4A3EJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3eJ00
2XSDC 3HOVJ 1P7IA 1IDYA 1IUFA 1H89C 2O9LA 4D5FA 3HKZN 5IOZA 2LKXA 5E3OA 2MW8A 1ZGWA 2MGQA 4BXXJ 1A6IA 1DU0A 1UG2A 4DZJA 3QPSA 4A3KJ 2FD5A 2EZIA 2PMZN 4FE4A 2M0CA 1FTTA 2FJ1A 1JJ6C 4JX5A 4NDLA 4V2FA 3A01B 1U9OA 2EH3A 4UUSB 5GPAA 1I50J 2MSYA 1OFCX 3HOYJ 5K7FA 3MN2A 2Y9YA 1GV2A 1X2NA 2X6OA 4BBSJ 1JKPC 4LOCA 3IH4A 3IH3A 3E7LA 1E3OC 1AHDP 4MIMA 4DZPA 4C3IJ 3LSJA 2E2IJ 4UUSA 2GLOA 4A3GJ 3BTIA 2H8RA 3S1RJ 4W97A 2JWTA 4C3JJ 2NVTJ 1MH4A 4HNVA 3ZOBA 2DA4A 2HDDA 1FIAA 1MBFA 5DS9A 1WH5A 1MBEA 4M3GA 3HOXJ 4MLOA 1QVUA 3JRDA 4DYQA 5F0HA 1AKHB 2H1KA 3HDDA 1ETYA 1WI3A 1K61A 1VFCA 1H8AC 2HI3A 3BG5A 5J1RA 3JRHA 3GTGJ 3BG3A 4RDUA 3L1PA 4A3EJ 1MBKA 3ZQHA 3GTOJ 5EGOB 2YS9A 1T56A 3QPLA 3BR2A 3H3VK 5J3LA 4M6VA 5C44J 3CQZJ 1JT0A 1NK2P 2HXIA 1IC8A 2DMNA 2NOGA 3F0CA 2NVXJ 5JLWA 2HQ5A 1U8BA 3FISA 1R9TJ 5EGOA 5FKLA 4XRMA 1D5YA 1JGGA 1JTYA 5K7ZA 1GUUA 1XC5A 1Y1WJ 4DYCA 2LY9A 3S1QJ 4D7NA 3G1OA 4A3DJ 1WGXA 1MSFC 2ELKA 1UMQA 2L7FP 1ETVA 3ZQGA 4AC0A 2EZKA 4AYBN 2DA2A 5JLXA 5IPAA 2XB0X 3JRGA 2W48A 1JTXA 2LK2A 4G12A 4X6AJ 1LFBA 2ME6A 1TWFJ 1QVTA 2M9HA 4S0HB 1B72B 2R5YA 3TW7A 1WCMJ 3Q0WA 4BBRJ 1IJWC 1X58A 5F27A 1F43A 2AHQA 3LOCA 2Y2ZA 4A3JJ 1NTCA 1P7JA 1JUSA 2LR8A 2L0KA 1BJZA 5E3MA 2Y9ZA 3G1LA 3S14J 3LSPA 2CRGA 2L7MP 1JKRC 2K9SA 3A03A 2JMWA 4A3FJ 3B6AA 1U78A 5GPCA 4I76A 3S15J 1BW5A 1LE8A 2DA7A 2XPWA 3TW6A 4C2MJ 1W0UA 3GTPJ 2DJNA 3FK7A 3FKIJ 3FIWA 5E3LA 5C3EJ 2NS8A 3RKQA 5IP9J 2LD5A 2YUSA 1Q1VA 2L9RA 1G2HA 2DMPA 2X9DA 4JYKA 1ZQ3P 2LVSA 1NK3P 4JP0A 9ANTA 5EZGA 3K2AA 5EG0B 1FIPA 2OF7A 2QCOA 1HF0A 3S2HJ 2CU7A 1ZK8A 2IBDA 1MNMC 1JJ8C 1TWHJ 2O7OA 5IOYA 1B8IB 5E3NA 3A01A 1Z0XA 5FKOA 4BKXA 1ZTRA 5EEAA 4Y7NJ 5EG0A 5IYBJ 3GTLJ 4FTHA 5M5WJ 2FQ4A 3BR1A 1HCRA 4FISA 2IAIA 1ENHA 1OCPA 2E19A 1FJLA 1RR7A 2ME0A 5J1UA 3OIOA 4DW6A 1BW6A 4AUXA 1B8IA 2R7ZJ 3M4OJ 1K83J 4XIDA 4MFDA 2DN0A 3ZQLA 2JA8J 3D1NI 3BT9A 3H0GJ 2IEKA 3CDLA 2GM4A 5FKMA 1IDZA 1EF4A 4MFEA 1ETWA 4I6ZA 1RKTA 3GTMJ 2WB1N 5BNGA 2R5ZB 4A3BJ 2XPVA 1FEXA 4ABZA 4W1UA 1HOMA 1YRNB 3JRAA 4L5EA 2O8KA 1JUMA 5EYRA 2ZB9A 1AKHA 3HOWJ 5C4XJ 1JT6A 4IHVA 3TP0A 1MBGA 2X48A 5FKKA 4J19A 4V2GA 3S17J 5IYCJ 2VPRA 3NARA 4MO7A 2WAQN 1A5JA 3JRCA 3GBGA 1IRZA 3QQAA 2JJ7A 3BR3A 5EDNA 2CQQA 1VF9A 4C3HJ 2XB5A 5FLVA 1MH3A 4D5CA 3IH2A 4XRSA 5EZHA 2NS7A 2CJJA 5IP6A 3BQZA 5HODA 3RZDJ 2E2JJ 2E1OA 1JKQC 1VNDA 3SFIA 1JUPA 1ORKA 3JRIA 3Q0VA 1H88C 2HOAA 3GTJJ 4M3BA 3HOZJ 2L7ZA 2P81A 2XPUA 2Y0SN 2MG4A 2JA6J 1TWGJ 5F0CA 4A3MJ 3JR9A 5F08A 4CYCB 2M8GX 5IP7J 1GDTA 5F1JA 2HOTA 1F36A 1I6HJ 5IYDJ 2DMQA 2I10A 3PM1A 4QTRA 1OJLA 1LFUP 2D5VA 3TEDA 4XK4A 3DCFA 1B72A 1T33A 4RBOA 2VUMJ 3K7AJ 3GTKJ 1PUFB 4A93J 4QIWN 1IG7A 1TWCJ 3PO3J 1O4XA 2WV1A 2EBIA 3CMYA 2XGCA 1AU7A 1DU6A 1SFOJ 4UUTA 2JN6A 3WHCA 4BY1J 2DTZA 3OSGA 1RETA 2VKVA 2K9NA 2LP0A 3I4NJ 2COBA 3LSGA 4IEJA 1ETQA 1ETXA 3O8GA 3SJMA 1ZR2A 2TCTA 4JX4A 4M3DA 4FCYA 1RPWA 1ETKA 2TRTA 1UHSA 2JA7J 1MSEC 4A3CJ 2XRLA 2K9QA 2JK3A 4M3FA 1ZKGA 2GBYA 5M3MJ 1BL0A 3SDGA 3CCYA 3BG9A 2OPTA 5F0FA 2DA3A 3GTQJ 1X2MA 1GV5A 2YU9J 1S7EA 2LLKA 2KDZA 3HGYA 1W0TA 3JRFA 3HM5A 3HBLA 3S1NJ 2CQXA 4JX6A 3ZQCA 3BR5A 3Q3SA 2M34A 2DA1A 3S1MJ 3I4MJ 3BR0A 1WH7A 1Y1VJ 5FJ8J 1HDPA 1U9NA 2CUFA 1ETOA 3VPRA 4IHYA 3O8HA 4GFBA 2K40A 1XS9A 3S16J 2AO9A 3M3YJ 3RQIA 4DYRA 2FX0A 2XGDA 2HXOA 3HGGA 2RAEA 4XICA 3B6CA 1QPIA 2HOSA 3BQYA 2EZHA 1BA5A 1APLC 1HLVA 3OSFA 1I3QJ 3W6VA 5M3FJ 2DMUA 3MKLA 4QSHA 2R5ZA 2R92J 4D7MA 1GVDA 5K7HA 4B3AA 2ECCA 1YRNA 2JA5J 2NVYJ 5F04A 3OOUA 3IV5A 4A3IJ 3BTJA 2HYJA 2ID6A 4BY7J 1GT0C 4B1RA 1RESA 4X1EA 2DA5A 5M5YJ 3ZQFA 2N8GA 2ID3A 2QF7A 1VI0A 1RKWA 4M3EA 3MVPA 3JREA 4IHXA 3HOUJ 1POGA 4XRSG 4EEFG 5FLMJ 3HEFA 1HDDC 2XGEA 2CUEA 2G0EA 3BR6A 2VKEA 5J1YA 3A02A 1ITYA 1TWAJ 3RZOJ 1MBJA 1MBHA 2R0QC 2DA6A 2M2EA 3ZQIA 1TC3C 3NAUA 5M5XJ 2R5YB 2ECBA 5GP9A 5EF6A 3C2BA 1QRYA 4FE7A 1JKOC 2B63J 1ZR4A 2NVQJ 1FTZA 4Y52J 3G1MA 3TP3A 4A69C 3PO2J 2Y30A 3Q0UA 4CYCA 2Y31A 2LFBA 3UKGA 1IV6A 1CQTA 2R93J 1IGNA 3WHBA 5FKNA 4A3LJ 3JRBA 2KT0A 1SANA 2VI6A 5DTDA 2EZLA 3DEWA 3LNQA 3BTCA 1PUFA 4IHWA 3LSRA 1LE8B 1OCTC 2E2HJ 5C4JJ 3BTLA 1XG1A 3HB9A 4B4CA 2LTPA 2DMTA 3S2DJ 1WPKA 2EQRA 3FK6A 1Z77A
chains in the Genus database with same CATH superfamily
2XSDC 4JBAA 5B1AH 4RGUA 4RLQA 1IDYA 2KFDA 2AXTC 1USTA 4G6DA 3F21A 2NVUB 2MGQA 2PG4A 1V5EA 1A6IA 1TT0A 2OZUA 3QPSA 3BG6A 2NRAC 1FMWA 3F8CA 2MLKA 2M30A 3BZCA 2PMHA 1SFUA 3KP5A 4BHPA 1S7OA 1YLFA 2VXDA 3K4LA 4KT6A 3TBIA 5LEKA 3PNYA 1Z21A 4KICA 2DQLA 3H9QA 3I4PA 3VFZA 2QKMB 3PFIA 3AKZA 2K4BA 3K0LA 4EJOA 2JVGA 1A6QA 1H9GA 2O3FA 2K9MA 4L9VA 4UV8A 1JKPC 3K4CA 1FP1D 3IUOA 4XLFA 1PUEE 2GLOA 4HLXA 4A3GJ 1BBYA 5ED4A 2H8RA 1O57A 3S1RJ 2PFBA 4RA2A 2P4WA 3QOEA 3SZPA 1HW1A 2DA4A 3OS0A 1FNNA 5D5WB 2W00A 5DS9A 2I5UA 1WH5A 3PFYA 1W36D 2WA0A 3V7SA 3J80Z 2EILH 2OQRA 4MLOA 1VQ5I 4XOPA 1QZZA 3FXUA 3MFKA 2V1NA 1AKHB 2H1KA 3HDDA 2ISYA 3SDBA 2F5FA 2DFFA 2ZNZA 3VYSB 4CCMA 3F3XA 4C30A 2W84A 5FFZA 4A3EJ 3U21A 5IY5H 3DPTA 4BDYA 2DXIA 1X3ZB 3W2VA 4UVBA 3BR2A 5B66C 3DV8A 5J3LA 4QPOA 3CQZJ 1NK2P 2ZCWA 2DJIA 2A05A 2EA4A 3HXLA 3IRQA 2DMNA 2NOGA 2NVXJ 3HRTA 1R9TJ 1SD4A 3OS2A 3A0HC 2XHKA 1X1CA 4OMYA 3KLOA 1AOYA 1D5VA 1Y56A 1GUUA 1XC5A 1BJAA 3WTWC 4DYCA 1YW9A 3S1QJ 2XDVA 2DPUA 2HFHA 3G1OA 3KYDB 2KRFA 4II2A 5E1WA 1MSFC 4A3DJ 4A6DA 2XROA 1QHHD 1G3WA 1CF7B 1WI9A 4KMFA 2M5WA 3GFMA 4IRIA 3JRGA 2LK2A 1OYYA 4K2EA 4HPQA 2M9HA 4S0HB 4LJZF 4WF2A 4BBRJ 1X58A 2DK5A 2FNPA 3CTAA 3ZMDA 3ZN0A 1Y8QB 1NTCA 4U0WA 1XB4A 3CUQB 4YIIA 4KDPA 2L0KA 1SD7A 3GLXA 5FD5A 2V7FA 3DKWA 4OMZA 3SQNA 3ZCOA 1XMKA 3S14J 1FLIA 3CCSI 2CQ7A 2HQAA 4CYDA 4CH7A 2AS5F 2Y75A 1TLHB 3WG9A 1XTAA 5GPCA 3S15J 2STTA 1LE8A 2DA7A 3WE2A 2P7CB 2J5OA 2VE9A 4E7HA 4OIPF 2DJNA 1YJNI 1J0RA 2DT7B 2KIQA 2NS8A 4CCJA 5CVVA 2LD5A 2YUSA 4CGZA 1E3HA 2CUZA 1O3TA 2L9RA 2ZKZA 2DMPA 2YR2A 1P4XA 2X9DA 1TQMA 1ZQ3P 2O0YA 2Y69H 3L2CA 1ZREA 4JP0A 3QYEA 5DM7F 3PSFA 2DFHA 9ANTA 2PJPA 3ROUA 1PP8F 1XGNA 5EG0B 2DYRH 3WODF 5H20A 3CC2I 1FIPA 2QCOA 4N9IA 3L00A 2IBDA 2UWMA 5HDGA 1TQPA 5E1XA 1MNMC 4C9YA 1JJ8C 2EIJH 2RKHA 1TWHJ 4R8HA 1OISA 5D5XB 1R1TA 2IS6A 5FKOA 4BKXA 5EEAA 5EG0A 5KCMA 2XKPA 4DGWB 4FTHA 5M5WJ 1DPRA 4FISA 3BC8A 3SEZA 3L7WA 4HZFA 1YJ9I 3KEYA 3E5QA 1RR7A 2ME0A 2QA4I 3M4OJ 1BW6A 3BG7A 3K4KA 4AUXA 5B5EC 1Z05A 1Z3YA 3LFKA 2Y0MA 4EJTA 3D1NI 2GM4A 3GXOA 5FKMA 5HNFA 3HUGA 3EETA 4O3MA 5K5OA 4L18B 4RGXA 3TOBA 4XKWA 3AAFA 3I64A 4I6ZA 2RNGA 3DXJF 3CC7I 1IN6A 5IT3A 2V6CA 3P9CA 1UG0A 5BPIA 3CCUI 2Y0SA 4DJAA 2Q8KA 1GXPA 1YRNB 4L5EA 1JUMA 4I98B 2ZB9A 3HOWJ 3GYHX 4XSXF 4IF4A 1UB9A 4BAYA 2QKLB 3ECOA 2ZBKA 1QBJA 3FXLA 2XC7A 2VPRA 3IWFA 4BHBA 3FXMA 3AG2H 5DDGA 1UHWA 3PL8A 3S93A 1VTNC 5L3CA 1BI3A 4ESFA 3GBGA 2DO7A 4C3HJ 3L2VA 4HBLA 4IPAA 2W1OA 5LRSA 1VQNI 2IT0A 2NS0A 3HHHA 2IVMA 3LSTA 1MMAA 4C2TA 3GLLA 1BI2A 1W5CC 3GMEA 3ZQ7A 4M6XA 2FBHA 2VBZA 4QPQA 3G6EI 3N05A 1FX7A 1ZLJA 2HOAA 2PMUA 3W6KB 3GTJJ 4ENJA 2E1MB 2Y0SN 5FD6A 4P55A 2ZXHA 3E97A 2HOTA 5F1JA 1BR2A 1DDNA 1I1GA 4QTRA 3S3OA 2JRTA 1LFUP 1S6LA 3CESA 3VSLA 1T33A 1U6GA 1G3SA 2VUMJ 3K7AJ 4XLHA 5EEGA 1BI1A 2YX4A 3GTKJ 1FSHA 4A93J 4QIWN 4KIGA 2F5EA 5B1BH 5J4VA 3LMMA 4E4HA 4HF1A 4KJZA 3CMYA 1G3YA 4RAFA 3KE2A 4UB6C 1RIOH 1HC8A 4H0EA 5J8FA 3OYFA 1T2KA 1LDJA 4BY1J 4OU0A 1RETA 2VKVA 3DFGA 2VJJA 2VXZA 4PCQA 4HF0A 2PJRB 2RV8A 3E5UA 2MA3A 2VBWA 4E70A 3G71I 3I58A 4IEJA 1ETQA 2IP2A 1ZR2A 2TCTA 1EH7A 1F1ZA 1SMYF 3BP8A 3M8FA 4JX4A 4M3DA 3OYAA 1ETKA 1UHSA 2C6YA 1IXSB 1QPMA 4RGSA 2M45A 3ABMH 1IV8A 1YITI 4A3CJ 2XRLA 2JSCA 4UXNA 2DW4A 3CLQA 2JZYA 3H0DA 2D45A 1SVLA 1BIAA 2GA2A 5CVRA 1N77A 3GFLA 1XMAA 3DLAA 1A31A 4CICA 2DFIA 3TMOA 1XX5A 3KP6A 5KAIC 4BE1A 1X2MA 3DBRB 2JT1A 2DPDA 2YU9J 4F52A 1BC8C 1DUXC 1W0TA 2DT6A 2KRCA 3HBLA 3R4KA 3S1NJ 3JSOA 3I9V2 5F64A 3M1CA 3H9JA 4NNJA 4XONA 2XRNA 5DD4A 2L9NA 3LWFA 2MABA 1XDSA 4I99C 2IS1A 3BDDA 3ZRGA 3G4SI 2QQ9A 1YFHA 3VPRA 3IRRA 4AU7A 2AO9A 2XF7A 2NXNB 2GZWA 4F3QA 1T39A 2Z2SB 3OYCA 2KQRA 4XICA 3B6CA 2HOSA 3QP5A 2R7SA 5HOOA 2GAUA 3KCCA 4EVIA 2EZHA 5BPDA 2VBXA 1R5HA 1N25A 1BOBA 3GUDA 1KQ0A 1I3QJ 3W6VA 5M3FJ 3CCMI 1QQIA 1XD7A 1GVDA 3GCMA 4B3AA 4AYBA 3K70D 3ZMVA 2XAQA 2NVYJ 1WZ2A 2HYJA 3FXOA 3ZMTA 4ZC3A 3MEXA 2W82A 4E7KA 2V6EA 1HKQA 1ULYA 5M5YJ 1KQ9A 3ZQFA 2N8GA 2H8WA 4U87A 1RKWA 3QP6A 4IO9F 2KPMA 3M7GA 3VB2A 3LSMA 3MVPA 3JREA 4I0BA 2E71A 4JOMA 5HLHA 2LDUA 2DK8A 1ON1A 5FLMJ 2DCEA 1ZELA 1HDDC 2LG4A 1W7PA 2ZJQF 1E3PA 2F5CA 3KZYA 4WK8F 5HVQC 3LQRA 1K6YA 1WFXA 1FOWA 5J1YA 5E18F 3CP8A 2MC4A 2D1VA 3I56I 1R6RA 2LNBA 2HS5A 2HWVA 2R4GA 2BW3B 4M9SA 4BEHA 1LDKB 2DA6A 1TNSA 3NAUA 4A2UA 5M5XJ 2DBBA 4GYGA 2HVRA 5EF6A 1LEBA 2B63J 3CUOA 3N4MA 4FX0A 3G1MA 3K4NA 1TBXA 3SEQA 3PO2J 2Y30A 2A6HF 3L2RA 1OPCA 2BW3A 2O8XA 4CYCA 1M1EB 1RR8C 3HZJA 3UKGA 1K79A 3OR1C 1FY7A 3CCJI 1C0WA 4YELA 2P5LC 2F4MB 2KT0A 1QO0D 1SANA 2R7QA 5DTDA 2EZLA 1PUFA 2L7KA 4LG3A 2ZMEC 3A0BC 3BJAA 4BQNA 4U7BA 3D5LA 3IKVA 5FGMA 4B43A 1LVKA 3OYJA 3WTSC 1T6SA 3L09A 2BV6A 1K7AA 4IRHA 1J2XA 2R7UA 3C1DA 3FXRA 1X1PA 2K27A 4LG0A 3DBLB 2M7AA 2R7FA 1WPKA 2VC1A 3RZOJ 3RPUA 3S3MA 2O9LA 4OAZA 1H89C 2G7HA 3VWBA 3ZQQA 2E7WA 1T95A 3J7ZI 4BH9A 2MW8A 3E6CC 3CCLI 1TL8A 2CW0F 3N97A 4XL9A 1UG2A 4EATA 4YG2F 4DZJA 1LDDA 4A3KJ 3KP3A 2FU4A 1TW2A 4FE4A 2OTLI 2M0CA 1FTTA 2DI3A 4L5JA 5CQEA 3U2RA 4GO1A 4DIQA 3OYIA 4JX5A 2GXBA 1E17A 1JI8A 5L3BA 2HTJA 1U9OA 4KYWA 1WRJA 2VL8A 2KDOA 3ML6A 2Y9YA 2NNNA 5L3EA 4PK4A 4BBSJ 1X1AA 3HIFA 5JHFA 3OYGA 4KNYA 1ZARA 1E3OC 3WTUC 2CQKA 2MBFA 1UHMA 1B6AA 3DEEA 4C3IJ 3LSJA 2DT5A 2E2IJ 3BTIA 3Q5FA 4WXHA 3VDXA 4NHJA 2WAFA 3W6JB 4R1HA 4YIFA 2STWA 1ZG5A 3F8FA 2NVTJ 3P9IA 1X4PA 1DGWY 5TGTA 4HNVA 1S9HA 1S72I 3IHUA 2HDDA 1YX3A 5CKTA 1YE9A 3FHZA 1MBEA 2VQLA 4DBQA 1SFKA 2EA2A 5TISC 1IZ1A 4EQQA 2M3AA 2DQRA 4XLCA 5F0HA 1V4RA 2ZSHB 1ETYA 2D2WA 4D0PA 3KP2A 1Z7LA 1WI3A 1K61A 1H8AC 5LHIA 5J1RA 3GTGJ 1ERDA 4RDUA 2IRFG 1MBKA 3ZQHA 3KZZA 4CUGA 5KAFC 3GTOJ 2LC2A 2OJED 5EGOB 2MD5A 2GA1A 2YS9A 2VT3A 3PSIA 1T56A 4NQWB 4AIHA 3C2GA 2P8TA 4AIDA 4M6VA 4YIRX 5LGUA 5C44J 3M8EA 2ZMEB 2COMA 3F9KA 2ZXIA 5E20A 1IC8A 2Z5UA 4PGGA 3F0CA 4WX9A 3CCEI 5JLWA 2HU9A 3FISA 5EGOA 5FKLA 1Z6RA 4NQWA 1ZGAA 4XRMA 1D5YA 2OCEA 1JTYA 2HPIA 1YO5C 2ZMEA 2X6YA 3AG1H 2XV4S 2LY9A 3OMYA 4D7NA 2QUFA 2IJLA 2IA1A 5LLQA 3JAMK 1UMQA 5ERIA 2BY2A 4CXFA 3JTGA 4BS9A 2W48A 4G12A 2VPLA 2UV1A 1O3RA 1QVTA 4U0YA 2R5YA 3TW7A 1WCMJ 3Q0WA 4LB6B 2L02A 5F27A 4IKFA 4ANJA 1FYKA 1XCVA 2Y2ZA 4KA4A 4KITB 1BC7C 4A3JJ 4XORA 1FOYA 4WXCA 1IW7F 1JUSA 2LR8A 3KIOA 4CSWA 4CCLA 5E3MA 1R1VA 1XSVA 2Y9ZA 3ZP5A 3M9AA 2HTSA 2BYVE 4BGDA 3OY9A 3LSPA 2BY1A 2DFEA 2L2OA 2K9SA 3OV8A 2CUJA 2JMWA 5LHHA 3WTTC 3PNVA 3HTUA 2CV1A 4I76A 3HPGA 2JUCA 1BW5A 4HSRA 3LQQA 4O5VA 1WJ5A 4PSXA 3GTPJ 4WCGA 2XGXA 2X1CA 1MMGA 5E3LA 5C3EJ 2X85A 1KU9A 3R61A 1OCCH 3RKQA 1ZG1A 1XN7A 4ZZDA 3RDIA 2FQ3A 5ILSA 1Q1VA 1SFXA 1G2HA 1IRGA 4RB0A 4FHTA 3GFIA 1V3FA 2WB1A 4FETA 2RNJA 1ZH5A 4FASD 1NK3P 3L2WA 3BCAA 2V26A 2M4KA 3JW4A 3F6VA 1KA8A 3SYTA 1R36A 3CUQC 2KKOA 4OIQF 3MAJA 4IRGA 4B44A 2OF7A 3S2HJ 4BJTA 1Y39A 1W5TA 1BR4A 1ZYRF 2XVCA 2IA2A 5E3NA 3KYLA 1Z0XA 1J9IA 1ZRCA 3LFUA 2KHMA 2K4JA 1PDNC 3ZMZA 3BR1A 3I59B 1QHGA 2E19A 1IUYA 5J1UA 2R7ZJ 1Y8RB 3CMAI 2UZKA 1K83J 2K3PA 1Y0NA 4XIDA 2DN0A 2JA8J 2AQFA 4EV0A 3BT9A 2OUMA 1QA6A 1Y6IA 3CDLA 4Q4ZF 4ENNA 1EF4A 1JXSA 3E6DA 4KN4X 3CLOA 5E8GA 5L3DA 4AVZA 1SD5A 3BLYA 4BE0A 3WTZA 1FPQA 2WB1N 1QZYA 2X4HA 3GTMJ 5K5RA 2R5ZB 2P5KA 1D8JA 2K86A 1FEXA 2JUGA 5FLXK 1FWZA 1QGPA 1YW8A 4W1UA 4UVAA 1PP7U 1HOMA 3JRAA 1I27A 3RSNA 2Z3YA 3OR2C 4F91B 2VKHA 4XN0A 3HRSA 3TOAA 1AKHA 5C4XJ 4XNFA 4KIBA 1JT6A 4IHVA 3TP0A 1MBGA 2FMLA 2DLLA 2VE8A 2X48A 3EPZA 3GWZA 1R4MB 1YS6A 4J19A 3JCUC 2ZO4A 3G73A 4MGRA 2QEXI 4IL6C 4UV9A 3NARA 3DP7A 3KETA 4EGZA 3J81K 4N4NB 3COAC 2WADA 2D1HA 2ZFUA 1IRZA 3QQAA 1D1AA 2QSFX 2H27A 3W2AA 1MH3A 5FB2A 4XRSA 1WWXA 4OINF 4N4OB 2NS7A 3RZDJ 4ENMA 3ASNH 3OS1A 2Z9OA 2P6TA 4RM2A 2L3DA 2E1OA 1W5SA 3E5XA 4DBRA 4KIFA 3REOA 3C7JA 3CJTB 2XPUA 4HX7A 1FP2A 2R7WA 2GXGA 2FMYA 2IXSA 3QU3A 2PQ8A 4DNCA 4A3MJ 1CF7A 4XLNF 2XAHA 3G2BA 3KP7A 1VQ6I 2O61A 5IYDJ 5AIQA 3PM1A 4F55A 5BQTA 4UUVA 1OJLA 3TKYA 2D5VA 3QWLA 4XKVA 4CDGA 3GO5A 2OAZA 2HKOA 4F92B 4RBOA 2KIUA 5ILUA 1IG7A 3HRMA 1O4XA 3K2ZA 2WV1A 3CUQA 1XGOA 3A1YA 1SFOJ 4Q5SF 2FSWA 3IP4B 5D8KB 3HSEA 2LY1A 3WHCA 4ZDPA 1UZCA 3OSGA 4TV7A 2LP0A 3I4NJ 2COBA 3LSGA 1ETXA 1BI0A 2R7OA 2LREA 5HLIA 3CCQI 2E1MC 2KJBA 4FCYA 3S2WA 1RPWA 2V4JC 4I09A 2KZGA 1UCRA 3R0AA 4Y3OA 5TJJA 2HEOA 2JK3A 4M3FA 5HS8A 1VQMI 3GVAA 4E7SA 1BL0A 4I7HA 5LEJA 2X51A 4G6TB 5F0FA 2DA3A 4LK1F 3CF2A 4GCVA 4CZCA 3HHGA 3BPXA 1K4TA 1GV5A 1AWCA 1EV7A 3V8LA 2KDZA 5K5QA 4O6JA 4Y4RA 3KLNA 1HA8A 2CQXA 3D5SC 2HKXA 3RYRA 1SAXA 4HRIA 3FWEA 1S3JA 3S1MJ 1MMDA 2DOAA 1Z91A 2BY3A 2XIGA 3IC7A 3R6SA 1R1UA 2ZSIB 1SEUA 4IHYA 4CCOA 3M3YJ 3RQIA 3GZ5A 5E79C 3LAPA 1KYZA 1OKRA 2RAEA 3HGGA 1ZRDA 3L2UA 5D6FA 4IQJA 4KMUX 3M07A 1YI2I 1WJBA 5TRDA 3OL4A 4RLFA 1HLVA 1Z6TA 2FEZA 2VT2A 3LSKA 2R92J 4D7MA 3OWTA 1YRNA 4MTEA 4B3XA 1YQAA 3FX3A 2L5QA 5F04A 3OOUA 3IV5A 1YJWI 3K1PA 2ID6A 1G8XA 3E3VA 1GVJA 2ZC2A 5GTHC 2R7DA 3OOPA 3P5JA 1MNDA 4L5IA 4X1EA 2LH9A 4PFOA 4ETSA 4FT8A 4A12A 2E1CA 2ID3A 1VI0A 2X6WA 4EJVA 3FF5A 4IHXA 3HOUJ 1POGA 1QZEA 3UNGC 3CCRI 4ESBA 3RQ4A 2L54A 3HC7A 3FXJA 2H94A 3ZGKA 3WGIA 4XSZF 3DKYA 3K4JA 4BQQA 1FOXA 2YSRA 2Z99A 2R7XA 1P2FA 1ITYA 2VBYA 1TWAJ 1MBJA 1D1CA 4A0XA 1EA3A 3HKZA 2R0QC 1WVRA 1VQKI 4KISA 3K69A 3LL7A 3GFJA 1FMVA 2VQCA 3O6BB 2GIZA 1R49A 5B3SH 5GP9A 4G7HF 3C2BA 4FE7A 2BHYA 3ULQB 2QGUA 3DTIA 3TP3A 1D3YA 1OCZH 1XDUA 4IOCF 3Q0UA 3W3CA 2XAFA 2Y31A 1VQLI 2LFBA 3V8JA 4CZZA 3RI4A 4XLEA 2F5DA 2PBIA 2BVMA 5LBQA 2EB7A 3WHBA 5HLTA 1FOKA 1LJ9A 2F5VA 5AIPA 3JRBA 2HVQA 2VI6A 3H5RA 2A5YB 3BTCA 2CG4A 2P6SA 1ZN2A 3LSRA 4R79A 1OCTC 2E2HJ 4MTDA 4HDUA 4BACA 2DTRA 1GLNA 2QQBA 3LSIA 5HS9A 1IN4A 3HB9A 1T8IA 4HW0A 3CO7C 4B4CA 4IXAA 1LQ1A 4NUBA 4CHUA 4V19K 1KGSA 2XF5A 2O5RA 1Z77A 2CFXA 2PJRA 2E34A 3HJEA 4D5FA 3HKZN 5IOZA 3ZPLA 1OYIA 1UJ8A 5E3OA 3TL4X 2KIFA 3FKJA 1R23A 1ZGWA 3OIPA 1DU0A 5CVIA 4BXXJ 1A36A 4AIKA 4S05A 4BXFA 3RPQA 3C3WA 4PFPA 1IF1A 2FD5A 2EZIA 2BOLA 1F4KA 4ENKA 1OQYA 2DOEA 2CV0A 4BQAA 1TQIA 2V9VA 1VQPI 4HQMA 1B9NA 3SZTA 4ITVA 3A01B 1X1DA 4L9JA 4UUSB 1I50J 4G9YA 2MSYA 1OFCX 4X0GA 1P4WA 4H4KC 3MN2A 1HXDA 3RKYA 2EIMH 2HR3A 2X6OA 3KPHA 3QOPA 3K70C 4BJ5C 2ZXJA 3HTSB 1L0OC 1O3SA 3IH4A 3IH3A 2UXNA 4A5MA 4LK0F 4YFNF 3C18A 2H6CA 4UUSA 3H3ZA 2L9SA 3WTYC 4AVPA 2DU9A 2B9SA 2JWTA 1V55H 3HL2A 4C3JJ 4QLCU 1I3AA 3MKWB 1MH4A 2CWEA 4HEA2 3SXYA 3QODA 3ZOBA 2ACJA 1MBFA 6PAXA 4XMYA 2CS3A 3HOXJ 5FFXA 4B47A 4GRIA 3TGNA 4PSWA 1HW2A 1QVUA 5ILVA 1I6XA 1FC3A 2FBKA 2A61A 1YX5A 2CH0A 1VFCA 3KEQA 2A3SA 2HI3A 3HOTA 4E7IA 4PJLA 4ZYAA 1D1BA 1U5TB 3CP2A 3LA3A 3X2QH 4Q48A 3C2HA 3H3UA 3QPLA 2Q2EB 3I53A 1X3WB 4MNUA 3WTVC 2QSGX 2VOOA 1MJ9A 1J5YA 3PQKA 2P5VA 2DAOA 2BEOA 4HOBA 5JI6A 5DCFA 2A6TA 3HSRA 1U8BA 4IX7A 2FOKA 2VB6A 2CQNA 1R58A 5GAEJ 2E7XA 5DCMB 5HNHA 3MMYB 4A6EA 4Y13A 1JGGA 1R7JA 3KEOA 1WJAA 1EH6A 4RAZA 1Y1WJ 3NWTA 3ZN1A 1WGXA 3O3KA 5CQGA 5BS6A 3RKWA 3ZQGA 3HOSA 2EZKA 4AYBN 4ZYEA 4U0VA 2LYCA 2XB0X 4PZJA 4X6AJ 1LFBA 2ME6A 1TWFJ 1B72B 2EFOA 1LEAA 3BWGA 3ECHA 3LA7A 5FRNA 1J7KA 4L9NA 2HQNA 2F2EA 1MDMB 4GDFA 1MJAA 4BJ6C 2FBIA 3GZ6A 1ZGJA 1FYLA 2OTJI 3DU6A 4U88A 4B09A 1B59A 3FBIB 1E2XA 3G1LA 5JR3A 1JKRC 3V7CA 1I5ZA 2OV7A 3A03A 4DQ2A 3B6AA 2CO5A 2NOJB 5ICCA 2VC0A 1RUOA 4IHTA 1SFEA 1RNLA 5GAGJ 3IL2A 2GXAA 4S04A 1W0UA 4F93B 1TT5B 3FK7A 3RIRA 3FKIJ 4ESJA 2GOXB 4LD5A 4PGHA 2EWNA 2ZFWA 5IP9J 2ICWG 1STZA 2UUZA 4BDZA 3WU1B 1K4SA 5ICFA 4BL0B 5AONA 1WJEA 2DDAA 3IKTA 4XLPF 3ASOH 2QBYB 3PUBA 3A2KA 1MMNA 4M72A 1T38A 5JVGF 1HF0A 2X6XA 4HV6A 1ZK8A 4L0YB 4NC7A 4XKBA 3TO6A 4G7ZF 3D5RC 4M73A 5KVRA 1B8IB 3MD2A 3SFZA 2L4AA 4JK1X 1ZTRA 3HRUA 4XQFA 4Y7NJ 2WAQA 3S8PA 3GTLJ 4CA0A 4PJMA 4LMYA 2FQ4A 1I39A 3U9GA 5FROA 1IRFA 2EJRA 2L01A 1FJLA 3H5NA 3T8RA 1B8IA 1W4MA 2EINH 2OA4A 3GZNB 1O3QA 1CGPA 2KJCA 4BXUA 3ZQLA 1OMIA 2VKDA 1IDZA 1UFMA 3JAMZ 3FHNA 3KYCB 2YX7A 4N9HA 4ZZLA 3WGHA 3EDPA 4RB2C 4PJ0C 3VYUB 1WHUA 4ABZA 4E7ZA 3BROA 3CC4I 3CZ6A 1EJ9A 5CVUA 2W25A 5EYRA 2KL4A 4JQFA 2RQPA 4CO8A 3QYBA 3CMEI 2HZTA 5FKKA 3CJRB 3OYHA 2Z16A 4UB8C 4V2GA 3S17J 5IYCJ 1RC9A 4CCNA 5CYVA 5LHGA 4MO7A 2WAQN 3OL3A 2R7RA 2XASA 2JSPA 2OQGA 1A5JA 4A0ZA 2IGMA 1ONVA 2JJ7A 3BR3A 5L3FA 5EDNA 4AIJA 1PYVA 2BXZA 2XB5A 4D9JA 1LKXA 2A5WA 3MKYB 1JHHA 4KN7X 3AL0B 2G9WA 2CJJA 5HODA 2OU2A 2M4GA 3G3ZA 2EFQA 1LFPA 2XUBA 2HPMA 2AQEA 4HDVA 2EV0A 2W4SA 4Y33A 4B48A 1VNDA 1JKQC 3SFIA 3GEZA 4ZTFA 1JUPA 1ORKA 4XM3A 3Q0VA 4ZYDA 1H88C 5LRRA 3HOZJ 3AFHA 2L7ZA 2P81A 5D4SA 2J5PA 1TWGJ 5J4YA 4A5NA 2VODA 3ISPA 3TDUC 3KP4A 5F08A 4IQ4A 1Z1DA 2M8GX 1VZ0A 1WSUA 3I55I 1F36A 4HNUA 3BOQA 1I6HJ 1HSJA 1KU7A 1REPC 3TEDA 1WJFA 3DCFA 3EUHC 3R0JA 4XR6A 5LD2C 3TQNA 2LMDA 1PVEA 2ESHA 2DYSH 3PO3J 3PJRA 2EBIA 1P9QC 2XGCA 1J75A 1AU7A 1DP7P 2BHZA 4OAYA 2FA5A 2WY7Q 1U3EM 2X1EA 1KU3A 1VQOI 1TP4A 4U7DA 2DTZA 2Y48A 1IAWA 4ZYGA 2VJ5A 2K9NA 2JTVA 5K1YA 1S7AA 1BM9A 3VYTB 2I8DA 3FDYA 3CCVI 1JE8A 3F6OA 1HBXG 3FMSA 3SJMA 2PX9A 2XAJA 4IZZA 2BBYA 4MQ9F 4P96A 2TRTA 1ZLKA 2JA7J 3SHFA 1HSTA 3CDIA 3F8MA 3PQJA 1U0JA 2K9QA 3QYFA 5LFAA 1Z3XA 5L3GA 5FLXZ 1W36C 1Y0UA 2YPRA 1BR1A 2GBYA 4RMNA 3MZYA 2Z1DA 3UR3C 3H35A 4P9FA 2K7LA 2OPTA 3WE3A 3J7AY 5LGTA 4A0YA 3GX4X 3GTQJ 2RDPA 1G4DA 1S7EA 2LLKA 2PLYA 1IN7A 3HGYA 3L9FA 3HM5A 3J81Z 3ZXSA 2MLGA 4Y15A 3BR5A 3Q3SA 2V1XA 3B73A 2M34A 1OLTA 4Z6YA 1LPQA 2JQ7A 3F8BA 1WH7A 1Y1VJ 1KU2A 1A35A 3QPHA 5A2QZ 3I59A 3H36A 3MZHA 2DODA 1ODDA 5DYMA 1ETOA 2JVHA 2KZVA 2PN6A 3RTRA 3QU6A 4KT5C 4GFBA 1XS9A 2XAGA 3S16J 1FBSA 4DYRA 3AG3H 3LAJA 1J59A 1RZ4A 3IAS2 1BA5A 1APLC 3MKLA 2QLZA 3NQOA 4QSHA 2R5ZA 4ZTJA 1Z7UA 2KISA 4C2UA 5EEHA 3ERED 2ECCA 1TW3A 3E6MA 4EMSA 2JA5J 1HKTA 1TNTA 4RGRA 1JGSA 4GXOA 4A3IJ 3BTJA 2L9VA 2E36A 4BY7J 3E1SA 2LF7A 2VN2A 3EUKL 1TTYA 4B8XA 3Q9SA 2NYXA 2H6BA 2QF7A 4M3EA 2M7BA 1BOAA 5A2QK 5D8LB 3DWLE 3EUHA 1YS7A 4XRSG 4EEFG 2WWYA 2ELHA 4XN3A 2XSJC 2IA0A 3M1EA 2X0LA 3R60A 4XLAA 1V5GA 4MHGA 2OCCH 3EYYA 2JPCA 2VLAA 2Q1ZB 2PEXA 2VKEA 2VQHA 2WY8Q 3DPUA 3NEUA 2ZJ2A 3P7NA 4OIRF 1WKMA 3L2QA 3RYPA 3H92A 1XSXA 1SVMA 3ZQIA 3J80K 4BNCA 2ECBA 4ZJZA 3F8NA 2MYSA 2ETHA 1JKOC 2NVQJ 2XAUA 1MGTA 4ZDLA 4ZYHA 3JTHA 4A69C 2IS2A 2PMZA 1YG2A 1USSA 1V54H 1XCBA 3PIOF 2H09A 1CQTA 5JVTA 1LB2A 4HYEA 1H9TA 1IGNA 5FKNA 2EFNA 1U8RA 2V9KA 5GTIC 4A3LJ 4GYIA 2NNYA 1QU3A 3MWMA 4N0BA 5DEQA 4IOAF 3MKZA 2FNAA 3DEWA 3LNQA 2HYFA 1RI7A 5HS7A 1YHQI 4IHWA 1LE8B 3K9TA 4F7ZA 4EGYA 5H2FC 2V9PA 4LLNA 1R4NB 3PUFA 4LB5A 3PIPF 1WJCA 3DEUA 1NH3A 3H5AA 3B02A 4AWXB 4ON0A 3KZIC 1L3LA 3DTKA 2EQRA 3IWZA 3Q9VA 3RCOA 3FK6A 3E0JB 3HOVJ 1IO2A 1P7IA 1IUFA 1NHAA 1RRJA 3LA2A 1HQCA 2CW8A 1MZBA 2LKXA 3MCZA 1ZHFA 2FXAA 3CO6C 1MIJA 4M74A 4P5OA 2ZXWH 2PMZN 3S3NA 5DUIA 1B9MA 3P9KA 2W24A 2RGVA 3VODA 2FJ1A 1JJ6C 3FBNB 5HLGA 3BCBA 4NDLA 3QAHA 4V2FA 3EYIA 1FSEA 3ABTA 2EH3A 5GPAA 1PJRA 1MMSA 2F6CA 3HOYJ 5K7FA 4YEJA 4ZDOA 3J7AO 1GV2A 1X2NA 2OZ6A 2A69F 4MEYF 4XKCA 4LOCA 2WTEA 3E7LA 1AHDP 1J09A 4MIMA 4DZPA 3ERMA 4EM1A 1F5TA 2ELJA 4EM2A 3GF2A 1IN5A 1MW7A 2BZTA 2IGNA 3HUGB 4W97A 1D0YA 4MEXF 2IGOA 2LSOA 1K78B 1VQ8I 2VJIA 4BQOA 2M8EA 1FIAA 1P4AA 5JFRA 4M3GA 1YTYA 2EIKH 3JRDA 4DYQA 1GHCA 3H1CA 1K78A 3OYDA 5E1ZB 1LNWA 1AA7A 2HNHA 4XRFA 3BJ6A 3OYEA 2HGCA 4EJWA 1T0FC 1DQUA 3BG5A 3JRHA 3BG3A 1XPXA 1O7LA 3L1PA 3JSPA 1VQ7I 2B7EA 2BY0A 2DOFA 3OYLA 3FXQA 1MJBA 1P92A 3H3VK 2QWWA 2M0MA 1YOVB 1JT0A 4NBQA 2HXIA 2LRDA 2QVOA 4LGWA 1NG7A 2P0WA 4BE2A 2M1BA 3K6GA 2F4IA 2HQ5A 4GGGA 1X3UA 2K02A 1G59A 3CJNA 1KYWA 1KQ8A 3K4MA 2MH2A 3ONQA 5K7ZA 1D0XA 4PJJA 1G3TA 3WTXC 2BGCA 3IAM2 4I0AA 2ELKA 1IXRC 1MNEA 2FUG2 1QNTA 2L7FP 2HYGD 2CYYA 3HYIA 3KFWX 3WGGA 1ETVA 1Z67A 2EV6A 2FRHA 4AC0A 3EUAA 4I01A 2DA2A 5JLXA 5IPAA 5BMZA 1DPUA 2MC3A 1JTXA 5DD8A 1U5TC 2EPFA 4G6QA 2QYOA 4OOIA 4M6YA 1IJWC 1F43A 2AHQA 3FM3A 3LOCA 1I1SA 5FO5A 1ON2A 4UNOA 2LKPA 1P7JA 4IHSA 2JRMA 1ACIA 3OYKA 4RM3A 4EJUA 2AXLA 5KK1A 2EFWA 5CVJA 1BJZA 1KZHA 2H1LA 2WV0A 1V5FA 1OR7C 2KP6A 3V8KA 2CRGA 2L7MP 1MKMA 5EJCA 2RN7A 4A3FJ 1U78A 4HG2A 4LLLA 2DDBA 1LUJB 3T1BA 2XPWA 3DBHB 4BYYA 3E6BA 2LY2A 3TW6A 4C2MJ 3PNTA 3QPTA 1WJDA 1R71A 1GXQA 5D6EA 1K6OA 2IS4A 3FIWA 2K3FA 2E1NA 3V42A 3V7RA 2V1UA 4RS8A 3ELKA 4KFCA 1B4AA 5DV5A 1XSDA 4XOTA 2VONA 3ZR8X 2E35A 2MFZA 4JYKA 5CJ9A 2LVSA 3FMRA 2R7VA 1MD0A 5CPRB 3ABUA 4RAYA 5EZGA 3I0TA 3T0YA 1U2WA 3K2AA 5E17F 1W7PD 2BVLA 5CLSA 1R22A 3T5XA 3U1KA 4HA8A 3OYMA 5E8IA 1FBQA 2P7VB 2CU7A 4G94A 5FRMA 3FM5A 4YFKF 2O7OA 5IOYA 2B0LA 3DLLF 4NC8A 3I54A 3A01A 2WBMA 2ISZA 2W85A 3M8JA 2R3SA 2W57A 1TZLA 5IYBJ 1T0FA 1A04A 4HSTA 4E7JA 1HCRA 2GIVA 5J6XA 2IAIA 2QENA 2HOEA 1D8KA 1ENHA 1OCPA 4M9XA 4P1WA 4DW6A 3OIOA 5J8CA 1YIOA 1ZRFA 4LLGF 3S32A 1EKEA 4P9UA 2CSOA 4MFDA 4UY8I 1VQ9I 3FXKA 1IN8A 2K5CA 2IEKA 3H0GJ 2HDWA 2NAZA 2A68F 2RQQA 3OIQA 3BZ6A 1X1BA 3MZ8A 4MFEA 5H6QA 1ETWA 4IJAA 4NB5A 1RKTA 4J00A 4OIOF 5BNGA 1ZAOA 1UAAA 2QSHX 4A3BJ 2XPVA 1E0EA 3BZKA 2OD5A 2FE3A 3VYRB 1BN5A 3BJOA 4WXDA 2O8KA 3CDHA 3RKXA 1S5LC 3WU2C 3ABLH 2HZDA 4RB3C 5ICGA 2IW5A 2LF8A 3MQ0A 3RPUD 2F4OB 3ZMSA 3VEPA 4DOZA 1Q1HA 1YYVA 2HVSA 3VOEA 3GW2A 5HDKA 1U5TA 1S29A 2KMUA 2GWRA 4I2OA 4BHCA 1Z9CA 5H6RA 2GQQA 3JRCA 1W7PB 2KIMA 2HQRA 2Q2EA 4II3A 2CQQA 1VF9A 5HDNA 4MQVA 5FLVA 4M9ZA 1JHFA 4D5CA 3IH2A 5F6FA 4HX8A 3TO9A 3H9GA 1B1BA 5EZHA 1YW7A 2JPBA 3BQZA 5IP6A 1OR7A 4M71A 1RUNA 5IT9Z 1H0MA 4RB1A 1VQ4I 3ESWB 1D0ZA 2L4MA 3I71A 5DCMA 2XKOA 4BEHB 1DP3A 2E2JJ 4G7OF 1DGRM 3DQVC 2ZNYA 4D1QA 4UVCA 3JRIA 1HW5A 4M3BA 4BU2A 4AD9A 2VOPA 4Q47A 2MG4A 2JA6J 4HLYA 5F0CA 4NC6A 3JR9A 4HAMA 4CYCB 2CW7A 1UELB 3AG4H 1SMTA 1XMXA 5IP7J 1GDTA 4LIVA 2DMQA 2I10A 3V4GA 4XK4A 1SC7A 1B72A 2CMPA 1N78A 3WU0A 3EQLF 1PUFB 1N75A 1TWCJ 1MDMA 2UXXA 1SAUA 5F1RA 3BY6A 2E5NA 3OYBA 1T08B 3VSKA 2VJ4A 2QZ8A 1KONA 4G8XA 4HV5A 3SZGA 3NRVA 1DU6A 4LITA 3J7YJ 3AL0C 2FOWA 3K1NA 2JN6A 4UUTA 2KRHA 4EM0B 4HNTA 4LG0B 3O2PE 1IRXA 5IT9K 2QM3A 2WC2A 5GAHJ 1FBUA 1R5GA 2OC6A 3HSFA 4XBFA 3O8GA 4IVNA 2VIXA 3NWSA 1YIJI 3K4BA 2QQAA 4KUMA 1MSEC 3DU5A 2Z33A 5KHDA 2EK5A 4ASNA 2O6GE 3CMMA 2PI0A 4L9TA 4YRVA 2JA2A 1ZKGA 2CV2A 2MD0A 3FZVA 5M3MJ 1SVOA 1X19A 5JHUA 2OBPA 3SDGA 2CGPA 3CCYA 2V79A 5DUKA 3BG9A 2V1DA 2EFPA 2QBYA 3I3LA 3LSHA 4HX4A 2F48A 2EV5A 1ZG3A 3JRFA 3TO7A 3F22A 2TDXA 1XGMA 4PJNA 3OYNA 4JX6A 3ZQCA 1R00A 2DA1A 1SD6A 4Y17A 3U1DA 3I4MJ 2A6EF 3BR0A 5FJ8J 1HDPA 1EH8A 1U9NA 2VASA 2X1DA 1XGSA 2CUFA 3W2WA 1OCRH 2ZJPF 1OCOH 3O8HA 2K40A 3WG7H 1BIBA 2FX0A 2XGDA 4QWQA 2HXOA 5DM6F 2FF4A 5LGNA 4WWCA 1QPIA 2Q0OA 3BQYA 3ZMUA 3OSFA 3CD6I 1W1WE 2DMUA 2WAEA 1R5ID 3DTEA 5K7HA 4PUSA 4HQEA 2ADUA 1IXCA 2E60A 2YU3A 3I5UA 4PDKA 5KNLA 2K85A 1NG6A 1GT0C 1FZPB 3CJQB 4B1RA 1RESA 2DA5A 2LKSA 4RAGA 4J01A 3QRFF 1F9NA 3K10A 3KX2A 4I02A 1G6NA 3HEFA 2W7NA 2VQGA 2G7UA 2IPQX 2QQ8A 2XF6A 2XGEA 4ZH4F 2CUEA 2IGKA 2K9LA 4Z2YA 2G0EA 3BR6A 2LOOA 5GADJ 5D5VB 1FT9A 1X4OA 3FMQA 2LBFB 3TDZC 2RC4A 2RVCA 3A02A 4E7LA 1LVAA 5BOXA 1MBHA 3T8TA 3K1MA 2R7TA 1WQ2A 3ABKH 4UHTA 4LIUA 2M2EA 4FX4A 2BXYA 1TC3C 5D5UB 2R5YB 4YFXF 1QRYA 3CF5F 2LBFA 1ZR4A 5D4RA 1HKSA 1O7FA 3F23A 4Y52J 1FTZA 1P6RA 1S8NA 2M87A 3DPLC 3DKXA 3HG9A 1IV6A 4CCKA 2HDCA 2A07F 2R93J 2RREA 4BUPA 3D0SA 2GOMA 3RJPA 4FQGA 1OYWA 4LFUA 5J40A 4AM3A 3HPHA 2KLOA 3BPVA 3F72A 5J47A 5C4JJ 2MH9A 4E6KG 2BE5F 1T98A 4HF2A 2ZJRF 3BTLA 5ICEA 3A4CA 1XG1A 4L0ZB 4OWRB 2LTPA 2DMTA 2O03A 3S2DJ 2CFOA 3DF8A 1FYMA 2E5ZA 2ESNA
chains in the Genus database with same CATH topology
2XSDC 3HOVJ 1P7IA 1IDYA 1IUFA 1H89C 2O9LA 4D5FA 3HKZN 5IOZA 2LKXA 5E3OA 2MW8A 1ZGWA 2MGQA 4BXXJ 1A6IA 1DU0A 1UG2A 4DZJA 3QPSA 4A3KJ 2FD5A 2EZIA 2PMZN 4FE4A 2M0CA 1FTTA 2FJ1A 1JJ6C 4JX5A 4NDLA 4V2FA 3A01B 1U9OA 2EH3A 4UUSB 5GPAA 1I50J 2MSYA 1OFCX 3HOYJ 5K7FA 3MN2A 2Y9YA 1GV2A 1X2NA 2X6OA 4BBSJ 1JKPC 4LOCA 3IH4A 3IH3A 3E7LA 1E3OC 1AHDP 4MIMA 4DZPA 4C3IJ 3LSJA 2E2IJ 4UUSA 2GLOA 4A3GJ 3BTIA 2H8RA 3S1RJ 4W97A 2JWTA 4C3JJ 2NVTJ 1MH4A 4HNVA 3ZOBA 2DA4A 2HDDA 1FIAA 1MBFA 5DS9A 1WH5A 1MBEA 4M3GA 3HOXJ 4MLOA 1QVUA 3JRDA 4DYQA 5F0HA 1AKHB 2H1KA 3HDDA 1ETYA 1WI3A 1K61A 1VFCA 1H8AC 2HI3A 3BG5A 5J1RA 3JRHA 3GTGJ 3BG3A 4RDUA 3L1PA 4A3EJ 1MBKA 3ZQHA 3GTOJ 5EGOB 2YS9A 1T56A 3QPLA 3BR2A 3H3VK 5J3LA 4M6VA 5C44J 3CQZJ 1JT0A 1NK2P 2HXIA 1IC8A 2DMNA 2NOGA 3F0CA 2NVXJ 5JLWA 2HQ5A 1U8BA 3FISA 1R9TJ 5EGOA 5FKLA 4XRMA 1D5YA 1JGGA 1JTYA 5K7ZA 1GUUA 1XC5A 1Y1WJ 4DYCA 2LY9A 3S1QJ 4D7NA 3G1OA 4A3DJ 1WGXA 1MSFC 2ELKA 1UMQA 2L7FP 1ETVA 3ZQGA 4AC0A 2EZKA 4AYBN 2DA2A 5JLXA 5IPAA 2XB0X 3JRGA 2W48A 1JTXA 2LK2A 4G12A 4X6AJ 1LFBA 2ME6A 1TWFJ 1QVTA 2M9HA 4S0HB 1B72B 2R5YA 3TW7A 1WCMJ 3Q0WA 4BBRJ 1IJWC 1X58A 5F27A 1F43A 2AHQA 3LOCA 2Y2ZA 4A3JJ 1NTCA 1P7JA 1JUSA 2LR8A 2L0KA 1BJZA 5E3MA 2Y9ZA 3G1LA 3S14J 3LSPA 2CRGA 2L7MP 1JKRC 2K9SA 3A03A 2JMWA 4A3FJ 3B6AA 1U78A 5GPCA 4I76A 3S15J 1BW5A 1LE8A 2DA7A 2XPWA 3TW6A 4C2MJ 1W0UA 3GTPJ 2DJNA 3FK7A 3FKIJ 3FIWA 5E3LA 5C3EJ 2NS8A 3RKQA 5IP9J 2LD5A 2YUSA 1Q1VA 2L9RA 1G2HA 2DMPA 2X9DA 4JYKA 1ZQ3P 2LVSA 1NK3P 4JP0A 9ANTA 5EZGA 3K2AA 5EG0B 1FIPA 2OF7A 2QCOA 1HF0A 3S2HJ 2CU7A 1ZK8A 2IBDA 1MNMC 1JJ8C 1TWHJ 2O7OA 5IOYA 1B8IB 5E3NA 3A01A 1Z0XA 5FKOA 4BKXA 1ZTRA 5EEAA 4Y7NJ 5EG0A 5IYBJ 3GTLJ 4FTHA 5M5WJ 2FQ4A 3BR1A 1HCRA 4FISA 2IAIA 1ENHA 1OCPA 2E19A 1FJLA 1RR7A 2ME0A 5J1UA 3OIOA 4DW6A 1BW6A 4AUXA 1B8IA 2R7ZJ 3M4OJ 1K83J 4XIDA 4MFDA 2DN0A 3ZQLA 2JA8J 3D1NI 3BT9A 3H0GJ 2IEKA 3CDLA 2GM4A 5FKMA 1IDZA 1EF4A 4MFEA 1ETWA 4I6ZA 1RKTA 3GTMJ 2WB1N 5BNGA 2R5ZB 4A3BJ 2XPVA 1FEXA 4ABZA 4W1UA 1HOMA 1YRNB 3JRAA 4L5EA 2O8KA 1JUMA 5EYRA 2ZB9A 1AKHA 3HOWJ 5C4XJ 1JT6A 4IHVA 3TP0A 1MBGA 2X48A 5FKKA 4J19A 4V2GA 3S17J 5IYCJ 2VPRA 3NARA 4MO7A 2WAQN 1A5JA 3JRCA 3GBGA 1IRZA 3QQAA 2JJ7A 3BR3A 5EDNA 2CQQA 1VF9A 4C3HJ 2XB5A 5FLVA 1MH3A 4D5CA 3IH2A 4XRSA 5EZHA 2NS7A 2CJJA 5IP6A 3BQZA 5HODA 3RZDJ 2E2JJ 2E1OA 1JKQC 1VNDA 3SFIA 1JUPA 1ORKA 3JRIA 3Q0VA 1H88C 2HOAA 3GTJJ 4M3BA 3HOZJ 2L7ZA 2P81A 2XPUA 2Y0SN 2MG4A 2JA6J 1TWGJ 5F0CA 4A3MJ 3JR9A 5F08A 4CYCB 2M8GX 5IP7J 1GDTA 5F1JA 2HOTA 1F36A 1I6HJ 5IYDJ 2DMQA 2I10A 3PM1A 4QTRA 1OJLA 1LFUP 2D5VA 3TEDA 4XK4A 3DCFA 1B72A 1T33A 4RBOA 2VUMJ 3K7AJ 3GTKJ 1PUFB 4A93J 4QIWN 1IG7A 1TWCJ 3PO3J 1O4XA 2WV1A 2EBIA 3CMYA 2XGCA 1AU7A 1DU6A 1SFOJ 4UUTA 2JN6A 3WHCA 4BY1J 2DTZA 3OSGA 1RETA 2VKVA 2K9NA 2LP0A 3I4NJ 2COBA 3LSGA 4IEJA 1ETQA 1ETXA 3O8GA 3SJMA 1ZR2A 2TCTA 4JX4A 4M3DA 4FCYA 1RPWA 1ETKA 2TRTA 1UHSA 2JA7J 1MSEC 4A3CJ 2XRLA 2K9QA 2JK3A 4M3FA 1ZKGA 2GBYA 5M3MJ 1BL0A 3SDGA 3CCYA 3BG9A 2OPTA 5F0FA 2DA3A 3GTQJ 1X2MA 1GV5A 2YU9J 1S7EA 2LLKA 2KDZA 3HGYA 1W0TA 3JRFA 3HM5A 3HBLA 3S1NJ 2CQXA 4JX6A 3ZQCA 3BR5A 3Q3SA 2M34A 2DA1A 3S1MJ 3I4MJ 3BR0A 1WH7A 1Y1VJ 5FJ8J 1HDPA 1U9NA 2CUFA 1ETOA 3VPRA 4IHYA 3O8HA 4GFBA 2K40A 1XS9A 3S16J 2AO9A 3M3YJ 3RQIA 4DYRA 2FX0A 2XGDA 2HXOA 3HGGA 2RAEA 4XICA 3B6CA 1QPIA 2HOSA 3BQYA 2EZHA 1BA5A 1APLC 1HLVA 3OSFA 1I3QJ 3W6VA 5M3FJ 2DMUA 3MKLA 4QSHA 2R5ZA 2R92J 4D7MA 1GVDA 5K7HA 4B3AA 2ECCA 1YRNA 2JA5J 2NVYJ 5F04A 3OOUA 3IV5A 4A3IJ 3BTJA 2HYJA 2ID6A 4BY7J 1GT0C 4B1RA 1RESA 4X1EA 2DA5A 5M5YJ 3ZQFA 2N8GA 2ID3A 2QF7A 1VI0A 1RKWA 4M3EA 3MVPA 3JREA 4IHXA 3HOUJ 1POGA 4XRSG 4EEFG 5FLMJ 3HEFA 1HDDC 2XGEA 2CUEA 2G0EA 3BR6A 2VKEA 5J1YA 3A02A 1ITYA 1TWAJ 3RZOJ 1MBJA 1MBHA 2R0QC 2DA6A 2M2EA 3ZQIA 1TC3C 3NAUA 5M5XJ 2R5YB 2ECBA 5GP9A 5EF6A 3C2BA 1QRYA 4FE7A 1JKOC 2B63J 1ZR4A 2NVQJ 1FTZA 4Y52J 3G1MA 3TP3A 4A69C 3PO2J 2Y30A 3Q0UA 4CYCA 2Y31A 2LFBA 3UKGA 1IV6A 1CQTA 2R93J 1IGNA 3WHBA 5FKNA 4A3LJ 3JRBA 2KT0A 1SANA 2VI6A 5DTDA 2EZLA 3DEWA 3LNQA 3BTCA 1PUFA 4IHWA 3LSRA 1LE8B 1OCTC 2E2HJ 5C4JJ 3BTLA 1XG1A 3HB9A 4B4CA 2LTPA 2DMTA 3S2DJ 1WPKA 2EQRA 3FK6A 1Z77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSD C;  3HOV J;  1P7I A;  1IDY A;  1IUF A;  1H89 C;  2O9L A;  4D5F A;  3HKZ N;  5IOZ A;  2LKX A;  5E3O A;  2MW8 A;  1ZGW A;  2MGQ A;  4BXX J;  1A6I A;  1DU0 A;  1UG2 A;  4DZJ A;  3QPS A;  4A3K J;  2FD5 A;  2EZI A;  2PMZ N;  4FE4 A;  2M0C A;  1FTT A;  2FJ1 A;  1JJ6 C;  4JX5 A;  4NDL A;  4V2F A;  3A01 B;  1U9O A;  2EH3 A;  4UUS B;  5GPA A;  1I50 J;  2MSY A;  1OFC X;  3HOY J;  5K7F A;  3MN2 A;  2Y9Y A;  1GV2 A;  1X2N A;  2X6O A;  4BBS J;  1JKP C;  4LOC A;  3IH4 A;  3IH3 A;  3E7L A;  1E3O C;  1AHD P;  4MIM A;  4DZP A;  4C3I J;  3LSJ A;  2E2I J;  4UUS A;  2GLO A;  4A3G J;  3BTI A;  2H8R A;  3S1R J;  4W97 A;  2JWT A;  4C3J J;  2NVT J;  1MH4 A;  4HNV A;  3ZOB A;  2DA4 A;  2HDD A;  1FIA A;  1MBF A;  5DS9 A;  1WH5 A;  1MBE A;  4M3G A;  3HOX J;  4MLO A;  1QVU A;  3JRD A;  4DYQ A;  5F0H A;  1AKH B;  2H1K A;  3HDD A;  1ETY A;  1WI3 A;  1K61 A;  1VFC A;  1H8A C;  2HI3 A;  3BG5 A;  5J1R A;  3JRH A;  3GTG J;  3BG3 A;  4RDU A;  3L1P A;  4A3E J;  1MBK A;  3ZQH A;  3GTO J;  5EGO B;  2YS9 A;  1T56 A;  3QPL A;  3BR2 A;  3H3V K;  5J3L A;  4M6V A;  5C44 J;  3CQZ J;  1JT0 A;  1NK2 P;  2HXI A;  1IC8 A;  2DMN A;  2NOG A;  3F0C A;  2NVX J;  5JLW A;  2HQ5 A;  1U8B A;  3FIS A;  1R9T J;  5EGO A;  5FKL A;  4XRM A;  1D5Y A;  1JGG A;  1JTY A;  5K7Z A;  1GUU A;  1XC5 A;  1Y1W J;  4DYC A;  2LY9 A;  3S1Q J;  4D7N A;  3G1O A;  4A3D J;  1WGX A;  1MSF C;  2ELK A;  1UMQ A;  2L7F P;  1ETV A;  3ZQG A;  4AC0 A;  2EZK A;  4AYB N;  2DA2 A;  5JLX A;  5IPA A;  2XB0 X;  3JRG A;  2W48 A;  1JTX A;  2LK2 A;  4G12 A;  4X6A J;  1LFB A;  2ME6 A;  1TWF J;  1QVT A;  2M9H A;  4S0H B;  1B72 B;  2R5Y A;  3TW7 A;  1WCM J;  3Q0W A;  4BBR J;  1IJW C;  1X58 A;  5F27 A;  1F43 A;  2AHQ A;  3LOC A;  2Y2Z A;  4A3J J;  1NTC A;  1P7J A;  1JUS A;  2LR8 A;  2L0K A;  1BJZ A;  5E3M A;  2Y9Z A;  3G1L A;  3S14 J;  3LSP A;  2CRG A;  2L7M P;  1JKR C;  2K9S A;  3A03 A;  2JMW A;  4A3F J;  3B6A A;  1U78 A;  5GPC A;  4I76 A;  3S15 J;  1BW5 A;  1LE8 A;  2DA7 A;  2XPW A;  3TW6 A;  4C2M J;  1W0U A;  3GTP J;  2DJN A;  3FK7 A;  3FKI J;  3FIW A;  5E3L A;  5C3E J;  2NS8 A;  3RKQ A;  5IP9 J;  2LD5 A;  2YUS A;  1Q1V A;  2L9R A;  1G2H A;  2DMP A;  2X9D A;  4JYK A;  1ZQ3 P;  2LVS A;  1NK3 P;  4JP0 A;  9ANT A;  5EZG A;  3K2A A;  5EG0 B;  1FIP A;  2OF7 A;  2QCO A;  1HF0 A;  3S2H J;  2CU7 A;  1ZK8 A;  2IBD A;  1MNM C;  1JJ8 C;  1TWH J;  2O7O A;  5IOY A;  1B8I B;  5E3N A;  3A01 A;  1Z0X A;  5FKO A;  4BKX A;  1ZTR A;  5EEA A;  4Y7N J;  5EG0 A;  5IYB J;  3GTL J;  4FTH A;  5M5W J;  2FQ4 A;  3BR1 A;  1HCR A;  4FIS A;  2IAI A;  1ENH A;  1OCP A;  2E19 A;  1FJL A;  1RR7 A;  2ME0 A;  5J1U A;  3OIO A;  4DW6 A;  1BW6 A;  4AUX A;  1B8I A;  2R7Z J;  3M4O J;  1K83 J;  4XID A;  4MFD A;  2DN0 A;  3ZQL A;  2JA8 J;  3D1N I;  3BT9 A;  3H0G J;  2IEK A;  3CDL A;  2GM4 A;  5FKM A;  1IDZ A;  1EF4 A;  4MFE A;  1ETW A;  4I6Z A;  1RKT A;  3GTM J;  2WB1 N;  5BNG A;  2R5Z B;  4A3B J;  2XPV A;  1FEX A;  4ABZ A;  4W1U A;  1HOM A;  1YRN B;  3JRA A;  4L5E A;  2O8K A;  1JUM A;  5EYR A;  2ZB9 A;  1AKH A;  3HOW J;  5C4X J;  1JT6 A;  4IHV A;  3TP0 A;  1MBG A;  2X48 A;  5FKK A;  4J19 A;  4V2G A;  3S17 J;  5IYC J;  2VPR A;  3NAR A;  4MO7 A;  2WAQ N;  1A5J A;  3JRC A;  3GBG A;  1IRZ A;  3QQA A;  2JJ7 A;  3BR3 A;  5EDN A;  2CQQ A;  1VF9 A;  4C3H J;  2XB5 A;  5FLV A;  1MH3 A;  4D5C A;  3IH2 A;  4XRS A;  5EZH A;  2NS7 A;  2CJJ A;  5IP6 A;  3BQZ A;  5HOD A;  3RZD J;  2E2J J;  2E1O A;  1JKQ C;  1VND A;  3SFI A;  1JUP A;  1ORK A;  3JRI A;  3Q0V A;  1H88 C;  2HOA A;  3GTJ J;  4M3B A;  3HOZ J;  2L7Z A;  2P81 A;  2XPU A;  2Y0S N;  2MG4 A;  2JA6 J;  1TWG J;  5F0C A;  4A3M J;  3JR9 A;  5F08 A;  4CYC B;  2M8G X;  5IP7 J;  1GDT A;  5F1J A;  2HOT A;  1F36 A;  1I6H J;  5IYD J;  2DMQ A;  2I10 A;  3PM1 A;  4QTR A;  1OJL A;  1LFU P;  2D5V A;  3TED A;  4XK4 A;  3DCF A;  1B72 A;  1T33 A;  4RBO A;  2VUM J;  3K7A J;  3GTK J;  1PUF B;  4A93 J;  4QIW N;  1IG7 A;  1TWC J;  3PO3 J;  1O4X A;  2WV1 A;  2EBI A;  3CMY A;  2XGC A;  1AU7 A;  1DU6 A;  1SFO J;  4UUT A;  2JN6 A;  3WHC A;  4BY1 J;  2DTZ A;  3OSG A;  1RET A;  2VKV A;  2K9N A;  2LP0 A;  3I4N J;  2COB A;  3LSG A;  4IEJ A;  1ETQ A;  1ETX A;  3O8G A;  3SJM A;  1ZR2 A;  2TCT A;  4JX4 A;  4M3D A;  4FCY A;  1RPW A;  1ETK A;  2TRT A;  1UHS A;  2JA7 J;  1MSE C;  4A3C J;  2XRL A;  2K9Q A;  2JK3 A;  4M3F A;  1ZKG A;  2GBY A;  5M3M J;  1BL0 A;  3SDG A;  3CCY A;  3BG9 A;  2OPT A;  5F0F A;  2DA3 A;  3GTQ J;  1X2M A;  1GV5 A;  2YU9 J;  1S7E A;  2LLK A;  2KDZ A;  3HGY A;  1W0T A;  3JRF A;  3HM5 A;  3HBL A;  3S1N J;  2CQX A;  4JX6 A;  3ZQC A;  3BR5 A;  3Q3S A;  2M34 A;  2DA1 A;  3S1M J;  3I4M J;  3BR0 A;  1WH7 A;  1Y1V J;  5FJ8 J;  1HDP A;  1U9N A;  2CUF A;  1ETO A;  3VPR A;  4IHY A;  3O8H A;  4GFB A;  2K40 A;  1XS9 A;  3S16 J;  2AO9 A;  3M3Y J;  3RQI A;  4DYR A;  2FX0 A;  2XGD A;  2HXO A;  3HGG A;  2RAE A;  4XIC A;  3B6C A;  1QPI A;  2HOS A;  3BQY A;  2EZH A;  1BA5 A;  1APL C;  1HLV A;  3OSF A;  1I3Q J;  3W6V A;  5M3F J;  2DMU A;  3MKL A;  4QSH A;  2R5Z A;  2R92 J;  4D7M A;  1GVD A;  5K7H A;  4B3A A;  2ECC A;  1YRN A;  2JA5 J;  2NVY J;  5F04 A;  3OOU A;  3IV5 A;  4A3I J;  3BTJ A;  2HYJ A;  2ID6 A;  4BY7 J;  1GT0 C;  4B1R A;  1RES A;  4X1E A;  2DA5 A;  5M5Y J;  3ZQF A;  2N8G A;  2ID3 A;  2QF7 A;  1VI0 A;  1RKW A;  4M3E A;  3MVP A;  3JRE A;  4IHX A;  3HOU J;  1POG A;  4XRS G;  4EEF G;  5FLM J;  3HEF A;  1HDD C;  2XGE A;  2CUE A;  2G0E A;  3BR6 A;  2VKE A;  5J1Y A;  3A02 A;  1ITY A;  1TWA J;  3RZO J;  1MBJ A;  1MBH A;  2R0Q C;  2DA6 A;  2M2E A;  3ZQI A;  1TC3 C;  3NAU A;  5M5X J;  2R5Y B;  2ECB A;  5GP9 A;  5EF6 A;  3C2B A;  1QRY A;  4FE7 A;  1JKO C;  2B63 J;  1ZR4 A;  2NVQ J;  1FTZ A;  4Y52 J;  3G1M A;  3TP3 A;  4A69 C;  3PO2 J;  2Y30 A;  3Q0U A;  4CYC A;  2Y31 A;  2LFB A;  3UKG A;  1IV6 A;  1CQT A;  2R93 J;  1IGN A;  3WHB A;  5FKN A;  4A3L J;  3JRB A;  2KT0 A;  1SAN A;  2VI6 A;  5DTD A;  2EZL A;  3DEW A;  3LNQ A;  3BTC A;  1PUF A;  4IHW A;  3LSR A;  1LE8 B;  1OCT C;  2E2H J;  5C4J J;  3BTL A;  1XG1 A;  3HB9 A;  4B4C A;  2LTP A;  2DMT A;  3S2D J;  1WPK A;  2EQR A;  3FK6 A;  1Z77 A; 
#chains in the Genus database with same CATH topology
 2XSD C;  4JBA A;  5B1A H;  4RGU A;  4RLQ A;  1IDY A;  2KFD A;  2AXT C;  1UST A;  4G6D A;  3F21 A;  2NVU B;  2MGQ A;  2PG4 A;  1V5E A;  1A6I A;  1TT0 A;  2OZU A;  3QPS A;  3BG6 A;  2NRA C;  1FMW A;  3F8C A;  2MLK A;  2M30 A;  3BZC A;  2PMH A;  1SFU A;  3KP5 A;  4BHP A;  1S7O A;  1YLF A;  2VXD A;  3K4L A;  4KT6 A;  3TBI A;  5LEK A;  3PNY A;  1Z21 A;  4KIC A;  2DQL A;  3H9Q A;  3I4P A;  3VFZ A;  2QKM B;  3PFI A;  3AKZ A;  2K4B A;  3K0L A;  4EJO A;  2JVG A;  1A6Q A;  1H9G A;  2O3F A;  2K9M A;  4L9V A;  4UV8 A;  1JKP C;  3K4C A;  1FP1 D;  3IUO A;  4XLF A;  1PUE E;  2GLO A;  4HLX A;  4A3G J;  1BBY A;  5ED4 A;  2H8R A;  1O57 A;  3S1R J;  2PFB A;  4RA2 A;  2P4W A;  3QOE A;  3SZP A;  1HW1 A;  2DA4 A;  3OS0 A;  1FNN A;  5D5W B;  2W00 A;  5DS9 A;  2I5U A;  1WH5 A;  3PFY A;  1W36 D;  2WA0 A;  3V7S A;  3J80 Z;  2EIL H;  2OQR A;  4MLO A;  1VQ5 I;  4XOP A;  1QZZ A;  3FXU A;  3MFK A;  2V1N A;  1AKH B;  2H1K A;  3HDD A;  2ISY A;  3SDB A;  2F5F A;  2DFF A;  2ZNZ A;  3VYS B;  4CCM A;  3F3X A;  4C30 A;  2W84 A;  5FFZ A;  4A3E J;  3U21 A;  5IY5 H;  3DPT A;  4BDY A;  2DXI A;  1X3Z B;  3W2V A;  4UVB A;  3BR2 A;  5B66 C;  3DV8 A;  5J3L A;  4QPO A;  3CQZ J;  1NK2 P;  2ZCW A;  2DJI A;  2A05 A;  2EA4 A;  3HXL A;  3IRQ A;  2DMN A;  2NOG A;  2NVX J;  3HRT A;  1R9T J;  1SD4 A;  3OS2 A;  3A0H C;  2XHK A;  1X1C A;  4OMY A;  3KLO A;  1AOY A;  1D5V A;  1Y56 A;  1GUU A;  1XC5 A;  1BJA A;  3WTW C;  4DYC A;  1YW9 A;  3S1Q J;  2XDV A;  2DPU A;  2HFH A;  3G1O A;  3KYD B;  2KRF A;  4II2 A;  5E1W A;  1MSF C;  4A3D J;  4A6D A;  2XRO A;  1QHH D;  1G3W A;  1CF7 B;  1WI9 A;  4KMF A;  2M5W A;  3GFM A;  4IRI A;  3JRG A;  2LK2 A;  1OYY A;  4K2E A;  4HPQ A;  2M9H A;  4S0H B;  4LJZ F;  4WF2 A;  4BBR J;  1X58 A;  2DK5 A;  2FNP A;  3CTA A;  3ZMD A;  3ZN0 A;  1Y8Q B;  1NTC A;  4U0W A;  1XB4 A;  3CUQ B;  4YII A;  4KDP A;  2L0K A;  1SD7 A;  3GLX A;  5FD5 A;  2V7F A;  3DKW A;  4OMZ A;  3SQN A;  3ZCO A;  1XMK A;  3S14 J;  1FLI A;  3CCS I;  2CQ7 A;  2HQA A;  4CYD A;  4CH7 A;  2AS5 F;  2Y75 A;  1TLH B;  3WG9 A;  1XTA A;  5GPC A;  3S15 J;  2STT A;  1LE8 A;  2DA7 A;  3WE2 A;  2P7C B;  2J5O A;  2VE9 A;  4E7H A;  4OIP F;  2DJN A;  1YJN I;  1J0R A;  2DT7 B;  2KIQ A;  2NS8 A;  4CCJ A;  5CVV A;  2LD5 A;  2YUS A;  4CGZ A;  1E3H A;  2CUZ A;  1O3T A;  2L9R A;  2ZKZ A;  2DMP A;  2YR2 A;  1P4X A;  2X9D A;  1TQM A;  1ZQ3 P;  2O0Y A;  2Y69 H;  3L2C A;  1ZRE A;  4JP0 A;  3QYE A;  5DM7 F;  3PSF A;  2DFH A;  9ANT A;  2PJP A;  3ROU A;  1PP8 F;  1XGN A;  5EG0 B;  2DYR H;  3WOD F;  5H20 A;  3CC2 I;  1FIP A;  2QCO A;  4N9I A;  3L00 A;  2IBD A;  2UWM A;  5HDG A;  1TQP A;  5E1X A;  1MNM C;  4C9Y A;  1JJ8 C;  2EIJ H;  2RKH A;  1TWH J;  4R8H A;  1OIS A;  5D5X B;  1R1T A;  2IS6 A;  5FKO A;  4BKX A;  5EEA A;  5EG0 A;  5KCM A;  2XKP A;  4DGW B;  4FTH A;  5M5W J;  1DPR A;  4FIS A;  3BC8 A;  3SEZ A;  3L7W A;  4HZF A;  1YJ9 I;  3KEY A;  3E5Q A;  1RR7 A;  2ME0 A;  2QA4 I;  3M4O J;  1BW6 A;  3BG7 A;  3K4K A;  4AUX A;  5B5E C;  1Z05 A;  1Z3Y A;  3LFK A;  2Y0M A;  4EJT A;  3D1N I;  2GM4 A;  3GXO A;  5FKM A;  5HNF A;  3HUG A;  3EET A;  4O3M A;  5K5O A;  4L18 B;  4RGX A;  3TOB A;  4XKW A;  3AAF A;  3I64 A;  4I6Z A;  2RNG A;  3DXJ F;  3CC7 I;  1IN6 A;  5IT3 A;  2V6C A;  3P9C A;  1UG0 A;  5BPI A;  3CCU I;  2Y0S A;  4DJA A;  2Q8K A;  1GXP A;  1YRN B;  4L5E A;  1JUM A;  4I98 B;  2ZB9 A;  3HOW J;  3GYH X;  4XSX F;  4IF4 A;  1UB9 A;  4BAY A;  2QKL B;  3ECO A;  2ZBK A;  1QBJ A;  3FXL A;  2XC7 A;  2VPR A;  3IWF A;  4BHB A;  3FXM A;  3AG2 H;  5DDG A;  1UHW A;  3PL8 A;  3S93 A;  1VTN C;  5L3C A;  1BI3 A;  4ESF A;  3GBG A;  2DO7 A;  4C3H J;  3L2V A;  4HBL A;  4IPA A;  2W1O A;  5LRS A;  1VQN I;  2IT0 A;  2NS0 A;  3HHH A;  2IVM A;  3LST A;  1MMA A;  4C2T A;  3GLL A;  1BI2 A;  1W5C C;  3GME A;  3ZQ7 A;  4M6X A;  2FBH A;  2VBZ A;  4QPQ A;  3G6E I;  3N05 A;  1FX7 A;  1ZLJ A;  2HOA A;  2PMU A;  3W6K B;  3GTJ J;  4ENJ A;  2E1M B;  2Y0S N;  5FD6 A;  4P55 A;  2ZXH A;  3E97 A;  2HOT A;  5F1J A;  1BR2 A;  1DDN A;  1I1G A;  4QTR A;  3S3O A;  2JRT A;  1LFU P;  1S6L A;  3CES A;  3VSL A;  1T33 A;  1U6G A;  1G3S A;  2VUM J;  3K7A J;  4XLH A;  5EEG A;  1BI1 A;  2YX4 A;  3GTK J;  1FSH A;  4A93 J;  4QIW N;  4KIG A;  2F5E A;  5B1B H;  5J4V A;  3LMM A;  4E4H A;  4HF1 A;  4KJZ A;  3CMY A;  1G3Y A;  4RAF A;  3KE2 A;  4UB6 C;  1RIO H;  1HC8 A;  4H0E A;  5J8F A;  3OYF A;  1T2K A;  1LDJ A;  4BY1 J;  4OU0 A;  1RET A;  2VKV A;  3DFG A;  2VJJ A;  2VXZ A;  4PCQ A;  4HF0 A;  2PJR B;  2RV8 A;  3E5U A;  2MA3 A;  2VBW A;  4E70 A;  3G71 I;  3I58 A;  4IEJ A;  1ETQ A;  2IP2 A;  1ZR2 A;  2TCT A;  1EH7 A;  1F1Z A;  1SMY F;  3BP8 A;  3M8F A;  4JX4 A;  4M3D A;  3OYA A;  1ETK A;  1UHS A;  2C6Y A;  1IXS B;  1QPM A;  4RGS A;  2M45 A;  3ABM H;  1IV8 A;  1YIT I;  4A3C J;  2XRL A;  2JSC A;  4UXN A;  2DW4 A;  3CLQ A;  2JZY A;  3H0D A;  2D45 A;  1SVL A;  1BIA A;  2GA2 A;  5CVR A;  1N77 A;  3GFL A;  1XMA A;  3DLA A;  1A31 A;  4CIC A;  2DFI A;  3TMO A;  1XX5 A;  3KP6 A;  5KAI C;  4BE1 A;  1X2M A;  3DBR B;  2JT1 A;  2DPD A;  2YU9 J;  4F52 A;  1BC8 C;  1DUX C;  1W0T A;  2DT6 A;  2KRC A;  3HBL A;  3R4K A;  3S1N J;  3JSO A;  3I9V 2;  5F64 A;  3M1C A;  3H9J A;  4NNJ A;  4XON A;  2XRN A;  5DD4 A;  2L9N A;  3LWF A;  2MAB A;  1XDS A;  4I99 C;  2IS1 A;  3BDD A;  3ZRG A;  3G4S I;  2QQ9 A;  1YFH A;  3VPR A;  3IRR A;  4AU7 A;  2AO9 A;  2XF7 A;  2NXN B;  2GZW A;  4F3Q A;  1T39 A;  2Z2S B;  3OYC A;  2KQR A;  4XIC A;  3B6C A;  2HOS A;  3QP5 A;  2R7S A;  5HOO A;  2GAU A;  3KCC A;  4EVI A;  2EZH A;  5BPD A;  2VBX A;  1R5H A;  1N25 A;  1BOB A;  3GUD A;  1KQ0 A;  1I3Q J;  3W6V A;  5M3F J;  3CCM I;  1QQI A;  1XD7 A;  1GVD A;  3GCM A;  4B3A A;  4AYB A;  3K70 D;  3ZMV A;  2XAQ A;  2NVY J;  1WZ2 A;  2HYJ A;  3FXO A;  3ZMT A;  4ZC3 A;  3MEX A;  2W82 A;  4E7K A;  2V6E A;  1HKQ A;  1ULY A;  5M5Y J;  1KQ9 A;  3ZQF A;  2N8G A;  2H8W A;  4U87 A;  1RKW A;  3QP6 A;  4IO9 F;  2KPM A;  3M7G A;  3VB2 A;  3LSM A;  3MVP A;  3JRE A;  4I0B A;  2E71 A;  4JOM A;  5HLH A;  2LDU A;  2DK8 A;  1ON1 A;  5FLM J;  2DCE A;  1ZEL A;  1HDD C;  2LG4 A;  1W7P A;  2ZJQ F;  1E3P A;  2F5C A;  3KZY A;  4WK8 F;  5HVQ C;  3LQR A;  1K6Y A;  1WFX A;  1FOW A;  5J1Y A;  5E18 F;  3CP8 A;  2MC4 A;  2D1V A;  3I56 I;  1R6R A;  2LNB A;  2HS5 A;  2HWV A;  2R4G A;  2BW3 B;  4M9S A;  4BEH A;  1LDK B;  2DA6 A;  1TNS A;  3NAU A;  4A2U A;  5M5X J;  2DBB A;  4GYG A;  2HVR A;  5EF6 A;  1LEB A;  2B63 J;  3CUO A;  3N4M A;  4FX0 A;  3G1M A;  3K4N A;  1TBX A;  3SEQ A;  3PO2 J;  2Y30 A;  2A6H F;  3L2R A;  1OPC A;  2BW3 A;  2O8X A;  4CYC A;  1M1E B;  1RR8 C;  3HZJ A;  3UKG A;  1K79 A;  3OR1 C;  1FY7 A;  3CCJ I;  1C0W A;  4YEL A;  2P5L C;  2F4M B;  2KT0 A;  1QO0 D;  1SAN A;  2R7Q A;  5DTD A;  2EZL A;  1PUF A;  2L7K A;  4LG3 A;  2ZME C;  3A0B C;  3BJA A;  4BQN A;  4U7B A;  3D5L A;  3IKV A;  5FGM A;  4B43 A;  1LVK A;  3OYJ A;  3WTS C;  1T6S A;  3L09 A;  2BV6 A;  1K7A A;  4IRH A;  1J2X A;  2R7U A;  3C1D A;  3FXR A;  1X1P A;  2K27 A;  4LG0 A;  3DBL B;  2M7A A;  2R7F A;  1WPK A;  2VC1 A;  3RZO J;  3RPU A;  3S3M A;  2O9L A;  4OAZ A;  1H89 C;  2G7H A;  3VWB A;  3ZQQ A;  2E7W A;  1T95 A;  3J7Z I;  4BH9 A;  2MW8 A;  3E6C C;  3CCL I;  1TL8 A;  2CW0 F;  3N97 A;  4XL9 A;  1UG2 A;  4EAT A;  4YG2 F;  4DZJ A;  1LDD A;  4A3K J;  3KP3 A;  2FU4 A;  1TW2 A;  4FE4 A;  2OTL I;  2M0C A;  1FTT A;  2DI3 A;  4L5J A;  5CQE A;  3U2R A;  4GO1 A;  4DIQ A;  3OYI A;  4JX5 A;  2GXB A;  1E17 A;  1JI8 A;  5L3B A;  2HTJ A;  1U9O A;  4KYW A;  1WRJ A;  2VL8 A;  2KDO A;  3ML6 A;  2Y9Y A;  2NNN A;  5L3E A;  4PK4 A;  4BBS J;  1X1A A;  3HIF A;  5JHF A;  3OYG A;  4KNY A;  1ZAR A;  1E3O C;  3WTU C;  2CQK A;  2MBF A;  1UHM A;  1B6A A;  3DEE A;  4C3I J;  3LSJ A;  2DT5 A;  2E2I J;  3BTI A;  3Q5F A;  4WXH A;  3VDX A;  4NHJ A;  2WAF A;  3W6J B;  4R1H A;  4YIF A;  2STW A;  1ZG5 A;  3F8F A;  2NVT J;  3P9I A;  1X4P A;  1DGW Y;  5TGT A;  4HNV A;  1S9H A;  1S72 I;  3IHU A;  2HDD A;  1YX3 A;  5CKT A;  1YE9 A;  3FHZ A;  1MBE A;  2VQL A;  4DBQ A;  1SFK A;  2EA2 A;  5TIS C;  1IZ1 A;  4EQQ A;  2M3A A;  2DQR A;  4XLC A;  5F0H A;  1V4R A;  2ZSH B;  1ETY A;  2D2W A;  4D0P A;  3KP2 A;  1Z7L A;  1WI3 A;  1K61 A;  1H8A C;  5LHI A;  5J1R A;  3GTG J;  1ERD A;  4RDU A;  2IRF G;  1MBK A;  3ZQH A;  3KZZ A;  4CUG A;  5KAF C;  3GTO J;  2LC2 A;  2OJE D;  5EGO B;  2MD5 A;  2GA1 A;  2YS9 A;  2VT3 A;  3PSI A;  1T56 A;  4NQW B;  4AIH A;  3C2G A;  2P8T A;  4AID A;  4M6V A;  4YIR X;  5LGU A;  5C44 J;  3M8E A;  2ZME B;  2COM A;  3F9K A;  2ZXI A;  5E20 A;  1IC8 A;  2Z5U A;  4PGG A;  3F0C A;  4WX9 A;  3CCE I;  5JLW A;  2HU9 A;  3FIS A;  5EGO A;  5FKL A;  1Z6R A;  4NQW A;  1ZGA A;  4XRM A;  1D5Y A;  2OCE A;  1JTY A;  2HPI A;  1YO5 C;  2ZME A;  2X6Y A;  3AG1 H;  2XV4 S;  2LY9 A;  3OMY A;  4D7N A;  2QUF A;  2IJL A;  2IA1 A;  5LLQ A;  3JAM K;  1UMQ A;  5ERI A;  2BY2 A;  4CXF A;  3JTG A;  4BS9 A;  2W48 A;  4G12 A;  2VPL A;  2UV1 A;  1O3R A;  1QVT A;  4U0Y A;  2R5Y A;  3TW7 A;  1WCM J;  3Q0W A;  4LB6 B;  2L02 A;  5F27 A;  4IKF A;  4ANJ A;  1FYK A;  1XCV A;  2Y2Z A;  4KA4 A;  4KIT B;  1BC7 C;  4A3J J;  4XOR A;  1FOY A;  4WXC A;  1IW7 F;  1JUS A;  2LR8 A;  3KIO A;  4CSW A;  4CCL A;  5E3M A;  1R1V A;  1XSV A;  2Y9Z A;  3ZP5 A;  3M9A A;  2HTS A;  2BYV E;  4BGD A;  3OY9 A;  3LSP A;  2BY1 A;  2DFE A;  2L2O A;  2K9S A;  3OV8 A;  2CUJ A;  2JMW A;  5LHH A;  3WTT C;  3PNV A;  3HTU A;  2CV1 A;  4I76 A;  3HPG A;  2JUC A;  1BW5 A;  4HSR A;  3LQQ A;  4O5V A;  1WJ5 A;  4PSX A;  3GTP J;  4WCG A;  2XGX A;  2X1C A;  1MMG A;  5E3L A;  5C3E J;  2X85 A;  1KU9 A;  3R61 A;  1OCC H;  3RKQ A;  1ZG1 A;  1XN7 A;  4ZZD A;  3RDI A;  2FQ3 A;  5ILS A;  1Q1V A;  1SFX A;  1G2H A;  1IRG A;  4RB0 A;  4FHT A;  3GFI A;  1V3F A;  2WB1 A;  4FET A;  2RNJ A;  1ZH5 A;  4FAS D;  1NK3 P;  3L2W A;  3BCA A;  2V26 A;  2M4K A;  3JW4 A;  3F6V A;  1KA8 A;  3SYT A;  1R36 A;  3CUQ C;  2KKO A;  4OIQ F;  3MAJ A;  4IRG A;  4B44 A;  2OF7 A;  3S2H J;  4BJT A;  1Y39 A;  1W5T A;  1BR4 A;  1ZYR F;  2XVC A;  2IA2 A;  5E3N A;  3KYL A;  1Z0X A;  1J9I A;  1ZRC A;  3LFU A;  2KHM A;  2K4J A;  1PDN C;  3ZMZ A;  3BR1 A;  3I59 B;  1QHG A;  2E19 A;  1IUY A;  5J1U A;  2R7Z J;  1Y8R B;  3CMA I;  2UZK A;  1K83 J;  2K3P A;  1Y0N A;  4XID A;  2DN0 A;  2JA8 J;  2AQF A;  4EV0 A;  3BT9 A;  2OUM A;  1QA6 A;  1Y6I A;  3CDL A;  4Q4Z F;  4ENN A;  1EF4 A;  1JXS A;  3E6D A;  4KN4 X;  3CLO A;  5E8G A;  5L3D A;  4AVZ A;  1SD5 A;  3BLY A;  4BE0 A;  3WTZ A;  1FPQ A;  2WB1 N;  1QZY A;  2X4H A;  3GTM J;  5K5R A;  2R5Z B;  2P5K A;  1D8J A;  2K86 A;  1FEX A;  2JUG A;  5FLX K;  1FWZ A;  1QGP A;  1YW8 A;  4W1U A;  4UVA A;  1PP7 U;  1HOM A;  3JRA A;  1I27 A;  3RSN A;  2Z3Y A;  3OR2 C;  4F91 B;  2VKH A;  4XN0 A;  3HRS A;  3TOA A;  1AKH A;  5C4X J;  4XNF A;  4KIB A;  1JT6 A;  4IHV A;  3TP0 A;  1MBG A;  2FML A;  2DLL A;  2VE8 A;  2X48 A;  3EPZ A;  3GWZ A;  1R4M B;  1YS6 A;  4J19 A;  3JCU C;  2ZO4 A;  3G73 A;  4MGR A;  2QEX I;  4IL6 C;  4UV9 A;  3NAR A;  3DP7 A;  3KET A;  4EGZ A;  3J81 K;  4N4N B;  3COA C;  2WAD A;  2D1H A;  2ZFU A;  1IRZ A;  3QQA A;  1D1A A;  2QSF X;  2H27 A;  3W2A A;  1MH3 A;  5FB2 A;  4XRS A;  1WWX A;  4OIN F;  4N4O B;  2NS7 A;  3RZD J;  4ENM A;  3ASN H;  3OS1 A;  2Z9O A;  2P6T A;  4RM2 A;  2L3D A;  2E1O A;  1W5S A;  3E5X A;  4DBR A;  4KIF A;  3REO A;  3C7J A;  3CJT B;  2XPU A;  4HX7 A;  1FP2 A;  2R7W A;  2GXG A;  2FMY A;  2IXS A;  3QU3 A;  2PQ8 A;  4DNC A;  4A3M J;  1CF7 A;  4XLN F;  2XAH A;  3G2B A;  3KP7 A;  1VQ6 I;  2O61 A;  5IYD J;  5AIQ A;  3PM1 A;  4F55 A;  5BQT A;  4UUV A;  1OJL A;  3TKY A;  2D5V A;  3QWL A;  4XKV A;  4CDG A;  3GO5 A;  2OAZ A;  2HKO A;  4F92 B;  4RBO A;  2KIU A;  5ILU A;  1IG7 A;  3HRM A;  1O4X A;  3K2Z A;  2WV1 A;  3CUQ A;  1XGO A;  3A1Y A;  1SFO J;  4Q5S F;  2FSW A;  3IP4 B;  5D8K B;  3HSE A;  2LY1 A;  3WHC A;  4ZDP A;  1UZC A;  3OSG A;  4TV7 A;  2LP0 A;  3I4N J;  2COB A;  3LSG A;  1ETX A;  1BI0 A;  2R7O A;  2LRE A;  5HLI A;  3CCQ I;  2E1M C;  2KJB A;  4FCY A;  3S2W A;  1RPW A;  2V4J C;  4I09 A;  2KZG A;  1UCR A;  3R0A A;  4Y3O A;  5TJJ A;  2HEO A;  2JK3 A;  4M3F A;  5HS8 A;  1VQM I;  3GVA A;  4E7S A;  1BL0 A;  4I7H A;  5LEJ A;  2X51 A;  4G6T B;  5F0F A;  2DA3 A;  4LK1 F;  3CF2 A;  4GCV A;  4CZC A;  3HHG A;  3BPX A;  1K4T A;  1GV5 A;  1AWC A;  1EV7 A;  3V8L A;  2KDZ A;  5K5Q A;  4O6J A;  4Y4R A;  3KLN A;  1HA8 A;  2CQX A;  3D5S C;  2HKX A;  3RYR A;  1SAX A;  4HRI A;  3FWE A;  1S3J A;  3S1M J;  1MMD A;  2DOA A;  1Z91 A;  2BY3 A;  2XIG A;  3IC7 A;  3R6S A;  1R1U A;  2ZSI B;  1SEU A;  4IHY A;  4CCO A;  3M3Y J;  3RQI A;  3GZ5 A;  5E79 C;  3LAP A;  1KYZ A;  1OKR A;  2RAE A;  3HGG A;  1ZRD A;  3L2U A;  5D6F A;  4IQJ A;  4KMU X;  3M07 A;  1YI2 I;  1WJB A;  5TRD A;  3OL4 A;  4RLF A;  1HLV A;  1Z6T A;  2FEZ A;  2VT2 A;  3LSK A;  2R92 J;  4D7M A;  3OWT A;  1YRN A;  4MTE A;  4B3X A;  1YQA A;  3FX3 A;  2L5Q A;  5F04 A;  3OOU A;  3IV5 A;  1YJW I;  3K1P A;  2ID6 A;  1G8X A;  3E3V A;  1GVJ A;  2ZC2 A;  5GTH C;  2R7D A;  3OOP A;  3P5J A;  1MND A;  4L5I A;  4X1E A;  2LH9 A;  4PFO A;  4ETS A;  4FT8 A;  4A12 A;  2E1C A;  2ID3 A;  1VI0 A;  2X6W A;  4EJV A;  3FF5 A;  4IHX A;  3HOU J;  1POG A;  1QZE A;  3UNG C;  3CCR I;  4ESB A;  3RQ4 A;  2L54 A;  3HC7 A;  3FXJ A;  2H94 A;  3ZGK A;  3WGI A;  4XSZ F;  3DKY A;  3K4J A;  4BQQ A;  1FOX A;  2YSR A;  2Z99 A;  2R7X A;  1P2F A;  1ITY A;  2VBY A;  1TWA J;  1MBJ A;  1D1C A;  4A0X A;  1EA3 A;  3HKZ A;  2R0Q C;  1WVR A;  1VQK I;  4KIS A;  3K69 A;  3LL7 A;  3GFJ A;  1FMV A;  2VQC A;  3O6B B;  2GIZ A;  1R49 A;  5B3S H;  5GP9 A;  4G7H F;  3C2B A;  4FE7 A;  2BHY A;  3ULQ B;  2QGU A;  3DTI A;  3TP3 A;  1D3Y A;  1OCZ H;  1XDU A;  4IOC F;  3Q0U A;  3W3C A;  2XAF A;  2Y31 A;  1VQL I;  2LFB A;  3V8J A;  4CZZ A;  3RI4 A;  4XLE A;  2F5D A;  2PBI A;  2BVM A;  5LBQ A;  2EB7 A;  3WHB A;  5HLT A;  1FOK A;  1LJ9 A;  2F5V A;  5AIP A;  3JRB A;  2HVQ A;  2VI6 A;  3H5R A;  2A5Y B;  3BTC A;  2CG4 A;  2P6S A;  1ZN2 A;  3LSR A;  4R79 A;  1OCT C;  2E2H J;  4MTD A;  4HDU A;  4BAC A;  2DTR A;  1GLN A;  2QQB A;  3LSI A;  5HS9 A;  1IN4 A;  3HB9 A;  1T8I A;  4HW0 A;  3CO7 C;  4B4C A;  4IXA A;  1LQ1 A;  4NUB A;  4CHU A;  4V19 K;  1KGS A;  2XF5 A;  2O5R A;  1Z77 A;  2CFX A;  2PJR A;  2E34 A;  3HJE A;  4D5F A;  3HKZ N;  5IOZ A;  3ZPL A;  1OYI A;  1UJ8 A;  5E3O A;  3TL4 X;  2KIF A;  3FKJ A;  1R23 A;  1ZGW A;  3OIP A;  1DU0 A;  5CVI A;  4BXX J;  1A36 A;  4AIK A;  4S05 A;  4BXF A;  3RPQ A;  3C3W A;  4PFP A;  1IF1 A;  2FD5 A;  2EZI A;  2BOL A;  1F4K A;  4ENK A;  1OQY A;  2DOE A;  2CV0 A;  4BQA A;  1TQI A;  2V9V A;  1VQP I;  4HQM A;  1B9N A;  3SZT A;  4ITV A;  3A01 B;  1X1D A;  4L9J A;  4UUS B;  1I50 J;  4G9Y A;  2MSY A;  1OFC X;  4X0G A;  1P4W A;  4H4K C;  3MN2 A;  1HXD A;  3RKY A;  2EIM H;  2HR3 A;  2X6O A;  3KPH A;  3QOP A;  3K70 C;  4BJ5 C;  2ZXJ A;  3HTS B;  1L0O C;  1O3S A;  3IH4 A;  3IH3 A;  2UXN A;  4A5M A;  4LK0 F;  4YFN F;  3C18 A;  2H6C A;  4UUS A;  3H3Z A;  2L9S A;  3WTY C;  4AVP A;  2DU9 A;  2B9S A;  2JWT A;  1V55 H;  3HL2 A;  4C3J J;  4QLC U;  1I3A A;  3MKW B;  1MH4 A;  2CWE A;  4HEA 2;  3SXY A;  3QOD A;  3ZOB A;  2ACJ A;  1MBF A;  6PAX A;  4XMY A;  2CS3 A;  3HOX J;  5FFX A;  4B47 A;  4GRI A;  3TGN A;  4PSW A;  1HW2 A;  1QVU A;  5ILV A;  1I6X A;  1FC3 A;  2FBK A;  2A61 A;  1YX5 A;  2CH0 A;  1VFC A;  3KEQ A;  2A3S A;  2HI3 A;  3HOT A;  4E7I A;  4PJL A;  4ZYA A;  1D1B A;  1U5T B;  3CP2 A;  3LA3 A;  3X2Q H;  4Q48 A;  3C2H A;  3H3U A;  3QPL A;  2Q2E B;  3I53 A;  1X3W B;  4MNU A;  3WTV C;  2QSG X;  2VOO A;  1MJ9 A;  1J5Y A;  3PQK A;  2P5V A;  2DAO A;  2BEO A;  4HOB A;  5JI6 A;  5DCF A;  2A6T A;  3HSR A;  1U8B A;  4IX7 A;  2FOK A;  2VB6 A;  2CQN A;  1R58 A;  5GAE J;  2E7X A;  5DCM B;  5HNH A;  3MMY B;  4A6E A;  4Y13 A;  1JGG A;  1R7J A;  3KEO A;  1WJA A;  1EH6 A;  4RAZ A;  1Y1W J;  3NWT A;  3ZN1 A;  1WGX A;  3O3K A;  5CQG A;  5BS6 A;  3RKW A;  3ZQG A;  3HOS A;  2EZK A;  4AYB N;  4ZYE A;  4U0V A;  2LYC A;  2XB0 X;  4PZJ A;  4X6A J;  1LFB A;  2ME6 A;  1TWF J;  1B72 B;  2EFO A;  1LEA A;  3BWG A;  3ECH A;  3LA7 A;  5FRN A;  1J7K A;  4L9N A;  2HQN A;  2F2E A;  1MDM B;  4GDF A;  1MJA A;  4BJ6 C;  2FBI A;  3GZ6 A;  1ZGJ A;  1FYL A;  2OTJ I;  3DU6 A;  4U88 A;  4B09 A;  1B59 A;  3FBI B;  1E2X A;  3G1L A;  5JR3 A;  1JKR C;  3V7C A;  1I5Z A;  2OV7 A;  3A03 A;  4DQ2 A;  3B6A A;  2CO5 A;  2NOJ B;  5ICC A;  2VC0 A;  1RUO A;  4IHT A;  1SFE A;  1RNL A;  5GAG J;  3IL2 A;  2GXA A;  4S04 A;  1W0U A;  4F93 B;  1TT5 B;  3FK7 A;  3RIR A;  3FKI J;  4ESJ A;  2GOX B;  4LD5 A;  4PGH A;  2EWN A;  2ZFW A;  5IP9 J;  2ICW G;  1STZ A;  2UUZ A;  4BDZ A;  3WU1 B;  1K4S A;  5ICF A;  4BL0 B;  5AON A;  1WJE A;  2DDA A;  3IKT A;  4XLP F;  3ASO H;  2QBY B;  3PUB A;  3A2K A;  1MMN A;  4M72 A;  1T38 A;  5JVG F;  1HF0 A;  2X6X A;  4HV6 A;  1ZK8 A;  4L0Y B;  4NC7 A;  4XKB A;  3TO6 A;  4G7Z F;  3D5R C;  4M73 A;  5KVR A;  1B8I B;  3MD2 A;  3SFZ A;  2L4A A;  4JK1 X;  1ZTR A;  3HRU A;  4XQF A;  4Y7N J;  2WAQ A;  3S8P A;  3GTL J;  4CA0 A;  4PJM A;  4LMY A;  2FQ4 A;  1I39 A;  3U9G A;  5FRO A;  1IRF A;  2EJR A;  2L01 A;  1FJL A;  3H5N A;  3T8R A;  1B8I A;  1W4M A;  2EIN H;  2OA4 A;  3GZN B;  1O3Q A;  1CGP A;  2KJC A;  4BXU A;  3ZQL A;  1OMI A;  2VKD A;  1IDZ A;  1UFM A;  3JAM Z;  3FHN A;  3KYC B;  2YX7 A;  4N9H A;  4ZZL A;  3WGH A;  3EDP A;  4RB2 C;  4PJ0 C;  3VYU B;  1WHU A;  4ABZ A;  4E7Z A;  3BRO A;  3CC4 I;  3CZ6 A;  1EJ9 A;  5CVU A;  2W25 A;  5EYR A;  2KL4 A;  4JQF A;  2RQP A;  4CO8 A;  3QYB A;  3CME I;  2HZT A;  5FKK A;  3CJR B;  3OYH A;  2Z16 A;  4UB8 C;  4V2G A;  3S17 J;  5IYC J;  1RC9 A;  4CCN A;  5CYV A;  5LHG A;  4MO7 A;  2WAQ N;  3OL3 A;  2R7R A;  2XAS A;  2JSP A;  2OQG A;  1A5J A;  4A0Z A;  2IGM A;  1ONV A;  2JJ7 A;  3BR3 A;  5L3F A;  5EDN A;  4AIJ A;  1PYV A;  2BXZ A;  2XB5 A;  4D9J A;  1LKX A;  2A5W A;  3MKY B;  1JHH A;  4KN7 X;  3AL0 B;  2G9W A;  2CJJ A;  5HOD A;  2OU2 A;  2M4G A;  3G3Z A;  2EFQ A;  1LFP A;  2XUB A;  2HPM A;  2AQE A;  4HDV A;  2EV0 A;  2W4S A;  4Y33 A;  4B48 A;  1VND A;  1JKQ C;  3SFI A;  3GEZ A;  4ZTF A;  1JUP A;  1ORK A;  4XM3 A;  3Q0V A;  4ZYD A;  1H88 C;  5LRR A;  3HOZ J;  3AFH A;  2L7Z A;  2P81 A;  5D4S A;  2J5P A;  1TWG J;  5J4Y A;  4A5N A;  2VOD A;  3ISP A;  3TDU C;  3KP4 A;  5F08 A;  4IQ4 A;  1Z1D A;  2M8G X;  1VZ0 A;  1WSU A;  3I55 I;  1F36 A;  4HNU A;  3BOQ A;  1I6H J;  1HSJ A;  1KU7 A;  1REP C;  3TED A;  1WJF A;  3DCF A;  3EUH C;  3R0J A;  4XR6 A;  5LD2 C;  3TQN A;  2LMD A;  1PVE A;  2ESH A;  2DYS H;  3PO3 J;  3PJR A;  2EBI A;  1P9Q C;  2XGC A;  1J75 A;  1AU7 A;  1DP7 P;  2BHZ A;  4OAY A;  2FA5 A;  2WY7 Q;  1U3E M;  2X1E A;  1KU3 A;  1VQO I;  1TP4 A;  4U7D A;  2DTZ A;  2Y48 A;  1IAW A;  4ZYG A;  2VJ5 A;  2K9N A;  2JTV A;  5K1Y A;  1S7A A;  1BM9 A;  3VYT B;  2I8D A;  3FDY A;  3CCV I;  1JE8 A;  3F6O A;  1HBX G;  3FMS A;  3SJM A;  2PX9 A;  2XAJ A;  4IZZ A;  2BBY A;  4MQ9 F;  4P96 A;  2TRT A;  1ZLK A;  2JA7 J;  3SHF A;  1HST A;  3CDI A;  3F8M A;  3PQJ A;  1U0J A;  2K9Q A;  3QYF A;  5LFA A;  1Z3X A;  5L3G A;  5FLX Z;  1W36 C;  1Y0U A;  2YPR A;  1BR1 A;  2GBY A;  4RMN A;  3MZY A;  2Z1D A;  3UR3 C;  3H35 A;  4P9F A;  2K7L A;  2OPT A;  3WE3 A;  3J7A Y;  5LGT A;  4A0Y A;  3GX4 X;  3GTQ J;  2RDP A;  1G4D A;  1S7E A;  2LLK A;  2PLY A;  1IN7 A;  3HGY A;  3L9F A;  3HM5 A;  3J81 Z;  3ZXS A;  2MLG A;  4Y15 A;  3BR5 A;  3Q3S A;  2V1X A;  3B73 A;  2M34 A;  1OLT A;  4Z6Y A;  1LPQ A;  2JQ7 A;  3F8B A;  1WH7 A;  1Y1V J;  1KU2 A;  1A35 A;  3QPH A;  5A2Q Z;  3I59 A;  3H36 A;  3MZH A;  2DOD A;  1ODD A;  5DYM A;  1ETO A;  2JVH A;  2KZV A;  2PN6 A;  3RTR A;  3QU6 A;  4KT5 C;  4GFB A;  1XS9 A;  2XAG A;  3S16 J;  1FBS A;  4DYR A;  3AG3 H;  3LAJ A;  1J59 A;  1RZ4 A;  3IAS 2;  1BA5 A;  1APL C;  3MKL A;  2QLZ A;  3NQO A;  4QSH A;  2R5Z A;  4ZTJ A;  1Z7U A;  2KIS A;  4C2U A;  5EEH A;  3ERE D;  2ECC A;  1TW3 A;  3E6M A;  4EMS A;  2JA5 J;  1HKT A;  1TNT A;  4RGR A;  1JGS A;  4GXO A;  4A3I J;  3BTJ A;  2L9V A;  2E36 A;  4BY7 J;  3E1S A;  2LF7 A;  2VN2 A;  3EUK L;  1TTY A;  4B8X A;  3Q9S A;  2NYX A;  2H6B A;  2QF7 A;  4M3E A;  2M7B A;  1BOA A;  5A2Q K;  5D8L B;  3DWL E;  3EUH A;  1YS7 A;  4XRS G;  4EEF G;  2WWY A;  2ELH A;  4XN3 A;  2XSJ C;  2IA0 A;  3M1E A;  2X0L A;  3R60 A;  4XLA A;  1V5G A;  4MHG A;  2OCC H;  3EYY A;  2JPC A;  2VLA A;  2Q1Z B;  2PEX A;  2VKE A;  2VQH A;  2WY8 Q;  3DPU A;  3NEU A;  2ZJ2 A;  3P7N A;  4OIR F;  1WKM A;  3L2Q A;  3RYP A;  3H92 A;  1XSX A;  1SVM A;  3ZQI A;  3J80 K;  4BNC A;  2ECB A;  4ZJZ A;  3F8N A;  2MYS A;  2ETH A;  1JKO C;  2NVQ J;  2XAU A;  1MGT A;  4ZDL A;  4ZYH A;  3JTH A;  4A69 C;  2IS2 A;  2PMZ A;  1YG2 A;  1USS A;  1V54 H;  1XCB A;  3PIO F;  2H09 A;  1CQT A;  5JVT A;  1LB2 A;  4HYE A;  1H9T A;  1IGN A;  5FKN A;  2EFN A;  1U8R A;  2V9K A;  5GTI C;  4A3L J;  4GYI A;  2NNY A;  1QU3 A;  3MWM A;  4N0B A;  5DEQ A;  4IOA F;  3MKZ A;  2FNA A;  3DEW A;  3LNQ A;  2HYF A;  1RI7 A;  5HS7 A;  1YHQ I;  4IHW A;  1LE8 B;  3K9T A;  4F7Z A;  4EGY A;  5H2F C;  2V9P A;  4LLN A;  1R4N B;  3PUF A;  4LB5 A;  3PIP F;  1WJC A;  3DEU A;  1NH3 A;  3H5A A;  3B02 A;  4AWX B;  4ON0 A;  3KZI C;  1L3L A;  3DTK A;  2EQR A;  3IWZ A;  3Q9V A;  3RCO A;  3FK6 A;  3E0J B;  3HOV J;  1IO2 A;  1P7I A;  1IUF A;  1NHA A;  1RRJ A;  3LA2 A;  1HQC A;  2CW8 A;  1MZB A;  2LKX A;  3MCZ A;  1ZHF A;  2FXA A;  3CO6 C;  1MIJ A;  4M74 A;  4P5O A;  2ZXW H;  2PMZ N;  3S3N A;  5DUI A;  1B9M A;  3P9K A;  2W24 A;  2RGV A;  3VOD A;  2FJ1 A;  1JJ6 C;  3FBN B;  5HLG A;  3BCB A;  4NDL A;  3QAH A;  4V2F A;  3EYI A;  1FSE A;  3ABT A;  2EH3 A;  5GPA A;  1PJR A;  1MMS A;  2F6C A;  3HOY J;  5K7F A;  4YEJ A;  4ZDO A;  3J7A O;  1GV2 A;  1X2N A;  2OZ6 A;  2A69 F;  4MEY F;  4XKC A;  4LOC A;  2WTE A;  3E7L A;  1AHD P;  1J09 A;  4MIM A;  4DZP A;  3ERM A;  4EM1 A;  1F5T A;  2ELJ A;  4EM2 A;  3GF2 A;  1IN5 A;  1MW7 A;  2BZT A;  2IGN A;  3HUG B;  4W97 A;  1D0Y A;  4MEX F;  2IGO A;  2LSO A;  1K78 B;  1VQ8 I;  2VJI A;  4BQO A;  2M8E A;  1FIA A;  1P4A A;  5JFR A;  4M3G A;  1YTY A;  2EIK H;  3JRD A;  4DYQ A;  1GHC A;  3H1C A;  1K78 A;  3OYD A;  5E1Z B;  1LNW A;  1AA7 A;  2HNH A;  4XRF A;  3BJ6 A;  3OYE A;  2HGC A;  4EJW A;  1T0F C;  1DQU A;  3BG5 A;  3JRH A;  3BG3 A;  1XPX A;  1O7L A;  3L1P A;  3JSP A;  1VQ7 I;  2B7E A;  2BY0 A;  2DOF A;  3OYL A;  3FXQ A;  1MJB A;  1P92 A;  3H3V K;  2QWW A;  2M0M A;  1YOV B;  1JT0 A;  4NBQ A;  2HXI A;  2LRD A;  2QVO A;  4LGW A;  1NG7 A;  2P0W A;  4BE2 A;  2M1B A;  3K6G A;  2F4I A;  2HQ5 A;  4GGG A;  1X3U A;  2K02 A;  1G59 A;  3CJN A;  1KYW A;  1KQ8 A;  3K4M A;  2MH2 A;  3ONQ A;  5K7Z A;  1D0X A;  4PJJ A;  1G3T A;  3WTX C;  2BGC A;  3IAM 2;  4I0A A;  2ELK A;  1IXR C;  1MNE A;  2FUG 2;  1QNT A;  2L7F P;  2HYG D;  2CYY A;  3HYI A;  3KFW X;  3WGG A;  1ETV A;  1Z67 A;  2EV6 A;  2FRH A;  4AC0 A;  3EUA A;  4I01 A;  2DA2 A;  5JLX A;  5IPA A;  5BMZ A;  1DPU A;  2MC3 A;  1JTX A;  5DD8 A;  1U5T C;  2EPF A;  4G6Q A;  2QYO A;  4OOI A;  4M6Y A;  1IJW C;  1F43 A;  2AHQ A;  3FM3 A;  3LOC A;  1I1S A;  5FO5 A;  1ON2 A;  4UNO A;  2LKP A;  1P7J A;  4IHS A;  2JRM A;  1ACI A;  3OYK A;  4RM3 A;  4EJU A;  2AXL A;  5KK1 A;  2EFW A;  5CVJ A;  1BJZ A;  1KZH A;  2H1L A;  2WV0 A;  1V5F A;  1OR7 C;  2KP6 A;  3V8K A;  2CRG A;  2L7M P;  1MKM A;  5EJC A;  2RN7 A;  4A3F J;  1U78 A;  4HG2 A;  4LLL A;  2DDB A;  1LUJ B;  3T1B A;  2XPW A;  3DBH B;  4BYY A;  3E6B A;  2LY2 A;  3TW6 A;  4C2M J;  3PNT A;  3QPT A;  1WJD A;  1R71 A;  1GXQ A;  5D6E A;  1K6O A;  2IS4 A;  3FIW A;  2K3F A;  2E1N A;  3V42 A;  3V7R A;  2V1U A;  4RS8 A;  3ELK A;  4KFC A;  1B4A A;  5DV5 A;  1XSD A;  4XOT A;  2VON A;  3ZR8 X;  2E35 A;  2MFZ A;  4JYK A;  5CJ9 A;  2LVS A;  3FMR A;  2R7V A;  1MD0 A;  5CPR B;  3ABU A;  4RAY A;  5EZG A;  3I0T A;  3T0Y A;  1U2W A;  3K2A A;  5E17 F;  1W7P D;  2BVL A;  5CLS A;  1R22 A;  3T5X A;  3U1K A;  4HA8 A;  3OYM A;  5E8I A;  1FBQ A;  2P7V B;  2CU7 A;  4G94 A;  5FRM A;  3FM5 A;  4YFK F;  2O7O A;  5IOY A;  2B0L A;  3DLL F;  4NC8 A;  3I54 A;  3A01 A;  2WBM A;  2ISZ A;  2W85 A;  3M8J A;  2R3S A;  2W57 A;  1TZL A;  5IYB J;  1T0F A;  1A04 A;  4HST A;  4E7J A;  1HCR A;  2GIV A;  5J6X A;  2IAI A;  2QEN A;  2HOE A;  1D8K A;  1ENH A;  1OCP A;  4M9X A;  4P1W A;  4DW6 A;  3OIO A;  5J8C A;  1YIO A;  1ZRF A;  4LLG F;  3S32 A;  1EKE A;  4P9U A;  2CSO A;  4MFD A;  4UY8 I;  1VQ9 I;  3FXK A;  1IN8 A;  2K5C A;  2IEK A;  3H0G J;  2HDW A;  2NAZ A;  2A68 F;  2RQQ A;  3OIQ A;  3BZ6 A;  1X1B A;  3MZ8 A;  4MFE A;  5H6Q A;  1ETW A;  4IJA A;  4NB5 A;  1RKT A;  4J00 A;  4OIO F;  5BNG A;  1ZAO A;  1UAA A;  2QSH X;  4A3B J;  2XPV A;  1E0E A;  3BZK A;  2OD5 A;  2FE3 A;  3VYR B;  1BN5 A;  3BJO A;  4WXD A;  2O8K A;  3CDH A;  3RKX A;  1S5L C;  3WU2 C;  3ABL H;  2HZD A;  4RB3 C;  5ICG A;  2IW5 A;  2LF8 A;  3MQ0 A;  3RPU D;  2F4O B;  3ZMS A;  3VEP A;  4DOZ A;  1Q1H A;  1YYV A;  2HVS A;  3VOE A;  3GW2 A;  5HDK A;  1U5T A;  1S29 A;  2KMU A;  2GWR A;  4I2O A;  4BHC A;  1Z9C A;  5H6R A;  2GQQ A;  3JRC A;  1W7P B;  2KIM A;  2HQR A;  2Q2E A;  4II3 A;  2CQQ A;  1VF9 A;  5HDN A;  4MQV A;  5FLV A;  4M9Z A;  1JHF A;  4D5C A;  3IH2 A;  5F6F A;  4HX8 A;  3TO9 A;  3H9G A;  1B1B A;  5EZH A;  1YW7 A;  2JPB A;  3BQZ A;  5IP6 A;  1OR7 A;  4M71 A;  1RUN A;  5IT9 Z;  1H0M A;  4RB1 A;  1VQ4 I;  3ESW B;  1D0Z A;  2L4M A;  3I71 A;  5DCM A;  2XKO A;  4BEH B;  1DP3 A;  2E2J J;  4G7O F;  1DGR M;  3DQV C;  2ZNY A;  4D1Q A;  4UVC A;  3JRI A;  1HW5 A;  4M3B A;  4BU2 A;  4AD9 A;  2VOP A;  4Q47 A;  2MG4 A;  2JA6 J;  4HLY A;  5F0C A;  4NC6 A;  3JR9 A;  4HAM A;  4CYC B;  2CW7 A;  1UEL B;  3AG4 H;  1SMT A;  1XMX A;  5IP7 J;  1GDT A;  4LIV A;  2DMQ A;  2I10 A;  3V4G A;  4XK4 A;  1SC7 A;  1B72 A;  2CMP A;  1N78 A;  3WU0 A;  3EQL F;  1PUF B;  1N75 A;  1TWC J;  1MDM A;  2UXX A;  1SAU A;  5F1R A;  3BY6 A;  2E5N A;  3OYB A;  1T08 B;  3VSK A;  2VJ4 A;  2QZ8 A;  1KON A;  4G8X A;  4HV5 A;  3SZG A;  3NRV A;  1DU6 A;  4LIT A;  3J7Y J;  3AL0 C;  2FOW A;  3K1N A;  2JN6 A;  4UUT A;  2KRH A;  4EM0 B;  4HNT A;  4LG0 B;  3O2P E;  1IRX A;  5IT9 K;  2QM3 A;  2WC2 A;  5GAH J;  1FBU A;  1R5G A;  2OC6 A;  3HSF A;  4XBF A;  3O8G A;  4IVN A;  2VIX A;  3NWS A;  1YIJ I;  3K4B A;  2QQA A;  4KUM A;  1MSE C;  3DU5 A;  2Z33 A;  5KHD A;  2EK5 A;  4ASN A;  2O6G E;  3CMM A;  2PI0 A;  4L9T A;  4YRV A;  2JA2 A;  1ZKG A;  2CV2 A;  2MD0 A;  3FZV A;  5M3M J;  1SVO A;  1X19 A;  5JHU A;  2OBP A;  3SDG A;  2CGP A;  3CCY A;  2V79 A;  5DUK A;  3BG9 A;  2V1D A;  2EFP A;  2QBY A;  3I3L A;  3LSH A;  4HX4 A;  2F48 A;  2EV5 A;  1ZG3 A;  3JRF A;  3TO7 A;  3F22 A;  2TDX A;  1XGM A;  4PJN A;  3OYN A;  4JX6 A;  3ZQC A;  1R00 A;  2DA1 A;  1SD6 A;  4Y17 A;  3U1D A;  3I4M J;  2A6E F;  3BR0 A;  5FJ8 J;  1HDP A;  1EH8 A;  1U9N A;  2VAS A;  2X1D A;  1XGS A;  2CUF A;  3W2W A;  1OCR H;  2ZJP F;  1OCO H;  3O8H A;  2K40 A;  3WG7 H;  1BIB A;  2FX0 A;  2XGD A;  4QWQ A;  2HXO A;  5DM6 F;  2FF4 A;  5LGN A;  4WWC A;  1QPI A;  2Q0O A;  3BQY A;  3ZMU A;  3OSF A;  3CD6 I;  1W1W E;  2DMU A;  2WAE A;  1R5I D;  3DTE A;  5K7H A;  4PUS A;  4HQE A;  2ADU A;  1IXC A;  2E60 A;  2YU3 A;  3I5U A;  4PDK A;  5KNL A;  2K85 A;  1NG6 A;  1GT0 C;  1FZP B;  3CJQ B;  4B1R A;  1RES A;  2DA5 A;  2LKS A;  4RAG A;  4J01 A;  3QRF F;  1F9N A;  3K10 A;  3KX2 A;  4I02 A;  1G6N A;  3HEF A;  2W7N A;  2VQG A;  2G7U A;  2IPQ X;  2QQ8 A;  2XF6 A;  2XGE A;  4ZH4 F;  2CUE A;  2IGK A;  2K9L A;  4Z2Y A;  2G0E A;  3BR6 A;  2LOO A;  5GAD J;  5D5V B;  1FT9 A;  1X4O A;  3FMQ A;  2LBF B;  3TDZ C;  2RC4 A;  2RVC A;  3A02 A;  4E7L A;  1LVA A;  5BOX A;  1MBH A;  3T8T A;  3K1M A;  2R7T A;  1WQ2 A;  3ABK H;  4UHT A;  4LIU A;  2M2E A;  4FX4 A;  2BXY A;  1TC3 C;  5D5U B;  2R5Y B;  4YFX F;  1QRY A;  3CF5 F;  2LBF A;  1ZR4 A;  5D4R A;  1HKS A;  1O7F A;  3F23 A;  4Y52 J;  1FTZ A;  1P6R A;  1S8N A;  2M87 A;  3DPL C;  3DKX A;  3HG9 A;  1IV6 A;  4CCK A;  2HDC A;  2A07 F;  2R93 J;  2RRE A;  4BUP A;  3D0S A;  2GOM A;  3RJP A;  4FQG A;  1OYW A;  4LFU A;  5J40 A;  4AM3 A;  3HPH A;  2KLO A;  3BPV A;  3F72 A;  5J47 A;  5C4J J;  2MH9 A;  4E6K G;  2BE5 F;  1T98 A;  4HF2 A;  2ZJR F;  3BTL A;  5ICE A;  3A4C A;  1XG1 A;  4L0Z B;  4OWR B;  2LTP A;  2DMT A;  2O03 A;  3S2D J;  2CFO A;  3DF8 A;  1FYM A;  2E5Z A;  2ESN A; 
#chains in the Genus database with same CATH homology
 2XSD C;  3HOV J;  1P7I A;  1IDY A;  1IUF A;  1H89 C;  2O9L A;  4D5F A;  3HKZ N;  5IOZ A;  2LKX A;  5E3O A;  2MW8 A;  1ZGW A;  2MGQ A;  4BXX J;  1A6I A;  1DU0 A;  1UG2 A;  4DZJ A;  3QPS A;  4A3K J;  2FD5 A;  2EZI A;  2PMZ N;  4FE4 A;  2M0C A;  1FTT A;  2FJ1 A;  1JJ6 C;  4JX5 A;  4NDL A;  4V2F A;  3A01 B;  1U9O A;  2EH3 A;  4UUS B;  5GPA A;  1I50 J;  2MSY A;  1OFC X;  3HOY J;  5K7F A;  3MN2 A;  2Y9Y A;  1GV2 A;  1X2N A;  2X6O A;  4BBS J;  1JKP C;  4LOC A;  3IH4 A;  3IH3 A;  3E7L A;  1E3O C;  1AHD P;  4MIM A;  4DZP A;  4C3I J;  3LSJ A;  2E2I J;  4UUS A;  2GLO A;  4A3G J;  3BTI A;  2H8R A;  3S1R J;  4W97 A;  2JWT A;  4C3J J;  2NVT J;  1MH4 A;  4HNV A;  3ZOB A;  2DA4 A;  2HDD A;  1FIA A;  1MBF A;  5DS9 A;  1WH5 A;  1MBE A;  4M3G A;  3HOX J;  4MLO A;  1QVU A;  3JRD A;  4DYQ A;  5F0H A;  1AKH B;  2H1K A;  3HDD A;  1ETY A;  1WI3 A;  1K61 A;  1VFC A;  1H8A C;  2HI3 A;  3BG5 A;  5J1R A;  3JRH A;  3GTG J;  3BG3 A;  4RDU A;  3L1P A;  4A3E J;  1MBK A;  3ZQH A;  3GTO J;  5EGO B;  2YS9 A;  1T56 A;  3QPL A;  3BR2 A;  3H3V K;  5J3L A;  4M6V A;  5C44 J;  3CQZ J;  1JT0 A;  1NK2 P;  2HXI A;  1IC8 A;  2DMN A;  2NOG A;  3F0C A;  2NVX J;  5JLW A;  2HQ5 A;  1U8B A;  3FIS A;  1R9T J;  5EGO A;  5FKL A;  4XRM A;  1D5Y A;  1JGG A;  1JTY A;  5K7Z A;  1GUU A;  1XC5 A;  1Y1W J;  4DYC A;  2LY9 A;  3S1Q J;  4D7N A;  3G1O A;  4A3D J;  1WGX A;  1MSF C;  2ELK A;  1UMQ A;  2L7F P;  1ETV A;  3ZQG A;  4AC0 A;  2EZK A;  4AYB N;  2DA2 A;  5JLX A;  5IPA A;  2XB0 X;  3JRG A;  2W48 A;  1JTX A;  2LK2 A;  4G12 A;  4X6A J;  1LFB A;  2ME6 A;  1TWF J;  1QVT A;  2M9H A;  4S0H B;  1B72 B;  2R5Y A;  3TW7 A;  1WCM J;  3Q0W A;  4BBR J;  1IJW C;  1X58 A;  5F27 A;  1F43 A;  2AHQ A;  3LOC A;  2Y2Z A;  4A3J J;  1NTC A;  1P7J A;  1JUS A;  2LR8 A;  2L0K A;  1BJZ A;  5E3M A;  2Y9Z A;  3G1L A;  3S14 J;  3LSP A;  2CRG A;  2L7M P;  1JKR C;  2K9S A;  3A03 A;  2JMW A;  4A3F J;  3B6A A;  1U78 A;  5GPC A;  4I76 A;  3S15 J;  1BW5 A;  1LE8 A;  2DA7 A;  2XPW A;  3TW6 A;  4C2M J;  1W0U A;  3GTP J;  2DJN A;  3FK7 A;  3FKI J;  3FIW A;  5E3L A;  5C3E J;  2NS8 A;  3RKQ A;  5IP9 J;  2LD5 A;  2YUS A;  1Q1V A;  2L9R A;  1G2H A;  2DMP A;  2X9D A;  4JYK A;  1ZQ3 P;  2LVS A;  1NK3 P;  4JP0 A;  9ANT A;  5EZG A;  3K2A A;  5EG0 B;  1FIP A;  2OF7 A;  2QCO A;  1HF0 A;  3S2H J;  2CU7 A;  1ZK8 A;  2IBD A;  1MNM C;  1JJ8 C;  1TWH J;  2O7O A;  5IOY A;  1B8I B;  5E3N A;  3A01 A;  1Z0X A;  5FKO A;  4BKX A;  1ZTR A;  5EEA A;  4Y7N J;  5EG0 A;  5IYB J;  3GTL J;  4FTH A;  5M5W J;  2FQ4 A;  3BR1 A;  1HCR A;  4FIS A;  2IAI A;  1ENH A;  1OCP A;  2E19 A;  1FJL A;  1RR7 A;  2ME0 A;  5J1U A;  3OIO A;  4DW6 A;  1BW6 A;  4AUX A;  1B8I A;  2R7Z J;  3M4O J;  1K83 J;  4XID A;  4MFD A;  2DN0 A;  3ZQL A;  2JA8 J;  3D1N I;  3BT9 A;  3H0G J;  2IEK A;  3CDL A;  2GM4 A;  5FKM A;  1IDZ A;  1EF4 A;  4MFE A;  1ETW A;  4I6Z A;  1RKT A;  3GTM J;  2WB1 N;  5BNG A;  2R5Z B;  4A3B J;  2XPV A;  1FEX A;  4ABZ A;  4W1U A;  1HOM A;  1YRN B;  3JRA A;  4L5E A;  2O8K A;  1JUM A;  5EYR A;  2ZB9 A;  1AKH A;  3HOW J;  5C4X J;  1JT6 A;  4IHV A;  3TP0 A;  1MBG A;  2X48 A;  5FKK A;  4J19 A;  4V2G A;  3S17 J;  5IYC J;  2VPR A;  3NAR A;  4MO7 A;  2WAQ N;  1A5J A;  3JRC A;  3GBG A;  1IRZ A;  3QQA A;  2JJ7 A;  3BR3 A;  5EDN A;  2CQQ A;  1VF9 A;  4C3H J;  2XB5 A;  5FLV A;  1MH3 A;  4D5C A;  3IH2 A;  4XRS A;  5EZH A;  2NS7 A;  2CJJ A;  5IP6 A;  3BQZ A;  5HOD A;  3RZD J;  2E2J J;  2E1O A;  1JKQ C;  1VND A;  3SFI A;  1JUP A;  1ORK A;  3JRI A;  3Q0V A;  1H88 C;  2HOA A;  3GTJ J;  4M3B A;  3HOZ J;  2L7Z A;  2P81 A;  2XPU A;  2Y0S N;  2MG4 A;  2JA6 J;  1TWG J;  5F0C A;  4A3M J;  3JR9 A;  5F08 A;  4CYC B;  2M8G X;  5IP7 J;  1GDT A;  5F1J A;  2HOT A;  1F36 A;  1I6H J;  5IYD J;  2DMQ A;  2I10 A;  3PM1 A;  4QTR A;  1OJL A;  1LFU P;  2D5V A;  3TED A;  4XK4 A;  3DCF A;  1B72 A;  1T33 A;  4RBO A;  2VUM J;  3K7A J;  3GTK J;  1PUF B;  4A93 J;  4QIW N;  1IG7 A;  1TWC J;  3PO3 J;  1O4X A;  2WV1 A;  2EBI A;  3CMY A;  2XGC A;  1AU7 A;  1DU6 A;  1SFO J;  4UUT A;  2JN6 A;  3WHC A;  4BY1 J;  2DTZ A;  3OSG A;  1RET A;  2VKV A;  2K9N A;  2LP0 A;  3I4N J;  2COB A;  3LSG A;  4IEJ A;  1ETQ A;  1ETX A;  3O8G A;  3SJM A;  1ZR2 A;  2TCT A;  4JX4 A;  4M3D A;  4FCY A;  1RPW A;  1ETK A;  2TRT A;  1UHS A;  2JA7 J;  1MSE C;  4A3C J;  2XRL A;  2K9Q A;  2JK3 A;  4M3F A;  1ZKG A;  2GBY A;  5M3M J;  1BL0 A;  3SDG A;  3CCY A;  3BG9 A;  2OPT A;  5F0F A;  2DA3 A;  3GTQ J;  1X2M A;  1GV5 A;  2YU9 J;  1S7E A;  2LLK A;  2KDZ A;  3HGY A;  1W0T A;  3JRF A;  3HM5 A;  3HBL A;  3S1N J;  2CQX A;  4JX6 A;  3ZQC A;  3BR5 A;  3Q3S A;  2M34 A;  2DA1 A;  3S1M J;  3I4M J;  3BR0 A;  1WH7 A;  1Y1V J;  5FJ8 J;  1HDP A;  1U9N A;  2CUF A;  1ETO A;  3VPR A;  4IHY A;  3O8H A;  4GFB A;  2K40 A;  1XS9 A;  3S16 J;  2AO9 A;  3M3Y J;  3RQI A;  4DYR A;  2FX0 A;  2XGD A;  2HXO A;  3HGG A;  2RAE A;  4XIC A;  3B6C A;  1QPI A;  2HOS A;  3BQY A;  2EZH A;  1BA5 A;  1APL C;  1HLV A;  3OSF A;  1I3Q J;  3W6V A;  5M3F J;  2DMU A;  3MKL A;  4QSH A;  2R5Z A;  2R92 J;  4D7M A;  1GVD A;  5K7H A;  4B3A A;  2ECC A;  1YRN A;  2JA5 J;  2NVY J;  5F04 A;  3OOU A;  3IV5 A;  4A3I J;  3BTJ A;  2HYJ A;  2ID6 A;  4BY7 J;  1GT0 C;  4B1R A;  1RES A;  4X1E A;  2DA5 A;  5M5Y J;  3ZQF A;  2N8G A;  2ID3 A;  2QF7 A;  1VI0 A;  1RKW A;  4M3E A;  3MVP A;  3JRE A;  4IHX A;  3HOU J;  1POG A;  4XRS G;  4EEF G;  5FLM J;  3HEF A;  1HDD C;  2XGE A;  2CUE A;  2G0E A;  3BR6 A;  2VKE A;  5J1Y A;  3A02 A;  1ITY A;  1TWA J;  3RZO J;  1MBJ A;  1MBH A;  2R0Q C;  2DA6 A;  2M2E A;  3ZQI A;  1TC3 C;  3NAU A;  5M5X J;  2R5Y B;  2ECB A;  5GP9 A;  5EF6 A;  3C2B A;  1QRY A;  4FE7 A;  1JKO C;  2B63 J;  1ZR4 A;  2NVQ J;  1FTZ A;  4Y52 J;  3G1M A;  3TP3 A;  4A69 C;  3PO2 J;  2Y30 A;  3Q0U A;  4CYC A;  2Y31 A;  2LFB A;  3UKG A;  1IV6 A;  1CQT A;  2R93 J;  1IGN A;  3WHB A;  5FKN A;  4A3L J;  3JRB A;  2KT0 A;  1SAN A;  2VI6 A;  5DTD A;  2EZL A;  3DEW A;  3LNQ A;  3BTC A;  1PUF A;  4IHW A;  3LSR A;  1LE8 B;  1OCT C;  2E2H J;  5C4J J;  3BTL A;  1XG1 A;  3HB9 A;  4B4C A;  2LTP A;  2DMT A;  3S2D J;  1WPK A;  2EQR A;  3FK6 A;  1Z77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...