3ZPLA

Crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
b'PRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
publication title Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription/dna
total genus 62
structure length 159
sequence length 159
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zplA00
2MC3A 1KQ0A 2RGVA 3IRQA 1D8JA 1TW3A 3KLNA 3DV8A 3CUQC 4ZYHA 2XAQA 3LAJA 3I64A 4U0WA 1SFXA 1FPQA 4ZH4F 3BPVA 1YQAA 4L0ZB 3JAMZ 2QENA 3T8TA 2XGXA 2R7FA 2O6GE 4M9ZA 2EK5A 5E17F 4M72A 2RN7A 4HV6A 3J80K 1R23A 3TO9A 2QQAA 2ADUA 3ISPA 4CXFA 2GA2A 2HTJA 5EEHA 5LEKA 4KMUX 2H6BA 1ZLKA 1FBUA 1R22A 1UHWA 1OKRA 1XB4A 5DDGA 4I7HA 5LHIA 4EM0B 3MCZA 2IVMA 5ILSA 1FYKA 2ZNYA 2CO5A 2WC2A 1B59A 1ZRCA 1XGMA 5LGUA 4S04A 1UCRA 1R1VA 3QPHA 2LDUA 4RB0A 2EA2A 1KYWA 4EGZA 2OA4A 2ELHA 1EH8A 5LLQA 1U5TA 3WTWC 3KLOA 4Y15A 3DXJF 1OYWA 2DQRA 5HOOA 3F6VA 3R0JA 4HDUA 3F8FA 4ZYEA 1BBYA 2FNPA 3BDDA 1U2WA 3RJPA 2GXBA 1S7AA 3GW2A 3RPQA 2NRAC 2EJRA 2YX7A 2E7WA 1XSDA 3KP2A 2ZXJA 2MLGA 2LNBA 2PI0A 2VOOA 1WWXA 3P9KA 4RGRA 2VXZA 4EM2A 3ZMDA 2UXXA 3IWZA 4HV5A 5J6XA 1JE8A 1W7PA 1B1BA 3BPXA 4A0YA 3SQNA 3LFKA 1R5GA 3RKYA 1IN8A 3FX3A 1S8NA 4IPAA 1I6XA 2FQ3A 3ABUA 1LVAA 1KGSA 4CGZA 3GUDA 1HW1A 1K78A 4IHSA 3L9FA 5L3GA 1QO0D 2J5OA 1LJ9A 4G94A 2VT3A 3PFIA 2RNJA 5D4RA 2LSOA 5IT3A 2F2EA 4U0YA 4Q4ZF 5DUKA 4LLLA 1BOAA 2KRFA 5CJ9A 4IXAA 3B73A 3RI4A 4R8HA 2O3FA 1FSHA 5A2QZ 1MDMB 1QZZA 4L5JA 3DP7A 3JTGA 1IW7F 1FSEA 2DO7A 4WF2A 2VN2A 3KZYA 2VE8A 2E7XA 5L3CA 3WTUC 4EJWA 3J81Z 2VC0A 3IKVA 5F1RA 1ZG5A 5IT9K 3GZ5A 1ONVA 3QPTA 1QQIA 4HQMA 2FBIA 3CDHA 2QYOA 2R7DA 4CHUA 1IN6A 1O3QA 4L9JA 4U88A 2W24A 4WXDA 3TQNA 3PQJA 4M73A 3HRMA 4B8XA 4YFKF 2MH9A 2V1UA 5HVQC 2A3SA 4G7HF 3GVAA 4K2EA 1B4AA 1YO5C 4Q47A 4WWCA 4L0YB 5HS8A 3QRFF 1XDSA 5BQTA 4UHTA 3KCCA 3ZN1A 1OMIA 4P96A 2GAUA 2VBYA 2DTRA 3E5QA 1JHHA 3D5LA 3ZMUA 3IRRA 3RYRA 4NQWA 3EQLF 3R4KA 1RNLA 4ENMA 3T1BA 2NNYA 5JFRA 3F6OA 3ECHA 1ZG3A 1KYZA 2G7HA 2DPDA 4UVCA 3CUQA 1TTYA 3N4MA 2CFXA 2WTEA 2ZBKA 3ZQ7A 2HKOA 5FLXZ 4BH9A 2A69F 4KICA 4IRIA 4HF2A 4I0AA 1KU7A 2LF7A 1TQMA 2WWYA 3C3WA 1E17A 3WU1B 2HZTA 1J7KA 1QNTA 1Z6RA 3CLOA 2QBYB 3Q9SA 2NS0A 3FHZA 3ZMZA 1FBQA 3I0TA 3CJNA 4UVBA 1PUEE 3D0SA 2XROA 4RS8A 4D0PA 2RVCA 3BJOA 4FX0A 4M9SA 1P4WA 5LEJA 1LDJA 5FO5A 2ZFWA 2YU3A 2HEOA 3V4GA 1ULYA 4AD9A 4ESBA 1HKTA 2PEXA 4IRGA 4A5NA 3IC7A 2KJBA 2JZYA 4IRHA 5J8FA 3TGNA 2HFHA 2NAZA 2P5KA 2Z33A 2DBBA 3WU0A 2L3DA 4HX7A 1FC3A 1REPC 3WGGA 2IA2A 4UV8A 3KP6A 3QU3A 2JSCA 3DFGA 3F8CA 4PDKA 4BYYA 4Q5SF 3ULQB 5ICGA 4OMYA 3ML6A 5F64A 3JSPA 4BHBA 2V1DA 2PN6A 4G9YA 2PMHA 5KK1A 1T98A 1ZREA 2Z5UA 3V8JA 2DLLA 2L4AA 2M30A 3T5XA 3T8RA 3GFJA 3L2CA 2IA0A 2DFIA 2QLZA 4G8XA 1O3SA 3J81K 4OINF 1X3UA 1FNNA 2PMUA 1XGOA 3QP6A 3ABTA 1YW7A 2QUFA 3TO6A 2HQNA 4XLPF 2EV5A 5D6EA 4PGHA 5F6FA 3ELKA 5HS7A 5D5UB 4U7BA 1SD4A 3KP4A 5J8CA 5LGTA 2RC4A 2XRNA 3P9CA 1OYYA 3L7WA 1XN7A 2JRTA 4L9TA 1TNSA 1RUNA 1HXDA 3K1PA 1ZHFA 3GF2A 4CDGA 2A6HF 3MWMA 3VOEA 1DPRA 2MH2A 2K27A 3K1NA 1O57A 2DU9A 3BP8A 4OIQF 2DAOA 4GYIA 2WV0A 2VONA 1O7LA 2STWA 1GHCA 4XSXF 2FEZA 3FMSA 1BI0A 1K7AA 5FLXK 3CUQB 4CZZA 5K5RA 5LRSA 4S05A 3TDZC 2ISYA 3TKYA 2W25A 1YFHA 1MDMA 1W4MA 3V7RA 2HDCA 4E70A 3I53A 2P7VB 3WE3A 1BC8C 1IZ1A 4ON0A 1R5HA 2V79A 2VODA 2Z3YA 5HLIA 1ZGJA 2JTVA 2EFNA 1MJBA 2O0YA 2KIFA 3BJ6A 3GFMA 4JBAA 1T38A 5D8KB 2JT1A 3HSFA 2BV6A 3MEXA 3HTUA 3MFKA 2ZCWA 2TDXA 2Q8KA 2FBHA 1MJAA 3L09A 5ERIA 3E3VA 3CO7C 1L3LA 2NNNA 3V8LA 1XGSA 4HLYA 2EFOA 1RUOA 2FNAA 4R1HA 5DV5A 5E18F 1BI1A 2GWRA 4ESFA 4XSZF 1ZAOA 3WGIA 2OQRA 4RAYA 1YLFA 4GXOA 1LB2A 1JHFA 1ZLJA 2ETHA 1F1ZA 2XKOA 3OV8A 2X4HA 2BE5F 2A61A 1FP1D 1HSTA 1HBXG 3NEUA 4U0VA 4A2UA 3BROA 4LK0F 4WX9A 1PP8F 4O3MA 1R1UA 3ERED 4HDVA 3H3UA 5K1YA 4GGGA 1JGSA 1P92A 1FOKA 1J9IA 4YFXF 2ACJA 1U78A 5FFZA 2JPBA 2LF8A 1CF7B 1BN5A 1O3TA 4M6XA 2D1VA 1XSVA 3ZMSA 2L01A 4MQVA 4AIJA 5D4SA 2QBYA 5E1XA 2ZO4A 5E8GA 4BQAA 4ZYDA 5CLSA 3TOAA 3COAC 2P8TA 1EH6A 3O2PE 3ZPLA 3JTHA 3JW4A 4MTEA 1S29A 1RZ4A 4O6JA 4GYGA 4U7DA 4I98B 3FM5A 4KN4X 3GFLA 2VOPA 3E6MA 1R00A 3F21A 2EFWA 3MZHA 3ECOA 3KP3A 2FSWA 4NB5A 3HRTA 1S3JA 4HA8A 2OAZA 4LB6B 3BY6A 2O61A 4EMSA 4BAYA 3WG9A 4ZZDA 5H6RA 4WK8F 3GO5A 2QQBA 3LAPA 2HTSA 2FA5A 2VE9A 4HF1A 2HOEA 1H9TA 3E6CC 3SFZA 1IF1A 4MHGA 2ESNA 2Y0MA 1HKQA 5BMZA 2IP2A 2XIGA 3U1DA 4AVPA 1B9NA 2FBKA 1TNTA 3DF8A 2ZJ2A 2L02A 1SD5A 4BNCA 3WTTC 1F5TA 1HQCA 3GZ6A 4BHCA 1EH7A 5TJJA 4ZZLA 2EFQA 3G73A 3AAFA 4KFCA 4A5MA 2O8XA 1SFEA 3E6DA 5JVTA 3TOBA 2EV0A 1I27A 1Z9CA 4OIPF 1A04A 3GXOA 4ZYGA 3QP5A 5DEQA 3HSRA 4IHTA 1IUYA 1FY7A 1XDUA 1FYMA 2G7UA 3P7NA 3JAMK 2UZKA 4UXNA 4N9IA 2DT5A 4DQ2A 5LHGA 4B09A 1LNWA 1TQPA 3HIFA 3H92A 1WQ2A 2IT0A 1J2XA 1G3SA 1QZYA 1I1SA 3RKXA 1KU3A 5E8IA 1BM9A 4A12A 2L54A 4UNOA 2H6CA 3HOTA 4I2OA 1D8KA 2V1XA 3SXYA 2XVCA 3R6SA 3O3KA 4HBLA 2K4BA 2W85A 4HOBA 1MKMA 1OR7A 4RGUA 3R0AA 1KU9A 3LQQA 5BPDA 1WRJA 3GLXA 2P7CB 5ILVA 4WCGA 5BPIA 1V3FA 2DI3A 1TLHB 4NHJA 4KA4A 4N0BA 2D45A 2YSRA 3DPLC 2COMA 2XHKA 3F8MA 5DD8A 4XLNF 4RB2C 5FB2A 1U6GA 3W6JB 1BJAA 1IXRC 4AIKA 3DEUA 4IJAA 6PAXA 4L5IA 5E1ZB 1XMAA 2KKOA 1QGPA 5DYMA 2DW4A 3U2RA 3SZTA 1FT9A 2YPRA 3EYIA 2RV8A 4EJVA 3EYYA 4P5OA 2P5VA 1R1TA 1BI3A 5JR3A 4MGRA 2XAGA 2HWVA 1YTYA 2ZMEA 4A0XA 3K9TA 2Q2EA 3Q9VA 4IVNA 2E1NA 1WI9A 4Y17A 4MTDA 2FMLA 1HW2A 2ISZA 4F7ZA 5DCMB 5D8LB 2Y75A 1UHMA 3K69A 5E20A 1ZG1A 3V8KA 1VTNC 4I09A 1P4AA 1ON1A 2QM3A 3I58A 4PGGA 4A6DA 4LFUA 3C1DA 4OIRF 3QU6A 2EB7A 1FX7A 5A2QK 1CF7A 3KP5A 1ZRFA 3GWZA 1G4DA 3REOA 2HYFA 3TO7A 3FXRA 5H6QA 1KQ8A 1WSUA 1Z1DA 3RTRA 2MA3A 4G7OF 4AWXB 3M9AA 3C18A 1D5VA 2P4WA 2F5EA 4YFNF 1ODDA 1R58A 4MQ9F 1UFMA 4FHTA 1TW2A 3FXQA 4HAMA 1K79A 3HHGA 1Y0UA 3M8EA 4BHPA 1F4KA 3WODF 4G7ZF 4L9NA 1T2KA 2CG4A 4WXCA 1S7OA 1AOYA 3PQKA 1OYIA 1SD7A 4KYWA 2M8EA 1Z6TA 1KA8A 4KMFA 3SHFA 2IRFG 5ICEA 1D3YA 2EWNA 3N97A 1ZH5A 3WGHA 1XCBA 4LLGF 2HQRA 5BOXA 2IJLA 3F22A 1SD6A 3FMQA 2FMYA 3FM3A 2V6CA 3LQRA 1ZYRF 2EFPA 2BGCA 4YIFA 4UVAA 3K0LA 3MAJA 3E97A 4ENKA 5L3DA 1EV7A 3G3ZA 3BZ6A 1H0MA 1SFUA 2B0LA 1HSJA 2XASA 2P5LC 2ESHA 3VEPA 1P2FA 3LSTA 5ICCA 2CWEA 4Q48A 4Y13A 4CYDA 3M8FA 3DPTA 2QZ8A 5CVRA 3KFWX 2IW5A 3TDUC 1I1GA 2QQ9A 1ZARA 3R61A 1QBJA 2AXLA 4G6DA 5FFXA 1J5YA 3V7CA 2PBIA 4M9XA 3WE2A 4LD5A 2JPCA 3ZMTA 2E1CA 4CICA 1KQ9A 4KUMA 1J75A 5TRDA 1XD7A 5FD6A 4M74A 4JQFA 1YS6A 1MD0A 5IT9Z 2BYVE 1C0WA 2OZUA 2ZMEB 4LK1F 3M7GA 1K6OA 1STZA 5LGNA 1DDNA 4P9UA 4DNCA 1TBXA 2XUBA 3HUGA 4WXHA 3FMRA 3HYIA 1MJ9A 1H9GA 3LA2A 2PLYA 3F23A 5CVJA 2STTA 3BOQA 4A6EA 2XV4S 3BWGA 2DK8A 5H20A 2PQ8A 5D5XB 5HDNA 3H3ZA 4CO8A 1W5SA 5ILUA 2KIMA 4L9VA 2F5DA 4KIGA 3FWEA 3MZYA 3BJAA 3CUOA 3U9GA 3WTYC 2BEOA 2XAJA 1YS7A 4N9HA 4OU0A 1MZBA 4GO1A 3I59B 3OOPA 2FE3A 3HOSA 5D5WB 1CGPA 3C7JA 2LKPA 1FP2A 1BIAA 4MNUA 1R7JA 4R79A 1LEBA 1TQIA 3NRVA 5JI6A 3LA3A 3HRUA 3ZMVA 4AIHA 1IXCA 3GX4X 4PZJA 2Y48A 2GXGA 1PP7U 1IXSB 5EEGA 4GCVA 3ROUA 1BC7C 1IRFA 3WTVC 1P4XA 1NHAA 3ZN0A 3M1EA 3EUHA 1XSXA 1DPUA 5FD5A 5HDGA 2K7LA 1ON2A 3I54A 5AIQA 3RDIA 1R36A 3F72A 2Z9OA 4EJUA 2M1BA 2PFBA 2MLKA 4YG2F 1LQ1A 4P9FA 2EA4A 2KIUA 4EJOA 1T6SA 5HS9A 2R3SA 2XAFA 2X0LA 5DCMA 1P6RA 3NQOA 1DP7P 3EETA 2VBZA 3QAHA 2K02A 1ZN2A 3E5XA 2ZKZA 1IAWA 1FWZA 4QWQA 1UB9A 1MGTA 2DPUA 3FXUA 2J5PA 1L0OC 5L3EA 4ENNA 1G3TA 1T39A 3EDPA 4M71A 4QLCU 2HS5A 2W57A 3KEQA 1WKMA 3KETA 5LRRA 5LBQA 4LB5A 2M87A 4LGWA 3KZZA 1Z7UA 3R60A 4I0BA 4LG0B 1XGNA 1SMYF 1FZPB 4RB1A 5CVUA 3SZPA 2XAHA 5DD4A 2DQLA 4EM1A 2RKHA 1T0FA 2BBYA 3J7AO 1LEAA 2D2WA 3IKTA 4RGSA 2RQPA 3ZP5A 3MQ0A 1IN4A 3S2WA 3GFIA 2Q0OA 3K2ZA 1U8RA 1FLIA 1SAXA 2GZWA 3RKWA 2CW0F 3WTXC 2M45A 2AS5F 1YIOA 4ETSA 5D5VB 5E1WA 5ICFA 2DK5A 4XRFA 2A6EF 4YIIA 2K86A 2VC1A 1Z91A 5CVVA 2A07F 2L4MA 3JSOA 4LJZF 1RIOH 4KT5C 4EQQA 5LHHA 1J0RA 4HYEA 4HX8A 1USSA 4HW0A 2HR3A 2HGCA 4KN7X 5AIPA 2W84A 4KDPA 1ZGAA 2QWWA 1J59A 4Z2YA 2Z99A 2K4JA 2QVOA 1I5ZA 1G6NA 3F3XA 4UV9A 2H94A 3E5UA 2G9WA 1GVJA 4ENJA 2A68F 3K1MA 2M5WA 4OIOF 1W7PD 3I5UA 3GEZA 3HHHA 5AONA 1LDKB 4I01A 2P6SA 1USTA 3F8BA 1XCVA 3IHUA 4FX4A 3VB2A 4A0ZA 2V9VA 2GA1A 3VODA 4ASNA 3Q5FA 2OD5A 1Z05A 1BI2A 5BS6A 1U5TB 4HZFA 2UWMA 3IWFA 3KEOA 4LLNA 2OBPA 2P6TA 4TV7A 3HRSA 4LMYA 2CYYA 5CVIA 1S6LA 2ZNZA 3B02A 5D6FA 2D1HA 4FT8A 3KE2A 4MEYF 3RPUA 1B6AA 1U5TC 2FU4A 1IN5A 2GIVA 2GQQA 4KIFA 3L00A 4EV0A 1DUXC 1JXSA 4OMZA 3GYHX 4JK1X 4MEXF 4G6QA 3P9IA 2XKPA 5JHUA 1W7PB 2F5FA 4P55A 1YG2A 1IRGA 2HYGD 3J80Z 2O03A 1LDDA 1K78B 3CTAA 4HQEA 4KIBA 3F8NA 2HKXA 2F5CA 1BIBA 4HLXA 1SMTA 2CSOA 1Q1HA 2UXNA 2KJCA 3RIRA 2H27A 5KVRA 5L3FA 3DKWA 2MBFA 1HKSA 4IF4A 1XMKA 1O7FA 1E2XA 2A5YB 3I59A 1FYLA 4EJTA 1GXPA 1G3WA 4XBFA 2EV6A 4HF0A 1AWCA 2CQKA 1YYVA 2H09A 3E6BA 4L18B 2C6YA 4ESJA 3KP7A 3IL2A 3LWFA 4KNYA 5CYVA 2RDPA 5FGMA 3WTZA 3W6KB 1YW9A 5HLGA 3O6BB 2FRHA 4H0EA 1F9NA 1V4RA 2MD5A 4BXUA 4M6YA 1HW5A 1W5TA 4RAZA 2NYXA 2VBXA 3LA7A 1U3EM 3FF5A 3V7SA 1YW8A 2YR2A 3HTSB 2IA1A 1FBSA 4RB3C 1IN7A 2OU2A 1RI7A 4O5VA 4HX4A 2CGPA 2VBWA 5HLHA 2PJPA 2OZ6A 1KU2A 5DUIA 1GXQA 3I71A 4EVIA 2FXAA 3DQVC 2FOKA 2IPQX 1O3RA 2OQGA 2VT2A 1G3YA 2YX4A 3CO6C 5L3BA 4PCQA 1OPCA 1QPMA 4I02A 5HDKA 3WTSC 3RYPA 3FZVA 5DCFA 3I4PA 4LG0A 4UUVA 2PG4A 4OOIA 1PDNC 2FF4A 3HSEA 5K5OA 5ED4A 5K5QA 1ZRDA 4RGXA 3VFZA 4EGYA 1B9MA 3QOPA 3T0YA
chains in the Genus database with same CATH superfamily
2MC3A 2F4MB 2ZFUA 2ME6A 4IQJA 3IAS2 1KQ0A 4D7MA 2IS4A 2RGVA 4P1WA 3IRQA 2M2EA 1D8JA 1IDYA 1TW3A 2HXOA 5F0HA 3KLNA 3DV8A 3IUOA 3FBIB 3FK6A 3CUQC 3IH4A 2XAQA 4BUPA 4ZYHA 3LAJA 3I64A 4BXFA 3AKZA 4U0WA 1SFXA 5EJCA 1FPQA 5F0FA 4ZH4F 1DGRM 2HVRA 4RMNA 2M7AA 3BPVA 1I3QJ 1YQAA 4L0ZB 4HRIA 2K9SA 3JAMZ 2QENA 2WAEA 3T8TA 4X1EA 1WI3A 1Z3YA 3AL0B 1VZ0A 2XGXA 3RQIA 2R7FA 2O6GE 2LH9A 4J01A 4M9ZA 2EK5A 5E17F 3CJTB 3FXLA 3TBIA 4M72A 3CMAI 2RN7A 4HV6A 3OYKA 3J80K 1R23A 3M8JA 2LR8A 2M9HA 1GDTA 2M4KA 1QVTA 2I8DA 3TO9A 2L9VA 2QQAA 3CCVI 2ADUA 3ISPA 4CXFA 2GA2A 2HTJA 5EEHA 1TWHJ 1VQKI 2XF7A 1JUPA 4RLQA 3KYCB 5LEKA 5GAGJ 3OYDA 4KMUX 2H6BA 1ZLKA 1LKXA 1RRJA 1FBUA 1R22A 1UHWA 1OKRA 1XB4A 2IGKA 5DDGA 2HNHA 4I7HA 5LHIA 3PNTA 4XLFA 2OC6A 4EM0B 1QPIA 3MCZA 3DTKA 2IVMA 5ILSA 5F04A 4ANJA 1FYKA 2ZNYA 3VPRA 2CO5A 4XLHA 2WC2A 1B59A 3EUKL 1ZRCA 1XGMA 1JGGA 5LGUA 4IHXA 3I4NJ 4S04A 1S9HA 1UCRA 2E1OA 1R1VA 2CUEA 3QPHA 2LDUA 5EG0B 4A3FJ 4RB0A 3B6AA 1ZTRA 2EA2A 2LYCA 1KYWA 1Z21A 2OA4A 2ELHA 4B3XA 4EGZA 4XLCA 1EH8A 2ZSIB 3FHNA 3L2WA 4UUSB 5LLQA 2EIMH 1FTZA 1U5TA 1HLVA 1MBEA 3WTWC 3KLOA 1QVUA 3DXJF 4Y15A 3GTGJ 5B3SH 3J7YJ 4BEHA 1OYWA 3QODA 3SEQA 2VJ5A 4C2TA 2X48A 2DQRA 1S5LC 3OYIA 5HOOA 2QSHX 3MKLA 3F6VA 3S1NJ 3R0JA 4HDUA 3S8PA 5DM6F 4C9YA 3F8FA 4ZYEA 4Y33A 4C3IJ 1BBYA 2FNPA 3BDDA 1U2WA 2ZXIA 3RJPA 2Y0SA 3HEFA 1S7AA 2GXBA 3GW2A 4JYKA 2CUJA 3RPQA 1R49A 2NRAC 4C3HJ 3TW6A 2EJRA 3CDIA 1N78A 2QQ8A 2YX7A 2E7WA 2R7RA 1XSDA 3KP2A 4Y4RA 2HPIA 2ZXJA 2MLGA 2LNBA 3FK7A 3K6GA 3SYTA 4XQFA 2PI0A 2VOOA 1MBGA 1WWXA 4HSRA 3IH3A 3P9KA 4DZJA 1DU0A 4RGRA 1K83J 2BHYA 2VXZA 4EM2A 4BQQA 3ZMDA 2UXXA 3IWZA 4HV5A 5J6XA 1JE8A 2PJRA 4PJMA 1W7PA 1B1BA 3BPXA 4A0YA 3MKWB 1X58A 4S0HB 1SFOJ 3GZNB 3SQNA 4BJ6C 3DWLE 3LFKA 1R5GA 4BE0A 3RKYA 1IN8A 1MNEA 2A05A 1S8NA 3FX3A 1IRXA 1I6XA 4IPAA 2FQ3A 3ABUA 1LVAA 1KGSA 5IYBJ 4UB6C 4CGZA 1RETA 2VKVA 3GUDA 1HW1A 5KHDA 2LKSA 1K78A 4IHSA 3G1OA 3L9FA 5L3GA 1QO0D 2GBYA 4QPOA 2H8RA 3QYFA 4IEJA 2J5OA 1D1AA 1LJ9A 1B72B 4G94A 2CQ7A 2CQQA 4GRIA 3CCUI 5CKTA 2KLOA 2VT3A 2DA7A 2DDAA 3PFIA 2RNJA 1MNDA 1V55H 4I76A 5JLXA 5D4RA 2LSOA 5IT3A 4F3QA 2F2EA 4U0YA 4Q4ZF 1BR1A 1M1EB 3RZDJ 2AHQA 4XN0A 1OCRH 5DUKA 4LLLA 1BOAA 1EKEA 2KRFA 4DBQA 1IC8A 5CJ9A 4RLFA 2CV1A 4IXAA 3ABKH 3H5RA 3B73A 3RI4A 4R8HA 3A02A 5TGTA 1I6HJ 3VYRB 3H9GA 4DGWB 1ETQA 1DU6A 2K85A 1SC7A 2O3FA 1I3AA 2VI6A 3BR2A 1FSHA 5A2QZ 1MDMB 5F1JA 1QZZA 4L5JA 4OAYA 2R92J 3DP7A 3ZRGA 3JTGA 1WGXA 1IW7F 1FSEA 2DO7A 4WF2A 2VN2A 1VI0A 2WA0A 3IP4B 3KZYA 2VE8A 2E7XA 5L3CA 3HG9A 3WTUC 4EJWA 3J81Z 2VC0A 3IKVA 4W97A 5F1RA 2KDOA 1GV2A 4CYCA 2RNGA 9ANTA 2H1KA 1ZG5A 3M4OJ 2JVGA 3GTOJ 5IT9K 3GZ5A 2HVQA 2ZJPF 4IOAF 1ONVA 5K7FA 1SFKA 1QQIA 3QPTA 1A35A 1OCPA 4HQMA 2FBIA 3CDHA 2QYOA 2R7DA 3CZ6A 3S3MA 2B9SA 4CHUA 1IN6A 2M34A 3DBHB 1O3QA 4L9JA 2MYSA 4U88A 2W24A 2NOJB 1W0UA 3CQZJ 3DTIA 3HXLA 3G1MA 4WXDA 3I9V2 3TQNA 3K70D 3PQJA 4M73A 3HRMA 3LL7A 3Q0WA 4B8XA 4YFKF 2MH9A 2V1UA 5HVQC 2A3SA 4G7HF 2QEXI 4JX4A 3GVAA 4V19K 4K2EA 1B4AA 1YO5C 4Q47A 4WWCA 3DLAA 1IJWC 4L0YB 5HS8A 5FJ8J 1BOBA 2EIJH 2NXNB 3QRFF 1N75A 2DODA 3BQYA 4RDUA 1VNDA 3OIPA 1XDSA 3BG5A 5BQTA 3PO3J 4UHTA 2Z1DA 3K4KA 1WHUA 4LG3A 3KCCA 4BY7J 2W7NA 3ZN1A 1OMIA 2XGDA 4P96A 2GAUA 2VBYA 2DTRA 3E5QA 1XMXA 3K10A 1JHHA 3D5LA 2E36A 2ZJRF 5B5EC 3ZMUA 4XICA 3IRRA 3RYRA 4NQWA 5FROA 1MBHA 3EQLF 2WY8Q 3S15J 3R4KA 4PFOA 1RNLA 3PL8A 4ENMA 2Q1ZB 1B8IA 3T1BA 2NNYA 1F43A 5JFRA 3F6OA 3EUAA 4XM3A 4QSHA 2NVYJ 4BGDA 3ECHA 1ZG3A 1KYZA 3GMEA 2G7HA 2A6TA 2QKMB 3QWLA 2DPDA 4UVCA 3CUQA 3HKZN 4XRMA 2VJIA 1JJ8C 1TTYA 3BT9A 3N4MA 2CFXA 2WTEA 3PJRA 2XPVA 2ZBKA 2XB0X 2HKOA 3ZQ7A 5FLXZ 2JVHA 2DTZA 3AG1H 1T33A 3F0CA 4BH9A 2A69F 4KICA 4J19A 4IRIA 4HF2A 4I0AA 1KU7A 4V2GA 2LF7A 1MBJA 1N25A 1R5ID 1TQMA 2WWYA 3C3WA 1E17A 3WU1B 2HZTA 1J7KA 4E4HA 1YJNI 2CU7A 1QNTA 4PJNA 1Z6RA 2KRCA 2QSFX 4CCLA 1P9QC 4XKCA 3CLOA 2QBYB 2MSYA 2VL8A 4DJAA 3Q9SA 4KITB 2NS0A 3FHZA 3ZMZA 4A3LJ 1FBQA 2DA4A 3I0TA 1X2NA 5EZGA 2CH0A 2YS9A 3A4CA 3WG7H 1K6YA 1MH4A 3CJNA 4UVBA 4XIDA 1PUEE 3D0SA 3PUBA 1R4NB 2XROA 4RS8A 3H35A 4D0PA 2RVCA 4EATA 3BJOA 4FX0A 4II3A 1NG6A 4Y7NJ 4M9SA 3ERMA 1P4WA 5LEJA 5J1YA 3HOXJ 1LDJA 2GOMA 5FO5A 3BLYA 3IH2A 3K70C 3L2RA 2FUG2 2ZFWA 2YU3A 2HEOA 4JX6A 3V4GA 1ULYA 1BW5A 4AD9A 2PJRB 4ESBA 1ZQ3P 1ACIA 2OPTA 2R7SA 1HKTA 2PEXA 4IRGA 4A5NA 3IC7A 2L7MP 3TP0A 2KJBA 2X6OA 4ZDPA 2L9RA 2JZYA 4RBOA 4IRHA 4IHVA 5J8FA 1IV8A 3TGNA 2HFHA 5DM7F 2M3AA 2WY7Q 3HOYJ 2L7KA 3DBLB 3MKYB 1UMQA 1X19A 2NAZA 2DA3A 2P5KA 4XK4A 2Z33A 2LY9A 1FEXA 2DBBA 3WU0A 2L3DA 4HX7A 2RAEA 2X1EA 1FC3A 1REPC 3ASNH 3WGGA 2IA2A 3CDLA 4UV8A 2LTPA 3KP6A 1KZHA 3OYBA 3QU3A 2JSCA 3DFGA 3F8CA 5K7ZA 4PDKA 4BYYA 4Q5SF 3ULQB 5ICGA 4RAGA 2Y9ZA 4OMYA 3W2WA 1G2HA 3ML6A 2X6XA 1FMVA 5F64A 3JSPA 2EH3A 2PX9A 4UB8C 3BCAA 4N4NB 2BXZA 4BHBA 2V1DA 3LOCA 2PN6A 4G9YA 5EG0A 2E2JJ 1D1CA 2PMHA 5KK1A 1T98A 1ZREA 1MSEC 2VQCA 2IEKA 2Z5UA 3V8JA 2YU9J 2DLLA 2L4AA 2M30A 1WJ5A 3T5XA 3T8RA 4UUSA 1BA5A 3GFJA 3L2CA 2IA0A 2K9LA 2DFIA 4I99C 1G8XA 2OCCH 3CC7I 1WH5A 2QLZA 4NDLA 3JRFA 4G8XA 1O3SA 5IY5H 3J81K 4OINF 1TC3C 1X3UA 1FNNA 1SVLA 2PMUA 2E19A 1XGOA 3QP6A 3ABTA 1YW7A 2X1CA 2QUFA 3TO6A 2HQNA 4XLPF 1Y8RB 2EV5A 5D6EA 4G6TB 4B43A 3WHCA 4PGHA 2KPMA 5F6FA 2DMPA 3ELKA 5GTHC 5HS7A 3CCEI 1YJ9I 5D5UB 4U7BA 1SD4A 3KP4A 5J8CA 5LGTA 2RC4A 1UG0A 4IQ4A 2W1OA 2HOTA 2LD5A 2RQQA 2XRNA 3PNVA 3DU6A 3P9CA 2K9QA 1OYYA 2HYJA 1WJFA 3L7WA 1XN7A 2E60A 5FKOA 3JRIA 4B48A 2JRTA 3LSJA 4L9TA 1TNSA 1RUNA 2JK3A 1IRZA 3BG3A 1HXDA 1WFXA 2X6WA 3K1PA 2GIZA 3E0JB 4FTHA 3CP8A 1SAUA 3O8HA 2V4JC 2VLAA 1ZHFA 2XPUA 3GF2A 2EZIA 5M3FJ 4CDGA 3SDBA 3K4NA 2Y0SN 2A6HF 2JUCA 3DPUA 3TMOA 2FQ4A 2Y2ZA 4BQNA 3MWMA 3PSIA 3VOEA 1F36A 1B72A 1MMNA 2R4GA 1DPRA 2MH2A 2K27A 2K3PA 3K1NA 1FJLA 1AHDP 1O57A 2DU9A 3CJRB 3BP8A 4OIQF 2DAOA 4GYIA 2Z16A 2WV0A 2VONA 1O7LA 2STWA 1GHCA 4XSXF 1R6RA 2FEZA 3FMSA 1BI0A 3K4MA 2JA6J 1JT6A 3OOUA 1OISA 3HOZJ 1K7AA 2MFZA 5C44J 4MLOA 5FLXK 2MC4A 3CUQB 4CZZA 1UJ8A 5K5RA 5LRSA 4S05A 3TDZC 2KISA 5M5XJ 4HSTA 3Q0VA 2ISYA 3V42A 3TKYA 2OV7A 2W25A 4XLEA 1RESA 1O4XA 1YFHA 1MDMA 4A3CJ 1W4MA 3V7RA 2HDCA 4E70A 3I53A 1E0EA 3G6EI 5HNHA 3K4JA 3ABMH 2L7FP 2P7VB 5J3LA 3WE3A 1BC8C 1VQLI 1IZ1A 2ELKA 4ON0A 3Q0UA 3DEWA 2FD5A 4PJLA 2OTJI 3L2QA 1R5HA 1OR7C 2V79A 1VQ5I 3GCMA 2VODA 2Z3YA 2VKDA 5HLIA 1ZGJA 2KDZA 1VQPI 2JTVA 2YUSA 2EFNA 1MJBA 2LP0A 2O0YA 2KIFA 3BJ6A 2K5CA 3GFMA 4JBAA 1T38A 5D8KB 2JT1A 2Y9YA 3HSFA 5FKKA 3FBNB 2BV6A 3UR3C 1RPWA 2XRLA 1K4SA 3LNQA 2BY1A 3MEXA 3DTEA 3HTUA 5IYCJ 3MFKA 2ZCWA 2TDXA 3VYUB 4M3FA 2Q8KA 2FBHA 3VWBA 1MJAA 4XRSA 4BJ5C 1VQOI 3W2AA 2XGCA 3L09A 5ERIA 2BVMA 3E3VA 4F92B 2F4IA 3HL2A 3CO7C 1L3LA 5KCMA 2NNNA 3V8LA 1XGSA 4HLYA 2EFOA 1RUOA 2FNAA 4R1HA 5DV5A 5E18F 3K4BA 4RM2A 3PO2J 1BI1A 3OL3A 1UZCA 2GWRA 4ESFA 4IOCF 2COBA 3DU5A 1ZAOA 4XSZF 3WGIA 3KIOA 1HC8A 2HOSA 2OQRA 4RAYA 1YLFA 2VJ4A 4GXOA 4YRVA 1GUUA 1LB2A 3GTMJ 1JHFA 4BE1A 1ZLJA 2Q2EB 2ETHA 1F1ZA 2XKOA 1QZEA 3OV8A 2X4HA 1MMAA 1NG7A 3KYDB 2BE5F 1U9OA 4LOCA 2A61A 1FP1D 1HSTA 3DLLF 5LD2C 1HBXG 2LC2A 3NEUA 4U0VA 1ETVA 4A2UA 3BROA 4B4CA 1H88C 4LK0F 3K4CA 3DKXA 2R7XA 4WX9A 3CLQA 2PMZA 1PP8F 3ZQIA 2ZMEC 2JA8J 4O3MA 1R1UA 3ERED 1HDDC 4HDVA 3H3UA 5K1YA 4GGGA 1JGSA 1R4MB 1P92A 5EF6A 2CW7A 2DOFA 3BR0A 3OR2C 3HM5A 3M07A 1DGWY 3RZOJ 3KYLA 4KJZA 1XPXA 1FOKA 1J9IA 1FTTA 4N4OB 4YFXF 2V7FA 2ACJA 1U78A 5FFZA 1ITYA 4FASD 1QU3A 2JPBA 2LF8A 5FLMJ 3QYBA 1CF7B 1BN5A 1O3TA 4M6XA 2D1VA 3H1CA 1W5CC 4OAZA 2E1MC 1XSVA 2CUZA 3ZMSA 2L01A 2VXDA 4MQVA 3U1KA 1QRYA 1U9NA 4AIJA 5D4SA 3H0DA 2QBYA 5E1XA 5FRNA 4A3BJ 4M3DA 2ZO4A 4XMYA 1ETYA 5FLVA 1GLNA 3ZQCA 3QYEA 5E8GA 4BQAA 3GTQJ 4ZYDA 3KZIC 4LITA 1WJEA 1VF9A 5CLSA 1GT0C 2V6EA 3TOAA 3COAC 3CCLI 2P8TA 5IYDJ 1EH6A 1D1BA 3O2PE 2DMUA 5M3MJ 3MN2A 3A2KA 3ZPLA 1Z7LA 2ZXHA 3JTHA 3JW4A 2KRHA 4MTEA 3CD6I 1S29A 1RZ4A 4O6JA 1T8IA 4GYGA 1EJ9A 4U7DA 3O8GA 2K3FA 2NS8A 5EEAA 4E7IA 5IOZA 4I98B 3FM5A 2B7EA 4KN4X 4CUGA 1QHGA 2FX0A 3GFLA 1IO2A 2VOPA 3E6MA 1R00A 3FXKA 3OYAA 3HGGA 3F21A 2EFWA 4CA0A 3MZHA 2M0MA 3ECOA 3KP3A 2FSWA 4AUXA 2M7BA 4IHYA 4NB5A 3CCQI 3HRTA 1S3JA 2RREA 4E7ZA 4HA8A 2OAZA 2JUGA 4LB6B 4AYBA 1PUFB 1X4OA 2M4GA 3BY6A 4DW6A 2O61A 4EMSA 2ZJQF 4BAYA 4AM3A 3WG9A 4ZZDA 5H6RA 1HCRA 1OCZH 4WK8F 3GO5A 2QQBA 3OWTA 1DP3A 3LAPA 3K2AA 2HQ5A 2HTSA 2FA5A 2VE9A 3OYJA 5GAEJ 2CFOA 4HF1A 1BR4A 2HOEA 1H9TA 2DCEA 3D1NI 3SFZA 3E6CC 4E7SA 4PJ0C 1IF1A 4MHGA 4ZTJA 2Y0MA 3BR1A 2ESNA 2HZDA 1HKQA 2EILH 3OL4A 5BMZA 2IP2A 2XIGA 2DMTA 3U1DA 4AVPA 1APLC 5FKMA 1NK3P 1B9NA 2BXYA 2FBKA 1TNTA 2MD0A 5BNGA 3DF8A 2ZJ2A 2L02A 3HDDA 5C4XJ 1JT0A 1SD5A 1DQUA 4BNCA 2NVUB 3SFIA 3WTTC 1F5TA 1HQCA 4YIRX 3I4MJ 3GZ6A 3HOWJ 1YX5A 4BHCA 1EH7A 1MBFA 3HBLA 2OUMA 5TJJA 4HNUA 4ZZLA 2EFQA 3G73A 3AAFA 4KFCA 4A5MA 4DIQA 5GPAA 1MW7A 2O8XA 1SFEA 3E6DA 1P7JA 2QSGX 5JVTA 3TOBA 2WAQA 2EV0A 3ZQQA 1I27A 4ZTFA 3OSFA 2ZC2A 1XS9A 1Z9CA 4OIPF 1GVDA 1A04A 3GXOA 4ZYGA 3D5SC 2CQNA 4OWRB 3QP5A 3S1RJ 5DEQA 3S14J 2Y31A 2KMUA 3HSRA 3FKJA 4IHTA 1IUYA 1FY7A 1FOXA 1XDUA 1Y39A 2ZXWH 1FYMA 2G7UA 3P7NA 4NBQA 2B63J 2V9KA 3JAMK 1TWCJ 2O5RA 2UZKA 1X3WB 3BG7A 1WJAA 2KQRA 4N9IA 4UXNA 1AKHB 2DT5A 4A3GJ 2GLOA 4DQ2A 4Z6YA 5LHGA 2VIXA 2DT7B 4B09A 4ZDLA 3CCSI 1LNWA 1X1PA 2XF5A 2QCOA 4XKWA 3PNYA 2DYSH 4ABZA 3GTLJ 1TQPA 3HIFA 2JRMA 3H92A 4JP0A 1WQ2A 1EA3A 2K9MA 3PIPF 2I5UA 2DOEA 1YX3A 1TT5B 2IT0A 1AA7A 1J2XA 1G3SA 2EBIA 1QZYA 4MFDA 4E7JA 1SANA 2R5YB 1I1SA 4D5CA 3RKXA 2D5VA 1KU3A 5E8IA 1BM9A 5J1UA 4A12A 3VYTB 2GOXB 2R7VA 1OQYA 2L54A 4IX7A 3M3YJ 4UNOA 2H6CA 1ORKA 3HOTA 2O9LA 4I2OA 4XR6A 3OYHA 1D8KA 2V1NA 2V1XA 1T95A 4DYQA 3UKGA 3HOUJ 3MD2A 4GDFA 3SXYA 1Y1WJ 2LREA 2XVCA 2LBFB 3MZ8A 4I6ZA 3R6SA 3O3KA 3LSMA 4HBLA 2ECBA 3PSFA 2K4BA 4G12A 2W85A 4HOBA 1MKMA 1OR7A 4RGUA 2XSDC 4PSXA 1YITI 3DBRB 3R0AA 5KAFC 1W1WE 1LFUP 4HNVA 1D5YA 2NS7A 1KU9A 2DOAA 3LQQA 3OYMA 5BPDA 2TCTA 1WRJA 2JA5J 3GLXA 2P7CB 5GPCA 1A6QA 2XSJC 5ILVA 4WCGA 5BPIA 1V3FA 2ZSHB 2DI3A 1TLHB 2CS3A 4NHJA 4KA4A 1Z67A 2O8KA 1K61A 1HF0A 4N0BA 2D45A 3LFUA 2YSRA 1S72I 3DPLC 4AVZA 2COMA 2XHKA 2Y30A 3F8MA 5DD8A 2WB1A 4XLNF 4RB2C 5FB2A 3FXMA 1U6GA 3W6JB 1BJAA 4BBRJ 1IXRC 2KFDA 4AIKA 3DEUA 4IJAA 6PAXA 2R7QA 4L5IA 5E1ZB 1XMAA 2E35A 2KKOA 1QGPA 3S93A 4BS9A 2ME0A 3BR6A 2DW4A 1X3ZB 5DYMA 3U2RA 3SZTA 1FT9A 2YPRA 1LFPA 4BE2A 3EYIA 4ZDOA 4QPQA 2RV8A 4A3DJ 3JR9A 1LVKA 2QF7A 2XDVA 2LG4A 4W1UA 4EJVA 3EYYA 4P5OA 2P5VA 3CC2I 1ERDA 1R1TA 4NC8A 1ZGWA 2DMNA 2G0EA 2KT0A 1BI3A 5JR3A 2FJ1A 3S17J 1JUMA 4MGRA 2XAGA 1TWGJ 1YIJI 3LSKA 2HWVA 1YTYA 2JA7J 2ZMEA 4JX5A 3Q3SA 4M3EA 4A0XA 3K9TA 4PSWA 3S16J 2E71A 2Q2EA 3CMMA 3Q9VA 2CJJA 4IVNA 2E1NA 1WI9A 4Y17A 1JJ6C 5JVGF 3RSNA 3TL4X 1K4TA 2WV1A 4MTDA 1OCTC 2FMLA 1HW2A 2ISZA 1Y1VJ 4F7ZA 3H5AA 1TWFJ 2QGUA 5CQEA 5DCMB 5D8LB 3ZQGA 1YE9A 2Y75A 1UHMA 2AQEA 3K69A 2R7TA 5E20A 1BL0A 1ZG1A 3V8KA 1VTNC 3EUHC 4GFBA 4I09A 1P4AA 5J1RA 1ON1A 2QM3A 1UAAA 3I58A 2IS6A 4PGGA 3S3NA 4A6DA 4LFUA 3C1DA 1V5EA 4OIRF 4BXXJ 1LFBA 3LSHA 3G4SI 1QHHD 4RM3A 5B1AH 3QU6A 1JKOC 2EB7A 1FX7A 5A2QK 4A3IJ 2VPLA 1TZLA 4A3MJ 1CF7A 3KP5A 3G71I 2F4OB 1ZRFA 3GWZA 1G4DA 2X51A 3REOA 2HDWA 2HYFA 2IGOA 3OR1C 3FXRA 3TO7A 1G59A 2ZB9A 5H6QA 1KQ8A 1WSUA 1Z1DA 3FIWA 3RTRA 4E7LA 3CP2A 2MA3A 1XC5A 1PYVA 4G7OF 2DFEA 1I50J 4AWXB 1A36A 3M9AA 3FXOA 2V9PA 3LMMA 5J47A 1VQ4I 3C18A 1D5VA 2DT6A 2P4WA 2F5EA 2PMZN 5F27A 3J7AY 4YFNF 1ETKA 1ODDA 2EZHA 2CV2A 1OCCH 3OMYA 1R58A 4MQ9F 4HEA2 1WJCA 1POGA 1VQMI 1UFMA 4FHTA 1TW2A 4XOTA 4DZPA 1WH7A 3FXQA 4HAMA 1K79A 5KAIC 3HHGA 1Y0UA 3E1SA 3OYLA 3M8EA 4BHPA 1XX5A 1F4KA 1YRNB 3HB9A 3WODF 4G7ZF 2AXTC 4L9NA 1T2KA 1D0YA 2CG4A 1Y6IA 1T0FC 4WXCA 1S7OA 2MG4A 2M0CA 1AOYA 4EEFG 3PQKA 1MMGA 1OYIA 4CCNA 2VB6A 1A5JA 1SD7A 4KYWA 2GXAA 1E3HA 2M8EA 1PUFA 1Z6TA 1KA8A 4KMFA 3SHFA 2IRFG 4RA2A 5ICEA 1D3YA 2NVTJ 5GTIC 3JCUC 2EWNA 3TW7A 3N97A 1ZH5A 4KT6A 3I3LA 3WGHA 2XF6A 4IZZA 1H89C 1XCBA 3OS2A 3PIOF 4LLGF 5IP9J 2HQRA 2LKXA 5BOXA 2BY2A 2R7OA 2IJLA 3FDYA 1VQ7I 3EPZA 3F22A 1RR8C 3AG3H 3RPUD 3CCRI 1SD6A 3FMQA 3I56I 3SZGA 2FMYA 3FM3A 3BQZA 2V6CA 1AU7A 3LQRA 2JN6A 3MMYB 2EINH 4A3EJ 1ZYRF 2HXIA 1JTYA 2EFPA 2EZLA 2BGCA 1CQTA 4YIFA 4UVAA 1XTAA 4A93J 3K0LA 3MAJA 2JA2A 4AYBN 4XL9A 3H3VK 2LLKA 3E97A 2EQRA 2R0QC 4ENKA 4FE7A 1X1BA 5L3DA 4DBRA 1V54H 2FOWA 2X1DA 5EZHA 1EV7A 3G3ZA 3BZ6A 1H0MA 2KL4A 2HVSA 1SFUA 2B0LA 4UUTA 2ECCA 1HSJA 5K7HA 1LE8B 4CCMA 2XASA 2P5LC 2ESHA 2X85A 3VEPA 1P2FA 3LSTA 1ZR2A 2WADA 5ICCA 4PK4A 1YOVB 2CWEA 2MGQA 4Q48A 4Y13A 2OJED 1FOWA 4CYDA 3M8FA 3DPTA 3H9JA 2QZ8A 5CVRA 3KFWX 3RKQA 3JREA 2IW5A 1AKHA 3TDUC 1SEUA 1I1GA 2LY1A 2QQ9A 1ZARA 3R61A 3BR5A 5E3OA 1QBJA 2AXLA 4G6DA 2DJNA 1J5YA 5FFXA 3V7CA 2CQXA 4HPQA 2PBIA 4M9XA 4B3AA 3FKIJ 3WE2A 3NARA 4PJJA 1IUFA 4LD5A 2JPCA 3WHBA 4F52A 1MSFC 2R5ZB 3ZMTA 2E1CA 1T56A 4CICA 1KQ9A 1HDPA 2LFBA 2WAQN 1MMDA 2HPMA 4KUMA 3VSLA 1J75A 5TRDA 1XD7A 5FD6A 4M74A 4JQFA 4C2MJ 3HGYA 4MO7A 3JRHA 1YS6A 1MD0A 5IT9Z 2BYVE 3BCBA 1C0WA 2OZUA 1EF4A 2ZMEB 4LK1F 4A3KJ 3M7GA 1JKRC 1STZA 3G1LA 5LGNA 1K6OA 1A31A 5M5YJ 1DDNA 4P9UA 4NC7A 4DNCA 1TBXA 2P81A 2XUBA 3HUGA 3FMRA 4U87A 4WXHA 2R5YA 1IG7A 3HYIA 4UY8I 1MJ9A 4ITVA 1H9GA 3A0HC 3LA2A 2HU9A 2PLYA 3SDGA 3W2VA 4F93B 3X2QH 3F23A 5CVJA 2STTA 2BY0A 3BOQA 3CCMI 4A6EA 1JKPC 1T08B 2F5VA 1VQNI 3S1MJ 3NWSA 2XV4S 1GV5A 3BWGA 3DEEA 1YHQI 2DXIA 1FMWA 1SVOA 2DK8A 2E2HJ 1RR7A 5H20A 1Y56A 3D5RC 1OFCX 2E1MB 1UG2A 2PQ8A 2L5QA 3RCOA 5D5XB 5HDNA 2IS1A 3H3ZA 4CCOA 4CO8A 1W5SA 2VJJA 2LBFA 3NAUA 3HJEA 4L5EA 5ILUA 2KIMA 2KHMA 2HI3A 3AL0C 4L9VA 2F5DA 3OYNA 3W6VA 3BR3A 3QQAA 2L9NA 2DFFA 4KIGA 3FWEA 3SEZA 3MZYA 3HPHA 3BJAA 3CUOA 3RQ4A 3U9GA 3WTYC 2BY3A 1MIJA 1JUSA 2BEOA 2XAJA 2CUFA 3CF5F 4A3JJ 3AFHA 2UV1A 3C2BA 1YS7A 4MFEA 4N9HA 3A03A 4OU0A 4BKXA 1MZBA 2V26A 4GO1A 3I59B 3OOPA 4AC0A 5JLWA 4X6AJ 3F9KA 2FE3A 3FXJA 3PFYA 3HOSA 5D5WB 2CRGA 1CGPA 4BJTA 4F55A 3C7JA 4YELA 2LKPA 5F0CA 1FP2A 1BIAA 4MNUA 1OLTA 1R7JA 2X6YA 4R79A 4D5FA 3PUFA 3OYCA 4E7KA 4IKFA 1LEBA 1ETOA 4NUBA 1TQIA 1X1DA 3IAM2 3NRVA 5JI6A 3LA3A 1P7IA 3HRUA 3ZMVA 4AIHA 2IGNA 3OY9A 1IXCA 4AIDA 1MH3A 1FIPA 3BG6A 3GX4X 4NNJA 5EYRA 3S32A 4PZJA 2Y48A 4XNFA 5HLTA 2GXGA 3MVPA 3ZQLA 1PP7U 3QPLA 1IXSB 3BTCA 5EEGA 4B47A 2EZKA 2QKLB 4XOPA 1QA6A 5B1BH 5EGOB 3JRAA 4GCVA 3ROUA 1BC7C 1IRFA 5TISC 1MBKA 3WTVC 1P4XA 1NHAA 3VYSB 3ZN0A 3M1EA 1S7EA 3S1QJ 3HOVJ 3EUHA 2WB1N 1XSXA 1Z0XA 1DPUA 3AG4H 5FD5A 5HODA 5HDGA 2K7LA 1ON2A 1WVRA 1VQ9I 3I54A 5AIQA 4M6VA 3RDIA 4D7NA 1R36A 3CF2A 3F72A 2Z9OA 3S2DJ 2E5ZA 4EJUA 4ZYAA 2M1BA 2PFBA 2MLKA 4YG2F 2W00A 1LQ1A 5CQGA 4P9FA 2EA4A 4DYRA 4BBSJ 2BOLA 2KIUA 4EJOA 1T6SA 5HS9A 2MW8A 2R3SA 2XAFA 2X0LA 1FOYA 1MNMC 2ELJA 5DCMA 2E34A 3ABLH 1P6RA 5J40A 3NQOA 1DP7P 3EETA 2VBZA 4PFPA 3LSPA 1N77A 5B66C 2OCEA 1U0JA 3QAHA 2KIQA 2K02A 2L9SA 1ZN2A 3E5XA 3VDXA 3CCYA 4CZCA 2ZKZA 2EIKH 1IAWA 3ZXSA 1FWZA 2DYRH 2F48A 4QWQA 2KZVA 4D1QA 1UB9A 3C2GA 3W3CA 2LK2A 1RKTA 1MGTA 2DPUA 3FXUA 2LMDA 3L1PA 3LSRA 1R9TJ 2J5PA 1L0OC 2JSPA 4LIUA 3A01B 5L3EA 4ENNA 1G3TA 1ETXA 1T39A 1X4PA 2W82A 3EDPA 4M71A 4QLCU 4BY1J 2HS5A 2W57A 3KEQA 1WKMA 3KETA 5LRRA 5LBQA 4LB5A 2M87A 4LGWA 3KZZA 3FISA 4HNTA 3A1YA 1Z7UA 3R60A 5C3EJ 4I0BA 4LG0B 1XGNA 2L7ZA 1SMYF 4AU7A 4RB1A 1FZPB 5CVUA 3H5NA 3SZPA 4C30A 2XAHA 5DD4A 4BU2A 2UUZA 2DQLA 4EM1A 2RKHA 1VFCA 2NOGA 1T0FA 2BBYA 3OS0A 3J7AO 1NTCA 4IO9F 3OSGA 1LEAA 2D2WA 3G2BA 1OJLA 3IKTA 4RGSA 2RQPA 3ZP5A 4XN3A 5CPRB 2JJ7A 3MQ0A 3OYEA 1IN4A 4E7HA 2BW3B 3S2WA 3GFIA 1Z3XA 2Q0OA 3K2ZA 3A0BC 1U8RA 4BL0B 5IP7J 2HOAA 2JMWA 1FLIA 1YRNA 1SAXA 2GZWA 3RKWA 2CW0F 3WTXC 1BR2A 2LRDA 2M45A 2AS5F 1YIOA 4ETSA 5D5VB 5IOYA 5E1WA 2BHZA 5ICFA 2N8GA 3HC7A 2DK5A 4BDYA 4XRFA 1ZR4A 2A6EF 4YIIA 2K86A 2LY2A 2VC1A 1Z91A 4BDZA 3OYFA 5CVVA 2A07F 2L4MA 3JSOA 2DMQA 5GP9A 4LJZF 2VASA 5JHFA 2L0KA 4KT5C 4EQQA 5LHHA 1RIOH 3GTKJ 1J0RA 2L2OA 3K4LA 4HYEA 3HUGB 4HX8A 4MIMA 5GAHJ 1USSA 3GTJJ 2IS2A 4HW0A 4FISA 1J09A 3L2VA 2HR3A 3HZJA 5E3NA 2HGCA 4KN7X 4ZC3A 5AIPA 3JRCA 4NC6A 2F6CA 2W84A 3OIOA 4IL6C 4KDPA 1ZGAA 4IHWA 3IV5A 2QWWA 2AO9A 2Z2SB 3OYGA 1J59A 5C4JJ 5DTDA 4Z2YA 1BW6A 1Z77A 4XKBA 2Z99A 4KISA 1I39A 2K4JA 3QOEA 4DOZA 5HNFA 2QVOA 3GLLA 4HG2A 1I5ZA 1RKWA 1WCMJ 1G6NA 3CESA 3F3XA 4UV9A 5E79C 2H94A 1VQ6I 3E5UA 2G9WA 1Y8QB 1GVJA 2W48A 4ENJA 2BZTA 2DA1A 2A68F 3K1MA 2M5WA 4BQOA 3GTPJ 4OIOF 1W7PD 2KP6A 3I5UA 3MKZA 4H4KC 3OS1A 3GEZA 3HHHA 1VQ8I 4C3JJ 5AONA 1LDKB 2VQHA 4I01A 2P6SA 1USTA 3F8BA 1LUJB 1Y0NA 1XCVA 3IHUA 3CMEI 4FX4A 4LIVA 3VB2A 1W0TA 1LE8A 4A0ZA 3KX2A 3BTIA 1A6IA 2V9VA 2XAUA 2GA1A 3M1CA 3JRDA 3VODA 4ASNA 3Q5FA 3BC8A 4A69C 1D0ZA 2OD5A 1Z05A 1BI2A 2XC7A 5BS6A 1U5TB 2E5NA 1XG1A 4HZFA 5IPAA 1NH3A 3KPHA 2UWMA 3IWFA 2QA4I 2TRTA 3KEOA 2WAFA 1YI2I 4LLNA 1IDZA 1D0XA 2OF7A 5IP6A 4BEHB 4F91B 2CV0A 2OBPA 2P6TA 1JKQC 4J00A 5F08A 4TV7A 3HRSA 4LMYA 2R5ZA 2CYYA 1TP4A 5CVIA 2JWTA 3AG2H 5GADJ 1S6LA 2ZNZA 3B02A 5D6FA 2IAIA 2D1HA 3N05A 4FT8A 2XGEA 2OTLI 2XB5A 4BACA 3ZGKA 2VKEA 5DS9A 2ID3A 3KE2A 4XONA 2VPRA 4MEYF 3RPUA 1ETWA 3E7LA 2DDBA 1X2MA 1B6AA 1U5TC 2FU4A 1E3PA 5H2FC 1ENHA 4QIWN 1IN5A 3ZCOA 3K7AJ 3BZKA 2GIVA 2GQQA 4XKVA 4KIFA 3ZQFA 3L00A 2DN0A 2W4SA 4EV0A 1DUXC 4C2UA 1Q1VA 1WJBA 3CC4I 1JXSA 2H1LA 4OMZA 3GYHX 3HPGA 4JK1X 4MEXF 3DCFA 4G6QA 3P9IA 2XKPA 5JHUA 1W7PB 3QPSA 2F5FA 2EPFA 4P55A 1YG2A 1IRGA 2HYGD 3J80Z 3P5JA 1PJRA 2DJIA 5J4VA 3OIQA 2XPWA 2O03A 3BZCA 1HOMA 1LDDA 4CCKA 3WU2C 3CTAA 2KZGA 3CCJI 1K78B 2R7ZJ 2GM4A 3ZR8X 4HQEA 3LSGA 4KIBA 3F8NA 2IXSA 2HKXA 2F5CA 1BIBA 4HLXA 1SMTA 2NVQJ 2CSOA 1Q1HA 2R7UA 2UXNA 2KJCA 3RIRA 2H27A 5KVRA 2E2IJ 5L3FA 3JRGA 3J7ZI 3ZOBA 3DKWA 2MBFA 1HKSA 4IF4A 1XMKA 3S3OA 1O7FA 4XORA 1UHSA 3TEDA 3VSKA 1RC9A 4ZJZA 1E2XA 2A5YB 1MMSA 1BJZA 2O7OA 1PVEA 3H0GJ 3I59A 1FYLA 4EJTA 1GXPA 3U21A 2CW8A 3H36A 1H8AC 1G3WA 2VUMJ 2Y69H 5E3MA 5J4YA 1W36D 1YJWI 4XBFA 2K9NA 4E6KG 1ZKGA 2ID6A 1SVMA 2EV6A 3LSIA 3TP3A 4QTRA 3B6CA 2CMPA 2HQAA 1HA8A 4HF0A 2P0WA 1E3OC 1AWCA 4V2FA 2CQKA 1YYVA 3L2UA 2H09A 3E6BA 1U8BA 4L18B 1WJDA 4XLAA 2C6YA 2R93J 4ESJA 1R71A 2H8WA 3KP7A 3IL2A 3LWFA 4RAFA 1OCOH 1TT0A 4XRSG 2I10A 4CYCB 4KNYA 4FETA 5EGOA 4Y52J 5CYVA 4CSWA 2RDPA 5M5WJ 5FGMA 3WTZA 1JTXA 4FCYA 3W6KB 1YW9A 5HLGA 2DA2A 4Y3OA 4CCJA 5KNLA 2DA6A 2VQGA 2X9DA 3O6BB 2FRHA 4JOMA 1IGNA 4H0EA 4II2A 2AQFA 3ONQA 1F9NA 1V4RA 4M3GA 2MD5A 4BXUA 4M6YA 3ESWB 3CJQB 1HW5A 1W5TA 4D9JA 1IV6A 4RAZA 2NYXA 2VBXA 3LA7A 3PM1A 2R7WA 1U3EM 2WBMA 3FF5A 3V7SA 2DFHA 5LFAA 3BTJA 1YW8A 4B44A 2YR2A 3HTSB 2IA1A 5EDNA 1FBSA 2DA5A 1LPQA 4RB3C 1IN7A 2OU2A 2M8GX 4DYCA 1V5FA 3BG9A 3HKZA 1NK2P 1RI7A 2HDDA 4O5VA 4HX4A 2CGPA 2IBDA 2VBWA 1TWAJ 5HLHA 2LVSA 4YEJA 4PUSA 5FKNA 3BTLA 2PJPA 2OZ6A 5FRMA 3CMYA 1KU2A 1WZ2A 5DUIA 2IGMA 1GXQA 3I71A 4EVIA 1V5GA 2FXAA 2FOKA 2IPQX 3DQVC 5E3LA 1O3RA 2OQGA 4FE4A 2JQ7A 2VT2A 2K40A 1G3YA 1TL8A 4NQWB 3A01A 3UNGC 3C2HA 2YX4A 4FQGA 4X0GA 3CO6C 5L3BA 4PCQA 1OPCA 3DKYA 1QPMA 4I02A 5HDKA 1WPKA 3WTSC 3S2HJ 3RYPA 1FIAA 4B1RA 1B8IB 2MABA 3FZVA 5DCFA 2VKHA 4CH7A 3I4PA 4LG0A 2NVXJ 1ZELA 3I55I 4UUVA 1X1CA 3NWTA 2PG4A 4OOIA 2VQLA 1PDNC 1X1AA 2FF4A 3H9QA 5FKLA 3GBGA 1KONA 3ASOH 1W36C 1ZK8A 2A5WA 3HSEA 3SJMA 3KEYA 1JI8A 5K5OA 4M3BA 3ZQHA 5ED4A 3JRBA 2BVLA 5K5QA 1ZRDA 2ICWG 4RGXA 3VFZA 4EGYA 1B9MA 2LOOA 1UELB 3QOPA 2BW3A 3T0YA
chains in the Genus database with same CATH topology
2MC3A 1KQ0A 2RGVA 3IRQA 1D8JA 1TW3A 3KLNA 3DV8A 3CUQC 4ZYHA 2XAQA 3LAJA 3I64A 4U0WA 1SFXA 1FPQA 4ZH4F 3BPVA 1YQAA 4L0ZB 3JAMZ 2QENA 3T8TA 2XGXA 2R7FA 2O6GE 4M9ZA 2EK5A 5E17F 4M72A 2RN7A 4HV6A 3J80K 1R23A 3TO9A 2QQAA 2ADUA 3ISPA 4CXFA 2GA2A 2HTJA 5EEHA 5LEKA 4KMUX 2H6BA 1ZLKA 1FBUA 1R22A 1UHWA 1OKRA 1XB4A 5DDGA 4I7HA 5LHIA 4EM0B 3MCZA 2IVMA 5ILSA 1FYKA 2ZNYA 2CO5A 2WC2A 1B59A 1ZRCA 1XGMA 5LGUA 4S04A 1UCRA 1R1VA 3QPHA 2LDUA 4RB0A 2EA2A 1KYWA 4EGZA 2OA4A 2ELHA 1EH8A 5LLQA 1U5TA 3WTWC 3KLOA 4Y15A 3DXJF 1OYWA 2DQRA 5HOOA 3F6VA 3R0JA 4HDUA 3F8FA 4ZYEA 1BBYA 2FNPA 3BDDA 1U2WA 3RJPA 2GXBA 1S7AA 3GW2A 3RPQA 2NRAC 2EJRA 2YX7A 2E7WA 1XSDA 3KP2A 2ZXJA 2MLGA 2LNBA 2PI0A 2VOOA 1WWXA 3P9KA 4RGRA 2VXZA 4EM2A 3ZMDA 2UXXA 3IWZA 4HV5A 5J6XA 1JE8A 1W7PA 1B1BA 3BPXA 4A0YA 3SQNA 3LFKA 1R5GA 3RKYA 1IN8A 3FX3A 1S8NA 4IPAA 1I6XA 2FQ3A 3ABUA 1LVAA 1KGSA 4CGZA 3GUDA 1HW1A 1K78A 4IHSA 3L9FA 5L3GA 1QO0D 2J5OA 1LJ9A 4G94A 2VT3A 3PFIA 2RNJA 5D4RA 2LSOA 5IT3A 2F2EA 4U0YA 4Q4ZF 5DUKA 4LLLA 1BOAA 2KRFA 5CJ9A 4IXAA 3B73A 3RI4A 4R8HA 2O3FA 1FSHA 5A2QZ 1MDMB 1QZZA 4L5JA 3DP7A 3JTGA 1IW7F 1FSEA 2DO7A 4WF2A 2VN2A 3KZYA 2VE8A 2E7XA 5L3CA 3WTUC 4EJWA 3J81Z 2VC0A 3IKVA 5F1RA 1ZG5A 5IT9K 3GZ5A 1ONVA 3QPTA 1QQIA 4HQMA 2FBIA 3CDHA 2QYOA 2R7DA 4CHUA 1IN6A 1O3QA 4L9JA 4U88A 2W24A 4WXDA 3TQNA 3PQJA 4M73A 3HRMA 4B8XA 4YFKF 2MH9A 2V1UA 5HVQC 2A3SA 4G7HF 3GVAA 4K2EA 1B4AA 1YO5C 4Q47A 4WWCA 4L0YB 5HS8A 3QRFF 1XDSA 5BQTA 4UHTA 3KCCA 3ZN1A 1OMIA 4P96A 2GAUA 2VBYA 2DTRA 3E5QA 1JHHA 3D5LA 3ZMUA 3IRRA 3RYRA 4NQWA 3EQLF 3R4KA 1RNLA 4ENMA 3T1BA 2NNYA 5JFRA 3F6OA 3ECHA 1ZG3A 1KYZA 2G7HA 2DPDA 4UVCA 3CUQA 1TTYA 3N4MA 2CFXA 2WTEA 2ZBKA 3ZQ7A 2HKOA 5FLXZ 4BH9A 2A69F 4KICA 4IRIA 4HF2A 4I0AA 1KU7A 2LF7A 1TQMA 2WWYA 3C3WA 1E17A 3WU1B 2HZTA 1J7KA 1QNTA 1Z6RA 3CLOA 2QBYB 3Q9SA 2NS0A 3FHZA 3ZMZA 1FBQA 3I0TA 3CJNA 4UVBA 1PUEE 3D0SA 2XROA 4RS8A 4D0PA 2RVCA 3BJOA 4FX0A 4M9SA 1P4WA 5LEJA 1LDJA 5FO5A 2ZFWA 2YU3A 2HEOA 3V4GA 1ULYA 4AD9A 4ESBA 1HKTA 2PEXA 4IRGA 4A5NA 3IC7A 2KJBA 2JZYA 4IRHA 5J8FA 3TGNA 2HFHA 2NAZA 2P5KA 2Z33A 2DBBA 3WU0A 2L3DA 4HX7A 1FC3A 1REPC 3WGGA 2IA2A 4UV8A 3KP6A 3QU3A 2JSCA 3DFGA 3F8CA 4PDKA 4BYYA 4Q5SF 3ULQB 5ICGA 4OMYA 3ML6A 5F64A 3JSPA 4BHBA 2V1DA 2PN6A 4G9YA 2PMHA 5KK1A 1T98A 1ZREA 2Z5UA 3V8JA 2DLLA 2L4AA 2M30A 3T5XA 3T8RA 3GFJA 3L2CA 2IA0A 2DFIA 2QLZA 4G8XA 1O3SA 3J81K 4OINF 1X3UA 1FNNA 2PMUA 1XGOA 3QP6A 3ABTA 1YW7A 2QUFA 3TO6A 2HQNA 4XLPF 2EV5A 5D6EA 4PGHA 5F6FA 3ELKA 5HS7A 5D5UB 4U7BA 1SD4A 3KP4A 5J8CA 5LGTA 2RC4A 2XRNA 3P9CA 1OYYA 3L7WA 1XN7A 2JRTA 4L9TA 1TNSA 1RUNA 1HXDA 3K1PA 1ZHFA 3GF2A 4CDGA 2A6HF 3MWMA 3VOEA 1DPRA 2MH2A 2K27A 3K1NA 1O57A 2DU9A 3BP8A 4OIQF 2DAOA 4GYIA 2WV0A 2VONA 1O7LA 2STWA 1GHCA 4XSXF 2FEZA 3FMSA 1BI0A 1K7AA 5FLXK 3CUQB 4CZZA 5K5RA 5LRSA 4S05A 3TDZC 2ISYA 3TKYA 2W25A 1YFHA 1MDMA 1W4MA 3V7RA 2HDCA 4E70A 3I53A 2P7VB 3WE3A 1BC8C 1IZ1A 4ON0A 1R5HA 2V79A 2VODA 2Z3YA 5HLIA 1ZGJA 2JTVA 2EFNA 1MJBA 2O0YA 2KIFA 3BJ6A 3GFMA 4JBAA 1T38A 5D8KB 2JT1A 3HSFA 2BV6A 3MEXA 3HTUA 3MFKA 2ZCWA 2TDXA 2Q8KA 2FBHA 1MJAA 3L09A 5ERIA 3E3VA 3CO7C 1L3LA 2NNNA 3V8LA 1XGSA 4HLYA 2EFOA 1RUOA 2FNAA 4R1HA 5DV5A 5E18F 1BI1A 2GWRA 4ESFA 4XSZF 1ZAOA 3WGIA 2OQRA 4RAYA 1YLFA 4GXOA 1LB2A 1JHFA 1ZLJA 2ETHA 1F1ZA 2XKOA 3OV8A 2X4HA 2BE5F 2A61A 1FP1D 1HSTA 1HBXG 3NEUA 4U0VA 4A2UA 3BROA 4LK0F 4WX9A 1PP8F 4O3MA 1R1UA 3ERED 4HDVA 3H3UA 5K1YA 4GGGA 1JGSA 1P92A 1FOKA 1J9IA 4YFXF 2ACJA 1U78A 5FFZA 2JPBA 2LF8A 1CF7B 1BN5A 1O3TA 4M6XA 2D1VA 1XSVA 3ZMSA 2L01A 4MQVA 4AIJA 5D4SA 2QBYA 5E1XA 2ZO4A 5E8GA 4BQAA 4ZYDA 5CLSA 3TOAA 3COAC 2P8TA 1EH6A 3O2PE 3ZPLA 3JTHA 3JW4A 4MTEA 1S29A 1RZ4A 4O6JA 4GYGA 4U7DA 4I98B 3FM5A 4KN4X 3GFLA 2VOPA 3E6MA 1R00A 3F21A 2EFWA 3MZHA 3ECOA 3KP3A 2FSWA 4NB5A 3HRTA 1S3JA 4HA8A 2OAZA 4LB6B 3BY6A 2O61A 4EMSA 4BAYA 3WG9A 4ZZDA 5H6RA 4WK8F 3GO5A 2QQBA 3LAPA 2HTSA 2FA5A 2VE9A 4HF1A 2HOEA 1H9TA 3E6CC 3SFZA 1IF1A 4MHGA 2ESNA 2Y0MA 1HKQA 5BMZA 2IP2A 2XIGA 3U1DA 4AVPA 1B9NA 2FBKA 1TNTA 3DF8A 2ZJ2A 2L02A 1SD5A 4BNCA 3WTTC 1F5TA 1HQCA 3GZ6A 4BHCA 1EH7A 5TJJA 4ZZLA 2EFQA 3G73A 3AAFA 4KFCA 4A5MA 2O8XA 1SFEA 3E6DA 5JVTA 3TOBA 2EV0A 1I27A 1Z9CA 4OIPF 1A04A 3GXOA 4ZYGA 3QP5A 5DEQA 3HSRA 4IHTA 1IUYA 1FY7A 1XDUA 1FYMA 2G7UA 3P7NA 3JAMK 2UZKA 4UXNA 4N9IA 2DT5A 4DQ2A 5LHGA 4B09A 1LNWA 1TQPA 3HIFA 3H92A 1WQ2A 2IT0A 1J2XA 1G3SA 1QZYA 1I1SA 3RKXA 1KU3A 5E8IA 1BM9A 4A12A 2L54A 4UNOA 2H6CA 3HOTA 4I2OA 1D8KA 2V1XA 3SXYA 2XVCA 3R6SA 3O3KA 4HBLA 2K4BA 2W85A 4HOBA 1MKMA 1OR7A 4RGUA 3R0AA 1KU9A 3LQQA 5BPDA 1WRJA 3GLXA 2P7CB 5ILVA 4WCGA 5BPIA 1V3FA 2DI3A 1TLHB 4NHJA 4KA4A 4N0BA 2D45A 2YSRA 3DPLC 2COMA 2XHKA 3F8MA 5DD8A 4XLNF 4RB2C 5FB2A 1U6GA 3W6JB 1BJAA 1IXRC 4AIKA 3DEUA 4IJAA 6PAXA 4L5IA 5E1ZB 1XMAA 2KKOA 1QGPA 5DYMA 2DW4A 3U2RA 3SZTA 1FT9A 2YPRA 3EYIA 2RV8A 4EJVA 3EYYA 4P5OA 2P5VA 1R1TA 1BI3A 5JR3A 4MGRA 2XAGA 2HWVA 1YTYA 2ZMEA 4A0XA 3K9TA 2Q2EA 3Q9VA 4IVNA 2E1NA 1WI9A 4Y17A 4MTDA 2FMLA 1HW2A 2ISZA 4F7ZA 5DCMB 5D8LB 2Y75A 1UHMA 3K69A 5E20A 1ZG1A 3V8KA 1VTNC 4I09A 1P4AA 1ON1A 2QM3A 3I58A 4PGGA 4A6DA 4LFUA 3C1DA 4OIRF 3QU6A 2EB7A 1FX7A 5A2QK 1CF7A 3KP5A 1ZRFA 3GWZA 1G4DA 3REOA 2HYFA 3TO7A 3FXRA 5H6QA 1KQ8A 1WSUA 1Z1DA 3RTRA 2MA3A 4G7OF 4AWXB 3M9AA 3C18A 1D5VA 2P4WA 2F5EA 4YFNF 1ODDA 1R58A 4MQ9F 1UFMA 4FHTA 1TW2A 3FXQA 4HAMA 1K79A 3HHGA 1Y0UA 3M8EA 4BHPA 1F4KA 3WODF 4G7ZF 4L9NA 1T2KA 2CG4A 4WXCA 1S7OA 1AOYA 3PQKA 1OYIA 1SD7A 4KYWA 2M8EA 1Z6TA 1KA8A 4KMFA 3SHFA 2IRFG 5ICEA 1D3YA 2EWNA 3N97A 1ZH5A 3WGHA 1XCBA 4LLGF 2HQRA 5BOXA 2IJLA 3F22A 1SD6A 3FMQA 2FMYA 3FM3A 2V6CA 3LQRA 1ZYRF 2EFPA 2BGCA 4YIFA 4UVAA 3K0LA 3MAJA 3E97A 4ENKA 5L3DA 1EV7A 3G3ZA 3BZ6A 1H0MA 1SFUA 2B0LA 1HSJA 2XASA 2P5LC 2ESHA 3VEPA 1P2FA 3LSTA 5ICCA 2CWEA 4Q48A 4Y13A 4CYDA 3M8FA 3DPTA 2QZ8A 5CVRA 3KFWX 2IW5A 3TDUC 1I1GA 2QQ9A 1ZARA 3R61A 1QBJA 2AXLA 4G6DA 5FFXA 1J5YA 3V7CA 2PBIA 4M9XA 3WE2A 4LD5A 2JPCA 3ZMTA 2E1CA 4CICA 1KQ9A 4KUMA 1J75A 5TRDA 1XD7A 5FD6A 4M74A 4JQFA 1YS6A 1MD0A 5IT9Z 2BYVE 1C0WA 2OZUA 2ZMEB 4LK1F 3M7GA 1K6OA 1STZA 5LGNA 1DDNA 4P9UA 4DNCA 1TBXA 2XUBA 3HUGA 4WXHA 3FMRA 3HYIA 1MJ9A 1H9GA 3LA2A 2PLYA 3F23A 5CVJA 2STTA 3BOQA 4A6EA 2XV4S 3BWGA 2DK8A 5H20A 2PQ8A 5D5XB 5HDNA 3H3ZA 4CO8A 1W5SA 5ILUA 2KIMA 4L9VA 2F5DA 4KIGA 3FWEA 3MZYA 3BJAA 3CUOA 3U9GA 3WTYC 2BEOA 2XAJA 1YS7A 4N9HA 4OU0A 1MZBA 4GO1A 3I59B 3OOPA 2FE3A 3HOSA 5D5WB 1CGPA 3C7JA 2LKPA 1FP2A 1BIAA 4MNUA 1R7JA 4R79A 1LEBA 1TQIA 3NRVA 5JI6A 3LA3A 3HRUA 3ZMVA 4AIHA 1IXCA 3GX4X 4PZJA 2Y48A 2GXGA 1PP7U 1IXSB 5EEGA 4GCVA 3ROUA 1BC7C 1IRFA 3WTVC 1P4XA 1NHAA 3ZN0A 3M1EA 3EUHA 1XSXA 1DPUA 5FD5A 5HDGA 2K7LA 1ON2A 3I54A 5AIQA 3RDIA 1R36A 3F72A 2Z9OA 4EJUA 2M1BA 2PFBA 2MLKA 4YG2F 1LQ1A 4P9FA 2EA4A 2KIUA 4EJOA 1T6SA 5HS9A 2R3SA 2XAFA 2X0LA 5DCMA 1P6RA 3NQOA 1DP7P 3EETA 2VBZA 3QAHA 2K02A 1ZN2A 3E5XA 2ZKZA 1IAWA 1FWZA 4QWQA 1UB9A 1MGTA 2DPUA 3FXUA 2J5PA 1L0OC 5L3EA 4ENNA 1G3TA 1T39A 3EDPA 4M71A 4QLCU 2HS5A 2W57A 3KEQA 1WKMA 3KETA 5LRRA 5LBQA 4LB5A 2M87A 4LGWA 3KZZA 1Z7UA 3R60A 4I0BA 4LG0B 1XGNA 1SMYF 1FZPB 4RB1A 5CVUA 3SZPA 2XAHA 5DD4A 2DQLA 4EM1A 2RKHA 1T0FA 2BBYA 3J7AO 1LEAA 2D2WA 3IKTA 4RGSA 2RQPA 3ZP5A 3MQ0A 1IN4A 3S2WA 3GFIA 2Q0OA 3K2ZA 1U8RA 1FLIA 1SAXA 2GZWA 3RKWA 2CW0F 3WTXC 2M45A 2AS5F 1YIOA 4ETSA 5D5VB 5E1WA 5ICFA 2DK5A 4XRFA 2A6EF 4YIIA 2K86A 2VC1A 1Z91A 5CVVA 2A07F 2L4MA 3JSOA 4LJZF 1RIOH 4KT5C 4EQQA 5LHHA 1J0RA 4HYEA 4HX8A 1USSA 4HW0A 2HR3A 2HGCA 4KN7X 5AIPA 2W84A 4KDPA 1ZGAA 2QWWA 1J59A 4Z2YA 2Z99A 2K4JA 2QVOA 1I5ZA 1G6NA 3F3XA 4UV9A 2H94A 3E5UA 2G9WA 1GVJA 4ENJA 2A68F 3K1MA 2M5WA 4OIOF 1W7PD 3I5UA 3GEZA 3HHHA 5AONA 1LDKB 4I01A 2P6SA 1USTA 3F8BA 1XCVA 3IHUA 4FX4A 3VB2A 4A0ZA 2V9VA 2GA1A 3VODA 4ASNA 3Q5FA 2OD5A 1Z05A 1BI2A 5BS6A 1U5TB 4HZFA 2UWMA 3IWFA 3KEOA 4LLNA 2OBPA 2P6TA 4TV7A 3HRSA 4LMYA 2CYYA 5CVIA 1S6LA 2ZNZA 3B02A 5D6FA 2D1HA 4FT8A 3KE2A 4MEYF 3RPUA 1B6AA 1U5TC 2FU4A 1IN5A 2GIVA 2GQQA 4KIFA 3L00A 4EV0A 1DUXC 1JXSA 4OMZA 3GYHX 4JK1X 4MEXF 4G6QA 3P9IA 2XKPA 5JHUA 1W7PB 2F5FA 4P55A 1YG2A 1IRGA 2HYGD 3J80Z 2O03A 1LDDA 1K78B 3CTAA 4HQEA 4KIBA 3F8NA 2HKXA 2F5CA 1BIBA 4HLXA 1SMTA 2CSOA 1Q1HA 2UXNA 2KJCA 3RIRA 2H27A 5KVRA 5L3FA 3DKWA 2MBFA 1HKSA 4IF4A 1XMKA 1O7FA 1E2XA 2A5YB 3I59A 1FYLA 4EJTA 1GXPA 1G3WA 4XBFA 2EV6A 4HF0A 1AWCA 2CQKA 1YYVA 2H09A 3E6BA 4L18B 2C6YA 4ESJA 3KP7A 3IL2A 3LWFA 4KNYA 5CYVA 2RDPA 5FGMA 3WTZA 3W6KB 1YW9A 5HLGA 3O6BB 2FRHA 4H0EA 1F9NA 1V4RA 2MD5A 4BXUA 4M6YA 1HW5A 1W5TA 4RAZA 2NYXA 2VBXA 3LA7A 1U3EM 3FF5A 3V7SA 1YW8A 2YR2A 3HTSB 2IA1A 1FBSA 4RB3C 1IN7A 2OU2A 1RI7A 4O5VA 4HX4A 2CGPA 2VBWA 5HLHA 2PJPA 2OZ6A 1KU2A 5DUIA 1GXQA 3I71A 4EVIA 2FXAA 3DQVC 2FOKA 2IPQX 1O3RA 2OQGA 2VT2A 1G3YA 2YX4A 3CO6C 5L3BA 4PCQA 1OPCA 1QPMA 4I02A 5HDKA 3WTSC 3RYPA 3FZVA 5DCFA 3I4PA 4LG0A 4UUVA 2PG4A 4OOIA 1PDNC 2FF4A 3HSEA 5K5OA 5ED4A 5K5QA 1ZRDA 4RGXA 3VFZA 4EGYA 1B9MA 3QOPA 3T0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MC3 A;  1KQ0 A;  2RGV A;  3IRQ A;  1D8J A;  1TW3 A;  3KLN A;  3DV8 A;  3CUQ C;  4ZYH A;  2XAQ A;  3LAJ A;  3I64 A;  4U0W A;  1SFX A;  1FPQ A;  4ZH4 F;  3BPV A;  1YQA A;  4L0Z B;  3JAM Z;  2QEN A;  3T8T A;  2XGX A;  2R7F A;  2O6G E;  4M9Z A;  2EK5 A;  5E17 F;  4M72 A;  2RN7 A;  4HV6 A;  3J80 K;  1R23 A;  3TO9 A;  2QQA A;  2ADU A;  3ISP A;  4CXF A;  2GA2 A;  2HTJ A;  5EEH A;  5LEK A;  4KMU X;  2H6B A;  1ZLK A;  1FBU A;  1R22 A;  1UHW A;  1OKR A;  1XB4 A;  5DDG A;  4I7H A;  5LHI A;  4EM0 B;  3MCZ A;  2IVM A;  5ILS A;  1FYK A;  2ZNY A;  2CO5 A;  2WC2 A;  1B59 A;  1ZRC A;  1XGM A;  5LGU A;  4S04 A;  1UCR A;  1R1V A;  3QPH A;  2LDU A;  4RB0 A;  2EA2 A;  1KYW A;  4EGZ A;  2OA4 A;  2ELH A;  1EH8 A;  5LLQ A;  1U5T A;  3WTW C;  3KLO A;  4Y15 A;  3DXJ F;  1OYW A;  2DQR A;  5HOO A;  3F6V A;  3R0J A;  4HDU A;  3F8F A;  4ZYE A;  1BBY A;  2FNP A;  3BDD A;  1U2W A;  3RJP A;  2GXB A;  1S7A A;  3GW2 A;  3RPQ A;  2NRA C;  2EJR A;  2YX7 A;  2E7W A;  1XSD A;  3KP2 A;  2ZXJ A;  2MLG A;  2LNB A;  2PI0 A;  2VOO A;  1WWX A;  3P9K A;  4RGR A;  2VXZ A;  4EM2 A;  3ZMD A;  2UXX A;  3IWZ A;  4HV5 A;  5J6X A;  1JE8 A;  1W7P A;  1B1B A;  3BPX A;  4A0Y A;  3SQN A;  3LFK A;  1R5G A;  3RKY A;  1IN8 A;  3FX3 A;  1S8N A;  4IPA A;  1I6X A;  2FQ3 A;  3ABU A;  1LVA A;  1KGS A;  4CGZ A;  3GUD A;  1HW1 A;  1K78 A;  4IHS A;  3L9F A;  5L3G A;  1QO0 D;  2J5O A;  1LJ9 A;  4G94 A;  2VT3 A;  3PFI A;  2RNJ A;  5D4R A;  2LSO A;  5IT3 A;  2F2E A;  4U0Y A;  4Q4Z F;  5DUK A;  4LLL A;  1BOA A;  2KRF A;  5CJ9 A;  4IXA A;  3B73 A;  3RI4 A;  4R8H A;  2O3F A;  1FSH A;  5A2Q Z;  1MDM B;  1QZZ A;  4L5J A;  3DP7 A;  3JTG A;  1IW7 F;  1FSE A;  2DO7 A;  4WF2 A;  2VN2 A;  3KZY A;  2VE8 A;  2E7X A;  5L3C A;  3WTU C;  4EJW A;  3J81 Z;  2VC0 A;  3IKV A;  5F1R A;  1ZG5 A;  5IT9 K;  3GZ5 A;  1ONV A;  3QPT A;  1QQI A;  4HQM A;  2FBI A;  3CDH A;  2QYO A;  2R7D A;  4CHU A;  1IN6 A;  1O3Q A;  4L9J A;  4U88 A;  2W24 A;  4WXD A;  3TQN A;  3PQJ A;  4M73 A;  3HRM A;  4B8X A;  4YFK F;  2MH9 A;  2V1U A;  5HVQ C;  2A3S A;  4G7H F;  3GVA A;  4K2E A;  1B4A A;  1YO5 C;  4Q47 A;  4WWC A;  4L0Y B;  5HS8 A;  3QRF F;  1XDS A;  5BQT A;  4UHT A;  3KCC A;  3ZN1 A;  1OMI A;  4P96 A;  2GAU A;  2VBY A;  2DTR A;  3E5Q A;  1JHH A;  3D5L A;  3ZMU A;  3IRR A;  3RYR A;  4NQW A;  3EQL F;  3R4K A;  1RNL A;  4ENM A;  3T1B A;  2NNY A;  5JFR A;  3F6O A;  3ECH A;  1ZG3 A;  1KYZ A;  2G7H A;  2DPD A;  4UVC A;  3CUQ A;  1TTY A;  3N4M A;  2CFX A;  2WTE A;  2ZBK A;  3ZQ7 A;  2HKO A;  5FLX Z;  4BH9 A;  2A69 F;  4KIC A;  4IRI A;  4HF2 A;  4I0A A;  1KU7 A;  2LF7 A;  1TQM A;  2WWY A;  3C3W A;  1E17 A;  3WU1 B;  2HZT A;  1J7K A;  1QNT A;  1Z6R A;  3CLO A;  2QBY B;  3Q9S A;  2NS0 A;  3FHZ A;  3ZMZ A;  1FBQ A;  3I0T A;  3CJN A;  4UVB A;  1PUE E;  3D0S A;  2XRO A;  4RS8 A;  4D0P A;  2RVC A;  3BJO A;  4FX0 A;  4M9S A;  1P4W A;  5LEJ A;  1LDJ A;  5FO5 A;  2ZFW A;  2YU3 A;  2HEO A;  3V4G A;  1ULY A;  4AD9 A;  4ESB A;  1HKT A;  2PEX A;  4IRG A;  4A5N A;  3IC7 A;  2KJB A;  2JZY A;  4IRH A;  5J8F A;  3TGN A;  2HFH A;  2NAZ A;  2P5K A;  2Z33 A;  2DBB A;  3WU0 A;  2L3D A;  4HX7 A;  1FC3 A;  1REP C;  3WGG A;  2IA2 A;  4UV8 A;  3KP6 A;  3QU3 A;  2JSC A;  3DFG A;  3F8C A;  4PDK A;  4BYY A;  4Q5S F;  3ULQ B;  5ICG A;  4OMY A;  3ML6 A;  5F64 A;  3JSP A;  4BHB A;  2V1D A;  2PN6 A;  4G9Y A;  2PMH A;  5KK1 A;  1T98 A;  1ZRE A;  2Z5U A;  3V8J A;  2DLL A;  2L4A A;  2M30 A;  3T5X A;  3T8R A;  3GFJ A;  3L2C A;  2IA0 A;  2DFI A;  2QLZ A;  4G8X A;  1O3S A;  3J81 K;  4OIN F;  1X3U A;  1FNN A;  2PMU A;  1XGO A;  3QP6 A;  3ABT A;  1YW7 A;  2QUF A;  3TO6 A;  2HQN A;  4XLP F;  2EV5 A;  5D6E A;  4PGH A;  5F6F A;  3ELK A;  5HS7 A;  5D5U B;  4U7B A;  1SD4 A;  3KP4 A;  5J8C A;  5LGT A;  2RC4 A;  2XRN A;  3P9C A;  1OYY A;  3L7W A;  1XN7 A;  2JRT A;  4L9T A;  1TNS A;  1RUN A;  1HXD A;  3K1P A;  1ZHF A;  3GF2 A;  4CDG A;  2A6H F;  3MWM A;  3VOE A;  1DPR A;  2MH2 A;  2K27 A;  3K1N A;  1O57 A;  2DU9 A;  3BP8 A;  4OIQ F;  2DAO A;  4GYI A;  2WV0 A;  2VON A;  1O7L A;  2STW A;  1GHC A;  4XSX F;  2FEZ A;  3FMS A;  1BI0 A;  1K7A A;  5FLX K;  3CUQ B;  4CZZ A;  5K5R A;  5LRS A;  4S05 A;  3TDZ C;  2ISY A;  3TKY A;  2W25 A;  1YFH A;  1MDM A;  1W4M A;  3V7R A;  2HDC A;  4E70 A;  3I53 A;  2P7V B;  3WE3 A;  1BC8 C;  1IZ1 A;  4ON0 A;  1R5H A;  2V79 A;  2VOD A;  2Z3Y A;  5HLI A;  1ZGJ A;  2JTV A;  2EFN A;  1MJB A;  2O0Y A;  2KIF A;  3BJ6 A;  3GFM A;  4JBA A;  1T38 A;  5D8K B;  2JT1 A;  3HSF A;  2BV6 A;  3MEX A;  3HTU A;  3MFK A;  2ZCW A;  2TDX A;  2Q8K A;  2FBH A;  1MJA A;  3L09 A;  5ERI A;  3E3V A;  3CO7 C;  1L3L A;  2NNN A;  3V8L A;  1XGS A;  4HLY A;  2EFO A;  1RUO A;  2FNA A;  4R1H A;  5DV5 A;  5E18 F;  1BI1 A;  2GWR A;  4ESF A;  4XSZ F;  1ZAO A;  3WGI A;  2OQR A;  4RAY A;  1YLF A;  4GXO A;  1LB2 A;  1JHF A;  1ZLJ A;  2ETH A;  1F1Z A;  2XKO A;  3OV8 A;  2X4H A;  2BE5 F;  2A61 A;  1FP1 D;  1HST A;  1HBX G;  3NEU A;  4U0V A;  4A2U A;  3BRO A;  4LK0 F;  4WX9 A;  1PP8 F;  4O3M A;  1R1U A;  3ERE D;  4HDV A;  3H3U A;  5K1Y A;  4GGG A;  1JGS A;  1P92 A;  1FOK A;  1J9I A;  4YFX F;  2ACJ A;  1U78 A;  5FFZ A;  2JPB A;  2LF8 A;  1CF7 B;  1BN5 A;  1O3T A;  4M6X A;  2D1V A;  1XSV A;  3ZMS A;  2L01 A;  4MQV A;  4AIJ A;  5D4S A;  2QBY A;  5E1X A;  2ZO4 A;  5E8G A;  4BQA A;  4ZYD A;  5CLS A;  3TOA A;  3COA C;  2P8T A;  1EH6 A;  3O2P E;  3ZPL A;  3JTH A;  3JW4 A;  4MTE A;  1S29 A;  1RZ4 A;  4O6J A;  4GYG A;  4U7D A;  4I98 B;  3FM5 A;  4KN4 X;  3GFL A;  2VOP A;  3E6M A;  1R00 A;  3F21 A;  2EFW A;  3MZH A;  3ECO A;  3KP3 A;  2FSW A;  4NB5 A;  3HRT A;  1S3J A;  4HA8 A;  2OAZ A;  4LB6 B;  3BY6 A;  2O61 A;  4EMS A;  4BAY A;  3WG9 A;  4ZZD A;  5H6R A;  4WK8 F;  3GO5 A;  2QQB A;  3LAP A;  2HTS A;  2FA5 A;  2VE9 A;  4HF1 A;  2HOE A;  1H9T A;  3E6C C;  3SFZ A;  1IF1 A;  4MHG A;  2ESN A;  2Y0M A;  1HKQ A;  5BMZ A;  2IP2 A;  2XIG A;  3U1D A;  4AVP A;  1B9N A;  2FBK A;  1TNT A;  3DF8 A;  2ZJ2 A;  2L02 A;  1SD5 A;  4BNC A;  3WTT C;  1F5T A;  1HQC A;  3GZ6 A;  4BHC A;  1EH7 A;  5TJJ A;  4ZZL A;  2EFQ A;  3G73 A;  3AAF A;  4KFC A;  4A5M A;  2O8X A;  1SFE A;  3E6D A;  5JVT A;  3TOB A;  2EV0 A;  1I27 A;  1Z9C A;  4OIP F;  1A04 A;  3GXO A;  4ZYG A;  3QP5 A;  5DEQ A;  3HSR A;  4IHT A;  1IUY A;  1FY7 A;  1XDU A;  1FYM A;  2G7U A;  3P7N A;  3JAM K;  2UZK A;  4UXN A;  4N9I A;  2DT5 A;  4DQ2 A;  5LHG A;  4B09 A;  1LNW A;  1TQP A;  3HIF A;  3H92 A;  1WQ2 A;  2IT0 A;  1J2X A;  1G3S A;  1QZY A;  1I1S A;  3RKX A;  1KU3 A;  5E8I A;  1BM9 A;  4A12 A;  2L54 A;  4UNO A;  2H6C A;  3HOT A;  4I2O A;  1D8K A;  2V1X A;  3SXY A;  2XVC A;  3R6S A;  3O3K A;  4HBL A;  2K4B A;  2W85 A;  4HOB A;  1MKM A;  1OR7 A;  4RGU A;  3R0A A;  1KU9 A;  3LQQ A;  5BPD A;  1WRJ A;  3GLX A;  2P7C B;  5ILV A;  4WCG A;  5BPI A;  1V3F A;  2DI3 A;  1TLH B;  4NHJ A;  4KA4 A;  4N0B A;  2D45 A;  2YSR A;  3DPL C;  2COM A;  2XHK A;  3F8M A;  5DD8 A;  4XLN F;  4RB2 C;  5FB2 A;  1U6G A;  3W6J B;  1BJA A;  1IXR C;  4AIK A;  3DEU A;  4IJA A;  6PAX A;  4L5I A;  5E1Z B;  1XMA A;  2KKO A;  1QGP A;  5DYM A;  2DW4 A;  3U2R A;  3SZT A;  1FT9 A;  2YPR A;  3EYI A;  2RV8 A;  4EJV A;  3EYY A;  4P5O A;  2P5V A;  1R1T A;  1BI3 A;  5JR3 A;  4MGR A;  2XAG A;  2HWV A;  1YTY A;  2ZME A;  4A0X A;  3K9T A;  2Q2E A;  3Q9V A;  4IVN A;  2E1N A;  1WI9 A;  4Y17 A;  4MTD A;  2FML A;  1HW2 A;  2ISZ A;  4F7Z A;  5DCM B;  5D8L B;  2Y75 A;  1UHM A;  3K69 A;  5E20 A;  1ZG1 A;  3V8K A;  1VTN C;  4I09 A;  1P4A A;  1ON1 A;  2QM3 A;  3I58 A;  4PGG A;  4A6D A;  4LFU A;  3C1D A;  4OIR F;  3QU6 A;  2EB7 A;  1FX7 A;  5A2Q K;  1CF7 A;  3KP5 A;  1ZRF A;  3GWZ A;  1G4D A;  3REO A;  2HYF A;  3TO7 A;  3FXR A;  5H6Q A;  1KQ8 A;  1WSU A;  1Z1D A;  3RTR A;  2MA3 A;  4G7O F;  4AWX B;  3M9A A;  3C18 A;  1D5V A;  2P4W A;  2F5E A;  4YFN F;  1ODD A;  1R58 A;  4MQ9 F;  1UFM A;  4FHT A;  1TW2 A;  3FXQ A;  4HAM A;  1K79 A;  3HHG A;  1Y0U A;  3M8E A;  4BHP A;  1F4K A;  3WOD F;  4G7Z F;  4L9N A;  1T2K A;  2CG4 A;  4WXC A;  1S7O A;  1AOY A;  3PQK A;  1OYI A;  1SD7 A;  4KYW A;  2M8E A;  1Z6T A;  1KA8 A;  4KMF A;  3SHF A;  2IRF G;  5ICE A;  1D3Y A;  2EWN A;  3N97 A;  1ZH5 A;  3WGH A;  1XCB A;  4LLG F;  2HQR A;  5BOX A;  2IJL A;  3F22 A;  1SD6 A;  3FMQ A;  2FMY A;  3FM3 A;  2V6C A;  3LQR A;  1ZYR F;  2EFP A;  2BGC A;  4YIF A;  4UVA A;  3K0L A;  3MAJ A;  3E97 A;  4ENK A;  5L3D A;  1EV7 A;  3G3Z A;  3BZ6 A;  1H0M A;  1SFU A;  2B0L A;  1HSJ A;  2XAS A;  2P5L C;  2ESH A;  3VEP A;  1P2F A;  3LST A;  5ICC A;  2CWE A;  4Q48 A;  4Y13 A;  4CYD A;  3M8F A;  3DPT A;  2QZ8 A;  5CVR A;  3KFW X;  2IW5 A;  3TDU C;  1I1G A;  2QQ9 A;  1ZAR A;  3R61 A;  1QBJ A;  2AXL A;  4G6D A;  5FFX A;  1J5Y A;  3V7C A;  2PBI A;  4M9X A;  3WE2 A;  4LD5 A;  2JPC A;  3ZMT A;  2E1C A;  4CIC A;  1KQ9 A;  4KUM A;  1J75 A;  5TRD A;  1XD7 A;  5FD6 A;  4M74 A;  4JQF A;  1YS6 A;  1MD0 A;  5IT9 Z;  2BYV E;  1C0W A;  2OZU A;  2ZME B;  4LK1 F;  3M7G A;  1K6O A;  1STZ A;  5LGN A;  1DDN A;  4P9U A;  4DNC A;  1TBX A;  2XUB A;  3HUG A;  4WXH A;  3FMR A;  3HYI A;  1MJ9 A;  1H9G A;  3LA2 A;  2PLY A;  3F23 A;  5CVJ A;  2STT A;  3BOQ A;  4A6E A;  2XV4 S;  3BWG A;  2DK8 A;  5H20 A;  2PQ8 A;  5D5X B;  5HDN A;  3H3Z A;  4CO8 A;  1W5S A;  5ILU A;  2KIM A;  4L9V A;  2F5D A;  4KIG A;  3FWE A;  3MZY A;  3BJA A;  3CUO A;  3U9G A;  3WTY C;  2BEO A;  2XAJ A;  1YS7 A;  4N9H A;  4OU0 A;  1MZB A;  4GO1 A;  3I59 B;  3OOP A;  2FE3 A;  3HOS A;  5D5W B;  1CGP A;  3C7J A;  2LKP A;  1FP2 A;  1BIA A;  4MNU A;  1R7J A;  4R79 A;  1LEB A;  1TQI A;  3NRV A;  5JI6 A;  3LA3 A;  3HRU A;  3ZMV A;  4AIH A;  1IXC A;  3GX4 X;  4PZJ A;  2Y48 A;  2GXG A;  1PP7 U;  1IXS B;  5EEG A;  4GCV A;  3ROU A;  1BC7 C;  1IRF A;  3WTV C;  1P4X A;  1NHA A;  3ZN0 A;  3M1E A;  3EUH A;  1XSX A;  1DPU A;  5FD5 A;  5HDG A;  2K7L A;  1ON2 A;  3I54 A;  5AIQ A;  3RDI A;  1R36 A;  3F72 A;  2Z9O A;  4EJU A;  2M1B A;  2PFB A;  2MLK A;  4YG2 F;  1LQ1 A;  4P9F A;  2EA4 A;  2KIU A;  4EJO A;  1T6S A;  5HS9 A;  2R3S A;  2XAF A;  2X0L A;  5DCM A;  1P6R A;  3NQO A;  1DP7 P;  3EET A;  2VBZ A;  3QAH A;  2K02 A;  1ZN2 A;  3E5X A;  2ZKZ A;  1IAW A;  1FWZ A;  4QWQ A;  1UB9 A;  1MGT A;  2DPU A;  3FXU A;  2J5P A;  1L0O C;  5L3E A;  4ENN A;  1G3T A;  1T39 A;  3EDP A;  4M71 A;  4QLC U;  2HS5 A;  2W57 A;  3KEQ A;  1WKM A;  3KET A;  5LRR A;  5LBQ A;  4LB5 A;  2M87 A;  4LGW A;  3KZZ A;  1Z7U A;  3R60 A;  4I0B A;  4LG0 B;  1XGN A;  1SMY F;  1FZP B;  4RB1 A;  5CVU A;  3SZP A;  2XAH A;  5DD4 A;  2DQL A;  4EM1 A;  2RKH A;  1T0F A;  2BBY A;  3J7A O;  1LEA A;  2D2W A;  3IKT A;  4RGS A;  2RQP A;  3ZP5 A;  3MQ0 A;  1IN4 A;  3S2W A;  3GFI A;  2Q0O A;  3K2Z A;  1U8R A;  1FLI A;  1SAX A;  2GZW A;  3RKW A;  2CW0 F;  3WTX C;  2M45 A;  2AS5 F;  1YIO A;  4ETS A;  5D5V B;  5E1W A;  5ICF A;  2DK5 A;  4XRF A;  2A6E F;  4YII A;  2K86 A;  2VC1 A;  1Z91 A;  5CVV A;  2A07 F;  2L4M A;  3JSO A;  4LJZ F;  1RIO H;  4KT5 C;  4EQQ A;  5LHH A;  1J0R A;  4HYE A;  4HX8 A;  1USS A;  4HW0 A;  2HR3 A;  2HGC A;  4KN7 X;  5AIP A;  2W84 A;  4KDP A;  1ZGA A;  2QWW A;  1J59 A;  4Z2Y A;  2Z99 A;  2K4J A;  2QVO A;  1I5Z A;  1G6N A;  3F3X A;  4UV9 A;  2H94 A;  3E5U A;  2G9W A;  1GVJ A;  4ENJ A;  2A68 F;  3K1M A;  2M5W A;  4OIO F;  1W7P D;  3I5U A;  3GEZ A;  3HHH A;  5AON A;  1LDK B;  4I01 A;  2P6S A;  1UST A;  3F8B A;  1XCV A;  3IHU A;  4FX4 A;  3VB2 A;  4A0Z A;  2V9V A;  2GA1 A;  3VOD A;  4ASN A;  3Q5F A;  2OD5 A;  1Z05 A;  1BI2 A;  5BS6 A;  1U5T B;  4HZF A;  2UWM A;  3IWF A;  3KEO A;  4LLN A;  2OBP A;  2P6T A;  4TV7 A;  3HRS A;  4LMY A;  2CYY A;  5CVI A;  1S6L A;  2ZNZ A;  3B02 A;  5D6F A;  2D1H A;  4FT8 A;  3KE2 A;  4MEY F;  3RPU A;  1B6A A;  1U5T C;  2FU4 A;  1IN5 A;  2GIV A;  2GQQ A;  4KIF A;  3L00 A;  4EV0 A;  1DUX C;  1JXS A;  4OMZ A;  3GYH X;  4JK1 X;  4MEX F;  4G6Q A;  3P9I A;  2XKP A;  5JHU A;  1W7P B;  2F5F A;  4P55 A;  1YG2 A;  1IRG A;  2HYG D;  3J80 Z;  2O03 A;  1LDD A;  1K78 B;  3CTA A;  4HQE A;  4KIB A;  3F8N A;  2HKX A;  2F5C A;  1BIB A;  4HLX A;  1SMT A;  2CSO A;  1Q1H A;  2UXN A;  2KJC A;  3RIR A;  2H27 A;  5KVR A;  5L3F A;  3DKW A;  2MBF A;  1HKS A;  4IF4 A;  1XMK A;  1O7F A;  1E2X A;  2A5Y B;  3I59 A;  1FYL A;  4EJT A;  1GXP A;  1G3W A;  4XBF A;  2EV6 A;  4HF0 A;  1AWC A;  2CQK A;  1YYV A;  2H09 A;  3E6B A;  4L18 B;  2C6Y A;  4ESJ A;  3KP7 A;  3IL2 A;  3LWF A;  4KNY A;  5CYV A;  2RDP A;  5FGM A;  3WTZ A;  3W6K B;  1YW9 A;  5HLG A;  3O6B B;  2FRH A;  4H0E A;  1F9N A;  1V4R A;  2MD5 A;  4BXU A;  4M6Y A;  1HW5 A;  1W5T A;  4RAZ A;  2NYX A;  2VBX A;  3LA7 A;  1U3E M;  3FF5 A;  3V7S A;  1YW8 A;  2YR2 A;  3HTS B;  2IA1 A;  1FBS A;  4RB3 C;  1IN7 A;  2OU2 A;  1RI7 A;  4O5V A;  4HX4 A;  2CGP A;  2VBW A;  5HLH A;  2PJP A;  2OZ6 A;  1KU2 A;  5DUI A;  1GXQ A;  3I71 A;  4EVI A;  2FXA A;  3DQV C;  2FOK A;  2IPQ X;  1O3R A;  2OQG A;  2VT2 A;  1G3Y A;  2YX4 A;  3CO6 C;  5L3B A;  4PCQ A;  1OPC A;  1QPM A;  4I02 A;  5HDK A;  3WTS C;  3RYP A;  3FZV A;  5DCF A;  3I4P A;  4LG0 A;  4UUV A;  2PG4 A;  4OOI A;  1PDN C;  2FF4 A;  3HSE A;  5K5O A;  5ED4 A;  5K5Q A;  1ZRD A;  4RGX A;  3VFZ A;  4EGY A;  1B9M A;  3QOP A;  3T0Y A; 
#chains in the Genus database with same CATH topology
 2MC3 A;  2F4M B;  2ZFU A;  2ME6 A;  4IQJ A;  3IAS 2;  1KQ0 A;  4D7M A;  2IS4 A;  2RGV A;  4P1W A;  3IRQ A;  2M2E A;  1D8J A;  1IDY A;  1TW3 A;  2HXO A;  5F0H A;  3KLN A;  3DV8 A;  3IUO A;  3FBI B;  3FK6 A;  3CUQ C;  3IH4 A;  2XAQ A;  4BUP A;  4ZYH A;  3LAJ A;  3I64 A;  4BXF A;  3AKZ A;  4U0W A;  1SFX A;  5EJC A;  1FPQ A;  5F0F A;  4ZH4 F;  1DGR M;  2HVR A;  4RMN A;  2M7A A;  3BPV A;  1I3Q J;  1YQA A;  4L0Z B;  4HRI A;  2K9S A;  3JAM Z;  2QEN A;  2WAE A;  3T8T A;  4X1E A;  1WI3 A;  1Z3Y A;  3AL0 B;  1VZ0 A;  2XGX A;  3RQI A;  2R7F A;  2O6G E;  2LH9 A;  4J01 A;  4M9Z A;  2EK5 A;  5E17 F;  3CJT B;  3FXL A;  3TBI A;  4M72 A;  3CMA I;  2RN7 A;  4HV6 A;  3OYK A;  3J80 K;  1R23 A;  3M8J A;  2LR8 A;  2M9H A;  1GDT A;  2M4K A;  1QVT A;  2I8D A;  3TO9 A;  2L9V A;  2QQA A;  3CCV I;  2ADU A;  3ISP A;  4CXF A;  2GA2 A;  2HTJ A;  5EEH A;  1TWH J;  1VQK I;  2XF7 A;  1JUP A;  4RLQ A;  3KYC B;  5LEK A;  5GAG J;  3OYD A;  4KMU X;  2H6B A;  1ZLK A;  1LKX A;  1RRJ A;  1FBU A;  1R22 A;  1UHW A;  1OKR A;  1XB4 A;  2IGK A;  5DDG A;  2HNH A;  4I7H A;  5LHI A;  3PNT A;  4XLF A;  2OC6 A;  4EM0 B;  1QPI A;  3MCZ A;  3DTK A;  2IVM A;  5ILS A;  5F04 A;  4ANJ A;  1FYK A;  2ZNY A;  3VPR A;  2CO5 A;  4XLH A;  2WC2 A;  1B59 A;  3EUK L;  1ZRC A;  1XGM A;  1JGG A;  5LGU A;  4IHX A;  3I4N J;  4S04 A;  1S9H A;  1UCR A;  2E1O A;  1R1V A;  2CUE A;  3QPH A;  2LDU A;  5EG0 B;  4A3F J;  4RB0 A;  3B6A A;  1ZTR A;  2EA2 A;  2LYC A;  1KYW A;  1Z21 A;  2OA4 A;  2ELH A;  4B3X A;  4EGZ A;  4XLC A;  1EH8 A;  2ZSI B;  3FHN A;  3L2W A;  4UUS B;  5LLQ A;  2EIM H;  1FTZ A;  1U5T A;  1HLV A;  1MBE A;  3WTW C;  3KLO A;  1QVU A;  3DXJ F;  4Y15 A;  3GTG J;  5B3S H;  3J7Y J;  4BEH A;  1OYW A;  3QOD A;  3SEQ A;  2VJ5 A;  4C2T A;  2X48 A;  2DQR A;  1S5L C;  3OYI A;  5HOO A;  2QSH X;  3MKL A;  3F6V A;  3S1N J;  3R0J A;  4HDU A;  3S8P A;  5DM6 F;  4C9Y A;  3F8F A;  4ZYE A;  4Y33 A;  4C3I J;  1BBY A;  2FNP A;  3BDD A;  1U2W A;  2ZXI A;  3RJP A;  2Y0S A;  3HEF A;  1S7A A;  2GXB A;  3GW2 A;  4JYK A;  2CUJ A;  3RPQ A;  1R49 A;  2NRA C;  4C3H J;  3TW6 A;  2EJR A;  3CDI A;  1N78 A;  2QQ8 A;  2YX7 A;  2E7W A;  2R7R A;  1XSD A;  3KP2 A;  4Y4R A;  2HPI A;  2ZXJ A;  2MLG A;  2LNB A;  3FK7 A;  3K6G A;  3SYT A;  4XQF A;  2PI0 A;  2VOO A;  1MBG A;  1WWX A;  4HSR A;  3IH3 A;  3P9K A;  4DZJ A;  1DU0 A;  4RGR A;  1K83 J;  2BHY A;  2VXZ A;  4EM2 A;  4BQQ A;  3ZMD A;  2UXX A;  3IWZ A;  4HV5 A;  5J6X A;  1JE8 A;  2PJR A;  4PJM A;  1W7P A;  1B1B A;  3BPX A;  4A0Y A;  3MKW B;  1X58 A;  4S0H B;  1SFO J;  3GZN B;  3SQN A;  4BJ6 C;  3DWL E;  3LFK A;  1R5G A;  4BE0 A;  3RKY A;  1IN8 A;  1MNE A;  2A05 A;  1S8N A;  3FX3 A;  1IRX A;  1I6X A;  4IPA A;  2FQ3 A;  3ABU A;  1LVA A;  1KGS A;  5IYB J;  4UB6 C;  4CGZ A;  1RET A;  2VKV A;  3GUD A;  1HW1 A;  5KHD A;  2LKS A;  1K78 A;  4IHS A;  3G1O A;  3L9F A;  5L3G A;  1QO0 D;  2GBY A;  4QPO A;  2H8R A;  3QYF A;  4IEJ A;  2J5O A;  1D1A A;  1LJ9 A;  1B72 B;  4G94 A;  2CQ7 A;  2CQQ A;  4GRI A;  3CCU I;  5CKT A;  2KLO A;  2VT3 A;  2DA7 A;  2DDA A;  3PFI A;  2RNJ A;  1MND A;  1V55 H;  4I76 A;  5JLX A;  5D4R A;  2LSO A;  5IT3 A;  4F3Q A;  2F2E A;  4U0Y A;  4Q4Z F;  1BR1 A;  1M1E B;  3RZD J;  2AHQ A;  4XN0 A;  1OCR H;  5DUK A;  4LLL A;  1BOA A;  1EKE A;  2KRF A;  4DBQ A;  1IC8 A;  5CJ9 A;  4RLF A;  2CV1 A;  4IXA A;  3ABK H;  3H5R A;  3B73 A;  3RI4 A;  4R8H A;  3A02 A;  5TGT A;  1I6H J;  3VYR B;  3H9G A;  4DGW B;  1ETQ A;  1DU6 A;  2K85 A;  1SC7 A;  2O3F A;  1I3A A;  2VI6 A;  3BR2 A;  1FSH A;  5A2Q Z;  1MDM B;  5F1J A;  1QZZ A;  4L5J A;  4OAY A;  2R92 J;  3DP7 A;  3ZRG A;  3JTG A;  1WGX A;  1IW7 F;  1FSE A;  2DO7 A;  4WF2 A;  2VN2 A;  1VI0 A;  2WA0 A;  3IP4 B;  3KZY A;  2VE8 A;  2E7X A;  5L3C A;  3HG9 A;  3WTU C;  4EJW A;  3J81 Z;  2VC0 A;  3IKV A;  4W97 A;  5F1R A;  2KDO A;  1GV2 A;  4CYC A;  2RNG A;  9ANT A;  2H1K A;  1ZG5 A;  3M4O J;  2JVG A;  3GTO J;  5IT9 K;  3GZ5 A;  2HVQ A;  2ZJP F;  4IOA F;  1ONV A;  5K7F A;  1SFK A;  1QQI A;  3QPT A;  1A35 A;  1OCP A;  4HQM A;  2FBI A;  3CDH A;  2QYO A;  2R7D A;  3CZ6 A;  3S3M A;  2B9S A;  4CHU A;  1IN6 A;  2M34 A;  3DBH B;  1O3Q A;  4L9J A;  2MYS A;  4U88 A;  2W24 A;  2NOJ B;  1W0U A;  3CQZ J;  3DTI A;  3HXL A;  3G1M A;  4WXD A;  3I9V 2;  3TQN A;  3K70 D;  3PQJ A;  4M73 A;  3HRM A;  3LL7 A;  3Q0W A;  4B8X A;  4YFK F;  2MH9 A;  2V1U A;  5HVQ C;  2A3S A;  4G7H F;  2QEX I;  4JX4 A;  3GVA A;  4V19 K;  4K2E A;  1B4A A;  1YO5 C;  4Q47 A;  4WWC A;  3DLA A;  1IJW C;  4L0Y B;  5HS8 A;  5FJ8 J;  1BOB A;  2EIJ H;  2NXN B;  3QRF F;  1N75 A;  2DOD A;  3BQY A;  4RDU A;  1VND A;  3OIP A;  1XDS A;  3BG5 A;  5BQT A;  3PO3 J;  4UHT A;  2Z1D A;  3K4K A;  1WHU A;  4LG3 A;  3KCC A;  4BY7 J;  2W7N A;  3ZN1 A;  1OMI A;  2XGD A;  4P96 A;  2GAU A;  2VBY A;  2DTR A;  3E5Q A;  1XMX A;  3K10 A;  1JHH A;  3D5L A;  2E36 A;  2ZJR F;  5B5E C;  3ZMU A;  4XIC A;  3IRR A;  3RYR A;  4NQW A;  5FRO A;  1MBH A;  3EQL F;  2WY8 Q;  3S15 J;  3R4K A;  4PFO A;  1RNL A;  3PL8 A;  4ENM A;  2Q1Z B;  1B8I A;  3T1B A;  2NNY A;  1F43 A;  5JFR A;  3F6O A;  3EUA A;  4XM3 A;  4QSH A;  2NVY J;  4BGD A;  3ECH A;  1ZG3 A;  1KYZ A;  3GME A;  2G7H A;  2A6T A;  2QKM B;  3QWL A;  2DPD A;  4UVC A;  3CUQ A;  3HKZ N;  4XRM A;  2VJI A;  1JJ8 C;  1TTY A;  3BT9 A;  3N4M A;  2CFX A;  2WTE A;  3PJR A;  2XPV A;  2ZBK A;  2XB0 X;  2HKO A;  3ZQ7 A;  5FLX Z;  2JVH A;  2DTZ A;  3AG1 H;  1T33 A;  3F0C A;  4BH9 A;  2A69 F;  4KIC A;  4J19 A;  4IRI A;  4HF2 A;  4I0A A;  1KU7 A;  4V2G A;  2LF7 A;  1MBJ A;  1N25 A;  1R5I D;  1TQM A;  2WWY A;  3C3W A;  1E17 A;  3WU1 B;  2HZT A;  1J7K A;  4E4H A;  1YJN I;  2CU7 A;  1QNT A;  4PJN A;  1Z6R A;  2KRC A;  2QSF X;  4CCL A;  1P9Q C;  4XKC A;  3CLO A;  2QBY B;  2MSY A;  2VL8 A;  4DJA A;  3Q9S A;  4KIT B;  2NS0 A;  3FHZ A;  3ZMZ A;  4A3L J;  1FBQ A;  2DA4 A;  3I0T A;  1X2N A;  5EZG A;  2CH0 A;  2YS9 A;  3A4C A;  3WG7 H;  1K6Y A;  1MH4 A;  3CJN A;  4UVB A;  4XID A;  1PUE E;  3D0S A;  3PUB A;  1R4N B;  2XRO A;  4RS8 A;  3H35 A;  4D0P A;  2RVC A;  4EAT A;  3BJO A;  4FX0 A;  4II3 A;  1NG6 A;  4Y7N J;  4M9S A;  3ERM A;  1P4W A;  5LEJ A;  5J1Y A;  3HOX J;  1LDJ A;  2GOM A;  5FO5 A;  3BLY A;  3IH2 A;  3K70 C;  3L2R A;  2FUG 2;  2ZFW A;  2YU3 A;  2HEO A;  4JX6 A;  3V4G A;  1ULY A;  1BW5 A;  4AD9 A;  2PJR B;  4ESB A;  1ZQ3 P;  1ACI A;  2OPT A;  2R7S A;  1HKT A;  2PEX A;  4IRG A;  4A5N A;  3IC7 A;  2L7M P;  3TP0 A;  2KJB A;  2X6O A;  4ZDP A;  2L9R A;  2JZY A;  4RBO A;  4IRH A;  4IHV A;  5J8F A;  1IV8 A;  3TGN A;  2HFH A;  5DM7 F;  2M3A A;  2WY7 Q;  3HOY J;  2L7K A;  3DBL B;  3MKY B;  1UMQ A;  1X19 A;  2NAZ A;  2DA3 A;  2P5K A;  4XK4 A;  2Z33 A;  2LY9 A;  1FEX A;  2DBB A;  3WU0 A;  2L3D A;  4HX7 A;  2RAE A;  2X1E A;  1FC3 A;  1REP C;  3ASN H;  3WGG A;  2IA2 A;  3CDL A;  4UV8 A;  2LTP A;  3KP6 A;  1KZH A;  3OYB A;  3QU3 A;  2JSC A;  3DFG A;  3F8C A;  5K7Z A;  4PDK A;  4BYY A;  4Q5S F;  3ULQ B;  5ICG A;  4RAG A;  2Y9Z A;  4OMY A;  3W2W A;  1G2H A;  3ML6 A;  2X6X A;  1FMV A;  5F64 A;  3JSP A;  2EH3 A;  2PX9 A;  4UB8 C;  3BCA A;  4N4N B;  2BXZ A;  4BHB A;  2V1D A;  3LOC A;  2PN6 A;  4G9Y A;  5EG0 A;  2E2J J;  1D1C A;  2PMH A;  5KK1 A;  1T98 A;  1ZRE A;  1MSE C;  2VQC A;  2IEK A;  2Z5U A;  3V8J A;  2YU9 J;  2DLL A;  2L4A A;  2M30 A;  1WJ5 A;  3T5X A;  3T8R A;  4UUS A;  1BA5 A;  3GFJ A;  3L2C A;  2IA0 A;  2K9L A;  2DFI A;  4I99 C;  1G8X A;  2OCC H;  3CC7 I;  1WH5 A;  2QLZ A;  4NDL A;  3JRF A;  4G8X A;  1O3S A;  5IY5 H;  3J81 K;  4OIN F;  1TC3 C;  1X3U A;  1FNN A;  1SVL A;  2PMU A;  2E19 A;  1XGO A;  3QP6 A;  3ABT A;  1YW7 A;  2X1C A;  2QUF A;  3TO6 A;  2HQN A;  4XLP F;  1Y8R B;  2EV5 A;  5D6E A;  4G6T B;  4B43 A;  3WHC A;  4PGH A;  2KPM A;  5F6F A;  2DMP A;  3ELK A;  5GTH C;  5HS7 A;  3CCE I;  1YJ9 I;  5D5U B;  4U7B A;  1SD4 A;  3KP4 A;  5J8C A;  5LGT A;  2RC4 A;  1UG0 A;  4IQ4 A;  2W1O A;  2HOT A;  2LD5 A;  2RQQ A;  2XRN A;  3PNV A;  3DU6 A;  3P9C A;  2K9Q A;  1OYY A;  2HYJ A;  1WJF A;  3L7W A;  1XN7 A;  2E60 A;  5FKO A;  3JRI A;  4B48 A;  2JRT A;  3LSJ A;  4L9T A;  1TNS A;  1RUN A;  2JK3 A;  1IRZ A;  3BG3 A;  1HXD A;  1WFX A;  2X6W A;  3K1P A;  2GIZ A;  3E0J B;  4FTH A;  3CP8 A;  1SAU A;  3O8H A;  2V4J C;  2VLA A;  1ZHF A;  2XPU A;  3GF2 A;  2EZI A;  5M3F J;  4CDG A;  3SDB A;  3K4N A;  2Y0S N;  2A6H F;  2JUC A;  3DPU A;  3TMO A;  2FQ4 A;  2Y2Z A;  4BQN A;  3MWM A;  3PSI A;  3VOE A;  1F36 A;  1B72 A;  1MMN A;  2R4G A;  1DPR A;  2MH2 A;  2K27 A;  2K3P A;  3K1N A;  1FJL A;  1AHD P;  1O57 A;  2DU9 A;  3CJR B;  3BP8 A;  4OIQ F;  2DAO A;  4GYI A;  2Z16 A;  2WV0 A;  2VON A;  1O7L A;  2STW A;  1GHC A;  4XSX F;  1R6R A;  2FEZ A;  3FMS A;  1BI0 A;  3K4M A;  2JA6 J;  1JT6 A;  3OOU A;  1OIS A;  3HOZ J;  1K7A A;  2MFZ A;  5C44 J;  4MLO A;  5FLX K;  2MC4 A;  3CUQ B;  4CZZ A;  1UJ8 A;  5K5R A;  5LRS A;  4S05 A;  3TDZ C;  2KIS A;  5M5X J;  4HST A;  3Q0V A;  2ISY A;  3V42 A;  3TKY A;  2OV7 A;  2W25 A;  4XLE A;  1RES A;  1O4X A;  1YFH A;  1MDM A;  4A3C J;  1W4M A;  3V7R A;  2HDC A;  4E70 A;  3I53 A;  1E0E A;  3G6E I;  5HNH A;  3K4J A;  3ABM H;  2L7F P;  2P7V B;  5J3L A;  3WE3 A;  1BC8 C;  1VQL I;  1IZ1 A;  2ELK A;  4ON0 A;  3Q0U A;  3DEW A;  2FD5 A;  4PJL A;  2OTJ I;  3L2Q A;  1R5H A;  1OR7 C;  2V79 A;  1VQ5 I;  3GCM A;  2VOD A;  2Z3Y A;  2VKD A;  5HLI A;  1ZGJ A;  2KDZ A;  1VQP I;  2JTV A;  2YUS A;  2EFN A;  1MJB A;  2LP0 A;  2O0Y A;  2KIF A;  3BJ6 A;  2K5C A;  3GFM A;  4JBA A;  1T38 A;  5D8K B;  2JT1 A;  2Y9Y A;  3HSF A;  5FKK A;  3FBN B;  2BV6 A;  3UR3 C;  1RPW A;  2XRL A;  1K4S A;  3LNQ A;  2BY1 A;  3MEX A;  3DTE A;  3HTU A;  5IYC J;  3MFK A;  2ZCW A;  2TDX A;  3VYU B;  4M3F A;  2Q8K A;  2FBH A;  3VWB A;  1MJA A;  4XRS A;  4BJ5 C;  1VQO I;  3W2A A;  2XGC A;  3L09 A;  5ERI A;  2BVM A;  3E3V A;  4F92 B;  2F4I A;  3HL2 A;  3CO7 C;  1L3L A;  5KCM A;  2NNN A;  3V8L A;  1XGS A;  4HLY A;  2EFO A;  1RUO A;  2FNA A;  4R1H A;  5DV5 A;  5E18 F;  3K4B A;  4RM2 A;  3PO2 J;  1BI1 A;  3OL3 A;  1UZC A;  2GWR A;  4ESF A;  4IOC F;  2COB A;  3DU5 A;  1ZAO A;  4XSZ F;  3WGI A;  3KIO A;  1HC8 A;  2HOS A;  2OQR A;  4RAY A;  1YLF A;  2VJ4 A;  4GXO A;  4YRV A;  1GUU A;  1LB2 A;  3GTM J;  1JHF A;  4BE1 A;  1ZLJ A;  2Q2E B;  2ETH A;  1F1Z A;  2XKO A;  1QZE A;  3OV8 A;  2X4H A;  1MMA A;  1NG7 A;  3KYD B;  2BE5 F;  1U9O A;  4LOC A;  2A61 A;  1FP1 D;  1HST A;  3DLL F;  5LD2 C;  1HBX G;  2LC2 A;  3NEU A;  4U0V A;  1ETV A;  4A2U A;  3BRO A;  4B4C A;  1H88 C;  4LK0 F;  3K4C A;  3DKX A;  2R7X A;  4WX9 A;  3CLQ A;  2PMZ A;  1PP8 F;  3ZQI A;  2ZME C;  2JA8 J;  4O3M A;  1R1U A;  3ERE D;  1HDD C;  4HDV A;  3H3U A;  5K1Y A;  4GGG A;  1JGS A;  1R4M B;  1P92 A;  5EF6 A;  2CW7 A;  2DOF A;  3BR0 A;  3OR2 C;  3HM5 A;  3M07 A;  1DGW Y;  3RZO J;  3KYL A;  4KJZ A;  1XPX A;  1FOK A;  1J9I A;  1FTT A;  4N4O B;  4YFX F;  2V7F A;  2ACJ A;  1U78 A;  5FFZ A;  1ITY A;  4FAS D;  1QU3 A;  2JPB A;  2LF8 A;  5FLM J;  3QYB A;  1CF7 B;  1BN5 A;  1O3T A;  4M6X A;  2D1V A;  3H1C A;  1W5C C;  4OAZ A;  2E1M C;  1XSV A;  2CUZ A;  3ZMS A;  2L01 A;  2VXD A;  4MQV A;  3U1K A;  1QRY A;  1U9N A;  4AIJ A;  5D4S A;  3H0D A;  2QBY A;  5E1X A;  5FRN A;  4A3B J;  4M3D A;  2ZO4 A;  4XMY A;  1ETY A;  5FLV A;  1GLN A;  3ZQC A;  3QYE A;  5E8G A;  4BQA A;  3GTQ J;  4ZYD A;  3KZI C;  4LIT A;  1WJE A;  1VF9 A;  5CLS A;  1GT0 C;  2V6E A;  3TOA A;  3COA C;  3CCL I;  2P8T A;  5IYD J;  1EH6 A;  1D1B A;  3O2P E;  2DMU A;  5M3M J;  3MN2 A;  3A2K A;  3ZPL A;  1Z7L A;  2ZXH A;  3JTH A;  3JW4 A;  2KRH A;  4MTE A;  3CD6 I;  1S29 A;  1RZ4 A;  4O6J A;  1T8I A;  4GYG A;  1EJ9 A;  4U7D A;  3O8G A;  2K3F A;  2NS8 A;  5EEA A;  4E7I A;  5IOZ A;  4I98 B;  3FM5 A;  2B7E A;  4KN4 X;  4CUG A;  1QHG A;  2FX0 A;  3GFL A;  1IO2 A;  2VOP A;  3E6M A;  1R00 A;  3FXK A;  3OYA A;  3HGG A;  3F21 A;  2EFW A;  4CA0 A;  3MZH A;  2M0M A;  3ECO A;  3KP3 A;  2FSW A;  4AUX A;  2M7B A;  4IHY A;  4NB5 A;  3CCQ I;  3HRT A;  1S3J A;  2RRE A;  4E7Z A;  4HA8 A;  2OAZ A;  2JUG A;  4LB6 B;  4AYB A;  1PUF B;  1X4O A;  2M4G A;  3BY6 A;  4DW6 A;  2O61 A;  4EMS A;  2ZJQ F;  4BAY A;  4AM3 A;  3WG9 A;  4ZZD A;  5H6R A;  1HCR A;  1OCZ H;  4WK8 F;  3GO5 A;  2QQB A;  3OWT A;  1DP3 A;  3LAP A;  3K2A A;  2HQ5 A;  2HTS A;  2FA5 A;  2VE9 A;  3OYJ A;  5GAE J;  2CFO A;  4HF1 A;  1BR4 A;  2HOE A;  1H9T A;  2DCE A;  3D1N I;  3SFZ A;  3E6C C;  4E7S A;  4PJ0 C;  1IF1 A;  4MHG A;  4ZTJ A;  2Y0M A;  3BR1 A;  2ESN A;  2HZD A;  1HKQ A;  2EIL H;  3OL4 A;  5BMZ A;  2IP2 A;  2XIG A;  2DMT A;  3U1D A;  4AVP A;  1APL C;  5FKM A;  1NK3 P;  1B9N A;  2BXY A;  2FBK A;  1TNT A;  2MD0 A;  5BNG A;  3DF8 A;  2ZJ2 A;  2L02 A;  3HDD A;  5C4X J;  1JT0 A;  1SD5 A;  1DQU A;  4BNC A;  2NVU B;  3SFI A;  3WTT C;  1F5T A;  1HQC A;  4YIR X;  3I4M J;  3GZ6 A;  3HOW J;  1YX5 A;  4BHC A;  1EH7 A;  1MBF A;  3HBL A;  2OUM A;  5TJJ A;  4HNU A;  4ZZL A;  2EFQ A;  3G73 A;  3AAF A;  4KFC A;  4A5M A;  4DIQ A;  5GPA A;  1MW7 A;  2O8X A;  1SFE A;  3E6D A;  1P7J A;  2QSG X;  5JVT A;  3TOB A;  2WAQ A;  2EV0 A;  3ZQQ A;  1I27 A;  4ZTF A;  3OSF A;  2ZC2 A;  1XS9 A;  1Z9C A;  4OIP F;  1GVD A;  1A04 A;  3GXO A;  4ZYG A;  3D5S C;  2CQN A;  4OWR B;  3QP5 A;  3S1R J;  5DEQ A;  3S14 J;  2Y31 A;  2KMU A;  3HSR A;  3FKJ A;  4IHT A;  1IUY A;  1FY7 A;  1FOX A;  1XDU A;  1Y39 A;  2ZXW H;  1FYM A;  2G7U A;  3P7N A;  4NBQ A;  2B63 J;  2V9K A;  3JAM K;  1TWC J;  2O5R A;  2UZK A;  1X3W B;  3BG7 A;  1WJA A;  2KQR A;  4N9I A;  4UXN A;  1AKH B;  2DT5 A;  4A3G J;  2GLO A;  4DQ2 A;  4Z6Y A;  5LHG A;  2VIX A;  2DT7 B;  4B09 A;  4ZDL A;  3CCS I;  1LNW A;  1X1P A;  2XF5 A;  2QCO A;  4XKW A;  3PNY A;  2DYS H;  4ABZ A;  3GTL J;  1TQP A;  3HIF A;  2JRM A;  3H92 A;  4JP0 A;  1WQ2 A;  1EA3 A;  2K9M A;  3PIP F;  2I5U A;  2DOE A;  1YX3 A;  1TT5 B;  2IT0 A;  1AA7 A;  1J2X A;  1G3S A;  2EBI A;  1QZY A;  4MFD A;  4E7J A;  1SAN A;  2R5Y B;  1I1S A;  4D5C A;  3RKX A;  2D5V A;  1KU3 A;  5E8I A;  1BM9 A;  5J1U A;  4A12 A;  3VYT B;  2GOX B;  2R7V A;  1OQY A;  2L54 A;  4IX7 A;  3M3Y J;  4UNO A;  2H6C A;  1ORK A;  3HOT A;  2O9L A;  4I2O A;  4XR6 A;  3OYH A;  1D8K A;  2V1N A;  2V1X A;  1T95 A;  4DYQ A;  3UKG A;  3HOU J;  3MD2 A;  4GDF A;  3SXY A;  1Y1W J;  2LRE A;  2XVC A;  2LBF B;  3MZ8 A;  4I6Z A;  3R6S A;  3O3K A;  3LSM A;  4HBL A;  2ECB A;  3PSF A;  2K4B A;  4G12 A;  2W85 A;  4HOB A;  1MKM A;  1OR7 A;  4RGU A;  2XSD C;  4PSX A;  1YIT I;  3DBR B;  3R0A A;  5KAF C;  1W1W E;  1LFU P;  4HNV A;  1D5Y A;  2NS7 A;  1KU9 A;  2DOA A;  3LQQ A;  3OYM A;  5BPD A;  2TCT A;  1WRJ A;  2JA5 J;  3GLX A;  2P7C B;  5GPC A;  1A6Q A;  2XSJ C;  5ILV A;  4WCG A;  5BPI A;  1V3F A;  2ZSH B;  2DI3 A;  1TLH B;  2CS3 A;  4NHJ A;  4KA4 A;  1Z67 A;  2O8K A;  1K61 A;  1HF0 A;  4N0B A;  2D45 A;  3LFU A;  2YSR A;  1S72 I;  3DPL C;  4AVZ A;  2COM A;  2XHK A;  2Y30 A;  3F8M A;  5DD8 A;  2WB1 A;  4XLN F;  4RB2 C;  5FB2 A;  3FXM A;  1U6G A;  3W6J B;  1BJA A;  4BBR J;  1IXR C;  2KFD A;  4AIK A;  3DEU A;  4IJA A;  6PAX A;  2R7Q A;  4L5I A;  5E1Z B;  1XMA A;  2E35 A;  2KKO A;  1QGP A;  3S93 A;  4BS9 A;  2ME0 A;  3BR6 A;  2DW4 A;  1X3Z B;  5DYM A;  3U2R A;  3SZT A;  1FT9 A;  2YPR A;  1LFP A;  4BE2 A;  3EYI A;  4ZDO A;  4QPQ A;  2RV8 A;  4A3D J;  3JR9 A;  1LVK A;  2QF7 A;  2XDV A;  2LG4 A;  4W1U A;  4EJV A;  3EYY A;  4P5O A;  2P5V A;  3CC2 I;  1ERD A;  1R1T A;  4NC8 A;  1ZGW A;  2DMN A;  2G0E A;  2KT0 A;  1BI3 A;  5JR3 A;  2FJ1 A;  3S17 J;  1JUM A;  4MGR A;  2XAG A;  1TWG J;  1YIJ I;  3LSK A;  2HWV A;  1YTY A;  2JA7 J;  2ZME A;  4JX5 A;  3Q3S A;  4M3E A;  4A0X A;  3K9T A;  4PSW A;  3S16 J;  2E71 A;  2Q2E A;  3CMM A;  3Q9V A;  2CJJ A;  4IVN A;  2E1N A;  1WI9 A;  4Y17 A;  1JJ6 C;  5JVG F;  3RSN A;  3TL4 X;  1K4T A;  2WV1 A;  4MTD A;  1OCT C;  2FML A;  1HW2 A;  2ISZ A;  1Y1V J;  4F7Z A;  3H5A A;  1TWF J;  2QGU A;  5CQE A;  5DCM B;  5D8L B;  3ZQG A;  1YE9 A;  2Y75 A;  1UHM A;  2AQE A;  3K69 A;  2R7T A;  5E20 A;  1BL0 A;  1ZG1 A;  3V8K A;  1VTN C;  3EUH C;  4GFB A;  4I09 A;  1P4A A;  5J1R A;  1ON1 A;  2QM3 A;  1UAA A;  3I58 A;  2IS6 A;  4PGG A;  3S3N A;  4A6D A;  4LFU A;  3C1D A;  1V5E A;  4OIR F;  4BXX J;  1LFB A;  3LSH A;  3G4S I;  1QHH D;  4RM3 A;  5B1A H;  3QU6 A;  1JKO C;  2EB7 A;  1FX7 A;  5A2Q K;  4A3I J;  2VPL A;  1TZL A;  4A3M J;  1CF7 A;  3KP5 A;  3G71 I;  2F4O B;  1ZRF A;  3GWZ A;  1G4D A;  2X51 A;  3REO A;  2HDW A;  2HYF A;  2IGO A;  3OR1 C;  3FXR A;  3TO7 A;  1G59 A;  2ZB9 A;  5H6Q A;  1KQ8 A;  1WSU A;  1Z1D A;  3FIW A;  3RTR A;  4E7L A;  3CP2 A;  2MA3 A;  1XC5 A;  1PYV A;  4G7O F;  2DFE A;  1I50 J;  4AWX B;  1A36 A;  3M9A A;  3FXO A;  2V9P A;  3LMM A;  5J47 A;  1VQ4 I;  3C18 A;  1D5V A;  2DT6 A;  2P4W A;  2F5E A;  2PMZ N;  5F27 A;  3J7A Y;  4YFN F;  1ETK A;  1ODD A;  2EZH A;  2CV2 A;  1OCC H;  3OMY A;  1R58 A;  4MQ9 F;  4HEA 2;  1WJC A;  1POG A;  1VQM I;  1UFM A;  4FHT A;  1TW2 A;  4XOT A;  4DZP A;  1WH7 A;  3FXQ A;  4HAM A;  1K79 A;  5KAI C;  3HHG A;  1Y0U A;  3E1S A;  3OYL A;  3M8E A;  4BHP A;  1XX5 A;  1F4K A;  1YRN B;  3HB9 A;  3WOD F;  4G7Z F;  2AXT C;  4L9N A;  1T2K A;  1D0Y A;  2CG4 A;  1Y6I A;  1T0F C;  4WXC A;  1S7O A;  2MG4 A;  2M0C A;  1AOY A;  4EEF G;  3PQK A;  1MMG A;  1OYI A;  4CCN A;  2VB6 A;  1A5J A;  1SD7 A;  4KYW A;  2GXA A;  1E3H A;  2M8E A;  1PUF A;  1Z6T A;  1KA8 A;  4KMF A;  3SHF A;  2IRF G;  4RA2 A;  5ICE A;  1D3Y A;  2NVT J;  5GTI C;  3JCU C;  2EWN A;  3TW7 A;  3N97 A;  1ZH5 A;  4KT6 A;  3I3L A;  3WGH A;  2XF6 A;  4IZZ A;  1H89 C;  1XCB A;  3OS2 A;  3PIO F;  4LLG F;  5IP9 J;  2HQR A;  2LKX A;  5BOX A;  2BY2 A;  2R7O A;  2IJL A;  3FDY A;  1VQ7 I;  3EPZ A;  3F22 A;  1RR8 C;  3AG3 H;  3RPU D;  3CCR I;  1SD6 A;  3FMQ A;  3I56 I;  3SZG A;  2FMY A;  3FM3 A;  3BQZ A;  2V6C A;  1AU7 A;  3LQR A;  2JN6 A;  3MMY B;  2EIN H;  4A3E J;  1ZYR F;  2HXI A;  1JTY A;  2EFP A;  2EZL A;  2BGC A;  1CQT A;  4YIF A;  4UVA A;  1XTA A;  4A93 J;  3K0L A;  3MAJ A;  2JA2 A;  4AYB N;  4XL9 A;  3H3V K;  2LLK A;  3E97 A;  2EQR A;  2R0Q C;  4ENK A;  4FE7 A;  1X1B A;  5L3D A;  4DBR A;  1V54 H;  2FOW A;  2X1D A;  5EZH A;  1EV7 A;  3G3Z A;  3BZ6 A;  1H0M A;  2KL4 A;  2HVS A;  1SFU A;  2B0L A;  4UUT A;  2ECC A;  1HSJ A;  5K7H A;  1LE8 B;  4CCM A;  2XAS A;  2P5L C;  2ESH A;  2X85 A;  3VEP A;  1P2F A;  3LST A;  1ZR2 A;  2WAD A;  5ICC A;  4PK4 A;  1YOV B;  2CWE A;  2MGQ A;  4Q48 A;  4Y13 A;  2OJE D;  1FOW A;  4CYD A;  3M8F A;  3DPT A;  3H9J A;  2QZ8 A;  5CVR A;  3KFW X;  3RKQ A;  3JRE A;  2IW5 A;  1AKH A;  3TDU C;  1SEU A;  1I1G A;  2LY1 A;  2QQ9 A;  1ZAR A;  3R61 A;  3BR5 A;  5E3O A;  1QBJ A;  2AXL A;  4G6D A;  2DJN A;  1J5Y A;  5FFX A;  3V7C A;  2CQX A;  4HPQ A;  2PBI A;  4M9X A;  4B3A A;  3FKI J;  3WE2 A;  3NAR A;  4PJJ A;  1IUF A;  4LD5 A;  2JPC A;  3WHB A;  4F52 A;  1MSF C;  2R5Z B;  3ZMT A;  2E1C A;  1T56 A;  4CIC A;  1KQ9 A;  1HDP A;  2LFB A;  2WAQ N;  1MMD A;  2HPM A;  4KUM A;  3VSL A;  1J75 A;  5TRD A;  1XD7 A;  5FD6 A;  4M74 A;  4JQF A;  4C2M J;  3HGY A;  4MO7 A;  3JRH A;  1YS6 A;  1MD0 A;  5IT9 Z;  2BYV E;  3BCB A;  1C0W A;  2OZU A;  1EF4 A;  2ZME B;  4LK1 F;  4A3K J;  3M7G A;  1JKR C;  1STZ A;  3G1L A;  5LGN A;  1K6O A;  1A31 A;  5M5Y J;  1DDN A;  4P9U A;  4NC7 A;  4DNC A;  1TBX A;  2P81 A;  2XUB A;  3HUG A;  3FMR A;  4U87 A;  4WXH A;  2R5Y A;  1IG7 A;  3HYI A;  4UY8 I;  1MJ9 A;  4ITV A;  1H9G A;  3A0H C;  3LA2 A;  2HU9 A;  2PLY A;  3SDG A;  3W2V A;  4F93 B;  3X2Q H;  3F23 A;  5CVJ A;  2STT A;  2BY0 A;  3BOQ A;  3CCM I;  4A6E A;  1JKP C;  1T08 B;  2F5V A;  1VQN I;  3S1M J;  3NWS A;  2XV4 S;  1GV5 A;  3BWG A;  3DEE A;  1YHQ I;  2DXI A;  1FMW A;  1SVO A;  2DK8 A;  2E2H J;  1RR7 A;  5H20 A;  1Y56 A;  3D5R C;  1OFC X;  2E1M B;  1UG2 A;  2PQ8 A;  2L5Q A;  3RCO A;  5D5X B;  5HDN A;  2IS1 A;  3H3Z A;  4CCO A;  4CO8 A;  1W5S A;  2VJJ A;  2LBF A;  3NAU A;  3HJE A;  4L5E A;  5ILU A;  2KIM A;  2KHM A;  2HI3 A;  3AL0 C;  4L9V A;  2F5D A;  3OYN A;  3W6V A;  3BR3 A;  3QQA A;  2L9N A;  2DFF A;  4KIG A;  3FWE A;  3SEZ A;  3MZY A;  3HPH A;  3BJA A;  3CUO A;  3RQ4 A;  3U9G A;  3WTY C;  2BY3 A;  1MIJ A;  1JUS A;  2BEO A;  2XAJ A;  2CUF A;  3CF5 F;  4A3J J;  3AFH A;  2UV1 A;  3C2B A;  1YS7 A;  4MFE A;  4N9H A;  3A03 A;  4OU0 A;  4BKX A;  1MZB A;  2V26 A;  4GO1 A;  3I59 B;  3OOP A;  4AC0 A;  5JLW A;  4X6A J;  3F9K A;  2FE3 A;  3FXJ A;  3PFY A;  3HOS A;  5D5W B;  2CRG A;  1CGP A;  4BJT A;  4F55 A;  3C7J A;  4YEL A;  2LKP A;  5F0C A;  1FP2 A;  1BIA A;  4MNU A;  1OLT A;  1R7J A;  2X6Y A;  4R79 A;  4D5F A;  3PUF A;  3OYC A;  4E7K A;  4IKF A;  1LEB A;  1ETO A;  4NUB A;  1TQI A;  1X1D A;  3IAM 2;  3NRV A;  5JI6 A;  3LA3 A;  1P7I A;  3HRU A;  3ZMV A;  4AIH A;  2IGN A;  3OY9 A;  1IXC A;  4AID A;  1MH3 A;  1FIP A;  3BG6 A;  3GX4 X;  4NNJ A;  5EYR A;  3S32 A;  4PZJ A;  2Y48 A;  4XNF A;  5HLT A;  2GXG A;  3MVP A;  3ZQL A;  1PP7 U;  3QPL A;  1IXS B;  3BTC A;  5EEG A;  4B47 A;  2EZK A;  2QKL B;  4XOP A;  1QA6 A;  5B1B H;  5EGO B;  3JRA A;  4GCV A;  3ROU A;  1BC7 C;  1IRF A;  5TIS C;  1MBK A;  3WTV C;  1P4X A;  1NHA A;  3VYS B;  3ZN0 A;  3M1E A;  1S7E A;  3S1Q J;  3HOV J;  3EUH A;  2WB1 N;  1XSX A;  1Z0X A;  1DPU A;  3AG4 H;  5FD5 A;  5HOD A;  5HDG A;  2K7L A;  1ON2 A;  1WVR A;  1VQ9 I;  3I54 A;  5AIQ A;  4M6V A;  3RDI A;  4D7N A;  1R36 A;  3CF2 A;  3F72 A;  2Z9O A;  3S2D J;  2E5Z A;  4EJU A;  4ZYA A;  2M1B A;  2PFB A;  2MLK A;  4YG2 F;  2W00 A;  1LQ1 A;  5CQG A;  4P9F A;  2EA4 A;  4DYR A;  4BBS J;  2BOL A;  2KIU A;  4EJO A;  1T6S A;  5HS9 A;  2MW8 A;  2R3S A;  2XAF A;  2X0L A;  1FOY A;  1MNM C;  2ELJ A;  5DCM A;  2E34 A;  3ABL H;  1P6R A;  5J40 A;  3NQO A;  1DP7 P;  3EET A;  2VBZ A;  4PFP A;  3LSP A;  1N77 A;  5B66 C;  2OCE A;  1U0J A;  3QAH A;  2KIQ A;  2K02 A;  2L9S A;  1ZN2 A;  3E5X A;  3VDX A;  3CCY A;  4CZC A;  2ZKZ A;  2EIK H;  1IAW A;  3ZXS A;  1FWZ A;  2DYR H;  2F48 A;  4QWQ A;  2KZV A;  4D1Q A;  1UB9 A;  3C2G A;  3W3C A;  2LK2 A;  1RKT A;  1MGT A;  2DPU A;  3FXU A;  2LMD A;  3L1P A;  3LSR A;  1R9T J;  2J5P A;  1L0O C;  2JSP A;  4LIU A;  3A01 B;  5L3E A;  4ENN A;  1G3T A;  1ETX A;  1T39 A;  1X4P A;  2W82 A;  3EDP A;  4M71 A;  4QLC U;  4BY1 J;  2HS5 A;  2W57 A;  3KEQ A;  1WKM A;  3KET A;  5LRR A;  5LBQ A;  4LB5 A;  2M87 A;  4LGW A;  3KZZ A;  3FIS A;  4HNT A;  3A1Y A;  1Z7U A;  3R60 A;  5C3E J;  4I0B A;  4LG0 B;  1XGN A;  2L7Z A;  1SMY F;  4AU7 A;  4RB1 A;  1FZP B;  5CVU A;  3H5N A;  3SZP A;  4C30 A;  2XAH A;  5DD4 A;  4BU2 A;  2UUZ A;  2DQL A;  4EM1 A;  2RKH A;  1VFC A;  2NOG A;  1T0F A;  2BBY A;  3OS0 A;  3J7A O;  1NTC A;  4IO9 F;  3OSG A;  1LEA A;  2D2W A;  3G2B A;  1OJL A;  3IKT A;  4RGS A;  2RQP A;  3ZP5 A;  4XN3 A;  5CPR B;  2JJ7 A;  3MQ0 A;  3OYE A;  1IN4 A;  4E7H A;  2BW3 B;  3S2W A;  3GFI A;  1Z3X A;  2Q0O A;  3K2Z A;  3A0B C;  1U8R A;  4BL0 B;  5IP7 J;  2HOA A;  2JMW A;  1FLI A;  1YRN A;  1SAX A;  2GZW A;  3RKW A;  2CW0 F;  3WTX C;  1BR2 A;  2LRD A;  2M45 A;  2AS5 F;  1YIO A;  4ETS A;  5D5V B;  5IOY A;  5E1W A;  2BHZ A;  5ICF A;  2N8G A;  3HC7 A;  2DK5 A;  4BDY A;  4XRF A;  1ZR4 A;  2A6E F;  4YII A;  2K86 A;  2LY2 A;  2VC1 A;  1Z91 A;  4BDZ A;  3OYF A;  5CVV A;  2A07 F;  2L4M A;  3JSO A;  2DMQ A;  5GP9 A;  4LJZ F;  2VAS A;  5JHF A;  2L0K A;  4KT5 C;  4EQQ A;  5LHH A;  1RIO H;  3GTK J;  1J0R A;  2L2O A;  3K4L A;  4HYE A;  3HUG B;  4HX8 A;  4MIM A;  5GAH J;  1USS A;  3GTJ J;  2IS2 A;  4HW0 A;  4FIS A;  1J09 A;  3L2V A;  2HR3 A;  3HZJ A;  5E3N A;  2HGC A;  4KN7 X;  4ZC3 A;  5AIP A;  3JRC A;  4NC6 A;  2F6C A;  2W84 A;  3OIO A;  4IL6 C;  4KDP A;  1ZGA A;  4IHW A;  3IV5 A;  2QWW A;  2AO9 A;  2Z2S B;  3OYG A;  1J59 A;  5C4J J;  5DTD A;  4Z2Y A;  1BW6 A;  1Z77 A;  4XKB A;  2Z99 A;  4KIS A;  1I39 A;  2K4J A;  3QOE A;  4DOZ A;  5HNF A;  2QVO A;  3GLL A;  4HG2 A;  1I5Z A;  1RKW A;  1WCM J;  1G6N A;  3CES A;  3F3X A;  4UV9 A;  5E79 C;  2H94 A;  1VQ6 I;  3E5U A;  2G9W A;  1Y8Q B;  1GVJ A;  2W48 A;  4ENJ A;  2BZT A;  2DA1 A;  2A68 F;  3K1M A;  2M5W A;  4BQO A;  3GTP J;  4OIO F;  1W7P D;  2KP6 A;  3I5U A;  3MKZ A;  4H4K C;  3OS1 A;  3GEZ A;  3HHH A;  1VQ8 I;  4C3J J;  5AON A;  1LDK B;  2VQH A;  4I01 A;  2P6S A;  1UST A;  3F8B A;  1LUJ B;  1Y0N A;  1XCV A;  3IHU A;  3CME I;  4FX4 A;  4LIV A;  3VB2 A;  1W0T A;  1LE8 A;  4A0Z A;  3KX2 A;  3BTI A;  1A6I A;  2V9V A;  2XAU A;  2GA1 A;  3M1C A;  3JRD A;  3VOD A;  4ASN A;  3Q5F A;  3BC8 A;  4A69 C;  1D0Z A;  2OD5 A;  1Z05 A;  1BI2 A;  2XC7 A;  5BS6 A;  1U5T B;  2E5N A;  1XG1 A;  4HZF A;  5IPA A;  1NH3 A;  3KPH A;  2UWM A;  3IWF A;  2QA4 I;  2TRT A;  3KEO A;  2WAF A;  1YI2 I;  4LLN A;  1IDZ A;  1D0X A;  2OF7 A;  5IP6 A;  4BEH B;  4F91 B;  2CV0 A;  2OBP A;  2P6T A;  1JKQ C;  4J00 A;  5F08 A;  4TV7 A;  3HRS A;  4LMY A;  2R5Z A;  2CYY A;  1TP4 A;  5CVI A;  2JWT A;  3AG2 H;  5GAD J;  1S6L A;  2ZNZ A;  3B02 A;  5D6F A;  2IAI A;  2D1H A;  3N05 A;  4FT8 A;  2XGE A;  2OTL I;  2XB5 A;  4BAC A;  3ZGK A;  2VKE A;  5DS9 A;  2ID3 A;  3KE2 A;  4XON A;  2VPR A;  4MEY F;  3RPU A;  1ETW A;  3E7L A;  2DDB A;  1X2M A;  1B6A A;  1U5T C;  2FU4 A;  1E3P A;  5H2F C;  1ENH A;  4QIW N;  1IN5 A;  3ZCO A;  3K7A J;  3BZK A;  2GIV A;  2GQQ A;  4XKV A;  4KIF A;  3ZQF A;  3L00 A;  2DN0 A;  2W4S A;  4EV0 A;  1DUX C;  4C2U A;  1Q1V A;  1WJB A;  3CC4 I;  1JXS A;  2H1L A;  4OMZ A;  3GYH X;  3HPG A;  4JK1 X;  4MEX F;  3DCF A;  4G6Q A;  3P9I A;  2XKP A;  5JHU A;  1W7P B;  3QPS A;  2F5F A;  2EPF A;  4P55 A;  1YG2 A;  1IRG A;  2HYG D;  3J80 Z;  3P5J A;  1PJR A;  2DJI A;  5J4V A;  3OIQ A;  2XPW A;  2O03 A;  3BZC A;  1HOM A;  1LDD A;  4CCK A;  3WU2 C;  3CTA A;  2KZG A;  3CCJ I;  1K78 B;  2R7Z J;  2GM4 A;  3ZR8 X;  4HQE A;  3LSG A;  4KIB A;  3F8N A;  2IXS A;  2HKX A;  2F5C A;  1BIB A;  4HLX A;  1SMT A;  2NVQ J;  2CSO A;  1Q1H A;  2R7U A;  2UXN A;  2KJC A;  3RIR A;  2H27 A;  5KVR A;  2E2I J;  5L3F A;  3JRG A;  3J7Z I;  3ZOB A;  3DKW A;  2MBF A;  1HKS A;  4IF4 A;  1XMK A;  3S3O A;  1O7F A;  4XOR A;  1UHS A;  3TED A;  3VSK A;  1RC9 A;  4ZJZ A;  1E2X A;  2A5Y B;  1MMS A;  1BJZ A;  2O7O A;  1PVE A;  3H0G J;  3I59 A;  1FYL A;  4EJT A;  1GXP A;  3U21 A;  2CW8 A;  3H36 A;  1H8A C;  1G3W A;  2VUM J;  2Y69 H;  5E3M A;  5J4Y A;  1W36 D;  1YJW I;  4XBF A;  2K9N A;  4E6K G;  1ZKG A;  2ID6 A;  1SVM A;  2EV6 A;  3LSI A;  3TP3 A;  4QTR A;  3B6C A;  2CMP A;  2HQA A;  1HA8 A;  4HF0 A;  2P0W A;  1E3O C;  1AWC A;  4V2F A;  2CQK A;  1YYV A;  3L2U A;  2H09 A;  3E6B A;  1U8B A;  4L18 B;  1WJD A;  4XLA A;  2C6Y A;  2R93 J;  4ESJ A;  1R71 A;  2H8W A;  3KP7 A;  3IL2 A;  3LWF A;  4RAF A;  1OCO H;  1TT0 A;  4XRS G;  2I10 A;  4CYC B;  4KNY A;  4FET A;  5EGO A;  4Y52 J;  5CYV A;  4CSW A;  2RDP A;  5M5W J;  5FGM A;  3WTZ A;  1JTX A;  4FCY A;  3W6K B;  1YW9 A;  5HLG A;  2DA2 A;  4Y3O A;  4CCJ A;  5KNL A;  2DA6 A;  2VQG A;  2X9D A;  3O6B B;  2FRH A;  4JOM A;  1IGN A;  4H0E A;  4II2 A;  2AQF A;  3ONQ A;  1F9N A;  1V4R A;  4M3G A;  2MD5 A;  4BXU A;  4M6Y A;  3ESW B;  3CJQ B;  1HW5 A;  1W5T A;  4D9J A;  1IV6 A;  4RAZ A;  2NYX A;  2VBX A;  3LA7 A;  3PM1 A;  2R7W A;  1U3E M;  2WBM A;  3FF5 A;  3V7S A;  2DFH A;  5LFA A;  3BTJ A;  1YW8 A;  4B44 A;  2YR2 A;  3HTS B;  2IA1 A;  5EDN A;  1FBS A;  2DA5 A;  1LPQ A;  4RB3 C;  1IN7 A;  2OU2 A;  2M8G X;  4DYC A;  1V5F A;  3BG9 A;  3HKZ A;  1NK2 P;  1RI7 A;  2HDD A;  4O5V A;  4HX4 A;  2CGP A;  2IBD A;  2VBW A;  1TWA J;  5HLH A;  2LVS A;  4YEJ A;  4PUS A;  5FKN A;  3BTL A;  2PJP A;  2OZ6 A;  5FRM A;  3CMY A;  1KU2 A;  1WZ2 A;  5DUI A;  2IGM A;  1GXQ A;  3I71 A;  4EVI A;  1V5G A;  2FXA A;  2FOK A;  2IPQ X;  3DQV C;  5E3L A;  1O3R A;  2OQG A;  4FE4 A;  2JQ7 A;  2VT2 A;  2K40 A;  1G3Y A;  1TL8 A;  4NQW B;  3A01 A;  3UNG C;  3C2H A;  2YX4 A;  4FQG A;  4X0G A;  3CO6 C;  5L3B A;  4PCQ A;  1OPC A;  3DKY A;  1QPM A;  4I02 A;  5HDK A;  1WPK A;  3WTS C;  3S2H J;  3RYP A;  1FIA A;  4B1R A;  1B8I B;  2MAB A;  3FZV A;  5DCF A;  2VKH A;  4CH7 A;  3I4P A;  4LG0 A;  2NVX J;  1ZEL A;  3I55 I;  4UUV A;  1X1C A;  3NWT A;  2PG4 A;  4OOI A;  2VQL A;  1PDN C;  1X1A A;  2FF4 A;  3H9Q A;  5FKL A;  3GBG A;  1KON A;  3ASO H;  1W36 C;  1ZK8 A;  2A5W A;  3HSE A;  3SJM A;  3KEY A;  1JI8 A;  5K5O A;  4M3B A;  3ZQH A;  5ED4 A;  3JRB A;  2BVL A;  5K5Q A;  1ZRD A;  2ICW G;  4RGX A;  3VFZ A;  4EGY A;  1B9M A;  2LOO A;  1UEL B;  3QOP A;  2BW3 A;  3T0Y A; 
#chains in the Genus database with same CATH homology
 2MC3 A;  1KQ0 A;  2RGV A;  3IRQ A;  1D8J A;  1TW3 A;  3KLN A;  3DV8 A;  3CUQ C;  4ZYH A;  2XAQ A;  3LAJ A;  3I64 A;  4U0W A;  1SFX A;  1FPQ A;  4ZH4 F;  3BPV A;  1YQA A;  4L0Z B;  3JAM Z;  2QEN A;  3T8T A;  2XGX A;  2R7F A;  2O6G E;  4M9Z A;  2EK5 A;  5E17 F;  4M72 A;  2RN7 A;  4HV6 A;  3J80 K;  1R23 A;  3TO9 A;  2QQA A;  2ADU A;  3ISP A;  4CXF A;  2GA2 A;  2HTJ A;  5EEH A;  5LEK A;  4KMU X;  2H6B A;  1ZLK A;  1FBU A;  1R22 A;  1UHW A;  1OKR A;  1XB4 A;  5DDG A;  4I7H A;  5LHI A;  4EM0 B;  3MCZ A;  2IVM A;  5ILS A;  1FYK A;  2ZNY A;  2CO5 A;  2WC2 A;  1B59 A;  1ZRC A;  1XGM A;  5LGU A;  4S04 A;  1UCR A;  1R1V A;  3QPH A;  2LDU A;  4RB0 A;  2EA2 A;  1KYW A;  4EGZ A;  2OA4 A;  2ELH A;  1EH8 A;  5LLQ A;  1U5T A;  3WTW C;  3KLO A;  4Y15 A;  3DXJ F;  1OYW A;  2DQR A;  5HOO A;  3F6V A;  3R0J A;  4HDU A;  3F8F A;  4ZYE A;  1BBY A;  2FNP A;  3BDD A;  1U2W A;  3RJP A;  2GXB A;  1S7A A;  3GW2 A;  3RPQ A;  2NRA C;  2EJR A;  2YX7 A;  2E7W A;  1XSD A;  3KP2 A;  2ZXJ A;  2MLG A;  2LNB A;  2PI0 A;  2VOO A;  1WWX A;  3P9K A;  4RGR A;  2VXZ A;  4EM2 A;  3ZMD A;  2UXX A;  3IWZ A;  4HV5 A;  5J6X A;  1JE8 A;  1W7P A;  1B1B A;  3BPX A;  4A0Y A;  3SQN A;  3LFK A;  1R5G A;  3RKY A;  1IN8 A;  3FX3 A;  1S8N A;  4IPA A;  1I6X A;  2FQ3 A;  3ABU A;  1LVA A;  1KGS A;  4CGZ A;  3GUD A;  1HW1 A;  1K78 A;  4IHS A;  3L9F A;  5L3G A;  1QO0 D;  2J5O A;  1LJ9 A;  4G94 A;  2VT3 A;  3PFI A;  2RNJ A;  5D4R A;  2LSO A;  5IT3 A;  2F2E A;  4U0Y A;  4Q4Z F;  5DUK A;  4LLL A;  1BOA A;  2KRF A;  5CJ9 A;  4IXA A;  3B73 A;  3RI4 A;  4R8H A;  2O3F A;  1FSH A;  5A2Q Z;  1MDM B;  1QZZ A;  4L5J A;  3DP7 A;  3JTG A;  1IW7 F;  1FSE A;  2DO7 A;  4WF2 A;  2VN2 A;  3KZY A;  2VE8 A;  2E7X A;  5L3C A;  3WTU C;  4EJW A;  3J81 Z;  2VC0 A;  3IKV A;  5F1R A;  1ZG5 A;  5IT9 K;  3GZ5 A;  1ONV A;  3QPT A;  1QQI A;  4HQM A;  2FBI A;  3CDH A;  2QYO A;  2R7D A;  4CHU A;  1IN6 A;  1O3Q A;  4L9J A;  4U88 A;  2W24 A;  4WXD A;  3TQN A;  3PQJ A;  4M73 A;  3HRM A;  4B8X A;  4YFK F;  2MH9 A;  2V1U A;  5HVQ C;  2A3S A;  4G7H F;  3GVA A;  4K2E A;  1B4A A;  1YO5 C;  4Q47 A;  4WWC A;  4L0Y B;  5HS8 A;  3QRF F;  1XDS A;  5BQT A;  4UHT A;  3KCC A;  3ZN1 A;  1OMI A;  4P96 A;  2GAU A;  2VBY A;  2DTR A;  3E5Q A;  1JHH A;  3D5L A;  3ZMU A;  3IRR A;  3RYR A;  4NQW A;  3EQL F;  3R4K A;  1RNL A;  4ENM A;  3T1B A;  2NNY A;  5JFR A;  3F6O A;  3ECH A;  1ZG3 A;  1KYZ A;  2G7H A;  2DPD A;  4UVC A;  3CUQ A;  1TTY A;  3N4M A;  2CFX A;  2WTE A;  2ZBK A;  3ZQ7 A;  2HKO A;  5FLX Z;  4BH9 A;  2A69 F;  4KIC A;  4IRI A;  4HF2 A;  4I0A A;  1KU7 A;  2LF7 A;  1TQM A;  2WWY A;  3C3W A;  1E17 A;  3WU1 B;  2HZT A;  1J7K A;  1QNT A;  1Z6R A;  3CLO A;  2QBY B;  3Q9S A;  2NS0 A;  3FHZ A;  3ZMZ A;  1FBQ A;  3I0T A;  3CJN A;  4UVB A;  1PUE E;  3D0S A;  2XRO A;  4RS8 A;  4D0P A;  2RVC A;  3BJO A;  4FX0 A;  4M9S A;  1P4W A;  5LEJ A;  1LDJ A;  5FO5 A;  2ZFW A;  2YU3 A;  2HEO A;  3V4G A;  1ULY A;  4AD9 A;  4ESB A;  1HKT A;  2PEX A;  4IRG A;  4A5N A;  3IC7 A;  2KJB A;  2JZY A;  4IRH A;  5J8F A;  3TGN A;  2HFH A;  2NAZ A;  2P5K A;  2Z33 A;  2DBB A;  3WU0 A;  2L3D A;  4HX7 A;  1FC3 A;  1REP C;  3WGG A;  2IA2 A;  4UV8 A;  3KP6 A;  3QU3 A;  2JSC A;  3DFG A;  3F8C A;  4PDK A;  4BYY A;  4Q5S F;  3ULQ B;  5ICG A;  4OMY A;  3ML6 A;  5F64 A;  3JSP A;  4BHB A;  2V1D A;  2PN6 A;  4G9Y A;  2PMH A;  5KK1 A;  1T98 A;  1ZRE A;  2Z5U A;  3V8J A;  2DLL A;  2L4A A;  2M30 A;  3T5X A;  3T8R A;  3GFJ A;  3L2C A;  2IA0 A;  2DFI A;  2QLZ A;  4G8X A;  1O3S A;  3J81 K;  4OIN F;  1X3U A;  1FNN A;  2PMU A;  1XGO A;  3QP6 A;  3ABT A;  1YW7 A;  2QUF A;  3TO6 A;  2HQN A;  4XLP F;  2EV5 A;  5D6E A;  4PGH A;  5F6F A;  3ELK A;  5HS7 A;  5D5U B;  4U7B A;  1SD4 A;  3KP4 A;  5J8C A;  5LGT A;  2RC4 A;  2XRN A;  3P9C A;  1OYY A;  3L7W A;  1XN7 A;  2JRT A;  4L9T A;  1TNS A;  1RUN A;  1HXD A;  3K1P A;  1ZHF A;  3GF2 A;  4CDG A;  2A6H F;  3MWM A;  3VOE A;  1DPR A;  2MH2 A;  2K27 A;  3K1N A;  1O57 A;  2DU9 A;  3BP8 A;  4OIQ F;  2DAO A;  4GYI A;  2WV0 A;  2VON A;  1O7L A;  2STW A;  1GHC A;  4XSX F;  2FEZ A;  3FMS A;  1BI0 A;  1K7A A;  5FLX K;  3CUQ B;  4CZZ A;  5K5R A;  5LRS A;  4S05 A;  3TDZ C;  2ISY A;  3TKY A;  2W25 A;  1YFH A;  1MDM A;  1W4M A;  3V7R A;  2HDC A;  4E70 A;  3I53 A;  2P7V B;  3WE3 A;  1BC8 C;  1IZ1 A;  4ON0 A;  1R5H A;  2V79 A;  2VOD A;  2Z3Y A;  5HLI A;  1ZGJ A;  2JTV A;  2EFN A;  1MJB A;  2O0Y A;  2KIF A;  3BJ6 A;  3GFM A;  4JBA A;  1T38 A;  5D8K B;  2JT1 A;  3HSF A;  2BV6 A;  3MEX A;  3HTU A;  3MFK A;  2ZCW A;  2TDX A;  2Q8K A;  2FBH A;  1MJA A;  3L09 A;  5ERI A;  3E3V A;  3CO7 C;  1L3L A;  2NNN A;  3V8L A;  1XGS A;  4HLY A;  2EFO A;  1RUO A;  2FNA A;  4R1H A;  5DV5 A;  5E18 F;  1BI1 A;  2GWR A;  4ESF A;  4XSZ F;  1ZAO A;  3WGI A;  2OQR A;  4RAY A;  1YLF A;  4GXO A;  1LB2 A;  1JHF A;  1ZLJ A;  2ETH A;  1F1Z A;  2XKO A;  3OV8 A;  2X4H A;  2BE5 F;  2A61 A;  1FP1 D;  1HST A;  1HBX G;  3NEU A;  4U0V A;  4A2U A;  3BRO A;  4LK0 F;  4WX9 A;  1PP8 F;  4O3M A;  1R1U A;  3ERE D;  4HDV A;  3H3U A;  5K1Y A;  4GGG A;  1JGS A;  1P92 A;  1FOK A;  1J9I A;  4YFX F;  2ACJ A;  1U78 A;  5FFZ A;  2JPB A;  2LF8 A;  1CF7 B;  1BN5 A;  1O3T A;  4M6X A;  2D1V A;  1XSV A;  3ZMS A;  2L01 A;  4MQV A;  4AIJ A;  5D4S A;  2QBY A;  5E1X A;  2ZO4 A;  5E8G A;  4BQA A;  4ZYD A;  5CLS A;  3TOA A;  3COA C;  2P8T A;  1EH6 A;  3O2P E;  3ZPL A;  3JTH A;  3JW4 A;  4MTE A;  1S29 A;  1RZ4 A;  4O6J A;  4GYG A;  4U7D A;  4I98 B;  3FM5 A;  4KN4 X;  3GFL A;  2VOP A;  3E6M A;  1R00 A;  3F21 A;  2EFW A;  3MZH A;  3ECO A;  3KP3 A;  2FSW A;  4NB5 A;  3HRT A;  1S3J A;  4HA8 A;  2OAZ A;  4LB6 B;  3BY6 A;  2O61 A;  4EMS A;  4BAY A;  3WG9 A;  4ZZD A;  5H6R A;  4WK8 F;  3GO5 A;  2QQB A;  3LAP A;  2HTS A;  2FA5 A;  2VE9 A;  4HF1 A;  2HOE A;  1H9T A;  3E6C C;  3SFZ A;  1IF1 A;  4MHG A;  2ESN A;  2Y0M A;  1HKQ A;  5BMZ A;  2IP2 A;  2XIG A;  3U1D A;  4AVP A;  1B9N A;  2FBK A;  1TNT A;  3DF8 A;  2ZJ2 A;  2L02 A;  1SD5 A;  4BNC A;  3WTT C;  1F5T A;  1HQC A;  3GZ6 A;  4BHC A;  1EH7 A;  5TJJ A;  4ZZL A;  2EFQ A;  3G73 A;  3AAF A;  4KFC A;  4A5M A;  2O8X A;  1SFE A;  3E6D A;  5JVT A;  3TOB A;  2EV0 A;  1I27 A;  1Z9C A;  4OIP F;  1A04 A;  3GXO A;  4ZYG A;  3QP5 A;  5DEQ A;  3HSR A;  4IHT A;  1IUY A;  1FY7 A;  1XDU A;  1FYM A;  2G7U A;  3P7N A;  3JAM K;  2UZK A;  4UXN A;  4N9I A;  2DT5 A;  4DQ2 A;  5LHG A;  4B09 A;  1LNW A;  1TQP A;  3HIF A;  3H92 A;  1WQ2 A;  2IT0 A;  1J2X A;  1G3S A;  1QZY A;  1I1S A;  3RKX A;  1KU3 A;  5E8I A;  1BM9 A;  4A12 A;  2L54 A;  4UNO A;  2H6C A;  3HOT A;  4I2O A;  1D8K A;  2V1X A;  3SXY A;  2XVC A;  3R6S A;  3O3K A;  4HBL A;  2K4B A;  2W85 A;  4HOB A;  1MKM A;  1OR7 A;  4RGU A;  3R0A A;  1KU9 A;  3LQQ A;  5BPD A;  1WRJ A;  3GLX A;  2P7C B;  5ILV A;  4WCG A;  5BPI A;  1V3F A;  2DI3 A;  1TLH B;  4NHJ A;  4KA4 A;  4N0B A;  2D45 A;  2YSR A;  3DPL C;  2COM A;  2XHK A;  3F8M A;  5DD8 A;  4XLN F;  4RB2 C;  5FB2 A;  1U6G A;  3W6J B;  1BJA A;  1IXR C;  4AIK A;  3DEU A;  4IJA A;  6PAX A;  4L5I A;  5E1Z B;  1XMA A;  2KKO A;  1QGP A;  5DYM A;  2DW4 A;  3U2R A;  3SZT A;  1FT9 A;  2YPR A;  3EYI A;  2RV8 A;  4EJV A;  3EYY A;  4P5O A;  2P5V A;  1R1T A;  1BI3 A;  5JR3 A;  4MGR A;  2XAG A;  2HWV A;  1YTY A;  2ZME A;  4A0X A;  3K9T A;  2Q2E A;  3Q9V A;  4IVN A;  2E1N A;  1WI9 A;  4Y17 A;  4MTD A;  2FML A;  1HW2 A;  2ISZ A;  4F7Z A;  5DCM B;  5D8L B;  2Y75 A;  1UHM A;  3K69 A;  5E20 A;  1ZG1 A;  3V8K A;  1VTN C;  4I09 A;  1P4A A;  1ON1 A;  2QM3 A;  3I58 A;  4PGG A;  4A6D A;  4LFU A;  3C1D A;  4OIR F;  3QU6 A;  2EB7 A;  1FX7 A;  5A2Q K;  1CF7 A;  3KP5 A;  1ZRF A;  3GWZ A;  1G4D A;  3REO A;  2HYF A;  3TO7 A;  3FXR A;  5H6Q A;  1KQ8 A;  1WSU A;  1Z1D A;  3RTR A;  2MA3 A;  4G7O F;  4AWX B;  3M9A A;  3C18 A;  1D5V A;  2P4W A;  2F5E A;  4YFN F;  1ODD A;  1R58 A;  4MQ9 F;  1UFM A;  4FHT A;  1TW2 A;  3FXQ A;  4HAM A;  1K79 A;  3HHG A;  1Y0U A;  3M8E A;  4BHP A;  1F4K A;  3WOD F;  4G7Z F;  4L9N A;  1T2K A;  2CG4 A;  4WXC A;  1S7O A;  1AOY A;  3PQK A;  1OYI A;  1SD7 A;  4KYW A;  2M8E A;  1Z6T A;  1KA8 A;  4KMF A;  3SHF A;  2IRF G;  5ICE A;  1D3Y A;  2EWN A;  3N97 A;  1ZH5 A;  3WGH A;  1XCB A;  4LLG F;  2HQR A;  5BOX A;  2IJL A;  3F22 A;  1SD6 A;  3FMQ A;  2FMY A;  3FM3 A;  2V6C A;  3LQR A;  1ZYR F;  2EFP A;  2BGC A;  4YIF A;  4UVA A;  3K0L A;  3MAJ A;  3E97 A;  4ENK A;  5L3D A;  1EV7 A;  3G3Z A;  3BZ6 A;  1H0M A;  1SFU A;  2B0L A;  1HSJ A;  2XAS A;  2P5L C;  2ESH A;  3VEP A;  1P2F A;  3LST A;  5ICC A;  2CWE A;  4Q48 A;  4Y13 A;  4CYD A;  3M8F A;  3DPT A;  2QZ8 A;  5CVR A;  3KFW X;  2IW5 A;  3TDU C;  1I1G A;  2QQ9 A;  1ZAR A;  3R61 A;  1QBJ A;  2AXL A;  4G6D A;  5FFX A;  1J5Y A;  3V7C A;  2PBI A;  4M9X A;  3WE2 A;  4LD5 A;  2JPC A;  3ZMT A;  2E1C A;  4CIC A;  1KQ9 A;  4KUM A;  1J75 A;  5TRD A;  1XD7 A;  5FD6 A;  4M74 A;  4JQF A;  1YS6 A;  1MD0 A;  5IT9 Z;  2BYV E;  1C0W A;  2OZU A;  2ZME B;  4LK1 F;  3M7G A;  1K6O A;  1STZ A;  5LGN A;  1DDN A;  4P9U A;  4DNC A;  1TBX A;  2XUB A;  3HUG A;  4WXH A;  3FMR A;  3HYI A;  1MJ9 A;  1H9G A;  3LA2 A;  2PLY A;  3F23 A;  5CVJ A;  2STT A;  3BOQ A;  4A6E A;  2XV4 S;  3BWG A;  2DK8 A;  5H20 A;  2PQ8 A;  5D5X B;  5HDN A;  3H3Z A;  4CO8 A;  1W5S A;  5ILU A;  2KIM A;  4L9V A;  2F5D A;  4KIG A;  3FWE A;  3MZY A;  3BJA A;  3CUO A;  3U9G A;  3WTY C;  2BEO A;  2XAJ A;  1YS7 A;  4N9H A;  4OU0 A;  1MZB A;  4GO1 A;  3I59 B;  3OOP A;  2FE3 A;  3HOS A;  5D5W B;  1CGP A;  3C7J A;  2LKP A;  1FP2 A;  1BIA A;  4MNU A;  1R7J A;  4R79 A;  1LEB A;  1TQI A;  3NRV A;  5JI6 A;  3LA3 A;  3HRU A;  3ZMV A;  4AIH A;  1IXC A;  3GX4 X;  4PZJ A;  2Y48 A;  2GXG A;  1PP7 U;  1IXS B;  5EEG A;  4GCV A;  3ROU A;  1BC7 C;  1IRF A;  3WTV C;  1P4X A;  1NHA A;  3ZN0 A;  3M1E A;  3EUH A;  1XSX A;  1DPU A;  5FD5 A;  5HDG A;  2K7L A;  1ON2 A;  3I54 A;  5AIQ A;  3RDI A;  1R36 A;  3F72 A;  2Z9O A;  4EJU A;  2M1B A;  2PFB A;  2MLK A;  4YG2 F;  1LQ1 A;  4P9F A;  2EA4 A;  2KIU A;  4EJO A;  1T6S A;  5HS9 A;  2R3S A;  2XAF A;  2X0L A;  5DCM A;  1P6R A;  3NQO A;  1DP7 P;  3EET A;  2VBZ A;  3QAH A;  2K02 A;  1ZN2 A;  3E5X A;  2ZKZ A;  1IAW A;  1FWZ A;  4QWQ A;  1UB9 A;  1MGT A;  2DPU A;  3FXU A;  2J5P A;  1L0O C;  5L3E A;  4ENN A;  1G3T A;  1T39 A;  3EDP A;  4M71 A;  4QLC U;  2HS5 A;  2W57 A;  3KEQ A;  1WKM A;  3KET A;  5LRR A;  5LBQ A;  4LB5 A;  2M87 A;  4LGW A;  3KZZ A;  1Z7U A;  3R60 A;  4I0B A;  4LG0 B;  1XGN A;  1SMY F;  1FZP B;  4RB1 A;  5CVU A;  3SZP A;  2XAH A;  5DD4 A;  2DQL A;  4EM1 A;  2RKH A;  1T0F A;  2BBY A;  3J7A O;  1LEA A;  2D2W A;  3IKT A;  4RGS A;  2RQP A;  3ZP5 A;  3MQ0 A;  1IN4 A;  3S2W A;  3GFI A;  2Q0O A;  3K2Z A;  1U8R A;  1FLI A;  1SAX A;  2GZW A;  3RKW A;  2CW0 F;  3WTX C;  2M45 A;  2AS5 F;  1YIO A;  4ETS A;  5D5V B;  5E1W A;  5ICF A;  2DK5 A;  4XRF A;  2A6E F;  4YII A;  2K86 A;  2VC1 A;  1Z91 A;  5CVV A;  2A07 F;  2L4M A;  3JSO A;  4LJZ F;  1RIO H;  4KT5 C;  4EQQ A;  5LHH A;  1J0R A;  4HYE A;  4HX8 A;  1USS A;  4HW0 A;  2HR3 A;  2HGC A;  4KN7 X;  5AIP A;  2W84 A;  4KDP A;  1ZGA A;  2QWW A;  1J59 A;  4Z2Y A;  2Z99 A;  2K4J A;  2QVO A;  1I5Z A;  1G6N A;  3F3X A;  4UV9 A;  2H94 A;  3E5U A;  2G9W A;  1GVJ A;  4ENJ A;  2A68 F;  3K1M A;  2M5W A;  4OIO F;  1W7P D;  3I5U A;  3GEZ A;  3HHH A;  5AON A;  1LDK B;  4I01 A;  2P6S A;  1UST A;  3F8B A;  1XCV A;  3IHU A;  4FX4 A;  3VB2 A;  4A0Z A;  2V9V A;  2GA1 A;  3VOD A;  4ASN A;  3Q5F A;  2OD5 A;  1Z05 A;  1BI2 A;  5BS6 A;  1U5T B;  4HZF A;  2UWM A;  3IWF A;  3KEO A;  4LLN A;  2OBP A;  2P6T A;  4TV7 A;  3HRS A;  4LMY A;  2CYY A;  5CVI A;  1S6L A;  2ZNZ A;  3B02 A;  5D6F A;  2D1H A;  4FT8 A;  3KE2 A;  4MEY F;  3RPU A;  1B6A A;  1U5T C;  2FU4 A;  1IN5 A;  2GIV A;  2GQQ A;  4KIF A;  3L00 A;  4EV0 A;  1DUX C;  1JXS A;  4OMZ A;  3GYH X;  4JK1 X;  4MEX F;  4G6Q A;  3P9I A;  2XKP A;  5JHU A;  1W7P B;  2F5F A;  4P55 A;  1YG2 A;  1IRG A;  2HYG D;  3J80 Z;  2O03 A;  1LDD A;  1K78 B;  3CTA A;  4HQE A;  4KIB A;  3F8N A;  2HKX A;  2F5C A;  1BIB A;  4HLX A;  1SMT A;  2CSO A;  1Q1H A;  2UXN A;  2KJC A;  3RIR A;  2H27 A;  5KVR A;  5L3F A;  3DKW A;  2MBF A;  1HKS A;  4IF4 A;  1XMK A;  1O7F A;  1E2X A;  2A5Y B;  3I59 A;  1FYL A;  4EJT A;  1GXP A;  1G3W A;  4XBF A;  2EV6 A;  4HF0 A;  1AWC A;  2CQK A;  1YYV A;  2H09 A;  3E6B A;  4L18 B;  2C6Y A;  4ESJ A;  3KP7 A;  3IL2 A;  3LWF A;  4KNY A;  5CYV A;  2RDP A;  5FGM A;  3WTZ A;  3W6K B;  1YW9 A;  5HLG A;  3O6B B;  2FRH A;  4H0E A;  1F9N A;  1V4R A;  2MD5 A;  4BXU A;  4M6Y A;  1HW5 A;  1W5T A;  4RAZ A;  2NYX A;  2VBX A;  3LA7 A;  1U3E M;  3FF5 A;  3V7S A;  1YW8 A;  2YR2 A;  3HTS B;  2IA1 A;  1FBS A;  4RB3 C;  1IN7 A;  2OU2 A;  1RI7 A;  4O5V A;  4HX4 A;  2CGP A;  2VBW A;  5HLH A;  2PJP A;  2OZ6 A;  1KU2 A;  5DUI A;  1GXQ A;  3I71 A;  4EVI A;  2FXA A;  3DQV C;  2FOK A;  2IPQ X;  1O3R A;  2OQG A;  2VT2 A;  1G3Y A;  2YX4 A;  3CO6 C;  5L3B A;  4PCQ A;  1OPC A;  1QPM A;  4I02 A;  5HDK A;  3WTS C;  3RYP A;  3FZV A;  5DCF A;  3I4P A;  4LG0 A;  4UUV A;  2PG4 A;  4OOI A;  1PDN C;  2FF4 A;  3HSE A;  5K5O A;  5ED4 A;  5K5Q A;  1ZRD A;  4RGX A;  3VFZ A;  4EGY A;  1B9M A;  3QOP A;  3T0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...