3GTOJ

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtoJ00
1ZK8A 2E2HJ 1B72A 4AC0A 3GTPJ 1APLC 1H8AC 4W97A 2DA6A 5M3MJ 4B3AA 2EBIA 5E3LA 1EF4A 1JT0A 2YU9J 4A3LJ 3ZQGA 3BR1A 3JREA 2OPTA 3FK7A 4MLOA 4FISA 1Y1WJ 2XGDA 5FLMJ 4DZPA 1X58A 4IHVA 1UMQA 1BW5A 1P7IA 1MNMC 1JGGA 1TC3C 1D5YA 5E3NA 2MG4A 4M3BA 3BTCA 1RPWA 1ZR2A 3W6VA 1OJLA 4A3FJ 3Q3SA 3ZOBA 3IH4A 1GV5A 3HEFA 5J1YA 1SANA 4A3DJ 2RAEA 1AHDP 3GTKJ 4B4CA 1H88C 1Z77A 3SDGA 4C2MJ 4J19A 3K2AA 4M6VA 2LTPA 4DYRA 2DA3A 3CMYA 1GV2A 4GFBA 5F0FA 3GTJJ 5FJ8J 2M2EA 5E3MA 1MBEA 1QVUA 2K9NA 4AYBN 2Y31A 3FKIJ 2O8KA 3LSRA 3JRFA 5C4XJ 1DU0A 4FE4A 4D5FA 2K9QA 3DEWA 4XIDA 4I6ZA 5IOZA 3TP0A 1B8IA 4NDLA 2WAQN 4QTRA 2TCTA 4DZJA 2ID6A 1JT6A 2PMZN 2COBA 3LOCA 3B6AA 3PO2J 2WB1N 5BNGA 2LP0A 5F1JA 2DTZA 3DCFA 4MFEA 1WCMJ 2R5ZB 1AKHB 1IDYA 1DU6A 1TWCJ 1XC5A 1NTCA 4C3HJ 3BR5A 4M3EA 2E1OA 1B72B 2LKXA 2M9HA 4V2GA 1BA5A 1IJWC 5FLVA 2Y0SN 4V2FA 2YS9A 1HDDC 3RKQA 2AO9A 4BKXA 4MO7A 4X1EA 4LOCA 4CYCA 1BL0A 1OFCX 5JLWA 3OIOA 4IHYA 2E2JJ 3BTLA 4BXXJ 2DMTA 2VPRA 2XPUA 1VI0A 3HM5A 2EH3A 3PO3J 1CQTA 2MW8A 4QSHA 4MIMA 5EYRA 3BR6A 3BR2A 3C2BA 1HLVA 4A93J 1X2MA 3H0GJ 3Q0VA 1LFUP 2DMPA 1QPIA 1ETKA 2CJJA 2I10A 3JRGA 2XB5A 2E19A 3TP3A 3FK6A 3HOZJ 3F0CA 1YRNB 1RESA 2GLOA 3OOUA 5EZHA 1JKQC 3LNQA 5F0HA 2R93J 1IG7A 3M3YJ 4A3MJ 4D7NA 3A02A 2DMUA 2R5ZA 3BR0A 1AKHA 1JUMA 1RKTA 1JUPA 1JKRC 5M3FJ 1POGA 5IYDJ 2CU7A 2P81A 3BQYA 4JX5A 2JA8J 2QF7A 2HI3A 5EDNA 1IC8A 1U78A 1VFCA 1B8IB 3G1MA 3GTGJ 1SFOJ 1E3OC 1JKPC 3HBLA 3JR9A 1ETYA 4XK4A 4CYCB 3BG5A 4JP0A 1IDZA 3ZQFA 1MH3A 2XGEA 1MBJA 4B1RA 1ZR4A 1Y1VJ 2JK3A 4G12A 3I4MJ 1XG1A 5K7ZA 1WH7A 5M5YJ 3TW7A 3TEDA 3FISA 3IH2A 1JJ6C 1LFBA 2DN0A 4M3DA 4IHWA 3ZQLA 2EQRA 1I6HJ 2DA1A 4DYCA 3S1MJ 1S7EA 1R9TJ 2MSYA 3B6CA 4DW6A 2EZIA 5FKLA 3CDLA 3UKGA 1HOMA 1MBKA 2CUFA 2FX0A 5C3EJ 4DYQA 1PUFA 4M3FA 3JRAA 3BR3A 1T33A 4BY1J 1YRNA 3GTLJ 3S17J 2DJNA 2XB0X 3O8HA 1W0TA 5F08A 4BBRJ 1K61A 4S0HB 3G1OA 3QPSA 1BW6A 1P7JA 1A6IA 3HB9A 4IHXA 4UUTA 1O4XA 2H8RA 2VI6A 4A69C 4RBOA 1IRZA 4QIWN 4AUXA 1NK3P 3Q0UA 1HF0A 5EF6A 1ENHA 5IPAA 2VUMJ 2JN6A 1JKOC 2NVXJ 4XRSG 1WH5A 1XS9A 1BJZA 2XPWA 1GUUA 3Q0WA 3S2HJ 5EG0A 2IAIA 4Y7NJ 2HYJA 4BBSJ 3LSPA 5K7FA 3OSGA 2X6OA 4UUSB 2K9SA 4W1UA 5IP7J 1U8BA 3A01B 5IP6A 3CQZJ 2X9DA 2IBDA 4D7MA 5IOYA 1OCTC 4XRMA 3IH3A 1MBHA 3BT9A 2M34A 1FTZA 4C3IJ 1W0UA 1UG2A 1MH4A 2HOSA 2JA6J 4BY7J 2FJ1A 3JRHA 5FKOA 5JLXA 2ZB9A 2LVSA 1K83J 1X2NA 2WV1A 1TWAJ 3S1RJ 5K7HA 2R92J 1FIPA 5E3OA 2KT0A 5GPAA 5EGOA 1U9NA 4HNVA 1ORKA 2GM4A 3GBGA 1MSFC 1ZKGA 3BG3A 3A01A 3OSFA 3S2DJ 3S15J 1RETA 2DMQA 1LE8A 1GDTA 2K40A 2YUSA 2FD5A 1TWGJ 4JX6A 1G2HA 1FEXA 2R7ZJ 4RDUA 3HOXJ 1GT0C 3RQIA 5F27A 2EZLA 2NOGA 1IV6A 3SJMA 4IEJA 1ZTRA 5EZGA 1GVDA 3MVPA 2LK2A 3S1NJ 2DMNA 4XICA 1FJLA 4EEFG 3HOUJ 1WGXA 1Z0XA 5HODA 3PM1A 3BTJA 2DA7A 4A3EJ 2NS8A 2EZKA 3ZQCA 3GTOJ 1MBGA 2LY9A 3A03A 2CUEA 3TW6A 5M5WJ 2NVQJ 5J1UA 4A3BJ 2XPVA 1ETWA 2Y30A 3M4OJ 2HOTA 1HCRA 1TWFJ 2O9LA 3JRIA 1QRYA 2DA2A 5F0CA 1TWHJ 2CQQA 2IEKA 1ETVA 1F36A 2VKEA 5EEAA 2KDZA 2CRGA 1IUFA 2ID3A 3GTMJ 2OF7A 3JRDA 5EG0B 3JRBA 3NARA 1I50J 4A3IJ 1A5JA 1VNDA 2ECBA 2LLKA 1JTYA 1RKWA 1H89C 3WHBA 2ME6A 3CCYA 3BG9A 4L5EA 4JX4A 1OCPA 3BTIA 3S16J 3LSJA 1QVTA 1JUSA 2JA5J 3ZQIA 1ZQ3P 3SFIA 2M8GX 1WI3A 2JMWA 3K7AJ 2Y9YA 1ETOA 5J1RA 2E2IJ 3S1QJ 1F43A 2X48A 1PUFB 3HOYJ 1WPKA 1ITYA 2R5YB 1FTTA 2G0EA 5FKNA 2MGQA 1FIAA 5M5XJ 2B63J 9ANTA 3HKZN 2LFBA 4A3JJ 2JWTA 5GP9A 1HDPA 3G1LA 2Y2ZA 3BQZA 4FE7A 1AU7A 2ME0A 5IYBJ 3S14J 4Y52J 2R5YA 1NK2P 2NVTJ 4C3JJ 3FIWA 3IV5A 2R0QC 1VF9A 5F04A 4A3CJ 5IP9J 3E7LA 1Q1VA 3L1PA 1ETXA 2LR8A 3NAUA 2HDDA 1JTXA 2LD5A 3MN2A 2JJ7A 3ZQHA 3WHCA 3JRCA 2M0CA 2O7OA 2D5VA 1ZGWA 4ABZA 3HDDA 3MKLA 3I4NJ 2CQXA 2L9RA 3QPLA 1IGNA 2ECCA 2TRTA 2L0KA 2AHQA 2HXOA 1RR7A 1UHSA 2L7FP 5GPCA 1U9OA 4I76A 4FTHA 2Y9ZA 2HXIA 3HOWJ 3QQAA 2H1KA 4JYKA 3O8GA 3HGGA 2L7ZA 4XRSA 3LSGA 2QCOA 2DA5A 2FQ4A 5FKKA 2XSDC 1MSEC 4D5CA 5EGOB 2L7MP 5C4JJ 3GTQJ 2HOAA 3HGYA 1T56A 5J3LA 2EZHA 4M3GA 2W48A 1MBFA 2NVYJ 2XGCA 5IYCJ 4X6AJ 2N8GA 5DS9A 1I3QJ 2GBYA 5C44J 3D1NI 4A3KJ 2DA4A 2VKVA 2XRLA 3RZOJ 2NS7A 1ETQA 3HOVJ 4FCYA 3RZDJ 3H3VK 4UUSA 2JA7J 4A3GJ 1LE8B 2ELKA 2HQ5A 4MFDA 5FKMA 5DTDA 1JJ8C 3VPRA
chains in the Genus database with same CATH superfamily
1TW3A 2BW3B 3V8JA 1CF7A 2R7SA 3KLNA 2EIMH 1USSA 2ZJQF 1QGPA 4AC0A 2DA6A 3ULQB 2Q0OA 3F21A 2QQ9A 4HLXA 2XGXA 4LMYA 2YU3A 4BYYA 3VOEA 2YU9J 4HF1A 2LH9A 3ZQGA 2ACJA 1I1SA 2OPTA 4Q4ZF 2ELHA 1TT0A 4MTEA 4P96A 3ZRGA 4D1QA 3WTXC 1P7IA 4LIUA 5F64A 1EJ9A 2BOLA 2MG4A 4HSTA 4P9UA 2BY0A 2W1OA 3WTUC 3W6VA 4A3FJ 3ABTA 3ZOBA 5J1YA 1O3TA 3X2QH 1SMTA 4CA0A 2KFDA 4U0YA 1H88C 1FY7A 1MJBA 4YRVA 3OS0A 1SVLA 3HRSA 1ONVA 4ITVA 1JI8A 3FX3A 3SDGA 3WU0A 3CMEI 2RV8A 2EA2A 1T6SA 3K4BA 4UVCA 4ZYAA 4DYRA 1SMYF 1PUEE 4EM0B 1GV2A 1HW2A 1W5SA 4GFBA 2ZNZA 2HZDA 1QVUA 1IN8A 5L3GA 1BI3A 3JTHA 4RAGA 4RM3A 2UXXA 3FKIJ 3HG9A 3E0JB 5FRMA 2VXDA 3JAMZ 3F23A 2YR2A 2HDWA 2VPLA 4HOBA 1EH6A 1D0ZA 1X4OA 4XRFA 5IOZA 3IP4B 1FP2A 3CP8A 2WAQN 1BI1A 4NC7A 4B48A 3ABMH 2V1XA 1B1BA 2PMZN 1X1AA 4DZJA 1O3SA 1NH3A 4OU0A 3PO2J 4CCMA 3K1MA 4MEYF 1YW9A 3MAJA 2O6GE 1WCMJ 3FZVA 4G94A 2STTA 1QU3A 2R5ZB 1AKHB 1DU6A 4LK0F 2Y0MA 3GLLA 3KP6A 2Z5UA 1LEAA 4M3EA 3DPUA 1AOYA 1UG0A 1B72B 1J59A 4AVZA 1V4RA 1YJNI 1ULYA 5E1XA 3ZGKA 3GZNB 4BACA 1P4WA 3KYDB 4HF0A 2JT1A 4HAMA 1PDNC 3ZPLA 1VQ6I 3GFJA 1FMWA 1FX7A 3HSRA 1O7FA 4AVPA 1VQ9I 2CYYA 3I55I 5DUKA 1K7AA 2OTJI 4CYCA 1J09A 2HPMA 3BG6A 1Z67A 4IHYA 1IZ1A 4IVNA 3BTLA 2E7XA 3S3OA 5FO5A 4CH7A 4OIRF 1VI0A 2NOJB 3WTSC 4WK8F 2PBIA 2ZFUA 3DPLC 4HPQA 1CQTA 2MW8A 1K78B 4HG2A 1IRXA 3OV8A 1HW5A 2LKPA 3K0LA 4CUGA 1LFUP 2HEOA 2CJJA 1IN6A 5FFXA 3P9CA 3ASOH 2ZBKA 4GXOA 3WGGA 2KRCA 4XKBA 3DFGA 1S6LA 3FK6A 4NB5A 5HDGA 1YRNB 4OWRB 4HV5A 2GLOA 4ZZDA 3M3YJ 4V19K 5CPRB 3K70C 4D7NA 2R7VA 2DDAA 2IGOA 2R5ZA 3BR0A 1AKHA 3PNYA 1RKTA 2ZMEA 5M3FJ 3BZCA 1ON1A 2RGVA 3I4PA 2GOMA 3ABLH 2CU7A 3BQYA 4YIIA 2JA8J 5IYDJ 2K27A 2ZC2A 2ETHA 3T1BA 4M6XA 4KISA 4ETSA 3GTGJ 1E3OC 4LG0A 1ETYA 3AAFA 1W7PB 1T08B 1MH3A 3V7CA 2HQAA 4G12A 3FXRA 1RC9A 1T2KA 3TW7A 2M5WA 4NBQA 4AIDA 3IH2A 4ZJZA 2DN0A 4M3DA 1F5TA 3ZQLA 1I6HJ 3QP6A 5EEGA 1QZYA 4IRHA 3R61A 5H6QA 4UUVA 3J7AY 4S05A 4PSWA 1S7EA 4KJZA 5KAIC 2CV2A 2R7WA 3EYYA 1FSHA 3B02A 4XN3A 2J5OA 3K69A 1KU3A 1T95A 4BDYA 2BHYA 3GF2A 4DYQA 1PUFA 2X6XA 3JRAA 2WY8Q 4PUSA 1WZ2A 1YRNA 2ICWG 1D8KA 2DJNA 1K61A 4XLHA 3G1OA 2PG4A 1HQCA 1P7JA 2OAZA 3IHUA 1A6IA 2M0MA 2QVOA 3HB9A 3OS2A 1O4XA 5KK1A 2DK5A 3CCVI 1O3QA 4A69C 4I09A 1IRZA 1LFPA 2KIUA 1OQYA 4BQQA 3W2VA 1ENHA 3PQKA 5IPAA 4OMYA 4IX7A 2O5RA 3ISPA 1KQ8A 1VQ4I 3TGNA 1WH5A 1XS9A 3FMSA 1BJZA 4I98B 1GUUA 2FU4A 3Q0WA 4BEHA 2HTSA 2IGMA 3W6JB 3JSPA 4MHGA 5F1RA 3OSGA 4C30A 3GEZA 2KZGA 2MC4A 4KIGA 1LVKA 3A01B 4N9IA 2P6SA 5IP6A 2QYOA 2IBDA 2JRMA 5ICCA 3IH3A 1SAXA 1KU7A 2KHMA 2M34A 1TNTA 2EFWA 1W0UA 2K9LA 3OYKA 2BY3A 4ON0A 1I39A 2QKLB 1U3EM 4CYDA 1K83J 1BJAA 3U2RA 1X2NA 2WV1A 1TWAJ 3S1RJ 2FF4A 2BVLA 4F52A 3EUHA 4A0ZA 2GOXB 5K7HA 4BHBA 3QYBA 4XR6A 2KT0A 5EGOA 4IKFA 2HYGD 1YFHA 4P5OA 4HNVA 2PLYA 3LA2A 3A01A 3KFWX 3OSFA 1XGSA 1Z3YA 3KP4A 3S15J 3KYLA 3REOA 1HC8A 4HEA2 4WXHA 2DMQA 5HNFA 2Z9OA 2K40A 2DOFA 2QLZA 4M6YA 3BJOA 2PMUA 1IN4A 1TWGJ 3OYEA 4KICA 1FEXA 2R7ZJ 2VE9A 1GT0C 3RQIA 4JK1X 5ED4A 4L9JA 4AM3A 2EZLA 5TRDA 2NOGA 3VDXA 3SJMA 2Y75A 1ZTRA 3HUGA 1GVDA 2NAZA 3EQLF 3MVPA 3S1NJ 3LSKA 4PK4A 2DOEA 3BP8A 4UXNA 1FJLA 1MW7A 1WGXA 2L9VA 3HC7A 3CJTB 3PM1A 4BHCA 3AL0B 1EKEA 2X85A 1HKSA 1P4XA 1SVMA 3GTOJ 1D1CA 3BCAA 3M7GA 2CUEA 3TW6A 5M5WJ 1Z3XA 2NVQJ 4ZYHA 3CCQI 5J1UA 3V7RA 5LBQA 3VFZA 1G59A 1HCRA 4ZDOA 3H3UA 2M30A 1QRYA 3QPHA 2DA2A 5F0CA 3FDYA 1TWHJ 2IEKA 1ETVA 2VKEA 2KDZA 4ENKA 2P7CB 1IUFA 5GAEJ 1RUNA 4P55A 3JRBA 3SEZA 3GFMA 4FASD 3DTIA 5HS8A 1HW1A 1A5JA 1P9QC 3P7NA 2LLKA 3P9KA 1ZRDA 1JTYA 1XGOA 3WHBA 4RM2A 4DGWB 5BPIA 2FMLA 4JX4A 2X0LA 3EDPA 3PFYA 1OCPA 1Y0NA 3S16J 5J6XA 2P4WA 2IPQX 2VBZA 4B8XA 3OYDA 3DF8A 3ZMZA 3EUHC 4F91B 5LFAA 3KP7A 4BU2A 2QWWA 2MLKA 2JMWA 3KEQA 1G8XA 2Y9YA 1ETOA 2W00A 3S1QJ 4M73A 3E5QA 2OCEA 2X48A 5DM7F 1PUFB 3CC4I 1XCBA 3HKZA 2XAJA 5KNLA 2IA2A 3ZR8X 5HDKA 5L3EA 1FTTA 4HRIA 2MGQA 1FIAA 2B63J 2MLGA 3RKWA 2G7UA 3V8KA 3BQZA 4FE7A 3PUFA 4KT5C 2ME0A 4A0YA 1MMNA 3IRQA 2K4BA 2K4JA 3SDBA 3CZ6A 3FIWA 3LL7A 4II3A 1FYMA 1SFKA 1VF9A 5F04A 5FB2A 4I7HA 1Q1VA 4H0EA 2EFNA 3EPZA 1OCRH 1OPCA 5LEJA 2XSJC 2YPRA 5JHFA 2HDDA 4UHTA 2JJ7A 3WGHA 3WHCA 3JRCA 2M0CA 1Y39A 2O7OA 2W4SA 3CO6C 3AFHA 3BZ6A 1IN7A 2ZXWH 2PN6A 2UUZA 3ZMVA 2ECCA 3D5RC 2P0WA 3ZN1A 2BYVE 5LRSA 2AHQA 2EFPA 3C1DA 1RR7A 3SZPA 1R6RA 3HJEA 4XLPF 3HYIA 3DLLF 3PJRA 1VQ7I 2Y9ZA 4PFPA 3I56I 3K4NA 1ACIA 5E8GA 4PFOA 2H1KA 4NQWB 2GWRA 4C2UA 3JCUC 2EV5A 2HPIA 2L7ZA 2WY7Q 3FXOA 4E7SA 1SFEA 3EETA 2DA5A 2E1CA 5FKKA 3ESWB 3RDIA 3H0DA 3ECHA 1AWCA 5CLSA 1MSEC 5EGOB 2L7MP 3LMMA 2XKOA 3HGYA 1T56A 3VYTB 3H9JA 5J3LA 3PNTA 4ENJA 1QZEA 4HDVA 2EZHA 1KONA 1Z6RA 1O57A 2W48A 4DJAA 4Q47A 1OCOH 2NVYJ 4IF4A 4ZDLA 1P4AA 4KFCA 5DS9A 5L3FA 1I3QJ 1R5HA 2GBYA 5CYVA 3D1NI 5ICFA 4ENNA 2DA4A 2VKVA 2EWNA 2XRLA 4GYIA 2PJRB 1LVAA 1YS7A 2KIQA 3FMRA 2F5CA 3IWFA 3U1KA 1YOVB 4GYGA 4RAYA 3MWMA 4XNFA 2HVQA 4CHUA 4CXFA 4NC6A 2X6YA 3RZDJ 2FUG2 1U0JA 2HQ5A 1Z9CA 3I59B 5K5OA 3ZMTA 5DDGA 1JJ8C 3HOSA 1DDNA 2FE3A 2COMA 2VBXA 1ZK8A 2E2HJ 2KZVA 4L5JA 3QOEA 3GFIA 2KRHA 3GTPJ 2L7KA 3AKZA 4HW0A 5GTHC 2K3PA 2EBIA 4KDPA 1YIOA 2KIMA 4KN4X 3ECOA 4AD9A 3BR1A 4Y3OA 3ZMDA 3JREA 2W84A 4KIFA 1R7JA 1BIAA 1UMQA 2YSRA 1BW5A 4CZZA 1A35A 3H92A 2J5PA 1KQ0A 1R1UA 3OR2C 1JGGA 1TBXA 3UR3C 1TC3C 4M3BA 4CCLA 4DBQA 1I5ZA 3AL0C 1RPWA 2XAQA 3D5LA 1OJLA 2A6TA 3Q3SA 1K4SA 5J40A 1NHAA 3CC2I 3FXMA 3FM5A 3IH4A 1GV5A 3BPXA 3HEFA 1SANA 4A3DJ 3MQ0A 2DODA 1ZLKA 4XLNF 3GTKJ 4CCJA 5DM6F 1MGTA 5EJCA 1Z77A 4XSZF 2F4IA 3F8NA 3K2AA 4M6VA 3GO5A 1ZELA 5CVUA 5TGTA 2LTPA 1N75A 2BXYA 3B73A 1JE8A 2HVSA 2FOWA 1FOXA 2BZTA 5GADJ 2VOPA 1S29A 3OIQA 2FQ3A 5B66C 2P5LC 3I59A 2BW3A 1KU2A 2M2EA 5FJ8J 3GTJJ 1GHCA 1MBEA 1S7OA 2P5VA 4L9NA 4A12A 1V3FA 3PNVA 3LSRA 1QNTA 2UWMA 3WTTC 5C4XJ 4LG0B 3NWSA 3JW4A 4D5FA 4I6ZA 4XIDA 1WFXA 3ERMA 4PJMA 3H9GA 4N9HA 4NDLA 2HS5A 1QA6A 4I99C 3QWLA 2WV0A 4RLFA 5FLXK 2ID6A 1JT6A 1Z1DA 3KX2A 3MFKA 5BNGA 2LP0A 2IGKA 2R7QA 3FBIB 4RMNA 2XF6A 1IDYA 1X1CA 1E3HA 3M07A 3KPHA 1I3AA 3CDIA 3BY6A 4ZTFA 1UHWA 5LGTA 2QSHX 1XSDA 5HVQC 2M9HA 2XAGA 5D5VB 3G2BA 4HX7A 4V2GA 3E1SA 2LC2A 1BA5A 1IJWC 1VQ8I 2VC0A 2BE5F 2Y0SN 3H5AA 4QPQA 4U7DA 4NHJA 2GIZA 3R0JA 2AO9A 4BKXA 1TTYA 3DTEA 4MO7A 1G3WA 1QQIA 2G9WA 3WG7H 3CJNA 2HVRA 2JSPA 3BG7A 2VT3A 3NEUA 2F6CA 3CLQA 4XLAA 3OYHA 2E2JJ 4FETA 4YFXF 2XPUA 1XD7A 1VQPI 3HSEA 2ZCWA 1OCZH 2JRTA 1LB2A 4XONA 3G6EI 5EYRA 4MIMA 4RGXA 2Z1DA 2DBBA 1JHFA 2LF7A 4AIJA 1ETKA 2Z99A 1V5GA 5KAFC 3LAJA 1BBYA 3HOZJ 4A2UA 2FRHA 3F0CA 1RESA 3WU1B 1S7AA 3OOUA 3WE3A 3LNQA 5F0HA 4LFUA 1O7LA 2DMUA 2GA2A 1JUPA 1E3PA 1K4TA 4JX5A 4LD5A 1OYIA 2VB6A 2IW5A 2HFHA 1ZG3A 1J5YA 2HI3A 5JVTA 5EDNA 4ESJA 1UCRA 2V1NA 1IC8A 1VFCA 5LHGA 4IOCF 4XLEA 3G1MA 3A0BC 3I5UA 5H6RA 4EM1A 3BJAA 3HBLA 3JR9A 2M4GA 3C2GA 4G6DA 5CQEA 3OL3A 4BJ5C 2R7FA 4EGYA 4Y15A 2JK3A 5E20A 3I4MJ 4LK1F 1XG1A 1RIOH 1AA7A 4ESFA 3HL2A 3TEDA 3FISA 3KEOA 3S3MA 2KKOA 2CS3A 2DAOA 3I71A 2W82A 3F9KA 5LEKA 1JJ6C 1MJAA 3DPTA 2A05A 3PQJA 3FWEA 2VQHA 4GCVA 1D1AA 3E5UA 1VQOI 1QHHD 4CCNA 1D5VA 5J4VA 3S1MJ 2MABA 1R9TJ 1R5ID 4I02A 4RB1A 1MIJA 5FKLA 4RB3C 3N05A 3HPGA 1MNEA 3ERED 1RUOA 2IJLA 4ESBA 1BR4A 1H9TA 2XRNA 4QPOA 3BR3A 3HIFA 3WU2C 3VEPA 3GTLJ 3S17J 2ZXHA 2XB0X 1W0TA 1WJAA 1EH7A 4PCQA 4LIVA 1UHMA 2Q2EB 4UUTA 1KYWA 5KHDA 3NQOA 4M72A 4L0ZB 1G3YA 2VKHA 3KYCB 5HNHA 1BC8C 2VUMJ 1JKOC 4FX4A 3WG9A 4XOTA 1G3TA 3CLOA 1WJBA 4RS8A 1V55H 1V5EA 2JVHA 3DLAA 4E7KA 5EG0A 1OYWA 2IAIA 4L0YB 3K2ZA 4F55A 1VTNC 2HZTA 2DW4A 1OR7C 3T8RA 2MA3A 3J81K 4YIFA 3TKYA 3BDDA 4IQ4A 3LA7A 4W1UA 5IP7J 3RJPA 4MTDA 2R7RA 1U8BA 5E1WA 5HOOA 1GVJA 2DFEA 1R23A 1FC3A 3WODF 2LBFA 5IOYA 1LJ9A 2EA4A 3AG4H 1MBHA 2HR3A 3F8FA 1UG2A 1ZREA 2HOSA 2JA6J 2L9SA 2E71A 3I58A 3VYUB 2DQLA 5FKOA 2V26A 1BM9A 2D1HA 2EB7A 1IRFA 3PUBA 1W5TA 2VT2A 4O6JA 1YIJI 5H20A 3K4LA 2R92J 3DU5A 1FNNA 3MKWB 4UVAA 1ORKA 3TO9A 2Q1ZB 2L54A 2R4GA 3K6GA 4F92B 2GM4A 1F4KA 4A6DA 4IZZA 4PGGA 2PJPA 3S2DJ 3H5NA 1VZ0A 3PFIA 2F2EA 2R7DA 3FXKA 1W5CC 1LE8A 2MYSA 2ZNYA 5HLGA 1H0MA 4JX6A 1G2HA 5JI6A 4BH9A 3HOXJ 5A2QZ 2DYRH 3ZMSA 3MMYB 2AXLA 2F5VA 3R6SA 3MZHA 2ZJRF 2A6EF 4EATA 3DTKA 4PGHA 2LYCA 2E1MB 4RAFA 4IEJA 1MDMA 3V7SA 3M8FA 2EV6A 1UB9A 1TNSA 1D0XA 4Y13A 2DMNA 4XICA 1BOBA 3J7ZI 3SHFA 2LG4A 4KA4A 4BS9A 2F4OB 4PZJA 2DK8A 2DXIA 3DV8A 3OMYA 4Y33A 3J80Z 4JOMA 4CCOA 2E35A 3RPUA 4S04A 3OYAA 2ESHA 3M4OJ 2CGPA 3F8MA 2M7BA 3ZXSA 4ZZLA 2MH9A 4DQ2A 2F5FA 3JRIA 3CF5F 2ZJPF 3GTMJ 2OF7A 1FMVA 1V5FA 1KA8A 5BQTA 3JRDA 3NARA 5HS9A 1YW7A 4A3IJ 3M1EA 1VNDA 4D9JA 1XGNA 3G71I 5A2QK 3GX4X 4BE0A 1ZHFA 1D8JA 4IHSA 2ISYA 1H89C 3KE2A 3Q9SA 2ME6A 4KT6A 1K79A 2ADUA 3DXJF 4LG3A 2KMUA 1VQ5I 1CF7B 4OAZA 1KU9A 2K9MA 1JUSA 4YELA 2IS6A 3IL2A 5DYMA 3VYRB 3SFIA 2Q2EA 2M8GX 2BBYA 5B3SH 2LSOA 5LGNA 2CO5A 2D1VA 2FA5A 2ZSHB 2CW8A 5D6EA 1TP4A 5LHHA 3HOYJ 1ITYA 3CCMI 5BS6A 1LQ1A 5ILSA 2G0EA 1YLFA 2V6EA 9ANTA 4P1WA 4DIQA 2JWTA 5GP9A 5LRRA 1KZHA 2LREA 2Y2ZA 3S3NA 1U5TB 3S14J 1P2FA 4Y4RA 4N4OB 1MMGA 3CUQA 1B6AA 2K3FA 1HKQA 4L5IA 3PSIA 1SD4A 5D4RA 1B59A 1PP7U 1QO0D 2ELJA 2LR8A 2XVCA 3TO7A 3HRMA 4E7HA 3MN2A 4YIRX 2QBYA 5DUIA 3K70D 5LGUA 4U0VA 3S2WA 3MKLA 2L9RA 5IT3A 4G8XA 2FEZA 2V9KA 3QPLA 4Z2YA 2TRTA 4PJ0C 2L0KA 1WJEA 4LGWA 2HXOA 1P6RA 3RIRA 3MCZA 4G6QA 3U1DA 1U8RA 3ABUA 4LLLA 1FPQA 1UELB 2HXIA 3HOWJ 3QQAA 4ZYGA 2IT0A 2LKSA 2A69F 2RQQA 1YTYA 2KJBA 2E7WA 2LNBA 4JYKA 5JFRA 4PJJA 3HGGA 3BOQA 3GZ6A 1WKMA 3LSGA 2NVUB 2VE8A 2QCOA 3CCLI 2GQQA 1W36D 1ZYRF 2PQ8A 2FQ4A 3QRFF 5TISC 4D5CA 3S8PA 1OLTA 5D4SA 3QAHA 2CV1A 3COAC 1ZRFA 5HS7A 5DCFA 1ZG5A 1T8IA 1WJDA 2BY1A 2QA4I 2N8GA 2RC4A 2V79A 4A3KJ 3KZIC 1YYVA 1H9GA 4GDFA 2FXAA 4YEJA 1E17A 5D6FA 5BPDA 1WSUA 4E7IA 2NS7A 5FGMA 1BN5A 3TQNA 1KQ9A 4FCYA 1VQKI 2A3SA 1TQPA 1BI0A 4UUSA 4ZTJA 2JA7J 3NWTA 2HKOA 2KJCA 4A3GJ 1YO5C 4HNTA 3J7AO 5FKMA 1Y0UA 5DTDA 3O6BB 4LLGF 2X1DA 1HXDA 2C6YA 3ML6A 2JQ7A 2WC2A 1XGMA 1FBSA 2WAFA 1N78A 1P92A 1APLC 2BXZA 2JUGA 4W97A 5HLIA 3OYFA 3F3XA 2W7NA 5DCMA 3L2UA 4U7BA 2R7UA 2P7VB 1EF4A 3KP3A 3KZYA 1DP7P 1YE9A 4ZH4F 4A3LJ 3CESA 3DKWA 1Y1WJ 2XGDA 5FLMJ 3S93A 1X58A 3F8CA 4RLQA 3HHGA 1VQNI 1Z6TA 2B9SA 4B43A 1D5YA 5E3NA 1YI2I 1FP1D 2I8DA 3BTCA 1EV7A 3GCMA 4E4HA 3IAS2 3QODA 2RAEA 1AHDP 1TW2A 2GA1A 3LSMA 2FBKA 4II2A 2H94A 3FHNA 4OIOF 1JGSA 4XKCA 5CVIA 2KIFA 1X3WB 3TO6A 4GO1A 3CJRB 4J19A 2IS4A 2QSGX 2DO7A 3CMYA 2R7TA 2OUMA 2IRFG 5E3MA 3QP5A 2K9NA 4AYBN 4IXAA 3H3ZA 1ZH5A 3CF2A 1DU0A 2VC1A 1MMSA 3R4KA 3DEWA 3T8TA 3V4GA 4OIQF 1J2XA 3FBNB 4MNUA 4QTRA 3L2QA 1SEUA 3DQVC 2TCTA 1TLHB 4X0GA 3LOCA 2MBFA 3B6AA 1OMIA 3O3KA 2NS0A 1R4NB 3DU6A 1LUJB 3OYLA 2A5WA 4MFEA 3RCOA 1JXSA 5L3CA 1NG7A 2DYSH 2K02A 2WWYA 1PP8F 2WB1A 1TWCJ 2R3SA 2H6CA 1HA8A 1XC5A 1NTCA 2FBIA 2CWEA 1FOKA 2LKXA 5D8KB 2XV4S 3OYNA 2IA0A 3FXQA 4G9YA 2L2OA 2O8XA 4EJTA 3DWLE 3CCSI 4KYWA 5AIQA 1TZLA 4V2FA 5E17F 2X1CA 1TQIA 2QENA 2RN7A 2JZYA 2UZKA 1HSJA 4X1EA 4LOCA 4M74A 3PSFA 2DT6A 1BL0A 4OOIA 2CQNA 1OFCX 5JLWA 3OIOA 4MQ9F 2VJ4A 3I54A 5IT9Z 1BR1A 2QQ8A 3HSFA 3RKXA 2DMTA 1XX5A 3HRTA 2PJRA 2EH3A 3LFUA 4BAYA 2RQPA 4E7LA 3C2BA 3DP7A 3OR1C 4A93J 3Q0VA 3CMAI 2DMPA 2BGCA 5LLQA 1YS6A 1IXSB 1X1DA 2XB5A 4I0BA 5IY5H 2E19A 3E97A 3TP3A 1E0EA 1ZAOA 1SD5A 5EZHA 1IF1A 2OJED 1WVRA 3UNGC 3ASNH 2DTRA 3EYIA 2QSFX 2EK5A 3L2RA 1J0RA 1JUMA 2W57A 3W2WA 1IO2A 1POGA 3EUKL 3SYTA 3V8LA 1A36A 4BE1A 1FYKA 5HDNA 2QQAA 1QPMA 4XKWA 1ZARA 4EJUA 4HDUA 1B8IB 1MJ9A 4R8HA 2GAUA 1U6GA 3M8JA 1UJ8A 4XK4A 2K5CA 3BG5A 4JP0A 1B9NA 3ZQFA 2XIGA 2RREA 2UV1A 2EFQA 3C18A 1ZR4A 4CO8A 1G4DA 3N4MA 1S72I 4WWCA 3VODA 5K7ZA 4RB0A 4XQFA 5M5YJ 1RNLA 3A4CA 4GGGA 3OYIA 4EVIA 2VJJA 2OD5A 3OY9A 2HWVA 4IHWA 1IXCA 2EQRA 2VONA 4Y17A 2OV7A 3E6BA 4N4NB 1YW8A 3GZ5A 2G7HA 1CGPA 2IS2A 3MD2A 2EZIA 4DW6A 2L5QA 1STZA 4R1HA 2EIJH 1MBKA 2CUFA 4DOZA 2W24A 5DEQA 5C3EJ 1IAWA 1YX5A 4M3FA 1T0FA 4UB6C 4Z6YA 4LB5A 1T33A 4BY1J 3ZMUA 4M9SA 3BWGA 3DKYA 3O8HA 2WA0A 4EGZA 4S0HB 2M87A 3QPSA 3OL4A 1XSVA 4IHXA 3E3VA 6PAXA 3DBLB 3MZYA 4MGRA 2H8RA 1J75A 1MKMA 4IQJA 4RBOA 3HPHA 4AUXA 2ZJ2A 1W4MA 1T39A 3Q0UA 1HF0A 2Z16A 2ZXIA 5EF6A 2XROA 4UNOA 1F9NA 1S3JA 1FOWA 1OR7A 2FMYA 3OYMA 4I01A 3IWZA 2XPWA 3S2HJ 1RR8C 2HYJA 4DNCA 4BBSJ 4BJTA 2X6OA 2K9SA 2OZ6A 2A07F 3R60A 4CICA 2EJRA 3HXLA 4L9TA 1OCTC 4XRMA 2TDXA 2EPFA 1FTZA 1MH4A 2VIXA 4BY7J 3JRHA 3TDZC 3VSLA 3OS1A 1Z21A 5JLXA 2ZB9A 4EJWA 3W2AA 5JHUA 2WBMA 1DQUA 2CMPA 3G4SI 2VL8A 2LVSA 2RVCA 4IO9F 3RI4A 2A68F 5ICGA 1Y8QB 1LEBA 4Q5SF 1LDJA 5E3OA 5GPAA 3IRRA 2DJIA 2E5NA 4XLCA 3RYPA 3GBGA 1ZKGA 3BG3A 4AIHA 1D1BA 4PDKA 5FD6A 1R5GA 4MEXF 5D5WB 2AXTC 2YUSA 2FD5A 4LITA 3TOBA 2CV0A 2L01A 1REPC 2GXAA 3R0AA 2CSOA 4PSXA 2OZUA 5J8CA 1IV6A 5B1AH 1IN5A 5FRNA 1XDUA 2LK2A 2VBYA 2BV6A 2LRDA 2W85A 3LQQA 2E60A 4EEFG 1Z0XA 3BTJA 1UFMA 4A3EJ 2NS8A 1ZN2A 3ZQCA 2L3DA 3A0HC 4L18B 2LBFB 5EEHA 4IL6C 1TT5B 4CCKA 3TDUC 3L9FA 4A3BJ 2MC3A 2XPVA 4XKVA 4TV7A 1ETWA 2OCCH 2Y30A 1XMXA 3BJ6A 3CUQB 3WTYC 1TWFJ 3I64A 1S5LC 5EEAA 4YFKF 2CRGA 3E6MA 2GZWA 5EG0B 3RPUD 1I50J 2ISZA 4UV9A 1Y56A 2E5ZA 2ECBA 1B9MA 2JUCA 3D0SA 4KMFA 1L3LA 3QU6A 3WGIA 1W7PD 3TMOA 4XMYA 2NXNB 3BG9A 1Q1HA 2VXZA 2QEXI 1XPXA 3WTZA 3C7JA 3BTIA 1DP3A 2Y0SA 3LSJA 1QVTA 1W36C 5CVRA 3ZQIA 1ZQ3P 4IHTA 3WE2A 4CGZA 2QUFA 3K7AJ 1KGSA 2DQRA 5J1RA 1F43A 3RKYA 1XB4A 2GXGA 1WPKA 1Z91A 3CUQC 3D5SC 4CSWA 4BQOA 4D0PA 3L7WA 4N0BA 5JR3A 5CKTA 4IPAA 5FKNA 2BY2A 1FBQA 5M5XJ 5ILVA 2UXNA 3HKZN 2YX7A 2K7LA 4YFNF 4A3JJ 3ABKH 2RNGA 1AU7A 3BZKA 5L3BA 3MKZA 4Y52J 1R22A 1U5TC 2Q8KA 2NVTJ 3K4KA 4BGDA 4C3JJ 2QZ8A 3JSOA 3IV5A 2R0QC 1FOYA 3CP2A 2DCEA 3C2HA 3BC8A 1MZBA 1VQMI 1A04A 2DPDA 2D45A 1ETXA 3ELKA 3NAUA 2LD5A 4ABZA 3HDDA 3SQNA 2CQXA 3I4NJ 1R00A 1R58A 3FF5A 2MD5A 3RSNA 1NG6A 1UHSA 2FNAA 2JPCA 2L7FP 2LMDA 5GPCA 3J7YJ 1ERDA 2IXSA 3L09A 1Z7UA 2DI3A 4I76A 3FHZA 3IC7A 2VJ5A 2Z33A 4OAYA 2CH0A 5D5XB 2V4JC 2WAEA 1OKRA 4KMUX 4I2OA 2KRFA 3HTUA 2KQRA 2ZMEB 3AG3H 4XRSA 2F4MB 3N97A 2L9NA 2AQEA 4EMSA 3DKXA 2KISA 4PJNA 2CW7A 1WJFA 3GTQJ 3F6VA 2HOAA 4WXDA 2PFBA 4NNJA 2JVGA 4M3GA 5D5UB 2LY1A 4X6AJ 3FM3A 3SZGA 1BI2A 3GVAA 5C44J 1L0OC 4IRIA 1X4PA 4E7ZA 2V9VA 2CG4A 3HZJA 4BUPA 4M9ZA 3K4CA 1C0WA 3CMMA 3GMEA 1XDSA 5DD8A 2LY2A 1HBXG 3RZOJ 3CUOA 4IOAF 3DEEA 5L3DA 1RI7A 1YITI 3ZCOA 1M1EB 3GFLA 3E6DA 2BVMA 3H3VK 2QM3A 3F22A 2ESNA 3A1YA 4RAZA 3F8BA 1LE8B 2OQRA 2ELKA 3KIOA 4FT8A 2JPBA 5J8FA 1XMKA 2F48A 1U2WA 3VPRA 4EJOA 4CZCA 1I6XA 2NYXA 3CJQB 3M8EA 1B72A 4KNYA 1UAAA 4ZDPA 2DFIA 3K4JA 3H36A 1Y8RB 1H8AC 5M3MJ 4B3AA 3L2CA 2DLLA 2E1NA 4UB8C 4QLCU 5E3LA 2KDOA 2M4KA 4EQQA 1JT0A 2CQ7A 3FK7A 2PMHA 4FISA 3FXJA 4HX4A 4MLOA 4M71A 2Y48A 4DZPA 1Y6IA 3PIOF 4IHVA 1BIBA 3FKJA 1IRGA 1OISA 5FFZA 1BOAA 2L4MA 1ON2A 2XKPA 2YX4A 5ERIA 4FHTA 2DDBA 5J47A 1MNMC 1FWZA 3K10A 1X1BA 1XSXA 5E79C 1ZR2A 3KCCA 5LHIA 2VOOA 2M8EA 5FD5A 5J4YA 3IKVA 1J9IA 3M1CA 4XORA 1EA3A 2DT5A 3H5RA 5DV5A 3QU3A 4B4CA 3Q5FA 2V9PA 4JBAA 5LD2C 1X1PA 2OA4A 3J81Z 1IV8A 2NRAC 3BCBA 4C2MJ 4HYEA 4M9XA 2DA3A 2VJIA 1BR2A 3O2PE 4A0XA 5JVGF 4RGSA 2Z3YA 5F0FA 2Y31A 2H1LA 2O8KA 3JRFA 4OIPF 2L02A 4FE4A 2K9QA 4AWXB 3MZ8A 3GXOA 3TP0A 1B8IA 2X4HA 2H09A 4LLNA 2A61A 2COBA 5D8LB 1G6NA 2WB1N 4G7OF 5F1JA 1TL8A 2DTZA 3SFZA 1LDDA 2M7AA 3DCFA 5HLTA 3WTWC 4KITB 2VLAA 2O03A 2PMZA 5DCMB 3KEYA 1WHUA 3HUGB 3BLYA 5BOXA 4WX9A 3AG2H 2FOKA 3L2WA 2EFOA 1IXRC 4C3HJ 2IP2A 3BR5A 2O3FA 2BEOA 2ZSIB 2E1OA 4BJ6C 5HLHA 2AQFA 3K1PA 1W1WE 2HU9A 2LOOA 4R79A 2PX9A 4BQNA 5DD4A 3CCRI 4WF2A 2VASA 3DBRB 5FLVA 5K5QA 2HYFA 3SZTA 2YS9A 1HDDC 1YX3A 1YJWI 4JQFA 3W3CA 2XC7A 4NQWA 4HSRA 3RKQA 1R4MB 3GUDA 1FSEA 1LDKB 4XLFA 1X3UA 4I0AA 3NRVA 5GAHJ 3CCJI 4BXXJ 1IW7F 2VPRA 2CQKA 2QQBA 3HM5A 3VWBA 1LNWA 5KCMA 1TQMA 3PO3J 4BXFA 2XASA 3A2KA 4QSHA 2FSWA 3BR6A 1FYLA 3BR2A 1HLVA 2H27A 1X2MA 1OYYA 3H0GJ 1A31A 2IVMA 1QPIA 3RYRA 2I10A 3JRGA 1ZRCA 1N77A 4NC8A 5FROA 2P8TA 4A5MA 3JTGA 3VB2A 3SEQA 3H35A 4F7ZA 4HLYA 1JKQC 1WWXA 1I27A 1IG7A 2R93J 4A3MJ 1KYZA 3A02A 2XDVA 2I5UA 4HX8A 4BNCA 4AIKA 2M1BA 2X1EA 5CVVA 3KETA 4OINF 1JKRC 1DGWY 4PJLA 1F1ZA 4BEHB 2P81A 4BQAA 2VQCA 3HOTA 3VYSB 1R1TA 1SVOA 1FZPB 2QF7A 3SXYA 3S32A 1U78A 2DOAA 1YG2A 1MMAA 1WI9A 2HTJA 2XAFA 3DEUA 4HZFA 4C9YA 3JAMK 1SFOJ 1JKPC 2K85A 4CYCB 3LFKA 2E1MC 2O61A 1IDZA 1FT9A 2XGEA 1MBJA 4BE2A 4B1RA 4O5VA 1Y1VJ 4BDZA 2IA1A 1DGRM 2H6BA 1WH7A 3EUAA 3CTAA 3TL4X 5CQGA 3OYJA 3GWZA 3IAM2 1DPRA 2DT7B 2F5DA 3F72A 1LFBA 2M45A 4FX0A 3FXUA 4LB6B 2DA1A 3GW2A 5B5EC 1FBUA 4DYCA 5E18F 2AS5F 1VQLI 3H1CA 2MSYA 3B6CA 4UV8A 4GRIA 3CDLA 3TOAA 3UKGA 1X19A 2WTEA 3U21A 1XMAA 3W6KB 3WTVC 3OYCA 1HOMA 2KLOA 4A6EA 1SD7A 3CCEI 2FX0A 3CO7C 3QYFA 2ZO4A 1PYVA 5CVJA 2OBPA 3ZQ7A 3LAPA 3RTRA 4HQEA 4BL0B 4FQGA 2RKHA 3K9TA 5FLXZ 3OYBA 5F08A 4BBRJ 2CUZA 3AG1H 1RZ4A 1BW6A 4NUBA 1IUYA 4MQVA 3V42A 1EH8A 2D2WA 2CFOA 1W7PA 2VI6A 1MD0A 4E70A 1ZGAA 4RGRA 4QIWN 2VBWA 3IKTA 4L9VA 1NK3P 5H2FC 4RGUA 1LKXA 2JN6A 1MDMB 2ZFWA 2VQLA 2EILH 2HKXA 3LWFA 3LSTA 2NVXJ 3RPQA 4XRSG 5B1BH 5K5RA 4H4KC 3IUOA 3OOPA 3CDHA 2OC6A 4Y7NJ 1ZG1A 3L2VA 3LSPA 4E7JA 4F3QA 5K7FA 2HGCA 3CD6I 4UUSB 2A5YB 2GXBA 2R7XA 1X3ZB 2ZKZA 1WQ2A 1Z05A 3CQZJ 2VKDA 2X9DA 5BMZA 3I3LA 4D7MA 2MH2A 3FMQA 5KVRA 2M3AA 3HTSB 2BHZA 3BT9A 4XM3A 2PEXA 3U9GA 4C3IJ 3CC7I 2OU2A 3LSIA 2FJ1A 1ZGJA 2HNHA 2XF7A 1XN7A 2DPUA 3T5XA 1SD6A 1ODDA 2F5EA 3LQRA 2JA2A 4EJVA 1MNDA 1FIPA 2V1UA 1WJ5A 1U9NA 1N25A 1GLNA 5IT9K 2V6CA 1MSFC 2MD0A 1YHQI 1B4AA 2L4AA 4BHPA 1RETA 1USTA 2FBHA 3PIPF 4LJZF 1QHGA 1GDTA 1J7KA 4CDGA 1T98A 2RDPA 4KIBA 4RDUA 3G3ZA 5F6FA 4HA8A 5F27A 2CFXA 4K2EA 3L00A 5EZGA 2JTVA 3P5JA 2WAQA 2E36A 4OMZA 5TJJA 3HOUJ 1JHHA 5HODA 3T0YA 4EM2A 2X6WA 4UVBA 2DA7A 2EZKA 1HKTA 1MBGA 2LY9A 2RNJA 3A03A 4HF2A 2LDUA 2CW0F 1K6YA 2IGNA 3ZP5A 2P6TA 3GLXA 1G3SA 3VSKA 3MKYB 5GAGJ 2VODA 1I1GA 2JSCA 2HOTA 1XTAA 2P5KA 4IRGA 4WCGA 2VQGA 1FLIA 4XSXF 1UZCA 2O9LA 2IS1A 4ZYDA 3KZZA 2CQQA 2Y69H 1R36A 1F36A 2OQGA 4G7HF 2ID3A 2NNNA 1DUXC 4ENMA 2KPMA 4HNUA 4A5NA 1SC7A 1QBJA 4HQMA 2H8WA 2QGUA 5E8IA 2WADA 1WRJA 1T38A 1QZZA 2XAHA 1RKWA 3CCUI 2K86A 3OWTA 2DFFA 3CCYA 4U88A 4L5EA 1MMDA 1PJRA 3BPVA 3GYHX 4UY8I 3HRUA 2JA5J 1ZLJA 1GXPA 2XF5A 4ZYEA 4XBFA 4ANJA 2ZXJA 3HHHA 4KUMA 1WI3A 3LSHA 4EV0A 1SFXA 4G6TB 1T0FC 2A6HF 2HQNA 2E2IJ 1D0YA 2CUJA 4G7ZF 3I9V2 3P9IA 1WJCA 2LF8A 2R5YB 1D3YA 3PL8A 3I53A 4B44A 5GTIC 1R1VA 2LFBA 1HDPA 1HSTA 1O3RA 3G1LA 1S8NA 4P9FA 5AIPA 3ZQQA 4F93B 3E5XA 5IYBJ 4C2TA 2R5YA 1NK2P 3OYGA 5K1YA 4QWQA 2KP6A 2EINH 1RRJA 5ILUA 4HBLA 5IP9J 2EV0A 3E7LA 4A3CJ 4XL9A 3L1PA 4HV6A 4E6KG 1JTXA 3MEXA 3ZN0A 3ZQHA 4BXUA 2W25A 4AYBA 3G73A 1ZGWA 3QOPA 2D5VA 2MFZA 4ASNA 1DPUA 2B0LA 1V54H 2OTLI 4KN7X 4ZC3A 1K78A 3QYEA 4DBRA 1IGNA 4XOPA 3K4MA 4Q48A 1A6QA 1U9OA 1YQAA 2HQRA 2VN2A 3KP2A 3LA3A 1OCCH 2NNYA 4AU7A 4FTHA 1S9HA 4U87A 5CJ9A 3ROUA 2X51A 2ZMEC 2QBYB 3O8GA 1SFUA 4YG2F 3KP5A 3FXLA 3TBIA 2XUBA 2XSDC 1Z7LA 3OIPA 5E1ZB 2Z2SB 5C4JJ 3ONQA 3H9QA 4B09A 2V1DA 4RB2C 1LPQA 2XHKA 4IJAA 1U5TA 3RQ4A 1MBFA 2O0YA 2XGCA 5IYCJ 2PI0A 1K6OA 1BC7C 4B47A 3J80K 2B7EA 4XN0A 4B3XA 4O3MA 2V7FA 1R71A 2R7OA 4WXCA 5AONA 1R49A 3BROA 2DU9A 3Q9VA 1ETQA 5ICEA 4J00A 4U0WA 3HOVJ 1XCVA 2QKMB 2XAUA 1GXQA 3C3WA 1YJ9I 3E6CC 2STWA 1PVEA 2DFHA 2EIKH 2FNPA 4J01A 2GIVA 3DBHB 3M9AA 2HOEA 3QPTA 4MFDA 2KL4A 3KLOA 2HDCA 1E2XA 3I0TA 3K1NA 4RA2A 1SAUA 3F6OA 2E34A
chains in the Genus database with same CATH topology
1ZK8A 2E2HJ 1B72A 4AC0A 3GTPJ 1APLC 1H8AC 4W97A 2DA6A 5M3MJ 4B3AA 2EBIA 5E3LA 1EF4A 1JT0A 2YU9J 4A3LJ 3ZQGA 3BR1A 3JREA 2OPTA 3FK7A 4MLOA 4FISA 1Y1WJ 2XGDA 5FLMJ 4DZPA 1X58A 4IHVA 1UMQA 1BW5A 1P7IA 1MNMC 1JGGA 1TC3C 1D5YA 5E3NA 2MG4A 4M3BA 3BTCA 1RPWA 1ZR2A 3W6VA 1OJLA 4A3FJ 3Q3SA 3ZOBA 3IH4A 1GV5A 3HEFA 5J1YA 1SANA 4A3DJ 2RAEA 1AHDP 3GTKJ 4B4CA 1H88C 1Z77A 3SDGA 4C2MJ 4J19A 3K2AA 4M6VA 2LTPA 4DYRA 2DA3A 3CMYA 1GV2A 4GFBA 5F0FA 3GTJJ 5FJ8J 2M2EA 5E3MA 1MBEA 1QVUA 2K9NA 4AYBN 2Y31A 3FKIJ 2O8KA 3LSRA 3JRFA 5C4XJ 1DU0A 4FE4A 4D5FA 2K9QA 3DEWA 4XIDA 4I6ZA 5IOZA 3TP0A 1B8IA 4NDLA 2WAQN 4QTRA 2TCTA 4DZJA 2ID6A 1JT6A 2PMZN 2COBA 3LOCA 3B6AA 3PO2J 2WB1N 5BNGA 2LP0A 5F1JA 2DTZA 3DCFA 4MFEA 1WCMJ 2R5ZB 1AKHB 1IDYA 1DU6A 1TWCJ 1XC5A 1NTCA 4C3HJ 3BR5A 4M3EA 2E1OA 1B72B 2LKXA 2M9HA 4V2GA 1BA5A 1IJWC 5FLVA 2Y0SN 4V2FA 2YS9A 1HDDC 3RKQA 2AO9A 4BKXA 4MO7A 4X1EA 4LOCA 4CYCA 1BL0A 1OFCX 5JLWA 3OIOA 4IHYA 2E2JJ 3BTLA 4BXXJ 2DMTA 2VPRA 2XPUA 1VI0A 3HM5A 2EH3A 3PO3J 1CQTA 2MW8A 4QSHA 4MIMA 5EYRA 3BR6A 3BR2A 3C2BA 1HLVA 4A93J 1X2MA 3H0GJ 3Q0VA 1LFUP 2DMPA 1QPIA 1ETKA 2CJJA 2I10A 3JRGA 2XB5A 2E19A 3TP3A 3FK6A 3HOZJ 3F0CA 1YRNB 1RESA 2GLOA 3OOUA 5EZHA 1JKQC 3LNQA 5F0HA 2R93J 1IG7A 3M3YJ 4A3MJ 4D7NA 3A02A 2DMUA 2R5ZA 3BR0A 1AKHA 1JUMA 1RKTA 1JUPA 1JKRC 5M3FJ 1POGA 5IYDJ 2CU7A 2P81A 3BQYA 4JX5A 2JA8J 2QF7A 2HI3A 5EDNA 1IC8A 1U78A 1VFCA 1B8IB 3G1MA 3GTGJ 1SFOJ 1E3OC 1JKPC 3HBLA 3JR9A 1ETYA 4XK4A 4CYCB 3BG5A 4JP0A 1IDZA 3ZQFA 1MH3A 2XGEA 1MBJA 4B1RA 1ZR4A 1Y1VJ 2JK3A 4G12A 3I4MJ 1XG1A 5K7ZA 1WH7A 5M5YJ 3TW7A 3TEDA 3FISA 3IH2A 1JJ6C 1LFBA 2DN0A 4M3DA 4IHWA 3ZQLA 2EQRA 1I6HJ 2DA1A 4DYCA 3S1MJ 1S7EA 1R9TJ 2MSYA 3B6CA 4DW6A 2EZIA 5FKLA 3CDLA 3UKGA 1HOMA 1MBKA 2CUFA 2FX0A 5C3EJ 4DYQA 1PUFA 4M3FA 3JRAA 3BR3A 1T33A 4BY1J 1YRNA 3GTLJ 3S17J 2DJNA 2XB0X 3O8HA 1W0TA 5F08A 4BBRJ 1K61A 4S0HB 3G1OA 3QPSA 1BW6A 1P7JA 1A6IA 3HB9A 4IHXA 4UUTA 1O4XA 2H8RA 2VI6A 4A69C 4RBOA 1IRZA 4QIWN 4AUXA 1NK3P 3Q0UA 1HF0A 5EF6A 1ENHA 5IPAA 2VUMJ 2JN6A 1JKOC 2NVXJ 4XRSG 1WH5A 1XS9A 1BJZA 2XPWA 1GUUA 3Q0WA 3S2HJ 5EG0A 2IAIA 4Y7NJ 2HYJA 4BBSJ 3LSPA 5K7FA 3OSGA 2X6OA 4UUSB 2K9SA 4W1UA 5IP7J 1U8BA 3A01B 5IP6A 3CQZJ 2X9DA 2IBDA 4D7MA 5IOYA 1OCTC 4XRMA 3IH3A 1MBHA 3BT9A 2M34A 1FTZA 4C3IJ 1W0UA 1UG2A 1MH4A 2HOSA 2JA6J 4BY7J 2FJ1A 3JRHA 5FKOA 5JLXA 2ZB9A 2LVSA 1K83J 1X2NA 2WV1A 1TWAJ 3S1RJ 5K7HA 2R92J 1FIPA 5E3OA 2KT0A 5GPAA 5EGOA 1U9NA 4HNVA 1ORKA 2GM4A 3GBGA 1MSFC 1ZKGA 3BG3A 3A01A 3OSFA 3S2DJ 3S15J 1RETA 2DMQA 1LE8A 1GDTA 2K40A 2YUSA 2FD5A 1TWGJ 4JX6A 1G2HA 1FEXA 2R7ZJ 4RDUA 3HOXJ 1GT0C 3RQIA 5F27A 2EZLA 2NOGA 1IV6A 3SJMA 4IEJA 1ZTRA 5EZGA 1GVDA 3MVPA 2LK2A 3S1NJ 2DMNA 4XICA 1FJLA 4EEFG 3HOUJ 1WGXA 1Z0XA 5HODA 3PM1A 3BTJA 2DA7A 4A3EJ 2NS8A 2EZKA 3ZQCA 3GTOJ 1MBGA 2LY9A 3A03A 2CUEA 3TW6A 5M5WJ 2NVQJ 5J1UA 4A3BJ 2XPVA 1ETWA 2Y30A 3M4OJ 2HOTA 1HCRA 1TWFJ 2O9LA 3JRIA 1QRYA 2DA2A 5F0CA 1TWHJ 2CQQA 2IEKA 1ETVA 1F36A 2VKEA 5EEAA 2KDZA 2CRGA 1IUFA 2ID3A 3GTMJ 2OF7A 3JRDA 5EG0B 3JRBA 3NARA 1I50J 4A3IJ 1A5JA 1VNDA 2ECBA 2LLKA 1JTYA 1RKWA 1H89C 3WHBA 2ME6A 3CCYA 3BG9A 4L5EA 4JX4A 1OCPA 3BTIA 3S16J 3LSJA 1QVTA 1JUSA 2JA5J 3ZQIA 1ZQ3P 3SFIA 2M8GX 1WI3A 2JMWA 3K7AJ 2Y9YA 1ETOA 5J1RA 2E2IJ 3S1QJ 1F43A 2X48A 1PUFB 3HOYJ 1WPKA 1ITYA 2R5YB 1FTTA 2G0EA 5FKNA 2MGQA 1FIAA 5M5XJ 2B63J 9ANTA 3HKZN 2LFBA 4A3JJ 2JWTA 5GP9A 1HDPA 3G1LA 2Y2ZA 3BQZA 4FE7A 1AU7A 2ME0A 5IYBJ 3S14J 4Y52J 2R5YA 1NK2P 2NVTJ 4C3JJ 3FIWA 3IV5A 2R0QC 1VF9A 5F04A 4A3CJ 5IP9J 3E7LA 1Q1VA 3L1PA 1ETXA 2LR8A 3NAUA 2HDDA 1JTXA 2LD5A 3MN2A 2JJ7A 3ZQHA 3WHCA 3JRCA 2M0CA 2O7OA 2D5VA 1ZGWA 4ABZA 3HDDA 3MKLA 3I4NJ 2CQXA 2L9RA 3QPLA 1IGNA 2ECCA 2TRTA 2L0KA 2AHQA 2HXOA 1RR7A 1UHSA 2L7FP 5GPCA 1U9OA 4I76A 4FTHA 2Y9ZA 2HXIA 3HOWJ 3QQAA 2H1KA 4JYKA 3O8GA 3HGGA 2L7ZA 4XRSA 3LSGA 2QCOA 2DA5A 2FQ4A 5FKKA 2XSDC 1MSEC 4D5CA 5EGOB 2L7MP 5C4JJ 3GTQJ 2HOAA 3HGYA 1T56A 5J3LA 2EZHA 4M3GA 2W48A 1MBFA 2NVYJ 2XGCA 5IYCJ 4X6AJ 2N8GA 5DS9A 1I3QJ 2GBYA 5C44J 3D1NI 4A3KJ 2DA4A 2VKVA 2XRLA 3RZOJ 2NS7A 1ETQA 3HOVJ 4FCYA 3RZDJ 3H3VK 4UUSA 2JA7J 4A3GJ 1LE8B 2ELKA 2HQ5A 4MFDA 5FKMA 5DTDA 1JJ8C 3VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  2E2H J;  1B72 A;  4AC0 A;  3GTP J;  1APL C;  1H8A C;  4W97 A;  2DA6 A;  5M3M J;  4B3A A;  2EBI A;  5E3L A;  1EF4 A;  1JT0 A;  2YU9 J;  4A3L J;  3ZQG A;  3BR1 A;  3JRE A;  2OPT A;  3FK7 A;  4MLO A;  4FIS A;  1Y1W J;  2XGD A;  5FLM J;  4DZP A;  1X58 A;  4IHV A;  1UMQ A;  1BW5 A;  1P7I A;  1MNM C;  1JGG A;  1TC3 C;  1D5Y A;  5E3N A;  2MG4 A;  4M3B A;  3BTC A;  1RPW A;  1ZR2 A;  3W6V A;  1OJL A;  4A3F J;  3Q3S A;  3ZOB A;  3IH4 A;  1GV5 A;  3HEF A;  5J1Y A;  1SAN A;  4A3D J;  2RAE A;  1AHD P;  3GTK J;  4B4C A;  1H88 C;  1Z77 A;  3SDG A;  4C2M J;  4J19 A;  3K2A A;  4M6V A;  2LTP A;  4DYR A;  2DA3 A;  3CMY A;  1GV2 A;  4GFB A;  5F0F A;  3GTJ J;  5FJ8 J;  2M2E A;  5E3M A;  1MBE A;  1QVU A;  2K9N A;  4AYB N;  2Y31 A;  3FKI J;  2O8K A;  3LSR A;  3JRF A;  5C4X J;  1DU0 A;  4FE4 A;  4D5F A;  2K9Q A;  3DEW A;  4XID A;  4I6Z A;  5IOZ A;  3TP0 A;  1B8I A;  4NDL A;  2WAQ N;  4QTR A;  2TCT A;  4DZJ A;  2ID6 A;  1JT6 A;  2PMZ N;  2COB A;  3LOC A;  3B6A A;  3PO2 J;  2WB1 N;  5BNG A;  2LP0 A;  5F1J A;  2DTZ A;  3DCF A;  4MFE A;  1WCM J;  2R5Z B;  1AKH B;  1IDY A;  1DU6 A;  1TWC J;  1XC5 A;  1NTC A;  4C3H J;  3BR5 A;  4M3E A;  2E1O A;  1B72 B;  2LKX A;  2M9H A;  4V2G A;  1BA5 A;  1IJW C;  5FLV A;  2Y0S N;  4V2F A;  2YS9 A;  1HDD C;  3RKQ A;  2AO9 A;  4BKX A;  4MO7 A;  4X1E A;  4LOC A;  4CYC A;  1BL0 A;  1OFC X;  5JLW A;  3OIO A;  4IHY A;  2E2J J;  3BTL A;  4BXX J;  2DMT A;  2VPR A;  2XPU A;  1VI0 A;  3HM5 A;  2EH3 A;  3PO3 J;  1CQT A;  2MW8 A;  4QSH A;  4MIM A;  5EYR A;  3BR6 A;  3BR2 A;  3C2B A;  1HLV A;  4A93 J;  1X2M A;  3H0G J;  3Q0V A;  1LFU P;  2DMP A;  1QPI A;  1ETK A;  2CJJ A;  2I10 A;  3JRG A;  2XB5 A;  2E19 A;  3TP3 A;  3FK6 A;  3HOZ J;  3F0C A;  1YRN B;  1RES A;  2GLO A;  3OOU A;  5EZH A;  1JKQ C;  3LNQ A;  5F0H A;  2R93 J;  1IG7 A;  3M3Y J;  4A3M J;  4D7N A;  3A02 A;  2DMU A;  2R5Z A;  3BR0 A;  1AKH A;  1JUM A;  1RKT A;  1JUP A;  1JKR C;  5M3F J;  1POG A;  5IYD J;  2CU7 A;  2P81 A;  3BQY A;  4JX5 A;  2JA8 J;  2QF7 A;  2HI3 A;  5EDN A;  1IC8 A;  1U78 A;  1VFC A;  1B8I B;  3G1M A;  3GTG J;  1SFO J;  1E3O C;  1JKP C;  3HBL A;  3JR9 A;  1ETY A;  4XK4 A;  4CYC B;  3BG5 A;  4JP0 A;  1IDZ A;  3ZQF A;  1MH3 A;  2XGE A;  1MBJ A;  4B1R A;  1ZR4 A;  1Y1V J;  2JK3 A;  4G12 A;  3I4M J;  1XG1 A;  5K7Z A;  1WH7 A;  5M5Y J;  3TW7 A;  3TED A;  3FIS A;  3IH2 A;  1JJ6 C;  1LFB A;  2DN0 A;  4M3D A;  4IHW A;  3ZQL A;  2EQR A;  1I6H J;  2DA1 A;  4DYC A;  3S1M J;  1S7E A;  1R9T J;  2MSY A;  3B6C A;  4DW6 A;  2EZI A;  5FKL A;  3CDL A;  3UKG A;  1HOM A;  1MBK A;  2CUF A;  2FX0 A;  5C3E J;  4DYQ A;  1PUF A;  4M3F A;  3JRA A;  3BR3 A;  1T33 A;  4BY1 J;  1YRN A;  3GTL J;  3S17 J;  2DJN A;  2XB0 X;  3O8H A;  1W0T A;  5F08 A;  4BBR J;  1K61 A;  4S0H B;  3G1O A;  3QPS A;  1BW6 A;  1P7J A;  1A6I A;  3HB9 A;  4IHX A;  4UUT A;  1O4X A;  2H8R A;  2VI6 A;  4A69 C;  4RBO A;  1IRZ A;  4QIW N;  4AUX A;  1NK3 P;  3Q0U A;  1HF0 A;  5EF6 A;  1ENH A;  5IPA A;  2VUM J;  2JN6 A;  1JKO C;  2NVX J;  4XRS G;  1WH5 A;  1XS9 A;  1BJZ A;  2XPW A;  1GUU A;  3Q0W A;  3S2H J;  5EG0 A;  2IAI A;  4Y7N J;  2HYJ A;  4BBS J;  3LSP A;  5K7F A;  3OSG A;  2X6O A;  4UUS B;  2K9S A;  4W1U A;  5IP7 J;  1U8B A;  3A01 B;  5IP6 A;  3CQZ J;  2X9D A;  2IBD A;  4D7M A;  5IOY A;  1OCT C;  4XRM A;  3IH3 A;  1MBH A;  3BT9 A;  2M34 A;  1FTZ A;  4C3I J;  1W0U A;  1UG2 A;  1MH4 A;  2HOS A;  2JA6 J;  4BY7 J;  2FJ1 A;  3JRH A;  5FKO A;  5JLX A;  2ZB9 A;  2LVS A;  1K83 J;  1X2N A;  2WV1 A;  1TWA J;  3S1R J;  5K7H A;  2R92 J;  1FIP A;  5E3O A;  2KT0 A;  5GPA A;  5EGO A;  1U9N A;  4HNV A;  1ORK A;  2GM4 A;  3GBG A;  1MSF C;  1ZKG A;  3BG3 A;  3A01 A;  3OSF A;  3S2D J;  3S15 J;  1RET A;  2DMQ A;  1LE8 A;  1GDT A;  2K40 A;  2YUS A;  2FD5 A;  1TWG J;  4JX6 A;  1G2H A;  1FEX A;  2R7Z J;  4RDU A;  3HOX J;  1GT0 C;  3RQI A;  5F27 A;  2EZL A;  2NOG A;  1IV6 A;  3SJM A;  4IEJ A;  1ZTR A;  5EZG A;  1GVD A;  3MVP A;  2LK2 A;  3S1N J;  2DMN A;  4XIC A;  1FJL A;  4EEF G;  3HOU J;  1WGX A;  1Z0X A;  5HOD A;  3PM1 A;  3BTJ A;  2DA7 A;  4A3E J;  2NS8 A;  2EZK A;  3ZQC A;  3GTO J;  1MBG A;  2LY9 A;  3A03 A;  2CUE A;  3TW6 A;  5M5W J;  2NVQ J;  5J1U A;  4A3B J;  2XPV A;  1ETW A;  2Y30 A;  3M4O J;  2HOT A;  1HCR A;  1TWF J;  2O9L A;  3JRI A;  1QRY A;  2DA2 A;  5F0C A;  1TWH J;  2CQQ A;  2IEK A;  1ETV A;  1F36 A;  2VKE A;  5EEA A;  2KDZ A;  2CRG A;  1IUF A;  2ID3 A;  3GTM J;  2OF7 A;  3JRD A;  5EG0 B;  3JRB A;  3NAR A;  1I50 J;  4A3I J;  1A5J A;  1VND A;  2ECB A;  2LLK A;  1JTY A;  1RKW A;  1H89 C;  3WHB A;  2ME6 A;  3CCY A;  3BG9 A;  4L5E A;  4JX4 A;  1OCP A;  3BTI A;  3S16 J;  3LSJ A;  1QVT A;  1JUS A;  2JA5 J;  3ZQI A;  1ZQ3 P;  3SFI A;  2M8G X;  1WI3 A;  2JMW A;  3K7A J;  2Y9Y A;  1ETO A;  5J1R A;  2E2I J;  3S1Q J;  1F43 A;  2X48 A;  1PUF B;  3HOY J;  1WPK A;  1ITY A;  2R5Y B;  1FTT A;  2G0E A;  5FKN A;  2MGQ A;  1FIA A;  5M5X J;  2B63 J;  9ANT A;  3HKZ N;  2LFB A;  4A3J J;  2JWT A;  5GP9 A;  1HDP A;  3G1L A;  2Y2Z A;  3BQZ A;  4FE7 A;  1AU7 A;  2ME0 A;  5IYB J;  3S14 J;  4Y52 J;  2R5Y A;  1NK2 P;  2NVT J;  4C3J J;  3FIW A;  3IV5 A;  2R0Q C;  1VF9 A;  5F04 A;  4A3C J;  5IP9 J;  3E7L A;  1Q1V A;  3L1P A;  1ETX A;  2LR8 A;  3NAU A;  2HDD A;  1JTX A;  2LD5 A;  3MN2 A;  2JJ7 A;  3ZQH A;  3WHC A;  3JRC A;  2M0C A;  2O7O A;  2D5V A;  1ZGW A;  4ABZ A;  3HDD A;  3MKL A;  3I4N J;  2CQX A;  2L9R A;  3QPL A;  1IGN A;  2ECC A;  2TRT A;  2L0K A;  2AHQ A;  2HXO A;  1RR7 A;  1UHS A;  2L7F P;  5GPC A;  1U9O A;  4I76 A;  4FTH A;  2Y9Z A;  2HXI A;  3HOW J;  3QQA A;  2H1K A;  4JYK A;  3O8G A;  3HGG A;  2L7Z A;  4XRS A;  3LSG A;  2QCO A;  2DA5 A;  2FQ4 A;  5FKK A;  2XSD C;  1MSE C;  4D5C A;  5EGO B;  2L7M P;  5C4J J;  3GTQ J;  2HOA A;  3HGY A;  1T56 A;  5J3L A;  2EZH A;  4M3G A;  2W48 A;  1MBF A;  2NVY J;  2XGC A;  5IYC J;  4X6A J;  2N8G A;  5DS9 A;  1I3Q J;  2GBY A;  5C44 J;  3D1N I;  4A3K J;  2DA4 A;  2VKV A;  2XRL A;  3RZO J;  2NS7 A;  1ETQ A;  3HOV J;  4FCY A;  3RZD J;  3H3V K;  4UUS A;  2JA7 J;  4A3G J;  1LE8 B;  2ELK A;  2HQ5 A;  4MFD A;  5FKM A;  5DTD A;  1JJ8 C;  3VPR A; 
#chains in the Genus database with same CATH topology
 1TW3 A;  2BW3 B;  3V8J A;  1CF7 A;  2R7S A;  3KLN A;  2EIM H;  1USS A;  2ZJQ F;  1QGP A;  4AC0 A;  2DA6 A;  3ULQ B;  2Q0O A;  3F21 A;  2QQ9 A;  4HLX A;  2XGX A;  4LMY A;  2YU3 A;  4BYY A;  3VOE A;  2YU9 J;  4HF1 A;  2LH9 A;  3ZQG A;  2ACJ A;  1I1S A;  2OPT A;  4Q4Z F;  2ELH A;  1TT0 A;  4MTE A;  4P96 A;  3ZRG A;  4D1Q A;  3WTX C;  1P7I A;  4LIU A;  5F64 A;  1EJ9 A;  2BOL A;  2MG4 A;  4HST A;  4P9U A;  2BY0 A;  2W1O A;  3WTU C;  3W6V A;  4A3F J;  3ABT A;  3ZOB A;  5J1Y A;  1O3T A;  3X2Q H;  1SMT A;  4CA0 A;  2KFD A;  4U0Y A;  1H88 C;  1FY7 A;  1MJB A;  4YRV A;  3OS0 A;  1SVL A;  3HRS A;  1ONV A;  4ITV A;  1JI8 A;  3FX3 A;  3SDG A;  3WU0 A;  3CME I;  2RV8 A;  2EA2 A;  1T6S A;  3K4B A;  4UVC A;  4ZYA A;  4DYR A;  1SMY F;  1PUE E;  4EM0 B;  1GV2 A;  1HW2 A;  1W5S A;  4GFB A;  2ZNZ A;  2HZD A;  1QVU A;  1IN8 A;  5L3G A;  1BI3 A;  3JTH A;  4RAG A;  4RM3 A;  2UXX A;  3FKI J;  3HG9 A;  3E0J B;  5FRM A;  2VXD A;  3JAM Z;  3F23 A;  2YR2 A;  2HDW A;  2VPL A;  4HOB A;  1EH6 A;  1D0Z A;  1X4O A;  4XRF A;  5IOZ A;  3IP4 B;  1FP2 A;  3CP8 A;  2WAQ N;  1BI1 A;  4NC7 A;  4B48 A;  3ABM H;  2V1X A;  1B1B A;  2PMZ N;  1X1A A;  4DZJ A;  1O3S A;  1NH3 A;  4OU0 A;  3PO2 J;  4CCM A;  3K1M A;  4MEY F;  1YW9 A;  3MAJ A;  2O6G E;  1WCM J;  3FZV A;  4G94 A;  2STT A;  1QU3 A;  2R5Z B;  1AKH B;  1DU6 A;  4LK0 F;  2Y0M A;  3GLL A;  3KP6 A;  2Z5U A;  1LEA A;  4M3E A;  3DPU A;  1AOY A;  1UG0 A;  1B72 B;  1J59 A;  4AVZ A;  1V4R A;  1YJN I;  1ULY A;  5E1X A;  3ZGK A;  3GZN B;  4BAC A;  1P4W A;  3KYD B;  4HF0 A;  2JT1 A;  4HAM A;  1PDN C;  3ZPL A;  1VQ6 I;  3GFJ A;  1FMW A;  1FX7 A;  3HSR A;  1O7F A;  4AVP A;  1VQ9 I;  2CYY A;  3I55 I;  5DUK A;  1K7A A;  2OTJ I;  4CYC A;  1J09 A;  2HPM A;  3BG6 A;  1Z67 A;  4IHY A;  1IZ1 A;  4IVN A;  3BTL A;  2E7X A;  3S3O A;  5FO5 A;  4CH7 A;  4OIR F;  1VI0 A;  2NOJ B;  3WTS C;  4WK8 F;  2PBI A;  2ZFU A;  3DPL C;  4HPQ A;  1CQT A;  2MW8 A;  1K78 B;  4HG2 A;  1IRX A;  3OV8 A;  1HW5 A;  2LKP A;  3K0L A;  4CUG A;  1LFU P;  2HEO A;  2CJJ A;  1IN6 A;  5FFX A;  3P9C A;  3ASO H;  2ZBK A;  4GXO A;  3WGG A;  2KRC A;  4XKB A;  3DFG A;  1S6L A;  3FK6 A;  4NB5 A;  5HDG A;  1YRN B;  4OWR B;  4HV5 A;  2GLO A;  4ZZD A;  3M3Y J;  4V19 K;  5CPR B;  3K70 C;  4D7N A;  2R7V A;  2DDA A;  2IGO A;  2R5Z A;  3BR0 A;  1AKH A;  3PNY A;  1RKT A;  2ZME A;  5M3F J;  3BZC A;  1ON1 A;  2RGV A;  3I4P A;  2GOM A;  3ABL H;  2CU7 A;  3BQY A;  4YII A;  2JA8 J;  5IYD J;  2K27 A;  2ZC2 A;  2ETH A;  3T1B A;  4M6X A;  4KIS A;  4ETS A;  3GTG J;  1E3O C;  4LG0 A;  1ETY A;  3AAF A;  1W7P B;  1T08 B;  1MH3 A;  3V7C A;  2HQA A;  4G12 A;  3FXR A;  1RC9 A;  1T2K A;  3TW7 A;  2M5W A;  4NBQ A;  4AID A;  3IH2 A;  4ZJZ A;  2DN0 A;  4M3D A;  1F5T A;  3ZQL A;  1I6H J;  3QP6 A;  5EEG A;  1QZY A;  4IRH A;  3R61 A;  5H6Q A;  4UUV A;  3J7A Y;  4S05 A;  4PSW A;  1S7E A;  4KJZ A;  5KAI C;  2CV2 A;  2R7W A;  3EYY A;  1FSH A;  3B02 A;  4XN3 A;  2J5O A;  3K69 A;  1KU3 A;  1T95 A;  4BDY A;  2BHY A;  3GF2 A;  4DYQ A;  1PUF A;  2X6X A;  3JRA A;  2WY8 Q;  4PUS A;  1WZ2 A;  1YRN A;  2ICW G;  1D8K A;  2DJN A;  1K61 A;  4XLH A;  3G1O A;  2PG4 A;  1HQC A;  1P7J A;  2OAZ A;  3IHU A;  1A6I A;  2M0M A;  2QVO A;  3HB9 A;  3OS2 A;  1O4X A;  5KK1 A;  2DK5 A;  3CCV I;  1O3Q A;  4A69 C;  4I09 A;  1IRZ A;  1LFP A;  2KIU A;  1OQY A;  4BQQ A;  3W2V A;  1ENH A;  3PQK A;  5IPA A;  4OMY A;  4IX7 A;  2O5R A;  3ISP A;  1KQ8 A;  1VQ4 I;  3TGN A;  1WH5 A;  1XS9 A;  3FMS A;  1BJZ A;  4I98 B;  1GUU A;  2FU4 A;  3Q0W A;  4BEH A;  2HTS A;  2IGM A;  3W6J B;  3JSP A;  4MHG A;  5F1R A;  3OSG A;  4C30 A;  3GEZ A;  2KZG A;  2MC4 A;  4KIG A;  1LVK A;  3A01 B;  4N9I A;  2P6S A;  5IP6 A;  2QYO A;  2IBD A;  2JRM A;  5ICC A;  3IH3 A;  1SAX A;  1KU7 A;  2KHM A;  2M34 A;  1TNT A;  2EFW A;  1W0U A;  2K9L A;  3OYK A;  2BY3 A;  4ON0 A;  1I39 A;  2QKL B;  1U3E M;  4CYD A;  1K83 J;  1BJA A;  3U2R A;  1X2N A;  2WV1 A;  1TWA J;  3S1R J;  2FF4 A;  2BVL A;  4F52 A;  3EUH A;  4A0Z A;  2GOX B;  5K7H A;  4BHB A;  3QYB A;  4XR6 A;  2KT0 A;  5EGO A;  4IKF A;  2HYG D;  1YFH A;  4P5O A;  4HNV A;  2PLY A;  3LA2 A;  3A01 A;  3KFW X;  3OSF A;  1XGS A;  1Z3Y A;  3KP4 A;  3S15 J;  3KYL A;  3REO A;  1HC8 A;  4HEA 2;  4WXH A;  2DMQ A;  5HNF A;  2Z9O A;  2K40 A;  2DOF A;  2QLZ A;  4M6Y A;  3BJO A;  2PMU A;  1IN4 A;  1TWG J;  3OYE A;  4KIC A;  1FEX A;  2R7Z J;  2VE9 A;  1GT0 C;  3RQI A;  4JK1 X;  5ED4 A;  4L9J A;  4AM3 A;  2EZL A;  5TRD A;  2NOG A;  3VDX A;  3SJM A;  2Y75 A;  1ZTR A;  3HUG A;  1GVD A;  2NAZ A;  3EQL F;  3MVP A;  3S1N J;  3LSK A;  4PK4 A;  2DOE A;  3BP8 A;  4UXN A;  1FJL A;  1MW7 A;  1WGX A;  2L9V A;  3HC7 A;  3CJT B;  3PM1 A;  4BHC A;  3AL0 B;  1EKE A;  2X85 A;  1HKS A;  1P4X A;  1SVM A;  3GTO J;  1D1C A;  3BCA A;  3M7G A;  2CUE A;  3TW6 A;  5M5W J;  1Z3X A;  2NVQ J;  4ZYH A;  3CCQ I;  5J1U A;  3V7R A;  5LBQ A;  3VFZ A;  1G59 A;  1HCR A;  4ZDO A;  3H3U A;  2M30 A;  1QRY A;  3QPH A;  2DA2 A;  5F0C A;  3FDY A;  1TWH J;  2IEK A;  1ETV A;  2VKE A;  2KDZ A;  4ENK A;  2P7C B;  1IUF A;  5GAE J;  1RUN A;  4P55 A;  3JRB A;  3SEZ A;  3GFM A;  4FAS D;  3DTI A;  5HS8 A;  1HW1 A;  1A5J A;  1P9Q C;  3P7N A;  2LLK A;  3P9K A;  1ZRD A;  1JTY A;  1XGO A;  3WHB A;  4RM2 A;  4DGW B;  5BPI A;  2FML A;  4JX4 A;  2X0L A;  3EDP A;  3PFY A;  1OCP A;  1Y0N A;  3S16 J;  5J6X A;  2P4W A;  2IPQ X;  2VBZ A;  4B8X A;  3OYD A;  3DF8 A;  3ZMZ A;  3EUH C;  4F91 B;  5LFA A;  3KP7 A;  4BU2 A;  2QWW A;  2MLK A;  2JMW A;  3KEQ A;  1G8X A;  2Y9Y A;  1ETO A;  2W00 A;  3S1Q J;  4M73 A;  3E5Q A;  2OCE A;  2X48 A;  5DM7 F;  1PUF B;  3CC4 I;  1XCB A;  3HKZ A;  2XAJ A;  5KNL A;  2IA2 A;  3ZR8 X;  5HDK A;  5L3E A;  1FTT A;  4HRI A;  2MGQ A;  1FIA A;  2B63 J;  2MLG A;  3RKW A;  2G7U A;  3V8K A;  3BQZ A;  4FE7 A;  3PUF A;  4KT5 C;  2ME0 A;  4A0Y A;  1MMN A;  3IRQ A;  2K4B A;  2K4J A;  3SDB A;  3CZ6 A;  3FIW A;  3LL7 A;  4II3 A;  1FYM A;  1SFK A;  1VF9 A;  5F04 A;  5FB2 A;  4I7H A;  1Q1V A;  4H0E A;  2EFN A;  3EPZ A;  1OCR H;  1OPC A;  5LEJ A;  2XSJ C;  2YPR A;  5JHF A;  2HDD A;  4UHT A;  2JJ7 A;  3WGH A;  3WHC A;  3JRC A;  2M0C A;  1Y39 A;  2O7O A;  2W4S A;  3CO6 C;  3AFH A;  3BZ6 A;  1IN7 A;  2ZXW H;  2PN6 A;  2UUZ A;  3ZMV A;  2ECC A;  3D5R C;  2P0W A;  3ZN1 A;  2BYV E;  5LRS A;  2AHQ A;  2EFP A;  3C1D A;  1RR7 A;  3SZP A;  1R6R A;  3HJE A;  4XLP F;  3HYI A;  3DLL F;  3PJR A;  1VQ7 I;  2Y9Z A;  4PFP A;  3I56 I;  3K4N A;  1ACI A;  5E8G A;  4PFO A;  2H1K A;  4NQW B;  2GWR A;  4C2U A;  3JCU C;  2EV5 A;  2HPI A;  2L7Z A;  2WY7 Q;  3FXO A;  4E7S A;  1SFE A;  3EET A;  2DA5 A;  2E1C A;  5FKK A;  3ESW B;  3RDI A;  3H0D A;  3ECH A;  1AWC A;  5CLS A;  1MSE C;  5EGO B;  2L7M P;  3LMM A;  2XKO A;  3HGY A;  1T56 A;  3VYT B;  3H9J A;  5J3L A;  3PNT A;  4ENJ A;  1QZE A;  4HDV A;  2EZH A;  1KON A;  1Z6R A;  1O57 A;  2W48 A;  4DJA A;  4Q47 A;  1OCO H;  2NVY J;  4IF4 A;  4ZDL A;  1P4A A;  4KFC A;  5DS9 A;  5L3F A;  1I3Q J;  1R5H A;  2GBY A;  5CYV A;  3D1N I;  5ICF A;  4ENN A;  2DA4 A;  2VKV A;  2EWN A;  2XRL A;  4GYI A;  2PJR B;  1LVA A;  1YS7 A;  2KIQ A;  3FMR A;  2F5C A;  3IWF A;  3U1K A;  1YOV B;  4GYG A;  4RAY A;  3MWM A;  4XNF A;  2HVQ A;  4CHU A;  4CXF A;  4NC6 A;  2X6Y A;  3RZD J;  2FUG 2;  1U0J A;  2HQ5 A;  1Z9C A;  3I59 B;  5K5O A;  3ZMT A;  5DDG A;  1JJ8 C;  3HOS A;  1DDN A;  2FE3 A;  2COM A;  2VBX A;  1ZK8 A;  2E2H J;  2KZV A;  4L5J A;  3QOE A;  3GFI A;  2KRH A;  3GTP J;  2L7K A;  3AKZ A;  4HW0 A;  5GTH C;  2K3P A;  2EBI A;  4KDP A;  1YIO A;  2KIM A;  4KN4 X;  3ECO A;  4AD9 A;  3BR1 A;  4Y3O A;  3ZMD A;  3JRE A;  2W84 A;  4KIF A;  1R7J A;  1BIA A;  1UMQ A;  2YSR A;  1BW5 A;  4CZZ A;  1A35 A;  3H92 A;  2J5P A;  1KQ0 A;  1R1U A;  3OR2 C;  1JGG A;  1TBX A;  3UR3 C;  1TC3 C;  4M3B A;  4CCL A;  4DBQ A;  1I5Z A;  3AL0 C;  1RPW A;  2XAQ A;  3D5L A;  1OJL A;  2A6T A;  3Q3S A;  1K4S A;  5J40 A;  1NHA A;  3CC2 I;  3FXM A;  3FM5 A;  3IH4 A;  1GV5 A;  3BPX A;  3HEF A;  1SAN A;  4A3D J;  3MQ0 A;  2DOD A;  1ZLK A;  4XLN F;  3GTK J;  4CCJ A;  5DM6 F;  1MGT A;  5EJC A;  1Z77 A;  4XSZ F;  2F4I A;  3F8N A;  3K2A A;  4M6V A;  3GO5 A;  1ZEL A;  5CVU A;  5TGT A;  2LTP A;  1N75 A;  2BXY A;  3B73 A;  1JE8 A;  2HVS A;  2FOW A;  1FOX A;  2BZT A;  5GAD J;  2VOP A;  1S29 A;  3OIQ A;  2FQ3 A;  5B66 C;  2P5L C;  3I59 A;  2BW3 A;  1KU2 A;  2M2E A;  5FJ8 J;  3GTJ J;  1GHC A;  1MBE A;  1S7O A;  2P5V A;  4L9N A;  4A12 A;  1V3F A;  3PNV A;  3LSR A;  1QNT A;  2UWM A;  3WTT C;  5C4X J;  4LG0 B;  3NWS A;  3JW4 A;  4D5F A;  4I6Z A;  4XID A;  1WFX A;  3ERM A;  4PJM A;  3H9G A;  4N9H A;  4NDL A;  2HS5 A;  1QA6 A;  4I99 C;  3QWL A;  2WV0 A;  4RLF A;  5FLX K;  2ID6 A;  1JT6 A;  1Z1D A;  3KX2 A;  3MFK A;  5BNG A;  2LP0 A;  2IGK A;  2R7Q A;  3FBI B;  4RMN A;  2XF6 A;  1IDY A;  1X1C A;  1E3H A;  3M07 A;  3KPH A;  1I3A A;  3CDI A;  3BY6 A;  4ZTF A;  1UHW A;  5LGT A;  2QSH X;  1XSD A;  5HVQ C;  2M9H A;  2XAG A;  5D5V B;  3G2B A;  4HX7 A;  4V2G A;  3E1S A;  2LC2 A;  1BA5 A;  1IJW C;  1VQ8 I;  2VC0 A;  2BE5 F;  2Y0S N;  3H5A A;  4QPQ A;  4U7D A;  4NHJ A;  2GIZ A;  3R0J A;  2AO9 A;  4BKX A;  1TTY A;  3DTE A;  4MO7 A;  1G3W A;  1QQI A;  2G9W A;  3WG7 H;  3CJN A;  2HVR A;  2JSP A;  3BG7 A;  2VT3 A;  3NEU A;  2F6C A;  3CLQ A;  4XLA A;  3OYH A;  2E2J J;  4FET A;  4YFX F;  2XPU A;  1XD7 A;  1VQP I;  3HSE A;  2ZCW A;  1OCZ H;  2JRT A;  1LB2 A;  4XON A;  3G6E I;  5EYR A;  4MIM A;  4RGX A;  2Z1D A;  2DBB A;  1JHF A;  2LF7 A;  4AIJ A;  1ETK A;  2Z99 A;  1V5G A;  5KAF C;  3LAJ A;  1BBY A;  3HOZ J;  4A2U A;  2FRH A;  3F0C A;  1RES A;  3WU1 B;  1S7A A;  3OOU A;  3WE3 A;  3LNQ A;  5F0H A;  4LFU A;  1O7L A;  2DMU A;  2GA2 A;  1JUP A;  1E3P A;  1K4T A;  4JX5 A;  4LD5 A;  1OYI A;  2VB6 A;  2IW5 A;  2HFH A;  1ZG3 A;  1J5Y A;  2HI3 A;  5JVT A;  5EDN A;  4ESJ A;  1UCR A;  2V1N A;  1IC8 A;  1VFC A;  5LHG A;  4IOC F;  4XLE A;  3G1M A;  3A0B C;  3I5U A;  5H6R A;  4EM1 A;  3BJA A;  3HBL A;  3JR9 A;  2M4G A;  3C2G A;  4G6D A;  5CQE A;  3OL3 A;  4BJ5 C;  2R7F A;  4EGY A;  4Y15 A;  2JK3 A;  5E20 A;  3I4M J;  4LK1 F;  1XG1 A;  1RIO H;  1AA7 A;  4ESF A;  3HL2 A;  3TED A;  3FIS A;  3KEO A;  3S3M A;  2KKO A;  2CS3 A;  2DAO A;  3I71 A;  2W82 A;  3F9K A;  5LEK A;  1JJ6 C;  1MJA A;  3DPT A;  2A05 A;  3PQJ A;  3FWE A;  2VQH A;  4GCV A;  1D1A A;  3E5U A;  1VQO I;  1QHH D;  4CCN A;  1D5V A;  5J4V A;  3S1M J;  2MAB A;  1R9T J;  1R5I D;  4I02 A;  4RB1 A;  1MIJ A;  5FKL A;  4RB3 C;  3N05 A;  3HPG A;  1MNE A;  3ERE D;  1RUO A;  2IJL A;  4ESB A;  1BR4 A;  1H9T A;  2XRN A;  4QPO A;  3BR3 A;  3HIF A;  3WU2 C;  3VEP A;  3GTL J;  3S17 J;  2ZXH A;  2XB0 X;  1W0T A;  1WJA A;  1EH7 A;  4PCQ A;  4LIV A;  1UHM A;  2Q2E B;  4UUT A;  1KYW A;  5KHD A;  3NQO A;  4M72 A;  4L0Z B;  1G3Y A;  2VKH A;  3KYC B;  5HNH A;  1BC8 C;  2VUM J;  1JKO C;  4FX4 A;  3WG9 A;  4XOT A;  1G3T A;  3CLO A;  1WJB A;  4RS8 A;  1V55 H;  1V5E A;  2JVH A;  3DLA A;  4E7K A;  5EG0 A;  1OYW A;  2IAI A;  4L0Y B;  3K2Z A;  4F55 A;  1VTN C;  2HZT A;  2DW4 A;  1OR7 C;  3T8R A;  2MA3 A;  3J81 K;  4YIF A;  3TKY A;  3BDD A;  4IQ4 A;  3LA7 A;  4W1U A;  5IP7 J;  3RJP A;  4MTD A;  2R7R A;  1U8B A;  5E1W A;  5HOO A;  1GVJ A;  2DFE A;  1R23 A;  1FC3 A;  3WOD F;  2LBF A;  5IOY A;  1LJ9 A;  2EA4 A;  3AG4 H;  1MBH A;  2HR3 A;  3F8F A;  1UG2 A;  1ZRE A;  2HOS A;  2JA6 J;  2L9S A;  2E71 A;  3I58 A;  3VYU B;  2DQL A;  5FKO A;  2V26 A;  1BM9 A;  2D1H A;  2EB7 A;  1IRF A;  3PUB A;  1W5T A;  2VT2 A;  4O6J A;  1YIJ I;  5H20 A;  3K4L A;  2R92 J;  3DU5 A;  1FNN A;  3MKW B;  4UVA A;  1ORK A;  3TO9 A;  2Q1Z B;  2L54 A;  2R4G A;  3K6G A;  4F92 B;  2GM4 A;  1F4K A;  4A6D A;  4IZZ A;  4PGG A;  2PJP A;  3S2D J;  3H5N A;  1VZ0 A;  3PFI A;  2F2E A;  2R7D A;  3FXK A;  1W5C C;  1LE8 A;  2MYS A;  2ZNY A;  5HLG A;  1H0M A;  4JX6 A;  1G2H A;  5JI6 A;  4BH9 A;  3HOX J;  5A2Q Z;  2DYR H;  3ZMS A;  3MMY B;  2AXL A;  2F5V A;  3R6S A;  3MZH A;  2ZJR F;  2A6E F;  4EAT A;  3DTK A;  4PGH A;  2LYC A;  2E1M B;  4RAF A;  4IEJ A;  1MDM A;  3V7S A;  3M8F A;  2EV6 A;  1UB9 A;  1TNS A;  1D0X A;  4Y13 A;  2DMN A;  4XIC A;  1BOB A;  3J7Z I;  3SHF A;  2LG4 A;  4KA4 A;  4BS9 A;  2F4O B;  4PZJ A;  2DK8 A;  2DXI A;  3DV8 A;  3OMY A;  4Y33 A;  3J80 Z;  4JOM A;  4CCO A;  2E35 A;  3RPU A;  4S04 A;  3OYA A;  2ESH A;  3M4O J;  2CGP A;  3F8M A;  2M7B A;  3ZXS A;  4ZZL A;  2MH9 A;  4DQ2 A;  2F5F A;  3JRI A;  3CF5 F;  2ZJP F;  3GTM J;  2OF7 A;  1FMV A;  1V5F A;  1KA8 A;  5BQT A;  3JRD A;  3NAR A;  5HS9 A;  1YW7 A;  4A3I J;  3M1E A;  1VND A;  4D9J A;  1XGN A;  3G71 I;  5A2Q K;  3GX4 X;  4BE0 A;  1ZHF A;  1D8J A;  4IHS A;  2ISY A;  1H89 C;  3KE2 A;  3Q9S A;  2ME6 A;  4KT6 A;  1K79 A;  2ADU A;  3DXJ F;  4LG3 A;  2KMU A;  1VQ5 I;  1CF7 B;  4OAZ A;  1KU9 A;  2K9M A;  1JUS A;  4YEL A;  2IS6 A;  3IL2 A;  5DYM A;  3VYR B;  3SFI A;  2Q2E A;  2M8G X;  2BBY A;  5B3S H;  2LSO A;  5LGN A;  2CO5 A;  2D1V A;  2FA5 A;  2ZSH B;  2CW8 A;  5D6E A;  1TP4 A;  5LHH A;  3HOY J;  1ITY A;  3CCM I;  5BS6 A;  1LQ1 A;  5ILS A;  2G0E A;  1YLF A;  2V6E A;  9ANT A;  4P1W A;  4DIQ A;  2JWT A;  5GP9 A;  5LRR A;  1KZH A;  2LRE A;  2Y2Z A;  3S3N A;  1U5T B;  3S14 J;  1P2F A;  4Y4R A;  4N4O B;  1MMG A;  3CUQ A;  1B6A A;  2K3F A;  1HKQ A;  4L5I A;  3PSI A;  1SD4 A;  5D4R A;  1B59 A;  1PP7 U;  1QO0 D;  2ELJ A;  2LR8 A;  2XVC A;  3TO7 A;  3HRM A;  4E7H A;  3MN2 A;  4YIR X;  2QBY A;  5DUI A;  3K70 D;  5LGU A;  4U0V A;  3S2W A;  3MKL A;  2L9R A;  5IT3 A;  4G8X A;  2FEZ A;  2V9K A;  3QPL A;  4Z2Y A;  2TRT A;  4PJ0 C;  2L0K A;  1WJE A;  4LGW A;  2HXO A;  1P6R A;  3RIR A;  3MCZ A;  4G6Q A;  3U1D A;  1U8R A;  3ABU A;  4LLL A;  1FPQ A;  1UEL B;  2HXI A;  3HOW J;  3QQA A;  4ZYG A;  2IT0 A;  2LKS A;  2A69 F;  2RQQ A;  1YTY A;  2KJB A;  2E7W A;  2LNB A;  4JYK A;  5JFR A;  4PJJ A;  3HGG A;  3BOQ A;  3GZ6 A;  1WKM A;  3LSG A;  2NVU B;  2VE8 A;  2QCO A;  3CCL I;  2GQQ A;  1W36 D;  1ZYR F;  2PQ8 A;  2FQ4 A;  3QRF F;  5TIS C;  4D5C A;  3S8P A;  1OLT A;  5D4S A;  3QAH A;  2CV1 A;  3COA C;  1ZRF A;  5HS7 A;  5DCF A;  1ZG5 A;  1T8I A;  1WJD A;  2BY1 A;  2QA4 I;  2N8G A;  2RC4 A;  2V79 A;  4A3K J;  3KZI C;  1YYV A;  1H9G A;  4GDF A;  2FXA A;  4YEJ A;  1E17 A;  5D6F A;  5BPD A;  1WSU A;  4E7I A;  2NS7 A;  5FGM A;  1BN5 A;  3TQN A;  1KQ9 A;  4FCY A;  1VQK I;  2A3S A;  1TQP A;  1BI0 A;  4UUS A;  4ZTJ A;  2JA7 J;  3NWT A;  2HKO A;  2KJC A;  4A3G J;  1YO5 C;  4HNT A;  3J7A O;  5FKM A;  1Y0U A;  5DTD A;  3O6B B;  4LLG F;  2X1D A;  1HXD A;  2C6Y A;  3ML6 A;  2JQ7 A;  2WC2 A;  1XGM A;  1FBS A;  2WAF A;  1N78 A;  1P92 A;  1APL C;  2BXZ A;  2JUG A;  4W97 A;  5HLI A;  3OYF A;  3F3X A;  2W7N A;  5DCM A;  3L2U A;  4U7B A;  2R7U A;  2P7V B;  1EF4 A;  3KP3 A;  3KZY A;  1DP7 P;  1YE9 A;  4ZH4 F;  4A3L J;  3CES A;  3DKW A;  1Y1W J;  2XGD A;  5FLM J;  3S93 A;  1X58 A;  3F8C A;  4RLQ A;  3HHG A;  1VQN I;  1Z6T A;  2B9S A;  4B43 A;  1D5Y A;  5E3N A;  1YI2 I;  1FP1 D;  2I8D A;  3BTC A;  1EV7 A;  3GCM A;  4E4H A;  3IAS 2;  3QOD A;  2RAE A;  1AHD P;  1TW2 A;  2GA1 A;  3LSM A;  2FBK A;  4II2 A;  2H94 A;  3FHN A;  4OIO F;  1JGS A;  4XKC A;  5CVI A;  2KIF A;  1X3W B;  3TO6 A;  4GO1 A;  3CJR B;  4J19 A;  2IS4 A;  2QSG X;  2DO7 A;  3CMY A;  2R7T A;  2OUM A;  2IRF G;  5E3M A;  3QP5 A;  2K9N A;  4AYB N;  4IXA A;  3H3Z A;  1ZH5 A;  3CF2 A;  1DU0 A;  2VC1 A;  1MMS A;  3R4K A;  3DEW A;  3T8T A;  3V4G A;  4OIQ F;  1J2X A;  3FBN B;  4MNU A;  4QTR A;  3L2Q A;  1SEU A;  3DQV C;  2TCT A;  1TLH B;  4X0G A;  3LOC A;  2MBF A;  3B6A A;  1OMI A;  3O3K A;  2NS0 A;  1R4N B;  3DU6 A;  1LUJ B;  3OYL A;  2A5W A;  4MFE A;  3RCO A;  1JXS A;  5L3C A;  1NG7 A;  2DYS H;  2K02 A;  2WWY A;  1PP8 F;  2WB1 A;  1TWC J;  2R3S A;  2H6C A;  1HA8 A;  1XC5 A;  1NTC A;  2FBI A;  2CWE A;  1FOK A;  2LKX A;  5D8K B;  2XV4 S;  3OYN A;  2IA0 A;  3FXQ A;  4G9Y A;  2L2O A;  2O8X A;  4EJT A;  3DWL E;  3CCS I;  4KYW A;  5AIQ A;  1TZL A;  4V2F A;  5E17 F;  2X1C A;  1TQI A;  2QEN A;  2RN7 A;  2JZY A;  2UZK A;  1HSJ A;  4X1E A;  4LOC A;  4M74 A;  3PSF A;  2DT6 A;  1BL0 A;  4OOI A;  2CQN A;  1OFC X;  5JLW A;  3OIO A;  4MQ9 F;  2VJ4 A;  3I54 A;  5IT9 Z;  1BR1 A;  2QQ8 A;  3HSF A;  3RKX A;  2DMT A;  1XX5 A;  3HRT A;  2PJR A;  2EH3 A;  3LFU A;  4BAY A;  2RQP A;  4E7L A;  3C2B A;  3DP7 A;  3OR1 C;  4A93 J;  3Q0V A;  3CMA I;  2DMP A;  2BGC A;  5LLQ A;  1YS6 A;  1IXS B;  1X1D A;  2XB5 A;  4I0B A;  5IY5 H;  2E19 A;  3E97 A;  3TP3 A;  1E0E A;  1ZAO A;  1SD5 A;  5EZH A;  1IF1 A;  2OJE D;  1WVR A;  3UNG C;  3ASN H;  2DTR A;  3EYI A;  2QSF X;  2EK5 A;  3L2R A;  1J0R A;  1JUM A;  2W57 A;  3W2W A;  1IO2 A;  1POG A;  3EUK L;  3SYT A;  3V8L A;  1A36 A;  4BE1 A;  1FYK A;  5HDN A;  2QQA A;  1QPM A;  4XKW A;  1ZAR A;  4EJU A;  4HDU A;  1B8I B;  1MJ9 A;  4R8H A;  2GAU A;  1U6G A;  3M8J A;  1UJ8 A;  4XK4 A;  2K5C A;  3BG5 A;  4JP0 A;  1B9N A;  3ZQF A;  2XIG A;  2RRE A;  2UV1 A;  2EFQ A;  3C18 A;  1ZR4 A;  4CO8 A;  1G4D A;  3N4M A;  1S72 I;  4WWC A;  3VOD A;  5K7Z A;  4RB0 A;  4XQF A;  5M5Y J;  1RNL A;  3A4C A;  4GGG A;  3OYI A;  4EVI A;  2VJJ A;  2OD5 A;  3OY9 A;  2HWV A;  4IHW A;  1IXC A;  2EQR A;  2VON A;  4Y17 A;  2OV7 A;  3E6B A;  4N4N B;  1YW8 A;  3GZ5 A;  2G7H A;  1CGP A;  2IS2 A;  3MD2 A;  2EZI A;  4DW6 A;  2L5Q A;  1STZ A;  4R1H A;  2EIJ H;  1MBK A;  2CUF A;  4DOZ A;  2W24 A;  5DEQ A;  5C3E J;  1IAW A;  1YX5 A;  4M3F A;  1T0F A;  4UB6 C;  4Z6Y A;  4LB5 A;  1T33 A;  4BY1 J;  3ZMU A;  4M9S A;  3BWG A;  3DKY A;  3O8H A;  2WA0 A;  4EGZ A;  4S0H B;  2M87 A;  3QPS A;  3OL4 A;  1XSV A;  4IHX A;  3E3V A;  6PAX A;  3DBL B;  3MZY A;  4MGR A;  2H8R A;  1J75 A;  1MKM A;  4IQJ A;  4RBO A;  3HPH A;  4AUX A;  2ZJ2 A;  1W4M A;  1T39 A;  3Q0U A;  1HF0 A;  2Z16 A;  2ZXI A;  5EF6 A;  2XRO A;  4UNO A;  1F9N A;  1S3J A;  1FOW A;  1OR7 A;  2FMY A;  3OYM A;  4I01 A;  3IWZ A;  2XPW A;  3S2H J;  1RR8 C;  2HYJ A;  4DNC A;  4BBS J;  4BJT A;  2X6O A;  2K9S A;  2OZ6 A;  2A07 F;  3R60 A;  4CIC A;  2EJR A;  3HXL A;  4L9T A;  1OCT C;  4XRM A;  2TDX A;  2EPF A;  1FTZ A;  1MH4 A;  2VIX A;  4BY7 J;  3JRH A;  3TDZ C;  3VSL A;  3OS1 A;  1Z21 A;  5JLX A;  2ZB9 A;  4EJW A;  3W2A A;  5JHU A;  2WBM A;  1DQU A;  2CMP A;  3G4S I;  2VL8 A;  2LVS A;  2RVC A;  4IO9 F;  3RI4 A;  2A68 F;  5ICG A;  1Y8Q B;  1LEB A;  4Q5S F;  1LDJ A;  5E3O A;  5GPA A;  3IRR A;  2DJI A;  2E5N A;  4XLC A;  3RYP A;  3GBG A;  1ZKG A;  3BG3 A;  4AIH A;  1D1B A;  4PDK A;  5FD6 A;  1R5G A;  4MEX F;  5D5W B;  2AXT C;  2YUS A;  2FD5 A;  4LIT A;  3TOB A;  2CV0 A;  2L01 A;  1REP C;  2GXA A;  3R0A A;  2CSO A;  4PSX A;  2OZU A;  5J8C A;  1IV6 A;  5B1A H;  1IN5 A;  5FRN A;  1XDU A;  2LK2 A;  2VBY A;  2BV6 A;  2LRD A;  2W85 A;  3LQQ A;  2E60 A;  4EEF G;  1Z0X A;  3BTJ A;  1UFM A;  4A3E J;  2NS8 A;  1ZN2 A;  3ZQC A;  2L3D A;  3A0H C;  4L18 B;  2LBF B;  5EEH A;  4IL6 C;  1TT5 B;  4CCK A;  3TDU C;  3L9F A;  4A3B J;  2MC3 A;  2XPV A;  4XKV A;  4TV7 A;  1ETW A;  2OCC H;  2Y30 A;  1XMX A;  3BJ6 A;  3CUQ B;  3WTY C;  1TWF J;  3I64 A;  1S5L C;  5EEA A;  4YFK F;  2CRG A;  3E6M A;  2GZW A;  5EG0 B;  3RPU D;  1I50 J;  2ISZ A;  4UV9 A;  1Y56 A;  2E5Z A;  2ECB A;  1B9M A;  2JUC A;  3D0S A;  4KMF A;  1L3L A;  3QU6 A;  3WGI A;  1W7P D;  3TMO A;  4XMY A;  2NXN B;  3BG9 A;  1Q1H A;  2VXZ A;  2QEX I;  1XPX A;  3WTZ A;  3C7J A;  3BTI A;  1DP3 A;  2Y0S A;  3LSJ A;  1QVT A;  1W36 C;  5CVR A;  3ZQI A;  1ZQ3 P;  4IHT A;  3WE2 A;  4CGZ A;  2QUF A;  3K7A J;  1KGS A;  2DQR A;  5J1R A;  1F43 A;  3RKY A;  1XB4 A;  2GXG A;  1WPK A;  1Z91 A;  3CUQ C;  3D5S C;  4CSW A;  4BQO A;  4D0P A;  3L7W A;  4N0B A;  5JR3 A;  5CKT A;  4IPA A;  5FKN A;  2BY2 A;  1FBQ A;  5M5X J;  5ILV A;  2UXN A;  3HKZ N;  2YX7 A;  2K7L A;  4YFN F;  4A3J J;  3ABK H;  2RNG A;  1AU7 A;  3BZK A;  5L3B A;  3MKZ A;  4Y52 J;  1R22 A;  1U5T C;  2Q8K A;  2NVT J;  3K4K A;  4BGD A;  4C3J J;  2QZ8 A;  3JSO A;  3IV5 A;  2R0Q C;  1FOY A;  3CP2 A;  2DCE A;  3C2H A;  3BC8 A;  1MZB A;  1VQM I;  1A04 A;  2DPD A;  2D45 A;  1ETX A;  3ELK A;  3NAU A;  2LD5 A;  4ABZ A;  3HDD A;  3SQN A;  2CQX A;  3I4N J;  1R00 A;  1R58 A;  3FF5 A;  2MD5 A;  3RSN A;  1NG6 A;  1UHS A;  2FNA A;  2JPC A;  2L7F P;  2LMD A;  5GPC A;  3J7Y J;  1ERD A;  2IXS A;  3L09 A;  1Z7U A;  2DI3 A;  4I76 A;  3FHZ A;  3IC7 A;  2VJ5 A;  2Z33 A;  4OAY A;  2CH0 A;  5D5X B;  2V4J C;  2WAE A;  1OKR A;  4KMU X;  4I2O A;  2KRF A;  3HTU A;  2KQR A;  2ZME B;  3AG3 H;  4XRS A;  2F4M B;  3N97 A;  2L9N A;  2AQE A;  4EMS A;  3DKX A;  2KIS A;  4PJN A;  2CW7 A;  1WJF A;  3GTQ J;  3F6V A;  2HOA A;  4WXD A;  2PFB A;  4NNJ A;  2JVG A;  4M3G A;  5D5U B;  2LY1 A;  4X6A J;  3FM3 A;  3SZG A;  1BI2 A;  3GVA A;  5C44 J;  1L0O C;  4IRI A;  1X4P A;  4E7Z A;  2V9V A;  2CG4 A;  3HZJ A;  4BUP A;  4M9Z A;  3K4C A;  1C0W A;  3CMM A;  3GME A;  1XDS A;  5DD8 A;  2LY2 A;  1HBX G;  3RZO J;  3CUO A;  4IOA F;  3DEE A;  5L3D A;  1RI7 A;  1YIT I;  3ZCO A;  1M1E B;  3GFL A;  3E6D A;  2BVM A;  3H3V K;  2QM3 A;  3F22 A;  2ESN A;  3A1Y A;  4RAZ A;  3F8B A;  1LE8 B;  2OQR A;  2ELK A;  3KIO A;  4FT8 A;  2JPB A;  5J8F A;  1XMK A;  2F48 A;  1U2W A;  3VPR A;  4EJO A;  4CZC A;  1I6X A;  2NYX A;  3CJQ B;  3M8E A;  1B72 A;  4KNY A;  1UAA A;  4ZDP A;  2DFI A;  3K4J A;  3H36 A;  1Y8R B;  1H8A C;  5M3M J;  4B3A A;  3L2C A;  2DLL A;  2E1N A;  4UB8 C;  4QLC U;  5E3L A;  2KDO A;  2M4K A;  4EQQ A;  1JT0 A;  2CQ7 A;  3FK7 A;  2PMH A;  4FIS A;  3FXJ A;  4HX4 A;  4MLO A;  4M71 A;  2Y48 A;  4DZP A;  1Y6I A;  3PIO F;  4IHV A;  1BIB A;  3FKJ A;  1IRG A;  1OIS A;  5FFZ A;  1BOA A;  2L4M A;  1ON2 A;  2XKP A;  2YX4 A;  5ERI A;  4FHT A;  2DDB A;  5J47 A;  1MNM C;  1FWZ A;  3K10 A;  1X1B A;  1XSX A;  5E79 C;  1ZR2 A;  3KCC A;  5LHI A;  2VOO A;  2M8E A;  5FD5 A;  5J4Y A;  3IKV A;  1J9I A;  3M1C A;  4XOR A;  1EA3 A;  2DT5 A;  3H5R A;  5DV5 A;  3QU3 A;  4B4C A;  3Q5F A;  2V9P A;  4JBA A;  5LD2 C;  1X1P A;  2OA4 A;  3J81 Z;  1IV8 A;  2NRA C;  3BCB A;  4C2M J;  4HYE A;  4M9X A;  2DA3 A;  2VJI A;  1BR2 A;  3O2P E;  4A0X A;  5JVG F;  4RGS A;  2Z3Y A;  5F0F A;  2Y31 A;  2H1L A;  2O8K A;  3JRF A;  4OIP F;  2L02 A;  4FE4 A;  2K9Q A;  4AWX B;  3MZ8 A;  3GXO A;  3TP0 A;  1B8I A;  2X4H A;  2H09 A;  4LLN A;  2A61 A;  2COB A;  5D8L B;  1G6N A;  2WB1 N;  4G7O F;  5F1J A;  1TL8 A;  2DTZ A;  3SFZ A;  1LDD A;  2M7A A;  3DCF A;  5HLT A;  3WTW C;  4KIT B;  2VLA A;  2O03 A;  2PMZ A;  5DCM B;  3KEY A;  1WHU A;  3HUG B;  3BLY A;  5BOX A;  4WX9 A;  3AG2 H;  2FOK A;  3L2W A;  2EFO A;  1IXR C;  4C3H J;  2IP2 A;  3BR5 A;  2O3F A;  2BEO A;  2ZSI B;  2E1O A;  4BJ6 C;  5HLH A;  2AQF A;  3K1P A;  1W1W E;  2HU9 A;  2LOO A;  4R79 A;  2PX9 A;  4BQN A;  5DD4 A;  3CCR I;  4WF2 A;  2VAS A;  3DBR B;  5FLV A;  5K5Q A;  2HYF A;  3SZT A;  2YS9 A;  1HDD C;  1YX3 A;  1YJW I;  4JQF A;  3W3C A;  2XC7 A;  4NQW A;  4HSR A;  3RKQ A;  1R4M B;  3GUD A;  1FSE A;  1LDK B;  4XLF A;  1X3U A;  4I0A A;  3NRV A;  5GAH J;  3CCJ I;  4BXX J;  1IW7 F;  2VPR A;  2CQK A;  2QQB A;  3HM5 A;  3VWB A;  1LNW A;  5KCM A;  1TQM A;  3PO3 J;  4BXF A;  2XAS A;  3A2K A;  4QSH A;  2FSW A;  3BR6 A;  1FYL A;  3BR2 A;  1HLV A;  2H27 A;  1X2M A;  1OYY A;  3H0G J;  1A31 A;  2IVM A;  1QPI A;  3RYR A;  2I10 A;  3JRG A;  1ZRC A;  1N77 A;  4NC8 A;  5FRO A;  2P8T A;  4A5M A;  3JTG A;  3VB2 A;  3SEQ A;  3H35 A;  4F7Z A;  4HLY A;  1JKQ C;  1WWX A;  1I27 A;  1IG7 A;  2R93 J;  4A3M J;  1KYZ A;  3A02 A;  2XDV A;  2I5U A;  4HX8 A;  4BNC A;  4AIK A;  2M1B A;  2X1E A;  5CVV A;  3KET A;  4OIN F;  1JKR C;  1DGW Y;  4PJL A;  1F1Z A;  4BEH B;  2P81 A;  4BQA A;  2VQC A;  3HOT A;  3VYS B;  1R1T A;  1SVO A;  1FZP B;  2QF7 A;  3SXY A;  3S32 A;  1U78 A;  2DOA A;  1YG2 A;  1MMA A;  1WI9 A;  2HTJ A;  2XAF A;  3DEU A;  4HZF A;  4C9Y A;  3JAM K;  1SFO J;  1JKP C;  2K85 A;  4CYC B;  3LFK A;  2E1M C;  2O61 A;  1IDZ A;  1FT9 A;  2XGE A;  1MBJ A;  4BE2 A;  4B1R A;  4O5V A;  1Y1V J;  4BDZ A;  2IA1 A;  1DGR M;  2H6B A;  1WH7 A;  3EUA A;  3CTA A;  3TL4 X;  5CQG A;  3OYJ A;  3GWZ A;  3IAM 2;  1DPR A;  2DT7 B;  2F5D A;  3F72 A;  1LFB A;  2M45 A;  4FX0 A;  3FXU A;  4LB6 B;  2DA1 A;  3GW2 A;  5B5E C;  1FBU A;  4DYC A;  5E18 F;  2AS5 F;  1VQL I;  3H1C A;  2MSY A;  3B6C A;  4UV8 A;  4GRI A;  3CDL A;  3TOA A;  3UKG A;  1X19 A;  2WTE A;  3U21 A;  1XMA A;  3W6K B;  3WTV C;  3OYC A;  1HOM A;  2KLO A;  4A6E A;  1SD7 A;  3CCE I;  2FX0 A;  3CO7 C;  3QYF A;  2ZO4 A;  1PYV A;  5CVJ A;  2OBP A;  3ZQ7 A;  3LAP A;  3RTR A;  4HQE A;  4BL0 B;  4FQG A;  2RKH A;  3K9T A;  5FLX Z;  3OYB A;  5F08 A;  4BBR J;  2CUZ A;  3AG1 H;  1RZ4 A;  1BW6 A;  4NUB A;  1IUY A;  4MQV A;  3V42 A;  1EH8 A;  2D2W A;  2CFO A;  1W7P A;  2VI6 A;  1MD0 A;  4E70 A;  1ZGA A;  4RGR A;  4QIW N;  2VBW A;  3IKT A;  4L9V A;  1NK3 P;  5H2F C;  4RGU A;  1LKX A;  2JN6 A;  1MDM B;  2ZFW A;  2VQL A;  2EIL H;  2HKX A;  3LWF A;  3LST A;  2NVX J;  3RPQ A;  4XRS G;  5B1B H;  5K5R A;  4H4K C;  3IUO A;  3OOP A;  3CDH A;  2OC6 A;  4Y7N J;  1ZG1 A;  3L2V A;  3LSP A;  4E7J A;  4F3Q A;  5K7F A;  2HGC A;  3CD6 I;  4UUS B;  2A5Y B;  2GXB A;  2R7X A;  1X3Z B;  2ZKZ A;  1WQ2 A;  1Z05 A;  3CQZ J;  2VKD A;  2X9D A;  5BMZ A;  3I3L A;  4D7M A;  2MH2 A;  3FMQ A;  5KVR A;  2M3A A;  3HTS B;  2BHZ A;  3BT9 A;  4XM3 A;  2PEX A;  3U9G A;  4C3I J;  3CC7 I;  2OU2 A;  3LSI A;  2FJ1 A;  1ZGJ A;  2HNH A;  2XF7 A;  1XN7 A;  2DPU A;  3T5X A;  1SD6 A;  1ODD A;  2F5E A;  3LQR A;  2JA2 A;  4EJV A;  1MND A;  1FIP A;  2V1U A;  1WJ5 A;  1U9N A;  1N25 A;  1GLN A;  5IT9 K;  2V6C A;  1MSF C;  2MD0 A;  1YHQ I;  1B4A A;  2L4A A;  4BHP A;  1RET A;  1UST A;  2FBH A;  3PIP F;  4LJZ F;  1QHG A;  1GDT A;  1J7K A;  4CDG A;  1T98 A;  2RDP A;  4KIB A;  4RDU A;  3G3Z A;  5F6F A;  4HA8 A;  5F27 A;  2CFX A;  4K2E A;  3L00 A;  5EZG A;  2JTV A;  3P5J A;  2WAQ A;  2E36 A;  4OMZ A;  5TJJ A;  3HOU J;  1JHH A;  5HOD A;  3T0Y A;  4EM2 A;  2X6W A;  4UVB A;  2DA7 A;  2EZK A;  1HKT A;  1MBG A;  2LY9 A;  2RNJ A;  3A03 A;  4HF2 A;  2LDU A;  2CW0 F;  1K6Y A;  2IGN A;  3ZP5 A;  2P6T A;  3GLX A;  1G3S A;  3VSK A;  3MKY B;  5GAG J;  2VOD A;  1I1G A;  2JSC A;  2HOT A;  1XTA A;  2P5K A;  4IRG A;  4WCG A;  2VQG A;  1FLI A;  4XSX F;  1UZC A;  2O9L A;  2IS1 A;  4ZYD A;  3KZZ A;  2CQQ A;  2Y69 H;  1R36 A;  1F36 A;  2OQG A;  4G7H F;  2ID3 A;  2NNN A;  1DUX C;  4ENM A;  2KPM A;  4HNU A;  4A5N A;  1SC7 A;  1QBJ A;  4HQM A;  2H8W A;  2QGU A;  5E8I A;  2WAD A;  1WRJ A;  1T38 A;  1QZZ A;  2XAH A;  1RKW A;  3CCU I;  2K86 A;  3OWT A;  2DFF A;  3CCY A;  4U88 A;  4L5E A;  1MMD A;  1PJR A;  3BPV A;  3GYH X;  4UY8 I;  3HRU A;  2JA5 J;  1ZLJ A;  1GXP A;  2XF5 A;  4ZYE A;  4XBF A;  4ANJ A;  2ZXJ A;  3HHH A;  4KUM A;  1WI3 A;  3LSH A;  4EV0 A;  1SFX A;  4G6T B;  1T0F C;  2A6H F;  2HQN A;  2E2I J;  1D0Y A;  2CUJ A;  4G7Z F;  3I9V 2;  3P9I A;  1WJC A;  2LF8 A;  2R5Y B;  1D3Y A;  3PL8 A;  3I53 A;  4B44 A;  5GTI C;  1R1V A;  2LFB A;  1HDP A;  1HST A;  1O3R A;  3G1L A;  1S8N A;  4P9F A;  5AIP A;  3ZQQ A;  4F93 B;  3E5X A;  5IYB J;  4C2T A;  2R5Y A;  1NK2 P;  3OYG A;  5K1Y A;  4QWQ A;  2KP6 A;  2EIN H;  1RRJ A;  5ILU A;  4HBL A;  5IP9 J;  2EV0 A;  3E7L A;  4A3C J;  4XL9 A;  3L1P A;  4HV6 A;  4E6K G;  1JTX A;  3MEX A;  3ZN0 A;  3ZQH A;  4BXU A;  2W25 A;  4AYB A;  3G73 A;  1ZGW A;  3QOP A;  2D5V A;  2MFZ A;  4ASN A;  1DPU A;  2B0L A;  1V54 H;  2OTL I;  4KN7 X;  4ZC3 A;  1K78 A;  3QYE A;  4DBR A;  1IGN A;  4XOP A;  3K4M A;  4Q48 A;  1A6Q A;  1U9O A;  1YQA A;  2HQR A;  2VN2 A;  3KP2 A;  3LA3 A;  1OCC H;  2NNY A;  4AU7 A;  4FTH A;  1S9H A;  4U87 A;  5CJ9 A;  3ROU A;  2X51 A;  2ZME C;  2QBY B;  3O8G A;  1SFU A;  4YG2 F;  3KP5 A;  3FXL A;  3TBI A;  2XUB A;  2XSD C;  1Z7L A;  3OIP A;  5E1Z B;  2Z2S B;  5C4J J;  3ONQ A;  3H9Q A;  4B09 A;  2V1D A;  4RB2 C;  1LPQ A;  2XHK A;  4IJA A;  1U5T A;  3RQ4 A;  1MBF A;  2O0Y A;  2XGC A;  5IYC J;  2PI0 A;  1K6O A;  1BC7 C;  4B47 A;  3J80 K;  2B7E A;  4XN0 A;  4B3X A;  4O3M A;  2V7F A;  1R71 A;  2R7O A;  4WXC A;  5AON A;  1R49 A;  3BRO A;  2DU9 A;  3Q9V A;  1ETQ A;  5ICE A;  4J00 A;  4U0W A;  3HOV J;  1XCV A;  2QKM B;  2XAU A;  1GXQ A;  3C3W A;  1YJ9 I;  3E6C C;  2STW A;  1PVE A;  2DFH A;  2EIK H;  2FNP A;  4J01 A;  2GIV A;  3DBH B;  3M9A A;  2HOE A;  3QPT A;  4MFD A;  2KL4 A;  3KLO A;  2HDC A;  1E2X A;  3I0T A;  3K1N A;  4RA2 A;  1SAU A;  3F6O A;  2E34 A; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  2E2H J;  1B72 A;  4AC0 A;  3GTP J;  1APL C;  1H8A C;  4W97 A;  2DA6 A;  5M3M J;  4B3A A;  2EBI A;  5E3L A;  1EF4 A;  1JT0 A;  2YU9 J;  4A3L J;  3ZQG A;  3BR1 A;  3JRE A;  2OPT A;  3FK7 A;  4MLO A;  4FIS A;  1Y1W J;  2XGD A;  5FLM J;  4DZP A;  1X58 A;  4IHV A;  1UMQ A;  1BW5 A;  1P7I A;  1MNM C;  1JGG A;  1TC3 C;  1D5Y A;  5E3N A;  2MG4 A;  4M3B A;  3BTC A;  1RPW A;  1ZR2 A;  3W6V A;  1OJL A;  4A3F J;  3Q3S A;  3ZOB A;  3IH4 A;  1GV5 A;  3HEF A;  5J1Y A;  1SAN A;  4A3D J;  2RAE A;  1AHD P;  3GTK J;  4B4C A;  1H88 C;  1Z77 A;  3SDG A;  4C2M J;  4J19 A;  3K2A A;  4M6V A;  2LTP A;  4DYR A;  2DA3 A;  3CMY A;  1GV2 A;  4GFB A;  5F0F A;  3GTJ J;  5FJ8 J;  2M2E A;  5E3M A;  1MBE A;  1QVU A;  2K9N A;  4AYB N;  2Y31 A;  3FKI J;  2O8K A;  3LSR A;  3JRF A;  5C4X J;  1DU0 A;  4FE4 A;  4D5F A;  2K9Q A;  3DEW A;  4XID A;  4I6Z A;  5IOZ A;  3TP0 A;  1B8I A;  4NDL A;  2WAQ N;  4QTR A;  2TCT A;  4DZJ A;  2ID6 A;  1JT6 A;  2PMZ N;  2COB A;  3LOC A;  3B6A A;  3PO2 J;  2WB1 N;  5BNG A;  2LP0 A;  5F1J A;  2DTZ A;  3DCF A;  4MFE A;  1WCM J;  2R5Z B;  1AKH B;  1IDY A;  1DU6 A;  1TWC J;  1XC5 A;  1NTC A;  4C3H J;  3BR5 A;  4M3E A;  2E1O A;  1B72 B;  2LKX A;  2M9H A;  4V2G A;  1BA5 A;  1IJW C;  5FLV A;  2Y0S N;  4V2F A;  2YS9 A;  1HDD C;  3RKQ A;  2AO9 A;  4BKX A;  4MO7 A;  4X1E A;  4LOC A;  4CYC A;  1BL0 A;  1OFC X;  5JLW A;  3OIO A;  4IHY A;  2E2J J;  3BTL A;  4BXX J;  2DMT A;  2VPR A;  2XPU A;  1VI0 A;  3HM5 A;  2EH3 A;  3PO3 J;  1CQT A;  2MW8 A;  4QSH A;  4MIM A;  5EYR A;  3BR6 A;  3BR2 A;  3C2B A;  1HLV A;  4A93 J;  1X2M A;  3H0G J;  3Q0V A;  1LFU P;  2DMP A;  1QPI A;  1ETK A;  2CJJ A;  2I10 A;  3JRG A;  2XB5 A;  2E19 A;  3TP3 A;  3FK6 A;  3HOZ J;  3F0C A;  1YRN B;  1RES A;  2GLO A;  3OOU A;  5EZH A;  1JKQ C;  3LNQ A;  5F0H A;  2R93 J;  1IG7 A;  3M3Y J;  4A3M J;  4D7N A;  3A02 A;  2DMU A;  2R5Z A;  3BR0 A;  1AKH A;  1JUM A;  1RKT A;  1JUP A;  1JKR C;  5M3F J;  1POG A;  5IYD J;  2CU7 A;  2P81 A;  3BQY A;  4JX5 A;  2JA8 J;  2QF7 A;  2HI3 A;  5EDN A;  1IC8 A;  1U78 A;  1VFC A;  1B8I B;  3G1M A;  3GTG J;  1SFO J;  1E3O C;  1JKP C;  3HBL A;  3JR9 A;  1ETY A;  4XK4 A;  4CYC B;  3BG5 A;  4JP0 A;  1IDZ A;  3ZQF A;  1MH3 A;  2XGE A;  1MBJ A;  4B1R A;  1ZR4 A;  1Y1V J;  2JK3 A;  4G12 A;  3I4M J;  1XG1 A;  5K7Z A;  1WH7 A;  5M5Y J;  3TW7 A;  3TED A;  3FIS A;  3IH2 A;  1JJ6 C;  1LFB A;  2DN0 A;  4M3D A;  4IHW A;  3ZQL A;  2EQR A;  1I6H J;  2DA1 A;  4DYC A;  3S1M J;  1S7E A;  1R9T J;  2MSY A;  3B6C A;  4DW6 A;  2EZI A;  5FKL A;  3CDL A;  3UKG A;  1HOM A;  1MBK A;  2CUF A;  2FX0 A;  5C3E J;  4DYQ A;  1PUF A;  4M3F A;  3JRA A;  3BR3 A;  1T33 A;  4BY1 J;  1YRN A;  3GTL J;  3S17 J;  2DJN A;  2XB0 X;  3O8H A;  1W0T A;  5F08 A;  4BBR J;  1K61 A;  4S0H B;  3G1O A;  3QPS A;  1BW6 A;  1P7J A;  1A6I A;  3HB9 A;  4IHX A;  4UUT A;  1O4X A;  2H8R A;  2VI6 A;  4A69 C;  4RBO A;  1IRZ A;  4QIW N;  4AUX A;  1NK3 P;  3Q0U A;  1HF0 A;  5EF6 A;  1ENH A;  5IPA A;  2VUM J;  2JN6 A;  1JKO C;  2NVX J;  4XRS G;  1WH5 A;  1XS9 A;  1BJZ A;  2XPW A;  1GUU A;  3Q0W A;  3S2H J;  5EG0 A;  2IAI A;  4Y7N J;  2HYJ A;  4BBS J;  3LSP A;  5K7F A;  3OSG A;  2X6O A;  4UUS B;  2K9S A;  4W1U A;  5IP7 J;  1U8B A;  3A01 B;  5IP6 A;  3CQZ J;  2X9D A;  2IBD A;  4D7M A;  5IOY A;  1OCT C;  4XRM A;  3IH3 A;  1MBH A;  3BT9 A;  2M34 A;  1FTZ A;  4C3I J;  1W0U A;  1UG2 A;  1MH4 A;  2HOS A;  2JA6 J;  4BY7 J;  2FJ1 A;  3JRH A;  5FKO A;  5JLX A;  2ZB9 A;  2LVS A;  1K83 J;  1X2N A;  2WV1 A;  1TWA J;  3S1R J;  5K7H A;  2R92 J;  1FIP A;  5E3O A;  2KT0 A;  5GPA A;  5EGO A;  1U9N A;  4HNV A;  1ORK A;  2GM4 A;  3GBG A;  1MSF C;  1ZKG A;  3BG3 A;  3A01 A;  3OSF A;  3S2D J;  3S15 J;  1RET A;  2DMQ A;  1LE8 A;  1GDT A;  2K40 A;  2YUS A;  2FD5 A;  1TWG J;  4JX6 A;  1G2H A;  1FEX A;  2R7Z J;  4RDU A;  3HOX J;  1GT0 C;  3RQI A;  5F27 A;  2EZL A;  2NOG A;  1IV6 A;  3SJM A;  4IEJ A;  1ZTR A;  5EZG A;  1GVD A;  3MVP A;  2LK2 A;  3S1N J;  2DMN A;  4XIC A;  1FJL A;  4EEF G;  3HOU J;  1WGX A;  1Z0X A;  5HOD A;  3PM1 A;  3BTJ A;  2DA7 A;  4A3E J;  2NS8 A;  2EZK A;  3ZQC A;  3GTO J;  1MBG A;  2LY9 A;  3A03 A;  2CUE A;  3TW6 A;  5M5W J;  2NVQ J;  5J1U A;  4A3B J;  2XPV A;  1ETW A;  2Y30 A;  3M4O J;  2HOT A;  1HCR A;  1TWF J;  2O9L A;  3JRI A;  1QRY A;  2DA2 A;  5F0C A;  1TWH J;  2CQQ A;  2IEK A;  1ETV A;  1F36 A;  2VKE A;  5EEA A;  2KDZ A;  2CRG A;  1IUF A;  2ID3 A;  3GTM J;  2OF7 A;  3JRD A;  5EG0 B;  3JRB A;  3NAR A;  1I50 J;  4A3I J;  1A5J A;  1VND A;  2ECB A;  2LLK A;  1JTY A;  1RKW A;  1H89 C;  3WHB A;  2ME6 A;  3CCY A;  3BG9 A;  4L5E A;  4JX4 A;  1OCP A;  3BTI A;  3S16 J;  3LSJ A;  1QVT A;  1JUS A;  2JA5 J;  3ZQI A;  1ZQ3 P;  3SFI A;  2M8G X;  1WI3 A;  2JMW A;  3K7A J;  2Y9Y A;  1ETO A;  5J1R A;  2E2I J;  3S1Q J;  1F43 A;  2X48 A;  1PUF B;  3HOY J;  1WPK A;  1ITY A;  2R5Y B;  1FTT A;  2G0E A;  5FKN A;  2MGQ A;  1FIA A;  5M5X J;  2B63 J;  9ANT A;  3HKZ N;  2LFB A;  4A3J J;  2JWT A;  5GP9 A;  1HDP A;  3G1L A;  2Y2Z A;  3BQZ A;  4FE7 A;  1AU7 A;  2ME0 A;  5IYB J;  3S14 J;  4Y52 J;  2R5Y A;  1NK2 P;  2NVT J;  4C3J J;  3FIW A;  3IV5 A;  2R0Q C;  1VF9 A;  5F04 A;  4A3C J;  5IP9 J;  3E7L A;  1Q1V A;  3L1P A;  1ETX A;  2LR8 A;  3NAU A;  2HDD A;  1JTX A;  2LD5 A;  3MN2 A;  2JJ7 A;  3ZQH A;  3WHC A;  3JRC A;  2M0C A;  2O7O A;  2D5V A;  1ZGW A;  4ABZ A;  3HDD A;  3MKL A;  3I4N J;  2CQX A;  2L9R A;  3QPL A;  1IGN A;  2ECC A;  2TRT A;  2L0K A;  2AHQ A;  2HXO A;  1RR7 A;  1UHS A;  2L7F P;  5GPC A;  1U9O A;  4I76 A;  4FTH A;  2Y9Z A;  2HXI A;  3HOW J;  3QQA A;  2H1K A;  4JYK A;  3O8G A;  3HGG A;  2L7Z A;  4XRS A;  3LSG A;  2QCO A;  2DA5 A;  2FQ4 A;  5FKK A;  2XSD C;  1MSE C;  4D5C A;  5EGO B;  2L7M P;  5C4J J;  3GTQ J;  2HOA A;  3HGY A;  1T56 A;  5J3L A;  2EZH A;  4M3G A;  2W48 A;  1MBF A;  2NVY J;  2XGC A;  5IYC J;  4X6A J;  2N8G A;  5DS9 A;  1I3Q J;  2GBY A;  5C44 J;  3D1N I;  4A3K J;  2DA4 A;  2VKV A;  2XRL A;  3RZO J;  2NS7 A;  1ETQ A;  3HOV J;  4FCY A;  3RZD J;  3H3V K;  4UUS A;  2JA7 J;  4A3G J;  1LE8 B;  2ELK A;  2HQ5 A;  4MFD A;  5FKM A;  5DTD A;  1JJ8 C;  3VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...