1XB4A

Crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
180
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
publication title Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 56
structure length 180
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xb4A02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1xb4A01
1C0WA 3MZYA 2A69F 2QZ8A 5AONA 2PBIA 4GCVA 3Q5FA 3SZPA 1QBJA 3DP7A 2XAQA 2P7CB 4FHTA 4OIQF 5K5QA 2HYFA 1BOAA 1XGOA 1B9MA 1BI2A 4N9IA 3FM3A 5ERIA 1KA8A 2B0LA 3R4KA 2OAZA 2V1DA 3VFZA 4P9UA 4HDVA 1ZYRF 4UHTA 5LEKA 1UHMA 3BJ6A 5BMZA 2ADUA 3WTSC 1VTNC 2D2WA 2HKXA 3WE2A 2HKOA 3ZN0A 1FBUA 1LDKB 3P9IA 5ICFA 4HV6A 1SD5A 3IRQA 2LF7A 3CUQA 4QWQA 1QZZA 3KLNA 3WG9A 5FLXK 3GYHX 3LA7A 4KICA 4LLGF 1U2WA 3TOAA 2V79A 4ZYHA 3M1EA 2R7DA 3KP5A 3GFIA 3SFZA 1ZH5A 2YSRA 3HSFA 2EV6A 3K0LA 5CJ9A 4MTDA 2CSOA 2BEOA 1K79A 2CFXA 2IRFG 4ZYEA 1Z6TA 1V4RA 4HX8A 3W6JB 1R22A 1L0OC 1OPCA 4RGRA 3KP7A 3E97A 3GUDA 4NQWA 2PLYA 4KIFA 1XDUA 1YQAA 4LB5A 3I58A 3D5LA 4KDPA 3FZVA 2L3DA 3HRMA 2DAOA 4B09A 1LB2A 2ZMEA 5DCMA 2NNNA 4RB2C 1YO5C 3TQNA 5DV5A 4XRFA 1J2XA 1TQIA 2A61A 2Z33A 2WWYA 5FFZA 2DBBA 3WGHA 2GWRA 4KMUX 3GX4X 1I1GA 3F72A 5DD4A 5HLGA 4OINF 1EH6A 1XSXA 4M9XA 3BWGA 5D5XB 2DU9A 3DQVC 1KU2A 1ZGAA 5J8CA 3PQKA 2W24A 3WE3A 4YFXF 3KEOA 2E1NA 2P4WA 3IHUA 1MJBA 3ZMZA 2VN2A 2P5LC 3GF2A 4BNCA 4ESBA 1HKQA 3E6DA 5D6EA 2JT1A 5E17F 1P4WA 3FXQA 1HKTA 2PMHA 1U5TB 3E6BA 3J81Z 5H6RA 5H6QA 4ENMA 4O5VA 2GIVA 2BYVE 1IZ1A 4YG2F 2VE9A 1TTYA 3RPQA 4GYIA 3DF8A 4I09A 3GFMA 1ZG1A 1ZRDA 1F9NA 5LLQA 3ROUA 1EV7A 1CF7B 5LRSA 4S04A 2JZYA 1K78B 1USSA 1G3WA 4JBAA 2W57A 2CW0F 3DPLC 2M30A 2HDCA 5DYMA 1A04A 2CG4A 3DKWA 2VBWA 2ISYA 2JTVA 3GFJA 1R36A 2W85A 3IKTA 2CQKA 2ETHA 1J75A 1U5TC 1KU3A 4O6JA 4HLYA 4AIJA 1DDNA 4Y17A 3TDZC 1J5YA 4HZFA 4IRHA 4IPAA 2GQQA 5D8LB 1DUXC 4LGWA 2KRFA 4EQQA 2MBFA 5JHUA 2DT5A 1SFUA 4G7ZF 2ZFWA 1MDMB 3MFKA 1XCVA 1W5SA 5E1WA 1ZRCA 2A07F 3SHFA 4TV7A 1PUEE 1SMTA 3F23A 4XSXF 4A0YA 4CXFA 3JAMK 1MD0A 5HDNA 1BBYA 1G3SA 4BXUA 4I2OA 4WF2A 3J80K 3QOPA 1OMIA 2RNJA 3BJAA 1T98A 3RKXA 3VODA 2VBZA 5IT9K 4RAZA 1FWZA 1TNSA 3V7RA 4EM1A 1FNNA 4CGZA 2VBYA 2IPQX 1H9GA 1K7AA 3ZMUA 1FP1D 4BYYA 5E8IA 1HQCA 3WTYC 2VODA 1ON2A 4AD9A 3WU1B 2J5PA 3BPVA 4MQ9F 5ED4A 2P6TA 4MQVA 2FNAA 1OYYA 1T39A 2A68F 3E5QA 3JW4A 1EH8A 3BDDA 1Z91A 4G7OF 1R5HA 1DPUA 2VBXA 4Y13A 3EDPA 2OU2A 3HUGA 5A2QZ 3QP6A 5K5OA 3T5XA 3GZ6A 5E20A 2RVCA 1T6SA 1Z7UA 2RC4A 3R0AA 2VT2A 1YIOA 3RYPA 2ZMEB 5IT3A 5DCMB 2J5OA 4L0ZB 1KYZA 3HRUA 3F22A 4LMYA 4UV9A 2X0LA 3F8NA 2FBKA 1PDNC 2FEZA 4XLNF 2LNBA 2HWVA 2DLLA 1YW9A 3KCCA 3FM5A 1W7PA 1K6OA 2GXBA 1WWXA 3R61A 1T2KA 2HTJA 4RB3C 1YFHA 1EH7A 2QVOA 5JR3A 1P92A 1ONVA 2UWMA 3KZZA 4M9ZA 3RIRA 5LHIA 4H0EA 2AS5F 4DNCA 5HS8A 2EWNA 2DQLA 2XGXA 3SQNA 1XMAA 4IHTA 2M87A 2G7HA 2L54A 5DUKA 1S3JA 4RB1A 1KQ0A 5EEGA 4EM0B 2QYOA 1FT9A 1XMKA 4M74A 2FOKA 2VOPA 1P6RA 1U5TA 2Z3YA 5LRRA 2QQAA 4OIRF 3FMQA 1SD7A 4FX0A 3T8RA 4EM2A 1F5TA 3RKYA 3LAJA 4A6EA 2GXGA 3HOTA 4G7HF 5BQTA 3ABUA 4LD5A 2PFBA 3QAHA 2RQPA 3QRFF 2O3FA 1XN7A 2EV0A 4RGSA 2PI0A 1TQMA 3Q9VA 5CVVA 3M7GA 1SMYF 1FC3A 4E70A 1KQ8A 3R0JA 2Z5UA 1GXQA 1QQIA 1B4AA 3ELKA 2O8XA 2PEXA 4MGRA 2HFHA 3V8KA 2A6HF 4CHUA 3P7NA 1QGPA 2V9VA 4EJWA 4P96A 2UXXA 1REPC 2RV8A 1IRGA 3BOQA 4EMSA 1HKSA 1JHFA 4MNUA 5TJJA 2HOEA 4NHJA 2M1BA 3R60A 2HGCA 4L9NA 3ZN1A 3U9GA 3K9TA 2F5EA 2XKPA 1ZN2A 2WV0A 2NRAC 2VC0A 2OZUA 3E6MA 5FD5A 4OU0A 4KFCA 1DP7P 1RIOH 2ESNA 5LGNA 1FYLA 3HOSA 1KU7A 2JRTA 4Q5SF 3AAFA 3M9AA 1MDMA 2DTRA 4D0PA 2EB7A 2ZKZA 1O3QA 3EQLF 4BH9A 1IN4A 1YW8A 4EJOA 4R79A 3IL2A 1ZREA 4I7HA 4M6YA 4HX7A 4HQMA 1HBXG 1LQ1A 3M8FA 5F1RA 3I0TA 2UXNA 4ON0A 4NB5A 1BI3A 4A2UA 2JSCA 2IP2A 4OIPF 5L3BA 2Y75A 3BZ6A 4ZZDA 2STWA 4AIHA 2DQRA 5ICEA 1MKMA 3O3KA 1I1SA 2R3SA 4KA4A 4LG0A 3ISPA 2FBHA 4LLLA 5JVTA 1P4XA 1R5GA 3MEXA 2FXAA 3V7SA 3WU0A 5F64A 1FY7A 1RUNA 2E7WA 2XIGA 2RKHA 2K4BA 3MZHA 3ZMDA 3WGIA 4EV0A 1JXSA 2P5VA 1RI7A 3J7AO 2H6BA 3HTUA 2HS5A 4MHGA 1CGPA 4HA8A 3ZMVA 1ZG5A 2MD5A 1USTA 4LJZF 5CVJA 1FX7A 3K1MA 2EA2A 4L0YB 2IW5A 2KJBA 3S2WA 1TLHB 2KIUA 1DPRA 2YX7A 3GVAA 3I64A 5CVRA 5L3GA 3I59B 5K1YA 4WCGA 1W7PB 4CDGA 3WTTC 4N9HA 3FF5A 2D1VA 3TDUC 4OMZA 3GW2A 2ISZA 1OKRA 2LKPA 3E6CC 2ZNZA 3HTSB 1B59A 1Z05A 1ZLKA 2QWWA 5L3FA 3BROA 2LF8A 1IRFA 1S29A 4ESJA 4GYGA 2WC2A 2OD5A 3RKWA 2PMUA 5FO5A 1RNLA 3NQOA 4MEXF 5LGTA 4CO8A 2XV4S 2EV5A 3T0YA 5E1ZB 1O3SA 4G6DA 4Q47A 1TQPA 3JTGA 4PZJA 4KN4X 1ZG3A 2O61A 2VXZA 2CYYA 4FX4A 1G4DA 1QPMA 3H92A 2JPCA 3D0SA 4BAYA 3COAC 1ZLJA 1W5TA 3GXOA 4YIFA 4YFNF 2Y48A 1XD7A 2EA4A 1QZYA 3F6OA 1BIBA 2RN7A 2UZKA 3C1DA 3GLXA 2EFNA 4P55A 5D6FA 2QM3A 4IXAA 4RB0A 1J7KA 2M45A 3FXRA 3REOA 1ZAOA 2FQ3A 1JHHA 1FSHA 4WXCA 3U1DA 3IRRA 2OBPA 1J59A 2LDUA 2DW4A 3TO7A 5EEHA 1UB9A 2EFPA 1LVAA 1O7LA 2IVMA 4RS8A 2W25A 1IN8A 1ZGJA 2HQNA 3L00A 4K2EA 3SZTA 1P4AA 2ZXJA 2P8TA 2MC3A 3HRSA 1MJAA 3L7WA 2L01A 2IA2A 5K5RA 4EVIA 1HW5A 3O2PE 2FBIA 1NHAA 3R6SA 4KIGA 4XLPF 1ZHFA 1SFEA 4PDKA 2YX4A 4ZZLA 3LSTA 4WXHA 1V3FA 1RUOA 4Q48A 3WTXC 3CJNA 2QENA 2M5WA 1ZARA 5E18F 1YTYA 5LGUA 3IC7A 3M8EA 4LG0B 1R1VA 4A0XA 3I71A 2EFWA 4LK0F 4RGXA 2HEOA 2KIMA 4HX4A 5ICGA 2XAFA 3QPHA 1U3EM 5D4RA 4OMYA 4WWCA 2RGVA 4XSZF 1B1BA 1QNTA 4BHBA 4ESFA 3K2ZA 4L18B 1WSUA 4LLNA 3TKYA 3MAJA 2DO7A 5L3DA 1IN7A 4KNYA 2E1CA 4HF1A 3TO9A 3WTZA 5HS7A 3ABTA 2W84A 1H9TA 3HIFA 1BI0A 1WKMA 1HW2A 4ETSA 4EGYA 3KP6A 2A3SA 3J81K 3I4PA 4UUVA 4IF4A 3P9CA 4HQEA 1XCBA 1E2XA 3I59A 4KMFA 2YR2A 4A0ZA 1MZBA 1SFXA 3L2CA 5FLXZ 2QQBA 3O6BB 3ZMSA 1H0MA 2F2EA 3HRTA 5BPIA 5AIQA 1FLIA 1GXPA 3ECOA 1Z6RA 2A5YB 4WK8F 1L3LA 1ON1A 1BC7C 2M8EA 5E1XA 1TNTA 2PG4A 3HYIA 2VT3A 4IRIA 1MJ9A 2EJRA 5LHGA 1XB4A 1TW2A 5HLHA 2JPBA 4HAMA 3KE2A 1OYIA 3L9FA 4A12A 4KN7X 4HF0A 3IWZA 3TGNA 1LEAA 4L9JA 2O03A 4I0BA 3ECHA 5F6FA 3FXUA 4YIIA 4ENKA 2C6YA 2VOOA 2PN6A 3DPTA 4I02A 1FYKA 6PAXA 2NAZA 1E17A 4Q4ZF 1YYVA 1BI1A 4FT8A 2KJCA 2IA0A 2XASA 2D45A 1MGTA 3KP3A 2HQRA 4ZYDA 4MTEA 1BN5A 1SAXA 4ZYGA 1U78A 2FNPA 3V7CA 4UV8A 2MA3A 1G3YA 1KYWA 4ZH4F 2OA4A 1D5VA 4MEYF 3BJOA 2DK8A 3B73A 4HYEA 4EGZA 2H27A 2QUFA 2L02A 5FB2A 1IN6A 1ODDA 1R00A 2GZWA 2IA1A 1D8KA 1I5ZA 2E7XA 3WTVC 5D5VB 2Q0OA 4KIBA 4G6QA 4UVBA 1O57A 3F6VA 5HVQC 5D5WB 3WTWC 5BPDA 5DD8A 2CWEA 1FBSA 2Z9OA 3GWZA 4LFUA 3KLOA 3PQJA 3RPUA 2NYXA 2Q8KA 1LNWA 3W6KB 2P6SA 4G9YA 2LSOA 3L09A 2MLGA 3CO6C 1S7AA 3LQRA 2FE3A 3F8CA 4YFKF 2F5CA 1IUYA 5A2QK 4GO1A 2OQGA 5J8FA 3KEQA 3TOBA 4M6XA 4DQ2A 3H3UA 1IXSB 1WRJA 5CLSA 4A6DA 4U7BA 3ZMTA 3GFLA 2QQ9A 4U0VA 2DPUA 2ZJ2A 3HSRA 3RDIA 5D5UB 1D3YA 4F7ZA 1PP7U 2HZTA 2MH9A 3F8MA 4IVNA 1GHCA 3T8TA 3WODF 1AWCA 1HXDA 4BQAA 2BE5F 4HF2A 1BIAA 3EUHA 4M71A 1T38A 2GA2A 2EFQA 2VE8A 3C3WA 4UNOA 2FMLA 4AWXB 1IW7F 2GA1A 1WI9A 3F21A 3B02A 4Z2YA 1Z1DA 3WGGA 4L5JA 5BS6A 1UHWA 3ML6A 1LDJA 4IJAA 1GVJA 4UVAA 4UXNA 5FGMA 2KKOA 3JAMZ 3FWEA 2BBYA 2X4HA 2OZ6A 3VEPA 1U8RA 3DXJF 3J80Z 3GZ5A 2ELHA 4KYWA 5HDKA 5IT9Z 2OQRA 2O0YA 4P5OA 4L5IA 4ENNA 1OYWA 3EYYA 3KETA 2H94A 2F5DA 5ICCA 2V6CA 4R1HA 2KIFA 3PFIA 5CVUA 4OIOF 4GGGA 4CZZA 1J9IA 3K1PA 1YW7A 2YU3A 1S7OA 1R1TA 4EJVA 4M73A 4U7DA 3KP2A 3QU6A 2D1HA 2DK5A 3EETA 2HR3A 1FP2A 3LA2A 4WXDA 1OR7A 3F3XA 3LFKA 1IAWA 3U2RA 4HW0A 3V8JA 3CLOA 2G9WA 4RGUA 3IKVA 4KT5C 5L3CA 3E3VA 2QBYB 3FHZA 2NS0A 1W7PD 2FA5A 4HV5A 1STZA 3BP8A 4CYDA 5JFRA 1BM9A 1JE8A 4U0YA 3DV8A 3TO6A 3RYRA 5DDGA 1I6XA 1IN5A 1O3TA 4UVCA 1FOKA 5HDGA 2XKOA 3H3ZA 3IWFA 5J6XA 3LQQA 2XAHA 1R58A 2XUBA 2ZNYA 4PGGA 3I5UA 1FBQA 1BC8C 3RTRA 2O6GE 2H6CA 3FMRA 3KP4A 1W4MA 2K4JA 1SD4A 5JI6A 4CICA 1S6LA 5KVRA 3GEZA 1LEBA 1XDSA 1TBXA 2CGPA 1JGSA 5FD6A 2ZCWA 4B8XA 4LK1F 3N4MA 2RDPA 4HBLA 2VC1A 4LB6B 4AIKA 5HLIA 1HW1A 2HTSA 3ZQ7A 5CVIA 2V1UA 4A5MA 4HOBA 5ILVA 1XGSA 3I54A 1IXCA 1LJ9A 5HOOA 2ACJA 3K1NA 5BOXA 3QU3A 1Y0UA 2Z99A 2FF4A 3SXYA 3F8FA 3KZYA 1XSVA 4L9TA 2AXLA 5D4SA 1R23A 1R7JA 1UFMA 2FSWA 5KK1A 2FMYA 4M9SA 1O3RA 4O3MA 5LHHA 2EFOA 5ILSA 3HSEA 3KFWX 2HYGD 1FYMA 2L4MA 1F1ZA 1Z9CA 1YG2A 4BHCA 1LDDA 3K69A 3V8LA 3ULQB 3QP5A 3RI4A 1AOYA 3CUQB 2K86A 4RAYA 3WTUC 1XGMA 4KUMA 1S8NA 4HDUA 1G3TA 3P9KA 2L4AA 2V1XA 3LAPA 5TRDA 3NRVA 4ASNA 2XAJA 1ZRFA 1XSDA 5DEQA 5H20A 3GO5A 1B9NA 4Y15A 2EK5A 3LWFA 1O7FA 3MWMA 4GXOA 4M72A 4G94A 4HLXA 2G7UA 2K02A 1J0RA 2Y0MA 5DUIA 1TW3A 4ENJA 5LBQA 1G6NA 2COMA 2DI3A 1HSJA 3MQ0A 3ZP5A 2P5KA 2K7LA 3C7JA 1SD6A 4S05A 3CUQC 1WQ2A 2XROA 3QPTA 4P9FA 3EYIA 2XHKA 3I53A 4IRGA 4U88A 2DPDA 3NEUA 2MH2A 4JK1X 4L9VA 2IJLA 2XVCA 3HHGA 3MCZA 3JTHA 2BV6A 2F5FA 2FRHA 5LEJA 3G3ZA 2K27A 2TDXA 2MLKA 2VONA 3N97A 3HHHA 3ZPLA 1D8JA 1FPQA 3OV8A 3BY6A 5ILUA 2ESHA 1F4KA 3DFGA 1P2FA 3E5XA 1FZPB 1BJAA 5L3EA 2CO5A 1IXRC 1YS6A 4G8XA 1KQ9A 1KGSA 3BPXA 2QLZA 4QLCU 2ZMEC 4OOIA 2QBYA 1FSEA 4EJTA 3G73A 2XRNA 3JSOA 4PGHA 4JQFA 2YPRA 2R7FA 1ULYA 1YLFA 3RJPA 2P7VB 4A5NA 4PCQA 4I0AA 3LA3A 3VOEA 1Q1HA 4U0WA 3V4GA 2Q2EA 1XGNA 2FU4A 2PJPA 3E5UA 3CO7C 1B6AA 3FMSA 2DFIA 3OOPA 3T1BA 1CF7A 1K78A 2STTA 1U6GA 4WX9A 5CYVA 4EJUA 1R1UA 5HS9A 4XBFA 2H09A 1X3UA 2GAUA 3CDHA 3C18A 3JSPA 1T0FA 2PQ8A 4N0BA 3CUOA 2WTEA 2XAGA 5AIPA 1QO0D 4I01A 3CTAA 1UCRA 3DEUA 2A6EF 4BHPA 2BGCA 5DCFA 5FFXA 1KU9A 2ZBKA 3FX3A 3Q9SA 4IHSA 1IF1A 3F8BA 4AVPA 5D8KB 3VB2A 1HSTA 1PP8F 4R8HA 1RZ4A 1I27A 3ERED 2NNYA 4I98B 1YS7A 2ZO4A 5E8GA 2IT0A
chains in the Genus database with same CATH superfamily
1C0WA 3MZYA 2HVSA 2WAQN 2A69F 2QZ8A 2XB0X 5AONA 2MD0A 2LG4A 2PBIA 4GCVA 4KJZA 2ZFUA 3SZPA 4BKXA 3Q5FA 2ZSHB 2ME0A 1QBJA 1IO2A 4M3EA 3DP7A 2XAQA 3SEZA 2P7CB 4XKVA 2JJ7A 3NWSA 4FHTA 2Y9YA 2VKVA 2X48A 4OIQF 5K5QA 1IRZA 3Q0UA 1GV2A 2HYFA 2NOGA 1BOAA 1XGOA 1B9MA 2NOJB 1MNMC 1BI2A 4N9IA 3FM3A 1QRYA 5ERIA 4C30A 1KA8A 1A36A 2B0LA 2JSPA 3R4KA 2OAZA 2V1DA 3VFZA 2ZXHA 3H9GA 1EJ9A 1RKTA 2OV7A 3ASNH 4P9UA 3IUOA 3OL4A 4HDVA 2E71A 1ZYRF 1WJDA 3VYTB 1MBFA 4UHTA 2DXIA 3A01A 4DYQA 5LEKA 1AU7A 1AKHA 1UHMA 3BJ6A 2M0CA 4PJ0C 5C3EJ 4IQJA 5BMZA 2ADUA 5M3MJ 2LH9A 1ZELA 3WTSC 2D2WA 2HKXA 1VTNC 3WE2A 2HKOA 2OUMA 3ZN0A 1FBUA 1LDKB 4II3A 3LSRA 2JQ7A 2Y31A 3P9IA 5ICFA 4HV6A 3GTQJ 1SD5A 2O5RA 3QWLA 3IRQA 2LC2A 2LF7A 3CUQA 4QWQA 1Z77A 1QZZA 2MABA 2R93J 3KLNA 3WG9A 2NVXJ 2QSHX 5FLXK 3GYHX 3LA7A 4KICA 4LLGF 1U2WA 3H35A 4LIVA 3TOAA 5E3OA 5FRNA 2V79A 4ZYHA 3M1EA 3SJMA 2R7DA 3KP5A 3GFIA 2X6WA 3SFZA 1ZH5A 2W48A 3LSHA 3ZXSA 2YSRA 1XC5A 2DMUA 3HSFA 2EV6A 1H88C 4A3EJ 1TWGJ 3K0LA 2EBIA 5CJ9A 2F4OB 4MTDA 3SDGA 2CSOA 3QYEA 2BEOA 4IHXA 1K79A 2CFXA 2IRFG 4KT6A 4ZYEA 4P1WA 1Z6TA 1V4RA 3AG1H 4HX8A 2L7FP 4CUGA 1X2NA 2DA6A 3W6JB 1R22A 3FK7A 1L0OC 1OPCA 4RGRA 3KP7A 3E97A 2CW8A 4DJAA 2COBA 4RM2A 3HKZA 3GUDA 4NQWA 2PLYA 2FX0A 4KIFA 1XDUA 1YQAA 2KMUA 4LB5A 3CCLI 3CCUI 2XB5A 2KLOA 1IDYA 4LITA 3I58A 3IP4B 3D5LA 1HCRA 2W4SA 3ONQA 4KDPA 3FZVA 2L3DA 1PYVA 3HRMA 2DAOA 4B09A 1LB2A 2LBFA 2ZMEA 5DCMA 1VQ6I 2NNNA 3AKZA 2VXDA 5FROA 4RB2C 5BNGA 1YO5C 3TQNA 5DV5A 4XRFA 1XS9A 2K5CA 1J2XA 1TQIA 2A61A 2ZJPF 1IRGA 3PUFA 2Z33A 4XLFA 2WWYA 2YU9J 2LKXA 5FFZA 2DBBA 3WGHA 2DFEA 5IYDJ 1X3WB 2GWRA 4KMUX 3GX4X 3WU2C 3J7YJ 2R0QC 3BCBA 1I1GA 3CLQA 3F72A 2X6XA 2JMWA 2HPIA 5DD4A 2PJRA 5HLGA 2BW3A 2GOMA 4OINF 1EH6A 2KDOA 1XSXA 3TW6A 4M9XA 2E36A 3HGYA 3LSJA 3BWGA 5D5XB 2CV1A 2DU9A 2DODA 3DQVC 1YJ9I 1KU2A 4YRVA 4XLEA 1ZGAA 2BOLA 2VPLA 5J8CA 1IDZA 3PQKA 4ITVA 2K9LA 1DU0A 2W24A 3WE3A 1XG1A 2JA2A 3KEOA 2E1NA 5GP9A 2P4WA 4YFXF 1LFUP 3VSKA 3HOWJ 3IHUA 1D0ZA 1ETXA 1MJBA 3ZMZA 3KYDB 2QF7A 3FXMA 3GTGJ 2VN2A 2P5LC 3GF2A 2B63J 3JCUC 4BNCA 4ESBA 2XF5A 1HKQA 2L9NA 1YRNA 1RPWA 3E6DA 5D6EA 4AM3A 1VQ8I 2VKEA 2JT1A 3QPLA 4AU7A 4A93J 5E17F 3PSFA 1P4WA 4PUSA 3FXQA 1HKTA 1T56A 2DYRH 1I3QJ 1X58A 2CRGA 1Y56A 4BJ6C 2PMHA 1U5TB 3E6BA 1LKXA 3J81Z 2WAFA 4V2GA 3O8HA 5H6RA 3DU6A 3ZQLA 3QOEA 3IH3A 3EUKL 5H6QA 4ENMA 4O5VA 2AHQA 5IPAA 3W2VA 2XC7A 2GIVA 2BYVE 1LFPA 1YX5A 4H4KC 1IZ1A 2Q2EB 4YG2F 2VE9A 1IC8A 5C4XJ 1TTYA 3RPQA 4IHWA 1X3ZB 4GYIA 3LFUA 3DF8A 5EZGA 4I6ZA 3BC8A 4I09A 3GFMA 3OYJA 1SC7A 2NVQJ 4F92B 1ZG1A 1ZRDA 1F9NA 3BTIA 3ROUA 1EV7A 5LLQA 1CF7B 4A69C 5LRSA 4S04A 2JZYA 1K78B 5GAHJ 5EF6A 2KHMA 1USSA 1G3WA 4JBAA 4LG3A 4BE1A 2W57A 3B6AA 2M9HA 3CJQB 2HQ5A 2KPMA 2CW0F 4CYCB 4CCLA 3DPLC 2M30A 2HDCA 3D5SC 4YIRX 5DYMA 1A04A 2QEXI 1MBHA 2CG4A 1MSEC 3FHNA 3DKWA 2VBWA 2ISYA 1B72B 2JTVA 4HG2A 1ZK8A 3FXJA 3GFJA 1R36A 2W85A 2WA0A 3IKTA 4E7ZA 3CF2A 3MKWB 2CQKA 2P0WA 2ETHA 1J75A 1U5TC 1KU3A 4FTHA 2X1EA 4O6JA 4UUSA 5EYRA 4HLYA 3OWTA 1MH4A 4AIJA 1DDNA 4Y17A 1RESA 3TDZC 1J5YA 2L7KA 4HZFA 4B48A 1JT0A 4IRHA 3TP0A 3UNGC 3ZQHA 4IPAA 2HXIA 2GQQA 2QSFX 1U0JA 5D8LB 3L2VA 1DUXC 4LGWA 4AIDA 3M3YJ 1MBJA 3RZOJ 2KRFA 1A6IA 2KQRA 4EQQA 2EQRA 2LY9A 2MBFA 4Y33A 5J1UA 3AL0B 1ETYA 3PUBA 3GTLJ 1T08B 4BGDA 2DT5A 4F3QA 5JHUA 1SFUA 4G7ZF 3CMYA 4M3BA 2ZFWA 1VQ5I 1MDMB 3MFKA 2WBMA 3IH2A 4HSRA 1XCVA 5CQGA 4KISA 1W5SA 5E1WA 1ZRCA 2KRHA 3HPGA 5DM7F 5HNHA 2A07F 3SHFA 4TV7A 1PUEE 2I5UA 1SMTA 3F23A 4XSXF 4A0YA 3CJRB 4CXFA 2JUCA 3JAMK 3NAUA 1K61A 1OFCX 1MD0A 5HDNA 1E3PA 3HOUJ 3X2QH 4IEJA 1BBYA 4A3LJ 2NS7A 4PJJA 1G3SA 2F5VA 4BXUA 4I2OA 1AKHB 3KYCB 4WF2A 3CCQI 3J80K 2K85A 4RA2A 3QOPA 1OMIA 2RNJA 4BY1J 3BJAA 3OIOA 1T98A 2JRMA 3RKXA 3VODA 2VBZA 5IT9K 2BHYA 2HDWA 4RAZA 2VL8A 1FWZA 1TNSA 2DTZA 3V7RA 4EM1A 2XGEA 1SANA 4W97A 3RPUD 1FNNA 2LY1A 4CGZA 2VBYA 5J40A 2IPQX 3W3CA 1H9GA 1VQNI 1K7AA 3ZMUA 2DJNA 1JI8A 1FP1D 4BYYA 2F4IA 1HQCA 5E8IA 3WTYC 4XIDA 3VWBA 4JP0A 2VODA 1ON2A 4AD9A 3WU1B 2J5PA 1NG7A 3BPVA 4IHVA 2JVGA 3BG5A 1JKRC 4MQ9F 5ED4A 2JA5J 2P6TA 3S1MJ 3ZRGA 4MQVA 3CCYA 4PK4A 2FNAA 4RMNA 1VQPI 2R5YA 3HPHA 1OYYA 2ECBA 1T39A 2QKMB 5IYBJ 1BR1A 1D1BA 2A68F 3K4NA 3K4CA 4NC6A 1UAAA 3E5QA 4F52A 3JW4A 1EH8A 1Y6IA 4PJLA 3VYRB 3TEDA 3BDDA 1Z91A 3K70C 2E1OA 1HC8A 4G7OF 1R5HA 3LOCA 1ETVA 3DTKA 1DPUA 3L2QA 2VBXA 2DA5A 4Y13A 3EDPA 2OU2A 3S17J 2Q1ZB 4F55A 2L9SA 3HUGA 3NARA 1VI0A 5A2QZ 3V42A 3LSPA 3QP6A 5K5OA 3T5XA 3GZ6A 5E20A 2CW7A 2RVCA 1T6SA 3KX2A 1W0TA 5DM6F 1BW6A 1Z7UA 2RC4A 3R0AA 2VT2A 3CJTB 5GTHC 2KZGA 3U21A 1YIOA 3Q0VA 3RYPA 2CUFA 5F0FA 2LBFB 2ZMEB 5IT3A 1E0EA 5DCMB 1HDDC 1R4MB 4QTRA 2J5OA 2MFZA 4L0ZB 1S9HA 1VQLI 3A03A 3MKZA 1KYZA 4II2A 1R71A 3JRDA 2R7UA 3HRUA 4LMYA 4UV9A 3F22A 4HRIA 2X0LA 3BZKA 3F8NA 2FBKA 1PDNC 2FEZA 3HM5A 5KAIC 4XLNF 1T95A 4E7IA 2LNBA 4IX7A 2VKHA 2HWVA 2DLLA 3E7LA 1FTZA 1YW9A 3KCCA 2FOWA 2HYJA 3FXKA 3FM5A 2BW3B 1BW5A 3OYEA 3K4LA 1YX3A 3GLLA 1W7PA 3OYIA 1K6OA 1WWXA 3R61A 4JOMA 1T2KA 2GXBA 3HKZN 4NC7A 4BDYA 2HTJA 3JRAA 4RB3C 1HOMA 1P7JA 1YFHA 1EH7A 2QVOA 2QQ8A 3ABMH 5JR3A 1P92A 1ONVA 2HVRA 3S3NA 3DBHB 5CQEA 4BUPA 2UWMA 5GADJ 2FUG2 3KZZA 3QYFA 2YS9A 4M9ZA 1WHUA 1VQKI 3RIRA 5EG0A 5LHIA 4H0EA 2AS5F 2CJJA 4DNCA 3L2WA 5HS8A 2EWNA 1YRNB 2DQLA 3A4CA 4BEHA 2XGXA 3BR3A 3SQNA 1XMAA 4IHTA 1Z21A 2M87A 2G7HA 2L54A 3WHCA 5DUKA 1IV8A 1S3JA 4HNVA 4RB1A 1KQ0A 2ID3A 5EEGA 2E35A 4EM0B 3RZDJ 2QYOA 1FT9A 1XMKA 1MW7A 2K9NA 4G12A 4M74A 1X2MA 1S7EA 2FOKA 2VOPA 1U9OA 1P6RA 1U5TA 3FISA 5GAGJ 3RQ4A 4Y4RA 2Z3YA 5LRRA 2QQAA 4OIRF 3FMQA 1SD7A 4FX0A 3T8RA 2CMPA 2M8GX 2M4KA 4EM2A 1F5TA 3RKYA 3LAJA 3L1PA 1GVDA 4A6EA 2GXGA 3H3VK 2DMTA 1IGNA 2BY1A 3G2BA 2EH3A 3HOTA 2DOFA 4IKFA 4G7HF 5BQTA 3ABUA 3I9V2 4LD5A 3MD2A 2PFBA 3H36A 3QAHA 2RQPA 3QRFF 1RR8C 2O3FA 1XN7A 3CCRI 3DTEA 2EV0A 4RGSA 2PI0A 1TQMA 3Q9VA 2AO9A 5CVVA 2H1LA 3M7GA 1SMYF 1FC3A 4E70A 3PFYA 1KQ8A 3ZCOA 3R0JA 4XM3A 4DOZA 2Z5UA 4XICA 4UB8C 5TGTA 4IO9F 1GXQA 1QQIA 1WVRA 4XN0A 2HPMA 4Y52J 3BR5A 4A3JJ 1B4AA 3ELKA 2O8XA 2IGKA 1MH3A 1JTYA 2PEXA 3OMYA 4MGRA 2HFHA 3V8KA 2A6HF 4Y7NJ 4CHUA 3P7NA 4XK4A 1QGPA 1B72A 2V9VA 4EJWA 1XTAA 2UXXA 4P96A 1BJZA 2RV8A 3LMMA 4UUSB 3BOQA 1REPC 1QVTA 2ZC2A 1HKSA 4EMSA 1JHFA 4MNUA 5TJJA 2HOEA 4C3IJ 4NHJA 2M1BA 1UJ8A 2VB6A 3R60A 4B3AA 4DBQA 2HGCA 4HEA2 5B1BH 4D7MA 2W00A 4L9NA 3ZN1A 3U9GA 3K9TA 2F5EA 2XKPA 1V5FA 3PL8A 1ZN2A 2WV0A 1TZLA 2NRAC 4RM3A 3HOVJ 2VC0A 2OZUA 2ZJQF 3E6MA 3LSKA 5FD5A 3D5RC 4OU0A 4KFCA 5EZHA 1DP7P 2X85A 1RIOH 1Z3XA 2DYSH 4FISA 2IS6A 2ESNA 5LGNA 1FYLA 1ZQ3P 3BG9A 3GTOJ 4CA0A 3HOSA 1KU7A 2JRTA 4CH7A 4XKBA 3KPHA 4Q5SF 3AAFA 3OYFA 1MMNA 3M9AA 3G1MA 1MDMA 2CQNA 2DTRA 1DGWY 4L5EA 4UB6C 4D0PA 2EB7A 3OIPA 2ZKZA 4X0GA 3SFIA 5KHDA 1O3QA 3EQLF 4BH9A 4CZCA 1IN4A 2MW8A 1YW8A 4EJOA 2F4MB 4R79A 3IL2A 2R7TA 1VQMI 3CDLA 2R7OA 1ZREA 4I7HA 4M6YA 4HX7A 4HQMA 1HBXG 2DT6A 1LQ1A 4XOTA 3M8FA 5F1RA 2F48A 3I0TA 2UXNA 4ON0A 4NB5A 1BI3A 4UUTA 4A2UA 2JSCA 2VLAA 2IP2A 2LR8A 1OCOH 3CCJI 5J3LA 5J4YA 4JX6A 4OIPF 1H89C 5L3BA 2LD5A 2Y75A 3BZ6A 2A6TA 4ZZDA 2STWA 5FKNA 4AIHA 2VJJA 3WG7H 4S0HB 2DQRA 3MKLA 1TC3C 2RREA 2PX9A 3CESA 5ICEA 1MKMA 4A3IJ 3O3KA 4C2MJ 3S15J 4C2TA 2R3SA 1I1SA 4KA4A 3FKIJ 4LG0A 3ISPA 4E6KG 1ZGWA 2FBHA 4LLLA 5JVTA 1P4XA 1R5GA 3GZNB 3MEXA 2JA7J 2FXAA 3V7SA 3WU0A 3Q3SA 4B4CA 1WJBA 5GAEJ 5K7FA 5F64A 2R5YB 3TP3A 1FY7A 1RUNA 2E7WA 1JTXA 2XIGA 2KFDA 3GTJJ 1R49A 1MNEA 2RKHA 4XQFA 4XONA 2K4BA 4B47A 3MZHA 3ZMDA 4IL6C 3WGIA 1ERDA 2W7NA 4EV0A 1JXSA 2P5VA 1FMWA 1RI7A 3ZQIA 2IAIA 3J7AO 3OIQA 3BTCA 2DFFA 3OR2C 3HUGB 3K4KA 3ESWB 1QU3A 2H6BA 2X51A 1MBGA 3C2HA 3HTUA 3L2UA 2HS5A 2BY3A 4MHGA 2IGOA 1CGPA 4GDFA 2X6YA 4HA8A 3ZMVA 3S3MA 3ABLH 1JUMA 1ZG5A 2E60A 3BG3A 1FOWA 4V2FA 2FJ1A 1ETQA 4HSTA 2MD5A 2K9SA 4XRMA 4PJNA 1USTA 4G6TB 2R7RA 4LJZF 1XPXA 5CVJA 4BE2A 3KIOA 4RAFA 3OOUA 2KL4A 1FX7A 3FDYA 3ZGKA 3K1MA 3CP8A 2DOAA 2EA2A 4L0YB 3BQYA 3HOXJ 2IW5A 2KJBA 2VQHA 3S2WA 1TLHB 5F1JA 2KIUA 1DPRA 2DFHA 2CQQA 2YX7A 2O7OA 3GVAA 1PJRA 3I64A 1U9NA 4V19K 4XORA 5L3GA 3I59B 3EUAA 2VIXA 3GBGA 1WJAA 5K1YA 4WCGA 1W7PB 2JA8J 3OYDA 4CDGA 3WTTC 2HOSA 4N9HA 4JYKA 3DEEA 3FF5A 2CS3A 2D1VA 2CUJA 3O8GA 1SVOA 4XN3A 3TDUC 2LOOA 4OMZA 3GW2A 1X1DA 2W1OA 5K7ZA 2ISZA 2IXSA 1OKRA 2LKPA 3J7ZI 3ZR8X 3G71I 3CCSI 3OYHA 3ZQFA 3E6CC 2PMZA 3OYAA 2WADA 5EG0B 1NK2P 3S16J 2ZNZA 3H5AA 3HGGA 1K4SA 3HTSB 4PFOA 1B59A 2I10A 1X4OA 2WY7Q 1Z05A 4BEHB 2XAUA 2AXTC 1ZLKA 1EF4A 1D1CA 2QWWA 1Y1WJ 3K4BA 5L3FA 3BROA 2LF8A 2VASA 3FIWA 1V5GA 1I39A 1IRFA 1S29A 1UELB 2N8GA 5B3SH 4ESJA 4GYGA 2WC2A 4X6AJ 1WGXA 2OD5A 3RKWA 2PMUA 1X1AA 3TBIA 2QSGX 5FO5A 4XRSA 4YELA 1CQTA 1RNLA 2L0KA 3NQOA 4MEXF 4RLFA 5LGTA 4CO8A 1FOYA 1Z7LA 5EJCA 2XV4S 1NG6A 2EV5A 3T0YA 5KAFC 2CUZA 1VQ7I 5E1ZB 1O3SA 4G6DA 2L5QA 1N75A 2EZLA 3QQAA 4Q47A 1TQPA 2Y30A 3JTGA 1I6HJ 3SEQA 5F27A 4XRSG 1TL8A 2R92J 1X1PA 4PZJA 4E7KA 3QODA 2MSYA 5EGOA 4KN4X 1ZG3A 3BT9A 2O61A 2EZIA 2VXZA 4M3FA 2CYYA 4FX4A 1AHDP 1G4DA 4C3JJ 1QPMA 1WZ2A 2Y69H 3TW7A 3H92A 1MIJA 2GBYA 4Z6YA 2JPCA 3BTJA 3CP2A 3D0SA 3HEFA 4BAYA 3COAC 5KNLA 2V9PA 5F0CA 1ZLJA 4ANJA 5LFAA 1W5TA 3GXOA 2RNGA 4YIFA 4YFNF 5E3MA 2Y48A 2D5VA 3FBIB 1XD7A 1W36C 1ETOA 2EA4A 1VFCA 1QZYA 3F6OA 3GTPJ 1BIBA 2RN7A 2UZKA 3C1DA 3GLXA 2EFNA 4P55A 2VQGA 5D6FA 2EILH 4CCOA 2QM3A 3PIPF 4IXAA 3HC7A 4RB0A 4HNUA 1JKPC 2F6CA 1J7KA 3JRHA 3JRCA 2M45A 3UKGA 1QHHD 4PSWA 1YI2I 2GXAA 1QHGA 2K3FA 3FXRA 2BY0A 3REOA 1TWHJ 1ZAOA 3BR6A 1BA5A 2FQ3A 1JHHA 4BL0B 1FSHA 4WXCA 3U1DA 3ZQGA 1W0UA 3IRRA 2OBPA 2R7ZJ 3GCMA 1J59A 4QIWN 3PNVA 2LDUA 2DW4A 3TO7A 5EEHA 4XKWA 1UB9A 3W6VA 5JVGF 2EFPA 4J01A 1LVAA 1O7LA 2IVMA 4RS8A 2W25A 1IN8A 1ZGJA 2HQNA 3M8JA 3BCAA 3L00A 4K2EA 3SZTA 1P4AA 2ZXJA 2P8TA 2ME6A 2LTPA 3BG6A 2MC3A 3HRSA 4GFBA 3OS0A 3CF5F 1YJWI 1MJAA 3ZOBA 4A3CJ 2L7ZA 3L7WA 2L01A 2IA2A 3QYBA 4MLOA 4D5CA 5K5RA 2HDDA 4EVIA 1HW5A 5FKLA 2DMQA 4ABZA 3Q0WA 2ID6A 3O2PE 2FBIA 1NHAA 3R6SA 3MZ8A 1Z3YA 4KIGA 4XLPF 1ZHFA 3OYCA 3A2KA 1SFEA 4OAZA 4PDKA 5M3FJ 2YX4A 2QA4I 4ZZLA 3LSTA 4WXHA 1WJCA 1V3FA 1RUOA 3ERMA 3P5JA 3H9JA 4CCNA 3H5RA 5CPRB 2NVUB 3TMOA 1APLC 1FOXA 4Q48A 3WTXC 3CJNA 2VKDA 2QENA 1N78A 4N4OB 2M5WA 3IV5A 2R5ZB 1ZARA 5E18F 3CMEI 3VPRA 4XLHA 1YTYA 1UG0A 3PM1A 1BOBA 5LGUA 3IC7A 3DEWA 3M8EA 4LG0B 1R1VA 3JRGA 3DKYA 4IQ4A 4A0XA 3SZGA 3I71A 2EFWA 1VQOI 1AA7A 4LK0F 3IH4A 1F43A 4RGXA 4OAYA 2HEOA 2AQFA 2KIMA 1OISA 2HVQA 4D1QA 2XSJC 2W82A 3S1NJ 4HX4A 3BZCA 2VUMJ 5ICGA 2XAFA 1Z67A 3G6EI 3QPHA 1U3EM 5JLWA 5D4RA 4OMYA 4ZJZA 4F91B 4WWCA 1LUJB 1ZKGA 2RGVA 4XSZF 1IUFA 1B1BA 3N05A 1QNTA 1VQ4I 3LSGA 4BHBA 4DGWB 4D9JA 4BE0A 4ESFA 3K2ZA 5M5WJ 2DA1A 2OTLI 4L18B 3BR2A 1WSUA 5FJ8J 1D5YA 2EZHA 2OTJI 1OCZH 2V9KA 4LLNA 3TKYA 3M07A 1LPQA 2ICWG 3MAJA 1G8XA 2DO7A 2I8DA 2DA4A 2R7QA 2M34A 5M5XJ 5L3DA 1IN7A 4KNYA 2DA2A 3LNQA 2E1CA 4N4NB 2R4GA 4NUBA 4HF1A 1JGGA 5IY5H 2K3PA 4FQGA 3TO9A 1RKWA 3WTZA 5HS7A 4XMYA 3ABTA 4I76A 2W84A 1H9TA 3HIFA 1BI0A 1WKMA 3CC7I 1HW2A 5HLTA 4ETSA 4EGYA 3KP6A 2A3SA 3J81K 1WJ5A 2LK2A 2RQQA 3OYKA 2LP0A 3FXOA 3CC4I 1HA8A 3EUHC 3I4PA 1DQUA 4JX4A 4BQNA 4UUVA 1H8AC 4IF4A 1D0XA 3P9CA 4HQEA 1XCBA 1S72I 1E2XA 3I59A 4KMFA 2YR2A 2DA7A 2K9QA 3DLAA 4A0ZA 9ANTA 1ACIA 1MZBA 1SFXA 1V54H 1BR4A 3L2CA 5FLXZ 2QQBA 1R4NB 3LL7A 3O6BB 3ZMSA 1H0MA 2F2EA 3HRTA 2V1NA 2B7EA 5BPIA 3DCFA 3BG7A 5AIQA 1U8BA 1GXPA 1FLIA 1LFBA 5E79C 4B44A 4ZDPA 4B1RA 3ECOA 5J1RA 1Z6RA 2A5YB 1OLTA 3OL3A 2HQAA 4WK8F 1L3LA 1FJLA 1ON1A 3MN2A 1BC7C 3A0HC 2M8EA 5E1XA 1WI3A 4ZTJA 1TNTA 2MYSA 2NXNB 2PG4A 3HYIA 3I4MJ 2R7WA 2VJ5A 2KP6A 2VT3A 1YIJI 4IRIA 4CCKA 5EEAA 1MJ9A 2X9DA 3K10A 1T33A 4RAGA 3I3LA 4EATA 3HL2A 2EJRA 4A3BJ 5LHGA 1XB4A 4IOAF 1TW2A 4J00A 5HLHA 4J19A 1MSFC 1GLNA 2JPBA 4HAMA 3BR1A 3KE2A 1OYIA 3L9FA 4RBOA 4KN7X 3CMAI 4A12A 4HF0A 3IWZA 2OC6A 2M3AA 3H1CA 3TGNA 4RLQA 1LEAA 4L9JA 5EGOB 1Y1VJ 2O03A 4I0BA 3NWTA 3ECHA 5F6FA 3FXUA 4YIIA 1YHQI 4ENKA 1IRXA 2C6YA 2PMZN 2VOOA 1YE9A 2PN6A 3DPTA 4I02A 4CSWA 2V7FA 3W2WA 2YUSA 2DCEA 1FYKA 6PAXA 2NVTJ 2NAZA 1E17A 1NH3A 3OR1C 5FKMA 1Y0NA 2CQXA 2IT0A 3CD6I 4B43A 2KT0A 4Q4ZF 1M1EB 2IGMA 4QSHA 1YYVA 1BI1A 4FE7A 2EIMH 4FT8A 4DZJA 2KJCA 2IA0A 2P81A 2XASA 5B1AH 2D45A 1MGTA 2BHZA 3KP3A 3BTLA 4CCMA 1OQYA 2TCTA 2HQRA 1S5LC 3JRIA 3A0BC 4DBRA 5F04A 5FLVA 4ZYDA 4MTEA 3OS1A 1BN5A 4Y3OA 1SAXA 2XRLA 4ZYGA 1U78A 2FNPA 3V7CA 4UV8A 3LSIA 1ETKA 2MA3A 1G3YA 1KYWA 4ZH4F 1B8IB 1OR7C 2OA4A 2GOXB 1D5VA 2AQEA 4MEYF 3FXLA 3BJOA 2DK8A 3B73A 4HYEA 4EGZA 2L9VA 5IYCJ 2H27A 4A3KJ 4AVZA 2QUFA 5K7HA 2L02A 5FB2A 1IN6A 1ODDA 3JREA 3MKYB 1R00A 1F36A 3GMEA 2GZWA 3HXLA 2IA1A 1D8KA 5J4VA 4X1EA 2LREA 1I5ZA 2E7XA 3WTVC 1UHSA 5D5VB 1GDTA 2Q0OA 1YOVB 4IOCF 4KIBA 4G6QA 4UVBA 1O57A 3F6VA 5HVQC 3W2AA 5D5WB 3WTWC 5BPDA 3G1OA 1T8IA 5DD8A 2CWEA 2K9MA 4OWRB 4PJMA 4U87A 1FTTA 1FBSA 3PO2J 2Z9OA 3DKXA 3GWZA 4LFUA 3KLOA 3PQJA 3RPUA 3MVPA 2NYXA 2Q8KA 1LNWA 4XLCA 5C4JJ 2DA3A 3W6KB 2P6SA 4G9YA 4AYBA 2HU9A 2LSOA 2V6EA 3L09A 2NVYJ 2MLGA 1JUSA 3CO6C 2L9RA 1S7AA 3LQRA 1WPKA 2FE3A 3F8CA 4XOPA 3VYSB 4YFKF 2F5CA 1IUYA 5A2QK 2MC4A 2OQGA 4GO1A 3OY9A 5J8FA 4QPOA 3KEQA 1PVEA 3TOBA 4M6XA 4DQ2A 2RAEA 3H3UA 3K4MA 1IXSB 2DOEA 4MFDA 5GPCA 1HDPA 1WRJA 5CLSA 4A6DA 5F0HA 4U7BA 3DBLB 3ZMTA 1VNDA 3GFLA 2QQ9A 4U0VA 2DPUA 2WV1A 4FETA 2ZJ2A 4BS9A 1W5CC 2M0MA 3HSRA 3RDIA 2GLOA 4NNJA 5D5UB 1D3YA 2R5ZA 4F7ZA 2XF7A 5HNFA 1YITI 4A3DJ 5CKTA 1PP7U 4AC0A 2HZTA 5DTDA 2MH9A 2UUZA 3F8MA 4IVNA 1FIAA 2R7VA 2XGDA 1GHCA 3H0DA 2FD5A 3T8TA 3WODF 1AWCA 1HXDA 4BQAA 3FKJA 2BE5F 4HF2A 1BIAA 2WY8Q 3CMMA 1SAUA 3EUHA 3K6GA 4M71A 1T38A 3GTKJ 1PUFB 1WJFA 3FBNB 2GA2A 3F0CA 1K83J 2DT7B 3FK6A 5C44J 2E5NA 2EFQA 2VE8A 3G1LA 3C3WA 5IP7J 4B3XA 3OYNA 3S3OA 4UNOA 4DIQA 2FMLA 2JUGA 2OCEA 4AWXB 1IW7F 2GA1A 1MMGA 2O9LA 1WI9A 3F21A 3B02A 4Z2YA 5HODA 3C2GA 2MG4A 1Z1DA 3WGGA 2QGUA 4L5JA 1MBKA 1UHWA 4XNFA 5BS6A 2H8RA 2A5WA 3ML6A 2X1DA 1LDJA 2EIJH 3OSGA 1JJ6C 5GTIC 4IJAA 1GVJA 2CQ7A 3HOYJ 4UVAA 4UXNA 2DDBA 3PNYA 5FGMA 1VZ0A 2KKOA 4BJTA 3CZ6A 3JAMZ 3FWEA 1RRJA 2BBYA 2X4HA 2LFBA 1P9QC 2OZ6A 2L2OA 3VEPA 2ZJRF 4BU2A 1SFKA 1U8RA 1ZTRA 1KONA 3AG2H 2XGCA 3DXJF 4DZPA 3J80Z 3GZ5A 2ELHA 2V26A 2BY2A 3RCOA 4KYWA 2JA6J 4HPQA 2WB1A 5HDKA 1KZHA 2OQRA 5IT9Z 2O0YA 4P5OA 1XX5A 4L5IA 4ENNA 1FIPA 1OYWA 4ZC3A 1WFXA 3D1NI 4BDZA 2IS2A 3EYYA 3KETA 3I55I 1ETWA 1K6YA 1MNDA 3RSNA 2H94A 2F5DA 5ICCA 1W1WE 2HI3A 2V6CA 4R1HA 1QPIA 2VQLA 1R9TJ 2KIFA 3PFIA 5CVUA 2E1MB 4OIOF 2DMNA 4GGGA 5KCMA 3ZQQA 4IZZA 4CZZA 3I4NJ 3K1PA 1MMSA 1YW7A 4DW6A 3PIOF 5E8GA 4A3MJ 1J9IA 2YU3A 1S7OA 3TL4X 4YEJA 3DBRB 3BQZA 4BBRJ 2CU7A 1JT6A 1A31A 2Y0SA 1R1TA 2KZVA 4EJVA 3AFHA 1DU6A 4IHYA 1J09A 3F9KA 4M73A 4QPQA 4U7DA 3KP2A 5FRMA 4FE4A 2JVHA 3QU6A 2HOAA 2D1HA 2DK5A 2VQCA 3C2BA 5E3LA 3EETA 2HR3A 4ZYAA 1FP2A 3S1RJ 1A5JA 3LA2A 3S8PA 4W1UA 4WXDA 1OR7A 3F3XA 3KEYA 1NTCA 5EDNA 3LFKA 1IAWA 1D0YA 3M1CA 3U2RA 4HW0A 3V8JA 5TISC 3CLOA 2G9WA 1NK3P 4FCYA 4RGUA 3CCEI 3AG3H 1VF9A 1MMDA 2DMPA 3G4SI 3IKVA 3RQIA 4ZTFA 3HDDA 4KT5C 3BR0A 5L3CA 4D7NA 1ORKA 5B66C 3E3VA 2HXOA 1QZEA 2QBYB 3FHZA 1W7PD 2FA5A 4HV5A 1STZA 3BP8A 4CYDA 2XDVA 1OCPA 4E7HA 2Y2ZA 2DN0A 2E1MC 4BBSJ 5JFRA 1SFOJ 3WHBA 1BM9A 1JE8A 4U0YA 1EA3A 5IP9J 2GIZA 3DV8A 3TO6A 4MFEA 3RYRA 5DDGA 1I6XA 4MO7A 1IN5A 1O3TA 4RDUA 2JWTA 4UVCA 1FOKA 5HDGA 1G2HA 1LE8B 2XKOA 3H3ZA 3IWFA 4GRIA 5J6XA 2HOTA 3LQQA 3S14J 5JLXA 1W36D 2XAHA 1R58A 3OYLA 3OSFA 2XUBA 2NS8A 5J1YA 2ZNYA 1I50J 3HB9A 4PGGA 5CVRA 4BXXJ 3I5UA 1FEXA 1FBQA 1B8IA 1BC8C 1SVMA 4LIUA 3RTRA 1DGRM 2O6GE 4C3HJ 2H6CA 1Y8RB 2XPUA 3FMRA 1OCTC 3KP4A 1V55H 1W4MA 2K4JA 1SD4A 3EPZA 5JI6A 2WAQA 4CICA 2QCOA 1S6LA 3L2RA 4HNTA 5KVRA 1GV5A 2WAEA 3GEZA 1LEBA 3PNTA 1XDSA 1TBXA 3E1SA 2CGPA 1JGSA 1BL0A 5FD6A 2ZCWA 4B8XA 4LK1F 3N4MA 4M6VA 2RDPA 4CCJA 3IAM2 2LVSA 4HBLA 1QA6A 5M5YJ 1GUUA 1TT5B 2VC1A 4MIMA 4LB6B 4AIKA 4E7JA 5HLIA 3A02A 1HW1A 2HTSA 3ZQ7A 4UY8I 5CVIA 1ITYA 2V1UA 4A5MA 4HOBA 5ILVA 3OYGA 2LLKA 1XGSA 1A6QA 1V5EA 2H1KA 2OPTA 4ZDLA 3ASOH 3I54A 5FLMJ 3JRBA 2Z1DA 1E3OC 1QVUA 1IXCA 2M7AA 1Z0XA 1LJ9A 1UZCA 3H9QA 5HOOA 2E2HJ 2ACJA 3K1NA 1JUPA 5BOXA 3QU3A 3E0JB 1Y0UA 2Z99A 2R7XA 2FF4A 1JKQC 1P7IA 5JHFA 1ENHA 3SXYA 1T0FC 3F8FA 2V4JC 3KZYA 1XSVA 4L9TA 2AXLA 2UV1A 5D4SA 1R23A 1R7JA 5J47A 1UFMA 2FSWA 5KK1A 2FMYA 2IS4A 4M9SA 4D5FA 2HNHA 2DJIA 2B9SA 1O3RA 4O3MA 5B5EC 3VDXA 2EFOA 5LHHA 5ILSA 5IOYA 3M4OJ 2BXZA 4JX5A 3KYLA 3HSEA 3KFWX 2HYGD 2ZSIB 2CFOA 3A01B 2IGNA 1FYMA 3UR3C 2L4MA 1F1ZA 1Z9CA 2E2IJ 1YG2A 1A35A 3KZIC 2VPRA 4A3GJ 4BHCA 1WCMJ 1LDDA 4KITB 3K69A 3I56I 3V8LA 4AYBN 3ULQB 3QP5A 1TP4A 3GTMJ 1UMQA 2KDZA 3RI4A 1PUFA 1JKOC 3CUQB 1AOYA 4FASD 2K86A 2TRTA 2VJ4A 4PFPA 4RAYA 2BZTA 3WTUC 2Z2SB 1XGMA 3AL0C 3K70D 1WH5A 3OS2A 2OJED 3DPUA 1S8NA 3K4JA 4KUMA 2LRDA 3PJRA 4BXFA 1N77A 4ZDOA 3ABKH 4HDUA 1G3TA 3P9KA 2G0EA 5F08A 2QKLB 2L4AA 2V1XA 3CQZJ 2XPVA 3LAPA 2E2JJ 4DYRA 5TRDA 3NRVA 4ASNA 3CCVI 1OCCH 2XAJA 1ZRFA 5FKKA 4E7SA 1XSDA 3PO3J 5DEQA 5H20A 3GO5A 1E3HA 2CV2A 1B9NA 3RKQA 4Y15A 5LD2C 2EK5A 3CDIA 2ELKA 1I3AA 3LWFA 1R5ID 4NQWB 1O7FA 2EIKH 3MWMA 4GXOA 2M2EA 4M72A 2R7SA 1ZR2A 4XL9A 3HG9A 4G94A 4HLXA 3J7AY 2G7UA 2ELJA 1J0RA 2K02A 2Y0MA 5DUIA 1ZR4A 2KIQA 1DP3A 5H2FC 1SEUA 2ZXIA 1TW3A 4ENJA 3HZJA 5LBQA 1G6NA 2BVLA 3H0GJ 3CCMI 2COMA 2DI3A 1HSJA 3MQ0A 2DDAA 3MMYB 2P5KA 3ZP5A 2K7LA 5E3NA 3C7JA 1X1CA 4LOCA 1SD6A 2MGQA 4AUXA 4E4HA 4S05A 3CUQC 1WQ2A 2XROA 3QPTA 2LYCA 2EPFA 2EINH 3S93A 4P9FA 1X1BA 3K2AA 3EYIA 3CC2I 2XHKA 3I53A 4IRGA 4U88A 2DPDA 3NEUA 2MH2A 1Y39A 4JK1X 4L9VA 2IJLA 1POGA 2XVCA 3HHGA 3MCZA 3JTHA 2XSDC 2BV6A 1K4TA 2PJRB 1OCRH 2F5FA 2FRHA 2BXYA 5LEJA 2ZXWH 3H5NA 1X4PA 3U1KA 2E5ZA 3K7AJ 1RETA 4NBQA 3G3ZA 1FMVA 2K27A 3B6CA 3S2HJ 2TDXA 2MLKA 2E19A 2WB1N 2VONA 3N97A 3HHHA 1IJWC 3ZPLA 3HOZJ 1D8JA 2H8WA 1FPQA 5DS9A 2GM4A 1N25A 2FQ4A 2IEKA 3OV8A 4I99C 4NC8A 1GT0C 2JN6A 3BY6A 3S1QJ 1MMAA 5ILUA 2ESHA 1F4KA 2M7BA 1UG2A 3DFGA 1P2FA 3E5XA 2L7MP 3IAS2 1FZPB 1BJAA 2LKSA 2HZDA 2M4GA 5L3EA 2CO5A 1IXRC 1HLVA 1YS6A 4G8XA 3SDBA 3OYBA 1KQ9A 1KGSA 2BVMA 3BPXA 4DYCA 3PSIA 3A1YA 2QLZA 4QLCU 2ZMEC 2OCCH 4F93B 2X6OA 2Y0SN 4OOIA 2QBYA 1FSEA 1SVLA 4EJTA 1Q1VA 3JR9A 3G73A 3ZQCA 2XRNA 2ECCA 3JSOA 4PGHA 4JQFA 1JJ8C 2YPRA 4XKCA 2R7FA 4BQOA 1ULYA 1MBEA 1YLFA 3RJPA 2P7VB 2O8KA 4A5NA 2KISA 3HBLA 4PCQA 4I0AA 1TT0A 3LA3A 4M3DA 3SYTA 3VOEA 1Q1HA 4U0WA 3V4GA 2Q2EA 1XGNA 2FU4A 1LE8A 4XLAA 4M3GA 2PJPA 3E5UA 5GPAA 3CO7C 2Z16A 4BACA 3JRFA 4E7LA 1B6AA 3FMSA 2DFIA 4EEFG 1RR7A 3OOPA 4BQQA 4XR6A 3T1BA 2E34A 1CF7A 3DTIA 1IV6A 1IG7A 1K78A 2STTA 1U6GA 4WX9A 5CYVA 1BR2A 1WJEA 2ZB9A 4EJUA 1R1UA 5HS9A 2JK3A 1XMXA 4XBFA 2H09A 5IOZA 1X3UA 2GAUA 3DLLF 3CDHA 3QPSA 3C18A 5IP6A 3JSPA 1OJLA 1EKEA 1T0FA 2PQ8A 4N0BA 3CUOA 2WTEA 3DWLE 2XAGA 5AIPA 3HJEA 4BY7J 1QO0D 2OF7A 4I01A 2CUEA 4CYCA 2CV0A 3CTAA 1UCRA 2XPWA 3DU5A 3DEUA 3OYMA 2A6EF 4BHPA 1D1AA 4C2UA 3LSMA 2BGCA 5DCFA 5FFXA 2KRCA 3AG4H 4BJ5C 4NDLA 2XF6A 3VYUB 1KU9A 2Y9ZA 1G59A 2ZBKA 3FX3A 3S2DJ 3S32A 2X1CA 1R6RA 2VJIA 1VQ9I 1TWFJ 4PSXA 1X19A 1TWAJ 1HF0A 1Y8QB 3Q9SA 4IHSA 2IBDA 1IF1A 2LY2A 3F8BA 3VSLA 4AVPA 2EZKA 1WH7A 3VB2A 5D8KB 1YJNI 1RC9A 2A05A 1HSTA 4C9YA 4A3FJ 2LMDA 1PP8F 4R8HA 1RZ4A 1LVKA 1I27A 3ERED 3BLYA 2IS1A 2K40A 5FKOA 2NNYA 2CH0A 2VI6A 4I98B 1YS7A 2ZO4A 1O4XA 2NS0A 1TWCJ
chains in the Genus database with same CATH topology
1C0WA 3MZYA 2A69F 2QZ8A 5AONA 2PBIA 4GCVA 3Q5FA 3SZPA 1QBJA 3DP7A 2XAQA 2P7CB 4FHTA 4OIQF 5K5QA 2HYFA 1BOAA 1XGOA 1B9MA 1BI2A 4N9IA 3FM3A 5ERIA 1KA8A 2B0LA 3R4KA 2OAZA 2V1DA 3VFZA 4P9UA 4HDVA 1ZYRF 4UHTA 5LEKA 1UHMA 3BJ6A 5BMZA 2ADUA 3WTSC 1VTNC 2D2WA 2HKXA 3WE2A 2HKOA 3ZN0A 1FBUA 1LDKB 3P9IA 5ICFA 4HV6A 1SD5A 3IRQA 2LF7A 3CUQA 4QWQA 1QZZA 3KLNA 3WG9A 5FLXK 3GYHX 3LA7A 4KICA 4LLGF 1U2WA 3TOAA 2V79A 4ZYHA 3M1EA 2R7DA 3KP5A 3GFIA 3SFZA 1ZH5A 2YSRA 3HSFA 2EV6A 3K0LA 5CJ9A 4MTDA 2CSOA 2BEOA 1K79A 2CFXA 2IRFG 4ZYEA 1Z6TA 1V4RA 4HX8A 3W6JB 1R22A 1L0OC 1OPCA 4RGRA 3KP7A 3E97A 3GUDA 4NQWA 2PLYA 4KIFA 1XDUA 1YQAA 4LB5A 3I58A 3D5LA 4KDPA 3FZVA 2L3DA 3HRMA 2DAOA 4B09A 1LB2A 2ZMEA 5DCMA 2NNNA 4RB2C 1YO5C 3TQNA 5DV5A 4XRFA 1J2XA 1TQIA 2A61A 2Z33A 2WWYA 5FFZA 2DBBA 3WGHA 2GWRA 4KMUX 3GX4X 1I1GA 3F72A 5DD4A 5HLGA 4OINF 1EH6A 1XSXA 4M9XA 3BWGA 5D5XB 2DU9A 3DQVC 1KU2A 1ZGAA 5J8CA 3PQKA 2W24A 3WE3A 4YFXF 3KEOA 2E1NA 2P4WA 3IHUA 1MJBA 3ZMZA 2VN2A 2P5LC 3GF2A 4BNCA 4ESBA 1HKQA 3E6DA 5D6EA 2JT1A 5E17F 1P4WA 3FXQA 1HKTA 2PMHA 1U5TB 3E6BA 3J81Z 5H6RA 5H6QA 4ENMA 4O5VA 2GIVA 2BYVE 1IZ1A 4YG2F 2VE9A 1TTYA 3RPQA 4GYIA 3DF8A 4I09A 3GFMA 1ZG1A 1ZRDA 1F9NA 5LLQA 3ROUA 1EV7A 1CF7B 5LRSA 4S04A 2JZYA 1K78B 1USSA 1G3WA 4JBAA 2W57A 2CW0F 3DPLC 2M30A 2HDCA 5DYMA 1A04A 2CG4A 3DKWA 2VBWA 2ISYA 2JTVA 3GFJA 1R36A 2W85A 3IKTA 2CQKA 2ETHA 1J75A 1U5TC 1KU3A 4O6JA 4HLYA 4AIJA 1DDNA 4Y17A 3TDZC 1J5YA 4HZFA 4IRHA 4IPAA 2GQQA 5D8LB 1DUXC 4LGWA 2KRFA 4EQQA 2MBFA 5JHUA 2DT5A 1SFUA 4G7ZF 2ZFWA 1MDMB 3MFKA 1XCVA 1W5SA 5E1WA 1ZRCA 2A07F 3SHFA 4TV7A 1PUEE 1SMTA 3F23A 4XSXF 4A0YA 4CXFA 3JAMK 1MD0A 5HDNA 1BBYA 1G3SA 4BXUA 4I2OA 4WF2A 3J80K 3QOPA 1OMIA 2RNJA 3BJAA 1T98A 3RKXA 3VODA 2VBZA 5IT9K 4RAZA 1FWZA 1TNSA 3V7RA 4EM1A 1FNNA 4CGZA 2VBYA 2IPQX 1H9GA 1K7AA 3ZMUA 1FP1D 4BYYA 5E8IA 1HQCA 3WTYC 2VODA 1ON2A 4AD9A 3WU1B 2J5PA 3BPVA 4MQ9F 5ED4A 2P6TA 4MQVA 2FNAA 1OYYA 1T39A 2A68F 3E5QA 3JW4A 1EH8A 3BDDA 1Z91A 4G7OF 1R5HA 1DPUA 2VBXA 4Y13A 3EDPA 2OU2A 3HUGA 5A2QZ 3QP6A 5K5OA 3T5XA 3GZ6A 5E20A 2RVCA 1T6SA 1Z7UA 2RC4A 3R0AA 2VT2A 1YIOA 3RYPA 2ZMEB 5IT3A 5DCMB 2J5OA 4L0ZB 1KYZA 3HRUA 3F22A 4LMYA 4UV9A 2X0LA 3F8NA 2FBKA 1PDNC 2FEZA 4XLNF 2LNBA 2HWVA 2DLLA 1YW9A 3KCCA 3FM5A 1W7PA 1K6OA 2GXBA 1WWXA 3R61A 1T2KA 2HTJA 4RB3C 1YFHA 1EH7A 2QVOA 5JR3A 1P92A 1ONVA 2UWMA 3KZZA 4M9ZA 3RIRA 5LHIA 4H0EA 2AS5F 4DNCA 5HS8A 2EWNA 2DQLA 2XGXA 3SQNA 1XMAA 4IHTA 2M87A 2G7HA 2L54A 5DUKA 1S3JA 4RB1A 1KQ0A 5EEGA 4EM0B 2QYOA 1FT9A 1XMKA 4M74A 2FOKA 2VOPA 1P6RA 1U5TA 2Z3YA 5LRRA 2QQAA 4OIRF 3FMQA 1SD7A 4FX0A 3T8RA 4EM2A 1F5TA 3RKYA 3LAJA 4A6EA 2GXGA 3HOTA 4G7HF 5BQTA 3ABUA 4LD5A 2PFBA 3QAHA 2RQPA 3QRFF 2O3FA 1XN7A 2EV0A 4RGSA 2PI0A 1TQMA 3Q9VA 5CVVA 3M7GA 1SMYF 1FC3A 4E70A 1KQ8A 3R0JA 2Z5UA 1GXQA 1QQIA 1B4AA 3ELKA 2O8XA 2PEXA 4MGRA 2HFHA 3V8KA 2A6HF 4CHUA 3P7NA 1QGPA 2V9VA 4EJWA 4P96A 2UXXA 1REPC 2RV8A 1IRGA 3BOQA 4EMSA 1HKSA 1JHFA 4MNUA 5TJJA 2HOEA 4NHJA 2M1BA 3R60A 2HGCA 4L9NA 3ZN1A 3U9GA 3K9TA 2F5EA 2XKPA 1ZN2A 2WV0A 2NRAC 2VC0A 2OZUA 3E6MA 5FD5A 4OU0A 4KFCA 1DP7P 1RIOH 2ESNA 5LGNA 1FYLA 3HOSA 1KU7A 2JRTA 4Q5SF 3AAFA 3M9AA 1MDMA 2DTRA 4D0PA 2EB7A 2ZKZA 1O3QA 3EQLF 4BH9A 1IN4A 1YW8A 4EJOA 4R79A 3IL2A 1ZREA 4I7HA 4M6YA 4HX7A 4HQMA 1HBXG 1LQ1A 3M8FA 5F1RA 3I0TA 2UXNA 4ON0A 4NB5A 1BI3A 4A2UA 2JSCA 2IP2A 4OIPF 5L3BA 2Y75A 3BZ6A 4ZZDA 2STWA 4AIHA 2DQRA 5ICEA 1MKMA 3O3KA 1I1SA 2R3SA 4KA4A 4LG0A 3ISPA 2FBHA 4LLLA 5JVTA 1P4XA 1R5GA 3MEXA 2FXAA 3V7SA 3WU0A 5F64A 1FY7A 1RUNA 2E7WA 2XIGA 2RKHA 2K4BA 3MZHA 3ZMDA 3WGIA 4EV0A 1JXSA 2P5VA 1RI7A 3J7AO 2H6BA 3HTUA 2HS5A 4MHGA 1CGPA 4HA8A 3ZMVA 1ZG5A 2MD5A 1USTA 4LJZF 5CVJA 1FX7A 3K1MA 2EA2A 4L0YB 2IW5A 2KJBA 3S2WA 1TLHB 2KIUA 1DPRA 2YX7A 3GVAA 3I64A 5CVRA 5L3GA 3I59B 5K1YA 4WCGA 1W7PB 4CDGA 3WTTC 4N9HA 3FF5A 2D1VA 3TDUC 4OMZA 3GW2A 2ISZA 1OKRA 2LKPA 3E6CC 2ZNZA 3HTSB 1B59A 1Z05A 1ZLKA 2QWWA 5L3FA 3BROA 2LF8A 1IRFA 1S29A 4ESJA 4GYGA 2WC2A 2OD5A 3RKWA 2PMUA 5FO5A 1RNLA 3NQOA 4MEXF 5LGTA 4CO8A 2XV4S 2EV5A 3T0YA 5E1ZB 1O3SA 4G6DA 4Q47A 1TQPA 3JTGA 4PZJA 4KN4X 1ZG3A 2O61A 2VXZA 2CYYA 4FX4A 1G4DA 1QPMA 3H92A 2JPCA 3D0SA 4BAYA 3COAC 1ZLJA 1W5TA 3GXOA 4YIFA 4YFNF 2Y48A 1XD7A 2EA4A 1QZYA 3F6OA 1BIBA 2RN7A 2UZKA 3C1DA 3GLXA 2EFNA 4P55A 5D6FA 2QM3A 4IXAA 4RB0A 1J7KA 2M45A 3FXRA 3REOA 1ZAOA 2FQ3A 1JHHA 1FSHA 4WXCA 3U1DA 3IRRA 2OBPA 1J59A 2LDUA 2DW4A 3TO7A 5EEHA 1UB9A 2EFPA 1LVAA 1O7LA 2IVMA 4RS8A 2W25A 1IN8A 1ZGJA 2HQNA 3L00A 4K2EA 3SZTA 1P4AA 2ZXJA 2P8TA 2MC3A 3HRSA 1MJAA 3L7WA 2L01A 2IA2A 5K5RA 4EVIA 1HW5A 3O2PE 2FBIA 1NHAA 3R6SA 4KIGA 4XLPF 1ZHFA 1SFEA 4PDKA 2YX4A 4ZZLA 3LSTA 4WXHA 1V3FA 1RUOA 4Q48A 3WTXC 3CJNA 2QENA 2M5WA 1ZARA 5E18F 1YTYA 5LGUA 3IC7A 3M8EA 4LG0B 1R1VA 4A0XA 3I71A 2EFWA 4LK0F 4RGXA 2HEOA 2KIMA 4HX4A 5ICGA 2XAFA 3QPHA 1U3EM 5D4RA 4OMYA 4WWCA 2RGVA 4XSZF 1B1BA 1QNTA 4BHBA 4ESFA 3K2ZA 4L18B 1WSUA 4LLNA 3TKYA 3MAJA 2DO7A 5L3DA 1IN7A 4KNYA 2E1CA 4HF1A 3TO9A 3WTZA 5HS7A 3ABTA 2W84A 1H9TA 3HIFA 1BI0A 1WKMA 1HW2A 4ETSA 4EGYA 3KP6A 2A3SA 3J81K 3I4PA 4UUVA 4IF4A 3P9CA 4HQEA 1XCBA 1E2XA 3I59A 4KMFA 2YR2A 4A0ZA 1MZBA 1SFXA 3L2CA 5FLXZ 2QQBA 3O6BB 3ZMSA 1H0MA 2F2EA 3HRTA 5BPIA 5AIQA 1FLIA 1GXPA 3ECOA 1Z6RA 2A5YB 4WK8F 1L3LA 1ON1A 1BC7C 2M8EA 5E1XA 1TNTA 2PG4A 3HYIA 2VT3A 4IRIA 1MJ9A 2EJRA 5LHGA 1XB4A 1TW2A 5HLHA 2JPBA 4HAMA 3KE2A 1OYIA 3L9FA 4A12A 4KN7X 4HF0A 3IWZA 3TGNA 1LEAA 4L9JA 2O03A 4I0BA 3ECHA 5F6FA 3FXUA 4YIIA 4ENKA 2C6YA 2VOOA 2PN6A 3DPTA 4I02A 1FYKA 6PAXA 2NAZA 1E17A 4Q4ZF 1YYVA 1BI1A 4FT8A 2KJCA 2IA0A 2XASA 2D45A 1MGTA 3KP3A 2HQRA 4ZYDA 4MTEA 1BN5A 1SAXA 4ZYGA 1U78A 2FNPA 3V7CA 4UV8A 2MA3A 1G3YA 1KYWA 4ZH4F 2OA4A 1D5VA 4MEYF 3BJOA 2DK8A 3B73A 4HYEA 4EGZA 2H27A 2QUFA 2L02A 5FB2A 1IN6A 1ODDA 1R00A 2GZWA 2IA1A 1D8KA 1I5ZA 2E7XA 3WTVC 5D5VB 2Q0OA 4KIBA 4G6QA 4UVBA 1O57A 3F6VA 5HVQC 5D5WB 3WTWC 5BPDA 5DD8A 2CWEA 1FBSA 2Z9OA 3GWZA 4LFUA 3KLOA 3PQJA 3RPUA 2NYXA 2Q8KA 1LNWA 3W6KB 2P6SA 4G9YA 2LSOA 3L09A 2MLGA 3CO6C 1S7AA 3LQRA 2FE3A 3F8CA 4YFKF 2F5CA 1IUYA 5A2QK 4GO1A 2OQGA 5J8FA 3KEQA 3TOBA 4M6XA 4DQ2A 3H3UA 1IXSB 1WRJA 5CLSA 4A6DA 4U7BA 3ZMTA 3GFLA 2QQ9A 4U0VA 2DPUA 2ZJ2A 3HSRA 3RDIA 5D5UB 1D3YA 4F7ZA 1PP7U 2HZTA 2MH9A 3F8MA 4IVNA 1GHCA 3T8TA 3WODF 1AWCA 1HXDA 4BQAA 2BE5F 4HF2A 1BIAA 3EUHA 4M71A 1T38A 2GA2A 2EFQA 2VE8A 3C3WA 4UNOA 2FMLA 4AWXB 1IW7F 2GA1A 1WI9A 3F21A 3B02A 4Z2YA 1Z1DA 3WGGA 4L5JA 5BS6A 1UHWA 3ML6A 1LDJA 4IJAA 1GVJA 4UVAA 4UXNA 5FGMA 2KKOA 3JAMZ 3FWEA 2BBYA 2X4HA 2OZ6A 3VEPA 1U8RA 3DXJF 3J80Z 3GZ5A 2ELHA 4KYWA 5HDKA 5IT9Z 2OQRA 2O0YA 4P5OA 4L5IA 4ENNA 1OYWA 3EYYA 3KETA 2H94A 2F5DA 5ICCA 2V6CA 4R1HA 2KIFA 3PFIA 5CVUA 4OIOF 4GGGA 4CZZA 1J9IA 3K1PA 1YW7A 2YU3A 1S7OA 1R1TA 4EJVA 4M73A 4U7DA 3KP2A 3QU6A 2D1HA 2DK5A 3EETA 2HR3A 1FP2A 3LA2A 4WXDA 1OR7A 3F3XA 3LFKA 1IAWA 3U2RA 4HW0A 3V8JA 3CLOA 2G9WA 4RGUA 3IKVA 4KT5C 5L3CA 3E3VA 2QBYB 3FHZA 2NS0A 1W7PD 2FA5A 4HV5A 1STZA 3BP8A 4CYDA 5JFRA 1BM9A 1JE8A 4U0YA 3DV8A 3TO6A 3RYRA 5DDGA 1I6XA 1IN5A 1O3TA 4UVCA 1FOKA 5HDGA 2XKOA 3H3ZA 3IWFA 5J6XA 3LQQA 2XAHA 1R58A 2XUBA 2ZNYA 4PGGA 3I5UA 1FBQA 1BC8C 3RTRA 2O6GE 2H6CA 3FMRA 3KP4A 1W4MA 2K4JA 1SD4A 5JI6A 4CICA 1S6LA 5KVRA 3GEZA 1LEBA 1XDSA 1TBXA 2CGPA 1JGSA 5FD6A 2ZCWA 4B8XA 4LK1F 3N4MA 2RDPA 4HBLA 2VC1A 4LB6B 4AIKA 5HLIA 1HW1A 2HTSA 3ZQ7A 5CVIA 2V1UA 4A5MA 4HOBA 5ILVA 1XGSA 3I54A 1IXCA 1LJ9A 5HOOA 2ACJA 3K1NA 5BOXA 3QU3A 1Y0UA 2Z99A 2FF4A 3SXYA 3F8FA 3KZYA 1XSVA 4L9TA 2AXLA 5D4SA 1R23A 1R7JA 1UFMA 2FSWA 5KK1A 2FMYA 4M9SA 1O3RA 4O3MA 5LHHA 2EFOA 5ILSA 3HSEA 3KFWX 2HYGD 1FYMA 2L4MA 1F1ZA 1Z9CA 1YG2A 4BHCA 1LDDA 3K69A 3V8LA 3ULQB 3QP5A 3RI4A 1AOYA 3CUQB 2K86A 4RAYA 3WTUC 1XGMA 4KUMA 1S8NA 4HDUA 1G3TA 3P9KA 2L4AA 2V1XA 3LAPA 5TRDA 3NRVA 4ASNA 2XAJA 1ZRFA 1XSDA 5DEQA 5H20A 3GO5A 1B9NA 4Y15A 2EK5A 3LWFA 1O7FA 3MWMA 4GXOA 4M72A 4G94A 4HLXA 2G7UA 2K02A 1J0RA 2Y0MA 5DUIA 1TW3A 4ENJA 5LBQA 1G6NA 2COMA 2DI3A 1HSJA 3MQ0A 3ZP5A 2P5KA 2K7LA 3C7JA 1SD6A 4S05A 3CUQC 1WQ2A 2XROA 3QPTA 4P9FA 3EYIA 2XHKA 3I53A 4IRGA 4U88A 2DPDA 3NEUA 2MH2A 4JK1X 4L9VA 2IJLA 2XVCA 3HHGA 3MCZA 3JTHA 2BV6A 2F5FA 2FRHA 5LEJA 3G3ZA 2K27A 2TDXA 2MLKA 2VONA 3N97A 3HHHA 3ZPLA 1D8JA 1FPQA 3OV8A 3BY6A 5ILUA 2ESHA 1F4KA 3DFGA 1P2FA 3E5XA 1FZPB 1BJAA 5L3EA 2CO5A 1IXRC 1YS6A 4G8XA 1KQ9A 1KGSA 3BPXA 2QLZA 4QLCU 2ZMEC 4OOIA 2QBYA 1FSEA 4EJTA 3G73A 2XRNA 3JSOA 4PGHA 4JQFA 2YPRA 2R7FA 1ULYA 1YLFA 3RJPA 2P7VB 4A5NA 4PCQA 4I0AA 3LA3A 3VOEA 1Q1HA 4U0WA 3V4GA 2Q2EA 1XGNA 2FU4A 2PJPA 3E5UA 3CO7C 1B6AA 3FMSA 2DFIA 3OOPA 3T1BA 1CF7A 1K78A 2STTA 1U6GA 4WX9A 5CYVA 4EJUA 1R1UA 5HS9A 4XBFA 2H09A 1X3UA 2GAUA 3CDHA 3C18A 3JSPA 1T0FA 2PQ8A 4N0BA 3CUOA 2WTEA 2XAGA 5AIPA 1QO0D 4I01A 3CTAA 1UCRA 3DEUA 2A6EF 4BHPA 2BGCA 5DCFA 5FFXA 1KU9A 2ZBKA 3FX3A 3Q9SA 4IHSA 1IF1A 3F8BA 4AVPA 5D8KB 3VB2A 1HSTA 1PP8F 4R8HA 1RZ4A 1I27A 3ERED 2NNYA 4I98B 1YS7A 2ZO4A 5E8GA 2IT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0W A;  3MZY A;  2A69 F;  2QZ8 A;  5AON A;  2PBI A;  4GCV A;  3Q5F A;  3SZP A;  1QBJ A;  3DP7 A;  2XAQ A;  2P7C B;  4FHT A;  4OIQ F;  5K5Q A;  2HYF A;  1BOA A;  1XGO A;  1B9M A;  1BI2 A;  4N9I A;  3FM3 A;  5ERI A;  1KA8 A;  2B0L A;  3R4K A;  2OAZ A;  2V1D A;  3VFZ A;  4P9U A;  4HDV A;  1ZYR F;  4UHT A;  5LEK A;  1UHM A;  3BJ6 A;  5BMZ A;  2ADU A;  3WTS C;  1VTN C;  2D2W A;  2HKX A;  3WE2 A;  2HKO A;  3ZN0 A;  1FBU A;  1LDK B;  3P9I A;  5ICF A;  4HV6 A;  1SD5 A;  3IRQ A;  2LF7 A;  3CUQ A;  4QWQ A;  1QZZ A;  3KLN A;  3WG9 A;  5FLX K;  3GYH X;  3LA7 A;  4KIC A;  4LLG F;  1U2W A;  3TOA A;  2V79 A;  4ZYH A;  3M1E A;  2R7D A;  3KP5 A;  3GFI A;  3SFZ A;  1ZH5 A;  2YSR A;  3HSF A;  2EV6 A;  3K0L A;  5CJ9 A;  4MTD A;  2CSO A;  2BEO A;  1K79 A;  2CFX A;  2IRF G;  4ZYE A;  1Z6T A;  1V4R A;  4HX8 A;  3W6J B;  1R22 A;  1L0O C;  1OPC A;  4RGR A;  3KP7 A;  3E97 A;  3GUD A;  4NQW A;  2PLY A;  4KIF A;  1XDU A;  1YQA A;  4LB5 A;  3I58 A;  3D5L A;  4KDP A;  3FZV A;  2L3D A;  3HRM A;  2DAO A;  4B09 A;  1LB2 A;  2ZME A;  5DCM A;  2NNN A;  4RB2 C;  1YO5 C;  3TQN A;  5DV5 A;  4XRF A;  1J2X A;  1TQI A;  2A61 A;  2Z33 A;  2WWY A;  5FFZ A;  2DBB A;  3WGH A;  2GWR A;  4KMU X;  3GX4 X;  1I1G A;  3F72 A;  5DD4 A;  5HLG A;  4OIN F;  1EH6 A;  1XSX A;  4M9X A;  3BWG A;  5D5X B;  2DU9 A;  3DQV C;  1KU2 A;  1ZGA A;  5J8C A;  3PQK A;  2W24 A;  3WE3 A;  4YFX F;  3KEO A;  2E1N A;  2P4W A;  3IHU A;  1MJB A;  3ZMZ A;  2VN2 A;  2P5L C;  3GF2 A;  4BNC A;  4ESB A;  1HKQ A;  3E6D A;  5D6E A;  2JT1 A;  5E17 F;  1P4W A;  3FXQ A;  1HKT A;  2PMH A;  1U5T B;  3E6B A;  3J81 Z;  5H6R A;  5H6Q A;  4ENM A;  4O5V A;  2GIV A;  2BYV E;  1IZ1 A;  4YG2 F;  2VE9 A;  1TTY A;  3RPQ A;  4GYI A;  3DF8 A;  4I09 A;  3GFM A;  1ZG1 A;  1ZRD A;  1F9N A;  5LLQ A;  3ROU A;  1EV7 A;  1CF7 B;  5LRS A;  4S04 A;  2JZY A;  1K78 B;  1USS A;  1G3W A;  4JBA A;  2W57 A;  2CW0 F;  3DPL C;  2M30 A;  2HDC A;  5DYM A;  1A04 A;  2CG4 A;  3DKW A;  2VBW A;  2ISY A;  2JTV A;  3GFJ A;  1R36 A;  2W85 A;  3IKT A;  2CQK A;  2ETH A;  1J75 A;  1U5T C;  1KU3 A;  4O6J A;  4HLY A;  4AIJ A;  1DDN A;  4Y17 A;  3TDZ C;  1J5Y A;  4HZF A;  4IRH A;  4IPA A;  2GQQ A;  5D8L B;  1DUX C;  4LGW A;  2KRF A;  4EQQ A;  2MBF A;  5JHU A;  2DT5 A;  1SFU A;  4G7Z F;  2ZFW A;  1MDM B;  3MFK A;  1XCV A;  1W5S A;  5E1W A;  1ZRC A;  2A07 F;  3SHF A;  4TV7 A;  1PUE E;  1SMT A;  3F23 A;  4XSX F;  4A0Y A;  4CXF A;  3JAM K;  1MD0 A;  5HDN A;  1BBY A;  1G3S A;  4BXU A;  4I2O A;  4WF2 A;  3J80 K;  3QOP A;  1OMI A;  2RNJ A;  3BJA A;  1T98 A;  3RKX A;  3VOD A;  2VBZ A;  5IT9 K;  4RAZ A;  1FWZ A;  1TNS A;  3V7R A;  4EM1 A;  1FNN A;  4CGZ A;  2VBY A;  2IPQ X;  1H9G A;  1K7A A;  3ZMU A;  1FP1 D;  4BYY A;  5E8I A;  1HQC A;  3WTY C;  2VOD A;  1ON2 A;  4AD9 A;  3WU1 B;  2J5P A;  3BPV A;  4MQ9 F;  5ED4 A;  2P6T A;  4MQV A;  2FNA A;  1OYY A;  1T39 A;  2A68 F;  3E5Q A;  3JW4 A;  1EH8 A;  3BDD A;  1Z91 A;  4G7O F;  1R5H A;  1DPU A;  2VBX A;  4Y13 A;  3EDP A;  2OU2 A;  3HUG A;  5A2Q Z;  3QP6 A;  5K5O A;  3T5X A;  3GZ6 A;  5E20 A;  2RVC A;  1T6S A;  1Z7U A;  2RC4 A;  3R0A A;  2VT2 A;  1YIO A;  3RYP A;  2ZME B;  5IT3 A;  5DCM B;  2J5O A;  4L0Z B;  1KYZ A;  3HRU A;  3F22 A;  4LMY A;  4UV9 A;  2X0L A;  3F8N A;  2FBK A;  1PDN C;  2FEZ A;  4XLN F;  2LNB A;  2HWV A;  2DLL A;  1YW9 A;  3KCC A;  3FM5 A;  1W7P A;  1K6O A;  2GXB A;  1WWX A;  3R61 A;  1T2K A;  2HTJ A;  4RB3 C;  1YFH A;  1EH7 A;  2QVO A;  5JR3 A;  1P92 A;  1ONV A;  2UWM A;  3KZZ A;  4M9Z A;  3RIR A;  5LHI A;  4H0E A;  2AS5 F;  4DNC A;  5HS8 A;  2EWN A;  2DQL A;  2XGX A;  3SQN A;  1XMA A;  4IHT A;  2M87 A;  2G7H A;  2L54 A;  5DUK A;  1S3J A;  4RB1 A;  1KQ0 A;  5EEG A;  4EM0 B;  2QYO A;  1FT9 A;  1XMK A;  4M74 A;  2FOK A;  2VOP A;  1P6R A;  1U5T A;  2Z3Y A;  5LRR A;  2QQA A;  4OIR F;  3FMQ A;  1SD7 A;  4FX0 A;  3T8R A;  4EM2 A;  1F5T A;  3RKY A;  3LAJ A;  4A6E A;  2GXG A;  3HOT A;  4G7H F;  5BQT A;  3ABU A;  4LD5 A;  2PFB A;  3QAH A;  2RQP A;  3QRF F;  2O3F A;  1XN7 A;  2EV0 A;  4RGS A;  2PI0 A;  1TQM A;  3Q9V A;  5CVV A;  3M7G A;  1SMY F;  1FC3 A;  4E70 A;  1KQ8 A;  3R0J A;  2Z5U A;  1GXQ A;  1QQI A;  1B4A A;  3ELK A;  2O8X A;  2PEX A;  4MGR A;  2HFH A;  3V8K A;  2A6H F;  4CHU A;  3P7N A;  1QGP A;  2V9V A;  4EJW A;  4P96 A;  2UXX A;  1REP C;  2RV8 A;  1IRG A;  3BOQ A;  4EMS A;  1HKS A;  1JHF A;  4MNU A;  5TJJ A;  2HOE A;  4NHJ A;  2M1B A;  3R60 A;  2HGC A;  4L9N A;  3ZN1 A;  3U9G A;  3K9T A;  2F5E A;  2XKP A;  1ZN2 A;  2WV0 A;  2NRA C;  2VC0 A;  2OZU A;  3E6M A;  5FD5 A;  4OU0 A;  4KFC A;  1DP7 P;  1RIO H;  2ESN A;  5LGN A;  1FYL A;  3HOS A;  1KU7 A;  2JRT A;  4Q5S F;  3AAF A;  3M9A A;  1MDM A;  2DTR A;  4D0P A;  2EB7 A;  2ZKZ A;  1O3Q A;  3EQL F;  4BH9 A;  1IN4 A;  1YW8 A;  4EJO A;  4R79 A;  3IL2 A;  1ZRE A;  4I7H A;  4M6Y A;  4HX7 A;  4HQM A;  1HBX G;  1LQ1 A;  3M8F A;  5F1R A;  3I0T A;  2UXN A;  4ON0 A;  4NB5 A;  1BI3 A;  4A2U A;  2JSC A;  2IP2 A;  4OIP F;  5L3B A;  2Y75 A;  3BZ6 A;  4ZZD A;  2STW A;  4AIH A;  2DQR A;  5ICE A;  1MKM A;  3O3K A;  1I1S A;  2R3S A;  4KA4 A;  4LG0 A;  3ISP A;  2FBH A;  4LLL A;  5JVT A;  1P4X A;  1R5G A;  3MEX A;  2FXA A;  3V7S A;  3WU0 A;  5F64 A;  1FY7 A;  1RUN A;  2E7W A;  2XIG A;  2RKH A;  2K4B A;  3MZH A;  3ZMD A;  3WGI A;  4EV0 A;  1JXS A;  2P5V A;  1RI7 A;  3J7A O;  2H6B A;  3HTU A;  2HS5 A;  4MHG A;  1CGP A;  4HA8 A;  3ZMV A;  1ZG5 A;  2MD5 A;  1UST A;  4LJZ F;  5CVJ A;  1FX7 A;  3K1M A;  2EA2 A;  4L0Y B;  2IW5 A;  2KJB A;  3S2W A;  1TLH B;  2KIU A;  1DPR A;  2YX7 A;  3GVA A;  3I64 A;  5CVR A;  5L3G A;  3I59 B;  5K1Y A;  4WCG A;  1W7P B;  4CDG A;  3WTT C;  4N9H A;  3FF5 A;  2D1V A;  3TDU C;  4OMZ A;  3GW2 A;  2ISZ A;  1OKR A;  2LKP A;  3E6C C;  2ZNZ A;  3HTS B;  1B59 A;  1Z05 A;  1ZLK A;  2QWW A;  5L3F A;  3BRO A;  2LF8 A;  1IRF A;  1S29 A;  4ESJ A;  4GYG A;  2WC2 A;  2OD5 A;  3RKW A;  2PMU A;  5FO5 A;  1RNL A;  3NQO A;  4MEX F;  5LGT A;  4CO8 A;  2XV4 S;  2EV5 A;  3T0Y A;  5E1Z B;  1O3S A;  4G6D A;  4Q47 A;  1TQP A;  3JTG A;  4PZJ A;  4KN4 X;  1ZG3 A;  2O61 A;  2VXZ A;  2CYY A;  4FX4 A;  1G4D A;  1QPM A;  3H92 A;  2JPC A;  3D0S A;  4BAY A;  3COA C;  1ZLJ A;  1W5T A;  3GXO A;  4YIF A;  4YFN F;  2Y48 A;  1XD7 A;  2EA4 A;  1QZY A;  3F6O A;  1BIB A;  2RN7 A;  2UZK A;  3C1D A;  3GLX A;  2EFN A;  4P55 A;  5D6F A;  2QM3 A;  4IXA A;  4RB0 A;  1J7K A;  2M45 A;  3FXR A;  3REO A;  1ZAO A;  2FQ3 A;  1JHH A;  1FSH A;  4WXC A;  3U1D A;  3IRR A;  2OBP A;  1J59 A;  2LDU A;  2DW4 A;  3TO7 A;  5EEH A;  1UB9 A;  2EFP A;  1LVA A;  1O7L A;  2IVM A;  4RS8 A;  2W25 A;  1IN8 A;  1ZGJ A;  2HQN A;  3L00 A;  4K2E A;  3SZT A;  1P4A A;  2ZXJ A;  2P8T A;  2MC3 A;  3HRS A;  1MJA A;  3L7W A;  2L01 A;  2IA2 A;  5K5R A;  4EVI A;  1HW5 A;  3O2P E;  2FBI A;  1NHA A;  3R6S A;  4KIG A;  4XLP F;  1ZHF A;  1SFE A;  4PDK A;  2YX4 A;  4ZZL A;  3LST A;  4WXH A;  1V3F A;  1RUO A;  4Q48 A;  3WTX C;  3CJN A;  2QEN A;  2M5W A;  1ZAR A;  5E18 F;  1YTY A;  5LGU A;  3IC7 A;  3M8E A;  4LG0 B;  1R1V A;  4A0X A;  3I71 A;  2EFW A;  4LK0 F;  4RGX A;  2HEO A;  2KIM A;  4HX4 A;  5ICG A;  2XAF A;  3QPH A;  1U3E M;  5D4R A;  4OMY A;  4WWC A;  2RGV A;  4XSZ F;  1B1B A;  1QNT A;  4BHB A;  4ESF A;  3K2Z A;  4L18 B;  1WSU A;  4LLN A;  3TKY A;  3MAJ A;  2DO7 A;  5L3D A;  1IN7 A;  4KNY A;  2E1C A;  4HF1 A;  3TO9 A;  3WTZ A;  5HS7 A;  3ABT A;  2W84 A;  1H9T A;  3HIF A;  1BI0 A;  1WKM A;  1HW2 A;  4ETS A;  4EGY A;  3KP6 A;  2A3S A;  3J81 K;  3I4P A;  4UUV A;  4IF4 A;  3P9C A;  4HQE A;  1XCB A;  1E2X A;  3I59 A;  4KMF A;  2YR2 A;  4A0Z A;  1MZB A;  1SFX A;  3L2C A;  5FLX Z;  2QQB A;  3O6B B;  3ZMS A;  1H0M A;  2F2E A;  3HRT A;  5BPI A;  5AIQ A;  1FLI A;  1GXP A;  3ECO A;  1Z6R A;  2A5Y B;  4WK8 F;  1L3L A;  1ON1 A;  1BC7 C;  2M8E A;  5E1X A;  1TNT A;  2PG4 A;  3HYI A;  2VT3 A;  4IRI A;  1MJ9 A;  2EJR A;  5LHG A;  1XB4 A;  1TW2 A;  5HLH A;  2JPB A;  4HAM A;  3KE2 A;  1OYI A;  3L9F A;  4A12 A;  4KN7 X;  4HF0 A;  3IWZ A;  3TGN A;  1LEA A;  4L9J A;  2O03 A;  4I0B A;  3ECH A;  5F6F A;  3FXU A;  4YII A;  4ENK A;  2C6Y A;  2VOO A;  2PN6 A;  3DPT A;  4I02 A;  1FYK A;  6PAX A;  2NAZ A;  1E17 A;  4Q4Z F;  1YYV A;  1BI1 A;  4FT8 A;  2KJC A;  2IA0 A;  2XAS A;  2D45 A;  1MGT A;  3KP3 A;  2HQR A;  4ZYD A;  4MTE A;  1BN5 A;  1SAX A;  4ZYG A;  1U78 A;  2FNP A;  3V7C A;  4UV8 A;  2MA3 A;  1G3Y A;  1KYW A;  4ZH4 F;  2OA4 A;  1D5V A;  4MEY F;  3BJO A;  2DK8 A;  3B73 A;  4HYE A;  4EGZ A;  2H27 A;  2QUF A;  2L02 A;  5FB2 A;  1IN6 A;  1ODD A;  1R00 A;  2GZW A;  2IA1 A;  1D8K A;  1I5Z A;  2E7X A;  3WTV C;  5D5V B;  2Q0O A;  4KIB A;  4G6Q A;  4UVB A;  1O57 A;  3F6V A;  5HVQ C;  5D5W B;  3WTW C;  5BPD A;  5DD8 A;  2CWE A;  1FBS A;  2Z9O A;  3GWZ A;  4LFU A;  3KLO A;  3PQJ A;  3RPU A;  2NYX A;  2Q8K A;  1LNW A;  3W6K B;  2P6S A;  4G9Y A;  2LSO A;  3L09 A;  2MLG A;  3CO6 C;  1S7A A;  3LQR A;  2FE3 A;  3F8C A;  4YFK F;  2F5C A;  1IUY A;  5A2Q K;  4GO1 A;  2OQG A;  5J8F A;  3KEQ A;  3TOB A;  4M6X A;  4DQ2 A;  3H3U A;  1IXS B;  1WRJ A;  5CLS A;  4A6D A;  4U7B A;  3ZMT A;  3GFL A;  2QQ9 A;  4U0V A;  2DPU A;  2ZJ2 A;  3HSR A;  3RDI A;  5D5U B;  1D3Y A;  4F7Z A;  1PP7 U;  2HZT A;  2MH9 A;  3F8M A;  4IVN A;  1GHC A;  3T8T A;  3WOD F;  1AWC A;  1HXD A;  4BQA A;  2BE5 F;  4HF2 A;  1BIA A;  3EUH A;  4M71 A;  1T38 A;  2GA2 A;  2EFQ A;  2VE8 A;  3C3W A;  4UNO A;  2FML A;  4AWX B;  1IW7 F;  2GA1 A;  1WI9 A;  3F21 A;  3B02 A;  4Z2Y A;  1Z1D A;  3WGG A;  4L5J A;  5BS6 A;  1UHW A;  3ML6 A;  1LDJ A;  4IJA A;  1GVJ A;  4UVA A;  4UXN A;  5FGM A;  2KKO A;  3JAM Z;  3FWE A;  2BBY A;  2X4H A;  2OZ6 A;  3VEP A;  1U8R A;  3DXJ F;  3J80 Z;  3GZ5 A;  2ELH A;  4KYW A;  5HDK A;  5IT9 Z;  2OQR A;  2O0Y A;  4P5O A;  4L5I A;  4ENN A;  1OYW A;  3EYY A;  3KET A;  2H94 A;  2F5D A;  5ICC A;  2V6C A;  4R1H A;  2KIF A;  3PFI A;  5CVU A;  4OIO F;  4GGG A;  4CZZ A;  1J9I A;  3K1P A;  1YW7 A;  2YU3 A;  1S7O A;  1R1T A;  4EJV A;  4M73 A;  4U7D A;  3KP2 A;  3QU6 A;  2D1H A;  2DK5 A;  3EET A;  2HR3 A;  1FP2 A;  3LA2 A;  4WXD A;  1OR7 A;  3F3X A;  3LFK A;  1IAW A;  3U2R A;  4HW0 A;  3V8J A;  3CLO A;  2G9W A;  4RGU A;  3IKV A;  4KT5 C;  5L3C A;  3E3V A;  2QBY B;  3FHZ A;  2NS0 A;  1W7P D;  2FA5 A;  4HV5 A;  1STZ A;  3BP8 A;  4CYD A;  5JFR A;  1BM9 A;  1JE8 A;  4U0Y A;  3DV8 A;  3TO6 A;  3RYR A;  5DDG A;  1I6X A;  1IN5 A;  1O3T A;  4UVC A;  1FOK A;  5HDG A;  2XKO A;  3H3Z A;  3IWF A;  5J6X A;  3LQQ A;  2XAH A;  1R58 A;  2XUB A;  2ZNY A;  4PGG A;  3I5U A;  1FBQ A;  1BC8 C;  3RTR A;  2O6G E;  2H6C A;  3FMR A;  3KP4 A;  1W4M A;  2K4J A;  1SD4 A;  5JI6 A;  4CIC A;  1S6L A;  5KVR A;  3GEZ A;  1LEB A;  1XDS A;  1TBX A;  2CGP A;  1JGS A;  5FD6 A;  2ZCW A;  4B8X A;  4LK1 F;  3N4M A;  2RDP A;  4HBL A;  2VC1 A;  4LB6 B;  4AIK A;  5HLI A;  1HW1 A;  2HTS A;  3ZQ7 A;  5CVI A;  2V1U A;  4A5M A;  4HOB A;  5ILV A;  1XGS A;  3I54 A;  1IXC A;  1LJ9 A;  5HOO A;  2ACJ A;  3K1N A;  5BOX A;  3QU3 A;  1Y0U A;  2Z99 A;  2FF4 A;  3SXY A;  3F8F A;  3KZY A;  1XSV A;  4L9T A;  2AXL A;  5D4S A;  1R23 A;  1R7J A;  1UFM A;  2FSW A;  5KK1 A;  2FMY A;  4M9S A;  1O3R A;  4O3M A;  5LHH A;  2EFO A;  5ILS A;  3HSE A;  3KFW X;  2HYG D;  1FYM A;  2L4M A;  1F1Z A;  1Z9C A;  1YG2 A;  4BHC A;  1LDD A;  3K69 A;  3V8L A;  3ULQ B;  3QP5 A;  3RI4 A;  1AOY A;  3CUQ B;  2K86 A;  4RAY A;  3WTU C;  1XGM A;  4KUM A;  1S8N A;  4HDU A;  1G3T A;  3P9K A;  2L4A A;  2V1X A;  3LAP A;  5TRD A;  3NRV A;  4ASN A;  2XAJ A;  1ZRF A;  1XSD A;  5DEQ A;  5H20 A;  3GO5 A;  1B9N A;  4Y15 A;  2EK5 A;  3LWF A;  1O7F A;  3MWM A;  4GXO A;  4M72 A;  4G94 A;  4HLX A;  2G7U A;  2K02 A;  1J0R A;  2Y0M A;  5DUI A;  1TW3 A;  4ENJ A;  5LBQ A;  1G6N A;  2COM A;  2DI3 A;  1HSJ A;  3MQ0 A;  3ZP5 A;  2P5K A;  2K7L A;  3C7J A;  1SD6 A;  4S05 A;  3CUQ C;  1WQ2 A;  2XRO A;  3QPT A;  4P9F A;  3EYI A;  2XHK A;  3I53 A;  4IRG A;  4U88 A;  2DPD A;  3NEU A;  2MH2 A;  4JK1 X;  4L9V A;  2IJL A;  2XVC A;  3HHG A;  3MCZ A;  3JTH A;  2BV6 A;  2F5F A;  2FRH A;  5LEJ A;  3G3Z A;  2K27 A;  2TDX A;  2MLK A;  2VON A;  3N97 A;  3HHH A;  3ZPL A;  1D8J A;  1FPQ A;  3OV8 A;  3BY6 A;  5ILU A;  2ESH A;  1F4K A;  3DFG A;  1P2F A;  3E5X A;  1FZP B;  1BJA A;  5L3E A;  2CO5 A;  1IXR C;  1YS6 A;  4G8X A;  1KQ9 A;  1KGS A;  3BPX A;  2QLZ A;  4QLC U;  2ZME C;  4OOI A;  2QBY A;  1FSE A;  4EJT A;  3G73 A;  2XRN A;  3JSO A;  4PGH A;  4JQF A;  2YPR A;  2R7F A;  1ULY A;  1YLF A;  3RJP A;  2P7V B;  4A5N A;  4PCQ A;  4I0A A;  3LA3 A;  3VOE A;  1Q1H A;  4U0W A;  3V4G A;  2Q2E A;  1XGN A;  2FU4 A;  2PJP A;  3E5U A;  3CO7 C;  1B6A A;  3FMS A;  2DFI A;  3OOP A;  3T1B A;  1CF7 A;  1K78 A;  2STT A;  1U6G A;  4WX9 A;  5CYV A;  4EJU A;  1R1U A;  5HS9 A;  4XBF A;  2H09 A;  1X3U A;  2GAU A;  3CDH A;  3C18 A;  3JSP A;  1T0F A;  2PQ8 A;  4N0B A;  3CUO A;  2WTE A;  2XAG A;  5AIP A;  1QO0 D;  4I01 A;  3CTA A;  1UCR A;  3DEU A;  2A6E F;  4BHP A;  2BGC A;  5DCF A;  5FFX A;  1KU9 A;  2ZBK A;  3FX3 A;  3Q9S A;  4IHS A;  1IF1 A;  3F8B A;  4AVP A;  5D8K B;  3VB2 A;  1HST A;  1PP8 F;  4R8H A;  1RZ4 A;  1I27 A;  3ERE D;  2NNY A;  4I98 B;  1YS7 A;  2ZO4 A;  5E8G A;  2IT0 A; 
#chains in the Genus database with same CATH topology
 1C0W A;  3MZY A;  2HVS A;  2WAQ N;  2A69 F;  2QZ8 A;  2XB0 X;  5AON A;  2MD0 A;  2LG4 A;  2PBI A;  4GCV A;  4KJZ A;  2ZFU A;  3SZP A;  4BKX A;  3Q5F A;  2ZSH B;  2ME0 A;  1QBJ A;  1IO2 A;  4M3E A;  3DP7 A;  2XAQ A;  3SEZ A;  2P7C B;  4XKV A;  2JJ7 A;  3NWS A;  4FHT A;  2Y9Y A;  2VKV A;  2X48 A;  4OIQ F;  5K5Q A;  1IRZ A;  3Q0U A;  1GV2 A;  2HYF A;  2NOG A;  1BOA A;  1XGO A;  1B9M A;  2NOJ B;  1MNM C;  1BI2 A;  4N9I A;  3FM3 A;  1QRY A;  5ERI A;  4C30 A;  1KA8 A;  1A36 A;  2B0L A;  2JSP A;  3R4K A;  2OAZ A;  2V1D A;  3VFZ A;  2ZXH A;  3H9G A;  1EJ9 A;  1RKT A;  2OV7 A;  3ASN H;  4P9U A;  3IUO A;  3OL4 A;  4HDV A;  2E71 A;  1ZYR F;  1WJD A;  3VYT B;  1MBF A;  4UHT A;  2DXI A;  3A01 A;  4DYQ A;  5LEK A;  1AU7 A;  1AKH A;  1UHM A;  3BJ6 A;  2M0C A;  4PJ0 C;  5C3E J;  4IQJ A;  5BMZ A;  2ADU A;  5M3M J;  2LH9 A;  1ZEL A;  3WTS C;  2D2W A;  2HKX A;  1VTN C;  3WE2 A;  2HKO A;  2OUM A;  3ZN0 A;  1FBU A;  1LDK B;  4II3 A;  3LSR A;  2JQ7 A;  2Y31 A;  3P9I A;  5ICF A;  4HV6 A;  3GTQ J;  1SD5 A;  2O5R A;  3QWL A;  3IRQ A;  2LC2 A;  2LF7 A;  3CUQ A;  4QWQ A;  1Z77 A;  1QZZ A;  2MAB A;  2R93 J;  3KLN A;  3WG9 A;  2NVX J;  2QSH X;  5FLX K;  3GYH X;  3LA7 A;  4KIC A;  4LLG F;  1U2W A;  3H35 A;  4LIV A;  3TOA A;  5E3O A;  5FRN A;  2V79 A;  4ZYH A;  3M1E A;  3SJM A;  2R7D A;  3KP5 A;  3GFI A;  2X6W A;  3SFZ A;  1ZH5 A;  2W48 A;  3LSH A;  3ZXS A;  2YSR A;  1XC5 A;  2DMU A;  3HSF A;  2EV6 A;  1H88 C;  4A3E J;  1TWG J;  3K0L A;  2EBI A;  5CJ9 A;  2F4O B;  4MTD A;  3SDG A;  2CSO A;  3QYE A;  2BEO A;  4IHX A;  1K79 A;  2CFX A;  2IRF G;  4KT6 A;  4ZYE A;  4P1W A;  1Z6T A;  1V4R A;  3AG1 H;  4HX8 A;  2L7F P;  4CUG A;  1X2N A;  2DA6 A;  3W6J B;  1R22 A;  3FK7 A;  1L0O C;  1OPC A;  4RGR A;  3KP7 A;  3E97 A;  2CW8 A;  4DJA A;  2COB A;  4RM2 A;  3HKZ A;  3GUD A;  4NQW A;  2PLY A;  2FX0 A;  4KIF A;  1XDU A;  1YQA A;  2KMU A;  4LB5 A;  3CCL I;  3CCU I;  2XB5 A;  2KLO A;  1IDY A;  4LIT A;  3I58 A;  3IP4 B;  3D5L A;  1HCR A;  2W4S A;  3ONQ A;  4KDP A;  3FZV A;  2L3D A;  1PYV A;  3HRM A;  2DAO A;  4B09 A;  1LB2 A;  2LBF A;  2ZME A;  5DCM A;  1VQ6 I;  2NNN A;  3AKZ A;  2VXD A;  5FRO A;  4RB2 C;  5BNG A;  1YO5 C;  3TQN A;  5DV5 A;  4XRF A;  1XS9 A;  2K5C A;  1J2X A;  1TQI A;  2A61 A;  2ZJP F;  1IRG A;  3PUF A;  2Z33 A;  4XLF A;  2WWY A;  2YU9 J;  2LKX A;  5FFZ A;  2DBB A;  3WGH A;  2DFE A;  5IYD J;  1X3W B;  2GWR A;  4KMU X;  3GX4 X;  3WU2 C;  3J7Y J;  2R0Q C;  3BCB A;  1I1G A;  3CLQ A;  3F72 A;  2X6X A;  2JMW A;  2HPI A;  5DD4 A;  2PJR A;  5HLG A;  2BW3 A;  2GOM A;  4OIN F;  1EH6 A;  2KDO A;  1XSX A;  3TW6 A;  4M9X A;  2E36 A;  3HGY A;  3LSJ A;  3BWG A;  5D5X B;  2CV1 A;  2DU9 A;  2DOD A;  3DQV C;  1YJ9 I;  1KU2 A;  4YRV A;  4XLE A;  1ZGA A;  2BOL A;  2VPL A;  5J8C A;  1IDZ A;  3PQK A;  4ITV A;  2K9L A;  1DU0 A;  2W24 A;  3WE3 A;  1XG1 A;  2JA2 A;  3KEO A;  2E1N A;  5GP9 A;  2P4W A;  4YFX F;  1LFU P;  3VSK A;  3HOW J;  3IHU A;  1D0Z A;  1ETX A;  1MJB A;  3ZMZ A;  3KYD B;  2QF7 A;  3FXM A;  3GTG J;  2VN2 A;  2P5L C;  3GF2 A;  2B63 J;  3JCU C;  4BNC A;  4ESB A;  2XF5 A;  1HKQ A;  2L9N A;  1YRN A;  1RPW A;  3E6D A;  5D6E A;  4AM3 A;  1VQ8 I;  2VKE A;  2JT1 A;  3QPL A;  4AU7 A;  4A93 J;  5E17 F;  3PSF A;  1P4W A;  4PUS A;  3FXQ A;  1HKT A;  1T56 A;  2DYR H;  1I3Q J;  1X58 A;  2CRG A;  1Y56 A;  4BJ6 C;  2PMH A;  1U5T B;  3E6B A;  1LKX A;  3J81 Z;  2WAF A;  4V2G A;  3O8H A;  5H6R A;  3DU6 A;  3ZQL A;  3QOE A;  3IH3 A;  3EUK L;  5H6Q A;  4ENM A;  4O5V A;  2AHQ A;  5IPA A;  3W2V A;  2XC7 A;  2GIV A;  2BYV E;  1LFP A;  1YX5 A;  4H4K C;  1IZ1 A;  2Q2E B;  4YG2 F;  2VE9 A;  1IC8 A;  5C4X J;  1TTY A;  3RPQ A;  4IHW A;  1X3Z B;  4GYI A;  3LFU A;  3DF8 A;  5EZG A;  4I6Z A;  3BC8 A;  4I09 A;  3GFM A;  3OYJ A;  1SC7 A;  2NVQ J;  4F92 B;  1ZG1 A;  1ZRD A;  1F9N A;  3BTI A;  3ROU A;  1EV7 A;  5LLQ A;  1CF7 B;  4A69 C;  5LRS A;  4S04 A;  2JZY A;  1K78 B;  5GAH J;  5EF6 A;  2KHM A;  1USS A;  1G3W A;  4JBA A;  4LG3 A;  4BE1 A;  2W57 A;  3B6A A;  2M9H A;  3CJQ B;  2HQ5 A;  2KPM A;  2CW0 F;  4CYC B;  4CCL A;  3DPL C;  2M30 A;  2HDC A;  3D5S C;  4YIR X;  5DYM A;  1A04 A;  2QEX I;  1MBH A;  2CG4 A;  1MSE C;  3FHN A;  3DKW A;  2VBW A;  2ISY A;  1B72 B;  2JTV A;  4HG2 A;  1ZK8 A;  3FXJ A;  3GFJ A;  1R36 A;  2W85 A;  2WA0 A;  3IKT A;  4E7Z A;  3CF2 A;  3MKW B;  2CQK A;  2P0W A;  2ETH A;  1J75 A;  1U5T C;  1KU3 A;  4FTH A;  2X1E A;  4O6J A;  4UUS A;  5EYR A;  4HLY A;  3OWT A;  1MH4 A;  4AIJ A;  1DDN A;  4Y17 A;  1RES A;  3TDZ C;  1J5Y A;  2L7K A;  4HZF A;  4B48 A;  1JT0 A;  4IRH A;  3TP0 A;  3UNG C;  3ZQH A;  4IPA A;  2HXI A;  2GQQ A;  2QSF X;  1U0J A;  5D8L B;  3L2V A;  1DUX C;  4LGW A;  4AID A;  3M3Y J;  1MBJ A;  3RZO J;  2KRF A;  1A6I A;  2KQR A;  4EQQ A;  2EQR A;  2LY9 A;  2MBF A;  4Y33 A;  5J1U A;  3AL0 B;  1ETY A;  3PUB A;  3GTL J;  1T08 B;  4BGD A;  2DT5 A;  4F3Q A;  5JHU A;  1SFU A;  4G7Z F;  3CMY A;  4M3B A;  2ZFW A;  1VQ5 I;  1MDM B;  3MFK A;  2WBM A;  3IH2 A;  4HSR A;  1XCV A;  5CQG A;  4KIS A;  1W5S A;  5E1W A;  1ZRC A;  2KRH A;  3HPG A;  5DM7 F;  5HNH A;  2A07 F;  3SHF A;  4TV7 A;  1PUE E;  2I5U A;  1SMT A;  3F23 A;  4XSX F;  4A0Y A;  3CJR B;  4CXF A;  2JUC A;  3JAM K;  3NAU A;  1K61 A;  1OFC X;  1MD0 A;  5HDN A;  1E3P A;  3HOU J;  3X2Q H;  4IEJ A;  1BBY A;  4A3L J;  2NS7 A;  4PJJ A;  1G3S A;  2F5V A;  4BXU A;  4I2O A;  1AKH B;  3KYC B;  4WF2 A;  3CCQ I;  3J80 K;  2K85 A;  4RA2 A;  3QOP A;  1OMI A;  2RNJ A;  4BY1 J;  3BJA A;  3OIO A;  1T98 A;  2JRM A;  3RKX A;  3VOD A;  2VBZ A;  5IT9 K;  2BHY A;  2HDW A;  4RAZ A;  2VL8 A;  1FWZ A;  1TNS A;  2DTZ A;  3V7R A;  4EM1 A;  2XGE A;  1SAN A;  4W97 A;  3RPU D;  1FNN A;  2LY1 A;  4CGZ A;  2VBY A;  5J40 A;  2IPQ X;  3W3C A;  1H9G A;  1VQN I;  1K7A A;  3ZMU A;  2DJN A;  1JI8 A;  1FP1 D;  4BYY A;  2F4I A;  1HQC A;  5E8I A;  3WTY C;  4XID A;  3VWB A;  4JP0 A;  2VOD A;  1ON2 A;  4AD9 A;  3WU1 B;  2J5P A;  1NG7 A;  3BPV A;  4IHV A;  2JVG A;  3BG5 A;  1JKR C;  4MQ9 F;  5ED4 A;  2JA5 J;  2P6T A;  3S1M J;  3ZRG A;  4MQV A;  3CCY A;  4PK4 A;  2FNA A;  4RMN A;  1VQP I;  2R5Y A;  3HPH A;  1OYY A;  2ECB A;  1T39 A;  2QKM B;  5IYB J;  1BR1 A;  1D1B A;  2A68 F;  3K4N A;  3K4C A;  4NC6 A;  1UAA A;  3E5Q A;  4F52 A;  3JW4 A;  1EH8 A;  1Y6I A;  4PJL A;  3VYR B;  3TED A;  3BDD A;  1Z91 A;  3K70 C;  2E1O A;  1HC8 A;  4G7O F;  1R5H A;  3LOC A;  1ETV A;  3DTK A;  1DPU A;  3L2Q A;  2VBX A;  2DA5 A;  4Y13 A;  3EDP A;  2OU2 A;  3S17 J;  2Q1Z B;  4F55 A;  2L9S A;  3HUG A;  3NAR A;  1VI0 A;  5A2Q Z;  3V42 A;  3LSP A;  3QP6 A;  5K5O A;  3T5X A;  3GZ6 A;  5E20 A;  2CW7 A;  2RVC A;  1T6S A;  3KX2 A;  1W0T A;  5DM6 F;  1BW6 A;  1Z7U A;  2RC4 A;  3R0A A;  2VT2 A;  3CJT B;  5GTH C;  2KZG A;  3U21 A;  1YIO A;  3Q0V A;  3RYP A;  2CUF A;  5F0F A;  2LBF B;  2ZME B;  5IT3 A;  1E0E A;  5DCM B;  1HDD C;  1R4M B;  4QTR A;  2J5O A;  2MFZ A;  4L0Z B;  1S9H A;  1VQL I;  3A03 A;  3MKZ A;  1KYZ A;  4II2 A;  1R71 A;  3JRD A;  2R7U A;  3HRU A;  4LMY A;  4UV9 A;  3F22 A;  4HRI A;  2X0L A;  3BZK A;  3F8N A;  2FBK A;  1PDN C;  2FEZ A;  3HM5 A;  5KAI C;  4XLN F;  1T95 A;  4E7I A;  2LNB A;  4IX7 A;  2VKH A;  2HWV A;  2DLL A;  3E7L A;  1FTZ A;  1YW9 A;  3KCC A;  2FOW A;  2HYJ A;  3FXK A;  3FM5 A;  2BW3 B;  1BW5 A;  3OYE A;  3K4L A;  1YX3 A;  3GLL A;  1W7P A;  3OYI A;  1K6O A;  1WWX A;  3R61 A;  4JOM A;  1T2K A;  2GXB A;  3HKZ N;  4NC7 A;  4BDY A;  2HTJ A;  3JRA A;  4RB3 C;  1HOM A;  1P7J A;  1YFH A;  1EH7 A;  2QVO A;  2QQ8 A;  3ABM H;  5JR3 A;  1P92 A;  1ONV A;  2HVR A;  3S3N A;  3DBH B;  5CQE A;  4BUP A;  2UWM A;  5GAD J;  2FUG 2;  3KZZ A;  3QYF A;  2YS9 A;  4M9Z A;  1WHU A;  1VQK I;  3RIR A;  5EG0 A;  5LHI A;  4H0E A;  2AS5 F;  2CJJ A;  4DNC A;  3L2W A;  5HS8 A;  2EWN A;  1YRN B;  2DQL A;  3A4C A;  4BEH A;  2XGX A;  3BR3 A;  3SQN A;  1XMA A;  4IHT A;  1Z21 A;  2M87 A;  2G7H A;  2L54 A;  3WHC A;  5DUK A;  1IV8 A;  1S3J A;  4HNV A;  4RB1 A;  1KQ0 A;  2ID3 A;  5EEG A;  2E35 A;  4EM0 B;  3RZD J;  2QYO A;  1FT9 A;  1XMK A;  1MW7 A;  2K9N A;  4G12 A;  4M74 A;  1X2M A;  1S7E A;  2FOK A;  2VOP A;  1U9O A;  1P6R A;  1U5T A;  3FIS A;  5GAG J;  3RQ4 A;  4Y4R A;  2Z3Y A;  5LRR A;  2QQA A;  4OIR F;  3FMQ A;  1SD7 A;  4FX0 A;  3T8R A;  2CMP A;  2M8G X;  2M4K A;  4EM2 A;  1F5T A;  3RKY A;  3LAJ A;  3L1P A;  1GVD A;  4A6E A;  2GXG A;  3H3V K;  2DMT A;  1IGN A;  2BY1 A;  3G2B A;  2EH3 A;  3HOT A;  2DOF A;  4IKF A;  4G7H F;  5BQT A;  3ABU A;  3I9V 2;  4LD5 A;  3MD2 A;  2PFB A;  3H36 A;  3QAH A;  2RQP A;  3QRF F;  1RR8 C;  2O3F A;  1XN7 A;  3CCR I;  3DTE A;  2EV0 A;  4RGS A;  2PI0 A;  1TQM A;  3Q9V A;  2AO9 A;  5CVV A;  2H1L A;  3M7G A;  1SMY F;  1FC3 A;  4E70 A;  3PFY A;  1KQ8 A;  3ZCO A;  3R0J A;  4XM3 A;  4DOZ A;  2Z5U A;  4XIC A;  4UB8 C;  5TGT A;  4IO9 F;  1GXQ A;  1QQI A;  1WVR A;  4XN0 A;  2HPM A;  4Y52 J;  3BR5 A;  4A3J J;  1B4A A;  3ELK A;  2O8X A;  2IGK A;  1MH3 A;  1JTY A;  2PEX A;  3OMY A;  4MGR A;  2HFH A;  3V8K A;  2A6H F;  4Y7N J;  4CHU A;  3P7N A;  4XK4 A;  1QGP A;  1B72 A;  2V9V A;  4EJW A;  1XTA A;  2UXX A;  4P96 A;  1BJZ A;  2RV8 A;  3LMM A;  4UUS B;  3BOQ A;  1REP C;  1QVT A;  2ZC2 A;  1HKS A;  4EMS A;  1JHF A;  4MNU A;  5TJJ A;  2HOE A;  4C3I J;  4NHJ A;  2M1B A;  1UJ8 A;  2VB6 A;  3R60 A;  4B3A A;  4DBQ A;  2HGC A;  4HEA 2;  5B1B H;  4D7M A;  2W00 A;  4L9N A;  3ZN1 A;  3U9G A;  3K9T A;  2F5E A;  2XKP A;  1V5F A;  3PL8 A;  1ZN2 A;  2WV0 A;  1TZL A;  2NRA C;  4RM3 A;  3HOV J;  2VC0 A;  2OZU A;  2ZJQ F;  3E6M A;  3LSK A;  5FD5 A;  3D5R C;  4OU0 A;  4KFC A;  5EZH A;  1DP7 P;  2X85 A;  1RIO H;  1Z3X A;  2DYS H;  4FIS A;  2IS6 A;  2ESN A;  5LGN A;  1FYL A;  1ZQ3 P;  3BG9 A;  3GTO J;  4CA0 A;  3HOS A;  1KU7 A;  2JRT A;  4CH7 A;  4XKB A;  3KPH A;  4Q5S F;  3AAF A;  3OYF A;  1MMN A;  3M9A A;  3G1M A;  1MDM A;  2CQN A;  2DTR A;  1DGW Y;  4L5E A;  4UB6 C;  4D0P A;  2EB7 A;  3OIP A;  2ZKZ A;  4X0G A;  3SFI A;  5KHD A;  1O3Q A;  3EQL F;  4BH9 A;  4CZC A;  1IN4 A;  2MW8 A;  1YW8 A;  4EJO A;  2F4M B;  4R79 A;  3IL2 A;  2R7T A;  1VQM I;  3CDL A;  2R7O A;  1ZRE A;  4I7H A;  4M6Y A;  4HX7 A;  4HQM A;  1HBX G;  2DT6 A;  1LQ1 A;  4XOT A;  3M8F A;  5F1R A;  2F48 A;  3I0T A;  2UXN A;  4ON0 A;  4NB5 A;  1BI3 A;  4UUT A;  4A2U A;  2JSC A;  2VLA A;  2IP2 A;  2LR8 A;  1OCO H;  3CCJ I;  5J3L A;  5J4Y A;  4JX6 A;  4OIP F;  1H89 C;  5L3B A;  2LD5 A;  2Y75 A;  3BZ6 A;  2A6T A;  4ZZD A;  2STW A;  5FKN A;  4AIH A;  2VJJ A;  3WG7 H;  4S0H B;  2DQR A;  3MKL A;  1TC3 C;  2RRE A;  2PX9 A;  3CES A;  5ICE A;  1MKM A;  4A3I J;  3O3K A;  4C2M J;  3S15 J;  4C2T A;  2R3S A;  1I1S A;  4KA4 A;  3FKI J;  4LG0 A;  3ISP A;  4E6K G;  1ZGW A;  2FBH A;  4LLL A;  5JVT A;  1P4X A;  1R5G A;  3GZN B;  3MEX A;  2JA7 J;  2FXA A;  3V7S A;  3WU0 A;  3Q3S A;  4B4C A;  1WJB A;  5GAE J;  5K7F A;  5F64 A;  2R5Y B;  3TP3 A;  1FY7 A;  1RUN A;  2E7W A;  1JTX A;  2XIG A;  2KFD A;  3GTJ J;  1R49 A;  1MNE A;  2RKH A;  4XQF A;  4XON A;  2K4B A;  4B47 A;  3MZH A;  3ZMD A;  4IL6 C;  3WGI A;  1ERD A;  2W7N A;  4EV0 A;  1JXS A;  2P5V A;  1FMW A;  1RI7 A;  3ZQI A;  2IAI A;  3J7A O;  3OIQ A;  3BTC A;  2DFF A;  3OR2 C;  3HUG B;  3K4K A;  3ESW B;  1QU3 A;  2H6B A;  2X51 A;  1MBG A;  3C2H A;  3HTU A;  3L2U A;  2HS5 A;  2BY3 A;  4MHG A;  2IGO A;  1CGP A;  4GDF A;  2X6Y A;  4HA8 A;  3ZMV A;  3S3M A;  3ABL H;  1JUM A;  1ZG5 A;  2E60 A;  3BG3 A;  1FOW A;  4V2F A;  2FJ1 A;  1ETQ A;  4HST A;  2MD5 A;  2K9S A;  4XRM A;  4PJN A;  1UST A;  4G6T B;  2R7R A;  4LJZ F;  1XPX A;  5CVJ A;  4BE2 A;  3KIO A;  4RAF A;  3OOU A;  2KL4 A;  1FX7 A;  3FDY A;  3ZGK A;  3K1M A;  3CP8 A;  2DOA A;  2EA2 A;  4L0Y B;  3BQY A;  3HOX J;  2IW5 A;  2KJB A;  2VQH A;  3S2W A;  1TLH B;  5F1J A;  2KIU A;  1DPR A;  2DFH A;  2CQQ A;  2YX7 A;  2O7O A;  3GVA A;  1PJR A;  3I64 A;  1U9N A;  4V19 K;  4XOR A;  5L3G A;  3I59 B;  3EUA A;  2VIX A;  3GBG A;  1WJA A;  5K1Y A;  4WCG A;  1W7P B;  2JA8 J;  3OYD A;  4CDG A;  3WTT C;  2HOS A;  4N9H A;  4JYK A;  3DEE A;  3FF5 A;  2CS3 A;  2D1V A;  2CUJ A;  3O8G A;  1SVO A;  4XN3 A;  3TDU C;  2LOO A;  4OMZ A;  3GW2 A;  1X1D A;  2W1O A;  5K7Z A;  2ISZ A;  2IXS A;  1OKR A;  2LKP A;  3J7Z I;  3ZR8 X;  3G71 I;  3CCS I;  3OYH A;  3ZQF A;  3E6C C;  2PMZ A;  3OYA A;  2WAD A;  5EG0 B;  1NK2 P;  3S16 J;  2ZNZ A;  3H5A A;  3HGG A;  1K4S A;  3HTS B;  4PFO A;  1B59 A;  2I10 A;  1X4O A;  2WY7 Q;  1Z05 A;  4BEH B;  2XAU A;  2AXT C;  1ZLK A;  1EF4 A;  1D1C A;  2QWW A;  1Y1W J;  3K4B A;  5L3F A;  3BRO A;  2LF8 A;  2VAS A;  3FIW A;  1V5G A;  1I39 A;  1IRF A;  1S29 A;  1UEL B;  2N8G A;  5B3S H;  4ESJ A;  4GYG A;  2WC2 A;  4X6A J;  1WGX A;  2OD5 A;  3RKW A;  2PMU A;  1X1A A;  3TBI A;  2QSG X;  5FO5 A;  4XRS A;  4YEL A;  1CQT A;  1RNL A;  2L0K A;  3NQO A;  4MEX F;  4RLF A;  5LGT A;  4CO8 A;  1FOY A;  1Z7L A;  5EJC A;  2XV4 S;  1NG6 A;  2EV5 A;  3T0Y A;  5KAF C;  2CUZ A;  1VQ7 I;  5E1Z B;  1O3S A;  4G6D A;  2L5Q A;  1N75 A;  2EZL A;  3QQA A;  4Q47 A;  1TQP A;  2Y30 A;  3JTG A;  1I6H J;  3SEQ A;  5F27 A;  4XRS G;  1TL8 A;  2R92 J;  1X1P A;  4PZJ A;  4E7K A;  3QOD A;  2MSY A;  5EGO A;  4KN4 X;  1ZG3 A;  3BT9 A;  2O61 A;  2EZI A;  2VXZ A;  4M3F A;  2CYY A;  4FX4 A;  1AHD P;  1G4D A;  4C3J J;  1QPM A;  1WZ2 A;  2Y69 H;  3TW7 A;  3H92 A;  1MIJ A;  2GBY A;  4Z6Y A;  2JPC A;  3BTJ A;  3CP2 A;  3D0S A;  3HEF A;  4BAY A;  3COA C;  5KNL A;  2V9P A;  5F0C A;  1ZLJ A;  4ANJ A;  5LFA A;  1W5T A;  3GXO A;  2RNG A;  4YIF A;  4YFN F;  5E3M A;  2Y48 A;  2D5V A;  3FBI B;  1XD7 A;  1W36 C;  1ETO A;  2EA4 A;  1VFC A;  1QZY A;  3F6O A;  3GTP J;  1BIB A;  2RN7 A;  2UZK A;  3C1D A;  3GLX A;  2EFN A;  4P55 A;  2VQG A;  5D6F A;  2EIL H;  4CCO A;  2QM3 A;  3PIP F;  4IXA A;  3HC7 A;  4RB0 A;  4HNU A;  1JKP C;  2F6C A;  1J7K A;  3JRH A;  3JRC A;  2M45 A;  3UKG A;  1QHH D;  4PSW A;  1YI2 I;  2GXA A;  1QHG A;  2K3F A;  3FXR A;  2BY0 A;  3REO A;  1TWH J;  1ZAO A;  3BR6 A;  1BA5 A;  2FQ3 A;  1JHH A;  4BL0 B;  1FSH A;  4WXC A;  3U1D A;  3ZQG A;  1W0U A;  3IRR A;  2OBP A;  2R7Z J;  3GCM A;  1J59 A;  4QIW N;  3PNV A;  2LDU A;  2DW4 A;  3TO7 A;  5EEH A;  4XKW A;  1UB9 A;  3W6V A;  5JVG F;  2EFP A;  4J01 A;  1LVA A;  1O7L A;  2IVM A;  4RS8 A;  2W25 A;  1IN8 A;  1ZGJ A;  2HQN A;  3M8J A;  3BCA A;  3L00 A;  4K2E A;  3SZT A;  1P4A A;  2ZXJ A;  2P8T A;  2ME6 A;  2LTP A;  3BG6 A;  2MC3 A;  3HRS A;  4GFB A;  3OS0 A;  3CF5 F;  1YJW I;  1MJA A;  3ZOB A;  4A3C J;  2L7Z A;  3L7W A;  2L01 A;  2IA2 A;  3QYB A;  4MLO A;  4D5C A;  5K5R A;  2HDD A;  4EVI A;  1HW5 A;  5FKL A;  2DMQ A;  4ABZ A;  3Q0W A;  2ID6 A;  3O2P E;  2FBI A;  1NHA A;  3R6S A;  3MZ8 A;  1Z3Y A;  4KIG A;  4XLP F;  1ZHF A;  3OYC A;  3A2K A;  1SFE A;  4OAZ A;  4PDK A;  5M3F J;  2YX4 A;  2QA4 I;  4ZZL A;  3LST A;  4WXH A;  1WJC A;  1V3F A;  1RUO A;  3ERM A;  3P5J A;  3H9J A;  4CCN A;  3H5R A;  5CPR B;  2NVU B;  3TMO A;  1APL C;  1FOX A;  4Q48 A;  3WTX C;  3CJN A;  2VKD A;  2QEN A;  1N78 A;  4N4O B;  2M5W A;  3IV5 A;  2R5Z B;  1ZAR A;  5E18 F;  3CME I;  3VPR A;  4XLH A;  1YTY A;  1UG0 A;  3PM1 A;  1BOB A;  5LGU A;  3IC7 A;  3DEW A;  3M8E A;  4LG0 B;  1R1V A;  3JRG A;  3DKY A;  4IQ4 A;  4A0X A;  3SZG A;  3I71 A;  2EFW A;  1VQO I;  1AA7 A;  4LK0 F;  3IH4 A;  1F43 A;  4RGX A;  4OAY A;  2HEO A;  2AQF A;  2KIM A;  1OIS A;  2HVQ A;  4D1Q A;  2XSJ C;  2W82 A;  3S1N J;  4HX4 A;  3BZC A;  2VUM J;  5ICG A;  2XAF A;  1Z67 A;  3G6E I;  3QPH A;  1U3E M;  5JLW A;  5D4R A;  4OMY A;  4ZJZ A;  4F91 B;  4WWC A;  1LUJ B;  1ZKG A;  2RGV A;  4XSZ F;  1IUF A;  1B1B A;  3N05 A;  1QNT A;  1VQ4 I;  3LSG A;  4BHB A;  4DGW B;  4D9J A;  4BE0 A;  4ESF A;  3K2Z A;  5M5W J;  2DA1 A;  2OTL I;  4L18 B;  3BR2 A;  1WSU A;  5FJ8 J;  1D5Y A;  2EZH A;  2OTJ I;  1OCZ H;  2V9K A;  4LLN A;  3TKY A;  3M07 A;  1LPQ A;  2ICW G;  3MAJ A;  1G8X A;  2DO7 A;  2I8D A;  2DA4 A;  2R7Q A;  2M34 A;  5M5X J;  5L3D A;  1IN7 A;  4KNY A;  2DA2 A;  3LNQ A;  2E1C A;  4N4N B;  2R4G A;  4NUB A;  4HF1 A;  1JGG A;  5IY5 H;  2K3P A;  4FQG A;  3TO9 A;  1RKW A;  3WTZ A;  5HS7 A;  4XMY A;  3ABT A;  4I76 A;  2W84 A;  1H9T A;  3HIF A;  1BI0 A;  1WKM A;  3CC7 I;  1HW2 A;  5HLT A;  4ETS A;  4EGY A;  3KP6 A;  2A3S A;  3J81 K;  1WJ5 A;  2LK2 A;  2RQQ A;  3OYK A;  2LP0 A;  3FXO A;  3CC4 I;  1HA8 A;  3EUH C;  3I4P A;  1DQU A;  4JX4 A;  4BQN A;  4UUV A;  1H8A C;  4IF4 A;  1D0X A;  3P9C A;  4HQE A;  1XCB A;  1S72 I;  1E2X A;  3I59 A;  4KMF A;  2YR2 A;  2DA7 A;  2K9Q A;  3DLA A;  4A0Z A;  9ANT A;  1ACI A;  1MZB A;  1SFX A;  1V54 H;  1BR4 A;  3L2C A;  5FLX Z;  2QQB A;  1R4N B;  3LL7 A;  3O6B B;  3ZMS A;  1H0M A;  2F2E A;  3HRT A;  2V1N A;  2B7E A;  5BPI A;  3DCF A;  3BG7 A;  5AIQ A;  1U8B A;  1GXP A;  1FLI A;  1LFB A;  5E79 C;  4B44 A;  4ZDP A;  4B1R A;  3ECO A;  5J1R A;  1Z6R A;  2A5Y B;  1OLT A;  3OL3 A;  2HQA A;  4WK8 F;  1L3L A;  1FJL A;  1ON1 A;  3MN2 A;  1BC7 C;  3A0H C;  2M8E A;  5E1X A;  1WI3 A;  4ZTJ A;  1TNT A;  2MYS A;  2NXN B;  2PG4 A;  3HYI A;  3I4M J;  2R7W A;  2VJ5 A;  2KP6 A;  2VT3 A;  1YIJ I;  4IRI A;  4CCK A;  5EEA A;  1MJ9 A;  2X9D A;  3K10 A;  1T33 A;  4RAG A;  3I3L A;  4EAT A;  3HL2 A;  2EJR A;  4A3B J;  5LHG A;  1XB4 A;  4IOA F;  1TW2 A;  4J00 A;  5HLH A;  4J19 A;  1MSF C;  1GLN A;  2JPB A;  4HAM A;  3BR1 A;  3KE2 A;  1OYI A;  3L9F A;  4RBO A;  4KN7 X;  3CMA I;  4A12 A;  4HF0 A;  3IWZ A;  2OC6 A;  2M3A A;  3H1C A;  3TGN A;  4RLQ A;  1LEA A;  4L9J A;  5EGO B;  1Y1V J;  2O03 A;  4I0B A;  3NWT A;  3ECH A;  5F6F A;  3FXU A;  4YII A;  1YHQ I;  4ENK A;  1IRX A;  2C6Y A;  2PMZ N;  2VOO A;  1YE9 A;  2PN6 A;  3DPT A;  4I02 A;  4CSW A;  2V7F A;  3W2W A;  2YUS A;  2DCE A;  1FYK A;  6PAX A;  2NVT J;  2NAZ A;  1E17 A;  1NH3 A;  3OR1 C;  5FKM A;  1Y0N A;  2CQX A;  2IT0 A;  3CD6 I;  4B43 A;  2KT0 A;  4Q4Z F;  1M1E B;  2IGM A;  4QSH A;  1YYV A;  1BI1 A;  4FE7 A;  2EIM H;  4FT8 A;  4DZJ A;  2KJC A;  2IA0 A;  2P81 A;  2XAS A;  5B1A H;  2D45 A;  1MGT A;  2BHZ A;  3KP3 A;  3BTL A;  4CCM A;  1OQY A;  2TCT A;  2HQR A;  1S5L C;  3JRI A;  3A0B C;  4DBR A;  5F04 A;  5FLV A;  4ZYD A;  4MTE A;  3OS1 A;  1BN5 A;  4Y3O A;  1SAX A;  2XRL A;  4ZYG A;  1U78 A;  2FNP A;  3V7C A;  4UV8 A;  3LSI A;  1ETK A;  2MA3 A;  1G3Y A;  1KYW A;  4ZH4 F;  1B8I B;  1OR7 C;  2OA4 A;  2GOX B;  1D5V A;  2AQE A;  4MEY F;  3FXL A;  3BJO A;  2DK8 A;  3B73 A;  4HYE A;  4EGZ A;  2L9V A;  5IYC J;  2H27 A;  4A3K J;  4AVZ A;  2QUF A;  5K7H A;  2L02 A;  5FB2 A;  1IN6 A;  1ODD A;  3JRE A;  3MKY B;  1R00 A;  1F36 A;  3GME A;  2GZW A;  3HXL A;  2IA1 A;  1D8K A;  5J4V A;  4X1E A;  2LRE A;  1I5Z A;  2E7X A;  3WTV C;  1UHS A;  5D5V B;  1GDT A;  2Q0O A;  1YOV B;  4IOC F;  4KIB A;  4G6Q A;  4UVB A;  1O57 A;  3F6V A;  5HVQ C;  3W2A A;  5D5W B;  3WTW C;  5BPD A;  3G1O A;  1T8I A;  5DD8 A;  2CWE A;  2K9M A;  4OWR B;  4PJM A;  4U87 A;  1FTT A;  1FBS A;  3PO2 J;  2Z9O A;  3DKX A;  3GWZ A;  4LFU A;  3KLO A;  3PQJ A;  3RPU A;  3MVP A;  2NYX A;  2Q8K A;  1LNW A;  4XLC A;  5C4J J;  2DA3 A;  3W6K B;  2P6S A;  4G9Y A;  4AYB A;  2HU9 A;  2LSO A;  2V6E A;  3L09 A;  2NVY J;  2MLG A;  1JUS A;  3CO6 C;  2L9R A;  1S7A A;  3LQR A;  1WPK A;  2FE3 A;  3F8C A;  4XOP A;  3VYS B;  4YFK F;  2F5C A;  1IUY A;  5A2Q K;  2MC4 A;  2OQG A;  4GO1 A;  3OY9 A;  5J8F A;  4QPO A;  3KEQ A;  1PVE A;  3TOB A;  4M6X A;  4DQ2 A;  2RAE A;  3H3U A;  3K4M A;  1IXS B;  2DOE A;  4MFD A;  5GPC A;  1HDP A;  1WRJ A;  5CLS A;  4A6D A;  5F0H A;  4U7B A;  3DBL B;  3ZMT A;  1VND A;  3GFL A;  2QQ9 A;  4U0V A;  2DPU A;  2WV1 A;  4FET A;  2ZJ2 A;  4BS9 A;  1W5C C;  2M0M A;  3HSR A;  3RDI A;  2GLO A;  4NNJ A;  5D5U B;  1D3Y A;  2R5Z A;  4F7Z A;  2XF7 A;  5HNF A;  1YIT I;  4A3D J;  5CKT A;  1PP7 U;  4AC0 A;  2HZT A;  5DTD A;  2MH9 A;  2UUZ A;  3F8M A;  4IVN A;  1FIA A;  2R7V A;  2XGD A;  1GHC A;  3H0D A;  2FD5 A;  3T8T A;  3WOD F;  1AWC A;  1HXD A;  4BQA A;  3FKJ A;  2BE5 F;  4HF2 A;  1BIA A;  2WY8 Q;  3CMM A;  1SAU A;  3EUH A;  3K6G A;  4M71 A;  1T38 A;  3GTK J;  1PUF B;  1WJF A;  3FBN B;  2GA2 A;  3F0C A;  1K83 J;  2DT7 B;  3FK6 A;  5C44 J;  2E5N A;  2EFQ A;  2VE8 A;  3G1L A;  3C3W A;  5IP7 J;  4B3X A;  3OYN A;  3S3O A;  4UNO A;  4DIQ A;  2FML A;  2JUG A;  2OCE A;  4AWX B;  1IW7 F;  2GA1 A;  1MMG A;  2O9L A;  1WI9 A;  3F21 A;  3B02 A;  4Z2Y A;  5HOD A;  3C2G A;  2MG4 A;  1Z1D A;  3WGG A;  2QGU A;  4L5J A;  1MBK A;  1UHW A;  4XNF A;  5BS6 A;  2H8R A;  2A5W A;  3ML6 A;  2X1D A;  1LDJ A;  2EIJ H;  3OSG A;  1JJ6 C;  5GTI C;  4IJA A;  1GVJ A;  2CQ7 A;  3HOY J;  4UVA A;  4UXN A;  2DDB A;  3PNY A;  5FGM A;  1VZ0 A;  2KKO A;  4BJT A;  3CZ6 A;  3JAM Z;  3FWE A;  1RRJ A;  2BBY A;  2X4H A;  2LFB A;  1P9Q C;  2OZ6 A;  2L2O A;  3VEP A;  2ZJR F;  4BU2 A;  1SFK A;  1U8R A;  1ZTR A;  1KON A;  3AG2 H;  2XGC A;  3DXJ F;  4DZP A;  3J80 Z;  3GZ5 A;  2ELH A;  2V26 A;  2BY2 A;  3RCO A;  4KYW A;  2JA6 J;  4HPQ A;  2WB1 A;  5HDK A;  1KZH A;  2OQR A;  5IT9 Z;  2O0Y A;  4P5O A;  1XX5 A;  4L5I A;  4ENN A;  1FIP A;  1OYW A;  4ZC3 A;  1WFX A;  3D1N I;  4BDZ A;  2IS2 A;  3EYY A;  3KET A;  3I55 I;  1ETW A;  1K6Y A;  1MND A;  3RSN A;  2H94 A;  2F5D A;  5ICC A;  1W1W E;  2HI3 A;  2V6C A;  4R1H A;  1QPI A;  2VQL A;  1R9T J;  2KIF A;  3PFI A;  5CVU A;  2E1M B;  4OIO F;  2DMN A;  4GGG A;  5KCM A;  3ZQQ A;  4IZZ A;  4CZZ A;  3I4N J;  3K1P A;  1MMS A;  1YW7 A;  4DW6 A;  3PIO F;  5E8G A;  4A3M J;  1J9I A;  2YU3 A;  1S7O A;  3TL4 X;  4YEJ A;  3DBR B;  3BQZ A;  4BBR J;  2CU7 A;  1JT6 A;  1A31 A;  2Y0S A;  1R1T A;  2KZV A;  4EJV A;  3AFH A;  1DU6 A;  4IHY A;  1J09 A;  3F9K A;  4M73 A;  4QPQ A;  4U7D A;  3KP2 A;  5FRM A;  4FE4 A;  2JVH A;  3QU6 A;  2HOA A;  2D1H A;  2DK5 A;  2VQC A;  3C2B A;  5E3L A;  3EET A;  2HR3 A;  4ZYA A;  1FP2 A;  3S1R J;  1A5J A;  3LA2 A;  3S8P A;  4W1U A;  4WXD A;  1OR7 A;  3F3X A;  3KEY A;  1NTC A;  5EDN A;  3LFK A;  1IAW A;  1D0Y A;  3M1C A;  3U2R A;  4HW0 A;  3V8J A;  5TIS C;  3CLO A;  2G9W A;  1NK3 P;  4FCY A;  4RGU A;  3CCE I;  3AG3 H;  1VF9 A;  1MMD A;  2DMP A;  3G4S I;  3IKV A;  3RQI A;  4ZTF A;  3HDD A;  4KT5 C;  3BR0 A;  5L3C A;  4D7N A;  1ORK A;  5B66 C;  3E3V A;  2HXO A;  1QZE A;  2QBY B;  3FHZ A;  1W7P D;  2FA5 A;  4HV5 A;  1STZ A;  3BP8 A;  4CYD A;  2XDV A;  1OCP A;  4E7H A;  2Y2Z A;  2DN0 A;  2E1M C;  4BBS J;  5JFR A;  1SFO J;  3WHB A;  1BM9 A;  1JE8 A;  4U0Y A;  1EA3 A;  5IP9 J;  2GIZ A;  3DV8 A;  3TO6 A;  4MFE A;  3RYR A;  5DDG A;  1I6X A;  4MO7 A;  1IN5 A;  1O3T A;  4RDU A;  2JWT A;  4UVC A;  1FOK A;  5HDG A;  1G2H A;  1LE8 B;  2XKO A;  3H3Z A;  3IWF A;  4GRI A;  5J6X A;  2HOT A;  3LQQ A;  3S14 J;  5JLX A;  1W36 D;  2XAH A;  1R58 A;  3OYL A;  3OSF A;  2XUB A;  2NS8 A;  5J1Y A;  2ZNY A;  1I50 J;  3HB9 A;  4PGG A;  5CVR A;  4BXX J;  3I5U A;  1FEX A;  1FBQ A;  1B8I A;  1BC8 C;  1SVM A;  4LIU A;  3RTR A;  1DGR M;  2O6G E;  4C3H J;  2H6C A;  1Y8R B;  2XPU A;  3FMR A;  1OCT C;  3KP4 A;  1V55 H;  1W4M A;  2K4J A;  1SD4 A;  3EPZ A;  5JI6 A;  2WAQ A;  4CIC A;  2QCO A;  1S6L A;  3L2R A;  4HNT A;  5KVR A;  1GV5 A;  2WAE A;  3GEZ A;  1LEB A;  3PNT A;  1XDS A;  1TBX A;  3E1S A;  2CGP A;  1JGS A;  1BL0 A;  5FD6 A;  2ZCW A;  4B8X A;  4LK1 F;  3N4M A;  4M6V A;  2RDP A;  4CCJ A;  3IAM 2;  2LVS A;  4HBL A;  1QA6 A;  5M5Y J;  1GUU A;  1TT5 B;  2VC1 A;  4MIM A;  4LB6 B;  4AIK A;  4E7J A;  5HLI A;  3A02 A;  1HW1 A;  2HTS A;  3ZQ7 A;  4UY8 I;  5CVI A;  1ITY A;  2V1U A;  4A5M A;  4HOB A;  5ILV A;  3OYG A;  2LLK A;  1XGS A;  1A6Q A;  1V5E A;  2H1K A;  2OPT A;  4ZDL A;  3ASO H;  3I54 A;  5FLM J;  3JRB A;  2Z1D A;  1E3O C;  1QVU A;  1IXC A;  2M7A A;  1Z0X A;  1LJ9 A;  1UZC A;  3H9Q A;  5HOO A;  2E2H J;  2ACJ A;  3K1N A;  1JUP A;  5BOX A;  3QU3 A;  3E0J B;  1Y0U A;  2Z99 A;  2R7X A;  2FF4 A;  1JKQ C;  1P7I A;  5JHF A;  1ENH A;  3SXY A;  1T0F C;  3F8F A;  2V4J C;  3KZY A;  1XSV A;  4L9T A;  2AXL A;  2UV1 A;  5D4S A;  1R23 A;  1R7J A;  5J47 A;  1UFM A;  2FSW A;  5KK1 A;  2FMY A;  2IS4 A;  4M9S A;  4D5F A;  2HNH A;  2DJI A;  2B9S A;  1O3R A;  4O3M A;  5B5E C;  3VDX A;  2EFO A;  5LHH A;  5ILS A;  5IOY A;  3M4O J;  2BXZ A;  4JX5 A;  3KYL A;  3HSE A;  3KFW X;  2HYG D;  2ZSI B;  2CFO A;  3A01 B;  2IGN A;  1FYM A;  3UR3 C;  2L4M A;  1F1Z A;  1Z9C A;  2E2I J;  1YG2 A;  1A35 A;  3KZI C;  2VPR A;  4A3G J;  4BHC A;  1WCM J;  1LDD A;  4KIT B;  3K69 A;  3I56 I;  3V8L A;  4AYB N;  3ULQ B;  3QP5 A;  1TP4 A;  3GTM J;  1UMQ A;  2KDZ A;  3RI4 A;  1PUF A;  1JKO C;  3CUQ B;  1AOY A;  4FAS D;  2K86 A;  2TRT A;  2VJ4 A;  4PFP A;  4RAY A;  2BZT A;  3WTU C;  2Z2S B;  1XGM A;  3AL0 C;  3K70 D;  1WH5 A;  3OS2 A;  2OJE D;  3DPU A;  1S8N A;  3K4J A;  4KUM A;  2LRD A;  3PJR A;  4BXF A;  1N77 A;  4ZDO A;  3ABK H;  4HDU A;  1G3T A;  3P9K A;  2G0E A;  5F08 A;  2QKL B;  2L4A A;  2V1X A;  3CQZ J;  2XPV A;  3LAP A;  2E2J J;  4DYR A;  5TRD A;  3NRV A;  4ASN A;  3CCV I;  1OCC H;  2XAJ A;  1ZRF A;  5FKK A;  4E7S A;  1XSD A;  3PO3 J;  5DEQ A;  5H20 A;  3GO5 A;  1E3H A;  2CV2 A;  1B9N A;  3RKQ A;  4Y15 A;  5LD2 C;  2EK5 A;  3CDI A;  2ELK A;  1I3A A;  3LWF A;  1R5I D;  4NQW B;  1O7F A;  2EIK H;  3MWM A;  4GXO A;  2M2E A;  4M72 A;  2R7S A;  1ZR2 A;  4XL9 A;  3HG9 A;  4G94 A;  4HLX A;  3J7A Y;  2G7U A;  2ELJ A;  1J0R A;  2K02 A;  2Y0M A;  5DUI A;  1ZR4 A;  2KIQ A;  1DP3 A;  5H2F C;  1SEU A;  2ZXI A;  1TW3 A;  4ENJ A;  3HZJ A;  5LBQ A;  1G6N A;  2BVL A;  3H0G J;  3CCM I;  2COM A;  2DI3 A;  1HSJ A;  3MQ0 A;  2DDA A;  3MMY B;  2P5K A;  3ZP5 A;  2K7L A;  5E3N A;  3C7J A;  1X1C A;  4LOC A;  1SD6 A;  2MGQ A;  4AUX A;  4E4H A;  4S05 A;  3CUQ C;  1WQ2 A;  2XRO A;  3QPT A;  2LYC A;  2EPF A;  2EIN H;  3S93 A;  4P9F A;  1X1B A;  3K2A A;  3EYI A;  3CC2 I;  2XHK A;  3I53 A;  4IRG A;  4U88 A;  2DPD A;  3NEU A;  2MH2 A;  1Y39 A;  4JK1 X;  4L9V A;  2IJL A;  1POG A;  2XVC A;  3HHG A;  3MCZ A;  3JTH A;  2XSD C;  2BV6 A;  1K4T A;  2PJR B;  1OCR H;  2F5F A;  2FRH A;  2BXY A;  5LEJ A;  2ZXW H;  3H5N A;  1X4P A;  3U1K A;  2E5Z A;  3K7A J;  1RET A;  4NBQ A;  3G3Z A;  1FMV A;  2K27 A;  3B6C A;  3S2H J;  2TDX A;  2MLK A;  2E19 A;  2WB1 N;  2VON A;  3N97 A;  3HHH A;  1IJW C;  3ZPL A;  3HOZ J;  1D8J A;  2H8W A;  1FPQ A;  5DS9 A;  2GM4 A;  1N25 A;  2FQ4 A;  2IEK A;  3OV8 A;  4I99 C;  4NC8 A;  1GT0 C;  2JN6 A;  3BY6 A;  3S1Q J;  1MMA A;  5ILU A;  2ESH A;  1F4K A;  2M7B A;  1UG2 A;  3DFG A;  1P2F A;  3E5X A;  2L7M P;  3IAS 2;  1FZP B;  1BJA A;  2LKS A;  2HZD A;  2M4G A;  5L3E A;  2CO5 A;  1IXR C;  1HLV A;  1YS6 A;  4G8X A;  3SDB A;  3OYB A;  1KQ9 A;  1KGS A;  2BVM A;  3BPX A;  4DYC A;  3PSI A;  3A1Y A;  2QLZ A;  4QLC U;  2ZME C;  2OCC H;  4F93 B;  2X6O A;  2Y0S N;  4OOI A;  2QBY A;  1FSE A;  1SVL A;  4EJT A;  1Q1V A;  3JR9 A;  3G73 A;  3ZQC A;  2XRN A;  2ECC A;  3JSO A;  4PGH A;  4JQF A;  1JJ8 C;  2YPR A;  4XKC A;  2R7F A;  4BQO A;  1ULY A;  1MBE A;  1YLF A;  3RJP A;  2P7V B;  2O8K A;  4A5N A;  2KIS A;  3HBL A;  4PCQ A;  4I0A A;  1TT0 A;  3LA3 A;  4M3D A;  3SYT A;  3VOE A;  1Q1H A;  4U0W A;  3V4G A;  2Q2E A;  1XGN A;  2FU4 A;  1LE8 A;  4XLA A;  4M3G A;  2PJP A;  3E5U A;  5GPA A;  3CO7 C;  2Z16 A;  4BAC A;  3JRF A;  4E7L A;  1B6A A;  3FMS A;  2DFI A;  4EEF G;  1RR7 A;  3OOP A;  4BQQ A;  4XR6 A;  3T1B A;  2E34 A;  1CF7 A;  3DTI A;  1IV6 A;  1IG7 A;  1K78 A;  2STT A;  1U6G A;  4WX9 A;  5CYV A;  1BR2 A;  1WJE A;  2ZB9 A;  4EJU A;  1R1U A;  5HS9 A;  2JK3 A;  1XMX A;  4XBF A;  2H09 A;  5IOZ A;  1X3U A;  2GAU A;  3DLL F;  3CDH A;  3QPS A;  3C18 A;  5IP6 A;  3JSP A;  1OJL A;  1EKE A;  1T0F A;  2PQ8 A;  4N0B A;  3CUO A;  2WTE A;  3DWL E;  2XAG A;  5AIP A;  3HJE A;  4BY7 J;  1QO0 D;  2OF7 A;  4I01 A;  2CUE A;  4CYC A;  2CV0 A;  3CTA A;  1UCR A;  2XPW A;  3DU5 A;  3DEU A;  3OYM A;  2A6E F;  4BHP A;  1D1A A;  4C2U A;  3LSM A;  2BGC A;  5DCF A;  5FFX A;  2KRC A;  3AG4 H;  4BJ5 C;  4NDL A;  2XF6 A;  3VYU B;  1KU9 A;  2Y9Z A;  1G59 A;  2ZBK A;  3FX3 A;  3S2D J;  3S32 A;  2X1C A;  1R6R A;  2VJI A;  1VQ9 I;  1TWF J;  4PSX A;  1X19 A;  1TWA J;  1HF0 A;  1Y8Q B;  3Q9S A;  4IHS A;  2IBD A;  1IF1 A;  2LY2 A;  3F8B A;  3VSL A;  4AVP A;  2EZK A;  1WH7 A;  3VB2 A;  5D8K B;  1YJN I;  1RC9 A;  2A05 A;  1HST A;  4C9Y A;  4A3F J;  2LMD A;  1PP8 F;  4R8H A;  1RZ4 A;  1LVK A;  1I27 A;  3ERE D;  3BLY A;  2IS1 A;  2K40 A;  5FKO A;  2NNY A;  2CH0 A;  2VI6 A;  4I98 B;  1YS7 A;  2ZO4 A;  1O4X A;  2NS0 A;  1TWC J; 
#chains in the Genus database with same CATH homology
 1C0W A;  3MZY A;  2A69 F;  2QZ8 A;  5AON A;  2PBI A;  4GCV A;  3Q5F A;  3SZP A;  1QBJ A;  3DP7 A;  2XAQ A;  2P7C B;  4FHT A;  4OIQ F;  5K5Q A;  2HYF A;  1BOA A;  1XGO A;  1B9M A;  1BI2 A;  4N9I A;  3FM3 A;  5ERI A;  1KA8 A;  2B0L A;  3R4K A;  2OAZ A;  2V1D A;  3VFZ A;  4P9U A;  4HDV A;  1ZYR F;  4UHT A;  5LEK A;  1UHM A;  3BJ6 A;  5BMZ A;  2ADU A;  3WTS C;  1VTN C;  2D2W A;  2HKX A;  3WE2 A;  2HKO A;  3ZN0 A;  1FBU A;  1LDK B;  3P9I A;  5ICF A;  4HV6 A;  1SD5 A;  3IRQ A;  2LF7 A;  3CUQ A;  4QWQ A;  1QZZ A;  3KLN A;  3WG9 A;  5FLX K;  3GYH X;  3LA7 A;  4KIC A;  4LLG F;  1U2W A;  3TOA A;  2V79 A;  4ZYH A;  3M1E A;  2R7D A;  3KP5 A;  3GFI A;  3SFZ A;  1ZH5 A;  2YSR A;  3HSF A;  2EV6 A;  3K0L A;  5CJ9 A;  4MTD A;  2CSO A;  2BEO A;  1K79 A;  2CFX A;  2IRF G;  4ZYE A;  1Z6T A;  1V4R A;  4HX8 A;  3W6J B;  1R22 A;  1L0O C;  1OPC A;  4RGR A;  3KP7 A;  3E97 A;  3GUD A;  4NQW A;  2PLY A;  4KIF A;  1XDU A;  1YQA A;  4LB5 A;  3I58 A;  3D5L A;  4KDP A;  3FZV A;  2L3D A;  3HRM A;  2DAO A;  4B09 A;  1LB2 A;  2ZME A;  5DCM A;  2NNN A;  4RB2 C;  1YO5 C;  3TQN A;  5DV5 A;  4XRF A;  1J2X A;  1TQI A;  2A61 A;  2Z33 A;  2WWY A;  5FFZ A;  2DBB A;  3WGH A;  2GWR A;  4KMU X;  3GX4 X;  1I1G A;  3F72 A;  5DD4 A;  5HLG A;  4OIN F;  1EH6 A;  1XSX A;  4M9X A;  3BWG A;  5D5X B;  2DU9 A;  3DQV C;  1KU2 A;  1ZGA A;  5J8C A;  3PQK A;  2W24 A;  3WE3 A;  4YFX F;  3KEO A;  2E1N A;  2P4W A;  3IHU A;  1MJB A;  3ZMZ A;  2VN2 A;  2P5L C;  3GF2 A;  4BNC A;  4ESB A;  1HKQ A;  3E6D A;  5D6E A;  2JT1 A;  5E17 F;  1P4W A;  3FXQ A;  1HKT A;  2PMH A;  1U5T B;  3E6B A;  3J81 Z;  5H6R A;  5H6Q A;  4ENM A;  4O5V A;  2GIV A;  2BYV E;  1IZ1 A;  4YG2 F;  2VE9 A;  1TTY A;  3RPQ A;  4GYI A;  3DF8 A;  4I09 A;  3GFM A;  1ZG1 A;  1ZRD A;  1F9N A;  5LLQ A;  3ROU A;  1EV7 A;  1CF7 B;  5LRS A;  4S04 A;  2JZY A;  1K78 B;  1USS A;  1G3W A;  4JBA A;  2W57 A;  2CW0 F;  3DPL C;  2M30 A;  2HDC A;  5DYM A;  1A04 A;  2CG4 A;  3DKW A;  2VBW A;  2ISY A;  2JTV A;  3GFJ A;  1R36 A;  2W85 A;  3IKT A;  2CQK A;  2ETH A;  1J75 A;  1U5T C;  1KU3 A;  4O6J A;  4HLY A;  4AIJ A;  1DDN A;  4Y17 A;  3TDZ C;  1J5Y A;  4HZF A;  4IRH A;  4IPA A;  2GQQ A;  5D8L B;  1DUX C;  4LGW A;  2KRF A;  4EQQ A;  2MBF A;  5JHU A;  2DT5 A;  1SFU A;  4G7Z F;  2ZFW A;  1MDM B;  3MFK A;  1XCV A;  1W5S A;  5E1W A;  1ZRC A;  2A07 F;  3SHF A;  4TV7 A;  1PUE E;  1SMT A;  3F23 A;  4XSX F;  4A0Y A;  4CXF A;  3JAM K;  1MD0 A;  5HDN A;  1BBY A;  1G3S A;  4BXU A;  4I2O A;  4WF2 A;  3J80 K;  3QOP A;  1OMI A;  2RNJ A;  3BJA A;  1T98 A;  3RKX A;  3VOD A;  2VBZ A;  5IT9 K;  4RAZ A;  1FWZ A;  1TNS A;  3V7R A;  4EM1 A;  1FNN A;  4CGZ A;  2VBY A;  2IPQ X;  1H9G A;  1K7A A;  3ZMU A;  1FP1 D;  4BYY A;  5E8I A;  1HQC A;  3WTY C;  2VOD A;  1ON2 A;  4AD9 A;  3WU1 B;  2J5P A;  3BPV A;  4MQ9 F;  5ED4 A;  2P6T A;  4MQV A;  2FNA A;  1OYY A;  1T39 A;  2A68 F;  3E5Q A;  3JW4 A;  1EH8 A;  3BDD A;  1Z91 A;  4G7O F;  1R5H A;  1DPU A;  2VBX A;  4Y13 A;  3EDP A;  2OU2 A;  3HUG A;  5A2Q Z;  3QP6 A;  5K5O A;  3T5X A;  3GZ6 A;  5E20 A;  2RVC A;  1T6S A;  1Z7U A;  2RC4 A;  3R0A A;  2VT2 A;  1YIO A;  3RYP A;  2ZME B;  5IT3 A;  5DCM B;  2J5O A;  4L0Z B;  1KYZ A;  3HRU A;  3F22 A;  4LMY A;  4UV9 A;  2X0L A;  3F8N A;  2FBK A;  1PDN C;  2FEZ A;  4XLN F;  2LNB A;  2HWV A;  2DLL A;  1YW9 A;  3KCC A;  3FM5 A;  1W7P A;  1K6O A;  2GXB A;  1WWX A;  3R61 A;  1T2K A;  2HTJ A;  4RB3 C;  1YFH A;  1EH7 A;  2QVO A;  5JR3 A;  1P92 A;  1ONV A;  2UWM A;  3KZZ A;  4M9Z A;  3RIR A;  5LHI A;  4H0E A;  2AS5 F;  4DNC A;  5HS8 A;  2EWN A;  2DQL A;  2XGX A;  3SQN A;  1XMA A;  4IHT A;  2M87 A;  2G7H A;  2L54 A;  5DUK A;  1S3J A;  4RB1 A;  1KQ0 A;  5EEG A;  4EM0 B;  2QYO A;  1FT9 A;  1XMK A;  4M74 A;  2FOK A;  2VOP A;  1P6R A;  1U5T A;  2Z3Y A;  5LRR A;  2QQA A;  4OIR F;  3FMQ A;  1SD7 A;  4FX0 A;  3T8R A;  4EM2 A;  1F5T A;  3RKY A;  3LAJ A;  4A6E A;  2GXG A;  3HOT A;  4G7H F;  5BQT A;  3ABU A;  4LD5 A;  2PFB A;  3QAH A;  2RQP A;  3QRF F;  2O3F A;  1XN7 A;  2EV0 A;  4RGS A;  2PI0 A;  1TQM A;  3Q9V A;  5CVV A;  3M7G A;  1SMY F;  1FC3 A;  4E70 A;  1KQ8 A;  3R0J A;  2Z5U A;  1GXQ A;  1QQI A;  1B4A A;  3ELK A;  2O8X A;  2PEX A;  4MGR A;  2HFH A;  3V8K A;  2A6H F;  4CHU A;  3P7N A;  1QGP A;  2V9V A;  4EJW A;  4P96 A;  2UXX A;  1REP C;  2RV8 A;  1IRG A;  3BOQ A;  4EMS A;  1HKS A;  1JHF A;  4MNU A;  5TJJ A;  2HOE A;  4NHJ A;  2M1B A;  3R60 A;  2HGC A;  4L9N A;  3ZN1 A;  3U9G A;  3K9T A;  2F5E A;  2XKP A;  1ZN2 A;  2WV0 A;  2NRA C;  2VC0 A;  2OZU A;  3E6M A;  5FD5 A;  4OU0 A;  4KFC A;  1DP7 P;  1RIO H;  2ESN A;  5LGN A;  1FYL A;  3HOS A;  1KU7 A;  2JRT A;  4Q5S F;  3AAF A;  3M9A A;  1MDM A;  2DTR A;  4D0P A;  2EB7 A;  2ZKZ A;  1O3Q A;  3EQL F;  4BH9 A;  1IN4 A;  1YW8 A;  4EJO A;  4R79 A;  3IL2 A;  1ZRE A;  4I7H A;  4M6Y A;  4HX7 A;  4HQM A;  1HBX G;  1LQ1 A;  3M8F A;  5F1R A;  3I0T A;  2UXN A;  4ON0 A;  4NB5 A;  1BI3 A;  4A2U A;  2JSC A;  2IP2 A;  4OIP F;  5L3B A;  2Y75 A;  3BZ6 A;  4ZZD A;  2STW A;  4AIH A;  2DQR A;  5ICE A;  1MKM A;  3O3K A;  1I1S A;  2R3S A;  4KA4 A;  4LG0 A;  3ISP A;  2FBH A;  4LLL A;  5JVT A;  1P4X A;  1R5G A;  3MEX A;  2FXA A;  3V7S A;  3WU0 A;  5F64 A;  1FY7 A;  1RUN A;  2E7W A;  2XIG A;  2RKH A;  2K4B A;  3MZH A;  3ZMD A;  3WGI A;  4EV0 A;  1JXS A;  2P5V A;  1RI7 A;  3J7A O;  2H6B A;  3HTU A;  2HS5 A;  4MHG A;  1CGP A;  4HA8 A;  3ZMV A;  1ZG5 A;  2MD5 A;  1UST A;  4LJZ F;  5CVJ A;  1FX7 A;  3K1M A;  2EA2 A;  4L0Y B;  2IW5 A;  2KJB A;  3S2W A;  1TLH B;  2KIU A;  1DPR A;  2YX7 A;  3GVA A;  3I64 A;  5CVR A;  5L3G A;  3I59 B;  5K1Y A;  4WCG A;  1W7P B;  4CDG A;  3WTT C;  4N9H A;  3FF5 A;  2D1V A;  3TDU C;  4OMZ A;  3GW2 A;  2ISZ A;  1OKR A;  2LKP A;  3E6C C;  2ZNZ A;  3HTS B;  1B59 A;  1Z05 A;  1ZLK A;  2QWW A;  5L3F A;  3BRO A;  2LF8 A;  1IRF A;  1S29 A;  4ESJ A;  4GYG A;  2WC2 A;  2OD5 A;  3RKW A;  2PMU A;  5FO5 A;  1RNL A;  3NQO A;  4MEX F;  5LGT A;  4CO8 A;  2XV4 S;  2EV5 A;  3T0Y A;  5E1Z B;  1O3S A;  4G6D A;  4Q47 A;  1TQP A;  3JTG A;  4PZJ A;  4KN4 X;  1ZG3 A;  2O61 A;  2VXZ A;  2CYY A;  4FX4 A;  1G4D A;  1QPM A;  3H92 A;  2JPC A;  3D0S A;  4BAY A;  3COA C;  1ZLJ A;  1W5T A;  3GXO A;  4YIF A;  4YFN F;  2Y48 A;  1XD7 A;  2EA4 A;  1QZY A;  3F6O A;  1BIB A;  2RN7 A;  2UZK A;  3C1D A;  3GLX A;  2EFN A;  4P55 A;  5D6F A;  2QM3 A;  4IXA A;  4RB0 A;  1J7K A;  2M45 A;  3FXR A;  3REO A;  1ZAO A;  2FQ3 A;  1JHH A;  1FSH A;  4WXC A;  3U1D A;  3IRR A;  2OBP A;  1J59 A;  2LDU A;  2DW4 A;  3TO7 A;  5EEH A;  1UB9 A;  2EFP A;  1LVA A;  1O7L A;  2IVM A;  4RS8 A;  2W25 A;  1IN8 A;  1ZGJ A;  2HQN A;  3L00 A;  4K2E A;  3SZT A;  1P4A A;  2ZXJ A;  2P8T A;  2MC3 A;  3HRS A;  1MJA A;  3L7W A;  2L01 A;  2IA2 A;  5K5R A;  4EVI A;  1HW5 A;  3O2P E;  2FBI A;  1NHA A;  3R6S A;  4KIG A;  4XLP F;  1ZHF A;  1SFE A;  4PDK A;  2YX4 A;  4ZZL A;  3LST A;  4WXH A;  1V3F A;  1RUO A;  4Q48 A;  3WTX C;  3CJN A;  2QEN A;  2M5W A;  1ZAR A;  5E18 F;  1YTY A;  5LGU A;  3IC7 A;  3M8E A;  4LG0 B;  1R1V A;  4A0X A;  3I71 A;  2EFW A;  4LK0 F;  4RGX A;  2HEO A;  2KIM A;  4HX4 A;  5ICG A;  2XAF A;  3QPH A;  1U3E M;  5D4R A;  4OMY A;  4WWC A;  2RGV A;  4XSZ F;  1B1B A;  1QNT A;  4BHB A;  4ESF A;  3K2Z A;  4L18 B;  1WSU A;  4LLN A;  3TKY A;  3MAJ A;  2DO7 A;  5L3D A;  1IN7 A;  4KNY A;  2E1C A;  4HF1 A;  3TO9 A;  3WTZ A;  5HS7 A;  3ABT A;  2W84 A;  1H9T A;  3HIF A;  1BI0 A;  1WKM A;  1HW2 A;  4ETS A;  4EGY A;  3KP6 A;  2A3S A;  3J81 K;  3I4P A;  4UUV A;  4IF4 A;  3P9C A;  4HQE A;  1XCB A;  1E2X A;  3I59 A;  4KMF A;  2YR2 A;  4A0Z A;  1MZB A;  1SFX A;  3L2C A;  5FLX Z;  2QQB A;  3O6B B;  3ZMS A;  1H0M A;  2F2E A;  3HRT A;  5BPI A;  5AIQ A;  1FLI A;  1GXP A;  3ECO A;  1Z6R A;  2A5Y B;  4WK8 F;  1L3L A;  1ON1 A;  1BC7 C;  2M8E A;  5E1X A;  1TNT A;  2PG4 A;  3HYI A;  2VT3 A;  4IRI A;  1MJ9 A;  2EJR A;  5LHG A;  1XB4 A;  1TW2 A;  5HLH A;  2JPB A;  4HAM A;  3KE2 A;  1OYI A;  3L9F A;  4A12 A;  4KN7 X;  4HF0 A;  3IWZ A;  3TGN A;  1LEA A;  4L9J A;  2O03 A;  4I0B A;  3ECH A;  5F6F A;  3FXU A;  4YII A;  4ENK A;  2C6Y A;  2VOO A;  2PN6 A;  3DPT A;  4I02 A;  1FYK A;  6PAX A;  2NAZ A;  1E17 A;  4Q4Z F;  1YYV A;  1BI1 A;  4FT8 A;  2KJC A;  2IA0 A;  2XAS A;  2D45 A;  1MGT A;  3KP3 A;  2HQR A;  4ZYD A;  4MTE A;  1BN5 A;  1SAX A;  4ZYG A;  1U78 A;  2FNP A;  3V7C A;  4UV8 A;  2MA3 A;  1G3Y A;  1KYW A;  4ZH4 F;  2OA4 A;  1D5V A;  4MEY F;  3BJO A;  2DK8 A;  3B73 A;  4HYE A;  4EGZ A;  2H27 A;  2QUF A;  2L02 A;  5FB2 A;  1IN6 A;  1ODD A;  1R00 A;  2GZW A;  2IA1 A;  1D8K A;  1I5Z A;  2E7X A;  3WTV C;  5D5V B;  2Q0O A;  4KIB A;  4G6Q A;  4UVB A;  1O57 A;  3F6V A;  5HVQ C;  5D5W B;  3WTW C;  5BPD A;  5DD8 A;  2CWE A;  1FBS A;  2Z9O A;  3GWZ A;  4LFU A;  3KLO A;  3PQJ A;  3RPU A;  2NYX A;  2Q8K A;  1LNW A;  3W6K B;  2P6S A;  4G9Y A;  2LSO A;  3L09 A;  2MLG A;  3CO6 C;  1S7A A;  3LQR A;  2FE3 A;  3F8C A;  4YFK F;  2F5C A;  1IUY A;  5A2Q K;  4GO1 A;  2OQG A;  5J8F A;  3KEQ A;  3TOB A;  4M6X A;  4DQ2 A;  3H3U A;  1IXS B;  1WRJ A;  5CLS A;  4A6D A;  4U7B A;  3ZMT A;  3GFL A;  2QQ9 A;  4U0V A;  2DPU A;  2ZJ2 A;  3HSR A;  3RDI A;  5D5U B;  1D3Y A;  4F7Z A;  1PP7 U;  2HZT A;  2MH9 A;  3F8M A;  4IVN A;  1GHC A;  3T8T A;  3WOD F;  1AWC A;  1HXD A;  4BQA A;  2BE5 F;  4HF2 A;  1BIA A;  3EUH A;  4M71 A;  1T38 A;  2GA2 A;  2EFQ A;  2VE8 A;  3C3W A;  4UNO A;  2FML A;  4AWX B;  1IW7 F;  2GA1 A;  1WI9 A;  3F21 A;  3B02 A;  4Z2Y A;  1Z1D A;  3WGG A;  4L5J A;  5BS6 A;  1UHW A;  3ML6 A;  1LDJ A;  4IJA A;  1GVJ A;  4UVA A;  4UXN A;  5FGM A;  2KKO A;  3JAM Z;  3FWE A;  2BBY A;  2X4H A;  2OZ6 A;  3VEP A;  1U8R A;  3DXJ F;  3J80 Z;  3GZ5 A;  2ELH A;  4KYW A;  5HDK A;  5IT9 Z;  2OQR A;  2O0Y A;  4P5O A;  4L5I A;  4ENN A;  1OYW A;  3EYY A;  3KET A;  2H94 A;  2F5D A;  5ICC A;  2V6C A;  4R1H A;  2KIF A;  3PFI A;  5CVU A;  4OIO F;  4GGG A;  4CZZ A;  1J9I A;  3K1P A;  1YW7 A;  2YU3 A;  1S7O A;  1R1T A;  4EJV A;  4M73 A;  4U7D A;  3KP2 A;  3QU6 A;  2D1H A;  2DK5 A;  3EET A;  2HR3 A;  1FP2 A;  3LA2 A;  4WXD A;  1OR7 A;  3F3X A;  3LFK A;  1IAW A;  3U2R A;  4HW0 A;  3V8J A;  3CLO A;  2G9W A;  4RGU A;  3IKV A;  4KT5 C;  5L3C A;  3E3V A;  2QBY B;  3FHZ A;  2NS0 A;  1W7P D;  2FA5 A;  4HV5 A;  1STZ A;  3BP8 A;  4CYD A;  5JFR A;  1BM9 A;  1JE8 A;  4U0Y A;  3DV8 A;  3TO6 A;  3RYR A;  5DDG A;  1I6X A;  1IN5 A;  1O3T A;  4UVC A;  1FOK A;  5HDG A;  2XKO A;  3H3Z A;  3IWF A;  5J6X A;  3LQQ A;  2XAH A;  1R58 A;  2XUB A;  2ZNY A;  4PGG A;  3I5U A;  1FBQ A;  1BC8 C;  3RTR A;  2O6G E;  2H6C A;  3FMR A;  3KP4 A;  1W4M A;  2K4J A;  1SD4 A;  5JI6 A;  4CIC A;  1S6L A;  5KVR A;  3GEZ A;  1LEB A;  1XDS A;  1TBX A;  2CGP A;  1JGS A;  5FD6 A;  2ZCW A;  4B8X A;  4LK1 F;  3N4M A;  2RDP A;  4HBL A;  2VC1 A;  4LB6 B;  4AIK A;  5HLI A;  1HW1 A;  2HTS A;  3ZQ7 A;  5CVI A;  2V1U A;  4A5M A;  4HOB A;  5ILV A;  1XGS A;  3I54 A;  1IXC A;  1LJ9 A;  5HOO A;  2ACJ A;  3K1N A;  5BOX A;  3QU3 A;  1Y0U A;  2Z99 A;  2FF4 A;  3SXY A;  3F8F A;  3KZY A;  1XSV A;  4L9T A;  2AXL A;  5D4S A;  1R23 A;  1R7J A;  1UFM A;  2FSW A;  5KK1 A;  2FMY A;  4M9S A;  1O3R A;  4O3M A;  5LHH A;  2EFO A;  5ILS A;  3HSE A;  3KFW X;  2HYG D;  1FYM A;  2L4M A;  1F1Z A;  1Z9C A;  1YG2 A;  4BHC A;  1LDD A;  3K69 A;  3V8L A;  3ULQ B;  3QP5 A;  3RI4 A;  1AOY A;  3CUQ B;  2K86 A;  4RAY A;  3WTU C;  1XGM A;  4KUM A;  1S8N A;  4HDU A;  1G3T A;  3P9K A;  2L4A A;  2V1X A;  3LAP A;  5TRD A;  3NRV A;  4ASN A;  2XAJ A;  1ZRF A;  1XSD A;  5DEQ A;  5H20 A;  3GO5 A;  1B9N A;  4Y15 A;  2EK5 A;  3LWF A;  1O7F A;  3MWM A;  4GXO A;  4M72 A;  4G94 A;  4HLX A;  2G7U A;  2K02 A;  1J0R A;  2Y0M A;  5DUI A;  1TW3 A;  4ENJ A;  5LBQ A;  1G6N A;  2COM A;  2DI3 A;  1HSJ A;  3MQ0 A;  3ZP5 A;  2P5K A;  2K7L A;  3C7J A;  1SD6 A;  4S05 A;  3CUQ C;  1WQ2 A;  2XRO A;  3QPT A;  4P9F A;  3EYI A;  2XHK A;  3I53 A;  4IRG A;  4U88 A;  2DPD A;  3NEU A;  2MH2 A;  4JK1 X;  4L9V A;  2IJL A;  2XVC A;  3HHG A;  3MCZ A;  3JTH A;  2BV6 A;  2F5F A;  2FRH A;  5LEJ A;  3G3Z A;  2K27 A;  2TDX A;  2MLK A;  2VON A;  3N97 A;  3HHH A;  3ZPL A;  1D8J A;  1FPQ A;  3OV8 A;  3BY6 A;  5ILU A;  2ESH A;  1F4K A;  3DFG A;  1P2F A;  3E5X A;  1FZP B;  1BJA A;  5L3E A;  2CO5 A;  1IXR C;  1YS6 A;  4G8X A;  1KQ9 A;  1KGS A;  3BPX A;  2QLZ A;  4QLC U;  2ZME C;  4OOI A;  2QBY A;  1FSE A;  4EJT A;  3G73 A;  2XRN A;  3JSO A;  4PGH A;  4JQF A;  2YPR A;  2R7F A;  1ULY A;  1YLF A;  3RJP A;  2P7V B;  4A5N A;  4PCQ A;  4I0A A;  3LA3 A;  3VOE A;  1Q1H A;  4U0W A;  3V4G A;  2Q2E A;  1XGN A;  2FU4 A;  2PJP A;  3E5U A;  3CO7 C;  1B6A A;  3FMS A;  2DFI A;  3OOP A;  3T1B A;  1CF7 A;  1K78 A;  2STT A;  1U6G A;  4WX9 A;  5CYV A;  4EJU A;  1R1U A;  5HS9 A;  4XBF A;  2H09 A;  1X3U A;  2GAU A;  3CDH A;  3C18 A;  3JSP A;  1T0F A;  2PQ8 A;  4N0B A;  3CUO A;  2WTE A;  2XAG A;  5AIP A;  1QO0 D;  4I01 A;  3CTA A;  1UCR A;  3DEU A;  2A6E F;  4BHP A;  2BGC A;  5DCF A;  5FFX A;  1KU9 A;  2ZBK A;  3FX3 A;  3Q9S A;  4IHS A;  1IF1 A;  3F8B A;  4AVP A;  5D8K B;  3VB2 A;  1HST A;  1PP8 F;  4R8H A;  1RZ4 A;  1I27 A;  3ERE D;  2NNY A;  4I98 B;  1YS7 A;  2ZO4 A;  5E8G A;  2IT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...