2UUZA

Orthorhombic crystal form of gams from bacteriophage lambda.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
89
structure length
89
Chain Sequence
RLEAQSWARHYQQLAREEKEAELADDMEKGIPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords HOST-NUCLEASE INHIBITOR PROTEIN GAM
publication title The Crystal Structure of Lambda-Gam Protein Suggests a Model for Recbcd Inhibition.
pubmed doi rcsb
source organism Bacteriophage lambda
total genus 40
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06064 Gam Host-nuclease inhibitor protein Gam
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2020 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2uuzA00
2UUZA 2UV1A
chains in the Genus database with same CATH superfamily
3S93A 1AKHB 3JTGA 2X0LA 3JRHA 2LF8A 3GTOJ 4DZJA 3OYJA 2O8XA 4XLNF 5K5QA 2NVXJ 4PFPA 2XF5A 2MH2A 1Z77A 2R92J 1FLIA 3WGGA 3H3ZA 2W00A 4G7HF 1ZHFA 5F0CA 2XPWA 2VBZA 2XDVA 2R5ZB 1Z3YA 2EFQA 3HYIA 1B8IB 1D1CA 3ZQQA 4KYWA 3PIOF 1XSVA 2W82A 1K6OA 1P4WA 4YEJA 1W5SA 3ROUA 1IRFA 1FYLA 2ZFWA 4Q47A 3CUOA 3CESA 5J1YA 2YU3A 4BJ5C 1O3SA 1HOMA 4HAMA 1EV7A 5CVUA 1AWCA 4YFNF 4AM3A 2DOAA 1G4DA 4FE4A 4ZDPA 3I9V2 3NRVA 3BR6A 3LSHA 1R1VA 1SD4A 3M07A 2HNHA 3OYHA 2PEXA 3CZ6A 1ZREA 2LKSA 2CW8A 1BI0A 2L7ZA 2GOMA 5JVGF 1OYIA 3CDIA 2MLKA 1IUFA 3WGIA 2OA4A 1R1UA 3T0YA 2K4JA 5C44J 4EM0B 1J59A 2OTJI 3RKXA 2AQFA 2A68F 3FMRA 2BXYA 2QKMB 2CG4A 2RNGA 4UV9A 2OBPA 2JRTA 2Y2ZA 4LG0A 4PGHA 3BCBA 4I6ZA 5GP9A 1TWAJ 2E5NA 2ETHA 3HSRA 5FKNA 3H3VK 5CJ9A 1RIOH 3HB9A 3SHFA 1PUFB 2CGPA 4CHUA 1RC9A 3HRTA 3H92A 4I0BA 2HZDA 1YRNA 3M8JA 4HLXA 1MDMB 5FLXK 5FKLA 3PFIA 1X1PA 3O6BB 4FHTA 4C2TA 1X3WB 1MSEC 4XSXF 3S17J 2DT6A 2UXXA 4HSTA 4IRIA 4XLFA 1HW5A 1XN7A 3SFIA 2VLAA 2MC4A 1H8AC 1KQ9A 3G1OA 1J75A 1YOVB 4L0ZB 1S7EA 3PFYA 3M7GA 4A5NA 5GADJ 3F6VA 2Y9YA 3M1EA 1VQ7I 4EJVA 2CWEA 1SVOA 3QRFF 1S9HA 2IA2A 2JSCA 4LFUA 3VYUB 3VYSB 3ZMZA 3O2PE 3CCJI 2JA5J 2OF7A 3J7YJ 4G6TB 5HVQC 1UCRA 3ABKH 3LSPA 4IHSA 3RKQA 1PYVA 3G2BA 4XBFA 1FOKA 3RIRA 2JMWA 4AYBN 4KN7X 2HYJA 2Z33A 2DQRA 2EFWA 3HKZN 3ZMUA 2OQRA 4RMNA 3F9KA 1H9TA 3ZQCA 1S72I 4R8HA 1R36A 1MMSA 3MN2A 2I5UA 3K4KA 3BCAA 2IGMA 3BZKA 3K2ZA 4JQFA 3JRFA 2NRAC 5EF6A 3ZGKA 3BR0A 2VOPA 1K6YA 5AONA 3LAPA 2EILH 4HYEA 1SFKA 1IN8A 3K4LA 2DCEA 1ITYA 2ISZA 3KCCA 1W0UA 2EWNA 2IGOA 2LK2A 1E2XA 3CQZJ 5CPRB 4BKXA 5D5WB 5D4SA 4JX4A 1BIAA 1FBSA 2NNNA 1J2XA 3DPUA 4XONA 1MMDA 2L7MP 5E3NA 4B4CA 1N25A 1U0JA 3CC4I 4BQNA 1LVKA 1YW8A 2PN6A 2G0EA 2QGUA 2QBYA 1KONA 1Y8RB 4KITB 3OYFA 2FBHA 5J6XA 1VQKI 3T8TA 1XG1A 2W7NA 3MFKA 1OYYA 2J5PA 5EG0B 1OCZH 2KRCA 2Z3YA 3C1DA 1YRNB 1SFOJ 2QQ8A 4M71A 1FWZA 5AIQA 1Z6TA 2M34A 3EUKL 5K7ZA 4J00A 2HDWA 4KFCA 3W2VA 3WODF 4S05A 2XASA 3KP2A 4CCLA 2QSFX 3MVPA 3CP2A 1GDTA 5E1XA 4RB0A 5BQTA 1NG7A 1R4NB 4L5IA 4XN0A 1ZGJA 2XAHA 3O8HA 3HOTA 2DFEA 1W7PA 3ABLH 3K1NA 3KP5A 2X6XA 4I76A 4PJNA 1I5ZA 1PVEA 5LFAA 2R7ZJ 2Y48A 1R4MB 3HDDA 4A3LJ 2VQLA 1FP2A 1RESA 3VSLA 3GZ6A 3BR1A 2OZ6A 4XIDA 2HWVA 1P7JA 2PX9A 1FMWA 2XUBA 2ZO4A 1XGOA 5B1BH 3X2QH 1LNWA 2FBKA 2B9SA 2VBYA 3S14J 1DUXC 3H5RA 4HQEA 2E7XA 2DFFA 2HKXA 2VASA 2X48A 3GFJA 3V8JA 2CO5A 2Q8KA 3RQIA 4KDPA 3BWGA 3WE2A 2L9SA 2H27A 1TZLA 2BW3B 1X1AA 2HI3A 3OIOA 2LY9A 1RZ4A 2P8TA 5KAFC 2M4GA 3I5UA 2X6WA 3PQKA 3Q0VA 3ABTA 2GA1A 3M8EA 4FCYA 3D1NI 1TL8A 1EJ9A 2Z9OA 1Z21A 1I50J 1O57A 3GFMA 4CCKA 3GTGJ 4D9JA 1TBXA 4RAFA 3OWTA 3GLXA 2QWWA 2CQXA 2L9NA 3IC7A 3BC8A 1HKQA 2VPRA 2HQ5A 1LDJA 3TEDA 4CZCA 2E60A 4E7ZA 1RR7A 4HNVA 2FXAA 5ICGA 2WTEA 1HC8A 1Y0UA 3KEQA 1J7KA 3L2CA 2CV0A 3C2GA 3AG2H 1FIPA 3ZQLA 2OJED 2E1NA 2ZMEC 2VT3A 2FA5A 2X9DA 3BTJA 3IKVA 2OAZA 2OPTA 3OYKA 3KZYA 2EINH 3ONQA 1J9IA 1V55H 4WXDA 4PGGA 4IRHA 1SD6A 3GEZA 3HOUJ 1B6AA 2KFDA 3OYAA 4JX5A 4M3BA 4L5EA 1W7PB 3HOXJ 3OYNA 4ZDOA 3K6GA 2ZXWH 2IVMA 1IXSB 3WTZA 3FXLA 5JVTA 1JJ6C 3FXOA 3C7JA 5IYDJ 1TQPA 5GAHJ 2VXDA 1KGSA 1D0YA 4ENKA 1O4XA 2PJRB 1LEAA 1SD7A 1TP4A 1ZG3A 2NVYJ 3L2VA 1N77A 2O9LA 3CLOA 2BOLA 4CYCA 1ETXA 1OCRH 4XRFA 3CUQA 4BAYA 1JJ8C 4ZDLA 4RAYA 1OCOH 2D5VA 3W2AA 6PAXA 3ULQB 2E35A 4OIRF 1YHQI 4HBLA 2IBDA 4Y17A 4UUVA 2RVCA 3OMYA 2R7FA 1XSDA 3DEEA 2FMLA 2V1DA 2JZYA 2M3AA 2WAQA 4D1QA 2CUEA 4CCNA 2LRDA 2DFIA 3N05A 2HDCA 4LB5A 1OYWA 1D5VA 2VB6A 5JLWA 3Q3SA 5GTHC 1GV5A 2QF7A 1U9OA 3QU6A 1TWFJ 4CICA 2MLGA 1WH5A 4AUXA 3KP6A 2DFHA 3EQLF 3I56I 1Y6IA 3ZQFA 1Y0NA 3FISA 2OD5A 5DD4A 5J40A 1MW7A 3HUGA 1G59A 1R23A 2DO7A 3GVAA 2ZB9A 1L0OC 3FXKA 1WJCA 4FISA 3K0LA 3GUDA 2GLOA 2KQRA 3JAMK 3A0BC 1ZR2A 2IS4A 4EMSA 3KEOA 1TWHJ 3SEQA 4OIOF 2DT5A 1YI2I 2JA8J 3DKWA 5JHUA 2O3FA 2R4GA 3K10A 4O6JA 1KQ8A 2YUSA 3KLNA 1O7LA 4G6QA 3S1QJ 3OR2C 2Y0MA 4BQOA 9ANTA 3J7ZI 2NS8A 2QCOA 1FTTA 3C3WA 5E3MA 3E0JB 4Q48A 3IL2A 1JKOC 4HEA2 4GXOA 4KT5C 4KT6A 4PJMA 1T56A 1LPQA 2EFOA 2QM3A 3DPLC 5CYVA 1BI2A 1JHFA 1DGWY 5F08A 2K85A 2EB7A 2K40A 2D45A 3LSKA 4WK8F 4P9UA 2RQPA 3H35A 1P6RA 3GLLA 3CUQB 4HNUA 1BA5A 2PMZN 1JGSA 4JK1X 4LG3A 4N4OB 1HDDC 1D5YA 3LSMA 2R93J 2GAUA 5ILUA 2MYSA 2LLKA 2HU9A 1LB2A 1W5CC 5B66C 4D7NA 2QKLB 1T0FC 1IV6A 1ETYA 1D0ZA 3B6CA 3E7LA 3DTIA 2HR3A 5IP7J 1IG7A 3JRBA 2KJBA 3GTQJ 3MKYB 2ADUA 1Z6RA 1STZA 4U7DA 2XRLA 1V5FA 4IKFA 2V7FA 1AOYA 4ANJA 2A61A 1ONVA 2OU2A 1FX7A 2H1KA 5FFXA 4FASD 4XICA 4W1UA 1KYZA 2IEKA 3LSGA 1REPC 3TP0A 2VBWA 5EEGA 3KYLA 1F4KA 5A2QZ 1TNSA 2ELHA 1VQMI 3KZIC 5LLQA 2GXAA 3SDBA 1SC7A 3TOBA 4IRGA 1YIOA 3H36A 4PZJA 3WTUC 2YSRA 5F6FA 4HPQA 2E2IJ 4A6DA 2M45A 5F04A 1X4OA 5GAEJ 1X3ZB 3U1KA 2OTLI 5E17F 2KL4A 4F91B 1FNNA 1Y8QB 2DI3A 4I0AA 1WSUA 1RI7A 3I4MJ 3SFZA 2CFXA 5K5OA 1JTXA 3V8KA 2CH0A 1EH7A 3O8GA 4HRIA 1X1BA 3AFHA 4L0YB 2HGCA 3PUBA 2Y0SA 3EDPA 1IXCA 2O7OA 2L7FP 2WY7Q 4NBQA 3L2RA 2DXIA 4C2UA 3HC7A 5ED4A 5D8LB 4S04A 1YO5C 1VQ5I 2H8RA 4U88A 1FIAA 3E1SA 2NVTJ 1HLVA 4A3KJ 1T0FA 2KIFA 4J01A 3TKYA 2YPRA 3CDLA 2ELKA 2VJ4A 4ESBA 3S1NJ 3R0JA 2XGDA 2KZVA 2M30A 4HX4A 3I4PA 3MKLA 1JHHA 4ENNA 5C4JJ 4M9SA 4UB8C 1I27A 1KU2A 1OISA 2H09A 2F48A 2X6OA 3RPQA 3JRDA 1TC3C 3E6BA 1NHAA 5HOOA 3RPUD 3WU0A 2PG4A 4ON0A 1HSJA 5E3OA 2P4WA 4M9XA 4ZH4F 2Q0OA 3HTSB 3L9FA 3JRCA 4GYIA 1DPRA 5EZGA 3ZXSA 3FM5A 3L2QA 3E97A 4QLCU 1JGGA 1YW9A 3OYDA 1TW2A 2EV5A 1Y1VJ 1WQ2A 2Y75A 1D0XA 1OCCH 2IGNA 3P9IA 2OV7A 1HBXG 4EJTA 3K1PA 5KVRA 4M3GA 4BBRJ 2R5ZA 1PP8F 3K9TA 5E18F 1HF0A 1ZELA 1O3RA 1S6LA 2Z5UA 3PJRA 4Q5SF 2KIUA 5D5VB 1EH8A 4Z2YA 1QA6A 3S3MA 1U2WA 1OR7C 2IW5A 2YX4A 4B43A 2BZTA 4MLOA 2Q1ZB 3CCLI 3DWLE 2R7QA 1XDUA 3HOWJ 3RYPA 4B09A 4MNUA 3ZOBA 2M9HA 2P5KA 3GFLA 4XR6A 4II3A 2R0QC 4A12A 3PO3J 1LKXA 4BE2A 2D1VA 3ZRGA 3H9JA 3REOA 3VYTB 2AO9A 3J81K 4CCMA 1G3SA 3KYCB 3MD2A 2QQAA 2ME0A 5CVIA 2XPVA 4ZJZA 3I53A 2VC1A 2DOFA 3EUHC 3H0GJ 4A0XA 1QBJA 3W6VA 3CMMA 3COAC 2FD5A 2MGQA 3Q0WA 4F93B 1PUEE 3I64A 3N97A 3HIFA 4J19A 2EZLA 1WRJA 3JRIA 1CQTA 3M9AA 2LVSA 4EM2A 4Y4RA 2K3FA 3HPHA 2DJNA 1MJ9A 1FSEA 4L9NA 5IYCJ 3G6EI 3OV8A 2FF4A 4RA2A 4CCJA 1MDMA 3OR1C 3DKXA 4BUPA 4YFKF 4FX0A 2ZSHB 2W1OA 3ZQ7A 5C3EJ 2A5WA 1PDNC 1BBYA 1MH3A 4GYGA 4Z6YA 1IXRC 1TW3A 3E5QA 1MJBA 4XLEA 5CVJA 3J80Z 3I59A 4MQVA 4S0HB 1FC3A 5F1JA 2F5FA 5HLIA 1XC5A 2XAQA 1S29A 4ENMA 2QYOA 1X4PA 1ZARA 1OR7A 2HZTA 4GRIA 3V8LA 2VT2A 5F64A 1FJLA 1SANA 2VONA 1YG2A 3LNQA 1F1ZA 3M4OJ 4E7SA 3GTJJ 3OY9A 4HW0A 4I7HA 2L2OA 1KA8A 4IXAA 4NC8A 3FK7A 3DP7A 2DMTA 2ID3A 2L9VA 2Y69H 3K4JA 4LJZF 2HQAA 1APLC 1RKTA 1A36A 4D5FA 3LQQA 1B4AA 4ETSA 4A6EA 2A6EF 4YELA 4M74A 1Y39A 2B7EA 1RETA 3PSFA 4HLYA 5IP9J 2E1MB 2KPMA 3EUHA 5KHDA 2JA7J 2E19A 4Y52J 4KIBA 1J0RA 3IRQA 1ZAOA 1KU7A 2HOTA 3CJTB 2DA6A 3RKYA 5ILVA 1Z1DA 2C6YA 1K79A 3LFUA 4BQAA 4V19K 4MGRA 3R61A 4HG2A 1IN4A 5LHHA 4X1EA 1U5TB 2KMUA 1LVAA 2BE5F 3F6OA 2CW0F 5L3GA 1MMGA 2EH3A 4BS9A 1B59A 2MW8A 1A5JA 1QHHD 3CCEI 2DT7B 5FO5A 4UVBA 4IOAF 5IT9Z 5CLSA 1XGNA 2R7DA 2VJJA 3M1CA 2YS9A 1SEUA 4Y13A 3GCMA 1KU9A 2I8DA 5LHIA 5M5YJ 1WCMJ 1ETQA 5EG0A 5J4VA 4EATA 1R58A 2L54A 4HSRA 1VI0A 2EIJH 3KP7A 4A93J 2O61A 3RCOA 2HOEA 2PJPA 4MTEA 3K69A 3GW2A 4I2OA 1R7JA 3KLOA 3I59B 3S2HJ 5LGNA 3OS0A 2WY8Q 4KA4A 4JYKA 1V3FA 2E5ZA 3FK6A 2DA5A 4R1HA 3K7AJ 3NAUA 3CCQI 2PQ8A 2GOXB 3LAJA 1QPIA 1OQYA 2L4MA 3DBRB 2VE8A 4GDFA 4AIHA 1IGNA 5BPIA 2NNYA 2CW7A 2V4JC 1FOXA 3HZJA 3PL8A 4PK4A 1FPQA 2EQRA 1YW7A 4P1WA 3AG3H 2VE9A 2DW4A 5FKMA 2GXGA 5LRRA 2HDDA 2WBMA 3SZTA 1ULYA 2Z16A 5EGOB 4F52A 1MNMC 2MABA 5FRMA 2JPBA 2R7UA 2DLLA 3IRRA 2V26A 3ZQIA 3A1YA 3MZHA 2F5DA 1BI1A 2ZJRF 1R5GA 4AU7A 3CTAA 4XNFA 2DN0A 2V6CA 2GIZA 4UV8A 3ZPLA 3BJ6A 2ZFUA 2EA2A 4MTDA 2BW3A 1G3TA 5A2QK 4XLCA 2IA1A 1QGPA 3E3VA 5LHGA 4EQQA 4C3HJ 4C9YA 2EZIA 5BPDA 1U9NA 1YLFA 2EBIA 2F5VA 1YS6A 3OYLA 2KJCA 3SZPA 3LSRA 4P96A 3VOEA 2JWTA 4CSWA 1UELB 1JTYA 3FF5A 2AQEA 2R7OA 2JVGA 4YIIA 3QQAA 2DU9A 3WU2C 2TRTA 1ZRCA 5J8FA 3OYMA 1WJDA 4FX4A 2YX7A 1DP3A 1H89C 3GZ5A 5LRSA 2XROA 3OOUA 2ZXJA 1XX5A 5KK1A 1SMTA 2JK3A 2K5CA 3LWFA 3QPTA 5ERIA 2K4BA 1FEXA 5LGTA 5B5EC 1IDYA 2VKEA 1M1EB 2BGCA 1Y56A 2K9QA 4PJLA 2CSOA 1Z0XA 1LFUP 5DUIA 4XLAA 4C3IJ 1Z05A 4BJTA 2GA2A 1IAWA 3TDUC 1UB9A 3VODA 1BJAA 2YR2A 3VPRA 1O3QA 1WJEA 3G71I 4P9FA 5H6QA 2BHZA 2Y31A 3BR2A 3G73A 3AAFA 4L9TA 4NB5A 4IHWA 3JREA 3BZCA 3B73A 1WVRA 1Z91A 2AXTC 4XOTA 2V9VA 4IHYA 4B3XA 4FTHA 4Y33A 4AVZA 4PUSA 1FBQA 2PJRA 4PSWA 2KZGA 4A0ZA 3NEUA 3JR9A 4JOMA 1MGTA 4CA0A 3E6MA 2HTJA 1SVLA 2LY1A 2P7VB 3TOAA 3TO7A 4E7HA 2CQ7A 1SAUA 1S3JA 2YU9J 3CC2I 2ICWG 2G7HA 2A07F 3R6SA 3OYGA 1I1GA 4ZTJA 4L9JA 4V2GA 2HFHA 4IQJA 1ZQ3P 4K2EA 4E6KG 2LD5A 4OAZA 1E3HA 1FYMA 4QPQA 3Q5FA 2QQBA 2A6HF 3KZZA 3I4NJ 3FMQA 3WTYC 4IHTA 5TRDA 1MIJA 1XCVA 1BN5A 3JSOA 3CUQC 2E34A 2RGVA 5J4YA 5D8KB 5DS9A 3SEZA 1FT9A 1QZZA 2A69F 2KHMA 2FRHA 3I58A 2G9WA 3ZQHA 1XSXA 3GX4X 5BNGA 2OCEA 3Q9SA 4U7BA 1GVJA 4AWXB 3HOSA 1UHWA 2CFOA 4NNJA 2STWA 2P5VA 3E5XA 1W1WE 4L9VA 2VJ5A 1F43A 1GUUA 2XHKA 4ABZA 3V42A 5FROA 1A31A 1O3TA 5IOZA 4RDUA 2Q2EB 2GBYA 2W25A 1Z3XA 2LH9A 3GTLJ 4YIFA 5LBQA 1B9MA 1ERDA 1K83J 1IJWC 3OIPA 2HPMA 2XSDC 3A02A 2IP2A 2OC6A 2CUZA 1MMAA 2HYGD 2R3SA 2IRFG 2DDBA 2AS5F 1EF4A 3IP4B 5L3FA 1RPWA 1HKTA 3KFWX 3S2WA 2DPDA 2OCCH 2M4KA 2VIXA 4ZYAA 1HA8A 3AKZA 1IN7A 2KIQA 1RRJA 1DU6A 3TW6A 1JT6A 3E6DA 5FD6A 3WTSC 3T1BA 2WB1N 4G94A 5BMZA 1ZGAA 3J80K 3MEXA 2M0CA 2M0MA 1ZG5A 1WWXA 3BY6A 3F72A 5DCFA 1JKQC 1S8NA 5E79C 2PFBA 2XIGA 2VXZA 3K2AA 3PSIA 4A3IJ 5IY5H 1KU3A 3ZCOA 3ZR8X 5EEAA 1ZG1A 3DLAA 4ZZLA 5EDNA 3QU3A 4N0BA 1SAXA 1DP7P 1ZH5A 1ETKA 3LQRA 1TQMA 3CCMI 4AIJA 1TT5B 4IO9F 4PSXA 3S8PA 2FJ1A 3WTXC 3WHCA 1OPCA 5FLVA 3VWBA 4HNTA 4I09A 2CQQA 4CXFA 3EYYA 3KETA 4LLLA 1D1BA 1JT0A 3TGNA 3GTMJ 1HQCA 4AVPA 3DU5A 5L3DA 3U1DA 1P9QC 2L4AA 4OIQF 3MAJA 5K5RA 2DA7A 2XGCA 2LP0A 2LSOA 2UZKA 4ESJA 1YS7A 5HODA 2P7CB 4M6YA 4B3AA 4E70A 3MCZA 2BVLA 4U0YA 2EZHA 1LFPA 1YYVA 2BBYA 4W97A 1BC7C 1H9GA 1XDSA 4L18B 1UHSA 1ZK8A 3FXRA 3IAS2 3WU1B 2XC7A 2WA0A 5D6EA 2W48A 1V5GA 4WX9A 1F36A 2Y9ZA 3HHHA 1VQPI 3D0SA 2IPQX 3BTLA 2WV1A 1BR1A 2F5EA 1W36D 4XQFA 1MSFC 3CCSI 3BG9A 3RJPA 1ODDA 1Z7UA 4BDYA 5D5UB 2RDPA 1R6RA 4KMUX 3IUOA 3QP5A 5F0FA 3IV5A 1LJ9A 2QUFA 3BR5A 2XPUA 1DQUA 3JTHA 2XKOA 4M73A 4UVAA 4BBSJ 1WKMA 3G1MA 3HHGA 2ZNZA 4DGWB 2DYRH 4A69C 3OL3A 3DBLB 3QYEA 4QSHA 5DDGA 1SFUA 5DCMA 4M9ZA 4XKCA 1ZLKA 1BJZA 4RB2C 2XKPA 4HZFA 1T33A 5J1UA 2M8GX 1YITI 1C0WA 3GF2A 4QPOA 1WJBA 2PBIA 3CJRB 1QPMA 2PMZA 3V7CA 2HVQA 4KISA 2KDOA 1GLNA 2A05A 4RB3C 4BL0B 1OLTA 5LD2C 3PUFA 1OMIA 4DOZA 4UNOA 2F4OB 5LEJA 2DA4A 4G7ZF 2CV1A 3FZVA 1QU3A 2RQQA 3K4MA 3F3XA 1AU7A 2GXBA 1TWGJ 2VKDA 2NOJB 1P7IA 1F5TA 2JN6A 4XSZF 4DQ2A 3U9GA 3FXUA 1B72A 2J5OA 4Y3OA 4CUGA 1BOAA 2DA2A 3HRUA 2ZXHA 4M3FA 4UUSB 1U6GA 4BACA 2LBFB 2JUGA 3H0DA 2AHQA 2HXIA 3D5RC 3HL2A 3B6AA 1D8JA 4XN3A 1GT0C 4HDVA 4IZZA 3TO6A 2FSWA 1ZTRA 3CP8A 3DF8A 2XGEA 2K02A 4OAYA 1X19A 1G8XA 1SVMA 2LR8A 2PMUA 5E1WA 4R79A 3CCVI 1NTCA 3HPGA 2W24A 3CO6C 3HM5A 2ID6A 4EM1A 1IF1A 3LOCA 4QIWN 4I02A 2DK8A 1B9NA 5D6FA 2W4SA 4AC0A 1S7OA 2DODA 4ASNA 4G6DA 4N4NB 4HDUA 3UNGC 5GPCA 5HNFA 2MA3A 3LA3A 5FD5A 2CV2A 1UG0A 2LREA 3PNVA 2QSHX 1KQ0A 2E1MC 3IH3A 3DXJF 2DK5A 5BS6A 4PDKA 5CKTA 5DCMB 4CCOA 1WJ5A 2ZNYA 2W85A 1G3YA 2DMPA 4BXFA 3JRGA 1W5TA 4B44A 2E1OA 4IF4A 5HLTA 1IDZA 2KIMA 3S32A 3TQNA 1FY7A 3I55I 4CGZA 1U5TC 1IRZA 5J8CA 4DBQA 1QNTA 3I0TA 1I39A 1JXSA 1LDKB 1BR4A 4Y15A 2L5QA 1T2KA 5FJ8J 3HRSA 2O8KA 2Z99A 2K9NA 1FTZA 4BGDA 5EEHA 1PJRA 4EJOA 2FMYA 2O5RA 5CQEA 3W6KB 4LOCA 3DTKA 1KZHA 3F8FA 4HF0A 4ZYEA 1RR8C 1JE8A 1GXQA 1POGA 2K9MA 1TQIA 2ACJA 5F27A 2XF6A 3BG6A 3I3LA 3RI4A 1X1DA 2EIKH 3OYBA 2R7RA 3V7SA 1B72B 4XORA 1HDPA 3GO5A 4E7JA 3HSFA 1NK2P 3WGHA 4I99C 2P0WA 5ILSA 1SFXA 5DV5A 1O7FA 3QOEA 4XL9A 4E7LA 2WAEA 3WTVC 2VBXA 4LIVA 4IPAA 2BY1A 3S1MJ 4HX7A 1XS9A 2IA0A 3BR3A 1FYKA 4A3GJ 2NVQJ 4XKWA 2XRNA 3RSNA 2RNJA 4CO8A 3KP4A 1E0EA 3FXQA 3I71A 1QQIA 5E8GA 4KNYA 1U78A 3KX2A 1BM9A 1X2MA 2ELJA 1TT0A 3BG5A 4XRMA 2GIVA 1ORKA 4UY8I 1ON2A 5KCMA 2R7XA 3S3OA 1D3YA 4EV0A 1CF7B 2P81A 3C2HA 1OJLA 5E20A 2FQ3A 2BY0A 1ZR4A 2DQLA 5M3MJ 3E5UA 3ESWB 2HVSA 3BOQA 4RM3A 4IX7A 1WHUA 1U5TA 2ZSIB 3D5SC 1FZPB 4RGRA 1VQNI 1MBKA 2LY2A 1HKSA 1LE8B 1MH4A 1R9TJ 1FMVA 1GHCA 1YJWI 3RTRA 2CQNA 2M1BA 3BT9A 4HF2A 5DM7F 1USSA 2F6CA 3CCRI 4GGGA 5BOXA 2D1HA 2DTRA 4N9IA 3AL0B 2BY3A 1W7PD 5KNLA 2VC0A 2IS2A 2TDXA 3BQZA 1DGRM 3J7AY 2IGKA 3GTKJ 4CYDA 1USTA 3ERMA 1MBFA 1T98A 3DBHB 4X6AJ 4KJZA 4ESFA 3DKYA 4L5JA 2DBBA 3L09A 4WXCA 5CVVA 3N4MA 3S15J 3VB2A 3K70C 5AIPA 1AA7A 2F4IA 3IKTA 2R7TA 1XTAA 3LSIA 3ZP5A 4ENJA 4M6VA 1IUYA 3DFGA 1IN6A 3HXLA 5CVRA 2CRGA 4NDLA 4LIUA 1VF9A 3F8BA 3OSFA 1IC8A 3ELKA 3I54A 3HBLA 1G2HA 5FKKA 1E3PA 3DTEA 2CUJA 3FXMA 1WH7A 5HS9A 4RS8A 4JBAA 5EGOA 1VZ0A 4BY7J 3BTIA 3L1PA 1G6NA 2FE3A 1JUSA 5DTDA 5EJCA 4BHCA 2NS0A 2AXLA 2ZC2A 5H2FC 2VI6A 3HG9A 3IH4A 3CJQB 4XLHA 2QEXI 1BL0A 4IJAA 3TMOA 2V9KA 4G12A 1YIJI 4I01A 3EYIA 2DTZA 2FNAA 1A6IA 1IW7F 2F2EA 4U0VA 4XOPA 1VQ9I 4EGYA 2V79A 2BEOA 1WFXA 2LFBA 2V1NA 2MD5A 1T08B 2K9LA 2MBFA 3KYDB 3QWLA 4PJJA 2E2JJ 1UHMA 1MBHA 1MJAA 3SXYA 2XGXA 3VFZA 5ICFA 3TP3A 2CYYA 4WXHA 4B1RA 1UAAA 4EVIA 1NH3A 5HDNA 1HW2A 3A03A 4AIDA 1JI8A 4HX8A 4ZYHA 1MZBA 2EIMH 3VDXA 1YFHA 3RKWA 3ML6A 5L3EA 5FB2A 2VQCA 5HS7A 4LITA 3RYRA 2JSPA 1T8IA 1IO2A 2K86A 4XM3A 1MD0A 3DU6A 3KEYA 3A01B 2M2EA 3T5XA 4F92B 1Z7LA 2LYCA 1LDDA 4G7OF 1EH6A 1D1AA 4NUBA 3JAMZ 2LKXA 1XB4A 2ME6A 2ZXIA 2LC2A 4G8XA 4Q4ZF 3WTWC 1U3EM 5E8IA 2JPCA 1I6XA 5K7HA 4ZYDA 4OOIA 1R71A 1RKWA 2HS5A 3DEUA 4IHXA 2H8WA 4G9YA 1T38A 4LLNA 1MBGA 1SD5A 2NVUB 3L7WA 3BG3A 2L9RA 3QPSA 4A2UA 1DU0A 1ON1A 4X0GA 1E17A 1QHGA 1TLHB 4KIFA 5HNHA 1U8BA 2IT0A 4M72A 2JUCA 1JKPC 3S3NA 2WADA 3BG7A 3IH2A 1VQLI 3LL7A 2R7WA 4PFOA 2JA2A 3QYBA 4E7IA 4XKVA 3T8RA 4ITVA 2VODA 1QZYA 1G3WA 5HLHA 4LGWA 4XLPF 1MBJA 5D4RA 2RKHA 1ETVA 1R49A 5F1RA 1VQ4I 1P4XA 2HQRA 5FFZA 1ENHA 2EV6A 2H94A 4AYBA 2X4HA 4BYYA 2JVHA 4EEFG 2ECBA 2QENA 1HCRA 2PI0A 4JP0A 3H3UA 1U8RA 3HKZA 1ZKGA 3WE3A 1TTYA 3BLYA 3QOPA 4IL6C 4BDZA 3CC7I 4XKBA 4E7KA 1ZYRF 1FOWA 4DBRA 3RPUA 1IN5A 4MEXF 1I3QJ 3H1CA 3S16J 1R1TA 5IPAA 1X2NA 2A6TA 1B1BA 2B0LA 3CJNA 3HOYJ 2IAIA 2X1DA 3FKIJ 3FXJA 2L01A 2STTA 4II2A 2BY2A 3FIWA 2N8GA 4A5MA 2L02A 4MIMA 5FKOA 5DUKA 2KLOA 1BC8C 2E2HJ 3OYEA 2CJJA 3Q0UA 4RLFA 2L0KA 2O0YA 2ZKZA 2JT1A 2L7KA 3R0AA 3ZN1A 4LMYA 1ETWA 2FU4A 3G3ZA 4RLQA 2Q2EA 3RZOJ 4BE0A 3FHNA 1WJAA 3BJOA 1BW6A 1XMXA 2D2WA 4F55A 2X1EA 2JQ7A 5ICEA 3PM1A 1JKRC 4HF1A 2VKVA 4LG0B 2V9PA 2HOAA 3IAM2 1QZEA 2KISA 3GWZA 3KE2A 3HOZJ 1MNEA 3SYTA 1ZN2A 2VPLA 4YFXF 2X6YA 4LK0F 4DYQA 4JX6A 3Q9VA 5HDGA 3IHUA 3LFKA 2HXOA 3IWFA 1UG2A 5EYRA 3K4NA 1A35A 1VQ8I 5JHFA 2DMNA 3IWZA 5C4XJ 3F23A 4HA8A 2FEZA 1N75A 4RAGA 4UHTA 1S7AA 1A04A 1MMNA 3DQVC 2OUMA 3GBGA 1QRYA 2DOEA 3EETA 3HRMA 2HTSA 4U0WA 1BIBA 1VQOI 4B48A 1Q1VA 3HGGA 3JW4A 2LNBA 1NK3P 2FNPA 1I3AA 3CMYA 2LMDA 1XGMA 3CCYA 4RBOA 4QTRA 1UZCA 2PLYA 2M87A 3P5JA 1LFBA 3QPLA 3A4CA 2BHYA 2KRFA 3U2RA 2HQNA 3VEPA 1D8KA 3OL4A 4IOCF 5HS8A 4MEYF 2QVOA 1W4MA 1AHDP 3TW7A 4UXNA 5GTIC 2DA1A 2DA3A 2NYXA 2QZ8A 2RREA 1ACIA 3S2DJ 5J1RA 3B02A 2XVCA 5K1YA 4UVCA 3OOPA 4M6XA 3CMEI 1ZRDA 4FETA 4BXUA 4P55A 2QQ9A 3V7RA 2CU7A 2I10A 3H5AA 4XMYA 2RN7A 4UUTA 1Y1WJ 3ABUA 1LEBA 3FBIB 3TBIA 1N78A 2M5WA 3MMYB 2O03A 4A0YA 4QWQA 2ZCWA 2COMA 5CQGA 3WTTC 1XCBA 2ZJQF 2CUFA 1QVUA 2G7UA 3MZYA 5FLMJ 2QSGX 2QBYB 2K3PA 4ZZDA 4OMYA 1P92A 1WZ2A 3NWSA 3KP3A 1QO0D 2KT0A 2KDZA 4WWCA 4AIKA 2CS3A 4P5OA 2GZWA 3BPXA 4HQMA 4NQWA 5J47A 4RGXA 4BH9A 2Y30A 1XD7A 4A3EJ 3DV8A 2MFZA 3BQYA 4DZPA 3J81Z 3CF5F 3AG4H 5JI6A 4BNCA 3UKGA 3MKZA 2WB1A 2X1CA 4A3CJ 2VOOA 2DYSH 1IRXA 2VQGA 4C2MJ 3CMAI 5LGUA 1PP7U 4KIGA 4ZTFA 4EGZA 1YJ9I 2P6TA 4BEHA 1NG6A 2HPIA 3F8CA 4UB6C 4ZC3A 3FDYA 1LQ1A 3F22A 4IEJA 2F5CA 1T6SA 2MH9A 2V1XA 2VQHA 3BDDA 2E7WA 2LKPA 1GXPA 1GV2A 1S5LC 4A3BJ 1IZ1A 4H0EA 4OWRB 3C18A 1FBUA 2HYFA 4WF2A 3OS2A 3SJMA 5DD8A 3W3CA 3L2UA 4F3QA 5M5WJ 2WAQN 2E1CA 5HLGA 2RAEA 1KYWA 1RUNA 3MKWB 1MKMA 4B47A 2NOGA 3MQ0A 4IQ4A 2P6SA 3SZGA 4A3DJ 2FBIA 2HVRA 1A6QA 1FSHA 1TNTA 2NS7A 4XRSG 4UUSA 1H88C 3NQOA 5E1ZB 3WG9A 2CMPA 3H9QA 2XF7A 3HSEA 2LBFA 2W57A 1SFEA 4YG2F 1Z67A 5EZHA 4GCVA 2BV6A 3VYRB 2FOWA 2FUG2 4MO7A 2FX0A 2H6BA 4NC7A 1R22A 3MWMA 3QP6A 4NC6A 5IOYA 3V4GA 3QPHA 5IP6A 4PJ0C 1BR2A 1YE9A 3HGYA 3FKJA 4FT8A 3S1RJ 3UR3C 2GM4A 2ZMEA 5IT9K 3NARA 5DYMA 3LMMA 2H6CA 4IHVA 4I98B 2ISYA 1XPXA 2BXZA 3G1LA 5E3LA 1BI3A 2KRHA 2DMUA 4OU0A 3QODA 3ISPA 2V1UA 4EJWA 3R4KA 1JUPA 4F7ZA 1OFCX 3G4SI 3ECHA 3DEWA 4BY1J 4O3MA 4NQWB 4KUMA 3ABMH 1F9NA 2DAOA 3OYIA 3ASNH 3RQ4A 5D5XB 4RGSA 4D0PA 1VNDA 3ZN0A 2JJ7A 3CF2A 2HOSA 1XMAA 4BJ6C 3D5LA 3CDHA 2QA4I 3QAHA 2XSJC 1W0TA 1EKEA 4D7MA 4KN4X 2VUMJ 3A0HC 4HOBA 3L2WA 4LLGF 2EPFA 2ECCA 4RAZA 3FX3A 4XRSA 3F8MA 4BEHB 4BXXJ 3TL4X 1E3OC 3BTCA 3ZMDA 4N9HA 2WAFA 3NWTA 4OIPF 1UJ8A 4Y7NJ 4LK1F 1HXDA 3LSTA 1K4SA 1FP1D 4A3MJ 1OCPA 1ZLJA 4BHPA 2BYVE 2JRMA 3WG7H 2GQQA 4GFBA 2UXNA 3PQJA 3GZNB 4CYCB 1OCTC 5FLXZ 1OKRA 2VL8A 3RDIA 3VSKA 5FRNA 4DIQA 1YJNI 4M3DA 3F8NA 3FWEA 1BOBA 3JRAA 3AL0C 3ZMSA 1T39A 1IV8A 1X58A 1DPUA 3K1MA 3KIOA 3GFIA 4DYRA 5B3SH 1ZRFA 4YIRX 1BW5A 3W6JB 2MSYA 3ZMVA 3RZDJ 5L3CA 1JUMA 4BQQA 3F21A 2GWRA 2JA6J 1K78A 3CCUI 2F4MB 3EPZA 3OYCA 3LSJA 2OZUA 5LEKA 3ZQGA 4BHBA 1X3UA 2XAFA 3ECOA 1MNDA 4KMFA 3M3YJ 2K7LA 2V6EA 3CLQA 2NXNB 4DNCA 3PNTA 1WI9A 4E4HA 3A2KA 4V2FA 4GO1A 3HUGB 3JSPA 2KP6A 2ZMEB 2TCTA 2IXSA 2WV0A 2XAUA 2Z1DA 3H5NA 3K4BA 2QLZA 2M7AA 3ASOH 4FQGA 1CF7A 3K70D 3ZMTA 5GAGJ 2E36A 2KKOA 2VN2A 3GTPJ 5TGTA 2HKOA 1T95A 2UV1A 3TO9A 5JLXA 3SDGA 4O5VA 1LE8A 3HEFA 1DDNA 1P4AA 3ERED 4LD5A 3BROA 3M8FA 1Z9CA 2LF7A 3PO2J 1FOYA 2Y0SN 4YRVA 3J7AO 5HDKA 3WHBA 3H9GA 2COBA 1EA3A 4RGUA 2K9SA 2XAJA 2R5YA 1SMYF 3PNYA 2L3DA 2RC4A 3EUAA 2XB0X 2R7SA 1RNLA 1X1CA 5M3FJ 3OS1A 2NAZA 1J5YA 4AD9A 5ICCA 1H0MA 2M8EA 3L00A 2OQGA 4WCGA 3HOVJ 1TWCJ 5IT3A 3P7NA 3MZ8A 4MHGA 5M5XJ 3P9CA 1HW1A 4U87A 5GPAA 3HTUA 4OINF 2EZKA 2FQ4A 2LDUA 4RM2A 4DYCA 5K7FA 2X51A 1MBEA 2VKHA 2Z2SB 3DLLF 4A3FJ 2O6GE 1I6HJ 3PIPF 5B1AH 1W36C 1YX5A 3HJEA 3FHZA 2PMHA 3R60A 4C3JJ 1K78B 1K4TA 2XV4S 4CZZA 4B8XA 4CDGA 5DM6F 1UFMA 4DW6A 2P5LC 2RV8A 4H4KC 1K7AA 2FOKA 4RB1A 1ZGWA 5L3BA 2WC2A 1AKHA 5F0HA 4DJAA 1Q1HA 3CD6I 2CQKA 4OMZA 5FGMA 1YX3A 3BZ6A 1R5HA 3OIQA 1LUJB 2LG4A 4TV7A 1UMQA 1WPKA 2K27A 5JFRA 2JTVA 1B8IA 2ESHA 4EJUA 2EA4A 2UWMA 4D5CA 2X85A 2E71A 2LTPA 1V5EA 2IJLA 3C2BA 2MD0A 1RUOA 3FM3A 2ZBKA 3TDZC 2WWYA 4A3JJ 1VTNC 1IRGA 3OSGA 4BU2A 4KICA 4MFEA 2XB5A 2EFPA 5JR3A 2B63J 1V4RA 4M3EA 4MQ9F 4HV6A 2M7BA 4HV5A 1VQ6I 4XK4A 5DEQA 4ZYGA 2ZJ2A 3JCUC 1VFCA 2EV0A 4NHJA 2A5YB 1L3LA 3GMEA 3K4CA 1WI3A 3P9KA 3A01A 2HEOA 3LA2A 2R5YB 4FE7A 1WGXA 5TISC 2EK5A 1XMKA 2DJIA 3U21A 3SQNA 4LB6B 1K61A 3FBNB 3O3KA 4MFDA 1HSTA 3BPVA 2ZJPF 4IVNA 2UUZA 3KPHA 2A3SA 2BVMA 5H6RA 2IS6A 2R7VA 1I1SA 5TJJA 4BE1A 1J09A 1ETOA 4PCQA 1R00A 1GVDA 1YQAA 3LA7A 5IYBJ 3FMSA 2EFNA 1PUFA 3W2WA 1P2FA 2DPUA 2DDAA 2MG4A 2XAGA 5J3LA 4CH7A 1R5ID 3CO7C 1XGSA 3BP8A 1CGPA 3BJAA 2EJRA 2LOOA 3E6CC 1YTYA 1V54H 2IS1A 3GXOA 3AG1H 5H20A 1WJFA 2DMQA 1QVTA 2VJIA 3F0CA 2ESNA 3GYHX 5KAIC 2H1LA 3QYFA 3DCFA 4C30A 2W84A 2MC3A 3DPTA
chains in the Genus database with same CATH topology
3S93A 3FHNA 3S8PA 1WJAA 4F55A 2X1EA 3VWBA 4HNTA 3OYJA 1D1BA 3IAM2 4PFPA 2XF5A 2CH0A 3DU5A 4HRIA 1X1BA 3AFHA 3PUBA 2Y0SA 2W00A 1MNEA 3SYTA 1P9QC 2WY7Q 2VPLA 2X6YA 3L2RA 2XDVA 2DXIA 4C2UA 3HC7A 1Z3YA 1D1CA 3ZQQA 2BVLA 3E1SA 1LFPA 2W82A 4YEJA 3K4NA 4J01A 5JHFA 2VJ4A 3CESA 3IAS2 4BJ5C 2XC7A 2WA0A 2KZVA 2DOAA 1N75A 1V5GA 4ZDPA 1MMNA 3DQVC 2OUMA 3I9V2 3LSHA 3GBGA 2HNHA 3OYHA 3CZ6A 1BR1A 4B48A 2CW8A 2GOMA 5HOOA 1W36D 3RPUD 4XQFA 3ZXSA 3L2QA 4BDYA 2AQFA 2QKMB 1R6RA 2RNGA 3IUOA 3OYDA 1D0XA 3A4CA 3BCBA 1DQUA 2E5NA 4DGWB 2IGNA 2OV7A 3OL4A 3OL3A 3QYEA 2HZDA 1ZELA 4XKCA 3PJRA 3M8JA 2RREA 3S3MA 4C2TA 1OR7C 4PSXA 4B43A 4QPOA 1WJBA 3CJRB 2DT6A 4HSTA 4MLOA 4XLFA 2Q1ZB 2PMZA 3DWLE 4FETA 2VLAA 2R7QA 2MC4A 3PFYA 2HVQA 4KISA 3H5AA 4XMYA 2KDOA 1GLNA 4II3A 4XR6A 1LKXA 1OLTA 3FBIB 3TBIA 4BL0B 4BE2A 5LD2C 1N78A 3MMYB 3ZRGA 1S9HA 3VYUB 3H9JA 4DOZA 3VYSB 3VYTB 5CQGA 4CCMA 2K3PA 2CV1A 3MD2A 4G6TB 5HVQC 1QU3A 4ZJZA 2RQQA 3K4MA 3NWSA 3EUHC 1PYVA 3CMMA 2CS3A 3G2BA 2VKDA 4P5OA 2NOJB 4F93B 4Y3OA 4CUGA 2ZXHA 2MFZA 4RMNA 3F9KA 4Y4RA 4BACA 2LBFB 2JUGA 3HPHA 3K4KA 3H0DA 3BCAA 2IGMA 4JQFA 2WB1A 3MKZA 3D5RC 3HL2A 2X1CA 3ZGKA 4CCJA 3OR1C 4XN3A 1IRXA 1K6YA 3DKXA 2VQGA 4BUPA 4IZZA 1SFKA 2ZSHB 4ZTFA 3K4LA 2W1OA 3CP8A 2A5WA 2DCEA 4R79A 4OAYA 1X19A 1G8XA 4BEHA 1NG6A 2IGOA 2HPIA 4ZC3A 3FDYA 4XLEA 3HPGA 5CPRB 2VQHA 4XONA 2W4SA 3DPUA 1X4PA 1MMDA 4N4NB 4OWRB 3OS2A 1U0JA 4BQNA 3UNGC 1LVKA 5HNFA 2CV2A 4GRIA 3W3CA 3L2UA 4F3QA 1UG0A 2LREA 1KONA 3PNVA 4KITB 3MKWB 3OYFA 4E7SA 4B47A 3OY9A 2E1MC 2L2OA 4IQ4A 3SZGA 5CKTA 4NC8A 4CCOA 2W7NA 1WJ5A 2HVRA 2KRCA 3K4JA 2HQAA 4BXFA 3EUKL 4B44A 4J00A 2HDWA 3W2VA 2CMPA 3H9QA 2XF7A 2LBFA 5HLTA 3S32A 4CCLA 4YELA 3CP2A 3VYRB 4DBQA 3PSFA 1NG7A 2E1MB 2FUG2 2KPMA 4XN0A 5KHDA 1LDKB 3HOTA 1BR4A 4NC7A 2L5QA 1BR2A 1YE9A 2X6XA 3FKJA 4PJNA 3UR3C 5LFAA 4BGDA 3LFUA 3LMMA 1PJRA 2VQLA 3VSLA 2KRHA 4HG2A 2O5RA 5CQEA 3QODA 3DTKA 2KMUA 1FMWA 2K9MA 1MMGA 4BS9A 2XF6A 3BG6A 3I3LA 4NQWB 3H5RA 1X1DA 3OYBA 1QHHD 2R7RA 2DT7B 4XORA 3OYIA 3RQ4A 2VASA 2VJJA 3M1CA 4E7JA 2L9SA 2I8DA 2P0WA 3CF2A 4BJ6C 1TZLA 2BW3B 1X1AA 3QOEA 4XL9A 4E7LA 3D5LA 4EATA 2WAEA 4LIVA 2XSJC 2M4GA 4HSRA 2X6WA 3RCOA 3L2WA 4XKWA 3RSNA 1E0EA 1Z21A 4BEHB 4CCKA 3TL4X 3KX2A 2ELJA 2WAFA 3NWTA 1TT0A 4D9JA 3OWTA 3OS0A 2WY8Q 5KCMA 2R7XA 3S3OA 2L9NA 2E5ZA 3BC8A 3C2HA 2GOXB 2VL8A 3VSKA 5FRNA 2CW7A 2V4JC 4DIQA 3PL8A 4PK4A 1BOBA 3AL0C 4CZCA 2E60A 4E7ZA 4P1WA 2HVSA 4RM3A 4IX7A 2WBMA 2ZSIB 3D5SC 2Z16A 4F52A 2LY2A 2MABA 5FRMA 2R7UA 2CV0A 2V26A 3C2GA 1FMVA 4BQQA 3RTRA 3A1YA 3EPZA 3OYCA 2F6CA 4AU7A 4XNFA 3OYKA 3AL0B 1MNDA 5KNLA 2ZFUA 2IS2A 3ONQA 2V6EA 2BW3A 1DGRM 3J7AY 4XLCA 2IGKA 3PNTA 4C9YA 4E4HA 3A2KA 3OYAA 4KJZA 4ZDOA 2F5VA 3HUGB 3OYNA 3DKYA 3K6GA 3OYLA 2KP6A 3K70C 4CSWA 1AA7A 1UELB 1D0YA 2F4IA 2IXSA 2VXDA 2R7TA 2PJRB 3LSIA 2AQEA 2R7OA 2XAUA 2JVGA 2Z1DA 3L2VA 1N77A 3H5NA 2BOLA 3HXLA 2M7AA 3K4BA 3OYMA 1WJDA 3K70D 1DP3A 4LIUA 3OOUA 4ZDLA 5TGTA 2K5CA 3DTEA 3W2AA 1T95A 2CUJA 2UV1A 3OMYA 1VZ0A 3DEEA 1Y56A 4PJLA 2M3AA 2WAQA 4D1QA 4CCNA 2LRDA 4XLAA 3N05A 4BJTA 4YRVA 3H9GA 2VB6A 1EA3A 3HG9A 3CJQB 4XLHA 1WJEA 3PNYA 3TMOA 2V9KA 3EUAA 1Y6IA 2R7SA 4XOPA 1X1CA 1MW7A 4XOTA 1WFXA 3OS1A 1G59A 2V1NA 2K9LA 4PJJA 4B3XA 4Y33A 1WJCA 4PUSA 4AVZA 1UAAA 4PSWA 2PJRA 4JOMA 4CA0A 4U87A 1JI8A 2LY1A 4E7HA 2KQRA 1SAUA 4RM2A 3VDXA 2X51A 2VKHA 2Z2SB 3OYGA 4ZTJA 2IS4A 3SEQA 1W36C 1YX5A 4IQJA 2VQCA 4LITA 4E6KG 2JSPA 4OAZA 2R4GA 3K10A 4QPQA 4XM3A 3DU6A 3KEYA 4H4KC 4F92B 1Z7LA 2LYCA 3OR2C 4BQOA 4NUBA 1D1AA 4DJAA 2ZXIA 2LC2A 3E0JB 3SEZA 4HEA2 2KHMA 4KT6A 4PJMA 1YX3A 3DPLC 3OIQA 2LG4A 1DGWY 4U7BA 3LSKA 2UWMA 3HOSA 4X0GA 2X85A 2CFOA 3H35A 4NNJA 1QHGA 1V5EA 4HNUA 2MD0A 5HNHA 2VJ5A 4LG3A 3V42A 4N4OB 3S3NA 2WADA 3BG7A 5FROA 3LSMA 3LL7A 4BU2A 2R7WA 4PFOA 2Q2EB 2JA2A 1Z3XA 2MYSA 3QYBA 4E7IA 4XKVA 2LH9A 4ITVA 2HU9A 2M7BA 1ERDA 3OIPA 2HPMA 2OC6A 2CUZA 1MMAA 2QKLB 3IP4B 3K4CA 1T0FC 1D0ZA 4AYBA 3DTIA 2JVHA 3MKYB 3HKZA 2M4KA 2VIXA 4ZYAA 1HA8A 3AKZA 3BLYA 2DJIA 4BDZA 3U21A 1V5FA 4XKBA 3FBNB 4E7KA 4IKFA 2UUZA 2V7FA 4DBRA 4ANJA 2BVMA 2IS6A 2A6TA 2R7VA 4FASD 4BE1A 1J09A 2X1DA 4II2A 3LSGA 3W2WA 4BE0A 2M0MA 3KYLA 4CH7A 2LOOA 3SDBA 2VXZA 2IS1A 3PSIA 2KLOA 3ZCOA 3ZR8X 3OYEA 4RLFA 3DLAA 1WJFA 2VJIA 2L7KA 4HPQA 4RLQA 1X4OA 3QYFA 4C30A 2KL4A 4F91B 3DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUZ A;  2UV1 A; 
#chains in the Genus database with same CATH topology
 3S93 A;  1AKH B;  3JTG A;  2X0L A;  3JRH A;  2LF8 A;  3GTO J;  4DZJ A;  3OYJ A;  2O8X A;  4XLN F;  5K5Q A;  2NVX J;  4PFP A;  2XF5 A;  2MH2 A;  1Z77 A;  2R92 J;  1FLI A;  3WGG A;  3H3Z A;  2W00 A;  4G7H F;  1ZHF A;  5F0C A;  2XPW A;  2VBZ A;  2XDV A;  2R5Z B;  1Z3Y A;  2EFQ A;  3HYI A;  1B8I B;  1D1C A;  3ZQQ A;  4KYW A;  3PIO F;  1XSV A;  2W82 A;  1K6O A;  1P4W A;  4YEJ A;  1W5S A;  3ROU A;  1IRF A;  1FYL A;  2ZFW A;  4Q47 A;  3CUO A;  3CES A;  5J1Y A;  2YU3 A;  4BJ5 C;  1O3S A;  1HOM A;  4HAM A;  1EV7 A;  5CVU A;  1AWC A;  4YFN F;  4AM3 A;  2DOA A;  1G4D A;  4FE4 A;  4ZDP A;  3I9V 2;  3NRV A;  3BR6 A;  3LSH A;  1R1V A;  1SD4 A;  3M07 A;  2HNH A;  3OYH A;  2PEX A;  3CZ6 A;  1ZRE A;  2LKS A;  2CW8 A;  1BI0 A;  2L7Z A;  2GOM A;  5JVG F;  1OYI A;  3CDI A;  2MLK A;  1IUF A;  3WGI A;  2OA4 A;  1R1U A;  3T0Y A;  2K4J A;  5C44 J;  4EM0 B;  1J59 A;  2OTJ I;  3RKX A;  2AQF A;  2A68 F;  3FMR A;  2BXY A;  2QKM B;  2CG4 A;  2RNG A;  4UV9 A;  2OBP A;  2JRT A;  2Y2Z A;  4LG0 A;  4PGH A;  3BCB A;  4I6Z A;  5GP9 A;  1TWA J;  2E5N A;  2ETH A;  3HSR A;  5FKN A;  3H3V K;  5CJ9 A;  1RIO H;  3HB9 A;  3SHF A;  1PUF B;  2CGP A;  4CHU A;  1RC9 A;  3HRT A;  3H92 A;  4I0B A;  2HZD A;  1YRN A;  3M8J A;  4HLX A;  1MDM B;  5FLX K;  5FKL A;  3PFI A;  1X1P A;  3O6B B;  4FHT A;  4C2T A;  1X3W B;  1MSE C;  4XSX F;  3S17 J;  2DT6 A;  2UXX A;  4HST A;  4IRI A;  4XLF A;  1HW5 A;  1XN7 A;  3SFI A;  2VLA A;  2MC4 A;  1H8A C;  1KQ9 A;  3G1O A;  1J75 A;  1YOV B;  4L0Z B;  1S7E A;  3PFY A;  3M7G A;  4A5N A;  5GAD J;  3F6V A;  2Y9Y A;  3M1E A;  1VQ7 I;  4EJV A;  2CWE A;  1SVO A;  3QRF F;  1S9H A;  2IA2 A;  2JSC A;  4LFU A;  3VYU B;  3VYS B;  3ZMZ A;  3O2P E;  3CCJ I;  2JA5 J;  2OF7 A;  3J7Y J;  4G6T B;  5HVQ C;  1UCR A;  3ABK H;  3LSP A;  4IHS A;  3RKQ A;  1PYV A;  3G2B A;  4XBF A;  1FOK A;  3RIR A;  2JMW A;  4AYB N;  4KN7 X;  2HYJ A;  2Z33 A;  2DQR A;  2EFW A;  3HKZ N;  3ZMU A;  2OQR A;  4RMN A;  3F9K A;  1H9T A;  3ZQC A;  1S72 I;  4R8H A;  1R36 A;  1MMS A;  3MN2 A;  2I5U A;  3K4K A;  3BCA A;  2IGM A;  3BZK A;  3K2Z A;  4JQF A;  3JRF A;  2NRA C;  5EF6 A;  3ZGK A;  3BR0 A;  2VOP A;  1K6Y A;  5AON A;  3LAP A;  2EIL H;  4HYE A;  1SFK A;  1IN8 A;  3K4L A;  2DCE A;  1ITY A;  2ISZ A;  3KCC A;  1W0U A;  2EWN A;  2IGO A;  2LK2 A;  1E2X A;  3CQZ J;  5CPR B;  4BKX A;  5D5W B;  5D4S A;  4JX4 A;  1BIA A;  1FBS A;  2NNN A;  1J2X A;  3DPU A;  4XON A;  1MMD A;  2L7M P;  5E3N A;  4B4C A;  1N25 A;  1U0J A;  3CC4 I;  4BQN A;  1LVK A;  1YW8 A;  2PN6 A;  2G0E A;  2QGU A;  2QBY A;  1KON A;  1Y8R B;  4KIT B;  3OYF A;  2FBH A;  5J6X A;  1VQK I;  3T8T A;  1XG1 A;  2W7N A;  3MFK A;  1OYY A;  2J5P A;  5EG0 B;  1OCZ H;  2KRC A;  2Z3Y A;  3C1D A;  1YRN B;  1SFO J;  2QQ8 A;  4M71 A;  1FWZ A;  5AIQ A;  1Z6T A;  2M34 A;  3EUK L;  5K7Z A;  4J00 A;  2HDW A;  4KFC A;  3W2V A;  3WOD F;  4S05 A;  2XAS A;  3KP2 A;  4CCL A;  2QSF X;  3MVP A;  3CP2 A;  1GDT A;  5E1X A;  4RB0 A;  5BQT A;  1NG7 A;  1R4N B;  4L5I A;  4XN0 A;  1ZGJ A;  2XAH A;  3O8H A;  3HOT A;  2DFE A;  1W7P A;  3ABL H;  3K1N A;  3KP5 A;  2X6X A;  4I76 A;  4PJN A;  1I5Z A;  1PVE A;  5LFA A;  2R7Z J;  2Y48 A;  1R4M B;  3HDD A;  4A3L J;  2VQL A;  1FP2 A;  1RES A;  3VSL A;  3GZ6 A;  3BR1 A;  2OZ6 A;  4XID A;  2HWV A;  1P7J A;  2PX9 A;  1FMW A;  2XUB A;  2ZO4 A;  1XGO A;  5B1B H;  3X2Q H;  1LNW A;  2FBK A;  2B9S A;  2VBY A;  3S14 J;  1DUX C;  3H5R A;  4HQE A;  2E7X A;  2DFF A;  2HKX A;  2VAS A;  2X48 A;  3GFJ A;  3V8J A;  2CO5 A;  2Q8K A;  3RQI A;  4KDP A;  3BWG A;  3WE2 A;  2L9S A;  2H27 A;  1TZL A;  2BW3 B;  1X1A A;  2HI3 A;  3OIO A;  2LY9 A;  1RZ4 A;  2P8T A;  5KAF C;  2M4G A;  3I5U A;  2X6W A;  3PQK A;  3Q0V A;  3ABT A;  2GA1 A;  3M8E A;  4FCY A;  3D1N I;  1TL8 A;  1EJ9 A;  2Z9O A;  1Z21 A;  1I50 J;  1O57 A;  3GFM A;  4CCK A;  3GTG J;  4D9J A;  1TBX A;  4RAF A;  3OWT A;  3GLX A;  2QWW A;  2CQX A;  2L9N A;  3IC7 A;  3BC8 A;  1HKQ A;  2VPR A;  2HQ5 A;  1LDJ A;  3TED A;  4CZC A;  2E60 A;  4E7Z A;  1RR7 A;  4HNV A;  2FXA A;  5ICG A;  2WTE A;  1HC8 A;  1Y0U A;  3KEQ A;  1J7K A;  3L2C A;  2CV0 A;  3C2G A;  3AG2 H;  1FIP A;  3ZQL A;  2OJE D;  2E1N A;  2ZME C;  2VT3 A;  2FA5 A;  2X9D A;  3BTJ A;  3IKV A;  2OAZ A;  2OPT A;  3OYK A;  3KZY A;  2EIN H;  3ONQ A;  1J9I A;  1V55 H;  4WXD A;  4PGG A;  4IRH A;  1SD6 A;  3GEZ A;  3HOU J;  1B6A A;  2KFD A;  3OYA A;  4JX5 A;  4M3B A;  4L5E A;  1W7P B;  3HOX J;  3OYN A;  4ZDO A;  3K6G A;  2ZXW H;  2IVM A;  1IXS B;  3WTZ A;  3FXL A;  5JVT A;  1JJ6 C;  3FXO A;  3C7J A;  5IYD J;  1TQP A;  5GAH J;  2VXD A;  1KGS A;  1D0Y A;  4ENK A;  1O4X A;  2PJR B;  1LEA A;  1SD7 A;  1TP4 A;  1ZG3 A;  2NVY J;  3L2V A;  1N77 A;  2O9L A;  3CLO A;  2BOL A;  4CYC A;  1ETX A;  1OCR H;  4XRF A;  3CUQ A;  4BAY A;  1JJ8 C;  4ZDL A;  4RAY A;  1OCO H;  2D5V A;  3W2A A;  6PAX A;  3ULQ B;  2E35 A;  4OIR F;  1YHQ I;  4HBL A;  2IBD A;  4Y17 A;  4UUV A;  2RVC A;  3OMY A;  2R7F A;  1XSD A;  3DEE A;  2FML A;  2V1D A;  2JZY A;  2M3A A;  2WAQ A;  4D1Q A;  2CUE A;  4CCN A;  2LRD A;  2DFI A;  3N05 A;  2HDC A;  4LB5 A;  1OYW A;  1D5V A;  2VB6 A;  5JLW A;  3Q3S A;  5GTH C;  1GV5 A;  2QF7 A;  1U9O A;  3QU6 A;  1TWF J;  4CIC A;  2MLG A;  1WH5 A;  4AUX A;  3KP6 A;  2DFH A;  3EQL F;  3I56 I;  1Y6I A;  3ZQF A;  1Y0N A;  3FIS A;  2OD5 A;  5DD4 A;  5J40 A;  1MW7 A;  3HUG A;  1G59 A;  1R23 A;  2DO7 A;  3GVA A;  2ZB9 A;  1L0O C;  3FXK A;  1WJC A;  4FIS A;  3K0L A;  3GUD A;  2GLO A;  2KQR A;  3JAM K;  3A0B C;  1ZR2 A;  2IS4 A;  4EMS A;  3KEO A;  1TWH J;  3SEQ A;  4OIO F;  2DT5 A;  1YI2 I;  2JA8 J;  3DKW A;  5JHU A;  2O3F A;  2R4G A;  3K10 A;  4O6J A;  1KQ8 A;  2YUS A;  3KLN A;  1O7L A;  4G6Q A;  3S1Q J;  3OR2 C;  2Y0M A;  4BQO A;  9ANT A;  3J7Z I;  2NS8 A;  2QCO A;  1FTT A;  3C3W A;  5E3M A;  3E0J B;  4Q48 A;  3IL2 A;  1JKO C;  4HEA 2;  4GXO A;  4KT5 C;  4KT6 A;  4PJM A;  1T56 A;  1LPQ A;  2EFO A;  2QM3 A;  3DPL C;  5CYV A;  1BI2 A;  1JHF A;  1DGW Y;  5F08 A;  2K85 A;  2EB7 A;  2K40 A;  2D45 A;  3LSK A;  4WK8 F;  4P9U A;  2RQP A;  3H35 A;  1P6R A;  3GLL A;  3CUQ B;  4HNU A;  1BA5 A;  2PMZ N;  1JGS A;  4JK1 X;  4LG3 A;  4N4O B;  1HDD C;  1D5Y A;  3LSM A;  2R93 J;  2GAU A;  5ILU A;  2MYS A;  2LLK A;  2HU9 A;  1LB2 A;  1W5C C;  5B66 C;  4D7N A;  2QKL B;  1T0F C;  1IV6 A;  1ETY A;  1D0Z A;  3B6C A;  3E7L A;  3DTI A;  2HR3 A;  5IP7 J;  1IG7 A;  3JRB A;  2KJB A;  3GTQ J;  3MKY B;  2ADU A;  1Z6R A;  1STZ A;  4U7D A;  2XRL A;  1V5F A;  4IKF A;  2V7F A;  1AOY A;  4ANJ A;  2A61 A;  1ONV A;  2OU2 A;  1FX7 A;  2H1K A;  5FFX A;  4FAS D;  4XIC A;  4W1U A;  1KYZ A;  2IEK A;  3LSG A;  1REP C;  3TP0 A;  2VBW A;  5EEG A;  3KYL A;  1F4K A;  5A2Q Z;  1TNS A;  2ELH A;  1VQM I;  3KZI C;  5LLQ A;  2GXA A;  3SDB A;  1SC7 A;  3TOB A;  4IRG A;  1YIO A;  3H36 A;  4PZJ A;  3WTU C;  2YSR A;  5F6F A;  4HPQ A;  2E2I J;  4A6D A;  2M45 A;  5F04 A;  1X4O A;  5GAE J;  1X3Z B;  3U1K A;  2OTL I;  5E17 F;  2KL4 A;  4F91 B;  1FNN A;  1Y8Q B;  2DI3 A;  4I0A A;  1WSU A;  1RI7 A;  3I4M J;  3SFZ A;  2CFX A;  5K5O A;  1JTX A;  3V8K A;  2CH0 A;  1EH7 A;  3O8G A;  4HRI A;  1X1B A;  3AFH A;  4L0Y B;  2HGC A;  3PUB A;  2Y0S A;  3EDP A;  1IXC A;  2O7O A;  2L7F P;  2WY7 Q;  4NBQ A;  3L2R A;  2DXI A;  4C2U A;  3HC7 A;  5ED4 A;  5D8L B;  4S04 A;  1YO5 C;  1VQ5 I;  2H8R A;  4U88 A;  1FIA A;  3E1S A;  2NVT J;  1HLV A;  4A3K J;  1T0F A;  2KIF A;  4J01 A;  3TKY A;  2YPR A;  3CDL A;  2ELK A;  2VJ4 A;  4ESB A;  3S1N J;  3R0J A;  2XGD A;  2KZV A;  2M30 A;  4HX4 A;  3I4P A;  3MKL A;  1JHH A;  4ENN A;  5C4J J;  4M9S A;  4UB8 C;  1I27 A;  1KU2 A;  1OIS A;  2H09 A;  2F48 A;  2X6O A;  3RPQ A;  3JRD A;  1TC3 C;  3E6B A;  1NHA A;  5HOO A;  3RPU D;  3WU0 A;  2PG4 A;  4ON0 A;  1HSJ A;  5E3O A;  2P4W A;  4M9X A;  4ZH4 F;  2Q0O A;  3HTS B;  3L9F A;  3JRC A;  4GYI A;  1DPR A;  5EZG A;  3ZXS A;  3FM5 A;  3L2Q A;  3E97 A;  4QLC U;  1JGG A;  1YW9 A;  3OYD A;  1TW2 A;  2EV5 A;  1Y1V J;  1WQ2 A;  2Y75 A;  1D0X A;  1OCC H;  2IGN A;  3P9I A;  2OV7 A;  1HBX G;  4EJT A;  3K1P A;  5KVR A;  4M3G A;  4BBR J;  2R5Z A;  1PP8 F;  3K9T A;  5E18 F;  1HF0 A;  1ZEL A;  1O3R A;  1S6L A;  2Z5U A;  3PJR A;  4Q5S F;  2KIU A;  5D5V B;  1EH8 A;  4Z2Y A;  1QA6 A;  3S3M A;  1U2W A;  1OR7 C;  2IW5 A;  2YX4 A;  4B43 A;  2BZT A;  4MLO A;  2Q1Z B;  3CCL I;  3DWL E;  2R7Q A;  1XDU A;  3HOW J;  3RYP A;  4B09 A;  4MNU A;  3ZOB A;  2M9H A;  2P5K A;  3GFL A;  4XR6 A;  4II3 A;  2R0Q C;  4A12 A;  3PO3 J;  1LKX A;  4BE2 A;  2D1V A;  3ZRG A;  3H9J A;  3REO A;  3VYT B;  2AO9 A;  3J81 K;  4CCM A;  1G3S A;  3KYC B;  3MD2 A;  2QQA A;  2ME0 A;  5CVI A;  2XPV A;  4ZJZ A;  3I53 A;  2VC1 A;  2DOF A;  3EUH C;  3H0G J;  4A0X A;  1QBJ A;  3W6V A;  3CMM A;  3COA C;  2FD5 A;  2MGQ A;  3Q0W A;  4F93 B;  1PUE E;  3I64 A;  3N97 A;  3HIF A;  4J19 A;  2EZL A;  1WRJ A;  3JRI A;  1CQT A;  3M9A A;  2LVS A;  4EM2 A;  4Y4R A;  2K3F A;  3HPH A;  2DJN A;  1MJ9 A;  1FSE A;  4L9N A;  5IYC J;  3G6E I;  3OV8 A;  2FF4 A;  4RA2 A;  4CCJ A;  1MDM A;  3OR1 C;  3DKX A;  4BUP A;  4YFK F;  4FX0 A;  2ZSH B;  2W1O A;  3ZQ7 A;  5C3E J;  2A5W A;  1PDN C;  1BBY A;  1MH3 A;  4GYG A;  4Z6Y A;  1IXR C;  1TW3 A;  3E5Q A;  1MJB A;  4XLE A;  5CVJ A;  3J80 Z;  3I59 A;  4MQV A;  4S0H B;  1FC3 A;  5F1J A;  2F5F A;  5HLI A;  1XC5 A;  2XAQ A;  1S29 A;  4ENM A;  2QYO A;  1X4P A;  1ZAR A;  1OR7 A;  2HZT A;  4GRI A;  3V8L A;  2VT2 A;  5F64 A;  1FJL A;  1SAN A;  2VON A;  1YG2 A;  3LNQ A;  1F1Z A;  3M4O J;  4E7S A;  3GTJ J;  3OY9 A;  4HW0 A;  4I7H A;  2L2O A;  1KA8 A;  4IXA A;  4NC8 A;  3FK7 A;  3DP7 A;  2DMT A;  2ID3 A;  2L9V A;  2Y69 H;  3K4J A;  4LJZ F;  2HQA A;  1APL C;  1RKT A;  1A36 A;  4D5F A;  3LQQ A;  1B4A A;  4ETS A;  4A6E A;  2A6E F;  4YEL A;  4M74 A;  1Y39 A;  2B7E A;  1RET A;  3PSF A;  4HLY A;  5IP9 J;  2E1M B;  2KPM A;  3EUH A;  5KHD A;  2JA7 J;  2E19 A;  4Y52 J;  4KIB A;  1J0R A;  3IRQ A;  1ZAO A;  1KU7 A;  2HOT A;  3CJT B;  2DA6 A;  3RKY A;  5ILV A;  1Z1D A;  2C6Y A;  1K79 A;  3LFU A;  4BQA A;  4V19 K;  4MGR A;  3R61 A;  4HG2 A;  1IN4 A;  5LHH A;  4X1E A;  1U5T B;  2KMU A;  1LVA A;  2BE5 F;  3F6O A;  2CW0 F;  5L3G A;  1MMG A;  2EH3 A;  4BS9 A;  1B59 A;  2MW8 A;  1A5J A;  1QHH D;  3CCE I;  2DT7 B;  5FO5 A;  4UVB A;  4IOA F;  5IT9 Z;  5CLS A;  1XGN A;  2R7D A;  2VJJ A;  3M1C A;  2YS9 A;  1SEU A;  4Y13 A;  3GCM A;  1KU9 A;  2I8D A;  5LHI A;  5M5Y J;  1WCM J;  1ETQ A;  5EG0 A;  5J4V A;  4EAT A;  1R58 A;  2L54 A;  4HSR A;  1VI0 A;  2EIJ H;  3KP7 A;  4A93 J;  2O61 A;  3RCO A;  2HOE A;  2PJP A;  4MTE A;  3K69 A;  3GW2 A;  4I2O A;  1R7J A;  3KLO A;  3I59 B;  3S2H J;  5LGN A;  3OS0 A;  2WY8 Q;  4KA4 A;  4JYK A;  1V3F A;  2E5Z A;  3FK6 A;  2DA5 A;  4R1H A;  3K7A J;  3NAU A;  3CCQ I;  2PQ8 A;  2GOX B;  3LAJ A;  1QPI A;  1OQY A;  2L4M A;  3DBR B;  2VE8 A;  4GDF A;  4AIH A;  1IGN A;  5BPI A;  2NNY A;  2CW7 A;  2V4J C;  1FOX A;  3HZJ A;  3PL8 A;  4PK4 A;  1FPQ A;  2EQR A;  1YW7 A;  4P1W A;  3AG3 H;  2VE9 A;  2DW4 A;  5FKM A;  2GXG A;  5LRR A;  2HDD A;  2WBM A;  3SZT A;  1ULY A;  2Z16 A;  5EGO B;  4F52 A;  1MNM C;  2MAB A;  5FRM A;  2JPB A;  2R7U A;  2DLL A;  3IRR A;  2V26 A;  3ZQI A;  3A1Y A;  3MZH A;  2F5D A;  1BI1 A;  2ZJR F;  1R5G A;  4AU7 A;  3CTA A;  4XNF A;  2DN0 A;  2V6C A;  2GIZ A;  4UV8 A;  3ZPL A;  3BJ6 A;  2ZFU A;  2EA2 A;  4MTD A;  2BW3 A;  1G3T A;  5A2Q K;  4XLC A;  2IA1 A;  1QGP A;  3E3V A;  5LHG A;  4EQQ A;  4C3H J;  4C9Y A;  2EZI A;  5BPD A;  1U9N A;  1YLF A;  2EBI A;  2F5V A;  1YS6 A;  3OYL A;  2KJC A;  3SZP A;  3LSR A;  4P96 A;  3VOE A;  2JWT A;  4CSW A;  1UEL B;  1JTY A;  3FF5 A;  2AQE A;  2R7O A;  2JVG A;  4YII A;  3QQA A;  2DU9 A;  3WU2 C;  2TRT A;  1ZRC A;  5J8F A;  3OYM A;  1WJD A;  4FX4 A;  2YX7 A;  1DP3 A;  1H89 C;  3GZ5 A;  5LRS A;  2XRO A;  3OOU A;  2ZXJ A;  1XX5 A;  5KK1 A;  1SMT A;  2JK3 A;  2K5C A;  3LWF A;  3QPT A;  5ERI A;  2K4B A;  1FEX A;  5LGT A;  5B5E C;  1IDY A;  2VKE A;  1M1E B;  2BGC A;  1Y56 A;  2K9Q A;  4PJL A;  2CSO A;  1Z0X A;  1LFU P;  5DUI A;  4XLA A;  4C3I J;  1Z05 A;  4BJT A;  2GA2 A;  1IAW A;  3TDU C;  1UB9 A;  3VOD A;  1BJA A;  2YR2 A;  3VPR A;  1O3Q A;  1WJE A;  3G71 I;  4P9F A;  5H6Q A;  2BHZ A;  2Y31 A;  3BR2 A;  3G73 A;  3AAF A;  4L9T A;  4NB5 A;  4IHW A;  3JRE A;  3BZC A;  3B73 A;  1WVR A;  1Z91 A;  2AXT C;  4XOT A;  2V9V A;  4IHY A;  4B3X A;  4FTH A;  4Y33 A;  4AVZ A;  4PUS A;  1FBQ A;  2PJR A;  4PSW A;  2KZG A;  4A0Z A;  3NEU A;  3JR9 A;  4JOM A;  1MGT A;  4CA0 A;  3E6M A;  2HTJ A;  1SVL A;  2LY1 A;  2P7V B;  3TOA A;  3TO7 A;  4E7H A;  2CQ7 A;  1SAU A;  1S3J A;  2YU9 J;  3CC2 I;  2ICW G;  2G7H A;  2A07 F;  3R6S A;  3OYG A;  1I1G A;  4ZTJ A;  4L9J A;  4V2G A;  2HFH A;  4IQJ A;  1ZQ3 P;  4K2E A;  4E6K G;  2LD5 A;  4OAZ A;  1E3H A;  1FYM A;  4QPQ A;  3Q5F A;  2QQB A;  2A6H F;  3KZZ A;  3I4N J;  3FMQ A;  3WTY C;  4IHT A;  5TRD A;  1MIJ A;  1XCV A;  1BN5 A;  3JSO A;  3CUQ C;  2E34 A;  2RGV A;  5J4Y A;  5D8K B;  5DS9 A;  3SEZ A;  1FT9 A;  1QZZ A;  2A69 F;  2KHM A;  2FRH A;  3I58 A;  2G9W A;  3ZQH A;  1XSX A;  3GX4 X;  5BNG A;  2OCE A;  3Q9S A;  4U7B A;  1GVJ A;  4AWX B;  3HOS A;  1UHW A;  2CFO A;  4NNJ A;  2STW A;  2P5V A;  3E5X A;  1W1W E;  4L9V A;  2VJ5 A;  1F43 A;  1GUU A;  2XHK A;  4ABZ A;  3V42 A;  5FRO A;  1A31 A;  1O3T A;  5IOZ A;  4RDU A;  2Q2E B;  2GBY A;  2W25 A;  1Z3X A;  2LH9 A;  3GTL J;  4YIF A;  5LBQ A;  1B9M A;  1ERD A;  1K83 J;  1IJW C;  3OIP A;  2HPM A;  2XSD C;  3A02 A;  2IP2 A;  2OC6 A;  2CUZ A;  1MMA A;  2HYG D;  2R3S A;  2IRF G;  2DDB A;  2AS5 F;  1EF4 A;  3IP4 B;  5L3F A;  1RPW A;  1HKT A;  3KFW X;  3S2W A;  2DPD A;  2OCC H;  2M4K A;  2VIX A;  4ZYA A;  1HA8 A;  3AKZ A;  1IN7 A;  2KIQ A;  1RRJ A;  1DU6 A;  3TW6 A;  1JT6 A;  3E6D A;  5FD6 A;  3WTS C;  3T1B A;  2WB1 N;  4G94 A;  5BMZ A;  1ZGA A;  3J80 K;  3MEX A;  2M0C A;  2M0M A;  1ZG5 A;  1WWX A;  3BY6 A;  3F72 A;  5DCF A;  1JKQ C;  1S8N A;  5E79 C;  2PFB A;  2XIG A;  2VXZ A;  3K2A A;  3PSI A;  4A3I J;  5IY5 H;  1KU3 A;  3ZCO A;  3ZR8 X;  5EEA A;  1ZG1 A;  3DLA A;  4ZZL A;  5EDN A;  3QU3 A;  4N0B A;  1SAX A;  1DP7 P;  1ZH5 A;  1ETK A;  3LQR A;  1TQM A;  3CCM I;  4AIJ A;  1TT5 B;  4IO9 F;  4PSX A;  3S8P A;  2FJ1 A;  3WTX C;  3WHC A;  1OPC A;  5FLV A;  3VWB A;  4HNT A;  4I09 A;  2CQQ A;  4CXF A;  3EYY A;  3KET A;  4LLL A;  1D1B A;  1JT0 A;  3TGN A;  3GTM J;  1HQC A;  4AVP A;  3DU5 A;  5L3D A;  3U1D A;  1P9Q C;  2L4A A;  4OIQ F;  3MAJ A;  5K5R A;  2DA7 A;  2XGC A;  2LP0 A;  2LSO A;  2UZK A;  4ESJ A;  1YS7 A;  5HOD A;  2P7C B;  4M6Y A;  4B3A A;  4E70 A;  3MCZ A;  2BVL A;  4U0Y A;  2EZH A;  1LFP A;  1YYV A;  2BBY A;  4W97 A;  1BC7 C;  1H9G A;  1XDS A;  4L18 B;  1UHS A;  1ZK8 A;  3FXR A;  3IAS 2;  3WU1 B;  2XC7 A;  2WA0 A;  5D6E A;  2W48 A;  1V5G A;  4WX9 A;  1F36 A;  2Y9Z A;  3HHH A;  1VQP I;  3D0S A;  2IPQ X;  3BTL A;  2WV1 A;  1BR1 A;  2F5E A;  1W36 D;  4XQF A;  1MSF C;  3CCS I;  3BG9 A;  3RJP A;  1ODD A;  1Z7U A;  4BDY A;  5D5U B;  2RDP A;  1R6R A;  4KMU X;  3IUO A;  3QP5 A;  5F0F A;  3IV5 A;  1LJ9 A;  2QUF A;  3BR5 A;  2XPU A;  1DQU A;  3JTH A;  2XKO A;  4M73 A;  4UVA A;  4BBS J;  1WKM A;  3G1M A;  3HHG A;  2ZNZ A;  4DGW B;  2DYR H;  4A69 C;  3OL3 A;  3DBL B;  3QYE A;  4QSH A;  5DDG A;  1SFU A;  5DCM A;  4M9Z A;  4XKC A;  1ZLK A;  1BJZ A;  4RB2 C;  2XKP A;  4HZF A;  1T33 A;  5J1U A;  2M8G X;  1YIT I;  1C0W A;  3GF2 A;  4QPO A;  1WJB A;  2PBI A;  3CJR B;  1QPM A;  2PMZ A;  3V7C A;  2HVQ A;  4KIS A;  2KDO A;  1GLN A;  2A05 A;  4RB3 C;  4BL0 B;  1OLT A;  5LD2 C;  3PUF A;  1OMI A;  4DOZ A;  4UNO A;  2F4O B;  5LEJ A;  2DA4 A;  4G7Z F;  2CV1 A;  3FZV A;  1QU3 A;  2RQQ A;  3K4M A;  3F3X A;  1AU7 A;  2GXB A;  1TWG J;  2VKD A;  2NOJ B;  1P7I A;  1F5T A;  2JN6 A;  4XSZ F;  4DQ2 A;  3U9G A;  3FXU A;  1B72 A;  2J5O A;  4Y3O A;  4CUG A;  1BOA A;  2DA2 A;  3HRU A;  2ZXH A;  4M3F A;  4UUS B;  1U6G A;  4BAC A;  2LBF B;  2JUG A;  3H0D A;  2AHQ A;  2HXI A;  3D5R C;  3HL2 A;  3B6A A;  1D8J A;  4XN3 A;  1GT0 C;  4HDV A;  4IZZ A;  3TO6 A;  2FSW A;  1ZTR A;  3CP8 A;  3DF8 A;  2XGE A;  2K02 A;  4OAY A;  1X19 A;  1G8X A;  1SVM A;  2LR8 A;  2PMU A;  5E1W A;  4R79 A;  3CCV I;  1NTC A;  3HPG A;  2W24 A;  3CO6 C;  3HM5 A;  2ID6 A;  4EM1 A;  1IF1 A;  3LOC A;  4QIW N;  4I02 A;  2DK8 A;  1B9N A;  5D6F A;  2W4S A;  4AC0 A;  1S7O A;  2DOD A;  4ASN A;  4G6D A;  4N4N B;  4HDU A;  3UNG C;  5GPC A;  5HNF A;  2MA3 A;  3LA3 A;  5FD5 A;  2CV2 A;  1UG0 A;  2LRE A;  3PNV A;  2QSH X;  1KQ0 A;  2E1M C;  3IH3 A;  3DXJ F;  2DK5 A;  5BS6 A;  4PDK A;  5CKT A;  5DCM B;  4CCO A;  1WJ5 A;  2ZNY A;  2W85 A;  1G3Y A;  2DMP A;  4BXF A;  3JRG A;  1W5T A;  4B44 A;  2E1O A;  4IF4 A;  5HLT A;  1IDZ A;  2KIM A;  3S32 A;  3TQN A;  1FY7 A;  3I55 I;  4CGZ A;  1U5T C;  1IRZ A;  5J8C A;  4DBQ A;  1QNT A;  3I0T A;  1I39 A;  1JXS A;  1LDK B;  1BR4 A;  4Y15 A;  2L5Q A;  1T2K A;  5FJ8 J;  3HRS A;  2O8K A;  2Z99 A;  2K9N A;  1FTZ A;  4BGD A;  5EEH A;  1PJR A;  4EJO A;  2FMY A;  2O5R A;  5CQE A;  3W6K B;  4LOC A;  3DTK A;  1KZH A;  3F8F A;  4HF0 A;  4ZYE A;  1RR8 C;  1JE8 A;  1GXQ A;  1POG A;  2K9M A;  1TQI A;  2ACJ A;  5F27 A;  2XF6 A;  3BG6 A;  3I3L A;  3RI4 A;  1X1D A;  2EIK H;  3OYB A;  2R7R A;  3V7S A;  1B72 B;  4XOR A;  1HDP A;  3GO5 A;  4E7J A;  3HSF A;  1NK2 P;  3WGH A;  4I99 C;  2P0W A;  5ILS A;  1SFX A;  5DV5 A;  1O7F A;  3QOE A;  4XL9 A;  4E7L A;  2WAE A;  3WTV C;  2VBX A;  4LIV A;  4IPA A;  2BY1 A;  3S1M J;  4HX7 A;  1XS9 A;  2IA0 A;  3BR3 A;  1FYK A;  4A3G J;  2NVQ J;  4XKW A;  2XRN A;  3RSN A;  2RNJ A;  4CO8 A;  3KP4 A;  1E0E A;  3FXQ A;  3I71 A;  1QQI A;  5E8G A;  4KNY A;  1U78 A;  3KX2 A;  1BM9 A;  1X2M A;  2ELJ A;  1TT0 A;  3BG5 A;  4XRM A;  2GIV A;  1ORK A;  4UY8 I;  1ON2 A;  5KCM A;  2R7X A;  3S3O A;  1D3Y A;  4EV0 A;  1CF7 B;  2P81 A;  3C2H A;  1OJL A;  5E20 A;  2FQ3 A;  2BY0 A;  1ZR4 A;  2DQL A;  5M3M J;  3E5U A;  3ESW B;  2HVS A;  3BOQ A;  4RM3 A;  4IX7 A;  1WHU A;  1U5T A;  2ZSI B;  3D5S C;  1FZP B;  4RGR A;  1VQN I;  1MBK A;  2LY2 A;  1HKS A;  1LE8 B;  1MH4 A;  1R9T J;  1FMV A;  1GHC A;  1YJW I;  3RTR A;  2CQN A;  2M1B A;  3BT9 A;  4HF2 A;  5DM7 F;  1USS A;  2F6C A;  3CCR I;  4GGG A;  5BOX A;  2D1H A;  2DTR A;  4N9I A;  3AL0 B;  2BY3 A;  1W7P D;  5KNL A;  2VC0 A;  2IS2 A;  2TDX A;  3BQZ A;  1DGR M;  3J7A Y;  2IGK A;  3GTK J;  4CYD A;  1UST A;  3ERM A;  1MBF A;  1T98 A;  3DBH B;  4X6A J;  4KJZ A;  4ESF A;  3DKY A;  4L5J A;  2DBB A;  3L09 A;  4WXC A;  5CVV A;  3N4M A;  3S15 J;  3VB2 A;  3K70 C;  5AIP A;  1AA7 A;  2F4I A;  3IKT A;  2R7T A;  1XTA A;  3LSI A;  3ZP5 A;  4ENJ A;  4M6V A;  1IUY A;  3DFG A;  1IN6 A;  3HXL A;  5CVR A;  2CRG A;  4NDL A;  4LIU A;  1VF9 A;  3F8B A;  3OSF A;  1IC8 A;  3ELK A;  3I54 A;  3HBL A;  1G2H A;  5FKK A;  1E3P A;  3DTE A;  2CUJ A;  3FXM A;  1WH7 A;  5HS9 A;  4RS8 A;  4JBA A;  5EGO A;  1VZ0 A;  4BY7 J;  3BTI A;  3L1P A;  1G6N A;  2FE3 A;  1JUS A;  5DTD A;  5EJC A;  4BHC A;  2NS0 A;  2AXL A;  2ZC2 A;  5H2F C;  2VI6 A;  3HG9 A;  3IH4 A;  3CJQ B;  4XLH A;  2QEX I;  1BL0 A;  4IJA A;  3TMO A;  2V9K A;  4G12 A;  1YIJ I;  4I01 A;  3EYI A;  2DTZ A;  2FNA A;  1A6I A;  1IW7 F;  2F2E A;  4U0V A;  4XOP A;  1VQ9 I;  4EGY A;  2V79 A;  2BEO A;  1WFX A;  2LFB A;  2V1N A;  2MD5 A;  1T08 B;  2K9L A;  2MBF A;  3KYD B;  3QWL A;  4PJJ A;  2E2J J;  1UHM A;  1MBH A;  1MJA A;  3SXY A;  2XGX A;  3VFZ A;  5ICF A;  3TP3 A;  2CYY A;  4WXH A;  4B1R A;  1UAA A;  4EVI A;  1NH3 A;  5HDN A;  1HW2 A;  3A03 A;  4AID A;  1JI8 A;  4HX8 A;  4ZYH A;  1MZB A;  2EIM H;  3VDX A;  1YFH A;  3RKW A;  3ML6 A;  5L3E A;  5FB2 A;  2VQC A;  5HS7 A;  4LIT A;  3RYR A;  2JSP A;  1T8I A;  1IO2 A;  2K86 A;  4XM3 A;  1MD0 A;  3DU6 A;  3KEY A;  3A01 B;  2M2E A;  3T5X A;  4F92 B;  1Z7L A;  2LYC A;  1LDD A;  4G7O F;  1EH6 A;  1D1A A;  4NUB A;  3JAM Z;  2LKX A;  1XB4 A;  2ME6 A;  2ZXI A;  2LC2 A;  4G8X A;  4Q4Z F;  3WTW C;  1U3E M;  5E8I A;  2JPC A;  1I6X A;  5K7H A;  4ZYD A;  4OOI A;  1R71 A;  1RKW A;  2HS5 A;  3DEU A;  4IHX A;  2H8W A;  4G9Y A;  1T38 A;  4LLN A;  1MBG A;  1SD5 A;  2NVU B;  3L7W A;  3BG3 A;  2L9R A;  3QPS A;  4A2U A;  1DU0 A;  1ON1 A;  4X0G A;  1E17 A;  1QHG A;  1TLH B;  4KIF A;  5HNH A;  1U8B A;  2IT0 A;  4M72 A;  2JUC A;  1JKP C;  3S3N A;  2WAD A;  3BG7 A;  3IH2 A;  1VQL I;  3LL7 A;  2R7W A;  4PFO A;  2JA2 A;  3QYB A;  4E7I A;  4XKV A;  3T8R A;  4ITV A;  2VOD A;  1QZY A;  1G3W A;  5HLH A;  4LGW A;  4XLP F;  1MBJ A;  5D4R A;  2RKH A;  1ETV A;  1R49 A;  5F1R A;  1VQ4 I;  1P4X A;  2HQR A;  5FFZ A;  1ENH A;  2EV6 A;  2H94 A;  4AYB A;  2X4H A;  4BYY A;  2JVH A;  4EEF G;  2ECB A;  2QEN A;  1HCR A;  2PI0 A;  4JP0 A;  3H3U A;  1U8R A;  3HKZ A;  1ZKG A;  3WE3 A;  1TTY A;  3BLY A;  3QOP A;  4IL6 C;  4BDZ A;  3CC7 I;  4XKB A;  4E7K A;  1ZYR F;  1FOW A;  4DBR A;  3RPU A;  1IN5 A;  4MEX F;  1I3Q J;  3H1C A;  3S16 J;  1R1T A;  5IPA A;  1X2N A;  2A6T A;  1B1B A;  2B0L A;  3CJN A;  3HOY J;  2IAI A;  2X1D A;  3FKI J;  3FXJ A;  2L01 A;  2STT A;  4II2 A;  2BY2 A;  3FIW A;  2N8G A;  4A5M A;  2L02 A;  4MIM A;  5FKO A;  5DUK A;  2KLO A;  1BC8 C;  2E2H J;  3OYE A;  2CJJ A;  3Q0U A;  4RLF A;  2L0K A;  2O0Y A;  2ZKZ A;  2JT1 A;  2L7K A;  3R0A A;  3ZN1 A;  4LMY A;  1ETW A;  2FU4 A;  3G3Z A;  4RLQ A;  2Q2E A;  3RZO J;  4BE0 A;  3FHN A;  1WJA A;  3BJO A;  1BW6 A;  1XMX A;  2D2W A;  4F55 A;  2X1E A;  2JQ7 A;  5ICE A;  3PM1 A;  1JKR C;  4HF1 A;  2VKV A;  4LG0 B;  2V9P A;  2HOA A;  3IAM 2;  1QZE A;  2KIS A;  3GWZ A;  3KE2 A;  3HOZ J;  1MNE A;  3SYT A;  1ZN2 A;  2VPL A;  4YFX F;  2X6Y A;  4LK0 F;  4DYQ A;  4JX6 A;  3Q9V A;  5HDG A;  3IHU A;  3LFK A;  2HXO A;  3IWF A;  1UG2 A;  5EYR A;  3K4N A;  1A35 A;  1VQ8 I;  5JHF A;  2DMN A;  3IWZ A;  5C4X J;  3F23 A;  4HA8 A;  2FEZ A;  1N75 A;  4RAG A;  4UHT A;  1S7A A;  1A04 A;  1MMN A;  3DQV C;  2OUM A;  3GBG A;  1QRY A;  2DOE A;  3EET A;  3HRM A;  2HTS A;  4U0W A;  1BIB A;  1VQO I;  4B48 A;  1Q1V A;  3HGG A;  3JW4 A;  2LNB A;  1NK3 P;  2FNP A;  1I3A A;  3CMY A;  2LMD A;  1XGM A;  3CCY A;  4RBO A;  4QTR A;  1UZC A;  2PLY A;  2M87 A;  3P5J A;  1LFB A;  3QPL A;  3A4C A;  2BHY A;  2KRF A;  3U2R A;  2HQN A;  3VEP A;  1D8K A;  3OL4 A;  4IOC F;  5HS8 A;  4MEY F;  2QVO A;  1W4M A;  1AHD P;  3TW7 A;  4UXN A;  5GTI C;  2DA1 A;  2DA3 A;  2NYX A;  2QZ8 A;  2RRE A;  1ACI A;  3S2D J;  5J1R A;  3B02 A;  2XVC A;  5K1Y A;  4UVC A;  3OOP A;  4M6X A;  3CME I;  1ZRD A;  4FET A;  4BXU A;  4P55 A;  2QQ9 A;  3V7R A;  2CU7 A;  2I10 A;  3H5A A;  4XMY A;  2RN7 A;  4UUT A;  1Y1W J;  3ABU A;  1LEB A;  3FBI B;  3TBI A;  1N78 A;  2M5W A;  3MMY B;  2O03 A;  4A0Y A;  4QWQ A;  2ZCW A;  2COM A;  5CQG A;  3WTT C;  1XCB A;  2ZJQ F;  2CUF A;  1QVU A;  2G7U A;  3MZY A;  5FLM J;  2QSG X;  2QBY B;  2K3P A;  4ZZD A;  4OMY A;  1P92 A;  1WZ2 A;  3NWS A;  3KP3 A;  1QO0 D;  2KT0 A;  2KDZ A;  4WWC A;  4AIK A;  2CS3 A;  4P5O A;  2GZW A;  3BPX A;  4HQM A;  4NQW A;  5J47 A;  4RGX A;  4BH9 A;  2Y30 A;  1XD7 A;  4A3E J;  3DV8 A;  2MFZ A;  3BQY A;  4DZP A;  3J81 Z;  3CF5 F;  3AG4 H;  5JI6 A;  4BNC A;  3UKG A;  3MKZ A;  2WB1 A;  2X1C A;  4A3C J;  2VOO A;  2DYS H;  1IRX A;  2VQG A;  4C2M J;  3CMA I;  5LGU A;  1PP7 U;  4KIG A;  4ZTF A;  4EGZ A;  1YJ9 I;  2P6T A;  4BEH A;  1NG6 A;  2HPI A;  3F8C A;  4UB6 C;  4ZC3 A;  3FDY A;  1LQ1 A;  3F22 A;  4IEJ A;  2F5C A;  1T6S A;  2MH9 A;  2V1X A;  2VQH A;  3BDD A;  2E7W A;  2LKP A;  1GXP A;  1GV2 A;  1S5L C;  4A3B J;  1IZ1 A;  4H0E A;  4OWR B;  3C18 A;  1FBU A;  2HYF A;  4WF2 A;  3OS2 A;  3SJM A;  5DD8 A;  3W3C A;  3L2U A;  4F3Q A;  5M5W J;  2WAQ N;  2E1C A;  5HLG A;  2RAE A;  1KYW A;  1RUN A;  3MKW B;  1MKM A;  4B47 A;  2NOG A;  3MQ0 A;  4IQ4 A;  2P6S A;  3SZG A;  4A3D J;  2FBI A;  2HVR A;  1A6Q A;  1FSH A;  1TNT A;  2NS7 A;  4XRS G;  4UUS A;  1H88 C;  3NQO A;  5E1Z B;  3WG9 A;  2CMP A;  3H9Q A;  2XF7 A;  3HSE A;  2LBF A;  2W57 A;  1SFE A;  4YG2 F;  1Z67 A;  5EZH A;  4GCV A;  2BV6 A;  3VYR B;  2FOW A;  2FUG 2;  4MO7 A;  2FX0 A;  2H6B A;  4NC7 A;  1R22 A;  3MWM A;  3QP6 A;  4NC6 A;  5IOY A;  3V4G A;  3QPH A;  5IP6 A;  4PJ0 C;  1BR2 A;  1YE9 A;  3HGY A;  3FKJ A;  4FT8 A;  3S1R J;  3UR3 C;  2GM4 A;  2ZME A;  5IT9 K;  3NAR A;  5DYM A;  3LMM A;  2H6C A;  4IHV A;  4I98 B;  2ISY A;  1XPX A;  2BXZ A;  3G1L A;  5E3L A;  1BI3 A;  2KRH A;  2DMU A;  4OU0 A;  3QOD A;  3ISP A;  2V1U A;  4EJW A;  3R4K A;  1JUP A;  4F7Z A;  1OFC X;  3G4S I;  3ECH A;  3DEW A;  4BY1 J;  4O3M A;  4NQW B;  4KUM A;  3ABM H;  1F9N A;  2DAO A;  3OYI A;  3ASN H;  3RQ4 A;  5D5X B;  4RGS A;  4D0P A;  1VND A;  3ZN0 A;  2JJ7 A;  3CF2 A;  2HOS A;  1XMA A;  4BJ6 C;  3D5L A;  3CDH A;  2QA4 I;  3QAH A;  2XSJ C;  1W0T A;  1EKE A;  4D7M A;  4KN4 X;  2VUM J;  3A0H C;  4HOB A;  3L2W A;  4LLG F;  2EPF A;  2ECC A;  4RAZ A;  3FX3 A;  4XRS A;  3F8M A;  4BEH B;  4BXX J;  3TL4 X;  1E3O C;  3BTC A;  3ZMD A;  4N9H A;  2WAF A;  3NWT A;  4OIP F;  1UJ8 A;  4Y7N J;  4LK1 F;  1HXD A;  3LST A;  1K4S A;  1FP1 D;  4A3M J;  1OCP A;  1ZLJ A;  4BHP A;  2BYV E;  2JRM A;  3WG7 H;  2GQQ A;  4GFB A;  2UXN A;  3PQJ A;  3GZN B;  4CYC B;  1OCT C;  5FLX Z;  1OKR A;  2VL8 A;  3RDI A;  3VSK A;  5FRN A;  4DIQ A;  1YJN I;  4M3D A;  3F8N A;  3FWE A;  1BOB A;  3JRA A;  3AL0 C;  3ZMS A;  1T39 A;  1IV8 A;  1X58 A;  1DPU A;  3K1M A;  3KIO A;  3GFI A;  4DYR A;  5B3S H;  1ZRF A;  4YIR X;  1BW5 A;  3W6J B;  2MSY A;  3ZMV A;  3RZD J;  5L3C A;  1JUM A;  4BQQ A;  3F21 A;  2GWR A;  2JA6 J;  1K78 A;  3CCU I;  2F4M B;  3EPZ A;  3OYC A;  3LSJ A;  2OZU A;  5LEK A;  3ZQG A;  4BHB A;  1X3U A;  2XAF A;  3ECO A;  1MND A;  4KMF A;  3M3Y J;  2K7L A;  2V6E A;  3CLQ A;  2NXN B;  4DNC A;  3PNT A;  1WI9 A;  4E4H A;  3A2K A;  4V2F A;  4GO1 A;  3HUG B;  3JSP A;  2KP6 A;  2ZME B;  2TCT A;  2IXS A;  2WV0 A;  2XAU A;  2Z1D A;  3H5N A;  3K4B A;  2QLZ A;  2M7A A;  3ASO H;  4FQG A;  1CF7 A;  3K70 D;  3ZMT A;  5GAG J;  2E36 A;  2KKO A;  2VN2 A;  3GTP J;  5TGT A;  2HKO A;  1T95 A;  2UV1 A;  3TO9 A;  5JLX A;  3SDG A;  4O5V A;  1LE8 A;  3HEF A;  1DDN A;  1P4A A;  3ERE D;  4LD5 A;  3BRO A;  3M8F A;  1Z9C A;  2LF7 A;  3PO2 J;  1FOY A;  2Y0S N;  4YRV A;  3J7A O;  5HDK A;  3WHB A;  3H9G A;  2COB A;  1EA3 A;  4RGU A;  2K9S A;  2XAJ A;  2R5Y A;  1SMY F;  3PNY A;  2L3D A;  2RC4 A;  3EUA A;  2XB0 X;  2R7S A;  1RNL A;  1X1C A;  5M3F J;  3OS1 A;  2NAZ A;  1J5Y A;  4AD9 A;  5ICC A;  1H0M A;  2M8E A;  3L00 A;  2OQG A;  4WCG A;  3HOV J;  1TWC J;  5IT3 A;  3P7N A;  3MZ8 A;  4MHG A;  5M5X J;  3P9C A;  1HW1 A;  4U87 A;  5GPA A;  3HTU A;  4OIN F;  2EZK A;  2FQ4 A;  2LDU A;  4RM2 A;  4DYC A;  5K7F A;  2X51 A;  1MBE A;  2VKH A;  2Z2S B;  3DLL F;  4A3F J;  2O6G E;  1I6H J;  3PIP F;  5B1A H;  1W36 C;  1YX5 A;  3HJE A;  3FHZ A;  2PMH A;  3R60 A;  4C3J J;  1K78 B;  1K4T A;  2XV4 S;  4CZZ A;  4B8X A;  4CDG A;  5DM6 F;  1UFM A;  4DW6 A;  2P5L C;  2RV8 A;  4H4K C;  1K7A A;  2FOK A;  4RB1 A;  1ZGW A;  5L3B A;  2WC2 A;  1AKH A;  5F0H A;  4DJA A;  1Q1H A;  3CD6 I;  2CQK A;  4OMZ A;  5FGM A;  1YX3 A;  3BZ6 A;  1R5H A;  3OIQ A;  1LUJ B;  2LG4 A;  4TV7 A;  1UMQ A;  1WPK A;  2K27 A;  5JFR A;  2JTV A;  1B8I A;  2ESH A;  4EJU A;  2EA4 A;  2UWM A;  4D5C A;  2X85 A;  2E71 A;  2LTP A;  1V5E A;  2IJL A;  3C2B A;  2MD0 A;  1RUO A;  3FM3 A;  2ZBK A;  3TDZ C;  2WWY A;  4A3J J;  1VTN C;  1IRG A;  3OSG A;  4BU2 A;  4KIC A;  4MFE A;  2XB5 A;  2EFP A;  5JR3 A;  2B63 J;  1V4R A;  4M3E A;  4MQ9 F;  4HV6 A;  2M7B A;  4HV5 A;  1VQ6 I;  4XK4 A;  5DEQ A;  4ZYG A;  2ZJ2 A;  3JCU C;  1VFC A;  2EV0 A;  4NHJ A;  2A5Y B;  1L3L A;  3GME A;  3K4C A;  1WI3 A;  3P9K A;  3A01 A;  2HEO A;  3LA2 A;  2R5Y B;  4FE7 A;  1WGX A;  5TIS C;  2EK5 A;  1XMK A;  2DJI A;  3U21 A;  3SQN A;  4LB6 B;  1K61 A;  3FBN B;  3O3K A;  4MFD A;  1HST A;  3BPV A;  2ZJP F;  4IVN A;  2UUZ A;  3KPH A;  2A3S A;  2BVM A;  5H6R A;  2IS6 A;  2R7V A;  1I1S A;  5TJJ A;  4BE1 A;  1J09 A;  1ETO A;  4PCQ A;  1R00 A;  1GVD A;  1YQA A;  3LA7 A;  5IYB J;  3FMS A;  2EFN A;  1PUF A;  3W2W A;  1P2F A;  2DPU A;  2DDA A;  2MG4 A;  2XAG A;  5J3L A;  4CH7 A;  1R5I D;  3CO7 C;  1XGS A;  3BP8 A;  1CGP A;  3BJA A;  2EJR A;  2LOO A;  3E6C C;  1YTY A;  1V54 H;  2IS1 A;  3GXO A;  3AG1 H;  5H20 A;  1WJF A;  2DMQ A;  1QVT A;  2VJI A;  3F0C A;  2ESN A;  3GYH X;  5KAI C;  2H1L A;  3QYF A;  3DCF A;  4C30 A;  2W84 A;  2MC3 A;  3DPT A; 
#chains in the Genus database with same CATH homology
 3S93 A;  3FHN A;  3S8P A;  1WJA A;  4F55 A;  2X1E A;  3VWB A;  4HNT A;  3OYJ A;  1D1B A;  3IAM 2;  4PFP A;  2XF5 A;  2CH0 A;  3DU5 A;  4HRI A;  1X1B A;  3AFH A;  3PUB A;  2Y0S A;  2W00 A;  1MNE A;  3SYT A;  1P9Q C;  2WY7 Q;  2VPL A;  2X6Y A;  3L2R A;  2XDV A;  2DXI A;  4C2U A;  3HC7 A;  1Z3Y A;  1D1C A;  3ZQQ A;  2BVL A;  3E1S A;  1LFP A;  2W82 A;  4YEJ A;  3K4N A;  4J01 A;  5JHF A;  2VJ4 A;  3CES A;  3IAS 2;  4BJ5 C;  2XC7 A;  2WA0 A;  2KZV A;  2DOA A;  1N75 A;  1V5G A;  4ZDP A;  1MMN A;  3DQV C;  2OUM A;  3I9V 2;  3LSH A;  3GBG A;  2HNH A;  3OYH A;  3CZ6 A;  1BR1 A;  4B48 A;  2CW8 A;  2GOM A;  5HOO A;  1W36 D;  3RPU D;  4XQF A;  3ZXS A;  3L2Q A;  4BDY A;  2AQF A;  2QKM B;  1R6R A;  2RNG A;  3IUO A;  3OYD A;  1D0X A;  3A4C A;  3BCB A;  1DQU A;  2E5N A;  4DGW B;  2IGN A;  2OV7 A;  3OL4 A;  3OL3 A;  3QYE A;  2HZD A;  1ZEL A;  4XKC A;  3PJR A;  3M8J A;  2RRE A;  3S3M A;  4C2T A;  1OR7 C;  4PSX A;  4B43 A;  4QPO A;  1WJB A;  3CJR B;  2DT6 A;  4HST A;  4MLO A;  4XLF A;  2Q1Z B;  2PMZ A;  3DWL E;  4FET A;  2VLA A;  2R7Q A;  2MC4 A;  3PFY A;  2HVQ A;  4KIS A;  3H5A A;  4XMY A;  2KDO A;  1GLN A;  4II3 A;  4XR6 A;  1LKX A;  1OLT A;  3FBI B;  3TBI A;  4BL0 B;  4BE2 A;  5LD2 C;  1N78 A;  3MMY B;  3ZRG A;  1S9H A;  3VYU B;  3H9J A;  4DOZ A;  3VYS B;  3VYT B;  5CQG A;  4CCM A;  2K3P A;  2CV1 A;  3MD2 A;  4G6T B;  5HVQ C;  1QU3 A;  4ZJZ A;  2RQQ A;  3K4M A;  3NWS A;  3EUH C;  1PYV A;  3CMM A;  2CS3 A;  3G2B A;  2VKD A;  4P5O A;  2NOJ B;  4F93 B;  4Y3O A;  4CUG A;  2ZXH A;  2MFZ A;  4RMN A;  3F9K A;  4Y4R A;  4BAC A;  2LBF B;  2JUG A;  3HPH A;  3K4K A;  3H0D A;  3BCA A;  2IGM A;  4JQF A;  2WB1 A;  3MKZ A;  3D5R C;  3HL2 A;  2X1C A;  3ZGK A;  4CCJ A;  3OR1 C;  4XN3 A;  1IRX A;  1K6Y A;  3DKX A;  2VQG A;  4BUP A;  4IZZ A;  1SFK A;  2ZSH B;  4ZTF A;  3K4L A;  2W1O A;  3CP8 A;  2A5W A;  2DCE A;  4R79 A;  4OAY A;  1X19 A;  1G8X A;  4BEH A;  1NG6 A;  2IGO A;  2HPI A;  4ZC3 A;  3FDY A;  4XLE A;  3HPG A;  5CPR B;  2VQH A;  4XON A;  2W4S A;  3DPU A;  1X4P A;  1MMD A;  4N4N B;  4OWR B;  3OS2 A;  1U0J A;  4BQN A;  3UNG C;  1LVK A;  5HNF A;  2CV2 A;  4GRI A;  3W3C A;  3L2U A;  4F3Q A;  1UG0 A;  2LRE A;  1KON A;  3PNV A;  4KIT B;  3MKW B;  3OYF A;  4E7S A;  4B47 A;  3OY9 A;  2E1M C;  2L2O A;  4IQ4 A;  3SZG A;  5CKT A;  4NC8 A;  4CCO A;  2W7N A;  1WJ5 A;  2HVR A;  2KRC A;  3K4J A;  2HQA A;  4BXF A;  3EUK L;  4B44 A;  4J00 A;  2HDW A;  3W2V A;  2CMP A;  3H9Q A;  2XF7 A;  2LBF A;  5HLT A;  3S32 A;  4CCL A;  4YEL A;  3CP2 A;  3VYR B;  4DBQ A;  3PSF A;  1NG7 A;  2E1M B;  2FUG 2;  2KPM A;  4XN0 A;  5KHD A;  1LDK B;  3HOT A;  1BR4 A;  4NC7 A;  2L5Q A;  1BR2 A;  1YE9 A;  2X6X A;  3FKJ A;  4PJN A;  3UR3 C;  5LFA A;  4BGD A;  3LFU A;  3LMM A;  1PJR A;  2VQL A;  3VSL A;  2KRH A;  4HG2 A;  2O5R A;  5CQE A;  3QOD A;  3DTK A;  2KMU A;  1FMW A;  2K9M A;  1MMG A;  4BS9 A;  2XF6 A;  3BG6 A;  3I3L A;  4NQW B;  3H5R A;  1X1D A;  3OYB A;  1QHH D;  2R7R A;  2DT7 B;  4XOR A;  3OYI A;  3RQ4 A;  2VAS A;  2VJJ A;  3M1C A;  4E7J A;  2L9S A;  2I8D A;  2P0W A;  3CF2 A;  4BJ6 C;  1TZL A;  2BW3 B;  1X1A A;  3QOE A;  4XL9 A;  4E7L A;  3D5L A;  4EAT A;  2WAE A;  4LIV A;  2XSJ C;  2M4G A;  4HSR A;  2X6W A;  3RCO A;  3L2W A;  4XKW A;  3RSN A;  1E0E A;  1Z21 A;  4BEH B;  4CCK A;  3TL4 X;  3KX2 A;  2ELJ A;  2WAF A;  3NWT A;  1TT0 A;  4D9J A;  3OWT A;  3OS0 A;  2WY8 Q;  5KCM A;  2R7X A;  3S3O A;  2L9N A;  2E5Z A;  3BC8 A;  3C2H A;  2GOX B;  2VL8 A;  3VSK A;  5FRN A;  2CW7 A;  2V4J C;  4DIQ A;  3PL8 A;  4PK4 A;  1BOB A;  3AL0 C;  4CZC A;  2E60 A;  4E7Z A;  4P1W A;  2HVS A;  4RM3 A;  4IX7 A;  2WBM A;  2ZSI B;  3D5S C;  2Z16 A;  4F52 A;  2LY2 A;  2MAB A;  5FRM A;  2R7U A;  2CV0 A;  2V26 A;  3C2G A;  1FMV A;  4BQQ A;  3RTR A;  3A1Y A;  3EPZ A;  3OYC A;  2F6C A;  4AU7 A;  4XNF A;  3OYK A;  3AL0 B;  1MND A;  5KNL A;  2ZFU A;  2IS2 A;  3ONQ A;  2V6E A;  2BW3 A;  1DGR M;  3J7A Y;  4XLC A;  2IGK A;  3PNT A;  4C9Y A;  4E4H A;  3A2K A;  3OYA A;  4KJZ A;  4ZDO A;  2F5V A;  3HUG B;  3OYN A;  3DKY A;  3K6G A;  3OYL A;  2KP6 A;  3K70 C;  4CSW A;  1AA7 A;  1UEL B;  1D0Y A;  2F4I A;  2IXS A;  2VXD A;  2R7T A;  2PJR B;  3LSI A;  2AQE A;  2R7O A;  2XAU A;  2JVG A;  2Z1D A;  3L2V A;  1N77 A;  3H5N A;  2BOL A;  3HXL A;  2M7A A;  3K4B A;  3OYM A;  1WJD A;  3K70 D;  1DP3 A;  4LIU A;  3OOU A;  4ZDL A;  5TGT A;  2K5C A;  3DTE A;  3W2A A;  1T95 A;  2CUJ A;  2UV1 A;  3OMY A;  1VZ0 A;  3DEE A;  1Y56 A;  4PJL A;  2M3A A;  2WAQ A;  4D1Q A;  4CCN A;  2LRD A;  4XLA A;  3N05 A;  4BJT A;  4YRV A;  3H9G A;  2VB6 A;  1EA3 A;  3HG9 A;  3CJQ B;  4XLH A;  1WJE A;  3PNY A;  3TMO A;  2V9K A;  3EUA A;  1Y6I A;  2R7S A;  4XOP A;  1X1C A;  1MW7 A;  4XOT A;  1WFX A;  3OS1 A;  1G59 A;  2V1N A;  2K9L A;  4PJJ A;  4B3X A;  4Y33 A;  1WJC A;  4PUS A;  4AVZ A;  1UAA A;  4PSW A;  2PJR A;  4JOM A;  4CA0 A;  4U87 A;  1JI8 A;  2LY1 A;  4E7H A;  2KQR A;  1SAU A;  4RM2 A;  3VDX A;  2X51 A;  2VKH A;  2Z2S B;  3OYG A;  4ZTJ A;  2IS4 A;  3SEQ A;  1W36 C;  1YX5 A;  4IQJ A;  2VQC A;  4LIT A;  4E6K G;  2JSP A;  4OAZ A;  2R4G A;  3K10 A;  4QPQ A;  4XM3 A;  3DU6 A;  3KEY A;  4H4K C;  4F92 B;  1Z7L A;  2LYC A;  3OR2 C;  4BQO A;  4NUB A;  1D1A A;  4DJA A;  2ZXI A;  2LC2 A;  3E0J B;  3SEZ A;  4HEA 2;  2KHM A;  4KT6 A;  4PJM A;  1YX3 A;  3DPL C;  3OIQ A;  2LG4 A;  1DGW Y;  4U7B A;  3LSK A;  2UWM A;  3HOS A;  4X0G A;  2X85 A;  2CFO A;  3H35 A;  4NNJ A;  1QHG A;  1V5E A;  4HNU A;  2MD0 A;  5HNH A;  2VJ5 A;  4LG3 A;  3V42 A;  4N4O B;  3S3N A;  2WAD A;  3BG7 A;  5FRO A;  3LSM A;  3LL7 A;  4BU2 A;  2R7W A;  4PFO A;  2Q2E B;  2JA2 A;  1Z3X A;  2MYS A;  3QYB A;  4E7I A;  4XKV A;  2LH9 A;  4ITV A;  2HU9 A;  2M7B A;  1ERD A;  3OIP A;  2HPM A;  2OC6 A;  2CUZ A;  1MMA A;  2QKL B;  3IP4 B;  3K4C A;  1T0F C;  1D0Z A;  4AYB A;  3DTI A;  2JVH A;  3MKY B;  3HKZ A;  2M4K A;  2VIX A;  4ZYA A;  1HA8 A;  3AKZ A;  3BLY A;  2DJI A;  4BDZ A;  3U21 A;  1V5F A;  4XKB A;  3FBN B;  4E7K A;  4IKF A;  2UUZ A;  2V7F A;  4DBR A;  4ANJ A;  2BVM A;  2IS6 A;  2A6T A;  2R7V A;  4FAS D;  4BE1 A;  1J09 A;  2X1D A;  4II2 A;  3LSG A;  3W2W A;  4BE0 A;  2M0M A;  3KYL A;  4CH7 A;  2LOO A;  3SDB A;  2VXZ A;  2IS1 A;  3PSI A;  2KLO A;  3ZCO A;  3ZR8 X;  3OYE A;  4RLF A;  3DLA A;  1WJF A;  2VJI A;  2L7K A;  4HPQ A;  4RLQ A;  1X4O A;  3QYF A;  4C30 A;  2KL4 A;  4F91 B;  3DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...