1XB4A

Crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
180
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
total genus 56
structure length 180
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xb4A02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1xb4A01
3KZYA 1G4DA 4IRIA 4MTDA 5KVRA 1R1UA 2DTRA 3E6MA 3RPUA 1Z7UA 5BQTA 3WTTC 3QOPA 1HKTA 4FX0A 2V6CA 1G6NA 1K7AA 4BHCA 2PBIA 4LMYA 5LRSA 3RYPA 3I58A 2OD5A 2ZNZA 3HOTA 1JE8A 3EDPA 1YW7A 2FF4A 5IT3A 3I64A 3QU3A 3KP6A 3ZMVA 1BN5A 4D0PA 2FEZA 3F8CA 2GXBA 2Q8KA 4A12A 5CVUA 1YG2A 1FZPB 1PDNC 3JAMZ 4NQWA 1GVJA 3KFWX 5AIQA 2OQRA 4EQQA 5HDNA 1X3UA 2HGCA 2EWNA 2DK8A 2LDUA 4ZYHA 1FBSA 2QBYB 3WTZA 4A5MA 3D0SA 4M72A 5DV5A 1XSVA 5BPDA 1PP7U 2K7LA 3GZ5A 4IJAA 4CICA 1QPMA 4B8XA 2ETHA 1XDSA 3TO6A 3H3ZA 3W6JB 5F1RA 2FU4A 3VFZA 1Z9CA 5LGTA 2E7XA 4GXOA 3KP4A 4KDPA 3K1MA 2A6HF 1ZLKA 4KYWA 4UVCA 4EM1A 3FZVA 3IWFA 5BMZA 1H0MA 2YX7A 1ON2A 3OV8A 5ICEA 1XN7A 1MD0A 4RGUA 4R79A 1WRJA 3VOEA 2PG4A 5LBQA 4MGRA 4EM0B 2D1HA 3U2RA 5FD5A 3FF5A 1SD5A 2RQPA 2DQRA 1USSA 1HW2A 1TNSA 4EMSA 3GVAA 3HYIA 1FX7A 1DDNA 4G9YA 5E1ZB 2UWMA 4TV7A 2IA1A 3ZQ7A 1J2XA 2E1CA 2H6BA 4CDGA 3L2CA 1ZYRF 3ABUA 2ZNYA 4S05A 3BWGA 4HW0A 3HRUA 3PQKA 4M74A 2MD5A 2IPQX 4PGGA 1Z1DA 4A6DA 4L18B 3I53A 3ABTA 1VTNC 4KUMA 3HRTA 5DD4A 2CO5A 1R58A 4WXCA 2IP2A 1IRGA 3K1PA 2HS5A 2O03A 2YSRA 1FLIA 4HQEA 1RNLA 4AVPA 1OYWA 2VOOA 4U7DA 1U3EM 2D2WA 1J0RA 3QAHA 3QP5A 3ROUA 2FA5A 3ULQB 2VT2A 2OBPA 3GZ6A 2EA4A 3RI4A 3Q9VA 4RAYA 1H9TA 3ZMSA 4IHTA 3KCCA 1OYIA 1XGMA 3DXJF 1ONVA 2FBIA 1J75A 2RVCA 4Q47A 3HSEA 1KA8A 1ZAOA 1Z91A 1YS7A 1S6LA 1WSUA 1YW8A 1BM9A 1IN5A 3FMRA 2GA1A 2GQQA 2HDCA 1YYVA 1GXPA 5A2QK 3BDDA 2JTVA 4LLNA 4G8XA 1ZARA 2AS5F 1REPC 4G94A 4RGSA 1DUXC 3DEUA 3QPTA 5AONA 3DFGA 4GCVA 5JI6A 4ASNA 2V1UA 1BOAA 1S8NA 2VXZA 3KEQA 5J6XA 2OZUA 5FFZA 3V8KA 4ZYDA 2XKPA 4MEYF 3MFKA 2P6TA 1ODDA 1R00A 3JW4A 3GXOA 1O3RA 2ZMEB 4AIHA 3CLOA 4LK1F 1F1ZA 3F6VA 4BXUA 2ELHA 5DYMA 3IKVA 4KICA 2FBHA 4AD9A 1FSEA 6PAXA 1JHFA 4L5IA 4KMFA 2IW5A 3RDIA 1D5VA 3J81K 5E1WA 2HKXA 2HWVA 2UZKA 5LHHA 2O61A 1IXRC 1LVAA 1R5GA 1UHWA 4MQVA 1O3SA 1D8KA 4PCQA 3E6BA 1YO5C 1ZH5A 2VN2A 3LQRA 2O3FA 1FY7A 4M9SA 4LGWA 2XGXA 4JQFA 2CGPA 2JZYA 2VC1A 3FXQA 4RS8A 3JTGA 3T1BA 2BYVE 1KQ8A 2K86A 1SD4A 2F5CA 2UXXA 4BQAA 5FD6A 4KN4X 3QPHA 4HDUA 4EJVA 1B59A 2DI3A 2NYXA 4Z2YA 2FNPA 3GYHX 5L3FA 2F5EA 2UXNA 1W7PA 2M30A 2HTJA 2GIVA 5ILUA 2XASA 1LEAA 1FT9A 4ZYEA 2RC4A 3C7JA 4UXNA 3RYRA 4P9UA 3ZPLA 3DF8A 2Z99A 4O6JA 3M9AA 1XB4A 3DQVC 5E1XA 1S3JA 3MWMA 3D5LA 4OOIA 3TQNA 1IXSB 2CFXA 2G7UA 3LQQA 2RNJA 4DNCA 1MJ9A 3T0YA 1GXQA 2R7FA 1P92A 5ERIA 4I09A 3MZHA 1LDJA 1XGSA 1SD7A 1TNTA 2ADUA 3REOA 2D45A 4M71A 2DAOA 1OYYA 3IHUA 3GUDA 3J81Z 2JT1A 3F8MA 1BJAA 4LB6B 3HOSA 2A69F 2BV6A 2QBYA 4IHSA 1TW2A 1DP7P 3TOAA 2TDXA 3I5UA 3OOPA 5CYVA 4EJUA 2QQ9A 5HDKA 1T6SA 4XSXF 4Q5SF 1XMAA 1Z05A 1T38A 4F7ZA 3TGNA 3LAPA 1HXDA 1QBJA 2VE8A 3DPLC 3VODA 3I4PA 2PMHA 3K0LA 2XAQA 5LGNA 2Y48A 4A0YA 2A68F 2DLLA 3T8RA 3RPQA 4RB3C 2V1XA 3FXRA 2EFQA 3M8FA 4O3MA 2OAZA 4O5VA 3E6CC 3P9IA 2X4HA 2NRAC 1QZZA 5TJJA 4ENNA 4ESFA 2DW4A 3ZMUA 3EUHA 3ZMTA 2XRNA 3MZYA 4L9VA 3GLXA 1JHHA 1K78A 4KMUX 4CGZA 4FX4A 1LDDA 4I2OA 3I0TA 2XAJA 4H0EA 4LG0A 4WCGA 2RV8A 4YIIA 5FGMA 1QO0D 1WKMA 3BP8A 2FXAA 2W25A 1L0OC 4RB0A 1FSHA 2KKOA 2XUBA 3WTXC 4L9NA 3U1DA 1EV7A 4RB2C 1ON1A 3C18A 1LNWA 4KIBA 1U5TC 3E3VA 2IRFG 3E97A 2V1DA 2PI0A 3GX4X 2ZXJA 2VBZA 1NHAA 1LJ9A 2VBXA 5ILVA 4G7OF 4EVIA 4IVNA 1O3QA 4GGGA 1I5ZA 1OPCA 2WTEA 4WK8F 5D5WB 5K1YA 1O7LA 3GFLA 3ZMZA 2WWYA 4QWQA 2Z33A 4HLYA 3BPXA 4RGXA 5FO5A 3CUQB 4BYYA 1I6XA 1FYLA 4EJTA 4L0YB 5CLSA 2MH2A 3L00A 1UB9A 2XROA 4L0ZB 3B02A 4IXAA 2GWRA 3BOQA 2ZMEC 1B9MA 1W7PB 1FC3A 4HLXA 2K02A 3R61A 2HOEA 5JFRA 3F22A 4ENKA 1HW1A 4M9ZA 5KK1A 1R36A 2MLGA 4S04A 4XLNF 4AIJA 3EYYA 1U5TA 3RIRA 2DPUA 3KLOA 4HQMA 5HDGA 4ESBA 2W85A 4MTEA 4BAYA 3I71A 3IWZA 3SFZA 4Y15A 1U2WA 1G3YA 2JSCA 5JR3A 2LF8A 2FRHA 5HVQC 4KIGA 4I7HA 4RAZA 3DPTA 1V4RA 4OMYA 2MA3A 4M6YA 3WE3A 5TRDA 1TQIA 1G3SA 5L3CA 3C3WA 4PGHA 1KYZA 2IVMA 1FYMA 4KT5C 2FBKA 3GWZA 3M8EA 2H94A 1YIOA 2A5YB 2QQAA 2STTA 2XIGA 3L7WA 3WGGA 3SZPA 5DUIA 2XAFA 5HS8A 1WI9A 3HRSA 3KZZA 1W4MA 1P4XA 2CG4A 2L4MA 2KJCA 2XAGA 1J7KA 2L54A 2ZJ2A 4HA8A 1R1VA 1HSTA 1P2FA 4LLLA 4BHPA 1T98A 2Y0MA 5DDGA 4WXHA 4HF1A 4G6DA 3SXYA 3P9CA 5D5XB 4IRGA 2H09A 3J80Z 3KP7A 2KIMA 1XDUA 1S7AA 1XCBA 3JSOA 3M1EA 4XLPF 1HKSA 2BE5F 3RJPA 2M8EA 3HIFA 3T5XA 1SAXA 1FBUA 3N4MA 3DP7A 4HX8A 1TW3A 2ZCWA 3EETA 3E5QA 3R60A 1P6RA 4MEXF 2QM3A 2P5LC 5L3GA 2XVCA 3WTUC 3TOBA 3TDZC 3LA2A 1P4AA 2ZFWA 1SD6A 4ENJA 2EFOA 5D5VB 5LHGA 4YFXF 5L3EA 2CWEA 5J8CA 3J7AO 5FFXA 1FOKA 3HUGA 3O3KA 1FNNA 3ML6A 1B6AA 2D1VA 1G3TA 2EJRA 4N9HA 3WG9A 1XGOA 1HBXG 3WU1B 3HHGA 3O6BB 4K2EA 1SFXA 3KP5A 5IT9K 1MKMA 4Q4ZF 3NRVA 3ERED 5AIPA 2PLYA 4OMZA 2P7VB 1OKRA 3H92A 2MLKA 4CHUA 2FMLA 1BC8C 3EYIA 2VT3A 3B73A 2ESNA 3GFJA 5ED4A 2DU9A 4AWXB 2P6SA 4UV9A 3K1NA 3IC7A 4I02A 3FM3A 3Q9SA 2VODA 1STZA 2PFBA 1R1TA 2NS0A 5HOOA 2ZO4A 3E5UA 2OU2A 4LD5A 3HTSB 4A6EA 5HLIA 4GYGA 4N0BA 3FX3A 1XSXA 2E1NA 2MBFA 1TBXA 3ZN0A 3I59B 1W5TA 4P9FA 2MC3A 1R22A 3QRFF 2Q2EA 3F3XA 1IAWA 1RIOH 1CF7A 1U5TB 1ZG3A 2HZTA 1TLHB 4OU0A 4OINF 3W6KB 2DT5A 3K2ZA 3LWFA 2FQ3A 1F9NA 5EEGA 1KU3A 2ZKZA 1FBQA 2BGCA 2YR2A 2O6GE 4U7BA 1S29A 4KIFA 4KNYA 2IJLA 2DO7A 3LAJA 2EFWA 1EH6A 4NHJA 4M73A 1L3LA 3WU0A 2QQBA 3U9GA 3SZTA 3T8TA 3QP6A 5D4SA 3BJ6A 2H27A 5ICFA 2EFPA 5E17F 1I1GA 3R6SA 4AIKA 2XKOA 2FE3A 2K4JA 2RGVA 2O0YA 2XV4S 2ZBKA 2LKPA 3I59A 1XGNA 3N97A 2K27A 1K6OA 4ZZDA 5LHIA 3GEZA 1MDMB 4OIRF 3FMQA 2Z5UA 1C0WA 1Y0UA 4HX7A 2QYOA 3WODF 1KYWA 1SMYF 5K5OA 3G3ZA 3HSRA 1K79A 2GAUA 2LF7A 4I01A 1QGPA 5HS7A 2YX4A 2RDPA 5LEJA 2DQLA 2GA2A 5DCMB 2OZ6A 1E17A 1UHMA 4P96A 1HSJA 4BHBA 2WV0A 3VEPA 1SFEA 2ZMEA 2BBYA 4RGRA 4WF2A 2JRTA 1RUOA 4N9IA 4P5OA 4ZZLA 5FB2A 3HHHA 1KU9A 2F5DA 2M1BA 2CQKA 1Z6RA 3F8FA 1HQCA 3R4KA 1ZGJA 4E70A 2FNAA 4YG2F 3ZMDA 1LQ1A 1J9IA 1MJAA 2P7CB 4MHGA 4CO8A 2W24A 3JAMK 2QLZA 1Q1HA 3CO7C 5DEQA 4HV5A 4UVBA 3JTHA 3GFIA 3E5XA 1Z6TA 4MQ9F 4G7ZF 2HFHA 2KRFA 2QVOA 4U0VA 3KEOA 3EQLF 4MNUA 1K78B 1XMKA 2P4WA 1H9GA 2Z9OA 3QU6A 3ZN1A 2HQNA 3V8JA 2EA2A 1MZBA 5DUKA 1IF1A 2L4AA 4OIOF 2AXLA 3RTRA 5ICCA 5A2QZ 2QWWA 2HQRA 3V7RA 3KP2A 1FWZA 4RB1A 1XSDA 5L3BA 2GZWA 2K4BA 2DFIA 3BJAA 1TQMA 1D3YA 4FT8A 4EJWA 2NNNA 3BROA 3CUQC 3SHFA 2EV6A 2HYGD 4HF0A 1KQ0A 2HKOA 3CO6C 3RKXA 2V79A 3WTVC 1IRFA 2IA0A 4L5JA 2DK5A 1ZREA 1IZ1A 3VB2A 3FMSA 5BPIA 3GO5A 4ZYGA 1W7PD 1YLFA 1FP2A 2XHKA 4ZH4F 4UV8A 1J59A 3F23A 3KETA 4ETSA 4CYDA 1SFUA 2OA4A 4L9TA 1QQIA 3COAC 3MQ0A 4HYEA 1ZG5A 4Y13A 1BI1A 3L09A 1DPUA 4FHTA 3PQJA 2PN6A 4NB5A 2EB7A 1IN6A 1ZRCA 1S7OA 1JGSA 5HS9A 3TKYA 3CTAA 3ZP5A 3HTUA 3CDHA 3GW2A 1IN7A 1AWCA 5F6FA 3WTYC 3DKWA 5E20A 2XAHA 3WTSC 2CW0F 3TO7A 1ZLJA 2ISYA 2FSWA 3Q5FA 3C1DA 5CVJA 1B1BA 1V3FA 3MEXA 4Q48A 4LJZF 1QZYA 1IN8A 3IL2A 3L9FA 1FPQA 1ZGAA 1WQ2A 4LK0F 4IPAA 1RUNA 1U78A 1OR7A 4OIQF 2DBBA 4CXFA 4EGYA 2V9VA 3PFIA 3F6OA 5BS6A 3FM5A 4YIFA 1O57A 4XSZF 3G73A 5K5RA 3GF2A 1EH8A 1ULYA 2MH9A 3BJOA 4EJOA 4EGZA 5H20A 4I0BA 5E8IA 5LEKA 1BC7C 1F5TA 2CSOA 1MDMA 1KU2A 2P8TA 4GYIA 4XBFA 3MCZA 5D6FA 2P5VA 2M45A 1LB2A 4EV0A 2F2EA 4Y17A 2M87A 2PJPA 1A04A 1IUYA 1W5SA 2HR3A 4P55A 5D6EA 2ESHA 4KA4A 2JPCA 1AOYA 4LG0B 4L9JA 1PP8F 2EV5A 2L3DA 1DPRA 1MJBA 3J80K 4PDKA 2KIFA 5E8GA 2VC0A 3RKYA 5FLXZ 3V4GA 3FHZA 3NEUA 4IF4A 4A0XA 4A0ZA 2W57A 3HSFA 3O2PE 4JK1X 1D8JA 5F64A 3M7GA 1CGPA 5JVTA 2LSOA 1MGTA 5CJ9A 5L3DA 1U6GA 5H6RA 3BPVA 3S2WA 3ELKA 2COMA 3MAJA 1CF7B 3AAFA 4HX4A 1UCRA 5D4RA 5DCFA 4JBAA 2O8XA 3F8BA 3K9TA 3WE2A 4DQ2A 5ICGA 2PEXA 4LLGF 5D8LB 3R0JA 3NQOA 3I54A 3FXUA 4HV6A 4ENMA 5HLHA 1EH7A 2KIUA 3LFKA 1P4WA 1BBYA 4UHTA 5EEHA 4BNCA 2IT0A 2J5PA 1J5YA 2Y75A 2QZ8A 5LLQA 4HZFA 2J5OA 1E2XA 2HYFA 3E6DA 1GHCA 1B4AA 5H6QA 1T0FA 4YFNF 1USTA 1R7JA 1XCVA 3GFMA 5DCMA 2W84A 3LA3A 2ACJA 2C6YA 1G3WA 1HW5A 3K69A 4R8HA 2F5FA 2ISZA 3ECHA 4U88A 5HLGA 4HDVA 1RI7A 3WTWC 4M9XA 3TO9A 5D5UB 4I98B 2A07F 1JXSA 1KQ9A 1ZG1A 1QNTA 4ON0A 1SMTA 5CVRA 2WC2A 3WGIA 1B9NA 1IW7F 1KU7A 5BOXA 3KE2A 4HBLA 2A6EF 3BY6A 4KN7X 3FWEA 1IN4A 1O7FA 4WX9A 1BI2A 4B09A 2DPDA 3IKTA 1U8RA 3ISPA 3KLNA 2VOPA 1I1SA 2QENA 2X0LA 1UFMA 3ECOA 2A3SA 3LSTA 2JPBA 5DD8A 5K5QA 1T39A 3R0AA 3CUQA 1F4KA 1LEBA 2RN7A 1I27A 3CUOA 4ESJA 2PQ8A 4G6QA 2EV0A 5E18F 3H3UA 2Q0OA 2HEOA 4GO1A 2P5KA 1BI0A 4R1HA 1IXCA 2R3SA 3V7CA 2CYYA 2Z3YA 4UUVA 3RKWA 1BIBA 2E7WA 2HTSA 1FYKA 5IT9Z 3JSPA 4I0AA 2NNYA 5CVIA 2H6CA 1BI3A 3P7NA 4QLCU 2G9WA 3V7SA 3LA7A 3TDUC 4U0YA 1TQPA 2VE9A 5FLXK 4HF2A 2PMUA 2IA2A 1KGSA 1ZRDA 4OIPF 3F8NA 4HAMA 1RZ4A 2M5WA 2A61A 2VBWA 2GXGA 2VONA 1FP1D 4UNOA 2LNBA 5CVVA 4KFCA 5ILSA 1YFHA 3SQNA 5J8FA 2NAZA 1YTYA 3KP3A 4HOBA 1XD7A 2G7HA 2YU3A 1YQAA 1BIAA 1TTYA 4M6XA 5LRRA 1HKQA 3IRQA 1T2KA 2B0LA 1ZHFA 4IRHA 1YW9A 3V8LA 2STWA 4PZJA 1WWXA 2QUFA 3F72A 3IRRA 4UVAA 2YPRA 2KJBA 4YFKF 1O3TA 3CJNA 1PUEE 4WWCA 4G7HF 5JHUA 3F21A 4LFUA 2FMYA 2BEOA 2FOKA 2OQGA 2RKHA 1R5HA 3BZ6A 4A5NA 2R7DA 3DV8A 4WXDA 2VBYA 3P9KA 2L01A 4LB5A 1ZRFA 2L02A 3HRMA 5D8KB 1ZN2A 1R23A 2EK5A 1YS6A 4A2UA 4U0WA 1OMIA 5LGUA 3WGHA 1LDKB 4BH9A 4XRFA 4EM2A 2EFNA 4CZZA
chains in the Genus database with same CATH superfamily
3KZYA 4XRSG 1G4DA 2V6EA 1A31A 4IRIA 4MTDA 1X2MA 5KVRA 1VQLI 1R1UA 2DTRA 3E6MA 3RPUA 1Z7UA 3A03A 1V55H 5EDNA 3MKZA 5BQTA 4DYCA 2DDAA 3WTTC 5KCMA 1J09A 3OIOA 2EIJH 4DOZA 3QOPA 1HKTA 4FX0A 2V6CA 1G6NA 2HPMA 3TEDA 1K7AA 4BHCA 2PBIA 1YRNA 1MBGA 4LMYA 3K4CA 2E1MC 5F0HA 1SVLA 5LRSA 3RYPA 3I58A 2OD5A 2AQFA 2X48A 2ZNZA 2X6WA 1EJ9A 2BXZA 2QSHX 3J7AY 3HOTA 1JE8A 4PK4A 3A1YA 4X1EA 1XC5A 2CW7A 3EDPA 2R7VA 1YW7A 2K9SA 1FTZA 2FF4A 5IT3A 3I64A 1NTCA 2MW8A 3QU3A 1MNMC 3KP6A 3ZMVA 1BN5A 4D0PA 2FEZA 3F8CA 3LSHA 2GLOA 5EJCA 3FIWA 2GXBA 2Q8KA 2XGEA 2HOTA 3AG4H 4A12A 4ITVA 5CVUA 1YG2A 1FZPB 3FHNA 2LY9A 2ME0A 1PDNC 3JAMZ 2DFHA 4NQWA 1GVJA 3KFWX 5AIQA 2Q2EB 3AG2H 3DPUA 5IOZA 4Y33A 2OQRA 3ZR8X 4BXFA 4EQQA 5HDNA 3ZQCA 1X3UA 2HGCA 3K4BA 2EWNA 1IV8A 1ETKA 2DK8A 2ZJQF 2VUMJ 2LDUA 4ZYHA 1FBSA 2DMPA 2QBYB 1Z67A 2R4GA 2DMQA 3WTZA 3QYBA 1SVOA 4A5MA 2ELJA 1Y1WJ 3D0SA 4M72A 5GAGJ 5DV5A 1XSVA 1Y1VJ 5BPDA 2RNGA 1PP7U 2K7LA 3GZ5A 2HZDA 2LOOA 4IJAA 1GT0C 1LE8B 1B8IB 3LSPA 1W36C 4CICA 1QPMA 4MFEA 4B8XA 2ETHA 1XDSA 3TO6A 3H3ZA 3W6JB 5F1RA 2FU4A 3DU6A 5HLTA 4I99C 3VFZA 5LGTA 2E7XA 4E7JA 1Z9CA 3IH2A 4GXOA 3KP4A 4KDPA 3K1MA 2A6HF 3CJTB 1ZLKA 4M3EA 4KYWA 4UVCA 4EM1A 1WI3A 3OYJA 4GDFA 3FZVA 1JT0A 1VQPI 3IWFA 2DMTA 3IAS2 3OYMA 2H8WA 4BE1A 3DTKA 1ETXA 4RLFA 4XN3A 3P5JA 1OCCH 5BMZA 1H0MA 3SJMA 2YX7A 1ON2A 3OV8A 4PFOA 4FETA 2K5CA 5ICEA 3H0DA 1ZR4A 1XN7A 5FKNA 3M4OJ 2HU9A 3B6AA 1MD0A 4FE7A 4RGUA 4R79A 4CCJA 1FOXA 2ZXIA 1WRJA 2CUFA 3VOEA 2PG4A 5LBQA 4MGRA 4EM0B 4DBQA 3PO3J 2D1HA 1D1BA 1FJLA 3U2RA 5FD5A 5C3EJ 3FF5A 1IRXA 1SD5A 2RQPA 4F3QA 3BTCA 2VPLA 2DQRA 3Q0WA 1USSA 4BJ6C 2QF7A 2ZB9A 3K10A 1HW2A 4BY1J 5FRNA 1V54H 2R7ZJ 3DLAA 3MD2A 1TNSA 4XM3A 4BBSJ 4EMSA 3GVAA 3HYIA 1FX7A 1DDNA 4G9YA 5E1ZB 2WA0A 4TV7A 2UWMA 3ASOH 2EQRA 2IA1A 3LFUA 4LIUA 3ZQ7A 3ESWB 1J2XA 4NC7A 5E3LA 2E1CA 1QVTA 3J7YJ 1X1CA 2H6BA 4CDGA 3L2CA 1QU3A 2DDBA 1A35A 1U9OA 1ZYRF 4C2TA 3ABUA 2ZNYA 2X6OA 3BWGA 4HW0A 4S05A 5EYRA 3H9QA 3HRUA 1WJBA 3UR3C 2XGCA 1IC8A 3PQKA 4M74A 2MD5A 1YHQI 2IPQX 3QWLA 4PGGA 1LUJB 1JT6A 1Z1DA 4A6DA 4L18B 1FEXA 3I53A 3ABTA 3G4SI 1VTNC 1QZEA 3OYCA 4BQNA 2M3AA 4KUMA 1JKQC 4HNUA 2JVGA 3HRTA 2GXAA 5J4YA 5LD2C 2CUZA 2IGOA 3UNGC 3OYFA 1QA6A 5DD4A 4AUXA 1MH3A 2CO5A 1R58A 2L2OA 4XQFA 3CCVI 4WXCA 2ZXHA 2IP2A 1Q1VA 2LY1A 3LOCA 3K1PA 4G12A 1IRGA 2HS5A 2O03A 2YSRA 1FLIA 4HQEA 1RNLA 4E7IA 2LR8A 4AVPA 3DBLB 1OYWA 2VOOA 4XKWA 3A2KA 3K2AA 1EA3A 4C3HJ 2EPFA 2DA6A 4C3JJ 4U7DA 2E35A 1U3EM 2D2WA 1QPIA 3CDIA 3LSIA 1J0RA 3QAHA 2VQLA 3QP5A 3D1NI 3ROUA 1HF0A 2FA5A 3ULQB 1VQ7I 2VASA 2VT2A 2OBPA 3GZ6A 3OMYA 2EA4A 4RAGA 3RI4A 1MBHA 3Q9VA 3I4MJ 4RAYA 1M1EB 1H9TA 4D5CA 1WJEA 2HDWA 4PJMA 3JR9A 1X58A 3ZMSA 2V9PA 1K83J 4IHTA 4MO7A 2ID3A 3KCCA 3S3NA 3DU5A 3SFIA 2NS8A 3RQIA 2E36A 1OYIA 2LMDA 1XGMA 3DXJF 1Z7LA 3LL7A 1ONVA 1D0YA 2FBIA 1MMSA 3FXKA 1QVUA 3F9KA 1J75A 4D7NA 2HPIA 1YX5A 2RVCA 4Q47A 3HSEA 1Y8RB 4FISA 2ELKA 1TWFJ 3HXLA 1KA8A 1D1CA 2R7OA 5HNFA 2WY8Q 2M4KA 2VJ4A 1ZAOA 1Z91A 1YS7A 3PNVA 4RBOA 4UY8I 1ETVA 1JJ8C 1S6LA 3BCAA 1WSUA 1YW8A 1BM9A 4NC6A 2LC2A 1IN5A 5EEAA 2OUMA 3FMRA 1K4SA 2GA1A 2GQQA 4J19A 2HDCA 2QKMB 1YYVA 1GXPA 5A2QK 2Z2SB 2JA7J 2K9QA 3BDDA 2JTVA 3E0JB 1R6RA 1T0FC 4LLNA 4G8XA 1ZARA 2AS5F 1WVRA 2JWTA 1REPC 4G94A 5FKMA 4RGSA 3CCUI 3DEUA 1DUXC 3QPTA 5AONA 3DFGA 2KRCA 4GCVA 5FKLA 1A5JA 5JI6A 4ASNA 1E3OC 2V1UA 1BOAA 4IQJA 1S8NA 2VXZA 3KEQA 5J6XA 2OZUA 5FFZA 3V8KA 1MBFA 3VPRA 4ZYDA 3S15J 2XKPA 3OIQA 4MEYF 2P6TA 3MFKA 1ODDA 3HM5A 3U1KA 4GFBA 1R00A 2JVHA 3JW4A 3GXOA 1K6YA 2QSFX 2XDVA 1O3RA 2ZMEB 5IYBJ 4AIHA 3TW7A 3HPHA 1V5GA 3CLOA 4LK1F 1F1ZA 1X1DA 3F6VA 3DEWA 4PJ0C 4BXUA 2ELHA 5DYMA 2LH9A 3IKVA 1LVKA 1RPWA 1MSFC 4KICA 2FBHA 4AD9A 1FSEA 6PAXA 1BR1A 4IO9F 1JHFA 4L5IA 4KMFA 2IW5A 4F93B 3A01A 3RDIA 4LITA 1ZK8A 3BQYA 3J81K 1D5VA 2H1KA 5E1WA 2HKXA 2HWVA 2Y9YA 4CCMA 4CYCB 3TL4X 4B3XA 4JX5A 2UZKA 2KISA 4XKVA 5LHHA 3IV5A 2O61A 2CS3A 1IXRC 1LVAA 3FBNB 1R5GA 4JP0A 4A3GJ 1UHWA 2HVQA 4MQVA 1O3SA 1D8KA 4PCQA 3E6BA 1YO5C 2VIXA 3DLLF 2R5YA 4FTHA 1ZH5A 1K4TA 2JN6A 2VN2A 5GAHJ 3LQRA 3MN2A 2O3FA 1FY7A 2CRGA 4M9SA 5KAIC 4E7SA 4LGWA 2XGXA 4JQFA 2LG4A 4D1QA 2CGPA 2X9DA 5J40A 3GZNB 3MZ8A 2JZYA 3LSGA 1WPKA 4CCNA 2VC1A 3H0GJ 3FXQA 4RS8A 4E7LA 2CV0A 3CC7I 4BUPA 1QHGA 3JTGA 3T1BA 2K3FA 2BYVE 1PVEA 4NUBA 1B72B 2R5ZB 3IP4B 1KQ8A 2K86A 3WG7H 1SD4A 2EZIA 2F5CA 2UXXA 4OAYA 4IHWA 3MMYB 3WHBA 1U0JA 4A3MJ 3CMAI 4BQAA 5FD6A 4KN4X 1NG6A 3QPHA 4HDUA 2B9SA 3S32A 1B59A 3SDGA 4EJVA 4RDUA 2E60A 2DI3A 2NYXA 4Z2YA 2FNPA 5J1YA 3GYHX 5L3FA 2F5EA 2UXNA 1AKHB 1W7PA 2M30A 1ETYA 2HTJA 2JA2A 4A3DJ 4XR6A 2GIVA 3GCMA 3A0BC 1LKXA 1TWAJ 2DT6A 1XPXA 3K70D 3JRAA 1JKOC 5ILUA 2DA7A 3U21A 2XASA 2F48A 5EG0B 1LEAA 1AHDP 3DEEA 3WU2C 1FT9A 2FJ1A 4ZYEA 4DZJA 3RPUD 3QPLA 3ZRGA 2RC4A 2QEXI 5EF6A 3C7JA 4UXNA 3RYRA 5M5XJ 4P9UA 3ZPLA 3DF8A 2NVQJ 2Z99A 2KLOA 2BOLA 4M3DA 4O6JA 4Y4RA 3M9AA 2X1EA 1XB4A 3LSKA 3DQVC 3H1CA 5E1XA 1S3JA 3QYEA 3PSFA 3ZGKA 1FOWA 1Z3XA 2DA2A 2YUSA 3MWMA 3D5LA 4OOIA 3TQNA 1IXSB 5TGTA 2CFXA 1YITI 2JRMA 3TMOA 4HPQA 1UMQA 1PUFA 2G7UA 3ABKH 3JRCA 3LQQA 1JUSA 2BHZA 2L5QA 1WGXA 2TRTA 4BDZA 1LFUP 5FRMA 1WFXA 2GOXB 2RNJA 2HQAA 4DNCA 1MJ9A 2YU9J 3T0YA 1GXQA 2R7FA 2WAQA 1VQ5I 4Y3OA 1N75A 1P92A 1RC9A 2K85A 3TP3A 5ERIA 4I09A 3MZHA 1LDJA 3A0HC 1XGSA 4NNJA 1SD7A 1TNTA 2ADUA 2YS9A 3CCYA 3REOA 3KYLA 1D0ZA 2D45A 2E1OA 4M71A 2K40A 2DAOA 3EPZA 1OYYA 3NWTA 5C4XJ 3IHUA 2L9SA 3GUDA 3J81Z 1T8IA 2JT1A 5GPAA 3H36A 3M8JA 1N25A 3F8MA 1BJAA 4LB6B 3S93A 5E3OA 3HOSA 2EZHA 2A69F 2BV6A 2BXYA 3EUHC 2QBYA 2K3PA 3H5AA 4DYRA 4IHSA 1TW2A 2BW3A 2WBMA 3CLQA 1DP7P 3TOAA 2TDXA 5CQGA 2DA4A 3I5UA 2DODA 3OOPA 5CYVA 2GIZA 4EJUA 1MNEA 2QQ9A 5HDKA 2N8GA 1T6SA 4XSXF 4Q5SF 2E2IJ 1XMAA 1Z05A 4PJLA 1NG7A 3JCUC 1T38A 4F7ZA 3BG5A 2Y0SA 3TGNA 1YJNI 1WJAA 3LAPA 2Z16A 5F08A 4KISA 1HXDA 1QBJA 2VE8A 3DPLC 2OV7A 3I4PA 3VODA 1I6HJ 2PMHA 3K0LA 4BGDA 2XAQA 5LGNA 3GTLJ 3FDYA 2Y48A 4XNFA 1TWHJ 2NS7A 2CQNA 1T33A 4UUSA 4U87A 5C44J 4A0YA 2A68F 2DLLA 2WAFA 1DU6A 3T8RA 1ORKA 1H8AC 3RPQA 4ZDLA 1LFBA 2NVTJ 4RB3C 2V1XA 1LFPA 3FXRA 2EFQA 3M8FA 3JRIA 4O3MA 2OAZA 4O5VA 4XORA 5IY5H 4B3AA 3E6CC 5M3MJ 3H5NA 3P9IA 2X4HA 3HKZN 1QZZA 5TJJA 3BG7A 2NRAC 3BQZA 3E7LA 4ESFA 2DW4A 4RAFA 3ZMUA 4ENNA 3JRGA 2E2HJ 3V42A 3EUHA 5M5YJ 3LSRA 3ZMTA 3OS1A 4CCKA 3C2GA 1JUMA 1X4OA 2XRNA 3RSNA 3MZYA 2W4SA 2HOSA 4H4KC 4L9VA 2X1DA 1X1AA 3GLXA 4A93J 1WH7A 3HOWJ 1JHHA 2WY7Q 4MFDA 4IQ4A 4XLHA 2WAQN 1K78A 1KONA 4KMUX 2MFZA 3OS2A 1Y39A 4CGZA 4FX4A 1LDDA 4I2OA 1UG2A 3I0TA 2XAJA 4H0EA 1GV5A 4LG0A 4B47A 4WCGA 2CQ7A 2RV8A 1RKTA 1VQ9I 4YIIA 1OCOH 2CUEA 5FGMA 3BTLA 1N78A 4BE0A 1QO0D 1WKMA 2HOAA 3BP8A 2W1OA 2FXAA 3K4MA 3ASNH 2W25A 4F91B 1L0OC 4RB0A 2X1CA 1FSHA 1OCTC 2KKOA 2XUBA 3WTXC 4L9NA 2PJRB 2CQXA 4Y7NJ 3RQ4A 3U1DA 1EV7A 1T56A 4RB2C 1ON1A 2W82A 3C18A 4V2FA 1LNWA 4KIBA 1U5TC 1UG0A 3E3VA 1IDYA 2IRFG 3E97A 2V1DA 2PI0A 3GX4X 2ZXJA 3UKGA 2VBZA 1NHAA 4RM3A 1LJ9A 2VBXA 2XB5A 3TP0A 5ILVA 3ZQFA 4G7OF 1YJ9I 2E5NA 4EVIA 1MBJA 4IVNA 3BC8A 1O3QA 3A4CA 4HRIA 4GGGA 2CW8A 1LPQA 1EKEA 2ECCA 1I5ZA 1OPCA 2LYCA 2V4JC 5KAFC 2I5UA 2WTEA 4BDYA 2Y2ZA 4A3LJ 4WK8F 2ID6A 2Z1DA 3BTJA 1W0TA 4M3BA 3L2QA 5D5WB 5K1YA 1GDTA 1O7LA 1RR8C 2KDOA 5B66C 3W2VA 4E7KA 3GFLA 3ZMZA 2WWYA 3RCOA 4IKFA 2DXIA 4QWQA 3LNQA 2Z33A 4HLYA 1XS9A 2UV1A 3BPXA 1I3AA 4RGXA 5FO5A 3CUQB 4BYYA 5DM6F 1I6XA 2E19A 1FYLA 3VSLA 5JHFA 4P1WA 4EJTA 4L0YB 5CLSA 2MH2A 3L00A 3OYEA 2WADA 1UB9A 2XROA 1P7JA 2ZC2A 1JUPA 3B02A 3KPHA 4IXAA 3VSKA 1TL8A 2L9VA 4L0ZB 2WB1N 3JRFA 2GWRA 3BOQA 2ZMEC 4J01A 3JREA 4V19K 1B9MA 1W7PB 1X1PA 4DGWB 1FC3A 3GTGJ 3BCBA 4G6TB 4HLXA 1FIPA 2K02A 3R61A 2HOEA 5JFRA 3F0CA 3F22A 4ENKA 2KZGA 1D0XA 5B1AH 2L9NA 1HW1A 3E1SA 4M9ZA 2DTZA 5KK1A 2EZKA 3DBRB 3HG9A 1R36A 2M9HA 2RAEA 2MLGA 4S04A 2PMZN 3I55I 2R93J 4XLNF 2M4GA 3KYDB 4AIJA 3CCMI 3EYYA 1U5TA 1W1WE 5EZGA 1WJ5A 3GBGA 5EZHA 3RIRA 3L2UA 1A36A 2DPUA 2LY2A 3KLOA 3CC2I 2X6YA 4HQMA 2VQGA 5HDGA 4C2MJ 3OSGA 4E4HA 3ZQLA 4ESBA 3IAM2 2W85A 3W2WA 3AL0C 1DP3A 4PJNA 3S1NJ 2H8RA 3OYAA 4MTEA 4BAYA 2DCEA 1YE9A 3I71A 3H9GA 3IWZA 3SFZA 2VKVA 3S1QJ 4C9YA 4Y15A 1U2WA 1G3YA 4HNVA 4B4CA 2JSCA 5JR3A 4PSWA 1AA7A 1YIJI 2LF8A 2FRHA 2KMUA 2LK2A 5HVQC 4KIGA 5F04A 4I7HA 4BEHB 1ZKGA 2JUCA 2XPWA 4RAZA 3K4KA 4XLCA 1IDZA 5FLVA 3CP8A 3OIPA 4XRMA 3DPTA 1V4RA 4OMYA 1WHUA 3OL3A 2MA3A 4M6YA 3WE3A 2XAUA 3VWBA 1IRZA 3M07A 5TRDA 1S9HA 1TQIA 2VKEA 1G3SA 5L3CA 3C3WA 3OYBA 5CKTA 4PGHA 1KYZA 2HXOA 2IVMA 2KFDA 1FYMA 4KT5C 5CQEA 2FBKA 1EF4A 3GWZA 3M8EA 2CUJA 2M34A 2H94A 1YIOA 4BKXA 2EZLA 3CMMA 3PNTA 2A5YB 2VI6A 3BTIA 2QQAA 2STTA 2XIGA 3L7WA 3WGGA 3IUOA 3SZPA 5DUIA 2XAFA 3DTIA 4XOTA 2CJJA 5HS8A 2L7FP 1P9QC 1WI9A 1WJCA 3HRSA 2KHMA 3KZZA 3RZOJ 1TT5B 4BU2A 4A3IJ 2OC6A 1W4MA 1P4XA 2CG4A 4DZPA 5FJ8J 2L4MA 5BNGA 2HNHA 3PIOF 1E3PA 3O8GA 1GLNA 4PUSA 5E79C 3W6VA 2LBFA 3HUGB 2KJCA 4CZCA 1X2NA 2ZXWH 3SDBA 2XAGA 1J7KA 2L54A 1TP4A 1JTYA 2ZJ2A 3G1OA 4HA8A 4FCYA 1R1VA 1HSTA 2R0QC 1P2FA 2K9LA 4XKCA 4LLLA 4BHPA 1T98A 1ETOA 4CSWA 2Y0MA 5DDGA 4WXHA 4G6DA 4HF1A 1Y0NA 3SXYA 2IS1A 3P9CA 5D5XB 4M3FA 1TT0A 4IRGA 2H09A 3J80Z 3KP7A 5FLMJ 2KIMA 2M2EA 1XDUA 3RKQA 2BVMA 1S7AA 1XCBA 3JSOA 3M1EA 4XLPF 3FBIB 1B72A 1HKSA 4A69C 1F43A 1FIAA 2BE5F 3RJPA 2M8EA 3HIFA 3T5XA 1SAXA 3OYIA 1FBUA 3N4MA 1GV2A 2MGQA 4HNTA 3DP7A 2F4IA 1VQ8I 4IHXA 3AKZA 2JJ7A 1UAAA 4HX8A 2EINH 4BQQA 2VQHA 1TW3A 2VXDA 1MBKA 2X51A 2ZCWA 3EETA 3E5QA 3R60A 3CESA 3H5RA 1P6RA 4MEXF 4E7ZA 2QM3A 2P5LC 1FMVA 4NBQA 5L3GA 1R49A 2XVCA 1AKHA 4B44A 1AU7A 3WTUC 3TOBA 3TDZC 3LA2A 4CCOA 1P4AA 1W5CC 2ZFWA 1SD6A 4ENJA 2EFOA 5D5VB 5LHGA 4KJZA 4YFXF 5B5EC 5GTIC 3ZQHA 5L3EA 2CWEA 5J8CA 4ZYAA 1K61A 1JKPC 3J7AO 5FFXA 3JRBA 3OR1C 1FOKA 3Q0UA 5FKKA 1B8IA 1RKWA 2M7AA 5JVGF 4II2A 5K7HA 2IGNA 1W36D 3HUGA 2LBFB 3O3KA 1FNNA 3ML6A 1IGNA 3HOVJ 3SYTA 2LVSA 4HSTA 1B6AA 5JLWA 2F6CA 5M5WJ 2D1VA 1G3TA 2XGDA 4CCLA 2EJRA 4N9HA 2PJRA 3WG9A 1XGOA 1Y8QB 1HBXG 3WU1B 2QCOA 3HHGA 2XRLA 2CV2A 3O6BB 4K2EA 1SFXA 3KP5A 1BR4A 5IT9K 5EGOB 1MKMA 4Q4ZF 2M7BA 3NRVA 3ERED 2XB0X 4KT6A 5AIPA 2PLYA 4OMZA 4N4NB 5HODA 1VFCA 2P7VB 1YI2I 1MMGA 2AO9A 2BW3B 1OKRA 2JUGA 3H92A 1JKRC 3CC4I 3M3YJ 3CP2A 2MLKA 4CHUA 1BJZA 3VYRB 2B7EA 2FMLA 1NH3A 1BC8C 1MSEC 3EYIA 1P7IA 2VT3A 2R7QA 2WV1A 1TWGJ 3B73A 2ESNA 3HB9A 1ZELA 3GFJA 4XL9A 5ED4A 2DU9A 4AWXB 2P6SA 4UV9A 3ZQIA 3K1NA 3VYUB 3FKJA 3SZGA 3IC7A 4I02A 2EH3A 2M0MA 3FM3A 3Q9SA 2VODA 1STZA 2M8GX 2PFBA 1YRNB 3LSMA 1R1TA 2NS0A 5HOOA 1MBEA 1YOVB 4HEA2 5GAEJ 2ZO4A 3E5UA 2CQQA 2OU2A 4LD5A 1XTAA 1CQTA 3HTSB 4A6EA 2HVRA 3SEZA 1ACIA 5HLIA 4GYGA 2QGUA 4BE2A 4N0BA 3FX3A 1XSXA 2E1NA 2LP0A 1R5ID 3CQZJ 2MBFA 1DGRM 4UB6C 2R5ZA 3VDXA 1TBXA 5F27A 4D9JA 1KZHA 1U9NA 3I9V2 3ZN0A 2NOJB 4D5FA 1OISA 3I59B 1W5TA 1IJWC 2GOMA 2O8KA 2R7UA 3FISA 3S3OA 2OCEA 2I10A 4XKBA 3MKWB 5C4JJ 4P9FA 2K9NA 2MC3A 4RA2A 1R22A 3QRFF 2KP6A 3CF5F 3VYSB 2OTLI 5M3FJ 2CFOA 2Q2EA 3F3XA 1IAWA 2VJJA 2WAEA 3QOEA 2BZTA 3FXLA 1HLVA 1RIOH 2COBA 4YEJA 1CF7A 3BZCA 1U5TB 1ZG3A 2HZTA 1TLHB 4OU0A 4OINF 3W6KB 3AG3H 2DT5A 3K2ZA 1TWCJ 2FQ3A 3LWFA 1F9NA 5EG0A 4UUSB 2IS6A 3CD6I 3OS0A 4PSXA 5EEGA 3ZQQA 1KU3A 2ZKZA 1FBQA 1RESA 2AXTC 2QKLB 2BGCA 1BA5A 2YR2A 4NQWB 2QA4I 2O6GE 4U7BA 1BW5A 3PFYA 5TISC 3BG9A 1S29A 1SFOJ 3AG1H 4KIFA 2O5RA 4KNYA 2IJLA 1WCMJ 3Q0VA 2DO7A 2RREA 4ZTFA 3LAJA 4QSHA 2EFWA 1EH6A 1VQOI 5F1JA 4NHJA 4M73A 5GTHC 2E34A 2R7SA 3WU0A 1L3LA 2QQBA 2GM4A 4CH7A 3U9GA 1JTXA 3SZTA 3T8TA 3QP6A 5D4SA 3BJ6A 2H27A 5ICFA 2NOGA 4DW6A 2EFPA 1F36A 1MMDA 2O7OA 2WB1A 5E17F 2JA8J 1I1GA 5JLXA 3R6SA 4AIKA 2XKOA 2FE3A 2K4JA 3GTJJ 1S5LC 2RGVA 1LE8A 5IP7J 2O0YA 2KZVA 4RM2A 3GLLA 2XV4S 1Z3YA 3L2WA 2ZBKA 1E3HA 3QYFA 4IOCF 1E0EA 2LKPA 2OF7A 3I59A 3BR5A 1XGNA 2DOAA 3N97A 3S3MA 2K27A 2PMZA 4ZDOA 2HI3A 4ZZDA 4JYKA 3D5SC 1K6OA 5J3LA 5LHIA 3GEZA 3S8PA 1YX3A 1MDMB 4OIRF 3FMQA 4C3IJ 2W48A 3S2HJ 2Z5UA 2L7KA 3CDLA 1C0WA 1Z77A 2DA3A 3GTQJ 3PO2J 1Y0UA 4HX7A 2QYOA 3WODF 3GTOJ 1KYWA 3S16J 1SMYF 2KQRA 2LLKA 4M3GA 1R9TJ 5FROA 5K5OA 3G3ZA 2UUZA 3HSRA 1K79A 3BR2A 2GAUA 2R7XA 2LF7A 4I01A 1QGPA 5HS7A 2YX4A 2RDPA 5LEJA 2DQLA 5IPAA 2L0KA 2LKXA 2GA2A 5DCMB 2OZ6A 1E17A 1UHMA 1I39A 5F0FA 2AHQA 4JX6A 3K6GA 4P96A 3OR2C 1TC3C 4RMNA 1HSJA 2JA6J 3ERMA 2EIMH 2WV0A 3HZJA 4BHBA 4DBRA 3VEPA 2XC7A 4BACA 2E5ZA 5GPCA 1SFEA 2ZMEA 2BBYA 5KNLA 3ZQGA 4RGRA 4WF2A 2JRTA 1RUOA 1ITYA 4DJAA 4N9IA 4P5OA 4ZZLA 2E2JJ 2IGKA 5FB2A 2JA5J 2BY1A 3HHHA 3HBLA 1KU9A 2NVYJ 1VF9A 2F5DA 2X85A 2M1BA 2CQKA 4CA0A 1Z6RA 3F8FA 3S14J 1HQCA 2IEKA 3QPSA 3R4KA 4X6AJ 1ZGJA 1ZR2A 2FOWA 4FE4A 2A5WA 4E70A 4ZC3A 3CMEI 2FNAA 3Q3SA 2VQCA 4YG2F 4B1RA 3ZMDA 1LQ1A 3MVPA 1Y56A 1MJAA 1GUUA 2XF5A 1J9IA 2P7CB 4MHGA 3LSJA 4CO8A 4MIMA 3I3LA 1T08B 1DU0A 2W24A 3HGGA 3JAMK 2L7ZA 2IXSA 2VL8A 2LTPA 2QLZA 1Q1HA 3CF2A 1VNDA 3A02A 3CO7C 5DEQA 1BW6A 4HV5A 4UVBA 4D7MA 3JTHA 3GFIA 3E5XA 1Z6TA 4MQ9F 4G7ZF 2XSJC 2HFHA 2FQ4A 2KRFA 2QVOA 3ZOBA 5K7ZA 1I3QJ 1UELB 4U0VA 3C2BA 3KEOA 3BLYA 3EQLF 4MNUA 1K78B 4C2UA 1XMKA 1S72I 2P4WA 3MKYB 1H9GA 2Z9OA 3QU6A 2FD5A 3ZN1A 2HQNA 3V8JA 2V26A 3OSFA 2EA2A 1MZBA 5DUKA 5GADJ 4FQGA 2MABA 1PYVA 2MD0A 1BOBA 1IF1A 2L4AA 4OIOF 2FX0A 3H3VK 2AXLA 1HOMA 4XOPA 1VI0A 3RTRA 2OPTA 2F5VA 5ICCA 5A2QZ 2QWWA 2HQRA 4BEHA 3V7RA 3KP2A 1FWZA 4RB1A 1XSDA 5L3BA 2GZWA 1MMNA 2K4BA 3HOZJ 2DFIA 4KITB 3QODA 1VQKI 3L2RA 2L9RA 3BJAA 1TQMA 1D3YA 2Q1ZB 4FT8A 4XN0A 4AYBA 2NNNA 4EJWA 1BL0A 2DJNA 3K4NA 3BROA 3CUQC 3SHFA 2EV6A 2HYGD 2Y0SN 2F4OB 4HF0A 1KQ0A 4XLEA 2HKOA 3HOXJ 2BY0A 3CO6C 3RKXA 2V79A 3WTVC 1IRFA 2IA0A 4X0GA 2E1MB 4L5JA 2DYSH 2DK5A 1ZREA 1IZ1A 3VB2A 3CCEI 3FMSA 5BPIA 3GO5A 4LG3A 1HDPA 2NVUB 1SANA 4A3KJ 5J1UA 4ZYGA 1W7PD 1YLFA 5IYCJ 1FP2A 4JOMA 3HGYA 2XHKA 4ZH4F 4UV8A 1J59A 1QRYA 2V7FA 4XLAA 3KETA 3F23A 4ETSA 4GRIA 4CYDA 1SFUA 2OA4A 3ZCOA 4DYQA 4L9TA 3PUFA 1QQIA 3COAC 3MQ0A 3AL0B 4HYEA 1ZG5A 4Y13A 1U8BA 1BI1A 3L09A 1DPUA 4FHTA 3PQJA 2EIKH 1OJLA 1ERDA 2PN6A 2ZJRF 1JJ6C 4NB5A 3HKZA 2EB7A 1IN6A 1R4MB 3DWLE 2A05A 1ZRCA 1S7OA 1JGSA 5HS9A 3TKYA 4S0HB 4AVZA 1I50J 3CTAA 3FXMA 3ZP5A 4NDLA 3BG3A 4A3EJ 3HTUA 3CDHA 3GW2A 1IN7A 2EILH 1AWCA 5F6FA 3WTYC 3DKWA 5E20A 2XAHA 1VQNI 3WTSC 3ABMH 2CW0F 3TO7A 1ZLJA 2GBYA 2ISYA 2FSWA 1G2HA 2JQ7A 3Q5FA 3C1DA 5CVJA 2VB6A 1B1BA 1V3FA 3MEXA 4Q48A 2ICWG 4LJZF 1QZYA 3MKLA 4UB8C 2VKHA 1IN8A 3IL2A 3GTPJ 3L9FA 1FPQA 1VQ4I 1ZGAA 3ZXSA 1UHSA 2Y69H 4ZJZA 1WQ2A 2NXNB 3IH4A 4LK0F 1O4XA 4BBRJ 4QTRA 2HXIA 3DKYA 4BL0B 4IPAA 3KIOA 3LMMA 1RUNA 1OR7A 1U78A 2PX9A 4A3BJ 3NWSA 5DS9A 3O8HA 2CV1A 4W97A 1JGGA 2LRDA 2D5VA 4OIQF 2OTJI 2DBBA 4CXFA 4BXXJ 5DTDA 4EGYA 1SEUA 3K4LA 2V9VA 4A3CJ 3DTEA 3PJRA 2R7RA 3PFIA 3F6OA 3TW6A 3I56I 3ABLH 3BR1A 5BS6A 2ZSIB 3FM5A 1H89C 4YIFA 5KHDA 1O57A 4XSZF 1R4NB 3G73A 4ANJA 4IEJA 1POGA 5K5RA 1HA8A 3FXOA 3DBHB 3HEFA 2DN0A 3GF2A 1EH8A 3OYKA 2R92J 1ULYA 2MH9A 3BJOA 5LFAA 4EJOA 4EGZA 3CCJI 5H20A 3TBIA 1QHHD 4I0BA 3BR6A 4HSRA 3G1LA 4CUGA 5E8IA 2VPRA 1Y6IA 2ZFUA 5LEKA 2Y31A 1DGWY 3EUAA 1BC7C 3J7ZI 1F5TA 2DOEA 3S1MJ 2CSOA 1MDMA 1KU2A 3B6CA 2P8TA 3KX2A 2DA5A 4GYIA 4XRSA 4XBFA 5EGOA 3MCZA 1X3WB 5D6FA 2P5VA 2M45A 3S17J 1LB2A 4ABZA 4EV0A 2F2EA 4LIVA 1MNDA 4YRVA 4Y17A 2M87A 2KIQA 4BS9A 3OYHA 1IUFA 1A04A 2PJPA 2R7WA 1IUYA 3PSIA 1W5SA 3BR3A 3QQAA 1NK2P 2HR3A 2DA1A 4P55A 1T95A 5D6EA 2ESHA 3JRHA 3SEQA 4KA4A 2JPCA 3OYDA 1AOYA 4LG0B 4L9JA 1PP8F 2HYJA 2EV5A 2L3DA 1TZLA 4AYBN 1DPRA 3BG6A 2B63J 1MJBA 3J80K 4PDKA 2KIFA 5E8GA 4YELA 3CCSI 2QQ8A 4F92B 4ZTJA 1V5EA 2ECBA 2IS4A 3G2BA 1OLTA 2BVLA 4AC0A 2VC0A 3RKYA 1ZGWA 2R7TA 4F55A 1IV6A 3BT9A 5FLXZ 2H1LA 3S1RJ 4IOAF 3V4GA 3FHZA 2DFEA 2G0EA 3KEYA 3HL2A 3NEUA 2LFBA 3OY9A 3H35A 4IF4A 4A0XA 5IYDJ 3FK7A 4A0ZA 4QPQA 2XPUA 4L5EA 2W57A 2ZJPF 4XMYA 4E6KG 3HSFA 3O2PE 4JK1X 2CU7A 1G59A 2CH0A 1D8JA 5F64A 3HOYJ 4IZZA 3M7GA 5B1BH 2RQQA 3KYCB 1CGPA 4BJTA 3CMYA 5JVTA 2LSOA 3I4NJ 1SC7A 1MGTA 5CJ9A 5L3DA 4FASD 1RRJA 1U6GA 4II3A 2LD5A 5H6RA 3FKIJ 2KDZA 4XICA 3BPVA 4B43A 3S2WA 3ELKA 2COMA 2IBDA 3MAJA 1CF7B 3AAFA 4V2GA 2QSGX 5H2FC 4HX4A 4I76A 1UCRA 2A6TA 2FUG2 5K7FA 5D4RA 2DJIA 5DCFA 4JBAA 3S2DJ 3BR0A 3HC7A 2O8XA 3F8BA 3K9TA 4B48A 3WE2A 3RZDJ 4DQ2A 4AU7A 2KPMA 5ICGA 4W1UA 2PEXA 3OL4A 4YIRX 4ZDPA 2MC4A 1HDDC 3HPGA 1Z0XA 4LLGF 5D8LB 1WJFA 1PJRA 3R0JA 4C30A 3NQOA 3I54A 3OYNA 2ZSHB 3FXUA 2VJIA 2Y9ZA 2BY2A 4HV6A 1UZCA 3W2AA 4ENMA 5HLHA 2I8DA 1EH7A 2KIUA 3LFKA 1P4WA 1BBYA 4HG2A 4UHTA 5EEHA 2XF7A 4BNCA 4F52A 2IT0A 2KL4A 2J5PA 1NK3P 5IP6A 4EATA 1SAUA 4UUTA 1J5YA 4IHYA 2V9KA 2CMPA 2Y75A 3A01B 2BY3A 1N77A 2QZ8A 3G71I 5LLQA 2E71A 4HZFA 2J5OA 4BJ5C 1A6QA 1MMAA 1E2XA 2HYFA 3E6DA 3G1MA 3DKXA 5J4VA 1D5YA 1SVMA 1GHCA 1B4AA 1JI8A 5H6QA 1T0FA 4YFNF 1ZQ3P 1MH4A 1XG1A 3GTKJ 2XSDC 5E3MA 1USTA 1R7JA 2JK3A 5FKOA 1XCVA 3GFMA 5DCMA 2W84A 3LA3A 3AFHA 4IHVA 3HJEA 3OOUA 2ACJA 2C6YA 3K7AJ 1VQ6I 1G3WA 2Y30A 1HW5A 5IOYA 3K69A 4R8HA 2F5FA 3ECHA 4U88A 5HLGA 4HDVA 2ISZA 1RI7A 3WTWC 4M9XA 4AIDA 4I6ZA 1HCRA 3TO9A 2LREA 3IH3A 4BQOA 5D5UB 4I98B 2A07F 2ME6A 1JXSA 1KQ9A 2HDDA 2XF6A 1ZG1A 1QNTA 4LOCA 4N4OB 4ON0A 1SMTA 5CVRA 4J00A 2WC2A 1OCZH 4DIQA 1MIJA 2MYSA 1XX5A 5E3NA 3WGIA 3FXJA 1RR7A 2L7MP 3H9JA 3G6EI 2DMUA 1B9NA 1XMXA 5J1RA 3D5RC 3CCRI 1IW7F 3HDDA 2IS2A 1KU7A 5BOXA 4XONA 3KE2A 4HBLA 1WZ2A 3HOUJ 2A6EF 4OWRB 3BY6A 4KN7X 3PIPF 1APLC 1A6IA 3FWEA 1IN4A 2VLAA 1O7FA 2IGMA 4WX9A 5B3SH 5CPRB 1MW7A 1BI2A 2W7NA 4B09A 2DPDA 3IKTA 3M1CA 2KT0A 1ENHA 3K70C 1U8RA 4Y52J 4E7HA 3ISPA 2DOFA 2M0CA 3WHCA 4MLOA 2OCCH 3KLNA 3L2VA 2VOPA 1I1SA 4RLQA 2QENA 1Z21A 2X0LA 5DM7F 4XLFA 1UFMA 3OWTA 2MSYA 1BR2A 2XPVA 3ECOA 2EBIA 1WJDA 2A3SA 1G8XA 3LSTA 2JPBA 5DD8A 5K5QA 1T39A 3CJRB 3R0AA 3CUQA 1F4KA 1LEBA 2RN7A 1FTTA 1HC8A 1DQUA 1I27A 3CUOA 4ESJA 1FOYA 2PQ8A 4G6QA 5HNHA 2EV0A 5E18F 4A3FJ 3H3UA 2DMNA 5J47A 2Q0OA 2HEOA 4GO1A 2P5KA 1BI0A 4R1HA 2DYRH 5IP9J 1IXCA 2R3SA 3V7CA 2CYYA 2Z3YA 4UUVA 3RKWA 2P81A 1BIBA 2E7WA 1FMWA 2HTSA 1FYKA 1PUFB 3CCQI 3JSPA 2HVSA 4I0AA 5IT9Z 4XK4A 1RETA 5CVIA 2IAIA 2H6CA 2NNYA 1BI3A 3P7NA 1GVDA 4Z6YA 4QLCU 4OAZA 2G9WA 1OCPA 3EUKL 2K9MA 3V7SA 3CZ6A 3LA7A 3TDUC 4U0YA 1TQPA 2V1NA 4JX4A 1OFCX 2VE9A 5FLXK 4HF2A 3OYLA 2PMUA 2IA2A 1KGSA 2X6XA 3K4JA 1ZRDA 4OIPF 1D1AA 3F8NA 3KZIC 4HAMA 1RZ4A 1X1BA 2M5WA 2A61A 2VBWA 2JMWA 3DCFA 2GXGA 2VONA 1FP1D 1V5FA 2R5YB 4UNOA 2LNBA 4AM3A 5CVVA 4PFPA 3JRDA 4KFCA 2P0WA 5ILSA 2DT7B 3CJQB 1X3ZB 4QPOA 3SQNA 1YFHA 3GTMJ 2OJED 5J8FA 2NVXJ 2NAZA 1YTYA 3KP3A 4HOBA 3C2HA 1XD7A 2G7HA 4CYCA 5F0CA 1OQYA 3ONQA 1W0UA 1X19A 2YU3A 4A3JJ 1YQAA 3VYTB 1YJWI 2BHYA 3PL8A 1BIAA 1TTYA 4NC8A 1IG7A 4M6XA 2HQ5A 2VKDA 5LRRA 1HKQA 1OCRH 1UJ8A 3IRQA 1T2KA 2MG4A 2W00A 2AQEA 2F4MB 2TCTA 5GP9A 2B0LA 4PJJA 1ZHFA 4IRHA 1YW9A 4IX7A 3V8LA 4IL6C 2STWA 4PZJA 1IO2A 1WWXA 3N05A 2QUFA 3F72A 3IRRA 4UVAA 2YPRA 2KJBA 3BZKA 4BY7J 1WH5A 3PNYA 3NARA 4YFKF 1O3TA 3CJNA 1PUEE 4WWCA 4G7HF 4M6VA 3PM1A 1ZTRA 2O9LA 1S7EA 5JHUA 3F21A 4LFUA 2FMYA 1SFKA 2BEOA 2FOKA 2OQGA 1OR7C 2RKHA 1R5HA 2VJ5A 3BZ6A 4A5NA 2R7DA 3DV8A 4WXDA 2VBYA 3P9KA 2L01A 1VQMI 4LB5A 4XIDA 9ANTA 1ZRFA 2L02A 2LKSA 3HRMA 3NAUA 5D8KB 1VZ0A 1ZN2A 1R23A 3X2QH 3GMEA 3PUBA 2EK5A 1YS6A 4QIWN 3CCLI 4EEFG 4A2UA 1H88C 4U0WA 3FK6A 1OMIA 3L1PA 1ETQA 3OYGA 5LGUA 2JSPA 3WGHA 1R71A 1LDKB 4BH9A 3W3CA 1X4PA 2KRHA 4XRFA 1ETWA 4EM2A 2EFNA 4CZZA 2DFFA
chains in the Genus database with same CATH topology
3KZYA 1G4DA 4IRIA 4MTDA 5KVRA 1R1UA 2DTRA 3E6MA 3RPUA 1Z7UA 5BQTA 3WTTC 3QOPA 1HKTA 4FX0A 2V6CA 1G6NA 1K7AA 4BHCA 2PBIA 4LMYA 5LRSA 3RYPA 3I58A 2OD5A 2ZNZA 3HOTA 1JE8A 3EDPA 1YW7A 2FF4A 5IT3A 3I64A 3QU3A 3KP6A 3ZMVA 1BN5A 4D0PA 2FEZA 3F8CA 2GXBA 2Q8KA 4A12A 5CVUA 1YG2A 1FZPB 1PDNC 3JAMZ 4NQWA 1GVJA 3KFWX 5AIQA 2OQRA 4EQQA 5HDNA 1X3UA 2HGCA 2EWNA 2DK8A 2LDUA 4ZYHA 1FBSA 2QBYB 3WTZA 4A5MA 3D0SA 4M72A 5DV5A 1XSVA 5BPDA 1PP7U 2K7LA 3GZ5A 4IJAA 4CICA 1QPMA 4B8XA 2ETHA 1XDSA 3TO6A 3H3ZA 3W6JB 5F1RA 2FU4A 3VFZA 1Z9CA 5LGTA 2E7XA 4GXOA 3KP4A 4KDPA 3K1MA 2A6HF 1ZLKA 4KYWA 4UVCA 4EM1A 3FZVA 3IWFA 5BMZA 1H0MA 2YX7A 1ON2A 3OV8A 5ICEA 1XN7A 1MD0A 4RGUA 4R79A 1WRJA 3VOEA 2PG4A 5LBQA 4MGRA 4EM0B 2D1HA 3U2RA 5FD5A 3FF5A 1SD5A 2RQPA 2DQRA 1USSA 1HW2A 1TNSA 4EMSA 3GVAA 3HYIA 1FX7A 1DDNA 4G9YA 5E1ZB 2UWMA 4TV7A 2IA1A 3ZQ7A 1J2XA 2E1CA 2H6BA 4CDGA 3L2CA 1ZYRF 3ABUA 2ZNYA 4S05A 3BWGA 4HW0A 3HRUA 3PQKA 4M74A 2MD5A 2IPQX 4PGGA 1Z1DA 4A6DA 4L18B 3I53A 3ABTA 1VTNC 4KUMA 3HRTA 5DD4A 2CO5A 1R58A 4WXCA 2IP2A 1IRGA 3K1PA 2HS5A 2O03A 2YSRA 1FLIA 4HQEA 1RNLA 4AVPA 1OYWA 2VOOA 4U7DA 1U3EM 2D2WA 1J0RA 3QAHA 3QP5A 3ROUA 2FA5A 3ULQB 2VT2A 2OBPA 3GZ6A 2EA4A 3RI4A 3Q9VA 4RAYA 1H9TA 3ZMSA 4IHTA 3KCCA 1OYIA 1XGMA 3DXJF 1ONVA 2FBIA 1J75A 2RVCA 4Q47A 3HSEA 1KA8A 1ZAOA 1Z91A 1YS7A 1S6LA 1WSUA 1YW8A 1BM9A 1IN5A 3FMRA 2GA1A 2GQQA 2HDCA 1YYVA 1GXPA 5A2QK 3BDDA 2JTVA 4LLNA 4G8XA 1ZARA 2AS5F 1REPC 4G94A 4RGSA 1DUXC 3DEUA 3QPTA 5AONA 3DFGA 4GCVA 5JI6A 4ASNA 2V1UA 1BOAA 1S8NA 2VXZA 3KEQA 5J6XA 2OZUA 5FFZA 3V8KA 4ZYDA 2XKPA 4MEYF 3MFKA 2P6TA 1ODDA 1R00A 3JW4A 3GXOA 1O3RA 2ZMEB 4AIHA 3CLOA 4LK1F 1F1ZA 3F6VA 4BXUA 2ELHA 5DYMA 3IKVA 4KICA 2FBHA 4AD9A 1FSEA 6PAXA 1JHFA 4L5IA 4KMFA 2IW5A 3RDIA 1D5VA 3J81K 5E1WA 2HKXA 2HWVA 2UZKA 5LHHA 2O61A 1IXRC 1LVAA 1R5GA 1UHWA 4MQVA 1O3SA 1D8KA 4PCQA 3E6BA 1YO5C 1ZH5A 2VN2A 3LQRA 2O3FA 1FY7A 4M9SA 4LGWA 2XGXA 4JQFA 2CGPA 2JZYA 2VC1A 3FXQA 4RS8A 3JTGA 3T1BA 2BYVE 1KQ8A 2K86A 1SD4A 2F5CA 2UXXA 4BQAA 5FD6A 4KN4X 3QPHA 4HDUA 4EJVA 1B59A 2DI3A 2NYXA 4Z2YA 2FNPA 3GYHX 5L3FA 2F5EA 2UXNA 1W7PA 2M30A 2HTJA 2GIVA 5ILUA 2XASA 1LEAA 1FT9A 4ZYEA 2RC4A 3C7JA 4UXNA 3RYRA 4P9UA 3ZPLA 3DF8A 2Z99A 4O6JA 3M9AA 1XB4A 3DQVC 5E1XA 1S3JA 3MWMA 3D5LA 4OOIA 3TQNA 1IXSB 2CFXA 2G7UA 3LQQA 2RNJA 4DNCA 1MJ9A 3T0YA 1GXQA 2R7FA 1P92A 5ERIA 4I09A 3MZHA 1LDJA 1XGSA 1SD7A 1TNTA 2ADUA 3REOA 2D45A 4M71A 2DAOA 1OYYA 3IHUA 3GUDA 3J81Z 2JT1A 3F8MA 1BJAA 4LB6B 3HOSA 2A69F 2BV6A 2QBYA 4IHSA 1TW2A 1DP7P 3TOAA 2TDXA 3I5UA 3OOPA 5CYVA 4EJUA 2QQ9A 5HDKA 1T6SA 4XSXF 4Q5SF 1XMAA 1Z05A 1T38A 4F7ZA 3TGNA 3LAPA 1HXDA 1QBJA 2VE8A 3DPLC 3VODA 3I4PA 2PMHA 3K0LA 2XAQA 5LGNA 2Y48A 4A0YA 2A68F 2DLLA 3T8RA 3RPQA 4RB3C 2V1XA 3FXRA 2EFQA 3M8FA 4O3MA 2OAZA 4O5VA 3E6CC 3P9IA 2X4HA 2NRAC 1QZZA 5TJJA 4ENNA 4ESFA 2DW4A 3ZMUA 3EUHA 3ZMTA 2XRNA 3MZYA 4L9VA 3GLXA 1JHHA 1K78A 4KMUX 4CGZA 4FX4A 1LDDA 4I2OA 3I0TA 2XAJA 4H0EA 4LG0A 4WCGA 2RV8A 4YIIA 5FGMA 1QO0D 1WKMA 3BP8A 2FXAA 2W25A 1L0OC 4RB0A 1FSHA 2KKOA 2XUBA 3WTXC 4L9NA 3U1DA 1EV7A 4RB2C 1ON1A 3C18A 1LNWA 4KIBA 1U5TC 3E3VA 2IRFG 3E97A 2V1DA 2PI0A 3GX4X 2ZXJA 2VBZA 1NHAA 1LJ9A 2VBXA 5ILVA 4G7OF 4EVIA 4IVNA 1O3QA 4GGGA 1I5ZA 1OPCA 2WTEA 4WK8F 5D5WB 5K1YA 1O7LA 3GFLA 3ZMZA 2WWYA 4QWQA 2Z33A 4HLYA 3BPXA 4RGXA 5FO5A 3CUQB 4BYYA 1I6XA 1FYLA 4EJTA 4L0YB 5CLSA 2MH2A 3L00A 1UB9A 2XROA 4L0ZB 3B02A 4IXAA 2GWRA 3BOQA 2ZMEC 1B9MA 1W7PB 1FC3A 4HLXA 2K02A 3R61A 2HOEA 5JFRA 3F22A 4ENKA 1HW1A 4M9ZA 5KK1A 1R36A 2MLGA 4S04A 4XLNF 4AIJA 3EYYA 1U5TA 3RIRA 2DPUA 3KLOA 4HQMA 5HDGA 4ESBA 2W85A 4MTEA 4BAYA 3I71A 3IWZA 3SFZA 4Y15A 1U2WA 1G3YA 2JSCA 5JR3A 2LF8A 2FRHA 5HVQC 4KIGA 4I7HA 4RAZA 3DPTA 1V4RA 4OMYA 2MA3A 4M6YA 3WE3A 5TRDA 1TQIA 1G3SA 5L3CA 3C3WA 4PGHA 1KYZA 2IVMA 1FYMA 4KT5C 2FBKA 3GWZA 3M8EA 2H94A 1YIOA 2A5YB 2QQAA 2STTA 2XIGA 3L7WA 3WGGA 3SZPA 5DUIA 2XAFA 5HS8A 1WI9A 3HRSA 3KZZA 1W4MA 1P4XA 2CG4A 2L4MA 2KJCA 2XAGA 1J7KA 2L54A 2ZJ2A 4HA8A 1R1VA 1HSTA 1P2FA 4LLLA 4BHPA 1T98A 2Y0MA 5DDGA 4WXHA 4HF1A 4G6DA 3SXYA 3P9CA 5D5XB 4IRGA 2H09A 3J80Z 3KP7A 2KIMA 1XDUA 1S7AA 1XCBA 3JSOA 3M1EA 4XLPF 1HKSA 2BE5F 3RJPA 2M8EA 3HIFA 3T5XA 1SAXA 1FBUA 3N4MA 3DP7A 4HX8A 1TW3A 2ZCWA 3EETA 3E5QA 3R60A 1P6RA 4MEXF 2QM3A 2P5LC 5L3GA 2XVCA 3WTUC 3TOBA 3TDZC 3LA2A 1P4AA 2ZFWA 1SD6A 4ENJA 2EFOA 5D5VB 5LHGA 4YFXF 5L3EA 2CWEA 5J8CA 3J7AO 5FFXA 1FOKA 3HUGA 3O3KA 1FNNA 3ML6A 1B6AA 2D1VA 1G3TA 2EJRA 4N9HA 3WG9A 1XGOA 1HBXG 3WU1B 3HHGA 3O6BB 4K2EA 1SFXA 3KP5A 5IT9K 1MKMA 4Q4ZF 3NRVA 3ERED 5AIPA 2PLYA 4OMZA 2P7VB 1OKRA 3H92A 2MLKA 4CHUA 2FMLA 1BC8C 3EYIA 2VT3A 3B73A 2ESNA 3GFJA 5ED4A 2DU9A 4AWXB 2P6SA 4UV9A 3K1NA 3IC7A 4I02A 3FM3A 3Q9SA 2VODA 1STZA 2PFBA 1R1TA 2NS0A 5HOOA 2ZO4A 3E5UA 2OU2A 4LD5A 3HTSB 4A6EA 5HLIA 4GYGA 4N0BA 3FX3A 1XSXA 2E1NA 2MBFA 1TBXA 3ZN0A 3I59B 1W5TA 4P9FA 2MC3A 1R22A 3QRFF 2Q2EA 3F3XA 1IAWA 1RIOH 1CF7A 1U5TB 1ZG3A 2HZTA 1TLHB 4OU0A 4OINF 3W6KB 2DT5A 3K2ZA 3LWFA 2FQ3A 1F9NA 5EEGA 1KU3A 2ZKZA 1FBQA 2BGCA 2YR2A 2O6GE 4U7BA 1S29A 4KIFA 4KNYA 2IJLA 2DO7A 3LAJA 2EFWA 1EH6A 4NHJA 4M73A 1L3LA 3WU0A 2QQBA 3U9GA 3SZTA 3T8TA 3QP6A 5D4SA 3BJ6A 2H27A 5ICFA 2EFPA 5E17F 1I1GA 3R6SA 4AIKA 2XKOA 2FE3A 2K4JA 2RGVA 2O0YA 2XV4S 2ZBKA 2LKPA 3I59A 1XGNA 3N97A 2K27A 1K6OA 4ZZDA 5LHIA 3GEZA 1MDMB 4OIRF 3FMQA 2Z5UA 1C0WA 1Y0UA 4HX7A 2QYOA 3WODF 1KYWA 1SMYF 5K5OA 3G3ZA 3HSRA 1K79A 2GAUA 2LF7A 4I01A 1QGPA 5HS7A 2YX4A 2RDPA 5LEJA 2DQLA 2GA2A 5DCMB 2OZ6A 1E17A 1UHMA 4P96A 1HSJA 4BHBA 2WV0A 3VEPA 1SFEA 2ZMEA 2BBYA 4RGRA 4WF2A 2JRTA 1RUOA 4N9IA 4P5OA 4ZZLA 5FB2A 3HHHA 1KU9A 2F5DA 2M1BA 2CQKA 1Z6RA 3F8FA 1HQCA 3R4KA 1ZGJA 4E70A 2FNAA 4YG2F 3ZMDA 1LQ1A 1J9IA 1MJAA 2P7CB 4MHGA 4CO8A 2W24A 3JAMK 2QLZA 1Q1HA 3CO7C 5DEQA 4HV5A 4UVBA 3JTHA 3GFIA 3E5XA 1Z6TA 4MQ9F 4G7ZF 2HFHA 2KRFA 2QVOA 4U0VA 3KEOA 3EQLF 4MNUA 1K78B 1XMKA 2P4WA 1H9GA 2Z9OA 3QU6A 3ZN1A 2HQNA 3V8JA 2EA2A 1MZBA 5DUKA 1IF1A 2L4AA 4OIOF 2AXLA 3RTRA 5ICCA 5A2QZ 2QWWA 2HQRA 3V7RA 3KP2A 1FWZA 4RB1A 1XSDA 5L3BA 2GZWA 2K4BA 2DFIA 3BJAA 1TQMA 1D3YA 4FT8A 4EJWA 2NNNA 3BROA 3CUQC 3SHFA 2EV6A 2HYGD 4HF0A 1KQ0A 2HKOA 3CO6C 3RKXA 2V79A 3WTVC 1IRFA 2IA0A 4L5JA 2DK5A 1ZREA 1IZ1A 3VB2A 3FMSA 5BPIA 3GO5A 4ZYGA 1W7PD 1YLFA 1FP2A 2XHKA 4ZH4F 4UV8A 1J59A 3F23A 3KETA 4ETSA 4CYDA 1SFUA 2OA4A 4L9TA 1QQIA 3COAC 3MQ0A 4HYEA 1ZG5A 4Y13A 1BI1A 3L09A 1DPUA 4FHTA 3PQJA 2PN6A 4NB5A 2EB7A 1IN6A 1ZRCA 1S7OA 1JGSA 5HS9A 3TKYA 3CTAA 3ZP5A 3HTUA 3CDHA 3GW2A 1IN7A 1AWCA 5F6FA 3WTYC 3DKWA 5E20A 2XAHA 3WTSC 2CW0F 3TO7A 1ZLJA 2ISYA 2FSWA 3Q5FA 3C1DA 5CVJA 1B1BA 1V3FA 3MEXA 4Q48A 4LJZF 1QZYA 1IN8A 3IL2A 3L9FA 1FPQA 1ZGAA 1WQ2A 4LK0F 4IPAA 1RUNA 1U78A 1OR7A 4OIQF 2DBBA 4CXFA 4EGYA 2V9VA 3PFIA 3F6OA 5BS6A 3FM5A 4YIFA 1O57A 4XSZF 3G73A 5K5RA 3GF2A 1EH8A 1ULYA 2MH9A 3BJOA 4EJOA 4EGZA 5H20A 4I0BA 5E8IA 5LEKA 1BC7C 1F5TA 2CSOA 1MDMA 1KU2A 2P8TA 4GYIA 4XBFA 3MCZA 5D6FA 2P5VA 2M45A 1LB2A 4EV0A 2F2EA 4Y17A 2M87A 2PJPA 1A04A 1IUYA 1W5SA 2HR3A 4P55A 5D6EA 2ESHA 4KA4A 2JPCA 1AOYA 4LG0B 4L9JA 1PP8F 2EV5A 2L3DA 1DPRA 1MJBA 3J80K 4PDKA 2KIFA 5E8GA 2VC0A 3RKYA 5FLXZ 3V4GA 3FHZA 3NEUA 4IF4A 4A0XA 4A0ZA 2W57A 3HSFA 3O2PE 4JK1X 1D8JA 5F64A 3M7GA 1CGPA 5JVTA 2LSOA 1MGTA 5CJ9A 5L3DA 1U6GA 5H6RA 3BPVA 3S2WA 3ELKA 2COMA 3MAJA 1CF7B 3AAFA 4HX4A 1UCRA 5D4RA 5DCFA 4JBAA 2O8XA 3F8BA 3K9TA 3WE2A 4DQ2A 5ICGA 2PEXA 4LLGF 5D8LB 3R0JA 3NQOA 3I54A 3FXUA 4HV6A 4ENMA 5HLHA 1EH7A 2KIUA 3LFKA 1P4WA 1BBYA 4UHTA 5EEHA 4BNCA 2IT0A 2J5PA 1J5YA 2Y75A 2QZ8A 5LLQA 4HZFA 2J5OA 1E2XA 2HYFA 3E6DA 1GHCA 1B4AA 5H6QA 1T0FA 4YFNF 1USTA 1R7JA 1XCVA 3GFMA 5DCMA 2W84A 3LA3A 2ACJA 2C6YA 1G3WA 1HW5A 3K69A 4R8HA 2F5FA 2ISZA 3ECHA 4U88A 5HLGA 4HDVA 1RI7A 3WTWC 4M9XA 3TO9A 5D5UB 4I98B 2A07F 1JXSA 1KQ9A 1ZG1A 1QNTA 4ON0A 1SMTA 5CVRA 2WC2A 3WGIA 1B9NA 1IW7F 1KU7A 5BOXA 3KE2A 4HBLA 2A6EF 3BY6A 4KN7X 3FWEA 1IN4A 1O7FA 4WX9A 1BI2A 4B09A 2DPDA 3IKTA 1U8RA 3ISPA 3KLNA 2VOPA 1I1SA 2QENA 2X0LA 1UFMA 3ECOA 2A3SA 3LSTA 2JPBA 5DD8A 5K5QA 1T39A 3R0AA 3CUQA 1F4KA 1LEBA 2RN7A 1I27A 3CUOA 4ESJA 2PQ8A 4G6QA 2EV0A 5E18F 3H3UA 2Q0OA 2HEOA 4GO1A 2P5KA 1BI0A 4R1HA 1IXCA 2R3SA 3V7CA 2CYYA 2Z3YA 4UUVA 3RKWA 1BIBA 2E7WA 2HTSA 1FYKA 5IT9Z 3JSPA 4I0AA 2NNYA 5CVIA 2H6CA 1BI3A 3P7NA 4QLCU 2G9WA 3V7SA 3LA7A 3TDUC 4U0YA 1TQPA 2VE9A 5FLXK 4HF2A 2PMUA 2IA2A 1KGSA 1ZRDA 4OIPF 3F8NA 4HAMA 1RZ4A 2M5WA 2A61A 2VBWA 2GXGA 2VONA 1FP1D 4UNOA 2LNBA 5CVVA 4KFCA 5ILSA 1YFHA 3SQNA 5J8FA 2NAZA 1YTYA 3KP3A 4HOBA 1XD7A 2G7HA 2YU3A 1YQAA 1BIAA 1TTYA 4M6XA 5LRRA 1HKQA 3IRQA 1T2KA 2B0LA 1ZHFA 4IRHA 1YW9A 3V8LA 2STWA 4PZJA 1WWXA 2QUFA 3F72A 3IRRA 4UVAA 2YPRA 2KJBA 4YFKF 1O3TA 3CJNA 1PUEE 4WWCA 4G7HF 5JHUA 3F21A 4LFUA 2FMYA 2BEOA 2FOKA 2OQGA 2RKHA 1R5HA 3BZ6A 4A5NA 2R7DA 3DV8A 4WXDA 2VBYA 3P9KA 2L01A 4LB5A 1ZRFA 2L02A 3HRMA 5D8KB 1ZN2A 1R23A 2EK5A 1YS6A 4A2UA 4U0WA 1OMIA 5LGUA 3WGHA 1LDKB 4BH9A 4XRFA 4EM2A 2EFNA 4CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZY A;  1G4D A;  4IRI A;  4MTD A;  5KVR A;  1R1U A;  2DTR A;  3E6M A;  3RPU A;  1Z7U A;  5BQT A;  3WTT C;  3QOP A;  1HKT A;  4FX0 A;  2V6C A;  1G6N A;  1K7A A;  4BHC A;  2PBI A;  4LMY A;  5LRS A;  3RYP A;  3I58 A;  2OD5 A;  2ZNZ A;  3HOT A;  1JE8 A;  3EDP A;  1YW7 A;  2FF4 A;  5IT3 A;  3I64 A;  3QU3 A;  3KP6 A;  3ZMV A;  1BN5 A;  4D0P A;  2FEZ A;  3F8C A;  2GXB A;  2Q8K A;  4A12 A;  5CVU A;  1YG2 A;  1FZP B;  1PDN C;  3JAM Z;  4NQW A;  1GVJ A;  3KFW X;  5AIQ A;  2OQR A;  4EQQ A;  5HDN A;  1X3U A;  2HGC A;  2EWN A;  2DK8 A;  2LDU A;  4ZYH A;  1FBS A;  2QBY B;  3WTZ A;  4A5M A;  3D0S A;  4M72 A;  5DV5 A;  1XSV A;  5BPD A;  1PP7 U;  2K7L A;  3GZ5 A;  4IJA A;  4CIC A;  1QPM A;  4B8X A;  2ETH A;  1XDS A;  3TO6 A;  3H3Z A;  3W6J B;  5F1R A;  2FU4 A;  3VFZ A;  1Z9C A;  5LGT A;  2E7X A;  4GXO A;  3KP4 A;  4KDP A;  3K1M A;  2A6H F;  1ZLK A;  4KYW A;  4UVC A;  4EM1 A;  3FZV A;  3IWF A;  5BMZ A;  1H0M A;  2YX7 A;  1ON2 A;  3OV8 A;  5ICE A;  1XN7 A;  1MD0 A;  4RGU A;  4R79 A;  1WRJ A;  3VOE A;  2PG4 A;  5LBQ A;  4MGR A;  4EM0 B;  2D1H A;  3U2R A;  5FD5 A;  3FF5 A;  1SD5 A;  2RQP A;  2DQR A;  1USS A;  1HW2 A;  1TNS A;  4EMS A;  3GVA A;  3HYI A;  1FX7 A;  1DDN A;  4G9Y A;  5E1Z B;  2UWM A;  4TV7 A;  2IA1 A;  3ZQ7 A;  1J2X A;  2E1C A;  2H6B A;  4CDG A;  3L2C A;  1ZYR F;  3ABU A;  2ZNY A;  4S05 A;  3BWG A;  4HW0 A;  3HRU A;  3PQK A;  4M74 A;  2MD5 A;  2IPQ X;  4PGG A;  1Z1D A;  4A6D A;  4L18 B;  3I53 A;  3ABT A;  1VTN C;  4KUM A;  3HRT A;  5DD4 A;  2CO5 A;  1R58 A;  4WXC A;  2IP2 A;  1IRG A;  3K1P A;  2HS5 A;  2O03 A;  2YSR A;  1FLI A;  4HQE A;  1RNL A;  4AVP A;  1OYW A;  2VOO A;  4U7D A;  1U3E M;  2D2W A;  1J0R A;  3QAH A;  3QP5 A;  3ROU A;  2FA5 A;  3ULQ B;  2VT2 A;  2OBP A;  3GZ6 A;  2EA4 A;  3RI4 A;  3Q9V A;  4RAY A;  1H9T A;  3ZMS A;  4IHT A;  3KCC A;  1OYI A;  1XGM A;  3DXJ F;  1ONV A;  2FBI A;  1J75 A;  2RVC A;  4Q47 A;  3HSE A;  1KA8 A;  1ZAO A;  1Z91 A;  1YS7 A;  1S6L A;  1WSU A;  1YW8 A;  1BM9 A;  1IN5 A;  3FMR A;  2GA1 A;  2GQQ A;  2HDC A;  1YYV A;  1GXP A;  5A2Q K;  3BDD A;  2JTV A;  4LLN A;  4G8X A;  1ZAR A;  2AS5 F;  1REP C;  4G94 A;  4RGS A;  1DUX C;  3DEU A;  3QPT A;  5AON A;  3DFG A;  4GCV A;  5JI6 A;  4ASN A;  2V1U A;  1BOA A;  1S8N A;  2VXZ A;  3KEQ A;  5J6X A;  2OZU A;  5FFZ A;  3V8K A;  4ZYD A;  2XKP A;  4MEY F;  3MFK A;  2P6T A;  1ODD A;  1R00 A;  3JW4 A;  3GXO A;  1O3R A;  2ZME B;  4AIH A;  3CLO A;  4LK1 F;  1F1Z A;  3F6V A;  4BXU A;  2ELH A;  5DYM A;  3IKV A;  4KIC A;  2FBH A;  4AD9 A;  1FSE A;  6PAX A;  1JHF A;  4L5I A;  4KMF A;  2IW5 A;  3RDI A;  1D5V A;  3J81 K;  5E1W A;  2HKX A;  2HWV A;  2UZK A;  5LHH A;  2O61 A;  1IXR C;  1LVA A;  1R5G A;  1UHW A;  4MQV A;  1O3S A;  1D8K A;  4PCQ A;  3E6B A;  1YO5 C;  1ZH5 A;  2VN2 A;  3LQR A;  2O3F A;  1FY7 A;  4M9S A;  4LGW A;  2XGX A;  4JQF A;  2CGP A;  2JZY A;  2VC1 A;  3FXQ A;  4RS8 A;  3JTG A;  3T1B A;  2BYV E;  1KQ8 A;  2K86 A;  1SD4 A;  2F5C A;  2UXX A;  4BQA A;  5FD6 A;  4KN4 X;  3QPH A;  4HDU A;  4EJV A;  1B59 A;  2DI3 A;  2NYX A;  4Z2Y A;  2FNP A;  3GYH X;  5L3F A;  2F5E A;  2UXN A;  1W7P A;  2M30 A;  2HTJ A;  2GIV A;  5ILU A;  2XAS A;  1LEA A;  1FT9 A;  4ZYE A;  2RC4 A;  3C7J A;  4UXN A;  3RYR A;  4P9U A;  3ZPL A;  3DF8 A;  2Z99 A;  4O6J A;  3M9A A;  1XB4 A;  3DQV C;  5E1X A;  1S3J A;  3MWM A;  3D5L A;  4OOI A;  3TQN A;  1IXS B;  2CFX A;  2G7U A;  3LQQ A;  2RNJ A;  4DNC A;  1MJ9 A;  3T0Y A;  1GXQ A;  2R7F A;  1P92 A;  5ERI A;  4I09 A;  3MZH A;  1LDJ A;  1XGS A;  1SD7 A;  1TNT A;  2ADU A;  3REO A;  2D45 A;  4M71 A;  2DAO A;  1OYY A;  3IHU A;  3GUD A;  3J81 Z;  2JT1 A;  3F8M A;  1BJA A;  4LB6 B;  3HOS A;  2A69 F;  2BV6 A;  2QBY A;  4IHS A;  1TW2 A;  1DP7 P;  3TOA A;  2TDX A;  3I5U A;  3OOP A;  5CYV A;  4EJU A;  2QQ9 A;  5HDK A;  1T6S A;  4XSX F;  4Q5S F;  1XMA A;  1Z05 A;  1T38 A;  4F7Z A;  3TGN A;  3LAP A;  1HXD A;  1QBJ A;  2VE8 A;  3DPL C;  3VOD A;  3I4P A;  2PMH A;  3K0L A;  2XAQ A;  5LGN A;  2Y48 A;  4A0Y A;  2A68 F;  2DLL A;  3T8R A;  3RPQ A;  4RB3 C;  2V1X A;  3FXR A;  2EFQ A;  3M8F A;  4O3M A;  2OAZ A;  4O5V A;  3E6C C;  3P9I A;  2X4H A;  2NRA C;  1QZZ A;  5TJJ A;  4ENN A;  4ESF A;  2DW4 A;  3ZMU A;  3EUH A;  3ZMT A;  2XRN A;  3MZY A;  4L9V A;  3GLX A;  1JHH A;  1K78 A;  4KMU X;  4CGZ A;  4FX4 A;  1LDD A;  4I2O A;  3I0T A;  2XAJ A;  4H0E A;  4LG0 A;  4WCG A;  2RV8 A;  4YII A;  5FGM A;  1QO0 D;  1WKM A;  3BP8 A;  2FXA A;  2W25 A;  1L0O C;  4RB0 A;  1FSH A;  2KKO A;  2XUB A;  3WTX C;  4L9N A;  3U1D A;  1EV7 A;  4RB2 C;  1ON1 A;  3C18 A;  1LNW A;  4KIB A;  1U5T C;  3E3V A;  2IRF G;  3E97 A;  2V1D A;  2PI0 A;  3GX4 X;  2ZXJ A;  2VBZ A;  1NHA A;  1LJ9 A;  2VBX A;  5ILV A;  4G7O F;  4EVI A;  4IVN A;  1O3Q A;  4GGG A;  1I5Z A;  1OPC A;  2WTE A;  4WK8 F;  5D5W B;  5K1Y A;  1O7L A;  3GFL A;  3ZMZ A;  2WWY A;  4QWQ A;  2Z33 A;  4HLY A;  3BPX A;  4RGX A;  5FO5 A;  3CUQ B;  4BYY A;  1I6X A;  1FYL A;  4EJT A;  4L0Y B;  5CLS A;  2MH2 A;  3L00 A;  1UB9 A;  2XRO A;  4L0Z B;  3B02 A;  4IXA A;  2GWR A;  3BOQ A;  2ZME C;  1B9M A;  1W7P B;  1FC3 A;  4HLX A;  2K02 A;  3R61 A;  2HOE A;  5JFR A;  3F22 A;  4ENK A;  1HW1 A;  4M9Z A;  5KK1 A;  1R36 A;  2MLG A;  4S04 A;  4XLN F;  4AIJ A;  3EYY A;  1U5T A;  3RIR A;  2DPU A;  3KLO A;  4HQM A;  5HDG A;  4ESB A;  2W85 A;  4MTE A;  4BAY A;  3I71 A;  3IWZ A;  3SFZ A;  4Y15 A;  1U2W A;  1G3Y A;  2JSC A;  5JR3 A;  2LF8 A;  2FRH A;  5HVQ C;  4KIG A;  4I7H A;  4RAZ A;  3DPT A;  1V4R A;  4OMY A;  2MA3 A;  4M6Y A;  3WE3 A;  5TRD A;  1TQI A;  1G3S A;  5L3C A;  3C3W A;  4PGH A;  1KYZ A;  2IVM A;  1FYM A;  4KT5 C;  2FBK A;  3GWZ A;  3M8E A;  2H94 A;  1YIO A;  2A5Y B;  2QQA A;  2STT A;  2XIG A;  3L7W A;  3WGG A;  3SZP A;  5DUI A;  2XAF A;  5HS8 A;  1WI9 A;  3HRS A;  3KZZ A;  1W4M A;  1P4X A;  2CG4 A;  2L4M A;  2KJC A;  2XAG A;  1J7K A;  2L54 A;  2ZJ2 A;  4HA8 A;  1R1V A;  1HST A;  1P2F A;  4LLL A;  4BHP A;  1T98 A;  2Y0M A;  5DDG A;  4WXH A;  4HF1 A;  4G6D A;  3SXY A;  3P9C A;  5D5X B;  4IRG A;  2H09 A;  3J80 Z;  3KP7 A;  2KIM A;  1XDU A;  1S7A A;  1XCB A;  3JSO A;  3M1E A;  4XLP F;  1HKS A;  2BE5 F;  3RJP A;  2M8E A;  3HIF A;  3T5X A;  1SAX A;  1FBU A;  3N4M A;  3DP7 A;  4HX8 A;  1TW3 A;  2ZCW A;  3EET A;  3E5Q A;  3R60 A;  1P6R A;  4MEX F;  2QM3 A;  2P5L C;  5L3G A;  2XVC A;  3WTU C;  3TOB A;  3TDZ C;  3LA2 A;  1P4A A;  2ZFW A;  1SD6 A;  4ENJ A;  2EFO A;  5D5V B;  5LHG A;  4YFX F;  5L3E A;  2CWE A;  5J8C A;  3J7A O;  5FFX A;  1FOK A;  3HUG A;  3O3K A;  1FNN A;  3ML6 A;  1B6A A;  2D1V A;  1G3T A;  2EJR A;  4N9H A;  3WG9 A;  1XGO A;  1HBX G;  3WU1 B;  3HHG A;  3O6B B;  4K2E A;  1SFX A;  3KP5 A;  5IT9 K;  1MKM A;  4Q4Z F;  3NRV A;  3ERE D;  5AIP A;  2PLY A;  4OMZ A;  2P7V B;  1OKR A;  3H92 A;  2MLK A;  4CHU A;  2FML A;  1BC8 C;  3EYI A;  2VT3 A;  3B73 A;  2ESN A;  3GFJ A;  5ED4 A;  2DU9 A;  4AWX B;  2P6S A;  4UV9 A;  3K1N A;  3IC7 A;  4I02 A;  3FM3 A;  3Q9S A;  2VOD A;  1STZ A;  2PFB A;  1R1T A;  2NS0 A;  5HOO A;  2ZO4 A;  3E5U A;  2OU2 A;  4LD5 A;  3HTS B;  4A6E A;  5HLI A;  4GYG A;  4N0B A;  3FX3 A;  1XSX A;  2E1N A;  2MBF A;  1TBX A;  3ZN0 A;  3I59 B;  1W5T A;  4P9F A;  2MC3 A;  1R22 A;  3QRF F;  2Q2E A;  3F3X A;  1IAW A;  1RIO H;  1CF7 A;  1U5T B;  1ZG3 A;  2HZT A;  1TLH B;  4OU0 A;  4OIN F;  3W6K B;  2DT5 A;  3K2Z A;  3LWF A;  2FQ3 A;  1F9N A;  5EEG A;  1KU3 A;  2ZKZ A;  1FBQ A;  2BGC A;  2YR2 A;  2O6G E;  4U7B A;  1S29 A;  4KIF A;  4KNY A;  2IJL A;  2DO7 A;  3LAJ A;  2EFW A;  1EH6 A;  4NHJ A;  4M73 A;  1L3L A;  3WU0 A;  2QQB A;  3U9G A;  3SZT A;  3T8T A;  3QP6 A;  5D4S A;  3BJ6 A;  2H27 A;  5ICF A;  2EFP A;  5E17 F;  1I1G A;  3R6S A;  4AIK A;  2XKO A;  2FE3 A;  2K4J A;  2RGV A;  2O0Y A;  2XV4 S;  2ZBK A;  2LKP A;  3I59 A;  1XGN A;  3N97 A;  2K27 A;  1K6O A;  4ZZD A;  5LHI A;  3GEZ A;  1MDM B;  4OIR F;  3FMQ A;  2Z5U A;  1C0W A;  1Y0U A;  4HX7 A;  2QYO A;  3WOD F;  1KYW A;  1SMY F;  5K5O A;  3G3Z A;  3HSR A;  1K79 A;  2GAU A;  2LF7 A;  4I01 A;  1QGP A;  5HS7 A;  2YX4 A;  2RDP A;  5LEJ A;  2DQL A;  2GA2 A;  5DCM B;  2OZ6 A;  1E17 A;  1UHM A;  4P96 A;  1HSJ A;  4BHB A;  2WV0 A;  3VEP A;  1SFE A;  2ZME A;  2BBY A;  4RGR A;  4WF2 A;  2JRT A;  1RUO A;  4N9I A;  4P5O A;  4ZZL A;  5FB2 A;  3HHH A;  1KU9 A;  2F5D A;  2M1B A;  2CQK A;  1Z6R A;  3F8F A;  1HQC A;  3R4K A;  1ZGJ A;  4E70 A;  2FNA A;  4YG2 F;  3ZMD A;  1LQ1 A;  1J9I A;  1MJA A;  2P7C B;  4MHG A;  4CO8 A;  2W24 A;  3JAM K;  2QLZ A;  1Q1H A;  3CO7 C;  5DEQ A;  4HV5 A;  4UVB A;  3JTH A;  3GFI A;  3E5X A;  1Z6T A;  4MQ9 F;  4G7Z F;  2HFH A;  2KRF A;  2QVO A;  4U0V A;  3KEO A;  3EQL F;  4MNU A;  1K78 B;  1XMK A;  2P4W A;  1H9G A;  2Z9O A;  3QU6 A;  3ZN1 A;  2HQN A;  3V8J A;  2EA2 A;  1MZB A;  5DUK A;  1IF1 A;  2L4A A;  4OIO F;  2AXL A;  3RTR A;  5ICC A;  5A2Q Z;  2QWW A;  2HQR A;  3V7R A;  3KP2 A;  1FWZ A;  4RB1 A;  1XSD A;  5L3B A;  2GZW A;  2K4B A;  2DFI A;  3BJA A;  1TQM A;  1D3Y A;  4FT8 A;  4EJW A;  2NNN A;  3BRO A;  3CUQ C;  3SHF A;  2EV6 A;  2HYG D;  4HF0 A;  1KQ0 A;  2HKO A;  3CO6 C;  3RKX A;  2V79 A;  3WTV C;  1IRF A;  2IA0 A;  4L5J A;  2DK5 A;  1ZRE A;  1IZ1 A;  3VB2 A;  3FMS A;  5BPI A;  3GO5 A;  4ZYG A;  1W7P D;  1YLF A;  1FP2 A;  2XHK A;  4ZH4 F;  4UV8 A;  1J59 A;  3F23 A;  3KET A;  4ETS A;  4CYD A;  1SFU A;  2OA4 A;  4L9T A;  1QQI A;  3COA C;  3MQ0 A;  4HYE A;  1ZG5 A;  4Y13 A;  1BI1 A;  3L09 A;  1DPU A;  4FHT A;  3PQJ A;  2PN6 A;  4NB5 A;  2EB7 A;  1IN6 A;  1ZRC A;  1S7O A;  1JGS A;  5HS9 A;  3TKY A;  3CTA A;  3ZP5 A;  3HTU A;  3CDH A;  3GW2 A;  1IN7 A;  1AWC A;  5F6F A;  3WTY C;  3DKW A;  5E20 A;  2XAH A;  3WTS C;  2CW0 F;  3TO7 A;  1ZLJ A;  2ISY A;  2FSW A;  3Q5F A;  3C1D A;  5CVJ A;  1B1B A;  1V3F A;  3MEX A;  4Q48 A;  4LJZ F;  1QZY A;  1IN8 A;  3IL2 A;  3L9F A;  1FPQ A;  1ZGA A;  1WQ2 A;  4LK0 F;  4IPA A;  1RUN A;  1U78 A;  1OR7 A;  4OIQ F;  2DBB A;  4CXF A;  4EGY A;  2V9V A;  3PFI A;  3F6O A;  5BS6 A;  3FM5 A;  4YIF A;  1O57 A;  4XSZ F;  3G73 A;  5K5R A;  3GF2 A;  1EH8 A;  1ULY A;  2MH9 A;  3BJO A;  4EJO A;  4EGZ A;  5H20 A;  4I0B A;  5E8I A;  5LEK A;  1BC7 C;  1F5T A;  2CSO A;  1MDM A;  1KU2 A;  2P8T A;  4GYI A;  4XBF A;  3MCZ A;  5D6F A;  2P5V A;  2M45 A;  1LB2 A;  4EV0 A;  2F2E A;  4Y17 A;  2M87 A;  2PJP A;  1A04 A;  1IUY A;  1W5S A;  2HR3 A;  4P55 A;  5D6E A;  2ESH A;  4KA4 A;  2JPC A;  1AOY A;  4LG0 B;  4L9J A;  1PP8 F;  2EV5 A;  2L3D A;  1DPR A;  1MJB A;  3J80 K;  4PDK A;  2KIF A;  5E8G A;  2VC0 A;  3RKY A;  5FLX Z;  3V4G A;  3FHZ A;  3NEU A;  4IF4 A;  4A0X A;  4A0Z A;  2W57 A;  3HSF A;  3O2P E;  4JK1 X;  1D8J A;  5F64 A;  3M7G A;  1CGP A;  5JVT A;  2LSO A;  1MGT A;  5CJ9 A;  5L3D A;  1U6G A;  5H6R A;  3BPV A;  3S2W A;  3ELK A;  2COM A;  3MAJ A;  1CF7 B;  3AAF A;  4HX4 A;  1UCR A;  5D4R A;  5DCF A;  4JBA A;  2O8X A;  3F8B A;  3K9T A;  3WE2 A;  4DQ2 A;  5ICG A;  2PEX A;  4LLG F;  5D8L B;  3R0J A;  3NQO A;  3I54 A;  3FXU A;  4HV6 A;  4ENM A;  5HLH A;  1EH7 A;  2KIU A;  3LFK A;  1P4W A;  1BBY A;  4UHT A;  5EEH A;  4BNC A;  2IT0 A;  2J5P A;  1J5Y A;  2Y75 A;  2QZ8 A;  5LLQ A;  4HZF A;  2J5O A;  1E2X A;  2HYF A;  3E6D A;  1GHC A;  1B4A A;  5H6Q A;  1T0F A;  4YFN F;  1UST A;  1R7J A;  1XCV A;  3GFM A;  5DCM A;  2W84 A;  3LA3 A;  2ACJ A;  2C6Y A;  1G3W A;  1HW5 A;  3K69 A;  4R8H A;  2F5F A;  2ISZ A;  3ECH A;  4U88 A;  5HLG A;  4HDV A;  1RI7 A;  3WTW C;  4M9X A;  3TO9 A;  5D5U B;  4I98 B;  2A07 F;  1JXS A;  1KQ9 A;  1ZG1 A;  1QNT A;  4ON0 A;  1SMT A;  5CVR A;  2WC2 A;  3WGI A;  1B9N A;  1IW7 F;  1KU7 A;  5BOX A;  3KE2 A;  4HBL A;  2A6E F;  3BY6 A;  4KN7 X;  3FWE A;  1IN4 A;  1O7F A;  4WX9 A;  1BI2 A;  4B09 A;  2DPD A;  3IKT A;  1U8R A;  3ISP A;  3KLN A;  2VOP A;  1I1S A;  2QEN A;  2X0L A;  1UFM A;  3ECO A;  2A3S A;  3LST A;  2JPB A;  5DD8 A;  5K5Q A;  1T39 A;  3R0A A;  3CUQ A;  1F4K A;  1LEB A;  2RN7 A;  1I27 A;  3CUO A;  4ESJ A;  2PQ8 A;  4G6Q A;  2EV0 A;  5E18 F;  3H3U A;  2Q0O A;  2HEO A;  4GO1 A;  2P5K A;  1BI0 A;  4R1H A;  1IXC A;  2R3S A;  3V7C A;  2CYY A;  2Z3Y A;  4UUV A;  3RKW A;  1BIB A;  2E7W A;  2HTS A;  1FYK A;  5IT9 Z;  3JSP A;  4I0A A;  2NNY A;  5CVI A;  2H6C A;  1BI3 A;  3P7N A;  4QLC U;  2G9W A;  3V7S A;  3LA7 A;  3TDU C;  4U0Y A;  1TQP A;  2VE9 A;  5FLX K;  4HF2 A;  2PMU A;  2IA2 A;  1KGS A;  1ZRD A;  4OIP F;  3F8N A;  4HAM A;  1RZ4 A;  2M5W A;  2A61 A;  2VBW A;  2GXG A;  2VON A;  1FP1 D;  4UNO A;  2LNB A;  5CVV A;  4KFC A;  5ILS A;  1YFH A;  3SQN A;  5J8F A;  2NAZ A;  1YTY A;  3KP3 A;  4HOB A;  1XD7 A;  2G7H A;  2YU3 A;  1YQA A;  1BIA A;  1TTY A;  4M6X A;  5LRR A;  1HKQ A;  3IRQ A;  1T2K A;  2B0L A;  1ZHF A;  4IRH A;  1YW9 A;  3V8L A;  2STW A;  4PZJ A;  1WWX A;  2QUF A;  3F72 A;  3IRR A;  4UVA A;  2YPR A;  2KJB A;  4YFK F;  1O3T A;  3CJN A;  1PUE E;  4WWC A;  4G7H F;  5JHU A;  3F21 A;  4LFU A;  2FMY A;  2BEO A;  2FOK A;  2OQG A;  2RKH A;  1R5H A;  3BZ6 A;  4A5N A;  2R7D A;  3DV8 A;  4WXD A;  2VBY A;  3P9K A;  2L01 A;  4LB5 A;  1ZRF A;  2L02 A;  3HRM A;  5D8K B;  1ZN2 A;  1R23 A;  2EK5 A;  1YS6 A;  4A2U A;  4U0W A;  1OMI A;  5LGU A;  3WGH A;  1LDK B;  4BH9 A;  4XRF A;  4EM2 A;  2EFN A;  4CZZ A; 
#chains in the Genus database with same CATH topology
 3KZY A;  4XRS G;  1G4D A;  2V6E A;  1A31 A;  4IRI A;  4MTD A;  1X2M A;  5KVR A;  1VQL I;  1R1U A;  2DTR A;  3E6M A;  3RPU A;  1Z7U A;  3A03 A;  1V55 H;  5EDN A;  3MKZ A;  5BQT A;  4DYC A;  2DDA A;  3WTT C;  5KCM A;  1J09 A;  3OIO A;  2EIJ H;  4DOZ A;  3QOP A;  1HKT A;  4FX0 A;  2V6C A;  1G6N A;  2HPM A;  3TED A;  1K7A A;  4BHC A;  2PBI A;  1YRN A;  1MBG A;  4LMY A;  3K4C A;  2E1M C;  5F0H A;  1SVL A;  5LRS A;  3RYP A;  3I58 A;  2OD5 A;  2AQF A;  2X48 A;  2ZNZ A;  2X6W A;  1EJ9 A;  2BXZ A;  2QSH X;  3J7A Y;  3HOT A;  1JE8 A;  4PK4 A;  3A1Y A;  4X1E A;  1XC5 A;  2CW7 A;  3EDP A;  2R7V A;  1YW7 A;  2K9S A;  1FTZ A;  2FF4 A;  5IT3 A;  3I64 A;  1NTC A;  2MW8 A;  3QU3 A;  1MNM C;  3KP6 A;  3ZMV A;  1BN5 A;  4D0P A;  2FEZ A;  3F8C A;  3LSH A;  2GLO A;  5EJC A;  3FIW A;  2GXB A;  2Q8K A;  2XGE A;  2HOT A;  3AG4 H;  4A12 A;  4ITV A;  5CVU A;  1YG2 A;  1FZP B;  3FHN A;  2LY9 A;  2ME0 A;  1PDN C;  3JAM Z;  2DFH A;  4NQW A;  1GVJ A;  3KFW X;  5AIQ A;  2Q2E B;  3AG2 H;  3DPU A;  5IOZ A;  4Y33 A;  2OQR A;  3ZR8 X;  4BXF A;  4EQQ A;  5HDN A;  3ZQC A;  1X3U A;  2HGC A;  3K4B A;  2EWN A;  1IV8 A;  1ETK A;  2DK8 A;  2ZJQ F;  2VUM J;  2LDU A;  4ZYH A;  1FBS A;  2DMP A;  2QBY B;  1Z67 A;  2R4G A;  2DMQ A;  3WTZ A;  3QYB A;  1SVO A;  4A5M A;  2ELJ A;  1Y1W J;  3D0S A;  4M72 A;  5GAG J;  5DV5 A;  1XSV A;  1Y1V J;  5BPD A;  2RNG A;  1PP7 U;  2K7L A;  3GZ5 A;  2HZD A;  2LOO A;  4IJA A;  1GT0 C;  1LE8 B;  1B8I B;  3LSP A;  1W36 C;  4CIC A;  1QPM A;  4MFE A;  4B8X A;  2ETH A;  1XDS A;  3TO6 A;  3H3Z A;  3W6J B;  5F1R A;  2FU4 A;  3DU6 A;  5HLT A;  4I99 C;  3VFZ A;  5LGT A;  2E7X A;  4E7J A;  1Z9C A;  3IH2 A;  4GXO A;  3KP4 A;  4KDP A;  3K1M A;  2A6H F;  3CJT B;  1ZLK A;  4M3E A;  4KYW A;  4UVC A;  4EM1 A;  1WI3 A;  3OYJ A;  4GDF A;  3FZV A;  1JT0 A;  1VQP I;  3IWF A;  2DMT A;  3IAS 2;  3OYM A;  2H8W A;  4BE1 A;  3DTK A;  1ETX A;  4RLF A;  4XN3 A;  3P5J A;  1OCC H;  5BMZ A;  1H0M A;  3SJM A;  2YX7 A;  1ON2 A;  3OV8 A;  4PFO A;  4FET A;  2K5C A;  5ICE A;  3H0D A;  1ZR4 A;  1XN7 A;  5FKN A;  3M4O J;  2HU9 A;  3B6A A;  1MD0 A;  4FE7 A;  4RGU A;  4R79 A;  4CCJ A;  1FOX A;  2ZXI A;  1WRJ A;  2CUF A;  3VOE A;  2PG4 A;  5LBQ A;  4MGR A;  4EM0 B;  4DBQ A;  3PO3 J;  2D1H A;  1D1B A;  1FJL A;  3U2R A;  5FD5 A;  5C3E J;  3FF5 A;  1IRX A;  1SD5 A;  2RQP A;  4F3Q A;  3BTC A;  2VPL A;  2DQR A;  3Q0W A;  1USS A;  4BJ6 C;  2QF7 A;  2ZB9 A;  3K10 A;  1HW2 A;  4BY1 J;  5FRN A;  1V54 H;  2R7Z J;  3DLA A;  3MD2 A;  1TNS A;  4XM3 A;  4BBS J;  4EMS A;  3GVA A;  3HYI A;  1FX7 A;  1DDN A;  4G9Y A;  5E1Z B;  2WA0 A;  4TV7 A;  2UWM A;  3ASO H;  2EQR A;  2IA1 A;  3LFU A;  4LIU A;  3ZQ7 A;  3ESW B;  1J2X A;  4NC7 A;  5E3L A;  2E1C A;  1QVT A;  3J7Y J;  1X1C A;  2H6B A;  4CDG A;  3L2C A;  1QU3 A;  2DDB A;  1A35 A;  1U9O A;  1ZYR F;  4C2T A;  3ABU A;  2ZNY A;  2X6O A;  3BWG A;  4HW0 A;  4S05 A;  5EYR A;  3H9Q A;  3HRU A;  1WJB A;  3UR3 C;  2XGC A;  1IC8 A;  3PQK A;  4M74 A;  2MD5 A;  1YHQ I;  2IPQ X;  3QWL A;  4PGG A;  1LUJ B;  1JT6 A;  1Z1D A;  4A6D A;  4L18 B;  1FEX A;  3I53 A;  3ABT A;  3G4S I;  1VTN C;  1QZE A;  3OYC A;  4BQN A;  2M3A A;  4KUM A;  1JKQ C;  4HNU A;  2JVG A;  3HRT A;  2GXA A;  5J4Y A;  5LD2 C;  2CUZ A;  2IGO A;  3UNG C;  3OYF A;  1QA6 A;  5DD4 A;  4AUX A;  1MH3 A;  2CO5 A;  1R58 A;  2L2O A;  4XQF A;  3CCV I;  4WXC A;  2ZXH A;  2IP2 A;  1Q1V A;  2LY1 A;  3LOC A;  3K1P A;  4G12 A;  1IRG A;  2HS5 A;  2O03 A;  2YSR A;  1FLI A;  4HQE A;  1RNL A;  4E7I A;  2LR8 A;  4AVP A;  3DBL B;  1OYW A;  2VOO A;  4XKW A;  3A2K A;  3K2A A;  1EA3 A;  4C3H J;  2EPF A;  2DA6 A;  4C3J J;  4U7D A;  2E35 A;  1U3E M;  2D2W A;  1QPI A;  3CDI A;  3LSI A;  1J0R A;  3QAH A;  2VQL A;  3QP5 A;  3D1N I;  3ROU A;  1HF0 A;  2FA5 A;  3ULQ B;  1VQ7 I;  2VAS A;  2VT2 A;  2OBP A;  3GZ6 A;  3OMY A;  2EA4 A;  4RAG A;  3RI4 A;  1MBH A;  3Q9V A;  3I4M J;  4RAY A;  1M1E B;  1H9T A;  4D5C A;  1WJE A;  2HDW A;  4PJM A;  3JR9 A;  1X58 A;  3ZMS A;  2V9P A;  1K83 J;  4IHT A;  4MO7 A;  2ID3 A;  3KCC A;  3S3N A;  3DU5 A;  3SFI A;  2NS8 A;  3RQI A;  2E36 A;  1OYI A;  2LMD A;  1XGM A;  3DXJ F;  1Z7L A;  3LL7 A;  1ONV A;  1D0Y A;  2FBI A;  1MMS A;  3FXK A;  1QVU A;  3F9K A;  1J75 A;  4D7N A;  2HPI A;  1YX5 A;  2RVC A;  4Q47 A;  3HSE A;  1Y8R B;  4FIS A;  2ELK A;  1TWF J;  3HXL A;  1KA8 A;  1D1C A;  2R7O A;  5HNF A;  2WY8 Q;  2M4K A;  2VJ4 A;  1ZAO A;  1Z91 A;  1YS7 A;  3PNV A;  4RBO A;  4UY8 I;  1ETV A;  1JJ8 C;  1S6L A;  3BCA A;  1WSU A;  1YW8 A;  1BM9 A;  4NC6 A;  2LC2 A;  1IN5 A;  5EEA A;  2OUM A;  3FMR A;  1K4S A;  2GA1 A;  2GQQ A;  4J19 A;  2HDC A;  2QKM B;  1YYV A;  1GXP A;  5A2Q K;  2Z2S B;  2JA7 J;  2K9Q A;  3BDD A;  2JTV A;  3E0J B;  1R6R A;  1T0F C;  4LLN A;  4G8X A;  1ZAR A;  2AS5 F;  1WVR A;  2JWT A;  1REP C;  4G94 A;  5FKM A;  4RGS A;  3CCU I;  3DEU A;  1DUX C;  3QPT A;  5AON A;  3DFG A;  2KRC A;  4GCV A;  5FKL A;  1A5J A;  5JI6 A;  4ASN A;  1E3O C;  2V1U A;  1BOA A;  4IQJ A;  1S8N A;  2VXZ A;  3KEQ A;  5J6X A;  2OZU A;  5FFZ A;  3V8K A;  1MBF A;  3VPR A;  4ZYD A;  3S15 J;  2XKP A;  3OIQ A;  4MEY F;  2P6T A;  3MFK A;  1ODD A;  3HM5 A;  3U1K A;  4GFB A;  1R00 A;  2JVH A;  3JW4 A;  3GXO A;  1K6Y A;  2QSF X;  2XDV A;  1O3R A;  2ZME B;  5IYB J;  4AIH A;  3TW7 A;  3HPH A;  1V5G A;  3CLO A;  4LK1 F;  1F1Z A;  1X1D A;  3F6V A;  3DEW A;  4PJ0 C;  4BXU A;  2ELH A;  5DYM A;  2LH9 A;  3IKV A;  1LVK A;  1RPW A;  1MSF C;  4KIC A;  2FBH A;  4AD9 A;  1FSE A;  6PAX A;  1BR1 A;  4IO9 F;  1JHF A;  4L5I A;  4KMF A;  2IW5 A;  4F93 B;  3A01 A;  3RDI A;  4LIT A;  1ZK8 A;  3BQY A;  3J81 K;  1D5V A;  2H1K A;  5E1W A;  2HKX A;  2HWV A;  2Y9Y A;  4CCM A;  4CYC B;  3TL4 X;  4B3X A;  4JX5 A;  2UZK A;  2KIS A;  4XKV A;  5LHH A;  3IV5 A;  2O61 A;  2CS3 A;  1IXR C;  1LVA A;  3FBN B;  1R5G A;  4JP0 A;  4A3G J;  1UHW A;  2HVQ A;  4MQV A;  1O3S A;  1D8K A;  4PCQ A;  3E6B A;  1YO5 C;  2VIX A;  3DLL F;  2R5Y A;  4FTH A;  1ZH5 A;  1K4T A;  2JN6 A;  2VN2 A;  5GAH J;  3LQR A;  3MN2 A;  2O3F A;  1FY7 A;  2CRG A;  4M9S A;  5KAI C;  4E7S A;  4LGW A;  2XGX A;  4JQF A;  2LG4 A;  4D1Q A;  2CGP A;  2X9D A;  5J40 A;  3GZN B;  3MZ8 A;  2JZY A;  3LSG A;  1WPK A;  4CCN A;  2VC1 A;  3H0G J;  3FXQ A;  4RS8 A;  4E7L A;  2CV0 A;  3CC7 I;  4BUP A;  1QHG A;  3JTG A;  3T1B A;  2K3F A;  2BYV E;  1PVE A;  4NUB A;  1B72 B;  2R5Z B;  3IP4 B;  1KQ8 A;  2K86 A;  3WG7 H;  1SD4 A;  2EZI A;  2F5C A;  2UXX A;  4OAY A;  4IHW A;  3MMY B;  3WHB A;  1U0J A;  4A3M J;  3CMA I;  4BQA A;  5FD6 A;  4KN4 X;  1NG6 A;  3QPH A;  4HDU A;  2B9S A;  3S32 A;  1B59 A;  3SDG A;  4EJV A;  4RDU A;  2E60 A;  2DI3 A;  2NYX A;  4Z2Y A;  2FNP A;  5J1Y A;  3GYH X;  5L3F A;  2F5E A;  2UXN A;  1AKH B;  1W7P A;  2M30 A;  1ETY A;  2HTJ A;  2JA2 A;  4A3D J;  4XR6 A;  2GIV A;  3GCM A;  3A0B C;  1LKX A;  1TWA J;  2DT6 A;  1XPX A;  3K70 D;  3JRA A;  1JKO C;  5ILU A;  2DA7 A;  3U21 A;  2XAS A;  2F48 A;  5EG0 B;  1LEA A;  1AHD P;  3DEE A;  3WU2 C;  1FT9 A;  2FJ1 A;  4ZYE A;  4DZJ A;  3RPU D;  3QPL A;  3ZRG A;  2RC4 A;  2QEX I;  5EF6 A;  3C7J A;  4UXN A;  3RYR A;  5M5X J;  4P9U A;  3ZPL A;  3DF8 A;  2NVQ J;  2Z99 A;  2KLO A;  2BOL A;  4M3D A;  4O6J A;  4Y4R A;  3M9A A;  2X1E A;  1XB4 A;  3LSK A;  3DQV C;  3H1C A;  5E1X A;  1S3J A;  3QYE A;  3PSF A;  3ZGK A;  1FOW A;  1Z3X A;  2DA2 A;  2YUS A;  3MWM A;  3D5L A;  4OOI A;  3TQN A;  1IXS B;  5TGT A;  2CFX A;  1YIT I;  2JRM A;  3TMO A;  4HPQ A;  1UMQ A;  1PUF A;  2G7U A;  3ABK H;  3JRC A;  3LQQ A;  1JUS A;  2BHZ A;  2L5Q A;  1WGX A;  2TRT A;  4BDZ A;  1LFU P;  5FRM A;  1WFX A;  2GOX B;  2RNJ A;  2HQA A;  4DNC A;  1MJ9 A;  2YU9 J;  3T0Y A;  1GXQ A;  2R7F A;  2WAQ A;  1VQ5 I;  4Y3O A;  1N75 A;  1P92 A;  1RC9 A;  2K85 A;  3TP3 A;  5ERI A;  4I09 A;  3MZH A;  1LDJ A;  3A0H C;  1XGS A;  4NNJ A;  1SD7 A;  1TNT A;  2ADU A;  2YS9 A;  3CCY A;  3REO A;  3KYL A;  1D0Z A;  2D45 A;  2E1O A;  4M71 A;  2K40 A;  2DAO A;  3EPZ A;  1OYY A;  3NWT A;  5C4X J;  3IHU A;  2L9S A;  3GUD A;  3J81 Z;  1T8I A;  2JT1 A;  5GPA A;  3H36 A;  3M8J A;  1N25 A;  3F8M A;  1BJA A;  4LB6 B;  3S93 A;  5E3O A;  3HOS A;  2EZH A;  2A69 F;  2BV6 A;  2BXY A;  3EUH C;  2QBY A;  2K3P A;  3H5A A;  4DYR A;  4IHS A;  1TW2 A;  2BW3 A;  2WBM A;  3CLQ A;  1DP7 P;  3TOA A;  2TDX A;  5CQG A;  2DA4 A;  3I5U A;  2DOD A;  3OOP A;  5CYV A;  2GIZ A;  4EJU A;  1MNE A;  2QQ9 A;  5HDK A;  2N8G A;  1T6S A;  4XSX F;  4Q5S F;  2E2I J;  1XMA A;  1Z05 A;  4PJL A;  1NG7 A;  3JCU C;  1T38 A;  4F7Z A;  3BG5 A;  2Y0S A;  3TGN A;  1YJN I;  1WJA A;  3LAP A;  2Z16 A;  5F08 A;  4KIS A;  1HXD A;  1QBJ A;  2VE8 A;  3DPL C;  2OV7 A;  3I4P A;  3VOD A;  1I6H J;  2PMH A;  3K0L A;  4BGD A;  2XAQ A;  5LGN A;  3GTL J;  3FDY A;  2Y48 A;  4XNF A;  1TWH J;  2NS7 A;  2CQN A;  1T33 A;  4UUS A;  4U87 A;  5C44 J;  4A0Y A;  2A68 F;  2DLL A;  2WAF A;  1DU6 A;  3T8R A;  1ORK A;  1H8A C;  3RPQ A;  4ZDL A;  1LFB A;  2NVT J;  4RB3 C;  2V1X A;  1LFP A;  3FXR A;  2EFQ A;  3M8F A;  3JRI A;  4O3M A;  2OAZ A;  4O5V A;  4XOR A;  5IY5 H;  4B3A A;  3E6C C;  5M3M J;  3H5N A;  3P9I A;  2X4H A;  3HKZ N;  1QZZ A;  5TJJ A;  3BG7 A;  2NRA C;  3BQZ A;  3E7L A;  4ESF A;  2DW4 A;  4RAF A;  3ZMU A;  4ENN A;  3JRG A;  2E2H J;  3V42 A;  3EUH A;  5M5Y J;  3LSR A;  3ZMT A;  3OS1 A;  4CCK A;  3C2G A;  1JUM A;  1X4O A;  2XRN A;  3RSN A;  3MZY A;  2W4S A;  2HOS A;  4H4K C;  4L9V A;  2X1D A;  1X1A A;  3GLX A;  4A93 J;  1WH7 A;  3HOW J;  1JHH A;  2WY7 Q;  4MFD A;  4IQ4 A;  4XLH A;  2WAQ N;  1K78 A;  1KON A;  4KMU X;  2MFZ A;  3OS2 A;  1Y39 A;  4CGZ A;  4FX4 A;  1LDD A;  4I2O A;  1UG2 A;  3I0T A;  2XAJ A;  4H0E A;  1GV5 A;  4LG0 A;  4B47 A;  4WCG A;  2CQ7 A;  2RV8 A;  1RKT A;  1VQ9 I;  4YII A;  1OCO H;  2CUE A;  5FGM A;  3BTL A;  1N78 A;  4BE0 A;  1QO0 D;  1WKM A;  2HOA A;  3BP8 A;  2W1O A;  2FXA A;  3K4M A;  3ASN H;  2W25 A;  4F91 B;  1L0O C;  4RB0 A;  2X1C A;  1FSH A;  1OCT C;  2KKO A;  2XUB A;  3WTX C;  4L9N A;  2PJR B;  2CQX A;  4Y7N J;  3RQ4 A;  3U1D A;  1EV7 A;  1T56 A;  4RB2 C;  1ON1 A;  2W82 A;  3C18 A;  4V2F A;  1LNW A;  4KIB A;  1U5T C;  1UG0 A;  3E3V A;  1IDY A;  2IRF G;  3E97 A;  2V1D A;  2PI0 A;  3GX4 X;  2ZXJ A;  3UKG A;  2VBZ A;  1NHA A;  4RM3 A;  1LJ9 A;  2VBX A;  2XB5 A;  3TP0 A;  5ILV A;  3ZQF A;  4G7O F;  1YJ9 I;  2E5N A;  4EVI A;  1MBJ A;  4IVN A;  3BC8 A;  1O3Q A;  3A4C A;  4HRI A;  4GGG A;  2CW8 A;  1LPQ A;  1EKE A;  2ECC A;  1I5Z A;  1OPC A;  2LYC A;  2V4J C;  5KAF C;  2I5U A;  2WTE A;  4BDY A;  2Y2Z A;  4A3L J;  4WK8 F;  2ID6 A;  2Z1D A;  3BTJ A;  1W0T A;  4M3B A;  3L2Q A;  5D5W B;  5K1Y A;  1GDT A;  1O7L A;  1RR8 C;  2KDO A;  5B66 C;  3W2V A;  4E7K A;  3GFL A;  3ZMZ A;  2WWY A;  3RCO A;  4IKF A;  2DXI A;  4QWQ A;  3LNQ A;  2Z33 A;  4HLY A;  1XS9 A;  2UV1 A;  3BPX A;  1I3A A;  4RGX A;  5FO5 A;  3CUQ B;  4BYY A;  5DM6 F;  1I6X A;  2E19 A;  1FYL A;  3VSL A;  5JHF A;  4P1W A;  4EJT A;  4L0Y B;  5CLS A;  2MH2 A;  3L00 A;  3OYE A;  2WAD A;  1UB9 A;  2XRO A;  1P7J A;  2ZC2 A;  1JUP A;  3B02 A;  3KPH A;  4IXA A;  3VSK A;  1TL8 A;  2L9V A;  4L0Z B;  2WB1 N;  3JRF A;  2GWR A;  3BOQ A;  2ZME C;  4J01 A;  3JRE A;  4V19 K;  1B9M A;  1W7P B;  1X1P A;  4DGW B;  1FC3 A;  3GTG J;  3BCB A;  4G6T B;  4HLX A;  1FIP A;  2K02 A;  3R61 A;  2HOE A;  5JFR A;  3F0C A;  3F22 A;  4ENK A;  2KZG A;  1D0X A;  5B1A H;  2L9N A;  1HW1 A;  3E1S A;  4M9Z A;  2DTZ A;  5KK1 A;  2EZK A;  3DBR B;  3HG9 A;  1R36 A;  2M9H A;  2RAE A;  2MLG A;  4S04 A;  2PMZ N;  3I55 I;  2R93 J;  4XLN F;  2M4G A;  3KYD B;  4AIJ A;  3CCM I;  3EYY A;  1U5T A;  1W1W E;  5EZG A;  1WJ5 A;  3GBG A;  5EZH A;  3RIR A;  3L2U A;  1A36 A;  2DPU A;  2LY2 A;  3KLO A;  3CC2 I;  2X6Y A;  4HQM A;  2VQG A;  5HDG A;  4C2M J;  3OSG A;  4E4H A;  3ZQL A;  4ESB A;  3IAM 2;  2W85 A;  3W2W A;  3AL0 C;  1DP3 A;  4PJN A;  3S1N J;  2H8R A;  3OYA A;  4MTE A;  4BAY A;  2DCE A;  1YE9 A;  3I71 A;  3H9G A;  3IWZ A;  3SFZ A;  2VKV A;  3S1Q J;  4C9Y A;  4Y15 A;  1U2W A;  1G3Y A;  4HNV A;  4B4C A;  2JSC A;  5JR3 A;  4PSW A;  1AA7 A;  1YIJ I;  2LF8 A;  2FRH A;  2KMU A;  2LK2 A;  5HVQ C;  4KIG A;  5F04 A;  4I7H A;  4BEH B;  1ZKG A;  2JUC A;  2XPW A;  4RAZ A;  3K4K A;  4XLC A;  1IDZ A;  5FLV A;  3CP8 A;  3OIP A;  4XRM A;  3DPT A;  1V4R A;  4OMY A;  1WHU A;  3OL3 A;  2MA3 A;  4M6Y A;  3WE3 A;  2XAU A;  3VWB A;  1IRZ A;  3M07 A;  5TRD A;  1S9H A;  1TQI A;  2VKE A;  1G3S A;  5L3C A;  3C3W A;  3OYB A;  5CKT A;  4PGH A;  1KYZ A;  2HXO A;  2IVM A;  2KFD A;  1FYM A;  4KT5 C;  5CQE A;  2FBK A;  1EF4 A;  3GWZ A;  3M8E A;  2CUJ A;  2M34 A;  2H94 A;  1YIO A;  4BKX A;  2EZL A;  3CMM A;  3PNT A;  2A5Y B;  2VI6 A;  3BTI A;  2QQA A;  2STT A;  2XIG A;  3L7W A;  3WGG A;  3IUO A;  3SZP A;  5DUI A;  2XAF A;  3DTI A;  4XOT A;  2CJJ A;  5HS8 A;  2L7F P;  1P9Q C;  1WI9 A;  1WJC A;  3HRS A;  2KHM A;  3KZZ A;  3RZO J;  1TT5 B;  4BU2 A;  4A3I J;  2OC6 A;  1W4M A;  1P4X A;  2CG4 A;  4DZP A;  5FJ8 J;  2L4M A;  5BNG A;  2HNH A;  3PIO F;  1E3P A;  3O8G A;  1GLN A;  4PUS A;  5E79 C;  3W6V A;  2LBF A;  3HUG B;  2KJC A;  4CZC A;  1X2N A;  2ZXW H;  3SDB A;  2XAG A;  1J7K A;  2L54 A;  1TP4 A;  1JTY A;  2ZJ2 A;  3G1O A;  4HA8 A;  4FCY A;  1R1V A;  1HST A;  2R0Q C;  1P2F A;  2K9L A;  4XKC A;  4LLL A;  4BHP A;  1T98 A;  1ETO A;  4CSW A;  2Y0M A;  5DDG A;  4WXH A;  4G6D A;  4HF1 A;  1Y0N A;  3SXY A;  2IS1 A;  3P9C A;  5D5X B;  4M3F A;  1TT0 A;  4IRG A;  2H09 A;  3J80 Z;  3KP7 A;  5FLM J;  2KIM A;  2M2E A;  1XDU A;  3RKQ A;  2BVM A;  1S7A A;  1XCB A;  3JSO A;  3M1E A;  4XLP F;  3FBI B;  1B72 A;  1HKS A;  4A69 C;  1F43 A;  1FIA A;  2BE5 F;  3RJP A;  2M8E A;  3HIF A;  3T5X A;  1SAX A;  3OYI A;  1FBU A;  3N4M A;  1GV2 A;  2MGQ A;  4HNT A;  3DP7 A;  2F4I A;  1VQ8 I;  4IHX A;  3AKZ A;  2JJ7 A;  1UAA A;  4HX8 A;  2EIN H;  4BQQ A;  2VQH A;  1TW3 A;  2VXD A;  1MBK A;  2X51 A;  2ZCW A;  3EET A;  3E5Q A;  3R60 A;  3CES A;  3H5R A;  1P6R A;  4MEX F;  4E7Z A;  2QM3 A;  2P5L C;  1FMV A;  4NBQ A;  5L3G A;  1R49 A;  2XVC A;  1AKH A;  4B44 A;  1AU7 A;  3WTU C;  3TOB A;  3TDZ C;  3LA2 A;  4CCO A;  1P4A A;  1W5C C;  2ZFW A;  1SD6 A;  4ENJ A;  2EFO A;  5D5V B;  5LHG A;  4KJZ A;  4YFX F;  5B5E C;  5GTI C;  3ZQH A;  5L3E A;  2CWE A;  5J8C A;  4ZYA A;  1K61 A;  1JKP C;  3J7A O;  5FFX A;  3JRB A;  3OR1 C;  1FOK A;  3Q0U A;  5FKK A;  1B8I A;  1RKW A;  2M7A A;  5JVG F;  4II2 A;  5K7H A;  2IGN A;  1W36 D;  3HUG A;  2LBF B;  3O3K A;  1FNN A;  3ML6 A;  1IGN A;  3HOV J;  3SYT A;  2LVS A;  4HST A;  1B6A A;  5JLW A;  2F6C A;  5M5W J;  2D1V A;  1G3T A;  2XGD A;  4CCL A;  2EJR A;  4N9H A;  2PJR A;  3WG9 A;  1XGO A;  1Y8Q B;  1HBX G;  3WU1 B;  2QCO A;  3HHG A;  2XRL A;  2CV2 A;  3O6B B;  4K2E A;  1SFX A;  3KP5 A;  1BR4 A;  5IT9 K;  5EGO B;  1MKM A;  4Q4Z F;  2M7B A;  3NRV A;  3ERE D;  2XB0 X;  4KT6 A;  5AIP A;  2PLY A;  4OMZ A;  4N4N B;  5HOD A;  1VFC A;  2P7V B;  1YI2 I;  1MMG A;  2AO9 A;  2BW3 B;  1OKR A;  2JUG A;  3H92 A;  1JKR C;  3CC4 I;  3M3Y J;  3CP2 A;  2MLK A;  4CHU A;  1BJZ A;  3VYR B;  2B7E A;  2FML A;  1NH3 A;  1BC8 C;  1MSE C;  3EYI A;  1P7I A;  2VT3 A;  2R7Q A;  2WV1 A;  1TWG J;  3B73 A;  2ESN A;  3HB9 A;  1ZEL A;  3GFJ A;  4XL9 A;  5ED4 A;  2DU9 A;  4AWX B;  2P6S A;  4UV9 A;  3ZQI A;  3K1N A;  3VYU B;  3FKJ A;  3SZG A;  3IC7 A;  4I02 A;  2EH3 A;  2M0M A;  3FM3 A;  3Q9S A;  2VOD A;  1STZ A;  2M8G X;  2PFB A;  1YRN B;  3LSM A;  1R1T A;  2NS0 A;  5HOO A;  1MBE A;  1YOV B;  4HEA 2;  5GAE J;  2ZO4 A;  3E5U A;  2CQQ A;  2OU2 A;  4LD5 A;  1XTA A;  1CQT A;  3HTS B;  4A6E A;  2HVR A;  3SEZ A;  1ACI A;  5HLI A;  4GYG A;  2QGU A;  4BE2 A;  4N0B A;  3FX3 A;  1XSX A;  2E1N A;  2LP0 A;  1R5I D;  3CQZ J;  2MBF A;  1DGR M;  4UB6 C;  2R5Z A;  3VDX A;  1TBX A;  5F27 A;  4D9J A;  1KZH A;  1U9N A;  3I9V 2;  3ZN0 A;  2NOJ B;  4D5F A;  1OIS A;  3I59 B;  1W5T A;  1IJW C;  2GOM A;  2O8K A;  2R7U A;  3FIS A;  3S3O A;  2OCE A;  2I10 A;  4XKB A;  3MKW B;  5C4J J;  4P9F A;  2K9N A;  2MC3 A;  4RA2 A;  1R22 A;  3QRF F;  2KP6 A;  3CF5 F;  3VYS B;  2OTL I;  5M3F J;  2CFO A;  2Q2E A;  3F3X A;  1IAW A;  2VJJ A;  2WAE A;  3QOE A;  2BZT A;  3FXL A;  1HLV A;  1RIO H;  2COB A;  4YEJ A;  1CF7 A;  3BZC A;  1U5T B;  1ZG3 A;  2HZT A;  1TLH B;  4OU0 A;  4OIN F;  3W6K B;  3AG3 H;  2DT5 A;  3K2Z A;  1TWC J;  2FQ3 A;  3LWF A;  1F9N A;  5EG0 A;  4UUS B;  2IS6 A;  3CD6 I;  3OS0 A;  4PSX A;  5EEG A;  3ZQQ A;  1KU3 A;  2ZKZ A;  1FBQ A;  1RES A;  2AXT C;  2QKL B;  2BGC A;  1BA5 A;  2YR2 A;  4NQW B;  2QA4 I;  2O6G E;  4U7B A;  1BW5 A;  3PFY A;  5TIS C;  3BG9 A;  1S29 A;  1SFO J;  3AG1 H;  4KIF A;  2O5R A;  4KNY A;  2IJL A;  1WCM J;  3Q0V A;  2DO7 A;  2RRE A;  4ZTF A;  3LAJ A;  4QSH A;  2EFW A;  1EH6 A;  1VQO I;  5F1J A;  4NHJ A;  4M73 A;  5GTH C;  2E34 A;  2R7S A;  3WU0 A;  1L3L A;  2QQB A;  2GM4 A;  4CH7 A;  3U9G A;  1JTX A;  3SZT A;  3T8T A;  3QP6 A;  5D4S A;  3BJ6 A;  2H27 A;  5ICF A;  2NOG A;  4DW6 A;  2EFP A;  1F36 A;  1MMD A;  2O7O A;  2WB1 A;  5E17 F;  2JA8 J;  1I1G A;  5JLX A;  3R6S A;  4AIK A;  2XKO A;  2FE3 A;  2K4J A;  3GTJ J;  1S5L C;  2RGV A;  1LE8 A;  5IP7 J;  2O0Y A;  2KZV A;  4RM2 A;  3GLL A;  2XV4 S;  1Z3Y A;  3L2W A;  2ZBK A;  1E3H A;  3QYF A;  4IOC F;  1E0E A;  2LKP A;  2OF7 A;  3I59 A;  3BR5 A;  1XGN A;  2DOA A;  3N97 A;  3S3M A;  2K27 A;  2PMZ A;  4ZDO A;  2HI3 A;  4ZZD A;  4JYK A;  3D5S C;  1K6O A;  5J3L A;  5LHI A;  3GEZ A;  3S8P A;  1YX3 A;  1MDM B;  4OIR F;  3FMQ A;  4C3I J;  2W48 A;  3S2H J;  2Z5U A;  2L7K A;  3CDL A;  1C0W A;  1Z77 A;  2DA3 A;  3GTQ J;  3PO2 J;  1Y0U A;  4HX7 A;  2QYO A;  3WOD F;  3GTO J;  1KYW A;  3S16 J;  1SMY F;  2KQR A;  2LLK A;  4M3G A;  1R9T J;  5FRO A;  5K5O A;  3G3Z A;  2UUZ A;  3HSR A;  1K79 A;  3BR2 A;  2GAU A;  2R7X A;  2LF7 A;  4I01 A;  1QGP A;  5HS7 A;  2YX4 A;  2RDP A;  5LEJ A;  2DQL A;  5IPA A;  2L0K A;  2LKX A;  2GA2 A;  5DCM B;  2OZ6 A;  1E17 A;  1UHM A;  1I39 A;  5F0F A;  2AHQ A;  4JX6 A;  3K6G A;  4P96 A;  3OR2 C;  1TC3 C;  4RMN A;  1HSJ A;  2JA6 J;  3ERM A;  2EIM H;  2WV0 A;  3HZJ A;  4BHB A;  4DBR A;  3VEP A;  2XC7 A;  4BAC A;  2E5Z A;  5GPC A;  1SFE A;  2ZME A;  2BBY A;  5KNL A;  3ZQG A;  4RGR A;  4WF2 A;  2JRT A;  1RUO A;  1ITY A;  4DJA A;  4N9I A;  4P5O A;  4ZZL A;  2E2J J;  2IGK A;  5FB2 A;  2JA5 J;  2BY1 A;  3HHH A;  3HBL A;  1KU9 A;  2NVY J;  1VF9 A;  2F5D A;  2X85 A;  2M1B A;  2CQK A;  4CA0 A;  1Z6R A;  3F8F A;  3S14 J;  1HQC A;  2IEK A;  3QPS A;  3R4K A;  4X6A J;  1ZGJ A;  1ZR2 A;  2FOW A;  4FE4 A;  2A5W A;  4E70 A;  4ZC3 A;  3CME I;  2FNA A;  3Q3S A;  2VQC A;  4YG2 F;  4B1R A;  3ZMD A;  1LQ1 A;  3MVP A;  1Y56 A;  1MJA A;  1GUU A;  2XF5 A;  1J9I A;  2P7C B;  4MHG A;  3LSJ A;  4CO8 A;  4MIM A;  3I3L A;  1T08 B;  1DU0 A;  2W24 A;  3HGG A;  3JAM K;  2L7Z A;  2IXS A;  2VL8 A;  2LTP A;  2QLZ A;  1Q1H A;  3CF2 A;  1VND A;  3A02 A;  3CO7 C;  5DEQ A;  1BW6 A;  4HV5 A;  4UVB A;  4D7M A;  3JTH A;  3GFI A;  3E5X A;  1Z6T A;  4MQ9 F;  4G7Z F;  2XSJ C;  2HFH A;  2FQ4 A;  2KRF A;  2QVO A;  3ZOB A;  5K7Z A;  1I3Q J;  1UEL B;  4U0V A;  3C2B A;  3KEO A;  3BLY A;  3EQL F;  4MNU A;  1K78 B;  4C2U A;  1XMK A;  1S72 I;  2P4W A;  3MKY B;  1H9G A;  2Z9O A;  3QU6 A;  2FD5 A;  3ZN1 A;  2HQN A;  3V8J A;  2V26 A;  3OSF A;  2EA2 A;  1MZB A;  5DUK A;  5GAD J;  4FQG A;  2MAB A;  1PYV A;  2MD0 A;  1BOB A;  1IF1 A;  2L4A A;  4OIO F;  2FX0 A;  3H3V K;  2AXL A;  1HOM A;  4XOP A;  1VI0 A;  3RTR A;  2OPT A;  2F5V A;  5ICC A;  5A2Q Z;  2QWW A;  2HQR A;  4BEH A;  3V7R A;  3KP2 A;  1FWZ A;  4RB1 A;  1XSD A;  5L3B A;  2GZW A;  1MMN A;  2K4B A;  3HOZ J;  2DFI A;  4KIT B;  3QOD A;  1VQK I;  3L2R A;  2L9R A;  3BJA A;  1TQM A;  1D3Y A;  2Q1Z B;  4FT8 A;  4XN0 A;  4AYB A;  2NNN A;  4EJW A;  1BL0 A;  2DJN A;  3K4N A;  3BRO A;  3CUQ C;  3SHF A;  2EV6 A;  2HYG D;  2Y0S N;  2F4O B;  4HF0 A;  1KQ0 A;  4XLE A;  2HKO A;  3HOX J;  2BY0 A;  3CO6 C;  3RKX A;  2V79 A;  3WTV C;  1IRF A;  2IA0 A;  4X0G A;  2E1M B;  4L5J A;  2DYS H;  2DK5 A;  1ZRE A;  1IZ1 A;  3VB2 A;  3CCE I;  3FMS A;  5BPI A;  3GO5 A;  4LG3 A;  1HDP A;  2NVU B;  1SAN A;  4A3K J;  5J1U A;  4ZYG A;  1W7P D;  1YLF A;  5IYC J;  1FP2 A;  4JOM A;  3HGY A;  2XHK A;  4ZH4 F;  4UV8 A;  1J59 A;  1QRY A;  2V7F A;  4XLA A;  3KET A;  3F23 A;  4ETS A;  4GRI A;  4CYD A;  1SFU A;  2OA4 A;  3ZCO A;  4DYQ A;  4L9T A;  3PUF A;  1QQI A;  3COA C;  3MQ0 A;  3AL0 B;  4HYE A;  1ZG5 A;  4Y13 A;  1U8B A;  1BI1 A;  3L09 A;  1DPU A;  4FHT A;  3PQJ A;  2EIK H;  1OJL A;  1ERD A;  2PN6 A;  2ZJR F;  1JJ6 C;  4NB5 A;  3HKZ A;  2EB7 A;  1IN6 A;  1R4M B;  3DWL E;  2A05 A;  1ZRC A;  1S7O A;  1JGS A;  5HS9 A;  3TKY A;  4S0H B;  4AVZ A;  1I50 J;  3CTA A;  3FXM A;  3ZP5 A;  4NDL A;  3BG3 A;  4A3E J;  3HTU A;  3CDH A;  3GW2 A;  1IN7 A;  2EIL H;  1AWC A;  5F6F A;  3WTY C;  3DKW A;  5E20 A;  2XAH A;  1VQN I;  3WTS C;  3ABM H;  2CW0 F;  3TO7 A;  1ZLJ A;  2GBY A;  2ISY A;  2FSW A;  1G2H A;  2JQ7 A;  3Q5F A;  3C1D A;  5CVJ A;  2VB6 A;  1B1B A;  1V3F A;  3MEX A;  4Q48 A;  2ICW G;  4LJZ F;  1QZY A;  3MKL A;  4UB8 C;  2VKH A;  1IN8 A;  3IL2 A;  3GTP J;  3L9F A;  1FPQ A;  1VQ4 I;  1ZGA A;  3ZXS A;  1UHS A;  2Y69 H;  4ZJZ A;  1WQ2 A;  2NXN B;  3IH4 A;  4LK0 F;  1O4X A;  4BBR J;  4QTR A;  2HXI A;  3DKY A;  4BL0 B;  4IPA A;  3KIO A;  3LMM A;  1RUN A;  1OR7 A;  1U78 A;  2PX9 A;  4A3B J;  3NWS A;  5DS9 A;  3O8H A;  2CV1 A;  4W97 A;  1JGG A;  2LRD A;  2D5V A;  4OIQ F;  2OTJ I;  2DBB A;  4CXF A;  4BXX J;  5DTD A;  4EGY A;  1SEU A;  3K4L A;  2V9V A;  4A3C J;  3DTE A;  3PJR A;  2R7R A;  3PFI A;  3F6O A;  3TW6 A;  3I56 I;  3ABL H;  3BR1 A;  5BS6 A;  2ZSI B;  3FM5 A;  1H89 C;  4YIF A;  5KHD A;  1O57 A;  4XSZ F;  1R4N B;  3G73 A;  4ANJ A;  4IEJ A;  1POG A;  5K5R A;  1HA8 A;  3FXO A;  3DBH B;  3HEF A;  2DN0 A;  3GF2 A;  1EH8 A;  3OYK A;  2R92 J;  1ULY A;  2MH9 A;  3BJO A;  5LFA A;  4EJO A;  4EGZ A;  3CCJ I;  5H20 A;  3TBI A;  1QHH D;  4I0B A;  3BR6 A;  4HSR A;  3G1L A;  4CUG A;  5E8I A;  2VPR A;  1Y6I A;  2ZFU A;  5LEK A;  2Y31 A;  1DGW Y;  3EUA A;  1BC7 C;  3J7Z I;  1F5T A;  2DOE A;  3S1M J;  2CSO A;  1MDM A;  1KU2 A;  3B6C A;  2P8T A;  3KX2 A;  2DA5 A;  4GYI A;  4XRS A;  4XBF A;  5EGO A;  3MCZ A;  1X3W B;  5D6F A;  2P5V A;  2M45 A;  3S17 J;  1LB2 A;  4ABZ A;  4EV0 A;  2F2E A;  4LIV A;  1MND A;  4YRV A;  4Y17 A;  2M87 A;  2KIQ A;  4BS9 A;  3OYH A;  1IUF A;  1A04 A;  2PJP A;  2R7W A;  1IUY A;  3PSI A;  1W5S A;  3BR3 A;  3QQA A;  1NK2 P;  2HR3 A;  2DA1 A;  4P55 A;  1T95 A;  5D6E A;  2ESH A;  3JRH A;  3SEQ A;  4KA4 A;  2JPC A;  3OYD A;  1AOY A;  4LG0 B;  4L9J A;  1PP8 F;  2HYJ A;  2EV5 A;  2L3D A;  1TZL A;  4AYB N;  1DPR A;  3BG6 A;  2B63 J;  1MJB A;  3J80 K;  4PDK A;  2KIF A;  5E8G A;  4YEL A;  3CCS I;  2QQ8 A;  4F92 B;  4ZTJ A;  1V5E A;  2ECB A;  2IS4 A;  3G2B A;  1OLT A;  2BVL A;  4AC0 A;  2VC0 A;  3RKY A;  1ZGW A;  2R7T A;  4F55 A;  1IV6 A;  3BT9 A;  5FLX Z;  2H1L A;  3S1R J;  4IOA F;  3V4G A;  3FHZ A;  2DFE A;  2G0E A;  3KEY A;  3HL2 A;  3NEU A;  2LFB A;  3OY9 A;  3H35 A;  4IF4 A;  4A0X A;  5IYD J;  3FK7 A;  4A0Z A;  4QPQ A;  2XPU A;  4L5E A;  2W57 A;  2ZJP F;  4XMY A;  4E6K G;  3HSF A;  3O2P E;  4JK1 X;  2CU7 A;  1G59 A;  2CH0 A;  1D8J A;  5F64 A;  3HOY J;  4IZZ A;  3M7G A;  5B1B H;  2RQQ A;  3KYC B;  1CGP A;  4BJT A;  3CMY A;  5JVT A;  2LSO A;  3I4N J;  1SC7 A;  1MGT A;  5CJ9 A;  5L3D A;  4FAS D;  1RRJ A;  1U6G A;  4II3 A;  2LD5 A;  5H6R A;  3FKI J;  2KDZ A;  4XIC A;  3BPV A;  4B43 A;  3S2W A;  3ELK A;  2COM A;  2IBD A;  3MAJ A;  1CF7 B;  3AAF A;  4V2G A;  2QSG X;  5H2F C;  4HX4 A;  4I76 A;  1UCR A;  2A6T A;  2FUG 2;  5K7F A;  5D4R A;  2DJI A;  5DCF A;  4JBA A;  3S2D J;  3BR0 A;  3HC7 A;  2O8X A;  3F8B A;  3K9T A;  4B48 A;  3WE2 A;  3RZD J;  4DQ2 A;  4AU7 A;  2KPM A;  5ICG A;  4W1U A;  2PEX A;  3OL4 A;  4YIR X;  4ZDP A;  2MC4 A;  1HDD C;  3HPG A;  1Z0X A;  4LLG F;  5D8L B;  1WJF A;  1PJR A;  3R0J A;  4C30 A;  3NQO A;  3I54 A;  3OYN A;  2ZSH B;  3FXU A;  2VJI A;  2Y9Z A;  2BY2 A;  4HV6 A;  1UZC A;  3W2A A;  4ENM A;  5HLH A;  2I8D A;  1EH7 A;  2KIU A;  3LFK A;  1P4W A;  1BBY A;  4HG2 A;  4UHT A;  5EEH A;  2XF7 A;  4BNC A;  4F52 A;  2IT0 A;  2KL4 A;  2J5P A;  1NK3 P;  5IP6 A;  4EAT A;  1SAU A;  4UUT A;  1J5Y A;  4IHY A;  2V9K A;  2CMP A;  2Y75 A;  3A01 B;  2BY3 A;  1N77 A;  2QZ8 A;  3G71 I;  5LLQ A;  2E71 A;  4HZF A;  2J5O A;  4BJ5 C;  1A6Q A;  1MMA A;  1E2X A;  2HYF A;  3E6D A;  3G1M A;  3DKX A;  5J4V A;  1D5Y A;  1SVM A;  1GHC A;  1B4A A;  1JI8 A;  5H6Q A;  1T0F A;  4YFN F;  1ZQ3 P;  1MH4 A;  1XG1 A;  3GTK J;  2XSD C;  5E3M A;  1UST A;  1R7J A;  2JK3 A;  5FKO A;  1XCV A;  3GFM A;  5DCM A;  2W84 A;  3LA3 A;  3AFH A;  4IHV A;  3HJE A;  3OOU A;  2ACJ A;  2C6Y A;  3K7A J;  1VQ6 I;  1G3W A;  2Y30 A;  1HW5 A;  5IOY A;  3K69 A;  4R8H A;  2F5F A;  3ECH A;  4U88 A;  5HLG A;  4HDV A;  2ISZ A;  1RI7 A;  3WTW C;  4M9X A;  4AID A;  4I6Z A;  1HCR A;  3TO9 A;  2LRE A;  3IH3 A;  4BQO A;  5D5U B;  4I98 B;  2A07 F;  2ME6 A;  1JXS A;  1KQ9 A;  2HDD A;  2XF6 A;  1ZG1 A;  1QNT A;  4LOC A;  4N4O B;  4ON0 A;  1SMT A;  5CVR A;  4J00 A;  2WC2 A;  1OCZ H;  4DIQ A;  1MIJ A;  2MYS A;  1XX5 A;  5E3N A;  3WGI A;  3FXJ A;  1RR7 A;  2L7M P;  3H9J A;  3G6E I;  2DMU A;  1B9N A;  1XMX A;  5J1R A;  3D5R C;  3CCR I;  1IW7 F;  3HDD A;  2IS2 A;  1KU7 A;  5BOX A;  4XON A;  3KE2 A;  4HBL A;  1WZ2 A;  3HOU J;  2A6E F;  4OWR B;  3BY6 A;  4KN7 X;  3PIP F;  1APL C;  1A6I A;  3FWE A;  1IN4 A;  2VLA A;  1O7F A;  2IGM A;  4WX9 A;  5B3S H;  5CPR B;  1MW7 A;  1BI2 A;  2W7N A;  4B09 A;  2DPD A;  3IKT A;  3M1C A;  2KT0 A;  1ENH A;  3K70 C;  1U8R A;  4Y52 J;  4E7H A;  3ISP A;  2DOF A;  2M0C A;  3WHC A;  4MLO A;  2OCC H;  3KLN A;  3L2V A;  2VOP A;  1I1S A;  4RLQ A;  2QEN A;  1Z21 A;  2X0L A;  5DM7 F;  4XLF A;  1UFM A;  3OWT A;  2MSY A;  1BR2 A;  2XPV A;  3ECO A;  2EBI A;  1WJD A;  2A3S A;  1G8X A;  3LST A;  2JPB A;  5DD8 A;  5K5Q A;  1T39 A;  3CJR B;  3R0A A;  3CUQ A;  1F4K A;  1LEB A;  2RN7 A;  1FTT A;  1HC8 A;  1DQU A;  1I27 A;  3CUO A;  4ESJ A;  1FOY A;  2PQ8 A;  4G6Q A;  5HNH A;  2EV0 A;  5E18 F;  4A3F J;  3H3U A;  2DMN A;  5J47 A;  2Q0O A;  2HEO A;  4GO1 A;  2P5K A;  1BI0 A;  4R1H A;  2DYR H;  5IP9 J;  1IXC A;  2R3S A;  3V7C A;  2CYY A;  2Z3Y A;  4UUV A;  3RKW A;  2P81 A;  1BIB A;  2E7W A;  1FMW A;  2HTS A;  1FYK A;  1PUF B;  3CCQ I;  3JSP A;  2HVS A;  4I0A A;  5IT9 Z;  4XK4 A;  1RET A;  5CVI A;  2IAI A;  2H6C A;  2NNY A;  1BI3 A;  3P7N A;  1GVD A;  4Z6Y A;  4QLC U;  4OAZ A;  2G9W A;  1OCP A;  3EUK L;  2K9M A;  3V7S A;  3CZ6 A;  3LA7 A;  3TDU C;  4U0Y A;  1TQP A;  2V1N A;  4JX4 A;  1OFC X;  2VE9 A;  5FLX K;  4HF2 A;  3OYL A;  2PMU A;  2IA2 A;  1KGS A;  2X6X A;  3K4J A;  1ZRD A;  4OIP F;  1D1A A;  3F8N A;  3KZI C;  4HAM A;  1RZ4 A;  1X1B A;  2M5W A;  2A61 A;  2VBW A;  2JMW A;  3DCF A;  2GXG A;  2VON A;  1FP1 D;  1V5F A;  2R5Y B;  4UNO A;  2LNB A;  4AM3 A;  5CVV A;  4PFP A;  3JRD A;  4KFC A;  2P0W A;  5ILS A;  2DT7 B;  3CJQ B;  1X3Z B;  4QPO A;  3SQN A;  1YFH A;  3GTM J;  2OJE D;  5J8F A;  2NVX J;  2NAZ A;  1YTY A;  3KP3 A;  4HOB A;  3C2H A;  1XD7 A;  2G7H A;  4CYC A;  5F0C A;  1OQY A;  3ONQ A;  1W0U A;  1X19 A;  2YU3 A;  4A3J J;  1YQA A;  3VYT B;  1YJW I;  2BHY A;  3PL8 A;  1BIA A;  1TTY A;  4NC8 A;  1IG7 A;  4M6X A;  2HQ5 A;  2VKD A;  5LRR A;  1HKQ A;  1OCR H;  1UJ8 A;  3IRQ A;  1T2K A;  2MG4 A;  2W00 A;  2AQE A;  2F4M B;  2TCT A;  5GP9 A;  2B0L A;  4PJJ A;  1ZHF A;  4IRH A;  1YW9 A;  4IX7 A;  3V8L A;  4IL6 C;  2STW A;  4PZJ A;  1IO2 A;  1WWX A;  3N05 A;  2QUF A;  3F72 A;  3IRR A;  4UVA A;  2YPR A;  2KJB A;  3BZK A;  4BY7 J;  1WH5 A;  3PNY A;  3NAR A;  4YFK F;  1O3T A;  3CJN A;  1PUE E;  4WWC A;  4G7H F;  4M6V A;  3PM1 A;  1ZTR A;  2O9L A;  1S7E A;  5JHU A;  3F21 A;  4LFU A;  2FMY A;  1SFK A;  2BEO A;  2FOK A;  2OQG A;  1OR7 C;  2RKH A;  1R5H A;  2VJ5 A;  3BZ6 A;  4A5N A;  2R7D A;  3DV8 A;  4WXD A;  2VBY A;  3P9K A;  2L01 A;  1VQM I;  4LB5 A;  4XID A;  9ANT A;  1ZRF A;  2L02 A;  2LKS A;  3HRM A;  3NAU A;  5D8K B;  1VZ0 A;  1ZN2 A;  1R23 A;  3X2Q H;  3GME A;  3PUB A;  2EK5 A;  1YS6 A;  4QIW N;  3CCL I;  4EEF G;  4A2U A;  1H88 C;  4U0W A;  3FK6 A;  1OMI A;  3L1P A;  1ETQ A;  3OYG A;  5LGU A;  2JSP A;  3WGH A;  1R71 A;  1LDK B;  4BH9 A;  3W3C A;  1X4P A;  2KRH A;  4XRF A;  1ETW A;  4EM2 A;  2EFN A;  4CZZ A;  2DFF A; 
#chains in the Genus database with same CATH homology
 3KZY A;  1G4D A;  4IRI A;  4MTD A;  5KVR A;  1R1U A;  2DTR A;  3E6M A;  3RPU A;  1Z7U A;  5BQT A;  3WTT C;  3QOP A;  1HKT A;  4FX0 A;  2V6C A;  1G6N A;  1K7A A;  4BHC A;  2PBI A;  4LMY A;  5LRS A;  3RYP A;  3I58 A;  2OD5 A;  2ZNZ A;  3HOT A;  1JE8 A;  3EDP A;  1YW7 A;  2FF4 A;  5IT3 A;  3I64 A;  3QU3 A;  3KP6 A;  3ZMV A;  1BN5 A;  4D0P A;  2FEZ A;  3F8C A;  2GXB A;  2Q8K A;  4A12 A;  5CVU A;  1YG2 A;  1FZP B;  1PDN C;  3JAM Z;  4NQW A;  1GVJ A;  3KFW X;  5AIQ A;  2OQR A;  4EQQ A;  5HDN A;  1X3U A;  2HGC A;  2EWN A;  2DK8 A;  2LDU A;  4ZYH A;  1FBS A;  2QBY B;  3WTZ A;  4A5M A;  3D0S A;  4M72 A;  5DV5 A;  1XSV A;  5BPD A;  1PP7 U;  2K7L A;  3GZ5 A;  4IJA A;  4CIC A;  1QPM A;  4B8X A;  2ETH A;  1XDS A;  3TO6 A;  3H3Z A;  3W6J B;  5F1R A;  2FU4 A;  3VFZ A;  1Z9C A;  5LGT A;  2E7X A;  4GXO A;  3KP4 A;  4KDP A;  3K1M A;  2A6H F;  1ZLK A;  4KYW A;  4UVC A;  4EM1 A;  3FZV A;  3IWF A;  5BMZ A;  1H0M A;  2YX7 A;  1ON2 A;  3OV8 A;  5ICE A;  1XN7 A;  1MD0 A;  4RGU A;  4R79 A;  1WRJ A;  3VOE A;  2PG4 A;  5LBQ A;  4MGR A;  4EM0 B;  2D1H A;  3U2R A;  5FD5 A;  3FF5 A;  1SD5 A;  2RQP A;  2DQR A;  1USS A;  1HW2 A;  1TNS A;  4EMS A;  3GVA A;  3HYI A;  1FX7 A;  1DDN A;  4G9Y A;  5E1Z B;  2UWM A;  4TV7 A;  2IA1 A;  3ZQ7 A;  1J2X A;  2E1C A;  2H6B A;  4CDG A;  3L2C A;  1ZYR F;  3ABU A;  2ZNY A;  4S05 A;  3BWG A;  4HW0 A;  3HRU A;  3PQK A;  4M74 A;  2MD5 A;  2IPQ X;  4PGG A;  1Z1D A;  4A6D A;  4L18 B;  3I53 A;  3ABT A;  1VTN C;  4KUM A;  3HRT A;  5DD4 A;  2CO5 A;  1R58 A;  4WXC A;  2IP2 A;  1IRG A;  3K1P A;  2HS5 A;  2O03 A;  2YSR A;  1FLI A;  4HQE A;  1RNL A;  4AVP A;  1OYW A;  2VOO A;  4U7D A;  1U3E M;  2D2W A;  1J0R A;  3QAH A;  3QP5 A;  3ROU A;  2FA5 A;  3ULQ B;  2VT2 A;  2OBP A;  3GZ6 A;  2EA4 A;  3RI4 A;  3Q9V A;  4RAY A;  1H9T A;  3ZMS A;  4IHT A;  3KCC A;  1OYI A;  1XGM A;  3DXJ F;  1ONV A;  2FBI A;  1J75 A;  2RVC A;  4Q47 A;  3HSE A;  1KA8 A;  1ZAO A;  1Z91 A;  1YS7 A;  1S6L A;  1WSU A;  1YW8 A;  1BM9 A;  1IN5 A;  3FMR A;  2GA1 A;  2GQQ A;  2HDC A;  1YYV A;  1GXP A;  5A2Q K;  3BDD A;  2JTV A;  4LLN A;  4G8X A;  1ZAR A;  2AS5 F;  1REP C;  4G94 A;  4RGS A;  1DUX C;  3DEU A;  3QPT A;  5AON A;  3DFG A;  4GCV A;  5JI6 A;  4ASN A;  2V1U A;  1BOA A;  1S8N A;  2VXZ A;  3KEQ A;  5J6X A;  2OZU A;  5FFZ A;  3V8K A;  4ZYD A;  2XKP A;  4MEY F;  3MFK A;  2P6T A;  1ODD A;  1R00 A;  3JW4 A;  3GXO A;  1O3R A;  2ZME B;  4AIH A;  3CLO A;  4LK1 F;  1F1Z A;  3F6V A;  4BXU A;  2ELH A;  5DYM A;  3IKV A;  4KIC A;  2FBH A;  4AD9 A;  1FSE A;  6PAX A;  1JHF A;  4L5I A;  4KMF A;  2IW5 A;  3RDI A;  1D5V A;  3J81 K;  5E1W A;  2HKX A;  2HWV A;  2UZK A;  5LHH A;  2O61 A;  1IXR C;  1LVA A;  1R5G A;  1UHW A;  4MQV A;  1O3S A;  1D8K A;  4PCQ A;  3E6B A;  1YO5 C;  1ZH5 A;  2VN2 A;  3LQR A;  2O3F A;  1FY7 A;  4M9S A;  4LGW A;  2XGX A;  4JQF A;  2CGP A;  2JZY A;  2VC1 A;  3FXQ A;  4RS8 A;  3JTG A;  3T1B A;  2BYV E;  1KQ8 A;  2K86 A;  1SD4 A;  2F5C A;  2UXX A;  4BQA A;  5FD6 A;  4KN4 X;  3QPH A;  4HDU A;  4EJV A;  1B59 A;  2DI3 A;  2NYX A;  4Z2Y A;  2FNP A;  3GYH X;  5L3F A;  2F5E A;  2UXN A;  1W7P A;  2M30 A;  2HTJ A;  2GIV A;  5ILU A;  2XAS A;  1LEA A;  1FT9 A;  4ZYE A;  2RC4 A;  3C7J A;  4UXN A;  3RYR A;  4P9U A;  3ZPL A;  3DF8 A;  2Z99 A;  4O6J A;  3M9A A;  1XB4 A;  3DQV C;  5E1X A;  1S3J A;  3MWM A;  3D5L A;  4OOI A;  3TQN A;  1IXS B;  2CFX A;  2G7U A;  3LQQ A;  2RNJ A;  4DNC A;  1MJ9 A;  3T0Y A;  1GXQ A;  2R7F A;  1P92 A;  5ERI A;  4I09 A;  3MZH A;  1LDJ A;  1XGS A;  1SD7 A;  1TNT A;  2ADU A;  3REO A;  2D45 A;  4M71 A;  2DAO A;  1OYY A;  3IHU A;  3GUD A;  3J81 Z;  2JT1 A;  3F8M A;  1BJA A;  4LB6 B;  3HOS A;  2A69 F;  2BV6 A;  2QBY A;  4IHS A;  1TW2 A;  1DP7 P;  3TOA A;  2TDX A;  3I5U A;  3OOP A;  5CYV A;  4EJU A;  2QQ9 A;  5HDK A;  1T6S A;  4XSX F;  4Q5S F;  1XMA A;  1Z05 A;  1T38 A;  4F7Z A;  3TGN A;  3LAP A;  1HXD A;  1QBJ A;  2VE8 A;  3DPL C;  3VOD A;  3I4P A;  2PMH A;  3K0L A;  2XAQ A;  5LGN A;  2Y48 A;  4A0Y A;  2A68 F;  2DLL A;  3T8R A;  3RPQ A;  4RB3 C;  2V1X A;  3FXR A;  2EFQ A;  3M8F A;  4O3M A;  2OAZ A;  4O5V A;  3E6C C;  3P9I A;  2X4H A;  2NRA C;  1QZZ A;  5TJJ A;  4ENN A;  4ESF A;  2DW4 A;  3ZMU A;  3EUH A;  3ZMT A;  2XRN A;  3MZY A;  4L9V A;  3GLX A;  1JHH A;  1K78 A;  4KMU X;  4CGZ A;  4FX4 A;  1LDD A;  4I2O A;  3I0T A;  2XAJ A;  4H0E A;  4LG0 A;  4WCG A;  2RV8 A;  4YII A;  5FGM A;  1QO0 D;  1WKM A;  3BP8 A;  2FXA A;  2W25 A;  1L0O C;  4RB0 A;  1FSH A;  2KKO A;  2XUB A;  3WTX C;  4L9N A;  3U1D A;  1EV7 A;  4RB2 C;  1ON1 A;  3C18 A;  1LNW A;  4KIB A;  1U5T C;  3E3V A;  2IRF G;  3E97 A;  2V1D A;  2PI0 A;  3GX4 X;  2ZXJ A;  2VBZ A;  1NHA A;  1LJ9 A;  2VBX A;  5ILV A;  4G7O F;  4EVI A;  4IVN A;  1O3Q A;  4GGG A;  1I5Z A;  1OPC A;  2WTE A;  4WK8 F;  5D5W B;  5K1Y A;  1O7L A;  3GFL A;  3ZMZ A;  2WWY A;  4QWQ A;  2Z33 A;  4HLY A;  3BPX A;  4RGX A;  5FO5 A;  3CUQ B;  4BYY A;  1I6X A;  1FYL A;  4EJT A;  4L0Y B;  5CLS A;  2MH2 A;  3L00 A;  1UB9 A;  2XRO A;  4L0Z B;  3B02 A;  4IXA A;  2GWR A;  3BOQ A;  2ZME C;  1B9M A;  1W7P B;  1FC3 A;  4HLX A;  2K02 A;  3R61 A;  2HOE A;  5JFR A;  3F22 A;  4ENK A;  1HW1 A;  4M9Z A;  5KK1 A;  1R36 A;  2MLG A;  4S04 A;  4XLN F;  4AIJ A;  3EYY A;  1U5T A;  3RIR A;  2DPU A;  3KLO A;  4HQM A;  5HDG A;  4ESB A;  2W85 A;  4MTE A;  4BAY A;  3I71 A;  3IWZ A;  3SFZ A;  4Y15 A;  1U2W A;  1G3Y A;  2JSC A;  5JR3 A;  2LF8 A;  2FRH A;  5HVQ C;  4KIG A;  4I7H A;  4RAZ A;  3DPT A;  1V4R A;  4OMY A;  2MA3 A;  4M6Y A;  3WE3 A;  5TRD A;  1TQI A;  1G3S A;  5L3C A;  3C3W A;  4PGH A;  1KYZ A;  2IVM A;  1FYM A;  4KT5 C;  2FBK A;  3GWZ A;  3M8E A;  2H94 A;  1YIO A;  2A5Y B;  2QQA A;  2STT A;  2XIG A;  3L7W A;  3WGG A;  3SZP A;  5DUI A;  2XAF A;  5HS8 A;  1WI9 A;  3HRS A;  3KZZ A;  1W4M A;  1P4X A;  2CG4 A;  2L4M A;  2KJC A;  2XAG A;  1J7K A;  2L54 A;  2ZJ2 A;  4HA8 A;  1R1V A;  1HST A;  1P2F A;  4LLL A;  4BHP A;  1T98 A;  2Y0M A;  5DDG A;  4WXH A;  4HF1 A;  4G6D A;  3SXY A;  3P9C A;  5D5X B;  4IRG A;  2H09 A;  3J80 Z;  3KP7 A;  2KIM A;  1XDU A;  1S7A A;  1XCB A;  3JSO A;  3M1E A;  4XLP F;  1HKS A;  2BE5 F;  3RJP A;  2M8E A;  3HIF A;  3T5X A;  1SAX A;  1FBU A;  3N4M A;  3DP7 A;  4HX8 A;  1TW3 A;  2ZCW A;  3EET A;  3E5Q A;  3R60 A;  1P6R A;  4MEX F;  2QM3 A;  2P5L C;  5L3G A;  2XVC A;  3WTU C;  3TOB A;  3TDZ C;  3LA2 A;  1P4A A;  2ZFW A;  1SD6 A;  4ENJ A;  2EFO A;  5D5V B;  5LHG A;  4YFX F;  5L3E A;  2CWE A;  5J8C A;  3J7A O;  5FFX A;  1FOK A;  3HUG A;  3O3K A;  1FNN A;  3ML6 A;  1B6A A;  2D1V A;  1G3T A;  2EJR A;  4N9H A;  3WG9 A;  1XGO A;  1HBX G;  3WU1 B;  3HHG A;  3O6B B;  4K2E A;  1SFX A;  3KP5 A;  5IT9 K;  1MKM A;  4Q4Z F;  3NRV A;  3ERE D;  5AIP A;  2PLY A;  4OMZ A;  2P7V B;  1OKR A;  3H92 A;  2MLK A;  4CHU A;  2FML A;  1BC8 C;  3EYI A;  2VT3 A;  3B73 A;  2ESN A;  3GFJ A;  5ED4 A;  2DU9 A;  4AWX B;  2P6S A;  4UV9 A;  3K1N A;  3IC7 A;  4I02 A;  3FM3 A;  3Q9S A;  2VOD A;  1STZ A;  2PFB A;  1R1T A;  2NS0 A;  5HOO A;  2ZO4 A;  3E5U A;  2OU2 A;  4LD5 A;  3HTS B;  4A6E A;  5HLI A;  4GYG A;  4N0B A;  3FX3 A;  1XSX A;  2E1N A;  2MBF A;  1TBX A;  3ZN0 A;  3I59 B;  1W5T A;  4P9F A;  2MC3 A;  1R22 A;  3QRF F;  2Q2E A;  3F3X A;  1IAW A;  1RIO H;  1CF7 A;  1U5T B;  1ZG3 A;  2HZT A;  1TLH B;  4OU0 A;  4OIN F;  3W6K B;  2DT5 A;  3K2Z A;  3LWF A;  2FQ3 A;  1F9N A;  5EEG A;  1KU3 A;  2ZKZ A;  1FBQ A;  2BGC A;  2YR2 A;  2O6G E;  4U7B A;  1S29 A;  4KIF A;  4KNY A;  2IJL A;  2DO7 A;  3LAJ A;  2EFW A;  1EH6 A;  4NHJ A;  4M73 A;  1L3L A;  3WU0 A;  2QQB A;  3U9G A;  3SZT A;  3T8T A;  3QP6 A;  5D4S A;  3BJ6 A;  2H27 A;  5ICF A;  2EFP A;  5E17 F;  1I1G A;  3R6S A;  4AIK A;  2XKO A;  2FE3 A;  2K4J A;  2RGV A;  2O0Y A;  2XV4 S;  2ZBK A;  2LKP A;  3I59 A;  1XGN A;  3N97 A;  2K27 A;  1K6O A;  4ZZD A;  5LHI A;  3GEZ A;  1MDM B;  4OIR F;  3FMQ A;  2Z5U A;  1C0W A;  1Y0U A;  4HX7 A;  2QYO A;  3WOD F;  1KYW A;  1SMY F;  5K5O A;  3G3Z A;  3HSR A;  1K79 A;  2GAU A;  2LF7 A;  4I01 A;  1QGP A;  5HS7 A;  2YX4 A;  2RDP A;  5LEJ A;  2DQL A;  2GA2 A;  5DCM B;  2OZ6 A;  1E17 A;  1UHM A;  4P96 A;  1HSJ A;  4BHB A;  2WV0 A;  3VEP A;  1SFE A;  2ZME A;  2BBY A;  4RGR A;  4WF2 A;  2JRT A;  1RUO A;  4N9I A;  4P5O A;  4ZZL A;  5FB2 A;  3HHH A;  1KU9 A;  2F5D A;  2M1B A;  2CQK A;  1Z6R A;  3F8F A;  1HQC A;  3R4K A;  1ZGJ A;  4E70 A;  2FNA A;  4YG2 F;  3ZMD A;  1LQ1 A;  1J9I A;  1MJA A;  2P7C B;  4MHG A;  4CO8 A;  2W24 A;  3JAM K;  2QLZ A;  1Q1H A;  3CO7 C;  5DEQ A;  4HV5 A;  4UVB A;  3JTH A;  3GFI A;  3E5X A;  1Z6T A;  4MQ9 F;  4G7Z F;  2HFH A;  2KRF A;  2QVO A;  4U0V A;  3KEO A;  3EQL F;  4MNU A;  1K78 B;  1XMK A;  2P4W A;  1H9G A;  2Z9O A;  3QU6 A;  3ZN1 A;  2HQN A;  3V8J A;  2EA2 A;  1MZB A;  5DUK A;  1IF1 A;  2L4A A;  4OIO F;  2AXL A;  3RTR A;  5ICC A;  5A2Q Z;  2QWW A;  2HQR A;  3V7R A;  3KP2 A;  1FWZ A;  4RB1 A;  1XSD A;  5L3B A;  2GZW A;  2K4B A;  2DFI A;  3BJA A;  1TQM A;  1D3Y A;  4FT8 A;  4EJW A;  2NNN A;  3BRO A;  3CUQ C;  3SHF A;  2EV6 A;  2HYG D;  4HF0 A;  1KQ0 A;  2HKO A;  3CO6 C;  3RKX A;  2V79 A;  3WTV C;  1IRF A;  2IA0 A;  4L5J A;  2DK5 A;  1ZRE A;  1IZ1 A;  3VB2 A;  3FMS A;  5BPI A;  3GO5 A;  4ZYG A;  1W7P D;  1YLF A;  1FP2 A;  2XHK A;  4ZH4 F;  4UV8 A;  1J59 A;  3F23 A;  3KET A;  4ETS A;  4CYD A;  1SFU A;  2OA4 A;  4L9T A;  1QQI A;  3COA C;  3MQ0 A;  4HYE A;  1ZG5 A;  4Y13 A;  1BI1 A;  3L09 A;  1DPU A;  4FHT A;  3PQJ A;  2PN6 A;  4NB5 A;  2EB7 A;  1IN6 A;  1ZRC A;  1S7O A;  1JGS A;  5HS9 A;  3TKY A;  3CTA A;  3ZP5 A;  3HTU A;  3CDH A;  3GW2 A;  1IN7 A;  1AWC A;  5F6F A;  3WTY C;  3DKW A;  5E20 A;  2XAH A;  3WTS C;  2CW0 F;  3TO7 A;  1ZLJ A;  2ISY A;  2FSW A;  3Q5F A;  3C1D A;  5CVJ A;  1B1B A;  1V3F A;  3MEX A;  4Q48 A;  4LJZ F;  1QZY A;  1IN8 A;  3IL2 A;  3L9F A;  1FPQ A;  1ZGA A;  1WQ2 A;  4LK0 F;  4IPA A;  1RUN A;  1U78 A;  1OR7 A;  4OIQ F;  2DBB A;  4CXF A;  4EGY A;  2V9V A;  3PFI A;  3F6O A;  5BS6 A;  3FM5 A;  4YIF A;  1O57 A;  4XSZ F;  3G73 A;  5K5R A;  3GF2 A;  1EH8 A;  1ULY A;  2MH9 A;  3BJO A;  4EJO A;  4EGZ A;  5H20 A;  4I0B A;  5E8I A;  5LEK A;  1BC7 C;  1F5T A;  2CSO A;  1MDM A;  1KU2 A;  2P8T A;  4GYI A;  4XBF A;  3MCZ A;  5D6F A;  2P5V A;  2M45 A;  1LB2 A;  4EV0 A;  2F2E A;  4Y17 A;  2M87 A;  2PJP A;  1A04 A;  1IUY A;  1W5S A;  2HR3 A;  4P55 A;  5D6E A;  2ESH A;  4KA4 A;  2JPC A;  1AOY A;  4LG0 B;  4L9J A;  1PP8 F;  2EV5 A;  2L3D A;  1DPR A;  1MJB A;  3J80 K;  4PDK A;  2KIF A;  5E8G A;  2VC0 A;  3RKY A;  5FLX Z;  3V4G A;  3FHZ A;  3NEU A;  4IF4 A;  4A0X A;  4A0Z A;  2W57 A;  3HSF A;  3O2P E;  4JK1 X;  1D8J A;  5F64 A;  3M7G A;  1CGP A;  5JVT A;  2LSO A;  1MGT A;  5CJ9 A;  5L3D A;  1U6G A;  5H6R A;  3BPV A;  3S2W A;  3ELK A;  2COM A;  3MAJ A;  1CF7 B;  3AAF A;  4HX4 A;  1UCR A;  5D4R A;  5DCF A;  4JBA A;  2O8X A;  3F8B A;  3K9T A;  3WE2 A;  4DQ2 A;  5ICG A;  2PEX A;  4LLG F;  5D8L B;  3R0J A;  3NQO A;  3I54 A;  3FXU A;  4HV6 A;  4ENM A;  5HLH A;  1EH7 A;  2KIU A;  3LFK A;  1P4W A;  1BBY A;  4UHT A;  5EEH A;  4BNC A;  2IT0 A;  2J5P A;  1J5Y A;  2Y75 A;  2QZ8 A;  5LLQ A;  4HZF A;  2J5O A;  1E2X A;  2HYF A;  3E6D A;  1GHC A;  1B4A A;  5H6Q A;  1T0F A;  4YFN F;  1UST A;  1R7J A;  1XCV A;  3GFM A;  5DCM A;  2W84 A;  3LA3 A;  2ACJ A;  2C6Y A;  1G3W A;  1HW5 A;  3K69 A;  4R8H A;  2F5F A;  2ISZ A;  3ECH A;  4U88 A;  5HLG A;  4HDV A;  1RI7 A;  3WTW C;  4M9X A;  3TO9 A;  5D5U B;  4I98 B;  2A07 F;  1JXS A;  1KQ9 A;  1ZG1 A;  1QNT A;  4ON0 A;  1SMT A;  5CVR A;  2WC2 A;  3WGI A;  1B9N A;  1IW7 F;  1KU7 A;  5BOX A;  3KE2 A;  4HBL A;  2A6E F;  3BY6 A;  4KN7 X;  3FWE A;  1IN4 A;  1O7F A;  4WX9 A;  1BI2 A;  4B09 A;  2DPD A;  3IKT A;  1U8R A;  3ISP A;  3KLN A;  2VOP A;  1I1S A;  2QEN A;  2X0L A;  1UFM A;  3ECO A;  2A3S A;  3LST A;  2JPB A;  5DD8 A;  5K5Q A;  1T39 A;  3R0A A;  3CUQ A;  1F4K A;  1LEB A;  2RN7 A;  1I27 A;  3CUO A;  4ESJ A;  2PQ8 A;  4G6Q A;  2EV0 A;  5E18 F;  3H3U A;  2Q0O A;  2HEO A;  4GO1 A;  2P5K A;  1BI0 A;  4R1H A;  1IXC A;  2R3S A;  3V7C A;  2CYY A;  2Z3Y A;  4UUV A;  3RKW A;  1BIB A;  2E7W A;  2HTS A;  1FYK A;  5IT9 Z;  3JSP A;  4I0A A;  2NNY A;  5CVI A;  2H6C A;  1BI3 A;  3P7N A;  4QLC U;  2G9W A;  3V7S A;  3LA7 A;  3TDU C;  4U0Y A;  1TQP A;  2VE9 A;  5FLX K;  4HF2 A;  2PMU A;  2IA2 A;  1KGS A;  1ZRD A;  4OIP F;  3F8N A;  4HAM A;  1RZ4 A;  2M5W A;  2A61 A;  2VBW A;  2GXG A;  2VON A;  1FP1 D;  4UNO A;  2LNB A;  5CVV A;  4KFC A;  5ILS A;  1YFH A;  3SQN A;  5J8F A;  2NAZ A;  1YTY A;  3KP3 A;  4HOB A;  1XD7 A;  2G7H A;  2YU3 A;  1YQA A;  1BIA A;  1TTY A;  4M6X A;  5LRR A;  1HKQ A;  3IRQ A;  1T2K A;  2B0L A;  1ZHF A;  4IRH A;  1YW9 A;  3V8L A;  2STW A;  4PZJ A;  1WWX A;  2QUF A;  3F72 A;  3IRR A;  4UVA A;  2YPR A;  2KJB A;  4YFK F;  1O3T A;  3CJN A;  1PUE E;  4WWC A;  4G7H F;  5JHU A;  3F21 A;  4LFU A;  2FMY A;  2BEO A;  2FOK A;  2OQG A;  2RKH A;  1R5H A;  3BZ6 A;  4A5N A;  2R7D A;  3DV8 A;  4WXD A;  2VBY A;  3P9K A;  2L01 A;  4LB5 A;  1ZRF A;  2L02 A;  3HRM A;  5D8K B;  1ZN2 A;  1R23 A;  2EK5 A;  1YS6 A;  4A2U A;  4U0W A;  1OMI A;  5LGU A;  3WGH A;  1LDK B;  4BH9 A;  4XRF A;  4EM2 A;  2EFN A;  4CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...