2CQNA

Solution structure of the ff domain of human formin-binding protein 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formin-binding protein 3
publication title Solution structure of the FF domain of human Formin-binding protein 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2cqnA00
2CQNA 2JUCA 2KZGA 2KIQA 2KFDA 2L9VA 2DODA 2B7EA 2DOFA 2KISA 2LKSA 1UZCA 2K85A 2E71A 4FQGA 2DOEA
chains in the Genus database with same CATH superfamily
3CF5F 2ID3A 6PAXA 4GGGA 2VC1A 1XCBA 2OQRA 2ZFUA 2B63J 3FMSA 4ZYHA 4NQWA 1IUYA 1G8XA 1Y0UA 4EVIA 5KAFC 4OMZA 4AM3A 3K1MA 3RIRA 1ETXA 4PFOA 2DMPA 3DPTA 4PJ0C 5K1YA 4E7KA 3K4JA 4NHJA 4WWCA 3CLQA 3QAHA 2K5CA 2XSDC 1S7EA 1UG2A 5CVIA 4CSWA 4CDGA 4TV7A 4Q48A 4KMFA 3CUQA 3HOZJ 4KJZA 2MH2A 2MBFA 4RGXA 4JBAA 2DFIA 2ME0A 2EFNA 1K4SA 2EV6A 2XVCA 3CTAA 3AG3H 5K5RA 3MZHA 1RI7A 4ZTJA 3BG7A 4WK8F 2OCEA 3KYDB 1NHAA 3LSRA 4IHWA 2XV4S 4V2GA 4A3EJ 3ESWB 3LSIA 3VODA 1I5ZA 1FP1D 2A05A 4C2MJ 5LLQA 4ENNA 4CICA 4OIOF 2JK3A 2M7AA 4BQNA 1QZYA 2LH9A 4ZZDA 5BPIA 5GTIC 3WGGA 4WF2A 1HOMA 5FLMJ 2MC4A 4E7LA 3GFLA 1I1SA 3K9TA 2DA5A 2VBYA 4YIFA 3DF8A 1IZ1A 1UMQA 2JSCA 2RGVA 1QPIA 2B0LA 3SDGA 4AYBN 2PMHA 3IP4B 4XBFA 2BW3B 3BY6A 2NVUB 2LREA 1IJWC 2VBWA 2FQ4A 3CLOA 1YOVB 2HZTA 4QWQA 1YX5A 2LMDA 3C2HA 4KA4A 2QGUA 1BIBA 2JSPA 2BVMA 4QIWN 2Q8KA 2O03A 3OYAA 1EH7A 4BXXJ 1WGXA 1ZRCA 1S9HA 5LHHA 4AVPA 2H6CA 4BYYA 1AKHB 1RETA 5FJ8J 1ORKA 2D1HA 5IP7J 3BG5A 1FWZA 5DV5A 5D5XB 1N25A 4B47A 3EUAA 2P6SA 3GLLA 1QHHD 4XL9A 3W2WA 2QKMB 2XPVA 1HW2A 4S04A 1EJ9A 2H94A 3C7JA 2X6YA 2WB1N 2XRNA 1FYKA 4RS8A 3I9V2 3W2AA 4Y15A 5HS7A 1FT9A 4AIHA 4BS9A 1MBKA 3ZMVA 1OCTC 1F9NA 2LOOA 3CO6C 3BCAA 4XRSA 3D1NI 1T0FA 2WBMA 4LJZF 4XLHA 5FKMA 1YTYA 3U21A 3PJRA 2LBFB 2VASA 2BOLA 5KHDA 2K02A 4XICA 3L2QA 3DU5A 2CFOA 2OF7A 3E5XA 4ZZLA 1J5YA 2PEXA 4M3FA 4RAYA 4HX8A 2QQAA 3C18A 3VEPA 3KYLA 3G1LA 1B4AA 2IJLA 2O6GE 4ESFA 4CCNA 3FM5A 4DYCA 2ZXIA 2ELJA 4AIKA 3S17J 1BOAA 1ETQA 4LIUA 3KLNA 4O6JA 1XMAA 2V9VA 2XPWA 2V79A 3BTCA 5D5WB 4FTHA 5EEAA 2GAUA 1R22A 3A01B 1IDYA 1WJEA 3OL3A 3ZPLA 3HHHA 3SZGA 1O7LA 2LY9A 3K10A 1BW6A 3U1KA 4A0YA 2HOTA 1RZ4A 3K4NA 1LVAA 2A6TA 2YUSA 3I64A 3AAFA 2JZYA 4ASNA 1FIAA 1J9IA 4XLPF 2R0QC 3LAPA 2EIJH 3HJEA 2HYGD 1VQ8I 1MIJA 1W5CC 1FY7A 3WTVC 2G0EA 1S3JA 1MBEA 2ZJRF 2L7MP 2JPCA 3RZDJ 3SEQA 2O8KA 3GTGJ 2I8DA 3RKQA 2PBIA 3GZ6A 5CLSA 1VQ6I 3MN2A 3TKYA 2DCEA 1T33A 3HG9A 2R7SA 2BBYA 1N75A 2DA4A 3OWTA 1CQTA 4E7SA 1W36D 2ZMEA 2DFFA 4GYIA 1LDJA 1MNDA 2VT3A 4IOCF 2H27A 2W82A 2Q0OA 1A04A 1FTTA 3HPGA 1R36A 3KIOA 9ANTA 2JA7J 5L3DA 3TOAA 4HNUA 3CDIA 3K1NA 4Y17A 1RPWA 3JAMZ 3WTWC 1OCOH 5CPRB 1YITI 1HKSA 1Z7LA 3TEDA 2L7KA 3LSHA 4OINF 3KETA 2QENA 4XR6A 3DPUA 5J1YA 5DDGA 5C44J 5BMZA 1ZARA 4N9IA 4IX7A 4RGSA 5AONA 1YG2A 1BBYA 3K7AJ 2IGNA 1R71A 1SFEA 1IN7A 2R7FA 3TW7A 3HTUA 2JA8J 3FM3A 3C2GA 5B66C 4B4CA 3GX4X 3DP7A 1HSTA 4BDZA 3ZMSA 5IT9K 2Y2ZA 4F52A 3TBIA 3GXOA 1HC8A 2BVLA 1ETKA 4ZDPA 2KIUA 3JRGA 1POGA 4UUSA 4ZYEA 3HL2A 2V26A 2LTPA 3OIOA 3FF5A 1YIJI 5K7ZA 1X3UA 1E3OC 1ETWA 3KX2A 1GV2A 4A2UA 4ON0A 5K5QA 4H0EA 1YO5C 1FC3A 4AWXB 4EM2A 2DT6A 4A69C 3GZNB 2HPMA 2NAZA 1BC7C 2IGMA 2FF4A 4XSZF 4WCGA 1W1WE 2F4IA 4XOTA 4UNOA 1I39A 2DYRH 5IY5H 1ZKGA 3WGIA 3G73A 1H88C 2Y30A 2O61A 3U2RA 3SZPA 2VUMJ 4Y3OA 3KPHA 3D5LA 2OAZA 3E5UA 3MVPA 4BE1A 1BC8C 2A07F 3CUOA 1KU7A 2K4BA 4EV0A 1DGRM 2MYSA 2E5NA 3KYCB 1H9TA 5J3LA 3K4BA 5F0HA 3DLLF 3ABTA 4DGWB 1ZRDA 2DAOA 3MFKA 4R8HA 2R5ZA 2RREA 3ZQHA 2WTEA 4PJJA 5FB2A 3BLYA 4IVNA 1JGGA 2ZB9A 1ON1A 3E0JB 2ZBKA 2EPFA 3FMQA 2XF7A 4X0GA 2KKOA 4P55A 4HX7A 4QPOA 1R5GA 2W00A 1IUFA 5LHIA 3MWMA 1D1BA 2XAJA 3G71I 2L7FP 3KCCA 1AOYA 3OOUA 3HYIA 3W3CA 4DYRA 1FOXA 2XASA 4QSHA 4CCOA 4D9JA 1YFHA 4E7ZA 5TGTA 5FKLA 2MSYA 4PCQA 1U3EM 3SEZA 1U5TA 2L4AA 2EWNA 2M2EA 4HBLA 3RPUD 1B8IB 4X1EA 3HDDA 5KAIC 1SD4A 2MC3A 4RBOA 2E35A 1J09A 3I4PA 4GDFA 2HDDA 1HW5A 3ECHA 2LG4A 3A2KA 2FU4A 1RC9A 4XKCA 4LG0B 5GAHJ 1PJRA 3ASOH 4XM3A 4F91B 1OISA 2BY0A 2PJRB 1TWGJ 1DGWY 1GV5A 2MG4A 3M1CA 5FRNA 1LUJB 1FMWA 3J7YJ 3I56I 3GTPJ 4HSRA 1T08B 4IHXA 4KIGA 3O8HA 1RR8C 4ESJA 1VQ9I 2KZVA 2BV6A 3F9KA 3OYBA 1T98A 2AHQA 3FX3A 3G4SI 1MNEA 1O4XA 1G6NA 2GA1A 2EZKA 3WHCA 3I59A 1R1UA 3G6EI 2VKEA 3TW6A 5B5EC 4G6DA 4P9UA 2HVSA 4D0PA 2Q2EA 1F43A 1W5TA 2YS9A 4ZYGA 3J81K 2ACJA 3H0GJ 2ZJPF 5FFZA 4II2A 3DKXA 3K4MA 3K70C 3AL0C 2DQLA 2EH3A 2VQCA 1LEAA 1LJ9A 4AUXA 4LLGF 3FMRA 3EYYA 3IWZA 2XC7A 1YYVA 1XN7A 3Q0VA 3ABMH 4FE7A 1KU2A 4BEHB 2PJPA 1LVKA 1XB4A 2VODA 3FHZA 3NWSA 1V55H 2E2HJ 3DEUA 4BU2A 1TWFJ 2I10A 1JJ8C 3HOWJ 3BOQA 5D8LB 3S1NJ 1GXQA 2Z99A 4E7JA 3CDHA 2GOMA 4GYGA 1J59A 4AIJA 3J80K 4HNVA 1G3YA 4A3JJ 2DXIA 2H6BA 2IA2A 1KQ0A 3M07A 2MA3A 1ZN2A 3SXYA 3V8JA 5L3FA 1QVTA 3T1BA 1Y39A 5LRSA 1DU0A 2IS1A 2NS0A 2LY1A 3SDBA 2KT0A 3S14J 1RUOA 3K6GA 4IRHA 1BR1A 1PDNC 4I76A 2CFXA 4P9FA 1TW2A 3I58A 4HX4A 2L4MA 3AL0B 4IL6C 2E2IJ 4CO8A 1ZH5A 3QYBA 2TCTA 1QO0D 1E17A 2BY3A 4BQAA 1SVLA 2HNHA 1B6AA 2V6CA 3P9IA 1X58A 2LD5A 2VJ5A 1Y6IA 3ASNH 3LA7A 4BL0B 1G3SA 2Y9YA 2RKHA 2CJJA 5E18F 2G7HA 1JT6A 2M5WA 1QZEA 2H09A 2EINH 4HNTA 5TISC 4XLFA 2M30A 1MGTA 4QLCU 2ZXWH 2GIZA 1MNMC 3KZIC 1N78A 1PP8F 2TRTA 2WC2A 5A2QK 4NC6A 2VI6A 1ZAOA 2F2EA 1X1AA 3J7ZI 5CQEA 2AQEA 2DMNA 5DUKA 2STWA 1WKMA 3MKLA 1GHCA 5E1ZB 2F5CA 4BKXA 2YR2A 4ZYAA 1JKQC 2WADA 3OYEA 1S72I 5J4YA 3H5RA 1FOYA 2KIMA 5BOXA 3TL4X 4M3EA 1OCCH 2VJ4A 3F23A 2BHZA 4YFXF 1ZQ3P 2R7DA 1QPMA 5IP6A 3KEYA 2ZXJA 3BJAA 1WJCA 1S7OA 3CCLI 4HEA2 4XOPA 1R9TJ 1IXRC 4WXDA 4NC8A 2H1KA 4DJAA 1BA5A 1QNTA 3QYEA 4B48A 3H9JA 3JREA 3OYMA 2EA2A 1ETVA 1MDMB 3WTXC 2IVMA 2DBBA 2XHKA 3HSEA 3OYLA 4UV9A 2CH0A 1Z67A 5F0FA 3KP4A 4S0HB 4A3KJ 3LWFA 1Y0NA 3C3WA 4G94A 2IGKA 3J7AY 1ONVA 5LHGA 3CC2I 3Q0WA 5HLHA 1S29A 1XS9A 4E4HA 2XGEA 2Y48A 3RPUA 3MKZA 5J40A 4PFPA 1Y8QB 1SD5A 4BQOA 5IYDJ 1C0WA 1ZTRA 2JRMA 3DWLE 4DW6A 3OMYA 2DJIA 1K7AA 1IXCA 2Y9ZA 2Z2SB 2ISYA 3HOSA 2GLOA 4MQVA 2DOFA 5D8KB 1V5FA 5AIQA 4L9VA 4KIFA 4UUTA 4BGDA 4YEJA 4Q47A 3MKYB 4BDYA 4UV8A 4D7NA 2NOGA 2KJCA 3CJQB 3ELKA 4MNUA 1FLIA 1YS6A 1MD0A 2CQXA 1USSA 3CCUI 5EGOB 1A31A 3K4CA 2QVOA 2V9PA 5J1RA 2X48A 4AYBA 4PGGA 5DS9A 1IN6A 1EKEA 4FASD 3IL2A 2BW3A 5HNFA 1RKTA 3R0AA 1J0RA 4G8XA 4HOBA 1IRZA 3KP5A 5HS8A 2R92J 2AXLA 1MBJA 1W7PB 4FCYA 3S2DJ 1DU6A 1UHSA 2RC4A 3PQKA 3PSFA 1A6IA 1Z9CA 5EJCA 2WV1A 2Y75A 2LFBA 2XB0X 3TOBA 2QF7A 3ZOBA 1X19A 3KP3A 4YELA 4MIMA 1WVRA 2KISA 2CSOA 3IC7A 2D45A 4A6DA 5IT3A 3BTLA 1F4KA 5D4RA 2VJJA 5E8GA 1XSDA 5GAEJ 3OYNA 2QQ8A 1IAWA 1AU7A 3QYFA 3CCJI 4N4OB 5D4SA 1SEUA 2ELHA 3IV5A 1YW9A 2FQ3A 3KP6A 1TT0A 2M45A 4EJOA 3SFZA 3IKTA 1V5EA 1YRNA 3LA2A 3PSIA 2A3SA 4ESBA 2WB1A 1TWAJ 3HRTA 1WSUA 1RNLA 2CQQA 4HRIA 3JSPA 3WTUC 1LDKB 3P7NA 1EH6A 5BPDA 2OA4A 1NG6A 4E6KG 3M9AA 4B3AA 2DFHA 1TWCJ 4HG2A 2NXNB 1JI8A 4MEXF 2DA6A 2P8TA 5FKNA 4LMYA 4M9SA 2PMZN 2K40A 5EEGA 2XAGA 2KMUA 3M8EA 5LRRA 4M73A 3S2WA 4HF1A 1R4NB 3HPHA 2EJRA 5CVVA 2DA3A 3FBNB 4RB2C 1UZCA 5JVGF 2R7WA 1TZLA 4JOMA 1MSFC 1WJ5A 2IRFG 4CZZA 4U87A 4KN7X 3IH2A 1R23A 3WTZA 4XK4A 3ECOA 1R1VA 3VYRB 3BPVA 3H3ZA 3A01A 3LMMA 2CUJA 2PMUA 3MCZA 2DI3A 4D5FA 4JX6A 2KZGA 2CQ7A 1XMXA 1FTZA 1IG7A 1VQ5I 3HM5A 4FISA 4I02A 1QQIA 5HLTA 3T8TA 1FSEA 5FLXK 4EMSA 2CO5A 2DPDA 1OR7C 2MLKA 2E19A 1B9NA 3PUFA 1AA7A 1UB9A 3DTEA 1OKRA 1TBXA 1XDSA 3EPZA 2A68F 2DW4A 2LYCA 2HTJA 1JTYA 1WI9A 5F64A 3C2BA 2M8GX 3E1SA 2VB6A 3KEOA 1R00A 2LLKA 4R79A 3F0CA 1Z0XA 3S32A 1IO2A 4HA8A 4EQQA 3FBIB 2K9MA 5IPAA 4IRIA 4YIIA 2VE9A 3I55I 3FHNA 1MJBA 5EZHA 2ELKA 4M6YA 4Y13A 2K7LA 3R0JA 3GTMJ 2JA2A 5F1JA 1TQMA 1O7FA 5E79C 2Y0MA 3OIQA 4II3A 1MMDA 3P9CA 4G7ZF 3S15J 1IC8A 1G3WA 2MABA 3LSKA 1ZYRF 1JJ6C 1FP2A 1H0MA 2E71A 4RAFA 2FD5A 4A3LJ 1VQ4I 4IZZA 4MLOA 2FNPA 1R6RA 1I1GA 4KICA 5B1BH 2MGQA 3JRDA 2P4WA 2L0KA 3BTJA 4FX4A 3RPQA 4A93J 4E70A 3DCFA 3G3ZA 5IOYA 4L18B 5JLWA 4GRIA 2NRAC 2CRGA 2L9RA 1MJAA 1S6LA 2V1NA 3H5NA 3ZQCA 1GDTA 4DQ2A 1UG0A 5KCMA 3OSGA 3H3VK 2XAUA 2JMWA 1OPCA 4PUSA 4X6AJ 1T6SA 1ODDA 4LIVA 5KNLA 4PK4A 3GF2A 4BNCA 5GADJ 2F4MB 1T95A 2CV0A 5FKOA 1K6OA 2KIQA 2NNNA 1P4XA 3BZKA 3WE2A 4CCLA 3FXQA 2E36A 3HOUJ 3K70D 2JWTA 2KDOA 5E20A 5TRDA 3GFJA 1IXSB 5J6XA 2KP6A 5H20A 3CCRI 1MJ9A 1F36A 4PDKA 3AG4H 5FD5A 2EFWA 1I3AA 2P5VA 1U9OA 4B1RA 2AQFA 2Z16A 1BL0A 5TJJA 4U0YA 1LFUP 1K78B 4NC7A 5M5YJ 5J8CA 4KNYA 2IS4A 1PP7U 1F5TA 4BAYA 3FISA 4OU0A 3JTGA 2RVCA 3F8FA 5M5WJ 1H9GA 3OS1A 2DODA 2FEZA 2NNYA 2LVSA 3K69A 1LE8B 2O3FA 2FXAA 1I27A 3JR9A 3HSRA 2W1OA 1IN5A 5D5UB 2FOKA 2ID6A 1FBUA 2HXIA 3IUOA 3QRFF 4E7HA 4LOCA 2HU9A 3E6BA 4UVAA 4CYDA 2VE8A 4WXCA 5HLGA 3BZ6A 2YX7A 1VFCA 2X85A 2MH9A 4OIQF 1IN8A 2F5VA 4FETA 4I99C 5LGTA 3VWBA 4LK0F 1SFUA 1BN5A 3ZQQA 5DM7F 5FO5A 2V9KA 4NBQA 5DEQA 2DMTA 2FRHA 4DOZA 4BHPA 1MW7A 1XSXA 2BYVE 3S16J 3NQOA 3K2ZA 2KQRA 3CD6I 2QZ8A 3OS2A 1BI0A 1JKOC 4A3GJ 4RB0A 1D1AA 2KHMA 2OQGA 3HRMA 4RGRA 2E7XA 3PQJA 1OQYA 3DFGA 4BJTA 4BBRJ 3BROA 2W84A 1AWCA 3M7GA 3JCUC 4HZFA 3F22A 5E1WA 4M72A 2FMYA 3JRAA 4DYQA 1FYMA 4IKFA 1T39A 1WRJA 3NEUA 3CJNA 4DBRA 2Y31A 2WWYA 3CCSI 1B8IA 4UB8C 3FZVA 3O6BB 4OIPF 2L01A 2XAHA 3BR2A 4CZCA 3HIFA 3GTJJ 3GLXA 3RJPA 1B72B 3HKZN 1MBGA 1XCVA 3CDLA 4IF4A 1GXPA 2VL8A 1QVUA 1MZBA 3FIWA 3UNGC 1JHHA 4ZTFA 2VC0A 1WPKA 4LG0A 4RAZA 3PO3J 3QOPA 1IF1A 2X1DA 4DIQA 4RDUA 2D1VA 1WH7A 1ERDA 3V8LA 1F1ZA 2QYOA 3T8RA 2IA1A 3QPTA 1S8NA 2P5LC 5GPCA 1WI3A 2DDAA 1DP7P 1TTYA 2L9VA 2IS2A 1V3FA 1SFOJ 4KDPA 1ENHA 5F1RA 1TC3C 3PIOF 1SVOA 1Z77A 3ZMDA 3ZQGA 5L3BA 3PL8A 1ZHFA 3AKZA 2JQ7A 3HUGB 3FDYA 1Z6TA 3OYHA 2KL4A 3G2BA 1NG7A 3EDPA 4JP0A 4A0ZA 3JRBA 4YG2F 3UKGA 2R7QA 3GTOJ 2D2WA 1ETOA 2M8EA 3EUHC 1W7PD 3HEFA 3LL7A 1U78A 1FX7A 2FE3A 1YJ9I 3H36A 4I0AA 3DBRB 5ILSA 3F8MA 3R6SA 1WFXA 4J00A 2ETHA 5K5OA 5GP9A 4QTRA 3H92A 1MH4A 2JRTA 3LOCA 3CCVI 2FMLA 4EJWA 1SFXA 1EV7A 1I6HJ 3GBGA 1WCMJ 4XN3A 3O3KA 3DEEA 4C9YA 4CHUA 5CVJA 3DKYA 2MLGA 3S3NA 3GW2A 2LK2A 4IEJA 4BEHA 2ZMEB 2A6HF 2XF5A 1VQPI 1YE9A 2F5DA 3ABKH 3NWTA 4L5EA 4N4NB 2H8WA 3NRVA 4E7IA 2ADUA 3UR3C 4D7MA 1QBJA 4Y52J 5HDKA 3BT9A 4I98B 1OYWA 1B9MA 4XKBA 1RESA 2OCCH 1HXDA 1WZ2A 2W7NA 2HYJA 2WAQN 1OLTA 3CCEI 4OAYA 2BXZA 3QOEA 3S8PA 5DD4A 3RKYA 4KITB 3PNYA 3ABLH 3ZXSA 4L0ZB 2VPLA 3IAM2 3L09A 2NS7A 3F8BA 2A69F 3JTHA 3V7CA 4A5NA 1KZHA 2ME6A 1MSEC 4XONA 3L2WA 3BCBA 2F5EA 1RKWA 4MEYF 2X51A 4GCVA 4EJUA 1YQAA 2XROA 3HGYA 1RRJA 4LD5A 4LB5A 3I54A 1ZLJA 4ENMA 3ZN1A 3VYTB 2QSFX 4LG3A 2LSOA 3AG1H 4XORA 5D6EA 2VT2A 4BH9A 1SD6A 3PNTA 1NK3P 4IXAA 1VQMI 1OFCX 1X1BA 1W5SA 1P4WA 1IRXA 4HDVA 5H6RA 1HDDC 1G3TA 4A3BJ 2JN6A 3A02A 3ZRGA 4IHYA 4HV5A 3W6KB 4XLCA 5E3MA 4HF0A 4M71A 4XSXF 2RDPA 2GXAA 2R7TA 1FNNA 2NYXA 4KUMA 1K6YA 3E6CC 3HZJA 3WG9A 1ZELA 4NUBA 4XIDA 1IDZA 2A5WA 2OV7A 3JAMK 1IRGA 3E3VA 2BY2A 5DUIA 4C2UA 1FEXA 1JUSA 2HQAA 3K0LA 2CV1A 1BJZA 1UHMA 1Z21A 2HGCA 2LKXA 2HTSA 4MTEA 4AIDA 3B02A 5EG0B 2E60A 1VZ0A 2V4JC 3I71A 4IRGA 1XGSA 4ANJA 2UUZA 2CGPA 4L5IA 2R5YB 1DPUA 3SFIA 1LB2A 5L3CA 3ISPA 2WY8Q 3WU0A 1KQ8A 1TWHJ 2CUEA 2X1CA 2L02A 3IRQA 3BR0A 1GVDA 1DP3A 4H4KC 1J2XA 1JGSA 2YPRA 4RAGA 5F0CA 4P5OA 1EF4A 1JUPA 2DQRA 4W97A 2UWMA 2KRCA 1XGNA 4U7DA 3JRIA 1MDMA 3A03A 3P5JA 4R1HA 1P9QC 1UJ8A 1Z1DA 2K27A 3LAJA 2DT7B 1GLNA 3M3YJ 4ZH4F 3RSNA 2CMPA 3T0YA 2X6OA 3PFYA 5L3EA 3OIPA 2K3FA 4M6VA 1K79A 4UHTA 4A6EA 2XF6A 3BJOA 4KN4X 2DN0A 1TT5B 3MEXA 2F6CA 4LLLA 4G9YA 2XPUA 1OMIA 4G6TB 4P96A 2V7FA 2CU7A 1MBHA 1TL8A 1W0UA 4GXOA 4J01A 2KIFA 2HYFA 1SMTA 2GQQA 4YFKF 1FZPB 2OTLI 2X6XA 1X3WB 3IKVA 4GO1A 3OS0A 2P7CB 1OYYA 4CYCB 5LBQA 3HOTA 2IS6A 3B6CA 3BWGA 5LEJA 2GXBA 1R49A 1TQPA 2EIMH 1S7AA 3DU6A 1MMGA 3F72A 2STTA 2AS5F 2CS3A 3BC8A 3IH4A 1Y56A 4ZC3A 2FBKA 1X4PA 1VI0A 1NTCA 3B73A 1T56A 1E3HA 3DTKA 2FX0A 5EGOA 2KRFA 2CV2A 2OC6A 3REOA 4BXFA 2CG4A 4MHGA 4RB1A 5E17F 1O57A 4EJVA 3OYIA 4HAMA 5F6FA 2W57A 3ZGKA 4ENJA 1LFPA 2F4OB 4F3QA 3S1RJ 3MD2A 4M3DA 4ZJZA 2M7BA 5FGMA 2QBYB 3KP7A 1TP4A 2GXGA 2EV0A 2HI3A 1XG1A 2E34A 5J47A 4I2OA 2DK5A 4KT6A 5CVRA 5IP9J 2XGXA 5FLVA 4XN0A 1BI3A 2OUMA 5HDNA 2PLYA 4RLFA 5DCMB 1X1DA 3W6JB 2R7UA 4HLYA 4HQEA 3GO5A 3ML6A 3RKXA 5K7FA 4F55A 2Q2EB 2YSRA 2CUFA 2M1BA 3CMMA 3D0SA 5EEHA 4I01A 5E3OA 3M8JA 1N77A 3TDZC 3PUBA 3MQ0A 5LFAA 2XAFA 2E2JJ 2K9SA 3KEQA 3HSFA 1X4OA 3JW4A 3ZQLA 1WQ2A 5F04A 3V8KA 5C4JJ 2ZO4A 3MMYB 3TDUC 3TQNA 2FBHA 2EQRA 2QA4I 5JLXA 4BJ6C 4UVCA 5HOOA 3S1MJ 4ZDOA 3G1MA 2MFZA 2LDUA 2PMZA 4A3DJ 1IV6A 1JT0A 5CKTA 1G2HA 3D5SC 3QPSA 3R60A 4HW0A 1D0XA 5CQGA 1S5LC 5AIPA 1T38A 2LY2A 3HGGA 2HQNA 4G7OF 2QWWA 1D0ZA 1WJAA 1XTAA 2VXDA 1RUNA 1WJDA 4JQFA 1LQ1A 4MQ9F 4S05A 5KK1A 2IXSA 3SJMA 3BG3A 2R7OA 5H6QA 1SVMA 2KPMA 5GAGJ 2BGCA 2IW5A 1T8IA 3OYDA 3I3LA 1PUFB 2K85A 2ZJ2A 2CW7A 3JRFA 2ESNA 2DA2A 1IGNA 2RNGA 2F48A 1OCRH 4I09A 3CCMI 2B9SA 2ZFWA 3FXMA 3V7RA 1KYWA 1Z91A 2BHYA 3OOPA 4RM2A 3DTIA 2HKOA 3BR1A 3I4MJ 5HNHA 2ZC2A 1W0TA 4EATA 1O3TA 2QLZA 3ULQB 1ZGJA 1K4TA 1PUEE 3R4KA 3CMAI 3GTKJ 3E5QA 1Y8RB 2ZJQF 3A0HC 4B09A 4BXUA 1MKMA 4V19K 2DK8A 5EDNA 1B1BA 4CGZA 4HYEA 2ICWG 1DQUA 3ZMZA 4C3IJ 3CF2A 1VNDA 3C1DA 1YIOA 3K4LA 4HV6A 2H8RA 3X2QH 5ERIA 3VPRA 3CZ6A 3LFKA 2DMUA 3ZCOA 2L5QA 4XLNF 3RI4A 1Q1VA 2IT0A 3O8GA 2IGOA 1MH3A 1UFMA 3CESA 4M3GA 1R7JA 2Y0SN 2FOWA 3RYPA 1AKHA 3E6MA 1ZLKA 4C3JJ 3DBLB 1BW5A 2E1OA 1I50J 2HPIA 4HQMA 1VQ7I 2ECCA 4GFBA 3COAC 1V4RA 1FIPA 2Z33A 2PI0A 2VKHA 4M74A 1CGPA 3EUKL 3H9QA 3BDDA 3EETA 1ZREA 3TMOA 2A5YB 1OCPA 2OU2A 2R93J 4QPQA 1ETYA 1W4MA 1ZG3A 2I5UA 1P7IA 1QA6A 2R4GA 2PN6A 1IV8A 3I5UA 3WHBA 2BXYA 2RNJA 2L9SA 2JVHA 3DLAA 3GMEA 3DEWA 1PYVA 2O8XA 2LRDA 1X3ZB 3FXUA 2R7XA 2O5RA 4A5MA 1LNWA 2XSJC 3QQAA 3GYHX 1IN4A 4PSXA 2EILH 4LB6B 4FHTA 5K7HA 2LBFA 3LSPA 2M9HA 2VQLA 1XX5A 5EF6A 1ZGAA 1JHFA 2QQBA 4MFDA 1ZG5A 1OR7A 2VKVA 4C2TA 2QSGX 3BR3A 3WTYC 1D5VA 4BBSJ 3CJTB 1FPQA 3MAJA 5ICEA 5HS9A 1ZR4A 4Q4ZF 3NAUA 3LSMA 2VQGA 4N0BA 4CCMA 1LKXA 1AHDP 1BJAA 2N8GA 2VKDA 5J8FA 3QPLA 1OJLA 3VSLA 4D1QA 1R1TA 2L3DA 1J7KA 1TNSA 3BR6A 2GWRA 4UY8I 1ZRFA 5KVRA 1U9NA 2COBA 5ED4A 5JR3A 1X2NA 2VIXA 4HSTA 3FKJA 1P4AA 2HOAA 2M4GA 2X6WA 2WY7Q 4KFCA 4J19A 3KZZA 1G4DA 2B7EA 2V1UA 4PZJA 4BY7J 2R3SA 3FWEA 4EM1A 2R7RA 2P6TA 1K78A 3CUQC 3TGNA 3OL4A 2MW8A 4RMNA 1CF7B 3HTSB 1ITYA 2EFQA 2LP0A 3H1CA 3FXRA 4NB5A 4XKVA 1R5ID 4BJ5C 4HF2A 1HLVA 2EV5A 1FBSA 3OSFA 1LE8A 3Q5FA 1WJBA 2FA5A 4HDUA 1TW3A 2UV1A 3RYRA 5IT9Z 1KGSA 2ZCWA 2NVYJ 2PG4A 1HKQA 4IJAA 3WGHA 5ICGA 2OPTA 2GA2A 2EZIA 4AU7A 1USTA 4RM3A 4NQWB 3WTSC 1JE8A 3T5XA 3BP8A 2AO9A 5HDGA 1LPQA 3IRRA 1HCRA 1VQKI 3FXLA 3HHGA 4G6QA 4CH7A 1O3RA 1SFKA 1QU3A 2QKLB 2KJBA 1QZZA 3PM1A 3WTTC 3RKWA 2JA6J 2W24A 2CWEA 2XGDA 4A12A 4OIRF 1P92A 1P7JA 1YRNB 4IPAA 1KA8A 3ERMA 2HXOA 2QUFA 4OAZA 1YHQI 3TO9A 4Y7NJ 3CMEI 3CUQB 3R61A 1ZR2A 2RQQA 4UB6C 2HQRA 2AXTC 3GFIA 2KFDA 3DXJF 2O0YA 3FXKA 3K1PA 4A0XA 1OCZH 2NOJB 3CO7C 3BZCA 2K9QA 4Y4RA 1RIOH 1IW7F 3ZR8X 4PGHA 3HKZA 1LFBA 4K2EA 1B72A 3W6VA 4OMYA 2FBIA 1A5JA 1J75A 2FNAA 3GVAA 2HVQA 3D5RC 1HSJA 4MFEA 2A61A 4CCJA 1Z6RA 1REPC 1ON2A 4PSWA 5D5VB 1WH5A 4F92B 3K4KA 3OV8A 3OYGA 4U0VA 3QU6A 4IQ4A 2M3AA 2IBDA 1FMVA 2LC2A 3VYUB 1Z3XA 3TO6A 4BHBA 1ZGWA 2L9NA 5J1UA 2D5VA 3L2RA 2HVRA 3RQ4A 3L2VA 3VFZA 3GTLJ 3B6AA 3F6VA 2M0CA 3MZ8A 2JUCA 4MGRA 2DFEA 1OYIA 2DDBA 3HUGA 4B44A 5IOZA 4JYKA 3L1PA 4WX9A 4AVZA 3DV8A 3BQZA 1D5YA 4ENKA 4KYWA 3ERED 4UUVA 5IYCJ 2GZWA 3V4GA 2GM4A 1T0FC 4C30A 3OYFA 1D0YA 2CQNA 1Y1WJ 2P81A 1A6QA 3Q0UA 1SANA 4IHSA 3VYSB 1TLHB 2ZNYA 2OD5A 2J5PA 3KFWX 2HEOA 3WU2C 1BI2A 2X1EA 2DO7A 5LD2C 3RCOA 3S3MA 2G9WA 2W25A 2EIKH 4KMUX 2IP2A 3E7LA 2KLOA 5JFRA 4BY1J 5JI6A 4CXFA 2ESHA 2L54A 3ZN0A 1O3QA 1SAUA 2HKXA 2WAEA 2W48A 5E3LA 2HOSA 1XGOA 3GZ5A 1QGPA 1ZG1A 5BQTA 4JK1X 2DYSH 1GUUA 2XKPA 3KE2A 5BS6A 3Q9SA 2PX9A 3CP2A 4EGZA 1MMAA 1WJFA 3S3OA 2ZNZA 3OYCA 4PJMA 2UZKA 1E2XA 2WAQA 3QWLA 2OBPA 3TO7A 3P9KA 3IWFA 3MZYA 2K3PA 3BQYA 3H5AA 4BACA 2OJED 3GCMA 2X0LA 3FK6A 4LFUA 1XMKA 5FFXA 4NDLA 3RTRA 4XLAA 3J81Z 3EUHA 1XPXA 1K61A 2K9LA 3LFUA 3CP8A 4KISA 2PFBA 2O9LA 3NARA 3VOEA 1DUXC 2VOPA 2QQ9A 1TNTA 1FSHA 5JVTA 4KIBA 3BPXA 3JSOA 4YIRX 2ZMEC 3PNVA 4I6ZA 1DDNA 2PJRA 2Z3YA 3L7WA 5E8IA 5J4VA 3WODF 1MMNA 4XRSG 4F7ZA 1D8JA 3N4MA 3U1DA 4B3XA 4ETSA 3TP3A 2JT1A 2RQPA 3EQLF 3GEZA 4M6XA 2QSHX 2PQ8A 3F6OA 3JRHA 2Q1ZB 4Y33A 2E7WA 3K2AA 4Q5SF 1BR4A 1X2MA 1NH3A 2VLAA 2BY1A 5E3NA 3J80Z 5DD8A 1U2WA 1K83J 1HKTA 2MD0A 1E0EA 1FJLA 1B59A 4JX4A 2FUG2 1WWXA 5JHUA 1YS7A 1HDPA 2ISZA 4NNJA 2NVQJ 5H2FC 2DMQA 3F8NA 2HDCA 5EG0A 2Z9OA 1YW8A 3ZMTA 2R7VA 4RB3C 2R5YA 2C6YA 1KU3A 3HXLA 1RR7A 2L7ZA 3AFHA 3CC7I 3HRUA 4IHVA 1IRFA 1EH8A 2EFOA 2Y69H 3HRSA 2L2OA 4L5JA 1A36A 2LF8A 1ZK8A 4N9HA 1JKRC 2XIGA 5ICCA 1SAXA 1KQ9A 3S1QJ 4A3CJ 3QU3A 4LITA 3SHFA 2V1DA 4O5VA 4PJNA 4AD9A 1E3PA 3SYTA 3J7AO 1U6GA 3V7SA 5A2QZ 3LA3A 5C3EJ 4O3MA 2XRLA 2VN2A 5M3MJ 1QHGA 2XKOA 2ZKZA 4D5CA 4A3MJ 2DTZA 2LR8A 1G59A 2DPUA 1P2FA 4JX5A 4L9JA 4L0YB 2GBYA 3I53A 3H0DA 1GVJA 1BM9A 2HWVA 5L3GA 3MKWB 1X1CA 2WV0A 3VDXA 4XQFA 2P5KA 3M8FA 1ULYA 4LLNA 4U0WA 3WE3A 3G1OA 1Z05A 1L3LA 1Z3YA 4FQGA 3H9GA 4CYCA 4DZJA 5FD6A 1XD7A 2DOAA 3GTQJ 2HOEA 3CC4I 4UUSB 3CQZJ 2NVTJ 3RZOJ 4HLXA 2DJNA 2IAIA 3FKIJ 2EK5A 4IOAF 1HW1A 2A6EF 4CCKA 1APLC 1YLFA 2M34A 2WAFA 4XMYA 4FT8A 4DZPA 1JTXA 2X9DA 4BE0A 2EA4A 5LEKA 4WXHA 2JJ7A 2BEOA 2IPQX 3CJRB 5CYVA 1SC7A 1UELB 2O7OA 5DCFA 3TP0A 2VONA 1H89C 1TQIA 1YI2I 2F5FA 4KT5C 1YX3A 1PVEA 2QBYA 3OYKA 5FKKA 2NS8A 1U5TC 1HA8A 1SMYF 2R7ZJ 4M3BA 4M9XA 2EZHA 2HZDA 3IAS2 5B3SH 5E1XA 3LSGA 4CUGA 2P7VB 2HDWA 5M5XJ 5DCMA 4PJLA 4DBQA 4XLEA 5HVQC 2YU9J 3KLOA 2RV8A 3ZQIA 1MBFA 4LGWA 2YU3A 1UCRA 1VQNI 1D8KA 2EFPA 1YJNI 1YJWI 1STZA 4MTDA 3F3XA 2LF7A 2VBZA 2R5ZB 1VTNC 1D3YA 3Q3SA 4BUPA 3GWZA 2OZ6A 1I3QJ 2W85A 5EZGA 2V1XA 2ECBA 2IA0A 2DLLA 1ACIA 5B1AH 1HBXG 2JA5J 2QCOA 1P6RA 2LNBA 1R5HA 4IO9F 2ZSHB 3E97A 1XGMA 3SQNA 1KYZA 3Q9VA 2OZUA 3BTIA 3JRCA 3WU1B 5EYRA 3HOVJ 2TDXA 1Z7UA 4G12A 2HS5A 3WG7H 2EB7A 2E1CA 1VF9A 1GT0C 4F93B 2QM3A 2XAQA 4XKWA 4M9ZA 4CA0A 2IEKA 1LEBA 3DQVC 4IHTA 3PO2J 5HLIA 2LKPA 1DPRA 1UAAA 3KP2A 1XC5A 1R58A 4B8XA 1L0OC 2CW8A 1U5TB 3PFIA 3F21A 1HQCA 1LDDA 3A1YA 1VQLI 3ZP5A 2DT5A 2QEXI 2RAEA 3AG2H 3FK7A 2EBIA 5JHFA 3M1EA 1W36C 2FJ1A 4A3IJ 3LNQA 2BZTA 2COMA 2K86A 2ZSIB 4ABZA 1PUFA 2V6EA 3L2CA 3HBLA 3L9FA 5DTDA 3S93A 2H1LA 3LSTA 1FBQA 1X1PA 4MO7A 1HF0A 1V5GA 4EEFG 5FRMA 2ZXHA 2E5ZA 3QP6A 5C4XJ 1QRYA 1SD7A 4U88A 3I4NJ 4EJTA 3N05A 2Z1DA 1O3SA 3CCYA 3I0TA 2NVXJ 1I6XA 3E6DA 3V42A 3ZQFA 3HOXJ 2M4KA 3ONQA 2JPBA 5HODA 3KZYA 5CVUA 1W7PA 2M87A 3BG9A 4I0BA 1FYLA 2RN7A 1U0JA 3HB9A 5DM6F 5ILUA 5ILVA 2VQHA 3RDIA 2DA7A 3RQIA 3I59B 3IHUA 4RLQA 5M3FJ 1FOKA 3VSKA 2CW0F 5LGUA 3ABUA 5F27A 1BR2A 2MD5A 3PIPF 3FXOA 3IH3A 2XB5A 2DTRA 2Y0SA 1H8AC 2XUBA 2KRHA 3OYJA 2VJIA 5BNGA 1UHWA 1XSVA 2VPRA 1BOBA 3BR5A 3QPHA 3W2VA 1M1EB 1D1CA 1EA3A 3DPLC 2E1MC 3LQRA 4V2FA 5ICFA 3ZMUA 1Y1VJ 2W4SA 3OR1C 3GFMA 4L9TA 4B43A 4OWRB 5IYBJ 4Z6YA 2CUZA 2EZLA 2JTVA 4FE4A 5FLXZ 2HR3A 4XRFA 1BI1A 2E1NA 2XDVA 4UVBA 4U7BA 4BHCA 4OOIA 3HOYJ 3L00A 2VBXA 4W1UA 4IQJA 3EYIA 1A35A 3SZTA 4YFNF 4BE2A 1U8RA 5DYMA 5LGNA 3BJ6A 4XRMA 1YW7A 3A0BC 4EGYA 2JUGA 3OR2C 4Z2YA 2P0WA 4L9NA 2J5OA 1BIAA 2GOXB 1JKPC 3LSJA 4ITVA 2DA1A 4DNCA 4UXNA 2HFHA 2Z5UA 4I7HA 2X4HA 4C3HJ 4HPQA 4YRVA 2UXNA 2GIVA 1JUMA 2JVGA 3BG6A 3QP5A 5GTHC 4G7HF 1T2KA 1U8BA 3QODA 3S2HJ 3M4OJ 3N97A 3LQQA 3VB2A 1MMSA 2E1MB 2KDZA 3U9GA 2M0MA 1FOWA 2CYYA 5FROA 4EM0B 1VQOI 1XDUA 2UXXA 1KU9A 4RGUA 1KONA 2OTJI 3FXJA 4RA2A 4XNFA 3H3UA 2DOEA 2HQ5A 4ZYDA 4BQQA 2K4JA 1Q1HA 2CQKA 3OY9A 1CF7A 4AC0A 1WHUA 3H35A 2DU9A 3O2PE 2XGCA 2YX4A 4FX0A 2BE5F 5F08A 5CJ9A 3L2UA 3GUDA 5D6FA 3HC7A 4A3FJ 3DKWA 2LKSA 1V54H 3CMYA 2VXZA 3ROUA 5GPAA 4ZDLA 3ZQ7A 2K9NA 2FSWA 1R4MB 1NK2P 3F8CA 1JXSA 3DBHB 3A4CA 2G7UA 3CCQI 4P1WA 2VOOA 2WA0A 4LK1F
chains in the Genus database with same CATH topology
2CQNA 2JUCA 2KZGA 2KIQA 2KFDA 2L9VA 2DODA 2B7EA 2DOFA 2KISA 2LKSA 1UZCA 2K85A 2E71A 4FQGA 2DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQN A;  2JUC A;  2KZG A;  2KIQ A;  2KFD A;  2L9V A;  2DOD A;  2B7E A;  2DOF A;  2KIS A;  2LKS A;  1UZC A;  2K85 A;  2E71 A;  4FQG A;  2DOE A; 
#chains in the Genus database with same CATH topology
 3CF5 F;  2ID3 A;  6PAX A;  4GGG A;  2VC1 A;  1XCB A;  2OQR A;  2ZFU A;  2B63 J;  3FMS A;  4ZYH A;  4NQW A;  1IUY A;  1G8X A;  1Y0U A;  4EVI A;  5KAF C;  4OMZ A;  4AM3 A;  3K1M A;  3RIR A;  1ETX A;  4PFO A;  2DMP A;  3DPT A;  4PJ0 C;  5K1Y A;  4E7K A;  3K4J A;  4NHJ A;  4WWC A;  3CLQ A;  3QAH A;  2K5C A;  2XSD C;  1S7E A;  1UG2 A;  5CVI A;  4CSW A;  4CDG A;  4TV7 A;  4Q48 A;  4KMF A;  3CUQ A;  3HOZ J;  4KJZ A;  2MH2 A;  2MBF A;  4RGX A;  4JBA A;  2DFI A;  2ME0 A;  2EFN A;  1K4S A;  2EV6 A;  2XVC A;  3CTA A;  3AG3 H;  5K5R A;  3MZH A;  1RI7 A;  4ZTJ A;  3BG7 A;  4WK8 F;  2OCE A;  3KYD B;  1NHA A;  3LSR A;  4IHW A;  2XV4 S;  4V2G A;  4A3E J;  3ESW B;  3LSI A;  3VOD A;  1I5Z A;  1FP1 D;  2A05 A;  4C2M J;  5LLQ A;  4ENN A;  4CIC A;  4OIO F;  2JK3 A;  2M7A A;  4BQN A;  1QZY A;  2LH9 A;  4ZZD A;  5BPI A;  5GTI C;  3WGG A;  4WF2 A;  1HOM A;  5FLM J;  2MC4 A;  4E7L A;  3GFL A;  1I1S A;  3K9T A;  2DA5 A;  2VBY A;  4YIF A;  3DF8 A;  1IZ1 A;  1UMQ A;  2JSC A;  2RGV A;  1QPI A;  2B0L A;  3SDG A;  4AYB N;  2PMH A;  3IP4 B;  4XBF A;  2BW3 B;  3BY6 A;  2NVU B;  2LRE A;  1IJW C;  2VBW A;  2FQ4 A;  3CLO A;  1YOV B;  2HZT A;  4QWQ A;  1YX5 A;  2LMD A;  3C2H A;  4KA4 A;  2QGU A;  1BIB A;  2JSP A;  2BVM A;  4QIW N;  2Q8K A;  2O03 A;  3OYA A;  1EH7 A;  4BXX J;  1WGX A;  1ZRC A;  1S9H A;  5LHH A;  4AVP A;  2H6C A;  4BYY A;  1AKH B;  1RET A;  5FJ8 J;  1ORK A;  2D1H A;  5IP7 J;  3BG5 A;  1FWZ A;  5DV5 A;  5D5X B;  1N25 A;  4B47 A;  3EUA A;  2P6S A;  3GLL A;  1QHH D;  4XL9 A;  3W2W A;  2QKM B;  2XPV A;  1HW2 A;  4S04 A;  1EJ9 A;  2H94 A;  3C7J A;  2X6Y A;  2WB1 N;  2XRN A;  1FYK A;  4RS8 A;  3I9V 2;  3W2A A;  4Y15 A;  5HS7 A;  1FT9 A;  4AIH A;  4BS9 A;  1MBK A;  3ZMV A;  1OCT C;  1F9N A;  2LOO A;  3CO6 C;  3BCA A;  4XRS A;  3D1N I;  1T0F A;  2WBM A;  4LJZ F;  4XLH A;  5FKM A;  1YTY A;  3U21 A;  3PJR A;  2LBF B;  2VAS A;  2BOL A;  5KHD A;  2K02 A;  4XIC A;  3L2Q A;  3DU5 A;  2CFO A;  2OF7 A;  3E5X A;  4ZZL A;  1J5Y A;  2PEX A;  4M3F A;  4RAY A;  4HX8 A;  2QQA A;  3C18 A;  3VEP A;  3KYL A;  3G1L A;  1B4A A;  2IJL A;  2O6G E;  4ESF A;  4CCN A;  3FM5 A;  4DYC A;  2ZXI A;  2ELJ A;  4AIK A;  3S17 J;  1BOA A;  1ETQ A;  4LIU A;  3KLN A;  4O6J A;  1XMA A;  2V9V A;  2XPW A;  2V79 A;  3BTC A;  5D5W B;  4FTH A;  5EEA A;  2GAU A;  1R22 A;  3A01 B;  1IDY A;  1WJE A;  3OL3 A;  3ZPL A;  3HHH A;  3SZG A;  1O7L A;  2LY9 A;  3K10 A;  1BW6 A;  3U1K A;  4A0Y A;  2HOT A;  1RZ4 A;  3K4N A;  1LVA A;  2A6T A;  2YUS A;  3I64 A;  3AAF A;  2JZY A;  4ASN A;  1FIA A;  1J9I A;  4XLP F;  2R0Q C;  3LAP A;  2EIJ H;  3HJE A;  2HYG D;  1VQ8 I;  1MIJ A;  1W5C C;  1FY7 A;  3WTV C;  2G0E A;  1S3J A;  1MBE A;  2ZJR F;  2L7M P;  2JPC A;  3RZD J;  3SEQ A;  2O8K A;  3GTG J;  2I8D A;  3RKQ A;  2PBI A;  3GZ6 A;  5CLS A;  1VQ6 I;  3MN2 A;  3TKY A;  2DCE A;  1T33 A;  3HG9 A;  2R7S A;  2BBY A;  1N75 A;  2DA4 A;  3OWT A;  1CQT A;  4E7S A;  1W36 D;  2ZME A;  2DFF A;  4GYI A;  1LDJ A;  1MND A;  2VT3 A;  4IOC F;  2H27 A;  2W82 A;  2Q0O A;  1A04 A;  1FTT A;  3HPG A;  1R36 A;  3KIO A;  9ANT A;  2JA7 J;  5L3D A;  3TOA A;  4HNU A;  3CDI A;  3K1N A;  4Y17 A;  1RPW A;  3JAM Z;  3WTW C;  1OCO H;  5CPR B;  1YIT I;  1HKS A;  1Z7L A;  3TED A;  2L7K A;  3LSH A;  4OIN F;  3KET A;  2QEN A;  4XR6 A;  3DPU A;  5J1Y A;  5DDG A;  5C44 J;  5BMZ A;  1ZAR A;  4N9I A;  4IX7 A;  4RGS A;  5AON A;  1YG2 A;  1BBY A;  3K7A J;  2IGN A;  1R71 A;  1SFE A;  1IN7 A;  2R7F A;  3TW7 A;  3HTU A;  2JA8 J;  3FM3 A;  3C2G A;  5B66 C;  4B4C A;  3GX4 X;  3DP7 A;  1HST A;  4BDZ A;  3ZMS A;  5IT9 K;  2Y2Z A;  4F52 A;  3TBI A;  3GXO A;  1HC8 A;  2BVL A;  1ETK A;  4ZDP A;  2KIU A;  3JRG A;  1POG A;  4UUS A;  4ZYE A;  3HL2 A;  2V26 A;  2LTP A;  3OIO A;  3FF5 A;  1YIJ I;  5K7Z A;  1X3U A;  1E3O C;  1ETW A;  3KX2 A;  1GV2 A;  4A2U A;  4ON0 A;  5K5Q A;  4H0E A;  1YO5 C;  1FC3 A;  4AWX B;  4EM2 A;  2DT6 A;  4A69 C;  3GZN B;  2HPM A;  2NAZ A;  1BC7 C;  2IGM A;  2FF4 A;  4XSZ F;  4WCG A;  1W1W E;  2F4I A;  4XOT A;  4UNO A;  1I39 A;  2DYR H;  5IY5 H;  1ZKG A;  3WGI A;  3G73 A;  1H88 C;  2Y30 A;  2O61 A;  3U2R A;  3SZP A;  2VUM J;  4Y3O A;  3KPH A;  3D5L A;  2OAZ A;  3E5U A;  3MVP A;  4BE1 A;  1BC8 C;  2A07 F;  3CUO A;  1KU7 A;  2K4B A;  4EV0 A;  1DGR M;  2MYS A;  2E5N A;  3KYC B;  1H9T A;  5J3L A;  3K4B A;  5F0H A;  3DLL F;  3ABT A;  4DGW B;  1ZRD A;  2DAO A;  3MFK A;  4R8H A;  2R5Z A;  2RRE A;  3ZQH A;  2WTE A;  4PJJ A;  5FB2 A;  3BLY A;  4IVN A;  1JGG A;  2ZB9 A;  1ON1 A;  3E0J B;  2ZBK A;  2EPF A;  3FMQ A;  2XF7 A;  4X0G A;  2KKO A;  4P55 A;  4HX7 A;  4QPO A;  1R5G A;  2W00 A;  1IUF A;  5LHI A;  3MWM A;  1D1B A;  2XAJ A;  3G71 I;  2L7F P;  3KCC A;  1AOY A;  3OOU A;  3HYI A;  3W3C A;  4DYR A;  1FOX A;  2XAS A;  4QSH A;  4CCO A;  4D9J A;  1YFH A;  4E7Z A;  5TGT A;  5FKL A;  2MSY A;  4PCQ A;  1U3E M;  3SEZ A;  1U5T A;  2L4A A;  2EWN A;  2M2E A;  4HBL A;  3RPU D;  1B8I B;  4X1E A;  3HDD A;  5KAI C;  1SD4 A;  2MC3 A;  4RBO A;  2E35 A;  1J09 A;  3I4P A;  4GDF A;  2HDD A;  1HW5 A;  3ECH A;  2LG4 A;  3A2K A;  2FU4 A;  1RC9 A;  4XKC A;  4LG0 B;  5GAH J;  1PJR A;  3ASO H;  4XM3 A;  4F91 B;  1OIS A;  2BY0 A;  2PJR B;  1TWG J;  1DGW Y;  1GV5 A;  2MG4 A;  3M1C A;  5FRN A;  1LUJ B;  1FMW A;  3J7Y J;  3I56 I;  3GTP J;  4HSR A;  1T08 B;  4IHX A;  4KIG A;  3O8H A;  1RR8 C;  4ESJ A;  1VQ9 I;  2KZV A;  2BV6 A;  3F9K A;  3OYB A;  1T98 A;  2AHQ A;  3FX3 A;  3G4S I;  1MNE A;  1O4X A;  1G6N A;  2GA1 A;  2EZK A;  3WHC A;  3I59 A;  1R1U A;  3G6E I;  2VKE A;  3TW6 A;  5B5E C;  4G6D A;  4P9U A;  2HVS A;  4D0P A;  2Q2E A;  1F43 A;  1W5T A;  2YS9 A;  4ZYG A;  3J81 K;  2ACJ A;  3H0G J;  2ZJP F;  5FFZ A;  4II2 A;  3DKX A;  3K4M A;  3K70 C;  3AL0 C;  2DQL A;  2EH3 A;  2VQC A;  1LEA A;  1LJ9 A;  4AUX A;  4LLG F;  3FMR A;  3EYY A;  3IWZ A;  2XC7 A;  1YYV A;  1XN7 A;  3Q0V A;  3ABM H;  4FE7 A;  1KU2 A;  4BEH B;  2PJP A;  1LVK A;  1XB4 A;  2VOD A;  3FHZ A;  3NWS A;  1V55 H;  2E2H J;  3DEU A;  4BU2 A;  1TWF J;  2I10 A;  1JJ8 C;  3HOW J;  3BOQ A;  5D8L B;  3S1N J;  1GXQ A;  2Z99 A;  4E7J A;  3CDH A;  2GOM A;  4GYG A;  1J59 A;  4AIJ A;  3J80 K;  4HNV A;  1G3Y A;  4A3J J;  2DXI A;  2H6B A;  2IA2 A;  1KQ0 A;  3M07 A;  2MA3 A;  1ZN2 A;  3SXY A;  3V8J A;  5L3F A;  1QVT A;  3T1B A;  1Y39 A;  5LRS A;  1DU0 A;  2IS1 A;  2NS0 A;  2LY1 A;  3SDB A;  2KT0 A;  3S14 J;  1RUO A;  3K6G A;  4IRH A;  1BR1 A;  1PDN C;  4I76 A;  2CFX A;  4P9F A;  1TW2 A;  3I58 A;  4HX4 A;  2L4M A;  3AL0 B;  4IL6 C;  2E2I J;  4CO8 A;  1ZH5 A;  3QYB A;  2TCT A;  1QO0 D;  1E17 A;  2BY3 A;  4BQA A;  1SVL A;  2HNH A;  1B6A A;  2V6C A;  3P9I A;  1X58 A;  2LD5 A;  2VJ5 A;  1Y6I A;  3ASN H;  3LA7 A;  4BL0 B;  1G3S A;  2Y9Y A;  2RKH A;  2CJJ A;  5E18 F;  2G7H A;  1JT6 A;  2M5W A;  1QZE A;  2H09 A;  2EIN H;  4HNT A;  5TIS C;  4XLF A;  2M30 A;  1MGT A;  4QLC U;  2ZXW H;  2GIZ A;  1MNM C;  3KZI C;  1N78 A;  1PP8 F;  2TRT A;  2WC2 A;  5A2Q K;  4NC6 A;  2VI6 A;  1ZAO A;  2F2E A;  1X1A A;  3J7Z I;  5CQE A;  2AQE A;  2DMN A;  5DUK A;  2STW A;  1WKM A;  3MKL A;  1GHC A;  5E1Z B;  2F5C A;  4BKX A;  2YR2 A;  4ZYA A;  1JKQ C;  2WAD A;  3OYE A;  1S72 I;  5J4Y A;  3H5R A;  1FOY A;  2KIM A;  5BOX A;  3TL4 X;  4M3E A;  1OCC H;  2VJ4 A;  3F23 A;  2BHZ A;  4YFX F;  1ZQ3 P;  2R7D A;  1QPM A;  5IP6 A;  3KEY A;  2ZXJ A;  3BJA A;  1WJC A;  1S7O A;  3CCL I;  4HEA 2;  4XOP A;  1R9T J;  1IXR C;  4WXD A;  4NC8 A;  2H1K A;  4DJA A;  1BA5 A;  1QNT A;  3QYE A;  4B48 A;  3H9J A;  3JRE A;  3OYM A;  2EA2 A;  1ETV A;  1MDM B;  3WTX C;  2IVM A;  2DBB A;  2XHK A;  3HSE A;  3OYL A;  4UV9 A;  2CH0 A;  1Z67 A;  5F0F A;  3KP4 A;  4S0H B;  4A3K J;  3LWF A;  1Y0N A;  3C3W A;  4G94 A;  2IGK A;  3J7A Y;  1ONV A;  5LHG A;  3CC2 I;  3Q0W A;  5HLH A;  1S29 A;  1XS9 A;  4E4H A;  2XGE A;  2Y48 A;  3RPU A;  3MKZ A;  5J40 A;  4PFP A;  1Y8Q B;  1SD5 A;  4BQO A;  5IYD J;  1C0W A;  1ZTR A;  2JRM A;  3DWL E;  4DW6 A;  3OMY A;  2DJI A;  1K7A A;  1IXC A;  2Y9Z A;  2Z2S B;  2ISY A;  3HOS A;  2GLO A;  4MQV A;  2DOF A;  5D8K B;  1V5F A;  5AIQ A;  4L9V A;  4KIF A;  4UUT A;  4BGD A;  4YEJ A;  4Q47 A;  3MKY B;  4BDY A;  4UV8 A;  4D7N A;  2NOG A;  2KJC A;  3CJQ B;  3ELK A;  4MNU A;  1FLI A;  1YS6 A;  1MD0 A;  2CQX A;  1USS A;  3CCU I;  5EGO B;  1A31 A;  3K4C A;  2QVO A;  2V9P A;  5J1R A;  2X48 A;  4AYB A;  4PGG A;  5DS9 A;  1IN6 A;  1EKE A;  4FAS D;  3IL2 A;  2BW3 A;  5HNF A;  1RKT A;  3R0A A;  1J0R A;  4G8X A;  4HOB A;  1IRZ A;  3KP5 A;  5HS8 A;  2R92 J;  2AXL A;  1MBJ A;  1W7P B;  4FCY A;  3S2D J;  1DU6 A;  1UHS A;  2RC4 A;  3PQK A;  3PSF A;  1A6I A;  1Z9C A;  5EJC A;  2WV1 A;  2Y75 A;  2LFB A;  2XB0 X;  3TOB A;  2QF7 A;  3ZOB A;  1X19 A;  3KP3 A;  4YEL A;  4MIM A;  1WVR A;  2KIS A;  2CSO A;  3IC7 A;  2D45 A;  4A6D A;  5IT3 A;  3BTL A;  1F4K A;  5D4R A;  2VJJ A;  5E8G A;  1XSD A;  5GAE J;  3OYN A;  2QQ8 A;  1IAW A;  1AU7 A;  3QYF A;  3CCJ I;  4N4O B;  5D4S A;  1SEU A;  2ELH A;  3IV5 A;  1YW9 A;  2FQ3 A;  3KP6 A;  1TT0 A;  2M45 A;  4EJO A;  3SFZ A;  3IKT A;  1V5E A;  1YRN A;  3LA2 A;  3PSI A;  2A3S A;  4ESB A;  2WB1 A;  1TWA J;  3HRT A;  1WSU A;  1RNL A;  2CQQ A;  4HRI A;  3JSP A;  3WTU C;  1LDK B;  3P7N A;  1EH6 A;  5BPD A;  2OA4 A;  1NG6 A;  4E6K G;  3M9A A;  4B3A A;  2DFH A;  1TWC J;  4HG2 A;  2NXN B;  1JI8 A;  4MEX F;  2DA6 A;  2P8T A;  5FKN A;  4LMY A;  4M9S A;  2PMZ N;  2K40 A;  5EEG A;  2XAG A;  2KMU A;  3M8E A;  5LRR A;  4M73 A;  3S2W A;  4HF1 A;  1R4N B;  3HPH A;  2EJR A;  5CVV A;  2DA3 A;  3FBN B;  4RB2 C;  1UZC A;  5JVG F;  2R7W A;  1TZL A;  4JOM A;  1MSF C;  1WJ5 A;  2IRF G;  4CZZ A;  4U87 A;  4KN7 X;  3IH2 A;  1R23 A;  3WTZ A;  4XK4 A;  3ECO A;  1R1V A;  3VYR B;  3BPV A;  3H3Z A;  3A01 A;  3LMM A;  2CUJ A;  2PMU A;  3MCZ A;  2DI3 A;  4D5F A;  4JX6 A;  2KZG A;  2CQ7 A;  1XMX A;  1FTZ A;  1IG7 A;  1VQ5 I;  3HM5 A;  4FIS A;  4I02 A;  1QQI A;  5HLT A;  3T8T A;  1FSE A;  5FLX K;  4EMS A;  2CO5 A;  2DPD A;  1OR7 C;  2MLK A;  2E19 A;  1B9N A;  3PUF A;  1AA7 A;  1UB9 A;  3DTE A;  1OKR A;  1TBX A;  1XDS A;  3EPZ A;  2A68 F;  2DW4 A;  2LYC A;  2HTJ A;  1JTY A;  1WI9 A;  5F64 A;  3C2B A;  2M8G X;  3E1S A;  2VB6 A;  3KEO A;  1R00 A;  2LLK A;  4R79 A;  3F0C A;  1Z0X A;  3S32 A;  1IO2 A;  4HA8 A;  4EQQ A;  3FBI B;  2K9M A;  5IPA A;  4IRI A;  4YII A;  2VE9 A;  3I55 I;  3FHN A;  1MJB A;  5EZH A;  2ELK A;  4M6Y A;  4Y13 A;  2K7L A;  3R0J A;  3GTM J;  2JA2 A;  5F1J A;  1TQM A;  1O7F A;  5E79 C;  2Y0M A;  3OIQ A;  4II3 A;  1MMD A;  3P9C A;  4G7Z F;  3S15 J;  1IC8 A;  1G3W A;  2MAB A;  3LSK A;  1ZYR F;  1JJ6 C;  1FP2 A;  1H0M A;  2E71 A;  4RAF A;  2FD5 A;  4A3L J;  1VQ4 I;  4IZZ A;  4MLO A;  2FNP A;  1R6R A;  1I1G A;  4KIC A;  5B1B H;  2MGQ A;  3JRD A;  2P4W A;  2L0K A;  3BTJ A;  4FX4 A;  3RPQ A;  4A93 J;  4E70 A;  3DCF A;  3G3Z A;  5IOY A;  4L18 B;  5JLW A;  4GRI A;  2NRA C;  2CRG A;  2L9R A;  1MJA A;  1S6L A;  2V1N A;  3H5N A;  3ZQC A;  1GDT A;  4DQ2 A;  1UG0 A;  5KCM A;  3OSG A;  3H3V K;  2XAU A;  2JMW A;  1OPC A;  4PUS A;  4X6A J;  1T6S A;  1ODD A;  4LIV A;  5KNL A;  4PK4 A;  3GF2 A;  4BNC A;  5GAD J;  2F4M B;  1T95 A;  2CV0 A;  5FKO A;  1K6O A;  2KIQ A;  2NNN A;  1P4X A;  3BZK A;  3WE2 A;  4CCL A;  3FXQ A;  2E36 A;  3HOU J;  3K70 D;  2JWT A;  2KDO A;  5E20 A;  5TRD A;  3GFJ A;  1IXS B;  5J6X A;  2KP6 A;  5H20 A;  3CCR I;  1MJ9 A;  1F36 A;  4PDK A;  3AG4 H;  5FD5 A;  2EFW A;  1I3A A;  2P5V A;  1U9O A;  4B1R A;  2AQF A;  2Z16 A;  1BL0 A;  5TJJ A;  4U0Y A;  1LFU P;  1K78 B;  4NC7 A;  5M5Y J;  5J8C A;  4KNY A;  2IS4 A;  1PP7 U;  1F5T A;  4BAY A;  3FIS A;  4OU0 A;  3JTG A;  2RVC A;  3F8F A;  5M5W J;  1H9G A;  3OS1 A;  2DOD A;  2FEZ A;  2NNY A;  2LVS A;  3K69 A;  1LE8 B;  2O3F A;  2FXA A;  1I27 A;  3JR9 A;  3HSR A;  2W1O A;  1IN5 A;  5D5U B;  2FOK A;  2ID6 A;  1FBU A;  2HXI A;  3IUO A;  3QRF F;  4E7H A;  4LOC A;  2HU9 A;  3E6B A;  4UVA A;  4CYD A;  2VE8 A;  4WXC A;  5HLG A;  3BZ6 A;  2YX7 A;  1VFC A;  2X85 A;  2MH9 A;  4OIQ F;  1IN8 A;  2F5V A;  4FET A;  4I99 C;  5LGT A;  3VWB A;  4LK0 F;  1SFU A;  1BN5 A;  3ZQQ A;  5DM7 F;  5FO5 A;  2V9K A;  4NBQ A;  5DEQ A;  2DMT A;  2FRH A;  4DOZ A;  4BHP A;  1MW7 A;  1XSX A;  2BYV E;  3S16 J;  3NQO A;  3K2Z A;  2KQR A;  3CD6 I;  2QZ8 A;  3OS2 A;  1BI0 A;  1JKO C;  4A3G J;  4RB0 A;  1D1A A;  2KHM A;  2OQG A;  3HRM A;  4RGR A;  2E7X A;  3PQJ A;  1OQY A;  3DFG A;  4BJT A;  4BBR J;  3BRO A;  2W84 A;  1AWC A;  3M7G A;  3JCU C;  4HZF A;  3F22 A;  5E1W A;  4M72 A;  2FMY A;  3JRA A;  4DYQ A;  1FYM A;  4IKF A;  1T39 A;  1WRJ A;  3NEU A;  3CJN A;  4DBR A;  2Y31 A;  2WWY A;  3CCS I;  1B8I A;  4UB8 C;  3FZV A;  3O6B B;  4OIP F;  2L01 A;  2XAH A;  3BR2 A;  4CZC A;  3HIF A;  3GTJ J;  3GLX A;  3RJP A;  1B72 B;  3HKZ N;  1MBG A;  1XCV A;  3CDL A;  4IF4 A;  1GXP A;  2VL8 A;  1QVU A;  1MZB A;  3FIW A;  3UNG C;  1JHH A;  4ZTF A;  2VC0 A;  1WPK A;  4LG0 A;  4RAZ A;  3PO3 J;  3QOP A;  1IF1 A;  2X1D A;  4DIQ A;  4RDU A;  2D1V A;  1WH7 A;  1ERD A;  3V8L A;  1F1Z A;  2QYO A;  3T8R A;  2IA1 A;  3QPT A;  1S8N A;  2P5L C;  5GPC A;  1WI3 A;  2DDA A;  1DP7 P;  1TTY A;  2L9V A;  2IS2 A;  1V3F A;  1SFO J;  4KDP A;  1ENH A;  5F1R A;  1TC3 C;  3PIO F;  1SVO A;  1Z77 A;  3ZMD A;  3ZQG A;  5L3B A;  3PL8 A;  1ZHF A;  3AKZ A;  2JQ7 A;  3HUG B;  3FDY A;  1Z6T A;  3OYH A;  2KL4 A;  3G2B A;  1NG7 A;  3EDP A;  4JP0 A;  4A0Z A;  3JRB A;  4YG2 F;  3UKG A;  2R7Q A;  3GTO J;  2D2W A;  1ETO A;  2M8E A;  3EUH C;  1W7P D;  3HEF A;  3LL7 A;  1U78 A;  1FX7 A;  2FE3 A;  1YJ9 I;  3H36 A;  4I0A A;  3DBR B;  5ILS A;  3F8M A;  3R6S A;  1WFX A;  4J00 A;  2ETH A;  5K5O A;  5GP9 A;  4QTR A;  3H92 A;  1MH4 A;  2JRT A;  3LOC A;  3CCV I;  2FML A;  4EJW A;  1SFX A;  1EV7 A;  1I6H J;  3GBG A;  1WCM J;  4XN3 A;  3O3K A;  3DEE A;  4C9Y A;  4CHU A;  5CVJ A;  3DKY A;  2MLG A;  3S3N A;  3GW2 A;  2LK2 A;  4IEJ A;  4BEH A;  2ZME B;  2A6H F;  2XF5 A;  1VQP I;  1YE9 A;  2F5D A;  3ABK H;  3NWT A;  4L5E A;  4N4N B;  2H8W A;  3NRV A;  4E7I A;  2ADU A;  3UR3 C;  4D7M A;  1QBJ A;  4Y52 J;  5HDK A;  3BT9 A;  4I98 B;  1OYW A;  1B9M A;  4XKB A;  1RES A;  2OCC H;  1HXD A;  1WZ2 A;  2W7N A;  2HYJ A;  2WAQ N;  1OLT A;  3CCE I;  4OAY A;  2BXZ A;  3QOE A;  3S8P A;  5DD4 A;  3RKY A;  4KIT B;  3PNY A;  3ABL H;  3ZXS A;  4L0Z B;  2VPL A;  3IAM 2;  3L09 A;  2NS7 A;  3F8B A;  2A69 F;  3JTH A;  3V7C A;  4A5N A;  1KZH A;  2ME6 A;  1MSE C;  4XON A;  3L2W A;  3BCB A;  2F5E A;  1RKW A;  4MEY F;  2X51 A;  4GCV A;  4EJU A;  1YQA A;  2XRO A;  3HGY A;  1RRJ A;  4LD5 A;  4LB5 A;  3I54 A;  1ZLJ A;  4ENM A;  3ZN1 A;  3VYT B;  2QSF X;  4LG3 A;  2LSO A;  3AG1 H;  4XOR A;  5D6E A;  2VT2 A;  4BH9 A;  1SD6 A;  3PNT A;  1NK3 P;  4IXA A;  1VQM I;  1OFC X;  1X1B A;  1W5S A;  1P4W A;  1IRX A;  4HDV A;  5H6R A;  1HDD C;  1G3T A;  4A3B J;  2JN6 A;  3A02 A;  3ZRG A;  4IHY A;  4HV5 A;  3W6K B;  4XLC A;  5E3M A;  4HF0 A;  4M71 A;  4XSX F;  2RDP A;  2GXA A;  2R7T A;  1FNN A;  2NYX A;  4KUM A;  1K6Y A;  3E6C C;  3HZJ A;  3WG9 A;  1ZEL A;  4NUB A;  4XID A;  1IDZ A;  2A5W A;  2OV7 A;  3JAM K;  1IRG A;  3E3V A;  2BY2 A;  5DUI A;  4C2U A;  1FEX A;  1JUS A;  2HQA A;  3K0L A;  2CV1 A;  1BJZ A;  1UHM A;  1Z21 A;  2HGC A;  2LKX A;  2HTS A;  4MTE A;  4AID A;  3B02 A;  5EG0 B;  2E60 A;  1VZ0 A;  2V4J C;  3I71 A;  4IRG A;  1XGS A;  4ANJ A;  2UUZ A;  2CGP A;  4L5I A;  2R5Y B;  1DPU A;  3SFI A;  1LB2 A;  5L3C A;  3ISP A;  2WY8 Q;  3WU0 A;  1KQ8 A;  1TWH J;  2CUE A;  2X1C A;  2L02 A;  3IRQ A;  3BR0 A;  1GVD A;  1DP3 A;  4H4K C;  1J2X A;  1JGS A;  2YPR A;  4RAG A;  5F0C A;  4P5O A;  1EF4 A;  1JUP A;  2DQR A;  4W97 A;  2UWM A;  2KRC A;  1XGN A;  4U7D A;  3JRI A;  1MDM A;  3A03 A;  3P5J A;  4R1H A;  1P9Q C;  1UJ8 A;  1Z1D A;  2K27 A;  3LAJ A;  2DT7 B;  1GLN A;  3M3Y J;  4ZH4 F;  3RSN A;  2CMP A;  3T0Y A;  2X6O A;  3PFY A;  5L3E A;  3OIP A;  2K3F A;  4M6V A;  1K79 A;  4UHT A;  4A6E A;  2XF6 A;  3BJO A;  4KN4 X;  2DN0 A;  1TT5 B;  3MEX A;  2F6C A;  4LLL A;  4G9Y A;  2XPU A;  1OMI A;  4G6T B;  4P96 A;  2V7F A;  2CU7 A;  1MBH A;  1TL8 A;  1W0U A;  4GXO A;  4J01 A;  2KIF A;  2HYF A;  1SMT A;  2GQQ A;  4YFK F;  1FZP B;  2OTL I;  2X6X A;  1X3W B;  3IKV A;  4GO1 A;  3OS0 A;  2P7C B;  1OYY A;  4CYC B;  5LBQ A;  3HOT A;  2IS6 A;  3B6C A;  3BWG A;  5LEJ A;  2GXB A;  1R49 A;  1TQP A;  2EIM H;  1S7A A;  3DU6 A;  1MMG A;  3F72 A;  2STT A;  2AS5 F;  2CS3 A;  3BC8 A;  3IH4 A;  1Y56 A;  4ZC3 A;  2FBK A;  1X4P A;  1VI0 A;  1NTC A;  3B73 A;  1T56 A;  1E3H A;  3DTK A;  2FX0 A;  5EGO A;  2KRF A;  2CV2 A;  2OC6 A;  3REO A;  4BXF A;  2CG4 A;  4MHG A;  4RB1 A;  5E17 F;  1O57 A;  4EJV A;  3OYI A;  4HAM A;  5F6F A;  2W57 A;  3ZGK A;  4ENJ A;  1LFP A;  2F4O B;  4F3Q A;  3S1R J;  3MD2 A;  4M3D A;  4ZJZ A;  2M7B A;  5FGM A;  2QBY B;  3KP7 A;  1TP4 A;  2GXG A;  2EV0 A;  2HI3 A;  1XG1 A;  2E34 A;  5J47 A;  4I2O A;  2DK5 A;  4KT6 A;  5CVR A;  5IP9 J;  2XGX A;  5FLV A;  4XN0 A;  1BI3 A;  2OUM A;  5HDN A;  2PLY A;  4RLF A;  5DCM B;  1X1D A;  3W6J B;  2R7U A;  4HLY A;  4HQE A;  3GO5 A;  3ML6 A;  3RKX A;  5K7F A;  4F55 A;  2Q2E B;  2YSR A;  2CUF A;  2M1B A;  3CMM A;  3D0S A;  5EEH A;  4I01 A;  5E3O A;  3M8J A;  1N77 A;  3TDZ C;  3PUB A;  3MQ0 A;  5LFA A;  2XAF A;  2E2J J;  2K9S A;  3KEQ A;  3HSF A;  1X4O A;  3JW4 A;  3ZQL A;  1WQ2 A;  5F04 A;  3V8K A;  5C4J J;  2ZO4 A;  3MMY B;  3TDU C;  3TQN A;  2FBH A;  2EQR A;  2QA4 I;  5JLX A;  4BJ6 C;  4UVC A;  5HOO A;  3S1M J;  4ZDO A;  3G1M A;  2MFZ A;  2LDU A;  2PMZ A;  4A3D J;  1IV6 A;  1JT0 A;  5CKT A;  1G2H A;  3D5S C;  3QPS A;  3R60 A;  4HW0 A;  1D0X A;  5CQG A;  1S5L C;  5AIP A;  1T38 A;  2LY2 A;  3HGG A;  2HQN A;  4G7O F;  2QWW A;  1D0Z A;  1WJA A;  1XTA A;  2VXD A;  1RUN A;  1WJD A;  4JQF A;  1LQ1 A;  4MQ9 F;  4S05 A;  5KK1 A;  2IXS A;  3SJM A;  3BG3 A;  2R7O A;  5H6Q A;  1SVM A;  2KPM A;  5GAG J;  2BGC A;  2IW5 A;  1T8I A;  3OYD A;  3I3L A;  1PUF B;  2K85 A;  2ZJ2 A;  2CW7 A;  3JRF A;  2ESN A;  2DA2 A;  1IGN A;  2RNG A;  2F48 A;  1OCR H;  4I09 A;  3CCM I;  2B9S A;  2ZFW A;  3FXM A;  3V7R A;  1KYW A;  1Z91 A;  2BHY A;  3OOP A;  4RM2 A;  3DTI A;  2HKO A;  3BR1 A;  3I4M J;  5HNH A;  2ZC2 A;  1W0T A;  4EAT A;  1O3T A;  2QLZ A;  3ULQ B;  1ZGJ A;  1K4T A;  1PUE E;  3R4K A;  3CMA I;  3GTK J;  3E5Q A;  1Y8R B;  2ZJQ F;  3A0H C;  4B09 A;  4BXU A;  1MKM A;  4V19 K;  2DK8 A;  5EDN A;  1B1B A;  4CGZ A;  4HYE A;  2ICW G;  1DQU A;  3ZMZ A;  4C3I J;  3CF2 A;  1VND A;  3C1D A;  1YIO A;  3K4L A;  4HV6 A;  2H8R A;  3X2Q H;  5ERI A;  3VPR A;  3CZ6 A;  3LFK A;  2DMU A;  3ZCO A;  2L5Q A;  4XLN F;  3RI4 A;  1Q1V A;  2IT0 A;  3O8G A;  2IGO A;  1MH3 A;  1UFM A;  3CES A;  4M3G A;  1R7J A;  2Y0S N;  2FOW A;  3RYP A;  1AKH A;  3E6M A;  1ZLK A;  4C3J J;  3DBL B;  1BW5 A;  2E1O A;  1I50 J;  2HPI A;  4HQM A;  1VQ7 I;  2ECC A;  4GFB A;  3COA C;  1V4R A;  1FIP A;  2Z33 A;  2PI0 A;  2VKH A;  4M74 A;  1CGP A;  3EUK L;  3H9Q A;  3BDD A;  3EET A;  1ZRE A;  3TMO A;  2A5Y B;  1OCP A;  2OU2 A;  2R93 J;  4QPQ A;  1ETY A;  1W4M A;  1ZG3 A;  2I5U A;  1P7I A;  1QA6 A;  2R4G A;  2PN6 A;  1IV8 A;  3I5U A;  3WHB A;  2BXY A;  2RNJ A;  2L9S A;  2JVH A;  3DLA A;  3GME A;  3DEW A;  1PYV A;  2O8X A;  2LRD A;  1X3Z B;  3FXU A;  2R7X A;  2O5R A;  4A5M A;  1LNW A;  2XSJ C;  3QQA A;  3GYH X;  1IN4 A;  4PSX A;  2EIL H;  4LB6 B;  4FHT A;  5K7H A;  2LBF A;  3LSP A;  2M9H A;  2VQL A;  1XX5 A;  5EF6 A;  1ZGA A;  1JHF A;  2QQB A;  4MFD A;  1ZG5 A;  1OR7 A;  2VKV A;  4C2T A;  2QSG X;  3BR3 A;  3WTY C;  1D5V A;  4BBS J;  3CJT B;  1FPQ A;  3MAJ A;  5ICE A;  5HS9 A;  1ZR4 A;  4Q4Z F;  3NAU A;  3LSM A;  2VQG A;  4N0B A;  4CCM A;  1LKX A;  1AHD P;  1BJA A;  2N8G A;  2VKD A;  5J8F A;  3QPL A;  1OJL A;  3VSL A;  4D1Q A;  1R1T A;  2L3D A;  1J7K A;  1TNS A;  3BR6 A;  2GWR A;  4UY8 I;  1ZRF A;  5KVR A;  1U9N A;  2COB A;  5ED4 A;  5JR3 A;  1X2N A;  2VIX A;  4HST A;  3FKJ A;  1P4A A;  2HOA A;  2M4G A;  2X6W A;  2WY7 Q;  4KFC A;  4J19 A;  3KZZ A;  1G4D A;  2B7E A;  2V1U A;  4PZJ A;  4BY7 J;  2R3S A;  3FWE A;  4EM1 A;  2R7R A;  2P6T A;  1K78 A;  3CUQ C;  3TGN A;  3OL4 A;  2MW8 A;  4RMN A;  1CF7 B;  3HTS B;  1ITY A;  2EFQ A;  2LP0 A;  3H1C A;  3FXR A;  4NB5 A;  4XKV A;  1R5I D;  4BJ5 C;  4HF2 A;  1HLV A;  2EV5 A;  1FBS A;  3OSF A;  1LE8 A;  3Q5F A;  1WJB A;  2FA5 A;  4HDU A;  1TW3 A;  2UV1 A;  3RYR A;  5IT9 Z;  1KGS A;  2ZCW A;  2NVY J;  2PG4 A;  1HKQ A;  4IJA A;  3WGH A;  5ICG A;  2OPT A;  2GA2 A;  2EZI A;  4AU7 A;  1UST A;  4RM3 A;  4NQW B;  3WTS C;  1JE8 A;  3T5X A;  3BP8 A;  2AO9 A;  5HDG A;  1LPQ A;  3IRR A;  1HCR A;  1VQK I;  3FXL A;  3HHG A;  4G6Q A;  4CH7 A;  1O3R A;  1SFK A;  1QU3 A;  2QKL B;  2KJB A;  1QZZ A;  3PM1 A;  3WTT C;  3RKW A;  2JA6 J;  2W24 A;  2CWE A;  2XGD A;  4A12 A;  4OIR F;  1P92 A;  1P7J A;  1YRN B;  4IPA A;  1KA8 A;  3ERM A;  2HXO A;  2QUF A;  4OAZ A;  1YHQ I;  3TO9 A;  4Y7N J;  3CME I;  3CUQ B;  3R61 A;  1ZR2 A;  2RQQ A;  4UB6 C;  2HQR A;  2AXT C;  3GFI A;  2KFD A;  3DXJ F;  2O0Y A;  3FXK A;  3K1P A;  4A0X A;  1OCZ H;  2NOJ B;  3CO7 C;  3BZC A;  2K9Q A;  4Y4R A;  1RIO H;  1IW7 F;  3ZR8 X;  4PGH A;  3HKZ A;  1LFB A;  4K2E A;  1B72 A;  3W6V A;  4OMY A;  2FBI A;  1A5J A;  1J75 A;  2FNA A;  3GVA A;  2HVQ A;  3D5R C;  1HSJ A;  4MFE A;  2A61 A;  4CCJ A;  1Z6R A;  1REP C;  1ON2 A;  4PSW A;  5D5V B;  1WH5 A;  4F92 B;  3K4K A;  3OV8 A;  3OYG A;  4U0V A;  3QU6 A;  4IQ4 A;  2M3A A;  2IBD A;  1FMV A;  2LC2 A;  3VYU B;  1Z3X A;  3TO6 A;  4BHB A;  1ZGW A;  2L9N A;  5J1U A;  2D5V A;  3L2R A;  2HVR A;  3RQ4 A;  3L2V A;  3VFZ A;  3GTL J;  3B6A A;  3F6V A;  2M0C A;  3MZ8 A;  2JUC A;  4MGR A;  2DFE A;  1OYI A;  2DDB A;  3HUG A;  4B44 A;  5IOZ A;  4JYK A;  3L1P A;  4WX9 A;  4AVZ A;  3DV8 A;  3BQZ A;  1D5Y A;  4ENK A;  4KYW A;  3ERE D;  4UUV A;  5IYC J;  2GZW A;  3V4G A;  2GM4 A;  1T0F C;  4C30 A;  3OYF A;  1D0Y A;  2CQN A;  1Y1W J;  2P81 A;  1A6Q A;  3Q0U A;  1SAN A;  4IHS A;  3VYS B;  1TLH B;  2ZNY A;  2OD5 A;  2J5P A;  3KFW X;  2HEO A;  3WU2 C;  1BI2 A;  2X1E A;  2DO7 A;  5LD2 C;  3RCO A;  3S3M A;  2G9W A;  2W25 A;  2EIK H;  4KMU X;  2IP2 A;  3E7L A;  2KLO A;  5JFR A;  4BY1 J;  5JI6 A;  4CXF A;  2ESH A;  2L54 A;  3ZN0 A;  1O3Q A;  1SAU A;  2HKX A;  2WAE A;  2W48 A;  5E3L A;  2HOS A;  1XGO A;  3GZ5 A;  1QGP A;  1ZG1 A;  5BQT A;  4JK1 X;  2DYS H;  1GUU A;  2XKP A;  3KE2 A;  5BS6 A;  3Q9S A;  2PX9 A;  3CP2 A;  4EGZ A;  1MMA A;  1WJF A;  3S3O A;  2ZNZ A;  3OYC A;  4PJM A;  2UZK A;  1E2X A;  2WAQ A;  3QWL A;  2OBP A;  3TO7 A;  3P9K A;  3IWF A;  3MZY A;  2K3P A;  3BQY A;  3H5A A;  4BAC A;  2OJE D;  3GCM A;  2X0L A;  3FK6 A;  4LFU A;  1XMK A;  5FFX A;  4NDL A;  3RTR A;  4XLA A;  3J81 Z;  3EUH A;  1XPX A;  1K61 A;  2K9L A;  3LFU A;  3CP8 A;  4KIS A;  2PFB A;  2O9L A;  3NAR A;  3VOE A;  1DUX C;  2VOP A;  2QQ9 A;  1TNT A;  1FSH A;  5JVT A;  4KIB A;  3BPX A;  3JSO A;  4YIR X;  2ZME C;  3PNV A;  4I6Z A;  1DDN A;  2PJR A;  2Z3Y A;  3L7W A;  5E8I A;  5J4V A;  3WOD F;  1MMN A;  4XRS G;  4F7Z A;  1D8J A;  3N4M A;  3U1D A;  4B3X A;  4ETS A;  3TP3 A;  2JT1 A;  2RQP A;  3EQL F;  3GEZ A;  4M6X A;  2QSH X;  2PQ8 A;  3F6O A;  3JRH A;  2Q1Z B;  4Y33 A;  2E7W A;  3K2A A;  4Q5S F;  1BR4 A;  1X2M A;  1NH3 A;  2VLA A;  2BY1 A;  5E3N A;  3J80 Z;  5DD8 A;  1U2W A;  1K83 J;  1HKT A;  2MD0 A;  1E0E A;  1FJL A;  1B59 A;  4JX4 A;  2FUG 2;  1WWX A;  5JHU A;  1YS7 A;  1HDP A;  2ISZ A;  4NNJ A;  2NVQ J;  5H2F C;  2DMQ A;  3F8N A;  2HDC A;  5EG0 A;  2Z9O A;  1YW8 A;  3ZMT A;  2R7V A;  4RB3 C;  2R5Y A;  2C6Y A;  1KU3 A;  3HXL A;  1RR7 A;  2L7Z A;  3AFH A;  3CC7 I;  3HRU A;  4IHV A;  1IRF A;  1EH8 A;  2EFO A;  2Y69 H;  3HRS A;  2L2O A;  4L5J A;  1A36 A;  2LF8 A;  1ZK8 A;  4N9H A;  1JKR C;  2XIG A;  5ICC A;  1SAX A;  1KQ9 A;  3S1Q J;  4A3C J;  3QU3 A;  4LIT A;  3SHF A;  2V1D A;  4O5V A;  4PJN A;  4AD9 A;  1E3P A;  3SYT A;  3J7A O;  1U6G A;  3V7S A;  5A2Q Z;  3LA3 A;  5C3E J;  4O3M A;  2XRL A;  2VN2 A;  5M3M J;  1QHG A;  2XKO A;  2ZKZ A;  4D5C A;  4A3M J;  2DTZ A;  2LR8 A;  1G59 A;  2DPU A;  1P2F A;  4JX5 A;  4L9J A;  4L0Y B;  2GBY A;  3I53 A;  3H0D A;  1GVJ A;  1BM9 A;  2HWV A;  5L3G A;  3MKW B;  1X1C A;  2WV0 A;  3VDX A;  4XQF A;  2P5K A;  3M8F A;  1ULY A;  4LLN A;  4U0W A;  3WE3 A;  3G1O A;  1Z05 A;  1L3L A;  1Z3Y A;  4FQG A;  3H9G A;  4CYC A;  4DZJ A;  5FD6 A;  1XD7 A;  2DOA A;  3GTQ J;  2HOE A;  3CC4 I;  4UUS B;  3CQZ J;  2NVT J;  3RZO J;  4HLX A;  2DJN A;  2IAI A;  3FKI J;  2EK5 A;  4IOA F;  1HW1 A;  2A6E F;  4CCK A;  1APL C;  1YLF A;  2M34 A;  2WAF A;  4XMY A;  4FT8 A;  4DZP A;  1JTX A;  2X9D A;  4BE0 A;  2EA4 A;  5LEK A;  4WXH A;  2JJ7 A;  2BEO A;  2IPQ X;  3CJR B;  5CYV A;  1SC7 A;  1UEL B;  2O7O A;  5DCF A;  3TP0 A;  2VON A;  1H89 C;  1TQI A;  1YI2 I;  2F5F A;  4KT5 C;  1YX3 A;  1PVE A;  2QBY A;  3OYK A;  5FKK A;  2NS8 A;  1U5T C;  1HA8 A;  1SMY F;  2R7Z J;  4M3B A;  4M9X A;  2EZH A;  2HZD A;  3IAS 2;  5B3S H;  5E1X A;  3LSG A;  4CUG A;  2P7V B;  2HDW A;  5M5X J;  5DCM A;  4PJL A;  4DBQ A;  4XLE A;  5HVQ C;  2YU9 J;  3KLO A;  2RV8 A;  3ZQI A;  1MBF A;  4LGW A;  2YU3 A;  1UCR A;  1VQN I;  1D8K A;  2EFP A;  1YJN I;  1YJW I;  1STZ A;  4MTD A;  3F3X A;  2LF7 A;  2VBZ A;  2R5Z B;  1VTN C;  1D3Y A;  3Q3S A;  4BUP A;  3GWZ A;  2OZ6 A;  1I3Q J;  2W85 A;  5EZG A;  2V1X A;  2ECB A;  2IA0 A;  2DLL A;  1ACI A;  5B1A H;  1HBX G;  2JA5 J;  2QCO A;  1P6R A;  2LNB A;  1R5H A;  4IO9 F;  2ZSH B;  3E97 A;  1XGM A;  3SQN A;  1KYZ A;  3Q9V A;  2OZU A;  3BTI A;  3JRC A;  3WU1 B;  5EYR A;  3HOV J;  2TDX A;  1Z7U A;  4G12 A;  2HS5 A;  3WG7 H;  2EB7 A;  2E1C A;  1VF9 A;  1GT0 C;  4F93 B;  2QM3 A;  2XAQ A;  4XKW A;  4M9Z A;  4CA0 A;  2IEK A;  1LEB A;  3DQV C;  4IHT A;  3PO2 J;  5HLI A;  2LKP A;  1DPR A;  1UAA A;  3KP2 A;  1XC5 A;  1R58 A;  4B8X A;  1L0O C;  2CW8 A;  1U5T B;  3PFI A;  3F21 A;  1HQC A;  1LDD A;  3A1Y A;  1VQL I;  3ZP5 A;  2DT5 A;  2QEX I;  2RAE A;  3AG2 H;  3FK7 A;  2EBI A;  5JHF A;  3M1E A;  1W36 C;  2FJ1 A;  4A3I J;  3LNQ A;  2BZT A;  2COM A;  2K86 A;  2ZSI B;  4ABZ A;  1PUF A;  2V6E A;  3L2C A;  3HBL A;  3L9F A;  5DTD A;  3S93 A;  2H1L A;  3LST A;  1FBQ A;  1X1P A;  4MO7 A;  1HF0 A;  1V5G A;  4EEF G;  5FRM A;  2ZXH A;  2E5Z A;  3QP6 A;  5C4X J;  1QRY A;  1SD7 A;  4U88 A;  3I4N J;  4EJT A;  3N05 A;  2Z1D A;  1O3S A;  3CCY A;  3I0T A;  2NVX J;  1I6X A;  3E6D A;  3V42 A;  3ZQF A;  3HOX J;  2M4K A;  3ONQ A;  2JPB A;  5HOD A;  3KZY A;  5CVU A;  1W7P A;  2M87 A;  3BG9 A;  4I0B A;  1FYL A;  2RN7 A;  1U0J A;  3HB9 A;  5DM6 F;  5ILU A;  5ILV A;  2VQH A;  3RDI A;  2DA7 A;  3RQI A;  3I59 B;  3IHU A;  4RLQ A;  5M3F J;  1FOK A;  3VSK A;  2CW0 F;  5LGU A;  3ABU A;  5F27 A;  1BR2 A;  2MD5 A;  3PIP F;  3FXO A;  3IH3 A;  2XB5 A;  2DTR A;  2Y0S A;  1H8A C;  2XUB A;  2KRH A;  3OYJ A;  2VJI A;  5BNG A;  1UHW A;  1XSV A;  2VPR A;  1BOB A;  3BR5 A;  3QPH A;  3W2V A;  1M1E B;  1D1C A;  1EA3 A;  3DPL C;  2E1M C;  3LQR A;  4V2F A;  5ICF A;  3ZMU A;  1Y1V J;  2W4S A;  3OR1 C;  3GFM A;  4L9T A;  4B43 A;  4OWR B;  5IYB J;  4Z6Y A;  2CUZ A;  2EZL A;  2JTV A;  4FE4 A;  5FLX Z;  2HR3 A;  4XRF A;  1BI1 A;  2E1N A;  2XDV A;  4UVB A;  4U7B A;  4BHC A;  4OOI A;  3HOY J;  3L00 A;  2VBX A;  4W1U A;  4IQJ A;  3EYI A;  1A35 A;  3SZT A;  4YFN F;  4BE2 A;  1U8R A;  5DYM A;  5LGN A;  3BJ6 A;  4XRM A;  1YW7 A;  3A0B C;  4EGY A;  2JUG A;  3OR2 C;  4Z2Y A;  2P0W A;  4L9N A;  2J5O A;  1BIA A;  2GOX B;  1JKP C;  3LSJ A;  4ITV A;  2DA1 A;  4DNC A;  4UXN A;  2HFH A;  2Z5U A;  4I7H A;  2X4H A;  4C3H J;  4HPQ A;  4YRV A;  2UXN A;  2GIV A;  1JUM A;  2JVG A;  3BG6 A;  3QP5 A;  5GTH C;  4G7H F;  1T2K A;  1U8B A;  3QOD A;  3S2H J;  3M4O J;  3N97 A;  3LQQ A;  3VB2 A;  1MMS A;  2E1M B;  2KDZ A;  3U9G A;  2M0M A;  1FOW A;  2CYY A;  5FRO A;  4EM0 B;  1VQO I;  1XDU A;  2UXX A;  1KU9 A;  4RGU A;  1KON A;  2OTJ I;  3FXJ A;  4RA2 A;  4XNF A;  3H3U A;  2DOE A;  2HQ5 A;  4ZYD A;  4BQQ A;  2K4J A;  1Q1H A;  2CQK A;  3OY9 A;  1CF7 A;  4AC0 A;  1WHU A;  3H35 A;  2DU9 A;  3O2P E;  2XGC A;  2YX4 A;  4FX0 A;  2BE5 F;  5F08 A;  5CJ9 A;  3L2U A;  3GUD A;  5D6F A;  3HC7 A;  4A3F J;  3DKW A;  2LKS A;  1V54 H;  3CMY A;  2VXZ A;  3ROU A;  5GPA A;  4ZDL A;  3ZQ7 A;  2K9N A;  2FSW A;  1R4M B;  1NK2 P;  3F8C A;  1JXS A;  3DBH B;  3A4C A;  2G7U A;  3CCQ I;  4P1W A;  2VOO A;  2WA0 A;  4LK1 F; 
#chains in the Genus database with same CATH homology
 2CQN A;  2JUC A;  2KZG A;  2KIQ A;  2KFD A;  2L9V A;  2DOD A;  2B7E A;  2DOF A;  2KIS A;  2LKS A;  1UZC A;  2K85 A;  2E71 A;  4FQG A;  2DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...