2CQNA

Solution structure of the ff domain of human formin-binding protein 3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
GSSGSSGMKRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Formin-binding protein 3
publication title Solution structure of the FF domain of human Formin-binding protein 3
rcsb
source organism Homo sapiens
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2cqnA00
2K85A 2LKSA 4FQGA 1UZCA 2KZGA 2KISA 2JUCA 2B7EA 2CQNA 2DOFA 2DODA 2KIQA 2E71A 2DOEA 2L9VA 2KFDA
chains in the Genus database with same CATH superfamily
1FYKA 2G7HA 4BQOA 4BAYA 3PM1A 2HI3A 2IT0A 2DT7B 2EBIA 2HYGD 2QA4I 3OYDA 1EKEA 3J80Z 3DXJF 1R1UA 1W5TA 3E1SA 4CUGA 4DZJA 1XCVA 2Y0MA 3HKZN 2QCOA 3QPTA 4AIHA 2JZYA 3WGIA 2FMYA 1KQ0A 3DPTA 2QBYB 1H0MA 3S2HJ 3P5JA 2ZFWA 3QYFA 5FROA 3WTUC 2W00A 3A01A 5B5EC 2WB1A 4D9JA 2E2IJ 5F0HA 5F6FA 2OPTA 1ETQA 2L7ZA 1YHQI 1RKWA 2IEKA 2ZFUA 2KMUA 2OCEA 3HHHA 4W1UA 3CCLI 1GHCA 1FTZA 1IN8A 1NG7A 1O57A 3X2QH 2BXYA 3L09A 2RVCA 2K9MA 3BG7A 3ELKA 1IUFA 2E5NA 4FISA 1APLC 1MJAA 2VQLA 2FNAA 2IW5A 4A3IJ 5K7FA 3KP7A 3PNVA 3KZIC 5DYMA 3CO6C 4RB1A 3WG9A 2WAQA 3DFGA 4BQQA 2XSDC 2XGEA 1HKSA 2P7CB 1Z67A 3OWTA 3CC7I 2QBYA 3J7YJ 2YS9A 2IGNA 3CMEI 1D0XA 3R60A 4NC8A 2JTVA 1U8BA 4PGHA 1D0YA 1U8RA 4E7LA 2DMNA 3TOBA 1R9TJ 4M9ZA 1FIAA 2GOXB 3A0BC 1MDMB 4WK8F 3K10A 4HEA2 1FBUA 2H6BA 3HUGB 2BHZA 4F7ZA 3HOSA 5GAEJ 1QBJA 5AONA 3PO3J 3OS0A 3GYHX 2X6XA 4RDUA 2UZKA 1K6OA 2WTEA 1Y6IA 2OAZA 2PMZA 3ZMSA 4FTHA 3KEOA 2V9KA 3IKTA 1MNMC 4M6VA 2WV1A 4WXDA 2WV0A 4EMSA 2JMWA 5HLHA 4HDVA 2CV2A 4F92B 2XB5A 3K2ZA 1BJZA 3JCUC 2Y69H 2FOKA 5D5XB 2CQ7A 4CXFA 1K78B 5KAIC 2ZMEB 1HW5A 1WPKA 2ISZA 5C3EJ 2ZSHB 3W2WA 2A07F 4UVAA 2E71A 3F0CA 2X6OA 1MDMA 1BM9A 1W7PB 2J5OA 5M3FJ 3SJMA 3HUGA 2LNBA 5KK1A 3ZMUA 2IVMA 4F55A 2QSGX 2E36A 2GIVA 3HBLA 5DUIA 2XROA 1VQMI 4X0GA 4UB8C 1VFCA 5C4JJ 2L9NA 4I0BA 3M4OJ 2HXIA 2EFOA 4BHBA 1FC3A 1XMXA 2NVYJ 4RBOA 3JRFA 4WF2A 1DQUA 2OA4A 3I9V2 4NUBA 1D1AA 1YW8A 2IGMA 3FWEA 2QWWA 4RLFA 2DU9A 1JT0A 4GXOA 5IOZA 2VE9A 1QHGA 1O7FA 5L3EA 3KP5A 1IN7A 3TOAA 3KYLA 4BHCA 2FXAA 3BDDA 2HQNA 2ZMEA 3ZQIA 4XKBA 5IYCJ 2C6YA 1MH3A 3F8FA 2P0WA 4BY7J 3G1LA 2GXBA 1NTCA 1S7EA 1UG0A 3PUBA 2HDDA 4L9TA 3LSKA 3FMQA 1W7PA 3OR2C 1ULYA 3PFYA 2J5PA 3OR1C 4O5VA 5ERIA 3N97A 1Y1WJ 1HLVA 5CKTA 3F21A 1FTTA 1UFMA 3HB9A 4RGUA 2I10A 3CCMI 4BACA 5C44J 3CLQA 4I02A 2DI3A 5EEHA 2EFPA 3BWGA 3HRUA 1U0JA 4CA0A 4LK1F 2BOLA 3E6BA 3BQYA 4JX5A 3H0DA 2Y0SA 3OYMA 1I50J 2X6YA 2QKMB 2XGDA 2LREA 2DO7A 2VN2A 3R6SA 1ON1A 4GYGA 1LVKA 2DFHA 3R4KA 4LLNA 3V8JA 1YS6A 3SZTA 1YO5C 2QUFA 1RUNA 1MZBA 1T98A 3IWZA 4L5IA 1SFUA 1U5TB 1P4XA 1F9NA 4JK1X 2EH3A 3ABUA 2QF7A 3IH4A 4DIQA 2RGVA 2X0LA 3P9CA 1SMYF 5CVJA 3DKXA 2EB7A 4OWRB 2HQ5A 4DYCA 3OL4A 1SC7A 1VQ5I 3U2RA 5ICFA 2VOOA 3GTKJ 2LVSA 1D1CA 3M1EA 4A3CJ 3DU5A 2ZMEC 1G3YA 2HQRA 3GO5A 5JLXA 2HPMA 3HHGA 3CO7C 5LEJA 1R5GA 3DBLB 2VT3A 4U0WA 2VJJA 4DBQA 1MBHA 3LSTA 4G7ZF 3WTYC 3BJAA 3ABTA 4BJ5C 1BC8C 2LC2A 5FD5A 2FD5A 3QWLA 4FCYA 3S1QJ 1V5GA 1JI8A 1J9IA 3B6AA 2LLKA 1ZYRF 3FMSA 2JA6J 2DPUA 3ZGKA 2FRHA 3OIOA 4E4HA 1E3OC 2W4SA 1D0ZA 3OS2A 2ELKA 3ERED 1X1CA 3BTCA 3LSHA 2R3SA 2K9NA 2MA3A 4B48A 2CMPA 4ZTJA 4DJAA 2DYSH 4KT6A 4MFDA 4BBRJ 4PGGA 3OOUA 5EF6A 2KRCA 3CDHA 2E1CA 4FHTA 2EIMH 3FHNA 3ZR8X 2LKPA 3SDBA 4GRIA 5LRRA 3FKJA 1KQ8A 2ECCA 4A69C 4PJMA 3GXOA 4NC7A 1SFEA 1JXSA 5E79C 3IRQA 3S15J 4RAZA 5M5YJ 1KZHA 4AIKA 1ZLJA 1XB4A 3K7AJ 4HW0A 2V79A 1BL0A 1F43A 3OL3A 3JSPA 5E1WA 4N4NB 1ZTRA 4FT8A 3V42A 3WTTC 4M3FA 5ICEA 3FMRA 3L2UA 4B3XA 4E7SA 4G6TB 1LEBA 3OIPA 4LG0B 5J3LA 3GTQJ 1D5VA 1Z1DA 4GYIA 1EH8A 4XONA 5E8GA 2P5LC 3CJNA 2OV7A 4AIJA 1ZQ3P 2GXGA 3A0HC 3TL4X 3CMAI 3HOZJ 1X1DA 4M6YA 1ETYA 4HLYA 4IO9F 2B9SA 2GQQA 3JRHA 3CMYA 2QVOA 4KMFA 3DBHB 2MABA 3H5RA 4A3MJ 1TWCJ 1XX5A 3FXOA 3LSMA 1T38A 3NAUA 4C3JJ 1YRNB 3LSRA 3M3YJ 2K9QA 2K86A 1O3QA 5GAHJ 3L2WA 2UV1A 5BOXA 4ETSA 1LEAA 3S17J 2XF6A 2K27A 5B3SH 2EK5A 3HG9A 5FKNA 4LIUA 3CCYA 4CHUA 5LHGA 2VC0A 3NEUA 3EDPA 4C9YA 3IH3A 3ABLH 1Z6TA 4LK0F 3WE3A 2Y31A 4YELA 4LG0A 4EJWA 2R7WA 3K4MA 2E60A 4L18B 2JVHA 4DQ2A 1X3ZB 2KRHA 1I1SA 1TBXA 2OCCH 2XKOA 4CCLA 1T8IA 1OMIA 2NRAC 3TMOA 2M34A 3N05A 2QEXI 2CW8A 4D5CA 4BU2A 2R7DA 4ESBA 2O8KA 5GPAA 3I3LA 1DUXC 5K7ZA 1RRJA 3K4LA 3ZQHA 1YRNA 3QYBA 2DK5A 1YJWI 4F93B 1QNTA 3GZNB 5K1YA 2M45A 3ZQCA 1ZH5A 2MYSA 1OKRA 4NQWB 2KPMA 3FIWA 3MQ0A 1LE8B 1KA8A 1JUSA 2EA2A 3RZDJ 2M8EA 4A3JJ 1UZCA 1IXCA 2FNPA 2XAUA 5IPAA 3I4NJ 3HPHA 4MTDA 1F5TA 4C30A 3QODA 3JAMK 1XD7A 2DBBA 5HLIA 4HF2A 5H6RA 2F6CA 4M3BA 5DV5A 4BDZA 2W25A 1CF7B 2FE3A 2VPRA 1ON2A 3MZHA 2E19A 2ESNA 1JTXA 4XSZF 2Y75A 5DCFA 4U0VA 2O8XA 3V7SA 1YITI 4AVPA 1S9HA 5DTDA 3L1PA 1WJDA 1RKTA 1Y8QB 2JN6A 4HAMA 4C3HJ 1ZLKA 1IGNA 2D45A 2F5CA 3TO9A 4A3BJ 1W7PD 3IKVA 1ZR4A 3L00A 4NQWA 5E3OA 3CDLA 1LE8A 1RNLA 2NS0A 5IP9J 3BZCA 3EQLF 2ESHA 4OIOF 5A2QZ 4C2MJ 1WI3A 1RPWA 4ZDPA 1CF7A 4KMUX 2X48A 3V7CA 4FX0A 2IRFG 2X1DA 2DA1A 1ACIA 2EJRA 5F1JA 3RIRA 3RYPA 1BW5A 1TZLA 1VTNC 3PFIA 3KZZA 5D4SA 2GA2A 2COBA 3MKYB 3K4KA 2LY1A 1MMDA 1P4WA 4D0PA 2MC3A 3FXMA 4IOCF 3V7RA 3FK6A 2EZIA 3QYEA 1I6HJ 4BH9A 3DPUA 4OIRF 3VWBA 1HQCA 2NYXA 1R23A 1MBKA 5FLXK 2XPVA 3COAC 2Z2SB 1TWFJ 1XGNA 3KLNA 1IRXA 4G8XA 3IC7A 3JRIA 1LFPA 1ETXA 5FKOA 3REOA 1MNDA 4IXAA 4A3DJ 4NHJA 1IAWA 4YIIA 2Y48A 2AXTC 3BY6A 4RM2A 1V54H 4B09A 3DTIA 3I5UA 3P7NA 2DDBA 3IL2A 1K4TA 1KGSA 1O3TA 4E7KA 3CQZJ 3MMYB 4EJTA 1OFCX 4QTRA 3UNGC 1VNDA 3SZPA 3QRFF 3MKLA 2ZXJA 3ZMTA 4UUVA 1HSJA 4ZYAA 4KISA 1LUJB 2R7TA 2KIUA 4PJLA 4M9SA 4IEJA 2DA4A 4EM0B 2ME6A 3I64A 4I7HA 1BI3A 3BR2A 3VSKA 4B43A 2H27A 2CFXA 4AVZA 2PI0A 3VYUB 5J8FA 5ICGA 2L4MA 1ZR2A 4CCNA 2R7XA 4KFCA 2HEOA 4UHTA 1SAUA 3OYAA 3I53A 1YG2A 1R4MB 4R1HA 1YX3A 4CCKA 1Z7LA 2YUSA 4CDGA 4XM3A 2LKSA 2Y9ZA 2JA7J 4LLLA 1SFOJ 2JSCA 3K4BA 1FT9A 4PFPA 5F08A 3U9GA 4A5NA 4ESJA 5B66C 2M30A 5DD8A 2XGXA 4XRSA 4L5JA 3GLXA 4HQEA 4OAZA 3OSFA 1V5FA 2LTPA 2GLOA 2COMA 1WKMA 3W2AA 3BOQA 1U3EM 4MFEA 2V7FA 4IZZA 4L9VA 1HA8A 3LA3A 4YFKF 3Q0WA 3SDGA 1TNSA 2K3PA 4DW6A 3M07A 4RS8A 2CUFA 2LMDA 4D1QA 3HRMA 5BNGA 3OYEA 1BI2A 2G9WA 5FKMA 4UVCA 1MBFA 2BY0A 3TP3A 2QLZA 1BR1A 2EFQA 2A5WA 2DFIA 2VODA 1KYWA 2LR8A 1WJAA 1VZ0A 2BE5F 5J47A 4CYCB 1P7IA 1P4AA 4QPQA 1SD6A 2ZCWA 3DEEA 5GADJ 4J00A 4KYWA 1ZAOA 3DLLF 1GDTA 3JTHA 4CO8A 2E1OA 3CTAA 4W97A 4ABZA 2CGPA 4PJ0C 2BHYA 1BJAA 4F3QA 3A2KA 4TV7A 5H6QA 1WJ5A 4YIRX 2VQCA 3BLYA 2N8GA 4CCJA 3RKYA 1ZG1A 3S93A 2XUBA 5BS6A 3T5XA 2OQGA 3KP3A 1KU7A 2HU9A 4RAYA 2B0LA 2MG4A 3GZ5A 2O0YA 1WI9A 3CLOA 1W5CC 1U78A 2NNNA 3ECHA 1G3WA 3DTKA 3ABKH 2FUG2 3L2QA 5JHFA 3BR1A 1AA7A 1S7OA 3EYYA 5EEAA 3RDIA 3UKGA 2ZNYA 1IV6A 4MIMA 4AYBN 2KFDA 1FEXA 2GZWA 3JRDA 2ACJA 5GP9A 4YFXF 1MBGA 4CYCA 1BI1A 1V3FA 3PJRA 2Y2ZA 1K83J 2FBHA 4XICA 1ZK8A 5TISC 3LSPA 1J09A 2EV6A 2ID6A 2VL8A 5FO5A 4ON0A 5CJ9A 4R79A 3J80K 4HX4A 4LJZF 3MCZA 2ELHA 4U7DA 1X2NA 1RR7A 4UVBA 1AU7A 1Y0NA 1USSA 3C2HA 4LITA 1D8JA 3QP6A 5HDNA 2IS4A 3ZQ7A 3LSIA 2XHKA 4M71A 1M1EB 3HRSA 3FBNB 2H8RA 4LOCA 1T0FA 3C7JA 3MFKA 1D8KA 3LFUA 2IAIA 3AL0B 3FXLA 3IV5A 5HOOA 5D6FA 3S2DJ 3OYGA 3Q9SA 1VQLI 2BY1A 4RAGA 2CH0A 1XDSA 2FX0A 2L7KA 2DQRA 3MWMA 5HLTA 4KUMA 3ZRGA 4Y52J 5CVIA 2MD5A 2DXIA 4XKVA 3H1CA 3F8BA 1NG6A 2FEZA 4Y33A 3DP7A 4MQVA 5IOYA 1VQNI 1YS7A 1FYLA 4PJJA 2GWRA 3ASOH 4BXXJ 1TQMA 5E1XA 4S04A 4XOTA 3WGGA 1YOVB 3NQOA 4RMNA 1FY7A 2CUZA 2L54A 3F8NA 1XSVA 3M1CA 4LFUA 2M7AA 4UV8A 3GWZA 2KLOA 1LPQA 3QQAA 3A03A 4LD5A 1JKOC 2K5CA 3LQQA 2VQHA 1IC8A 5CQEA 4XRMA 1ZG3A 3GFMA 2MH2A 1ETWA 2XB0X 1WGXA 2IPQX 2P81A 2TCTA 2BY3A 2VJ4A 1T0FC 4A2UA 3OYKA 1ONVA 4A3KJ 1KU3A 1KU9A 5DUKA 2HYJA 1QO0D 5TRDA 3FHZA 1X3WB 2JK3A 3K6GA 3TGNA 1ORKA 3S8PA 2DT5A 4MNUA 2W85A 4BS9A 2JA2A 5JR3A 1FLIA 1X1PA 2EV0A 4M3EA 2F5DA 2R7VA 1SD4A 2V6EA 2KISA 3BG5A 1B1BA 5DM6F 3FF5A 3IHUA 3TO6A 4M3DA 3ZCOA 3CF2A 3EPZA 4LGWA 2F4OB 3ONQA 3K2AA 4OU0A 1R4NB 2BY2A 3LOCA 4O6JA 1ENHA 2MH9A 1YJNI 3HOTA 2GAUA 3SXYA 4OMYA 4YIFA 2HFHA 3C2BA 5J1RA 1E0EA 5EEGA 1P6RA 3KYCB 1S3JA 2EV5A 4EJUA 5LHHA 2VONA 1ETVA 2DA5A 2Z9OA 2JPBA 2NVXJ 3L2CA 3GTLJ 2PQ8A 2M9HA 4A0XA 1Z3YA 5D8LB 1JJ6C 2K40A 2QGUA 2H94A 1H88C 2LOOA 3HM5A 1YW7A 2K3FA 4IQJA 2VQGA 2XC7A 2E1MB 1X2MA 2CWEA 2DT6A 2AS5F 2L5QA 2L9VA 3GEZA 2GM4A 1AOYA 2K9LA 4ZTFA 3E5UA 4KN7X 2RC4A 4DZPA 3WE2A 1Z6RA 4O3MA 1ZELA 1JGSA 1MMNA 2CQXA 2RQPA 3QPSA 4CICA 1LB2A 2TDXA 5E20A 5B1AH 3HSEA 2EA4A 1YLFA 2KL4A 3O2PE 2ICWG 4FETA 4NC6A 4ZZDA 4PDKA 1XSDA 2CUEA 3GBGA 3O8GA 3D5LA 3KP4A 4GCVA 1FOKA 1B72B 2Y9YA 2L3DA 5LGTA 1B9NA 2AQEA 2AO9A 3DWLE 3E0JB 1HXDA 1X19A 4L9NA 4EGYA 4E7IA 2HKOA 3R0JA 4P96A 1MMGA 2WADA 4UUTA 2DOFA 1FP1D 1K78A 4D7MA 1A04A 3DBRB 2P4WA 2LP0A 4PZJA 5E3NA 3LQRA 1EA3A 3F9KA 2M7BA 4EM2A 3PNTA 1BC7C 3CF5F 2LF7A 3S2WA 4RB0A 1ZARA 1UHWA 1OLTA 4FASD 1YIOA 4XK4A 1IN6A 1I5ZA 2XAJA 3RPUD 3QOEA 2R7ZJ 2E34A 2A3SA 3IAM2 2VXZA 5FFXA 4CGZA 2V1DA 4E7JA 1B72A 4BE2A 2V1XA 1LNWA 5LFAA 3JREA 2VPLA 2O03A 5J40A 4CH7A 3C1DA 1ITYA 2JPCA 1V55H 1GUUA 5IT3A 5DEQA 5IYBJ 1HW1A 3JSOA 1S29A 3TEDA 1FMVA 1MMAA 1Z05A 2DJNA 2HOAA 4G6QA 2HOTA 3GTMJ 2NVQJ 3I56I 1SANA 4A6DA 1MGTA 2XSJC 2BVLA 3OYLA 2E1MC 2QYOA 1N75A 3J81K 3AG1H 2WB1N 2M2EA 1CQTA 3O8HA 4LG3A 2X51A 1I27A 2XPWA 2BVMA 5D6EA 3G4SI 2PFBA 4CZCA 3P9IA 1ZKGA 4IHSA 3QPLA 3U1KA 4KITB 3CC2I 3HGYA 3E3VA 2WAEA 3MKWB 3CJTB 1TW2A 3ZP5A 1ERDA 2A5YB 2BW3B 3K9TA 4I09A 2CQKA 2L0KA 2ZO4A 4JQFA 2X9DA 4PFOA 3D5RC 2OTJI 4II3A 2DMUA 2R93J 1A6QA 3ERMA 2A6TA 1GVJA 4ZJZA 2IA2A 2DQLA 2Z16A 2TRTA 3A1YA 2K4JA 2WAQN 3GFIA 3M8JA 2IGKA 1BR4A 1U5TA 2WAFA 4DBRA 4G94A 4MO7A 2PBIA 4V2GA 4ESFA 3H35A 4ENKA 1G3SA 1SD5A 1OCCH 2JRTA 1R71A 2OZUA 2KIFA 1WZ2A 2EIKH 1P92A 2V4JC 3AKZA 2QSFX 4DOZA 4P55A 3ULQB 4BHPA 3EYIA 1OISA 1P2FA 1O3SA 2LH9A 3CP8A 2V9PA 2R4GA 3ZQGA 1DDNA 2G7UA 4HV6A 2F4IA 4XR6A 2BW3A 1ZRDA 5F04A 2XGCA 2WWYA 3CUQB 1SFXA 3RKWA 1WJCA 1FBSA 2PMZN 4KNYA 4RGXA 2EILH 1R7JA 4MTEA 2XVCA 3DTEA 4XLAA 4PSWA 1VQ9I 1QU3A 2HXOA 4FX4A 1Y1VJ 2FF4A 3HTUA 5GAGJ 3HDDA 4ZYEA 3K4NA 5JFRA 3MVPA 5EGOB 2HKXA 4M6XA 1VQ7I 3AG2H 1HCRA 2FJ1A 2OD5A 3AAFA 2JUGA 1N25A 2IS6A 2VJIA 1U5TC 1JT6A 1E17A 3K1MA 5D4RA 4EQQA 1G4DA 3I54A 2I8DA 5HDGA 5IP6A 1MW7A 2LY2A 2VXDA 3DPLC 5L3CA 2P7VB 4EATA 1IXSB 3MZ8A 4PJNA 2CO5A 3CUQA 4FQGA 1UCRA 3C2GA 2W84A 1U9NA 4A3LJ 1X3UA 4E7ZA 3K1PA 1JHHA 1WWXA 2ELJA 3DKYA 3HEFA 4NDLA 2QM3A 1OYYA 4G9YA 1XPXA 1XMAA 5EGOA 5AIQA 3PSFA 3KP6A 5IT9K 1BIAA 3ML6A 3GX4X 3HTSB 1OR7A 4IOAF 2WY7Q 4B3AA 1IRZA 4WXHA 1QZYA 1TNTA 4XLFA 4Y15A 1VQKI 4JP0A 4XRFA 3RCOA 3GW2A 4HLXA 4HG2A 3WG7H 5FFZA 2HPIA 4IRIA 1J2XA 3J7AY 5D5VB 1U2WA 3I71A 4HQMA 3WU0A 2E5ZA 3RKXA 5D5UB 3K4JA 3VSLA 3HOUJ 2Y0SN 3Q3SA 2CRGA 4U7BA 3KE2A 1I39A 5JVGF 5HS8A 2R7FA 2VBYA 2KIMA 3CCJI 2M4GA 3BTJA 1BI0A 2E1NA 3CUQC 3TBIA 3D0SA 2FSWA 4KA4A 2RNGA 1HDDC 2W1OA 4GDFA 1F1ZA 5JHUA 2LG4A 1P9QC 1IXRC 4M3GA 3QAHA 2BXZA 1LFUP 1WJFA 2YX4A 1QHHD 2EWNA 4X1EA 1WJEA 1Q1HA 1TQIA 1J59A 1TC3C 5E1ZB 1Z3XA 3LWFA 1WSUA 1IV8A 3CCRI 1YFHA 5IY5H 2DA6A 2DTRA 3FKIJ 4N9HA 4OAYA 1BOAA 3HXLA 4UXNA 3B73A 4IQ4A 3QU6A 2CW7A 3W6JB 2VB6A 1WHUA 3OIQA 4LB6B 3O6BB 4B8XA 3BG3A 2L02A 1X1BA 3G2BA 3ZMDA 1SEUA 3HSRA 1O7LA 1FOYA 3S32A 1EJ9A 3I59B 3Q0UA 4AUXA 1B8IB 2PMUA 1SMTA 1Y39A 3WODF 2M0CA 3T1BA 5KNLA 2R5ZB 3GUDA 4IL6C 1TP4A 2W82A 2CG4A 2VC1A 4BQNA 2XAGA 2WBMA 4I98B 5M3MJ 3GCMA 2V26A 2VKDA 4I01A 2JVGA 2V6CA 3RI4A 4AD9A 2LRDA 3JAMZ 4V19K 5J6XA 3T8RA 4QSHA 2ZJPF 4MQ9F 2DFFA 4OMZA 3WTWC 1XGOA 3GMEA 2R7UA 1P7JA 3CCSI 1VQ8I 1IRFA 4A5MA 1R5HA 2OU2A 3VYSB 5DDGA 2XAHA 5ILUA 4IVNA 1J0RA 1ZRCA 4P1WA 2QKLB 2HGCA 3FXKA 4JX4A 5TJJA 5FKLA 1Z0XA 4CZZA 3GTOJ 4ANJA 1UG2A 1UMQA 2EIJH 4PSXA 3S1RJ 1HOMA 5HLGA 3ABMH 1I3QJ 2KDOA 1K4SA 1ETKA 2UXXA 5EZGA 3I59A 3J7AO 2M1BA 4KT5C 2JRMA 2XF5A 4IHTA 2DA2A 3C18A 1B8IA 2V1UA 1XS9A 2IXSA 2R5ZA 4G7HF 2ME0A 4UV9A 3RQ4A 4A12A 2DODA 4D5FA 1PP8F 3DU6A 1RC9A 1W36C 2DMTA 4Q5SF 2ZC2A 3VDXA 1DGRM 2F5VA 3E5QA 2ETHA 4BDYA 4II2A 2L7FP 1YQAA 1TWHJ 1LDJA 3RPQA 2R7RA 3GFJA 3VEPA 3HKZA 3ZQQA 1SVOA 5J1UA 5HNHA 2DA7A 2DTZA 1C0WA 3KPHA 2FA5A 2PLYA 3CCEI 4B1RA 5GTHC 2KKOA 4HYEA 4B4CA 5CVRA 4ZYHA 2P5KA 3FM3A 1MJBA 5JI6A 1SVLA 2LSOA 1PYVA 4XOPA 1Y0UA 1ZREA 3GLLA 5FLXZ 1FWZA 4IKFA 1PDNC 3DLAA 5ICCA 4KIGA 5L3GA 1UB9A 1Z21A 1JUMA 5J8CA 4NB5A 2CV1A 2VJ5A 3E97A 1S6LA 4U88A 1E3PA 3HC7A 4F52A 4RB2C 2LD5A 1EV7A 2L2OA 3JW4A 3V4GA 1GV5A 4RLQA 2PX9A 4HV5A 5EDNA 5L3FA 4HF1A 4Y4RA 1JJ8C 1HW2A 3CD6I 4H4KC 1B9MA 3LMMA 3BR0A 4GGGA 5F0FA 1H9TA 1B6AA 3WTVC 1QVTA 2STWA 2IJLA 2EZKA 2HNHA 3TDZC 1HF0A 4XMYA 2NVUB 1MD0A 2DPDA 5GTIC 1W0TA 1KYZA 2Z5UA 1XTAA 2MD0A 4PUSA 4HOBA 3G73A 5EG0B 1I6XA 4IRGA 3OY9A 1JTYA 1R00A 3OMYA 4EGZA 2ZXIA 4ZDLA 2NS8A 1YTYA 4XNFA 1FOWA 2M8GX 3A02A 1IUYA 4L5EA 3HOVJ 3KLOA 1IO2A 4HZFA 3DQVC 1JUPA 2UUZA 5HS7A 1E2XA 3S1NJ 3VOEA 2AQFA 2AHQA 5L3BA 3WTZA 4XN0A 3BPXA 1J7KA 3OYCA 2X1EA 1VQOI 1FYMA 5JLWA 2EQRA 2CJJA 3AG4H 1DPUA 2JWTA 1EF4A 1H89C 5D5WB 2YU9J 5K7HA 2HR3A 2OQRA 3BG6A 4I0AA 3JRGA 4ENNA 3M8FA 2RQQA 1GT0C 3Q5FA 2ECBA 4IHWA 2LY9A 2CFOA 3BC8A 4IHVA 2H1LA 3DCFA 3KCCA 3NARA 3H3ZA 1OCTC 2JUCA 1Z91A 2B7EA 4BQAA 4XORA 5K5RA 4P9FA 1WRJA 2QZ8A 4HX8A 2H6CA 5EG0A 3KIOA 4BYYA 1IRGA 1Y56A 2EINH 4AU7A 2X4HA 2YSRA 4XLCA 4UY8I 3T8TA 3BR6A 1SAXA 1A31A 4ZYDA 4BGDA 5CPRB 1EH6A 3LFKA 3ECOA 3Q0VA 3PUFA 5J4YA 4E70A 3I4PA 4AC0A 1BOBA 3K0LA 2IS1A 1AKHB 4ZYGA 1LVAA 3GTJJ 1TQPA 2R0QC 3ASNH 1S8NA 2F2EA 2VI6A 3LA7A 4RA2A 1Z77A 4YEJA 1B59A 2X6WA 3BPVA 1W5SA 1X1AA 1JKQC 1GXPA 2H1KA 4OINF 2NS7A 4RAFA 2XIGA 5FGMA 2M0MA 2OTLI 3LL7A 2EZLA 1IG7A 1J75A 1FZPB 2PMHA 2HOSA 3PIPF 4I99C 4XBFA 4WWCA 2RN7A 3EUAA 3E6DA 2DLLA 4A0ZA 1VF9A 2H09A 2LDUA 2QENA 3EUHA 1QQIA 5KHDA 2BEOA 1HC8A 2E7XA 3ZN0A 2NNYA 3E6CC 4BNCA 1MJ9A 4FE7A 3SHFA 3HRTA 4RB3C 3F3XA 2Q8KA 5BPDA 1XMKA 3RSNA 3RZOJ 1AKHA 1W36D 4C3IJ 3FZVA 1QPMA 3OYIA 2DMPA 1WH5A 1MSFC 1ZGJA 4MHGA 3JRAA 2RNJA 3CCVI 2E2JJ 1D3YA 3AFHA 1WQ2A 2PN6A 3IP4B 1MBEA 1TTYA 5E17F 4CCMA 3RQIA 3MKZA 3TO7A 2A05A 2FU4A 2A68F 2KHMA 5HODA 1LDDA 1JHFA 3P9KA 4A3GJ 1KQ9A 3G6EI 2R7OA 4BJ6C 2VUMJ 3VPRA 4C2TA 1SFKA 1XGMA 1FJLA 2FMLA 3OS1A 2NVTJ 3CDIA 4BBSJ 5EJCA 1FBQA 3M7GA 4I6ZA 3S1MJ 5ILVA 1T2KA 2GOMA 2I5UA 5E3LA 3EUKL 5ED4A 1G6NA 4Q48A 2WC2A 3KYDB 1BA5A 1XC5A 2PG4A 3EUHC 4N4OB 4BL0B 3BCAA 4ENJA 2Z3YA 2RV8A 4BY1J 5FLVA 4LMYA 4X6AJ 4L9JA 2WA0A 3ZN1A 3CJRB 2GIZA 4WCGA 4XL9A 3AL0C 5IP7J 3TQNA 2VBZA 3LAPA 1O4XA 3FISA 2K4BA 1L0OC 1IN5A 4YFNF 1IDYA 2DK8A 3F8CA 5BQTA 3LNQA 2DOEA 1YYVA 4Z2YA 4ASNA 4G7OF 4MEYF 4N9IA 1G8XA 3BQZA 2KZVA 1OJLA 3KEYA 4HF0A 1PUEE 3NWTA 2ID3A 1K6YA 1RETA 1WVRA 2CW0F 3QOPA 2O5RA 3HOYJ 2NXNB 1BN5A 1QPIA 2CS3A 3KP2A 2CU7A 2F48A 1FNNA 1R36A 5KCMA 9ANTA 2PJPA 3FM5A 2M87A 1QA6A 1JE8A 1X4PA 1A6IA 2LF8A 3BCBA 4QWQA 1EH7A 2R92J 4I2OA 5CVUA 2D1VA 1XDUA 2DFEA 4D7NA 1D5YA 5H2FC 2HDCA 2EZHA 4EM1A 1YIJI 4MEXF 2HS5A 4AIDA 2HVSA 3SZGA 2VKHA 1STZA 4UNOA 1HDPA 3FXJA 4UUSB 2HTJA 3WHCA 1LQ1A 2PEXA 1UHMA 5F0CA 1DU6A 4DGWB 1A35A 4EVIA 2XAFA 4XSXF 1WCMJ 3B02A 2DAOA 1QRYA 2QQBA 3VFZA 2F5FA 1G59A 1UJ8A 3PQJA 3RTRA 5LBQA 2E35A 1MNEA 2P5VA 4DYRA 1T39A 2QQAA 3F8MA 4AWXB 4BUPA 4ZZLA 1IN4A 2OZ6A 3CMMA 1IZ1A 3MD2A 5HS9A 2MLGA 3BTIA 3OYFA 3GTPJ 1MIJA 2L01A 3BR5A 1UELB 3DV8A 1DP7P 1R1TA 3HOXJ 1XCBA 4GFBA 2LK2A 3BTLA 2DYRH 3H9JA 4IHYA 4GO1A 2XRNA 1OCOH 3OOPA 4BEHB 2M5WA 1X4OA 3HPGA 5D8KB 2DCEA 1DGWY 4F91B 4UUSA 1YI2I 2FQ3A 3D5SC 2KIQA 4HA8A 1WJBA 3MN2A 4A0YA 4M72A 1ZG5A 3KFWX 3EETA 4PCQA 2STTA 4JBAA 3CCQI 1G2HA 2HVQA 4WXCA 1FPQA 4AM3A 2LYCA 3MZYA 4XLEA 4OIPF 5TGTA 2CQQA 3JRCA 1QZEA 1IJWC 4M9XA 1NK3P 5DM7F 4OOIA 3TW7A 3VYTB 4XIDA 4XLNF 4KIBA 2V9VA 4ZDOA 3D1NI 3Q9VA 2Q0OA 4P5OA 3R0AA 1FSHA 2EPFA 1PP7U 2KJCA 2K85A 1L3LA 3SFIA 3K1NA 1FSEA 1T6SA 1ETOA 1R1VA 4BEHA 1WFXA 1A5JA 1I1GA 1S7AA 3PO2J 1UHSA 5CQGA 1HKTA 3DEUA 1OYIA 4HRIA 1D1BA 3G1MA 3IRRA 2RREA 2ZSIB 1X58A 5F64A 5C4XJ 3FXQA 5HVQC 2L9RA 4BXUA 2W7NA 3FBIB 4U87A 2FOWA 2ZXWH 4S0HB 3WU2C 2Q2EB 5EZHA 1ZGAA 3M9AA 2KJBA 2HVRA 4YG2F 2BBYA 1SD7A 2LFBA 4L0ZB 3ISPA 4UB6C 4QLCU 4ENMA 3S3MA 2O6GE 4M73A 1GVDA 1U9OA 4NNJA 1AHDP 2ADUA 3ZPLA 5ILSA 5HDKA 5FD6A 1J5YA 2YR2A 2HDWA 3K70C 2O61A 2CSOA 1RI7A 1YX5A 4KICA 1HBXG 4L0YB 4CYDA 2XKPA 1TT0A 2KT0A 3LSJA 3J81Z 3L2RA 3HIFA 3ZMZA 2EFWA 3BJOA 3BP8A 5F27A 2IA0A 3N4MA 5DD4A 2Q1ZB 2Q2EA 3GVAA 3OYBA 2VASA 1TT5B 1OCZH 4HNUA 3U21A 2M4KA 1F36A 2IS2A 3ESWB 4QPOA 5E3MA 3CP2A 1QGPA 3S14J 5EYRA 4HNVA 1YW9A 4C2UA 3JRBA 1XGSA 3ROUA 1GV2A 2O7OA 5DS9A 2E2HJ 2QQ9A 1RESA 4ZC3A 1IF1A 2CV0A 2BGCA 2FBKA 1MMSA 1IDZA 3FXUA 3HSFA 4P9UA 5DCMB 4B44A 2FBIA 1ODDA 3VB2A 3OV8A 4KJZA 1ZRFA 2MC4A 2QQ8A 3O3KA 2KRFA 4MLOA 3ZOBA 3SEZA 1BW6A 1N77A 2JA8J 2R7SA 5FKKA 1E3HA 1B4AA 1ZN2A 2V1NA 1KU2A 2LBFB 3GZ6A 2ZBKA 3CCUI 2HQAA 2X85A 1T08B 3I55I 1VQ6I 3WGHA 4OIQF 1R6RA 2OF7A 5E8IA 2DDAA 1LKXA 3B6CA 3NWSA 4BXFA 1H9GA 3U1DA 3E6MA 4YRVA 5HNFA 1NH3A 1OQYA 4MGRA 4E6KG 3H3VK 4XRSG 4IF4A 3RJPA 3H9QA 2XPUA 6PAXA 1MSEC 3JTGA 3IH2A 2PJRB 5DCMA 1UAAA 1NK2P 5A2QK 3GF2A 3TW6A 2ZJRF 3HGGA 2CQNA 4RM3A 3M8EA 3ZXSA 4RGRA 4Y7NJ 2KP6A 4BE0A 4XN3A 5FB2A 3KETA 2KQRA 1HSTA 2ZJ2A 1R5ID 4CSWA 3FDYA 4I76A 4U0YA 3L7WA 1N78A 3PQKA 2LBFA 1IW7F 1OYWA 4XKWA 3L2VA 2MGQA 2VBXA 4DYQA 2D2WA 3MAJA 1USTA 4HX7A 3F22A 4A3FJ 5FRNA 4G6DA 1V4RA 4BE1A 1REPC 2H8WA 3T0YA 5FRMA 1OR7C 5J1YA 3DEWA 3BJ6A 1K61A 4CCOA 1ZHFA 3AG3H 5M5XJ 1DU0A 1K7AA 2P6SA 5E18F 2MBFA 2W48A 1NHAA 2VKVA 4E7HA 3W2VA 3HOWJ 4FE4A 2PJRA 4HDUA 5IT9Z 2DMQA 3BT9A 3K69A 3H5NA 3NRVA 4NBQA 1XN7A 2JA5J 4KN4X 1K79A 5LLQA 2XF7A 3WTSC 2JT1A 1YJ9I 2BYVE 2O3FA 2ZJQF 2X1CA 4BJTA 3RKQA 2OC6A 3LA2A 4ZH4F 1U6GA 1TWGJ 2DA3A 2E7WA 1H8AC 4LB5A 3H9GA 3PNYA 4IX7A 1S5LC 4AYBA 1DPRA 1FOXA 3BR3A 1VQ4I 1OCPA 4A6EA 3G71I 3IAS2 4WX9A 3F6VA 1TWAJ 2CUJA 2YU3A 3K4CA 4KIFA 2Z99A 3ZMVA 3FXRA 4N0BA 4G12A 3PL8A 2Z33A 1TLHB 2D5VA 2MFZA 3K70D 2VOPA 2AXLA 2A69F 1RZ4A 2VT2A 3BZ6A 1FP2A 3H92A 3GFLA 4HSTA 4XLHA 3I58A 5AIPA 4DNCA 1TW3A 1FIPA 4JOMA 2MLKA 1W1WE 2MW8A 1T95A 2RKHA 3LAJA 2UXNA 2P8TA 3LSGA 1GLNA 3QU3A 4M74A 5FLMJ 3V8LA 2IP2A 4IJAA 2ZNZA 1VQPI 1LDKB 2JSPA 2BZTA 3CZ6A 4LLGF 2R5YB 1LFBA 3F6OA 2VIXA 1OPCA 3S16J 3E7LA 1RIOH 1WH7A 2K9SA 3CJQB 2DJIA 4HSRA 2DOAA 3IWFA 2OUMA 4BKXA 4Y3OA 3E5XA 1Y8RB 1FX7A 2XRLA 3SFZA 3TDUC 5BMZA 3IUOA 1Z9CA 1A36A 2P6TA 4A93J 3RYRA 2B63J 3FX3A 5J4VA 1GXQA 2F5EA 5LHIA 1RR8C 5CVVA 1R22A 3OYNA 2WY8Q 3S3NA 3HL2A 3PIOF 3C3WA 1PVEA 2MSYA 1TL8A 2HWVA 3ZQLA 3HYIA 5LRSA 5LGUA 3G3ZA 3I4MJ 2ZB9A 4KDPA 1YE9A 3VYRB 4EEFG 5LEKA 3HZJA 1FMWA 4B47A 1Z7UA 2YPRA 4QIWN 2R5YA 2FQ4A 2W57A 5IYDJ 4JX6A 3CESA 3S3OA 3ZQFA 5LD2C 3KX2A 2CYYA 4XKCA 2A6EF 3V8KA 2DW4A 3BG9A 4HPQA 4J01A 2D1HA 3BZKA 1PUFB 3PSIA 2EFNA 1F4KA 2K7LA 5KVRA 5BPIA 3WHBA 3JR9A 5FJ8J 1ZGWA 3BROA 3F72A 3W3CA 2F4MB 2IGOA 2W24A 3CUOA 3TKYA 3DF8A 2HZTA 4Z6YA 2XAQA 5H20A 2IA1A 4K2EA 1S72I 1BBYA 1SVMA 2G0EA 3WU1B 3UR3C 2L4AA 4JYKA 3A4CA 2IBDA 2YX7A 4Y13A 2XASA 1QZZA 5CYVA 1MBJA 3H36A 1W0UA 3W6VA 4Y17A 4J19A 1R58A 2NAZA 1MH4A 2NOJB 2O9LA 1R49A 1JKPC 2ISYA 2L9SA 2HZDA 4V2FA 3OYHA 2OJED 2NOGA 2Y30A 2UWMA 2XDVA 4A3EJ 1BIBA 1PUFA 1RUOA 5JVTA 3HJEA 5B1BH 1VI0A 1I3AA 4R8HA 2BV6A 4HBLA 3VODA 4EJOA 2RDPA 3CC4I 2A61A 5K5QA 2HOEA 3QP5A 2VBWA 5L3DA 2L7MP 2ZXHA 5CLSA 3MEXA 4IHXA 4IPAA 4HNTA 1XSXA 2GXAA 2GBYA 1HKQA 2VE8A 3H5AA 3RPUA 4RGSA 3H3UA 5K5OA 3W6KB 2K02A 2QSHX 2A6HF 2KDZA 1MKMA 1G3TA 1DP3A 3I0TA 4EV0A 1AWCA 1T33A 5KAFC 2Z1DA 4S05A 4Q47A 3GTGJ 5LGNA 1JGGA 1V5EA 3R61A 3G1OA 1BR2A 2ZKZA 3F23A 3J7ZI 1CGPA 1O3RA 2DN0A 1QVUA 4Q4ZF 4LIVA 3SEQA 3TP0A 1Q1VA 2GA1A 4XLPF 2JQ7A 3SYTA 2JJ7A 2OBPA 4ITVA 2KZGA 4PK4A 2R7QA 4EJVA 3DKWA 2VKEA 3OSGA 4XQFA 2RAEA 5GPCA 1T56A 3WTXC 2M3AA 2XV4S 1PJRA 1KONA 4IRHA 3A01B 5M5WJ 1OCRH 2VLAA 3OYJA 5F1RA 1W4MA 1XG1A 4H0EA 2LKXA 3KEQA 1JKRC 2HYFA 3H0GJ 1POGA 1LJ9A 3KZYA 3QPHA 3SQNA 2HTSA 3L9FA 3FK7A
chains in the Genus database with same CATH topology
2K85A 2LKSA 4FQGA 1UZCA 2KZGA 2KISA 2JUCA 2B7EA 2CQNA 2DOFA 2DODA 2KIQA 2E71A 2DOEA 2L9VA 2KFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K85 A;  2LKS A;  4FQG A;  1UZC A;  2KZG A;  2KIS A;  2JUC A;  2B7E A;  2CQN A;  2DOF A;  2DOD A;  2KIQ A;  2E71 A;  2DOE A;  2L9V A;  2KFD A; 
#chains in the Genus database with same CATH topology
 1FYK A;  2G7H A;  4BQO A;  4BAY A;  3PM1 A;  2HI3 A;  2IT0 A;  2DT7 B;  2EBI A;  2HYG D;  2QA4 I;  3OYD A;  1EKE A;  3J80 Z;  3DXJ F;  1R1U A;  1W5T A;  3E1S A;  4CUG A;  4DZJ A;  1XCV A;  2Y0M A;  3HKZ N;  2QCO A;  3QPT A;  4AIH A;  2JZY A;  3WGI A;  2FMY A;  1KQ0 A;  3DPT A;  2QBY B;  1H0M A;  3S2H J;  3P5J A;  2ZFW A;  3QYF A;  5FRO A;  3WTU C;  2W00 A;  3A01 A;  5B5E C;  2WB1 A;  4D9J A;  2E2I J;  5F0H A;  5F6F A;  2OPT A;  1ETQ A;  2L7Z A;  1YHQ I;  1RKW A;  2IEK A;  2ZFU A;  2KMU A;  2OCE A;  3HHH A;  4W1U A;  3CCL I;  1GHC A;  1FTZ A;  1IN8 A;  1NG7 A;  1O57 A;  3X2Q H;  2BXY A;  3L09 A;  2RVC A;  2K9M A;  3BG7 A;  3ELK A;  1IUF A;  2E5N A;  4FIS A;  1APL C;  1MJA A;  2VQL A;  2FNA A;  2IW5 A;  4A3I J;  5K7F A;  3KP7 A;  3PNV A;  3KZI C;  5DYM A;  3CO6 C;  4RB1 A;  3WG9 A;  2WAQ A;  3DFG A;  4BQQ A;  2XSD C;  2XGE A;  1HKS A;  2P7C B;  1Z67 A;  3OWT A;  3CC7 I;  2QBY A;  3J7Y J;  2YS9 A;  2IGN A;  3CME I;  1D0X A;  3R60 A;  4NC8 A;  2JTV A;  1U8B A;  4PGH A;  1D0Y A;  1U8R A;  4E7L A;  2DMN A;  3TOB A;  1R9T J;  4M9Z A;  1FIA A;  2GOX B;  3A0B C;  1MDM B;  4WK8 F;  3K10 A;  4HEA 2;  1FBU A;  2H6B A;  3HUG B;  2BHZ A;  4F7Z A;  3HOS A;  5GAE J;  1QBJ A;  5AON A;  3PO3 J;  3OS0 A;  3GYH X;  2X6X A;  4RDU A;  2UZK A;  1K6O A;  2WTE A;  1Y6I A;  2OAZ A;  2PMZ A;  3ZMS A;  4FTH A;  3KEO A;  2V9K A;  3IKT A;  1MNM C;  4M6V A;  2WV1 A;  4WXD A;  2WV0 A;  4EMS A;  2JMW A;  5HLH A;  4HDV A;  2CV2 A;  4F92 B;  2XB5 A;  3K2Z A;  1BJZ A;  3JCU C;  2Y69 H;  2FOK A;  5D5X B;  2CQ7 A;  4CXF A;  1K78 B;  5KAI C;  2ZME B;  1HW5 A;  1WPK A;  2ISZ A;  5C3E J;  2ZSH B;  3W2W A;  2A07 F;  4UVA A;  2E71 A;  3F0C A;  2X6O A;  1MDM A;  1BM9 A;  1W7P B;  2J5O A;  5M3F J;  3SJM A;  3HUG A;  2LNB A;  5KK1 A;  3ZMU A;  2IVM A;  4F55 A;  2QSG X;  2E36 A;  2GIV A;  3HBL A;  5DUI A;  2XRO A;  1VQM I;  4X0G A;  4UB8 C;  1VFC A;  5C4J J;  2L9N A;  4I0B A;  3M4O J;  2HXI A;  2EFO A;  4BHB A;  1FC3 A;  1XMX A;  2NVY J;  4RBO A;  3JRF A;  4WF2 A;  1DQU A;  2OA4 A;  3I9V 2;  4NUB A;  1D1A A;  1YW8 A;  2IGM A;  3FWE A;  2QWW A;  4RLF A;  2DU9 A;  1JT0 A;  4GXO A;  5IOZ A;  2VE9 A;  1QHG A;  1O7F A;  5L3E A;  3KP5 A;  1IN7 A;  3TOA A;  3KYL A;  4BHC A;  2FXA A;  3BDD A;  2HQN A;  2ZME A;  3ZQI A;  4XKB A;  5IYC J;  2C6Y A;  1MH3 A;  3F8F A;  2P0W A;  4BY7 J;  3G1L A;  2GXB A;  1NTC A;  1S7E A;  1UG0 A;  3PUB A;  2HDD A;  4L9T A;  3LSK A;  3FMQ A;  1W7P A;  3OR2 C;  1ULY A;  3PFY A;  2J5P A;  3OR1 C;  4O5V A;  5ERI A;  3N97 A;  1Y1W J;  1HLV A;  5CKT A;  3F21 A;  1FTT A;  1UFM A;  3HB9 A;  4RGU A;  2I10 A;  3CCM I;  4BAC A;  5C44 J;  3CLQ A;  4I02 A;  2DI3 A;  5EEH A;  2EFP A;  3BWG A;  3HRU A;  1U0J A;  4CA0 A;  4LK1 F;  2BOL A;  3E6B A;  3BQY A;  4JX5 A;  3H0D A;  2Y0S A;  3OYM A;  1I50 J;  2X6Y A;  2QKM B;  2XGD A;  2LRE A;  2DO7 A;  2VN2 A;  3R6S A;  1ON1 A;  4GYG A;  1LVK A;  2DFH A;  3R4K A;  4LLN A;  3V8J A;  1YS6 A;  3SZT A;  1YO5 C;  2QUF A;  1RUN A;  1MZB A;  1T98 A;  3IWZ A;  4L5I A;  1SFU A;  1U5T B;  1P4X A;  1F9N A;  4JK1 X;  2EH3 A;  3ABU A;  2QF7 A;  3IH4 A;  4DIQ A;  2RGV A;  2X0L A;  3P9C A;  1SMY F;  5CVJ A;  3DKX A;  2EB7 A;  4OWR B;  2HQ5 A;  4DYC A;  3OL4 A;  1SC7 A;  1VQ5 I;  3U2R A;  5ICF A;  2VOO A;  3GTK J;  2LVS A;  1D1C A;  3M1E A;  4A3C J;  3DU5 A;  2ZME C;  1G3Y A;  2HQR A;  3GO5 A;  5JLX A;  2HPM A;  3HHG A;  3CO7 C;  5LEJ A;  1R5G A;  3DBL B;  2VT3 A;  4U0W A;  2VJJ A;  4DBQ A;  1MBH A;  3LST A;  4G7Z F;  3WTY C;  3BJA A;  3ABT A;  4BJ5 C;  1BC8 C;  2LC2 A;  5FD5 A;  2FD5 A;  3QWL A;  4FCY A;  3S1Q J;  1V5G A;  1JI8 A;  1J9I A;  3B6A A;  2LLK A;  1ZYR F;  3FMS A;  2JA6 J;  2DPU A;  3ZGK A;  2FRH A;  3OIO A;  4E4H A;  1E3O C;  2W4S A;  1D0Z A;  3OS2 A;  2ELK A;  3ERE D;  1X1C A;  3BTC A;  3LSH A;  2R3S A;  2K9N A;  2MA3 A;  4B48 A;  2CMP A;  4ZTJ A;  4DJA A;  2DYS H;  4KT6 A;  4MFD A;  4BBR J;  4PGG A;  3OOU A;  5EF6 A;  2KRC A;  3CDH A;  2E1C A;  4FHT A;  2EIM H;  3FHN A;  3ZR8 X;  2LKP A;  3SDB A;  4GRI A;  5LRR A;  3FKJ A;  1KQ8 A;  2ECC A;  4A69 C;  4PJM A;  3GXO A;  4NC7 A;  1SFE A;  1JXS A;  5E79 C;  3IRQ A;  3S15 J;  4RAZ A;  5M5Y J;  1KZH A;  4AIK A;  1ZLJ A;  1XB4 A;  3K7A J;  4HW0 A;  2V79 A;  1BL0 A;  1F43 A;  3OL3 A;  3JSP A;  5E1W A;  4N4N B;  1ZTR A;  4FT8 A;  3V42 A;  3WTT C;  4M3F A;  5ICE A;  3FMR A;  3L2U A;  4B3X A;  4E7S A;  4G6T B;  1LEB A;  3OIP A;  4LG0 B;  5J3L A;  3GTQ J;  1D5V A;  1Z1D A;  4GYI A;  1EH8 A;  4XON A;  5E8G A;  2P5L C;  3CJN A;  2OV7 A;  4AIJ A;  1ZQ3 P;  2GXG A;  3A0H C;  3TL4 X;  3CMA I;  3HOZ J;  1X1D A;  4M6Y A;  1ETY A;  4HLY A;  4IO9 F;  2B9S A;  2GQQ A;  3JRH A;  3CMY A;  2QVO A;  4KMF A;  3DBH B;  2MAB A;  3H5R A;  4A3M J;  1TWC J;  1XX5 A;  3FXO A;  3LSM A;  1T38 A;  3NAU A;  4C3J J;  1YRN B;  3LSR A;  3M3Y J;  2K9Q A;  2K86 A;  1O3Q A;  5GAH J;  3L2W A;  2UV1 A;  5BOX A;  4ETS A;  1LEA A;  3S17 J;  2XF6 A;  2K27 A;  5B3S H;  2EK5 A;  3HG9 A;  5FKN A;  4LIU A;  3CCY A;  4CHU A;  5LHG A;  2VC0 A;  3NEU A;  3EDP A;  4C9Y A;  3IH3 A;  3ABL H;  1Z6T A;  4LK0 F;  3WE3 A;  2Y31 A;  4YEL A;  4LG0 A;  4EJW A;  2R7W A;  3K4M A;  2E60 A;  4L18 B;  2JVH A;  4DQ2 A;  1X3Z B;  2KRH A;  1I1S A;  1TBX A;  2OCC H;  2XKO A;  4CCL A;  1T8I A;  1OMI A;  2NRA C;  3TMO A;  2M34 A;  3N05 A;  2QEX I;  2CW8 A;  4D5C A;  4BU2 A;  2R7D A;  4ESB A;  2O8K A;  5GPA A;  3I3L A;  1DUX C;  5K7Z A;  1RRJ A;  3K4L A;  3ZQH A;  1YRN A;  3QYB A;  2DK5 A;  1YJW I;  4F93 B;  1QNT A;  3GZN B;  5K1Y A;  2M45 A;  3ZQC A;  1ZH5 A;  2MYS A;  1OKR A;  4NQW B;  2KPM A;  3FIW A;  3MQ0 A;  1LE8 B;  1KA8 A;  1JUS A;  2EA2 A;  3RZD J;  2M8E A;  4A3J J;  1UZC A;  1IXC A;  2FNP A;  2XAU A;  5IPA A;  3I4N J;  3HPH A;  4MTD A;  1F5T A;  4C30 A;  3QOD A;  3JAM K;  1XD7 A;  2DBB A;  5HLI A;  4HF2 A;  5H6R A;  2F6C A;  4M3B A;  5DV5 A;  4BDZ A;  2W25 A;  1CF7 B;  2FE3 A;  2VPR A;  1ON2 A;  3MZH A;  2E19 A;  2ESN A;  1JTX A;  4XSZ F;  2Y75 A;  5DCF A;  4U0V A;  2O8X A;  3V7S A;  1YIT I;  4AVP A;  1S9H A;  5DTD A;  3L1P A;  1WJD A;  1RKT A;  1Y8Q B;  2JN6 A;  4HAM A;  4C3H J;  1ZLK A;  1IGN A;  2D45 A;  2F5C A;  3TO9 A;  4A3B J;  1W7P D;  3IKV A;  1ZR4 A;  3L00 A;  4NQW A;  5E3O A;  3CDL A;  1LE8 A;  1RNL A;  2NS0 A;  5IP9 J;  3BZC A;  3EQL F;  2ESH A;  4OIO F;  5A2Q Z;  4C2M J;  1WI3 A;  1RPW A;  4ZDP A;  1CF7 A;  4KMU X;  2X48 A;  3V7C A;  4FX0 A;  2IRF G;  2X1D A;  2DA1 A;  1ACI A;  2EJR A;  5F1J A;  3RIR A;  3RYP A;  1BW5 A;  1TZL A;  1VTN C;  3PFI A;  3KZZ A;  5D4S A;  2GA2 A;  2COB A;  3MKY B;  3K4K A;  2LY1 A;  1MMD A;  1P4W A;  4D0P A;  2MC3 A;  3FXM A;  4IOC F;  3V7R A;  3FK6 A;  2EZI A;  3QYE A;  1I6H J;  4BH9 A;  3DPU A;  4OIR F;  3VWB A;  1HQC A;  2NYX A;  1R23 A;  1MBK A;  5FLX K;  2XPV A;  3COA C;  2Z2S B;  1TWF J;  1XGN A;  3KLN A;  1IRX A;  4G8X A;  3IC7 A;  3JRI A;  1LFP A;  1ETX A;  5FKO A;  3REO A;  1MND A;  4IXA A;  4A3D J;  4NHJ A;  1IAW A;  4YII A;  2Y48 A;  2AXT C;  3BY6 A;  4RM2 A;  1V54 H;  4B09 A;  3DTI A;  3I5U A;  3P7N A;  2DDB A;  3IL2 A;  1K4T A;  1KGS A;  1O3T A;  4E7K A;  3CQZ J;  3MMY B;  4EJT A;  1OFC X;  4QTR A;  3UNG C;  1VND A;  3SZP A;  3QRF F;  3MKL A;  2ZXJ A;  3ZMT A;  4UUV A;  1HSJ A;  4ZYA A;  4KIS A;  1LUJ B;  2R7T A;  2KIU A;  4PJL A;  4M9S A;  4IEJ A;  2DA4 A;  4EM0 B;  2ME6 A;  3I64 A;  4I7H A;  1BI3 A;  3BR2 A;  3VSK A;  4B43 A;  2H27 A;  2CFX A;  4AVZ A;  2PI0 A;  3VYU B;  5J8F A;  5ICG A;  2L4M A;  1ZR2 A;  4CCN A;  2R7X A;  4KFC A;  2HEO A;  4UHT A;  1SAU A;  3OYA A;  3I53 A;  1YG2 A;  1R4M B;  4R1H A;  1YX3 A;  4CCK A;  1Z7L A;  2YUS A;  4CDG A;  4XM3 A;  2LKS A;  2Y9Z A;  2JA7 J;  4LLL A;  1SFO J;  2JSC A;  3K4B A;  1FT9 A;  4PFP A;  5F08 A;  3U9G A;  4A5N A;  4ESJ A;  5B66 C;  2M30 A;  5DD8 A;  2XGX A;  4XRS A;  4L5J A;  3GLX A;  4HQE A;  4OAZ A;  3OSF A;  1V5F A;  2LTP A;  2GLO A;  2COM A;  1WKM A;  3W2A A;  3BOQ A;  1U3E M;  4MFE A;  2V7F A;  4IZZ A;  4L9V A;  1HA8 A;  3LA3 A;  4YFK F;  3Q0W A;  3SDG A;  1TNS A;  2K3P A;  4DW6 A;  3M07 A;  4RS8 A;  2CUF A;  2LMD A;  4D1Q A;  3HRM A;  5BNG A;  3OYE A;  1BI2 A;  2G9W A;  5FKM A;  4UVC A;  1MBF A;  2BY0 A;  3TP3 A;  2QLZ A;  1BR1 A;  2EFQ A;  2A5W A;  2DFI A;  2VOD A;  1KYW A;  2LR8 A;  1WJA A;  1VZ0 A;  2BE5 F;  5J47 A;  4CYC B;  1P7I A;  1P4A A;  4QPQ A;  1SD6 A;  2ZCW A;  3DEE A;  5GAD J;  4J00 A;  4KYW A;  1ZAO A;  3DLL F;  1GDT A;  3JTH A;  4CO8 A;  2E1O A;  3CTA A;  4W97 A;  4ABZ A;  2CGP A;  4PJ0 C;  2BHY A;  1BJA A;  4F3Q A;  3A2K A;  4TV7 A;  5H6Q A;  1WJ5 A;  4YIR X;  2VQC A;  3BLY A;  2N8G A;  4CCJ A;  3RKY A;  1ZG1 A;  3S93 A;  2XUB A;  5BS6 A;  3T5X A;  2OQG A;  3KP3 A;  1KU7 A;  2HU9 A;  4RAY A;  2B0L A;  2MG4 A;  3GZ5 A;  2O0Y A;  1WI9 A;  3CLO A;  1W5C C;  1U78 A;  2NNN A;  3ECH A;  1G3W A;  3DTK A;  3ABK H;  2FUG 2;  3L2Q A;  5JHF A;  3BR1 A;  1AA7 A;  1S7O A;  3EYY A;  5EEA A;  3RDI A;  3UKG A;  2ZNY A;  1IV6 A;  4MIM A;  4AYB N;  2KFD A;  1FEX A;  2GZW A;  3JRD A;  2ACJ A;  5GP9 A;  4YFX F;  1MBG A;  4CYC A;  1BI1 A;  1V3F A;  3PJR A;  2Y2Z A;  1K83 J;  2FBH A;  4XIC A;  1ZK8 A;  5TIS C;  3LSP A;  1J09 A;  2EV6 A;  2ID6 A;  2VL8 A;  5FO5 A;  4ON0 A;  5CJ9 A;  4R79 A;  3J80 K;  4HX4 A;  4LJZ F;  3MCZ A;  2ELH A;  4U7D A;  1X2N A;  1RR7 A;  4UVB A;  1AU7 A;  1Y0N A;  1USS A;  3C2H A;  4LIT A;  1D8J A;  3QP6 A;  5HDN A;  2IS4 A;  3ZQ7 A;  3LSI A;  2XHK A;  4M71 A;  1M1E B;  3HRS A;  3FBN B;  2H8R A;  4LOC A;  1T0F A;  3C7J A;  3MFK A;  1D8K A;  3LFU A;  2IAI A;  3AL0 B;  3FXL A;  3IV5 A;  5HOO A;  5D6F A;  3S2D J;  3OYG A;  3Q9S A;  1VQL I;  2BY1 A;  4RAG A;  2CH0 A;  1XDS A;  2FX0 A;  2L7K A;  2DQR A;  3MWM A;  5HLT A;  4KUM A;  3ZRG A;  4Y52 J;  5CVI A;  2MD5 A;  2DXI A;  4XKV A;  3H1C A;  3F8B A;  1NG6 A;  2FEZ A;  4Y33 A;  3DP7 A;  4MQV A;  5IOY A;  1VQN I;  1YS7 A;  1FYL A;  4PJJ A;  2GWR A;  3ASO H;  4BXX J;  1TQM A;  5E1X A;  4S04 A;  4XOT A;  3WGG A;  1YOV B;  3NQO A;  4RMN A;  1FY7 A;  2CUZ A;  2L54 A;  3F8N A;  1XSV A;  3M1C A;  4LFU A;  2M7A A;  4UV8 A;  3GWZ A;  2KLO A;  1LPQ A;  3QQA A;  3A03 A;  4LD5 A;  1JKO C;  2K5C A;  3LQQ A;  2VQH A;  1IC8 A;  5CQE A;  4XRM A;  1ZG3 A;  3GFM A;  2MH2 A;  1ETW A;  2XB0 X;  1WGX A;  2IPQ X;  2P81 A;  2TCT A;  2BY3 A;  2VJ4 A;  1T0F C;  4A2U A;  3OYK A;  1ONV A;  4A3K J;  1KU3 A;  1KU9 A;  5DUK A;  2HYJ A;  1QO0 D;  5TRD A;  3FHZ A;  1X3W B;  2JK3 A;  3K6G A;  3TGN A;  1ORK A;  3S8P A;  2DT5 A;  4MNU A;  2W85 A;  4BS9 A;  2JA2 A;  5JR3 A;  1FLI A;  1X1P A;  2EV0 A;  4M3E A;  2F5D A;  2R7V A;  1SD4 A;  2V6E A;  2KIS A;  3BG5 A;  1B1B A;  5DM6 F;  3FF5 A;  3IHU A;  3TO6 A;  4M3D A;  3ZCO A;  3CF2 A;  3EPZ A;  4LGW A;  2F4O B;  3ONQ A;  3K2A A;  4OU0 A;  1R4N B;  2BY2 A;  3LOC A;  4O6J A;  1ENH A;  2MH9 A;  1YJN I;  3HOT A;  2GAU A;  3SXY A;  4OMY A;  4YIF A;  2HFH A;  3C2B A;  5J1R A;  1E0E A;  5EEG A;  1P6R A;  3KYC B;  1S3J A;  2EV5 A;  4EJU A;  5LHH A;  2VON A;  1ETV A;  2DA5 A;  2Z9O A;  2JPB A;  2NVX J;  3L2C A;  3GTL J;  2PQ8 A;  2M9H A;  4A0X A;  1Z3Y A;  5D8L B;  1JJ6 C;  2K40 A;  2QGU A;  2H94 A;  1H88 C;  2LOO A;  3HM5 A;  1YW7 A;  2K3F A;  4IQJ A;  2VQG A;  2XC7 A;  2E1M B;  1X2M A;  2CWE A;  2DT6 A;  2AS5 F;  2L5Q A;  2L9V A;  3GEZ A;  2GM4 A;  1AOY A;  2K9L A;  4ZTF A;  3E5U A;  4KN7 X;  2RC4 A;  4DZP A;  3WE2 A;  1Z6R A;  4O3M A;  1ZEL A;  1JGS A;  1MMN A;  2CQX A;  2RQP A;  3QPS A;  4CIC A;  1LB2 A;  2TDX A;  5E20 A;  5B1A H;  3HSE A;  2EA4 A;  1YLF A;  2KL4 A;  3O2P E;  2ICW G;  4FET A;  4NC6 A;  4ZZD A;  4PDK A;  1XSD A;  2CUE A;  3GBG A;  3O8G A;  3D5L A;  3KP4 A;  4GCV A;  1FOK A;  1B72 B;  2Y9Y A;  2L3D A;  5LGT A;  1B9N A;  2AQE A;  2AO9 A;  3DWL E;  3E0J B;  1HXD A;  1X19 A;  4L9N A;  4EGY A;  4E7I A;  2HKO A;  3R0J A;  4P96 A;  1MMG A;  2WAD A;  4UUT A;  2DOF A;  1FP1 D;  1K78 A;  4D7M A;  1A04 A;  3DBR B;  2P4W A;  2LP0 A;  4PZJ A;  5E3N A;  3LQR A;  1EA3 A;  3F9K A;  2M7B A;  4EM2 A;  3PNT A;  1BC7 C;  3CF5 F;  2LF7 A;  3S2W A;  4RB0 A;  1ZAR A;  1UHW A;  1OLT A;  4FAS D;  1YIO A;  4XK4 A;  1IN6 A;  1I5Z A;  2XAJ A;  3RPU D;  3QOE A;  2R7Z J;  2E34 A;  2A3S A;  3IAM 2;  2VXZ A;  5FFX A;  4CGZ A;  2V1D A;  4E7J A;  1B72 A;  4BE2 A;  2V1X A;  1LNW A;  5LFA A;  3JRE A;  2VPL A;  2O03 A;  5J40 A;  4CH7 A;  3C1D A;  1ITY A;  2JPC A;  1V55 H;  1GUU A;  5IT3 A;  5DEQ A;  5IYB J;  1HW1 A;  3JSO A;  1S29 A;  3TED A;  1FMV A;  1MMA A;  1Z05 A;  2DJN A;  2HOA A;  4G6Q A;  2HOT A;  3GTM J;  2NVQ J;  3I56 I;  1SAN A;  4A6D A;  1MGT A;  2XSJ C;  2BVL A;  3OYL A;  2E1M C;  2QYO A;  1N75 A;  3J81 K;  3AG1 H;  2WB1 N;  2M2E A;  1CQT A;  3O8H A;  4LG3 A;  2X51 A;  1I27 A;  2XPW A;  2BVM A;  5D6E A;  3G4S I;  2PFB A;  4CZC A;  3P9I A;  1ZKG A;  4IHS A;  3QPL A;  3U1K A;  4KIT B;  3CC2 I;  3HGY A;  3E3V A;  2WAE A;  3MKW B;  3CJT B;  1TW2 A;  3ZP5 A;  1ERD A;  2A5Y B;  2BW3 B;  3K9T A;  4I09 A;  2CQK A;  2L0K A;  2ZO4 A;  4JQF A;  2X9D A;  4PFO A;  3D5R C;  2OTJ I;  4II3 A;  2DMU A;  2R93 J;  1A6Q A;  3ERM A;  2A6T A;  1GVJ A;  4ZJZ A;  2IA2 A;  2DQL A;  2Z16 A;  2TRT A;  3A1Y A;  2K4J A;  2WAQ N;  3GFI A;  3M8J A;  2IGK A;  1BR4 A;  1U5T A;  2WAF A;  4DBR A;  4G94 A;  4MO7 A;  2PBI A;  4V2G A;  4ESF A;  3H35 A;  4ENK A;  1G3S A;  1SD5 A;  1OCC H;  2JRT A;  1R71 A;  2OZU A;  2KIF A;  1WZ2 A;  2EIK H;  1P92 A;  2V4J C;  3AKZ A;  2QSF X;  4DOZ A;  4P55 A;  3ULQ B;  4BHP A;  3EYI A;  1OIS A;  1P2F A;  1O3S A;  2LH9 A;  3CP8 A;  2V9P A;  2R4G A;  3ZQG A;  1DDN A;  2G7U A;  4HV6 A;  2F4I A;  4XR6 A;  2BW3 A;  1ZRD A;  5F04 A;  2XGC A;  2WWY A;  3CUQ B;  1SFX A;  3RKW A;  1WJC A;  1FBS A;  2PMZ N;  4KNY A;  4RGX A;  2EIL H;  1R7J A;  4MTE A;  2XVC A;  3DTE A;  4XLA A;  4PSW A;  1VQ9 I;  1QU3 A;  2HXO A;  4FX4 A;  1Y1V J;  2FF4 A;  3HTU A;  5GAG J;  3HDD A;  4ZYE A;  3K4N A;  5JFR A;  3MVP A;  5EGO B;  2HKX A;  4M6X A;  1VQ7 I;  3AG2 H;  1HCR A;  2FJ1 A;  2OD5 A;  3AAF A;  2JUG A;  1N25 A;  2IS6 A;  2VJI A;  1U5T C;  1JT6 A;  1E17 A;  3K1M A;  5D4R A;  4EQQ A;  1G4D A;  3I54 A;  2I8D A;  5HDG A;  5IP6 A;  1MW7 A;  2LY2 A;  2VXD A;  3DPL C;  5L3C A;  2P7V B;  4EAT A;  1IXS B;  3MZ8 A;  4PJN A;  2CO5 A;  3CUQ A;  4FQG A;  1UCR A;  3C2G A;  2W84 A;  1U9N A;  4A3L J;  1X3U A;  4E7Z A;  3K1P A;  1JHH A;  1WWX A;  2ELJ A;  3DKY A;  3HEF A;  4NDL A;  2QM3 A;  1OYY A;  4G9Y A;  1XPX A;  1XMA A;  5EGO A;  5AIQ A;  3PSF A;  3KP6 A;  5IT9 K;  1BIA A;  3ML6 A;  3GX4 X;  3HTS B;  1OR7 A;  4IOA F;  2WY7 Q;  4B3A A;  1IRZ A;  4WXH A;  1QZY A;  1TNT A;  4XLF A;  4Y15 A;  1VQK I;  4JP0 A;  4XRF A;  3RCO A;  3GW2 A;  4HLX A;  4HG2 A;  3WG7 H;  5FFZ A;  2HPI A;  4IRI A;  1J2X A;  3J7A Y;  5D5V B;  1U2W A;  3I71 A;  4HQM A;  3WU0 A;  2E5Z A;  3RKX A;  5D5U B;  3K4J A;  3VSL A;  3HOU J;  2Y0S N;  3Q3S A;  2CRG A;  4U7B A;  3KE2 A;  1I39 A;  5JVG F;  5HS8 A;  2R7F A;  2VBY A;  2KIM A;  3CCJ I;  2M4G A;  3BTJ A;  1BI0 A;  2E1N A;  3CUQ C;  3TBI A;  3D0S A;  2FSW A;  4KA4 A;  2RNG A;  1HDD C;  2W1O A;  4GDF A;  1F1Z A;  5JHU A;  2LG4 A;  1P9Q C;  1IXR C;  4M3G A;  3QAH A;  2BXZ A;  1LFU P;  1WJF A;  2YX4 A;  1QHH D;  2EWN A;  4X1E A;  1WJE A;  1Q1H A;  1TQI A;  1J59 A;  1TC3 C;  5E1Z B;  1Z3X A;  3LWF A;  1WSU A;  1IV8 A;  3CCR I;  1YFH A;  5IY5 H;  2DA6 A;  2DTR A;  3FKI J;  4N9H A;  4OAY A;  1BOA A;  3HXL A;  4UXN A;  3B73 A;  4IQ4 A;  3QU6 A;  2CW7 A;  3W6J B;  2VB6 A;  1WHU A;  3OIQ A;  4LB6 B;  3O6B B;  4B8X A;  3BG3 A;  2L02 A;  1X1B A;  3G2B A;  3ZMD A;  1SEU A;  3HSR A;  1O7L A;  1FOY A;  3S32 A;  1EJ9 A;  3I59 B;  3Q0U A;  4AUX A;  1B8I B;  2PMU A;  1SMT A;  1Y39 A;  3WOD F;  2M0C A;  3T1B A;  5KNL A;  2R5Z B;  3GUD A;  4IL6 C;  1TP4 A;  2W82 A;  2CG4 A;  2VC1 A;  4BQN A;  2XAG A;  2WBM A;  4I98 B;  5M3M J;  3GCM A;  2V26 A;  2VKD A;  4I01 A;  2JVG A;  2V6C A;  3RI4 A;  4AD9 A;  2LRD A;  3JAM Z;  4V19 K;  5J6X A;  3T8R A;  4QSH A;  2ZJP F;  4MQ9 F;  2DFF A;  4OMZ A;  3WTW C;  1XGO A;  3GME A;  2R7U A;  1P7J A;  3CCS I;  1VQ8 I;  1IRF A;  4A5M A;  1R5H A;  2OU2 A;  3VYS B;  5DDG A;  2XAH A;  5ILU A;  4IVN A;  1J0R A;  1ZRC A;  4P1W A;  2QKL B;  2HGC A;  3FXK A;  4JX4 A;  5TJJ A;  5FKL A;  1Z0X A;  4CZZ A;  3GTO J;  4ANJ A;  1UG2 A;  1UMQ A;  2EIJ H;  4PSX A;  3S1R J;  1HOM A;  5HLG A;  3ABM H;  1I3Q J;  2KDO A;  1K4S A;  1ETK A;  2UXX A;  5EZG A;  3I59 A;  3J7A O;  2M1B A;  4KT5 C;  2JRM A;  2XF5 A;  4IHT A;  2DA2 A;  3C18 A;  1B8I A;  2V1U A;  1XS9 A;  2IXS A;  2R5Z A;  4G7H F;  2ME0 A;  4UV9 A;  3RQ4 A;  4A12 A;  2DOD A;  4D5F A;  1PP8 F;  3DU6 A;  1RC9 A;  1W36 C;  2DMT A;  4Q5S F;  2ZC2 A;  3VDX A;  1DGR M;  2F5V A;  3E5Q A;  2ETH A;  4BDY A;  4II2 A;  2L7F P;  1YQA A;  1TWH J;  1LDJ A;  3RPQ A;  2R7R A;  3GFJ A;  3VEP A;  3HKZ A;  3ZQQ A;  1SVO A;  5J1U A;  5HNH A;  2DA7 A;  2DTZ A;  1C0W A;  3KPH A;  2FA5 A;  2PLY A;  3CCE I;  4B1R A;  5GTH C;  2KKO A;  4HYE A;  4B4C A;  5CVR A;  4ZYH A;  2P5K A;  3FM3 A;  1MJB A;  5JI6 A;  1SVL A;  2LSO A;  1PYV A;  4XOP A;  1Y0U A;  1ZRE A;  3GLL A;  5FLX Z;  1FWZ A;  4IKF A;  1PDN C;  3DLA A;  5ICC A;  4KIG A;  5L3G A;  1UB9 A;  1Z21 A;  1JUM A;  5J8C A;  4NB5 A;  2CV1 A;  2VJ5 A;  3E97 A;  1S6L A;  4U88 A;  1E3P A;  3HC7 A;  4F52 A;  4RB2 C;  2LD5 A;  1EV7 A;  2L2O A;  3JW4 A;  3V4G A;  1GV5 A;  4RLQ A;  2PX9 A;  4HV5 A;  5EDN A;  5L3F A;  4HF1 A;  4Y4R A;  1JJ8 C;  1HW2 A;  3CD6 I;  4H4K C;  1B9M A;  3LMM A;  3BR0 A;  4GGG A;  5F0F A;  1H9T A;  1B6A A;  3WTV C;  1QVT A;  2STW A;  2IJL A;  2EZK A;  2HNH A;  3TDZ C;  1HF0 A;  4XMY A;  2NVU B;  1MD0 A;  2DPD A;  5GTI C;  1W0T A;  1KYZ A;  2Z5U A;  1XTA A;  2MD0 A;  4PUS A;  4HOB A;  3G73 A;  5EG0 B;  1I6X A;  4IRG A;  3OY9 A;  1JTY A;  1R00 A;  3OMY A;  4EGZ A;  2ZXI A;  4ZDL A;  2NS8 A;  1YTY A;  4XNF A;  1FOW A;  2M8G X;  3A02 A;  1IUY A;  4L5E A;  3HOV J;  3KLO A;  1IO2 A;  4HZF A;  3DQV C;  1JUP A;  2UUZ A;  5HS7 A;  1E2X A;  3S1N J;  3VOE A;  2AQF A;  2AHQ A;  5L3B A;  3WTZ A;  4XN0 A;  3BPX A;  1J7K A;  3OYC A;  2X1E A;  1VQO I;  1FYM A;  5JLW A;  2EQR A;  2CJJ A;  3AG4 H;  1DPU A;  2JWT A;  1EF4 A;  1H89 C;  5D5W B;  2YU9 J;  5K7H A;  2HR3 A;  2OQR A;  3BG6 A;  4I0A A;  3JRG A;  4ENN A;  3M8F A;  2RQQ A;  1GT0 C;  3Q5F A;  2ECB A;  4IHW A;  2LY9 A;  2CFO A;  3BC8 A;  4IHV A;  2H1L A;  3DCF A;  3KCC A;  3NAR A;  3H3Z A;  1OCT C;  2JUC A;  1Z91 A;  2B7E A;  4BQA A;  4XOR A;  5K5R A;  4P9F A;  1WRJ A;  2QZ8 A;  4HX8 A;  2H6C A;  5EG0 A;  3KIO A;  4BYY A;  1IRG A;  1Y56 A;  2EIN H;  4AU7 A;  2X4H A;  2YSR A;  4XLC A;  4UY8 I;  3T8T A;  3BR6 A;  1SAX A;  1A31 A;  4ZYD A;  4BGD A;  5CPR B;  1EH6 A;  3LFK A;  3ECO A;  3Q0V A;  3PUF A;  5J4Y A;  4E70 A;  3I4P A;  4AC0 A;  1BOB A;  3K0L A;  2IS1 A;  1AKH B;  4ZYG A;  1LVA A;  3GTJ J;  1TQP A;  2R0Q C;  3ASN H;  1S8N A;  2F2E A;  2VI6 A;  3LA7 A;  4RA2 A;  1Z77 A;  4YEJ A;  1B59 A;  2X6W A;  3BPV A;  1W5S A;  1X1A A;  1JKQ C;  1GXP A;  2H1K A;  4OIN F;  2NS7 A;  4RAF A;  2XIG A;  5FGM A;  2M0M A;  2OTL I;  3LL7 A;  2EZL A;  1IG7 A;  1J75 A;  1FZP B;  2PMH A;  2HOS A;  3PIP F;  4I99 C;  4XBF A;  4WWC A;  2RN7 A;  3EUA A;  3E6D A;  2DLL A;  4A0Z A;  1VF9 A;  2H09 A;  2LDU A;  2QEN A;  3EUH A;  1QQI A;  5KHD A;  2BEO A;  1HC8 A;  2E7X A;  3ZN0 A;  2NNY A;  3E6C C;  4BNC A;  1MJ9 A;  4FE7 A;  3SHF A;  3HRT A;  4RB3 C;  3F3X A;  2Q8K A;  5BPD A;  1XMK A;  3RSN A;  3RZO J;  1AKH A;  1W36 D;  4C3I J;  3FZV A;  1QPM A;  3OYI A;  2DMP A;  1WH5 A;  1MSF C;  1ZGJ A;  4MHG A;  3JRA A;  2RNJ A;  3CCV I;  2E2J J;  1D3Y A;  3AFH A;  1WQ2 A;  2PN6 A;  3IP4 B;  1MBE A;  1TTY A;  5E17 F;  4CCM A;  3RQI A;  3MKZ A;  3TO7 A;  2A05 A;  2FU4 A;  2A68 F;  2KHM A;  5HOD A;  1LDD A;  1JHF A;  3P9K A;  4A3G J;  1KQ9 A;  3G6E I;  2R7O A;  4BJ6 C;  2VUM J;  3VPR A;  4C2T A;  1SFK A;  1XGM A;  1FJL A;  2FML A;  3OS1 A;  2NVT J;  3CDI A;  4BBS J;  5EJC A;  1FBQ A;  3M7G A;  4I6Z A;  3S1M J;  5ILV A;  1T2K A;  2GOM A;  2I5U A;  5E3L A;  3EUK L;  5ED4 A;  1G6N A;  4Q48 A;  2WC2 A;  3KYD B;  1BA5 A;  1XC5 A;  2PG4 A;  3EUH C;  4N4O B;  4BL0 B;  3BCA A;  4ENJ A;  2Z3Y A;  2RV8 A;  4BY1 J;  5FLV A;  4LMY A;  4X6A J;  4L9J A;  2WA0 A;  3ZN1 A;  3CJR B;  2GIZ A;  4WCG A;  4XL9 A;  3AL0 C;  5IP7 J;  3TQN A;  2VBZ A;  3LAP A;  1O4X A;  3FIS A;  2K4B A;  1L0O C;  1IN5 A;  4YFN F;  1IDY A;  2DK8 A;  3F8C A;  5BQT A;  3LNQ A;  2DOE A;  1YYV A;  4Z2Y A;  4ASN A;  4G7O F;  4MEY F;  4N9I A;  1G8X A;  3BQZ A;  2KZV A;  1OJL A;  3KEY A;  4HF0 A;  1PUE E;  3NWT A;  2ID3 A;  1K6Y A;  1RET A;  1WVR A;  2CW0 F;  3QOP A;  2O5R A;  3HOY J;  2NXN B;  1BN5 A;  1QPI A;  2CS3 A;  3KP2 A;  2CU7 A;  2F48 A;  1FNN A;  1R36 A;  5KCM A;  9ANT A;  2PJP A;  3FM5 A;  2M87 A;  1QA6 A;  1JE8 A;  1X4P A;  1A6I A;  2LF8 A;  3BCB A;  4QWQ A;  1EH7 A;  2R92 J;  4I2O A;  5CVU A;  2D1V A;  1XDU A;  2DFE A;  4D7N A;  1D5Y A;  5H2F C;  2HDC A;  2EZH A;  4EM1 A;  1YIJ I;  4MEX F;  2HS5 A;  4AID A;  2HVS A;  3SZG A;  2VKH A;  1STZ A;  4UNO A;  1HDP A;  3FXJ A;  4UUS B;  2HTJ A;  3WHC A;  1LQ1 A;  2PEX A;  1UHM A;  5F0C A;  1DU6 A;  4DGW B;  1A35 A;  4EVI A;  2XAF A;  4XSX F;  1WCM J;  3B02 A;  2DAO A;  1QRY A;  2QQB A;  3VFZ A;  2F5F A;  1G59 A;  1UJ8 A;  3PQJ A;  3RTR A;  5LBQ A;  2E35 A;  1MNE A;  2P5V A;  4DYR A;  1T39 A;  2QQA A;  3F8M A;  4AWX B;  4BUP A;  4ZZL A;  1IN4 A;  2OZ6 A;  3CMM A;  1IZ1 A;  3MD2 A;  5HS9 A;  2MLG A;  3BTI A;  3OYF A;  3GTP J;  1MIJ A;  2L01 A;  3BR5 A;  1UEL B;  3DV8 A;  1DP7 P;  1R1T A;  3HOX J;  1XCB A;  4GFB A;  2LK2 A;  3BTL A;  2DYR H;  3H9J A;  4IHY A;  4GO1 A;  2XRN A;  1OCO H;  3OOP A;  4BEH B;  2M5W A;  1X4O A;  3HPG A;  5D8K B;  2DCE A;  1DGW Y;  4F91 B;  4UUS A;  1YI2 I;  2FQ3 A;  3D5S C;  2KIQ A;  4HA8 A;  1WJB A;  3MN2 A;  4A0Y A;  4M72 A;  1ZG5 A;  3KFW X;  3EET A;  4PCQ A;  2STT A;  4JBA A;  3CCQ I;  1G2H A;  2HVQ A;  4WXC A;  1FPQ A;  4AM3 A;  2LYC A;  3MZY A;  4XLE A;  4OIP F;  5TGT A;  2CQQ A;  3JRC A;  1QZE A;  1IJW C;  4M9X A;  1NK3 P;  5DM7 F;  4OOI A;  3TW7 A;  3VYT B;  4XID A;  4XLN F;  4KIB A;  2V9V A;  4ZDO A;  3D1N I;  3Q9V A;  2Q0O A;  4P5O A;  3R0A A;  1FSH A;  2EPF A;  1PP7 U;  2KJC A;  2K85 A;  1L3L A;  3SFI A;  3K1N A;  1FSE A;  1T6S A;  1ETO A;  1R1V A;  4BEH A;  1WFX A;  1A5J A;  1I1G A;  1S7A A;  3PO2 J;  1UHS A;  5CQG A;  1HKT A;  3DEU A;  1OYI A;  4HRI A;  1D1B A;  3G1M A;  3IRR A;  2RRE A;  2ZSI B;  1X58 A;  5F64 A;  5C4X J;  3FXQ A;  5HVQ C;  2L9R A;  4BXU A;  2W7N A;  3FBI B;  4U87 A;  2FOW A;  2ZXW H;  4S0H B;  3WU2 C;  2Q2E B;  5EZH A;  1ZGA A;  3M9A A;  2KJB A;  2HVR A;  4YG2 F;  2BBY A;  1SD7 A;  2LFB A;  4L0Z B;  3ISP A;  4UB6 C;  4QLC U;  4ENM A;  3S3M A;  2O6G E;  4M73 A;  1GVD A;  1U9O A;  4NNJ A;  1AHD P;  2ADU A;  3ZPL A;  5ILS A;  5HDK A;  5FD6 A;  1J5Y A;  2YR2 A;  2HDW A;  3K70 C;  2O61 A;  2CSO A;  1RI7 A;  1YX5 A;  4KIC A;  1HBX G;  4L0Y B;  4CYD A;  2XKP A;  1TT0 A;  2KT0 A;  3LSJ A;  3J81 Z;  3L2R A;  3HIF A;  3ZMZ A;  2EFW A;  3BJO A;  3BP8 A;  5F27 A;  2IA0 A;  3N4M A;  5DD4 A;  2Q1Z B;  2Q2E A;  3GVA A;  3OYB A;  2VAS A;  1TT5 B;  1OCZ H;  4HNU A;  3U21 A;  2M4K A;  1F36 A;  2IS2 A;  3ESW B;  4QPO A;  5E3M A;  3CP2 A;  1QGP A;  3S14 J;  5EYR A;  4HNV A;  1YW9 A;  4C2U A;  3JRB A;  1XGS A;  3ROU A;  1GV2 A;  2O7O A;  5DS9 A;  2E2H J;  2QQ9 A;  1RES A;  4ZC3 A;  1IF1 A;  2CV0 A;  2BGC A;  2FBK A;  1MMS A;  1IDZ A;  3FXU A;  3HSF A;  4P9U A;  5DCM B;  4B44 A;  2FBI A;  1ODD A;  3VB2 A;  3OV8 A;  4KJZ A;  1ZRF A;  2MC4 A;  2QQ8 A;  3O3K A;  2KRF A;  4MLO A;  3ZOB A;  3SEZ A;  1BW6 A;  1N77 A;  2JA8 J;  2R7S A;  5FKK A;  1E3H A;  1B4A A;  1ZN2 A;  2V1N A;  1KU2 A;  2LBF B;  3GZ6 A;  2ZBK A;  3CCU I;  2HQA A;  2X85 A;  1T08 B;  3I55 I;  1VQ6 I;  3WGH A;  4OIQ F;  1R6R A;  2OF7 A;  5E8I A;  2DDA A;  1LKX A;  3B6C A;  3NWS A;  4BXF A;  1H9G A;  3U1D A;  3E6M A;  4YRV A;  5HNF A;  1NH3 A;  1OQY A;  4MGR A;  4E6K G;  3H3V K;  4XRS G;  4IF4 A;  3RJP A;  3H9Q A;  2XPU A;  6PAX A;  1MSE C;  3JTG A;  3IH2 A;  2PJR B;  5DCM A;  1UAA A;  1NK2 P;  5A2Q K;  3GF2 A;  3TW6 A;  2ZJR F;  3HGG A;  2CQN A;  4RM3 A;  3M8E A;  3ZXS A;  4RGR A;  4Y7N J;  2KP6 A;  4BE0 A;  4XN3 A;  5FB2 A;  3KET A;  2KQR A;  1HST A;  2ZJ2 A;  1R5I D;  4CSW A;  3FDY A;  4I76 A;  4U0Y A;  3L7W A;  1N78 A;  3PQK A;  2LBF A;  1IW7 F;  1OYW A;  4XKW A;  3L2V A;  2MGQ A;  2VBX A;  4DYQ A;  2D2W A;  3MAJ A;  1UST A;  4HX7 A;  3F22 A;  4A3F J;  5FRN A;  4G6D A;  1V4R A;  4BE1 A;  1REP C;  2H8W A;  3T0Y A;  5FRM A;  1OR7 C;  5J1Y A;  3DEW A;  3BJ6 A;  1K61 A;  4CCO A;  1ZHF A;  3AG3 H;  5M5X J;  1DU0 A;  1K7A A;  2P6S A;  5E18 F;  2MBF A;  2W48 A;  1NHA A;  2VKV A;  4E7H A;  3W2V A;  3HOW J;  4FE4 A;  2PJR A;  4HDU A;  5IT9 Z;  2DMQ A;  3BT9 A;  3K69 A;  3H5N A;  3NRV A;  4NBQ A;  1XN7 A;  2JA5 J;  4KN4 X;  1K79 A;  5LLQ A;  2XF7 A;  3WTS C;  2JT1 A;  1YJ9 I;  2BYV E;  2O3F A;  2ZJQ F;  2X1C A;  4BJT A;  3RKQ A;  2OC6 A;  3LA2 A;  4ZH4 F;  1U6G A;  1TWG J;  2DA3 A;  2E7W A;  1H8A C;  4LB5 A;  3H9G A;  3PNY A;  4IX7 A;  1S5L C;  4AYB A;  1DPR A;  1FOX A;  3BR3 A;  1VQ4 I;  1OCP A;  4A6E A;  3G71 I;  3IAS 2;  4WX9 A;  3F6V A;  1TWA J;  2CUJ A;  2YU3 A;  3K4C A;  4KIF A;  2Z99 A;  3ZMV A;  3FXR A;  4N0B A;  4G12 A;  3PL8 A;  2Z33 A;  1TLH B;  2D5V A;  2MFZ A;  3K70 D;  2VOP A;  2AXL A;  2A69 F;  1RZ4 A;  2VT2 A;  3BZ6 A;  1FP2 A;  3H92 A;  3GFL A;  4HST A;  4XLH A;  3I58 A;  5AIP A;  4DNC A;  1TW3 A;  1FIP A;  4JOM A;  2MLK A;  1W1W E;  2MW8 A;  1T95 A;  2RKH A;  3LAJ A;  2UXN A;  2P8T A;  3LSG A;  1GLN A;  3QU3 A;  4M74 A;  5FLM J;  3V8L A;  2IP2 A;  4IJA A;  2ZNZ A;  1VQP I;  1LDK B;  2JSP A;  2BZT A;  3CZ6 A;  4LLG F;  2R5Y B;  1LFB A;  3F6O A;  2VIX A;  1OPC A;  3S16 J;  3E7L A;  1RIO H;  1WH7 A;  2K9S A;  3CJQ B;  2DJI A;  4HSR A;  2DOA A;  3IWF A;  2OUM A;  4BKX A;  4Y3O A;  3E5X A;  1Y8R B;  1FX7 A;  2XRL A;  3SFZ A;  3TDU C;  5BMZ A;  3IUO A;  1Z9C A;  1A36 A;  2P6T A;  4A93 J;  3RYR A;  2B63 J;  3FX3 A;  5J4V A;  1GXQ A;  2F5E A;  5LHI A;  1RR8 C;  5CVV A;  1R22 A;  3OYN A;  2WY8 Q;  3S3N A;  3HL2 A;  3PIO F;  3C3W A;  1PVE A;  2MSY A;  1TL8 A;  2HWV A;  3ZQL A;  3HYI A;  5LRS A;  5LGU A;  3G3Z A;  3I4M J;  2ZB9 A;  4KDP A;  1YE9 A;  3VYR B;  4EEF G;  5LEK A;  3HZJ A;  1FMW A;  4B47 A;  1Z7U A;  2YPR A;  4QIW N;  2R5Y A;  2FQ4 A;  2W57 A;  5IYD J;  4JX6 A;  3CES A;  3S3O A;  3ZQF A;  5LD2 C;  3KX2 A;  2CYY A;  4XKC A;  2A6E F;  3V8K A;  2DW4 A;  3BG9 A;  4HPQ A;  4J01 A;  2D1H A;  3BZK A;  1PUF B;  3PSI A;  2EFN A;  1F4K A;  2K7L A;  5KVR A;  5BPI A;  3WHB A;  3JR9 A;  5FJ8 J;  1ZGW A;  3BRO A;  3F72 A;  3W3C A;  2F4M B;  2IGO A;  2W24 A;  3CUO A;  3TKY A;  3DF8 A;  2HZT A;  4Z6Y A;  2XAQ A;  5H20 A;  2IA1 A;  4K2E A;  1S72 I;  1BBY A;  1SVM A;  2G0E A;  3WU1 B;  3UR3 C;  2L4A A;  4JYK A;  3A4C A;  2IBD A;  2YX7 A;  4Y13 A;  2XAS A;  1QZZ A;  5CYV A;  1MBJ A;  3H36 A;  1W0U A;  3W6V A;  4Y17 A;  4J19 A;  1R58 A;  2NAZ A;  1MH4 A;  2NOJ B;  2O9L A;  1R49 A;  1JKP C;  2ISY A;  2L9S A;  2HZD A;  4V2F A;  3OYH A;  2OJE D;  2NOG A;  2Y30 A;  2UWM A;  2XDV A;  4A3E J;  1BIB A;  1PUF A;  1RUO A;  5JVT A;  3HJE A;  5B1B H;  1VI0 A;  1I3A A;  4R8H A;  2BV6 A;  4HBL A;  3VOD A;  4EJO A;  2RDP A;  3CC4 I;  2A61 A;  5K5Q A;  2HOE A;  3QP5 A;  2VBW A;  5L3D A;  2L7M P;  2ZXH A;  5CLS A;  3MEX A;  4IHX A;  4IPA A;  4HNT A;  1XSX A;  2GXA A;  2GBY A;  1HKQ A;  2VE8 A;  3H5A A;  3RPU A;  4RGS A;  3H3U A;  5K5O A;  3W6K B;  2K02 A;  2QSH X;  2A6H F;  2KDZ A;  1MKM A;  1G3T A;  1DP3 A;  3I0T A;  4EV0 A;  1AWC A;  1T33 A;  5KAF C;  2Z1D A;  4S05 A;  4Q47 A;  3GTG J;  5LGN A;  1JGG A;  1V5E A;  3R61 A;  3G1O A;  1BR2 A;  2ZKZ A;  3F23 A;  3J7Z I;  1CGP A;  1O3R A;  2DN0 A;  1QVU A;  4Q4Z F;  4LIV A;  3SEQ A;  3TP0 A;  1Q1V A;  2GA1 A;  4XLP F;  2JQ7 A;  3SYT A;  2JJ7 A;  2OBP A;  4ITV A;  2KZG A;  4PK4 A;  2R7Q A;  4EJV A;  3DKW A;  2VKE A;  3OSG A;  4XQF A;  2RAE A;  5GPC A;  1T56 A;  3WTX C;  2M3A A;  2XV4 S;  1PJR A;  1KON A;  4IRH A;  3A01 B;  5M5W J;  1OCR H;  2VLA A;  3OYJ A;  5F1R A;  1W4M A;  1XG1 A;  4H0E A;  2LKX A;  3KEQ A;  1JKR C;  2HYF A;  3H0G J;  1POG A;  1LJ9 A;  3KZY A;  3QPH A;  3SQN A;  2HTS A;  3L9F A;  3FK7 A; 
#chains in the Genus database with same CATH homology
 2K85 A;  2LKS A;  4FQG A;  1UZC A;  2KZG A;  2KIS A;  2JUC A;  2B7E A;  2CQN A;  2DOF A;  2DOD A;  2KIQ A;  2E71 A;  2DOE A;  2L9V A;  2KFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...