3ZPLA

Crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
PRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
publication title Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 62
structure length 159
sequence length 159
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zplA00
1ZLKA 5DCMB 3JTGA 1O3SA 4KN4X 2K27A 2NNYA 3N4MA 1PP7U 5CVUA 1S7AA 3WG9A 4ZZDA 5E8GA 1OMIA 2BBYA 1LVAA 3F8CA 1XGOA 1O57A 2BE5F 2KKOA 3KLOA 5HDKA 4EGZA 3PFIA 5DD4A 3GW2A 4NB5A 2K7LA 4CGZA 4HDVA 3F72A 4IF4A 5BQTA 4U0VA 4LMYA 5DCFA 4IHTA 4L9NA 3V8KA 4YG2F 3F3XA 1Z05A 3JAMZ 1T39A 1R1VA 1JHHA 5D5WB 2Y48A 4B09A 3WE2A 5LRRA 1FBUA 2FA5A 2HKOA 3W6JB 5D4SA 3KEOA 3DPTA 3RKXA 1IF1A 1SAXA 4DNCA 2WWYA 3LQQA 4P55A 3I59B 5LGNA 2XAQA 2Z33A 1O3QA 3ZMDA 5LEKA 1I27A 1FP1D 1Q1HA 2PJPA 5DV5A 3M8FA 4GXOA 4CZZA 4I09A 2IRFG 4NHJA 5F1RA 4LLGF 1G4DA 2XGXA 2H09A 2FXAA 3I71A 1KU9A 3WTTC 3E6DA 4XLNF 1IXRC 4M9ZA 3IKVA 1TNTA 5J8CA 2UXXA 4I0BA 3LSTA 1JGSA 1HXDA 3DKWA 1KGSA 2QM3A 3C1DA 1MJBA 4RGXA 5CVVA 3QU3A 3EETA 4RAZA 3JTHA 3MZHA 2J5PA 3RYRA 1R23A 4OMYA 3PQJA 1F1ZA 3WTSC 2CSOA 3K1MA 1YTYA 4H0EA 4KIBA 4KT5C 2GIVA 3H92A 4ENMA 2BGCA 5AIPA 2HTSA 4L0YB 3TKYA 2V1UA 4BAYA 3GZ5A 5CVRA 1U5TB 2ISZA 2NAZA 3LWFA 1J2XA 3I58A 4I01A 1HBXG 5HLHA 3RKYA 1BC7C 4AVPA 3ZMTA 1IN5A 5E1ZB 2D1VA 4O6JA 1KU7A 1LNWA 1YFHA 2FBKA 4Y13A 5HDNA 2DTRA 2R3SA 3R6SA 5E17F 5A2QK 4G9YA 2COMA 2JSCA 4BHPA 3J81K 3QU6A 1LDJA 2P5KA 3HTSB 5L3EA 2YSRA 3NQOA 2LKPA 4EM0B 2ZCWA 4WXHA 3IWFA 4ZH4F 1XGSA 2XIGA 3ZN0A 3CLOA 4PDKA 1E17A 3R61A 3R0AA 1FC3A 2C6YA 1EH8A 2P5VA 1T98A 3DF8A 1LEBA 2L4MA 2DT5A 4MEYF 4MTEA 3FM5A 5K1YA 4HOBA 5LGTA 4OIRF 3BJ6A 1LDKB 2Y0MA 1IN6A 1I1SA 5D6FA 1SFXA 1R1UA 4CICA 1D8KA 4ENNA 1LEAA 1IXCA 1FOKA 1SFEA 2CWEA 4GYGA 4YIFA 1Y0UA 2VC1A 2W25A 2MBFA 1FNNA 3WU0A 1OYYA 2PMHA 3ZMUA 1K78B 4OIQF 5DUIA 1IAWA 2GQQA 4RGRA 3GF2A 4FHTA 4LK1F 1G6NA 1YQAA 1OR7A 1B6AA 4M74A 3BOQA 2XROA 2RC4A 3HHHA 2PQ8A 5E18F 3REOA 3ABTA 2P7VB 1R22A 3RTRA 1JHFA 5E8IA 2A6HF 5JFRA 5ILSA 3KEQA 1O7FA 1CF7B 2LF7A 1GXPA 2W85A 1W5SA 1AWCA 2VBXA 5E20A 3KETA 2VODA 2O61A 1ZLJA 2FF4A 3KZYA 2JT1A 3WTZA 2STWA 4KDPA 5L3GA 3JW4A 4UVAA 3FMQA 1BBYA 3L2CA 2GA2A 4YFXF 2AXLA 1R36A 2K4JA 2HYFA 1GXQA 3F21A 4M71A 3E5UA 5H6QA 1STZA 3GXOA 3E6BA 4HYEA 2GXBA 2Q8KA 1S29A 5D6EA 3V8LA 3O2PE 2D2WA 3TO7A 3ISPA 3MAJA 5CJ9A 3K0LA 1IZ1A 2P6SA 4M9XA 5D5VB 3VOEA 2JRTA 1TW3A 3Q9VA 3FXQA 1FBQA 3QAHA 3COAC 2VBWA 3KP2A 1A04A 3CO6C 3VODA 3SZTA 3QOPA 3T8RA 5E1WA 5TRDA 3WTXC 2ISYA 3FF5A 3M8EA 2V9VA 1KA8A 3KP3A 1Z9CA 3BZ6A 3LQRA 4RB3C 2NNNA 4QLCU 1W7PA 4UVBA 1MD0A 2XAFA 5ILVA 2LF8A 2MA3A 5JHUA 4PGGA 1USTA 5J8FA 2ESNA 4WWCA 2BEOA 2A5YB 4U88A 1ON1A 1T38A 3P9IA 1FYMA 2XV4S 3JAMK 3EUHA 4G8XA 1LB2A 2G7HA 2PBIA 1NHAA 3F6OA 3HYIA 3FXRA 2VT2A 1WQ2A 2VOOA 4RB2C 2VC0A 1MGTA 1UHWA 2X4HA 3HRSA 4ZYGA 2FU4A 4LK0F 2EFQA 1J0RA 2EA2A 4R1HA 4AIJA 3FMRA 5LEJA 2QLZA 4RB1A 2FOKA 4UV8A 4EVIA 2UZKA 4IRGA 3TGNA 3QPTA 3U1DA 5FD6A 2Z99A 1F9NA 3I5UA 4Q5SF 4N9HA 3L09A 2MD5A 4ETSA 2STTA 3L00A 3ZMSA 4BYYA 2FBHA 4L9VA 3BJAA 2L01A 2MLGA 3S2WA 2FE3A 4A5MA 4KICA 5FGMA 3AAFA 4BHCA 2Z3YA 3WU1B 4IHSA 3WODF 4L5JA 3Q5FA 2O3FA 1RI7A 4Q48A 2B0LA 2QBYA 2H94A 5BPDA 2QYOA 3HTUA 2DPDA 4AD9A 4XSZF 4RS8A 2OD5A 3ECHA 2W84A 5F6FA 2ZBKA 1BOAA 4MGRA 4CXFA 1RUNA 1TQMA 4UUVA 2WC2A 4RGSA 1J75A 2F5EA 3RIRA 2L4AA 3WE3A 2IVMA 3D0SA 2ZMEB 4KIGA 4A2UA 3F8MA 1PDNC 1OYWA 4BH9A 2ZJ2A 1T6SA 1D8JA 2A3SA 3TO9A 3MWMA 4Y17A 4EMSA 2HQRA 2M87A 2GZWA 2HOEA 3TDZC 2FMYA 1DUXC 4UHTA 3WTVC 2H6CA 1Z1DA 1TW2A 2QQBA 3FX3A 5D4RA 3V7RA 1BM9A 2H27A 1MJAA 4JK1X 2RVCA 2HEOA 2IA2A 4R8HA 3M9AA 4WXDA 4HBLA 3U2RA 4N0BA 1MDMA 1YW9A 5KVRA 5FO5A 4HAMA 5DCMA 5L3CA 3L7WA 2IJLA 4CYDA 1XCVA 2UXNA 3BROA 2A07F 2V6CA 4CO8A 4ENKA 4LFUA 4L9TA 1G3SA 1ZRCA 2VXZA 4HX7A 2KIUA 4ESFA 4IRIA 1WWXA 2MH9A 2KIMA 3E97A 4P9UA 1USSA 1X3UA 1XN7A 4WK8F 4UVCA 3CUQB 3HUGA 1GVJA 3MCZA 4HQMA 1ZG5A 5EEHA 1R58A 2EV0A 2EFNA 3DP7A 4PCQA 4K2EA 1JE8A 2MC3A 2LNBA 4ZZLA 1P2FA 2HDCA 3G73A 1DPUA 5ED4A 4CHUA 5K5RA 3BJOA 5DEQA 5BPIA 3LAJA 2P5LC 5HLGA 1YIOA 4ON0A 1U78A 5DUKA 1RZ4A 2HQNA 3DEUA 3IWZA 5BMZA 4AIKA 3NRVA 4P5OA 4A0XA 1KU2A 4M6YA 1KYZA 1QPMA 2HZTA 2HFHA 3I59A 1HW5A 2VT3A 3VFZA 3DV8A 4M73A 1U5TC 4ENJA 2HWVA 4F7ZA 3HIFA 2DQRA 1L0OC 2ESHA 2HYGD 4B8XA 1HW2A 1W5TA 1EH6A 3V7SA 1S8NA 1IXSB 2XHKA 3CJNA 3HHGA 1U6GA 1YW8A 2OQRA 3QRFF 5L3DA 4D0PA 1BI3A 2QQ9A 2E1CA 5LHHA 2KIFA 4XBFA 4LG0B 1YYVA 4GGGA 2O03A 4KMFA 3KP7A 2ELHA 3E5XA 2ZO4A 5ICFA 1GHCA 3GLXA 3PQKA 3O6BB 2DK5A 3E3VA 1IRGA 3ABUA 3F22A 3FXUA 4Q47A 1XDUA 1G3YA 1FP2A 2NYXA 2EWNA 3TQNA 1XMKA 4LLLA 4KA4A 4EJUA 1ODDA 4O5VA 1R7JA 1QQIA 1IN7A 5E1XA 2M8EA 4AWXB 2IA1A 1KU3A 2VN2A 1U5TA 3EQLF 2JZYA 2DQLA 3HSFA 1D5VA 5TJJA 3U9GA 2Q2EA 1UFMA 3P9CA 4I02A 5ICCA 4WX9A 1V4RA 2Y75A 1E2XA 3J80Z 2IT0A 1DP7P 4MNUA 1XD7A 1FSHA 4A6EA 2A61A 5IT3A 4ZYEA 4TV7A 2M45A 3V4GA 1UCRA 3T5XA 2XASA 1FX7A 5H20A 3ROUA 1ZG1A 2V1DA 1FPQA 3C3WA 2OBPA 4EM2A 4EJOA 2XUBA 3F6VA 2EFPA 2QVOA 4ASNA 3KP4A 3K2ZA 2CG4A 2EB7A 2EV5A 2O0YA 1T2KA 3CDHA 5DD8A 3WGGA 3KFWX 2P6TA 3J81Z 2F5DA 4IPAA 2ZKZA 4HX8A 1BN5A 1B9MA 2NS0A 3I64A 1XSVA 1U3EM 3NEUA 1XDSA 3HRTA 4I0AA 1IN4A 1J9IA 3GFJA 2ETHA 4ZYDA 2FSWA 2A69F 1TTYA 4EJWA 1VTNC 1ON2A 2VBZA 1IRFA 3ZP5A 4G6DA 4CDGA 2W24A 4L5IA 5D5XB 2QWWA 4P96A 5HS7A 1SD7A 2FEZA 4A12A 3V8JA 3IKTA 3T1BA 3KE2A 4HV6A 4YFKF 3GX4X 6PAXA 4S05A 4OIOF 3EYYA 4MEXF 2QENA 3GFLA 2HKXA 2X0LA 5ICEA 1SD5A 2VBYA 1Z6TA 1P4WA 3I4PA 1S7OA 2QQAA 3SFZA 4EJVA 2R7DA 1DPRA 1S6LA 2DW4A 1K78A 3BY6A 3C18A 3EDPA 4HA8A 2YPRA 1SMYF 3CUOA 1QNTA 1K79A 2YR2A 4EV0A 3GYHX 1FYLA 4KMUX 3IC7A 1UB9A 2IA0A 2YU3A 4RB0A 1R5GA 3MEXA 1C0WA 1SD4A 2M30A 3M7GA 3E6MA 4HW0A 4BNCA 3G3ZA 1ONVA 3EYIA 4U0WA 3DFGA 2L54A 1R1TA 2W57A 1CF7A 4WXCA 3BP8A 3R0JA 2D1HA 2EA4A 2RGVA 1QBJA 5HDGA 1JXSA 3BPXA 1QO0D 1BI0A 3GUDA 1V3FA 3ELKA 3TOBA 5D8KB 3R60A 4OU0A 2P8TA 3FM3A 2H6BA 4FT8A 2E7WA 4A0ZA 1MKMA 5CVJA 2F2EA 1KQ9A 3O3KA 4E70A 4LJZF 5FLXZ 2K86A 3P9KA 3W6KB 5HOOA 5ILUA 2KRFA 1OPCA 5AONA 1I6XA 2JPBA 4AIHA 3WTUC 4HDUA 2XAGA 2GWRA 3ULQB 1WKMA 2J5OA 1KQ8A 1HSTA 3IRRA 1MJ9A 3I53A 3OOPA 3MQ0A 2MH2A 1OYIA 5H6RA 1ZN2A 2JTVA 2CGPA 4OIPF 4RGUA 4GCVA 3QP5A 3D5LA 3K69A 2PLYA 1ZGAA 5IT9Z 3F8NA 1LJ9A 1YS6A 3GWZA 5LGUA 4EGYA 4GYIA 2FNPA 2ACJA 2LDUA 4IVNA 4UNOA 4KYWA 2RN7A 5FFZA 2FBIA 4L9JA 3HRUA 3HOSA 2F5FA 4MQ9F 1KQ0A 1QGPA 3CTAA 1XGMA 3VB2A 3QP6A 5LHGA 5L3BA 3LA3A 3SQNA 5K5QA 4YIIA 1EV7A 2O6GE 1HQCA 2BYVE 5ICGA 3LA2A 1XSDA 1P92A 3RYPA 2RKHA 2DO7A 4HLYA 1HSJA 1J59A 5BOXA 3RKWA 1B4AA 1TLHB 1MZBA 4L18B 2M5WA 4M9SA 1BIBA 2PN6A 2HS5A 1S3JA 3SZPA 2NRAC 1PUEE 4KFCA 4G7OF 1O3RA 2G9WA 3T0YA 1D3YA 1REPC 1ZHFA 1ZAOA 1FY7A 5D5UB 3DQVC 3TDUC 3JSPA 1R5HA 1K6OA 2E1NA 4JBAA 1WSUA 3T8TA 1RUOA 2OA4A 3RPQA 4RAYA 4KNYA 1YG2A 4HLXA 3FMSA 4Z2YA 1U2WA 2WV0A 4HX4A 2Z5UA 2ZXJA 5DYMA 1TQIA 4R79A 1XCBA 5CLSA 1AOYA 2OU2A 2V79A 1YLFA 1FZPB 1FLIA 1BI2A 2QZ8A 2Z9OA 2HR3A 4HQEA 3FHZA 4UXNA 2VE9A 2GA1A 2RQPA 3TOAA 1OKRA 2YX7A 5EEGA 4MTDA 3BDDA 2XAHA 3KP6A 3H3ZA 3HOTA 2V1XA 4M72A 3KP5A 1SD6A 2UWMA 3MZYA 2VOPA 3WGIA 3RPUA 3B73A 4IRHA 4OOIA 4ESJA 4S04A 3IHUA 2PMUA 5LLQA 3LA7A 2IW5A 1DDNA 1TBXA 2RDPA 5K5OA 5BS6A 2ZNYA 4YFNF 1FT9A 2CW0F 2IPQX 3V7CA 3K1PA 3DPLC 2PI0A 1B1BA 2ZMEA 2QUFA 5KK1A 3CUQC 3L9FA 3M1EA 3SXYA 1W4MA 2OQGA 2ZNZA 4I2OA 2LSOA 4KIFA 4LB5A 2K02A 3J80K 4OINF 5L3FA 1O3TA 3QPHA 2EFWA 3LAPA 1HKSA 2BV6A 1CGPA 1I1GA 3IL2A 2P7CB 3VEPA 2EFOA 5JI6A 1B59A 2VONA 3FZVA 2EV6A 2PG4A 2XRNA 2VE8A 2PEXA 4XLPF 4U0YA 3ZMZA 3GFIA 1YW7A 2FQ3A 3F8FA 1K7AA 1SFUA 2A68F 2CFXA 1IUYA 3I0TA 3E5QA 1RNLA 4MHGA 4P9FA 3ZPLA 3WTWC 4EM1A 4FX0A 4A5NA 1IN8A 3BPVA 4U7BA 1HW1A 1ULYA 1WI9A 2Q0OA 5FB2A 3GEZA 1LQ1A 2OZ6A 1FSEA 2XVCA 3ZMVA 4MQVA 3FWEA 3CUQA 1XB4A 4L0ZB 3HRMA 1ZH5A 2FNAA 5HVQC 2CO5A 1KYWA 1H9TA 1L3LA 1TQPA 3WGHA 2RV8A 2RNJA 3OV8A 2CQKA 3GFMA 4I98B 1XMAA 1O7LA 1G3TA 1H0MA 3ECOA 2DLLA 3HSRA 4JQFA 1W7PD 3DXJF 2ADUA 2JPCA 5ERIA 4QWQA 4BHBA 1TNSA 3GO5A 2XAJA 4KN7X 3MFKA 4UV9A 2D45A 1YS7A 3K1NA 1ZRDA 1W7PB 1F5TA 4IJAA 4Q4ZF 2GXGA 2KJCA 5AIQA 4O3MA 4HV5A 3ZN1A 3P7NA 3KCCA 5A2QZ 4N9IA 4GO1A 2GAUA 3Q9SA 2L02A 3JSOA 1BC8C 3RI4A 5CVIA 1Z6RA 2XKOA 5LRSA 2O8XA 2G7UA 4XRFA 4ESBA 5HS8A 3F8BA 3SHFA 1P6RA 4LG0A 2A6EF 1Z7UA 3KLNA 1BJAA 1QZYA 5LBQA 1R00A 1UHMA 2ZFWA 3N97A 2F5CA 3C7JA 2XKPA 1QZZA 4HF1A 3ZQ7A 4WCGA 4ZYHA 1XSXA 4A6DA 2OAZA 4XSXF 1ZARA 5FLXK 2PFBA 5FFXA 3WTYC 5CYVA 4G6QA 1XGNA 5JR3A 4G7HF 1P4AA 4WF2A 5HLIA 5LHIA 4A0YA 1H9GA 4IXAA 3LFKA 2DPUA 3R4KA 1B9NA 1Z91A 3RDIA 3GVAA 1LDDA 1SMTA 4HF0A 1BI1A 2WTEA 3CO7C 2CYYA 1ZGJA 1ZG3A 5D8LB 1ZREA 2IP2A 4NQWA 2DAOA 2DBBA 5IT9K 3IRQA 4BQAA 4G7ZF 4DQ2A 2DFIA 1EH7A 1ZRFA 4U7DA 2M1BA 2DK8A 4EQQA 3H3UA 2L3DA 2K4BA 3KZZA 3I54A 4PZJA 4I7HA 1YO5C 2YX4A 4EJTA 4HZFA 2QBYB 2HTJA 4LB6B 3RJPA 2DU9A 2EK5A 3GZ6A 1J7KA 2TDXA 5FD5A 2E7XA 3ML6A 3F23A 4LLNA 1ZYRF 4KUMA 1HKQA 5F64A 4BXUA 1FYKA 2MLKA 1P4XA 4M6XA 2EJRA 3B02A 3BWGA 5DDGA 1T0FA 5J6XA 4LGWA 2FRHA 1WRJA 2HGCA 1BIAA 3E6CC 1RIOH 3TO6A 1HKTA 5JVTA 2FMLA 1F4KA 1PP8F 4G94A 1IW7F 1G3WA 1I5ZA 1U8RA 4HF2A 3HSEA 3K9TA 3ERED 4LD5A 1FWZA 1FBSA 2KJBA 4FX4A 4PGHA 2AS5F 4Y15A 4OMZA 5HS9A 1MDMB 2OZUA 2DI3A 3J7AO 1J5YA 2P4WA 2R7FA
chains in the Genus database with same CATH superfamily
1ZLKA 3GTJJ 4HEA2 5DCMB 1Y6IA 3JTGA 4Y7NJ 3OMYA 1O3SA 4KN4X 2K27A 3K4JA 3BTJA 2NNYA 4A3GJ 3N4MA 1PP7U 4CCMA 4JX4A 3CCQI 1UMQA 2ZXIA 4XLAA 5CVUA 1S7AA 1X1BA 3WG9A 4ZZDA 2K40A 5E8GA 1OMIA 4ANJA 3BQYA 2EZHA 2BOLA 1MBGA 3HXLA 2VI6A 1MMGA 2BBYA 1VZ0A 5FKNA 1LVAA 2JUCA 1JKRC 2XF5A 4F92B 1U0JA 3BR5A 3F8CA 2QEXI 1XGOA 4BY1J 1LUJB 1O57A 2BE5F 2KKOA 3KLOA 4EEFG 5HNHA 5HDKA 1ETYA 1JKQC 3OL4A 3PFIA 4EGZA 5DD4A 3GW2A 3BQZA 4LOCA 4NB5A 1BR1A 2K7LA 4CGZA 3HUGB 3FXMA 4HDVA 3F72A 3A01A 3HC7A 4IF4A 5BQTA 1Y1WJ 1FIPA 3DU5A 2JA6J 2CQXA 2LOOA 4U0VA 4LMYA 5DCFA 3IP4B 1R9TJ 2CFOA 4IHTA 5F0CA 4L9NA 2HVSA 3V8KA 4YG2F 2NVUB 3LNQA 2X1CA 3F3XA 1Z05A 3JAMZ 3ESWB 3RKQA 2LREA 1T39A 1ZQ3P 4NC6A 2QGUA 1R1VA 4PJJA 2X1EA 4NUBA 5IY5H 1JHHA 5D5WB 2LBFA 1MIJA 3NWTA 2K5CA 2CUEA 2Y48A 2H1KA 4B09A 3WE2A 2W00A 2ZSIB 5LRRA 1FBUA 2FA5A 2HKOA 2DT6A 2ME6A 3W6JB 5D4SA 2FOWA 3KEOA 4DZJA 3DPTA 3RKXA 3FXJA 3OS1A 1SAXA 1IF1A 1BR4A 4DNCA 4PSWA 2WWYA 3LQQA 2VJJA 2BW3B 2YUSA 4P55A 3I59B 5LGNA 2JA7J 2XAQA 2Z33A 1O3QA 2QF7A 2K85A 2NOGA 3ZRGA 3ZMDA 4XL9A 5LEKA 4II2A 1SC7A 3GTLJ 1I27A 1FP1D 1WH5A 2HU9A 3FK7A 3I55I 1Q1HA 3S1QJ 3H3VK 5EF6A 2ZFUA 1G2HA 4F91B 2PJPA 3W6VA 4OAYA 1PJRA 4RM3A 5DV5A 4FQGA 3M8FA 4GXOA 1VQ5I 3KEYA 1IG7A 1UG0A 3OWTA 2LFBA 4F52A 4CZZA 2E5ZA 5LFAA 4I09A 2H1LA 3CMEI 2IRFG 2PMZN 4NHJA 2PMZA 5F1RA 4LLGF 3OYDA 3OSGA 1G4DA 4AUXA 1HF0A 2XGXA 2H09A 2JRMA 1T95A 4UY8I 1WPKA 3ZXSA 5GAHJ 2FXAA 3CC2I 4EATA 5IOZA 5KCMA 2B63J 3NARA 3I71A 4BKXA 3GZNB 4PJMA 5EGOA 2LD5A 2DCEA 1KU9A 3BTLA 5F04A 3WTTC 3K4BA 1DGWY 1SFOJ 1EJ9A 3E6DA 3F0CA 1IXRC 4XLNF 4M9ZA 3IKVA 1TNTA 5J8CA 5LD2C 2NXNB 2UXXA 3HGYA 4M6VA 4I0BA 3LSTA 2JMWA 1JGSA 1VQNI 1W36C 1HXDA 3DKWA 1Z7LA 4QPOA 1KGSA 2QM3A 2DJIA 3C1DA 1MJBA 4RGXA 1W0TA 5F0FA 5CVVA 3QU3A 1LFPA 3EETA 4RAZA 3QYBA 2BY3A 1RR8C 3JTHA 4XOTA 3MZHA 3SYTA 2O9LA 2J5PA 3SEZA 3RYRA 1R23A 4OMYA 3PQJA 1F1ZA 4Y4RA 3S17J 3WTSC 2CSOA 2DMTA 3K1MA 1YTYA 2L7MP 4H0EA 4KIBA 4KT5C 5IYDJ 2GIVA 3H92A 3TL4X 4NC7A 4ENMA 1ZTRA 2BGCA 5AIPA 2HTSA 1Y39A 1AA7A 1V55H 2MW8A 1WH7A 2ID6A 4L0YB 2CV1A 1S5LC 3TKYA 2V1UA 4BAYA 1OCCH 3GZ5A 5CVRA 1U5TB 5CKTA 1QRYA 2ISZA 5EDNA 2IAIA 4J19A 2NAZA 3LWFA 4C2UA 2G0EA 1QHGA 4IHWA 1J2XA 2Q2EB 2E71A 3I58A 4W97A 2NVTJ 4HSRA 1X1PA 3LSGA 4I01A 1XC5A 1TC3C 3HPGA 3OYIA 4E7KA 1HBXG 1MSFC 4RMNA 3BR3A 5HLHA 2A05A 3OYAA 3RKYA 3WHCA 1MMDA 1BC7C 2E60A 4AVPA 4BDYA 3ZMTA 2M2EA 1IN5A 5E1ZB 2D1VA 4O6JA 3E0JB 5GP9A 2V1NA 1LNWA 1KU7A 1YFHA 2FBKA 3UR3C 5J4VA 4F93B 1X58A 2HOSA 2QCOA 1VI0A 4Y13A 2VKHA 5HDNA 4BUPA 2DFHA 2DTRA 2GOMA 2R3SA 2IS4A 1T8IA 2HYJA 3A0HC 3R6SA 5E17F 4MFEA 5A2QK 4G9YA 3K4MA 2COMA 2JSCA 4BHPA 2KDOA 3J81K 1S9HA 3QU6A 1LDJA 2P5KA 3HTSB 5L3EA 1MNDA 2M0MA 2AO9A 1B72B 2YSRA 3NQOA 5GPCA 2OF7A 4IL6C 2LKPA 2CQ7A 4ZYAA 4EM0B 1BA5A 2ZCWA 4XICA 4WXHA 3IWFA 1BW6A 3GCMA 3EUAA 4ZH4F 1XGSA 2XIGA 3ZN0A 1NH3A 2NS7A 3CLOA 4PDKA 4GDFA 3S32A 3O8HA 4A3FJ 1E17A 2KHMA 3R61A 4DJAA 3R0AA 1FC3A 5M5XJ 1YJNI 1JT6A 4CCOA 2C6YA 1EH8A 3LSJA 3VYTB 1H89C 2WY7Q 2P5VA 1T98A 3DF8A 1LEBA 2L4MA 2DT5A 3A4CA 4MEYF 4MTEA 2R5YA 2CUFA 3FM5A 1PUFA 5K1YA 1UHSA 4HOBA 3P5JA 5LGTA 4OIRF 2GM4A 3BJ6A 1LDKB 2BY0A 1IN6A 2Y0MA 3CESA 1MW7A 1QVUA 4XMYA 1SFXA 5D6FA 1R1UA 4CICA 1D8KA 4ENNA 1LEAA 1IXCA 3A02A 3LOCA 2WB1A 2EILH 2Y9ZA 1FOKA 1SFEA 2CWEA 2AQEA 2O5RA 4GYGA 1K83J 3G4SI 4YIFA 1Y0UA 2VC1A 3TMOA 1X19A 2DTZA 2W25A 2IGNA 2MBFA 2L9NA 1FNNA 3TW6A 3WU0A 1LKXA 1OYYA 2WAQN 2PMHA 2LR8A 2JQ7A 3ZMUA 1K78B 4OIQF 3OIQA 4XR6A 2VQCA 5DUIA 2IBDA 2KIQA 2Z2SB 1IAWA 4NBQA 2JSPA 2GQQA 4RAFA 4RGRA 1OCPA 2DOFA 3VSKA 3OIPA 2OUMA 2YS9A 3GF2A 4FHTA 2R93J 3ZQIA 5GAEJ 3CJQB 4LK1F 1G6NA 2IXSA 2L7KA 1FJLA 1TWCJ 1YQAA 1MH4A 3S1MJ 1D1BA 4NQWB 2X85A 1OR7A 1B6AA 4GRIA 4M74A 3BOQA 5J1RA 2XROA 2RC4A 3HHHA 4ZDPA 1T33A 2L0KA 2PQ8A 1HDPA 1K61A 2GLOA 5E18F 3REOA 1LE8A 4V19K 3ABTA 3BCAA 3VDXA 2P7VB 3CCMI 4E7IA 4BQOA 4BL0B 4UB8C 1I6HJ 3K4KA 1R22A 3SJMA 3RTRA 1JHFA 4D5FA 3L2QA 1FTTA 2DXIA 3LSKA 2GOXB 3NAUA 5E8IA 2A6HF 5JFRA 5ILSA 3H5RA 3KEQA 4FETA 1O7FA 1CF7B 3WU2C 2LF7A 4V2GA 1GV2A 1GXPA 2W85A 3QYFA 4V2FA 1W5SA 3FHNA 1AWCA 1I1SA 2VBXA 5E20A 3KETA 2VODA 2X6XA 2O61A 1ZLJA 2FF4A 3KZYA 4XNFA 2JT1A 4CA0A 3WTZA 2STWA 1LPQA 2LK2A 4IO9F 2CH0A 4MFDA 3FXOA 4KDPA 5L3GA 3JW4A 2K9NA 4UVAA 3JRGA 3FMQA 1BBYA 3L2CA 2GA2A 4YFXF 2AXLA 1R36A 2K4JA 2DA6A 2HYFA 2R7TA 1GXQA 1WJEA 1F43A 3F21A 3LL7A 4M71A 3E5UA 1TP4A 1STZA 1E3PA 2M9HA 3GXOA 5H6QA 1WGXA 2P0WA 3E6BA 4HYEA 4CYCB 2GXBA 4ZTFA 2ZSHB 1FEXA 5CQEA 2Q8KA 1S29A 5D6EA 2E1OA 2QSFX 3V8LA 4BXXJ 3O2PE 1X1CA 2D2WA 1P7IA 3EUHC 3TO7A 2CRGA 3ISPA 3MAJA 3LSHA 2R7QA 2L7ZA 4XLEA 5CJ9A 5M5WJ 5KNLA 1GT0C 1T0FC 4IKFA 3K0LA 2Y69H 1RR7A 1IZ1A 2BHZA 4CH7A 4Z6YA 2P6SA 1GDTA 4IHVA 4M9XA 5D5VB 4D9JA 4YEJA 3VOEA 2DDBA 2GIZA 2L2OA 3HOWJ 2LLKA 5E3LA 1RRJA 2JRTA 3JRAA 1TW3A 3Q9VA 3MVPA 2R92J 1MMNA 2EIJH 3FXQA 1FBQA 3QAHA 3COAC 2E2IJ 5C3EJ 2NVQJ 1VQ7I 2VBWA 3BTIA 1EF4A 1A5JA 2F4IA 3C2HA 3BCBA 3KP2A 4I6ZA 1A04A 3CO6C 3VODA 3SZTA 4QSHA 3QOPA 3T8RA 4DW6A 3DKYA 5E1WA 5TRDA 5FLMJ 3HG9A 3CC4I 4HNTA 3WTXC 1T56A 4C3JJ 2ISYA 3FF5A 2F6CA 2V9VA 3M8EA 4XLHA 1KA8A 1YI2I 1YX3A 3KP3A 1T08B 1V5GA 1Z9CA 4M3FA 2VPRA 3BZ6A 1SEUA 3LQRA 4UUTA 4RB3C 2NNNA 4NDLA 3KIOA 4DOZA 4QLCU 1WVRA 1W7PA 1R4MB 4UVBA 1P7JA 2XB5A 1MD0A 3K70D 5J3LA 3VSLA 1U8BA 2XAFA 1YHQI 4JX5A 3KYLA 2W82A 2L9VA 5ILVA 4LG3A 4XIDA 3ZQFA 5EYRA 1B8IA 2LF8A 2MA3A 3BG3A 2R5ZA 5JHUA 4PGGA 1USTA 5J8FA 1XMXA 2ESNA 4WWCA 2BEOA 1Z3XA 2A5YB 4U88A 4M3GA 1ON1A 1T38A 1HC8A 3P9IA 2M0CA 5HLTA 1FYMA 1X3WB 2DFFA 2XV4S 4DGWB 1YRNB 2LC2A 1X1DA 3JAMK 5IP6A 4I76A 2ZXWH 3EUHA 1SANA 4G8XA 4BACA 4G6TB 3DEWA 1LB2A 2G7HA 2PBIA 1NHAA 3F6OA 3HKZN 3HKZA 3HYIA 3BZCA 3BG6A 2VT2A 3FXRA 1VFCA 2BY2A 1WQ2A 2VOOA 4RB2C 2XPWA 2VC0A 3CMMA 1MGTA 1LFUP 1UHWA 2X4HA 4D1QA 3HRSA 3FBIB 4ZYGA 3LFUA 2FU4A 2A5WA 4XRMA 4B44A 1S7EA 1W0UA 4LK0F 2EFQA 1J0RA 1JUMA 1ACIA 2EA2A 2JVHA 2X51A 5B5EC 3OYGA 4BEHA 2DA5A 4D7NA 4R1HA 2EQRA 5JLWA 4AIJA 3FMRA 5LEJA 2QLZA 1K4TA 2WV1A 3OS2A 1WJDA 5GAGJ 4RB1A 1VQKI 2AHQA 4PSXA 2MD0A 2FOKA 4UV8A 1UZCA 3W2WA 4QTRA 2E1MB 1OQYA 2V4JC 3VWBA 5KAFC 4EVIA 3DBRB 2UZKA 2DOAA 3H9QA 4IRGA 3CF5F 1LFBA 2OTLI 3TGNA 4KISA 4UUSA 1ETOA 3QPTA 2ECCA 2ZJRF 3U1DA 1TWGJ 4FE7A 3OYFA 5FD6A 2Z99A 1F9NA 3QPSA 3I5UA 1JGGA 5FJ8J 4Q5SF 2E2JJ 3RPUD 4N9HA 4U87A 3JRIA 3L09A 2MD5A 3S14J 4RLFA 4ETSA 2CMPA 3S3MA 3PNTA 2HXOA 2STTA 2I10A 3L00A 3FXKA 4IOAF 3ZMSA 4BYYA 2FBHA 4L9VA 3OR1C 3BJAA 4XKBA 4CCNA 2L01A 4D7MA 2MLGA 3S2WA 3IV5A 5J1UA 2FE3A 4A5MA 1YE9A 4KICA 5FGMA 3AAFA 3ZQLA 3TP3A 2D5VA 4BHCA 3DWLE 2Z3YA 3WU1B 4IHSA 3CCYA 3WODF 3ZQGA 4L5JA 4FCYA 5EG0A 1RKWA 3Q5FA 3IH4A 3CC7I 2O3FA 1RI7A 4Q48A 2B0LA 2QBYA 2H94A 2VB6A 5BPDA 2KQRA 3ABLH 2QYOA 3HTUA 1E3HA 1IJWC 1HDDC 2DPDA 1UJ8A 4AD9A 4XSZF 3IH2A 1FOXA 1WJCA 1TZLA 2KT0A 2NOJB 4RS8A 3HOVJ 2HDWA 3G71I 1VQPI 2OD5A 1NG7A 3ECHA 2W84A 3BR2A 5F6FA 2ZBKA 1BOAA 4MGRA 4CXFA 3V42A 1RUNA 2XPUA 1TQMA 2XPVA 4ZC3A 4UUVA 3S16J 2HVRA 2WC2A 2MSYA 2K9SA 4RGSA 1J75A 2F5EA 3RIRA 2L4AA 3WE3A 2IVMA 1FIAA 3D0SA 2ZMEB 4KIGA 1ORKA 2R0QC 4A2UA 3F8MA 1PDNC 1OYWA 4BH9A 2ZJ2A 3DPUA 1T6SA 2VJIA 4YELA 4M3DA 2XRLA 4DBRA 1D8JA 2A3SA 4XLCA 3TO9A 2Z1DA 3MWMA 3Q0UA 4Y17A 3OYKA 3PL8A 2Y30A 4EMSA 2HQRA 2M87A 2GZWA 2HOEA 3TDZC 2BZTA 2FMYA 1DUXC 3OOUA 4UHTA 1AHDP 1IC8A 3ASNH 2H6CA 3WTVC 3TP0A 1Z1DA 4E7JA 3Q0WA 1TW2A 2QQBA 3ASOH 1DU6A 3FX3A 2ID3A 5D4RA 3V7RA 1BM9A 2JJ7A 2H27A 1MJAA 1OCZH 4JK1X 2RVCA 2HEOA 2IA2A 1TWFJ 3PO3J 1I3AA 4R8HA 3M9AA 4WXDA 4HBLA 3U2RA 3CJRB 1D5YA 3TBIA 4N0BA 2VASA 3HPHA 3A1YA 1MDMA 3OR2C 1YW9A 5KVRA 5FO5A 2DYSH 4XN0A 2V7FA 4HAMA 4E4HA 3X2QH 2JK3A 5DCMA 1MMAA 1WI3A 5L3CA 3L7WA 2IJLA 3OY9A 3BR1A 1FMVA 2QKLB 4BBSJ 1W1WE 1XCVA 4CYDA 2UXNA 3BROA 2A07F 2V9PA 5EZGA 5IP9J 2V6CA 4CO8A 4HG2A 4ENKA 4LFUA 2ZJPF 4L9TA 1G3SA 4BE1A 1ZRCA 2VXZA 1D0XA 4HX7A 2KIUA 2HDDA 3H5AA 4ESFA 4IRIA 1IUFA 2RAEA 1RKTA 2RQQA 1WWXA 2MH9A 2KIMA 1K4SA 2K3PA 1N25A 3E97A 4B3AA 1USSA 1X3UA 1XN7A 4P9UA 2Q1ZB 5TISC 4WK8F 4N4OB 4UVCA 3OYNA 2L5QA 1QZEA 3CUQB 1UG2A 3HUGA 4L5EA 1GVJA 2X9DA 3MCZA 3CZ6A 3OYCA 4HQMA 1ZG5A 2HI3A 1PUFB 5EEHA 1R58A 2EV0A 2EFNA 3DP7A 3UKGA 3W2VA 4II3A 4PCQA 4K2EA 1JE8A 2MC3A 2QKMB 2LNBA 2UUZA 1S72I 4XN3A 4ZZLA 2Y2ZA 3FISA 1P2FA 5E79C 2W1OA 3G73A 2HDCA 1DPUA 5ED4A 4CHUA 5K5RA 3G2BA 3BJOA 5DEQA 2KZVA 5BPIA 3LAJA 2CQQA 2P5LC 3Q0VA 5HLGA 4B3XA 3KYDB 1YIOA 3IH3A 4ON0A 5H2FC 4KT6A 1U78A 5DUKA 1RZ4A 3VYRB 5C4XJ 9ANTA 2HQNA 1ZKGA 3CDIA 3BG9A 3ZOBA 4FASD 3DEUA 3IWZA 5BMZA 1R71A 1N77A 1VQ6I 4AIKA 2HOAA 3NRVA 2VJ5A 1XPXA 4P5OA 2NVYJ 4A0XA 2BW3A 1KU2A 4M6YA 3VYSB 3S2HJ 1KYZA 1QPMA 4E7LA 3S3NA 2HZTA 2HFHA 1RETA 3I59A 2M8GX 2KRCA 3ZQQA 2DA7A 1HW5A 2VT3A 3RQIA 3VFZA 2CV0A 3DV8A 3FDYA 4C3IJ 4M73A 1U5TC 4ENJA 2HWVA 3WHBA 2EZLA 1XG1A 4F7ZA 3HIFA 3RSNA 2DQRA 1L0OC 5B3SH 2XGCA 1OISA 2OTJI 2ESHA 2HYGD 4B8XA 1HW2A 1W5TA 4XRSA 3PJRA 1TT0A 3ABKH 2X6YA 2CQNA 4DBQA 2WA0A 1EH6A 3I9V2 1OR7C 3V7SA 1S8NA 3CCEI 1IXSB 3W3CA 2DMPA 2XHKA 2F4OB 3CJNA 3HHGA 1U6GA 5J1YA 3AG3H 4ABZA 4OAZA 1YW8A 1WCMJ 2OQRA 4JOMA 5L3DA 3QRFF 4D0PA 1ZR2A 1BI3A 2VLAA 3G1LA 4BJ6C 2QQ9A 2LY1A 2XSJC 4DYCA 2E1CA 1U9OA 5LHHA 2KIFA 4XBFA 4C2MJ 1OLTA 4LG0B 1YYVA 4GGGA 4HRIA 2O03A 3KPHA 3CCJI 4KMFA 5JHFA 1Z67A 1WHUA 2E19A 3M4OJ 4C9YA 3KP7A 2ELHA 3E5XA 3ZR8X 4CCJA 3L1PA 2ZO4A 2W7NA 5FLVA 5ICFA 4B48A 1GHCA 3GLXA 3PQKA 3TW7A 2MG4A 3O6BB 5TGTA 2DK5A 5IPAA 3E3VA 1IRGA 1MNEA 3ABUA 4Y52J 4IX7A 5DS9A 1N78A 3GTPJ 3F22A 4AVZA 3ERMA 3FXUA 4QIWN 4Q47A 2WB1N 1Y1VJ 1BW5A 4IQJA 1TWHJ 1XDUA 1Q1VA 1G3YA 1XX5A 4BS9A 1FP2A 2NYXA 3CP2A 2EWNA 3TQNA 4RAGA 1XMKA 4LLLA 4KA4A 3JREA 4EJUA 1ODDA 3DBHB 3H5NA 1XTAA 1R7JA 4O5VA 1QQIA 4A93J 1IN7A 5E1XA 1ZGWA 2M8EA 1FTZA 2WADA 4JX6A 5CQGA 4AWXB 2IA1A 2EH3A 1KU3A 2EINH 2M3AA 2VN2A 1U5TA 4PK4A 3EQLF 2JZYA 2QSHX 2DQLA 2LKXA 3HSFA 1D5VA 5TJJA 4XKVA 1Z0XA 4LIVA 3U9GA 2CS3A 2Q2EA 1UFMA 3AG2H 3P9CA 4I02A 3C2BA 5ICCA 2E36A 3M8JA 4WX9A 1V4RA 5EZHA 2XC7A 2Y75A 3I4MJ 1ITYA 3PO2J 3SEQA 2NVXJ 5B66C 2VQHA 3JCUC 4FISA 1E2XA 3J80Z 5B1AH 2IT0A 1DP7P 4MNUA 1XD7A 1FSHA 5KHDA 2DA3A 2CUJA 1VQ4I 4A6EA 2A61A 4FE4A 1MH3A 5IT3A 3U21A 4PJLA 4ZYEA 4TV7A 5GADJ 5FRMA 2M45A 3V4GA 1UCRA 3T5XA 3MKWB 3QPLA 2XASA 1FX7A 5FKKA 4X6AJ 3G1OA 3AFHA 1N75A 5H20A 3ROUA 3GLLA 4DZPA 2V1DA 1ZG1A 4BGDA 1FPQA 2IGOA 3C3WA 3OS0A 1ETXA 2OBPA 2IGMA 4EM2A 4EJOA 2XUBA 3F6VA 2EFPA 2QVOA 4ASNA 3MKZA 3BR6A 1VNDA 3K2ZA 3KP4A 2R7RA 4BXFA 1FOYA 2CG4A 2EB7A 2EV5A 3AG1H 1SAUA 2O0YA 2KLOA 3HM5A 1T2KA 1YITI 3CDHA 5DD8A 3WGGA 2DA4A 3KFWX 3JR9A 2P6TA 3J81Z 2F5DA 1B72A 4IPAA 1WJAA 2ZKZA 4HX8A 1BN5A 1B9MA 2NS0A 3I64A 4YIRX 1XSVA 1U3EM 3NEUA 5FROA 5J47A 2CJJA 2RNGA 1XDSA 3HRTA 2V26A 4I0AA 1IN4A 1E0EA 3NWSA 1J9IA 2PJRA 1WFXA 2Y0SA 3GFJA 2ETHA 4A3CJ 4ZYDA 1I50J 1BOBA 3Q3SA 2ZXHA 2FSWA 2A69F 1TTYA 3CD6I 4BY7J 4EJWA 4NC8A 1ON2A 2VBZA 1VTNC 2NS8A 1IRFA 3ZP5A 1ETWA 1WJ5A 2Y9YA 4G6DA 4CDGA 1Y56A 4BJ5C 5C4JJ 1HCRA 2W24A 4L5IA 5D5XB 2QWWA 4P96A 5E3OA 3F9KA 3K4LA 4Y3OA 5HS7A 5HNFA 1SD7A 2L7FP 2FEZA 1NTCA 2LYCA 1E3OC 4PJ0C 1JKPC 5IYBJ 4A12A 3V8JA 3IKTA 3T1BA 3KE2A 4HV6A 4YFKF 1QPIA 3GX4X 6PAXA 4S05A 4OIOF 4MO7A 3EYYA 4MEXF 2BXZA 3DBLB 3S93A 3HOYJ 2QENA 4ZDLA 3GFLA 2HKXA 2X0LA 5ICEA 2Y31A 3QWLA 1SD5A 2VBYA 1Z6TA 4CSWA 1P4WA 3I4PA 1S7OA 2QQAA 3O8GA 3SFZA 4CCKA 4EJVA 2R7DA 1DPRA 1YOVB 2E35A 1S6LA 2DW4A 1KZHA 2LMDA 1K78A 3G1MA 3S8PA 3PIOF 3BY6A 3C18A 3GTKJ 3DLLF 3EDPA 4HA8A 1ERDA 2YPRA 1SMYF 3CUOA 1QNTA 1YJWI 1K79A 2YR2A 4EV0A 3GYHX 1FYLA 2DT7B 4PJNA 4KMUX 3IC7A 1UB9A 3IUOA 3VYUB 2IA0A 2YU3A 3AL0B 4RB0A 2VQLA 4AU7A 1X4PA 1MBEA 3OIOA 1R5GA 3FKJA 4E7HA 3MEXA 1C0WA 1SD4A 2M30A 3K2AA 3M7GA 5HODA 3E6MA 4X0GA 1V5FA 4HW0A 4BNCA 4Y33A 3OL3A 4AYBN 4MLOA 4AYBA 3G3ZA 5EG0B 1ONVA 3A03A 3J7YJ 1IGNA 2EZKA 3EYIA 4U0WA 3DFGA 3A01B 3H1CA 1YX5A 2L54A 1R1TA 2W57A 1CF7A 1QU3A 4WXCA 1POGA 2JVGA 3BP8A 3R0JA 2D1HA 5K7HA 1TWAJ 2EA4A 1QVTA 2RGVA 3GMEA 4XOPA 1QBJA 5HDGA 3PSIA 3CQZJ 1JXSA 4P1WA 3BPXA 1QO0D 1DGRM 3DLAA 1BI0A 3GUDA 1V3FA 3ELKA 3TOBA 3JRHA 2YU9J 5D8KB 3OYEA 3CCSI 3R60A 2LBFB 1CQTA 1JT0A 1EA3A 3L2UA 3PSFA 2M4GA 4OU0A 2P8TA 4B43A 4JP0A 3FM3A 2H6BA 3K4CA 1WZ2A 3HL2A 2OJED 3MKYB 3LSPA 4FT8A 4M3BA 2E7WA 4A0ZA 4CYCA 3KZIC 1MKMA 5CVJA 3LSRA 5F27A 2COBA 2F2EA 3CLQA 1KQ9A 1M1EB 1K6YA 2TCTA 3O3KA 4LJZF 3PNVA 4E70A 3H9JA 3AG4H 2K86A 3P9KA 5FLXZ 3W6KB 2R7XA 1P9QC 3K70C 4DIQA 1D1AA 5HOOA 3WG7H 2HXIA 2KRFA 5ILUA 3S3OA 1OPCA 5AONA 1I6XA 1IV8A 2JPBA 3HOXJ 4AIHA 2IS1A 3WTUC 4HDUA 1PVEA 2XAGA 2GWRA 2HPIA 3ULQB 1WKMA 2J5OA 1SVMA 1KQ8A 1HSTA 3IRRA 1MJ9A 3I53A 4JYKA 3OOPA 3MQ0A 2MH2A 1OYIA 5H6RA 1ZN2A 2OCEA 1X2NA 3H9GA 3HB9A 1H8AC 2JTVA 2CGPA 3BTCA 5GTHC 4OIPF 3ZQHA 4RGUA 4GCVA 2EIKH 1Y8RB 3QP5A 5GTIC 2K9MA 3G6EI 1Y0NA 2KDZA 2V9KA 3D5LA 1APLC 2VPLA 3K69A 2PLYA 1JUPA 3UNGC 4A3KJ 1D0ZA 2CUZA 2M4KA 3HGGA 5EGOB 1ZGAA 3PUFA 5IT9Z 3F8NA 2L9RA 1LJ9A 1YS6A 2ZJQF 5FRNA 3GWZA 5LGUA 2KZGA 4EGYA 2L9SA 2FNPA 4GYIA 2ACJA 2LDUA 3BR0A 4IVNA 4UNOA 1MMSA 2IS2A 4KYWA 1FMWA 1HA8A 2ELKA 2RN7A 4X1EA 4XLFA 5FFZA 1G8XA 2KMUA 2FBIA 2VL8A 4L9JA 3HRUA 3HOSA 2WAFA 1Z3YA 2F5FA 4MQ9F 1KQ0A 1QGPA 1QHHD 3CTAA 1XGMA 2OCCH 3VB2A 3QP6A 5LHGA 5JLXA 5L3BA 3LA3A 3SQNA 1GV5A 5K5QA 4YIIA 1JJ6C 3W2AA 1EV7A 5J4YA 1ETVA 1ZR4A 1UAAA 2O6GE 3RZOJ 1HQCA 2MC4A 3PNYA 2BYVE 1UELB 4CZCA 4MIMA 1YRNA 5ICGA 5JVGF 4XONA 3LA2A 1MBHA 2W4SA 3ABMH 2OC6A 2JA2A 1XSDA 1P92A 1OFCX 4B4CA 3RYPA 2KP6A 2VKVA 2JA5J 2XSDC 1R4NB 2RKHA 1ETKA 2DO7A 3M1CA 2X6OA 2ICWG 4HLYA 3S15J 3PFYA 1HSJA 3BZKA 1J59A 2GBYA 5BOXA 3RKWA 4RDUA 4N4NB 3QQAA 1B4AA 1TLHB 2HQ5A 1MZBA 4L18B 2M5WA 2Z16A 4E7ZA 4AC0A 2QQ8A 4M9SA 1BIBA 2KFDA 2ELJA 2PN6A 2HS5A 5FKLA 1S3JA 3SZPA 3K4NA 3LSMA 1AKHA 2NRAC 1PUEE 4KFCA 4YRVA 4G7OF 3K7AJ 1ZK8A 1O3RA 2G9WA 2DODA 2UV1A 4G12A 3T0YA 1D3YA 3CMYA 1W36D 3CMAI 1Z77A 1ZHFA 1REPC 2LH9A 1ZAOA 2ZMEC 1FY7A 2PX9A 5FKMA 3JRFA 2FX0A 1KONA 2MGQA 5D5UB 2FD5A 3DQVC 3TDUC 3HDDA 3JSPA 1R5HA 1K6OA 1G59A 2E1NA 4JBAA 2DMUA 1WSUA 2JUGA 1GVDA 2OA4A 3RPQA 3T8TA 2BY1A 1RUOA 4C2TA 3A2KA 4RAYA 4KNYA 1YG2A 1MSEC 1IO2A 3MN2A 4HLXA 5J40A 4DYRA 3FMSA 4Z2YA 1U2WA 2HNHA 2E2HJ 2WV0A 5IP7J 4HX4A 2Z5UA 2ZXJA 2B7EA 5DYMA 3IAS2 1TQIA 4R79A 1XCBA 5CLSA 4PFOA 1AOYA 1NG6A 2BVMA 3ZQCA 3CF2A 2OU2A 2V79A 1YLFA 3B6AA 1FZPB 1FLIA 2F5VA 1IRXA 2K9QA 4AIDA 1BI2A 2QZ8A 2Z9OA 2HR3A 4HQEA 1MBJA 3FHZA 4D5CA 2CW8A 3S1RJ 4UXNA 2VE9A 2GA1A 2R7SA 2DN0A 4QPQA 2RQPA 3DTIA 3TOAA 4RBOA 1OKRA 2YX7A 2DYRH 1RC9A 5EEGA 2LKSA 1JUSA 2M7BA 2XAHA 3BDDA 3KP6A 5F1JA 4MTDA 3EPZA 4AM3A 3H3ZA 1MBFA 2P4WA 3HOTA 4BDZA 2V1XA 4M72A 3GBGA 3KP5A 2M34A 1V54H 4HSTA 1TT5B 1SD6A 2CW7A 2UWMA 3MZYA 2VOPA 3WGIA 4XORA 3RPUA 3B73A 2HPMA 4RA2A 1ZELA 4IEJA 4HNUA 4IRHA 5E3MA 4OOIA 2R5YB 2H8RA 1QA6A 4ESJA 3FBNB 4S04A 3IHUA 2PMUA 5LLQA 3ONQA 3SZGA 3LA7A 2IW5A 2EZIA 2MYSA 2OV7A 3DCFA 1VF9A 2LY9A 3HZJA 3FKIJ 3L2RA 1TBXA 1DDNA 3RQ4A 3LSIA 3E1SA 2ME0A 3S1NJ 2RDPA 3OYMA 1R6RA 5K5OA 3SDBA 5BS6A 2LY2A 4J00A 2ZNYA 4YFNF 1FT9A 2CW0F 2IPQX 3V7CA 2WY8Q 3DU6A 3FIWA 4IHXA 3K1PA 3DPLC 3H0GJ 2F48A 2PI0A 4W1UA 1B1BA 2ZMEA 2QUFA 5KK1A 3CUQC 3L9FA 5M3MJ 3H0DA 5GPAA 4IQ4A 3S2DJ 2W48A 3M1EA 2KISA 4A3IJ 3SXYA 1W4MA 2OQGA 2ZNZA 3OYHA 3DTEA 3BT9A 1X1AA 4I2OA 2LSOA 3VPRA 4KIFA 4LB5A 2K02A 3J80K 4OINF 5L3FA 1R5ID 1WJFA 4A3DJ 1O3TA 3QPHA 1U9NA 2OPTA 2ZB9A 2XGEA 3BLYA 4CCLA 2P81A 3DKXA 2EFWA 2R7WA 3LAPA 1HKSA 5CPRB 2BV6A 1CGPA 1I1GA 1LE8B 3IL2A 2P7CB 2VQGA 3VEPA 3HOZJ 5F08A 4BE0A 2EFOA 3QOEA 3D1NI 1B59A 3LMMA 5JI6A 2VONA 3FZVA 2EV6A 2PG4A 2XRNA 1I3QJ 3PUBA 3SDGA 3M3YJ 2VE8A 4IZZA 2PEXA 4XLPF 4U0YA 3ZMZA 3GFIA 1YW7A 2ZC2A 3MKLA 2FQ3A 4B1RA 3F8FA 1Y8QB 1K7AA 1SFUA 1VQ8I 2A68F 5F0HA 2R7VA 3GTQJ 2CFXA 1YJ9I 3JRCA 3IAM2 1IUYA 5EEAA 2BXYA 4BQQA 3I0TA 1SVOA 4GFBA 3E5QA 1RNLA 4NNJA 4OWRB 4MHGA 4P9FA 4XKCA 3ZPLA 2O7OA 5KAIC 1XS9A 3WTWC 2JWTA 4EM1A 1VQMI 3KYCB 4FX0A 4A5NA 2DDAA 2XF6A 1IN8A 1JI8A 3BPVA 2PJRB 4A69C 4U7BA 1HW1A 1ULYA 1WI9A 4ZDOA 4XM3A 2Q0OA 5FB2A 3GEZA 3BG5A 1LQ1A 3SFIA 1DP3A 2OZ6A 2KRHA 1DQUA 1FOWA 3I56I 1VQ9I 1FSEA 2XVCA 3ZMVA 4MQVA 2BHYA 3CUQA 1XB4A 2JN6A 3FWEA 4S0HB 4L0ZB 1X4OA 3HRMA 1ZH5A 2FNAA 5HVQC 1D1CA 2CO5A 4IOCF 5DM7F 4HNVA 1KYWA 3CJTB 1H9TA 1OCRH 2A6TA 1IRZA 5IOYA 1L3LA 2VJ4A 1TQPA 3HBLA 3WGHA 3CDLA 1PYVA 2LTPA 2RV8A 2RNJA 3OV8A 3ZCOA 3N05A 2CQKA 4ITVA 3GFMA 4I98B 1XMAA 1O7LA 1G3TA 4C3HJ 2DFEA 1H0MA 4PUSA 3ZGKA 3ECOA 2DLLA 3HSRA 4JQFA 1W7PD 3DXJF 2ADUA 3BG7A 2JPCA 2WAQA 5ERIA 4QWQA 4BHBA 3DTKA 1TNSA 2XDVA 3GO5A 2XAJA 2AXTC 4BE2A 4KN7X 2R7OA 3MFKA 2IGKA 1RPWA 4J01A 4UV9A 2D45A 3J7ZI 4HPQA 1VQOI 1YS7A 2WAEA 3BC8A 3M07A 1NK2P 3I4NJ 3K1NA 2LP0A 1ZRDA 1W7PB 1F5TA 3D5SC 4IJAA 4Q4ZF 2GXGA 2KJCA 3QODA 3A0BC 5AIQA 3HEFA 4O3MA 4HV5A 3ZN1A 4LITA 3P7NA 5DM6F 3KCCA 3JRDA 5A2QZ 4N9IA 5C44J 2FJ1A 2LG4A 1B8IB 4GO1A 2V6EA 3B6CA 2GAUA 4KITB 2R5ZB 1R49A 3Q9SA 2L02A 1GUUA 3AKZA 3JSOA 1BC8C 2K9LA 2E34A 1X3ZB 3RI4A 2DMQA 4BJTA 1JTXA 5CVIA 1Z6RA 3H36A 2EIMH 2XKOA 3GTOJ 1NK3P 5LRSA 1IDZA 2O8XA 2G7UA 4XRFA 1V5EA 3MMYB 2AQFA 3F8BA 4ESBA 4BQNA 3SHFA 1P6RA 5HS8A 2JA8J 3EUKL 2R7ZJ 1IDYA 2Y0SN 4LG0A 2A6EF 1A6IA 4UB6C 1Z7UA 3C2GA 2KPMA 1JKOC 3D5RC 3KLNA 1BJAA 4BU2A 1JTYA 1MBKA 1QZYA 2MFZA 4CUGA 5LBQA 1R00A 3CCUI 1UHMA 2ZFWA 3N97A 1D0YA 2VKDA 2F5CA 3C7JA 2XKPA 1QZZA 1VQLI 1SVLA 4HF1A 3DEEA 3ZQ7A 4WCGA 2XF7A 4ZYHA 1XSXA 3CP8A 1LVKA 1A35A 4A6DA 2B9SA 4F3QA 5IYCJ 2K3FA 4BEHB 2OAZA 4XSXF 1ZARA 3L2WA 3CCLI 5FLXK 4E7SA 2QSGX 2PFBA 5FFXA 3WTYC 2I8DA 5CYVA 4ZTJA 4G6QA 1TL8A 1XGNA 2IEKA 3E7LA 3RZDJ 5JR3A 2I5UA 4G7HF 1P4AA 4DYQA 4WF2A 1IV6A 4E6KG 2O8KA 5HLIA 5FKOA 5M3FJ 2HOTA 4LIUA 4I99C 5LHIA 3TEDA 4A0YA 1H9GA 3OYJA 4IXAA 4XKWA 1BR2A 4UUSB 3J7AY 4M3EA 1H88C 1ETQA 2M7AA 3LFKA 3U1KA 2DPUA 2TRTA 3R4KA 4ZJZA 1B9NA 3MD2A 3L2VA 1Z91A 3RDIA 3GVAA 1LDDA 1SMTA 2HVQA 2LVSA 4HF0A 4XK4A 1BI1A 1ENHA 2WTEA 3CO7C 2CYYA 1ZGJA 1ZG3A 5D8LB 1A36A 3PM1A 1ZREA 1OCTC 4BBRJ 1Z21A 1OJLA 3CCVI 2IP2A 1HOMA 4NQWA 4A3LJ 2EPFA 2HZDA 2DAOA 2DBBA 5IT9K 2MABA 2XAUA 4XQFA 1HLVA 2CU7A 3IRQA 5BNGA 4BQAA 4G7ZF 4DQ2A 2FUG2 2DFIA 1EH7A 1X2MA 1BL0A 1ZRFA 4U7DA 2XB0X 2M1BA 4FTHA 4RM2A 4C30A 2DK8A 4EQQA 3H3UA 3OYLA 2L3DA 3HOUJ 2K4BA 3KZZA 3I54A 4PZJA 4I7HA 1YO5C 5K7FA 1OCOH 2YX4A 4EJTA 2ECBA 4HZFA 2QBYB 1I39A 2HTJA 1WJBA 4LB6B 3RJPA 1A6QA 2DU9A 2EK5A 4KJZA 1AU7A 1SFKA 3GZ6A 1J7KA 2F4MB 2TDXA 1DU0A 3RCOA 2LRDA 3AL0C 5FD5A 2E7XA 3ML6A 3F23A 4LLNA 1ZYRF 3H35A 2HQAA 1A31A 4KUMA 3CCRI 1HKQA 5F64A 3K10A 2X1DA 2DJNA 2XGDA 2BVLA 2DA1A 5K7ZA 4IHYA 4BXUA 1FYKA 2MLKA 5E3NA 1W5CC 1P4XA 3OSFA 4H4KC 4M6XA 5B1BH 2EJRA 3B02A 3BWGA 4B47A 2KL4A 5DDGA 2QA4I 5M5YJ 1T0FA 3GTGJ 1RESA 2VUMJ 1YIJI 1J09A 5J6XA 4LGWA 2R4GA 2FRHA 2FQ4A 2RREA 3QYEA 1WRJA 2HGCA 1BJZA 3K6GA 1BIAA 1O4XA 4A3EJ 2DOEA 1JJ8C 3E6CC 2VXDA 2WBMA 4RLQA 1RIOH 3TO6A 1GLNA 2IS6A 1HKTA 2E5NA 5JVTA 2FMLA 1F4KA 4A3BJ 4A3MJ 5DTDA 1PP8F 4G94A 2R7UA 1IW7F 3FXLA 1G3WA 1AKHB 4F55A 1I5ZA 3KX2A 4A3JJ 2X48A 1U8RA 4HF2A 3HSEA 2H8WA 2EBIA 4PFPA 1F36A 3HJEA 1EKEA 2DMNA 3I3LA 3K9TA 2VIXA 3JRBA 3ERED 4LD5A 1FWZA 1FBSA 3PIPF 2KJBA 4FX4A 4PGHA 2VKEA 2CV2A 2AS5F 4XRSG 4Y15A 5EJCA 2GXAA 2DA2A 3FK6A 4OMZA 3MZ8A 3OYBA 1MNMC 5HS9A 1MDMB 2OZUA 2DI3A 3GTMJ 3J7AO 1J5YA 2E1MC 2N8GA 2X6WA 2R7FA
chains in the Genus database with same CATH topology
1ZLKA 5DCMB 3JTGA 1O3SA 4KN4X 2K27A 2NNYA 3N4MA 1PP7U 5CVUA 1S7AA 3WG9A 4ZZDA 5E8GA 1OMIA 2BBYA 1LVAA 3F8CA 1XGOA 1O57A 2BE5F 2KKOA 3KLOA 5HDKA 4EGZA 3PFIA 5DD4A 3GW2A 4NB5A 2K7LA 4CGZA 4HDVA 3F72A 4IF4A 5BQTA 4U0VA 4LMYA 5DCFA 4IHTA 4L9NA 3V8KA 4YG2F 3F3XA 1Z05A 3JAMZ 1T39A 1R1VA 1JHHA 5D5WB 2Y48A 4B09A 3WE2A 5LRRA 1FBUA 2FA5A 2HKOA 3W6JB 5D4SA 3KEOA 3DPTA 3RKXA 1IF1A 1SAXA 4DNCA 2WWYA 3LQQA 4P55A 3I59B 5LGNA 2XAQA 2Z33A 1O3QA 3ZMDA 5LEKA 1I27A 1FP1D 1Q1HA 2PJPA 5DV5A 3M8FA 4GXOA 4CZZA 4I09A 2IRFG 4NHJA 5F1RA 4LLGF 1G4DA 2XGXA 2H09A 2FXAA 3I71A 1KU9A 3WTTC 3E6DA 4XLNF 1IXRC 4M9ZA 3IKVA 1TNTA 5J8CA 2UXXA 4I0BA 3LSTA 1JGSA 1HXDA 3DKWA 1KGSA 2QM3A 3C1DA 1MJBA 4RGXA 5CVVA 3QU3A 3EETA 4RAZA 3JTHA 3MZHA 2J5PA 3RYRA 1R23A 4OMYA 3PQJA 1F1ZA 3WTSC 2CSOA 3K1MA 1YTYA 4H0EA 4KIBA 4KT5C 2GIVA 3H92A 4ENMA 2BGCA 5AIPA 2HTSA 4L0YB 3TKYA 2V1UA 4BAYA 3GZ5A 5CVRA 1U5TB 2ISZA 2NAZA 3LWFA 1J2XA 3I58A 4I01A 1HBXG 5HLHA 3RKYA 1BC7C 4AVPA 3ZMTA 1IN5A 5E1ZB 2D1VA 4O6JA 1KU7A 1LNWA 1YFHA 2FBKA 4Y13A 5HDNA 2DTRA 2R3SA 3R6SA 5E17F 5A2QK 4G9YA 2COMA 2JSCA 4BHPA 3J81K 3QU6A 1LDJA 2P5KA 3HTSB 5L3EA 2YSRA 3NQOA 2LKPA 4EM0B 2ZCWA 4WXHA 3IWFA 4ZH4F 1XGSA 2XIGA 3ZN0A 3CLOA 4PDKA 1E17A 3R61A 3R0AA 1FC3A 2C6YA 1EH8A 2P5VA 1T98A 3DF8A 1LEBA 2L4MA 2DT5A 4MEYF 4MTEA 3FM5A 5K1YA 4HOBA 5LGTA 4OIRF 3BJ6A 1LDKB 2Y0MA 1IN6A 1I1SA 5D6FA 1SFXA 1R1UA 4CICA 1D8KA 4ENNA 1LEAA 1IXCA 1FOKA 1SFEA 2CWEA 4GYGA 4YIFA 1Y0UA 2VC1A 2W25A 2MBFA 1FNNA 3WU0A 1OYYA 2PMHA 3ZMUA 1K78B 4OIQF 5DUIA 1IAWA 2GQQA 4RGRA 3GF2A 4FHTA 4LK1F 1G6NA 1YQAA 1OR7A 1B6AA 4M74A 3BOQA 2XROA 2RC4A 3HHHA 2PQ8A 5E18F 3REOA 3ABTA 2P7VB 1R22A 3RTRA 1JHFA 5E8IA 2A6HF 5JFRA 5ILSA 3KEQA 1O7FA 1CF7B 2LF7A 1GXPA 2W85A 1W5SA 1AWCA 2VBXA 5E20A 3KETA 2VODA 2O61A 1ZLJA 2FF4A 3KZYA 2JT1A 3WTZA 2STWA 4KDPA 5L3GA 3JW4A 4UVAA 3FMQA 1BBYA 3L2CA 2GA2A 4YFXF 2AXLA 1R36A 2K4JA 2HYFA 1GXQA 3F21A 4M71A 3E5UA 5H6QA 1STZA 3GXOA 3E6BA 4HYEA 2GXBA 2Q8KA 1S29A 5D6EA 3V8LA 3O2PE 2D2WA 3TO7A 3ISPA 3MAJA 5CJ9A 3K0LA 1IZ1A 2P6SA 4M9XA 5D5VB 3VOEA 2JRTA 1TW3A 3Q9VA 3FXQA 1FBQA 3QAHA 3COAC 2VBWA 3KP2A 1A04A 3CO6C 3VODA 3SZTA 3QOPA 3T8RA 5E1WA 5TRDA 3WTXC 2ISYA 3FF5A 3M8EA 2V9VA 1KA8A 3KP3A 1Z9CA 3BZ6A 3LQRA 4RB3C 2NNNA 4QLCU 1W7PA 4UVBA 1MD0A 2XAFA 5ILVA 2LF8A 2MA3A 5JHUA 4PGGA 1USTA 5J8FA 2ESNA 4WWCA 2BEOA 2A5YB 4U88A 1ON1A 1T38A 3P9IA 1FYMA 2XV4S 3JAMK 3EUHA 4G8XA 1LB2A 2G7HA 2PBIA 1NHAA 3F6OA 3HYIA 3FXRA 2VT2A 1WQ2A 2VOOA 4RB2C 2VC0A 1MGTA 1UHWA 2X4HA 3HRSA 4ZYGA 2FU4A 4LK0F 2EFQA 1J0RA 2EA2A 4R1HA 4AIJA 3FMRA 5LEJA 2QLZA 4RB1A 2FOKA 4UV8A 4EVIA 2UZKA 4IRGA 3TGNA 3QPTA 3U1DA 5FD6A 2Z99A 1F9NA 3I5UA 4Q5SF 4N9HA 3L09A 2MD5A 4ETSA 2STTA 3L00A 3ZMSA 4BYYA 2FBHA 4L9VA 3BJAA 2L01A 2MLGA 3S2WA 2FE3A 4A5MA 4KICA 5FGMA 3AAFA 4BHCA 2Z3YA 3WU1B 4IHSA 3WODF 4L5JA 3Q5FA 2O3FA 1RI7A 4Q48A 2B0LA 2QBYA 2H94A 5BPDA 2QYOA 3HTUA 2DPDA 4AD9A 4XSZF 4RS8A 2OD5A 3ECHA 2W84A 5F6FA 2ZBKA 1BOAA 4MGRA 4CXFA 1RUNA 1TQMA 4UUVA 2WC2A 4RGSA 1J75A 2F5EA 3RIRA 2L4AA 3WE3A 2IVMA 3D0SA 2ZMEB 4KIGA 4A2UA 3F8MA 1PDNC 1OYWA 4BH9A 2ZJ2A 1T6SA 1D8JA 2A3SA 3TO9A 3MWMA 4Y17A 4EMSA 2HQRA 2M87A 2GZWA 2HOEA 3TDZC 2FMYA 1DUXC 4UHTA 3WTVC 2H6CA 1Z1DA 1TW2A 2QQBA 3FX3A 5D4RA 3V7RA 1BM9A 2H27A 1MJAA 4JK1X 2RVCA 2HEOA 2IA2A 4R8HA 3M9AA 4WXDA 4HBLA 3U2RA 4N0BA 1MDMA 1YW9A 5KVRA 5FO5A 4HAMA 5DCMA 5L3CA 3L7WA 2IJLA 4CYDA 1XCVA 2UXNA 3BROA 2A07F 2V6CA 4CO8A 4ENKA 4LFUA 4L9TA 1G3SA 1ZRCA 2VXZA 4HX7A 2KIUA 4ESFA 4IRIA 1WWXA 2MH9A 2KIMA 3E97A 4P9UA 1USSA 1X3UA 1XN7A 4WK8F 4UVCA 3CUQB 3HUGA 1GVJA 3MCZA 4HQMA 1ZG5A 5EEHA 1R58A 2EV0A 2EFNA 3DP7A 4PCQA 4K2EA 1JE8A 2MC3A 2LNBA 4ZZLA 1P2FA 2HDCA 3G73A 1DPUA 5ED4A 4CHUA 5K5RA 3BJOA 5DEQA 5BPIA 3LAJA 2P5LC 5HLGA 1YIOA 4ON0A 1U78A 5DUKA 1RZ4A 2HQNA 3DEUA 3IWZA 5BMZA 4AIKA 3NRVA 4P5OA 4A0XA 1KU2A 4M6YA 1KYZA 1QPMA 2HZTA 2HFHA 3I59A 1HW5A 2VT3A 3VFZA 3DV8A 4M73A 1U5TC 4ENJA 2HWVA 4F7ZA 3HIFA 2DQRA 1L0OC 2ESHA 2HYGD 4B8XA 1HW2A 1W5TA 1EH6A 3V7SA 1S8NA 1IXSB 2XHKA 3CJNA 3HHGA 1U6GA 1YW8A 2OQRA 3QRFF 5L3DA 4D0PA 1BI3A 2QQ9A 2E1CA 5LHHA 2KIFA 4XBFA 4LG0B 1YYVA 4GGGA 2O03A 4KMFA 3KP7A 2ELHA 3E5XA 2ZO4A 5ICFA 1GHCA 3GLXA 3PQKA 3O6BB 2DK5A 3E3VA 1IRGA 3ABUA 3F22A 3FXUA 4Q47A 1XDUA 1G3YA 1FP2A 2NYXA 2EWNA 3TQNA 1XMKA 4LLLA 4KA4A 4EJUA 1ODDA 4O5VA 1R7JA 1QQIA 1IN7A 5E1XA 2M8EA 4AWXB 2IA1A 1KU3A 2VN2A 1U5TA 3EQLF 2JZYA 2DQLA 3HSFA 1D5VA 5TJJA 3U9GA 2Q2EA 1UFMA 3P9CA 4I02A 5ICCA 4WX9A 1V4RA 2Y75A 1E2XA 3J80Z 2IT0A 1DP7P 4MNUA 1XD7A 1FSHA 4A6EA 2A61A 5IT3A 4ZYEA 4TV7A 2M45A 3V4GA 1UCRA 3T5XA 2XASA 1FX7A 5H20A 3ROUA 1ZG1A 2V1DA 1FPQA 3C3WA 2OBPA 4EM2A 4EJOA 2XUBA 3F6VA 2EFPA 2QVOA 4ASNA 3KP4A 3K2ZA 2CG4A 2EB7A 2EV5A 2O0YA 1T2KA 3CDHA 5DD8A 3WGGA 3KFWX 2P6TA 3J81Z 2F5DA 4IPAA 2ZKZA 4HX8A 1BN5A 1B9MA 2NS0A 3I64A 1XSVA 1U3EM 3NEUA 1XDSA 3HRTA 4I0AA 1IN4A 1J9IA 3GFJA 2ETHA 4ZYDA 2FSWA 2A69F 1TTYA 4EJWA 1VTNC 1ON2A 2VBZA 1IRFA 3ZP5A 4G6DA 4CDGA 2W24A 4L5IA 5D5XB 2QWWA 4P96A 5HS7A 1SD7A 2FEZA 4A12A 3V8JA 3IKTA 3T1BA 3KE2A 4HV6A 4YFKF 3GX4X 6PAXA 4S05A 4OIOF 3EYYA 4MEXF 2QENA 3GFLA 2HKXA 2X0LA 5ICEA 1SD5A 2VBYA 1Z6TA 1P4WA 3I4PA 1S7OA 2QQAA 3SFZA 4EJVA 2R7DA 1DPRA 1S6LA 2DW4A 1K78A 3BY6A 3C18A 3EDPA 4HA8A 2YPRA 1SMYF 3CUOA 1QNTA 1K79A 2YR2A 4EV0A 3GYHX 1FYLA 4KMUX 3IC7A 1UB9A 2IA0A 2YU3A 4RB0A 1R5GA 3MEXA 1C0WA 1SD4A 2M30A 3M7GA 3E6MA 4HW0A 4BNCA 3G3ZA 1ONVA 3EYIA 4U0WA 3DFGA 2L54A 1R1TA 2W57A 1CF7A 4WXCA 3BP8A 3R0JA 2D1HA 2EA4A 2RGVA 1QBJA 5HDGA 1JXSA 3BPXA 1QO0D 1BI0A 3GUDA 1V3FA 3ELKA 3TOBA 5D8KB 3R60A 4OU0A 2P8TA 3FM3A 2H6BA 4FT8A 2E7WA 4A0ZA 1MKMA 5CVJA 2F2EA 1KQ9A 3O3KA 4E70A 4LJZF 5FLXZ 2K86A 3P9KA 3W6KB 5HOOA 5ILUA 2KRFA 1OPCA 5AONA 1I6XA 2JPBA 4AIHA 3WTUC 4HDUA 2XAGA 2GWRA 3ULQB 1WKMA 2J5OA 1KQ8A 1HSTA 3IRRA 1MJ9A 3I53A 3OOPA 3MQ0A 2MH2A 1OYIA 5H6RA 1ZN2A 2JTVA 2CGPA 4OIPF 4RGUA 4GCVA 3QP5A 3D5LA 3K69A 2PLYA 1ZGAA 5IT9Z 3F8NA 1LJ9A 1YS6A 3GWZA 5LGUA 4EGYA 4GYIA 2FNPA 2ACJA 2LDUA 4IVNA 4UNOA 4KYWA 2RN7A 5FFZA 2FBIA 4L9JA 3HRUA 3HOSA 2F5FA 4MQ9F 1KQ0A 1QGPA 3CTAA 1XGMA 3VB2A 3QP6A 5LHGA 5L3BA 3LA3A 3SQNA 5K5QA 4YIIA 1EV7A 2O6GE 1HQCA 2BYVE 5ICGA 3LA2A 1XSDA 1P92A 3RYPA 2RKHA 2DO7A 4HLYA 1HSJA 1J59A 5BOXA 3RKWA 1B4AA 1TLHB 1MZBA 4L18B 2M5WA 4M9SA 1BIBA 2PN6A 2HS5A 1S3JA 3SZPA 2NRAC 1PUEE 4KFCA 4G7OF 1O3RA 2G9WA 3T0YA 1D3YA 1REPC 1ZHFA 1ZAOA 1FY7A 5D5UB 3DQVC 3TDUC 3JSPA 1R5HA 1K6OA 2E1NA 4JBAA 1WSUA 3T8TA 1RUOA 2OA4A 3RPQA 4RAYA 4KNYA 1YG2A 4HLXA 3FMSA 4Z2YA 1U2WA 2WV0A 4HX4A 2Z5UA 2ZXJA 5DYMA 1TQIA 4R79A 1XCBA 5CLSA 1AOYA 2OU2A 2V79A 1YLFA 1FZPB 1FLIA 1BI2A 2QZ8A 2Z9OA 2HR3A 4HQEA 3FHZA 4UXNA 2VE9A 2GA1A 2RQPA 3TOAA 1OKRA 2YX7A 5EEGA 4MTDA 3BDDA 2XAHA 3KP6A 3H3ZA 3HOTA 2V1XA 4M72A 3KP5A 1SD6A 2UWMA 3MZYA 2VOPA 3WGIA 3RPUA 3B73A 4IRHA 4OOIA 4ESJA 4S04A 3IHUA 2PMUA 5LLQA 3LA7A 2IW5A 1DDNA 1TBXA 2RDPA 5K5OA 5BS6A 2ZNYA 4YFNF 1FT9A 2CW0F 2IPQX 3V7CA 3K1PA 3DPLC 2PI0A 1B1BA 2ZMEA 2QUFA 5KK1A 3CUQC 3L9FA 3M1EA 3SXYA 1W4MA 2OQGA 2ZNZA 4I2OA 2LSOA 4KIFA 4LB5A 2K02A 3J80K 4OINF 5L3FA 1O3TA 3QPHA 2EFWA 3LAPA 1HKSA 2BV6A 1CGPA 1I1GA 3IL2A 2P7CB 3VEPA 2EFOA 5JI6A 1B59A 2VONA 3FZVA 2EV6A 2PG4A 2XRNA 2VE8A 2PEXA 4XLPF 4U0YA 3ZMZA 3GFIA 1YW7A 2FQ3A 3F8FA 1K7AA 1SFUA 2A68F 2CFXA 1IUYA 3I0TA 3E5QA 1RNLA 4MHGA 4P9FA 3ZPLA 3WTWC 4EM1A 4FX0A 4A5NA 1IN8A 3BPVA 4U7BA 1HW1A 1ULYA 1WI9A 2Q0OA 5FB2A 3GEZA 1LQ1A 2OZ6A 1FSEA 2XVCA 3ZMVA 4MQVA 3FWEA 3CUQA 1XB4A 4L0ZB 3HRMA 1ZH5A 2FNAA 5HVQC 2CO5A 1KYWA 1H9TA 1L3LA 1TQPA 3WGHA 2RV8A 2RNJA 3OV8A 2CQKA 3GFMA 4I98B 1XMAA 1O7LA 1G3TA 1H0MA 3ECOA 2DLLA 3HSRA 4JQFA 1W7PD 3DXJF 2ADUA 2JPCA 5ERIA 4QWQA 4BHBA 1TNSA 3GO5A 2XAJA 4KN7X 3MFKA 4UV9A 2D45A 1YS7A 3K1NA 1ZRDA 1W7PB 1F5TA 4IJAA 4Q4ZF 2GXGA 2KJCA 5AIQA 4O3MA 4HV5A 3ZN1A 3P7NA 3KCCA 5A2QZ 4N9IA 4GO1A 2GAUA 3Q9SA 2L02A 3JSOA 1BC8C 3RI4A 5CVIA 1Z6RA 2XKOA 5LRSA 2O8XA 2G7UA 4XRFA 4ESBA 5HS8A 3F8BA 3SHFA 1P6RA 4LG0A 2A6EF 1Z7UA 3KLNA 1BJAA 1QZYA 5LBQA 1R00A 1UHMA 2ZFWA 3N97A 2F5CA 3C7JA 2XKPA 1QZZA 4HF1A 3ZQ7A 4WCGA 4ZYHA 1XSXA 4A6DA 2OAZA 4XSXF 1ZARA 5FLXK 2PFBA 5FFXA 3WTYC 5CYVA 4G6QA 1XGNA 5JR3A 4G7HF 1P4AA 4WF2A 5HLIA 5LHIA 4A0YA 1H9GA 4IXAA 3LFKA 2DPUA 3R4KA 1B9NA 1Z91A 3RDIA 3GVAA 1LDDA 1SMTA 4HF0A 1BI1A 2WTEA 3CO7C 2CYYA 1ZGJA 1ZG3A 5D8LB 1ZREA 2IP2A 4NQWA 2DAOA 2DBBA 5IT9K 3IRQA 4BQAA 4G7ZF 4DQ2A 2DFIA 1EH7A 1ZRFA 4U7DA 2M1BA 2DK8A 4EQQA 3H3UA 2L3DA 2K4BA 3KZZA 3I54A 4PZJA 4I7HA 1YO5C 2YX4A 4EJTA 4HZFA 2QBYB 2HTJA 4LB6B 3RJPA 2DU9A 2EK5A 3GZ6A 1J7KA 2TDXA 5FD5A 2E7XA 3ML6A 3F23A 4LLNA 1ZYRF 4KUMA 1HKQA 5F64A 4BXUA 1FYKA 2MLKA 1P4XA 4M6XA 2EJRA 3B02A 3BWGA 5DDGA 1T0FA 5J6XA 4LGWA 2FRHA 1WRJA 2HGCA 1BIAA 3E6CC 1RIOH 3TO6A 1HKTA 5JVTA 2FMLA 1F4KA 1PP8F 4G94A 1IW7F 1G3WA 1I5ZA 1U8RA 4HF2A 3HSEA 3K9TA 3ERED 4LD5A 1FWZA 1FBSA 2KJBA 4FX4A 4PGHA 2AS5F 4Y15A 4OMZA 5HS9A 1MDMB 2OZUA 2DI3A 3J7AO 1J5YA 2P4WA 2R7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLK A;  5DCM B;  3JTG A;  1O3S A;  4KN4 X;  2K27 A;  2NNY A;  3N4M A;  1PP7 U;  5CVU A;  1S7A A;  3WG9 A;  4ZZD A;  5E8G A;  1OMI A;  2BBY A;  1LVA A;  3F8C A;  1XGO A;  1O57 A;  2BE5 F;  2KKO A;  3KLO A;  5HDK A;  4EGZ A;  3PFI A;  5DD4 A;  3GW2 A;  4NB5 A;  2K7L A;  4CGZ A;  4HDV A;  3F72 A;  4IF4 A;  5BQT A;  4U0V A;  4LMY A;  5DCF A;  4IHT A;  4L9N A;  3V8K A;  4YG2 F;  3F3X A;  1Z05 A;  3JAM Z;  1T39 A;  1R1V A;  1JHH A;  5D5W B;  2Y48 A;  4B09 A;  3WE2 A;  5LRR A;  1FBU A;  2FA5 A;  2HKO A;  3W6J B;  5D4S A;  3KEO A;  3DPT A;  3RKX A;  1IF1 A;  1SAX A;  4DNC A;  2WWY A;  3LQQ A;  4P55 A;  3I59 B;  5LGN A;  2XAQ A;  2Z33 A;  1O3Q A;  3ZMD A;  5LEK A;  1I27 A;  1FP1 D;  1Q1H A;  2PJP A;  5DV5 A;  3M8F A;  4GXO A;  4CZZ A;  4I09 A;  2IRF G;  4NHJ A;  5F1R A;  4LLG F;  1G4D A;  2XGX A;  2H09 A;  2FXA A;  3I71 A;  1KU9 A;  3WTT C;  3E6D A;  4XLN F;  1IXR C;  4M9Z A;  3IKV A;  1TNT A;  5J8C A;  2UXX A;  4I0B A;  3LST A;  1JGS A;  1HXD A;  3DKW A;  1KGS A;  2QM3 A;  3C1D A;  1MJB A;  4RGX A;  5CVV A;  3QU3 A;  3EET A;  4RAZ A;  3JTH A;  3MZH A;  2J5P A;  3RYR A;  1R23 A;  4OMY A;  3PQJ A;  1F1Z A;  3WTS C;  2CSO A;  3K1M A;  1YTY A;  4H0E A;  4KIB A;  4KT5 C;  2GIV A;  3H92 A;  4ENM A;  2BGC A;  5AIP A;  2HTS A;  4L0Y B;  3TKY A;  2V1U A;  4BAY A;  3GZ5 A;  5CVR A;  1U5T B;  2ISZ A;  2NAZ A;  3LWF A;  1J2X A;  3I58 A;  4I01 A;  1HBX G;  5HLH A;  3RKY A;  1BC7 C;  4AVP A;  3ZMT A;  1IN5 A;  5E1Z B;  2D1V A;  4O6J A;  1KU7 A;  1LNW A;  1YFH A;  2FBK A;  4Y13 A;  5HDN A;  2DTR A;  2R3S A;  3R6S A;  5E17 F;  5A2Q K;  4G9Y A;  2COM A;  2JSC A;  4BHP A;  3J81 K;  3QU6 A;  1LDJ A;  2P5K A;  3HTS B;  5L3E A;  2YSR A;  3NQO A;  2LKP A;  4EM0 B;  2ZCW A;  4WXH A;  3IWF A;  4ZH4 F;  1XGS A;  2XIG A;  3ZN0 A;  3CLO A;  4PDK A;  1E17 A;  3R61 A;  3R0A A;  1FC3 A;  2C6Y A;  1EH8 A;  2P5V A;  1T98 A;  3DF8 A;  1LEB A;  2L4M A;  2DT5 A;  4MEY F;  4MTE A;  3FM5 A;  5K1Y A;  4HOB A;  5LGT A;  4OIR F;  3BJ6 A;  1LDK B;  2Y0M A;  1IN6 A;  1I1S A;  5D6F A;  1SFX A;  1R1U A;  4CIC A;  1D8K A;  4ENN A;  1LEA A;  1IXC A;  1FOK A;  1SFE A;  2CWE A;  4GYG A;  4YIF A;  1Y0U A;  2VC1 A;  2W25 A;  2MBF A;  1FNN A;  3WU0 A;  1OYY A;  2PMH A;  3ZMU A;  1K78 B;  4OIQ F;  5DUI A;  1IAW A;  2GQQ A;  4RGR A;  3GF2 A;  4FHT A;  4LK1 F;  1G6N A;  1YQA A;  1OR7 A;  1B6A A;  4M74 A;  3BOQ A;  2XRO A;  2RC4 A;  3HHH A;  2PQ8 A;  5E18 F;  3REO A;  3ABT A;  2P7V B;  1R22 A;  3RTR A;  1JHF A;  5E8I A;  2A6H F;  5JFR A;  5ILS A;  3KEQ A;  1O7F A;  1CF7 B;  2LF7 A;  1GXP A;  2W85 A;  1W5S A;  1AWC A;  2VBX A;  5E20 A;  3KET A;  2VOD A;  2O61 A;  1ZLJ A;  2FF4 A;  3KZY A;  2JT1 A;  3WTZ A;  2STW A;  4KDP A;  5L3G A;  3JW4 A;  4UVA A;  3FMQ A;  1BBY A;  3L2C A;  2GA2 A;  4YFX F;  2AXL A;  1R36 A;  2K4J A;  2HYF A;  1GXQ A;  3F21 A;  4M71 A;  3E5U A;  5H6Q A;  1STZ A;  3GXO A;  3E6B A;  4HYE A;  2GXB A;  2Q8K A;  1S29 A;  5D6E A;  3V8L A;  3O2P E;  2D2W A;  3TO7 A;  3ISP A;  3MAJ A;  5CJ9 A;  3K0L A;  1IZ1 A;  2P6S A;  4M9X A;  5D5V B;  3VOE A;  2JRT A;  1TW3 A;  3Q9V A;  3FXQ A;  1FBQ A;  3QAH A;  3COA C;  2VBW A;  3KP2 A;  1A04 A;  3CO6 C;  3VOD A;  3SZT A;  3QOP A;  3T8R A;  5E1W A;  5TRD A;  3WTX C;  2ISY A;  3FF5 A;  3M8E A;  2V9V A;  1KA8 A;  3KP3 A;  1Z9C A;  3BZ6 A;  3LQR A;  4RB3 C;  2NNN A;  4QLC U;  1W7P A;  4UVB A;  1MD0 A;  2XAF A;  5ILV A;  2LF8 A;  2MA3 A;  5JHU A;  4PGG A;  1UST A;  5J8F A;  2ESN A;  4WWC A;  2BEO A;  2A5Y B;  4U88 A;  1ON1 A;  1T38 A;  3P9I A;  1FYM A;  2XV4 S;  3JAM K;  3EUH A;  4G8X A;  1LB2 A;  2G7H A;  2PBI A;  1NHA A;  3F6O A;  3HYI A;  3FXR A;  2VT2 A;  1WQ2 A;  2VOO A;  4RB2 C;  2VC0 A;  1MGT A;  1UHW A;  2X4H A;  3HRS A;  4ZYG A;  2FU4 A;  4LK0 F;  2EFQ A;  1J0R A;  2EA2 A;  4R1H A;  4AIJ A;  3FMR A;  5LEJ A;  2QLZ A;  4RB1 A;  2FOK A;  4UV8 A;  4EVI A;  2UZK A;  4IRG A;  3TGN A;  3QPT A;  3U1D A;  5FD6 A;  2Z99 A;  1F9N A;  3I5U A;  4Q5S F;  4N9H A;  3L09 A;  2MD5 A;  4ETS A;  2STT A;  3L00 A;  3ZMS A;  4BYY A;  2FBH A;  4L9V A;  3BJA A;  2L01 A;  2MLG A;  3S2W A;  2FE3 A;  4A5M A;  4KIC A;  5FGM A;  3AAF A;  4BHC A;  2Z3Y A;  3WU1 B;  4IHS A;  3WOD F;  4L5J A;  3Q5F A;  2O3F A;  1RI7 A;  4Q48 A;  2B0L A;  2QBY A;  2H94 A;  5BPD A;  2QYO A;  3HTU A;  2DPD A;  4AD9 A;  4XSZ F;  4RS8 A;  2OD5 A;  3ECH A;  2W84 A;  5F6F A;  2ZBK A;  1BOA A;  4MGR A;  4CXF A;  1RUN A;  1TQM A;  4UUV A;  2WC2 A;  4RGS A;  1J75 A;  2F5E A;  3RIR A;  2L4A A;  3WE3 A;  2IVM A;  3D0S A;  2ZME B;  4KIG A;  4A2U A;  3F8M A;  1PDN C;  1OYW A;  4BH9 A;  2ZJ2 A;  1T6S A;  1D8J A;  2A3S A;  3TO9 A;  3MWM A;  4Y17 A;  4EMS A;  2HQR A;  2M87 A;  2GZW A;  2HOE A;  3TDZ C;  2FMY A;  1DUX C;  4UHT A;  3WTV C;  2H6C A;  1Z1D A;  1TW2 A;  2QQB A;  3FX3 A;  5D4R A;  3V7R A;  1BM9 A;  2H27 A;  1MJA A;  4JK1 X;  2RVC A;  2HEO A;  2IA2 A;  4R8H A;  3M9A A;  4WXD A;  4HBL A;  3U2R A;  4N0B A;  1MDM A;  1YW9 A;  5KVR A;  5FO5 A;  4HAM A;  5DCM A;  5L3C A;  3L7W A;  2IJL A;  4CYD A;  1XCV A;  2UXN A;  3BRO A;  2A07 F;  2V6C A;  4CO8 A;  4ENK A;  4LFU A;  4L9T A;  1G3S A;  1ZRC A;  2VXZ A;  4HX7 A;  2KIU A;  4ESF A;  4IRI A;  1WWX A;  2MH9 A;  2KIM A;  3E97 A;  4P9U A;  1USS A;  1X3U A;  1XN7 A;  4WK8 F;  4UVC A;  3CUQ B;  3HUG A;  1GVJ A;  3MCZ A;  4HQM A;  1ZG5 A;  5EEH A;  1R58 A;  2EV0 A;  2EFN A;  3DP7 A;  4PCQ A;  4K2E A;  1JE8 A;  2MC3 A;  2LNB A;  4ZZL A;  1P2F A;  2HDC A;  3G73 A;  1DPU A;  5ED4 A;  4CHU A;  5K5R A;  3BJO A;  5DEQ A;  5BPI A;  3LAJ A;  2P5L C;  5HLG A;  1YIO A;  4ON0 A;  1U78 A;  5DUK A;  1RZ4 A;  2HQN A;  3DEU A;  3IWZ A;  5BMZ A;  4AIK A;  3NRV A;  4P5O A;  4A0X A;  1KU2 A;  4M6Y A;  1KYZ A;  1QPM A;  2HZT A;  2HFH A;  3I59 A;  1HW5 A;  2VT3 A;  3VFZ A;  3DV8 A;  4M73 A;  1U5T C;  4ENJ A;  2HWV A;  4F7Z A;  3HIF A;  2DQR A;  1L0O C;  2ESH A;  2HYG D;  4B8X A;  1HW2 A;  1W5T A;  1EH6 A;  3V7S A;  1S8N A;  1IXS B;  2XHK A;  3CJN A;  3HHG A;  1U6G A;  1YW8 A;  2OQR A;  3QRF F;  5L3D A;  4D0P A;  1BI3 A;  2QQ9 A;  2E1C A;  5LHH A;  2KIF A;  4XBF A;  4LG0 B;  1YYV A;  4GGG A;  2O03 A;  4KMF A;  3KP7 A;  2ELH A;  3E5X A;  2ZO4 A;  5ICF A;  1GHC A;  3GLX A;  3PQK A;  3O6B B;  2DK5 A;  3E3V A;  1IRG A;  3ABU A;  3F22 A;  3FXU A;  4Q47 A;  1XDU A;  1G3Y A;  1FP2 A;  2NYX A;  2EWN A;  3TQN A;  1XMK A;  4LLL A;  4KA4 A;  4EJU A;  1ODD A;  4O5V A;  1R7J A;  1QQI A;  1IN7 A;  5E1X A;  2M8E A;  4AWX B;  2IA1 A;  1KU3 A;  2VN2 A;  1U5T A;  3EQL F;  2JZY A;  2DQL A;  3HSF A;  1D5V A;  5TJJ A;  3U9G A;  2Q2E A;  1UFM A;  3P9C A;  4I02 A;  5ICC A;  4WX9 A;  1V4R A;  2Y75 A;  1E2X A;  3J80 Z;  2IT0 A;  1DP7 P;  4MNU A;  1XD7 A;  1FSH A;  4A6E A;  2A61 A;  5IT3 A;  4ZYE A;  4TV7 A;  2M45 A;  3V4G A;  1UCR A;  3T5X A;  2XAS A;  1FX7 A;  5H20 A;  3ROU A;  1ZG1 A;  2V1D A;  1FPQ A;  3C3W A;  2OBP A;  4EM2 A;  4EJO A;  2XUB A;  3F6V A;  2EFP A;  2QVO A;  4ASN A;  3KP4 A;  3K2Z A;  2CG4 A;  2EB7 A;  2EV5 A;  2O0Y A;  1T2K A;  3CDH A;  5DD8 A;  3WGG A;  3KFW X;  2P6T A;  3J81 Z;  2F5D A;  4IPA A;  2ZKZ A;  4HX8 A;  1BN5 A;  1B9M A;  2NS0 A;  3I64 A;  1XSV A;  1U3E M;  3NEU A;  1XDS A;  3HRT A;  4I0A A;  1IN4 A;  1J9I A;  3GFJ A;  2ETH A;  4ZYD A;  2FSW A;  2A69 F;  1TTY A;  4EJW A;  1VTN C;  1ON2 A;  2VBZ A;  1IRF A;  3ZP5 A;  4G6D A;  4CDG A;  2W24 A;  4L5I A;  5D5X B;  2QWW A;  4P96 A;  5HS7 A;  1SD7 A;  2FEZ A;  4A12 A;  3V8J A;  3IKT A;  3T1B A;  3KE2 A;  4HV6 A;  4YFK F;  3GX4 X;  6PAX A;  4S05 A;  4OIO F;  3EYY A;  4MEX F;  2QEN A;  3GFL A;  2HKX A;  2X0L A;  5ICE A;  1SD5 A;  2VBY A;  1Z6T A;  1P4W A;  3I4P A;  1S7O A;  2QQA A;  3SFZ A;  4EJV A;  2R7D A;  1DPR A;  1S6L A;  2DW4 A;  1K78 A;  3BY6 A;  3C18 A;  3EDP A;  4HA8 A;  2YPR A;  1SMY F;  3CUO A;  1QNT A;  1K79 A;  2YR2 A;  4EV0 A;  3GYH X;  1FYL A;  4KMU X;  3IC7 A;  1UB9 A;  2IA0 A;  2YU3 A;  4RB0 A;  1R5G A;  3MEX A;  1C0W A;  1SD4 A;  2M30 A;  3M7G A;  3E6M A;  4HW0 A;  4BNC A;  3G3Z A;  1ONV A;  3EYI A;  4U0W A;  3DFG A;  2L54 A;  1R1T A;  2W57 A;  1CF7 A;  4WXC A;  3BP8 A;  3R0J A;  2D1H A;  2EA4 A;  2RGV A;  1QBJ A;  5HDG A;  1JXS A;  3BPX A;  1QO0 D;  1BI0 A;  3GUD A;  1V3F A;  3ELK A;  3TOB A;  5D8K B;  3R60 A;  4OU0 A;  2P8T A;  3FM3 A;  2H6B A;  4FT8 A;  2E7W A;  4A0Z A;  1MKM A;  5CVJ A;  2F2E A;  1KQ9 A;  3O3K A;  4E70 A;  4LJZ F;  5FLX Z;  2K86 A;  3P9K A;  3W6K B;  5HOO A;  5ILU A;  2KRF A;  1OPC A;  5AON A;  1I6X A;  2JPB A;  4AIH A;  3WTU C;  4HDU A;  2XAG A;  2GWR A;  3ULQ B;  1WKM A;  2J5O A;  1KQ8 A;  1HST A;  3IRR A;  1MJ9 A;  3I53 A;  3OOP A;  3MQ0 A;  2MH2 A;  1OYI A;  5H6R A;  1ZN2 A;  2JTV A;  2CGP A;  4OIP F;  4RGU A;  4GCV A;  3QP5 A;  3D5L A;  3K69 A;  2PLY A;  1ZGA A;  5IT9 Z;  3F8N A;  1LJ9 A;  1YS6 A;  3GWZ A;  5LGU A;  4EGY A;  4GYI A;  2FNP A;  2ACJ A;  2LDU A;  4IVN A;  4UNO A;  4KYW A;  2RN7 A;  5FFZ A;  2FBI A;  4L9J A;  3HRU A;  3HOS A;  2F5F A;  4MQ9 F;  1KQ0 A;  1QGP A;  3CTA A;  1XGM A;  3VB2 A;  3QP6 A;  5LHG A;  5L3B A;  3LA3 A;  3SQN A;  5K5Q A;  4YII A;  1EV7 A;  2O6G E;  1HQC A;  2BYV E;  5ICG A;  3LA2 A;  1XSD A;  1P92 A;  3RYP A;  2RKH A;  2DO7 A;  4HLY A;  1HSJ A;  1J59 A;  5BOX A;  3RKW A;  1B4A A;  1TLH B;  1MZB A;  4L18 B;  2M5W A;  4M9S A;  1BIB A;  2PN6 A;  2HS5 A;  1S3J A;  3SZP A;  2NRA C;  1PUE E;  4KFC A;  4G7O F;  1O3R A;  2G9W A;  3T0Y A;  1D3Y A;  1REP C;  1ZHF A;  1ZAO A;  1FY7 A;  5D5U B;  3DQV C;  3TDU C;  3JSP A;  1R5H A;  1K6O A;  2E1N A;  4JBA A;  1WSU A;  3T8T A;  1RUO A;  2OA4 A;  3RPQ A;  4RAY A;  4KNY A;  1YG2 A;  4HLX A;  3FMS A;  4Z2Y A;  1U2W A;  2WV0 A;  4HX4 A;  2Z5U A;  2ZXJ A;  5DYM A;  1TQI A;  4R79 A;  1XCB A;  5CLS A;  1AOY A;  2OU2 A;  2V79 A;  1YLF A;  1FZP B;  1FLI A;  1BI2 A;  2QZ8 A;  2Z9O A;  2HR3 A;  4HQE A;  3FHZ A;  4UXN A;  2VE9 A;  2GA1 A;  2RQP A;  3TOA A;  1OKR A;  2YX7 A;  5EEG A;  4MTD A;  3BDD A;  2XAH A;  3KP6 A;  3H3Z A;  3HOT A;  2V1X A;  4M72 A;  3KP5 A;  1SD6 A;  2UWM A;  3MZY A;  2VOP A;  3WGI A;  3RPU A;  3B73 A;  4IRH A;  4OOI A;  4ESJ A;  4S04 A;  3IHU A;  2PMU A;  5LLQ A;  3LA7 A;  2IW5 A;  1DDN A;  1TBX A;  2RDP A;  5K5O A;  5BS6 A;  2ZNY A;  4YFN F;  1FT9 A;  2CW0 F;  2IPQ X;  3V7C A;  3K1P A;  3DPL C;  2PI0 A;  1B1B A;  2ZME A;  2QUF A;  5KK1 A;  3CUQ C;  3L9F A;  3M1E A;  3SXY A;  1W4M A;  2OQG A;  2ZNZ A;  4I2O A;  2LSO A;  4KIF A;  4LB5 A;  2K02 A;  3J80 K;  4OIN F;  5L3F A;  1O3T A;  3QPH A;  2EFW A;  3LAP A;  1HKS A;  2BV6 A;  1CGP A;  1I1G A;  3IL2 A;  2P7C B;  3VEP A;  2EFO A;  5JI6 A;  1B59 A;  2VON A;  3FZV A;  2EV6 A;  2PG4 A;  2XRN A;  2VE8 A;  2PEX A;  4XLP F;  4U0Y A;  3ZMZ A;  3GFI A;  1YW7 A;  2FQ3 A;  3F8F A;  1K7A A;  1SFU A;  2A68 F;  2CFX A;  1IUY A;  3I0T A;  3E5Q A;  1RNL A;  4MHG A;  4P9F A;  3ZPL A;  3WTW C;  4EM1 A;  4FX0 A;  4A5N A;  1IN8 A;  3BPV A;  4U7B A;  1HW1 A;  1ULY A;  1WI9 A;  2Q0O A;  5FB2 A;  3GEZ A;  1LQ1 A;  2OZ6 A;  1FSE A;  2XVC A;  3ZMV A;  4MQV A;  3FWE A;  3CUQ A;  1XB4 A;  4L0Z B;  3HRM A;  1ZH5 A;  2FNA A;  5HVQ C;  2CO5 A;  1KYW A;  1H9T A;  1L3L A;  1TQP A;  3WGH A;  2RV8 A;  2RNJ A;  3OV8 A;  2CQK A;  3GFM A;  4I98 B;  1XMA A;  1O7L A;  1G3T A;  1H0M A;  3ECO A;  2DLL A;  3HSR A;  4JQF A;  1W7P D;  3DXJ F;  2ADU A;  2JPC A;  5ERI A;  4QWQ A;  4BHB A;  1TNS A;  3GO5 A;  2XAJ A;  4KN7 X;  3MFK A;  4UV9 A;  2D45 A;  1YS7 A;  3K1N A;  1ZRD A;  1W7P B;  1F5T A;  4IJA A;  4Q4Z F;  2GXG A;  2KJC A;  5AIQ A;  4O3M A;  4HV5 A;  3ZN1 A;  3P7N A;  3KCC A;  5A2Q Z;  4N9I A;  4GO1 A;  2GAU A;  3Q9S A;  2L02 A;  3JSO A;  1BC8 C;  3RI4 A;  5CVI A;  1Z6R A;  2XKO A;  5LRS A;  2O8X A;  2G7U A;  4XRF A;  4ESB A;  5HS8 A;  3F8B A;  3SHF A;  1P6R A;  4LG0 A;  2A6E F;  1Z7U A;  3KLN A;  1BJA A;  1QZY A;  5LBQ A;  1R00 A;  1UHM A;  2ZFW A;  3N97 A;  2F5C A;  3C7J A;  2XKP A;  1QZZ A;  4HF1 A;  3ZQ7 A;  4WCG A;  4ZYH A;  1XSX A;  4A6D A;  2OAZ A;  4XSX F;  1ZAR A;  5FLX K;  2PFB A;  5FFX A;  3WTY C;  5CYV A;  4G6Q A;  1XGN A;  5JR3 A;  4G7H F;  1P4A A;  4WF2 A;  5HLI A;  5LHI A;  4A0Y A;  1H9G A;  4IXA A;  3LFK A;  2DPU A;  3R4K A;  1B9N A;  1Z91 A;  3RDI A;  3GVA A;  1LDD A;  1SMT A;  4HF0 A;  1BI1 A;  2WTE A;  3CO7 C;  2CYY A;  1ZGJ A;  1ZG3 A;  5D8L B;  1ZRE A;  2IP2 A;  4NQW A;  2DAO A;  2DBB A;  5IT9 K;  3IRQ A;  4BQA A;  4G7Z F;  4DQ2 A;  2DFI A;  1EH7 A;  1ZRF A;  4U7D A;  2M1B A;  2DK8 A;  4EQQ A;  3H3U A;  2L3D A;  2K4B A;  3KZZ A;  3I54 A;  4PZJ A;  4I7H A;  1YO5 C;  2YX4 A;  4EJT A;  4HZF A;  2QBY B;  2HTJ A;  4LB6 B;  3RJP A;  2DU9 A;  2EK5 A;  3GZ6 A;  1J7K A;  2TDX A;  5FD5 A;  2E7X A;  3ML6 A;  3F23 A;  4LLN A;  1ZYR F;  4KUM A;  1HKQ A;  5F64 A;  4BXU A;  1FYK A;  2MLK A;  1P4X A;  4M6X A;  2EJR A;  3B02 A;  3BWG A;  5DDG A;  1T0F A;  5J6X A;  4LGW A;  2FRH A;  1WRJ A;  2HGC A;  1BIA A;  3E6C C;  1RIO H;  3TO6 A;  1HKT A;  5JVT A;  2FML A;  1F4K A;  1PP8 F;  4G94 A;  1IW7 F;  1G3W A;  1I5Z A;  1U8R A;  4HF2 A;  3HSE A;  3K9T A;  3ERE D;  4LD5 A;  1FWZ A;  1FBS A;  2KJB A;  4FX4 A;  4PGH A;  2AS5 F;  4Y15 A;  4OMZ A;  5HS9 A;  1MDM B;  2OZU A;  2DI3 A;  3J7A O;  1J5Y A;  2P4W A;  2R7F A; 
#chains in the Genus database with same CATH topology
 1ZLK A;  3GTJ J;  4HEA 2;  5DCM B;  1Y6I A;  3JTG A;  4Y7N J;  3OMY A;  1O3S A;  4KN4 X;  2K27 A;  3K4J A;  3BTJ A;  2NNY A;  4A3G J;  3N4M A;  1PP7 U;  4CCM A;  4JX4 A;  3CCQ I;  1UMQ A;  2ZXI A;  4XLA A;  5CVU A;  1S7A A;  1X1B A;  3WG9 A;  4ZZD A;  2K40 A;  5E8G A;  1OMI A;  4ANJ A;  3BQY A;  2EZH A;  2BOL A;  1MBG A;  3HXL A;  2VI6 A;  1MMG A;  2BBY A;  1VZ0 A;  5FKN A;  1LVA A;  2JUC A;  1JKR C;  2XF5 A;  4F92 B;  1U0J A;  3BR5 A;  3F8C A;  2QEX I;  1XGO A;  4BY1 J;  1LUJ B;  1O57 A;  2BE5 F;  2KKO A;  3KLO A;  4EEF G;  5HNH A;  5HDK A;  1ETY A;  1JKQ C;  3OL4 A;  3PFI A;  4EGZ A;  5DD4 A;  3GW2 A;  3BQZ A;  4LOC A;  4NB5 A;  1BR1 A;  2K7L A;  4CGZ A;  3HUG B;  3FXM A;  4HDV A;  3F72 A;  3A01 A;  3HC7 A;  4IF4 A;  5BQT A;  1Y1W J;  1FIP A;  3DU5 A;  2JA6 J;  2CQX A;  2LOO A;  4U0V A;  4LMY A;  5DCF A;  3IP4 B;  1R9T J;  2CFO A;  4IHT A;  5F0C A;  4L9N A;  2HVS A;  3V8K A;  4YG2 F;  2NVU B;  3LNQ A;  2X1C A;  3F3X A;  1Z05 A;  3JAM Z;  3ESW B;  3RKQ A;  2LRE A;  1T39 A;  1ZQ3 P;  4NC6 A;  2QGU A;  1R1V A;  4PJJ A;  2X1E A;  4NUB A;  5IY5 H;  1JHH A;  5D5W B;  2LBF A;  1MIJ A;  3NWT A;  2K5C A;  2CUE A;  2Y48 A;  2H1K A;  4B09 A;  3WE2 A;  2W00 A;  2ZSI B;  5LRR A;  1FBU A;  2FA5 A;  2HKO A;  2DT6 A;  2ME6 A;  3W6J B;  5D4S A;  2FOW A;  3KEO A;  4DZJ A;  3DPT A;  3RKX A;  3FXJ A;  3OS1 A;  1SAX A;  1IF1 A;  1BR4 A;  4DNC A;  4PSW A;  2WWY A;  3LQQ A;  2VJJ A;  2BW3 B;  2YUS A;  4P55 A;  3I59 B;  5LGN A;  2JA7 J;  2XAQ A;  2Z33 A;  1O3Q A;  2QF7 A;  2K85 A;  2NOG A;  3ZRG A;  3ZMD A;  4XL9 A;  5LEK A;  4II2 A;  1SC7 A;  3GTL J;  1I27 A;  1FP1 D;  1WH5 A;  2HU9 A;  3FK7 A;  3I55 I;  1Q1H A;  3S1Q J;  3H3V K;  5EF6 A;  2ZFU A;  1G2H A;  4F91 B;  2PJP A;  3W6V A;  4OAY A;  1PJR A;  4RM3 A;  5DV5 A;  4FQG A;  3M8F A;  4GXO A;  1VQ5 I;  3KEY A;  1IG7 A;  1UG0 A;  3OWT A;  2LFB A;  4F52 A;  4CZZ A;  2E5Z A;  5LFA A;  4I09 A;  2H1L A;  3CME I;  2IRF G;  2PMZ N;  4NHJ A;  2PMZ A;  5F1R A;  4LLG F;  3OYD A;  3OSG A;  1G4D A;  4AUX A;  1HF0 A;  2XGX A;  2H09 A;  2JRM A;  1T95 A;  4UY8 I;  1WPK A;  3ZXS A;  5GAH J;  2FXA A;  3CC2 I;  4EAT A;  5IOZ A;  5KCM A;  2B63 J;  3NAR A;  3I71 A;  4BKX A;  3GZN B;  4PJM A;  5EGO A;  2LD5 A;  2DCE A;  1KU9 A;  3BTL A;  5F04 A;  3WTT C;  3K4B A;  1DGW Y;  1SFO J;  1EJ9 A;  3E6D A;  3F0C A;  1IXR C;  4XLN F;  4M9Z A;  3IKV A;  1TNT A;  5J8C A;  5LD2 C;  2NXN B;  2UXX A;  3HGY A;  4M6V A;  4I0B A;  3LST A;  2JMW A;  1JGS A;  1VQN I;  1W36 C;  1HXD A;  3DKW A;  1Z7L A;  4QPO A;  1KGS A;  2QM3 A;  2DJI A;  3C1D A;  1MJB A;  4RGX A;  1W0T A;  5F0F A;  5CVV A;  3QU3 A;  1LFP A;  3EET A;  4RAZ A;  3QYB A;  2BY3 A;  1RR8 C;  3JTH A;  4XOT A;  3MZH A;  3SYT A;  2O9L A;  2J5P A;  3SEZ A;  3RYR A;  1R23 A;  4OMY A;  3PQJ A;  1F1Z A;  4Y4R A;  3S17 J;  3WTS C;  2CSO A;  2DMT A;  3K1M A;  1YTY A;  2L7M P;  4H0E A;  4KIB A;  4KT5 C;  5IYD J;  2GIV A;  3H92 A;  3TL4 X;  4NC7 A;  4ENM A;  1ZTR A;  2BGC A;  5AIP A;  2HTS A;  1Y39 A;  1AA7 A;  1V55 H;  2MW8 A;  1WH7 A;  2ID6 A;  4L0Y B;  2CV1 A;  1S5L C;  3TKY A;  2V1U A;  4BAY A;  1OCC H;  3GZ5 A;  5CVR A;  1U5T B;  5CKT A;  1QRY A;  2ISZ A;  5EDN A;  2IAI A;  4J19 A;  2NAZ A;  3LWF A;  4C2U A;  2G0E A;  1QHG A;  4IHW A;  1J2X A;  2Q2E B;  2E71 A;  3I58 A;  4W97 A;  2NVT J;  4HSR A;  1X1P A;  3LSG A;  4I01 A;  1XC5 A;  1TC3 C;  3HPG A;  3OYI A;  4E7K A;  1HBX G;  1MSF C;  4RMN A;  3BR3 A;  5HLH A;  2A05 A;  3OYA A;  3RKY A;  3WHC A;  1MMD A;  1BC7 C;  2E60 A;  4AVP A;  4BDY A;  3ZMT A;  2M2E A;  1IN5 A;  5E1Z B;  2D1V A;  4O6J A;  3E0J B;  5GP9 A;  2V1N A;  1LNW A;  1KU7 A;  1YFH A;  2FBK A;  3UR3 C;  5J4V A;  4F93 B;  1X58 A;  2HOS A;  2QCO A;  1VI0 A;  4Y13 A;  2VKH A;  5HDN A;  4BUP A;  2DFH A;  2DTR A;  2GOM A;  2R3S A;  2IS4 A;  1T8I A;  2HYJ A;  3A0H C;  3R6S A;  5E17 F;  4MFE A;  5A2Q K;  4G9Y A;  3K4M A;  2COM A;  2JSC A;  4BHP A;  2KDO A;  3J81 K;  1S9H A;  3QU6 A;  1LDJ A;  2P5K A;  3HTS B;  5L3E A;  1MND A;  2M0M A;  2AO9 A;  1B72 B;  2YSR A;  3NQO A;  5GPC A;  2OF7 A;  4IL6 C;  2LKP A;  2CQ7 A;  4ZYA A;  4EM0 B;  1BA5 A;  2ZCW A;  4XIC A;  4WXH A;  3IWF A;  1BW6 A;  3GCM A;  3EUA A;  4ZH4 F;  1XGS A;  2XIG A;  3ZN0 A;  1NH3 A;  2NS7 A;  3CLO A;  4PDK A;  4GDF A;  3S32 A;  3O8H A;  4A3F J;  1E17 A;  2KHM A;  3R61 A;  4DJA A;  3R0A A;  1FC3 A;  5M5X J;  1YJN I;  1JT6 A;  4CCO A;  2C6Y A;  1EH8 A;  3LSJ A;  3VYT B;  1H89 C;  2WY7 Q;  2P5V A;  1T98 A;  3DF8 A;  1LEB A;  2L4M A;  2DT5 A;  3A4C A;  4MEY F;  4MTE A;  2R5Y A;  2CUF A;  3FM5 A;  1PUF A;  5K1Y A;  1UHS A;  4HOB A;  3P5J A;  5LGT A;  4OIR F;  2GM4 A;  3BJ6 A;  1LDK B;  2BY0 A;  1IN6 A;  2Y0M A;  3CES A;  1MW7 A;  1QVU A;  4XMY A;  1SFX A;  5D6F A;  1R1U A;  4CIC A;  1D8K A;  4ENN A;  1LEA A;  1IXC A;  3A02 A;  3LOC A;  2WB1 A;  2EIL H;  2Y9Z A;  1FOK A;  1SFE A;  2CWE A;  2AQE A;  2O5R A;  4GYG A;  1K83 J;  3G4S I;  4YIF A;  1Y0U A;  2VC1 A;  3TMO A;  1X19 A;  2DTZ A;  2W25 A;  2IGN A;  2MBF A;  2L9N A;  1FNN A;  3TW6 A;  3WU0 A;  1LKX A;  1OYY A;  2WAQ N;  2PMH A;  2LR8 A;  2JQ7 A;  3ZMU A;  1K78 B;  4OIQ F;  3OIQ A;  4XR6 A;  2VQC A;  5DUI A;  2IBD A;  2KIQ A;  2Z2S B;  1IAW A;  4NBQ A;  2JSP A;  2GQQ A;  4RAF A;  4RGR A;  1OCP A;  2DOF A;  3VSK A;  3OIP A;  2OUM A;  2YS9 A;  3GF2 A;  4FHT A;  2R93 J;  3ZQI A;  5GAE J;  3CJQ B;  4LK1 F;  1G6N A;  2IXS A;  2L7K A;  1FJL A;  1TWC J;  1YQA A;  1MH4 A;  3S1M J;  1D1B A;  4NQW B;  2X85 A;  1OR7 A;  1B6A A;  4GRI A;  4M74 A;  3BOQ A;  5J1R A;  2XRO A;  2RC4 A;  3HHH A;  4ZDP A;  1T33 A;  2L0K A;  2PQ8 A;  1HDP A;  1K61 A;  2GLO A;  5E18 F;  3REO A;  1LE8 A;  4V19 K;  3ABT A;  3BCA A;  3VDX A;  2P7V B;  3CCM I;  4E7I A;  4BQO A;  4BL0 B;  4UB8 C;  1I6H J;  3K4K A;  1R22 A;  3SJM A;  3RTR A;  1JHF A;  4D5F A;  3L2Q A;  1FTT A;  2DXI A;  3LSK A;  2GOX B;  3NAU A;  5E8I A;  2A6H F;  5JFR A;  5ILS A;  3H5R A;  3KEQ A;  4FET A;  1O7F A;  1CF7 B;  3WU2 C;  2LF7 A;  4V2G A;  1GV2 A;  1GXP A;  2W85 A;  3QYF A;  4V2F A;  1W5S A;  3FHN A;  1AWC A;  1I1S A;  2VBX A;  5E20 A;  3KET A;  2VOD A;  2X6X A;  2O61 A;  1ZLJ A;  2FF4 A;  3KZY A;  4XNF A;  2JT1 A;  4CA0 A;  3WTZ A;  2STW A;  1LPQ A;  2LK2 A;  4IO9 F;  2CH0 A;  4MFD A;  3FXO A;  4KDP A;  5L3G A;  3JW4 A;  2K9N A;  4UVA A;  3JRG A;  3FMQ A;  1BBY A;  3L2C A;  2GA2 A;  4YFX F;  2AXL A;  1R36 A;  2K4J A;  2DA6 A;  2HYF A;  2R7T A;  1GXQ A;  1WJE A;  1F43 A;  3F21 A;  3LL7 A;  4M71 A;  3E5U A;  1TP4 A;  1STZ A;  1E3P A;  2M9H A;  3GXO A;  5H6Q A;  1WGX A;  2P0W A;  3E6B A;  4HYE A;  4CYC B;  2GXB A;  4ZTF A;  2ZSH B;  1FEX A;  5CQE A;  2Q8K A;  1S29 A;  5D6E A;  2E1O A;  2QSF X;  3V8L A;  4BXX J;  3O2P E;  1X1C A;  2D2W A;  1P7I A;  3EUH C;  3TO7 A;  2CRG A;  3ISP A;  3MAJ A;  3LSH A;  2R7Q A;  2L7Z A;  4XLE A;  5CJ9 A;  5M5W J;  5KNL A;  1GT0 C;  1T0F C;  4IKF A;  3K0L A;  2Y69 H;  1RR7 A;  1IZ1 A;  2BHZ A;  4CH7 A;  4Z6Y A;  2P6S A;  1GDT A;  4IHV A;  4M9X A;  5D5V B;  4D9J A;  4YEJ A;  3VOE A;  2DDB A;  2GIZ A;  2L2O A;  3HOW J;  2LLK A;  5E3L A;  1RRJ A;  2JRT A;  3JRA A;  1TW3 A;  3Q9V A;  3MVP A;  2R92 J;  1MMN A;  2EIJ H;  3FXQ A;  1FBQ A;  3QAH A;  3COA C;  2E2I J;  5C3E J;  2NVQ J;  1VQ7 I;  2VBW A;  3BTI A;  1EF4 A;  1A5J A;  2F4I A;  3C2H A;  3BCB A;  3KP2 A;  4I6Z A;  1A04 A;  3CO6 C;  3VOD A;  3SZT A;  4QSH A;  3QOP A;  3T8R A;  4DW6 A;  3DKY A;  5E1W A;  5TRD A;  5FLM J;  3HG9 A;  3CC4 I;  4HNT A;  3WTX C;  1T56 A;  4C3J J;  2ISY A;  3FF5 A;  2F6C A;  2V9V A;  3M8E A;  4XLH A;  1KA8 A;  1YI2 I;  1YX3 A;  3KP3 A;  1T08 B;  1V5G A;  1Z9C A;  4M3F A;  2VPR A;  3BZ6 A;  1SEU A;  3LQR A;  4UUT A;  4RB3 C;  2NNN A;  4NDL A;  3KIO A;  4DOZ A;  4QLC U;  1WVR A;  1W7P A;  1R4M B;  4UVB A;  1P7J A;  2XB5 A;  1MD0 A;  3K70 D;  5J3L A;  3VSL A;  1U8B A;  2XAF A;  1YHQ I;  4JX5 A;  3KYL A;  2W82 A;  2L9V A;  5ILV A;  4LG3 A;  4XID A;  3ZQF A;  5EYR A;  1B8I A;  2LF8 A;  2MA3 A;  3BG3 A;  2R5Z A;  5JHU A;  4PGG A;  1UST A;  5J8F A;  1XMX A;  2ESN A;  4WWC A;  2BEO A;  1Z3X A;  2A5Y B;  4U88 A;  4M3G A;  1ON1 A;  1T38 A;  1HC8 A;  3P9I A;  2M0C A;  5HLT A;  1FYM A;  1X3W B;  2DFF A;  2XV4 S;  4DGW B;  1YRN B;  2LC2 A;  1X1D A;  3JAM K;  5IP6 A;  4I76 A;  2ZXW H;  3EUH A;  1SAN A;  4G8X A;  4BAC A;  4G6T B;  3DEW A;  1LB2 A;  2G7H A;  2PBI A;  1NHA A;  3F6O A;  3HKZ N;  3HKZ A;  3HYI A;  3BZC A;  3BG6 A;  2VT2 A;  3FXR A;  1VFC A;  2BY2 A;  1WQ2 A;  2VOO A;  4RB2 C;  2XPW A;  2VC0 A;  3CMM A;  1MGT A;  1LFU P;  1UHW A;  2X4H A;  4D1Q A;  3HRS A;  3FBI B;  4ZYG A;  3LFU A;  2FU4 A;  2A5W A;  4XRM A;  4B44 A;  1S7E A;  1W0U A;  4LK0 F;  2EFQ A;  1J0R A;  1JUM A;  1ACI A;  2EA2 A;  2JVH A;  2X51 A;  5B5E C;  3OYG A;  4BEH A;  2DA5 A;  4D7N A;  4R1H A;  2EQR A;  5JLW A;  4AIJ A;  3FMR A;  5LEJ A;  2QLZ A;  1K4T A;  2WV1 A;  3OS2 A;  1WJD A;  5GAG J;  4RB1 A;  1VQK I;  2AHQ A;  4PSX A;  2MD0 A;  2FOK A;  4UV8 A;  1UZC A;  3W2W A;  4QTR A;  2E1M B;  1OQY A;  2V4J C;  3VWB A;  5KAF C;  4EVI A;  3DBR B;  2UZK A;  2DOA A;  3H9Q A;  4IRG A;  3CF5 F;  1LFB A;  2OTL I;  3TGN A;  4KIS A;  4UUS A;  1ETO A;  3QPT A;  2ECC A;  2ZJR F;  3U1D A;  1TWG J;  4FE7 A;  3OYF A;  5FD6 A;  2Z99 A;  1F9N A;  3QPS A;  3I5U A;  1JGG A;  5FJ8 J;  4Q5S F;  2E2J J;  3RPU D;  4N9H A;  4U87 A;  3JRI A;  3L09 A;  2MD5 A;  3S14 J;  4RLF A;  4ETS A;  2CMP A;  3S3M A;  3PNT A;  2HXO A;  2STT A;  2I10 A;  3L00 A;  3FXK A;  4IOA F;  3ZMS A;  4BYY A;  2FBH A;  4L9V A;  3OR1 C;  3BJA A;  4XKB A;  4CCN A;  2L01 A;  4D7M A;  2MLG A;  3S2W A;  3IV5 A;  5J1U A;  2FE3 A;  4A5M A;  1YE9 A;  4KIC A;  5FGM A;  3AAF A;  3ZQL A;  3TP3 A;  2D5V A;  4BHC A;  3DWL E;  2Z3Y A;  3WU1 B;  4IHS A;  3CCY A;  3WOD F;  3ZQG A;  4L5J A;  4FCY A;  5EG0 A;  1RKW A;  3Q5F A;  3IH4 A;  3CC7 I;  2O3F A;  1RI7 A;  4Q48 A;  2B0L A;  2QBY A;  2H94 A;  2VB6 A;  5BPD A;  2KQR A;  3ABL H;  2QYO A;  3HTU A;  1E3H A;  1IJW C;  1HDD C;  2DPD A;  1UJ8 A;  4AD9 A;  4XSZ F;  3IH2 A;  1FOX A;  1WJC A;  1TZL A;  2KT0 A;  2NOJ B;  4RS8 A;  3HOV J;  2HDW A;  3G71 I;  1VQP I;  2OD5 A;  1NG7 A;  3ECH A;  2W84 A;  3BR2 A;  5F6F A;  2ZBK A;  1BOA A;  4MGR A;  4CXF A;  3V42 A;  1RUN A;  2XPU A;  1TQM A;  2XPV A;  4ZC3 A;  4UUV A;  3S16 J;  2HVR A;  2WC2 A;  2MSY A;  2K9S A;  4RGS A;  1J75 A;  2F5E A;  3RIR A;  2L4A A;  3WE3 A;  2IVM A;  1FIA A;  3D0S A;  2ZME B;  4KIG A;  1ORK A;  2R0Q C;  4A2U A;  3F8M A;  1PDN C;  1OYW A;  4BH9 A;  2ZJ2 A;  3DPU A;  1T6S A;  2VJI A;  4YEL A;  4M3D A;  2XRL A;  4DBR A;  1D8J A;  2A3S A;  4XLC A;  3TO9 A;  2Z1D A;  3MWM A;  3Q0U A;  4Y17 A;  3OYK A;  3PL8 A;  2Y30 A;  4EMS A;  2HQR A;  2M87 A;  2GZW A;  2HOE A;  3TDZ C;  2BZT A;  2FMY A;  1DUX C;  3OOU A;  4UHT A;  1AHD P;  1IC8 A;  3ASN H;  2H6C A;  3WTV C;  3TP0 A;  1Z1D A;  4E7J A;  3Q0W A;  1TW2 A;  2QQB A;  3ASO H;  1DU6 A;  3FX3 A;  2ID3 A;  5D4R A;  3V7R A;  1BM9 A;  2JJ7 A;  2H27 A;  1MJA A;  1OCZ H;  4JK1 X;  2RVC A;  2HEO A;  2IA2 A;  1TWF J;  3PO3 J;  1I3A A;  4R8H A;  3M9A A;  4WXD A;  4HBL A;  3U2R A;  3CJR B;  1D5Y A;  3TBI A;  4N0B A;  2VAS A;  3HPH A;  3A1Y A;  1MDM A;  3OR2 C;  1YW9 A;  5KVR A;  5FO5 A;  2DYS H;  4XN0 A;  2V7F A;  4HAM A;  4E4H A;  3X2Q H;  2JK3 A;  5DCM A;  1MMA A;  1WI3 A;  5L3C A;  3L7W A;  2IJL A;  3OY9 A;  3BR1 A;  1FMV A;  2QKL B;  4BBS J;  1W1W E;  1XCV A;  4CYD A;  2UXN A;  3BRO A;  2A07 F;  2V9P A;  5EZG A;  5IP9 J;  2V6C A;  4CO8 A;  4HG2 A;  4ENK A;  4LFU A;  2ZJP F;  4L9T A;  1G3S A;  4BE1 A;  1ZRC A;  2VXZ A;  1D0X A;  4HX7 A;  2KIU A;  2HDD A;  3H5A A;  4ESF A;  4IRI A;  1IUF A;  2RAE A;  1RKT A;  2RQQ A;  1WWX A;  2MH9 A;  2KIM A;  1K4S A;  2K3P A;  1N25 A;  3E97 A;  4B3A A;  1USS A;  1X3U A;  1XN7 A;  4P9U A;  2Q1Z B;  5TIS C;  4WK8 F;  4N4O B;  4UVC A;  3OYN A;  2L5Q A;  1QZE A;  3CUQ B;  1UG2 A;  3HUG A;  4L5E A;  1GVJ A;  2X9D A;  3MCZ A;  3CZ6 A;  3OYC A;  4HQM A;  1ZG5 A;  2HI3 A;  1PUF B;  5EEH A;  1R58 A;  2EV0 A;  2EFN A;  3DP7 A;  3UKG A;  3W2V A;  4II3 A;  4PCQ A;  4K2E A;  1JE8 A;  2MC3 A;  2QKM B;  2LNB A;  2UUZ A;  1S72 I;  4XN3 A;  4ZZL A;  2Y2Z A;  3FIS A;  1P2F A;  5E79 C;  2W1O A;  3G73 A;  2HDC A;  1DPU A;  5ED4 A;  4CHU A;  5K5R A;  3G2B A;  3BJO A;  5DEQ A;  2KZV A;  5BPI A;  3LAJ A;  2CQQ A;  2P5L C;  3Q0V A;  5HLG A;  4B3X A;  3KYD B;  1YIO A;  3IH3 A;  4ON0 A;  5H2F C;  4KT6 A;  1U78 A;  5DUK A;  1RZ4 A;  3VYR B;  5C4X J;  9ANT A;  2HQN A;  1ZKG A;  3CDI A;  3BG9 A;  3ZOB A;  4FAS D;  3DEU A;  3IWZ A;  5BMZ A;  1R71 A;  1N77 A;  1VQ6 I;  4AIK A;  2HOA A;  3NRV A;  2VJ5 A;  1XPX A;  4P5O A;  2NVY J;  4A0X A;  2BW3 A;  1KU2 A;  4M6Y A;  3VYS B;  3S2H J;  1KYZ A;  1QPM A;  4E7L A;  3S3N A;  2HZT A;  2HFH A;  1RET A;  3I59 A;  2M8G X;  2KRC A;  3ZQQ A;  2DA7 A;  1HW5 A;  2VT3 A;  3RQI A;  3VFZ A;  2CV0 A;  3DV8 A;  3FDY A;  4C3I J;  4M73 A;  1U5T C;  4ENJ A;  2HWV A;  3WHB A;  2EZL A;  1XG1 A;  4F7Z A;  3HIF A;  3RSN A;  2DQR A;  1L0O C;  5B3S H;  2XGC A;  1OIS A;  2OTJ I;  2ESH A;  2HYG D;  4B8X A;  1HW2 A;  1W5T A;  4XRS A;  3PJR A;  1TT0 A;  3ABK H;  2X6Y A;  2CQN A;  4DBQ A;  2WA0 A;  1EH6 A;  3I9V 2;  1OR7 C;  3V7S A;  1S8N A;  3CCE I;  1IXS B;  3W3C A;  2DMP A;  2XHK A;  2F4O B;  3CJN A;  3HHG A;  1U6G A;  5J1Y A;  3AG3 H;  4ABZ A;  4OAZ A;  1YW8 A;  1WCM J;  2OQR A;  4JOM A;  5L3D A;  3QRF F;  4D0P A;  1ZR2 A;  1BI3 A;  2VLA A;  3G1L A;  4BJ6 C;  2QQ9 A;  2LY1 A;  2XSJ C;  4DYC A;  2E1C A;  1U9O A;  5LHH A;  2KIF A;  4XBF A;  4C2M J;  1OLT A;  4LG0 B;  1YYV A;  4GGG A;  4HRI A;  2O03 A;  3KPH A;  3CCJ I;  4KMF A;  5JHF A;  1Z67 A;  1WHU A;  2E19 A;  3M4O J;  4C9Y A;  3KP7 A;  2ELH A;  3E5X A;  3ZR8 X;  4CCJ A;  3L1P A;  2ZO4 A;  2W7N A;  5FLV A;  5ICF A;  4B48 A;  1GHC A;  3GLX A;  3PQK A;  3TW7 A;  2MG4 A;  3O6B B;  5TGT A;  2DK5 A;  5IPA A;  3E3V A;  1IRG A;  1MNE A;  3ABU A;  4Y52 J;  4IX7 A;  5DS9 A;  1N78 A;  3GTP J;  3F22 A;  4AVZ A;  3ERM A;  3FXU A;  4QIW N;  4Q47 A;  2WB1 N;  1Y1V J;  1BW5 A;  4IQJ A;  1TWH J;  1XDU A;  1Q1V A;  1G3Y A;  1XX5 A;  4BS9 A;  1FP2 A;  2NYX A;  3CP2 A;  2EWN A;  3TQN A;  4RAG A;  1XMK A;  4LLL A;  4KA4 A;  3JRE A;  4EJU A;  1ODD A;  3DBH B;  3H5N A;  1XTA A;  1R7J A;  4O5V A;  1QQI A;  4A93 J;  1IN7 A;  5E1X A;  1ZGW A;  2M8E A;  1FTZ A;  2WAD A;  4JX6 A;  5CQG A;  4AWX B;  2IA1 A;  2EH3 A;  1KU3 A;  2EIN H;  2M3A A;  2VN2 A;  1U5T A;  4PK4 A;  3EQL F;  2JZY A;  2QSH X;  2DQL A;  2LKX A;  3HSF A;  1D5V A;  5TJJ A;  4XKV A;  1Z0X A;  4LIV A;  3U9G A;  2CS3 A;  2Q2E A;  1UFM A;  3AG2 H;  3P9C A;  4I02 A;  3C2B A;  5ICC A;  2E36 A;  3M8J A;  4WX9 A;  1V4R A;  5EZH A;  2XC7 A;  2Y75 A;  3I4M J;  1ITY A;  3PO2 J;  3SEQ A;  2NVX J;  5B66 C;  2VQH A;  3JCU C;  4FIS A;  1E2X A;  3J80 Z;  5B1A H;  2IT0 A;  1DP7 P;  4MNU A;  1XD7 A;  1FSH A;  5KHD A;  2DA3 A;  2CUJ A;  1VQ4 I;  4A6E A;  2A61 A;  4FE4 A;  1MH3 A;  5IT3 A;  3U21 A;  4PJL A;  4ZYE A;  4TV7 A;  5GAD J;  5FRM A;  2M45 A;  3V4G A;  1UCR A;  3T5X A;  3MKW B;  3QPL A;  2XAS A;  1FX7 A;  5FKK A;  4X6A J;  3G1O A;  3AFH A;  1N75 A;  5H20 A;  3ROU A;  3GLL A;  4DZP A;  2V1D A;  1ZG1 A;  4BGD A;  1FPQ A;  2IGO A;  3C3W A;  3OS0 A;  1ETX A;  2OBP A;  2IGM A;  4EM2 A;  4EJO A;  2XUB A;  3F6V A;  2EFP A;  2QVO A;  4ASN A;  3MKZ A;  3BR6 A;  1VND A;  3K2Z A;  3KP4 A;  2R7R A;  4BXF A;  1FOY A;  2CG4 A;  2EB7 A;  2EV5 A;  3AG1 H;  1SAU A;  2O0Y A;  2KLO A;  3HM5 A;  1T2K A;  1YIT I;  3CDH A;  5DD8 A;  3WGG A;  2DA4 A;  3KFW X;  3JR9 A;  2P6T A;  3J81 Z;  2F5D A;  1B72 A;  4IPA A;  1WJA A;  2ZKZ A;  4HX8 A;  1BN5 A;  1B9M A;  2NS0 A;  3I64 A;  4YIR X;  1XSV A;  1U3E M;  3NEU A;  5FRO A;  5J47 A;  2CJJ A;  2RNG A;  1XDS A;  3HRT A;  2V26 A;  4I0A A;  1IN4 A;  1E0E A;  3NWS A;  1J9I A;  2PJR A;  1WFX A;  2Y0S A;  3GFJ A;  2ETH A;  4A3C J;  4ZYD A;  1I50 J;  1BOB A;  3Q3S A;  2ZXH A;  2FSW A;  2A69 F;  1TTY A;  3CD6 I;  4BY7 J;  4EJW A;  4NC8 A;  1ON2 A;  2VBZ A;  1VTN C;  2NS8 A;  1IRF A;  3ZP5 A;  1ETW A;  1WJ5 A;  2Y9Y A;  4G6D A;  4CDG A;  1Y56 A;  4BJ5 C;  5C4J J;  1HCR A;  2W24 A;  4L5I A;  5D5X B;  2QWW A;  4P96 A;  5E3O A;  3F9K A;  3K4L A;  4Y3O A;  5HS7 A;  5HNF A;  1SD7 A;  2L7F P;  2FEZ A;  1NTC A;  2LYC A;  1E3O C;  4PJ0 C;  1JKP C;  5IYB J;  4A12 A;  3V8J A;  3IKT A;  3T1B A;  3KE2 A;  4HV6 A;  4YFK F;  1QPI A;  3GX4 X;  6PAX A;  4S05 A;  4OIO F;  4MO7 A;  3EYY A;  4MEX F;  2BXZ A;  3DBL B;  3S93 A;  3HOY J;  2QEN A;  4ZDL A;  3GFL A;  2HKX A;  2X0L A;  5ICE A;  2Y31 A;  3QWL A;  1SD5 A;  2VBY A;  1Z6T A;  4CSW A;  1P4W A;  3I4P A;  1S7O A;  2QQA A;  3O8G A;  3SFZ A;  4CCK A;  4EJV A;  2R7D A;  1DPR A;  1YOV B;  2E35 A;  1S6L A;  2DW4 A;  1KZH A;  2LMD A;  1K78 A;  3G1M A;  3S8P A;  3PIO F;  3BY6 A;  3C18 A;  3GTK J;  3DLL F;  3EDP A;  4HA8 A;  1ERD A;  2YPR A;  1SMY F;  3CUO A;  1QNT A;  1YJW I;  1K79 A;  2YR2 A;  4EV0 A;  3GYH X;  1FYL A;  2DT7 B;  4PJN A;  4KMU X;  3IC7 A;  1UB9 A;  3IUO A;  3VYU B;  2IA0 A;  2YU3 A;  3AL0 B;  4RB0 A;  2VQL A;  4AU7 A;  1X4P A;  1MBE A;  3OIO A;  1R5G A;  3FKJ A;  4E7H A;  3MEX A;  1C0W A;  1SD4 A;  2M30 A;  3K2A A;  3M7G A;  5HOD A;  3E6M A;  4X0G A;  1V5F A;  4HW0 A;  4BNC A;  4Y33 A;  3OL3 A;  4AYB N;  4MLO A;  4AYB A;  3G3Z A;  5EG0 B;  1ONV A;  3A03 A;  3J7Y J;  1IGN A;  2EZK A;  3EYI A;  4U0W A;  3DFG A;  3A01 B;  3H1C A;  1YX5 A;  2L54 A;  1R1T A;  2W57 A;  1CF7 A;  1QU3 A;  4WXC A;  1POG A;  2JVG A;  3BP8 A;  3R0J A;  2D1H A;  5K7H A;  1TWA J;  2EA4 A;  1QVT A;  2RGV A;  3GME A;  4XOP A;  1QBJ A;  5HDG A;  3PSI A;  3CQZ J;  1JXS A;  4P1W A;  3BPX A;  1QO0 D;  1DGR M;  3DLA A;  1BI0 A;  3GUD A;  1V3F A;  3ELK A;  3TOB A;  3JRH A;  2YU9 J;  5D8K B;  3OYE A;  3CCS I;  3R60 A;  2LBF B;  1CQT A;  1JT0 A;  1EA3 A;  3L2U A;  3PSF A;  2M4G A;  4OU0 A;  2P8T A;  4B43 A;  4JP0 A;  3FM3 A;  2H6B A;  3K4C A;  1WZ2 A;  3HL2 A;  2OJE D;  3MKY B;  3LSP A;  4FT8 A;  4M3B A;  2E7W A;  4A0Z A;  4CYC A;  3KZI C;  1MKM A;  5CVJ A;  3LSR A;  5F27 A;  2COB A;  2F2E A;  3CLQ A;  1KQ9 A;  1M1E B;  1K6Y A;  2TCT A;  3O3K A;  4LJZ F;  3PNV A;  4E70 A;  3H9J A;  3AG4 H;  2K86 A;  3P9K A;  5FLX Z;  3W6K B;  2R7X A;  1P9Q C;  3K70 C;  4DIQ A;  1D1A A;  5HOO A;  3WG7 H;  2HXI A;  2KRF A;  5ILU A;  3S3O A;  1OPC A;  5AON A;  1I6X A;  1IV8 A;  2JPB A;  3HOX J;  4AIH A;  2IS1 A;  3WTU C;  4HDU A;  1PVE A;  2XAG A;  2GWR A;  2HPI A;  3ULQ B;  1WKM A;  2J5O A;  1SVM A;  1KQ8 A;  1HST A;  3IRR A;  1MJ9 A;  3I53 A;  4JYK A;  3OOP A;  3MQ0 A;  2MH2 A;  1OYI A;  5H6R A;  1ZN2 A;  2OCE A;  1X2N A;  3H9G A;  3HB9 A;  1H8A C;  2JTV A;  2CGP A;  3BTC A;  5GTH C;  4OIP F;  3ZQH A;  4RGU A;  4GCV A;  2EIK H;  1Y8R B;  3QP5 A;  5GTI C;  2K9M A;  3G6E I;  1Y0N A;  2KDZ A;  2V9K A;  3D5L A;  1APL C;  2VPL A;  3K69 A;  2PLY A;  1JUP A;  3UNG C;  4A3K J;  1D0Z A;  2CUZ A;  2M4K A;  3HGG A;  5EGO B;  1ZGA A;  3PUF A;  5IT9 Z;  3F8N A;  2L9R A;  1LJ9 A;  1YS6 A;  2ZJQ F;  5FRN A;  3GWZ A;  5LGU A;  2KZG A;  4EGY A;  2L9S A;  2FNP A;  4GYI A;  2ACJ A;  2LDU A;  3BR0 A;  4IVN A;  4UNO A;  1MMS A;  2IS2 A;  4KYW A;  1FMW A;  1HA8 A;  2ELK A;  2RN7 A;  4X1E A;  4XLF A;  5FFZ A;  1G8X A;  2KMU A;  2FBI A;  2VL8 A;  4L9J A;  3HRU A;  3HOS A;  2WAF A;  1Z3Y A;  2F5F A;  4MQ9 F;  1KQ0 A;  1QGP A;  1QHH D;  3CTA A;  1XGM A;  2OCC H;  3VB2 A;  3QP6 A;  5LHG A;  5JLX A;  5L3B A;  3LA3 A;  3SQN A;  1GV5 A;  5K5Q A;  4YII A;  1JJ6 C;  3W2A A;  1EV7 A;  5J4Y A;  1ETV A;  1ZR4 A;  1UAA A;  2O6G E;  3RZO J;  1HQC A;  2MC4 A;  3PNY A;  2BYV E;  1UEL B;  4CZC A;  4MIM A;  1YRN A;  5ICG A;  5JVG F;  4XON A;  3LA2 A;  1MBH A;  2W4S A;  3ABM H;  2OC6 A;  2JA2 A;  1XSD A;  1P92 A;  1OFC X;  4B4C A;  3RYP A;  2KP6 A;  2VKV A;  2JA5 J;  2XSD C;  1R4N B;  2RKH A;  1ETK A;  2DO7 A;  3M1C A;  2X6O A;  2ICW G;  4HLY A;  3S15 J;  3PFY A;  1HSJ A;  3BZK A;  1J59 A;  2GBY A;  5BOX A;  3RKW A;  4RDU A;  4N4N B;  3QQA A;  1B4A A;  1TLH B;  2HQ5 A;  1MZB A;  4L18 B;  2M5W A;  2Z16 A;  4E7Z A;  4AC0 A;  2QQ8 A;  4M9S A;  1BIB A;  2KFD A;  2ELJ A;  2PN6 A;  2HS5 A;  5FKL A;  1S3J A;  3SZP A;  3K4N A;  3LSM A;  1AKH A;  2NRA C;  1PUE E;  4KFC A;  4YRV A;  4G7O F;  3K7A J;  1ZK8 A;  1O3R A;  2G9W A;  2DOD A;  2UV1 A;  4G12 A;  3T0Y A;  1D3Y A;  3CMY A;  1W36 D;  3CMA I;  1Z77 A;  1ZHF A;  1REP C;  2LH9 A;  1ZAO A;  2ZME C;  1FY7 A;  2PX9 A;  5FKM A;  3JRF A;  2FX0 A;  1KON A;  2MGQ A;  5D5U B;  2FD5 A;  3DQV C;  3TDU C;  3HDD A;  3JSP A;  1R5H A;  1K6O A;  1G59 A;  2E1N A;  4JBA A;  2DMU A;  1WSU A;  2JUG A;  1GVD A;  2OA4 A;  3RPQ A;  3T8T A;  2BY1 A;  1RUO A;  4C2T A;  3A2K A;  4RAY A;  4KNY A;  1YG2 A;  1MSE C;  1IO2 A;  3MN2 A;  4HLX A;  5J40 A;  4DYR A;  3FMS A;  4Z2Y A;  1U2W A;  2HNH A;  2E2H J;  2WV0 A;  5IP7 J;  4HX4 A;  2Z5U A;  2ZXJ A;  2B7E A;  5DYM A;  3IAS 2;  1TQI A;  4R79 A;  1XCB A;  5CLS A;  4PFO A;  1AOY A;  1NG6 A;  2BVM A;  3ZQC A;  3CF2 A;  2OU2 A;  2V79 A;  1YLF A;  3B6A A;  1FZP B;  1FLI A;  2F5V A;  1IRX A;  2K9Q A;  4AID A;  1BI2 A;  2QZ8 A;  2Z9O A;  2HR3 A;  4HQE A;  1MBJ A;  3FHZ A;  4D5C A;  2CW8 A;  3S1R J;  4UXN A;  2VE9 A;  2GA1 A;  2R7S A;  2DN0 A;  4QPQ A;  2RQP A;  3DTI A;  3TOA A;  4RBO A;  1OKR A;  2YX7 A;  2DYR H;  1RC9 A;  5EEG A;  2LKS A;  1JUS A;  2M7B A;  2XAH A;  3BDD A;  3KP6 A;  5F1J A;  4MTD A;  3EPZ A;  4AM3 A;  3H3Z A;  1MBF A;  2P4W A;  3HOT A;  4BDZ A;  2V1X A;  4M72 A;  3GBG A;  3KP5 A;  2M34 A;  1V54 H;  4HST A;  1TT5 B;  1SD6 A;  2CW7 A;  2UWM A;  3MZY A;  2VOP A;  3WGI A;  4XOR A;  3RPU A;  3B73 A;  2HPM A;  4RA2 A;  1ZEL A;  4IEJ A;  4HNU A;  4IRH A;  5E3M A;  4OOI A;  2R5Y B;  2H8R A;  1QA6 A;  4ESJ A;  3FBN B;  4S04 A;  3IHU A;  2PMU A;  5LLQ A;  3ONQ A;  3SZG A;  3LA7 A;  2IW5 A;  2EZI A;  2MYS A;  2OV7 A;  3DCF A;  1VF9 A;  2LY9 A;  3HZJ A;  3FKI J;  3L2R A;  1TBX A;  1DDN A;  3RQ4 A;  3LSI A;  3E1S A;  2ME0 A;  3S1N J;  2RDP A;  3OYM A;  1R6R A;  5K5O A;  3SDB A;  5BS6 A;  2LY2 A;  4J00 A;  2ZNY A;  4YFN F;  1FT9 A;  2CW0 F;  2IPQ X;  3V7C A;  2WY8 Q;  3DU6 A;  3FIW A;  4IHX A;  3K1P A;  3DPL C;  3H0G J;  2F48 A;  2PI0 A;  4W1U A;  1B1B A;  2ZME A;  2QUF A;  5KK1 A;  3CUQ C;  3L9F A;  5M3M J;  3H0D A;  5GPA A;  4IQ4 A;  3S2D J;  2W48 A;  3M1E A;  2KIS A;  4A3I J;  3SXY A;  1W4M A;  2OQG A;  2ZNZ A;  3OYH A;  3DTE A;  3BT9 A;  1X1A A;  4I2O A;  2LSO A;  3VPR A;  4KIF A;  4LB5 A;  2K02 A;  3J80 K;  4OIN F;  5L3F A;  1R5I D;  1WJF A;  4A3D J;  1O3T A;  3QPH A;  1U9N A;  2OPT A;  2ZB9 A;  2XGE A;  3BLY A;  4CCL A;  2P81 A;  3DKX A;  2EFW A;  2R7W A;  3LAP A;  1HKS A;  5CPR B;  2BV6 A;  1CGP A;  1I1G A;  1LE8 B;  3IL2 A;  2P7C B;  2VQG A;  3VEP A;  3HOZ J;  5F08 A;  4BE0 A;  2EFO A;  3QOE A;  3D1N I;  1B59 A;  3LMM A;  5JI6 A;  2VON A;  3FZV A;  2EV6 A;  2PG4 A;  2XRN A;  1I3Q J;  3PUB A;  3SDG A;  3M3Y J;  2VE8 A;  4IZZ A;  2PEX A;  4XLP F;  4U0Y A;  3ZMZ A;  3GFI A;  1YW7 A;  2ZC2 A;  3MKL A;  2FQ3 A;  4B1R A;  3F8F A;  1Y8Q B;  1K7A A;  1SFU A;  1VQ8 I;  2A68 F;  5F0H A;  2R7V A;  3GTQ J;  2CFX A;  1YJ9 I;  3JRC A;  3IAM 2;  1IUY A;  5EEA A;  2BXY A;  4BQQ A;  3I0T A;  1SVO A;  4GFB A;  3E5Q A;  1RNL A;  4NNJ A;  4OWR B;  4MHG A;  4P9F A;  4XKC A;  3ZPL A;  2O7O A;  5KAI C;  1XS9 A;  3WTW C;  2JWT A;  4EM1 A;  1VQM I;  3KYC B;  4FX0 A;  4A5N A;  2DDA A;  2XF6 A;  1IN8 A;  1JI8 A;  3BPV A;  2PJR B;  4A69 C;  4U7B A;  1HW1 A;  1ULY A;  1WI9 A;  4ZDO A;  4XM3 A;  2Q0O A;  5FB2 A;  3GEZ A;  3BG5 A;  1LQ1 A;  3SFI A;  1DP3 A;  2OZ6 A;  2KRH A;  1DQU A;  1FOW A;  3I56 I;  1VQ9 I;  1FSE A;  2XVC A;  3ZMV A;  4MQV A;  2BHY A;  3CUQ A;  1XB4 A;  2JN6 A;  3FWE A;  4S0H B;  4L0Z B;  1X4O A;  3HRM A;  1ZH5 A;  2FNA A;  5HVQ C;  1D1C A;  2CO5 A;  4IOC F;  5DM7 F;  4HNV A;  1KYW A;  3CJT B;  1H9T A;  1OCR H;  2A6T A;  1IRZ A;  5IOY A;  1L3L A;  2VJ4 A;  1TQP A;  3HBL A;  3WGH A;  3CDL A;  1PYV A;  2LTP A;  2RV8 A;  2RNJ A;  3OV8 A;  3ZCO A;  3N05 A;  2CQK A;  4ITV A;  3GFM A;  4I98 B;  1XMA A;  1O7L A;  1G3T A;  4C3H J;  2DFE A;  1H0M A;  4PUS A;  3ZGK A;  3ECO A;  2DLL A;  3HSR A;  4JQF A;  1W7P D;  3DXJ F;  2ADU A;  3BG7 A;  2JPC A;  2WAQ A;  5ERI A;  4QWQ A;  4BHB A;  3DTK A;  1TNS A;  2XDV A;  3GO5 A;  2XAJ A;  2AXT C;  4BE2 A;  4KN7 X;  2R7O A;  3MFK A;  2IGK A;  1RPW A;  4J01 A;  4UV9 A;  2D45 A;  3J7Z I;  4HPQ A;  1VQO I;  1YS7 A;  2WAE A;  3BC8 A;  3M07 A;  1NK2 P;  3I4N J;  3K1N A;  2LP0 A;  1ZRD A;  1W7P B;  1F5T A;  3D5S C;  4IJA A;  4Q4Z F;  2GXG A;  2KJC A;  3QOD A;  3A0B C;  5AIQ A;  3HEF A;  4O3M A;  4HV5 A;  3ZN1 A;  4LIT A;  3P7N A;  5DM6 F;  3KCC A;  3JRD A;  5A2Q Z;  4N9I A;  5C44 J;  2FJ1 A;  2LG4 A;  1B8I B;  4GO1 A;  2V6E A;  3B6C A;  2GAU A;  4KIT B;  2R5Z B;  1R49 A;  3Q9S A;  2L02 A;  1GUU A;  3AKZ A;  3JSO A;  1BC8 C;  2K9L A;  2E34 A;  1X3Z B;  3RI4 A;  2DMQ A;  4BJT A;  1JTX A;  5CVI A;  1Z6R A;  3H36 A;  2EIM H;  2XKO A;  3GTO J;  1NK3 P;  5LRS A;  1IDZ A;  2O8X A;  2G7U A;  4XRF A;  1V5E A;  3MMY B;  2AQF A;  3F8B A;  4ESB A;  4BQN A;  3SHF A;  1P6R A;  5HS8 A;  2JA8 J;  3EUK L;  2R7Z J;  1IDY A;  2Y0S N;  4LG0 A;  2A6E F;  1A6I A;  4UB6 C;  1Z7U A;  3C2G A;  2KPM A;  1JKO C;  3D5R C;  3KLN A;  1BJA A;  4BU2 A;  1JTY A;  1MBK A;  1QZY A;  2MFZ A;  4CUG A;  5LBQ A;  1R00 A;  3CCU I;  1UHM A;  2ZFW A;  3N97 A;  1D0Y A;  2VKD A;  2F5C A;  3C7J A;  2XKP A;  1QZZ A;  1VQL I;  1SVL A;  4HF1 A;  3DEE A;  3ZQ7 A;  4WCG A;  2XF7 A;  4ZYH A;  1XSX A;  3CP8 A;  1LVK A;  1A35 A;  4A6D A;  2B9S A;  4F3Q A;  5IYC J;  2K3F A;  4BEH B;  2OAZ A;  4XSX F;  1ZAR A;  3L2W A;  3CCL I;  5FLX K;  4E7S A;  2QSG X;  2PFB A;  5FFX A;  3WTY C;  2I8D A;  5CYV A;  4ZTJ A;  4G6Q A;  1TL8 A;  1XGN A;  2IEK A;  3E7L A;  3RZD J;  5JR3 A;  2I5U A;  4G7H F;  1P4A A;  4DYQ A;  4WF2 A;  1IV6 A;  4E6K G;  2O8K A;  5HLI A;  5FKO A;  5M3F J;  2HOT A;  4LIU A;  4I99 C;  5LHI A;  3TED A;  4A0Y A;  1H9G A;  3OYJ A;  4IXA A;  4XKW A;  1BR2 A;  4UUS B;  3J7A Y;  4M3E A;  1H88 C;  1ETQ A;  2M7A A;  3LFK A;  3U1K A;  2DPU A;  2TRT A;  3R4K A;  4ZJZ A;  1B9N A;  3MD2 A;  3L2V A;  1Z91 A;  3RDI A;  3GVA A;  1LDD A;  1SMT A;  2HVQ A;  2LVS A;  4HF0 A;  4XK4 A;  1BI1 A;  1ENH A;  2WTE A;  3CO7 C;  2CYY A;  1ZGJ A;  1ZG3 A;  5D8L B;  1A36 A;  3PM1 A;  1ZRE A;  1OCT C;  4BBR J;  1Z21 A;  1OJL A;  3CCV I;  2IP2 A;  1HOM A;  4NQW A;  4A3L J;  2EPF A;  2HZD A;  2DAO A;  2DBB A;  5IT9 K;  2MAB A;  2XAU A;  4XQF A;  1HLV A;  2CU7 A;  3IRQ A;  5BNG A;  4BQA A;  4G7Z F;  4DQ2 A;  2FUG 2;  2DFI A;  1EH7 A;  1X2M A;  1BL0 A;  1ZRF A;  4U7D A;  2XB0 X;  2M1B A;  4FTH A;  4RM2 A;  4C30 A;  2DK8 A;  4EQQ A;  3H3U A;  3OYL A;  2L3D A;  3HOU J;  2K4B A;  3KZZ A;  3I54 A;  4PZJ A;  4I7H A;  1YO5 C;  5K7F A;  1OCO H;  2YX4 A;  4EJT A;  2ECB A;  4HZF A;  2QBY B;  1I39 A;  2HTJ A;  1WJB A;  4LB6 B;  3RJP A;  1A6Q A;  2DU9 A;  2EK5 A;  4KJZ A;  1AU7 A;  1SFK A;  3GZ6 A;  1J7K A;  2F4M B;  2TDX A;  1DU0 A;  3RCO A;  2LRD A;  3AL0 C;  5FD5 A;  2E7X A;  3ML6 A;  3F23 A;  4LLN A;  1ZYR F;  3H35 A;  2HQA A;  1A31 A;  4KUM A;  3CCR I;  1HKQ A;  5F64 A;  3K10 A;  2X1D A;  2DJN A;  2XGD A;  2BVL A;  2DA1 A;  5K7Z A;  4IHY A;  4BXU A;  1FYK A;  2MLK A;  5E3N A;  1W5C C;  1P4X A;  3OSF A;  4H4K C;  4M6X A;  5B1B H;  2EJR A;  3B02 A;  3BWG A;  4B47 A;  2KL4 A;  5DDG A;  2QA4 I;  5M5Y J;  1T0F A;  3GTG J;  1RES A;  2VUM J;  1YIJ I;  1J09 A;  5J6X A;  4LGW A;  2R4G A;  2FRH A;  2FQ4 A;  2RRE A;  3QYE A;  1WRJ A;  2HGC A;  1BJZ A;  3K6G A;  1BIA A;  1O4X A;  4A3E J;  2DOE A;  1JJ8 C;  3E6C C;  2VXD A;  2WBM A;  4RLQ A;  1RIO H;  3TO6 A;  1GLN A;  2IS6 A;  1HKT A;  2E5N A;  5JVT A;  2FML A;  1F4K A;  4A3B J;  4A3M J;  5DTD A;  1PP8 F;  4G94 A;  2R7U A;  1IW7 F;  3FXL A;  1G3W A;  1AKH B;  4F55 A;  1I5Z A;  3KX2 A;  4A3J J;  2X48 A;  1U8R A;  4HF2 A;  3HSE A;  2H8W A;  2EBI A;  4PFP A;  1F36 A;  3HJE A;  1EKE A;  2DMN A;  3I3L A;  3K9T A;  2VIX A;  3JRB A;  3ERE D;  4LD5 A;  1FWZ A;  1FBS A;  3PIP F;  2KJB A;  4FX4 A;  4PGH A;  2VKE A;  2CV2 A;  2AS5 F;  4XRS G;  4Y15 A;  5EJC A;  2GXA A;  2DA2 A;  3FK6 A;  4OMZ A;  3MZ8 A;  3OYB A;  1MNM C;  5HS9 A;  1MDM B;  2OZU A;  2DI3 A;  3GTM J;  3J7A O;  1J5Y A;  2E1M C;  2N8G A;  2X6W A;  2R7F A; 
#chains in the Genus database with same CATH homology
 1ZLK A;  5DCM B;  3JTG A;  1O3S A;  4KN4 X;  2K27 A;  2NNY A;  3N4M A;  1PP7 U;  5CVU A;  1S7A A;  3WG9 A;  4ZZD A;  5E8G A;  1OMI A;  2BBY A;  1LVA A;  3F8C A;  1XGO A;  1O57 A;  2BE5 F;  2KKO A;  3KLO A;  5HDK A;  4EGZ A;  3PFI A;  5DD4 A;  3GW2 A;  4NB5 A;  2K7L A;  4CGZ A;  4HDV A;  3F72 A;  4IF4 A;  5BQT A;  4U0V A;  4LMY A;  5DCF A;  4IHT A;  4L9N A;  3V8K A;  4YG2 F;  3F3X A;  1Z05 A;  3JAM Z;  1T39 A;  1R1V A;  1JHH A;  5D5W B;  2Y48 A;  4B09 A;  3WE2 A;  5LRR A;  1FBU A;  2FA5 A;  2HKO A;  3W6J B;  5D4S A;  3KEO A;  3DPT A;  3RKX A;  1IF1 A;  1SAX A;  4DNC A;  2WWY A;  3LQQ A;  4P55 A;  3I59 B;  5LGN A;  2XAQ A;  2Z33 A;  1O3Q A;  3ZMD A;  5LEK A;  1I27 A;  1FP1 D;  1Q1H A;  2PJP A;  5DV5 A;  3M8F A;  4GXO A;  4CZZ A;  4I09 A;  2IRF G;  4NHJ A;  5F1R A;  4LLG F;  1G4D A;  2XGX A;  2H09 A;  2FXA A;  3I71 A;  1KU9 A;  3WTT C;  3E6D A;  4XLN F;  1IXR C;  4M9Z A;  3IKV A;  1TNT A;  5J8C A;  2UXX A;  4I0B A;  3LST A;  1JGS A;  1HXD A;  3DKW A;  1KGS A;  2QM3 A;  3C1D A;  1MJB A;  4RGX A;  5CVV A;  3QU3 A;  3EET A;  4RAZ A;  3JTH A;  3MZH A;  2J5P A;  3RYR A;  1R23 A;  4OMY A;  3PQJ A;  1F1Z A;  3WTS C;  2CSO A;  3K1M A;  1YTY A;  4H0E A;  4KIB A;  4KT5 C;  2GIV A;  3H92 A;  4ENM A;  2BGC A;  5AIP A;  2HTS A;  4L0Y B;  3TKY A;  2V1U A;  4BAY A;  3GZ5 A;  5CVR A;  1U5T B;  2ISZ A;  2NAZ A;  3LWF A;  1J2X A;  3I58 A;  4I01 A;  1HBX G;  5HLH A;  3RKY A;  1BC7 C;  4AVP A;  3ZMT A;  1IN5 A;  5E1Z B;  2D1V A;  4O6J A;  1KU7 A;  1LNW A;  1YFH A;  2FBK A;  4Y13 A;  5HDN A;  2DTR A;  2R3S A;  3R6S A;  5E17 F;  5A2Q K;  4G9Y A;  2COM A;  2JSC A;  4BHP A;  3J81 K;  3QU6 A;  1LDJ A;  2P5K A;  3HTS B;  5L3E A;  2YSR A;  3NQO A;  2LKP A;  4EM0 B;  2ZCW A;  4WXH A;  3IWF A;  4ZH4 F;  1XGS A;  2XIG A;  3ZN0 A;  3CLO A;  4PDK A;  1E17 A;  3R61 A;  3R0A A;  1FC3 A;  2C6Y A;  1EH8 A;  2P5V A;  1T98 A;  3DF8 A;  1LEB A;  2L4M A;  2DT5 A;  4MEY F;  4MTE A;  3FM5 A;  5K1Y A;  4HOB A;  5LGT A;  4OIR F;  3BJ6 A;  1LDK B;  2Y0M A;  1IN6 A;  1I1S A;  5D6F A;  1SFX A;  1R1U A;  4CIC A;  1D8K A;  4ENN A;  1LEA A;  1IXC A;  1FOK A;  1SFE A;  2CWE A;  4GYG A;  4YIF A;  1Y0U A;  2VC1 A;  2W25 A;  2MBF A;  1FNN A;  3WU0 A;  1OYY A;  2PMH A;  3ZMU A;  1K78 B;  4OIQ F;  5DUI A;  1IAW A;  2GQQ A;  4RGR A;  3GF2 A;  4FHT A;  4LK1 F;  1G6N A;  1YQA A;  1OR7 A;  1B6A A;  4M74 A;  3BOQ A;  2XRO A;  2RC4 A;  3HHH A;  2PQ8 A;  5E18 F;  3REO A;  3ABT A;  2P7V B;  1R22 A;  3RTR A;  1JHF A;  5E8I A;  2A6H F;  5JFR A;  5ILS A;  3KEQ A;  1O7F A;  1CF7 B;  2LF7 A;  1GXP A;  2W85 A;  1W5S A;  1AWC A;  2VBX A;  5E20 A;  3KET A;  2VOD A;  2O61 A;  1ZLJ A;  2FF4 A;  3KZY A;  2JT1 A;  3WTZ A;  2STW A;  4KDP A;  5L3G A;  3JW4 A;  4UVA A;  3FMQ A;  1BBY A;  3L2C A;  2GA2 A;  4YFX F;  2AXL A;  1R36 A;  2K4J A;  2HYF A;  1GXQ A;  3F21 A;  4M71 A;  3E5U A;  5H6Q A;  1STZ A;  3GXO A;  3E6B A;  4HYE A;  2GXB A;  2Q8K A;  1S29 A;  5D6E A;  3V8L A;  3O2P E;  2D2W A;  3TO7 A;  3ISP A;  3MAJ A;  5CJ9 A;  3K0L A;  1IZ1 A;  2P6S A;  4M9X A;  5D5V B;  3VOE A;  2JRT A;  1TW3 A;  3Q9V A;  3FXQ A;  1FBQ A;  3QAH A;  3COA C;  2VBW A;  3KP2 A;  1A04 A;  3CO6 C;  3VOD A;  3SZT A;  3QOP A;  3T8R A;  5E1W A;  5TRD A;  3WTX C;  2ISY A;  3FF5 A;  3M8E A;  2V9V A;  1KA8 A;  3KP3 A;  1Z9C A;  3BZ6 A;  3LQR A;  4RB3 C;  2NNN A;  4QLC U;  1W7P A;  4UVB A;  1MD0 A;  2XAF A;  5ILV A;  2LF8 A;  2MA3 A;  5JHU A;  4PGG A;  1UST A;  5J8F A;  2ESN A;  4WWC A;  2BEO A;  2A5Y B;  4U88 A;  1ON1 A;  1T38 A;  3P9I A;  1FYM A;  2XV4 S;  3JAM K;  3EUH A;  4G8X A;  1LB2 A;  2G7H A;  2PBI A;  1NHA A;  3F6O A;  3HYI A;  3FXR A;  2VT2 A;  1WQ2 A;  2VOO A;  4RB2 C;  2VC0 A;  1MGT A;  1UHW A;  2X4H A;  3HRS A;  4ZYG A;  2FU4 A;  4LK0 F;  2EFQ A;  1J0R A;  2EA2 A;  4R1H A;  4AIJ A;  3FMR A;  5LEJ A;  2QLZ A;  4RB1 A;  2FOK A;  4UV8 A;  4EVI A;  2UZK A;  4IRG A;  3TGN A;  3QPT A;  3U1D A;  5FD6 A;  2Z99 A;  1F9N A;  3I5U A;  4Q5S F;  4N9H A;  3L09 A;  2MD5 A;  4ETS A;  2STT A;  3L00 A;  3ZMS A;  4BYY A;  2FBH A;  4L9V A;  3BJA A;  2L01 A;  2MLG A;  3S2W A;  2FE3 A;  4A5M A;  4KIC A;  5FGM A;  3AAF A;  4BHC A;  2Z3Y A;  3WU1 B;  4IHS A;  3WOD F;  4L5J A;  3Q5F A;  2O3F A;  1RI7 A;  4Q48 A;  2B0L A;  2QBY A;  2H94 A;  5BPD A;  2QYO A;  3HTU A;  2DPD A;  4AD9 A;  4XSZ F;  4RS8 A;  2OD5 A;  3ECH A;  2W84 A;  5F6F A;  2ZBK A;  1BOA A;  4MGR A;  4CXF A;  1RUN A;  1TQM A;  4UUV A;  2WC2 A;  4RGS A;  1J75 A;  2F5E A;  3RIR A;  2L4A A;  3WE3 A;  2IVM A;  3D0S A;  2ZME B;  4KIG A;  4A2U A;  3F8M A;  1PDN C;  1OYW A;  4BH9 A;  2ZJ2 A;  1T6S A;  1D8J A;  2A3S A;  3TO9 A;  3MWM A;  4Y17 A;  4EMS A;  2HQR A;  2M87 A;  2GZW A;  2HOE A;  3TDZ C;  2FMY A;  1DUX C;  4UHT A;  3WTV C;  2H6C A;  1Z1D A;  1TW2 A;  2QQB A;  3FX3 A;  5D4R A;  3V7R A;  1BM9 A;  2H27 A;  1MJA A;  4JK1 X;  2RVC A;  2HEO A;  2IA2 A;  4R8H A;  3M9A A;  4WXD A;  4HBL A;  3U2R A;  4N0B A;  1MDM A;  1YW9 A;  5KVR A;  5FO5 A;  4HAM A;  5DCM A;  5L3C A;  3L7W A;  2IJL A;  4CYD A;  1XCV A;  2UXN A;  3BRO A;  2A07 F;  2V6C A;  4CO8 A;  4ENK A;  4LFU A;  4L9T A;  1G3S A;  1ZRC A;  2VXZ A;  4HX7 A;  2KIU A;  4ESF A;  4IRI A;  1WWX A;  2MH9 A;  2KIM A;  3E97 A;  4P9U A;  1USS A;  1X3U A;  1XN7 A;  4WK8 F;  4UVC A;  3CUQ B;  3HUG A;  1GVJ A;  3MCZ A;  4HQM A;  1ZG5 A;  5EEH A;  1R58 A;  2EV0 A;  2EFN A;  3DP7 A;  4PCQ A;  4K2E A;  1JE8 A;  2MC3 A;  2LNB A;  4ZZL A;  1P2F A;  2HDC A;  3G73 A;  1DPU A;  5ED4 A;  4CHU A;  5K5R A;  3BJO A;  5DEQ A;  5BPI A;  3LAJ A;  2P5L C;  5HLG A;  1YIO A;  4ON0 A;  1U78 A;  5DUK A;  1RZ4 A;  2HQN A;  3DEU A;  3IWZ A;  5BMZ A;  4AIK A;  3NRV A;  4P5O A;  4A0X A;  1KU2 A;  4M6Y A;  1KYZ A;  1QPM A;  2HZT A;  2HFH A;  3I59 A;  1HW5 A;  2VT3 A;  3VFZ A;  3DV8 A;  4M73 A;  1U5T C;  4ENJ A;  2HWV A;  4F7Z A;  3HIF A;  2DQR A;  1L0O C;  2ESH A;  2HYG D;  4B8X A;  1HW2 A;  1W5T A;  1EH6 A;  3V7S A;  1S8N A;  1IXS B;  2XHK A;  3CJN A;  3HHG A;  1U6G A;  1YW8 A;  2OQR A;  3QRF F;  5L3D A;  4D0P A;  1BI3 A;  2QQ9 A;  2E1C A;  5LHH A;  2KIF A;  4XBF A;  4LG0 B;  1YYV A;  4GGG A;  2O03 A;  4KMF A;  3KP7 A;  2ELH A;  3E5X A;  2ZO4 A;  5ICF A;  1GHC A;  3GLX A;  3PQK A;  3O6B B;  2DK5 A;  3E3V A;  1IRG A;  3ABU A;  3F22 A;  3FXU A;  4Q47 A;  1XDU A;  1G3Y A;  1FP2 A;  2NYX A;  2EWN A;  3TQN A;  1XMK A;  4LLL A;  4KA4 A;  4EJU A;  1ODD A;  4O5V A;  1R7J A;  1QQI A;  1IN7 A;  5E1X A;  2M8E A;  4AWX B;  2IA1 A;  1KU3 A;  2VN2 A;  1U5T A;  3EQL F;  2JZY A;  2DQL A;  3HSF A;  1D5V A;  5TJJ A;  3U9G A;  2Q2E A;  1UFM A;  3P9C A;  4I02 A;  5ICC A;  4WX9 A;  1V4R A;  2Y75 A;  1E2X A;  3J80 Z;  2IT0 A;  1DP7 P;  4MNU A;  1XD7 A;  1FSH A;  4A6E A;  2A61 A;  5IT3 A;  4ZYE A;  4TV7 A;  2M45 A;  3V4G A;  1UCR A;  3T5X A;  2XAS A;  1FX7 A;  5H20 A;  3ROU A;  1ZG1 A;  2V1D A;  1FPQ A;  3C3W A;  2OBP A;  4EM2 A;  4EJO A;  2XUB A;  3F6V A;  2EFP A;  2QVO A;  4ASN A;  3KP4 A;  3K2Z A;  2CG4 A;  2EB7 A;  2EV5 A;  2O0Y A;  1T2K A;  3CDH A;  5DD8 A;  3WGG A;  3KFW X;  2P6T A;  3J81 Z;  2F5D A;  4IPA A;  2ZKZ A;  4HX8 A;  1BN5 A;  1B9M A;  2NS0 A;  3I64 A;  1XSV A;  1U3E M;  3NEU A;  1XDS A;  3HRT A;  4I0A A;  1IN4 A;  1J9I A;  3GFJ A;  2ETH A;  4ZYD A;  2FSW A;  2A69 F;  1TTY A;  4EJW A;  1VTN C;  1ON2 A;  2VBZ A;  1IRF A;  3ZP5 A;  4G6D A;  4CDG A;  2W24 A;  4L5I A;  5D5X B;  2QWW A;  4P96 A;  5HS7 A;  1SD7 A;  2FEZ A;  4A12 A;  3V8J A;  3IKT A;  3T1B A;  3KE2 A;  4HV6 A;  4YFK F;  3GX4 X;  6PAX A;  4S05 A;  4OIO F;  3EYY A;  4MEX F;  2QEN A;  3GFL A;  2HKX A;  2X0L A;  5ICE A;  1SD5 A;  2VBY A;  1Z6T A;  1P4W A;  3I4P A;  1S7O A;  2QQA A;  3SFZ A;  4EJV A;  2R7D A;  1DPR A;  1S6L A;  2DW4 A;  1K78 A;  3BY6 A;  3C18 A;  3EDP A;  4HA8 A;  2YPR A;  1SMY F;  3CUO A;  1QNT A;  1K79 A;  2YR2 A;  4EV0 A;  3GYH X;  1FYL A;  4KMU X;  3IC7 A;  1UB9 A;  2IA0 A;  2YU3 A;  4RB0 A;  1R5G A;  3MEX A;  1C0W A;  1SD4 A;  2M30 A;  3M7G A;  3E6M A;  4HW0 A;  4BNC A;  3G3Z A;  1ONV A;  3EYI A;  4U0W A;  3DFG A;  2L54 A;  1R1T A;  2W57 A;  1CF7 A;  4WXC A;  3BP8 A;  3R0J A;  2D1H A;  2EA4 A;  2RGV A;  1QBJ A;  5HDG A;  1JXS A;  3BPX A;  1QO0 D;  1BI0 A;  3GUD A;  1V3F A;  3ELK A;  3TOB A;  5D8K B;  3R60 A;  4OU0 A;  2P8T A;  3FM3 A;  2H6B A;  4FT8 A;  2E7W A;  4A0Z A;  1MKM A;  5CVJ A;  2F2E A;  1KQ9 A;  3O3K A;  4E70 A;  4LJZ F;  5FLX Z;  2K86 A;  3P9K A;  3W6K B;  5HOO A;  5ILU A;  2KRF A;  1OPC A;  5AON A;  1I6X A;  2JPB A;  4AIH A;  3WTU C;  4HDU A;  2XAG A;  2GWR A;  3ULQ B;  1WKM A;  2J5O A;  1KQ8 A;  1HST A;  3IRR A;  1MJ9 A;  3I53 A;  3OOP A;  3MQ0 A;  2MH2 A;  1OYI A;  5H6R A;  1ZN2 A;  2JTV A;  2CGP A;  4OIP F;  4RGU A;  4GCV A;  3QP5 A;  3D5L A;  3K69 A;  2PLY A;  1ZGA A;  5IT9 Z;  3F8N A;  1LJ9 A;  1YS6 A;  3GWZ A;  5LGU A;  4EGY A;  4GYI A;  2FNP A;  2ACJ A;  2LDU A;  4IVN A;  4UNO A;  4KYW A;  2RN7 A;  5FFZ A;  2FBI A;  4L9J A;  3HRU A;  3HOS A;  2F5F A;  4MQ9 F;  1KQ0 A;  1QGP A;  3CTA A;  1XGM A;  3VB2 A;  3QP6 A;  5LHG A;  5L3B A;  3LA3 A;  3SQN A;  5K5Q A;  4YII A;  1EV7 A;  2O6G E;  1HQC A;  2BYV E;  5ICG A;  3LA2 A;  1XSD A;  1P92 A;  3RYP A;  2RKH A;  2DO7 A;  4HLY A;  1HSJ A;  1J59 A;  5BOX A;  3RKW A;  1B4A A;  1TLH B;  1MZB A;  4L18 B;  2M5W A;  4M9S A;  1BIB A;  2PN6 A;  2HS5 A;  1S3J A;  3SZP A;  2NRA C;  1PUE E;  4KFC A;  4G7O F;  1O3R A;  2G9W A;  3T0Y A;  1D3Y A;  1REP C;  1ZHF A;  1ZAO A;  1FY7 A;  5D5U B;  3DQV C;  3TDU C;  3JSP A;  1R5H A;  1K6O A;  2E1N A;  4JBA A;  1WSU A;  3T8T A;  1RUO A;  2OA4 A;  3RPQ A;  4RAY A;  4KNY A;  1YG2 A;  4HLX A;  3FMS A;  4Z2Y A;  1U2W A;  2WV0 A;  4HX4 A;  2Z5U A;  2ZXJ A;  5DYM A;  1TQI A;  4R79 A;  1XCB A;  5CLS A;  1AOY A;  2OU2 A;  2V79 A;  1YLF A;  1FZP B;  1FLI A;  1BI2 A;  2QZ8 A;  2Z9O A;  2HR3 A;  4HQE A;  3FHZ A;  4UXN A;  2VE9 A;  2GA1 A;  2RQP A;  3TOA A;  1OKR A;  2YX7 A;  5EEG A;  4MTD A;  3BDD A;  2XAH A;  3KP6 A;  3H3Z A;  3HOT A;  2V1X A;  4M72 A;  3KP5 A;  1SD6 A;  2UWM A;  3MZY A;  2VOP A;  3WGI A;  3RPU A;  3B73 A;  4IRH A;  4OOI A;  4ESJ A;  4S04 A;  3IHU A;  2PMU A;  5LLQ A;  3LA7 A;  2IW5 A;  1DDN A;  1TBX A;  2RDP A;  5K5O A;  5BS6 A;  2ZNY A;  4YFN F;  1FT9 A;  2CW0 F;  2IPQ X;  3V7C A;  3K1P A;  3DPL C;  2PI0 A;  1B1B A;  2ZME A;  2QUF A;  5KK1 A;  3CUQ C;  3L9F A;  3M1E A;  3SXY A;  1W4M A;  2OQG A;  2ZNZ A;  4I2O A;  2LSO A;  4KIF A;  4LB5 A;  2K02 A;  3J80 K;  4OIN F;  5L3F A;  1O3T A;  3QPH A;  2EFW A;  3LAP A;  1HKS A;  2BV6 A;  1CGP A;  1I1G A;  3IL2 A;  2P7C B;  3VEP A;  2EFO A;  5JI6 A;  1B59 A;  2VON A;  3FZV A;  2EV6 A;  2PG4 A;  2XRN A;  2VE8 A;  2PEX A;  4XLP F;  4U0Y A;  3ZMZ A;  3GFI A;  1YW7 A;  2FQ3 A;  3F8F A;  1K7A A;  1SFU A;  2A68 F;  2CFX A;  1IUY A;  3I0T A;  3E5Q A;  1RNL A;  4MHG A;  4P9F A;  3ZPL A;  3WTW C;  4EM1 A;  4FX0 A;  4A5N A;  1IN8 A;  3BPV A;  4U7B A;  1HW1 A;  1ULY A;  1WI9 A;  2Q0O A;  5FB2 A;  3GEZ A;  1LQ1 A;  2OZ6 A;  1FSE A;  2XVC A;  3ZMV A;  4MQV A;  3FWE A;  3CUQ A;  1XB4 A;  4L0Z B;  3HRM A;  1ZH5 A;  2FNA A;  5HVQ C;  2CO5 A;  1KYW A;  1H9T A;  1L3L A;  1TQP A;  3WGH A;  2RV8 A;  2RNJ A;  3OV8 A;  2CQK A;  3GFM A;  4I98 B;  1XMA A;  1O7L A;  1G3T A;  1H0M A;  3ECO A;  2DLL A;  3HSR A;  4JQF A;  1W7P D;  3DXJ F;  2ADU A;  2JPC A;  5ERI A;  4QWQ A;  4BHB A;  1TNS A;  3GO5 A;  2XAJ A;  4KN7 X;  3MFK A;  4UV9 A;  2D45 A;  1YS7 A;  3K1N A;  1ZRD A;  1W7P B;  1F5T A;  4IJA A;  4Q4Z F;  2GXG A;  2KJC A;  5AIQ A;  4O3M A;  4HV5 A;  3ZN1 A;  3P7N A;  3KCC A;  5A2Q Z;  4N9I A;  4GO1 A;  2GAU A;  3Q9S A;  2L02 A;  3JSO A;  1BC8 C;  3RI4 A;  5CVI A;  1Z6R A;  2XKO A;  5LRS A;  2O8X A;  2G7U A;  4XRF A;  4ESB A;  5HS8 A;  3F8B A;  3SHF A;  1P6R A;  4LG0 A;  2A6E F;  1Z7U A;  3KLN A;  1BJA A;  1QZY A;  5LBQ A;  1R00 A;  1UHM A;  2ZFW A;  3N97 A;  2F5C A;  3C7J A;  2XKP A;  1QZZ A;  4HF1 A;  3ZQ7 A;  4WCG A;  4ZYH A;  1XSX A;  4A6D A;  2OAZ A;  4XSX F;  1ZAR A;  5FLX K;  2PFB A;  5FFX A;  3WTY C;  5CYV A;  4G6Q A;  1XGN A;  5JR3 A;  4G7H F;  1P4A A;  4WF2 A;  5HLI A;  5LHI A;  4A0Y A;  1H9G A;  4IXA A;  3LFK A;  2DPU A;  3R4K A;  1B9N A;  1Z91 A;  3RDI A;  3GVA A;  1LDD A;  1SMT A;  4HF0 A;  1BI1 A;  2WTE A;  3CO7 C;  2CYY A;  1ZGJ A;  1ZG3 A;  5D8L B;  1ZRE A;  2IP2 A;  4NQW A;  2DAO A;  2DBB A;  5IT9 K;  3IRQ A;  4BQA A;  4G7Z F;  4DQ2 A;  2DFI A;  1EH7 A;  1ZRF A;  4U7D A;  2M1B A;  2DK8 A;  4EQQ A;  3H3U A;  2L3D A;  2K4B A;  3KZZ A;  3I54 A;  4PZJ A;  4I7H A;  1YO5 C;  2YX4 A;  4EJT A;  4HZF A;  2QBY B;  2HTJ A;  4LB6 B;  3RJP A;  2DU9 A;  2EK5 A;  3GZ6 A;  1J7K A;  2TDX A;  5FD5 A;  2E7X A;  3ML6 A;  3F23 A;  4LLN A;  1ZYR F;  4KUM A;  1HKQ A;  5F64 A;  4BXU A;  1FYK A;  2MLK A;  1P4X A;  4M6X A;  2EJR A;  3B02 A;  3BWG A;  5DDG A;  1T0F A;  5J6X A;  4LGW A;  2FRH A;  1WRJ A;  2HGC A;  1BIA A;  3E6C C;  1RIO H;  3TO6 A;  1HKT A;  5JVT A;  2FML A;  1F4K A;  1PP8 F;  4G94 A;  1IW7 F;  1G3W A;  1I5Z A;  1U8R A;  4HF2 A;  3HSE A;  3K9T A;  3ERE D;  4LD5 A;  1FWZ A;  1FBS A;  2KJB A;  4FX4 A;  4PGH A;  2AS5 F;  4Y15 A;  4OMZ A;  5HS9 A;  1MDM B;  2OZU A;  2DI3 A;  3J7A O;  1J5Y A;  2P4W A;  2R7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...