2CQNA

Solution structure of the ff domain of human formin-binding protein 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Formin-binding protein 3
publication title Solution structure of the FF domain of human Formin-binding protein 3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2cqnA00
1UZCA 2KFDA 2L9VA 2KISA 2LKSA 2K85A 2DOFA 2KZGA 2DODA 2B7EA 4FQGA 2JUCA 2DOEA 2E71A 2KIQA 2CQNA
chains in the Genus database with same CATH superfamily
1VQOI 3N97A 2HPMA 3BROA 3F8BA 4RAFA 1R00A 2KMUA 1QHGA 2CS3A 4Y3OA 4EGZA 5J8CA 3MQ0A 4IHTA 2V9PA 5GTHC 1IRFA 4R79A 2VJIA 4QIWN 1JHHA 2DJNA 2D45A 4XLCA 2ID6A 4DGWB 4X0GA 4I0AA 2ADUA 2JA8J 2ISYA 2KZGA 3ZRGA 4UB8C 4N4NB 1GV2A 4EM1A 3CD6I 3ZQHA 3RYPA 3L2QA 5LHIA 2WV1A 5L3EA 1I3QJ 4QSHA 3GTQJ 5K1YA 2A6TA 1LUJB 2MSYA 4XQFA 2LR8A 2W24A 3F23A 3FMRA 3BZCA 5H6RA 2K27A 2L4MA 1PUFB 1E2XA 2L0KA 2DK5A 5CQEA 3RQIA 4XLEA 3TKYA 5HOOA 3GZ5A 2ZSIB 2KRFA 5HS8A 3LNQA 1S9HA 3JRFA 4FHTA 5TISC 4MFDA 2VN2A 4CCNA 3ZMTA 4R8HA 2XGCA 1FOYA 3CMAI 1IN5A 3CO6C 3GCMA 2CV2A 1I1GA 3RQ4A 3KP7A 1WQ2A 3V7RA 2FF4A 3BTIA 1FLIA 2V4JC 5M5WJ 2ZMEA 3EUHA 3OY9A 1LNWA 3G1LA 1RESA 1F9NA 4M3BA 1W7PA 3GFIA 2J5PA 2H6BA 2HWVA 3L2WA 1OCCH 1RPWA 1P2FA 1LFBA 4FE4A 4A5NA 3FDYA 4HPQA 5GTIC 4HLYA 3QU6A 1X1BA 1N25A 3I54A 3KE2A 2VXZA 2F5EA 4C3IJ 3A03A 2JA5J 1KU3A 1E3HA 3HSRA 4XKBA 4ESBA 1L0OC 3G71I 4ZDPA 2O5RA 2AQFA 4KIGA 3H5AA 3S2HJ 1BW6A 1I5ZA 1ZG5A 4HNTA 2KPMA 3I64A 1S6LA 2O61A 3I56I 2Y9YA 4FTHA 5D5WB 3KZIC 2HR3A 2EV0A 2ZXJA 3ASNH 2M87A 3JTGA 3WU0A 1NG7A 2Y9ZA 2NVQJ 2MLKA 5HNHA 2JWTA 1PJRA 1ZTRA 4RA2A 2MG4A 1HA8A 3K7AJ 5F6FA 3I5UA 3NARA 3ZMSA 3LSPA 3J81Z 1JXSA 1YG2A 3S1MJ 2EIKH 3Q9SA 4D5CA 3OYHA 2PJRB 2KJBA 3LSMA 5IP6A 3KEYA 2PJPA 2CH0A 3EQLF 5B1AH 2LSOA 2BOLA 1X19A 1OFCX 3CUQB 3ROUA 2L9NA 2BBYA 1R1VA 4CYDA 4MGRA 1NH3A 1LVKA 3IAM2 1IN6A 1XSXA 3FF5A 1JGGA 3K4LA 4P9UA 3AG3H 2EFPA 2B9SA 4MTDA 2DJIA 4YEJA 1A5JA 2L2OA 5K7FA 2DDAA 3BQZA 2ECBA 3GWZA 2C6YA 3TP0A 4G94A 2D5VA 4JX6A 2EV5A 1N75A 1TNSA 4MLOA 4CCJA 3OYFA 5AIQA 1NK3P 5DD8A 1ETOA 2L7MP 3GZNB 3WTVC 2EFQA 3OWTA 3GTKJ 3DLLF 1TQIA 1IN4A 2RKHA 3U9GA 4P96A 1TC3C 5BQTA 2W4SA 2K9NA 3DPTA 5IT9Z 2W85A 3LOCA 1ON2A 3S14J 1I6HJ 4AU7A 4MFEA 5EEHA 4BUPA 4X1EA 3HOTA 4OAZA 2WTEA 1GLNA 2G9WA 2QBYA 2EINH 2Y0SA 2JQ7A 2F5VA 4JK1X 3JSOA 5GAHJ 1U0JA 4HSTA 4UVBA 4BJ5C 4XORA 1UJ8A 3U1KA 3OSFA 2O03A 2WWYA 5K5QA 4IPAA 3AG1H 1P9QC 4M3GA 5FLXK 5EF6A 2X1EA 4PGHA 1SANA 1B9MA 4RBOA 5IYDJ 3PFYA 1EF4A 2EQRA 4W1UA 1LFUP 2DDBA 1ONVA 3L9FA 1TLHB 3P7NA 4G7ZF 5B66C 1VTNC 4TV7A 1FNNA 2QEXI 1U8BA 4A0YA 4A12A 1CF7B 2ZFWA 2DPDA 3VYTB 2KFDA 2I8DA 5M5XJ 2WADA 2HOSA 3F6VA 1S3JA 1BJAA 3OIQA 2NOGA 4RMNA 1IC8A 3BR6A 1EKEA 4DW6A 4KICA 3SDGA 3CCSI 2EB7A 5A2QK 2FBKA 3H1CA 3RPUA 1YRNA 3CUOA 5DUKA 2OPTA 4L9TA 3QP5A 2CV1A 3BG3A 1MNEA 4IRIA 3FBIB 5E79C 1HC8A 2E1MB 1J2XA 2BEOA 2V6CA 3BG5A 5FKNA 4DYQA 4UUVA 3VYRB 1A6QA 1ENHA 1ZN2A 4NB5A 3SEZA 4M72A 5BOXA 1AKHB 5J4YA 3GX4X 2VE9A 4NHJA 4ANJA 3HPHA 4OMYA 1WJAA 4I7HA 3LSIA 2CMPA 4AC0A 4GDFA 2H27A 1MBGA 5FB2A 2CUZA 3K9TA 2RC4A 2VJ4A 2ISZA 3LSRA 3PJRA 4LJZF 4L5JA 2LREA 2YUSA 5KAFC 5L3BA 1RNLA 2VXDA 2E36A 3CDHA 1HKTA 2E5NA 3C1DA 3OS1A 3CLQA 2HKOA 2X1DA 1OJLA 1BIAA 4BE0A 5DYMA 2XAHA 3VOEA 5ICFA 2H8WA 4PDKA 3GFJA 2ZJQF 2FOWA 3IHUA 4IHYA 1ZELA 3TP3A 3OYIA 4XR6A 4UUTA 1XGSA 1ETVA 1ITYA 3CCMI 3A1YA 4O5VA 4PZJA 2WV0A 2VLAA 2VONA 1IO2A 1T33A 1IXCA 2L54A 3J80K 5E20A 5ED4A 2WA0A 3C2GA 3SZGA 2Y30A 3TO6A 3DEWA 2IPQX 1WPKA 3QPTA 1Y6IA 4P55A 4ZYDA 1Z77A 3VSLA 2DQLA 3TO9A 3ZN0A 2X6XA 2KJCA 4L5IA 3V8KA 3MAJA 3E5XA 3O6BB 1MJBA 4EV0A 2LKPA 1KU2A 2QQBA 3I58A 5K7ZA 3W3CA 3H9GA 2L02A 4LIUA 2GM4A 2L7FP 2NVTJ 4M9SA 4LLNA 1JHFA 4II2A 3SZPA 4D5FA 4RGRA 3BPXA 4OMZA 4A3KJ 2BZTA 3TL4X 3FK7A 5F0HA 4L5EA 4B43A 2L5QA 3KYLA 1FT9A 4CCMA 1UMQA 3C2HA 1IAWA 4BE1A 5CVRA 1X2NA 4DBRA 2LF7A 3DWLE 2AO9A 1P4AA 3DTIA 4NQWA 4CYCA 3RTRA 2QVOA 1V5EA 1R1TA 2DTRA 3WGHA 2A5YB 3B02A 2Y48A 1P6RA 4NUBA 2OV7A 4KDPA 2A3SA 2MA3A 3CDLA 1Z1DA 2LOOA 3HHHA 1WHUA 1J75A 2F5DA 2IGOA 2E1NA 3GBGA 4M71A 1ZG3A 3LA3A 4PJMA 5FJ8J 3BCBA 5M3MJ 1C0WA 4HX8A 2FNPA 2XUBA 4B8XA 3MFKA 3WHCA 2EV6A 4ZH4F 4IZZA 4E7IA 3BG7A 4BHPA 2GBYA 2GOMA 1KQ9A 1BI2A 2JA6J 4YIFA 2IBDA 3CJTB 2R93J 3R4KA 3K1MA 3LSTA 2OBPA 4A6EA 1UAAA 1K78A 3HOXJ 2X6YA 3CC2I 5FRMA 2EIJH 1G3SA 2H8RA 1SD5A 2VBYA 3LSGA 5GADJ 1RR7A 1K79A 1R36A 2O0YA 2VC0A 2ME6A 2P7CB 4KT6A 4FISA 2X48A 3P5JA 1KA8A 5DM6F 3IWFA 1SAUA 5L3DA 3QAHA 1DQUA 2FMLA 1GUUA 2VT2A 2OAZA 3LWFA 3OYCA 1Y0UA 1X1AA 1J9IA 5HDKA 2QZ8A 5DDGA 1OCTC 1RIOH 5B3SH 3SYTA 4RGUA 4GXOA 5DS9A 4XLFA 4ZZLA 1GDTA 2GWRA 3QYFA 2DLLA 3J81K 1IDZA 2DYRH 2W1OA 3ABUA 4XLAA 1G3YA 5GPCA 4A3LJ 4C30A 1BOAA 4UUSB 2GIVA 1U6GA 2HQRA 3L2UA 5LGTA 3DKYA 2XC7A 1FTTA 5H20A 1QGPA 3QPSA 3DXJF 3K1NA 2YU3A 3RJPA 2E2HJ 2WAEA 3G1MA 4I99C 2DMPA 2FMYA 2BXZA 3DTEA 1X2MA 4KA4A 2ZJ2A 2QA4I 5GAEJ 2EA2A 1SMYF 4GFBA 4RDUA 1ZRCA 4GGGA 3HRMA 2LTPA 1RKTA 3DEEA 3LFKA 3L2CA 3PUBA 1O3QA 3ABLH 1RI7A 3QYEA 1Z6RA 4B09A 2VUMJ 3CCEI 4LFUA 3Q3SA 3MKZA 5J1RA 4A5MA 3HRUA 3FK6A 3GVAA 3I4MJ 3HBLA 3CQZJ 5E8IA 3FKIJ 1DGWY 3NWTA 2E7WA 2AS5F 3S93A 4MEXF 3PNVA 1F1ZA 4BBSJ 5FKLA 3T1BA 4EJOA 2QQAA 3A0HC 1X1PA 2EK5A 1O3RA 1JT0A 4I02A 5LRRA 1LFPA 1E17A 1BBYA 1YITI 2Z99A 1UHWA 2CUJA 4G9YA 1ZK8A 2OZ6A 3F22A 4BYYA 4C2UA 5K5RA 4MNUA 2XGDA 1IDYA 5E3LA 3K4CA 2H6CA 1STZA 1S7AA 2F5CA 1HDPA 1Z7LA 2V1DA 2LMDA 4KMFA 1VQ6I 2O7OA 1XCBA 1NTCA 2PLYA 2B7EA 4MTEA 4XKWA 3F6OA 4Y4RA 2HYGD 2P8TA 1KONA 3AL0B 1QZZA 1GVJA 4BY7J 3RCOA 2EBIA 4MEYF 3JREA 2A6EF 2LD5A 1IJWC 1MMAA 3QOEA 2QKMB 2KDOA 5DCFA 3GLXA 2UWMA 2P81A 4CICA 3KLNA 4Z2YA 2HZTA 5EG0B 4PJNA 2GAUA 2RAEA 4HOBA 2FQ4A 4A0XA 3TMOA 5HDGA 2XKOA 1QQIA 4CGZA 5ILUA 1K4SA 4A3JJ 1ULYA 2M4GA 2V9KA 4M6YA 5M5YJ 4A93J 3K6GA 1FWZA 1N78A 4CH7A 4AUXA 2ZMEC 3HG9A 1HKSA 4XRMA 4E7LA 3IRRA 2R5ZA 4U7DA 1HOMA 4PCQA 2XAFA 4WCGA 2QKLB 3COAC 2PJRA 2JPBA 1W1WE 1A35A 1XGOA 1ZGWA 2B63J 2IJLA 5DV5A 2OJED 5EZGA 1OPCA 1FMVA 1MBHA 3CUQA 2E5ZA 1JGSA 2KIFA 2FEZA 2FOKA 2Z1DA 3VFZA 3HSFA 3HIFA 4CCOA 2BHZA 2F48A 2IRFG 4XMYA 1RR8C 1XSVA 1YW7A 5LLQA 4WXDA 3HTUA 4J01A 3FXJA 3RKXA 1D0ZA 2Q2EB 2LP0A 4KT5C 2E1OA 3GLLA 4BDYA 1Z05A 4PGGA 3PFIA 3FHZA 1K61A 1K6OA 1J7KA 2J5OA 1Y0NA 3KP5A 2VPLA 3DP7A 3OS0A 2JRTA 3AFHA 2EFNA 4UY8I 4IXAA 1KGSA 2BHYA 2M0MA 1OQYA 1JJ6C 4FE7A 2EZKA 4ZC3A 3BR0A 1U8RA 5CLSA 3E5QA 1QRYA 3FWEA 3H9QA 1TNTA 4IF4A 4BACA 5LBQA 5LHHA 4KITB 4BXFA 5E3MA 3JRAA 1ETWA 4BQQA 4XN0A 5DM7F 1KU9A 2Z33A 1HBXG 2YU9J 1DUXC 4CHUA 2CQ7A 1WFXA 1H8AC 1XC5A 4QPOA 2W84A 1V54H 2DCEA 1U5TA 2PG4A 3NRVA 5ICGA 3E1SA 3LA7A 5JR3A 2EZHA 2QSHX 2IAIA 3AG4H 3F9KA 1JE8A 1L3LA 2VKDA 3I3LA 4GRIA 3ZMUA 4B3AA 2P5LC 1XMKA 5HLTA 1SFXA 1TW3A 1PUEE 2G7UA 1IRGA 1YS7A 3JRBA 1IRXA 2NOJB 4I09A 3NEUA 5KAIC 2DQRA 1D1AA 2HZDA 5K5OA 1FOXA 4E7HA 2F2EA 5F27A 4D7MA 2GXBA 3KEQA 1UCRA 4G12A 1CF7A 3REOA 3M7GA 1R9TJ 1A6IA 2MBFA 2IEKA 3GUDA 5HLHA 4B3XA 3K69A 2PQ8A 4B1RA 2EZLA 4ZDOA 3LSKA 3K1PA 2N8GA 3IC7A 5DEQA 4KISA 2QSGX 1UHSA 1VQPI 1D1CA 4P9FA 2R7UA 3VODA 3ZPLA 2DMUA 2A61A 1A31A 3ZMZA 2P6SA 1Y1VJ 4XLHA 1F4KA 4ZDLA 1VQNI 2EPFA 3C18A 5D5XB 2G7HA 2OU2A 1FYLA 1G6NA 1AKHA 1G3WA 2YX7A 3SHFA 4Q48A 4G7OF 4NC7A 1B8IA 1KU7A 2LG4A 4XLPF 1VQ5I 3RYRA 3C2BA 3RPUD 5FD6A 3CC7I 1R7JA 2DW4A 1X3UA 3PNTA 3D5RC 3MZHA 3SJMA 3BCAA 2HDDA 2PMUA 2CQKA 1VQ7I 3GTPJ 2B0LA 2E2JJ 2H1LA 3T8RA 3ECOA 4M9XA 1WJ5A 2DO7A 2X6WA 3KPHA 2HOAA 4PJJA 4RB0A 1T38A 1FBSA 3CCQI 4Y13A 1YJNI 2LRDA 1XN7A 2HS5A 2MGQA 2EA4A 3K2AA 1S7OA 3BR3A 3OYKA 1B6AA 1VQ8I 3RPQA 3A02A 4IX7A 1V3FA 4AD9A 2GOXB 4XRFA 4IOCF 2IS4A 3S1QJ 5C3EJ 1IV8A 1OCRH 2DA6A 5IP7J 2KIUA 3E6MA 1VFCA 4V2FA 2X1CA 5KHDA 1BR1A 5IT3A 1Y39A 4HW0A 2CV0A 4U88A 4NDLA 3U1DA 1GT0C 5BNGA 4ENKA 2MH9A 3HTSB 4A3GJ 3A0BC 1D1BA 5HDNA 4AM3A 4FETA 3FMQA 3CJQB 2VC1A 5DD4A 2ZXHA 4ZJZA 4G7HF 3HM5A 1R4MB 3QRFF 3DKWA 1T95A 3KEOA 3G4SI 2KKOA 3H5RA 5B5EC 1BIBA 4N0BA 2VBZA 1P7JA 4A3BJ 1J09A 4LITA 2ZSHB 3K4MA 5K7HA 2W48A 2R5YB 2Z5UA 1ZQ3P 1ZR2A 2UUZA 1XMAA 1E3OC 3DQVC 3CZ6A 3I71A 2OTLI 1IRZA 3CCUI 4F55A 4OIOF 1MIJA 2ZXWH 3LFUA 4QLCU 4G6TB 5JFRA 1FC3A 2W57A 4YFKF 4QWQA 4LK0F 3CDIA 1Z9CA 3IL2A 2BXYA 3GEZA 2EFWA 2IW5A 3FXQA 1ACIA 1XGMA 3H35A 4CCKA 3BP8A 3LAPA 2PI0A 3F0CA 4D7NA 1FOKA 3HOSA 4MQVA 3JRHA 2M5WA 4BBRJ 2FBIA 2HYFA 3QQAA 4U0WA 3DKXA 5E18F 1RRJA 2CU7A 1YHQI 1GVDA 3TDUC 4CO8A 1RETA 3HOZJ 5FD5A 1LEBA 1GV5A 1MZBA 2ETHA 2UXXA 4ETSA 2OF7A 4YIRX 2XPVA 3S1RJ 1ETKA 1YX3A 2O3FA 4Z6YA 2XF7A 2E19A 3WG7H 4MHGA 5DCMB 1USTA 2A6HF 3FX3A 4AIKA 2VJJA 2RNJA 5AONA 4LG0B 2Q1ZB 3GO5A 1I50J 4XOTA 2E35A 1QU3A 5LD2C 4LLLA 3FM3A 1VQ9I 2PX9A 3EETA 4NNJA 1X4PA 1T39A 1ZRFA 4R1HA 4XK4A 4DYRA 3FXRA 2LBFB 5LGUA 1JI8A 2DA7A 2RQPA 1LVAA 3OL3A 4F3QA 4A3MJ 3EYIA 3PQKA 4RAYA 4B4CA 2XDVA 1JKPC 1QZYA 5H2FC 3S1NJ 2K7LA 3MWMA 2JA7J 2VOOA 4DIQA 4BXUA 3CLOA 4L9NA 2WY8Q 4XLNF 1B9NA 2Z2SB 4GYGA 3IKTA 2TRTA 2KRHA 2P0WA 3ABKH 2GA2A 3R0AA 4A3CJ 3FMSA 4UUSA 1MDMA 3BDDA 2OZUA 2IS1A 4E70A 5HODA 3E0JB 4DQ2A 1MNMC 2HXIA 1Q1HA 3E6CC 2LKSA 2OCEA 2QQ9A 2EH3A 1TL8A 1T8IA 2NS8A 2YPRA 3ZMVA 3BTJA 2BGCA 3I9V2 4A2UA 4AWXB 1DPRA 4IRHA 5FLMJ 3E97A 4N4OB 4BH9A 1YS6A 2CW8A 5EEAA 2DA5A 2FU4A 1YLFA 3RZOJ 3G2BA 5J1UA 4KUMA 3V4GA 3M4OJ 1MH4A 3S16J 4XRSA 4H0EA 2M1BA 4E7KA 2O8XA 1H9GA 2FJ1A 2GQQA 4EJVA 1ZREA 3K4JA 4OIRF 2NNYA 2DU9A 4H4KC 1PP7U 2RREA 5D6EA 4EM2A 4A6DA 4F92B 3ONQA 2Z3YA 3BR2A 4HA8A 4M3FA 2FQ3A 4P1WA 5J40A 1XTAA 3CC4I 1DDNA 1WCMJ 3A01B 3KYDB 4A0ZA 4XSXF 3IAS2 3D5SC 2KP6A 2R7TA 4UB6C 2R7OA 2I5UA 4HDUA 2W00A 1R6RA 4U0VA 2ZMEB 2DK8A 5FFZA 5BMZA 3DFGA 1SFKA 4HF0A 1G4DA 1ZAOA 3FBNB 4N9IA 1OYWA 4PJLA 1UELB 5D8LB 2BY3A 4NC8A 1ERDA 3K4BA 4D1QA 3HGGA 1DPUA 4M3DA 4DNCA 3FKJA 3CCVI 5CQGA 1P92A 2DMNA 1DU0A 4BKXA 4KNYA 2PMZN 5J6XA 1T2KA 1MNDA 1VNDA 3KYCB 2HFHA 2RGVA 3M1EA 2X51A 4BQNA 1HSJA 1HXDA 3BG6A 4BDZA 3N05A 2JJ7A 2RDPA 5CVJA 2Y31A 2ESHA 5EG0A 4EGYA 2QQ8A 1WH7A 2DAOA 3HHGA 1JUPA 1VQMI 2UZKA 5IYCJ 4IQ4A 3CCJI 3Q0VA 3MKYB 2V79A 5IP9J 2NS7A 1I3AA 5CVUA 4FT8A 1SVOA 4GCVA 3HUGA 5F08A 4CA0A 4MQ9F 4V2GA 3PUFA 3M8FA 3OS2A 3JW4A 3SQNA 2LK2A 2XHKA 3GF2A 3ABTA 1JKRC 1Y8QB 5CVVA 3VB2A 2ME0A 3O8GA 1FSHA 3SXYA 2R7ZJ 4WF2A 5F04A 2V9VA 1N77A 1LDKB 3MEXA 3JRIA 3S2DJ 5EGOA 1ZH5A 1HW5A 2M8EA 5C44J 1G2HA 1E3PA 1HW2A 3HKZN 3K4KA 1KQ8A 5FFXA 2R92J 2KZVA 3ZN1A 2Q2EA 1MJAA 1I39A 4OIPF 3WHBA 4DJAA 4Y52J 2BVMA 3J7ZI 2VQLA 2DODA 2IA0A 3RZDJ 4L9VA 5FLVA 2LH9A 3KLOA 3DLAA 3HJEA 3GW2A 3ZQ7A 2L7KA 1OCZH 3M07A 2DMQA 1FSEA 2W25A 3I59B 2DFHA 2EWNA 1OCPA 2KLOA 3M3YJ 3FXLA 1BJZA 2XVCA 3VEPA 1VZ0A 4A3EJ 2XB0X 3FHNA 3LQQA 4L0YB 3O2PE 1BL0A 4LG3A 3ESWB 4PUSA 1D8JA 1LDJA 3CF2A 3BG9A 2K9MA 1G59A 3VPRA 4GO1A 4KFCA 2ZO4A 3ZR8X 3WGIA 1LKXA 4C2TA 3G1OA 2RNGA 2OD5A 2EILH 3BOQA 1YIJI 1SD7A 4II3A 1B72B 3S8PA 1A04A 4A3IJ 3I4PA 3O8HA 2VOPA 2BVLA 2R0QC 2EZIA 3BT9A 2ID3A 1XGNA 1MBKA 5TGTA 2HU9A 3OYLA 1R4NB 2V1UA 2AXTC 5E3NA 5J8FA 1RKWA 3D0SA 1OCOH 3OV8A 2OCCH 1K7AA 1BW5A 2M7BA 5J4VA 5LRSA 1ETXA 3BLYA 3OYNA 1LE8B 4LGWA 1SC7A 3ERMA 3C7JA 3WODF 2Z16A 5DUIA 3ZOBA 1Y8RB 4E6KG 4KIBA 2K3PA 1YYVA 5JLXA 2LFBA 1G8XA 1HQCA 5IYBJ 1PUFA 3OYMA 4YIIA 2ZFUA 1T0FA 2PEXA 2M4KA 3HL2A 3QPLA 2VQGA 1U5TC 4ZTFA 3SFZA 4HX4A 1WJDA 3HGYA 3J7AY 2DPUA 1U9NA 2DT5A 2CQXA 1DU6A 1VQKI 2R7VA 2DXIA 5IT9K 4G8XA 4S04A 5KVRA 1Z67A 2XV4S 3Q0UA 4DBQA 2Y0MA 3ZQGA 5GP9A 2JRMA 2VASA 2GZWA 4ON0A 3SEQA 2F6CA 2K3FA 3DEUA 2LDUA 4XKVA 3H3ZA 2CW7A 1MBEA 3E5UA 2XSJC 3FM5A 2KHMA 3P9CA 3PIOF 3G6EI 3V42A 1CQTA 3GTOJ 2XAGA 4OIQF 4RS8A 1VQ4I 5ICEA 3JRCA 4ENMA 1OMIA 1WWXA 1WJEA 2CFXA 4ITVA 4M9ZA 5HS9A 3WG9A 3G73A 2KL4A 2MYSA 2M9HA 2CGPA 1KYWA 4FCYA 4Y7NJ 2CYYA 3DPUA 3OL4A 3GTMJ 1DP3A 3Q0WA 5L3GA 1ORKA 1W7PD 4DYCA 2W7NA 1HKQA 1MBFA 4U0YA 4JX5A 3RKQA 2ECCA 1AU7A 3W2VA 5TJJA 3ZP5A 5F1RA 5BS6A 1ZGAA 3FISA 1FYMA 3B6CA 2KISA 2O9LA 2NS0A 2K9SA 4B47A 3TO7A 1HCRA 4GYIA 3E7LA 3GYHX 4F93B 2PMHA 3T0YA 2FXAA 3EUHC 5FLXZ 4K2EA 9ANTA 1TQPA 4BJTA 1H9TA 2HVRA 1A36A 1T56A 3S2WA 4E7ZA 3WTWC 2HOEA 4QTRA 4BEHB 3W6KB 2RVCA 4IEJA 3ULQB 2CJJA 1QNTA 1F43A 4IQJA 3CP8A 2PMZA 4XKCA 1NHAA 3F3XA 3TBIA 1VF9A 1W36D 1O7FA 2ZKZA 4RLFA 3I0TA 3KCCA 2R5YA 1FY7A 2JUGA 1PYVA 1FZPB 4WWCA 1AOYA 4MIMA 5JVTA 3JRDA 1QZEA 3GFMA 1X1CA 1IN8A 2K4JA 3CF5F 5EJCA 4A69C 1SFUA 3KP6A 3V8LA 5J1YA 2FRHA 2MC4A 2LVSA 2K5CA 1P4XA 1EH8A 5CPRB 5E1WA 3VSKA 5A2QZ 2XSDC 2R7WA 1AWCA 4HSRA 3QP6A 4NQWB 2Y69H 2FBHA 1OR7A 2BY0A 4ZYAA 2BW3B 3V7SA 1W36C 3GFLA 2XRLA 4I6ZA 3JRGA 1EH6A 3QYBA 2DOEA 1D8KA 4EM0B 1YTYA 3BR5A 4FASD 3OIOA 3L1PA 1NK2P 3WU1B 2VBWA 3K2ZA 2AHQA 4ZYHA 2HTSA 5KCMA 4EVIA 3UNGC 3JR9A 3TW7A 3F8CA 1SAXA 3F72A 4UHTA 2XROA 2BY2A 2JVGA 2ACJA 5BPIA 4OINF 3S3MA 1I6XA 3MKLA 3WTXC 3HKZA 3TEDA 4Q5SF 4IVNA 1XCVA 1K78B 2NVXJ 1TWFJ 1WVRA 3JAMZ 3QU3A 3IH2A 3M9AA 4KN4X 5BPDA 1T08B 5HVQC 3H3UA 4PSXA 4KJZA 4W97A 1RUOA 3ZQQA 3GTLJ 2QYOA 3L2RA 3BTLA 4OOIA 1XG1A 2XGXA 4FQGA 3KP2A 5FRNA 2OQRA 3PM1A 3LSJA 1NG6A 4YELA 2LNBA 2PBIA 1XX5A 2L01A 2E7XA 5EEGA 3J80Z 1IG7A 1V4RA 4LB5A 2X85A 4PK4A 1ZLJA 2GA1A 3QODA 2HEOA 2DA2A 3M1CA 2AQEA 1JTYA 3R61A 1OLTA 1ZLKA 1VI0A 1WRJA 2DTZA 2YR2A 4QPQA 4XM3A 4CSWA 1Y56A 3H0DA 2HPIA 1ZRDA 4ENNA 1IGNA 2IA2A 1SVLA 4D9JA 1MJ9A 2QWWA 3QWLA 2BE5F 1R71A 2VQHA 4CZCA 3TW6A 5D4RA 3L7WA 2D2WA 3AKZA 1JUSA 2WAQN 4UXNA 2WC2A 5LFAA 2P5VA 3OSGA 4EQQA 3W2AA 2WY7Q 3MMYB 5D8KB 1BR2A 3NQOA 4AIHA 1SMTA 3VWBA 1FIAA 3HC7A 3I4NJ 2X6OA 4XN3A 2M2EA 1KYZA 2L9SA 2QCOA 1XS9A 1LB2A 3DTKA 2JSCA 1ZYRF 4LMYA 3RKWA 3VYSB 1LPQA 1U3EM 1X3WB 4I2OA 1OKRA 3NWSA 4DZJA 1DGRM 4UV9A 4YFXF 4S05A 3A01A 4LOCA 3HEFA 3WGGA 3IUOA 3CCRI 2DN0A 1Z91A 1FX7A 3MVPA 4IJAA 1UHMA 2MD5A 2O6GE 1ON1A 3BY6A 1W5CC 3PL8A 1XB4A 1WJBA 4AIJA 1YX5A 6PAXA 2JTVA 5HNFA 2QSFX 1R58A 5GPAA 3TQNA 4BAYA 2VL8A 4PSWA 1TW2A 3EDPA 3PO3J 2DA1A 2ZNZA 3ZQFA 2DMTA 2XASA 1WGXA 3E3VA 3X2QH 3C3WA 2WB1N 1JT6A 2AXLA 2P4WA 2ZBKA 3ECHA 2A5WA 2JSPA 3S17J 2JMWA 3GMEA 1R22A 1Z0XA 4HV6A 4I98B 4HV5A 4AYBN 2F4OB 1D3YA 2E60A 2STWA 2HXOA 4PFPA 4I0BA 1FTZA 1SFOJ 1GXQA 2KRCA 4XSZF 4C3JJ 3CJNA 2JVHA 3D5LA 1E0EA 3EYYA 2MABA 5HS7A 2XKPA 5FGMA 3TOAA 1O3TA 2QF7A 5IPAA 3S3NA 3CCLI 2VI6A 1ETYA 1QO0D 3E6DA 2EIMH 4B48A 5J47A 4BU2A 1W0UA 2TDXA 4JBAA 3CO7C 3I53A 5E8GA 4RM2A 3UKGA 2LY2A 4N9HA 2KIMA 2WBMA 4ESJA 1SFEA 3IH4A 5FKMA 4UNOA 3WTSC 2R5ZB 4XBFA 1HSTA 2LY1A 1V5GA 1VQLI 2HTJA 4M6XA 1W4MA 2FNAA 1RZ4A 5EDNA 2VT3A 5AIPA 1WZ2A 5FROA 4WX9A 2JN6A 3AL0C 1D5VA 1MW7A 2L3DA 3PO2J 2P5KA 3TOBA 3TDZC 2DOFA 5CJ9A 4HF1A 2COBA 3H0GJ 3T8TA 3S32A 2E71A 3QOPA 2RN7A 1G3TA 3ZQCA 1FIPA 4RGXA 1X1DA 1EV7A 4HRIA 1WI3A 2M3AA 2K86A 1J0RA 1YQAA 2VQCA 4WXCA 1OYYA 1YE9A 4M6VA 3O3KA 2ZNYA 4EMSA 1QBJA 4ENJA 1YFHA 2CG4A 1V55H 2XAJA 2NRAC 4XOPA 1IUYA 3I59A 5JHUA 4F7ZA 2M30A 1F5TA 2KQRA 3L09A 1QHHD 1S8NA 3HB9A 2F5FA 3PQJA 5ERIA 4YFNF 2KDZA 2FD5A 2IGNA 2VJ5A 4E4HA 1JKOC 3LMMA 4RB1A 2HYJA 1O3SA 4O3MA 2LY9A 2VE8A 1O57A 2Q8KA 1F36A 1R5ID 3IP4B 3OYJA 1JUMA 2H09A 4EJUA 5FKKA 4KN7X 2DT7B 2HQAA 5LHGA 4ZZDA 1S72I 2IA1A 5EZHA 2X0LA 1CGPA 3PSIA 3BJOA 5H6QA 3MZYA 3S15J 3W6VA 3CP2A 5ICCA 1POGA 1QVTA 4LLGF 3RSNA 2LKXA 5F1JA 1MH3A 1U5TB 4Y15A 2FA5A 1X58A 2W82A 2XGEA 2FX0A 4RAGA 1B72A 2YS9A 4BHBA 2V1XA 5E1XA 5EYRA 2A68F 4UV8A 4UVAA 4BHCA 4HDVA 3KP3A 1FOWA 4AIDA 4EJWA 2E1CA 2K9QA 2GXAA 1TTYA 1MSEC 4EATA 2R7RA 3F21A 1HDDC 5TRDA 1SVMA 3UR3C 1GXPA 2HDWA 3DV8A 4ESFA 2DA4A 1LE8A 1I27A 1P4WA 1FJLA 2M34A 2LF8A 3OYBA 2K9LA 5CVIA 3ZGKA 4BJ6C 2FUG2 3RKYA 1D0XA 4XICA 2DFFA 3F8MA 3OYGA 2DBBA 1X4OA 2A07F 4FX4A 1IUFA 2MC3A 5CKTA 3JSPA 2NYXA 1FPQA 2IS6A 4ZYGA 1J5YA 2IS2A 4AVPA 2XIGA 3F8NA 5L3FA 4E7SA 2R4GA 1ETQA 2KT0A 1ZKGA 2JT1A 3PNYA 4JYKA 3DBLB 4M73A 1JKQC 1PVEA 3RIRA 1WSUA 4HNVA 3WTUC 1LJ9A 4IKFA 2JA2A 4M74A 4IRGA 4JOMA 4IHVA 2V7FA 1XDSA 2XPUA 3OMYA 1SEUA 4XNFA 5CYVA 5FO5A 1B8IB 2IT0A 3ZXSA 2MFZA 4ABZA 2TCTA 2HDCA 1ZHFA 1BI3A 1ZG1A 2CUFA 1MMDA 2IGMA 1IXSB 5LGNA 1FEXA 2WAQA 1ZARA 2M7AA 1Q1VA 1W7PB 1MBJA 1MMGA 2ZC2A 1R5HA 3WU2C 2HVQA 3P9IA 1UB9A 3Q9VA 3WE3A 5KNLA 2HQ5A 3HZJA 2ZJPF 3JAMK 3KETA 2V26A 4UVCA 4JP0A 1TWHJ 3OYEA 2XF5A 4AVZA 5IY5H 2ELJA 2L9VA 1EJ9A 3GTGJ 1T0FC 1IXRC 1ZGJA 3DU6A 1TQMA 2E34A 2HVSA 4HAMA 4P5OA 3HYIA 2X4HA 1Z3YA 2ZXIA 5D6FA 2F4IA 3HSEA 2JPCA 1TT0A 1S29A 4BXXJ 2DT6A 2VB6A 4BQOA 2VKHA 4CCLA 3NAUA 4HF2A 3EUAA 5F64A 1AA7A 1XDUA 1W5SA 3OR2C 3H36A 1KQ0A 3MD2A 2EJRA 4BEHA 5E17F 2D1HA 1DP7P 5JHFA 2V6EA 2Y75A 3BJAA 4NBQA 2CFOA 4L18B 4HQMA 3AAFA 2G0EA 1O7LA 2COMA 2DA3A 4IOAF 3BQYA 2WB1A 2YSRA 1WKMA 1IZ1A 3DF8A 1BC7C 5B1BH 3J7AO 4CUGA 1GHCA 1WH5A 4AYBA 3OR1C 1YIOA 3H92A 2CUEA 2BV6A 1M1EB 1BM9A 3H9JA 3QPHA 1FYKA 2V1NA 4EEFG 2ZJRF 2NVYJ 2OC6A 1QVUA 3CJRB 2ESNA 2K40A 3T5XA 4Q4ZF 1B59A 1XMXA 4CZZA 3A4CA 4PJ0C 3Q5FA 1I1SA 1D5YA 3F8FA 3ML6A 3IRQA 1OISA 2XRNA 3B6AA 4LD5A 1EA3A 1EH7A 3PSFA 1S5LC 1UG0A 2L4AA 2VPRA 4BS9A 2BW3A 2R7XA 1BN5A 1S7EA 4I76A 4Q47A 1PDNC 1B4AA 3WTYC 1QPIA 2R7DA 1X3ZB 4C3HJ 1AHDP 4HQEA 4HX7A 4L9JA 2DFIA 3E6BA 3I55I 5M3FJ 4IO9F 1YOVB 5L3CA 2A69F 4DZPA 5JLWA 4B44A 1U78A 5D5UB 1REPC 4LB6B 2MW8A 2DYSH 2NVUB 3V8JA 2I10A 4DOZA 3ELKA 3HRSA 2BY1A 2K4BA 2R7QA 3BC8A 3H5NA 2DFEA 2QBYB 3HDDA 3CUQC 1RUNA 3RDIA 1UG2A 3EUKL 4OWRB 2ELKA 3BJ6A 3GZ6A 3LA2A 5F0FA 3SDBA 4RB2C 4HNUA 1Y1WJ 2CWEA 4M3EA 4C9YA 3OOPA 4U7BA 3IH3A 1ZR4A 1Z21A 3CCYA 4XONA 4FX0A 4RM3A 1Z3XA 4JX4A 5LEKA 1SD4A 2QUFA 3U2RA 5IOYA 2VIXA 3FXOA 1LQ1A 2STTA 1BC8C 4KMUX 3M8JA 4RGSA 3OYDA 2UXNA 1O4XA 3HOVJ 1TP4A 1USSA 3G3ZA 3LQRA 4I01A 1OR7C 3A2KA 4X6AJ 4A3DJ 2L7ZA 2FSWA 1R49A 3HOWJ 3KIOA 4HG2A 1V5FA 2M45A 2JUCA 2EFOA 2P7VB 2CO5A 4IHXA 3ZMDA 3MKWB 4YG2F 1ODDA 2VKVA 2VODA 1K4TA 1IW7F 2CQQA 4XRSG 3GTJJ 1HF0A 1QPMA 1YW8A 2IVMA 2ZCWA 1MDMB 1H89C 4BE2A 5ILSA 1XD7A 2QGUA 1LEAA 1BR4A 1TWAJ 1MD0A 3CESA 3L2VA 2XAUA 3ISPA 3HOYJ 3K10A 4G6DA 1BOBA 5IOZA 1YRNB 2E2IJ 1Z7UA 4IHWA 1FP2A 3FXMA 1HW1A 3SFIA 2DI3A 3DU5A 5KK1A 1UZCA 3R6SA 1TWGJ 4HBLA 4ZYEA 1U9OA 2IXSA 5D5VB 3IWZA 3MCZA 3ZCOA 3PIPF 4S0HB 1BI0A 1PP8F 5C4XJ 2OUMA 3CMYA 3DCFA 2R3SA 1IF1A 3ABMH 3BR1A 3K0LA 3JCUC 3CMEI 2M8GX 4C2MJ 2MD0A 4D0PA 3H3VK 4MO7A 1R23A 3BPVA 3N4MA 2XF6A 3IV5A 2QM3A 2VBXA 2CSOA 3S3OA 1TBXA 4BL0B 1P7IA 2IGKA 3FXUA 5F0CA 4HYEA 2KIQA 2L9RA 2Q0OA 3K70D 4F91B 2ICWG 3AG2H 3KZZA 3MN2A 2LYCA 3EPZA 1J59A 1R5GA 2HI3A 2R7FA 2DOAA 1H88C 3KX2A 1IV6A 5D4SA 2HKXA 4PFOA 3LSHA 4O6JA 2HQNA 5FKOA 4LIVA 2K02A 1YO5C 4BNCA 3FXKA 4EJTA 1MMSA 4E7JA 1WJCA 1UFMA 2NAZA 3DPLC 3TGNA 2H94A 3W6JB 5HLIA 4V19K 1R1UA 2NXNB 4RAZA 2E1MC 3GXOA 1T6SA 4BY1J 3K70C 1YJ9I 4J19A 2VKEA 3FZVA 1RC9A 2WAFA 3BWGA 2CRGA 3WTZA 2P6TA 3MZ8A 1H0MA 2PFBA 5DTDA 5J3LA 1BI1A 2HGCA 2YX4A 3K4NA 2UV1A 3RI4A 5JVGF 1SD6A 4Y17A 4XIDA 1W5TA 2K85A 1TT5B 3KZYA 5GAGJ 4XL9A 1Z6TA 1K83J 3JTHA 1FP1D 2M0CA 4NC6A 3ERED 2Z9OA 3J7YJ 4WK8F 2MH2A 4YRVA 2LC2A 3IKVA 3HUGB 3U21A 4RB3C 3HRTA 5HLGA 2JK3A 3CTAA 2IP2A 2NNNA 5C4JJ 1QA6A 1FMWA 1YI2I 5ILVA 3VYUB 1MKMA 1D0YA 2GXGA 4G6QA 3WE2A 2RV8A 3BZKA 3R0JA 4HZFA 4CDGA 4IHSA 2F4MB 4ASNA 4CYCB 2R7SA 2RQQA 4BQAA 4U87A 4ZTJA 2Y0SN 4Y33A 5EGOB 2O8KA 1MGTA 5JI6A 3V7CA 4WXHA 3HXLA 2LLKA 1IN7A 2JZYA 2A05A 1APLC 2FE3A 5LEJA 3ASOH 2OA4A 2QENA 4KIFA 2GLOA 4A3FJ 2HOTA 1TWCJ 2ZB9A 2XAQA 3M8EA 2OTJI 4JQFA 1KZHA 1WI9A 1YW9A 1FBQA 3DBRB 4RLQA 2XPWA 3HPGA 4HEA2 3VDXA 5E3OA 3B73A 2H1KA 1LDDA 1JTXA 2XB5A 3OOUA 3KP4A 5DCMA 5E1ZB 4KYWA 2MLGA 3OIPA 4LK1F 1XPXA 1JJ8C 4LG0A 1B1BA 1TZLA 1YJWI 3L00A 1K6YA 1MMNA 2CW0F 4BGDA 1W0TA 4CXFA 3BTCA 4OAYA 4HLXA 2Y2ZA 2X9DA 3WTTC 1U2WA 4IL6C 2LBFA 1FBUA 3W2WA 2PN6A 3OYAA 4J00A 4OU0A 3R60A 3D1NI 3BZ6A 2OQGA 3LAJA 2D1VA 3FIWA 4F52A 2ELHA 3DBHB 3CMMA 3ZQLA 4L0ZB 3LL7A 1WJFA 2BYVE 1OYIA 3ZQIA 1T98A 1HLVA 3HOUJ 1BA5A 3KFWX 2HNHA 2QLZA 3P9KA 3SZTA 2GIZA 1XSDA 2CQNA 1MSFC
chains in the Genus database with same CATH topology
1UZCA 2KFDA 2L9VA 2KISA 2LKSA 2K85A 2DOFA 2KZGA 2DODA 2B7EA 4FQGA 2JUCA 2DOEA 2E71A 2KIQA 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZC A;  2KFD A;  2L9V A;  2KIS A;  2LKS A;  2K85 A;  2DOF A;  2KZG A;  2DOD A;  2B7E A;  4FQG A;  2JUC A;  2DOE A;  2E71 A;  2KIQ A;  2CQN A; 
#chains in the Genus database with same CATH topology
 1VQO I;  3N97 A;  2HPM A;  3BRO A;  3F8B A;  4RAF A;  1R00 A;  2KMU A;  1QHG A;  2CS3 A;  4Y3O A;  4EGZ A;  5J8C A;  3MQ0 A;  4IHT A;  2V9P A;  5GTH C;  1IRF A;  4R79 A;  2VJI A;  4QIW N;  1JHH A;  2DJN A;  2D45 A;  4XLC A;  2ID6 A;  4DGW B;  4X0G A;  4I0A A;  2ADU A;  2JA8 J;  2ISY A;  2KZG A;  3ZRG A;  4UB8 C;  4N4N B;  1GV2 A;  4EM1 A;  3CD6 I;  3ZQH A;  3RYP A;  3L2Q A;  5LHI A;  2WV1 A;  5L3E A;  1I3Q J;  4QSH A;  3GTQ J;  5K1Y A;  2A6T A;  1LUJ B;  2MSY A;  4XQF A;  2LR8 A;  2W24 A;  3F23 A;  3FMR A;  3BZC A;  5H6R A;  2K27 A;  2L4M A;  1PUF B;  1E2X A;  2L0K A;  2DK5 A;  5CQE A;  3RQI A;  4XLE A;  3TKY A;  5HOO A;  3GZ5 A;  2ZSI B;  2KRF A;  5HS8 A;  3LNQ A;  1S9H A;  3JRF A;  4FHT A;  5TIS C;  4MFD A;  2VN2 A;  4CCN A;  3ZMT A;  4R8H A;  2XGC A;  1FOY A;  3CMA I;  1IN5 A;  3CO6 C;  3GCM A;  2CV2 A;  1I1G A;  3RQ4 A;  3KP7 A;  1WQ2 A;  3V7R A;  2FF4 A;  3BTI A;  1FLI A;  2V4J C;  5M5W J;  2ZME A;  3EUH A;  3OY9 A;  1LNW A;  3G1L A;  1RES A;  1F9N A;  4M3B A;  1W7P A;  3GFI A;  2J5P A;  2H6B A;  2HWV A;  3L2W A;  1OCC H;  1RPW A;  1P2F A;  1LFB A;  4FE4 A;  4A5N A;  3FDY A;  4HPQ A;  5GTI C;  4HLY A;  3QU6 A;  1X1B A;  1N25 A;  3I54 A;  3KE2 A;  2VXZ A;  2F5E A;  4C3I J;  3A03 A;  2JA5 J;  1KU3 A;  1E3H A;  3HSR A;  4XKB A;  4ESB A;  1L0O C;  3G71 I;  4ZDP A;  2O5R A;  2AQF A;  4KIG A;  3H5A A;  3S2H J;  1BW6 A;  1I5Z A;  1ZG5 A;  4HNT A;  2KPM A;  3I64 A;  1S6L A;  2O61 A;  3I56 I;  2Y9Y A;  4FTH A;  5D5W B;  3KZI C;  2HR3 A;  2EV0 A;  2ZXJ A;  3ASN H;  2M87 A;  3JTG A;  3WU0 A;  1NG7 A;  2Y9Z A;  2NVQ J;  2MLK A;  5HNH A;  2JWT A;  1PJR A;  1ZTR A;  4RA2 A;  2MG4 A;  1HA8 A;  3K7A J;  5F6F A;  3I5U A;  3NAR A;  3ZMS A;  3LSP A;  3J81 Z;  1JXS A;  1YG2 A;  3S1M J;  2EIK H;  3Q9S A;  4D5C A;  3OYH A;  2PJR B;  2KJB A;  3LSM A;  5IP6 A;  3KEY A;  2PJP A;  2CH0 A;  3EQL F;  5B1A H;  2LSO A;  2BOL A;  1X19 A;  1OFC X;  3CUQ B;  3ROU A;  2L9N A;  2BBY A;  1R1V A;  4CYD A;  4MGR A;  1NH3 A;  1LVK A;  3IAM 2;  1IN6 A;  1XSX A;  3FF5 A;  1JGG A;  3K4L A;  4P9U A;  3AG3 H;  2EFP A;  2B9S A;  4MTD A;  2DJI A;  4YEJ A;  1A5J A;  2L2O A;  5K7F A;  2DDA A;  3BQZ A;  2ECB A;  3GWZ A;  2C6Y A;  3TP0 A;  4G94 A;  2D5V A;  4JX6 A;  2EV5 A;  1N75 A;  1TNS A;  4MLO A;  4CCJ A;  3OYF A;  5AIQ A;  1NK3 P;  5DD8 A;  1ETO A;  2L7M P;  3GZN B;  3WTV C;  2EFQ A;  3OWT A;  3GTK J;  3DLL F;  1TQI A;  1IN4 A;  2RKH A;  3U9G A;  4P96 A;  1TC3 C;  5BQT A;  2W4S A;  2K9N A;  3DPT A;  5IT9 Z;  2W85 A;  3LOC A;  1ON2 A;  3S14 J;  1I6H J;  4AU7 A;  4MFE A;  5EEH A;  4BUP A;  4X1E A;  3HOT A;  4OAZ A;  2WTE A;  1GLN A;  2G9W A;  2QBY A;  2EIN H;  2Y0S A;  2JQ7 A;  2F5V A;  4JK1 X;  3JSO A;  5GAH J;  1U0J A;  4HST A;  4UVB A;  4BJ5 C;  4XOR A;  1UJ8 A;  3U1K A;  3OSF A;  2O03 A;  2WWY A;  5K5Q A;  4IPA A;  3AG1 H;  1P9Q C;  4M3G A;  5FLX K;  5EF6 A;  2X1E A;  4PGH A;  1SAN A;  1B9M A;  4RBO A;  5IYD J;  3PFY A;  1EF4 A;  2EQR A;  4W1U A;  1LFU P;  2DDB A;  1ONV A;  3L9F A;  1TLH B;  3P7N A;  4G7Z F;  5B66 C;  1VTN C;  4TV7 A;  1FNN A;  2QEX I;  1U8B A;  4A0Y A;  4A12 A;  1CF7 B;  2ZFW A;  2DPD A;  3VYT B;  2KFD A;  2I8D A;  5M5X J;  2WAD A;  2HOS A;  3F6V A;  1S3J A;  1BJA A;  3OIQ A;  2NOG A;  4RMN A;  1IC8 A;  3BR6 A;  1EKE A;  4DW6 A;  4KIC A;  3SDG A;  3CCS I;  2EB7 A;  5A2Q K;  2FBK A;  3H1C A;  3RPU A;  1YRN A;  3CUO A;  5DUK A;  2OPT A;  4L9T A;  3QP5 A;  2CV1 A;  3BG3 A;  1MNE A;  4IRI A;  3FBI B;  5E79 C;  1HC8 A;  2E1M B;  1J2X A;  2BEO A;  2V6C A;  3BG5 A;  5FKN A;  4DYQ A;  4UUV A;  3VYR B;  1A6Q A;  1ENH A;  1ZN2 A;  4NB5 A;  3SEZ A;  4M72 A;  5BOX A;  1AKH B;  5J4Y A;  3GX4 X;  2VE9 A;  4NHJ A;  4ANJ A;  3HPH A;  4OMY A;  1WJA A;  4I7H A;  3LSI A;  2CMP A;  4AC0 A;  4GDF A;  2H27 A;  1MBG A;  5FB2 A;  2CUZ A;  3K9T A;  2RC4 A;  2VJ4 A;  2ISZ A;  3LSR A;  3PJR A;  4LJZ F;  4L5J A;  2LRE A;  2YUS A;  5KAF C;  5L3B A;  1RNL A;  2VXD A;  2E36 A;  3CDH A;  1HKT A;  2E5N A;  3C1D A;  3OS1 A;  3CLQ A;  2HKO A;  2X1D A;  1OJL A;  1BIA A;  4BE0 A;  5DYM A;  2XAH A;  3VOE A;  5ICF A;  2H8W A;  4PDK A;  3GFJ A;  2ZJQ F;  2FOW A;  3IHU A;  4IHY A;  1ZEL A;  3TP3 A;  3OYI A;  4XR6 A;  4UUT A;  1XGS A;  1ETV A;  1ITY A;  3CCM I;  3A1Y A;  4O5V A;  4PZJ A;  2WV0 A;  2VLA A;  2VON A;  1IO2 A;  1T33 A;  1IXC A;  2L54 A;  3J80 K;  5E20 A;  5ED4 A;  2WA0 A;  3C2G A;  3SZG A;  2Y30 A;  3TO6 A;  3DEW A;  2IPQ X;  1WPK A;  3QPT A;  1Y6I A;  4P55 A;  4ZYD A;  1Z77 A;  3VSL A;  2DQL A;  3TO9 A;  3ZN0 A;  2X6X A;  2KJC A;  4L5I A;  3V8K A;  3MAJ A;  3E5X A;  3O6B B;  1MJB A;  4EV0 A;  2LKP A;  1KU2 A;  2QQB A;  3I58 A;  5K7Z A;  3W3C A;  3H9G A;  2L02 A;  4LIU A;  2GM4 A;  2L7F P;  2NVT J;  4M9S A;  4LLN A;  1JHF A;  4II2 A;  3SZP A;  4D5F A;  4RGR A;  3BPX A;  4OMZ A;  4A3K J;  2BZT A;  3TL4 X;  3FK7 A;  5F0H A;  4L5E A;  4B43 A;  2L5Q A;  3KYL A;  1FT9 A;  4CCM A;  1UMQ A;  3C2H A;  1IAW A;  4BE1 A;  5CVR A;  1X2N A;  4DBR A;  2LF7 A;  3DWL E;  2AO9 A;  1P4A A;  3DTI A;  4NQW A;  4CYC A;  3RTR A;  2QVO A;  1V5E A;  1R1T A;  2DTR A;  3WGH A;  2A5Y B;  3B02 A;  2Y48 A;  1P6R A;  4NUB A;  2OV7 A;  4KDP A;  2A3S A;  2MA3 A;  3CDL A;  1Z1D A;  2LOO A;  3HHH A;  1WHU A;  1J75 A;  2F5D A;  2IGO A;  2E1N A;  3GBG A;  4M71 A;  1ZG3 A;  3LA3 A;  4PJM A;  5FJ8 J;  3BCB A;  5M3M J;  1C0W A;  4HX8 A;  2FNP A;  2XUB A;  4B8X A;  3MFK A;  3WHC A;  2EV6 A;  4ZH4 F;  4IZZ A;  4E7I A;  3BG7 A;  4BHP A;  2GBY A;  2GOM A;  1KQ9 A;  1BI2 A;  2JA6 J;  4YIF A;  2IBD A;  3CJT B;  2R93 J;  3R4K A;  3K1M A;  3LST A;  2OBP A;  4A6E A;  1UAA A;  1K78 A;  3HOX J;  2X6Y A;  3CC2 I;  5FRM A;  2EIJ H;  1G3S A;  2H8R A;  1SD5 A;  2VBY A;  3LSG A;  5GAD J;  1RR7 A;  1K79 A;  1R36 A;  2O0Y A;  2VC0 A;  2ME6 A;  2P7C B;  4KT6 A;  4FIS A;  2X48 A;  3P5J A;  1KA8 A;  5DM6 F;  3IWF A;  1SAU A;  5L3D A;  3QAH A;  1DQU A;  2FML A;  1GUU A;  2VT2 A;  2OAZ A;  3LWF A;  3OYC A;  1Y0U A;  1X1A A;  1J9I A;  5HDK A;  2QZ8 A;  5DDG A;  1OCT C;  1RIO H;  5B3S H;  3SYT A;  4RGU A;  4GXO A;  5DS9 A;  4XLF A;  4ZZL A;  1GDT A;  2GWR A;  3QYF A;  2DLL A;  3J81 K;  1IDZ A;  2DYR H;  2W1O A;  3ABU A;  4XLA A;  1G3Y A;  5GPC A;  4A3L J;  4C30 A;  1BOA A;  4UUS B;  2GIV A;  1U6G A;  2HQR A;  3L2U A;  5LGT A;  3DKY A;  2XC7 A;  1FTT A;  5H20 A;  1QGP A;  3QPS A;  3DXJ F;  3K1N A;  2YU3 A;  3RJP A;  2E2H J;  2WAE A;  3G1M A;  4I99 C;  2DMP A;  2FMY A;  2BXZ A;  3DTE A;  1X2M A;  4KA4 A;  2ZJ2 A;  2QA4 I;  5GAE J;  2EA2 A;  1SMY F;  4GFB A;  4RDU A;  1ZRC A;  4GGG A;  3HRM A;  2LTP A;  1RKT A;  3DEE A;  3LFK A;  3L2C A;  3PUB A;  1O3Q A;  3ABL H;  1RI7 A;  3QYE A;  1Z6R A;  4B09 A;  2VUM J;  3CCE I;  4LFU A;  3Q3S A;  3MKZ A;  5J1R A;  4A5M A;  3HRU A;  3FK6 A;  3GVA A;  3I4M J;  3HBL A;  3CQZ J;  5E8I A;  3FKI J;  1DGW Y;  3NWT A;  2E7W A;  2AS5 F;  3S93 A;  4MEX F;  3PNV A;  1F1Z A;  4BBS J;  5FKL A;  3T1B A;  4EJO A;  2QQA A;  3A0H C;  1X1P A;  2EK5 A;  1O3R A;  1JT0 A;  4I02 A;  5LRR A;  1LFP A;  1E17 A;  1BBY A;  1YIT I;  2Z99 A;  1UHW A;  2CUJ A;  4G9Y A;  1ZK8 A;  2OZ6 A;  3F22 A;  4BYY A;  4C2U A;  5K5R A;  4MNU A;  2XGD A;  1IDY A;  5E3L A;  3K4C A;  2H6C A;  1STZ A;  1S7A A;  2F5C A;  1HDP A;  1Z7L A;  2V1D A;  2LMD A;  4KMF A;  1VQ6 I;  2O7O A;  1XCB A;  1NTC A;  2PLY A;  2B7E A;  4MTE A;  4XKW A;  3F6O A;  4Y4R A;  2HYG D;  2P8T A;  1KON A;  3AL0 B;  1QZZ A;  1GVJ A;  4BY7 J;  3RCO A;  2EBI A;  4MEY F;  3JRE A;  2A6E F;  2LD5 A;  1IJW C;  1MMA A;  3QOE A;  2QKM B;  2KDO A;  5DCF A;  3GLX A;  2UWM A;  2P81 A;  4CIC A;  3KLN A;  4Z2Y A;  2HZT A;  5EG0 B;  4PJN A;  2GAU A;  2RAE A;  4HOB A;  2FQ4 A;  4A0X A;  3TMO A;  5HDG A;  2XKO A;  1QQI A;  4CGZ A;  5ILU A;  1K4S A;  4A3J J;  1ULY A;  2M4G A;  2V9K A;  4M6Y A;  5M5Y J;  4A93 J;  3K6G A;  1FWZ A;  1N78 A;  4CH7 A;  4AUX A;  2ZME C;  3HG9 A;  1HKS A;  4XRM A;  4E7L A;  3IRR A;  2R5Z A;  4U7D A;  1HOM A;  4PCQ A;  2XAF A;  4WCG A;  2QKL B;  3COA C;  2PJR A;  2JPB A;  1W1W E;  1A35 A;  1XGO A;  1ZGW A;  2B63 J;  2IJL A;  5DV5 A;  2OJE D;  5EZG A;  1OPC A;  1FMV A;  1MBH A;  3CUQ A;  2E5Z A;  1JGS A;  2KIF A;  2FEZ A;  2FOK A;  2Z1D A;  3VFZ A;  3HSF A;  3HIF A;  4CCO A;  2BHZ A;  2F48 A;  2IRF G;  4XMY A;  1RR8 C;  1XSV A;  1YW7 A;  5LLQ A;  4WXD A;  3HTU A;  4J01 A;  3FXJ A;  3RKX A;  1D0Z A;  2Q2E B;  2LP0 A;  4KT5 C;  2E1O A;  3GLL A;  4BDY A;  1Z05 A;  4PGG A;  3PFI A;  3FHZ A;  1K61 A;  1K6O A;  1J7K A;  2J5O A;  1Y0N A;  3KP5 A;  2VPL A;  3DP7 A;  3OS0 A;  2JRT A;  3AFH A;  2EFN A;  4UY8 I;  4IXA A;  1KGS A;  2BHY A;  2M0M A;  1OQY A;  1JJ6 C;  4FE7 A;  2EZK A;  4ZC3 A;  3BR0 A;  1U8R A;  5CLS A;  3E5Q A;  1QRY A;  3FWE A;  3H9Q A;  1TNT A;  4IF4 A;  4BAC A;  5LBQ A;  5LHH A;  4KIT B;  4BXF A;  5E3M A;  3JRA A;  1ETW A;  4BQQ A;  4XN0 A;  5DM7 F;  1KU9 A;  2Z33 A;  1HBX G;  2YU9 J;  1DUX C;  4CHU A;  2CQ7 A;  1WFX A;  1H8A C;  1XC5 A;  4QPO A;  2W84 A;  1V54 H;  2DCE A;  1U5T A;  2PG4 A;  3NRV A;  5ICG A;  3E1S A;  3LA7 A;  5JR3 A;  2EZH A;  2QSH X;  2IAI A;  3AG4 H;  3F9K A;  1JE8 A;  1L3L A;  2VKD A;  3I3L A;  4GRI A;  3ZMU A;  4B3A A;  2P5L C;  1XMK A;  5HLT A;  1SFX A;  1TW3 A;  1PUE E;  2G7U A;  1IRG A;  1YS7 A;  3JRB A;  1IRX A;  2NOJ B;  4I09 A;  3NEU A;  5KAI C;  2DQR A;  1D1A A;  2HZD A;  5K5O A;  1FOX A;  4E7H A;  2F2E A;  5F27 A;  4D7M A;  2GXB A;  3KEQ A;  1UCR A;  4G12 A;  1CF7 A;  3REO A;  3M7G A;  1R9T J;  1A6I A;  2MBF A;  2IEK A;  3GUD A;  5HLH A;  4B3X A;  3K69 A;  2PQ8 A;  4B1R A;  2EZL A;  4ZDO A;  3LSK A;  3K1P A;  2N8G A;  3IC7 A;  5DEQ A;  4KIS A;  2QSG X;  1UHS A;  1VQP I;  1D1C A;  4P9F A;  2R7U A;  3VOD A;  3ZPL A;  2DMU A;  2A61 A;  1A31 A;  3ZMZ A;  2P6S A;  1Y1V J;  4XLH A;  1F4K A;  4ZDL A;  1VQN I;  2EPF A;  3C18 A;  5D5X B;  2G7H A;  2OU2 A;  1FYL A;  1G6N A;  1AKH A;  1G3W A;  2YX7 A;  3SHF A;  4Q48 A;  4G7O F;  4NC7 A;  1B8I A;  1KU7 A;  2LG4 A;  4XLP F;  1VQ5 I;  3RYR A;  3C2B A;  3RPU D;  5FD6 A;  3CC7 I;  1R7J A;  2DW4 A;  1X3U A;  3PNT A;  3D5R C;  3MZH A;  3SJM A;  3BCA A;  2HDD A;  2PMU A;  2CQK A;  1VQ7 I;  3GTP J;  2B0L A;  2E2J J;  2H1L A;  3T8R A;  3ECO A;  4M9X A;  1WJ5 A;  2DO7 A;  2X6W A;  3KPH A;  2HOA A;  4PJJ A;  4RB0 A;  1T38 A;  1FBS A;  3CCQ I;  4Y13 A;  1YJN I;  2LRD A;  1XN7 A;  2HS5 A;  2MGQ A;  2EA4 A;  3K2A A;  1S7O A;  3BR3 A;  3OYK A;  1B6A A;  1VQ8 I;  3RPQ A;  3A02 A;  4IX7 A;  1V3F A;  4AD9 A;  2GOX B;  4XRF A;  4IOC F;  2IS4 A;  3S1Q J;  5C3E J;  1IV8 A;  1OCR H;  2DA6 A;  5IP7 J;  2KIU A;  3E6M A;  1VFC A;  4V2F A;  2X1C A;  5KHD A;  1BR1 A;  5IT3 A;  1Y39 A;  4HW0 A;  2CV0 A;  4U88 A;  4NDL A;  3U1D A;  1GT0 C;  5BNG A;  4ENK A;  2MH9 A;  3HTS B;  4A3G J;  3A0B C;  1D1B A;  5HDN A;  4AM3 A;  4FET A;  3FMQ A;  3CJQ B;  2VC1 A;  5DD4 A;  2ZXH A;  4ZJZ A;  4G7H F;  3HM5 A;  1R4M B;  3QRF F;  3DKW A;  1T95 A;  3KEO A;  3G4S I;  2KKO A;  3H5R A;  5B5E C;  1BIB A;  4N0B A;  2VBZ A;  1P7J A;  4A3B J;  1J09 A;  4LIT A;  2ZSH B;  3K4M A;  5K7H A;  2W48 A;  2R5Y B;  2Z5U A;  1ZQ3 P;  1ZR2 A;  2UUZ A;  1XMA A;  1E3O C;  3DQV C;  3CZ6 A;  3I71 A;  2OTL I;  1IRZ A;  3CCU I;  4F55 A;  4OIO F;  1MIJ A;  2ZXW H;  3LFU A;  4QLC U;  4G6T B;  5JFR A;  1FC3 A;  2W57 A;  4YFK F;  4QWQ A;  4LK0 F;  3CDI A;  1Z9C A;  3IL2 A;  2BXY A;  3GEZ A;  2EFW A;  2IW5 A;  3FXQ A;  1ACI A;  1XGM A;  3H35 A;  4CCK A;  3BP8 A;  3LAP A;  2PI0 A;  3F0C A;  4D7N A;  1FOK A;  3HOS A;  4MQV A;  3JRH A;  2M5W A;  4BBR J;  2FBI A;  2HYF A;  3QQA A;  4U0W A;  3DKX A;  5E18 F;  1RRJ A;  2CU7 A;  1YHQ I;  1GVD A;  3TDU C;  4CO8 A;  1RET A;  3HOZ J;  5FD5 A;  1LEB A;  1GV5 A;  1MZB A;  2ETH A;  2UXX A;  4ETS A;  2OF7 A;  4YIR X;  2XPV A;  3S1R J;  1ETK A;  1YX3 A;  2O3F A;  4Z6Y A;  2XF7 A;  2E19 A;  3WG7 H;  4MHG A;  5DCM B;  1UST A;  2A6H F;  3FX3 A;  4AIK A;  2VJJ A;  2RNJ A;  5AON A;  4LG0 B;  2Q1Z B;  3GO5 A;  1I50 J;  4XOT A;  2E35 A;  1QU3 A;  5LD2 C;  4LLL A;  3FM3 A;  1VQ9 I;  2PX9 A;  3EET A;  4NNJ A;  1X4P A;  1T39 A;  1ZRF A;  4R1H A;  4XK4 A;  4DYR A;  3FXR A;  2LBF B;  5LGU A;  1JI8 A;  2DA7 A;  2RQP A;  1LVA A;  3OL3 A;  4F3Q A;  4A3M J;  3EYI A;  3PQK A;  4RAY A;  4B4C A;  2XDV A;  1JKP C;  1QZY A;  5H2F C;  3S1N J;  2K7L A;  3MWM A;  2JA7 J;  2VOO A;  4DIQ A;  4BXU A;  3CLO A;  4L9N A;  2WY8 Q;  4XLN F;  1B9N A;  2Z2S B;  4GYG A;  3IKT A;  2TRT A;  2KRH A;  2P0W A;  3ABK H;  2GA2 A;  3R0A A;  4A3C J;  3FMS A;  4UUS A;  1MDM A;  3BDD A;  2OZU A;  2IS1 A;  4E70 A;  5HOD A;  3E0J B;  4DQ2 A;  1MNM C;  2HXI A;  1Q1H A;  3E6C C;  2LKS A;  2OCE A;  2QQ9 A;  2EH3 A;  1TL8 A;  1T8I A;  2NS8 A;  2YPR A;  3ZMV A;  3BTJ A;  2BGC A;  3I9V 2;  4A2U A;  4AWX B;  1DPR A;  4IRH A;  5FLM J;  3E97 A;  4N4O B;  4BH9 A;  1YS6 A;  2CW8 A;  5EEA A;  2DA5 A;  2FU4 A;  1YLF A;  3RZO J;  3G2B A;  5J1U A;  4KUM A;  3V4G A;  3M4O J;  1MH4 A;  3S16 J;  4XRS A;  4H0E A;  2M1B A;  4E7K A;  2O8X A;  1H9G A;  2FJ1 A;  2GQQ A;  4EJV A;  1ZRE A;  3K4J A;  4OIR F;  2NNY A;  2DU9 A;  4H4K C;  1PP7 U;  2RRE A;  5D6E A;  4EM2 A;  4A6D A;  4F92 B;  3ONQ A;  2Z3Y A;  3BR2 A;  4HA8 A;  4M3F A;  2FQ3 A;  4P1W A;  5J40 A;  1XTA A;  3CC4 I;  1DDN A;  1WCM J;  3A01 B;  3KYD B;  4A0Z A;  4XSX F;  3IAS 2;  3D5S C;  2KP6 A;  2R7T A;  4UB6 C;  2R7O A;  2I5U A;  4HDU A;  2W00 A;  1R6R A;  4U0V A;  2ZME B;  2DK8 A;  5FFZ A;  5BMZ A;  3DFG A;  1SFK A;  4HF0 A;  1G4D A;  1ZAO A;  3FBN B;  4N9I A;  1OYW A;  4PJL A;  1UEL B;  5D8L B;  2BY3 A;  4NC8 A;  1ERD A;  3K4B A;  4D1Q A;  3HGG A;  1DPU A;  4M3D A;  4DNC A;  3FKJ A;  3CCV I;  5CQG A;  1P92 A;  2DMN A;  1DU0 A;  4BKX A;  4KNY A;  2PMZ N;  5J6X A;  1T2K A;  1MND A;  1VND A;  3KYC B;  2HFH A;  2RGV A;  3M1E A;  2X51 A;  4BQN A;  1HSJ A;  1HXD A;  3BG6 A;  4BDZ A;  3N05 A;  2JJ7 A;  2RDP A;  5CVJ A;  2Y31 A;  2ESH A;  5EG0 A;  4EGY A;  2QQ8 A;  1WH7 A;  2DAO A;  3HHG A;  1JUP A;  1VQM I;  2UZK A;  5IYC J;  4IQ4 A;  3CCJ I;  3Q0V A;  3MKY B;  2V79 A;  5IP9 J;  2NS7 A;  1I3A A;  5CVU A;  4FT8 A;  1SVO A;  4GCV A;  3HUG A;  5F08 A;  4CA0 A;  4MQ9 F;  4V2G A;  3PUF A;  3M8F A;  3OS2 A;  3JW4 A;  3SQN A;  2LK2 A;  2XHK A;  3GF2 A;  3ABT A;  1JKR C;  1Y8Q B;  5CVV A;  3VB2 A;  2ME0 A;  3O8G A;  1FSH A;  3SXY A;  2R7Z J;  4WF2 A;  5F04 A;  2V9V A;  1N77 A;  1LDK B;  3MEX A;  3JRI A;  3S2D J;  5EGO A;  1ZH5 A;  1HW5 A;  2M8E A;  5C44 J;  1G2H A;  1E3P A;  1HW2 A;  3HKZ N;  3K4K A;  1KQ8 A;  5FFX A;  2R92 J;  2KZV A;  3ZN1 A;  2Q2E A;  1MJA A;  1I39 A;  4OIP F;  3WHB A;  4DJA A;  4Y52 J;  2BVM A;  3J7Z I;  2VQL A;  2DOD A;  2IA0 A;  3RZD J;  4L9V A;  5FLV A;  2LH9 A;  3KLO A;  3DLA A;  3HJE A;  3GW2 A;  3ZQ7 A;  2L7K A;  1OCZ H;  3M07 A;  2DMQ A;  1FSE A;  2W25 A;  3I59 B;  2DFH A;  2EWN A;  1OCP A;  2KLO A;  3M3Y J;  3FXL A;  1BJZ A;  2XVC A;  3VEP A;  1VZ0 A;  4A3E J;  2XB0 X;  3FHN A;  3LQQ A;  4L0Y B;  3O2P E;  1BL0 A;  4LG3 A;  3ESW B;  4PUS A;  1D8J A;  1LDJ A;  3CF2 A;  3BG9 A;  2K9M A;  1G59 A;  3VPR A;  4GO1 A;  4KFC A;  2ZO4 A;  3ZR8 X;  3WGI A;  1LKX A;  4C2T A;  3G1O A;  2RNG A;  2OD5 A;  2EIL H;  3BOQ A;  1YIJ I;  1SD7 A;  4II3 A;  1B72 B;  3S8P A;  1A04 A;  4A3I J;  3I4P A;  3O8H A;  2VOP A;  2BVL A;  2R0Q C;  2EZI A;  3BT9 A;  2ID3 A;  1XGN A;  1MBK A;  5TGT A;  2HU9 A;  3OYL A;  1R4N B;  2V1U A;  2AXT C;  5E3N A;  5J8F A;  1RKW A;  3D0S A;  1OCO H;  3OV8 A;  2OCC H;  1K7A A;  1BW5 A;  2M7B A;  5J4V A;  5LRS A;  1ETX A;  3BLY A;  3OYN A;  1LE8 B;  4LGW A;  1SC7 A;  3ERM A;  3C7J A;  3WOD F;  2Z16 A;  5DUI A;  3ZOB A;  1Y8R B;  4E6K G;  4KIB A;  2K3P A;  1YYV A;  5JLX A;  2LFB A;  1G8X A;  1HQC A;  5IYB J;  1PUF A;  3OYM A;  4YII A;  2ZFU A;  1T0F A;  2PEX A;  2M4K A;  3HL2 A;  3QPL A;  2VQG A;  1U5T C;  4ZTF A;  3SFZ A;  4HX4 A;  1WJD A;  3HGY A;  3J7A Y;  2DPU A;  1U9N A;  2DT5 A;  2CQX A;  1DU6 A;  1VQK I;  2R7V A;  2DXI A;  5IT9 K;  4G8X A;  4S04 A;  5KVR A;  1Z67 A;  2XV4 S;  3Q0U A;  4DBQ A;  2Y0M A;  3ZQG A;  5GP9 A;  2JRM A;  2VAS A;  2GZW A;  4ON0 A;  3SEQ A;  2F6C A;  2K3F A;  3DEU A;  2LDU A;  4XKV A;  3H3Z A;  2CW7 A;  1MBE A;  3E5U A;  2XSJ C;  3FM5 A;  2KHM A;  3P9C A;  3PIO F;  3G6E I;  3V42 A;  1CQT A;  3GTO J;  2XAG A;  4OIQ F;  4RS8 A;  1VQ4 I;  5ICE A;  3JRC A;  4ENM A;  1OMI A;  1WWX A;  1WJE A;  2CFX A;  4ITV A;  4M9Z A;  5HS9 A;  3WG9 A;  3G73 A;  2KL4 A;  2MYS A;  2M9H A;  2CGP A;  1KYW A;  4FCY A;  4Y7N J;  2CYY A;  3DPU A;  3OL4 A;  3GTM J;  1DP3 A;  3Q0W A;  5L3G A;  1ORK A;  1W7P D;  4DYC A;  2W7N A;  1HKQ A;  1MBF A;  4U0Y A;  4JX5 A;  3RKQ A;  2ECC A;  1AU7 A;  3W2V A;  5TJJ A;  3ZP5 A;  5F1R A;  5BS6 A;  1ZGA A;  3FIS A;  1FYM A;  3B6C A;  2KIS A;  2O9L A;  2NS0 A;  2K9S A;  4B47 A;  3TO7 A;  1HCR A;  4GYI A;  3E7L A;  3GYH X;  4F93 B;  2PMH A;  3T0Y A;  2FXA A;  3EUH C;  5FLX Z;  4K2E A;  9ANT A;  1TQP A;  4BJT A;  1H9T A;  2HVR A;  1A36 A;  1T56 A;  3S2W A;  4E7Z A;  3WTW C;  2HOE A;  4QTR A;  4BEH B;  3W6K B;  2RVC A;  4IEJ A;  3ULQ B;  2CJJ A;  1QNT A;  1F43 A;  4IQJ A;  3CP8 A;  2PMZ A;  4XKC A;  1NHA A;  3F3X A;  3TBI A;  1VF9 A;  1W36 D;  1O7F A;  2ZKZ A;  4RLF A;  3I0T A;  3KCC A;  2R5Y A;  1FY7 A;  2JUG A;  1PYV A;  1FZP B;  4WWC A;  1AOY A;  4MIM A;  5JVT A;  3JRD A;  1QZE A;  3GFM A;  1X1C A;  1IN8 A;  2K4J A;  3CF5 F;  5EJC A;  4A69 C;  1SFU A;  3KP6 A;  3V8L A;  5J1Y A;  2FRH A;  2MC4 A;  2LVS A;  2K5C A;  1P4X A;  1EH8 A;  5CPR B;  5E1W A;  3VSK A;  5A2Q Z;  2XSD C;  2R7W A;  1AWC A;  4HSR A;  3QP6 A;  4NQW B;  2Y69 H;  2FBH A;  1OR7 A;  2BY0 A;  4ZYA A;  2BW3 B;  3V7S A;  1W36 C;  3GFL A;  2XRL A;  4I6Z A;  3JRG A;  1EH6 A;  3QYB A;  2DOE A;  1D8K A;  4EM0 B;  1YTY A;  3BR5 A;  4FAS D;  3OIO A;  3L1P A;  1NK2 P;  3WU1 B;  2VBW A;  3K2Z A;  2AHQ A;  4ZYH A;  2HTS A;  5KCM A;  4EVI A;  3UNG C;  3JR9 A;  3TW7 A;  3F8C A;  1SAX A;  3F72 A;  4UHT A;  2XRO A;  2BY2 A;  2JVG A;  2ACJ A;  5BPI A;  4OIN F;  3S3M A;  1I6X A;  3MKL A;  3WTX C;  3HKZ A;  3TED A;  4Q5S F;  4IVN A;  1XCV A;  1K78 B;  2NVX J;  1TWF J;  1WVR A;  3JAM Z;  3QU3 A;  3IH2 A;  3M9A A;  4KN4 X;  5BPD A;  1T08 B;  5HVQ C;  3H3U A;  4PSX A;  4KJZ A;  4W97 A;  1RUO A;  3ZQQ A;  3GTL J;  2QYO A;  3L2R A;  3BTL A;  4OOI A;  1XG1 A;  2XGX A;  4FQG A;  3KP2 A;  5FRN A;  2OQR A;  3PM1 A;  3LSJ A;  1NG6 A;  4YEL A;  2LNB A;  2PBI A;  1XX5 A;  2L01 A;  2E7X A;  5EEG A;  3J80 Z;  1IG7 A;  1V4R A;  4LB5 A;  2X85 A;  4PK4 A;  1ZLJ A;  2GA1 A;  3QOD A;  2HEO A;  2DA2 A;  3M1C A;  2AQE A;  1JTY A;  3R61 A;  1OLT A;  1ZLK A;  1VI0 A;  1WRJ A;  2DTZ A;  2YR2 A;  4QPQ A;  4XM3 A;  4CSW A;  1Y56 A;  3H0D A;  2HPI A;  1ZRD A;  4ENN A;  1IGN A;  2IA2 A;  1SVL A;  4D9J A;  1MJ9 A;  2QWW A;  3QWL A;  2BE5 F;  1R71 A;  2VQH A;  4CZC A;  3TW6 A;  5D4R A;  3L7W A;  2D2W A;  3AKZ A;  1JUS A;  2WAQ N;  4UXN A;  2WC2 A;  5LFA A;  2P5V A;  3OSG A;  4EQQ A;  3W2A A;  2WY7 Q;  3MMY B;  5D8K B;  1BR2 A;  3NQO A;  4AIH A;  1SMT A;  3VWB A;  1FIA A;  3HC7 A;  3I4N J;  2X6O A;  4XN3 A;  2M2E A;  1KYZ A;  2L9S A;  2QCO A;  1XS9 A;  1LB2 A;  3DTK A;  2JSC A;  1ZYR F;  4LMY A;  3RKW A;  3VYS B;  1LPQ A;  1U3E M;  1X3W B;  4I2O A;  1OKR A;  3NWS A;  4DZJ A;  1DGR M;  4UV9 A;  4YFX F;  4S05 A;  3A01 A;  4LOC A;  3HEF A;  3WGG A;  3IUO A;  3CCR I;  2DN0 A;  1Z91 A;  1FX7 A;  3MVP A;  4IJA A;  1UHM A;  2MD5 A;  2O6G E;  1ON1 A;  3BY6 A;  1W5C C;  3PL8 A;  1XB4 A;  1WJB A;  4AIJ A;  1YX5 A;  6PAX A;  2JTV A;  5HNF A;  2QSF X;  1R58 A;  5GPA A;  3TQN A;  4BAY A;  2VL8 A;  4PSW A;  1TW2 A;  3EDP A;  3PO3 J;  2DA1 A;  2ZNZ A;  3ZQF A;  2DMT A;  2XAS A;  1WGX A;  3E3V A;  3X2Q H;  3C3W A;  2WB1 N;  1JT6 A;  2AXL A;  2P4W A;  2ZBK A;  3ECH A;  2A5W A;  2JSP A;  3S17 J;  2JMW A;  3GME A;  1R22 A;  1Z0X A;  4HV6 A;  4I98 B;  4HV5 A;  4AYB N;  2F4O B;  1D3Y A;  2E60 A;  2STW A;  2HXO A;  4PFP A;  4I0B A;  1FTZ A;  1SFO J;  1GXQ A;  2KRC A;  4XSZ F;  4C3J J;  3CJN A;  2JVH A;  3D5L A;  1E0E A;  3EYY A;  2MAB A;  5HS7 A;  2XKP A;  5FGM A;  3TOA A;  1O3T A;  2QF7 A;  5IPA A;  3S3N A;  3CCL I;  2VI6 A;  1ETY A;  1QO0 D;  3E6D A;  2EIM H;  4B48 A;  5J47 A;  4BU2 A;  1W0U A;  2TDX A;  4JBA A;  3CO7 C;  3I53 A;  5E8G A;  4RM2 A;  3UKG A;  2LY2 A;  4N9H A;  2KIM A;  2WBM A;  4ESJ A;  1SFE A;  3IH4 A;  5FKM A;  4UNO A;  3WTS C;  2R5Z B;  4XBF A;  1HST A;  2LY1 A;  1V5G A;  1VQL I;  2HTJ A;  4M6X A;  1W4M A;  2FNA A;  1RZ4 A;  5EDN A;  2VT3 A;  5AIP A;  1WZ2 A;  5FRO A;  4WX9 A;  2JN6 A;  3AL0 C;  1D5V A;  1MW7 A;  2L3D A;  3PO2 J;  2P5K A;  3TOB A;  3TDZ C;  2DOF A;  5CJ9 A;  4HF1 A;  2COB A;  3H0G J;  3T8T A;  3S32 A;  2E71 A;  3QOP A;  2RN7 A;  1G3T A;  3ZQC A;  1FIP A;  4RGX A;  1X1D A;  1EV7 A;  4HRI A;  1WI3 A;  2M3A A;  2K86 A;  1J0R A;  1YQA A;  2VQC A;  4WXC A;  1OYY A;  1YE9 A;  4M6V A;  3O3K A;  2ZNY A;  4EMS A;  1QBJ A;  4ENJ A;  1YFH A;  2CG4 A;  1V55 H;  2XAJ A;  2NRA C;  4XOP A;  1IUY A;  3I59 A;  5JHU A;  4F7Z A;  2M30 A;  1F5T A;  2KQR A;  3L09 A;  1QHH D;  1S8N A;  3HB9 A;  2F5F A;  3PQJ A;  5ERI A;  4YFN F;  2KDZ A;  2FD5 A;  2IGN A;  2VJ5 A;  4E4H A;  1JKO C;  3LMM A;  4RB1 A;  2HYJ A;  1O3S A;  4O3M A;  2LY9 A;  2VE8 A;  1O57 A;  2Q8K A;  1F36 A;  1R5I D;  3IP4 B;  3OYJ A;  1JUM A;  2H09 A;  4EJU A;  5FKK A;  4KN7 X;  2DT7 B;  2HQA A;  5LHG A;  4ZZD A;  1S72 I;  2IA1 A;  5EZH A;  2X0L A;  1CGP A;  3PSI A;  3BJO A;  5H6Q A;  3MZY A;  3S15 J;  3W6V A;  3CP2 A;  5ICC A;  1POG A;  1QVT A;  4LLG F;  3RSN A;  2LKX A;  5F1J A;  1MH3 A;  1U5T B;  4Y15 A;  2FA5 A;  1X58 A;  2W82 A;  2XGE A;  2FX0 A;  4RAG A;  1B72 A;  2YS9 A;  4BHB A;  2V1X A;  5E1X A;  5EYR A;  2A68 F;  4UV8 A;  4UVA A;  4BHC A;  4HDV A;  3KP3 A;  1FOW A;  4AID A;  4EJW A;  2E1C A;  2K9Q A;  2GXA A;  1TTY A;  1MSE C;  4EAT A;  2R7R A;  3F21 A;  1HDD C;  5TRD A;  1SVM A;  3UR3 C;  1GXP A;  2HDW A;  3DV8 A;  4ESF A;  2DA4 A;  1LE8 A;  1I27 A;  1P4W A;  1FJL A;  2M34 A;  2LF8 A;  3OYB A;  2K9L A;  5CVI A;  3ZGK A;  4BJ6 C;  2FUG 2;  3RKY A;  1D0X A;  4XIC A;  2DFF A;  3F8M A;  3OYG A;  2DBB A;  1X4O A;  2A07 F;  4FX4 A;  1IUF A;  2MC3 A;  5CKT A;  3JSP A;  2NYX A;  1FPQ A;  2IS6 A;  4ZYG A;  1J5Y A;  2IS2 A;  4AVP A;  2XIG A;  3F8N A;  5L3F A;  4E7S A;  2R4G A;  1ETQ A;  2KT0 A;  1ZKG A;  2JT1 A;  3PNY A;  4JYK A;  3DBL B;  4M73 A;  1JKQ C;  1PVE A;  3RIR A;  1WSU A;  4HNV A;  3WTU C;  1LJ9 A;  4IKF A;  2JA2 A;  4M74 A;  4IRG A;  4JOM A;  4IHV A;  2V7F A;  1XDS A;  2XPU A;  3OMY A;  1SEU A;  4XNF A;  5CYV A;  5FO5 A;  1B8I B;  2IT0 A;  3ZXS A;  2MFZ A;  4ABZ A;  2TCT A;  2HDC A;  1ZHF A;  1BI3 A;  1ZG1 A;  2CUF A;  1MMD A;  2IGM A;  1IXS B;  5LGN A;  1FEX A;  2WAQ A;  1ZAR A;  2M7A A;  1Q1V A;  1W7P B;  1MBJ A;  1MMG A;  2ZC2 A;  1R5H A;  3WU2 C;  2HVQ A;  3P9I A;  1UB9 A;  3Q9V A;  3WE3 A;  5KNL A;  2HQ5 A;  3HZJ A;  2ZJP F;  3JAM K;  3KET A;  2V26 A;  4UVC A;  4JP0 A;  1TWH J;  3OYE A;  2XF5 A;  4AVZ A;  5IY5 H;  2ELJ A;  2L9V A;  1EJ9 A;  3GTG J;  1T0F C;  1IXR C;  1ZGJ A;  3DU6 A;  1TQM A;  2E34 A;  2HVS A;  4HAM A;  4P5O A;  3HYI A;  2X4H A;  1Z3Y A;  2ZXI A;  5D6F A;  2F4I A;  3HSE A;  2JPC A;  1TT0 A;  1S29 A;  4BXX J;  2DT6 A;  2VB6 A;  4BQO A;  2VKH A;  4CCL A;  3NAU A;  4HF2 A;  3EUA A;  5F64 A;  1AA7 A;  1XDU A;  1W5S A;  3OR2 C;  3H36 A;  1KQ0 A;  3MD2 A;  2EJR A;  4BEH A;  5E17 F;  2D1H A;  1DP7 P;  5JHF A;  2V6E A;  2Y75 A;  3BJA A;  4NBQ A;  2CFO A;  4L18 B;  4HQM A;  3AAF A;  2G0E A;  1O7L A;  2COM A;  2DA3 A;  4IOA F;  3BQY A;  2WB1 A;  2YSR A;  1WKM A;  1IZ1 A;  3DF8 A;  1BC7 C;  5B1B H;  3J7A O;  4CUG A;  1GHC A;  1WH5 A;  4AYB A;  3OR1 C;  1YIO A;  3H92 A;  2CUE A;  2BV6 A;  1M1E B;  1BM9 A;  3H9J A;  3QPH A;  1FYK A;  2V1N A;  4EEF G;  2ZJR F;  2NVY J;  2OC6 A;  1QVU A;  3CJR B;  2ESN A;  2K40 A;  3T5X A;  4Q4Z F;  1B59 A;  1XMX A;  4CZZ A;  3A4C A;  4PJ0 C;  3Q5F A;  1I1S A;  1D5Y A;  3F8F A;  3ML6 A;  3IRQ A;  1OIS A;  2XRN A;  3B6A A;  4LD5 A;  1EA3 A;  1EH7 A;  3PSF A;  1S5L C;  1UG0 A;  2L4A A;  2VPR A;  4BS9 A;  2BW3 A;  2R7X A;  1BN5 A;  1S7E A;  4I76 A;  4Q47 A;  1PDN C;  1B4A A;  3WTY C;  1QPI A;  2R7D A;  1X3Z B;  4C3H J;  1AHD P;  4HQE A;  4HX7 A;  4L9J A;  2DFI A;  3E6B A;  3I55 I;  5M3F J;  4IO9 F;  1YOV B;  5L3C A;  2A69 F;  4DZP A;  5JLW A;  4B44 A;  1U78 A;  5D5U B;  1REP C;  4LB6 B;  2MW8 A;  2DYS H;  2NVU B;  3V8J A;  2I10 A;  4DOZ A;  3ELK A;  3HRS A;  2BY1 A;  2K4B A;  2R7Q A;  3BC8 A;  3H5N A;  2DFE A;  2QBY B;  3HDD A;  3CUQ C;  1RUN A;  3RDI A;  1UG2 A;  3EUK L;  4OWR B;  2ELK A;  3BJ6 A;  3GZ6 A;  3LA2 A;  5F0F A;  3SDB A;  4RB2 C;  4HNU A;  1Y1W J;  2CWE A;  4M3E A;  4C9Y A;  3OOP A;  4U7B A;  3IH3 A;  1ZR4 A;  1Z21 A;  3CCY A;  4XON A;  4FX0 A;  4RM3 A;  1Z3X A;  4JX4 A;  5LEK A;  1SD4 A;  2QUF A;  3U2R A;  5IOY A;  2VIX A;  3FXO A;  1LQ1 A;  2STT A;  1BC8 C;  4KMU X;  3M8J A;  4RGS A;  3OYD A;  2UXN A;  1O4X A;  3HOV J;  1TP4 A;  1USS A;  3G3Z A;  3LQR A;  4I01 A;  1OR7 C;  3A2K A;  4X6A J;  4A3D J;  2L7Z A;  2FSW A;  1R49 A;  3HOW J;  3KIO A;  4HG2 A;  1V5F A;  2M45 A;  2JUC A;  2EFO A;  2P7V B;  2CO5 A;  4IHX A;  3ZMD A;  3MKW B;  4YG2 F;  1ODD A;  2VKV A;  2VOD A;  1K4T A;  1IW7 F;  2CQQ A;  4XRS G;  3GTJ J;  1HF0 A;  1QPM A;  1YW8 A;  2IVM A;  2ZCW A;  1MDM B;  1H89 C;  4BE2 A;  5ILS A;  1XD7 A;  2QGU A;  1LEA A;  1BR4 A;  1TWA J;  1MD0 A;  3CES A;  3L2V A;  2XAU A;  3ISP A;  3HOY J;  3K10 A;  4G6D A;  1BOB A;  5IOZ A;  1YRN B;  2E2I J;  1Z7U A;  4IHW A;  1FP2 A;  3FXM A;  1HW1 A;  3SFI A;  2DI3 A;  3DU5 A;  5KK1 A;  1UZC A;  3R6S A;  1TWG J;  4HBL A;  4ZYE A;  1U9O A;  2IXS A;  5D5V B;  3IWZ A;  3MCZ A;  3ZCO A;  3PIP F;  4S0H B;  1BI0 A;  1PP8 F;  5C4X J;  2OUM A;  3CMY A;  3DCF A;  2R3S A;  1IF1 A;  3ABM H;  3BR1 A;  3K0L A;  3JCU C;  3CME I;  2M8G X;  4C2M J;  2MD0 A;  4D0P A;  3H3V K;  4MO7 A;  1R23 A;  3BPV A;  3N4M A;  2XF6 A;  3IV5 A;  2QM3 A;  2VBX A;  2CSO A;  3S3O A;  1TBX A;  4BL0 B;  1P7I A;  2IGK A;  3FXU A;  5F0C A;  4HYE A;  2KIQ A;  2L9R A;  2Q0O A;  3K70 D;  4F91 B;  2ICW G;  3AG2 H;  3KZZ A;  3MN2 A;  2LYC A;  3EPZ A;  1J59 A;  1R5G A;  2HI3 A;  2R7F A;  2DOA A;  1H88 C;  3KX2 A;  1IV6 A;  5D4S A;  2HKX A;  4PFO A;  3LSH A;  4O6J A;  2HQN A;  5FKO A;  4LIV A;  2K02 A;  1YO5 C;  4BNC A;  3FXK A;  4EJT A;  1MMS A;  4E7J A;  1WJC A;  1UFM A;  2NAZ A;  3DPL C;  3TGN A;  2H94 A;  3W6J B;  5HLI A;  4V19 K;  1R1U A;  2NXN B;  4RAZ A;  2E1M C;  3GXO A;  1T6S A;  4BY1 J;  3K70 C;  1YJ9 I;  4J19 A;  2VKE A;  3FZV A;  1RC9 A;  2WAF A;  3BWG A;  2CRG A;  3WTZ A;  2P6T A;  3MZ8 A;  1H0M A;  2PFB A;  5DTD A;  5J3L A;  1BI1 A;  2HGC A;  2YX4 A;  3K4N A;  2UV1 A;  3RI4 A;  5JVG F;  1SD6 A;  4Y17 A;  4XID A;  1W5T A;  2K85 A;  1TT5 B;  3KZY A;  5GAG J;  4XL9 A;  1Z6T A;  1K83 J;  3JTH A;  1FP1 D;  2M0C A;  4NC6 A;  3ERE D;  2Z9O A;  3J7Y J;  4WK8 F;  2MH2 A;  4YRV A;  2LC2 A;  3IKV A;  3HUG B;  3U21 A;  4RB3 C;  3HRT A;  5HLG A;  2JK3 A;  3CTA A;  2IP2 A;  2NNN A;  5C4J J;  1QA6 A;  1FMW A;  1YI2 I;  5ILV A;  3VYU B;  1MKM A;  1D0Y A;  2GXG A;  4G6Q A;  3WE2 A;  2RV8 A;  3BZK A;  3R0J A;  4HZF A;  4CDG A;  4IHS A;  2F4M B;  4ASN A;  4CYC B;  2R7S A;  2RQQ A;  4BQA A;  4U87 A;  4ZTJ A;  2Y0S N;  4Y33 A;  5EGO B;  2O8K A;  1MGT A;  5JI6 A;  3V7C A;  4WXH A;  3HXL A;  2LLK A;  1IN7 A;  2JZY A;  2A05 A;  1APL C;  2FE3 A;  5LEJ A;  3ASO H;  2OA4 A;  2QEN A;  4KIF A;  2GLO A;  4A3F J;  2HOT A;  1TWC J;  2ZB9 A;  2XAQ A;  3M8E A;  2OTJ I;  4JQF A;  1KZH A;  1WI9 A;  1YW9 A;  1FBQ A;  3DBR B;  4RLQ A;  2XPW A;  3HPG A;  4HEA 2;  3VDX A;  5E3O A;  3B73 A;  2H1K A;  1LDD A;  1JTX A;  2XB5 A;  3OOU A;  3KP4 A;  5DCM A;  5E1Z B;  4KYW A;  2MLG A;  3OIP A;  4LK1 F;  1XPX A;  1JJ8 C;  4LG0 A;  1B1B A;  1TZL A;  1YJW I;  3L00 A;  1K6Y A;  1MMN A;  2CW0 F;  4BGD A;  1W0T A;  4CXF A;  3BTC A;  4OAY A;  4HLX A;  2Y2Z A;  2X9D A;  3WTT C;  1U2W A;  4IL6 C;  2LBF A;  1FBU A;  3W2W A;  2PN6 A;  3OYA A;  4J00 A;  4OU0 A;  3R60 A;  3D1N I;  3BZ6 A;  2OQG A;  3LAJ A;  2D1V A;  3FIW A;  4F52 A;  2ELH A;  3DBH B;  3CMM A;  3ZQL A;  4L0Z B;  3LL7 A;  1WJF A;  2BYV E;  1OYI A;  3ZQI A;  1T98 A;  1HLV A;  3HOU J;  1BA5 A;  3KFW X;  2HNH A;  2QLZ A;  3P9K A;  3SZT A;  2GIZ A;  1XSD A;  2CQN A;  1MSF C; 
#chains in the Genus database with same CATH homology
 1UZC A;  2KFD A;  2L9V A;  2KIS A;  2LKS A;  2K85 A;  2DOF A;  2KZG A;  2DOD A;  2B7E A;  4FQG A;  2JUC A;  2DOE A;  2E71 A;  2KIQ A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...