4A3EJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3eJ00
2X9DA 2LKXA 3GTKJ 2ID3A 4M3FA 1VI0A 1HLVA 4Y7NJ 5EEAA 2X48A 3S16J 1VFCA 3PO3J 1WH7A 1IRZA 2DMUA 4BBRJ 2H1KA 2R5ZB 3Q0UA 2AO9A 2M8GX 1IDYA 5FKOA 4A93J 1DU6A 2ELKA 1RR7A 1FTTA 2Y9YA 2LY9A 1RETA 5J1RA 5M5XJ 1W0UA 1ZR2A 2O9LA 1GVDA 2M2EA 3O8HA 4DW6A 2CJJA 4A69C 1XG1A 5JLWA 2GM4A 5EG0A 3OSGA 1WPKA 2CQQA 2MW8A 3A02A 4A3EJ 4BKXA 4BBSJ 4IHXA 3S14J 2CU7A 1JJ8C 3SJMA 5GPAA 1QRYA 2O7OA 5C44J 2FX0A 3A03A 1ORKA 2NOGA 1I50J 3BG9A 3IH2A 2K40A 1GV5A 5IYDJ 3IH3A 1TWCJ 4A3FJ 2COBA 5DS9A 4A3KJ 4LOCA 3A01B 4Y52J 3LSGA 2TCTA 1GUUA 3Q3SA 1F36A 2HDDA 1IJWC 3DCFA 2Y2ZA 2KT0A 2QCOA 2DMPA 1BL0A 3TW7A 5EF6A 3QPLA 2N8GA 3I4NJ 4MO7A 2Y0SN 1S7EA 2G0EA 4QSHA 3B6CA 4BY1J 2R93J 1YRNA 1K83J 1UMQA 1GDTA 1VNDA 1X2MA 1X2NA 3HOXJ 2D5VA 1JGGA 3BQYA 2E2IJ 5IP9J 4W97A 4A3BJ 5F1JA 2HYJA 3BG5A 3GTJJ 3OOUA 4M3BA 2O8KA 4BY7J 1U8BA 2L7FP 3FK6A 1JJ6C 5FKNA 2NS8A 3BT9A 4DYQA 4C3HJ 4AYBN 2HXIA 5EGOA 3FK7A 1O4XA 1MNMC 4D7MA 1WI3A 4UUTA 3CMYA 3M4OJ 1AKHA 4S0HB 4D5CA 4CYCB 1X58A 1EF4A 3BQZA 5K7FA 3D1NI 2ID6A 1G2HA 3LSJA 4DZPA 5M5WJ 2XGDA 1T56A 2CUEA 3JRFA 1POGA 3TEDA 2LTPA 4MIMA 5GP9A 1UHSA 3ZQCA 2HXOA 2HQ5A 1P7JA 5K7HA 1XC5A 5E3MA 1IV6A 2TRTA 2R5YA 2XSDC 2ME6A 3CQZJ 2LK2A 2FJ1A 2VPRA 1U9OA 4FE4A 2DA5A 3HKZN 3SFIA 1HOMA 2VKEA 3ZQHA 1LE8A 4AC0A 1RKTA 2PMZN 5J1UA 3BR5A 3G1MA 2YUSA 4B4CA 3FIWA 3MN2A 4I76A 2LFBA 4M3EA 4JYKA 4DYCA 4A3GJ 1IUFA 2EZKA 5IP7J 3HGYA 5IYCJ 3JRDA 3S1QJ 3LOCA 1ETKA 4A3JJ 4ABZA 1FIPA 2XGCA 1JKQC 2JWTA 1U9NA 5C3EJ 2L7ZA 4UUSA 1JKPC 2DA2A 1JUPA 2EBIA 1YRNB 2ZB9A 2RAEA 4CYCA 2DA7A 4DYRA 3JRHA 2K9NA 5E3OA 1SFOJ 1W0TA 2HOSA 3RKQA 4JX5A 3M3YJ 3BG3A 2NVQJ 2DMTA 3OSFA 1FEXA 1B72A 1OCTC 1VF9A 1BW6A 3O8GA 1H8AC 3UKGA 2CRGA 2DA6A 2GLOA 2Y9ZA 1ITYA 1ZK8A 3DEWA 2EZLA 3HM5A 3VPRA 4IEJA 1LFBA 2H8RA 4FTHA 2DMNA 5FLMJ 1OJLA 1HCRA 5J1YA 3CDLA 2NVTJ 1ETQA 2M34A 4FE7A 5EGOB 4HNVA 2WV1A 3W6VA 1WH5A 1AKHB 3LSPA 4IHVA 2YU9J 3GTQJ 4G12A 3ZQLA 1FTZA 2EZIA 3HOUJ 2ME0A 3BR1A 1Z77A 1AU7A 4GFBA 3BR0A 3PO2J 4JX4A 2LD5A 5C4JJ 5JLXA 1TWHJ 1R9TJ 1IDZA 1PUFA 1MBHA 1H88C 4J19A 2R0QC 1FIAA 4IHYA 1MSEC 2R5YB 1QVUA 1JTYA 4X1EA 3JRCA 2QF7A 3S1MJ 1ETYA 4XK4A 2Y30A 3S1NJ 1AHDP 1HDDC 2LR8A 2CQXA 1F43A 2K9QA 5BNGA 4I6ZA 1LE8B 5IP6A 3S15J 2X6OA 3HOWJ 3NARA 2VI6A 3FISA 2HOAA 3JRBA 3RZOJ 1P7IA 3S17J 2LP0A 3CCYA 3BTCA 4FCYA 5F0HA 3NAUA 5GPCA 1ZQ3P 1TWAJ 4UUSB 2Y31A 5DTDA 5IOYA 2JMWA 1FJLA 4MLOA 3Q0WA 2JJ7A 2ECBA 4W1UA 5F27A 1WCMJ 3F0CA 1JT0A 1UG2A 1JTXA 3B6AA 1B72B 1OCPA 2MGQA 5FJ8J 2K9SA 4D7NA 3MKLA 5EDNA 1XS9A 3Q0VA 2IBDA 3FKIJ 4M6VA 1U78A 3BR2A 4XIDA 3S1RJ 1QVTA 1OFCX 3MVPA 3TW6A 1K61A 3BTLA 2XB0X 1ZGWA 1B8IA 3S2HJ 1I6HJ 1BW5A 1RESA 4V2GA 4X6AJ 2I10A 1IC8A 5EZHA 3G1LA 1MBKA 3JRAA 3K7AJ 4AUXA 2EH3A 1GT0C 2DN0A 1TWFJ 3SDGA 2MSYA 5IPAA 2JA7J 1HDPA 1JUSA 3RZDJ 3HOVJ 4C3JJ 4D5FA 2DMQA 1RPWA 5FLVA 2IEKA 2JK3A 4MFDA 4XRSG 1I3QJ 5IYBJ 3HEFA 2L7MP 4B3AA 3JRIA 1PUFB 3ZQIA 1GV2A 3GBGA 4IHWA 1MBGA 1ETVA 5F08A 5FKMA 4M3GA 2JA8J 3G1OA 3H3VK 1ETOA 2XPUA 3HBLA 1MH4A 2EZHA 1JKRC 1TWGJ 5E3NA 3K2AA 4L5EA 1MBEA 3QPSA 2CUFA 3S2DJ 4BXXJ 2XRLA 1A6IA 3H0GJ 4QTRA 2AHQA 2E1OA 4V2FA 1A5JA 2L9RA 3WHBA 2OF7A 4QIWN 2DA3A 1Q1VA 2FD5A 4B1RA 3L1PA 2WB1N 3E7LA 1MBJA 1Z0XA 2LLKA 5IOZA 1BA5A 2E2HJ 2M0CA 4NDLA 2E19A 1Y1WJ 2JN6A 4MFEA 2DA1A 2DTZA 2GBYA 3RQIA 4RDUA 3BTJA 1D5YA 2IAIA 2ECCA 3BR3A 4C2MJ 2R92J 2DA4A 3HOZJ 1NTCA 2R5ZA 1H89C 5F04A 1BJZA 4XICA 5C4XJ 2EQRA 1ETWA 2DJNA 2XPWA 1ZTRA 1T33A 5M5YJ 3I4MJ 3ZQGA 1MSFC 5K7ZA 4JP0A 5HODA 2NVYJ 4XRMA 1B8IB 2L0KA 2JA6J 3IH4A 5FKKA 4C3IJ 2B63J 3GTGJ 2P81A 3PM1A 5E3LA 5M3FJ 1MH3A 3OIOA 1DU0A 4RBOA 3ZOBA 1IGNA 1CQTA 4DZJA 1ZKGA 3WHCA 2YS9A 2XPVA 3JRGA 4A3MJ 1WGXA 1RKWA 3QQAA 3JREA 1MBFA 2HOTA 4XRSA 3HOYJ 2WAQN 3HDDA 2VUMJ 3GTMJ 5EYRA 2HI3A 4M3DA 3ZQFA 1Y1VJ 4A3IJ 1JKOC 2NVXJ 2E2JJ 2R7ZJ 1ETXA 1NK3P 3HGGA 1TC3C 4A3DJ 3IV5A 3GTLJ 3TP0A 4A3CJ 2LVSA 3BR6A 1ENHA 2NS7A 1APLC 5F0CA 3LNQA 2XGEA 5FKLA 1IG7A 2XB5A 2MG4A 2JA5J 1HF0A 3C2BA 4EEFG 3JR9A 3A01A 1LFUP 1SANA 2OPTA 3GTPJ 3GTOJ 3HB9A 1JT6A 4A3LJ 5EZGA 5F0FA 5J3LA 3TP3A 9ANTA 5EG0B 3LSRA 2FQ4A 2M9HA 1JUMA 4JX6A 5M3MJ 2VKVA 1ZR4A 1QPIA 3BTIA 1E3OC 2KDZA 4FISA 1NK2P 2W48A
chains in the Genus database with same CATH superfamily
2MLKA 4LD5A 5LBQA 2ID3A 4M3FA 4Z6YA 4Y7NJ 5EEAA 3KE2A 1ZG3A 3DEUA 2CO5A 2JT1A 5D6EA 4BJTA 3CLQA 1PYVA 1WSUA 2OTJI 4IHTA 4BJ6C 2ZJPF 2TDXA 3RPUA 1U5TB 4A93J 4XNFA 3S8PA 1XMXA 2ELKA 2CFXA 2FRHA 5L3FA 2Y9YA 1P6RA 1BJAA 2HOEA 3I4PA 4O3MA 4NC7A 4YG2F 3V4GA 1TT0A 1YYVA 5M5XJ 1X19A 1VQOI 1ZR2A 2OZUA 1GVDA 2LF8A 2O9LA 3FZVA 2R7VA 1IV8A 4NHJA 2HVSA 2CJJA 3CMMA 3KP3A 5JLWA 1P9QC 1EV7A 1GLNA 2OUMA 1G8XA 3WTWC 5IT9K 2L5QA 2LBFA 5F64A 3OSGA 4ZYAA 1QGPA 2CQQA 3GXOA 1T38A 4G6QA 4IHXA 1BM9A 3S14J 3BCBA 1R5ID 1ZRDA 1JJ8C 2IGOA 4HLYA 3QP6A 1PUEE 1Y8QB 1UAAA 2QVOA 3A03A 1ORKA 1R4NB 3HSRA 3IH2A 3FM3A 4C9YA 5KHDA 4L5IA 3QRFF 3LSTA 5IYDJ 2CW0F 3KZYA 1DGWY 4KIBA 4N9IA 2H1LA 4N4NB 4LOCA 2RDPA 2OBPA 1Z9CA 1BI0A 1QHGA 1FOWA 4E7ZA 1YTYA 5H6RA 4DGWB 3PIPF 2A07F 2RVCA 5L3DA 2F6CA 2ZMEB 2DMPA 3E6DA 2O5RA 1FYKA 4B43A 2VN2A 4KA4A 3TW7A 3H3ZA 2BXZA 2NRAC 2CQKA 1O7LA 3I58A 3K4CA 3I4NJ 4HZFA 3E3VA 2PMHA 2FBIA 2Y0SN 4I09A 3B6CA 2R93J 3OYJA 2Q0OA 1X2MA 1IRFA 5ILVA 3M7GA 3HOXJ 2MBFA 3WTZA 2O8XA 3BQYA 4E4HA 3I55I 5HOOA 3E6BA 4HNUA 2F5EA 4LLNA 3KX2A 5F1JA 3ISPA 1O3SA 4M3BA 2EIMH 4HSTA 4LGWA 2KPMA 2EV0A 2VT3A 2NS8A 2HZDA 2K85A 3EQLF 4N0BA 1I27A 1T0FA 2I8DA 2KLOA 4HG2A 1CGPA 2PFBA 3VYRB 4D7MA 1WI3A 4UUTA 5FGMA 1LVKA 2YSRA 3M1CA 1AKHA 1P4AA 3CDIA 4ENJA 1B59A 5LHGA 2DW4A 2HYFA 2DTRA 3MD2A 1X58A 3K4JA 3TO9A 2LBFB 1YIJI 3BQZA 5K7FA 1G2HA 2YX7A 1VQ7I 4RAZA 4XR6A 4HPQA 4DIQA 2LTPA 1P7JA 3PFYA 4RMNA 3HRUA 4RLFA 3SHFA 3PJRA 1XGMA 1A6QA 3EUAA 1I3AA 2KIUA 2R5YA 1BR4A 5E8IA 3C7JA 4CZCA 1U8RA 1T39A 1U3EM 3ZRGA 4UVCA 2HVRA 3CJTB 1VQ9I 1U9OA 1BIAA 4L9VA 3BPVA 3ZQHA 4AC0A 3L9FA 3T0YA 3MWMA 2PMZN 5J1UA 3G1MA 1UHWA 2Y0SA 2A61A 3ESWB 4FT8A 4A3GJ 2EZKA 4XKBA 3WGGA 1PDNC 4E7KA 2L7ZA 5L3GA 4V19K 2HVQA 1WFXA 3GZNB 4AIJA 1ZAOA 2RNGA 3BOQA 4DYRA 3DBHB 3DTIA 1F5TA 2V1UA 3FXJA 3LFKA 4PJLA 3F21A 3RKQA 4LLGF 2DMTA 2NVQJ 2A6HF 1B72A 1OCTC 3W2AA 3NRVA 1H8AC 3SZTA 3UKGA 3OS0A 3ZMTA 2ZJ2A 2JVHA 2GLOA 3AG4H 2P6TA 3E5QA 3BC8A 2HPMA 5LGNA 1ITYA 3E5UA 2E36A 4HX8A 1TZLA 3PUBA 1VTNC 1FBQA 3DEEA 3UR3C 3L2QA 2ZSHB 2L4AA 4XOTA 1EH6A 2VJ4A 2H8RA 1FSHA 4HX7A 2DMNA 1MNEA 5FLMJ 1Q1HA 1HCRA 5J1YA 2QZ8A 3KEOA 4I02A 3ROUA 2VBZA 3F9KA 2VE8A 3MMYB 4LLLA 1D8KA 3IWZA 3QWLA 3J80Z 1FBSA 4CYDA 1AKHB 3D5SC 3LSPA 1I39A 4F7ZA 1FTZA 2VXDA 2ME0A 4WX9A 3BR1A 3LAJA 3PO2J 2PJPA 3CCQI 2E71A 5L3BA 3L2UA 4IL6C 3KEQA 4ESBA 4AIKA 1R9TJ 2W4SA 4NC8A 3HC7A 1NG6A 1MBHA 2P7CB 1H88C 4J19A 1FIAA 2PMZA 5GTHC 2R5YB 2FOKA 2DT6A 1ETYA 2VQHA 2DYSH 5ED4A 1XMAA 4CHUA 2XF7A 1HDDC 2LR8A 2CQXA 1F43A 4N9HA 3W6JB 1KU9A 2UUZA 3NARA 2F4MB 2R7DA 3FHZA 4IJAA 3KP4A 3OYBA 1IRGA 4FETA 2VIXA 5JFRA 4O5VA 4M74A 3V7RA 3BTCA 5J4YA 2GXBA 4I7HA 1JHHA 4NC6A 3A0HC 2NNYA 4WWCA 4WF2A 4YFKF 2IXSA 2JMWA 4KMUX 4MLOA 2QSFX 5CYVA 3MAJA 3ZN0A 1WCMJ 5FO5A 1QBJA 2VB6A 1UG2A 1BI2A 1G3WA 2ESNA 2NXNB 3ZP5A 2JVGA 3RYRA 1B72B 2H27A 5FJ8J 3NWTA 4ON0A 4BQOA 1KGSA 1X1PA 3CDHA 3FWEA 3JCUC 3Q0VA 2ZSIB 5JR3A 1XS9A 1RUOA 1R23A 1R22A 4A2UA 1U78A 1O3TA 3QP5A 1QHHD 3BR2A 1TQIA 3F6VA 3MVPA 4M9XA 4IOCF 2L2OA 2XB0X 1FOYA 3TOAA 3ZQ7A 2VPLA 3ABUA 5EZHA 3QYEA 1YI2I 1XDUA 2XHKA 3JRAA 1FSEA 2EFNA 4AUXA 4IOAF 1TWFJ 2V79A 3SDGA 2MSYA 3QODA 2Q2EB 4U87A 2XF6A 2X51A 4B47A 1FZPB 3H9GA 1TQMA 1K79A 4ZDPA 3WTXC 2Y69H 2V9PA 2IEKA 2L9VA 4MFDA 3WTUC 3U9GA 3HEFA 2MYSA 1XGSA 3MZ8A 2Q8KA 5L3EA 2P4WA 1ZGJA 3DQVC 1AWCA 4KMFA 1TQPA 1WJFA 1GV2A 2HS5A 2MD5A 3DBLB 3R0AA 3VODA 3GBGA 1OLTA 2YU3A 1ETVA 2EA2A 2E7XA 2FNPA 2ESHA 5FKMA 2Z3YA 1X3WB 4KFCA 1ETOA 2XPUA 4B8XA 2PG4A 1MH4A 5J4VA 3GFMA 3OL3A 5E3NA 1REPC 3LSHA 1GXPA 5CVIA 1YJWI 1J0RA 1A5JA 2EV5A 3J81Z 2IT0A 5E1ZB 2L9RA 4K2EA 3WHBA 3FXUA 4XLNF 5LHHA 1UZCA 4U0WA 2EA4A 1T95A 4B1RA 3WG9A 3E7LA 4CCNA 3VB2A 2FQ3A 3GVAA 1G3TA 1ULYA 4JBAA 2V9KA 3MFKA 3S3OA 5HS8A 5FRNA 1LEAA 1WJBA 5CQGA 1KONA 1P4WA 3F8FA 4MFEA 1HA8A 1IO2A 2DA1A 2DTZA 1LNWA 3RKYA 2PQ8A 1NTCA 5DUIA 5F04A 3R60A 4LFUA 5CVVA 2EQRA 1X4PA 1WWXA 1Z3YA 4Y13A 4MHGA 1ZTRA 3F3XA 2CSOA 4EJTA 3WU2C 5K7ZA 3WODF 2HFHA 3BROA 3CUQC 4KITB 5HODA 2VONA 3SEQA 3ZMDA 3R6SA 3JTHA 2JA6J 3IH4A 4XKCA 2BOLA 3HPGA 5FKKA 4C3IJ 3RI4A 3DU6A 3BJOA 2FA5A 3P7NA 2L9NA 2P81A 2GOMA 1S5LC 1MH3A 3OIOA 4BHBA 2V6CA 2W84A 2WC2A 4F92B 4FQGA 4LB6B 1ZKGA 3KP2A 3WHCA 1FOKA 5D5XB 1RKWA 5GAGJ 1MBFA 2BY1A 4G8XA 4XRSA 1VQ8I 3HOYJ 2WAQN 3CUOA 3HDDA 3K0LA 4J01A 1W5TA 1V5FA 5EYRA 3ZQFA 4IRIA 3OIPA 4A5NA 4U88A 4XRFA 1QO0D 3HGGA 4OMZA 3LAPA 4CCMA 3IV5A 1O3RA 2FMYA 2E35A 3BR6A 4G6TB 4B09A 4OAZA 3DTEA 2QQ9A 2XB5A 1A35A 4EEFG 1MGTA 3JR9A 4IHSA 3A01A 1MDMA 2M0MA 3BPXA 2VJJA 3H35A 3DLLF 1IN7A 3WU0A 2Y75A 4A3LJ 2ZJQF 4GXOA 9ANTA 4BEHA 3HSFA 3ZGKA 5EG0B 2GIZA 3CF2A 2M9HA 2KDZA 2HTJA 1R58A 1HW5A 2KHMA 3CJQB 3J7AY 1ZR4A 5D6FA 3R61A 2EFPA 1E3OC 1NK2P 2DQLA 4A12A 3GTKJ 3FMSA 1K6YA 4EM2A 2X48A 3H0DA 2XDVA 2IGMA 1PP8F 3OV8A 2JZYA 5DV5A 3HRTA 3F8MA 3FMRA 3DBRB 4BBRJ 1OYWA 2DXIA 3OR2C 2D1VA 1U5TC 4DQ2A 1NHAA 1TNSA 3F8NA 2Z9OA 1YO5C 2F4OB 1A04A 3CMEI 2E1NA 2EINH 1OKRA 2LY9A 3LMMA 2K3FA 3BZ6A 3GZ5A 2L02A 3GX4X 3DP7A 4M9ZA 1YHQI 3M8FA 5LGUA 3O8HA 4KN4X 1DP3A 1IW7F 4U0YA 1N75A 2VOPA 5BMZA 1GXQA 4KUMA 1FWZA 2EIJH 3BY6A 5D5VB 4EJOA 3N4MA 3CC7I 1S3JA 4I0AA 1LJ9A 2UXXA 1V54H 2GM4A 1Z6RA 2GXAA 1WPKA 1I5ZA 2KRFA 1IRXA 2DDBA 4LB5A 3GFLA 4BKXA 4BBSJ 4LG0A 3E0JB 2CU7A 2QQ8A 3SJMA 2D45A 5GPAA 1QRYA 4LIUA 1RR8C 1D0YA 2FX0A 2M45A 2FBKA 2ISYA 3ASNH 1J2XA 4BUPA 1K78B 2DOFA 2M87A 3BG9A 2VQGA 2M7BA 3ZR8X 2RN7A 5DCMA 1MW7A 3RTRA 4E7SA 1GV5A 2DODA 2BY0A 2MH9A 3PNVA 5EEGA 3H36A 1SFEA 3BP8A 2ZFWA 2COBA 2AS5F 4X0GA 3K4BA 3A01B 1MDMB 1IAWA 4KN7X 3LSGA 1W7PD 2E5ZA 2QQBA 2LSOA 2QKMB 1F36A 4ETSA 3DFGA 3G73A 5EJCA 3B02A 2PBIA 2DFFA 3DCFA 4XLEA 3ECHA 4BEHB 2E5NA 2KIQA 3CCMI 1QZYA 1BL0A 5EF6A 3K1NA 1HKTA 2N8GA 3LA3A 1S7EA 2G0EA 1TW3A 3S2WA 3PQJA 2RV8A 2OQGA 4Q4ZF 3BJ6A 3HKZA 1GDTA 2WWYA 1X2NA 5HLGA 3ASOH 4NUBA 4E7HA 1ZRFA 3LSKA 2D5VA 1VZ0A 4WXHA 4NNJA 3L2WA 4GGGA 3TKYA 4B48A 1SFXA 2K27A 3WTVC 4Q48A 4XLAA 5HDGA 2HYJA 2KJBA 3OOUA 2XAJA 2QSGX 2FU4A 1U8BA 1IN6A 2COMA 4LK1F 2BW3A 2DK5A 3H9QA 1BC8C 1VQ6I 3GLLA 1QZZA 2HGCA 4B3XA 4QPQA 3M8EA 4DYQA 2JUCA 1B4AA 3C1DA 1JXSA 1LB2A 2O6GE 3I0TA 3FK7A 1O4XA 3AL0B 3PNTA 4XBFA 2O0YA 4ZYGA 2ZFUA 3K4NA 4S0HB 1X1BA 1JE8A 3H1CA 4CYCB 2ZMEA 3IL2A 2P5VA 2M1BA 3F8BA 3JSOA 4BQQA 2IA0A 3BJAA 3TL4X 3LQRA 3TO6A 4RLQA 1MKMA 2M4GA 3L7WA 1R71A 4DZPA 1FC3A 3OS2A 1WJCA 1T56A 4UVBA 1O57A 4LG0B 2JQ7A 4MIMA 1OYIA 3ZQCA 2HQ5A 5K7HA 2M4KA 1XC5A 1E3HA 2EFOA 3LQQA 3OYIA 2LK2A 3BLYA 2FJ1A 5DCMB 2F5CA 1ZELA 3LFUA 2VPRA 2K7LA 3P9CA 3CTAA 4I0BA 1HOMA 2RQPA 2XF5A 3CD6I 4Q5SF 1RKTA 1SVMA 1T2KA 2VBYA 1RI7A 4BACA 2A6TA 3FIWA 4B4CA 4I76A 1ZLKA 3LSMA 2R7TA 5DD4A 5IY5H 5IYCJ 3LOCA 1ETKA 2DQRA 4ABZA 4U7BA 1FIPA 3KPHA 3PL8A 2QUFA 3FM5A 3TDZC 3OL4A 3CJNA 1U9NA 2JPBA 4M6XA 3EPZA 5C3EJ 1QA6A 4J00A 1JKPC 2EK5A 3CJRB 1SFUA 4F55A 3CCEI 3DTKA 1R6RA 2DA7A 3E97A 4KYWA 3P9IA 3WE2A 1M1EB 1SFOJ 4OINF 3PFIA 1R4MB 4P1WA 5KAFC 2H09A 4BS9A 1FEXA 5FFZA 3H9JA 2KP6A 1STZA 1W5SA 3O8GA 2YR2A 5A2QZ 2CRGA 1P4XA 3R0JA 2DA6A 5CJ9A 1YG2A 4GYGA 1TW2A 2HYGD 2BVLA 2Y9ZA 3FXOA 2X85A 3DEWA 5FB2A 3OYNA 4IX7A 1J9IA 2OV7A 3VPRA 2F48A 2BW3B 3EUKL 1LFBA 5D8LB 2UV1A 2CS3A 4IQJA 4DJAA 4U0VA 1T0FC 3EDPA 3TBIA 3CDLA 3CLOA 2NVTJ 2JUGA 2M34A 4FE7A 3GO5A 2L3DA 3SXYA 1T8IA 2WV1A 3HL2A 1IN5A 1LDKB 1KQ8A 3ZMZA 1ZHFA 2W57A 2XRNA 4KJZA 3K70C 3GTQJ 4G12A 4B44A 3ZQLA 4XMYA 2VE9A 3K2ZA 2IGKA 2O3FA 4AIHA 1Z77A 1AU7A 3DKYA 3L00A 4JX4A 5C4JJ 2M8EA 2K4JA 1FYLA 2R7SA 2ELHA 4MEXF 5DM7F 2DPDA 4PJMA 1B9MA 2R0QC 1LPQA 1Z21A 2P5KA 2NVUB 2BHYA 1LQ1A 4UHTA 3X2QH 4X1EA 3IRRA 4HV6A 3JRCA 1A31A 2VQLA 4BE1A 3DKWA 3AG3H 4G9YA 4XK4A 1BR1A 2L4MA 3MEXA 3KIOA 1ZGAA 4RGXA 4ZZDA 4BDYA 4TV7A 1X4OA 5BNGA 3RDIA 4I6ZA 2X6OA 2ZBKA 3JRBA 3RZOJ 2VC1A 5DDGA 1XN7A 4LIVA 1P7IA 5B1AH 1BOBA 1PP7U 3S17J 2LP0A 3NAUA 1KU7A 1OPCA 2V1NA 1ZG5A 2XAUA 4RM2A 1R1TA 3FBIB 4HF1A 2HWVA 4ZH4F 1UFMA 4R79A 1FJLA 1ONVA 4ZDOA 2JJ7A 2ECBA 4W1UA 5F27A 3K10A 4UV9A 4KT6A 4C2TA 3F0CA 1IF1A 3DPUA 3SDBA 1XSXA 4FHTA 2MGQA 5CVRA 1W36C 2K9SA 3FX3A 3MKLA 4D7NA 4WXDA 3H5AA 4ZYHA 4EV0A 4XIDA 5FD5A 2EIKH 4F3QA 1OFCX 2MFZA 1K61A 1V5EA 1U2WA 3BTLA 3MQ0A 5DYMA 2IA2A 2LNBA 3C3WA 1I6HJ 5D4SA 4V2GA 2RREA 4CZZA 1IC8A 2RGVA 2R7QA 3H3UA 5D5WB 3JSPA 3VSLA 1Z67A 2Z1DA 2JA7J 4HEA2 1HDPA 2PI0A 1YITI 3HOVJ 4D5FA 2V26A 2JK3A 1WJDA 4XRSG 4HV5A 2BY2A 1FPQA 1G6NA 1MMSA 4MTEA 3ZQIA 4YELA 2IS2A 1XCBA 2VJIA 4LK0F 2ZXIA 1U0JA 2F5FA 4M3GA 2KZGA 3BWGA 3OYHA 1JKRC 3J7AO 1MMDA 2KDOA 4L5EA 4YIRX 2CUFA 3EETA 4HRIA 2QEXI 2XAGA 2V1XA 3H0GJ 4QTRA 2E1OA 3RIRA 2HU9A 3ABKH 4CCJA 1IN4A 5TJJA 3J80K 3QU6A 3IKTA 3CCRI 4QIWN 2DA3A 3CMAI 2VT2A 2FMLA 1BBYA 2ZKZA 4HLXA 4YIIA 4EM1A 1S9HA 2X4HA 1Z0XA 2LLKA 4I01A 4Y33A 5IOZA 2CV0A 1SVLA 3BZCA 2E1MB 2E2HJ 3M9AA 3S32A 2P7VB 2A69F 2X6WA 2Q2EA 4LG3A 3I54A 1GVJA 2GBYA 2GWRA 3V8LA 3BTJA 3GCMA 3GW2A 2AXTC 2IAIA 3FHNA 1IXSB 4S05A 2R92J 2R5ZA 5TRDA 2LREA 2P6SA 2DCEA 2DJNA 2XPWA 2RC4A 1I1SA 3A2KA 4CICA 2HDCA 3IAS2 3I4MJ 3VDXA 3RCOA 1VQPI 2MC3A 2XKOA 3PQKA 1PVEA 5LEJA 1B6AA 1T6SA 4XLFA 1Z1DA 2OU2A 5EEHA 3GTGJ 5M3FJ 3SZPA 5E3LA 5GTIC 4FX4A 1DU0A 3EYYA 2R7FA 2NOJB 1ODDA 3KP5A 3BDDA 3QYFA 3VYSB 5AONA 1XSVA 1WZ2A 1V55H 2CFOA 2X6XA 2HKXA 3KLOA 1KQ9A 2HOTA 1KZHA 2VLAA 4LMYA 2JRMA 3EUHA 4OAYA 3F23A 3OWTA 2HI3A 1Y1VJ 2CH0A 4A3IJ 4PUSA 3KYCB 4ZJZA 2K4BA 3VYUB 4BH9A 1OR7A 1TC3C 4A3DJ 1ZH5A 2AXLA 3GTLJ 4A3CJ 4AVZA 4HYEA 2NS7A 1APLC 1S7AA 2CQ7A 3LNQA 3A0BC 5FKLA 2MG4A 1O7FA 1JHFA 3CP2A 2Y0MA 3FMQA 2H94A 4S04A 2OCCH 2OPTA 2DDAA 2L9SA 4CCOA 1LFUP 3GTPJ 3GTOJ 2PJRB 3PNYA 4BQNA 3CF5F 2ZC2A 2E34A 3AG2H 1XX5A 2UZKA 3OMYA 2DLLA 4Y15A 2OAZA 2DOEA 2L01A 4JX6A 5M3MJ 2XV4S 3SYTA 1DPUA 1UJ8A 6PAXA 2GIVA 3QYBA 2XAHA 4WCGA 4L9TA 1YQAA 2LKXA 1X1DA 2DBBA 3Q9SA 4E6KG 5K5RA 1FLIA 2CW7A 4CH7A 4F93B 4ESJA 2BBYA 4U7DA 1WJ5A 4F52A 3W2VA 2KFDA 4MEYF 2R7WA 4EGZA 2DMUA 2EV6A 2QKLB 4ZTJA 1ZRCA 2H1KA 1IRZA 2OQRA 2R5ZB 1SMYF 2AO9A 3GF2A 3ML6A 3IWFA 1IDYA 5CVJA 2FBHA 2G7UA 2MC4A 3CCUI 3MZHA 4OIRF 1FTTA 2FUG2 3J81K 4FX0A 2MLGA 4ESFA 4L0ZB 1YIOA 2X1CA 3P5JA 4QPOA 3F8CA 1BI1A 5LFAA 2DI3A 1LKXA 2M2EA 5FD6A 3O3KA 4RAFA 3AAFA 3QPHA 3RPQA 2WADA 2PX9A 1Z3XA 1XG1A 3HJEA 2XROA 1WJEA 5EG0A 1EH8A 2WA0A 4A3EJ 2MW8A 5CVUA 1MJBA 3P9KA 2Y48A 4ZDLA 2JRTA 1QQIA 3O6BB 1EA3A 1JGSA 4AYBA 4L0YB 2NOGA 4EJUA 5B66C 2K40A 4IKFA 4BE2A 4HOBA 2R7XA 3IH3A 4A3FJ 3V7CA 5BPIA 4MNUA 3HTSB 3TO7A 2KMUA 2TCTA 4R8HA 4AD9A 3L2CA 1XMKA 1HKSA 2HDDA 3GMEA 2BGCA 1SMTA 3HHGA 3K1PA 4BYYA 4L18B 2QCOA 2KRHA 3DU5A 3ABMH 4XONA 1ON1A 2OZ6A 4PK4A 3RYPA 1X3ZB 2BY3A 3ABTA 5FLXZ 4BY1J 3GLXA 1K83J 1W7PA 2IJLA 2YX4A 2K3PA 3E6CC 2ETHA 1VNDA 1DDNA 3HUGA 1R36A 3OYLA 2IVMA 3JAMZ 1JGGA 1VQMI 2FF4A 1SAUA 1H9GA 4W97A 3UNGC 2QLZA 4N4OB 1TP4A 4MGRA 1ZG1A 4HDVA 1P92A 3BG5A 1K78A 2O8KA 2G7HA 3ERED 2L7FP 3M07A 3N05A 3BT9A 3JW4A 3HRSA 2W25A 3AL0C 5J6XA 5EGOA 2F2EA 2XAFA 2CG4A 3BCAA 3CMYA 1OMIA 3O2PE 1R1UA 4NB5A 4PJNA 1LVAA 3VYTB 4D5CA 4NQWA 3WG7H 2R4GA 4PGGA 2KRCA 3FXKA 2Q1ZB 5HVQC 3D1NI 2ID6A 3LSJA 4HAMA 3FF5A 3HPHA 1IXCA 2XGDA 2CUEA 2IW5A 3JRFA 3TEDA 1FT9A 1OCOH 5GP9A 2EPFA 4BHCA 4OIPF 1K6OA 3K4MA 3JTGA 4RB3C 5E3MA 1IV6A 3K6GA 2XGXA 2R3SA 2CV2A 4KT5C 5E1WA 2XSDC 2XVCA 3GYHX 4UXNA 3CQZJ 4YIFA 1WHUA 1X3UA 2ZNYA 1MJAA 4FE4A 3FDYA 2DA5A 1YX5A 2OD5A 3HKZN 2RKHA 3V7SA 5L3CA 2RNJA 1C0WA 4C2UA 3J7YJ 1ZREA 3OYMA 4F91B 5CLSA 2QA4I 3BR5A 2GA1A 2YUSA 1XGOA 2LYCA 2LFBA 5HDKA 2BEOA 4OWRB 4DYCA 4BAYA 4G7OF 1IUFA 5IP7J 3I53A 3HGYA 3S1QJ 1R00A 4A3JJ 3CCLI 2ACJA 1S29A 1JKQC 2JWTA 3EYIA 3CCSI 1G3SA 4RAGA 1VQ4I 4UUSA 2LG4A 1D5VA 1N78A 2DA2A 1JUPA 2LH9A 1HW1A 1W7PB 2DFIA 4UB6C 5F6FA 4CYCA 4IO9F 3JRHA 2K9NA 3F6OA 3HUGB 5E3OA 5JVGF 2NYXA 1DP7P 1W0TA 2HOSA 3F22A 3M3YJ 3BG3A 3VWBA 3U2RA 4AIDA 3OS1A 3HOSA 1BW6A 1R5HA 4D1QA 1P2FA 3CC2I 1MIJA 3CP8A 3CC4I 2QSHX 1Z7LA 2EZLA 5KAIC 1IZ1A 3T5XA 3HM5A 3OIQA 2BHZA 2ZXHA 3OYFA 1T08B 4IEJA 3QU3A 4FTHA 3KYLA 3AKZA 1G3YA 4XOPA 2VXZA 3ONQA 1VQLI 2KL4A 1EH7A 2V9VA 5EGOB 2NNNA 1MNDA 3D5RC 1AOYA 1T98A 2QBYA 3W6VA 1WH5A 1V4RA 3GWZA 4IHVA 2ZMEC 4C30A 2YU9J 4E7IA 4ASNA 4NQWB 2EZIA 2BVMA 3HYIA 3V8JA 5HLTA 4IZZA 1KYWA 2ZXWH 4PJ0C 4PZJA 2X1DA 4GFBA 2FSWA 2LD5A 5DCFA 4HA8A 3WE3A 3GZ6A 2IS4A 1TWHJ 3SZGA 1IDZA 1PUFA 2V6EA 2W00A 2M3AA 1O3QA 5LHIA 3OOPA 1MSEC 4IRHA 2E7WA 1WRJA 3S1NJ 2Y30A 4BDZA 1ZLJA 2HEOA 1AHDP 1VQ5I 1IN8A 5IP6A 3S15J 3COAC 2VI6A 4YFXF 1YE9A 2OCEA 2XASA 1F9NA 4CCLA 2LY1A 2WBMA 3LL7A 4XKWA 1RIOH 4FCYA 4D0PA 2G9WA 2D2WA 4I99C 5GPCA 1ZQ3P 1W1WE 4L5JA 4UUSB 4H0EA 3BG7A 3OYCA 2LRDA 2CW8A 1BC7C 2HKOA 3IKVA 4LITA 2R7UA 2A3SA 3Q0WA 5ICCA 3MKWB 3QPTA 1KYZA 2E1CA 4HDUA 5GADJ 4Q47A 4OOIA 1V5GA 2LDUA 1LFPA 3B6AA 2ADUA 4A0YA 5FRMA 2IPQX 2K02A 1D1CA 2CYYA 4RS8A 1S8NA 4G94A 5EDNA 1S7OA 5LRSA 2HZTA 3FKIJ 2WB1A 2NAZA 3S1RJ 1QVTA 1J7KA 1YS6A 3TW6A 3I64A 1TT5B 2VKDA 3S2HJ 1BW5A 4L9NA 1PJRA 3CZ6A 1RESA 4PDKA 5JVTA 4XSZF 4EQQA 1HW2A 2NS0A 1MBKA 1YLFA 2QBYB 3GEZA 1YS7A 1UELB 1GT0C 4RGRA 2DN0A 2DYRH 5D5UB 5IPAA 3WGIA 3G71I 1Y39A 1MJ9A 1JUSA 2JSPA 5B1BH 3RZDJ 2HDWA 2EB7A 2EFQA 3FXLA 4EGYA 1SD5A 2M7AA 2AQEA 5FLVA 4GO1A 3WGHA 2EFWA 1I3QJ 4HF0A 2L7MP 5A2QK 1YJ9I 4RGSA 3JRIA 1XCVA 1PUFB 3G6EI 2XIGA 3C18A 2BV6A 1F4KA 1LUJB 1BOAA 1KA8A 3H3VK 3G1OA 3KYDB 3HBLA 2EZHA 4HW0A 1TWGJ 2WY8Q 1WI9A 4Y4RA 1OCCH 2DPUA 3ZXSA 4DOZA 3S2DJ 2XRLA 4BXXJ 1A6IA 2FE3A 1FMVA 3FXQA 1EKEA 2AHQA 3DWLE 4V2FA 3WU1B 1NH3A 2Z99A 4ITVA 2OF7A 4PFOA 3E5XA 3IP4B 4RM3A 4CGZA 3NWSA 3KZZA 2Z5UA 3IC7A 3L1PA 5K5QA 4A5MA 2OC6A 2E1MC 2DT7B 4IQ4A 1AA7A 4M73A 4RB0A 1XPXA 1L3LA 1ACIA 4NDLA 2E19A 2DK8A 5IT9Z 3V42A 2JN6A 3RQIA 3MCZA 5TGTA 3MKZA 1E17A 3BR3A 4C2MJ 4NBQA 2KZVA 3DPTA 1K4SA 3I56I 3HOZJ 2STWA 5KK1A 1H89C 1R5GA 3NQOA 1BJZA 1ETWA 3HTUA 4EM0B 2W24A 4WK8F 1T33A 3H92A 2ZJRF 1KU2A 3ZQGA 4XL9A 3J7ZI 2GA2A 2X6YA 2XKPA 1KU3A 3W6KB 2H6CA 3DKXA 5HLIA 5DM6F 2IP2A 4PGHA 3HOTA 4E7JA 2B63J 2HQRA 3A4CA 4JQFA 3M8JA 3PM1A 5HS7A 4E70A 2R7RA 1KQ0A 4P9UA 4RBOA 3ZOBA 1IGNA 4Y3OA 2A5WA 2J5OA 4DZJA 1DUXC 5B3SH 1WGXA 3C2HA 3QQAA 1OYYA 3SEZA 1RUNA 5AIPA 1TL8A 3D0SA 4BHPA 4M3DA 2XAQA 1JKOC 5BPDA 2E2JJ 1ETXA 2KIMA 1NK3P 3QOPA 5B5EC 2JSCA 5JI6A 4RB2C 2W7NA 1D0ZA 1ENHA 3CCVI 2A68F 5F0CA 2XGEA 1IG7A 3HSEA 2JA5J 1HF0A 3C2BA 3DPLC 1N77A 3I3LA 3ULQB 1I6XA 1E3PA 4D9JA 2L54A 3HB9A 4II2A 3OYEA 1JT6A 1Y6IA 2ELJA 3DF8A 1R49A 2IS1A 5J3LA 3G3ZA 1UG0A 2PLYA 2MA3A 3LSRA 3VFZA 2VBXA 2FEZA 1JUMA 5JHUA 2CMPA 2VKVA 1QPIA 2VOOA 5CKTA 3I9V2 3RPUD 1K4TA 2W48A 2X9DA 4UVAA 4Z2YA 1X1AA 4UY8I 4HSRA 2MABA 4WXCA 1VI0A 1HLVA 1USTA 4ENKA 1V3FA 3S16J 3H5RA 1VFCA 3PO3J 5DD8A 1WH7A 2GAUA 1I1GA 4UNOA 1XB4A 4I2OA 2J5PA 3Q0UA 1S72I 3TDUC 2M8GX 3RKWA 5FKOA 1DU6A 2QQAA 3CESA 1TNTA 5J8CA 1UB9A 1G4DA 1Z6TA 3ZCOA 3H5NA 1RR7A 2VC0A 1RETA 1UCRA 3DXJF 3A1YA 5J1RA 4EVIA 1W0UA 4RA2A 2ISZA 1B1BA 2AQFA 3ZMVA 3REOA 4DW6A 4ZYDA 1S6LA 4DBQA 2PJRA 4A69C 2WY7Q 4DNCA 3QOEA 3A02A 1YX3A 3EUHC 1HSJA 3U1DA 4L9JA 1MD0A 1RZ4A 1FYMA 3MZYA 4EATA 2V4JC 2WAEA 2O7OA 2H8WA 1OR7C 3SQNA 5C44J 3KETA 3Q5FA 2ICWG 5HS9A 5JHFA 1JI8A 1I50J 4M71A 3ZQQA 1Z7UA 2CQNA 4UB8C 1DPRA 3ERMA 4CXFA 2ZO4A 5E1XA 2CWEA 3I59A 1TWCJ 4EMSA 1H0MA 1IUYA 3G4SI 3V8KA 5DS9A 5HLHA 3K4LA 4DBRA 1J59A 4A3KJ 4Y52J 1W5CC 2ZNZA 4ENMA 3ECOA 3I5UA 1GUUA 3Q3SA 2YPRA 2L7KA 4XM3A 1RNLA 1IJWC 2CUJA 2Y2ZA 2KT0A 2STTA 1MMGA 2O03A 5LRRA 2IGNA 4QWQA 4OIQF 5DEQA 3QPLA 2FNAA 2JA2A 4MO7A 1OISA 4UV8A 4QSHA 4RB1A 1YRNA 1J75A 1LEBA 1UMQA 1ERDA 2W85A 3GFIA 1DGRM 2B9SA 5DUKA 3IAM2 3NEUA 4ZC3A 2HR3A 4BGDA 2QENA 2X0LA 4XLCA 2W82A 2F4IA 2E2IJ 5E17F 5IP9J 4GYIA 2M30A 5GAEJ 4M72A 4A3BJ 4IXAA 3TMOA 5AIQA 3E1SA 1SD4A 3GTJJ 4G7ZF 3OR1C 4BY7J 1BIBA 3DV8A 3K70D 4R1HA 3FK6A 1JJ6C 2Z33A 5FKNA 2X1EA 1XSDA 1OCRH 2XC7A 1TBXA 4II3A 3C2GA 5J8FA 4C3HJ 3LA7A 2B0LA 2HXIA 4AYBN 1WQ2A 5LD2C 2LOOA 1MNMC 4Y17A 4BU2A 4ANJA 2O61A 4IVNA 3M4OJ 2DFEA 4XN3A 3R4KA 4KICA 3D5LA 3IUOA 3SFZA 3PSIA 3IRQA 4OU0A 3FBNB 3U1KA 1EF4A 3ABLH 4CA0A 3ZMSA 2Z2SB 5M5WJ 1OCZH 1Y56A 1POGA 1MZBA 2KIFA 1UHSA 2HXOA 3OY9A 1ZN2A 5ICFA 2TRTA 2CV1A 4P55A 2VASA 1SD7A 2ME6A 4PJJA 4H4KC 1N25A 3I59B 2UWMA 2HNHA 3SFIA 3S93A 2VKEA 5LLQA 1LE8A 1ON2A 5CQEA 5HNHA 4XSXF 3MN2A 4M3EA 4JYKA 3K4KA 3JRDA 1YW7A 1IXRC 3ZPLA 1ZYRF 4MTDA 3G2BA 2XGCA 3HXLA 4IF4A 2GOXB 3OYGA 5FROA 3F72A 1SD6A 3CCJI 1QNTA 2XUBA 1W36D 2EJRA 4BL0B 2EBIA 1YRNB 2ZB9A 2HQAA 2RAEA 1SFKA 5FFXA 4PSWA 1CF7A 4BNCA 4I98B 5E79C 5K5OA 1MMAA 4KIGA 2OTLI 4JX5A 3OSFA 4HF2A 1VF9A 5KNLA 4OIOF 1XTAA 4BE0A 1QPMA 1YOVB 1XD7A 2KISA 4YRVA 1ZK8A 1W4MA 3HRMA 3KLNA 5KVRA 3FXMA 4HX4A 1SVOA 1FNNA 5F1RA 1YJNI 5ICGA 3FKJA 1OJLA 1LDJA 3K9TA 3KFWX 4M9SA 1RRJA 4BXFA 1ETQA 3HZJA 5BQTA 4HNVA 3VSKA 1D1BA 2A6EF 2V1DA 2H6BA 5FLXK 2K5CA 4XN0A 1FX7A 1E0EA 4ZTFA 4RGUA 2WV0A 2P5LC 3HOUJ 1QU3A 1H9TA 3WTSC 3S3MA 1D3YA 4CSWA 3JAMK 2DT5A 3BR0A 1FY7A 4A0ZA 1U6GA 2LC2A 5JLXA 1FP1D 3PUFA 1GHCA 4O6JA 4OMYA 4IHYA 2F5VA 1QVUA 1JTYA 2IS6A 2QF7A 1HQCA 1Z05A 1F1ZA 3S1MJ 2LKSA 2W1OA 2WAFA 3RQ4A 4KISA 4G6DA 1RC9A 1QZEA 5LEKA 2VBWA 2E60A 2K9QA 1FOXA 1LE8B 2DJIA 4XQFA 3HOWJ 3FISA 2HOAA 3HHHA 2P0WA 4BQAA 2FXAA 2Z16A 2IA1A 1HSTA 2K9MA 5TISC 4ZZLA 2BZTA 2ZXJA 3CCYA 5ICEA 2K9LA 5F0HA 2GXGA 3IHUA 4P9FA 1D0XA 1TWAJ 2JPCA 2FOWA 1R7JA 2Y31A 3BZKA 4XKVA 5DTDA 1K7AA 1TLHB 5IOYA 5D4RA 1CF7B 1X1CA 5ILSA 4A6DA 2I5UA 1JT0A 4GCVA 1JTXA 4FASD 2LKPA 5H6QA 3S3NA 1OCPA 1YW9A 4G7HF 1UHMA 2MH2A 2VODA 4HNTA 5K1YA 1WVRA 2IBDA 4M6VA 2KQRA 4XORA 2DU9A 2V7FA 3KP7A 1OQYA 3B73A 2VKHA 2JTVA 1ZGWA 5ILUA 1B8IA 5E20A 3CUQA 2CUZA 4KDPA 4X6AJ 2I10A 3G1LA 3L2VA 1ZARA 3K7AJ 1EJ9A 2EH3A 3KP6A 1YW8A 4QLCU 2LMDA 5H2FC 2BXYA 1FBUA 4C3JJ 3W3CA 1XGNA 4P5OA 4AM3A 2DMQA 1Y0NA 4BJ5C 1RPWA 3T8RA 3TOBA 3DLAA 2EWNA 5IYBJ 1L0OC 3ZN1A 2DFHA 3L09A 4B3AA 3PIOF 5GAHJ 3T1BA 4A0XA 4HQMA 2QWWA 2WTEA 3TGNA 4EJVA 2MD0A 4IHWA 1MBGA 2HPIA 1Y8RB 3W2WA 1D8JA 5F08A 3E6MA 2JA8J 4AVPA 1A36A 4PSXA 2UXNA 4MQ9F 1BI3A 3HG9A 3K2AA 2A5YB 3RJPA 1E2XA 1MBEA 3QPSA 3RKXA 4YFNF 4KNYA 1DQUA 3GUDA 5J47A 2WAQA 4PFPA 2BYVE 2DO7A 1FP2A 3ZMUA 5LGTA 2VJ5A 1SAXA 1Q1VA 5IT3A 2C6YA 2FD5A 4MQVA 3GFJA 2WB1N 4LJZF 1MBJA 4A6EA 2HTSA 5H20A 3BG6A 3WTYC 3LWFA 4IPAA 4KIFA 4M6YA 4RAYA 1BA5A 2M0CA 1BN5A 1LDDA 3AFHA 3I71A 3TQNA 1HXDA 3QAHA 2PEXA 1Y1WJ 5D8KB 1B9NA 1YFHA 4RDUA 4ENNA 1D5YA 2ECCA 2GZWA 1VQNI 5J40A 2DA4A 1USSA 2F5DA 2PN6A 2DOAA 2GQQA 2A05A 4XICA 5C4XJ 1BR2A 2DAOA 5KCMA 1U5TA 3RSNA 4JK1X 2EILH 5M5YJ 5BOXA 4YEJA 2RQQA 2KJCA 3KEYA 3N97A 1MSFC 1SEUA 3LSIA 4JP0A 2NVYJ 3AG1H 4XRMA 1B8IB 2M5WA 2L0KA 2VL8A 2LY2A 2P8TA 3CUQB 3K1MA 4CO8A 3MKYB 2CGPA 2XSJC 2IRFG 4P96A 3K69A 2LF7A 5BS6A 2B7EA 1D1AA 4CCKA 4CUGA 1CQTA 2PMUA 3FXRA 4IRGA 4XLPF 1NG7A 3Q9VA 2YS9A 4HBLA 3OYAA 2XPVA 4JOMA 2OJED 3JRGA 4A3MJ 1HBXG 2QM3A 1Z91A 3JREA 1G59A 4GRIA 4GDFA 2VQCA 4AWXB 4PCQA 2VUMJ 3GTMJ 2D1HA 3M1EA 1J09A 2NVXJ 1WKMA 2R7ZJ 3CO7C 4EJWA 5HDNA 5CPRB 3PSFA 3U21A 4CDGA 3T8TA 5E18F 3TP0A 2R7OA 2LVSA 1HKQA 3VOEA 3KZIC 5E8GA 1MMNA 3ELKA 5HNFA 2ZCWA 3VEPA 1WJAA 3OYDA 1R1VA 4E7LA 4BXUA 4XLHA 2BE5F 1FMWA 2HQNA 1SANA 1J5YA 4ZYEA 3CO6C 3OYKA 4HQEA 1HC8A 1TTYA 2K86A 3LA2A 5EZGA 1SC7A 2QGUA 5ERIA 2OA4A 5F0FA 3TP3A 1VQKI 1Y0UA 3L2RA 3WTTC 2FQ4A 2KKOA 3HIFA 4AU7A 4UUVA 3BTIA 3KCCA 1XDSA 4FISA 2QYOA
chains in the Genus database with same CATH topology
2X9DA 2LKXA 3GTKJ 2ID3A 4M3FA 1VI0A 1HLVA 4Y7NJ 5EEAA 2X48A 3S16J 1VFCA 3PO3J 1WH7A 1IRZA 2DMUA 4BBRJ 2H1KA 2R5ZB 3Q0UA 2AO9A 2M8GX 1IDYA 5FKOA 4A93J 1DU6A 2ELKA 1RR7A 1FTTA 2Y9YA 2LY9A 1RETA 5J1RA 5M5XJ 1W0UA 1ZR2A 2O9LA 1GVDA 2M2EA 3O8HA 4DW6A 2CJJA 4A69C 1XG1A 5JLWA 2GM4A 5EG0A 3OSGA 1WPKA 2CQQA 2MW8A 3A02A 4A3EJ 4BKXA 4BBSJ 4IHXA 3S14J 2CU7A 1JJ8C 3SJMA 5GPAA 1QRYA 2O7OA 5C44J 2FX0A 3A03A 1ORKA 2NOGA 1I50J 3BG9A 3IH2A 2K40A 1GV5A 5IYDJ 3IH3A 1TWCJ 4A3FJ 2COBA 5DS9A 4A3KJ 4LOCA 3A01B 4Y52J 3LSGA 2TCTA 1GUUA 3Q3SA 1F36A 2HDDA 1IJWC 3DCFA 2Y2ZA 2KT0A 2QCOA 2DMPA 1BL0A 3TW7A 5EF6A 3QPLA 2N8GA 3I4NJ 4MO7A 2Y0SN 1S7EA 2G0EA 4QSHA 3B6CA 4BY1J 2R93J 1YRNA 1K83J 1UMQA 1GDTA 1VNDA 1X2MA 1X2NA 3HOXJ 2D5VA 1JGGA 3BQYA 2E2IJ 5IP9J 4W97A 4A3BJ 5F1JA 2HYJA 3BG5A 3GTJJ 3OOUA 4M3BA 2O8KA 4BY7J 1U8BA 2L7FP 3FK6A 1JJ6C 5FKNA 2NS8A 3BT9A 4DYQA 4C3HJ 4AYBN 2HXIA 5EGOA 3FK7A 1O4XA 1MNMC 4D7MA 1WI3A 4UUTA 3CMYA 3M4OJ 1AKHA 4S0HB 4D5CA 4CYCB 1X58A 1EF4A 3BQZA 5K7FA 3D1NI 2ID6A 1G2HA 3LSJA 4DZPA 5M5WJ 2XGDA 1T56A 2CUEA 3JRFA 1POGA 3TEDA 2LTPA 4MIMA 5GP9A 1UHSA 3ZQCA 2HXOA 2HQ5A 1P7JA 5K7HA 1XC5A 5E3MA 1IV6A 2TRTA 2R5YA 2XSDC 2ME6A 3CQZJ 2LK2A 2FJ1A 2VPRA 1U9OA 4FE4A 2DA5A 3HKZN 3SFIA 1HOMA 2VKEA 3ZQHA 1LE8A 4AC0A 1RKTA 2PMZN 5J1UA 3BR5A 3G1MA 2YUSA 4B4CA 3FIWA 3MN2A 4I76A 2LFBA 4M3EA 4JYKA 4DYCA 4A3GJ 1IUFA 2EZKA 5IP7J 3HGYA 5IYCJ 3JRDA 3S1QJ 3LOCA 1ETKA 4A3JJ 4ABZA 1FIPA 2XGCA 1JKQC 2JWTA 1U9NA 5C3EJ 2L7ZA 4UUSA 1JKPC 2DA2A 1JUPA 2EBIA 1YRNB 2ZB9A 2RAEA 4CYCA 2DA7A 4DYRA 3JRHA 2K9NA 5E3OA 1SFOJ 1W0TA 2HOSA 3RKQA 4JX5A 3M3YJ 3BG3A 2NVQJ 2DMTA 3OSFA 1FEXA 1B72A 1OCTC 1VF9A 1BW6A 3O8GA 1H8AC 3UKGA 2CRGA 2DA6A 2GLOA 2Y9ZA 1ITYA 1ZK8A 3DEWA 2EZLA 3HM5A 3VPRA 4IEJA 1LFBA 2H8RA 4FTHA 2DMNA 5FLMJ 1OJLA 1HCRA 5J1YA 3CDLA 2NVTJ 1ETQA 2M34A 4FE7A 5EGOB 4HNVA 2WV1A 3W6VA 1WH5A 1AKHB 3LSPA 4IHVA 2YU9J 3GTQJ 4G12A 3ZQLA 1FTZA 2EZIA 3HOUJ 2ME0A 3BR1A 1Z77A 1AU7A 4GFBA 3BR0A 3PO2J 4JX4A 2LD5A 5C4JJ 5JLXA 1TWHJ 1R9TJ 1IDZA 1PUFA 1MBHA 1H88C 4J19A 2R0QC 1FIAA 4IHYA 1MSEC 2R5YB 1QVUA 1JTYA 4X1EA 3JRCA 2QF7A 3S1MJ 1ETYA 4XK4A 2Y30A 3S1NJ 1AHDP 1HDDC 2LR8A 2CQXA 1F43A 2K9QA 5BNGA 4I6ZA 1LE8B 5IP6A 3S15J 2X6OA 3HOWJ 3NARA 2VI6A 3FISA 2HOAA 3JRBA 3RZOJ 1P7IA 3S17J 2LP0A 3CCYA 3BTCA 4FCYA 5F0HA 3NAUA 5GPCA 1ZQ3P 1TWAJ 4UUSB 2Y31A 5DTDA 5IOYA 2JMWA 1FJLA 4MLOA 3Q0WA 2JJ7A 2ECBA 4W1UA 5F27A 1WCMJ 3F0CA 1JT0A 1UG2A 1JTXA 3B6AA 1B72B 1OCPA 2MGQA 5FJ8J 2K9SA 4D7NA 3MKLA 5EDNA 1XS9A 3Q0VA 2IBDA 3FKIJ 4M6VA 1U78A 3BR2A 4XIDA 3S1RJ 1QVTA 1OFCX 3MVPA 3TW6A 1K61A 3BTLA 2XB0X 1ZGWA 1B8IA 3S2HJ 1I6HJ 1BW5A 1RESA 4V2GA 4X6AJ 2I10A 1IC8A 5EZHA 3G1LA 1MBKA 3JRAA 3K7AJ 4AUXA 2EH3A 1GT0C 2DN0A 1TWFJ 3SDGA 2MSYA 5IPAA 2JA7J 1HDPA 1JUSA 3RZDJ 3HOVJ 4C3JJ 4D5FA 2DMQA 1RPWA 5FLVA 2IEKA 2JK3A 4MFDA 4XRSG 1I3QJ 5IYBJ 3HEFA 2L7MP 4B3AA 3JRIA 1PUFB 3ZQIA 1GV2A 3GBGA 4IHWA 1MBGA 1ETVA 5F08A 5FKMA 4M3GA 2JA8J 3G1OA 3H3VK 1ETOA 2XPUA 3HBLA 1MH4A 2EZHA 1JKRC 1TWGJ 5E3NA 3K2AA 4L5EA 1MBEA 3QPSA 2CUFA 3S2DJ 4BXXJ 2XRLA 1A6IA 3H0GJ 4QTRA 2AHQA 2E1OA 4V2FA 1A5JA 2L9RA 3WHBA 2OF7A 4QIWN 2DA3A 1Q1VA 2FD5A 4B1RA 3L1PA 2WB1N 3E7LA 1MBJA 1Z0XA 2LLKA 5IOZA 1BA5A 2E2HJ 2M0CA 4NDLA 2E19A 1Y1WJ 2JN6A 4MFEA 2DA1A 2DTZA 2GBYA 3RQIA 4RDUA 3BTJA 1D5YA 2IAIA 2ECCA 3BR3A 4C2MJ 2R92J 2DA4A 3HOZJ 1NTCA 2R5ZA 1H89C 5F04A 1BJZA 4XICA 5C4XJ 2EQRA 1ETWA 2DJNA 2XPWA 1ZTRA 1T33A 5M5YJ 3I4MJ 3ZQGA 1MSFC 5K7ZA 4JP0A 5HODA 2NVYJ 4XRMA 1B8IB 2L0KA 2JA6J 3IH4A 5FKKA 4C3IJ 2B63J 3GTGJ 2P81A 3PM1A 5E3LA 5M3FJ 1MH3A 3OIOA 1DU0A 4RBOA 3ZOBA 1IGNA 1CQTA 4DZJA 1ZKGA 3WHCA 2YS9A 2XPVA 3JRGA 4A3MJ 1WGXA 1RKWA 3QQAA 3JREA 1MBFA 2HOTA 4XRSA 3HOYJ 2WAQN 3HDDA 2VUMJ 3GTMJ 5EYRA 2HI3A 4M3DA 3ZQFA 1Y1VJ 4A3IJ 1JKOC 2NVXJ 2E2JJ 2R7ZJ 1ETXA 1NK3P 3HGGA 1TC3C 4A3DJ 3IV5A 3GTLJ 3TP0A 4A3CJ 2LVSA 3BR6A 1ENHA 2NS7A 1APLC 5F0CA 3LNQA 2XGEA 5FKLA 1IG7A 2XB5A 2MG4A 2JA5J 1HF0A 3C2BA 4EEFG 3JR9A 3A01A 1LFUP 1SANA 2OPTA 3GTPJ 3GTOJ 3HB9A 1JT6A 4A3LJ 5EZGA 5F0FA 5J3LA 3TP3A 9ANTA 5EG0B 3LSRA 2FQ4A 2M9HA 1JUMA 4JX6A 5M3MJ 2VKVA 1ZR4A 1QPIA 3BTIA 1E3OC 2KDZA 4FISA 1NK2P 2W48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9D A;  2LKX A;  3GTK J;  2ID3 A;  4M3F A;  1VI0 A;  1HLV A;  4Y7N J;  5EEA A;  2X48 A;  3S16 J;  1VFC A;  3PO3 J;  1WH7 A;  1IRZ A;  2DMU A;  4BBR J;  2H1K A;  2R5Z B;  3Q0U A;  2AO9 A;  2M8G X;  1IDY A;  5FKO A;  4A93 J;  1DU6 A;  2ELK A;  1RR7 A;  1FTT A;  2Y9Y A;  2LY9 A;  1RET A;  5J1R A;  5M5X J;  1W0U A;  1ZR2 A;  2O9L A;  1GVD A;  2M2E A;  3O8H A;  4DW6 A;  2CJJ A;  4A69 C;  1XG1 A;  5JLW A;  2GM4 A;  5EG0 A;  3OSG A;  1WPK A;  2CQQ A;  2MW8 A;  3A02 A;  4A3E J;  4BKX A;  4BBS J;  4IHX A;  3S14 J;  2CU7 A;  1JJ8 C;  3SJM A;  5GPA A;  1QRY A;  2O7O A;  5C44 J;  2FX0 A;  3A03 A;  1ORK A;  2NOG A;  1I50 J;  3BG9 A;  3IH2 A;  2K40 A;  1GV5 A;  5IYD J;  3IH3 A;  1TWC J;  4A3F J;  2COB A;  5DS9 A;  4A3K J;  4LOC A;  3A01 B;  4Y52 J;  3LSG A;  2TCT A;  1GUU A;  3Q3S A;  1F36 A;  2HDD A;  1IJW C;  3DCF A;  2Y2Z A;  2KT0 A;  2QCO A;  2DMP A;  1BL0 A;  3TW7 A;  5EF6 A;  3QPL A;  2N8G A;  3I4N J;  4MO7 A;  2Y0S N;  1S7E A;  2G0E A;  4QSH A;  3B6C A;  4BY1 J;  2R93 J;  1YRN A;  1K83 J;  1UMQ A;  1GDT A;  1VND A;  1X2M A;  1X2N A;  3HOX J;  2D5V A;  1JGG A;  3BQY A;  2E2I J;  5IP9 J;  4W97 A;  4A3B J;  5F1J A;  2HYJ A;  3BG5 A;  3GTJ J;  3OOU A;  4M3B A;  2O8K A;  4BY7 J;  1U8B A;  2L7F P;  3FK6 A;  1JJ6 C;  5FKN A;  2NS8 A;  3BT9 A;  4DYQ A;  4C3H J;  4AYB N;  2HXI A;  5EGO A;  3FK7 A;  1O4X A;  1MNM C;  4D7M A;  1WI3 A;  4UUT A;  3CMY A;  3M4O J;  1AKH A;  4S0H B;  4D5C A;  4CYC B;  1X58 A;  1EF4 A;  3BQZ A;  5K7F A;  3D1N I;  2ID6 A;  1G2H A;  3LSJ A;  4DZP A;  5M5W J;  2XGD A;  1T56 A;  2CUE A;  3JRF A;  1POG A;  3TED A;  2LTP A;  4MIM A;  5GP9 A;  1UHS A;  3ZQC A;  2HXO A;  2HQ5 A;  1P7J A;  5K7H A;  1XC5 A;  5E3M A;  1IV6 A;  2TRT A;  2R5Y A;  2XSD C;  2ME6 A;  3CQZ J;  2LK2 A;  2FJ1 A;  2VPR A;  1U9O A;  4FE4 A;  2DA5 A;  3HKZ N;  3SFI A;  1HOM A;  2VKE A;  3ZQH A;  1LE8 A;  4AC0 A;  1RKT A;  2PMZ N;  5J1U A;  3BR5 A;  3G1M A;  2YUS A;  4B4C A;  3FIW A;  3MN2 A;  4I76 A;  2LFB A;  4M3E A;  4JYK A;  4DYC A;  4A3G J;  1IUF A;  2EZK A;  5IP7 J;  3HGY A;  5IYC J;  3JRD A;  3S1Q J;  3LOC A;  1ETK A;  4A3J J;  4ABZ A;  1FIP A;  2XGC A;  1JKQ C;  2JWT A;  1U9N A;  5C3E J;  2L7Z A;  4UUS A;  1JKP C;  2DA2 A;  1JUP A;  2EBI A;  1YRN B;  2ZB9 A;  2RAE A;  4CYC A;  2DA7 A;  4DYR A;  3JRH A;  2K9N A;  5E3O A;  1SFO J;  1W0T A;  2HOS A;  3RKQ A;  4JX5 A;  3M3Y J;  3BG3 A;  2NVQ J;  2DMT A;  3OSF A;  1FEX A;  1B72 A;  1OCT C;  1VF9 A;  1BW6 A;  3O8G A;  1H8A C;  3UKG A;  2CRG A;  2DA6 A;  2GLO A;  2Y9Z A;  1ITY A;  1ZK8 A;  3DEW A;  2EZL A;  3HM5 A;  3VPR A;  4IEJ A;  1LFB A;  2H8R A;  4FTH A;  2DMN A;  5FLM J;  1OJL A;  1HCR A;  5J1Y A;  3CDL A;  2NVT J;  1ETQ A;  2M34 A;  4FE7 A;  5EGO B;  4HNV A;  2WV1 A;  3W6V A;  1WH5 A;  1AKH B;  3LSP A;  4IHV A;  2YU9 J;  3GTQ J;  4G12 A;  3ZQL A;  1FTZ A;  2EZI A;  3HOU J;  2ME0 A;  3BR1 A;  1Z77 A;  1AU7 A;  4GFB A;  3BR0 A;  3PO2 J;  4JX4 A;  2LD5 A;  5C4J J;  5JLX A;  1TWH J;  1R9T J;  1IDZ A;  1PUF A;  1MBH A;  1H88 C;  4J19 A;  2R0Q C;  1FIA A;  4IHY A;  1MSE C;  2R5Y B;  1QVU A;  1JTY A;  4X1E A;  3JRC A;  2QF7 A;  3S1M J;  1ETY A;  4XK4 A;  2Y30 A;  3S1N J;  1AHD P;  1HDD C;  2LR8 A;  2CQX A;  1F43 A;  2K9Q A;  5BNG A;  4I6Z A;  1LE8 B;  5IP6 A;  3S15 J;  2X6O A;  3HOW J;  3NAR A;  2VI6 A;  3FIS A;  2HOA A;  3JRB A;  3RZO J;  1P7I A;  3S17 J;  2LP0 A;  3CCY A;  3BTC A;  4FCY A;  5F0H A;  3NAU A;  5GPC A;  1ZQ3 P;  1TWA J;  4UUS B;  2Y31 A;  5DTD A;  5IOY A;  2JMW A;  1FJL A;  4MLO A;  3Q0W A;  2JJ7 A;  2ECB A;  4W1U A;  5F27 A;  1WCM J;  3F0C A;  1JT0 A;  1UG2 A;  1JTX A;  3B6A A;  1B72 B;  1OCP A;  2MGQ A;  5FJ8 J;  2K9S A;  4D7N A;  3MKL A;  5EDN A;  1XS9 A;  3Q0V A;  2IBD A;  3FKI J;  4M6V A;  1U78 A;  3BR2 A;  4XID A;  3S1R J;  1QVT A;  1OFC X;  3MVP A;  3TW6 A;  1K61 A;  3BTL A;  2XB0 X;  1ZGW A;  1B8I A;  3S2H J;  1I6H J;  1BW5 A;  1RES A;  4V2G A;  4X6A J;  2I10 A;  1IC8 A;  5EZH A;  3G1L A;  1MBK A;  3JRA A;  3K7A J;  4AUX A;  2EH3 A;  1GT0 C;  2DN0 A;  1TWF J;  3SDG A;  2MSY A;  5IPA A;  2JA7 J;  1HDP A;  1JUS A;  3RZD J;  3HOV J;  4C3J J;  4D5F A;  2DMQ A;  1RPW A;  5FLV A;  2IEK A;  2JK3 A;  4MFD A;  4XRS G;  1I3Q J;  5IYB J;  3HEF A;  2L7M P;  4B3A A;  3JRI A;  1PUF B;  3ZQI A;  1GV2 A;  3GBG A;  4IHW A;  1MBG A;  1ETV A;  5F08 A;  5FKM A;  4M3G A;  2JA8 J;  3G1O A;  3H3V K;  1ETO A;  2XPU A;  3HBL A;  1MH4 A;  2EZH A;  1JKR C;  1TWG J;  5E3N A;  3K2A A;  4L5E A;  1MBE A;  3QPS A;  2CUF A;  3S2D J;  4BXX J;  2XRL A;  1A6I A;  3H0G J;  4QTR A;  2AHQ A;  2E1O A;  4V2F A;  1A5J A;  2L9R A;  3WHB A;  2OF7 A;  4QIW N;  2DA3 A;  1Q1V A;  2FD5 A;  4B1R A;  3L1P A;  2WB1 N;  3E7L A;  1MBJ A;  1Z0X A;  2LLK A;  5IOZ A;  1BA5 A;  2E2H J;  2M0C A;  4NDL A;  2E19 A;  1Y1W J;  2JN6 A;  4MFE A;  2DA1 A;  2DTZ A;  2GBY A;  3RQI A;  4RDU A;  3BTJ A;  1D5Y A;  2IAI A;  2ECC A;  3BR3 A;  4C2M J;  2R92 J;  2DA4 A;  3HOZ J;  1NTC A;  2R5Z A;  1H89 C;  5F04 A;  1BJZ A;  4XIC A;  5C4X J;  2EQR A;  1ETW A;  2DJN A;  2XPW A;  1ZTR A;  1T33 A;  5M5Y J;  3I4M J;  3ZQG A;  1MSF C;  5K7Z A;  4JP0 A;  5HOD A;  2NVY J;  4XRM A;  1B8I B;  2L0K A;  2JA6 J;  3IH4 A;  5FKK A;  4C3I J;  2B63 J;  3GTG J;  2P81 A;  3PM1 A;  5E3L A;  5M3F J;  1MH3 A;  3OIO A;  1DU0 A;  4RBO A;  3ZOB A;  1IGN A;  1CQT A;  4DZJ A;  1ZKG A;  3WHC A;  2YS9 A;  2XPV A;  3JRG A;  4A3M J;  1WGX A;  1RKW A;  3QQA A;  3JRE A;  1MBF A;  2HOT A;  4XRS A;  3HOY J;  2WAQ N;  3HDD A;  2VUM J;  3GTM J;  5EYR A;  2HI3 A;  4M3D A;  3ZQF A;  1Y1V J;  4A3I J;  1JKO C;  2NVX J;  2E2J J;  2R7Z J;  1ETX A;  1NK3 P;  3HGG A;  1TC3 C;  4A3D J;  3IV5 A;  3GTL J;  3TP0 A;  4A3C J;  2LVS A;  3BR6 A;  1ENH A;  2NS7 A;  1APL C;  5F0C A;  3LNQ A;  2XGE A;  5FKL A;  1IG7 A;  2XB5 A;  2MG4 A;  2JA5 J;  1HF0 A;  3C2B A;  4EEF G;  3JR9 A;  3A01 A;  1LFU P;  1SAN A;  2OPT A;  3GTP J;  3GTO J;  3HB9 A;  1JT6 A;  4A3L J;  5EZG A;  5F0F A;  5J3L A;  3TP3 A;  9ANT A;  5EG0 B;  3LSR A;  2FQ4 A;  2M9H A;  1JUM A;  4JX6 A;  5M3M J;  2VKV A;  1ZR4 A;  1QPI A;  3BTI A;  1E3O C;  2KDZ A;  4FIS A;  1NK2 P;  2W48 A; 
#chains in the Genus database with same CATH topology
 2MLK A;  4LD5 A;  5LBQ A;  2ID3 A;  4M3F A;  4Z6Y A;  4Y7N J;  5EEA A;  3KE2 A;  1ZG3 A;  3DEU A;  2CO5 A;  2JT1 A;  5D6E A;  4BJT A;  3CLQ A;  1PYV A;  1WSU A;  2OTJ I;  4IHT A;  4BJ6 C;  2ZJP F;  2TDX A;  3RPU A;  1U5T B;  4A93 J;  4XNF A;  3S8P A;  1XMX A;  2ELK A;  2CFX A;  2FRH A;  5L3F A;  2Y9Y A;  1P6R A;  1BJA A;  2HOE A;  3I4P A;  4O3M A;  4NC7 A;  4YG2 F;  3V4G A;  1TT0 A;  1YYV A;  5M5X J;  1X19 A;  1VQO I;  1ZR2 A;  2OZU A;  1GVD A;  2LF8 A;  2O9L A;  3FZV A;  2R7V A;  1IV8 A;  4NHJ A;  2HVS A;  2CJJ A;  3CMM A;  3KP3 A;  5JLW A;  1P9Q C;  1EV7 A;  1GLN A;  2OUM A;  1G8X A;  3WTW C;  5IT9 K;  2L5Q A;  2LBF A;  5F64 A;  3OSG A;  4ZYA A;  1QGP A;  2CQQ A;  3GXO A;  1T38 A;  4G6Q A;  4IHX A;  1BM9 A;  3S14 J;  3BCB A;  1R5I D;  1ZRD A;  1JJ8 C;  2IGO A;  4HLY A;  3QP6 A;  1PUE E;  1Y8Q B;  1UAA A;  2QVO A;  3A03 A;  1ORK A;  1R4N B;  3HSR A;  3IH2 A;  3FM3 A;  4C9Y A;  5KHD A;  4L5I A;  3QRF F;  3LST A;  5IYD J;  2CW0 F;  3KZY A;  1DGW Y;  4KIB A;  4N9I A;  2H1L A;  4N4N B;  4LOC A;  2RDP A;  2OBP A;  1Z9C A;  1BI0 A;  1QHG A;  1FOW A;  4E7Z A;  1YTY A;  5H6R A;  4DGW B;  3PIP F;  2A07 F;  2RVC A;  5L3D A;  2F6C A;  2ZME B;  2DMP A;  3E6D A;  2O5R A;  1FYK A;  4B43 A;  2VN2 A;  4KA4 A;  3TW7 A;  3H3Z A;  2BXZ A;  2NRA C;  2CQK A;  1O7L A;  3I58 A;  3K4C A;  3I4N J;  4HZF A;  3E3V A;  2PMH A;  2FBI A;  2Y0S N;  4I09 A;  3B6C A;  2R93 J;  3OYJ A;  2Q0O A;  1X2M A;  1IRF A;  5ILV A;  3M7G A;  3HOX J;  2MBF A;  3WTZ A;  2O8X A;  3BQY A;  4E4H A;  3I55 I;  5HOO A;  3E6B A;  4HNU A;  2F5E A;  4LLN A;  3KX2 A;  5F1J A;  3ISP A;  1O3S A;  4M3B A;  2EIM H;  4HST A;  4LGW A;  2KPM A;  2EV0 A;  2VT3 A;  2NS8 A;  2HZD A;  2K85 A;  3EQL F;  4N0B A;  1I27 A;  1T0F A;  2I8D A;  2KLO A;  4HG2 A;  1CGP A;  2PFB A;  3VYR B;  4D7M A;  1WI3 A;  4UUT A;  5FGM A;  1LVK A;  2YSR A;  3M1C A;  1AKH A;  1P4A A;  3CDI A;  4ENJ A;  1B59 A;  5LHG A;  2DW4 A;  2HYF A;  2DTR A;  3MD2 A;  1X58 A;  3K4J A;  3TO9 A;  2LBF B;  1YIJ I;  3BQZ A;  5K7F A;  1G2H A;  2YX7 A;  1VQ7 I;  4RAZ A;  4XR6 A;  4HPQ A;  4DIQ A;  2LTP A;  1P7J A;  3PFY A;  4RMN A;  3HRU A;  4RLF A;  3SHF A;  3PJR A;  1XGM A;  1A6Q A;  3EUA A;  1I3A A;  2KIU A;  2R5Y A;  1BR4 A;  5E8I A;  3C7J A;  4CZC A;  1U8R A;  1T39 A;  1U3E M;  3ZRG A;  4UVC A;  2HVR A;  3CJT B;  1VQ9 I;  1U9O A;  1BIA A;  4L9V A;  3BPV A;  3ZQH A;  4AC0 A;  3L9F A;  3T0Y A;  3MWM A;  2PMZ N;  5J1U A;  3G1M A;  1UHW A;  2Y0S A;  2A61 A;  3ESW B;  4FT8 A;  4A3G J;  2EZK A;  4XKB A;  3WGG A;  1PDN C;  4E7K A;  2L7Z A;  5L3G A;  4V19 K;  2HVQ A;  1WFX A;  3GZN B;  4AIJ A;  1ZAO A;  2RNG A;  3BOQ A;  4DYR A;  3DBH B;  3DTI A;  1F5T A;  2V1U A;  3FXJ A;  3LFK A;  4PJL A;  3F21 A;  3RKQ A;  4LLG F;  2DMT A;  2NVQ J;  2A6H F;  1B72 A;  1OCT C;  3W2A A;  3NRV A;  1H8A C;  3SZT A;  3UKG A;  3OS0 A;  3ZMT A;  2ZJ2 A;  2JVH A;  2GLO A;  3AG4 H;  2P6T A;  3E5Q A;  3BC8 A;  2HPM A;  5LGN A;  1ITY A;  3E5U A;  2E36 A;  4HX8 A;  1TZL A;  3PUB A;  1VTN C;  1FBQ A;  3DEE A;  3UR3 C;  3L2Q A;  2ZSH B;  2L4A A;  4XOT A;  1EH6 A;  2VJ4 A;  2H8R A;  1FSH A;  4HX7 A;  2DMN A;  1MNE A;  5FLM J;  1Q1H A;  1HCR A;  5J1Y A;  2QZ8 A;  3KEO A;  4I02 A;  3ROU A;  2VBZ A;  3F9K A;  2VE8 A;  3MMY B;  4LLL A;  1D8K A;  3IWZ A;  3QWL A;  3J80 Z;  1FBS A;  4CYD A;  1AKH B;  3D5S C;  3LSP A;  1I39 A;  4F7Z A;  1FTZ A;  2VXD A;  2ME0 A;  4WX9 A;  3BR1 A;  3LAJ A;  3PO2 J;  2PJP A;  3CCQ I;  2E71 A;  5L3B A;  3L2U A;  4IL6 C;  3KEQ A;  4ESB A;  4AIK A;  1R9T J;  2W4S A;  4NC8 A;  3HC7 A;  1NG6 A;  1MBH A;  2P7C B;  1H88 C;  4J19 A;  1FIA A;  2PMZ A;  5GTH C;  2R5Y B;  2FOK A;  2DT6 A;  1ETY A;  2VQH A;  2DYS H;  5ED4 A;  1XMA A;  4CHU A;  2XF7 A;  1HDD C;  2LR8 A;  2CQX A;  1F43 A;  4N9H A;  3W6J B;  1KU9 A;  2UUZ A;  3NAR A;  2F4M B;  2R7D A;  3FHZ A;  4IJA A;  3KP4 A;  3OYB A;  1IRG A;  4FET A;  2VIX A;  5JFR A;  4O5V A;  4M74 A;  3V7R A;  3BTC A;  5J4Y A;  2GXB A;  4I7H A;  1JHH A;  4NC6 A;  3A0H C;  2NNY A;  4WWC A;  4WF2 A;  4YFK F;  2IXS A;  2JMW A;  4KMU X;  4MLO A;  2QSF X;  5CYV A;  3MAJ A;  3ZN0 A;  1WCM J;  5FO5 A;  1QBJ A;  2VB6 A;  1UG2 A;  1BI2 A;  1G3W A;  2ESN A;  2NXN B;  3ZP5 A;  2JVG A;  3RYR A;  1B72 B;  2H27 A;  5FJ8 J;  3NWT A;  4ON0 A;  4BQO A;  1KGS A;  1X1P A;  3CDH A;  3FWE A;  3JCU C;  3Q0V A;  2ZSI B;  5JR3 A;  1XS9 A;  1RUO A;  1R23 A;  1R22 A;  4A2U A;  1U78 A;  1O3T A;  3QP5 A;  1QHH D;  3BR2 A;  1TQI A;  3F6V A;  3MVP A;  4M9X A;  4IOC F;  2L2O A;  2XB0 X;  1FOY A;  3TOA A;  3ZQ7 A;  2VPL A;  3ABU A;  5EZH A;  3QYE A;  1YI2 I;  1XDU A;  2XHK A;  3JRA A;  1FSE A;  2EFN A;  4AUX A;  4IOA F;  1TWF J;  2V79 A;  3SDG A;  2MSY A;  3QOD A;  2Q2E B;  4U87 A;  2XF6 A;  2X51 A;  4B47 A;  1FZP B;  3H9G A;  1TQM A;  1K79 A;  4ZDP A;  3WTX C;  2Y69 H;  2V9P A;  2IEK A;  2L9V A;  4MFD A;  3WTU C;  3U9G A;  3HEF A;  2MYS A;  1XGS A;  3MZ8 A;  2Q8K A;  5L3E A;  2P4W A;  1ZGJ A;  3DQV C;  1AWC A;  4KMF A;  1TQP A;  1WJF A;  1GV2 A;  2HS5 A;  2MD5 A;  3DBL B;  3R0A A;  3VOD A;  3GBG A;  1OLT A;  2YU3 A;  1ETV A;  2EA2 A;  2E7X A;  2FNP A;  2ESH A;  5FKM A;  2Z3Y A;  1X3W B;  4KFC A;  1ETO A;  2XPU A;  4B8X A;  2PG4 A;  1MH4 A;  5J4V A;  3GFM A;  3OL3 A;  5E3N A;  1REP C;  3LSH A;  1GXP A;  5CVI A;  1YJW I;  1J0R A;  1A5J A;  2EV5 A;  3J81 Z;  2IT0 A;  5E1Z B;  2L9R A;  4K2E A;  3WHB A;  3FXU A;  4XLN F;  5LHH A;  1UZC A;  4U0W A;  2EA4 A;  1T95 A;  4B1R A;  3WG9 A;  3E7L A;  4CCN A;  3VB2 A;  2FQ3 A;  3GVA A;  1G3T A;  1ULY A;  4JBA A;  2V9K A;  3MFK A;  3S3O A;  5HS8 A;  5FRN A;  1LEA A;  1WJB A;  5CQG A;  1KON A;  1P4W A;  3F8F A;  4MFE A;  1HA8 A;  1IO2 A;  2DA1 A;  2DTZ A;  1LNW A;  3RKY A;  2PQ8 A;  1NTC A;  5DUI A;  5F04 A;  3R60 A;  4LFU A;  5CVV A;  2EQR A;  1X4P A;  1WWX A;  1Z3Y A;  4Y13 A;  4MHG A;  1ZTR A;  3F3X A;  2CSO A;  4EJT A;  3WU2 C;  5K7Z A;  3WOD F;  2HFH A;  3BRO A;  3CUQ C;  4KIT B;  5HOD A;  2VON A;  3SEQ A;  3ZMD A;  3R6S A;  3JTH A;  2JA6 J;  3IH4 A;  4XKC A;  2BOL A;  3HPG A;  5FKK A;  4C3I J;  3RI4 A;  3DU6 A;  3BJO A;  2FA5 A;  3P7N A;  2L9N A;  2P81 A;  2GOM A;  1S5L C;  1MH3 A;  3OIO A;  4BHB A;  2V6C A;  2W84 A;  2WC2 A;  4F92 B;  4FQG A;  4LB6 B;  1ZKG A;  3KP2 A;  3WHC A;  1FOK A;  5D5X B;  1RKW A;  5GAG J;  1MBF A;  2BY1 A;  4G8X A;  4XRS A;  1VQ8 I;  3HOY J;  2WAQ N;  3CUO A;  3HDD A;  3K0L A;  4J01 A;  1W5T A;  1V5F A;  5EYR A;  3ZQF A;  4IRI A;  3OIP A;  4A5N A;  4U88 A;  4XRF A;  1QO0 D;  3HGG A;  4OMZ A;  3LAP A;  4CCM A;  3IV5 A;  1O3R A;  2FMY A;  2E35 A;  3BR6 A;  4G6T B;  4B09 A;  4OAZ A;  3DTE A;  2QQ9 A;  2XB5 A;  1A35 A;  4EEF G;  1MGT A;  3JR9 A;  4IHS A;  3A01 A;  1MDM A;  2M0M A;  3BPX A;  2VJJ A;  3H35 A;  3DLL F;  1IN7 A;  3WU0 A;  2Y75 A;  4A3L J;  2ZJQ F;  4GXO A;  9ANT A;  4BEH A;  3HSF A;  3ZGK A;  5EG0 B;  2GIZ A;  3CF2 A;  2M9H A;  2KDZ A;  2HTJ A;  1R58 A;  1HW5 A;  2KHM A;  3CJQ B;  3J7A Y;  1ZR4 A;  5D6F A;  3R61 A;  2EFP A;  1E3O C;  1NK2 P;  2DQL A;  4A12 A;  3GTK J;  3FMS A;  1K6Y A;  4EM2 A;  2X48 A;  3H0D A;  2XDV A;  2IGM A;  1PP8 F;  3OV8 A;  2JZY A;  5DV5 A;  3HRT A;  3F8M A;  3FMR A;  3DBR B;  4BBR J;  1OYW A;  2DXI A;  3OR2 C;  2D1V A;  1U5T C;  4DQ2 A;  1NHA A;  1TNS A;  3F8N A;  2Z9O A;  1YO5 C;  2F4O B;  1A04 A;  3CME I;  2E1N A;  2EIN H;  1OKR A;  2LY9 A;  3LMM A;  2K3F A;  3BZ6 A;  3GZ5 A;  2L02 A;  3GX4 X;  3DP7 A;  4M9Z A;  1YHQ I;  3M8F A;  5LGU A;  3O8H A;  4KN4 X;  1DP3 A;  1IW7 F;  4U0Y A;  1N75 A;  2VOP A;  5BMZ A;  1GXQ A;  4KUM A;  1FWZ A;  2EIJ H;  3BY6 A;  5D5V B;  4EJO A;  3N4M A;  3CC7 I;  1S3J A;  4I0A A;  1LJ9 A;  2UXX A;  1V54 H;  2GM4 A;  1Z6R A;  2GXA A;  1WPK A;  1I5Z A;  2KRF A;  1IRX A;  2DDB A;  4LB5 A;  3GFL A;  4BKX A;  4BBS J;  4LG0 A;  3E0J B;  2CU7 A;  2QQ8 A;  3SJM A;  2D45 A;  5GPA A;  1QRY A;  4LIU A;  1RR8 C;  1D0Y A;  2FX0 A;  2M45 A;  2FBK A;  2ISY A;  3ASN H;  1J2X A;  4BUP A;  1K78 B;  2DOF A;  2M87 A;  3BG9 A;  2VQG A;  2M7B A;  3ZR8 X;  2RN7 A;  5DCM A;  1MW7 A;  3RTR A;  4E7S A;  1GV5 A;  2DOD A;  2BY0 A;  2MH9 A;  3PNV A;  5EEG A;  3H36 A;  1SFE A;  3BP8 A;  2ZFW A;  2COB A;  2AS5 F;  4X0G A;  3K4B A;  3A01 B;  1MDM B;  1IAW A;  4KN7 X;  3LSG A;  1W7P D;  2E5Z A;  2QQB A;  2LSO A;  2QKM B;  1F36 A;  4ETS A;  3DFG A;  3G73 A;  5EJC A;  3B02 A;  2PBI A;  2DFF A;  3DCF A;  4XLE A;  3ECH A;  4BEH B;  2E5N A;  2KIQ A;  3CCM I;  1QZY A;  1BL0 A;  5EF6 A;  3K1N A;  1HKT A;  2N8G A;  3LA3 A;  1S7E A;  2G0E A;  1TW3 A;  3S2W A;  3PQJ A;  2RV8 A;  2OQG A;  4Q4Z F;  3BJ6 A;  3HKZ A;  1GDT A;  2WWY A;  1X2N A;  5HLG A;  3ASO H;  4NUB A;  4E7H A;  1ZRF A;  3LSK A;  2D5V A;  1VZ0 A;  4WXH A;  4NNJ A;  3L2W A;  4GGG A;  3TKY A;  4B48 A;  1SFX A;  2K27 A;  3WTV C;  4Q48 A;  4XLA A;  5HDG A;  2HYJ A;  2KJB A;  3OOU A;  2XAJ A;  2QSG X;  2FU4 A;  1U8B A;  1IN6 A;  2COM A;  4LK1 F;  2BW3 A;  2DK5 A;  3H9Q A;  1BC8 C;  1VQ6 I;  3GLL A;  1QZZ A;  2HGC A;  4B3X A;  4QPQ A;  3M8E A;  4DYQ A;  2JUC A;  1B4A A;  3C1D A;  1JXS A;  1LB2 A;  2O6G E;  3I0T A;  3FK7 A;  1O4X A;  3AL0 B;  3PNT A;  4XBF A;  2O0Y A;  4ZYG A;  2ZFU A;  3K4N A;  4S0H B;  1X1B A;  1JE8 A;  3H1C A;  4CYC B;  2ZME A;  3IL2 A;  2P5V A;  2M1B A;  3F8B A;  3JSO A;  4BQQ A;  2IA0 A;  3BJA A;  3TL4 X;  3LQR A;  3TO6 A;  4RLQ A;  1MKM A;  2M4G A;  3L7W A;  1R71 A;  4DZP A;  1FC3 A;  3OS2 A;  1WJC A;  1T56 A;  4UVB A;  1O57 A;  4LG0 B;  2JQ7 A;  4MIM A;  1OYI A;  3ZQC A;  2HQ5 A;  5K7H A;  2M4K A;  1XC5 A;  1E3H A;  2EFO A;  3LQQ A;  3OYI A;  2LK2 A;  3BLY A;  2FJ1 A;  5DCM B;  2F5C A;  1ZEL A;  3LFU A;  2VPR A;  2K7L A;  3P9C A;  3CTA A;  4I0B A;  1HOM A;  2RQP A;  2XF5 A;  3CD6 I;  4Q5S F;  1RKT A;  1SVM A;  1T2K A;  2VBY A;  1RI7 A;  4BAC A;  2A6T A;  3FIW A;  4B4C A;  4I76 A;  1ZLK A;  3LSM A;  2R7T A;  5DD4 A;  5IY5 H;  5IYC J;  3LOC A;  1ETK A;  2DQR A;  4ABZ A;  4U7B A;  1FIP A;  3KPH A;  3PL8 A;  2QUF A;  3FM5 A;  3TDZ C;  3OL4 A;  3CJN A;  1U9N A;  2JPB A;  4M6X A;  3EPZ A;  5C3E J;  1QA6 A;  4J00 A;  1JKP C;  2EK5 A;  3CJR B;  1SFU A;  4F55 A;  3CCE I;  3DTK A;  1R6R A;  2DA7 A;  3E97 A;  4KYW A;  3P9I A;  3WE2 A;  1M1E B;  1SFO J;  4OIN F;  3PFI A;  1R4M B;  4P1W A;  5KAF C;  2H09 A;  4BS9 A;  1FEX A;  5FFZ A;  3H9J A;  2KP6 A;  1STZ A;  1W5S A;  3O8G A;  2YR2 A;  5A2Q Z;  2CRG A;  1P4X A;  3R0J A;  2DA6 A;  5CJ9 A;  1YG2 A;  4GYG A;  1TW2 A;  2HYG D;  2BVL A;  2Y9Z A;  3FXO A;  2X85 A;  3DEW A;  5FB2 A;  3OYN A;  4IX7 A;  1J9I A;  2OV7 A;  3VPR A;  2F48 A;  2BW3 B;  3EUK L;  1LFB A;  5D8L B;  2UV1 A;  2CS3 A;  4IQJ A;  4DJA A;  4U0V A;  1T0F C;  3EDP A;  3TBI A;  3CDL A;  3CLO A;  2NVT J;  2JUG A;  2M34 A;  4FE7 A;  3GO5 A;  2L3D A;  3SXY A;  1T8I A;  2WV1 A;  3HL2 A;  1IN5 A;  1LDK B;  1KQ8 A;  3ZMZ A;  1ZHF A;  2W57 A;  2XRN A;  4KJZ A;  3K70 C;  3GTQ J;  4G12 A;  4B44 A;  3ZQL A;  4XMY A;  2VE9 A;  3K2Z A;  2IGK A;  2O3F A;  4AIH A;  1Z77 A;  1AU7 A;  3DKY A;  3L00 A;  4JX4 A;  5C4J J;  2M8E A;  2K4J A;  1FYL A;  2R7S A;  2ELH A;  4MEX F;  5DM7 F;  2DPD A;  4PJM A;  1B9M A;  2R0Q C;  1LPQ A;  1Z21 A;  2P5K A;  2NVU B;  2BHY A;  1LQ1 A;  4UHT A;  3X2Q H;  4X1E A;  3IRR A;  4HV6 A;  3JRC A;  1A31 A;  2VQL A;  4BE1 A;  3DKW A;  3AG3 H;  4G9Y A;  4XK4 A;  1BR1 A;  2L4M A;  3MEX A;  3KIO A;  1ZGA A;  4RGX A;  4ZZD A;  4BDY A;  4TV7 A;  1X4O A;  5BNG A;  3RDI A;  4I6Z A;  2X6O A;  2ZBK A;  3JRB A;  3RZO J;  2VC1 A;  5DDG A;  1XN7 A;  4LIV A;  1P7I A;  5B1A H;  1BOB A;  1PP7 U;  3S17 J;  2LP0 A;  3NAU A;  1KU7 A;  1OPC A;  2V1N A;  1ZG5 A;  2XAU A;  4RM2 A;  1R1T A;  3FBI B;  4HF1 A;  2HWV A;  4ZH4 F;  1UFM A;  4R79 A;  1FJL A;  1ONV A;  4ZDO A;  2JJ7 A;  2ECB A;  4W1U A;  5F27 A;  3K10 A;  4UV9 A;  4KT6 A;  4C2T A;  3F0C A;  1IF1 A;  3DPU A;  3SDB A;  1XSX A;  4FHT A;  2MGQ A;  5CVR A;  1W36 C;  2K9S A;  3FX3 A;  3MKL A;  4D7N A;  4WXD A;  3H5A A;  4ZYH A;  4EV0 A;  4XID A;  5FD5 A;  2EIK H;  4F3Q A;  1OFC X;  2MFZ A;  1K61 A;  1V5E A;  1U2W A;  3BTL A;  3MQ0 A;  5DYM A;  2IA2 A;  2LNB A;  3C3W A;  1I6H J;  5D4S A;  4V2G A;  2RRE A;  4CZZ A;  1IC8 A;  2RGV A;  2R7Q A;  3H3U A;  5D5W B;  3JSP A;  3VSL A;  1Z67 A;  2Z1D A;  2JA7 J;  4HEA 2;  1HDP A;  2PI0 A;  1YIT I;  3HOV J;  4D5F A;  2V26 A;  2JK3 A;  1WJD A;  4XRS G;  4HV5 A;  2BY2 A;  1FPQ A;  1G6N A;  1MMS A;  4MTE A;  3ZQI A;  4YEL A;  2IS2 A;  1XCB A;  2VJI A;  4LK0 F;  2ZXI A;  1U0J A;  2F5F A;  4M3G A;  2KZG A;  3BWG A;  3OYH A;  1JKR C;  3J7A O;  1MMD A;  2KDO A;  4L5E A;  4YIR X;  2CUF A;  3EET A;  4HRI A;  2QEX I;  2XAG A;  2V1X A;  3H0G J;  4QTR A;  2E1O A;  3RIR A;  2HU9 A;  3ABK H;  4CCJ A;  1IN4 A;  5TJJ A;  3J80 K;  3QU6 A;  3IKT A;  3CCR I;  4QIW N;  2DA3 A;  3CMA I;  2VT2 A;  2FML A;  1BBY A;  2ZKZ A;  4HLX A;  4YII A;  4EM1 A;  1S9H A;  2X4H A;  1Z0X A;  2LLK A;  4I01 A;  4Y33 A;  5IOZ A;  2CV0 A;  1SVL A;  3BZC A;  2E1M B;  2E2H J;  3M9A A;  3S32 A;  2P7V B;  2A69 F;  2X6W A;  2Q2E A;  4LG3 A;  3I54 A;  1GVJ A;  2GBY A;  2GWR A;  3V8L A;  3BTJ A;  3GCM A;  3GW2 A;  2AXT C;  2IAI A;  3FHN A;  1IXS B;  4S05 A;  2R92 J;  2R5Z A;  5TRD A;  2LRE A;  2P6S A;  2DCE A;  2DJN A;  2XPW A;  2RC4 A;  1I1S A;  3A2K A;  4CIC A;  2HDC A;  3IAS 2;  3I4M J;  3VDX A;  3RCO A;  1VQP I;  2MC3 A;  2XKO A;  3PQK A;  1PVE A;  5LEJ A;  1B6A A;  1T6S A;  4XLF A;  1Z1D A;  2OU2 A;  5EEH A;  3GTG J;  5M3F J;  3SZP A;  5E3L A;  5GTI C;  4FX4 A;  1DU0 A;  3EYY A;  2R7F A;  2NOJ B;  1ODD A;  3KP5 A;  3BDD A;  3QYF A;  3VYS B;  5AON A;  1XSV A;  1WZ2 A;  1V55 H;  2CFO A;  2X6X A;  2HKX A;  3KLO A;  1KQ9 A;  2HOT A;  1KZH A;  2VLA A;  4LMY A;  2JRM A;  3EUH A;  4OAY A;  3F23 A;  3OWT A;  2HI3 A;  1Y1V J;  2CH0 A;  4A3I J;  4PUS A;  3KYC B;  4ZJZ A;  2K4B A;  3VYU B;  4BH9 A;  1OR7 A;  1TC3 C;  4A3D J;  1ZH5 A;  2AXL A;  3GTL J;  4A3C J;  4AVZ A;  4HYE A;  2NS7 A;  1APL C;  1S7A A;  2CQ7 A;  3LNQ A;  3A0B C;  5FKL A;  2MG4 A;  1O7F A;  1JHF A;  3CP2 A;  2Y0M A;  3FMQ A;  2H94 A;  4S04 A;  2OCC H;  2OPT A;  2DDA A;  2L9S A;  4CCO A;  1LFU P;  3GTP J;  3GTO J;  2PJR B;  3PNY A;  4BQN A;  3CF5 F;  2ZC2 A;  2E34 A;  3AG2 H;  1XX5 A;  2UZK A;  3OMY A;  2DLL A;  4Y15 A;  2OAZ A;  2DOE A;  2L01 A;  4JX6 A;  5M3M J;  2XV4 S;  3SYT A;  1DPU A;  1UJ8 A;  6PAX A;  2GIV A;  3QYB A;  2XAH A;  4WCG A;  4L9T A;  1YQA A;  2LKX A;  1X1D A;  2DBB A;  3Q9S A;  4E6K G;  5K5R A;  1FLI A;  2CW7 A;  4CH7 A;  4F93 B;  4ESJ A;  2BBY A;  4U7D A;  1WJ5 A;  4F52 A;  3W2V A;  2KFD A;  4MEY F;  2R7W A;  4EGZ A;  2DMU A;  2EV6 A;  2QKL B;  4ZTJ A;  1ZRC A;  2H1K A;  1IRZ A;  2OQR A;  2R5Z B;  1SMY F;  2AO9 A;  3GF2 A;  3ML6 A;  3IWF A;  1IDY A;  5CVJ A;  2FBH A;  2G7U A;  2MC4 A;  3CCU I;  3MZH A;  4OIR F;  1FTT A;  2FUG 2;  3J81 K;  4FX0 A;  2MLG A;  4ESF A;  4L0Z B;  1YIO A;  2X1C A;  3P5J A;  4QPO A;  3F8C A;  1BI1 A;  5LFA A;  2DI3 A;  1LKX A;  2M2E A;  5FD6 A;  3O3K A;  4RAF A;  3AAF A;  3QPH A;  3RPQ A;  2WAD A;  2PX9 A;  1Z3X A;  1XG1 A;  3HJE A;  2XRO A;  1WJE A;  5EG0 A;  1EH8 A;  2WA0 A;  4A3E J;  2MW8 A;  5CVU A;  1MJB A;  3P9K A;  2Y48 A;  4ZDL A;  2JRT A;  1QQI A;  3O6B B;  1EA3 A;  1JGS A;  4AYB A;  4L0Y B;  2NOG A;  4EJU A;  5B66 C;  2K40 A;  4IKF A;  4BE2 A;  4HOB A;  2R7X A;  3IH3 A;  4A3F J;  3V7C A;  5BPI A;  4MNU A;  3HTS B;  3TO7 A;  2KMU A;  2TCT A;  4R8H A;  4AD9 A;  3L2C A;  1XMK A;  1HKS A;  2HDD A;  3GME A;  2BGC A;  1SMT A;  3HHG A;  3K1P A;  4BYY A;  4L18 B;  2QCO A;  2KRH A;  3DU5 A;  3ABM H;  4XON A;  1ON1 A;  2OZ6 A;  4PK4 A;  3RYP A;  1X3Z B;  2BY3 A;  3ABT A;  5FLX Z;  4BY1 J;  3GLX A;  1K83 J;  1W7P A;  2IJL A;  2YX4 A;  2K3P A;  3E6C C;  2ETH A;  1VND A;  1DDN A;  3HUG A;  1R36 A;  3OYL A;  2IVM A;  3JAM Z;  1JGG A;  1VQM I;  2FF4 A;  1SAU A;  1H9G A;  4W97 A;  3UNG C;  2QLZ A;  4N4O B;  1TP4 A;  4MGR A;  1ZG1 A;  4HDV A;  1P92 A;  3BG5 A;  1K78 A;  2O8K A;  2G7H A;  3ERE D;  2L7F P;  3M07 A;  3N05 A;  3BT9 A;  3JW4 A;  3HRS A;  2W25 A;  3AL0 C;  5J6X A;  5EGO A;  2F2E A;  2XAF A;  2CG4 A;  3BCA A;  3CMY A;  1OMI A;  3O2P E;  1R1U A;  4NB5 A;  4PJN A;  1LVA A;  3VYT B;  4D5C A;  4NQW A;  3WG7 H;  2R4G A;  4PGG A;  2KRC A;  3FXK A;  2Q1Z B;  5HVQ C;  3D1N I;  2ID6 A;  3LSJ A;  4HAM A;  3FF5 A;  3HPH A;  1IXC A;  2XGD A;  2CUE A;  2IW5 A;  3JRF A;  3TED A;  1FT9 A;  1OCO H;  5GP9 A;  2EPF A;  4BHC A;  4OIP F;  1K6O A;  3K4M A;  3JTG A;  4RB3 C;  5E3M A;  1IV6 A;  3K6G A;  2XGX A;  2R3S A;  2CV2 A;  4KT5 C;  5E1W A;  2XSD C;  2XVC A;  3GYH X;  4UXN A;  3CQZ J;  4YIF A;  1WHU A;  1X3U A;  2ZNY A;  1MJA A;  4FE4 A;  3FDY A;  2DA5 A;  1YX5 A;  2OD5 A;  3HKZ N;  2RKH A;  3V7S A;  5L3C A;  2RNJ A;  1C0W A;  4C2U A;  3J7Y J;  1ZRE A;  3OYM A;  4F91 B;  5CLS A;  2QA4 I;  3BR5 A;  2GA1 A;  2YUS A;  1XGO A;  2LYC A;  2LFB A;  5HDK A;  2BEO A;  4OWR B;  4DYC A;  4BAY A;  4G7O F;  1IUF A;  5IP7 J;  3I53 A;  3HGY A;  3S1Q J;  1R00 A;  4A3J J;  3CCL I;  2ACJ A;  1S29 A;  1JKQ C;  2JWT A;  3EYI A;  3CCS I;  1G3S A;  4RAG A;  1VQ4 I;  4UUS A;  2LG4 A;  1D5V A;  1N78 A;  2DA2 A;  1JUP A;  2LH9 A;  1HW1 A;  1W7P B;  2DFI A;  4UB6 C;  5F6F A;  4CYC A;  4IO9 F;  3JRH A;  2K9N A;  3F6O A;  3HUG B;  5E3O A;  5JVG F;  2NYX A;  1DP7 P;  1W0T A;  2HOS A;  3F22 A;  3M3Y J;  3BG3 A;  3VWB A;  3U2R A;  4AID A;  3OS1 A;  3HOS A;  1BW6 A;  1R5H A;  4D1Q A;  1P2F A;  3CC2 I;  1MIJ A;  3CP8 A;  3CC4 I;  2QSH X;  1Z7L A;  2EZL A;  5KAI C;  1IZ1 A;  3T5X A;  3HM5 A;  3OIQ A;  2BHZ A;  2ZXH A;  3OYF A;  1T08 B;  4IEJ A;  3QU3 A;  4FTH A;  3KYL A;  3AKZ A;  1G3Y A;  4XOP A;  2VXZ A;  3ONQ A;  1VQL I;  2KL4 A;  1EH7 A;  2V9V A;  5EGO B;  2NNN A;  1MND A;  3D5R C;  1AOY A;  1T98 A;  2QBY A;  3W6V A;  1WH5 A;  1V4R A;  3GWZ A;  4IHV A;  2ZME C;  4C30 A;  2YU9 J;  4E7I A;  4ASN A;  4NQW B;  2EZI A;  2BVM A;  3HYI A;  3V8J A;  5HLT A;  4IZZ A;  1KYW A;  2ZXW H;  4PJ0 C;  4PZJ A;  2X1D A;  4GFB A;  2FSW A;  2LD5 A;  5DCF A;  4HA8 A;  3WE3 A;  3GZ6 A;  2IS4 A;  1TWH J;  3SZG A;  1IDZ A;  1PUF A;  2V6E A;  2W00 A;  2M3A A;  1O3Q A;  5LHI A;  3OOP A;  1MSE C;  4IRH A;  2E7W A;  1WRJ A;  3S1N J;  2Y30 A;  4BDZ A;  1ZLJ A;  2HEO A;  1AHD P;  1VQ5 I;  1IN8 A;  5IP6 A;  3S15 J;  3COA C;  2VI6 A;  4YFX F;  1YE9 A;  2OCE A;  2XAS A;  1F9N A;  4CCL A;  2LY1 A;  2WBM A;  3LL7 A;  4XKW A;  1RIO H;  4FCY A;  4D0P A;  2G9W A;  2D2W A;  4I99 C;  5GPC A;  1ZQ3 P;  1W1W E;  4L5J A;  4UUS B;  4H0E A;  3BG7 A;  3OYC A;  2LRD A;  2CW8 A;  1BC7 C;  2HKO A;  3IKV A;  4LIT A;  2R7U A;  2A3S A;  3Q0W A;  5ICC A;  3MKW B;  3QPT A;  1KYZ A;  2E1C A;  4HDU A;  5GAD J;  4Q47 A;  4OOI A;  1V5G A;  2LDU A;  1LFP A;  3B6A A;  2ADU A;  4A0Y A;  5FRM A;  2IPQ X;  2K02 A;  1D1C A;  2CYY A;  4RS8 A;  1S8N A;  4G94 A;  5EDN A;  1S7O A;  5LRS A;  2HZT A;  3FKI J;  2WB1 A;  2NAZ A;  3S1R J;  1QVT A;  1J7K A;  1YS6 A;  3TW6 A;  3I64 A;  1TT5 B;  2VKD A;  3S2H J;  1BW5 A;  4L9N A;  1PJR A;  3CZ6 A;  1RES A;  4PDK A;  5JVT A;  4XSZ F;  4EQQ A;  1HW2 A;  2NS0 A;  1MBK A;  1YLF A;  2QBY B;  3GEZ A;  1YS7 A;  1UEL B;  1GT0 C;  4RGR A;  2DN0 A;  2DYR H;  5D5U B;  5IPA A;  3WGI A;  3G71 I;  1Y39 A;  1MJ9 A;  1JUS A;  2JSP A;  5B1B H;  3RZD J;  2HDW A;  2EB7 A;  2EFQ A;  3FXL A;  4EGY A;  1SD5 A;  2M7A A;  2AQE A;  5FLV A;  4GO1 A;  3WGH A;  2EFW A;  1I3Q J;  4HF0 A;  2L7M P;  5A2Q K;  1YJ9 I;  4RGS A;  3JRI A;  1XCV A;  1PUF B;  3G6E I;  2XIG A;  3C18 A;  2BV6 A;  1F4K A;  1LUJ B;  1BOA A;  1KA8 A;  3H3V K;  3G1O A;  3KYD B;  3HBL A;  2EZH A;  4HW0 A;  1TWG J;  2WY8 Q;  1WI9 A;  4Y4R A;  1OCC H;  2DPU A;  3ZXS A;  4DOZ A;  3S2D J;  2XRL A;  4BXX J;  1A6I A;  2FE3 A;  1FMV A;  3FXQ A;  1EKE A;  2AHQ A;  3DWL E;  4V2F A;  3WU1 B;  1NH3 A;  2Z99 A;  4ITV A;  2OF7 A;  4PFO A;  3E5X A;  3IP4 B;  4RM3 A;  4CGZ A;  3NWS A;  3KZZ A;  2Z5U A;  3IC7 A;  3L1P A;  5K5Q A;  4A5M A;  2OC6 A;  2E1M C;  2DT7 B;  4IQ4 A;  1AA7 A;  4M73 A;  4RB0 A;  1XPX A;  1L3L A;  1ACI A;  4NDL A;  2E19 A;  2DK8 A;  5IT9 Z;  3V42 A;  2JN6 A;  3RQI A;  3MCZ A;  5TGT A;  3MKZ A;  1E17 A;  3BR3 A;  4C2M J;  4NBQ A;  2KZV A;  3DPT A;  1K4S A;  3I56 I;  3HOZ J;  2STW A;  5KK1 A;  1H89 C;  1R5G A;  3NQO A;  1BJZ A;  1ETW A;  3HTU A;  4EM0 B;  2W24 A;  4WK8 F;  1T33 A;  3H92 A;  2ZJR F;  1KU2 A;  3ZQG A;  4XL9 A;  3J7Z I;  2GA2 A;  2X6Y A;  2XKP A;  1KU3 A;  3W6K B;  2H6C A;  3DKX A;  5HLI A;  5DM6 F;  2IP2 A;  4PGH A;  3HOT A;  4E7J A;  2B63 J;  2HQR A;  3A4C A;  4JQF A;  3M8J A;  3PM1 A;  5HS7 A;  4E70 A;  2R7R A;  1KQ0 A;  4P9U A;  4RBO A;  3ZOB A;  1IGN A;  4Y3O A;  2A5W A;  2J5O A;  4DZJ A;  1DUX C;  5B3S H;  1WGX A;  3C2H A;  3QQA A;  1OYY A;  3SEZ A;  1RUN A;  5AIP A;  1TL8 A;  3D0S A;  4BHP A;  4M3D A;  2XAQ A;  1JKO C;  5BPD A;  2E2J J;  1ETX A;  2KIM A;  1NK3 P;  3QOP A;  5B5E C;  2JSC A;  5JI6 A;  4RB2 C;  2W7N A;  1D0Z A;  1ENH A;  3CCV I;  2A68 F;  5F0C A;  2XGE A;  1IG7 A;  3HSE A;  2JA5 J;  1HF0 A;  3C2B A;  3DPL C;  1N77 A;  3I3L A;  3ULQ B;  1I6X A;  1E3P A;  4D9J A;  2L54 A;  3HB9 A;  4II2 A;  3OYE A;  1JT6 A;  1Y6I A;  2ELJ A;  3DF8 A;  1R49 A;  2IS1 A;  5J3L A;  3G3Z A;  1UG0 A;  2PLY A;  2MA3 A;  3LSR A;  3VFZ A;  2VBX A;  2FEZ A;  1JUM A;  5JHU A;  2CMP A;  2VKV A;  1QPI A;  2VOO A;  5CKT A;  3I9V 2;  3RPU D;  1K4T A;  2W48 A;  2X9D A;  4UVA A;  4Z2Y A;  1X1A A;  4UY8 I;  4HSR A;  2MAB A;  4WXC A;  1VI0 A;  1HLV A;  1UST A;  4ENK A;  1V3F A;  3S16 J;  3H5R A;  1VFC A;  3PO3 J;  5DD8 A;  1WH7 A;  2GAU A;  1I1G A;  4UNO A;  1XB4 A;  4I2O A;  2J5P A;  3Q0U A;  1S72 I;  3TDU C;  2M8G X;  3RKW A;  5FKO A;  1DU6 A;  2QQA A;  3CES A;  1TNT A;  5J8C A;  1UB9 A;  1G4D A;  1Z6T A;  3ZCO A;  3H5N A;  1RR7 A;  2VC0 A;  1RET A;  1UCR A;  3DXJ F;  3A1Y A;  5J1R A;  4EVI A;  1W0U A;  4RA2 A;  2ISZ A;  1B1B A;  2AQF A;  3ZMV A;  3REO A;  4DW6 A;  4ZYD A;  1S6L A;  4DBQ A;  2PJR A;  4A69 C;  2WY7 Q;  4DNC A;  3QOE A;  3A02 A;  1YX3 A;  3EUH C;  1HSJ A;  3U1D A;  4L9J A;  1MD0 A;  1RZ4 A;  1FYM A;  3MZY A;  4EAT A;  2V4J C;  2WAE A;  2O7O A;  2H8W A;  1OR7 C;  3SQN A;  5C44 J;  3KET A;  3Q5F A;  2ICW G;  5HS9 A;  5JHF A;  1JI8 A;  1I50 J;  4M71 A;  3ZQQ A;  1Z7U A;  2CQN A;  4UB8 C;  1DPR A;  3ERM A;  4CXF A;  2ZO4 A;  5E1X A;  2CWE A;  3I59 A;  1TWC J;  4EMS A;  1H0M A;  1IUY A;  3G4S I;  3V8K A;  5DS9 A;  5HLH A;  3K4L A;  4DBR A;  1J59 A;  4A3K J;  4Y52 J;  1W5C C;  2ZNZ A;  4ENM A;  3ECO A;  3I5U A;  1GUU A;  3Q3S A;  2YPR A;  2L7K A;  4XM3 A;  1RNL A;  1IJW C;  2CUJ A;  2Y2Z A;  2KT0 A;  2STT A;  1MMG A;  2O03 A;  5LRR A;  2IGN A;  4QWQ A;  4OIQ F;  5DEQ A;  3QPL A;  2FNA A;  2JA2 A;  4MO7 A;  1OIS A;  4UV8 A;  4QSH A;  4RB1 A;  1YRN A;  1J75 A;  1LEB A;  1UMQ A;  1ERD A;  2W85 A;  3GFI A;  1DGR M;  2B9S A;  5DUK A;  3IAM 2;  3NEU A;  4ZC3 A;  2HR3 A;  4BGD A;  2QEN A;  2X0L A;  4XLC A;  2W82 A;  2F4I A;  2E2I J;  5E17 F;  5IP9 J;  4GYI A;  2M30 A;  5GAE J;  4M72 A;  4A3B J;  4IXA A;  3TMO A;  5AIQ A;  3E1S A;  1SD4 A;  3GTJ J;  4G7Z F;  3OR1 C;  4BY7 J;  1BIB A;  3DV8 A;  3K70 D;  4R1H A;  3FK6 A;  1JJ6 C;  2Z33 A;  5FKN A;  2X1E A;  1XSD A;  1OCR H;  2XC7 A;  1TBX A;  4II3 A;  3C2G A;  5J8F A;  4C3H J;  3LA7 A;  2B0L A;  2HXI A;  4AYB N;  1WQ2 A;  5LD2 C;  2LOO A;  1MNM C;  4Y17 A;  4BU2 A;  4ANJ A;  2O61 A;  4IVN A;  3M4O J;  2DFE A;  4XN3 A;  3R4K A;  4KIC A;  3D5L A;  3IUO A;  3SFZ A;  3PSI A;  3IRQ A;  4OU0 A;  3FBN B;  3U1K A;  1EF4 A;  3ABL H;  4CA0 A;  3ZMS A;  2Z2S B;  5M5W J;  1OCZ H;  1Y56 A;  1POG A;  1MZB A;  2KIF A;  1UHS A;  2HXO A;  3OY9 A;  1ZN2 A;  5ICF A;  2TRT A;  2CV1 A;  4P55 A;  2VAS A;  1SD7 A;  2ME6 A;  4PJJ A;  4H4K C;  1N25 A;  3I59 B;  2UWM A;  2HNH A;  3SFI A;  3S93 A;  2VKE A;  5LLQ A;  1LE8 A;  1ON2 A;  5CQE A;  5HNH A;  4XSX F;  3MN2 A;  4M3E A;  4JYK A;  3K4K A;  3JRD A;  1YW7 A;  1IXR C;  3ZPL A;  1ZYR F;  4MTD A;  3G2B A;  2XGC A;  3HXL A;  4IF4 A;  2GOX B;  3OYG A;  5FRO A;  3F72 A;  1SD6 A;  3CCJ I;  1QNT A;  2XUB A;  1W36 D;  2EJR A;  4BL0 B;  2EBI A;  1YRN B;  2ZB9 A;  2HQA A;  2RAE A;  1SFK A;  5FFX A;  4PSW A;  1CF7 A;  4BNC A;  4I98 B;  5E79 C;  5K5O A;  1MMA A;  4KIG A;  2OTL I;  4JX5 A;  3OSF A;  4HF2 A;  1VF9 A;  5KNL A;  4OIO F;  1XTA A;  4BE0 A;  1QPM A;  1YOV B;  1XD7 A;  2KIS A;  4YRV A;  1ZK8 A;  1W4M A;  3HRM A;  3KLN A;  5KVR A;  3FXM A;  4HX4 A;  1SVO A;  1FNN A;  5F1R A;  1YJN I;  5ICG A;  3FKJ A;  1OJL A;  1LDJ A;  3K9T A;  3KFW X;  4M9S A;  1RRJ A;  4BXF A;  1ETQ A;  3HZJ A;  5BQT A;  4HNV A;  3VSK A;  1D1B A;  2A6E F;  2V1D A;  2H6B A;  5FLX K;  2K5C A;  4XN0 A;  1FX7 A;  1E0E A;  4ZTF A;  4RGU A;  2WV0 A;  2P5L C;  3HOU J;  1QU3 A;  1H9T A;  3WTS C;  3S3M A;  1D3Y A;  4CSW A;  3JAM K;  2DT5 A;  3BR0 A;  1FY7 A;  4A0Z A;  1U6G A;  2LC2 A;  5JLX A;  1FP1 D;  3PUF A;  1GHC A;  4O6J A;  4OMY A;  4IHY A;  2F5V A;  1QVU A;  1JTY A;  2IS6 A;  2QF7 A;  1HQC A;  1Z05 A;  1F1Z A;  3S1M J;  2LKS A;  2W1O A;  2WAF A;  3RQ4 A;  4KIS A;  4G6D A;  1RC9 A;  1QZE A;  5LEK A;  2VBW A;  2E60 A;  2K9Q A;  1FOX A;  1LE8 B;  2DJI A;  4XQF A;  3HOW J;  3FIS A;  2HOA A;  3HHH A;  2P0W A;  4BQA A;  2FXA A;  2Z16 A;  2IA1 A;  1HST A;  2K9M A;  5TIS C;  4ZZL A;  2BZT A;  2ZXJ A;  3CCY A;  5ICE A;  2K9L A;  5F0H A;  2GXG A;  3IHU A;  4P9F A;  1D0X A;  1TWA J;  2JPC A;  2FOW A;  1R7J A;  2Y31 A;  3BZK A;  4XKV A;  5DTD A;  1K7A A;  1TLH B;  5IOY A;  5D4R A;  1CF7 B;  1X1C A;  5ILS A;  4A6D A;  2I5U A;  1JT0 A;  4GCV A;  1JTX A;  4FAS D;  2LKP A;  5H6Q A;  3S3N A;  1OCP A;  1YW9 A;  4G7H F;  1UHM A;  2MH2 A;  2VOD A;  4HNT A;  5K1Y A;  1WVR A;  2IBD A;  4M6V A;  2KQR A;  4XOR A;  2DU9 A;  2V7F A;  3KP7 A;  1OQY A;  3B73 A;  2VKH A;  2JTV A;  1ZGW A;  5ILU A;  1B8I A;  5E20 A;  3CUQ A;  2CUZ A;  4KDP A;  4X6A J;  2I10 A;  3G1L A;  3L2V A;  1ZAR A;  3K7A J;  1EJ9 A;  2EH3 A;  3KP6 A;  1YW8 A;  4QLC U;  2LMD A;  5H2F C;  2BXY A;  1FBU A;  4C3J J;  3W3C A;  1XGN A;  4P5O A;  4AM3 A;  2DMQ A;  1Y0N A;  4BJ5 C;  1RPW A;  3T8R A;  3TOB A;  3DLA A;  2EWN A;  5IYB J;  1L0O C;  3ZN1 A;  2DFH A;  3L09 A;  4B3A A;  3PIO F;  5GAH J;  3T1B A;  4A0X A;  4HQM A;  2QWW A;  2WTE A;  3TGN A;  4EJV A;  2MD0 A;  4IHW A;  1MBG A;  2HPI A;  1Y8R B;  3W2W A;  1D8J A;  5F08 A;  3E6M A;  2JA8 J;  4AVP A;  1A36 A;  4PSX A;  2UXN A;  4MQ9 F;  1BI3 A;  3HG9 A;  3K2A A;  2A5Y B;  3RJP A;  1E2X A;  1MBE A;  3QPS A;  3RKX A;  4YFN F;  4KNY A;  1DQU A;  3GUD A;  5J47 A;  2WAQ A;  4PFP A;  2BYV E;  2DO7 A;  1FP2 A;  3ZMU A;  5LGT A;  2VJ5 A;  1SAX A;  1Q1V A;  5IT3 A;  2C6Y A;  2FD5 A;  4MQV A;  3GFJ A;  2WB1 N;  4LJZ F;  1MBJ A;  4A6E A;  2HTS A;  5H20 A;  3BG6 A;  3WTY C;  3LWF A;  4IPA A;  4KIF A;  4M6Y A;  4RAY A;  1BA5 A;  2M0C A;  1BN5 A;  1LDD A;  3AFH A;  3I71 A;  3TQN A;  1HXD A;  3QAH A;  2PEX A;  1Y1W J;  5D8K B;  1B9N A;  1YFH A;  4RDU A;  4ENN A;  1D5Y A;  2ECC A;  2GZW A;  1VQN I;  5J40 A;  2DA4 A;  1USS A;  2F5D A;  2PN6 A;  2DOA A;  2GQQ A;  2A05 A;  4XIC A;  5C4X J;  1BR2 A;  2DAO A;  5KCM A;  1U5T A;  3RSN A;  4JK1 X;  2EIL H;  5M5Y J;  5BOX A;  4YEJ A;  2RQQ A;  2KJC A;  3KEY A;  3N97 A;  1MSF C;  1SEU A;  3LSI A;  4JP0 A;  2NVY J;  3AG1 H;  4XRM A;  1B8I B;  2M5W A;  2L0K A;  2VL8 A;  2LY2 A;  2P8T A;  3CUQ B;  3K1M A;  4CO8 A;  3MKY B;  2CGP A;  2XSJ C;  2IRF G;  4P96 A;  3K69 A;  2LF7 A;  5BS6 A;  2B7E A;  1D1A A;  4CCK A;  4CUG A;  1CQT A;  2PMU A;  3FXR A;  4IRG A;  4XLP F;  1NG7 A;  3Q9V A;  2YS9 A;  4HBL A;  3OYA A;  2XPV A;  4JOM A;  2OJE D;  3JRG A;  4A3M J;  1HBX G;  2QM3 A;  1Z91 A;  3JRE A;  1G59 A;  4GRI A;  4GDF A;  2VQC A;  4AWX B;  4PCQ A;  2VUM J;  3GTM J;  2D1H A;  3M1E A;  1J09 A;  2NVX J;  1WKM A;  2R7Z J;  3CO7 C;  4EJW A;  5HDN A;  5CPR B;  3PSF A;  3U21 A;  4CDG A;  3T8T A;  5E18 F;  3TP0 A;  2R7O A;  2LVS A;  1HKQ A;  3VOE A;  3KZI C;  5E8G A;  1MMN A;  3ELK A;  5HNF A;  2ZCW A;  3VEP A;  1WJA A;  3OYD A;  1R1V A;  4E7L A;  4BXU A;  4XLH A;  2BE5 F;  1FMW A;  2HQN A;  1SAN A;  1J5Y A;  4ZYE A;  3CO6 C;  3OYK A;  4HQE A;  1HC8 A;  1TTY A;  2K86 A;  3LA2 A;  5EZG A;  1SC7 A;  2QGU A;  5ERI A;  2OA4 A;  5F0F A;  3TP3 A;  1VQK I;  1Y0U A;  3L2R A;  3WTT C;  2FQ4 A;  2KKO A;  3HIF A;  4AU7 A;  4UUV A;  3BTI A;  3KCC A;  1XDS A;  4FIS A;  2QYO A; 
#chains in the Genus database with same CATH homology
 2X9D A;  2LKX A;  3GTK J;  2ID3 A;  4M3F A;  1VI0 A;  1HLV A;  4Y7N J;  5EEA A;  2X48 A;  3S16 J;  1VFC A;  3PO3 J;  1WH7 A;  1IRZ A;  2DMU A;  4BBR J;  2H1K A;  2R5Z B;  3Q0U A;  2AO9 A;  2M8G X;  1IDY A;  5FKO A;  4A93 J;  1DU6 A;  2ELK A;  1RR7 A;  1FTT A;  2Y9Y A;  2LY9 A;  1RET A;  5J1R A;  5M5X J;  1W0U A;  1ZR2 A;  2O9L A;  1GVD A;  2M2E A;  3O8H A;  4DW6 A;  2CJJ A;  4A69 C;  1XG1 A;  5JLW A;  2GM4 A;  5EG0 A;  3OSG A;  1WPK A;  2CQQ A;  2MW8 A;  3A02 A;  4A3E J;  4BKX A;  4BBS J;  4IHX A;  3S14 J;  2CU7 A;  1JJ8 C;  3SJM A;  5GPA A;  1QRY A;  2O7O A;  5C44 J;  2FX0 A;  3A03 A;  1ORK A;  2NOG A;  1I50 J;  3BG9 A;  3IH2 A;  2K40 A;  1GV5 A;  5IYD J;  3IH3 A;  1TWC J;  4A3F J;  2COB A;  5DS9 A;  4A3K J;  4LOC A;  3A01 B;  4Y52 J;  3LSG A;  2TCT A;  1GUU A;  3Q3S A;  1F36 A;  2HDD A;  1IJW C;  3DCF A;  2Y2Z A;  2KT0 A;  2QCO A;  2DMP A;  1BL0 A;  3TW7 A;  5EF6 A;  3QPL A;  2N8G A;  3I4N J;  4MO7 A;  2Y0S N;  1S7E A;  2G0E A;  4QSH A;  3B6C A;  4BY1 J;  2R93 J;  1YRN A;  1K83 J;  1UMQ A;  1GDT A;  1VND A;  1X2M A;  1X2N A;  3HOX J;  2D5V A;  1JGG A;  3BQY A;  2E2I J;  5IP9 J;  4W97 A;  4A3B J;  5F1J A;  2HYJ A;  3BG5 A;  3GTJ J;  3OOU A;  4M3B A;  2O8K A;  4BY7 J;  1U8B A;  2L7F P;  3FK6 A;  1JJ6 C;  5FKN A;  2NS8 A;  3BT9 A;  4DYQ A;  4C3H J;  4AYB N;  2HXI A;  5EGO A;  3FK7 A;  1O4X A;  1MNM C;  4D7M A;  1WI3 A;  4UUT A;  3CMY A;  3M4O J;  1AKH A;  4S0H B;  4D5C A;  4CYC B;  1X58 A;  1EF4 A;  3BQZ A;  5K7F A;  3D1N I;  2ID6 A;  1G2H A;  3LSJ A;  4DZP A;  5M5W J;  2XGD A;  1T56 A;  2CUE A;  3JRF A;  1POG A;  3TED A;  2LTP A;  4MIM A;  5GP9 A;  1UHS A;  3ZQC A;  2HXO A;  2HQ5 A;  1P7J A;  5K7H A;  1XC5 A;  5E3M A;  1IV6 A;  2TRT A;  2R5Y A;  2XSD C;  2ME6 A;  3CQZ J;  2LK2 A;  2FJ1 A;  2VPR A;  1U9O A;  4FE4 A;  2DA5 A;  3HKZ N;  3SFI A;  1HOM A;  2VKE A;  3ZQH A;  1LE8 A;  4AC0 A;  1RKT A;  2PMZ N;  5J1U A;  3BR5 A;  3G1M A;  2YUS A;  4B4C A;  3FIW A;  3MN2 A;  4I76 A;  2LFB A;  4M3E A;  4JYK A;  4DYC A;  4A3G J;  1IUF A;  2EZK A;  5IP7 J;  3HGY A;  5IYC J;  3JRD A;  3S1Q J;  3LOC A;  1ETK A;  4A3J J;  4ABZ A;  1FIP A;  2XGC A;  1JKQ C;  2JWT A;  1U9N A;  5C3E J;  2L7Z A;  4UUS A;  1JKP C;  2DA2 A;  1JUP A;  2EBI A;  1YRN B;  2ZB9 A;  2RAE A;  4CYC A;  2DA7 A;  4DYR A;  3JRH A;  2K9N A;  5E3O A;  1SFO J;  1W0T A;  2HOS A;  3RKQ A;  4JX5 A;  3M3Y J;  3BG3 A;  2NVQ J;  2DMT A;  3OSF A;  1FEX A;  1B72 A;  1OCT C;  1VF9 A;  1BW6 A;  3O8G A;  1H8A C;  3UKG A;  2CRG A;  2DA6 A;  2GLO A;  2Y9Z A;  1ITY A;  1ZK8 A;  3DEW A;  2EZL A;  3HM5 A;  3VPR A;  4IEJ A;  1LFB A;  2H8R A;  4FTH A;  2DMN A;  5FLM J;  1OJL A;  1HCR A;  5J1Y A;  3CDL A;  2NVT J;  1ETQ A;  2M34 A;  4FE7 A;  5EGO B;  4HNV A;  2WV1 A;  3W6V A;  1WH5 A;  1AKH B;  3LSP A;  4IHV A;  2YU9 J;  3GTQ J;  4G12 A;  3ZQL A;  1FTZ A;  2EZI A;  3HOU J;  2ME0 A;  3BR1 A;  1Z77 A;  1AU7 A;  4GFB A;  3BR0 A;  3PO2 J;  4JX4 A;  2LD5 A;  5C4J J;  5JLX A;  1TWH J;  1R9T J;  1IDZ A;  1PUF A;  1MBH A;  1H88 C;  4J19 A;  2R0Q C;  1FIA A;  4IHY A;  1MSE C;  2R5Y B;  1QVU A;  1JTY A;  4X1E A;  3JRC A;  2QF7 A;  3S1M J;  1ETY A;  4XK4 A;  2Y30 A;  3S1N J;  1AHD P;  1HDD C;  2LR8 A;  2CQX A;  1F43 A;  2K9Q A;  5BNG A;  4I6Z A;  1LE8 B;  5IP6 A;  3S15 J;  2X6O A;  3HOW J;  3NAR A;  2VI6 A;  3FIS A;  2HOA A;  3JRB A;  3RZO J;  1P7I A;  3S17 J;  2LP0 A;  3CCY A;  3BTC A;  4FCY A;  5F0H A;  3NAU A;  5GPC A;  1ZQ3 P;  1TWA J;  4UUS B;  2Y31 A;  5DTD A;  5IOY A;  2JMW A;  1FJL A;  4MLO A;  3Q0W A;  2JJ7 A;  2ECB A;  4W1U A;  5F27 A;  1WCM J;  3F0C A;  1JT0 A;  1UG2 A;  1JTX A;  3B6A A;  1B72 B;  1OCP A;  2MGQ A;  5FJ8 J;  2K9S A;  4D7N A;  3MKL A;  5EDN A;  1XS9 A;  3Q0V A;  2IBD A;  3FKI J;  4M6V A;  1U78 A;  3BR2 A;  4XID A;  3S1R J;  1QVT A;  1OFC X;  3MVP A;  3TW6 A;  1K61 A;  3BTL A;  2XB0 X;  1ZGW A;  1B8I A;  3S2H J;  1I6H J;  1BW5 A;  1RES A;  4V2G A;  4X6A J;  2I10 A;  1IC8 A;  5EZH A;  3G1L A;  1MBK A;  3JRA A;  3K7A J;  4AUX A;  2EH3 A;  1GT0 C;  2DN0 A;  1TWF J;  3SDG A;  2MSY A;  5IPA A;  2JA7 J;  1HDP A;  1JUS A;  3RZD J;  3HOV J;  4C3J J;  4D5F A;  2DMQ A;  1RPW A;  5FLV A;  2IEK A;  2JK3 A;  4MFD A;  4XRS G;  1I3Q J;  5IYB J;  3HEF A;  2L7M P;  4B3A A;  3JRI A;  1PUF B;  3ZQI A;  1GV2 A;  3GBG A;  4IHW A;  1MBG A;  1ETV A;  5F08 A;  5FKM A;  4M3G A;  2JA8 J;  3G1O A;  3H3V K;  1ETO A;  2XPU A;  3HBL A;  1MH4 A;  2EZH A;  1JKR C;  1TWG J;  5E3N A;  3K2A A;  4L5E A;  1MBE A;  3QPS A;  2CUF A;  3S2D J;  4BXX J;  2XRL A;  1A6I A;  3H0G J;  4QTR A;  2AHQ A;  2E1O A;  4V2F A;  1A5J A;  2L9R A;  3WHB A;  2OF7 A;  4QIW N;  2DA3 A;  1Q1V A;  2FD5 A;  4B1R A;  3L1P A;  2WB1 N;  3E7L A;  1MBJ A;  1Z0X A;  2LLK A;  5IOZ A;  1BA5 A;  2E2H J;  2M0C A;  4NDL A;  2E19 A;  1Y1W J;  2JN6 A;  4MFE A;  2DA1 A;  2DTZ A;  2GBY A;  3RQI A;  4RDU A;  3BTJ A;  1D5Y A;  2IAI A;  2ECC A;  3BR3 A;  4C2M J;  2R92 J;  2DA4 A;  3HOZ J;  1NTC A;  2R5Z A;  1H89 C;  5F04 A;  1BJZ A;  4XIC A;  5C4X J;  2EQR A;  1ETW A;  2DJN A;  2XPW A;  1ZTR A;  1T33 A;  5M5Y J;  3I4M J;  3ZQG A;  1MSF C;  5K7Z A;  4JP0 A;  5HOD A;  2NVY J;  4XRM A;  1B8I B;  2L0K A;  2JA6 J;  3IH4 A;  5FKK A;  4C3I J;  2B63 J;  3GTG J;  2P81 A;  3PM1 A;  5E3L A;  5M3F J;  1MH3 A;  3OIO A;  1DU0 A;  4RBO A;  3ZOB A;  1IGN A;  1CQT A;  4DZJ A;  1ZKG A;  3WHC A;  2YS9 A;  2XPV A;  3JRG A;  4A3M J;  1WGX A;  1RKW A;  3QQA A;  3JRE A;  1MBF A;  2HOT A;  4XRS A;  3HOY J;  2WAQ N;  3HDD A;  2VUM J;  3GTM J;  5EYR A;  2HI3 A;  4M3D A;  3ZQF A;  1Y1V J;  4A3I J;  1JKO C;  2NVX J;  2E2J J;  2R7Z J;  1ETX A;  1NK3 P;  3HGG A;  1TC3 C;  4A3D J;  3IV5 A;  3GTL J;  3TP0 A;  4A3C J;  2LVS A;  3BR6 A;  1ENH A;  2NS7 A;  1APL C;  5F0C A;  3LNQ A;  2XGE A;  5FKL A;  1IG7 A;  2XB5 A;  2MG4 A;  2JA5 J;  1HF0 A;  3C2B A;  4EEF G;  3JR9 A;  3A01 A;  1LFU P;  1SAN A;  2OPT A;  3GTP J;  3GTO J;  3HB9 A;  1JT6 A;  4A3L J;  5EZG A;  5F0F A;  5J3L A;  3TP3 A;  9ANT A;  5EG0 B;  3LSR A;  2FQ4 A;  2M9H A;  1JUM A;  4JX6 A;  5M3M J;  2VKV A;  1ZR4 A;  1QPI A;  3BTI A;  1E3O C;  2KDZ A;  4FIS A;  1NK2 P;  2W48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...