2CQNA

Solution structure of the ff domain of human formin-binding protein 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the FF domain of human Formin-binding protein 3
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Formin-binding protein 3
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2cqnA00
2K85A 2DODA 2CQNA 4FQGA 2E71A 2KISA 1UZCA 2DOFA 2L9VA 2KZGA 2KIQA 2JUCA 2B7EA 2DOEA 2LKSA 2KFDA
chains in the Genus database with same CATH superfamily
1FY7A 2WY8Q 2ZFWA 5FB2A 5F0HA 1DDNA 3LSJA 2OC6A 1UCRA 2EBIA 1GV2A 1HSJA 1C0WA 1FMWA 5DUIA 1ETOA 3Q3SA 5GADJ 1KA8A 2V6EA 2MA3A 4ENKA 1F43A 2M87A 2BY3A 2BE5F 5TGTA 1RR8C 3SFZA 2K86A 4RGSA 5HDNA 3KETA 1FOWA 3CTAA 2ZC2A 3ZMTA 3DKYA 1YLFA 4XLPF 2QA4I 1BJAA 1XSDA 2DTZA 2UXNA 1XCBA 2VLAA 2PI0A 1W5TA 3HRTA 3REOA 3LSPA 4HA8A 3OSFA 1P4AA 3V4GA 3J7AY 3L2WA 5F0FA 1RETA 2RC4A 2NVUB 1XSXA 4BXUA 1XD7A 3N4MA 1IDZA 5LEJA 4CCOA 2LC2A 1GHCA 1W7PB 2FOKA 4KMUX 3WTUC 2JA5J 2K3PA 1E3PA 4C2TA 1R5GA 2X6OA 1N25A 3L2UA 1PUFA 2BHYA 2ZSIB 4RGXA 5J4VA 2DA6A 1ZYRF 4YFKF 3SDBA 1SD6A 5CVIA 3CDLA 2K5CA 4U7BA 2XPUA 4CCMA 1CF7A 3DXJF 2WY7Q 1E0EA 2JUCA 1TNTA 5F04A 3AL0B 2UZKA 3RZDJ 3NARA 1TQIA 3UNGC 2XGCA 3G4SI 1V55H 1WJFA 3M7GA 1VQNI 3WGGA 1ZREA 4P96A 2XKPA 4JX5A 4RM2A 1YIJI 2NVQJ 1O7LA 4HEA2 5J6XA 4P9FA 2Z99A 1KQ8A 1UHWA 1RKWA 4TV7A 3K10A 3CUQA 3G3ZA 1RZ4A 4PFOA 3UR3C 1P4WA 3CCRI 3ONQA 3HOVJ 5JI6A 3CJRB 3H9GA 1R4NB 2BVMA 1MDMB 3GF2A 1HDPA 2AO9A 2M7AA 3RPUA 2NNNA 4U0VA 2VOPA 2L54A 2H27A 1YOVB 5B66C 5EYRA 3KEYA 2NRAC 3GTPJ 3QYEA 1Y56A 2IW5A 3ML6A 3CCUI 1OCOH 2CV0A 1QHHD 1SMYF 3BWGA 3W3CA 5A2QK 1P7JA 5E3LA 2LDUA 3PFYA 4YFXF 5K5QA 3A01A 2VKVA 4M3GA 3RTRA 1LPQA 1WPKA 2ACJA 1ONVA 2EFOA 3KCCA 1QPMA 3JW4A 1ETYA 2CW7A 3FMRA 4EV0A 1LEAA 1K78A 3U1KA 2QBYA 4J19A 2EV5A 4OIQF 2IA0A 1T38A 3CJQB 2DPUA 2KDOA 4IX7A 1GVJA 2LP0A 2WADA 3PNYA 2JWTA 3GTJJ 4AUXA 2K9SA 1K83J 1QVTA 3V7SA 1D8KA 1BR4A 2DFIA 1ZAOA 3CESA 4W1UA 1YIOA 1ON1A 3OYGA 3KP7A 2WV0A 2F5VA 3QP5A 4BQAA 3S14J 4NC7A 2QSGX 2WAFA 3GYHX 3I71A 2GAUA 1JT0A 1MBFA 4N4OB 4N9IA 1Z7UA 3M8FA 1UHMA 1VQ5I 4XBFA 5EEHA 4BJ6C 5HS8A 1KQ9A 4AU7A 3K4MA 2CMPA 4M74A 1S72I 2DK5A 2ZJPF 3I54A 4R1HA 1QA6A 2PJRB 1UAAA 4IHSA 4MEYF 5EDNA 3ZXSA 2E60A 4R8HA 3F8FA 4JBAA 3WU1B 2ID3A 5FROA 5IP7J 2CYYA 2DLLA 2PMUA 4V19K 5CLSA 2FF4A 5B5EC 1YG2A 3CJNA 3DBHB 3EYYA 2OBPA 4D7MA 5LEKA 2CV1A 2PMZA 3LAPA 2Z5UA 1WI3A 1Q1VA 3MZYA 2CGPA 1HC8A 3WG9A 2R7TA 5GPCA 3IL2A 4NC6A 3ABUA 3HTSB 4ABZA 2K85A 1OPCA 2HZDA 5C4XJ 2ESHA 5E1ZB 3EUAA 2RREA 2L7MP 3BR3A 4IRHA 3X2QH 5JFRA 3QQAA 3F8NA 1GUUA 1TW2A 4KA4A 1MBGA 1USTA 2QLZA 3F8MA 3H0DA 2V7FA 1FOXA 5K5RA 2HU9A 5CVVA 3M3YJ 2DI3A 5HS7A 4LFUA 2L2OA 1D8JA 3I9V2 5TRDA 4CZZA 2QGUA 2GXGA 1W4MA 2EZLA 4LLNA 1SD5A 4LG0B 1ZLJA 2X1CA 2LK2A 5D5UB 2X6YA 5IYDJ 5H20A 3WTWC 2A6TA 2I8DA 4BBSJ 2XF6A 5IT9K 2J5OA 2IGOA 4ZH4F 2FBHA 4ZYGA 5LGUA 1WJDA 4E70A 1S5LC 5IOZA 1YE9A 4HQEA 3H1CA 1RUOA 3IC7A 4KMFA 2BW3A 3ISPA 2A5WA 4Q48A 4CUGA 4EEFG 3VEPA 2I10A 5IP9J 1DU0A 2ZJRF 3ZPLA 2DT6A 2DT7B 1V3FA 2MH9A 1J75A 1PVEA 3GZNB 4RM3A 2IJLA 4DYCA 4XKVA 3HSFA 3H9JA 3GFLA 1SFKA 4JX6A 5FLMJ 3TQNA 3QU6A 2X48A 2Z16A 1IUFA 2W85A 1TC3C 2M0MA 1Z21A 1FYMA 4RB2C 4E7LA 2FD5A 5ICFA 1GVDA 5ED4A 1KZHA 5CPRB 1PYVA 2DA7A 2KKOA 3O8HA 5F64A 5FKNA 3BLYA 1BM9A 2DFHA 3HC7A 2R4GA 5DYMA 4AYBN 1BIBA 3CCSI 3MAJA 2R5YB 2P8TA 1YX5A 5DM6F 4CHUA 1UMQA 3ABMH 3PSFA 3WTTC 3QODA 4ZTJA 2Q8KA 3PO2J 2P5VA 3B73A 4Y3OA 2DMTA 3IH4A 2Q2EB 4YELA 2BY1A 4F92B 3WU2C 2Z3YA 1XPXA 2IA1A 1IN5A 4UVCA 3P9CA 4AIJA 4H0EA 1E3OC 2CJJA 5E3OA 4BHPA 5HLHA 4D5CA 3C2BA 1OCTC 3CC7I 1BBYA 1G59A 2AHQA 1I39A 3V8LA 2ZBKA 4D7NA 4J00A 2GIZA 3PQKA 3DQVC 3BR5A 5CQEA 2RN7A 4GO1A 5DDGA 5L3GA 3MD2A 3V8JA 4IL6C 2QSFX 2E35A 4MTDA 4HNVA 4LLGF 2JT1A 2ZCWA 2F4IA 4IXAA 3TP3A 3K4NA 2M0CA 3BDDA 3C18A 3GXOA 1R5HA 5HNHA 1MNDA 2L01A 5L3DA 1V4RA 3JRBA 3AAFA 5DD4A 3ELKA 5K7FA 9ANTA 3ZQFA 5L3EA 4N9HA 4BE1A 1MH4A 6PAXA 3F0CA 3KYDB 2VN2A 5J1UA 3O3KA 1DPRA 4XRSG 3SJMA 3OYHA 3IP4B 5JHUA 3BCAA 2NYXA 1RIOH 2A05A 1Y8RB 1SC7A 1MNEA 1F36A 4XLEA 3FX3A 2R7ZJ 5BS6A 3BR2A 1QO0D 1GV5A 2HXOA 3CCVI 3KEOA 3I0TA 2F6CA 2CG4A 2H6CA 1U3EM 4RGRA 1HLVA 3J81K 2D1VA 2KISA 1T95A 4A0YA 2CW0F 3KYCB 4E7KA 4XORA 4BGDA 4KISA 3DBLB 3ZQGA 4ESJA 3I56I 5FGMA 3AL0C 4V2GA 3K2AA 1UG0A 2E2JJ 4UV9A 4PSWA 4WXHA 3ZMSA 2OQRA 1SD4A 3CCYA 2MD5A 2M2EA 2KQRA 3BP8A 3ZQIA 3EETA 2O8KA 1NTCA 2K9MA 3SHFA 2V1UA 3HOXJ 1SD7A 2ELKA 3QOEA 3A03A 4WXDA 3H9QA 2JN6A 3R61A 3DFGA 2MYSA 4GXOA 3LA3A 5LGTA 3OSGA 3DU5A 1LNWA 3DTIA 4H4KC 4I99C 2QEXI 2F5FA 3S3OA 1YRNB 1E17A 5GTIC 1YTYA 1MMNA 3F22A 1J09A 2HQRA 4A6EA 2XUBA 4RMNA 1MKMA 4DYRA 1Z0XA 4MQVA 1PP7U 3EUHA 5FRMA 3PIOF 4AIDA 2QQ8A 2BGCA 4L9VA 2PG4A 2R7QA 3DKWA 1XN7A 4JK1X 4ZDLA 2HDDA 3GTKJ 4XKWA 3U2RA 4NHJA 1D0YA 1QZEA 5E18F 2GIVA 2DMNA 4A5MA 4PJ0C 5E1XA 3K1NA 2STTA 4KITB 1KU9A 2CW8A 3RQ4A 2VQHA 1WWXA 3MZ8A 3AG1H 2RNGA 1H9TA 1KU7A 2O5RA 3I59A 2WAQA 3ZQLA 2OU2A 2E7XA 5LHGA 1G3WA 2XAHA 2JA8J 3PL8A 4LGWA 1OCRH 2E1CA 2D45A 2OJED 4KIFA 5M5WJ 1T39A 1TT5B 3I4MJ 5J47A 3V7RA 1LVAA 1K6OA 2KZVA 2VJJA 4DOZA 4HOBA 2Z33A 1D5YA 2JMWA 5IT9Z 3UKGA 2EIMH 2WBMA 1XGOA 2CU7A 4M3FA 5L3CA 4HG2A 2OA4A 4BQOA 3F8CA 1L0OC 1YQAA 2QQAA 4B48A 4OOIA 1ETXA 2JA2A 5F08A 4M9ZA 2EIKH 2LY2A 1DP7P 4IQ4A 2MBFA 1VI0A 4M71A 1MBKA 2L9RA 1ENHA 2K3FA 3EYIA 1A6IA 1ZQ3P 4RB3C 3HHGA 1B9MA 2QCOA 2MG4A 3KEQA 4IOAF 1ZRDA 5GP9A 3GUDA 4FHTA 4LK1F 2M45A 3K69A 2RQPA 1FYLA 2MC3A 4CH7A 3J7AO 2HVQA 3N97A 1W36D 1Y1VJ 2IS2A 4EMSA 2PQ8A 2XV4S 4I76A 3M9AA 1LJ9A 2LY1A 2QSHX 4IHYA 3DBRB 4KFCA 5DCMA 5ILUA 1A31A 1MZBA 4JOMA 4BS9A 5EF6A 1WQ2A 1YS7A 1IXSB 2UV1A 1ZGAA 3SEZA 3T8TA 3BJ6A 1J5YA 1KGSA 2KJBA 2WA0A 1P2FA 1J2XA 3Q9VA 1ZRCA 1TQPA 3ECOA 4A3CJ 1X3ZB 4G12A 4PJJA 4M9XA 2IBDA 2LD5A 4G7OF 1QZYA 1WJCA 4CYCA 2HOEA 4C3IJ 4KN7X 1FC3A 4C2UA 2NOGA 4MHGA 3WU0A 5BQTA 1WRJA 2EV6A 4Y15A 3HL2A 2VPRA 5FLVA 3H5NA 3I64A 4E7JA 2KL4A 4N4NB 2LSOA 1IN6A 3TO7A 1U5TB 2NVYJ 4A3MJ 2BHZA 2DW4A 3Q0WA 1HOMA 1STZA 2VB6A 3TW7A 3RYPA 4AIHA 4A3KJ 2GA1A 2M4KA 2VJ5A 2X6WA 3RCOA 3VOEA 4KJZA 3A1YA 3MKWB 3B02A 3VSLA 1TW3A 1RKTA 2L3DA 3E5UA 2ZJQF 1MH3A 2O61A 4XK4A 3CZ6A 2R7DA 3V7CA 3L2VA 4UNOA 1J59A 5E3MA 5B1BH 3RQIA 1IN4A 3I5UA 2VE9A 3CO7C 4A12A 3HOYJ 1X3WB 1ETKA 3F23A 1I3QJ 3TGNA 5J4YA 1A36A 2VQLA 5M5YJ 2PJPA 1HSTA 4M6VA 1OCZH 4L5JA 4KNYA 2HVSA 2E1NA 3MN2A 1O57A 4BL0B 4DBRA 2P0WA 2V6CA 3PUFA 5E3NA 3F21A 2LF8A 3DPTA 5E8IA 4FQGA 4WF2A 1G4DA 1IRGA 1IW7F 3EUHC 3LFKA 2JPCA 3O8GA 2VOOA 2A6HF 1NG6A 1FBQA 1ZELA 3VWBA 2CQKA 2M7BA 5FD5A 1VZ0A 4PZJA 5M5XJ 3CMEI 1ZHFA 1JHFA 1KU3A 3BR6A 4RGUA 3WTXC 1I27A 3TW6A 3CCEI 2DA3A 4HNUA 1POGA 3FMSA 2F4OB 1W1WE 4HF2A 1JGSA 2K9QA 2LR8A 2DA2A 1BN5A 4BDYA 1SEUA 1L3LA 1JKRC 1RC9A 3OYJA 5HLGA 1HKTA 1H0MA 2LTPA 3DU6A 3H3ZA 3P9KA 2ISZA 1T98A 1YW8A 2DQLA 2R92J 2DOAA 1XC5A 3M1EA 3GBGA 3G6EI 3RJPA 2LBFA 2H1KA 4CXFA 3ZQ7A 5DEQA 2M9HA 3C7JA 3GX4X 1K78B 3S1MJ 3BQYA 4DIQA 2VQCA 2ICWG 2NS8A 3LFUA 4C3JJ 3W2AA 3DCFA 3ZRGA 2MC4A 4B09A 3FXKA 2HR3A 1BOAA 1SVMA 3EUKL 3CCLI 1X1DA 5CVJA 2FOWA 1TBXA 1U2WA 5JLXA 3A2KA 4EVIA 3CUOA 3A01B 2Y31A 1MGTA 1CQTA 4IRIA 1B59A 3CQZJ 2K9LA 4B3XA 3OYCA 2YSRA 3I4NJ 3SQNA 5DM7F 3JSOA 3TDZC 2PN6A 4ESFA 5J1YA 4B1RA 3VPRA 2DO7A 4MFEA 1IUYA 3OIOA 3MWMA 3FIWA 2G0EA 3K6GA 1DQUA 4I6ZA 3RDIA 1J0RA 1HKSA 3L2RA 2ZMEB 3T8RA 3IV5A 3HB9A 1SVOA 1I6XA 4WK8F 1R1UA 4L5EA 1TWCJ 1I3AA 5FKKA 4IQJA 4BHCA 3HRMA 2R5YA 3BY6A 4G6TB 1K61A 3IRRA 4IHVA 5IT3A 4XMYA 5DV5A 3B6CA 1SAUA 1IAWA 3FXLA 5FRNA 4FTHA 3DPLC 4F55A 5KAFC 5JR3A 1SANA 4RAGA 1JUMA 4BACA 3HIFA 1WJAA 3NAUA 1MBHA 2M30A 1ZN2A 3H0GJ 1WCMJ 2XB5A 3MCZA 4UUTA 3G2BA 2DYSH 5FJ8J 3KLOA 2HQAA 2JZYA 1P6RA 2C6YA 2BEOA 1SFOJ 4CCKA 3CD6I 2NNYA 3OYBA 3BQZA 4RAYA 3HSEA 1KYZA 4I0BA 4LG0A 3S2HJ 1OMIA 3BTLA 3HXLA 4LIUA 1MMDA 1R5ID 3FISA 3HDDA 1X3UA 4U88A 2W4SA 3L7WA 3FXQA 3LQRA 1VQ4I 1X58A 3E6MA 1CGPA 4XLNF 1V54H 2X1DA 2LREA 1JTXA 4XN0A 1FWZA 2VT3A 1SFUA 1CF7B 4HV6A 3FXOA 4GGGA 4PK4A 4AC0A 3W6VA 4B4CA 4YG2F 1OKRA 4BEHA 4Y33A 4LITA 2VE8A 1AA7A 1B8IB 3G73A 2X85A 4JP0A 3CCMI 3LSHA 2KJCA 3FBNB 1XDUA 4FETA 1O3QA 1Z7LA 5GTHC 4KYWA 5LRRA 2AQFA 2B63J 4ZC3A 3ZP5A 3CP2A 3FBIB 1FBSA 1IO2A 4MQ9F 5E1WA 5ERIA 4E7ZA 3SFIA 3GLXA 3KX2A 1NHAA 3O6BB 2V1DA 2LKXA 1G3TA 3LMMA 2Y2ZA 1O3SA 1T56A 2XPWA 4L0YB 2KPMA 1Z77A 3QRFF 3KYLA 1YW7A 5ICGA 3E3VA 3E6DA 3ZQHA 2RAEA 1HKQA 4O3MA 3ASNH 3V42A 2EB7A 1MW7A 1OISA 4IVNA 2OZ6A 4S05A 5EGOB 2DQRA 1EH7A 3WG7H 3ESWB 1HW1A 4XM3A 4EGZA 4E7HA 4DZJA 2HQNA 5E20A 2P7CB 2V9PA 1JTYA 2OTJI 2VONA 4ZYEA 4X6AJ 1D0ZA 4YEJA 3JAMZ 4FE7A 4ZTFA 4HRIA 1KQ0A 3CLOA 3E1SA 1TP4A 3M07A 2EIJH 1XMXA 1FBUA 3HYIA 5GPAA 3OS0A 1ETVA 2W25A 4LK0F 5E8GA 2IEKA 2FJ1A 4FX0A 2COBA 4Z6YA 2HXIA 4BE0A 2ME6A 3HUGA 3L09A 2V9KA 4EJWA 1OYWA 2FQ3A 2QQ9A 3E6CC 2IGNA 2VL8A 3SZPA 5K5OA 2QKLB 1ZK8A 3OYFA 1WHUA 3W2WA 4A6DA 5LBQA 5B3SH 1BC7C 2BXZA 2HFHA 4P5OA 2DN0A 5E79C 2HS5A 2HEOA 3QPSA 2XROA 1B72A 1QNTA 5DCFA 1FYKA 4D0PA 3GTLJ 1MBJA 5ILVA 5HDKA 4G94A 2R3SA 1A6QA 4UXNA 1IV8A 1OYYA 4ZJZA 5EG0A 3PM1A 4M3EA 2DXIA 4DBQA 2HTJA 2VC1A 2HZTA 2LMDA 1MSFC 4O6JA 1FP2A 2K4BA 4ZYHA 2YPRA 5BPIA 1AKHA 2E5NA 2M1BA 2QQBA 2BVLA 1G2HA 2KIFA 3M8JA 2JRMA 1YFHA 5TJJA 1SVLA 3ABKH 3W6KB 5CJ9A 1BIAA 1HQCA 5HNFA 4Q47A 4DNCA 4A3GJ 3CDIA 1QGPA 2P5KA 1ERDA 2KDZA 3GFJA 4CCLA 1ORKA 2A5YB 4IHWA 3OOUA 1TWHJ 4AVZA 3CP8A 2OZUA 4MNUA 2HKXA 3OR1C 2WAQN 1FJLA 2VODA 4D9JA 5D8KB 5D5VB 1QZZA 3F6OA 4ENJA 1VQKI 2DJIA 2Y69H 1P92A 3F6VA 2I5UA 1Z91A 4NNJA 1U8RA 1FTTA 3VYTB 2COMA 1OYIA 1R9TJ 1LQ1A 2VXZA 4I01A 2PLYA 1S29A 2E1MC 1B8IA 3ABLH 2R7UA 5GAEJ 1ZGJA 2R0QC 3DEWA 3S2WA 3OS2A 4YIIA 1SAXA 2VI6A 2Y30A 1I1GA 4A3FJ 2FU4A 3QOPA 4QPQA 1K7AA 3P5JA 2MLGA 5EEGA 4N0BA 2DDBA 3ZMZA 2JA7J 1XGSA 2H94A 3KFWX 3BG5A 4IHTA 3IUOA 2DK8A 5H2FC 2DDAA 3K4CA 4EM0B 3P9IA 4BH9A 3TL4X 1Y8QB 5AIPA 1VQLI 4J01A 1DGRM 4C2MJ 2V4JC 2QVOA 3K70D 5D8LB 2TRTA 3KZYA 5IOYA 2EFPA 1A04A 2H6BA 3WTZA 2GQQA 4XKCA 1HBXG 3PO3J 1MDMA 2DOFA 3OS1A 4NUBA 2BW3B 3WHCA 1AKHB 2LKSA 2R5ZA 1IV6A 1YS6A 1GLNA 1Y0UA 3HGGA 3HM5A 1Z1DA 2JK3A 4RB0A 3U1DA 3AG3H 1ZTRA 3CMYA 4OINF 2VBXA 5D5WB 1VTNC 4F91B 3CO6C 2F48A 2RGVA 1ZG3A 4I7HA 4HF1A 3KP5A 4ANJA 1MJ9A 4HX8A 1R7JA 3BJOA 1B4AA 3MMYB 4LB5A 3PQJA 4XN3A 2QBYB 1EF4A 1R58A 3DTEA 3OL4A 4HDVA 1R6RA 2E19A 3HOWJ 2DT5A 2O6GE 4XOPA 1MNMC 2Y0MA 2NVXJ 1B72B 4EM2A 3LNQA 5DCMB 5J3LA 1K4TA 4BYYA 1APLC 4HZFA 4MGRA 2BBYA 2QUFA 1P9QC 1X2NA 1DP3A 5KHDA 3FKIJ 3IRQA 2IS1A 2Y75A 2LNBA 2E5ZA 5EZHA 3B6AA 2DJNA 3BR1A 5J8FA 4RLQA 3HPHA 3RKXA 2BV6A 1X1PA 3G1MA 5K7HA 2NOJB 3TOAA 1O7FA 2NXNB 1SFXA 4M73A 4PJLA 1VQMI 4DYQA 1IC8A 3A0HC 2IA2A 1D5VA 4FISA 1NG7A 2LG4A 1DUXC 2XC7A 2ESNA 2K9NA 2LF7A 1PJRA 3WE3A 1X2MA 4XL9A 5CYVA 1YI2I 4E6KG 3BTCA 5FO5A 2NAZA 3TDUC 1HXDA 2LYCA 2XRLA 5AIQA 2TCTA 5D4SA 1BL0A 2JA6J 2K40A 4ZDOA 3GCMA 3Q5FA 2W1OA 1QQIA 3LSMA 3OV8A 4BKXA 1D1CA 2E2HJ 2FRHA 3GMEA 1I5ZA 4UUSA 1ZGWA 1J7KA 4XICA 1MJBA 2L7KA 2VJ4A 3CMAI 1F9NA 1VQOI 2F5DA 4KICA 1FLIA 1ZG1A 1UG2A 4O5VA 1GXQA 3J80Z 3OYLA 1I50J 3OL3A 1PUFB 2RKHA 1JJ8C 2W00A 2A69F 4KIGA 2VBWA 2D1HA 3RKQA 3H5AA 2G9WA 2X0LA 1JXSA 4OIOF 1RR7A 2ZNZA 4KIBA 4M6YA 5KNLA 5BPDA 2DU9A 1WKMA 2P4WA 1ETQA 1BI1A 2Y9YA 3D5SC 3MKLA 2GWRA 2KRHA 1B6AA 2ISYA 3LSRA 3DWLE 1RPWA 4OIPF 2GM4A 2VASA 3PIPF 2DMPA 2HQ5A 4A3EJ 3OR2C 3WTVC 2XSJC 2NVTJ 1XMAA 2GZWA 2X51A 2LLKA 4CICA 2M4GA 2CS3A 2KP6A 2V9VA 2JQ7A 3ROUA 4OIRF 1OJLA 4CGZA 1QRYA 2HTSA 2HKOA 2WB1N 5IY5H 4BUPA 3C2HA 1BR1A 2HOSA 1XGNA 1Z9CA 2DPDA 1IF1A 2H8WA 1SMTA 4D5FA 2Q0OA 2MLKA 2R5ZB 1YYVA 4IZZA 2H09A 1D1BA 2DMUA 4IOCF 3S93A 2IGMA 3K4BA 4KT5C 1HW2A 1IXCA 3JCUC 1Z05A 1AOYA 3IWFA 2K4JA 1S9HA 5EG0B 2EFNA 3E5QA 2V79A 3F8BA 4BJTA 4DW6A 3JRCA 2DFEA 2A3SA 2CRGA 3A02A 3GTOJ 4G7ZF 3W6JB 3KE2A 3AFHA 4PUSA 3RIRA 2VQGA 5C4JJ 1NK2P 5IPAA 4IPAA 4AWXB 4EATA 3I55I 4HX4A 3FXMA 1WJBA 3VB2A 1U8BA 4EJOA 2E36A 3ZOBA 5L3BA 2A6EF 3RPUD 3R4KA 2UWMA 1V5FA 2H8RA 1FP1D 4MTEA 1FPQA 2WWYA 2EPFA 1TL8A 2XIGA 1FZPB 2E1MB 2CUJA 1JUPA 1BI2A 2PFBA 3H5RA 3O2PE 2F2EA 3H36A 3S32A 3DTKA 2OCEA 4MLOA 3JR9A 1T0FC 3BROA 2BZTA 5LHIA 2STWA 5KK1A 2WAEA 3K1MA 1RUNA 4OAYA 2KIMA 3D5LA 2CFOA 2HDWA 3KP4A 3VSKA 3ZMUA 2ZNYA 4B47A 1IN8A 4BXFA 3JRDA 4BDZA 1YJ9I 5LGNA 4ESBA 4X0GA 1IN7A 2ECCA 3R0AA 5DS9A 2FNAA 5ICEA 3MFKA 1HA8A 3HHHA 1WI9A 2EQRA 4IRGA 4LOCA 3MKYB 3HOTA 1IG7A 4NC8A 5CQGA 3TO9A 3HJEA 1IZ1A 2KMUA 1Z6RA 2DODA 3BR0A 3R0JA 2R7FA 2Y0SA 1WVRA 4I09A 5M3FJ 4BXXJ 1DPUA 2ME0A 1R00A 1P4XA 1QBJA 3MQ0A 1R71A 4RAFA 2R7VA 2XAFA 3HRSA 2XVCA 3PNTA 4LB6B 4OU0A 2G7HA 2E71A 2Y48A 4XRSA 1Z67A 4NBQA 2VKEA 3OYAA 1LFPA 1G6NA 3WGHA 3CCJI 5FKLA 2XF5A 3J7YJ 3CUQB 1PDNC 1F5TA 1JJ6C 5DUKA 2W57A 1TWAJ 1WH7A 4XRFA 1UJ8A 5KAIC 2KIUA 3KZIC 3PFIA 4P1WA 5J40A 4IO9F 1QHGA 3V8KA 4BEHB 3NEUA 1Y0NA 4HLXA 4RDUA 5BMZA 1H89C 4IKFA 1N78A 2E34A 4OMYA 1W0UA 2IPQX 2LKPA 1U5TA 4HLYA 1NH3A 4U87A 4QPOA 3KIOA 4ZZDA 1T33A 1RNLA 4C9YA 2D5VA 2H1LA 1OFCX 3WTSC 4RS8A 1Y39A 5GAGJ 4II2A 2MGQA 1XG1A 3QAHA 1KYWA 3AG4H 2CWEA 2OV7A 3FXRA 2MD0A 2JTVA 2OD5A 1Y6IA 2QM3A 2XDVA 4A3DJ 2B9SA 1QVUA 3BZCA 3F3XA 1OR7C 5AONA 4U7DA 4P9UA 2IXSA 3L00A 1BI0A 1JHHA 1YW9A 2IT0A 2W84A 2WC2A 1B1BA 3FK6A 1MIJA 4U0YA 2K02A 3ZR8X 1QU3A 1X4OA 2ELJA 4UY8I 2EZHA 2GOXB 3E5XA 1S7OA 4AVPA 3L2CA 1U6GA 2XRNA 1IRZA 4XLCA 2DTRA 2XAGA 4HDUA 1USSA 4A3JJ 1PUEE 3NWSA 5H6RA 1JE8A 3L9FA 4LJZF 5ILSA 3AG2H 1OCCH 2IP2A 4WXCA 4E7SA 3GWZA 3SZTA 3FKJA 1YRNA 3JTHA 5C3EJ 2DCEA 2OUMA 2XAJA 2EA2A 4IF4A 1T08B 5H6QA 2O3FA 1LEBA 2EFWA 1BR2A 4ASNA 1YX3A 1M1EB 3MKZA 1TWGJ 3PJRA 3OYNA 1LB2A 1BW5A 2ID6A 2K7LA 1ZKGA 4XOTA 5K1YA 3CLQA 5FKOA 2EZIA 1Q1HA 4HX7A 4F93B 3QPTA 3I4PA 2PMZN 3S8PA 5BOXA 4CYDA 3FXUA 1R1TA 3DLLF 4ETSA 1P7IA 2WTEA 4BHBA 4IJAA 1W5CC 4GFBA 2CUEA 1EA3A 4JQFA 5F0CA 2ADUA 4ZZLA 1JI8A 4MIMA 1LDDA 1MD0A 3H3VK 5F6FA 2JVHA 1AHDP 4M6XA 2ELHA 4A2UA 2XAQA 2IS4A 4U0WA 2BXYA 3KP6A 4PGGA 2PMHA 3KPHA 2LY9A 5DD8A 5LLQA 1T0FA 1R4MB 3Q0VA 4PCQA 2A07F 3E6BA 4AIKA 4EJTA 3ZQQA 5D5XB 1UHSA 3JREA 2KRFA 3MVPA 1H8AC 5K7ZA 3QU3A 4HW0A 4ITVA 3EDPA 3EQLF 2ETHA 3BTIA 4QWQA 1BC8C 1X1CA 4NDLA 2JJ7A 3E97A 2JSCA 1UELB 3KP2A 2VUMJ 4A5NA 3RYRA 3SEQA 4WX9A 4Y7NJ 1WJ5A 5LHHA 2EK5A 3CDHA 2FMLA 3HSRA 4C3HJ 2VC0A 2HYFA 4F3QA 1VQPI 5FLXK 1MMAA 2ZJ2A 2A68F 3JRFA 4EGYA 2KZGA 3LSIA 2XHKA 3RSNA 2N8GA 1FIPA 2HDCA 2R7WA 2ZXJA 3U9GA 3OOPA 4FE4A 5HLTA 5EZGA 2EILH 3GFMA 2XKOA 4XSXF 3OYIA 3S16J 2CH0A 4LMYA 1Z6TA 2EV0A 3BCBA 2HOAA 2NS7A 4LD5A 1RRJA 4Y4RA 2M8GX 2VKDA 4G8XA 3DF8A 4BQNA 1WJEA 3ZQCA 4UB8C 4CO8A 2YS9A 3NQOA 1FNNA 3K4LA 3LWFA 3OIQA 4LG3A 2YU3A 5LFAA 1T6SA 1ON2A 2EA4A 2HOTA 3HPGA 1F4KA 3H3UA 3RPQA 2FMYA 3LA7A 5D4RA 1XCVA 4V2FA 2V1NA 3K0LA 2XASA 4MFDA 5JVTA 3ULQB 3CC2I 3OYMA 1TT0A 3S17J 2O03A 5HOOA 4PSXA 1S7AA 1WGXA 2VT2A 3ZCOA 1ZH5A 3VYUB 3K4KA 3KZZA 4JX4A 2HI3A 3NRVA 1YJNI 2O0YA 2Y0SN 2IRFG 2JVGA 2OAZA 5F27A 5F1JA 2WB1A 2OF7A 3HG9A 2HNHA 2EWNA 3G71I 4WWCA 3GZ6A 1BW6A 3FZVA 2M8EA 1K79A 1VQ7I 4L18B 4C30A 3W2VA 2P6TA 1EH6A 5GAHJ 5J8CA 4RLFA 2R7RA 3QPHA 2XB0X 2J5PA 2DOEA 4UUSB 3F9KA 1TLHB 5HDGA 2XGEA 2M34A 3CC4I 3F72A 1K4SA 3BC8A 3C1DA 4GRIA 1ZR2A 1HW5A 5HLIA 2FX0A 3OMYA 3DLAA 5FKMA 4BQQA 2HWVA 2PBIA 5D6FA 3Q9SA 2L9SA 2BYVE 3H35A 3VYRB 1O3TA 4B8XA 3FHZA 2VIXA 1I6HJ 2MW8A 1U78A 3I58A 4XONA 1H88C 4XLAA 2G7UA 2KHMA 2CFXA 2K27A 4A0ZA 4F7ZA 3TMOA 1V5GA 4B3AA 4M3DA 2BY0A 4ENNA 2VBZA 3R6SA 3CMMA 1LUJB 3A0BC 1FTZA 1JT6A 2FBKA 5CVUA 1PP8F 3J7ZI 4AYBA 2O8XA 2ZB9A 2JRTA 2UXXA 3ERMA 4FCYA 3D1NI 2Z9OA 1FIAA 2ZFUA 2LRDA 3LSTA 5IP6A 4E7IA 2F5CA 4YFNF 1ITYA 2FEZA 3DEEA 4OAZA 1Z3XA 2AQEA 4YRVA 1ZG5A 2W24A 1FOKA 4PJMA 4HQMA 5EEAA 2YUSA 1JUSA 4GDFA 2A61A 4Q4ZF 3BG9A 2WV1A 2JSPA 2FXAA 3ABTA 3PNVA 3T0YA 3WODF 3JAMK 1K6YA 1XB4A 4R79A 3HTUA 1N77A 1WZ2A 1GT0C 2JPBA 1D3YA 2RVCA 5JLWA 4QSHA 4UVBA 3M8EA 2YR2A 3OWTA 4FX4A 2TDXA 2QF7A 2ECBA 4G6QA 4XLHA 1YJWI 3HOZJ 4PFPA 4HV5A 1G3SA 3L2QA 2VJIA 2HVRA 2YX7A 2F4MB 3NWTA 2ZMEA 4OMZA 4GYIA 5IYBJ 1UB9A 2V1XA 3TO6A 2XPVA 1EJ9A 3ZN1A 2XAUA 3S3NA 4BE2A 1ACIA 2ZXHA 3S1RJ 2L0KA 1DGWY 1UZCA 2FSWA 3C2GA 4A69C 3BPXA 1MMGA 2B0LA 1IJWC 4XRMA 5FLXZ 2LOOA 2OTLI 4L5IA 3G1LA 1BA5A 2EJRA 4M3BA 3JRAA 5EJCA 3ZMVA 4A93J 1ULYA 4GCVA 5CKTA 2EFQA 1W7PD 2EZKA 3TP0A 1TWFJ 4QIWN 4L9TA 5HVQC 3FHNA 2X4HA 1S8NA 3OYEA 2HYGD 1A5JA 1FSHA 2LH9A 2R7OA 3LAJA 3WE2A 1YO5C 1OQYA 4MO7A 3J80K 2DBBA 4G6DA 4PGHA 4L0ZB 1J9IA 2FBIA 2X6XA 1XS9A 4Y13A 1TTYA 4G9YA 1FMVA 2E1OA 1JKPC 1LE8A 1FX7A 4I0AA 3S15J 1WFXA 1FSEA 2IVMA 4CA0A 4HNTA 1BJZA 5LD2C 1MBEA 2ZO4A 2HPIA 4BNCA 4UHTA 2KFDA 4HAMA 2CUFA 2VXDA 3PUBA 4DJAA 3QYFA 2CUZA 2W7NA 5FFZA 2M5WA 4MEXF 3KLNA 1G3YA 2MSYA 1IXRC 2DAOA 4HYEA 4UB6C 4EJUA 5KVRA 1ETWA 4XR6A 1D1AA 3ZMDA 1ZRFA 2OPTA 3GTMJ 2CQQA 4AM3A 1EV7A 3CF2A 1S6LA 3ERED 1RI7A 4LLLA 2IS6A 3BPVA 1XGMA 1R36A 3IAS2 3WTYC 2AS5F 2EH3A 5C44J 4UUVA 3TEDA 1LFBA 2FUG2 3K9TA 2VBYA 4KT6A 2L4MA 3RI4A 4CYCB 1G8XA 2KT0A 4A0XA 1XX5A 1VNDA 2AXLA 3E0JB 5FFXA 4E4HA 3FK7A 1BI3A 3CUQC 4A3LJ 3H92A 1XMKA 1KONA 5TISC 4KUMA 3FXJA 1FT9A 3K1PA 2O7OA 3LA2A 4A3IJ 5LRSA 2PX9A 4BU2A 3D5RC 2ZSHB 3CCQI 2DMQA 3KP3A 2MH2A 1TQMA 1MMSA 3K2ZA 4HSRA 3RZOJ 4Q5SF 2AXTC 4YIRX 1UFMA 3HBLA 4B43A 4BY7J 4PJNA 3R60A 3FMQA 2DYRH 2QENA 3BT9A 2Z1DA 1HCRA 3TBIA 3BG6A 3QP6A 3E7LA 3K70C 2L9NA 2CV2A 1LVKA 2OQGA 3IHUA 4Y17A 2W82A 4RBOA 3SDGA 2HPMA 2DA5A 2VKHA 3ECHA 3GTGJ 1DU6A 3M1CA 3T1BA 1EKEA 3DP7A 1O4XA 4GYGA 1VFCA 3JTGA 3GEZA 2X9DA 3A4CA 3DV8A 1AWCA 2CO5A 4ZYDA 2XSDC 3JRIA 3AKZA 4QLCU 4A3BJ 3M4OJ 1R22A 1VF9A 1IRFA 1REPC 1B9NA 4L9JA 3QWLA 1FEXA 4M72A 3RKYA 2B7EA 3TKYA 3HGYA 1GDTA 3P7NA 4L9NA 1X4PA 3JRGA 3GW2A 5JHFA 3S1QJ 3HRUA 1IDYA 4XNFA 2FQ4A 3DPUA 3QYBA 1ZLKA 4II3A 1IGNA 3VDXA 4UVAA 1I1SA 2Y9ZA 1W0TA 4DZPA 2L5QA 4RA2A 1QPIA 2IGKA 3VFZA 3IKTA 4QTRA 1YITI 3HUGB 5HODA 2CQNA 3C3WA 2EINH 4ZYAA 2KIQA 2Q2EA 4BJ5C 3MZHA 3K7AJ 2L7ZA 2LVSA 2L7FP 1KU2A 4B44A 4BAYA 4G7HF 1O3RA 1S7EA 3BZ6A 1SFEA 1X19A 3U21A 1LKXA 3WGIA 1R49A 4KDPA 4IEJA 4YIFA 2PJRA 2NS0A 3SZGA 2YU9J 1W5SA 4Z2YA 2M3AA 4CDGA 2XF7A 4XLFA 1TNSA 4K2EA 2L4AA 4D1QA 4I98B 1W36C 4Y52J 3S3MA 3BJAA 2RDPA 3Q0UA 1WH5A 5A2QZ 4XIDA 3WHBA 1MSEC 3GTQJ 3OY9A 1U9OA 3GVAA 3VYSB 2MFZA 4XSZF 1IRXA 4BY1J 3GLLA 3GO5A 1T8IA 1HF0A 1N75A 3IAM2 1ZR4A 3LQQA 3FF5A 5JVGF 4P55A 2P5LC 2GXBA 4CCJA 1LDKB 4NQWA 4CCNA 2F5EA 4XQFA 3OIPA 3RKWA 1JGGA 5F1RA 3HOSA 4FT8A 3J81Z 2FA5A 2R93J 2RNJA 3HZJA 1U0JA 5CVRA 5DTDA 2R7XA 4UV8A 4HF0A 3CJTB 5E17F 2P7VB 3OYKA 4EQQA 1GXPA 3S1NJ 1JKOC 2GXAA 3T5XA 1Z3YA 2W48A 4JYKA 4I2OA 3IKVA 1F1ZA 2CQXA 3EPZA 1HDDC 4NB5A 2OCCH 2CSOA 3ZGKA 1X1AA 1VQ6I 1E3HA 1TZLA 3QPLA 4RB1A 2P6SA 3LSKA 3MEXA 1WSUA 1D0XA 2ZXWH 5B1AH 1S3JA 1MJAA 2GA2A 2L02A 3DKXA 3JRHA 4HSTA 1BOBA 1ZARA 2KRCA 3I53A 3HKZA 1OCPA 2JUGA 2YX4A 2QZ8A 2BY2A 3BZKA 1A35A 1E2XA 3IWZA 4X1EA 1V5EA 2E2IJ 2DFFA 3D0SA 2P81A 1JKQC 4LIVA 1H9GA 2ZKZA 3G1OA 3GZ5A 4EM1A 3BG7A 3LL7A 1OLTA 4ZDPA 2DA1A 4BBRJ 4PDKA 2GLOA 2Z2SB 2PEXA 2MABA 2CQ7A 1YHQI 1XSVA 2GBYA 2DA4A 2RQQA 2X1EA 5D6EA 5KCMA 2QWWA 1X1BA 3SYTA 1VQ9I 2IAIA 2QKMB 3HOUJ 4W97A 2GOMA 5BNGA 3LOCA 5M3MJ 3DEUA 4HPQA 3N05A 2XGXA 3I3LA 2UUZA 4KN4X 4WCGA 3PSIA 1LE8B 3SXYA 1T2KA 1XTAA 4OWRB 2HYJA 5L3FA 3HKZN 1R1VA 3I59B 4ON0A 1XDSA 3TOBA 2RV8A 5IYCJ 4EJVA 1ODDA 2V26A 4AD9A 2D2WA 1AU7A 2XGDA 3OYDA 2R7SA 4F52A 2VPLA 1W7PA 3FWEA 4ENMA 3ASOH 3BOQA 3IH3A 4NQWB 3L1PA 1FOYA 3GFIA 1U5TC 2HGCA 2E7WA 4I02A 3VODA 3FDYA 4RAZA 5ICCA 4DQ2A 5HS9A 2BOLA 2Q1ZB 1LDJA 4M9SA 1LFUP 4FASD 2FNPA 2O9LA 3BTJA 4CZCA 4IHXA 3BG3A 3ZN0A 5EGOA 2FE3A 2QYOA 2KLOA 2LFBA 2LBFB 1RESA 3FM5A 3HEFA 3CF5F 2ZXIA 4CSWA 3JSPA 3K4JA 4HBLA 2ZMEC 1EH8A 3FM3A 4XKBA 3LSGA 4S0HB 5J1RA 3IH2A 5FD6A 1Y1WJ 1NK3P 1VQ8I 1U9NA 2L9VA 4DGWB 4S04A 3S2DJ 1OR7A 1R23A 3COAC
chains in the Genus database with same CATH topology
2K85A 2DODA 2CQNA 4FQGA 2E71A 2KISA 1UZCA 2DOFA 2L9VA 2KZGA 2KIQA 2JUCA 2B7EA 2DOEA 2LKSA 2KFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K85 A;  2DOD A;  2CQN A;  4FQG A;  2E71 A;  2KIS A;  1UZC A;  2DOF A;  2L9V A;  2KZG A;  2KIQ A;  2JUC A;  2B7E A;  2DOE A;  2LKS A;  2KFD A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  2WY8 Q;  2ZFW A;  5FB2 A;  5F0H A;  1DDN A;  3LSJ A;  2OC6 A;  1UCR A;  2EBI A;  1GV2 A;  1HSJ A;  1C0W A;  1FMW A;  5DUI A;  1ETO A;  3Q3S A;  5GAD J;  1KA8 A;  2V6E A;  2MA3 A;  4ENK A;  1F43 A;  2M87 A;  2BY3 A;  2BE5 F;  5TGT A;  1RR8 C;  3SFZ A;  2K86 A;  4RGS A;  5HDN A;  3KET A;  1FOW A;  3CTA A;  2ZC2 A;  3ZMT A;  3DKY A;  1YLF A;  4XLP F;  2QA4 I;  1BJA A;  1XSD A;  2DTZ A;  2UXN A;  1XCB A;  2VLA A;  2PI0 A;  1W5T A;  3HRT A;  3REO A;  3LSP A;  4HA8 A;  3OSF A;  1P4A A;  3V4G A;  3J7A Y;  3L2W A;  5F0F A;  1RET A;  2RC4 A;  2NVU B;  1XSX A;  4BXU A;  1XD7 A;  3N4M A;  1IDZ A;  5LEJ A;  4CCO A;  2LC2 A;  1GHC A;  1W7P B;  2FOK A;  4KMU X;  3WTU C;  2JA5 J;  2K3P A;  1E3P A;  4C2T A;  1R5G A;  2X6O A;  1N25 A;  3L2U A;  1PUF A;  2BHY A;  2ZSI B;  4RGX A;  5J4V A;  2DA6 A;  1ZYR F;  4YFK F;  3SDB A;  1SD6 A;  5CVI A;  3CDL A;  2K5C A;  4U7B A;  2XPU A;  4CCM A;  1CF7 A;  3DXJ F;  2WY7 Q;  1E0E A;  2JUC A;  1TNT A;  5F04 A;  3AL0 B;  2UZK A;  3RZD J;  3NAR A;  1TQI A;  3UNG C;  2XGC A;  3G4S I;  1V55 H;  1WJF A;  3M7G A;  1VQN I;  3WGG A;  1ZRE A;  4P96 A;  2XKP A;  4JX5 A;  4RM2 A;  1YIJ I;  2NVQ J;  1O7L A;  4HEA 2;  5J6X A;  4P9F A;  2Z99 A;  1KQ8 A;  1UHW A;  1RKW A;  4TV7 A;  3K10 A;  3CUQ A;  3G3Z A;  1RZ4 A;  4PFO A;  3UR3 C;  1P4W A;  3CCR I;  3ONQ A;  3HOV J;  5JI6 A;  3CJR B;  3H9G A;  1R4N B;  2BVM A;  1MDM B;  3GF2 A;  1HDP A;  2AO9 A;  2M7A A;  3RPU A;  2NNN A;  4U0V A;  2VOP A;  2L54 A;  2H27 A;  1YOV B;  5B66 C;  5EYR A;  3KEY A;  2NRA C;  3GTP J;  3QYE A;  1Y56 A;  2IW5 A;  3ML6 A;  3CCU I;  1OCO H;  2CV0 A;  1QHH D;  1SMY F;  3BWG A;  3W3C A;  5A2Q K;  1P7J A;  5E3L A;  2LDU A;  3PFY A;  4YFX F;  5K5Q A;  3A01 A;  2VKV A;  4M3G A;  3RTR A;  1LPQ A;  1WPK A;  2ACJ A;  1ONV A;  2EFO A;  3KCC A;  1QPM A;  3JW4 A;  1ETY A;  2CW7 A;  3FMR A;  4EV0 A;  1LEA A;  1K78 A;  3U1K A;  2QBY A;  4J19 A;  2EV5 A;  4OIQ F;  2IA0 A;  1T38 A;  3CJQ B;  2DPU A;  2KDO A;  4IX7 A;  1GVJ A;  2LP0 A;  2WAD A;  3PNY A;  2JWT A;  3GTJ J;  4AUX A;  2K9S A;  1K83 J;  1QVT A;  3V7S A;  1D8K A;  1BR4 A;  2DFI A;  1ZAO A;  3CES A;  4W1U A;  1YIO A;  1ON1 A;  3OYG A;  3KP7 A;  2WV0 A;  2F5V A;  3QP5 A;  4BQA A;  3S14 J;  4NC7 A;  2QSG X;  2WAF A;  3GYH X;  3I71 A;  2GAU A;  1JT0 A;  1MBF A;  4N4O B;  4N9I A;  1Z7U A;  3M8F A;  1UHM A;  1VQ5 I;  4XBF A;  5EEH A;  4BJ6 C;  5HS8 A;  1KQ9 A;  4AU7 A;  3K4M A;  2CMP A;  4M74 A;  1S72 I;  2DK5 A;  2ZJP F;  3I54 A;  4R1H A;  1QA6 A;  2PJR B;  1UAA A;  4IHS A;  4MEY F;  5EDN A;  3ZXS A;  2E60 A;  4R8H A;  3F8F A;  4JBA A;  3WU1 B;  2ID3 A;  5FRO A;  5IP7 J;  2CYY A;  2DLL A;  2PMU A;  4V19 K;  5CLS A;  2FF4 A;  5B5E C;  1YG2 A;  3CJN A;  3DBH B;  3EYY A;  2OBP A;  4D7M A;  5LEK A;  2CV1 A;  2PMZ A;  3LAP A;  2Z5U A;  1WI3 A;  1Q1V A;  3MZY A;  2CGP A;  1HC8 A;  3WG9 A;  2R7T A;  5GPC A;  3IL2 A;  4NC6 A;  3ABU A;  3HTS B;  4ABZ A;  2K85 A;  1OPC A;  2HZD A;  5C4X J;  2ESH A;  5E1Z B;  3EUA A;  2RRE A;  2L7M P;  3BR3 A;  4IRH A;  3X2Q H;  5JFR A;  3QQA A;  3F8N A;  1GUU A;  1TW2 A;  4KA4 A;  1MBG A;  1UST A;  2QLZ A;  3F8M A;  3H0D A;  2V7F A;  1FOX A;  5K5R A;  2HU9 A;  5CVV A;  3M3Y J;  2DI3 A;  5HS7 A;  4LFU A;  2L2O A;  1D8J A;  3I9V 2;  5TRD A;  4CZZ A;  2QGU A;  2GXG A;  1W4M A;  2EZL A;  4LLN A;  1SD5 A;  4LG0 B;  1ZLJ A;  2X1C A;  2LK2 A;  5D5U B;  2X6Y A;  5IYD J;  5H20 A;  3WTW C;  2A6T A;  2I8D A;  4BBS J;  2XF6 A;  5IT9 K;  2J5O A;  2IGO A;  4ZH4 F;  2FBH A;  4ZYG A;  5LGU A;  1WJD A;  4E70 A;  1S5L C;  5IOZ A;  1YE9 A;  4HQE A;  3H1C A;  1RUO A;  3IC7 A;  4KMF A;  2BW3 A;  3ISP A;  2A5W A;  4Q48 A;  4CUG A;  4EEF G;  3VEP A;  2I10 A;  5IP9 J;  1DU0 A;  2ZJR F;  3ZPL A;  2DT6 A;  2DT7 B;  1V3F A;  2MH9 A;  1J75 A;  1PVE A;  3GZN B;  4RM3 A;  2IJL A;  4DYC A;  4XKV A;  3HSF A;  3H9J A;  3GFL A;  1SFK A;  4JX6 A;  5FLM J;  3TQN A;  3QU6 A;  2X48 A;  2Z16 A;  1IUF A;  2W85 A;  1TC3 C;  2M0M A;  1Z21 A;  1FYM A;  4RB2 C;  4E7L A;  2FD5 A;  5ICF A;  1GVD A;  5ED4 A;  1KZH A;  5CPR B;  1PYV A;  2DA7 A;  2KKO A;  3O8H A;  5F64 A;  5FKN A;  3BLY A;  1BM9 A;  2DFH A;  3HC7 A;  2R4G A;  5DYM A;  4AYB N;  1BIB A;  3CCS I;  3MAJ A;  2R5Y B;  2P8T A;  1YX5 A;  5DM6 F;  4CHU A;  1UMQ A;  3ABM H;  3PSF A;  3WTT C;  3QOD A;  4ZTJ A;  2Q8K A;  3PO2 J;  2P5V A;  3B73 A;  4Y3O A;  2DMT A;  3IH4 A;  2Q2E B;  4YEL A;  2BY1 A;  4F92 B;  3WU2 C;  2Z3Y A;  1XPX A;  2IA1 A;  1IN5 A;  4UVC A;  3P9C A;  4AIJ A;  4H0E A;  1E3O C;  2CJJ A;  5E3O A;  4BHP A;  5HLH A;  4D5C A;  3C2B A;  1OCT C;  3CC7 I;  1BBY A;  1G59 A;  2AHQ A;  1I39 A;  3V8L A;  2ZBK A;  4D7N A;  4J00 A;  2GIZ A;  3PQK A;  3DQV C;  3BR5 A;  5CQE A;  2RN7 A;  4GO1 A;  5DDG A;  5L3G A;  3MD2 A;  3V8J A;  4IL6 C;  2QSF X;  2E35 A;  4MTD A;  4HNV A;  4LLG F;  2JT1 A;  2ZCW A;  2F4I A;  4IXA A;  3TP3 A;  3K4N A;  2M0C A;  3BDD A;  3C18 A;  3GXO A;  1R5H A;  5HNH A;  1MND A;  2L01 A;  5L3D A;  1V4R A;  3JRB A;  3AAF A;  5DD4 A;  3ELK A;  5K7F A;  9ANT A;  3ZQF A;  5L3E A;  4N9H A;  4BE1 A;  1MH4 A;  6PAX A;  3F0C A;  3KYD B;  2VN2 A;  5J1U A;  3O3K A;  1DPR A;  4XRS G;  3SJM A;  3OYH A;  3IP4 B;  5JHU A;  3BCA A;  2NYX A;  1RIO H;  2A05 A;  1Y8R B;  1SC7 A;  1MNE A;  1F36 A;  4XLE A;  3FX3 A;  2R7Z J;  5BS6 A;  3BR2 A;  1QO0 D;  1GV5 A;  2HXO A;  3CCV I;  3KEO A;  3I0T A;  2F6C A;  2CG4 A;  2H6C A;  1U3E M;  4RGR A;  1HLV A;  3J81 K;  2D1V A;  2KIS A;  1T95 A;  4A0Y A;  2CW0 F;  3KYC B;  4E7K A;  4XOR A;  4BGD A;  4KIS A;  3DBL B;  3ZQG A;  4ESJ A;  3I56 I;  5FGM A;  3AL0 C;  4V2G A;  3K2A A;  1UG0 A;  2E2J J;  4UV9 A;  4PSW A;  4WXH A;  3ZMS A;  2OQR A;  1SD4 A;  3CCY A;  2MD5 A;  2M2E A;  2KQR A;  3BP8 A;  3ZQI A;  3EET A;  2O8K A;  1NTC A;  2K9M A;  3SHF A;  2V1U A;  3HOX J;  1SD7 A;  2ELK A;  3QOE A;  3A03 A;  4WXD A;  3H9Q A;  2JN6 A;  3R61 A;  3DFG A;  2MYS A;  4GXO A;  3LA3 A;  5LGT A;  3OSG A;  3DU5 A;  1LNW A;  3DTI A;  4H4K C;  4I99 C;  2QEX I;  2F5F A;  3S3O A;  1YRN B;  1E17 A;  5GTI C;  1YTY A;  1MMN A;  3F22 A;  1J09 A;  2HQR A;  4A6E A;  2XUB A;  4RMN A;  1MKM A;  4DYR A;  1Z0X A;  4MQV A;  1PP7 U;  3EUH A;  5FRM A;  3PIO F;  4AID A;  2QQ8 A;  2BGC A;  4L9V A;  2PG4 A;  2R7Q A;  3DKW A;  1XN7 A;  4JK1 X;  4ZDL A;  2HDD A;  3GTK J;  4XKW A;  3U2R A;  4NHJ A;  1D0Y A;  1QZE A;  5E18 F;  2GIV A;  2DMN A;  4A5M A;  4PJ0 C;  5E1X A;  3K1N A;  2STT A;  4KIT B;  1KU9 A;  2CW8 A;  3RQ4 A;  2VQH A;  1WWX A;  3MZ8 A;  3AG1 H;  2RNG A;  1H9T A;  1KU7 A;  2O5R A;  3I59 A;  2WAQ A;  3ZQL A;  2OU2 A;  2E7X A;  5LHG A;  1G3W A;  2XAH A;  2JA8 J;  3PL8 A;  4LGW A;  1OCR H;  2E1C A;  2D45 A;  2OJE D;  4KIF A;  5M5W J;  1T39 A;  1TT5 B;  3I4M J;  5J47 A;  3V7R A;  1LVA A;  1K6O A;  2KZV A;  2VJJ A;  4DOZ A;  4HOB A;  2Z33 A;  1D5Y A;  2JMW A;  5IT9 Z;  3UKG A;  2EIM H;  2WBM A;  1XGO A;  2CU7 A;  4M3F A;  5L3C A;  4HG2 A;  2OA4 A;  4BQO A;  3F8C A;  1L0O C;  1YQA A;  2QQA A;  4B48 A;  4OOI A;  1ETX A;  2JA2 A;  5F08 A;  4M9Z A;  2EIK H;  2LY2 A;  1DP7 P;  4IQ4 A;  2MBF A;  1VI0 A;  4M71 A;  1MBK A;  2L9R A;  1ENH A;  2K3F A;  3EYI A;  1A6I A;  1ZQ3 P;  4RB3 C;  3HHG A;  1B9M A;  2QCO A;  2MG4 A;  3KEQ A;  4IOA F;  1ZRD A;  5GP9 A;  3GUD A;  4FHT A;  4LK1 F;  2M45 A;  3K69 A;  2RQP A;  1FYL A;  2MC3 A;  4CH7 A;  3J7A O;  2HVQ A;  3N97 A;  1W36 D;  1Y1V J;  2IS2 A;  4EMS A;  2PQ8 A;  2XV4 S;  4I76 A;  3M9A A;  1LJ9 A;  2LY1 A;  2QSH X;  4IHY A;  3DBR B;  4KFC A;  5DCM A;  5ILU A;  1A31 A;  1MZB A;  4JOM A;  4BS9 A;  5EF6 A;  1WQ2 A;  1YS7 A;  1IXS B;  2UV1 A;  1ZGA A;  3SEZ A;  3T8T A;  3BJ6 A;  1J5Y A;  1KGS A;  2KJB A;  2WA0 A;  1P2F A;  1J2X A;  3Q9V A;  1ZRC A;  1TQP A;  3ECO A;  4A3C J;  1X3Z B;  4G12 A;  4PJJ A;  4M9X A;  2IBD A;  2LD5 A;  4G7O F;  1QZY A;  1WJC A;  4CYC A;  2HOE A;  4C3I J;  4KN7 X;  1FC3 A;  4C2U A;  2NOG A;  4MHG A;  3WU0 A;  5BQT A;  1WRJ A;  2EV6 A;  4Y15 A;  3HL2 A;  2VPR A;  5FLV A;  3H5N A;  3I64 A;  4E7J A;  2KL4 A;  4N4N B;  2LSO A;  1IN6 A;  3TO7 A;  1U5T B;  2NVY J;  4A3M J;  2BHZ A;  2DW4 A;  3Q0W A;  1HOM A;  1STZ A;  2VB6 A;  3TW7 A;  3RYP A;  4AIH A;  4A3K J;  2GA1 A;  2M4K A;  2VJ5 A;  2X6W A;  3RCO A;  3VOE A;  4KJZ A;  3A1Y A;  3MKW B;  3B02 A;  3VSL A;  1TW3 A;  1RKT A;  2L3D A;  3E5U A;  2ZJQ F;  1MH3 A;  2O61 A;  4XK4 A;  3CZ6 A;  2R7D A;  3V7C A;  3L2V A;  4UNO A;  1J59 A;  5E3M A;  5B1B H;  3RQI A;  1IN4 A;  3I5U A;  2VE9 A;  3CO7 C;  4A12 A;  3HOY J;  1X3W B;  1ETK A;  3F23 A;  1I3Q J;  3TGN A;  5J4Y A;  1A36 A;  2VQL A;  5M5Y J;  2PJP A;  1HST A;  4M6V A;  1OCZ H;  4L5J A;  4KNY A;  2HVS A;  2E1N A;  3MN2 A;  1O57 A;  4BL0 B;  4DBR A;  2P0W A;  2V6C A;  3PUF A;  5E3N A;  3F21 A;  2LF8 A;  3DPT A;  5E8I A;  4FQG A;  4WF2 A;  1G4D A;  1IRG A;  1IW7 F;  3EUH C;  3LFK A;  2JPC A;  3O8G A;  2VOO A;  2A6H F;  1NG6 A;  1FBQ A;  1ZEL A;  3VWB A;  2CQK A;  2M7B A;  5FD5 A;  1VZ0 A;  4PZJ A;  5M5X J;  3CME I;  1ZHF A;  1JHF A;  1KU3 A;  3BR6 A;  4RGU A;  3WTX C;  1I27 A;  3TW6 A;  3CCE I;  2DA3 A;  4HNU A;  1POG A;  3FMS A;  2F4O B;  1W1W E;  4HF2 A;  1JGS A;  2K9Q A;  2LR8 A;  2DA2 A;  1BN5 A;  4BDY A;  1SEU A;  1L3L A;  1JKR C;  1RC9 A;  3OYJ A;  5HLG A;  1HKT A;  1H0M A;  2LTP A;  3DU6 A;  3H3Z A;  3P9K A;  2ISZ A;  1T98 A;  1YW8 A;  2DQL A;  2R92 J;  2DOA A;  1XC5 A;  3M1E A;  3GBG A;  3G6E I;  3RJP A;  2LBF A;  2H1K A;  4CXF A;  3ZQ7 A;  5DEQ A;  2M9H A;  3C7J A;  3GX4 X;  1K78 B;  3S1M J;  3BQY A;  4DIQ A;  2VQC A;  2ICW G;  2NS8 A;  3LFU A;  4C3J J;  3W2A A;  3DCF A;  3ZRG A;  2MC4 A;  4B09 A;  3FXK A;  2HR3 A;  1BOA A;  1SVM A;  3EUK L;  3CCL I;  1X1D A;  5CVJ A;  2FOW A;  1TBX A;  1U2W A;  5JLX A;  3A2K A;  4EVI A;  3CUO A;  3A01 B;  2Y31 A;  1MGT A;  1CQT A;  4IRI A;  1B59 A;  3CQZ J;  2K9L A;  4B3X A;  3OYC A;  2YSR A;  3I4N J;  3SQN A;  5DM7 F;  3JSO A;  3TDZ C;  2PN6 A;  4ESF A;  5J1Y A;  4B1R A;  3VPR A;  2DO7 A;  4MFE A;  1IUY A;  3OIO A;  3MWM A;  3FIW A;  2G0E A;  3K6G A;  1DQU A;  4I6Z A;  3RDI A;  1J0R A;  1HKS A;  3L2R A;  2ZME B;  3T8R A;  3IV5 A;  3HB9 A;  1SVO A;  1I6X A;  4WK8 F;  1R1U A;  4L5E A;  1TWC J;  1I3A A;  5FKK A;  4IQJ A;  4BHC A;  3HRM A;  2R5Y A;  3BY6 A;  4G6T B;  1K61 A;  3IRR A;  4IHV A;  5IT3 A;  4XMY A;  5DV5 A;  3B6C A;  1SAU A;  1IAW A;  3FXL A;  5FRN A;  4FTH A;  3DPL C;  4F55 A;  5KAF C;  5JR3 A;  1SAN A;  4RAG A;  1JUM A;  4BAC A;  3HIF A;  1WJA A;  3NAU A;  1MBH A;  2M30 A;  1ZN2 A;  3H0G J;  1WCM J;  2XB5 A;  3MCZ A;  4UUT A;  3G2B A;  2DYS H;  5FJ8 J;  3KLO A;  2HQA A;  2JZY A;  1P6R A;  2C6Y A;  2BEO A;  1SFO J;  4CCK A;  3CD6 I;  2NNY A;  3OYB A;  3BQZ A;  4RAY A;  3HSE A;  1KYZ A;  4I0B A;  4LG0 A;  3S2H J;  1OMI A;  3BTL A;  3HXL A;  4LIU A;  1MMD A;  1R5I D;  3FIS A;  3HDD A;  1X3U A;  4U88 A;  2W4S A;  3L7W A;  3FXQ A;  3LQR A;  1VQ4 I;  1X58 A;  3E6M A;  1CGP A;  4XLN F;  1V54 H;  2X1D A;  2LRE A;  1JTX A;  4XN0 A;  1FWZ A;  2VT3 A;  1SFU A;  1CF7 B;  4HV6 A;  3FXO A;  4GGG A;  4PK4 A;  4AC0 A;  3W6V A;  4B4C A;  4YG2 F;  1OKR A;  4BEH A;  4Y33 A;  4LIT A;  2VE8 A;  1AA7 A;  1B8I B;  3G73 A;  2X85 A;  4JP0 A;  3CCM I;  3LSH A;  2KJC A;  3FBN B;  1XDU A;  4FET A;  1O3Q A;  1Z7L A;  5GTH C;  4KYW A;  5LRR A;  2AQF A;  2B63 J;  4ZC3 A;  3ZP5 A;  3CP2 A;  3FBI B;  1FBS A;  1IO2 A;  4MQ9 F;  5E1W A;  5ERI A;  4E7Z A;  3SFI A;  3GLX A;  3KX2 A;  1NHA A;  3O6B B;  2V1D A;  2LKX A;  1G3T A;  3LMM A;  2Y2Z A;  1O3S A;  1T56 A;  2XPW A;  4L0Y B;  2KPM A;  1Z77 A;  3QRF F;  3KYL A;  1YW7 A;  5ICG A;  3E3V A;  3E6D A;  3ZQH A;  2RAE A;  1HKQ A;  4O3M A;  3ASN H;  3V42 A;  2EB7 A;  1MW7 A;  1OIS A;  4IVN A;  2OZ6 A;  4S05 A;  5EGO B;  2DQR A;  1EH7 A;  3WG7 H;  3ESW B;  1HW1 A;  4XM3 A;  4EGZ A;  4E7H A;  4DZJ A;  2HQN A;  5E20 A;  2P7C B;  2V9P A;  1JTY A;  2OTJ I;  2VON A;  4ZYE A;  4X6A J;  1D0Z A;  4YEJ A;  3JAM Z;  4FE7 A;  4ZTF A;  4HRI A;  1KQ0 A;  3CLO A;  3E1S A;  1TP4 A;  3M07 A;  2EIJ H;  1XMX A;  1FBU A;  3HYI A;  5GPA A;  3OS0 A;  1ETV A;  2W25 A;  4LK0 F;  5E8G A;  2IEK A;  2FJ1 A;  4FX0 A;  2COB A;  4Z6Y A;  2HXI A;  4BE0 A;  2ME6 A;  3HUG A;  3L09 A;  2V9K A;  4EJW A;  1OYW A;  2FQ3 A;  2QQ9 A;  3E6C C;  2IGN A;  2VL8 A;  3SZP A;  5K5O A;  2QKL B;  1ZK8 A;  3OYF A;  1WHU A;  3W2W A;  4A6D A;  5LBQ A;  5B3S H;  1BC7 C;  2BXZ A;  2HFH A;  4P5O A;  2DN0 A;  5E79 C;  2HS5 A;  2HEO A;  3QPS A;  2XRO A;  1B72 A;  1QNT A;  5DCF A;  1FYK A;  4D0P A;  3GTL J;  1MBJ A;  5ILV A;  5HDK A;  4G94 A;  2R3S A;  1A6Q A;  4UXN A;  1IV8 A;  1OYY A;  4ZJZ A;  5EG0 A;  3PM1 A;  4M3E A;  2DXI A;  4DBQ A;  2HTJ A;  2VC1 A;  2HZT A;  2LMD A;  1MSF C;  4O6J A;  1FP2 A;  2K4B A;  4ZYH A;  2YPR A;  5BPI A;  1AKH A;  2E5N A;  2M1B A;  2QQB A;  2BVL A;  1G2H A;  2KIF A;  3M8J A;  2JRM A;  1YFH A;  5TJJ A;  1SVL A;  3ABK H;  3W6K B;  5CJ9 A;  1BIA A;  1HQC A;  5HNF A;  4Q47 A;  4DNC A;  4A3G J;  3CDI A;  1QGP A;  2P5K A;  1ERD A;  2KDZ A;  3GFJ A;  4CCL A;  1ORK A;  2A5Y B;  4IHW A;  3OOU A;  1TWH J;  4AVZ A;  3CP8 A;  2OZU A;  4MNU A;  2HKX A;  3OR1 C;  2WAQ N;  1FJL A;  2VOD A;  4D9J A;  5D8K B;  5D5V B;  1QZZ A;  3F6O A;  4ENJ A;  1VQK I;  2DJI A;  2Y69 H;  1P92 A;  3F6V A;  2I5U A;  1Z91 A;  4NNJ A;  1U8R A;  1FTT A;  3VYT B;  2COM A;  1OYI A;  1R9T J;  1LQ1 A;  2VXZ A;  4I01 A;  2PLY A;  1S29 A;  2E1M C;  1B8I A;  3ABL H;  2R7U A;  5GAE J;  1ZGJ A;  2R0Q C;  3DEW A;  3S2W A;  3OS2 A;  4YII A;  1SAX A;  2VI6 A;  2Y30 A;  1I1G A;  4A3F J;  2FU4 A;  3QOP A;  4QPQ A;  1K7A A;  3P5J A;  2MLG A;  5EEG A;  4N0B A;  2DDB A;  3ZMZ A;  2JA7 J;  1XGS A;  2H94 A;  3KFW X;  3BG5 A;  4IHT A;  3IUO A;  2DK8 A;  5H2F C;  2DDA A;  3K4C A;  4EM0 B;  3P9I A;  4BH9 A;  3TL4 X;  1Y8Q B;  5AIP A;  1VQL I;  4J01 A;  1DGR M;  4C2M J;  2V4J C;  2QVO A;  3K70 D;  5D8L B;  2TRT A;  3KZY A;  5IOY A;  2EFP A;  1A04 A;  2H6B A;  3WTZ A;  2GQQ A;  4XKC A;  1HBX G;  3PO3 J;  1MDM A;  2DOF A;  3OS1 A;  4NUB A;  2BW3 B;  3WHC A;  1AKH B;  2LKS A;  2R5Z A;  1IV6 A;  1YS6 A;  1GLN A;  1Y0U A;  3HGG A;  3HM5 A;  1Z1D A;  2JK3 A;  4RB0 A;  3U1D A;  3AG3 H;  1ZTR A;  3CMY A;  4OIN F;  2VBX A;  5D5W B;  1VTN C;  4F91 B;  3CO6 C;  2F48 A;  2RGV A;  1ZG3 A;  4I7H A;  4HF1 A;  3KP5 A;  4ANJ A;  1MJ9 A;  4HX8 A;  1R7J A;  3BJO A;  1B4A A;  3MMY B;  4LB5 A;  3PQJ A;  4XN3 A;  2QBY B;  1EF4 A;  1R58 A;  3DTE A;  3OL4 A;  4HDV A;  1R6R A;  2E19 A;  3HOW J;  2DT5 A;  2O6G E;  4XOP A;  1MNM C;  2Y0M A;  2NVX J;  1B72 B;  4EM2 A;  3LNQ A;  5DCM B;  5J3L A;  1K4T A;  4BYY A;  1APL C;  4HZF A;  4MGR A;  2BBY A;  2QUF A;  1P9Q C;  1X2N A;  1DP3 A;  5KHD A;  3FKI J;  3IRQ A;  2IS1 A;  2Y75 A;  2LNB A;  2E5Z A;  5EZH A;  3B6A A;  2DJN A;  3BR1 A;  5J8F A;  4RLQ A;  3HPH A;  3RKX A;  2BV6 A;  1X1P A;  3G1M A;  5K7H A;  2NOJ B;  3TOA A;  1O7F A;  2NXN B;  1SFX A;  4M73 A;  4PJL A;  1VQM I;  4DYQ A;  1IC8 A;  3A0H C;  2IA2 A;  1D5V A;  4FIS A;  1NG7 A;  2LG4 A;  1DUX C;  2XC7 A;  2ESN A;  2K9N A;  2LF7 A;  1PJR A;  3WE3 A;  1X2M A;  4XL9 A;  5CYV A;  1YI2 I;  4E6K G;  3BTC A;  5FO5 A;  2NAZ A;  3TDU C;  1HXD A;  2LYC A;  2XRL A;  5AIQ A;  2TCT A;  5D4S A;  1BL0 A;  2JA6 J;  2K40 A;  4ZDO A;  3GCM A;  3Q5F A;  2W1O A;  1QQI A;  3LSM A;  3OV8 A;  4BKX A;  1D1C A;  2E2H J;  2FRH A;  3GME A;  1I5Z A;  4UUS A;  1ZGW A;  1J7K A;  4XIC A;  1MJB A;  2L7K A;  2VJ4 A;  3CMA I;  1F9N A;  1VQO I;  2F5D A;  4KIC A;  1FLI A;  1ZG1 A;  1UG2 A;  4O5V A;  1GXQ A;  3J80 Z;  3OYL A;  1I50 J;  3OL3 A;  1PUF B;  2RKH A;  1JJ8 C;  2W00 A;  2A69 F;  4KIG A;  2VBW A;  2D1H A;  3RKQ A;  3H5A A;  2G9W A;  2X0L A;  1JXS A;  4OIO F;  1RR7 A;  2ZNZ A;  4KIB A;  4M6Y A;  5KNL A;  5BPD A;  2DU9 A;  1WKM A;  2P4W A;  1ETQ A;  1BI1 A;  2Y9Y A;  3D5S C;  3MKL A;  2GWR A;  2KRH A;  1B6A A;  2ISY A;  3LSR A;  3DWL E;  1RPW A;  4OIP F;  2GM4 A;  2VAS A;  3PIP F;  2DMP A;  2HQ5 A;  4A3E J;  3OR2 C;  3WTV C;  2XSJ C;  2NVT J;  1XMA A;  2GZW A;  2X51 A;  2LLK A;  4CIC A;  2M4G A;  2CS3 A;  2KP6 A;  2V9V A;  2JQ7 A;  3ROU A;  4OIR F;  1OJL A;  4CGZ A;  1QRY A;  2HTS A;  2HKO A;  2WB1 N;  5IY5 H;  4BUP A;  3C2H A;  1BR1 A;  2HOS A;  1XGN A;  1Z9C A;  2DPD A;  1IF1 A;  2H8W A;  1SMT A;  4D5F A;  2Q0O A;  2MLK A;  2R5Z B;  1YYV A;  4IZZ A;  2H09 A;  1D1B A;  2DMU A;  4IOC F;  3S93 A;  2IGM A;  3K4B A;  4KT5 C;  1HW2 A;  1IXC A;  3JCU C;  1Z05 A;  1AOY A;  3IWF A;  2K4J A;  1S9H A;  5EG0 B;  2EFN A;  3E5Q A;  2V79 A;  3F8B A;  4BJT A;  4DW6 A;  3JRC A;  2DFE A;  2A3S A;  2CRG A;  3A02 A;  3GTO J;  4G7Z F;  3W6J B;  3KE2 A;  3AFH A;  4PUS A;  3RIR A;  2VQG A;  5C4J J;  1NK2 P;  5IPA A;  4IPA A;  4AWX B;  4EAT A;  3I55 I;  4HX4 A;  3FXM A;  1WJB A;  3VB2 A;  1U8B A;  4EJO A;  2E36 A;  3ZOB A;  5L3B A;  2A6E F;  3RPU D;  3R4K A;  2UWM A;  1V5F A;  2H8R A;  1FP1 D;  4MTE A;  1FPQ A;  2WWY A;  2EPF A;  1TL8 A;  2XIG A;  1FZP B;  2E1M B;  2CUJ A;  1JUP A;  1BI2 A;  2PFB A;  3H5R A;  3O2P E;  2F2E A;  3H36 A;  3S32 A;  3DTK A;  2OCE A;  4MLO A;  3JR9 A;  1T0F C;  3BRO A;  2BZT A;  5LHI A;  2STW A;  5KK1 A;  2WAE A;  3K1M A;  1RUN A;  4OAY A;  2KIM A;  3D5L A;  2CFO A;  2HDW A;  3KP4 A;  3VSK A;  3ZMU A;  2ZNY A;  4B47 A;  1IN8 A;  4BXF A;  3JRD A;  4BDZ A;  1YJ9 I;  5LGN A;  4ESB A;  4X0G A;  1IN7 A;  2ECC A;  3R0A A;  5DS9 A;  2FNA A;  5ICE A;  3MFK A;  1HA8 A;  3HHH A;  1WI9 A;  2EQR A;  4IRG A;  4LOC A;  3MKY B;  3HOT A;  1IG7 A;  4NC8 A;  5CQG A;  3TO9 A;  3HJE A;  1IZ1 A;  2KMU A;  1Z6R A;  2DOD A;  3BR0 A;  3R0J A;  2R7F A;  2Y0S A;  1WVR A;  4I09 A;  5M3F J;  4BXX J;  1DPU A;  2ME0 A;  1R00 A;  1P4X A;  1QBJ A;  3MQ0 A;  1R71 A;  4RAF A;  2R7V A;  2XAF A;  3HRS A;  2XVC A;  3PNT A;  4LB6 B;  4OU0 A;  2G7H A;  2E71 A;  2Y48 A;  4XRS A;  1Z67 A;  4NBQ A;  2VKE A;  3OYA A;  1LFP A;  1G6N A;  3WGH A;  3CCJ I;  5FKL A;  2XF5 A;  3J7Y J;  3CUQ B;  1PDN C;  1F5T A;  1JJ6 C;  5DUK A;  2W57 A;  1TWA J;  1WH7 A;  4XRF A;  1UJ8 A;  5KAI C;  2KIU A;  3KZI C;  3PFI A;  4P1W A;  5J40 A;  4IO9 F;  1QHG A;  3V8K A;  4BEH B;  3NEU A;  1Y0N A;  4HLX A;  4RDU A;  5BMZ A;  1H89 C;  4IKF A;  1N78 A;  2E34 A;  4OMY A;  1W0U A;  2IPQ X;  2LKP A;  1U5T A;  4HLY A;  1NH3 A;  4U87 A;  4QPO A;  3KIO A;  4ZZD A;  1T33 A;  1RNL A;  4C9Y A;  2D5V A;  2H1L A;  1OFC X;  3WTS C;  4RS8 A;  1Y39 A;  5GAG J;  4II2 A;  2MGQ A;  1XG1 A;  3QAH A;  1KYW A;  3AG4 H;  2CWE A;  2OV7 A;  3FXR A;  2MD0 A;  2JTV A;  2OD5 A;  1Y6I A;  2QM3 A;  2XDV A;  4A3D J;  2B9S A;  1QVU A;  3BZC A;  3F3X A;  1OR7 C;  5AON A;  4U7D A;  4P9U A;  2IXS A;  3L00 A;  1BI0 A;  1JHH A;  1YW9 A;  2IT0 A;  2W84 A;  2WC2 A;  1B1B A;  3FK6 A;  1MIJ A;  4U0Y A;  2K02 A;  3ZR8 X;  1QU3 A;  1X4O A;  2ELJ A;  4UY8 I;  2EZH A;  2GOX B;  3E5X A;  1S7O A;  4AVP A;  3L2C A;  1U6G A;  2XRN A;  1IRZ A;  4XLC A;  2DTR A;  2XAG A;  4HDU A;  1USS A;  4A3J J;  1PUE E;  3NWS A;  5H6R A;  1JE8 A;  3L9F A;  4LJZ F;  5ILS A;  3AG2 H;  1OCC H;  2IP2 A;  4WXC A;  4E7S A;  3GWZ A;  3SZT A;  3FKJ A;  1YRN A;  3JTH A;  5C3E J;  2DCE A;  2OUM A;  2XAJ A;  2EA2 A;  4IF4 A;  1T08 B;  5H6Q A;  2O3F A;  1LEB A;  2EFW A;  1BR2 A;  4ASN A;  1YX3 A;  1M1E B;  3MKZ A;  1TWG J;  3PJR A;  3OYN A;  1LB2 A;  1BW5 A;  2ID6 A;  2K7L A;  1ZKG A;  4XOT A;  5K1Y A;  3CLQ A;  5FKO A;  2EZI A;  1Q1H A;  4HX7 A;  4F93 B;  3QPT A;  3I4P A;  2PMZ N;  3S8P A;  5BOX A;  4CYD A;  3FXU A;  1R1T A;  3DLL F;  4ETS A;  1P7I A;  2WTE A;  4BHB A;  4IJA A;  1W5C C;  4GFB A;  2CUE A;  1EA3 A;  4JQF A;  5F0C A;  2ADU A;  4ZZL A;  1JI8 A;  4MIM A;  1LDD A;  1MD0 A;  3H3V K;  5F6F A;  2JVH A;  1AHD P;  4M6X A;  2ELH A;  4A2U A;  2XAQ A;  2IS4 A;  4U0W A;  2BXY A;  3KP6 A;  4PGG A;  2PMH A;  3KPH A;  2LY9 A;  5DD8 A;  5LLQ A;  1T0F A;  1R4M B;  3Q0V A;  4PCQ A;  2A07 F;  3E6B A;  4AIK A;  4EJT A;  3ZQQ A;  5D5X B;  1UHS A;  3JRE A;  2KRF A;  3MVP A;  1H8A C;  5K7Z A;  3QU3 A;  4HW0 A;  4ITV A;  3EDP A;  3EQL F;  2ETH A;  3BTI A;  4QWQ A;  1BC8 C;  1X1C A;  4NDL A;  2JJ7 A;  3E97 A;  2JSC A;  1UEL B;  3KP2 A;  2VUM J;  4A5N A;  3RYR A;  3SEQ A;  4WX9 A;  4Y7N J;  1WJ5 A;  5LHH A;  2EK5 A;  3CDH A;  2FML A;  3HSR A;  4C3H J;  2VC0 A;  2HYF A;  4F3Q A;  1VQP I;  5FLX K;  1MMA A;  2ZJ2 A;  2A68 F;  3JRF A;  4EGY A;  2KZG A;  3LSI A;  2XHK A;  3RSN A;  2N8G A;  1FIP A;  2HDC A;  2R7W A;  2ZXJ A;  3U9G A;  3OOP A;  4FE4 A;  5HLT A;  5EZG A;  2EIL H;  3GFM A;  2XKO A;  4XSX F;  3OYI A;  3S16 J;  2CH0 A;  4LMY A;  1Z6T A;  2EV0 A;  3BCB A;  2HOA A;  2NS7 A;  4LD5 A;  1RRJ A;  4Y4R A;  2M8G X;  2VKD A;  4G8X A;  3DF8 A;  4BQN A;  1WJE A;  3ZQC A;  4UB8 C;  4CO8 A;  2YS9 A;  3NQO A;  1FNN A;  3K4L A;  3LWF A;  3OIQ A;  4LG3 A;  2YU3 A;  5LFA A;  1T6S A;  1ON2 A;  2EA4 A;  2HOT A;  3HPG A;  1F4K A;  3H3U A;  3RPQ A;  2FMY A;  3LA7 A;  5D4R A;  1XCV A;  4V2F A;  2V1N A;  3K0L A;  2XAS A;  4MFD A;  5JVT A;  3ULQ B;  3CC2 I;  3OYM A;  1TT0 A;  3S17 J;  2O03 A;  5HOO A;  4PSX A;  1S7A A;  1WGX A;  2VT2 A;  3ZCO A;  1ZH5 A;  3VYU B;  3K4K A;  3KZZ A;  4JX4 A;  2HI3 A;  3NRV A;  1YJN I;  2O0Y A;  2Y0S N;  2IRF G;  2JVG A;  2OAZ A;  5F27 A;  5F1J A;  2WB1 A;  2OF7 A;  3HG9 A;  2HNH A;  2EWN A;  3G71 I;  4WWC A;  3GZ6 A;  1BW6 A;  3FZV A;  2M8E A;  1K79 A;  1VQ7 I;  4L18 B;  4C30 A;  3W2V A;  2P6T A;  1EH6 A;  5GAH J;  5J8C A;  4RLF A;  2R7R A;  3QPH A;  2XB0 X;  2J5P A;  2DOE A;  4UUS B;  3F9K A;  1TLH B;  5HDG A;  2XGE A;  2M34 A;  3CC4 I;  3F72 A;  1K4S A;  3BC8 A;  3C1D A;  4GRI A;  1ZR2 A;  1HW5 A;  5HLI A;  2FX0 A;  3OMY A;  3DLA A;  5FKM A;  4BQQ A;  2HWV A;  2PBI A;  5D6F A;  3Q9S A;  2L9S A;  2BYV E;  3H35 A;  3VYR B;  1O3T A;  4B8X A;  3FHZ A;  2VIX A;  1I6H J;  2MW8 A;  1U78 A;  3I58 A;  4XON A;  1H88 C;  4XLA A;  2G7U A;  2KHM A;  2CFX A;  2K27 A;  4A0Z A;  4F7Z A;  3TMO A;  1V5G A;  4B3A A;  4M3D A;  2BY0 A;  4ENN A;  2VBZ A;  3R6S A;  3CMM A;  1LUJ B;  3A0B C;  1FTZ A;  1JT6 A;  2FBK A;  5CVU A;  1PP8 F;  3J7Z I;  4AYB A;  2O8X A;  2ZB9 A;  2JRT A;  2UXX A;  3ERM A;  4FCY A;  3D1N I;  2Z9O A;  1FIA A;  2ZFU A;  2LRD A;  3LST A;  5IP6 A;  4E7I A;  2F5C A;  4YFN F;  1ITY A;  2FEZ A;  3DEE A;  4OAZ A;  1Z3X A;  2AQE A;  4YRV A;  1ZG5 A;  2W24 A;  1FOK A;  4PJM A;  4HQM A;  5EEA A;  2YUS A;  1JUS A;  4GDF A;  2A61 A;  4Q4Z F;  3BG9 A;  2WV1 A;  2JSP A;  2FXA A;  3ABT A;  3PNV A;  3T0Y A;  3WOD F;  3JAM K;  1K6Y A;  1XB4 A;  4R79 A;  3HTU A;  1N77 A;  1WZ2 A;  1GT0 C;  2JPB A;  1D3Y A;  2RVC A;  5JLW A;  4QSH A;  4UVB A;  3M8E A;  2YR2 A;  3OWT A;  4FX4 A;  2TDX A;  2QF7 A;  2ECB A;  4G6Q A;  4XLH A;  1YJW I;  3HOZ J;  4PFP A;  4HV5 A;  1G3S A;  3L2Q A;  2VJI A;  2HVR A;  2YX7 A;  2F4M B;  3NWT A;  2ZME A;  4OMZ A;  4GYI A;  5IYB J;  1UB9 A;  2V1X A;  3TO6 A;  2XPV A;  1EJ9 A;  3ZN1 A;  2XAU A;  3S3N A;  4BE2 A;  1ACI A;  2ZXH A;  3S1R J;  2L0K A;  1DGW Y;  1UZC A;  2FSW A;  3C2G A;  4A69 C;  3BPX A;  1MMG A;  2B0L A;  1IJW C;  4XRM A;  5FLX Z;  2LOO A;  2OTL I;  4L5I A;  3G1L A;  1BA5 A;  2EJR A;  4M3B A;  3JRA A;  5EJC A;  3ZMV A;  4A93 J;  1ULY A;  4GCV A;  5CKT A;  2EFQ A;  1W7P D;  2EZK A;  3TP0 A;  1TWF J;  4QIW N;  4L9T A;  5HVQ C;  3FHN A;  2X4H A;  1S8N A;  3OYE A;  2HYG D;  1A5J A;  1FSH A;  2LH9 A;  2R7O A;  3LAJ A;  3WE2 A;  1YO5 C;  1OQY A;  4MO7 A;  3J80 K;  2DBB A;  4G6D A;  4PGH A;  4L0Z B;  1J9I A;  2FBI A;  2X6X A;  1XS9 A;  4Y13 A;  1TTY A;  4G9Y A;  1FMV A;  2E1O A;  1JKP C;  1LE8 A;  1FX7 A;  4I0A A;  3S15 J;  1WFX A;  1FSE A;  2IVM A;  4CA0 A;  4HNT A;  1BJZ A;  5LD2 C;  1MBE A;  2ZO4 A;  2HPI A;  4BNC A;  4UHT A;  2KFD A;  4HAM A;  2CUF A;  2VXD A;  3PUB A;  4DJA A;  3QYF A;  2CUZ A;  2W7N A;  5FFZ A;  2M5W A;  4MEX F;  3KLN A;  1G3Y A;  2MSY A;  1IXR C;  2DAO A;  4HYE A;  4UB6 C;  4EJU A;  5KVR A;  1ETW A;  4XR6 A;  1D1A A;  3ZMD A;  1ZRF A;  2OPT A;  3GTM J;  2CQQ A;  4AM3 A;  1EV7 A;  3CF2 A;  1S6L A;  3ERE D;  1RI7 A;  4LLL A;  2IS6 A;  3BPV A;  1XGM A;  1R36 A;  3IAS 2;  3WTY C;  2AS5 F;  2EH3 A;  5C44 J;  4UUV A;  3TED A;  1LFB A;  2FUG 2;  3K9T A;  2VBY A;  4KT6 A;  2L4M A;  3RI4 A;  4CYC B;  1G8X A;  2KT0 A;  4A0X A;  1XX5 A;  1VND A;  2AXL A;  3E0J B;  5FFX A;  4E4H A;  3FK7 A;  1BI3 A;  3CUQ C;  4A3L J;  3H92 A;  1XMK A;  1KON A;  5TIS C;  4KUM A;  3FXJ A;  1FT9 A;  3K1P A;  2O7O A;  3LA2 A;  4A3I J;  5LRS A;  2PX9 A;  4BU2 A;  3D5R C;  2ZSH B;  3CCQ I;  2DMQ A;  3KP3 A;  2MH2 A;  1TQM A;  1MMS A;  3K2Z A;  4HSR A;  3RZO J;  4Q5S F;  2AXT C;  4YIR X;  1UFM A;  3HBL A;  4B43 A;  4BY7 J;  4PJN A;  3R60 A;  3FMQ A;  2DYR H;  2QEN A;  3BT9 A;  2Z1D A;  1HCR A;  3TBI A;  3BG6 A;  3QP6 A;  3E7L A;  3K70 C;  2L9N A;  2CV2 A;  1LVK A;  2OQG A;  3IHU A;  4Y17 A;  2W82 A;  4RBO A;  3SDG A;  2HPM A;  2DA5 A;  2VKH A;  3ECH A;  3GTG J;  1DU6 A;  3M1C A;  3T1B A;  1EKE A;  3DP7 A;  1O4X A;  4GYG A;  1VFC A;  3JTG A;  3GEZ A;  2X9D A;  3A4C A;  3DV8 A;  1AWC A;  2CO5 A;  4ZYD A;  2XSD C;  3JRI A;  3AKZ A;  4QLC U;  4A3B J;  3M4O J;  1R22 A;  1VF9 A;  1IRF A;  1REP C;  1B9N A;  4L9J A;  3QWL A;  1FEX A;  4M72 A;  3RKY A;  2B7E A;  3TKY A;  3HGY A;  1GDT A;  3P7N A;  4L9N A;  1X4P A;  3JRG A;  3GW2 A;  5JHF A;  3S1Q J;  3HRU A;  1IDY A;  4XNF A;  2FQ4 A;  3DPU A;  3QYB A;  1ZLK A;  4II3 A;  1IGN A;  3VDX A;  4UVA A;  1I1S A;  2Y9Z A;  1W0T A;  4DZP A;  2L5Q A;  4RA2 A;  1QPI A;  2IGK A;  3VFZ A;  3IKT A;  4QTR A;  1YIT I;  3HUG B;  5HOD A;  2CQN A;  3C3W A;  2EIN H;  4ZYA A;  2KIQ A;  2Q2E A;  4BJ5 C;  3MZH A;  3K7A J;  2L7Z A;  2LVS A;  2L7F P;  1KU2 A;  4B44 A;  4BAY A;  4G7H F;  1O3R A;  1S7E A;  3BZ6 A;  1SFE A;  1X19 A;  3U21 A;  1LKX A;  3WGI A;  1R49 A;  4KDP A;  4IEJ A;  4YIF A;  2PJR A;  2NS0 A;  3SZG A;  2YU9 J;  1W5S A;  4Z2Y A;  2M3A A;  4CDG A;  2XF7 A;  4XLF A;  1TNS A;  4K2E A;  2L4A A;  4D1Q A;  4I98 B;  1W36 C;  4Y52 J;  3S3M A;  3BJA A;  2RDP A;  3Q0U A;  1WH5 A;  5A2Q Z;  4XID A;  3WHB A;  1MSE C;  3GTQ J;  3OY9 A;  1U9O A;  3GVA A;  3VYS B;  2MFZ A;  4XSZ F;  1IRX A;  4BY1 J;  3GLL A;  3GO5 A;  1T8I A;  1HF0 A;  1N75 A;  3IAM 2;  1ZR4 A;  3LQQ A;  3FF5 A;  5JVG F;  4P55 A;  2P5L C;  2GXB A;  4CCJ A;  1LDK B;  4NQW A;  4CCN A;  2F5E A;  4XQF A;  3OIP A;  3RKW A;  1JGG A;  5F1R A;  3HOS A;  4FT8 A;  3J81 Z;  2FA5 A;  2R93 J;  2RNJ A;  3HZJ A;  1U0J A;  5CVR A;  5DTD A;  2R7X A;  4UV8 A;  4HF0 A;  3CJT B;  5E17 F;  2P7V B;  3OYK A;  4EQQ A;  1GXP A;  3S1N J;  1JKO C;  2GXA A;  3T5X A;  1Z3Y A;  2W48 A;  4JYK A;  4I2O A;  3IKV A;  1F1Z A;  2CQX A;  3EPZ A;  1HDD C;  4NB5 A;  2OCC H;  2CSO A;  3ZGK A;  1X1A A;  1VQ6 I;  1E3H A;  1TZL A;  3QPL A;  4RB1 A;  2P6S A;  3LSK A;  3MEX A;  1WSU A;  1D0X A;  2ZXW H;  5B1A H;  1S3J A;  1MJA A;  2GA2 A;  2L02 A;  3DKX A;  3JRH A;  4HST A;  1BOB A;  1ZAR A;  2KRC A;  3I53 A;  3HKZ A;  1OCP A;  2JUG A;  2YX4 A;  2QZ8 A;  2BY2 A;  3BZK A;  1A35 A;  1E2X A;  3IWZ A;  4X1E A;  1V5E A;  2E2I J;  2DFF A;  3D0S A;  2P81 A;  1JKQ C;  4LIV A;  1H9G A;  2ZKZ A;  3G1O A;  3GZ5 A;  4EM1 A;  3BG7 A;  3LL7 A;  1OLT A;  4ZDP A;  2DA1 A;  4BBR J;  4PDK A;  2GLO A;  2Z2S B;  2PEX A;  2MAB A;  2CQ7 A;  1YHQ I;  1XSV A;  2GBY A;  2DA4 A;  2RQQ A;  2X1E A;  5D6E A;  5KCM A;  2QWW A;  1X1B A;  3SYT A;  1VQ9 I;  2IAI A;  2QKM B;  3HOU J;  4W97 A;  2GOM A;  5BNG A;  3LOC A;  5M3M J;  3DEU A;  4HPQ A;  3N05 A;  2XGX A;  3I3L A;  2UUZ A;  4KN4 X;  4WCG A;  3PSI A;  1LE8 B;  3SXY A;  1T2K A;  1XTA A;  4OWR B;  2HYJ A;  5L3F A;  3HKZ N;  1R1V A;  3I59 B;  4ON0 A;  1XDS A;  3TOB A;  2RV8 A;  5IYC J;  4EJV A;  1ODD A;  2V26 A;  4AD9 A;  2D2W A;  1AU7 A;  2XGD A;  3OYD A;  2R7S A;  4F52 A;  2VPL A;  1W7P A;  3FWE A;  4ENM A;  3ASO H;  3BOQ A;  3IH3 A;  4NQW B;  3L1P A;  1FOY A;  3GFI A;  1U5T C;  2HGC A;  2E7W A;  4I02 A;  3VOD A;  3FDY A;  4RAZ A;  5ICC A;  4DQ2 A;  5HS9 A;  2BOL A;  2Q1Z B;  1LDJ A;  4M9S A;  1LFU P;  4FAS D;  2FNP A;  2O9L A;  3BTJ A;  4CZC A;  4IHX A;  3BG3 A;  3ZN0 A;  5EGO A;  2FE3 A;  2QYO A;  2KLO A;  2LFB A;  2LBF B;  1RES A;  3FM5 A;  3HEF A;  3CF5 F;  2ZXI A;  4CSW A;  3JSP A;  3K4J A;  4HBL A;  2ZME C;  1EH8 A;  3FM3 A;  4XKB A;  3LSG A;  4S0H B;  5J1R A;  3IH2 A;  5FD6 A;  1Y1W J;  1NK3 P;  1VQ8 I;  1U9N A;  2L9V A;  4DGW B;  4S04 A;  3S2D J;  1OR7 A;  1R23 A;  3COA C; 
#chains in the Genus database with same CATH homology
 2K85 A;  2DOD A;  2CQN A;  4FQG A;  2E71 A;  2KIS A;  1UZC A;  2DOF A;  2L9V A;  2KZG A;  2KIQ A;  2JUC A;  2B7E A;  2DOE A;  2LKS A;  2KFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...