3GTOJ

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtoJ00
1X2MA 5EEAA 3OSGA 2X9DA 3S2HJ 4IHWA 5FKNA 5IPAA 1Z77A 3TEDA 2XSDC 1H89C 2R5YB 3ZQCA 4IHXA 2GLOA 4D5FA 3S15J 5J1RA 4G12A 5C3EJ 3UKGA 4I6ZA 1AKHB 2M8GX 5FLVA 3LSPA 5C4XJ 3TP0A 2LK2A 5C44J 2W48A 2L0KA 3HKZN 2ME0A 1WI3A 4NDLA 3QQAA 3MN2A 1ZTRA 3TP3A 1X2NA 3GBGA 2JWTA 4X1EA 3SFIA 4XRSG 3RZDJ 3S17J 3S2DJ 1RKTA 3QPSA 1RR7A 3BTLA 1JJ8C 3GTOJ 3IH3A 2XGCA 3Q3SA 3L1PA 3HOXJ 2HOSA 5GPCA 3JR9A 2X48A 2JMWA 5IYCJ 4FCYA 4S0HB 3CCYA 4DYRA 5EGOA 3JRIA 2PMZN 1WGXA 4UUSB 1I50J 4J19A 1ETWA 4W1UA 2NOGA 3GTMJ 1JKOC 4A3BJ 4JX5A 1IG7A 1JKQC 2OF7A 2O8KA 1FTZA 5M5XJ 5M5YJ 4GFBA 5FKLA 2O7OA 4A3DJ 1VI0A 1HDPA 1IDYA 3GTLJ 3O8HA 4FE7A 3I4NJ 4M3GA 2EBIA 1ETOA 4FE4A 2MGQA 2M34A 2GM4A 4AC0A 1TWCJ 2Y9ZA 2FX0A 3I4MJ 4IHVA 2VUMJ 3BQYA 1HF0A 1TWHJ 5C4JJ 4I76A 2EH3A 2MSYA 1WH7A 2NS8A 5E3NA 4A3EJ 2HXIA 3ZOBA 3JRDA 1ZGWA 3Q0VA 5M5WJ 1O4XA 1U78A 2DTZA 2XPVA 2XRLA 1MBHA 2LR8A 5DS9A 3JRFA 3TW7A 5F08A 1HLVA 3S1NJ 3GTJJ 3S14J 3BT9A 5IYBJ 1ZKGA 4IHYA 4RDUA 5EYRA 2LFBA 4A3CJ 3BR6A 4CYCA 5M3MJ 1LE8B 1DU0A 3FK6A 1JUSA 1AHDP 2DMPA 2LP0A 1VF9A 1TWFJ 2K9QA 1D5YA 4XRSA 3BQZA 4D7MA 5F1JA 1LFUP 4M6VA 3HDDA 5BNGA 4XICA 2ID3A 2EZHA 1K61A 3LNQA 1Y1VJ 3Q0UA 1H8AC 5F0FA 4BY1J 3FKIJ 1W0UA 5EG0A 2KDZA 2JA7J 2AHQA 4M3FA 2RAEA 2K9SA 4M3EA 1OJLA 2P81A 1ZR4A 1GT0C 1NK2P 2XGEA 1UHSA 2Y31A 1B8IB 2IAIA 3H0GJ 2VPRA 1E3OC 2JK3A 3IH2A 2WB1N 3O8GA 4BBSJ 3A01B 1OCPA 1XS9A 1H88C 2HQ5A 2DMUA 2E1OA 4MFDA 1OCTC 2G0EA 1WCMJ 3G1OA 4A93J 3S1MJ 3MVPA 2NVXJ 2R5YA 3SJMA 4BXXJ 3JRCA 1AKHA 3A03A 3ZQHA 1S7EA 3OSFA 1YRNA 2IEKA 5J3LA 4FTHA 4ABZA 3S1RJ 1K83J 3GTGJ 1FJLA 3WHCA 2YUSA 2LY9A 1MSFC 3GTKJ 4V2FA 4A3JJ 2JN6A 1IDZA 2ELKA 1WPKA 3B6AA 4QSHA 1IJWC 5F27A 4C3JJ 3BG5A 4UUSA 4LOCA 3G1MA 4QIWN 3GTPJ 2E2JJ 3GTQJ 4BY7J 3OIOA 1ENHA 4A3KJ 5GP9A 5M3FJ 2ME6A 5K7FA 1VNDA 1Q1VA 3E7LA 2JJ7A 2WAQN 2FJ1A 4DYQA 3FK7A 1ETKA 1A6IA 2TRTA 2NVQJ 1GV5A 5EGOB 1JUPA 2XPUA 3RKQA 1UMQA 2CQQA 1HCRA 1MBJA 2KT0A 4RBOA 1CQTA 1W0TA 2H8RA 2DA7A 2FD5A 3MKLA 2N8GA 3PM1A 1PUFB 3W6VA 3BR3A 9ANTA 3JRGA 4C2MJ 3OOUA 1BL0A 2I10A 2HYJA 4DW6A 1NK3P 2L7FP 2DN0A 1AU7A 1BJZA 5JLXA 5IOZA 3G1LA 1JJ6C 4FISA 2R5ZB 1P7IA 1U8BA 1SFOJ 1RETA 3K2AA 2L7MP 4BKXA 2COBA 5K7ZA 1LE8A 2ECCA 2ECBA 2CRGA 3B6CA 3F0CA 3NAUA 1U9NA 2DA1A 2QF7A 1GDTA 2Y9YA 1JTXA 2HOAA 1MBKA 2VI6A 1FEXA 3S16J 4JX4A 1ZR2A 1MSEC 1HDDC 1B72B 2E2IJ 2ZB9A 4M3DA 5IP6A 2ID6A 1Z0XA 1Y1WJ 5FKOA 1QRYA 3JRAA 1UG2A 3BR1A 3PO3J 4CYCB 1G2HA 3S1QJ 2VKVA 1MBFA 1BW5A 2OPTA 2XPWA 1POGA 4JX6A 1JGGA 5E3LA 4IEJA 4V2GA 2QCOA 2K9NA 2MW8A 1JUMA 4JYKA 3JRHA 1XC5A 1JKPC 3H3VK 2DA4A 1IGNA 4A3IJ 1B8IA 1TWAJ 3HGYA 1ETYA 1ORKA 1MBGA 1FIPA 4DZJA 5F0HA 1P7JA 1QPIA 2XB5A 4DYCA 3A01A 2JA5J 3RZOJ 2XGDA 4A69C 1IV6A 5J1UA 3HOWJ 5GPAA 2AO9A 2LD5A 5E3MA 1T56A 3BTJA 4MLOA 3ZQGA 4D7NA 2HDDA 4JP0A 4A3FJ 3WHBA 1GVDA 3BTIA 5DTDA 1ZK8A 1RPWA 3HM5A 1I6HJ 1T33A 5F0CA 2CUFA 1APLC 3HOUJ 2MG4A 1DU6A 3JREA 4MIMA 3A02A 1RKWA 4W97A 1OFCX 1BA5A 4QTRA 5IP7J 3DCFA 1YRNB 4L5EA 2HI3A 2Y0SN 5FLMJ 2YU9J 5F04A 2LTPA 4AUXA 1JKRC 3CMYA 4Y52J 2JA6J 3CDLA 4A3MJ 2M2EA 3SDGA 4XK4A 5FJ8J 3IV5A 2B63J 2NVTJ 1RESA 2HXOA 4XRMA 3K7AJ 5EF6A 1F36A 2O9LA 2DMNA 2DJNA 3HOVJ 1JT6A 1ETVA 4M3BA 3RQIA 3PO2J 3ZQFA 2HOTA 3LSRA 4DZPA 5K7HA 2LVSA 1MNMC 1PUFA 1F43A 2CU7A 1QVTA 3HEFA 3M4OJ 3LSJA 1FIAA 2L9RA 3BR0A 1FTTA 3BG3A 5J1YA 2H1KA 2DA5A 3LSGA 2M9HA 2LLKA 3HB9A 4BBRJ 3CQZJ 2K40A 2R5ZA 4MFEA 1MH4A 2E19A 3QPLA 2M0CA 4D5CA 2FQ4A 1ITYA 1NTCA 3HGGA 1IRZA 1ETXA 1IC8A 4B4CA 4XIDA 4X6AJ 2CQXA 5HODA 1GV2A 2DMTA 2XB0X 4B1RA 2DA6A 3HBLA 1MBEA 3FISA 5JLWA 1IUFA 3BG9A 5E3OA 2EZLA 3Q0WA 1B72A 5IYDJ 1TWGJ 1MH3A 4UUTA 2EZKA 1EF4A 2Y30A 1QVUA 5EZGA 3BTCA 2IBDA 2R93J 5FKKA 1I3QJ 1BW6A 2DMQA 2R92J 1LFBA 2Y2ZA 1R9TJ 2CUEA 4C3IJ 2LKXA 5IP9J 3NARA 3M3YJ 1XG1A 2NVYJ 4B3AA 2DA3A 3IH4A 4Y7NJ 3VPRA 3C2BA 1WH5A 2E2HJ 2R7ZJ 2WV1A 1X58A 3ZQIA 1VFCA 3D1NI 2D5VA 2EQRA 1JTYA 1GUUA 5EG0B 1ETQA 2DA2A 2JA8J 4A3LJ 1HOMA 2L7ZA 1A5JA 3HOZJ 3HOYJ 5EDNA 1ZQ3P 4MO7A 2GBYA 2YS9A 1JT0A 4A3GJ 1U9OA 2TCTA 3DEWA 2EZIA 2NS7A 3FIWA 3JRBA 2CJJA 3BR5A 2VKEA 1TC3C 4AYBN 3LOCA 5FKMA 3TW6A 3BR2A 5IOYA 4HNVA 3ZQLA 4EEFG 4C3HJ 2X6OA 1SANA 2R0QC 5EZHA
chains in the Genus database with same CATH superfamily
2EIMH 2RQPA 5EEAA 3S2HJ 5IPAA 1Y0NA 3W6KB 1H89C 1KQ9A 2DFFA 1WJCA 2V7FA 3BZCA 4KICA 3HOSA 1A36A 2KRCA 2ZCWA 2GLOA 4IHXA 4BDYA 2L9SA 3K4JA 4G12A 5J1RA 2GXAA 3LQRA 3S15J 4RB2C 2OTJI 2H6BA 3MKWB 3HRSA 1S6LA 4DGWB 2A6HF 3ZN0A 4G7OF 3TOBA 2IVMA 1UJ8A 2W48A 2DK5A 3VWBA 1FPQA 2K4JA 3GBGA 1FMVA 2A6TA 3S2DJ 1R58A 3BTLA 3V8LA 3IH3A 2XGCA 3MKYB 3HOXJ 1XMAA 1Y8QB 2FA5A 2E1NA 4U0WA 3CMMA 4HV6A 4P5OA 3SZGA 3DP7A 3JRIA 3PSIA 3VFZA 1I50J 4IRIA 4W1UA 2COMA 2NOGA 3H36A 5ERIA 2GOXB 3V8JA 1JKOC 3GTMJ 4A3BJ 4JX5A 3QAHA 5LHIA 4N9IA 4B44A 1HSTA 2IGNA 1SD7A 2JSPA 2VJIA 3H1CA 1T08B 5L3EA 5A2QZ 3V7RA 4BS9A 1HDPA 1IDYA 1D1BA 3GTLJ 3O8HA 2ESNA 2KL4A 5IT9K 1ETOA 3QOEA 4FE4A 4HX7A 3MEXA 3HUGA 3U1KA 1Z3XA 2GM4A 3OYCA 2BHYA 4AVZA 1OISA 3FXMA 2V26A 4XSXF 4CO8A 2Y9ZA 3BDDA 4ZDLA 1VQ4I 3E1SA 4NC8A 2NRAC 1Y8RB 2R7QA 2HNHA 1W5CC 2DTRA 3GO5A 2QBYA 4I76A 1WH7A 1ZGWA 3M8JA 3Q0VA 5M5WJ 2IGMA 2MBFA 1U78A 2XPVA 2FBIA 3KCCA 5F08A 3S1NJ 3S14J 2DOEA 3KYCB 5EYRA 4YG2F 3IHUA 4BH9A 4OINF 5M3MJ 2M8EA 2HS5A 1LE8B 1DU0A 1J5YA 1Z67A 2EV0A 3DPLC 1YG2A 2HKOA 2WAQA 2CYYA 3HSFA 5BS6A 1JE8A 4OAYA 1B59A 4P96A 2P7CB 2KJBA 1FT9A 1H9GA 3BQZA 1D8JA 5BNGA 4XICA 5ICFA 1QZZA 4KFCA 4B09A 1T8IA 4AM3A 2EFQA 1H8AC 1ON2A 2W84A 4M72A 4BY1J 1YJ9I 3E3VA 5EG0A 4HEA2 2OZ6A 4A0XA 2EILH 6PAXA 3MMYB 5B66C 4CCLA 4DBQA 2JVHA 2P81A 1ZR4A 2K27A 2D2WA 1HXDA 1R7JA 3CJQB 3DPTA 3H0GJ 2L4MA 4CZZA 4HF2A 3K1NA 2JK3A 3IH2A 2WB1N 2UV1A 3ZMDA 1VQ5I 2E5ZA 1OCPA 2JTVA 5GAGJ 4D0PA 1XS9A 3CJRB 4MFDA 1OCTC 2FMYA 1X1AA 2E1CA 4PJMA 2UXXA 4UNOA 1DP3A 4ESFA 3G1OA 1S7AA 3VYRB 2OU2A 1S72I 1IRXA 3BJ6A 2HYGD 5E18F 2NVXJ 3MAJA 2R5YA 2A5YB 5TJJA 1W5TA 1P2FA 5LRRA 1AKHA 3A03A 4B8XA 4PFOA 1TQMA 1S7EA 3HZJA 2OBPA 3G2BA 1T0FA 3REOA 1Z91A 3GLXA 3GX4X 3HL2A 2XAQA 2IP2A 3W2WA 2TDXA 5BMZA 1IXCA 1OQYA 3MD2A 3DV8A 4LLLA 2LY9A 2W85A 3CCUI 1F9NA 3GTKJ 2HPMA 4FHTA 4A3JJ 2ELKA 4QSHA 1IJWC 5F27A 4HZFA 4P9UA 4LGWA 2M5WA 4QIWN 3GTPJ 2FBKA 3DU5A 3GTQJ 2XRNA 4BY7J 3OIOA 3OYEA 5GP9A 1X1PA 2DQRA 1OCRH 4ZYAA 2HDCA 1E2XA 2MD5A 1IZ1A 4R8HA 2WAQN 2FJ1A 2WBMA 4DYQA 1ETKA 3LSIA 2IRFG 2VKDA 2TRTA 2NVQJ 1GV5A 5EGOB 1JUPA 3OYNA 3TO6A 2KT0A 2PN6A 4BDZA 4XLCA 1XDSA 4HOBA 2HDWA 2QM3A 3K9TA 3BJOA 3G6EI 4AIHA 2DA7A 3WTXC 1NG7A 2X6XA 3M7GA 2LF8A 3R61A 2XASA 2R7VA 5GAHJ 2F6CA 2MYSA 2RKHA 4C2TA 4XN3A 3H9GA 4HRIA 2BGCA 1XSXA 2CQKA 4P9FA 3A2KA 1X3UA 4HLXA 4XMYA 1UCRA 3CMEI 4F93B 3ABKH 2R5ZB 3OYJA 1U8BA 1RETA 3K2AA 2L7MP 1R1VA 1R5HA 3O3KA 5JHFA 2COBA 1OKRA 5K7ZA 2LSOA 3LSKA 5BQTA 2H1LA 4ETSA 1U9NA 2OQGA 2QF7A 3J7AY 3HTUA 1WJFA 4BNCA 1PUEE 2M0MA 1B72B 4A6DA 2IA0A 5IP6A 3PIPF 1QRYA 3BR1A 1VTNC 4CYCB 2XF7A 1IN6A 2YPRA 1MNEA 3Q9VA 1ZH5A 4JX6A 1JGGA 1OYWA 1X3ZB 3MWMA 3BZ6A 2HQNA 3F6VA 2P5KA 5HDKA 1V55H 4PGGA 2ACJA 3KP4A 5ICEA 4XLPF 3JRHA 2XF5A 3QWLA 4HX4A 3BOQA 1MMNA 4CDGA 1QHHD 3GZ6A 1B4AA 2DODA 5DM7F 3HC7A 4A3IJ 4IQ4A 1B8IA 1LFPA 1MGTA 3C7JA 4DZJA 3KZYA 3EYIA 1YJWI 5GTIC 2JRTA 3EUHA 1SD5A 4DYCA 5GAEJ 5AIQA 4A69C 2EPFA 1XGNA 1SFEA 3HSEA 3ABLH 4N0BA 2LD5A 2UZKA 5E3MA 1FBSA 1R1TA 3S32A 4I01A 1K79A 3ZQGA 1ONVA 2HDDA 1GVDA 5DTDA 1JI8A 1XSVA 1OCOH 2BXYA 2ZBKA 2IJLA 3K1PA 1L3LA 2XC7A 1YOVB 3LSMA 2E71A 3GUDA 3VYTB 4LB6B 1HA8A 3HOUJ 1R36A 2KISA 2MG4A 5CVVA 2K9LA 4EV0A 4ENKA 1S3JA 2KJCA 4DQ2A 1MD0A 2VODA 1RKWA 1Z6RA 3KP7A 2AQEA 1FOXA 3TMOA 5IP7J 2GXGA 1YRNB 3PJRA 2DAOA 4L5EA 4ESBA 5CVUA 3HRTA 1IO2A 2Y0SN 5F1RA 2A3SA 1DGRM 1R6RA 5F04A 3AFHA 1LB2A 3ZCOA 1AOYA 2IGKA 4YELA 3CDLA 2V9VA 4A3MJ 1Z9CA 1KU2A 2JPBA 2NVTJ 4RAZA 1RESA 2HXOA 2HVSA 1J7KA 3K7AJ 1BN5A 2X1EA 3F8NA 4UV8A 3FHZA 3ROUA 1XDUA 4GGGA 1LJ9A 4P55A 3HOVJ 2QYOA 5FLXZ 3CTAA 5CVJA 3GXOA 4A0ZA 5FLXK 2EWNA 2HOTA 3LSRA 4DZPA 4ENJA 2LVSA 1PUFA 5L3DA 2CU7A 3CJNA 3I54A 4G6QA 4RAFA 2FE3A 2IS1A 3L7WA 5CJ9A 3TKYA 1FIAA 3ZMTA 2NAZA 2V79A 1FYLA 1YS6A 2QGUA 5J1YA 2OD5A 2M9HA 3CC2I 2LLKA 4I99C 2Y48A 3D0SA 3M9AA 3WTTC 2QBYB 1LPQA 4MGRA 2IS6A 2H6CA 1W36D 3JCUC 5LHHA 2L5QA 2B9SA 2MLGA 4KN7X 2NOJB 1RR8C 1P9QC 1NTCA 3WTYC 4CXFA 1SD6A 3QYFA 1O3RA 1ERDA 2HR3A 3GWZA 1V5EA 2CQXA 2CS3A 1MNDA 2DMTA 2XB0X 4IPAA 3DKXA 2PMZA 4EJWA 3BG9A 2JA2A 2LG4A 5LHGA 3EETA 2QQAA 4DOZA 4EJTA 3OR1C 2HWVA 1TWGJ 1K6YA 1MH3A 4LLNA 1U2WA 1X1BA 2EZKA 2F5EA 1HQCA 4G6DA 1FBQA 2LNBA 1EF4A 1ZARA 5DD8A 2RNGA 4Y17A 4CCKA 1QVUA 3OY9A 3DXJF 3T5XA 3OL4A 2R93J 2DMQA 5BOXA 4EM0B 1T98A 1E17A 2LKXA 2E36A 2GIZA 3SQNA 5LFAA 2O5RA 3KPHA 4B3AA 5LGTA 2JSCA 3VPRA 3FXLA 3WTWC 3J7AO 1SMYF 1WH5A 2E2HJ 2Y69H 4LG0A 3CUOA 3ONQA 5KAIC 3OYMA 4GRIA 3D1NI 2EQRA 2PMHA 2M4GA 5EG0B 5L3GA 3PNYA 2CG4A 1A5JA 2QZ8A 4L5IA 1OLTA 2DBBA 2GA2A 1R23A 4A3GJ 3HOTA 3DEWA 2XDVA 1XB4A 2FF4A 3AG4H 3RQ4A 4L0ZB 2VB6A 5CLSA 1DQUA 3HRMA 1Q1HA 4XQFA 3JRBA 4AYBN 2WADA 3TW6A 2OZUA 3IAM2 4RMNA 3ZQLA 3QYEA 4EEFG 4C3HJ 2X6OA 4YFNF 4KYWA 1SANA 5HNFA 3RZOJ 1TQPA 5EZHA 1X2MA 2EB7A 3KZZA 1A31A 5FKNA 3TEDA 1SMTA 4WX9A 2R5YB 2MABA 4D5FA 2OAZA 2VJ5A 2HPIA 5FFZA 3UKGA 1YITI 4U7BA 1ZHFA 1AKHB 2M8GX 5HVQC 1G3SA 2L0KA 1WI3A 1PYVA 2EFPA 3KEOA 3ERMA 2K9MA 4E7SA 4CICA 4XM3A 3S17J 4XRSG 1FMWA 4HQMA 3DKWA 3ZMSA 2L2OA 3PFYA 4F7ZA 4OWRB 3QPHA 3L1PA 1WSUA 3Q3SA 2HOSA 3BCBA 5GPCA 1EH8A 1FP1D 3QPTA 1E3PA 2VC0A 2JMWA 1GVJA 1VZ0A 5IYCJ 4FCYA 2A05A 3CCYA 5EGOA 2V1NA 4CZCA 2PMZN 3X2QH 3GF2A 2FEZA 4NQWA 3K4KA 4WXDA 3H92A 4LFUA 2JQ7A 4KITB 1IG7A 2RVCA 3K4MA 4RM2A 5M5XJ 4GFBA 2LC2A 1UHWA 2O7OA 3A0BC 5B1AH 2W25A 4BE0A 2V6CA 2MGQA 4FX4A 3SHFA 2QUFA 1LEBA 4AC0A 4B47A 2PEXA 3VOEA 3M8FA 4XLNF 2IGOA 3BCAA 1P92A 3GZ5A 1MJ9A 2CQ7A 3ZMZA 4XKVA 4KJZA 3JRDA 1G3YA 2HFHA 4XKBA 1OPCA 3KE2A 3PQKA 4EQQA 2WY7Q 1O4XA 1P4AA 2XRLA 4MNUA 2LR8A 4A12A 1O3SA 4I2OA 2RN7A 3E6CC 4M73A 3TW7A 1YTYA 1L0OC 2QKLB 5J4VA 1SAXA 3BT9A 4WCGA 4RA2A 1ODDA 1ZKGA 1JGSA 5E17F 4RDUA 2RDPA 2ESHA 1D3YA 1CGPA 3SZTA 2KIFA 3E6DA 4CYCA 2XAFA 1VQ7I 3J80K 2DMPA 4AD9A 1IN4A 3JTHA 3I9V2 3CUQA 3KFWX 2XV4S 4E7HA 2MD0A 2F2EA 2PJRA 4HAMA 3RCOA 4IX7A 4M6VA 2MH9A 1Z7UA 4HW0A 1ZRFA 5LD2C 5EEGA 2EZHA 3L2CA 3RTRA 2ZJ2A 3JSPA 1V4RA 3VYUB 3HYIA 4EM1A 1TZLA 2X0LA 2DFEA 3ZQQA 4QPQA 1RC9A 4B3XA 4M71A 2V1XA 3FMRA 2JA7J 4KIFA 2RAEA 3CD6I 4PSWA 4MQ9F 1X1CA 2KP6A 4HSTA 1GT0C 2W1OA 1R4MB 1YIOA 3ASOH 4YIFA 1B8IB 2IAIA 5KK1A 5L3FA 2DO7A 3IWFA 3FBIB 3FM5A 4LLGF 1KYWA 2QVOA 4BXFA 2PX9A 2WY8Q 1DPUA 4O5VA 3KYDB 2NXNB 4II3A 4IXAA 5HS8A 3S1MJ 3VSKA 2AXLA 3P9KA 4EM2A 1MW7A 5D8KB 1I6XA 3Q9SA 2A61A 5K5QA 2GA1A 3DWLE 2R0QC 1V5FA 1D8KA 2DDAA 2Q2EA 5J6XA 3OSFA 1YRNA 4L18B 1YE9A 2H8WA 3S1RJ 1K83J 4E4HA 3JSOA 1FJLA 3WGHA 2IS4A 3I3LA 2BZTA 4U7DA 3T1BA 1VQMI 4IOAF 1G59A 4IJAA 4IL6C 3IRRA 1ZG5A 4FASD 3DEEA 3I71A 3A1YA 3K10A 2JN6A 3B6AA 3VDXA 3GFLA 1EV7A 4C3JJ 4AIKA 5JVGF 3G4SI 3S3MA 3CESA 4LOCA 2E2JJ 3PNVA 4M74A 1EH7A 4JBAA 2EA4A 2KZVA 3E7LA 4OIPF 3LAPA 1D0ZA 3FK7A 1VQOI 1A6IA 5A2QK 2VE8A 2WA0A 2ICWG 2CQQA 1FC3A 2FRHA 2KRHA 1RUOA 3BZKA 3KZIC 1W0TA 1PJRA 2FD5A 3AAFA 4BJ6C 2XSJC 3MKLA 3RPUD 1MMSA 3PM1A 1PUFB 4MEXF 2FOKA 2HQRA 4Y4RA 3GYHX 9ANTA 4RAGA 2QWWA 3JRGA 4CGZA 3OOUA 3DU6A 5J8FA 1YX5A 4XOTA 2R7RA 2CGPA 2RGVA 2AS5F 3S3OA 4KN4X 4PSXA 1D0YA 3WTSC 5IOZA 5JLXA 1HSJA 3G1LA 3LSHA 3V4GA 2VKHA 2NVUB 1P7IA 4F91B 2X6YA 1AWCA 3TO9A 1T6SA 5F64A 4BKXA 2QQ8A 3RKYA 1GHCA 2ZKZA 4CA0A 2OJED 3B6CA 3F0CA 3DBLB 3EUKL 2DA1A 2Y75A 2Y9YA 2VOOA 1W1WE 2HOAA 1MBKA 4XOPA 2VI6A 2Z33A 1HW2A 2DOFA 2X6WA 1I5ZA 1W7PD 2VJJA 2IA2A 2WWYA 3C18A 2DYRH 4N4OB 4CYDA 1RIOH 3K70D 1ZN2A 2ELHA 5CPRB 4QPOA 5CQEA 1MBFA 4XLAA 1TNTA 3KYLA 2BVLA 2OPTA 2XPWA 3D5RC 2F5VA 4IEJA 1W7PB 2L9VA 4BQQA 1VQLI 2F5DA 1JUMA 4OIOF 1TTYA 2PJPA 1IN7A 4JK1X 1XC5A 1JKPC 1IXSB 1XCVA 5E8GA 1WJAA 4LG0B 2VL8A 1OR7A 2DI3A 2DK8A 3H5RA 4ENNA 5HDNA 1ORKA 2X85A 2XHKA 5TGTA 5F0HA 1D1AA 4BL0B 2KDOA 1XMKA 3A01A 2F4MB 4GYIA 2XAJA 2XGDA 5H6RA 3E5QA 5D4RA 4G7ZF 2OC6A 4AU7A 4ZYGA 5J1UA 3U21A 3HOWJ 2ZSIB 5GPAA 3MZHA 1BC8C 1T56A 5E1XA 4U0YA 4A3FJ 3ZGKA 3CCLI 4HDVA 1KQ0A 1RPWA 1KYZA 3HHHA 3KEYA 2V6EA 1IAWA 4WWCA 1K4TA 3K4LA 3BG6A 3F6OA 3DFGA 5F0CA 3TGNA 2DFIA 3PL8A 3S3NA 1KONA 2LKSA 3WE2A 4MIMA 2P4WA 3A02A 3CC4I 1ZGAA 1Y0UA 4J00A 1OFCX 3FMSA 4A6EA 2Z9OA 1RI7A 1MJBA 4QTRA 3DCFA 4O3MA 1KU3A 1MZBA 1TNSA 3ECHA 5HS7A 1TP4A 4BYYA 1LQ1A 1HBXG 4L9VA 4CHUA 3R60A 1BBYA 2X51A 2OUMA 4XSZF 3SFZA 1JKRC 3MKZA 4KISA 3K1MA 4UY8I 2Q1ZB 1KA8A 3C2HA 1S8NA 3E6MA 4CCOA 5DD4A 4DNCA 4XK4A 3RYRA 4WXHA 1OYYA 3B73A 4NQWB 3K69A 4XRMA 4Q48A 1F36A 2R7DA 2DLLA 1YYVA 2XF6A 2ZFWA 1JT6A 4UVAA 4EJVA 3GZNB 3ZXSA 1W36C 1ETVA 5E79C 3VODA 3W2VA 2V4JC 4RAYA 2EFOA 3VSLA 3VB2A 1D5VA 1HW1A 3TBIA 3QP5A 4GYGA 3MCZA 5K7HA 1F43A 3U9GA 1DPRA 5DV5A 3HEFA 3M4OJ 2L9RA 1Z3YA 3BR0A 5CKTA 4E7JA 3R4KA 2VC1A 2H1KA 2G7UA 2CFOA 2DA5A 3LSGA 4OMZA 3N4MA 2M30A 3IWZA 1ACIA 2W4SA 1S9HA 2P0WA 1H0MA 4ZYEA 2W00A 4MFEA 3V8KA 5D4SA 2ZXJA 3QPLA 2HU9A 3I64A 3EQLF 5CVIA 2C6YA 3TO7A 3HGGA 1WJDA 4KIGA 3BROA 2JZYA 4YIIA 1G8XA 4X6AJ 1V54H 2GQQA 2LOOA 2P6TA 2K7LA 1X4PA 2M3AA 3D5SC 1TT0A 5B3SH 3HBLA 3FISA 1BR4A 5K5RA 5E3OA 2E35A 3C3WA 2VQCA 3K4NA 4M9ZA 3H3ZA 4UUTA 2R7WA 2R7OA 3KP2A 3AG2H 3CUQB 3EYYA 1WFXA 2I5UA 1REPC 3W6JB 1WZ2A 3IUOA 3KEQA 5FKKA 2VLAA 1BW6A 2PJRB 2STWA 1LFBA 1Z6TA 3H0DA 5AONA 2KIMA 4Z6YA 3TQNA 3PUFA 1XG1A 2NVYJ 4A5NA 4IVNA 2AQFA 4HQEA 4Y7NJ 2QQ9A 2V9PA 3BPVA 3C2BA 4RS8A 1XCBA 2RNJA 1O3QA 2E1MB 4A5MA 3OYBA 2WAEA 3CO7C 3HXLA 1BR1A 1VFCA 2D5VA 5E1WA 1JTYA 2VQLA 2DA2A 3HOZJ 2LBFB 3IC7A 1BOAA 1T0FC 1U9OA 1R4NB 3LFUA 1YHQI 2KKOA 2EZIA 2BY0A 2CFXA 2NS7A 3FXJA 2MC3A 3ZMUA 1Z21A 3BR5A 3O2PE 5FKMA 2LY1A 4HLYA 4MTEA 3OYDA 1X3WB 3SDBA 2ZSHB 4J01A 3OSGA 2X9DA 2BBYA 1Z77A 2XSDC 1IXRC 2CV2A 3ZRGA 5C3EJ 4L0YB 3CLOA 4F52A 3I53A 4RB0A 5ILVA 4Q5SF 2B7EA 2B0LA 3FHNA 4UB6C 3ABMH 5FLVA 2OQRA 2IW5A 3IKVA 2Q2EB 2LK2A 1MMDA 1SFXA 4HPQA 1SVMA 4NC6A 2ME0A 3IKTA 4NDLA 3OYFA 3QQAA 1ZTRA 1RUNA 3T8RA 3J7YJ 4HYEA 4X1EA 5KVRA 3RZDJ 4ZTFA 1J59A 2X4HA 2VBWA 1RKTA 4LK0F 1ULYA 4MHGA 2GWRA 1U5TA 2NNYA 2CW0F 3GTOJ 1VQKI 3OYIA 1MDMB 3WG7H 2HTSA 4II2A 2FXAA 4DYRA 2AXTC 4HG2A 1WGXA 3PNTA 3IP4B 2QA4I 4J19A 2KMUA 1O57A 2BXZA 3CF2A 1QQIA 2JRMA 4FT8A 1CF7A 1I1GA 2GAUA 4BJTA 4KIBA 1SVOA 2Q0OA 2OF7A 5BPIA 1SC7A 1JKQC 2Q8KA 1K78B 1FTZA 5M5YJ 4HBLA 3AKZA 3H9JA 3HSRA 1VI0A 3MQ0A 2Y0MA 2GOMA 5KAFC 1D0XA 4M9XA 4FE7A 2PFBA 2EJRA 2EBIA 4U87A 5HNHA 4ON0A 4RGUA 1PDNC 1FLIA 2M34A 1BIBA 5ILSA 4Y3OA 4RLFA 2VIXA 1SAUA 5D6EA 3W3CA 3RPUA 2R7XA 1XGMA 4RGRA 5F6FA 3QU3A 2P6SA 5CQGA 4Z2YA 2KPMA 5C4JJ 1HF0A 2EH3A 2MSYA 5TRDA 3L2RA 5E3NA 3RKWA 4A3EJ 2UUZA 2HXIA 2Z2SB 3QODA 2ZFUA 1F1ZA 1MIJA 4BE2A 4UUVA 2DTZA 2XROA 1QNTA 5LEKA 2LDUA 4N9HA 1HLVA 2F48A 3TL4X 3GTJJ 5J8CA 3EDPA 5IYBJ 1K6OA 4UB8C 2CUJA 4IHYA 2F5CA 3V7SA 2VT2A 2LFBA 3ZPLA 5J4YA 1DUXC 4KNYA 3BR6A 3FK6A 5H2FC 1AHDP 3GMEA 4MEYF 1VF9A 2A5WA 1W7PA 5JR3A 3WU1B 2R4GA 1TWFJ 2FNAA 2CQNA 4XRSA 4D7MA 3EUHC 5F1JA 3S2WA 2M87A 3FM3A 4D1QA 2RREA 1XD7A 1FX7A 4EATA 3CLQA 3OR2C 5HOOA 1K61A 2GXBA 2HQAA 3GW2A 2HEOA 2STTA 4G7HF 2ETHA 4BHCA 2VN2A 3DF8A 5F0FA 4BHPA 1VQ8I 4KUMA 4I7HA 5K5OA 1W0UA 1PP8F 2KDZA 4GO1A 2DU9A 1U8RA 4M3FA 3FXOA 4RM3A 4XLEA 3CMAI 2K9SA 3PSFA 3RJPA 5JFRA 4IHTA 4M3EA 2YU3A 2BW3A 3LQQA 1JXSA 4LK1F 3OV8A 2Y31A 1S5LC 3WG9A 5B5EC 3RIRA 3GLLA 5B1BH 1E3OC 1EKEA 2DPUA 2EV6A 3LA7A 4BBSJ 3A01B 3ZN1A 2ZMEA 1OMIA 2DMUA 2E1OA 2HQ5A 2P8TA 2X1CA 4YFKF 4HNUA 5DUIA 3Q5FA 4XLHA 4KA4A 1WCMJ 1QPMA 3HIFA 4A93J 2OTLI 1W4MA 2CMPA 4PJNA 2HOEA 3T0YA 4BXXJ 4NHJA 2EK5A 4O6JA 3DBHB 1EH6A 3ZQHA 2H09A 2Z5UA 3FF5A 3M8EA 5J3LA 3TDUC 4ABZA 4BEHB 4ZYDA 3OYKA 1P4WA 1BC7C 1XGSA 4GXOA 4L9JA 1WI9A 3LAJA 2DT7B 2DFHA 2VT3A 3DEUA 2VJ4A 2W57A 3H5AA 4L9TA 4WK8F 2VQGA 4V2FA 4NUBA 4ZDOA 1IDZA 1WPKA 4ZC3A 4OAZA 1WJ5A 1MMGA 1Z05A 2W82A 3IL2A 1HW5A 4UUSA 1ZLJA 3G1MA 4G8XA 4PGHA 1FOWA 3VYSB 4A3KJ 3QU6A 3E6BA 2ME6A 4HSRA 1Q1VA 2JJ7A 2RQQA 4A0YA 1X1DA 2CSOA 5LGNA 3CZ6A 1YW9A 3CCQI 4IZZA 4HF1A 3RKQA 2PI0A 1MBJA 1QA6A 1M1EB 1LUJB 2NYXA 1RRJA 1SD4A 2FOWA 2H8RA 4G9YA 4XLFA 2ELJA 2M7BA 3HRUA 3OS0A 1ZLKA 3W6VA 1YS7A 3BR3A 4L9NA 2PMUA 3KP6A 1BL0A 3WGIA 2I10A 4S04A 3BLYA 4M6XA 1NK3P 4DW6A 3OL3A 2L7FP 3F21A 2DN0A 1BJZA 1USSA 3RKXA 5FRNA 1SFOJ 3NEUA 3PUBA 5LGUA 1UB9A 1Y39A 1BJAA 3AG3H 3KLNA 5D5VB 2ECCA 3AL0B 1ZG1A 1J2XA 3NAUA 4RLQA 1J0RA 5LBQA 1U6GA 1IW7F 1JTXA 3K0LA 1YX3A 1HKTA 5E20A 3S16J 3NRVA 4JX4A 1ZR2A 3BWGA 1X19A 1MSEC 2O61A 4M3DA 2EA2A 4DBRA 1MKMA 2IA1A 2ID6A 1Z0XA 3L9FA 2UXNA 5EJCA 3JRAA 1G2HA 2W24A 3S1QJ 2VKVA 5FD5A 5E3LA 1OCZH 2D1HA 4V2GA 4A2UA 2GIVA 3K6GA 4QLCU 2K9NA 4OOIA 3G73A 1IN8A 1LVKA 1R1UA 4JYKA 2K86A 3DTEA 2JUGA 2Z1DA 4I0BA 3L2VA 1HKSA 2LBFA 1B6AA 2MFZA 1D1CA 4EVIA 4EGZA 1DDNA 2DA4A 3OYHA 3ZP5A 2R7SA 3I4PA 3FWEA 3CDIA 1IGNA 4PJLA 1BOBA 4AIDA 1B9MA 1TWAJ 1LKXA 4ITVA 4E7KA 4XONA 3L00A 1Y56A 2V1DA 3ML6A 3WU0A 2JA5J 3KETA 1RZ4A 3UNGC 5JI6A 1J75A 2VBZA 4PDKA 1IV6A 1ZRCA 1T95A 4CCNA 2AO9A 4LG3A 1HKQA 2UWMA 2Z3YA 2BY1A 3BTJA 4MLOA 4D7NA 4HX8A 4JP0A 2K3PA 2F5FA 3ABUA 3WHBA 2VONA 2BHZA 3BTIA 4B43A 1ZK8A 5DCMA 4ZJZA 4HA8A 1FBUA 5JHUA 1P6RA 1T33A 1VQ6I 1YO5C 4ENMA 4NB5A 3LFKA 2CUFA 3K4BA 3L09A 4FQGA 3SEQA 1FOYA 2L3DA 2L9NA 4MQVA 4C9YA 3JREA 2BY2A 4P1WA 4F3QA 1SVLA 5HDGA 1MDMA 1KGSA 4K2EA 5H20A 2IT0A 1BA5A 4IO9F 2QSGX 3DLAA 1NH3A 4QWQA 2HI3A 3C1DA 3FXRA 4ZDPA 2KIUA 5KHDA 1UFMA 1V5GA 3OIQA 5FLMJ 2YU9J 3FXKA 4DIQA 5HLTA 2RV8A 5HLGA 1U5TB 2CUZA 2LTPA 1BR2A 4AUXA 4IHSA 4U0VA 1K78A 2PBIA 4LJZF 2JA6J 3V42A 3V7CA 4PCQA 3F3XA 2M2EA 3SDGA 3I58A 5FJ8J 3BP8A 3IV5A 1B1BA 1LVAA 5KCMA 2R3SA 4CSWA 1CF7B 2J5PA 4CUGA 4BU2A 3M1EA 3M07A 4Y15A 2DJNA 2L54A 2WB1A 3WTUC 3A0HC 1STZA 1WHUA 1TLHB 4BXUA 3PO2J 3ZQFA 1A35A 4Y13A 5IT9Z 3VEPA 1MNMC 5IY5H 1XN7A 1QVTA 2EFWA 4IRGA 1VQ9I 1S7OA 2VASA 1R71A 3LSJA 1IRFA 2HGCA 1ZAOA 2E7XA 3CCJI 1K4SA 1FTTA 3BG3A 3B02A 3CUQC 4UXNA 3HB9A 5E1ZB 3CQZJ 5FFXA 5IT3A 3HKZA 1QBJA 1J09A 1UELB 4PFPA 2E19A 3KP5A 4BGDA 2M0CA 2Z99A 4D5CA 1FP2A 2E5NA 1ITYA 1R22A 4OMYA 1G6NA 1IRZA 2E1MC 3HPGA 1ZG3A 5HODA 1GV2A 1RNLA 3JAMZ 2DA6A 4HNTA 1QZEA 3P9CA 1W5SA 1IUFA 5DCFA 2K85A 1KU7A 3JAMK 3OYLA 2DXIA 4NC7A 1H9TA 3H5NA 3AG1H 1O3TA 2XUBA 1TW3A 2Y30A 4JQFA 2HYFA 5CYVA 1YLFA 1I3QJ 2Z16A 3P9IA 2HZTA 3DTKA 4AVPA 2Y2ZA 4C3IJ 3O6BB 4F55A 1LDJA 1UG0A 3PQJA 2D45A 4EJOA 5K1YA 2LY2A 3RYPA 4XKWA 3WU2C 5D5UB 2A6EF 2DT5A 2EIJH 2ZJRF 2R7ZJ 2FBHA 2WV1A 4IQJA 4XL9A 3A4CA 4HF0A 3L2UA 1N75A 4NBQA 4A3LJ 2L7ZA 2ZJQF 5HLIA 4S05A 2K4BA 3ERED 1ZQ3P 2K02A 4MO7A 2GBYA 1JT0A 2LH9A 2BW3B 3F72A 3OWTA 4ASNA 1LDKB 3FIWA 4XORA 5DDGA 2QENA 2VKEA 4PK4A 5DUKA 4F92B 1TC3C 3LOCA 1XMXA 4KMUX 4I09A 5IOYA 1G3WA 2CH0A 2FU4A 2V9KA 2ZMEB 3H3UA 3ULQB 5E8IA 2JVGA 3WTVC 3I59A 4Q47A 2O8XA 4IHWA 3LSTA 3ASNH 1BI0A 3FBNB 4BEHA 1FZPB 3P5JA 3ZQCA 2KFDA 3LA3A 4XR6A 2DCEA 1I39A 3R0AA 5H6QA 4FETA 3BC8A 3NQOA 4XNFA 4I6ZA 1Y6IA 2P5VA 3LSPA 5C4XJ 2ZNZA 3TP0A 4CCJA 5C44J 3HKZN 1GXQA 1LEAA 1GLNA 3MN2A 2BEOA 4UHTA 3TP3A 4BJ5C 5D5XB 1X2NA 2F4IA 2JWTA 3SFIA 5KNLA 1ZGJA 3QPSA 1RR7A 4GCVA 1JJ8C 5HLHA 3CF5F 1T2KA 3OIPA 1SFUA 4LB5A 2ZC2A 3CJTB 3JR9A 2NS0A 2X48A 5CVRA 4UVBA 1T39A 4S0HB 2L7KA 3OOPA 4RB3C 4UUSB 1XX5A 1ETWA 3W2AA 3QP6A 2X1DA 4XBFA 1IRGA 4CH7A 3GFJA 4E7LA 3CC7I 1O7LA 2QSHX 2FUG2 3RDIA 4YRVA 2O8KA 5HS9A 4WXCA 3QOPA 1TL8A 2FSWA 5FKLA 2R7FA 4AWXB 4A3DJ 3SEZA 1WVRA 3IAS2 3I4NJ 4M3GA 4PJJA 4UV9A 1UHMA 1WRJA 3HPHA 4KT5C 3CCVI 2P5LC 2MC4A 3M1CA 1R49A 4Y33A 1TWCJ 3ABTA 2DJIA 2FX0A 5L3BA 3I4MJ 1X4OA 1OCCH 5TISC 4IHVA 2VUMJ 2IXSA 4RB1A 3BQYA 4BQNA 1TWHJ 4X0GA 1JHFA 4WF2A 1BI3A 2NS8A 1QO0D 5ED4A 4H4KC 3U1DA 3ZOBA 3HHGA 3E5XA 3GEZA 5LEJA 2A69F 4HDUA 1YQAA 1ZYRF 2ZJPF 2DW4A 1MBHA 3LL7A 5DS9A 3F9KA 3G3ZA 4BQOA 2W7NA 3SXYA 2BY3A 3JRFA 2VBXA 4OU0A 4EGYA 4Q4ZF 3CCMI 2Y0SA 4IOCF 4A3CJ 4JOMA 5GADJ 4GDFA 2PLYA 2DPDA 4ESJA 2DT6A 4BACA 1JUSA 1OR7C 2LP0A 4BHBA 3LA2A 2MH2A 3GFMA 2K9QA 3S8PA 1D5YA 3COAC 2XIGA 3KLOA 1LFUP 1XTAA 2LF7A 2PQ8A 3F8BA 3HDDA 1VQPI 2ID3A 1QU3A 5FRMA 3LNQA 1Y1VJ 1JHHA 4M9SA 3LWFA 1GXPA 1AA7A 3N97A 3Q0UA 2I8DA 2D1VA 3FKIJ 1G3TA 3PIOF 3WE3A 3MFKA 2G7HA 2AHQA 3FKJA 1FNNA 2GZWA 2L01A 5DEQA 4BE1A 1OJLA 4HV5A 3T8TA 1U3EM 1NK2P 2XGEA 1UHSA 2CO5A 1E3HA 2A68F 2VPRA 2BOLA 2E60A 2O0YA 4OIQF 2XKOA 3FZVA 3O8GA 3ZQ7A 1BIAA 1H88C 2HZDA 4PJ0C 3EUAA 3IRQA 2G0EA 3EPZA 2XAHA 1TT5B 3MVPA 3FXUA 2DOAA 3SJMA 1EA3A 4TV7A 2XVCA 3E0JB 3JRCA 1NHAA 1IF1A 1LDDA 5DCMB 3I5UA 5FGMA 5LRSA 1XGOA 4YFXF 2IEKA 1DGWY 2BVMA 3BJAA 4FTHA 1A04A 3LMMA 3ELKA 3KP3A 2XGXA 5EEHA 5FO5A 3GTGJ 3WHCA 2YUSA 3BPXA 2IS2A 4LIUA 5J40A 3F8MA 2OCCH 2FQ3A 4CCMA 4XN0A 1MSFC 2HTJA 1XSDA 2ZXWH 3CP2A 3GVAA 4LIVA 3F8FA 2ZO4A 2O6GE 1KQ8A 3F8CA 3BG5A 2M7AA 1U0JA 4YEJA 3DQVC 2JUCA 4LMYA 4MTDA 1ENHA 3UR3C 3G71I 5M3FJ 1USTA 2E7WA 5K7FA 1VNDA 3E97A 1KU9A 4BAYA 4XRFA 3J81Z 1BI2A 1E0EA 1WJEA 3J81K 5ILUA 2XPUA 1UMQA 1HCRA 3WGGA 1FYKA 5FD6A 2KQRA 1FOKA 1WWXA 5ICGA 4RBOA 3AL0C 4AYBA 1CQTA 1G4DA 3OS2A 3FDYA 3J7ZI 2EV5A 2BYVE 2LYCA 5FROA 2N8GA 2QLZA 4G6TB 1FSHA 3H35A 4C2MJ 3HUGB 1PVEA 4IRHA 4L5JA 3SYTA 4IKFA 2HYJA 1YIJI 3S93A 2VQHA 1I3AA 4FX0A 1YW7A 1P4XA 3R6SA 1AU7A 5DM6F 1JJ6C 4FISA 2DDBA 2K5CA 2EIKH 4EJUA 1Z7LA 3OMYA 3WODF 2IPQX 1TBXA 3CCSI 4UVCA 1I27A 1LE8A 2ECBA 2CRGA 1FSEA 3ECOA 1GDTA 2DQLA 1EJ9A 3KX2A 1FWZA 1FEXA 2YSRA 3RSNA 3TOAA 3MZ8A 3DLLF 1HDDC 4I98B 4ANJA 2E2IJ 2ZB9A 3P7NA 3U2RA 1Y1WJ 2KHMA 2KRFA 5FKOA 2YX7A 4I0AA 1UG2A 3PO3J 1A6QA 2M45A 4C30A 3FMQA 1BW5A 2VXZA 1POGA 2OA4A 1OYIA 1VQNI 3NWSA 4BQAA 2QCOA 1K7AA 4C2UA 1QGPA 2YR2A 2MW8A 4M6YA 3BY6A 4G94A 2R7UA 2P7VB 3HG9A 4LD5A 1QHGA 2FNPA 3TDZC 1WJBA 2R7TA 3SZPA 3H3VK 4E7IA 1ZELA 1YJNI 3DTIA 3F22A 3C2GA 4E7ZA 3R0JA 4N4NB 1ETYA 1FIPA 1MBGA 3HGYA 4KMFA 3FX3A 3GFIA 1BM9A 1P7JA 3K4CA 1QPIA 1J9IA 2XB5A 4I02A 5ICCA 3ISPA 4ZZDA 1V3FA 1WKMA 2QKMB 2ZNYA 2QEXI 1XPXA 2L02A 3ZR8X 1U5TC 1R5GA 2JT1A 4U88A 4ZTJA 5D5WB 2PG4A 4ZZLA 1MMAA 2HKXA 3MZYA 1BI1A 3I59B 3PFIA 1F5TA 2H27A 4PZJA 3HM5A 4DJAA 3JTGA 1I6HJ 3NWTA 2L4AA 4B48A 1C0WA 2WAFA 3GCMA 2G9WA 1APLC 1I1SA 1DU6A 3F23A 2ZXHA 3ESWB 2FMLA 4NNJA 1MJAA 4W97A 5JVTA 2JPCA 5D8LB 4D9JA 2BV6A 4AIJA 3KIOA 3CCEI 2WC2A 2HVQA 3OS1A 2DYSH 3L2WA 3CMYA 3QRFF 4RGSA 2HVRA 2EFNA 4Y52J 4RGXA 4YIRX 3I0TA 2WV0A 5J47A 5L3CA 3HTSB 1ZREA 2ZXIA 2CW7A 3I56I 2B63J 4IF4A 2M1BA 2LREA 4ZYHA 3BG7A 5EF6A 3RPQA 1WQ2A 1YW8A 3QYBA 2DMNA 2O9LA 2J5OA 4KT6A 1YFHA 5GTHC 1N78A 2VBYA 1SEUA 1O7FA 3E5UA 2F4OB 4M3BA 3FXQA 1ZRDA 3RQIA 3JW4A 3OYAA 2CV1A 4EMSA 2E34A 2QQBA 3CO6C 1PP7U 2LMDA 4V19K 2NNNA 4E70A 4KDPA 1T38A 1ON1A 2OV7A 4XKCA 1F4KA 1LNWA 1KZHA 3H9QA 4BBRJ 2KIQA 3K70C 2ISYA 1R5ID 2K40A 2M4KA 3CCRI 2ISZA 2A07F 2R5ZA 2CW8A 2VPLA 1UAAA 2CWEA 2LKPA 1MH4A 1FYMA 5LLQA 2KLOA 1NG6A 2FQ4A 2QSFX 2V1UA 3DKYA 1N77A 3WTZA 1ETXA 1IC8A 2XKPA 4B4CA 4XIDA 2RC4A 4B1RA 2MLKA 5FB2A 1MBEA 5JLWA 2XAUA 2O3FA 2EZLA 3Q0WA 3RI4A 1B72A 2VOPA 5IYDJ 3J80Z 2H94A 1FY7A 4E6KG 4OIRF 1TQIA 3DBRB 2VE9A 1HC8A 4R79A 3OYGA 1S29A 4H0EA 1N25A 5EZGA 3BTCA 2IBDA 3N05A 2ADUA 2R92J 1IV8A 1TW2A 2ZMEC 1R9TJ 2CUEA 1R00A 3ZMVA 5IP9J 3K2ZA 3HJEA 3NARA 3M3YJ 2VXDA 2YX4A 2DA3A 5D6FA 3IH4A 1UZCA 2LRDA 1B9NA 1SFKA 1X58A 3D5LA 3ZQIA 1IUYA 1GUUA 1ETQA 2OCEA 2JA8J 1HOMA 5DYMA 5BPDA 3HOYJ 5EDNA 2XAGA 2YS9A 2TCTA 2K3FA 5AIPA 2WTEA 4BUPA 4ZH4F 1Z1DA 2CV0A 2MA3A 1IN5A 1YI2I 2CJJA 3I55I 1DP7P 3CDHA 4R1HA 3BR2A 4LITA 3DPUA 1QZYA 2EINH 2O03A 4HNVA 3L2QA 2KZGA 2BE5F 3CP8A 4PUSA
chains in the Genus database with same CATH topology
1X2MA 5EEAA 3OSGA 2X9DA 3S2HJ 4IHWA 5FKNA 5IPAA 1Z77A 3TEDA 2XSDC 1H89C 2R5YB 3ZQCA 4IHXA 2GLOA 4D5FA 3S15J 5J1RA 4G12A 5C3EJ 3UKGA 4I6ZA 1AKHB 2M8GX 5FLVA 3LSPA 5C4XJ 3TP0A 2LK2A 5C44J 2W48A 2L0KA 3HKZN 2ME0A 1WI3A 4NDLA 3QQAA 3MN2A 1ZTRA 3TP3A 1X2NA 3GBGA 2JWTA 4X1EA 3SFIA 4XRSG 3RZDJ 3S17J 3S2DJ 1RKTA 3QPSA 1RR7A 3BTLA 1JJ8C 3GTOJ 3IH3A 2XGCA 3Q3SA 3L1PA 3HOXJ 2HOSA 5GPCA 3JR9A 2X48A 2JMWA 5IYCJ 4FCYA 4S0HB 3CCYA 4DYRA 5EGOA 3JRIA 2PMZN 1WGXA 4UUSB 1I50J 4J19A 1ETWA 4W1UA 2NOGA 3GTMJ 1JKOC 4A3BJ 4JX5A 1IG7A 1JKQC 2OF7A 2O8KA 1FTZA 5M5XJ 5M5YJ 4GFBA 5FKLA 2O7OA 4A3DJ 1VI0A 1HDPA 1IDYA 3GTLJ 3O8HA 4FE7A 3I4NJ 4M3GA 2EBIA 1ETOA 4FE4A 2MGQA 2M34A 2GM4A 4AC0A 1TWCJ 2Y9ZA 2FX0A 3I4MJ 4IHVA 2VUMJ 3BQYA 1HF0A 1TWHJ 5C4JJ 4I76A 2EH3A 2MSYA 1WH7A 2NS8A 5E3NA 4A3EJ 2HXIA 3ZOBA 3JRDA 1ZGWA 3Q0VA 5M5WJ 1O4XA 1U78A 2DTZA 2XPVA 2XRLA 1MBHA 2LR8A 5DS9A 3JRFA 3TW7A 5F08A 1HLVA 3S1NJ 3GTJJ 3S14J 3BT9A 5IYBJ 1ZKGA 4IHYA 4RDUA 5EYRA 2LFBA 4A3CJ 3BR6A 4CYCA 5M3MJ 1LE8B 1DU0A 3FK6A 1JUSA 1AHDP 2DMPA 2LP0A 1VF9A 1TWFJ 2K9QA 1D5YA 4XRSA 3BQZA 4D7MA 5F1JA 1LFUP 4M6VA 3HDDA 5BNGA 4XICA 2ID3A 2EZHA 1K61A 3LNQA 1Y1VJ 3Q0UA 1H8AC 5F0FA 4BY1J 3FKIJ 1W0UA 5EG0A 2KDZA 2JA7J 2AHQA 4M3FA 2RAEA 2K9SA 4M3EA 1OJLA 2P81A 1ZR4A 1GT0C 1NK2P 2XGEA 1UHSA 2Y31A 1B8IB 2IAIA 3H0GJ 2VPRA 1E3OC 2JK3A 3IH2A 2WB1N 3O8GA 4BBSJ 3A01B 1OCPA 1XS9A 1H88C 2HQ5A 2DMUA 2E1OA 4MFDA 1OCTC 2G0EA 1WCMJ 3G1OA 4A93J 3S1MJ 3MVPA 2NVXJ 2R5YA 3SJMA 4BXXJ 3JRCA 1AKHA 3A03A 3ZQHA 1S7EA 3OSFA 1YRNA 2IEKA 5J3LA 4FTHA 4ABZA 3S1RJ 1K83J 3GTGJ 1FJLA 3WHCA 2YUSA 2LY9A 1MSFC 3GTKJ 4V2FA 4A3JJ 2JN6A 1IDZA 2ELKA 1WPKA 3B6AA 4QSHA 1IJWC 5F27A 4C3JJ 3BG5A 4UUSA 4LOCA 3G1MA 4QIWN 3GTPJ 2E2JJ 3GTQJ 4BY7J 3OIOA 1ENHA 4A3KJ 5GP9A 5M3FJ 2ME6A 5K7FA 1VNDA 1Q1VA 3E7LA 2JJ7A 2WAQN 2FJ1A 4DYQA 3FK7A 1ETKA 1A6IA 2TRTA 2NVQJ 1GV5A 5EGOB 1JUPA 2XPUA 3RKQA 1UMQA 2CQQA 1HCRA 1MBJA 2KT0A 4RBOA 1CQTA 1W0TA 2H8RA 2DA7A 2FD5A 3MKLA 2N8GA 3PM1A 1PUFB 3W6VA 3BR3A 9ANTA 3JRGA 4C2MJ 3OOUA 1BL0A 2I10A 2HYJA 4DW6A 1NK3P 2L7FP 2DN0A 1AU7A 1BJZA 5JLXA 5IOZA 3G1LA 1JJ6C 4FISA 2R5ZB 1P7IA 1U8BA 1SFOJ 1RETA 3K2AA 2L7MP 4BKXA 2COBA 5K7ZA 1LE8A 2ECCA 2ECBA 2CRGA 3B6CA 3F0CA 3NAUA 1U9NA 2DA1A 2QF7A 1GDTA 2Y9YA 1JTXA 2HOAA 1MBKA 2VI6A 1FEXA 3S16J 4JX4A 1ZR2A 1MSEC 1HDDC 1B72B 2E2IJ 2ZB9A 4M3DA 5IP6A 2ID6A 1Z0XA 1Y1WJ 5FKOA 1QRYA 3JRAA 1UG2A 3BR1A 3PO3J 4CYCB 1G2HA 3S1QJ 2VKVA 1MBFA 1BW5A 2OPTA 2XPWA 1POGA 4JX6A 1JGGA 5E3LA 4IEJA 4V2GA 2QCOA 2K9NA 2MW8A 1JUMA 4JYKA 3JRHA 1XC5A 1JKPC 3H3VK 2DA4A 1IGNA 4A3IJ 1B8IA 1TWAJ 3HGYA 1ETYA 1ORKA 1MBGA 1FIPA 4DZJA 5F0HA 1P7JA 1QPIA 2XB5A 4DYCA 3A01A 2JA5J 3RZOJ 2XGDA 4A69C 1IV6A 5J1UA 3HOWJ 5GPAA 2AO9A 2LD5A 5E3MA 1T56A 3BTJA 4MLOA 3ZQGA 4D7NA 2HDDA 4JP0A 4A3FJ 3WHBA 1GVDA 3BTIA 5DTDA 1ZK8A 1RPWA 3HM5A 1I6HJ 1T33A 5F0CA 2CUFA 1APLC 3HOUJ 2MG4A 1DU6A 3JREA 4MIMA 3A02A 1RKWA 4W97A 1OFCX 1BA5A 4QTRA 5IP7J 3DCFA 1YRNB 4L5EA 2HI3A 2Y0SN 5FLMJ 2YU9J 5F04A 2LTPA 4AUXA 1JKRC 3CMYA 4Y52J 2JA6J 3CDLA 4A3MJ 2M2EA 3SDGA 4XK4A 5FJ8J 3IV5A 2B63J 2NVTJ 1RESA 2HXOA 4XRMA 3K7AJ 5EF6A 1F36A 2O9LA 2DMNA 2DJNA 3HOVJ 1JT6A 1ETVA 4M3BA 3RQIA 3PO2J 3ZQFA 2HOTA 3LSRA 4DZPA 5K7HA 2LVSA 1MNMC 1PUFA 1F43A 2CU7A 1QVTA 3HEFA 3M4OJ 3LSJA 1FIAA 2L9RA 3BR0A 1FTTA 3BG3A 5J1YA 2H1KA 2DA5A 3LSGA 2M9HA 2LLKA 3HB9A 4BBRJ 3CQZJ 2K40A 2R5ZA 4MFEA 1MH4A 2E19A 3QPLA 2M0CA 4D5CA 2FQ4A 1ITYA 1NTCA 3HGGA 1IRZA 1ETXA 1IC8A 4B4CA 4XIDA 4X6AJ 2CQXA 5HODA 1GV2A 2DMTA 2XB0X 4B1RA 2DA6A 3HBLA 1MBEA 3FISA 5JLWA 1IUFA 3BG9A 5E3OA 2EZLA 3Q0WA 1B72A 5IYDJ 1TWGJ 1MH3A 4UUTA 2EZKA 1EF4A 2Y30A 1QVUA 5EZGA 3BTCA 2IBDA 2R93J 5FKKA 1I3QJ 1BW6A 2DMQA 2R92J 1LFBA 2Y2ZA 1R9TJ 2CUEA 4C3IJ 2LKXA 5IP9J 3NARA 3M3YJ 1XG1A 2NVYJ 4B3AA 2DA3A 3IH4A 4Y7NJ 3VPRA 3C2BA 1WH5A 2E2HJ 2R7ZJ 2WV1A 1X58A 3ZQIA 1VFCA 3D1NI 2D5VA 2EQRA 1JTYA 1GUUA 5EG0B 1ETQA 2DA2A 2JA8J 4A3LJ 1HOMA 2L7ZA 1A5JA 3HOZJ 3HOYJ 5EDNA 1ZQ3P 4MO7A 2GBYA 2YS9A 1JT0A 4A3GJ 1U9OA 2TCTA 3DEWA 2EZIA 2NS7A 3FIWA 3JRBA 2CJJA 3BR5A 2VKEA 1TC3C 4AYBN 3LOCA 5FKMA 3TW6A 3BR2A 5IOYA 4HNVA 3ZQLA 4EEFG 4C3HJ 2X6OA 1SANA 2R0QC 5EZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2M A;  5EEA A;  3OSG A;  2X9D A;  3S2H J;  4IHW A;  5FKN A;  5IPA A;  1Z77 A;  3TED A;  2XSD C;  1H89 C;  2R5Y B;  3ZQC A;  4IHX A;  2GLO A;  4D5F A;  3S15 J;  5J1R A;  4G12 A;  5C3E J;  3UKG A;  4I6Z A;  1AKH B;  2M8G X;  5FLV A;  3LSP A;  5C4X J;  3TP0 A;  2LK2 A;  5C44 J;  2W48 A;  2L0K A;  3HKZ N;  2ME0 A;  1WI3 A;  4NDL A;  3QQA A;  3MN2 A;  1ZTR A;  3TP3 A;  1X2N A;  3GBG A;  2JWT A;  4X1E A;  3SFI A;  4XRS G;  3RZD J;  3S17 J;  3S2D J;  1RKT A;  3QPS A;  1RR7 A;  3BTL A;  1JJ8 C;  3GTO J;  3IH3 A;  2XGC A;  3Q3S A;  3L1P A;  3HOX J;  2HOS A;  5GPC A;  3JR9 A;  2X48 A;  2JMW A;  5IYC J;  4FCY A;  4S0H B;  3CCY A;  4DYR A;  5EGO A;  3JRI A;  2PMZ N;  1WGX A;  4UUS B;  1I50 J;  4J19 A;  1ETW A;  4W1U A;  2NOG A;  3GTM J;  1JKO C;  4A3B J;  4JX5 A;  1IG7 A;  1JKQ C;  2OF7 A;  2O8K A;  1FTZ A;  5M5X J;  5M5Y J;  4GFB A;  5FKL A;  2O7O A;  4A3D J;  1VI0 A;  1HDP A;  1IDY A;  3GTL J;  3O8H A;  4FE7 A;  3I4N J;  4M3G A;  2EBI A;  1ETO A;  4FE4 A;  2MGQ A;  2M34 A;  2GM4 A;  4AC0 A;  1TWC J;  2Y9Z A;  2FX0 A;  3I4M J;  4IHV A;  2VUM J;  3BQY A;  1HF0 A;  1TWH J;  5C4J J;  4I76 A;  2EH3 A;  2MSY A;  1WH7 A;  2NS8 A;  5E3N A;  4A3E J;  2HXI A;  3ZOB A;  3JRD A;  1ZGW A;  3Q0V A;  5M5W J;  1O4X A;  1U78 A;  2DTZ A;  2XPV A;  2XRL A;  1MBH A;  2LR8 A;  5DS9 A;  3JRF A;  3TW7 A;  5F08 A;  1HLV A;  3S1N J;  3GTJ J;  3S14 J;  3BT9 A;  5IYB J;  1ZKG A;  4IHY A;  4RDU A;  5EYR A;  2LFB A;  4A3C J;  3BR6 A;  4CYC A;  5M3M J;  1LE8 B;  1DU0 A;  3FK6 A;  1JUS A;  1AHD P;  2DMP A;  2LP0 A;  1VF9 A;  1TWF J;  2K9Q A;  1D5Y A;  4XRS A;  3BQZ A;  4D7M A;  5F1J A;  1LFU P;  4M6V A;  3HDD A;  5BNG A;  4XIC A;  2ID3 A;  2EZH A;  1K61 A;  3LNQ A;  1Y1V J;  3Q0U A;  1H8A C;  5F0F A;  4BY1 J;  3FKI J;  1W0U A;  5EG0 A;  2KDZ A;  2JA7 J;  2AHQ A;  4M3F A;  2RAE A;  2K9S A;  4M3E A;  1OJL A;  2P81 A;  1ZR4 A;  1GT0 C;  1NK2 P;  2XGE A;  1UHS A;  2Y31 A;  1B8I B;  2IAI A;  3H0G J;  2VPR A;  1E3O C;  2JK3 A;  3IH2 A;  2WB1 N;  3O8G A;  4BBS J;  3A01 B;  1OCP A;  1XS9 A;  1H88 C;  2HQ5 A;  2DMU A;  2E1O A;  4MFD A;  1OCT C;  2G0E A;  1WCM J;  3G1O A;  4A93 J;  3S1M J;  3MVP A;  2NVX J;  2R5Y A;  3SJM A;  4BXX J;  3JRC A;  1AKH A;  3A03 A;  3ZQH A;  1S7E A;  3OSF A;  1YRN A;  2IEK A;  5J3L A;  4FTH A;  4ABZ A;  3S1R J;  1K83 J;  3GTG J;  1FJL A;  3WHC A;  2YUS A;  2LY9 A;  1MSF C;  3GTK J;  4V2F A;  4A3J J;  2JN6 A;  1IDZ A;  2ELK A;  1WPK A;  3B6A A;  4QSH A;  1IJW C;  5F27 A;  4C3J J;  3BG5 A;  4UUS A;  4LOC A;  3G1M A;  4QIW N;  3GTP J;  2E2J J;  3GTQ J;  4BY7 J;  3OIO A;  1ENH A;  4A3K J;  5GP9 A;  5M3F J;  2ME6 A;  5K7F A;  1VND A;  1Q1V A;  3E7L A;  2JJ7 A;  2WAQ N;  2FJ1 A;  4DYQ A;  3FK7 A;  1ETK A;  1A6I A;  2TRT A;  2NVQ J;  1GV5 A;  5EGO B;  1JUP A;  2XPU A;  3RKQ A;  1UMQ A;  2CQQ A;  1HCR A;  1MBJ A;  2KT0 A;  4RBO A;  1CQT A;  1W0T A;  2H8R A;  2DA7 A;  2FD5 A;  3MKL A;  2N8G A;  3PM1 A;  1PUF B;  3W6V A;  3BR3 A;  9ANT A;  3JRG A;  4C2M J;  3OOU A;  1BL0 A;  2I10 A;  2HYJ A;  4DW6 A;  1NK3 P;  2L7F P;  2DN0 A;  1AU7 A;  1BJZ A;  5JLX A;  5IOZ A;  3G1L A;  1JJ6 C;  4FIS A;  2R5Z B;  1P7I A;  1U8B A;  1SFO J;  1RET A;  3K2A A;  2L7M P;  4BKX A;  2COB A;  5K7Z A;  1LE8 A;  2ECC A;  2ECB A;  2CRG A;  3B6C A;  3F0C A;  3NAU A;  1U9N A;  2DA1 A;  2QF7 A;  1GDT A;  2Y9Y A;  1JTX A;  2HOA A;  1MBK A;  2VI6 A;  1FEX A;  3S16 J;  4JX4 A;  1ZR2 A;  1MSE C;  1HDD C;  1B72 B;  2E2I J;  2ZB9 A;  4M3D A;  5IP6 A;  2ID6 A;  1Z0X A;  1Y1W J;  5FKO A;  1QRY A;  3JRA A;  1UG2 A;  3BR1 A;  3PO3 J;  4CYC B;  1G2H A;  3S1Q J;  2VKV A;  1MBF A;  1BW5 A;  2OPT A;  2XPW A;  1POG A;  4JX6 A;  1JGG A;  5E3L A;  4IEJ A;  4V2G A;  2QCO A;  2K9N A;  2MW8 A;  1JUM A;  4JYK A;  3JRH A;  1XC5 A;  1JKP C;  3H3V K;  2DA4 A;  1IGN A;  4A3I J;  1B8I A;  1TWA J;  3HGY A;  1ETY A;  1ORK A;  1MBG A;  1FIP A;  4DZJ A;  5F0H A;  1P7J A;  1QPI A;  2XB5 A;  4DYC A;  3A01 A;  2JA5 J;  3RZO J;  2XGD A;  4A69 C;  1IV6 A;  5J1U A;  3HOW J;  5GPA A;  2AO9 A;  2LD5 A;  5E3M A;  1T56 A;  3BTJ A;  4MLO A;  3ZQG A;  4D7N A;  2HDD A;  4JP0 A;  4A3F J;  3WHB A;  1GVD A;  3BTI A;  5DTD A;  1ZK8 A;  1RPW A;  3HM5 A;  1I6H J;  1T33 A;  5F0C A;  2CUF A;  1APL C;  3HOU J;  2MG4 A;  1DU6 A;  3JRE A;  4MIM A;  3A02 A;  1RKW A;  4W97 A;  1OFC X;  1BA5 A;  4QTR A;  5IP7 J;  3DCF A;  1YRN B;  4L5E A;  2HI3 A;  2Y0S N;  5FLM J;  2YU9 J;  5F04 A;  2LTP A;  4AUX A;  1JKR C;  3CMY A;  4Y52 J;  2JA6 J;  3CDL A;  4A3M J;  2M2E A;  3SDG A;  4XK4 A;  5FJ8 J;  3IV5 A;  2B63 J;  2NVT J;  1RES A;  2HXO A;  4XRM A;  3K7A J;  5EF6 A;  1F36 A;  2O9L A;  2DMN A;  2DJN A;  3HOV J;  1JT6 A;  1ETV A;  4M3B A;  3RQI A;  3PO2 J;  3ZQF A;  2HOT A;  3LSR A;  4DZP A;  5K7H A;  2LVS A;  1MNM C;  1PUF A;  1F43 A;  2CU7 A;  1QVT A;  3HEF A;  3M4O J;  3LSJ A;  1FIA A;  2L9R A;  3BR0 A;  1FTT A;  3BG3 A;  5J1Y A;  2H1K A;  2DA5 A;  3LSG A;  2M9H A;  2LLK A;  3HB9 A;  4BBR J;  3CQZ J;  2K40 A;  2R5Z A;  4MFE A;  1MH4 A;  2E19 A;  3QPL A;  2M0C A;  4D5C A;  2FQ4 A;  1ITY A;  1NTC A;  3HGG A;  1IRZ A;  1ETX A;  1IC8 A;  4B4C A;  4XID A;  4X6A J;  2CQX A;  5HOD A;  1GV2 A;  2DMT A;  2XB0 X;  4B1R A;  2DA6 A;  3HBL A;  1MBE A;  3FIS A;  5JLW A;  1IUF A;  3BG9 A;  5E3O A;  2EZL A;  3Q0W A;  1B72 A;  5IYD J;  1TWG J;  1MH3 A;  4UUT A;  2EZK A;  1EF4 A;  2Y30 A;  1QVU A;  5EZG A;  3BTC A;  2IBD A;  2R93 J;  5FKK A;  1I3Q J;  1BW6 A;  2DMQ A;  2R92 J;  1LFB A;  2Y2Z A;  1R9T J;  2CUE A;  4C3I J;  2LKX A;  5IP9 J;  3NAR A;  3M3Y J;  1XG1 A;  2NVY J;  4B3A A;  2DA3 A;  3IH4 A;  4Y7N J;  3VPR A;  3C2B A;  1WH5 A;  2E2H J;  2R7Z J;  2WV1 A;  1X58 A;  3ZQI A;  1VFC A;  3D1N I;  2D5V A;  2EQR A;  1JTY A;  1GUU A;  5EG0 B;  1ETQ A;  2DA2 A;  2JA8 J;  4A3L J;  1HOM A;  2L7Z A;  1A5J A;  3HOZ J;  3HOY J;  5EDN A;  1ZQ3 P;  4MO7 A;  2GBY A;  2YS9 A;  1JT0 A;  4A3G J;  1U9O A;  2TCT A;  3DEW A;  2EZI A;  2NS7 A;  3FIW A;  3JRB A;  2CJJ A;  3BR5 A;  2VKE A;  1TC3 C;  4AYB N;  3LOC A;  5FKM A;  3TW6 A;  3BR2 A;  5IOY A;  4HNV A;  3ZQL A;  4EEF G;  4C3H J;  2X6O A;  1SAN A;  2R0Q C;  5EZH A; 
#chains in the Genus database with same CATH topology
 2EIM H;  2RQP A;  5EEA A;  3S2H J;  5IPA A;  1Y0N A;  3W6K B;  1H89 C;  1KQ9 A;  2DFF A;  1WJC A;  2V7F A;  3BZC A;  4KIC A;  3HOS A;  1A36 A;  2KRC A;  2ZCW A;  2GLO A;  4IHX A;  4BDY A;  2L9S A;  3K4J A;  4G12 A;  5J1R A;  2GXA A;  3LQR A;  3S15 J;  4RB2 C;  2OTJ I;  2H6B A;  3MKW B;  3HRS A;  1S6L A;  4DGW B;  2A6H F;  3ZN0 A;  4G7O F;  3TOB A;  2IVM A;  1UJ8 A;  2W48 A;  2DK5 A;  3VWB A;  1FPQ A;  2K4J A;  3GBG A;  1FMV A;  2A6T A;  3S2D J;  1R58 A;  3BTL A;  3V8L A;  3IH3 A;  2XGC A;  3MKY B;  3HOX J;  1XMA A;  1Y8Q B;  2FA5 A;  2E1N A;  4U0W A;  3CMM A;  4HV6 A;  4P5O A;  3SZG A;  3DP7 A;  3JRI A;  3PSI A;  3VFZ A;  1I50 J;  4IRI A;  4W1U A;  2COM A;  2NOG A;  3H36 A;  5ERI A;  2GOX B;  3V8J A;  1JKO C;  3GTM J;  4A3B J;  4JX5 A;  3QAH A;  5LHI A;  4N9I A;  4B44 A;  1HST A;  2IGN A;  1SD7 A;  2JSP A;  2VJI A;  3H1C A;  1T08 B;  5L3E A;  5A2Q Z;  3V7R A;  4BS9 A;  1HDP A;  1IDY A;  1D1B A;  3GTL J;  3O8H A;  2ESN A;  2KL4 A;  5IT9 K;  1ETO A;  3QOE A;  4FE4 A;  4HX7 A;  3MEX A;  3HUG A;  3U1K A;  1Z3X A;  2GM4 A;  3OYC A;  2BHY A;  4AVZ A;  1OIS A;  3FXM A;  2V26 A;  4XSX F;  4CO8 A;  2Y9Z A;  3BDD A;  4ZDL A;  1VQ4 I;  3E1S A;  4NC8 A;  2NRA C;  1Y8R B;  2R7Q A;  2HNH A;  1W5C C;  2DTR A;  3GO5 A;  2QBY A;  4I76 A;  1WH7 A;  1ZGW A;  3M8J A;  3Q0V A;  5M5W J;  2IGM A;  2MBF A;  1U78 A;  2XPV A;  2FBI A;  3KCC A;  5F08 A;  3S1N J;  3S14 J;  2DOE A;  3KYC B;  5EYR A;  4YG2 F;  3IHU A;  4BH9 A;  4OIN F;  5M3M J;  2M8E A;  2HS5 A;  1LE8 B;  1DU0 A;  1J5Y A;  1Z67 A;  2EV0 A;  3DPL C;  1YG2 A;  2HKO A;  2WAQ A;  2CYY A;  3HSF A;  5BS6 A;  1JE8 A;  4OAY A;  1B59 A;  4P96 A;  2P7C B;  2KJB A;  1FT9 A;  1H9G A;  3BQZ A;  1D8J A;  5BNG A;  4XIC A;  5ICF A;  1QZZ A;  4KFC A;  4B09 A;  1T8I A;  4AM3 A;  2EFQ A;  1H8A C;  1ON2 A;  2W84 A;  4M72 A;  4BY1 J;  1YJ9 I;  3E3V A;  5EG0 A;  4HEA 2;  2OZ6 A;  4A0X A;  2EIL H;  6PAX A;  3MMY B;  5B66 C;  4CCL A;  4DBQ A;  2JVH A;  2P81 A;  1ZR4 A;  2K27 A;  2D2W A;  1HXD A;  1R7J A;  3CJQ B;  3DPT A;  3H0G J;  2L4M A;  4CZZ A;  4HF2 A;  3K1N A;  2JK3 A;  3IH2 A;  2WB1 N;  2UV1 A;  3ZMD A;  1VQ5 I;  2E5Z A;  1OCP A;  2JTV A;  5GAG J;  4D0P A;  1XS9 A;  3CJR B;  4MFD A;  1OCT C;  2FMY A;  1X1A A;  2E1C A;  4PJM A;  2UXX A;  4UNO A;  1DP3 A;  4ESF A;  3G1O A;  1S7A A;  3VYR B;  2OU2 A;  1S72 I;  1IRX A;  3BJ6 A;  2HYG D;  5E18 F;  2NVX J;  3MAJ A;  2R5Y A;  2A5Y B;  5TJJ A;  1W5T A;  1P2F A;  5LRR A;  1AKH A;  3A03 A;  4B8X A;  4PFO A;  1TQM A;  1S7E A;  3HZJ A;  2OBP A;  3G2B A;  1T0F A;  3REO A;  1Z91 A;  3GLX A;  3GX4 X;  3HL2 A;  2XAQ A;  2IP2 A;  3W2W A;  2TDX A;  5BMZ A;  1IXC A;  1OQY A;  3MD2 A;  3DV8 A;  4LLL A;  2LY9 A;  2W85 A;  3CCU I;  1F9N A;  3GTK J;  2HPM A;  4FHT A;  4A3J J;  2ELK A;  4QSH A;  1IJW C;  5F27 A;  4HZF A;  4P9U A;  4LGW A;  2M5W A;  4QIW N;  3GTP J;  2FBK A;  3DU5 A;  3GTQ J;  2XRN A;  4BY7 J;  3OIO A;  3OYE A;  5GP9 A;  1X1P A;  2DQR A;  1OCR H;  4ZYA A;  2HDC A;  1E2X A;  2MD5 A;  1IZ1 A;  4R8H A;  2WAQ N;  2FJ1 A;  2WBM A;  4DYQ A;  1ETK A;  3LSI A;  2IRF G;  2VKD A;  2TRT A;  2NVQ J;  1GV5 A;  5EGO B;  1JUP A;  3OYN A;  3TO6 A;  2KT0 A;  2PN6 A;  4BDZ A;  4XLC A;  1XDS A;  4HOB A;  2HDW A;  2QM3 A;  3K9T A;  3BJO A;  3G6E I;  4AIH A;  2DA7 A;  3WTX C;  1NG7 A;  2X6X A;  3M7G A;  2LF8 A;  3R61 A;  2XAS A;  2R7V A;  5GAH J;  2F6C A;  2MYS A;  2RKH A;  4C2T A;  4XN3 A;  3H9G A;  4HRI A;  2BGC A;  1XSX A;  2CQK A;  4P9F A;  3A2K A;  1X3U A;  4HLX A;  4XMY A;  1UCR A;  3CME I;  4F93 B;  3ABK H;  2R5Z B;  3OYJ A;  1U8B A;  1RET A;  3K2A A;  2L7M P;  1R1V A;  1R5H A;  3O3K A;  5JHF A;  2COB A;  1OKR A;  5K7Z A;  2LSO A;  3LSK A;  5BQT A;  2H1L A;  4ETS A;  1U9N A;  2OQG A;  2QF7 A;  3J7A Y;  3HTU A;  1WJF A;  4BNC A;  1PUE E;  2M0M A;  1B72 B;  4A6D A;  2IA0 A;  5IP6 A;  3PIP F;  1QRY A;  3BR1 A;  1VTN C;  4CYC B;  2XF7 A;  1IN6 A;  2YPR A;  1MNE A;  3Q9V A;  1ZH5 A;  4JX6 A;  1JGG A;  1OYW A;  1X3Z B;  3MWM A;  3BZ6 A;  2HQN A;  3F6V A;  2P5K A;  5HDK A;  1V55 H;  4PGG A;  2ACJ A;  3KP4 A;  5ICE A;  4XLP F;  3JRH A;  2XF5 A;  3QWL A;  4HX4 A;  3BOQ A;  1MMN A;  4CDG A;  1QHH D;  3GZ6 A;  1B4A A;  2DOD A;  5DM7 F;  3HC7 A;  4A3I J;  4IQ4 A;  1B8I A;  1LFP A;  1MGT A;  3C7J A;  4DZJ A;  3KZY A;  3EYI A;  1YJW I;  5GTI C;  2JRT A;  3EUH A;  1SD5 A;  4DYC A;  5GAE J;  5AIQ A;  4A69 C;  2EPF A;  1XGN A;  1SFE A;  3HSE A;  3ABL H;  4N0B A;  2LD5 A;  2UZK A;  5E3M A;  1FBS A;  1R1T A;  3S32 A;  4I01 A;  1K79 A;  3ZQG A;  1ONV A;  2HDD A;  1GVD A;  5DTD A;  1JI8 A;  1XSV A;  1OCO H;  2BXY A;  2ZBK A;  2IJL A;  3K1P A;  1L3L A;  2XC7 A;  1YOV B;  3LSM A;  2E71 A;  3GUD A;  3VYT B;  4LB6 B;  1HA8 A;  3HOU J;  1R36 A;  2KIS A;  2MG4 A;  5CVV A;  2K9L A;  4EV0 A;  4ENK A;  1S3J A;  2KJC A;  4DQ2 A;  1MD0 A;  2VOD A;  1RKW A;  1Z6R A;  3KP7 A;  2AQE A;  1FOX A;  3TMO A;  5IP7 J;  2GXG A;  1YRN B;  3PJR A;  2DAO A;  4L5E A;  4ESB A;  5CVU A;  3HRT A;  1IO2 A;  2Y0S N;  5F1R A;  2A3S A;  1DGR M;  1R6R A;  5F04 A;  3AFH A;  1LB2 A;  3ZCO A;  1AOY A;  2IGK A;  4YEL A;  3CDL A;  2V9V A;  4A3M J;  1Z9C A;  1KU2 A;  2JPB A;  2NVT J;  4RAZ A;  1RES A;  2HXO A;  2HVS A;  1J7K A;  3K7A J;  1BN5 A;  2X1E A;  3F8N A;  4UV8 A;  3FHZ A;  3ROU A;  1XDU A;  4GGG A;  1LJ9 A;  4P55 A;  3HOV J;  2QYO A;  5FLX Z;  3CTA A;  5CVJ A;  3GXO A;  4A0Z A;  5FLX K;  2EWN A;  2HOT A;  3LSR A;  4DZP A;  4ENJ A;  2LVS A;  1PUF A;  5L3D A;  2CU7 A;  3CJN A;  3I54 A;  4G6Q A;  4RAF A;  2FE3 A;  2IS1 A;  3L7W A;  5CJ9 A;  3TKY A;  1FIA A;  3ZMT A;  2NAZ A;  2V79 A;  1FYL A;  1YS6 A;  2QGU A;  5J1Y A;  2OD5 A;  2M9H A;  3CC2 I;  2LLK A;  4I99 C;  2Y48 A;  3D0S A;  3M9A A;  3WTT C;  2QBY B;  1LPQ A;  4MGR A;  2IS6 A;  2H6C A;  1W36 D;  3JCU C;  5LHH A;  2L5Q A;  2B9S A;  2MLG A;  4KN7 X;  2NOJ B;  1RR8 C;  1P9Q C;  1NTC A;  3WTY C;  4CXF A;  1SD6 A;  3QYF A;  1O3R A;  1ERD A;  2HR3 A;  3GWZ A;  1V5E A;  2CQX A;  2CS3 A;  1MND A;  2DMT A;  2XB0 X;  4IPA A;  3DKX A;  2PMZ A;  4EJW A;  3BG9 A;  2JA2 A;  2LG4 A;  5LHG A;  3EET A;  2QQA A;  4DOZ A;  4EJT A;  3OR1 C;  2HWV A;  1TWG J;  1K6Y A;  1MH3 A;  4LLN A;  1U2W A;  1X1B A;  2EZK A;  2F5E A;  1HQC A;  4G6D A;  1FBQ A;  2LNB A;  1EF4 A;  1ZAR A;  5DD8 A;  2RNG A;  4Y17 A;  4CCK A;  1QVU A;  3OY9 A;  3DXJ F;  3T5X A;  3OL4 A;  2R93 J;  2DMQ A;  5BOX A;  4EM0 B;  1T98 A;  1E17 A;  2LKX A;  2E36 A;  2GIZ A;  3SQN A;  5LFA A;  2O5R A;  3KPH A;  4B3A A;  5LGT A;  2JSC A;  3VPR A;  3FXL A;  3WTW C;  3J7A O;  1SMY F;  1WH5 A;  2E2H J;  2Y69 H;  4LG0 A;  3CUO A;  3ONQ A;  5KAI C;  3OYM A;  4GRI A;  3D1N I;  2EQR A;  2PMH A;  2M4G A;  5EG0 B;  5L3G A;  3PNY A;  2CG4 A;  1A5J A;  2QZ8 A;  4L5I A;  1OLT A;  2DBB A;  2GA2 A;  1R23 A;  4A3G J;  3HOT A;  3DEW A;  2XDV A;  1XB4 A;  2FF4 A;  3AG4 H;  3RQ4 A;  4L0Z B;  2VB6 A;  5CLS A;  1DQU A;  3HRM A;  1Q1H A;  4XQF A;  3JRB A;  4AYB N;  2WAD A;  3TW6 A;  2OZU A;  3IAM 2;  4RMN A;  3ZQL A;  3QYE A;  4EEF G;  4C3H J;  2X6O A;  4YFN F;  4KYW A;  1SAN A;  5HNF A;  3RZO J;  1TQP A;  5EZH A;  1X2M A;  2EB7 A;  3KZZ A;  1A31 A;  5FKN A;  3TED A;  1SMT A;  4WX9 A;  2R5Y B;  2MAB A;  4D5F A;  2OAZ A;  2VJ5 A;  2HPI A;  5FFZ A;  3UKG A;  1YIT I;  4U7B A;  1ZHF A;  1AKH B;  2M8G X;  5HVQ C;  1G3S A;  2L0K A;  1WI3 A;  1PYV A;  2EFP A;  3KEO A;  3ERM A;  2K9M A;  4E7S A;  4CIC A;  4XM3 A;  3S17 J;  4XRS G;  1FMW A;  4HQM A;  3DKW A;  3ZMS A;  2L2O A;  3PFY A;  4F7Z A;  4OWR B;  3QPH A;  3L1P A;  1WSU A;  3Q3S A;  2HOS A;  3BCB A;  5GPC A;  1EH8 A;  1FP1 D;  3QPT A;  1E3P A;  2VC0 A;  2JMW A;  1GVJ A;  1VZ0 A;  5IYC J;  4FCY A;  2A05 A;  3CCY A;  5EGO A;  2V1N A;  4CZC A;  2PMZ N;  3X2Q H;  3GF2 A;  2FEZ A;  4NQW A;  3K4K A;  4WXD A;  3H92 A;  4LFU A;  2JQ7 A;  4KIT B;  1IG7 A;  2RVC A;  3K4M A;  4RM2 A;  5M5X J;  4GFB A;  2LC2 A;  1UHW A;  2O7O A;  3A0B C;  5B1A H;  2W25 A;  4BE0 A;  2V6C A;  2MGQ A;  4FX4 A;  3SHF A;  2QUF A;  1LEB A;  4AC0 A;  4B47 A;  2PEX A;  3VOE A;  3M8F A;  4XLN F;  2IGO A;  3BCA A;  1P92 A;  3GZ5 A;  1MJ9 A;  2CQ7 A;  3ZMZ A;  4XKV A;  4KJZ A;  3JRD A;  1G3Y A;  2HFH A;  4XKB A;  1OPC A;  3KE2 A;  3PQK A;  4EQQ A;  2WY7 Q;  1O4X A;  1P4A A;  2XRL A;  4MNU A;  2LR8 A;  4A12 A;  1O3S A;  4I2O A;  2RN7 A;  3E6C C;  4M73 A;  3TW7 A;  1YTY A;  1L0O C;  2QKL B;  5J4V A;  1SAX A;  3BT9 A;  4WCG A;  4RA2 A;  1ODD A;  1ZKG A;  1JGS A;  5E17 F;  4RDU A;  2RDP A;  2ESH A;  1D3Y A;  1CGP A;  3SZT A;  2KIF A;  3E6D A;  4CYC A;  2XAF A;  1VQ7 I;  3J80 K;  2DMP A;  4AD9 A;  1IN4 A;  3JTH A;  3I9V 2;  3CUQ A;  3KFW X;  2XV4 S;  4E7H A;  2MD0 A;  2F2E A;  2PJR A;  4HAM A;  3RCO A;  4IX7 A;  4M6V A;  2MH9 A;  1Z7U A;  4HW0 A;  1ZRF A;  5LD2 C;  5EEG A;  2EZH A;  3L2C A;  3RTR A;  2ZJ2 A;  3JSP A;  1V4R A;  3VYU B;  3HYI A;  4EM1 A;  1TZL A;  2X0L A;  2DFE A;  3ZQQ A;  4QPQ A;  1RC9 A;  4B3X A;  4M71 A;  2V1X A;  3FMR A;  2JA7 J;  4KIF A;  2RAE A;  3CD6 I;  4PSW A;  4MQ9 F;  1X1C A;  2KP6 A;  4HST A;  1GT0 C;  2W1O A;  1R4M B;  1YIO A;  3ASO H;  4YIF A;  1B8I B;  2IAI A;  5KK1 A;  5L3F A;  2DO7 A;  3IWF A;  3FBI B;  3FM5 A;  4LLG F;  1KYW A;  2QVO A;  4BXF A;  2PX9 A;  2WY8 Q;  1DPU A;  4O5V A;  3KYD B;  2NXN B;  4II3 A;  4IXA A;  5HS8 A;  3S1M J;  3VSK A;  2AXL A;  3P9K A;  4EM2 A;  1MW7 A;  5D8K B;  1I6X A;  3Q9S A;  2A61 A;  5K5Q A;  2GA1 A;  3DWL E;  2R0Q C;  1V5F A;  1D8K A;  2DDA A;  2Q2E A;  5J6X A;  3OSF A;  1YRN A;  4L18 B;  1YE9 A;  2H8W A;  3S1R J;  1K83 J;  4E4H A;  3JSO A;  1FJL A;  3WGH A;  2IS4 A;  3I3L A;  2BZT A;  4U7D A;  3T1B A;  1VQM I;  4IOA F;  1G59 A;  4IJA A;  4IL6 C;  3IRR A;  1ZG5 A;  4FAS D;  3DEE A;  3I71 A;  3A1Y A;  3K10 A;  2JN6 A;  3B6A A;  3VDX A;  3GFL A;  1EV7 A;  4C3J J;  4AIK A;  5JVG F;  3G4S I;  3S3M A;  3CES A;  4LOC A;  2E2J J;  3PNV A;  4M74 A;  1EH7 A;  4JBA A;  2EA4 A;  2KZV A;  3E7L A;  4OIP F;  3LAP A;  1D0Z A;  3FK7 A;  1VQO I;  1A6I A;  5A2Q K;  2VE8 A;  2WA0 A;  2ICW G;  2CQQ A;  1FC3 A;  2FRH A;  2KRH A;  1RUO A;  3BZK A;  3KZI C;  1W0T A;  1PJR A;  2FD5 A;  3AAF A;  4BJ6 C;  2XSJ C;  3MKL A;  3RPU D;  1MMS A;  3PM1 A;  1PUF B;  4MEX F;  2FOK A;  2HQR A;  4Y4R A;  3GYH X;  9ANT A;  4RAG A;  2QWW A;  3JRG A;  4CGZ A;  3OOU A;  3DU6 A;  5J8F A;  1YX5 A;  4XOT A;  2R7R A;  2CGP A;  2RGV A;  2AS5 F;  3S3O A;  4KN4 X;  4PSX A;  1D0Y A;  3WTS C;  5IOZ A;  5JLX A;  1HSJ A;  3G1L A;  3LSH A;  3V4G A;  2VKH A;  2NVU B;  1P7I A;  4F91 B;  2X6Y A;  1AWC A;  3TO9 A;  1T6S A;  5F64 A;  4BKX A;  2QQ8 A;  3RKY A;  1GHC A;  2ZKZ A;  4CA0 A;  2OJE D;  3B6C A;  3F0C A;  3DBL B;  3EUK L;  2DA1 A;  2Y75 A;  2Y9Y A;  2VOO A;  1W1W E;  2HOA A;  1MBK A;  4XOP A;  2VI6 A;  2Z33 A;  1HW2 A;  2DOF A;  2X6W A;  1I5Z A;  1W7P D;  2VJJ A;  2IA2 A;  2WWY A;  3C18 A;  2DYR H;  4N4O B;  4CYD A;  1RIO H;  3K70 D;  1ZN2 A;  2ELH A;  5CPR B;  4QPO A;  5CQE A;  1MBF A;  4XLA A;  1TNT A;  3KYL A;  2BVL A;  2OPT A;  2XPW A;  3D5R C;  2F5V A;  4IEJ A;  1W7P B;  2L9V A;  4BQQ A;  1VQL I;  2F5D A;  1JUM A;  4OIO F;  1TTY A;  2PJP A;  1IN7 A;  4JK1 X;  1XC5 A;  1JKP C;  1IXS B;  1XCV A;  5E8G A;  1WJA A;  4LG0 B;  2VL8 A;  1OR7 A;  2DI3 A;  2DK8 A;  3H5R A;  4ENN A;  5HDN A;  1ORK A;  2X85 A;  2XHK A;  5TGT A;  5F0H A;  1D1A A;  4BL0 B;  2KDO A;  1XMK A;  3A01 A;  2F4M B;  4GYI A;  2XAJ A;  2XGD A;  5H6R A;  3E5Q A;  5D4R A;  4G7Z F;  2OC6 A;  4AU7 A;  4ZYG A;  5J1U A;  3U21 A;  3HOW J;  2ZSI B;  5GPA A;  3MZH A;  1BC8 C;  1T56 A;  5E1X A;  4U0Y A;  4A3F J;  3ZGK A;  3CCL I;  4HDV A;  1KQ0 A;  1RPW A;  1KYZ A;  3HHH A;  3KEY A;  2V6E A;  1IAW A;  4WWC A;  1K4T A;  3K4L A;  3BG6 A;  3F6O A;  3DFG A;  5F0C A;  3TGN A;  2DFI A;  3PL8 A;  3S3N A;  1KON A;  2LKS A;  3WE2 A;  4MIM A;  2P4W A;  3A02 A;  3CC4 I;  1ZGA A;  1Y0U A;  4J00 A;  1OFC X;  3FMS A;  4A6E A;  2Z9O A;  1RI7 A;  1MJB A;  4QTR A;  3DCF A;  4O3M A;  1KU3 A;  1MZB A;  1TNS A;  3ECH A;  5HS7 A;  1TP4 A;  4BYY A;  1LQ1 A;  1HBX G;  4L9V A;  4CHU A;  3R60 A;  1BBY A;  2X51 A;  2OUM A;  4XSZ F;  3SFZ A;  1JKR C;  3MKZ A;  4KIS A;  3K1M A;  4UY8 I;  2Q1Z B;  1KA8 A;  3C2H A;  1S8N A;  3E6M A;  4CCO A;  5DD4 A;  4DNC A;  4XK4 A;  3RYR A;  4WXH A;  1OYY A;  3B73 A;  4NQW B;  3K69 A;  4XRM A;  4Q48 A;  1F36 A;  2R7D A;  2DLL A;  1YYV A;  2XF6 A;  2ZFW A;  1JT6 A;  4UVA A;  4EJV A;  3GZN B;  3ZXS A;  1W36 C;  1ETV A;  5E79 C;  3VOD A;  3W2V A;  2V4J C;  4RAY A;  2EFO A;  3VSL A;  3VB2 A;  1D5V A;  1HW1 A;  3TBI A;  3QP5 A;  4GYG A;  3MCZ A;  5K7H A;  1F43 A;  3U9G A;  1DPR A;  5DV5 A;  3HEF A;  3M4O J;  2L9R A;  1Z3Y A;  3BR0 A;  5CKT A;  4E7J A;  3R4K A;  2VC1 A;  2H1K A;  2G7U A;  2CFO A;  2DA5 A;  3LSG A;  4OMZ A;  3N4M A;  2M30 A;  3IWZ A;  1ACI A;  2W4S A;  1S9H A;  2P0W A;  1H0M A;  4ZYE A;  2W00 A;  4MFE A;  3V8K A;  5D4S A;  2ZXJ A;  3QPL A;  2HU9 A;  3I64 A;  3EQL F;  5CVI A;  2C6Y A;  3TO7 A;  3HGG A;  1WJD A;  4KIG A;  3BRO A;  2JZY A;  4YII A;  1G8X A;  4X6A J;  1V54 H;  2GQQ A;  2LOO A;  2P6T A;  2K7L A;  1X4P A;  2M3A A;  3D5S C;  1TT0 A;  5B3S H;  3HBL A;  3FIS A;  1BR4 A;  5K5R A;  5E3O A;  2E35 A;  3C3W A;  2VQC A;  3K4N A;  4M9Z A;  3H3Z A;  4UUT A;  2R7W A;  2R7O A;  3KP2 A;  3AG2 H;  3CUQ B;  3EYY A;  1WFX A;  2I5U A;  1REP C;  3W6J B;  1WZ2 A;  3IUO A;  3KEQ A;  5FKK A;  2VLA A;  1BW6 A;  2PJR B;  2STW A;  1LFB A;  1Z6T A;  3H0D A;  5AON A;  2KIM A;  4Z6Y A;  3TQN A;  3PUF A;  1XG1 A;  2NVY J;  4A5N A;  4IVN A;  2AQF A;  4HQE A;  4Y7N J;  2QQ9 A;  2V9P A;  3BPV A;  3C2B A;  4RS8 A;  1XCB A;  2RNJ A;  1O3Q A;  2E1M B;  4A5M A;  3OYB A;  2WAE A;  3CO7 C;  3HXL A;  1BR1 A;  1VFC A;  2D5V A;  5E1W A;  1JTY A;  2VQL A;  2DA2 A;  3HOZ J;  2LBF B;  3IC7 A;  1BOA A;  1T0F C;  1U9O A;  1R4N B;  3LFU A;  1YHQ I;  2KKO A;  2EZI A;  2BY0 A;  2CFX A;  2NS7 A;  3FXJ A;  2MC3 A;  3ZMU A;  1Z21 A;  3BR5 A;  3O2P E;  5FKM A;  2LY1 A;  4HLY A;  4MTE A;  3OYD A;  1X3W B;  3SDB A;  2ZSH B;  4J01 A;  3OSG A;  2X9D A;  2BBY A;  1Z77 A;  2XSD C;  1IXR C;  2CV2 A;  3ZRG A;  5C3E J;  4L0Y B;  3CLO A;  4F52 A;  3I53 A;  4RB0 A;  5ILV A;  4Q5S F;  2B7E A;  2B0L A;  3FHN A;  4UB6 C;  3ABM H;  5FLV A;  2OQR A;  2IW5 A;  3IKV A;  2Q2E B;  2LK2 A;  1MMD A;  1SFX A;  4HPQ A;  1SVM A;  4NC6 A;  2ME0 A;  3IKT A;  4NDL A;  3OYF A;  3QQA A;  1ZTR A;  1RUN A;  3T8R A;  3J7Y J;  4HYE A;  4X1E A;  5KVR A;  3RZD J;  4ZTF A;  1J59 A;  2X4H A;  2VBW A;  1RKT A;  4LK0 F;  1ULY A;  4MHG A;  2GWR A;  1U5T A;  2NNY A;  2CW0 F;  3GTO J;  1VQK I;  3OYI A;  1MDM B;  3WG7 H;  2HTS A;  4II2 A;  2FXA A;  4DYR A;  2AXT C;  4HG2 A;  1WGX A;  3PNT A;  3IP4 B;  2QA4 I;  4J19 A;  2KMU A;  1O57 A;  2BXZ A;  3CF2 A;  1QQI A;  2JRM A;  4FT8 A;  1CF7 A;  1I1G A;  2GAU A;  4BJT A;  4KIB A;  1SVO A;  2Q0O A;  2OF7 A;  5BPI A;  1SC7 A;  1JKQ C;  2Q8K A;  1K78 B;  1FTZ A;  5M5Y J;  4HBL A;  3AKZ A;  3H9J A;  3HSR A;  1VI0 A;  3MQ0 A;  2Y0M A;  2GOM A;  5KAF C;  1D0X A;  4M9X A;  4FE7 A;  2PFB A;  2EJR A;  2EBI A;  4U87 A;  5HNH A;  4ON0 A;  4RGU A;  1PDN C;  1FLI A;  2M34 A;  1BIB A;  5ILS A;  4Y3O A;  4RLF A;  2VIX A;  1SAU A;  5D6E A;  3W3C A;  3RPU A;  2R7X A;  1XGM A;  4RGR A;  5F6F A;  3QU3 A;  2P6S A;  5CQG A;  4Z2Y A;  2KPM A;  5C4J J;  1HF0 A;  2EH3 A;  2MSY A;  5TRD A;  3L2R A;  5E3N A;  3RKW A;  4A3E J;  2UUZ A;  2HXI A;  2Z2S B;  3QOD A;  2ZFU A;  1F1Z A;  1MIJ A;  4BE2 A;  4UUV A;  2DTZ A;  2XRO A;  1QNT A;  5LEK A;  2LDU A;  4N9H A;  1HLV A;  2F48 A;  3TL4 X;  3GTJ J;  5J8C A;  3EDP A;  5IYB J;  1K6O A;  4UB8 C;  2CUJ A;  4IHY A;  2F5C A;  3V7S A;  2VT2 A;  2LFB A;  3ZPL A;  5J4Y A;  1DUX C;  4KNY A;  3BR6 A;  3FK6 A;  5H2F C;  1AHD P;  3GME A;  4MEY F;  1VF9 A;  2A5W A;  1W7P A;  5JR3 A;  3WU1 B;  2R4G A;  1TWF J;  2FNA A;  2CQN A;  4XRS A;  4D7M A;  3EUH C;  5F1J A;  3S2W A;  2M87 A;  3FM3 A;  4D1Q A;  2RRE A;  1XD7 A;  1FX7 A;  4EAT A;  3CLQ A;  3OR2 C;  5HOO A;  1K61 A;  2GXB A;  2HQA A;  3GW2 A;  2HEO A;  2STT A;  4G7H F;  2ETH A;  4BHC A;  2VN2 A;  3DF8 A;  5F0F A;  4BHP A;  1VQ8 I;  4KUM A;  4I7H A;  5K5O A;  1W0U A;  1PP8 F;  2KDZ A;  4GO1 A;  2DU9 A;  1U8R A;  4M3F A;  3FXO A;  4RM3 A;  4XLE A;  3CMA I;  2K9S A;  3PSF A;  3RJP A;  5JFR A;  4IHT A;  4M3E A;  2YU3 A;  2BW3 A;  3LQQ A;  1JXS A;  4LK1 F;  3OV8 A;  2Y31 A;  1S5L C;  3WG9 A;  5B5E C;  3RIR A;  3GLL A;  5B1B H;  1E3O C;  1EKE A;  2DPU A;  2EV6 A;  3LA7 A;  4BBS J;  3A01 B;  3ZN1 A;  2ZME A;  1OMI A;  2DMU A;  2E1O A;  2HQ5 A;  2P8T A;  2X1C A;  4YFK F;  4HNU A;  5DUI A;  3Q5F A;  4XLH A;  4KA4 A;  1WCM J;  1QPM A;  3HIF A;  4A93 J;  2OTL I;  1W4M A;  2CMP A;  4PJN A;  2HOE A;  3T0Y A;  4BXX J;  4NHJ A;  2EK5 A;  4O6J A;  3DBH B;  1EH6 A;  3ZQH A;  2H09 A;  2Z5U A;  3FF5 A;  3M8E A;  5J3L A;  3TDU C;  4ABZ A;  4BEH B;  4ZYD A;  3OYK A;  1P4W A;  1BC7 C;  1XGS A;  4GXO A;  4L9J A;  1WI9 A;  3LAJ A;  2DT7 B;  2DFH A;  2VT3 A;  3DEU A;  2VJ4 A;  2W57 A;  3H5A A;  4L9T A;  4WK8 F;  2VQG A;  4V2F A;  4NUB A;  4ZDO A;  1IDZ A;  1WPK A;  4ZC3 A;  4OAZ A;  1WJ5 A;  1MMG A;  1Z05 A;  2W82 A;  3IL2 A;  1HW5 A;  4UUS A;  1ZLJ A;  3G1M A;  4G8X A;  4PGH A;  1FOW A;  3VYS B;  4A3K J;  3QU6 A;  3E6B A;  2ME6 A;  4HSR A;  1Q1V A;  2JJ7 A;  2RQQ A;  4A0Y A;  1X1D A;  2CSO A;  5LGN A;  3CZ6 A;  1YW9 A;  3CCQ I;  4IZZ A;  4HF1 A;  3RKQ A;  2PI0 A;  1MBJ A;  1QA6 A;  1M1E B;  1LUJ B;  2NYX A;  1RRJ A;  1SD4 A;  2FOW A;  2H8R A;  4G9Y A;  4XLF A;  2ELJ A;  2M7B A;  3HRU A;  3OS0 A;  1ZLK A;  3W6V A;  1YS7 A;  3BR3 A;  4L9N A;  2PMU A;  3KP6 A;  1BL0 A;  3WGI A;  2I10 A;  4S04 A;  3BLY A;  4M6X A;  1NK3 P;  4DW6 A;  3OL3 A;  2L7F P;  3F21 A;  2DN0 A;  1BJZ A;  1USS A;  3RKX A;  5FRN A;  1SFO J;  3NEU A;  3PUB A;  5LGU A;  1UB9 A;  1Y39 A;  1BJA A;  3AG3 H;  3KLN A;  5D5V B;  2ECC A;  3AL0 B;  1ZG1 A;  1J2X A;  3NAU A;  4RLQ A;  1J0R A;  5LBQ A;  1U6G A;  1IW7 F;  1JTX A;  3K0L A;  1YX3 A;  1HKT A;  5E20 A;  3S16 J;  3NRV A;  4JX4 A;  1ZR2 A;  3BWG A;  1X19 A;  1MSE C;  2O61 A;  4M3D A;  2EA2 A;  4DBR A;  1MKM A;  2IA1 A;  2ID6 A;  1Z0X A;  3L9F A;  2UXN A;  5EJC A;  3JRA A;  1G2H A;  2W24 A;  3S1Q J;  2VKV A;  5FD5 A;  5E3L A;  1OCZ H;  2D1H A;  4V2G A;  4A2U A;  2GIV A;  3K6G A;  4QLC U;  2K9N A;  4OOI A;  3G73 A;  1IN8 A;  1LVK A;  1R1U A;  4JYK A;  2K86 A;  3DTE A;  2JUG A;  2Z1D A;  4I0B A;  3L2V A;  1HKS A;  2LBF A;  1B6A A;  2MFZ A;  1D1C A;  4EVI A;  4EGZ A;  1DDN A;  2DA4 A;  3OYH A;  3ZP5 A;  2R7S A;  3I4P A;  3FWE A;  3CDI A;  1IGN A;  4PJL A;  1BOB A;  4AID A;  1B9M A;  1TWA J;  1LKX A;  4ITV A;  4E7K A;  4XON A;  3L00 A;  1Y56 A;  2V1D A;  3ML6 A;  3WU0 A;  2JA5 J;  3KET A;  1RZ4 A;  3UNG C;  5JI6 A;  1J75 A;  2VBZ A;  4PDK A;  1IV6 A;  1ZRC A;  1T95 A;  4CCN A;  2AO9 A;  4LG3 A;  1HKQ A;  2UWM A;  2Z3Y A;  2BY1 A;  3BTJ A;  4MLO A;  4D7N A;  4HX8 A;  4JP0 A;  2K3P A;  2F5F A;  3ABU A;  3WHB A;  2VON A;  2BHZ A;  3BTI A;  4B43 A;  1ZK8 A;  5DCM A;  4ZJZ A;  4HA8 A;  1FBU A;  5JHU A;  1P6R A;  1T33 A;  1VQ6 I;  1YO5 C;  4ENM A;  4NB5 A;  3LFK A;  2CUF A;  3K4B A;  3L09 A;  4FQG A;  3SEQ A;  1FOY A;  2L3D A;  2L9N A;  4MQV A;  4C9Y A;  3JRE A;  2BY2 A;  4P1W A;  4F3Q A;  1SVL A;  5HDG A;  1MDM A;  1KGS A;  4K2E A;  5H20 A;  2IT0 A;  1BA5 A;  4IO9 F;  2QSG X;  3DLA A;  1NH3 A;  4QWQ A;  2HI3 A;  3C1D A;  3FXR A;  4ZDP A;  2KIU A;  5KHD A;  1UFM A;  1V5G A;  3OIQ A;  5FLM J;  2YU9 J;  3FXK A;  4DIQ A;  5HLT A;  2RV8 A;  5HLG A;  1U5T B;  2CUZ A;  2LTP A;  1BR2 A;  4AUX A;  4IHS A;  4U0V A;  1K78 A;  2PBI A;  4LJZ F;  2JA6 J;  3V42 A;  3V7C A;  4PCQ A;  3F3X A;  2M2E A;  3SDG A;  3I58 A;  5FJ8 J;  3BP8 A;  3IV5 A;  1B1B A;  1LVA A;  5KCM A;  2R3S A;  4CSW A;  1CF7 B;  2J5P A;  4CUG A;  4BU2 A;  3M1E A;  3M07 A;  4Y15 A;  2DJN A;  2L54 A;  2WB1 A;  3WTU C;  3A0H C;  1STZ A;  1WHU A;  1TLH B;  4BXU A;  3PO2 J;  3ZQF A;  1A35 A;  4Y13 A;  5IT9 Z;  3VEP A;  1MNM C;  5IY5 H;  1XN7 A;  1QVT A;  2EFW A;  4IRG A;  1VQ9 I;  1S7O A;  2VAS A;  1R71 A;  3LSJ A;  1IRF A;  2HGC A;  1ZAO A;  2E7X A;  3CCJ I;  1K4S A;  1FTT A;  3BG3 A;  3B02 A;  3CUQ C;  4UXN A;  3HB9 A;  5E1Z B;  3CQZ J;  5FFX A;  5IT3 A;  3HKZ A;  1QBJ A;  1J09 A;  1UEL B;  4PFP A;  2E19 A;  3KP5 A;  4BGD A;  2M0C A;  2Z99 A;  4D5C A;  1FP2 A;  2E5N A;  1ITY A;  1R22 A;  4OMY A;  1G6N A;  1IRZ A;  2E1M C;  3HPG A;  1ZG3 A;  5HOD A;  1GV2 A;  1RNL A;  3JAM Z;  2DA6 A;  4HNT A;  1QZE A;  3P9C A;  1W5S A;  1IUF A;  5DCF A;  2K85 A;  1KU7 A;  3JAM K;  3OYL A;  2DXI A;  4NC7 A;  1H9T A;  3H5N A;  3AG1 H;  1O3T A;  2XUB A;  1TW3 A;  2Y30 A;  4JQF A;  2HYF A;  5CYV A;  1YLF A;  1I3Q J;  2Z16 A;  3P9I A;  2HZT A;  3DTK A;  4AVP A;  2Y2Z A;  4C3I J;  3O6B B;  4F55 A;  1LDJ A;  1UG0 A;  3PQJ A;  2D45 A;  4EJO A;  5K1Y A;  2LY2 A;  3RYP A;  4XKW A;  3WU2 C;  5D5U B;  2A6E F;  2DT5 A;  2EIJ H;  2ZJR F;  2R7Z J;  2FBH A;  2WV1 A;  4IQJ A;  4XL9 A;  3A4C A;  4HF0 A;  3L2U A;  1N75 A;  4NBQ A;  4A3L J;  2L7Z A;  2ZJQ F;  5HLI A;  4S05 A;  2K4B A;  3ERE D;  1ZQ3 P;  2K02 A;  4MO7 A;  2GBY A;  1JT0 A;  2LH9 A;  2BW3 B;  3F72 A;  3OWT A;  4ASN A;  1LDK B;  3FIW A;  4XOR A;  5DDG A;  2QEN A;  2VKE A;  4PK4 A;  5DUK A;  4F92 B;  1TC3 C;  3LOC A;  1XMX A;  4KMU X;  4I09 A;  5IOY A;  1G3W A;  2CH0 A;  2FU4 A;  2V9K A;  2ZME B;  3H3U A;  3ULQ B;  5E8I A;  2JVG A;  3WTV C;  3I59 A;  4Q47 A;  2O8X A;  4IHW A;  3LST A;  3ASN H;  1BI0 A;  3FBN B;  4BEH A;  1FZP B;  3P5J A;  3ZQC A;  2KFD A;  3LA3 A;  4XR6 A;  2DCE A;  1I39 A;  3R0A A;  5H6Q A;  4FET A;  3BC8 A;  3NQO A;  4XNF A;  4I6Z A;  1Y6I A;  2P5V A;  3LSP A;  5C4X J;  2ZNZ A;  3TP0 A;  4CCJ A;  5C44 J;  3HKZ N;  1GXQ A;  1LEA A;  1GLN A;  3MN2 A;  2BEO A;  4UHT A;  3TP3 A;  4BJ5 C;  5D5X B;  1X2N A;  2F4I A;  2JWT A;  3SFI A;  5KNL A;  1ZGJ A;  3QPS A;  1RR7 A;  4GCV A;  1JJ8 C;  5HLH A;  3CF5 F;  1T2K A;  3OIP A;  1SFU A;  4LB5 A;  2ZC2 A;  3CJT B;  3JR9 A;  2NS0 A;  2X48 A;  5CVR A;  4UVB A;  1T39 A;  4S0H B;  2L7K A;  3OOP A;  4RB3 C;  4UUS B;  1XX5 A;  1ETW A;  3W2A A;  3QP6 A;  2X1D A;  4XBF A;  1IRG A;  4CH7 A;  3GFJ A;  4E7L A;  3CC7 I;  1O7L A;  2QSH X;  2FUG 2;  3RDI A;  4YRV A;  2O8K A;  5HS9 A;  4WXC A;  3QOP A;  1TL8 A;  2FSW A;  5FKL A;  2R7F A;  4AWX B;  4A3D J;  3SEZ A;  1WVR A;  3IAS 2;  3I4N J;  4M3G A;  4PJJ A;  4UV9 A;  1UHM A;  1WRJ A;  3HPH A;  4KT5 C;  3CCV I;  2P5L C;  2MC4 A;  3M1C A;  1R49 A;  4Y33 A;  1TWC J;  3ABT A;  2DJI A;  2FX0 A;  5L3B A;  3I4M J;  1X4O A;  1OCC H;  5TIS C;  4IHV A;  2VUM J;  2IXS A;  4RB1 A;  3BQY A;  4BQN A;  1TWH J;  4X0G A;  1JHF A;  4WF2 A;  1BI3 A;  2NS8 A;  1QO0 D;  5ED4 A;  4H4K C;  3U1D A;  3ZOB A;  3HHG A;  3E5X A;  3GEZ A;  5LEJ A;  2A69 F;  4HDU A;  1YQA A;  1ZYR F;  2ZJP F;  2DW4 A;  1MBH A;  3LL7 A;  5DS9 A;  3F9K A;  3G3Z A;  4BQO A;  2W7N A;  3SXY A;  2BY3 A;  3JRF A;  2VBX A;  4OU0 A;  4EGY A;  4Q4Z F;  3CCM I;  2Y0S A;  4IOC F;  4A3C J;  4JOM A;  5GAD J;  4GDF A;  2PLY A;  2DPD A;  4ESJ A;  2DT6 A;  4BAC A;  1JUS A;  1OR7 C;  2LP0 A;  4BHB A;  3LA2 A;  2MH2 A;  3GFM A;  2K9Q A;  3S8P A;  1D5Y A;  3COA C;  2XIG A;  3KLO A;  1LFU P;  1XTA A;  2LF7 A;  2PQ8 A;  3F8B A;  3HDD A;  1VQP I;  2ID3 A;  1QU3 A;  5FRM A;  3LNQ A;  1Y1V J;  1JHH A;  4M9S A;  3LWF A;  1GXP A;  1AA7 A;  3N97 A;  3Q0U A;  2I8D A;  2D1V A;  3FKI J;  1G3T A;  3PIO F;  3WE3 A;  3MFK A;  2G7H A;  2AHQ A;  3FKJ A;  1FNN A;  2GZW A;  2L01 A;  5DEQ A;  4BE1 A;  1OJL A;  4HV5 A;  3T8T A;  1U3E M;  1NK2 P;  2XGE A;  1UHS A;  2CO5 A;  1E3H A;  2A68 F;  2VPR A;  2BOL A;  2E60 A;  2O0Y A;  4OIQ F;  2XKO A;  3FZV A;  3O8G A;  3ZQ7 A;  1BIA A;  1H88 C;  2HZD A;  4PJ0 C;  3EUA A;  3IRQ A;  2G0E A;  3EPZ A;  2XAH A;  1TT5 B;  3MVP A;  3FXU A;  2DOA A;  3SJM A;  1EA3 A;  4TV7 A;  2XVC A;  3E0J B;  3JRC A;  1NHA A;  1IF1 A;  1LDD A;  5DCM B;  3I5U A;  5FGM A;  5LRS A;  1XGO A;  4YFX F;  2IEK A;  1DGW Y;  2BVM A;  3BJA A;  4FTH A;  1A04 A;  3LMM A;  3ELK A;  3KP3 A;  2XGX A;  5EEH A;  5FO5 A;  3GTG J;  3WHC A;  2YUS A;  3BPX A;  2IS2 A;  4LIU A;  5J40 A;  3F8M A;  2OCC H;  2FQ3 A;  4CCM A;  4XN0 A;  1MSF C;  2HTJ A;  1XSD A;  2ZXW H;  3CP2 A;  3GVA A;  4LIV A;  3F8F A;  2ZO4 A;  2O6G E;  1KQ8 A;  3F8C A;  3BG5 A;  2M7A A;  1U0J A;  4YEJ A;  3DQV C;  2JUC A;  4LMY A;  4MTD A;  1ENH A;  3UR3 C;  3G71 I;  5M3F J;  1UST A;  2E7W A;  5K7F A;  1VND A;  3E97 A;  1KU9 A;  4BAY A;  4XRF A;  3J81 Z;  1BI2 A;  1E0E A;  1WJE A;  3J81 K;  5ILU A;  2XPU A;  1UMQ A;  1HCR A;  3WGG A;  1FYK A;  5FD6 A;  2KQR A;  1FOK A;  1WWX A;  5ICG A;  4RBO A;  3AL0 C;  4AYB A;  1CQT A;  1G4D A;  3OS2 A;  3FDY A;  3J7Z I;  2EV5 A;  2BYV E;  2LYC A;  5FRO A;  2N8G A;  2QLZ A;  4G6T B;  1FSH A;  3H35 A;  4C2M J;  3HUG B;  1PVE A;  4IRH A;  4L5J A;  3SYT A;  4IKF A;  2HYJ A;  1YIJ I;  3S93 A;  2VQH A;  1I3A A;  4FX0 A;  1YW7 A;  1P4X A;  3R6S A;  1AU7 A;  5DM6 F;  1JJ6 C;  4FIS A;  2DDB A;  2K5C A;  2EIK H;  4EJU A;  1Z7L A;  3OMY A;  3WOD F;  2IPQ X;  1TBX A;  3CCS I;  4UVC A;  1I27 A;  1LE8 A;  2ECB A;  2CRG A;  1FSE A;  3ECO A;  1GDT A;  2DQL A;  1EJ9 A;  3KX2 A;  1FWZ A;  1FEX A;  2YSR A;  3RSN A;  3TOA A;  3MZ8 A;  3DLL F;  1HDD C;  4I98 B;  4ANJ A;  2E2I J;  2ZB9 A;  3P7N A;  3U2R A;  1Y1W J;  2KHM A;  2KRF A;  5FKO A;  2YX7 A;  4I0A A;  1UG2 A;  3PO3 J;  1A6Q A;  2M45 A;  4C30 A;  3FMQ A;  1BW5 A;  2VXZ A;  1POG A;  2OA4 A;  1OYI A;  1VQN I;  3NWS A;  4BQA A;  2QCO A;  1K7A A;  4C2U A;  1QGP A;  2YR2 A;  2MW8 A;  4M6Y A;  3BY6 A;  4G94 A;  2R7U A;  2P7V B;  3HG9 A;  4LD5 A;  1QHG A;  2FNP A;  3TDZ C;  1WJB A;  2R7T A;  3SZP A;  3H3V K;  4E7I A;  1ZEL A;  1YJN I;  3DTI A;  3F22 A;  3C2G A;  4E7Z A;  3R0J A;  4N4N B;  1ETY A;  1FIP A;  1MBG A;  3HGY A;  4KMF A;  3FX3 A;  3GFI A;  1BM9 A;  1P7J A;  3K4C A;  1QPI A;  1J9I A;  2XB5 A;  4I02 A;  5ICC A;  3ISP A;  4ZZD A;  1V3F A;  1WKM A;  2QKM B;  2ZNY A;  2QEX I;  1XPX A;  2L02 A;  3ZR8 X;  1U5T C;  1R5G A;  2JT1 A;  4U88 A;  4ZTJ A;  5D5W B;  2PG4 A;  4ZZL A;  1MMA A;  2HKX A;  3MZY A;  1BI1 A;  3I59 B;  3PFI A;  1F5T A;  2H27 A;  4PZJ A;  3HM5 A;  4DJA A;  3JTG A;  1I6H J;  3NWT A;  2L4A A;  4B48 A;  1C0W A;  2WAF A;  3GCM A;  2G9W A;  1APL C;  1I1S A;  1DU6 A;  3F23 A;  2ZXH A;  3ESW B;  2FML A;  4NNJ A;  1MJA A;  4W97 A;  5JVT A;  2JPC A;  5D8L B;  4D9J A;  2BV6 A;  4AIJ A;  3KIO A;  3CCE I;  2WC2 A;  2HVQ A;  3OS1 A;  2DYS H;  3L2W A;  3CMY A;  3QRF F;  4RGS A;  2HVR A;  2EFN A;  4Y52 J;  4RGX A;  4YIR X;  3I0T A;  2WV0 A;  5J47 A;  5L3C A;  3HTS B;  1ZRE A;  2ZXI A;  2CW7 A;  3I56 I;  2B63 J;  4IF4 A;  2M1B A;  2LRE A;  4ZYH A;  3BG7 A;  5EF6 A;  3RPQ A;  1WQ2 A;  1YW8 A;  3QYB A;  2DMN A;  2O9L A;  2J5O A;  4KT6 A;  1YFH A;  5GTH C;  1N78 A;  2VBY A;  1SEU A;  1O7F A;  3E5U A;  2F4O B;  4M3B A;  3FXQ A;  1ZRD A;  3RQI A;  3JW4 A;  3OYA A;  2CV1 A;  4EMS A;  2E34 A;  2QQB A;  3CO6 C;  1PP7 U;  2LMD A;  4V19 K;  2NNN A;  4E70 A;  4KDP A;  1T38 A;  1ON1 A;  2OV7 A;  4XKC A;  1F4K A;  1LNW A;  1KZH A;  3H9Q A;  4BBR J;  2KIQ A;  3K70 C;  2ISY A;  1R5I D;  2K40 A;  2M4K A;  3CCR I;  2ISZ A;  2A07 F;  2R5Z A;  2CW8 A;  2VPL A;  1UAA A;  2CWE A;  2LKP A;  1MH4 A;  1FYM A;  5LLQ A;  2KLO A;  1NG6 A;  2FQ4 A;  2QSF X;  2V1U A;  3DKY A;  1N77 A;  3WTZ A;  1ETX A;  1IC8 A;  2XKP A;  4B4C A;  4XID A;  2RC4 A;  4B1R A;  2MLK A;  5FB2 A;  1MBE A;  5JLW A;  2XAU A;  2O3F A;  2EZL A;  3Q0W A;  3RI4 A;  1B72 A;  2VOP A;  5IYD J;  3J80 Z;  2H94 A;  1FY7 A;  4E6K G;  4OIR F;  1TQI A;  3DBR B;  2VE9 A;  1HC8 A;  4R79 A;  3OYG A;  1S29 A;  4H0E A;  1N25 A;  5EZG A;  3BTC A;  2IBD A;  3N05 A;  2ADU A;  2R92 J;  1IV8 A;  1TW2 A;  2ZME C;  1R9T J;  2CUE A;  1R00 A;  3ZMV A;  5IP9 J;  3K2Z A;  3HJE A;  3NAR A;  3M3Y J;  2VXD A;  2YX4 A;  2DA3 A;  5D6F A;  3IH4 A;  1UZC A;  2LRD A;  1B9N A;  1SFK A;  1X58 A;  3D5L A;  3ZQI A;  1IUY A;  1GUU A;  1ETQ A;  2OCE A;  2JA8 J;  1HOM A;  5DYM A;  5BPD A;  3HOY J;  5EDN A;  2XAG A;  2YS9 A;  2TCT A;  2K3F A;  5AIP A;  2WTE A;  4BUP A;  4ZH4 F;  1Z1D A;  2CV0 A;  2MA3 A;  1IN5 A;  1YI2 I;  2CJJ A;  3I55 I;  1DP7 P;  3CDH A;  4R1H A;  3BR2 A;  4LIT A;  3DPU A;  1QZY A;  2EIN H;  2O03 A;  4HNV A;  3L2Q A;  2KZG A;  2BE5 F;  3CP8 A;  4PUS A; 
#chains in the Genus database with same CATH homology
 1X2M A;  5EEA A;  3OSG A;  2X9D A;  3S2H J;  4IHW A;  5FKN A;  5IPA A;  1Z77 A;  3TED A;  2XSD C;  1H89 C;  2R5Y B;  3ZQC A;  4IHX A;  2GLO A;  4D5F A;  3S15 J;  5J1R A;  4G12 A;  5C3E J;  3UKG A;  4I6Z A;  1AKH B;  2M8G X;  5FLV A;  3LSP A;  5C4X J;  3TP0 A;  2LK2 A;  5C44 J;  2W48 A;  2L0K A;  3HKZ N;  2ME0 A;  1WI3 A;  4NDL A;  3QQA A;  3MN2 A;  1ZTR A;  3TP3 A;  1X2N A;  3GBG A;  2JWT A;  4X1E A;  3SFI A;  4XRS G;  3RZD J;  3S17 J;  3S2D J;  1RKT A;  3QPS A;  1RR7 A;  3BTL A;  1JJ8 C;  3GTO J;  3IH3 A;  2XGC A;  3Q3S A;  3L1P A;  3HOX J;  2HOS A;  5GPC A;  3JR9 A;  2X48 A;  2JMW A;  5IYC J;  4FCY A;  4S0H B;  3CCY A;  4DYR A;  5EGO A;  3JRI A;  2PMZ N;  1WGX A;  4UUS B;  1I50 J;  4J19 A;  1ETW A;  4W1U A;  2NOG A;  3GTM J;  1JKO C;  4A3B J;  4JX5 A;  1IG7 A;  1JKQ C;  2OF7 A;  2O8K A;  1FTZ A;  5M5X J;  5M5Y J;  4GFB A;  5FKL A;  2O7O A;  4A3D J;  1VI0 A;  1HDP A;  1IDY A;  3GTL J;  3O8H A;  4FE7 A;  3I4N J;  4M3G A;  2EBI A;  1ETO A;  4FE4 A;  2MGQ A;  2M34 A;  2GM4 A;  4AC0 A;  1TWC J;  2Y9Z A;  2FX0 A;  3I4M J;  4IHV A;  2VUM J;  3BQY A;  1HF0 A;  1TWH J;  5C4J J;  4I76 A;  2EH3 A;  2MSY A;  1WH7 A;  2NS8 A;  5E3N A;  4A3E J;  2HXI A;  3ZOB A;  3JRD A;  1ZGW A;  3Q0V A;  5M5W J;  1O4X A;  1U78 A;  2DTZ A;  2XPV A;  2XRL A;  1MBH A;  2LR8 A;  5DS9 A;  3JRF A;  3TW7 A;  5F08 A;  1HLV A;  3S1N J;  3GTJ J;  3S14 J;  3BT9 A;  5IYB J;  1ZKG A;  4IHY A;  4RDU A;  5EYR A;  2LFB A;  4A3C J;  3BR6 A;  4CYC A;  5M3M J;  1LE8 B;  1DU0 A;  3FK6 A;  1JUS A;  1AHD P;  2DMP A;  2LP0 A;  1VF9 A;  1TWF J;  2K9Q A;  1D5Y A;  4XRS A;  3BQZ A;  4D7M A;  5F1J A;  1LFU P;  4M6V A;  3HDD A;  5BNG A;  4XIC A;  2ID3 A;  2EZH A;  1K61 A;  3LNQ A;  1Y1V J;  3Q0U A;  1H8A C;  5F0F A;  4BY1 J;  3FKI J;  1W0U A;  5EG0 A;  2KDZ A;  2JA7 J;  2AHQ A;  4M3F A;  2RAE A;  2K9S A;  4M3E A;  1OJL A;  2P81 A;  1ZR4 A;  1GT0 C;  1NK2 P;  2XGE A;  1UHS A;  2Y31 A;  1B8I B;  2IAI A;  3H0G J;  2VPR A;  1E3O C;  2JK3 A;  3IH2 A;  2WB1 N;  3O8G A;  4BBS J;  3A01 B;  1OCP A;  1XS9 A;  1H88 C;  2HQ5 A;  2DMU A;  2E1O A;  4MFD A;  1OCT C;  2G0E A;  1WCM J;  3G1O A;  4A93 J;  3S1M J;  3MVP A;  2NVX J;  2R5Y A;  3SJM A;  4BXX J;  3JRC A;  1AKH A;  3A03 A;  3ZQH A;  1S7E A;  3OSF A;  1YRN A;  2IEK A;  5J3L A;  4FTH A;  4ABZ A;  3S1R J;  1K83 J;  3GTG J;  1FJL A;  3WHC A;  2YUS A;  2LY9 A;  1MSF C;  3GTK J;  4V2F A;  4A3J J;  2JN6 A;  1IDZ A;  2ELK A;  1WPK A;  3B6A A;  4QSH A;  1IJW C;  5F27 A;  4C3J J;  3BG5 A;  4UUS A;  4LOC A;  3G1M A;  4QIW N;  3GTP J;  2E2J J;  3GTQ J;  4BY7 J;  3OIO A;  1ENH A;  4A3K J;  5GP9 A;  5M3F J;  2ME6 A;  5K7F A;  1VND A;  1Q1V A;  3E7L A;  2JJ7 A;  2WAQ N;  2FJ1 A;  4DYQ A;  3FK7 A;  1ETK A;  1A6I A;  2TRT A;  2NVQ J;  1GV5 A;  5EGO B;  1JUP A;  2XPU A;  3RKQ A;  1UMQ A;  2CQQ A;  1HCR A;  1MBJ A;  2KT0 A;  4RBO A;  1CQT A;  1W0T A;  2H8R A;  2DA7 A;  2FD5 A;  3MKL A;  2N8G A;  3PM1 A;  1PUF B;  3W6V A;  3BR3 A;  9ANT A;  3JRG A;  4C2M J;  3OOU A;  1BL0 A;  2I10 A;  2HYJ A;  4DW6 A;  1NK3 P;  2L7F P;  2DN0 A;  1AU7 A;  1BJZ A;  5JLX A;  5IOZ A;  3G1L A;  1JJ6 C;  4FIS A;  2R5Z B;  1P7I A;  1U8B A;  1SFO J;  1RET A;  3K2A A;  2L7M P;  4BKX A;  2COB A;  5K7Z A;  1LE8 A;  2ECC A;  2ECB A;  2CRG A;  3B6C A;  3F0C A;  3NAU A;  1U9N A;  2DA1 A;  2QF7 A;  1GDT A;  2Y9Y A;  1JTX A;  2HOA A;  1MBK A;  2VI6 A;  1FEX A;  3S16 J;  4JX4 A;  1ZR2 A;  1MSE C;  1HDD C;  1B72 B;  2E2I J;  2ZB9 A;  4M3D A;  5IP6 A;  2ID6 A;  1Z0X A;  1Y1W J;  5FKO A;  1QRY A;  3JRA A;  1UG2 A;  3BR1 A;  3PO3 J;  4CYC B;  1G2H A;  3S1Q J;  2VKV A;  1MBF A;  1BW5 A;  2OPT A;  2XPW A;  1POG A;  4JX6 A;  1JGG A;  5E3L A;  4IEJ A;  4V2G A;  2QCO A;  2K9N A;  2MW8 A;  1JUM A;  4JYK A;  3JRH A;  1XC5 A;  1JKP C;  3H3V K;  2DA4 A;  1IGN A;  4A3I J;  1B8I A;  1TWA J;  3HGY A;  1ETY A;  1ORK A;  1MBG A;  1FIP A;  4DZJ A;  5F0H A;  1P7J A;  1QPI A;  2XB5 A;  4DYC A;  3A01 A;  2JA5 J;  3RZO J;  2XGD A;  4A69 C;  1IV6 A;  5J1U A;  3HOW J;  5GPA A;  2AO9 A;  2LD5 A;  5E3M A;  1T56 A;  3BTJ A;  4MLO A;  3ZQG A;  4D7N A;  2HDD A;  4JP0 A;  4A3F J;  3WHB A;  1GVD A;  3BTI A;  5DTD A;  1ZK8 A;  1RPW A;  3HM5 A;  1I6H J;  1T33 A;  5F0C A;  2CUF A;  1APL C;  3HOU J;  2MG4 A;  1DU6 A;  3JRE A;  4MIM A;  3A02 A;  1RKW A;  4W97 A;  1OFC X;  1BA5 A;  4QTR A;  5IP7 J;  3DCF A;  1YRN B;  4L5E A;  2HI3 A;  2Y0S N;  5FLM J;  2YU9 J;  5F04 A;  2LTP A;  4AUX A;  1JKR C;  3CMY A;  4Y52 J;  2JA6 J;  3CDL A;  4A3M J;  2M2E A;  3SDG A;  4XK4 A;  5FJ8 J;  3IV5 A;  2B63 J;  2NVT J;  1RES A;  2HXO A;  4XRM A;  3K7A J;  5EF6 A;  1F36 A;  2O9L A;  2DMN A;  2DJN A;  3HOV J;  1JT6 A;  1ETV A;  4M3B A;  3RQI A;  3PO2 J;  3ZQF A;  2HOT A;  3LSR A;  4DZP A;  5K7H A;  2LVS A;  1MNM C;  1PUF A;  1F43 A;  2CU7 A;  1QVT A;  3HEF A;  3M4O J;  3LSJ A;  1FIA A;  2L9R A;  3BR0 A;  1FTT A;  3BG3 A;  5J1Y A;  2H1K A;  2DA5 A;  3LSG A;  2M9H A;  2LLK A;  3HB9 A;  4BBR J;  3CQZ J;  2K40 A;  2R5Z A;  4MFE A;  1MH4 A;  2E19 A;  3QPL A;  2M0C A;  4D5C A;  2FQ4 A;  1ITY A;  1NTC A;  3HGG A;  1IRZ A;  1ETX A;  1IC8 A;  4B4C A;  4XID A;  4X6A J;  2CQX A;  5HOD A;  1GV2 A;  2DMT A;  2XB0 X;  4B1R A;  2DA6 A;  3HBL A;  1MBE A;  3FIS A;  5JLW A;  1IUF A;  3BG9 A;  5E3O A;  2EZL A;  3Q0W A;  1B72 A;  5IYD J;  1TWG J;  1MH3 A;  4UUT A;  2EZK A;  1EF4 A;  2Y30 A;  1QVU A;  5EZG A;  3BTC A;  2IBD A;  2R93 J;  5FKK A;  1I3Q J;  1BW6 A;  2DMQ A;  2R92 J;  1LFB A;  2Y2Z A;  1R9T J;  2CUE A;  4C3I J;  2LKX A;  5IP9 J;  3NAR A;  3M3Y J;  1XG1 A;  2NVY J;  4B3A A;  2DA3 A;  3IH4 A;  4Y7N J;  3VPR A;  3C2B A;  1WH5 A;  2E2H J;  2R7Z J;  2WV1 A;  1X58 A;  3ZQI A;  1VFC A;  3D1N I;  2D5V A;  2EQR A;  1JTY A;  1GUU A;  5EG0 B;  1ETQ A;  2DA2 A;  2JA8 J;  4A3L J;  1HOM A;  2L7Z A;  1A5J A;  3HOZ J;  3HOY J;  5EDN A;  1ZQ3 P;  4MO7 A;  2GBY A;  2YS9 A;  1JT0 A;  4A3G J;  1U9O A;  2TCT A;  3DEW A;  2EZI A;  2NS7 A;  3FIW A;  3JRB A;  2CJJ A;  3BR5 A;  2VKE A;  1TC3 C;  4AYB N;  3LOC A;  5FKM A;  3TW6 A;  3BR2 A;  5IOY A;  4HNV A;  3ZQL A;  4EEF G;  4C3H J;  2X6O A;  1SAN A;  2R0Q C;  5EZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...