1XB4A

Crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
180
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
total genus 56
structure length 180
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xb4A02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1xb4A01
1I27A 3EUHA 5HLGA 3ZMTA 1FWZA 2KIMA 3NEUA 3HRMA 4CXFA 1HKSA 1QZYA 2EV0A 4BHCA 1L3LA 4AIJA 5ILSA 5CJ9A 2M30A 3JSOA 2ESNA 1F9NA 2HDCA 3KLNA 5H20A 1KGSA 1YW7A 2H94A 1W7PB 5CVIA 3C7JA 4KICA 5HDKA 1IN8A 3GYHX 1UFMA 3DV8A 5HDGA 1MJAA 3ROUA 2GA2A 4GYIA 3P7NA 4IVNA 1IXRC 2QUFA 1BBYA 2FA5A 3M7GA 1I1SA 3MAJA 2K86A 2QWWA 3BOQA 2DBBA 2FF4A 2O8XA 5L3FA 3EDPA 2MD5A 3TO6A 2DW4A 1LNWA 1BIBA 5BPIA 3QPHA 4M74A 4LFUA 2QZ8A 1TBXA 1B9NA 2EV5A 1USSA 3KEOA 2MH9A 1QGPA 4HF1A 2WV0A 4LLNA 2F2EA 1TNTA 1P92A 4N0BA 1WKMA 4CYDA 3KZZA 3RI4A 1YS6A 3ZMUA 2CSOA 5ICFA 2A5YB 3F8BA 4NB5A 3CUOA 1JGSA 4ENJA 4PGGA 4PZJA 5E1ZB 5DCMB 2O6GE 2VXZA 1HW2A 2P4WA 2QYOA 2XAHA 1OYYA 3BROA 1O3RA 2Z99A 3SQNA 3IWZA 1LQ1A 2VBXA 3WTXC 4LG0B 2ZXJA 2VBWA 2CWEA 4XLNF 1S29A 3KP7A 4KDPA 2HOEA 5FFZA 3GVAA 3F8MA 3I0TA 5CVUA 1BN5A 2IJLA 3FXUA 1SMYF 2M8EA 1O7FA 4HAMA 1BOAA 5AIQA 2K02A 4M73A 1FT9A 4ASNA 1KU2A 1YQAA 4KA4A 4G7OF 3TDZC 1FNNA 3I54A 2Q8KA 2QVOA 1ZRDA 3KP3A 4A0YA 4Q48A 2PG4A 1IN6A 2PEXA 1W5SA 1U3EM 1YLFA 2FBIA 1KYZA 3ISPA 3RPQA 4LB5A 4P9FA 3GXOA 1BI1A 4L18B 3T0YA 1QQIA 4YIFA 1Z9CA 4B8XA 2ISYA 5LBQA 2IA0A 1IZ1A 2EA2A 2EFQA 5E8GA 2DK8A 4WF2A 4HV5A 1EV7A 1FYKA 5D8LB 4GGGA 1U5TA 1WI9A 4ESFA 1UHWA 1BI0A 4B09A 4I7HA 1Q1HA 3R61A 3WU1B 1YG2A 1T98A 1QNTA 2FSWA 1EH6A 1KQ9A 1XCBA 4BAYA 4G9YA 4LG0A 4LMYA 1S3JA 3SXYA 3E6BA 4H0EA 1KA8A 2HKOA 4BYYA 3N4MA 1K6OA 4Y17A 1MDMB 3F72A 3CO7C 2GAUA 3V7RA 1TTYA 4IF4A 2F5EA 1SMTA 1QZZA 1B6AA 1P2FA 1ZLJA 1HKQA 3K1MA 4G94A 4L5JA 2J5OA 2R3SA 2FQ3A 2A3SA 2XAQA 2P7CB 5HVQC 2LKPA 2QLZA 2QM3A 1XD7A 4LGWA 1J7KA 3R60A 4GYGA 4LD5A 4MEYF 2DK5A 5LEJA 6PAXA 1VTNC 3FWEA 3BWGA 2IP2A 5JHUA 1HSJA 1C0WA 2NNNA 1HW1A 2ZMEB 5LHIA 1R7JA 1XGOA 2ELHA 1JXSA 2K7LA 1G3WA 1IN5A 2COMA 2PMHA 3GO5A 3GFIA 5TJJA 2FBHA 1U2WA 2VE9A 2O3FA 3R4KA 2R7FA 2G9WA 5F6FA 3T8TA 2GXBA 3C18A 5K5QA 1UB9A 1OMIA 1HQCA 2ESHA 3IKVA 1USTA 1XSVA 1T2KA 4RGXA 1HBXG 5FLXK 1S8NA 1BI2A 4A6EA 2OQGA 2NNYA 2UZKA 1IXSB 3U9GA 1R58A 4OIRF 2VODA 4EM0B 4IXAA 3E6CC 3HSEA 1OR7A 5D5UB 4ENKA 1LDJA 3KP5A 3HTSB 4UHTA 1Z6RA 3C1DA 2DTRA 4EJUA 2STTA 5BOXA 1CF7A 2G7HA 2X4HA 3LQQA 3LA7A 5DD4A 4HW0A 4L0YB 2YPRA 2V1UA 5K1YA 1HSTA 3ECOA 3ULQB 2Z9OA 5FD5A 1IRGA 5HLIA 1PP7U 2V1XA 3ZQ7A 1D8KA 2GQQA 4IRHA 2JRTA 1SD5A 3GW2A 3BDDA 4Z2YA 2VOOA 3E5XA 4WX9A 3EYIA 1OPCA 4BQAA 4P96A 2WTEA 1QBJA 3G73A 1FBQA 2EK5A 1H9TA 4KIBA 3Q9SA 2P6TA 2OZ6A 2D45A 2DO7A 3ZMVA 5HS7A 1SFEA 4G6QA 1BC8C 3KLOA 4HQMA 2BV6A 3FF5A 4RAZA 2KJCA 1YS7A 4EMSA 2XKOA 1V3FA 2XKPA 1GHCA 1Y0UA 3FM5A 5DD8A 3BJAA 3F22A 1R00A 1J2XA 3V7CA 3FMQA 1L0OC 3L7WA 3DFGA 3TGNA 1TW2A 2YSRA 2L02A 3KP2A 1DUXC 2LF7A 5KVRA 2GIVA 3FX3A 1YW9A 5J8CA 4HX8A 3WTZA 2ZMEC 3OOPA 2UWMA 1QO0D 1BM9A 4LB6B 2FNPA 3K2ZA 4LK1F 4ETSA 2M5WA 1S6LA 3LWFA 2L3DA 3TO7A 2CYYA 4D0PA 1ZYRF 3B73A 3BPVA 5KK1A 3IWFA 3RKXA 1XMKA 1UCRA 4IRIA 2P5VA 5LRSA 5DCMA 1EH7A 2PFBA 2FBKA 2MA3A 3CTAA 3E97A 2K4BA 1P4XA 1KQ8A 1ZARA 1G3SA 1ON2A 2RKHA 2KIUA 4FX4A 4MQ9F 3SFZA 3RYPA 1REPC 1ZLKA 4MGRA 2P6SA 1FP2A 2RN7A 3REOA 2EFOA 3J81Z 3HOSA 2ZCWA 3JW4A 4RGSA 1R36A 3WTSC 2QQBA 2ZKZA 3RIRA 4GCVA 3ABUA 4XBFA 2JPCA 1O3TA 1B59A 3MCZA 2UXXA 2UXNA 3KE2A 1MDMA 1TW3A 2A07F 2FEZA 3W6JB 3I59B 4R79A 4WXCA 3K1PA 5JI6A 4N9HA 5ICCA 2Y48A 1YW8A 1OYIA 1W7PA 4BH9A 3COAC 2PI0A 5FGMA 1J5YA 3IC7A 2H09A 2STWA 3V8JA 5CYVA 2P5LC 4L9VA 4I0AA 4YFKF 3GFJA 2HQRA 1Z1DA 3K9TA 2YR2A 4HYEA 2XIGA 1ZG5A 2ZJ2A 3QPTA 3CDHA 2P8TA 2PMUA 4CO8A 2F5CA 3T8RA 2L54A 1FBSA 1FX7A 2OBPA 3LAJA 2DAOA 2OAZA 4AWXB 1DPUA 1P4WA 2XROA 5LHGA 5DEQA 4ZZDA 4OIOF 5ICEA 1V4RA 5DUIA 3LAPA 4ON0A 2RGVA 3DXJF 2D2WA 3O2PE 2GZWA 1MD0A 3BJ6A 2A69F 4UXNA 3FMRA 1HW5A 2V79A 4K2EA 4R8HA 2VT3A 4ZYDA 5ILUA 4RB3C 5LLQA 1SD6A 3I5UA 4HX4A 4I02A 4A5NA 1I5ZA 3TKYA 2XV4S 2GXGA 4ZYHA 1IN4A 4A6DA 2NRAC 1H0MA 3EQLF 3C3WA 2ISZA 2XVCA 3WTVC 3E5UA 1G6NA 1U5TC 1K78A 1X3UA 5DCFA 2EB7A 3O6BB 1YFHA 2B0LA 2DFIA 2XHKA 1W5TA 3QRFF 1U78A 2L4AA 3B02A 1O57A 1S7OA 2HS5A 3ELKA 2DU9A 3GFLA 4NQWA 2W57A 2M45A 1ON1A 2V9VA 1LB2A 4WXHA 3WGHA 1Z05A 2HYFA 3F3XA 4Q4ZF 2W85A 3MFKA 5DYMA 4CZZA 3KFWX 4G7ZF 1F4KA 1CF7B 2VOPA 3AAFA 4ENNA 4OOIA 3J7AO 3JAMZ 4A2UA 1W4MA 5ICGA 4L0ZB 3GZ5A 1J59A 2LDUA 4WWCA 4KIFA 1ZN2A 2VBYA 1CGPA 4UVAA 3I71A 4EQQA 3ERED 1JHHA 2A68F 3M1EA 2G7UA 2XAJA 3D5LA 2BEOA 3DP7A 3J80Z 1K79A 1ZAOA 4Q5SF 1MZBA 1MGTA 4PCQA 4CDGA 4L9JA 1QPMA 2C6YA 2BE5F 4UVBA 1WWXA 3HTUA 5FFXA 4AIKA 3IL2A 4IHTA 5AIPA 2ZMEA 3GZ6A 2YX7A 1LDKB 3F8CA 2KKOA 3ZMSA 1DDNA 2KIFA 1SFXA 1MKMA 2O03A 3CUQB 4QLCU 3P9KA 4RB0A 3RTRA 3ZMDA 2XAGA 3I53A 1A04A 2OU2A 4TV7A 3MWMA 2AXLA 1R1UA 4I0BA 4OU0A 4U0YA 4ENMA 4CGZA 4JBAA 1PUEE 4A0ZA 4ZZLA 2K4JA 3E6DA 4IRGA 2CFXA 3S2WA 2ETHA 3P9IA 1IXCA 4PGHA 2M1BA 3RPUA 1U5TB 4S05A 4RS8A 3F6VA 1T6SA 2Y75A 4N9IA 4MHGA 1U6GA 3FXRA 2XGXA 1DP7P 5F64A 1XMAA 4EGYA 1O3QA 2PLYA 2VBZA 1XGMA 4EJVA 2CGPA 3HHHA 1OYWA 2KJBA 4KMFA 1LJ9A 4I01A 4KNYA 1XSXA 5D4SA 3WTTC 3H3ZA 5E1XA 2DQLA 1TQPA 3J81K 4HV6A 3E5QA 5BPDA 4AIHA 5DUKA 2VT2A 1SD4A 4KN4X 4QWQA 2GWRA 1TLHB 2W84A 4YIIA 2FE3A 5D6FA 1TQMA 1LEBA 1B4AA 2A6HF 1IW7F 2L01A 3L00A 3DPLC 2IW5A 1FZPB 4FHTA 2P5KA 3ZN1A 4YFXF 3SHFA 1O7LA 3K0LA 3WE3A 1MJ9A 5HDNA 1GXPA 2EA4A 3DF8A 5LEKA 1ZHFA 3FZVA 3L9FA 1BC7C 4KFCA 1KU7A 2E7WA 3EYYA 2FRHA 5HOOA 3PQJA 2BBYA 3T5XA 4RGRA 3KP4A 1IAWA 2LF8A 4AVPA 1J75A 5TRDA 4Y15A 1HXDA 3GF2A 3GFMA 4P55A 1FPQA 4A0XA 3K1NA 2HTSA 3HUGA 4M6YA 3CO6C 4OMZA 2ZFWA 2XASA 2HR3A 1KU3A 2OD5A 3DQVC 5K5RA 2LSOA 5F1RA 2OZUA 3TOAA 4HOBA 3HYIA 3J80K 5LRRA 4P9UA 3LQRA 5EEGA 4OINF 1J9IA 1J0RA 4MNUA 3LSTA 2VC0A 4LLLA 2F5FA 2VONA 2EWNA 3Q5FA 1XDUA 4RB2C 4YG2F 4NHJA 4HA8A 1JHFA 2RV8A 3V8KA 4O5VA 3FXQA 3NRVA 3FMSA 3LFKA 1FSHA 3JSPA 5E8IA 3DKWA 2HYGD 4M9SA 3BPXA 5IT3A 4XSZF 4XSXF 3F21A 4HLYA 2V6CA 3KCCA 2Y0MA 4JK1X 1R1VA 2HTJA 5CVRA 2LNBA 1KU9A 3W6KB 2QBYB 5D5VB 1LEAA 1XSDA 3MZYA 3QP5A 2H27A 4EJOA 3G3ZA 5LGUA 3WGGA 2RDPA 4G8XA 3PFIA 5L3EA 3I4PA 1DPRA 3PQKA 2JPBA 3KZYA 5ERIA 2TDXA 5D5WB 1HKTA 1YO5C 5E18F 3LA2A 4R1HA 5HS8A 1E2XA 1TQIA 3ZP5A 1U8RA 1FYLA 4IPAA 4CICA 1Z7UA 1G3YA 2JSCA 5L3DA 1MJBA 2EFPA 5L3CA 1ZRFA 4BNCA 4ESJA 2JTVA 4HLXA 4U88A 1RI7A 5A2QK 3RYRA 4AD9A 4EM1A 3JAMK 1Z91A 2DQRA 3F6OA 3JTGA 3FHZA 2JT1A 2HKXA 3HRTA 3CLOA 2GA1A 3TOBA 1GXQA 4M9XA 2OA4A 2EJRA 5H6QA 4GO1A 3MQ0A 1FC3A 1T39A 3BZ6A 3F8NA 1H9GA 2PQ8A 3M8FA 2IVMA 3DEUA 3QU3A 1TNSA 2L4MA 4Q47A 3DPTA 2DPDA 4O6JA 3O3KA 2R7DA 2IRFG 4YFNF 4EVIA 2J5PA 1ZREA 5CLSA 5DV5A 2ZBKA 3KP6A 2FXAA 2NYXA 5IT9Z 3I58A 3F8FA 2EFNA 1ZG3A 2PN6A 2AS5F 3VB2A 1S7AA 3WE2A 1E17A 4L5IA 1YYVA 1FSEA 3WG9A 5JVTA 1ZG1A 3GUDA 1ULYA 3I64A 4HX7A 4HBLA 1RNLA 5ILVA 1UHMA 1B9MA 5CVJA 3WTWC 5D6EA 4F7ZA 2HWVA 4G7HF 1RUNA 3GWZA 2CQKA 3H92A 5HLHA 2K27A 1O3SA 2W24A 3L09A 4FX0A 3MEXA 3GX4X 3U2RA 1EH8A 1XB4A 5ED4A 2QQAA 2YX4A 1SD7A 3BJOA 1T0FA 3R6SA 1R22A 4MEXF 2QENA 2HZTA 3BP8A 4KIGA 2A61A 1IN7A 4RB1A 3QAHA 4KN7X 3TDUC 3QP6A 2ZNYA 1F5TA 4DNCA 3QOPA 2RC4A 2JZYA 3RJPA 4UNOA 3ZN0A 3Q9VA 3NQOA 2EV6A 2O0YA 5DDGA 2CO5A 4ZH4F 4M72A 4ESBA 1FYMA 3JTHA 3VFZA 2WWYA 3HSFA 1JE8A 4U7DA 5J6XA 3WGIA 3EETA 4KYWA 2DPUA 3HRUA 2Z33A 4WK8F 3FM3A 4FT8A 5CVVA 4HQEA 3M9AA 5J8FA 1PP8F 3WTUC 5LGNA 3U1DA 3RDIA 1G3TA 3WTYC 3IHUA 2Z5UA 4HZFA 4BHPA 3GEZA 4P5OA 3OV8A 4I09A 1RZ4A 2E7XA 4RAYA 1I1GA 1W7PD 4A12A 2KRFA 2RQPA 1Z6TA 1XGSA 4EV0A 3ZMZA 4XRFA 1FP1D 1AOYA 2RNJA 2ZNZA 1BIAA 2X0LA 2MH2A 1ZGAA 3GLXA 2IA2A 3P9CA 1D5VA 1BJAA 2ACJA 5A2QZ 1LVAA 4RGUA 4WXDA 2MLKA 2ADUA 5BS6A 4EJWA 5FB2A 1BI3A 4DQ2A 1XGNA 1YTYA 4OIPF 4E70A 5H6RA 3N97A 3I59A 4HDUA 2PJPA 2FMYA 3CUQA 4KT5C 1R1TA 2QQ9A 2O61A 4OIQF 4HDVA 5IT9K 2FMLA 2QBYA 5D4RA 2DLLA 2FNAA 3MZHA 3QU6A 3KEQA 4GXOA 1XDSA 1ZRCA 5L3GA 3E3VA 5LGTA 1D8JA 5JR3A 2E1NA 3HIFA 2W25A 1KQ0A 1SAXA 1PDNC 2HGCA 4O3MA 2NS0A 1G4DA 1ODDA 3SZPA 4MQVA 1P6RA 1P4AA 2FOKA 4U7BA 5FLXZ 2VC1A 1ONVA 2H6BA 5JFRA 4G6DA 4U0VA 3HHGA 2HFHA 2DT5A 2NAZA 2YU3A 1STZA 1FY7A 2XAFA 4KUMA 5L3BA 3IRRA 2EFWA 3LA3A 2XRNA 4ZYGA 4JQFA 3TO9A 1R23A 4LLGF 2V1DA 2E1CA 1YIOA 4UV9A 1IRFA 3ABTA 1LDDA 1IF1A 4L9NA 3WU0A 4EM2A 1F1ZA 1B1BA 5EEHA 3BY6A 3L2CA 3K69A 3KETA 4ZYEA 2VN2A 4MTEA 4LK0F 2P7VB 4MTDA 5E17F 2WC2A 2FU4A 2MLGA 5LHHA 3ZPLA 4CHUA 2VE8A 3RKYA 5AONA 4A5MA 4PDKA 1K78B 4UV8A 3VODA 4I2OA 3ML6A 3R0JA 4L9TA 3E6MA 1D3YA 3WODF 4KMUX 1SFUA 4M6XA 1AWCA 4BXUA 1GVJA 5BQTA 1XN7A 4UUVA 2D1HA 5K5OA 1IUYA 2CW0F 3CUQC 1ZH5A 2A6EF 1I6XA 5E1WA 3HSRA 3VEPA 1FOKA 3D0SA 1WSUA 4XLPF 2Z3YA 2PBIA 4HF2A 5D5XB 1OKRA 1WRJA 3SZTA 5FO5A 1T38A 1WQ2A 5FD6A 4IHSA 2CG4A 1FLIA 2BGCA 3VOEA 2IPQX 3IRQA 2M87A 3HOTA 5E20A 2ZO4A 2HEOA 1XCVA 1RIOH 4WCGA 2F5DA 3IKTA 3CJNA 4M9ZA 4LJZF 3T1BA 4U0WA 3RKWA 3V4GA 4OMYA 3V7SA 4I98B 1K7AA 4BHBA 4M71A 5D8KB 4UVCA 2XUBA 2Q2EA 3R0AA 3H3UA 1RUOA 3HRSA 4EJTA 5BMZA 3V8LA 2MC3A 2DI3A 2OQRA 3F23A 3M8EA 1ZGJA 4HF0A 4Y13A 3TQNA 2D1VA 1FBUA 2H6CA 1R5GA 2IA1A 2HQNA 4IJAA 4EGZA 2RVCA 1R5HA 2MBFA 1KYWA 5HS9A 2IT0A 4S04A 2Q0OA 2BYVE 3ECHA 1NHAA
chains in the Genus database with same CATH superfamily
3PNVA 1I27A 3X2QH 3OSFA 1ETOA 2VQCA 3EUHA 3OR1C 4BBSJ 1K61A 5HLGA 4XLAA 3W6VA 3ZMTA 2XC7A 3WHCA 1FWZA 2LH9A 2KIMA 3NEUA 5F0CA 3D5SC 3JR9A 1FMVA 3HRMA 4CXFA 1HKSA 4LG3A 4F91B 1QZYA 2OTLI 2EV0A 4A69C 5IP9J 3K4LA 4BHCA 1EJ9A 1WZ2A 1L3LA 4AIJA 5ILSA 1D1BA 2XF6A 2MW8A 3K4KA 5CJ9A 4C2TA 2M30A 1JI8A 2OJED 2HDWA 2K9LA 2LG4A 3M1CA 5TISC 2MYSA 3JSOA 2F6CA 2ESNA 1F9NA 2HDCA 4OWRB 4DBQA 3KLNA 5H20A 1KGSA 1YW7A 2H94A 1JUPA 1VQNI 3MZ8A 1T0FC 1W7PB 5CVIA 3C7JA 4KICA 5HDKA 1VQMI 2KFDA 1IN8A 3GYHX 3CCMI 1UFMA 3OIPA 3DV8A 5EEAA 5F27A 1X58A 2BY0A 4MO7A 5HDGA 1MJAA 5E3OA 2E2HJ 3FBNB 3ROUA 3H0DA 2GA2A 2E1MC 4UUSA 4GYIA 3P7NA 4JYKA 4IVNA 1MH3A 1IXRC 2QUFA 1BBYA 3HC7A 2L7ZA 2FA5A 3M7GA 1I1SA 3MAJA 2K86A 2W4SA 2QWWA 3BOQA 3S3MA 1BL0A 2DBBA 2FF4A 2O8XA 2LY9A 5L3FA 3MD2A 3EDPA 1F43A 2MD5A 3CCJI 1JT0A 2K9QA 2DW4A 3BT9A 3TO6A 1LVKA 1LNWA 1BIBA 5BPIA 3QPHA 4M74A 4LFUA 2E34A 2QZ8A 1TBXA 1E3HA 2XGCA 1B9NA 2EV5A 1USSA 3KEOA 4BU2A 2MH9A 4M6VA 2DA6A 5IY5H 3HL2A 4A3LJ 1QGPA 1R9TJ 2WV0A 4HF1A 3FXMA 1I6HJ 1QRYA 1JUMA 4LLNA 2F2EA 1TNTA 4NBQA 1P92A 4N0BA 1WKMA 2IAIA 3QOEA 4CYDA 3KZZA 3M8JA 3RI4A 2ZXWH 1YS6A 3ZMUA 2CSOA 2GBYA 3O8GA 2IGNA 1MBGA 5ICFA 2A5YB 3F8BA 3AFHA 3TL4X 1XMXA 2DCEA 4RLFA 2XPUA 1VQ5I 2K9SA 2XB5A 4NB5A 3CUOA 1JGSA 4LOCA 2AXTC 4ENJA 3V42A 4PGGA 5C4XJ 3QPSA 4PZJA 4XIDA 4MFDA 1BR1A 4BE2A 3OS0A 5E1ZB 5DCMB 5DS9A 2O6GE 3SDBA 2VXZA 1HW2A 2P4WA 2R0QC 2QYOA 4PJLA 1BR4A 2XAHA 1OYYA 3BROA 3OOUA 1O3RA 2DJIA 2Z99A 3SQNA 3IWZA 4M3EA 2W48A 1LQ1A 1OCPA 2VBXA 3WTXC 1WJCA 1Z77A 4LG0B 2ZXJA 3L2RA 2VBWA 2CWEA 1VQPI 1MIJA 4MIMA 3K4NA 4XLNF 1S29A 3MKYB 3KP7A 4XLHA 2HOAA 4KDPA 2HOEA 3TP0A 5FFZA 3GVAA 3F8MA 3I0TA 5CVUA 1RRJA 1BN5A 2IJLA 3HB9A 2O9LA 3FXUA 5EZHA 3F0CA 1SMYF 2BY2A 2M8EA 1O7FA 4HAMA 1BOAA 4XMYA 5AIQA 2K02A 4ZTFA 4M73A 5EYRA 1AKHA 1FT9A 1AKHB 1LUJB 4ASNA 1KU2A 1YQAA 4KA4A 3U1KA 2LKXA 2KPMA 4G7OF 3TDZC 1FNNA 5IOZA 3C2BA 3I54A 2Q8KA 2QVOA 4AUXA 5DM6F 1ZRDA 3KP3A 1D0XA 4A0YA 3DBHB 1ZQ3P 4HNTA 4Q48A 4U87A 4ANJA 2E19A 1Z3XA 3H0GJ 4XLFA 3OY9A 2PG4A 1IN6A 2PEXA 1POGA 1W5SA 1U3EM 1YJ9I 3GTLJ 5CQGA 4M3BA 1YLFA 2FBIA 3CCUI 1KYZA 3ISPA 4Y33A 1X1DA 4I6ZA 4RM3A 4II2A 1YHQI 3S3NA 3RPQA 4LB5A 4P9FA 3DPUA 3GXOA 1BI1A 4L18B 4ZDLA 3T0YA 3CCYA 3CP8A 2ZSHB 1QQIA 2M8GX 4YIFA 3AKZA 4B8XA 3DLLF 1Z9CA 2ISYA 5LBQA 2BY1A 2M4GA 1OCTC 2IA0A 2VL8A 1JJ6C 1IZ1A 2EA2A 3DU6A 2LR8A 2EFQA 3DEEA 5E8GA 1M1EB 2LTPA 2DK8A 2VQGA 4HV5A 4QPOA 4WF2A 1I3QJ 4BQQA 4DJAA 1EV7A 1FYKA 3ZOBA 4E7IA 5D8LB 4CSWA 3A01A 4GGGA 2QEXI 1U5TA 3BQYA 2XSDC 2V6EA 1WI9A 5B5EC 2LFBA 4ESFA 4J00A 2CQQA 3LOCA 4XKVA 3QYBA 2HOSA 5CQEA 1UMQA 4BJ5C 1UHWA 4E7ZA 1BI0A 4E7JA 4B09A 2R93J 4I7HA 1Q1HA 3R61A 3OWTA 1VQLI 3WU1B 1GV2A 1TWFJ 1YG2A 4PSWA 1T98A 4ZJZA 1QNTA 2FSWA 1EH6A 2X1DA 1KQ9A 3W2WA 2M3AA 4C2UA 3EPZA 1XCBA 4BAYA 4G9YA 4LG0A 3MKLA 2DDAA 3RZDJ 3JREA 2YS9A 2XAUA 4LMYA 1S3JA 1WH5A 1QHHD 3E6BA 3SXYA 2WBMA 3L2VA 4H0EA 1KA8A 2HKOA 4BYYA 4YELA 4FE4A 3N4MA 1K6OA 4IHYA 1TT0A 1ZR4A 4Y17A 3L2WA 1MDMB 2KRHA 5E79C 1JGGA 3F72A 2DMUA 5GTIC 3CO7C 4HPQA 4BACA 2GAUA 2D5VA 1SAUA 1VQ9I 1PUFA 3V7RA 1A5JA 1TTYA 4IF4A 2F5EA 3CP2A 3IH4A 2Y9ZA 1SMTA 1RKTA 1QZZA 3NWTA 1B6AA 1P2FA 1ZLJA 1HKQA 3M4OJ 3K1MA 2E1MB 1Y1WJ 2ZFUA 1TWGJ 3CCSI 2X48A 4G94A 3CF2A 1R5ID 4GFBA 4L5JA 2K3PA 1HDPA 1H88C 2XGDA 1MMAA 2J5OA 2R3SA 2FQ3A 1MW7A 2A3SA 2XAQA 1D5YA 5M5XJ 2P7CB 1E0EA 5B1AH 5HVQC 3WU2C 2LKPA 2QGUA 2MABA 2QM3A 2QLZA 1XD7A 3K10A 4LGWA 2OC6A 1J7KA 2EPFA 4IKFA 3R60A 4GYGA 2JMWA 4LD5A 4NC6A 4ZTJA 2ZC2A 2HPIA 4MEYF 1PJRA 3EUAA 2DK5A 5LEJA 3CMEI 1NG6A 1D0YA 6PAXA 1VTNC 3FWEA 3ONQA 2X1EA 3BWGA 2IP2A 1H89C 5JHUA 1HSJA 1ORKA 1A35A 1C0WA 1WJAA 4V19K 4A3KJ 3VPRA 2NNNA 1HW1A 3C2GA 4H4KC 3UNGC 2ZMEB 5LHIA 1R7JA 1XGOA 2ELHA 5F04A 1JXSA 5J1YA 2K7LA 1G3WA 1IN5A 3M07A 3BR0A 2COMA 1KONA 2PMHA 3AG1H 3GO5A 3GFIA 5TJJA 1QVTA 2FBHA 2EQRA 1U2WA 1XTAA 2VE9A 2K85A 2O3FA 3K4BA 4II3A 4F55A 3R4KA 2R7FA 2G9WA 1Z21A 3IAS2 1QZEA 5F6FA 3T8TA 2GXBA 3C18A 5K5QA 1UB9A 4NC7A 1OMIA 2M2EA 1HQCA 4B1RA 2ESHA 3IKVA 3PIPF 1USTA 1XSVA 1T2KA 4RGXA 1HBXG 5FLXK 3K4CA 1S8NA 4RM2A 2DMPA 3CMYA 1X3ZB 1BI2A 4A6EA 2R7VA 2OQGA 3CC7I 2H1KA 2NNYA 2UZKA 3AG2H 1VFCA 1IXSB 1D1AA 2BHYA 3SJMA 2PJRA 3U9GA 2JA8J 3CJRB 1R58A 1YOVB 4OIRF 1ENHA 4JP0A 3CCLI 2VODA 4EM0B 4B4CA 4IXAA 4KJZA 3LSPA 1PVEA 3B6CA 3E6CC 2E1OA 2EZKA 2OCCH 5EG0B 9ANTA 3HSEA 1OR7A 5D5UB 4A3JJ 4ENKA 1LDJA 3KP5A 3BR1A 4UHTA 1Z6RA 3C1DA 3HTSB 2DTRA 4EJUA 2STTA 2JA6J 2LK2A 3MVPA 5BOXA 1CF7A 2WY7Q 2G7HA 2X4HA 3LQQA 2ZXHA 3LA7A 5DD4A 2VXDA 4HW0A 3UKGA 4BQNA 4L0YB 2YPRA 2V1UA 5K1YA 3CJTB 1HSTA 1MBHA 3ECOA 3CCRI 2R7OA 3ULQB 2Z9OA 2Q1ZB 5FD5A 1IRGA 5HLIA 3BR6A 1YRNA 2RAEA 1PP7U 1MBJA 2V1XA 2A05A 2NVXJ 2VUMJ 4AYBA 1YJNI 2Y31A 3ZQ7A 1D8KA 2GQQA 4XONA 4IRHA 1QA6A 1Y8RB 2JRTA 2DT6A 1SD5A 3GW2A 3BDDA 1IDZA 4Z2YA 4CYCB 2VOOA 3E5XA 4WX9A 4DBRA 3EYIA 4UUTA 1S9HA 1OPCA 4BQAA 4P96A 2WTEA 1QBJA 3BCAA 4LITA 4L5EA 1FBQA 3G73A 1FJLA 2V1NA 4BXFA 2EK5A 1H9TA 4NUBA 1SFOJ 4KIBA 3Q9SA 2P6TA 2OZ6A 1JJ8C 2D45A 2ECCA 2DO7A 3ZMVA 5HS7A 1SFEA 4G6QA 1BC8C 3RPUD 3DCFA 4A3DJ 1D1CA 3SFIA 3KLOA 3OYBA 1RC9A 4HQMA 2BV6A 3J7YJ 3FF5A 4RAZA 2KJCA 1YS7A 5J47A 3FXKA 2MGQA 1J09A 4EMSA 3GLLA 2XKOA 3GCMA 2G0EA 4JX6A 1V3FA 4C30A 2XKPA 1GHCA 1ETXA 2ECBA 1Y0UA 5FRMA 2VI6A 3FM5A 5DD8A 3BJAA 5KAFC 3F22A 1R00A 5FKOA 4DZJA 1J2XA 3DLAA 3V7CA 3FMQA 4IHVA 1L0OC 2VKHA 3L7WA 2DN0A 3DFGA 4CZCA 1SVMA 3G4SI 3TGNA 1TW2A 2YSRA 5EDNA 2L02A 3KP2A 4BEHA 1DUXC 1MNMC 2LF7A 5KVRA 1B72B 2IXSA 2GIVA 3FX3A 1MBKA 2CQNA 5B1BH 3FBIB 1YW9A 4CYCA 2R7SA 5J8CA 4HX8A 3WTZA 2KZVA 2ZMEC 3OOPA 2R7UA 5F0FA 2UWMA 3JRIA 1QO0D 2M0MA 2VQLA 1BM9A 5GAGJ 4LB6B 4Y3OA 3RQ4A 2CH0A 2FNPA 3MKZA 3K2ZA 4LK1F 1HCRA 1IJWC 3QYFA 3HOZJ 4ETSA 3MMYB 4MLOA 1Z0XA 2M5WA 1S6LA 2QSGX 1W0UA 2NVTJ 3LWFA 3ZRGA 2L3DA 3TO7A 3OYFA 5BNGA 2CYYA 4D0PA 5JLXA 1VQ4I 3HOVJ 1ZYRF 5EZGA 1WPKA 3C2HA 2CQ7A 3VDXA 1JUSA 4A3MJ 3B73A 3LNQA 3BPVA 5KK1A 3HPHA 3IWFA 2ZJQF 3RKXA 1XMKA 4W1UA 1UCRA 4IRIA 1EA3A 2P5VA 5LRSA 1D0ZA 5DCMA 1EH7A 2XDVA 1TZLA 2PFBA 2FBKA 3FK6A 1DP3A 4M3DA 2VLAA 2MA3A 4HG2A 3CTAA 3E97A 3PM1A 4V2GA 2K4BA 1P4XA 3KYCB 4OAZA 4AC0A 2B7EA 2KQRA 3S2DJ 3S2HJ 1KQ8A 2WAEA 5IP6A 1ZARA 1BA5A 1G3SA 1ON2A 2RKHA 2KIUA 4FX4A 4LIUA 4MQ9F 3SFZA 4KITB 3RYPA 1REPC 3I3LA 1ZLKA 4XKCA 2JWTA 3HKZA 1WH7A 4MGRA 2P6SA 1FP2A 2RN7A 3REOA 3CLQA 2EFOA 3J81Z 3HOSA 2AO9A 4ZYAA 1AHDP 2ZCWA 3JW4A 4RGSA 2OCEA 1R36A 3WTSC 4Y7NJ 3G1OA 2QQBA 4XICA 2ZKZA 3RIRA 3KZIC 3TEDA 3OYDA 4IO9F 3TP3A 1FIPA 4GCVA 3ABUA 4XBFA 4DGWB 2IS6A 2X6XA 1MNEA 2JPCA 1O3TA 2EBIA 2L9SA 1B59A 3MCZA 2VPRA 1MBEA 4E7SA 2UXXA 3W3CA 2UXNA 3KE2A 2NXNB 5M5YJ 1SANA 1MDMA 2JA2A 1TW3A 1LPQA 2A07F 3OYGA 1TC3C 2FEZA 1JTYA 3W6JB 5DM7F 3I59B 3IP4B 2F4MB 1IO2A 4R79A 4WXCA 2L7FP 5EGOA 2ZXIA 3K1PA 5JI6A 4N9HA 5ICCA 4DYCA 2Y48A 1YW8A 1OYIA 1W7PA 3F9KA 2NOGA 2VB6A 4BH9A 3COAC 2PI0A 5FGMA 1QPIA 2FQ4A 1X4OA 3LSIA 3SEZA 3J7AY 4PJJA 1J5YA 3IC7A 1ITYA 2H09A 2A6TA 4RMNA 1Z7LA 2STWA 1OCOH 4XM3A 4BKXA 3DTEA 2BXYA 3V8JA 1VF9A 5CYVA 3SDGA 2P5LC 4L9VA 4I0AA 3FISA 4YFKF 3GFJA 2HQRA 3M3YJ 1Z1DA 1W36D 2CUEA 3GTQJ 1A31A 1G2HA 3CCVI 3K9TA 2LP0A 2B63J 2YR2A 4HYEA 2XIGA 1ZG5A 2ZJ2A 3QPTA 1BW6A 2CUFA 2Y0SA 4UY8I 2VPLA 3CDHA 2P8TA 3BZCA 4HNUA 1TWCJ 2HPMA 4A3FJ 2PMUA 4CO8A 2F5CA 1VZ0A 3T8RA 2L54A 1FBSA 5FLVA 1Z67A 4XN0A 1FX7A 2KT0A 2OBPA 2HNHA 3OYNA 3DTIA 3LAJA 1ZGWA 2M0CA 2DAOA 3NAUA 2NS7A 2E71A 2R7XA 2OAZA 4B43A 4AWXB 4C9YA 4A3IJ 1DPUA 1P4WA 2XROA 5LHGA 2E5ZA 3CJQB 3MKWB 1RETA 4QTRA 5DEQA 2HXOA 4ZZDA 4OIOF 2DA4A 5ICEA 1V4RA 5DUIA 2XPVA 3LAPA 3K70C 4ON0A 2RGVA 3DXJF 2D2WA 1T08B 3RKQA 3O2PE 4OAYA 5C4JJ 1X19A 1K4SA 2GZWA 3G6EI 1MD0A 3BJ6A 4CCOA 2A69F 2KRCA 4PUSA 4UXNA 3FMRA 2JA7J 2VKDA 3O8HA 1HW5A 3Q3SA 1OCCH 3CESA 2V79A 1AU7A 5FROA 4K2EA 1Y1VJ 4R8HA 2VT3A 4F92B 2DA2A 4ZYDA 2DOAA 5ILUA 4RB3C 2R5ZA 3S14J 5LLQA 1W1WE 1SD6A 3I4NJ 3I5UA 4HX4A 4I02A 4A5NA 3PFYA 1I5ZA 2R92J 3TKYA 3WG7H 2VQHA 2XV4S 3BTJA 1GLNA 2GXGA 4FETA 1TP4A 4E4HA 4ZYHA 2TRTA 1IN4A 3A2KA 4A6DA 1N77A 3IUOA 1UZCA 5TGTA 4CUGA 3CZ6A 2NRAC 1H0MA 3EQLF 3C3WA 3G1LA 2ISZA 3JCUC 3TW6A 2XVCA 2AQEA 3WTVC 4NC8A 3E5UA 1G6NA 1U5TC 4BE0A 3VYTB 1K78A 1X3UA 4DYQA 2W7NA 5DCFA 3ASOH 2R7ZJ 2EB7A 3LSHA 2BW3B 3BG3A 3O6BB 4BDYA 2B0LA 2DFIA 4M3GA 1YFHA 1OCRH 5KNLA 2MC4A 5B66C 3WHBA 3ZCOA 3FXLA 2XHKA 1P9QC 4ZDOA 1W5TA 3QRFF 3AL0B 1U78A 1LFUP 2L4AA 2W1OA 5C3EJ 4D7NA 5CPRB 3BTLA 3ABLH 2LOOA 2VJ5A 3B02A 1O57A 2X85A 1X2MA 1S7OA 3S17J 1WJBA 4RBOA 2IGOA 3ELKA 2HS5A 2DU9A 3GFLA 2CMPA 3OL3A 4NQWA 2W57A 2B9SA 3PSIA 2M45A 1ON1A 2MG4A 1NG7A 1DU6A 2V9VA 1LB2A 2I10A 4AYBN 4WXHA 3WGHA 4JX5A 5K7HA 2XRLA 3VSKA 1Z05A 1N78A 4E7KA 3A02A 2L2OA 2HYFA 2IGKA 3F3XA 4Q4ZF 1U8BA 1XS9A 1OCZH 2W85A 3MFKA 5DYMA 4CZZA 4Z6YA 3KFWX 4G7ZF 3L1PA 3PSFA 1F4KA 3S1MJ 2DDBA 1MNDA 3D5RC 3VYUB 3GTJJ 3DKXA 1V5GA 2R7TA 1IRXA 3K7AJ 3JRHA 1CF7B 2VOPA 3AAFA 4ENNA 2KDOA 4OOIA 2WAQN 3ZXSA 3J7AO 1T8IA 2MSYA 2ZB9A 1DGWY 2XB0X 3JAMZ 2DODA 4A2UA 2PMZA 1W4MA 5ICGA 4L0ZB 2LC2A 2LREA 2VKEA 3GZ5A 2LDUA 4WWCA 4KIFA 1J59A 1ZN2A 4XLCA 4BQOA 2VBYA 3OSGA 1CGPA 2PMZN 1QHGA 4UVAA 3I71A 4EQQA 4PFPA 3ERED 1JHHA 4UB6C 2A68F 3M1EA 2EIMH 1OQYA 3PUFA 2NVQJ 2G7UA 2XAJA 3D5LA 2AHQA 2BEOA 1MMSA 3DP7A 3J80Z 3I55I 1K79A 3FXOA 3S93A 1ZAOA 1LFPA 4Q5SF 1MZBA 1MGTA 4PCQA 4CDGA 4L9JA 1QPMA 2C6YA 2R7RA 2BE5F 2NVYJ 4UVBA 1WWXA 3HTUA 5FFXA 4AIKA 3IL2A 4IHTA 2BVLA 2BOLA 5AIPA 3H5NA 1H8AC 4E7HA 2ZMEA 3GZ6A 2YX7A 1LDKB 2AQFA 3F8CA 2COBA 2KKOA 3ZMSA 1DDNA 1ERDA 2KIFA 2DXIA 1SVLA 2QCOA 2FOWA 1SFXA 3GMEA 1MKMA 2O03A 2K40A 3CUQB 4QLCU 2ZJRF 4HRIA 4AM3A 3P9KA 4RB0A 1U0JA 1XG1A 2QF7A 4DYRA 3RTRA 3ZMDA 1HF0A 2XAGA 3I53A 5IP7J 2DFEA 4V2FA 3RQIA 1A04A 3IV5A 2UUZA 4E6KG 3BCBA 5F08A 2R7QA 2OU2A 4TV7A 3MWMA 1P7JA 2YUSA 2AXLA 1R1UA 4I0BA 4OU0A 4U0YA 4ENMA 4CGZA 4JBAA 1PUEE 2NS8A 4A0ZA 4ZZLA 4DOZA 2CW7A 2R5YA 2K4JA 3E6DA 4IRGA 2CFXA 2WAFA 3S2WA 2ETHA 3P9IA 1IXCA 4PGHA 2QKMB 2FJ1A 2M1BA 3RPUA 1RESA 1T56A 1U5TB 4S05A 4CCLA 2GLOA 4DIQA 4J01A 4B44A 2DMQA 3S16J 4RS8A 1I39A 3F6VA 1WGXA 1T6SA 2H8WA 3E0JB 1SVOA 2Y75A 3BQZA 4N9IA 4F3QA 3LMMA 2CFOA 4MHGA 1U6GA 2QA4I 3FXRA 2XGXA 4J19A 1O4XA 3G1MA 1DP7P 5F64A 3SEQA 4XRSA 1XMAA 3FIWA 2JJ7A 4XN3A 4B48A 4EGYA 1G8XA 3BR5A 1O3QA 2PLYA 1X4PA 2VBZA 2CV2A 1XGMA 2HU9A 4EJVA 2CGPA 3HHHA 1OYWA 2KJBA 2R7WA 3BLYA 4KMFA 1FTTA 1LJ9A 3IH2A 2V26A 4RLQA 4I01A 4KNYA 1XSXA 1ZELA 5D4SA 3WTTC 3H3ZA 4CCKA 5E1XA 4IL6C 2K9NA 5M3FJ 2DQLA 1TQPA 4BE1A 3J81K 2Y9YA 4HV6A 3E5QA 1HOMA 5BPDA 1VQOI 4AIHA 4PK4A 5DUKA 2VT2A 3ESWB 1BOBA 3EUHC 1SD4A 3NARA 3ZQGA 4KN4X 1DQUA 5GAEJ 4QWQA 2GWRA 1TLHB 2W84A 3H9JA 4D5FA 4YIIA 1FIAA 2FE3A 3ZQCA 1DGRM 5D6FA 1TQMA 1LEBA 1B4AA 4BXXJ 2LVSA 3LSKA 1OR7C 2KMUA 3OYHA 1WI3A 4IHXA 3K4JA 2A6HF 2K9MA 1F36A 4I99C 1PYVA 5GP9A 1LKXA 1IW7F 2L01A 3L00A 3DPLC 3QQAA 3VSLA 2LD5A 2IW5A 1FZPB 4FHTA 1NH3A 2P5KA 4XRSG 3ZN1A 1R71A 4YFXF 3SHFA 1O7LA 1V5FA 3K0LA 3WE3A 1WJFA 1MJ9A 5HDNA 1GXPA 1UG0A 2EA4A 2E5NA 3DF8A 5LEKA 1ZHFA 3FZVA 3LFUA 3L9FA 1BC7C 4KFCA 3S3OA 1KU7A 2E7WA 3EYYA 2FRHA 1Y8QB 5HOOA 4RAGA 3PQJA 2BBYA 3T5XA 4RGRA 3KP4A 5F1JA 1IAWA 2LF8A 4AVPA 2X51A 1J75A 5TRDA 2KISA 3Q0WA 3SYTA 1NTCA 5CKTA 3S32A 1IG7A 3DBLB 4Y15A 1HXDA 3GF2A 3GFMA 5GAHJ 4P55A 1FPQA 3K4MA 3CQZJ 3K2AA 4A0XA 3K1NA 2HTSA 3HUGA 3HOUJ 1YI2I 1X1PA 4M6YA 3CO6C 4OMZA 4PJ0C 2FUG2 2ZFWA 1W36C 2XASA 2P0WA 2XPWA 4I76A 2IS1A 2HR3A 2JUCA 1KU3A 2OD5A 3VYSB 1IV8A 3DQVC 5K5RA 3HUGB 1N75A 1OISA 2LSOA 2I8DA 3B6AA 1IV6A 4F52A 5F1RA 2OZUA 2HVRA 3TOAA 4HOBA 3HYIA 3J80K 5KAIC 3EUKL 3ZQQA 2Y30A 3LSMA 5LRRA 2CRGA 2CS3A 4P9UA 4XLEA 2RQQA 3LQRA 5EEGA 4OINF 1X1BA 1J9IA 3OYJA 1J0RA 1UJ8A 4MFEA 4BGDA 2WB1A 4MNUA 1A6QA 3LSTA 2EILH 2VC0A 4LLLA 2HOTA 3OIOA 3PL8A 2F5FA 5IPAA 2VONA 2EWNA 2E35A 3I56I 3VWBA 3TBIA 3ZR8X 4UB8C 4UUSB 2OPTA 2N8GA 3Q5FA 1XDUA 4XRMA 4B3AA 4RB2C 4YG2F 3HPGA 2OUMA 5J4YA 2PJRB 4NHJA 4HA8A 4PFOA 1JHFA 2RV8A 2V9KA 3ASNH 2KDZA 3V8KA 4YEJA 4O5VA 3OYMA 3FXQA 3NRVA 3FMSA 3LFKA 1FSHA 2CUZA 3JSPA 5E8IA 4CH7A 2Y2ZA 3ZQIA 3FK7A 3CMAI 3DKWA 2HYGD 3PNYA 4M9SA 2HDDA 1IRZA 3BPXA 3OYLA 5IT3A 3H9QA 4XSZF 1FMWA 2K3FA 5E3MA 4X0GA 3BG7A 3BR3A 4XSXF 3F21A 3HOYJ 5EGOB 4HLYA 2V6CA 3KCCA 2O8KA 4M3FA 1DU0A 2Y0MA 1IGNA 4JK1X 1R1VA 4P1WA 5J3LA 3KYDB 2HTJA 4YRVA 2DOEA 5CVRA 2LNBA 3RSNA 5GPAA 1KU9A 1UHSA 3W6KB 2QBYB 4HSRA 4ZC3A 5D5VB 1LEAA 1XSDA 1ETKA 3MZYA 3QP5A 2M9HA 2BXZA 4EJOA 5GTHC 3G3ZA 3HKZN 4B47A 1APLC 2H27A 2GIZA 4CCJA 5LGUA 1V55H 3ZQLA 3WGGA 2RDPA 2I5UA 2M7AA 3ABMH 3IAM2 4G8XA 4CCMA 2DA7A 2VJIA 5IYBJ 3PFIA 5L3EA 3I4PA 1DPRA 4NNJA 2DTZA 3PQKA 2JPBA 2V7FA 3KZYA 4KT6A 2RREA 5ERIA 2VIXA 2TDXA 3LL7A 2DJNA 1UG2A 5D5WB 5LD2C 1YO5C 1HKTA 4GDFA 3PIOF 3ABKH 5E18F 3LA2A 4R1HA 5HS8A 1E2XA 3G2BA 2A5WA 1TQIA 3ZP5A 1U8RA 1FYLA 1K6YA 4JX4A 2WADA 4IPAA 4CICA 2ZSIB 1Z7UA 1G3YA 2JSCA 1MSEC 2ICWG 5L3DA 1Q1VA 5H2FC 4BL0B 5J1UA 1RPWA 1VNDA 4FCYA 1MJBA 2FD5A 2EFPA 5L3CA 2XF7A 1ZRFA 4HSTA 4AIDA 4ESJA 4BNCA 2CUJA 3AG4H 2JTVA 4HLXA 2JN6A 4U88A 2LYCA 3P5JA 2GM4A 1RI7A 5A2QK 3RYRA 2ELJA 1MBFA 4LIVA 4AD9A 3GTGJ 4EM1A 3JAMK 1Z91A 2JUGA 2DQRA 2LMDA 3F6OA 3JTGA 2HQAA 1FEXA 1RR8C 3FHZA 3S1QJ 5DTDA 2KLOA 2JT1A 3GTMJ 2HKXA 5HNHA 3HRTA 3CLOA 3W2VA 1WJ5A 1RR7A 1BJZA 1S72I 2FX0A 2GA1A 3LSJA 2BY3A 4ZDPA 2QSFX 3TOBA 1GXQA 1YE9A 4M9XA 4IX7A 2OA4A 2EJRA 5H6QA 4DZPA 4GO1A 4F93B 5JVGF 2Y0SN 2Z16A 5J40A 1RKWA 3MQ0A 2BHZA 2X6YA 1FC3A 2E2IJ 1T39A 1Y56A 2UV1A 3BZ6A 3F8NA 3ERMA 5HLTA 1H9GA 3OYKA 3JRBA 2PQ8A 3M8FA 3A4CA 2IVMA 3DEUA 3QU3A 1TNSA 1BR2A 2EZIA 2L4MA 3Q0UA 4Q47A 1KZHA 2P81A 3DPTA 2DPDA 4O6JA 3ZQHA 1B72A 1JKOC 3O3KA 3CCEI 2R7DA 2IRFG 2V9PA 2K5CA 2RNGA 4EVIA 4YFNF 3HOWJ 2J5PA 1IC8A 4GRIA 2DOFA 1ZREA 5CLSA 5DV5A 2W82A 2KL4A 2ZBKA 2BW3A 3A1YA 2JRMA 1VQ8I 1GUUA 3DBRB 3KP6A 2FXAA 2ID3A 2NYXA 5IT9Z 3I58A 2CJJA 3F8FA 2EFNA 1ZG3A 2PN6A 2AS5F 3KEYA 5FKNA 3VB2A 4IEJA 1S7AA 4JOMA 3FHNA 1XPXA 4BDZA 2HZDA 1X1CA 2V4JC 4S0HB 3WE2A 1E17A 3IH3A 3QYEA 3PO2J 3JRGA 2CU7A 1ETQA 1V5EA 4L5IA 1SEUA 1YYVA 1FSEA 1GVDA 4IQ4A 3WG9A 5JVTA 1ZG1A 2VKVA 1WJDA 3GUDA 2NVUB 1ULYA 2DMTA 3S15J 2R5ZB 3I64A 4XNFA 4DW6A 4HX7A 2WV1A 2F5VA 4HBLA 4N4OB 1RNLA 5ILVA 1UHMA 1B9MA 5CVJA 4BJ6C 3WTWC 3E1SA 5D6EA 4F7ZA 4IOCF 2HWVA 4G7HF 1RUNA 3GWZA 1T95A 2CQKA 1Y0NA 2QQ8A 3K70D 3GZNB 4XKWA 3OYIA 1UELB 1QU3A 3H92A 3E7LA 2HQ5A 5HLHA 2K27A 1O3SA 2W24A 2ID6A 4FISA 3L09A 4ABZA 1GDTA 3MEXA 4FX0A 4XR6A 1W5CC 4BBRJ 3U21A 3GX4X 1VQ6I 1JT6A 3U2RA 1E3OC 3GTPJ 3L2QA 1EH8A 1XB4A 5K7FA 4IZZA 2HI3A 2GXAA 5ED4A 3I4MJ 2QQAA 5FLMJ 1WVRA 4A3GJ 3FKJA 2YX4A 1SD7A 2BZTA 4PJMA 3S1RJ 3W2AA 3BJOA 1T0FA 3R6SA 2Z2SB 1R22A 2DA5A 1I50J 4MEXF 1TWHJ 2QENA 1JTXA 1X3WB 2MFZA 3S8PA 2HZTA 3BP8A 4KIGA 2A61A 1IN7A 4BJTA 4RB1A 3BZKA 3QAHA 4KN7X 3TDUC 4CA0A 2Z1DA 5LFAA 3QP6A 3CF5F 2ZNYA 1F5TA 4DNCA 2X1CA 2LLKA 1HDDC 2H8RA 2IS4A 3QOPA 2RC4A 1CQTA 2JZYA 3RJPA 1YX5A 4UNOA 3ZN0A 3Q9VA 3NQOA 2EV6A 2VJ4A 5JHFA 2CV0A 2O0YA 5DDGA 2CO5A 2DFHA 4ZH4F 1E3PA 2M7BA 2R4GA 4M72A 4ESBA 1FYMA 4CCNA 4XK4A 3JTHA 2GOMA 3VFZA 2IEKA 2WWYA 4PSXA 4NDLA 3HGYA 3HSFA 1JE8A 4U7DA 4G6TB 2ME0A 5J6XA 3WGIA 3FKIJ 4A3EJ 2YU9J 1LE8A 3EETA 4KYWA 2DPUA 3HRUA 2Z33A 4WK8F 3FM3A 4FT8A 2X9DA 4IHWA 4RDUA 5CVVA 4HQEA 1ZK8A 3M9AA 4KISA 3LSRA 5J8FA 1PP8F 4AU7A 3WTUC 3I9V2 5KHDA 1FOYA 1YX3A 5LGNA 3HG9A 5HNFA 3U1DA 2ME6A 2GOXB 2L0KA 3RDIA 1G3TA 3VYRB 3IHUA 3WTYC 3JRAA 1IUFA 3QWLA 1YITI 4EEFG 3AL0C 5FRNA 1WCMJ 2E60A 3LSGA 2Z5UA 4HZFA 4BHPA 1QVUA 3GEZA 4P5OA 2X6WA 5M5WJ 5JLWA 4XKBA 3OV8A 2JVGA 4I09A 1RZ4A 2E7XA 3OR2C 4RAYA 1I1GA 1W7PD 1ZR2A 2EZHA 4E7LA 4A12A 2E36A 2KRFA 1FTZA 3CDIA 3K6GA 1X2NA 2EIKH 3RCOA 2L9VA 2RQPA 1YJWI 1MSFC 1X1AA 1Z6TA 1XGSA 2EZLA 4BY1J 4EV0A 1G59A 3ZMZA 2TCTA 4XRFA 3HEFA 4D5CA 1FP1D 3KX2A 1AOYA 2RNJA 3J7ZI 4FASD 2WA0A 2ZNZA 1T33A 1BIAA 2X0LA 2F4IA 2MH2A 1ZGAA 1R6RA 2F4OB 3GLXA 3H35A 1SC7A 2O7OA 2IA2A 3P9CA 1D5VA 4A93J 1BJAA 2ACJA 5A2QZ 1V54H 1LVAA 5GADJ 3CC4I 2X6OA 4RGUA 2L9NA 4EATA 1K4TA 5B3SH 4WXDA 2MLKA 2ADUA 2L7KA 4EJWA 5BS6A 5FB2A 1MH4A 1BI3A 3JRFA 2LY2A 4DQ2A 2VASA 2W00A 1XGNA 1YTYA 4OIPF 4E70A 5H6RA 3N97A 3I59A 1S5LC 1JKQC 2EIJH 4HDUA 2PJPA 4FTHA 2FMYA 3CUQA 3HM5A 4KT5C 5HODA 3BTCA 4D9JA 4BY7J 1TL8A 1R1TA 2QQ9A 1VI0A 3HJEA 2O61A 3HZJA 4OIQF 4HDVA 5IT9K 2FMLA 2QBYA 2MD0A 1FOWA 4XOPA 5D4RA 2PX9A 2DYSH 1MMDA 2DLLA 2FNAA 3MZHA 3QU6A 3KEQA 3N05A 1FOXA 4GXOA 1WHUA 1XDSA 3RZOJ 1ZRCA 4NQWB 5L3GA 3E3VA 4QIWN 3CC2I 1S7EA 2EH3A 5LGTA 1D8JA 5FJ8J 5JR3A 3G71I 2O5RA 4HEA2 2R5YB 3A01B 2E1NA 2CW8A 4Y4RA 4B3XA 3HIFA 1HA8A 4A3CJ 4A3BJ 2BVMA 2W25A 1KQ0A 1SAXA 1PDNC 2HGCA 4O3MA 2NS0A 2XF5A 5EF6A 3KYLA 1G4DA 2ZJPF 3CD6I 1LFBA 1ODDA 5J1RA 4PJNA 3SZPA 2IGMA 4MQVA 1P6RA 1P4AA 2EINH 2FOKA 4U7BA 5FLXZ 2DFFA 5C44J 3ZQFA 2VC1A 1ONVA 2JQ7A 3CCQI 1HC8A 3OYCA 2H6BA 4C3JJ 3OMYA 5JFRA 1U9NA 2WAQA 4G6DA 1JKPC 1AA7A 1OLTA 4U0VA 2LBFA 3HHGA 1PUFB 1A36A 1ACIA 2VJJA 4IQJA 2HFHA 2DT5A 2NAZA 2YU3A 3DU5A 2OTJI 3PUBA 4N4NB 3D1NI 5IYCJ 1STZA 1FY7A 2XAFA 4KUMA 5L3BA 1VQ7I 4FE7A 4BS9A 3BG5A 3IRRA 1K83J 2OV7A 3FDYA 2H1LA 2EFWA 3LA3A 2XRNA 4QPQA 4C2MJ 4ZYGA 4JQFA 1R4MB 1GT0C 3TO9A 1R23A 4LLGF 2V1DA 2CV1A 2E1CA 5E3NA 2KP6A 4RAFA 1A6IA 2JVHA 1YIOA 4UV9A 3Q0VA 2QKLB 1HLVA 3DWLE 2IS2A 2LY1A 4C3HJ 2LRDA 1LE8B 1W0TA 1IRFA 4AVZA 3S1NJ 1ETWA 3ABTA 1LDDA 1IF1A 1OFCX 4L9NA 3WU0A 4BUPA 4EM2A 1F1ZA 3KIOA 1B1BA 5EEHA 4RA2A 3BY6A 3L2CA 1YRNB 4D1QA 3K69A 3KETA 2OF7A 4ZYEA 2VN2A 4YIRX 3HOXJ 4IOAF 2L5QA 4BEHB 4MTEA 3BC8A 5IYDJ 1EF4A 4LK0F 2P7VB 2WB1N 4MTDA 5E17F 3HBLA 1XX5A 2WC2A 2FU4A 2MLGA 3GBGA 5FKKA 1OJLA 2HXIA 5LHHA 3ZPLA 2VE8A 4CHUA 3RKYA 2L9RA 5AONA 1ETVA 4A5MA 4XL9A 3A0BC 4PDKA 1K78B 4UV8A 1NK3P 1UAAA 3PNTA 3VODA 4I2OA 3PJRA 2DMNA 3ML6A 3UR3C 3OYEA 2LBFB 4X6AJ 1R49A 3R0JA 4L9TA 1BW5A 3E6MA 3TMOA 3MN2A 3TW7A 1D3YA 3WODF 4KMUX 4X1EA 1SFUA 4M6XA 4QSHA 1XC5A 4FQGA 1AWCA 1SFKA 1MMGA 4BXUA 1GVJA 5BQTA 1U9OA 2DT7B 1XN7A 2IBDA 5J4VA 3H9GA 3BTIA 1NK2P 4HNVA 1ETYA 5M3MJ 4UUVA 2D1HA 4Y52J 1WJEA 5K5OA 1IUYA 2CW0F 3CUQC 3DEWA 1ZH5A 2A6EF 1I6XA 3H5RA 5E1WA 3HSRA 3VEPA 1FOKA 5KCMA 2DA1A 3D0SA 5FKLA 1IDYA 1WSUA 4C3IJ 4XLPF 2M34A 3JRDA 2KIQA 3DTKA 2DA3A 2Z3YA 2PBIA 3KPHA 4HF2A 3QODA 5D5XB 1OKRA 2E2JJ 4D7MA 3HDDA 3OS2A 5K7ZA 4ITVA 1WRJA 3SZTA 4XQFA 5FO5A 2WY8Q 3OIQA 1TWAJ 1WQ2A 5FD6A 1T38A 4IHSA 3ZGKA 2CG4A 1FLIA 2BGCA 3VOEA 2NOJB 3JRCA 4G12A 2IPQX 5GPCA 1Y39A 3IRQA 3CMMA 2M87A 3HOTA 2HVSA 2HYJA 5E20A 3HXLA 3FXJA 2ZO4A 2HEOA 3H36A 2LKSA 1XCVA 1JKRC 1Y6IA 1EKEA 1GV5A 3HGGA 1MMNA 1RIOH 4WCGA 3A03A 2F5DA 3IKTA 2XGEA 3CJNA 1WFXA 4M9ZA 4LJZF 5EJCA 3T1BA 4U0WA 3OS1A 3RKWA 3V4GA 5EG0A 5FKMA 4OMYA 2JK3A 3BG9A 1P7IA 4W97A 3H1CA 3V7SA 3BG6A 4I98B 3BR2A 1K7AA 5IOYA 2JA5J 4BHBA 3GTKJ 3PO3J 2KZGA 4M71A 5E3LA 5D8KB 3H3VK 4UVCA 2XUBA 1YIJI 3H5AA 1ZTRA 1I3AA 2Q2EA 2CQXA 3AG3H 2Q2EB 1Z3YA 3R0AA 1TT5B 3H3UA 1RUOA 3HRSA 4EJTA 5BMZA 3V8LA 2MC3A 2ELKA 2JSPA 2DI3A 4XOTA 2OQRA 3F23A 3M8EA 4XORA 1ZGJA 4HF0A 4Y13A 3TQNA 2D1VA 3L2UA 1FBUA 2H6CA 1R5GA 2KHMA 2HVQA 2IA1A 2XSJC 3OL4A 2HQNA 2QSHX 4IJAA 2M4KA 4EGZA 1B8IA 2RVCA 2Y69H 2L7MP 1R5HA 2MBFA 2DYRH 1ZKGA 3A0HC 3QPLA 1KYWA 3DKYA 5HS9A 5F0HA 3OYAA 1VQKI 2IT0A 2F48A 3NWSA 3SZGA 1N25A 4S04A 3GTOJ 3CDLA 2Q0OA 1B8IB 2BYVE 1R4NB 3ECHA 1NHAA
chains in the Genus database with same CATH topology
1I27A 3EUHA 5HLGA 3ZMTA 1FWZA 2KIMA 3NEUA 3HRMA 4CXFA 1HKSA 1QZYA 2EV0A 4BHCA 1L3LA 4AIJA 5ILSA 5CJ9A 2M30A 3JSOA 2ESNA 1F9NA 2HDCA 3KLNA 5H20A 1KGSA 1YW7A 2H94A 1W7PB 5CVIA 3C7JA 4KICA 5HDKA 1IN8A 3GYHX 1UFMA 3DV8A 5HDGA 1MJAA 3ROUA 2GA2A 4GYIA 3P7NA 4IVNA 1IXRC 2QUFA 1BBYA 2FA5A 3M7GA 1I1SA 3MAJA 2K86A 2QWWA 3BOQA 2DBBA 2FF4A 2O8XA 5L3FA 3EDPA 2MD5A 3TO6A 2DW4A 1LNWA 1BIBA 5BPIA 3QPHA 4M74A 4LFUA 2QZ8A 1TBXA 1B9NA 2EV5A 1USSA 3KEOA 2MH9A 1QGPA 4HF1A 2WV0A 4LLNA 2F2EA 1TNTA 1P92A 4N0BA 1WKMA 4CYDA 3KZZA 3RI4A 1YS6A 3ZMUA 2CSOA 5ICFA 2A5YB 3F8BA 4NB5A 3CUOA 1JGSA 4ENJA 4PGGA 4PZJA 5E1ZB 5DCMB 2O6GE 2VXZA 1HW2A 2P4WA 2QYOA 2XAHA 1OYYA 3BROA 1O3RA 2Z99A 3SQNA 3IWZA 1LQ1A 2VBXA 3WTXC 4LG0B 2ZXJA 2VBWA 2CWEA 4XLNF 1S29A 3KP7A 4KDPA 2HOEA 5FFZA 3GVAA 3F8MA 3I0TA 5CVUA 1BN5A 2IJLA 3FXUA 1SMYF 2M8EA 1O7FA 4HAMA 1BOAA 5AIQA 2K02A 4M73A 1FT9A 4ASNA 1KU2A 1YQAA 4KA4A 4G7OF 3TDZC 1FNNA 3I54A 2Q8KA 2QVOA 1ZRDA 3KP3A 4A0YA 4Q48A 2PG4A 1IN6A 2PEXA 1W5SA 1U3EM 1YLFA 2FBIA 1KYZA 3ISPA 3RPQA 4LB5A 4P9FA 3GXOA 1BI1A 4L18B 3T0YA 1QQIA 4YIFA 1Z9CA 4B8XA 2ISYA 5LBQA 2IA0A 1IZ1A 2EA2A 2EFQA 5E8GA 2DK8A 4WF2A 4HV5A 1EV7A 1FYKA 5D8LB 4GGGA 1U5TA 1WI9A 4ESFA 1UHWA 1BI0A 4B09A 4I7HA 1Q1HA 3R61A 3WU1B 1YG2A 1T98A 1QNTA 2FSWA 1EH6A 1KQ9A 1XCBA 4BAYA 4G9YA 4LG0A 4LMYA 1S3JA 3SXYA 3E6BA 4H0EA 1KA8A 2HKOA 4BYYA 3N4MA 1K6OA 4Y17A 1MDMB 3F72A 3CO7C 2GAUA 3V7RA 1TTYA 4IF4A 2F5EA 1SMTA 1QZZA 1B6AA 1P2FA 1ZLJA 1HKQA 3K1MA 4G94A 4L5JA 2J5OA 2R3SA 2FQ3A 2A3SA 2XAQA 2P7CB 5HVQC 2LKPA 2QLZA 2QM3A 1XD7A 4LGWA 1J7KA 3R60A 4GYGA 4LD5A 4MEYF 2DK5A 5LEJA 6PAXA 1VTNC 3FWEA 3BWGA 2IP2A 5JHUA 1HSJA 1C0WA 2NNNA 1HW1A 2ZMEB 5LHIA 1R7JA 1XGOA 2ELHA 1JXSA 2K7LA 1G3WA 1IN5A 2COMA 2PMHA 3GO5A 3GFIA 5TJJA 2FBHA 1U2WA 2VE9A 2O3FA 3R4KA 2R7FA 2G9WA 5F6FA 3T8TA 2GXBA 3C18A 5K5QA 1UB9A 1OMIA 1HQCA 2ESHA 3IKVA 1USTA 1XSVA 1T2KA 4RGXA 1HBXG 5FLXK 1S8NA 1BI2A 4A6EA 2OQGA 2NNYA 2UZKA 1IXSB 3U9GA 1R58A 4OIRF 2VODA 4EM0B 4IXAA 3E6CC 3HSEA 1OR7A 5D5UB 4ENKA 1LDJA 3KP5A 3HTSB 4UHTA 1Z6RA 3C1DA 2DTRA 4EJUA 2STTA 5BOXA 1CF7A 2G7HA 2X4HA 3LQQA 3LA7A 5DD4A 4HW0A 4L0YB 2YPRA 2V1UA 5K1YA 1HSTA 3ECOA 3ULQB 2Z9OA 5FD5A 1IRGA 5HLIA 1PP7U 2V1XA 3ZQ7A 1D8KA 2GQQA 4IRHA 2JRTA 1SD5A 3GW2A 3BDDA 4Z2YA 2VOOA 3E5XA 4WX9A 3EYIA 1OPCA 4BQAA 4P96A 2WTEA 1QBJA 3G73A 1FBQA 2EK5A 1H9TA 4KIBA 3Q9SA 2P6TA 2OZ6A 2D45A 2DO7A 3ZMVA 5HS7A 1SFEA 4G6QA 1BC8C 3KLOA 4HQMA 2BV6A 3FF5A 4RAZA 2KJCA 1YS7A 4EMSA 2XKOA 1V3FA 2XKPA 1GHCA 1Y0UA 3FM5A 5DD8A 3BJAA 3F22A 1R00A 1J2XA 3V7CA 3FMQA 1L0OC 3L7WA 3DFGA 3TGNA 1TW2A 2YSRA 2L02A 3KP2A 1DUXC 2LF7A 5KVRA 2GIVA 3FX3A 1YW9A 5J8CA 4HX8A 3WTZA 2ZMEC 3OOPA 2UWMA 1QO0D 1BM9A 4LB6B 2FNPA 3K2ZA 4LK1F 4ETSA 2M5WA 1S6LA 3LWFA 2L3DA 3TO7A 2CYYA 4D0PA 1ZYRF 3B73A 3BPVA 5KK1A 3IWFA 3RKXA 1XMKA 1UCRA 4IRIA 2P5VA 5LRSA 5DCMA 1EH7A 2PFBA 2FBKA 2MA3A 3CTAA 3E97A 2K4BA 1P4XA 1KQ8A 1ZARA 1G3SA 1ON2A 2RKHA 2KIUA 4FX4A 4MQ9F 3SFZA 3RYPA 1REPC 1ZLKA 4MGRA 2P6SA 1FP2A 2RN7A 3REOA 2EFOA 3J81Z 3HOSA 2ZCWA 3JW4A 4RGSA 1R36A 3WTSC 2QQBA 2ZKZA 3RIRA 4GCVA 3ABUA 4XBFA 2JPCA 1O3TA 1B59A 3MCZA 2UXXA 2UXNA 3KE2A 1MDMA 1TW3A 2A07F 2FEZA 3W6JB 3I59B 4R79A 4WXCA 3K1PA 5JI6A 4N9HA 5ICCA 2Y48A 1YW8A 1OYIA 1W7PA 4BH9A 3COAC 2PI0A 5FGMA 1J5YA 3IC7A 2H09A 2STWA 3V8JA 5CYVA 2P5LC 4L9VA 4I0AA 4YFKF 3GFJA 2HQRA 1Z1DA 3K9TA 2YR2A 4HYEA 2XIGA 1ZG5A 2ZJ2A 3QPTA 3CDHA 2P8TA 2PMUA 4CO8A 2F5CA 3T8RA 2L54A 1FBSA 1FX7A 2OBPA 3LAJA 2DAOA 2OAZA 4AWXB 1DPUA 1P4WA 2XROA 5LHGA 5DEQA 4ZZDA 4OIOF 5ICEA 1V4RA 5DUIA 3LAPA 4ON0A 2RGVA 3DXJF 2D2WA 3O2PE 2GZWA 1MD0A 3BJ6A 2A69F 4UXNA 3FMRA 1HW5A 2V79A 4K2EA 4R8HA 2VT3A 4ZYDA 5ILUA 4RB3C 5LLQA 1SD6A 3I5UA 4HX4A 4I02A 4A5NA 1I5ZA 3TKYA 2XV4S 2GXGA 4ZYHA 1IN4A 4A6DA 2NRAC 1H0MA 3EQLF 3C3WA 2ISZA 2XVCA 3WTVC 3E5UA 1G6NA 1U5TC 1K78A 1X3UA 5DCFA 2EB7A 3O6BB 1YFHA 2B0LA 2DFIA 2XHKA 1W5TA 3QRFF 1U78A 2L4AA 3B02A 1O57A 1S7OA 2HS5A 3ELKA 2DU9A 3GFLA 4NQWA 2W57A 2M45A 1ON1A 2V9VA 1LB2A 4WXHA 3WGHA 1Z05A 2HYFA 3F3XA 4Q4ZF 2W85A 3MFKA 5DYMA 4CZZA 3KFWX 4G7ZF 1F4KA 1CF7B 2VOPA 3AAFA 4ENNA 4OOIA 3J7AO 3JAMZ 4A2UA 1W4MA 5ICGA 4L0ZB 3GZ5A 1J59A 2LDUA 4WWCA 4KIFA 1ZN2A 2VBYA 1CGPA 4UVAA 3I71A 4EQQA 3ERED 1JHHA 2A68F 3M1EA 2G7UA 2XAJA 3D5LA 2BEOA 3DP7A 3J80Z 1K79A 1ZAOA 4Q5SF 1MZBA 1MGTA 4PCQA 4CDGA 4L9JA 1QPMA 2C6YA 2BE5F 4UVBA 1WWXA 3HTUA 5FFXA 4AIKA 3IL2A 4IHTA 5AIPA 2ZMEA 3GZ6A 2YX7A 1LDKB 3F8CA 2KKOA 3ZMSA 1DDNA 2KIFA 1SFXA 1MKMA 2O03A 3CUQB 4QLCU 3P9KA 4RB0A 3RTRA 3ZMDA 2XAGA 3I53A 1A04A 2OU2A 4TV7A 3MWMA 2AXLA 1R1UA 4I0BA 4OU0A 4U0YA 4ENMA 4CGZA 4JBAA 1PUEE 4A0ZA 4ZZLA 2K4JA 3E6DA 4IRGA 2CFXA 3S2WA 2ETHA 3P9IA 1IXCA 4PGHA 2M1BA 3RPUA 1U5TB 4S05A 4RS8A 3F6VA 1T6SA 2Y75A 4N9IA 4MHGA 1U6GA 3FXRA 2XGXA 1DP7P 5F64A 1XMAA 4EGYA 1O3QA 2PLYA 2VBZA 1XGMA 4EJVA 2CGPA 3HHHA 1OYWA 2KJBA 4KMFA 1LJ9A 4I01A 4KNYA 1XSXA 5D4SA 3WTTC 3H3ZA 5E1XA 2DQLA 1TQPA 3J81K 4HV6A 3E5QA 5BPDA 4AIHA 5DUKA 2VT2A 1SD4A 4KN4X 4QWQA 2GWRA 1TLHB 2W84A 4YIIA 2FE3A 5D6FA 1TQMA 1LEBA 1B4AA 2A6HF 1IW7F 2L01A 3L00A 3DPLC 2IW5A 1FZPB 4FHTA 2P5KA 3ZN1A 4YFXF 3SHFA 1O7LA 3K0LA 3WE3A 1MJ9A 5HDNA 1GXPA 2EA4A 3DF8A 5LEKA 1ZHFA 3FZVA 3L9FA 1BC7C 4KFCA 1KU7A 2E7WA 3EYYA 2FRHA 5HOOA 3PQJA 2BBYA 3T5XA 4RGRA 3KP4A 1IAWA 2LF8A 4AVPA 1J75A 5TRDA 4Y15A 1HXDA 3GF2A 3GFMA 4P55A 1FPQA 4A0XA 3K1NA 2HTSA 3HUGA 4M6YA 3CO6C 4OMZA 2ZFWA 2XASA 2HR3A 1KU3A 2OD5A 3DQVC 5K5RA 2LSOA 5F1RA 2OZUA 3TOAA 4HOBA 3HYIA 3J80K 5LRRA 4P9UA 3LQRA 5EEGA 4OINF 1J9IA 1J0RA 4MNUA 3LSTA 2VC0A 4LLLA 2F5FA 2VONA 2EWNA 3Q5FA 1XDUA 4RB2C 4YG2F 4NHJA 4HA8A 1JHFA 2RV8A 3V8KA 4O5VA 3FXQA 3NRVA 3FMSA 3LFKA 1FSHA 3JSPA 5E8IA 3DKWA 2HYGD 4M9SA 3BPXA 5IT3A 4XSZF 4XSXF 3F21A 4HLYA 2V6CA 3KCCA 2Y0MA 4JK1X 1R1VA 2HTJA 5CVRA 2LNBA 1KU9A 3W6KB 2QBYB 5D5VB 1LEAA 1XSDA 3MZYA 3QP5A 2H27A 4EJOA 3G3ZA 5LGUA 3WGGA 2RDPA 4G8XA 3PFIA 5L3EA 3I4PA 1DPRA 3PQKA 2JPBA 3KZYA 5ERIA 2TDXA 5D5WB 1HKTA 1YO5C 5E18F 3LA2A 4R1HA 5HS8A 1E2XA 1TQIA 3ZP5A 1U8RA 1FYLA 4IPAA 4CICA 1Z7UA 1G3YA 2JSCA 5L3DA 1MJBA 2EFPA 5L3CA 1ZRFA 4BNCA 4ESJA 2JTVA 4HLXA 4U88A 1RI7A 5A2QK 3RYRA 4AD9A 4EM1A 3JAMK 1Z91A 2DQRA 3F6OA 3JTGA 3FHZA 2JT1A 2HKXA 3HRTA 3CLOA 2GA1A 3TOBA 1GXQA 4M9XA 2OA4A 2EJRA 5H6QA 4GO1A 3MQ0A 1FC3A 1T39A 3BZ6A 3F8NA 1H9GA 2PQ8A 3M8FA 2IVMA 3DEUA 3QU3A 1TNSA 2L4MA 4Q47A 3DPTA 2DPDA 4O6JA 3O3KA 2R7DA 2IRFG 4YFNF 4EVIA 2J5PA 1ZREA 5CLSA 5DV5A 2ZBKA 3KP6A 2FXAA 2NYXA 5IT9Z 3I58A 3F8FA 2EFNA 1ZG3A 2PN6A 2AS5F 3VB2A 1S7AA 3WE2A 1E17A 4L5IA 1YYVA 1FSEA 3WG9A 5JVTA 1ZG1A 3GUDA 1ULYA 3I64A 4HX7A 4HBLA 1RNLA 5ILVA 1UHMA 1B9MA 5CVJA 3WTWC 5D6EA 4F7ZA 2HWVA 4G7HF 1RUNA 3GWZA 2CQKA 3H92A 5HLHA 2K27A 1O3SA 2W24A 3L09A 4FX0A 3MEXA 3GX4X 3U2RA 1EH8A 1XB4A 5ED4A 2QQAA 2YX4A 1SD7A 3BJOA 1T0FA 3R6SA 1R22A 4MEXF 2QENA 2HZTA 3BP8A 4KIGA 2A61A 1IN7A 4RB1A 3QAHA 4KN7X 3TDUC 3QP6A 2ZNYA 1F5TA 4DNCA 3QOPA 2RC4A 2JZYA 3RJPA 4UNOA 3ZN0A 3Q9VA 3NQOA 2EV6A 2O0YA 5DDGA 2CO5A 4ZH4F 4M72A 4ESBA 1FYMA 3JTHA 3VFZA 2WWYA 3HSFA 1JE8A 4U7DA 5J6XA 3WGIA 3EETA 4KYWA 2DPUA 3HRUA 2Z33A 4WK8F 3FM3A 4FT8A 5CVVA 4HQEA 3M9AA 5J8FA 1PP8F 3WTUC 5LGNA 3U1DA 3RDIA 1G3TA 3WTYC 3IHUA 2Z5UA 4HZFA 4BHPA 3GEZA 4P5OA 3OV8A 4I09A 1RZ4A 2E7XA 4RAYA 1I1GA 1W7PD 4A12A 2KRFA 2RQPA 1Z6TA 1XGSA 4EV0A 3ZMZA 4XRFA 1FP1D 1AOYA 2RNJA 2ZNZA 1BIAA 2X0LA 2MH2A 1ZGAA 3GLXA 2IA2A 3P9CA 1D5VA 1BJAA 2ACJA 5A2QZ 1LVAA 4RGUA 4WXDA 2MLKA 2ADUA 5BS6A 4EJWA 5FB2A 1BI3A 4DQ2A 1XGNA 1YTYA 4OIPF 4E70A 5H6RA 3N97A 3I59A 4HDUA 2PJPA 2FMYA 3CUQA 4KT5C 1R1TA 2QQ9A 2O61A 4OIQF 4HDVA 5IT9K 2FMLA 2QBYA 5D4RA 2DLLA 2FNAA 3MZHA 3QU6A 3KEQA 4GXOA 1XDSA 1ZRCA 5L3GA 3E3VA 5LGTA 1D8JA 5JR3A 2E1NA 3HIFA 2W25A 1KQ0A 1SAXA 1PDNC 2HGCA 4O3MA 2NS0A 1G4DA 1ODDA 3SZPA 4MQVA 1P6RA 1P4AA 2FOKA 4U7BA 5FLXZ 2VC1A 1ONVA 2H6BA 5JFRA 4G6DA 4U0VA 3HHGA 2HFHA 2DT5A 2NAZA 2YU3A 1STZA 1FY7A 2XAFA 4KUMA 5L3BA 3IRRA 2EFWA 3LA3A 2XRNA 4ZYGA 4JQFA 3TO9A 1R23A 4LLGF 2V1DA 2E1CA 1YIOA 4UV9A 1IRFA 3ABTA 1LDDA 1IF1A 4L9NA 3WU0A 4EM2A 1F1ZA 1B1BA 5EEHA 3BY6A 3L2CA 3K69A 3KETA 4ZYEA 2VN2A 4MTEA 4LK0F 2P7VB 4MTDA 5E17F 2WC2A 2FU4A 2MLGA 5LHHA 3ZPLA 4CHUA 2VE8A 3RKYA 5AONA 4A5MA 4PDKA 1K78B 4UV8A 3VODA 4I2OA 3ML6A 3R0JA 4L9TA 3E6MA 1D3YA 3WODF 4KMUX 1SFUA 4M6XA 1AWCA 4BXUA 1GVJA 5BQTA 1XN7A 4UUVA 2D1HA 5K5OA 1IUYA 2CW0F 3CUQC 1ZH5A 2A6EF 1I6XA 5E1WA 3HSRA 3VEPA 1FOKA 3D0SA 1WSUA 4XLPF 2Z3YA 2PBIA 4HF2A 5D5XB 1OKRA 1WRJA 3SZTA 5FO5A 1T38A 1WQ2A 5FD6A 4IHSA 2CG4A 1FLIA 2BGCA 3VOEA 2IPQX 3IRQA 2M87A 3HOTA 5E20A 2ZO4A 2HEOA 1XCVA 1RIOH 4WCGA 2F5DA 3IKTA 3CJNA 4M9ZA 4LJZF 3T1BA 4U0WA 3RKWA 3V4GA 4OMYA 3V7SA 4I98B 1K7AA 4BHBA 4M71A 5D8KB 4UVCA 2XUBA 2Q2EA 3R0AA 3H3UA 1RUOA 3HRSA 4EJTA 5BMZA 3V8LA 2MC3A 2DI3A 2OQRA 3F23A 3M8EA 1ZGJA 4HF0A 4Y13A 3TQNA 2D1VA 1FBUA 2H6CA 1R5GA 2IA1A 2HQNA 4IJAA 4EGZA 2RVCA 1R5HA 2MBFA 1KYWA 5HS9A 2IT0A 4S04A 2Q0OA 2BYVE 3ECHA 1NHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I27 A;  3EUH A;  5HLG A;  3ZMT A;  1FWZ A;  2KIM A;  3NEU A;  3HRM A;  4CXF A;  1HKS A;  1QZY A;  2EV0 A;  4BHC A;  1L3L A;  4AIJ A;  5ILS A;  5CJ9 A;  2M30 A;  3JSO A;  2ESN A;  1F9N A;  2HDC A;  3KLN A;  5H20 A;  1KGS A;  1YW7 A;  2H94 A;  1W7P B;  5CVI A;  3C7J A;  4KIC A;  5HDK A;  1IN8 A;  3GYH X;  1UFM A;  3DV8 A;  5HDG A;  1MJA A;  3ROU A;  2GA2 A;  4GYI A;  3P7N A;  4IVN A;  1IXR C;  2QUF A;  1BBY A;  2FA5 A;  3M7G A;  1I1S A;  3MAJ A;  2K86 A;  2QWW A;  3BOQ A;  2DBB A;  2FF4 A;  2O8X A;  5L3F A;  3EDP A;  2MD5 A;  3TO6 A;  2DW4 A;  1LNW A;  1BIB A;  5BPI A;  3QPH A;  4M74 A;  4LFU A;  2QZ8 A;  1TBX A;  1B9N A;  2EV5 A;  1USS A;  3KEO A;  2MH9 A;  1QGP A;  4HF1 A;  2WV0 A;  4LLN A;  2F2E A;  1TNT A;  1P92 A;  4N0B A;  1WKM A;  4CYD A;  3KZZ A;  3RI4 A;  1YS6 A;  3ZMU A;  2CSO A;  5ICF A;  2A5Y B;  3F8B A;  4NB5 A;  3CUO A;  1JGS A;  4ENJ A;  4PGG A;  4PZJ A;  5E1Z B;  5DCM B;  2O6G E;  2VXZ A;  1HW2 A;  2P4W A;  2QYO A;  2XAH A;  1OYY A;  3BRO A;  1O3R A;  2Z99 A;  3SQN A;  3IWZ A;  1LQ1 A;  2VBX A;  3WTX C;  4LG0 B;  2ZXJ A;  2VBW A;  2CWE A;  4XLN F;  1S29 A;  3KP7 A;  4KDP A;  2HOE A;  5FFZ A;  3GVA A;  3F8M A;  3I0T A;  5CVU A;  1BN5 A;  2IJL A;  3FXU A;  1SMY F;  2M8E A;  1O7F A;  4HAM A;  1BOA A;  5AIQ A;  2K02 A;  4M73 A;  1FT9 A;  4ASN A;  1KU2 A;  1YQA A;  4KA4 A;  4G7O F;  3TDZ C;  1FNN A;  3I54 A;  2Q8K A;  2QVO A;  1ZRD A;  3KP3 A;  4A0Y A;  4Q48 A;  2PG4 A;  1IN6 A;  2PEX A;  1W5S A;  1U3E M;  1YLF A;  2FBI A;  1KYZ A;  3ISP A;  3RPQ A;  4LB5 A;  4P9F A;  3GXO A;  1BI1 A;  4L18 B;  3T0Y A;  1QQI A;  4YIF A;  1Z9C A;  4B8X A;  2ISY A;  5LBQ A;  2IA0 A;  1IZ1 A;  2EA2 A;  2EFQ A;  5E8G A;  2DK8 A;  4WF2 A;  4HV5 A;  1EV7 A;  1FYK A;  5D8L B;  4GGG A;  1U5T A;  1WI9 A;  4ESF A;  1UHW A;  1BI0 A;  4B09 A;  4I7H A;  1Q1H A;  3R61 A;  3WU1 B;  1YG2 A;  1T98 A;  1QNT A;  2FSW A;  1EH6 A;  1KQ9 A;  1XCB A;  4BAY A;  4G9Y A;  4LG0 A;  4LMY A;  1S3J A;  3SXY A;  3E6B A;  4H0E A;  1KA8 A;  2HKO A;  4BYY A;  3N4M A;  1K6O A;  4Y17 A;  1MDM B;  3F72 A;  3CO7 C;  2GAU A;  3V7R A;  1TTY A;  4IF4 A;  2F5E A;  1SMT A;  1QZZ A;  1B6A A;  1P2F A;  1ZLJ A;  1HKQ A;  3K1M A;  4G94 A;  4L5J A;  2J5O A;  2R3S A;  2FQ3 A;  2A3S A;  2XAQ A;  2P7C B;  5HVQ C;  2LKP A;  2QLZ A;  2QM3 A;  1XD7 A;  4LGW A;  1J7K A;  3R60 A;  4GYG A;  4LD5 A;  4MEY F;  2DK5 A;  5LEJ A;  6PAX A;  1VTN C;  3FWE A;  3BWG A;  2IP2 A;  5JHU A;  1HSJ A;  1C0W A;  2NNN A;  1HW1 A;  2ZME B;  5LHI A;  1R7J A;  1XGO A;  2ELH A;  1JXS A;  2K7L A;  1G3W A;  1IN5 A;  2COM A;  2PMH A;  3GO5 A;  3GFI A;  5TJJ A;  2FBH A;  1U2W A;  2VE9 A;  2O3F A;  3R4K A;  2R7F A;  2G9W A;  5F6F A;  3T8T A;  2GXB A;  3C18 A;  5K5Q A;  1UB9 A;  1OMI A;  1HQC A;  2ESH A;  3IKV A;  1UST A;  1XSV A;  1T2K A;  4RGX A;  1HBX G;  5FLX K;  1S8N A;  1BI2 A;  4A6E A;  2OQG A;  2NNY A;  2UZK A;  1IXS B;  3U9G A;  1R58 A;  4OIR F;  2VOD A;  4EM0 B;  4IXA A;  3E6C C;  3HSE A;  1OR7 A;  5D5U B;  4ENK A;  1LDJ A;  3KP5 A;  3HTS B;  4UHT A;  1Z6R A;  3C1D A;  2DTR A;  4EJU A;  2STT A;  5BOX A;  1CF7 A;  2G7H A;  2X4H A;  3LQQ A;  3LA7 A;  5DD4 A;  4HW0 A;  4L0Y B;  2YPR A;  2V1U A;  5K1Y A;  1HST A;  3ECO A;  3ULQ B;  2Z9O A;  5FD5 A;  1IRG A;  5HLI A;  1PP7 U;  2V1X A;  3ZQ7 A;  1D8K A;  2GQQ A;  4IRH A;  2JRT A;  1SD5 A;  3GW2 A;  3BDD A;  4Z2Y A;  2VOO A;  3E5X A;  4WX9 A;  3EYI A;  1OPC A;  4BQA A;  4P96 A;  2WTE A;  1QBJ A;  3G73 A;  1FBQ A;  2EK5 A;  1H9T A;  4KIB A;  3Q9S A;  2P6T A;  2OZ6 A;  2D45 A;  2DO7 A;  3ZMV A;  5HS7 A;  1SFE A;  4G6Q A;  1BC8 C;  3KLO A;  4HQM A;  2BV6 A;  3FF5 A;  4RAZ A;  2KJC A;  1YS7 A;  4EMS A;  2XKO A;  1V3F A;  2XKP A;  1GHC A;  1Y0U A;  3FM5 A;  5DD8 A;  3BJA A;  3F22 A;  1R00 A;  1J2X A;  3V7C A;  3FMQ A;  1L0O C;  3L7W A;  3DFG A;  3TGN A;  1TW2 A;  2YSR A;  2L02 A;  3KP2 A;  1DUX C;  2LF7 A;  5KVR A;  2GIV A;  3FX3 A;  1YW9 A;  5J8C A;  4HX8 A;  3WTZ A;  2ZME C;  3OOP A;  2UWM A;  1QO0 D;  1BM9 A;  4LB6 B;  2FNP A;  3K2Z A;  4LK1 F;  4ETS A;  2M5W A;  1S6L A;  3LWF A;  2L3D A;  3TO7 A;  2CYY A;  4D0P A;  1ZYR F;  3B73 A;  3BPV A;  5KK1 A;  3IWF A;  3RKX A;  1XMK A;  1UCR A;  4IRI A;  2P5V A;  5LRS A;  5DCM A;  1EH7 A;  2PFB A;  2FBK A;  2MA3 A;  3CTA A;  3E97 A;  2K4B A;  1P4X A;  1KQ8 A;  1ZAR A;  1G3S A;  1ON2 A;  2RKH A;  2KIU A;  4FX4 A;  4MQ9 F;  3SFZ A;  3RYP A;  1REP C;  1ZLK A;  4MGR A;  2P6S A;  1FP2 A;  2RN7 A;  3REO A;  2EFO A;  3J81 Z;  3HOS A;  2ZCW A;  3JW4 A;  4RGS A;  1R36 A;  3WTS C;  2QQB A;  2ZKZ A;  3RIR A;  4GCV A;  3ABU A;  4XBF A;  2JPC A;  1O3T A;  1B59 A;  3MCZ A;  2UXX A;  2UXN A;  3KE2 A;  1MDM A;  1TW3 A;  2A07 F;  2FEZ A;  3W6J B;  3I59 B;  4R79 A;  4WXC A;  3K1P A;  5JI6 A;  4N9H A;  5ICC A;  2Y48 A;  1YW8 A;  1OYI A;  1W7P A;  4BH9 A;  3COA C;  2PI0 A;  5FGM A;  1J5Y A;  3IC7 A;  2H09 A;  2STW A;  3V8J A;  5CYV A;  2P5L C;  4L9V A;  4I0A A;  4YFK F;  3GFJ A;  2HQR A;  1Z1D A;  3K9T A;  2YR2 A;  4HYE A;  2XIG A;  1ZG5 A;  2ZJ2 A;  3QPT A;  3CDH A;  2P8T A;  2PMU A;  4CO8 A;  2F5C A;  3T8R A;  2L54 A;  1FBS A;  1FX7 A;  2OBP A;  3LAJ A;  2DAO A;  2OAZ A;  4AWX B;  1DPU A;  1P4W A;  2XRO A;  5LHG A;  5DEQ A;  4ZZD A;  4OIO F;  5ICE A;  1V4R A;  5DUI A;  3LAP A;  4ON0 A;  2RGV A;  3DXJ F;  2D2W A;  3O2P E;  2GZW A;  1MD0 A;  3BJ6 A;  2A69 F;  4UXN A;  3FMR A;  1HW5 A;  2V79 A;  4K2E A;  4R8H A;  2VT3 A;  4ZYD A;  5ILU A;  4RB3 C;  5LLQ A;  1SD6 A;  3I5U A;  4HX4 A;  4I02 A;  4A5N A;  1I5Z A;  3TKY A;  2XV4 S;  2GXG A;  4ZYH A;  1IN4 A;  4A6D A;  2NRA C;  1H0M A;  3EQL F;  3C3W A;  2ISZ A;  2XVC A;  3WTV C;  3E5U A;  1G6N A;  1U5T C;  1K78 A;  1X3U A;  5DCF A;  2EB7 A;  3O6B B;  1YFH A;  2B0L A;  2DFI A;  2XHK A;  1W5T A;  3QRF F;  1U78 A;  2L4A A;  3B02 A;  1O57 A;  1S7O A;  2HS5 A;  3ELK A;  2DU9 A;  3GFL A;  4NQW A;  2W57 A;  2M45 A;  1ON1 A;  2V9V A;  1LB2 A;  4WXH A;  3WGH A;  1Z05 A;  2HYF A;  3F3X A;  4Q4Z F;  2W85 A;  3MFK A;  5DYM A;  4CZZ A;  3KFW X;  4G7Z F;  1F4K A;  1CF7 B;  2VOP A;  3AAF A;  4ENN A;  4OOI A;  3J7A O;  3JAM Z;  4A2U A;  1W4M A;  5ICG A;  4L0Z B;  3GZ5 A;  1J59 A;  2LDU A;  4WWC A;  4KIF A;  1ZN2 A;  2VBY A;  1CGP A;  4UVA A;  3I71 A;  4EQQ A;  3ERE D;  1JHH A;  2A68 F;  3M1E A;  2G7U A;  2XAJ A;  3D5L A;  2BEO A;  3DP7 A;  3J80 Z;  1K79 A;  1ZAO A;  4Q5S F;  1MZB A;  1MGT A;  4PCQ A;  4CDG A;  4L9J A;  1QPM A;  2C6Y A;  2BE5 F;  4UVB A;  1WWX A;  3HTU A;  5FFX A;  4AIK A;  3IL2 A;  4IHT A;  5AIP A;  2ZME A;  3GZ6 A;  2YX7 A;  1LDK B;  3F8C A;  2KKO A;  3ZMS A;  1DDN A;  2KIF A;  1SFX A;  1MKM A;  2O03 A;  3CUQ B;  4QLC U;  3P9K A;  4RB0 A;  3RTR A;  3ZMD A;  2XAG A;  3I53 A;  1A04 A;  2OU2 A;  4TV7 A;  3MWM A;  2AXL A;  1R1U A;  4I0B A;  4OU0 A;  4U0Y A;  4ENM A;  4CGZ A;  4JBA A;  1PUE E;  4A0Z A;  4ZZL A;  2K4J A;  3E6D A;  4IRG A;  2CFX A;  3S2W A;  2ETH A;  3P9I A;  1IXC A;  4PGH A;  2M1B A;  3RPU A;  1U5T B;  4S05 A;  4RS8 A;  3F6V A;  1T6S A;  2Y75 A;  4N9I A;  4MHG A;  1U6G A;  3FXR A;  2XGX A;  1DP7 P;  5F64 A;  1XMA A;  4EGY A;  1O3Q A;  2PLY A;  2VBZ A;  1XGM A;  4EJV A;  2CGP A;  3HHH A;  1OYW A;  2KJB A;  4KMF A;  1LJ9 A;  4I01 A;  4KNY A;  1XSX A;  5D4S A;  3WTT C;  3H3Z A;  5E1X A;  2DQL A;  1TQP A;  3J81 K;  4HV6 A;  3E5Q A;  5BPD A;  4AIH A;  5DUK A;  2VT2 A;  1SD4 A;  4KN4 X;  4QWQ A;  2GWR A;  1TLH B;  2W84 A;  4YII A;  2FE3 A;  5D6F A;  1TQM A;  1LEB A;  1B4A A;  2A6H F;  1IW7 F;  2L01 A;  3L00 A;  3DPL C;  2IW5 A;  1FZP B;  4FHT A;  2P5K A;  3ZN1 A;  4YFX F;  3SHF A;  1O7L A;  3K0L A;  3WE3 A;  1MJ9 A;  5HDN A;  1GXP A;  2EA4 A;  3DF8 A;  5LEK A;  1ZHF A;  3FZV A;  3L9F A;  1BC7 C;  4KFC A;  1KU7 A;  2E7W A;  3EYY A;  2FRH A;  5HOO A;  3PQJ A;  2BBY A;  3T5X A;  4RGR A;  3KP4 A;  1IAW A;  2LF8 A;  4AVP A;  1J75 A;  5TRD A;  4Y15 A;  1HXD A;  3GF2 A;  3GFM A;  4P55 A;  1FPQ A;  4A0X A;  3K1N A;  2HTS A;  3HUG A;  4M6Y A;  3CO6 C;  4OMZ A;  2ZFW A;  2XAS A;  2HR3 A;  1KU3 A;  2OD5 A;  3DQV C;  5K5R A;  2LSO A;  5F1R A;  2OZU A;  3TOA A;  4HOB A;  3HYI A;  3J80 K;  5LRR A;  4P9U A;  3LQR A;  5EEG A;  4OIN F;  1J9I A;  1J0R A;  4MNU A;  3LST A;  2VC0 A;  4LLL A;  2F5F A;  2VON A;  2EWN A;  3Q5F A;  1XDU A;  4RB2 C;  4YG2 F;  4NHJ A;  4HA8 A;  1JHF A;  2RV8 A;  3V8K A;  4O5V A;  3FXQ A;  3NRV A;  3FMS A;  3LFK A;  1FSH A;  3JSP A;  5E8I A;  3DKW A;  2HYG D;  4M9S A;  3BPX A;  5IT3 A;  4XSZ F;  4XSX F;  3F21 A;  4HLY A;  2V6C A;  3KCC A;  2Y0M A;  4JK1 X;  1R1V A;  2HTJ A;  5CVR A;  2LNB A;  1KU9 A;  3W6K B;  2QBY B;  5D5V B;  1LEA A;  1XSD A;  3MZY A;  3QP5 A;  2H27 A;  4EJO A;  3G3Z A;  5LGU A;  3WGG A;  2RDP A;  4G8X A;  3PFI A;  5L3E A;  3I4P A;  1DPR A;  3PQK A;  2JPB A;  3KZY A;  5ERI A;  2TDX A;  5D5W B;  1HKT A;  1YO5 C;  5E18 F;  3LA2 A;  4R1H A;  5HS8 A;  1E2X A;  1TQI A;  3ZP5 A;  1U8R A;  1FYL A;  4IPA A;  4CIC A;  1Z7U A;  1G3Y A;  2JSC A;  5L3D A;  1MJB A;  2EFP A;  5L3C A;  1ZRF A;  4BNC A;  4ESJ A;  2JTV A;  4HLX A;  4U88 A;  1RI7 A;  5A2Q K;  3RYR A;  4AD9 A;  4EM1 A;  3JAM K;  1Z91 A;  2DQR A;  3F6O A;  3JTG A;  3FHZ A;  2JT1 A;  2HKX A;  3HRT A;  3CLO A;  2GA1 A;  3TOB A;  1GXQ A;  4M9X A;  2OA4 A;  2EJR A;  5H6Q A;  4GO1 A;  3MQ0 A;  1FC3 A;  1T39 A;  3BZ6 A;  3F8N A;  1H9G A;  2PQ8 A;  3M8F A;  2IVM A;  3DEU A;  3QU3 A;  1TNS A;  2L4M A;  4Q47 A;  3DPT A;  2DPD A;  4O6J A;  3O3K A;  2R7D A;  2IRF G;  4YFN F;  4EVI A;  2J5P A;  1ZRE A;  5CLS A;  5DV5 A;  2ZBK A;  3KP6 A;  2FXA A;  2NYX A;  5IT9 Z;  3I58 A;  3F8F A;  2EFN A;  1ZG3 A;  2PN6 A;  2AS5 F;  3VB2 A;  1S7A A;  3WE2 A;  1E17 A;  4L5I A;  1YYV A;  1FSE A;  3WG9 A;  5JVT A;  1ZG1 A;  3GUD A;  1ULY A;  3I64 A;  4HX7 A;  4HBL A;  1RNL A;  5ILV A;  1UHM A;  1B9M A;  5CVJ A;  3WTW C;  5D6E A;  4F7Z A;  2HWV A;  4G7H F;  1RUN A;  3GWZ A;  2CQK A;  3H92 A;  5HLH A;  2K27 A;  1O3S A;  2W24 A;  3L09 A;  4FX0 A;  3MEX A;  3GX4 X;  3U2R A;  1EH8 A;  1XB4 A;  5ED4 A;  2QQA A;  2YX4 A;  1SD7 A;  3BJO A;  1T0F A;  3R6S A;  1R22 A;  4MEX F;  2QEN A;  2HZT A;  3BP8 A;  4KIG A;  2A61 A;  1IN7 A;  4RB1 A;  3QAH A;  4KN7 X;  3TDU C;  3QP6 A;  2ZNY A;  1F5T A;  4DNC A;  3QOP A;  2RC4 A;  2JZY A;  3RJP A;  4UNO A;  3ZN0 A;  3Q9V A;  3NQO A;  2EV6 A;  2O0Y A;  5DDG A;  2CO5 A;  4ZH4 F;  4M72 A;  4ESB A;  1FYM A;  3JTH A;  3VFZ A;  2WWY A;  3HSF A;  1JE8 A;  4U7D A;  5J6X A;  3WGI A;  3EET A;  4KYW A;  2DPU A;  3HRU A;  2Z33 A;  4WK8 F;  3FM3 A;  4FT8 A;  5CVV A;  4HQE A;  3M9A A;  5J8F A;  1PP8 F;  3WTU C;  5LGN A;  3U1D A;  3RDI A;  1G3T A;  3WTY C;  3IHU A;  2Z5U A;  4HZF A;  4BHP A;  3GEZ A;  4P5O A;  3OV8 A;  4I09 A;  1RZ4 A;  2E7X A;  4RAY A;  1I1G A;  1W7P D;  4A12 A;  2KRF A;  2RQP A;  1Z6T A;  1XGS A;  4EV0 A;  3ZMZ A;  4XRF A;  1FP1 D;  1AOY A;  2RNJ A;  2ZNZ A;  1BIA A;  2X0L A;  2MH2 A;  1ZGA A;  3GLX A;  2IA2 A;  3P9C A;  1D5V A;  1BJA A;  2ACJ A;  5A2Q Z;  1LVA A;  4RGU A;  4WXD A;  2MLK A;  2ADU A;  5BS6 A;  4EJW A;  5FB2 A;  1BI3 A;  4DQ2 A;  1XGN A;  1YTY A;  4OIP F;  4E70 A;  5H6R A;  3N97 A;  3I59 A;  4HDU A;  2PJP A;  2FMY A;  3CUQ A;  4KT5 C;  1R1T A;  2QQ9 A;  2O61 A;  4OIQ F;  4HDV A;  5IT9 K;  2FML A;  2QBY A;  5D4R A;  2DLL A;  2FNA A;  3MZH A;  3QU6 A;  3KEQ A;  4GXO A;  1XDS A;  1ZRC A;  5L3G A;  3E3V A;  5LGT A;  1D8J A;  5JR3 A;  2E1N A;  3HIF A;  2W25 A;  1KQ0 A;  1SAX A;  1PDN C;  2HGC A;  4O3M A;  2NS0 A;  1G4D A;  1ODD A;  3SZP A;  4MQV A;  1P6R A;  1P4A A;  2FOK A;  4U7B A;  5FLX Z;  2VC1 A;  1ONV A;  2H6B A;  5JFR A;  4G6D A;  4U0V A;  3HHG A;  2HFH A;  2DT5 A;  2NAZ A;  2YU3 A;  1STZ A;  1FY7 A;  2XAF A;  4KUM A;  5L3B A;  3IRR A;  2EFW A;  3LA3 A;  2XRN A;  4ZYG A;  4JQF A;  3TO9 A;  1R23 A;  4LLG F;  2V1D A;  2E1C A;  1YIO A;  4UV9 A;  1IRF A;  3ABT A;  1LDD A;  1IF1 A;  4L9N A;  3WU0 A;  4EM2 A;  1F1Z A;  1B1B A;  5EEH A;  3BY6 A;  3L2C A;  3K69 A;  3KET A;  4ZYE A;  2VN2 A;  4MTE A;  4LK0 F;  2P7V B;  4MTD A;  5E17 F;  2WC2 A;  2FU4 A;  2MLG A;  5LHH A;  3ZPL A;  4CHU A;  2VE8 A;  3RKY A;  5AON A;  4A5M A;  4PDK A;  1K78 B;  4UV8 A;  3VOD A;  4I2O A;  3ML6 A;  3R0J A;  4L9T A;  3E6M A;  1D3Y A;  3WOD F;  4KMU X;  1SFU A;  4M6X A;  1AWC A;  4BXU A;  1GVJ A;  5BQT A;  1XN7 A;  4UUV A;  2D1H A;  5K5O A;  1IUY A;  2CW0 F;  3CUQ C;  1ZH5 A;  2A6E F;  1I6X A;  5E1W A;  3HSR A;  3VEP A;  1FOK A;  3D0S A;  1WSU A;  4XLP F;  2Z3Y A;  2PBI A;  4HF2 A;  5D5X B;  1OKR A;  1WRJ A;  3SZT A;  5FO5 A;  1T38 A;  1WQ2 A;  5FD6 A;  4IHS A;  2CG4 A;  1FLI A;  2BGC A;  3VOE A;  2IPQ X;  3IRQ A;  2M87 A;  3HOT A;  5E20 A;  2ZO4 A;  2HEO A;  1XCV A;  1RIO H;  4WCG A;  2F5D A;  3IKT A;  3CJN A;  4M9Z A;  4LJZ F;  3T1B A;  4U0W A;  3RKW A;  3V4G A;  4OMY A;  3V7S A;  4I98 B;  1K7A A;  4BHB A;  4M71 A;  5D8K B;  4UVC A;  2XUB A;  2Q2E A;  3R0A A;  3H3U A;  1RUO A;  3HRS A;  4EJT A;  5BMZ A;  3V8L A;  2MC3 A;  2DI3 A;  2OQR A;  3F23 A;  3M8E A;  1ZGJ A;  4HF0 A;  4Y13 A;  3TQN A;  2D1V A;  1FBU A;  2H6C A;  1R5G A;  2IA1 A;  2HQN A;  4IJA A;  4EGZ A;  2RVC A;  1R5H A;  2MBF A;  1KYW A;  5HS9 A;  2IT0 A;  4S04 A;  2Q0O A;  2BYV E;  3ECH A;  1NHA A; 
#chains in the Genus database with same CATH topology
 3PNV A;  1I27 A;  3X2Q H;  3OSF A;  1ETO A;  2VQC A;  3EUH A;  3OR1 C;  4BBS J;  1K61 A;  5HLG A;  4XLA A;  3W6V A;  3ZMT A;  2XC7 A;  3WHC A;  1FWZ A;  2LH9 A;  2KIM A;  3NEU A;  5F0C A;  3D5S C;  3JR9 A;  1FMV A;  3HRM A;  4CXF A;  1HKS A;  4LG3 A;  4F91 B;  1QZY A;  2OTL I;  2EV0 A;  4A69 C;  5IP9 J;  3K4L A;  4BHC A;  1EJ9 A;  1WZ2 A;  1L3L A;  4AIJ A;  5ILS A;  1D1B A;  2XF6 A;  2MW8 A;  3K4K A;  5CJ9 A;  4C2T A;  2M30 A;  1JI8 A;  2OJE D;  2HDW A;  2K9L A;  2LG4 A;  3M1C A;  5TIS C;  2MYS A;  3JSO A;  2F6C A;  2ESN A;  1F9N A;  2HDC A;  4OWR B;  4DBQ A;  3KLN A;  5H20 A;  1KGS A;  1YW7 A;  2H94 A;  1JUP A;  1VQN I;  3MZ8 A;  1T0F C;  1W7P B;  5CVI A;  3C7J A;  4KIC A;  5HDK A;  1VQM I;  2KFD A;  1IN8 A;  3GYH X;  3CCM I;  1UFM A;  3OIP A;  3DV8 A;  5EEA A;  5F27 A;  1X58 A;  2BY0 A;  4MO7 A;  5HDG A;  1MJA A;  5E3O A;  2E2H J;  3FBN B;  3ROU A;  3H0D A;  2GA2 A;  2E1M C;  4UUS A;  4GYI A;  3P7N A;  4JYK A;  4IVN A;  1MH3 A;  1IXR C;  2QUF A;  1BBY A;  3HC7 A;  2L7Z A;  2FA5 A;  3M7G A;  1I1S A;  3MAJ A;  2K86 A;  2W4S A;  2QWW A;  3BOQ A;  3S3M A;  1BL0 A;  2DBB A;  2FF4 A;  2O8X A;  2LY9 A;  5L3F A;  3MD2 A;  3EDP A;  1F43 A;  2MD5 A;  3CCJ I;  1JT0 A;  2K9Q A;  2DW4 A;  3BT9 A;  3TO6 A;  1LVK A;  1LNW A;  1BIB A;  5BPI A;  3QPH A;  4M74 A;  4LFU A;  2E34 A;  2QZ8 A;  1TBX A;  1E3H A;  2XGC A;  1B9N A;  2EV5 A;  1USS A;  3KEO A;  4BU2 A;  2MH9 A;  4M6V A;  2DA6 A;  5IY5 H;  3HL2 A;  4A3L J;  1QGP A;  1R9T J;  2WV0 A;  4HF1 A;  3FXM A;  1I6H J;  1QRY A;  1JUM A;  4LLN A;  2F2E A;  1TNT A;  4NBQ A;  1P92 A;  4N0B A;  1WKM A;  2IAI A;  3QOE A;  4CYD A;  3KZZ A;  3M8J A;  3RI4 A;  2ZXW H;  1YS6 A;  3ZMU A;  2CSO A;  2GBY A;  3O8G A;  2IGN A;  1MBG A;  5ICF A;  2A5Y B;  3F8B A;  3AFH A;  3TL4 X;  1XMX A;  2DCE A;  4RLF A;  2XPU A;  1VQ5 I;  2K9S A;  2XB5 A;  4NB5 A;  3CUO A;  1JGS A;  4LOC A;  2AXT C;  4ENJ A;  3V42 A;  4PGG A;  5C4X J;  3QPS A;  4PZJ A;  4XID A;  4MFD A;  1BR1 A;  4BE2 A;  3OS0 A;  5E1Z B;  5DCM B;  5DS9 A;  2O6G E;  3SDB A;  2VXZ A;  1HW2 A;  2P4W A;  2R0Q C;  2QYO A;  4PJL A;  1BR4 A;  2XAH A;  1OYY A;  3BRO A;  3OOU A;  1O3R A;  2DJI A;  2Z99 A;  3SQN A;  3IWZ A;  4M3E A;  2W48 A;  1LQ1 A;  1OCP A;  2VBX A;  3WTX C;  1WJC A;  1Z77 A;  4LG0 B;  2ZXJ A;  3L2R A;  2VBW A;  2CWE A;  1VQP I;  1MIJ A;  4MIM A;  3K4N A;  4XLN F;  1S29 A;  3MKY B;  3KP7 A;  4XLH A;  2HOA A;  4KDP A;  2HOE A;  3TP0 A;  5FFZ A;  3GVA A;  3F8M A;  3I0T A;  5CVU A;  1RRJ A;  1BN5 A;  2IJL A;  3HB9 A;  2O9L A;  3FXU A;  5EZH A;  3F0C A;  1SMY F;  2BY2 A;  2M8E A;  1O7F A;  4HAM A;  1BOA A;  4XMY A;  5AIQ A;  2K02 A;  4ZTF A;  4M73 A;  5EYR A;  1AKH A;  1FT9 A;  1AKH B;  1LUJ B;  4ASN A;  1KU2 A;  1YQA A;  4KA4 A;  3U1K A;  2LKX A;  2KPM A;  4G7O F;  3TDZ C;  1FNN A;  5IOZ A;  3C2B A;  3I54 A;  2Q8K A;  2QVO A;  4AUX A;  5DM6 F;  1ZRD A;  3KP3 A;  1D0X A;  4A0Y A;  3DBH B;  1ZQ3 P;  4HNT A;  4Q48 A;  4U87 A;  4ANJ A;  2E19 A;  1Z3X A;  3H0G J;  4XLF A;  3OY9 A;  2PG4 A;  1IN6 A;  2PEX A;  1POG A;  1W5S A;  1U3E M;  1YJ9 I;  3GTL J;  5CQG A;  4M3B A;  1YLF A;  2FBI A;  3CCU I;  1KYZ A;  3ISP A;  4Y33 A;  1X1D A;  4I6Z A;  4RM3 A;  4II2 A;  1YHQ I;  3S3N A;  3RPQ A;  4LB5 A;  4P9F A;  3DPU A;  3GXO A;  1BI1 A;  4L18 B;  4ZDL A;  3T0Y A;  3CCY A;  3CP8 A;  2ZSH B;  1QQI A;  2M8G X;  4YIF A;  3AKZ A;  4B8X A;  3DLL F;  1Z9C A;  2ISY A;  5LBQ A;  2BY1 A;  2M4G A;  1OCT C;  2IA0 A;  2VL8 A;  1JJ6 C;  1IZ1 A;  2EA2 A;  3DU6 A;  2LR8 A;  2EFQ A;  3DEE A;  5E8G A;  1M1E B;  2LTP A;  2DK8 A;  2VQG A;  4HV5 A;  4QPO A;  4WF2 A;  1I3Q J;  4BQQ A;  4DJA A;  1EV7 A;  1FYK A;  3ZOB A;  4E7I A;  5D8L B;  4CSW A;  3A01 A;  4GGG A;  2QEX I;  1U5T A;  3BQY A;  2XSD C;  2V6E A;  1WI9 A;  5B5E C;  2LFB A;  4ESF A;  4J00 A;  2CQQ A;  3LOC A;  4XKV A;  3QYB A;  2HOS A;  5CQE A;  1UMQ A;  4BJ5 C;  1UHW A;  4E7Z A;  1BI0 A;  4E7J A;  4B09 A;  2R93 J;  4I7H A;  1Q1H A;  3R61 A;  3OWT A;  1VQL I;  3WU1 B;  1GV2 A;  1TWF J;  1YG2 A;  4PSW A;  1T98 A;  4ZJZ A;  1QNT A;  2FSW A;  1EH6 A;  2X1D A;  1KQ9 A;  3W2W A;  2M3A A;  4C2U A;  3EPZ A;  1XCB A;  4BAY A;  4G9Y A;  4LG0 A;  3MKL A;  2DDA A;  3RZD J;  3JRE A;  2YS9 A;  2XAU A;  4LMY A;  1S3J A;  1WH5 A;  1QHH D;  3E6B A;  3SXY A;  2WBM A;  3L2V A;  4H0E A;  1KA8 A;  2HKO A;  4BYY A;  4YEL A;  4FE4 A;  3N4M A;  1K6O A;  4IHY A;  1TT0 A;  1ZR4 A;  4Y17 A;  3L2W A;  1MDM B;  2KRH A;  5E79 C;  1JGG A;  3F72 A;  2DMU A;  5GTI C;  3CO7 C;  4HPQ A;  4BAC A;  2GAU A;  2D5V A;  1SAU A;  1VQ9 I;  1PUF A;  3V7R A;  1A5J A;  1TTY A;  4IF4 A;  2F5E A;  3CP2 A;  3IH4 A;  2Y9Z A;  1SMT A;  1RKT A;  1QZZ A;  3NWT A;  1B6A A;  1P2F A;  1ZLJ A;  1HKQ A;  3M4O J;  3K1M A;  2E1M B;  1Y1W J;  2ZFU A;  1TWG J;  3CCS I;  2X48 A;  4G94 A;  3CF2 A;  1R5I D;  4GFB A;  4L5J A;  2K3P A;  1HDP A;  1H88 C;  2XGD A;  1MMA A;  2J5O A;  2R3S A;  2FQ3 A;  1MW7 A;  2A3S A;  2XAQ A;  1D5Y A;  5M5X J;  2P7C B;  1E0E A;  5B1A H;  5HVQ C;  3WU2 C;  2LKP A;  2QGU A;  2MAB A;  2QM3 A;  2QLZ A;  1XD7 A;  3K10 A;  4LGW A;  2OC6 A;  1J7K A;  2EPF A;  4IKF A;  3R60 A;  4GYG A;  2JMW A;  4LD5 A;  4NC6 A;  4ZTJ A;  2ZC2 A;  2HPI A;  4MEY F;  1PJR A;  3EUA A;  2DK5 A;  5LEJ A;  3CME I;  1NG6 A;  1D0Y A;  6PAX A;  1VTN C;  3FWE A;  3ONQ A;  2X1E A;  3BWG A;  2IP2 A;  1H89 C;  5JHU A;  1HSJ A;  1ORK A;  1A35 A;  1C0W A;  1WJA A;  4V19 K;  4A3K J;  3VPR A;  2NNN A;  1HW1 A;  3C2G A;  4H4K C;  3UNG C;  2ZME B;  5LHI A;  1R7J A;  1XGO A;  2ELH A;  5F04 A;  1JXS A;  5J1Y A;  2K7L A;  1G3W A;  1IN5 A;  3M07 A;  3BR0 A;  2COM A;  1KON A;  2PMH A;  3AG1 H;  3GO5 A;  3GFI A;  5TJJ A;  1QVT A;  2FBH A;  2EQR A;  1U2W A;  1XTA A;  2VE9 A;  2K85 A;  2O3F A;  3K4B A;  4II3 A;  4F55 A;  3R4K A;  2R7F A;  2G9W A;  1Z21 A;  3IAS 2;  1QZE A;  5F6F A;  3T8T A;  2GXB A;  3C18 A;  5K5Q A;  1UB9 A;  4NC7 A;  1OMI A;  2M2E A;  1HQC A;  4B1R A;  2ESH A;  3IKV A;  3PIP F;  1UST A;  1XSV A;  1T2K A;  4RGX A;  1HBX G;  5FLX K;  3K4C A;  1S8N A;  4RM2 A;  2DMP A;  3CMY A;  1X3Z B;  1BI2 A;  4A6E A;  2R7V A;  2OQG A;  3CC7 I;  2H1K A;  2NNY A;  2UZK A;  3AG2 H;  1VFC A;  1IXS B;  1D1A A;  2BHY A;  3SJM A;  2PJR A;  3U9G A;  2JA8 J;  3CJR B;  1R58 A;  1YOV B;  4OIR F;  1ENH A;  4JP0 A;  3CCL I;  2VOD A;  4EM0 B;  4B4C A;  4IXA A;  4KJZ A;  3LSP A;  1PVE A;  3B6C A;  3E6C C;  2E1O A;  2EZK A;  2OCC H;  5EG0 B;  9ANT A;  3HSE A;  1OR7 A;  5D5U B;  4A3J J;  4ENK A;  1LDJ A;  3KP5 A;  3BR1 A;  4UHT A;  1Z6R A;  3C1D A;  3HTS B;  2DTR A;  4EJU A;  2STT A;  2JA6 J;  2LK2 A;  3MVP A;  5BOX A;  1CF7 A;  2WY7 Q;  2G7H A;  2X4H A;  3LQQ A;  2ZXH A;  3LA7 A;  5DD4 A;  2VXD A;  4HW0 A;  3UKG A;  4BQN A;  4L0Y B;  2YPR A;  2V1U A;  5K1Y A;  3CJT B;  1HST A;  1MBH A;  3ECO A;  3CCR I;  2R7O A;  3ULQ B;  2Z9O A;  2Q1Z B;  5FD5 A;  1IRG A;  5HLI A;  3BR6 A;  1YRN A;  2RAE A;  1PP7 U;  1MBJ A;  2V1X A;  2A05 A;  2NVX J;  2VUM J;  4AYB A;  1YJN I;  2Y31 A;  3ZQ7 A;  1D8K A;  2GQQ A;  4XON A;  4IRH A;  1QA6 A;  1Y8R B;  2JRT A;  2DT6 A;  1SD5 A;  3GW2 A;  3BDD A;  1IDZ A;  4Z2Y A;  4CYC B;  2VOO A;  3E5X A;  4WX9 A;  4DBR A;  3EYI A;  4UUT A;  1S9H A;  1OPC A;  4BQA A;  4P96 A;  2WTE A;  1QBJ A;  3BCA A;  4LIT A;  4L5E A;  1FBQ A;  3G73 A;  1FJL A;  2V1N A;  4BXF A;  2EK5 A;  1H9T A;  4NUB A;  1SFO J;  4KIB A;  3Q9S A;  2P6T A;  2OZ6 A;  1JJ8 C;  2D45 A;  2ECC A;  2DO7 A;  3ZMV A;  5HS7 A;  1SFE A;  4G6Q A;  1BC8 C;  3RPU D;  3DCF A;  4A3D J;  1D1C A;  3SFI A;  3KLO A;  3OYB A;  1RC9 A;  4HQM A;  2BV6 A;  3J7Y J;  3FF5 A;  4RAZ A;  2KJC A;  1YS7 A;  5J47 A;  3FXK A;  2MGQ A;  1J09 A;  4EMS A;  3GLL A;  2XKO A;  3GCM A;  2G0E A;  4JX6 A;  1V3F A;  4C30 A;  2XKP A;  1GHC A;  1ETX A;  2ECB A;  1Y0U A;  5FRM A;  2VI6 A;  3FM5 A;  5DD8 A;  3BJA A;  5KAF C;  3F22 A;  1R00 A;  5FKO A;  4DZJ A;  1J2X A;  3DLA A;  3V7C A;  3FMQ A;  4IHV A;  1L0O C;  2VKH A;  3L7W A;  2DN0 A;  3DFG A;  4CZC A;  1SVM A;  3G4S I;  3TGN A;  1TW2 A;  2YSR A;  5EDN A;  2L02 A;  3KP2 A;  4BEH A;  1DUX C;  1MNM C;  2LF7 A;  5KVR A;  1B72 B;  2IXS A;  2GIV A;  3FX3 A;  1MBK A;  2CQN A;  5B1B H;  3FBI B;  1YW9 A;  4CYC A;  2R7S A;  5J8C A;  4HX8 A;  3WTZ A;  2KZV A;  2ZME C;  3OOP A;  2R7U A;  5F0F A;  2UWM A;  3JRI A;  1QO0 D;  2M0M A;  2VQL A;  1BM9 A;  5GAG J;  4LB6 B;  4Y3O A;  3RQ4 A;  2CH0 A;  2FNP A;  3MKZ A;  3K2Z A;  4LK1 F;  1HCR A;  1IJW C;  3QYF A;  3HOZ J;  4ETS A;  3MMY B;  4MLO A;  1Z0X A;  2M5W A;  1S6L A;  2QSG X;  1W0U A;  2NVT J;  3LWF A;  3ZRG A;  2L3D A;  3TO7 A;  3OYF A;  5BNG A;  2CYY A;  4D0P A;  5JLX A;  1VQ4 I;  3HOV J;  1ZYR F;  5EZG A;  1WPK A;  3C2H A;  2CQ7 A;  3VDX A;  1JUS A;  4A3M J;  3B73 A;  3LNQ A;  3BPV A;  5KK1 A;  3HPH A;  3IWF A;  2ZJQ F;  3RKX A;  1XMK A;  4W1U A;  1UCR A;  4IRI A;  1EA3 A;  2P5V A;  5LRS A;  1D0Z A;  5DCM A;  1EH7 A;  2XDV A;  1TZL A;  2PFB A;  2FBK A;  3FK6 A;  1DP3 A;  4M3D A;  2VLA A;  2MA3 A;  4HG2 A;  3CTA A;  3E97 A;  3PM1 A;  4V2G A;  2K4B A;  1P4X A;  3KYC B;  4OAZ A;  4AC0 A;  2B7E A;  2KQR A;  3S2D J;  3S2H J;  1KQ8 A;  2WAE A;  5IP6 A;  1ZAR A;  1BA5 A;  1G3S A;  1ON2 A;  2RKH A;  2KIU A;  4FX4 A;  4LIU A;  4MQ9 F;  3SFZ A;  4KIT B;  3RYP A;  1REP C;  3I3L A;  1ZLK A;  4XKC A;  2JWT A;  3HKZ A;  1WH7 A;  4MGR A;  2P6S A;  1FP2 A;  2RN7 A;  3REO A;  3CLQ A;  2EFO A;  3J81 Z;  3HOS A;  2AO9 A;  4ZYA A;  1AHD P;  2ZCW A;  3JW4 A;  4RGS A;  2OCE A;  1R36 A;  3WTS C;  4Y7N J;  3G1O A;  2QQB A;  4XIC A;  2ZKZ A;  3RIR A;  3KZI C;  3TED A;  3OYD A;  4IO9 F;  3TP3 A;  1FIP A;  4GCV A;  3ABU A;  4XBF A;  4DGW B;  2IS6 A;  2X6X A;  1MNE A;  2JPC A;  1O3T A;  2EBI A;  2L9S A;  1B59 A;  3MCZ A;  2VPR A;  1MBE A;  4E7S A;  2UXX A;  3W3C A;  2UXN A;  3KE2 A;  2NXN B;  5M5Y J;  1SAN A;  1MDM A;  2JA2 A;  1TW3 A;  1LPQ A;  2A07 F;  3OYG A;  1TC3 C;  2FEZ A;  1JTY A;  3W6J B;  5DM7 F;  3I59 B;  3IP4 B;  2F4M B;  1IO2 A;  4R79 A;  4WXC A;  2L7F P;  5EGO A;  2ZXI A;  3K1P A;  5JI6 A;  4N9H A;  5ICC A;  4DYC A;  2Y48 A;  1YW8 A;  1OYI A;  1W7P A;  3F9K A;  2NOG A;  2VB6 A;  4BH9 A;  3COA C;  2PI0 A;  5FGM A;  1QPI A;  2FQ4 A;  1X4O A;  3LSI A;  3SEZ A;  3J7A Y;  4PJJ A;  1J5Y A;  3IC7 A;  1ITY A;  2H09 A;  2A6T A;  4RMN A;  1Z7L A;  2STW A;  1OCO H;  4XM3 A;  4BKX A;  3DTE A;  2BXY A;  3V8J A;  1VF9 A;  5CYV A;  3SDG A;  2P5L C;  4L9V A;  4I0A A;  3FIS A;  4YFK F;  3GFJ A;  2HQR A;  3M3Y J;  1Z1D A;  1W36 D;  2CUE A;  3GTQ J;  1A31 A;  1G2H A;  3CCV I;  3K9T A;  2LP0 A;  2B63 J;  2YR2 A;  4HYE A;  2XIG A;  1ZG5 A;  2ZJ2 A;  3QPT A;  1BW6 A;  2CUF A;  2Y0S A;  4UY8 I;  2VPL A;  3CDH A;  2P8T A;  3BZC A;  4HNU A;  1TWC J;  2HPM A;  4A3F J;  2PMU A;  4CO8 A;  2F5C A;  1VZ0 A;  3T8R A;  2L54 A;  1FBS A;  5FLV A;  1Z67 A;  4XN0 A;  1FX7 A;  2KT0 A;  2OBP A;  2HNH A;  3OYN A;  3DTI A;  3LAJ A;  1ZGW A;  2M0C A;  2DAO A;  3NAU A;  2NS7 A;  2E71 A;  2R7X A;  2OAZ A;  4B43 A;  4AWX B;  4C9Y A;  4A3I J;  1DPU A;  1P4W A;  2XRO A;  5LHG A;  2E5Z A;  3CJQ B;  3MKW B;  1RET A;  4QTR A;  5DEQ A;  2HXO A;  4ZZD A;  4OIO F;  2DA4 A;  5ICE A;  1V4R A;  5DUI A;  2XPV A;  3LAP A;  3K70 C;  4ON0 A;  2RGV A;  3DXJ F;  2D2W A;  1T08 B;  3RKQ A;  3O2P E;  4OAY A;  5C4J J;  1X19 A;  1K4S A;  2GZW A;  3G6E I;  1MD0 A;  3BJ6 A;  4CCO A;  2A69 F;  2KRC A;  4PUS A;  4UXN A;  3FMR A;  2JA7 J;  2VKD A;  3O8H A;  1HW5 A;  3Q3S A;  1OCC H;  3CES A;  2V79 A;  1AU7 A;  5FRO A;  4K2E A;  1Y1V J;  4R8H A;  2VT3 A;  4F92 B;  2DA2 A;  4ZYD A;  2DOA A;  5ILU A;  4RB3 C;  2R5Z A;  3S14 J;  5LLQ A;  1W1W E;  1SD6 A;  3I4N J;  3I5U A;  4HX4 A;  4I02 A;  4A5N A;  3PFY A;  1I5Z A;  2R92 J;  3TKY A;  3WG7 H;  2VQH A;  2XV4 S;  3BTJ A;  1GLN A;  2GXG A;  4FET A;  1TP4 A;  4E4H A;  4ZYH A;  2TRT A;  1IN4 A;  3A2K A;  4A6D A;  1N77 A;  3IUO A;  1UZC A;  5TGT A;  4CUG A;  3CZ6 A;  2NRA C;  1H0M A;  3EQL F;  3C3W A;  3G1L A;  2ISZ A;  3JCU C;  3TW6 A;  2XVC A;  2AQE A;  3WTV C;  4NC8 A;  3E5U A;  1G6N A;  1U5T C;  4BE0 A;  3VYT B;  1K78 A;  1X3U A;  4DYQ A;  2W7N A;  5DCF A;  3ASO H;  2R7Z J;  2EB7 A;  3LSH A;  2BW3 B;  3BG3 A;  3O6B B;  4BDY A;  2B0L A;  2DFI A;  4M3G A;  1YFH A;  1OCR H;  5KNL A;  2MC4 A;  5B66 C;  3WHB A;  3ZCO A;  3FXL A;  2XHK A;  1P9Q C;  4ZDO A;  1W5T A;  3QRF F;  3AL0 B;  1U78 A;  1LFU P;  2L4A A;  2W1O A;  5C3E J;  4D7N A;  5CPR B;  3BTL A;  3ABL H;  2LOO A;  2VJ5 A;  3B02 A;  1O57 A;  2X85 A;  1X2M A;  1S7O A;  3S17 J;  1WJB A;  4RBO A;  2IGO A;  3ELK A;  2HS5 A;  2DU9 A;  3GFL A;  2CMP A;  3OL3 A;  4NQW A;  2W57 A;  2B9S A;  3PSI A;  2M45 A;  1ON1 A;  2MG4 A;  1NG7 A;  1DU6 A;  2V9V A;  1LB2 A;  2I10 A;  4AYB N;  4WXH A;  3WGH A;  4JX5 A;  5K7H A;  2XRL A;  3VSK A;  1Z05 A;  1N78 A;  4E7K A;  3A02 A;  2L2O A;  2HYF A;  2IGK A;  3F3X A;  4Q4Z F;  1U8B A;  1XS9 A;  1OCZ H;  2W85 A;  3MFK A;  5DYM A;  4CZZ A;  4Z6Y A;  3KFW X;  4G7Z F;  3L1P A;  3PSF A;  1F4K A;  3S1M J;  2DDB A;  1MND A;  3D5R C;  3VYU B;  3GTJ J;  3DKX A;  1V5G A;  2R7T A;  1IRX A;  3K7A J;  3JRH A;  1CF7 B;  2VOP A;  3AAF A;  4ENN A;  2KDO A;  4OOI A;  2WAQ N;  3ZXS A;  3J7A O;  1T8I A;  2MSY A;  2ZB9 A;  1DGW Y;  2XB0 X;  3JAM Z;  2DOD A;  4A2U A;  2PMZ A;  1W4M A;  5ICG A;  4L0Z B;  2LC2 A;  2LRE A;  2VKE A;  3GZ5 A;  2LDU A;  4WWC A;  4KIF A;  1J59 A;  1ZN2 A;  4XLC A;  4BQO A;  2VBY A;  3OSG A;  1CGP A;  2PMZ N;  1QHG A;  4UVA A;  3I71 A;  4EQQ A;  4PFP A;  3ERE D;  1JHH A;  4UB6 C;  2A68 F;  3M1E A;  2EIM H;  1OQY A;  3PUF A;  2NVQ J;  2G7U A;  2XAJ A;  3D5L A;  2AHQ A;  2BEO A;  1MMS A;  3DP7 A;  3J80 Z;  3I55 I;  1K79 A;  3FXO A;  3S93 A;  1ZAO A;  1LFP A;  4Q5S F;  1MZB A;  1MGT A;  4PCQ A;  4CDG A;  4L9J A;  1QPM A;  2C6Y A;  2R7R A;  2BE5 F;  2NVY J;  4UVB A;  1WWX A;  3HTU A;  5FFX A;  4AIK A;  3IL2 A;  4IHT A;  2BVL A;  2BOL A;  5AIP A;  3H5N A;  1H8A C;  4E7H A;  2ZME A;  3GZ6 A;  2YX7 A;  1LDK B;  2AQF A;  3F8C A;  2COB A;  2KKO A;  3ZMS A;  1DDN A;  1ERD A;  2KIF A;  2DXI A;  1SVL A;  2QCO A;  2FOW A;  1SFX A;  3GME A;  1MKM A;  2O03 A;  2K40 A;  3CUQ B;  4QLC U;  2ZJR F;  4HRI A;  4AM3 A;  3P9K A;  4RB0 A;  1U0J A;  1XG1 A;  2QF7 A;  4DYR A;  3RTR A;  3ZMD A;  1HF0 A;  2XAG A;  3I53 A;  5IP7 J;  2DFE A;  4V2F A;  3RQI A;  1A04 A;  3IV5 A;  2UUZ A;  4E6K G;  3BCB A;  5F08 A;  2R7Q A;  2OU2 A;  4TV7 A;  3MWM A;  1P7J A;  2YUS A;  2AXL A;  1R1U A;  4I0B A;  4OU0 A;  4U0Y A;  4ENM A;  4CGZ A;  4JBA A;  1PUE E;  2NS8 A;  4A0Z A;  4ZZL A;  4DOZ A;  2CW7 A;  2R5Y A;  2K4J A;  3E6D A;  4IRG A;  2CFX A;  2WAF A;  3S2W A;  2ETH A;  3P9I A;  1IXC A;  4PGH A;  2QKM B;  2FJ1 A;  2M1B A;  3RPU A;  1RES A;  1T56 A;  1U5T B;  4S05 A;  4CCL A;  2GLO A;  4DIQ A;  4J01 A;  4B44 A;  2DMQ A;  3S16 J;  4RS8 A;  1I39 A;  3F6V A;  1WGX A;  1T6S A;  2H8W A;  3E0J B;  1SVO A;  2Y75 A;  3BQZ A;  4N9I A;  4F3Q A;  3LMM A;  2CFO A;  4MHG A;  1U6G A;  2QA4 I;  3FXR A;  2XGX A;  4J19 A;  1O4X A;  3G1M A;  1DP7 P;  5F64 A;  3SEQ A;  4XRS A;  1XMA A;  3FIW A;  2JJ7 A;  4XN3 A;  4B48 A;  4EGY A;  1G8X A;  3BR5 A;  1O3Q A;  2PLY A;  1X4P A;  2VBZ A;  2CV2 A;  1XGM A;  2HU9 A;  4EJV A;  2CGP A;  3HHH A;  1OYW A;  2KJB A;  2R7W A;  3BLY A;  4KMF A;  1FTT A;  1LJ9 A;  3IH2 A;  2V26 A;  4RLQ A;  4I01 A;  4KNY A;  1XSX A;  1ZEL A;  5D4S A;  3WTT C;  3H3Z A;  4CCK A;  5E1X A;  4IL6 C;  2K9N A;  5M3F J;  2DQL A;  1TQP A;  4BE1 A;  3J81 K;  2Y9Y A;  4HV6 A;  3E5Q A;  1HOM A;  5BPD A;  1VQO I;  4AIH A;  4PK4 A;  5DUK A;  2VT2 A;  3ESW B;  1BOB A;  3EUH C;  1SD4 A;  3NAR A;  3ZQG A;  4KN4 X;  1DQU A;  5GAE J;  4QWQ A;  2GWR A;  1TLH B;  2W84 A;  3H9J A;  4D5F A;  4YII A;  1FIA A;  2FE3 A;  3ZQC A;  1DGR M;  5D6F A;  1TQM A;  1LEB A;  1B4A A;  4BXX J;  2LVS A;  3LSK A;  1OR7 C;  2KMU A;  3OYH A;  1WI3 A;  4IHX A;  3K4J A;  2A6H F;  2K9M A;  1F36 A;  4I99 C;  1PYV A;  5GP9 A;  1LKX A;  1IW7 F;  2L01 A;  3L00 A;  3DPL C;  3QQA A;  3VSL A;  2LD5 A;  2IW5 A;  1FZP B;  4FHT A;  1NH3 A;  2P5K A;  4XRS G;  3ZN1 A;  1R71 A;  4YFX F;  3SHF A;  1O7L A;  1V5F A;  3K0L A;  3WE3 A;  1WJF A;  1MJ9 A;  5HDN A;  1GXP A;  1UG0 A;  2EA4 A;  2E5N A;  3DF8 A;  5LEK A;  1ZHF A;  3FZV A;  3LFU A;  3L9F A;  1BC7 C;  4KFC A;  3S3O A;  1KU7 A;  2E7W A;  3EYY A;  2FRH A;  1Y8Q B;  5HOO A;  4RAG A;  3PQJ A;  2BBY A;  3T5X A;  4RGR A;  3KP4 A;  5F1J A;  1IAW A;  2LF8 A;  4AVP A;  2X51 A;  1J75 A;  5TRD A;  2KIS A;  3Q0W A;  3SYT A;  1NTC A;  5CKT A;  3S32 A;  1IG7 A;  3DBL B;  4Y15 A;  1HXD A;  3GF2 A;  3GFM A;  5GAH J;  4P55 A;  1FPQ A;  3K4M A;  3CQZ J;  3K2A A;  4A0X A;  3K1N A;  2HTS A;  3HUG A;  3HOU J;  1YI2 I;  1X1P A;  4M6Y A;  3CO6 C;  4OMZ A;  4PJ0 C;  2FUG 2;  2ZFW A;  1W36 C;  2XAS A;  2P0W A;  2XPW A;  4I76 A;  2IS1 A;  2HR3 A;  2JUC A;  1KU3 A;  2OD5 A;  3VYS B;  1IV8 A;  3DQV C;  5K5R A;  3HUG B;  1N75 A;  1OIS A;  2LSO A;  2I8D A;  3B6A A;  1IV6 A;  4F52 A;  5F1R A;  2OZU A;  2HVR A;  3TOA A;  4HOB A;  3HYI A;  3J80 K;  5KAI C;  3EUK L;  3ZQQ A;  2Y30 A;  3LSM A;  5LRR A;  2CRG A;  2CS3 A;  4P9U A;  4XLE A;  2RQQ A;  3LQR A;  5EEG A;  4OIN F;  1X1B A;  1J9I A;  3OYJ A;  1J0R A;  1UJ8 A;  4MFE A;  4BGD A;  2WB1 A;  4MNU A;  1A6Q A;  3LST A;  2EIL H;  2VC0 A;  4LLL A;  2HOT A;  3OIO A;  3PL8 A;  2F5F A;  5IPA A;  2VON A;  2EWN A;  2E35 A;  3I56 I;  3VWB A;  3TBI A;  3ZR8 X;  4UB8 C;  4UUS B;  2OPT A;  2N8G A;  3Q5F A;  1XDU A;  4XRM A;  4B3A A;  4RB2 C;  4YG2 F;  3HPG A;  2OUM A;  5J4Y A;  2PJR B;  4NHJ A;  4HA8 A;  4PFO A;  1JHF A;  2RV8 A;  2V9K A;  3ASN H;  2KDZ A;  3V8K A;  4YEJ A;  4O5V A;  3OYM A;  3FXQ A;  3NRV A;  3FMS A;  3LFK A;  1FSH A;  2CUZ A;  3JSP A;  5E8I A;  4CH7 A;  2Y2Z A;  3ZQI A;  3FK7 A;  3CMA I;  3DKW A;  2HYG D;  3PNY A;  4M9S A;  2HDD A;  1IRZ A;  3BPX A;  3OYL A;  5IT3 A;  3H9Q A;  4XSZ F;  1FMW A;  2K3F A;  5E3M A;  4X0G A;  3BG7 A;  3BR3 A;  4XSX F;  3F21 A;  3HOY J;  5EGO B;  4HLY A;  2V6C A;  3KCC A;  2O8K A;  4M3F A;  1DU0 A;  2Y0M A;  1IGN A;  4JK1 X;  1R1V A;  4P1W A;  5J3L A;  3KYD B;  2HTJ A;  4YRV A;  2DOE A;  5CVR A;  2LNB A;  3RSN A;  5GPA A;  1KU9 A;  1UHS A;  3W6K B;  2QBY B;  4HSR A;  4ZC3 A;  5D5V B;  1LEA A;  1XSD A;  1ETK A;  3MZY A;  3QP5 A;  2M9H A;  2BXZ A;  4EJO A;  5GTH C;  3G3Z A;  3HKZ N;  4B47 A;  1APL C;  2H27 A;  2GIZ A;  4CCJ A;  5LGU A;  1V55 H;  3ZQL A;  3WGG A;  2RDP A;  2I5U A;  2M7A A;  3ABM H;  3IAM 2;  4G8X A;  4CCM A;  2DA7 A;  2VJI A;  5IYB J;  3PFI A;  5L3E A;  3I4P A;  1DPR A;  4NNJ A;  2DTZ A;  3PQK A;  2JPB A;  2V7F A;  3KZY A;  4KT6 A;  2RRE A;  5ERI A;  2VIX A;  2TDX A;  3LL7 A;  2DJN A;  1UG2 A;  5D5W B;  5LD2 C;  1YO5 C;  1HKT A;  4GDF A;  3PIO F;  3ABK H;  5E18 F;  3LA2 A;  4R1H A;  5HS8 A;  1E2X A;  3G2B A;  2A5W A;  1TQI A;  3ZP5 A;  1U8R A;  1FYL A;  1K6Y A;  4JX4 A;  2WAD A;  4IPA A;  4CIC A;  2ZSI B;  1Z7U A;  1G3Y A;  2JSC A;  1MSE C;  2ICW G;  5L3D A;  1Q1V A;  5H2F C;  4BL0 B;  5J1U A;  1RPW A;  1VND A;  4FCY A;  1MJB A;  2FD5 A;  2EFP A;  5L3C A;  2XF7 A;  1ZRF A;  4HST A;  4AID A;  4ESJ A;  4BNC A;  2CUJ A;  3AG4 H;  2JTV A;  4HLX A;  2JN6 A;  4U88 A;  2LYC A;  3P5J A;  2GM4 A;  1RI7 A;  5A2Q K;  3RYR A;  2ELJ A;  1MBF A;  4LIV A;  4AD9 A;  3GTG J;  4EM1 A;  3JAM K;  1Z91 A;  2JUG A;  2DQR A;  2LMD A;  3F6O A;  3JTG A;  2HQA A;  1FEX A;  1RR8 C;  3FHZ A;  3S1Q J;  5DTD A;  2KLO A;  2JT1 A;  3GTM J;  2HKX A;  5HNH A;  3HRT A;  3CLO A;  3W2V A;  1WJ5 A;  1RR7 A;  1BJZ A;  1S72 I;  2FX0 A;  2GA1 A;  3LSJ A;  2BY3 A;  4ZDP A;  2QSF X;  3TOB A;  1GXQ A;  1YE9 A;  4M9X A;  4IX7 A;  2OA4 A;  2EJR A;  5H6Q A;  4DZP A;  4GO1 A;  4F93 B;  5JVG F;  2Y0S N;  2Z16 A;  5J40 A;  1RKW A;  3MQ0 A;  2BHZ A;  2X6Y A;  1FC3 A;  2E2I J;  1T39 A;  1Y56 A;  2UV1 A;  3BZ6 A;  3F8N A;  3ERM A;  5HLT A;  1H9G A;  3OYK A;  3JRB A;  2PQ8 A;  3M8F A;  3A4C A;  2IVM A;  3DEU A;  3QU3 A;  1TNS A;  1BR2 A;  2EZI A;  2L4M A;  3Q0U A;  4Q47 A;  1KZH A;  2P81 A;  3DPT A;  2DPD A;  4O6J A;  3ZQH A;  1B72 A;  1JKO C;  3O3K A;  3CCE I;  2R7D A;  2IRF G;  2V9P A;  2K5C A;  2RNG A;  4EVI A;  4YFN F;  3HOW J;  2J5P A;  1IC8 A;  4GRI A;  2DOF A;  1ZRE A;  5CLS A;  5DV5 A;  2W82 A;  2KL4 A;  2ZBK A;  2BW3 A;  3A1Y A;  2JRM A;  1VQ8 I;  1GUU A;  3DBR B;  3KP6 A;  2FXA A;  2ID3 A;  2NYX A;  5IT9 Z;  3I58 A;  2CJJ A;  3F8F A;  2EFN A;  1ZG3 A;  2PN6 A;  2AS5 F;  3KEY A;  5FKN A;  3VB2 A;  4IEJ A;  1S7A A;  4JOM A;  3FHN A;  1XPX A;  4BDZ A;  2HZD A;  1X1C A;  2V4J C;  4S0H B;  3WE2 A;  1E17 A;  3IH3 A;  3QYE A;  3PO2 J;  3JRG A;  2CU7 A;  1ETQ A;  1V5E A;  4L5I A;  1SEU A;  1YYV A;  1FSE A;  1GVD A;  4IQ4 A;  3WG9 A;  5JVT A;  1ZG1 A;  2VKV A;  1WJD A;  3GUD A;  2NVU B;  1ULY A;  2DMT A;  3S15 J;  2R5Z B;  3I64 A;  4XNF A;  4DW6 A;  4HX7 A;  2WV1 A;  2F5V A;  4HBL A;  4N4O B;  1RNL A;  5ILV A;  1UHM A;  1B9M A;  5CVJ A;  4BJ6 C;  3WTW C;  3E1S A;  5D6E A;  4F7Z A;  4IOC F;  2HWV A;  4G7H F;  1RUN A;  3GWZ A;  1T95 A;  2CQK A;  1Y0N A;  2QQ8 A;  3K70 D;  3GZN B;  4XKW A;  3OYI A;  1UEL B;  1QU3 A;  3H92 A;  3E7L A;  2HQ5 A;  5HLH A;  2K27 A;  1O3S A;  2W24 A;  2ID6 A;  4FIS A;  3L09 A;  4ABZ A;  1GDT A;  3MEX A;  4FX0 A;  4XR6 A;  1W5C C;  4BBR J;  3U21 A;  3GX4 X;  1VQ6 I;  1JT6 A;  3U2R A;  1E3O C;  3GTP J;  3L2Q A;  1EH8 A;  1XB4 A;  5K7F A;  4IZZ A;  2HI3 A;  2GXA A;  5ED4 A;  3I4M J;  2QQA A;  5FLM J;  1WVR A;  4A3G J;  3FKJ A;  2YX4 A;  1SD7 A;  2BZT A;  4PJM A;  3S1R J;  3W2A A;  3BJO A;  1T0F A;  3R6S A;  2Z2S B;  1R22 A;  2DA5 A;  1I50 J;  4MEX F;  1TWH J;  2QEN A;  1JTX A;  1X3W B;  2MFZ A;  3S8P A;  2HZT A;  3BP8 A;  4KIG A;  2A61 A;  1IN7 A;  4BJT A;  4RB1 A;  3BZK A;  3QAH A;  4KN7 X;  3TDU C;  4CA0 A;  2Z1D A;  5LFA A;  3QP6 A;  3CF5 F;  2ZNY A;  1F5T A;  4DNC A;  2X1C A;  2LLK A;  1HDD C;  2H8R A;  2IS4 A;  3QOP A;  2RC4 A;  1CQT A;  2JZY A;  3RJP A;  1YX5 A;  4UNO A;  3ZN0 A;  3Q9V A;  3NQO A;  2EV6 A;  2VJ4 A;  5JHF A;  2CV0 A;  2O0Y A;  5DDG A;  2CO5 A;  2DFH A;  4ZH4 F;  1E3P A;  2M7B A;  2R4G A;  4M72 A;  4ESB A;  1FYM A;  4CCN A;  4XK4 A;  3JTH A;  2GOM A;  3VFZ A;  2IEK A;  2WWY A;  4PSX A;  4NDL A;  3HGY A;  3HSF A;  1JE8 A;  4U7D A;  4G6T B;  2ME0 A;  5J6X A;  3WGI A;  3FKI J;  4A3E J;  2YU9 J;  1LE8 A;  3EET A;  4KYW A;  2DPU A;  3HRU A;  2Z33 A;  4WK8 F;  3FM3 A;  4FT8 A;  2X9D A;  4IHW A;  4RDU A;  5CVV A;  4HQE A;  1ZK8 A;  3M9A A;  4KIS A;  3LSR A;  5J8F A;  1PP8 F;  4AU7 A;  3WTU C;  3I9V 2;  5KHD A;  1FOY A;  1YX3 A;  5LGN A;  3HG9 A;  5HNF A;  3U1D A;  2ME6 A;  2GOX B;  2L0K A;  3RDI A;  1G3T A;  3VYR B;  3IHU A;  3WTY C;  3JRA A;  1IUF A;  3QWL A;  1YIT I;  4EEF G;  3AL0 C;  5FRN A;  1WCM J;  2E60 A;  3LSG A;  2Z5U A;  4HZF A;  4BHP A;  1QVU A;  3GEZ A;  4P5O A;  2X6W A;  5M5W J;  5JLW A;  4XKB A;  3OV8 A;  2JVG A;  4I09 A;  1RZ4 A;  2E7X A;  3OR2 C;  4RAY A;  1I1G A;  1W7P D;  1ZR2 A;  2EZH A;  4E7L A;  4A12 A;  2E36 A;  2KRF A;  1FTZ A;  3CDI A;  3K6G A;  1X2N A;  2EIK H;  3RCO A;  2L9V A;  2RQP A;  1YJW I;  1MSF C;  1X1A A;  1Z6T A;  1XGS A;  2EZL A;  4BY1 J;  4EV0 A;  1G59 A;  3ZMZ A;  2TCT A;  4XRF A;  3HEF A;  4D5C A;  1FP1 D;  3KX2 A;  1AOY A;  2RNJ A;  3J7Z I;  4FAS D;  2WA0 A;  2ZNZ A;  1T33 A;  1BIA A;  2X0L A;  2F4I A;  2MH2 A;  1ZGA A;  1R6R A;  2F4O B;  3GLX A;  3H35 A;  1SC7 A;  2O7O A;  2IA2 A;  3P9C A;  1D5V A;  4A93 J;  1BJA A;  2ACJ A;  5A2Q Z;  1V54 H;  1LVA A;  5GAD J;  3CC4 I;  2X6O A;  4RGU A;  2L9N A;  4EAT A;  1K4T A;  5B3S H;  4WXD A;  2MLK A;  2ADU A;  2L7K A;  4EJW A;  5BS6 A;  5FB2 A;  1MH4 A;  1BI3 A;  3JRF A;  2LY2 A;  4DQ2 A;  2VAS A;  2W00 A;  1XGN A;  1YTY A;  4OIP F;  4E70 A;  5H6R A;  3N97 A;  3I59 A;  1S5L C;  1JKQ C;  2EIJ H;  4HDU A;  2PJP A;  4FTH A;  2FMY A;  3CUQ A;  3HM5 A;  4KT5 C;  5HOD A;  3BTC A;  4D9J A;  4BY7 J;  1TL8 A;  1R1T A;  2QQ9 A;  1VI0 A;  3HJE A;  2O61 A;  3HZJ A;  4OIQ F;  4HDV A;  5IT9 K;  2FML A;  2QBY A;  2MD0 A;  1FOW A;  4XOP A;  5D4R A;  2PX9 A;  2DYS H;  1MMD A;  2DLL A;  2FNA A;  3MZH A;  3QU6 A;  3KEQ A;  3N05 A;  1FOX A;  4GXO A;  1WHU A;  1XDS A;  3RZO J;  1ZRC A;  4NQW B;  5L3G A;  3E3V A;  4QIW N;  3CC2 I;  1S7E A;  2EH3 A;  5LGT A;  1D8J A;  5FJ8 J;  5JR3 A;  3G71 I;  2O5R A;  4HEA 2;  2R5Y B;  3A01 B;  2E1N A;  2CW8 A;  4Y4R A;  4B3X A;  3HIF A;  1HA8 A;  4A3C J;  4A3B J;  2BVM A;  2W25 A;  1KQ0 A;  1SAX A;  1PDN C;  2HGC A;  4O3M A;  2NS0 A;  2XF5 A;  5EF6 A;  3KYL A;  1G4D A;  2ZJP F;  3CD6 I;  1LFB A;  1ODD A;  5J1R A;  4PJN A;  3SZP A;  2IGM A;  4MQV A;  1P6R A;  1P4A A;  2EIN H;  2FOK A;  4U7B A;  5FLX Z;  2DFF A;  5C44 J;  3ZQF A;  2VC1 A;  1ONV A;  2JQ7 A;  3CCQ I;  1HC8 A;  3OYC A;  2H6B A;  4C3J J;  3OMY A;  5JFR A;  1U9N A;  2WAQ A;  4G6D A;  1JKP C;  1AA7 A;  1OLT A;  4U0V A;  2LBF A;  3HHG A;  1PUF B;  1A36 A;  1ACI A;  2VJJ A;  4IQJ A;  2HFH A;  2DT5 A;  2NAZ A;  2YU3 A;  3DU5 A;  2OTJ I;  3PUB A;  4N4N B;  3D1N I;  5IYC J;  1STZ A;  1FY7 A;  2XAF A;  4KUM A;  5L3B A;  1VQ7 I;  4FE7 A;  4BS9 A;  3BG5 A;  3IRR A;  1K83 J;  2OV7 A;  3FDY A;  2H1L A;  2EFW A;  3LA3 A;  2XRN A;  4QPQ A;  4C2M J;  4ZYG A;  4JQF A;  1R4M B;  1GT0 C;  3TO9 A;  1R23 A;  4LLG F;  2V1D A;  2CV1 A;  2E1C A;  5E3N A;  2KP6 A;  4RAF A;  1A6I A;  2JVH A;  1YIO A;  4UV9 A;  3Q0V A;  2QKL B;  1HLV A;  3DWL E;  2IS2 A;  2LY1 A;  4C3H J;  2LRD A;  1LE8 B;  1W0T A;  1IRF A;  4AVZ A;  3S1N J;  1ETW A;  3ABT A;  1LDD A;  1IF1 A;  1OFC X;  4L9N A;  3WU0 A;  4BUP A;  4EM2 A;  1F1Z A;  3KIO A;  1B1B A;  5EEH A;  4RA2 A;  3BY6 A;  3L2C A;  1YRN B;  4D1Q A;  3K69 A;  3KET A;  2OF7 A;  4ZYE A;  2VN2 A;  4YIR X;  3HOX J;  4IOA F;  2L5Q A;  4BEH B;  4MTE A;  3BC8 A;  5IYD J;  1EF4 A;  4LK0 F;  2P7V B;  2WB1 N;  4MTD A;  5E17 F;  3HBL A;  1XX5 A;  2WC2 A;  2FU4 A;  2MLG A;  3GBG A;  5FKK A;  1OJL A;  2HXI A;  5LHH A;  3ZPL A;  2VE8 A;  4CHU A;  3RKY A;  2L9R A;  5AON A;  1ETV A;  4A5M A;  4XL9 A;  3A0B C;  4PDK A;  1K78 B;  4UV8 A;  1NK3 P;  1UAA A;  3PNT A;  3VOD A;  4I2O A;  3PJR A;  2DMN A;  3ML6 A;  3UR3 C;  3OYE A;  2LBF B;  4X6A J;  1R49 A;  3R0J A;  4L9T A;  1BW5 A;  3E6M A;  3TMO A;  3MN2 A;  3TW7 A;  1D3Y A;  3WOD F;  4KMU X;  4X1E A;  1SFU A;  4M6X A;  4QSH A;  1XC5 A;  4FQG A;  1AWC A;  1SFK A;  1MMG A;  4BXU A;  1GVJ A;  5BQT A;  1U9O A;  2DT7 B;  1XN7 A;  2IBD A;  5J4V A;  3H9G A;  3BTI A;  1NK2 P;  4HNV A;  1ETY A;  5M3M J;  4UUV A;  2D1H A;  4Y52 J;  1WJE A;  5K5O A;  1IUY A;  2CW0 F;  3CUQ C;  3DEW A;  1ZH5 A;  2A6E F;  1I6X A;  3H5R A;  5E1W A;  3HSR A;  3VEP A;  1FOK A;  5KCM A;  2DA1 A;  3D0S A;  5FKL A;  1IDY A;  1WSU A;  4C3I J;  4XLP F;  2M34 A;  3JRD A;  2KIQ A;  3DTK A;  2DA3 A;  2Z3Y A;  2PBI A;  3KPH A;  4HF2 A;  3QOD A;  5D5X B;  1OKR A;  2E2J J;  4D7M A;  3HDD A;  3OS2 A;  5K7Z A;  4ITV A;  1WRJ A;  3SZT A;  4XQF A;  5FO5 A;  2WY8 Q;  3OIQ A;  1TWA J;  1WQ2 A;  5FD6 A;  1T38 A;  4IHS A;  3ZGK A;  2CG4 A;  1FLI A;  2BGC A;  3VOE A;  2NOJ B;  3JRC A;  4G12 A;  2IPQ X;  5GPC A;  1Y39 A;  3IRQ A;  3CMM A;  2M87 A;  3HOT A;  2HVS A;  2HYJ A;  5E20 A;  3HXL A;  3FXJ A;  2ZO4 A;  2HEO A;  3H36 A;  2LKS A;  1XCV A;  1JKR C;  1Y6I A;  1EKE A;  1GV5 A;  3HGG A;  1MMN A;  1RIO H;  4WCG A;  3A03 A;  2F5D A;  3IKT A;  2XGE A;  3CJN A;  1WFX A;  4M9Z A;  4LJZ F;  5EJC A;  3T1B A;  4U0W A;  3OS1 A;  3RKW A;  3V4G A;  5EG0 A;  5FKM A;  4OMY A;  2JK3 A;  3BG9 A;  1P7I A;  4W97 A;  3H1C A;  3V7S A;  3BG6 A;  4I98 B;  3BR2 A;  1K7A A;  5IOY A;  2JA5 J;  4BHB A;  3GTK J;  3PO3 J;  2KZG A;  4M71 A;  5E3L A;  5D8K B;  3H3V K;  4UVC A;  2XUB A;  1YIJ I;  3H5A A;  1ZTR A;  1I3A A;  2Q2E A;  2CQX A;  3AG3 H;  2Q2E B;  1Z3Y A;  3R0A A;  1TT5 B;  3H3U A;  1RUO A;  3HRS A;  4EJT A;  5BMZ A;  3V8L A;  2MC3 A;  2ELK A;  2JSP A;  2DI3 A;  4XOT A;  2OQR A;  3F23 A;  3M8E A;  4XOR A;  1ZGJ A;  4HF0 A;  4Y13 A;  3TQN A;  2D1V A;  3L2U A;  1FBU A;  2H6C A;  1R5G A;  2KHM A;  2HVQ A;  2IA1 A;  2XSJ C;  3OL4 A;  2HQN A;  2QSH X;  4IJA A;  2M4K A;  4EGZ A;  1B8I A;  2RVC A;  2Y69 H;  2L7M P;  1R5H A;  2MBF A;  2DYR H;  1ZKG A;  3A0H C;  3QPL A;  1KYW A;  3DKY A;  5HS9 A;  5F0H A;  3OYA A;  1VQK I;  2IT0 A;  2F48 A;  3NWS A;  3SZG A;  1N25 A;  4S04 A;  3GTO J;  3CDL A;  2Q0O A;  1B8I B;  2BYV E;  1R4N B;  3ECH A;  1NHA A; 
#chains in the Genus database with same CATH homology
 1I27 A;  3EUH A;  5HLG A;  3ZMT A;  1FWZ A;  2KIM A;  3NEU A;  3HRM A;  4CXF A;  1HKS A;  1QZY A;  2EV0 A;  4BHC A;  1L3L A;  4AIJ A;  5ILS A;  5CJ9 A;  2M30 A;  3JSO A;  2ESN A;  1F9N A;  2HDC A;  3KLN A;  5H20 A;  1KGS A;  1YW7 A;  2H94 A;  1W7P B;  5CVI A;  3C7J A;  4KIC A;  5HDK A;  1IN8 A;  3GYH X;  1UFM A;  3DV8 A;  5HDG A;  1MJA A;  3ROU A;  2GA2 A;  4GYI A;  3P7N A;  4IVN A;  1IXR C;  2QUF A;  1BBY A;  2FA5 A;  3M7G A;  1I1S A;  3MAJ A;  2K86 A;  2QWW A;  3BOQ A;  2DBB A;  2FF4 A;  2O8X A;  5L3F A;  3EDP A;  2MD5 A;  3TO6 A;  2DW4 A;  1LNW A;  1BIB A;  5BPI A;  3QPH A;  4M74 A;  4LFU A;  2QZ8 A;  1TBX A;  1B9N A;  2EV5 A;  1USS A;  3KEO A;  2MH9 A;  1QGP A;  4HF1 A;  2WV0 A;  4LLN A;  2F2E A;  1TNT A;  1P92 A;  4N0B A;  1WKM A;  4CYD A;  3KZZ A;  3RI4 A;  1YS6 A;  3ZMU A;  2CSO A;  5ICF A;  2A5Y B;  3F8B A;  4NB5 A;  3CUO A;  1JGS A;  4ENJ A;  4PGG A;  4PZJ A;  5E1Z B;  5DCM B;  2O6G E;  2VXZ A;  1HW2 A;  2P4W A;  2QYO A;  2XAH A;  1OYY A;  3BRO A;  1O3R A;  2Z99 A;  3SQN A;  3IWZ A;  1LQ1 A;  2VBX A;  3WTX C;  4LG0 B;  2ZXJ A;  2VBW A;  2CWE A;  4XLN F;  1S29 A;  3KP7 A;  4KDP A;  2HOE A;  5FFZ A;  3GVA A;  3F8M A;  3I0T A;  5CVU A;  1BN5 A;  2IJL A;  3FXU A;  1SMY F;  2M8E A;  1O7F A;  4HAM A;  1BOA A;  5AIQ A;  2K02 A;  4M73 A;  1FT9 A;  4ASN A;  1KU2 A;  1YQA A;  4KA4 A;  4G7O F;  3TDZ C;  1FNN A;  3I54 A;  2Q8K A;  2QVO A;  1ZRD A;  3KP3 A;  4A0Y A;  4Q48 A;  2PG4 A;  1IN6 A;  2PEX A;  1W5S A;  1U3E M;  1YLF A;  2FBI A;  1KYZ A;  3ISP A;  3RPQ A;  4LB5 A;  4P9F A;  3GXO A;  1BI1 A;  4L18 B;  3T0Y A;  1QQI A;  4YIF A;  1Z9C A;  4B8X A;  2ISY A;  5LBQ A;  2IA0 A;  1IZ1 A;  2EA2 A;  2EFQ A;  5E8G A;  2DK8 A;  4WF2 A;  4HV5 A;  1EV7 A;  1FYK A;  5D8L B;  4GGG A;  1U5T A;  1WI9 A;  4ESF A;  1UHW A;  1BI0 A;  4B09 A;  4I7H A;  1Q1H A;  3R61 A;  3WU1 B;  1YG2 A;  1T98 A;  1QNT A;  2FSW A;  1EH6 A;  1KQ9 A;  1XCB A;  4BAY A;  4G9Y A;  4LG0 A;  4LMY A;  1S3J A;  3SXY A;  3E6B A;  4H0E A;  1KA8 A;  2HKO A;  4BYY A;  3N4M A;  1K6O A;  4Y17 A;  1MDM B;  3F72 A;  3CO7 C;  2GAU A;  3V7R A;  1TTY A;  4IF4 A;  2F5E A;  1SMT A;  1QZZ A;  1B6A A;  1P2F A;  1ZLJ A;  1HKQ A;  3K1M A;  4G94 A;  4L5J A;  2J5O A;  2R3S A;  2FQ3 A;  2A3S A;  2XAQ A;  2P7C B;  5HVQ C;  2LKP A;  2QLZ A;  2QM3 A;  1XD7 A;  4LGW A;  1J7K A;  3R60 A;  4GYG A;  4LD5 A;  4MEY F;  2DK5 A;  5LEJ A;  6PAX A;  1VTN C;  3FWE A;  3BWG A;  2IP2 A;  5JHU A;  1HSJ A;  1C0W A;  2NNN A;  1HW1 A;  2ZME B;  5LHI A;  1R7J A;  1XGO A;  2ELH A;  1JXS A;  2K7L A;  1G3W A;  1IN5 A;  2COM A;  2PMH A;  3GO5 A;  3GFI A;  5TJJ A;  2FBH A;  1U2W A;  2VE9 A;  2O3F A;  3R4K A;  2R7F A;  2G9W A;  5F6F A;  3T8T A;  2GXB A;  3C18 A;  5K5Q A;  1UB9 A;  1OMI A;  1HQC A;  2ESH A;  3IKV A;  1UST A;  1XSV A;  1T2K A;  4RGX A;  1HBX G;  5FLX K;  1S8N A;  1BI2 A;  4A6E A;  2OQG A;  2NNY A;  2UZK A;  1IXS B;  3U9G A;  1R58 A;  4OIR F;  2VOD A;  4EM0 B;  4IXA A;  3E6C C;  3HSE A;  1OR7 A;  5D5U B;  4ENK A;  1LDJ A;  3KP5 A;  3HTS B;  4UHT A;  1Z6R A;  3C1D A;  2DTR A;  4EJU A;  2STT A;  5BOX A;  1CF7 A;  2G7H A;  2X4H A;  3LQQ A;  3LA7 A;  5DD4 A;  4HW0 A;  4L0Y B;  2YPR A;  2V1U A;  5K1Y A;  1HST A;  3ECO A;  3ULQ B;  2Z9O A;  5FD5 A;  1IRG A;  5HLI A;  1PP7 U;  2V1X A;  3ZQ7 A;  1D8K A;  2GQQ A;  4IRH A;  2JRT A;  1SD5 A;  3GW2 A;  3BDD A;  4Z2Y A;  2VOO A;  3E5X A;  4WX9 A;  3EYI A;  1OPC A;  4BQA A;  4P96 A;  2WTE A;  1QBJ A;  3G73 A;  1FBQ A;  2EK5 A;  1H9T A;  4KIB A;  3Q9S A;  2P6T A;  2OZ6 A;  2D45 A;  2DO7 A;  3ZMV A;  5HS7 A;  1SFE A;  4G6Q A;  1BC8 C;  3KLO A;  4HQM A;  2BV6 A;  3FF5 A;  4RAZ A;  2KJC A;  1YS7 A;  4EMS A;  2XKO A;  1V3F A;  2XKP A;  1GHC A;  1Y0U A;  3FM5 A;  5DD8 A;  3BJA A;  3F22 A;  1R00 A;  1J2X A;  3V7C A;  3FMQ A;  1L0O C;  3L7W A;  3DFG A;  3TGN A;  1TW2 A;  2YSR A;  2L02 A;  3KP2 A;  1DUX C;  2LF7 A;  5KVR A;  2GIV A;  3FX3 A;  1YW9 A;  5J8C A;  4HX8 A;  3WTZ A;  2ZME C;  3OOP A;  2UWM A;  1QO0 D;  1BM9 A;  4LB6 B;  2FNP A;  3K2Z A;  4LK1 F;  4ETS A;  2M5W A;  1S6L A;  3LWF A;  2L3D A;  3TO7 A;  2CYY A;  4D0P A;  1ZYR F;  3B73 A;  3BPV A;  5KK1 A;  3IWF A;  3RKX A;  1XMK A;  1UCR A;  4IRI A;  2P5V A;  5LRS A;  5DCM A;  1EH7 A;  2PFB A;  2FBK A;  2MA3 A;  3CTA A;  3E97 A;  2K4B A;  1P4X A;  1KQ8 A;  1ZAR A;  1G3S A;  1ON2 A;  2RKH A;  2KIU A;  4FX4 A;  4MQ9 F;  3SFZ A;  3RYP A;  1REP C;  1ZLK A;  4MGR A;  2P6S A;  1FP2 A;  2RN7 A;  3REO A;  2EFO A;  3J81 Z;  3HOS A;  2ZCW A;  3JW4 A;  4RGS A;  1R36 A;  3WTS C;  2QQB A;  2ZKZ A;  3RIR A;  4GCV A;  3ABU A;  4XBF A;  2JPC A;  1O3T A;  1B59 A;  3MCZ A;  2UXX A;  2UXN A;  3KE2 A;  1MDM A;  1TW3 A;  2A07 F;  2FEZ A;  3W6J B;  3I59 B;  4R79 A;  4WXC A;  3K1P A;  5JI6 A;  4N9H A;  5ICC A;  2Y48 A;  1YW8 A;  1OYI A;  1W7P A;  4BH9 A;  3COA C;  2PI0 A;  5FGM A;  1J5Y A;  3IC7 A;  2H09 A;  2STW A;  3V8J A;  5CYV A;  2P5L C;  4L9V A;  4I0A A;  4YFK F;  3GFJ A;  2HQR A;  1Z1D A;  3K9T A;  2YR2 A;  4HYE A;  2XIG A;  1ZG5 A;  2ZJ2 A;  3QPT A;  3CDH A;  2P8T A;  2PMU A;  4CO8 A;  2F5C A;  3T8R A;  2L54 A;  1FBS A;  1FX7 A;  2OBP A;  3LAJ A;  2DAO A;  2OAZ A;  4AWX B;  1DPU A;  1P4W A;  2XRO A;  5LHG A;  5DEQ A;  4ZZD A;  4OIO F;  5ICE A;  1V4R A;  5DUI A;  3LAP A;  4ON0 A;  2RGV A;  3DXJ F;  2D2W A;  3O2P E;  2GZW A;  1MD0 A;  3BJ6 A;  2A69 F;  4UXN A;  3FMR A;  1HW5 A;  2V79 A;  4K2E A;  4R8H A;  2VT3 A;  4ZYD A;  5ILU A;  4RB3 C;  5LLQ A;  1SD6 A;  3I5U A;  4HX4 A;  4I02 A;  4A5N A;  1I5Z A;  3TKY A;  2XV4 S;  2GXG A;  4ZYH A;  1IN4 A;  4A6D A;  2NRA C;  1H0M A;  3EQL F;  3C3W A;  2ISZ A;  2XVC A;  3WTV C;  3E5U A;  1G6N A;  1U5T C;  1K78 A;  1X3U A;  5DCF A;  2EB7 A;  3O6B B;  1YFH A;  2B0L A;  2DFI A;  2XHK A;  1W5T A;  3QRF F;  1U78 A;  2L4A A;  3B02 A;  1O57 A;  1S7O A;  2HS5 A;  3ELK A;  2DU9 A;  3GFL A;  4NQW A;  2W57 A;  2M45 A;  1ON1 A;  2V9V A;  1LB2 A;  4WXH A;  3WGH A;  1Z05 A;  2HYF A;  3F3X A;  4Q4Z F;  2W85 A;  3MFK A;  5DYM A;  4CZZ A;  3KFW X;  4G7Z F;  1F4K A;  1CF7 B;  2VOP A;  3AAF A;  4ENN A;  4OOI A;  3J7A O;  3JAM Z;  4A2U A;  1W4M A;  5ICG A;  4L0Z B;  3GZ5 A;  1J59 A;  2LDU A;  4WWC A;  4KIF A;  1ZN2 A;  2VBY A;  1CGP A;  4UVA A;  3I71 A;  4EQQ A;  3ERE D;  1JHH A;  2A68 F;  3M1E A;  2G7U A;  2XAJ A;  3D5L A;  2BEO A;  3DP7 A;  3J80 Z;  1K79 A;  1ZAO A;  4Q5S F;  1MZB A;  1MGT A;  4PCQ A;  4CDG A;  4L9J A;  1QPM A;  2C6Y A;  2BE5 F;  4UVB A;  1WWX A;  3HTU A;  5FFX A;  4AIK A;  3IL2 A;  4IHT A;  5AIP A;  2ZME A;  3GZ6 A;  2YX7 A;  1LDK B;  3F8C A;  2KKO A;  3ZMS A;  1DDN A;  2KIF A;  1SFX A;  1MKM A;  2O03 A;  3CUQ B;  4QLC U;  3P9K A;  4RB0 A;  3RTR A;  3ZMD A;  2XAG A;  3I53 A;  1A04 A;  2OU2 A;  4TV7 A;  3MWM A;  2AXL A;  1R1U A;  4I0B A;  4OU0 A;  4U0Y A;  4ENM A;  4CGZ A;  4JBA A;  1PUE E;  4A0Z A;  4ZZL A;  2K4J A;  3E6D A;  4IRG A;  2CFX A;  3S2W A;  2ETH A;  3P9I A;  1IXC A;  4PGH A;  2M1B A;  3RPU A;  1U5T B;  4S05 A;  4RS8 A;  3F6V A;  1T6S A;  2Y75 A;  4N9I A;  4MHG A;  1U6G A;  3FXR A;  2XGX A;  1DP7 P;  5F64 A;  1XMA A;  4EGY A;  1O3Q A;  2PLY A;  2VBZ A;  1XGM A;  4EJV A;  2CGP A;  3HHH A;  1OYW A;  2KJB A;  4KMF A;  1LJ9 A;  4I01 A;  4KNY A;  1XSX A;  5D4S A;  3WTT C;  3H3Z A;  5E1X A;  2DQL A;  1TQP A;  3J81 K;  4HV6 A;  3E5Q A;  5BPD A;  4AIH A;  5DUK A;  2VT2 A;  1SD4 A;  4KN4 X;  4QWQ A;  2GWR A;  1TLH B;  2W84 A;  4YII A;  2FE3 A;  5D6F A;  1TQM A;  1LEB A;  1B4A A;  2A6H F;  1IW7 F;  2L01 A;  3L00 A;  3DPL C;  2IW5 A;  1FZP B;  4FHT A;  2P5K A;  3ZN1 A;  4YFX F;  3SHF A;  1O7L A;  3K0L A;  3WE3 A;  1MJ9 A;  5HDN A;  1GXP A;  2EA4 A;  3DF8 A;  5LEK A;  1ZHF A;  3FZV A;  3L9F A;  1BC7 C;  4KFC A;  1KU7 A;  2E7W A;  3EYY A;  2FRH A;  5HOO A;  3PQJ A;  2BBY A;  3T5X A;  4RGR A;  3KP4 A;  1IAW A;  2LF8 A;  4AVP A;  1J75 A;  5TRD A;  4Y15 A;  1HXD A;  3GF2 A;  3GFM A;  4P55 A;  1FPQ A;  4A0X A;  3K1N A;  2HTS A;  3HUG A;  4M6Y A;  3CO6 C;  4OMZ A;  2ZFW A;  2XAS A;  2HR3 A;  1KU3 A;  2OD5 A;  3DQV C;  5K5R A;  2LSO A;  5F1R A;  2OZU A;  3TOA A;  4HOB A;  3HYI A;  3J80 K;  5LRR A;  4P9U A;  3LQR A;  5EEG A;  4OIN F;  1J9I A;  1J0R A;  4MNU A;  3LST A;  2VC0 A;  4LLL A;  2F5F A;  2VON A;  2EWN A;  3Q5F A;  1XDU A;  4RB2 C;  4YG2 F;  4NHJ A;  4HA8 A;  1JHF A;  2RV8 A;  3V8K A;  4O5V A;  3FXQ A;  3NRV A;  3FMS A;  3LFK A;  1FSH A;  3JSP A;  5E8I A;  3DKW A;  2HYG D;  4M9S A;  3BPX A;  5IT3 A;  4XSZ F;  4XSX F;  3F21 A;  4HLY A;  2V6C A;  3KCC A;  2Y0M A;  4JK1 X;  1R1V A;  2HTJ A;  5CVR A;  2LNB A;  1KU9 A;  3W6K B;  2QBY B;  5D5V B;  1LEA A;  1XSD A;  3MZY A;  3QP5 A;  2H27 A;  4EJO A;  3G3Z A;  5LGU A;  3WGG A;  2RDP A;  4G8X A;  3PFI A;  5L3E A;  3I4P A;  1DPR A;  3PQK A;  2JPB A;  3KZY A;  5ERI A;  2TDX A;  5D5W B;  1HKT A;  1YO5 C;  5E18 F;  3LA2 A;  4R1H A;  5HS8 A;  1E2X A;  1TQI A;  3ZP5 A;  1U8R A;  1FYL A;  4IPA A;  4CIC A;  1Z7U A;  1G3Y A;  2JSC A;  5L3D A;  1MJB A;  2EFP A;  5L3C A;  1ZRF A;  4BNC A;  4ESJ A;  2JTV A;  4HLX A;  4U88 A;  1RI7 A;  5A2Q K;  3RYR A;  4AD9 A;  4EM1 A;  3JAM K;  1Z91 A;  2DQR A;  3F6O A;  3JTG A;  3FHZ A;  2JT1 A;  2HKX A;  3HRT A;  3CLO A;  2GA1 A;  3TOB A;  1GXQ A;  4M9X A;  2OA4 A;  2EJR A;  5H6Q A;  4GO1 A;  3MQ0 A;  1FC3 A;  1T39 A;  3BZ6 A;  3F8N A;  1H9G A;  2PQ8 A;  3M8F A;  2IVM A;  3DEU A;  3QU3 A;  1TNS A;  2L4M A;  4Q47 A;  3DPT A;  2DPD A;  4O6J A;  3O3K A;  2R7D A;  2IRF G;  4YFN F;  4EVI A;  2J5P A;  1ZRE A;  5CLS A;  5DV5 A;  2ZBK A;  3KP6 A;  2FXA A;  2NYX A;  5IT9 Z;  3I58 A;  3F8F A;  2EFN A;  1ZG3 A;  2PN6 A;  2AS5 F;  3VB2 A;  1S7A A;  3WE2 A;  1E17 A;  4L5I A;  1YYV A;  1FSE A;  3WG9 A;  5JVT A;  1ZG1 A;  3GUD A;  1ULY A;  3I64 A;  4HX7 A;  4HBL A;  1RNL A;  5ILV A;  1UHM A;  1B9M A;  5CVJ A;  3WTW C;  5D6E A;  4F7Z A;  2HWV A;  4G7H F;  1RUN A;  3GWZ A;  2CQK A;  3H92 A;  5HLH A;  2K27 A;  1O3S A;  2W24 A;  3L09 A;  4FX0 A;  3MEX A;  3GX4 X;  3U2R A;  1EH8 A;  1XB4 A;  5ED4 A;  2QQA A;  2YX4 A;  1SD7 A;  3BJO A;  1T0F A;  3R6S A;  1R22 A;  4MEX F;  2QEN A;  2HZT A;  3BP8 A;  4KIG A;  2A61 A;  1IN7 A;  4RB1 A;  3QAH A;  4KN7 X;  3TDU C;  3QP6 A;  2ZNY A;  1F5T A;  4DNC A;  3QOP A;  2RC4 A;  2JZY A;  3RJP A;  4UNO A;  3ZN0 A;  3Q9V A;  3NQO A;  2EV6 A;  2O0Y A;  5DDG A;  2CO5 A;  4ZH4 F;  4M72 A;  4ESB A;  1FYM A;  3JTH A;  3VFZ A;  2WWY A;  3HSF A;  1JE8 A;  4U7D A;  5J6X A;  3WGI A;  3EET A;  4KYW A;  2DPU A;  3HRU A;  2Z33 A;  4WK8 F;  3FM3 A;  4FT8 A;  5CVV A;  4HQE A;  3M9A A;  5J8F A;  1PP8 F;  3WTU C;  5LGN A;  3U1D A;  3RDI A;  1G3T A;  3WTY C;  3IHU A;  2Z5U A;  4HZF A;  4BHP A;  3GEZ A;  4P5O A;  3OV8 A;  4I09 A;  1RZ4 A;  2E7X A;  4RAY A;  1I1G A;  1W7P D;  4A12 A;  2KRF A;  2RQP A;  1Z6T A;  1XGS A;  4EV0 A;  3ZMZ A;  4XRF A;  1FP1 D;  1AOY A;  2RNJ A;  2ZNZ A;  1BIA A;  2X0L A;  2MH2 A;  1ZGA A;  3GLX A;  2IA2 A;  3P9C A;  1D5V A;  1BJA A;  2ACJ A;  5A2Q Z;  1LVA A;  4RGU A;  4WXD A;  2MLK A;  2ADU A;  5BS6 A;  4EJW A;  5FB2 A;  1BI3 A;  4DQ2 A;  1XGN A;  1YTY A;  4OIP F;  4E70 A;  5H6R A;  3N97 A;  3I59 A;  4HDU A;  2PJP A;  2FMY A;  3CUQ A;  4KT5 C;  1R1T A;  2QQ9 A;  2O61 A;  4OIQ F;  4HDV A;  5IT9 K;  2FML A;  2QBY A;  5D4R A;  2DLL A;  2FNA A;  3MZH A;  3QU6 A;  3KEQ A;  4GXO A;  1XDS A;  1ZRC A;  5L3G A;  3E3V A;  5LGT A;  1D8J A;  5JR3 A;  2E1N A;  3HIF A;  2W25 A;  1KQ0 A;  1SAX A;  1PDN C;  2HGC A;  4O3M A;  2NS0 A;  1G4D A;  1ODD A;  3SZP A;  4MQV A;  1P6R A;  1P4A A;  2FOK A;  4U7B A;  5FLX Z;  2VC1 A;  1ONV A;  2H6B A;  5JFR A;  4G6D A;  4U0V A;  3HHG A;  2HFH A;  2DT5 A;  2NAZ A;  2YU3 A;  1STZ A;  1FY7 A;  2XAF A;  4KUM A;  5L3B A;  3IRR A;  2EFW A;  3LA3 A;  2XRN A;  4ZYG A;  4JQF A;  3TO9 A;  1R23 A;  4LLG F;  2V1D A;  2E1C A;  1YIO A;  4UV9 A;  1IRF A;  3ABT A;  1LDD A;  1IF1 A;  4L9N A;  3WU0 A;  4EM2 A;  1F1Z A;  1B1B A;  5EEH A;  3BY6 A;  3L2C A;  3K69 A;  3KET A;  4ZYE A;  2VN2 A;  4MTE A;  4LK0 F;  2P7V B;  4MTD A;  5E17 F;  2WC2 A;  2FU4 A;  2MLG A;  5LHH A;  3ZPL A;  4CHU A;  2VE8 A;  3RKY A;  5AON A;  4A5M A;  4PDK A;  1K78 B;  4UV8 A;  3VOD A;  4I2O A;  3ML6 A;  3R0J A;  4L9T A;  3E6M A;  1D3Y A;  3WOD F;  4KMU X;  1SFU A;  4M6X A;  1AWC A;  4BXU A;  1GVJ A;  5BQT A;  1XN7 A;  4UUV A;  2D1H A;  5K5O A;  1IUY A;  2CW0 F;  3CUQ C;  1ZH5 A;  2A6E F;  1I6X A;  5E1W A;  3HSR A;  3VEP A;  1FOK A;  3D0S A;  1WSU A;  4XLP F;  2Z3Y A;  2PBI A;  4HF2 A;  5D5X B;  1OKR A;  1WRJ A;  3SZT A;  5FO5 A;  1T38 A;  1WQ2 A;  5FD6 A;  4IHS A;  2CG4 A;  1FLI A;  2BGC A;  3VOE A;  2IPQ X;  3IRQ A;  2M87 A;  3HOT A;  5E20 A;  2ZO4 A;  2HEO A;  1XCV A;  1RIO H;  4WCG A;  2F5D A;  3IKT A;  3CJN A;  4M9Z A;  4LJZ F;  3T1B A;  4U0W A;  3RKW A;  3V4G A;  4OMY A;  3V7S A;  4I98 B;  1K7A A;  4BHB A;  4M71 A;  5D8K B;  4UVC A;  2XUB A;  2Q2E A;  3R0A A;  3H3U A;  1RUO A;  3HRS A;  4EJT A;  5BMZ A;  3V8L A;  2MC3 A;  2DI3 A;  2OQR A;  3F23 A;  3M8E A;  1ZGJ A;  4HF0 A;  4Y13 A;  3TQN A;  2D1V A;  1FBU A;  2H6C A;  1R5G A;  2IA1 A;  2HQN A;  4IJA A;  4EGZ A;  2RVC A;  1R5H A;  2MBF A;  1KYW A;  5HS9 A;  2IT0 A;  4S04 A;  2Q0O A;  2BYV E;  3ECH A;  1NHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...