1TLH B;  2IGO A;  3QU3 A;  5HOD A;  2DBB A;  4BAC A;  3OMY A;  2X0L A;  1UEL B;  3SZP A;  4QIW N;  2DK5 A;  4EJT A;  3DF8 A;  5GPC A;  2CW8 A;  1GT0 C;  2AHQ A;  2PMZ A;  4XBF A;  1FNN A;  3KEY A;  3SFZ A;  3U1D A;  4AU7 A;  4B09 A;  1BJZ A;  2V6C A;  5EGO A;  1AA7 A;  4XKC A;  2RNG A;  4IF4 A;  2L9N A;  5A2Q K;  1HKS A;  2LD5 A;  2ZC2 A;  3S1M J;  1YIO A;  1VQO I;  4XR6 A;  2A6T A;  1XSX A;  2KFD A;  3HEF A;  4XLC A;  4R8H A;  5IT3 A;  4RS8 A;  5FRM A;  2DFF A;  5EZH A;  4MTE A;  3ASO H;  2VKE A;  3P5J A;  4XON A;  3T5X A;  3W6V A;  1D0X A;  2XIG A;  1DQU A;  2DW4 A;  3HSE A;  3GYH X;  5DD8 A;  1OCZ H;  1ZTR A;  2LF7 A;  2ZXI A;  2W4S A;  4HA8 A;  1HC8 A;  3K1N A;  3IRR A;  3BLY A;  3ABM H;  2Y0S N;  3CZ6 A;  3CP2 A;  2RGV A;  3PFI A;  3ZMS A;  5M3M J;  2KRC A;  2HQN A;  3LSI A;  4L0Y B;  2IPQ X;  3WG9 A;  3GTM J;  4ZJZ A;  2Y31 A;  1OR7 A;  3PM1 A;  1SD4 A;  4L9T A;  1REP C;  1S5L C;  4EJO A;  2DA5 A;  2VE8 A;  4BEH A;  2WY7 Q;  3QOP A;  2O61 A;  5KHD A;  1S7O A;  4CHU A;  2BW3 B;  1ZGJ A;  2V9K A;  1IF1 A;  2HVR A;  3HM5 A;  3LA3 A;  2VPL A;  1PJR A;  4P55 A;  5E1X A;  1ERD A;  2IGM A;  3JTG A;  1IGN A;  1P4W A;  1JJ8 C;  2DMQ A;  2OF7 A;  3ISP A;  3RIR A;  3BWG A;  2JA7 J;  4G9Y A;  2LNB A;  2QZ8 A;  4IHY A;  1ODD A;  2IGN A;  2YU9 J;  3D0S A;  4O3M A;  4E7S A;  1QZY A;  4WXC A;  4X6A J;  3S32 A;  1TL8 A;  1QPI A;  3IP4 B;  2GA2 A;  4JOM A;  1DGW Y;  3WU0 A;  1X3U A;  4DNC A;  5H2F C;  5K7H A;  5IP9 J;  5D5U B;  2KRF A;  5E17 F;  4CZC A;  2M87 A;  5F1R A;  3GME A;  3VEP A;  1LPQ A;  2PJR B;  3BJA A;  5CVR A;  3CCS I;  3ZP5 A;  2OTL I;  2QYO A;  3DEE A;  1W7P B;  3N97 A;  3SZG A;  1LEA A;  3OYN A;  1TZL A;  4PGH A;  4IQ4 A;  2DT7 B;  3DKW A;  1LEB A;  2IT0 A;  1SVL A;  1SC7 A;  3D5R C;  1SAN A;  3U1K A;  2LG4 A;  4WF2 A;  2BEO A;  1MIJ A;  1OQY A;  2Y0M A;  3NRV A;  5C4X J;  4BDY A;  1WGX A;  4L5J A;  4ZDO A;  2IP2 A;  3TQN A;  3HRU A;  3ABU A;  2W00 A;  3DLL F;  2LKP A;  1SVO A;  4AD9 A;  2PEX A;  4IRG A;  1ZK8 A;  4LIT A;  1WFX A;  3F3X A;  2E19 A;  4E7L A;  4HF1 A;  3WGI A;  3FMQ A;  3GZN B;  5F0C A;  4BHC A;  4YFK F;  3J81 Z;  2KJC A;  1MSF C;  4D5F A;  1SVM A;  3N05 A;  4AIH A;  4EJU A;  3JRF A;  3P7N A;  1KA8 A;  3SJM A;  3PO2 J;  1FEX A;  2DAO A;  3LSM A;  2AQF A;  4G6T B;  2H1K A;  3CDI A;  1ZLK A;  3I59 B;  3FBI B;  1I39 A;  5E3L A;  3I4N J;  3F22 A;  4XKW A;  2EIL H;  4NB5 A;  4DYR A;  1JKR C;  2HU9 A;  1VQL I;  2FX0 A;  3NAU A;  1YJW I;  4OIR F;  2DA1 A;  1P2F A;  2K9S A;  4I99 C;  3WE2 A;  3HHH A;  4R79 A;  3CCL I;  3K69 A;  3CC4 I;  2QSG X;  1EKE A;  2RVC A;  2COB A;  4BBR J;  3HUG B;  2WV0 A;  5EEH A;  3KFW X;  3JRD A;  1HKQ A;  3KLO A;  4HF2 A;  4A5N A;  1I3A A;  2EZI A;  1HW2 A;  2DLL A;  3L09 A;  3H5R A;  2QQA A;  3GXO A;  4Z2Y A;  2L4A A;  1RRJ A;  1H8A C;  3JRI A;  3SXY A;  2MG4 A;  4HDV A;  2ISZ A;  3GX4 X;  1NK2 P;  1MKM A;  2KKO A;  4PJ0 C;  4QWQ A;  4JX4 A;  2OC6 A;  4XOT A;  4B44 A;  5IPA A;  1J09 A;  4CGZ A;  2G0E A;  2IA0 A;  4HF0 A;  1IV8 A;  4HLX A;  3AFH A;  3G1L A;  2RDP A;  1IRF A;  3HGY A;  4KFC A;  3E6C C;  1BW5 A;  1O57 A;  1OJL A;  2O03 A;  4A3J J;  3K10 A;  3ZQC A;  1W5S A;  2FJ1 A;  3DV8 A;  1BM9 A;  4CSW A;  4L9J A;  2CGP A;  1YYV A;  1FIP A;  2QKM B;  5CVI A;  3A02 A;  2OTJ I;  3CP8 A;  5HNH A;  1FSE A;  2LY1 A;  3HPG A;  1LQ1 A;  2JPC A;  2OD5 A;  2F6C A;  1UMQ A;  2P8T A;  2K7L A;  5LFA A;  3QRF F;  2XAF A;  2V1D A;  2I8D A;  4Y3O A;  1XMK A;  4I76 A;  2CO5 A;  2NVY J;  4HYE A;  4CA0 A;  1IRG A;  3J7Y J;  5B3S H;  1NK3 P;  3QAH A;  1XS9 A;  4WCG A;  2Q2E A;  2PBI A;  2LK2 A;  3OYM A;  4GYI A;  3LSG A;  3OYH A;  2RRE A;  4XN3 A;  3B02 A;  3LQQ A;  2QEN A;  4XM3 A;  3KE2 A;  1ZH5 A;  3FIS A;  3QYE A;  2VJJ A;  3RCO A;  4M9S A;  1V4R A;  3M8E A;  4CO8 A;  5M5W J;  3DPL C;  4LLG F;  2P5L C;  2LVS A;  2CW7 A;  2A07 F;  1O3Q A;  3DU6 A;  3KLN A;  3H3V K;  3V8J A;  4IJA A;  1OCC H;  1U3E M;  2R7U A;  5F0H A;  3BG3 A;  2Y75 A;  2VQL A;  1B8I B;  1F1Z A;  1K7A A;  3TDZ C;  2E1O A;  1L0O C;  2KIU A;  1NTC A;  2EQR A;  4I01 A;  2M7B A;  4WK8 F;  1T08 B;  4HNU A;  1FP2 A;  1Z21 A;  2R7R A;  2DK8 A;  4E6K G;  3BT9 A;  1I3Q J;  2Y30 A;  2HYJ A;  4FT8 A;  4FE4 A;  2E5N A;  1IXR C;  3C3W A;  1W1W E;  1ETW A;  4BH9 A;  2ZXH A;  3OYK A;  2L7Z A;  3QPS A;  1QVU A;  2WA0 A;  3E7L A;  2P6S A;  4XKV A;  4DYC A;  5J1R A;  3GCM A;  5GP9 A;  3BZ6 A;  3JRE A;  1J75 A;  4ZYE A;  1RUO A;  1OKR A;  5LRR A;  4E7I A;  5GAD J;  3WTX C;  3FHZ A;  5EZG A;  2GIV A;  1LFP A;  2ZSI B;  4FIS A;  3GW2 A;  3NAR A;  1LFB A;  1R22 A;  1BR2 A;  1D8K A;  3I53 A;  3CF5 F;  1UJ8 A;  3BR1 A;  1HXD A;  1UB9 A;  2LR8 A;  2CUF A;  3ZQG A;  3S1N J;  2LBF A;  1FYM A;  2CQ7 A;  2CUJ A;  3I9V 2;  4BYY A;  3OY9 A;  3IKT A;  5GTI C;  3A01 A;  1BI1 A;  5TJJ A;  5LHG A;  4AIJ A;  2BOL A;  2FA5 A;  2ELJ A;  3R0A A;  1XSV A;  2LP0 A;  1UG0 A;  3BTL A;  4KIF A;  2E2I J;  2LMD A;  4OU0 A;  3CDL A;  3J81 K;  1B59 A;  4YFX F;  2XV4 S;  1QO0 D;  1QNT A;  3CD6 I;  2XUB A;  3NQO A;  3TP0 A;  2Y9Y A;  3K4K A;  5J6X A;  1AU7 A;  1S7E A;  2K9M A;  3K4M A;  5IP7 J;  1PYV A;  4RA2 A;  2ETH A;  2HS5 A;  3DBR B;  2VBX A;  1TNS A;  1O3T A;  1MBK A;  3ABT A; 
#chains in the Genus database with same CATH homology
 1W4M A;  1AWC A;  4LGW A;  1Z6T A;  3E6M A;  1I5Z A;  4KYW A;  4HV6 A;  2MLG A;  3KP7 A;  5FD5 A;  1SD6 A;  3ZMV A;  3F23 A;  1Z05 A;  4LMY A;  4AVP A;  3ROU A;  3O2P E;  1IW7 F;  1T0F A;  2EK5 A;  4U88 A;  3DXJ F;  1KQ8 A;  2ZME A;  5HDK A;  5DEQ A;  4KA4 A;  5LHI A;  4I02 A;  1BIA A;  2L01 A;  2VN2 A;  1R58 A;  1G3S A;  1LDJ A;  3JAM K;  2PG4 A;  1R1T A;  3P9K A;  3HHG A;  3HRT A;  1O7F A;  3KP6 A;  4KMF A;  2YU3 A;  4MQ9 F;  3C18 A;  4A0Y A;  2RKH A;  1BI0 A;  3RKY A;  2OA4 A;  1H9T A;  4A5M A;  2WTE A;  1DPR A;  5CVV A;  3V8K A;  4L9N A;  1BI2 A;  3V7R A;  5D6F A;  1SFE A;  2H27 A;  2GAU A;  2E7W A;  5LBQ A;  5F64 A;  1LNW A;  1T39 A;  4GO1 A;  3FMR A;  4G7O F;  3AAF A;  1TW3 A;  3Q9S A;  4MEY F;  4G6Q A;  2F2E A;  3RDI A;  4ENJ A;  3I0T A;  3RKX A;  3MZH A;  1Z6R A;  4UVA A;  5HVQ C;  2IA2 A;  4CXF A;  2VOO A;  1XN7 A;  3HSR A;  2D45 A;  4A2U A;  2UZK A;  5AIP A;  3HIF A;  3V4G A;  1IXC A;  5D4S A;  1E2X A;  1UHW A;  4WXH A;  4A12 A;  2LSO A;  3S2W A;  2CQK A;  4HAM A;  3FX3 A;  2XAG A;  3E6B A;  2EFW A;  2VOP A;  3ULQ B;  1Z1D A;  3HOT A;  4Y17 A;  3ERE D;  3KZZ A;  5TRD A;  3GFL A;  1BI3 A;  3E5X A;  4JK1 X;  1UCR A;  2FMY A;  1BBY A;  3I4P A;  3ZMD A;  3QP5 A;  3RJP A;  5DV5 A;  1FWZ A;  3BRO A;  4M9Z A;  4LJZ F;  3T1B A;  3G73 A;  5HLG A;  2RV8 A;  1I6X A;  4ON0 A;  2W24 A;  4UNO A;  3ML6 A;  4KT5 C;  1FP1 D;  1YW7 A;  3ECO A;  4HV5 A;  2GXB A;  2BGC A;  1STZ A;  2M8E A;  3FXR A;  3IWZ A;  3V8L A;  2MH9 A;  3FWE A;  3G3Z A;  3KZY A;  4MNU A;  2YR2 A;  5D6E A;  2NNY A;  2V1X A;  4L0Z B;  2V9V A;  3EQL F;  2V79 A;  2KJB A;  3CTA A;  1DP7 P;  2CWE A;  2IW5 A;  3KP2 A;  2DFI A;  4ESJ A;  5LHH A;  3RYR A;  3Q9V A;  1ZG1 A;  5FO5 A;  1GXQ A;  4D0P A;  2HFH A;  2ZO4 A;  2MBF A;  1Z91 A;  4P9F A;  2D1V A;  5LEJ A;  3RKW A;  2FNA A;  4M74 A;  4MTD A;  4Y15 A;  5F6F A;  3V7C A;  4Q48 A;  1BC8 C;  2VC1 A;  2DO7 A;  1EV7 A;  1J5Y A;  3IRQ A;  4RB2 C;  2LF8 A;  4N9H A;  2OZ6 A;  2BV6 A;  1WKM A;  2VC0 A;  4KN4 X;  4GCV A;  3WTW C;  4BAY A;  2M45 A;  4HDU A;  2R3S A;  1RUN A;  1USS A;  2EFN A;  5HS9 A;  4RB1 A;  2CG4 A;  1K79 A;  1TQI A;  2ZXJ A;  1KU3 A;  3LAP A;  3C7J A;  1PP8 F;  1R7J A;  1XCV A;  3E3V A;  4HX4 A;  1E17 A;  3QP6 A;  3R0J A;  1D8J A;  2ZJ2 A;  4CYD A;  5JFR A;  4P5O A;  5L3D A;  2MA3 A;  2EJR A;  4YFN F;  2M5W A;  4XSX F;  3F6V A;  2Q0O A;  2VON A;  4WWC A;  2ESH A;  3ZMZ A;  2DQL A;  2IA1 A;  2FQ3 A;  2E1C A;  4Q5S F;  2NNN A;  3IC7 A;  1FOK A;  2RQP A;  3LQR A;  4IRH A;  3CLO A;  3SHF A;  1YW8 A;  1JHH A;  2PQ8 A;  1ZG3 A;  2HYF A;  2NS0 A;  3IWF A;  1MGT A;  2UXN A;  1B4A A;  3HTS B;  2P5K A;  4OOI A;  4XRF A;  1Z7U A;  3J7A O;  1ZG5 A;  2D1H A;  1QPM A;  1QQI A;  2FXA A;  1XGN A;  4ZYG A;  3EET A;  4A6E A;  2W25 A;  2JTV A;  5E18 F;  2IVM A;  4I0B A;  1MDM A;  5FGM A;  1K78 B;  1KU9 A;  3O3K A;  4RGU A;  1S8N A;  4RGX A;  3CUQ B;  4Y13 A;  3HRM A;  4ESB A;  3LAJ A;  1GVJ A;  1BJA A;  4ASN A;  1LVA A;  1U5T A;  3D5L A;  3F72 A;  2VOD A;  2EA4 A;  2Q8K A;  1O7L A;  3FZV A;  4IXA A;  4IHS A;  3BDD A;  4RGS A;  4KNY A;  4HQE A;  3CUO A;  2MD5 A;  2Z9O A;  4WXD A;  4MHG A;  4F7Z A;  2VBZ A;  3BOQ A;  1ON2 A;  3VFZ A;  1XDU A;  2OQG A;  2HZT A;  2FF4 A;  4LK1 F;  1FBU A;  3K9T A;  1SMY F;  3MCZ A;  4IRI A;  1YTY A;  1P92 A;  3ZMT A;  3IKV A;  1F9N A;  2P7C B;  4IVN A;  3LST A;  5KK1 A;  1MJ9 A;  5JI6 A;  1HSJ A;  1CF7 A;  5K5Q A;  2YX7 A;  3RYP A;  3EDP A;  1SFX A;  2FSW A;  2ELH A;  1KYZ A;  2HKX A;  1YS7 A;  2FOK A;  2H94 A;  3WGG A;  6PAX A;  2HR3 A;  4BXU A;  2HTS A;  3GEZ A;  1YLF A;  2QBY A;  3T0Y A;  5H6R A;  3DQV C;  1EH7 A;  2L54 A;  1ZGA A;  5AIQ A;  1Z9C A;  4E70 A;  1MZB A;  3H3U A;  4RAY A;  3TO9 A;  1ZRD A;  5DCM A;  3L00 A;  1QGP A;  3MZY A;  2H6C A;  1ZN2 A;  4EMS A;  4DQ2 A;  1U8R A;  1J2X A;  5FD6 A;  3WTV C;  3COA C;  1B6A A;  5HS8 A;  1FC3 A;  4I98 B;  4HX8 A;  3VOE A;  2XGX A;  5HDG A;  2G7U A;  5ILV A;  3MFK A;  3LWF A;  2XAQ A;  5K1Y A;  4CZZ A;  3NEU A;  3GZ6 A;  1T6S A;  1S7A A;  1C0W A;  5CYV A;  4ESF A;  5HLI A;  5HOO A;  1BOA A;  3HUG A;  3GLX A;  4L18 B;  1QZZ A;  1W7P A;  5CLS A;  4N9I A;  4LK0 F;  1KQ0 A;  5ILU A;  3GO5 A;  2A6E F;  4OIO F;  4K2E A;  4ENK A;  3L9F A;  2NRA C;  3P9I A;  5CVJ A;  3RPU A;  5E20 A;  2CYY A;  4GGG A;  4Q4Z F;  3I5U A;  5ICC A;  3VOD A;  2KIF A;  1ZRC A;  3LA7 A;  3TO7 A;  2Z99 A;  3BJO A;  3HYI A;  5K5O A;  5ICE A;  1KU7 A;  3I71 A;  4MQV A;  1I27 A;  3W6J B;  5JR3 A;  1Y0U A;  2VT3 A;  1MD0 A;  1PP7 U;  2WWY A;  1MJA A;  4G7H F;  2COM A;  4EVI A;  4RB0 A;  3F8N A;  2M1B A;  1U5T C;  4G8X A;  2UXX A;  2EB7 A;  3F21 A;  4FX0 A;  1TBX A;  4G7Z F;  2BYV E;  2QWW A;  3F8F A;  2P5V A;  4HLY A;  1XGS A;  1JE8 A;  3R61 A;  1D5V A;  1G3W A;  4KDP A;  2EFQ A;  4ZH4 F;  3I64 A;  4M73 A;  1W5T A;  2QQ9 A;  5L3B A;  4RB3 C;  2P6T A;  4XLP F;  1HQC A;  2A6H F;  2JSC A;  4OIN F;  2BE5 F;  3LFK A;  2MH2 A;  4I2O A;  3JTH A;  2H09 A;  1U6G A;  4FX4 A;  1JXS A;  4GYG A;  3E6D A;  2OAZ A;  3ZN0 A;  3CJN A;  4N0B A;  5BPI A;  1S6L A;  4YIF A;  3DFG A;  3N4M A;  1R00 A;  3C1D A;  3KEO A;  2J5O A;  2VXZ A;  4P9U A;  4BHP A;  4EJW A;  2GA1 A;  3ECH A;  1B1B A;  4LLN A;  2YPR A;  3Q5F A;  5CVU A;  2GZW A;  1OYI A;  1TQP A;  4ETS A;  2F5E A;  2K4J A;  5L3E A;  4O6J A;  3WTS C;  4U0W A;  4CDG A;  5IT9 K;  5ERI A;  3J80 K;  4UVC A;  3GF2 A;  3RI4 A;  3HOS A;  2G7H A;  1OYY A;  3GUD A;  2DPD A;  3MEX A;  5BOX A;  4O5V A;  3FM3 A;  1P4X A;  4Q47 A;  4WX9 A;  1ON1 A;  3IL2 A;  1RNL A;  4H0E A;  1P6R A;  5HDN A;  2ZFW A;  1J59 A;  1FYL A;  4LD5 A;  4I09 A;  2CFX A;  2H6B A;  1G4D A;  1FBQ A;  2NYX A;  3F8C A;  3GZ5 A;  3MAJ A;  5AON A;  2F5C A;  1EH6 A;  2ZBK A;  4IPA A;  2W57 A;  2PMU A;  2CW0 F;  3R6S A;  2XRN A;  3H3Z A;  3DP7 A;  1IN4 A;  2XHK A;  1Q1H A;  5LGT A;  1ULY A;  2M30 A;  3GVA A;  4RAZ A;  3K1M A;  1ZRF A;  1DPU A;  2VBW A;  1FBS A;  1IN6 A;  2DU9 A;  4UV9 A;  2EWN A;  2EFO A;  2PFB A;  2OQR A;  3P9C A;  3PQJ A;  1FPQ A;  2K86 A;  2FBK A;  3IHU A;  3E97 A;  1L3L A;  2ZKZ A;  1HW1 A;  1R5H A;  5DCM B;  5IT9 Z;  2ZNY A;  4BHB A;  1V3F A;  4L5I A;  2L3D A;  2FRH A;  2XAJ A;  1J9I A;  1SMT A;  5FFX A;  3WTZ A;  2RNJ A;  4UHT A;  4BQA A;  5E1Z B;  1IAW A;  4KUM A;  5ICG A;  2Z33 A;  2P7V B;  4HQM A;  2HQR A;  4EM1 A;  1LB2 A;  3QU6 A;  3WTU C;  4M71 A;  3JSP A;  1J0R A;  3REO A;  2R7D A;  2FBI A;  5BPD A;  1RZ4 A;  1KU2 A;  2VE9 A;  1R1U A;  1ZAO A;  3HRS A;  3T8T A;  1RIO H;  5HLH A;  1F5T A;  2UWM A;  1KYW A;  3K0L A;  1XSD A;  1D3Y A;  2GQQ A;  1PDN C;  2OU2 A;  3JAM Z;  5L3F A;  1IUY A;  1T38 A;  3KET A;  1FT9 A;  1GHC A;  2FEZ A;  2JPB A;  2GWR A;  3TDU C;  1U78 A;  1ZAR A;  4OIP F;  3V7S A;  2XKO A;  4XLN F;  2A68 F;  4KIB A;  2HGC A;  3HSF A;  1S29 A;  4B8X A;  2EV0 A;  2VT2 A;  5LGU A;  3LA2 A;  4HZF A;  2XRO A;  5FB2 A;  3BP8 A;  3QPH A;  3BJ6 A;  5JHU A;  3SQN A;  1G6N A;  2VBY A;  3W6K B;  1UFM A;  4M9X A;  3GFJ A;  4HW0 A;  2ZME B;  5KVR A;  2G9W A;  1DUX C;  2DT5 A;  4OMY A;  3OOP A;  2DI3 A;  2L4M A;  1IN5 A;  4TV7 A;  3K2Z A;  3F8B A;  2FU4 A;  1RI7 A;  1BN5 A;  4MGR A;  1R36 A;  1JGS A;  1FYK A;  3PQK A;  2IJL A;  4ENN A;  1XB4 A;  3EYY A;  1UHM A;  3WGH A;  1K78 A;  2K27 A;  4EGZ A;  3KP5 A;  1FLI A;  3RPQ A;  2FE3 A;  1A04 A;  1CGP A;  1IXS B;  2HYG D;  4EM0 B;  1B9N A;  3WTT C;  2PN6 A;  3T8R A;  3FM5 A;  3GFM A;  3ZMU A;  1GXP A;  2TDX A;  5H20 A;  3E5U A;  3FXQ A;  5DDG A;  3CO6 C;  1XCB A;  4PCQ A;  2HTJ A;  2FBH A;  1U2W A;  2Y48 A;  1DDN A;  3CUQ A;  3H92 A;  4HOB A;  2C6Y A;  2QQB A;  4HX7 A;  3RTR A;  5BQT A;  4AWX B;  3BPX A;  3WE3 A;  1XGO A;  5D5V B;  1ZYR F;  3JSO A;  1SD5 A;  5E8G A;  3BPV A;  4S04 A;  1O3S A;  2DTR A;  4L9V A;  4MEX F;  4OMZ A;  1CF7 B;  5DD4 A;  3I54 A;  4AIK A;  1I1G A;  4GXO A;  2PLY A;  1IN7 A;  3O6B B;  1FZP B;  1SFU A;  1QBJ A;  3ZN1 A;  5D5X B;  3F6O A;  5K5R A;  2V1U A;  4U7D A;  2X4H A;  3EYI A;  4NQW A;  3GWZ A;  5D8K B;  5ICF A;  2HWV A;  2L02 A;  1ZLJ A;  3KP3 A;  1YG2 A;  2E7X A;  3K1P A;  2YSR A;  1PUE E;  5DUI A;  4QLC U;  5D5W B;  3TOA A;  4YII A;  2LDU A;  2JZY A;  2E1N A;  4P96 A;  3I58 A;  1MDM B;  1S3J A;  3TGN A;  4OIQ F;  2RN7 A;  1BC7 C;  4KMU X;  1MJB A;  1G3Y A;  2O0Y A;  4U7B A;  1TNT A;  4YG2 F;  2Z5U A;  5FFZ A;  3U9G A;  2FNP A;  2F5D A;  3TOB A;  4ZYD A;  3KEQ A;  5LGN A;  1W7P D;  4KIG A;  4R1H A;  5A2Q Z;  1SAX A;  3DEU A;  5BMZ A;  1YFH A;  2QLZ A;  3M7G A;  5CJ9 A;  3WU1 B;  2D2W A;  2J5P A;  3VB2 A;  2AXL A;  3TKY A;  1YQA A;  5L3C A;  1WRJ A;  3WTY C;  1YW9 A;  5E1W A;  4EV0 A;  3ZQ7 A;  4A0Z A;  1NHA A;  1H0M A;  1LJ9 A;  2A61 A;  4UVB A;  4IHT A;  1WWX A;  1JHF A;  5EEG A;  4G94 A;  1HW5 A;  1TTY A;  3EUH A;  3J80 Z;  3U2R A;  1I1S A;  2K4B A;  3B73 A;  2EV6 A;  3KP4 A;  4KN7 X;  1BIB A;  2BBY A;  1XGM A;  1FSH A;  3BY6 A;  3MWM A;  4UXN A;  4EJV A;  2O3F A;  2O8X A;  2HOE A;  1G3T A;  4HBL A;  1WQ2 A;  2GXG A;  4I7H A;  2A5Y B;  1HKT A;  1R5G A;  3DPT A;  4XSZ F;  4UV8 A;  1OPC A;  1R1V A;  3FMS A;  1B9M A;  4M6Y A;  1U5T B;  5FLX K;  2W85 A;  4CIC A;  2ZCW A;  5J8C A;  2ACJ A;  2XKP A;  3R4K A;  2ISY A;  5L3G A;  2PI0 A;  4M72 A;  1YS6 A;  2O6G E;  2MLK A;  2XAH A;  4G6D A;  4EM2 A;  1VTN C;  3L2C A;  4ZZL A;  2AS5 F;  4LFU A;  2QM3 A;  1SD7 A;  5LEK A;  3E5Q A;  4A6D A;  1F4K A;  1P4A A;  4M6X A;  2FML A;  5LRS A;  2HEO A;  2IRF G;  4BNC A;  3GFI A;  4UUV A;  2XAS A;  4RGR A;  4PGG A;  3ZPL A;  5DUK A;  1HBX G;  1EH8 A;  2JT1 A;  5DCF A;  1O3R A;  1ZRE A;  1H9G A;  3M8F A;  2XVC A;  2P4W A;  3WOD F;  3M1E A;  2HDC A;  4A0X A;  4LG0 B;  4PZJ A;  4JQF A;  2JRT A;  5J8F A;  2PJP A;  3QPT A;  5HS7 A;  5FLX Z;  1IZ1 A;  4LB6 B;  5JVT A;  2A3S A;  1LDK B;  2DPU A;  3ELK A;  3MQ0 A;  4U0V A;  1AOY A;  2MC3 A;  2DQR A;  3CUQ C;  3KCC A;  4I0A A;  3I59 A;  2W84 A;  4NHJ A;  4LG0 A;  2EV5 A;  1T2K A;  4EQQ A;  1FX7 A;  1IN8 A;  1XMA A;  2R7F A;  2CSO A;  2ZNZ A;  1HST A;  4U0Y A;  5LLQ A;  1ZHF A;  2YX4 A;  2STT A;  2ESN A;  2QVO A;  4KIC A;  4ENM A;  2QUF A;  1WSU A;  1XDS A;  1OMI A;  2OBP A;  1XD7 A;  2PMH A;  4FHT A;  3OV8 A;  5DYM A;  1K6O A;  3FXU A;  2HKO A;  5H6Q A;  3SZT A;  4PDK A;  1FY7 A;  2WC2 A;  3L7W A;  1ONV A;  1OYW A;  1T98 A;  5E8I A;  4ZZD A;  4S05 A;  4ZYH A;  2KIM A;  2Z3Y A;  5D4R A;  5ED4 A;  2STW A;  3HTU A;  1R23 A;  5ILS A;  1KQ9 A;  3FF5 A;  4LLL A;  1LDD A;  2RC4 A;  3CDH A;  3M9A A;  4JBA A;  4LB5 A;  2K02 A;  2A69 F;  1KGS A;  2B0L A;  3F8M A;  3CO7 C;  2F5F A;  2ADU A;  1J7K A;  1UST A;  1WI9 A;  1TQM A;  3R60 A;  1YO5 C;  3TO6 A;  2EA2 A;  5D8L B;  1TW2 A;  3JW4 A;  4EGY A;  2EFP A;  2NAZ A;  2QBY B;  2OZU A;  5BS6 A;  1TLH B;  3QU3 A;  2DBB A;  2X0L A;  3SZP A;  2DK5 A;  4EJT A;  3DF8 A;  4XBF A;  1FNN A;  3SFZ A;  3U1D A;  4B09 A;  2V6C A;  4IF4 A;  5A2Q K;  1HKS A;  1YIO A;  1XSX A;  4R8H A;  5IT3 A;  4RS8 A;  4MTE A;  3T5X A;  2XIG A;  2DW4 A;  3HSE A;  3GYH X;  5DD8 A;  2LF7 A;  4HA8 A;  3K1N A;  3IRR A;  2RGV A;  3PFI A;  3ZMS A;  2HQN A;  4L0Y B;  2IPQ X;  3WG9 A;  1OR7 A;  1SD4 A;  4L9T A;  1REP C;  4EJO A;  2VE8 A;  3QOP A;  2O61 A;  1S7O A;  4CHU A;  1ZGJ A;  1IF1 A;  3LA3 A;  4P55 A;  5E1X A;  3JTG A;  1P4W A;  3ISP A;  3RIR A;  3BWG A;  4G9Y A;  2LNB A;  2QZ8 A;  1ODD A;  3D0S A;  4O3M A;  1QZY A;  4WXC A;  2GA2 A;  3WU0 A;  1X3U A;  4DNC A;  5D5U B;  2KRF A;  5E17 F;  2M87 A;  5F1R A;  3VEP A;  3BJA A;  5CVR A;  3ZP5 A;  2QYO A;  1W7P B;  3N97 A;  1LEA A;  4PGH A;  3DKW A;  1LEB A;  2IT0 A;  4WF2 A;  2BEO A;  2Y0M A;  3NRV A;  4L5J A;  2IP2 A;  3TQN A;  3HRU A;  3ABU A;  2LKP A;  4AD9 A;  2PEX A;  4IRG A;  3F3X A;  4HF1 A;  3WGI A;  3FMQ A;  4YFK F;  4BHC A;  3J81 Z;  2KJC A;  4AIH A;  4EJU A;  3P7N A;  1KA8 A;  2DAO A;  1ZLK A;  3I59 B;  3F22 A;  4NB5 A;  4OIR F;  1P2F A;  3WE2 A;  4R79 A;  3HHH A;  3K69 A;  2RVC A;  2WV0 A;  5EEH A;  3KFW X;  1HKQ A;  3KLO A;  4HF2 A;  4A5N A;  1HW2 A;  2DLL A;  3L09 A;  2QQA A;  3GXO A;  4Z2Y A;  2L4A A;  3SXY A;  4HDV A;  2ISZ A;  3GX4 X;  1MKM A;  2KKO A;  4QWQ A;  4CGZ A;  2IA0 A;  4HF0 A;  4HLX A;  2RDP A;  1IRF A;  4KFC A;  3E6C C;  1O57 A;  2O03 A;  1W5S A;  3DV8 A;  1BM9 A;  4L9J A;  2CGP A;  1YYV A;  5CVI A;  1FSE A;  1LQ1 A;  2JPC A;  2OD5 A;  2P8T A;  2K7L A;  3QRF F;  2XAF A;  2V1D A;  1XMK A;  2CO5 A;  4HYE A;  1IRG A;  3QAH A;  4WCG A;  2Q2E A;  2PBI A;  4GYI A;  3B02 A;  3LQQ A;  2QEN A;  3KE2 A;  1ZH5 A;  4M9S A;  1V4R A;  3M8E A;  4CO8 A;  3DPL C;  4LLG F;  2P5L C;  2A07 F;  1O3Q A;  3KLN A;  3V8J A;  4IJA A;  1U3E M;  2Y75 A;  1F1Z A;  1K7A A;  3TDZ C;  1L0O C;  2KIU A;  4I01 A;  4WK8 F;  1FP2 A;  2DK8 A;  4FT8 A;  1IXR C;  3C3W A;  4BH9 A;  2P6S A;  3BZ6 A;  1J75 A;  4ZYE A;  1RUO A;  1OKR A;  5LRR A;  3WTX C;  3FHZ A;  2GIV A;  3GW2 A;  1R22 A;  1D8K A;  3I53 A;  1HXD A;  1UB9 A;  1FYM A;  4BYY A;  3IKT A;  1BI1 A;  5TJJ A;  5LHG A;  4AIJ A;  2FA5 A;  3R0A A;  1XSV A;  4KIF A;  3J81 K;  4OU0 A;  1B59 A;  4YFX F;  2XV4 S;  1QO0 D;  1QNT A;  2XUB A;  3NQO A;  5J6X A;  2ETH A;  2HS5 A;  2VBX A;  1TNS A;  1O3T A;  3ABT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...