4A3EJ

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3eJ00
2EZIA 3MN2A 2LKXA 1B8IA 2R93J 4Y52J 1TWHJ 3BQYA 5C3EJ 4MO7A 4D5FA 4A3CJ 1IUFA 3TW6A 5BNGA 3M4OJ 1A6IA 2DA3A 1JKPC 3Q3SA 1F43A 1IV6A 4QIWN 1JGGA 1CQTA 3TP0A 2CUFA 2XGCA 5EG0A 1LFBA 1FJLA 3LSGA 2Y31A 2M9HA 2XRLA 4C2MJ 3H3VK 4A3EJ 5IYDJ 2DMNA 1YRNB 4M3GA 1RETA 4UUTA 1QPIA 1ZQ3P 5K7FA 2Y2ZA 2X48A 4I76A 4CYCA 2P81A 2NVTJ 4DYRA 2NVXJ 2K9SA 4QSHA 1AHDP 2XB0X 1B8IB 2WAQN 1JJ8C 2QF7A 2DA5A 3FK7A 5EGOB 3BT9A 1BA5A 2I10A 2G0EA 4XK4A 4A3LJ 5EZHA 1RKWA 2JJ7A 5HODA 2LP0A 1X2NA 2ME6A 5EDNA 2K40A 4JP0A 2M0CA 4X1EA 1GV2A 2R0QC 1ZTRA 3GTJJ 2XGDA 3IV5A 4JX5A 3HKZN 4CYCB 2TCTA 3DEWA 1LFUP 3HOZJ 2GLOA 2LR8A 1OJLA 1JTXA 2XGEA 5IYBJ 5GPCA 2B63J 1QVUA 2LD5A 4D5CA 5EF6A 1MNMC 2EZLA 3BTIA 3QQAA 1POGA 3A01A 1WCMJ 3FISA 2L7ZA 3BQZA 3LSJA 3HOXJ 4A3IJ 1I3QJ 2DMPA 5JLWA 4I6ZA 1GT0C 1VFCA 3JRIA 3SJMA 4FTHA 3ZQIA 1RR7A 1SFOJ 2NVQJ 3JREA 2AO9A 2R5ZA 5F0FA 1MBJA 1X2MA 1BJZA 3D1NI 1WI3A 2YU9J 1JKOC 3UKGA 2DA2A 3HOVJ 2JK3A 2VKEA 2R5YA 3S15J 2XSDC 1ZR2A 1RPWA 3PM1A 2IBDA 3BR1A 2LLKA 2AHQA 3SDGA 5J1UA 4MIMA 5IPAA 2DMQA 5FKKA 4V2GA 3WHBA 3ZQFA 3A01B 3S1RJ 2HYJA 3WHCA 2M8GX 1D5YA 4XRMA 4B1RA 3S1NJ 4DYQA 1JTYA 4DZJA 2M2EA 1UHSA 4BKXA 1K83J 1MSFC 5IYCJ 1MBFA 5M5WJ 2Y9YA 3JRCA 3E7LA 1QRYA 1HDPA 1WGXA 3TP3A 1I50J 2XPUA 1ZKGA 5M5YJ 1OFCX 1IDYA 4FCYA 1JKQC 3HOUJ 4A3BJ 2DA6A 2ID3A 1OCPA 3NAUA 3OIOA 2R5YB 3IH2A 1TWCJ 2IAIA 2WB1N 3H0GJ 5M5XJ 3G1LA 5EZGA 5FLVA 1TWGJ 2KDZA 2CRGA 3ZQCA 4MLOA 5E3MA 3ZQGA 4S0HB 4AUXA 4IEJA 2EH3A 4LOCA 3LNQA 3BR5A 4NDLA 2DA1A 5DTDA 2EZHA 1IDZA 4BXXJ 4DW6A 1BW5A 4RDUA 1P7IA 1IGNA 1MSEC 5IOYA 1NK3P 2Y0SN 1IC8A 1JKRC 2E2IJ 1MBHA 1W0TA 3BTJA 3GTMJ 3W6VA 3GTOJ 4C3IJ 2E19A 2Y30A 2DTZA 5F27A 2DA7A 5GP9A 3LSPA 2ECBA 3Q0UA 1BL0A 1Z77A 3JRFA 2H8RA 5IP7J 1WH5A 3O8GA 5F0CA 4XRSG 5FLMJ 5M3MJ 2MG4A 3G1OA 1FTZA 1AKHA 1XS9A 3S14J 5EG0B 1U9OA 4BY7J 2X6OA 2RAEA 2PMZN 3RQIA 3CDLA 1P7JA 1TWFJ 1T33A 4UUSA 3S2HJ 3FIWA 4G12A 1MBEA 2CJJA 2HXIA 2HOSA 1HLVA 5IOZA 1MH4A 3B6CA 2Y9ZA 3JR9A 1WPKA 3A02A 5IP9J 4BBSJ 2COBA 4A3FJ 1JUPA 1FIAA 4V2FA 2FQ4A 2W48A 1ITYA 1SANA 2JMWA 2XPWA 3CCYA 2ELKA 4XIDA 1ETVA 3ZOBA 5F0HA 2JA7J 5E3NA 1R9TJ 4QTRA 2DA4A 2GBYA 1IRZA 2R7ZJ 4X6AJ 1AKHB 2R92J 2O7OA 2FX0A 2QCOA 4FISA 3OSGA 3TEDA 3Q0WA 2X9DA 2MGQA 4IHWA 3MVPA 4JYKA 2FD5A 3I4NJ 4A3MJ 1A5JA 4BY1J 5DS9A 4XRSA 5FKNA 3I4MJ 2HXOA 2OF7A 5K7ZA 1B72A 4JX4A 4BBRJ 5K7HA 3RKQA 4A3DJ 2JA5J 2NOGA 5FKMA 5FJ8J 2LVSA 1HCRA 5C4XJ 1ETYA 2E1OA 5J1RA 2CQQA 1JJ6C 1U78A 3OSFA 1JT0A 2L9RA 2XPVA 1ZR4A 3OOUA 2DMTA 3VPRA 1APLC 4ABZA 1MH3A 3TW7A 1ORKA 4L5EA 5E3LA 3A03A 5F04A 1HOMA 3BR6A 2HI3A 3B6AA 3FKIJ 1VNDA 1AU7A 1B72B 1H89C 4A3GJ 2R5ZB 3LSRA 2EQRA 1Z0XA 3QPLA 3MKLA 1K61A 1QVTA 4M3DA 1XG1A 1ZK8A 1IJWC 3HBLA 1ETOA 1JT6A 1S7EA 1NK2P 4AYBN 1HDDC 2TRTA 3JRBA 2IEKA 1ZGWA 3NARA 3PO3J 1PUFA 2L0KA 1BW6A 2JA6J 5EYRA 2YUSA 2O8KA 3F0CA 5FKOA 2ZB9A 2HQ5A 2H1KA 2GM4A 2VI6A 1FIPA 1EF4A 4IHYA 5F1JA 1ETWA 2E2JJ 3S2DJ 4M6VA 1MBGA 1XC5A 3LOCA 5EGOA 1GDTA 2CQXA 3HEFA 1MBKA 2NS8A 2HOAA 2DN0A 1UMQA 1WH7A 5M3FJ 2ID6A 2HDDA 3S17J 1T56A 5C4JJ 2EZKA 3JRGA 3HOYJ 2NVYJ 3BG3A 3L1PA 4B3AA 1G2HA 1Y1VJ 2MSYA 1PUFB 5JLXA 2VPRA 3CMYA 3GTLJ 1H8AC 1FTTA 4A93J 4M3BA 1H88C 1X58A 2L7MP 3BR0A 1VI0A 2K9NA 3S1MJ 1GUUA 4C3JJ 3FK6A 4B4CA 3JRDA 1NTCA 1FEXA 2VKVA 1JUMA 4MFEA 3M3YJ 1U9NA 3HGGA 5F08A 2DJNA 4Y7NJ 2LFBA 2N8GA 4M3FA 4AC0A 3GTKJ 1F36A 1O4XA 2O9LA 1ETQA 1LE8A 2JN6A 3GTPJ 1RKTA 3BG5A 1ETKA 2KT0A 1TWAJ 1IG7A 4JX6A 1VF9A 5EEAA 2LK2A 3HOWJ 4UUSB 4M3EA 3C2BA 2LTPA 2ME0A 3HDDA 4A3KJ 2L7FP 4GFBA 1I6HJ 4DYCA 3RZOJ 5IP6A 3IH3A 3GBGA 2K9QA 4RBOA 2ECCA 4D7MA 1ENHA 3IH4A 4W97A 3BTLA 5GPAA 4A3JJ 4W1UA 4A69C 1GV5A 1JUSA 4C3HJ 1W0UA 5J1YA 1DU6A 1ETXA 3K7AJ 3RZDJ 1Y1WJ 2MW8A 2OPTA 2WV1A 3ZQLA 1LE8B 3HB9A 4IHVA 5FKLA 3G1MA 5C44J 3QPSA 4FE7A 5J3LA 2D5VA 1OCTC 2EBIA 3DCFA 4IHXA 4DZPA 3GTGJ 1Q1VA 3CQZJ 4XICA 2E2HJ 3HM5A 2DMUA 3JRHA 9ANTA 2CU7A 2VUMJ 3HGYA 3GTQJ 1U8BA 2NS7A 2JA8J 1UG2A 2CUEA 3BR3A 1E3OC 2HOTA 3BTCA 1TC3C 3S1QJ 4J19A 3BR2A 1RESA 2M34A 2LY9A 3SFIA 3BG9A 1HF0A 2FJ1A 3PO2J 3Q0VA 3JRAA 4D7NA 1YRNA 5E3OA 3K2AA 3O8HA 4MFDA 3S16J 1GVDA 2XB5A 2JWTA 4EEFG 4HNVA 3ZQHA 1DU0A 2YS9A 4FE4A
chains in the Genus database with same CATH superfamily
2EZIA 3MN2A 2LKXA 2M8EA 1B8IA 2AXTC 2E35A 2PEXA 3GO5A 3MZHA 3GLLA 4Y52J 1UCRA 3PNVA 4D5FA 4HV6A 2L9NA 5HOOA 3ZGKA 2XKPA 2X85A 2VOOA 1A6IA 4L5IA 1FX7A 1JKPC 4MQ9F 2MLGA 1CQTA 2CUFA 4A5MA 2WWYA 4NBQA 4EJUA 4IJAA 2JPCA 3G3ZA 4ENJA 2JRTA 4C2MJ 4K2EA 1S6LA 4HX8A 2YR2A 1AA7A 2DMNA 4DGWB 1YRNB 5IYDJ 1TBXA 1QPIA 3BJ6A 4CYCA 1W7PB 3BPXA 4OOIA 2F2EA 3SZGA 2NVTJ 4CH7A 2IS2A 5LEJA 4NC8A 1P6RA 1B8IB 3OYLA 1JJ8C 1TLHB 4RGSA 2CWEA 1W36D 4U0WA 4CCNA 2DA5A 1XMXA 1O3SA 3D5SC 1XTAA 2FNAA 3FK7A 3QYFA 4XRFA 2FE3A 5EGOB 3BT9A 3OYDA 3CDIA 4XK4A 2XAJA 3T5XA 4RLFA 3H0DA 4C2UA 1UHMA 2ZXJA 3M8FA 4KN7X 2JSCA 1IN8A 1R71A 3SEZA 3CJTB 2K40A 4JP0A 2BZTA 1MNDA 5CVRA 2R0QC 5LRRA 1O57A 1ZTRA 2LRDA 2M0MA 2X1EA 3FM3A 1ZREA 4B43A 3UR3C 4JX5A 2NNNA 2XAUA 3KEYA 4CYCB 1JE8A 4DIQA 2A61A 2TCTA 3DEWA 5KK1A 1OCRH 2LR8A 3KP4A 4MNUA 5IYBJ 2CV2A 4KFCA 4MEXF 3BOQA 1Z3XA 3VYSB 1OPCA 4EGYA 2IS4A 3W2WA 4LMYA 2CH0A 2KL4A 1LB2A 1LJ9A 1W5CC 5E8GA 5LHGA 4XSXF 2ZMEA 4B3XA 2EZLA 1DQUA 4L9NA 1ZRDA 2ZXIA 2Z16A 3VOEA 3A01A 2EILH 3M7GA 2L7ZA 3WG9A 3K6GA 4ESBA 1R4MB 1ONVA 4JBAA 2L4MA 1SD6A 2CYYA 3TMOA 2NVQJ 3FF5A 2UZKA 3D0SA 1H9GA 2FUG2 3EYYA 1GVJA 1BI1A 3OL3A 3AG3H 3HOVJ 1YJNI 2XSDC 1V5FA 3PM1A 1O3RA 3RKWA 3R4KA 2ZMEB 3H5NA 1LKXA 1XGSA 5FKKA 4EM1A 2VC0A 2CGPA 5D5UB 3A01B 3S1RJ 1SFKA 4LLGF 1R58A 1TL8A 2TDXA 4B1RA 4XRMA 2Q2EB 4DYQA 1JTYA 4DZJA 5HVQC 2M2EA 1UHSA 4BKXA 3GWZA 5JHUA 1YS7A 4N9IA 1V4RA 2M4KA 2Y9YA 3JRCA 1X19A 2L9VA 3E7LA 2HQAA 1V54H 2ZBKA 2XPUA 3QOEA 5M5YJ 2QSFX 2JUGA 2P6SA 3HOUJ 3QAHA 3QP6A 3I64A 4NC6A 1D0XA 3V42A 3MWMA 4CCMA 2BVMA 2BW3B 1OCPA 3BJAA 3NAUA 4YFXF 1R7JA 3WTYC 2VJ5A 4RAZA 3N4MA 2X6WA 1PYVA 2ZMEC 3G1LA 4NUBA 1J0RA 1FOYA 3RQ4A 5JVGF 2X4HA 5FLVA 5CLSA 4EV0A 3C2HA 2DDAA 4N9HA 5A2QZ 1JGSA 4XLEA 5TGTA 2FNPA 2RVCA 5L3BA 3WU2C 3BC8A 3KP2A 4HLYA 3DP7A 3HSEA 4AUXA 4FX4A 1LQ1A 2EH3A 2FA5A 3LNQA 1P4XA 1IDZA 1WJAA 4DW6A 1T2KA 2DPUA 2VQHA 4WF2A 1YHQI 4E7LA 3HTSB 1W4MA 4XKCA 2KP6A 1Z6RA 5IOYA 2M30A 1T98A 2Y48A 4V19K 3CCSI 3BTJA 3GTMJ 3BLYA 3CZ6A 3W6VA 3GTOJ 4ASNA 2DTZA 1JXSA 2W25A 2ECBA 5IT9K 3DQVC 1Z77A 3JRFA 4HX7A 1WH5A 2OZUA 2X0LA 3O8GA 1W7PD 4ZC3A 4XRSG 5FLMJ 2K3PA 3EUAA 4MHGA 2BYVE 4CCOA 1MJ9A 2EV6A 5EG0B 4LJZF 5ERIA 4E7IA 4A12A 1R5ID 5D5WB 1FWZA 1I6XA 1P7JA 3DXJF 2EFQA 4UUSA 3FIWA 4CICA 2CJJA 5KHDA 3OYCA 1BR1A 3P9CA 2GA1A 1XX5A 2MC4A 3B6CA 2OBPA 3A02A 4RM3A 2BY3A 1FMVA 4XKVA 1G3YA 1FIAA 2VT2A 1VZ0A 1SANA 2FMLA 1ITYA 2Z3YA 2ELKA 1U5TA 4O3MA 1FPQA 3ZOBA 2AS5F 1NG7A 4YEJA 5F0HA 1REPC 1YYVA 2JA7J 5ICEA 1K79A 1IRZA 4X6AJ 2Z33A 3I9V2 2O7OA 4IHWA 4CSWA 1USSA 2DFFA 2FD5A 3DFGA 1WJ5A 2VQCA 4IRGA 2EA2A 5ILVA 3M1CA 2KISA 3X2QH 4XRSA 3F22A 5CQGA 2HTJA 3KX2A 2HXOA 2VKHA 4II2A 4FX0A 2AXLA 5K7ZA 2O3FA 4EGZA 2OZ6A 3GX4X 3ABKH 3GFLA 4JX4A 4BBRJ 5K7HA 3OS1A 5FKMA 5FJ8J 2DT6A 5C4XJ 1ETYA 3T8TA 1U5TB 1X1BA 1SFUA 1MW7A 3HRMA 2V9PA 2QWWA 3RPQA 2ZC2A 2QENA 1G4DA 2CS3A 3AG4H 3OSFA 1JT0A 1VQNI 4XLAA 3OOUA 5GTIC 2K7LA 3DU6A 4CZCA 3DEUA 4C2TA 1ORKA 4S05A 1LFPA 1OCCH 2DBBA 4LK0F 1MJBA 1D8JA 1HOMA 4E6KG 3F8CA 3OOPA 3FKIJ 1K6YA 1AU7A 3DLAA 2DQLA 1H89C 4HQEA 2OQGA 3ROUA 1VQ7I 1Z0XA 3QPLA 4PFPA 2STTA 4M3DA 4B44A 1U5TC 3G2BA 3LMMA 1ETOA 4I02A 1YE9A 1S7EA 4G7OF 3JRBA 3GCMA 1ZGWA 4KUMA 1PUFA 2H1LA 1O3TA 3KIOA 1F9NA 2VONA 1DPUA 2ZB9A 5FB2A 3DBRB 4A0ZA 2H1KA 4BU2A 4P9UA 4DBRA 5ED4A 3IRQA 5KAIC 5F1RA 1TNTA 4MGRA 4M6VA 4G7HF 1MMNA 3F23A 2W85A 1IO2A 1XC5A 1EH7A 1I39A 1ZGAA 3NEUA 4CO8A 3U21A 1JHFA 3HEFA 1BI3A 1HW5A 2M4GA 2LF7A 4H4KC 4F55A 1LEAA 3E1SA 3HJEA 3OIQA 1J9IA 1Z05A 2OD5A 2Y0MA 3PSIA 4EMSA 1YW8A 3F6OA 4CXFA 2NVYJ 3L1PA 3CUQA 3FZVA 1GXPA 1ZGJA 1Y1VJ 4Y33A 4OIPF 4X0GA 4P96A 2MSYA 1PUFB 4HF1A 2X1DA 4WK8F 1QBJA 2EFNA 3CLQA 5TISC 1R5HA 1QHHD 3LQRA 1G3WA 2EIJH 3CF2A 4BQOA 2RQPA 4L9JA 1X58A 4LD5A 1XGMA 4L18B 1UB9A 4OMYA 1V5GA 1U2WA 5JR3A 2F5FA 2K9NA 4A0YA 3L2RA 3JTHA 4RMNA 2OC6A 3H3ZA 4LITA 2VKVA 3WGIA 2COMA 2F5CA 3CUQB 4RLQA 2ZFWA 3MFKA 1DUXC 3M3YJ 1E3HA 4U7BA 4KIFA 4BHPA 5FFXA 5F08A 4E4HA 1IZ1A 3VEPA 4Y7NJ 4CA0A 3C3WA 4HSRA 3KYLA 3CCRI 4BJ6C 1FY7A 3K1PA 4HX4A 1IG7A 3DBLB 1QA6A 1HSTA 2WV0A 4U0YA 2IGNA 4M3EA 4PDKA 3IC7A 2DO7A 3A0BC 4A3KJ 1Y0NA 4XLCA 3AKZA 4ITVA 1BC7C 5HNHA 1WFXA 2VE9A 1XPXA 1XGNA 3RZOJ 5IP6A 5HDNA 3GBGA 3KCCA 3UNGC 2V1UA 3CMEI 1ACIA 1ENHA 3IH4A 2VJIA 3ZMVA 1KYZA 3QYBA 4BXFA 3CUQC 2YPRA 4W1UA 2D1HA 4C3HJ 3HTUA 1UELB 4FT8A 1DU6A 4KT5C 1EKEA 1ETXA 5K5OA 3K7AJ 1Y1WJ 3W6JB 2A68F 4CCKA 3BCBA 2FBIA 2P7VB 3BWGA 2RQQA 5FROA 1S3JA 3CJQB 1ZRFA 3FM5A 3H5AA 1A04A 5J3LA 2QEXI 4WX9A 3GF2A 4PSWA 4YFKF 2PLYA 4IHXA 3ZR8X 3ZQQA 1J7KA 3K4CA 2R7OA 3KPHA 2JUCA 3DF8A 1Q1VA 2DODA 2PFBA 4HAMA 3TOAA 3CCUI 4Y13A 2DMUA 2E1CA 3ZCOA 3GTQJ 1U8BA 2NS7A 4ZYAA 2V79A 4F3QA 2HOTA 2GQQA 2NOJB 2EIKH 4J19A 3BR2A 1RESA 1Z21A 1G3TA 2ZFUA 3OYGA 3L2VA 4HV5A 5D8KB 4F7ZA 2UXNA 3MQ0A 2GOMA 4YIIA 2L7KA 3ASOH 2V1NA 3LFUA 2JVHA 2V26A 3K2AA 1GVDA 3H9JA 1OYIA 3LL7A 5LRSA 1SEUA 2F5EA 3K10A 1DU0A 2NRAC 3FBNB 3BQYA 2FXAA 4A3CJ 1JHHA 1HKQA 3PNTA 1J59A 2WADA 1OMIA 2DA3A 3WE3A 2HZTA 4UY8I 3Q3SA 1F43A 3K9TA 3OWTA 4QIWN 1D3YA 1JGGA 3GZ6A 3RPUD 1HKTA 3I59A 2AQEA 1BIAA 1USTA 2W82A 2XF6A 3H36A 1U3EM 5J40A 2KKOA 1ZHFA 3EQLF 4ZDPA 1HW1A 3FXUA 1ZQ3P 3SQNA 5K7FA 1FP1D 4I76A 1OISA 2P81A 4Q47A 4BQNA 1QO0D 2NVXJ 2W00A 3GVAA 3EYIA 4QSHA 1AHDP 2DT5A 3S3NA 4HNUA 4U0VA 3E6DA 2H94A 3SZPA 3TDZC 4QLCU 3IHUA 3L00A 4HZFA 2CQNA 1BA5A 2I10A 3TGNA 4G6TB 5LGNA 5A2QK 3M1EA 4A3LJ 5EZHA 4JK1X 2JJ7A 2O03A 4MTDA 3DKWA 3I59B 1MMGA 2HGCA 2CUJA 3BG6A 3K4BA 1X2NA 2ME6A 4XLPF 4ENNA 5E17F 3CCLI 1W36C 1MMAA 4J01A 1QZEA 4M9SA 5B66C 3GTJJ 1SAXA 4GYIA 3HKZN 4LLNA 3A4CA 4PGGA 1DPRA 3CJRB 3K4NA 1LDKB 1RUOA 3EPZA 2K9MA 3HOZJ 1WZ2A 1FT9A 4M6XA 4LB5A 3TOBA 1OYWA 2B63J 1DDNA 5E1WA 3TKYA 3DWLE 3L2UA 1UJ8A 4R8HA 3GYHX 2KPMA 1J09A 3FISA 5DM7F 4I6ZA 1GT0C 2LF8A 4O5VA 1VFCA 4CZZA 4FTHA 1ZG5A 2JPBA 1RR7A 3KEOA 3OYBA 1XDUA 1LVKA 2AO9A 2HS5A 2R5ZA 1MBJA 2HFHA 1P4AA 1X2MA 4ANJA 4RA2A 3PIOF 1FOKA 1WI3A 3KLOA 1A36A 3UKGA 4YELA 1YX3A 2F6CA 3ABTA 2WY8Q 3BR1A 1AWCA 2AHQA 5J1UA 2VQLA 4KDPA 5KCMA 2DMQA 1YFHA 3F21A 5D6FA 3ZQFA 1VQPI 2KIFA 3TDUC 1SD7A 5HNFA 3E5UA 3E0JB 2B9SA 1MSFC 3WTZA 2XSJC 3ASNH 3PUBA 4PJJA 5M5WJ 5L3CA 4BHBA 3JSPA 1ZKGA 1QHGA 2ESNA 1JKQC 3QPTA 1V3FA 2ZCWA 3GLXA 2D45A 2LSOA 2DA6A 2EJRA 3LSMA 1BOAA 3OIOA 3RJPA 1K7AA 4GDFA 2ELJA 4IPAA 3MKZA 1MJAA 1TWCJ 2F48A 2WB1N 1ZARA 2KDOA 3K1NA 4XNFA 2M87A 1YIOA 1IRGA 2PG4A 3RKYA 3WGGA 3PJRA 3C1DA 2HZDA 2HYFA 2XGXA 1B6AA 1VQOI 1LPQA 1EJ9A 1YLFA 1V55H 3CTAA 4LIVA 2QQ8A 1X3WB 4IEJA 4A2UA 2E34A 4LOCA 2H09A 4BQAA 2DA1A 5DTDA 2EZHA 2ZNZA 4L9TA 1BW5A 3LSTA 4ZYGA 4I98B 3VODA 4RDUA 1S8NA 2HNHA 1BOBA 2LC2A 2IA0A 3BROA 5D8LB 4KA4A 2Y0SN 1JKRC 2Z9OA 1MBHA 3WODF 2R7WA 1R36A 5F27A 3ZQ7A 3IWZA 5GP9A 1BL0A 1OYYA 2H8RA 3DTKA 5IP7J 3IP4B 5DDGA 5F0CA 1FYMA 3P5JA 5M3MJ 2MG4A 1QZYA 3I4PA 4ZYDA 1XS9A 3RKXA 2JRMA 3VYUB 1EH6A 4XR6A 1U9OA 2ETHA 3FHZA 1NHAA 3OYMA 3CDLA 2KRHA 2Y69H 2FEZA 1BI2A 3SEQA 5GAEJ 1MGTA 4PFOA 2WAQA 2X51A 1X1DA 2CUZA 2Y9ZA 4GO1A 5BMZA 1A31A 5IP9J 4BBSJ 2COBA 3O3KA 1IN6A 1K6OA 1D0ZA 2W48A 3L9FA 1C0WA 1WI9A 2LY1A 2RREA 2PMUA 3K4JA 1ETVA 2ZNYA 4HG2A 4M6YA 1SD5A 2L9SA 1R9TJ 4QTRA 4FASD 1KU2A 1SFEA 2DA4A 2GBYA 2RC4A 1IN7A 2HOEA 3TQNA 4QPOA 2QCOA 3OSGA 1T0FA 2B7EA 3Q0WA 5GAGJ 4HNTA 1R6RA 2VBWA 4HSTA 4HEA2 3JSOA 3BPVA 5J8CA 2OF7A 2KZVA 2RNJA 3HG9A 1RZ4A 2NOGA 1TP4A 3N05A 2QZ8A 1YQAA 2PJRA 1JJ6C 2I8DA 3JAMK 2XROA 1U78A 5HLIA 1Y8QB 2L9RA 3I53A 1P4WA 1PJRA 3U1DA 5J47A 4RM2A 2DMTA 3VPRA 4ABZA 2JT1A 2KJBA 1R4NB 3TW7A 1R22A 2ZO4A 5CVJA 2A5YB 3ABLH 4UB6C 4IF4A 1FZPB 1LDJA 1G6NA 1TQPA 2OA4A 2PJPA 4Z2YA 3BR6A 5DCMA 1MIJA 2GOXB 4CYDA 3B6AA 3J7ZI 2A05A 4E7HA 1SAUA 1G3SA 2JSPA 3I54A 2EQRA 5L3GA 3MKLA 4E7JA 2BXYA 4F91B 3COAC 1MMSA 4YIRX 4KT6A 5FO5A 3L2QA 4Y4RA 4A6EA 3D5LA 3BJOA 2V6EA 1STZA 1JT6A 4XSZF 5L3EA 1NK2P 4P5OA 1HQCA 2IEKA 5HDGA 2DFEA 3SXYA 4ON0A 1MMDA 2L0KA 4AVPA 4UUVA 1BW6A 1TQIA 4NNJA 4OIOF 1VTNC 2PBIA 3O2PE 3F0CA 4BUPA 2HQ5A 1LNWA 2MD5A 5DCMB 4ENKA 4WXHA 1AOYA 1FIPA 4E70A 1EF4A 1BM9A 3SHFA 2E2JJ 1P92A 3CCMI 3KYDB 3E6CC 4NHJA 1UZCA 1VQ9I 2CQXA 1BIBA 4D1QA 3HYIA 1GHCA 3HOTA 2P4WA 2EA4A 2HOAA 1UMQA 1WH7A 5M3FJ 1D1AA 4G7ZF 3KFWX 3ZMSA 3DPLC 1T56A 2EPFA 5EEGA 5J8FA 5C4JJ 3HOYJ 4BDYA 1G2HA 2ISYA 2LH9A 3F72A 1VQ5I 3W2AA 1SMYF 4C9YA 2K27A 2R3SA 4HPQA 5JLXA 3V8KA 2QQBA 3WTWC 2FOKA 1BJAA 1XCBA 4OAYA 4KITB 3GFIA 1TW2A 3RYPA 4I0BA 4D0PA 5LHHA 5D4RA 2LG4A 1H88C 1FOWA 1LEBA 5GAHJ 1Z1DA 2BOLA 1FP2A 3BR0A 4BE0A 4LG3A 5ICGA 3JW4A 2BEOA 1YX5A 2L54A 2DFHA 4C3JJ 2BGCA 1D5VA 5ILSA 3CLOA 2V9KA 1KA8A 1X3ZB 1ZLKA 2DPDA 3SDBA 3J7AO 2K86A 5LD2C 1JUMA 2VLAA 4Y3OA 4M74A 2P5VA 1U9NA 1X4PA 3KP3A 3T1BA 3P7NA 3RCOA 2DJNA 3KLNA 4EATA 5H6QA 2PMZA 2QUFA 4G8XA 4M3FA 2P8TA 4PJMA 2P6TA 3F6VA 2HDWA 1WJDA 5GTHC 2DQRA 3GTKJ 1F36A 2BXZA 3JCUC 2O9LA 3Q9SA 3ZMDA 4GGGA 5B1AH 2IGKA 3BG5A 1ETKA 5DD8A 4G6QA 5EEAA 1H0MA 5IY5H 2LK2A 4UUSB 1ZYRF 2LTPA 2QKMB 2ME0A 1XGOA 4I99C 2GIZA 1WVRA 3WE2A 4FETA 1W5SA 3IH3A 2K9QA 3HRSA 2B0LA 1EA3A 4RBOA 4DOZA 2VXDA 4W97A 1T95A 1DGWY 5GPAA 2Q1ZB 3MCZA 1W0UA 2R7VA 4LIUA 5J1YA 2DXIA 1W5TA 3RZDJ 3A0HC 3A2KA 1IRXA 2OPTA 4BEHA 4LG0A 3VYTB 1A35A 5CPRB 2WTEA 2ADUA 4B09A 4AIKA 3IKVA 2WBMA 1BBYA 3IWFA 4MTEA 4ZTFA 3D5RC 4J00A 3MKYB 1OCTC 3RPUA 4CHUA 2OV7A 3J81K 1I5ZA 1KYWA 2VB6A 4G6DA 4U87A 3CQZJ 2E2HJ 3HM5A 1ZELA 4XONA 3VFZA 2FF4A 3GMEA 9ANTA 3CESA 2LDUA 1FYLA 2CUEA 4EQQA 3L2CA 3CMAI 1IN5A 2HQRA 2IXSA 2KIQA 3FDYA 2DOAA 2M34A 3LSHA 5LHIA 2GWRA 3FKJA 4I7HA 4BEHB 3VWBA 4LG0B 3R6SA 1SVMA 3BG9A 5BOXA 3PO2J 2XDVA 3Q0VA 3K4MA 4D7NA 4NC7A 3REOA 3VB2A 1Y8RB 3O8HA 1RRJA 3FX3A 4MFDA 5HLTA 2HR3A 3WGHA 4EEFG 3CC4I 3CO6C 3FXRA 4IRIA 3W6KB 4P9FA 4OU0A 2YS9A 1IXCA 2IW5A 4IQJA 4HDVA 2CV1A 4GRIA 1VQ6I 3AG1H 1IUFA 1IXSB 5H2FC 3HC7A 2XIGA 5BPIA 3TW6A 2A6TA 5BNGA 4CCLA 4AYBA 3RIRA 3TO9A 2R4GA 3IRRA 1IV6A 1BR2A 4RGUA 2XGCA 5FLXZ 1TT5B 3F8BA 1RI7A 2XRLA 3H3VK 2QQ9A 2K02A 3NWSA 3H92A 4UUTA 2Y2ZA 4PJNA 1ZG1A 4XMYA 4DYRA 4BJTA 3IKTA 2OU2A 1TZLA 1P2FA 2K9SA 2XB0X 4WXDA 4YRVA 2Z99A 3SZTA 3BDDA 1Y0UA 4TV7A 1WKMA 3CO7C 4KYWA 4EJTA 4PJLA 2GXAA 3V8LA 2HVRA 5DEQA 2G9WA 4Y17A 2EFWA 3ECHA 2O6GE 3GFJA 4Q4ZF 1QZZA 2ZJPF 2MH2A 1RKWA 4XN0A 3E97A 2L3DA 3F3XA 5HODA 1PP8F 2WY7Q 2JQ7A 2M0CA 4X1EA 1GV2A 2OUMA 3H5RA 2K3FA 5D5XB 2XGDA 3IV5A 3OR1C 4S04A 2ICWG 1DP3A 1BR4A 3ZMUA 4HRIA 1IF1A 1MNEA 2K85A 3U1KA 3MKWB 1DGRM 2GLOA 1BN5A 2DTRA 2PQ8A 1OJLA 3E6MA 4XOTA 1KGSA 3QWLA 1X1CA 5H20A 2NVUB 2Z1DA 5HS8A 1QVUA 3GW2A 1HKSA 3FXLA 2LD5A 5EF6A 2XC7A 3WU0A 2XUBA 4UV8A 1MNMC 2R7UA 3WTSC 3ERMA 3BTIA 3QQAA 1S7AA 3KP6A 3V7CA 1POGA 2F4IA 2XF7A 2LKPA 3BQZA 3SYTA 2QYOA 4DNCA 3HOXJ 4BE2A 4A3IJ 1I3QJ 5JLWA 1OLTA 4OMZA 2P5KA 3ZQIA 2IVMA 3HRUA 4CUGA 3JREA 1PDNC 3OS2A 2J5OA 3Q9VA 3V7SA 3PNYA 1SMTA 3R0JA 3D1NI 4ESJA 1JKOC 2YU9J 3G6EI 1YJ9I 5LGTA 2VKEA 3S15J 3OS0A 1ZR2A 4ZDOA 1RPWA 2GIVA 2CQKA 2IBDA 5D5VB 3HXLA 3BG7A 1FSHA 2Z5UA 3PFYA 3QOPA 5IPAA 1N77A 2VBYA 2DT7B 2DAOA 3AAFA 2HYJA 4HOBA 2M8GX 3WHCA 1Z91A 1D5YA 3S1NJ 2ZXWH 1QU3A 3VYRB 2XASA 2HPMA 1K83J 3OYFA 4ZH4F 4EM2A 1MBFA 3ZPLA 3FXOA 1QRYA 1D1CA 3CCJI 4AD9A 2CW0F 1WGXA 3TP3A 2W84A 4RB1A 4MEYF 4A3BJ 4G9YA 4IHTA 2E5ZA 2ID3A 1WWXA 1S29A 2PMHA 3IH2A 2BBYA 2CSOA 4ZYEA 3ABUA 5M5XJ 3M9AA 1FBQA 2MFZA 1F4KA 3OYEA 1ZH5A 5EZGA 2XRNA 4IXAA 1TWGJ 3FXJA 2CRGA 3ZQCA 4MLOA 1I3AA 1Y56A 2VT3A 5E3MA 3ZQGA 1IW7F 2R7QA 3E5QA 1B59A 3FXMA 2M7BA 3BR5A 2FOWA 2W4SA 4BXXJ 1MDMA 1WJEA 3OL4A 3HSFA 2KMUA 4A0XA 3CDHA 2E1NA 2QBYA 1IGNA 1X4OA 2IP2A 1MSEC 1NK3P 1VQMI 1IC8A 1ZAOA 4AVZA 4ZJZA 3HOSA 2FBHA 2ISZA 5TJJA 2CQ7A 3MZ8A 2E19A 1N75A 3EDPA 4KICA 2DA7A 4HYEA 3LSPA 4C30A 1VQ4I 3HSRA 1T08B 3Q0UA 3K2ZA 3ABMH 3I0TA 2CV0A 2RGVA 2A3SA 4E7SA 1I1GA 1HXDA 5E8IA 4Y15A 3G1OA 3OMYA 3V7RA 1AKHA 2EWNA 3KP7A 3S14J 4UB8C 3ZRGA 2KRFA 2L01A 2XAQA 2LREA 4ZDLA 2RAEA 1YJWI 1Z9CA 1MKMA 1TWFJ 1MDMB 1U6GA 4G12A 5J4VA 4OIRF 3AFHA 1MBEA 2HXIA 1RNLA 2HOSA 3BCAA 2L2OA 3KEQA 2QBYB 1HLVA 2ESHA 3LSKA 3JR9A 2DK8A 3SFZA 2FBKA 4A3FJ 4BACA 4N0BA 2ZXHA 4XM3A 2FQ4A 2GA2A 4QWQA 4M9ZA 2JMWA 2XPWA 3CCYA 1HW2A 4XIDA 3QU6A 3CCEI 1FYKA 1R1VA 5E3NA 1NH3A 2R7ZJ 1AKHB 2EK5A 4PJ0C 2M1BA 3TEDA 2VASA 1IUYA 1Q1HA 2M45A 4NQWA 1PVEA 2GXGA 2MGQA 2RDPA 2X9DA 2HTSA 3MVPA 2WAEA 4JYKA 1TQMA 1S9HA 1OR7A 4A3MJ 1BC8C 4BY1J 1SVOA 4RGXA 5DS9A 4B48A 4D9JA 1FMWA 5FKNA 2LNBA 3LAJA 1YTYA 2NXNB 1YITI 1QNTA 2EINH 3RKQA 4E7KA 1F5TA 3CC2I 3V8JA 3HL2A 2MD0A 2JA5J 2LVSA 2QLZA 3CP2A 1R00A 3QYEA 3HIFA 4JOMA 5EEHA 1Z6TA 1A6QA 4LGWA 3IL2A 3DTIA 2R7SA 3DBHB 2NNYA 2XPVA 3OYHA 1ZR4A 4ZZLA 5F6FA 1APLC 2A5WA 2J5PA 4NQWB 3K70D 1SD4A 4N4OB 1S72I 1JI8A 4L5EA 2NAZA 2KZGA 5CYVA 3RYRA 2ELHA 1XCVA 4CDGA 2HWVA 1X1AA 5JFRA 4HQMA 3FHNA 2HI3A 1FOXA 1VNDA 3HRTA 4RAGA 1TT0A 2R7XA 1B9MA 2AQFA 2DDBA 5FFZA 2ZKZA 2R5ZB 3LSRA 3ELKA 3HHGA 1J2XA 1K61A 2E5NA 2E71A 4KIBA 1QVTA 3ISPA 4BS9A 2UUZA 1XG1A 5B5EC 1ZK8A 2DJIA 2LYCA 2O61A 2HDCA 4AIDA 2ACJA 2H27A 3I58A 2IA2A 1WRJA 3H35A 1HDDC 1Z7UA 2LY2A 4RB0A 3NARA 1B1BA 3I3LA 4PGHA 5LBQA 1CGPA 3PO3J 2MH9A 5HS7A 1YW7A 3M8JA 2JA6J 3C2GA 3NQOA 5EYRA 4DQ2A 1OCOH 2O8KA 3PQKA 1O7FA 4HLXA 5DUIA 1T39A 4IHSA 1S5LC 1YI2I 2C6YA 5F1JA 1ETWA 1GLNA 4IHYA 3S2DJ 1PP7U 1MBGA 4XKWA 3JTGA 2QGUA 5EGOA 5E20A 3KZYA 4AU7A 2I5UA 3CUOA 3OIPA 2ID6A 2L02A 2HDDA 3S17J 4OWRB 3KZZA 5LEKA 1T6SA 3JRGA 2EZKA 4UNOA 2WA0A 1TNSA 2KIUA 4B3AA 2XAGA 3IAM2 2DU9A 2M3AA 1KQ9A 2L4AA 3F8NA 4L0YB 2HU9A 1Y6IA 3GUDA 3H1CA 2FMYA 2VPRA 2XAFA 3GTLJ 2EB7A 4ZYHA 4A93J 2QKLB 4DBQA 1FBSA 1UHWA 4M3BA 1UAAA 2XF5A 4ZTJA 2FU4A 2HQNA 1YW9A 3KP5A 5DM6F 3W2VA 1G59A 1XB4A 1KU3A 1QQIA 3S3OA 3S1MJ 2KQRA 2HYGD 4B4CA 3JRDA 3ML6A 1XD7A 1NTCA 5FLXK 1WHUA 2VN2A 2QQAA 3WTTC 3TO6A 1X3UA 1VQLI 3I71A 3HGGA 3R60A 2LMDA 1KU9A 2LFBA 3CCQI 4YIFA 5TRDA 2N8GA 1O4XA 4BGDA 2JN6A 3NRVA 5AIQA 3GTPJ 4M73A 2XKOA 2KT0A 4XKBA 5DYMA 4JX6A 2X1CA 1XMAA 3HOWJ 3C2BA 4UV9A 4ETSA 1Z7LA 4IO9F 3HDDA 4GFBA 2VL8A 4DYCA 1SFXA 2CMPA 2ECCA 4D7MA 3G4SI 5CJ9A 1O7LA 2VODA 4I2OA 4FHTA 2MBFA 3C18A 5CKTA 1GV5A 1JUSA 3LQQA 1F1ZA 2HEOA 2Q2EA 5BQTA 1ZRCA 1KU7A 4F52A 3I5UA 2E7WA 1YIJI 2V6CA 3HB9A 3MEXA 4IHVA 2LBFA 3E5XA 4RAYA 5FKLA 3RDIA 3G1MA 5C44J 3QPSA 4FE7A 2DYRH 2RN7A 3AL0B 1RIOH 4DJAA 5J6XA 1H9TA 1FBUA 3IAS2 4U88A 4WCGA 1YO5C 3DCFA 3DKXA 2BW3A 4OINF 4DZPA 3GTGJ 4ESFA 3GEZA 2P7CB 4XICA 1QPMA 4OIQF 2R7DA 5HS9A 2BHZA 3JRHA 1FNNA 3PSFA 2Q8KA 1TTYA 3DPUA 3KZIC 2CU7A 4XQFA 3HGYA 2VUMJ 2LOOA 2PJRB 1UG2A 3T8RA 1E3OC 1RUNA 1LDDA 2MC3A 1PUEE 3U2RA 2DFIA 3TBIA 4BXUA 2W57A 4EJWA 1B4AA 2IGMA 4L5JA 3I55I 1HF0A 5HLGA 2DK5A 1T0FC 3JRAA 1D8KA 2LBFB 2DYSH 3U9GA 4IX7A 3BZCA 5B1BH 4H0EA 3MZYA 3OY9A 2JWTA 5BPDA 5E18F 3AL0C 3ULQB 2A6EF 3QPHA 2KHMA 3ZN0A 3JRIA 4FE4A 2R93J 3EUHA 3F8MA 4KIGA 5AONA 1TWHJ 1WSUA 5C3EJ 4MO7A 2YU3A 3HPHA 1U0JA 3K0LA 2EV5A 4KN4X 3RI4A 3ZMZA 1N78A 1MD0A 3M4OJ 1L0OC 3B73A 1VQKI 3H9QA 2W24A 4B47A 5CQEA 3TP0A 3J80Z 3CCVI 1HA8A 5EG0A 1LFBA 4XL9A 1FJLA 3LA2A 1RC9A 5KNLA 2OCCH 3LSGA 1B9NA 2Y31A 2M9HA 4A3EJ 3V4GA 2Q0OA 4M3GA 1RETA 1ERDA 2X48A 1FLIA 3PFIA 4KMFA 2XHKA 1ZG3A 4F93B 1ULYA 2WAQN 2CFXA 1DP7P 2KLOA 2OAZA 2QF7A 1EH8A 2FSWA 4OAZA 2HPIA 5CVVA 1ZN2A 4BQQA 2G0EA 3CJNA 1ON2A 2XV4S 3GZ5A 3FXKA 4IOCF 2W1OA 2VPLA 2LP0A 5EDNA 1E3PA 2KJCA 4BYYA 1ON1A 3H9GA 2A6HF 1FSEA 3K4KA 3MAJA 5DUKA 4RS8A 1Z3YA 3PQJA 4U7DA 1LFUP 2YX4A 3K69A 1E17A 1XDSA 4BH9A 3HUGA 3FMQA 1JTXA 2XGEA 2DW4A 3F9KA 1K4SA 3EETA 3EUHC 4PUSA 3M07A 5GPCA 1CF7A 1V5EA 2VBXA 3C7JA 5KVRA 4D5CA 4BJ5C 3ZP5A 1Y39A 2WC2A 2VJ4A 3FWEA 5E1XA 5ICFA 1WCMJ 3LSJA 2DMPA 2IPQX 2K4BA 3VDXA 2R7FA 4II3A 3CP8A 1KQ0A 3SJMA 2IA1A 2RKHA 4JQFA 4RB3C 4AIJA 1SFOJ 2E7XA 2IS1A 3E6BA 3HUGB 5F0FA 3W3CA 2G7HA 2V4JC 3R61A 4LLLA 2ZSHB 1G8XA 1BJZA 1O3QA 5HLHA 2O8XA 1CF7B 2DA2A 2JK3A 2R5YA 2P5LC 1IAWA 4KNYA 4CGZA 2LLKA 4IKFA 3G73A 2GZWA 3SDGA 4MIMA 4IRHA 4RGRA 4BL0B 4V2GA 3WHBA 4KISA 1ZLJA 2STWA 3IUOA 1YOVB 2VOPA 5F64A 2V1DA 5IYCJ 2E60A 4BNCA 1LVAA 4EJVA 1HDPA 3OYNA 1I50J 2ZJQF 1OCZH 1IDYA 1OFCX 4FCYA 2H6CA 4RAFA 3OYIA 1W1WE 2Z2SB 3Q5FA 1S7OA 4XLHA 4MQVA 1XMKA 4GCVA 2R5YB 4CCJA 3DEEA 2IAIA 2IRFG 2XVCA 3R0AA 3H0GJ 2VQGA 2E36A 3S8PA 2KDZA 2ZSIB 3S32A 3ZN1A 1P9QC 4IQ4A 4S0HB 5GADJ 2KIMA 1U8RA 3ZQHA 4HW0A 4NDLA 3DV8A 4PK4A 4GYGA 4Q48A 2BHYA 4PZJA 2EV0A 3PUFA 2KRCA 5FRNA 1P7IA 1IV8A 2ZJRF 1Z67A 2OCEA 2E2IJ 1W0TA 1IRFA 2L5QA 2UWMA 4WXCA 4C3IJ 2Y30A 1XSXA 3A1YA 4KMUX 4B8XA 2R7RA 3DKYA 1R49A 5FD5A 1WJBA 1FTZA 4LFUA 2VJJA 2X6YA 2KFDA 1OQYA 2HKXA 4UVCA 1HSJA 4BY7J 2EFOA 2VBZA 2X6OA 1I27A 2PMZN 3RQIA 1T33A 3S2HJ 4PSXA 2RNGA 4G94A 4L9VA 4UVAA 1R1UA 4P55A 2DCEA 4XLNF 5IOZA 1MH4A 5KAFC 2NS0A 4YG2F 3OYKA 2QVOA 2DOEA 1WPKA 2DLLA 3EUKL 3QODA 1K78A 3FXQA 1JUPA 1T38A 3B02A 2XAHA 1N25A 4RB2C 1UG0A 4V2FA 2HKOA 2V7FA 3MD2A 3WTXC 2CFOA 2JVGA 4AWXB 3JAMZ 5BS6A 4HDUA 3S93A 3CC7I 5ICCA 5FRMA 5B3SH 3OV8A 2CG4A 3G71I 2F5VA 2R92J 2FX0A 4FISA 4Z6YA 2QA4I 4ENMA 3HKZA 4BDZA 2OTJI 3I4NJ 2JTVA 4P1WA 3RSNA 3J7YJ 1TW3A 2PX9A 1A5JA 5E1ZB 2QSHX 6PAXA 3T0YA 3I4MJ 3F8FA 1FC3A 1B72A 4BHCA 2VC1A 5CVIA 3LWFA 1K78B 2K5CA 4BAYA 2PI0A 4A3DJ 3TL4X 2GXBA 2CO5A 2LKSA 4UHTA 4AIHA 3ERED 2V1XA 1HCRA 1L3LA 2E1OA 5J1RA 2CQQA 2Y75A 4M71A 1XSDA 1MZBA 2EFPA 4M72A 3L2WA 4E7ZA 2QSGX 2D2WA 2FQ3A 1MH3A 3WU1B 3OYJA 3BZKA 3WTVC 5E3LA 2JZYA 1KZHA 3A03A 2K9LA 4L0ZB 5F04A 2MYSA 4I0AA 5AIPA 2BE5F 2BV6A 1R23A 2UV1A 4HBLA 3ESWB 2CW8A 1B72B 4AM3A 4A3GJ 3L7WA 4KJZA 1M1EB 1HC8A 2GAUA 3K70C 3HHHA 3O6BB 4IZZA 1ODDA 3P9IA 1QGPA 1IJWC 1E2XA 3HBLA 2D1VA 4IL6C 2R7TA 4EVIA 3LFKA 4AYBN 1NG6A 4R1HA 3KETA 4IVNA 2TRTA 5IT9Z 1EV7A 3DPTA 3HZJA 2O5RA 3GZNB 1J75A 5LLQA 3GFMA 2A07F 5EJCA 5JVTA 2V9VA 2YUSA 5FKOA 4I01A 2GM4A 3TO7A 1WJFA 4HF0A 2VI6A 3WG7H 2O0YA 4UXNA 1WQ2A 1R1TA 3LOCA 1GDTA 2EIMH 4XOPA 5DCFA 1MBKA 2NS8A 2WB1A 4M9XA 1RR8C 2DN0A 1UFMA 3FMSA 4R79A 3K1MA 3J7AY 3OYAA 1KQ8A 5DD4A 3BG3A 1LUJB 3ONQA 3LAPA 2JA2A 2HVQA 4EJOA 2IJLA 3L09A 2HVSA 5CVUA 2WAFA 5LFAA 5FD6A 1K4TA 3RTRA 3CMYA 4A6DA 2W7NA 1H8AC 1FTTA 3LSIA 4O6JA 2BY1A 3FBIB 2MA3A 3HPGA 4A5NA 1SC7A 4UVBA 4IOAF 2L7MP 2Y0SA 4QPQA 1XSVA 4YFNF 1VI0A 2DI3A 2H6BA 1GUUA 4LK1F 5JI6A 3FK6A 4F92B 3J80K 2QM3A 4XN3A 5J4YA 5K1YA 3I56I 3LA3A 3NWTA 1FEXA 2P0WA 3WTUC 2BY2A 3FMRA 4MFEA 4GXOA 3BP8A 3ZXSA 3H3UA 3P9KA 3BZ6A 2OQRA 3ZMTA 5K5RA 2VKDA 1X1PA 5H6RA 4AC0A 1ETQA 1LE8A 3PL8A 4N4NB 2ZJ2A 1RKTA 2YX7A 1TWAJ 3E3VA 2A69F 1VF9A 4BE1A 3M8EA 3BY6A 5LGUA 2L7FP 3PIPF 3N97A 1I6HJ 2UXXA 2BY0A 3VSKA 3LA7A 3J81Z 2RV8A 1GXQA 3DTEA 2VIXA 2PN6A 3GXOA 1J5YA 2YSRA 3K4LA 3DU5A 1HBXG 3BTLA 1D1BA 3CF5F 3KE2A 3VSLA 3AG2H 5L3FA 4A3JJ 4ZZDA 2DOFA 2IT0A 4A69C 1E0EA 2IGOA 4XORA 2F4MB 4NB5A 3QRFF 3S2WA 3MMYB 2MW8A 1IXRC 2G7UA 2CW7A 2WV1A 3ZQLA 2K4JA 1R5GA 1LE8B 5IT3A 1WJCA 3QP5A 1XN7A 2E1MB 2F5DA 2MABA 1YS6A 2X6XA 2D5VA 5HDKA 1T8IA 1SVLA 1D0YA 2EBIA 1KONA 1I1SA 4HA8A 3CD6I 4XLFA 4XBFA 4I09A 5K5QA 1IN4A 3CMMA 3ECOA 4LB6B 5L3DA 3KYCB 1YG2A 2JA8J 3BR3A 2FRHA 3BTCA 5D6EA 3QU3A 1TC3C 2VE8A 3S1QJ 2BVLA 4EM0B 2OTLI 2MLKA 1BI0A 4WWCA 2LY9A 2F4OB 2VXZA 5ILUA 3SFIA 2FJ1A 2M5WA 4FQGA 5FGMA 3DLLF 1YRNA 2IS6A 5D4SA 2M7AA 5JHFA 4HF2A 4Q5SF 5E3OA 3S3MA 1W7PA 1VQ8I 2H8WA 3S16J 2E1MC 1OR7C 2XB5A 4PCQA 3OR2C 5DV5A 4HNVA 2NYXA 2OJED 1OKRA 5E79C
chains in the Genus database with same CATH topology
2EZIA 3MN2A 2LKXA 1B8IA 2R93J 4Y52J 1TWHJ 3BQYA 5C3EJ 4MO7A 4D5FA 4A3CJ 1IUFA 3TW6A 5BNGA 3M4OJ 1A6IA 2DA3A 1JKPC 3Q3SA 1F43A 1IV6A 4QIWN 1JGGA 1CQTA 3TP0A 2CUFA 2XGCA 5EG0A 1LFBA 1FJLA 3LSGA 2Y31A 2M9HA 2XRLA 4C2MJ 3H3VK 4A3EJ 5IYDJ 2DMNA 1YRNB 4M3GA 1RETA 4UUTA 1QPIA 1ZQ3P 5K7FA 2Y2ZA 2X48A 4I76A 4CYCA 2P81A 2NVTJ 4DYRA 2NVXJ 2K9SA 4QSHA 1AHDP 2XB0X 1B8IB 2WAQN 1JJ8C 2QF7A 2DA5A 3FK7A 5EGOB 3BT9A 1BA5A 2I10A 2G0EA 4XK4A 4A3LJ 5EZHA 1RKWA 2JJ7A 5HODA 2LP0A 1X2NA 2ME6A 5EDNA 2K40A 4JP0A 2M0CA 4X1EA 1GV2A 2R0QC 1ZTRA 3GTJJ 2XGDA 3IV5A 4JX5A 3HKZN 4CYCB 2TCTA 3DEWA 1LFUP 3HOZJ 2GLOA 2LR8A 1OJLA 1JTXA 2XGEA 5IYBJ 5GPCA 2B63J 1QVUA 2LD5A 4D5CA 5EF6A 1MNMC 2EZLA 3BTIA 3QQAA 1POGA 3A01A 1WCMJ 3FISA 2L7ZA 3BQZA 3LSJA 3HOXJ 4A3IJ 1I3QJ 2DMPA 5JLWA 4I6ZA 1GT0C 1VFCA 3JRIA 3SJMA 4FTHA 3ZQIA 1RR7A 1SFOJ 2NVQJ 3JREA 2AO9A 2R5ZA 5F0FA 1MBJA 1X2MA 1BJZA 3D1NI 1WI3A 2YU9J 1JKOC 3UKGA 2DA2A 3HOVJ 2JK3A 2VKEA 2R5YA 3S15J 2XSDC 1ZR2A 1RPWA 3PM1A 2IBDA 3BR1A 2LLKA 2AHQA 3SDGA 5J1UA 4MIMA 5IPAA 2DMQA 5FKKA 4V2GA 3WHBA 3ZQFA 3A01B 3S1RJ 2HYJA 3WHCA 2M8GX 1D5YA 4XRMA 4B1RA 3S1NJ 4DYQA 1JTYA 4DZJA 2M2EA 1UHSA 4BKXA 1K83J 1MSFC 5IYCJ 1MBFA 5M5WJ 2Y9YA 3JRCA 3E7LA 1QRYA 1HDPA 1WGXA 3TP3A 1I50J 2XPUA 1ZKGA 5M5YJ 1OFCX 1IDYA 4FCYA 1JKQC 3HOUJ 4A3BJ 2DA6A 2ID3A 1OCPA 3NAUA 3OIOA 2R5YB 3IH2A 1TWCJ 2IAIA 2WB1N 3H0GJ 5M5XJ 3G1LA 5EZGA 5FLVA 1TWGJ 2KDZA 2CRGA 3ZQCA 4MLOA 5E3MA 3ZQGA 4S0HB 4AUXA 4IEJA 2EH3A 4LOCA 3LNQA 3BR5A 4NDLA 2DA1A 5DTDA 2EZHA 1IDZA 4BXXJ 4DW6A 1BW5A 4RDUA 1P7IA 1IGNA 1MSEC 5IOYA 1NK3P 2Y0SN 1IC8A 1JKRC 2E2IJ 1MBHA 1W0TA 3BTJA 3GTMJ 3W6VA 3GTOJ 4C3IJ 2E19A 2Y30A 2DTZA 5F27A 2DA7A 5GP9A 3LSPA 2ECBA 3Q0UA 1BL0A 1Z77A 3JRFA 2H8RA 5IP7J 1WH5A 3O8GA 5F0CA 4XRSG 5FLMJ 5M3MJ 2MG4A 3G1OA 1FTZA 1AKHA 1XS9A 3S14J 5EG0B 1U9OA 4BY7J 2X6OA 2RAEA 2PMZN 3RQIA 3CDLA 1P7JA 1TWFJ 1T33A 4UUSA 3S2HJ 3FIWA 4G12A 1MBEA 2CJJA 2HXIA 2HOSA 1HLVA 5IOZA 1MH4A 3B6CA 2Y9ZA 3JR9A 1WPKA 3A02A 5IP9J 4BBSJ 2COBA 4A3FJ 1JUPA 1FIAA 4V2FA 2FQ4A 2W48A 1ITYA 1SANA 2JMWA 2XPWA 3CCYA 2ELKA 4XIDA 1ETVA 3ZOBA 5F0HA 2JA7J 5E3NA 1R9TJ 4QTRA 2DA4A 2GBYA 1IRZA 2R7ZJ 4X6AJ 1AKHB 2R92J 2O7OA 2FX0A 2QCOA 4FISA 3OSGA 3TEDA 3Q0WA 2X9DA 2MGQA 4IHWA 3MVPA 4JYKA 2FD5A 3I4NJ 4A3MJ 1A5JA 4BY1J 5DS9A 4XRSA 5FKNA 3I4MJ 2HXOA 2OF7A 5K7ZA 1B72A 4JX4A 4BBRJ 5K7HA 3RKQA 4A3DJ 2JA5J 2NOGA 5FKMA 5FJ8J 2LVSA 1HCRA 5C4XJ 1ETYA 2E1OA 5J1RA 2CQQA 1JJ6C 1U78A 3OSFA 1JT0A 2L9RA 2XPVA 1ZR4A 3OOUA 2DMTA 3VPRA 1APLC 4ABZA 1MH3A 3TW7A 1ORKA 4L5EA 5E3LA 3A03A 5F04A 1HOMA 3BR6A 2HI3A 3B6AA 3FKIJ 1VNDA 1AU7A 1B72B 1H89C 4A3GJ 2R5ZB 3LSRA 2EQRA 1Z0XA 3QPLA 3MKLA 1K61A 1QVTA 4M3DA 1XG1A 1ZK8A 1IJWC 3HBLA 1ETOA 1JT6A 1S7EA 1NK2P 4AYBN 1HDDC 2TRTA 3JRBA 2IEKA 1ZGWA 3NARA 3PO3J 1PUFA 2L0KA 1BW6A 2JA6J 5EYRA 2YUSA 2O8KA 3F0CA 5FKOA 2ZB9A 2HQ5A 2H1KA 2GM4A 2VI6A 1FIPA 1EF4A 4IHYA 5F1JA 1ETWA 2E2JJ 3S2DJ 4M6VA 1MBGA 1XC5A 3LOCA 5EGOA 1GDTA 2CQXA 3HEFA 1MBKA 2NS8A 2HOAA 2DN0A 1UMQA 1WH7A 5M3FJ 2ID6A 2HDDA 3S17J 1T56A 5C4JJ 2EZKA 3JRGA 3HOYJ 2NVYJ 3BG3A 3L1PA 4B3AA 1G2HA 1Y1VJ 2MSYA 1PUFB 5JLXA 2VPRA 3CMYA 3GTLJ 1H8AC 1FTTA 4A93J 4M3BA 1H88C 1X58A 2L7MP 3BR0A 1VI0A 2K9NA 3S1MJ 1GUUA 4C3JJ 3FK6A 4B4CA 3JRDA 1NTCA 1FEXA 2VKVA 1JUMA 4MFEA 3M3YJ 1U9NA 3HGGA 5F08A 2DJNA 4Y7NJ 2LFBA 2N8GA 4M3FA 4AC0A 3GTKJ 1F36A 1O4XA 2O9LA 1ETQA 1LE8A 2JN6A 3GTPJ 1RKTA 3BG5A 1ETKA 2KT0A 1TWAJ 1IG7A 4JX6A 1VF9A 5EEAA 2LK2A 3HOWJ 4UUSB 4M3EA 3C2BA 2LTPA 2ME0A 3HDDA 4A3KJ 2L7FP 4GFBA 1I6HJ 4DYCA 3RZOJ 5IP6A 3IH3A 3GBGA 2K9QA 4RBOA 2ECCA 4D7MA 1ENHA 3IH4A 4W97A 3BTLA 5GPAA 4A3JJ 4W1UA 4A69C 1GV5A 1JUSA 4C3HJ 1W0UA 5J1YA 1DU6A 1ETXA 3K7AJ 3RZDJ 1Y1WJ 2MW8A 2OPTA 2WV1A 3ZQLA 1LE8B 3HB9A 4IHVA 5FKLA 3G1MA 5C44J 3QPSA 4FE7A 5J3LA 2D5VA 1OCTC 2EBIA 3DCFA 4IHXA 4DZPA 3GTGJ 1Q1VA 3CQZJ 4XICA 2E2HJ 3HM5A 2DMUA 3JRHA 9ANTA 2CU7A 2VUMJ 3HGYA 3GTQJ 1U8BA 2NS7A 2JA8J 1UG2A 2CUEA 3BR3A 1E3OC 2HOTA 3BTCA 1TC3C 3S1QJ 4J19A 3BR2A 1RESA 2M34A 2LY9A 3SFIA 3BG9A 1HF0A 2FJ1A 3PO2J 3Q0VA 3JRAA 4D7NA 1YRNA 5E3OA 3K2AA 3O8HA 4MFDA 3S16J 1GVDA 2XB5A 2JWTA 4EEFG 4HNVA 3ZQHA 1DU0A 2YS9A 4FE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZI A;  3MN2 A;  2LKX A;  1B8I A;  2R93 J;  4Y52 J;  1TWH J;  3BQY A;  5C3E J;  4MO7 A;  4D5F A;  4A3C J;  1IUF A;  3TW6 A;  5BNG A;  3M4O J;  1A6I A;  2DA3 A;  1JKP C;  3Q3S A;  1F43 A;  1IV6 A;  4QIW N;  1JGG A;  1CQT A;  3TP0 A;  2CUF A;  2XGC A;  5EG0 A;  1LFB A;  1FJL A;  3LSG A;  2Y31 A;  2M9H A;  2XRL A;  4C2M J;  3H3V K;  4A3E J;  5IYD J;  2DMN A;  1YRN B;  4M3G A;  1RET A;  4UUT A;  1QPI A;  1ZQ3 P;  5K7F A;  2Y2Z A;  2X48 A;  4I76 A;  4CYC A;  2P81 A;  2NVT J;  4DYR A;  2NVX J;  2K9S A;  4QSH A;  1AHD P;  2XB0 X;  1B8I B;  2WAQ N;  1JJ8 C;  2QF7 A;  2DA5 A;  3FK7 A;  5EGO B;  3BT9 A;  1BA5 A;  2I10 A;  2G0E A;  4XK4 A;  4A3L J;  5EZH A;  1RKW A;  2JJ7 A;  5HOD A;  2LP0 A;  1X2N A;  2ME6 A;  5EDN A;  2K40 A;  4JP0 A;  2M0C A;  4X1E A;  1GV2 A;  2R0Q C;  1ZTR A;  3GTJ J;  2XGD A;  3IV5 A;  4JX5 A;  3HKZ N;  4CYC B;  2TCT A;  3DEW A;  1LFU P;  3HOZ J;  2GLO A;  2LR8 A;  1OJL A;  1JTX A;  2XGE A;  5IYB J;  5GPC A;  2B63 J;  1QVU A;  2LD5 A;  4D5C A;  5EF6 A;  1MNM C;  2EZL A;  3BTI A;  3QQA A;  1POG A;  3A01 A;  1WCM J;  3FIS A;  2L7Z A;  3BQZ A;  3LSJ A;  3HOX J;  4A3I J;  1I3Q J;  2DMP A;  5JLW A;  4I6Z A;  1GT0 C;  1VFC A;  3JRI A;  3SJM A;  4FTH A;  3ZQI A;  1RR7 A;  1SFO J;  2NVQ J;  3JRE A;  2AO9 A;  2R5Z A;  5F0F A;  1MBJ A;  1X2M A;  1BJZ A;  3D1N I;  1WI3 A;  2YU9 J;  1JKO C;  3UKG A;  2DA2 A;  3HOV J;  2JK3 A;  2VKE A;  2R5Y A;  3S15 J;  2XSD C;  1ZR2 A;  1RPW A;  3PM1 A;  2IBD A;  3BR1 A;  2LLK A;  2AHQ A;  3SDG A;  5J1U A;  4MIM A;  5IPA A;  2DMQ A;  5FKK A;  4V2G A;  3WHB A;  3ZQF A;  3A01 B;  3S1R J;  2HYJ A;  3WHC A;  2M8G X;  1D5Y A;  4XRM A;  4B1R A;  3S1N J;  4DYQ A;  1JTY A;  4DZJ A;  2M2E A;  1UHS A;  4BKX A;  1K83 J;  1MSF C;  5IYC J;  1MBF A;  5M5W J;  2Y9Y A;  3JRC A;  3E7L A;  1QRY A;  1HDP A;  1WGX A;  3TP3 A;  1I50 J;  2XPU A;  1ZKG A;  5M5Y J;  1OFC X;  1IDY A;  4FCY A;  1JKQ C;  3HOU J;  4A3B J;  2DA6 A;  2ID3 A;  1OCP A;  3NAU A;  3OIO A;  2R5Y B;  3IH2 A;  1TWC J;  2IAI A;  2WB1 N;  3H0G J;  5M5X J;  3G1L A;  5EZG A;  5FLV A;  1TWG J;  2KDZ A;  2CRG A;  3ZQC A;  4MLO A;  5E3M A;  3ZQG A;  4S0H B;  4AUX A;  4IEJ A;  2EH3 A;  4LOC A;  3LNQ A;  3BR5 A;  4NDL A;  2DA1 A;  5DTD A;  2EZH A;  1IDZ A;  4BXX J;  4DW6 A;  1BW5 A;  4RDU A;  1P7I A;  1IGN A;  1MSE C;  5IOY A;  1NK3 P;  2Y0S N;  1IC8 A;  1JKR C;  2E2I J;  1MBH A;  1W0T A;  3BTJ A;  3GTM J;  3W6V A;  3GTO J;  4C3I J;  2E19 A;  2Y30 A;  2DTZ A;  5F27 A;  2DA7 A;  5GP9 A;  3LSP A;  2ECB A;  3Q0U A;  1BL0 A;  1Z77 A;  3JRF A;  2H8R A;  5IP7 J;  1WH5 A;  3O8G A;  5F0C A;  4XRS G;  5FLM J;  5M3M J;  2MG4 A;  3G1O A;  1FTZ A;  1AKH A;  1XS9 A;  3S14 J;  5EG0 B;  1U9O A;  4BY7 J;  2X6O A;  2RAE A;  2PMZ N;  3RQI A;  3CDL A;  1P7J A;  1TWF J;  1T33 A;  4UUS A;  3S2H J;  3FIW A;  4G12 A;  1MBE A;  2CJJ A;  2HXI A;  2HOS A;  1HLV A;  5IOZ A;  1MH4 A;  3B6C A;  2Y9Z A;  3JR9 A;  1WPK A;  3A02 A;  5IP9 J;  4BBS J;  2COB A;  4A3F J;  1JUP A;  1FIA A;  4V2F A;  2FQ4 A;  2W48 A;  1ITY A;  1SAN A;  2JMW A;  2XPW A;  3CCY A;  2ELK A;  4XID A;  1ETV A;  3ZOB A;  5F0H A;  2JA7 J;  5E3N A;  1R9T J;  4QTR A;  2DA4 A;  2GBY A;  1IRZ A;  2R7Z J;  4X6A J;  1AKH B;  2R92 J;  2O7O A;  2FX0 A;  2QCO A;  4FIS A;  3OSG A;  3TED A;  3Q0W A;  2X9D A;  2MGQ A;  4IHW A;  3MVP A;  4JYK A;  2FD5 A;  3I4N J;  4A3M J;  1A5J A;  4BY1 J;  5DS9 A;  4XRS A;  5FKN A;  3I4M J;  2HXO A;  2OF7 A;  5K7Z A;  1B72 A;  4JX4 A;  4BBR J;  5K7H A;  3RKQ A;  4A3D J;  2JA5 J;  2NOG A;  5FKM A;  5FJ8 J;  2LVS A;  1HCR A;  5C4X J;  1ETY A;  2E1O A;  5J1R A;  2CQQ A;  1JJ6 C;  1U78 A;  3OSF A;  1JT0 A;  2L9R A;  2XPV A;  1ZR4 A;  3OOU A;  2DMT A;  3VPR A;  1APL C;  4ABZ A;  1MH3 A;  3TW7 A;  1ORK A;  4L5E A;  5E3L A;  3A03 A;  5F04 A;  1HOM A;  3BR6 A;  2HI3 A;  3B6A A;  3FKI J;  1VND A;  1AU7 A;  1B72 B;  1H89 C;  4A3G J;  2R5Z B;  3LSR A;  2EQR A;  1Z0X A;  3QPL A;  3MKL A;  1K61 A;  1QVT A;  4M3D A;  1XG1 A;  1ZK8 A;  1IJW C;  3HBL A;  1ETO A;  1JT6 A;  1S7E A;  1NK2 P;  4AYB N;  1HDD C;  2TRT A;  3JRB A;  2IEK A;  1ZGW A;  3NAR A;  3PO3 J;  1PUF A;  2L0K A;  1BW6 A;  2JA6 J;  5EYR A;  2YUS A;  2O8K A;  3F0C A;  5FKO A;  2ZB9 A;  2HQ5 A;  2H1K A;  2GM4 A;  2VI6 A;  1FIP A;  1EF4 A;  4IHY A;  5F1J A;  1ETW A;  2E2J J;  3S2D J;  4M6V A;  1MBG A;  1XC5 A;  3LOC A;  5EGO A;  1GDT A;  2CQX A;  3HEF A;  1MBK A;  2NS8 A;  2HOA A;  2DN0 A;  1UMQ A;  1WH7 A;  5M3F J;  2ID6 A;  2HDD A;  3S17 J;  1T56 A;  5C4J J;  2EZK A;  3JRG A;  3HOY J;  2NVY J;  3BG3 A;  3L1P A;  4B3A A;  1G2H A;  1Y1V J;  2MSY A;  1PUF B;  5JLX A;  2VPR A;  3CMY A;  3GTL J;  1H8A C;  1FTT A;  4A93 J;  4M3B A;  1H88 C;  1X58 A;  2L7M P;  3BR0 A;  1VI0 A;  2K9N A;  3S1M J;  1GUU A;  4C3J J;  3FK6 A;  4B4C A;  3JRD A;  1NTC A;  1FEX A;  2VKV A;  1JUM A;  4MFE A;  3M3Y J;  1U9N A;  3HGG A;  5F08 A;  2DJN A;  4Y7N J;  2LFB A;  2N8G A;  4M3F A;  4AC0 A;  3GTK J;  1F36 A;  1O4X A;  2O9L A;  1ETQ A;  1LE8 A;  2JN6 A;  3GTP J;  1RKT A;  3BG5 A;  1ETK A;  2KT0 A;  1TWA J;  1IG7 A;  4JX6 A;  1VF9 A;  5EEA A;  2LK2 A;  3HOW J;  4UUS B;  4M3E A;  3C2B A;  2LTP A;  2ME0 A;  3HDD A;  4A3K J;  2L7F P;  4GFB A;  1I6H J;  4DYC A;  3RZO J;  5IP6 A;  3IH3 A;  3GBG A;  2K9Q A;  4RBO A;  2ECC A;  4D7M A;  1ENH A;  3IH4 A;  4W97 A;  3BTL A;  5GPA A;  4A3J J;  4W1U A;  4A69 C;  1GV5 A;  1JUS A;  4C3H J;  1W0U A;  5J1Y A;  1DU6 A;  1ETX A;  3K7A J;  3RZD J;  1Y1W J;  2MW8 A;  2OPT A;  2WV1 A;  3ZQL A;  1LE8 B;  3HB9 A;  4IHV A;  5FKL A;  3G1M A;  5C44 J;  3QPS A;  4FE7 A;  5J3L A;  2D5V A;  1OCT C;  2EBI A;  3DCF A;  4IHX A;  4DZP A;  3GTG J;  1Q1V A;  3CQZ J;  4XIC A;  2E2H J;  3HM5 A;  2DMU A;  3JRH A;  9ANT A;  2CU7 A;  2VUM J;  3HGY A;  3GTQ J;  1U8B A;  2NS7 A;  2JA8 J;  1UG2 A;  2CUE A;  3BR3 A;  1E3O C;  2HOT A;  3BTC A;  1TC3 C;  3S1Q J;  4J19 A;  3BR2 A;  1RES A;  2M34 A;  2LY9 A;  3SFI A;  3BG9 A;  1HF0 A;  2FJ1 A;  3PO2 J;  3Q0V A;  3JRA A;  4D7N A;  1YRN A;  5E3O A;  3K2A A;  3O8H A;  4MFD A;  3S16 J;  1GVD A;  2XB5 A;  2JWT A;  4EEF G;  4HNV A;  3ZQH A;  1DU0 A;  2YS9 A;  4FE4 A; 
#chains in the Genus database with same CATH topology
 2EZI A;  3MN2 A;  2LKX A;  2M8E A;  1B8I A;  2AXT C;  2E35 A;  2PEX A;  3GO5 A;  3MZH A;  3GLL A;  4Y52 J;  1UCR A;  3PNV A;  4D5F A;  4HV6 A;  2L9N A;  5HOO A;  3ZGK A;  2XKP A;  2X85 A;  2VOO A;  1A6I A;  4L5I A;  1FX7 A;  1JKP C;  4MQ9 F;  2MLG A;  1CQT A;  2CUF A;  4A5M A;  2WWY A;  4NBQ A;  4EJU A;  4IJA A;  2JPC A;  3G3Z A;  4ENJ A;  2JRT A;  4C2M J;  4K2E A;  1S6L A;  4HX8 A;  2YR2 A;  1AA7 A;  2DMN A;  4DGW B;  1YRN B;  5IYD J;  1TBX A;  1QPI A;  3BJ6 A;  4CYC A;  1W7P B;  3BPX A;  4OOI A;  2F2E A;  3SZG A;  2NVT J;  4CH7 A;  2IS2 A;  5LEJ A;  4NC8 A;  1P6R A;  1B8I B;  3OYL A;  1JJ8 C;  1TLH B;  4RGS A;  2CWE A;  1W36 D;  4U0W A;  4CCN A;  2DA5 A;  1XMX A;  1O3S A;  3D5S C;  1XTA A;  2FNA A;  3FK7 A;  3QYF A;  4XRF A;  2FE3 A;  5EGO B;  3BT9 A;  3OYD A;  3CDI A;  4XK4 A;  2XAJ A;  3T5X A;  4RLF A;  3H0D A;  4C2U A;  1UHM A;  2ZXJ A;  3M8F A;  4KN7 X;  2JSC A;  1IN8 A;  1R71 A;  3SEZ A;  3CJT B;  2K40 A;  4JP0 A;  2BZT A;  1MND A;  5CVR A;  2R0Q C;  5LRR A;  1O57 A;  1ZTR A;  2LRD A;  2M0M A;  2X1E A;  3FM3 A;  1ZRE A;  4B43 A;  3UR3 C;  4JX5 A;  2NNN A;  2XAU A;  3KEY A;  4CYC B;  1JE8 A;  4DIQ A;  2A61 A;  2TCT A;  3DEW A;  5KK1 A;  1OCR H;  2LR8 A;  3KP4 A;  4MNU A;  5IYB J;  2CV2 A;  4KFC A;  4MEX F;  3BOQ A;  1Z3X A;  3VYS B;  1OPC A;  4EGY A;  2IS4 A;  3W2W A;  4LMY A;  2CH0 A;  2KL4 A;  1LB2 A;  1LJ9 A;  1W5C C;  5E8G A;  5LHG A;  4XSX F;  2ZME A;  4B3X A;  2EZL A;  1DQU A;  4L9N A;  1ZRD A;  2ZXI A;  2Z16 A;  3VOE A;  3A01 A;  2EIL H;  3M7G A;  2L7Z A;  3WG9 A;  3K6G A;  4ESB A;  1R4M B;  1ONV A;  4JBA A;  2L4M A;  1SD6 A;  2CYY A;  3TMO A;  2NVQ J;  3FF5 A;  2UZK A;  3D0S A;  1H9G A;  2FUG 2;  3EYY A;  1GVJ A;  1BI1 A;  3OL3 A;  3AG3 H;  3HOV J;  1YJN I;  2XSD C;  1V5F A;  3PM1 A;  1O3R A;  3RKW A;  3R4K A;  2ZME B;  3H5N A;  1LKX A;  1XGS A;  5FKK A;  4EM1 A;  2VC0 A;  2CGP A;  5D5U B;  3A01 B;  3S1R J;  1SFK A;  4LLG F;  1R58 A;  1TL8 A;  2TDX A;  4B1R A;  4XRM A;  2Q2E B;  4DYQ A;  1JTY A;  4DZJ A;  5HVQ C;  2M2E A;  1UHS A;  4BKX A;  3GWZ A;  5JHU A;  1YS7 A;  4N9I A;  1V4R A;  2M4K A;  2Y9Y A;  3JRC A;  1X19 A;  2L9V A;  3E7L A;  2HQA A;  1V54 H;  2ZBK A;  2XPU A;  3QOE A;  5M5Y J;  2QSF X;  2JUG A;  2P6S A;  3HOU J;  3QAH A;  3QP6 A;  3I64 A;  4NC6 A;  1D0X A;  3V42 A;  3MWM A;  4CCM A;  2BVM A;  2BW3 B;  1OCP A;  3BJA A;  3NAU A;  4YFX F;  1R7J A;  3WTY C;  2VJ5 A;  4RAZ A;  3N4M A;  2X6W A;  1PYV A;  2ZME C;  3G1L A;  4NUB A;  1J0R A;  1FOY A;  3RQ4 A;  5JVG F;  2X4H A;  5FLV A;  5CLS A;  4EV0 A;  3C2H A;  2DDA A;  4N9H A;  5A2Q Z;  1JGS A;  4XLE A;  5TGT A;  2FNP A;  2RVC A;  5L3B A;  3WU2 C;  3BC8 A;  3KP2 A;  4HLY A;  3DP7 A;  3HSE A;  4AUX A;  4FX4 A;  1LQ1 A;  2EH3 A;  2FA5 A;  3LNQ A;  1P4X A;  1IDZ A;  1WJA A;  4DW6 A;  1T2K A;  2DPU A;  2VQH A;  4WF2 A;  1YHQ I;  4E7L A;  3HTS B;  1W4M A;  4XKC A;  2KP6 A;  1Z6R A;  5IOY A;  2M30 A;  1T98 A;  2Y48 A;  4V19 K;  3CCS I;  3BTJ A;  3GTM J;  3BLY A;  3CZ6 A;  3W6V A;  3GTO J;  4ASN A;  2DTZ A;  1JXS A;  2W25 A;  2ECB A;  5IT9 K;  3DQV C;  1Z77 A;  3JRF A;  4HX7 A;  1WH5 A;  2OZU A;  2X0L A;  3O8G A;  1W7P D;  4ZC3 A;  4XRS G;  5FLM J;  2K3P A;  3EUA A;  4MHG A;  2BYV E;  4CCO A;  1MJ9 A;  2EV6 A;  5EG0 B;  4LJZ F;  5ERI A;  4E7I A;  4A12 A;  1R5I D;  5D5W B;  1FWZ A;  1I6X A;  1P7J A;  3DXJ F;  2EFQ A;  4UUS A;  3FIW A;  4CIC A;  2CJJ A;  5KHD A;  3OYC A;  1BR1 A;  3P9C A;  2GA1 A;  1XX5 A;  2MC4 A;  3B6C A;  2OBP A;  3A02 A;  4RM3 A;  2BY3 A;  1FMV A;  4XKV A;  1G3Y A;  1FIA A;  2VT2 A;  1VZ0 A;  1SAN A;  2FML A;  1ITY A;  2Z3Y A;  2ELK A;  1U5T A;  4O3M A;  1FPQ A;  3ZOB A;  2AS5 F;  1NG7 A;  4YEJ A;  5F0H A;  1REP C;  1YYV A;  2JA7 J;  5ICE A;  1K79 A;  1IRZ A;  4X6A J;  2Z33 A;  3I9V 2;  2O7O A;  4IHW A;  4CSW A;  1USS A;  2DFF A;  2FD5 A;  3DFG A;  1WJ5 A;  2VQC A;  4IRG A;  2EA2 A;  5ILV A;  3M1C A;  2KIS A;  3X2Q H;  4XRS A;  3F22 A;  5CQG A;  2HTJ A;  3KX2 A;  2HXO A;  2VKH A;  4II2 A;  4FX0 A;  2AXL A;  5K7Z A;  2O3F A;  4EGZ A;  2OZ6 A;  3GX4 X;  3ABK H;  3GFL A;  4JX4 A;  4BBR J;  5K7H A;  3OS1 A;  5FKM A;  5FJ8 J;  2DT6 A;  5C4X J;  1ETY A;  3T8T A;  1U5T B;  1X1B A;  1SFU A;  1MW7 A;  3HRM A;  2V9P A;  2QWW A;  3RPQ A;  2ZC2 A;  2QEN A;  1G4D A;  2CS3 A;  3AG4 H;  3OSF A;  1JT0 A;  1VQN I;  4XLA A;  3OOU A;  5GTI C;  2K7L A;  3DU6 A;  4CZC A;  3DEU A;  4C2T A;  1ORK A;  4S05 A;  1LFP A;  1OCC H;  2DBB A;  4LK0 F;  1MJB A;  1D8J A;  1HOM A;  4E6K G;  3F8C A;  3OOP A;  3FKI J;  1K6Y A;  1AU7 A;  3DLA A;  2DQL A;  1H89 C;  4HQE A;  2OQG A;  3ROU A;  1VQ7 I;  1Z0X A;  3QPL A;  4PFP A;  2STT A;  4M3D A;  4B44 A;  1U5T C;  3G2B A;  3LMM A;  1ETO A;  4I02 A;  1YE9 A;  1S7E A;  4G7O F;  3JRB A;  3GCM A;  1ZGW A;  4KUM A;  1PUF A;  2H1L A;  1O3T A;  3KIO A;  1F9N A;  2VON A;  1DPU A;  2ZB9 A;  5FB2 A;  3DBR B;  4A0Z A;  2H1K A;  4BU2 A;  4P9U A;  4DBR A;  5ED4 A;  3IRQ A;  5KAI C;  5F1R A;  1TNT A;  4MGR A;  4M6V A;  4G7H F;  1MMN A;  3F23 A;  2W85 A;  1IO2 A;  1XC5 A;  1EH7 A;  1I39 A;  1ZGA A;  3NEU A;  4CO8 A;  3U21 A;  1JHF A;  3HEF A;  1BI3 A;  1HW5 A;  2M4G A;  2LF7 A;  4H4K C;  4F55 A;  1LEA A;  3E1S A;  3HJE A;  3OIQ A;  1J9I A;  1Z05 A;  2OD5 A;  2Y0M A;  3PSI A;  4EMS A;  1YW8 A;  3F6O A;  4CXF A;  2NVY J;  3L1P A;  3CUQ A;  3FZV A;  1GXP A;  1ZGJ A;  1Y1V J;  4Y33 A;  4OIP F;  4X0G A;  4P96 A;  2MSY A;  1PUF B;  4HF1 A;  2X1D A;  4WK8 F;  1QBJ A;  2EFN A;  3CLQ A;  5TIS C;  1R5H A;  1QHH D;  3LQR A;  1G3W A;  2EIJ H;  3CF2 A;  4BQO A;  2RQP A;  4L9J A;  1X58 A;  4LD5 A;  1XGM A;  4L18 B;  1UB9 A;  4OMY A;  1V5G A;  1U2W A;  5JR3 A;  2F5F A;  2K9N A;  4A0Y A;  3L2R A;  3JTH A;  4RMN A;  2OC6 A;  3H3Z A;  4LIT A;  2VKV A;  3WGI A;  2COM A;  2F5C A;  3CUQ B;  4RLQ A;  2ZFW A;  3MFK A;  1DUX C;  3M3Y J;  1E3H A;  4U7B A;  4KIF A;  4BHP A;  5FFX A;  5F08 A;  4E4H A;  1IZ1 A;  3VEP A;  4Y7N J;  4CA0 A;  3C3W A;  4HSR A;  3KYL A;  3CCR I;  4BJ6 C;  1FY7 A;  3K1P A;  4HX4 A;  1IG7 A;  3DBL B;  1QA6 A;  1HST A;  2WV0 A;  4U0Y A;  2IGN A;  4M3E A;  4PDK A;  3IC7 A;  2DO7 A;  3A0B C;  4A3K J;  1Y0N A;  4XLC A;  3AKZ A;  4ITV A;  1BC7 C;  5HNH A;  1WFX A;  2VE9 A;  1XPX A;  1XGN A;  3RZO J;  5IP6 A;  5HDN A;  3GBG A;  3KCC A;  3UNG C;  2V1U A;  3CME I;  1ACI A;  1ENH A;  3IH4 A;  2VJI A;  3ZMV A;  1KYZ A;  3QYB A;  4BXF A;  3CUQ C;  2YPR A;  4W1U A;  2D1H A;  4C3H J;  3HTU A;  1UEL B;  4FT8 A;  1DU6 A;  4KT5 C;  1EKE A;  1ETX A;  5K5O A;  3K7A J;  1Y1W J;  3W6J B;  2A68 F;  4CCK A;  3BCB A;  2FBI A;  2P7V B;  3BWG A;  2RQQ A;  5FRO A;  1S3J A;  3CJQ B;  1ZRF A;  3FM5 A;  3H5A A;  1A04 A;  5J3L A;  2QEX I;  4WX9 A;  3GF2 A;  4PSW A;  4YFK F;  2PLY A;  4IHX A;  3ZR8 X;  3ZQQ A;  1J7K A;  3K4C A;  2R7O A;  3KPH A;  2JUC A;  3DF8 A;  1Q1V A;  2DOD A;  2PFB A;  4HAM A;  3TOA A;  3CCU I;  4Y13 A;  2DMU A;  2E1C A;  3ZCO A;  3GTQ J;  1U8B A;  2NS7 A;  4ZYA A;  2V79 A;  4F3Q A;  2HOT A;  2GQQ A;  2NOJ B;  2EIK H;  4J19 A;  3BR2 A;  1RES A;  1Z21 A;  1G3T A;  2ZFU A;  3OYG A;  3L2V A;  4HV5 A;  5D8K B;  4F7Z A;  2UXN A;  3MQ0 A;  2GOM A;  4YII A;  2L7K A;  3ASO H;  2V1N A;  3LFU A;  2JVH A;  2V26 A;  3K2A A;  1GVD A;  3H9J A;  1OYI A;  3LL7 A;  5LRS A;  1SEU A;  2F5E A;  3K10 A;  1DU0 A;  2NRA C;  3FBN B;  3BQY A;  2FXA A;  4A3C J;  1JHH A;  1HKQ A;  3PNT A;  1J59 A;  2WAD A;  1OMI A;  2DA3 A;  3WE3 A;  2HZT A;  4UY8 I;  3Q3S A;  1F43 A;  3K9T A;  3OWT A;  4QIW N;  1D3Y A;  1JGG A;  3GZ6 A;  3RPU D;  1HKT A;  3I59 A;  2AQE A;  1BIA A;  1UST A;  2W82 A;  2XF6 A;  3H36 A;  1U3E M;  5J40 A;  2KKO A;  1ZHF A;  3EQL F;  4ZDP A;  1HW1 A;  3FXU A;  1ZQ3 P;  3SQN A;  5K7F A;  1FP1 D;  4I76 A;  1OIS A;  2P81 A;  4Q47 A;  4BQN A;  1QO0 D;  2NVX J;  2W00 A;  3GVA A;  3EYI A;  4QSH A;  1AHD P;  2DT5 A;  3S3N A;  4HNU A;  4U0V A;  3E6D A;  2H94 A;  3SZP A;  3TDZ C;  4QLC U;  3IHU A;  3L00 A;  4HZF A;  2CQN A;  1BA5 A;  2I10 A;  3TGN A;  4G6T B;  5LGN A;  5A2Q K;  3M1E A;  4A3L J;  5EZH A;  4JK1 X;  2JJ7 A;  2O03 A;  4MTD A;  3DKW A;  3I59 B;  1MMG A;  2HGC A;  2CUJ A;  3BG6 A;  3K4B A;  1X2N A;  2ME6 A;  4XLP F;  4ENN A;  5E17 F;  3CCL I;  1W36 C;  1MMA A;  4J01 A;  1QZE A;  4M9S A;  5B66 C;  3GTJ J;  1SAX A;  4GYI A;  3HKZ N;  4LLN A;  3A4C A;  4PGG A;  1DPR A;  3CJR B;  3K4N A;  1LDK B;  1RUO A;  3EPZ A;  2K9M A;  3HOZ J;  1WZ2 A;  1FT9 A;  4M6X A;  4LB5 A;  3TOB A;  1OYW A;  2B63 J;  1DDN A;  5E1W A;  3TKY A;  3DWL E;  3L2U A;  1UJ8 A;  4R8H A;  3GYH X;  2KPM A;  1J09 A;  3FIS A;  5DM7 F;  4I6Z A;  1GT0 C;  2LF8 A;  4O5V A;  1VFC A;  4CZZ A;  4FTH A;  1ZG5 A;  2JPB A;  1RR7 A;  3KEO A;  3OYB A;  1XDU A;  1LVK A;  2AO9 A;  2HS5 A;  2R5Z A;  1MBJ A;  2HFH A;  1P4A A;  1X2M A;  4ANJ A;  4RA2 A;  3PIO F;  1FOK A;  1WI3 A;  3KLO A;  1A36 A;  3UKG A;  4YEL A;  1YX3 A;  2F6C A;  3ABT A;  2WY8 Q;  3BR1 A;  1AWC A;  2AHQ A;  5J1U A;  2VQL A;  4KDP A;  5KCM A;  2DMQ A;  1YFH A;  3F21 A;  5D6F A;  3ZQF A;  1VQP I;  2KIF A;  3TDU C;  1SD7 A;  5HNF A;  3E5U A;  3E0J B;  2B9S A;  1MSF C;  3WTZ A;  2XSJ C;  3ASN H;  3PUB A;  4PJJ A;  5M5W J;  5L3C A;  4BHB A;  3JSP A;  1ZKG A;  1QHG A;  2ESN A;  1JKQ C;  3QPT A;  1V3F A;  2ZCW A;  3GLX A;  2D45 A;  2LSO A;  2DA6 A;  2EJR A;  3LSM A;  1BOA A;  3OIO A;  3RJP A;  1K7A A;  4GDF A;  2ELJ A;  4IPA A;  3MKZ A;  1MJA A;  1TWC J;  2F48 A;  2WB1 N;  1ZAR A;  2KDO A;  3K1N A;  4XNF A;  2M87 A;  1YIO A;  1IRG A;  2PG4 A;  3RKY A;  3WGG A;  3PJR A;  3C1D A;  2HZD A;  2HYF A;  2XGX A;  1B6A A;  1VQO I;  1LPQ A;  1EJ9 A;  1YLF A;  1V55 H;  3CTA A;  4LIV A;  2QQ8 A;  1X3W B;  4IEJ A;  4A2U A;  2E34 A;  4LOC A;  2H09 A;  4BQA A;  2DA1 A;  5DTD A;  2EZH A;  2ZNZ A;  4L9T A;  1BW5 A;  3LST A;  4ZYG A;  4I98 B;  3VOD A;  4RDU A;  1S8N A;  2HNH A;  1BOB A;  2LC2 A;  2IA0 A;  3BRO A;  5D8L B;  4KA4 A;  2Y0S N;  1JKR C;  2Z9O A;  1MBH A;  3WOD F;  2R7W A;  1R36 A;  5F27 A;  3ZQ7 A;  3IWZ A;  5GP9 A;  1BL0 A;  1OYY A;  2H8R A;  3DTK A;  5IP7 J;  3IP4 B;  5DDG A;  5F0C A;  1FYM A;  3P5J A;  5M3M J;  2MG4 A;  1QZY A;  3I4P A;  4ZYD A;  1XS9 A;  3RKX A;  2JRM A;  3VYU B;  1EH6 A;  4XR6 A;  1U9O A;  2ETH A;  3FHZ A;  1NHA A;  3OYM A;  3CDL A;  2KRH A;  2Y69 H;  2FEZ A;  1BI2 A;  3SEQ A;  5GAE J;  1MGT A;  4PFO A;  2WAQ A;  2X51 A;  1X1D A;  2CUZ A;  2Y9Z A;  4GO1 A;  5BMZ A;  1A31 A;  5IP9 J;  4BBS J;  2COB A;  3O3K A;  1IN6 A;  1K6O A;  1D0Z A;  2W48 A;  3L9F A;  1C0W A;  1WI9 A;  2LY1 A;  2RRE A;  2PMU A;  3K4J A;  1ETV A;  2ZNY A;  4HG2 A;  4M6Y A;  1SD5 A;  2L9S A;  1R9T J;  4QTR A;  4FAS D;  1KU2 A;  1SFE A;  2DA4 A;  2GBY A;  2RC4 A;  1IN7 A;  2HOE A;  3TQN A;  4QPO A;  2QCO A;  3OSG A;  1T0F A;  2B7E A;  3Q0W A;  5GAG J;  4HNT A;  1R6R A;  2VBW A;  4HST A;  4HEA 2;  3JSO A;  3BPV A;  5J8C A;  2OF7 A;  2KZV A;  2RNJ A;  3HG9 A;  1RZ4 A;  2NOG A;  1TP4 A;  3N05 A;  2QZ8 A;  1YQA A;  2PJR A;  1JJ6 C;  2I8D A;  3JAM K;  2XRO A;  1U78 A;  5HLI A;  1Y8Q B;  2L9R A;  3I53 A;  1P4W A;  1PJR A;  3U1D A;  5J47 A;  4RM2 A;  2DMT A;  3VPR A;  4ABZ A;  2JT1 A;  2KJB A;  1R4N B;  3TW7 A;  1R22 A;  2ZO4 A;  5CVJ A;  2A5Y B;  3ABL H;  4UB6 C;  4IF4 A;  1FZP B;  1LDJ A;  1G6N A;  1TQP A;  2OA4 A;  2PJP A;  4Z2Y A;  3BR6 A;  5DCM A;  1MIJ A;  2GOX B;  4CYD A;  3B6A A;  3J7Z I;  2A05 A;  4E7H A;  1SAU A;  1G3S A;  2JSP A;  3I54 A;  2EQR A;  5L3G A;  3MKL A;  4E7J A;  2BXY A;  4F91 B;  3COA C;  1MMS A;  4YIR X;  4KT6 A;  5FO5 A;  3L2Q A;  4Y4R A;  4A6E A;  3D5L A;  3BJO A;  2V6E A;  1STZ A;  1JT6 A;  4XSZ F;  5L3E A;  1NK2 P;  4P5O A;  1HQC A;  2IEK A;  5HDG A;  2DFE A;  3SXY A;  4ON0 A;  1MMD A;  2L0K A;  4AVP A;  4UUV A;  1BW6 A;  1TQI A;  4NNJ A;  4OIO F;  1VTN C;  2PBI A;  3O2P E;  3F0C A;  4BUP A;  2HQ5 A;  1LNW A;  2MD5 A;  5DCM B;  4ENK A;  4WXH A;  1AOY A;  1FIP A;  4E70 A;  1EF4 A;  1BM9 A;  3SHF A;  2E2J J;  1P92 A;  3CCM I;  3KYD B;  3E6C C;  4NHJ A;  1UZC A;  1VQ9 I;  2CQX A;  1BIB A;  4D1Q A;  3HYI A;  1GHC A;  3HOT A;  2P4W A;  2EA4 A;  2HOA A;  1UMQ A;  1WH7 A;  5M3F J;  1D1A A;  4G7Z F;  3KFW X;  3ZMS A;  3DPL C;  1T56 A;  2EPF A;  5EEG A;  5J8F A;  5C4J J;  3HOY J;  4BDY A;  1G2H A;  2ISY A;  2LH9 A;  3F72 A;  1VQ5 I;  3W2A A;  1SMY F;  4C9Y A;  2K27 A;  2R3S A;  4HPQ A;  5JLX A;  3V8K A;  2QQB A;  3WTW C;  2FOK A;  1BJA A;  1XCB A;  4OAY A;  4KIT B;  3GFI A;  1TW2 A;  3RYP A;  4I0B A;  4D0P A;  5LHH A;  5D4R A;  2LG4 A;  1H88 C;  1FOW A;  1LEB A;  5GAH J;  1Z1D A;  2BOL A;  1FP2 A;  3BR0 A;  4BE0 A;  4LG3 A;  5ICG A;  3JW4 A;  2BEO A;  1YX5 A;  2L54 A;  2DFH A;  4C3J J;  2BGC A;  1D5V A;  5ILS A;  3CLO A;  2V9K A;  1KA8 A;  1X3Z B;  1ZLK A;  2DPD A;  3SDB A;  3J7A O;  2K86 A;  5LD2 C;  1JUM A;  2VLA A;  4Y3O A;  4M74 A;  2P5V A;  1U9N A;  1X4P A;  3KP3 A;  3T1B A;  3P7N A;  3RCO A;  2DJN A;  3KLN A;  4EAT A;  5H6Q A;  2PMZ A;  2QUF A;  4G8X A;  4M3F A;  2P8T A;  4PJM A;  2P6T A;  3F6V A;  2HDW A;  1WJD A;  5GTH C;  2DQR A;  3GTK J;  1F36 A;  2BXZ A;  3JCU C;  2O9L A;  3Q9S A;  3ZMD A;  4GGG A;  5B1A H;  2IGK A;  3BG5 A;  1ETK A;  5DD8 A;  4G6Q A;  5EEA A;  1H0M A;  5IY5 H;  2LK2 A;  4UUS B;  1ZYR F;  2LTP A;  2QKM B;  2ME0 A;  1XGO A;  4I99 C;  2GIZ A;  1WVR A;  3WE2 A;  4FET A;  1W5S A;  3IH3 A;  2K9Q A;  3HRS A;  2B0L A;  1EA3 A;  4RBO A;  4DOZ A;  2VXD A;  4W97 A;  1T95 A;  1DGW Y;  5GPA A;  2Q1Z B;  3MCZ A;  1W0U A;  2R7V A;  4LIU A;  5J1Y A;  2DXI A;  1W5T A;  3RZD J;  3A0H C;  3A2K A;  1IRX A;  2OPT A;  4BEH A;  4LG0 A;  3VYT B;  1A35 A;  5CPR B;  2WTE A;  2ADU A;  4B09 A;  4AIK A;  3IKV A;  2WBM A;  1BBY A;  3IWF A;  4MTE A;  4ZTF A;  3D5R C;  4J00 A;  3MKY B;  1OCT C;  3RPU A;  4CHU A;  2OV7 A;  3J81 K;  1I5Z A;  1KYW A;  2VB6 A;  4G6D A;  4U87 A;  3CQZ J;  2E2H J;  3HM5 A;  1ZEL A;  4XON A;  3VFZ A;  2FF4 A;  3GME A;  9ANT A;  3CES A;  2LDU A;  1FYL A;  2CUE A;  4EQQ A;  3L2C A;  3CMA I;  1IN5 A;  2HQR A;  2IXS A;  2KIQ A;  3FDY A;  2DOA A;  2M34 A;  3LSH A;  5LHI A;  2GWR A;  3FKJ A;  4I7H A;  4BEH B;  3VWB A;  4LG0 B;  3R6S A;  1SVM A;  3BG9 A;  5BOX A;  3PO2 J;  2XDV A;  3Q0V A;  3K4M A;  4D7N A;  4NC7 A;  3REO A;  3VB2 A;  1Y8R B;  3O8H A;  1RRJ A;  3FX3 A;  4MFD A;  5HLT A;  2HR3 A;  3WGH A;  4EEF G;  3CC4 I;  3CO6 C;  3FXR A;  4IRI A;  3W6K B;  4P9F A;  4OU0 A;  2YS9 A;  1IXC A;  2IW5 A;  4IQJ A;  4HDV A;  2CV1 A;  4GRI A;  1VQ6 I;  3AG1 H;  1IUF A;  1IXS B;  5H2F C;  3HC7 A;  2XIG A;  5BPI A;  3TW6 A;  2A6T A;  5BNG A;  4CCL A;  4AYB A;  3RIR A;  3TO9 A;  2R4G A;  3IRR A;  1IV6 A;  1BR2 A;  4RGU A;  2XGC A;  5FLX Z;  1TT5 B;  3F8B A;  1RI7 A;  2XRL A;  3H3V K;  2QQ9 A;  2K02 A;  3NWS A;  3H92 A;  4UUT A;  2Y2Z A;  4PJN A;  1ZG1 A;  4XMY A;  4DYR A;  4BJT A;  3IKT A;  2OU2 A;  1TZL A;  1P2F A;  2K9S A;  2XB0 X;  4WXD A;  4YRV A;  2Z99 A;  3SZT A;  3BDD A;  1Y0U A;  4TV7 A;  1WKM A;  3CO7 C;  4KYW A;  4EJT A;  4PJL A;  2GXA A;  3V8L A;  2HVR A;  5DEQ A;  2G9W A;  4Y17 A;  2EFW A;  3ECH A;  2O6G E;  3GFJ A;  4Q4Z F;  1QZZ A;  2ZJP F;  2MH2 A;  1RKW A;  4XN0 A;  3E97 A;  2L3D A;  3F3X A;  5HOD A;  1PP8 F;  2WY7 Q;  2JQ7 A;  2M0C A;  4X1E A;  1GV2 A;  2OUM A;  3H5R A;  2K3F A;  5D5X B;  2XGD A;  3IV5 A;  3OR1 C;  4S04 A;  2ICW G;  1DP3 A;  1BR4 A;  3ZMU A;  4HRI A;  1IF1 A;  1MNE A;  2K85 A;  3U1K A;  3MKW B;  1DGR M;  2GLO A;  1BN5 A;  2DTR A;  2PQ8 A;  1OJL A;  3E6M A;  4XOT A;  1KGS A;  3QWL A;  1X1C A;  5H20 A;  2NVU B;  2Z1D A;  5HS8 A;  1QVU A;  3GW2 A;  1HKS A;  3FXL A;  2LD5 A;  5EF6 A;  2XC7 A;  3WU0 A;  2XUB A;  4UV8 A;  1MNM C;  2R7U A;  3WTS C;  3ERM A;  3BTI A;  3QQA A;  1S7A A;  3KP6 A;  3V7C A;  1POG A;  2F4I A;  2XF7 A;  2LKP A;  3BQZ A;  3SYT A;  2QYO A;  4DNC A;  3HOX J;  4BE2 A;  4A3I J;  1I3Q J;  5JLW A;  1OLT A;  4OMZ A;  2P5K A;  3ZQI A;  2IVM A;  3HRU A;  4CUG A;  3JRE A;  1PDN C;  3OS2 A;  2J5O A;  3Q9V A;  3V7S A;  3PNY A;  1SMT A;  3R0J A;  3D1N I;  4ESJ A;  1JKO C;  2YU9 J;  3G6E I;  1YJ9 I;  5LGT A;  2VKE A;  3S15 J;  3OS0 A;  1ZR2 A;  4ZDO A;  1RPW A;  2GIV A;  2CQK A;  2IBD A;  5D5V B;  3HXL A;  3BG7 A;  1FSH A;  2Z5U A;  3PFY A;  3QOP A;  5IPA A;  1N77 A;  2VBY A;  2DT7 B;  2DAO A;  3AAF A;  2HYJ A;  4HOB A;  2M8G X;  3WHC A;  1Z91 A;  1D5Y A;  3S1N J;  2ZXW H;  1QU3 A;  3VYR B;  2XAS A;  2HPM A;  1K83 J;  3OYF A;  4ZH4 F;  4EM2 A;  1MBF A;  3ZPL A;  3FXO A;  1QRY A;  1D1C A;  3CCJ I;  4AD9 A;  2CW0 F;  1WGX A;  3TP3 A;  2W84 A;  4RB1 A;  4MEY F;  4A3B J;  4G9Y A;  4IHT A;  2E5Z A;  2ID3 A;  1WWX A;  1S29 A;  2PMH A;  3IH2 A;  2BBY A;  2CSO A;  4ZYE A;  3ABU A;  5M5X J;  3M9A A;  1FBQ A;  2MFZ A;  1F4K A;  3OYE A;  1ZH5 A;  5EZG A;  2XRN A;  4IXA A;  1TWG J;  3FXJ A;  2CRG A;  3ZQC A;  4MLO A;  1I3A A;  1Y56 A;  2VT3 A;  5E3M A;  3ZQG A;  1IW7 F;  2R7Q A;  3E5Q A;  1B59 A;  3FXM A;  2M7B A;  3BR5 A;  2FOW A;  2W4S A;  4BXX J;  1MDM A;  1WJE A;  3OL4 A;  3HSF A;  2KMU A;  4A0X A;  3CDH A;  2E1N A;  2QBY A;  1IGN A;  1X4O A;  2IP2 A;  1MSE C;  1NK3 P;  1VQM I;  1IC8 A;  1ZAO A;  4AVZ A;  4ZJZ A;  3HOS A;  2FBH A;  2ISZ A;  5TJJ A;  2CQ7 A;  3MZ8 A;  2E19 A;  1N75 A;  3EDP A;  4KIC A;  2DA7 A;  4HYE A;  3LSP A;  4C30 A;  1VQ4 I;  3HSR A;  1T08 B;  3Q0U A;  3K2Z A;  3ABM H;  3I0T A;  2CV0 A;  2RGV A;  2A3S A;  4E7S A;  1I1G A;  1HXD A;  5E8I A;  4Y15 A;  3G1O A;  3OMY A;  3V7R A;  1AKH A;  2EWN A;  3KP7 A;  3S14 J;  4UB8 C;  3ZRG A;  2KRF A;  2L01 A;  2XAQ A;  2LRE A;  4ZDL A;  2RAE A;  1YJW I;  1Z9C A;  1MKM A;  1TWF J;  1MDM B;  1U6G A;  4G12 A;  5J4V A;  4OIR F;  3AFH A;  1MBE A;  2HXI A;  1RNL A;  2HOS A;  3BCA A;  2L2O A;  3KEQ A;  2QBY B;  1HLV A;  2ESH A;  3LSK A;  3JR9 A;  2DK8 A;  3SFZ A;  2FBK A;  4A3F J;  4BAC A;  4N0B A;  2ZXH A;  4XM3 A;  2FQ4 A;  2GA2 A;  4QWQ A;  4M9Z A;  2JMW A;  2XPW A;  3CCY A;  1HW2 A;  4XID A;  3QU6 A;  3CCE I;  1FYK A;  1R1V A;  5E3N A;  1NH3 A;  2R7Z J;  1AKH B;  2EK5 A;  4PJ0 C;  2M1B A;  3TED A;  2VAS A;  1IUY A;  1Q1H A;  2M45 A;  4NQW A;  1PVE A;  2GXG A;  2MGQ A;  2RDP A;  2X9D A;  2HTS A;  3MVP A;  2WAE A;  4JYK A;  1TQM A;  1S9H A;  1OR7 A;  4A3M J;  1BC8 C;  4BY1 J;  1SVO A;  4RGX A;  5DS9 A;  4B48 A;  4D9J A;  1FMW A;  5FKN A;  2LNB A;  3LAJ A;  1YTY A;  2NXN B;  1YIT I;  1QNT A;  2EIN H;  3RKQ A;  4E7K A;  1F5T A;  3CC2 I;  3V8J A;  3HL2 A;  2MD0 A;  2JA5 J;  2LVS A;  2QLZ A;  3CP2 A;  1R00 A;  3QYE A;  3HIF A;  4JOM A;  5EEH A;  1Z6T A;  1A6Q A;  4LGW A;  3IL2 A;  3DTI A;  2R7S A;  3DBH B;  2NNY A;  2XPV A;  3OYH A;  1ZR4 A;  4ZZL A;  5F6F A;  1APL C;  2A5W A;  2J5P A;  4NQW B;  3K70 D;  1SD4 A;  4N4O B;  1S72 I;  1JI8 A;  4L5E A;  2NAZ A;  2KZG A;  5CYV A;  3RYR A;  2ELH A;  1XCV A;  4CDG A;  2HWV A;  1X1A A;  5JFR A;  4HQM A;  3FHN A;  2HI3 A;  1FOX A;  1VND A;  3HRT A;  4RAG A;  1TT0 A;  2R7X A;  1B9M A;  2AQF A;  2DDB A;  5FFZ A;  2ZKZ A;  2R5Z B;  3LSR A;  3ELK A;  3HHG A;  1J2X A;  1K61 A;  2E5N A;  2E71 A;  4KIB A;  1QVT A;  3ISP A;  4BS9 A;  2UUZ A;  1XG1 A;  5B5E C;  1ZK8 A;  2DJI A;  2LYC A;  2O61 A;  2HDC A;  4AID A;  2ACJ A;  2H27 A;  3I58 A;  2IA2 A;  1WRJ A;  3H35 A;  1HDD C;  1Z7U A;  2LY2 A;  4RB0 A;  3NAR A;  1B1B A;  3I3L A;  4PGH A;  5LBQ A;  1CGP A;  3PO3 J;  2MH9 A;  5HS7 A;  1YW7 A;  3M8J A;  2JA6 J;  3C2G A;  3NQO A;  5EYR A;  4DQ2 A;  1OCO H;  2O8K A;  3PQK A;  1O7F A;  4HLX A;  5DUI A;  1T39 A;  4IHS A;  1S5L C;  1YI2 I;  2C6Y A;  5F1J A;  1ETW A;  1GLN A;  4IHY A;  3S2D J;  1PP7 U;  1MBG A;  4XKW A;  3JTG A;  2QGU A;  5EGO A;  5E20 A;  3KZY A;  4AU7 A;  2I5U A;  3CUO A;  3OIP A;  2ID6 A;  2L02 A;  2HDD A;  3S17 J;  4OWR B;  3KZZ A;  5LEK A;  1T6S A;  3JRG A;  2EZK A;  4UNO A;  2WA0 A;  1TNS A;  2KIU A;  4B3A A;  2XAG A;  3IAM 2;  2DU9 A;  2M3A A;  1KQ9 A;  2L4A A;  3F8N A;  4L0Y B;  2HU9 A;  1Y6I A;  3GUD A;  3H1C A;  2FMY A;  2VPR A;  2XAF A;  3GTL J;  2EB7 A;  4ZYH A;  4A93 J;  2QKL B;  4DBQ A;  1FBS A;  1UHW A;  4M3B A;  1UAA A;  2XF5 A;  4ZTJ A;  2FU4 A;  2HQN A;  1YW9 A;  3KP5 A;  5DM6 F;  3W2V A;  1G59 A;  1XB4 A;  1KU3 A;  1QQI A;  3S3O A;  3S1M J;  2KQR A;  2HYG D;  4B4C A;  3JRD A;  3ML6 A;  1XD7 A;  1NTC A;  5FLX K;  1WHU A;  2VN2 A;  2QQA A;  3WTT C;  3TO6 A;  1X3U A;  1VQL I;  3I71 A;  3HGG A;  3R60 A;  2LMD A;  1KU9 A;  2LFB A;  3CCQ I;  4YIF A;  5TRD A;  2N8G A;  1O4X A;  4BGD A;  2JN6 A;  3NRV A;  5AIQ A;  3GTP J;  4M73 A;  2XKO A;  2KT0 A;  4XKB A;  5DYM A;  4JX6 A;  2X1C A;  1XMA A;  3HOW J;  3C2B A;  4UV9 A;  4ETS A;  1Z7L A;  4IO9 F;  3HDD A;  4GFB A;  2VL8 A;  4DYC A;  1SFX A;  2CMP A;  2ECC A;  4D7M A;  3G4S I;  5CJ9 A;  1O7L A;  2VOD A;  4I2O A;  4FHT A;  2MBF A;  3C18 A;  5CKT A;  1GV5 A;  1JUS A;  3LQQ A;  1F1Z A;  2HEO A;  2Q2E A;  5BQT A;  1ZRC A;  1KU7 A;  4F52 A;  3I5U A;  2E7W A;  1YIJ I;  2V6C A;  3HB9 A;  3MEX A;  4IHV A;  2LBF A;  3E5X A;  4RAY A;  5FKL A;  3RDI A;  3G1M A;  5C44 J;  3QPS A;  4FE7 A;  2DYR H;  2RN7 A;  3AL0 B;  1RIO H;  4DJA A;  5J6X A;  1H9T A;  1FBU A;  3IAS 2;  4U88 A;  4WCG A;  1YO5 C;  3DCF A;  3DKX A;  2BW3 A;  4OIN F;  4DZP A;  3GTG J;  4ESF A;  3GEZ A;  2P7C B;  4XIC A;  1QPM A;  4OIQ F;  2R7D A;  5HS9 A;  2BHZ A;  3JRH A;  1FNN A;  3PSF A;  2Q8K A;  1TTY A;  3DPU A;  3KZI C;  2CU7 A;  4XQF A;  3HGY A;  2VUM J;  2LOO A;  2PJR B;  1UG2 A;  3T8R A;  1E3O C;  1RUN A;  1LDD A;  2MC3 A;  1PUE E;  3U2R A;  2DFI A;  3TBI A;  4BXU A;  2W57 A;  4EJW A;  1B4A A;  2IGM A;  4L5J A;  3I55 I;  1HF0 A;  5HLG A;  2DK5 A;  1T0F C;  3JRA A;  1D8K A;  2LBF B;  2DYS H;  3U9G A;  4IX7 A;  3BZC A;  5B1B H;  4H0E A;  3MZY A;  3OY9 A;  2JWT A;  5BPD A;  5E18 F;  3AL0 C;  3ULQ B;  2A6E F;  3QPH A;  2KHM A;  3ZN0 A;  3JRI A;  4FE4 A;  2R93 J;  3EUH A;  3F8M A;  4KIG A;  5AON A;  1TWH J;  1WSU A;  5C3E J;  4MO7 A;  2YU3 A;  3HPH A;  1U0J A;  3K0L A;  2EV5 A;  4KN4 X;  3RI4 A;  3ZMZ A;  1N78 A;  1MD0 A;  3M4O J;  1L0O C;  3B73 A;  1VQK I;  3H9Q A;  2W24 A;  4B47 A;  5CQE A;  3TP0 A;  3J80 Z;  3CCV I;  1HA8 A;  5EG0 A;  1LFB A;  4XL9 A;  1FJL A;  3LA2 A;  1RC9 A;  5KNL A;  2OCC H;  3LSG A;  1B9N A;  2Y31 A;  2M9H A;  4A3E J;  3V4G A;  2Q0O A;  4M3G A;  1RET A;  1ERD A;  2X48 A;  1FLI A;  3PFI A;  4KMF A;  2XHK A;  1ZG3 A;  4F93 B;  1ULY A;  2WAQ N;  2CFX A;  1DP7 P;  2KLO A;  2OAZ A;  2QF7 A;  1EH8 A;  2FSW A;  4OAZ A;  2HPI A;  5CVV A;  1ZN2 A;  4BQQ A;  2G0E A;  3CJN A;  1ON2 A;  2XV4 S;  3GZ5 A;  3FXK A;  4IOC F;  2W1O A;  2VPL A;  2LP0 A;  5EDN A;  1E3P A;  2KJC A;  4BYY A;  1ON1 A;  3H9G A;  2A6H F;  1FSE A;  3K4K A;  3MAJ A;  5DUK A;  4RS8 A;  1Z3Y A;  3PQJ A;  4U7D A;  1LFU P;  2YX4 A;  3K69 A;  1E17 A;  1XDS A;  4BH9 A;  3HUG A;  3FMQ A;  1JTX A;  2XGE A;  2DW4 A;  3F9K A;  1K4S A;  3EET A;  3EUH C;  4PUS A;  3M07 A;  5GPC A;  1CF7 A;  1V5E A;  2VBX A;  3C7J A;  5KVR A;  4D5C A;  4BJ5 C;  3ZP5 A;  1Y39 A;  2WC2 A;  2VJ4 A;  3FWE A;  5E1X A;  5ICF A;  1WCM J;  3LSJ A;  2DMP A;  2IPQ X;  2K4B A;  3VDX A;  2R7F A;  4II3 A;  3CP8 A;  1KQ0 A;  3SJM A;  2IA1 A;  2RKH A;  4JQF A;  4RB3 C;  4AIJ A;  1SFO J;  2E7X A;  2IS1 A;  3E6B A;  3HUG B;  5F0F A;  3W3C A;  2G7H A;  2V4J C;  3R61 A;  4LLL A;  2ZSH B;  1G8X A;  1BJZ A;  1O3Q A;  5HLH A;  2O8X A;  1CF7 B;  2DA2 A;  2JK3 A;  2R5Y A;  2P5L C;  1IAW A;  4KNY A;  4CGZ A;  2LLK A;  4IKF A;  3G73 A;  2GZW A;  3SDG A;  4MIM A;  4IRH A;  4RGR A;  4BL0 B;  4V2G A;  3WHB A;  4KIS A;  1ZLJ A;  2STW A;  3IUO A;  1YOV B;  2VOP A;  5F64 A;  2V1D A;  5IYC J;  2E60 A;  4BNC A;  1LVA A;  4EJV A;  1HDP A;  3OYN A;  1I50 J;  2ZJQ F;  1OCZ H;  1IDY A;  1OFC X;  4FCY A;  2H6C A;  4RAF A;  3OYI A;  1W1W E;  2Z2S B;  3Q5F A;  1S7O A;  4XLH A;  4MQV A;  1XMK A;  4GCV A;  2R5Y B;  4CCJ A;  3DEE A;  2IAI A;  2IRF G;  2XVC A;  3R0A A;  3H0G J;  2VQG A;  2E36 A;  3S8P A;  2KDZ A;  2ZSI B;  3S32 A;  3ZN1 A;  1P9Q C;  4IQ4 A;  4S0H B;  5GAD J;  2KIM A;  1U8R A;  3ZQH A;  4HW0 A;  4NDL A;  3DV8 A;  4PK4 A;  4GYG A;  4Q48 A;  2BHY A;  4PZJ A;  2EV0 A;  3PUF A;  2KRC A;  5FRN A;  1P7I A;  1IV8 A;  2ZJR F;  1Z67 A;  2OCE A;  2E2I J;  1W0T A;  1IRF A;  2L5Q A;  2UWM A;  4WXC A;  4C3I J;  2Y30 A;  1XSX A;  3A1Y A;  4KMU X;  4B8X A;  2R7R A;  3DKY A;  1R49 A;  5FD5 A;  1WJB A;  1FTZ A;  4LFU A;  2VJJ A;  2X6Y A;  2KFD A;  1OQY A;  2HKX A;  4UVC A;  1HSJ A;  4BY7 J;  2EFO A;  2VBZ A;  2X6O A;  1I27 A;  2PMZ N;  3RQI A;  1T33 A;  3S2H J;  4PSX A;  2RNG A;  4G94 A;  4L9V A;  4UVA A;  1R1U A;  4P55 A;  2DCE A;  4XLN F;  5IOZ A;  1MH4 A;  5KAF C;  2NS0 A;  4YG2 F;  3OYK A;  2QVO A;  2DOE A;  1WPK A;  2DLL A;  3EUK L;  3QOD A;  1K78 A;  3FXQ A;  1JUP A;  1T38 A;  3B02 A;  2XAH A;  1N25 A;  4RB2 C;  1UG0 A;  4V2F A;  2HKO A;  2V7F A;  3MD2 A;  3WTX C;  2CFO A;  2JVG A;  4AWX B;  3JAM Z;  5BS6 A;  4HDU A;  3S93 A;  3CC7 I;  5ICC A;  5FRM A;  5B3S H;  3OV8 A;  2CG4 A;  3G71 I;  2F5V A;  2R92 J;  2FX0 A;  4FIS A;  4Z6Y A;  2QA4 I;  4ENM A;  3HKZ A;  4BDZ A;  2OTJ I;  3I4N J;  2JTV A;  4P1W A;  3RSN A;  3J7Y J;  1TW3 A;  2PX9 A;  1A5J A;  5E1Z B;  2QSH X;  6PAX A;  3T0Y A;  3I4M J;  3F8F A;  1FC3 A;  1B72 A;  4BHC A;  2VC1 A;  5CVI A;  3LWF A;  1K78 B;  2K5C A;  4BAY A;  2PI0 A;  4A3D J;  3TL4 X;  2GXB A;  2CO5 A;  2LKS A;  4UHT A;  4AIH A;  3ERE D;  2V1X A;  1HCR A;  1L3L A;  2E1O A;  5J1R A;  2CQQ A;  2Y75 A;  4M71 A;  1XSD A;  1MZB A;  2EFP A;  4M72 A;  3L2W A;  4E7Z A;  2QSG X;  2D2W A;  2FQ3 A;  1MH3 A;  3WU1 B;  3OYJ A;  3BZK A;  3WTV C;  5E3L A;  2JZY A;  1KZH A;  3A03 A;  2K9L A;  4L0Z B;  5F04 A;  2MYS A;  4I0A A;  5AIP A;  2BE5 F;  2BV6 A;  1R23 A;  2UV1 A;  4HBL A;  3ESW B;  2CW8 A;  1B72 B;  4AM3 A;  4A3G J;  3L7W A;  4KJZ A;  1M1E B;  1HC8 A;  2GAU A;  3K70 C;  3HHH A;  3O6B B;  4IZZ A;  1ODD A;  3P9I A;  1QGP A;  1IJW C;  1E2X A;  3HBL A;  2D1V A;  4IL6 C;  2R7T A;  4EVI A;  3LFK A;  4AYB N;  1NG6 A;  4R1H A;  3KET A;  4IVN A;  2TRT A;  5IT9 Z;  1EV7 A;  3DPT A;  3HZJ A;  2O5R A;  3GZN B;  1J75 A;  5LLQ A;  3GFM A;  2A07 F;  5EJC A;  5JVT A;  2V9V A;  2YUS A;  5FKO A;  4I01 A;  2GM4 A;  3TO7 A;  1WJF A;  4HF0 A;  2VI6 A;  3WG7 H;  2O0Y A;  4UXN A;  1WQ2 A;  1R1T A;  3LOC A;  1GDT A;  2EIM H;  4XOP A;  5DCF A;  1MBK A;  2NS8 A;  2WB1 A;  4M9X A;  1RR8 C;  2DN0 A;  1UFM A;  3FMS A;  4R79 A;  3K1M A;  3J7A Y;  3OYA A;  1KQ8 A;  5DD4 A;  3BG3 A;  1LUJ B;  3ONQ A;  3LAP A;  2JA2 A;  2HVQ A;  4EJO A;  2IJL A;  3L09 A;  2HVS A;  5CVU A;  2WAF A;  5LFA A;  5FD6 A;  1K4T A;  3RTR A;  3CMY A;  4A6D A;  2W7N A;  1H8A C;  1FTT A;  3LSI A;  4O6J A;  2BY1 A;  3FBI B;  2MA3 A;  3HPG A;  4A5N A;  1SC7 A;  4UVB A;  4IOA F;  2L7M P;  2Y0S A;  4QPQ A;  1XSV A;  4YFN F;  1VI0 A;  2DI3 A;  2H6B A;  1GUU A;  4LK1 F;  5JI6 A;  3FK6 A;  4F92 B;  3J80 K;  2QM3 A;  4XN3 A;  5J4Y A;  5K1Y A;  3I56 I;  3LA3 A;  3NWT A;  1FEX A;  2P0W A;  3WTU C;  2BY2 A;  3FMR A;  4MFE A;  4GXO A;  3BP8 A;  3ZXS A;  3H3U A;  3P9K A;  3BZ6 A;  2OQR A;  3ZMT A;  5K5R A;  2VKD A;  1X1P A;  5H6R A;  4AC0 A;  1ETQ A;  1LE8 A;  3PL8 A;  4N4N B;  2ZJ2 A;  1RKT A;  2YX7 A;  1TWA J;  3E3V A;  2A69 F;  1VF9 A;  4BE1 A;  3M8E A;  3BY6 A;  5LGU A;  2L7F P;  3PIP F;  3N97 A;  1I6H J;  2UXX A;  2BY0 A;  3VSK A;  3LA7 A;  3J81 Z;  2RV8 A;  1GXQ A;  3DTE A;  2VIX A;  2PN6 A;  3GXO A;  1J5Y A;  2YSR A;  3K4L A;  3DU5 A;  1HBX G;  3BTL A;  1D1B A;  3CF5 F;  3KE2 A;  3VSL A;  3AG2 H;  5L3F A;  4A3J J;  4ZZD A;  2DOF A;  2IT0 A;  4A69 C;  1E0E A;  2IGO A;  4XOR A;  2F4M B;  4NB5 A;  3QRF F;  3S2W A;  3MMY B;  2MW8 A;  1IXR C;  2G7U A;  2CW7 A;  2WV1 A;  3ZQL A;  2K4J A;  1R5G A;  1LE8 B;  5IT3 A;  1WJC A;  3QP5 A;  1XN7 A;  2E1M B;  2F5D A;  2MAB A;  1YS6 A;  2X6X A;  2D5V A;  5HDK A;  1T8I A;  1SVL A;  1D0Y A;  2EBI A;  1KON A;  1I1S A;  4HA8 A;  3CD6 I;  4XLF A;  4XBF A;  4I09 A;  5K5Q A;  1IN4 A;  3CMM A;  3ECO A;  4LB6 B;  5L3D A;  3KYC B;  1YG2 A;  2JA8 J;  3BR3 A;  2FRH A;  3BTC A;  5D6E A;  3QU3 A;  1TC3 C;  2VE8 A;  3S1Q J;  2BVL A;  4EM0 B;  2OTL I;  2MLK A;  1BI0 A;  4WWC A;  2LY9 A;  2F4O B;  2VXZ A;  5ILU A;  3SFI A;  2FJ1 A;  2M5W A;  4FQG A;  5FGM A;  3DLL F;  1YRN A;  2IS6 A;  5D4S A;  2M7A A;  5JHF A;  4HF2 A;  4Q5S F;  5E3O A;  3S3M A;  1W7P A;  1VQ8 I;  2H8W A;  3S16 J;  2E1M C;  1OR7 C;  2XB5 A;  4PCQ A;  3OR2 C;  5DV5 A;  4HNV A;  2NYX A;  2OJE D;  1OKR A;  5E79 C; 
#chains in the Genus database with same CATH homology
 2EZI A;  3MN2 A;  2LKX A;  1B8I A;  2R93 J;  4Y52 J;  1TWH J;  3BQY A;  5C3E J;  4MO7 A;  4D5F A;  4A3C J;  1IUF A;  3TW6 A;  5BNG A;  3M4O J;  1A6I A;  2DA3 A;  1JKP C;  3Q3S A;  1F43 A;  1IV6 A;  4QIW N;  1JGG A;  1CQT A;  3TP0 A;  2CUF A;  2XGC A;  5EG0 A;  1LFB A;  1FJL A;  3LSG A;  2Y31 A;  2M9H A;  2XRL A;  4C2M J;  3H3V K;  4A3E J;  5IYD J;  2DMN A;  1YRN B;  4M3G A;  1RET A;  4UUT A;  1QPI A;  1ZQ3 P;  5K7F A;  2Y2Z A;  2X48 A;  4I76 A;  4CYC A;  2P81 A;  2NVT J;  4DYR A;  2NVX J;  2K9S A;  4QSH A;  1AHD P;  2XB0 X;  1B8I B;  2WAQ N;  1JJ8 C;  2QF7 A;  2DA5 A;  3FK7 A;  5EGO B;  3BT9 A;  1BA5 A;  2I10 A;  2G0E A;  4XK4 A;  4A3L J;  5EZH A;  1RKW A;  2JJ7 A;  5HOD A;  2LP0 A;  1X2N A;  2ME6 A;  5EDN A;  2K40 A;  4JP0 A;  2M0C A;  4X1E A;  1GV2 A;  2R0Q C;  1ZTR A;  3GTJ J;  2XGD A;  3IV5 A;  4JX5 A;  3HKZ N;  4CYC B;  2TCT A;  3DEW A;  1LFU P;  3HOZ J;  2GLO A;  2LR8 A;  1OJL A;  1JTX A;  2XGE A;  5IYB J;  5GPC A;  2B63 J;  1QVU A;  2LD5 A;  4D5C A;  5EF6 A;  1MNM C;  2EZL A;  3BTI A;  3QQA A;  1POG A;  3A01 A;  1WCM J;  3FIS A;  2L7Z A;  3BQZ A;  3LSJ A;  3HOX J;  4A3I J;  1I3Q J;  2DMP A;  5JLW A;  4I6Z A;  1GT0 C;  1VFC A;  3JRI A;  3SJM A;  4FTH A;  3ZQI A;  1RR7 A;  1SFO J;  2NVQ J;  3JRE A;  2AO9 A;  2R5Z A;  5F0F A;  1MBJ A;  1X2M A;  1BJZ A;  3D1N I;  1WI3 A;  2YU9 J;  1JKO C;  3UKG A;  2DA2 A;  3HOV J;  2JK3 A;  2VKE A;  2R5Y A;  3S15 J;  2XSD C;  1ZR2 A;  1RPW A;  3PM1 A;  2IBD A;  3BR1 A;  2LLK A;  2AHQ A;  3SDG A;  5J1U A;  4MIM A;  5IPA A;  2DMQ A;  5FKK A;  4V2G A;  3WHB A;  3ZQF A;  3A01 B;  3S1R J;  2HYJ A;  3WHC A;  2M8G X;  1D5Y A;  4XRM A;  4B1R A;  3S1N J;  4DYQ A;  1JTY A;  4DZJ A;  2M2E A;  1UHS A;  4BKX A;  1K83 J;  1MSF C;  5IYC J;  1MBF A;  5M5W J;  2Y9Y A;  3JRC A;  3E7L A;  1QRY A;  1HDP A;  1WGX A;  3TP3 A;  1I50 J;  2XPU A;  1ZKG A;  5M5Y J;  1OFC X;  1IDY A;  4FCY A;  1JKQ C;  3HOU J;  4A3B J;  2DA6 A;  2ID3 A;  1OCP A;  3NAU A;  3OIO A;  2R5Y B;  3IH2 A;  1TWC J;  2IAI A;  2WB1 N;  3H0G J;  5M5X J;  3G1L A;  5EZG A;  5FLV A;  1TWG J;  2KDZ A;  2CRG A;  3ZQC A;  4MLO A;  5E3M A;  3ZQG A;  4S0H B;  4AUX A;  4IEJ A;  2EH3 A;  4LOC A;  3LNQ A;  3BR5 A;  4NDL A;  2DA1 A;  5DTD A;  2EZH A;  1IDZ A;  4BXX J;  4DW6 A;  1BW5 A;  4RDU A;  1P7I A;  1IGN A;  1MSE C;  5IOY A;  1NK3 P;  2Y0S N;  1IC8 A;  1JKR C;  2E2I J;  1MBH A;  1W0T A;  3BTJ A;  3GTM J;  3W6V A;  3GTO J;  4C3I J;  2E19 A;  2Y30 A;  2DTZ A;  5F27 A;  2DA7 A;  5GP9 A;  3LSP A;  2ECB A;  3Q0U A;  1BL0 A;  1Z77 A;  3JRF A;  2H8R A;  5IP7 J;  1WH5 A;  3O8G A;  5F0C A;  4XRS G;  5FLM J;  5M3M J;  2MG4 A;  3G1O A;  1FTZ A;  1AKH A;  1XS9 A;  3S14 J;  5EG0 B;  1U9O A;  4BY7 J;  2X6O A;  2RAE A;  2PMZ N;  3RQI A;  3CDL A;  1P7J A;  1TWF J;  1T33 A;  4UUS A;  3S2H J;  3FIW A;  4G12 A;  1MBE A;  2CJJ A;  2HXI A;  2HOS A;  1HLV A;  5IOZ A;  1MH4 A;  3B6C A;  2Y9Z A;  3JR9 A;  1WPK A;  3A02 A;  5IP9 J;  4BBS J;  2COB A;  4A3F J;  1JUP A;  1FIA A;  4V2F A;  2FQ4 A;  2W48 A;  1ITY A;  1SAN A;  2JMW A;  2XPW A;  3CCY A;  2ELK A;  4XID A;  1ETV A;  3ZOB A;  5F0H A;  2JA7 J;  5E3N A;  1R9T J;  4QTR A;  2DA4 A;  2GBY A;  1IRZ A;  2R7Z J;  4X6A J;  1AKH B;  2R92 J;  2O7O A;  2FX0 A;  2QCO A;  4FIS A;  3OSG A;  3TED A;  3Q0W A;  2X9D A;  2MGQ A;  4IHW A;  3MVP A;  4JYK A;  2FD5 A;  3I4N J;  4A3M J;  1A5J A;  4BY1 J;  5DS9 A;  4XRS A;  5FKN A;  3I4M J;  2HXO A;  2OF7 A;  5K7Z A;  1B72 A;  4JX4 A;  4BBR J;  5K7H A;  3RKQ A;  4A3D J;  2JA5 J;  2NOG A;  5FKM A;  5FJ8 J;  2LVS A;  1HCR A;  5C4X J;  1ETY A;  2E1O A;  5J1R A;  2CQQ A;  1JJ6 C;  1U78 A;  3OSF A;  1JT0 A;  2L9R A;  2XPV A;  1ZR4 A;  3OOU A;  2DMT A;  3VPR A;  1APL C;  4ABZ A;  1MH3 A;  3TW7 A;  1ORK A;  4L5E A;  5E3L A;  3A03 A;  5F04 A;  1HOM A;  3BR6 A;  2HI3 A;  3B6A A;  3FKI J;  1VND A;  1AU7 A;  1B72 B;  1H89 C;  4A3G J;  2R5Z B;  3LSR A;  2EQR A;  1Z0X A;  3QPL A;  3MKL A;  1K61 A;  1QVT A;  4M3D A;  1XG1 A;  1ZK8 A;  1IJW C;  3HBL A;  1ETO A;  1JT6 A;  1S7E A;  1NK2 P;  4AYB N;  1HDD C;  2TRT A;  3JRB A;  2IEK A;  1ZGW A;  3NAR A;  3PO3 J;  1PUF A;  2L0K A;  1BW6 A;  2JA6 J;  5EYR A;  2YUS A;  2O8K A;  3F0C A;  5FKO A;  2ZB9 A;  2HQ5 A;  2H1K A;  2GM4 A;  2VI6 A;  1FIP A;  1EF4 A;  4IHY A;  5F1J A;  1ETW A;  2E2J J;  3S2D J;  4M6V A;  1MBG A;  1XC5 A;  3LOC A;  5EGO A;  1GDT A;  2CQX A;  3HEF A;  1MBK A;  2NS8 A;  2HOA A;  2DN0 A;  1UMQ A;  1WH7 A;  5M3F J;  2ID6 A;  2HDD A;  3S17 J;  1T56 A;  5C4J J;  2EZK A;  3JRG A;  3HOY J;  2NVY J;  3BG3 A;  3L1P A;  4B3A A;  1G2H A;  1Y1V J;  2MSY A;  1PUF B;  5JLX A;  2VPR A;  3CMY A;  3GTL J;  1H8A C;  1FTT A;  4A93 J;  4M3B A;  1H88 C;  1X58 A;  2L7M P;  3BR0 A;  1VI0 A;  2K9N A;  3S1M J;  1GUU A;  4C3J J;  3FK6 A;  4B4C A;  3JRD A;  1NTC A;  1FEX A;  2VKV A;  1JUM A;  4MFE A;  3M3Y J;  1U9N A;  3HGG A;  5F08 A;  2DJN A;  4Y7N J;  2LFB A;  2N8G A;  4M3F A;  4AC0 A;  3GTK J;  1F36 A;  1O4X A;  2O9L A;  1ETQ A;  1LE8 A;  2JN6 A;  3GTP J;  1RKT A;  3BG5 A;  1ETK A;  2KT0 A;  1TWA J;  1IG7 A;  4JX6 A;  1VF9 A;  5EEA A;  2LK2 A;  3HOW J;  4UUS B;  4M3E A;  3C2B A;  2LTP A;  2ME0 A;  3HDD A;  4A3K J;  2L7F P;  4GFB A;  1I6H J;  4DYC A;  3RZO J;  5IP6 A;  3IH3 A;  3GBG A;  2K9Q A;  4RBO A;  2ECC A;  4D7M A;  1ENH A;  3IH4 A;  4W97 A;  3BTL A;  5GPA A;  4A3J J;  4W1U A;  4A69 C;  1GV5 A;  1JUS A;  4C3H J;  1W0U A;  5J1Y A;  1DU6 A;  1ETX A;  3K7A J;  3RZD J;  1Y1W J;  2MW8 A;  2OPT A;  2WV1 A;  3ZQL A;  1LE8 B;  3HB9 A;  4IHV A;  5FKL A;  3G1M A;  5C44 J;  3QPS A;  4FE7 A;  5J3L A;  2D5V A;  1OCT C;  2EBI A;  3DCF A;  4IHX A;  4DZP A;  3GTG J;  1Q1V A;  3CQZ J;  4XIC A;  2E2H J;  3HM5 A;  2DMU A;  3JRH A;  9ANT A;  2CU7 A;  2VUM J;  3HGY A;  3GTQ J;  1U8B A;  2NS7 A;  2JA8 J;  1UG2 A;  2CUE A;  3BR3 A;  1E3O C;  2HOT A;  3BTC A;  1TC3 C;  3S1Q J;  4J19 A;  3BR2 A;  1RES A;  2M34 A;  2LY9 A;  3SFI A;  3BG9 A;  1HF0 A;  2FJ1 A;  3PO2 J;  3Q0V A;  3JRA A;  4D7N A;  1YRN A;  5E3O A;  3K2A A;  3O8H A;  4MFD A;  3S16 J;  1GVD A;  2XB5 A;  2JWT A;  4EEF G;  4HNV A;  3ZQH A;  1DU0 A;  2YS9 A;  4FE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...