3ZPLA

Crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
159
structure length
159
Chain Sequence
PRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQPSEAGADLPWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription/dna
molecule keywords PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR
total genus 62
structure length 159
sequence length 159
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zplA00
5K5RA 2A6HF 2V79A 4IRIA 1Z9CA 2K86A 1LEAA 2X4HA 3CUOA 3PQJA 4HBLA 4LG0A 2DW4A 5D5VB 2ESHA 2G9WA 2XAGA 4YFNF 3GFJA 1BBYA 1Z1DA 2QUFA 5LGUA 5F64A 3DPLC 4XSZF 2F2EA 1JGSA 3ZMVA 5DCMA 1MDMB 5D5WB 4KDPA 4UV8A 4WX9A 3LAPA 2YSRA 2FSWA 4OIQF 1U5TA 5TRDA 1ZH5A 5L3DA 1HBXG 4DQ2A 3HSRA 2J5OA 1LJ9A 2OZUA 2QM3A 1K6OA 5D6EA 1P6RA 2WV0A 3TO6A 1GXPA 2P6TA 1FYKA 1G3TA 4KN4X 5LEJA 2UXXA 3V7SA 1T39A 2PLYA 2VC0A 4Z2YA 2FE3A 1V3FA 1YG2A 2E1NA 2Q0OA 2ZO4A 3BJAA 4AVPA 2D45A 3AAFA 2E7XA 2VBWA 2JPCA 2P5KA 4U0WA 3KZYA 2NYXA 5BPIA 1B6AA 2HQRA 1W5SA 2Y48A 3F3XA 2HKXA 3ZN1A 5FLXZ 3FMRA 1OMIA 3MCZA 4EV0A 1IXCA 1BI0A 1BC7C 1HKQA 2K4JA 3CUQB 1BIAA 1WRJA 5AIPA 3WU0A 3FM3A 2ETHA 1UHWA 1D3YA 2EFWA 1QO0D 1XSXA 1Y0UA 1WKMA 1MGTA 4O5VA 2PQ8A 2RV8A 2BGCA 3EQLF 2VONA 2IVMA 1Q1HA 4LLLA 3IWFA 1TW2A 4MTEA 5IT9K 1SFEA 1JHHA 4OINF 1SD5A 2Z99A 3L09A 2NNNA 2EV0A 1KGSA 2JTVA 3JAMZ 2P8TA 3WTUC 2V1XA 3K1NA 4EM1A 1REPC 2JT1A 4FX0A 5DUKA 3RI4A 1U8RA 1ON1A 2Z3YA 3FF5A 3E6MA 5A2QK 4CXFA 3L2CA 3RTRA 5FB2A 3CLOA 4BYYA 3QPTA 4D0PA 3I0TA 2YX4A 2EK5A 1ZGAA 1MKMA 3WTZA 2FMYA 1KYWA 2C6YA 3GYHX 2L02A 4LK0F 5HDNA 4IVNA 1BJAA 3FHZA 3C18A 1MDMA 3K1PA 4F7ZA 3WE2A 2V1UA 2ZKZA 1O3RA 3EETA 2F5CA 2HQNA 5JVTA 1IAWA 1T2KA 5D8KB 2DI3A 3F6VA 4S05A 3HOSA 3KLNA 2DBBA 2W25A 1MD0A 5E8IA 2KKOA 4A2UA 4LK1F 2D1VA 3F8BA 5ICFA 2RGVA 3HSEA 2M5WA 1O7FA 2FBKA 4HV5A 5BPDA 4KIFA 5CVRA 4M6XA 3F6OA 4RS8A 1LEBA 3DXJF 5J8CA 4IPAA 3GVAA 4RB0A 4YG2F 2EFPA 1ZYRF 4EM0B 1T38A 2DK5A 1B9MA 2M30A 1QPMA 2LSOA 4ENMA 4L18B 1BIBA 1RZ4A 3GZ5A 1BN5A 2F5DA 5TJJA 2WTEA 1O3TA 5L3BA 2P5VA 1IZ1A 2G7HA 2Z9OA 1FSHA 4KMFA 1T98A 3SZTA 1SFXA 4HX8A 2MBFA 1CF7A 1P4WA 5DD8A 4OIPF 5DYMA 1T0FA 2CFXA 2V1DA 5F6FA 2BE5F 3IHUA 3K9TA 3R4KA 3KLOA 3IC7A 1FNNA 1L0OC 1RUNA 2ZCWA 1FY7A 1YYVA 3DP7A 1J2XA 4Q48A 5K5QA 3K1MA 3I59B 2ZMEA 4ZH4F 5CJ9A 2L4MA 4M6YA 1FPQA 5EEHA 4MTDA 1FC3A 4WXHA 3FZVA 1U5TB 3ZP5A 5ILUA 4A0XA 5D4SA 4L9NA 2QLZA 3V8JA 2VOPA 2ESNA 1XMKA 4IXAA 5K1YA 1YFHA 1LDJA 3E5XA 5HS9A 5HS7A 4Q47A 1STZA 1G3WA 1TBXA 4LB5A 5AIQA 2IRFG 1R00A 2K27A 1S29A 4WWCA 2IT0A 2ACJA 3HRMA 1UFMA 5KVRA 3TOBA 4WXCA 2A61A 2QQBA 4RB3C 1F5TA 3KP6A 2JRTA 2MLGA 1MJ9A 4KIGA 4CHUA 2EV5A 1NHAA 4OOIA 3IL2A 1FP1D 4RGRA 1Z05A 3Q5FA 3GZ6A 2HGCA 3WTWC 3HYIA 5FGMA 2VOOA 5ICGA 2LDUA 5FFXA 2YU3A 1USTA 3I58A 4HV6A 1D8JA 4JQFA 1U78A 1QBJA 4CZZA 2DPDA 1IN5A 4KMUX 4Q4ZF 1TNSA 4ETSA 3GO5A 1MJBA 1ZRCA 4L9TA 2HR3A 5LGNA 2KJCA 2QBYA 2O03A 1I1GA 3T5XA 2A3SA 4ZYDA 4HF0A 4AIJA 1XSDA 2FMLA 4ZYGA 1G3SA 3GEZA 1XSVA 1XD7A 2F5EA 3MEXA 2O6GE 2GA1A 5LGTA 4A0ZA 5IT9Z 1YW8A 4CYDA 2RNJA 3P9IA 4Y17A 3ISPA 2X0LA 2XASA 1ZREA 3RKXA 4U7BA 4TV7A 4EJOA 3MZHA 1K7AA 2ISYA 1YS6A 3WGHA 2DTRA 4A12A 3F21A 4GGGA 2IJLA 3EYIA 2EA2A 3GFMA 3FXQA 2L54A 4XLNF 2XUBA 4RGUA 2P4WA 3BJOA 3GFLA 1HXDA 5D6FA 3N97A 4RGXA 2IP2A 4A0YA 2FNAA 2KRFA 1T6SA 1Z7UA 5HDKA 3T0YA 3WGGA 1IN6A 2STTA 2Y0MA 4PGGA 4YIFA 2VT3A 3ZMZA 2GAUA 4YFKF 4M73A 2VT2A 3FMQA 4RAYA 1QNTA 3CO7C 2XAQA 2Q8KA 3J81K 1OKRA 1TQMA 3F8MA 1HSTA 1XB4A 3M9AA 4RGSA 2GA2A 3QRFF 4IF4A 1CGPA 1IUYA 1PP8F 1ZARA 4CICA 3G73A 4M71A 4ON0A 5EEGA 5HDGA 4PCQA 4PDKA 2O8XA 4G6QA 3F8CA 3ABUA 2EJRA 2CQKA 1FYMA 1FX7A 3KP3A 2AXLA 2QBYB 4UXNA 2XAFA 1EH7A 2DQRA 3RKWA 4I7HA 1B9NA 4HX7A 1FBSA 2O0YA 3M1EA 3J80Z 1IN8A 5FFZA 4YFXF 3I64A 4OMYA 1JE8A 4KNYA 3QOPA 1KQ9A 2QVOA 5BMZA 3HRUA 2PI0A 3E3VA 1SFUA 2QYOA 1R5HA 1FOKA 1W7PD 2UZKA 5BS6A 5L3GA 1S7AA 1HSJA 2WWYA 1ZLJA 4CDGA 3GFIA 5CLSA 4XLPF 4I01A 4L0ZB 2BEOA 2H6BA 3VEPA 1ZG3A 1GXQA 2RDPA 3BWGA 1AOYA 2EV6A 1ZG5A 2VBZA 2FBIA 2CGPA 1OPCA 3J7AO 3VODA 4OIRF 4CO8A 1LNWA 3JSPA 4GO1A 5ERIA 3KETA 1DUXC 4HYEA 4EGYA 3H3ZA 3I4PA 5F1RA 3PQKA 4P55A 1YW9A 4UVAA 4XBFA 4MEYF 1FSEA 1GVJA 3DV8A 2ZFWA 3I54A 2MLKA 2QWWA 4L5IA 4NHJA 3HHHA 3K0LA 3P9CA 1F4KA 3L9FA 4OMZA 2DQLA 2NRAC 4Y15A 1DDNA 2VBXA 4GCVA 4ENKA 1P4XA 1TLHB 4KN7X 5HS8A 1ULYA 2XROA 1BM9A 4KYWA 1PP7U 1KQ0A 4GYIA 2MA3A 3J81Z 2DPUA 1XGSA 1R23A 3ULQB 3V4GA 5L3EA 5E1WA 2J5PA 3BPXA 3MFKA 1XGOA 4BHCA 5HOOA 4BH9A 2P6SA 2GQQA 3C1DA 3HTUA 1IN4A 5CVJA 4G8XA 3QP6A 2EWNA 4R1HA 4XRFA 3LA7A 2HTJA 1R1UA 3TO9A 1FBUA 1L3LA 4AWXB 4P9FA 1R1VA 1H9TA 3IRRA 2ZBKA 1IXSB 1R36A 3ZMTA 1P4AA 3Q9VA 4BNCA 4LG0B 4MQVA 3VFZA 5ICEA 1BOAA 2KIUA 1FBQA 1ZRDA 2KJBA 3T8RA 1A04A 4HF1A 2CO5A 2L4AA 3NRVA 1X3UA 3DF8A 2W57A 2A68F 1W5TA 5CVUA 2W84A 3RKYA 1IN7A 4MGRA 2HTSA 2RQPA 5HLHA 3BY6A 4UVCA 3RYRA 4K2EA 3ZMUA 4GYGA 3NEUA 3VOEA 3Q9SA 4L9JA 4MQ9F 5D5XB 3KFWX 2QQAA 4G9YA 3O6BB 4A5MA 3TQNA 3TDZC 2QQ9A 3S2WA 3WGIA 4G7HF 2O61A 4HQMA 3ECOA 4BAYA 1RIOH 2P7CB 2HZTA 4E70A 1FLIA 4OU0A 4G7OF 4L9VA 1I1SA 1W7PA 3B02A 4LMYA 1TQPA 2FXAA 4ZYHA 5D4RA 1LDDA 1YIOA 3V8KA 5J8FA 1IF1A 1AWCA 1D8KA 3GXOA 5D5UB 3GF2A 4ZYEA 4JBAA 3KEQA 5JHUA 2FNPA 3ML6A 1USSA 3SFZA 3SXYA 4UNOA 2CWEA 4EGZA 2GXGA 3F22A 1YS7A 5H6QA 4KIBA 4R79A 2OQRA 2Z5UA 3WU1B 3F72A 1TQIA 1XCBA 2WC2A 3KZZA 5CYVA 2HEOA 2XRNA 2R7DA 3GUDA 1KU2A 5FO5A 3LQRA 1FWZA 3V8LA 2MH9A 1UCRA 2ZNYA 2R3SA 2COMA 1O3QA 2EFNA 1EV7A 2HWVA 4UHTA 1QGPA 3R6SA 2FOKA 2H09A 4KUMA 1RNLA 3WTVC 2DT5A 5LHHA 5HLIA 4G94A 1HW2A 3TO7A 1F1ZA 3FXUA 3LWFA 3R60A 2VN2A 1RI7A 4BHBA 3LQQA 3OOPA 2O3FA 3CUQC 1R7JA 2IPQX 1LB2A 2CYYA 1TTYA 1K78B 3HTSB 5H20A 4N0BA 4RB2C 3LA2A 4HF2A 2IA1A 2CSOA 3WTTC 3RDIA 4UVBA 1ZN2A 5IT3A 4L5JA 3TDUC 3ZN0A 2G7UA 1R5GA 2P7VB 3OV8A 1U2WA 3F23A 2ZJ2A 2FA5A 2XIGA 3E6CC 2XV4S 3KEOA 3WG9A 2GZWA 1D5VA 1R58A 4IJAA 3P9KA 4HOBA 2HDCA 4EJVA 4ESFA 3FWEA 2EFOA 1S6LA 4KA4A 4I0BA 1G4DA 4IRHA 3ZMDA 2OQGA 4MHGA 5AONA 3QP5A 5E20A 5DUIA 6PAXA 4A5NA 2GXBA 4G7ZF 5K5OA 1U3EM 2HS5A 2DO7A 3T1BA 3RJPA 2ZNZA 5JFRA 4O6JA 4N9IA 2LNBA 4ENNA 1S8NA 5J6XA 3QU6A 2PEXA 1WI9A 4OIOF 4EJUA 3COAC 2LF8A 3LSTA 1SD7A 3REOA 4YIIA 4LLNA 2YR2A 1WQ2A 1YO5C 4G6DA 2E1CA 1K79A 3L7WA 1BC8C 1YQAA 3HUGA 3DKWA 1WWXA 3C7JA 3GX4X 3E5UA 4B8XA 3HRTA 3GWZA 1XDSA 3TOAA 2L01A 1FYLA 2K7LA 5KK1A 2H27A 4IRGA 2CW0F 2D2WA 2EA4A 1FZPB 5LLQA 1PUEE 3M8EA 4EM2A 5BOXA 3H3UA 2FU4A 5LHGA 4I2OA 1W4MA 2H94A 3MAJA 4U0VA 1KA8A 2YPRA 1DPUA 4B09A 1XMAA 3BPVA 3U9GA 3MWMA 2RC4A 3RPQA 4NB5A 2FBHA 1E2XA 5ILSA 2FRHA 4HLYA 4BQAA 2GIVA 1ZRFA 2MC3A 1H9GA 2ISZA 1G3YA 1F9NA 2L3DA 4XSXF 2VODA 2A5YB 2PBIA 3MZYA 5E17F 4M72A 4P96A 1BI3A 5D8LB 3F8NA 4ZZLA 2MH2A 3W6JB 3BP8A 3KP5A 4U0YA 1SAXA 3O3KA 3JSOA 3NQOA 4JK1X 3FXRA 3E97A 3TGNA 4PGHA 5L3FA 4LLGF 3EYYA 4H0EA 1J59A 4I02A 1R1TA 2HYGD 4NQWA 3WTXC 4EJWA 4UUVA 4P5OA 2QENA 1J75A 1J5YA 2ADUA 4KFCA 3ZPLA 4FHTA 3WTYC 1QZZA 1KQ8A 4WXDA 4Y13A 1R22A 2OU2A 1I27A 3D5LA 3WE3A 4O3MA 3SHFA 2R7FA 3JTHA 2VXZA 4Q5SF 3ELKA 3JW4A 1ZHFA 1U5TC 1B1BA 2JZYA 2XKOA 3I71A 4MEXF 4M9ZA 3ECHA 2DK8A 3E6BA 1HKSA 5HLGA 2AS5F 2XAJA 3PFIA 2A07F 3HOTA 4HLXA 1TNTA 3DEUA 2EFQA 2VE8A 3EDPA 2OD5A 2UWMA 5FD6A 3W6KB 1V4RA 1MZBA 2PFBA 4PZJA 1HQCA 5ED4A 1W7PB 2QZ8A 2DFIA 5H6RA 2FQ3A 4AIKA 5E18F 3U1DA 4MNUA 1IRGA 4I98B 3B73A 5CVVA 2NNYA 1O3SA 4BXUA 1XCVA 2MD5A 1YW7A 3KE2A 3DQVC 1H0MA 4HX4A 1OYWA 4DNCA 2PMUA 3TKYA 3V7RA 1YLFA 3IRQA 1Z6RA 2STWA 1ZLKA 4HDVA 3KP4A 1OR7A 1ONVA 3BJ6A 2H6CA 1EH6A 5ICCA 2KIMA 4AIHA 1O57A 3QAHA 1SD6A 3K69A 1S7OA 1PDNC 1I5ZA 5LEKA 1ZAOA 3ZQ7A 1CF7B 2XAHA 3VB2A 4GXOA 3M7GA 2M1BA 2DU9A 5HVQC 1P92A 1S3JA 4HQEA 1E17A 3R0JA 2ZXJA 1SD4A 2OAZA 4P9UA 3K2ZA 2HKOA 2VC1A 3SZPA 2IW5A 3HRSA 4HA8A 2M87A 3D0SA 3L00A 1BI2A 2LF7A 1Z91A 4ASNA 3I53A 5DD4A 4I09A 4EQQA 1XGMA 5A2QZ 1VTNC 3O2PE 2D1HA 1IXRC 1P2FA 2TDXA 1YTYA 3G3ZA 4HW0A 1B59A 3ROUA 4QLCU 5LBQA 1DPRA 1IW7F 2ZMEB 3KCCA 3ERED 3H92A 2OBPA 3RYPA 2PJPA 3BOQA 1EH8A 2JSCA 3LAJA 4QWQA 4LD5A 2W85A 1Z6TA 2UXNA 3P7NA 2K02A 3ZMSA 1RUOA 2A6EF 1KU3A 1QZYA 1HW5A 3RIRA 4KT5C 3GLXA 4WCGA 2DLLA 3SQNA 3E6DA 1UHMA 3ABTA 4BHPA 3N4MA 1ZG1A 3IWZA 5DV5A 1J0RA 4FT8A 3QPHA 4LB6B 1SMYF 4EJTA 2OA4A 4UV9A 5E1ZB 4CGZA 2Q2EA 1OYYA 1TW3A 5L3CA 3V7CA 4S04A 1B4AA 3HIFA 2HOEA 2ELHA 3IKTA 5FLXK 5ILVA 2NS0A 1K78A 1FT9A 2DAOA 5DCFA 2K4BA 4WF2A 3T8TA 3CDHA 2XKPA 4LGWA 5BQTA 1SMTA 4IHSA 3JAMK 2HFHA 2XVCA 5LRRA 1LVAA 3DFGA 2FEZA 5LRSA 4ZZDA 4FX4A 2YX7A 1OYIA 1JHFA 2NAZA 2E7WA 2XGXA 2RVCA 3CJNA 3DPTA 4LJZF 5JI6A 3CO6C 4I0AA 3KP2A 2HYFA 2PG4A 4EMSA 5DCMB 3CUQA 1MJAA 3F8FA 4M9SA 3WTSC 2M45A 3MQ0A 3R61A 4A6EA 1KU7A 3IKVA 3BZ6A 3KP7A 4AD9A 1HW1A 2P5LC 4HDUA 2V6CA 1J9IA 2Z33A 2W24A 4RAZA 5JR3A 4LFUA 2PMHA 3CTAA 3QU3A 2RN7A 1I6XA 1IRFA 4RB1A 3I59A 3JTGA 3HSFA 3RPUA 1ZGJA 5FD5A 4KICA 1HKTA 1BI1A 1J7KA 2RKHA 4U7DA 1WSUA 4M74A 1KYZA 2OZ6A 4U88A 2V9VA 2XHKA 2A69F 5DDGA 2LKPA 4IHTA 5E8GA 1G6NA 2KIFA 1ON2A 1GHCA 4EVIA 3E5QA 4ESBA 4A6DA 3J80K 2FF4A 3U2RA 1FP2A 1LQ1A 3FM5A 2JPBA 2BBYA 3WODF 4N9HA 1XDUA 4L0YB 3M8FA 1U6GA 1QQIA 4M9XA 2GWRA 3FMSA 4R8HA 2VBYA 5CVIA 1JXSA 3BROA 1O7LA 2BV6A 3GW2A 2Y75A 1LDKB 3HHGA 1XN7A 3I5UA 5E1XA 4HAMA 1KU9A 2B0LA 5LHIA 4WK8F 1DP7P 3EUHA 5DEQA 4ESJA 2PN6A 2F5FA 2M8EA 1ODDA 2IA0A 1C0WA 2BYVE 3BDDA 1UB9A 2EB7A 4HZFA 1XGNA 3C3WA 2IA2A 3LA3A 3LFKA 2CG4A 3FX3A 4ENJA 3R0AA 2VE9A
chains in the Genus database with same CATH superfamily
5K5RA 2LP0A 3H0DA 2X9DA 2A6HF 1Y0NA 2V79A 2R92J 3FISA 1JTXA 2G0EA 2JQ7A 2X51A 4IRIA 3ABKH 1WFXA 1Z9CA 2K86A 1LEAA 2X4HA 3CUOA 3PQJA 4HBLA 4LG0A 5J1YA 1FMVA 2LH9A 3B6AA 2DW4A 5D5VB 2ESHA 2G9WA 2XAGA 2HVSA 3HKZN 5EF6A 4YFNF 5KNLA 3GFJA 1VQ8I 1BBYA 1Z1DA 2QUFA 3VSLA 3BC8A 5LGUA 5F64A 3DPLC 4XSZF 2F2EA 1JGSA 3ZMVA 1ETOA 4PJMA 5DCMA 2R93J 1MDMB 2DMQA 5D5WB 3LMMA 2GLOA 1EKEA 1YX5A 4KDPA 4UV8A 3LFUA 2XF5A 4WX9A 3LAPA 2YSRA 3FXKA 2FSWA 4OIQF 1U5TA 1SEUA 2A05A 4D1QA 4RA2A 5TRDA 1MBJA 3FXLA 1ZH5A 5L3DA 2IBDA 1HBXG 4DQ2A 1VQNI 4PK4A 4BGDA 3HSRA 4JP0A 2J5OA 1LJ9A 5KCMA 3MMYB 3Q3SA 2OZUA 2QM3A 2XDVA 1A5JA 3CMYA 1K6OA 2L7ZA 3OYIA 1YJ9I 3K4CA 4X6AJ 5D6EA 1P6RA 2WV0A 3TO6A 3NARA 1GXPA 4XKCA 2P6TA 1FYKA 1G3TA 4KN4X 2W82A 3RPUD 2UXXA 3V7SA 5LEJA 1T39A 3A01A 3PUBA 2PLYA 3G1MA 2VC0A 2HPIA 4Z2YA 2FE3A 1V3FA 1YG2A 1ZGWA 2OC6A 4KJZA 3C2GA 4XORA 2E1NA 2Q0OA 2ZO4A 3BJAA 4AYBN 2BHZA 4AVPA 1A36A 1R9TJ 2D45A 3AAFA 2E7XA 3W3CA 2VBWA 3M3YJ 1KONA 2JPCA 3JREA 1VFCA 5FRMA 1HCRA 2BXZA 1D1BA 3D5RC 2QF7A 2P5KA 3KZIC 4U0WA 3KZYA 2NYXA 5BPIA 1B6AA 2HQRA 4M3DA 1G8XA 1W5SA 5J40A 2Y0SN 2Y48A 4CCKA 2CV1A 1IG7A 3F3XA 1KZHA 3ZQQA 2DCEA 2JA6J 2R7VA 2HKXA 3ZN1A 5FLXZ 4E7SA 3J7ZI 3FMRA 1OMIA 3MCZA 4EV0A 1IXCA 1BI0A 1BC7C 4NC7A 2WB1N 3WHBA 4RLFA 3K6GA 4A3KJ 2E2IJ 2HXIA 4A3FJ 3D1NI 3ZRGA 1HKQA 2K4JA 3CMAI 3CUQB 1BIAA 5FKMA 1WRJA 5AIPA 3WU0A 2HVRA 3FM3A 2IS4A 3OS0A 1X19A 1VQ9I 3BTIA 2ETHA 4UB6C 5EG0A 3OIQA 1UHWA 1D3YA 1JKRC 2EFWA 1QO0D 3HOXJ 5M3FJ 3QODA 2DT6A 1XSXA 3CC7I 1Y0UA 3DU5A 2LY2A 1WKMA 3S1NJ 1MGTA 4O5VA 1BR4A 2PQ8A 2KMUA 2RV8A 2ECCA 3AKZA 2BGCA 3EQLF 5HNHA 3I3LA 2VONA 2IVMA 1DGWY 1Q1HA 4LLLA 1BR1A 3IWFA 5FROA 1TW2A 1RC9A 4MTEA 5IT9K 3FHNA 3FK7A 1SFEA 1JHHA 2Y31A 4OINF 3OS2A 1SD5A 2Z99A 1JUSA 1NK2P 3L09A 2NNNA 2EV0A 3NWSA 1KGSA 2V4JC 4B3XA 3CCUI 3S1QJ 2JTVA 2CV0A 3JAMZ 3MKYB 2P8TA 3WTUC 5IP6A 2V1XA 4C9YA 3K1NA 4EM1A 1REPC 1MNDA 2JT1A 4FX0A 3A1YA 5DUKA 1X2MA 1JJ8C 5FKLA 2XC7A 3RI4A 1D0YA 1U8RA 2WAFA 1ON1A 1YRNB 4IHXA 2Z3YA 3FF5A 1WI3A 3E6MA 5A2QK 4CXFA 3L2CA 4BY7J 3RTRA 4A3EJ 5FB2A 3CLOA 1X4OA 2EQRA 4B44A 4BYYA 3QPTA 2OTJI 4D0PA 3I0TA 2W48A 2YX4A 4RM3A 2EK5A 1F36A 3FXOA 2COBA 1ZGAA 1QA6A 4BXXJ 1RRJA 3A0BC 1MKMA 2OV7A 3WTZA 2FMYA 2ZB9A 1KYWA 2C6YA 2NOGA 1X4PA 2XGDA 2R5YB 1T95A 4CYCB 3GYHX 1YX3A 2M7BA 3OSGA 1MMGA 2L02A 4LK0F 5LFAA 5HDNA 4E7HA 3LNQA 4IVNA 1BJAA 2BVLA 3FHZA 3OYJA 3C18A 2KDOA 1APLC 2DA1A 4UB8C 1MNEA 1S9HA 4XL9A 1MDMA 3K1PA 4P1WA 4F7ZA 2CUEA 3WE2A 3FXMA 2ZJRF 4A3CJ 1GLNA 2V1UA 2CW8A 3V42A 1LVKA 1WJFA 1VZ0A 3PO2J 3OS1A 1FIAA 2ZKZA 1YOVB 1O3RA 2NVUB 2XF7A 2VI6A 3EETA 4HSRA 2F5CA 2HQNA 2OTLI 3DBHB 5JVTA 2E34A 1IAWA 3BCBA 1T2KA 4XOPA 2DI3A 2K3FA 5D8KB 3F6VA 2K3PA 4S05A 1GV5A 2VKHA 3HOSA 3KLNA 2JN6A 3RQ4A 1M1EB 1MSEC 2DBBA 2W25A 1MD0A 4M3BA 5E8IA 2KKOA 1IO2A 3EUHC 4A2UA 3WG7H 2R7RA 4LK1F 2D1VA 5IOYA 4MLOA 4XRSA 2OUMA 3F8BA 2VQGA 5ICFA 2RGVA 3GMEA 3HSEA 1T8IA 3LOCA 4UY8I 1SANA 2DMPA 3BG3A 4LOCA 2XB5A 2M5WA 1VF9A 1WJDA 1O7FA 3ABMH 2FBKA 4HV5A 5BPDA 1QHGA 2A6TA 3AG4H 4KIFA 5CVRA 4M6XA 4Y4RA 2LRDA 3H3VK 4YEJA 1ZR4A 3C2HA 3F6OA 1W0TA 2H8WA 2V9PA 4RS8A 2B9SA 4AIDA 1LEBA 3JRDA 3DXJF 4C2UA 5J8CA 2L9NA 3CDLA 4IPAA 1LPQA 2DODA 1FOYA 1VI0A 3GVAA 4CCOA 4RB0A 4S0HB 3WU2C 1D1AA 4D9JA 1VQ7I 3WHCA 4YG2F 3BR0A 2WY8Q 2CJJA 2DA6A 2EFPA 4DIQA 1ZYRF 3LL7A 3VYUB 4EM0B 1T38A 3KPHA 1QHHD 2DK5A 3DKXA 1B9MA 2HZDA 5GTIC 2M30A 4GFBA 4FASD 1QPMA 2EZHA 1E3PA 1P7JA 2LSOA 2FD5A 4ENMA 4L18B 4C2TA 2JA8J 1BIBA 1ORKA 5CKTA 1RZ4A 3GZ5A 1BN5A 3OYKA 2JSPA 2F5DA 3KX2A 1Y1WJ 4RLQA 5TJJA 2WTEA 1I3AA 1O3TA 5L3BA 4PUSA 2P5VA 1IZ1A 2W4SA 2G7HA 5B3SH 2Z9OA 1FSHA 5CPRB 4KMFA 1T98A 3SZTA 1SFXA 4HX8A 2MBFA 2DDBA 1CF7A 1ETYA 3DEWA 1P4WA 1I50J 5HNFA 4PSWA 5DD8A 4OIPF 3QYFA 5DYMA 2AQFA 1T0FA 1TWCJ 1Y1VJ 2CFXA 2V1DA 5F6FA 1OCTC 2BE5F 3ASNH 3IHUA 3K9TA 3R4KA 3H5AA 4A3DJ 3KLOA 3IC7A 3DKYA 1FNNA 1L0OC 2LTPA 4HEA2 1RUNA 2ZCWA 1FY7A 1YYVA 3DP7A 2CH0A 2ID6A 3S1MJ 1J2XA 4Q48A 1OCCH 5K5QA 3K1MA 3I59B 2ZMEA 4ZH4F 2CU7A 5CJ9A 1UJ8A 2L4MA 3LSPA 4E7JA 4M6YA 1FPQA 5EEHA 1MBFA 4MTDA 1FC3A 4WXHA 3FZVA 3BZKA 3FIWA 1U5TB 2QGUA 4HG2A 4AM3A 3ZP5A 5ILUA 4A0XA 4C3HJ 5D4SA 4L9NA 2DMUA 2QLZA 3V8JA 2VOPA 2ESNA 1XMKA 4IXAA 1WJAA 4C3JJ 5K1YA 1YFHA 2CUFA 3IUOA 4NQWB 3SZGA 3DLLF 2CMPA 1LDJA 3E5XA 4JYKA 5HS9A 3MKLA 5EYRA 5HS7A 4FE4A 4Q47A 3OR1C 4ZDOA 3HM5A 1STZA 1G3WA 3E0JB 1TBXA 3DU6A 4XMYA 1FOXA 4LB5A 2R7WA 5EEAA 3ONQA 4QSHA 3DPUA 2LBFA 5AIQA 5GP9A 3DTEA 5M5WJ 3SYTA 3BZCA 4XN3A 4BKXA 1NG7A 1X1PA 5JHFA 3KEYA 1RKTA 1SC7A 2IRFG 1A31A 1R00A 2NVYJ 1FOWA 3EUKL 5IYBJ 3F0CA 3TL4X 2K27A 1S29A 5FKOA 2ELJA 1LFBA 4II3A 1IV8A 1OQYA 5B1BH 4WWCA 2R5ZB 1HF0A 2IT0A 5HLTA 3OIOA 4LIVA 2ACJA 3HRMA 1UFMA 2FUG2 1PJRA 4XLHA 5KVRA 4WXCA 2A61A 3AG1H 3TOBA 1LFPA 4BBRJ 4BQNA 2QQBA 4FQGA 3OYNA 2ID3A 2K9QA 3FKJA 5F0CA 2JUGA 3HOWJ 4RB3C 1F5TA 1YIJI 2A5WA 3KP6A 2JRTA 2AQEA 2MLGA 4OWRB 1MJ9A 4DGWB 4KIGA 4CHUA 1Z77A 2EV5A 1NHAA 4OOIA 3IL2A 1IV6A 3OWTA 3DLAA 1FP1D 2Y9YA 4RGRA 1Z05A 4J01A 1VQMI 3Q5FA 2NVQJ 3GZ6A 4DBQA 4DZPA 2L7KA 2HGCA 2LMDA 3WTWC 3HYIA 2ZJQF 4HRIA 2RREA 1V5FA 5FGMA 4BDYA 2VOOA 5ICGA 2LDUA 2JVHA 5FFXA 1VQLI 2YU3A 2MSYA 1USTA 3I58A 4HV6A 2HOSA 1D8JA 3GCMA 3HG9A 2RAEA 2Y30A 3KYDB 2R7SA 1MIJA 2KDZA 2BY2A 4JQFA 1U78A 3RZOJ 1QBJA 4NNJA 4ZTFA 5KAFC 1B8IA 4CZZA 1VNDA 2DPDA 3M4OJ 1IN5A 1NG6A 4KMUX 4Q4ZF 5J4YA 1TNSA 2R7XA 4ETSA 5GTHC 3GO5A 4HSTA 2K40A 1MJBA 1XTAA 2HNHA 1ZRCA 2LKXA 1R6RA 4L9TA 1ACIA 2HR3A 5LGNA 2KJCA 3L2QA 1SVLA 2QBYA 2O03A 3AL0C 1I1GA 3PIPF 3ZQIA 3T5XA 3JRAA 3K70D 1EJ9A 2A3SA 4ZYDA 4HF0A 2DA3A 1QVTA 2VPRA 4AIJA 3TW6A 1XSDA 2FMLA 4ZYGA 5EDNA 3LSIA 1G3SA 3GEZA 1XSVA 2F6CA 1XD7A 2F5EA 3K4JA 3MEXA 5J4VA 2O6GE 4N4OB 3ZR8X 3ZQLA 1TWAJ 2O9LA 2GA1A 5C4XJ 5LGTA 3PNVA 2WV1A 4A0ZA 3OL3A 1POGA 1O4XA 5IT9Z 1MBEA 1YW8A 4E4HA 4CYDA 2RNJA 3P9IA 1D0ZA 4Y17A 3ISPA 2XF6A 4F55A 2X0LA 2R7OA 1MBHA 3MN2A 2XASA 4XQFA 3CMEI 1ZREA 1OCPA 3RKXA 4U7BA 4TV7A 3MKZA 3M8JA 4EJOA 3MZHA 4W97A 1K7AA 2ISYA 1WVRA 1I6HJ 1RR7A 2H1LA 2R7UA 1Z3YA 1YS6A 3WGHA 4AC0A 2DTRA 4A12A 3F21A 4GGGA 2IJLA 3EYIA 2EA2A 3GFMA 3FXQA 2L54A 4JX5A 4OAZA 3X2QH 4XLNF 4CZCA 2XUBA 4RGUA 2P4WA 3BJOA 3GFLA 2VQLA 1HXDA 4BJTA 2IAIA 3HC7A 5D6FA 4DOZA 2K85A 3N97A 1WHUA 4RGXA 5DS9A 2JWTA 1ETQA 4B4CA 5GAHJ 2IP2A 3CDIA 4A0YA 2ZC2A 2FNAA 2KRFA 1T6SA 1RKWA 1Z7UA 5HDKA 2DA2A 1H89C 1ITYA 3T0YA 3WGGA 2VJ4A 1IN6A 2STTA 2Y0MA 3ZGKA 2E36A 2ICWG 3BQYA 4PGGA 3PNYA 2ZSHB 4MO7A 1AKHB 4YIRX 3KYLA 2UUZA 1ZTRA 2M4GA 4YIFA 4Y3OA 2VT3A 3ZMZA 3BG7A 1MW7A 2GAUA 1BW5A 2CUZA 3A03A 4YFKF 4M73A 2VT2A 1V55H 3FMQA 1QNTA 4RAYA 3CO7C 2XAQA 1HDDC 4ITVA 2Q8KA 2EIMH 3J81K 1MMSA 1TQMA 1OKRA 1A6QA 3N05A 3F8MA 3MKWB 1HSTA 4ZYAA 1XB4A 1VQ6I 3M9AA 4RGSA 1PUFB 2GA2A 3QRFF 4IF4A 1CGPA 1IUYA 1PP8F 1ZARA 1YJNI 1OJLA 4CICA 3G73A 2F5VA 2R7QA 5FKKA 4M71A 4ON0A 5EEGA 1SFOJ 1RESA 5HDGA 4XK4A 4PCQA 1HOMA 2E1MB 2O8XA 4PDKA 4G6QA 3F8CA 3ABUA 2EJRA 2CQKA 2V26A 1Y8QB 3CMMA 4I99C 1FYMA 1FX7A 1JKOC 3KP3A 2AXLA 2QBYB 2FQ4A 4UXNA 3BT9A 2XAFA 5E3MA 3G6EI 4IHYA 1DQUA 1EH7A 2DQRA 3I9V2 4QPQA 4I7HA 3RKWA 1NK3P 1GDTA 1B9NA 2W00A 4HX7A 4X0GA 5F08A 3LSRA 1B8IB 1FBSA 2O0YA 4IQ4A 3M1EA 3J80Z 1IN8A 2IXSA 2MC4A 3JRFA 1A35A 5FFZA 1N25A 3CP2A 3S1RJ 4YFXF 1X3WB 2IEKA 3I64A 2LFBA 1JE8A 4KNYA 4OMYA 3QOPA 3ZCOA 1KQ9A 4IL6C 2B7EA 2QVOA 5BMZA 2HOTA 2CFOA 3HRUA 2WY7Q 4ZTJA 2OF7A 2DOFA 1NTCA 4JOMA 2PI0A 3E3VA 1SFUA 3GZNB 2QYOA 1R5HA 1FOKA 1I3QJ 4IOAF 1W7PD 2M0MA 2UZKA 2HI3A 5BS6A 2PMZN 1R4NB 5L3GA 1S7AA 1HSJA 3GTPJ 5IOZA 2WWYA 2E2JJ 1ZLJA 2M4KA 2X6XA 4B43A 3FXJA 4CDGA 1H88C 1IGNA 3GFIA 4DYRA 2GM4A 5CLSA 5IYCJ 4XLPF 3HOVJ 2CQNA 4I01A 4B1RA 2XB0X 1QU3A 2L5QA 4I76A 4L0ZB 5E3NA 2BEOA 2H6BA 3VEPA 3KYCB 4E7ZA 1ZG3A 1GXQA 2RDPA 2CV2A 3BWGA 1AOYA 2EV6A 1ZG5A 1GV2A 2VBZA 3RKQA 1AU7A 5EGOA 2RQQA 2FBIA 2CGPA 1OPCA 3PSFA 1OLTA 4BY1J 5J47A 3J7AO 5H2FC 3VODA 2LBFB 3JRIA 3BR2A 4OIRF 4CO8A 1LNWA 3JSPA 4GO1A 5ERIA 3KETA 2KZVA 1DUXC 4H4KC 4HYEA 4EGYA 1TWFJ 3H3ZA 4BQOA 2XPWA 3I4PA 5F1RA 4A3MJ 3PQKA 4P55A 1YW9A 4UVAA 2HXOA 5GADJ 5F0FA 4XBFA 2Y69H 4MEYF 3HL2A 1FSEA 1GVJA 3DV8A 2ZFWA 3I54A 2HVQA 2MLKA 1T33A 2QWWA 4L5IA 4J00A 4NHJA 3HHHA 1MMDA 3K0LA 3P9CA 1F4KA 1DU0A 3L9FA 1QRYA 3K4NA 4OMZA 2DQLA 2NRAC 2VASA 3GBGA 4Y15A 2JA5J 3PNTA 2ME0A 1DDNA 2VBXA 2DJIA 4GCVA 2K9NA 3OOUA 3W2VA 4ENKA 1P4XA 1TLHB 2EZKA 5F04A 4KN7X 2KIQA 2BZTA 5HS8A 2QSFX 4MIMA 1ULYA 2XROA 1BM9A 3TP0A 1PP7U 4KYWA 1KQ0A 4GYIA 2MA3A 3EUAA 3J81Z 2KLOA 1AA7A 4LIUA 2DPUA 1XGSA 3SEQA 2LY9A 3AG2H 1H8AC 2DOEA 3K4LA 5B5EC 3DTIA 1R23A 3ULQB 3V4GA 3GTJJ 4EEFG 5L3EA 3I55I 2J5PA 3BPXA 5E1WA 1SVOA 3MFKA 3H5RA 2YUSA 3VPRA 1XGOA 4BHCA 5HOOA 4BH9A 2PJRA 2P6SA 2GQQA 1K4SA 3C1DA 3HTUA 3HOZJ 5IY5H 1FTZA 5F0HA 4A69C 1IN4A 2XSJC 4D7MA 5CVJA 2R0QC 3A2KA 1JTYA 3QP6A 4G8XA 3SFIA 2Z1DA 4G6TB 4XKBA 1BW6A 2EWNA 2M0CA 4XLCA 4R1HA 4XRFA 4IZZA 3LA7A 2HTJA 4YELA 1BL0A 5EZHA 5KAIC 1D5YA 2E1MC 1R1UA 3K2AA 3TO9A 1FBUA 4HNTA 3U1KA 2OCCH 1L3LA 4AWXB 4P9FA 1R1VA 2V9KA 3IRRA 1H9TA 3I4NJ 3S15J 4PJJA 1WGXA 2ZBKA 1DP3A 2Y9ZA 3CC4I 1FIPA 2KFDA 1X1DA 3HDDA 1IXSB 1R36A 4XR6A 2JUCA 3H9QA 2E2HJ 3H9GA 2QQ8A 3ZMTA 1P4AA 3CCLI 1CQTA 3Q9VA 4BNCA 3MVPA 4LG0B 1QZEA 1JGGA 4MQVA 3VFZA 1U9OA 1JT6A 3BR3A 5F27A 5GAEJ 5ICEA 2KPMA 1VQ5I 1BOAA 2KIUA 1FBQA 1ZRDA 3CCEI 1OCOH 2KJBA 3T8RA 1A04A 2Z16A 4XICA 2QEXI 1E3HA 3LSJA 4HF1A 2L9SA 1JUMA 2VKDA 3H0GJ 2CO5A 2L4AA 2X6YA 4XRSG 3NRVA 1X3UA 2L0KA 3QOEA 5CQEA 3DF8A 3BQZA 3PSIA 2W57A 1X1AA 2A68F 1W5TA 3G1OA 5CVUA 2V7FA 2MYSA 2CS3A 2W84A 3RKYA 1ZR2A 1IN7A 2YS9A 4MGRA 2HTSA 2RQPA 5HLHA 3BY6A 2QSGX 4UVCA 1Y8RB 4K2EA 3RYRA 3ZMUA 3M1CA 4GYGA 4ZDPA 3NEUA 5C3EJ 3VOEA 3Q9SA 4L9JA 4MQ9F 5D5XB 3KFWX 2QQAA 3K4MA 3O6BB 4G9YA 4A5MA 3TQNA 3TDZC 2QQ9A 3S2WA 3WGIA 3AFHA 4PFOA 4B3AA 4G7HF 3OYFA 2O61A 4HQMA 3ECOA 2XRLA 3DTKA 4BAYA 1RIOH 1QPIA 2P7CB 3HJEA 4BBSJ 2HZTA 4E70A 1FLIA 3SJMA 1TC3C 2MABA 4BE0A 4OU0A 3BCAA 4G7OF 2OPTA 2ZFUA 4PJ0C 4L9VA 1I1SA 2X48A 1W7PA 2P81A 2NS8A 3B02A 4LMYA 1TQPA 2FXAA 4ZYHA 4I6ZA 1YJWI 5D4RA 1LDDA 1YIOA 3S2DJ 4C30A 2O5RA 3V8KA 3OIPA 3L2UA 5J8FA 4II2A 1JUPA 1IF1A 1AWCA 2BXYA 3TW7A 1D8KA 2GOXB 1T56A 2FJ1A 3GXOA 5D5UB 1K61A 2DT7B 3GF2A 4ZYEA 3K10A 1UELB 4JBAA 1IUFA 3KEQA 5JHUA 2FNPA 3ML6A 2VJ5A 1USSA 3SFZA 4A3GJ 3SXYA 4UNOA 2CWEA 1EA3A 4EGZA 2QKMB 2GXGA 4XNFA 3F22A 4M6VA 2F48A 1YS7A 5H6QA 2MGQA 4KIBA 3JRBA 4R79A 2OQRA 2Z5UA 3WU1B 3F72A 2M7AA 3IAM2 1TQIA 2E5ZA 1XCBA 2WC2A 1V5EA 3KZZA 5CYVA 2HEOA 1YRNA 4DJAA 2XRNA 2R7DA 3GUDA 1KU2A 5FO5A 1U8BA 1B72A 3LQRA 2GOMA 5JLWA 1FWZA 3V8LA 2MH9A 1UCRA 2ZNYA 2EIJH 2COMA 2R3SA 1O3QA 2GBYA 3A02A 1X1CA 2EFNA 1EV7A 2HWVA 4UHTA 2F4OB 3OYGA 1QGPA 3R6SA 4EATA 2FOKA 2H09A 2DMNA 4KUMA 1RNLA 3WTVC 1ERDA 2DT5A 2GXAA 1XC5A 2K5CA 5HLIA 1QVUA 5LHHA 3HOUJ 4PFPA 4G94A 1UG0A 3L1PA 1HW2A 3TO7A 3TBIA 3UNGC 1F1ZA 3FXUA 4J19A 3LWFA 3R60A 1K6YA 2VN2A 3H35A 1IRXA 4B48A 1RI7A 4BHBA 3LQQA 2W7NA 3OOPA 2O3FA 3CUQC 1R7JA 3BG9A 2DFHA 2IPQX 4Z6YA 1LB2A 2CYYA 4AUXA 1TTYA 2Z2SB 4Y33A 3HGYA 1K78B 4N4NB 3HTSB 5H20A 3W2AA 4N0BA 2X1DA 4RB2C 3LA2A 4HF2A 2IA1A 3CF5F 4MFDA 2CSOA 2DMTA 3WTTC 4IKFA 4GDFA 3RDIA 2ZMEC 1ZN2A 4UVBA 4BJ5C 5IT3A 1E0EA 1Z0XA 4L5JA 4ZDLA 3TDUC 3ZN0A 1T08B 2IS6A 2JK3A 3CJTB 3DEEA 2G7UA 2I10A 3GTLJ 5EZGA 1D0XA 3J7YJ 1WJ5A 1R5GA 3HBLA 4XKWA 3HKZA 3S17J 2P7VB 4FETA 4FE7A 2VLAA 3OYMA 3E7LA 3OV8A 1U2WA 3F23A 4F3QA 2LD5A 3RQIA 2ZJ2A 3OMYA 2FA5A 2XIGA 5FKNA 4HNUA 1WPKA 3IAS2 3E6CC 2XV4S 3KEOA 4JX4A 3WG9A 1BOBA 2GZWA 1D5VA 1R58A 1WZ2A 3CJRB 1BJZA 4IJAA 3P9KA 4HOBA 3H5NA 3W2WA 1XMXA 5DM6F 2HDCA 1TZLA 4EJVA 4ESFA 3K4KA 4DW6A 4ABZA 2R7TA 3LSHA 1UHSA 2R5ZA 1XX5A 1MMNA 2YU9J 1BA5A 2IS2A 3Q0UA 1YITI 4A3LJ 2F4IA 2WAQN 1S7EA 3FWEA 2EFOA 3JRHA 1S6LA 3DCFA 2HDDA 2IGKA 2PJRB 4KA4A 4I0BA 1G4DA 4IRHA 3ZMDA 4OAYA 2OQGA 3NWTA 5K7HA 4BE1A 1OCRH 2E1OA 4MHGA 5AONA 3QP5A 4KISA 2X6OA 5E20A 3UR3C 5DUIA 6PAXA 3FBNB 2KRHA 2L2OA 1IDZA 4A5NA 2GXBA 5DTDA 1AKHA 4G7ZF 3CCYA 5K5OA 2KP6A 4ZJZA 1U3EM 2HS5A 3ZQFA 2DO7A 3T1BA 3RJPA 2L9VA 1W5CC 1VQKI 2ZNZA 3B6CA 4NC6A 1PVEA 4M3EA 5B66C 5JFRA 4QTRA 1K4TA 4O6JA 3S8PA 4N9IA 2EIKH 3J7AY 1FMWA 4QPOA 2LNBA 5J1UA 2E71A 1TWGJ 4ENNA 3HUGB 1S8NA 3P5JA 2Y0SA 3K7AJ 3QU6A 5J6XA 4V2GA 2PEXA 1WI9A 3ABLH 3S32A 4OIOF 4V19K 2PMZA 4EJUA 4UUSB 2M9HA 1N75A 5DM7F 1GT0C 3S2HJ 4BEHB 1R4MB 3HEFA 2BVMA 5M5YJ 3COAC 2LF8A 3LSTA 1SD7A 5EGOB 3REOA 3PO3J 3JRCA 3ASOH 5CQGA 4YIIA 4BUPA 3QYEA 5TGTA 3FDYA 4LLNA 2LREA 2R5YA 2YR2A 4NUBA 3H1CA 1WQ2A 1YO5C 4G6DA 2E1CA 2E60A 3L7WA 1K79A 3BTCA 2CQQA 1BC8C 1YQAA 2P0WA 2O8KA 3HUGA 1JJ6C 3DKWA 1WWXA 3OYHA 1P7IA 2VQHA 4BS9A 4DZJA 2NS7A 3PJRA 3C7JA 3GX4X 2E19A 1PYVA 1U0JA 3E5UA 4B8XA 1RETA 3HRTA 3GWZA 1OFCX 3FBIB 2R7ZJ 1XDSA 3TOAA 1NH3A 2L01A 4UUTA 3IP4B 1FYLA 2K7LA 3G4SI 5KK1A 3GTMJ 5M5XJ 2H27A 4IRGA 5F1JA 2CW0F 1VQPI 1OISA 3CJQB 3IH2A 1IDYA 2D2WA 1N77A 2CW7A 2EA4A 1FZPB 4M3GA 5LLQA 1PUEE 1WH5A 3M8EA 3I4MJ 1JKPC 4CA0A 4EM2A 5FLVA 1UZCA 5BOXA 3H3UA 2FU4A 2MD0A 3PL8A 4V2FA 5LHGA 3RZDJ 3BR1A 4A93J 2EPFA 5K7FA 3MD2A 2M34A 2ZJPF 4I2OA 3L2VA 1W4MA 4IHWA 3HZJA 2LKSA 2H8RA 3HB9A 2DXIA 2H94A 3MAJA 4U0VA 1KA8A 1YE9A 2YPRA 1DPUA 2NVTJ 3CP8A 3GTKJ 4B09A 3IH4A 1XMAA 3BPVA 3U9GA 4D7NA 3MWMA 5IYDJ 2RC4A 3RPQA 2XSDC 4NB5A 3H9JA 2DFFA 3CF2A 2FBHA 3HXLA 1E2XA 4G12A 2FRHA 5ILSA 4C2MJ 2MG4A 4HLYA 2WADA 4BQAA 2Y2ZA 5GPAA 2GIVA 1ZRFA 2MC3A 1MMAA 1H9GA 2ISZA 3QWLA 3C2BA 1G3YA 1MH3A 1F9NA 4RM2A 3BR6A 1IC8A 2HQAA 1ZQ3P 5LD2C 2L3DA 4XSXF 2VODA 2A5YB 2PBIA 3MZYA 5E17F 4M72A 4P96A 1VQOI 4X1EA 1BI3A 5D8LB 2X85A 2L7MP 3F8NA 4ZZLA 5KHDA 2KRCA 2MH2A 3HPGA 4DBRA 3W6JB 3BP8A 3KP5A 4U0YA 5E79C 4YRVA 3Q0WA 3CCMI 4AVZA 4HNVA 2M2EA 1W0UA 3O3KA 3VSKA 1U9NA 1SAXA 3JSOA 3NQOA 4JK1X 2JJ7A 3CESA 3FXRA 1B72B 1Y6IA 3OYCA 3E97A 3TGNA 4PGHA 2FX0A 3S3MA 5L3FA 4LLGF 2HPMA 3EYYA 4H0EA 1J59A 3S14J 4I02A 3OYLA 2JA7J 1R1TA 2HYGD 4NQWA 2BOLA 4E6KG 3WTXC 2OJED 2QCOA 4EJWA 3OYBA 1E3OC 4UUVA 1ETXA 2XGEA 2KZGA 4P5OA 4XLAA 3L2WA 2DA7A 2QENA 1J75A 1J5YA 2ADUA 4C3IJ 4KFCA 5JLXA 3S3NA 1ZELA 3ZPLA 1Z67A 1X2NA 4FHTA 2X6WA 2L9RA 3SDGA 3WTYC 4CCJA 1QZZA 2UV1A 1KQ8A 2QSHX 3QPLA 4WXDA 4Y13A 1R22A 4CYCA 1OCZH 2OU2A 1I27A 3D5LA 3WE3A 4FCYA 4O3MA 3K70C 3SHFA 2R7FA 1ZKGA 2DFEA 3JTHA 2VXZA 2XGCA 4Q5SF 2CUJA 3DBLB 3ELKA 4F91B 2DDAA 3JW4A 1ZHFA 4IEJA 1U5TC 1B1BA 2JZYA 4BE2A 2XKOA 4XRMA 2XPVA 3I71A 4XLEA 3VYTB 3PUFA 4MEXF 5C4JJ 1N78A 4M9ZA 4XIDA 3ECHA 2DK8A 3E6BA 1HKSA 3Q0VA 1V54H 5HLGA 5E3LA 2AS5F 4U87A 2XAJA 3PFIA 2A07F 3HOTA 2EILH 4HLXA 5GAGJ 1BR2A 2NOJB 1TNTA 3DEUA 4PJNA 2EFQA 2VE8A 3EDPA 4RAGA 2OD5A 1LE8B 2UWMA 3GTOJ 5FD6A 2EBIA 4RAFA 3W6KB 1V4RA 1RPWA 1MZBA 4RDUA 2PFBA 2DTZA 4PZJA 4XLFA 1HQCA 2HYJA 1JKQC 5ED4A 1WJCA 1W7PB 2ELKA 4ANJA 4XM3A 1P9QC 2QZ8A 4BJ6C 2TCTA 4BXFA 2VJJA 2NVXJ 2DA4A 2GIZA 2DFIA 2XAUA 5H6RA 4BEHA 2FQ3A 1XPXA 4AIKA 5E18F 1R49A 3U1DA 4MNUA 5FRNA 4I98B 1IRGA 3HGGA 3B73A 2KT0A 5CVVA 1TL8A 2NNYA 2XPUA 4BXUA 1O3SA 1XCVA 2JVGA 2MD5A 1YW7A 2D5VA 3KE2A 1X3ZB 2DJNA 3DQVC 3OR2C 1SAUA 2KHMA 1MBKA 1H0MA 4HX4A 3K4BA 4DYQA 1OYWA 2LVSA 4DNCA 2W1OA 2N8GA 2PMUA 3TKYA 2WB1A 3ZQHA 3V7RA 2HDWA 2I8DA 1YLFA 3IRQA 1Z6RA 2STWA 2K9MA 1ZLKA 4HDVA 3D5SC 3KP4A 4F52A 3I56I 3QPSA 2AO9A 1OR7A 1ONVA 1S72I 3BJ6A 4W1UA 2H6CA 3LSGA 1EH6A 5ICCA 2KIMA 3CCVI 4AIHA 1TP4A 2BW3A 3AL0B 1O57A 3QAHA 4BQQA 2ECBA 1SD6A 3K69A 2AHQA 2DYSH 4DYCA 1ENHA 1X1BA 3FK6A 1S7OA 1PDNC 1I5ZA 5LEKA 2LG4A 1ZAOA 4MFEA 3ZQ7A 1WCMJ 1CF7B 2XAHA 1Z7LA 2VB6A 3VB2A 2B63J 2R4GA 1SFKA 2K9LA 2KISA 3M7GA 1XG1A 4GXOA 3ZQGA 2M1BA 3BLYA 1ETWA 2DU9A 4JX6A 5HVQC 1P92A 2BY0A 1S3JA 4HQEA 1E17A 2OCEA 3R0JA 2V1NA 3CCQI 2ZXJA 4IO9F 1Y56A 1SD4A 2OAZA 4P9UA 3SDBA 3K2ZA 1JT0A 1S5LC 2HKOA 2VC1A 3IH3A 3SZPA 2BY3A 2IGMA 3OYAA 2IW5A 3TMOA 2EINH 3HRSA 3L2RA 4HA8A 1W1WE 2E35A 2M87A 3D0SA 3L00A 3RSNA 4A3JJ 1DU6A 1BI2A 2LF7A 1Z91A 4ASNA 3BTJA 3I53A 5DD4A 4I09A 4EQQA 1XGMA 1TWHJ 2VQCA 5A2QZ 5FLMJ 1VTNC 3O2PE 2D1HA 3OL4A 1IXRC 1P2FA 3BG6A 2TDXA 3A0HC 1Z21A 2FOWA 3PIOF 1YTYA 2I5UA 3CZ6A 3CCSI 3M07A 1XS9A 3G3ZA 3AG3H 4HW0A 1B59A 2O7OA 3ROUA 3DWLE 4QLCU 5LBQA 5J1RA 4IX7A 3GTGJ 2MW8A 4UUSA 3CQZJ 1DPRA 1IW7F 5K7ZA 2ZMEB 3KCCA 3ERED 3H92A 4LG3A 2BHYA 3OSFA 2OBPA 3RYPA 1LE8A 1MNMC 2PJPA 3BOQA 1HLVA 1EH8A 2DYRH 2JSCA 1MH4A 1IRZA 3LAJA 4QWQA 2LLKA 4LD5A 2QKLB 2W85A 1Z6TA 4B47A 2LK2A 2CQXA 3PFYA 2UXNA 1RR8C 3P7NA 2K02A 3E1SA 3ZXSA 3ZMSA 1RUOA 2A6EF 1KU3A 1QZYA 1HW5A 2BY1A 3RIRA 3VDXA 3SEZA 2NXNB 1OR7C 4KT5C 1FJLA 3GLXA 4WCGA 1MBGA 2DLLA 2LC2A 2WAEA 3SQNA 3BTLA 3E6DA 1Y39A 2H1KA 1FTTA 5HODA 4XN0A 4FTHA 1UHMA 1K83J 3ABTA 3CCRI 4BHPA 3N4MA 1SVMA 3JRGA 1ZG1A 3IWZA 2DOAA 5DV5A 1J0RA 4FT8A 4M3FA 3QPHA 4LB6B 1LKXA 1SMYF 3OYDA 4EJTA 2PX9A 1D1CA 2OA4A 2WBMA 4UV9A 5E1ZB 4CGZA 2Q2EA 1ETKA 1WJEA 1OYYA 2VKVA 1TW3A 5L3CA 3BR5A 4BL0B 2VIXA 3V7CA 4S04A 1B4AA 3HIFA 3A4CA 2HOEA 2ELHA 4NBQA 2EZIA 1WH7A 3IKTA 1F43A 4F93B 5FLXK 1UMQA 4ZC3A 1V5GA 3S93A 2NS0A 5ILVA 4KT6A 4XKVA 2QA4I 3CCJI 1K78A 1FT9A 2DAOA 4Y52J 1A6IA 3U21A 1R5ID 1TT5B 3GTQJ 5DCFA 2K4BA 4WF2A 3T8TA 1GVDA 3CDHA 2VKEA 3QYBA 2XKPA 4GRIA 2BW3B 3UKGA 3ERMA 4LITA 4LGWA 5BQTA 5JVGF 4IOCF 4E7IA 1SMTA 2HU9A 5IP7J 4IHSA 2M3AA 4RMNA 3JAMK 4E7LA 2HFHA 2KQRA 2XVCA 5LRRA 1LVAA 1R71A 4A3BJ 1W36D 3DFGA 2FEZA 5LRSA 1T0FC 4ZZDA 1HC8A 4FX4A 2YX7A 3RCOA 3IV5A 3HPHA 1WJBA 4PJLA 1IJWC 3G1LA 1OYIA 4A3IJ 1JHFA 2X1EA 1Q1VA 2NAZA 1UAAA 2E7WA 2XGXA 3LSKA 2K9SA 4E7KA 2L7FP 2RVCA 3CJNA 3DPTA 5E3OA 4LJZF 5JI6A 3CO6C 2JA2A 2ZXWH 4I0AA 3KP2A 2HYFA 2PG4A 4EMSA 5DCMB 1PUFA 3CUQA 1X58A 1MJAA 1J09A 3F8FA 4M9SA 1YI2I 3JR9A 2EH3A 3WTSC 5C44J 4CCLA 4CUGA 3CC2I 1ETVA 2M45A 4Y7NJ 3MQ0A 2DA5A 2WA0A 3R61A 4A6EA 2F4MB 2VXDA 1KU7A 3EPZA 3S3OA 2LOOA 2TRTA 3IKVA 4BDZA 3BZ6A 3KP7A 4KITB 4AD9A 3BG5A 1HW1A 3H36A 2P5LC 5GPCA 4HDUA 1I39A 4L5EA 4NC8A 2V6CA 1J9IA 2Z33A 2W24A 1GUUA 4RAZA 3S16J 4LFUA 5JR3A 2PMHA 3CTAA 3OYEA 3ESWB 3QU3A 2RN7A 3NAUA 1ZK8A 1I6XA 4CCNA 1IRFA 3G71I 2VL8A 1AHDP 4HPQA 4D5FA 4RB1A 1G59A 3HOYJ 3I59A 3JTGA 3W6VA 3HSFA 3RPUA 2ZXHA 1ZGJA 5FD5A 4KICA 3FKIJ 1HKTA 4FISA 1BI1A 1J7KA 2HQ5A 3A01B 1TT0A 4AYBA 2RKHA 2IS1A 4U7DA 1WSUA 4M74A 1KYZA 2OZ6A 4CCMA 4U88A 2LYCA 2Q1ZB 2A69F 2V9VA 2XHKA 4AU7A 2IGOA 1UG2A 5DDGA 1W36C 5B1AH 1VQ4I 2LKPA 4IHTA 3TP3A 5BNGA 5E8GA 5IPAA 1G6NA 2ME6A 3VWBA 2KIFA 3CLQA 1ON2A 4CH7A 1GHCA 4EVIA 3E5QA 3KIOA 4ESBA 4A6DA 3J80K 1LUJB 3QQAA 3JCUC 3OY9A 2LY1A 2DN0A 2FF4A 3U2RA 3PM1A 4XONA 1HDPA 4CSWA 1FP2A 1LQ1A 3FM5A 2JPBA 2BBYA 2JRMA 2X1CA 5EJCA 2JMWA 3MZ8A 3WODF 1EF4A 1FEXA 4N9HA 1XDUA 2WAQA 2E5NA 2HOAA 4L0YB 3M8FA 2VUMJ 1U6GA 1QQIA 4PSXA 4M9XA 2GWRA 3FMSA 1MSFC 2Q2EB 4R8HA 2VBYA 2AXTC 5CVIA 4IHVA 1JXSA 4D5CA 3BROA 1O7LA 2BV6A 3GW2A 2Y75A 1LDKB 3HHGA 2EZLA 4QIWN 3DBRB 4IQJA 1XN7A 2V6EA 1G2HA 4BU2A 2VPLA 2M8GX 1Z3XA 3I5UA 5E1XA 5IP9J 4HAMA 1KU9A 5J3LA 3CD6I 2CQ7A 2B0LA 2IGNA 5LHIA 4WK8F 1DP7P 3GLLA 1DGRM 4BACA 2MFZA 1JI8A 3EUHA 9ANTA 2CRGA 3O8GA 5DEQA 3O8HA 5EG0B 4ESJA 2PN6A 5TISC 2ZXIA 1HA8A 2KL4A 4NDLA 2F5FA 2M8EA 2ZSIB 1ODDA 2IA0A 2RNGA 3G2BA 1C0WA 2BYVE 1LFUP 4XOTA 4F92B 3BDDA 3VYRB 3F9KA 1UB9A 3LSMA 2EB7A 4RBOA 4HZFA 5M3MJ 1XGNA 3C3WA 2IA2A 3LA3A 1YHQI 3LFKA 2CG4A 2VJIA 5FJ8J 3FX3A 4ENJA 3ZOBA 2LR8A 3ZQCA 3R0AA 3TEDA 3VYSB 2VE9A
chains in the Genus database with same CATH topology
5K5RA 2A6HF 2V79A 4IRIA 1Z9CA 2K86A 1LEAA 2X4HA 3CUOA 3PQJA 4HBLA 4LG0A 2DW4A 5D5VB 2ESHA 2G9WA 2XAGA 4YFNF 3GFJA 1BBYA 1Z1DA 2QUFA 5LGUA 5F64A 3DPLC 4XSZF 2F2EA 1JGSA 3ZMVA 5DCMA 1MDMB 5D5WB 4KDPA 4UV8A 4WX9A 3LAPA 2YSRA 2FSWA 4OIQF 1U5TA 5TRDA 1ZH5A 5L3DA 1HBXG 4DQ2A 3HSRA 2J5OA 1LJ9A 2OZUA 2QM3A 1K6OA 5D6EA 1P6RA 2WV0A 3TO6A 1GXPA 2P6TA 1FYKA 1G3TA 4KN4X 5LEJA 2UXXA 3V7SA 1T39A 2PLYA 2VC0A 4Z2YA 2FE3A 1V3FA 1YG2A 2E1NA 2Q0OA 2ZO4A 3BJAA 4AVPA 2D45A 3AAFA 2E7XA 2VBWA 2JPCA 2P5KA 4U0WA 3KZYA 2NYXA 5BPIA 1B6AA 2HQRA 1W5SA 2Y48A 3F3XA 2HKXA 3ZN1A 5FLXZ 3FMRA 1OMIA 3MCZA 4EV0A 1IXCA 1BI0A 1BC7C 1HKQA 2K4JA 3CUQB 1BIAA 1WRJA 5AIPA 3WU0A 3FM3A 2ETHA 1UHWA 1D3YA 2EFWA 1QO0D 1XSXA 1Y0UA 1WKMA 1MGTA 4O5VA 2PQ8A 2RV8A 2BGCA 3EQLF 2VONA 2IVMA 1Q1HA 4LLLA 3IWFA 1TW2A 4MTEA 5IT9K 1SFEA 1JHHA 4OINF 1SD5A 2Z99A 3L09A 2NNNA 2EV0A 1KGSA 2JTVA 3JAMZ 2P8TA 3WTUC 2V1XA 3K1NA 4EM1A 1REPC 2JT1A 4FX0A 5DUKA 3RI4A 1U8RA 1ON1A 2Z3YA 3FF5A 3E6MA 5A2QK 4CXFA 3L2CA 3RTRA 5FB2A 3CLOA 4BYYA 3QPTA 4D0PA 3I0TA 2YX4A 2EK5A 1ZGAA 1MKMA 3WTZA 2FMYA 1KYWA 2C6YA 3GYHX 2L02A 4LK0F 5HDNA 4IVNA 1BJAA 3FHZA 3C18A 1MDMA 3K1PA 4F7ZA 3WE2A 2V1UA 2ZKZA 1O3RA 3EETA 2F5CA 2HQNA 5JVTA 1IAWA 1T2KA 5D8KB 2DI3A 3F6VA 4S05A 3HOSA 3KLNA 2DBBA 2W25A 1MD0A 5E8IA 2KKOA 4A2UA 4LK1F 2D1VA 3F8BA 5ICFA 2RGVA 3HSEA 2M5WA 1O7FA 2FBKA 4HV5A 5BPDA 4KIFA 5CVRA 4M6XA 3F6OA 4RS8A 1LEBA 3DXJF 5J8CA 4IPAA 3GVAA 4RB0A 4YG2F 2EFPA 1ZYRF 4EM0B 1T38A 2DK5A 1B9MA 2M30A 1QPMA 2LSOA 4ENMA 4L18B 1BIBA 1RZ4A 3GZ5A 1BN5A 2F5DA 5TJJA 2WTEA 1O3TA 5L3BA 2P5VA 1IZ1A 2G7HA 2Z9OA 1FSHA 4KMFA 1T98A 3SZTA 1SFXA 4HX8A 2MBFA 1CF7A 1P4WA 5DD8A 4OIPF 5DYMA 1T0FA 2CFXA 2V1DA 5F6FA 2BE5F 3IHUA 3K9TA 3R4KA 3KLOA 3IC7A 1FNNA 1L0OC 1RUNA 2ZCWA 1FY7A 1YYVA 3DP7A 1J2XA 4Q48A 5K5QA 3K1MA 3I59B 2ZMEA 4ZH4F 5CJ9A 2L4MA 4M6YA 1FPQA 5EEHA 4MTDA 1FC3A 4WXHA 3FZVA 1U5TB 3ZP5A 5ILUA 4A0XA 5D4SA 4L9NA 2QLZA 3V8JA 2VOPA 2ESNA 1XMKA 4IXAA 5K1YA 1YFHA 1LDJA 3E5XA 5HS9A 5HS7A 4Q47A 1STZA 1G3WA 1TBXA 4LB5A 5AIQA 2IRFG 1R00A 2K27A 1S29A 4WWCA 2IT0A 2ACJA 3HRMA 1UFMA 5KVRA 3TOBA 4WXCA 2A61A 2QQBA 4RB3C 1F5TA 3KP6A 2JRTA 2MLGA 1MJ9A 4KIGA 4CHUA 2EV5A 1NHAA 4OOIA 3IL2A 1FP1D 4RGRA 1Z05A 3Q5FA 3GZ6A 2HGCA 3WTWC 3HYIA 5FGMA 2VOOA 5ICGA 2LDUA 5FFXA 2YU3A 1USTA 3I58A 4HV6A 1D8JA 4JQFA 1U78A 1QBJA 4CZZA 2DPDA 1IN5A 4KMUX 4Q4ZF 1TNSA 4ETSA 3GO5A 1MJBA 1ZRCA 4L9TA 2HR3A 5LGNA 2KJCA 2QBYA 2O03A 1I1GA 3T5XA 2A3SA 4ZYDA 4HF0A 4AIJA 1XSDA 2FMLA 4ZYGA 1G3SA 3GEZA 1XSVA 1XD7A 2F5EA 3MEXA 2O6GE 2GA1A 5LGTA 4A0ZA 5IT9Z 1YW8A 4CYDA 2RNJA 3P9IA 4Y17A 3ISPA 2X0LA 2XASA 1ZREA 3RKXA 4U7BA 4TV7A 4EJOA 3MZHA 1K7AA 2ISYA 1YS6A 3WGHA 2DTRA 4A12A 3F21A 4GGGA 2IJLA 3EYIA 2EA2A 3GFMA 3FXQA 2L54A 4XLNF 2XUBA 4RGUA 2P4WA 3BJOA 3GFLA 1HXDA 5D6FA 3N97A 4RGXA 2IP2A 4A0YA 2FNAA 2KRFA 1T6SA 1Z7UA 5HDKA 3T0YA 3WGGA 1IN6A 2STTA 2Y0MA 4PGGA 4YIFA 2VT3A 3ZMZA 2GAUA 4YFKF 4M73A 2VT2A 3FMQA 4RAYA 1QNTA 3CO7C 2XAQA 2Q8KA 3J81K 1OKRA 1TQMA 3F8MA 1HSTA 1XB4A 3M9AA 4RGSA 2GA2A 3QRFF 4IF4A 1CGPA 1IUYA 1PP8F 1ZARA 4CICA 3G73A 4M71A 4ON0A 5EEGA 5HDGA 4PCQA 4PDKA 2O8XA 4G6QA 3F8CA 3ABUA 2EJRA 2CQKA 1FYMA 1FX7A 3KP3A 2AXLA 2QBYB 4UXNA 2XAFA 1EH7A 2DQRA 3RKWA 4I7HA 1B9NA 4HX7A 1FBSA 2O0YA 3M1EA 3J80Z 1IN8A 5FFZA 4YFXF 3I64A 4OMYA 1JE8A 4KNYA 3QOPA 1KQ9A 2QVOA 5BMZA 3HRUA 2PI0A 3E3VA 1SFUA 2QYOA 1R5HA 1FOKA 1W7PD 2UZKA 5BS6A 5L3GA 1S7AA 1HSJA 2WWYA 1ZLJA 4CDGA 3GFIA 5CLSA 4XLPF 4I01A 4L0ZB 2BEOA 2H6BA 3VEPA 1ZG3A 1GXQA 2RDPA 3BWGA 1AOYA 2EV6A 1ZG5A 2VBZA 2FBIA 2CGPA 1OPCA 3J7AO 3VODA 4OIRF 4CO8A 1LNWA 3JSPA 4GO1A 5ERIA 3KETA 1DUXC 4HYEA 4EGYA 3H3ZA 3I4PA 5F1RA 3PQKA 4P55A 1YW9A 4UVAA 4XBFA 4MEYF 1FSEA 1GVJA 3DV8A 2ZFWA 3I54A 2MLKA 2QWWA 4L5IA 4NHJA 3HHHA 3K0LA 3P9CA 1F4KA 3L9FA 4OMZA 2DQLA 2NRAC 4Y15A 1DDNA 2VBXA 4GCVA 4ENKA 1P4XA 1TLHB 4KN7X 5HS8A 1ULYA 2XROA 1BM9A 4KYWA 1PP7U 1KQ0A 4GYIA 2MA3A 3J81Z 2DPUA 1XGSA 1R23A 3ULQB 3V4GA 5L3EA 5E1WA 2J5PA 3BPXA 3MFKA 1XGOA 4BHCA 5HOOA 4BH9A 2P6SA 2GQQA 3C1DA 3HTUA 1IN4A 5CVJA 4G8XA 3QP6A 2EWNA 4R1HA 4XRFA 3LA7A 2HTJA 1R1UA 3TO9A 1FBUA 1L3LA 4AWXB 4P9FA 1R1VA 1H9TA 3IRRA 2ZBKA 1IXSB 1R36A 3ZMTA 1P4AA 3Q9VA 4BNCA 4LG0B 4MQVA 3VFZA 5ICEA 1BOAA 2KIUA 1FBQA 1ZRDA 2KJBA 3T8RA 1A04A 4HF1A 2CO5A 2L4AA 3NRVA 1X3UA 3DF8A 2W57A 2A68F 1W5TA 5CVUA 2W84A 3RKYA 1IN7A 4MGRA 2HTSA 2RQPA 5HLHA 3BY6A 4UVCA 3RYRA 4K2EA 3ZMUA 4GYGA 3NEUA 3VOEA 3Q9SA 4L9JA 4MQ9F 5D5XB 3KFWX 2QQAA 4G9YA 3O6BB 4A5MA 3TQNA 3TDZC 2QQ9A 3S2WA 3WGIA 4G7HF 2O61A 4HQMA 3ECOA 4BAYA 1RIOH 2P7CB 2HZTA 4E70A 1FLIA 4OU0A 4G7OF 4L9VA 1I1SA 1W7PA 3B02A 4LMYA 1TQPA 2FXAA 4ZYHA 5D4RA 1LDDA 1YIOA 3V8KA 5J8FA 1IF1A 1AWCA 1D8KA 3GXOA 5D5UB 3GF2A 4ZYEA 4JBAA 3KEQA 5JHUA 2FNPA 3ML6A 1USSA 3SFZA 3SXYA 4UNOA 2CWEA 4EGZA 2GXGA 3F22A 1YS7A 5H6QA 4KIBA 4R79A 2OQRA 2Z5UA 3WU1B 3F72A 1TQIA 1XCBA 2WC2A 3KZZA 5CYVA 2HEOA 2XRNA 2R7DA 3GUDA 1KU2A 5FO5A 3LQRA 1FWZA 3V8LA 2MH9A 1UCRA 2ZNYA 2R3SA 2COMA 1O3QA 2EFNA 1EV7A 2HWVA 4UHTA 1QGPA 3R6SA 2FOKA 2H09A 4KUMA 1RNLA 3WTVC 2DT5A 5LHHA 5HLIA 4G94A 1HW2A 3TO7A 1F1ZA 3FXUA 3LWFA 3R60A 2VN2A 1RI7A 4BHBA 3LQQA 3OOPA 2O3FA 3CUQC 1R7JA 2IPQX 1LB2A 2CYYA 1TTYA 1K78B 3HTSB 5H20A 4N0BA 4RB2C 3LA2A 4HF2A 2IA1A 2CSOA 3WTTC 3RDIA 4UVBA 1ZN2A 5IT3A 4L5JA 3TDUC 3ZN0A 2G7UA 1R5GA 2P7VB 3OV8A 1U2WA 3F23A 2ZJ2A 2FA5A 2XIGA 3E6CC 2XV4S 3KEOA 3WG9A 2GZWA 1D5VA 1R58A 4IJAA 3P9KA 4HOBA 2HDCA 4EJVA 4ESFA 3FWEA 2EFOA 1S6LA 4KA4A 4I0BA 1G4DA 4IRHA 3ZMDA 2OQGA 4MHGA 5AONA 3QP5A 5E20A 5DUIA 6PAXA 4A5NA 2GXBA 4G7ZF 5K5OA 1U3EM 2HS5A 2DO7A 3T1BA 3RJPA 2ZNZA 5JFRA 4O6JA 4N9IA 2LNBA 4ENNA 1S8NA 5J6XA 3QU6A 2PEXA 1WI9A 4OIOF 4EJUA 3COAC 2LF8A 3LSTA 1SD7A 3REOA 4YIIA 4LLNA 2YR2A 1WQ2A 1YO5C 4G6DA 2E1CA 1K79A 3L7WA 1BC8C 1YQAA 3HUGA 3DKWA 1WWXA 3C7JA 3GX4X 3E5UA 4B8XA 3HRTA 3GWZA 1XDSA 3TOAA 2L01A 1FYLA 2K7LA 5KK1A 2H27A 4IRGA 2CW0F 2D2WA 2EA4A 1FZPB 5LLQA 1PUEE 3M8EA 4EM2A 5BOXA 3H3UA 2FU4A 5LHGA 4I2OA 1W4MA 2H94A 3MAJA 4U0VA 1KA8A 2YPRA 1DPUA 4B09A 1XMAA 3BPVA 3U9GA 3MWMA 2RC4A 3RPQA 4NB5A 2FBHA 1E2XA 5ILSA 2FRHA 4HLYA 4BQAA 2GIVA 1ZRFA 2MC3A 1H9GA 2ISZA 1G3YA 1F9NA 2L3DA 4XSXF 2VODA 2A5YB 2PBIA 3MZYA 5E17F 4M72A 4P96A 1BI3A 5D8LB 3F8NA 4ZZLA 2MH2A 3W6JB 3BP8A 3KP5A 4U0YA 1SAXA 3O3KA 3JSOA 3NQOA 4JK1X 3FXRA 3E97A 3TGNA 4PGHA 5L3FA 4LLGF 3EYYA 4H0EA 1J59A 4I02A 1R1TA 2HYGD 4NQWA 3WTXC 4EJWA 4UUVA 4P5OA 2QENA 1J75A 1J5YA 2ADUA 4KFCA 3ZPLA 4FHTA 3WTYC 1QZZA 1KQ8A 4WXDA 4Y13A 1R22A 2OU2A 1I27A 3D5LA 3WE3A 4O3MA 3SHFA 2R7FA 3JTHA 2VXZA 4Q5SF 3ELKA 3JW4A 1ZHFA 1U5TC 1B1BA 2JZYA 2XKOA 3I71A 4MEXF 4M9ZA 3ECHA 2DK8A 3E6BA 1HKSA 5HLGA 2AS5F 2XAJA 3PFIA 2A07F 3HOTA 4HLXA 1TNTA 3DEUA 2EFQA 2VE8A 3EDPA 2OD5A 2UWMA 5FD6A 3W6KB 1V4RA 1MZBA 2PFBA 4PZJA 1HQCA 5ED4A 1W7PB 2QZ8A 2DFIA 5H6RA 2FQ3A 4AIKA 5E18F 3U1DA 4MNUA 1IRGA 4I98B 3B73A 5CVVA 2NNYA 1O3SA 4BXUA 1XCVA 2MD5A 1YW7A 3KE2A 3DQVC 1H0MA 4HX4A 1OYWA 4DNCA 2PMUA 3TKYA 3V7RA 1YLFA 3IRQA 1Z6RA 2STWA 1ZLKA 4HDVA 3KP4A 1OR7A 1ONVA 3BJ6A 2H6CA 1EH6A 5ICCA 2KIMA 4AIHA 1O57A 3QAHA 1SD6A 3K69A 1S7OA 1PDNC 1I5ZA 5LEKA 1ZAOA 3ZQ7A 1CF7B 2XAHA 3VB2A 4GXOA 3M7GA 2M1BA 2DU9A 5HVQC 1P92A 1S3JA 4HQEA 1E17A 3R0JA 2ZXJA 1SD4A 2OAZA 4P9UA 3K2ZA 2HKOA 2VC1A 3SZPA 2IW5A 3HRSA 4HA8A 2M87A 3D0SA 3L00A 1BI2A 2LF7A 1Z91A 4ASNA 3I53A 5DD4A 4I09A 4EQQA 1XGMA 5A2QZ 1VTNC 3O2PE 2D1HA 1IXRC 1P2FA 2TDXA 1YTYA 3G3ZA 4HW0A 1B59A 3ROUA 4QLCU 5LBQA 1DPRA 1IW7F 2ZMEB 3KCCA 3ERED 3H92A 2OBPA 3RYPA 2PJPA 3BOQA 1EH8A 2JSCA 3LAJA 4QWQA 4LD5A 2W85A 1Z6TA 2UXNA 3P7NA 2K02A 3ZMSA 1RUOA 2A6EF 1KU3A 1QZYA 1HW5A 3RIRA 4KT5C 3GLXA 4WCGA 2DLLA 3SQNA 3E6DA 1UHMA 3ABTA 4BHPA 3N4MA 1ZG1A 3IWZA 5DV5A 1J0RA 4FT8A 3QPHA 4LB6B 1SMYF 4EJTA 2OA4A 4UV9A 5E1ZB 4CGZA 2Q2EA 1OYYA 1TW3A 5L3CA 3V7CA 4S04A 1B4AA 3HIFA 2HOEA 2ELHA 3IKTA 5FLXK 5ILVA 2NS0A 1K78A 1FT9A 2DAOA 5DCFA 2K4BA 4WF2A 3T8TA 3CDHA 2XKPA 4LGWA 5BQTA 1SMTA 4IHSA 3JAMK 2HFHA 2XVCA 5LRRA 1LVAA 3DFGA 2FEZA 5LRSA 4ZZDA 4FX4A 2YX7A 1OYIA 1JHFA 2NAZA 2E7WA 2XGXA 2RVCA 3CJNA 3DPTA 4LJZF 5JI6A 3CO6C 4I0AA 3KP2A 2HYFA 2PG4A 4EMSA 5DCMB 3CUQA 1MJAA 3F8FA 4M9SA 3WTSC 2M45A 3MQ0A 3R61A 4A6EA 1KU7A 3IKVA 3BZ6A 3KP7A 4AD9A 1HW1A 2P5LC 4HDUA 2V6CA 1J9IA 2Z33A 2W24A 4RAZA 5JR3A 4LFUA 2PMHA 3CTAA 3QU3A 2RN7A 1I6XA 1IRFA 4RB1A 3I59A 3JTGA 3HSFA 3RPUA 1ZGJA 5FD5A 4KICA 1HKTA 1BI1A 1J7KA 2RKHA 4U7DA 1WSUA 4M74A 1KYZA 2OZ6A 4U88A 2V9VA 2XHKA 2A69F 5DDGA 2LKPA 4IHTA 5E8GA 1G6NA 2KIFA 1ON2A 1GHCA 4EVIA 3E5QA 4ESBA 4A6DA 3J80K 2FF4A 3U2RA 1FP2A 1LQ1A 3FM5A 2JPBA 2BBYA 3WODF 4N9HA 1XDUA 4L0YB 3M8FA 1U6GA 1QQIA 4M9XA 2GWRA 3FMSA 4R8HA 2VBYA 5CVIA 1JXSA 3BROA 1O7LA 2BV6A 3GW2A 2Y75A 1LDKB 3HHGA 1XN7A 3I5UA 5E1XA 4HAMA 1KU9A 2B0LA 5LHIA 4WK8F 1DP7P 3EUHA 5DEQA 4ESJA 2PN6A 2F5FA 2M8EA 1ODDA 2IA0A 1C0WA 2BYVE 3BDDA 1UB9A 2EB7A 4HZFA 1XGNA 3C3WA 2IA2A 3LA3A 3LFKA 2CG4A 3FX3A 4ENJA 3R0AA 2VE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5R A;  2A6H F;  2V79 A;  4IRI A;  1Z9C A;  2K86 A;  1LEA A;  2X4H A;  3CUO A;  3PQJ A;  4HBL A;  4LG0 A;  2DW4 A;  5D5V B;  2ESH A;  2G9W A;  2XAG A;  4YFN F;  3GFJ A;  1BBY A;  1Z1D A;  2QUF A;  5LGU A;  5F64 A;  3DPL C;  4XSZ F;  2F2E A;  1JGS A;  3ZMV A;  5DCM A;  1MDM B;  5D5W B;  4KDP A;  4UV8 A;  4WX9 A;  3LAP A;  2YSR A;  2FSW A;  4OIQ F;  1U5T A;  5TRD A;  1ZH5 A;  5L3D A;  1HBX G;  4DQ2 A;  3HSR A;  2J5O A;  1LJ9 A;  2OZU A;  2QM3 A;  1K6O A;  5D6E A;  1P6R A;  2WV0 A;  3TO6 A;  1GXP A;  2P6T A;  1FYK A;  1G3T A;  4KN4 X;  5LEJ A;  2UXX A;  3V7S A;  1T39 A;  2PLY A;  2VC0 A;  4Z2Y A;  2FE3 A;  1V3F A;  1YG2 A;  2E1N A;  2Q0O A;  2ZO4 A;  3BJA A;  4AVP A;  2D45 A;  3AAF A;  2E7X A;  2VBW A;  2JPC A;  2P5K A;  4U0W A;  3KZY A;  2NYX A;  5BPI A;  1B6A A;  2HQR A;  1W5S A;  2Y48 A;  3F3X A;  2HKX A;  3ZN1 A;  5FLX Z;  3FMR A;  1OMI A;  3MCZ A;  4EV0 A;  1IXC A;  1BI0 A;  1BC7 C;  1HKQ A;  2K4J A;  3CUQ B;  1BIA A;  1WRJ A;  5AIP A;  3WU0 A;  3FM3 A;  2ETH A;  1UHW A;  1D3Y A;  2EFW A;  1QO0 D;  1XSX A;  1Y0U A;  1WKM A;  1MGT A;  4O5V A;  2PQ8 A;  2RV8 A;  2BGC A;  3EQL F;  2VON A;  2IVM A;  1Q1H A;  4LLL A;  3IWF A;  1TW2 A;  4MTE A;  5IT9 K;  1SFE A;  1JHH A;  4OIN F;  1SD5 A;  2Z99 A;  3L09 A;  2NNN A;  2EV0 A;  1KGS A;  2JTV A;  3JAM Z;  2P8T A;  3WTU C;  2V1X A;  3K1N A;  4EM1 A;  1REP C;  2JT1 A;  4FX0 A;  5DUK A;  3RI4 A;  1U8R A;  1ON1 A;  2Z3Y A;  3FF5 A;  3E6M A;  5A2Q K;  4CXF A;  3L2C A;  3RTR A;  5FB2 A;  3CLO A;  4BYY A;  3QPT A;  4D0P A;  3I0T A;  2YX4 A;  2EK5 A;  1ZGA A;  1MKM A;  3WTZ A;  2FMY A;  1KYW A;  2C6Y A;  3GYH X;  2L02 A;  4LK0 F;  5HDN A;  4IVN A;  1BJA A;  3FHZ A;  3C18 A;  1MDM A;  3K1P A;  4F7Z A;  3WE2 A;  2V1U A;  2ZKZ A;  1O3R A;  3EET A;  2F5C A;  2HQN A;  5JVT A;  1IAW A;  1T2K A;  5D8K B;  2DI3 A;  3F6V A;  4S05 A;  3HOS A;  3KLN A;  2DBB A;  2W25 A;  1MD0 A;  5E8I A;  2KKO A;  4A2U A;  4LK1 F;  2D1V A;  3F8B A;  5ICF A;  2RGV A;  3HSE A;  2M5W A;  1O7F A;  2FBK A;  4HV5 A;  5BPD A;  4KIF A;  5CVR A;  4M6X A;  3F6O A;  4RS8 A;  1LEB A;  3DXJ F;  5J8C A;  4IPA A;  3GVA A;  4RB0 A;  4YG2 F;  2EFP A;  1ZYR F;  4EM0 B;  1T38 A;  2DK5 A;  1B9M A;  2M30 A;  1QPM A;  2LSO A;  4ENM A;  4L18 B;  1BIB A;  1RZ4 A;  3GZ5 A;  1BN5 A;  2F5D A;  5TJJ A;  2WTE A;  1O3T A;  5L3B A;  2P5V A;  1IZ1 A;  2G7H A;  2Z9O A;  1FSH A;  4KMF A;  1T98 A;  3SZT A;  1SFX A;  4HX8 A;  2MBF A;  1CF7 A;  1P4W A;  5DD8 A;  4OIP F;  5DYM A;  1T0F A;  2CFX A;  2V1D A;  5F6F A;  2BE5 F;  3IHU A;  3K9T A;  3R4K A;  3KLO A;  3IC7 A;  1FNN A;  1L0O C;  1RUN A;  2ZCW A;  1FY7 A;  1YYV A;  3DP7 A;  1J2X A;  4Q48 A;  5K5Q A;  3K1M A;  3I59 B;  2ZME A;  4ZH4 F;  5CJ9 A;  2L4M A;  4M6Y A;  1FPQ A;  5EEH A;  4MTD A;  1FC3 A;  4WXH A;  3FZV A;  1U5T B;  3ZP5 A;  5ILU A;  4A0X A;  5D4S A;  4L9N A;  2QLZ A;  3V8J A;  2VOP A;  2ESN A;  1XMK A;  4IXA A;  5K1Y A;  1YFH A;  1LDJ A;  3E5X A;  5HS9 A;  5HS7 A;  4Q47 A;  1STZ A;  1G3W A;  1TBX A;  4LB5 A;  5AIQ A;  2IRF G;  1R00 A;  2K27 A;  1S29 A;  4WWC A;  2IT0 A;  2ACJ A;  3HRM A;  1UFM A;  5KVR A;  3TOB A;  4WXC A;  2A61 A;  2QQB A;  4RB3 C;  1F5T A;  3KP6 A;  2JRT A;  2MLG A;  1MJ9 A;  4KIG A;  4CHU A;  2EV5 A;  1NHA A;  4OOI A;  3IL2 A;  1FP1 D;  4RGR A;  1Z05 A;  3Q5F A;  3GZ6 A;  2HGC A;  3WTW C;  3HYI A;  5FGM A;  2VOO A;  5ICG A;  2LDU A;  5FFX A;  2YU3 A;  1UST A;  3I58 A;  4HV6 A;  1D8J A;  4JQF A;  1U78 A;  1QBJ A;  4CZZ A;  2DPD A;  1IN5 A;  4KMU X;  4Q4Z F;  1TNS A;  4ETS A;  3GO5 A;  1MJB A;  1ZRC A;  4L9T A;  2HR3 A;  5LGN A;  2KJC A;  2QBY A;  2O03 A;  1I1G A;  3T5X A;  2A3S A;  4ZYD A;  4HF0 A;  4AIJ A;  1XSD A;  2FML A;  4ZYG A;  1G3S A;  3GEZ A;  1XSV A;  1XD7 A;  2F5E A;  3MEX A;  2O6G E;  2GA1 A;  5LGT A;  4A0Z A;  5IT9 Z;  1YW8 A;  4CYD A;  2RNJ A;  3P9I A;  4Y17 A;  3ISP A;  2X0L A;  2XAS A;  1ZRE A;  3RKX A;  4U7B A;  4TV7 A;  4EJO A;  3MZH A;  1K7A A;  2ISY A;  1YS6 A;  3WGH A;  2DTR A;  4A12 A;  3F21 A;  4GGG A;  2IJL A;  3EYI A;  2EA2 A;  3GFM A;  3FXQ A;  2L54 A;  4XLN F;  2XUB A;  4RGU A;  2P4W A;  3BJO A;  3GFL A;  1HXD A;  5D6F A;  3N97 A;  4RGX A;  2IP2 A;  4A0Y A;  2FNA A;  2KRF A;  1T6S A;  1Z7U A;  5HDK A;  3T0Y A;  3WGG A;  1IN6 A;  2STT A;  2Y0M A;  4PGG A;  4YIF A;  2VT3 A;  3ZMZ A;  2GAU A;  4YFK F;  4M73 A;  2VT2 A;  3FMQ A;  4RAY A;  1QNT A;  3CO7 C;  2XAQ A;  2Q8K A;  3J81 K;  1OKR A;  1TQM A;  3F8M A;  1HST A;  1XB4 A;  3M9A A;  4RGS A;  2GA2 A;  3QRF F;  4IF4 A;  1CGP A;  1IUY A;  1PP8 F;  1ZAR A;  4CIC A;  3G73 A;  4M71 A;  4ON0 A;  5EEG A;  5HDG A;  4PCQ A;  4PDK A;  2O8X A;  4G6Q A;  3F8C A;  3ABU A;  2EJR A;  2CQK A;  1FYM A;  1FX7 A;  3KP3 A;  2AXL A;  2QBY B;  4UXN A;  2XAF A;  1EH7 A;  2DQR A;  3RKW A;  4I7H A;  1B9N A;  4HX7 A;  1FBS A;  2O0Y A;  3M1E A;  3J80 Z;  1IN8 A;  5FFZ A;  4YFX F;  3I64 A;  4OMY A;  1JE8 A;  4KNY A;  3QOP A;  1KQ9 A;  2QVO A;  5BMZ A;  3HRU A;  2PI0 A;  3E3V A;  1SFU A;  2QYO A;  1R5H A;  1FOK A;  1W7P D;  2UZK A;  5BS6 A;  5L3G A;  1S7A A;  1HSJ A;  2WWY A;  1ZLJ A;  4CDG A;  3GFI A;  5CLS A;  4XLP F;  4I01 A;  4L0Z B;  2BEO A;  2H6B A;  3VEP A;  1ZG3 A;  1GXQ A;  2RDP A;  3BWG A;  1AOY A;  2EV6 A;  1ZG5 A;  2VBZ A;  2FBI A;  2CGP A;  1OPC A;  3J7A O;  3VOD A;  4OIR F;  4CO8 A;  1LNW A;  3JSP A;  4GO1 A;  5ERI A;  3KET A;  1DUX C;  4HYE A;  4EGY A;  3H3Z A;  3I4P A;  5F1R A;  3PQK A;  4P55 A;  1YW9 A;  4UVA A;  4XBF A;  4MEY F;  1FSE A;  1GVJ A;  3DV8 A;  2ZFW A;  3I54 A;  2MLK A;  2QWW A;  4L5I A;  4NHJ A;  3HHH A;  3K0L A;  3P9C A;  1F4K A;  3L9F A;  4OMZ A;  2DQL A;  2NRA C;  4Y15 A;  1DDN A;  2VBX A;  4GCV A;  4ENK A;  1P4X A;  1TLH B;  4KN7 X;  5HS8 A;  1ULY A;  2XRO A;  1BM9 A;  4KYW A;  1PP7 U;  1KQ0 A;  4GYI A;  2MA3 A;  3J81 Z;  2DPU A;  1XGS A;  1R23 A;  3ULQ B;  3V4G A;  5L3E A;  5E1W A;  2J5P A;  3BPX A;  3MFK A;  1XGO A;  4BHC A;  5HOO A;  4BH9 A;  2P6S A;  2GQQ A;  3C1D A;  3HTU A;  1IN4 A;  5CVJ A;  4G8X A;  3QP6 A;  2EWN A;  4R1H A;  4XRF A;  3LA7 A;  2HTJ A;  1R1U A;  3TO9 A;  1FBU A;  1L3L A;  4AWX B;  4P9F A;  1R1V A;  1H9T A;  3IRR A;  2ZBK A;  1IXS B;  1R36 A;  3ZMT A;  1P4A A;  3Q9V A;  4BNC A;  4LG0 B;  4MQV A;  3VFZ A;  5ICE A;  1BOA A;  2KIU A;  1FBQ A;  1ZRD A;  2KJB A;  3T8R A;  1A04 A;  4HF1 A;  2CO5 A;  2L4A A;  3NRV A;  1X3U A;  3DF8 A;  2W57 A;  2A68 F;  1W5T A;  5CVU A;  2W84 A;  3RKY A;  1IN7 A;  4MGR A;  2HTS A;  2RQP A;  5HLH A;  3BY6 A;  4UVC A;  3RYR A;  4K2E A;  3ZMU A;  4GYG A;  3NEU A;  3VOE A;  3Q9S A;  4L9J A;  4MQ9 F;  5D5X B;  3KFW X;  2QQA A;  4G9Y A;  3O6B B;  4A5M A;  3TQN A;  3TDZ C;  2QQ9 A;  3S2W A;  3WGI A;  4G7H F;  2O61 A;  4HQM A;  3ECO A;  4BAY A;  1RIO H;  2P7C B;  2HZT A;  4E70 A;  1FLI A;  4OU0 A;  4G7O F;  4L9V A;  1I1S A;  1W7P A;  3B02 A;  4LMY A;  1TQP A;  2FXA A;  4ZYH A;  5D4R A;  1LDD A;  1YIO A;  3V8K A;  5J8F A;  1IF1 A;  1AWC A;  1D8K A;  3GXO A;  5D5U B;  3GF2 A;  4ZYE A;  4JBA A;  3KEQ A;  5JHU A;  2FNP A;  3ML6 A;  1USS A;  3SFZ A;  3SXY A;  4UNO A;  2CWE A;  4EGZ A;  2GXG A;  3F22 A;  1YS7 A;  5H6Q A;  4KIB A;  4R79 A;  2OQR A;  2Z5U A;  3WU1 B;  3F72 A;  1TQI A;  1XCB A;  2WC2 A;  3KZZ A;  5CYV A;  2HEO A;  2XRN A;  2R7D A;  3GUD A;  1KU2 A;  5FO5 A;  3LQR A;  1FWZ A;  3V8L A;  2MH9 A;  1UCR A;  2ZNY A;  2R3S A;  2COM A;  1O3Q A;  2EFN A;  1EV7 A;  2HWV A;  4UHT A;  1QGP A;  3R6S A;  2FOK A;  2H09 A;  4KUM A;  1RNL A;  3WTV C;  2DT5 A;  5LHH A;  5HLI A;  4G94 A;  1HW2 A;  3TO7 A;  1F1Z A;  3FXU A;  3LWF A;  3R60 A;  2VN2 A;  1RI7 A;  4BHB A;  3LQQ A;  3OOP A;  2O3F A;  3CUQ C;  1R7J A;  2IPQ X;  1LB2 A;  2CYY A;  1TTY A;  1K78 B;  3HTS B;  5H20 A;  4N0B A;  4RB2 C;  3LA2 A;  4HF2 A;  2IA1 A;  2CSO A;  3WTT C;  3RDI A;  4UVB A;  1ZN2 A;  5IT3 A;  4L5J A;  3TDU C;  3ZN0 A;  2G7U A;  1R5G A;  2P7V B;  3OV8 A;  1U2W A;  3F23 A;  2ZJ2 A;  2FA5 A;  2XIG A;  3E6C C;  2XV4 S;  3KEO A;  3WG9 A;  2GZW A;  1D5V A;  1R58 A;  4IJA A;  3P9K A;  4HOB A;  2HDC A;  4EJV A;  4ESF A;  3FWE A;  2EFO A;  1S6L A;  4KA4 A;  4I0B A;  1G4D A;  4IRH A;  3ZMD A;  2OQG A;  4MHG A;  5AON A;  3QP5 A;  5E20 A;  5DUI A;  6PAX A;  4A5N A;  2GXB A;  4G7Z F;  5K5O A;  1U3E M;  2HS5 A;  2DO7 A;  3T1B A;  3RJP A;  2ZNZ A;  5JFR A;  4O6J A;  4N9I A;  2LNB A;  4ENN A;  1S8N A;  5J6X A;  3QU6 A;  2PEX A;  1WI9 A;  4OIO F;  4EJU A;  3COA C;  2LF8 A;  3LST A;  1SD7 A;  3REO A;  4YII A;  4LLN A;  2YR2 A;  1WQ2 A;  1YO5 C;  4G6D A;  2E1C A;  1K79 A;  3L7W A;  1BC8 C;  1YQA A;  3HUG A;  3DKW A;  1WWX A;  3C7J A;  3GX4 X;  3E5U A;  4B8X A;  3HRT A;  3GWZ A;  1XDS A;  3TOA A;  2L01 A;  1FYL A;  2K7L A;  5KK1 A;  2H27 A;  4IRG A;  2CW0 F;  2D2W A;  2EA4 A;  1FZP B;  5LLQ A;  1PUE E;  3M8E A;  4EM2 A;  5BOX A;  3H3U A;  2FU4 A;  5LHG A;  4I2O A;  1W4M A;  2H94 A;  3MAJ A;  4U0V A;  1KA8 A;  2YPR A;  1DPU A;  4B09 A;  1XMA A;  3BPV A;  3U9G A;  3MWM A;  2RC4 A;  3RPQ A;  4NB5 A;  2FBH A;  1E2X A;  5ILS A;  2FRH A;  4HLY A;  4BQA A;  2GIV A;  1ZRF A;  2MC3 A;  1H9G A;  2ISZ A;  1G3Y A;  1F9N A;  2L3D A;  4XSX F;  2VOD A;  2A5Y B;  2PBI A;  3MZY A;  5E17 F;  4M72 A;  4P96 A;  1BI3 A;  5D8L B;  3F8N A;  4ZZL A;  2MH2 A;  3W6J B;  3BP8 A;  3KP5 A;  4U0Y A;  1SAX A;  3O3K A;  3JSO A;  3NQO A;  4JK1 X;  3FXR A;  3E97 A;  3TGN A;  4PGH A;  5L3F A;  4LLG F;  3EYY A;  4H0E A;  1J59 A;  4I02 A;  1R1T A;  2HYG D;  4NQW A;  3WTX C;  4EJW A;  4UUV A;  4P5O A;  2QEN A;  1J75 A;  1J5Y A;  2ADU A;  4KFC A;  3ZPL A;  4FHT A;  3WTY C;  1QZZ A;  1KQ8 A;  4WXD A;  4Y13 A;  1R22 A;  2OU2 A;  1I27 A;  3D5L A;  3WE3 A;  4O3M A;  3SHF A;  2R7F A;  3JTH A;  2VXZ A;  4Q5S F;  3ELK A;  3JW4 A;  1ZHF A;  1U5T C;  1B1B A;  2JZY A;  2XKO A;  3I71 A;  4MEX F;  4M9Z A;  3ECH A;  2DK8 A;  3E6B A;  1HKS A;  5HLG A;  2AS5 F;  2XAJ A;  3PFI A;  2A07 F;  3HOT A;  4HLX A;  1TNT A;  3DEU A;  2EFQ A;  2VE8 A;  3EDP A;  2OD5 A;  2UWM A;  5FD6 A;  3W6K B;  1V4R A;  1MZB A;  2PFB A;  4PZJ A;  1HQC A;  5ED4 A;  1W7P B;  2QZ8 A;  2DFI A;  5H6R A;  2FQ3 A;  4AIK A;  5E18 F;  3U1D A;  4MNU A;  1IRG A;  4I98 B;  3B73 A;  5CVV A;  2NNY A;  1O3S A;  4BXU A;  1XCV A;  2MD5 A;  1YW7 A;  3KE2 A;  3DQV C;  1H0M A;  4HX4 A;  1OYW A;  4DNC A;  2PMU A;  3TKY A;  3V7R A;  1YLF A;  3IRQ A;  1Z6R A;  2STW A;  1ZLK A;  4HDV A;  3KP4 A;  1OR7 A;  1ONV A;  3BJ6 A;  2H6C A;  1EH6 A;  5ICC A;  2KIM A;  4AIH A;  1O57 A;  3QAH A;  1SD6 A;  3K69 A;  1S7O A;  1PDN C;  1I5Z A;  5LEK A;  1ZAO A;  3ZQ7 A;  1CF7 B;  2XAH A;  3VB2 A;  4GXO A;  3M7G A;  2M1B A;  2DU9 A;  5HVQ C;  1P92 A;  1S3J A;  4HQE A;  1E17 A;  3R0J A;  2ZXJ A;  1SD4 A;  2OAZ A;  4P9U A;  3K2Z A;  2HKO A;  2VC1 A;  3SZP A;  2IW5 A;  3HRS A;  4HA8 A;  2M87 A;  3D0S A;  3L00 A;  1BI2 A;  2LF7 A;  1Z91 A;  4ASN A;  3I53 A;  5DD4 A;  4I09 A;  4EQQ A;  1XGM A;  5A2Q Z;  1VTN C;  3O2P E;  2D1H A;  1IXR C;  1P2F A;  2TDX A;  1YTY A;  3G3Z A;  4HW0 A;  1B59 A;  3ROU A;  4QLC U;  5LBQ A;  1DPR A;  1IW7 F;  2ZME B;  3KCC A;  3ERE D;  3H92 A;  2OBP A;  3RYP A;  2PJP A;  3BOQ A;  1EH8 A;  2JSC A;  3LAJ A;  4QWQ A;  4LD5 A;  2W85 A;  1Z6T A;  2UXN A;  3P7N A;  2K02 A;  3ZMS A;  1RUO A;  2A6E F;  1KU3 A;  1QZY A;  1HW5 A;  3RIR A;  4KT5 C;  3GLX A;  4WCG A;  2DLL A;  3SQN A;  3E6D A;  1UHM A;  3ABT A;  4BHP A;  3N4M A;  1ZG1 A;  3IWZ A;  5DV5 A;  1J0R A;  4FT8 A;  3QPH A;  4LB6 B;  1SMY F;  4EJT A;  2OA4 A;  4UV9 A;  5E1Z B;  4CGZ A;  2Q2E A;  1OYY A;  1TW3 A;  5L3C A;  3V7C A;  4S04 A;  1B4A A;  3HIF A;  2HOE A;  2ELH A;  3IKT A;  5FLX K;  5ILV A;  2NS0 A;  1K78 A;  1FT9 A;  2DAO A;  5DCF A;  2K4B A;  4WF2 A;  3T8T A;  3CDH A;  2XKP A;  4LGW A;  5BQT A;  1SMT A;  4IHS A;  3JAM K;  2HFH A;  2XVC A;  5LRR A;  1LVA A;  3DFG A;  2FEZ A;  5LRS A;  4ZZD A;  4FX4 A;  2YX7 A;  1OYI A;  1JHF A;  2NAZ A;  2E7W A;  2XGX A;  2RVC A;  3CJN A;  3DPT A;  4LJZ F;  5JI6 A;  3CO6 C;  4I0A A;  3KP2 A;  2HYF A;  2PG4 A;  4EMS A;  5DCM B;  3CUQ A;  1MJA A;  3F8F A;  4M9S A;  3WTS C;  2M45 A;  3MQ0 A;  3R61 A;  4A6E A;  1KU7 A;  3IKV A;  3BZ6 A;  3KP7 A;  4AD9 A;  1HW1 A;  2P5L C;  4HDU A;  2V6C A;  1J9I A;  2Z33 A;  2W24 A;  4RAZ A;  5JR3 A;  4LFU A;  2PMH A;  3CTA A;  3QU3 A;  2RN7 A;  1I6X A;  1IRF A;  4RB1 A;  3I59 A;  3JTG A;  3HSF A;  3RPU A;  1ZGJ A;  5FD5 A;  4KIC A;  1HKT A;  1BI1 A;  1J7K A;  2RKH A;  4U7D A;  1WSU A;  4M74 A;  1KYZ A;  2OZ6 A;  4U88 A;  2V9V A;  2XHK A;  2A69 F;  5DDG A;  2LKP A;  4IHT A;  5E8G A;  1G6N A;  2KIF A;  1ON2 A;  1GHC A;  4EVI A;  3E5Q A;  4ESB A;  4A6D A;  3J80 K;  2FF4 A;  3U2R A;  1FP2 A;  1LQ1 A;  3FM5 A;  2JPB A;  2BBY A;  3WOD F;  4N9H A;  1XDU A;  4L0Y B;  3M8F A;  1U6G A;  1QQI A;  4M9X A;  2GWR A;  3FMS A;  4R8H A;  2VBY A;  5CVI A;  1JXS A;  3BRO A;  1O7L A;  2BV6 A;  3GW2 A;  2Y75 A;  1LDK B;  3HHG A;  1XN7 A;  3I5U A;  5E1X A;  4HAM A;  1KU9 A;  2B0L A;  5LHI A;  4WK8 F;  1DP7 P;  3EUH A;  5DEQ A;  4ESJ A;  2PN6 A;  2F5F A;  2M8E A;  1ODD A;  2IA0 A;  1C0W A;  2BYV E;  3BDD A;  1UB9 A;  2EB7 A;  4HZF A;  1XGN A;  3C3W A;  2IA2 A;  3LA3 A;  3LFK A;  2CG4 A;  3FX3 A;  4ENJ A;  3R0A A;  2VE9 A; 
#chains in the Genus database with same CATH topology
 5K5R A;  2LP0 A;  3H0D A;  2X9D A;  2A6H F;  1Y0N A;  2V79 A;  2R92 J;  3FIS A;  1JTX A;  2G0E A;  2JQ7 A;  2X51 A;  4IRI A;  3ABK H;  1WFX A;  1Z9C A;  2K86 A;  1LEA A;  2X4H A;  3CUO A;  3PQJ A;  4HBL A;  4LG0 A;  5J1Y A;  1FMV A;  2LH9 A;  3B6A A;  2DW4 A;  5D5V B;  2ESH A;  2G9W A;  2XAG A;  2HVS A;  3HKZ N;  5EF6 A;  4YFN F;  5KNL A;  3GFJ A;  1VQ8 I;  1BBY A;  1Z1D A;  2QUF A;  3VSL A;  3BC8 A;  5LGU A;  5F64 A;  3DPL C;  4XSZ F;  2F2E A;  1JGS A;  3ZMV A;  1ETO A;  4PJM A;  5DCM A;  2R93 J;  1MDM B;  2DMQ A;  5D5W B;  3LMM A;  2GLO A;  1EKE A;  1YX5 A;  4KDP A;  4UV8 A;  3LFU A;  2XF5 A;  4WX9 A;  3LAP A;  2YSR A;  3FXK A;  2FSW A;  4OIQ F;  1U5T A;  1SEU A;  2A05 A;  4D1Q A;  4RA2 A;  5TRD A;  1MBJ A;  3FXL A;  1ZH5 A;  5L3D A;  2IBD A;  1HBX G;  4DQ2 A;  1VQN I;  4PK4 A;  4BGD A;  3HSR A;  4JP0 A;  2J5O A;  1LJ9 A;  5KCM A;  3MMY B;  3Q3S A;  2OZU A;  2QM3 A;  2XDV A;  1A5J A;  3CMY A;  1K6O A;  2L7Z A;  3OYI A;  1YJ9 I;  3K4C A;  4X6A J;  5D6E A;  1P6R A;  2WV0 A;  3TO6 A;  3NAR A;  1GXP A;  4XKC A;  2P6T A;  1FYK A;  1G3T A;  4KN4 X;  2W82 A;  3RPU D;  2UXX A;  3V7S A;  5LEJ A;  1T39 A;  3A01 A;  3PUB A;  2PLY A;  3G1M A;  2VC0 A;  2HPI A;  4Z2Y A;  2FE3 A;  1V3F A;  1YG2 A;  1ZGW A;  2OC6 A;  4KJZ A;  3C2G A;  4XOR A;  2E1N A;  2Q0O A;  2ZO4 A;  3BJA A;  4AYB N;  2BHZ A;  4AVP A;  1A36 A;  1R9T J;  2D45 A;  3AAF A;  2E7X A;  3W3C A;  2VBW A;  3M3Y J;  1KON A;  2JPC A;  3JRE A;  1VFC A;  5FRM A;  1HCR A;  2BXZ A;  1D1B A;  3D5R C;  2QF7 A;  2P5K A;  3KZI C;  4U0W A;  3KZY A;  2NYX A;  5BPI A;  1B6A A;  2HQR A;  4M3D A;  1G8X A;  1W5S A;  5J40 A;  2Y0S N;  2Y48 A;  4CCK A;  2CV1 A;  1IG7 A;  3F3X A;  1KZH A;  3ZQQ A;  2DCE A;  2JA6 J;  2R7V A;  2HKX A;  3ZN1 A;  5FLX Z;  4E7S A;  3J7Z I;  3FMR A;  1OMI A;  3MCZ A;  4EV0 A;  1IXC A;  1BI0 A;  1BC7 C;  4NC7 A;  2WB1 N;  3WHB A;  4RLF A;  3K6G A;  4A3K J;  2E2I J;  2HXI A;  4A3F J;  3D1N I;  3ZRG A;  1HKQ A;  2K4J A;  3CMA I;  3CUQ B;  1BIA A;  5FKM A;  1WRJ A;  5AIP A;  3WU0 A;  2HVR A;  3FM3 A;  2IS4 A;  3OS0 A;  1X19 A;  1VQ9 I;  3BTI A;  2ETH A;  4UB6 C;  5EG0 A;  3OIQ A;  1UHW A;  1D3Y A;  1JKR C;  2EFW A;  1QO0 D;  3HOX J;  5M3F J;  3QOD A;  2DT6 A;  1XSX A;  3CC7 I;  1Y0U A;  3DU5 A;  2LY2 A;  1WKM A;  3S1N J;  1MGT A;  4O5V A;  1BR4 A;  2PQ8 A;  2KMU A;  2RV8 A;  2ECC A;  3AKZ A;  2BGC A;  3EQL F;  5HNH A;  3I3L A;  2VON A;  2IVM A;  1DGW Y;  1Q1H A;  4LLL A;  1BR1 A;  3IWF A;  5FRO A;  1TW2 A;  1RC9 A;  4MTE A;  5IT9 K;  3FHN A;  3FK7 A;  1SFE A;  1JHH A;  2Y31 A;  4OIN F;  3OS2 A;  1SD5 A;  2Z99 A;  1JUS A;  1NK2 P;  3L09 A;  2NNN A;  2EV0 A;  3NWS A;  1KGS A;  2V4J C;  4B3X A;  3CCU I;  3S1Q J;  2JTV A;  2CV0 A;  3JAM Z;  3MKY B;  2P8T A;  3WTU C;  5IP6 A;  2V1X A;  4C9Y A;  3K1N A;  4EM1 A;  1REP C;  1MND A;  2JT1 A;  4FX0 A;  3A1Y A;  5DUK A;  1X2M A;  1JJ8 C;  5FKL A;  2XC7 A;  3RI4 A;  1D0Y A;  1U8R A;  2WAF A;  1ON1 A;  1YRN B;  4IHX A;  2Z3Y A;  3FF5 A;  1WI3 A;  3E6M A;  5A2Q K;  4CXF A;  3L2C A;  4BY7 J;  3RTR A;  4A3E J;  5FB2 A;  3CLO A;  1X4O A;  2EQR A;  4B44 A;  4BYY A;  3QPT A;  2OTJ I;  4D0P A;  3I0T A;  2W48 A;  2YX4 A;  4RM3 A;  2EK5 A;  1F36 A;  3FXO A;  2COB A;  1ZGA A;  1QA6 A;  4BXX J;  1RRJ A;  3A0B C;  1MKM A;  2OV7 A;  3WTZ A;  2FMY A;  2ZB9 A;  1KYW A;  2C6Y A;  2NOG A;  1X4P A;  2XGD A;  2R5Y B;  1T95 A;  4CYC B;  3GYH X;  1YX3 A;  2M7B A;  3OSG A;  1MMG A;  2L02 A;  4LK0 F;  5LFA A;  5HDN A;  4E7H A;  3LNQ A;  4IVN A;  1BJA A;  2BVL A;  3FHZ A;  3OYJ A;  3C18 A;  2KDO A;  1APL C;  2DA1 A;  4UB8 C;  1MNE A;  1S9H A;  4XL9 A;  1MDM A;  3K1P A;  4P1W A;  4F7Z A;  2CUE A;  3WE2 A;  3FXM A;  2ZJR F;  4A3C J;  1GLN A;  2V1U A;  2CW8 A;  3V42 A;  1LVK A;  1WJF A;  1VZ0 A;  3PO2 J;  3OS1 A;  1FIA A;  2ZKZ A;  1YOV B;  1O3R A;  2NVU B;  2XF7 A;  2VI6 A;  3EET A;  4HSR A;  2F5C A;  2HQN A;  2OTL I;  3DBH B;  5JVT A;  2E34 A;  1IAW A;  3BCB A;  1T2K A;  4XOP A;  2DI3 A;  2K3F A;  5D8K B;  3F6V A;  2K3P A;  4S05 A;  1GV5 A;  2VKH A;  3HOS A;  3KLN A;  2JN6 A;  3RQ4 A;  1M1E B;  1MSE C;  2DBB A;  2W25 A;  1MD0 A;  4M3B A;  5E8I A;  2KKO A;  1IO2 A;  3EUH C;  4A2U A;  3WG7 H;  2R7R A;  4LK1 F;  2D1V A;  5IOY A;  4MLO A;  4XRS A;  2OUM A;  3F8B A;  2VQG A;  5ICF A;  2RGV A;  3GME A;  3HSE A;  1T8I A;  3LOC A;  4UY8 I;  1SAN A;  2DMP A;  3BG3 A;  4LOC A;  2XB5 A;  2M5W A;  1VF9 A;  1WJD A;  1O7F A;  3ABM H;  2FBK A;  4HV5 A;  5BPD A;  1QHG A;  2A6T A;  3AG4 H;  4KIF A;  5CVR A;  4M6X A;  4Y4R A;  2LRD A;  3H3V K;  4YEJ A;  1ZR4 A;  3C2H A;  3F6O A;  1W0T A;  2H8W A;  2V9P A;  4RS8 A;  2B9S A;  4AID A;  1LEB A;  3JRD A;  3DXJ F;  4C2U A;  5J8C A;  2L9N A;  3CDL A;  4IPA A;  1LPQ A;  2DOD A;  1FOY A;  1VI0 A;  3GVA A;  4CCO A;  4RB0 A;  4S0H B;  3WU2 C;  1D1A A;  4D9J A;  1VQ7 I;  3WHC A;  4YG2 F;  3BR0 A;  2WY8 Q;  2CJJ A;  2DA6 A;  2EFP A;  4DIQ A;  1ZYR F;  3LL7 A;  3VYU B;  4EM0 B;  1T38 A;  3KPH A;  1QHH D;  2DK5 A;  3DKX A;  1B9M A;  2HZD A;  5GTI C;  2M30 A;  4GFB A;  4FAS D;  1QPM A;  2EZH A;  1E3P A;  1P7J A;  2LSO A;  2FD5 A;  4ENM A;  4L18 B;  4C2T A;  2JA8 J;  1BIB A;  1ORK A;  5CKT A;  1RZ4 A;  3GZ5 A;  1BN5 A;  3OYK A;  2JSP A;  2F5D A;  3KX2 A;  1Y1W J;  4RLQ A;  5TJJ A;  2WTE A;  1I3A A;  1O3T A;  5L3B A;  4PUS A;  2P5V A;  1IZ1 A;  2W4S A;  2G7H A;  5B3S H;  2Z9O A;  1FSH A;  5CPR B;  4KMF A;  1T98 A;  3SZT A;  1SFX A;  4HX8 A;  2MBF A;  2DDB A;  1CF7 A;  1ETY A;  3DEW A;  1P4W A;  1I50 J;  5HNF A;  4PSW A;  5DD8 A;  4OIP F;  3QYF A;  5DYM A;  2AQF A;  1T0F A;  1TWC J;  1Y1V J;  2CFX A;  2V1D A;  5F6F A;  1OCT C;  2BE5 F;  3ASN H;  3IHU A;  3K9T A;  3R4K A;  3H5A A;  4A3D J;  3KLO A;  3IC7 A;  3DKY A;  1FNN A;  1L0O C;  2LTP A;  4HEA 2;  1RUN A;  2ZCW A;  1FY7 A;  1YYV A;  3DP7 A;  2CH0 A;  2ID6 A;  3S1M J;  1J2X A;  4Q48 A;  1OCC H;  5K5Q A;  3K1M A;  3I59 B;  2ZME A;  4ZH4 F;  2CU7 A;  5CJ9 A;  1UJ8 A;  2L4M A;  3LSP A;  4E7J A;  4M6Y A;  1FPQ A;  5EEH A;  1MBF A;  4MTD A;  1FC3 A;  4WXH A;  3FZV A;  3BZK A;  3FIW A;  1U5T B;  2QGU A;  4HG2 A;  4AM3 A;  3ZP5 A;  5ILU A;  4A0X A;  4C3H J;  5D4S A;  4L9N A;  2DMU A;  2QLZ A;  3V8J A;  2VOP A;  2ESN A;  1XMK A;  4IXA A;  1WJA A;  4C3J J;  5K1Y A;  1YFH A;  2CUF A;  3IUO A;  4NQW B;  3SZG A;  3DLL F;  2CMP A;  1LDJ A;  3E5X A;  4JYK A;  5HS9 A;  3MKL A;  5EYR A;  5HS7 A;  4FE4 A;  4Q47 A;  3OR1 C;  4ZDO A;  3HM5 A;  1STZ A;  1G3W A;  3E0J B;  1TBX A;  3DU6 A;  4XMY A;  1FOX A;  4LB5 A;  2R7W A;  5EEA A;  3ONQ A;  4QSH A;  3DPU A;  2LBF A;  5AIQ A;  5GP9 A;  3DTE A;  5M5W J;  3SYT A;  3BZC A;  4XN3 A;  4BKX A;  1NG7 A;  1X1P A;  5JHF A;  3KEY A;  1RKT A;  1SC7 A;  2IRF G;  1A31 A;  1R00 A;  2NVY J;  1FOW A;  3EUK L;  5IYB J;  3F0C A;  3TL4 X;  2K27 A;  1S29 A;  5FKO A;  2ELJ A;  1LFB A;  4II3 A;  1IV8 A;  1OQY A;  5B1B H;  4WWC A;  2R5Z B;  1HF0 A;  2IT0 A;  5HLT A;  3OIO A;  4LIV A;  2ACJ A;  3HRM A;  1UFM A;  2FUG 2;  1PJR A;  4XLH A;  5KVR A;  4WXC A;  2A61 A;  3AG1 H;  3TOB A;  1LFP A;  4BBR J;  4BQN A;  2QQB A;  4FQG A;  3OYN A;  2ID3 A;  2K9Q A;  3FKJ A;  5F0C A;  2JUG A;  3HOW J;  4RB3 C;  1F5T A;  1YIJ I;  2A5W A;  3KP6 A;  2JRT A;  2AQE A;  2MLG A;  4OWR B;  1MJ9 A;  4DGW B;  4KIG A;  4CHU A;  1Z77 A;  2EV5 A;  1NHA A;  4OOI A;  3IL2 A;  1IV6 A;  3OWT A;  3DLA A;  1FP1 D;  2Y9Y A;  4RGR A;  1Z05 A;  4J01 A;  1VQM I;  3Q5F A;  2NVQ J;  3GZ6 A;  4DBQ A;  4DZP A;  2L7K A;  2HGC A;  2LMD A;  3WTW C;  3HYI A;  2ZJQ F;  4HRI A;  2RRE A;  1V5F A;  5FGM A;  4BDY A;  2VOO A;  5ICG A;  2LDU A;  2JVH A;  5FFX A;  1VQL I;  2YU3 A;  2MSY A;  1UST A;  3I58 A;  4HV6 A;  2HOS A;  1D8J A;  3GCM A;  3HG9 A;  2RAE A;  2Y30 A;  3KYD B;  2R7S A;  1MIJ A;  2KDZ A;  2BY2 A;  4JQF A;  1U78 A;  3RZO J;  1QBJ A;  4NNJ A;  4ZTF A;  5KAF C;  1B8I A;  4CZZ A;  1VND A;  2DPD A;  3M4O J;  1IN5 A;  1NG6 A;  4KMU X;  4Q4Z F;  5J4Y A;  1TNS A;  2R7X A;  4ETS A;  5GTH C;  3GO5 A;  4HST A;  2K40 A;  1MJB A;  1XTA A;  2HNH A;  1ZRC A;  2LKX A;  1R6R A;  4L9T A;  1ACI A;  2HR3 A;  5LGN A;  2KJC A;  3L2Q A;  1SVL A;  2QBY A;  2O03 A;  3AL0 C;  1I1G A;  3PIP F;  3ZQI A;  3T5X A;  3JRA A;  3K70 D;  1EJ9 A;  2A3S A;  4ZYD A;  4HF0 A;  2DA3 A;  1QVT A;  2VPR A;  4AIJ A;  3TW6 A;  1XSD A;  2FML A;  4ZYG A;  5EDN A;  3LSI A;  1G3S A;  3GEZ A;  1XSV A;  2F6C A;  1XD7 A;  2F5E A;  3K4J A;  3MEX A;  5J4V A;  2O6G E;  4N4O B;  3ZR8 X;  3ZQL A;  1TWA J;  2O9L A;  2GA1 A;  5C4X J;  5LGT A;  3PNV A;  2WV1 A;  4A0Z A;  3OL3 A;  1POG A;  1O4X A;  5IT9 Z;  1MBE A;  1YW8 A;  4E4H A;  4CYD A;  2RNJ A;  3P9I A;  1D0Z A;  4Y17 A;  3ISP A;  2XF6 A;  4F55 A;  2X0L A;  2R7O A;  1MBH A;  3MN2 A;  2XAS A;  4XQF A;  3CME I;  1ZRE A;  1OCP A;  3RKX A;  4U7B A;  4TV7 A;  3MKZ A;  3M8J A;  4EJO A;  3MZH A;  4W97 A;  1K7A A;  2ISY A;  1WVR A;  1I6H J;  1RR7 A;  2H1L A;  2R7U A;  1Z3Y A;  1YS6 A;  3WGH A;  4AC0 A;  2DTR A;  4A12 A;  3F21 A;  4GGG A;  2IJL A;  3EYI A;  2EA2 A;  3GFM A;  3FXQ A;  2L54 A;  4JX5 A;  4OAZ A;  3X2Q H;  4XLN F;  4CZC A;  2XUB A;  4RGU A;  2P4W A;  3BJO A;  3GFL A;  2VQL A;  1HXD A;  4BJT A;  2IAI A;  3HC7 A;  5D6F A;  4DOZ A;  2K85 A;  3N97 A;  1WHU A;  4RGX A;  5DS9 A;  2JWT A;  1ETQ A;  4B4C A;  5GAH J;  2IP2 A;  3CDI A;  4A0Y A;  2ZC2 A;  2FNA A;  2KRF A;  1T6S A;  1RKW A;  1Z7U A;  5HDK A;  2DA2 A;  1H89 C;  1ITY A;  3T0Y A;  3WGG A;  2VJ4 A;  1IN6 A;  2STT A;  2Y0M A;  3ZGK A;  2E36 A;  2ICW G;  3BQY A;  4PGG A;  3PNY A;  2ZSH B;  4MO7 A;  1AKH B;  4YIR X;  3KYL A;  2UUZ A;  1ZTR A;  2M4G A;  4YIF A;  4Y3O A;  2VT3 A;  3ZMZ A;  3BG7 A;  1MW7 A;  2GAU A;  1BW5 A;  2CUZ A;  3A03 A;  4YFK F;  4M73 A;  2VT2 A;  1V55 H;  3FMQ A;  1QNT A;  4RAY A;  3CO7 C;  2XAQ A;  1HDD C;  4ITV A;  2Q8K A;  2EIM H;  3J81 K;  1MMS A;  1TQM A;  1OKR A;  1A6Q A;  3N05 A;  3F8M A;  3MKW B;  1HST A;  4ZYA A;  1XB4 A;  1VQ6 I;  3M9A A;  4RGS A;  1PUF B;  2GA2 A;  3QRF F;  4IF4 A;  1CGP A;  1IUY A;  1PP8 F;  1ZAR A;  1YJN I;  1OJL A;  4CIC A;  3G73 A;  2F5V A;  2R7Q A;  5FKK A;  4M71 A;  4ON0 A;  5EEG A;  1SFO J;  1RES A;  5HDG A;  4XK4 A;  4PCQ A;  1HOM A;  2E1M B;  2O8X A;  4PDK A;  4G6Q A;  3F8C A;  3ABU A;  2EJR A;  2CQK A;  2V26 A;  1Y8Q B;  3CMM A;  4I99 C;  1FYM A;  1FX7 A;  1JKO C;  3KP3 A;  2AXL A;  2QBY B;  2FQ4 A;  4UXN A;  3BT9 A;  2XAF A;  5E3M A;  3G6E I;  4IHY A;  1DQU A;  1EH7 A;  2DQR A;  3I9V 2;  4QPQ A;  4I7H A;  3RKW A;  1NK3 P;  1GDT A;  1B9N A;  2W00 A;  4HX7 A;  4X0G A;  5F08 A;  3LSR A;  1B8I B;  1FBS A;  2O0Y A;  4IQ4 A;  3M1E A;  3J80 Z;  1IN8 A;  2IXS A;  2MC4 A;  3JRF A;  1A35 A;  5FFZ A;  1N25 A;  3CP2 A;  3S1R J;  4YFX F;  1X3W B;  2IEK A;  3I64 A;  2LFB A;  1JE8 A;  4KNY A;  4OMY A;  3QOP A;  3ZCO A;  1KQ9 A;  4IL6 C;  2B7E A;  2QVO A;  5BMZ A;  2HOT A;  2CFO A;  3HRU A;  2WY7 Q;  4ZTJ A;  2OF7 A;  2DOF A;  1NTC A;  4JOM A;  2PI0 A;  3E3V A;  1SFU A;  3GZN B;  2QYO A;  1R5H A;  1FOK A;  1I3Q J;  4IOA F;  1W7P D;  2M0M A;  2UZK A;  2HI3 A;  5BS6 A;  2PMZ N;  1R4N B;  5L3G A;  1S7A A;  1HSJ A;  3GTP J;  5IOZ A;  2WWY A;  2E2J J;  1ZLJ A;  2M4K A;  2X6X A;  4B43 A;  3FXJ A;  4CDG A;  1H88 C;  1IGN A;  3GFI A;  4DYR A;  2GM4 A;  5CLS A;  5IYC J;  4XLP F;  3HOV J;  2CQN A;  4I01 A;  4B1R A;  2XB0 X;  1QU3 A;  2L5Q A;  4I76 A;  4L0Z B;  5E3N A;  2BEO A;  2H6B A;  3VEP A;  3KYC B;  4E7Z A;  1ZG3 A;  1GXQ A;  2RDP A;  2CV2 A;  3BWG A;  1AOY A;  2EV6 A;  1ZG5 A;  1GV2 A;  2VBZ A;  3RKQ A;  1AU7 A;  5EGO A;  2RQQ A;  2FBI A;  2CGP A;  1OPC A;  3PSF A;  1OLT A;  4BY1 J;  5J47 A;  3J7A O;  5H2F C;  3VOD A;  2LBF B;  3JRI A;  3BR2 A;  4OIR F;  4CO8 A;  1LNW A;  3JSP A;  4GO1 A;  5ERI A;  3KET A;  2KZV A;  1DUX C;  4H4K C;  4HYE A;  4EGY A;  1TWF J;  3H3Z A;  4BQO A;  2XPW A;  3I4P A;  5F1R A;  4A3M J;  3PQK A;  4P55 A;  1YW9 A;  4UVA A;  2HXO A;  5GAD J;  5F0F A;  4XBF A;  2Y69 H;  4MEY F;  3HL2 A;  1FSE A;  1GVJ A;  3DV8 A;  2ZFW A;  3I54 A;  2HVQ A;  2MLK A;  1T33 A;  2QWW A;  4L5I A;  4J00 A;  4NHJ A;  3HHH A;  1MMD A;  3K0L A;  3P9C A;  1F4K A;  1DU0 A;  3L9F A;  1QRY A;  3K4N A;  4OMZ A;  2DQL A;  2NRA C;  2VAS A;  3GBG A;  4Y15 A;  2JA5 J;  3PNT A;  2ME0 A;  1DDN A;  2VBX A;  2DJI A;  4GCV A;  2K9N A;  3OOU A;  3W2V A;  4ENK A;  1P4X A;  1TLH B;  2EZK A;  5F04 A;  4KN7 X;  2KIQ A;  2BZT A;  5HS8 A;  2QSF X;  4MIM A;  1ULY A;  2XRO A;  1BM9 A;  3TP0 A;  1PP7 U;  4KYW A;  1KQ0 A;  4GYI A;  2MA3 A;  3EUA A;  3J81 Z;  2KLO A;  1AA7 A;  4LIU A;  2DPU A;  1XGS A;  3SEQ A;  2LY9 A;  3AG2 H;  1H8A C;  2DOE A;  3K4L A;  5B5E C;  3DTI A;  1R23 A;  3ULQ B;  3V4G A;  3GTJ J;  4EEF G;  5L3E A;  3I55 I;  2J5P A;  3BPX A;  5E1W A;  1SVO A;  3MFK A;  3H5R A;  2YUS A;  3VPR A;  1XGO A;  4BHC A;  5HOO A;  4BH9 A;  2PJR A;  2P6S A;  2GQQ A;  1K4S A;  3C1D A;  3HTU A;  3HOZ J;  5IY5 H;  1FTZ A;  5F0H A;  4A69 C;  1IN4 A;  2XSJ C;  4D7M A;  5CVJ A;  2R0Q C;  3A2K A;  1JTY A;  3QP6 A;  4G8X A;  3SFI A;  2Z1D A;  4G6T B;  4XKB A;  1BW6 A;  2EWN A;  2M0C A;  4XLC A;  4R1H A;  4XRF A;  4IZZ A;  3LA7 A;  2HTJ A;  4YEL A;  1BL0 A;  5EZH A;  5KAI C;  1D5Y A;  2E1M C;  1R1U A;  3K2A A;  3TO9 A;  1FBU A;  4HNT A;  3U1K A;  2OCC H;  1L3L A;  4AWX B;  4P9F A;  1R1V A;  2V9K A;  3IRR A;  1H9T A;  3I4N J;  3S15 J;  4PJJ A;  1WGX A;  2ZBK A;  1DP3 A;  2Y9Z A;  3CC4 I;  1FIP A;  2KFD A;  1X1D A;  3HDD A;  1IXS B;  1R36 A;  4XR6 A;  2JUC A;  3H9Q A;  2E2H J;  3H9G A;  2QQ8 A;  3ZMT A;  1P4A A;  3CCL I;  1CQT A;  3Q9V A;  4BNC A;  3MVP A;  4LG0 B;  1QZE A;  1JGG A;  4MQV A;  3VFZ A;  1U9O A;  1JT6 A;  3BR3 A;  5F27 A;  5GAE J;  5ICE A;  2KPM A;  1VQ5 I;  1BOA A;  2KIU A;  1FBQ A;  1ZRD A;  3CCE I;  1OCO H;  2KJB A;  3T8R A;  1A04 A;  2Z16 A;  4XIC A;  2QEX I;  1E3H A;  3LSJ A;  4HF1 A;  2L9S A;  1JUM A;  2VKD A;  3H0G J;  2CO5 A;  2L4A A;  2X6Y A;  4XRS G;  3NRV A;  1X3U A;  2L0K A;  3QOE A;  5CQE A;  3DF8 A;  3BQZ A;  3PSI A;  2W57 A;  1X1A A;  2A68 F;  1W5T A;  3G1O A;  5CVU A;  2V7F A;  2MYS A;  2CS3 A;  2W84 A;  3RKY A;  1ZR2 A;  1IN7 A;  2YS9 A;  4MGR A;  2HTS A;  2RQP A;  5HLH A;  3BY6 A;  2QSG X;  4UVC A;  1Y8R B;  4K2E A;  3RYR A;  3ZMU A;  3M1C A;  4GYG A;  4ZDP A;  3NEU A;  5C3E J;  3VOE A;  3Q9S A;  4L9J A;  4MQ9 F;  5D5X B;  3KFW X;  2QQA A;  3K4M A;  3O6B B;  4G9Y A;  4A5M A;  3TQN A;  3TDZ C;  2QQ9 A;  3S2W A;  3WGI A;  3AFH A;  4PFO A;  4B3A A;  4G7H F;  3OYF A;  2O61 A;  4HQM A;  3ECO A;  2XRL A;  3DTK A;  4BAY A;  1RIO H;  1QPI A;  2P7C B;  3HJE A;  4BBS J;  2HZT A;  4E70 A;  1FLI A;  3SJM A;  1TC3 C;  2MAB A;  4BE0 A;  4OU0 A;  3BCA A;  4G7O F;  2OPT A;  2ZFU A;  4PJ0 C;  4L9V A;  1I1S A;  2X48 A;  1W7P A;  2P81 A;  2NS8 A;  3B02 A;  4LMY A;  1TQP A;  2FXA A;  4ZYH A;  4I6Z A;  1YJW I;  5D4R A;  1LDD A;  1YIO A;  3S2D J;  4C30 A;  2O5R A;  3V8K A;  3OIP A;  3L2U A;  5J8F A;  4II2 A;  1JUP A;  1IF1 A;  1AWC A;  2BXY A;  3TW7 A;  1D8K A;  2GOX B;  1T56 A;  2FJ1 A;  3GXO A;  5D5U B;  1K61 A;  2DT7 B;  3GF2 A;  4ZYE A;  3K10 A;  1UEL B;  4JBA A;  1IUF A;  3KEQ A;  5JHU A;  2FNP A;  3ML6 A;  2VJ5 A;  1USS A;  3SFZ A;  4A3G J;  3SXY A;  4UNO A;  2CWE A;  1EA3 A;  4EGZ A;  2QKM B;  2GXG A;  4XNF A;  3F22 A;  4M6V A;  2F48 A;  1YS7 A;  5H6Q A;  2MGQ A;  4KIB A;  3JRB A;  4R79 A;  2OQR A;  2Z5U A;  3WU1 B;  3F72 A;  2M7A A;  3IAM 2;  1TQI A;  2E5Z A;  1XCB A;  2WC2 A;  1V5E A;  3KZZ A;  5CYV A;  2HEO A;  1YRN A;  4DJA A;  2XRN A;  2R7D A;  3GUD A;  1KU2 A;  5FO5 A;  1U8B A;  1B72 A;  3LQR A;  2GOM A;  5JLW A;  1FWZ A;  3V8L A;  2MH9 A;  1UCR A;  2ZNY A;  2EIJ H;  2COM A;  2R3S A;  1O3Q A;  2GBY A;  3A02 A;  1X1C A;  2EFN A;  1EV7 A;  2HWV A;  4UHT A;  2F4O B;  3OYG A;  1QGP A;  3R6S A;  4EAT A;  2FOK A;  2H09 A;  2DMN A;  4KUM A;  1RNL A;  3WTV C;  1ERD A;  2DT5 A;  2GXA A;  1XC5 A;  2K5C A;  5HLI A;  1QVU A;  5LHH A;  3HOU J;  4PFP A;  4G94 A;  1UG0 A;  3L1P A;  1HW2 A;  3TO7 A;  3TBI A;  3UNG C;  1F1Z A;  3FXU A;  4J19 A;  3LWF A;  3R60 A;  1K6Y A;  2VN2 A;  3H35 A;  1IRX A;  4B48 A;  1RI7 A;  4BHB A;  3LQQ A;  2W7N A;  3OOP A;  2O3F A;  3CUQ C;  1R7J A;  3BG9 A;  2DFH A;  2IPQ X;  4Z6Y A;  1LB2 A;  2CYY A;  4AUX A;  1TTY A;  2Z2S B;  4Y33 A;  3HGY A;  1K78 B;  4N4N B;  3HTS B;  5H20 A;  3W2A A;  4N0B A;  2X1D A;  4RB2 C;  3LA2 A;  4HF2 A;  2IA1 A;  3CF5 F;  4MFD A;  2CSO A;  2DMT A;  3WTT C;  4IKF A;  4GDF A;  3RDI A;  2ZME C;  1ZN2 A;  4UVB A;  4BJ5 C;  5IT3 A;  1E0E A;  1Z0X A;  4L5J A;  4ZDL A;  3TDU C;  3ZN0 A;  1T08 B;  2IS6 A;  2JK3 A;  3CJT B;  3DEE A;  2G7U A;  2I10 A;  3GTL J;  5EZG A;  1D0X A;  3J7Y J;  1WJ5 A;  1R5G A;  3HBL A;  4XKW A;  3HKZ A;  3S17 J;  2P7V B;  4FET A;  4FE7 A;  2VLA A;  3OYM A;  3E7L A;  3OV8 A;  1U2W A;  3F23 A;  4F3Q A;  2LD5 A;  3RQI A;  2ZJ2 A;  3OMY A;  2FA5 A;  2XIG A;  5FKN A;  4HNU A;  1WPK A;  3IAS 2;  3E6C C;  2XV4 S;  3KEO A;  4JX4 A;  3WG9 A;  1BOB A;  2GZW A;  1D5V A;  1R58 A;  1WZ2 A;  3CJR B;  1BJZ A;  4IJA A;  3P9K A;  4HOB A;  3H5N A;  3W2W A;  1XMX A;  5DM6 F;  2HDC A;  1TZL A;  4EJV A;  4ESF A;  3K4K A;  4DW6 A;  4ABZ A;  2R7T A;  3LSH A;  1UHS A;  2R5Z A;  1XX5 A;  1MMN A;  2YU9 J;  1BA5 A;  2IS2 A;  3Q0U A;  1YIT I;  4A3L J;  2F4I A;  2WAQ N;  1S7E A;  3FWE A;  2EFO A;  3JRH A;  1S6L A;  3DCF A;  2HDD A;  2IGK A;  2PJR B;  4KA4 A;  4I0B A;  1G4D A;  4IRH A;  3ZMD A;  4OAY A;  2OQG A;  3NWT A;  5K7H A;  4BE1 A;  1OCR H;  2E1O A;  4MHG A;  5AON A;  3QP5 A;  4KIS A;  2X6O A;  5E20 A;  3UR3 C;  5DUI A;  6PAX A;  3FBN B;  2KRH A;  2L2O A;  1IDZ A;  4A5N A;  2GXB A;  5DTD A;  1AKH A;  4G7Z F;  3CCY A;  5K5O A;  2KP6 A;  4ZJZ A;  1U3E M;  2HS5 A;  3ZQF A;  2DO7 A;  3T1B A;  3RJP A;  2L9V A;  1W5C C;  1VQK I;  2ZNZ A;  3B6C A;  4NC6 A;  1PVE A;  4M3E A;  5B66 C;  5JFR A;  4QTR A;  1K4T A;  4O6J A;  3S8P A;  4N9I A;  2EIK H;  3J7A Y;  1FMW A;  4QPO A;  2LNB A;  5J1U A;  2E71 A;  1TWG J;  4ENN A;  3HUG B;  1S8N A;  3P5J A;  2Y0S A;  3K7A J;  3QU6 A;  5J6X A;  4V2G A;  2PEX A;  1WI9 A;  3ABL H;  3S32 A;  4OIO F;  4V19 K;  2PMZ A;  4EJU A;  4UUS B;  2M9H A;  1N75 A;  5DM7 F;  1GT0 C;  3S2H J;  4BEH B;  1R4M B;  3HEF A;  2BVM A;  5M5Y J;  3COA C;  2LF8 A;  3LST A;  1SD7 A;  5EGO B;  3REO A;  3PO3 J;  3JRC A;  3ASO H;  5CQG A;  4YII A;  4BUP A;  3QYE A;  5TGT A;  3FDY A;  4LLN A;  2LRE A;  2R5Y A;  2YR2 A;  4NUB A;  3H1C A;  1WQ2 A;  1YO5 C;  4G6D A;  2E1C A;  2E60 A;  3L7W A;  1K79 A;  3BTC A;  2CQQ A;  1BC8 C;  1YQA A;  2P0W A;  2O8K A;  3HUG A;  1JJ6 C;  3DKW A;  1WWX A;  3OYH A;  1P7I A;  2VQH A;  4BS9 A;  4DZJ A;  2NS7 A;  3PJR A;  3C7J A;  3GX4 X;  2E19 A;  1PYV A;  1U0J A;  3E5U A;  4B8X A;  1RET A;  3HRT A;  3GWZ A;  1OFC X;  3FBI B;  2R7Z J;  1XDS A;  3TOA A;  1NH3 A;  2L01 A;  4UUT A;  3IP4 B;  1FYL A;  2K7L A;  3G4S I;  5KK1 A;  3GTM J;  5M5X J;  2H27 A;  4IRG A;  5F1J A;  2CW0 F;  1VQP I;  1OIS A;  3CJQ B;  3IH2 A;  1IDY A;  2D2W A;  1N77 A;  2CW7 A;  2EA4 A;  1FZP B;  4M3G A;  5LLQ A;  1PUE E;  1WH5 A;  3M8E A;  3I4M J;  1JKP C;  4CA0 A;  4EM2 A;  5FLV A;  1UZC A;  5BOX A;  3H3U A;  2FU4 A;  2MD0 A;  3PL8 A;  4V2F A;  5LHG A;  3RZD J;  3BR1 A;  4A93 J;  2EPF A;  5K7F A;  3MD2 A;  2M34 A;  2ZJP F;  4I2O A;  3L2V A;  1W4M A;  4IHW A;  3HZJ A;  2LKS A;  2H8R A;  3HB9 A;  2DXI A;  2H94 A;  3MAJ A;  4U0V A;  1KA8 A;  1YE9 A;  2YPR A;  1DPU A;  2NVT J;  3CP8 A;  3GTK J;  4B09 A;  3IH4 A;  1XMA A;  3BPV A;  3U9G A;  4D7N A;  3MWM A;  5IYD J;  2RC4 A;  3RPQ A;  2XSD C;  4NB5 A;  3H9J A;  2DFF A;  3CF2 A;  2FBH A;  3HXL A;  1E2X A;  4G12 A;  2FRH A;  5ILS A;  4C2M J;  2MG4 A;  4HLY A;  2WAD A;  4BQA A;  2Y2Z A;  5GPA A;  2GIV A;  1ZRF A;  2MC3 A;  1MMA A;  1H9G A;  2ISZ A;  3QWL A;  3C2B A;  1G3Y A;  1MH3 A;  1F9N A;  4RM2 A;  3BR6 A;  1IC8 A;  2HQA A;  1ZQ3 P;  5LD2 C;  2L3D A;  4XSX F;  2VOD A;  2A5Y B;  2PBI A;  3MZY A;  5E17 F;  4M72 A;  4P96 A;  1VQO I;  4X1E A;  1BI3 A;  5D8L B;  2X85 A;  2L7M P;  3F8N A;  4ZZL A;  5KHD A;  2KRC A;  2MH2 A;  3HPG A;  4DBR A;  3W6J B;  3BP8 A;  3KP5 A;  4U0Y A;  5E79 C;  4YRV A;  3Q0W A;  3CCM I;  4AVZ A;  4HNV A;  2M2E A;  1W0U A;  3O3K A;  3VSK A;  1U9N A;  1SAX A;  3JSO A;  3NQO A;  4JK1 X;  2JJ7 A;  3CES A;  3FXR A;  1B72 B;  1Y6I A;  3OYC A;  3E97 A;  3TGN A;  4PGH A;  2FX0 A;  3S3M A;  5L3F A;  4LLG F;  2HPM A;  3EYY A;  4H0E A;  1J59 A;  3S14 J;  4I02 A;  3OYL A;  2JA7 J;  1R1T A;  2HYG D;  4NQW A;  2BOL A;  4E6K G;  3WTX C;  2OJE D;  2QCO A;  4EJW A;  3OYB A;  1E3O C;  4UUV A;  1ETX A;  2XGE A;  2KZG A;  4P5O A;  4XLA A;  3L2W A;  2DA7 A;  2QEN A;  1J75 A;  1J5Y A;  2ADU A;  4C3I J;  4KFC A;  5JLX A;  3S3N A;  1ZEL A;  3ZPL A;  1Z67 A;  1X2N A;  4FHT A;  2X6W A;  2L9R A;  3SDG A;  3WTY C;  4CCJ A;  1QZZ A;  2UV1 A;  1KQ8 A;  2QSH X;  3QPL A;  4WXD A;  4Y13 A;  1R22 A;  4CYC A;  1OCZ H;  2OU2 A;  1I27 A;  3D5L A;  3WE3 A;  4FCY A;  4O3M A;  3K70 C;  3SHF A;  2R7F A;  1ZKG A;  2DFE A;  3JTH A;  2VXZ A;  2XGC A;  4Q5S F;  2CUJ A;  3DBL B;  3ELK A;  4F91 B;  2DDA A;  3JW4 A;  1ZHF A;  4IEJ A;  1U5T C;  1B1B A;  2JZY A;  4BE2 A;  2XKO A;  4XRM A;  2XPV A;  3I71 A;  4XLE A;  3VYT B;  3PUF A;  4MEX F;  5C4J J;  1N78 A;  4M9Z A;  4XID A;  3ECH A;  2DK8 A;  3E6B A;  1HKS A;  3Q0V A;  1V54 H;  5HLG A;  5E3L A;  2AS5 F;  4U87 A;  2XAJ A;  3PFI A;  2A07 F;  3HOT A;  2EIL H;  4HLX A;  5GAG J;  1BR2 A;  2NOJ B;  1TNT A;  3DEU A;  4PJN A;  2EFQ A;  2VE8 A;  3EDP A;  4RAG A;  2OD5 A;  1LE8 B;  2UWM A;  3GTO J;  5FD6 A;  2EBI A;  4RAF A;  3W6K B;  1V4R A;  1RPW A;  1MZB A;  4RDU A;  2PFB A;  2DTZ A;  4PZJ A;  4XLF A;  1HQC A;  2HYJ A;  1JKQ C;  5ED4 A;  1WJC A;  1W7P B;  2ELK A;  4ANJ A;  4XM3 A;  1P9Q C;  2QZ8 A;  4BJ6 C;  2TCT A;  4BXF A;  2VJJ A;  2NVX J;  2DA4 A;  2GIZ A;  2DFI A;  2XAU A;  5H6R A;  4BEH A;  2FQ3 A;  1XPX A;  4AIK A;  5E18 F;  1R49 A;  3U1D A;  4MNU A;  5FRN A;  4I98 B;  1IRG A;  3HGG A;  3B73 A;  2KT0 A;  5CVV A;  1TL8 A;  2NNY A;  2XPU A;  4BXU A;  1O3S A;  1XCV A;  2JVG A;  2MD5 A;  1YW7 A;  2D5V A;  3KE2 A;  1X3Z B;  2DJN A;  3DQV C;  3OR2 C;  1SAU A;  2KHM A;  1MBK A;  1H0M A;  4HX4 A;  3K4B A;  4DYQ A;  1OYW A;  2LVS A;  4DNC A;  2W1O A;  2N8G A;  2PMU A;  3TKY A;  2WB1 A;  3ZQH A;  3V7R A;  2HDW A;  2I8D A;  1YLF A;  3IRQ A;  1Z6R A;  2STW A;  2K9M A;  1ZLK A;  4HDV A;  3D5S C;  3KP4 A;  4F52 A;  3I56 I;  3QPS A;  2AO9 A;  1OR7 A;  1ONV A;  1S72 I;  3BJ6 A;  4W1U A;  2H6C A;  3LSG A;  1EH6 A;  5ICC A;  2KIM A;  3CCV I;  4AIH A;  1TP4 A;  2BW3 A;  3AL0 B;  1O57 A;  3QAH A;  4BQQ A;  2ECB A;  1SD6 A;  3K69 A;  2AHQ A;  2DYS H;  4DYC A;  1ENH A;  1X1B A;  3FK6 A;  1S7O A;  1PDN C;  1I5Z A;  5LEK A;  2LG4 A;  1ZAO A;  4MFE A;  3ZQ7 A;  1WCM J;  1CF7 B;  2XAH A;  1Z7L A;  2VB6 A;  3VB2 A;  2B63 J;  2R4G A;  1SFK A;  2K9L A;  2KIS A;  3M7G A;  1XG1 A;  4GXO A;  3ZQG A;  2M1B A;  3BLY A;  1ETW A;  2DU9 A;  4JX6 A;  5HVQ C;  1P92 A;  2BY0 A;  1S3J A;  4HQE A;  1E17 A;  2OCE A;  3R0J A;  2V1N A;  3CCQ I;  2ZXJ A;  4IO9 F;  1Y56 A;  1SD4 A;  2OAZ A;  4P9U A;  3SDB A;  3K2Z A;  1JT0 A;  1S5L C;  2HKO A;  2VC1 A;  3IH3 A;  3SZP A;  2BY3 A;  2IGM A;  3OYA A;  2IW5 A;  3TMO A;  2EIN H;  3HRS A;  3L2R A;  4HA8 A;  1W1W E;  2E35 A;  2M87 A;  3D0S A;  3L00 A;  3RSN A;  4A3J J;  1DU6 A;  1BI2 A;  2LF7 A;  1Z91 A;  4ASN A;  3BTJ A;  3I53 A;  5DD4 A;  4I09 A;  4EQQ A;  1XGM A;  1TWH J;  2VQC A;  5A2Q Z;  5FLM J;  1VTN C;  3O2P E;  2D1H A;  3OL4 A;  1IXR C;  1P2F A;  3BG6 A;  2TDX A;  3A0H C;  1Z21 A;  2FOW A;  3PIO F;  1YTY A;  2I5U A;  3CZ6 A;  3CCS I;  3M07 A;  1XS9 A;  3G3Z A;  3AG3 H;  4HW0 A;  1B59 A;  2O7O A;  3ROU A;  3DWL E;  4QLC U;  5LBQ A;  5J1R A;  4IX7 A;  3GTG J;  2MW8 A;  4UUS A;  3CQZ J;  1DPR A;  1IW7 F;  5K7Z A;  2ZME B;  3KCC A;  3ERE D;  3H92 A;  4LG3 A;  2BHY A;  3OSF A;  2OBP A;  3RYP A;  1LE8 A;  1MNM C;  2PJP A;  3BOQ A;  1HLV A;  1EH8 A;  2DYR H;  2JSC A;  1MH4 A;  1IRZ A;  3LAJ A;  4QWQ A;  2LLK A;  4LD5 A;  2QKL B;  2W85 A;  1Z6T A;  4B47 A;  2LK2 A;  2CQX A;  3PFY A;  2UXN A;  1RR8 C;  3P7N A;  2K02 A;  3E1S A;  3ZXS A;  3ZMS A;  1RUO A;  2A6E F;  1KU3 A;  1QZY A;  1HW5 A;  2BY1 A;  3RIR A;  3VDX A;  3SEZ A;  2NXN B;  1OR7 C;  4KT5 C;  1FJL A;  3GLX A;  4WCG A;  1MBG A;  2DLL A;  2LC2 A;  2WAE A;  3SQN A;  3BTL A;  3E6D A;  1Y39 A;  2H1K A;  1FTT A;  5HOD A;  4XN0 A;  4FTH A;  1UHM A;  1K83 J;  3ABT A;  3CCR I;  4BHP A;  3N4M A;  1SVM A;  3JRG A;  1ZG1 A;  3IWZ A;  2DOA A;  5DV5 A;  1J0R A;  4FT8 A;  4M3F A;  3QPH A;  4LB6 B;  1LKX A;  1SMY F;  3OYD A;  4EJT A;  2PX9 A;  1D1C A;  2OA4 A;  2WBM A;  4UV9 A;  5E1Z B;  4CGZ A;  2Q2E A;  1ETK A;  1WJE A;  1OYY A;  2VKV A;  1TW3 A;  5L3C A;  3BR5 A;  4BL0 B;  2VIX A;  3V7C A;  4S04 A;  1B4A A;  3HIF A;  3A4C A;  2HOE A;  2ELH A;  4NBQ A;  2EZI A;  1WH7 A;  3IKT A;  1F43 A;  4F93 B;  5FLX K;  1UMQ A;  4ZC3 A;  1V5G A;  3S93 A;  2NS0 A;  5ILV A;  4KT6 A;  4XKV A;  2QA4 I;  3CCJ I;  1K78 A;  1FT9 A;  2DAO A;  4Y52 J;  1A6I A;  3U21 A;  1R5I D;  1TT5 B;  3GTQ J;  5DCF A;  2K4B A;  4WF2 A;  3T8T A;  1GVD A;  3CDH A;  2VKE A;  3QYB A;  2XKP A;  4GRI A;  2BW3 B;  3UKG A;  3ERM A;  4LIT A;  4LGW A;  5BQT A;  5JVG F;  4IOC F;  4E7I A;  1SMT A;  2HU9 A;  5IP7 J;  4IHS A;  2M3A A;  4RMN A;  3JAM K;  4E7L A;  2HFH A;  2KQR A;  2XVC A;  5LRR A;  1LVA A;  1R71 A;  4A3B J;  1W36 D;  3DFG A;  2FEZ A;  5LRS A;  1T0F C;  4ZZD A;  1HC8 A;  4FX4 A;  2YX7 A;  3RCO A;  3IV5 A;  3HPH A;  1WJB A;  4PJL A;  1IJW C;  3G1L A;  1OYI A;  4A3I J;  1JHF A;  2X1E A;  1Q1V A;  2NAZ A;  1UAA A;  2E7W A;  2XGX A;  3LSK A;  2K9S A;  4E7K A;  2L7F P;  2RVC A;  3CJN A;  3DPT A;  5E3O A;  4LJZ F;  5JI6 A;  3CO6 C;  2JA2 A;  2ZXW H;  4I0A A;  3KP2 A;  2HYF A;  2PG4 A;  4EMS A;  5DCM B;  1PUF A;  3CUQ A;  1X58 A;  1MJA A;  1J09 A;  3F8F A;  4M9S A;  1YI2 I;  3JR9 A;  2EH3 A;  3WTS C;  5C44 J;  4CCL A;  4CUG A;  3CC2 I;  1ETV A;  2M45 A;  4Y7N J;  3MQ0 A;  2DA5 A;  2WA0 A;  3R61 A;  4A6E A;  2F4M B;  2VXD A;  1KU7 A;  3EPZ A;  3S3O A;  2LOO A;  2TRT A;  3IKV A;  4BDZ A;  3BZ6 A;  3KP7 A;  4KIT B;  4AD9 A;  3BG5 A;  1HW1 A;  3H36 A;  2P5L C;  5GPC A;  4HDU A;  1I39 A;  4L5E A;  4NC8 A;  2V6C A;  1J9I A;  2Z33 A;  2W24 A;  1GUU A;  4RAZ A;  3S16 J;  4LFU A;  5JR3 A;  2PMH A;  3CTA A;  3OYE A;  3ESW B;  3QU3 A;  2RN7 A;  3NAU A;  1ZK8 A;  1I6X A;  4CCN A;  1IRF A;  3G71 I;  2VL8 A;  1AHD P;  4HPQ A;  4D5F A;  4RB1 A;  1G59 A;  3HOY J;  3I59 A;  3JTG A;  3W6V A;  3HSF A;  3RPU A;  2ZXH A;  1ZGJ A;  5FD5 A;  4KIC A;  3FKI J;  1HKT A;  4FIS A;  1BI1 A;  1J7K A;  2HQ5 A;  3A01 B;  1TT0 A;  4AYB A;  2RKH A;  2IS1 A;  4U7D A;  1WSU A;  4M74 A;  1KYZ A;  2OZ6 A;  4CCM A;  4U88 A;  2LYC A;  2Q1Z B;  2A69 F;  2V9V A;  2XHK A;  4AU7 A;  2IGO A;  1UG2 A;  5DDG A;  1W36 C;  5B1A H;  1VQ4 I;  2LKP A;  4IHT A;  3TP3 A;  5BNG A;  5E8G A;  5IPA A;  1G6N A;  2ME6 A;  3VWB A;  2KIF A;  3CLQ A;  1ON2 A;  4CH7 A;  1GHC A;  4EVI A;  3E5Q A;  3KIO A;  4ESB A;  4A6D A;  3J80 K;  1LUJ B;  3QQA A;  3JCU C;  3OY9 A;  2LY1 A;  2DN0 A;  2FF4 A;  3U2R A;  3PM1 A;  4XON A;  1HDP A;  4CSW A;  1FP2 A;  1LQ1 A;  3FM5 A;  2JPB A;  2BBY A;  2JRM A;  2X1C A;  5EJC A;  2JMW A;  3MZ8 A;  3WOD F;  1EF4 A;  1FEX A;  4N9H A;  1XDU A;  2WAQ A;  2E5N A;  2HOA A;  4L0Y B;  3M8F A;  2VUM J;  1U6G A;  1QQI A;  4PSX A;  4M9X A;  2GWR A;  3FMS A;  1MSF C;  2Q2E B;  4R8H A;  2VBY A;  2AXT C;  5CVI A;  4IHV A;  1JXS A;  4D5C A;  3BRO A;  1O7L A;  2BV6 A;  3GW2 A;  2Y75 A;  1LDK B;  3HHG A;  2EZL A;  4QIW N;  3DBR B;  4IQJ A;  1XN7 A;  2V6E A;  1G2H A;  4BU2 A;  2VPL A;  2M8G X;  1Z3X A;  3I5U A;  5E1X A;  5IP9 J;  4HAM A;  1KU9 A;  5J3L A;  3CD6 I;  2CQ7 A;  2B0L A;  2IGN A;  5LHI A;  4WK8 F;  1DP7 P;  3GLL A;  1DGR M;  4BAC A;  2MFZ A;  1JI8 A;  3EUH A;  9ANT A;  2CRG A;  3O8G A;  5DEQ A;  3O8H A;  5EG0 B;  4ESJ A;  2PN6 A;  5TIS C;  2ZXI A;  1HA8 A;  2KL4 A;  4NDL A;  2F5F A;  2M8E A;  2ZSI B;  1ODD A;  2IA0 A;  2RNG A;  3G2B A;  1C0W A;  2BYV E;  1LFU P;  4XOT A;  4F92 B;  3BDD A;  3VYR B;  3F9K A;  1UB9 A;  3LSM A;  2EB7 A;  4RBO A;  4HZF A;  5M3M J;  1XGN A;  3C3W A;  2IA2 A;  3LA3 A;  1YHQ I;  3LFK A;  2CG4 A;  2VJI A;  5FJ8 J;  3FX3 A;  4ENJ A;  3ZOB A;  2LR8 A;  3ZQC A;  3R0A A;  3TED A;  3VYS B;  2VE9 A; 
#chains in the Genus database with same CATH homology
 5K5R A;  2A6H F;  2V79 A;  4IRI A;  1Z9C A;  2K86 A;  1LEA A;  2X4H A;  3CUO A;  3PQJ A;  4HBL A;  4LG0 A;  2DW4 A;  5D5V B;  2ESH A;  2G9W A;  2XAG A;  4YFN F;  3GFJ A;  1BBY A;  1Z1D A;  2QUF A;  5LGU A;  5F64 A;  3DPL C;  4XSZ F;  2F2E A;  1JGS A;  3ZMV A;  5DCM A;  1MDM B;  5D5W B;  4KDP A;  4UV8 A;  4WX9 A;  3LAP A;  2YSR A;  2FSW A;  4OIQ F;  1U5T A;  5TRD A;  1ZH5 A;  5L3D A;  1HBX G;  4DQ2 A;  3HSR A;  2J5O A;  1LJ9 A;  2OZU A;  2QM3 A;  1K6O A;  5D6E A;  1P6R A;  2WV0 A;  3TO6 A;  1GXP A;  2P6T A;  1FYK A;  1G3T A;  4KN4 X;  5LEJ A;  2UXX A;  3V7S A;  1T39 A;  2PLY A;  2VC0 A;  4Z2Y A;  2FE3 A;  1V3F A;  1YG2 A;  2E1N A;  2Q0O A;  2ZO4 A;  3BJA A;  4AVP A;  2D45 A;  3AAF A;  2E7X A;  2VBW A;  2JPC A;  2P5K A;  4U0W A;  3KZY A;  2NYX A;  5BPI A;  1B6A A;  2HQR A;  1W5S A;  2Y48 A;  3F3X A;  2HKX A;  3ZN1 A;  5FLX Z;  3FMR A;  1OMI A;  3MCZ A;  4EV0 A;  1IXC A;  1BI0 A;  1BC7 C;  1HKQ A;  2K4J A;  3CUQ B;  1BIA A;  1WRJ A;  5AIP A;  3WU0 A;  3FM3 A;  2ETH A;  1UHW A;  1D3Y A;  2EFW A;  1QO0 D;  1XSX A;  1Y0U A;  1WKM A;  1MGT A;  4O5V A;  2PQ8 A;  2RV8 A;  2BGC A;  3EQL F;  2VON A;  2IVM A;  1Q1H A;  4LLL A;  3IWF A;  1TW2 A;  4MTE A;  5IT9 K;  1SFE A;  1JHH A;  4OIN F;  1SD5 A;  2Z99 A;  3L09 A;  2NNN A;  2EV0 A;  1KGS A;  2JTV A;  3JAM Z;  2P8T A;  3WTU C;  2V1X A;  3K1N A;  4EM1 A;  1REP C;  2JT1 A;  4FX0 A;  5DUK A;  3RI4 A;  1U8R A;  1ON1 A;  2Z3Y A;  3FF5 A;  3E6M A;  5A2Q K;  4CXF A;  3L2C A;  3RTR A;  5FB2 A;  3CLO A;  4BYY A;  3QPT A;  4D0P A;  3I0T A;  2YX4 A;  2EK5 A;  1ZGA A;  1MKM A;  3WTZ A;  2FMY A;  1KYW A;  2C6Y A;  3GYH X;  2L02 A;  4LK0 F;  5HDN A;  4IVN A;  1BJA A;  3FHZ A;  3C18 A;  1MDM A;  3K1P A;  4F7Z A;  3WE2 A;  2V1U A;  2ZKZ A;  1O3R A;  3EET A;  2F5C A;  2HQN A;  5JVT A;  1IAW A;  1T2K A;  5D8K B;  2DI3 A;  3F6V A;  4S05 A;  3HOS A;  3KLN A;  2DBB A;  2W25 A;  1MD0 A;  5E8I A;  2KKO A;  4A2U A;  4LK1 F;  2D1V A;  3F8B A;  5ICF A;  2RGV A;  3HSE A;  2M5W A;  1O7F A;  2FBK A;  4HV5 A;  5BPD A;  4KIF A;  5CVR A;  4M6X A;  3F6O A;  4RS8 A;  1LEB A;  3DXJ F;  5J8C A;  4IPA A;  3GVA A;  4RB0 A;  4YG2 F;  2EFP A;  1ZYR F;  4EM0 B;  1T38 A;  2DK5 A;  1B9M A;  2M30 A;  1QPM A;  2LSO A;  4ENM A;  4L18 B;  1BIB A;  1RZ4 A;  3GZ5 A;  1BN5 A;  2F5D A;  5TJJ A;  2WTE A;  1O3T A;  5L3B A;  2P5V A;  1IZ1 A;  2G7H A;  2Z9O A;  1FSH A;  4KMF A;  1T98 A;  3SZT A;  1SFX A;  4HX8 A;  2MBF A;  1CF7 A;  1P4W A;  5DD8 A;  4OIP F;  5DYM A;  1T0F A;  2CFX A;  2V1D A;  5F6F A;  2BE5 F;  3IHU A;  3K9T A;  3R4K A;  3KLO A;  3IC7 A;  1FNN A;  1L0O C;  1RUN A;  2ZCW A;  1FY7 A;  1YYV A;  3DP7 A;  1J2X A;  4Q48 A;  5K5Q A;  3K1M A;  3I59 B;  2ZME A;  4ZH4 F;  5CJ9 A;  2L4M A;  4M6Y A;  1FPQ A;  5EEH A;  4MTD A;  1FC3 A;  4WXH A;  3FZV A;  1U5T B;  3ZP5 A;  5ILU A;  4A0X A;  5D4S A;  4L9N A;  2QLZ A;  3V8J A;  2VOP A;  2ESN A;  1XMK A;  4IXA A;  5K1Y A;  1YFH A;  1LDJ A;  3E5X A;  5HS9 A;  5HS7 A;  4Q47 A;  1STZ A;  1G3W A;  1TBX A;  4LB5 A;  5AIQ A;  2IRF G;  1R00 A;  2K27 A;  1S29 A;  4WWC A;  2IT0 A;  2ACJ A;  3HRM A;  1UFM A;  5KVR A;  3TOB A;  4WXC A;  2A61 A;  2QQB A;  4RB3 C;  1F5T A;  3KP6 A;  2JRT A;  2MLG A;  1MJ9 A;  4KIG A;  4CHU A;  2EV5 A;  1NHA A;  4OOI A;  3IL2 A;  1FP1 D;  4RGR A;  1Z05 A;  3Q5F A;  3GZ6 A;  2HGC A;  3WTW C;  3HYI A;  5FGM A;  2VOO A;  5ICG A;  2LDU A;  5FFX A;  2YU3 A;  1UST A;  3I58 A;  4HV6 A;  1D8J A;  4JQF A;  1U78 A;  1QBJ A;  4CZZ A;  2DPD A;  1IN5 A;  4KMU X;  4Q4Z F;  1TNS A;  4ETS A;  3GO5 A;  1MJB A;  1ZRC A;  4L9T A;  2HR3 A;  5LGN A;  2KJC A;  2QBY A;  2O03 A;  1I1G A;  3T5X A;  2A3S A;  4ZYD A;  4HF0 A;  4AIJ A;  1XSD A;  2FML A;  4ZYG A;  1G3S A;  3GEZ A;  1XSV A;  1XD7 A;  2F5E A;  3MEX A;  2O6G E;  2GA1 A;  5LGT A;  4A0Z A;  5IT9 Z;  1YW8 A;  4CYD A;  2RNJ A;  3P9I A;  4Y17 A;  3ISP A;  2X0L A;  2XAS A;  1ZRE A;  3RKX A;  4U7B A;  4TV7 A;  4EJO A;  3MZH A;  1K7A A;  2ISY A;  1YS6 A;  3WGH A;  2DTR A;  4A12 A;  3F21 A;  4GGG A;  2IJL A;  3EYI A;  2EA2 A;  3GFM A;  3FXQ A;  2L54 A;  4XLN F;  2XUB A;  4RGU A;  2P4W A;  3BJO A;  3GFL A;  1HXD A;  5D6F A;  3N97 A;  4RGX A;  2IP2 A;  4A0Y A;  2FNA A;  2KRF A;  1T6S A;  1Z7U A;  5HDK A;  3T0Y A;  3WGG A;  1IN6 A;  2STT A;  2Y0M A;  4PGG A;  4YIF A;  2VT3 A;  3ZMZ A;  2GAU A;  4YFK F;  4M73 A;  2VT2 A;  3FMQ A;  4RAY A;  1QNT A;  3CO7 C;  2XAQ A;  2Q8K A;  3J81 K;  1OKR A;  1TQM A;  3F8M A;  1HST A;  1XB4 A;  3M9A A;  4RGS A;  2GA2 A;  3QRF F;  4IF4 A;  1CGP A;  1IUY A;  1PP8 F;  1ZAR A;  4CIC A;  3G73 A;  4M71 A;  4ON0 A;  5EEG A;  5HDG A;  4PCQ A;  4PDK A;  2O8X A;  4G6Q A;  3F8C A;  3ABU A;  2EJR A;  2CQK A;  1FYM A;  1FX7 A;  3KP3 A;  2AXL A;  2QBY B;  4UXN A;  2XAF A;  1EH7 A;  2DQR A;  3RKW A;  4I7H A;  1B9N A;  4HX7 A;  1FBS A;  2O0Y A;  3M1E A;  3J80 Z;  1IN8 A;  5FFZ A;  4YFX F;  3I64 A;  4OMY A;  1JE8 A;  4KNY A;  3QOP A;  1KQ9 A;  2QVO A;  5BMZ A;  3HRU A;  2PI0 A;  3E3V A;  1SFU A;  2QYO A;  1R5H A;  1FOK A;  1W7P D;  2UZK A;  5BS6 A;  5L3G A;  1S7A A;  1HSJ A;  2WWY A;  1ZLJ A;  4CDG A;  3GFI A;  5CLS A;  4XLP F;  4I01 A;  4L0Z B;  2BEO A;  2H6B A;  3VEP A;  1ZG3 A;  1GXQ A;  2RDP A;  3BWG A;  1AOY A;  2EV6 A;  1ZG5 A;  2VBZ A;  2FBI A;  2CGP A;  1OPC A;  3J7A O;  3VOD A;  4OIR F;  4CO8 A;  1LNW A;  3JSP A;  4GO1 A;  5ERI A;  3KET A;  1DUX C;  4HYE A;  4EGY A;  3H3Z A;  3I4P A;  5F1R A;  3PQK A;  4P55 A;  1YW9 A;  4UVA A;  4XBF A;  4MEY F;  1FSE A;  1GVJ A;  3DV8 A;  2ZFW A;  3I54 A;  2MLK A;  2QWW A;  4L5I A;  4NHJ A;  3HHH A;  3K0L A;  3P9C A;  1F4K A;  3L9F A;  4OMZ A;  2DQL A;  2NRA C;  4Y15 A;  1DDN A;  2VBX A;  4GCV A;  4ENK A;  1P4X A;  1TLH B;  4KN7 X;  5HS8 A;  1ULY A;  2XRO A;  1BM9 A;  4KYW A;  1PP7 U;  1KQ0 A;  4GYI A;  2MA3 A;  3J81 Z;  2DPU A;  1XGS A;  1R23 A;  3ULQ B;  3V4G A;  5L3E A;  5E1W A;  2J5P A;  3BPX A;  3MFK A;  1XGO A;  4BHC A;  5HOO A;  4BH9 A;  2P6S A;  2GQQ A;  3C1D A;  3HTU A;  1IN4 A;  5CVJ A;  4G8X A;  3QP6 A;  2EWN A;  4R1H A;  4XRF A;  3LA7 A;  2HTJ A;  1R1U A;  3TO9 A;  1FBU A;  1L3L A;  4AWX B;  4P9F A;  1R1V A;  1H9T A;  3IRR A;  2ZBK A;  1IXS B;  1R36 A;  3ZMT A;  1P4A A;  3Q9V A;  4BNC A;  4LG0 B;  4MQV A;  3VFZ A;  5ICE A;  1BOA A;  2KIU A;  1FBQ A;  1ZRD A;  2KJB A;  3T8R A;  1A04 A;  4HF1 A;  2CO5 A;  2L4A A;  3NRV A;  1X3U A;  3DF8 A;  2W57 A;  2A68 F;  1W5T A;  5CVU A;  2W84 A;  3RKY A;  1IN7 A;  4MGR A;  2HTS A;  2RQP A;  5HLH A;  3BY6 A;  4UVC A;  3RYR A;  4K2E A;  3ZMU A;  4GYG A;  3NEU A;  3VOE A;  3Q9S A;  4L9J A;  4MQ9 F;  5D5X B;  3KFW X;  2QQA A;  4G9Y A;  3O6B B;  4A5M A;  3TQN A;  3TDZ C;  2QQ9 A;  3S2W A;  3WGI A;  4G7H F;  2O61 A;  4HQM A;  3ECO A;  4BAY A;  1RIO H;  2P7C B;  2HZT A;  4E70 A;  1FLI A;  4OU0 A;  4G7O F;  4L9V A;  1I1S A;  1W7P A;  3B02 A;  4LMY A;  1TQP A;  2FXA A;  4ZYH A;  5D4R A;  1LDD A;  1YIO A;  3V8K A;  5J8F A;  1IF1 A;  1AWC A;  1D8K A;  3GXO A;  5D5U B;  3GF2 A;  4ZYE A;  4JBA A;  3KEQ A;  5JHU A;  2FNP A;  3ML6 A;  1USS A;  3SFZ A;  3SXY A;  4UNO A;  2CWE A;  4EGZ A;  2GXG A;  3F22 A;  1YS7 A;  5H6Q A;  4KIB A;  4R79 A;  2OQR A;  2Z5U A;  3WU1 B;  3F72 A;  1TQI A;  1XCB A;  2WC2 A;  3KZZ A;  5CYV A;  2HEO A;  2XRN A;  2R7D A;  3GUD A;  1KU2 A;  5FO5 A;  3LQR A;  1FWZ A;  3V8L A;  2MH9 A;  1UCR A;  2ZNY A;  2R3S A;  2COM A;  1O3Q A;  2EFN A;  1EV7 A;  2HWV A;  4UHT A;  1QGP A;  3R6S A;  2FOK A;  2H09 A;  4KUM A;  1RNL A;  3WTV C;  2DT5 A;  5LHH A;  5HLI A;  4G94 A;  1HW2 A;  3TO7 A;  1F1Z A;  3FXU A;  3LWF A;  3R60 A;  2VN2 A;  1RI7 A;  4BHB A;  3LQQ A;  3OOP A;  2O3F A;  3CUQ C;  1R7J A;  2IPQ X;  1LB2 A;  2CYY A;  1TTY A;  1K78 B;  3HTS B;  5H20 A;  4N0B A;  4RB2 C;  3LA2 A;  4HF2 A;  2IA1 A;  2CSO A;  3WTT C;  3RDI A;  4UVB A;  1ZN2 A;  5IT3 A;  4L5J A;  3TDU C;  3ZN0 A;  2G7U A;  1R5G A;  2P7V B;  3OV8 A;  1U2W A;  3F23 A;  2ZJ2 A;  2FA5 A;  2XIG A;  3E6C C;  2XV4 S;  3KEO A;  3WG9 A;  2GZW A;  1D5V A;  1R58 A;  4IJA A;  3P9K A;  4HOB A;  2HDC A;  4EJV A;  4ESF A;  3FWE A;  2EFO A;  1S6L A;  4KA4 A;  4I0B A;  1G4D A;  4IRH A;  3ZMD A;  2OQG A;  4MHG A;  5AON A;  3QP5 A;  5E20 A;  5DUI A;  6PAX A;  4A5N A;  2GXB A;  4G7Z F;  5K5O A;  1U3E M;  2HS5 A;  2DO7 A;  3T1B A;  3RJP A;  2ZNZ A;  5JFR A;  4O6J A;  4N9I A;  2LNB A;  4ENN A;  1S8N A;  5J6X A;  3QU6 A;  2PEX A;  1WI9 A;  4OIO F;  4EJU A;  3COA C;  2LF8 A;  3LST A;  1SD7 A;  3REO A;  4YII A;  4LLN A;  2YR2 A;  1WQ2 A;  1YO5 C;  4G6D A;  2E1C A;  1K79 A;  3L7W A;  1BC8 C;  1YQA A;  3HUG A;  3DKW A;  1WWX A;  3C7J A;  3GX4 X;  3E5U A;  4B8X A;  3HRT A;  3GWZ A;  1XDS A;  3TOA A;  2L01 A;  1FYL A;  2K7L A;  5KK1 A;  2H27 A;  4IRG A;  2CW0 F;  2D2W A;  2EA4 A;  1FZP B;  5LLQ A;  1PUE E;  3M8E A;  4EM2 A;  5BOX A;  3H3U A;  2FU4 A;  5LHG A;  4I2O A;  1W4M A;  2H94 A;  3MAJ A;  4U0V A;  1KA8 A;  2YPR A;  1DPU A;  4B09 A;  1XMA A;  3BPV A;  3U9G A;  3MWM A;  2RC4 A;  3RPQ A;  4NB5 A;  2FBH A;  1E2X A;  5ILS A;  2FRH A;  4HLY A;  4BQA A;  2GIV A;  1ZRF A;  2MC3 A;  1H9G A;  2ISZ A;  1G3Y A;  1F9N A;  2L3D A;  4XSX F;  2VOD A;  2A5Y B;  2PBI A;  3MZY A;  5E17 F;  4M72 A;  4P96 A;  1BI3 A;  5D8L B;  3F8N A;  4ZZL A;  2MH2 A;  3W6J B;  3BP8 A;  3KP5 A;  4U0Y A;  1SAX A;  3O3K A;  3JSO A;  3NQO A;  4JK1 X;  3FXR A;  3E97 A;  3TGN A;  4PGH A;  5L3F A;  4LLG F;  3EYY A;  4H0E A;  1J59 A;  4I02 A;  1R1T A;  2HYG D;  4NQW A;  3WTX C;  4EJW A;  4UUV A;  4P5O A;  2QEN A;  1J75 A;  1J5Y A;  2ADU A;  4KFC A;  3ZPL A;  4FHT A;  3WTY C;  1QZZ A;  1KQ8 A;  4WXD A;  4Y13 A;  1R22 A;  2OU2 A;  1I27 A;  3D5L A;  3WE3 A;  4O3M A;  3SHF A;  2R7F A;  3JTH A;  2VXZ A;  4Q5S F;  3ELK A;  3JW4 A;  1ZHF A;  1U5T C;  1B1B A;  2JZY A;  2XKO A;  3I71 A;  4MEX F;  4M9Z A;  3ECH A;  2DK8 A;  3E6B A;  1HKS A;  5HLG A;  2AS5 F;  2XAJ A;  3PFI A;  2A07 F;  3HOT A;  4HLX A;  1TNT A;  3DEU A;  2EFQ A;  2VE8 A;  3EDP A;  2OD5 A;  2UWM A;  5FD6 A;  3W6K B;  1V4R A;  1MZB A;  2PFB A;  4PZJ A;  1HQC A;  5ED4 A;  1W7P B;  2QZ8 A;  2DFI A;  5H6R A;  2FQ3 A;  4AIK A;  5E18 F;  3U1D A;  4MNU A;  1IRG A;  4I98 B;  3B73 A;  5CVV A;  2NNY A;  1O3S A;  4BXU A;  1XCV A;  2MD5 A;  1YW7 A;  3KE2 A;  3DQV C;  1H0M A;  4HX4 A;  1OYW A;  4DNC A;  2PMU A;  3TKY A;  3V7R A;  1YLF A;  3IRQ A;  1Z6R A;  2STW A;  1ZLK A;  4HDV A;  3KP4 A;  1OR7 A;  1ONV A;  3BJ6 A;  2H6C A;  1EH6 A;  5ICC A;  2KIM A;  4AIH A;  1O57 A;  3QAH A;  1SD6 A;  3K69 A;  1S7O A;  1PDN C;  1I5Z A;  5LEK A;  1ZAO A;  3ZQ7 A;  1CF7 B;  2XAH A;  3VB2 A;  4GXO A;  3M7G A;  2M1B A;  2DU9 A;  5HVQ C;  1P92 A;  1S3J A;  4HQE A;  1E17 A;  3R0J A;  2ZXJ A;  1SD4 A;  2OAZ A;  4P9U A;  3K2Z A;  2HKO A;  2VC1 A;  3SZP A;  2IW5 A;  3HRS A;  4HA8 A;  2M87 A;  3D0S A;  3L00 A;  1BI2 A;  2LF7 A;  1Z91 A;  4ASN A;  3I53 A;  5DD4 A;  4I09 A;  4EQQ A;  1XGM A;  5A2Q Z;  1VTN C;  3O2P E;  2D1H A;  1IXR C;  1P2F A;  2TDX A;  1YTY A;  3G3Z A;  4HW0 A;  1B59 A;  3ROU A;  4QLC U;  5LBQ A;  1DPR A;  1IW7 F;  2ZME B;  3KCC A;  3ERE D;  3H92 A;  2OBP A;  3RYP A;  2PJP A;  3BOQ A;  1EH8 A;  2JSC A;  3LAJ A;  4QWQ A;  4LD5 A;  2W85 A;  1Z6T A;  2UXN A;  3P7N A;  2K02 A;  3ZMS A;  1RUO A;  2A6E F;  1KU3 A;  1QZY A;  1HW5 A;  3RIR A;  4KT5 C;  3GLX A;  4WCG A;  2DLL A;  3SQN A;  3E6D A;  1UHM A;  3ABT A;  4BHP A;  3N4M A;  1ZG1 A;  3IWZ A;  5DV5 A;  1J0R A;  4FT8 A;  3QPH A;  4LB6 B;  1SMY F;  4EJT A;  2OA4 A;  4UV9 A;  5E1Z B;  4CGZ A;  2Q2E A;  1OYY A;  1TW3 A;  5L3C A;  3V7C A;  4S04 A;  1B4A A;  3HIF A;  2HOE A;  2ELH A;  3IKT A;  5FLX K;  5ILV A;  2NS0 A;  1K78 A;  1FT9 A;  2DAO A;  5DCF A;  2K4B A;  4WF2 A;  3T8T A;  3CDH A;  2XKP A;  4LGW A;  5BQT A;  1SMT A;  4IHS A;  3JAM K;  2HFH A;  2XVC A;  5LRR A;  1LVA A;  3DFG A;  2FEZ A;  5LRS A;  4ZZD A;  4FX4 A;  2YX7 A;  1OYI A;  1JHF A;  2NAZ A;  2E7W A;  2XGX A;  2RVC A;  3CJN A;  3DPT A;  4LJZ F;  5JI6 A;  3CO6 C;  4I0A A;  3KP2 A;  2HYF A;  2PG4 A;  4EMS A;  5DCM B;  3CUQ A;  1MJA A;  3F8F A;  4M9S A;  3WTS C;  2M45 A;  3MQ0 A;  3R61 A;  4A6E A;  1KU7 A;  3IKV A;  3BZ6 A;  3KP7 A;  4AD9 A;  1HW1 A;  2P5L C;  4HDU A;  2V6C A;  1J9I A;  2Z33 A;  2W24 A;  4RAZ A;  5JR3 A;  4LFU A;  2PMH A;  3CTA A;  3QU3 A;  2RN7 A;  1I6X A;  1IRF A;  4RB1 A;  3I59 A;  3JTG A;  3HSF A;  3RPU A;  1ZGJ A;  5FD5 A;  4KIC A;  1HKT A;  1BI1 A;  1J7K A;  2RKH A;  4U7D A;  1WSU A;  4M74 A;  1KYZ A;  2OZ6 A;  4U88 A;  2V9V A;  2XHK A;  2A69 F;  5DDG A;  2LKP A;  4IHT A;  5E8G A;  1G6N A;  2KIF A;  1ON2 A;  1GHC A;  4EVI A;  3E5Q A;  4ESB A;  4A6D A;  3J80 K;  2FF4 A;  3U2R A;  1FP2 A;  1LQ1 A;  3FM5 A;  2JPB A;  2BBY A;  3WOD F;  4N9H A;  1XDU A;  4L0Y B;  3M8F A;  1U6G A;  1QQI A;  4M9X A;  2GWR A;  3FMS A;  4R8H A;  2VBY A;  5CVI A;  1JXS A;  3BRO A;  1O7L A;  2BV6 A;  3GW2 A;  2Y75 A;  1LDK B;  3HHG A;  1XN7 A;  3I5U A;  5E1X A;  4HAM A;  1KU9 A;  2B0L A;  5LHI A;  4WK8 F;  1DP7 P;  3EUH A;  5DEQ A;  4ESJ A;  2PN6 A;  2F5F A;  2M8E A;  1ODD A;  2IA0 A;  1C0W A;  2BYV E;  3BDD A;  1UB9 A;  2EB7 A;  4HZF A;  1XGN A;  3C3W A;  2IA2 A;  3LA3 A;  3LFK A;  2CG4 A;  3FX3 A;  4ENJ A;  3R0A A;  2VE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...