3ZPLA

Crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
PRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
publication title Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription/dna
total genus 62
structure length 159
sequence length 159
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zplA00
2CWEA 2KJCA 4LLLA 1P6RA 4KT5C 3I5UA 4WXCA 1IN5A 4RB2C 1R5HA 1D3YA 3F6VA 2M45A 1J75A 4M9SA 1U2WA 2O61A 1R22A 3BY6A 1SFXA 3BWGA 1FP1D 2GWRA 3C18A 3EYYA 5D5XB 1MDMA 3TKYA 2QQAA 3ML6A 3QU6A 3DPTA 4EJUA 3W6JB 5ICCA 4HDVA 4U7BA 3SZPA 4D0PA 4ZYHA 2XRNA 1I27A 2HQNA 2NRAC 3CUQB 1LDJA 4AIKA 4EMSA 2M1BA 1TLHB 3I71A 5CVJA 3VOEA 2G7HA 1UFMA 1I6XA 4AIJA 2XKPA 2DAOA 5ED4A 2DT5A 1F9NA 3ABTA 3K1PA 4LLNA 3RKXA 3FX3A 5L3EA 1ZREA 1Z05A 4Y13A 1KU2A 4RAZA 2EB7A 1ZAOA 2P6SA 1FSEA 3ZMDA 3B02A 4HX7A 1IRFA 1R36A 2DPUA 2FEZA 3ZMVA 3WU0A 3V8JA 1K7AA 2ADUA 1BI3A 3VODA 4OINF 3IC7A 4KUMA 2C6YA 4CO8A 4Y17A 5F64A 3T8TA 4P5OA 4YIIA 3WGIA 2GXGA 1U5TB 3WTTC 3FMRA 3J80K 1IN8A 3KEQA 4M9ZA 2QZ8A 4KMUX 2HS5A 5D8LB 3HRMA 3RKWA 4CXFA 4AWXB 1B6AA 4A0XA 5KK1A 5ILSA 5DCMB 2NNYA 1SFEA 5E8IA 4Y15A 2Y75A 4WX9A 3CUOA 1BOAA 4IXAA 2O03A 1OYIA 2ETHA 3ZN0A 1U6GA 3LQQA 2DBBA 4JBAA 3KE2A 3ECOA 3V7SA 2CQKA 1MJ9A 3H3UA 2P8TA 2F5DA 2D2WA 3IRRA 1MJBA 4RS8A 3T8RA 3ERED 2H6CA 4RGXA 5FLXZ 4KDPA 5JFRA 3MZYA 2OD5A 5H6QA 4U88A 1ON1A 4XLPF 4Q47A 3KLNA 5JHUA 1FLIA 3GX4X 3ZMUA 2XKOA 5AONA 1E17A 2VOOA 1T39A 1F4KA 3HOTA 2HZTA 5BPIA 2BBYA 4MHGA 4L0ZB 3TO6A 1UB9A 1USSA 1XDSA 1FBSA 5J8CA 3FM5A 2W57A 2QM3A 1ZG5A 1GXPA 4EM0B 3E3VA 1QNTA 3GZ5A 1KQ9A 4LFUA 2XV4S 3SQNA 4LGWA 4M72A 1F1ZA 1EH7A 4RB1A 1LJ9A 5HS9A 5TRDA 2Q2EA 2R3SA 4LJZF 1BN5A 1IRGA 1U3EM 2FMYA 4P96A 3L2CA 3F72A 3DP7A 1H9TA 1FP2A 2NAZA 3M7GA 1B59A 3DEUA 3F8FA 3CO7C 1K79A 3HUGA 4QWQA 2XASA 2IRFG 1S6LA 1G4DA 1SFUA 4G8XA 1XGOA 4I02A 6PAXA 4WXHA 3HSRA 1ZG1A 1C0WA 3L7WA 4MTDA 3ISPA 3SZTA 1HW1A 4IRHA 3I64A 3MAJA 4I0BA 1R1VA 2BE5F 3H3ZA 3JTGA 1O3QA 2DK8A 3H92A 3BJOA 2L54A 4UUVA 2MBFA 4XLNF 5FFZA 2X4HA 1AOYA 1XSVA 2XIGA 2LF8A 1ZRFA 2K86A 2AXLA 2Z33A 5D5WB 3E6CC 1JHHA 3U1DA 1ZYRF 2F5FA 4G6DA 5K5RA 1HSJA 2KIUA 1WRJA 5K5QA 3QU3A 4Q4ZF 5HDKA 3K1MA 2HYGD 3WTWC 2OU2A 3GF2A 4HBLA 3K2ZA 3GZ6A 2MC3A 2EV5A 2V6CA 2PBIA 3CTAA 1G3WA 4EJVA 2STTA 5J8FA 3BZ6A 1J5YA 3GWZA 2EFPA 1KU9A 1GHCA 3EDPA 1BI0A 2O0YA 2YPRA 1YW9A 3E5QA 4ENKA 3FM3A 5LGUA 3V7CA 4F7ZA 2UWMA 2E7XA 4GGGA 1T0FA 4YG2F 3HRSA 1ON2A 1R23A 2K27A 4RGUA 1SD5A 2HKXA 5LHGA 1YYVA 5BQTA 3V8KA 1IF1A 3CJNA 3TOBA 1QGPA 5E1WA 5ILUA 2HEOA 5D8KB 3KP7A 2NS0A 3TDZC 2EWNA 3HTSB 2XAQA 4ON0A 1EH6A 4ZYGA 4S04A 5CVVA 4MQ9F 3VB2A 1FYMA 4CYDA 1TQMA 2VBZA 2YX4A 3KEOA 4LMYA 1G3YA 2VBXA 1TW3A 5HLGA 1YLFA 4ESBA 1XSXA 1OMIA 4UVCA 4BHCA 1T98A 2VE9A 5FB2A 1JGSA 4A5NA 2G7UA 1S8NA 2ZNYA 2ZXJA 1FX7A 3PQKA 1I1GA 2HKOA 2J5OA 3F8NA 3F8BA 2CGPA 1ULYA 4JK1X 2Y48A 4PCQA 2Y0MA 1LVAA 3FZVA 4EM2A 1W7PB 4Q48A 1U5TA 2NNNA 3L09A 3L00A 1J59A 2GZWA 2FU4A 4N0BA 4UV8A 4A2UA 2HTJA 4YIFA 5ILVA 4L18B 2QQ9A 2FQ3A 2KKOA 4KIFA 5DCMA 3JSPA 5BMZA 1AWCA 2COMA 3CUQC 1PUEE 2LKPA 2WWYA 1W7PD 1BIBA 3IKVA 2OQGA 3P9IA 3EQLF 2F5EA 1W4MA 5D4RA 3NQOA 3F23A 4LB5A 5D6EA 3HHGA 2MH2A 3HTUA 5L3CA 2V1DA 3MQ0A 1EH8A 5LBQA 5HLIA 2GA1A 3C3WA 4AVPA 2GA2A 1IN6A 2FOKA 2MLKA 4IRGA 1ZLJA 2ESHA 4HA8A 1BI1A 2BYVE 5D5VB 4FX4A 4G7ZF 3TO9A 2XAFA 4HV5A 3L9FA 4Z2YA 2ZJ2A 4E70A 4P9UA 5FLXK 1U8RA 2A69F 4TV7A 3FMSA 4U7DA 1V3FA 2CO5A 1U5TC 3MWMA 4UHTA 4B8XA 5K1YA 2ISYA 3K69A 1UCRA 1Z91A 3IWFA 3WGHA 4A6DA 1DDNA 3DF8A 2HGCA 1O7LA 1TQIA 1FPQA 4NB5A 4G7HF 5LRRA 3I58A 2PFBA 3WTXC 2LDUA 1TTYA 1YS6A 4M73A 3IKTA 5DD4A 2MLGA 2GQQA 1OR7A 2KJBA 3T5XA 3DV8A 3LA3A 1HW2A 4O5VA 3QPHA 2Z9OA 2FBHA 2IW5A 3LQRA 4EV0A 3O3KA 2DU9A 4EJOA 1DPUA 1IW7F 4A0ZA 2R7DA 3RDIA 3DXJF 3WTSC 2JPBA 1G6NA 2EA2A 4RGSA 1BBYA 1KQ8A 1HKQA 3VEPA 2G9WA 1B9NA 1F5TA 1L3LA 4M9XA 3HOSA 1I1SA 3F8MA 5JVTA 3QOPA 1FT9A 1W5SA 2KIMA 5FGMA 1HXDA 2ZMEB 1LDDA 3T0YA 5E17F 4LG0A 1LEAA 1YQAA 3KP4A 5E1ZB 1T2KA 4HF2A 4EVIA 1SD6A 3S2WA 4CDGA 1Q1HA 1ZH5A 3ROUA 3T1BA 1KU7A 2M8EA 1KA8A 2P5KA 2O3FA 3HRUA 4PDKA 4WWCA 1XGSA 3BROA 3WU1B 1I5ZA 1RI7A 4A12A 1BJAA 2OQRA 3NRVA 4LD5A 3E5XA 1YO5C 4L0YB 5CVIA 4ASNA 5FO5A 2HR3A 1LNWA 4L9TA 3SFZA 2PEXA 1PDNC 2P4WA 4DQ2A 2PI0A 2TDXA 2IVMA 2CFXA 5DDGA 4N9HA 3I53A 4IJAA 3J7AO 4RB3C 2VC0A 5DD8A 1Z9CA 4BHBA 3M8EA 4EGYA 3GW2A 2IPQX 4UVAA 5BS6A 1K78B 3GFIA 2AS5F 3K1NA 1XMKA 1ZG3A 4G7OF 3I59B 5LHHA 3LWFA 4WK8F 1QZZA 5L3BA 4RAYA 1JE8A 2HYFA 4EM1A 5HVQC 3BOQA 1J2XA 2DO7A 3ECHA 3R60A 3SHFA 4R79A 4KYWA 2W25A 1DPRA 4K2EA 2YU3A 3DPLC 1LDKB 1IAWA 3F6OA 2QENA 3W6KB 2LF7A 2J5PA 1CGPA 2EFNA 3RYRA 3IRQA 1W7PA 4LK1F 1QPMA 4NQWA 3J81Z 1MDMB 1T38A 3QRFF 2DI3A 3HYIA 5DV5A 2RGVA 4UNOA 2IA1A 1XCBA 3WTVC 2HQRA 1CF7A 2VT2A 1HBXG 5A2QZ 5D6FA 1D5VA 3RJPA 4BH9A 2MD5A 2PMHA 3M9AA 4ETSA 5LLQA 2D1HA 2JPCA 3FXQA 4ZZLA 4PGGA 3EYIA 3ELKA 2ESNA 5F1RA 3TOAA 3E97A 4WCGA 2CG4A 2RKHA 1MGTA 4HAMA 2GIVA 2HDCA 5H6RA 1X3UA 2EK5A 4ENJA 1FBQA 3F3XA 4ESJA 2Q8KA 5ERIA 4P9FA 3HHHA 2WC2A 5KVRA 1ONVA 2W24A 4CZZA 4RGRA 1BI2A 4MNUA 3KZZA 1R5GA 1SMTA 2QBYA 3EETA 1P92A 3WTYC 4KICA 1TBXA 2VBYA 1KYZA 4LK0F 5K5OA 4HQMA 1WSUA 4HDUA 4UXNA 5CVUA 2E1NA 1TNTA 1QO0D 1D8JA 4L9JA 3LAJA 1S29A 1P2FA 1Z6RA 2HFHA 2PMUA 2QUFA 1ZARA 5HDNA 1Y0UA 4IPAA 4MEYF 1FYKA 4G6QA 5D4SA 3N97A 4AIHA 1O3RA 1G3SA 1HKTA 5L3GA 2V79A 3KP2A 2KRFA 2XAJA 4A0YA 3CUQA 1RZ4A 1IN4A 2DTRA 2JTVA 3TDUC 1FYLA 2EFOA 1TW2A 2A6EF 2HTSA 1KU3A 2FA5A 2PG4A 5EEHA 3RPUA 3GEZA 4I0AA 1REPC 1J7KA 1FWZA 2RC4A 1MKMA 2ZKZA 1YG2A 1FOKA 2ZO4A 3I54A 5DUKA 2ACJA 1TNSA 4R1HA 4ZYDA 4OIQF 2L01A 5AIQA 5L3FA 4HLYA 3K0LA 1YFHA 4NHJA 3U9GA 2L02A 2RQPA 3ZMSA 4HOBA 1SAXA 2UXXA 2E7WA 2FNAA 2XAGA 3R0JA 3V7RA 3MFKA 3JAMK 4MGRA 2H27A 5IT9Z 2EJRA 4M6YA 3I0TA 4H0EA 1IZ1A 1J0RA 1HSTA 2MA3A 2A6HF 1U78A 3DQVC 5H20A 1BIAA 2FNPA 2O8XA 1OYWA 2DW4A 2K7LA 2H09A 5F6FA 1PP7U 2QVOA 3MCZA 3RTRA 3E6DA 2NYXA 3GO5A 4I98B 2Q0OA 3PQJA 2BV6A 1RUNA 2QLZA 1O7FA 3COAC 2H94A 1WI9A 2VE8A 4R8HA 2ZCWA 1Z7UA 5E20A 4AD9A 4XRFA 3KP6A 1MZBA 2IP2A 1SD4A 4JQFA 4Q5SF 2Z5UA 1NHAA 5LGTA 3E6MA 1YW8A 2QQBA 1P4XA 4FT8A 3RKYA 1HKSA 4KFCA 4BAYA 4HLXA 2BGCA 3B73A 5DUIA 3KZYA 3Q5FA 1Z1DA 2M87A 4I2OA 2XROA 4OIPF 1VTNC 2DQRA 3E5UA 2IJLA 3I59A 3SXYA 1SMYF 1B9MA 5FD5A 2JZYA 3IHUA 1KYWA 4XSXF 2K4JA 2ISZA 1ZN2A 3RPQA 3BJ6A 2OZ6A 2IA2A 4KN7X 1S7OA 3CDHA 4KMFA 3FHZA 5D5UB 4I09A 3GXOA 5AIPA 4L9VA 3LFKA 5HOOA 5E1XA 5LHIA 3KCCA 1EV7A 4GYIA 3QAHA 4L5IA 2RDPA 2JRTA 2A61A 5DEQA 1O3SA 1QQIA 1WQ2A 1P4AA 3IWZA 2V1XA 3OV8A 4U0WA 4MEXF 2CSOA 3ZQ7A 1YS7A 1H9GA 3N4MA 3NEUA 2B0LA 4OIOF 3ZMTA 5ICEA 3KFWX 1BC7C 2YR2A 3FWEA 4IVNA 3ZN1A 4CHUA 3J81K 2R7FA 3TO7A 4HYEA 2P7VB 2WTEA 1RUOA 3REOA 1GXQA 2L4AA 3EUHA 4OU0A 1QBJA 3ZPLA 3JAMZ 2ELHA 3O6BB 5A2QK 1YW7A 3JTHA 2OBPA 4FX0A 4P55A 3KP3A 4FHTA 2EV0A 2DFIA 3HRTA 2FXAA 4IRIA 1XGNA 2DK5A 4OOIA 4ZZDA 3R6SA 2UXNA 3GVAA 3WTZA 1ZRDA 2F2EA 5HDGA 4BQAA 1Z6TA 4YFXF 5LRSA 2PN6A 2IA0A 1FC3A 1IN7A 4L5JA 3U2RA 5E18F 2MH9A 3JW4A 1B4AA 2LNBA 4G9YA 1TQPA 4GXOA 3RI4A 4ENMA 2K02A 1DUXC 3OOPA 2DLLA 2P6TA 5CJ9A 2EFQA 2X0LA 2VODA 3O2PE 3MZHA 5ICGA 1YTYA 1OKRA 4BYYA 1GVJA 4EQQA 4HZFA 2W85A 1P4WA 2RN7A 4UVBA 2KIFA 4GCVA 4IHTA 3WE3A 4CGZA 5DCFA 3D5LA 1WKMA 1LEBA 1IXCA 1IXSB 4HX8A 4BHPA 3MEXA 3RYPA 2VOPA 1SD7A 4OMZA 2ZBKA 5E8GA 1HW5A 4LB6B 1K6OA 1ODDA 1STZA 2FMLA 4HV6A 3K9TA 3LAPA 4WF2A 1KQ0A 2P7CB 2FF4A 3KP5A 3WTUC 1R00A 1R1UA 3FMQA 1XGMA 2YX7A 2F5CA 3HSFA 1XB4A 2HWVA 1FNNA 3VFZA 4EJTA 1MJAA 1ZGAA 1XCVA 1XSDA 2OAZA 2CW0F 2EV6A 5HLHA 3F21A 2XAHA 3E6BA 4OIRF 4ZH4F 1BM9A 2XUBA 2FSWA 2ZFWA 1O57A 3Q9SA 1KGSA 1ZGJA 3IL2A 2P5LC 5BOXA 2VT3A 1JXSA 4HX4A 1H0MA 1W5TA 3CO6C 3FXRA 3ABUA 1G3TA 4RB0A 5L3DA 1J9IA 2XGXA 2GXBA 3BPXA 5IT9K 2A3SA 3PFIA 3GLXA 4KN4X 1ZLKA 5FFXA 2XVCA 4G94A 3HSEA 4PGHA 4IHSA 3ZP5A 2ZNZA 1BC8C 3M1EA 4M71A 1UHMA 1L0OC 2OZUA 1R7JA 1E2XA 3V8LA 2Z3YA 2IT0A 2VONA 3Q9VA 1OYYA 4S05A 2CYYA 4QLCU 3J80Z 4CICA 3KETA 1LQ1A 2H6BA 1YIOA 4I7HA 1R58A 2UZKA 2M30A 2PJPA 5DYMA 1FSHA 5HS8A 3GYHX 2QYOA 4LG0B 2VN2A 3P9KA 2M5WA 4YFKF 2JSCA 2D1VA 3ULQB 2Z99A 4DNCA 4O3MA 2FBKA 1LB2A 4MTEA 4IF4A 3ZMZA 1V4RA 3C1DA 1USTA 3GFLA 4U0YA 2LSOA 4UV9A 3V4GA 3FF5A 3I4PA 4KA4A 1T6SA 2EA4A 3C7JA 4XBFA 4GO1A 5FD6A 4WXDA 2A68F 2FRHA 5CLSA 1XMAA 2DPDA 4I01A 3F22A 1DP7P 3P7NA 2RVCA 2E1CA 1D8KA 3DKWA 4M74A 2WV0A 5LEJA 1ZHFA 5LEKA 2YSRA 5HS7A 3QP5A 4KNYA 1XN7A 3R4KA 3LSTA 2GAUA 3G73A 4KIGA 1OPCA 3BP8A 2VXZA 4M6XA 4BNCA 3RIRA 4ZYEA 1A04A 2DQLA 2W84A 4ESFA 3LA7A 3QPTA 3BPVA 3WGGA 2RNJA 3GFMA 5CVRA 1IXRC 2HOEA 1R1TA 3FXUA 4O6JA 3D0SA 2ZMEA 4EJWA 2RV8A 3G3ZA 2STWA 1WWXA 4A6EA 4YFNF 1XDUA 1ZRCA 3R61A 1S7AA 4HF0A 3GUDA 4GYGA 1O3TA 4EGZA 1FY7A 4L9NA 3M8FA 2XHKA 1JHFA 2D45A 2OA4A 3CLOA 1S3JA 4BXUA 2V1UA 3WODF 3HIFA 3KLOA 3R0AA 2PLYA 4HW0A 4XSZF 3WE2A 3BJAA 2K4BA 2VBWA 1FZPB 1CF7B 4MQVA 1MD0A 5IT3A 2A07F 2QWWA 4LLGF 3TQNA 2P5VA 4B09A 3QP6A 1IUYA 1QZYA 1XD7A 1PP8F 2EFWA 5TJJA 4PZJA 4N9IA 2JT1A 2O6GE 4ENNA 4HQEA 1UHWA 5JR3A 2VC1A 2FE3A 3WG9A 1RIOH 1B1BA 3GFJA 5BPDA 3AAFA 1K78A 1FBUA 2A5YB 3TGNA 3LA2A 3BDDA 2V9VA 4A5MA 2FBIA 4HF1A 5ICFA 2BEOA 5J6XA 2PQ8A 2L3DA 2QBYB 4U0VA 5JI6A 5EEGA 3DFGA 2L4MA 5LGNA 3F8CA 3P9CA 3JSOA 5CYVA 1HQCA 4OMYA 1RNLA 4KIBA
chains in the Genus database with same CATH superfamily
2X6YA 2CWEA 2KJCA 4LLLA 1WHUA 5H2FC 4BDZA 1P6RA 4KT5C 2NVUB 3I5UA 1OLTA 5IYBJ 1YI2I 4WXCA 1CQTA 3U21A 1IN5A 1MBGA 3LSKA 4RB2C 1R5HA 1D3YA 3F6VA 3TW6A 2M45A 1J75A 3OL3A 4M9SA 1U2WA 2O61A 3NWTA 1R22A 3LNQA 3BY6A 2Y2ZA 1SFXA 3BWGA 1FP1D 2GWRA 3C18A 3WU2C 2IS2A 3EYYA 5D5XB 1MDMA 4FASD 2LFBA 3TKYA 4H4KC 2QQAA 2KFDA 4XLEA 3ML6A 3QU6A 2DA6A 2JUGA 3DPTA 4EJUA 3W6JB 3VWBA 5ICCA 3S17J 1ACIA 2E1OA 4FISA 1E0EA 4EATA 4ITVA 4LG3A 4HDVA 1SANA 2M0CA 2DMPA 4U7BA 3SZPA 1SC7A 2CW7A 4D7MA 3ASNH 1OCRH 4D0PA 5E3MA 4BJTA 4ZYHA 5J1YA 2XRNA 4A3LJ 1I27A 2HQNA 2NRAC 3CUQB 1LDJA 1X1BA 4AIKA 3W2WA 4EMSA 2M1BA 2E60A 3IAS2 1TLHB 3I71A 5K7HA 5CVJA 4NBQA 3VOEA 3A0BC 3A0HC 2G7HA 4CZCA 3CCLI 1UFMA 1I6XA 1Y56A 4FETA 4AIJA 2XKPA 3DPUA 2DAOA 5ED4A 4OWRB 2DT5A 3HOXJ 1F9NA 3ABTA 3K1PA 4I6ZA 4LLNA 5JLWA 3RKXA 1U0JA 2GXAA 3FX3A 3DEWA 3BG3A 5L3EA 1RR7A 1Z05A 3CCMI 1ZREA 3E0JB 4Y13A 1KU2A 3F0CA 2L2OA 4RAZA 3K2AA 2EB7A 5M5WJ 4XN0A 1D0ZA 1ZAOA 2P6SA 1FSEA 3DU5A 3ZMDA 3B02A 4HX7A 2HXOA 4IHXA 1IRFA 3KYLA 3S16J 1R36A 2HVSA 2DPUA 3JREA 3JRIA 2WAEA 3RPUD 2FEZA 3ZMVA 1KONA 3WU0A 1WJCA 4PFPA 3CCSI 3V8JA 1K7AA 1YJNI 2BHYA 2ADUA 1BI3A 3VODA 4OINF 1YJ9I 3IC7A 3ASOH 2L9SA 4KUMA 1IC8A 2C6YA 2HDDA 3DTEA 4BUPA 1JTYA 4CO8A 2VQHA 2MC4A 4Y17A 5F64A 1E3HA 1FMWA 1FJLA 4OAZA 3T8TA 4P5OA 4E4HA 1PUFB 4YIIA 3WGIA 2GXGA 1U5TB 4KITB 3WTTC 4UUSA 3FMRA 3J80K 1IN8A 2K40A 3KEQA 4M9ZA 3CCRI 2QZ8A 3ZQHA 2V7FA 1ETQA 1BL0A 4KMUX 2E71A 3MKWB 2IGMA 1ETXA 2HS5A 3HRMA 3Q0UA 3BG7A 4XLHA 5D8LB 2F4IA 3RKWA 4CXFA 4AWXB 2GIZA 3A2KA 1B6AA 5E3LA 2VL8A 4A0XA 1OR7C 3H5NA 5KK1A 5ILSA 5DCMB 3HPHA 2NNYA 1SFEA 5E8IA 4Y15A 2Y75A 4WX9A 2LY1A 3CUOA 1BOAA 4IXAA 4U87A 2LBFA 2DOEA 1X1DA 2O03A 1SAUA 3LL7A 3FXJA 3JRGA 1OYIA 2Z2SB 2VASA 2ETHA 3ZN0A 1U6GA 5F1JA 1ETKA 2Y9ZA 3RZDJ 3LQQA 2DBBA 3OWTA 4JBAA 5FRNA 3KE2A 2LREA 3ECOA 3V7SA 2VKVA 3PUBA 2CQKA 3S1MJ 4YRVA 1MJ9A 3H3UA 1ZR4A 3G2BA 2P8TA 2E19A 2F5DA 2D2WA 3IRRA 1GLNA 3A01B 3K4BA 3FISA 1VQOI 1MJBA 4OAYA 4RS8A 3T8RA 3ERED 3LSPA 4E7HA 1Z3XA 1F36A 2H6CA 4IL6C 4RGXA 5FLXZ 2HZDA 4KDPA 4B4CA 3BG9A 5JFRA 3MZYA 4JX6A 5KNLA 1HCRA 4XOTA 2LOOA 2EIKH 2DYRH 2OD5A 5H6QA 4U88A 4C3IJ 4ZJZA 1ON1A 4XLFA 2CUJA 4BQNA 4ZDLA 2NXNB 1HDDC 4ZDPA 4XLPF 4Q47A 2ECCA 3KLNA 5JHUA 1FLIA 2HVRA 3GX4X 3GZNB 1JGGA 3ZMUA 2XKOA 5AONA 1E17A 4N4NB 2VOOA 1J09A 3OS1A 1T39A 2ELJA 2HZTA 4S0HB 2BBYA 3AG3H 4MHGA 3TO6A 3HOTA 5BPIA 4L0ZB 2KPMA 4IHWA 4BL0B 1RRJA 2X48A 1UB9A 1USSA 1XDSA 1FBSA 2DFHA 3FM5A 2W57A 3QYBA 4KT6A 5J8CA 1K4TA 2QM3A 1ZG5A 5M5XJ 5J4YA 4XORA 1Y39A 1GXPA 4EM0B 3E3VA 5HNHA 1QNTA 1WFXA 3GZ5A 1KQ9A 4LFUA 2Y30A 2VXDA 2XV4S 3SQNA 2HXIA 1MSFC 3HOYJ 3TEDA 4LGWA 4M72A 1F1ZA 2G0EA 3CESA 3K4LA 3L2VA 1EH7A 4BY1J 1D1AA 4CCLA 1LJ9A 4RB1A 5HS9A 1JT0A 2NVXJ 3A1YA 4Y3OA 1VFCA 5TRDA 2Q2EA 3ESWB 2R3SA 1IRXA 4LJZF 1BN5A 1IRGA 4JP0A 3PL8A 1U3EM 1WJEA 3E7LA 2FMYA 3ABMH 4P96A 1APLC 4AUXA 3L2CA 3F72A 2BW3B 3EPZA 5M3FJ 2LKSA 3DP7A 1PJRA 1H9TA 1FP2A 2NAZA 3BZCA 3M7GA 3QPLA 2PJRB 1B59A 3DEUA 3F8FA 3OIQA 1Y6IA 3CO7C 4Z6YA 1K79A 1QU3A 3HUGA 4QWQA 1RKWA 2M8GX 5IY5H 4RDUA 3DKYA 2K9LA 2XASA 2IRFG 1S6LA 3SDBA 3H5RA 2FJ1A 3G1LA 1G4DA 4C9YA 1SFUA 4G8XA 1H8AC 1AKHA 2L5QA 3PUFA 1XGOA 2M4KA 4I02A 6PAXA 4WXHA 3HSRA 1ZG1A 1C0WA 3K10A 1X58A 3L7WA 4MTDA 3ISPA 1JJ8C 1MSEC 1D1CA 5B1BH 3SZTA 1HW1A 4DBQA 4IRHA 3I64A 3MAJA 4I0BA 2VQLA 3GCMA 1MNEA 1DGRM 1R1VA 2BE5F 3H3ZA 3JTGA 2K9QA 1O3QA 2DK8A 3H92A 3BJOA 2L54A 4UUVA 2MBFA 5CPRB 4XLNF 5FFZA 2X4HA 3FKJA 1AOYA 1XSVA 1T95A 2XIGA 2LF8A 3K4JA 3NARA 1R49A 5J47A 3K70C 5E79C 1ZRFA 2K86A 4ZYAA 2AXLA 2Z33A 5D5WB 1O4XA 1V5GA 4F93B 1DU0A 3E6CC 1JHHA 3U1DA 1ZYRF 2F5FA 4G6DA 5K5RA 1NG6A 1HSJA 2IGKA 2KIUA 2W00A 1WRJA 3OYFA 3BTJA 3OL4A 3VSKA 1W36C 3FHNA 3H5AA 2DMTA 2FD5A 3H9GA 1MMNA 1D0YA 2W7NA 5K5QA 4HNVA 4Y52J 3QU3A 4DYRA 4Q4ZF 5HDKA 3K1MA 3RSNA 2HYGD 3WTWC 2D5VA 1BJZA 4QPQA 2OU2A 3GF2A 4HBLA 3K2ZA 1BW6A 3GZ6A 2MC3A 2EV5A 2V6CA 2PBIA 3CTAA 2EBIA 1H88C 1ZK8A 2ZXWH 1G3WA 3JRFA 4A3BJ 2MSYA 4EJVA 2STTA 2M34A 5J8FA 3BZ6A 4XIDA 1J5YA 1MMDA 2BY0A 2X1EA 1NH3A 2JVGA 1OISA 2XF7A 3GWZA 4DYCA 4PJ0C 3ABLH 2OCEA 2EFPA 1KU9A 1GHCA 2FQ4A 3EDPA 2H8WA 5M3MJ 4M3BA 1BI0A 2BXYA 2O0YA 4DBRA 2YPRA 1YW9A 5GAGJ 1G59A 3E5QA 2LG4A 1TL8A 4ENKA 2KRHA 3NAUA 2EZKA 3FM3A 1ETYA 4PJMA 5LGUA 2L9NA 1IDYA 3V7CA 4F7ZA 2UWMA 2E7XA 4GGGA 1T0FA 4YG2F 1LFPA 3HRSA 4FE4A 1ON2A 1R23A 4IHVA 1B72A 1PYVA 2K27A 2DA4A 4RGUA 1SD5A 2HKXA 5LHGA 1YYVA 1JT6A 3IUOA 2JSPA 5BQTA 1AU7A 3V8KA 5BNGA 1IF1A 3CJNA 3TOBA 1QGPA 5E1WA 2CUFA 2MGQA 4B43A 5ILUA 5C3EJ 2HEOA 5D8KB 3KP7A 2NS0A 3TDZC 2EWNA 3HTSB 2XAQA 2P81A 2JWTA 3H0DA 4ON0A 1EH6A 1VQMI 4ZYGA 4S04A 5CVVA 4A3GJ 2X1DA 1A5JA 4MQ9F 1YHQI 1MH4A 3VB2A 1FYMA 4XRSA 4QPOA 4CYDA 1TQMA 2VBZA 2E5ZA 2EZIA 2YX4A 3ZQIA 3G6EI 2IEKA 3KEOA 4LMYA 5HNFA 3EUAA 2M9HA 5GP9A 1TWHJ 1G3YA 3FXMA 2VBXA 1TW3A 3CMYA 1LE8B 5FKLA 1YLFA 5HLGA 1ETWA 1XTAA 3S32A 3OYGA 2CMPA 4ESBA 1XSXA 3M07A 1ZR2A 1OMIA 1AHDP 4UVCA 4BHCA 2VQCA 4RMNA 1TWAJ 3A4CA 3B6AA 1POGA 2R4GA 1T98A 2VE9A 3MZ8A 1A6QA 5FB2A 1U8BA 1JGSA 4A5NA 2G7UA 4JOMA 1QHHD 2ME6A 5IOZA 1S8NA 2ZNYA 2ZXJA 1FX7A 2OC6A 3PQKA 5B3SH 1I1GA 2HKOA 2J5OA 3F8NA 3CCQI 3F8BA 2CGPA 3S1QJ 1ULYA 4JK1X 4JYKA 2Y48A 3FBNB 4FQGA 4DIQA 2GLOA 2DYSH 4PCQA 3RQ4A 1ETVA 5GTIC 2Y0MA 3AL0B 5FRMA 3S8PA 2Y0SN 1HF0A 1LVAA 1RKTA 3FZVA 3GTOJ 4EM2A 2KMUA 1T08B 1S5LC 5EGOA 1W7PB 4Q48A 2M7BA 1U5TA 2NNNA 3L09A 1WZ2A 3L00A 1J59A 2GZWA 3M3YJ 2FU4A 4N0BA 4BKXA 4UV8A 1T0FC 4A2UA 2FUG2 2HTJA 1ZKGA 3CJRB 4JX5A 2QQ9A 4YIFA 5ILVA 4L18B 1OCPA 2FQ3A 2KKOA 4HEA2 1N25A 4KIFA 2R7XA 5DCMA 3JSPA 2E5NA 5BMZA 1AWCA 3CQZJ 2COMA 3CUQC 4NC7A 1PUEE 2LKPA 1XPXA 2WWYA 2R93J 1W7PD 4A3IJ 2HQAA 3HGGA 1BIBA 2MYSA 3AG1H 2XSDC 3IKVA 1W5CC 3OR1C 1TT5B 2OQGA 1IDZA 1LUJB 1P7IA 3P9IA 4A3MJ 2EH3A 3EQLF 1R5ID 2F5EA 2LP0A 2WA0A 1W4MA 2BY2A 5EYRA 5D4RA 3UR3C 4CCMA 1I3QJ 3DBRB 3WHCA 1SFOJ 2ZXHA 2BVLA 3NQOA 1WJFA 1S72I 3K4MA 3F23A 4LB5A 3PO2J 5D6EA 2E36A 3HHGA 2MH2A 3HTUA 1DP3A 3BR5A 1GT0C 5L3CA 2V1DA 3MQ0A 1EH8A 3D1NI 3CCYA 5LBQA 5HLIA 2GA1A 3C3WA 4AVPA 2GA2A 3FKIJ 3ZGKA 2DMNA 1IN6A 2FOKA 1GV5A 1W0TA 2MLKA 4IRGA 3OYMA 1ZLJA 2ESHA 4HA8A 1BI1A 2BYVE 4PJLA 5D5VB 4FX4A 2X51A 3QQAA 4G7ZF 3TO9A 1T8IA 1MBEA 2LK2A 3BR0A 4BJ5C 2XAFA 1P9QC 1Y1WJ 4HV5A 3L9FA 1UJ8A 4Z2YA 2ZJ2A 4E70A 4P9UA 2LD5A 5FLXK 3BR6A 2LR8A 1X1AA 1MH3A 1V54H 1U8RA 2A69F 1A35A 3ABKH 2EZLA 1UMQA 4TV7A 2O5RA 4MLOA 3FMSA 5JLXA 4XMYA 4U7DA 1V3FA 2CO5A 2Y0SA 1U5TC 2MABA 3MWMA 1JJ6C 5CQEA 4BBSJ 4UHTA 4B8XA 5K1YA 1S9HA 1JUPA 1AA7A 2ISYA 2HYJA 2X6WA 3K69A 2LMDA 1VI0A 2E1MC 2A6TA 3FIWA 1UCRA 3LOCA 1Z91A 3IWFA 1X4PA 3WGHA 4A6DA 4RLFA 2KDZA 2LTPA 4DJAA 3LSGA 1DDNA 3DF8A 2KZVA 2HGCA 1O7LA 1TQIA 1FPQA 4NB5A 1OCZH 4G7HF 3GTLJ 2DFEA 1BW5A 1JKOC 2B63J 5LRRA 2HOTA 3A02A 4B47A 3I58A 1OQYA 2PFBA 3QYFA 3WTXC 2LDUA 3L2UA 2DOFA 1TTYA 1YS6A 4M73A 4RAFA 1SVOA 3IKTA 5DD4A 2MLGA 2GQQA 1MBHA 5DTDA 3JR9A 1WI3A 1OR7A 4D5FA 4DW6A 2KJBA 4M3EA 3T5XA 3UKGA 3IAM2 3DV8A 2K85A 3LA3A 1HW2A 3W3CA 2A5WA 4O5VA 3ZR8X 4AM3A 3QPHA 2Z9OA 2FBHA 2IW5A 3LQRA 1QVUA 1DU6A 4EV0A 3G4SI 1SEUA 2QSHX 1MBKA 3O3KA 1G2HA 2QKLB 2DU9A 1T33A 1T56A 4EJOA 3O8HA 1DPUA 1QHGA 2CU7A 3HXLA 2DA3A 1W0UA 5TGTA 1IW7F 4A0ZA 1YIJI 2R7DA 3DXJF 3RDIA 1BR1A 3WTSC 2JPBA 3TMOA 1G6NA 2EA2A 1FOWA 1TT0A 2UUZA 4RGSA 2WB1A 1BBYA 1KQ8A 4AYBA 3A03A 1HKQA 3H9JA 3VEPA 2G9WA 1QZEA 1B9NA 2VQGA 1X3ZB 2NOGA 4D9JA 1ZQ3P 1IJWC 2GOXB 2Y31A 4F52A 3K6GA 1F5TA 1L3LA 4M9XA 1UZCA 3HOSA 1I1SA 3F8MA 4XKWA 2O8KA 2NVQJ 4E7IA 3P5JA 5EG0A 4A3JJ 2B7EA 3S3MA 2LY2A 5JVTA 3QOPA 3FXLA 1SFKA 3KYCB 1FT9A 1W5SA 2KDOA 1Y8RB 1U9OA 2KIMA 3KZIC 5FGMA 1HXDA 2QSGX 2ZMEB 1LDDA 2MFZA 4XICA 1NK3P 2XPUA 3X2QH 4BEHB 3T0YA 2DMQA 4V2GA 2K9NA 2EPFA 5E17F 4LG0A 2LVSA 1LEAA 2IGNA 4J19A 4XLCA 4BBRJ 1YQAA 4MO7A 3KP4A 4BDYA 5E1ZB 1T2KA 4B48A 3HEFA 4KJZA 4HF2A 4EVIA 1SD6A 2DA5A 3S2WA 4CDGA 4A3FJ 1Q1HA 1ZH5A 3ROUA 4MFDA 3T1BA 4IHYA 2DODA 1KU7A 5C4XJ 3CP2A 5F0CA 2M8EA 1OCCH 2LH9A 5KCMA 2ICWG 1KA8A 3ZQCA 2P5KA 2O3FA 3HRUA 4PDKA 4QTRA 4WWCA 1XGSA 3BR1A 3BROA 4XM3A 3WU1B 1I5ZA 1RI7A 2JA5J 4A12A 5IP6A 3K4CA 2XGCA 1BJAA 2OQRA 3NRVA 4LD5A 4II3A 3E5XA 1YO5C 2ECBA 4L0YB 5CVIA 4ASNA 5KHDA 5J1UA 3VDXA 4RAGA 5FO5A 2E2HJ 2HR3A 2M3AA 1LNWA 3G1OA 4L9TA 3SFZA 4LOCA 4CYCB 2PEXA 2F6CA 1W1WE 5FKNA 1PDNC 2P4WA 2DA7A 4M3GA 3SDGA 4DQ2A 2PI0A 4HPQA 4XNFA 2TDXA 3BR3A 2IVMA 2BY3A 2CFXA 5DDGA 2HPIA 1I3AA 4N9HA 1A6IA 3HM5A 2HPMA 3CP8A 3I53A 4IJAA 3J7AO 4RB3C 4D1QA 4J01A 2VC0A 5DD8A 2I8DA 2MD0A 3TP0A 4BXFA 5EDNA 4D5CA 2JVHA 1Z9CA 4V2FA 4BHBA 1MMGA 3M1CA 3M8EA 3BZKA 4EGYA 3SFIA 3GW2A 2V1NA 2IPQX 1RPWA 4IEJA 4UVAA 2JA8J 1HLVA 5BS6A 4AVZA 2W82A 1K78B 3GFIA 1X2NA 2AS5F 4XQFA 3K1NA 1XMKA 2ZXIA 3TW7A 3FDYA 1ZG3A 4B1RA 4G7OF 3I59B 5LHHA 3LWFA 1B8IB 5GPAA 2R7WA 4WK8F 1QZZA 1LE8A 2LRDA 3V42A 5L3BA 3HKZA 4RAYA 1JE8A 3VYSB 3Q3SA 2R7TA 2HYFA 3OYJA 3OS0A 2AXTC 4EM1A 1JUMA 4HG2A 4E7SA 1V55H 3BOQA 5HVQC 3OYNA 3M4OJ 1J2XA 2DO7A 5B5EC 3ECHA 3R60A 4NC6A 4CCKA 3SHFA 4R79A 3H35A 4KYWA 2W25A 3JRCA 3H1CA 1DPRA 1ETOA 4K2EA 3DBLB 2YU3A 3DPLC 1WH5A 3G71I 3OMYA 1LDKB 1IAWA 3F6OA 2QENA 3W6KB 1UAAA 4F92B 1GUUA 2LF7A 2J5PA 2VJJA 3DLLF 2GBYA 1CGPA 2EFNA 3RYRA 3FBIB 3IRQA 1W7PA 2QSFX 5IOYA 4LK1F 2XDVA 2DA1A 3HGYA 4YIRX 1QPMA 3O8GA 2JA7J 4NQWA 3J81Z 1MDMB 1T38A 3LMMA 2DI3A 3HYIA 3K4NA 3CCVI 5DV5A 3QRFF 2YU9J 1I50J 2RGVA 4UNOA 3GMEA 3OSFA 1R71A 2IA1A 3E1SA 1XCBA 1FIAA 3WTVC 2HQRA 2EQRA 1CF7A 2VT2A 1HBXG 5A2QZ 1YITI 4B44A 1XC5A 5D6FA 3G1MA 1D5VA 1ENHA 3RJPA 4BH9A 2DJIA 2MD5A 2PMHA 2R7OA 3M9AA 5C44J 3GTQJ 3W2VA 4ETSA 1MBJA 3D5RC 2NOJB 5LLQA 4F91B 1UG2A 2D1HA 2AHQA 2JPCA 3D5SC 3FK7A 5M5YJ 1FEXA 3FXQA 4ZZLA 1WGXA 4PGGA 2F5VA 3EYIA 3BT9A 3ELKA 5FLVA 2ESNA 4BS9A 5IP9J 3LFUA 5F1RA 3TOAA 3E97A 2HQ5A 4WCGA 1D0XA 2CG4A 2RKHA 2K9MA 1MGTA 4HAMA 2EIMH 2VKHA 2GIVA 2HDCA 5H6RA 2ME0A 1X3UA 2EK5A 5FKMA 4ENJA 1FBQA 3F3XA 4BQOA 4ESJA 2Q8KA 5ERIA 4P9FA 3HHHA 2WC2A 1MNMC 5KVRA 1ONVA 2W24A 5IYDJ 2LLKA 3GTMJ 4CZZA 4RGRA 1BI2A 4MNUA 3KZZA 4JX4A 4LITA 1R5GA 1SMTA 3ZCOA 3CC7I 2R5YB 3HZJA 1GV2A 4E7JA 2ZJRF 5CQGA 4LIVA 3TBIA 2QBYA 2P0WA 3EETA 1P92A 3WTYC 1IO2A 1X4OA 3GBGA 3HPGA 3OIPA 4RM3A 3AL0C 2JK3A 1K83J 1LPQA 4KICA 3PFYA 1UG0A 2QA4I 5DM7F 1XMXA 1TBXA 2VBYA 3AG4H 2N8GA 3DBHB 1KYZA 1WJAA 4XL9A 4LK0F 2COBA 5FKKA 5K5OA 4Y7NJ 4HQMA 4ZDOA 1WSUA 3MMYB 3ZQQA 4HDUA 4UXNA 2R92J 4UUSB 5CVUA 2E1NA 3FK6A 2R7VA 5DS9A 1TNTA 2V26A 5J4VA 1ORKA 1QO0D 1D8JA 4L9JA 3LAJA 1IGNA 1S29A 1P2FA 1Z6RA 3I4MJ 2HFHA 2PMUA 2QUFA 1K61A 1ZARA 4CSWA 5HDNA 2W4SA 1Y0UA 4X6AJ 3PM1A 1IRZA 4IPAA 2JJ7A 5K7ZA 3HBLA 4MEYF 1FYKA 4G6QA 1QRYA 4ZC3A 4PK4A 1MMAA 5D4SA 2LBFB 4A3DJ 2Q1ZB 1TWGJ 3N97A 4AIHA 1O3RA 1G3SA 2L7MP 4CA0A 1YX5A 4RBOA 2CW8A 1HKTA 1R4MB 3ZRGA 5L3GA 4A93J 4DZPA 2V79A 3KP2A 2KRFA 2XAJA 2XF6A 2KHMA 5TISC 4A0YA 3CUQA 2FX0A 2E2JJ 1RZ4A 1IN4A 2DTRA 2JTVA 3TDUC 1FYLA 2V4JC 2EFOA 1HOMA 1TW2A 2A6EF 4IO9F 4CUGA 2HTSA 2IAIA 1KU3A 2FA5A 2PG4A 4UB8C 5EEHA 2NS8A 3CF5F 4AC0A 3RPUA 1HA8A 4NUBA 3GEZA 4I0AA 1REPC 1J7KA 1FWZA 1XG1A 1D1BA 2RC4A 3S93A 1MKMA 2ZKZA 5JHFA 2IXSA 2XB0X 1MW7A 1YE9A 1YG2A 3M8JA 2ZO4A 1FOKA 3I54A 5DUKA 2KZGA 2ACJA 3SJMA 3H3VK 3CCJI 1LFBA 4AU7A 2L7FP 1TNSA 4R1HA 4ZYDA 4OIQF 1IUFA 2L01A 5AIQA 5L3FA 2QEXI 2ZJPF 2JN6A 4GDFA 3IP4B 3ERMA 1U9NA 1OCOH 4HLYA 3K0LA 4UB6C 1YFHA 1RETA 4NHJA 3U9GA 1G8XA 1FOXA 2L02A 2RQPA 2ID3A 3PNTA 4RM2A 2L0KA 4HSTA 3SEZA 1YJWI 5EZGA 4HOBA 3ZMSA 5F27A 3HC7A 2OF7A 4W97A 1R6RA 3QWLA 2A05A 1VQLI 1SAXA 1VZ0A 5FROA 2LKXA 2UXXA 1PVEA 4HRIA 2E7WA 2FNAA 3CMEI 2XAGA 3R0JA 3V7RA 5EZHA 1WJDA 3MFKA 4NDLA 3JAMK 1PUFA 1FOYA 4MGRA 5J1RA 2R5ZB 4P1WA 2JMWA 2H27A 5C4JJ 5IT9Z 2EJRA 1MNDA 3KPHA 3SYTA 2NVYJ 4M6YA 3I0TA 2QQ8A 2Q2EB 2ZB9A 3ONQA 3OYBA 4H0EA 1IZ1A 3S3NA 1J0RA 1HSTA 2F4MB 3RCOA 2MA3A 3DCFA 1Y0NA 1YOVB 2TCTA 2A6HF 2NVTJ 1U78A 2VPRA 1E3OC 3DQVC 3L2WA 5KAIC 5H20A 1BIAA 2FNPA 1VQKI 1EA3A 1VQ6I 4CH7A 2O8XA 3I56I 1OYWA 2QGUA 3UNGC 2DW4A 2K7LA 2H09A 5HODA 3GTPJ 5F6FA 1PP7U 4N4OB 2JRMA 2QVOA 1IV8A 3E6DA 3MCZA 3RTRA 2NYXA 3GO5A 3HUGB 4I98B 2Q0OA 3S15J 2PMZN 3CJQB 3PQJA 5K7FA 2BV6A 3K7AJ 3S2DJ 1Z77A 1RUNA 2QLZA 1O7FA 2I5UA 3PJRA 3A01A 4PFOA 2H94A 3COAC 4XLAA 1WI9A 2VE8A 1AKHB 2FOWA 2DFFA 4R8HA 5F0HA 2ZCWA 3LSJA 1Z7UA 5E20A 4AD9A 1EJ9A 4XRFA 5IYCJ 1QA6A 3KP6A 1MZBA 2IP2A 1SD4A 4JQFA 4Q5SF 2RAEA 2Z5UA 1NHAA 3OS2A 4IX7A 5LGTA 3E6MA 1YW8A 2QQBA 1XS9A 2DT7B 4BACA 2HDWA 4PUSA 1P4XA 2WB1N 1S7EA 1FTTA 4AYBN 4FT8A 1DQUA 3RKYA 1HKSA 1NK2P 4KFCA 3GTGJ 4BAYA 4HLXA 1TWFJ 2BGCA 4RLQA 3B73A 3DEEA 5DUIA 3KZYA 3Q5FA 2F48A 1Z1DA 2M87A 2MW8A 2DCEA 4I2OA 2XROA 1WPKA 2ZMEC 4OIPF 2WBMA 1VTNC 1X3WB 3VSLA 2DQRA 1TC3C 3E5UA 2IJLA 3I59A 1B8IA 2WAQN 3SXYA 5GPCA 3OYDA 1SMYF 1B9MA 5FD5A 2JZYA 3IHUA 3CC4I 1KYWA 3DKXA 4XSXF 2K4JA 2ISZA 1ZN2A 3RPQA 2DDAA 2CRGA 2CJJA 4DOZA 3BJ6A 3JRDA 2CS3A 3BC8A 5B1AH 3C2BA 2OZ6A 1YX3A 2IA2A 4KN7X 1S7OA 3CDHA 4KMFA 3FHZA 1WJBA 3FXOA 2ZJQF 5D5UB 1TWCJ 1QPIA 4BY7J 4I09A 3GXOA 2KT0A 3Q0VA 2LY9A 3PSFA 5AIPA 3RQIA 4L9VA 2QF7A 3H9QA 3LFKA 3LSMA 2X85A 5HOOA 2JA6J 5E1XA 5LHIA 3HL2A 3KCCA 1EV7A 4GYIA 3QAHA 4L5IA 3OYCA 2DN0A 3VYUB 2RDPA 2XB5A 4RA2A 2BW3A 2JRTA 2CUEA 4D7NA 3OYHA 2A61A 5DEQA 4ABZA 2PMZA 5JVGF 1O3SA 1QQIA 2WADA 1P4AA 1BR2A 1WQ2A 2V1XA 3IWZA 3OV8A 3BG5A 3ZOBA 2PJRA 1VQ9I 4U0WA 4MEXF 2CSOA 4MFEA 3ZQ7A 4A69C 3FXKA 1YS7A 1H9GA 3N4MA 3NEUA 2B0LA 4OIOF 3ZMTA 4M3FA 5ICEA 3QPSA 3MKZA 1B72B 2JQ7A 3KFWX 1BC7C 2AQFA 2YR2A 3FWEA 4IVNA 3ZN1A 3MD2A 4CHUA 3S2HJ 3CDIA 3J81K 5FKOA 2R7FA 3TO7A 2JUCA 4HYEA 4DGWB 2P7VB 1KZHA 2WTEA 1N75A 1RUOA 2CQNA 3REOA 1MIJA 4HNTA 4IOAF 4XKCA 1GXQA 2L4AA 1JKQC 4FTHA 3BQZA 3EUHA 3LSRA 2CUZA 4OU0A 1QBJA 3ZPLA 1ITYA 5LD2C 3JAMZ 2ELHA 3O6BB 5A2QK 4A3CJ 4G6TB 2F4OB 1YW7A 2OV7A 1JTXA 3JTHA 2OBPA 2WAQA 4FX0A 3OSGA 4IQ4A 4P55A 4W1UA 4E7KA 4IZZA 5IP7J 3KP3A 5F0FA 4FHTA 3BQYA 2EV0A 2XF5A 1NTCA 2DFIA 2R7ZJ 2PX9A 2YUSA 3HRTA 2M4GA 2DMUA 2FXAA 4IRIA 1XGNA 2OTLI 2AO9A 2R5YA 2DK5A 4II2A 2ELKA 4OOIA 4ZZDA 2W48A 2WAFA 3R6SA 2KISA 4C2UA 2UXNA 3GVAA 3HKZN 2O9LA 1Y1VJ 3WTZA 5E3NA 1ZRDA 2F2EA 3MKYB 4Y33A 1VF9A 3OR2C 3BG6A 1TP4A 5HDGA 4BQAA 2XRLA 1Z6TA 2L7KA 4YFXF 2R0QC 5LRSA 3KX2A 2IBDA 3TP3A 1LKXA 2PN6A 3SZGA 4PJNA 2VJIA 2IA0A 3J7YJ 2KL4A 3DWLE 1FC3A 2K3FA 1IN7A 1ZTRA 2XPWA 3CMMA 3L2QA 2OTJI 1WJ5A 4L5JA 2KQRA 3U2RA 2KRCA 2MH9A 3JW4A 3KIOA 5E18F 5EGOB 1B4AA 2LNBA 4G9YA 5FJ8J 2OJED 2E2IJ 1TQPA 4GXOA 4E7ZA 4GFBA 2H1LA 3RI4A 3HOZJ 3L1PA 4B3AA 2EILH 1QVTA 2ZSIB 2EIJH 4ENMA 2K02A 4C3JJ 1DUXC 3OOPA 4LIUA 1WCMJ 2DLLA 3DLAA 2P6TA 2E1MB 1VQ7I 4E7LA 4NC8A 1TZLA 5CJ9A 3MKLA 1Y8QB 2EFQA 2VUMJ 2X0LA 2VODA 3O2PE 3MZHA 3IH2A 1EKEA 5ICGA 3CF2A 1YRNB 5J3LA 4EEFG 1OKRA 2BOLA 4PJJA 4BYYA 1YTYA 1GVJA 4EQQA 2R7RA 4HZFA 2W85A 4C2MJ 1P4WA 2X6XA 3CC2I 3J7ZI 3EUHC 2RN7A 4UVBA 2VJ5A 1E3PA 2KIFA 4GCVA 4IHTA 3WE3A 3VPRA 4CGZA 3OYAA 1M1EB 3OYIA 5DCFA 3D5LA 1WKMA 1LEBA 1IXCA 3JRHA 1IXSB 2BVMA 4BE0A 4HX8A 1Z67A 4BHPA 3MEXA 3RYPA 2VOPA 2IGOA 1BA5A 2BZTA 1SD7A 4OMZA 2ZBKA 5E8GA 1HW5A 3JCUC 1F43A 5HLTA 4LB6B 4IOCF 2IS1A 3K4KA 3S3OA 2UV1A 1SVMA 2XAUA 3CLQA 3JRAA 1K6OA 1ODDA 1STZA 4QSHA 4IKFA 2FMLA 3DTIA 1VQPI 3AFHA 1MBFA 2DXIA 4HV6A 3K9TA 2WY8Q 1FMVA 3LAPA 4WF2A 2GM4A 3CZ6A 1KQ0A 2M0MA 4HSRA 2P7CB 3KEYA 2KIQA 2FF4A 2OCCH 3KP5A 4C30A 3WTUC 1R00A 4CCJA 4ZTFA 3N05A 3EUKL 1R1UA 2IS4A 2Z16A 3FMQA 1XGMA 1JUSA 2DA2A 2DTZA 2YX7A 4UUTA 4J00A 2DDBA 3BTIA 2H8RA 2GOMA 2F5CA 3HSFA 2CV1A 1XB4A 2HWVA 3GTKJ 1FNNA 3VFZA 3W6VA 1HC8A 1R9TJ 2TRTA 1Q1VA 1MJAA 1XX5A 4EJTA 1ZGAA 1XCVA 2RNGA 4PSWA 1XSDA 2OAZA 2CW0F 2EV6A 3LSIA 5HLHA 2E35A 1Z0XA 3F21A 2HOSA 2XAHA 3HDDA 2Z1DA 3E6BA 2CFOA 2CQQA 3F9KA 3OYEA 1RC9A 3HB9A 3OIOA 5LFAA 4OIRF 4ZH4F 3S1NJ 1LFUP 3U1KA 4MIMA 1BM9A 3LSHA 2XUBA 2CV0A 2FSWA 4XK4A 2ZFWA 2HVQA 2R5ZA 3I9V2 1O57A 3Q9SA 1KGSA 1ZGJA 2CH0A 3IL2A 3H0GJ 2K3PA 4A3EJ 3PO3J 2WV1A 2P5LC 2CV2A 1UELB 4X0GA 3OY9A 5BOXA 2VT3A 3MVPA 1GVDA 2OUMA 4I99C 1JXSA 4HX4A 1H0MA 1W5TA 2V9PA 4FE7A 3CO6C 3FXRA 2WY7Q 3ABUA 1OJLA 3RZOJ 4M3DA 1G3TA 3BCAA 4RB0A 2R7SA 5L3DA 1J9IA 1BOBA 3L2RA 4NNJA 1FIPA 2XGXA 2GXBA 3CCEI 1ZELA 3BPXA 5IT9K 2XC7A 4BXXJ 2A3SA 3TL4X 4G12A 3H36A 3PFIA 3GLXA 4KN4X 1ZLKA 2XSJC 5FFXA 1X1PA 2XVCA 2VPLA 2OPTA 4G94A 1MMSA 3HSEA 1VQ5I 4PGHA 2KLOA 1ERDA 4IHSA 3ZP5A 4X1EA 1I6HJ 2W1OA 2Y9YA 2ZNZA 1BC8C 2M7AA 3IH3A 3M1EA 4M71A 3PNVA 3CD6I 1A36A 3WHBA 1UHMA 2QKMB 3J7AY 1L0OC 2ZSHB 2OZUA 1VQNI 1R7JA 3ZQLA 1E2XA 3V8LA 2Z3YA 3PSIA 5J40A 4YEJA 2XGEA 2X9DA 3CDLA 2IT0A 1Z7LA 2VONA 2VKEA 3Q9VA 1OYYA 4S05A 2CYYA 4QLCU 1Z21A 4FCYA 1FTZA 2M2EA 3I3LA 3J80Z 4CICA 3KETA 3MN2A 2K9SA 1X2MA 1LQ1A 5EG0B 2H6BA 4HNUA 1YIOA 4I7HA 1R58A 3BR2A 2UZKA 2M30A 2PJPA 5EF6A 5GAEJ 3BTLA 4UY8I 5DYMA 2DOAA 1FSHA 2NS7A 5HS8A 3JRBA 4ZTJA 3GYHX 4BQQA 2QYOA 4LG0B 4BGDA 4BE1A 2VN2A 3P9KA 1D5YA 2LYCA 4PSXA 3S14J 2M5WA 4YFKF 3GLLA 5E3OA 3C2HA 2JSCA 2HNHA 3Q0WA 2AQEA 5IPAA 1VQ8I 2D1VA 2O7OA 3ULQB 2K5CA 2Z99A 4DNCA 1K6YA 2FBKA 2R7QA 1LB2A 4O3MA 4MTEA 4IF4A 1IV6A 3HOUJ 3ZMZA 2HU9A 1V4RA 3C1DA 3PIOF 3QODA 2CQ7A 4YELA 5EEAA 1USTA 3GFLA 5GTHC 4U0YA 2BHZA 2LSOA 3C2GA 4C3HJ 4UV9A 3V4GA 3FF5A 3I4PA 4KA4A 3KYDB 2ZC2A 4XR6A 1T6SA 2EA4A 3C7JA 3CJTB 4GO1A 4XBFA 4BU2A 4WXDA 5FD6A 4AIDA 1JKPC 2A68F 2FRHA 5CLSA 1XMAA 2DPDA 2VI6A 4I01A 3F22A 1DGWY 2Y69H 1DP7P 2EZHA 3P7NA 2RVCA 2E1CA 1D8KA 3DKWA 4B3XA 2H1KA 1OFCX 4C2TA 4M74A 2EINH 1IG7A 2WV0A 5LEJA 3PNYA 4CCNA 1ZHFA 2VLAA 2JA2A 1V5EA 5LEKA 2B9SA 3QOEA 2YSRA 3ZQFA 5HS7A 3QP5A 3VYRB 2DT6A 4KNYA 1XN7A 9ANTA 4DZJA 1I39A 3R4KA 4GRIA 3LSTA 2GAUA 1H89C 3G73A 4CCOA 3DTKA 4KIGA 2R7UA 1OPCA 4V19K 3BP8A 2VXZA 4I76A 4XKVA 1JI8A 4F55A 4M6XA 4BNCA 3RIRA 3OOUA 3S1RJ 4XKBA 4ZYEA 1ZGWA 1RR8C 1N78A 1R4NB 1A04A 2DQLA 2W84A 3QYEA 4ESFA 3LA7A 3QPTA 3BPVA 3WGGA 2L9RA 2RNJA 3SEQA 3NWSA 3GFMA 5CVRA 1IXRC 2HOEA 5CKTA 1R1TA 3FXUA 4O6JA 1OCTC 2LC2A 3D0SA 1EF4A 2X6OA 2ZMEA 3AG2H 3GTJJ 3HJEA 3WG7H 1X19A 4EJWA 2RV8A 3G3ZA 2STWA 1NG7A 1WWXA 4A6EA 4YFNF 1XDUA 1ZRCA 4BEHA 4KISA 3RKQA 3R61A 1S7AA 2ID6A 4HF0A 3B6CA 1WH7A 3GUDA 4IQJA 2VKDA 2XGDA 4GYGA 1O3TA 2V6EA 4EGZA 1FY7A 4L9NA 4Y4RA 4ANJA 3M8FA 1RESA 2XHKA 2VIXA 3AKZA 1JHFA 4BE2A 2D45A 2OA4A 3CLOA 2HI3A 1S3JA 2BXZA 2XPVA 2IS6A 3K70D 4BXUA 2V1UA 4A3KJ 4NQWB 2YS9A 3WODF 1F4KA 3CMAI 2CQXA 3HIFA 3HOVJ 5KAFC 3BCBA 3DU6A 4BJ6C 3KLOA 3CCUI 3R0AA 3IH4A 2PLYA 1W36D 4HW0A 3HG9A 4XSZF 3WE2A 2RQQA 3BJAA 2K4BA 2VBWA 1N77A 1FZPB 2KP6A 1CF7B 5FLMJ 1K4SA 4CYCA 3VYTB 1YRNA 1V5FA 2VB6A 4MQVA 1MD0A 5IT3A 2I10A 2L9VA 2RREA 2A07F 3W2AA 3I55I 2QWWA 4LLGF 3TQNA 5GAHJ 4XRMA 5EJCA 2P5VA 2QCOA 5GADJ 4XRSG 4B09A 3QP6A 1IUYA 1QZYA 2V9KA 1XD7A 1PP8F 2EFWA 5TJJA 1A31A 1SVLA 4PZJA 4N9IA 3PIPF 2JT1A 2O6GE 3I4NJ 4DYQA 1JKRC 4ENNA 4HQEA 1UHWA 2BY1A 5F04A 5JR3A 4XONA 2VC1A 4XN3A 2FE3A 1WVRA 1P7JA 1BR4A 3WG9A 3BTCA 1VNDA 5DM6F 1B1BA 1RIOH 1VQ4I 1GDTA 2VJ4A 3GFJA 5F08A 5BPDA 2ZFUA 3AAFA 1K78A 1FBUA 3OYKA 2A5YB 1Z3YA 3TGNA 3LA2A 4QIWN 5B66C 4F3QA 3BDDA 2MG4A 2V9VA 3ZQGA 4A5MA 2FBIA 4HF1A 4E6KG 1UHSA 5ICFA 4XOPA 2BEOA 5J6XA 3HOWJ 1HDPA 2PQ8A 2L3DA 2X1CA 2QBYB 4U0VA 3ZXSA 2HOAA 5JI6A 1X1CA 2L7ZA 3BLYA 5EEGA 3DFGA 4L5EA 2L4MA 5LGNA 3OYLA 3F8CA 3P9CA 4M6VA 1LVKA 3JSOA 5CYVA 1HQCA 2DJNA 2E34A 4OMYA 1RNLA 4KIBA 3IV5A
chains in the Genus database with same CATH topology
2CWEA 2KJCA 4LLLA 1P6RA 4KT5C 3I5UA 4WXCA 1IN5A 4RB2C 1R5HA 1D3YA 3F6VA 2M45A 1J75A 4M9SA 1U2WA 2O61A 1R22A 3BY6A 1SFXA 3BWGA 1FP1D 2GWRA 3C18A 3EYYA 5D5XB 1MDMA 3TKYA 2QQAA 3ML6A 3QU6A 3DPTA 4EJUA 3W6JB 5ICCA 4HDVA 4U7BA 3SZPA 4D0PA 4ZYHA 2XRNA 1I27A 2HQNA 2NRAC 3CUQB 1LDJA 4AIKA 4EMSA 2M1BA 1TLHB 3I71A 5CVJA 3VOEA 2G7HA 1UFMA 1I6XA 4AIJA 2XKPA 2DAOA 5ED4A 2DT5A 1F9NA 3ABTA 3K1PA 4LLNA 3RKXA 3FX3A 5L3EA 1ZREA 1Z05A 4Y13A 1KU2A 4RAZA 2EB7A 1ZAOA 2P6SA 1FSEA 3ZMDA 3B02A 4HX7A 1IRFA 1R36A 2DPUA 2FEZA 3ZMVA 3WU0A 3V8JA 1K7AA 2ADUA 1BI3A 3VODA 4OINF 3IC7A 4KUMA 2C6YA 4CO8A 4Y17A 5F64A 3T8TA 4P5OA 4YIIA 3WGIA 2GXGA 1U5TB 3WTTC 3FMRA 3J80K 1IN8A 3KEQA 4M9ZA 2QZ8A 4KMUX 2HS5A 5D8LB 3HRMA 3RKWA 4CXFA 4AWXB 1B6AA 4A0XA 5KK1A 5ILSA 5DCMB 2NNYA 1SFEA 5E8IA 4Y15A 2Y75A 4WX9A 3CUOA 1BOAA 4IXAA 2O03A 1OYIA 2ETHA 3ZN0A 1U6GA 3LQQA 2DBBA 4JBAA 3KE2A 3ECOA 3V7SA 2CQKA 1MJ9A 3H3UA 2P8TA 2F5DA 2D2WA 3IRRA 1MJBA 4RS8A 3T8RA 3ERED 2H6CA 4RGXA 5FLXZ 4KDPA 5JFRA 3MZYA 2OD5A 5H6QA 4U88A 1ON1A 4XLPF 4Q47A 3KLNA 5JHUA 1FLIA 3GX4X 3ZMUA 2XKOA 5AONA 1E17A 2VOOA 1T39A 1F4KA 3HOTA 2HZTA 5BPIA 2BBYA 4MHGA 4L0ZB 3TO6A 1UB9A 1USSA 1XDSA 1FBSA 5J8CA 3FM5A 2W57A 2QM3A 1ZG5A 1GXPA 4EM0B 3E3VA 1QNTA 3GZ5A 1KQ9A 4LFUA 2XV4S 3SQNA 4LGWA 4M72A 1F1ZA 1EH7A 4RB1A 1LJ9A 5HS9A 5TRDA 2Q2EA 2R3SA 4LJZF 1BN5A 1IRGA 1U3EM 2FMYA 4P96A 3L2CA 3F72A 3DP7A 1H9TA 1FP2A 2NAZA 3M7GA 1B59A 3DEUA 3F8FA 3CO7C 1K79A 3HUGA 4QWQA 2XASA 2IRFG 1S6LA 1G4DA 1SFUA 4G8XA 1XGOA 4I02A 6PAXA 4WXHA 3HSRA 1ZG1A 1C0WA 3L7WA 4MTDA 3ISPA 3SZTA 1HW1A 4IRHA 3I64A 3MAJA 4I0BA 1R1VA 2BE5F 3H3ZA 3JTGA 1O3QA 2DK8A 3H92A 3BJOA 2L54A 4UUVA 2MBFA 4XLNF 5FFZA 2X4HA 1AOYA 1XSVA 2XIGA 2LF8A 1ZRFA 2K86A 2AXLA 2Z33A 5D5WB 3E6CC 1JHHA 3U1DA 1ZYRF 2F5FA 4G6DA 5K5RA 1HSJA 2KIUA 1WRJA 5K5QA 3QU3A 4Q4ZF 5HDKA 3K1MA 2HYGD 3WTWC 2OU2A 3GF2A 4HBLA 3K2ZA 3GZ6A 2MC3A 2EV5A 2V6CA 2PBIA 3CTAA 1G3WA 4EJVA 2STTA 5J8FA 3BZ6A 1J5YA 3GWZA 2EFPA 1KU9A 1GHCA 3EDPA 1BI0A 2O0YA 2YPRA 1YW9A 3E5QA 4ENKA 3FM3A 5LGUA 3V7CA 4F7ZA 2UWMA 2E7XA 4GGGA 1T0FA 4YG2F 3HRSA 1ON2A 1R23A 2K27A 4RGUA 1SD5A 2HKXA 5LHGA 1YYVA 5BQTA 3V8KA 1IF1A 3CJNA 3TOBA 1QGPA 5E1WA 5ILUA 2HEOA 5D8KB 3KP7A 2NS0A 3TDZC 2EWNA 3HTSB 2XAQA 4ON0A 1EH6A 4ZYGA 4S04A 5CVVA 4MQ9F 3VB2A 1FYMA 4CYDA 1TQMA 2VBZA 2YX4A 3KEOA 4LMYA 1G3YA 2VBXA 1TW3A 5HLGA 1YLFA 4ESBA 1XSXA 1OMIA 4UVCA 4BHCA 1T98A 2VE9A 5FB2A 1JGSA 4A5NA 2G7UA 1S8NA 2ZNYA 2ZXJA 1FX7A 3PQKA 1I1GA 2HKOA 2J5OA 3F8NA 3F8BA 2CGPA 1ULYA 4JK1X 2Y48A 4PCQA 2Y0MA 1LVAA 3FZVA 4EM2A 1W7PB 4Q48A 1U5TA 2NNNA 3L09A 3L00A 1J59A 2GZWA 2FU4A 4N0BA 4UV8A 4A2UA 2HTJA 4YIFA 5ILVA 4L18B 2QQ9A 2FQ3A 2KKOA 4KIFA 5DCMA 3JSPA 5BMZA 1AWCA 2COMA 3CUQC 1PUEE 2LKPA 2WWYA 1W7PD 1BIBA 3IKVA 2OQGA 3P9IA 3EQLF 2F5EA 1W4MA 5D4RA 3NQOA 3F23A 4LB5A 5D6EA 3HHGA 2MH2A 3HTUA 5L3CA 2V1DA 3MQ0A 1EH8A 5LBQA 5HLIA 2GA1A 3C3WA 4AVPA 2GA2A 1IN6A 2FOKA 2MLKA 4IRGA 1ZLJA 2ESHA 4HA8A 1BI1A 2BYVE 5D5VB 4FX4A 4G7ZF 3TO9A 2XAFA 4HV5A 3L9FA 4Z2YA 2ZJ2A 4E70A 4P9UA 5FLXK 1U8RA 2A69F 4TV7A 3FMSA 4U7DA 1V3FA 2CO5A 1U5TC 3MWMA 4UHTA 4B8XA 5K1YA 2ISYA 3K69A 1UCRA 1Z91A 3IWFA 3WGHA 4A6DA 1DDNA 3DF8A 2HGCA 1O7LA 1TQIA 1FPQA 4NB5A 4G7HF 5LRRA 3I58A 2PFBA 3WTXC 2LDUA 1TTYA 1YS6A 4M73A 3IKTA 5DD4A 2MLGA 2GQQA 1OR7A 2KJBA 3T5XA 3DV8A 3LA3A 1HW2A 4O5VA 3QPHA 2Z9OA 2FBHA 2IW5A 3LQRA 4EV0A 3O3KA 2DU9A 4EJOA 1DPUA 1IW7F 4A0ZA 2R7DA 3RDIA 3DXJF 3WTSC 2JPBA 1G6NA 2EA2A 4RGSA 1BBYA 1KQ8A 1HKQA 3VEPA 2G9WA 1B9NA 1F5TA 1L3LA 4M9XA 3HOSA 1I1SA 3F8MA 5JVTA 3QOPA 1FT9A 1W5SA 2KIMA 5FGMA 1HXDA 2ZMEB 1LDDA 3T0YA 5E17F 4LG0A 1LEAA 1YQAA 3KP4A 5E1ZB 1T2KA 4HF2A 4EVIA 1SD6A 3S2WA 4CDGA 1Q1HA 1ZH5A 3ROUA 3T1BA 1KU7A 2M8EA 1KA8A 2P5KA 2O3FA 3HRUA 4PDKA 4WWCA 1XGSA 3BROA 3WU1B 1I5ZA 1RI7A 4A12A 1BJAA 2OQRA 3NRVA 4LD5A 3E5XA 1YO5C 4L0YB 5CVIA 4ASNA 5FO5A 2HR3A 1LNWA 4L9TA 3SFZA 2PEXA 1PDNC 2P4WA 4DQ2A 2PI0A 2TDXA 2IVMA 2CFXA 5DDGA 4N9HA 3I53A 4IJAA 3J7AO 4RB3C 2VC0A 5DD8A 1Z9CA 4BHBA 3M8EA 4EGYA 3GW2A 2IPQX 4UVAA 5BS6A 1K78B 3GFIA 2AS5F 3K1NA 1XMKA 1ZG3A 4G7OF 3I59B 5LHHA 3LWFA 4WK8F 1QZZA 5L3BA 4RAYA 1JE8A 2HYFA 4EM1A 5HVQC 3BOQA 1J2XA 2DO7A 3ECHA 3R60A 3SHFA 4R79A 4KYWA 2W25A 1DPRA 4K2EA 2YU3A 3DPLC 1LDKB 1IAWA 3F6OA 2QENA 3W6KB 2LF7A 2J5PA 1CGPA 2EFNA 3RYRA 3IRQA 1W7PA 4LK1F 1QPMA 4NQWA 3J81Z 1MDMB 1T38A 3QRFF 2DI3A 3HYIA 5DV5A 2RGVA 4UNOA 2IA1A 1XCBA 3WTVC 2HQRA 1CF7A 2VT2A 1HBXG 5A2QZ 5D6FA 1D5VA 3RJPA 4BH9A 2MD5A 2PMHA 3M9AA 4ETSA 5LLQA 2D1HA 2JPCA 3FXQA 4ZZLA 4PGGA 3EYIA 3ELKA 2ESNA 5F1RA 3TOAA 3E97A 4WCGA 2CG4A 2RKHA 1MGTA 4HAMA 2GIVA 2HDCA 5H6RA 1X3UA 2EK5A 4ENJA 1FBQA 3F3XA 4ESJA 2Q8KA 5ERIA 4P9FA 3HHHA 2WC2A 5KVRA 1ONVA 2W24A 4CZZA 4RGRA 1BI2A 4MNUA 3KZZA 1R5GA 1SMTA 2QBYA 3EETA 1P92A 3WTYC 4KICA 1TBXA 2VBYA 1KYZA 4LK0F 5K5OA 4HQMA 1WSUA 4HDUA 4UXNA 5CVUA 2E1NA 1TNTA 1QO0D 1D8JA 4L9JA 3LAJA 1S29A 1P2FA 1Z6RA 2HFHA 2PMUA 2QUFA 1ZARA 5HDNA 1Y0UA 4IPAA 4MEYF 1FYKA 4G6QA 5D4SA 3N97A 4AIHA 1O3RA 1G3SA 1HKTA 5L3GA 2V79A 3KP2A 2KRFA 2XAJA 4A0YA 3CUQA 1RZ4A 1IN4A 2DTRA 2JTVA 3TDUC 1FYLA 2EFOA 1TW2A 2A6EF 2HTSA 1KU3A 2FA5A 2PG4A 5EEHA 3RPUA 3GEZA 4I0AA 1REPC 1J7KA 1FWZA 2RC4A 1MKMA 2ZKZA 1YG2A 1FOKA 2ZO4A 3I54A 5DUKA 2ACJA 1TNSA 4R1HA 4ZYDA 4OIQF 2L01A 5AIQA 5L3FA 4HLYA 3K0LA 1YFHA 4NHJA 3U9GA 2L02A 2RQPA 3ZMSA 4HOBA 1SAXA 2UXXA 2E7WA 2FNAA 2XAGA 3R0JA 3V7RA 3MFKA 3JAMK 4MGRA 2H27A 5IT9Z 2EJRA 4M6YA 3I0TA 4H0EA 1IZ1A 1J0RA 1HSTA 2MA3A 2A6HF 1U78A 3DQVC 5H20A 1BIAA 2FNPA 2O8XA 1OYWA 2DW4A 2K7LA 2H09A 5F6FA 1PP7U 2QVOA 3MCZA 3RTRA 3E6DA 2NYXA 3GO5A 4I98B 2Q0OA 3PQJA 2BV6A 1RUNA 2QLZA 1O7FA 3COAC 2H94A 1WI9A 2VE8A 4R8HA 2ZCWA 1Z7UA 5E20A 4AD9A 4XRFA 3KP6A 1MZBA 2IP2A 1SD4A 4JQFA 4Q5SF 2Z5UA 1NHAA 5LGTA 3E6MA 1YW8A 2QQBA 1P4XA 4FT8A 3RKYA 1HKSA 4KFCA 4BAYA 4HLXA 2BGCA 3B73A 5DUIA 3KZYA 3Q5FA 1Z1DA 2M87A 4I2OA 2XROA 4OIPF 1VTNC 2DQRA 3E5UA 2IJLA 3I59A 3SXYA 1SMYF 1B9MA 5FD5A 2JZYA 3IHUA 1KYWA 4XSXF 2K4JA 2ISZA 1ZN2A 3RPQA 3BJ6A 2OZ6A 2IA2A 4KN7X 1S7OA 3CDHA 4KMFA 3FHZA 5D5UB 4I09A 3GXOA 5AIPA 4L9VA 3LFKA 5HOOA 5E1XA 5LHIA 3KCCA 1EV7A 4GYIA 3QAHA 4L5IA 2RDPA 2JRTA 2A61A 5DEQA 1O3SA 1QQIA 1WQ2A 1P4AA 3IWZA 2V1XA 3OV8A 4U0WA 4MEXF 2CSOA 3ZQ7A 1YS7A 1H9GA 3N4MA 3NEUA 2B0LA 4OIOF 3ZMTA 5ICEA 3KFWX 1BC7C 2YR2A 3FWEA 4IVNA 3ZN1A 4CHUA 3J81K 2R7FA 3TO7A 4HYEA 2P7VB 2WTEA 1RUOA 3REOA 1GXQA 2L4AA 3EUHA 4OU0A 1QBJA 3ZPLA 3JAMZ 2ELHA 3O6BB 5A2QK 1YW7A 3JTHA 2OBPA 4FX0A 4P55A 3KP3A 4FHTA 2EV0A 2DFIA 3HRTA 2FXAA 4IRIA 1XGNA 2DK5A 4OOIA 4ZZDA 3R6SA 2UXNA 3GVAA 3WTZA 1ZRDA 2F2EA 5HDGA 4BQAA 1Z6TA 4YFXF 5LRSA 2PN6A 2IA0A 1FC3A 1IN7A 4L5JA 3U2RA 5E18F 2MH9A 3JW4A 1B4AA 2LNBA 4G9YA 1TQPA 4GXOA 3RI4A 4ENMA 2K02A 1DUXC 3OOPA 2DLLA 2P6TA 5CJ9A 2EFQA 2X0LA 2VODA 3O2PE 3MZHA 5ICGA 1YTYA 1OKRA 4BYYA 1GVJA 4EQQA 4HZFA 2W85A 1P4WA 2RN7A 4UVBA 2KIFA 4GCVA 4IHTA 3WE3A 4CGZA 5DCFA 3D5LA 1WKMA 1LEBA 1IXCA 1IXSB 4HX8A 4BHPA 3MEXA 3RYPA 2VOPA 1SD7A 4OMZA 2ZBKA 5E8GA 1HW5A 4LB6B 1K6OA 1ODDA 1STZA 2FMLA 4HV6A 3K9TA 3LAPA 4WF2A 1KQ0A 2P7CB 2FF4A 3KP5A 3WTUC 1R00A 1R1UA 3FMQA 1XGMA 2YX7A 2F5CA 3HSFA 1XB4A 2HWVA 1FNNA 3VFZA 4EJTA 1MJAA 1ZGAA 1XCVA 1XSDA 2OAZA 2CW0F 2EV6A 5HLHA 3F21A 2XAHA 3E6BA 4OIRF 4ZH4F 1BM9A 2XUBA 2FSWA 2ZFWA 1O57A 3Q9SA 1KGSA 1ZGJA 3IL2A 2P5LC 5BOXA 2VT3A 1JXSA 4HX4A 1H0MA 1W5TA 3CO6C 3FXRA 3ABUA 1G3TA 4RB0A 5L3DA 1J9IA 2XGXA 2GXBA 3BPXA 5IT9K 2A3SA 3PFIA 3GLXA 4KN4X 1ZLKA 5FFXA 2XVCA 4G94A 3HSEA 4PGHA 4IHSA 3ZP5A 2ZNZA 1BC8C 3M1EA 4M71A 1UHMA 1L0OC 2OZUA 1R7JA 1E2XA 3V8LA 2Z3YA 2IT0A 2VONA 3Q9VA 1OYYA 4S05A 2CYYA 4QLCU 3J80Z 4CICA 3KETA 1LQ1A 2H6BA 1YIOA 4I7HA 1R58A 2UZKA 2M30A 2PJPA 5DYMA 1FSHA 5HS8A 3GYHX 2QYOA 4LG0B 2VN2A 3P9KA 2M5WA 4YFKF 2JSCA 2D1VA 3ULQB 2Z99A 4DNCA 4O3MA 2FBKA 1LB2A 4MTEA 4IF4A 3ZMZA 1V4RA 3C1DA 1USTA 3GFLA 4U0YA 2LSOA 4UV9A 3V4GA 3FF5A 3I4PA 4KA4A 1T6SA 2EA4A 3C7JA 4XBFA 4GO1A 5FD6A 4WXDA 2A68F 2FRHA 5CLSA 1XMAA 2DPDA 4I01A 3F22A 1DP7P 3P7NA 2RVCA 2E1CA 1D8KA 3DKWA 4M74A 2WV0A 5LEJA 1ZHFA 5LEKA 2YSRA 5HS7A 3QP5A 4KNYA 1XN7A 3R4KA 3LSTA 2GAUA 3G73A 4KIGA 1OPCA 3BP8A 2VXZA 4M6XA 4BNCA 3RIRA 4ZYEA 1A04A 2DQLA 2W84A 4ESFA 3LA7A 3QPTA 3BPVA 3WGGA 2RNJA 3GFMA 5CVRA 1IXRC 2HOEA 1R1TA 3FXUA 4O6JA 3D0SA 2ZMEA 4EJWA 2RV8A 3G3ZA 2STWA 1WWXA 4A6EA 4YFNF 1XDUA 1ZRCA 3R61A 1S7AA 4HF0A 3GUDA 4GYGA 1O3TA 4EGZA 1FY7A 4L9NA 3M8FA 2XHKA 1JHFA 2D45A 2OA4A 3CLOA 1S3JA 4BXUA 2V1UA 3WODF 3HIFA 3KLOA 3R0AA 2PLYA 4HW0A 4XSZF 3WE2A 3BJAA 2K4BA 2VBWA 1FZPB 1CF7B 4MQVA 1MD0A 5IT3A 2A07F 2QWWA 4LLGF 3TQNA 2P5VA 4B09A 3QP6A 1IUYA 1QZYA 1XD7A 1PP8F 2EFWA 5TJJA 4PZJA 4N9IA 2JT1A 2O6GE 4ENNA 4HQEA 1UHWA 5JR3A 2VC1A 2FE3A 3WG9A 1RIOH 1B1BA 3GFJA 5BPDA 3AAFA 1K78A 1FBUA 2A5YB 3TGNA 3LA2A 3BDDA 2V9VA 4A5MA 2FBIA 4HF1A 5ICFA 2BEOA 5J6XA 2PQ8A 2L3DA 2QBYB 4U0VA 5JI6A 5EEGA 3DFGA 2L4MA 5LGNA 3F8CA 3P9CA 3JSOA 5CYVA 1HQCA 4OMYA 1RNLA 4KIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWE A;  2KJC A;  4LLL A;  1P6R A;  4KT5 C;  3I5U A;  4WXC A;  1IN5 A;  4RB2 C;  1R5H A;  1D3Y A;  3F6V A;  2M45 A;  1J75 A;  4M9S A;  1U2W A;  2O61 A;  1R22 A;  3BY6 A;  1SFX A;  3BWG A;  1FP1 D;  2GWR A;  3C18 A;  3EYY A;  5D5X B;  1MDM A;  3TKY A;  2QQA A;  3ML6 A;  3QU6 A;  3DPT A;  4EJU A;  3W6J B;  5ICC A;  4HDV A;  4U7B A;  3SZP A;  4D0P A;  4ZYH A;  2XRN A;  1I27 A;  2HQN A;  2NRA C;  3CUQ B;  1LDJ A;  4AIK A;  4EMS A;  2M1B A;  1TLH B;  3I71 A;  5CVJ A;  3VOE A;  2G7H A;  1UFM A;  1I6X A;  4AIJ A;  2XKP A;  2DAO A;  5ED4 A;  2DT5 A;  1F9N A;  3ABT A;  3K1P A;  4LLN A;  3RKX A;  3FX3 A;  5L3E A;  1ZRE A;  1Z05 A;  4Y13 A;  1KU2 A;  4RAZ A;  2EB7 A;  1ZAO A;  2P6S A;  1FSE A;  3ZMD A;  3B02 A;  4HX7 A;  1IRF A;  1R36 A;  2DPU A;  2FEZ A;  3ZMV A;  3WU0 A;  3V8J A;  1K7A A;  2ADU A;  1BI3 A;  3VOD A;  4OIN F;  3IC7 A;  4KUM A;  2C6Y A;  4CO8 A;  4Y17 A;  5F64 A;  3T8T A;  4P5O A;  4YII A;  3WGI A;  2GXG A;  1U5T B;  3WTT C;  3FMR A;  3J80 K;  1IN8 A;  3KEQ A;  4M9Z A;  2QZ8 A;  4KMU X;  2HS5 A;  5D8L B;  3HRM A;  3RKW A;  4CXF A;  4AWX B;  1B6A A;  4A0X A;  5KK1 A;  5ILS A;  5DCM B;  2NNY A;  1SFE A;  5E8I A;  4Y15 A;  2Y75 A;  4WX9 A;  3CUO A;  1BOA A;  4IXA A;  2O03 A;  1OYI A;  2ETH A;  3ZN0 A;  1U6G A;  3LQQ A;  2DBB A;  4JBA A;  3KE2 A;  3ECO A;  3V7S A;  2CQK A;  1MJ9 A;  3H3U A;  2P8T A;  2F5D A;  2D2W A;  3IRR A;  1MJB A;  4RS8 A;  3T8R A;  3ERE D;  2H6C A;  4RGX A;  5FLX Z;  4KDP A;  5JFR A;  3MZY A;  2OD5 A;  5H6Q A;  4U88 A;  1ON1 A;  4XLP F;  4Q47 A;  3KLN A;  5JHU A;  1FLI A;  3GX4 X;  3ZMU A;  2XKO A;  5AON A;  1E17 A;  2VOO A;  1T39 A;  1F4K A;  3HOT A;  2HZT A;  5BPI A;  2BBY A;  4MHG A;  4L0Z B;  3TO6 A;  1UB9 A;  1USS A;  1XDS A;  1FBS A;  5J8C A;  3FM5 A;  2W57 A;  2QM3 A;  1ZG5 A;  1GXP A;  4EM0 B;  3E3V A;  1QNT A;  3GZ5 A;  1KQ9 A;  4LFU A;  2XV4 S;  3SQN A;  4LGW A;  4M72 A;  1F1Z A;  1EH7 A;  4RB1 A;  1LJ9 A;  5HS9 A;  5TRD A;  2Q2E A;  2R3S A;  4LJZ F;  1BN5 A;  1IRG A;  1U3E M;  2FMY A;  4P96 A;  3L2C A;  3F72 A;  3DP7 A;  1H9T A;  1FP2 A;  2NAZ A;  3M7G A;  1B59 A;  3DEU A;  3F8F A;  3CO7 C;  1K79 A;  3HUG A;  4QWQ A;  2XAS A;  2IRF G;  1S6L A;  1G4D A;  1SFU A;  4G8X A;  1XGO A;  4I02 A;  6PAX A;  4WXH A;  3HSR A;  1ZG1 A;  1C0W A;  3L7W A;  4MTD A;  3ISP A;  3SZT A;  1HW1 A;  4IRH A;  3I64 A;  3MAJ A;  4I0B A;  1R1V A;  2BE5 F;  3H3Z A;  3JTG A;  1O3Q A;  2DK8 A;  3H92 A;  3BJO A;  2L54 A;  4UUV A;  2MBF A;  4XLN F;  5FFZ A;  2X4H A;  1AOY A;  1XSV A;  2XIG A;  2LF8 A;  1ZRF A;  2K86 A;  2AXL A;  2Z33 A;  5D5W B;  3E6C C;  1JHH A;  3U1D A;  1ZYR F;  2F5F A;  4G6D A;  5K5R A;  1HSJ A;  2KIU A;  1WRJ A;  5K5Q A;  3QU3 A;  4Q4Z F;  5HDK A;  3K1M A;  2HYG D;  3WTW C;  2OU2 A;  3GF2 A;  4HBL A;  3K2Z A;  3GZ6 A;  2MC3 A;  2EV5 A;  2V6C A;  2PBI A;  3CTA A;  1G3W A;  4EJV A;  2STT A;  5J8F A;  3BZ6 A;  1J5Y A;  3GWZ A;  2EFP A;  1KU9 A;  1GHC A;  3EDP A;  1BI0 A;  2O0Y A;  2YPR A;  1YW9 A;  3E5Q A;  4ENK A;  3FM3 A;  5LGU A;  3V7C A;  4F7Z A;  2UWM A;  2E7X A;  4GGG A;  1T0F A;  4YG2 F;  3HRS A;  1ON2 A;  1R23 A;  2K27 A;  4RGU A;  1SD5 A;  2HKX A;  5LHG A;  1YYV A;  5BQT A;  3V8K A;  1IF1 A;  3CJN A;  3TOB A;  1QGP A;  5E1W A;  5ILU A;  2HEO A;  5D8K B;  3KP7 A;  2NS0 A;  3TDZ C;  2EWN A;  3HTS B;  2XAQ A;  4ON0 A;  1EH6 A;  4ZYG A;  4S04 A;  5CVV A;  4MQ9 F;  3VB2 A;  1FYM A;  4CYD A;  1TQM A;  2VBZ A;  2YX4 A;  3KEO A;  4LMY A;  1G3Y A;  2VBX A;  1TW3 A;  5HLG A;  1YLF A;  4ESB A;  1XSX A;  1OMI A;  4UVC A;  4BHC A;  1T98 A;  2VE9 A;  5FB2 A;  1JGS A;  4A5N A;  2G7U A;  1S8N A;  2ZNY A;  2ZXJ A;  1FX7 A;  3PQK A;  1I1G A;  2HKO A;  2J5O A;  3F8N A;  3F8B A;  2CGP A;  1ULY A;  4JK1 X;  2Y48 A;  4PCQ A;  2Y0M A;  1LVA A;  3FZV A;  4EM2 A;  1W7P B;  4Q48 A;  1U5T A;  2NNN A;  3L09 A;  3L00 A;  1J59 A;  2GZW A;  2FU4 A;  4N0B A;  4UV8 A;  4A2U A;  2HTJ A;  4YIF A;  5ILV A;  4L18 B;  2QQ9 A;  2FQ3 A;  2KKO A;  4KIF A;  5DCM A;  3JSP A;  5BMZ A;  1AWC A;  2COM A;  3CUQ C;  1PUE E;  2LKP A;  2WWY A;  1W7P D;  1BIB A;  3IKV A;  2OQG A;  3P9I A;  3EQL F;  2F5E A;  1W4M A;  5D4R A;  3NQO A;  3F23 A;  4LB5 A;  5D6E A;  3HHG A;  2MH2 A;  3HTU A;  5L3C A;  2V1D A;  3MQ0 A;  1EH8 A;  5LBQ A;  5HLI A;  2GA1 A;  3C3W A;  4AVP A;  2GA2 A;  1IN6 A;  2FOK A;  2MLK A;  4IRG A;  1ZLJ A;  2ESH A;  4HA8 A;  1BI1 A;  2BYV E;  5D5V B;  4FX4 A;  4G7Z F;  3TO9 A;  2XAF A;  4HV5 A;  3L9F A;  4Z2Y A;  2ZJ2 A;  4E70 A;  4P9U A;  5FLX K;  1U8R A;  2A69 F;  4TV7 A;  3FMS A;  4U7D A;  1V3F A;  2CO5 A;  1U5T C;  3MWM A;  4UHT A;  4B8X A;  5K1Y A;  2ISY A;  3K69 A;  1UCR A;  1Z91 A;  3IWF A;  3WGH A;  4A6D A;  1DDN A;  3DF8 A;  2HGC A;  1O7L A;  1TQI A;  1FPQ A;  4NB5 A;  4G7H F;  5LRR A;  3I58 A;  2PFB A;  3WTX C;  2LDU A;  1TTY A;  1YS6 A;  4M73 A;  3IKT A;  5DD4 A;  2MLG A;  2GQQ A;  1OR7 A;  2KJB A;  3T5X A;  3DV8 A;  3LA3 A;  1HW2 A;  4O5V A;  3QPH A;  2Z9O A;  2FBH A;  2IW5 A;  3LQR A;  4EV0 A;  3O3K A;  2DU9 A;  4EJO A;  1DPU A;  1IW7 F;  4A0Z A;  2R7D A;  3RDI A;  3DXJ F;  3WTS C;  2JPB A;  1G6N A;  2EA2 A;  4RGS A;  1BBY A;  1KQ8 A;  1HKQ A;  3VEP A;  2G9W A;  1B9N A;  1F5T A;  1L3L A;  4M9X A;  3HOS A;  1I1S A;  3F8M A;  5JVT A;  3QOP A;  1FT9 A;  1W5S A;  2KIM A;  5FGM A;  1HXD A;  2ZME B;  1LDD A;  3T0Y A;  5E17 F;  4LG0 A;  1LEA A;  1YQA A;  3KP4 A;  5E1Z B;  1T2K A;  4HF2 A;  4EVI A;  1SD6 A;  3S2W A;  4CDG A;  1Q1H A;  1ZH5 A;  3ROU A;  3T1B A;  1KU7 A;  2M8E A;  1KA8 A;  2P5K A;  2O3F A;  3HRU A;  4PDK A;  4WWC A;  1XGS A;  3BRO A;  3WU1 B;  1I5Z A;  1RI7 A;  4A12 A;  1BJA A;  2OQR A;  3NRV A;  4LD5 A;  3E5X A;  1YO5 C;  4L0Y B;  5CVI A;  4ASN A;  5FO5 A;  2HR3 A;  1LNW A;  4L9T A;  3SFZ A;  2PEX A;  1PDN C;  2P4W A;  4DQ2 A;  2PI0 A;  2TDX A;  2IVM A;  2CFX A;  5DDG A;  4N9H A;  3I53 A;  4IJA A;  3J7A O;  4RB3 C;  2VC0 A;  5DD8 A;  1Z9C A;  4BHB A;  3M8E A;  4EGY A;  3GW2 A;  2IPQ X;  4UVA A;  5BS6 A;  1K78 B;  3GFI A;  2AS5 F;  3K1N A;  1XMK A;  1ZG3 A;  4G7O F;  3I59 B;  5LHH A;  3LWF A;  4WK8 F;  1QZZ A;  5L3B A;  4RAY A;  1JE8 A;  2HYF A;  4EM1 A;  5HVQ C;  3BOQ A;  1J2X A;  2DO7 A;  3ECH A;  3R60 A;  3SHF A;  4R79 A;  4KYW A;  2W25 A;  1DPR A;  4K2E A;  2YU3 A;  3DPL C;  1LDK B;  1IAW A;  3F6O A;  2QEN A;  3W6K B;  2LF7 A;  2J5P A;  1CGP A;  2EFN A;  3RYR A;  3IRQ A;  1W7P A;  4LK1 F;  1QPM A;  4NQW A;  3J81 Z;  1MDM B;  1T38 A;  3QRF F;  2DI3 A;  3HYI A;  5DV5 A;  2RGV A;  4UNO A;  2IA1 A;  1XCB A;  3WTV C;  2HQR A;  1CF7 A;  2VT2 A;  1HBX G;  5A2Q Z;  5D6F A;  1D5V A;  3RJP A;  4BH9 A;  2MD5 A;  2PMH A;  3M9A A;  4ETS A;  5LLQ A;  2D1H A;  2JPC A;  3FXQ A;  4ZZL A;  4PGG A;  3EYI A;  3ELK A;  2ESN A;  5F1R A;  3TOA A;  3E97 A;  4WCG A;  2CG4 A;  2RKH A;  1MGT A;  4HAM A;  2GIV A;  2HDC A;  5H6R A;  1X3U A;  2EK5 A;  4ENJ A;  1FBQ A;  3F3X A;  4ESJ A;  2Q8K A;  5ERI A;  4P9F A;  3HHH A;  2WC2 A;  5KVR A;  1ONV A;  2W24 A;  4CZZ A;  4RGR A;  1BI2 A;  4MNU A;  3KZZ A;  1R5G A;  1SMT A;  2QBY A;  3EET A;  1P92 A;  3WTY C;  4KIC A;  1TBX A;  2VBY A;  1KYZ A;  4LK0 F;  5K5O A;  4HQM A;  1WSU A;  4HDU A;  4UXN A;  5CVU A;  2E1N A;  1TNT A;  1QO0 D;  1D8J A;  4L9J A;  3LAJ A;  1S29 A;  1P2F A;  1Z6R A;  2HFH A;  2PMU A;  2QUF A;  1ZAR A;  5HDN A;  1Y0U A;  4IPA A;  4MEY F;  1FYK A;  4G6Q A;  5D4S A;  3N97 A;  4AIH A;  1O3R A;  1G3S A;  1HKT A;  5L3G A;  2V79 A;  3KP2 A;  2KRF A;  2XAJ A;  4A0Y A;  3CUQ A;  1RZ4 A;  1IN4 A;  2DTR A;  2JTV A;  3TDU C;  1FYL A;  2EFO A;  1TW2 A;  2A6E F;  2HTS A;  1KU3 A;  2FA5 A;  2PG4 A;  5EEH A;  3RPU A;  3GEZ A;  4I0A A;  1REP C;  1J7K A;  1FWZ A;  2RC4 A;  1MKM A;  2ZKZ A;  1YG2 A;  1FOK A;  2ZO4 A;  3I54 A;  5DUK A;  2ACJ A;  1TNS A;  4R1H A;  4ZYD A;  4OIQ F;  2L01 A;  5AIQ A;  5L3F A;  4HLY A;  3K0L A;  1YFH A;  4NHJ A;  3U9G A;  2L02 A;  2RQP A;  3ZMS A;  4HOB A;  1SAX A;  2UXX A;  2E7W A;  2FNA A;  2XAG A;  3R0J A;  3V7R A;  3MFK A;  3JAM K;  4MGR A;  2H27 A;  5IT9 Z;  2EJR A;  4M6Y A;  3I0T A;  4H0E A;  1IZ1 A;  1J0R A;  1HST A;  2MA3 A;  2A6H F;  1U78 A;  3DQV C;  5H20 A;  1BIA A;  2FNP A;  2O8X A;  1OYW A;  2DW4 A;  2K7L A;  2H09 A;  5F6F A;  1PP7 U;  2QVO A;  3MCZ A;  3RTR A;  3E6D A;  2NYX A;  3GO5 A;  4I98 B;  2Q0O A;  3PQJ A;  2BV6 A;  1RUN A;  2QLZ A;  1O7F A;  3COA C;  2H94 A;  1WI9 A;  2VE8 A;  4R8H A;  2ZCW A;  1Z7U A;  5E20 A;  4AD9 A;  4XRF A;  3KP6 A;  1MZB A;  2IP2 A;  1SD4 A;  4JQF A;  4Q5S F;  2Z5U A;  1NHA A;  5LGT A;  3E6M A;  1YW8 A;  2QQB A;  1P4X A;  4FT8 A;  3RKY A;  1HKS A;  4KFC A;  4BAY A;  4HLX A;  2BGC A;  3B73 A;  5DUI A;  3KZY A;  3Q5F A;  1Z1D A;  2M87 A;  4I2O A;  2XRO A;  4OIP F;  1VTN C;  2DQR A;  3E5U A;  2IJL A;  3I59 A;  3SXY A;  1SMY F;  1B9M A;  5FD5 A;  2JZY A;  3IHU A;  1KYW A;  4XSX F;  2K4J A;  2ISZ A;  1ZN2 A;  3RPQ A;  3BJ6 A;  2OZ6 A;  2IA2 A;  4KN7 X;  1S7O A;  3CDH A;  4KMF A;  3FHZ A;  5D5U B;  4I09 A;  3GXO A;  5AIP A;  4L9V A;  3LFK A;  5HOO A;  5E1X A;  5LHI A;  3KCC A;  1EV7 A;  4GYI A;  3QAH A;  4L5I A;  2RDP A;  2JRT A;  2A61 A;  5DEQ A;  1O3S A;  1QQI A;  1WQ2 A;  1P4A A;  3IWZ A;  2V1X A;  3OV8 A;  4U0W A;  4MEX F;  2CSO A;  3ZQ7 A;  1YS7 A;  1H9G A;  3N4M A;  3NEU A;  2B0L A;  4OIO F;  3ZMT A;  5ICE A;  3KFW X;  1BC7 C;  2YR2 A;  3FWE A;  4IVN A;  3ZN1 A;  4CHU A;  3J81 K;  2R7F A;  3TO7 A;  4HYE A;  2P7V B;  2WTE A;  1RUO A;  3REO A;  1GXQ A;  2L4A A;  3EUH A;  4OU0 A;  1QBJ A;  3ZPL A;  3JAM Z;  2ELH A;  3O6B B;  5A2Q K;  1YW7 A;  3JTH A;  2OBP A;  4FX0 A;  4P55 A;  3KP3 A;  4FHT A;  2EV0 A;  2DFI A;  3HRT A;  2FXA A;  4IRI A;  1XGN A;  2DK5 A;  4OOI A;  4ZZD A;  3R6S A;  2UXN A;  3GVA A;  3WTZ A;  1ZRD A;  2F2E A;  5HDG A;  4BQA A;  1Z6T A;  4YFX F;  5LRS A;  2PN6 A;  2IA0 A;  1FC3 A;  1IN7 A;  4L5J A;  3U2R A;  5E18 F;  2MH9 A;  3JW4 A;  1B4A A;  2LNB A;  4G9Y A;  1TQP A;  4GXO A;  3RI4 A;  4ENM A;  2K02 A;  1DUX C;  3OOP A;  2DLL A;  2P6T A;  5CJ9 A;  2EFQ A;  2X0L A;  2VOD A;  3O2P E;  3MZH A;  5ICG A;  1YTY A;  1OKR A;  4BYY A;  1GVJ A;  4EQQ A;  4HZF A;  2W85 A;  1P4W A;  2RN7 A;  4UVB A;  2KIF A;  4GCV A;  4IHT A;  3WE3 A;  4CGZ A;  5DCF A;  3D5L A;  1WKM A;  1LEB A;  1IXC A;  1IXS B;  4HX8 A;  4BHP A;  3MEX A;  3RYP A;  2VOP A;  1SD7 A;  4OMZ A;  2ZBK A;  5E8G A;  1HW5 A;  4LB6 B;  1K6O A;  1ODD A;  1STZ A;  2FML A;  4HV6 A;  3K9T A;  3LAP A;  4WF2 A;  1KQ0 A;  2P7C B;  2FF4 A;  3KP5 A;  3WTU C;  1R00 A;  1R1U A;  3FMQ A;  1XGM A;  2YX7 A;  2F5C A;  3HSF A;  1XB4 A;  2HWV A;  1FNN A;  3VFZ A;  4EJT A;  1MJA A;  1ZGA A;  1XCV A;  1XSD A;  2OAZ A;  2CW0 F;  2EV6 A;  5HLH A;  3F21 A;  2XAH A;  3E6B A;  4OIR F;  4ZH4 F;  1BM9 A;  2XUB A;  2FSW A;  2ZFW A;  1O57 A;  3Q9S A;  1KGS A;  1ZGJ A;  3IL2 A;  2P5L C;  5BOX A;  2VT3 A;  1JXS A;  4HX4 A;  1H0M A;  1W5T A;  3CO6 C;  3FXR A;  3ABU A;  1G3T A;  4RB0 A;  5L3D A;  1J9I A;  2XGX A;  2GXB A;  3BPX A;  5IT9 K;  2A3S A;  3PFI A;  3GLX A;  4KN4 X;  1ZLK A;  5FFX A;  2XVC A;  4G94 A;  3HSE A;  4PGH A;  4IHS A;  3ZP5 A;  2ZNZ A;  1BC8 C;  3M1E A;  4M71 A;  1UHM A;  1L0O C;  2OZU A;  1R7J A;  1E2X A;  3V8L A;  2Z3Y A;  2IT0 A;  2VON A;  3Q9V A;  1OYY A;  4S05 A;  2CYY A;  4QLC U;  3J80 Z;  4CIC A;  3KET A;  1LQ1 A;  2H6B A;  1YIO A;  4I7H A;  1R58 A;  2UZK A;  2M30 A;  2PJP A;  5DYM A;  1FSH A;  5HS8 A;  3GYH X;  2QYO A;  4LG0 B;  2VN2 A;  3P9K A;  2M5W A;  4YFK F;  2JSC A;  2D1V A;  3ULQ B;  2Z99 A;  4DNC A;  4O3M A;  2FBK A;  1LB2 A;  4MTE A;  4IF4 A;  3ZMZ A;  1V4R A;  3C1D A;  1UST A;  3GFL A;  4U0Y A;  2LSO A;  4UV9 A;  3V4G A;  3FF5 A;  3I4P A;  4KA4 A;  1T6S A;  2EA4 A;  3C7J A;  4XBF A;  4GO1 A;  5FD6 A;  4WXD A;  2A68 F;  2FRH A;  5CLS A;  1XMA A;  2DPD A;  4I01 A;  3F22 A;  1DP7 P;  3P7N A;  2RVC A;  2E1C A;  1D8K A;  3DKW A;  4M74 A;  2WV0 A;  5LEJ A;  1ZHF A;  5LEK A;  2YSR A;  5HS7 A;  3QP5 A;  4KNY A;  1XN7 A;  3R4K A;  3LST A;  2GAU A;  3G73 A;  4KIG A;  1OPC A;  3BP8 A;  2VXZ A;  4M6X A;  4BNC A;  3RIR A;  4ZYE A;  1A04 A;  2DQL A;  2W84 A;  4ESF A;  3LA7 A;  3QPT A;  3BPV A;  3WGG A;  2RNJ A;  3GFM A;  5CVR A;  1IXR C;  2HOE A;  1R1T A;  3FXU A;  4O6J A;  3D0S A;  2ZME A;  4EJW A;  2RV8 A;  3G3Z A;  2STW A;  1WWX A;  4A6E A;  4YFN F;  1XDU A;  1ZRC A;  3R61 A;  1S7A A;  4HF0 A;  3GUD A;  4GYG A;  1O3T A;  4EGZ A;  1FY7 A;  4L9N A;  3M8F A;  2XHK A;  1JHF A;  2D45 A;  2OA4 A;  3CLO A;  1S3J A;  4BXU A;  2V1U A;  3WOD F;  3HIF A;  3KLO A;  3R0A A;  2PLY A;  4HW0 A;  4XSZ F;  3WE2 A;  3BJA A;  2K4B A;  2VBW A;  1FZP B;  1CF7 B;  4MQV A;  1MD0 A;  5IT3 A;  2A07 F;  2QWW A;  4LLG F;  3TQN A;  2P5V A;  4B09 A;  3QP6 A;  1IUY A;  1QZY A;  1XD7 A;  1PP8 F;  2EFW A;  5TJJ A;  4PZJ A;  4N9I A;  2JT1 A;  2O6G E;  4ENN A;  4HQE A;  1UHW A;  5JR3 A;  2VC1 A;  2FE3 A;  3WG9 A;  1RIO H;  1B1B A;  3GFJ A;  5BPD A;  3AAF A;  1K78 A;  1FBU A;  2A5Y B;  3TGN A;  3LA2 A;  3BDD A;  2V9V A;  4A5M A;  2FBI A;  4HF1 A;  5ICF A;  2BEO A;  5J6X A;  2PQ8 A;  2L3D A;  2QBY B;  4U0V A;  5JI6 A;  5EEG A;  3DFG A;  2L4M A;  5LGN A;  3F8C A;  3P9C A;  3JSO A;  5CYV A;  1HQC A;  4OMY A;  1RNL A;  4KIB A; 
#chains in the Genus database with same CATH topology
 2X6Y A;  2CWE A;  2KJC A;  4LLL A;  1WHU A;  5H2F C;  4BDZ A;  1P6R A;  4KT5 C;  2NVU B;  3I5U A;  1OLT A;  5IYB J;  1YI2 I;  4WXC A;  1CQT A;  3U21 A;  1IN5 A;  1MBG A;  3LSK A;  4RB2 C;  1R5H A;  1D3Y A;  3F6V A;  3TW6 A;  2M45 A;  1J75 A;  3OL3 A;  4M9S A;  1U2W A;  2O61 A;  3NWT A;  1R22 A;  3LNQ A;  3BY6 A;  2Y2Z A;  1SFX A;  3BWG A;  1FP1 D;  2GWR A;  3C18 A;  3WU2 C;  2IS2 A;  3EYY A;  5D5X B;  1MDM A;  4FAS D;  2LFB A;  3TKY A;  4H4K C;  2QQA A;  2KFD A;  4XLE A;  3ML6 A;  3QU6 A;  2DA6 A;  2JUG A;  3DPT A;  4EJU A;  3W6J B;  3VWB A;  5ICC A;  3S17 J;  1ACI A;  2E1O A;  4FIS A;  1E0E A;  4EAT A;  4ITV A;  4LG3 A;  4HDV A;  1SAN A;  2M0C A;  2DMP A;  4U7B A;  3SZP A;  1SC7 A;  2CW7 A;  4D7M A;  3ASN H;  1OCR H;  4D0P A;  5E3M A;  4BJT A;  4ZYH A;  5J1Y A;  2XRN A;  4A3L J;  1I27 A;  2HQN A;  2NRA C;  3CUQ B;  1LDJ A;  1X1B A;  4AIK A;  3W2W A;  4EMS A;  2M1B A;  2E60 A;  3IAS 2;  1TLH B;  3I71 A;  5K7H A;  5CVJ A;  4NBQ A;  3VOE A;  3A0B C;  3A0H C;  2G7H A;  4CZC A;  3CCL I;  1UFM A;  1I6X A;  1Y56 A;  4FET A;  4AIJ A;  2XKP A;  3DPU A;  2DAO A;  5ED4 A;  4OWR B;  2DT5 A;  3HOX J;  1F9N A;  3ABT A;  3K1P A;  4I6Z A;  4LLN A;  5JLW A;  3RKX A;  1U0J A;  2GXA A;  3FX3 A;  3DEW A;  3BG3 A;  5L3E A;  1RR7 A;  1Z05 A;  3CCM I;  1ZRE A;  3E0J B;  4Y13 A;  1KU2 A;  3F0C A;  2L2O A;  4RAZ A;  3K2A A;  2EB7 A;  5M5W J;  4XN0 A;  1D0Z A;  1ZAO A;  2P6S A;  1FSE A;  3DU5 A;  3ZMD A;  3B02 A;  4HX7 A;  2HXO A;  4IHX A;  1IRF A;  3KYL A;  3S16 J;  1R36 A;  2HVS A;  2DPU A;  3JRE A;  3JRI A;  2WAE A;  3RPU D;  2FEZ A;  3ZMV A;  1KON A;  3WU0 A;  1WJC A;  4PFP A;  3CCS I;  3V8J A;  1K7A A;  1YJN I;  2BHY A;  2ADU A;  1BI3 A;  3VOD A;  4OIN F;  1YJ9 I;  3IC7 A;  3ASO H;  2L9S A;  4KUM A;  1IC8 A;  2C6Y A;  2HDD A;  3DTE A;  4BUP A;  1JTY A;  4CO8 A;  2VQH A;  2MC4 A;  4Y17 A;  5F64 A;  1E3H A;  1FMW A;  1FJL A;  4OAZ A;  3T8T A;  4P5O A;  4E4H A;  1PUF B;  4YII A;  3WGI A;  2GXG A;  1U5T B;  4KIT B;  3WTT C;  4UUS A;  3FMR A;  3J80 K;  1IN8 A;  2K40 A;  3KEQ A;  4M9Z A;  3CCR I;  2QZ8 A;  3ZQH A;  2V7F A;  1ETQ A;  1BL0 A;  4KMU X;  2E71 A;  3MKW B;  2IGM A;  1ETX A;  2HS5 A;  3HRM A;  3Q0U A;  3BG7 A;  4XLH A;  5D8L B;  2F4I A;  3RKW A;  4CXF A;  4AWX B;  2GIZ A;  3A2K A;  1B6A A;  5E3L A;  2VL8 A;  4A0X A;  1OR7 C;  3H5N A;  5KK1 A;  5ILS A;  5DCM B;  3HPH A;  2NNY A;  1SFE A;  5E8I A;  4Y15 A;  2Y75 A;  4WX9 A;  2LY1 A;  3CUO A;  1BOA A;  4IXA A;  4U87 A;  2LBF A;  2DOE A;  1X1D A;  2O03 A;  1SAU A;  3LL7 A;  3FXJ A;  3JRG A;  1OYI A;  2Z2S B;  2VAS A;  2ETH A;  3ZN0 A;  1U6G A;  5F1J A;  1ETK A;  2Y9Z A;  3RZD J;  3LQQ A;  2DBB A;  3OWT A;  4JBA A;  5FRN A;  3KE2 A;  2LRE A;  3ECO A;  3V7S A;  2VKV A;  3PUB A;  2CQK A;  3S1M J;  4YRV A;  1MJ9 A;  3H3U A;  1ZR4 A;  3G2B A;  2P8T A;  2E19 A;  2F5D A;  2D2W A;  3IRR A;  1GLN A;  3A01 B;  3K4B A;  3FIS A;  1VQO I;  1MJB A;  4OAY A;  4RS8 A;  3T8R A;  3ERE D;  3LSP A;  4E7H A;  1Z3X A;  1F36 A;  2H6C A;  4IL6 C;  4RGX A;  5FLX Z;  2HZD A;  4KDP A;  4B4C A;  3BG9 A;  5JFR A;  3MZY A;  4JX6 A;  5KNL A;  1HCR A;  4XOT A;  2LOO A;  2EIK H;  2DYR H;  2OD5 A;  5H6Q A;  4U88 A;  4C3I J;  4ZJZ A;  1ON1 A;  4XLF A;  2CUJ A;  4BQN A;  4ZDL A;  2NXN B;  1HDD C;  4ZDP A;  4XLP F;  4Q47 A;  2ECC A;  3KLN A;  5JHU A;  1FLI A;  2HVR A;  3GX4 X;  3GZN B;  1JGG A;  3ZMU A;  2XKO A;  5AON A;  1E17 A;  4N4N B;  2VOO A;  1J09 A;  3OS1 A;  1T39 A;  2ELJ A;  2HZT A;  4S0H B;  2BBY A;  3AG3 H;  4MHG A;  3TO6 A;  3HOT A;  5BPI A;  4L0Z B;  2KPM A;  4IHW A;  4BL0 B;  1RRJ A;  2X48 A;  1UB9 A;  1USS A;  1XDS A;  1FBS A;  2DFH A;  3FM5 A;  2W57 A;  3QYB A;  4KT6 A;  5J8C A;  1K4T A;  2QM3 A;  1ZG5 A;  5M5X J;  5J4Y A;  4XOR A;  1Y39 A;  1GXP A;  4EM0 B;  3E3V A;  5HNH A;  1QNT A;  1WFX A;  3GZ5 A;  1KQ9 A;  4LFU A;  2Y30 A;  2VXD A;  2XV4 S;  3SQN A;  2HXI A;  1MSF C;  3HOY J;  3TED A;  4LGW A;  4M72 A;  1F1Z A;  2G0E A;  3CES A;  3K4L A;  3L2V A;  1EH7 A;  4BY1 J;  1D1A A;  4CCL A;  1LJ9 A;  4RB1 A;  5HS9 A;  1JT0 A;  2NVX J;  3A1Y A;  4Y3O A;  1VFC A;  5TRD A;  2Q2E A;  3ESW B;  2R3S A;  1IRX A;  4LJZ F;  1BN5 A;  1IRG A;  4JP0 A;  3PL8 A;  1U3E M;  1WJE A;  3E7L A;  2FMY A;  3ABM H;  4P96 A;  1APL C;  4AUX A;  3L2C A;  3F72 A;  2BW3 B;  3EPZ A;  5M3F J;  2LKS A;  3DP7 A;  1PJR A;  1H9T A;  1FP2 A;  2NAZ A;  3BZC A;  3M7G A;  3QPL A;  2PJR B;  1B59 A;  3DEU A;  3F8F A;  3OIQ A;  1Y6I A;  3CO7 C;  4Z6Y A;  1K79 A;  1QU3 A;  3HUG A;  4QWQ A;  1RKW A;  2M8G X;  5IY5 H;  4RDU A;  3DKY A;  2K9L A;  2XAS A;  2IRF G;  1S6L A;  3SDB A;  3H5R A;  2FJ1 A;  3G1L A;  1G4D A;  4C9Y A;  1SFU A;  4G8X A;  1H8A C;  1AKH A;  2L5Q A;  3PUF A;  1XGO A;  2M4K A;  4I02 A;  6PAX A;  4WXH A;  3HSR A;  1ZG1 A;  1C0W A;  3K10 A;  1X58 A;  3L7W A;  4MTD A;  3ISP A;  1JJ8 C;  1MSE C;  1D1C A;  5B1B H;  3SZT A;  1HW1 A;  4DBQ A;  4IRH A;  3I64 A;  3MAJ A;  4I0B A;  2VQL A;  3GCM A;  1MNE A;  1DGR M;  1R1V A;  2BE5 F;  3H3Z A;  3JTG A;  2K9Q A;  1O3Q A;  2DK8 A;  3H92 A;  3BJO A;  2L54 A;  4UUV A;  2MBF A;  5CPR B;  4XLN F;  5FFZ A;  2X4H A;  3FKJ A;  1AOY A;  1XSV A;  1T95 A;  2XIG A;  2LF8 A;  3K4J A;  3NAR A;  1R49 A;  5J47 A;  3K70 C;  5E79 C;  1ZRF A;  2K86 A;  4ZYA A;  2AXL A;  2Z33 A;  5D5W B;  1O4X A;  1V5G A;  4F93 B;  1DU0 A;  3E6C C;  1JHH A;  3U1D A;  1ZYR F;  2F5F A;  4G6D A;  5K5R A;  1NG6 A;  1HSJ A;  2IGK A;  2KIU A;  2W00 A;  1WRJ A;  3OYF A;  3BTJ A;  3OL4 A;  3VSK A;  1W36 C;  3FHN A;  3H5A A;  2DMT A;  2FD5 A;  3H9G A;  1MMN A;  1D0Y A;  2W7N A;  5K5Q A;  4HNV A;  4Y52 J;  3QU3 A;  4DYR A;  4Q4Z F;  5HDK A;  3K1M A;  3RSN A;  2HYG D;  3WTW C;  2D5V A;  1BJZ A;  4QPQ A;  2OU2 A;  3GF2 A;  4HBL A;  3K2Z A;  1BW6 A;  3GZ6 A;  2MC3 A;  2EV5 A;  2V6C A;  2PBI A;  3CTA A;  2EBI A;  1H88 C;  1ZK8 A;  2ZXW H;  1G3W A;  3JRF A;  4A3B J;  2MSY A;  4EJV A;  2STT A;  2M34 A;  5J8F A;  3BZ6 A;  4XID A;  1J5Y A;  1MMD A;  2BY0 A;  2X1E A;  1NH3 A;  2JVG A;  1OIS A;  2XF7 A;  3GWZ A;  4DYC A;  4PJ0 C;  3ABL H;  2OCE A;  2EFP A;  1KU9 A;  1GHC A;  2FQ4 A;  3EDP A;  2H8W A;  5M3M J;  4M3B A;  1BI0 A;  2BXY A;  2O0Y A;  4DBR A;  2YPR A;  1YW9 A;  5GAG J;  1G59 A;  3E5Q A;  2LG4 A;  1TL8 A;  4ENK A;  2KRH A;  3NAU A;  2EZK A;  3FM3 A;  1ETY A;  4PJM A;  5LGU A;  2L9N A;  1IDY A;  3V7C A;  4F7Z A;  2UWM A;  2E7X A;  4GGG A;  1T0F A;  4YG2 F;  1LFP A;  3HRS A;  4FE4 A;  1ON2 A;  1R23 A;  4IHV A;  1B72 A;  1PYV A;  2K27 A;  2DA4 A;  4RGU A;  1SD5 A;  2HKX A;  5LHG A;  1YYV A;  1JT6 A;  3IUO A;  2JSP A;  5BQT A;  1AU7 A;  3V8K A;  5BNG A;  1IF1 A;  3CJN A;  3TOB A;  1QGP A;  5E1W A;  2CUF A;  2MGQ A;  4B43 A;  5ILU A;  5C3E J;  2HEO A;  5D8K B;  3KP7 A;  2NS0 A;  3TDZ C;  2EWN A;  3HTS B;  2XAQ A;  2P81 A;  2JWT A;  3H0D A;  4ON0 A;  1EH6 A;  1VQM I;  4ZYG A;  4S04 A;  5CVV A;  4A3G J;  2X1D A;  1A5J A;  4MQ9 F;  1YHQ I;  1MH4 A;  3VB2 A;  1FYM A;  4XRS A;  4QPO A;  4CYD A;  1TQM A;  2VBZ A;  2E5Z A;  2EZI A;  2YX4 A;  3ZQI A;  3G6E I;  2IEK A;  3KEO A;  4LMY A;  5HNF A;  3EUA A;  2M9H A;  5GP9 A;  1TWH J;  1G3Y A;  3FXM A;  2VBX A;  1TW3 A;  3CMY A;  1LE8 B;  5FKL A;  1YLF A;  5HLG A;  1ETW A;  1XTA A;  3S32 A;  3OYG A;  2CMP A;  4ESB A;  1XSX A;  3M07 A;  1ZR2 A;  1OMI A;  1AHD P;  4UVC A;  4BHC A;  2VQC A;  4RMN A;  1TWA J;  3A4C A;  3B6A A;  1POG A;  2R4G A;  1T98 A;  2VE9 A;  3MZ8 A;  1A6Q A;  5FB2 A;  1U8B A;  1JGS A;  4A5N A;  2G7U A;  4JOM A;  1QHH D;  2ME6 A;  5IOZ A;  1S8N A;  2ZNY A;  2ZXJ A;  1FX7 A;  2OC6 A;  3PQK A;  5B3S H;  1I1G A;  2HKO A;  2J5O A;  3F8N A;  3CCQ I;  3F8B A;  2CGP A;  3S1Q J;  1ULY A;  4JK1 X;  4JYK A;  2Y48 A;  3FBN B;  4FQG A;  4DIQ A;  2GLO A;  2DYS H;  4PCQ A;  3RQ4 A;  1ETV A;  5GTI C;  2Y0M A;  3AL0 B;  5FRM A;  3S8P A;  2Y0S N;  1HF0 A;  1LVA A;  1RKT A;  3FZV A;  3GTO J;  4EM2 A;  2KMU A;  1T08 B;  1S5L C;  5EGO A;  1W7P B;  4Q48 A;  2M7B A;  1U5T A;  2NNN A;  3L09 A;  1WZ2 A;  3L00 A;  1J59 A;  2GZW A;  3M3Y J;  2FU4 A;  4N0B A;  4BKX A;  4UV8 A;  1T0F C;  4A2U A;  2FUG 2;  2HTJ A;  1ZKG A;  3CJR B;  4JX5 A;  2QQ9 A;  4YIF A;  5ILV A;  4L18 B;  1OCP A;  2FQ3 A;  2KKO A;  4HEA 2;  1N25 A;  4KIF A;  2R7X A;  5DCM A;  3JSP A;  2E5N A;  5BMZ A;  1AWC A;  3CQZ J;  2COM A;  3CUQ C;  4NC7 A;  1PUE E;  2LKP A;  1XPX A;  2WWY A;  2R93 J;  1W7P D;  4A3I J;  2HQA A;  3HGG A;  1BIB A;  2MYS A;  3AG1 H;  2XSD C;  3IKV A;  1W5C C;  3OR1 C;  1TT5 B;  2OQG A;  1IDZ A;  1LUJ B;  1P7I A;  3P9I A;  4A3M J;  2EH3 A;  3EQL F;  1R5I D;  2F5E A;  2LP0 A;  2WA0 A;  1W4M A;  2BY2 A;  5EYR A;  5D4R A;  3UR3 C;  4CCM A;  1I3Q J;  3DBR B;  3WHC A;  1SFO J;  2ZXH A;  2BVL A;  3NQO A;  1WJF A;  1S72 I;  3K4M A;  3F23 A;  4LB5 A;  3PO2 J;  5D6E A;  2E36 A;  3HHG A;  2MH2 A;  3HTU A;  1DP3 A;  3BR5 A;  1GT0 C;  5L3C A;  2V1D A;  3MQ0 A;  1EH8 A;  3D1N I;  3CCY A;  5LBQ A;  5HLI A;  2GA1 A;  3C3W A;  4AVP A;  2GA2 A;  3FKI J;  3ZGK A;  2DMN A;  1IN6 A;  2FOK A;  1GV5 A;  1W0T A;  2MLK A;  4IRG A;  3OYM A;  1ZLJ A;  2ESH A;  4HA8 A;  1BI1 A;  2BYV E;  4PJL A;  5D5V B;  4FX4 A;  2X51 A;  3QQA A;  4G7Z F;  3TO9 A;  1T8I A;  1MBE A;  2LK2 A;  3BR0 A;  4BJ5 C;  2XAF A;  1P9Q C;  1Y1W J;  4HV5 A;  3L9F A;  1UJ8 A;  4Z2Y A;  2ZJ2 A;  4E70 A;  4P9U A;  2LD5 A;  5FLX K;  3BR6 A;  2LR8 A;  1X1A A;  1MH3 A;  1V54 H;  1U8R A;  2A69 F;  1A35 A;  3ABK H;  2EZL A;  1UMQ A;  4TV7 A;  2O5R A;  4MLO A;  3FMS A;  5JLX A;  4XMY A;  4U7D A;  1V3F A;  2CO5 A;  2Y0S A;  1U5T C;  2MAB A;  3MWM A;  1JJ6 C;  5CQE A;  4BBS J;  4UHT A;  4B8X A;  5K1Y A;  1S9H A;  1JUP A;  1AA7 A;  2ISY A;  2HYJ A;  2X6W A;  3K69 A;  2LMD A;  1VI0 A;  2E1M C;  2A6T A;  3FIW A;  1UCR A;  3LOC A;  1Z91 A;  3IWF A;  1X4P A;  3WGH A;  4A6D A;  4RLF A;  2KDZ A;  2LTP A;  4DJA A;  3LSG A;  1DDN A;  3DF8 A;  2KZV A;  2HGC A;  1O7L A;  1TQI A;  1FPQ A;  4NB5 A;  1OCZ H;  4G7H F;  3GTL J;  2DFE A;  1BW5 A;  1JKO C;  2B63 J;  5LRR A;  2HOT A;  3A02 A;  4B47 A;  3I58 A;  1OQY A;  2PFB A;  3QYF A;  3WTX C;  2LDU A;  3L2U A;  2DOF A;  1TTY A;  1YS6 A;  4M73 A;  4RAF A;  1SVO A;  3IKT A;  5DD4 A;  2MLG A;  2GQQ A;  1MBH A;  5DTD A;  3JR9 A;  1WI3 A;  1OR7 A;  4D5F A;  4DW6 A;  2KJB A;  4M3E A;  3T5X A;  3UKG A;  3IAM 2;  3DV8 A;  2K85 A;  3LA3 A;  1HW2 A;  3W3C A;  2A5W A;  4O5V A;  3ZR8 X;  4AM3 A;  3QPH A;  2Z9O A;  2FBH A;  2IW5 A;  3LQR A;  1QVU A;  1DU6 A;  4EV0 A;  3G4S I;  1SEU A;  2QSH X;  1MBK A;  3O3K A;  1G2H A;  2QKL B;  2DU9 A;  1T33 A;  1T56 A;  4EJO A;  3O8H A;  1DPU A;  1QHG A;  2CU7 A;  3HXL A;  2DA3 A;  1W0U A;  5TGT A;  1IW7 F;  4A0Z A;  1YIJ I;  2R7D A;  3DXJ F;  3RDI A;  1BR1 A;  3WTS C;  2JPB A;  3TMO A;  1G6N A;  2EA2 A;  1FOW A;  1TT0 A;  2UUZ A;  4RGS A;  2WB1 A;  1BBY A;  1KQ8 A;  4AYB A;  3A03 A;  1HKQ A;  3H9J A;  3VEP A;  2G9W A;  1QZE A;  1B9N A;  2VQG A;  1X3Z B;  2NOG A;  4D9J A;  1ZQ3 P;  1IJW C;  2GOX B;  2Y31 A;  4F52 A;  3K6G A;  1F5T A;  1L3L A;  4M9X A;  1UZC A;  3HOS A;  1I1S A;  3F8M A;  4XKW A;  2O8K A;  2NVQ J;  4E7I A;  3P5J A;  5EG0 A;  4A3J J;  2B7E A;  3S3M A;  2LY2 A;  5JVT A;  3QOP A;  3FXL A;  1SFK A;  3KYC B;  1FT9 A;  1W5S A;  2KDO A;  1Y8R B;  1U9O A;  2KIM A;  3KZI C;  5FGM A;  1HXD A;  2QSG X;  2ZME B;  1LDD A;  2MFZ A;  4XIC A;  1NK3 P;  2XPU A;  3X2Q H;  4BEH B;  3T0Y A;  2DMQ A;  4V2G A;  2K9N A;  2EPF A;  5E17 F;  4LG0 A;  2LVS A;  1LEA A;  2IGN A;  4J19 A;  4XLC A;  4BBR J;  1YQA A;  4MO7 A;  3KP4 A;  4BDY A;  5E1Z B;  1T2K A;  4B48 A;  3HEF A;  4KJZ A;  4HF2 A;  4EVI A;  1SD6 A;  2DA5 A;  3S2W A;  4CDG A;  4A3F J;  1Q1H A;  1ZH5 A;  3ROU A;  4MFD A;  3T1B A;  4IHY A;  2DOD A;  1KU7 A;  5C4X J;  3CP2 A;  5F0C A;  2M8E A;  1OCC H;  2LH9 A;  5KCM A;  2ICW G;  1KA8 A;  3ZQC A;  2P5K A;  2O3F A;  3HRU A;  4PDK A;  4QTR A;  4WWC A;  1XGS A;  3BR1 A;  3BRO A;  4XM3 A;  3WU1 B;  1I5Z A;  1RI7 A;  2JA5 J;  4A12 A;  5IP6 A;  3K4C A;  2XGC A;  1BJA A;  2OQR A;  3NRV A;  4LD5 A;  4II3 A;  3E5X A;  1YO5 C;  2ECB A;  4L0Y B;  5CVI A;  4ASN A;  5KHD A;  5J1U A;  3VDX A;  4RAG A;  5FO5 A;  2E2H J;  2HR3 A;  2M3A A;  1LNW A;  3G1O A;  4L9T A;  3SFZ A;  4LOC A;  4CYC B;  2PEX A;  2F6C A;  1W1W E;  5FKN A;  1PDN C;  2P4W A;  2DA7 A;  4M3G A;  3SDG A;  4DQ2 A;  2PI0 A;  4HPQ A;  4XNF A;  2TDX A;  3BR3 A;  2IVM A;  2BY3 A;  2CFX A;  5DDG A;  2HPI A;  1I3A A;  4N9H A;  1A6I A;  3HM5 A;  2HPM A;  3CP8 A;  3I53 A;  4IJA A;  3J7A O;  4RB3 C;  4D1Q A;  4J01 A;  2VC0 A;  5DD8 A;  2I8D A;  2MD0 A;  3TP0 A;  4BXF A;  5EDN A;  4D5C A;  2JVH A;  1Z9C A;  4V2F A;  4BHB A;  1MMG A;  3M1C A;  3M8E A;  3BZK A;  4EGY A;  3SFI A;  3GW2 A;  2V1N A;  2IPQ X;  1RPW A;  4IEJ A;  4UVA A;  2JA8 J;  1HLV A;  5BS6 A;  4AVZ A;  2W82 A;  1K78 B;  3GFI A;  1X2N A;  2AS5 F;  4XQF A;  3K1N A;  1XMK A;  2ZXI A;  3TW7 A;  3FDY A;  1ZG3 A;  4B1R A;  4G7O F;  3I59 B;  5LHH A;  3LWF A;  1B8I B;  5GPA A;  2R7W A;  4WK8 F;  1QZZ A;  1LE8 A;  2LRD A;  3V42 A;  5L3B A;  3HKZ A;  4RAY A;  1JE8 A;  3VYS B;  3Q3S A;  2R7T A;  2HYF A;  3OYJ A;  3OS0 A;  2AXT C;  4EM1 A;  1JUM A;  4HG2 A;  4E7S A;  1V55 H;  3BOQ A;  5HVQ C;  3OYN A;  3M4O J;  1J2X A;  2DO7 A;  5B5E C;  3ECH A;  3R60 A;  4NC6 A;  4CCK A;  3SHF A;  4R79 A;  3H35 A;  4KYW A;  2W25 A;  3JRC A;  3H1C A;  1DPR A;  1ETO A;  4K2E A;  3DBL B;  2YU3 A;  3DPL C;  1WH5 A;  3G71 I;  3OMY A;  1LDK B;  1IAW A;  3F6O A;  2QEN A;  3W6K B;  1UAA A;  4F92 B;  1GUU A;  2LF7 A;  2J5P A;  2VJJ A;  3DLL F;  2GBY A;  1CGP A;  2EFN A;  3RYR A;  3FBI B;  3IRQ A;  1W7P A;  2QSF X;  5IOY A;  4LK1 F;  2XDV A;  2DA1 A;  3HGY A;  4YIR X;  1QPM A;  3O8G A;  2JA7 J;  4NQW A;  3J81 Z;  1MDM B;  1T38 A;  3LMM A;  2DI3 A;  3HYI A;  3K4N A;  3CCV I;  5DV5 A;  3QRF F;  2YU9 J;  1I50 J;  2RGV A;  4UNO A;  3GME A;  3OSF A;  1R71 A;  2IA1 A;  3E1S A;  1XCB A;  1FIA A;  3WTV C;  2HQR A;  2EQR A;  1CF7 A;  2VT2 A;  1HBX G;  5A2Q Z;  1YIT I;  4B44 A;  1XC5 A;  5D6F A;  3G1M A;  1D5V A;  1ENH A;  3RJP A;  4BH9 A;  2DJI A;  2MD5 A;  2PMH A;  2R7O A;  3M9A A;  5C44 J;  3GTQ J;  3W2V A;  4ETS A;  1MBJ A;  3D5R C;  2NOJ B;  5LLQ A;  4F91 B;  1UG2 A;  2D1H A;  2AHQ A;  2JPC A;  3D5S C;  3FK7 A;  5M5Y J;  1FEX A;  3FXQ A;  4ZZL A;  1WGX A;  4PGG A;  2F5V A;  3EYI A;  3BT9 A;  3ELK A;  5FLV A;  2ESN A;  4BS9 A;  5IP9 J;  3LFU A;  5F1R A;  3TOA A;  3E97 A;  2HQ5 A;  4WCG A;  1D0X A;  2CG4 A;  2RKH A;  2K9M A;  1MGT A;  4HAM A;  2EIM H;  2VKH A;  2GIV A;  2HDC A;  5H6R A;  2ME0 A;  1X3U A;  2EK5 A;  5FKM A;  4ENJ A;  1FBQ A;  3F3X A;  4BQO A;  4ESJ A;  2Q8K A;  5ERI A;  4P9F A;  3HHH A;  2WC2 A;  1MNM C;  5KVR A;  1ONV A;  2W24 A;  5IYD J;  2LLK A;  3GTM J;  4CZZ A;  4RGR A;  1BI2 A;  4MNU A;  3KZZ A;  4JX4 A;  4LIT A;  1R5G A;  1SMT A;  3ZCO A;  3CC7 I;  2R5Y B;  3HZJ A;  1GV2 A;  4E7J A;  2ZJR F;  5CQG A;  4LIV A;  3TBI A;  2QBY A;  2P0W A;  3EET A;  1P92 A;  3WTY C;  1IO2 A;  1X4O A;  3GBG A;  3HPG A;  3OIP A;  4RM3 A;  3AL0 C;  2JK3 A;  1K83 J;  1LPQ A;  4KIC A;  3PFY A;  1UG0 A;  2QA4 I;  5DM7 F;  1XMX A;  1TBX A;  2VBY A;  3AG4 H;  2N8G A;  3DBH B;  1KYZ A;  1WJA A;  4XL9 A;  4LK0 F;  2COB A;  5FKK A;  5K5O A;  4Y7N J;  4HQM A;  4ZDO A;  1WSU A;  3MMY B;  3ZQQ A;  4HDU A;  4UXN A;  2R92 J;  4UUS B;  5CVU A;  2E1N A;  3FK6 A;  2R7V A;  5DS9 A;  1TNT A;  2V26 A;  5J4V A;  1ORK A;  1QO0 D;  1D8J A;  4L9J A;  3LAJ A;  1IGN A;  1S29 A;  1P2F A;  1Z6R A;  3I4M J;  2HFH A;  2PMU A;  2QUF A;  1K61 A;  1ZAR A;  4CSW A;  5HDN A;  2W4S A;  1Y0U A;  4X6A J;  3PM1 A;  1IRZ A;  4IPA A;  2JJ7 A;  5K7Z A;  3HBL A;  4MEY F;  1FYK A;  4G6Q A;  1QRY A;  4ZC3 A;  4PK4 A;  1MMA A;  5D4S A;  2LBF B;  4A3D J;  2Q1Z B;  1TWG J;  3N97 A;  4AIH A;  1O3R A;  1G3S A;  2L7M P;  4CA0 A;  1YX5 A;  4RBO A;  2CW8 A;  1HKT A;  1R4M B;  3ZRG A;  5L3G A;  4A93 J;  4DZP A;  2V79 A;  3KP2 A;  2KRF A;  2XAJ A;  2XF6 A;  2KHM A;  5TIS C;  4A0Y A;  3CUQ A;  2FX0 A;  2E2J J;  1RZ4 A;  1IN4 A;  2DTR A;  2JTV A;  3TDU C;  1FYL A;  2V4J C;  2EFO A;  1HOM A;  1TW2 A;  2A6E F;  4IO9 F;  4CUG A;  2HTS A;  2IAI A;  1KU3 A;  2FA5 A;  2PG4 A;  4UB8 C;  5EEH A;  2NS8 A;  3CF5 F;  4AC0 A;  3RPU A;  1HA8 A;  4NUB A;  3GEZ A;  4I0A A;  1REP C;  1J7K A;  1FWZ A;  1XG1 A;  1D1B A;  2RC4 A;  3S93 A;  1MKM A;  2ZKZ A;  5JHF A;  2IXS A;  2XB0 X;  1MW7 A;  1YE9 A;  1YG2 A;  3M8J A;  2ZO4 A;  1FOK A;  3I54 A;  5DUK A;  2KZG A;  2ACJ A;  3SJM A;  3H3V K;  3CCJ I;  1LFB A;  4AU7 A;  2L7F P;  1TNS A;  4R1H A;  4ZYD A;  4OIQ F;  1IUF A;  2L01 A;  5AIQ A;  5L3F A;  2QEX I;  2ZJP F;  2JN6 A;  4GDF A;  3IP4 B;  3ERM A;  1U9N A;  1OCO H;  4HLY A;  3K0L A;  4UB6 C;  1YFH A;  1RET A;  4NHJ A;  3U9G A;  1G8X A;  1FOX A;  2L02 A;  2RQP A;  2ID3 A;  3PNT A;  4RM2 A;  2L0K A;  4HST A;  3SEZ A;  1YJW I;  5EZG A;  4HOB A;  3ZMS A;  5F27 A;  3HC7 A;  2OF7 A;  4W97 A;  1R6R A;  3QWL A;  2A05 A;  1VQL I;  1SAX A;  1VZ0 A;  5FRO A;  2LKX A;  2UXX A;  1PVE A;  4HRI A;  2E7W A;  2FNA A;  3CME I;  2XAG A;  3R0J A;  3V7R A;  5EZH A;  1WJD A;  3MFK A;  4NDL A;  3JAM K;  1PUF A;  1FOY A;  4MGR A;  5J1R A;  2R5Z B;  4P1W A;  2JMW A;  2H27 A;  5C4J J;  5IT9 Z;  2EJR A;  1MND A;  3KPH A;  3SYT A;  2NVY J;  4M6Y A;  3I0T A;  2QQ8 A;  2Q2E B;  2ZB9 A;  3ONQ A;  3OYB A;  4H0E A;  1IZ1 A;  3S3N A;  1J0R A;  1HST A;  2F4M B;  3RCO A;  2MA3 A;  3DCF A;  1Y0N A;  1YOV B;  2TCT A;  2A6H F;  2NVT J;  1U78 A;  2VPR A;  1E3O C;  3DQV C;  3L2W A;  5KAI C;  5H20 A;  1BIA A;  2FNP A;  1VQK I;  1EA3 A;  1VQ6 I;  4CH7 A;  2O8X A;  3I56 I;  1OYW A;  2QGU A;  3UNG C;  2DW4 A;  2K7L A;  2H09 A;  5HOD A;  3GTP J;  5F6F A;  1PP7 U;  4N4O B;  2JRM A;  2QVO A;  1IV8 A;  3E6D A;  3MCZ A;  3RTR A;  2NYX A;  3GO5 A;  3HUG B;  4I98 B;  2Q0O A;  3S15 J;  2PMZ N;  3CJQ B;  3PQJ A;  5K7F A;  2BV6 A;  3K7A J;  3S2D J;  1Z77 A;  1RUN A;  2QLZ A;  1O7F A;  2I5U A;  3PJR A;  3A01 A;  4PFO A;  2H94 A;  3COA C;  4XLA A;  1WI9 A;  2VE8 A;  1AKH B;  2FOW A;  2DFF A;  4R8H A;  5F0H A;  2ZCW A;  3LSJ A;  1Z7U A;  5E20 A;  4AD9 A;  1EJ9 A;  4XRF A;  5IYC J;  1QA6 A;  3KP6 A;  1MZB A;  2IP2 A;  1SD4 A;  4JQF A;  4Q5S F;  2RAE A;  2Z5U A;  1NHA A;  3OS2 A;  4IX7 A;  5LGT A;  3E6M A;  1YW8 A;  2QQB A;  1XS9 A;  2DT7 B;  4BAC A;  2HDW A;  4PUS A;  1P4X A;  2WB1 N;  1S7E A;  1FTT A;  4AYB N;  4FT8 A;  1DQU A;  3RKY A;  1HKS A;  1NK2 P;  4KFC A;  3GTG J;  4BAY A;  4HLX A;  1TWF J;  2BGC A;  4RLQ A;  3B73 A;  3DEE A;  5DUI A;  3KZY A;  3Q5F A;  2F48 A;  1Z1D A;  2M87 A;  2MW8 A;  2DCE A;  4I2O A;  2XRO A;  1WPK A;  2ZME C;  4OIP F;  2WBM A;  1VTN C;  1X3W B;  3VSL A;  2DQR A;  1TC3 C;  3E5U A;  2IJL A;  3I59 A;  1B8I A;  2WAQ N;  3SXY A;  5GPC A;  3OYD A;  1SMY F;  1B9M A;  5FD5 A;  2JZY A;  3IHU A;  3CC4 I;  1KYW A;  3DKX A;  4XSX F;  2K4J A;  2ISZ A;  1ZN2 A;  3RPQ A;  2DDA A;  2CRG A;  2CJJ A;  4DOZ A;  3BJ6 A;  3JRD A;  2CS3 A;  3BC8 A;  5B1A H;  3C2B A;  2OZ6 A;  1YX3 A;  2IA2 A;  4KN7 X;  1S7O A;  3CDH A;  4KMF A;  3FHZ A;  1WJB A;  3FXO A;  2ZJQ F;  5D5U B;  1TWC J;  1QPI A;  4BY7 J;  4I09 A;  3GXO A;  2KT0 A;  3Q0V A;  2LY9 A;  3PSF A;  5AIP A;  3RQI A;  4L9V A;  2QF7 A;  3H9Q A;  3LFK A;  3LSM A;  2X85 A;  5HOO A;  2JA6 J;  5E1X A;  5LHI A;  3HL2 A;  3KCC A;  1EV7 A;  4GYI A;  3QAH A;  4L5I A;  3OYC A;  2DN0 A;  3VYU B;  2RDP A;  2XB5 A;  4RA2 A;  2BW3 A;  2JRT A;  2CUE A;  4D7N A;  3OYH A;  2A61 A;  5DEQ A;  4ABZ A;  2PMZ A;  5JVG F;  1O3S A;  1QQI A;  2WAD A;  1P4A A;  1BR2 A;  1WQ2 A;  2V1X A;  3IWZ A;  3OV8 A;  3BG5 A;  3ZOB A;  2PJR A;  1VQ9 I;  4U0W A;  4MEX F;  2CSO A;  4MFE A;  3ZQ7 A;  4A69 C;  3FXK A;  1YS7 A;  1H9G A;  3N4M A;  3NEU A;  2B0L A;  4OIO F;  3ZMT A;  4M3F A;  5ICE A;  3QPS A;  3MKZ A;  1B72 B;  2JQ7 A;  3KFW X;  1BC7 C;  2AQF A;  2YR2 A;  3FWE A;  4IVN A;  3ZN1 A;  3MD2 A;  4CHU A;  3S2H J;  3CDI A;  3J81 K;  5FKO A;  2R7F A;  3TO7 A;  2JUC A;  4HYE A;  4DGW B;  2P7V B;  1KZH A;  2WTE A;  1N75 A;  1RUO A;  2CQN A;  3REO A;  1MIJ A;  4HNT A;  4IOA F;  4XKC A;  1GXQ A;  2L4A A;  1JKQ C;  4FTH A;  3BQZ A;  3EUH A;  3LSR A;  2CUZ A;  4OU0 A;  1QBJ A;  3ZPL A;  1ITY A;  5LD2 C;  3JAM Z;  2ELH A;  3O6B B;  5A2Q K;  4A3C J;  4G6T B;  2F4O B;  1YW7 A;  2OV7 A;  1JTX A;  3JTH A;  2OBP A;  2WAQ A;  4FX0 A;  3OSG A;  4IQ4 A;  4P55 A;  4W1U A;  4E7K A;  4IZZ A;  5IP7 J;  3KP3 A;  5F0F A;  4FHT A;  3BQY A;  2EV0 A;  2XF5 A;  1NTC A;  2DFI A;  2R7Z J;  2PX9 A;  2YUS A;  3HRT A;  2M4G A;  2DMU A;  2FXA A;  4IRI A;  1XGN A;  2OTL I;  2AO9 A;  2R5Y A;  2DK5 A;  4II2 A;  2ELK A;  4OOI A;  4ZZD A;  2W48 A;  2WAF A;  3R6S A;  2KIS A;  4C2U A;  2UXN A;  3GVA A;  3HKZ N;  2O9L A;  1Y1V J;  3WTZ A;  5E3N A;  1ZRD A;  2F2E A;  3MKY B;  4Y33 A;  1VF9 A;  3OR2 C;  3BG6 A;  1TP4 A;  5HDG A;  4BQA A;  2XRL A;  1Z6T A;  2L7K A;  4YFX F;  2R0Q C;  5LRS A;  3KX2 A;  2IBD A;  3TP3 A;  1LKX A;  2PN6 A;  3SZG A;  4PJN A;  2VJI A;  2IA0 A;  3J7Y J;  2KL4 A;  3DWL E;  1FC3 A;  2K3F A;  1IN7 A;  1ZTR A;  2XPW A;  3CMM A;  3L2Q A;  2OTJ I;  1WJ5 A;  4L5J A;  2KQR A;  3U2R A;  2KRC A;  2MH9 A;  3JW4 A;  3KIO A;  5E18 F;  5EGO B;  1B4A A;  2LNB A;  4G9Y A;  5FJ8 J;  2OJE D;  2E2I J;  1TQP A;  4GXO A;  4E7Z A;  4GFB A;  2H1L A;  3RI4 A;  3HOZ J;  3L1P A;  4B3A A;  2EIL H;  1QVT A;  2ZSI B;  2EIJ H;  4ENM A;  2K02 A;  4C3J J;  1DUX C;  3OOP A;  4LIU A;  1WCM J;  2DLL A;  3DLA A;  2P6T A;  2E1M B;  1VQ7 I;  4E7L A;  4NC8 A;  1TZL A;  5CJ9 A;  3MKL A;  1Y8Q B;  2EFQ A;  2VUM J;  2X0L A;  2VOD A;  3O2P E;  3MZH A;  3IH2 A;  1EKE A;  5ICG A;  3CF2 A;  1YRN B;  5J3L A;  4EEF G;  1OKR A;  2BOL A;  4PJJ A;  4BYY A;  1YTY A;  1GVJ A;  4EQQ A;  2R7R A;  4HZF A;  2W85 A;  4C2M J;  1P4W A;  2X6X A;  3CC2 I;  3J7Z I;  3EUH C;  2RN7 A;  4UVB A;  2VJ5 A;  1E3P A;  2KIF A;  4GCV A;  4IHT A;  3WE3 A;  3VPR A;  4CGZ A;  3OYA A;  1M1E B;  3OYI A;  5DCF A;  3D5L A;  1WKM A;  1LEB A;  1IXC A;  3JRH A;  1IXS B;  2BVM A;  4BE0 A;  4HX8 A;  1Z67 A;  4BHP A;  3MEX A;  3RYP A;  2VOP A;  2IGO A;  1BA5 A;  2BZT A;  1SD7 A;  4OMZ A;  2ZBK A;  5E8G A;  1HW5 A;  3JCU C;  1F43 A;  5HLT A;  4LB6 B;  4IOC F;  2IS1 A;  3K4K A;  3S3O A;  2UV1 A;  1SVM A;  2XAU A;  3CLQ A;  3JRA A;  1K6O A;  1ODD A;  1STZ A;  4QSH A;  4IKF A;  2FML A;  3DTI A;  1VQP I;  3AFH A;  1MBF A;  2DXI A;  4HV6 A;  3K9T A;  2WY8 Q;  1FMV A;  3LAP A;  4WF2 A;  2GM4 A;  3CZ6 A;  1KQ0 A;  2M0M A;  4HSR A;  2P7C B;  3KEY A;  2KIQ A;  2FF4 A;  2OCC H;  3KP5 A;  4C30 A;  3WTU C;  1R00 A;  4CCJ A;  4ZTF A;  3N05 A;  3EUK L;  1R1U A;  2IS4 A;  2Z16 A;  3FMQ A;  1XGM A;  1JUS A;  2DA2 A;  2DTZ A;  2YX7 A;  4UUT A;  4J00 A;  2DDB A;  3BTI A;  2H8R A;  2GOM A;  2F5C A;  3HSF A;  2CV1 A;  1XB4 A;  2HWV A;  3GTK J;  1FNN A;  3VFZ A;  3W6V A;  1HC8 A;  1R9T J;  2TRT A;  1Q1V A;  1MJA A;  1XX5 A;  4EJT A;  1ZGA A;  1XCV A;  2RNG A;  4PSW A;  1XSD A;  2OAZ A;  2CW0 F;  2EV6 A;  3LSI A;  5HLH A;  2E35 A;  1Z0X A;  3F21 A;  2HOS A;  2XAH A;  3HDD A;  2Z1D A;  3E6B A;  2CFO A;  2CQQ A;  3F9K A;  3OYE A;  1RC9 A;  3HB9 A;  3OIO A;  5LFA A;  4OIR F;  4ZH4 F;  3S1N J;  1LFU P;  3U1K A;  4MIM A;  1BM9 A;  3LSH A;  2XUB A;  2CV0 A;  2FSW A;  4XK4 A;  2ZFW A;  2HVQ A;  2R5Z A;  3I9V 2;  1O57 A;  3Q9S A;  1KGS A;  1ZGJ A;  2CH0 A;  3IL2 A;  3H0G J;  2K3P A;  4A3E J;  3PO3 J;  2WV1 A;  2P5L C;  2CV2 A;  1UEL B;  4X0G A;  3OY9 A;  5BOX A;  2VT3 A;  3MVP A;  1GVD A;  2OUM A;  4I99 C;  1JXS A;  4HX4 A;  1H0M A;  1W5T A;  2V9P A;  4FE7 A;  3CO6 C;  3FXR A;  2WY7 Q;  3ABU A;  1OJL A;  3RZO J;  4M3D A;  1G3T A;  3BCA A;  4RB0 A;  2R7S A;  5L3D A;  1J9I A;  1BOB A;  3L2R A;  4NNJ A;  1FIP A;  2XGX A;  2GXB A;  3CCE I;  1ZEL A;  3BPX A;  5IT9 K;  2XC7 A;  4BXX J;  2A3S A;  3TL4 X;  4G12 A;  3H36 A;  3PFI A;  3GLX A;  4KN4 X;  1ZLK A;  2XSJ C;  5FFX A;  1X1P A;  2XVC A;  2VPL A;  2OPT A;  4G94 A;  1MMS A;  3HSE A;  1VQ5 I;  4PGH A;  2KLO A;  1ERD A;  4IHS A;  3ZP5 A;  4X1E A;  1I6H J;  2W1O A;  2Y9Y A;  2ZNZ A;  1BC8 C;  2M7A A;  3IH3 A;  3M1E A;  4M71 A;  3PNV A;  3CD6 I;  1A36 A;  3WHB A;  1UHM A;  2QKM B;  3J7A Y;  1L0O C;  2ZSH B;  2OZU A;  1VQN I;  1R7J A;  3ZQL A;  1E2X A;  3V8L A;  2Z3Y A;  3PSI A;  5J40 A;  4YEJ A;  2XGE A;  2X9D A;  3CDL A;  2IT0 A;  1Z7L A;  2VON A;  2VKE A;  3Q9V A;  1OYY A;  4S05 A;  2CYY A;  4QLC U;  1Z21 A;  4FCY A;  1FTZ A;  2M2E A;  3I3L A;  3J80 Z;  4CIC A;  3KET A;  3MN2 A;  2K9S A;  1X2M A;  1LQ1 A;  5EG0 B;  2H6B A;  4HNU A;  1YIO A;  4I7H A;  1R58 A;  3BR2 A;  2UZK A;  2M30 A;  2PJP A;  5EF6 A;  5GAE J;  3BTL A;  4UY8 I;  5DYM A;  2DOA A;  1FSH A;  2NS7 A;  5HS8 A;  3JRB A;  4ZTJ A;  3GYH X;  4BQQ A;  2QYO A;  4LG0 B;  4BGD A;  4BE1 A;  2VN2 A;  3P9K A;  1D5Y A;  2LYC A;  4PSX A;  3S14 J;  2M5W A;  4YFK F;  3GLL A;  5E3O A;  3C2H A;  2JSC A;  2HNH A;  3Q0W A;  2AQE A;  5IPA A;  1VQ8 I;  2D1V A;  2O7O A;  3ULQ B;  2K5C A;  2Z99 A;  4DNC A;  1K6Y A;  2FBK A;  2R7Q A;  1LB2 A;  4O3M A;  4MTE A;  4IF4 A;  1IV6 A;  3HOU J;  3ZMZ A;  2HU9 A;  1V4R A;  3C1D A;  3PIO F;  3QOD A;  2CQ7 A;  4YEL A;  5EEA A;  1UST A;  3GFL A;  5GTH C;  4U0Y A;  2BHZ A;  2LSO A;  3C2G A;  4C3H J;  4UV9 A;  3V4G A;  3FF5 A;  3I4P A;  4KA4 A;  3KYD B;  2ZC2 A;  4XR6 A;  1T6S A;  2EA4 A;  3C7J A;  3CJT B;  4GO1 A;  4XBF A;  4BU2 A;  4WXD A;  5FD6 A;  4AID A;  1JKP C;  2A68 F;  2FRH A;  5CLS A;  1XMA A;  2DPD A;  2VI6 A;  4I01 A;  3F22 A;  1DGW Y;  2Y69 H;  1DP7 P;  2EZH A;  3P7N A;  2RVC A;  2E1C A;  1D8K A;  3DKW A;  4B3X A;  2H1K A;  1OFC X;  4C2T A;  4M74 A;  2EIN H;  1IG7 A;  2WV0 A;  5LEJ A;  3PNY A;  4CCN A;  1ZHF A;  2VLA A;  2JA2 A;  1V5E A;  5LEK A;  2B9S A;  3QOE A;  2YSR A;  3ZQF A;  5HS7 A;  3QP5 A;  3VYR B;  2DT6 A;  4KNY A;  1XN7 A;  9ANT A;  4DZJ A;  1I39 A;  3R4K A;  4GRI A;  3LST A;  2GAU A;  1H89 C;  3G73 A;  4CCO A;  3DTK A;  4KIG A;  2R7U A;  1OPC A;  4V19 K;  3BP8 A;  2VXZ A;  4I76 A;  4XKV A;  1JI8 A;  4F55 A;  4M6X A;  4BNC A;  3RIR A;  3OOU A;  3S1R J;  4XKB A;  4ZYE A;  1ZGW A;  1RR8 C;  1N78 A;  1R4N B;  1A04 A;  2DQL A;  2W84 A;  3QYE A;  4ESF A;  3LA7 A;  3QPT A;  3BPV A;  3WGG A;  2L9R A;  2RNJ A;  3SEQ A;  3NWS A;  3GFM A;  5CVR A;  1IXR C;  2HOE A;  5CKT A;  1R1T A;  3FXU A;  4O6J A;  1OCT C;  2LC2 A;  3D0S A;  1EF4 A;  2X6O A;  2ZME A;  3AG2 H;  3GTJ J;  3HJE A;  3WG7 H;  1X19 A;  4EJW A;  2RV8 A;  3G3Z A;  2STW A;  1NG7 A;  1WWX A;  4A6E A;  4YFN F;  1XDU A;  1ZRC A;  4BEH A;  4KIS A;  3RKQ A;  3R61 A;  1S7A A;  2ID6 A;  4HF0 A;  3B6C A;  1WH7 A;  3GUD A;  4IQJ A;  2VKD A;  2XGD A;  4GYG A;  1O3T A;  2V6E A;  4EGZ A;  1FY7 A;  4L9N A;  4Y4R A;  4ANJ A;  3M8F A;  1RES A;  2XHK A;  2VIX A;  3AKZ A;  1JHF A;  4BE2 A;  2D45 A;  2OA4 A;  3CLO A;  2HI3 A;  1S3J A;  2BXZ A;  2XPV A;  2IS6 A;  3K70 D;  4BXU A;  2V1U A;  4A3K J;  4NQW B;  2YS9 A;  3WOD F;  1F4K A;  3CMA I;  2CQX A;  3HIF A;  3HOV J;  5KAF C;  3BCB A;  3DU6 A;  4BJ6 C;  3KLO A;  3CCU I;  3R0A A;  3IH4 A;  2PLY A;  1W36 D;  4HW0 A;  3HG9 A;  4XSZ F;  3WE2 A;  2RQQ A;  3BJA A;  2K4B A;  2VBW A;  1N77 A;  1FZP B;  2KP6 A;  1CF7 B;  5FLM J;  1K4S A;  4CYC A;  3VYT B;  1YRN A;  1V5F A;  2VB6 A;  4MQV A;  1MD0 A;  5IT3 A;  2I10 A;  2L9V A;  2RRE A;  2A07 F;  3W2A A;  3I55 I;  2QWW A;  4LLG F;  3TQN A;  5GAH J;  4XRM A;  5EJC A;  2P5V A;  2QCO A;  5GAD J;  4XRS G;  4B09 A;  3QP6 A;  1IUY A;  1QZY A;  2V9K A;  1XD7 A;  1PP8 F;  2EFW A;  5TJJ A;  1A31 A;  1SVL A;  4PZJ A;  4N9I A;  3PIP F;  2JT1 A;  2O6G E;  3I4N J;  4DYQ A;  1JKR C;  4ENN A;  4HQE A;  1UHW A;  2BY1 A;  5F04 A;  5JR3 A;  4XON A;  2VC1 A;  4XN3 A;  2FE3 A;  1WVR A;  1P7J A;  1BR4 A;  3WG9 A;  3BTC A;  1VND A;  5DM6 F;  1B1B A;  1RIO H;  1VQ4 I;  1GDT A;  2VJ4 A;  3GFJ A;  5F08 A;  5BPD A;  2ZFU A;  3AAF A;  1K78 A;  1FBU A;  3OYK A;  2A5Y B;  1Z3Y A;  3TGN A;  3LA2 A;  4QIW N;  5B66 C;  4F3Q A;  3BDD A;  2MG4 A;  2V9V A;  3ZQG A;  4A5M A;  2FBI A;  4HF1 A;  4E6K G;  1UHS A;  5ICF A;  4XOP A;  2BEO A;  5J6X A;  3HOW J;  1HDP A;  2PQ8 A;  2L3D A;  2X1C A;  2QBY B;  4U0V A;  3ZXS A;  2HOA A;  5JI6 A;  1X1C A;  2L7Z A;  3BLY A;  5EEG A;  3DFG A;  4L5E A;  2L4M A;  5LGN A;  3OYL A;  3F8C A;  3P9C A;  4M6V A;  1LVK A;  3JSO A;  5CYV A;  1HQC A;  2DJN A;  2E34 A;  4OMY A;  1RNL A;  4KIB A;  3IV5 A; 
#chains in the Genus database with same CATH homology
 2CWE A;  2KJC A;  4LLL A;  1P6R A;  4KT5 C;  3I5U A;  4WXC A;  1IN5 A;  4RB2 C;  1R5H A;  1D3Y A;  3F6V A;  2M45 A;  1J75 A;  4M9S A;  1U2W A;  2O61 A;  1R22 A;  3BY6 A;  1SFX A;  3BWG A;  1FP1 D;  2GWR A;  3C18 A;  3EYY A;  5D5X B;  1MDM A;  3TKY A;  2QQA A;  3ML6 A;  3QU6 A;  3DPT A;  4EJU A;  3W6J B;  5ICC A;  4HDV A;  4U7B A;  3SZP A;  4D0P A;  4ZYH A;  2XRN A;  1I27 A;  2HQN A;  2NRA C;  3CUQ B;  1LDJ A;  4AIK A;  4EMS A;  2M1B A;  1TLH B;  3I71 A;  5CVJ A;  3VOE A;  2G7H A;  1UFM A;  1I6X A;  4AIJ A;  2XKP A;  2DAO A;  5ED4 A;  2DT5 A;  1F9N A;  3ABT A;  3K1P A;  4LLN A;  3RKX A;  3FX3 A;  5L3E A;  1ZRE A;  1Z05 A;  4Y13 A;  1KU2 A;  4RAZ A;  2EB7 A;  1ZAO A;  2P6S A;  1FSE A;  3ZMD A;  3B02 A;  4HX7 A;  1IRF A;  1R36 A;  2DPU A;  2FEZ A;  3ZMV A;  3WU0 A;  3V8J A;  1K7A A;  2ADU A;  1BI3 A;  3VOD A;  4OIN F;  3IC7 A;  4KUM A;  2C6Y A;  4CO8 A;  4Y17 A;  5F64 A;  3T8T A;  4P5O A;  4YII A;  3WGI A;  2GXG A;  1U5T B;  3WTT C;  3FMR A;  3J80 K;  1IN8 A;  3KEQ A;  4M9Z A;  2QZ8 A;  4KMU X;  2HS5 A;  5D8L B;  3HRM A;  3RKW A;  4CXF A;  4AWX B;  1B6A A;  4A0X A;  5KK1 A;  5ILS A;  5DCM B;  2NNY A;  1SFE A;  5E8I A;  4Y15 A;  2Y75 A;  4WX9 A;  3CUO A;  1BOA A;  4IXA A;  2O03 A;  1OYI A;  2ETH A;  3ZN0 A;  1U6G A;  3LQQ A;  2DBB A;  4JBA A;  3KE2 A;  3ECO A;  3V7S A;  2CQK A;  1MJ9 A;  3H3U A;  2P8T A;  2F5D A;  2D2W A;  3IRR A;  1MJB A;  4RS8 A;  3T8R A;  3ERE D;  2H6C A;  4RGX A;  5FLX Z;  4KDP A;  5JFR A;  3MZY A;  2OD5 A;  5H6Q A;  4U88 A;  1ON1 A;  4XLP F;  4Q47 A;  3KLN A;  5JHU A;  1FLI A;  3GX4 X;  3ZMU A;  2XKO A;  5AON A;  1E17 A;  2VOO A;  1T39 A;  1F4K A;  3HOT A;  2HZT A;  5BPI A;  2BBY A;  4MHG A;  4L0Z B;  3TO6 A;  1UB9 A;  1USS A;  1XDS A;  1FBS A;  5J8C A;  3FM5 A;  2W57 A;  2QM3 A;  1ZG5 A;  1GXP A;  4EM0 B;  3E3V A;  1QNT A;  3GZ5 A;  1KQ9 A;  4LFU A;  2XV4 S;  3SQN A;  4LGW A;  4M72 A;  1F1Z A;  1EH7 A;  4RB1 A;  1LJ9 A;  5HS9 A;  5TRD A;  2Q2E A;  2R3S A;  4LJZ F;  1BN5 A;  1IRG A;  1U3E M;  2FMY A;  4P96 A;  3L2C A;  3F72 A;  3DP7 A;  1H9T A;  1FP2 A;  2NAZ A;  3M7G A;  1B59 A;  3DEU A;  3F8F A;  3CO7 C;  1K79 A;  3HUG A;  4QWQ A;  2XAS A;  2IRF G;  1S6L A;  1G4D A;  1SFU A;  4G8X A;  1XGO A;  4I02 A;  6PAX A;  4WXH A;  3HSR A;  1ZG1 A;  1C0W A;  3L7W A;  4MTD A;  3ISP A;  3SZT A;  1HW1 A;  4IRH A;  3I64 A;  3MAJ A;  4I0B A;  1R1V A;  2BE5 F;  3H3Z A;  3JTG A;  1O3Q A;  2DK8 A;  3H92 A;  3BJO A;  2L54 A;  4UUV A;  2MBF A;  4XLN F;  5FFZ A;  2X4H A;  1AOY A;  1XSV A;  2XIG A;  2LF8 A;  1ZRF A;  2K86 A;  2AXL A;  2Z33 A;  5D5W B;  3E6C C;  1JHH A;  3U1D A;  1ZYR F;  2F5F A;  4G6D A;  5K5R A;  1HSJ A;  2KIU A;  1WRJ A;  5K5Q A;  3QU3 A;  4Q4Z F;  5HDK A;  3K1M A;  2HYG D;  3WTW C;  2OU2 A;  3GF2 A;  4HBL A;  3K2Z A;  3GZ6 A;  2MC3 A;  2EV5 A;  2V6C A;  2PBI A;  3CTA A;  1G3W A;  4EJV A;  2STT A;  5J8F A;  3BZ6 A;  1J5Y A;  3GWZ A;  2EFP A;  1KU9 A;  1GHC A;  3EDP A;  1BI0 A;  2O0Y A;  2YPR A;  1YW9 A;  3E5Q A;  4ENK A;  3FM3 A;  5LGU A;  3V7C A;  4F7Z A;  2UWM A;  2E7X A;  4GGG A;  1T0F A;  4YG2 F;  3HRS A;  1ON2 A;  1R23 A;  2K27 A;  4RGU A;  1SD5 A;  2HKX A;  5LHG A;  1YYV A;  5BQT A;  3V8K A;  1IF1 A;  3CJN A;  3TOB A;  1QGP A;  5E1W A;  5ILU A;  2HEO A;  5D8K B;  3KP7 A;  2NS0 A;  3TDZ C;  2EWN A;  3HTS B;  2XAQ A;  4ON0 A;  1EH6 A;  4ZYG A;  4S04 A;  5CVV A;  4MQ9 F;  3VB2 A;  1FYM A;  4CYD A;  1TQM A;  2VBZ A;  2YX4 A;  3KEO A;  4LMY A;  1G3Y A;  2VBX A;  1TW3 A;  5HLG A;  1YLF A;  4ESB A;  1XSX A;  1OMI A;  4UVC A;  4BHC A;  1T98 A;  2VE9 A;  5FB2 A;  1JGS A;  4A5N A;  2G7U A;  1S8N A;  2ZNY A;  2ZXJ A;  1FX7 A;  3PQK A;  1I1G A;  2HKO A;  2J5O A;  3F8N A;  3F8B A;  2CGP A;  1ULY A;  4JK1 X;  2Y48 A;  4PCQ A;  2Y0M A;  1LVA A;  3FZV A;  4EM2 A;  1W7P B;  4Q48 A;  1U5T A;  2NNN A;  3L09 A;  3L00 A;  1J59 A;  2GZW A;  2FU4 A;  4N0B A;  4UV8 A;  4A2U A;  2HTJ A;  4YIF A;  5ILV A;  4L18 B;  2QQ9 A;  2FQ3 A;  2KKO A;  4KIF A;  5DCM A;  3JSP A;  5BMZ A;  1AWC A;  2COM A;  3CUQ C;  1PUE E;  2LKP A;  2WWY A;  1W7P D;  1BIB A;  3IKV A;  2OQG A;  3P9I A;  3EQL F;  2F5E A;  1W4M A;  5D4R A;  3NQO A;  3F23 A;  4LB5 A;  5D6E A;  3HHG A;  2MH2 A;  3HTU A;  5L3C A;  2V1D A;  3MQ0 A;  1EH8 A;  5LBQ A;  5HLI A;  2GA1 A;  3C3W A;  4AVP A;  2GA2 A;  1IN6 A;  2FOK A;  2MLK A;  4IRG A;  1ZLJ A;  2ESH A;  4HA8 A;  1BI1 A;  2BYV E;  5D5V B;  4FX4 A;  4G7Z F;  3TO9 A;  2XAF A;  4HV5 A;  3L9F A;  4Z2Y A;  2ZJ2 A;  4E70 A;  4P9U A;  5FLX K;  1U8R A;  2A69 F;  4TV7 A;  3FMS A;  4U7D A;  1V3F A;  2CO5 A;  1U5T C;  3MWM A;  4UHT A;  4B8X A;  5K1Y A;  2ISY A;  3K69 A;  1UCR A;  1Z91 A;  3IWF A;  3WGH A;  4A6D A;  1DDN A;  3DF8 A;  2HGC A;  1O7L A;  1TQI A;  1FPQ A;  4NB5 A;  4G7H F;  5LRR A;  3I58 A;  2PFB A;  3WTX C;  2LDU A;  1TTY A;  1YS6 A;  4M73 A;  3IKT A;  5DD4 A;  2MLG A;  2GQQ A;  1OR7 A;  2KJB A;  3T5X A;  3DV8 A;  3LA3 A;  1HW2 A;  4O5V A;  3QPH A;  2Z9O A;  2FBH A;  2IW5 A;  3LQR A;  4EV0 A;  3O3K A;  2DU9 A;  4EJO A;  1DPU A;  1IW7 F;  4A0Z A;  2R7D A;  3RDI A;  3DXJ F;  3WTS C;  2JPB A;  1G6N A;  2EA2 A;  4RGS A;  1BBY A;  1KQ8 A;  1HKQ A;  3VEP A;  2G9W A;  1B9N A;  1F5T A;  1L3L A;  4M9X A;  3HOS A;  1I1S A;  3F8M A;  5JVT A;  3QOP A;  1FT9 A;  1W5S A;  2KIM A;  5FGM A;  1HXD A;  2ZME B;  1LDD A;  3T0Y A;  5E17 F;  4LG0 A;  1LEA A;  1YQA A;  3KP4 A;  5E1Z B;  1T2K A;  4HF2 A;  4EVI A;  1SD6 A;  3S2W A;  4CDG A;  1Q1H A;  1ZH5 A;  3ROU A;  3T1B A;  1KU7 A;  2M8E A;  1KA8 A;  2P5K A;  2O3F A;  3HRU A;  4PDK A;  4WWC A;  1XGS A;  3BRO A;  3WU1 B;  1I5Z A;  1RI7 A;  4A12 A;  1BJA A;  2OQR A;  3NRV A;  4LD5 A;  3E5X A;  1YO5 C;  4L0Y B;  5CVI A;  4ASN A;  5FO5 A;  2HR3 A;  1LNW A;  4L9T A;  3SFZ A;  2PEX A;  1PDN C;  2P4W A;  4DQ2 A;  2PI0 A;  2TDX A;  2IVM A;  2CFX A;  5DDG A;  4N9H A;  3I53 A;  4IJA A;  3J7A O;  4RB3 C;  2VC0 A;  5DD8 A;  1Z9C A;  4BHB A;  3M8E A;  4EGY A;  3GW2 A;  2IPQ X;  4UVA A;  5BS6 A;  1K78 B;  3GFI A;  2AS5 F;  3K1N A;  1XMK A;  1ZG3 A;  4G7O F;  3I59 B;  5LHH A;  3LWF A;  4WK8 F;  1QZZ A;  5L3B A;  4RAY A;  1JE8 A;  2HYF A;  4EM1 A;  5HVQ C;  3BOQ A;  1J2X A;  2DO7 A;  3ECH A;  3R60 A;  3SHF A;  4R79 A;  4KYW A;  2W25 A;  1DPR A;  4K2E A;  2YU3 A;  3DPL C;  1LDK B;  1IAW A;  3F6O A;  2QEN A;  3W6K B;  2LF7 A;  2J5P A;  1CGP A;  2EFN A;  3RYR A;  3IRQ A;  1W7P A;  4LK1 F;  1QPM A;  4NQW A;  3J81 Z;  1MDM B;  1T38 A;  3QRF F;  2DI3 A;  3HYI A;  5DV5 A;  2RGV A;  4UNO A;  2IA1 A;  1XCB A;  3WTV C;  2HQR A;  1CF7 A;  2VT2 A;  1HBX G;  5A2Q Z;  5D6F A;  1D5V A;  3RJP A;  4BH9 A;  2MD5 A;  2PMH A;  3M9A A;  4ETS A;  5LLQ A;  2D1H A;  2JPC A;  3FXQ A;  4ZZL A;  4PGG A;  3EYI A;  3ELK A;  2ESN A;  5F1R A;  3TOA A;  3E97 A;  4WCG A;  2CG4 A;  2RKH A;  1MGT A;  4HAM A;  2GIV A;  2HDC A;  5H6R A;  1X3U A;  2EK5 A;  4ENJ A;  1FBQ A;  3F3X A;  4ESJ A;  2Q8K A;  5ERI A;  4P9F A;  3HHH A;  2WC2 A;  5KVR A;  1ONV A;  2W24 A;  4CZZ A;  4RGR A;  1BI2 A;  4MNU A;  3KZZ A;  1R5G A;  1SMT A;  2QBY A;  3EET A;  1P92 A;  3WTY C;  4KIC A;  1TBX A;  2VBY A;  1KYZ A;  4LK0 F;  5K5O A;  4HQM A;  1WSU A;  4HDU A;  4UXN A;  5CVU A;  2E1N A;  1TNT A;  1QO0 D;  1D8J A;  4L9J A;  3LAJ A;  1S29 A;  1P2F A;  1Z6R A;  2HFH A;  2PMU A;  2QUF A;  1ZAR A;  5HDN A;  1Y0U A;  4IPA A;  4MEY F;  1FYK A;  4G6Q A;  5D4S A;  3N97 A;  4AIH A;  1O3R A;  1G3S A;  1HKT A;  5L3G A;  2V79 A;  3KP2 A;  2KRF A;  2XAJ A;  4A0Y A;  3CUQ A;  1RZ4 A;  1IN4 A;  2DTR A;  2JTV A;  3TDU C;  1FYL A;  2EFO A;  1TW2 A;  2A6E F;  2HTS A;  1KU3 A;  2FA5 A;  2PG4 A;  5EEH A;  3RPU A;  3GEZ A;  4I0A A;  1REP C;  1J7K A;  1FWZ A;  2RC4 A;  1MKM A;  2ZKZ A;  1YG2 A;  1FOK A;  2ZO4 A;  3I54 A;  5DUK A;  2ACJ A;  1TNS A;  4R1H A;  4ZYD A;  4OIQ F;  2L01 A;  5AIQ A;  5L3F A;  4HLY A;  3K0L A;  1YFH A;  4NHJ A;  3U9G A;  2L02 A;  2RQP A;  3ZMS A;  4HOB A;  1SAX A;  2UXX A;  2E7W A;  2FNA A;  2XAG A;  3R0J A;  3V7R A;  3MFK A;  3JAM K;  4MGR A;  2H27 A;  5IT9 Z;  2EJR A;  4M6Y A;  3I0T A;  4H0E A;  1IZ1 A;  1J0R A;  1HST A;  2MA3 A;  2A6H F;  1U78 A;  3DQV C;  5H20 A;  1BIA A;  2FNP A;  2O8X A;  1OYW A;  2DW4 A;  2K7L A;  2H09 A;  5F6F A;  1PP7 U;  2QVO A;  3MCZ A;  3RTR A;  3E6D A;  2NYX A;  3GO5 A;  4I98 B;  2Q0O A;  3PQJ A;  2BV6 A;  1RUN A;  2QLZ A;  1O7F A;  3COA C;  2H94 A;  1WI9 A;  2VE8 A;  4R8H A;  2ZCW A;  1Z7U A;  5E20 A;  4AD9 A;  4XRF A;  3KP6 A;  1MZB A;  2IP2 A;  1SD4 A;  4JQF A;  4Q5S F;  2Z5U A;  1NHA A;  5LGT A;  3E6M A;  1YW8 A;  2QQB A;  1P4X A;  4FT8 A;  3RKY A;  1HKS A;  4KFC A;  4BAY A;  4HLX A;  2BGC A;  3B73 A;  5DUI A;  3KZY A;  3Q5F A;  1Z1D A;  2M87 A;  4I2O A;  2XRO A;  4OIP F;  1VTN C;  2DQR A;  3E5U A;  2IJL A;  3I59 A;  3SXY A;  1SMY F;  1B9M A;  5FD5 A;  2JZY A;  3IHU A;  1KYW A;  4XSX F;  2K4J A;  2ISZ A;  1ZN2 A;  3RPQ A;  3BJ6 A;  2OZ6 A;  2IA2 A;  4KN7 X;  1S7O A;  3CDH A;  4KMF A;  3FHZ A;  5D5U B;  4I09 A;  3GXO A;  5AIP A;  4L9V A;  3LFK A;  5HOO A;  5E1X A;  5LHI A;  3KCC A;  1EV7 A;  4GYI A;  3QAH A;  4L5I A;  2RDP A;  2JRT A;  2A61 A;  5DEQ A;  1O3S A;  1QQI A;  1WQ2 A;  1P4A A;  3IWZ A;  2V1X A;  3OV8 A;  4U0W A;  4MEX F;  2CSO A;  3ZQ7 A;  1YS7 A;  1H9G A;  3N4M A;  3NEU A;  2B0L A;  4OIO F;  3ZMT A;  5ICE A;  3KFW X;  1BC7 C;  2YR2 A;  3FWE A;  4IVN A;  3ZN1 A;  4CHU A;  3J81 K;  2R7F A;  3TO7 A;  4HYE A;  2P7V B;  2WTE A;  1RUO A;  3REO A;  1GXQ A;  2L4A A;  3EUH A;  4OU0 A;  1QBJ A;  3ZPL A;  3JAM Z;  2ELH A;  3O6B B;  5A2Q K;  1YW7 A;  3JTH A;  2OBP A;  4FX0 A;  4P55 A;  3KP3 A;  4FHT A;  2EV0 A;  2DFI A;  3HRT A;  2FXA A;  4IRI A;  1XGN A;  2DK5 A;  4OOI A;  4ZZD A;  3R6S A;  2UXN A;  3GVA A;  3WTZ A;  1ZRD A;  2F2E A;  5HDG A;  4BQA A;  1Z6T A;  4YFX F;  5LRS A;  2PN6 A;  2IA0 A;  1FC3 A;  1IN7 A;  4L5J A;  3U2R A;  5E18 F;  2MH9 A;  3JW4 A;  1B4A A;  2LNB A;  4G9Y A;  1TQP A;  4GXO A;  3RI4 A;  4ENM A;  2K02 A;  1DUX C;  3OOP A;  2DLL A;  2P6T A;  5CJ9 A;  2EFQ A;  2X0L A;  2VOD A;  3O2P E;  3MZH A;  5ICG A;  1YTY A;  1OKR A;  4BYY A;  1GVJ A;  4EQQ A;  4HZF A;  2W85 A;  1P4W A;  2RN7 A;  4UVB A;  2KIF A;  4GCV A;  4IHT A;  3WE3 A;  4CGZ A;  5DCF A;  3D5L A;  1WKM A;  1LEB A;  1IXC A;  1IXS B;  4HX8 A;  4BHP A;  3MEX A;  3RYP A;  2VOP A;  1SD7 A;  4OMZ A;  2ZBK A;  5E8G A;  1HW5 A;  4LB6 B;  1K6O A;  1ODD A;  1STZ A;  2FML A;  4HV6 A;  3K9T A;  3LAP A;  4WF2 A;  1KQ0 A;  2P7C B;  2FF4 A;  3KP5 A;  3WTU C;  1R00 A;  1R1U A;  3FMQ A;  1XGM A;  2YX7 A;  2F5C A;  3HSF A;  1XB4 A;  2HWV A;  1FNN A;  3VFZ A;  4EJT A;  1MJA A;  1ZGA A;  1XCV A;  1XSD A;  2OAZ A;  2CW0 F;  2EV6 A;  5HLH A;  3F21 A;  2XAH A;  3E6B A;  4OIR F;  4ZH4 F;  1BM9 A;  2XUB A;  2FSW A;  2ZFW A;  1O57 A;  3Q9S A;  1KGS A;  1ZGJ A;  3IL2 A;  2P5L C;  5BOX A;  2VT3 A;  1JXS A;  4HX4 A;  1H0M A;  1W5T A;  3CO6 C;  3FXR A;  3ABU A;  1G3T A;  4RB0 A;  5L3D A;  1J9I A;  2XGX A;  2GXB A;  3BPX A;  5IT9 K;  2A3S A;  3PFI A;  3GLX A;  4KN4 X;  1ZLK A;  5FFX A;  2XVC A;  4G94 A;  3HSE A;  4PGH A;  4IHS A;  3ZP5 A;  2ZNZ A;  1BC8 C;  3M1E A;  4M71 A;  1UHM A;  1L0O C;  2OZU A;  1R7J A;  1E2X A;  3V8L A;  2Z3Y A;  2IT0 A;  2VON A;  3Q9V A;  1OYY A;  4S05 A;  2CYY A;  4QLC U;  3J80 Z;  4CIC A;  3KET A;  1LQ1 A;  2H6B A;  1YIO A;  4I7H A;  1R58 A;  2UZK A;  2M30 A;  2PJP A;  5DYM A;  1FSH A;  5HS8 A;  3GYH X;  2QYO A;  4LG0 B;  2VN2 A;  3P9K A;  2M5W A;  4YFK F;  2JSC A;  2D1V A;  3ULQ B;  2Z99 A;  4DNC A;  4O3M A;  2FBK A;  1LB2 A;  4MTE A;  4IF4 A;  3ZMZ A;  1V4R A;  3C1D A;  1UST A;  3GFL A;  4U0Y A;  2LSO A;  4UV9 A;  3V4G A;  3FF5 A;  3I4P A;  4KA4 A;  1T6S A;  2EA4 A;  3C7J A;  4XBF A;  4GO1 A;  5FD6 A;  4WXD A;  2A68 F;  2FRH A;  5CLS A;  1XMA A;  2DPD A;  4I01 A;  3F22 A;  1DP7 P;  3P7N A;  2RVC A;  2E1C A;  1D8K A;  3DKW A;  4M74 A;  2WV0 A;  5LEJ A;  1ZHF A;  5LEK A;  2YSR A;  5HS7 A;  3QP5 A;  4KNY A;  1XN7 A;  3R4K A;  3LST A;  2GAU A;  3G73 A;  4KIG A;  1OPC A;  3BP8 A;  2VXZ A;  4M6X A;  4BNC A;  3RIR A;  4ZYE A;  1A04 A;  2DQL A;  2W84 A;  4ESF A;  3LA7 A;  3QPT A;  3BPV A;  3WGG A;  2RNJ A;  3GFM A;  5CVR A;  1IXR C;  2HOE A;  1R1T A;  3FXU A;  4O6J A;  3D0S A;  2ZME A;  4EJW A;  2RV8 A;  3G3Z A;  2STW A;  1WWX A;  4A6E A;  4YFN F;  1XDU A;  1ZRC A;  3R61 A;  1S7A A;  4HF0 A;  3GUD A;  4GYG A;  1O3T A;  4EGZ A;  1FY7 A;  4L9N A;  3M8F A;  2XHK A;  1JHF A;  2D45 A;  2OA4 A;  3CLO A;  1S3J A;  4BXU A;  2V1U A;  3WOD F;  3HIF A;  3KLO A;  3R0A A;  2PLY A;  4HW0 A;  4XSZ F;  3WE2 A;  3BJA A;  2K4B A;  2VBW A;  1FZP B;  1CF7 B;  4MQV A;  1MD0 A;  5IT3 A;  2A07 F;  2QWW A;  4LLG F;  3TQN A;  2P5V A;  4B09 A;  3QP6 A;  1IUY A;  1QZY A;  1XD7 A;  1PP8 F;  2EFW A;  5TJJ A;  4PZJ A;  4N9I A;  2JT1 A;  2O6G E;  4ENN A;  4HQE A;  1UHW A;  5JR3 A;  2VC1 A;  2FE3 A;  3WG9 A;  1RIO H;  1B1B A;  3GFJ A;  5BPD A;  3AAF A;  1K78 A;  1FBU A;  2A5Y B;  3TGN A;  3LA2 A;  3BDD A;  2V9V A;  4A5M A;  2FBI A;  4HF1 A;  5ICF A;  2BEO A;  5J6X A;  2PQ8 A;  2L3D A;  2QBY B;  4U0V A;  5JI6 A;  5EEG A;  3DFG A;  2L4M A;  5LGN A;  3F8C A;  3P9C A;  3JSO A;  5CYV A;  1HQC A;  4OMY A;  1RNL A;  4KIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...