1XB4A

Crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
180
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
publication title Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 180
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xb4A02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1xb4A01
2YSRA 4KT5C 4ENJA 1ODDA 4L0YB 2V1UA 4YFXF 4UVAA 3MFKA 2COMA 3ZMVA 5DD4A 1MGTA 4O5VA 1JGSA 4M6YA 3COAC 2WTEA 2M1BA 2VBZA 2ZMEC 1ZHFA 4ENKA 3ELKA 4I98B 3GFIA 4HW0A 3HHHA 2HTSA 1TTYA 3CJNA 1G3SA 4EJUA 3KEOA 5CYVA 1KU2A 4XRFA 3KP3A 4I0AA 1J9IA 2LF7A 1R5HA 4RS8A 1IN6A 1B9NA 2EFQA 2H6CA 1SD5A 2QQAA 2CQKA 4Y17A 1WSUA 2A6EF 2QYOA 4IRHA 3GLXA 3MCZA 3SFZA 2GIVA 4ZZLA 1TBXA 1BIBA 3C1DA 3ABUA 3LSTA 3F72A 2LSOA 2OA4A 1LDDA 1K78A 4LG0A 3J81Z 3V7RA 1O3SA 2DO7A 4MHGA 5D6FA 2VE9A 2V6CA 5LRRA 1MJ9A 3BPVA 4PZJA 3PFIA 2F5DA 4L9VA 3WU1B 4LLNA 2FEZA 1U6GA 4UVBA 4EGYA 3GZ5A 1TLHB 1SD7A 3TDUC 3RI4A 2DQRA 5ICEA 4YIFA 2QVOA 3LWFA 4M9ZA 5J8FA 4H0EA 1SD4A 4S05A 5E17F 2EA4A 4RB2C 2L4AA 2VBWA 1BJAA 4EGZA 4MEXF 1XGOA 2ZBKA 1OYWA 3GX4X 3M1EA 1HKQA 3RKYA 4BQAA 1CGPA 3KLNA 3ZMSA 4JK1X 2K4JA 3V4GA 3IRRA 5IT9K 2VBYA 3K1MA 3ISPA 3D5LA 1ZN2A 1YTYA 4TV7A 2CO5A 5H6QA 4IHTA 3K69A 1HSTA 1ONVA 4LMYA 3ZMTA 5D5WB 2A69F 2WC2A 3K9TA 4L9NA 1P92A 3I64A 1KU9A 2V1DA 4EM0B 3GUDA 2FBHA 3LAJA 2UZKA 1XSXA 4LJZF 3K1NA 3E5QA 2D1HA 5KVRA 1GVJA 3FZVA 1CF7A 1USTA 3WTWC 2RV8A 1SFUA 1QZZA 1MZBA 3GFMA 1S8NA 4MQVA 3I58A 4U0YA 5BS6A 2PMHA 2PBIA 2CWEA 2HS5A 4L18B 4NQWA 3WE2A 3KCCA 3LFKA 2EV0A 2W84A 3F8CA 4UV8A 1F5TA 4CHUA 2EV6A 1ZGAA 2J5OA 3U1DA 1SAXA 5CJ9A 2ZO4A 4I01A 2OU2A 1SD6A 1U78A 4RGSA 5J6XA 4KICA 4KN7X 3BROA 3TOBA 1P4AA 3QP5A 4P9UA 3P9CA 2IPQX 2FNPA 5FGMA 4MNUA 3IHUA 3R0JA 3WTUC 3HSRA 4HQMA 3F8FA 1A04A 1YS6A 4KA4A 3F8NA 2CFXA 4L5IA 3DPTA 1O57A 1JE8A 1STZA 1WWXA 5K1YA 1YW8A 2FQ3A 2HGCA 4RAYA 4ENMA 3KFWX 5D8KB 4CGZA 3O2PE 1IN8A 2LDUA 3L2CA 1YW7A 2IW5A 3SZTA 1USSA 3RDIA 2XKOA 4PGHA 2FNAA 5DYMA 2KIMA 1R58A 3GF2A 2STWA 1U5TB 1GHCA 2JRTA 5CVJA 2JPCA 2ZXJA 1LVAA 2K27A 2ZCWA 5DCFA 4GO1A 2QBYA 4YFKF 3G73A 3HSFA 3KP6A 1FBUA 4M73A 4YG2F 5FB2A 4BHBA 3WGHA 2A07F 4HQEA 1RNLA 2Z5UA 2QZ8A 4WX9A 5DUIA 3VB2A 2H6BA 2Y75A 4IRGA 2OBPA 1GXPA 3R60A 3HTSB 4P9FA 2EV5A 2GXGA 4ZZDA 2XVCA 2A5YB 3O6BB 4OOIA 3ZQ7A 3CDHA 1R23A 4RGRA 2XV4S 4EMSA 1ZAOA 5ERIA 1G3TA 1Z1DA 4KDPA 5DV5A 1IRGA 4PCQA 4YIIA 2Q8KA 1T98A 3M8EA 1V4RA 3RIRA 5HS9A 1IXSB 2OQRA 4A2UA 4K2EA 3CUQB 1ZLKA 1BC8C 4EVIA 1U8RA 2X4HA 1ZARA 4G94A 1SFXA 3RPUA 2O8XA 2ZMEA 2VC0A 1TQPA 4CO8A 3KE2A 4A6DA 2QQ9A 2HTJA 1JXSA 2O3FA 2IT0A 5FFZA 1FZPB 2UXXA 1ZYRF 1EH6A 4KFCA 1OYIA 2DPUA 3FMRA 2CG4A 3GW2A 1DUXC 1HXDA 4HOBA 1KGSA 1KYZA 2FRHA 5A2QK 1UHMA 1B6AA 5DD8A 3WGIA 1ZH5A 1KU7A 2FF4A 1FSHA 3F6OA 2DK8A 2LNBA 3WODF 3K0LA 2H27A 5LGUA 1UCRA 1FYMA 5K5QA 3PQJA 2NRAC 1IZ1A 4WF2A 5F1RA 2F5EA 4A0ZA 1XN7A 5BPDA 4OIOF 1E17A 2H94A 1YIOA 1ZRCA 5ICGA 3IL2A 2STTA 3GO5A 4R1HA 2M87A 4LB5A 4ESFA 5JI6A 2EB7A 1I27A 3R4KA 4IJAA 3WG9A 5JFRA 2PLYA 1D8JA 4B09A 2XAQA 3EYYA 4JQFA 2M30A 2RDPA 3LQQA 3T1BA 3R61A 2A68F 2ADUA 3U9GA 4CICA 2P6TA 4I0BA 3VEPA 4OIQF 1EH7A 1UHWA 3KP7A 5BPIA 3MQ0A 1FBQA 2YU3A 2ESHA 1BC7C 3ABTA 1UFMA 1B4AA 1R00A 3V8KA 4GYIA 4XBFA 3N97A 4N0BA 4GGGA 4OMZA 3E97A 3OV8A 3Q9VA 1MDMB 2LF8A 1HQCA 3LA7A 1RZ4A 4HF1A 1FNNA 2NAZA 3GZ6A 3JTGA 1S29A 3HOTA 1QBJA 5LGTA 2GWRA 2VT2A 3WGGA 1O7LA 4HF0A 2HOEA 1W7PB 2VOPA 2M45A 1HKSA 1EV7A 2YX4A 1E2XA 3CLOA 4DQ2A 3NEUA 5LLQA 5LEJA 2KIFA 2GA2A 3VOEA 3EETA 5CVIA 2EK5A 2BYVE 4OINF 3VFZA 4KUMA 3GWZA 3J80K 1R1UA 1KYWA 2ISYA 1XCVA 2HYGD 4BNCA 5L3BA 5E18F 4FT8A 3ZMUA 4KIGA 4M9XA 3I53A 2PQ8A 3WTTC 4KIBA 2VOOA 1FWZA 2V79A 3DXJF 5HLGA 3R6SA 2MLKA 5L3CA 3B73A 3E6BA 1GXQA 3BOQA 2FBIA 3BJOA 4P5OA 3L9FA 1YQAA 2IRFG 4UXNA 1O7FA 5J8CA 5E8GA 4HV6A 2M8EA 3F8MA 4IVNA 2JT1A 1T2KA 1QQIA 1J7KA 4G6DA 2F2EA 2BV6A 1FOKA 1FLIA 1R5GA 1ZRDA 3BPXA 3FHZA 2Z33A 1XGNA 3F23A 4F7ZA 1H9TA 2XGXA 3MEXA 5ICCA 1H0MA 2Z99A 1BI2A 1J59A 3F6VA 3T0YA 2L01A 2VXZA 3C3WA 3KP2A 1TW2A 1O3TA 2XRNA 4XLPF 3EUHA 3EQLF 3V7SA 3TOAA 2DTRA 4KIFA 2NS0A 5D6EA 2XIGA 3TDZC 5EEGA 2Q0OA 1D8KA 4BH9A 3ZMDA 1D3YA 3QU3A 1REPC 3IKTA 2F5CA 4FX4A 2WWYA 4MGRA 1B59A 4WWCA 3L7WA 5DDGA 1FX7A 1JHHA 5IT9Z 4LLGF 1I1GA 2R3SA 4HYEA 4RB1A 2A61A 1O3QA 1YW9A 3EDPA 5D8LB 3LAPA 2HDCA 1BM9A 3E3VA 4KN4X 4BHPA 1YO5C 4L5JA 1MJBA 5FD6A 3HIFA 2H09A 2OZ6A 1IXCA 2RC4A 4PDKA 2KKOA 4O3MA 4WXDA 5E1ZB 4EM1A 4O6JA 1FP2A 2OD5A 4UNOA 1ON1A 2PEXA 5HDGA 3U2RA 1G3WA 3HTUA 4PGGA 2W85A 3WTVC 2HR3A 1FPQA 1G3YA 3MZHA 1R1TA 1TW3A 1U5TC 2YX7A 4BHCA 5F6FA 3REOA 2V9VA 3I5UA 5AONA 1IN5A 2FSWA 2XHKA 5CVUA 1B1BA 5HOOA 5TJJA 2L4MA 4ZYDA 1LEBA 2VT3A 1DPUA 3CUOA 3Q9SA 1C0WA 3DQVC 3GFLA 2XAJA 2PFBA 4HBLA 3RJPA 4MEYF 3E5XA 2P5KA 3TGNA 1EH8A 2HQNA 2EFNA 3BWGA 2TDXA 4N9HA 1I5ZA 5D5VB 3H3ZA 4HV5A 3GEZA 4ON0A 4AIKA 2D2WA 1OKRA 1BN5A 1LJ9A 4KNYA 2P5VA 4LK1F 1T38A 2QM3A 4EJOA 1JHFA 2K02A 1KQ8A 1YG2A 3M9AA 4QWQA 4CDGA 5DEQA 3RKWA 3WTYC 1G4DA 3IC7A 3HSEA 3V8LA 5K5RA 1OR7A 4FX0A 1MKMA 1K78B 2OAZA 2PJPA 4LG0B 1WI9A 2P4WA 3CUQC 3I59B 4M6XA 2XAFA 4EJWA 1QZYA 2EFPA 4HAMA 3F3XA 2JTVA 1XMKA 3ECOA 4Q48A 1IN7A 1KQ0A 4UUVA 2O6GE 4EJVA 3WE3A 3QRFF 3P9KA 4IHSA 2VC1A 1TQIA 2FXAA 4MQ9F 4BXUA 2ELHA 1Y0UA 3E5UA 4E70A 5FFXA 4HZFA 2QENA 2VONA 2HKXA 4I2OA 1Z7UA 1T0FA 2XKPA 2HQRA 4M71A 5FO5A 2O0YA 3JAMK 5LHHA 4OMYA 5D4SA 3BDDA 3QAHA 5JR3A 2MC3A 2CYYA 4RGXA 4ETSA 3Q5FA 3KP4A 1FY7A 3IWZA 5JVTA 4A0YA 1S3JA 5DCMB 3P7NA 4IRIA 4U7BA 3TQNA 2VODA 1I6XA 1Z6RA 3IWFA 3JTHA 2PMUA 2IA2A 5L3FA 1TNSA 1SFEA 1CF7B 2EJRA 1P2FA 1WKMA 2E1CA 4XSZF 1RUOA 1P6RA 5L3EA 1MD0A 3KLOA 1FYLA 1W5TA 2ZNZA 3HRSA 3QU6A 5A2QZ 3K2ZA 2ACJA 3E6CC 4HDUA 2VE8A 2DW4A 3FX3A 2P6SA 5KK1A 3V7CA 4Y13A 2XAGA 1FSEA 4ENNA 5HVQC 2JPBA 1BOAA 2JZYA 5ED4A 1R7JA 3KEQA 3CO7C 4Q4ZF 4GCVA 4EJTA 4ESBA 4M72A 3DFGA 4LB6B 1XDUA 1YLFA 5E1XA 2Q2EA 4A12A 1S7AA 2EA2A 3JSPA 6PAXA 3KZYA 2DLLA 4UVCA 4CZZA 4UHTA 3SHFA 3WTSC 1RIOH 1F9NA 2E7WA 4LD5A 3N4MA 3DPLC 3RPQA 4A6EA 1X3UA 2R7FA 1R36A 3OOPA 3TO6A 3HRUA 4Z2YA 1R22A 4AIJA 3JSOA 2V1XA 3PQKA 5AIQA 3GYHX 3NQOA 3TO9A 2J5PA 1LB2A 2PG4A 5H6RA 1XCBA 2RNJA 4XLNF 1SMTA 1IN4A 2AXLA 4LK0F 2FU4A 1K79A 4Y15A 4MTEA 3NRVA 2C6YA 2EWNA 2UXNA 2L3DA 1J75A 4ZYHA 4IPAA 5HS7A 2O03A 4L0ZB 2ZFWA 5F64A 4G9YA 4EV0A 5D4RA 3FXQA 5BQTA 3F22A 2QBYB 4RB0A 1AWCA 3HOSA 2P8TA 4ASNA 3KETA 2VN2A 2HFHA 1PDNC 2GA1A 4D0PA 5CVVA 4U7DA 4AD9A 1NHAA 4IXAA 3HRTA 2O61A 4P96A 1QGPA 2K7LA 1OPCA 1DPRA 2QWWA 4KMUX 2DK5A 3ZN0A 1BI3A 1KA8A 3R0AA 4A5NA 1FBSA 2QUFA 3V8JA 1ON2A 5LEKA 3J81K 2G9WA 2D45A 3DP7A 4LGWA 3I4PA 5D5XB 4ZH4F 1U5TA 4WK8F 3M7GA 1ULYA 3ROUA 1UB9A 2ESNA 1XSVA 2G7HA 3I59A 3J80Z 2BGCA 2RGVA 2KIUA 2Z9OA 2K4BA 2MA3A 2ZMEB 2DFIA 4RGUA 5ILVA 2XASA 3FXRA 3TKYA 4WXHA 2FE3A 1XSDA 5HDNA 2DU9A 1HBXG 2DBBA 5L3DA 4WXCA 3C7JA 3QPHA 4B8XA 1B9MA 4YFNF 2MH2A 3P9IA 1XDSA 2NNNA 2QQBA 4QLCU 3TO7A 2HKOA 3T8RA 1P4XA 2IA0A 4L9JA 2Y48A 2IA1A 1Z6TA 3RYPA 3T5XA 1W7PD 4AWXB 1RUNA 3BJ6A 4EM2A 3QP6A 4I02A 2L54A 3D0SA 2D1VA 3GFJA 3S2WA 4HF2A 1ZG5A 1R1VA 2EFWA 3CUQA 3ML6A 1PUEE 2EFOA 3I0TA 1ZRFA 2IJLA 2XROA 3C18A 1FC3A 4BAYA 2FA5A 1PP7U 1S6LA 1BI0A 1DP7P 1XMAA 1IUYA 4I09A 2RKHA 1K6OA 2PI0A 4XSXF 3W6JB 1J5YA 1VTNC 5LHGA 2OZUA 3CO6C 4RAZA 5DCMA 5LGNA 1HSJA 3ERED 4U88A 4HA8A 1G6NA 2B0LA 5ICFA 1LDKB 3FXUA 1HKTA 1ZGJA 2BEOA 4ZYGA 2YR2A 2MBFA 2ZNYA 5E1WA 4WCGA 2GQQA 1YS7A 4NHJA 4FHTA 5BOXA 2E1NA 4G7ZF 1BBYA 3LQRA 4DNCA 1OMIA 2A3SA 1RI7A 3RYRA 2W24A 1W4MA 4BYYA 4HLYA 2DPDA 1F1ZA 3IRQA 3FWEA 3DF8A 4OIPF 4JBAA 3AAFA 4U0VA 3WTZA 1QO0D 3I54A 1J0RA 5H20A 2HZTA 3BY6A 3QPTA 1AOYA 3E6DA 1IXRC 2IVMA 3H3UA 2Z3YA 1XD7A 4HDVA 3T8TA 3ZPLA 3FM5A 3FF5A 2AS5F 4G7OF 2LKPA 1PP8F 3VODA 2BBYA 1F4KA 3HHGA 2KJBA 5CLSA 2WV0A 4ZYEA 4I7HA 3ZN1A 5BMZA 3K1PA 4AIHA 1P4WA 2DAOA 4P55A 2KJCA 3IKVA 1WQ2A 2FOKA 3ULQB 4NB5A 4OIRF 4N9IA 1SMYF 1V3FA 2DI3A 4R8HA 3FM3A 1QPMA 2W57A 2CSOA 4LLLA 5E8IA 2E7XA 2PN6A 5ILSA 2HWVA 2IP2A 3WTXC 4M9SA 1HW5A 3DKWA 1O3RA 4R79A 2XUBA 5L3GA 1J2XA 1MDMA 3G3ZA 5E20A 4G7HF 1K7AA 2Y0MA 1LEAA 1MJAA 1HW1A 3CTAA 4CXFA 2FBKA 2XAHA 4ESJA 1IF1A 2R7DA 4M74A 4U0WA 5CVRA 3F21A 2P7VB 3W6KB 5AIPA 4CYDA 1U2WA 3JW4A 3L00A 4L9TA 3L09A 1W7PA 3MAJA 5FD5A 1T6SA 4KMFA 2G7UA 5TRDA 1WRJA 2RQPA 1Z91A 3LA3A 1TQMA 2ISZA 1YFHA 4OU0A 2CW0F 5HLIA 1XGSA 2RN7A 1ZREA 3BZ6A 1U3EM 4HX4A 3HRMA 1FYKA 2ZKZA 2MD5A 2ZJ2A 3GXOA 1S7OA 4A0XA 4LFUA 2K86A 1BIAA 3MZYA 1ZLJA 2HYFA 3I71A 2VBXA 1LQ1A 1BI1A 1IAWA 1HW2A 2GAUA 3JAMZ 3BJAA 5K5OA 4MTDA 2OQGA 2W25A 4GXOA 2DT5A 2GZWA 3WU0A 3LA2A 1D5VA 1FT9A 4G6QA 2DQLA 3ECHA 1H9GA 1LDJA 2JSCA 3O3KA 5HDKA 1IRFA 4HLXA 3SZPA 1W5SA 5D5UB 4AVPA 2F5FA 5LHIA 5ILUA 3J7AO 3ZP5A 3KZZA 4Q5SF 4IF4A 2HEOA 1KQ9A 5DUKA 5HS8A 3QOPA 3FMSA 2NNYA 3SQNA 4Q47A 1OYYA 2GXBA 2L02A 2NYXA 1XB4A 5EEHA 1LNWA 5LBQA 1Z05A 1ZG3A 1QNTA 2M5WA 1KU3A 3ZMZA 3DV8A 1TNTA 4EQQA 2RVCA 3FMQA 5IT3A 1YYVA 3KP5A 2X0LA 2P7CB 3EYIA 1L0OC 2BE5F 1I1SA 3BP8A 1Q1HA 2A6HF 5FLXK 3F8BA 1L3LA 2CGPA 4S04A 3RTRA 2MLGA 4A5MA 4KYWA 2FMYA 2P5LC 1Z9CA 4HX8A 3B02A 3H92A 2QLZA 2MH9A 3HUGA 2YPRA 1T39A 3M8FA 4HX7A 2FMLA 3RKXA 1ZG1A 3DEUA 5FLXZ 2ETHA 4G8XA 4RB3C 1IW7F 3MWMA 5JHUA 2UWMA 4UV9A 1DDNA 3E6MA 1XGMA 3HYIA 4GYGA 3SXYA 5LRSA 5HLHA 3GVAA 1FP1D 2KRFA
chains in the Genus database with same CATH superfamily
4C9YA 2YSRA 3DEWA 1YJWI 1JGGA 1Y0NA 3FDYA 1VQ8I 4A3CJ 4KT5C 4ENJA 1ODDA 4L0YB 2V1UA 4YFXF 4UVAA 1X2MA 1VQLI 3MFKA 3H1CA 2Q1ZB 2COMA 1HDDC 3ZMVA 5DD4A 4CCNA 1WJFA 1MGTA 4O5VA 3TP3A 1JGSA 2ZMEC 4M6YA 2WTEA 2M1BA 2VBZA 3U1KA 2YUSA 1ZHFA 4D1QA 3JRCA 4ENKA 2DDBA 3SEQA 3OY9A 4C3IJ 3ELKA 4I98B 3GFIA 4HW0A 3HHHA 2XPUA 2BY0A 2E1OA 3W2VA 1RR8C 3VDXA 2MD0A 1FOYA 2M34A 2HTSA 1TTYA 3CJNA 5EGOB 1G3SA 2W48A 4EJUA 3HXLA 3KEOA 4QIWN 5CYVA 2UV1A 1KU2A 5FKLA 2V9KA 4XRFA 3KP3A 3JRGA 4I0AA 2P81A 1J9IA 2LF7A 1R5HA 3K4LA 1TC3C 1E3HA 1OLTA 1LVKA 3PJRA 4RS8A 1IN6A 1B9NA 2EFQA 2ME6A 3S8PA 4BKXA 1IO2A 2H6CA 1SD5A 5F08A 2QQAA 4JP0A 2R5YA 2CQKA 4Y17A 1K4SA 3S16J 1WSUA 2A6EF 2QYOA 2DA5A 4IRHA 3GLXA 3MCZA 3SFZA 2GIVA 4FCYA 2Y0SA 2VKVA 4ZZLA 4QTRA 1TBXA 2OCEA 3ZQGA 1BIBA 3C1DA 3ABUA 1X19A 1IRXA 1ENHA 2QCOA 2H8WA 3LSTA 1AKHA 3F72A 2LSOA 1Z67A 2OA4A 3MZ8A 1LDDA 2V4JC 1K78A 4XLFA 2VB6A 1FMWA 1DU6A 4LG0A 2L5QA 1RR7A 4YRVA 3J81Z 3V7RA 4BU2A 3GCMA 3FKJA 1Q1VA 1RPWA 1O3SA 2DO7A 2E2JJ 5F1JA 4MHGA 4OAYA 5D6FA 4XORA 2VE9A 3ZRGA 3BTCA 1JKQC 2B63J 2V6CA 3K4CA 5LRRA 1VQKI 1MJ9A 4DGWB 3PNVA 2HOTA 1RKTA 3PNYA 2L7ZA 1WHUA 3C2HA 3CMEI 2DDAA 3BPVA 4PZJA 3PFIA 3KZIC 4HRIA 2QKLB 2F5DA 4D7NA 1U0JA 4L9VA 3WU1B 1W36C 4LLNA 3GTGJ 2FEZA 3GBGA 1U6GA 4OAZA 3B6CA 4UVBA 3S1RJ 3ABKH 4EGYA 3GZ5A 1TLHB 1LE8A 1A6QA 1FMVA 2DT7B 1SD7A 3IUOA 3WHCA 3TDUC 4BBRJ 3RI4A 2DQRA 1BL0A 5ICEA 1MSFC 2CV1A 1QHGA 4YIFA 3S15J 2QVOA 3LWFA 4M9ZA 1JT6A 5J8FA 4H0EA 3H5AA 1SD4A 3HOZJ 2WAFA 3LSJA 3CC4I 3BR0A 2E5NA 4S05A 1N75A 4QPQA 2VPLA 1TZLA 5E17F 2EA4A 4JYKA 4RB2C 3MKWB 3MMYB 1BOBA 1SAUA 2L4AA 3QODA 2VBWA 3NWTA 1BJAA 4EGZA 2Y9YA 4MEXF 1XGOA 2HYJA 4XQFA 2ZBKA 4XLHA 1OYWA 1VZ0A 2QSHX 3GX4X 3M1EA 1OISA 1HKQA 2F6CA 3RKYA 4BQAA 4E7KA 1CGPA 3KLNA 3ZMSA 1ETKA 2WAQN 2DCEA 1ZTRA 4JK1X 2K4JA 3G1LA 3FXKA 3CJQB 3GMEA 3V4GA 5GADJ 3IRRA 5IT9K 2KT0A 2VBYA 3SDGA 2ELJA 3K1MA 3ISPA 2IS6A 3D5LA 5EZGA 2HVQA 1ZN2A 1YTYA 4TV7A 2PJRA 2CO5A 4FISA 5H6QA 2DMQA 4F92B 2LMDA 4IHTA 4I76A 3K69A 1D0YA 3K4BA 1HSTA 1ONVA 4LMYA 3ZMTA 5D5WB 2A69F 2WC2A 3HBLA 3K9TA 4L9NA 2R5ZB 5GTHC 1P92A 3I64A 1KU9A 3K10A 2CFOA 2V1DA 3BG9A 4EM0B 3GUDA 2FBHA 3VYUB 3LAJA 4CA0A 2UZKA 2GM4A 2X6XA 1TT5B 4PFPA 2DFFA 1XSXA 4D5FA 2Q2EB 4BBSJ 4LJZF 3K1NA 3ZQIA 1XX5A 3E5QA 3CD6I 1S7EA 4J01A 3CZ6A 2D1HA 5KVRA 1U8BA 1GVJA 3FZVA 2K9QA 1CF7A 1USTA 3WTWC 1ETQA 1Y39A 2VKEA 3AG1H 3JR9A 2RV8A 1SFUA 1LFBA 2ZSHB 3BLYA 1QZZA 3DCFA 1MZBA 3GFMA 2HNHA 2VQHA 1S8NA 3H9QA 2WB1A 4MQVA 2QKMB 2HZDA 3I58A 4U0YA 5BS6A 2PMHA 2PBIA 2CWEA 2HS5A 2HXIA 2BZTA 2LYCA 2EILH 2MW8A 2VL8A 3IH2A 2DA6A 4L18B 2NVYJ 3CDLA 4NQWA 3PUFA 3WE2A 3KCCA 3LFKA 2EV0A 5E3MA 2WB1N 2W84A 2NS8A 1MBKA 3F8CA 1TL8A 3PM1A 1D1AA 4UV8A 1F5TA 4CHUA 2EV6A 1UAAA 5J1YA 1ZGAA 2J5OA 3U1DA 4IKFA 3H3VK 2CV0A 1SAXA 4GDFA 5CJ9A 3CCVI 2ZO4A 4I01A 1PVEA 3KYCB 4BE0A 1R9TJ 3BCAA 2OU2A 1SD6A 1U78A 2R4GA 4BE2A 4RGSA 2HDDA 5J6XA 1XPXA 4A3JJ 1LFPA 4KICA 2LRDA 1MSEC 4KN7X 3BROA 3TOBA 4PJLA 1P4AA 4IQ4A 3QP5A 3I4NJ 2W7NA 4P9UA 2KMUA 1UG0A 3P9CA 2IPQX 5B66C 2FNPA 5FGMA 3PNTA 5GP9A 1S72I 3OIQA 4MNUA 2VJJA 3IHUA 3R0JA 2M3AA 3HSRA 4HQMA 3WTUC 3TMOA 1JKOC 3F8FA 4C2TA 3M4OJ 4FETA 4M3FA 1WJBA 1A04A 1YS6A 4KA4A 3F8NA 2CFXA 4LOCA 3CCUI 2IS2A 4L5IA 4P1WA 2DOAA 2E36A 1E0EA 2IAIA 2L9NA 3DPTA 3OOUA 4XONA 4PSWA 1PUFA 3LMMA 1O57A 1JE8A 1STZA 4HNTA 3A1YA 2FUG2 1WWXA 5K1YA 1YW8A 3QPLA 2FQ3A 2HGCA 1ITYA 4RAYA 3HC7A 4N4NB 4ENMA 3KFWX 2BY2A 5D8KB 4CGZA 3LOCA 3O2PE 4XN3A 1IN8A 3EUHC 4CYCB 4UUSB 3B6AA 1DU0A 2LDUA 3L2CA 1YW7A 4FASD 3JRBA 2IW5A 3SZTA 1USSA 3RDIA 2W00A 2XKOA 3QYFA 4PGHA 2FNAA 3AL0C 5DYMA 2KIMA 1R58A 3GF2A 1NG7A 1Y1WJ 2STWA 4AIDA 1U5TB 1GHCA 2JRTA 5CVJA 2JPCA 2FD5A 4DZPA 2ZXJA 3M1CA 1LVAA 2K27A 4X6AJ 4UUTA 3DLAA 2ZCWA 5DCFA 1B72A 1VQNI 4GO1A 1M1EB 4JX5A 4B1RA 2ZXIA 3W2WA 2LKXA 2QBYA 4YFKF 3OWTA 3G73A 5C4JJ 3O8HA 3HSFA 3KP6A 4E7SA 1FBUA 4M73A 4YG2F 5FB2A 4XKBA 5EGOA 4BHBA 4XM3A 1K83J 1FJLA 3WGHA 2A07F 4HQEA 3DWLE 1RNLA 4KITB 4N4OB 2Z5UA 2QZ8A 3ZQHA 5DUIA 4WX9A 3VB2A 2VPRA 3G6EI 2H6BA 2OV7A 4RAFA 2Y75A 4IRGA 3S3MA 2OBPA 2R7OA 2DXIA 1GXPA 3R60A 3HTSB 4P9FA 2EV5A 2GXGA 4ZZDA 1MW7A 2XVCA 2A5YB 3O6BB 4OOIA 5FLMJ 1R6RA 3CDHA 3ZQ7A 1R23A 1AU7A 4OWRB 1U9OA 5EG0A 4RGRA 2XV4S 4EMSA 1ZAOA 3W6VA 1FEXA 1BW6A 5ERIA 3K2AA 3GTOJ 2PMZA 4MLOA 1G3TA 1Z1DA 2QSGX 4KDPA 5DV5A 1IRGA 1NH3A 1TWCJ 4PCQA 5FJ8J 3BTIA 3COAC 3LSIA 2YU9J 4YIIA 2Y9ZA 1K61A 2Q8KA 1N77A 1T98A 3IAS2 2R7WA 4A3GJ 3M8EA 1YI2I 2EQRA 1V4RA 3RIRA 5HS9A 1IDYA 3OYIA 1IXSB 2OQRA 4A2UA 3PSIA 4K2EA 3CUQB 1ZK8A 1ZLKA 1BC8C 4EVIA 5C3EJ 2ECBA 1U8RA 2X4HA 4ZJZA 1ZARA 4G94A 1SFXA 3OYGA 3RPUA 2O8XA 2ZMEA 5J47A 2VC0A 2KIQA 1TQPA 4CO8A 3KE2A 4A6DA 2QQ9A 2HTJA 1JXSA 2O3FA 2IT0A 4M3DA 4YELA 2GBYA 5FFZA 2WADA 5J3LA 3ZOBA 3QQAA 1ETXA 4E7ZA 2LFBA 4C2MJ 2LREA 4KJZA 1FZPB 2UXXA 4Y33A 1YRNA 4IHXA 1ZYRF 1EH6A 3DKXA 4KFCA 1OYIA 2DPUA 2KPMA 2HVRA 3FMRA 5H2FC 2R7UA 2CG4A 3GW2A 1DUXC 1HXDA 3K4NA 2M4GA 4HOBA 1KGSA 1KYZA 3OYLA 2FRHA 4E7JA 2DMUA 3ESWB 5A2QK 1UHMA 3KIOA 1B6AA 5DD8A 1SANA 3WGIA 2KZVA 1ZH5A 1KU7A 2FF4A 1FSHA 3F6OA 1IJWC 2DK8A 1TWGJ 2LNBA 3WODF 3K0LA 1ETWA 3I55I 2H27A 5LGUA 1UCRA 1FYMA 4A93J 3G1MA 2RAEA 3CF2A 5K5QA 2L7FP 3CP2A 3GLLA 3UKGA 3PQJA 2NRAC 3DBHB 1IZ1A 4WF2A 4LG3A 4AYBA 3ZGKA 2KLOA 5F1RA 2I8DA 5HODA 1A5JA 3CJRB 2F5EA 4A0ZA 2JA5J 3CCYA 5IYDJ 1XN7A 3AFHA 4HNVA 3QYBA 2R7SA 5BPDA 5GAHJ 9ANTA 4OIOF 3IAM2 4E7IA 1E17A 4LIUA 3S1MJ 1I3QJ 4BQOA 2H94A 1YJNI 2V9PA 1J09A 4XKCA 4NDLA 1YIOA 1R49A 4HPQA 1ZRCA 5ICGA 2EIMH 3QOEA 3IL2A 1JI8A 2STTA 2ZXWH 3GO5A 3CESA 4R1HA 2M87A 2ICWG 4LB5A 2QSFX 4ESFA 3FXOA 5JI6A 2M7BA 3M07A 2EB7A 1I27A 1MH4A 3R4KA 4E4HA 4BACA 4IJAA 1ZR2A 1MNDA 3D5RC 2ZJPF 2XGEA 3W2AA 1ZGWA 1MNEA 3WG9A 3H5NA 2KL4A 3BR2A 5JFRA 2PLYA 1H8AC 2XF5A 1D8JA 2AXTC 4B09A 3PFYA 4C3JJ 2XAQA 5TISC 3EYYA 4LIVA 4JQFA 1JKRC 2K85A 2M30A 2RDPA 2DMNA 4II2A 2E35A 3LQQA 3T1BA 3R61A 3LSPA 2A68F 3I56I 2ADUA 2DT6A 3U9GA 4CICA 3A02A 3VPRA 2BW3B 2P6TA 3ZXSA 3KEYA 4I0BA 3LSHA 3VEPA 3CC7I 1EH7A 1UHWA 4OIQF 1T0FC 3KP7A 5E3OA 4UB8C 5BPIA 2V6EA 2OC6A 2OUMA 1OCPA 3RSNA 3S3OA 3MQ0A 5B5EC 1FBQA 1GVDA 1LFUP 1X1CA 2YU3A 4X0GA 1VI0A 2ESHA 1BC7C 3ABTA 2JQ7A 1UFMA 2FJ1A 2L0KA 1U9NA 2BY3A 3ASOH 1B4AA 1R00A 4XRMA 4M3GA 4XRSG 3V8KA 4GYIA 4XBFA 1R4MB 4A3KJ 1FOXA 3N97A 4N0BA 4GGGA 4OMZA 3E97A 3OR1C 1D1BA 2W1OA 3OV8A 3NARA 3Q9VA 3CF5F 2CV2A 5DTDA 1MDMB 2XC7A 5J1RA 1K6YA 2I10A 3HG9A 1EF4A 3LSGA 3M3YJ 1PJRA 2LF8A 4BGDA 1D1CA 4RAGA 2CUZA 1HQCA 3WU2C 1VNDA 3LA7A 4RMNA 1RZ4A 4HF1A 1FNNA 2NAZA 3GZ6A 2L9RA 3LSMA 3JTGA 3K70C 1S29A 3HOTA 1QBJA 5LGTA 2GWRA 2VT2A 3WGGA 1A6IA 1O7LA 4HF0A 3Q0WA 2K9NA 2HOEA 1W7PB 2X1CA 1VFCA 2VOPA 2M45A 1VQ6I 1HKSA 2ZFUA 3MKLA 2TRTA 1WFXA 1B8IB 4J19A 1WJAA 1EV7A 2YX4A 1E2XA 2IS4A 3CLOA 2LKSA 5EEAA 4DQ2A 2HPIA 3NEUA 5LLQA 2NOJB 5LEJA 3HOVJ 2LC2A 2KIFA 2GA2A 3VOEA 3OL3A 2QQ8A 2JA2A 3EETA 5CVIA 2MYSA 2LD5A 2EK5A 2E2HJ 2HVSA 2R7XA 5IYCJ 4BEHB 2BYVE 2ME0A 3TEDA 4OINF 3BTJA 3VFZA 4KUMA 3GZNB 3GWZA 3J80K 2XPVA 1R1UA 1Z21A 1KYWA 3WG7H 3JRDA 1F43A 2ISYA 5K7HA 2KRCA 3H36A 1XCVA 2HYGD 1IRZA 4BNCA 5L3BA 2VUMJ 5E18F 4B48A 3RQ4A 4FT8A 3SFIA 3ZMUA 4KIGA 4M9XA 3I53A 3H0DA 2PQ8A 4U87A 4KIBA 3WTTC 2VOOA 3DTIA 3FK7A 5KHDA 1FWZA 2V79A 4ITVA 3LNQA 3DXJF 4XNFA 5HLGA 3OL4A 1YOVB 3R6SA 1FIPA 2LLKA 2MLKA 3GTQJ 5L3CA 3B73A 3E6BA 1GXQA 3E1SA 1ZR4A 3PSFA 3BOQA 3JCUC 2LY9A 3BQYA 2DYSH 2FBIA 1TT0A 2KDZA 3BJOA 2GXAA 4P5OA 1IUFA 3GTPJ 1W1WE 3L9FA 2BXZA 1YQAA 2CQXA 2IRFG 4UXNA 1O7FA 5E8GA 5J8CA 4RA2A 3UNGC 5F0CA 4HV6A 2M8EA 2EIKH 3BR6A 3F8MA 2JT1A 4IVNA 1T2KA 1QQIA 1J7KA 1UJ8A 4G6DA 3G1OA 5B3SH 2F2EA 2BV6A 1FOKA 1FLIA 2KQRA 3SZGA 4F93B 5FRNA 1R5GA 2W4SA 3KPHA 1ZRDA 3BPXA 2WAQA 3A01A 5CQGA 1VQMI 3FHZA 2JK3A 1G59A 2Z33A 2L7KA 1NK3P 1BR4A 1XGNA 3F23A 3U21A 4F7ZA 1WCMJ 4BJ6C 2XGXA 4BUPA 3MEXA 1H9TA 5ICCA 1H0MA 4ZC3A 3E7LA 2Z99A 1BI2A 1J59A 3F6VA 3T0YA 2L01A 3CP8A 2VXZA 3C3WA 4HEA2 5HNHA 3BZCA 3KP2A 1TW2A 1W5CC 2OTJI 1O3TA 1GT0C 4PJJA 2XRNA 4CCMA 3EUHA 3EQLF 4XLPF 5M5WJ 3V7SA 3TOAA 1Z3YA 3HZJA 1Z0XA 2DTRA 4KIFA 4A3FJ 4RLQA 2NS0A 4C3HJ 5D6EA 2XIGA 4XLEA 3TDZC 5EEGA 2Q0OA 4Y4RA 3X2QH 1D8KA 1VQOI 4BH9A 1YITI 3ZMDA 1D3YA 3QU3A 5LD2C 1CQTA 1REPC 2CQNA 3IKTA 2F5CA 4FX4A 5IOZA 2WWYA 2ID3A 4MGRA 3VSKA 1B59A 4WWCA 3UR3C 3MD2A 4EEFG 3L7WA 4A69C 4CCLA 5DDGA 1FX7A 1JHHA 5IT9Z 4LLGF 1I1GA 3CMYA 3S32A 2R3SA 4HYEA 4RB1A 2A61A 1LUJB 1O3QA 3FXLA 2Z2SB 1YW9A 3PO3J 4PSXA 1T08B 3EDPA 4HG2A 5D8LB 3LAPA 5C4XJ 2X6YA 2HDCA 2HXOA 1BM9A 3E3VA 4KN4X 4BHPA 1YO5C 4L5JA 1MJBA 5FD6A 3HIFA 2FX0A 4EATA 4A3EJ 2H09A 4E6KG 2OZ6A 4RDUA 3HL2A 1IXCA 2RC4A 3DKYA 4II3A 4PDKA 5JHFA 5DM7F 2KKOA 3G4SI 2ELKA 4O3MA 3HUGB 4XICA 2XDVA 4WXDA 5E1ZB 1ETYA 4EM1A 4IX7A 4IHVA 4O6JA 3I4MJ 1FIAA 1FP2A 2OD5A 2X6OA 4B3XA 5C44J 1EKEA 4UNOA 1ON1A 2PEXA 5HDGA 3U2RA 3K70D 1G3WA 3HGYA 3HTUA 4PGGA 2W85A 3HPGA 3WTVC 2HR3A 4ABZA 1FPQA 3W3CA 1G3YA 3MZHA 2MG4A 5EZHA 1R1TA 2A6TA 3LSRA 1TW3A 1U5TC 2YX7A 4BHCA 4NUBA 5F6FA 3REOA 2V9VA 3I5UA 3TW6A 2LBFB 5AONA 1IN5A 5M3MJ 3L2VA 3S2DJ 3AG3H 3HDDA 2HPMA 2FSWA 4XOTA 2H1LA 4B47A 4ZTFA 2XHKA 5CVUA 3VWBA 4V2FA 1B1BA 3CCJI 3BT9A 5TJJA 5HOOA 5F27A 1MMGA 2L4MA 4XRSA 4ZYDA 1WZ2A 1LEBA 2BHZA 1APLC 3HOUJ 1MMDA 2VT3A 1DPUA 3CUOA 3Q9SA 1C0WA 2IXSA 1UZCA 2B7EA 3DQVC 3DU6A 3GFLA 2LOOA 2XAJA 2LY2A 2PFBA 4HBLA 3RJPA 4MEYF 3E5XA 1Y6IA 2P5KA 2VXDA 3TGNA 1EH8A 2HQNA 2EFNA 2JVGA 3BWGA 5FLVA 4PJMA 2TDXA 5BNGA 1MMNA 3VYSB 3OYKA 4N9HA 1I5ZA 5D5VB 3H3ZA 4HV5A 3GEZA 3PL8A 1MMSA 4CUGA 3AG2H 4ON0A 4AIKA 2D2WA 2MGQA 2VIXA 3NWSA 4DIQA 4DW6A 1I3AA 1OKRA 2HU9A 2ECCA 1BN5A 1HOMA 1LJ9A 2EIJH 4KNYA 2P5VA 4LK1F 2X1EA 2RNGA 3K4JA 1T38A 4IQJA 4AVZA 2QM3A 4EJOA 3G71I 1JHFA 2K02A 1KQ8A 1YG2A 4A3BJ 3G2BA 2F4IA 3OR2C 3M9AA 4QWQA 4CDGA 2EZLA 3GTMJ 3L1PA 1K4TA 5DEQA 3RKWA 4CCKA 3WTYC 2K3FA 1G4DA 3IC7A 3HSEA 3V8LA 4DYQA 5KNLA 5K5RA 2XPWA 1W0TA 1OR7A 1AKHB 5M5YJ 2H8RA 4FX0A 1MKMA 1K78B 2CW8A 4XIDA 2OAZA 2AQFA 3ONQA 2PJPA 4PJ0C 4LG0B 5J4YA 1MBHA 1WI9A 5DM6F 2P4WA 3J7ZI 3CUQC 1WPKA 4BDYA 3I59B 4M6XA 3CDIA 2XAFA 1MBEA 4DJAA 1P7JA 3HGGA 4EJWA 1QZYA 2EZKA 2BY1A 2NVUB 3FXMA 1IC8A 1KONA 1JUSA 1RKWA 2EFPA 4HAMA 3D1NI 1NG6A 3F3XA 2CRGA 1GV2A 1R5ID 3H0GJ 2JTVA 2Z16A 1XMKA 3ECOA 4Q48A 1A35A 1IN7A 1KQ0A 4DYCA 1V54H 2D5VA 4UUVA 1O4XA 2O6GE 4EJVA 3WE3A 3QRFF 1LE8B 1P9QC 4Z6YA 3P9KA 4IHSA 3RZDJ 2VC1A 1TQIA 2FXAA 3HKZN 4MQ9F 3K4MA 2KFDA 5K7ZA 2LVSA 2F4MB 2EZIA 4BXUA 2R7RA 3H9GA 2ELHA 3HPHA 4B4CA 1B8IA 1X4OA 4L5EA 1Y0UA 1D5YA 2X6WA 3E5UA 4E70A 5FFXA 4XR6A 3BG3A 2HQ5A 3E0JB 4HZFA 2QENA 2VONA 1OCCH 2HKXA 4H4KC 2LH9A 2O9LA 4I2OA 1Z7UA 1MH3A 3ZCOA 1T0FA 5J40A 2XKPA 2HQRA 3OYEA 2DA3A 5E3LA 4M71A 3Q0VA 5FO5A 3HOWJ 4I99C 5CKTA 3VYTB 5GPCA 2EINH 3RCOA 2O0YA 1V5GA 3JAMK 5LHHA 4OMYA 2XB0X 1QHHD 2EZHA 5D4SA 5GAGJ 1MNMC 3BDDA 3QAHA 5JR3A 4HNUA 2MC3A 1TP4A 2E60A 2PJRB 2DMPA 5TGTA 2CYYA 2RREA 5K7FA 2CU7A 1HLVA 4RGXA 4ETSA 3Q5FA 1YE9A 3KP4A 1FY7A 3IWZA 3BCBA 4NC6A 5JVTA 1QRYA 3NAUA 2CJJA 2DYRH 4A0YA 1S3JA 1FTZA 5DCMB 2EPFA 3P7NA 5IY5H 1JTYA 3CMAI 4IRIA 2KRHA 4U7BA 2E1MB 3A03A 3TQNA 2BHYA 4W1UA 2VODA 2Y2ZA 1I6XA 1Z6RA 3IWFA 1DGRM 2DA7A 4V2GA 3JTHA 3OIOA 2PMUA 2IA2A 5L3FA 1G2HA 1TNSA 1SFEA 1CF7B 1XMXA 3VYRB 2NOGA 1OCZH 2L2OA 2EJRA 3N05A 2JA7J 1P2FA 1AHDP 3TL4X 2XGCA 2X9DA 1WKMA 2E1CA 1H89C 4XSZF 2DA2A 4AC0A 1OR7C 1P6RA 3F9KA 1RUOA 5L3EA 3IH3A 1MD0A 1BA5A 2Y31A 3KLOA 1FYLA 3EUAA 1W5TA 4ANJA 2ZNZA 3HRSA 1POGA 2R7VA 1DP3A 3LFUA 3QU6A 4NQWB 5A2QZ 3K2ZA 3A0BC 3IH4A 3OYDA 3E6CC 2ACJA 1JUPA 4HDUA 1PYVA 2VE8A 2DW4A 3FX3A 2P6SA 3JRFA 5KK1A 2DODA 3V7CA 4Y13A 1R71A 2VASA 4F52A 2HQAA 2XAGA 3ZQFA 3MKZA 1SVMA 1FSEA 3FISA 4ENNA 5HVQC 2OTLI 2X1DA 1XTAA 2JPBA 2M0MA 2M2EA 1BOAA 2JZYA 2I5UA 5ED4A 2K9SA 1R7JA 3JRHA 4S0HB 3KEQA 2IEKA 3CO7C 3GTLJ 4Q4ZF 4GCVA 4EJTA 2R5ZA 4ESBA 2K9LA 3DBLB 4M72A 3DFGA 4B3AA 1V5FA 4LB6B 1FTTA 1XDUA 2HDWA 1BW5A 1OCOH 3FKIJ 3OYJA 1SC7A 1YLFA 2ID6A 5E1XA 2WAEA 2Q2EA 3OS2A 4A12A 1S7AA 2WA0A 2EA2A 3JSPA 4M3EA 2OF7A 6PAXA 4NBQA 3KZYA 5FKMA 2DLLA 4UVCA 1SVOA 1TWAJ 4FQGA 4XK4A 2VLAA 1DQUA 4CZZA 4UHTA 3SHFA 3WTSC 1RIOH 3RZOJ 1F9NA 3JREA 2E7WA 2ZJQF 3BQZA 4LD5A 3LL7A 1NK2P 3N4MA 3JRAA 3DPLC 1Y56A 3GTKJ 3RPQA 4A6EA 1X3UA 2R7FA 1R36A 1HCRA 3OOPA 3K6GA 3TO6A 3HRUA 4Z2YA 4BJ5C 1R22A 4AIJA 4M6VA 2F4OB 5M5XJ 3JSOA 4F91B 2V1XA 3PQKA 5AIQA 4ZDOA 3QPSA 1X4PA 4CCOA 3L2QA 1VQ4I 1SFKA 3GYHX 3NQOA 1X3ZB 3TO9A 5FKOA 2J5PA 1LB2A 2PG4A 2M8GX 4Y52J 2AO9A 2FQ4A 5H6RA 1XCBA 3CJTB 3S1QJ 3SDBA 2RNJA 4XLNF 1SMTA 1IN4A 2AXLA 4LK0F 2FU4A 1ETVA 1K79A 4Y15A 1ERDA 1GV5A 4MTEA 3NRVA 2WY8Q 2EWNA 1X58A 2C6YA 2UXNA 2L3DA 3FHNA 3RKQA 1J75A 4ZYHA 3HEFA 2NS7A 4PUSA 4IPAA 4V19K 4C2UA 3HJEA 5HS7A 1DGWY 2O03A 4L0ZB 2ZFWA 5F64A 1X3WB 4G9YA 1B72B 4EV0A 1T33A 5D4RA 3FXQA 2MSYA 5BQTA 3F22A 2QBYB 4RB0A 1AWCA 5B1BH 3HOSA 2P8TA 4ASNA 3KETA 2JMWA 1Z7LA 2VN2A 2HFHA 2IBDA 5HLTA 1PDNC 3A4CA 2GA1A 4BDZA 4M3BA 4D0PA 5CVVA 4U7DA 2F48A 5M3FJ 3JRIA 4AD9A 1NHAA 3OSFA 1YX5A 2A5WA 4IXAA 3HRTA 2O61A 5F04A 5F0FA 4P96A 1QGPA 1BJZA 2K7LA 2VQLA 1OPCA 2E34A 4JX4A 1DPRA 1QVUA 2QWWA 2BVMA 4KMUX 2DK5A 3F0CA 3ZN0A 1BI3A 1KA8A 3BR1A 2TCTA 3R0AA 2WV1A 4A5NA 1FBSA 4W97A 3HOXJ 2QUFA 2XF7A 3V8JA 4DOZA 4UB6C 5KCMA 4CYCA 4UUSA 2B9SA 2CQQA 1ON2A 4RM3A 4RM2A 2VI6A 5LEKA 5EG0B 3J81K 2IGKA 2G9WA 2D45A 3DP7A 3DTKA 4LGWA 1N78A 1BR2A 4XMYA 3I4PA 1LKXA 2ZB9A 5D5XB 1VQ5I 2VJ5A 4D7MA 2BOLA 3FBNB 1QVTA 4XLCA 2E19A 1P7IA 4ZH4F 3I3LA 2K5CA 1U5TA 4WK8F 2FOWA 3M7GA 1ULYA 2QGUA 4ZYAA 3ROUA 2K3PA 2YS9A 1UB9A 1A36A 2ESNA 1XSVA 2Y0SN 2P0WA 2DFHA 4KISA 4XOPA 2OJED 2KZGA 2G7HA 3I59A 3J80Z 2M0CA 3QWLA 3AG4H 3DU5A 2BGCA 5IP7J 2BVLA 2RGVA 2KIUA 2Z9OA 2K4BA 2MA3A 2ZMEB 4AU7A 5KAFC 1A31A 2JVHA 2DFIA 4RGUA 5J4VA 3PIOF 3CCMI 4IHYA 3D5SC 4BJTA 5ILVA 2XASA 3FXRA 3TKYA 3S2HJ 4WXHA 2FE3A 3OS0A 1XSDA 3BC8A 5HDNA 2DU9A 4RBOA 2VQCA 1HBXG 2DBBA 5L3DA 2R7TA 4WXCA 1IV8A 1MMAA 3C7JA 3QPHA 4B8XA 4BQNA 1X1BA 1YRNB 2CS3A 3OYHA 3S93A 1B9MA 4YFNF 2MH2A 3P9IA 2PX9A 1XDSA 2CH0A 4YEJA 2NNNA 2QQBA 4QLCU 3TO7A 2HKOA 3T8RA 1WVRA 2DOEA 2IGNA 4Y3OA 3ZQCA 1P4XA 2M4KA 1RESA 2IA0A 4L9JA 4XN0A 4AM3A 2Y48A 4BS9A 2DJIA 4NNJA 2Z1DA 2IA1A 4IL6C 3DTEA 1Z6TA 3RYPA 3T5XA 1W7PD 2KISA 4AWXB 4IOCF 1RUNA 5FKKA 1F36A 3BJ6A 4G12A 4PFOA 4EM2A 2O7OA 3QP6A 4I02A 3H9JA 2L54A 1MBFA 3ERMA 2XGDA 4GFBA 3D0SA 2D1VA 2R7ZJ 3QYEA 2RQQA 2DN0A 3GFJA 1I6HJ 3S2WA 3SYTA 3ZQLA 4HF2A 1ZG5A 1R1VA 2ZXHA 3FBIB 2EFWA 3CUQA 3ML6A 1PUEE 2EFOA 3I0TA 1ZRFA 2IJLA 2XROA 3C2GA 2LG4A 1UMQA 1WJCA 1RETA 3C18A 1XC5A 1FC3A 2V1NA 4BAYA 2FA5A 1PP7U 3S1NJ 1JTXA 1VQ7I 1S6LA 3VSLA 1BI0A 3DLLF 1DP7P 5GPAA 4DYRA 2LP0A 1XMAA 1IUYA 1MBJA 2O5RA 4I09A 3IP4B 2RKHA 1K6OA 2PI0A 4RLFA 4XSXF 3W6JB 1J5YA 1VTNC 3A2KA 5LHGA 2OZUA 3CO6C 4KT6A 4RAZA 1VQPI 3SJMA 5DCMA 4X1EA 2F5VA 1HA8A 5LGNA 1HSJA 2VJ4A 4DBQA 2X51A 3ERED 2XRLA 2MC4A 4U88A 4HA8A 4MIMA 2KP6A 2E5ZA 3BG7A 1G6NA 2B0LA 5IYBJ 5ICFA 1LDKB 3V42A 3FXUA 3RPUD 3PO2J 1HKTA 1ZGJA 2CUFA 2XF6A 2BEOA 4ZYGA 2YR2A 3O8GA 1E3OC 2MBFA 2ZNYA 3WHBA 4GRIA 5E1WA 4WCGA 2GOXB 1ZKGA 3FK6A 4BXFA 4QSHA 2IGMA 2GQQA 1YS7A 4NHJA 4FHTA 1YIJI 4JOMA 5BOXA 2VJIA 2E1NA 4G7ZF 1BBYA 3LQRA 4DNCA 1OMIA 2A3SA 1RI7A 1SEUA 3RYRA 1X2NA 2W24A 3OYFA 1W4MA 2IGOA 4BYYA 3MKYB 1MIJA 4HLYA 2DPDA 1F1ZA 5IPAA 3IRQA 2K9MA 3BR5A 3EPZA 4MFEA 3FWEA 3DF8A 3LSKA 4JBAA 4OIPF 2V7FA 3M8JA 3AAFA 4ZDPA 2Y30A 4U0VA 1IGNA 3BG5A 3WTZA 1QO0D 5E3NA 5J1UA 3I54A 1J0RA 5H20A 3BTLA 2HZTA 3BY6A 3QPTA 1SFOJ 4IO9F 3DPUA 5GAEJ 1AOYA 3KYDB 1RC9A 3E6DA 1IXRC 1WJEA 4A3LJ 2IVMA 1D0ZA 2VKHA 2LTPA 3H3UA 4E7LA 2Z3YA 1XD7A 5FRMA 4HDVA 2DA4A 4FE4A 3T8TA 3HB9A 3ZPLA 3FM5A 3FF5A 2AS5F 4DZJA 4G7OF 2LKPA 1PP8F 3VODA 3S17J 1Z77A 2BBYA 2BXYA 1F4KA 3HHGA 2KJBA 5CPRB 2N8GA 4XL9A 5CLSA 2WV0A 2R5YB 4ZYEA 4I7HA 2VQGA 3ZN1A 3K1PA 4AIHA 1P4WA 2ZJRF 2DAOA 5BMZA 1XS9A 4P55A 1HC8A 2KJCA 3IKVA 2JWTA 2XAUA 3MN2A 1WQ2A 2FOKA 3ULQB 2BW3A 4NB5A 4OIRF 5IP9J 1BR1A 1VF9A 5EJCA 4N9IA 1QU3A 1SMYF 1V3FA 2DI3A 4R8HA 4PK4A 3ASNH 1YX3A 4XKWA 3FM3A 4BY7J 1QPMA 2W57A 3TP0A 1W36D 1ZQ3P 2H1KA 2CSOA 4LLLA 1GUUA 5E8IA 3KYLA 1AA7A 2E7XA 1Y1VJ 4I6ZA 2PN6A 5ILSA 1QA6A 4ZDLA 3J7AY 1I50J 2HWVA 3CLQA 2IP2A 3WTXC 4M9SA 2X48A 1HW5A 3DKWA 2X85A 5DS9A 3OMYA 1R4NB 1X1DA 3OYBA 3A0HC 1O3RA 4R79A 1GDTA 3PUBA 1EA3A 2XUBA 5L3GA 1IV6A 5IOYA 1J2XA 2K40A 5IP6A 1GLNA 1QZEA 1NTCA 1MDMA 1E3PA 3G3ZA 5E20A 2JJ7A 1JUMA 4G7HF 1K7AA 1ZELA 1TWHJ 3Q3SA 3L2WA 2Y69H 2Y0MA 1LEAA 1MJAA 3H5RA 3MVPA 3OYMA 4BE1A 2V26A 1HW1A 3HKZA 4A3IJ 2DA1A 3CTAA 3ZQQA 2HOSA 1QPIA 1V55H 2KHMA 3CCSI 3CCEI 3GTJJ 4CXFA 2FBKA 4NC7A 3CCQI 3HM5A 2XAHA 4ESJA 1IF1A 3P5JA 2JRMA 2R7DA 4M74A 2E1MC 4U0WA 2JA8J 4B44A 5CVRA 2JUGA 3F21A 3I9V2 5HNFA 2P7VB 1EJ9A 3W6KB 3KX2A 1FOWA 5AIPA 2XB5A 1WGXA 4CYDA 4F3QA 1U2WA 4CZCA 3IV5A 1YJ9I 3JW4A 3L00A 4L9TA 2DMTA 4B43A 4D9JA 1Y8QB 3L09A 1V5EA 1W7PA 3MAJA 5FD5A 3OIPA 3H35A 1T6SA 4D5CA 2M9HA 2OCCH 2NXNB 3RQIA 4KMFA 2G7UA 5FROA 5TRDA 2DTZA 1WRJA 3A01B 2OPTA 4FE7A 2RQPA 2NVTJ 4C30A 1Z3XA 1Z91A 2WY7Q 3K4KA 3S14J 1T56A 5B1AH 1IG7A 3LA3A 3CC2I 1TQMA 3BZKA 4IEJA 4CSWA 2ISZA 1D0XA 2DOFA 2E2IJ 4BEHA 1YFHA 4OU0A 1W0UA 2CW0F 4F55A 5HLIA 1UHSA 1XGSA 2LK2A 2RN7A 1ZREA 4ZTJA 2XSJC 3BZ6A 2KDOA 1U3EM 2JSPA 4HX4A 3HRMA 1FYKA 2ZKZA 3ZR8X 4LITA 2HI3A 2MD5A 3J7YJ 2ZJ2A 3GXOA 1S7OA 4IOAF 3AL0B 4A0XA 4YIRX 4BXXJ 4LFUA 2K86A 1BIAA 2HOAA 5FKNA 3OYCA 3MZYA 1ZLJA 2EH3A 2HYFA 1X1PA 2CUEA 1WH5A 3I71A 3TBIA 2VBXA 1LQ1A 5JLWA 1BI1A 2W82A 3DEEA 2PMZN 1IAWA 1HW2A 2GAUA 3JAMZ 3OSGA 3BJAA 2DFEA 5K5OA 4MTDA 2OQGA 1XG1A 2ZC2A 2W25A 1N25A 1S5LC 4MFDA 4GXOA 2DT5A 2GZWA 3WU0A 3LA2A 1JKPC 1D5VA 3Q0UA 1FT9A 4HSTA 4G6QA 2DQLA 3ECHA 1H9GA 1LDJA 2COBA 3OYAA 2JSCA 2XSDC 3O3KA 4IHWA 4PJNA 5HDKA 4Y7NJ 2GLOA 5E79C 1IRFA 4HLXA 3SZPA 1W5SA 5D5UB 4AVPA 2F5FA 2M7AA 1X1AA 5LHIA 5ILUA 4JX6A 3J7AO 1H88C 3EUKL 2R0QC 1UG2A 1MBGA 5F0HA 1UELB 2AQEA 2R7QA 2EBIA 2CW7A 3PIPF 3ZP5A 2GIZA 2ZSIB 2MABA 3KZZA 4Q5SF 4BY1J 4IF4A 4G6TB 2HEOA 1RRJA 1WJDA 3CQZJ 1KQ9A 5DUKA 5GTIC 2GOMA 2JA6J 1OCTC 4UY8I 5HS8A 1T95A 3QOPA 4BQQA 3FIWA 3FMSA 4NC8A 2NNYA 4CH7A 3SQNA 1OCRH 1YHQI 1S9HA 3C2BA 1WI3A 3CCLI 4Q47A 1OYYA 2GXBA 2NVQJ 4AUXA 2L02A 2NYXA 1XB4A 5EEHA 3L2UA 1TWFJ 1LNWA 2QF7A 2QA4I 5LBQA 2R93J 1Z05A 4HSRA 1ZG3A 2LR8A 3FXJA 2L7MP 1QNTA 3ABLH 1SVLA 3AKZA 4BL0B 2M5WA 1KU3A 2VKDA 3OS1A 3BR3A 3ZMZA 3DV8A 1TNTA 3L2RA 4EQQA 3ABMH 2RVCA 1T8IA 2IS1A 1IDZA 3FMQA 2L9VA 2G0EA 2NVXJ 5IT3A 1OFCX 1YYVA 3KP5A 2X0LA 2A05A 2P7CB 3EYIA 3HOYJ 1ORKA 1L0OC 2BE5F 4A3MJ 1HDPA 1I1SA 1JJ6C 3BP8A 4QPOA 2LY1A 4AYBN 5EF6A 5EDNA 1OQYA 1Q1HA 2A6HF 5FLXK 3F8BA 1L3LA 3S3NA 1OJLA 4DBRA 2CGPA 4S04A 3RTRA 2UUZA 2MLGA 3TW7A 4A5MA 4CCJA 4KYWA 2FMYA 3K7AJ 2P5LC 2E71A 1Z9CA 4HX8A 1WH7A 3B02A 3H92A 2JN6A 4IZZA 1PUFB 2QLZA 2MH9A 3HUGA 5JVGF 2YPRA 1T39A 3M8FA 2CQ7A 4HX7A 2FMLA 1WJ5A 3RKXA 3CMMA 1ZG1A 4XKVA 3DEUA 4XLAA 5FLXZ 2ETHA 3SEZA 1JJ8C 4G8XA 2R92J 2AHQA 4RB3C 4E7HA 1IW7F 4FTHA 3MWMA 5JHUA 3CCRI 4MO7A 5CQEA 1LPQA 3OYNA 2QEXI 1Y8RB 2WBMA 2DJNA 2UWMA 2JUCA 1I39A 4UV9A 4J00A 3E6MA 5KAIC 1DDNA 1G8XA 4A3DJ 1XGMA 3HYIA 2L9SA 4GYGA 2O8KA 3DBRB 2CMPA 3BG6A 1ETOA 3SXYA 5JLXA 1VQ9I 5LRSA 2MFZA 2LBFA 2CUJA 5HLHA 3GVAA 1FP1D 5EYRA 5LFAA 1KZHA 2KRFA 1HF0A 1JT0A 1ACIA
chains in the Genus database with same CATH topology
2YSRA 4KT5C 4ENJA 1ODDA 4L0YB 2V1UA 4YFXF 4UVAA 3MFKA 2COMA 3ZMVA 5DD4A 1MGTA 4O5VA 1JGSA 4M6YA 3COAC 2WTEA 2M1BA 2VBZA 2ZMEC 1ZHFA 4ENKA 3ELKA 4I98B 3GFIA 4HW0A 3HHHA 2HTSA 1TTYA 3CJNA 1G3SA 4EJUA 3KEOA 5CYVA 1KU2A 4XRFA 3KP3A 4I0AA 1J9IA 2LF7A 1R5HA 4RS8A 1IN6A 1B9NA 2EFQA 2H6CA 1SD5A 2QQAA 2CQKA 4Y17A 1WSUA 2A6EF 2QYOA 4IRHA 3GLXA 3MCZA 3SFZA 2GIVA 4ZZLA 1TBXA 1BIBA 3C1DA 3ABUA 3LSTA 3F72A 2LSOA 2OA4A 1LDDA 1K78A 4LG0A 3J81Z 3V7RA 1O3SA 2DO7A 4MHGA 5D6FA 2VE9A 2V6CA 5LRRA 1MJ9A 3BPVA 4PZJA 3PFIA 2F5DA 4L9VA 3WU1B 4LLNA 2FEZA 1U6GA 4UVBA 4EGYA 3GZ5A 1TLHB 1SD7A 3TDUC 3RI4A 2DQRA 5ICEA 4YIFA 2QVOA 3LWFA 4M9ZA 5J8FA 4H0EA 1SD4A 4S05A 5E17F 2EA4A 4RB2C 2L4AA 2VBWA 1BJAA 4EGZA 4MEXF 1XGOA 2ZBKA 1OYWA 3GX4X 3M1EA 1HKQA 3RKYA 4BQAA 1CGPA 3KLNA 3ZMSA 4JK1X 2K4JA 3V4GA 3IRRA 5IT9K 2VBYA 3K1MA 3ISPA 3D5LA 1ZN2A 1YTYA 4TV7A 2CO5A 5H6QA 4IHTA 3K69A 1HSTA 1ONVA 4LMYA 3ZMTA 5D5WB 2A69F 2WC2A 3K9TA 4L9NA 1P92A 3I64A 1KU9A 2V1DA 4EM0B 3GUDA 2FBHA 3LAJA 2UZKA 1XSXA 4LJZF 3K1NA 3E5QA 2D1HA 5KVRA 1GVJA 3FZVA 1CF7A 1USTA 3WTWC 2RV8A 1SFUA 1QZZA 1MZBA 3GFMA 1S8NA 4MQVA 3I58A 4U0YA 5BS6A 2PMHA 2PBIA 2CWEA 2HS5A 4L18B 4NQWA 3WE2A 3KCCA 3LFKA 2EV0A 2W84A 3F8CA 4UV8A 1F5TA 4CHUA 2EV6A 1ZGAA 2J5OA 3U1DA 1SAXA 5CJ9A 2ZO4A 4I01A 2OU2A 1SD6A 1U78A 4RGSA 5J6XA 4KICA 4KN7X 3BROA 3TOBA 1P4AA 3QP5A 4P9UA 3P9CA 2IPQX 2FNPA 5FGMA 4MNUA 3IHUA 3R0JA 3WTUC 3HSRA 4HQMA 3F8FA 1A04A 1YS6A 4KA4A 3F8NA 2CFXA 4L5IA 3DPTA 1O57A 1JE8A 1STZA 1WWXA 5K1YA 1YW8A 2FQ3A 2HGCA 4RAYA 4ENMA 3KFWX 5D8KB 4CGZA 3O2PE 1IN8A 2LDUA 3L2CA 1YW7A 2IW5A 3SZTA 1USSA 3RDIA 2XKOA 4PGHA 2FNAA 5DYMA 2KIMA 1R58A 3GF2A 2STWA 1U5TB 1GHCA 2JRTA 5CVJA 2JPCA 2ZXJA 1LVAA 2K27A 2ZCWA 5DCFA 4GO1A 2QBYA 4YFKF 3G73A 3HSFA 3KP6A 1FBUA 4M73A 4YG2F 5FB2A 4BHBA 3WGHA 2A07F 4HQEA 1RNLA 2Z5UA 2QZ8A 4WX9A 5DUIA 3VB2A 2H6BA 2Y75A 4IRGA 2OBPA 1GXPA 3R60A 3HTSB 4P9FA 2EV5A 2GXGA 4ZZDA 2XVCA 2A5YB 3O6BB 4OOIA 3ZQ7A 3CDHA 1R23A 4RGRA 2XV4S 4EMSA 1ZAOA 5ERIA 1G3TA 1Z1DA 4KDPA 5DV5A 1IRGA 4PCQA 4YIIA 2Q8KA 1T98A 3M8EA 1V4RA 3RIRA 5HS9A 1IXSB 2OQRA 4A2UA 4K2EA 3CUQB 1ZLKA 1BC8C 4EVIA 1U8RA 2X4HA 1ZARA 4G94A 1SFXA 3RPUA 2O8XA 2ZMEA 2VC0A 1TQPA 4CO8A 3KE2A 4A6DA 2QQ9A 2HTJA 1JXSA 2O3FA 2IT0A 5FFZA 1FZPB 2UXXA 1ZYRF 1EH6A 4KFCA 1OYIA 2DPUA 3FMRA 2CG4A 3GW2A 1DUXC 1HXDA 4HOBA 1KGSA 1KYZA 2FRHA 5A2QK 1UHMA 1B6AA 5DD8A 3WGIA 1ZH5A 1KU7A 2FF4A 1FSHA 3F6OA 2DK8A 2LNBA 3WODF 3K0LA 2H27A 5LGUA 1UCRA 1FYMA 5K5QA 3PQJA 2NRAC 1IZ1A 4WF2A 5F1RA 2F5EA 4A0ZA 1XN7A 5BPDA 4OIOF 1E17A 2H94A 1YIOA 1ZRCA 5ICGA 3IL2A 2STTA 3GO5A 4R1HA 2M87A 4LB5A 4ESFA 5JI6A 2EB7A 1I27A 3R4KA 4IJAA 3WG9A 5JFRA 2PLYA 1D8JA 4B09A 2XAQA 3EYYA 4JQFA 2M30A 2RDPA 3LQQA 3T1BA 3R61A 2A68F 2ADUA 3U9GA 4CICA 2P6TA 4I0BA 3VEPA 4OIQF 1EH7A 1UHWA 3KP7A 5BPIA 3MQ0A 1FBQA 2YU3A 2ESHA 1BC7C 3ABTA 1UFMA 1B4AA 1R00A 3V8KA 4GYIA 4XBFA 3N97A 4N0BA 4GGGA 4OMZA 3E97A 3OV8A 3Q9VA 1MDMB 2LF8A 1HQCA 3LA7A 1RZ4A 4HF1A 1FNNA 2NAZA 3GZ6A 3JTGA 1S29A 3HOTA 1QBJA 5LGTA 2GWRA 2VT2A 3WGGA 1O7LA 4HF0A 2HOEA 1W7PB 2VOPA 2M45A 1HKSA 1EV7A 2YX4A 1E2XA 3CLOA 4DQ2A 3NEUA 5LLQA 5LEJA 2KIFA 2GA2A 3VOEA 3EETA 5CVIA 2EK5A 2BYVE 4OINF 3VFZA 4KUMA 3GWZA 3J80K 1R1UA 1KYWA 2ISYA 1XCVA 2HYGD 4BNCA 5L3BA 5E18F 4FT8A 3ZMUA 4KIGA 4M9XA 3I53A 2PQ8A 3WTTC 4KIBA 2VOOA 1FWZA 2V79A 3DXJF 5HLGA 3R6SA 2MLKA 5L3CA 3B73A 3E6BA 1GXQA 3BOQA 2FBIA 3BJOA 4P5OA 3L9FA 1YQAA 2IRFG 4UXNA 1O7FA 5J8CA 5E8GA 4HV6A 2M8EA 3F8MA 4IVNA 2JT1A 1T2KA 1QQIA 1J7KA 4G6DA 2F2EA 2BV6A 1FOKA 1FLIA 1R5GA 1ZRDA 3BPXA 3FHZA 2Z33A 1XGNA 3F23A 4F7ZA 1H9TA 2XGXA 3MEXA 5ICCA 1H0MA 2Z99A 1BI2A 1J59A 3F6VA 3T0YA 2L01A 2VXZA 3C3WA 3KP2A 1TW2A 1O3TA 2XRNA 4XLPF 3EUHA 3EQLF 3V7SA 3TOAA 2DTRA 4KIFA 2NS0A 5D6EA 2XIGA 3TDZC 5EEGA 2Q0OA 1D8KA 4BH9A 3ZMDA 1D3YA 3QU3A 1REPC 3IKTA 2F5CA 4FX4A 2WWYA 4MGRA 1B59A 4WWCA 3L7WA 5DDGA 1FX7A 1JHHA 5IT9Z 4LLGF 1I1GA 2R3SA 4HYEA 4RB1A 2A61A 1O3QA 1YW9A 3EDPA 5D8LB 3LAPA 2HDCA 1BM9A 3E3VA 4KN4X 4BHPA 1YO5C 4L5JA 1MJBA 5FD6A 3HIFA 2H09A 2OZ6A 1IXCA 2RC4A 4PDKA 2KKOA 4O3MA 4WXDA 5E1ZB 4EM1A 4O6JA 1FP2A 2OD5A 4UNOA 1ON1A 2PEXA 5HDGA 3U2RA 1G3WA 3HTUA 4PGGA 2W85A 3WTVC 2HR3A 1FPQA 1G3YA 3MZHA 1R1TA 1TW3A 1U5TC 2YX7A 4BHCA 5F6FA 3REOA 2V9VA 3I5UA 5AONA 1IN5A 2FSWA 2XHKA 5CVUA 1B1BA 5HOOA 5TJJA 2L4MA 4ZYDA 1LEBA 2VT3A 1DPUA 3CUOA 3Q9SA 1C0WA 3DQVC 3GFLA 2XAJA 2PFBA 4HBLA 3RJPA 4MEYF 3E5XA 2P5KA 3TGNA 1EH8A 2HQNA 2EFNA 3BWGA 2TDXA 4N9HA 1I5ZA 5D5VB 3H3ZA 4HV5A 3GEZA 4ON0A 4AIKA 2D2WA 1OKRA 1BN5A 1LJ9A 4KNYA 2P5VA 4LK1F 1T38A 2QM3A 4EJOA 1JHFA 2K02A 1KQ8A 1YG2A 3M9AA 4QWQA 4CDGA 5DEQA 3RKWA 3WTYC 1G4DA 3IC7A 3HSEA 3V8LA 5K5RA 1OR7A 4FX0A 1MKMA 1K78B 2OAZA 2PJPA 4LG0B 1WI9A 2P4WA 3CUQC 3I59B 4M6XA 2XAFA 4EJWA 1QZYA 2EFPA 4HAMA 3F3XA 2JTVA 1XMKA 3ECOA 4Q48A 1IN7A 1KQ0A 4UUVA 2O6GE 4EJVA 3WE3A 3QRFF 3P9KA 4IHSA 2VC1A 1TQIA 2FXAA 4MQ9F 4BXUA 2ELHA 1Y0UA 3E5UA 4E70A 5FFXA 4HZFA 2QENA 2VONA 2HKXA 4I2OA 1Z7UA 1T0FA 2XKPA 2HQRA 4M71A 5FO5A 2O0YA 3JAMK 5LHHA 4OMYA 5D4SA 3BDDA 3QAHA 5JR3A 2MC3A 2CYYA 4RGXA 4ETSA 3Q5FA 3KP4A 1FY7A 3IWZA 5JVTA 4A0YA 1S3JA 5DCMB 3P7NA 4IRIA 4U7BA 3TQNA 2VODA 1I6XA 1Z6RA 3IWFA 3JTHA 2PMUA 2IA2A 5L3FA 1TNSA 1SFEA 1CF7B 2EJRA 1P2FA 1WKMA 2E1CA 4XSZF 1RUOA 1P6RA 5L3EA 1MD0A 3KLOA 1FYLA 1W5TA 2ZNZA 3HRSA 3QU6A 5A2QZ 3K2ZA 2ACJA 3E6CC 4HDUA 2VE8A 2DW4A 3FX3A 2P6SA 5KK1A 3V7CA 4Y13A 2XAGA 1FSEA 4ENNA 5HVQC 2JPBA 1BOAA 2JZYA 5ED4A 1R7JA 3KEQA 3CO7C 4Q4ZF 4GCVA 4EJTA 4ESBA 4M72A 3DFGA 4LB6B 1XDUA 1YLFA 5E1XA 2Q2EA 4A12A 1S7AA 2EA2A 3JSPA 6PAXA 3KZYA 2DLLA 4UVCA 4CZZA 4UHTA 3SHFA 3WTSC 1RIOH 1F9NA 2E7WA 4LD5A 3N4MA 3DPLC 3RPQA 4A6EA 1X3UA 2R7FA 1R36A 3OOPA 3TO6A 3HRUA 4Z2YA 1R22A 4AIJA 3JSOA 2V1XA 3PQKA 5AIQA 3GYHX 3NQOA 3TO9A 2J5PA 1LB2A 2PG4A 5H6RA 1XCBA 2RNJA 4XLNF 1SMTA 1IN4A 2AXLA 4LK0F 2FU4A 1K79A 4Y15A 4MTEA 3NRVA 2C6YA 2EWNA 2UXNA 2L3DA 1J75A 4ZYHA 4IPAA 5HS7A 2O03A 4L0ZB 2ZFWA 5F64A 4G9YA 4EV0A 5D4RA 3FXQA 5BQTA 3F22A 2QBYB 4RB0A 1AWCA 3HOSA 2P8TA 4ASNA 3KETA 2VN2A 2HFHA 1PDNC 2GA1A 4D0PA 5CVVA 4U7DA 4AD9A 1NHAA 4IXAA 3HRTA 2O61A 4P96A 1QGPA 2K7LA 1OPCA 1DPRA 2QWWA 4KMUX 2DK5A 3ZN0A 1BI3A 1KA8A 3R0AA 4A5NA 1FBSA 2QUFA 3V8JA 1ON2A 5LEKA 3J81K 2G9WA 2D45A 3DP7A 4LGWA 3I4PA 5D5XB 4ZH4F 1U5TA 4WK8F 3M7GA 1ULYA 3ROUA 1UB9A 2ESNA 1XSVA 2G7HA 3I59A 3J80Z 2BGCA 2RGVA 2KIUA 2Z9OA 2K4BA 2MA3A 2ZMEB 2DFIA 4RGUA 5ILVA 2XASA 3FXRA 3TKYA 4WXHA 2FE3A 1XSDA 5HDNA 2DU9A 1HBXG 2DBBA 5L3DA 4WXCA 3C7JA 3QPHA 4B8XA 1B9MA 4YFNF 2MH2A 3P9IA 1XDSA 2NNNA 2QQBA 4QLCU 3TO7A 2HKOA 3T8RA 1P4XA 2IA0A 4L9JA 2Y48A 2IA1A 1Z6TA 3RYPA 3T5XA 1W7PD 4AWXB 1RUNA 3BJ6A 4EM2A 3QP6A 4I02A 2L54A 3D0SA 2D1VA 3GFJA 3S2WA 4HF2A 1ZG5A 1R1VA 2EFWA 3CUQA 3ML6A 1PUEE 2EFOA 3I0TA 1ZRFA 2IJLA 2XROA 3C18A 1FC3A 4BAYA 2FA5A 1PP7U 1S6LA 1BI0A 1DP7P 1XMAA 1IUYA 4I09A 2RKHA 1K6OA 2PI0A 4XSXF 3W6JB 1J5YA 1VTNC 5LHGA 2OZUA 3CO6C 4RAZA 5DCMA 5LGNA 1HSJA 3ERED 4U88A 4HA8A 1G6NA 2B0LA 5ICFA 1LDKB 3FXUA 1HKTA 1ZGJA 2BEOA 4ZYGA 2YR2A 2MBFA 2ZNYA 5E1WA 4WCGA 2GQQA 1YS7A 4NHJA 4FHTA 5BOXA 2E1NA 4G7ZF 1BBYA 3LQRA 4DNCA 1OMIA 2A3SA 1RI7A 3RYRA 2W24A 1W4MA 4BYYA 4HLYA 2DPDA 1F1ZA 3IRQA 3FWEA 3DF8A 4OIPF 4JBAA 3AAFA 4U0VA 3WTZA 1QO0D 3I54A 1J0RA 5H20A 2HZTA 3BY6A 3QPTA 1AOYA 3E6DA 1IXRC 2IVMA 3H3UA 2Z3YA 1XD7A 4HDVA 3T8TA 3ZPLA 3FM5A 3FF5A 2AS5F 4G7OF 2LKPA 1PP8F 3VODA 2BBYA 1F4KA 3HHGA 2KJBA 5CLSA 2WV0A 4ZYEA 4I7HA 3ZN1A 5BMZA 3K1PA 4AIHA 1P4WA 2DAOA 4P55A 2KJCA 3IKVA 1WQ2A 2FOKA 3ULQB 4NB5A 4OIRF 4N9IA 1SMYF 1V3FA 2DI3A 4R8HA 3FM3A 1QPMA 2W57A 2CSOA 4LLLA 5E8IA 2E7XA 2PN6A 5ILSA 2HWVA 2IP2A 3WTXC 4M9SA 1HW5A 3DKWA 1O3RA 4R79A 2XUBA 5L3GA 1J2XA 1MDMA 3G3ZA 5E20A 4G7HF 1K7AA 2Y0MA 1LEAA 1MJAA 1HW1A 3CTAA 4CXFA 2FBKA 2XAHA 4ESJA 1IF1A 2R7DA 4M74A 4U0WA 5CVRA 3F21A 2P7VB 3W6KB 5AIPA 4CYDA 1U2WA 3JW4A 3L00A 4L9TA 3L09A 1W7PA 3MAJA 5FD5A 1T6SA 4KMFA 2G7UA 5TRDA 1WRJA 2RQPA 1Z91A 3LA3A 1TQMA 2ISZA 1YFHA 4OU0A 2CW0F 5HLIA 1XGSA 2RN7A 1ZREA 3BZ6A 1U3EM 4HX4A 3HRMA 1FYKA 2ZKZA 2MD5A 2ZJ2A 3GXOA 1S7OA 4A0XA 4LFUA 2K86A 1BIAA 3MZYA 1ZLJA 2HYFA 3I71A 2VBXA 1LQ1A 1BI1A 1IAWA 1HW2A 2GAUA 3JAMZ 3BJAA 5K5OA 4MTDA 2OQGA 2W25A 4GXOA 2DT5A 2GZWA 3WU0A 3LA2A 1D5VA 1FT9A 4G6QA 2DQLA 3ECHA 1H9GA 1LDJA 2JSCA 3O3KA 5HDKA 1IRFA 4HLXA 3SZPA 1W5SA 5D5UB 4AVPA 2F5FA 5LHIA 5ILUA 3J7AO 3ZP5A 3KZZA 4Q5SF 4IF4A 2HEOA 1KQ9A 5DUKA 5HS8A 3QOPA 3FMSA 2NNYA 3SQNA 4Q47A 1OYYA 2GXBA 2L02A 2NYXA 1XB4A 5EEHA 1LNWA 5LBQA 1Z05A 1ZG3A 1QNTA 2M5WA 1KU3A 3ZMZA 3DV8A 1TNTA 4EQQA 2RVCA 3FMQA 5IT3A 1YYVA 3KP5A 2X0LA 2P7CB 3EYIA 1L0OC 2BE5F 1I1SA 3BP8A 1Q1HA 2A6HF 5FLXK 3F8BA 1L3LA 2CGPA 4S04A 3RTRA 2MLGA 4A5MA 4KYWA 2FMYA 2P5LC 1Z9CA 4HX8A 3B02A 3H92A 2QLZA 2MH9A 3HUGA 2YPRA 1T39A 3M8FA 4HX7A 2FMLA 3RKXA 1ZG1A 3DEUA 5FLXZ 2ETHA 4G8XA 4RB3C 1IW7F 3MWMA 5JHUA 2UWMA 4UV9A 1DDNA 3E6MA 1XGMA 3HYIA 4GYGA 3SXYA 5LRSA 5HLHA 3GVAA 1FP1D 2KRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSR A;  4KT5 C;  4ENJ A;  1ODD A;  4L0Y B;  2V1U A;  4YFX F;  4UVA A;  3MFK A;  2COM A;  3ZMV A;  5DD4 A;  1MGT A;  4O5V A;  1JGS A;  4M6Y A;  3COA C;  2WTE A;  2M1B A;  2VBZ A;  2ZME C;  1ZHF A;  4ENK A;  3ELK A;  4I98 B;  3GFI A;  4HW0 A;  3HHH A;  2HTS A;  1TTY A;  3CJN A;  1G3S A;  4EJU A;  3KEO A;  5CYV A;  1KU2 A;  4XRF A;  3KP3 A;  4I0A A;  1J9I A;  2LF7 A;  1R5H A;  4RS8 A;  1IN6 A;  1B9N A;  2EFQ A;  2H6C A;  1SD5 A;  2QQA A;  2CQK A;  4Y17 A;  1WSU A;  2A6E F;  2QYO A;  4IRH A;  3GLX A;  3MCZ A;  3SFZ A;  2GIV A;  4ZZL A;  1TBX A;  1BIB A;  3C1D A;  3ABU A;  3LST A;  3F72 A;  2LSO A;  2OA4 A;  1LDD A;  1K78 A;  4LG0 A;  3J81 Z;  3V7R A;  1O3S A;  2DO7 A;  4MHG A;  5D6F A;  2VE9 A;  2V6C A;  5LRR A;  1MJ9 A;  3BPV A;  4PZJ A;  3PFI A;  2F5D A;  4L9V A;  3WU1 B;  4LLN A;  2FEZ A;  1U6G A;  4UVB A;  4EGY A;  3GZ5 A;  1TLH B;  1SD7 A;  3TDU C;  3RI4 A;  2DQR A;  5ICE A;  4YIF A;  2QVO A;  3LWF A;  4M9Z A;  5J8F A;  4H0E A;  1SD4 A;  4S05 A;  5E17 F;  2EA4 A;  4RB2 C;  2L4A A;  2VBW A;  1BJA A;  4EGZ A;  4MEX F;  1XGO A;  2ZBK A;  1OYW A;  3GX4 X;  3M1E A;  1HKQ A;  3RKY A;  4BQA A;  1CGP A;  3KLN A;  3ZMS A;  4JK1 X;  2K4J A;  3V4G A;  3IRR A;  5IT9 K;  2VBY A;  3K1M A;  3ISP A;  3D5L A;  1ZN2 A;  1YTY A;  4TV7 A;  2CO5 A;  5H6Q A;  4IHT A;  3K69 A;  1HST A;  1ONV A;  4LMY A;  3ZMT A;  5D5W B;  2A69 F;  2WC2 A;  3K9T A;  4L9N A;  1P92 A;  3I64 A;  1KU9 A;  2V1D A;  4EM0 B;  3GUD A;  2FBH A;  3LAJ A;  2UZK A;  1XSX A;  4LJZ F;  3K1N A;  3E5Q A;  2D1H A;  5KVR A;  1GVJ A;  3FZV A;  1CF7 A;  1UST A;  3WTW C;  2RV8 A;  1SFU A;  1QZZ A;  1MZB A;  3GFM A;  1S8N A;  4MQV A;  3I58 A;  4U0Y A;  5BS6 A;  2PMH A;  2PBI A;  2CWE A;  2HS5 A;  4L18 B;  4NQW A;  3WE2 A;  3KCC A;  3LFK A;  2EV0 A;  2W84 A;  3F8C A;  4UV8 A;  1F5T A;  4CHU A;  2EV6 A;  1ZGA A;  2J5O A;  3U1D A;  1SAX A;  5CJ9 A;  2ZO4 A;  4I01 A;  2OU2 A;  1SD6 A;  1U78 A;  4RGS A;  5J6X A;  4KIC A;  4KN7 X;  3BRO A;  3TOB A;  1P4A A;  3QP5 A;  4P9U A;  3P9C A;  2IPQ X;  2FNP A;  5FGM A;  4MNU A;  3IHU A;  3R0J A;  3WTU C;  3HSR A;  4HQM A;  3F8F A;  1A04 A;  1YS6 A;  4KA4 A;  3F8N A;  2CFX A;  4L5I A;  3DPT A;  1O57 A;  1JE8 A;  1STZ A;  1WWX A;  5K1Y A;  1YW8 A;  2FQ3 A;  2HGC A;  4RAY A;  4ENM A;  3KFW X;  5D8K B;  4CGZ A;  3O2P E;  1IN8 A;  2LDU A;  3L2C A;  1YW7 A;  2IW5 A;  3SZT A;  1USS A;  3RDI A;  2XKO A;  4PGH A;  2FNA A;  5DYM A;  2KIM A;  1R58 A;  3GF2 A;  2STW A;  1U5T B;  1GHC A;  2JRT A;  5CVJ A;  2JPC A;  2ZXJ A;  1LVA A;  2K27 A;  2ZCW A;  5DCF A;  4GO1 A;  2QBY A;  4YFK F;  3G73 A;  3HSF A;  3KP6 A;  1FBU A;  4M73 A;  4YG2 F;  5FB2 A;  4BHB A;  3WGH A;  2A07 F;  4HQE A;  1RNL A;  2Z5U A;  2QZ8 A;  4WX9 A;  5DUI A;  3VB2 A;  2H6B A;  2Y75 A;  4IRG A;  2OBP A;  1GXP A;  3R60 A;  3HTS B;  4P9F A;  2EV5 A;  2GXG A;  4ZZD A;  2XVC A;  2A5Y B;  3O6B B;  4OOI A;  3ZQ7 A;  3CDH A;  1R23 A;  4RGR A;  2XV4 S;  4EMS A;  1ZAO A;  5ERI A;  1G3T A;  1Z1D A;  4KDP A;  5DV5 A;  1IRG A;  4PCQ A;  4YII A;  2Q8K A;  1T98 A;  3M8E A;  1V4R A;  3RIR A;  5HS9 A;  1IXS B;  2OQR A;  4A2U A;  4K2E A;  3CUQ B;  1ZLK A;  1BC8 C;  4EVI A;  1U8R A;  2X4H A;  1ZAR A;  4G94 A;  1SFX A;  3RPU A;  2O8X A;  2ZME A;  2VC0 A;  1TQP A;  4CO8 A;  3KE2 A;  4A6D A;  2QQ9 A;  2HTJ A;  1JXS A;  2O3F A;  2IT0 A;  5FFZ A;  1FZP B;  2UXX A;  1ZYR F;  1EH6 A;  4KFC A;  1OYI A;  2DPU A;  3FMR A;  2CG4 A;  3GW2 A;  1DUX C;  1HXD A;  4HOB A;  1KGS A;  1KYZ A;  2FRH A;  5A2Q K;  1UHM A;  1B6A A;  5DD8 A;  3WGI A;  1ZH5 A;  1KU7 A;  2FF4 A;  1FSH A;  3F6O A;  2DK8 A;  2LNB A;  3WOD F;  3K0L A;  2H27 A;  5LGU A;  1UCR A;  1FYM A;  5K5Q A;  3PQJ A;  2NRA C;  1IZ1 A;  4WF2 A;  5F1R A;  2F5E A;  4A0Z A;  1XN7 A;  5BPD A;  4OIO F;  1E17 A;  2H94 A;  1YIO A;  1ZRC A;  5ICG A;  3IL2 A;  2STT A;  3GO5 A;  4R1H A;  2M87 A;  4LB5 A;  4ESF A;  5JI6 A;  2EB7 A;  1I27 A;  3R4K A;  4IJA A;  3WG9 A;  5JFR A;  2PLY A;  1D8J A;  4B09 A;  2XAQ A;  3EYY A;  4JQF A;  2M30 A;  2RDP A;  3LQQ A;  3T1B A;  3R61 A;  2A68 F;  2ADU A;  3U9G A;  4CIC A;  2P6T A;  4I0B A;  3VEP A;  4OIQ F;  1EH7 A;  1UHW A;  3KP7 A;  5BPI A;  3MQ0 A;  1FBQ A;  2YU3 A;  2ESH A;  1BC7 C;  3ABT A;  1UFM A;  1B4A A;  1R00 A;  3V8K A;  4GYI A;  4XBF A;  3N97 A;  4N0B A;  4GGG A;  4OMZ A;  3E97 A;  3OV8 A;  3Q9V A;  1MDM B;  2LF8 A;  1HQC A;  3LA7 A;  1RZ4 A;  4HF1 A;  1FNN A;  2NAZ A;  3GZ6 A;  3JTG A;  1S29 A;  3HOT A;  1QBJ A;  5LGT A;  2GWR A;  2VT2 A;  3WGG A;  1O7L A;  4HF0 A;  2HOE A;  1W7P B;  2VOP A;  2M45 A;  1HKS A;  1EV7 A;  2YX4 A;  1E2X A;  3CLO A;  4DQ2 A;  3NEU A;  5LLQ A;  5LEJ A;  2KIF A;  2GA2 A;  3VOE A;  3EET A;  5CVI A;  2EK5 A;  2BYV E;  4OIN F;  3VFZ A;  4KUM A;  3GWZ A;  3J80 K;  1R1U A;  1KYW A;  2ISY A;  1XCV A;  2HYG D;  4BNC A;  5L3B A;  5E18 F;  4FT8 A;  3ZMU A;  4KIG A;  4M9X A;  3I53 A;  2PQ8 A;  3WTT C;  4KIB A;  2VOO A;  1FWZ A;  2V79 A;  3DXJ F;  5HLG A;  3R6S A;  2MLK A;  5L3C A;  3B73 A;  3E6B A;  1GXQ A;  3BOQ A;  2FBI A;  3BJO A;  4P5O A;  3L9F A;  1YQA A;  2IRF G;  4UXN A;  1O7F A;  5J8C A;  5E8G A;  4HV6 A;  2M8E A;  3F8M A;  4IVN A;  2JT1 A;  1T2K A;  1QQI A;  1J7K A;  4G6D A;  2F2E A;  2BV6 A;  1FOK A;  1FLI A;  1R5G A;  1ZRD A;  3BPX A;  3FHZ A;  2Z33 A;  1XGN A;  3F23 A;  4F7Z A;  1H9T A;  2XGX A;  3MEX A;  5ICC A;  1H0M A;  2Z99 A;  1BI2 A;  1J59 A;  3F6V A;  3T0Y A;  2L01 A;  2VXZ A;  3C3W A;  3KP2 A;  1TW2 A;  1O3T A;  2XRN A;  4XLP F;  3EUH A;  3EQL F;  3V7S A;  3TOA A;  2DTR A;  4KIF A;  2NS0 A;  5D6E A;  2XIG A;  3TDZ C;  5EEG A;  2Q0O A;  1D8K A;  4BH9 A;  3ZMD A;  1D3Y A;  3QU3 A;  1REP C;  3IKT A;  2F5C A;  4FX4 A;  2WWY A;  4MGR A;  1B59 A;  4WWC A;  3L7W A;  5DDG A;  1FX7 A;  1JHH A;  5IT9 Z;  4LLG F;  1I1G A;  2R3S A;  4HYE A;  4RB1 A;  2A61 A;  1O3Q A;  1YW9 A;  3EDP A;  5D8L B;  3LAP A;  2HDC A;  1BM9 A;  3E3V A;  4KN4 X;  4BHP A;  1YO5 C;  4L5J A;  1MJB A;  5FD6 A;  3HIF A;  2H09 A;  2OZ6 A;  1IXC A;  2RC4 A;  4PDK A;  2KKO A;  4O3M A;  4WXD A;  5E1Z B;  4EM1 A;  4O6J A;  1FP2 A;  2OD5 A;  4UNO A;  1ON1 A;  2PEX A;  5HDG A;  3U2R A;  1G3W A;  3HTU A;  4PGG A;  2W85 A;  3WTV C;  2HR3 A;  1FPQ A;  1G3Y A;  3MZH A;  1R1T A;  1TW3 A;  1U5T C;  2YX7 A;  4BHC A;  5F6F A;  3REO A;  2V9V A;  3I5U A;  5AON A;  1IN5 A;  2FSW A;  2XHK A;  5CVU A;  1B1B A;  5HOO A;  5TJJ A;  2L4M A;  4ZYD A;  1LEB A;  2VT3 A;  1DPU A;  3CUO A;  3Q9S A;  1C0W A;  3DQV C;  3GFL A;  2XAJ A;  2PFB A;  4HBL A;  3RJP A;  4MEY F;  3E5X A;  2P5K A;  3TGN A;  1EH8 A;  2HQN A;  2EFN A;  3BWG A;  2TDX A;  4N9H A;  1I5Z A;  5D5V B;  3H3Z A;  4HV5 A;  3GEZ A;  4ON0 A;  4AIK A;  2D2W A;  1OKR A;  1BN5 A;  1LJ9 A;  4KNY A;  2P5V A;  4LK1 F;  1T38 A;  2QM3 A;  4EJO A;  1JHF A;  2K02 A;  1KQ8 A;  1YG2 A;  3M9A A;  4QWQ A;  4CDG A;  5DEQ A;  3RKW A;  3WTY C;  1G4D A;  3IC7 A;  3HSE A;  3V8L A;  5K5R A;  1OR7 A;  4FX0 A;  1MKM A;  1K78 B;  2OAZ A;  2PJP A;  4LG0 B;  1WI9 A;  2P4W A;  3CUQ C;  3I59 B;  4M6X A;  2XAF A;  4EJW A;  1QZY A;  2EFP A;  4HAM A;  3F3X A;  2JTV A;  1XMK A;  3ECO A;  4Q48 A;  1IN7 A;  1KQ0 A;  4UUV A;  2O6G E;  4EJV A;  3WE3 A;  3QRF F;  3P9K A;  4IHS A;  2VC1 A;  1TQI A;  2FXA A;  4MQ9 F;  4BXU A;  2ELH A;  1Y0U A;  3E5U A;  4E70 A;  5FFX A;  4HZF A;  2QEN A;  2VON A;  2HKX A;  4I2O A;  1Z7U A;  1T0F A;  2XKP A;  2HQR A;  4M71 A;  5FO5 A;  2O0Y A;  3JAM K;  5LHH A;  4OMY A;  5D4S A;  3BDD A;  3QAH A;  5JR3 A;  2MC3 A;  2CYY A;  4RGX A;  4ETS A;  3Q5F A;  3KP4 A;  1FY7 A;  3IWZ A;  5JVT A;  4A0Y A;  1S3J A;  5DCM B;  3P7N A;  4IRI A;  4U7B A;  3TQN A;  2VOD A;  1I6X A;  1Z6R A;  3IWF A;  3JTH A;  2PMU A;  2IA2 A;  5L3F A;  1TNS A;  1SFE A;  1CF7 B;  2EJR A;  1P2F A;  1WKM A;  2E1C A;  4XSZ F;  1RUO A;  1P6R A;  5L3E A;  1MD0 A;  3KLO A;  1FYL A;  1W5T A;  2ZNZ A;  3HRS A;  3QU6 A;  5A2Q Z;  3K2Z A;  2ACJ A;  3E6C C;  4HDU A;  2VE8 A;  2DW4 A;  3FX3 A;  2P6S A;  5KK1 A;  3V7C A;  4Y13 A;  2XAG A;  1FSE A;  4ENN A;  5HVQ C;  2JPB A;  1BOA A;  2JZY A;  5ED4 A;  1R7J A;  3KEQ A;  3CO7 C;  4Q4Z F;  4GCV A;  4EJT A;  4ESB A;  4M72 A;  3DFG A;  4LB6 B;  1XDU A;  1YLF A;  5E1X A;  2Q2E A;  4A12 A;  1S7A A;  2EA2 A;  3JSP A;  6PAX A;  3KZY A;  2DLL A;  4UVC A;  4CZZ A;  4UHT A;  3SHF A;  3WTS C;  1RIO H;  1F9N A;  2E7W A;  4LD5 A;  3N4M A;  3DPL C;  3RPQ A;  4A6E A;  1X3U A;  2R7F A;  1R36 A;  3OOP A;  3TO6 A;  3HRU A;  4Z2Y A;  1R22 A;  4AIJ A;  3JSO A;  2V1X A;  3PQK A;  5AIQ A;  3GYH X;  3NQO A;  3TO9 A;  2J5P A;  1LB2 A;  2PG4 A;  5H6R A;  1XCB A;  2RNJ A;  4XLN F;  1SMT A;  1IN4 A;  2AXL A;  4LK0 F;  2FU4 A;  1K79 A;  4Y15 A;  4MTE A;  3NRV A;  2C6Y A;  2EWN A;  2UXN A;  2L3D A;  1J75 A;  4ZYH A;  4IPA A;  5HS7 A;  2O03 A;  4L0Z B;  2ZFW A;  5F64 A;  4G9Y A;  4EV0 A;  5D4R A;  3FXQ A;  5BQT A;  3F22 A;  2QBY B;  4RB0 A;  1AWC A;  3HOS A;  2P8T A;  4ASN A;  3KET A;  2VN2 A;  2HFH A;  1PDN C;  2GA1 A;  4D0P A;  5CVV A;  4U7D A;  4AD9 A;  1NHA A;  4IXA A;  3HRT A;  2O61 A;  4P96 A;  1QGP A;  2K7L A;  1OPC A;  1DPR A;  2QWW A;  4KMU X;  2DK5 A;  3ZN0 A;  1BI3 A;  1KA8 A;  3R0A A;  4A5N A;  1FBS A;  2QUF A;  3V8J A;  1ON2 A;  5LEK A;  3J81 K;  2G9W A;  2D45 A;  3DP7 A;  4LGW A;  3I4P A;  5D5X B;  4ZH4 F;  1U5T A;  4WK8 F;  3M7G A;  1ULY A;  3ROU A;  1UB9 A;  2ESN A;  1XSV A;  2G7H A;  3I59 A;  3J80 Z;  2BGC A;  2RGV A;  2KIU A;  2Z9O A;  2K4B A;  2MA3 A;  2ZME B;  2DFI A;  4RGU A;  5ILV A;  2XAS A;  3FXR A;  3TKY A;  4WXH A;  2FE3 A;  1XSD A;  5HDN A;  2DU9 A;  1HBX G;  2DBB A;  5L3D A;  4WXC A;  3C7J A;  3QPH A;  4B8X A;  1B9M A;  4YFN F;  2MH2 A;  3P9I A;  1XDS A;  2NNN A;  2QQB A;  4QLC U;  3TO7 A;  2HKO A;  3T8R A;  1P4X A;  2IA0 A;  4L9J A;  2Y48 A;  2IA1 A;  1Z6T A;  3RYP A;  3T5X A;  1W7P D;  4AWX B;  1RUN A;  3BJ6 A;  4EM2 A;  3QP6 A;  4I02 A;  2L54 A;  3D0S A;  2D1V A;  3GFJ A;  3S2W A;  4HF2 A;  1ZG5 A;  1R1V A;  2EFW A;  3CUQ A;  3ML6 A;  1PUE E;  2EFO A;  3I0T A;  1ZRF A;  2IJL A;  2XRO A;  3C18 A;  1FC3 A;  4BAY A;  2FA5 A;  1PP7 U;  1S6L A;  1BI0 A;  1DP7 P;  1XMA A;  1IUY A;  4I09 A;  2RKH A;  1K6O A;  2PI0 A;  4XSX F;  3W6J B;  1J5Y A;  1VTN C;  5LHG A;  2OZU A;  3CO6 C;  4RAZ A;  5DCM A;  5LGN A;  1HSJ A;  3ERE D;  4U88 A;  4HA8 A;  1G6N A;  2B0L A;  5ICF A;  1LDK B;  3FXU A;  1HKT A;  1ZGJ A;  2BEO A;  4ZYG A;  2YR2 A;  2MBF A;  2ZNY A;  5E1W A;  4WCG A;  2GQQ A;  1YS7 A;  4NHJ A;  4FHT A;  5BOX A;  2E1N A;  4G7Z F;  1BBY A;  3LQR A;  4DNC A;  1OMI A;  2A3S A;  1RI7 A;  3RYR A;  2W24 A;  1W4M A;  4BYY A;  4HLY A;  2DPD A;  1F1Z A;  3IRQ A;  3FWE A;  3DF8 A;  4OIP F;  4JBA A;  3AAF A;  4U0V A;  3WTZ A;  1QO0 D;  3I54 A;  1J0R A;  5H20 A;  2HZT A;  3BY6 A;  3QPT A;  1AOY A;  3E6D A;  1IXR C;  2IVM A;  3H3U A;  2Z3Y A;  1XD7 A;  4HDV A;  3T8T A;  3ZPL A;  3FM5 A;  3FF5 A;  2AS5 F;  4G7O F;  2LKP A;  1PP8 F;  3VOD A;  2BBY A;  1F4K A;  3HHG A;  2KJB A;  5CLS A;  2WV0 A;  4ZYE A;  4I7H A;  3ZN1 A;  5BMZ A;  3K1P A;  4AIH A;  1P4W A;  2DAO A;  4P55 A;  2KJC A;  3IKV A;  1WQ2 A;  2FOK A;  3ULQ B;  4NB5 A;  4OIR F;  4N9I A;  1SMY F;  1V3F A;  2DI3 A;  4R8H A;  3FM3 A;  1QPM A;  2W57 A;  2CSO A;  4LLL A;  5E8I A;  2E7X A;  2PN6 A;  5ILS A;  2HWV A;  2IP2 A;  3WTX C;  4M9S A;  1HW5 A;  3DKW A;  1O3R A;  4R79 A;  2XUB A;  5L3G A;  1J2X A;  1MDM A;  3G3Z A;  5E20 A;  4G7H F;  1K7A A;  2Y0M A;  1LEA A;  1MJA A;  1HW1 A;  3CTA A;  4CXF A;  2FBK A;  2XAH A;  4ESJ A;  1IF1 A;  2R7D A;  4M74 A;  4U0W A;  5CVR A;  3F21 A;  2P7V B;  3W6K B;  5AIP A;  4CYD A;  1U2W A;  3JW4 A;  3L00 A;  4L9T A;  3L09 A;  1W7P A;  3MAJ A;  5FD5 A;  1T6S A;  4KMF A;  2G7U A;  5TRD A;  1WRJ A;  2RQP A;  1Z91 A;  3LA3 A;  1TQM A;  2ISZ A;  1YFH A;  4OU0 A;  2CW0 F;  5HLI A;  1XGS A;  2RN7 A;  1ZRE A;  3BZ6 A;  1U3E M;  4HX4 A;  3HRM A;  1FYK A;  2ZKZ A;  2MD5 A;  2ZJ2 A;  3GXO A;  1S7O A;  4A0X A;  4LFU A;  2K86 A;  1BIA A;  3MZY A;  1ZLJ A;  2HYF A;  3I71 A;  2VBX A;  1LQ1 A;  1BI1 A;  1IAW A;  1HW2 A;  2GAU A;  3JAM Z;  3BJA A;  5K5O A;  4MTD A;  2OQG A;  2W25 A;  4GXO A;  2DT5 A;  2GZW A;  3WU0 A;  3LA2 A;  1D5V A;  1FT9 A;  4G6Q A;  2DQL A;  3ECH A;  1H9G A;  1LDJ A;  2JSC A;  3O3K A;  5HDK A;  1IRF A;  4HLX A;  3SZP A;  1W5S A;  5D5U B;  4AVP A;  2F5F A;  5LHI A;  5ILU A;  3J7A O;  3ZP5 A;  3KZZ A;  4Q5S F;  4IF4 A;  2HEO A;  1KQ9 A;  5DUK A;  5HS8 A;  3QOP A;  3FMS A;  2NNY A;  3SQN A;  4Q47 A;  1OYY A;  2GXB A;  2L02 A;  2NYX A;  1XB4 A;  5EEH A;  1LNW A;  5LBQ A;  1Z05 A;  1ZG3 A;  1QNT A;  2M5W A;  1KU3 A;  3ZMZ A;  3DV8 A;  1TNT A;  4EQQ A;  2RVC A;  3FMQ A;  5IT3 A;  1YYV A;  3KP5 A;  2X0L A;  2P7C B;  3EYI A;  1L0O C;  2BE5 F;  1I1S A;  3BP8 A;  1Q1H A;  2A6H F;  5FLX K;  3F8B A;  1L3L A;  2CGP A;  4S04 A;  3RTR A;  2MLG A;  4A5M A;  4KYW A;  2FMY A;  2P5L C;  1Z9C A;  4HX8 A;  3B02 A;  3H92 A;  2QLZ A;  2MH9 A;  3HUG A;  2YPR A;  1T39 A;  3M8F A;  4HX7 A;  2FML A;  3RKX A;  1ZG1 A;  3DEU A;  5FLX Z;  2ETH A;  4G8X A;  4RB3 C;  1IW7 F;  3MWM A;  5JHU A;  2UWM A;  4UV9 A;  1DDN A;  3E6M A;  1XGM A;  3HYI A;  4GYG A;  3SXY A;  5LRS A;  5HLH A;  3GVA A;  1FP1 D;  2KRF A; 
#chains in the Genus database with same CATH topology
 4C9Y A;  2YSR A;  3DEW A;  1YJW I;  1JGG A;  1Y0N A;  3FDY A;  1VQ8 I;  4A3C J;  4KT5 C;  4ENJ A;  1ODD A;  4L0Y B;  2V1U A;  4YFX F;  4UVA A;  1X2M A;  1VQL I;  3MFK A;  3H1C A;  2Q1Z B;  2COM A;  1HDD C;  3ZMV A;  5DD4 A;  4CCN A;  1WJF A;  1MGT A;  4O5V A;  3TP3 A;  1JGS A;  2ZME C;  4M6Y A;  2WTE A;  2M1B A;  2VBZ A;  3U1K A;  2YUS A;  1ZHF A;  4D1Q A;  3JRC A;  4ENK A;  2DDB A;  3SEQ A;  3OY9 A;  4C3I J;  3ELK A;  4I98 B;  3GFI A;  4HW0 A;  3HHH A;  2XPU A;  2BY0 A;  2E1O A;  3W2V A;  1RR8 C;  3VDX A;  2MD0 A;  1FOY A;  2M34 A;  2HTS A;  1TTY A;  3CJN A;  5EGO B;  1G3S A;  2W48 A;  4EJU A;  3HXL A;  3KEO A;  4QIW N;  5CYV A;  2UV1 A;  1KU2 A;  5FKL A;  2V9K A;  4XRF A;  3KP3 A;  3JRG A;  4I0A A;  2P81 A;  1J9I A;  2LF7 A;  1R5H A;  3K4L A;  1TC3 C;  1E3H A;  1OLT A;  1LVK A;  3PJR A;  4RS8 A;  1IN6 A;  1B9N A;  2EFQ A;  2ME6 A;  3S8P A;  4BKX A;  1IO2 A;  2H6C A;  1SD5 A;  5F08 A;  2QQA A;  4JP0 A;  2R5Y A;  2CQK A;  4Y17 A;  1K4S A;  3S16 J;  1WSU A;  2A6E F;  2QYO A;  2DA5 A;  4IRH A;  3GLX A;  3MCZ A;  3SFZ A;  2GIV A;  4FCY A;  2Y0S A;  2VKV A;  4ZZL A;  4QTR A;  1TBX A;  2OCE A;  3ZQG A;  1BIB A;  3C1D A;  3ABU A;  1X19 A;  1IRX A;  1ENH A;  2QCO A;  2H8W A;  3LST A;  1AKH A;  3F72 A;  2LSO A;  1Z67 A;  2OA4 A;  3MZ8 A;  1LDD A;  2V4J C;  1K78 A;  4XLF A;  2VB6 A;  1FMW A;  1DU6 A;  4LG0 A;  2L5Q A;  1RR7 A;  4YRV A;  3J81 Z;  3V7R A;  4BU2 A;  3GCM A;  3FKJ A;  1Q1V A;  1RPW A;  1O3S A;  2DO7 A;  2E2J J;  5F1J A;  4MHG A;  4OAY A;  5D6F A;  4XOR A;  2VE9 A;  3ZRG A;  3BTC A;  1JKQ C;  2B63 J;  2V6C A;  3K4C A;  5LRR A;  1VQK I;  1MJ9 A;  4DGW B;  3PNV A;  2HOT A;  1RKT A;  3PNY A;  2L7Z A;  1WHU A;  3C2H A;  3CME I;  2DDA A;  3BPV A;  4PZJ A;  3PFI A;  3KZI C;  4HRI A;  2QKL B;  2F5D A;  4D7N A;  1U0J A;  4L9V A;  3WU1 B;  1W36 C;  4LLN A;  3GTG J;  2FEZ A;  3GBG A;  1U6G A;  4OAZ A;  3B6C A;  4UVB A;  3S1R J;  3ABK H;  4EGY A;  3GZ5 A;  1TLH B;  1LE8 A;  1A6Q A;  1FMV A;  2DT7 B;  1SD7 A;  3IUO A;  3WHC A;  3TDU C;  4BBR J;  3RI4 A;  2DQR A;  1BL0 A;  5ICE A;  1MSF C;  2CV1 A;  1QHG A;  4YIF A;  3S15 J;  2QVO A;  3LWF A;  4M9Z A;  1JT6 A;  5J8F A;  4H0E A;  3H5A A;  1SD4 A;  3HOZ J;  2WAF A;  3LSJ A;  3CC4 I;  3BR0 A;  2E5N A;  4S05 A;  1N75 A;  4QPQ A;  2VPL A;  1TZL A;  5E17 F;  2EA4 A;  4JYK A;  4RB2 C;  3MKW B;  3MMY B;  1BOB A;  1SAU A;  2L4A A;  3QOD A;  2VBW A;  3NWT A;  1BJA A;  4EGZ A;  2Y9Y A;  4MEX F;  1XGO A;  2HYJ A;  4XQF A;  2ZBK A;  4XLH A;  1OYW A;  1VZ0 A;  2QSH X;  3GX4 X;  3M1E A;  1OIS A;  1HKQ A;  2F6C A;  3RKY A;  4BQA A;  4E7K A;  1CGP A;  3KLN A;  3ZMS A;  1ETK A;  2WAQ N;  2DCE A;  1ZTR A;  4JK1 X;  2K4J A;  3G1L A;  3FXK A;  3CJQ B;  3GME A;  3V4G A;  5GAD J;  3IRR A;  5IT9 K;  2KT0 A;  2VBY A;  3SDG A;  2ELJ A;  3K1M A;  3ISP A;  2IS6 A;  3D5L A;  5EZG A;  2HVQ A;  1ZN2 A;  1YTY A;  4TV7 A;  2PJR A;  2CO5 A;  4FIS A;  5H6Q A;  2DMQ A;  4F92 B;  2LMD A;  4IHT A;  4I76 A;  3K69 A;  1D0Y A;  3K4B A;  1HST A;  1ONV A;  4LMY A;  3ZMT A;  5D5W B;  2A69 F;  2WC2 A;  3HBL A;  3K9T A;  4L9N A;  2R5Z B;  5GTH C;  1P92 A;  3I64 A;  1KU9 A;  3K10 A;  2CFO A;  2V1D A;  3BG9 A;  4EM0 B;  3GUD A;  2FBH A;  3VYU B;  3LAJ A;  4CA0 A;  2UZK A;  2GM4 A;  2X6X A;  1TT5 B;  4PFP A;  2DFF A;  1XSX A;  4D5F A;  2Q2E B;  4BBS J;  4LJZ F;  3K1N A;  3ZQI A;  1XX5 A;  3E5Q A;  3CD6 I;  1S7E A;  4J01 A;  3CZ6 A;  2D1H A;  5KVR A;  1U8B A;  1GVJ A;  3FZV A;  2K9Q A;  1CF7 A;  1UST A;  3WTW C;  1ETQ A;  1Y39 A;  2VKE A;  3AG1 H;  3JR9 A;  2RV8 A;  1SFU A;  1LFB A;  2ZSH B;  3BLY A;  1QZZ A;  3DCF A;  1MZB A;  3GFM A;  2HNH A;  2VQH A;  1S8N A;  3H9Q A;  2WB1 A;  4MQV A;  2QKM B;  2HZD A;  3I58 A;  4U0Y A;  5BS6 A;  2PMH A;  2PBI A;  2CWE A;  2HS5 A;  2HXI A;  2BZT A;  2LYC A;  2EIL H;  2MW8 A;  2VL8 A;  3IH2 A;  2DA6 A;  4L18 B;  2NVY J;  3CDL A;  4NQW A;  3PUF A;  3WE2 A;  3KCC A;  3LFK A;  2EV0 A;  5E3M A;  2WB1 N;  2W84 A;  2NS8 A;  1MBK A;  3F8C A;  1TL8 A;  3PM1 A;  1D1A A;  4UV8 A;  1F5T A;  4CHU A;  2EV6 A;  1UAA A;  5J1Y A;  1ZGA A;  2J5O A;  3U1D A;  4IKF A;  3H3V K;  2CV0 A;  1SAX A;  4GDF A;  5CJ9 A;  3CCV I;  2ZO4 A;  4I01 A;  1PVE A;  3KYC B;  4BE0 A;  1R9T J;  3BCA A;  2OU2 A;  1SD6 A;  1U78 A;  2R4G A;  4BE2 A;  4RGS A;  2HDD A;  5J6X A;  1XPX A;  4A3J J;  1LFP A;  4KIC A;  2LRD A;  1MSE C;  4KN7 X;  3BRO A;  3TOB A;  4PJL A;  1P4A A;  4IQ4 A;  3QP5 A;  3I4N J;  2W7N A;  4P9U A;  2KMU A;  1UG0 A;  3P9C A;  2IPQ X;  5B66 C;  2FNP A;  5FGM A;  3PNT A;  5GP9 A;  1S72 I;  3OIQ A;  4MNU A;  2VJJ A;  3IHU A;  3R0J A;  2M3A A;  3HSR A;  4HQM A;  3WTU C;  3TMO A;  1JKO C;  3F8F A;  4C2T A;  3M4O J;  4FET A;  4M3F A;  1WJB A;  1A04 A;  1YS6 A;  4KA4 A;  3F8N A;  2CFX A;  4LOC A;  3CCU I;  2IS2 A;  4L5I A;  4P1W A;  2DOA A;  2E36 A;  1E0E A;  2IAI A;  2L9N A;  3DPT A;  3OOU A;  4XON A;  4PSW A;  1PUF A;  3LMM A;  1O57 A;  1JE8 A;  1STZ A;  4HNT A;  3A1Y A;  2FUG 2;  1WWX A;  5K1Y A;  1YW8 A;  3QPL A;  2FQ3 A;  2HGC A;  1ITY A;  4RAY A;  3HC7 A;  4N4N B;  4ENM A;  3KFW X;  2BY2 A;  5D8K B;  4CGZ A;  3LOC A;  3O2P E;  4XN3 A;  1IN8 A;  3EUH C;  4CYC B;  4UUS B;  3B6A A;  1DU0 A;  2LDU A;  3L2C A;  1YW7 A;  4FAS D;  3JRB A;  2IW5 A;  3SZT A;  1USS A;  3RDI A;  2W00 A;  2XKO A;  3QYF A;  4PGH A;  2FNA A;  3AL0 C;  5DYM A;  2KIM A;  1R58 A;  3GF2 A;  1NG7 A;  1Y1W J;  2STW A;  4AID A;  1U5T B;  1GHC A;  2JRT A;  5CVJ A;  2JPC A;  2FD5 A;  4DZP A;  2ZXJ A;  3M1C A;  1LVA A;  2K27 A;  4X6A J;  4UUT A;  3DLA A;  2ZCW A;  5DCF A;  1B72 A;  1VQN I;  4GO1 A;  1M1E B;  4JX5 A;  4B1R A;  2ZXI A;  3W2W A;  2LKX A;  2QBY A;  4YFK F;  3OWT A;  3G73 A;  5C4J J;  3O8H A;  3HSF A;  3KP6 A;  4E7S A;  1FBU A;  4M73 A;  4YG2 F;  5FB2 A;  4XKB A;  5EGO A;  4BHB A;  4XM3 A;  1K83 J;  1FJL A;  3WGH A;  2A07 F;  4HQE A;  3DWL E;  1RNL A;  4KIT B;  4N4O B;  2Z5U A;  2QZ8 A;  3ZQH A;  5DUI A;  4WX9 A;  3VB2 A;  2VPR A;  3G6E I;  2H6B A;  2OV7 A;  4RAF A;  2Y75 A;  4IRG A;  3S3M A;  2OBP A;  2R7O A;  2DXI A;  1GXP A;  3R60 A;  3HTS B;  4P9F A;  2EV5 A;  2GXG A;  4ZZD A;  1MW7 A;  2XVC A;  2A5Y B;  3O6B B;  4OOI A;  5FLM J;  1R6R A;  3CDH A;  3ZQ7 A;  1R23 A;  1AU7 A;  4OWR B;  1U9O A;  5EG0 A;  4RGR A;  2XV4 S;  4EMS A;  1ZAO A;  3W6V A;  1FEX A;  1BW6 A;  5ERI A;  3K2A A;  3GTO J;  2PMZ A;  4MLO A;  1G3T A;  1Z1D A;  2QSG X;  4KDP A;  5DV5 A;  1IRG A;  1NH3 A;  1TWC J;  4PCQ A;  5FJ8 J;  3BTI A;  3COA C;  3LSI A;  2YU9 J;  4YII A;  2Y9Z A;  1K61 A;  2Q8K A;  1N77 A;  1T98 A;  3IAS 2;  2R7W A;  4A3G J;  3M8E A;  1YI2 I;  2EQR A;  1V4R A;  3RIR A;  5HS9 A;  1IDY A;  3OYI A;  1IXS B;  2OQR A;  4A2U A;  3PSI A;  4K2E A;  3CUQ B;  1ZK8 A;  1ZLK A;  1BC8 C;  4EVI A;  5C3E J;  2ECB A;  1U8R A;  2X4H A;  4ZJZ A;  1ZAR A;  4G94 A;  1SFX A;  3OYG A;  3RPU A;  2O8X A;  2ZME A;  5J47 A;  2VC0 A;  2KIQ A;  1TQP A;  4CO8 A;  3KE2 A;  4A6D A;  2QQ9 A;  2HTJ A;  1JXS A;  2O3F A;  2IT0 A;  4M3D A;  4YEL A;  2GBY A;  5FFZ A;  2WAD A;  5J3L A;  3ZOB A;  3QQA A;  1ETX A;  4E7Z A;  2LFB A;  4C2M J;  2LRE A;  4KJZ A;  1FZP B;  2UXX A;  4Y33 A;  1YRN A;  4IHX A;  1ZYR F;  1EH6 A;  3DKX A;  4KFC A;  1OYI A;  2DPU A;  2KPM A;  2HVR A;  3FMR A;  5H2F C;  2R7U A;  2CG4 A;  3GW2 A;  1DUX C;  1HXD A;  3K4N A;  2M4G A;  4HOB A;  1KGS A;  1KYZ A;  3OYL A;  2FRH A;  4E7J A;  2DMU A;  3ESW B;  5A2Q K;  1UHM A;  3KIO A;  1B6A A;  5DD8 A;  1SAN A;  3WGI A;  2KZV A;  1ZH5 A;  1KU7 A;  2FF4 A;  1FSH A;  3F6O A;  1IJW C;  2DK8 A;  1TWG J;  2LNB A;  3WOD F;  3K0L A;  1ETW A;  3I55 I;  2H27 A;  5LGU A;  1UCR A;  1FYM A;  4A93 J;  3G1M A;  2RAE A;  3CF2 A;  5K5Q A;  2L7F P;  3CP2 A;  3GLL A;  3UKG A;  3PQJ A;  2NRA C;  3DBH B;  1IZ1 A;  4WF2 A;  4LG3 A;  4AYB A;  3ZGK A;  2KLO A;  5F1R A;  2I8D A;  5HOD A;  1A5J A;  3CJR B;  2F5E A;  4A0Z A;  2JA5 J;  3CCY A;  5IYD J;  1XN7 A;  3AFH A;  4HNV A;  3QYB A;  2R7S A;  5BPD A;  5GAH J;  9ANT A;  4OIO F;  3IAM 2;  4E7I A;  1E17 A;  4LIU A;  3S1M J;  1I3Q J;  4BQO A;  2H94 A;  1YJN I;  2V9P A;  1J09 A;  4XKC A;  4NDL A;  1YIO A;  1R49 A;  4HPQ A;  1ZRC A;  5ICG A;  2EIM H;  3QOE A;  3IL2 A;  1JI8 A;  2STT A;  2ZXW H;  3GO5 A;  3CES A;  4R1H A;  2M87 A;  2ICW G;  4LB5 A;  2QSF X;  4ESF A;  3FXO A;  5JI6 A;  2M7B A;  3M07 A;  2EB7 A;  1I27 A;  1MH4 A;  3R4K A;  4E4H A;  4BAC A;  4IJA A;  1ZR2 A;  1MND A;  3D5R C;  2ZJP F;  2XGE A;  3W2A A;  1ZGW A;  1MNE A;  3WG9 A;  3H5N A;  2KL4 A;  3BR2 A;  5JFR A;  2PLY A;  1H8A C;  2XF5 A;  1D8J A;  2AXT C;  4B09 A;  3PFY A;  4C3J J;  2XAQ A;  5TIS C;  3EYY A;  4LIV A;  4JQF A;  1JKR C;  2K85 A;  2M30 A;  2RDP A;  2DMN A;  4II2 A;  2E35 A;  3LQQ A;  3T1B A;  3R61 A;  3LSP A;  2A68 F;  3I56 I;  2ADU A;  2DT6 A;  3U9G A;  4CIC A;  3A02 A;  3VPR A;  2BW3 B;  2P6T A;  3ZXS A;  3KEY A;  4I0B A;  3LSH A;  3VEP A;  3CC7 I;  1EH7 A;  1UHW A;  4OIQ F;  1T0F C;  3KP7 A;  5E3O A;  4UB8 C;  5BPI A;  2V6E A;  2OC6 A;  2OUM A;  1OCP A;  3RSN A;  3S3O A;  3MQ0 A;  5B5E C;  1FBQ A;  1GVD A;  1LFU P;  1X1C A;  2YU3 A;  4X0G A;  1VI0 A;  2ESH A;  1BC7 C;  3ABT A;  2JQ7 A;  1UFM A;  2FJ1 A;  2L0K A;  1U9N A;  2BY3 A;  3ASO H;  1B4A A;  1R00 A;  4XRM A;  4M3G A;  4XRS G;  3V8K A;  4GYI A;  4XBF A;  1R4M B;  4A3K J;  1FOX A;  3N97 A;  4N0B A;  4GGG A;  4OMZ A;  3E97 A;  3OR1 C;  1D1B A;  2W1O A;  3OV8 A;  3NAR A;  3Q9V A;  3CF5 F;  2CV2 A;  5DTD A;  1MDM B;  2XC7 A;  5J1R A;  1K6Y A;  2I10 A;  3HG9 A;  1EF4 A;  3LSG A;  3M3Y J;  1PJR A;  2LF8 A;  4BGD A;  1D1C A;  4RAG A;  2CUZ A;  1HQC A;  3WU2 C;  1VND A;  3LA7 A;  4RMN A;  1RZ4 A;  4HF1 A;  1FNN A;  2NAZ A;  3GZ6 A;  2L9R A;  3LSM A;  3JTG A;  3K70 C;  1S29 A;  3HOT A;  1QBJ A;  5LGT A;  2GWR A;  2VT2 A;  3WGG A;  1A6I A;  1O7L A;  4HF0 A;  3Q0W A;  2K9N A;  2HOE A;  1W7P B;  2X1C A;  1VFC A;  2VOP A;  2M45 A;  1VQ6 I;  1HKS A;  2ZFU A;  3MKL A;  2TRT A;  1WFX A;  1B8I B;  4J19 A;  1WJA A;  1EV7 A;  2YX4 A;  1E2X A;  2IS4 A;  3CLO A;  2LKS A;  5EEA A;  4DQ2 A;  2HPI A;  3NEU A;  5LLQ A;  2NOJ B;  5LEJ A;  3HOV J;  2LC2 A;  2KIF A;  2GA2 A;  3VOE A;  3OL3 A;  2QQ8 A;  2JA2 A;  3EET A;  5CVI A;  2MYS A;  2LD5 A;  2EK5 A;  2E2H J;  2HVS A;  2R7X A;  5IYC J;  4BEH B;  2BYV E;  2ME0 A;  3TED A;  4OIN F;  3BTJ A;  3VFZ A;  4KUM A;  3GZN B;  3GWZ A;  3J80 K;  2XPV A;  1R1U A;  1Z21 A;  1KYW A;  3WG7 H;  3JRD A;  1F43 A;  2ISY A;  5K7H A;  2KRC A;  3H36 A;  1XCV A;  2HYG D;  1IRZ A;  4BNC A;  5L3B A;  2VUM J;  5E18 F;  4B48 A;  3RQ4 A;  4FT8 A;  3SFI A;  3ZMU A;  4KIG A;  4M9X A;  3I53 A;  3H0D A;  2PQ8 A;  4U87 A;  4KIB A;  3WTT C;  2VOO A;  3DTI A;  3FK7 A;  5KHD A;  1FWZ A;  2V79 A;  4ITV A;  3LNQ A;  3DXJ F;  4XNF A;  5HLG A;  3OL4 A;  1YOV B;  3R6S A;  1FIP A;  2LLK A;  2MLK A;  3GTQ J;  5L3C A;  3B73 A;  3E6B A;  1GXQ A;  3E1S A;  1ZR4 A;  3PSF A;  3BOQ A;  3JCU C;  2LY9 A;  3BQY A;  2DYS H;  2FBI A;  1TT0 A;  2KDZ A;  3BJO A;  2GXA A;  4P5O A;  1IUF A;  3GTP J;  1W1W E;  3L9F A;  2BXZ A;  1YQA A;  2CQX A;  2IRF G;  4UXN A;  1O7F A;  5E8G A;  5J8C A;  4RA2 A;  3UNG C;  5F0C A;  4HV6 A;  2M8E A;  2EIK H;  3BR6 A;  3F8M A;  2JT1 A;  4IVN A;  1T2K A;  1QQI A;  1J7K A;  1UJ8 A;  4G6D A;  3G1O A;  5B3S H;  2F2E A;  2BV6 A;  1FOK A;  1FLI A;  2KQR A;  3SZG A;  4F93 B;  5FRN A;  1R5G A;  2W4S A;  3KPH A;  1ZRD A;  3BPX A;  2WAQ A;  3A01 A;  5CQG A;  1VQM I;  3FHZ A;  2JK3 A;  1G59 A;  2Z33 A;  2L7K A;  1NK3 P;  1BR4 A;  1XGN A;  3F23 A;  3U21 A;  4F7Z A;  1WCM J;  4BJ6 C;  2XGX A;  4BUP A;  3MEX A;  1H9T A;  5ICC A;  1H0M A;  4ZC3 A;  3E7L A;  2Z99 A;  1BI2 A;  1J59 A;  3F6V A;  3T0Y A;  2L01 A;  3CP8 A;  2VXZ A;  3C3W A;  4HEA 2;  5HNH A;  3BZC A;  3KP2 A;  1TW2 A;  1W5C C;  2OTJ I;  1O3T A;  1GT0 C;  4PJJ A;  2XRN A;  4CCM A;  3EUH A;  3EQL F;  4XLP F;  5M5W J;  3V7S A;  3TOA A;  1Z3Y A;  3HZJ A;  1Z0X A;  2DTR A;  4KIF A;  4A3F J;  4RLQ A;  2NS0 A;  4C3H J;  5D6E A;  2XIG A;  4XLE A;  3TDZ C;  5EEG A;  2Q0O A;  4Y4R A;  3X2Q H;  1D8K A;  1VQO I;  4BH9 A;  1YIT I;  3ZMD A;  1D3Y A;  3QU3 A;  5LD2 C;  1CQT A;  1REP C;  2CQN A;  3IKT A;  2F5C A;  4FX4 A;  5IOZ A;  2WWY A;  2ID3 A;  4MGR A;  3VSK A;  1B59 A;  4WWC A;  3UR3 C;  3MD2 A;  4EEF G;  3L7W A;  4A69 C;  4CCL A;  5DDG A;  1FX7 A;  1JHH A;  5IT9 Z;  4LLG F;  1I1G A;  3CMY A;  3S32 A;  2R3S A;  4HYE A;  4RB1 A;  2A61 A;  1LUJ B;  1O3Q A;  3FXL A;  2Z2S B;  1YW9 A;  3PO3 J;  4PSX A;  1T08 B;  3EDP A;  4HG2 A;  5D8L B;  3LAP A;  5C4X J;  2X6Y A;  2HDC A;  2HXO A;  1BM9 A;  3E3V A;  4KN4 X;  4BHP A;  1YO5 C;  4L5J A;  1MJB A;  5FD6 A;  3HIF A;  2FX0 A;  4EAT A;  4A3E J;  2H09 A;  4E6K G;  2OZ6 A;  4RDU A;  3HL2 A;  1IXC A;  2RC4 A;  3DKY A;  4II3 A;  4PDK A;  5JHF A;  5DM7 F;  2KKO A;  3G4S I;  2ELK A;  4O3M A;  3HUG B;  4XIC A;  2XDV A;  4WXD A;  5E1Z B;  1ETY A;  4EM1 A;  4IX7 A;  4IHV A;  4O6J A;  3I4M J;  1FIA A;  1FP2 A;  2OD5 A;  2X6O A;  4B3X A;  5C44 J;  1EKE A;  4UNO A;  1ON1 A;  2PEX A;  5HDG A;  3U2R A;  3K70 D;  1G3W A;  3HGY A;  3HTU A;  4PGG A;  2W85 A;  3HPG A;  3WTV C;  2HR3 A;  4ABZ A;  1FPQ A;  3W3C A;  1G3Y A;  3MZH A;  2MG4 A;  5EZH A;  1R1T A;  2A6T A;  3LSR A;  1TW3 A;  1U5T C;  2YX7 A;  4BHC A;  4NUB A;  5F6F A;  3REO A;  2V9V A;  3I5U A;  3TW6 A;  2LBF B;  5AON A;  1IN5 A;  5M3M J;  3L2V A;  3S2D J;  3AG3 H;  3HDD A;  2HPM A;  2FSW A;  4XOT A;  2H1L A;  4B47 A;  4ZTF A;  2XHK A;  5CVU A;  3VWB A;  4V2F A;  1B1B A;  3CCJ I;  3BT9 A;  5TJJ A;  5HOO A;  5F27 A;  1MMG A;  2L4M A;  4XRS A;  4ZYD A;  1WZ2 A;  1LEB A;  2BHZ A;  1APL C;  3HOU J;  1MMD A;  2VT3 A;  1DPU A;  3CUO A;  3Q9S A;  1C0W A;  2IXS A;  1UZC A;  2B7E A;  3DQV C;  3DU6 A;  3GFL A;  2LOO A;  2XAJ A;  2LY2 A;  2PFB A;  4HBL A;  3RJP A;  4MEY F;  3E5X A;  1Y6I A;  2P5K A;  2VXD A;  3TGN A;  1EH8 A;  2HQN A;  2EFN A;  2JVG A;  3BWG A;  5FLV A;  4PJM A;  2TDX A;  5BNG A;  1MMN A;  3VYS B;  3OYK A;  4N9H A;  1I5Z A;  5D5V B;  3H3Z A;  4HV5 A;  3GEZ A;  3PL8 A;  1MMS A;  4CUG A;  3AG2 H;  4ON0 A;  4AIK A;  2D2W A;  2MGQ A;  2VIX A;  3NWS A;  4DIQ A;  4DW6 A;  1I3A A;  1OKR A;  2HU9 A;  2ECC A;  1BN5 A;  1HOM A;  1LJ9 A;  2EIJ H;  4KNY A;  2P5V A;  4LK1 F;  2X1E A;  2RNG A;  3K4J A;  1T38 A;  4IQJ A;  4AVZ A;  2QM3 A;  4EJO A;  3G71 I;  1JHF A;  2K02 A;  1KQ8 A;  1YG2 A;  4A3B J;  3G2B A;  2F4I A;  3OR2 C;  3M9A A;  4QWQ A;  4CDG A;  2EZL A;  3GTM J;  3L1P A;  1K4T A;  5DEQ A;  3RKW A;  4CCK A;  3WTY C;  2K3F A;  1G4D A;  3IC7 A;  3HSE A;  3V8L A;  4DYQ A;  5KNL A;  5K5R A;  2XPW A;  1W0T A;  1OR7 A;  1AKH B;  5M5Y J;  2H8R A;  4FX0 A;  1MKM A;  1K78 B;  2CW8 A;  4XID A;  2OAZ A;  2AQF A;  3ONQ A;  2PJP A;  4PJ0 C;  4LG0 B;  5J4Y A;  1MBH A;  1WI9 A;  5DM6 F;  2P4W A;  3J7Z I;  3CUQ C;  1WPK A;  4BDY A;  3I59 B;  4M6X A;  3CDI A;  2XAF A;  1MBE A;  4DJA A;  1P7J A;  3HGG A;  4EJW A;  1QZY A;  2EZK A;  2BY1 A;  2NVU B;  3FXM A;  1IC8 A;  1KON A;  1JUS A;  1RKW A;  2EFP A;  4HAM A;  3D1N I;  1NG6 A;  3F3X A;  2CRG A;  1GV2 A;  1R5I D;  3H0G J;  2JTV A;  2Z16 A;  1XMK A;  3ECO A;  4Q48 A;  1A35 A;  1IN7 A;  1KQ0 A;  4DYC A;  1V54 H;  2D5V A;  4UUV A;  1O4X A;  2O6G E;  4EJV A;  3WE3 A;  3QRF F;  1LE8 B;  1P9Q C;  4Z6Y A;  3P9K A;  4IHS A;  3RZD J;  2VC1 A;  1TQI A;  2FXA A;  3HKZ N;  4MQ9 F;  3K4M A;  2KFD A;  5K7Z A;  2LVS A;  2F4M B;  2EZI A;  4BXU A;  2R7R A;  3H9G A;  2ELH A;  3HPH A;  4B4C A;  1B8I A;  1X4O A;  4L5E A;  1Y0U A;  1D5Y A;  2X6W A;  3E5U A;  4E70 A;  5FFX A;  4XR6 A;  3BG3 A;  2HQ5 A;  3E0J B;  4HZF A;  2QEN A;  2VON A;  1OCC H;  2HKX A;  4H4K C;  2LH9 A;  2O9L A;  4I2O A;  1Z7U A;  1MH3 A;  3ZCO A;  1T0F A;  5J40 A;  2XKP A;  2HQR A;  3OYE A;  2DA3 A;  5E3L A;  4M71 A;  3Q0V A;  5FO5 A;  3HOW J;  4I99 C;  5CKT A;  3VYT B;  5GPC A;  2EIN H;  3RCO A;  2O0Y A;  1V5G A;  3JAM K;  5LHH A;  4OMY A;  2XB0 X;  1QHH D;  2EZH A;  5D4S A;  5GAG J;  1MNM C;  3BDD A;  3QAH A;  5JR3 A;  4HNU A;  2MC3 A;  1TP4 A;  2E60 A;  2PJR B;  2DMP A;  5TGT A;  2CYY A;  2RRE A;  5K7F A;  2CU7 A;  1HLV A;  4RGX A;  4ETS A;  3Q5F A;  1YE9 A;  3KP4 A;  1FY7 A;  3IWZ A;  3BCB A;  4NC6 A;  5JVT A;  1QRY A;  3NAU A;  2CJJ A;  2DYR H;  4A0Y A;  1S3J A;  1FTZ A;  5DCM B;  2EPF A;  3P7N A;  5IY5 H;  1JTY A;  3CMA I;  4IRI A;  2KRH A;  4U7B A;  2E1M B;  3A03 A;  3TQN A;  2BHY A;  4W1U A;  2VOD A;  2Y2Z A;  1I6X A;  1Z6R A;  3IWF A;  1DGR M;  2DA7 A;  4V2G A;  3JTH A;  3OIO A;  2PMU A;  2IA2 A;  5L3F A;  1G2H A;  1TNS A;  1SFE A;  1CF7 B;  1XMX A;  3VYR B;  2NOG A;  1OCZ H;  2L2O A;  2EJR A;  3N05 A;  2JA7 J;  1P2F A;  1AHD P;  3TL4 X;  2XGC A;  2X9D A;  1WKM A;  2E1C A;  1H89 C;  4XSZ F;  2DA2 A;  4AC0 A;  1OR7 C;  1P6R A;  3F9K A;  1RUO A;  5L3E A;  3IH3 A;  1MD0 A;  1BA5 A;  2Y31 A;  3KLO A;  1FYL A;  3EUA A;  1W5T A;  4ANJ A;  2ZNZ A;  3HRS A;  1POG A;  2R7V A;  1DP3 A;  3LFU A;  3QU6 A;  4NQW B;  5A2Q Z;  3K2Z A;  3A0B C;  3IH4 A;  3OYD A;  3E6C C;  2ACJ A;  1JUP A;  4HDU A;  1PYV A;  2VE8 A;  2DW4 A;  3FX3 A;  2P6S A;  3JRF A;  5KK1 A;  2DOD A;  3V7C A;  4Y13 A;  1R71 A;  2VAS A;  4F52 A;  2HQA A;  2XAG A;  3ZQF A;  3MKZ A;  1SVM A;  1FSE A;  3FIS A;  4ENN A;  5HVQ C;  2OTL I;  2X1D A;  1XTA A;  2JPB A;  2M0M A;  2M2E A;  1BOA A;  2JZY A;  2I5U A;  5ED4 A;  2K9S A;  1R7J A;  3JRH A;  4S0H B;  3KEQ A;  2IEK A;  3CO7 C;  3GTL J;  4Q4Z F;  4GCV A;  4EJT A;  2R5Z A;  4ESB A;  2K9L A;  3DBL B;  4M72 A;  3DFG A;  4B3A A;  1V5F A;  4LB6 B;  1FTT A;  1XDU A;  2HDW A;  1BW5 A;  1OCO H;  3FKI J;  3OYJ A;  1SC7 A;  1YLF A;  2ID6 A;  5E1X A;  2WAE A;  2Q2E A;  3OS2 A;  4A12 A;  1S7A A;  2WA0 A;  2EA2 A;  3JSP A;  4M3E A;  2OF7 A;  6PAX A;  4NBQ A;  3KZY A;  5FKM A;  2DLL A;  4UVC A;  1SVO A;  1TWA J;  4FQG A;  4XK4 A;  2VLA A;  1DQU A;  4CZZ A;  4UHT A;  3SHF A;  3WTS C;  1RIO H;  3RZO J;  1F9N A;  3JRE A;  2E7W A;  2ZJQ F;  3BQZ A;  4LD5 A;  3LL7 A;  1NK2 P;  3N4M A;  3JRA A;  3DPL C;  1Y56 A;  3GTK J;  3RPQ A;  4A6E A;  1X3U A;  2R7F A;  1R36 A;  1HCR A;  3OOP A;  3K6G A;  3TO6 A;  3HRU A;  4Z2Y A;  4BJ5 C;  1R22 A;  4AIJ A;  4M6V A;  2F4O B;  5M5X J;  3JSO A;  4F91 B;  2V1X A;  3PQK A;  5AIQ A;  4ZDO A;  3QPS A;  1X4P A;  4CCO A;  3L2Q A;  1VQ4 I;  1SFK A;  3GYH X;  3NQO A;  1X3Z B;  3TO9 A;  5FKO A;  2J5P A;  1LB2 A;  2PG4 A;  2M8G X;  4Y52 J;  2AO9 A;  2FQ4 A;  5H6R A;  1XCB A;  3CJT B;  3S1Q J;  3SDB A;  2RNJ A;  4XLN F;  1SMT A;  1IN4 A;  2AXL A;  4LK0 F;  2FU4 A;  1ETV A;  1K79 A;  4Y15 A;  1ERD A;  1GV5 A;  4MTE A;  3NRV A;  2WY8 Q;  2EWN A;  1X58 A;  2C6Y A;  2UXN A;  2L3D A;  3FHN A;  3RKQ A;  1J75 A;  4ZYH A;  3HEF A;  2NS7 A;  4PUS A;  4IPA A;  4V19 K;  4C2U A;  3HJE A;  5HS7 A;  1DGW Y;  2O03 A;  4L0Z B;  2ZFW A;  5F64 A;  1X3W B;  4G9Y A;  1B72 B;  4EV0 A;  1T33 A;  5D4R A;  3FXQ A;  2MSY A;  5BQT A;  3F22 A;  2QBY B;  4RB0 A;  1AWC A;  5B1B H;  3HOS A;  2P8T A;  4ASN A;  3KET A;  2JMW A;  1Z7L A;  2VN2 A;  2HFH A;  2IBD A;  5HLT A;  1PDN C;  3A4C A;  2GA1 A;  4BDZ A;  4M3B A;  4D0P A;  5CVV A;  4U7D A;  2F48 A;  5M3F J;  3JRI A;  4AD9 A;  1NHA A;  3OSF A;  1YX5 A;  2A5W A;  4IXA A;  3HRT A;  2O61 A;  5F04 A;  5F0F A;  4P96 A;  1QGP A;  1BJZ A;  2K7L A;  2VQL A;  1OPC A;  2E34 A;  4JX4 A;  1DPR A;  1QVU A;  2QWW A;  2BVM A;  4KMU X;  2DK5 A;  3F0C A;  3ZN0 A;  1BI3 A;  1KA8 A;  3BR1 A;  2TCT A;  3R0A A;  2WV1 A;  4A5N A;  1FBS A;  4W97 A;  3HOX J;  2QUF A;  2XF7 A;  3V8J A;  4DOZ A;  4UB6 C;  5KCM A;  4CYC A;  4UUS A;  2B9S A;  2CQQ A;  1ON2 A;  4RM3 A;  4RM2 A;  2VI6 A;  5LEK A;  5EG0 B;  3J81 K;  2IGK A;  2G9W A;  2D45 A;  3DP7 A;  3DTK A;  4LGW A;  1N78 A;  1BR2 A;  4XMY A;  3I4P A;  1LKX A;  2ZB9 A;  5D5X B;  1VQ5 I;  2VJ5 A;  4D7M A;  2BOL A;  3FBN B;  1QVT A;  4XLC A;  2E19 A;  1P7I A;  4ZH4 F;  3I3L A;  2K5C A;  1U5T A;  4WK8 F;  2FOW A;  3M7G A;  1ULY A;  2QGU A;  4ZYA A;  3ROU A;  2K3P A;  2YS9 A;  1UB9 A;  1A36 A;  2ESN A;  1XSV A;  2Y0S N;  2P0W A;  2DFH A;  4KIS A;  4XOP A;  2OJE D;  2KZG A;  2G7H A;  3I59 A;  3J80 Z;  2M0C A;  3QWL A;  3AG4 H;  3DU5 A;  2BGC A;  5IP7 J;  2BVL A;  2RGV A;  2KIU A;  2Z9O A;  2K4B A;  2MA3 A;  2ZME B;  4AU7 A;  5KAF C;  1A31 A;  2JVH A;  2DFI A;  4RGU A;  5J4V A;  3PIO F;  3CCM I;  4IHY A;  3D5S C;  4BJT A;  5ILV A;  2XAS A;  3FXR A;  3TKY A;  3S2H J;  4WXH A;  2FE3 A;  3OS0 A;  1XSD A;  3BC8 A;  5HDN A;  2DU9 A;  4RBO A;  2VQC A;  1HBX G;  2DBB A;  5L3D A;  2R7T A;  4WXC A;  1IV8 A;  1MMA A;  3C7J A;  3QPH A;  4B8X A;  4BQN A;  1X1B A;  1YRN B;  2CS3 A;  3OYH A;  3S93 A;  1B9M A;  4YFN F;  2MH2 A;  3P9I A;  2PX9 A;  1XDS A;  2CH0 A;  4YEJ A;  2NNN A;  2QQB A;  4QLC U;  3TO7 A;  2HKO A;  3T8R A;  1WVR A;  2DOE A;  2IGN A;  4Y3O A;  3ZQC A;  1P4X A;  2M4K A;  1RES A;  2IA0 A;  4L9J A;  4XN0 A;  4AM3 A;  2Y48 A;  4BS9 A;  2DJI A;  4NNJ A;  2Z1D A;  2IA1 A;  4IL6 C;  3DTE A;  1Z6T A;  3RYP A;  3T5X A;  1W7P D;  2KIS A;  4AWX B;  4IOC F;  1RUN A;  5FKK A;  1F36 A;  3BJ6 A;  4G12 A;  4PFO A;  4EM2 A;  2O7O A;  3QP6 A;  4I02 A;  3H9J A;  2L54 A;  1MBF A;  3ERM A;  2XGD A;  4GFB A;  3D0S A;  2D1V A;  2R7Z J;  3QYE A;  2RQQ A;  2DN0 A;  3GFJ A;  1I6H J;  3S2W A;  3SYT A;  3ZQL A;  4HF2 A;  1ZG5 A;  1R1V A;  2ZXH A;  3FBI B;  2EFW A;  3CUQ A;  3ML6 A;  1PUE E;  2EFO A;  3I0T A;  1ZRF A;  2IJL A;  2XRO A;  3C2G A;  2LG4 A;  1UMQ A;  1WJC A;  1RET A;  3C18 A;  1XC5 A;  1FC3 A;  2V1N A;  4BAY A;  2FA5 A;  1PP7 U;  3S1N J;  1JTX A;  1VQ7 I;  1S6L A;  3VSL A;  1BI0 A;  3DLL F;  1DP7 P;  5GPA A;  4DYR A;  2LP0 A;  1XMA A;  1IUY A;  1MBJ A;  2O5R A;  4I09 A;  3IP4 B;  2RKH A;  1K6O A;  2PI0 A;  4RLF A;  4XSX F;  3W6J B;  1J5Y A;  1VTN C;  3A2K A;  5LHG A;  2OZU A;  3CO6 C;  4KT6 A;  4RAZ A;  1VQP I;  3SJM A;  5DCM A;  4X1E A;  2F5V A;  1HA8 A;  5LGN A;  1HSJ A;  2VJ4 A;  4DBQ A;  2X51 A;  3ERE D;  2XRL A;  2MC4 A;  4U88 A;  4HA8 A;  4MIM A;  2KP6 A;  2E5Z A;  3BG7 A;  1G6N A;  2B0L A;  5IYB J;  5ICF A;  1LDK B;  3V42 A;  3FXU A;  3RPU D;  3PO2 J;  1HKT A;  1ZGJ A;  2CUF A;  2XF6 A;  2BEO A;  4ZYG A;  2YR2 A;  3O8G A;  1E3O C;  2MBF A;  2ZNY A;  3WHB A;  4GRI A;  5E1W A;  4WCG A;  2GOX B;  1ZKG A;  3FK6 A;  4BXF A;  4QSH A;  2IGM A;  2GQQ A;  1YS7 A;  4NHJ A;  4FHT A;  1YIJ I;  4JOM A;  5BOX A;  2VJI A;  2E1N A;  4G7Z F;  1BBY A;  3LQR A;  4DNC A;  1OMI A;  2A3S A;  1RI7 A;  1SEU A;  3RYR A;  1X2N A;  2W24 A;  3OYF A;  1W4M A;  2IGO A;  4BYY A;  3MKY B;  1MIJ A;  4HLY A;  2DPD A;  1F1Z A;  5IPA A;  3IRQ A;  2K9M A;  3BR5 A;  3EPZ A;  4MFE A;  3FWE A;  3DF8 A;  3LSK A;  4JBA A;  4OIP F;  2V7F A;  3M8J A;  3AAF A;  4ZDP A;  2Y30 A;  4U0V A;  1IGN A;  3BG5 A;  3WTZ A;  1QO0 D;  5E3N A;  5J1U A;  3I54 A;  1J0R A;  5H20 A;  3BTL A;  2HZT A;  3BY6 A;  3QPT A;  1SFO J;  4IO9 F;  3DPU A;  5GAE J;  1AOY A;  3KYD B;  1RC9 A;  3E6D A;  1IXR C;  1WJE A;  4A3L J;  2IVM A;  1D0Z A;  2VKH A;  2LTP A;  3H3U A;  4E7L A;  2Z3Y A;  1XD7 A;  5FRM A;  4HDV A;  2DA4 A;  4FE4 A;  3T8T A;  3HB9 A;  3ZPL A;  3FM5 A;  3FF5 A;  2AS5 F;  4DZJ A;  4G7O F;  2LKP A;  1PP8 F;  3VOD A;  3S17 J;  1Z77 A;  2BBY A;  2BXY A;  1F4K A;  3HHG A;  2KJB A;  5CPR B;  2N8G A;  4XL9 A;  5CLS A;  2WV0 A;  2R5Y B;  4ZYE A;  4I7H A;  2VQG A;  3ZN1 A;  3K1P A;  4AIH A;  1P4W A;  2ZJR F;  2DAO A;  5BMZ A;  1XS9 A;  4P55 A;  1HC8 A;  2KJC A;  3IKV A;  2JWT A;  2XAU A;  3MN2 A;  1WQ2 A;  2FOK A;  3ULQ B;  2BW3 A;  4NB5 A;  4OIR F;  5IP9 J;  1BR1 A;  1VF9 A;  5EJC A;  4N9I A;  1QU3 A;  1SMY F;  1V3F A;  2DI3 A;  4R8H A;  4PK4 A;  3ASN H;  1YX3 A;  4XKW A;  3FM3 A;  4BY7 J;  1QPM A;  2W57 A;  3TP0 A;  1W36 D;  1ZQ3 P;  2H1K A;  2CSO A;  4LLL A;  1GUU A;  5E8I A;  3KYL A;  1AA7 A;  2E7X A;  1Y1V J;  4I6Z A;  2PN6 A;  5ILS A;  1QA6 A;  4ZDL A;  3J7A Y;  1I50 J;  2HWV A;  3CLQ A;  2IP2 A;  3WTX C;  4M9S A;  2X48 A;  1HW5 A;  3DKW A;  2X85 A;  5DS9 A;  3OMY A;  1R4N B;  1X1D A;  3OYB A;  3A0H C;  1O3R A;  4R79 A;  1GDT A;  3PUB A;  1EA3 A;  2XUB A;  5L3G A;  1IV6 A;  5IOY A;  1J2X A;  2K40 A;  5IP6 A;  1GLN A;  1QZE A;  1NTC A;  1MDM A;  1E3P A;  3G3Z A;  5E20 A;  2JJ7 A;  1JUM A;  4G7H F;  1K7A A;  1ZEL A;  1TWH J;  3Q3S A;  3L2W A;  2Y69 H;  2Y0M A;  1LEA A;  1MJA A;  3H5R A;  3MVP A;  3OYM A;  4BE1 A;  2V26 A;  1HW1 A;  3HKZ A;  4A3I J;  2DA1 A;  3CTA A;  3ZQQ A;  2HOS A;  1QPI A;  1V55 H;  2KHM A;  3CCS I;  3CCE I;  3GTJ J;  4CXF A;  2FBK A;  4NC7 A;  3CCQ I;  3HM5 A;  2XAH A;  4ESJ A;  1IF1 A;  3P5J A;  2JRM A;  2R7D A;  4M74 A;  2E1M C;  4U0W A;  2JA8 J;  4B44 A;  5CVR A;  2JUG A;  3F21 A;  3I9V 2;  5HNF A;  2P7V B;  1EJ9 A;  3W6K B;  3KX2 A;  1FOW A;  5AIP A;  2XB5 A;  1WGX A;  4CYD A;  4F3Q A;  1U2W A;  4CZC A;  3IV5 A;  1YJ9 I;  3JW4 A;  3L00 A;  4L9T A;  2DMT A;  4B43 A;  4D9J A;  1Y8Q B;  3L09 A;  1V5E A;  1W7P A;  3MAJ A;  5FD5 A;  3OIP A;  3H35 A;  1T6S A;  4D5C A;  2M9H A;  2OCC H;  2NXN B;  3RQI A;  4KMF A;  2G7U A;  5FRO A;  5TRD A;  2DTZ A;  1WRJ A;  3A01 B;  2OPT A;  4FE7 A;  2RQP A;  2NVT J;  4C30 A;  1Z3X A;  1Z91 A;  2WY7 Q;  3K4K A;  3S14 J;  1T56 A;  5B1A H;  1IG7 A;  3LA3 A;  3CC2 I;  1TQM A;  3BZK A;  4IEJ A;  4CSW A;  2ISZ A;  1D0X A;  2DOF A;  2E2I J;  4BEH A;  1YFH A;  4OU0 A;  1W0U A;  2CW0 F;  4F55 A;  5HLI A;  1UHS A;  1XGS A;  2LK2 A;  2RN7 A;  1ZRE A;  4ZTJ A;  2XSJ C;  3BZ6 A;  2KDO A;  1U3E M;  2JSP A;  4HX4 A;  3HRM A;  1FYK A;  2ZKZ A;  3ZR8 X;  4LIT A;  2HI3 A;  2MD5 A;  3J7Y J;  2ZJ2 A;  3GXO A;  1S7O A;  4IOA F;  3AL0 B;  4A0X A;  4YIR X;  4BXX J;  4LFU A;  2K86 A;  1BIA A;  2HOA A;  5FKN A;  3OYC A;  3MZY A;  1ZLJ A;  2EH3 A;  2HYF A;  1X1P A;  2CUE A;  1WH5 A;  3I71 A;  3TBI A;  2VBX A;  1LQ1 A;  5JLW A;  1BI1 A;  2W82 A;  3DEE A;  2PMZ N;  1IAW A;  1HW2 A;  2GAU A;  3JAM Z;  3OSG A;  3BJA A;  2DFE A;  5K5O A;  4MTD A;  2OQG A;  1XG1 A;  2ZC2 A;  2W25 A;  1N25 A;  1S5L C;  4MFD A;  4GXO A;  2DT5 A;  2GZW A;  3WU0 A;  3LA2 A;  1JKP C;  1D5V A;  3Q0U A;  1FT9 A;  4HST A;  4G6Q A;  2DQL A;  3ECH A;  1H9G A;  1LDJ A;  2COB A;  3OYA A;  2JSC A;  2XSD C;  3O3K A;  4IHW A;  4PJN A;  5HDK A;  4Y7N J;  2GLO A;  5E79 C;  1IRF A;  4HLX A;  3SZP A;  1W5S A;  5D5U B;  4AVP A;  2F5F A;  2M7A A;  1X1A A;  5LHI A;  5ILU A;  4JX6 A;  3J7A O;  1H88 C;  3EUK L;  2R0Q C;  1UG2 A;  1MBG A;  5F0H A;  1UEL B;  2AQE A;  2R7Q A;  2EBI A;  2CW7 A;  3PIP F;  3ZP5 A;  2GIZ A;  2ZSI B;  2MAB A;  3KZZ A;  4Q5S F;  4BY1 J;  4IF4 A;  4G6T B;  2HEO A;  1RRJ A;  1WJD A;  3CQZ J;  1KQ9 A;  5DUK A;  5GTI C;  2GOM A;  2JA6 J;  1OCT C;  4UY8 I;  5HS8 A;  1T95 A;  3QOP A;  4BQQ A;  3FIW A;  3FMS A;  4NC8 A;  2NNY A;  4CH7 A;  3SQN A;  1OCR H;  1YHQ I;  1S9H A;  3C2B A;  1WI3 A;  3CCL I;  4Q47 A;  1OYY A;  2GXB A;  2NVQ J;  4AUX A;  2L02 A;  2NYX A;  1XB4 A;  5EEH A;  3L2U A;  1TWF J;  1LNW A;  2QF7 A;  2QA4 I;  5LBQ A;  2R93 J;  1Z05 A;  4HSR A;  1ZG3 A;  2LR8 A;  3FXJ A;  2L7M P;  1QNT A;  3ABL H;  1SVL A;  3AKZ A;  4BL0 B;  2M5W A;  1KU3 A;  2VKD A;  3OS1 A;  3BR3 A;  3ZMZ A;  3DV8 A;  1TNT A;  3L2R A;  4EQQ A;  3ABM H;  2RVC A;  1T8I A;  2IS1 A;  1IDZ A;  3FMQ A;  2L9V A;  2G0E A;  2NVX J;  5IT3 A;  1OFC X;  1YYV A;  3KP5 A;  2X0L A;  2A05 A;  2P7C B;  3EYI A;  3HOY J;  1ORK A;  1L0O C;  2BE5 F;  4A3M J;  1HDP A;  1I1S A;  1JJ6 C;  3BP8 A;  4QPO A;  2LY1 A;  4AYB N;  5EF6 A;  5EDN A;  1OQY A;  1Q1H A;  2A6H F;  5FLX K;  3F8B A;  1L3L A;  3S3N A;  1OJL A;  4DBR A;  2CGP A;  4S04 A;  3RTR A;  2UUZ A;  2MLG A;  3TW7 A;  4A5M A;  4CCJ A;  4KYW A;  2FMY A;  3K7A J;  2P5L C;  2E71 A;  1Z9C A;  4HX8 A;  1WH7 A;  3B02 A;  3H92 A;  2JN6 A;  4IZZ A;  1PUF B;  2QLZ A;  2MH9 A;  3HUG A;  5JVG F;  2YPR A;  1T39 A;  3M8F A;  2CQ7 A;  4HX7 A;  2FML A;  1WJ5 A;  3RKX A;  3CMM A;  1ZG1 A;  4XKV A;  3DEU A;  4XLA A;  5FLX Z;  2ETH A;  3SEZ A;  1JJ8 C;  4G8X A;  2R92 J;  2AHQ A;  4RB3 C;  4E7H A;  1IW7 F;  4FTH A;  3MWM A;  5JHU A;  3CCR I;  4MO7 A;  5CQE A;  1LPQ A;  3OYN A;  2QEX I;  1Y8R B;  2WBM A;  2DJN A;  2UWM A;  2JUC A;  1I39 A;  4UV9 A;  4J00 A;  3E6M A;  5KAI C;  1DDN A;  1G8X A;  4A3D J;  1XGM A;  3HYI A;  2L9S A;  4GYG A;  2O8K A;  3DBR B;  2CMP A;  3BG6 A;  1ETO A;  3SXY A;  5JLX A;  1VQ9 I;  5LRS A;  2MFZ A;  2LBF A;  2CUJ A;  5HLH A;  3GVA A;  1FP1 D;  5EYR A;  5LFA A;  1KZH A;  2KRF A;  1HF0 A;  1JT0 A;  1ACI A; 
#chains in the Genus database with same CATH homology
 2YSR A;  4KT5 C;  4ENJ A;  1ODD A;  4L0Y B;  2V1U A;  4YFX F;  4UVA A;  3MFK A;  2COM A;  3ZMV A;  5DD4 A;  1MGT A;  4O5V A;  1JGS A;  4M6Y A;  3COA C;  2WTE A;  2M1B A;  2VBZ A;  2ZME C;  1ZHF A;  4ENK A;  3ELK A;  4I98 B;  3GFI A;  4HW0 A;  3HHH A;  2HTS A;  1TTY A;  3CJN A;  1G3S A;  4EJU A;  3KEO A;  5CYV A;  1KU2 A;  4XRF A;  3KP3 A;  4I0A A;  1J9I A;  2LF7 A;  1R5H A;  4RS8 A;  1IN6 A;  1B9N A;  2EFQ A;  2H6C A;  1SD5 A;  2QQA A;  2CQK A;  4Y17 A;  1WSU A;  2A6E F;  2QYO A;  4IRH A;  3GLX A;  3MCZ A;  3SFZ A;  2GIV A;  4ZZL A;  1TBX A;  1BIB A;  3C1D A;  3ABU A;  3LST A;  3F72 A;  2LSO A;  2OA4 A;  1LDD A;  1K78 A;  4LG0 A;  3J81 Z;  3V7R A;  1O3S A;  2DO7 A;  4MHG A;  5D6F A;  2VE9 A;  2V6C A;  5LRR A;  1MJ9 A;  3BPV A;  4PZJ A;  3PFI A;  2F5D A;  4L9V A;  3WU1 B;  4LLN A;  2FEZ A;  1U6G A;  4UVB A;  4EGY A;  3GZ5 A;  1TLH B;  1SD7 A;  3TDU C;  3RI4 A;  2DQR A;  5ICE A;  4YIF A;  2QVO A;  3LWF A;  4M9Z A;  5J8F A;  4H0E A;  1SD4 A;  4S05 A;  5E17 F;  2EA4 A;  4RB2 C;  2L4A A;  2VBW A;  1BJA A;  4EGZ A;  4MEX F;  1XGO A;  2ZBK A;  1OYW A;  3GX4 X;  3M1E A;  1HKQ A;  3RKY A;  4BQA A;  1CGP A;  3KLN A;  3ZMS A;  4JK1 X;  2K4J A;  3V4G A;  3IRR A;  5IT9 K;  2VBY A;  3K1M A;  3ISP A;  3D5L A;  1ZN2 A;  1YTY A;  4TV7 A;  2CO5 A;  5H6Q A;  4IHT A;  3K69 A;  1HST A;  1ONV A;  4LMY A;  3ZMT A;  5D5W B;  2A69 F;  2WC2 A;  3K9T A;  4L9N A;  1P92 A;  3I64 A;  1KU9 A;  2V1D A;  4EM0 B;  3GUD A;  2FBH A;  3LAJ A;  2UZK A;  1XSX A;  4LJZ F;  3K1N A;  3E5Q A;  2D1H A;  5KVR A;  1GVJ A;  3FZV A;  1CF7 A;  1UST A;  3WTW C;  2RV8 A;  1SFU A;  1QZZ A;  1MZB A;  3GFM A;  1S8N A;  4MQV A;  3I58 A;  4U0Y A;  5BS6 A;  2PMH A;  2PBI A;  2CWE A;  2HS5 A;  4L18 B;  4NQW A;  3WE2 A;  3KCC A;  3LFK A;  2EV0 A;  2W84 A;  3F8C A;  4UV8 A;  1F5T A;  4CHU A;  2EV6 A;  1ZGA A;  2J5O A;  3U1D A;  1SAX A;  5CJ9 A;  2ZO4 A;  4I01 A;  2OU2 A;  1SD6 A;  1U78 A;  4RGS A;  5J6X A;  4KIC A;  4KN7 X;  3BRO A;  3TOB A;  1P4A A;  3QP5 A;  4P9U A;  3P9C A;  2IPQ X;  2FNP A;  5FGM A;  4MNU A;  3IHU A;  3R0J A;  3WTU C;  3HSR A;  4HQM A;  3F8F A;  1A04 A;  1YS6 A;  4KA4 A;  3F8N A;  2CFX A;  4L5I A;  3DPT A;  1O57 A;  1JE8 A;  1STZ A;  1WWX A;  5K1Y A;  1YW8 A;  2FQ3 A;  2HGC A;  4RAY A;  4ENM A;  3KFW X;  5D8K B;  4CGZ A;  3O2P E;  1IN8 A;  2LDU A;  3L2C A;  1YW7 A;  2IW5 A;  3SZT A;  1USS A;  3RDI A;  2XKO A;  4PGH A;  2FNA A;  5DYM A;  2KIM A;  1R58 A;  3GF2 A;  2STW A;  1U5T B;  1GHC A;  2JRT A;  5CVJ A;  2JPC A;  2ZXJ A;  1LVA A;  2K27 A;  2ZCW A;  5DCF A;  4GO1 A;  2QBY A;  4YFK F;  3G73 A;  3HSF A;  3KP6 A;  1FBU A;  4M73 A;  4YG2 F;  5FB2 A;  4BHB A;  3WGH A;  2A07 F;  4HQE A;  1RNL A;  2Z5U A;  2QZ8 A;  4WX9 A;  5DUI A;  3VB2 A;  2H6B A;  2Y75 A;  4IRG A;  2OBP A;  1GXP A;  3R60 A;  3HTS B;  4P9F A;  2EV5 A;  2GXG A;  4ZZD A;  2XVC A;  2A5Y B;  3O6B B;  4OOI A;  3ZQ7 A;  3CDH A;  1R23 A;  4RGR A;  2XV4 S;  4EMS A;  1ZAO A;  5ERI A;  1G3T A;  1Z1D A;  4KDP A;  5DV5 A;  1IRG A;  4PCQ A;  4YII A;  2Q8K A;  1T98 A;  3M8E A;  1V4R A;  3RIR A;  5HS9 A;  1IXS B;  2OQR A;  4A2U A;  4K2E A;  3CUQ B;  1ZLK A;  1BC8 C;  4EVI A;  1U8R A;  2X4H A;  1ZAR A;  4G94 A;  1SFX A;  3RPU A;  2O8X A;  2ZME A;  2VC0 A;  1TQP A;  4CO8 A;  3KE2 A;  4A6D A;  2QQ9 A;  2HTJ A;  1JXS A;  2O3F A;  2IT0 A;  5FFZ A;  1FZP B;  2UXX A;  1ZYR F;  1EH6 A;  4KFC A;  1OYI A;  2DPU A;  3FMR A;  2CG4 A;  3GW2 A;  1DUX C;  1HXD A;  4HOB A;  1KGS A;  1KYZ A;  2FRH A;  5A2Q K;  1UHM A;  1B6A A;  5DD8 A;  3WGI A;  1ZH5 A;  1KU7 A;  2FF4 A;  1FSH A;  3F6O A;  2DK8 A;  2LNB A;  3WOD F;  3K0L A;  2H27 A;  5LGU A;  1UCR A;  1FYM A;  5K5Q A;  3PQJ A;  2NRA C;  1IZ1 A;  4WF2 A;  5F1R A;  2F5E A;  4A0Z A;  1XN7 A;  5BPD A;  4OIO F;  1E17 A;  2H94 A;  1YIO A;  1ZRC A;  5ICG A;  3IL2 A;  2STT A;  3GO5 A;  4R1H A;  2M87 A;  4LB5 A;  4ESF A;  5JI6 A;  2EB7 A;  1I27 A;  3R4K A;  4IJA A;  3WG9 A;  5JFR A;  2PLY A;  1D8J A;  4B09 A;  2XAQ A;  3EYY A;  4JQF A;  2M30 A;  2RDP A;  3LQQ A;  3T1B A;  3R61 A;  2A68 F;  2ADU A;  3U9G A;  4CIC A;  2P6T A;  4I0B A;  3VEP A;  4OIQ F;  1EH7 A;  1UHW A;  3KP7 A;  5BPI A;  3MQ0 A;  1FBQ A;  2YU3 A;  2ESH A;  1BC7 C;  3ABT A;  1UFM A;  1B4A A;  1R00 A;  3V8K A;  4GYI A;  4XBF A;  3N97 A;  4N0B A;  4GGG A;  4OMZ A;  3E97 A;  3OV8 A;  3Q9V A;  1MDM B;  2LF8 A;  1HQC A;  3LA7 A;  1RZ4 A;  4HF1 A;  1FNN A;  2NAZ A;  3GZ6 A;  3JTG A;  1S29 A;  3HOT A;  1QBJ A;  5LGT A;  2GWR A;  2VT2 A;  3WGG A;  1O7L A;  4HF0 A;  2HOE A;  1W7P B;  2VOP A;  2M45 A;  1HKS A;  1EV7 A;  2YX4 A;  1E2X A;  3CLO A;  4DQ2 A;  3NEU A;  5LLQ A;  5LEJ A;  2KIF A;  2GA2 A;  3VOE A;  3EET A;  5CVI A;  2EK5 A;  2BYV E;  4OIN F;  3VFZ A;  4KUM A;  3GWZ A;  3J80 K;  1R1U A;  1KYW A;  2ISY A;  1XCV A;  2HYG D;  4BNC A;  5L3B A;  5E18 F;  4FT8 A;  3ZMU A;  4KIG A;  4M9X A;  3I53 A;  2PQ8 A;  3WTT C;  4KIB A;  2VOO A;  1FWZ A;  2V79 A;  3DXJ F;  5HLG A;  3R6S A;  2MLK A;  5L3C A;  3B73 A;  3E6B A;  1GXQ A;  3BOQ A;  2FBI A;  3BJO A;  4P5O A;  3L9F A;  1YQA A;  2IRF G;  4UXN A;  1O7F A;  5J8C A;  5E8G A;  4HV6 A;  2M8E A;  3F8M A;  4IVN A;  2JT1 A;  1T2K A;  1QQI A;  1J7K A;  4G6D A;  2F2E A;  2BV6 A;  1FOK A;  1FLI A;  1R5G A;  1ZRD A;  3BPX A;  3FHZ A;  2Z33 A;  1XGN A;  3F23 A;  4F7Z A;  1H9T A;  2XGX A;  3MEX A;  5ICC A;  1H0M A;  2Z99 A;  1BI2 A;  1J59 A;  3F6V A;  3T0Y A;  2L01 A;  2VXZ A;  3C3W A;  3KP2 A;  1TW2 A;  1O3T A;  2XRN A;  4XLP F;  3EUH A;  3EQL F;  3V7S A;  3TOA A;  2DTR A;  4KIF A;  2NS0 A;  5D6E A;  2XIG A;  3TDZ C;  5EEG A;  2Q0O A;  1D8K A;  4BH9 A;  3ZMD A;  1D3Y A;  3QU3 A;  1REP C;  3IKT A;  2F5C A;  4FX4 A;  2WWY A;  4MGR A;  1B59 A;  4WWC A;  3L7W A;  5DDG A;  1FX7 A;  1JHH A;  5IT9 Z;  4LLG F;  1I1G A;  2R3S A;  4HYE A;  4RB1 A;  2A61 A;  1O3Q A;  1YW9 A;  3EDP A;  5D8L B;  3LAP A;  2HDC A;  1BM9 A;  3E3V A;  4KN4 X;  4BHP A;  1YO5 C;  4L5J A;  1MJB A;  5FD6 A;  3HIF A;  2H09 A;  2OZ6 A;  1IXC A;  2RC4 A;  4PDK A;  2KKO A;  4O3M A;  4WXD A;  5E1Z B;  4EM1 A;  4O6J A;  1FP2 A;  2OD5 A;  4UNO A;  1ON1 A;  2PEX A;  5HDG A;  3U2R A;  1G3W A;  3HTU A;  4PGG A;  2W85 A;  3WTV C;  2HR3 A;  1FPQ A;  1G3Y A;  3MZH A;  1R1T A;  1TW3 A;  1U5T C;  2YX7 A;  4BHC A;  5F6F A;  3REO A;  2V9V A;  3I5U A;  5AON A;  1IN5 A;  2FSW A;  2XHK A;  5CVU A;  1B1B A;  5HOO A;  5TJJ A;  2L4M A;  4ZYD A;  1LEB A;  2VT3 A;  1DPU A;  3CUO A;  3Q9S A;  1C0W A;  3DQV C;  3GFL A;  2XAJ A;  2PFB A;  4HBL A;  3RJP A;  4MEY F;  3E5X A;  2P5K A;  3TGN A;  1EH8 A;  2HQN A;  2EFN A;  3BWG A;  2TDX A;  4N9H A;  1I5Z A;  5D5V B;  3H3Z A;  4HV5 A;  3GEZ A;  4ON0 A;  4AIK A;  2D2W A;  1OKR A;  1BN5 A;  1LJ9 A;  4KNY A;  2P5V A;  4LK1 F;  1T38 A;  2QM3 A;  4EJO A;  1JHF A;  2K02 A;  1KQ8 A;  1YG2 A;  3M9A A;  4QWQ A;  4CDG A;  5DEQ A;  3RKW A;  3WTY C;  1G4D A;  3IC7 A;  3HSE A;  3V8L A;  5K5R A;  1OR7 A;  4FX0 A;  1MKM A;  1K78 B;  2OAZ A;  2PJP A;  4LG0 B;  1WI9 A;  2P4W A;  3CUQ C;  3I59 B;  4M6X A;  2XAF A;  4EJW A;  1QZY A;  2EFP A;  4HAM A;  3F3X A;  2JTV A;  1XMK A;  3ECO A;  4Q48 A;  1IN7 A;  1KQ0 A;  4UUV A;  2O6G E;  4EJV A;  3WE3 A;  3QRF F;  3P9K A;  4IHS A;  2VC1 A;  1TQI A;  2FXA A;  4MQ9 F;  4BXU A;  2ELH A;  1Y0U A;  3E5U A;  4E70 A;  5FFX A;  4HZF A;  2QEN A;  2VON A;  2HKX A;  4I2O A;  1Z7U A;  1T0F A;  2XKP A;  2HQR A;  4M71 A;  5FO5 A;  2O0Y A;  3JAM K;  5LHH A;  4OMY A;  5D4S A;  3BDD A;  3QAH A;  5JR3 A;  2MC3 A;  2CYY A;  4RGX A;  4ETS A;  3Q5F A;  3KP4 A;  1FY7 A;  3IWZ A;  5JVT A;  4A0Y A;  1S3J A;  5DCM B;  3P7N A;  4IRI A;  4U7B A;  3TQN A;  2VOD A;  1I6X A;  1Z6R A;  3IWF A;  3JTH A;  2PMU A;  2IA2 A;  5L3F A;  1TNS A;  1SFE A;  1CF7 B;  2EJR A;  1P2F A;  1WKM A;  2E1C A;  4XSZ F;  1RUO A;  1P6R A;  5L3E A;  1MD0 A;  3KLO A;  1FYL A;  1W5T A;  2ZNZ A;  3HRS A;  3QU6 A;  5A2Q Z;  3K2Z A;  2ACJ A;  3E6C C;  4HDU A;  2VE8 A;  2DW4 A;  3FX3 A;  2P6S A;  5KK1 A;  3V7C A;  4Y13 A;  2XAG A;  1FSE A;  4ENN A;  5HVQ C;  2JPB A;  1BOA A;  2JZY A;  5ED4 A;  1R7J A;  3KEQ A;  3CO7 C;  4Q4Z F;  4GCV A;  4EJT A;  4ESB A;  4M72 A;  3DFG A;  4LB6 B;  1XDU A;  1YLF A;  5E1X A;  2Q2E A;  4A12 A;  1S7A A;  2EA2 A;  3JSP A;  6PAX A;  3KZY A;  2DLL A;  4UVC A;  4CZZ A;  4UHT A;  3SHF A;  3WTS C;  1RIO H;  1F9N A;  2E7W A;  4LD5 A;  3N4M A;  3DPL C;  3RPQ A;  4A6E A;  1X3U A;  2R7F A;  1R36 A;  3OOP A;  3TO6 A;  3HRU A;  4Z2Y A;  1R22 A;  4AIJ A;  3JSO A;  2V1X A;  3PQK A;  5AIQ A;  3GYH X;  3NQO A;  3TO9 A;  2J5P A;  1LB2 A;  2PG4 A;  5H6R A;  1XCB A;  2RNJ A;  4XLN F;  1SMT A;  1IN4 A;  2AXL A;  4LK0 F;  2FU4 A;  1K79 A;  4Y15 A;  4MTE A;  3NRV A;  2C6Y A;  2EWN A;  2UXN A;  2L3D A;  1J75 A;  4ZYH A;  4IPA A;  5HS7 A;  2O03 A;  4L0Z B;  2ZFW A;  5F64 A;  4G9Y A;  4EV0 A;  5D4R A;  3FXQ A;  5BQT A;  3F22 A;  2QBY B;  4RB0 A;  1AWC A;  3HOS A;  2P8T A;  4ASN A;  3KET A;  2VN2 A;  2HFH A;  1PDN C;  2GA1 A;  4D0P A;  5CVV A;  4U7D A;  4AD9 A;  1NHA A;  4IXA A;  3HRT A;  2O61 A;  4P96 A;  1QGP A;  2K7L A;  1OPC A;  1DPR A;  2QWW A;  4KMU X;  2DK5 A;  3ZN0 A;  1BI3 A;  1KA8 A;  3R0A A;  4A5N A;  1FBS A;  2QUF A;  3V8J A;  1ON2 A;  5LEK A;  3J81 K;  2G9W A;  2D45 A;  3DP7 A;  4LGW A;  3I4P A;  5D5X B;  4ZH4 F;  1U5T A;  4WK8 F;  3M7G A;  1ULY A;  3ROU A;  1UB9 A;  2ESN A;  1XSV A;  2G7H A;  3I59 A;  3J80 Z;  2BGC A;  2RGV A;  2KIU A;  2Z9O A;  2K4B A;  2MA3 A;  2ZME B;  2DFI A;  4RGU A;  5ILV A;  2XAS A;  3FXR A;  3TKY A;  4WXH A;  2FE3 A;  1XSD A;  5HDN A;  2DU9 A;  1HBX G;  2DBB A;  5L3D A;  4WXC A;  3C7J A;  3QPH A;  4B8X A;  1B9M A;  4YFN F;  2MH2 A;  3P9I A;  1XDS A;  2NNN A;  2QQB A;  4QLC U;  3TO7 A;  2HKO A;  3T8R A;  1P4X A;  2IA0 A;  4L9J A;  2Y48 A;  2IA1 A;  1Z6T A;  3RYP A;  3T5X A;  1W7P D;  4AWX B;  1RUN A;  3BJ6 A;  4EM2 A;  3QP6 A;  4I02 A;  2L54 A;  3D0S A;  2D1V A;  3GFJ A;  3S2W A;  4HF2 A;  1ZG5 A;  1R1V A;  2EFW A;  3CUQ A;  3ML6 A;  1PUE E;  2EFO A;  3I0T A;  1ZRF A;  2IJL A;  2XRO A;  3C18 A;  1FC3 A;  4BAY A;  2FA5 A;  1PP7 U;  1S6L A;  1BI0 A;  1DP7 P;  1XMA A;  1IUY A;  4I09 A;  2RKH A;  1K6O A;  2PI0 A;  4XSX F;  3W6J B;  1J5Y A;  1VTN C;  5LHG A;  2OZU A;  3CO6 C;  4RAZ A;  5DCM A;  5LGN A;  1HSJ A;  3ERE D;  4U88 A;  4HA8 A;  1G6N A;  2B0L A;  5ICF A;  1LDK B;  3FXU A;  1HKT A;  1ZGJ A;  2BEO A;  4ZYG A;  2YR2 A;  2MBF A;  2ZNY A;  5E1W A;  4WCG A;  2GQQ A;  1YS7 A;  4NHJ A;  4FHT A;  5BOX A;  2E1N A;  4G7Z F;  1BBY A;  3LQR A;  4DNC A;  1OMI A;  2A3S A;  1RI7 A;  3RYR A;  2W24 A;  1W4M A;  4BYY A;  4HLY A;  2DPD A;  1F1Z A;  3IRQ A;  3FWE A;  3DF8 A;  4OIP F;  4JBA A;  3AAF A;  4U0V A;  3WTZ A;  1QO0 D;  3I54 A;  1J0R A;  5H20 A;  2HZT A;  3BY6 A;  3QPT A;  1AOY A;  3E6D A;  1IXR C;  2IVM A;  3H3U A;  2Z3Y A;  1XD7 A;  4HDV A;  3T8T A;  3ZPL A;  3FM5 A;  3FF5 A;  2AS5 F;  4G7O F;  2LKP A;  1PP8 F;  3VOD A;  2BBY A;  1F4K A;  3HHG A;  2KJB A;  5CLS A;  2WV0 A;  4ZYE A;  4I7H A;  3ZN1 A;  5BMZ A;  3K1P A;  4AIH A;  1P4W A;  2DAO A;  4P55 A;  2KJC A;  3IKV A;  1WQ2 A;  2FOK A;  3ULQ B;  4NB5 A;  4OIR F;  4N9I A;  1SMY F;  1V3F A;  2DI3 A;  4R8H A;  3FM3 A;  1QPM A;  2W57 A;  2CSO A;  4LLL A;  5E8I A;  2E7X A;  2PN6 A;  5ILS A;  2HWV A;  2IP2 A;  3WTX C;  4M9S A;  1HW5 A;  3DKW A;  1O3R A;  4R79 A;  2XUB A;  5L3G A;  1J2X A;  1MDM A;  3G3Z A;  5E20 A;  4G7H F;  1K7A A;  2Y0M A;  1LEA A;  1MJA A;  1HW1 A;  3CTA A;  4CXF A;  2FBK A;  2XAH A;  4ESJ A;  1IF1 A;  2R7D A;  4M74 A;  4U0W A;  5CVR A;  3F21 A;  2P7V B;  3W6K B;  5AIP A;  4CYD A;  1U2W A;  3JW4 A;  3L00 A;  4L9T A;  3L09 A;  1W7P A;  3MAJ A;  5FD5 A;  1T6S A;  4KMF A;  2G7U A;  5TRD A;  1WRJ A;  2RQP A;  1Z91 A;  3LA3 A;  1TQM A;  2ISZ A;  1YFH A;  4OU0 A;  2CW0 F;  5HLI A;  1XGS A;  2RN7 A;  1ZRE A;  3BZ6 A;  1U3E M;  4HX4 A;  3HRM A;  1FYK A;  2ZKZ A;  2MD5 A;  2ZJ2 A;  3GXO A;  1S7O A;  4A0X A;  4LFU A;  2K86 A;  1BIA A;  3MZY A;  1ZLJ A;  2HYF A;  3I71 A;  2VBX A;  1LQ1 A;  1BI1 A;  1IAW A;  1HW2 A;  2GAU A;  3JAM Z;  3BJA A;  5K5O A;  4MTD A;  2OQG A;  2W25 A;  4GXO A;  2DT5 A;  2GZW A;  3WU0 A;  3LA2 A;  1D5V A;  1FT9 A;  4G6Q A;  2DQL A;  3ECH A;  1H9G A;  1LDJ A;  2JSC A;  3O3K A;  5HDK A;  1IRF A;  4HLX A;  3SZP A;  1W5S A;  5D5U B;  4AVP A;  2F5F A;  5LHI A;  5ILU A;  3J7A O;  3ZP5 A;  3KZZ A;  4Q5S F;  4IF4 A;  2HEO A;  1KQ9 A;  5DUK A;  5HS8 A;  3QOP A;  3FMS A;  2NNY A;  3SQN A;  4Q47 A;  1OYY A;  2GXB A;  2L02 A;  2NYX A;  1XB4 A;  5EEH A;  1LNW A;  5LBQ A;  1Z05 A;  1ZG3 A;  1QNT A;  2M5W A;  1KU3 A;  3ZMZ A;  3DV8 A;  1TNT A;  4EQQ A;  2RVC A;  3FMQ A;  5IT3 A;  1YYV A;  3KP5 A;  2X0L A;  2P7C B;  3EYI A;  1L0O C;  2BE5 F;  1I1S A;  3BP8 A;  1Q1H A;  2A6H F;  5FLX K;  3F8B A;  1L3L A;  2CGP A;  4S04 A;  3RTR A;  2MLG A;  4A5M A;  4KYW A;  2FMY A;  2P5L C;  1Z9C A;  4HX8 A;  3B02 A;  3H92 A;  2QLZ A;  2MH9 A;  3HUG A;  2YPR A;  1T39 A;  3M8F A;  4HX7 A;  2FML A;  3RKX A;  1ZG1 A;  3DEU A;  5FLX Z;  2ETH A;  4G8X A;  4RB3 C;  1IW7 F;  3MWM A;  5JHU A;  2UWM A;  4UV9 A;  1DDN A;  3E6M A;  1XGM A;  3HYI A;  4GYG A;  3SXY A;  5LRS A;  5HLH A;  3GVA A;  1FP1 D;  2KRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...