2CQNA

Solution structure of the ff domain of human formin-binding protein 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formin-binding protein 3
publication title Solution structure of the FF domain of human Formin-binding protein 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2cqnA00
2DOFA 2L9VA 1UZCA 2K85A 2KIQA 2CQNA 2E71A 2DODA 4FQGA 2KISA 2JUCA 2KFDA 2KZGA 2LKSA 2B7EA 2DOEA
chains in the Genus database with same CATH superfamily
3E5XA 2LP0A 2EFPA 4DIQA 4LG3A 3FX3A 3ZQCA 1J59A 1QPIA 3ML6A 4PJJA 4PJMA 3GYHX 3NWTA 4Y3OA 2K3PA 4QWQA 4RAGA 2L9NA 1ON2A 3OV8A 4XKWA 4AIDA 3MKYB 2O6GE 3E0JB 4FHTA 3V8KA 4ANJA 3UKGA 1WJCA 4BL0B 5FLMJ 1JJ8C 4LG0B 1JUPA 4YRVA 3A0HC 5KNLA 2UV1A 3DBRB 5J1YA 2XIGA 3W6JB 1SD5A 1IZ1A 3FK6A 3DTKA 2FA5A 1HSTA 2PMUA 4LITA 2IA2A 3KYLA 5E1WA 1TT0A 1OR7A 1TWHJ 2M87A 2UXNA 1TBXA 2RV8A 2BXYA 2BVLA 3KCCA 4G7OF 2GXGA 4CH7A 1T08B 1LEBA 3KE2A 3OS2A 3QWLA 3KP3A 4BXUA 4G12A 1UG0A 3HRSA 4GO1A 4G6DA 1JE8A 3GF2A 3BDDA 1NG7A 3K4BA 1EKEA 2X1DA 1TT5B 3CCUI 2K27A 1A36A 1HQCA 4HX4A 2HS5A 2HTSA 3L9FA 1F43A 2FBHA 3PM1A 3SZPA 1MNMC 3LOCA 3AAFA 1FLIA 1R1UA 3IP4B 1OCPA 3H9JA 2OPTA 4UXNA 4M9XA 4FX4A 2AHQA 2MG4A 4QLCU 3G3ZA 1DU6A 2ZBKA 1GDTA 2VASA 2WV1A 2HDWA 3JRDA 4L5JA 5DDGA 2W25A 2IXSA 5KVRA 1E0EA 1SD4A 2FXAA 1R71A 1HXDA 5HNHA 5IP7J 4YFKF 4L5EA 4P9UA 1I6XA 4F52A 1Z7LA 4FE7A 1F9NA 1OQYA 2FNAA 2HOAA 1SFKA 1F36A 2VPLA 2CW0F 3BTJA 1IC8A 3K6GA 2KJCA 4KT6A 1HSJA 4HNUA 4DYCA 4UVCA 1I3AA 3CZ6A 3H3UA 2HQNA 2K9QA 3RTRA 3ZQIA 3MCZA 2EZIA 2NS7A 1MBKA 2NNYA 1WWXA 3VB2A 4BEHB 3L2RA 2K9NA 1ETQA 4I7HA 4DGWB 3FHZA 3HTSB 4HW0A 4IKFA 4XRSA 4LLNA 3R4KA 1JKQC 1IDYA 2YX4A 1T95A 1BW5A 2CV0A 4IHXA 1JHFA 3BZKA 1U6GA 3WE3A 1V4RA 1ZLJA 5A2QK 2VJ5A 3EETA 1QBJA 2L2OA 3PUBA 2DN0A 1YRNA 5M3FJ 3HKZN 2W84A 3DKYA 2JSCA 2EWNA 2DT6A 4OWRB 4MEXF 1N75A 2DBBA 2ID3A 3QYFA 2GXAA 2KL4A 4B1RA 1FTTA 4HRIA 2MA3A 3FXMA 3A02A 2MLGA 3J7AO 1RIOH 4N0BA 2XF5A 3ZN0A 3WTZA 3RQIA 4HQEA 9ANTA 1QRYA 2Y31A 2DI3A 2GIVA 2LC2A 3P9IA 3RZOJ 1IUFA 3KX2A 1T56A 2LG4A 4A5NA 3WGGA 1CGPA 1FOWA 1JUMA 2V4JC 1LE8A 1T38A 2L7ZA 3AL0B 2Y48A 2XV4S 4X0GA 3HM5A 2IT0A 3Q9SA 1J5YA 3GLXA 5DEQA 2JA6J 4EJUA 5CVIA 2NXNB 2I5UA 4A3CJ 5BNGA 3DWLE 3MZ8A 2L9SA 4UUVA 1X4PA 1IV8A 5CLSA 1NH3A 3J7AY 2HKOA 3FBIB 2HR3A 2QQBA 4LIVA 3PNVA 3HRMA 5J40A 2V26A 2R5ZA 3D1NI 2B63J 2N8GA 2G9WA 4XM3A 5FJ8J 4E7LA 2E36A 2VJJA 2Z16A 2ZXWH 3WHCA 1FT9A 1Y1VJ 5J3LA 2K5CA 4P1WA 4IOCF 2KIMA 3MEXA 1OMIA 3I64A 5L3CA 1YJ9I 1ZK8A 3BPXA 1J75A 2QA4I 1RZ4A 3CQZJ 2I8DA 4BHPA 4C2UA 2AQFA 2K40A 4BKXA 3GZNB 3J7YJ 3JRHA 3DCFA 2OZ6A 4WX9A 5K7HA 3O6BB 3WTWC 2DXIA 2HZTA 2DCEA 4XK4A 3LA2A 5FD5A 1P4WA 3PFIA 4YG2F 3W2WA 3VSKA 2IA1A 4WXHA 1GT0C 4B4CA 1X1AA 3CF5F 4O3MA 3CCJI 3Q3SA 2HKXA 1HDPA 2GZWA 4HBLA 5EG0A 3E5QA 1BIAA 1ZELA 2DOEA 4Q47A 5E1ZB 4JX4A 5JLXA 1MJBA 5M5WJ 5FRMA 3D5RC 2Q8KA 2XPWA 4CCKA 1QHHD 2MBFA 3MFKA 1P7JA 4CYCB 3CJQB 4QPQA 4RM3A 2NOJB 3CMYA 1SAUA 3U1DA 2KZVA 5LGNA 1XPXA 2PMHA 2CRGA 2GA1A 4BE2A 2E1MC 5F27A 2IA0A 2M0CA 4MHGA 1QNTA 5EYRA 4OAYA 3OYNA 3IRRA 1APLC 3ESWB 2YR2A 1R5GA 1Q1HA 1B72B 1LFUP 3K70D 2ELHA 2HVRA 5CQEA 2KPMA 3F21A 2PN6A 5CVVA 4HNTA 1XMKA 5M3MJ 3PFYA 4JX6A 1LPQA 1F5TA 1LQ1A 3U21A 2O0YA 4I99C 3BPVA 5C44J 1HCRA 1JI8A 4UY8I 2JJ7A 2LLKA 4OOIA 1AOYA 2KFDA 4PSXA 3E5UA 2LY2A 1WQ2A 1S7OA 3RDIA 1VI0A 3AKZA 3TO7A 1SANA 1WGXA 3LSIA 3KFWX 3GTKJ 3GFMA 1S7EA 1A35A 1PDNC 2ELJA 3JREA 2ELKA 5EGOB 2EFWA 1AKHB 4XSXF 3TW7A 4P55A 5JHFA 4G9YA 4ABZA 1MNDA 4MFEA 1L3LA 3KIOA 4XSZF 3DEUA 1U5TA 1EV7A 3PNYA 1KZHA 3HEFA 1E3HA 4BJTA 4CA0A 2DA2A 2JRMA 2WAQN 1ETYA 2FE3A 2A3SA 2IP2A 3J81Z 1BR2A 2ZNZA 3FF5A 5FO5A 4BQOA 1U8BA 4C3HJ 5B3SH 5CYVA 1MMAA 5JR3A 4H0EA 1BR4A 2O03A 4BYYA 2VT3A 2WY7Q 3LSRA 1LB2A 2P8TA 1TWAJ 3PNTA 4ENMA 3GXOA 4B44A 2XPVA 3CCYA 3GO5A 2H8WA 2IS6A 1Y56A 4B47A 5FKOA 5LEJA 1KYWA 3T8RA 1T0FC 1UAAA 2VPRA 4XLNF 1WFXA 4ON0A 3TKYA 1QA6A 3HUGA 5E8IA 1YHQI 2QLZA 4A3LJ 4RGSA 4YIRX 2ZMEA 3HOZJ 3IH4A 1QQIA 4XKBA 3OS1A 1JTYA 3JAMK 3C18A 2TRTA 2XSJC 2DDBA 3BTLA 2LYCA 2UWMA 2V9KA 4C3JJ 1FSHA 1HBXG 2IRFG 4L9NA 4H4KC 4ZTFA 2V6EA 1ORKA 1OKRA 2QSHX 5JI6A 2B9SA 1WKMA 1FWZA 4XLPF 2M7AA 2WTEA 3W6KB 4NQWA 3QPTA 1WJ5A 3TBIA 1YLFA 1KYZA 4QSHA 4ZZLA 2R7UA 2PEXA 3V42A 4XKVA 2XAQA 3V8LA 3K70C 5BOXA 1IJWC 1N25A 4FQGA 2E1NA 1R9TJ 1R5HA 2D1VA 4M9SA 1BI1A 5IOZA 4EJWA 3LSHA 1DQUA 1WJDA 1X4OA 5ICFA 5FLXZ 4ETSA 1UZCA 2EQRA 2Z33A 4HDUA 2I10A 1VQMI 4N9IA 4XLAA 1UG2A 1YITI 3S14J 2G7UA 4XN3A 2R7RA 2LK2A 1VNDA 2VC0A 4M72A 1UJ8A 1IGNA 2DA6A 1D3YA 2KHMA 4E70A 3BG7A 2PX9A 2H1LA 3OYFA 3LSJA 1Z67A 1ZYRF 1Y8RB 2NOGA 2QM3A 1ZTRA 3GTOJ 2EA2A 2Z5UA 2A07F 3FIWA 2CFXA 4F92B 3H1CA 4C2MJ 5ICCA 4NC8A 2BV6A 4G94A 4HYEA 4BAYA 3CMMA 3R60A 5J4VA 2RKHA 2Z2SB 1WVRA 2VJIA 4U0WA 3ZQLA 2V1UA 2JK3A 2XVCA 5EDNA 2QYOA 1GXPA 3JRBA 1PUEE 2YU9J 2BBYA 2IW5A 3F8MA 2WB1N 1KU2A 3BJAA 4IHVA 1V54H 2H6CA 3SHFA 1D5VA 1E17A 1BC7C 4MTEA 4M3BA 4V19K 2JPBA 1SD6A 4A0YA 2KP6A 2RQQA 2QF7A 4Y7NJ 4F3QA 4MFDA 3WTVC 4ZDOA 3AG3H 2LNBA 3C3WA 3L2CA 5J47A 4AVZA 4XLFA 1G3TA 1FZPB 2XGCA 2XSDC 5TISC 3W2VA 2RAEA 3MD2A 4X6AJ 5HS7A 1ZAOA 3GTJJ 2ZSIB 2DTZA 2V1NA 3T8TA 3F23A 3DF8A 3TEDA 1I3QJ 3P9CA 2X6XA 4BXFA 4A12A 4NC6A 1A31A 2CS3A 2ETHA 3CJRB 2DJIA 5D5VB 4JBAA 3R61A 3OOUA 2X1EA 4Y13A 2E2HJ 2O9LA 1R6RA 2DMQA 1W5SA 2F48A 2FQ3A 4RB2C 1ETVA 2EV5A 2DAOA 2VXZA 3CCVI 3ABKH 2BY0A 1R36A 1XS9A 2OA4A 4PJNA 3FM5A 3S3NA 2O8KA 3LA3A 3DPUA 2ADUA 1VQ7I 1U2WA 3HOWJ 2JMWA 2PBIA 1BI0A 1V5EA 2OQRA 2HWVA 3GTQJ 3ZP5A 1REPC 3PL8A 3OR2C 2PJRB 3BR6A 2XB0X 2QQAA 3TO9A 4EGZA 3RKXA 4L9VA 1ZARA 3A01B 1OJLA 1NK3P 2QBYB 2ECCA 1FYLA 1JT6A 1HOMA 1B59A 3GTMJ 1H9TA 1U9OA 2R7VA 3P5JA 5F1RA 2KDOA 3HSRA 5EZHA 2NVUB 1TNSA 1D1CA 2QSFX 5IT9Z 5LLQA 2VBXA 2XB5A 2ZFWA 3ISPA 4BHBA 4PZJA 2BW3A 5ILUA 3CCQI 2Z3YA 5L3BA 4D5FA 3OSFA 2R5YA 2P81A 2KRFA 1TC3C 3D0SA 3VEPA 3LSGA 1A04A 4B48A 3S1RJ 2PG4A 3LSPA 2STWA 4BQAA 4AYBN 2W57A 5E3LA 2BY3A 5J8FA 2BEOA 1U0JA 2A61A 1RNLA 2DFHA 3F8FA 1A5JA 3CDLA 2MABA 1FOXA 3OR1C 3O3KA 4BBRJ 1Z6TA 1CF7A 2OTJI 3BG5A 5ED4A 4CGZA 3LFKA 3CCEI 2UUZA 1U5TC 4UB6C 2DA3A 5D8KB 1U78A 2EZHA 3EUKL 2LBFA 2E1MB 2FF4A 4M3FA 3DQVC 4KFCA 1LVAA 1QZYA 4KICA 2H1KA 2EFOA 1CQTA 3FKIJ 1KQ8A 4XICA 1MJAA 2P6TA 3SEQA 2L4AA 3LFUA 1BOAA 1XB4A 2VC1A 4TV7A 2P5KA 4Z6YA 3R6SA 4RBOA 4BU2A 2E7XA 3GCMA 2M34A 2ESNA 1ETOA 2LVSA 1GLNA 2ZFUA 1YJWI 2FEZA 2L3DA 1K7AA 2E5ZA 2K9MA 1TZLA 3I4NJ 1MKMA 5FKLA 3FWEA 4I0BA 3I9V2 4JYKA 1SFOJ 1ACIA 1D0XA 1XSDA 2VODA 4M71A 3JTGA 4FT8A 2AO9A 4LK0F 4XRFA 4HX7A 2VIXA 4NB5A 4XIDA 3G4SI 3FISA 2EFQA 2X51A 5HLHA 2HXIA 1ETXA 5DCMB 4ENKA 3HBLA 5GAGJ 1R23A 4D7NA 1ZRFA 1XGNA 5GP9A 3HHHA 5GAHJ 3IAM2 3K2ZA 3QP6A 3FHNA 3ZCOA 2H27A 2PFBA 1ZRCA 3CUOA 3GZ6A 5DCFA 1GVDA 3GX4X 5DM7F 1YO5C 2LOOA 3M8FA 3ZQQA 1MMGA 5FRNA 3H3VK 2OV7A 2L9VA 3HHGA 2NVTJ 1FYMA 2F6CA 3F0CA 3GWZA 4GDFA 1S29A 3FM3A 1P2FA 1X1PA 5IPAA 1SMTA 4HPQA 3HOUJ 3M8EA 2LY9A 2Y0MA 3RQ4A 2IS4A 2WAFA 3DLAA 3DP7A 4IF4A 2WWYA 5E3MA 2FRHA 2DO7A 1EH8A 4RDUA 1MNEA 1U3EM 3OL4A 5GTIC 4PK4A 3G1OA 2EV6A 2DTRA 1ZQ3P 3GTLJ 2IAIA 2L4MA 3HOYJ 5FD6A 1VQ6I 4CICA 4D0PA 1FP1D 2LKSA 2Q2EB 1QHGA 1K78B 3ERMA 2OBPA 4XQFA 2BOLA 1ERDA 1BI2A 3TL4X 3JTHA 2OD5A 1R00A 2RN7A 4OMZA 3OYKA 3WE2A 1TL8A 2E19A 3HOVJ 3CDHA 3NQOA 1YS7A 1ZN2A 4CZZA 1FIAA 3O2PE 1FIPA 2CUZA 1UELB 2A6HF 2K7LA 1G3WA 2JZYA 2XAHA 3J80Z 3PJRA 2VE8A 3FK7A 2XASA 2CGPA 3PSIA 4ZYGA 3GFJA 4AVPA 1WH5A 5CKTA 1W0UA 3RIRA 3RZDJ 2MSYA 4CCNA 1MGTA 1P6RA 3QPLA 2XGXA 3PQKA 4LG0A 2ZJQF 1S7AA 3EUHA 3I71A 3F72A 1A6IA 1SMYF 4Z2YA 1IXCA 1EJ9A 2HYFA 1DP7P 2A69F 1XGSA 2XUBA 4FASD 4XLEA 4HG2A 4CCLA 4B3XA 4A3KJ 3F8BA 5D4RA 5J1RA 2E1CA 5F08A 1HW2A 3A0BC 4UVBA 2E34A 4M73A 3IL2A 3I3LA 1S9HA 2K4BA 2EBIA 5K5OA 2XRNA 2XROA 1K4TA 3BQYA 3PUFA 2E2IJ 2FMYA 4HSTA 5DS9A 3WHBA 4Y33A 4EM2A 1LEAA 3KEYA 4LLGF 3Q0VA 2KIFA 1R1VA 3A1YA 5CPRB 1XD7A 2L7MP 2LFBA 2UZKA 3Q0WA 2ZXIA 2NS0A 2DK8A 2L0KA 4BS9A 4HDVA 4PDKA 3HOSA 3MKWB 2R5ZB 1ZG1A 2VI6A 1YS6A 3E7LA 1LDDA 3K4CA 1WI3A 3V7RA 4OAZA 2XAUA 2CW7A 3K1PA 3PQJA 4BACA 2TDXA 3M3YJ 3S1QJ 4RAYA 1HKQA 3DTEA 2NNNA 2EILH 1WH7A 4ZZDA 2M4GA 1JXSA 3CUQA 2WV0A 2X6OA 1XC5A 3I0TA 4R8HA 5FKKA 1Z3YA 2F5DA 2KISA 3RKYA 3OYHA 2JA8J 3WG9A 3DPTA 4ENNA 2VB6A 3BOQA 4FCYA 3ASOH 3CP8A 3UNGC 4AD9A 4HX8A 3ROUA 1SEUA 4KDPA 4DZPA 1YTYA 2E35A 2IGKA 2CU7A 2CMPA 1BL0A 2PQ8A 1IXRC 2L5QA 2IS2A 3S1NJ 2RVCA 5D5XB 1RPWA 3L1PA 4I01A 3DU6A 1FBQA 4A3GJ 2JN6A 4BY7J 4BH9A 1G8XA 2UXXA 2HGCA 1W7PA 2GIZA 2R7ZJ 1MD0A 3HGGA 1RR7A 3KPHA 1OCOH 5J1UA 2IGOA 4ZDPA 2VQLA 2GAUA 3Q0UA 3H5AA 1IRZA 4IQ4A 2D45A 3H9GA 4BHCA 4XRMA 1YG2A 2BHYA 4BE0A 4PSWA 2L02A 3F6OA 2DYSH 3I55I 2VQCA 3ZQFA 5FB2A 3HKZA 1VQ5I 2W85A 1IN7A 2E7WA 2ZXJA 1ETWA 4XOTA 2OTLI 4IEJA 1STZA 3CP2A 4ESFA 4JOMA 2HQ5A 2LMDA 5L3EA 4MTDA 3I59B 4U87A 2IGNA 2KRHA 5DV5A 1R22A 1XMXA 4RGXA 4AWXB 4ZYEA 1MBGA 3K9TA 2Y0SN 1VZ0A 4S04A 1MW7A 1FOYA 1RKWA 4BDYA 1JKOC 1P9QC 3BJ6A 3OYGA 3NWSA 3L2WA 2JWTA 1XMAA 2XF6A 1FNNA 4KUMA 1Z7UA 3P7NA 4KN4X 2KRCA 1W4MA 1NK2P 2DDAA 1G4DA 3IH3A 2YSRA 3HSFA 3CC2I 2R7SA 3CC4I 1O4XA 1PJRA 5JHUA 5IYDJ 1EF4A 5H2FC 4HLYA 4A3MJ 3MKZA 5D6EA 1AWCA 2VT2A 3SEZA 3L2VA 3N4MA 4L0ZB 3GTPJ 1MDMB 3RKWA 1U5TB 3DBHB 3CLQA 1QVTA 1IN6A 5E3NA 2X85A 1TP4A 3M8JA 4G6TB 3HOXJ 1PUFB 2LF8A 1B1BA 4D5CA 2QSGX 5LBQA 2B0LA 3BCBA 3FZVA 3KYCB 3T1BA 1J2XA 1R4MB 2NAZA 2OAZA 2V79A 4XMYA 1BBYA 5F0CA 4O5VA 1U8RA 3DEEA 1JUSA 2JA5J 4RLFA 3WTUC 5IYBJ 3O8HA 3L2UA 5EF6A 3QU3A 4I98B 2R92J 4FE4A 3VFZA 2M8GX 4K2EA 4FISA 4F55A 1DU0A 1OR7C 4GFBA 2P0WA 2YPRA 1S8NA 2QVOA 3G1MA 1KU9A 2KQRA 3QAHA 2QQ9A 3VODA 2QGUA 2C6YA 3GZ5A 4UUSB 4J00A 1TLHB 1GVJA 4JX5A 1M1EB 2K85A 4YFNF 1ULYA 4XR6A 3K1MA 5BPIA 1IN4A 2M8EA 2FQ4A 4EV0A 3TMOA 3ZMDA 3NARA 3GEZA 1RI7A 1W5TA 4OU0A 3B6AA 2K9SA 3JAMZ 4CYCA 2XKPA 4F93B 1ZG3A 3B02A 1BOBA 2JUCA 1ZR2A 5HODA 4ZH4F 2VKVA 4NNJA 1S72I 2DA4A 4HNVA 5KHDA 1XDSA 3TOBA 1FYKA 3JSOA 3KZIC 2J5PA 4MGRA 3OYLA 5CQGA 1YW7A 1W7PD 2DPDA 3BLYA 1SFUA 2GA2A 2F5VA 1T98A 4HQMA 4C30A 4DBRA 2BY1A 3E97A 5CVJA 1MBJA 3HYIA 5FKMA 1O3SA 5LRSA 1G2HA 4CDGA 2VQGA 4IO9F 3CMAI 1OYIA 1B72A 4RMNA 1XDUA 3KYDB 3OYEA 4XN0A 3PSFA 2EB7A 2LKPA 1D8KA 1G3SA 4IXAA 1MIJA 3EUHC 1E2XA 4PJLA 3BG9A 2FMLA 2QWWA 4CYDA 1WRJA 4U0VA 1MH4A 1H89C 1N78A 1QVUA 3DV8A 4XLHA 5EEHA 3X2QH 2ZO4A 4D7MA 2FOKA 2JRTA 4ZC3A 4U7BA 2HEOA 2FNPA 2LRDA 3E3VA 4IHWA 1T39A 2CQ7A 2KKOA 2Y75A 4G7HF 1P92A 1AKHA 1D0ZA 4KT5C 5FROA 5CVRA 3QU6A 1BJAA 2HU9A 2ZXHA 1WJBA 4HV6A 4MO7A 5C3EJ 3IC7A 3BG6A 3IRQA 1ZR4A 1WHUA 3OMYA 3C2GA 5BQTA 1X2MA 1YQAA 1OCTC 4M74A 1WJFA 1AA7A 1ZGWA 5GPCA 5HNFA 4HOBA 1IN5A 1LFPA 3A2KA 2XGDA 3HJEA 4E7KA 1YYVA 2KZGA 3GUDA 1S3JA 2B7EA 3K10A 4FETA 3WU0A 3FBNB 2P4WA 1G3YA 4ESJA 3JRAA 4UUTA 1OCRH 1XCBA 5EZGA 3LQRA 2Y9ZA 2H94A 1JJ6C 3LMMA 3BY6A 2VE9A 3L09A 4Y52J 3CUQC 1OCZH 3ONQA 2CH0A 4MQ9F 2E2JJ 4UV9A 1IN8A 5CVUA 3S3MA 3ZPLA 3BR1A 2O3FA 3KEQA 3G1LA 4F7ZA 2ZNYA 1DGRM 3JW4A 4AU7A 3G71I 4CXFA 5FKNA 1BW6A 1MMNA 1W1WE 2GBYA 2LR8A 2MW8A 2VXDA 2X1CA 1EH6A 3H35A 4L9JA 4D9JA 5K7ZA 2PMZN 3S2WA 1BR1A 4CHUA 3E6BA 3GVAA 3ZN1A 1ZKGA 2EPFA 2ME0A 3F8NA 1FEXA 1WCMJ 3KETA 1SVOA 3DPLC 3H36A 4RAZA 1UHSA 2L9RA 3MQ0A 3OIOA 2FSWA 4GXOA 4UV8A 4IRHA 3RYRA 4U88A 3V7SA 1OYWA 1Z9CA 2IBDA 3CO6C 3LNQA 4OINF 4QPOA 4HEA2 2XHKA 1KONA 2X4HA 4LGWA 2ID6A 4G8XA 1V55H 2MGQA 5E1XA 5F0FA 4EVIA 1K6OA 5FLXK 5D5WB 2COBA 2Y69H 3REOA 2GLOA 5D5UB 1F4KA 3KP5A 1ZRDA 5C4XJ 1LUJB 1FBUA 4IHSA 1MMDA 3JSPA 5E18F 1BC8C 3VDXA 3FDYA 1MBFA 1USTA 4L5IA 2QENA 2RQPA 2ZC2A 5LEKA 5HOOA 4ZJZA 4M6YA 3RPUA 3HIFA 4ZYDA 1I5ZA 4DJAA 3G2BA 1DP3A 3AL0C 2BXZA 5E3OA 3FXKA 4IOAF 2HVSA 3BR3A 2IGMA 3KP4A 3I5UA 1GHCA 1UHWA 3S2HJ 1XSVA 3HL2A 4A0XA 3R0JA 5ERIA 2WY8Q 1X2NA 4Q5SF 2DT7B 2H8RA 1QU3A 4HA8A 4KNYA 3SZTA 2ZJPF 2O61A 1Z3XA 3D5SC 3QRFF 4E6KG 4KIFA 1IG7A 2M1BA 4DBQA 5KK1A 3M07A 4NBQA 3OYJA 2L7FP 2EK5A 1BIBA 1T8IA 1UFMA 1JGGA 1TQMA 4X1EA 2VBWA 3FMSA 3QOPA 3ZQ7A 3TP3A 1PYVA 1LJ9A 2K9LA 2R7FA 1J09A 5JFRA 1HC8A 1D0YA 1Z1DA 1VQ8I 1HW1A 1W5CC 2EZLA 4PFOA 4DZJA 3RYPA 4PGHA 3CESA 2M9HA 3AG4H 4BJ5C 1K61A 3SDGA 3FKJA 2R7DA 2DMUA 2HZDA 2CUJA 2ACJA 3S32A 3DEWA 3ZQGA 3VWBA 4ENJA 3GMEA 3BR5A 4CZCA 5B5EC 2M45A 2YU3A 2R4GA 4LLLA 3K1NA 2V9VA 4HF0A 4BE1A 4OIOF 3S1MJ 1T33A 2F4OB 1V5GA 4N4NB 1B8IB 5HVQC 1JHHA 1H9GA 1BJZA 3OYBA 3OOPA 2OC6A 3WGHA 2M4KA 4IHYA 3H0GJ 3BTCA 3IKVA 2AXLA 3NEUA 2V1DA 4P5OA 2VJ4A 5IT3A 3NRVA 1KU3A 3MVPA 4RGUA 1Y0UA 4A3JJ 3QPSA 1K4SA 2R7WA 1R7JA 4JP0A 4LJZF 3DBLB 1P4AA 4XL9A 5AIQA 4J19A 4KIBA 2W1OA 1V3FA 4WF2A 4AM3A 5ICEA 1FSEA 2CQXA 1C0WA 2AXTC 3OYAA 5BPDA 3A01A 5IT9K 1IUYA 4OIQF 4GRIA 2QBYA 3CC7I 3CLOA 2VN2A 1Z6RA 3BR0A 2R0QC 1I6HJ 2WBMA 3MZHA 3ERED 5ICGA 1TWFJ 4J01A 1I50J 2ZMEC 5K7FA 3GFLA 4RLQA 1JKRC 2DPUA 2GOMA 1GV5A 2JA2A 3G73A 3M7GA 4KMFA 2ISYA 3SDBA 4YIFA 3IWZA 1LNWA 3S3OA 2FD5A 5EEAA 3WODF 5HS9A 3K4JA 1FBSA 4O6JA 4BBSJ 2HOSA 1R5ID 1FTZA 2JQ7A 4M6VA 1EA3A 3DKWA 1TTYA 5TGTA 3LAPA 2RC4A 2VONA 4E7JA 4AYBA 1QGPA 4CCMA 3H5NA 2MC4A 2JSPA 1SVMA 2HOTA 1HA8A 4WK8F 3BQZA 5E8GA 1J7KA 2CO5A 4ZTJA 1LKXA 3C1DA 3K4MA 4UVAA 4IRGA 1X3UA 5HLTA 3JRFA 2JT1A 2DQRA 4HV5A 1Q1VA 2DW4A 1ODDA 3QYBA 4A6EA 3HDDA 3VOEA 1OCCH 4M6XA 1J9IA 2GXBA 4RB1A 5DD8A 5FFXA 3FXQA 4FTHA 1Z0XA 4C2TA 4CSWA 2L7KA 3U1KA 4DYRA 2M2EA 3RJPA 3QP5A 1KGSA 2LDUA 1W0TA 3FXOA 2GOXB 3SFIA 3ECOA 4A3IJ 3HRUA 3SJMA 1AU7A 3IWFA 3I4PA 1FC3A 4EJTA 2ESHA 3BZCA 2CQNA 2MLKA 1SFEA 2OU2A 3FXJA 3TW6A 3KZYA 4WXCA 5GTHC 2P7CB 1KQ9A 4RS8A 2K86A 2OCCH 2Q1ZB 3EUAA 3KP2A 4MQVA 1QO0D 3WGIA 2L54A 3K4NA 3OS0A 1IW7F 2LREA 4W1UA 5DCMA 4IL6C 5HDKA 2NVXJ 2OZUA 2EINH 2ICWG 2RREA 2VQHA 4F91B 4AIKA 2WAEA 3CJNA 5E17F 3F3XA 1BA5A 1S5LC 2DJNA 1YIJI 1TW3A 1O57A 5LD2C 1YRNB 3GTGJ 2AQEA 2YUSA 1QPMA 4AIJA 3I54A 3HB9A 3COAC 1ONVA 2HFHA 1O3TA 5A2QZ 2AS5F 4DOZA 3WG7H 1W36D 4C3IJ 5E20A 1Y1WJ 2DOFA 1X1BA 4MEYF 3SZGA 3S17J 3S2DJ 1R1TA 3ZRGA 1NG6A 3WU1B 2VUMJ 2NRAC 1MH3A 3BG3A 1Z77A 3LQQA 4UHTA 1IAWA 3I4MJ 2DFIA 2ZSHB 3DU5A 2W24A 4EJVA 1GUUA 5LFAA 4DYQA 1VQ4I 2CYYA 2PLYA 3H0DA 1X19A 4A3BJ 2JA7J 4EGYA 4L0YB 3EDPA 1IF1A 2NS8A 1YFHA 4II2A 2LF7A 3CD6I 3KZZA 3PIOF 3CUQB 1UB9A 1T0FA 2MD0A 4YELA 2HOEA 3OYMA 2A68F 1P7IA 2JVGA 2H09A 2GWRA 4YIIA 3CTAA 4EJOA 2Z1DA 1LE8B 2XRLA 4CCJA 2DFEA 3HZJA 3GBGA 1YE9A 1ZH5A 2Q2EA 1Y0NA 5ILVA 3S8PA 3C7JA 4BQNA 3HOTA 1K78A 1D5YA 3GLLA 3GFIA 3LSKA 3SFZA 1HDDC 1VF9A 2A5YB 3V4GA 3BR2A 1E3PA 3RPQA 1HF0A 4KJZA 1RESA 2VL8A 4Y4RA 1LDKB 2BZTA 2NYXA 2P7VB 2VBZA 2R7QA 3GW2A 4NUBA 5H20A 4BQQA 5LHGA 3WTYC 2CUEA 3J80K 1SC7A 1IO2A 3C2BA 4JK1X 4B09A 2Y9YA 1W7PB 2MH9A 4I09A 1HKTA 3HG9A 2JTVA 2P6SA 3RI4A 1PP8F 2V9PA 4XBFA 3MMYB 2BYVE 2WADA 1POGA 1D1AA 3Q9VA 1G6NA 4V2FA 2KIQA 1VTNC 2RGVA 4OMYA 3CJTB 2KJBA 1Z91A 5F1JA 1X1CA 3BT9A 1SFXA 3IH2A 3KP6A 1Y39A 4BY1J 5B1AH 4P96A 5EEGA 1T6SA 5DYMA 3W6VA 4IQJA 4GGGA 4IPAA 3T5XA 2QCOA 2L01A 2CFOA 5HDGA 3CCRI 3RKQA 2XF7A 2X6WA 4BEHA 4P9FA 1TQIA 2FJ1A 2NVQJ 2CQKA 2HQRA 5C4JJ 5GADJ 1OYYA 3H92A 5D8LB 4GYIA 2W48A 5EG0B 1S6LA 2HPIA 3IKTA 1SAXA 4KA4A 4XKCA 3QYEA 4XNFA 5F04A 1MJ9A 5F0HA 3OIPA 3RSNA 3SXYA 1I1SA 2WA0A 3SQNA 2HPMA 2CQQA 4LFUA 1MBHA 5K1YA 3ZMZA 4RM2A 4I76A 3S16J 2EA4A 2BGCA 4BDZA 3LWFA 2EIJH 4R1HA 1KQ0A 3N97A 2Y30A 2KMUA 2F5EA 2YX7A 4I02A 2KLOA 1W36C 2F4IA 4M3GA 1R58A 3D5LA 5GPAA 2VBYA 1YX5A 4LOCA 4A5MA 2BHZA 1MBEA 3K2AA 4BUPA 1XGMA 2MD5A 2IEKA 4KYWA 4KN7X 5LHIA 2A6EF 5IYCJ 1NHAA 5HS8A 4PUSA 4U0YA 4YEJA 2KT0A 2K3FA 3JRCA 3W2AA 1ZG5A 1RUOA 2ZKZA 5LHHA 1IRGA 4GYGA 2HNHA 5KAFC 1H88C 3HPGA 3JRIA 4EQQA 3CCMI 2JPCA 1IRFA 2STTA 1F1ZA 1WSUA 2E60A 4A3EJ 1VQOI 1VQKI 3HC7A 4IHTA 1VQNI 3F9KA 3ELKA 4GCVA 5J8CA 3M1CA 3KLNA 1SVLA 4ZYAA 2FOWA 3ABTA 1ZREA 3IAS2 1UHMA 2DYRH 1IDZA 5H6RA 3I58A 2FU4A 4HAMA 3E6DA 5DUKA 2M5WA 3E1SA 4UB8C 2F5CA 2XAGA 1DUXC 1FMVA 2EZKA 4KIGA 2EIKH 4N4OB 4HSRA 5CJ9A 4XORA 2O7OA 1I39A 1YW8A 4Y15A 1B9MA 2ZCWA 3QQAA 4YFXF 2A5WA 5B1BH 4A0ZA 5D6FA 3B6CA 1OISA 2VKDA 2DU9A 4Q48A 1VQ9I 1TWGJ 3OY9A 2ZJRF 6PAXA 2A05A 5LGUA 3JR9A 4A3DJ 4LB5A 1XX5A 1I1GA 4XRSG 4N9HA 3W3CA 4WXDA 5HLIA 2GM4A 5LGTA 2CJJA 4NDLA 4C9YA 1K79A 1JT0A 1Z21A 4NHJA 4AUXA 2HDCA 1O7FA 1ETKA 3F8CA 3ZMUA 1G59A 4HLXA 2X6YA 2Y2ZA 1YX3A 3ZMTA 4EM1A 5KAIC 2M3AA 5K5RA 3I59A 3HUGB 2XKOA 4PFPA 4A2UA 4CUGA 2ZMEB 1Y8QB 4CO8A 1WI9A 2JVHA 2OJED 3J7ZI 1SD7A 2DOAA 5H6QA 3VPRA 2EH3A 3L7WA 2M30A 3C2HA 4IJAA 5FGMA 1ITYA 4LB6B 4KITB 2LTPA 1X58A 2Y0SA 2D1HA 3K4LA 4RB0A 4XOPA 2XPUA 1DGWY 4LD5A 1DPRA 1U9NA 2XGEA 2K4JA 4BGDA 5KCMA 1L0OC 2MFZA 4A69C 1XN7A 2PJPA 3ZMVA 4E7SA 4NQWB 5AONA 2CUFA 2ECBA 1TQPA 2CV2A 2R7XA 5FFZA 1X3WB 1FJLA 4RB3C 2X0LA 3FXRA 1RUNA 3H9QA 1I27A 3MWMA 1MDMA 3FMRA 4II3A 2W7NA 5DD4A 1IRXA 2DLLA 2GQQA 5F6FA 1K83J 3AG1H 2W00A 3BP8A 4PJ0C 1B6AA 3E6MA 3WU2C 2X9DA 3KP7A 3WTSC 1PUFA 2HQAA 3G6EI 1EH7A 3R0AA 1MSFC 2BE5F 3ECHA 1RC9A 2E71A 4ITVA 2D5VA 1DPUA 3QPHA 5JVGF 1V5FA 2DT5A 1B9NA 1YI2I 2MH2A 2XAFA 1H0MA 3L00A 4FX0A 2RDPA 3MZYA 2ISZA 2QEXI 3CCSI 5FLVA 2R7OA 5EJCA 5L3GA 3PIPF 1T2KA 4S05A 2OQGA 4L9TA 4M9ZA 1WZ2A 2J5OA 2XAJA 3ULQB 4UUSA 3BC8A 4E7HA 5EGOA 2HYGD 3VYSB 3TDZC 2HTJA 4QIWN 3BCAA 3LA7A 2O5RA 3BJOA 3EPZA 3EQLF 3HRTA 4Q4ZF 2IPQX 3J81K 4MLOA 2DMTA 4I0AA 4PGGA 3M4OJ 2EJRA 4DQ2A 1LDJA 4MNUA 5TRDA 4HF2A 1E3OC 2LKXA 3K0LA 4B3AA 1WJAA 1USSA 1OFCX 2H6BA 2HVQA 2CV1A 2HI3A 2WAQA 2FX0A 1XGOA 2KIUA 3F6VA 2ME6A 1XG1A 1IV6A 4EM0B 3TP0A 2O8XA 4A6DA 3PO3J 2VOOA 3T0YA 3OSGA 1XSXA 2IVMA 2JUGA 4V2GA 5M5YJ 2LY1A 2IJLA 3VYTB 2QKLB 3LSTA 3KEOA 1K6YA 1TNTA 4Y17A 2NVYJ 2W4SA 5IY5H 2QKMB 3AFHA 2V7FA 3ABMH 3ZR8X 2HDDA 2W82A 3JRGA 3ABLH 5E79C 2DMNA 2FUG2 2DQLA 3BTIA 4QTRA 3IV5A 1MSEC 4LIUA 2DMPA 4BNCA 3K4KA 1FMWA 3ZGKA 3ZXSA 2FBKA 3Q5FA 1FP2A 4ASNA 1IXSB 1UMQA 3TQNA 2OF7A 5GAEJ 2EFNA 4EMSA 1TW2A 2MC3A 2M0MA 4KMUX 3IUOA 4RAFA 4NC7A 4PCQA 4IX7A 1D1BA 1FPQA 1B4AA 4AC0A 3TO6A 3CCLI 1A6QA 3CF2A 1GV2A 3CO7C 2XC7A 3OYCA 2Z9OA 1RETA 1QZEA 1R4NB 5F64A 2DFFA 4RA2A 1ZHFA 4ZDLA 4OIRF 2VKEA 2RNGA 4XONA 3KLOA 3MAJA 4E4HA 1KA8A 4EEFG 3TDUC 3A03A 1MMSA 2G0EA 4OIPF 2P5VA 1WJEA 4WCGA 2VLAA 3V8JA 1MZBA 3OYDA 3E6CC 2EIMH 1JKPC 1OPCA 1BI3A 2QZ8A 5IP6A 4HZFA 1LVKA 2CG4A 5D4SA 4CCOA 2LH9A 5LRRA 2DODA 2QUFA 3O8GA 2P5LC 3EYIA 5M5XJ 2VKHA 5DTDA 1HLVA 4U7DA 1LFBA 2BW3B 3EYYA 2KDZA 1TWCJ 1WPKA 2R5YB 5DM6F 4G7ZF 4E7ZA 4BJ6C 2E5NA 4UNOA 1YOVB 3CMEI 4MIMA 2LD5A 1FOKA 2M7BA 2PI0A 2OUMA 2OCEA 2DA1A 1ZGAA 3MN2A 2R93J 2BVMA 3DFGA 5L3DA 3WTTC 1R49A 3U2RA 4M3EA 4I2OA 4BXXJ 1X3ZB 3HXLA 3FXLA 1JGSA 5IOYA 3AG2H 5ILSA 1BM9A 3ZMSA 2F5FA 3BWGA 3RCOA 1CF7B 4EATA 1ZLKA 2F4MB 3HSEA 3V7CA 5B66C 3S15J 3BROA 3HPHA 2MYSA 1FX7A 2PMZA 4KISA 2LBFB 3I56I 2V1XA 3K7AJ 3QODA 1RR8C 4L18B 3I53A 5J6XA 3OL3A 2V6CA 3LL7A 1YJNI 2D2WA 1JTXA 2WB1A 3SYTA 1YIOA 4S0HB 4WWCA 1PVEA 2COMA 3H5RA 4XLCA 3DKXA 4AIHA 4B43A 3N05A 4D1QA 1NTCA 2K02A 3ABUA 2YS9A 5BMZA 2HXOA 4M3DA 3UR3C 1GXQA 5DUIA 3OYIA 4E7IA 1J0RA 2R3SA 3M1EA 3DXJF 3PO2J 1O3RA 2A6TA 1RKTA 1XCVA 1VFCA 4IVNA 2CWEA 2CW8A 2Z99A 3K69A 3DTIA 2DA5A 3IHUA 2G7HA 3S93A 1ZGJA 4R79A 3HTUA 3U9GA 1N77A 1HKSA 3OWTA 3VYUB 1VQLI 3ZOBA 3ZQHA 5AIPA 3HGYA 4RGRA 2WC2A 1QZZA 1XTAA 3ASNH 2CSOA 5K5QA 2DA7A 3L2QA 1KU7A 2F2EA 5L3FA 5BS6A 2QQ8A 2ZJ2A 2ZB9A 1FY7A 4IZZA 1YW9A 1AHDP 3FXUA 4JQFA 2RNJA 3VSLA 4DW6A 4HF1A 2PJRA 1OLTA 1P4XA 4ESBA 2R7TA 1H8AC 3MKLA 3CDIA 3M9AA 2BY2A 3QOEA 4W97A 3LAJA 3FMQA 2IS1A 1O7LA 2XDVA 4ZYHA 1PP7U 1VQPI 1D8JA 3TOAA 3B73A 1ENHA 5JLWA 3LSMA 5J4YA 2EV0A 3TGNA 1Z05A 2TCTA 2X48A 3VYRB 2LSOA 1BN5A 4G6QA 5IP9J 4LK1F 3DLLF 5HLGA 1UCRA 3H3ZA 3JCUC 3RPUD 3NAUA 4LMYA 2HYJA 4DNCA 5JVTA 1RRJA 5TJJA 3BZ6A 3P9KA 4A93J 3OIQA 1HW5A 4IRIA 1O3QA 2Q0OA 4I6ZA 2E1OA 3WTXC 5HDNA 2FBIA 4A3FJ 1B8IA 2VOPA 1X1DA 3A4CA 3F22A 1ON1A 1Y6IA 4B8XA 2DK5A 1DDNA
chains in the Genus database with same CATH topology
2DOFA 2L9VA 1UZCA 2K85A 2KIQA 2CQNA 2E71A 2DODA 4FQGA 2KISA 2JUCA 2KFDA 2KZGA 2LKSA 2B7EA 2DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOF A;  2L9V A;  1UZC A;  2K85 A;  2KIQ A;  2CQN A;  2E71 A;  2DOD A;  4FQG A;  2KIS A;  2JUC A;  2KFD A;  2KZG A;  2LKS A;  2B7E A;  2DOE A; 
#chains in the Genus database with same CATH topology
 3E5X A;  2LP0 A;  2EFP A;  4DIQ A;  4LG3 A;  3FX3 A;  3ZQC A;  1J59 A;  1QPI A;  3ML6 A;  4PJJ A;  4PJM A;  3GYH X;  3NWT A;  4Y3O A;  2K3P A;  4QWQ A;  4RAG A;  2L9N A;  1ON2 A;  3OV8 A;  4XKW A;  4AID A;  3MKY B;  2O6G E;  3E0J B;  4FHT A;  3V8K A;  4ANJ A;  3UKG A;  1WJC A;  4BL0 B;  5FLM J;  1JJ8 C;  4LG0 B;  1JUP A;  4YRV A;  3A0H C;  5KNL A;  2UV1 A;  3DBR B;  5J1Y A;  2XIG A;  3W6J B;  1SD5 A;  1IZ1 A;  3FK6 A;  3DTK A;  2FA5 A;  1HST A;  2PMU A;  4LIT A;  2IA2 A;  3KYL A;  5E1W A;  1TT0 A;  1OR7 A;  1TWH J;  2M87 A;  2UXN A;  1TBX A;  2RV8 A;  2BXY A;  2BVL A;  3KCC A;  4G7O F;  2GXG A;  4CH7 A;  1T08 B;  1LEB A;  3KE2 A;  3OS2 A;  3QWL A;  3KP3 A;  4BXU A;  4G12 A;  1UG0 A;  3HRS A;  4GO1 A;  4G6D A;  1JE8 A;  3GF2 A;  3BDD A;  1NG7 A;  3K4B A;  1EKE A;  2X1D A;  1TT5 B;  3CCU I;  2K27 A;  1A36 A;  1HQC A;  4HX4 A;  2HS5 A;  2HTS A;  3L9F A;  1F43 A;  2FBH A;  3PM1 A;  3SZP A;  1MNM C;  3LOC A;  3AAF A;  1FLI A;  1R1U A;  3IP4 B;  1OCP A;  3H9J A;  2OPT A;  4UXN A;  4M9X A;  4FX4 A;  2AHQ A;  2MG4 A;  4QLC U;  3G3Z A;  1DU6 A;  2ZBK A;  1GDT A;  2VAS A;  2WV1 A;  2HDW A;  3JRD A;  4L5J A;  5DDG A;  2W25 A;  2IXS A;  5KVR A;  1E0E A;  1SD4 A;  2FXA A;  1R71 A;  1HXD A;  5HNH A;  5IP7 J;  4YFK F;  4L5E A;  4P9U A;  1I6X A;  4F52 A;  1Z7L A;  4FE7 A;  1F9N A;  1OQY A;  2FNA A;  2HOA A;  1SFK A;  1F36 A;  2VPL A;  2CW0 F;  3BTJ A;  1IC8 A;  3K6G A;  2KJC A;  4KT6 A;  1HSJ A;  4HNU A;  4DYC A;  4UVC A;  1I3A A;  3CZ6 A;  3H3U A;  2HQN A;  2K9Q A;  3RTR A;  3ZQI A;  3MCZ A;  2EZI A;  2NS7 A;  1MBK A;  2NNY A;  1WWX A;  3VB2 A;  4BEH B;  3L2R A;  2K9N A;  1ETQ A;  4I7H A;  4DGW B;  3FHZ A;  3HTS B;  4HW0 A;  4IKF A;  4XRS A;  4LLN A;  3R4K A;  1JKQ C;  1IDY A;  2YX4 A;  1T95 A;  1BW5 A;  2CV0 A;  4IHX A;  1JHF A;  3BZK A;  1U6G A;  3WE3 A;  1V4R A;  1ZLJ A;  5A2Q K;  2VJ5 A;  3EET A;  1QBJ A;  2L2O A;  3PUB A;  2DN0 A;  1YRN A;  5M3F J;  3HKZ N;  2W84 A;  3DKY A;  2JSC A;  2EWN A;  2DT6 A;  4OWR B;  4MEX F;  1N75 A;  2DBB A;  2ID3 A;  3QYF A;  2GXA A;  2KL4 A;  4B1R A;  1FTT A;  4HRI A;  2MA3 A;  3FXM A;  3A02 A;  2MLG A;  3J7A O;  1RIO H;  4N0B A;  2XF5 A;  3ZN0 A;  3WTZ A;  3RQI A;  4HQE A;  9ANT A;  1QRY A;  2Y31 A;  2DI3 A;  2GIV A;  2LC2 A;  3P9I A;  3RZO J;  1IUF A;  3KX2 A;  1T56 A;  2LG4 A;  4A5N A;  3WGG A;  1CGP A;  1FOW A;  1JUM A;  2V4J C;  1LE8 A;  1T38 A;  2L7Z A;  3AL0 B;  2Y48 A;  2XV4 S;  4X0G A;  3HM5 A;  2IT0 A;  3Q9S A;  1J5Y A;  3GLX A;  5DEQ A;  2JA6 J;  4EJU A;  5CVI A;  2NXN B;  2I5U A;  4A3C J;  5BNG A;  3DWL E;  3MZ8 A;  2L9S A;  4UUV A;  1X4P A;  1IV8 A;  5CLS A;  1NH3 A;  3J7A Y;  2HKO A;  3FBI B;  2HR3 A;  2QQB A;  4LIV A;  3PNV A;  3HRM A;  5J40 A;  2V26 A;  2R5Z A;  3D1N I;  2B63 J;  2N8G A;  2G9W A;  4XM3 A;  5FJ8 J;  4E7L A;  2E36 A;  2VJJ A;  2Z16 A;  2ZXW H;  3WHC A;  1FT9 A;  1Y1V J;  5J3L A;  2K5C A;  4P1W A;  4IOC F;  2KIM A;  3MEX A;  1OMI A;  3I64 A;  5L3C A;  1YJ9 I;  1ZK8 A;  3BPX A;  1J75 A;  2QA4 I;  1RZ4 A;  3CQZ J;  2I8D A;  4BHP A;  4C2U A;  2AQF A;  2K40 A;  4BKX A;  3GZN B;  3J7Y J;  3JRH A;  3DCF A;  2OZ6 A;  4WX9 A;  5K7H A;  3O6B B;  3WTW C;  2DXI A;  2HZT A;  2DCE A;  4XK4 A;  3LA2 A;  5FD5 A;  1P4W A;  3PFI A;  4YG2 F;  3W2W A;  3VSK A;  2IA1 A;  4WXH A;  1GT0 C;  4B4C A;  1X1A A;  3CF5 F;  4O3M A;  3CCJ I;  3Q3S A;  2HKX A;  1HDP A;  2GZW A;  4HBL A;  5EG0 A;  3E5Q A;  1BIA A;  1ZEL A;  2DOE A;  4Q47 A;  5E1Z B;  4JX4 A;  5JLX A;  1MJB A;  5M5W J;  5FRM A;  3D5R C;  2Q8K A;  2XPW A;  4CCK A;  1QHH D;  2MBF A;  3MFK A;  1P7J A;  4CYC B;  3CJQ B;  4QPQ A;  4RM3 A;  2NOJ B;  3CMY A;  1SAU A;  3U1D A;  2KZV A;  5LGN A;  1XPX A;  2PMH A;  2CRG A;  2GA1 A;  4BE2 A;  2E1M C;  5F27 A;  2IA0 A;  2M0C A;  4MHG A;  1QNT A;  5EYR A;  4OAY A;  3OYN A;  3IRR A;  1APL C;  3ESW B;  2YR2 A;  1R5G A;  1Q1H A;  1B72 B;  1LFU P;  3K70 D;  2ELH A;  2HVR A;  5CQE A;  2KPM A;  3F21 A;  2PN6 A;  5CVV A;  4HNT A;  1XMK A;  5M3M J;  3PFY A;  4JX6 A;  1LPQ A;  1F5T A;  1LQ1 A;  3U21 A;  2O0Y A;  4I99 C;  3BPV A;  5C44 J;  1HCR A;  1JI8 A;  4UY8 I;  2JJ7 A;  2LLK A;  4OOI A;  1AOY A;  2KFD A;  4PSX A;  3E5U A;  2LY2 A;  1WQ2 A;  1S7O A;  3RDI A;  1VI0 A;  3AKZ A;  3TO7 A;  1SAN A;  1WGX A;  3LSI A;  3KFW X;  3GTK J;  3GFM A;  1S7E A;  1A35 A;  1PDN C;  2ELJ A;  3JRE A;  2ELK A;  5EGO B;  2EFW A;  1AKH B;  4XSX F;  3TW7 A;  4P55 A;  5JHF A;  4G9Y A;  4ABZ A;  1MND A;  4MFE A;  1L3L A;  3KIO A;  4XSZ F;  3DEU A;  1U5T A;  1EV7 A;  3PNY A;  1KZH A;  3HEF A;  1E3H A;  4BJT A;  4CA0 A;  2DA2 A;  2JRM A;  2WAQ N;  1ETY A;  2FE3 A;  2A3S A;  2IP2 A;  3J81 Z;  1BR2 A;  2ZNZ A;  3FF5 A;  5FO5 A;  4BQO A;  1U8B A;  4C3H J;  5B3S H;  5CYV A;  1MMA A;  5JR3 A;  4H0E A;  1BR4 A;  2O03 A;  4BYY A;  2VT3 A;  2WY7 Q;  3LSR A;  1LB2 A;  2P8T A;  1TWA J;  3PNT A;  4ENM A;  3GXO A;  4B44 A;  2XPV A;  3CCY A;  3GO5 A;  2H8W A;  2IS6 A;  1Y56 A;  4B47 A;  5FKO A;  5LEJ A;  1KYW A;  3T8R A;  1T0F C;  1UAA A;  2VPR A;  4XLN F;  1WFX A;  4ON0 A;  3TKY A;  1QA6 A;  3HUG A;  5E8I A;  1YHQ I;  2QLZ A;  4A3L J;  4RGS A;  4YIR X;  2ZME A;  3HOZ J;  3IH4 A;  1QQI A;  4XKB A;  3OS1 A;  1JTY A;  3JAM K;  3C18 A;  2TRT A;  2XSJ C;  2DDB A;  3BTL A;  2LYC A;  2UWM A;  2V9K A;  4C3J J;  1FSH A;  1HBX G;  2IRF G;  4L9N A;  4H4K C;  4ZTF A;  2V6E A;  1ORK A;  1OKR A;  2QSH X;  5JI6 A;  2B9S A;  1WKM A;  1FWZ A;  4XLP F;  2M7A A;  2WTE A;  3W6K B;  4NQW A;  3QPT A;  1WJ5 A;  3TBI A;  1YLF A;  1KYZ A;  4QSH A;  4ZZL A;  2R7U A;  2PEX A;  3V42 A;  4XKV A;  2XAQ A;  3V8L A;  3K70 C;  5BOX A;  1IJW C;  1N25 A;  4FQG A;  2E1N A;  1R9T J;  1R5H A;  2D1V A;  4M9S A;  1BI1 A;  5IOZ A;  4EJW A;  3LSH A;  1DQU A;  1WJD A;  1X4O A;  5ICF A;  5FLX Z;  4ETS A;  1UZC A;  2EQR A;  2Z33 A;  4HDU A;  2I10 A;  1VQM I;  4N9I A;  4XLA A;  1UG2 A;  1YIT I;  3S14 J;  2G7U A;  4XN3 A;  2R7R A;  2LK2 A;  1VND A;  2VC0 A;  4M72 A;  1UJ8 A;  1IGN A;  2DA6 A;  1D3Y A;  2KHM A;  4E70 A;  3BG7 A;  2PX9 A;  2H1L A;  3OYF A;  3LSJ A;  1Z67 A;  1ZYR F;  1Y8R B;  2NOG A;  2QM3 A;  1ZTR A;  3GTO J;  2EA2 A;  2Z5U A;  2A07 F;  3FIW A;  2CFX A;  4F92 B;  3H1C A;  4C2M J;  5ICC A;  4NC8 A;  2BV6 A;  4G94 A;  4HYE A;  4BAY A;  3CMM A;  3R60 A;  5J4V A;  2RKH A;  2Z2S B;  1WVR A;  2VJI A;  4U0W A;  3ZQL A;  2V1U A;  2JK3 A;  2XVC A;  5EDN A;  2QYO A;  1GXP A;  3JRB A;  1PUE E;  2YU9 J;  2BBY A;  2IW5 A;  3F8M A;  2WB1 N;  1KU2 A;  3BJA A;  4IHV A;  1V54 H;  2H6C A;  3SHF A;  1D5V A;  1E17 A;  1BC7 C;  4MTE A;  4M3B A;  4V19 K;  2JPB A;  1SD6 A;  4A0Y A;  2KP6 A;  2RQQ A;  2QF7 A;  4Y7N J;  4F3Q A;  4MFD A;  3WTV C;  4ZDO A;  3AG3 H;  2LNB A;  3C3W A;  3L2C A;  5J47 A;  4AVZ A;  4XLF A;  1G3T A;  1FZP B;  2XGC A;  2XSD C;  5TIS C;  3W2V A;  2RAE A;  3MD2 A;  4X6A J;  5HS7 A;  1ZAO A;  3GTJ J;  2ZSI B;  2DTZ A;  2V1N A;  3T8T A;  3F23 A;  3DF8 A;  3TED A;  1I3Q J;  3P9C A;  2X6X A;  4BXF A;  4A12 A;  4NC6 A;  1A31 A;  2CS3 A;  2ETH A;  3CJR B;  2DJI A;  5D5V B;  4JBA A;  3R61 A;  3OOU A;  2X1E A;  4Y13 A;  2E2H J;  2O9L A;  1R6R A;  2DMQ A;  1W5S A;  2F48 A;  2FQ3 A;  4RB2 C;  1ETV A;  2EV5 A;  2DAO A;  2VXZ A;  3CCV I;  3ABK H;  2BY0 A;  1R36 A;  1XS9 A;  2OA4 A;  4PJN A;  3FM5 A;  3S3N A;  2O8K A;  3LA3 A;  3DPU A;  2ADU A;  1VQ7 I;  1U2W A;  3HOW J;  2JMW A;  2PBI A;  1BI0 A;  1V5E A;  2OQR A;  2HWV A;  3GTQ J;  3ZP5 A;  1REP C;  3PL8 A;  3OR2 C;  2PJR B;  3BR6 A;  2XB0 X;  2QQA A;  3TO9 A;  4EGZ A;  3RKX A;  4L9V A;  1ZAR A;  3A01 B;  1OJL A;  1NK3 P;  2QBY B;  2ECC A;  1FYL A;  1JT6 A;  1HOM A;  1B59 A;  3GTM J;  1H9T A;  1U9O A;  2R7V A;  3P5J A;  5F1R A;  2KDO A;  3HSR A;  5EZH A;  2NVU B;  1TNS A;  1D1C A;  2QSF X;  5IT9 Z;  5LLQ A;  2VBX A;  2XB5 A;  2ZFW A;  3ISP A;  4BHB A;  4PZJ A;  2BW3 A;  5ILU A;  3CCQ I;  2Z3Y A;  5L3B A;  4D5F A;  3OSF A;  2R5Y A;  2P81 A;  2KRF A;  1TC3 C;  3D0S A;  3VEP A;  3LSG A;  1A04 A;  4B48 A;  3S1R J;  2PG4 A;  3LSP A;  2STW A;  4BQA A;  4AYB N;  2W57 A;  5E3L A;  2BY3 A;  5J8F A;  2BEO A;  1U0J A;  2A61 A;  1RNL A;  2DFH A;  3F8F A;  1A5J A;  3CDL A;  2MAB A;  1FOX A;  3OR1 C;  3O3K A;  4BBR J;  1Z6T A;  1CF7 A;  2OTJ I;  3BG5 A;  5ED4 A;  4CGZ A;  3LFK A;  3CCE I;  2UUZ A;  1U5T C;  4UB6 C;  2DA3 A;  5D8K B;  1U78 A;  2EZH A;  3EUK L;  2LBF A;  2E1M B;  2FF4 A;  4M3F A;  3DQV C;  4KFC A;  1LVA A;  1QZY A;  4KIC A;  2H1K A;  2EFO A;  1CQT A;  3FKI J;  1KQ8 A;  4XIC A;  1MJA A;  2P6T A;  3SEQ A;  2L4A A;  3LFU A;  1BOA A;  1XB4 A;  2VC1 A;  4TV7 A;  2P5K A;  4Z6Y A;  3R6S A;  4RBO A;  4BU2 A;  2E7X A;  3GCM A;  2M34 A;  2ESN A;  1ETO A;  2LVS A;  1GLN A;  2ZFU A;  1YJW I;  2FEZ A;  2L3D A;  1K7A A;  2E5Z A;  2K9M A;  1TZL A;  3I4N J;  1MKM A;  5FKL A;  3FWE A;  4I0B A;  3I9V 2;  4JYK A;  1SFO J;  1ACI A;  1D0X A;  1XSD A;  2VOD A;  4M71 A;  3JTG A;  4FT8 A;  2AO9 A;  4LK0 F;  4XRF A;  4HX7 A;  2VIX A;  4NB5 A;  4XID A;  3G4S I;  3FIS A;  2EFQ A;  2X51 A;  5HLH A;  2HXI A;  1ETX A;  5DCM B;  4ENK A;  3HBL A;  5GAG J;  1R23 A;  4D7N A;  1ZRF A;  1XGN A;  5GP9 A;  3HHH A;  5GAH J;  3IAM 2;  3K2Z A;  3QP6 A;  3FHN A;  3ZCO A;  2H27 A;  2PFB A;  1ZRC A;  3CUO A;  3GZ6 A;  5DCF A;  1GVD A;  3GX4 X;  5DM7 F;  1YO5 C;  2LOO A;  3M8F A;  3ZQQ A;  1MMG A;  5FRN A;  3H3V K;  2OV7 A;  2L9V A;  3HHG A;  2NVT J;  1FYM A;  2F6C A;  3F0C A;  3GWZ A;  4GDF A;  1S29 A;  3FM3 A;  1P2F A;  1X1P A;  5IPA A;  1SMT A;  4HPQ A;  3HOU J;  3M8E A;  2LY9 A;  2Y0M A;  3RQ4 A;  2IS4 A;  2WAF A;  3DLA A;  3DP7 A;  4IF4 A;  2WWY A;  5E3M A;  2FRH A;  2DO7 A;  1EH8 A;  4RDU A;  1MNE A;  1U3E M;  3OL4 A;  5GTI C;  4PK4 A;  3G1O A;  2EV6 A;  2DTR A;  1ZQ3 P;  3GTL J;  2IAI A;  2L4M A;  3HOY J;  5FD6 A;  1VQ6 I;  4CIC A;  4D0P A;  1FP1 D;  2LKS A;  2Q2E B;  1QHG A;  1K78 B;  3ERM A;  2OBP A;  4XQF A;  2BOL A;  1ERD A;  1BI2 A;  3TL4 X;  3JTH A;  2OD5 A;  1R00 A;  2RN7 A;  4OMZ A;  3OYK A;  3WE2 A;  1TL8 A;  2E19 A;  3HOV J;  3CDH A;  3NQO A;  1YS7 A;  1ZN2 A;  4CZZ A;  1FIA A;  3O2P E;  1FIP A;  2CUZ A;  1UEL B;  2A6H F;  2K7L A;  1G3W A;  2JZY A;  2XAH A;  3J80 Z;  3PJR A;  2VE8 A;  3FK7 A;  2XAS A;  2CGP A;  3PSI A;  4ZYG A;  3GFJ A;  4AVP A;  1WH5 A;  5CKT A;  1W0U A;  3RIR A;  3RZD J;  2MSY A;  4CCN A;  1MGT A;  1P6R A;  3QPL A;  2XGX A;  3PQK A;  4LG0 A;  2ZJQ F;  1S7A A;  3EUH A;  3I71 A;  3F72 A;  1A6I A;  1SMY F;  4Z2Y A;  1IXC A;  1EJ9 A;  2HYF A;  1DP7 P;  2A69 F;  1XGS A;  2XUB A;  4FAS D;  4XLE A;  4HG2 A;  4CCL A;  4B3X A;  4A3K J;  3F8B A;  5D4R A;  5J1R A;  2E1C A;  5F08 A;  1HW2 A;  3A0B C;  4UVB A;  2E34 A;  4M73 A;  3IL2 A;  3I3L A;  1S9H A;  2K4B A;  2EBI A;  5K5O A;  2XRN A;  2XRO A;  1K4T A;  3BQY A;  3PUF A;  2E2I J;  2FMY A;  4HST A;  5DS9 A;  3WHB A;  4Y33 A;  4EM2 A;  1LEA A;  3KEY A;  4LLG F;  3Q0V A;  2KIF A;  1R1V A;  3A1Y A;  5CPR B;  1XD7 A;  2L7M P;  2LFB A;  2UZK A;  3Q0W A;  2ZXI A;  2NS0 A;  2DK8 A;  2L0K A;  4BS9 A;  4HDV A;  4PDK A;  3HOS A;  3MKW B;  2R5Z B;  1ZG1 A;  2VI6 A;  1YS6 A;  3E7L A;  1LDD A;  3K4C A;  1WI3 A;  3V7R A;  4OAZ A;  2XAU A;  2CW7 A;  3K1P A;  3PQJ A;  4BAC A;  2TDX A;  3M3Y J;  3S1Q J;  4RAY A;  1HKQ A;  3DTE A;  2NNN A;  2EIL H;  1WH7 A;  4ZZD A;  2M4G A;  1JXS A;  3CUQ A;  2WV0 A;  2X6O A;  1XC5 A;  3I0T A;  4R8H A;  5FKK A;  1Z3Y A;  2F5D A;  2KIS A;  3RKY A;  3OYH A;  2JA8 J;  3WG9 A;  3DPT A;  4ENN A;  2VB6 A;  3BOQ A;  4FCY A;  3ASO H;  3CP8 A;  3UNG C;  4AD9 A;  4HX8 A;  3ROU A;  1SEU A;  4KDP A;  4DZP A;  1YTY A;  2E35 A;  2IGK A;  2CU7 A;  2CMP A;  1BL0 A;  2PQ8 A;  1IXR C;  2L5Q A;  2IS2 A;  3S1N J;  2RVC A;  5D5X B;  1RPW A;  3L1P A;  4I01 A;  3DU6 A;  1FBQ A;  4A3G J;  2JN6 A;  4BY7 J;  4BH9 A;  1G8X A;  2UXX A;  2HGC A;  1W7P A;  2GIZ A;  2R7Z J;  1MD0 A;  3HGG A;  1RR7 A;  3KPH A;  1OCO H;  5J1U A;  2IGO A;  4ZDP A;  2VQL A;  2GAU A;  3Q0U A;  3H5A A;  1IRZ A;  4IQ4 A;  2D45 A;  3H9G A;  4BHC A;  4XRM A;  1YG2 A;  2BHY A;  4BE0 A;  4PSW A;  2L02 A;  3F6O A;  2DYS H;  3I55 I;  2VQC A;  3ZQF A;  5FB2 A;  3HKZ A;  1VQ5 I;  2W85 A;  1IN7 A;  2E7W A;  2ZXJ A;  1ETW A;  4XOT A;  2OTL I;  4IEJ A;  1STZ A;  3CP2 A;  4ESF A;  4JOM A;  2HQ5 A;  2LMD A;  5L3E A;  4MTD A;  3I59 B;  4U87 A;  2IGN A;  2KRH A;  5DV5 A;  1R22 A;  1XMX A;  4RGX A;  4AWX B;  4ZYE A;  1MBG A;  3K9T A;  2Y0S N;  1VZ0 A;  4S04 A;  1MW7 A;  1FOY A;  1RKW A;  4BDY A;  1JKO C;  1P9Q C;  3BJ6 A;  3OYG A;  3NWS A;  3L2W A;  2JWT A;  1XMA A;  2XF6 A;  1FNN A;  4KUM A;  1Z7U A;  3P7N A;  4KN4 X;  2KRC A;  1W4M A;  1NK2 P;  2DDA A;  1G4D A;  3IH3 A;  2YSR A;  3HSF A;  3CC2 I;  2R7S A;  3CC4 I;  1O4X A;  1PJR A;  5JHU A;  5IYD J;  1EF4 A;  5H2F C;  4HLY A;  4A3M J;  3MKZ A;  5D6E A;  1AWC A;  2VT2 A;  3SEZ A;  3L2V A;  3N4M A;  4L0Z B;  3GTP J;  1MDM B;  3RKW A;  1U5T B;  3DBH B;  3CLQ A;  1QVT A;  1IN6 A;  5E3N A;  2X85 A;  1TP4 A;  3M8J A;  4G6T B;  3HOX J;  1PUF B;  2LF8 A;  1B1B A;  4D5C A;  2QSG X;  5LBQ A;  2B0L A;  3BCB A;  3FZV A;  3KYC B;  3T1B A;  1J2X A;  1R4M B;  2NAZ A;  2OAZ A;  2V79 A;  4XMY A;  1BBY A;  5F0C A;  4O5V A;  1U8R A;  3DEE A;  1JUS A;  2JA5 J;  4RLF A;  3WTU C;  5IYB J;  3O8H A;  3L2U A;  5EF6 A;  3QU3 A;  4I98 B;  2R92 J;  4FE4 A;  3VFZ A;  2M8G X;  4K2E A;  4FIS A;  4F55 A;  1DU0 A;  1OR7 C;  4GFB A;  2P0W A;  2YPR A;  1S8N A;  2QVO A;  3G1M A;  1KU9 A;  2KQR A;  3QAH A;  2QQ9 A;  3VOD A;  2QGU A;  2C6Y A;  3GZ5 A;  4UUS B;  4J00 A;  1TLH B;  1GVJ A;  4JX5 A;  1M1E B;  2K85 A;  4YFN F;  1ULY A;  4XR6 A;  3K1M A;  5BPI A;  1IN4 A;  2M8E A;  2FQ4 A;  4EV0 A;  3TMO A;  3ZMD A;  3NAR A;  3GEZ A;  1RI7 A;  1W5T A;  4OU0 A;  3B6A A;  2K9S A;  3JAM Z;  4CYC A;  2XKP A;  4F93 B;  1ZG3 A;  3B02 A;  1BOB A;  2JUC A;  1ZR2 A;  5HOD A;  4ZH4 F;  2VKV A;  4NNJ A;  1S72 I;  2DA4 A;  4HNV A;  5KHD A;  1XDS A;  3TOB A;  1FYK A;  3JSO A;  3KZI C;  2J5P A;  4MGR A;  3OYL A;  5CQG A;  1YW7 A;  1W7P D;  2DPD A;  3BLY A;  1SFU A;  2GA2 A;  2F5V A;  1T98 A;  4HQM A;  4C30 A;  4DBR A;  2BY1 A;  3E97 A;  5CVJ A;  1MBJ A;  3HYI A;  5FKM A;  1O3S A;  5LRS A;  1G2H A;  4CDG A;  2VQG A;  4IO9 F;  3CMA I;  1OYI A;  1B72 A;  4RMN A;  1XDU A;  3KYD B;  3OYE A;  4XN0 A;  3PSF A;  2EB7 A;  2LKP A;  1D8K A;  1G3S A;  4IXA A;  1MIJ A;  3EUH C;  1E2X A;  4PJL A;  3BG9 A;  2FML A;  2QWW A;  4CYD A;  1WRJ A;  4U0V A;  1MH4 A;  1H89 C;  1N78 A;  1QVU A;  3DV8 A;  4XLH A;  5EEH A;  3X2Q H;  2ZO4 A;  4D7M A;  2FOK A;  2JRT A;  4ZC3 A;  4U7B A;  2HEO A;  2FNP A;  2LRD A;  3E3V A;  4IHW A;  1T39 A;  2CQ7 A;  2KKO A;  2Y75 A;  4G7H F;  1P92 A;  1AKH A;  1D0Z A;  4KT5 C;  5FRO A;  5CVR A;  3QU6 A;  1BJA A;  2HU9 A;  2ZXH A;  1WJB A;  4HV6 A;  4MO7 A;  5C3E J;  3IC7 A;  3BG6 A;  3IRQ A;  1ZR4 A;  1WHU A;  3OMY A;  3C2G A;  5BQT A;  1X2M A;  1YQA A;  1OCT C;  4M74 A;  1WJF A;  1AA7 A;  1ZGW A;  5GPC A;  5HNF A;  4HOB A;  1IN5 A;  1LFP A;  3A2K A;  2XGD A;  3HJE A;  4E7K A;  1YYV A;  2KZG A;  3GUD A;  1S3J A;  2B7E A;  3K10 A;  4FET A;  3WU0 A;  3FBN B;  2P4W A;  1G3Y A;  4ESJ A;  3JRA A;  4UUT A;  1OCR H;  1XCB A;  5EZG A;  3LQR A;  2Y9Z A;  2H94 A;  1JJ6 C;  3LMM A;  3BY6 A;  2VE9 A;  3L09 A;  4Y52 J;  3CUQ C;  1OCZ H;  3ONQ A;  2CH0 A;  4MQ9 F;  2E2J J;  4UV9 A;  1IN8 A;  5CVU A;  3S3M A;  3ZPL A;  3BR1 A;  2O3F A;  3KEQ A;  3G1L A;  4F7Z A;  2ZNY A;  1DGR M;  3JW4 A;  4AU7 A;  3G71 I;  4CXF A;  5FKN A;  1BW6 A;  1MMN A;  1W1W E;  2GBY A;  2LR8 A;  2MW8 A;  2VXD A;  2X1C A;  1EH6 A;  3H35 A;  4L9J A;  4D9J A;  5K7Z A;  2PMZ N;  3S2W A;  1BR1 A;  4CHU A;  3E6B A;  3GVA A;  3ZN1 A;  1ZKG A;  2EPF A;  2ME0 A;  3F8N A;  1FEX A;  1WCM J;  3KET A;  1SVO A;  3DPL C;  3H36 A;  4RAZ A;  1UHS A;  2L9R A;  3MQ0 A;  3OIO A;  2FSW A;  4GXO A;  4UV8 A;  4IRH A;  3RYR A;  4U88 A;  3V7S A;  1OYW A;  1Z9C A;  2IBD A;  3CO6 C;  3LNQ A;  4OIN F;  4QPO A;  4HEA 2;  2XHK A;  1KON A;  2X4H A;  4LGW A;  2ID6 A;  4G8X A;  1V55 H;  2MGQ A;  5E1X A;  5F0F A;  4EVI A;  1K6O A;  5FLX K;  5D5W B;  2COB A;  2Y69 H;  3REO A;  2GLO A;  5D5U B;  1F4K A;  3KP5 A;  1ZRD A;  5C4X J;  1LUJ B;  1FBU A;  4IHS A;  1MMD A;  3JSP A;  5E18 F;  1BC8 C;  3VDX A;  3FDY A;  1MBF A;  1UST A;  4L5I A;  2QEN A;  2RQP A;  2ZC2 A;  5LEK A;  5HOO A;  4ZJZ A;  4M6Y A;  3RPU A;  3HIF A;  4ZYD A;  1I5Z A;  4DJA A;  3G2B A;  1DP3 A;  3AL0 C;  2BXZ A;  5E3O A;  3FXK A;  4IOA F;  2HVS A;  3BR3 A;  2IGM A;  3KP4 A;  3I5U A;  1GHC A;  1UHW A;  3S2H J;  1XSV A;  3HL2 A;  4A0X A;  3R0J A;  5ERI A;  2WY8 Q;  1X2N A;  4Q5S F;  2DT7 B;  2H8R A;  1QU3 A;  4HA8 A;  4KNY A;  3SZT A;  2ZJP F;  2O61 A;  1Z3X A;  3D5S C;  3QRF F;  4E6K G;  4KIF A;  1IG7 A;  2M1B A;  4DBQ A;  5KK1 A;  3M07 A;  4NBQ A;  3OYJ A;  2L7F P;  2EK5 A;  1BIB A;  1T8I A;  1UFM A;  1JGG A;  1TQM A;  4X1E A;  2VBW A;  3FMS A;  3QOP A;  3ZQ7 A;  3TP3 A;  1PYV A;  1LJ9 A;  2K9L A;  2R7F A;  1J09 A;  5JFR A;  1HC8 A;  1D0Y A;  1Z1D A;  1VQ8 I;  1HW1 A;  1W5C C;  2EZL A;  4PFO A;  4DZJ A;  3RYP A;  4PGH A;  3CES A;  2M9H A;  3AG4 H;  4BJ5 C;  1K61 A;  3SDG A;  3FKJ A;  2R7D A;  2DMU A;  2HZD A;  2CUJ A;  2ACJ A;  3S32 A;  3DEW A;  3ZQG A;  3VWB A;  4ENJ A;  3GME A;  3BR5 A;  4CZC A;  5B5E C;  2M45 A;  2YU3 A;  2R4G A;  4LLL A;  3K1N A;  2V9V A;  4HF0 A;  4BE1 A;  4OIO F;  3S1M J;  1T33 A;  2F4O B;  1V5G A;  4N4N B;  1B8I B;  5HVQ C;  1JHH A;  1H9G A;  1BJZ A;  3OYB A;  3OOP A;  2OC6 A;  3WGH A;  2M4K A;  4IHY A;  3H0G J;  3BTC A;  3IKV A;  2AXL A;  3NEU A;  2V1D A;  4P5O A;  2VJ4 A;  5IT3 A;  3NRV A;  1KU3 A;  3MVP A;  4RGU A;  1Y0U A;  4A3J J;  3QPS A;  1K4S A;  2R7W A;  1R7J A;  4JP0 A;  4LJZ F;  3DBL B;  1P4A A;  4XL9 A;  5AIQ A;  4J19 A;  4KIB A;  2W1O A;  1V3F A;  4WF2 A;  4AM3 A;  5ICE A;  1FSE A;  2CQX A;  1C0W A;  2AXT C;  3OYA A;  5BPD A;  3A01 A;  5IT9 K;  1IUY A;  4OIQ F;  4GRI A;  2QBY A;  3CC7 I;  3CLO A;  2VN2 A;  1Z6R A;  3BR0 A;  2R0Q C;  1I6H J;  2WBM A;  3MZH A;  3ERE D;  5ICG A;  1TWF J;  4J01 A;  1I50 J;  2ZME C;  5K7F A;  3GFL A;  4RLQ A;  1JKR C;  2DPU A;  2GOM A;  1GV5 A;  2JA2 A;  3G73 A;  3M7G A;  4KMF A;  2ISY A;  3SDB A;  4YIF A;  3IWZ A;  1LNW A;  3S3O A;  2FD5 A;  5EEA A;  3WOD F;  5HS9 A;  3K4J A;  1FBS A;  4O6J A;  4BBS J;  2HOS A;  1R5I D;  1FTZ A;  2JQ7 A;  4M6V A;  1EA3 A;  3DKW A;  1TTY A;  5TGT A;  3LAP A;  2RC4 A;  2VON A;  4E7J A;  4AYB A;  1QGP A;  4CCM A;  3H5N A;  2MC4 A;  2JSP A;  1SVM A;  2HOT A;  1HA8 A;  4WK8 F;  3BQZ A;  5E8G A;  1J7K A;  2CO5 A;  4ZTJ A;  1LKX A;  3C1D A;  3K4M A;  4UVA A;  4IRG A;  1X3U A;  5HLT A;  3JRF A;  2JT1 A;  2DQR A;  4HV5 A;  1Q1V A;  2DW4 A;  1ODD A;  3QYB A;  4A6E A;  3HDD A;  3VOE A;  1OCC H;  4M6X A;  1J9I A;  2GXB A;  4RB1 A;  5DD8 A;  5FFX A;  3FXQ A;  4FTH A;  1Z0X A;  4C2T A;  4CSW A;  2L7K A;  3U1K A;  4DYR A;  2M2E A;  3RJP A;  3QP5 A;  1KGS A;  2LDU A;  1W0T A;  3FXO A;  2GOX B;  3SFI A;  3ECO A;  4A3I J;  3HRU A;  3SJM A;  1AU7 A;  3IWF A;  3I4P A;  1FC3 A;  4EJT A;  2ESH A;  3BZC A;  2CQN A;  2MLK A;  1SFE A;  2OU2 A;  3FXJ A;  3TW6 A;  3KZY A;  4WXC A;  5GTH C;  2P7C B;  1KQ9 A;  4RS8 A;  2K86 A;  2OCC H;  2Q1Z B;  3EUA A;  3KP2 A;  4MQV A;  1QO0 D;  3WGI A;  2L54 A;  3K4N A;  3OS0 A;  1IW7 F;  2LRE A;  4W1U A;  5DCM A;  4IL6 C;  5HDK A;  2NVX J;  2OZU A;  2EIN H;  2ICW G;  2RRE A;  2VQH A;  4F91 B;  4AIK A;  2WAE A;  3CJN A;  5E17 F;  3F3X A;  1BA5 A;  1S5L C;  2DJN A;  1YIJ I;  1TW3 A;  1O57 A;  5LD2 C;  1YRN B;  3GTG J;  2AQE A;  2YUS A;  1QPM A;  4AIJ A;  3I54 A;  3HB9 A;  3COA C;  1ONV A;  2HFH A;  1O3T A;  5A2Q Z;  2AS5 F;  4DOZ A;  3WG7 H;  1W36 D;  4C3I J;  5E20 A;  1Y1W J;  2DOF A;  1X1B A;  4MEY F;  3SZG A;  3S17 J;  3S2D J;  1R1T A;  3ZRG A;  1NG6 A;  3WU1 B;  2VUM J;  2NRA C;  1MH3 A;  3BG3 A;  1Z77 A;  3LQQ A;  4UHT A;  1IAW A;  3I4M J;  2DFI A;  2ZSH B;  3DU5 A;  2W24 A;  4EJV A;  1GUU A;  5LFA A;  4DYQ A;  1VQ4 I;  2CYY A;  2PLY A;  3H0D A;  1X19 A;  4A3B J;  2JA7 J;  4EGY A;  4L0Y B;  3EDP A;  1IF1 A;  2NS8 A;  1YFH A;  4II2 A;  2LF7 A;  3CD6 I;  3KZZ A;  3PIO F;  3CUQ B;  1UB9 A;  1T0F A;  2MD0 A;  4YEL A;  2HOE A;  3OYM A;  2A68 F;  1P7I A;  2JVG A;  2H09 A;  2GWR A;  4YII A;  3CTA A;  4EJO A;  2Z1D A;  1LE8 B;  2XRL A;  4CCJ A;  2DFE A;  3HZJ A;  3GBG A;  1YE9 A;  1ZH5 A;  2Q2E A;  1Y0N A;  5ILV A;  3S8P A;  3C7J A;  4BQN A;  3HOT A;  1K78 A;  1D5Y A;  3GLL A;  3GFI A;  3LSK A;  3SFZ A;  1HDD C;  1VF9 A;  2A5Y B;  3V4G A;  3BR2 A;  1E3P A;  3RPQ A;  1HF0 A;  4KJZ A;  1RES A;  2VL8 A;  4Y4R A;  1LDK B;  2BZT A;  2NYX A;  2P7V B;  2VBZ A;  2R7Q A;  3GW2 A;  4NUB A;  5H20 A;  4BQQ A;  5LHG A;  3WTY C;  2CUE A;  3J80 K;  1SC7 A;  1IO2 A;  3C2B A;  4JK1 X;  4B09 A;  2Y9Y A;  1W7P B;  2MH9 A;  4I09 A;  1HKT A;  3HG9 A;  2JTV A;  2P6S A;  3RI4 A;  1PP8 F;  2V9P A;  4XBF A;  3MMY B;  2BYV E;  2WAD A;  1POG A;  1D1A A;  3Q9V A;  1G6N A;  4V2F A;  2KIQ A;  1VTN C;  2RGV A;  4OMY A;  3CJT B;  2KJB A;  1Z91 A;  5F1J A;  1X1C A;  3BT9 A;  1SFX A;  3IH2 A;  3KP6 A;  1Y39 A;  4BY1 J;  5B1A H;  4P96 A;  5EEG A;  1T6S A;  5DYM A;  3W6V A;  4IQJ A;  4GGG A;  4IPA A;  3T5X A;  2QCO A;  2L01 A;  2CFO A;  5HDG A;  3CCR I;  3RKQ A;  2XF7 A;  2X6W A;  4BEH A;  4P9F A;  1TQI A;  2FJ1 A;  2NVQ J;  2CQK A;  2HQR A;  5C4J J;  5GAD J;  1OYY A;  3H92 A;  5D8L B;  4GYI A;  2W48 A;  5EG0 B;  1S6L A;  2HPI A;  3IKT A;  1SAX A;  4KA4 A;  4XKC A;  3QYE A;  4XNF A;  5F04 A;  1MJ9 A;  5F0H A;  3OIP A;  3RSN A;  3SXY A;  1I1S A;  2WA0 A;  3SQN A;  2HPM A;  2CQQ A;  4LFU A;  1MBH A;  5K1Y A;  3ZMZ A;  4RM2 A;  4I76 A;  3S16 J;  2EA4 A;  2BGC A;  4BDZ A;  3LWF A;  2EIJ H;  4R1H A;  1KQ0 A;  3N97 A;  2Y30 A;  2KMU A;  2F5E A;  2YX7 A;  4I02 A;  2KLO A;  1W36 C;  2F4I A;  4M3G A;  1R58 A;  3D5L A;  5GPA A;  2VBY A;  1YX5 A;  4LOC A;  4A5M A;  2BHZ A;  1MBE A;  3K2A A;  4BUP A;  1XGM A;  2MD5 A;  2IEK A;  4KYW A;  4KN7 X;  5LHI A;  2A6E F;  5IYC J;  1NHA A;  5HS8 A;  4PUS A;  4U0Y A;  4YEJ A;  2KT0 A;  2K3F A;  3JRC A;  3W2A A;  1ZG5 A;  1RUO A;  2ZKZ A;  5LHH A;  1IRG A;  4GYG A;  2HNH A;  5KAF C;  1H88 C;  3HPG A;  3JRI A;  4EQQ A;  3CCM I;  2JPC A;  1IRF A;  2STT A;  1F1Z A;  1WSU A;  2E60 A;  4A3E J;  1VQO I;  1VQK I;  3HC7 A;  4IHT A;  1VQN I;  3F9K A;  3ELK A;  4GCV A;  5J8C A;  3M1C A;  3KLN A;  1SVL A;  4ZYA A;  2FOW A;  3ABT A;  1ZRE A;  3IAS 2;  1UHM A;  2DYR H;  1IDZ A;  5H6R A;  3I58 A;  2FU4 A;  4HAM A;  3E6D A;  5DUK A;  2M5W A;  3E1S A;  4UB8 C;  2F5C A;  2XAG A;  1DUX C;  1FMV A;  2EZK A;  4KIG A;  2EIK H;  4N4O B;  4HSR A;  5CJ9 A;  4XOR A;  2O7O A;  1I39 A;  1YW8 A;  4Y15 A;  1B9M A;  2ZCW A;  3QQA A;  4YFX F;  2A5W A;  5B1B H;  4A0Z A;  5D6F A;  3B6C A;  1OIS A;  2VKD A;  2DU9 A;  4Q48 A;  1VQ9 I;  1TWG J;  3OY9 A;  2ZJR F;  6PAX A;  2A05 A;  5LGU A;  3JR9 A;  4A3D J;  4LB5 A;  1XX5 A;  1I1G A;  4XRS G;  4N9H A;  3W3C A;  4WXD A;  5HLI A;  2GM4 A;  5LGT A;  2CJJ A;  4NDL A;  4C9Y A;  1K79 A;  1JT0 A;  1Z21 A;  4NHJ A;  4AUX A;  2HDC A;  1O7F A;  1ETK A;  3F8C A;  3ZMU A;  1G59 A;  4HLX A;  2X6Y A;  2Y2Z A;  1YX3 A;  3ZMT A;  4EM1 A;  5KAI C;  2M3A A;  5K5R A;  3I59 A;  3HUG B;  2XKO A;  4PFP A;  4A2U A;  4CUG A;  2ZME B;  1Y8Q B;  4CO8 A;  1WI9 A;  2JVH A;  2OJE D;  3J7Z I;  1SD7 A;  2DOA A;  5H6Q A;  3VPR A;  2EH3 A;  3L7W A;  2M30 A;  3C2H A;  4IJA A;  5FGM A;  1ITY A;  4LB6 B;  4KIT B;  2LTP A;  1X58 A;  2Y0S A;  2D1H A;  3K4L A;  4RB0 A;  4XOP A;  2XPU A;  1DGW Y;  4LD5 A;  1DPR A;  1U9N A;  2XGE A;  2K4J A;  4BGD A;  5KCM A;  1L0O C;  2MFZ A;  4A69 C;  1XN7 A;  2PJP A;  3ZMV A;  4E7S A;  4NQW B;  5AON A;  2CUF A;  2ECB A;  1TQP A;  2CV2 A;  2R7X A;  5FFZ A;  1X3W B;  1FJL A;  4RB3 C;  2X0L A;  3FXR A;  1RUN A;  3H9Q A;  1I27 A;  3MWM A;  1MDM A;  3FMR A;  4II3 A;  2W7N A;  5DD4 A;  1IRX A;  2DLL A;  2GQQ A;  5F6F A;  1K83 J;  3AG1 H;  2W00 A;  3BP8 A;  4PJ0 C;  1B6A A;  3E6M A;  3WU2 C;  2X9D A;  3KP7 A;  3WTS C;  1PUF A;  2HQA A;  3G6E I;  1EH7 A;  3R0A A;  1MSF C;  2BE5 F;  3ECH A;  1RC9 A;  2E71 A;  4ITV A;  2D5V A;  1DPU A;  3QPH A;  5JVG F;  1V5F A;  2DT5 A;  1B9N A;  1YI2 I;  2MH2 A;  2XAF A;  1H0M A;  3L00 A;  4FX0 A;  2RDP A;  3MZY A;  2ISZ A;  2QEX I;  3CCS I;  5FLV A;  2R7O A;  5EJC A;  5L3G A;  3PIP F;  1T2K A;  4S05 A;  2OQG A;  4L9T A;  4M9Z A;  1WZ2 A;  2J5O A;  2XAJ A;  3ULQ B;  4UUS A;  3BC8 A;  4E7H A;  5EGO A;  2HYG D;  3VYS B;  3TDZ C;  2HTJ A;  4QIW N;  3BCA A;  3LA7 A;  2O5R A;  3BJO A;  3EPZ A;  3EQL F;  3HRT A;  4Q4Z F;  2IPQ X;  3J81 K;  4MLO A;  2DMT A;  4I0A A;  4PGG A;  3M4O J;  2EJR A;  4DQ2 A;  1LDJ A;  4MNU A;  5TRD A;  4HF2 A;  1E3O C;  2LKX A;  3K0L A;  4B3A A;  1WJA A;  1USS A;  1OFC X;  2H6B A;  2HVQ A;  2CV1 A;  2HI3 A;  2WAQ A;  2FX0 A;  1XGO A;  2KIU A;  3F6V A;  2ME6 A;  1XG1 A;  1IV6 A;  4EM0 B;  3TP0 A;  2O8X A;  4A6D A;  3PO3 J;  2VOO A;  3T0Y A;  3OSG A;  1XSX A;  2IVM A;  2JUG A;  4V2G A;  5M5Y J;  2LY1 A;  2IJL A;  3VYT B;  2QKL B;  3LST A;  3KEO A;  1K6Y A;  1TNT A;  4Y17 A;  2NVY J;  2W4S A;  5IY5 H;  2QKM B;  3AFH A;  2V7F A;  3ABM H;  3ZR8 X;  2HDD A;  2W82 A;  3JRG A;  3ABL H;  5E79 C;  2DMN A;  2FUG 2;  2DQL A;  3BTI A;  4QTR A;  3IV5 A;  1MSE C;  4LIU A;  2DMP A;  4BNC A;  3K4K A;  1FMW A;  3ZGK A;  3ZXS A;  2FBK A;  3Q5F A;  1FP2 A;  4ASN A;  1IXS B;  1UMQ A;  3TQN A;  2OF7 A;  5GAE J;  2EFN A;  4EMS A;  1TW2 A;  2MC3 A;  2M0M A;  4KMU X;  3IUO A;  4RAF A;  4NC7 A;  4PCQ A;  4IX7 A;  1D1B A;  1FPQ A;  1B4A A;  4AC0 A;  3TO6 A;  3CCL I;  1A6Q A;  3CF2 A;  1GV2 A;  3CO7 C;  2XC7 A;  3OYC A;  2Z9O A;  1RET A;  1QZE A;  1R4N B;  5F64 A;  2DFF A;  4RA2 A;  1ZHF A;  4ZDL A;  4OIR F;  2VKE A;  2RNG A;  4XON A;  3KLO A;  3MAJ A;  4E4H A;  1KA8 A;  4EEF G;  3TDU C;  3A03 A;  1MMS A;  2G0E A;  4OIP F;  2P5V A;  1WJE A;  4WCG A;  2VLA A;  3V8J A;  1MZB A;  3OYD A;  3E6C C;  2EIM H;  1JKP C;  1OPC A;  1BI3 A;  2QZ8 A;  5IP6 A;  4HZF A;  1LVK A;  2CG4 A;  5D4S A;  4CCO A;  2LH9 A;  5LRR A;  2DOD A;  2QUF A;  3O8G A;  2P5L C;  3EYI A;  5M5X J;  2VKH A;  5DTD A;  1HLV A;  4U7D A;  1LFB A;  2BW3 B;  3EYY A;  2KDZ A;  1TWC J;  1WPK A;  2R5Y B;  5DM6 F;  4G7Z F;  4E7Z A;  4BJ6 C;  2E5N A;  4UNO A;  1YOV B;  3CME I;  4MIM A;  2LD5 A;  1FOK A;  2M7B A;  2PI0 A;  2OUM A;  2OCE A;  2DA1 A;  1ZGA A;  3MN2 A;  2R93 J;  2BVM A;  3DFG A;  5L3D A;  3WTT C;  1R49 A;  3U2R A;  4M3E A;  4I2O A;  4BXX J;  1X3Z B;  3HXL A;  3FXL A;  1JGS A;  5IOY A;  3AG2 H;  5ILS A;  1BM9 A;  3ZMS A;  2F5F A;  3BWG A;  3RCO A;  1CF7 B;  4EAT A;  1ZLK A;  2F4M B;  3HSE A;  3V7C A;  5B66 C;  3S15 J;  3BRO A;  3HPH A;  2MYS A;  1FX7 A;  2PMZ A;  4KIS A;  2LBF B;  3I56 I;  2V1X A;  3K7A J;  3QOD A;  1RR8 C;  4L18 B;  3I53 A;  5J6X A;  3OL3 A;  2V6C A;  3LL7 A;  1YJN I;  2D2W A;  1JTX A;  2WB1 A;  3SYT A;  1YIO A;  4S0H B;  4WWC A;  1PVE A;  2COM A;  3H5R A;  4XLC A;  3DKX A;  4AIH A;  4B43 A;  3N05 A;  4D1Q A;  1NTC A;  2K02 A;  3ABU A;  2YS9 A;  5BMZ A;  2HXO A;  4M3D A;  3UR3 C;  1GXQ A;  5DUI A;  3OYI A;  4E7I A;  1J0R A;  2R3S A;  3M1E A;  3DXJ F;  3PO2 J;  1O3R A;  2A6T A;  1RKT A;  1XCV A;  1VFC A;  4IVN A;  2CWE A;  2CW8 A;  2Z99 A;  3K69 A;  3DTI A;  2DA5 A;  3IHU A;  2G7H A;  3S93 A;  1ZGJ A;  4R79 A;  3HTU A;  3U9G A;  1N77 A;  1HKS A;  3OWT A;  3VYU B;  1VQL I;  3ZOB A;  3ZQH A;  5AIP A;  3HGY A;  4RGR A;  2WC2 A;  1QZZ A;  1XTA A;  3ASN H;  2CSO A;  5K5Q A;  2DA7 A;  3L2Q A;  1KU7 A;  2F2E A;  5L3F A;  5BS6 A;  2QQ8 A;  2ZJ2 A;  2ZB9 A;  1FY7 A;  4IZZ A;  1YW9 A;  1AHD P;  3FXU A;  4JQF A;  2RNJ A;  3VSL A;  4DW6 A;  4HF1 A;  2PJR A;  1OLT A;  1P4X A;  4ESB A;  2R7T A;  1H8A C;  3MKL A;  3CDI A;  3M9A A;  2BY2 A;  3QOE A;  4W97 A;  3LAJ A;  3FMQ A;  2IS1 A;  1O7L A;  2XDV A;  4ZYH A;  1PP7 U;  1VQP I;  1D8J A;  3TOA A;  3B73 A;  1ENH A;  5JLW A;  3LSM A;  5J4Y A;  2EV0 A;  3TGN A;  1Z05 A;  2TCT A;  2X48 A;  3VYR B;  2LSO A;  1BN5 A;  4G6Q A;  5IP9 J;  4LK1 F;  3DLL F;  5HLG A;  1UCR A;  3H3Z A;  3JCU C;  3RPU D;  3NAU A;  4LMY A;  2HYJ A;  4DNC A;  5JVT A;  1RRJ A;  5TJJ A;  3BZ6 A;  3P9K A;  4A93 J;  3OIQ A;  1HW5 A;  4IRI A;  1O3Q A;  2Q0O A;  4I6Z A;  2E1O A;  3WTX C;  5HDN A;  2FBI A;  4A3F J;  1B8I A;  2VOP A;  1X1D A;  3A4C A;  3F22 A;  1ON1 A;  1Y6I A;  4B8X A;  2DK5 A;  1DDN A; 
#chains in the Genus database with same CATH homology
 2DOF A;  2L9V A;  1UZC A;  2K85 A;  2KIQ A;  2CQN A;  2E71 A;  2DOD A;  4FQG A;  2KIS A;  2JUC A;  2KFD A;  2KZG A;  2LKS A;  2B7E A;  2DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...