2STWA

Solution nmr structure of the human ets1/dna complex, restrained regularized mean structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A
publication title Correction of the NMR structure of the ETS1/DNA complex.
pubmed doi rcsb
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2stwA00
3O6BB 5HLIA 3I59A 1MZBA 1DP7P 3CO7C 5JHUA 2LDUA 3KP2A 1S3JA 3GZ6A 2OZ6A 1YS7A 3I71A 5IT3A 3SZTA 2TDXA 4A6DA 1I1SA 1KYZA 3HSEA 4L5JA 5AONA 1V3FA 2YX7A 3GX4X 3J81Z 3Q9VA 2NS0A 3EYIA 2BEOA 5DCFA 4CHUA 4A6EA 4XSXF 3GFLA 2HEOA 2DK5A 5LLQA 2VT3A 3F6VA 4HLXA 1CF7B 2ZBKA 1K79A 1HKSA 2QQBA 4HX4A 2P5VA 3DF8A 4HF0A 3GYHX 3ZN1A 3CUQA 2ZNZA 4MTEA 2RC4A 4O5VA 3K2ZA 3RDIA 2OZUA 4IHTA 1JXSA 2HWVA 2PFBA 2GIVA 2DW4A 1P4XA 1SD4A 1EH6A 3KP5A 1P4WA 1OYYA 5CVJA 4EMSA 3M8FA 5FD5A 2OBPA 4YG2F 1R1TA 3EQLF 5J8FA 1L3LA 3HTSB 1YIOA 3HUGA 4CDGA 2H94A 4M71A 3WGIA 3ZMVA 1QNTA 1BJAA 3M8EA 2EV5A 3TO6A 5ILSA 5E18F 4XSZF 1WRJA 1S7OA 1Z9CA 4IPAA 2ZMEB 2MLKA 5H6QA 5KVRA 3QP6A 3W6JB 1GXPA 1ZARA 4AIKA 2H6CA 1A04A 2ESNA 2ZO4A 4EJUA 4IRGA 1ZG5A 5L3EA 4U0WA 4G94A 1HXDA 2O03A 2DO7A 4KDPA 4P96A 2XAQA 1KGSA 3E97A 2GQQA 4ZZDA 4UNOA 4UVCA 1QZZA 1O57A 3CJNA 4QWQA 2FEZA 2M30A 4XRFA 4RAZA 3P9KA 2HS5A 1H9GA 1ZRDA 1R23A 3LAPA 2M45A 4B09A 1MJBA 1T98A 5LGTA 1UCRA 3FF5A 2ZJ2A 2ISZA 3RYRA 2ZFWA 4YIIA 4Y13A 2P6SA 3U2RA 2F5EA 2PLYA 5ERIA 2GA1A 5FFXA 3D0SA 2M8EA 1W7PA 2PI0A 2HYFA 5K5QA 4BQAA 1U8RA 4CICA 2XROA 5AIQA 3M7GA 3GWZA 4WXDA 3T5XA 3ECHA 3R0AA 3BJOA 1H9TA 1UHWA 4M9SA 2G7UA 4L5IA 4M74A 4TV7A 1K7AA 1HQCA 3C1DA 5BOXA 4CXFA 1ZRCA 1IZ1A 1C0WA 4ETSA 3E6DA 5E20A 1U2WA 3IKVA 3HRSA 1J9IA 3MFKA 4AIJA 4EJVA 5DDGA 4MEXF 3PFIA 3ISPA 3PQKA 3K9TA 3BZ6A 2WTEA 2MD5A 2O6GE 4G9YA 1RUOA 1CF7A 1GVJA 2F5DA 4GYIA 2D1HA 2H09A 1ZREA 1LEAA 1T38A 2RNJA 1IRGA 2A5YB 1RI7A 1JHHA 3NQOA 4LK1F 4CYDA 1FY7A 2EK5A 2FU4A 4Q47A 3CLOA 2KRFA 5D4SA 2ZNYA 5LEKA 1USSA 4GXOA 2BV6A 3E3VA 4XLNF 4EJWA 1Z05A 3C3WA 3KP6A 2YPRA 4L9TA 1BC7C 1FSEA 1Z91A 4KYWA 5F1RA 1FP1D 2VC1A 5HS9A 1U78A 2GWRA 1TQPA 3BROA 3OV8A 1S8NA 1V4RA 2XGXA 1ULYA 5CVVA 2NYXA 3QP5A 2Q2EA 5ICFA 2ZMEA 1W5SA 5H6RA 4WX9A 3MQ0A 2MLGA 4BHPA 3WTWC 3WU1B 2Z3YA 1IN6A 1YS6A 2QQAA 1T6SA 2XAHA 3VEPA 1F9NA 1TW3A 4LB5A 1R1UA 2F5CA 3WU0A 1E17A 3CDHA 1KQ8A 1AWCA 2LKPA 1O7FA 4R79A 3ZMDA 4KUMA 3BJAA 2LNBA 2RVCA 5JR3A 3LA2A 1USTA 3SZPA 3KZZA 5FLXK 4BHCA 5L3CA 4Q4ZF 4IHSA 4WCGA 2LSOA 2K7LA 3HHHA 1JHFA 1GHCA 4NHJA 2L3DA 3TGNA 3JTHA 4OIRF 1ZYRF 2DLLA 5CVRA 4L9VA 1LJ9A 3F8MA 4LLGF 3HSRA 2HTJA 5E8IA 5D8KB 1LDDA 3D5LA 3MZHA 5K1YA 1P4AA 3RKXA 2ESHA 2MH9A 2EFQA 2FQ3A 3EUHA 1YO5C 3SFZA 2GAUA 1R1VA 4LK0F 1Z6TA 1QO0D 2HFHA 2VC0A 5BPIA 2PEXA 3O2PE 4RS8A 2V1XA 3FXQA 4JK1X 4RGXA 1S7AA 3VODA 1YFHA 2O61A 1O3QA 3C7JA 5CJ9A 4M73A 4HV5A 4L9NA 1TQIA 1XGSA 2MC3A 1FC3A 4M6YA 4AIHA 4LLNA 4ESBA 5HLHA 2V9VA 3GZ5A 2VBWA 3FHZA 3QPHA 2NNNA 1BC8C 1FNNA 1F4KA 1I5ZA 3WE3A 2M1BA 1EV7A 2DQRA 4CGZA 3BDDA 2P5LC 1FT9A 3WODF 4WF2A 3HRMA 1W5TA 3RKYA 2D45A 3E6CC 1U5TC 1MJAA 2F5FA 1R7JA 3SQNA 3ZMTA 3GFIA 4UVAA 4Q5SF 1YLFA 3E6MA 5CYVA 2EV6A 2XV4S 3DFGA 1YW7A 4P5OA 2XKOA 1Q1HA 4KIFA 2ZXJA 2FRHA 4PCQA 2G9WA 1L0OC 3RPUA 3G3ZA 2DI3A 3LA7A 2HGCA 2HKOA 3HOSA 3QU3A 4Z2YA 4EJOA 2QZ8A 5FLXZ 3BJ6A 3KP3A 3IWFA 3Q9SA 5EEGA 2FNPA 2IW5A 1FBSA 5DYMA 1R5HA 2B0LA 2P4WA 1D8JA 3QOPA 3V8LA 4DNCA 2OAZA 3VFZA 4P55A 1J59A 1B9MA 3MZYA 5DUKA 1ON2A 2D1VA 4GO1A 4ZYDA 4ZYGA 1F1ZA 4KN7X 5DV5A 3F8BA 3L09A 4KIGA 2DK8A 1WKMA 4NB5A 4G6DA 4WWCA 2Z5UA 1LDKB 2VBYA 4RB0A 4DQ2A 4RGUA 4JQFA 3R61A 2XAJA 3BOQA 1FX7A 1MGTA 4RB2C 3JW4A 1SMTA 3F6OA 3TO7A 4YFNF 1J7KA 1T2KA 1SD6A 5E8GA 4U7DA 2FXAA 1TTYA 4EQQA 3J7AO 3K1MA 1KQ9A 2XVCA 3K69A 2VOOA 2PJPA 3U9GA 4BAYA 4KT5C 1FYLA 3QAHA 1U5TB 1AOYA 4LGWA 1TNSA 3V8KA 1IXRC 1TLHB 3ZN0A 4ZYHA 1KQ0A 1S29A 4ENMA 1W7PD 3FMSA 1S6LA 3V7RA 4EV0A 1MDMB 3IWZA 2K86A 2Q0OA 3FX3A 3F23A 4B8XA 5JI6A 3V4GA 3L00A 3DP7A 2COMA 1FBUA 2E1CA 5L3DA 1XSDA 1GXQA 3KETA 4YIFA 4K2EA 2QYOA 1OPCA 4HV6A 3KCCA 3IHUA 4I0AA 4MTDA 3R4KA 2KJBA 1J75A 1R22A 4IJAA 4AWXB 4HQEA 1HBXG 2JRTA 2DAOA 4HBLA 3JTGA 2MBFA 2STWA 3IC7A 2H27A 1BIAA 4G7HF 3MAJA 3I54A 3QU6A 2DU9A 2EJRA 4G7ZF 5TRDA 2XHKA 4PGGA 3HHGA 1BBYA 1B59A 4HQMA 3RPQA 1LNWA 2A3SA 3HRUA 4EM0B 4OMYA 6PAXA 1OYIA 2Z99A 1G4DA 1D8KA 3I58A 2Q8KA 4MGRA 4F7ZA 5E1WA 3ZMZA 4L0ZB 1XGMA 4WXCA 2UZKA 2CWEA 2CSOA 4A2UA 1O7LA 3IRRA 4MNUA 5LRSA 2HQRA 2YX4A 1P2FA 2KJCA 3DEUA 1XCVA 1IN7A 4LLLA 2MH2A 5FGMA 2V79A 3F21A 2D2WA 1D5VA 2IP2A 1FYMA 2VT2A 2GZWA 1BOAA 4ON0A 1D3YA 2OQGA 4UV8A 2HKXA 4KMFA 4HF1A 4QLCU 2A61A 5AIPA 1J0RA 4LB6B 4LG0B 3IRQA 4A0XA 3WGHA 2OU2A 1B6AA 5D5WB 2PMHA 3GXOA 3DQVC 4KMUX 2IA0A 4EJTA 2P7CB 3V7CA 5HDKA 1O3SA 3V7SA 3P9IA 4I0BA 2W85A 4N0BA 3Q5FA 4IRIA 3WTSC 2EA4A 4OIOF 3T8RA 4I09A 1KU7A 4N9IA 3H3ZA 1IXSB 3DPTA 4FX0A 5E1XA 2YU3A 4Y17A 2JSCA 1SAXA 5BS6A 2CW0F 3ZP5A 2L02A 3RKWA 2CGPA 2J5PA 5J8CA 4BYYA 1ZH5A 2DTRA 2VN2A 1XMAA 5L3FA 3M1EA 2A07F 5HVQC 2KIMA 1SFXA 1KA8A 1U5TA 2YR2A 2P6TA 1WWXA 2QWWA 4YFKF 4S05A 3ELKA 5J6XA 1MDMA 4EGZA 1HW5A 3GW2A 1REPC 3JSPA 2Z9OA 2VOPA 2R3SA 3E5XA 2CFXA 2HDCA 2Y75A 1R5GA 1SMYF 3GLXA 3JSOA 4CZZA 4R8HA 2RV8A 2XAFA 3QRFF 1ZGAA 1ZGJA 3QPTA 5LRRA 2FSWA 5IT9K 5E1ZB 2ACJA 3I0TA 1HSTA 3WTZA 3WGGA 3EDPA 2BBYA 1IN8A 1XCBA 1Z7UA 2PN6A 4LMYA 1PUEE 5F64A 2RKHA 3ABTA 5BMZA 2VODA 2AXLA 2HOEA 3GO5A 1DPUA 1HW1A 1MKMA 5DEQA 5ILUA 5JVTA 1P92A 1WSUA 4R1HA 3LA3A 3S2WA 3MWMA 2ELHA 3F8CA 4EGYA 3KP4A 1XGNA 1E2XA 4OOIA 5LEJA 2FMYA 3OOPA 3RTRA 5LGUA 3GFJA 3I64A 3B73A 3N97A 1QZYA 5L3GA 3TOBA 1I6XA 5D6FA 2A68F 4BNCA 2VBXA 1QBJA 3FZVA 4HW0A 4LJZF 2M5WA 4OMZA 1TBXA 2IPQX 1U3EM 3GVAA 4UXNA 3WE2A 2FE3A 1BI2A 3ML6A 3ABUA 4GGGA 3HTUA 4I2OA 4UHTA 5D5VB 3F72A 1BM9A 3WTXC 4Q48A 4LG0A 1P6RA 2M87A 1KU2A 2ETHA 3ULQB 1MJ9A 3F3XA 4A0ZA 3TO9A 2FBIA 1RZ4A 1R36A 4LD5A 1XB4A 2V1UA 5A2QK 1IN4A 2Y48A 3E5UA 1K6OA 2G7HA 2UWMA 1G3WA 3RI4A 2OD5A 4OIPF 2Y0MA 3J80K 1KU9A 4PZJA 2QBYB 4PDKA 2ZCWA 2IJLA 4M9XA 5D4RA 2HR3A 4UUVA 1IRFA 4MEYF 3ROUA 1PP7U 2LF8A 1BN5A 5IT9Z 3B02A 4BXUA 2WWYA 1RUNA 1IUYA 2V6CA 3TKYA 2H6BA 2E7XA 1ODDA 1ON1A 1ZAOA 2UXNA 2AS5F 3U1DA 1LVAA 4MQVA 2DPDA 2UXXA 3DXJF 1O3RA 1G3TA 4UV9A 4HDVA 3WTYC 4A5NA 4BHBA 2LF7A 1IF1A 2PG4A 1JE8A 3G73A 3I53A 1B1BA 4CO8A 5ICGA 3REOA 2CO5A 3LQRA 1UFMA 2VXZA 3BPXA 3CTAA 2EWNA 3TDUC 1FP2A 2IA2A 3I5UA 3AAFA 3GF2A 1ZLJA 2BGCA 3BP8A 1TNTA 1FSHA 3PQJA 4EM2A 4ESFA 5FB2A 5K5OA 3CUOA 4HZFA 2FBKA 3BWGA 3R0JA 4KNYA 1OYWA 1UB9A 1CGPA 3N4MA 4ZH4F 1XDSA 2PBIA 5ED4A 1BI3A 5D5XB 5FFZA 2HZTA 2NAZA 2HQNA 4ESJA 1FZPB 2X4HA 4BH9A 5LHHA 4I7HA 1R00A 2K4JA 2NNYA 4HA8A 1LEBA 3KEQA 1IW7F 1LB2A 3LWFA 3CO6C 2QVOA 1YW9A 3T8TA 4KICA 2QQ9A 2L54A 1STZA 4XLPF 3R60A 3I4PA 2EFOA 4ENJA 3DV8A 5A2QZ 2P5KA 1R58A 4GCVA 4MHGA 1HKTA 1OKRA 5DUIA 1WQ2A 4U0YA 5FO5A 4WXHA 2IVMA 4ZYEA 5LHGA 5H20A 2EFWA 2F2EA 4HYEA 4G7OF 1X3UA 4A5MA 1IN5A 1Z1DA 2BE5F 3J80Z 1FWZA 1PDNC 3NEUA 4XBFA 4E70A 3M9AA 2NRAC 4KN4X 1HW2A 4KFCA 3ZQ7A 3ZMUA 5ICEA 3C18A 5FD6A 3FM5A 2ADUA 3GUDA 5DD8A 3FXRA 3WTVC 1SD5A 2CG4A 2X0LA 2FOKA 2PQ8A 2QBYA 1Y0UA 2DQLA 2O0YA 5DCMB 1QPMA 2GA2A 1ZRFA 2DBBA 1BIBA 5D5UB 3KE2A 3TQNA 1XD7A 1NHAA 3RIRA 3DKWA 3P9CA 2V1DA 1B4AA 2Z33A 3WTUC 3LSTA 4RGSA 2XRNA 3BPVA 5E17F 4ASNA 4AVPA 5LBQA 4ENNA 4I98B 4MQ9F 1EH8A 3GEZA 4NQWA 3TOAA 3JAMK 2K4BA 1SD7A 1ZG3A 1EH7A 2PMUA 4L18B 1WI9A 3GFMA 1DUXC 1HKQA 2EA2A 3E6BA 2A69F 1ZN2A 1JGSA 2XAGA 2DFIA 5JFRA 2VONA 1OR7A 3HSFA 3MEXA 5HS8A 3HRTA 5LGNA 3FMQA 3K0LA 2IT0A 2K02A 2STTA 1ONVA 2KIFA 2HTSA 4EVIA 4OIQF 2FBHA 5CLSA 2EB7A 3P7NA 3RJPA 4RB1A 4GYGA 1ZHFA 1ZG1A 1YQAA 3KP7A 3COAC 4I01A 3FM3A 2WC2A 1FOKA 4N9HA 4IF4A 2EFPA 4FHTA 1W4MA 4JBAA 1BI0A 1IXCA 2XIGA 4HOBA 2RDPA 4OINF 3VB2A 2RN7A 2VE9A 4G6QA 2VBZA 1RIOH 1YW8A 5K5RA 5D8LB 4UVBA 1HSJA 2KIUA 4U7BA 3L9FA 4KA4A 1I27A 3EETA 4HLYA 3K1NA 2FMLA 4A12A 3CUQC 2KKOA 2WV0A 1PP8F 2R7DA 5F6FA 3ZMSA 4O3MA 4L0YB 3KZYA 3LFKA 1G3YA 2QLZA 1T39A 1FYKA 2JZYA 3NRVA 2W84A 2ISYA 4LFUA 1G6NA 3ECOA 5CVUA 4M72A 2EV0A 1J2XA 2E7WA 2JTVA 2HYGD 3IL2A 1K78B 5HOOA 1DDNA 1H0MA 2CYYA 1UHMA 1XSVA 4HX8A 2DT5A 1KU3A 5D6EA 1YYVA 5TJJA 3SHFA 5BPDA 2RGVA 4EM1A 3T1BA 4M6XA 2J5OA 3I59B 4O6JA 4I02A 2O3FA 5HS7A 4HDUA 3L2CA 5CVIA 2W24A 3R6SA 1KYWA 2K27A 3RYPA 2FA5A 2BYVE 2CQKA 4P9UA 1YG2A 1FLIA 2C6YA 5DCMA 2GXGA 4PGHA 1XSXA 4HF2A 2OQRA 1TQMA 2FF4A 3JAMZ 2R7FA 3KEOA 4U88A 5BQTA 4FT8A 4ENKA 1XGOA 2IRFG 3DPLC 3LAJA 3SXYA 2W25A 1OMIA 1G3SA 3IKTA 2A6EF 1SFEA 5HDGA 4YFXF 1VTNC 3FMRA 3HYIA 4KIBA 4Y15A 3ZPLA 3F8NA 2JPCA 1IAWA 3KLNA 3J81K 1XMKA 2L4MA 3CUQB 2QM3A 2EFNA 2QUFA 2A6HF 2XUBA 4M9ZA 2W57A 4U0VA 1RNLA 5KK1A 2DPUA 3TDZC 4FX4A 1QGPA 3HOTA 2YSRA 3FWEA 3ERED 1TW2A 3HIFA 3E5QA 2L4AA 1ZLKA 1I1GA 1O3TA 2IA1A 2QENA 3T0YA 4H0EA 5ICCA 5DD4A 2XASA 2FNAA 1B9NA 4IRHA 2JT1A 2RQPA 1SFUA 2O8XA 2JPBA 3WTTC 1Z6RA 4WK8F 4HX7A 1YTYA 4L9JA 3BY6A 1QQIA 3V8JA 2P7VB 1XDUA 3EYYA 1J5YA 2OA4A 4RGRA 1BI1A 4D0PA 5EEHA 4G8XA 2E1NA 3VOEA 4ZZLA 2XKPA 3KLOA 4P9FA 3F22A 2MA3A 2ZKZA 3H3UA 4RB3C 1DPRA 2VE8A 3MCZA 3LQQA 2P8TA 3L7WA 5HLGA 1LDJA 3W6KB 2L01A 3KFWX 1LQ1A 4S04A 5L3BA 4HAMA 3F8FA 1T0FA 5HDNA 1FBQA 4A0YA 4AD9A 3H92A 1K78A 4OU0A 4RAYA 1MD0A 3K1PA 1XN7A 1F5TA 3O3KA 2GXBA 4IVNA 4IXAA 5LHIA 5ILVA 3WG9A 1W7PB 1FPQA 3FXUA 1U6GA
chains in the Genus database with same CATH superfamily
3O6BB 4XK4A 3BQZA 5GTIC 3BQYA 1HDPA 5HLIA 4XL9A 3I59A 2ZMEC 3IAS2 1MZBA 1DP7P 2HOTA 3CO7C 2CUEA 1FMVA 5JHUA 2XPWA 3BG5A 3JRFA 4A3KJ 2LDUA 1PUFA 5GP9A 4PFPA 3KP2A 1S3JA 1W0UA 3CQZJ 4D9JA 4XIDA 3RZDJ 2BVLA 3GZ6A 2OZ6A 1YS7A 2HOSA 3I71A 5IT3A 3SZTA 2LR8A 3LFUA 2TDXA 1SANA 4A6DA 1KYZA 3HSEA 3ESWB 2DDAA 4Y33A 1I1SA 1ETQA 4L5JA 5AONA 1HLVA 1V3FA 3K4LA 2YX7A 3GX4X 3HM5A 1S9HA 2RAEA 1YJ9I 3J81Z 3A03A 1JUMA 2V9KA 4EEFG 1A6IA 3Q9VA 2NS0A 3EYIA 5M3FJ 1VZ0A 2BEOA 1SFKA 5DCFA 4CHUA 1IV6A 1FEXA 2FX0A 4BY1J 4A6EA 4XSXF 1Z3YA 2ELKA 4XLFA 2GXAA 3GFLA 2HEOA 1RR7A 2WAQN 2DK5A 2EQRA 1DQUA 1S5LC 5IPAA 4RAFA 4XKVA 5LLQA 3H3VK 3PO3J 2VT3A 3F6VA 5F04A 4X1EA 1FMWA 2ZB9A 4HLXA 3MN2A 5JVGF 3HC7A 1CF7B 2ZBKA 1VI0A 1K79A 2BZTA 1HKSA 2QQBA 3GTPJ 4HX4A 2P5VA 2NVTJ 3DF8A 4HF0A 4CCKA 3GYHX 2XGEA 2Z16A 2LY1A 3ZN1A 2VXDA 3CUQA 4AUXA 2ZNZA 2ZJQF 4MTEA 2W4SA 3KYCB 2RC4A 4O5VA 3K2ZA 5J47A 3RDIA 2OZUA 4IHTA 4NBQA 1HC8A 2HWVA 1JXSA 2GLOA 5F27A 2PFBA 1ZKGA 3S15J 4DZJA 2GIVA 3LSHA 2DW4A 2XB5A 2R93J 1N78A 1P4XA 1SD4A 4BE0A 5IYDJ 1EH6A 3KP5A 3I4NJ 3OYCA 3I9V2 3W2VA 3ZCOA 1P4WA 2PX9A 1OYYA 2VQLA 5CVJA 4EMSA 3M8FA 2F4MB 5FD5A 1DP3A 2OBPA 1Y1WJ 1PYVA 4B48A 4YG2F 1R1TA 1SVOA 1SVMA 3EQLF 2DA4A 2QF7A 5J8FA 1L3LA 3HTSB 1YIOA 3HUGA 4CDGA 2H94A 3HGGA 4J19A 1P7JA 3K7AJ 4M71A 3WGIA 3ZMVA 1QNTA 3I3LA 3V42A 1BJAA 1WJCA 3EUHC 3M8EA 3A02A 4V2GA 2EV5A 3TO6A 4A3CJ 1ACIA 5EGOB 5ILSA 5E18F 3K70D 1YIJI 2IGMA 4XSZF 1WRJA 1S7OA 2Q2EB 2FD5A 3FBNB 1Z9CA 1MNDA 4IPAA 4D1QA 2ZMEB 2MLKA 2VB6A 5KNLA 5H6QA 5KVRA 3QP6A 3W6JB 1GXPA 3DTEA 4HSTA 3FXMA 4XOTA 2E60A 1ZARA 4AIKA 2DYRH 2H6CA 1CQTA 1A04A 3OYMA 2ESNA 3BG7A 2ZXIA 2ZO4A 4XKWA 3OYGA 4EJUA 2FQ4A 2WAQA 4IRGA 1ZG5A 5L3EA 3OYAA 3GTQJ 1XG1A 2IS2A 4U0WA 3HL2A 4G94A 1HXDA 1IGNA 2O03A 2DO7A 1HF0A 4KDPA 4XM3A 4P96A 2XAQA 2DN0A 1KGSA 3E97A 5E3OA 3A01B 2GQQA 4ZZDA 4ZJZA 4UNOA 4UVCA 1GV2A 3O8GA 1QZZA 1D0XA 2DOAA 1O57A 2Y69H 3D5SC 5FKNA 3CJNA 4QWQA 2HYJA 1VQKI 2FEZA 4M3EA 3CDIA 3S32A 3BR3A 2M30A 4XRFA 3CCMI 4RAZA 3IUOA 3P9KA 2HS5A 4ANJA 1H9GA 1NH3A 1ZRDA 3BR1A 1R23A 5KAFC 3LAPA 2M45A 2EZHA 3GTMJ 2CUFA 1MJBA 4B09A 1T98A 5IOZA 3M8JA 5LGTA 1UCRA 2BHZA 1ETXA 3FF5A 2ZJ2A 1S7EA 4FE4A 3RYRA 2ISZA 2QGUA 2ZFWA 4XKCA 3KZIC 1F36A 1TWAJ 4YIIA 2DJIA 4Y13A 4BXXJ 2P6SA 3U2RA 2EIMH 2F5EA 2PLYA 3DPUA 1ETVA 5ERIA 2GA1A 5FFXA 3D0SA 3LL7A 2LOOA 3E1SA 2M8EA 1W7PA 3ASOH 2PI0A 1UMQA 4YEJA 2HYFA 2P0WA 1QRYA 2Y9YA 2MD0A 5K5QA 4BQAA 4M3DA 4OAYA 2K9SA 4DIQA 1U8RA 4CICA 4HG2A 2XROA 5AIQA 1T56A 2WAEA 3GWZA 3M7GA 4WXDA 1D5YA 2LFBA 2WY7Q 4DBRA 3S3OA 3T5XA 4PSWA 4CH7A 2OV7A 1FJLA 3ECHA 3R0AA 3BJOA 3IH2A 1H9TA 2X85A 3RCOA 1ETWA 2B63J 1UHWA 3CD6I 3SJMA 4M9SA 1XTAA 2CW8A 2ECCA 2G7UA 4L5IA 4P1WA 2Z1DA 4M74A 1EF4A 4TV7A 2HVQA 1K7AA 2QCOA 2LYCA 1HQCA 3C1DA 5BOXA 3BTLA 2E71A 5TISC 3ZOBA 3B6CA 4CXFA 5FLVA 4ZTFA 3SEQA 1ZRCA 3OSFA 2MFZA 2ZJRF 1IZ1A 4HNTA 4ETSA 3LSRA 5FROA 1C0WA 3E6DA 3DBHB 3FHNA 2LK2A 5E20A 1U2WA 3IKVA 5J1UA 2Y30A 3HRSA 4AVZA 1J9IA 2R4GA 4B44A 2XC7A 1FOYA 3MFKA 2VJIA 4AIJA 4EJVA 5DDGA 1KONA 4UB6C 4E7SA 5GADJ 2I5UA 4MEXF 3PFIA 3S16J 3ISPA 1WJFA 3PQKA 1WJAA 4S0HB 3U21A 3K9TA 3BZ6A 2DA3A 1LFPA 2MD5A 2WTEA 2O6GE 3DU5A 1MBGA 2DMPA 2M4GA 4G9YA 1RUOA 3PUFA 1CF7A 1GVJA 2F5DA 1HCRA 4GYIA 4CCOA 2D1HA 2H09A 1ZREA 1LEAA 1HOMA 4XRSA 2DYSH 3OYKA 1T38A 1MNMC 2RNJA 4IL6C 1IJWC 1IRGA 2A5YB 1RI7A 1JHHA 3NQOA 1WI3A 4LK1F 4BJTA 4CYDA 4BE1A 1FY7A 3ASNH 2EK5A 5E3NA 1V5GA 2FU4A 2JUGA 4BKXA 3CCRI 1ZR4A 4Q47A 2KDOA 3CLOA 2GBYA 3OYBA 2KRFA 5D4SA 3MKYB 2ZNYA 5LEKA 2HQ5A 1USSA 2MGQA 2TRTA 2EILH 4GXOA 3TL4X 3N05A 2BV6A 3E3VA 5C4JJ 4XLNF 4EJWA 1Z05A 3C3WA 3KP6A 2YPRA 4L9TA 1TZLA 1BC7C 1X1AA 4NDLA 1FSEA 4DOZA 1Z91A 4KYWA 2X51A 5F1RA 1FP1D 2VC1A 2NVQJ 5HS9A 1U78A 2GWRA 1TQPA 3BROA 3OIQA 3OV8A 1S8NA 4E7HA 1G8XA 4HPQA 2A6TA 2PJRB 1V4RA 2XGXA 3G71I 1ULYA 5CVVA 3S3NA 2K5CA 4HEA2 2OUMA 5EGOA 1G59A 3CF2A 4UUTA 2NVYJ 2NYXA 3QP5A 2Q2EA 5ICFA 1R4NB 4D7MA 2ZMEA 3HB9A 1W5SA 5JHFA 5H6RA 2YS9A 4WX9A 3MMYB 4HNVA 3MQ0A 2MLGA 4BHPA 2W48A 3WTWC 1R5ID 1V54H 3WU1B 1PUFB 1QHHD 2Z3YA 1ITYA 1IN6A 1YS6A 3FISA 2FJ1A 2QQAA 3IH4A 1BJZA 3LOCA 2OC6A 1T6SA 3L2RA 1P7IA 2XAHA 3H9QA 3VEPA 1F9NA 4Z6YA 2NVXJ 1TW3A 4LB5A 5DM7F 2KRHA 1VQNI 1R1UA 3A01A 2F5CA 3WU0A 1E17A 1ZR2A 4LITA 3CDHA 2XB0X 1KQ8A 1AWCA 2LKPA 3HZJA 1O7FA 1WZ2A 3CCSI 4R79A 2LP0A 3ZMDA 3HOXJ 1OCZH 3K2AA 4KUMA 3BJAA 1U8BA 2LNBA 2RVCA 3NWSA 5JR3A 3UKGA 1MW7A 2IGKA 3LA2A 2L7FP 2MABA 3LSGA 1USTA 1IDZA 3QOEA 2KT0A 2QEXI 3LSPA 3SZPA 3KZZA 5FLXK 4IQ4A 2KRCA 2LD5A 2VI6A 4BHCA 3ZQIA 3F9KA 5L3CA 4Q4ZF 4IHSA 2V7FA 4WCGA 3ABKH 2XSDC 2LSOA 2K7LA 2VKVA 3WHCA 2CH0A 1YOVB 5HNHA 4HNUA 2CFOA 2TCTA 3BR2A 3HHHA 3W3CA 4XLCA 1I3QJ 1IDYA 2LC2A 4EATA 1JHFA 1GHCA 1QVUA 2JRMA 5BNGA 1ERDA 2K3FA 3C2GA 1BL0A 4NHJA 1JT6A 5CQEA 2L3DA 3H5RA 3TGNA 2WV1A 4PJJA 3JTHA 3W2AA 2PMZN 1D1CA 2M3AA 4OIRF 1JTYA 1ZYRF 2DLLA 3ONQA 3AG3H 4XR6A 5CVRA 4L9VA 5GAGJ 2L7ZA 3DKYA 1LJ9A 4B47A 4HSRA 3FBIB 3NAUA 3F8MA 3S1QJ 4LLGF 4XLHA 3SFIA 5H2FC 4J01A 1W0TA 3HSRA 3OR2C 4BE2A 2HQAA 2HTJA 2HU9A 5E8IA 3G6EI 5D8KB 5B5EC 1LDDA 1H8AC 3PIPF 3D5LA 2EBIA 3MZHA 1K4SA 1MMAA 2IAIA 4OAZA 3K4BA 2L9NA 5K1YA 1P4AA 1W1WE 3RKXA 2ESHA 2MH9A 1LVKA 4YELA 2Y9ZA 2EFQA 2FQ3A 1E3OC 3EUHA 1YO5C 3GZNB 1X3WB 4QPOA 3SFZA 2GAUA 1R1VA 2W00A 3KIOA 1X1BA 1R71A 4LK0F 1Z6TA 3F0CA 2R7ZJ 1QO0D 2OJED 2HFHA 2VC0A 5BPIA 3OYJA 2LKSA 3QYBA 1ZELA 2PEXA 1U9NA 3O2PE 4RS8A 2V1XA 3FXQA 4JK1X 4RGXA 1S7AA 1VQ5I 4BU2A 1FTTA 3VODA 1YFHA 2O61A 2X1CA 2E36A 1O3QA 1NG6A 3DEWA 4LIVA 1WFXA 3C7JA 1EA3A 5CJ9A 4M73A 3TMOA 2DA5A 4HV5A 3CC7I 4L9NA 1TQIA 3ZQCA 2H8RA 1XGSA 1VQ7I 2MYSA 4KISA 2MC3A 3HOZJ 1FC3A 4M6YA 4AIHA 4LLNA 2BW3B 5F08A 4ESBA 5CQGA 5HLHA 2V9VA 4MO7A 3ZRGA 3EUKL 2B9SA 3GZ5A 2VBWA 1ENHA 3FHZA 3C2HA 3QPHA 2NNNA 3BTJA 2HVSA 3G1OA 2K9NA 3CC4I 3JRDA 1BC8C 1FNNA 1F4KA 4A3FJ 2HDDA 1I5ZA 3WE3A 2M1BA 1EV7A 2DQRA 3X2QH 4CGZA 3BDDA 3K4NA 1FT9A 3WODF 4WF2A 3HRMA 2P5LC 1MNEA 1W5TA 2PMZA 2R7VA 3RKYA 2D45A 5DM6F 1BA5A 5CKTA 4M3GA 2VQHA 4NC6A 3HJEA 3RKQA 2BHYA 3E6CC 1OLTA 1U5TC 1MJAA 2F5FA 4I6ZA 1R7JA 5FKMA 3SQNA 3E7LA 4D5CA 3ZMTA 3GFIA 4BJ6C 4UVAA 4Q5SF 1D0YA 1YLFA 3E6MA 1GV5A 3JRAA 5CYVA 2EV6A 2XV4S 3DFGA 1OISA 2COBA 4A93J 3VYSB 3S3MA 1YW7A 4JOMA 4P5OA 1A35A 2XKOA 1Q1HA 2PJRA 3CMAI 1Y39A 4KIFA 2NS7A 2ZXJA 2FRHA 2LMDA 4PCQA 4UB8C 3G2BA 1E3HA 2G9WA 1L0OC 1AA7A 2I10A 3GTJJ 2E1MC 3PM1A 4MIMA 4ZYAA 4C3JJ 2E1OA 1YITI 3RPUA 2L9SA 3G3ZA 1K83J 2M9HA 2CUZA 2DI3A 1LPQA 3LA7A 4AU7A 2HGCA 2HKOA 1VQ8I 2Z2SB 2DOEA 3HOSA 3QU3A 1JKPC 4Z2YA 4EJOA 2QZ8A 5FLXZ 3BJ6A 1N75A 3KP3A 5E79C 3IWFA 3Q9SA 5EEGA 2R5ZB 2FNPA 3MZ8A 3OYEA 2IW5A 4QTRA 1FBSA 3LNQA 5DYMA 1R5HA 1GVDA 5EF6A 2B0LA 1YJNI 2P4WA 2E5NA 1D8JA 4I76A 3QOPA 2IGOA 1MIJA 2OAZA 4Y3OA 4P55A 2LBFB 3V8LA 3VFZA 4LG3A 4DNCA 1J59A 1B9MA 3MZYA 5DUKA 2R7UA 1ON2A 3OS1A 3OS0A 2D1VA 3G1LA 4GO1A 2VPRA 4ZYGA 2XF5A 1F1ZA 4KN7X 4ZYDA 5DV5A 3OYIA 4J00A 3S1NJ 2F48A 3F8BA 3BR0A 3L09A 5EDNA 2UV1A 4KIGA 4A3DJ 1X3ZB 4IOAF 2DK8A 1WKMA 3CZ6A 4NB5A 2R0QC 4G6DA 2KQRA 2KZGA 4WWCA 1A5JA 2Z5UA 1LDKB 3CJQB 2VBYA 1AU7A 4RB0A 4DQ2A 2E5ZA 4RGUA 4JQFA 2HPMA 3R61A 2XAJA 3BOQA 1H88C 1U0JA 1BR4A 1FX7A 2X6XA 4UY8I 1MGTA 4RB2C 1SEUA 4C2MJ 4JX6A 1MBHA 3JW4A 3OYHA 1VQ4I 1SMTA 3AL0C 3F6OA 3TO7A 4YFNF 5J4VA 1J7KA 2MSYA 1T2KA 1SD6A 5E8GA 3CCJI 4XOPA 4U7DA 3SZGA 1TT0A 2FXAA 1TTYA 4EQQA 5B66C 3J7AO 1TL8A 1W36C 3K1MA 4MFDA 4BQOA 1KQ9A 2XVCA 3K69A 2VOOA 2PJPA 3U9GA 1MMDA 4BAYA 4BQQA 1JGGA 4ZDOA 3K4MA 4KT5C 1FYLA 3QAHA 1U5TB 1JJ6C 4LGWA 1TNSA 1AOYA 3WG7H 3V8KA 1IXRC 1TLHB 3ZN0A 4ZYHA 5E3MA 2HPIA 1KQ0A 5HNFA 4XRMA 1S29A 4ENMA 1W7PD 2F5VA 2KP6A 3FMSA 2DOFA 5LD2C 1S6LA 2CJJA 3CJTB 3V7RA 4EV0A 1EKEA 2X1DA 2BY2A 1MDMB 2VUMJ 3IWZA 3BG6A 2K86A 4RBOA 2Q0OA 2LY9A 3PO2J 3FX3A 3F23A 4B8XA 5JI6A 5C4XJ 3FXKA 3V4GA 3L00A 3DP7A 3BLYA 2COMA 1FBUA 2CRGA 2ME0A 5F0HA 5EEAA 5FKKA 5C44J 2XGCA 2E1CA 3FXLA 5L3DA 1NK2P 2R7RA 1XSDA 1I39A 4AIDA 1NK3P 1WPKA 2E1MB 1GXQA 2BXYA 3KETA 4YIFA 4K2EA 2CS3A 2QYOA 1BW6A 1OPCA 4HV6A 2BY3A 1FIPA 3KCCA 5K7FA 3IHUA 4I0AA 4MTDA 1JTXA 4XMYA 2DODA 1T33A 3R4KA 2ZFUA 2KJBA 5EG0B 1J75A 2IS1A 1R22A 4BACA 3HG9A 3TW7A 4U87A 4IJAA 5JLXA 4AWXB 4BGDA 4HQEA 2JWTA 1HBXG 2JRTA 4CSWA 2VKEA 2DAOA 2UUZA 2BOLA 4HBLA 2Y31A 3JTGA 2MBFA 1U9OA 2STWA 1IC8A 3IC7A 2H27A 3Q0WA 2DFEA 2BW3A 3A2KA 2X6WA 1BIAA 3DU6A 4G7HF 3MAJA 1B8IB 3I54A 2JA7J 1OJLA 1NG7A 1Y8QB 4F91B 3QU6A 2DU9A 1TWHJ 5EZGA 1QVTA 4BQNA 2EJRA 4G7ZF 3OYFA 5TRDA 2XHKA 4PGGA 4RDUA 1D1AA 1DU0A 4V19K 9ANTA 3HHGA 1NTCA 1BBYA 2OTJI 1B59A 4HQMA 4RAGA 3RPQA 3IV5A 1LNWA 4NC8A 2A3SA 3HRUA 2JVHA 2IS6A 4EM0B 1A36A 3C2BA 4OMYA 6PAXA 1OYIA 5LFAA 2VLAA 2Z99A 1G4DA 1D8KA 3CCUI 3I58A 3BT9A 1VQ9I 1J09A 2Q8KA 4MGRA 4F7ZA 3LSIA 5E1WA 3ZMZA 3FIWA 4L0ZB 1XGMA 4WXCA 3DTKA 2UZKA 2EH3A 3CF5F 1POGA 2CWEA 4XKBA 1A31A 3AL0B 2CSOA 4A2UA 2B7EA 1O7LA 3IRRA 2DA6A 4MNUA 5LRSA 2DXIA 1Y6IA 2HQRA 3P5JA 4E7IA 2YX4A 3ZQGA 1EJ9A 1P2FA 4XNFA 4BXFA 2KJCA 3DEUA 1XCVA 2WBMA 1IN7A 2XDVA 4PSXA 2MH2A 4LLLA 5DS9A 1X1PA 5FGMA 2V79A 3F21A 2D2WA 4CCNA 4BEHB 2K9LA 1D5VA 2IP2A 2RREA 1FYMA 2VT2A 2X6YA 1I3AA 2GZWA 2GOXB 2JN6A 3TEDA 3NARA 4FASD 1BOAA 4ON0A 2KFDA 4PJNA 2R5ZA 2XF7A 1D3YA 2R7OA 2OQGA 4UV8A 1XMXA 3FKIJ 2HKXA 4KMFA 4HF1A 3RZOJ 5GAEJ 4RM2A 3CCLI 4QLCU 2A61A 5AIPA 5M3MJ 1J0RA 2LBFA 2VJ4A 3S8PA 2KLOA 4E4HA 4LB6B 1TP4A 4LG0B 3IRQA 4A0XA 3HXLA 3WGHA 2OU2A 1B6AA 2JA2A 4B3AA 3S93A 5D5WB 1VQ6I 2PMHA 2N8GA 3GXOA 3DQVC 4G12A 1ETKA 1ETYA 4KMUX 1N25A 2IA0A 4EJTA 2P7CB 3PNYA 3ABMH 3V7CA 1SVLA 5HDKA 1O3SA 3V7SA 3P9IA 4I0BA 2W85A 4N0BA 4BDYA 3CCEI 3OSGA 2DT6A 2DMNA 3Q5FA 4IRIA 3WTSC 2EA4A 4OIOF 3T8RA 1Y1VJ 2IS4A 4I09A 5IYBJ 1KU7A 4IHWA 4N9IA 3H3ZA 2YU9J 1IXSB 3DPTA 4FX0A 5E1XA 4B4CA 3DLLF 2YU3A 1JKQC 2EIJH 1WH5A 4Y17A 5FJ8J 2JSCA 4KJZA 1SAXA 5BS6A 2CW0F 3ZGKA 3HDDA 3ZP5A 2EZIA 2RQQA 2L02A 5FKLA 1BR2A 2JUCA 3RKWA 3AG1H 2CGPA 2J5PA 5J8CA 4BYYA 4E7ZA 1ZH5A 2DTRA 3L2WA 2VN2A 2AXTC 1XMAA 4RM3A 5L3FA 3M1EA 1M1EB 4PJLA 2A07F 5HVQC 2KIMA 1SFXA 1KA8A 1U5TA 2YR2A 1OCPA 2P6TA 1K4TA 2E2HJ 1WWXA 2QWWA 2KL4A 4YFKF 4S05A 5JLWA 3SDBA 4QIWN 4FE7A 1VQLI 4DW6A 3OR1C 3ELKA 3PSIA 4MLOA 5J6XA 2VKDA 3DBLB 1MDMA 2Y0SN 4PFOA 4EGZA 3A0BC 1HW5A 3GW2A 3M07A 3TW6A 1REPC 3H1CA 1ZTRA 4IHXA 3JSPA 2Z9OA 4BDZA 1W36D 2VOPA 2R3SA 3E5XA 4E6KG 2CFXA 4Y7NJ 2HDCA 3JREA 4X0GA 2VJJA 3GTKJ 1Q1VA 2Y75A 3ABLH 5J3LA 1R5GA 1SMYF 4IZZA 3GLXA 3JSOA 4CZZA 5HLTA 3H9GA 3I4MJ 4R8HA 4DJAA 2OPTA 1OQYA 1AKHB 4KITB 2RV8A 2XAFA 3M1CA 3DLAA 1ZGAA 1MBEA 3RQIA 3QRFF 1ZGJA 3QPTA 5LRRA 2A5WA 1UELB 5EG0A 2IXSA 2FSWA 2QA4I 5IT9K 5E1ZB 2V4JC 2ACJA 1RRJA 4ZDPA 1E3PA 1QZEA 2O9LA 3I0TA 1HSTA 3Q0VA 3WTZA 3WGGA 3EDPA 4XLEA 3VYUB 2DA2A 2BBYA 1IN8A 3KX2A 2E2JJ 1AHDP 1XCBA 1Z7UA 3GTLJ 4IQJA 3CMYA 2PN6A 3HEFA 1B8IA 2HDWA 2CW7A 4ZDLA 4LMYA 1PUEE 2WY8Q 5F64A 1LKXA 1MSEC 3NWTA 3K4JA 2EZKA 3H0DA 1ZK8A 2RKHA 3ABTA 3GTOJ 5BMZA 2VODA 3UR3C 2AXLA 2HOEA 2W1OA 4NC7A 3GO5A 2X1EA 3GMEA 1DPUA 1HW1A 1MKMA 3CESA 5DEQA 5ILUA 5JVTA 1P92A 3JRCA 4ITVA 2EIKH 5EYRA 5J1YA 1WSUA 4XLAA 4KT6A 1WCMJ 4DGWB 3BR6A 3ZXSA 2WADA 1V55H 1K6YA 4R1HA 3LA3A 3TP0A 4BBSJ 4I99C 3S2WA 2HI3A 2DT7B 2H8WA 3DCFA 3MWMA 5EZHA 1MMGA 4MFEA 2ELHA 1YRNB 2HXOA 1IG7A 3F8CA 4XORA 2IGNA 1A6QA 3EUAA 4EGYA 3IP4B 3KP4A 1MMSA 5B3SH 1XGNA 1E2XA 4OOIA 5LEJA 2FMYA 2Y0SA 3OOPA 4PK4A 3RTRA 5LGUA 3GFJA 4L5EA 3I64A 3B73A 2NXNB 3N97A 1QZYA 4JP0A 1SC7A 5L3GA 4M3BA 3TOBA 1I6XA 5D6FA 2A68F 2BVMA 2DJNA 4F92B 4BNCA 4BEHA 2VBXA 1QBJA 3FZVA 4HW0A 4LJZF 2M5WA 4OMZA 5DTDA 2E19A 1TBXA 2IPQX 1U3EM 3GVAA 2ELJA 1QA6A 4UXNA 3WE2A 2FE3A 1OR7C 1BI2A 3ML6A 1MBFA 4IO9F 1QPIA 3ABUA 2ZJPF 1X4PA 4GGGA 3HTUA 2W7NA 4I2OA 4UHTA 3K70C 5D5VB 1T08B 2DFHA 3RPUD 3F72A 4QPQA 1BM9A 4FTHA 3WTXC 1OCRH 1JKRC 4Q48A 4LG0A 1P6RA 2M87A 1KU2A 2ETHA 3ULQB 5M5XJ 1MJ9A 3LSJA 3F3XA 3RSNA 4A0ZA 1LUJB 3ERMA 3TO9A 1H89C 1OCCH 3E0JB 2FBIA 3HOWJ 1RZ4A 3J7AY 4W97A 4UUSB 1R36A 5GAHJ 1ZQ3P 2DDBA 3FXJA 4LD5A 1XB4A 2V1UA 4HRIA 5A2QK 1ETOA 1IN4A 4A3LJ 2XPVA 4XRSG 2Y48A 3TBIA 3E5UA 1K6OA 3HOVJ 3FKJA 2G7HA 2HVRA 4C9YA 3MKWB 2UWMA 1G3WA 3RI4A 1VQOI 2OD5A 4OIPF 3JRHA 4ABZA 2NOJB 2Y0MA 3VSKA 2M0MA 3J80K 1KU9A 4PZJA 3U1KA 5IOYA 2QBYB 1Z77A 1FOWA 2X6OA 2VPLA 4PDKA 2ZCWA 2IJLA 4M9XA 1Z3XA 3OYLA 1SFOJ 2V6EA 5D4RA 5F1JA 3L2QA 4NNJA 3JCUC 2HR3A 4UUVA 2M34A 1IRFA 4B43A 3DEEA 4MEYF 3ROUA 1PP7U 2LF8A 1BN5A 1TWCJ 2LY2A 1R9TJ 3OYDA 3HGYA 3S1MJ 5IT9Z 1PVEA 3B02A 4BXUA 3CCYA 2CMPA 3FK6A 3PIOF 2WWYA 1RUNA 2JA6J 1IUYA 2CV0A 2CV2A 4IHYA 2E35A 2DTZA 4A3MJ 2V6CA 3TKYA 2H6BA 3D1NI 2E7XA 1ODDA 2P81A 1ON1A 1ZAOA 2UXNA 2AS5F 3U1DA 2M7AA 1GLNA 3FDYA 4OWRB 4RA2A 4NQWB 1LVAA 4NUBA 4MQVA 1OFCX 2DPDA 1AKHA 4BS9A 3PL8A 2UXXA 3DXJF 1O3RA 1G3TA 3QPSA 4UV9A 3WTYC 4HDVA 3ZR8X 1XC5A 3CMMA 4A5NA 1OCTC 3A4CA 4BHBA 2LF7A 1YHQI 1IF1A 1Z67A 2PG4A 4CZCA 1JE8A 2ME6A 3G73A 3I53A 1B1BA 1O4XA 1MBKA 4CO8A 5F0FA 2OTLI 3KPHA 5ICGA 4AYBN 3REOA 2CO5A 3LQRA 2GOMA 2JQ7A 1W5CC 1UFMA 2VXZA 3OWTA 3BPXA 2F4OB 2X9DA 3CTAA 1V5FA 2EWNA 3TDUC 1FP2A 2IA2A 3I5UA 3AAFA 2LRDA 3GF2A 2CU7A 1ZLJA 2BGCA 2M7BA 5K7ZA 3BP8A 2LKXA 1TNTA 3OL3A 3PQJA 1FSHA 4EM2A 2R7WA 1JT0A 2R7SA 4A3BJ 5GPAA 4ESFA 5FB2A 5K5OA 3CUOA 2L7KA 4HZFA 2ZXHA 2OCCH 2FBKA 3BWGA 3R0JA 4KNYA 1OYWA 3S14J 1VF9A 1UB9A 1CGPA 1DU6A 3N4MA 1JKOC 4ZH4F 1XDSA 4II2A 2PBIA 2KZVA 5ED4A 3TP3A 1WH7A 3MKLA 2R5YB 2EINH 3LSKA 3HBLA 1BI3A 5D5XB 3DTIA 4CCLA 1YRNA 3W2WA 3MD2A 5FFZA 2LTPA 4DYRA 2HZTA 2NAZA 2L5QA 2HQNA 4ESJA 1FTZA 1FZPB 2M4KA 3BZCA 2X4HA 4BH9A 2F6CA 3UNGC 1TWGJ 5LHHA 1LFUP 4I7HA 1R00A 2K4JA 4GDFA 4LOCA 2NNYA 4HA8A 1LEBA 3LMMA 3KEQA 1IW7F 3KEYA 4BJ5C 1LB2A 2EPFA 1BOBA 3LWFA 3CO6C 2L9RA 2QSFX 2QVOA 1MBJA 1YW9A 2HOAA 3T8TA 2R7XA 4CCMA 1YI2I 3CP2A 1QHGA 1X1CA 4KICA 2DA1A 2QQ9A 2QSGX 2Y2ZA 2VQGA 1FOXA 2L54A 1STZA 1D1BA 4AYBA 2JSPA 4XLPF 3R60A 2W82A 3I4PA 4CYCB 3L1PA 2EFOA 4ENJA 2DA7A 2ICWG 3DV8A 5A2QZ 4N4OB 2P5KA 1R58A 5GTHC 3LSMA 3SDGA 2QKLB 1TWFJ 3BCAA 4GCVA 4MHGA 5M5YJ 1ORKA 3FK7A 2HZDA 1HKTA 1OKRA 5DUIA 4IX7A 3CDLA 4Y4RA 1WQ2A 3AG4H 1T8IA 4U0YA 5FO5A 2VKHA 4WXHA 2IVMA 2K9QA 4F52A 4ZYEA 2R7QA 5LHGA 5H20A 2EFWA 2F2EA 4HYEA 2CQXA 4G7OF 1X3UA 2CV1A 2WB1N 1IN5A 1Z1DA 2BE5F 4A5MA 5M5WJ 2KHMA 3HKZN 3J80Z 4UUSA 1FWZA 1PDNC 2LREA 4C2TA 4XQFA 3NEUA 4XBFA 4E70A 5J4YA 4C2UA 2JK3A 1E0EA 1JUSA 3M9AA 2NRAC 1MMNA 2M0CA 1RC9A 4KN4X 1HW2A 4KFCA 2X48A 2KDZA 3ZQ7A 3HPHA 3ZMUA 2CQ7A 2L9VA 5ICEA 4LIUA 3C18A 5FD6A 3FM5A 3H36A 3PFYA 1T95A 2ADUA 1RKWA 3GUDA 5DD8A 3FXRA 3WTVC 5B1BH 3DKXA 1SD5A 4ZC3A 2CG4A 3VDXA 2X0LA 1RKTA 3K10A 5GPCA 3CCVI 2FOKA 2PQ8A 4ZTJA 2QBYA 1Y0UA 2DQLA 2O0YA 3MVPA 3SEZA 1XS9A 2XRLA 1QPMA 5DCMB 2RNGA 1MSFC 1G2HA 2GA2A 4IEJA 2DBBA 1ZRFA 1JI8A 1BIBA 4W1UA 5D5UB 1IV8A 3QODA 3KE2A 3TQNA 1XD7A 1NHAA 3RIRA 4M6VA 3G1MA 2KIQA 3DKWA 3P9CA 2V1DA 2DFFA 1B4AA 2L7MP 1X4OA 2Z33A 5FKOA 2M8GX 3OS2A 4E7LA 5FRNA 3J7YJ 3WTUC 4IOCF 3LSTA 3D5RC 1IUFA 2XRNA 4RGSA 3BPVA 5E17F 4ASNA 4AVPA 5LBQA 4ENNA 3PNTA 2ZSHB 2CQNA 4I98B 4MQ9F 1APLC 2K3PA 3S17J 1T0FC 2LVSA 3ZQLA 1EH8A 3BG9A 3CMEI 2K85A 1YX5A 2VIXA 3GEZA 4NQWA 3TOAA 4D7NA 2BXZA 2AHQA 1IRZA 3JAMK 2K4BA 5FLMJ 1LFBA 1SD7A 1ZG3A 1EH7A 2PMUA 4L18B 1WVRA 1WI9A 2L0KA 1HA8A 3GFMA 1DUXC 3BR5A 3JRBA 1HKQA 2EA2A 3B6AA 3E6BA 2A69F 3SYTA 1ZN2A 1JGSA 2XAGA 3H9JA 2JA5J 2DFIA 2WB1A 4C3IJ 1GT0C 5JFRA 3VWBA 3HOYJ 2VONA 3PNVA 5B1AH 1MH4A 1OR7A 3HSFA 3HKZA 3MEXA 2GM4A 5HS8A 3HRTA 1YX3A 2V26A 5LGNA 2JVGA 3FMQA 3I55I 1V5EA 1YJWI 3K0LA 2WAFA 2XGDA 2CQQA 2K02A 2IT0A 2STTA 4N4NB 3A1YA 1ONVA 5CPRB 2KIFA 2HTSA 4QSHA 4EVIA 4OIQF 2L2OA 3BZKA 3DWLE 3OYNA 1Z0XA 2K40A 2YUSA 4DYCA 4A3EJ 5FRMA 2FBHA 2O7OA 5CLSA 2EB7A 2ID3A 3P7NA 3RJPA 4RB1A 3GTGJ 4GYGA 2IEKA 4BY7J 2F4IA 1S72I 1UJ8A 1ZHFA 4M3FA 5J40A 1ZG1A 1LE8B 3H0GJ 3HPGA 1YQAA 3KP7A 3GBGA 3COAC 4I01A 1F43A 4FISA 2KPMA 4JYKA 3FM3A 2K9MA 2WC2A 4FETA 1FOKA 4N9HA 4IF4A 2EFPA 4FHTA 3QQAA 1WJEA 1W4MA 4CCJA 3JR9A 4JBAA 1BI0A 1IXCA 2XIGA 4JX4A 2R5YA 4HOBA 1WJDA 2RDPA 2ECBA 3FXOA 4OINF 4X6AJ 3VB2A 2FOWA 3AG2H 2BY0A 2HNHA 4GFBA 2RN7A 2VE9A 2Q1ZB 4A3GJ 3WU2C 3GLLA 1GDTA 4RLFA 4G6QA 2VBZA 1RIOH 2AQEA 3K6GA 2AQFA 1YW8A 1B72B 1KZHA 5K5RA 5D8LB 4E7JA 1UZCA 4UVBA 1HSJA 4AM3A 2KIUA 4U7BA 3L9FA 4KA4A 1I27A 3Q0UA 2V9PA 2I8DA 3EETA 3I56I 3K1NA 4HLYA 2FMLA 1Y8RB 4A12A 4D5FA 3CUQC 2KKOA 2WV0A 1PP8F 2R7DA 1UG2A 5F6FA 3ZMSA 4O3MA 4XN0A 4L0YB 3KZYA 3OMYA 3LFKA 1X19A 1G3YA 2QLZA 1T39A 1FYKA 2KMUA 2JZYA 3NRVA 5F0CA 2W84A 2ISYA 4LFUA 1G6NA 2MC4A 3K4CA 3BCBA 4CYCA 3ECOA 3K4KA 1UHSA 2H1LA 5CVUA 4M72A 2EV0A 1J2XA 2E7WA 2BY1A 2NS8A 1D0ZA 2JTVA 2HYGD 2DMUA 3ZQQA 3IL2A 1K78B 5KAIC 4DZPA 3PSFA 5HOOA 1SAUA 1DDNA 3ZQFA 4V2FA 4BBRJ 1H0MA 2CYYA 3O8HA 1UHMA 1XSVA 4HX8A 3CLQA 2DT5A 3OIPA 3S2DJ 1KU3A 5D6EA 1YYVA 5TJJA 3SHFA 2WA0A 5BPDA 5K7HA 1UAAA 2EZLA 1I6HJ 2XAUA 2KISA 1VQMI 2RGVA 5J1RA 4EM1A 3T1BA 3M4OJ 3BG3A 3ZQHA 4M6XA 4CA0A 1Z7LA 1VQPI 1PJRA 2XPUA 2J5OA 3I59B 4O6JA 4XN3A 4I02A 4XONA 2O3FA 5HS7A 4HDUA 3L2CA 5CVIA 3L2UA 2W24A 3S1RJ 3A0HC 1BW5A 4II3A 3R6SA 1IO2A 4E7KA 2OF7A 1KYWA 4H4KC 2K27A 3RQ4A 3RYPA 2FA5A 2BYVE 2CQKA 4IHVA 4P9UA 1YE9A 2XF6A 2R92J 5IY5H 1YG2A 1FLIA 1Y0NA 5KCMA 2C6YA 5DCMA 2GXGA 4FCYA 4PGHA 1XSXA 2ZC2A 4HF2A 2OQRA 1TQMA 2FF4A 4RLQA 3JAMZ 2LG4A 1IRXA 2VQCA 2R7FA 3BC8A 3KEOA 4U88A 5BQTA 1XPXA 4FT8A 1DGWY 2CUJA 4ENKA 1XGOA 1FIAA 4AC0A 3DPLC 3KYDB 2IRFG 3LAJA 3WHBA 3SXYA 2W25A 4GRIA 3QYFA 1OMIA 2D5VA 2A05A 1BR1A 4Y52J 1G3SA 3IKTA 2A6EF 3VYRB 1SFEA 5HDGA 4B1RA 4YFXF 1I50J 1VTNC 3FMRA 2JJ7A 3HYIA 4KIBA 5EJCA 3IAM2 1VFCA 4Y15A 3ZPLA 3F8NA 2JPCA 1IAWA 3KLNA 1X1DA 3CC2I 3JRGA 2XSJC 3J81K 1XMKA 1WGXA 2O8KA 1R6RA 2E34A 3JRIA 2L4MA 3CUQB 3G4SI 2QM3A 3QPLA 2EFNA 2QUFA 2A6HF 2XUBA 4M9ZA 2W57A 4U0VA 2LH9A 1RNLA 5KK1A 2DPUA 3TDZC 4FX4A 1QGPA 3HOTA 3Q3SA 2YSRA 3FWEA 5HODA 3CCQI 3OY9A 3OOUA 1TW2A 3HIFA 3ERED 3E5QA 3IH3A 4A3IJ 2L4AA 1TT5B 1RETA 1ZGWA 3OL4A 2ZXWH 1ZLKA 1I1GA 2QQ8A 4FQGA 2V1NA 1O3TA 4BUPA 2IA1A 2QENA 1JUPA 3S2HJ 1QU3A 3CP8A 3T0YA 5KHDA 3BTIA 2ZSIB 4H0EA 2R7TA 5ICCA 4F93B 1X58A 5DD4A 3M3YJ 4PUSA 2XASA 2FNAA 1DGRM 2OCEA 2VASA 1P9QC 1LE8A 1B9NA 3AKZA 4IRHA 3PUBA 4YIRX 2JT1A 2RQPA 3HUGB 1SFUA 2MG4A 2O8XA 2JPBA 3WTTC 1Z6RA 4WK8F 3GCMA 2DCEA 3H5NA 2O5RA 2ID6A 1R49A 4HX7A 1RPWA 5TGTA 3MKZA 1YTYA 4L9JA 3VSLA 3BY6A 2DMQA 1X2NA 2NVUB 3J7ZI 2IBDA 4RMNA 1QQIA 3QWLA 4BL0B 3V8JA 3BTCA 5C3EJ 1Y56A 4XICA 2P7VB 2E2IJ 1MH3A 1XDUA 3VPRA 4B3XA 1TC3C 3EYYA 2H1KA 1GUUA 1J5YA 2OA4A 4RGRA 1UG0A 4CUGA 1BI1A 4YRVA 4D0PA 5EEHA 1WJ5A 4DBQA 3DBRB 3W6VA 2AO9A 4G6TB 4G8XA 3HOUJ 2DMTA 2G0EA 2E1NA 3VOEA 5IYCJ 1B72A 4ZZLA 3L2VA 2XKPA 2JMWA 3KLOA 4P9FA 2MW8A 3H5AA 1X2MA 3F22A 1HDDC 2MA3A 2GIZA 4A69C 1VNDA 2ZKZA 3H3UA 4RB3C 1DPRA 1K61A 2VE8A 4C30A 3MCZA 4C3HJ 3LQQA 2P8TA 1XX5A 2VL8A 3L7WA 2M2EA 2JA8J 4F3QA 2VJ5A 1R4MB 5HLGA 2HXIA 1LDJA 3W6KB 2L01A 4PJMA 3KFWX 1LQ1A 4S04A 5L3BA 4IKFA 4HAMA 3QYEA 3F8FA 4PJ0C 1T0FA 5IP6A 5HDNA 3OIOA 1JJ8C 1FBQA 3EPZA 4A0YA 4F55A 2QSHX 5IP7J 4AD9A 3H92A 1K78A 2NOGA 4OU0A 3PJRA 1RR8C 1Z21A 4RAYA 1MD0A 4DYQA 2LLKA 1OCOH 3K1PA 4JX5A 1XN7A 1F5TA 3O3KA 2GXBA 1WJBA 1N77A 4IVNA 4IXAA 5E3LA 1WHUA 5LHIA 2FUG2 1RESA 5ILVA 3H35A 5IP9J 3WG9A 3VYTB 1W7PB 1FPQA 3AFHA 3KYLA 2QKMB 3FXUA 1U6GA 4A3JJ 3CJRB
chains in the Genus database with same CATH topology
3O6BB 5HLIA 3I59A 1MZBA 1DP7P 3CO7C 5JHUA 2LDUA 3KP2A 1S3JA 3GZ6A 2OZ6A 1YS7A 3I71A 5IT3A 3SZTA 2TDXA 4A6DA 1I1SA 1KYZA 3HSEA 4L5JA 5AONA 1V3FA 2YX7A 3GX4X 3J81Z 3Q9VA 2NS0A 3EYIA 2BEOA 5DCFA 4CHUA 4A6EA 4XSXF 3GFLA 2HEOA 2DK5A 5LLQA 2VT3A 3F6VA 4HLXA 1CF7B 2ZBKA 1K79A 1HKSA 2QQBA 4HX4A 2P5VA 3DF8A 4HF0A 3GYHX 3ZN1A 3CUQA 2ZNZA 4MTEA 2RC4A 4O5VA 3K2ZA 3RDIA 2OZUA 4IHTA 1JXSA 2HWVA 2PFBA 2GIVA 2DW4A 1P4XA 1SD4A 1EH6A 3KP5A 1P4WA 1OYYA 5CVJA 4EMSA 3M8FA 5FD5A 2OBPA 4YG2F 1R1TA 3EQLF 5J8FA 1L3LA 3HTSB 1YIOA 3HUGA 4CDGA 2H94A 4M71A 3WGIA 3ZMVA 1QNTA 1BJAA 3M8EA 2EV5A 3TO6A 5ILSA 5E18F 4XSZF 1WRJA 1S7OA 1Z9CA 4IPAA 2ZMEB 2MLKA 5H6QA 5KVRA 3QP6A 3W6JB 1GXPA 1ZARA 4AIKA 2H6CA 1A04A 2ESNA 2ZO4A 4EJUA 4IRGA 1ZG5A 5L3EA 4U0WA 4G94A 1HXDA 2O03A 2DO7A 4KDPA 4P96A 2XAQA 1KGSA 3E97A 2GQQA 4ZZDA 4UNOA 4UVCA 1QZZA 1O57A 3CJNA 4QWQA 2FEZA 2M30A 4XRFA 4RAZA 3P9KA 2HS5A 1H9GA 1ZRDA 1R23A 3LAPA 2M45A 4B09A 1MJBA 1T98A 5LGTA 1UCRA 3FF5A 2ZJ2A 2ISZA 3RYRA 2ZFWA 4YIIA 4Y13A 2P6SA 3U2RA 2F5EA 2PLYA 5ERIA 2GA1A 5FFXA 3D0SA 2M8EA 1W7PA 2PI0A 2HYFA 5K5QA 4BQAA 1U8RA 4CICA 2XROA 5AIQA 3M7GA 3GWZA 4WXDA 3T5XA 3ECHA 3R0AA 3BJOA 1H9TA 1UHWA 4M9SA 2G7UA 4L5IA 4M74A 4TV7A 1K7AA 1HQCA 3C1DA 5BOXA 4CXFA 1ZRCA 1IZ1A 1C0WA 4ETSA 3E6DA 5E20A 1U2WA 3IKVA 3HRSA 1J9IA 3MFKA 4AIJA 4EJVA 5DDGA 4MEXF 3PFIA 3ISPA 3PQKA 3K9TA 3BZ6A 2WTEA 2MD5A 2O6GE 4G9YA 1RUOA 1CF7A 1GVJA 2F5DA 4GYIA 2D1HA 2H09A 1ZREA 1LEAA 1T38A 2RNJA 1IRGA 2A5YB 1RI7A 1JHHA 3NQOA 4LK1F 4CYDA 1FY7A 2EK5A 2FU4A 4Q47A 3CLOA 2KRFA 5D4SA 2ZNYA 5LEKA 1USSA 4GXOA 2BV6A 3E3VA 4XLNF 4EJWA 1Z05A 3C3WA 3KP6A 2YPRA 4L9TA 1BC7C 1FSEA 1Z91A 4KYWA 5F1RA 1FP1D 2VC1A 5HS9A 1U78A 2GWRA 1TQPA 3BROA 3OV8A 1S8NA 1V4RA 2XGXA 1ULYA 5CVVA 2NYXA 3QP5A 2Q2EA 5ICFA 2ZMEA 1W5SA 5H6RA 4WX9A 3MQ0A 2MLGA 4BHPA 3WTWC 3WU1B 2Z3YA 1IN6A 1YS6A 2QQAA 1T6SA 2XAHA 3VEPA 1F9NA 1TW3A 4LB5A 1R1UA 2F5CA 3WU0A 1E17A 3CDHA 1KQ8A 1AWCA 2LKPA 1O7FA 4R79A 3ZMDA 4KUMA 3BJAA 2LNBA 2RVCA 5JR3A 3LA2A 1USTA 3SZPA 3KZZA 5FLXK 4BHCA 5L3CA 4Q4ZF 4IHSA 4WCGA 2LSOA 2K7LA 3HHHA 1JHFA 1GHCA 4NHJA 2L3DA 3TGNA 3JTHA 4OIRF 1ZYRF 2DLLA 5CVRA 4L9VA 1LJ9A 3F8MA 4LLGF 3HSRA 2HTJA 5E8IA 5D8KB 1LDDA 3D5LA 3MZHA 5K1YA 1P4AA 3RKXA 2ESHA 2MH9A 2EFQA 2FQ3A 3EUHA 1YO5C 3SFZA 2GAUA 1R1VA 4LK0F 1Z6TA 1QO0D 2HFHA 2VC0A 5BPIA 2PEXA 3O2PE 4RS8A 2V1XA 3FXQA 4JK1X 4RGXA 1S7AA 3VODA 1YFHA 2O61A 1O3QA 3C7JA 5CJ9A 4M73A 4HV5A 4L9NA 1TQIA 1XGSA 2MC3A 1FC3A 4M6YA 4AIHA 4LLNA 4ESBA 5HLHA 2V9VA 3GZ5A 2VBWA 3FHZA 3QPHA 2NNNA 1BC8C 1FNNA 1F4KA 1I5ZA 3WE3A 2M1BA 1EV7A 2DQRA 4CGZA 3BDDA 2P5LC 1FT9A 3WODF 4WF2A 3HRMA 1W5TA 3RKYA 2D45A 3E6CC 1U5TC 1MJAA 2F5FA 1R7JA 3SQNA 3ZMTA 3GFIA 4UVAA 4Q5SF 1YLFA 3E6MA 5CYVA 2EV6A 2XV4S 3DFGA 1YW7A 4P5OA 2XKOA 1Q1HA 4KIFA 2ZXJA 2FRHA 4PCQA 2G9WA 1L0OC 3RPUA 3G3ZA 2DI3A 3LA7A 2HGCA 2HKOA 3HOSA 3QU3A 4Z2YA 4EJOA 2QZ8A 5FLXZ 3BJ6A 3KP3A 3IWFA 3Q9SA 5EEGA 2FNPA 2IW5A 1FBSA 5DYMA 1R5HA 2B0LA 2P4WA 1D8JA 3QOPA 3V8LA 4DNCA 2OAZA 3VFZA 4P55A 1J59A 1B9MA 3MZYA 5DUKA 1ON2A 2D1VA 4GO1A 4ZYDA 4ZYGA 1F1ZA 4KN7X 5DV5A 3F8BA 3L09A 4KIGA 2DK8A 1WKMA 4NB5A 4G6DA 4WWCA 2Z5UA 1LDKB 2VBYA 4RB0A 4DQ2A 4RGUA 4JQFA 3R61A 2XAJA 3BOQA 1FX7A 1MGTA 4RB2C 3JW4A 1SMTA 3F6OA 3TO7A 4YFNF 1J7KA 1T2KA 1SD6A 5E8GA 4U7DA 2FXAA 1TTYA 4EQQA 3J7AO 3K1MA 1KQ9A 2XVCA 3K69A 2VOOA 2PJPA 3U9GA 4BAYA 4KT5C 1FYLA 3QAHA 1U5TB 1AOYA 4LGWA 1TNSA 3V8KA 1IXRC 1TLHB 3ZN0A 4ZYHA 1KQ0A 1S29A 4ENMA 1W7PD 3FMSA 1S6LA 3V7RA 4EV0A 1MDMB 3IWZA 2K86A 2Q0OA 3FX3A 3F23A 4B8XA 5JI6A 3V4GA 3L00A 3DP7A 2COMA 1FBUA 2E1CA 5L3DA 1XSDA 1GXQA 3KETA 4YIFA 4K2EA 2QYOA 1OPCA 4HV6A 3KCCA 3IHUA 4I0AA 4MTDA 3R4KA 2KJBA 1J75A 1R22A 4IJAA 4AWXB 4HQEA 1HBXG 2JRTA 2DAOA 4HBLA 3JTGA 2MBFA 2STWA 3IC7A 2H27A 1BIAA 4G7HF 3MAJA 3I54A 3QU6A 2DU9A 2EJRA 4G7ZF 5TRDA 2XHKA 4PGGA 3HHGA 1BBYA 1B59A 4HQMA 3RPQA 1LNWA 2A3SA 3HRUA 4EM0B 4OMYA 6PAXA 1OYIA 2Z99A 1G4DA 1D8KA 3I58A 2Q8KA 4MGRA 4F7ZA 5E1WA 3ZMZA 4L0ZB 1XGMA 4WXCA 2UZKA 2CWEA 2CSOA 4A2UA 1O7LA 3IRRA 4MNUA 5LRSA 2HQRA 2YX4A 1P2FA 2KJCA 3DEUA 1XCVA 1IN7A 4LLLA 2MH2A 5FGMA 2V79A 3F21A 2D2WA 1D5VA 2IP2A 1FYMA 2VT2A 2GZWA 1BOAA 4ON0A 1D3YA 2OQGA 4UV8A 2HKXA 4KMFA 4HF1A 4QLCU 2A61A 5AIPA 1J0RA 4LB6B 4LG0B 3IRQA 4A0XA 3WGHA 2OU2A 1B6AA 5D5WB 2PMHA 3GXOA 3DQVC 4KMUX 2IA0A 4EJTA 2P7CB 3V7CA 5HDKA 1O3SA 3V7SA 3P9IA 4I0BA 2W85A 4N0BA 3Q5FA 4IRIA 3WTSC 2EA4A 4OIOF 3T8RA 4I09A 1KU7A 4N9IA 3H3ZA 1IXSB 3DPTA 4FX0A 5E1XA 2YU3A 4Y17A 2JSCA 1SAXA 5BS6A 2CW0F 3ZP5A 2L02A 3RKWA 2CGPA 2J5PA 5J8CA 4BYYA 1ZH5A 2DTRA 2VN2A 1XMAA 5L3FA 3M1EA 2A07F 5HVQC 2KIMA 1SFXA 1KA8A 1U5TA 2YR2A 2P6TA 1WWXA 2QWWA 4YFKF 4S05A 3ELKA 5J6XA 1MDMA 4EGZA 1HW5A 3GW2A 1REPC 3JSPA 2Z9OA 2VOPA 2R3SA 3E5XA 2CFXA 2HDCA 2Y75A 1R5GA 1SMYF 3GLXA 3JSOA 4CZZA 4R8HA 2RV8A 2XAFA 3QRFF 1ZGAA 1ZGJA 3QPTA 5LRRA 2FSWA 5IT9K 5E1ZB 2ACJA 3I0TA 1HSTA 3WTZA 3WGGA 3EDPA 2BBYA 1IN8A 1XCBA 1Z7UA 2PN6A 4LMYA 1PUEE 5F64A 2RKHA 3ABTA 5BMZA 2VODA 2AXLA 2HOEA 3GO5A 1DPUA 1HW1A 1MKMA 5DEQA 5ILUA 5JVTA 1P92A 1WSUA 4R1HA 3LA3A 3S2WA 3MWMA 2ELHA 3F8CA 4EGYA 3KP4A 1XGNA 1E2XA 4OOIA 5LEJA 2FMYA 3OOPA 3RTRA 5LGUA 3GFJA 3I64A 3B73A 3N97A 1QZYA 5L3GA 3TOBA 1I6XA 5D6FA 2A68F 4BNCA 2VBXA 1QBJA 3FZVA 4HW0A 4LJZF 2M5WA 4OMZA 1TBXA 2IPQX 1U3EM 3GVAA 4UXNA 3WE2A 2FE3A 1BI2A 3ML6A 3ABUA 4GGGA 3HTUA 4I2OA 4UHTA 5D5VB 3F72A 1BM9A 3WTXC 4Q48A 4LG0A 1P6RA 2M87A 1KU2A 2ETHA 3ULQB 1MJ9A 3F3XA 4A0ZA 3TO9A 2FBIA 1RZ4A 1R36A 4LD5A 1XB4A 2V1UA 5A2QK 1IN4A 2Y48A 3E5UA 1K6OA 2G7HA 2UWMA 1G3WA 3RI4A 2OD5A 4OIPF 2Y0MA 3J80K 1KU9A 4PZJA 2QBYB 4PDKA 2ZCWA 2IJLA 4M9XA 5D4RA 2HR3A 4UUVA 1IRFA 4MEYF 3ROUA 1PP7U 2LF8A 1BN5A 5IT9Z 3B02A 4BXUA 2WWYA 1RUNA 1IUYA 2V6CA 3TKYA 2H6BA 2E7XA 1ODDA 1ON1A 1ZAOA 2UXNA 2AS5F 3U1DA 1LVAA 4MQVA 2DPDA 2UXXA 3DXJF 1O3RA 1G3TA 4UV9A 4HDVA 3WTYC 4A5NA 4BHBA 2LF7A 1IF1A 2PG4A 1JE8A 3G73A 3I53A 1B1BA 4CO8A 5ICGA 3REOA 2CO5A 3LQRA 1UFMA 2VXZA 3BPXA 3CTAA 2EWNA 3TDUC 1FP2A 2IA2A 3I5UA 3AAFA 3GF2A 1ZLJA 2BGCA 3BP8A 1TNTA 1FSHA 3PQJA 4EM2A 4ESFA 5FB2A 5K5OA 3CUOA 4HZFA 2FBKA 3BWGA 3R0JA 4KNYA 1OYWA 1UB9A 1CGPA 3N4MA 4ZH4F 1XDSA 2PBIA 5ED4A 1BI3A 5D5XB 5FFZA 2HZTA 2NAZA 2HQNA 4ESJA 1FZPB 2X4HA 4BH9A 5LHHA 4I7HA 1R00A 2K4JA 2NNYA 4HA8A 1LEBA 3KEQA 1IW7F 1LB2A 3LWFA 3CO6C 2QVOA 1YW9A 3T8TA 4KICA 2QQ9A 2L54A 1STZA 4XLPF 3R60A 3I4PA 2EFOA 4ENJA 3DV8A 5A2QZ 2P5KA 1R58A 4GCVA 4MHGA 1HKTA 1OKRA 5DUIA 1WQ2A 4U0YA 5FO5A 4WXHA 2IVMA 4ZYEA 5LHGA 5H20A 2EFWA 2F2EA 4HYEA 4G7OF 1X3UA 4A5MA 1IN5A 1Z1DA 2BE5F 3J80Z 1FWZA 1PDNC 3NEUA 4XBFA 4E70A 3M9AA 2NRAC 4KN4X 1HW2A 4KFCA 3ZQ7A 3ZMUA 5ICEA 3C18A 5FD6A 3FM5A 2ADUA 3GUDA 5DD8A 3FXRA 3WTVC 1SD5A 2CG4A 2X0LA 2FOKA 2PQ8A 2QBYA 1Y0UA 2DQLA 2O0YA 5DCMB 1QPMA 2GA2A 1ZRFA 2DBBA 1BIBA 5D5UB 3KE2A 3TQNA 1XD7A 1NHAA 3RIRA 3DKWA 3P9CA 2V1DA 1B4AA 2Z33A 3WTUC 3LSTA 4RGSA 2XRNA 3BPVA 5E17F 4ASNA 4AVPA 5LBQA 4ENNA 4I98B 4MQ9F 1EH8A 3GEZA 4NQWA 3TOAA 3JAMK 2K4BA 1SD7A 1ZG3A 1EH7A 2PMUA 4L18B 1WI9A 3GFMA 1DUXC 1HKQA 2EA2A 3E6BA 2A69F 1ZN2A 1JGSA 2XAGA 2DFIA 5JFRA 2VONA 1OR7A 3HSFA 3MEXA 5HS8A 3HRTA 5LGNA 3FMQA 3K0LA 2IT0A 2K02A 2STTA 1ONVA 2KIFA 2HTSA 4EVIA 4OIQF 2FBHA 5CLSA 2EB7A 3P7NA 3RJPA 4RB1A 4GYGA 1ZHFA 1ZG1A 1YQAA 3KP7A 3COAC 4I01A 3FM3A 2WC2A 1FOKA 4N9HA 4IF4A 2EFPA 4FHTA 1W4MA 4JBAA 1BI0A 1IXCA 2XIGA 4HOBA 2RDPA 4OINF 3VB2A 2RN7A 2VE9A 4G6QA 2VBZA 1RIOH 1YW8A 5K5RA 5D8LB 4UVBA 1HSJA 2KIUA 4U7BA 3L9FA 4KA4A 1I27A 3EETA 4HLYA 3K1NA 2FMLA 4A12A 3CUQC 2KKOA 2WV0A 1PP8F 2R7DA 5F6FA 3ZMSA 4O3MA 4L0YB 3KZYA 3LFKA 1G3YA 2QLZA 1T39A 1FYKA 2JZYA 3NRVA 2W84A 2ISYA 4LFUA 1G6NA 3ECOA 5CVUA 4M72A 2EV0A 1J2XA 2E7WA 2JTVA 2HYGD 3IL2A 1K78B 5HOOA 1DDNA 1H0MA 2CYYA 1UHMA 1XSVA 4HX8A 2DT5A 1KU3A 5D6EA 1YYVA 5TJJA 3SHFA 5BPDA 2RGVA 4EM1A 3T1BA 4M6XA 2J5OA 3I59B 4O6JA 4I02A 2O3FA 5HS7A 4HDUA 3L2CA 5CVIA 2W24A 3R6SA 1KYWA 2K27A 3RYPA 2FA5A 2BYVE 2CQKA 4P9UA 1YG2A 1FLIA 2C6YA 5DCMA 2GXGA 4PGHA 1XSXA 4HF2A 2OQRA 1TQMA 2FF4A 3JAMZ 2R7FA 3KEOA 4U88A 5BQTA 4FT8A 4ENKA 1XGOA 2IRFG 3DPLC 3LAJA 3SXYA 2W25A 1OMIA 1G3SA 3IKTA 2A6EF 1SFEA 5HDGA 4YFXF 1VTNC 3FMRA 3HYIA 4KIBA 4Y15A 3ZPLA 3F8NA 2JPCA 1IAWA 3KLNA 3J81K 1XMKA 2L4MA 3CUQB 2QM3A 2EFNA 2QUFA 2A6HF 2XUBA 4M9ZA 2W57A 4U0VA 1RNLA 5KK1A 2DPUA 3TDZC 4FX4A 1QGPA 3HOTA 2YSRA 3FWEA 3ERED 1TW2A 3HIFA 3E5QA 2L4AA 1ZLKA 1I1GA 1O3TA 2IA1A 2QENA 3T0YA 4H0EA 5ICCA 5DD4A 2XASA 2FNAA 1B9NA 4IRHA 2JT1A 2RQPA 1SFUA 2O8XA 2JPBA 3WTTC 1Z6RA 4WK8F 4HX7A 1YTYA 4L9JA 3BY6A 1QQIA 3V8JA 2P7VB 1XDUA 3EYYA 1J5YA 2OA4A 4RGRA 1BI1A 4D0PA 5EEHA 4G8XA 2E1NA 3VOEA 4ZZLA 2XKPA 3KLOA 4P9FA 3F22A 2MA3A 2ZKZA 3H3UA 4RB3C 1DPRA 2VE8A 3MCZA 3LQQA 2P8TA 3L7WA 5HLGA 1LDJA 3W6KB 2L01A 3KFWX 1LQ1A 4S04A 5L3BA 4HAMA 3F8FA 1T0FA 5HDNA 1FBQA 4A0YA 4AD9A 3H92A 1K78A 4OU0A 4RAYA 1MD0A 3K1PA 1XN7A 1F5TA 3O3KA 2GXBA 4IVNA 4IXAA 5LHIA 5ILVA 3WG9A 1W7PB 1FPQA 3FXUA 1U6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O6B B;  5HLI A;  3I59 A;  1MZB A;  1DP7 P;  3CO7 C;  5JHU A;  2LDU A;  3KP2 A;  1S3J A;  3GZ6 A;  2OZ6 A;  1YS7 A;  3I71 A;  5IT3 A;  3SZT A;  2TDX A;  4A6D A;  1I1S A;  1KYZ A;  3HSE A;  4L5J A;  5AON A;  1V3F A;  2YX7 A;  3GX4 X;  3J81 Z;  3Q9V A;  2NS0 A;  3EYI A;  2BEO A;  5DCF A;  4CHU A;  4A6E A;  4XSX F;  3GFL A;  2HEO A;  2DK5 A;  5LLQ A;  2VT3 A;  3F6V A;  4HLX A;  1CF7 B;  2ZBK A;  1K79 A;  1HKS A;  2QQB A;  4HX4 A;  2P5V A;  3DF8 A;  4HF0 A;  3GYH X;  3ZN1 A;  3CUQ A;  2ZNZ A;  4MTE A;  2RC4 A;  4O5V A;  3K2Z A;  3RDI A;  2OZU A;  4IHT A;  1JXS A;  2HWV A;  2PFB A;  2GIV A;  2DW4 A;  1P4X A;  1SD4 A;  1EH6 A;  3KP5 A;  1P4W A;  1OYY A;  5CVJ A;  4EMS A;  3M8F A;  5FD5 A;  2OBP A;  4YG2 F;  1R1T A;  3EQL F;  5J8F A;  1L3L A;  3HTS B;  1YIO A;  3HUG A;  4CDG A;  2H94 A;  4M71 A;  3WGI A;  3ZMV A;  1QNT A;  1BJA A;  3M8E A;  2EV5 A;  3TO6 A;  5ILS A;  5E18 F;  4XSZ F;  1WRJ A;  1S7O A;  1Z9C A;  4IPA A;  2ZME B;  2MLK A;  5H6Q A;  5KVR A;  3QP6 A;  3W6J B;  1GXP A;  1ZAR A;  4AIK A;  2H6C A;  1A04 A;  2ESN A;  2ZO4 A;  4EJU A;  4IRG A;  1ZG5 A;  5L3E A;  4U0W A;  4G94 A;  1HXD A;  2O03 A;  2DO7 A;  4KDP A;  4P96 A;  2XAQ A;  1KGS A;  3E97 A;  2GQQ A;  4ZZD A;  4UNO A;  4UVC A;  1QZZ A;  1O57 A;  3CJN A;  4QWQ A;  2FEZ A;  2M30 A;  4XRF A;  4RAZ A;  3P9K A;  2HS5 A;  1H9G A;  1ZRD A;  1R23 A;  3LAP A;  2M45 A;  4B09 A;  1MJB A;  1T98 A;  5LGT A;  1UCR A;  3FF5 A;  2ZJ2 A;  2ISZ A;  3RYR A;  2ZFW A;  4YII A;  4Y13 A;  2P6S A;  3U2R A;  2F5E A;  2PLY A;  5ERI A;  2GA1 A;  5FFX A;  3D0S A;  2M8E A;  1W7P A;  2PI0 A;  2HYF A;  5K5Q A;  4BQA A;  1U8R A;  4CIC A;  2XRO A;  5AIQ A;  3M7G A;  3GWZ A;  4WXD A;  3T5X A;  3ECH A;  3R0A A;  3BJO A;  1H9T A;  1UHW A;  4M9S A;  2G7U A;  4L5I A;  4M74 A;  4TV7 A;  1K7A A;  1HQC A;  3C1D A;  5BOX A;  4CXF A;  1ZRC A;  1IZ1 A;  1C0W A;  4ETS A;  3E6D A;  5E20 A;  1U2W A;  3IKV A;  3HRS A;  1J9I A;  3MFK A;  4AIJ A;  4EJV A;  5DDG A;  4MEX F;  3PFI A;  3ISP A;  3PQK A;  3K9T A;  3BZ6 A;  2WTE A;  2MD5 A;  2O6G E;  4G9Y A;  1RUO A;  1CF7 A;  1GVJ A;  2F5D A;  4GYI A;  2D1H A;  2H09 A;  1ZRE A;  1LEA A;  1T38 A;  2RNJ A;  1IRG A;  2A5Y B;  1RI7 A;  1JHH A;  3NQO A;  4LK1 F;  4CYD A;  1FY7 A;  2EK5 A;  2FU4 A;  4Q47 A;  3CLO A;  2KRF A;  5D4S A;  2ZNY A;  5LEK A;  1USS A;  4GXO A;  2BV6 A;  3E3V A;  4XLN F;  4EJW A;  1Z05 A;  3C3W A;  3KP6 A;  2YPR A;  4L9T A;  1BC7 C;  1FSE A;  1Z91 A;  4KYW A;  5F1R A;  1FP1 D;  2VC1 A;  5HS9 A;  1U78 A;  2GWR A;  1TQP A;  3BRO A;  3OV8 A;  1S8N A;  1V4R A;  2XGX A;  1ULY A;  5CVV A;  2NYX A;  3QP5 A;  2Q2E A;  5ICF A;  2ZME A;  1W5S A;  5H6R A;  4WX9 A;  3MQ0 A;  2MLG A;  4BHP A;  3WTW C;  3WU1 B;  2Z3Y A;  1IN6 A;  1YS6 A;  2QQA A;  1T6S A;  2XAH A;  3VEP A;  1F9N A;  1TW3 A;  4LB5 A;  1R1U A;  2F5C A;  3WU0 A;  1E17 A;  3CDH A;  1KQ8 A;  1AWC A;  2LKP A;  1O7F A;  4R79 A;  3ZMD A;  4KUM A;  3BJA A;  2LNB A;  2RVC A;  5JR3 A;  3LA2 A;  1UST A;  3SZP A;  3KZZ A;  5FLX K;  4BHC A;  5L3C A;  4Q4Z F;  4IHS A;  4WCG A;  2LSO A;  2K7L A;  3HHH A;  1JHF A;  1GHC A;  4NHJ A;  2L3D A;  3TGN A;  3JTH A;  4OIR F;  1ZYR F;  2DLL A;  5CVR A;  4L9V A;  1LJ9 A;  3F8M A;  4LLG F;  3HSR A;  2HTJ A;  5E8I A;  5D8K B;  1LDD A;  3D5L A;  3MZH A;  5K1Y A;  1P4A A;  3RKX A;  2ESH A;  2MH9 A;  2EFQ A;  2FQ3 A;  3EUH A;  1YO5 C;  3SFZ A;  2GAU A;  1R1V A;  4LK0 F;  1Z6T A;  1QO0 D;  2HFH A;  2VC0 A;  5BPI A;  2PEX A;  3O2P E;  4RS8 A;  2V1X A;  3FXQ A;  4JK1 X;  4RGX A;  1S7A A;  3VOD A;  1YFH A;  2O61 A;  1O3Q A;  3C7J A;  5CJ9 A;  4M73 A;  4HV5 A;  4L9N A;  1TQI A;  1XGS A;  2MC3 A;  1FC3 A;  4M6Y A;  4AIH A;  4LLN A;  4ESB A;  5HLH A;  2V9V A;  3GZ5 A;  2VBW A;  3FHZ A;  3QPH A;  2NNN A;  1BC8 C;  1FNN A;  1F4K A;  1I5Z A;  3WE3 A;  2M1B A;  1EV7 A;  2DQR A;  4CGZ A;  3BDD A;  2P5L C;  1FT9 A;  3WOD F;  4WF2 A;  3HRM A;  1W5T A;  3RKY A;  2D45 A;  3E6C C;  1U5T C;  1MJA A;  2F5F A;  1R7J A;  3SQN A;  3ZMT A;  3GFI A;  4UVA A;  4Q5S F;  1YLF A;  3E6M A;  5CYV A;  2EV6 A;  2XV4 S;  3DFG A;  1YW7 A;  4P5O A;  2XKO A;  1Q1H A;  4KIF A;  2ZXJ A;  2FRH A;  4PCQ A;  2G9W A;  1L0O C;  3RPU A;  3G3Z A;  2DI3 A;  3LA7 A;  2HGC A;  2HKO A;  3HOS A;  3QU3 A;  4Z2Y A;  4EJO A;  2QZ8 A;  5FLX Z;  3BJ6 A;  3KP3 A;  3IWF A;  3Q9S A;  5EEG A;  2FNP A;  2IW5 A;  1FBS A;  5DYM A;  1R5H A;  2B0L A;  2P4W A;  1D8J A;  3QOP A;  3V8L A;  4DNC A;  2OAZ A;  3VFZ A;  4P55 A;  1J59 A;  1B9M A;  3MZY A;  5DUK A;  1ON2 A;  2D1V A;  4GO1 A;  4ZYD A;  4ZYG A;  1F1Z A;  4KN7 X;  5DV5 A;  3F8B A;  3L09 A;  4KIG A;  2DK8 A;  1WKM A;  4NB5 A;  4G6D A;  4WWC A;  2Z5U A;  1LDK B;  2VBY A;  4RB0 A;  4DQ2 A;  4RGU A;  4JQF A;  3R61 A;  2XAJ A;  3BOQ A;  1FX7 A;  1MGT A;  4RB2 C;  3JW4 A;  1SMT A;  3F6O A;  3TO7 A;  4YFN F;  1J7K A;  1T2K A;  1SD6 A;  5E8G A;  4U7D A;  2FXA A;  1TTY A;  4EQQ A;  3J7A O;  3K1M A;  1KQ9 A;  2XVC A;  3K69 A;  2VOO A;  2PJP A;  3U9G A;  4BAY A;  4KT5 C;  1FYL A;  3QAH A;  1U5T B;  1AOY A;  4LGW A;  1TNS A;  3V8K A;  1IXR C;  1TLH B;  3ZN0 A;  4ZYH A;  1KQ0 A;  1S29 A;  4ENM A;  1W7P D;  3FMS A;  1S6L A;  3V7R A;  4EV0 A;  1MDM B;  3IWZ A;  2K86 A;  2Q0O A;  3FX3 A;  3F23 A;  4B8X A;  5JI6 A;  3V4G A;  3L00 A;  3DP7 A;  2COM A;  1FBU A;  2E1C A;  5L3D A;  1XSD A;  1GXQ A;  3KET A;  4YIF A;  4K2E A;  2QYO A;  1OPC A;  4HV6 A;  3KCC A;  3IHU A;  4I0A A;  4MTD A;  3R4K A;  2KJB A;  1J75 A;  1R22 A;  4IJA A;  4AWX B;  4HQE A;  1HBX G;  2JRT A;  2DAO A;  4HBL A;  3JTG A;  2MBF A;  2STW A;  3IC7 A;  2H27 A;  1BIA A;  4G7H F;  3MAJ A;  3I54 A;  3QU6 A;  2DU9 A;  2EJR A;  4G7Z F;  5TRD A;  2XHK A;  4PGG A;  3HHG A;  1BBY A;  1B59 A;  4HQM A;  3RPQ A;  1LNW A;  2A3S A;  3HRU A;  4EM0 B;  4OMY A;  6PAX A;  1OYI A;  2Z99 A;  1G4D A;  1D8K A;  3I58 A;  2Q8K A;  4MGR A;  4F7Z A;  5E1W A;  3ZMZ A;  4L0Z B;  1XGM A;  4WXC A;  2UZK A;  2CWE A;  2CSO A;  4A2U A;  1O7L A;  3IRR A;  4MNU A;  5LRS A;  2HQR A;  2YX4 A;  1P2F A;  2KJC A;  3DEU A;  1XCV A;  1IN7 A;  4LLL A;  2MH2 A;  5FGM A;  2V79 A;  3F21 A;  2D2W A;  1D5V A;  2IP2 A;  1FYM A;  2VT2 A;  2GZW A;  1BOA A;  4ON0 A;  1D3Y A;  2OQG A;  4UV8 A;  2HKX A;  4KMF A;  4HF1 A;  4QLC U;  2A61 A;  5AIP A;  1J0R A;  4LB6 B;  4LG0 B;  3IRQ A;  4A0X A;  3WGH A;  2OU2 A;  1B6A A;  5D5W B;  2PMH A;  3GXO A;  3DQV C;  4KMU X;  2IA0 A;  4EJT A;  2P7C B;  3V7C A;  5HDK A;  1O3S A;  3V7S A;  3P9I A;  4I0B A;  2W85 A;  4N0B A;  3Q5F A;  4IRI A;  3WTS C;  2EA4 A;  4OIO F;  3T8R A;  4I09 A;  1KU7 A;  4N9I A;  3H3Z A;  1IXS B;  3DPT A;  4FX0 A;  5E1X A;  2YU3 A;  4Y17 A;  2JSC A;  1SAX A;  5BS6 A;  2CW0 F;  3ZP5 A;  2L02 A;  3RKW A;  2CGP A;  2J5P A;  5J8C A;  4BYY A;  1ZH5 A;  2DTR A;  2VN2 A;  1XMA A;  5L3F A;  3M1E A;  2A07 F;  5HVQ C;  2KIM A;  1SFX A;  1KA8 A;  1U5T A;  2YR2 A;  2P6T A;  1WWX A;  2QWW A;  4YFK F;  4S05 A;  3ELK A;  5J6X A;  1MDM A;  4EGZ A;  1HW5 A;  3GW2 A;  1REP C;  3JSP A;  2Z9O A;  2VOP A;  2R3S A;  3E5X A;  2CFX A;  2HDC A;  2Y75 A;  1R5G A;  1SMY F;  3GLX A;  3JSO A;  4CZZ A;  4R8H A;  2RV8 A;  2XAF A;  3QRF F;  1ZGA A;  1ZGJ A;  3QPT A;  5LRR A;  2FSW A;  5IT9 K;  5E1Z B;  2ACJ A;  3I0T A;  1HST A;  3WTZ A;  3WGG A;  3EDP A;  2BBY A;  1IN8 A;  1XCB A;  1Z7U A;  2PN6 A;  4LMY A;  1PUE E;  5F64 A;  2RKH A;  3ABT A;  5BMZ A;  2VOD A;  2AXL A;  2HOE A;  3GO5 A;  1DPU A;  1HW1 A;  1MKM A;  5DEQ A;  5ILU A;  5JVT A;  1P92 A;  1WSU A;  4R1H A;  3LA3 A;  3S2W A;  3MWM A;  2ELH A;  3F8C A;  4EGY A;  3KP4 A;  1XGN A;  1E2X A;  4OOI A;  5LEJ A;  2FMY A;  3OOP A;  3RTR A;  5LGU A;  3GFJ A;  3I64 A;  3B73 A;  3N97 A;  1QZY A;  5L3G A;  3TOB A;  1I6X A;  5D6F A;  2A68 F;  4BNC A;  2VBX A;  1QBJ A;  3FZV A;  4HW0 A;  4LJZ F;  2M5W A;  4OMZ A;  1TBX A;  2IPQ X;  1U3E M;  3GVA A;  4UXN A;  3WE2 A;  2FE3 A;  1BI2 A;  3ML6 A;  3ABU A;  4GGG A;  3HTU A;  4I2O A;  4UHT A;  5D5V B;  3F72 A;  1BM9 A;  3WTX C;  4Q48 A;  4LG0 A;  1P6R A;  2M87 A;  1KU2 A;  2ETH A;  3ULQ B;  1MJ9 A;  3F3X A;  4A0Z A;  3TO9 A;  2FBI A;  1RZ4 A;  1R36 A;  4LD5 A;  1XB4 A;  2V1U A;  5A2Q K;  1IN4 A;  2Y48 A;  3E5U A;  1K6O A;  2G7H A;  2UWM A;  1G3W A;  3RI4 A;  2OD5 A;  4OIP F;  2Y0M A;  3J80 K;  1KU9 A;  4PZJ A;  2QBY B;  4PDK A;  2ZCW A;  2IJL A;  4M9X A;  5D4R A;  2HR3 A;  4UUV A;  1IRF A;  4MEY F;  3ROU A;  1PP7 U;  2LF8 A;  1BN5 A;  5IT9 Z;  3B02 A;  4BXU A;  2WWY A;  1RUN A;  1IUY A;  2V6C A;  3TKY A;  2H6B A;  2E7X A;  1ODD A;  1ON1 A;  1ZAO A;  2UXN A;  2AS5 F;  3U1D A;  1LVA A;  4MQV A;  2DPD A;  2UXX A;  3DXJ F;  1O3R A;  1G3T A;  4UV9 A;  4HDV A;  3WTY C;  4A5N A;  4BHB A;  2LF7 A;  1IF1 A;  2PG4 A;  1JE8 A;  3G73 A;  3I53 A;  1B1B A;  4CO8 A;  5ICG A;  3REO A;  2CO5 A;  3LQR A;  1UFM A;  2VXZ A;  3BPX A;  3CTA A;  2EWN A;  3TDU C;  1FP2 A;  2IA2 A;  3I5U A;  3AAF A;  3GF2 A;  1ZLJ A;  2BGC A;  3BP8 A;  1TNT A;  1FSH A;  3PQJ A;  4EM2 A;  4ESF A;  5FB2 A;  5K5O A;  3CUO A;  4HZF A;  2FBK A;  3BWG A;  3R0J A;  4KNY A;  1OYW A;  1UB9 A;  1CGP A;  3N4M A;  4ZH4 F;  1XDS A;  2PBI A;  5ED4 A;  1BI3 A;  5D5X B;  5FFZ A;  2HZT A;  2NAZ A;  2HQN A;  4ESJ A;  1FZP B;  2X4H A;  4BH9 A;  5LHH A;  4I7H A;  1R00 A;  2K4J A;  2NNY A;  4HA8 A;  1LEB A;  3KEQ A;  1IW7 F;  1LB2 A;  3LWF A;  3CO6 C;  2QVO A;  1YW9 A;  3T8T A;  4KIC A;  2QQ9 A;  2L54 A;  1STZ A;  4XLP F;  3R60 A;  3I4P A;  2EFO A;  4ENJ A;  3DV8 A;  5A2Q Z;  2P5K A;  1R58 A;  4GCV A;  4MHG A;  1HKT A;  1OKR A;  5DUI A;  1WQ2 A;  4U0Y A;  5FO5 A;  4WXH A;  2IVM A;  4ZYE A;  5LHG A;  5H20 A;  2EFW A;  2F2E A;  4HYE A;  4G7O F;  1X3U A;  4A5M A;  1IN5 A;  1Z1D A;  2BE5 F;  3J80 Z;  1FWZ A;  1PDN C;  3NEU A;  4XBF A;  4E70 A;  3M9A A;  2NRA C;  4KN4 X;  1HW2 A;  4KFC A;  3ZQ7 A;  3ZMU A;  5ICE A;  3C18 A;  5FD6 A;  3FM5 A;  2ADU A;  3GUD A;  5DD8 A;  3FXR A;  3WTV C;  1SD5 A;  2CG4 A;  2X0L A;  2FOK A;  2PQ8 A;  2QBY A;  1Y0U A;  2DQL A;  2O0Y A;  5DCM B;  1QPM A;  2GA2 A;  1ZRF A;  2DBB A;  1BIB A;  5D5U B;  3KE2 A;  3TQN A;  1XD7 A;  1NHA A;  3RIR A;  3DKW A;  3P9C A;  2V1D A;  1B4A A;  2Z33 A;  3WTU C;  3LST A;  4RGS A;  2XRN A;  3BPV A;  5E17 F;  4ASN A;  4AVP A;  5LBQ A;  4ENN A;  4I98 B;  4MQ9 F;  1EH8 A;  3GEZ A;  4NQW A;  3TOA A;  3JAM K;  2K4B A;  1SD7 A;  1ZG3 A;  1EH7 A;  2PMU A;  4L18 B;  1WI9 A;  3GFM A;  1DUX C;  1HKQ A;  2EA2 A;  3E6B A;  2A69 F;  1ZN2 A;  1JGS A;  2XAG A;  2DFI A;  5JFR A;  2VON A;  1OR7 A;  3HSF A;  3MEX A;  5HS8 A;  3HRT A;  5LGN A;  3FMQ A;  3K0L A;  2IT0 A;  2K02 A;  2STT A;  1ONV A;  2KIF A;  2HTS A;  4EVI A;  4OIQ F;  2FBH A;  5CLS A;  2EB7 A;  3P7N A;  3RJP A;  4RB1 A;  4GYG A;  1ZHF A;  1ZG1 A;  1YQA A;  3KP7 A;  3COA C;  4I01 A;  3FM3 A;  2WC2 A;  1FOK A;  4N9H A;  4IF4 A;  2EFP A;  4FHT A;  1W4M A;  4JBA A;  1BI0 A;  1IXC A;  2XIG A;  4HOB A;  2RDP A;  4OIN F;  3VB2 A;  2RN7 A;  2VE9 A;  4G6Q A;  2VBZ A;  1RIO H;  1YW8 A;  5K5R A;  5D8L B;  4UVB A;  1HSJ A;  2KIU A;  4U7B A;  3L9F A;  4KA4 A;  1I27 A;  3EET A;  4HLY A;  3K1N A;  2FML A;  4A12 A;  3CUQ C;  2KKO A;  2WV0 A;  1PP8 F;  2R7D A;  5F6F A;  3ZMS A;  4O3M A;  4L0Y B;  3KZY A;  3LFK A;  1G3Y A;  2QLZ A;  1T39 A;  1FYK A;  2JZY A;  3NRV A;  2W84 A;  2ISY A;  4LFU A;  1G6N A;  3ECO A;  5CVU A;  4M72 A;  2EV0 A;  1J2X A;  2E7W A;  2JTV A;  2HYG D;  3IL2 A;  1K78 B;  5HOO A;  1DDN A;  1H0M A;  2CYY A;  1UHM A;  1XSV A;  4HX8 A;  2DT5 A;  1KU3 A;  5D6E A;  1YYV A;  5TJJ A;  3SHF A;  5BPD A;  2RGV A;  4EM1 A;  3T1B A;  4M6X A;  2J5O A;  3I59 B;  4O6J A;  4I02 A;  2O3F A;  5HS7 A;  4HDU A;  3L2C A;  5CVI A;  2W24 A;  3R6S A;  1KYW A;  2K27 A;  3RYP A;  2FA5 A;  2BYV E;  2CQK A;  4P9U A;  1YG2 A;  1FLI A;  2C6Y A;  5DCM A;  2GXG A;  4PGH A;  1XSX A;  4HF2 A;  2OQR A;  1TQM A;  2FF4 A;  3JAM Z;  2R7F A;  3KEO A;  4U88 A;  5BQT A;  4FT8 A;  4ENK A;  1XGO A;  2IRF G;  3DPL C;  3LAJ A;  3SXY A;  2W25 A;  1OMI A;  1G3S A;  3IKT A;  2A6E F;  1SFE A;  5HDG A;  4YFX F;  1VTN C;  3FMR A;  3HYI A;  4KIB A;  4Y15 A;  3ZPL A;  3F8N A;  2JPC A;  1IAW A;  3KLN A;  3J81 K;  1XMK A;  2L4M A;  3CUQ B;  2QM3 A;  2EFN A;  2QUF A;  2A6H F;  2XUB A;  4M9Z A;  2W57 A;  4U0V A;  1RNL A;  5KK1 A;  2DPU A;  3TDZ C;  4FX4 A;  1QGP A;  3HOT A;  2YSR A;  3FWE A;  3ERE D;  1TW2 A;  3HIF A;  3E5Q A;  2L4A A;  1ZLK A;  1I1G A;  1O3T A;  2IA1 A;  2QEN A;  3T0Y A;  4H0E A;  5ICC A;  5DD4 A;  2XAS A;  2FNA A;  1B9N A;  4IRH A;  2JT1 A;  2RQP A;  1SFU A;  2O8X A;  2JPB A;  3WTT C;  1Z6R A;  4WK8 F;  4HX7 A;  1YTY A;  4L9J A;  3BY6 A;  1QQI A;  3V8J A;  2P7V B;  1XDU A;  3EYY A;  1J5Y A;  2OA4 A;  4RGR A;  1BI1 A;  4D0P A;  5EEH A;  4G8X A;  2E1N A;  3VOE A;  4ZZL A;  2XKP A;  3KLO A;  4P9F A;  3F22 A;  2MA3 A;  2ZKZ A;  3H3U A;  4RB3 C;  1DPR A;  2VE8 A;  3MCZ A;  3LQQ A;  2P8T A;  3L7W A;  5HLG A;  1LDJ A;  3W6K B;  2L01 A;  3KFW X;  1LQ1 A;  4S04 A;  5L3B A;  4HAM A;  3F8F A;  1T0F A;  5HDN A;  1FBQ A;  4A0Y A;  4AD9 A;  3H92 A;  1K78 A;  4OU0 A;  4RAY A;  1MD0 A;  3K1P A;  1XN7 A;  1F5T A;  3O3K A;  2GXB A;  4IVN A;  4IXA A;  5LHI A;  5ILV A;  3WG9 A;  1W7P B;  1FPQ A;  3FXU A;  1U6G A; 
#chains in the Genus database with same CATH topology
 3O6B B;  4XK4 A;  3BQZ A;  5GTI C;  3BQY A;  1HDP A;  5HLI A;  4XL9 A;  3I59 A;  2ZME C;  3IAS 2;  1MZB A;  1DP7 P;  2HOT A;  3CO7 C;  2CUE A;  1FMV A;  5JHU A;  2XPW A;  3BG5 A;  3JRF A;  4A3K J;  2LDU A;  1PUF A;  5GP9 A;  4PFP A;  3KP2 A;  1S3J A;  1W0U A;  3CQZ J;  4D9J A;  4XID A;  3RZD J;  2BVL A;  3GZ6 A;  2OZ6 A;  1YS7 A;  2HOS A;  3I71 A;  5IT3 A;  3SZT A;  2LR8 A;  3LFU A;  2TDX A;  1SAN A;  4A6D A;  1KYZ A;  3HSE A;  3ESW B;  2DDA A;  4Y33 A;  1I1S A;  1ETQ A;  4L5J A;  5AON A;  1HLV A;  1V3F A;  3K4L A;  2YX7 A;  3GX4 X;  3HM5 A;  1S9H A;  2RAE A;  1YJ9 I;  3J81 Z;  3A03 A;  1JUM A;  2V9K A;  4EEF G;  1A6I A;  3Q9V A;  2NS0 A;  3EYI A;  5M3F J;  1VZ0 A;  2BEO A;  1SFK A;  5DCF A;  4CHU A;  1IV6 A;  1FEX A;  2FX0 A;  4BY1 J;  4A6E A;  4XSX F;  1Z3Y A;  2ELK A;  4XLF A;  2GXA A;  3GFL A;  2HEO A;  1RR7 A;  2WAQ N;  2DK5 A;  2EQR A;  1DQU A;  1S5L C;  5IPA A;  4RAF A;  4XKV A;  5LLQ A;  3H3V K;  3PO3 J;  2VT3 A;  3F6V A;  5F04 A;  4X1E A;  1FMW A;  2ZB9 A;  4HLX A;  3MN2 A;  5JVG F;  3HC7 A;  1CF7 B;  2ZBK A;  1VI0 A;  1K79 A;  2BZT A;  1HKS A;  2QQB A;  3GTP J;  4HX4 A;  2P5V A;  2NVT J;  3DF8 A;  4HF0 A;  4CCK A;  3GYH X;  2XGE A;  2Z16 A;  2LY1 A;  3ZN1 A;  2VXD A;  3CUQ A;  4AUX A;  2ZNZ A;  2ZJQ F;  4MTE A;  2W4S A;  3KYC B;  2RC4 A;  4O5V A;  3K2Z A;  5J47 A;  3RDI A;  2OZU A;  4IHT A;  4NBQ A;  1HC8 A;  2HWV A;  1JXS A;  2GLO A;  5F27 A;  2PFB A;  1ZKG A;  3S15 J;  4DZJ A;  2GIV A;  3LSH A;  2DW4 A;  2XB5 A;  2R93 J;  1N78 A;  1P4X A;  1SD4 A;  4BE0 A;  5IYD J;  1EH6 A;  3KP5 A;  3I4N J;  3OYC A;  3I9V 2;  3W2V A;  3ZCO A;  1P4W A;  2PX9 A;  1OYY A;  2VQL A;  5CVJ A;  4EMS A;  3M8F A;  2F4M B;  5FD5 A;  1DP3 A;  2OBP A;  1Y1W J;  1PYV A;  4B48 A;  4YG2 F;  1R1T A;  1SVO A;  1SVM A;  3EQL F;  2DA4 A;  2QF7 A;  5J8F A;  1L3L A;  3HTS B;  1YIO A;  3HUG A;  4CDG A;  2H94 A;  3HGG A;  4J19 A;  1P7J A;  3K7A J;  4M71 A;  3WGI A;  3ZMV A;  1QNT A;  3I3L A;  3V42 A;  1BJA A;  1WJC A;  3EUH C;  3M8E A;  3A02 A;  4V2G A;  2EV5 A;  3TO6 A;  4A3C J;  1ACI A;  5EGO B;  5ILS A;  5E18 F;  3K70 D;  1YIJ I;  2IGM A;  4XSZ F;  1WRJ A;  1S7O A;  2Q2E B;  2FD5 A;  3FBN B;  1Z9C A;  1MND A;  4IPA A;  4D1Q A;  2ZME B;  2MLK A;  2VB6 A;  5KNL A;  5H6Q A;  5KVR A;  3QP6 A;  3W6J B;  1GXP A;  3DTE A;  4HST A;  3FXM A;  4XOT A;  2E60 A;  1ZAR A;  4AIK A;  2DYR H;  2H6C A;  1CQT A;  1A04 A;  3OYM A;  2ESN A;  3BG7 A;  2ZXI A;  2ZO4 A;  4XKW A;  3OYG A;  4EJU A;  2FQ4 A;  2WAQ A;  4IRG A;  1ZG5 A;  5L3E A;  3OYA A;  3GTQ J;  1XG1 A;  2IS2 A;  4U0W A;  3HL2 A;  4G94 A;  1HXD A;  1IGN A;  2O03 A;  2DO7 A;  1HF0 A;  4KDP A;  4XM3 A;  4P96 A;  2XAQ A;  2DN0 A;  1KGS A;  3E97 A;  5E3O A;  3A01 B;  2GQQ A;  4ZZD A;  4ZJZ A;  4UNO A;  4UVC A;  1GV2 A;  3O8G A;  1QZZ A;  1D0X A;  2DOA A;  1O57 A;  2Y69 H;  3D5S C;  5FKN A;  3CJN A;  4QWQ A;  2HYJ A;  1VQK I;  2FEZ A;  4M3E A;  3CDI A;  3S32 A;  3BR3 A;  2M30 A;  4XRF A;  3CCM I;  4RAZ A;  3IUO A;  3P9K A;  2HS5 A;  4ANJ A;  1H9G A;  1NH3 A;  1ZRD A;  3BR1 A;  1R23 A;  5KAF C;  3LAP A;  2M45 A;  2EZH A;  3GTM J;  2CUF A;  1MJB A;  4B09 A;  1T98 A;  5IOZ A;  3M8J A;  5LGT A;  1UCR A;  2BHZ A;  1ETX A;  3FF5 A;  2ZJ2 A;  1S7E A;  4FE4 A;  3RYR A;  2ISZ A;  2QGU A;  2ZFW A;  4XKC A;  3KZI C;  1F36 A;  1TWA J;  4YII A;  2DJI A;  4Y13 A;  4BXX J;  2P6S A;  3U2R A;  2EIM H;  2F5E A;  2PLY A;  3DPU A;  1ETV A;  5ERI A;  2GA1 A;  5FFX A;  3D0S A;  3LL7 A;  2LOO A;  3E1S A;  2M8E A;  1W7P A;  3ASO H;  2PI0 A;  1UMQ A;  4YEJ A;  2HYF A;  2P0W A;  1QRY A;  2Y9Y A;  2MD0 A;  5K5Q A;  4BQA A;  4M3D A;  4OAY A;  2K9S A;  4DIQ A;  1U8R A;  4CIC A;  4HG2 A;  2XRO A;  5AIQ A;  1T56 A;  2WAE A;  3GWZ A;  3M7G A;  4WXD A;  1D5Y A;  2LFB A;  2WY7 Q;  4DBR A;  3S3O A;  3T5X A;  4PSW A;  4CH7 A;  2OV7 A;  1FJL A;  3ECH A;  3R0A A;  3BJO A;  3IH2 A;  1H9T A;  2X85 A;  3RCO A;  1ETW A;  2B63 J;  1UHW A;  3CD6 I;  3SJM A;  4M9S A;  1XTA A;  2CW8 A;  2ECC A;  2G7U A;  4L5I A;  4P1W A;  2Z1D A;  4M74 A;  1EF4 A;  4TV7 A;  2HVQ A;  1K7A A;  2QCO A;  2LYC A;  1HQC A;  3C1D A;  5BOX A;  3BTL A;  2E71 A;  5TIS C;  3ZOB A;  3B6C A;  4CXF A;  5FLV A;  4ZTF A;  3SEQ A;  1ZRC A;  3OSF A;  2MFZ A;  2ZJR F;  1IZ1 A;  4HNT A;  4ETS A;  3LSR A;  5FRO A;  1C0W A;  3E6D A;  3DBH B;  3FHN A;  2LK2 A;  5E20 A;  1U2W A;  3IKV A;  5J1U A;  2Y30 A;  3HRS A;  4AVZ A;  1J9I A;  2R4G A;  4B44 A;  2XC7 A;  1FOY A;  3MFK A;  2VJI A;  4AIJ A;  4EJV A;  5DDG A;  1KON A;  4UB6 C;  4E7S A;  5GAD J;  2I5U A;  4MEX F;  3PFI A;  3S16 J;  3ISP A;  1WJF A;  3PQK A;  1WJA A;  4S0H B;  3U21 A;  3K9T A;  3BZ6 A;  2DA3 A;  1LFP A;  2MD5 A;  2WTE A;  2O6G E;  3DU5 A;  1MBG A;  2DMP A;  2M4G A;  4G9Y A;  1RUO A;  3PUF A;  1CF7 A;  1GVJ A;  2F5D A;  1HCR A;  4GYI A;  4CCO A;  2D1H A;  2H09 A;  1ZRE A;  1LEA A;  1HOM A;  4XRS A;  2DYS H;  3OYK A;  1T38 A;  1MNM C;  2RNJ A;  4IL6 C;  1IJW C;  1IRG A;  2A5Y B;  1RI7 A;  1JHH A;  3NQO A;  1WI3 A;  4LK1 F;  4BJT A;  4CYD A;  4BE1 A;  1FY7 A;  3ASN H;  2EK5 A;  5E3N A;  1V5G A;  2FU4 A;  2JUG A;  4BKX A;  3CCR I;  1ZR4 A;  4Q47 A;  2KDO A;  3CLO A;  2GBY A;  3OYB A;  2KRF A;  5D4S A;  3MKY B;  2ZNY A;  5LEK A;  2HQ5 A;  1USS A;  2MGQ A;  2TRT A;  2EIL H;  4GXO A;  3TL4 X;  3N05 A;  2BV6 A;  3E3V A;  5C4J J;  4XLN F;  4EJW A;  1Z05 A;  3C3W A;  3KP6 A;  2YPR A;  4L9T A;  1TZL A;  1BC7 C;  1X1A A;  4NDL A;  1FSE A;  4DOZ A;  1Z91 A;  4KYW A;  2X51 A;  5F1R A;  1FP1 D;  2VC1 A;  2NVQ J;  5HS9 A;  1U78 A;  2GWR A;  1TQP A;  3BRO A;  3OIQ A;  3OV8 A;  1S8N A;  4E7H A;  1G8X A;  4HPQ A;  2A6T A;  2PJR B;  1V4R A;  2XGX A;  3G71 I;  1ULY A;  5CVV A;  3S3N A;  2K5C A;  4HEA 2;  2OUM A;  5EGO A;  1G59 A;  3CF2 A;  4UUT A;  2NVY J;  2NYX A;  3QP5 A;  2Q2E A;  5ICF A;  1R4N B;  4D7M A;  2ZME A;  3HB9 A;  1W5S A;  5JHF A;  5H6R A;  2YS9 A;  4WX9 A;  3MMY B;  4HNV A;  3MQ0 A;  2MLG A;  4BHP A;  2W48 A;  3WTW C;  1R5I D;  1V54 H;  3WU1 B;  1PUF B;  1QHH D;  2Z3Y A;  1ITY A;  1IN6 A;  1YS6 A;  3FIS A;  2FJ1 A;  2QQA A;  3IH4 A;  1BJZ A;  3LOC A;  2OC6 A;  1T6S A;  3L2R A;  1P7I A;  2XAH A;  3H9Q A;  3VEP A;  1F9N A;  4Z6Y A;  2NVX J;  1TW3 A;  4LB5 A;  5DM7 F;  2KRH A;  1VQN I;  1R1U A;  3A01 A;  2F5C A;  3WU0 A;  1E17 A;  1ZR2 A;  4LIT A;  3CDH A;  2XB0 X;  1KQ8 A;  1AWC A;  2LKP A;  3HZJ A;  1O7F A;  1WZ2 A;  3CCS I;  4R79 A;  2LP0 A;  3ZMD A;  3HOX J;  1OCZ H;  3K2A A;  4KUM A;  3BJA A;  1U8B A;  2LNB A;  2RVC A;  3NWS A;  5JR3 A;  3UKG A;  1MW7 A;  2IGK A;  3LA2 A;  2L7F P;  2MAB A;  3LSG A;  1UST A;  1IDZ A;  3QOE A;  2KT0 A;  2QEX I;  3LSP A;  3SZP A;  3KZZ A;  5FLX K;  4IQ4 A;  2KRC A;  2LD5 A;  2VI6 A;  4BHC A;  3ZQI A;  3F9K A;  5L3C A;  4Q4Z F;  4IHS A;  2V7F A;  4WCG A;  3ABK H;  2XSD C;  2LSO A;  2K7L A;  2VKV A;  3WHC A;  2CH0 A;  1YOV B;  5HNH A;  4HNU A;  2CFO A;  2TCT A;  3BR2 A;  3HHH A;  3W3C A;  4XLC A;  1I3Q J;  1IDY A;  2LC2 A;  4EAT A;  1JHF A;  1GHC A;  1QVU A;  2JRM A;  5BNG A;  1ERD A;  2K3F A;  3C2G A;  1BL0 A;  4NHJ A;  1JT6 A;  5CQE A;  2L3D A;  3H5R A;  3TGN A;  2WV1 A;  4PJJ A;  3JTH A;  3W2A A;  2PMZ N;  1D1C A;  2M3A A;  4OIR F;  1JTY A;  1ZYR F;  2DLL A;  3ONQ A;  3AG3 H;  4XR6 A;  5CVR A;  4L9V A;  5GAG J;  2L7Z A;  3DKY A;  1LJ9 A;  4B47 A;  4HSR A;  3FBI B;  3NAU A;  3F8M A;  3S1Q J;  4LLG F;  4XLH A;  3SFI A;  5H2F C;  4J01 A;  1W0T A;  3HSR A;  3OR2 C;  4BE2 A;  2HQA A;  2HTJ A;  2HU9 A;  5E8I A;  3G6E I;  5D8K B;  5B5E C;  1LDD A;  1H8A C;  3PIP F;  3D5L A;  2EBI A;  3MZH A;  1K4S A;  1MMA A;  2IAI A;  4OAZ A;  3K4B A;  2L9N A;  5K1Y A;  1P4A A;  1W1W E;  3RKX A;  2ESH A;  2MH9 A;  1LVK A;  4YEL A;  2Y9Z A;  2EFQ A;  2FQ3 A;  1E3O C;  3EUH A;  1YO5 C;  3GZN B;  1X3W B;  4QPO A;  3SFZ A;  2GAU A;  1R1V A;  2W00 A;  3KIO A;  1X1B A;  1R71 A;  4LK0 F;  1Z6T A;  3F0C A;  2R7Z J;  1QO0 D;  2OJE D;  2HFH A;  2VC0 A;  5BPI A;  3OYJ A;  2LKS A;  3QYB A;  1ZEL A;  2PEX A;  1U9N A;  3O2P E;  4RS8 A;  2V1X A;  3FXQ A;  4JK1 X;  4RGX A;  1S7A A;  1VQ5 I;  4BU2 A;  1FTT A;  3VOD A;  1YFH A;  2O61 A;  2X1C A;  2E36 A;  1O3Q A;  1NG6 A;  3DEW A;  4LIV A;  1WFX A;  3C7J A;  1EA3 A;  5CJ9 A;  4M73 A;  3TMO A;  2DA5 A;  4HV5 A;  3CC7 I;  4L9N A;  1TQI A;  3ZQC A;  2H8R A;  1XGS A;  1VQ7 I;  2MYS A;  4KIS A;  2MC3 A;  3HOZ J;  1FC3 A;  4M6Y A;  4AIH A;  4LLN A;  2BW3 B;  5F08 A;  4ESB A;  5CQG A;  5HLH A;  2V9V A;  4MO7 A;  3ZRG A;  3EUK L;  2B9S A;  3GZ5 A;  2VBW A;  1ENH A;  3FHZ A;  3C2H A;  3QPH A;  2NNN A;  3BTJ A;  2HVS A;  3G1O A;  2K9N A;  3CC4 I;  3JRD A;  1BC8 C;  1FNN A;  1F4K A;  4A3F J;  2HDD A;  1I5Z A;  3WE3 A;  2M1B A;  1EV7 A;  2DQR A;  3X2Q H;  4CGZ A;  3BDD A;  3K4N A;  1FT9 A;  3WOD F;  4WF2 A;  3HRM A;  2P5L C;  1MNE A;  1W5T A;  2PMZ A;  2R7V A;  3RKY A;  2D45 A;  5DM6 F;  1BA5 A;  5CKT A;  4M3G A;  2VQH A;  4NC6 A;  3HJE A;  3RKQ A;  2BHY A;  3E6C C;  1OLT A;  1U5T C;  1MJA A;  2F5F A;  4I6Z A;  1R7J A;  5FKM A;  3SQN A;  3E7L A;  4D5C A;  3ZMT A;  3GFI A;  4BJ6 C;  4UVA A;  4Q5S F;  1D0Y A;  1YLF A;  3E6M A;  1GV5 A;  3JRA A;  5CYV A;  2EV6 A;  2XV4 S;  3DFG A;  1OIS A;  2COB A;  4A93 J;  3VYS B;  3S3M A;  1YW7 A;  4JOM A;  4P5O A;  1A35 A;  2XKO A;  1Q1H A;  2PJR A;  3CMA I;  1Y39 A;  4KIF A;  2NS7 A;  2ZXJ A;  2FRH A;  2LMD A;  4PCQ A;  4UB8 C;  3G2B A;  1E3H A;  2G9W A;  1L0O C;  1AA7 A;  2I10 A;  3GTJ J;  2E1M C;  3PM1 A;  4MIM A;  4ZYA A;  4C3J J;  2E1O A;  1YIT I;  3RPU A;  2L9S A;  3G3Z A;  1K83 J;  2M9H A;  2CUZ A;  2DI3 A;  1LPQ A;  3LA7 A;  4AU7 A;  2HGC A;  2HKO A;  1VQ8 I;  2Z2S B;  2DOE A;  3HOS A;  3QU3 A;  1JKP C;  4Z2Y A;  4EJO A;  2QZ8 A;  5FLX Z;  3BJ6 A;  1N75 A;  3KP3 A;  5E79 C;  3IWF A;  3Q9S A;  5EEG A;  2R5Z B;  2FNP A;  3MZ8 A;  3OYE A;  2IW5 A;  4QTR A;  1FBS A;  3LNQ A;  5DYM A;  1R5H A;  1GVD A;  5EF6 A;  2B0L A;  1YJN I;  2P4W A;  2E5N A;  1D8J A;  4I76 A;  3QOP A;  2IGO A;  1MIJ A;  2OAZ A;  4Y3O A;  4P55 A;  2LBF B;  3V8L A;  3VFZ A;  4LG3 A;  4DNC A;  1J59 A;  1B9M A;  3MZY A;  5DUK A;  2R7U A;  1ON2 A;  3OS1 A;  3OS0 A;  2D1V A;  3G1L A;  4GO1 A;  2VPR A;  4ZYG A;  2XF5 A;  1F1Z A;  4KN7 X;  4ZYD A;  5DV5 A;  3OYI A;  4J00 A;  3S1N J;  2F48 A;  3F8B A;  3BR0 A;  3L09 A;  5EDN A;  2UV1 A;  4KIG A;  4A3D J;  1X3Z B;  4IOA F;  2DK8 A;  1WKM A;  3CZ6 A;  4NB5 A;  2R0Q C;  4G6D A;  2KQR A;  2KZG A;  4WWC A;  1A5J A;  2Z5U A;  1LDK B;  3CJQ B;  2VBY A;  1AU7 A;  4RB0 A;  4DQ2 A;  2E5Z A;  4RGU A;  4JQF A;  2HPM A;  3R61 A;  2XAJ A;  3BOQ A;  1H88 C;  1U0J A;  1BR4 A;  1FX7 A;  2X6X A;  4UY8 I;  1MGT A;  4RB2 C;  1SEU A;  4C2M J;  4JX6 A;  1MBH A;  3JW4 A;  3OYH A;  1VQ4 I;  1SMT A;  3AL0 C;  3F6O A;  3TO7 A;  4YFN F;  5J4V A;  1J7K A;  2MSY A;  1T2K A;  1SD6 A;  5E8G A;  3CCJ I;  4XOP A;  4U7D A;  3SZG A;  1TT0 A;  2FXA A;  1TTY A;  4EQQ A;  5B66 C;  3J7A O;  1TL8 A;  1W36 C;  3K1M A;  4MFD A;  4BQO A;  1KQ9 A;  2XVC A;  3K69 A;  2VOO A;  2PJP A;  3U9G A;  1MMD A;  4BAY A;  4BQQ A;  1JGG A;  4ZDO A;  3K4M A;  4KT5 C;  1FYL A;  3QAH A;  1U5T B;  1JJ6 C;  4LGW A;  1TNS A;  1AOY A;  3WG7 H;  3V8K A;  1IXR C;  1TLH B;  3ZN0 A;  4ZYH A;  5E3M A;  2HPI A;  1KQ0 A;  5HNF A;  4XRM A;  1S29 A;  4ENM A;  1W7P D;  2F5V A;  2KP6 A;  3FMS A;  2DOF A;  5LD2 C;  1S6L A;  2CJJ A;  3CJT B;  3V7R A;  4EV0 A;  1EKE A;  2X1D A;  2BY2 A;  1MDM B;  2VUM J;  3IWZ A;  3BG6 A;  2K86 A;  4RBO A;  2Q0O A;  2LY9 A;  3PO2 J;  3FX3 A;  3F23 A;  4B8X A;  5JI6 A;  5C4X J;  3FXK A;  3V4G A;  3L00 A;  3DP7 A;  3BLY A;  2COM A;  1FBU A;  2CRG A;  2ME0 A;  5F0H A;  5EEA A;  5FKK A;  5C44 J;  2XGC A;  2E1C A;  3FXL A;  5L3D A;  1NK2 P;  2R7R A;  1XSD A;  1I39 A;  4AID A;  1NK3 P;  1WPK A;  2E1M B;  1GXQ A;  2BXY A;  3KET A;  4YIF A;  4K2E A;  2CS3 A;  2QYO A;  1BW6 A;  1OPC A;  4HV6 A;  2BY3 A;  1FIP A;  3KCC A;  5K7F A;  3IHU A;  4I0A A;  4MTD A;  1JTX A;  4XMY A;  2DOD A;  1T33 A;  3R4K A;  2ZFU A;  2KJB A;  5EG0 B;  1J75 A;  2IS1 A;  1R22 A;  4BAC A;  3HG9 A;  3TW7 A;  4U87 A;  4IJA A;  5JLX A;  4AWX B;  4BGD A;  4HQE A;  2JWT A;  1HBX G;  2JRT A;  4CSW A;  2VKE A;  2DAO A;  2UUZ A;  2BOL A;  4HBL A;  2Y31 A;  3JTG A;  2MBF A;  1U9O A;  2STW A;  1IC8 A;  3IC7 A;  2H27 A;  3Q0W A;  2DFE A;  2BW3 A;  3A2K A;  2X6W A;  1BIA A;  3DU6 A;  4G7H F;  3MAJ A;  1B8I B;  3I54 A;  2JA7 J;  1OJL A;  1NG7 A;  1Y8Q B;  4F91 B;  3QU6 A;  2DU9 A;  1TWH J;  5EZG A;  1QVT A;  4BQN A;  2EJR A;  4G7Z F;  3OYF A;  5TRD A;  2XHK A;  4PGG A;  4RDU A;  1D1A A;  1DU0 A;  4V19 K;  9ANT A;  3HHG A;  1NTC A;  1BBY A;  2OTJ I;  1B59 A;  4HQM A;  4RAG A;  3RPQ A;  3IV5 A;  1LNW A;  4NC8 A;  2A3S A;  3HRU A;  2JVH A;  2IS6 A;  4EM0 B;  1A36 A;  3C2B A;  4OMY A;  6PAX A;  1OYI A;  5LFA A;  2VLA A;  2Z99 A;  1G4D A;  1D8K A;  3CCU I;  3I58 A;  3BT9 A;  1VQ9 I;  1J09 A;  2Q8K A;  4MGR A;  4F7Z A;  3LSI A;  5E1W A;  3ZMZ A;  3FIW A;  4L0Z B;  1XGM A;  4WXC A;  3DTK A;  2UZK A;  2EH3 A;  3CF5 F;  1POG A;  2CWE A;  4XKB A;  1A31 A;  3AL0 B;  2CSO A;  4A2U A;  2B7E A;  1O7L A;  3IRR A;  2DA6 A;  4MNU A;  5LRS A;  2DXI A;  1Y6I A;  2HQR A;  3P5J A;  4E7I A;  2YX4 A;  3ZQG A;  1EJ9 A;  1P2F A;  4XNF A;  4BXF A;  2KJC A;  3DEU A;  1XCV A;  2WBM A;  1IN7 A;  2XDV A;  4PSX A;  2MH2 A;  4LLL A;  5DS9 A;  1X1P A;  5FGM A;  2V79 A;  3F21 A;  2D2W A;  4CCN A;  4BEH B;  2K9L A;  1D5V A;  2IP2 A;  2RRE A;  1FYM A;  2VT2 A;  2X6Y A;  1I3A A;  2GZW A;  2GOX B;  2JN6 A;  3TED A;  3NAR A;  4FAS D;  1BOA A;  4ON0 A;  2KFD A;  4PJN A;  2R5Z A;  2XF7 A;  1D3Y A;  2R7O A;  2OQG A;  4UV8 A;  1XMX A;  3FKI J;  2HKX A;  4KMF A;  4HF1 A;  3RZO J;  5GAE J;  4RM2 A;  3CCL I;  4QLC U;  2A61 A;  5AIP A;  5M3M J;  1J0R A;  2LBF A;  2VJ4 A;  3S8P A;  2KLO A;  4E4H A;  4LB6 B;  1TP4 A;  4LG0 B;  3IRQ A;  4A0X A;  3HXL A;  3WGH A;  2OU2 A;  1B6A A;  2JA2 A;  4B3A A;  3S93 A;  5D5W B;  1VQ6 I;  2PMH A;  2N8G A;  3GXO A;  3DQV C;  4G12 A;  1ETK A;  1ETY A;  4KMU X;  1N25 A;  2IA0 A;  4EJT A;  2P7C B;  3PNY A;  3ABM H;  3V7C A;  1SVL A;  5HDK A;  1O3S A;  3V7S A;  3P9I A;  4I0B A;  2W85 A;  4N0B A;  4BDY A;  3CCE I;  3OSG A;  2DT6 A;  2DMN A;  3Q5F A;  4IRI A;  3WTS C;  2EA4 A;  4OIO F;  3T8R A;  1Y1V J;  2IS4 A;  4I09 A;  5IYB J;  1KU7 A;  4IHW A;  4N9I A;  3H3Z A;  2YU9 J;  1IXS B;  3DPT A;  4FX0 A;  5E1X A;  4B4C A;  3DLL F;  2YU3 A;  1JKQ C;  2EIJ H;  1WH5 A;  4Y17 A;  5FJ8 J;  2JSC A;  4KJZ A;  1SAX A;  5BS6 A;  2CW0 F;  3ZGK A;  3HDD A;  3ZP5 A;  2EZI A;  2RQQ A;  2L02 A;  5FKL A;  1BR2 A;  2JUC A;  3RKW A;  3AG1 H;  2CGP A;  2J5P A;  5J8C A;  4BYY A;  4E7Z A;  1ZH5 A;  2DTR A;  3L2W A;  2VN2 A;  2AXT C;  1XMA A;  4RM3 A;  5L3F A;  3M1E A;  1M1E B;  4PJL A;  2A07 F;  5HVQ C;  2KIM A;  1SFX A;  1KA8 A;  1U5T A;  2YR2 A;  1OCP A;  2P6T A;  1K4T A;  2E2H J;  1WWX A;  2QWW A;  2KL4 A;  4YFK F;  4S05 A;  5JLW A;  3SDB A;  4QIW N;  4FE7 A;  1VQL I;  4DW6 A;  3OR1 C;  3ELK A;  3PSI A;  4MLO A;  5J6X A;  2VKD A;  3DBL B;  1MDM A;  2Y0S N;  4PFO A;  4EGZ A;  3A0B C;  1HW5 A;  3GW2 A;  3M07 A;  3TW6 A;  1REP C;  3H1C A;  1ZTR A;  4IHX A;  3JSP A;  2Z9O A;  4BDZ A;  1W36 D;  2VOP A;  2R3S A;  3E5X A;  4E6K G;  2CFX A;  4Y7N J;  2HDC A;  3JRE A;  4X0G A;  2VJJ A;  3GTK J;  1Q1V A;  2Y75 A;  3ABL H;  5J3L A;  1R5G A;  1SMY F;  4IZZ A;  3GLX A;  3JSO A;  4CZZ A;  5HLT A;  3H9G A;  3I4M J;  4R8H A;  4DJA A;  2OPT A;  1OQY A;  1AKH B;  4KIT B;  2RV8 A;  2XAF A;  3M1C A;  3DLA A;  1ZGA A;  1MBE A;  3RQI A;  3QRF F;  1ZGJ A;  3QPT A;  5LRR A;  2A5W A;  1UEL B;  5EG0 A;  2IXS A;  2FSW A;  2QA4 I;  5IT9 K;  5E1Z B;  2V4J C;  2ACJ A;  1RRJ A;  4ZDP A;  1E3P A;  1QZE A;  2O9L A;  3I0T A;  1HST A;  3Q0V A;  3WTZ A;  3WGG A;  3EDP A;  4XLE A;  3VYU B;  2DA2 A;  2BBY A;  1IN8 A;  3KX2 A;  2E2J J;  1AHD P;  1XCB A;  1Z7U A;  3GTL J;  4IQJ A;  3CMY A;  2PN6 A;  3HEF A;  1B8I A;  2HDW A;  2CW7 A;  4ZDL A;  4LMY A;  1PUE E;  2WY8 Q;  5F64 A;  1LKX A;  1MSE C;  3NWT A;  3K4J A;  2EZK A;  3H0D A;  1ZK8 A;  2RKH A;  3ABT A;  3GTO J;  5BMZ A;  2VOD A;  3UR3 C;  2AXL A;  2HOE A;  2W1O A;  4NC7 A;  3GO5 A;  2X1E A;  3GME A;  1DPU A;  1HW1 A;  1MKM A;  3CES A;  5DEQ A;  5ILU A;  5JVT A;  1P92 A;  3JRC A;  4ITV A;  2EIK H;  5EYR A;  5J1Y A;  1WSU A;  4XLA A;  4KT6 A;  1WCM J;  4DGW B;  3BR6 A;  3ZXS A;  2WAD A;  1V55 H;  1K6Y A;  4R1H A;  3LA3 A;  3TP0 A;  4BBS J;  4I99 C;  3S2W A;  2HI3 A;  2DT7 B;  2H8W A;  3DCF A;  3MWM A;  5EZH A;  1MMG A;  4MFE A;  2ELH A;  1YRN B;  2HXO A;  1IG7 A;  3F8C A;  4XOR A;  2IGN A;  1A6Q A;  3EUA A;  4EGY A;  3IP4 B;  3KP4 A;  1MMS A;  5B3S H;  1XGN A;  1E2X A;  4OOI A;  5LEJ A;  2FMY A;  2Y0S A;  3OOP A;  4PK4 A;  3RTR A;  5LGU A;  3GFJ A;  4L5E A;  3I64 A;  3B73 A;  2NXN B;  3N97 A;  1QZY A;  4JP0 A;  1SC7 A;  5L3G A;  4M3B A;  3TOB A;  1I6X A;  5D6F A;  2A68 F;  2BVM A;  2DJN A;  4F92 B;  4BNC A;  4BEH A;  2VBX A;  1QBJ A;  3FZV A;  4HW0 A;  4LJZ F;  2M5W A;  4OMZ A;  5DTD A;  2E19 A;  1TBX A;  2IPQ X;  1U3E M;  3GVA A;  2ELJ A;  1QA6 A;  4UXN A;  3WE2 A;  2FE3 A;  1OR7 C;  1BI2 A;  3ML6 A;  1MBF A;  4IO9 F;  1QPI A;  3ABU A;  2ZJP F;  1X4P A;  4GGG A;  3HTU A;  2W7N A;  4I2O A;  4UHT A;  3K70 C;  5D5V B;  1T08 B;  2DFH A;  3RPU D;  3F72 A;  4QPQ A;  1BM9 A;  4FTH A;  3WTX C;  1OCR H;  1JKR C;  4Q48 A;  4LG0 A;  1P6R A;  2M87 A;  1KU2 A;  2ETH A;  3ULQ B;  5M5X J;  1MJ9 A;  3LSJ A;  3F3X A;  3RSN A;  4A0Z A;  1LUJ B;  3ERM A;  3TO9 A;  1H89 C;  1OCC H;  3E0J B;  2FBI A;  3HOW J;  1RZ4 A;  3J7A Y;  4W97 A;  4UUS B;  1R36 A;  5GAH J;  1ZQ3 P;  2DDB A;  3FXJ A;  4LD5 A;  1XB4 A;  2V1U A;  4HRI A;  5A2Q K;  1ETO A;  1IN4 A;  4A3L J;  2XPV A;  4XRS G;  2Y48 A;  3TBI A;  3E5U A;  1K6O A;  3HOV J;  3FKJ A;  2G7H A;  2HVR A;  4C9Y A;  3MKW B;  2UWM A;  1G3W A;  3RI4 A;  1VQO I;  2OD5 A;  4OIP F;  3JRH A;  4ABZ A;  2NOJ B;  2Y0M A;  3VSK A;  2M0M A;  3J80 K;  1KU9 A;  4PZJ A;  3U1K A;  5IOY A;  2QBY B;  1Z77 A;  1FOW A;  2X6O A;  2VPL A;  4PDK A;  2ZCW A;  2IJL A;  4M9X A;  1Z3X A;  3OYL A;  1SFO J;  2V6E A;  5D4R A;  5F1J A;  3L2Q A;  4NNJ A;  3JCU C;  2HR3 A;  4UUV A;  2M34 A;  1IRF A;  4B43 A;  3DEE A;  4MEY F;  3ROU A;  1PP7 U;  2LF8 A;  1BN5 A;  1TWC J;  2LY2 A;  1R9T J;  3OYD A;  3HGY A;  3S1M J;  5IT9 Z;  1PVE A;  3B02 A;  4BXU A;  3CCY A;  2CMP A;  3FK6 A;  3PIO F;  2WWY A;  1RUN A;  2JA6 J;  1IUY A;  2CV0 A;  2CV2 A;  4IHY A;  2E35 A;  2DTZ A;  4A3M J;  2V6C A;  3TKY A;  2H6B A;  3D1N I;  2E7X A;  1ODD A;  2P81 A;  1ON1 A;  1ZAO A;  2UXN A;  2AS5 F;  3U1D A;  2M7A A;  1GLN A;  3FDY A;  4OWR B;  4RA2 A;  4NQW B;  1LVA A;  4NUB A;  4MQV A;  1OFC X;  2DPD A;  1AKH A;  4BS9 A;  3PL8 A;  2UXX A;  3DXJ F;  1O3R A;  1G3T A;  3QPS A;  4UV9 A;  3WTY C;  4HDV A;  3ZR8 X;  1XC5 A;  3CMM A;  4A5N A;  1OCT C;  3A4C A;  4BHB A;  2LF7 A;  1YHQ I;  1IF1 A;  1Z67 A;  2PG4 A;  4CZC A;  1JE8 A;  2ME6 A;  3G73 A;  3I53 A;  1B1B A;  1O4X A;  1MBK A;  4CO8 A;  5F0F A;  2OTL I;  3KPH A;  5ICG A;  4AYB N;  3REO A;  2CO5 A;  3LQR A;  2GOM A;  2JQ7 A;  1W5C C;  1UFM A;  2VXZ A;  3OWT A;  3BPX A;  2F4O B;  2X9D A;  3CTA A;  1V5F A;  2EWN A;  3TDU C;  1FP2 A;  2IA2 A;  3I5U A;  3AAF A;  2LRD A;  3GF2 A;  2CU7 A;  1ZLJ A;  2BGC A;  2M7B A;  5K7Z A;  3BP8 A;  2LKX A;  1TNT A;  3OL3 A;  3PQJ A;  1FSH A;  4EM2 A;  2R7W A;  1JT0 A;  2R7S A;  4A3B J;  5GPA A;  4ESF A;  5FB2 A;  5K5O A;  3CUO A;  2L7K A;  4HZF A;  2ZXH A;  2OCC H;  2FBK A;  3BWG A;  3R0J A;  4KNY A;  1OYW A;  3S14 J;  1VF9 A;  1UB9 A;  1CGP A;  1DU6 A;  3N4M A;  1JKO C;  4ZH4 F;  1XDS A;  4II2 A;  2PBI A;  2KZV A;  5ED4 A;  3TP3 A;  1WH7 A;  3MKL A;  2R5Y B;  2EIN H;  3LSK A;  3HBL A;  1BI3 A;  5D5X B;  3DTI A;  4CCL A;  1YRN A;  3W2W A;  3MD2 A;  5FFZ A;  2LTP A;  4DYR A;  2HZT A;  2NAZ A;  2L5Q A;  2HQN A;  4ESJ A;  1FTZ A;  1FZP B;  2M4K A;  3BZC A;  2X4H A;  4BH9 A;  2F6C A;  3UNG C;  1TWG J;  5LHH A;  1LFU P;  4I7H A;  1R00 A;  2K4J A;  4GDF A;  4LOC A;  2NNY A;  4HA8 A;  1LEB A;  3LMM A;  3KEQ A;  1IW7 F;  3KEY A;  4BJ5 C;  1LB2 A;  2EPF A;  1BOB A;  3LWF A;  3CO6 C;  2L9R A;  2QSF X;  2QVO A;  1MBJ A;  1YW9 A;  2HOA A;  3T8T A;  2R7X A;  4CCM A;  1YI2 I;  3CP2 A;  1QHG A;  1X1C A;  4KIC A;  2DA1 A;  2QQ9 A;  2QSG X;  2Y2Z A;  2VQG A;  1FOX A;  2L54 A;  1STZ A;  1D1B A;  4AYB A;  2JSP A;  4XLP F;  3R60 A;  2W82 A;  3I4P A;  4CYC B;  3L1P A;  2EFO A;  4ENJ A;  2DA7 A;  2ICW G;  3DV8 A;  5A2Q Z;  4N4O B;  2P5K A;  1R58 A;  5GTH C;  3LSM A;  3SDG A;  2QKL B;  1TWF J;  3BCA A;  4GCV A;  4MHG A;  5M5Y J;  1ORK A;  3FK7 A;  2HZD A;  1HKT A;  1OKR A;  5DUI A;  4IX7 A;  3CDL A;  4Y4R A;  1WQ2 A;  3AG4 H;  1T8I A;  4U0Y A;  5FO5 A;  2VKH A;  4WXH A;  2IVM A;  2K9Q A;  4F52 A;  4ZYE A;  2R7Q A;  5LHG A;  5H20 A;  2EFW A;  2F2E A;  4HYE A;  2CQX A;  4G7O F;  1X3U A;  2CV1 A;  2WB1 N;  1IN5 A;  1Z1D A;  2BE5 F;  4A5M A;  5M5W J;  2KHM A;  3HKZ N;  3J80 Z;  4UUS A;  1FWZ A;  1PDN C;  2LRE A;  4C2T A;  4XQF A;  3NEU A;  4XBF A;  4E70 A;  5J4Y A;  4C2U A;  2JK3 A;  1E0E A;  1JUS A;  3M9A A;  2NRA C;  1MMN A;  2M0C A;  1RC9 A;  4KN4 X;  1HW2 A;  4KFC A;  2X48 A;  2KDZ A;  3ZQ7 A;  3HPH A;  3ZMU A;  2CQ7 A;  2L9V A;  5ICE A;  4LIU A;  3C18 A;  5FD6 A;  3FM5 A;  3H36 A;  3PFY A;  1T95 A;  2ADU A;  1RKW A;  3GUD A;  5DD8 A;  3FXR A;  3WTV C;  5B1B H;  3DKX A;  1SD5 A;  4ZC3 A;  2CG4 A;  3VDX A;  2X0L A;  1RKT A;  3K10 A;  5GPC A;  3CCV I;  2FOK A;  2PQ8 A;  4ZTJ A;  2QBY A;  1Y0U A;  2DQL A;  2O0Y A;  3MVP A;  3SEZ A;  1XS9 A;  2XRL A;  1QPM A;  5DCM B;  2RNG A;  1MSF C;  1G2H A;  2GA2 A;  4IEJ A;  2DBB A;  1ZRF A;  1JI8 A;  1BIB A;  4W1U A;  5D5U B;  1IV8 A;  3QOD A;  3KE2 A;  3TQN A;  1XD7 A;  1NHA A;  3RIR A;  4M6V A;  3G1M A;  2KIQ A;  3DKW A;  3P9C A;  2V1D A;  2DFF A;  1B4A A;  2L7M P;  1X4O A;  2Z33 A;  5FKO A;  2M8G X;  3OS2 A;  4E7L A;  5FRN A;  3J7Y J;  3WTU C;  4IOC F;  3LST A;  3D5R C;  1IUF A;  2XRN A;  4RGS A;  3BPV A;  5E17 F;  4ASN A;  4AVP A;  5LBQ A;  4ENN A;  3PNT A;  2ZSH B;  2CQN A;  4I98 B;  4MQ9 F;  1APL C;  2K3P A;  3S17 J;  1T0F C;  2LVS A;  3ZQL A;  1EH8 A;  3BG9 A;  3CME I;  2K85 A;  1YX5 A;  2VIX A;  3GEZ A;  4NQW A;  3TOA A;  4D7N A;  2BXZ A;  2AHQ A;  1IRZ A;  3JAM K;  2K4B A;  5FLM J;  1LFB A;  1SD7 A;  1ZG3 A;  1EH7 A;  2PMU A;  4L18 B;  1WVR A;  1WI9 A;  2L0K A;  1HA8 A;  3GFM A;  1DUX C;  3BR5 A;  3JRB A;  1HKQ A;  2EA2 A;  3B6A A;  3E6B A;  2A69 F;  3SYT A;  1ZN2 A;  1JGS A;  2XAG A;  3H9J A;  2JA5 J;  2DFI A;  2WB1 A;  4C3I J;  1GT0 C;  5JFR A;  3VWB A;  3HOY J;  2VON A;  3PNV A;  5B1A H;  1MH4 A;  1OR7 A;  3HSF A;  3HKZ A;  3MEX A;  2GM4 A;  5HS8 A;  3HRT A;  1YX3 A;  2V26 A;  5LGN A;  2JVG A;  3FMQ A;  3I55 I;  1V5E A;  1YJW I;  3K0L A;  2WAF A;  2XGD A;  2CQQ A;  2K02 A;  2IT0 A;  2STT A;  4N4N B;  3A1Y A;  1ONV A;  5CPR B;  2KIF A;  2HTS A;  4QSH A;  4EVI A;  4OIQ F;  2L2O A;  3BZK A;  3DWL E;  3OYN A;  1Z0X A;  2K40 A;  2YUS A;  4DYC A;  4A3E J;  5FRM A;  2FBH A;  2O7O A;  5CLS A;  2EB7 A;  2ID3 A;  3P7N A;  3RJP A;  4RB1 A;  3GTG J;  4GYG A;  2IEK A;  4BY7 J;  2F4I A;  1S72 I;  1UJ8 A;  1ZHF A;  4M3F A;  5J40 A;  1ZG1 A;  1LE8 B;  3H0G J;  3HPG A;  1YQA A;  3KP7 A;  3GBG A;  3COA C;  4I01 A;  1F43 A;  4FIS A;  2KPM A;  4JYK A;  3FM3 A;  2K9M A;  2WC2 A;  4FET A;  1FOK A;  4N9H A;  4IF4 A;  2EFP A;  4FHT A;  3QQA A;  1WJE A;  1W4M A;  4CCJ A;  3JR9 A;  4JBA A;  1BI0 A;  1IXC A;  2XIG A;  4JX4 A;  2R5Y A;  4HOB A;  1WJD A;  2RDP A;  2ECB A;  3FXO A;  4OIN F;  4X6A J;  3VB2 A;  2FOW A;  3AG2 H;  2BY0 A;  2HNH A;  4GFB A;  2RN7 A;  2VE9 A;  2Q1Z B;  4A3G J;  3WU2 C;  3GLL A;  1GDT A;  4RLF A;  4G6Q A;  2VBZ A;  1RIO H;  2AQE A;  3K6G A;  2AQF A;  1YW8 A;  1B72 B;  1KZH A;  5K5R A;  5D8L B;  4E7J A;  1UZC A;  4UVB A;  1HSJ A;  4AM3 A;  2KIU A;  4U7B A;  3L9F A;  4KA4 A;  1I27 A;  3Q0U A;  2V9P A;  2I8D A;  3EET A;  3I56 I;  3K1N A;  4HLY A;  2FML A;  1Y8R B;  4A12 A;  4D5F A;  3CUQ C;  2KKO A;  2WV0 A;  1PP8 F;  2R7D A;  1UG2 A;  5F6F A;  3ZMS A;  4O3M A;  4XN0 A;  4L0Y B;  3KZY A;  3OMY A;  3LFK A;  1X19 A;  1G3Y A;  2QLZ A;  1T39 A;  1FYK A;  2KMU A;  2JZY A;  3NRV A;  5F0C A;  2W84 A;  2ISY A;  4LFU A;  1G6N A;  2MC4 A;  3K4C A;  3BCB A;  4CYC A;  3ECO A;  3K4K A;  1UHS A;  2H1L A;  5CVU A;  4M72 A;  2EV0 A;  1J2X A;  2E7W A;  2BY1 A;  2NS8 A;  1D0Z A;  2JTV A;  2HYG D;  2DMU A;  3ZQQ A;  3IL2 A;  1K78 B;  5KAI C;  4DZP A;  3PSF A;  5HOO A;  1SAU A;  1DDN A;  3ZQF A;  4V2F A;  4BBR J;  1H0M A;  2CYY A;  3O8H A;  1UHM A;  1XSV A;  4HX8 A;  3CLQ A;  2DT5 A;  3OIP A;  3S2D J;  1KU3 A;  5D6E A;  1YYV A;  5TJJ A;  3SHF A;  2WA0 A;  5BPD A;  5K7H A;  1UAA A;  2EZL A;  1I6H J;  2XAU A;  2KIS A;  1VQM I;  2RGV A;  5J1R A;  4EM1 A;  3T1B A;  3M4O J;  3BG3 A;  3ZQH A;  4M6X A;  4CA0 A;  1Z7L A;  1VQP I;  1PJR A;  2XPU A;  2J5O A;  3I59 B;  4O6J A;  4XN3 A;  4I02 A;  4XON A;  2O3F A;  5HS7 A;  4HDU A;  3L2C A;  5CVI A;  3L2U A;  2W24 A;  3S1R J;  3A0H C;  1BW5 A;  4II3 A;  3R6S A;  1IO2 A;  4E7K A;  2OF7 A;  1KYW A;  4H4K C;  2K27 A;  3RQ4 A;  3RYP A;  2FA5 A;  2BYV E;  2CQK A;  4IHV A;  4P9U A;  1YE9 A;  2XF6 A;  2R92 J;  5IY5 H;  1YG2 A;  1FLI A;  1Y0N A;  5KCM A;  2C6Y A;  5DCM A;  2GXG A;  4FCY A;  4PGH A;  1XSX A;  2ZC2 A;  4HF2 A;  2OQR A;  1TQM A;  2FF4 A;  4RLQ A;  3JAM Z;  2LG4 A;  1IRX A;  2VQC A;  2R7F A;  3BC8 A;  3KEO A;  4U88 A;  5BQT A;  1XPX A;  4FT8 A;  1DGW Y;  2CUJ A;  4ENK A;  1XGO A;  1FIA A;  4AC0 A;  3DPL C;  3KYD B;  2IRF G;  3LAJ A;  3WHB A;  3SXY A;  2W25 A;  4GRI A;  3QYF A;  1OMI A;  2D5V A;  2A05 A;  1BR1 A;  4Y52 J;  1G3S A;  3IKT A;  2A6E F;  3VYR B;  1SFE A;  5HDG A;  4B1R A;  4YFX F;  1I50 J;  1VTN C;  3FMR A;  2JJ7 A;  3HYI A;  4KIB A;  5EJC A;  3IAM 2;  1VFC A;  4Y15 A;  3ZPL A;  3F8N A;  2JPC A;  1IAW A;  3KLN A;  1X1D A;  3CC2 I;  3JRG A;  2XSJ C;  3J81 K;  1XMK A;  1WGX A;  2O8K A;  1R6R A;  2E34 A;  3JRI A;  2L4M A;  3CUQ B;  3G4S I;  2QM3 A;  3QPL A;  2EFN A;  2QUF A;  2A6H F;  2XUB A;  4M9Z A;  2W57 A;  4U0V A;  2LH9 A;  1RNL A;  5KK1 A;  2DPU A;  3TDZ C;  4FX4 A;  1QGP A;  3HOT A;  3Q3S A;  2YSR A;  3FWE A;  5HOD A;  3CCQ I;  3OY9 A;  3OOU A;  1TW2 A;  3HIF A;  3ERE D;  3E5Q A;  3IH3 A;  4A3I J;  2L4A A;  1TT5 B;  1RET A;  1ZGW A;  3OL4 A;  2ZXW H;  1ZLK A;  1I1G A;  2QQ8 A;  4FQG A;  2V1N A;  1O3T A;  4BUP A;  2IA1 A;  2QEN A;  1JUP A;  3S2H J;  1QU3 A;  3CP8 A;  3T0Y A;  5KHD A;  3BTI A;  2ZSI B;  4H0E A;  2R7T A;  5ICC A;  4F93 B;  1X58 A;  5DD4 A;  3M3Y J;  4PUS A;  2XAS A;  2FNA A;  1DGR M;  2OCE A;  2VAS A;  1P9Q C;  1LE8 A;  1B9N A;  3AKZ A;  4IRH A;  3PUB A;  4YIR X;  2JT1 A;  2RQP A;  3HUG B;  1SFU A;  2MG4 A;  2O8X A;  2JPB A;  3WTT C;  1Z6R A;  4WK8 F;  3GCM A;  2DCE A;  3H5N A;  2O5R A;  2ID6 A;  1R49 A;  4HX7 A;  1RPW A;  5TGT A;  3MKZ A;  1YTY A;  4L9J A;  3VSL A;  3BY6 A;  2DMQ A;  1X2N A;  2NVU B;  3J7Z I;  2IBD A;  4RMN A;  1QQI A;  3QWL A;  4BL0 B;  3V8J A;  3BTC A;  5C3E J;  1Y56 A;  4XIC A;  2P7V B;  2E2I J;  1MH3 A;  1XDU A;  3VPR A;  4B3X A;  1TC3 C;  3EYY A;  2H1K A;  1GUU A;  1J5Y A;  2OA4 A;  4RGR A;  1UG0 A;  4CUG A;  1BI1 A;  4YRV A;  4D0P A;  5EEH A;  1WJ5 A;  4DBQ A;  3DBR B;  3W6V A;  2AO9 A;  4G6T B;  4G8X A;  3HOU J;  2DMT A;  2G0E A;  2E1N A;  3VOE A;  5IYC J;  1B72 A;  4ZZL A;  3L2V A;  2XKP A;  2JMW A;  3KLO A;  4P9F A;  2MW8 A;  3H5A A;  1X2M A;  3F22 A;  1HDD C;  2MA3 A;  2GIZ A;  4A69 C;  1VND A;  2ZKZ A;  3H3U A;  4RB3 C;  1DPR A;  1K61 A;  2VE8 A;  4C30 A;  3MCZ A;  4C3H J;  3LQQ A;  2P8T A;  1XX5 A;  2VL8 A;  3L7W A;  2M2E A;  2JA8 J;  4F3Q A;  2VJ5 A;  1R4M B;  5HLG A;  2HXI A;  1LDJ A;  3W6K B;  2L01 A;  4PJM A;  3KFW X;  1LQ1 A;  4S04 A;  5L3B A;  4IKF A;  4HAM A;  3QYE A;  3F8F A;  4PJ0 C;  1T0F A;  5IP6 A;  5HDN A;  3OIO A;  1JJ8 C;  1FBQ A;  3EPZ A;  4A0Y A;  4F55 A;  2QSH X;  5IP7 J;  4AD9 A;  3H92 A;  1K78 A;  2NOG A;  4OU0 A;  3PJR A;  1RR8 C;  1Z21 A;  4RAY A;  1MD0 A;  4DYQ A;  2LLK A;  1OCO H;  3K1P A;  4JX5 A;  1XN7 A;  1F5T A;  3O3K A;  2GXB A;  1WJB A;  1N77 A;  4IVN A;  4IXA A;  5E3L A;  1WHU A;  5LHI A;  2FUG 2;  1RES A;  5ILV A;  3H35 A;  5IP9 J;  3WG9 A;  3VYT B;  1W7P B;  1FPQ A;  3AFH A;  3KYL A;  2QKM B;  3FXU A;  1U6G A;  4A3J J;  3CJR B; 
#chains in the Genus database with same CATH homology
 3O6B B;  5HLI A;  3I59 A;  1MZB A;  1DP7 P;  3CO7 C;  5JHU A;  2LDU A;  3KP2 A;  1S3J A;  3GZ6 A;  2OZ6 A;  1YS7 A;  3I71 A;  5IT3 A;  3SZT A;  2TDX A;  4A6D A;  1I1S A;  1KYZ A;  3HSE A;  4L5J A;  5AON A;  1V3F A;  2YX7 A;  3GX4 X;  3J81 Z;  3Q9V A;  2NS0 A;  3EYI A;  2BEO A;  5DCF A;  4CHU A;  4A6E A;  4XSX F;  3GFL A;  2HEO A;  2DK5 A;  5LLQ A;  2VT3 A;  3F6V A;  4HLX A;  1CF7 B;  2ZBK A;  1K79 A;  1HKS A;  2QQB A;  4HX4 A;  2P5V A;  3DF8 A;  4HF0 A;  3GYH X;  3ZN1 A;  3CUQ A;  2ZNZ A;  4MTE A;  2RC4 A;  4O5V A;  3K2Z A;  3RDI A;  2OZU A;  4IHT A;  1JXS A;  2HWV A;  2PFB A;  2GIV A;  2DW4 A;  1P4X A;  1SD4 A;  1EH6 A;  3KP5 A;  1P4W A;  1OYY A;  5CVJ A;  4EMS A;  3M8F A;  5FD5 A;  2OBP A;  4YG2 F;  1R1T A;  3EQL F;  5J8F A;  1L3L A;  3HTS B;  1YIO A;  3HUG A;  4CDG A;  2H94 A;  4M71 A;  3WGI A;  3ZMV A;  1QNT A;  1BJA A;  3M8E A;  2EV5 A;  3TO6 A;  5ILS A;  5E18 F;  4XSZ F;  1WRJ A;  1S7O A;  1Z9C A;  4IPA A;  2ZME B;  2MLK A;  5H6Q A;  5KVR A;  3QP6 A;  3W6J B;  1GXP A;  1ZAR A;  4AIK A;  2H6C A;  1A04 A;  2ESN A;  2ZO4 A;  4EJU A;  4IRG A;  1ZG5 A;  5L3E A;  4U0W A;  4G94 A;  1HXD A;  2O03 A;  2DO7 A;  4KDP A;  4P96 A;  2XAQ A;  1KGS A;  3E97 A;  2GQQ A;  4ZZD A;  4UNO A;  4UVC A;  1QZZ A;  1O57 A;  3CJN A;  4QWQ A;  2FEZ A;  2M30 A;  4XRF A;  4RAZ A;  3P9K A;  2HS5 A;  1H9G A;  1ZRD A;  1R23 A;  3LAP A;  2M45 A;  4B09 A;  1MJB A;  1T98 A;  5LGT A;  1UCR A;  3FF5 A;  2ZJ2 A;  2ISZ A;  3RYR A;  2ZFW A;  4YII A;  4Y13 A;  2P6S A;  3U2R A;  2F5E A;  2PLY A;  5ERI A;  2GA1 A;  5FFX A;  3D0S A;  2M8E A;  1W7P A;  2PI0 A;  2HYF A;  5K5Q A;  4BQA A;  1U8R A;  4CIC A;  2XRO A;  5AIQ A;  3M7G A;  3GWZ A;  4WXD A;  3T5X A;  3ECH A;  3R0A A;  3BJO A;  1H9T A;  1UHW A;  4M9S A;  2G7U A;  4L5I A;  4M74 A;  4TV7 A;  1K7A A;  1HQC A;  3C1D A;  5BOX A;  4CXF A;  1ZRC A;  1IZ1 A;  1C0W A;  4ETS A;  3E6D A;  5E20 A;  1U2W A;  3IKV A;  3HRS A;  1J9I A;  3MFK A;  4AIJ A;  4EJV A;  5DDG A;  4MEX F;  3PFI A;  3ISP A;  3PQK A;  3K9T A;  3BZ6 A;  2WTE A;  2MD5 A;  2O6G E;  4G9Y A;  1RUO A;  1CF7 A;  1GVJ A;  2F5D A;  4GYI A;  2D1H A;  2H09 A;  1ZRE A;  1LEA A;  1T38 A;  2RNJ A;  1IRG A;  2A5Y B;  1RI7 A;  1JHH A;  3NQO A;  4LK1 F;  4CYD A;  1FY7 A;  2EK5 A;  2FU4 A;  4Q47 A;  3CLO A;  2KRF A;  5D4S A;  2ZNY A;  5LEK A;  1USS A;  4GXO A;  2BV6 A;  3E3V A;  4XLN F;  4EJW A;  1Z05 A;  3C3W A;  3KP6 A;  2YPR A;  4L9T A;  1BC7 C;  1FSE A;  1Z91 A;  4KYW A;  5F1R A;  1FP1 D;  2VC1 A;  5HS9 A;  1U78 A;  2GWR A;  1TQP A;  3BRO A;  3OV8 A;  1S8N A;  1V4R A;  2XGX A;  1ULY A;  5CVV A;  2NYX A;  3QP5 A;  2Q2E A;  5ICF A;  2ZME A;  1W5S A;  5H6R A;  4WX9 A;  3MQ0 A;  2MLG A;  4BHP A;  3WTW C;  3WU1 B;  2Z3Y A;  1IN6 A;  1YS6 A;  2QQA A;  1T6S A;  2XAH A;  3VEP A;  1F9N A;  1TW3 A;  4LB5 A;  1R1U A;  2F5C A;  3WU0 A;  1E17 A;  3CDH A;  1KQ8 A;  1AWC A;  2LKP A;  1O7F A;  4R79 A;  3ZMD A;  4KUM A;  3BJA A;  2LNB A;  2RVC A;  5JR3 A;  3LA2 A;  1UST A;  3SZP A;  3KZZ A;  5FLX K;  4BHC A;  5L3C A;  4Q4Z F;  4IHS A;  4WCG A;  2LSO A;  2K7L A;  3HHH A;  1JHF A;  1GHC A;  4NHJ A;  2L3D A;  3TGN A;  3JTH A;  4OIR F;  1ZYR F;  2DLL A;  5CVR A;  4L9V A;  1LJ9 A;  3F8M A;  4LLG F;  3HSR A;  2HTJ A;  5E8I A;  5D8K B;  1LDD A;  3D5L A;  3MZH A;  5K1Y A;  1P4A A;  3RKX A;  2ESH A;  2MH9 A;  2EFQ A;  2FQ3 A;  3EUH A;  1YO5 C;  3SFZ A;  2GAU A;  1R1V A;  4LK0 F;  1Z6T A;  1QO0 D;  2HFH A;  2VC0 A;  5BPI A;  2PEX A;  3O2P E;  4RS8 A;  2V1X A;  3FXQ A;  4JK1 X;  4RGX A;  1S7A A;  3VOD A;  1YFH A;  2O61 A;  1O3Q A;  3C7J A;  5CJ9 A;  4M73 A;  4HV5 A;  4L9N A;  1TQI A;  1XGS A;  2MC3 A;  1FC3 A;  4M6Y A;  4AIH A;  4LLN A;  4ESB A;  5HLH A;  2V9V A;  3GZ5 A;  2VBW A;  3FHZ A;  3QPH A;  2NNN A;  1BC8 C;  1FNN A;  1F4K A;  1I5Z A;  3WE3 A;  2M1B A;  1EV7 A;  2DQR A;  4CGZ A;  3BDD A;  2P5L C;  1FT9 A;  3WOD F;  4WF2 A;  3HRM A;  1W5T A;  3RKY A;  2D45 A;  3E6C C;  1U5T C;  1MJA A;  2F5F A;  1R7J A;  3SQN A;  3ZMT A;  3GFI A;  4UVA A;  4Q5S F;  1YLF A;  3E6M A;  5CYV A;  2EV6 A;  2XV4 S;  3DFG A;  1YW7 A;  4P5O A;  2XKO A;  1Q1H A;  4KIF A;  2ZXJ A;  2FRH A;  4PCQ A;  2G9W A;  1L0O C;  3RPU A;  3G3Z A;  2DI3 A;  3LA7 A;  2HGC A;  2HKO A;  3HOS A;  3QU3 A;  4Z2Y A;  4EJO A;  2QZ8 A;  5FLX Z;  3BJ6 A;  3KP3 A;  3IWF A;  3Q9S A;  5EEG A;  2FNP A;  2IW5 A;  1FBS A;  5DYM A;  1R5H A;  2B0L A;  2P4W A;  1D8J A;  3QOP A;  3V8L A;  4DNC A;  2OAZ A;  3VFZ A;  4P55 A;  1J59 A;  1B9M A;  3MZY A;  5DUK A;  1ON2 A;  2D1V A;  4GO1 A;  4ZYD A;  4ZYG A;  1F1Z A;  4KN7 X;  5DV5 A;  3F8B A;  3L09 A;  4KIG A;  2DK8 A;  1WKM A;  4NB5 A;  4G6D A;  4WWC A;  2Z5U A;  1LDK B;  2VBY A;  4RB0 A;  4DQ2 A;  4RGU A;  4JQF A;  3R61 A;  2XAJ A;  3BOQ A;  1FX7 A;  1MGT A;  4RB2 C;  3JW4 A;  1SMT A;  3F6O A;  3TO7 A;  4YFN F;  1J7K A;  1T2K A;  1SD6 A;  5E8G A;  4U7D A;  2FXA A;  1TTY A;  4EQQ A;  3J7A O;  3K1M A;  1KQ9 A;  2XVC A;  3K69 A;  2VOO A;  2PJP A;  3U9G A;  4BAY A;  4KT5 C;  1FYL A;  3QAH A;  1U5T B;  1AOY A;  4LGW A;  1TNS A;  3V8K A;  1IXR C;  1TLH B;  3ZN0 A;  4ZYH A;  1KQ0 A;  1S29 A;  4ENM A;  1W7P D;  3FMS A;  1S6L A;  3V7R A;  4EV0 A;  1MDM B;  3IWZ A;  2K86 A;  2Q0O A;  3FX3 A;  3F23 A;  4B8X A;  5JI6 A;  3V4G A;  3L00 A;  3DP7 A;  2COM A;  1FBU A;  2E1C A;  5L3D A;  1XSD A;  1GXQ A;  3KET A;  4YIF A;  4K2E A;  2QYO A;  1OPC A;  4HV6 A;  3KCC A;  3IHU A;  4I0A A;  4MTD A;  3R4K A;  2KJB A;  1J75 A;  1R22 A;  4IJA A;  4AWX B;  4HQE A;  1HBX G;  2JRT A;  2DAO A;  4HBL A;  3JTG A;  2MBF A;  2STW A;  3IC7 A;  2H27 A;  1BIA A;  4G7H F;  3MAJ A;  3I54 A;  3QU6 A;  2DU9 A;  2EJR A;  4G7Z F;  5TRD A;  2XHK A;  4PGG A;  3HHG A;  1BBY A;  1B59 A;  4HQM A;  3RPQ A;  1LNW A;  2A3S A;  3HRU A;  4EM0 B;  4OMY A;  6PAX A;  1OYI A;  2Z99 A;  1G4D A;  1D8K A;  3I58 A;  2Q8K A;  4MGR A;  4F7Z A;  5E1W A;  3ZMZ A;  4L0Z B;  1XGM A;  4WXC A;  2UZK A;  2CWE A;  2CSO A;  4A2U A;  1O7L A;  3IRR A;  4MNU A;  5LRS A;  2HQR A;  2YX4 A;  1P2F A;  2KJC A;  3DEU A;  1XCV A;  1IN7 A;  4LLL A;  2MH2 A;  5FGM A;  2V79 A;  3F21 A;  2D2W A;  1D5V A;  2IP2 A;  1FYM A;  2VT2 A;  2GZW A;  1BOA A;  4ON0 A;  1D3Y A;  2OQG A;  4UV8 A;  2HKX A;  4KMF A;  4HF1 A;  4QLC U;  2A61 A;  5AIP A;  1J0R A;  4LB6 B;  4LG0 B;  3IRQ A;  4A0X A;  3WGH A;  2OU2 A;  1B6A A;  5D5W B;  2PMH A;  3GXO A;  3DQV C;  4KMU X;  2IA0 A;  4EJT A;  2P7C B;  3V7C A;  5HDK A;  1O3S A;  3V7S A;  3P9I A;  4I0B A;  2W85 A;  4N0B A;  3Q5F A;  4IRI A;  3WTS C;  2EA4 A;  4OIO F;  3T8R A;  4I09 A;  1KU7 A;  4N9I A;  3H3Z A;  1IXS B;  3DPT A;  4FX0 A;  5E1X A;  2YU3 A;  4Y17 A;  2JSC A;  1SAX A;  5BS6 A;  2CW0 F;  3ZP5 A;  2L02 A;  3RKW A;  2CGP A;  2J5P A;  5J8C A;  4BYY A;  1ZH5 A;  2DTR A;  2VN2 A;  1XMA A;  5L3F A;  3M1E A;  2A07 F;  5HVQ C;  2KIM A;  1SFX A;  1KA8 A;  1U5T A;  2YR2 A;  2P6T A;  1WWX A;  2QWW A;  4YFK F;  4S05 A;  3ELK A;  5J6X A;  1MDM A;  4EGZ A;  1HW5 A;  3GW2 A;  1REP C;  3JSP A;  2Z9O A;  2VOP A;  2R3S A;  3E5X A;  2CFX A;  2HDC A;  2Y75 A;  1R5G A;  1SMY F;  3GLX A;  3JSO A;  4CZZ A;  4R8H A;  2RV8 A;  2XAF A;  3QRF F;  1ZGA A;  1ZGJ A;  3QPT A;  5LRR A;  2FSW A;  5IT9 K;  5E1Z B;  2ACJ A;  3I0T A;  1HST A;  3WTZ A;  3WGG A;  3EDP A;  2BBY A;  1IN8 A;  1XCB A;  1Z7U A;  2PN6 A;  4LMY A;  1PUE E;  5F64 A;  2RKH A;  3ABT A;  5BMZ A;  2VOD A;  2AXL A;  2HOE A;  3GO5 A;  1DPU A;  1HW1 A;  1MKM A;  5DEQ A;  5ILU A;  5JVT A;  1P92 A;  1WSU A;  4R1H A;  3LA3 A;  3S2W A;  3MWM A;  2ELH A;  3F8C A;  4EGY A;  3KP4 A;  1XGN A;  1E2X A;  4OOI A;  5LEJ A;  2FMY A;  3OOP A;  3RTR A;  5LGU A;  3GFJ A;  3I64 A;  3B73 A;  3N97 A;  1QZY A;  5L3G A;  3TOB A;  1I6X A;  5D6F A;  2A68 F;  4BNC A;  2VBX A;  1QBJ A;  3FZV A;  4HW0 A;  4LJZ F;  2M5W A;  4OMZ A;  1TBX A;  2IPQ X;  1U3E M;  3GVA A;  4UXN A;  3WE2 A;  2FE3 A;  1BI2 A;  3ML6 A;  3ABU A;  4GGG A;  3HTU A;  4I2O A;  4UHT A;  5D5V B;  3F72 A;  1BM9 A;  3WTX C;  4Q48 A;  4LG0 A;  1P6R A;  2M87 A;  1KU2 A;  2ETH A;  3ULQ B;  1MJ9 A;  3F3X A;  4A0Z A;  3TO9 A;  2FBI A;  1RZ4 A;  1R36 A;  4LD5 A;  1XB4 A;  2V1U A;  5A2Q K;  1IN4 A;  2Y48 A;  3E5U A;  1K6O A;  2G7H A;  2UWM A;  1G3W A;  3RI4 A;  2OD5 A;  4OIP F;  2Y0M A;  3J80 K;  1KU9 A;  4PZJ A;  2QBY B;  4PDK A;  2ZCW A;  2IJL A;  4M9X A;  5D4R A;  2HR3 A;  4UUV A;  1IRF A;  4MEY F;  3ROU A;  1PP7 U;  2LF8 A;  1BN5 A;  5IT9 Z;  3B02 A;  4BXU A;  2WWY A;  1RUN A;  1IUY A;  2V6C A;  3TKY A;  2H6B A;  2E7X A;  1ODD A;  1ON1 A;  1ZAO A;  2UXN A;  2AS5 F;  3U1D A;  1LVA A;  4MQV A;  2DPD A;  2UXX A;  3DXJ F;  1O3R A;  1G3T A;  4UV9 A;  4HDV A;  3WTY C;  4A5N A;  4BHB A;  2LF7 A;  1IF1 A;  2PG4 A;  1JE8 A;  3G73 A;  3I53 A;  1B1B A;  4CO8 A;  5ICG A;  3REO A;  2CO5 A;  3LQR A;  1UFM A;  2VXZ A;  3BPX A;  3CTA A;  2EWN A;  3TDU C;  1FP2 A;  2IA2 A;  3I5U A;  3AAF A;  3GF2 A;  1ZLJ A;  2BGC A;  3BP8 A;  1TNT A;  1FSH A;  3PQJ A;  4EM2 A;  4ESF A;  5FB2 A;  5K5O A;  3CUO A;  4HZF A;  2FBK A;  3BWG A;  3R0J A;  4KNY A;  1OYW A;  1UB9 A;  1CGP A;  3N4M A;  4ZH4 F;  1XDS A;  2PBI A;  5ED4 A;  1BI3 A;  5D5X B;  5FFZ A;  2HZT A;  2NAZ A;  2HQN A;  4ESJ A;  1FZP B;  2X4H A;  4BH9 A;  5LHH A;  4I7H A;  1R00 A;  2K4J A;  2NNY A;  4HA8 A;  1LEB A;  3KEQ A;  1IW7 F;  1LB2 A;  3LWF A;  3CO6 C;  2QVO A;  1YW9 A;  3T8T A;  4KIC A;  2QQ9 A;  2L54 A;  1STZ A;  4XLP F;  3R60 A;  3I4P A;  2EFO A;  4ENJ A;  3DV8 A;  5A2Q Z;  2P5K A;  1R58 A;  4GCV A;  4MHG A;  1HKT A;  1OKR A;  5DUI A;  1WQ2 A;  4U0Y A;  5FO5 A;  4WXH A;  2IVM A;  4ZYE A;  5LHG A;  5H20 A;  2EFW A;  2F2E A;  4HYE A;  4G7O F;  1X3U A;  4A5M A;  1IN5 A;  1Z1D A;  2BE5 F;  3J80 Z;  1FWZ A;  1PDN C;  3NEU A;  4XBF A;  4E70 A;  3M9A A;  2NRA C;  4KN4 X;  1HW2 A;  4KFC A;  3ZQ7 A;  3ZMU A;  5ICE A;  3C18 A;  5FD6 A;  3FM5 A;  2ADU A;  3GUD A;  5DD8 A;  3FXR A;  3WTV C;  1SD5 A;  2CG4 A;  2X0L A;  2FOK A;  2PQ8 A;  2QBY A;  1Y0U A;  2DQL A;  2O0Y A;  5DCM B;  1QPM A;  2GA2 A;  1ZRF A;  2DBB A;  1BIB A;  5D5U B;  3KE2 A;  3TQN A;  1XD7 A;  1NHA A;  3RIR A;  3DKW A;  3P9C A;  2V1D A;  1B4A A;  2Z33 A;  3WTU C;  3LST A;  4RGS A;  2XRN A;  3BPV A;  5E17 F;  4ASN A;  4AVP A;  5LBQ A;  4ENN A;  4I98 B;  4MQ9 F;  1EH8 A;  3GEZ A;  4NQW A;  3TOA A;  3JAM K;  2K4B A;  1SD7 A;  1ZG3 A;  1EH7 A;  2PMU A;  4L18 B;  1WI9 A;  3GFM A;  1DUX C;  1HKQ A;  2EA2 A;  3E6B A;  2A69 F;  1ZN2 A;  1JGS A;  2XAG A;  2DFI A;  5JFR A;  2VON A;  1OR7 A;  3HSF A;  3MEX A;  5HS8 A;  3HRT A;  5LGN A;  3FMQ A;  3K0L A;  2IT0 A;  2K02 A;  2STT A;  1ONV A;  2KIF A;  2HTS A;  4EVI A;  4OIQ F;  2FBH A;  5CLS A;  2EB7 A;  3P7N A;  3RJP A;  4RB1 A;  4GYG A;  1ZHF A;  1ZG1 A;  1YQA A;  3KP7 A;  3COA C;  4I01 A;  3FM3 A;  2WC2 A;  1FOK A;  4N9H A;  4IF4 A;  2EFP A;  4FHT A;  1W4M A;  4JBA A;  1BI0 A;  1IXC A;  2XIG A;  4HOB A;  2RDP A;  4OIN F;  3VB2 A;  2RN7 A;  2VE9 A;  4G6Q A;  2VBZ A;  1RIO H;  1YW8 A;  5K5R A;  5D8L B;  4UVB A;  1HSJ A;  2KIU A;  4U7B A;  3L9F A;  4KA4 A;  1I27 A;  3EET A;  4HLY A;  3K1N A;  2FML A;  4A12 A;  3CUQ C;  2KKO A;  2WV0 A;  1PP8 F;  2R7D A;  5F6F A;  3ZMS A;  4O3M A;  4L0Y B;  3KZY A;  3LFK A;  1G3Y A;  2QLZ A;  1T39 A;  1FYK A;  2JZY A;  3NRV A;  2W84 A;  2ISY A;  4LFU A;  1G6N A;  3ECO A;  5CVU A;  4M72 A;  2EV0 A;  1J2X A;  2E7W A;  2JTV A;  2HYG D;  3IL2 A;  1K78 B;  5HOO A;  1DDN A;  1H0M A;  2CYY A;  1UHM A;  1XSV A;  4HX8 A;  2DT5 A;  1KU3 A;  5D6E A;  1YYV A;  5TJJ A;  3SHF A;  5BPD A;  2RGV A;  4EM1 A;  3T1B A;  4M6X A;  2J5O A;  3I59 B;  4O6J A;  4I02 A;  2O3F A;  5HS7 A;  4HDU A;  3L2C A;  5CVI A;  2W24 A;  3R6S A;  1KYW A;  2K27 A;  3RYP A;  2FA5 A;  2BYV E;  2CQK A;  4P9U A;  1YG2 A;  1FLI A;  2C6Y A;  5DCM A;  2GXG A;  4PGH A;  1XSX A;  4HF2 A;  2OQR A;  1TQM A;  2FF4 A;  3JAM Z;  2R7F A;  3KEO A;  4U88 A;  5BQT A;  4FT8 A;  4ENK A;  1XGO A;  2IRF G;  3DPL C;  3LAJ A;  3SXY A;  2W25 A;  1OMI A;  1G3S A;  3IKT A;  2A6E F;  1SFE A;  5HDG A;  4YFX F;  1VTN C;  3FMR A;  3HYI A;  4KIB A;  4Y15 A;  3ZPL A;  3F8N A;  2JPC A;  1IAW A;  3KLN A;  3J81 K;  1XMK A;  2L4M A;  3CUQ B;  2QM3 A;  2EFN A;  2QUF A;  2A6H F;  2XUB A;  4M9Z A;  2W57 A;  4U0V A;  1RNL A;  5KK1 A;  2DPU A;  3TDZ C;  4FX4 A;  1QGP A;  3HOT A;  2YSR A;  3FWE A;  3ERE D;  1TW2 A;  3HIF A;  3E5Q A;  2L4A A;  1ZLK A;  1I1G A;  1O3T A;  2IA1 A;  2QEN A;  3T0Y A;  4H0E A;  5ICC A;  5DD4 A;  2XAS A;  2FNA A;  1B9N A;  4IRH A;  2JT1 A;  2RQP A;  1SFU A;  2O8X A;  2JPB A;  3WTT C;  1Z6R A;  4WK8 F;  4HX7 A;  1YTY A;  4L9J A;  3BY6 A;  1QQI A;  3V8J A;  2P7V B;  1XDU A;  3EYY A;  1J5Y A;  2OA4 A;  4RGR A;  1BI1 A;  4D0P A;  5EEH A;  4G8X A;  2E1N A;  3VOE A;  4ZZL A;  2XKP A;  3KLO A;  4P9F A;  3F22 A;  2MA3 A;  2ZKZ A;  3H3U A;  4RB3 C;  1DPR A;  2VE8 A;  3MCZ A;  3LQQ A;  2P8T A;  3L7W A;  5HLG A;  1LDJ A;  3W6K B;  2L01 A;  3KFW X;  1LQ1 A;  4S04 A;  5L3B A;  4HAM A;  3F8F A;  1T0F A;  5HDN A;  1FBQ A;  4A0Y A;  4AD9 A;  3H92 A;  1K78 A;  4OU0 A;  4RAY A;  1MD0 A;  3K1P A;  1XN7 A;  1F5T A;  3O3K A;  2GXB A;  4IVN A;  4IXA A;  5LHI A;  5ILV A;  3WG9 A;  1W7P B;  1FPQ A;  3FXU A;  1U6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...