1XB4A

Crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
201
structure length
180
Chain Sequence
MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
molecule keywords Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
total genus 56
structure length 180
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05871 ESCRT-II ESCRT-II complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xb4A02
1.10.10.570 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "Winged helix" DNA-binding domain. Chain C. Domain 1 1xb4A01
5ILSA 3JSPA 1B9MA 1MGTA 4RAZA 4KN4X 2DPUA 2OA4A 4UVAA 1WI9A 3I53A 3FMRA 1O7FA 4OOIA 3WE3A 1HW2A 4PGGA 3IWZA 1ZYRF 2P5KA 1L3LA 2ELHA 4ZYDA 4Y17A 2X0LA 3RTRA 1O3QA 2L01A 5JFRA 3F3XA 5ERIA 2HYGD 3L09A 4A6DA 2R3SA 2HOEA 2M8EA 4U7BA 3MZYA 4GCVA 4LJZF 1DPRA 2EB7A 4OIOF 3RKWA 4HDUA 1FT9A 1JGSA 3LA2A 2ZMEA 4Q4ZF 1EH7A 1Z7UA 2DO7A 1MZBA 4DNCA 4KYWA 1U5TB 2FE3A 2O61A 1SD5A 3M1EA 1FNNA 1T6SA 1F5TA 4AIJA 1WRJA 1QZYA 4RS8A 2VC1A 2WWYA 2PQ8A 1KU9A 1J7KA 4CYDA 1K6OA 4TV7A 2KJCA 1KQ0A 4KDPA 4P9UA 3AAFA 2HKOA 1XSVA 5J8FA 4UV8A 2HWVA 1I27A 5LGTA 1F1ZA 1MJ9A 1XGMA 2BV6A 5BMZA 1SMYF 3QPTA 2R7FA 1O3RA 1LVAA 1T0FA 4G7OF 3V8LA 1BBYA 2Y0MA 3SHFA 1OKRA 4PDKA 2V79A 2CGPA 1OYWA 3U1DA 4A0XA 4HW0A 3V4GA 2RV8A 2PEXA 1FPQA 3RPUA 2VBWA 3DF8A 2P6SA 4WF2A 4N0BA 3EUHA 1IXSB 2OQGA 3WTTC 5ED4A 1D8JA 4B8XA 3WTSC 2EFOA 4O5VA 2W24A 2Q0OA 4AD9A 1P6RA 2EV5A 1WQ2A 1R5GA 1SMTA 3ZMVA 3TO7A 2O0YA 3VEPA 1DP7P 3GFMA 2CFXA 4IHSA 3HHGA 3GXOA 3BPXA 4EJTA 1UCRA 1G4DA 1R1VA 3ISPA 1FSEA 3K69A 3ULQB 1WWXA 3HSFA 3ABTA 3RYRA 3BROA 4GO1A 2BE5F 1CF7B 4BAYA 1ZRFA 2IRFG 2UXNA 1G3YA 4LB5A 5DCFA 3LFKA 2YSRA 2ZBKA 1UFMA 4ENKA 1A04A 2KRFA 4WX9A 4UV9A 1XGOA 2A5YB 5DD8A 1K7AA 1XB4A 2JPCA 2QZ8A 5L3EA 1EV7A 3HOSA 3RDIA 1H9TA 5FO5A 2JTVA 1S8NA 3F6OA 4HV6A 2YX7A 4QLCU 1SAXA 3Q9SA 2CYYA 2EFPA 2BYVE 2GXBA 1IRFA 5HLGA 3I58A 2FBHA 1EH6A 5LRRA 4XLPF 2EFNA 3GVAA 1BN5A 1ZARA 1S7AA 3KP3A 3HRUA 3DFGA 2GWRA 2JZYA 4HX7A 3WU1B 4ENNA 1YIOA 1F4KA 5FFZA 2E1NA 1KQ9A 1FYKA 3KZYA 5E17F 2D1HA 3DP7A 2A6EF 1YFHA 2IPQX 4EM0B 3I64A 3HIFA 3WE2A 5KVRA 1KQ8A 3BWGA 3TOAA 2W84A 3C3WA 4MNUA 4P9FA 2PMHA 1ULYA 3COAC 2RGVA 4R8HA 2RKHA 3R4KA 1D3YA 2DTRA 5D4RA 4HLYA 1BI0A 5LEKA 1IN8A 2QWWA 3GX4X 2RN7A 4WK8F 2V6CA 4L9JA 4G6DA 4HAMA 2ISZA 3BDDA 2W25A 4AIHA 2GXGA 1TNTA 2A69F 2RNJA 3E97A 1JXSA 2G9WA 3WTUC 1FYMA 4Y13A 3E3VA 4Y15A 3EYIA 4U88A 5LEJA 2H6BA 3C1DA 1BC8C 2DQRA 1BC7C 4WWCA 5A2QK 4ESBA 4EGZA 4OINF 3V7CA 5D8LB 5ILVA 1KU7A 4MEYF 3KE2A 3HSRA 4P55A 2XROA 4A2UA 4Q5SF 4N9IA 2IT0A 5DCMB 1DUXC 2MH2A 3QPHA 1ONVA 2VT2A 5D6FA 2F5DA 4L5JA 4MHGA 4U0VA 1ZAOA 2Z9OA 2ZNZA 1NHAA 5LGNA 4XRFA 4IJAA 1IUYA 2DU9A 3I71A 3K1NA 2J5OA 3RKYA 1XMKA 2L4MA 2VOOA 1R36A 3F8MA 1HKQA 1DPUA 1W5TA 5DUIA 3CJNA 2A07F 3ECHA 1XCVA 2FBKA 2MC3A 1QQIA 4KMUX 2RDPA 4GGGA 5K1YA 4CDGA 3F8CA 3IWFA 4D0PA 5H6QA 3CLOA 1REPC 5FGMA 3P9KA 1XDUA 4KN7X 4HF1A 1Q1HA 4MTEA 2LF7A 2XKPA 1JHFA 3QP5A 2IA1A 3BPVA 4Q47A 1ZH5A 1ON2A 1IN7A 4HX4A 1BJAA 3GFLA 4I01A 4U0WA 4O3MA 3RPQA 2HEOA 2ADUA 1U3EM 4MQ9F 5CVRA 1IW7F 1QGPA 3VOEA 5ICEA 4YG2F 1BM9A 5F64A 1MKMA 2P8TA 3HHHA 3JW4A 3CUQB 2FMYA 5J6XA 5HDKA 2A6HF 2UZKA 2AXLA 2PBIA 4BYYA 2RQPA 3TQNA 1P2FA 3QU6A 2L3DA 1YO5C 1FWZA 2FMLA 1GXPA 3GZ6A 4HYEA 4LB6B 3D5LA 1LB2A 2VBXA 1ZHFA 3WGGA 4EM2A 1U5TA 2F2EA 2R7DA 2ZMEB 4MGRA 1RUNA 3CO6C 4BXUA 1UHMA 3H3ZA 3GEZA 1IAWA 4G7ZF 3F6VA 2RC4A 5D8KB 4LK1F 2M45A 2BBYA 3M8FA 2LKPA 5J8CA 3DXJF 2ZMEC 1O3SA 1U78A 4NHJA 4KFCA 1BI3A 2H6CA 3GLXA 3REOA 1E2XA 2DK8A 2EJRA 3RYPA 4KNYA 3KFWX 1FSHA 2COMA 3FXRA 3K2ZA 1SFXA 5CYVA 1HKTA 4G9YA 2G7HA 1W4MA 6PAXA 4A0YA 1HXDA 3ABUA 1R58A 1W5SA 3EDPA 3ZMUA 1J9IA 3J80Z 2FF4A 3ROUA 2HZTA 3F21A 3I59A 3DPTA 1IN5A 4IVNA 4QWQA 2VODA 5D5WB 4RB1A 2PMUA 3HRMA 4XSXF 3L7WA 1ZREA 4RB2C 4WXHA 5AIPA 3O2PE 4F7ZA 1AOYA 4ENJA 3B73A 2LSOA 2IA2A 4ESFA 4RGUA 5CVVA 3J81K 2OU2A 4FX4A 4I98B 3HYIA 2WTEA 3CDHA 3E6CC 3U2RA 4HZFA 3WTZA 4GYGA 3RKXA 3CUQC 2FBIA 4HBLA 1ZRDA 3GFIA 3IKTA 3DPLC 1HW5A 2YR2A 4S05A 2VXZA 2VC0A 5HLIA 3HUGA 4PCQA 1J5YA 2OD5A 4L9VA 5D5XB 3ELKA 3EETA 1ZLJA 3SZPA 4AVPA 3V7RA 3ZMDA 2UWMA 2HR3A 3ZQ7A 3I54A 3SZTA 2QUFA 1KGSA 3F22A 2HFHA 1IF1A 1ON1A 5DEQA 2ACJA 4YFNF 3J7AO 4IPAA 2D2WA 4RAYA 1MDMA 1PDNC 1LQ1A 2E7WA 1ZLKA 2XAQA 1KYZA 1I1GA 4HLXA 2HQRA 3LQQA 4IRIA 2FOKA 1FC3A 1CGPA 1J2XA 3T0YA 2L02A 1HQCA 1G3SA 2ISYA 1VTNC 4EJUA 5HS8A 4EMSA 2ZO4A 1P4XA 4ENMA 2DT5A 1J0RA 3IKVA 3C18A 2DK5A 5LRSA 1Z6RA 1DDNA 1YG2A 4RGXA 3U9GA 4XBFA 2CSOA 4KMFA 5LBQA 2HTSA 3JTHA 2HDCA 2M87A 3L9FA 3HRTA 2YX4A 4U0YA 3TDZC 5JHUA 1YTYA 1XD7A 4UXNA 2ESHA 2VBZA 3KP7A 3ML6A 4A5NA 1ZG3A 2VT3A 1FY7A 2VE8A 1MD0A 1G3TA 2QYOA 1FLIA 5E18F 4L18B 3B02A 1OYYA 2XUBA 2LDUA 1RZ4A 1YS6A 1FYLA 2K4BA 1T39A 2GA2A 1G6NA 5HS9A 1B4AA 2ZCWA 1C0WA 1Z9CA 2M30A 2YPRA 3RIRA 2W57A 4CO8A 2Q2EA 2NNYA 1HBXG 3WTXC 5L3GA 5L3CA 1TBXA 3C7JA 3WODF 5FD6A 2IVMA 5HLHA 3MFKA 2PN6A 4AWXB 1KU3A 5BPIA 4DQ2A 2XAFA 4HF2A 4YFXF 3WG9A 3F23A 3SQNA 3OOPA 2MLKA 3HSEA 5DYMA 2YU3A 3F8BA 1LNWA 3FM3A 3DKWA 1RI7A 2WV0A 4BNCA 3MWMA 3KCCA 3F8FA 4LD5A 1ZG5A 3R60A 4ON0A 1GVJA 1Z05A 3LA7A 5LHHA 3K1MA 2RVCA 4HA8A 2M1BA 1B1BA 1IZ1A 3M9AA 1LDDA 2A3SA 5TJJA 1STZA 1USTA 3V7SA 4ETSA 4G6QA 1R1TA 4AIKA 4KIFA 2DQLA 2MLGA 1MJBA 4U7DA 4A12A 1O3TA 4LLNA 2O3FA 5BQTA 1TNSA 2L4AA 1SD6A 4GYIA 1ZG1A 2NRAC 3CTAA 3E6DA 2Z3YA 4M9ZA 5L3BA 2QQ9A 3WTVC 1K78A 3JSOA 4WCGA 3GUDA 2O8XA 1R5HA 2QM3A 2KIFA 4H0EA 2C6YA 1T38A 5D5UB 3LAPA 1LDJA 1OR7A 1MDMB 1B6AA 3HRSA 4PZJA 3E5UA 2JPBA 4I02A 2FXAA 2NAZA 3GF2A 1HSTA 5LHIA 4OIQF 2P7VB 4BHPA 3R61A 2K4JA 2Y75A 2NS0A 2ZFWA 3JAMK 2K86A 1UHWA 1B59A 5E1ZB 1O7LA 1ZGJA 1GXQA 3BJOA 1BIBA 5CVIA 3KP2A 5LHGA 4OMZA 5FB2A 4BQAA 3G73A 2V1UA 1QZZA 3I5UA 2ZXJA 4UVCA 1IXCA 2PFBA 4N9HA 1U5TC 1QO0D 3CO7C 4I2OA 2DI3A 4S04A 1X3UA 5JVTA 1FBUA 3CUOA 5K5QA 4IF4A 1IRGA 3QU3A 3MQ0A 2ESNA 4IRGA 5ILUA 5TRDA 1Z91A 3T5XA 2HKXA 2TDXA 5L3FA 3IRQA 1XSXA 3GFJA 3GYHX 1PUEE 5IT9K 3Q9VA 2GZWA 2LF8A 4RGSA 3QP6A 4FX0A 2OZUA 5K5RA 4XLNF 1ZN2A 1IXRC 1YQAA 2W85A 3DEUA 1USSA 4RB0A 4A6EA 4HQMA 5HDNA 5HDGA 4LG0A 2STWA 1WKMA 1XGSA 2KIMA 1G3WA 1SD7A 2B0LA 1PP8F 4WXDA 1QBJA 5A2QZ 3FHZA 2OQRA 2GAUA 2DBBA 1TW3A 4LLGF 4ZH4F 3ERED 3LAJA 3GZ5A 4EJWA 2ZNYA 2H09A 2OBPA 3EYYA 3VB2A 4BHCA 1EH8A 4CHUA 1LJ9A 4L9TA 5CLSA 3FXUA 3IL2A 3ZMSA 1TLHB 2Z99A 1FBQA 1AWCA 2PG4A 1OMIA 2XVCA 4NB5A 5DV5A 2DAOA 4OIRF 3T1BA 3VFZA 1P4WA 1KU2A 3FX3A 5H20A 3FF5A 4I09A 1R00A 4OMYA 4IXAA 4ZZDA 5AONA 4L0ZB 3WTWC 4P5OA 2D45A 1BI1A 2VN2A 3VODA 5E8GA 5L3DA 4CZZA 1RUOA 2DW4A 2NYXA 3PFIA 3W6KB 3TDUC 2ETHA 2BGCA 2CG4A 2XRNA 1R1UA 4A5MA 4BH9A 3G3ZA 5F6FA 3MCZA 3SFZA 4UNOA 1XDSA 5LGUA 3DV8A 3ZMZA 1CF7A 1HW1A 3KP4A 3OV8A 5ICGA 2MBFA 1LEAA 2MA3A 1U2WA 1PP7U 4P96A 3BJAA 3S2WA 4M72A 2K27A 4EJVA 3H3UA 4EJOA 2DPDA 3BY6A 4KICA 2AS5F 2QVOA 2STTA 4HV5A 4M6XA 3EQLF 4KIGA 3TO9A 2EFQA 5E1XA 4I0AA 2HS5A 2VOPA 2CO5A 4OU0A 1BOAA 1Z1DA 2IA0A 2Y48A 1XSDA 3K0LA 1T2KA 5ICFA 3FZVA 3LWFA 2GA1A 1L0OC 2JRTA 2JT1A 2HGCA 1Z6TA 2O6GE 1IN4A 2QLZA 4LG0B 1UB9A 4JQFA 2XAGA 3JAMZ 2ZKZA 3WGIA 1P4AA 3T8RA 4MEXF 2P6TA 1OYIA 2IW5A 2V9VA 3PQKA 2PJPA 4M74A 1JHHA 2K02A 5DUKA 3MEXA 2FNAA 5CJ9A 1KYWA 1TW2A 2BEOA 1YW9A 1Y0UA 2OZ6A 3WU0A 4L5IA 3KETA 1IN6A 1FP1D 4CICA 2CWEA 5ICCA 1FX7A 3W6JB 5LLQA 1S6LA 3KLNA 3FMQA 5D4SA 3ZN0A 3E6MA 4HF0A 4PGHA 2KKOA 2WC2A 4M6YA 4G7HF 2EV0A 2F5CA 2XHKA 2XV4S 2HTJA 2MH9A 1O57A 4O6JA 2DFIA 5FD5A 4GXOA 4LMYA 1QNTA 2FRHA 2XAHA 3ZMTA 2P5LC 1OPCA 3KZZA 1TQMA 2D1VA 5D6EA 2P7CB 1RNLA 3R6SA 4B09A 2XIGA 2Z33A 1J59A 3FM5A 2E7XA 3WGHA 2DLLA 3FXQA 1E17A 3R0AA 3HOTA 2FEZA 1TTYA 2XAJA 4HX8A 2QENA 1FZPB 3N4MA 5DDGA 1XCBA 3FWEA 4KT5C 4R1HA 5DD4A 1TQIA 2EA4A 4CGZA 3R0JA 4HDVA 2X4HA 2ZJ2A 3V8KA 1K79A 4EVIA 3RI4A 2OAZA 3TO6A 3BZ6A 4EV0A 1W7PD 4NQWA 2VONA 2F5EA 4R79A 4UUVA 2Z5UA 4EGYA 3WTYC 4Q48A 2Q8KA 4KA4A 3MAJA 2IP2A 3F8NA 1J75A 1R22A 5F1RA 5CVJA 4MQVA 1XGNA 4UHTA 1V4RA 2JSCA 1F9NA 3I59B 2KJBA 2H27A 3P9IA 5EEHA 1FBSA 2XASA 5BOXA 4YFKF 1HKSA 3CUQA 3M7GA 5HOOA 4ZYEA 3N97A 1H0MA 3PQJA 4WXCA 5FLXK 2L54A 1XN7A 5EEGA 1SFUA 4E70A 5HS7A 2FU4A 4CXFA 4L0YB 1QPMA 3ZPLA 2A68F 3V8JA 1BIAA 5H6RA 3HTSB 2XKOA 2P4WA 3BP8A 2V1DA 3E6BA 3NRVA 3P9CA 3KP5A 2QQAA 3I4PA 3LA3A 2LNBA 2K7LA 3JTGA 2EK5A 4G8XA 2PI0A 2J5PA 4A0ZA 3TGNA 3E5XA 3D0SA 1ZRCA 4ZYGA 1I1SA 2EFWA 4LGWA 5BPDA 5K5OA 4M9SA 3IRRA 3FMSA 1S3JA 4Z2YA 3QRFF 1K78B 2GQQA 5BS6A 2FQ3A 1YLFA 1B9NA 3BOQA 3RJPA 3T8TA 3KEOA 1YYVA 2M5WA 1XMAA 5HVQC 2VBYA 4YIIA 1HSJA 1S7OA 2QBYB 3NQOA 4M71A 5D5VB 4I0BA 3KEQA 4JBAA 1SD4A 4FHTA 5JI6A 1R7JA 3Q5FA 1BI2A 4YIFA 2O03A 3QAHA 1ZGAA 2A61A 2QBYA 2V1XA 4M9XA 3MZHA 3IHUA 4LLLA 1U6GA 4KUMA 1LDKB 1SFEA 4MTDA 1YS7A 3O6BB 2HQNA 4XSZF 1FOKA 4L9NA 4UVBA 3HTUA 3IC7A 2GIVA 2PLYA 2F5FA 1U8RA 3GW2A 3LQRA 3ZN1A 2FSWA 3SXYA 1R23A 1YW8A 1P92A 5CVUA 4JK1X 4ZZLA 3TOBA 1ODDA 3K9TA 2VE9A 4IHTA 2NNNA 2UXXA 3O3KA 5IT9Z 1GHCA 2P5VA 1MJAA 3KP6A 3QOPA 4RB3C 1LEBA 3GO5A 2HYFA 2EWNA 2G7UA 4I7HA 1V3FA 3H92A 3ECOA 1H9GA 4RGRA 1I5ZA 2FNPA 3TKYA 4K2EA 3GWZA 3K1PA 4HOBA 5DCMA 2CQKA 3L00A 3E5QA 2CW0F 5E1WA 3J80K 5FLXZ 1KA8A 4KIBA 3ZP5A 5AIQA 3F72A 3BJ6A 3L2CA 1TQPA 4ASNA 2E1CA 4ZYHA 4OIPF 3DQVC 2XGXA 1I6XA 4LFUA 4G94A 2QQBA 1JE8A 1D8KA 1S29A 4EM1A 2IJLA 5FFXA 3I0TA 3J81Z 4EQQA 5JR3A 2EV6A 5E20A 5E8IA 2FA5A 2KIUA 1D5VA 1WSUA 4ESJA 1RIOH 2EA2A 1T98A 2H94A 2MD5A 4FT8A 3M8EA 4IRHA 1W7PB 4BHBA 1FP2A 5KK1A 5IT3A 3KLOA 1W7PA 4M73A 4HQEA 4LK0F 3P7NA 3NEUA 3LSTA 1YW7A
chains in the Genus database with same CATH superfamily
4DYCA 3GMEA 5ILSA 3JSPA 1B9MA 2DA2A 2XSDC 1MGTA 4RAZA 3JRIA 2LBFA 4KN4X 3VYTB 2DPUA 4NBQA 2OA4A 2KIQA 4UVAA 2LC2A 1WI9A 3CCLI 3D1NI 2VPRA 1KONA 3CCQI 3QQAA 3I53A 1DP3A 3FMRA 1O7FA 3PUBA 4OOIA 3PFYA 3WE3A 1HW2A 2R7WA 2ECCA 3HXLA 4PGGA 1MW7A 3IWZA 2JA8J 3K4NA 1ZYRF 2P5KA 1VQPI 5IP7J 2VQHA 1L3LA 2ELHA 2Q1ZB 4ZYDA 4Y17A 3CCMI 1JI8A 2X0LA 3RTRA 1O3QA 1ZR4A 1DQUA 3SJMA 4IHWA 2L01A 5JFRA 3F3XA 4DJAA 3EUAA 3MD2A 5ERIA 2HYGD 3L09A 3S14J 4A6DA 4HNUA 2R3SA 1HOMA 3EUHC 3ERMA 2HOEA 4X1EA 1X2NA 2M8EA 3ASOH 4RM3A 3ZOBA 3GTLJ 3ZXSA 2TCTA 4ABZA 3UR3C 4U7BA 2IGNA 3MZYA 5GAEJ 3MKYB 4GCVA 2BY1A 3GZNB 4LJZF 2A05A 1X58A 1DPRA 2EB7A 4C2MJ 4OIOF 1OCZH 2IBDA 3H9QA 3RKWA 4HDUA 3ABLH 2LYCA 3KIOA 3CMEI 1FT9A 1JGSA 3LA2A 2ZMEA 4Q4ZF 1EH7A 1Z7UA 2DO7A 1MZBA 4DNCA 3GLLA 4ZDPA 4KYWA 1U5TB 2FE3A 4XMYA 2O61A 5FKNA 1SD5A 3M1EA 4XKBA 5GP9A 1FNNA 1T6SA 2ZJQF 1F5TA 1A5JA 4AIJA 4XONA 1WRJA 2CUEA 1QZYA 4BL0B 4RS8A 2VC1A 2WWYA 2PQ8A 3K10A 1KU9A 5M5XJ 1SFOJ 1J7KA 4CYDA 1TT5B 5TISC 1K6OA 4TV7A 2KJCA 1KQ0A 2EZKA 3ASNH 4KDPA 4HPQA 3PJRA 4P9UA 2R5ZA 3AAFA 2QSHX 1G2HA 2YS9A 1T8IA 1UAAA 5DM6F 2HKOA 4QPQA 1XSVA 2R7XA 2VQLA 5J8FA 4G12A 4UV8A 2H8RA 2HWVA 1I27A 5LGTA 3VYSB 1F1ZA 2BXYA 1MJ9A 2Y0SA 1XGMA 2BV6A 2PMZN 2VJJA 5BMZA 1FJLA 3KEYA 1SMYF 3ZQLA 3QPTA 2R7FA 1O3RA 4HNVA 1LVAA 1X3ZB 2COBA 3HGYA 5B3SH 1W0TA 3OYKA 1XX5A 4UUSB 1T0FA 2E5ZA 3BLYA 4G7OF 3V8LA 1BBYA 1Y0NA 4B48A 2Y0MA 3SHFA 1OKRA 4PDKA 4YIRX 2V79A 2HOSA 2CGPA 1OYWA 2WBMA 3U1DA 2BXZA 4F55A 2CQXA 4A0XA 4HW0A 3V4GA 3BR6A 2RV8A 2PEXA 3PIOF 1FPQA 4BJTA 3A2KA 3RPUA 3U21A 2VBWA 3DF8A 1IUFA 2P6SA 4WF2A 5FROA 4N0BA 3EUHA 1EF4A 1IXSB 2DODA 2OQGA 3WTTC 2HU9A 2NVQJ 2IGMA 5ED4A 3RCOA 1D8JA 4C2TA 2V1NA 4B8XA 3WTSC 1YJNI 2EFOA 1JKPC 1VQ8I 3H35A 4O5VA 2W24A 3F9KA 4ZTFA 2M4KA 2W4SA 2Q0OA 2Z16A 1P6RA 4AD9A 2EV5A 1T0FC 1WQ2A 1TP4A 1R5GA 1SMTA 4BE0A 3ZMVA 3TO7A 4BU2A 3OY9A 2L0KA 2Y9YA 1YIJI 1IC8A 2O0YA 1DU6A 1I6HJ 1OISA 1IO2A 3VEPA 2K9QA 1HF0A 5EGOA 4RLQA 3HOZJ 1DP7P 2B9SA 5EDNA 3GFMA 2CFXA 3SDBA 4IHSA 3HHGA 3GXOA 3BPXA 4RA2A 3OYAA 4EJTA 1UCRA 1G4DA 3DU6A 1J09A 2BY2A 3KZIC 1UG2A 2H1LA 3PIPF 2R5ZB 2R5YB 1R1VA 1ITYA 3ISPA 4Y33A 1FSEA 3K69A 3ULQB 3KYLA 2JVGA 1YX3A 3DEEA 5LD2C 1TWGJ 1WWXA 3HSFA 2XC7A 1N25A 3ABTA 2HPMA 2EPFA 3RYRA 1EA3A 1RKTA 3WHCA 1VNDA 3BROA 4GO1A 2BE5F 1CF7B 4BAYA 1ZRFA 2IRFG 2UXNA 1G3YA 2BOLA 3GTGJ 4LB5A 5DCFA 2OPTA 1ZR2A 3LFKA 2YSRA 2ZBKA 3K70C 1UFMA 4ENKA 1A04A 2KRFA 4WX9A 2DOAA 4UV9A 1XGOA 2A5YB 5DD8A 2K85A 1K7AA 1XB4A 2JPCA 2QZ8A 5L3EA 1EV7A 4XKWA 2E2IJ 4BS9A 3HOSA 3RDIA 1H9TA 3S3NA 5FO5A 2JTVA 1S8NA 3W2AA 4HG2A 3F6OA 3L2WA 1NK3P 4HV6A 2NS7A 1RC9A 2YX7A 1Y39A 4QLCU 1XPXA 4EEFG 1SAXA 3Q9SA 2GOMA 3H9GA 1YHQI 2X48A 1V5FA 2CYYA 2EFPA 2BYVE 2CUZA 1BR4A 2R7UA 2GXBA 2DJNA 2IGKA 3QOEA 1IRFA 4AYBN 5HLGA 3I58A 3CJTB 1ORKA 1OCPA 3TL4X 1EH6A 1JTYA 2DCEA 2FBHA 2VJ4A 2M0MA 2EFNA 5LRRA 2O7OA 3GVAA 5GAGJ 4XLPF 4V2FA 1BN5A 1ZARA 1S7AA 3KP3A 1N77A 3FISA 3HRUA 3SFIA 4E7KA 3LSPA 1V5GA 4IX7A 2JRMA 3E0JB 2GWRA 3DFGA 4XORA 2JZYA 2VIXA 4HX7A 2HVSA 3CMMA 4YELA 3WU1B 1NG7A 1R9TJ 2KPMA 4XK4A 4ENNA 5IPAA 1YIOA 2BW3B 1F4KA 2Y2ZA 2E1NA 2M34A 1KQ9A 5FFZA 1FYKA 1HDDC 2IS4A 3CCVI 3KZYA 5E79C 4N4OB 4LITA 5E17F 4A3CJ 2D1HA 3MZ8A 3DP7A 2R7TA 3RZOJ 2A6EF 3CQZJ 2IPQX 1YFHA 2BHYA 2DOFA 1X4OA 2VKHA 3I64A 2HYJA 2LH9A 2XGCA 4EM0B 4FTHA 3HIFA 1U9NA 1A6QA 1ZKGA 1E3PA 3WE2A 5KVRA 3AG1H 2PX9A 2GIZA 3S16J 1KQ8A 1ETXA 2OF7A 3BWGA 4A3MJ 1TL8A 3TOAA 4F52A 5TGTA 2W84A 3C3WA 4MNUA 1E0EA 3I9V2 4P9FA 2PMHA 1ULYA 2W1OA 3COAC 2RGVA 3BCBA 4R8HA 2JUCA 2RKHA 3QYFA 1D3YA 3R4KA 2LP0A 3HJEA 2CQNA 2VPLA 2DTRA 5D4RA 3OS2A 4HLYA 1BI0A 5LEKA 4E7ZA 4BEHB 1IN8A 2QWWA 3GX4X 1VQ9I 5FKMA 2RN7A 1QHGA 4WK8F 2ICWG 2V6CA 4L9JA 4G6DA 4HAMA 4BJ6C 3E7LA 1X2MA 3A03A 2ISZA 3H5RA 3BDDA 2W25A 4AIHA 2GXGA 3TP0A 1TNTA 2A69F 4XN3A 1FIPA 2RNJA 3SEQA 3HOYJ 3E97A 1JXSA 2G9WA 3WTUC 2DTZA 4F92B 4Y13A 1FYMA 2LREA 3FXJA 2CV2A 3E3VA 2Y30A 4Y15A 3EYIA 2LY9A 1E3OC 4U88A 3S15J 5LEJA 2H6BA 3C1DA 1WFXA 1BC8C 2DQRA 4HRIA 1BC7C 3OYGA 4WWCA 4J01A 2LKSA 5A2QK 4ESBA 4EGZA 4OINF 3V7CA 3W6VA 5D8LB 5ILVA 1LKXA 3TMOA 1KU7A 4MEYF 3KE2A 3HSRA 4P55A 4B3AA 1Y8RB 2E60A 2XROA 3RPUD 4A2UA 4Q5SF 4N9IA 1CQTA 2IT0A 4BE1A 5DCMB 1WCMJ 4BY1J 2ZC2A 4Z6YA 2LBFB 3EPZA 1YJ9I 1DUXC 2MH2A 3CJRB 3QPHA 1ONVA 1ETWA 1N78A 4FETA 2VT2A 5D6FA 5FKLA 2UUZA 3TW6A 2WB1A 2Z2SB 3OSFA 4E7LA 3FBIB 2YU9J 1TWCJ 4DZPA 2F5DA 5E3OA 4A3BJ 5B5EC 2MYSA 4L5JA 1WJEA 4MHGA 4U0VA 2EZLA 1ZAOA 3OYJA 2Z9OA 2ZNZA 3OOUA 1NHAA 1DGRM 2KL4A 5LGNA 3CDIA 3HOXJ 4XRFA 4BXXJ 3OIQA 4IJAA 1IUYA 2DU9A 2CJJA 4IHYA 2P81A 3I71A 2QGUA 3SZGA 5BNGA 3JRGA 2M8GX 3S1QJ 2E35A 3K1NA 2R5YA 2J5OA 3RKYA 5FKKA 2XB0X 1HCRA 1XMKA 2KLOA 2L4MA 3LSMA 5FJ8J 2VOOA 1R36A 3F8MA 4BDZA 3PL8A 1B72A 3A4CA 1HKQA 1MSEC 1DPUA 1W5TA 2RNGA 4IQ4A 4HSRA 5DUIA 2CU7A 5CQGA 3CJNA 1OCRH 5FKOA 2A07F 2R7QA 3ECHA 1XCVA 2FBKA 2MC3A 5EGOB 1QQIA 4KMUX 3FKIJ 2RDPA 4GGGA 5K1YA 1PUFA 1T56A 4CDGA 2I10A 2V7FA 3F8CA 3S1RJ 3M3YJ 4PK4A 3IWFA 2FOWA 2KRHA 4D0PA 1ENHA 5H6QA 3CLOA 1REPC 3QPSA 5FGMA 3P9KA 4C9YA 1XDUA 4KN7X 3AKZA 4HF1A 3L2QA 1Z21A 1R49A 1Q1HA 4MTEA 2LF7A 2XKPA 1JHFA 3QP5A 3ZRGA 2OCEA 3CCEI 3HKZA 3Q0UA 2IA1A 3BPVA 4Q47A 3S1NJ 1RESA 1ZH5A 1ON2A 4XIDA 1IN7A 3HDDA 3BR2A 4HX4A 3A01B 1APLC 2WAQN 1BJAA 2LRDA 3GFLA 4I01A 4U0WA 3MMYB 4O3MA 3RPQA 2R7ZJ 2JK3A 2HEOA 4F3QA 2ADUA 1U3EM 1TT0A 4MQ9F 5CVRA 1IW7F 1GV5A 1QGPA 3VOEA 3VSKA 5ICEA 3AG3H 4YG2F 4FASD 1BM9A 2KDZA 3S3MA 4BE2A 5F64A 1MKMA 2P8TA 4XOPA 3RZDJ 3HHHA 3H0DA 1GLNA 5M3MJ 4XM3A 5J1YA 5IYDJ 3JW4A 4XRSG 1TWAJ 2AHQA 1AA7A 5GPAA 3CUQB 2L5QA 2FMYA 4A3LJ 5J6XA 3CC4I 5HDKA 1FMWA 1Q1VA 2A6HF 2UZKA 2AO9A 3DBLB 2AXLA 2PBIA 4BYYA 2RQPA 3TQNA 1P2FA 2HVRA 1QU3A 3QU6A 2L3DA 1YO5C 4BKXA 4A3GJ 1FWZA 2FMLA 1GXPA 5M3FJ 3GZ6A 4HYEA 1K4TA 4LB6B 3D5LA 1LB2A 4L5EA 2VBXA 2EILH 4DIQA 2HOAA 1QHHD 1ZHFA 3WGGA 4EM2A 1U5TA 3J7AY 2ZXHA 5J47A 5GAHJ 2F2EA 3LSHA 2R7DA 2ZMEB 4MGRA 4AVZA 3SEZA 2VUMJ 1JT0A 3DBRB 1RUNA 3ESWB 3CO6C 4BXUA 1UHMA 3H3ZA 3GEZA 3VDXA 3CLQA 1IAWA 1V5EA 4OWRB 3K4LA 4G7ZF 2DA6A 3W2WA 4B44A 3F6VA 2RC4A 5D8KB 4LK1F 1IG7A 2M45A 2BBYA 3M8FA 2LKPA 5J8CA 2TRTA 3DXJF 3CCSI 1Z67A 2ZMEC 1O3SA 3LL7A 1U78A 4N4NB 4EATA 4NHJA 1D0ZA 1A6IA 4KFCA 4ZYAA 4UY8I 4BUPA 2LD5A 2HQAA 3OYBA 1BI3A 2H6CA 3PSIA 1JGGA 3GLXA 3HM5A 2DOEA 4ZTJA 5K7ZA 3REOA 4C3IJ 1E2XA 2DK8A 2EJRA 3RYPA 1TWHJ 2YUSA 3PUFA 4KNYA 3KFWX 1FSHA 2CRGA 2KT0A 1PYVA 2COMA 2JUGA 2LTPA 3FXRA 4ZC3A 3K2ZA 1SFXA 5CYVA 2EIMH 1HKTA 2A6TA 4G9YA 2G7HA 1W4MA 2IGOA 4UUSA 2A5WA 3KYCB 6PAXA 5CQEA 4A0YA 1HXDA 4J19A 2L9SA 1R58A 3ABUA 1D1CA 1W5SA 3EDPA 3ZMUA 1J9IA 3J80Z 2FF4A 1WJAA 3ROUA 2HZTA 3F21A 3ZQGA 2F5VA 3I59A 3DPTA 3ABMH 1IN5A 4IVNA 3K4CA 4QWQA 1MMSA 2VODA 1VFCA 2HXIA 4CA0A 5D5WB 4RB1A 4C3HJ 2PMUA 4BGDA 2JA5J 1SEUA 1H88C 1MBFA 2L7FP 3HRMA 1QRYA 4XSXF 3L7WA 1ZREA 4RB2C 3I4MJ 3MKLA 5HNHA 2F4OB 4WXHA 3QYBA 5AIPA 2EIJH 3O2PE 4F7ZA 1AOYA 1GDTA 4NQWB 2FD5A 4ENJA 1P7JA 3B73A 2M4GA 2IAIA 2LSOA 4V2GA 2IA2A 4ESFA 2KRCA 4RGUA 5CVVA 3J81K 1KZHA 2OU2A 4FX4A 2E1MB 4I98B 3HYIA 2PJRA 2WTEA 3CDHA 4BBRJ 4E6KG 3E6CC 1W1WE 3U2RA 4GDFA 3ZQFA 4HZFA 3NARA 5HNFA 1ZK8A 3DEWA 3WTZA 2DA3A 4GYGA 3DCFA 1S72I 3RKXA 3HL2A 3CUQC 2FBIA 4HBLA 1ZRDA 4XRSA 3GFIA 3IKTA 5M5YJ 1N75A 3DPLC 1HW5A 2YR2A 4S05A 2XF6A 2E1MC 2Y0SN 2R0QC 2VXZA 4G6TB 2VC0A 3DLAA 5HLIA 3HUGA 1Z0XA 4DOZA 4ZDOA 4PCQA 1HA8A 4I6ZA 1I3QJ 1ERDA 1RR8C 1J5YA 3H5NA 2OD5A 2HPIA 2LY1A 4L9VA 4AM3A 5D5XB 3ELKA 3CF2A 3EETA 1ZLJA 3SZPA 4AVPA 3V7RA 4RAFA 3CC7I 3ZMDA 2UWMA 2DT7B 4QPOA 2HR3A 3ZQ7A 3H5AA 2CMPA 2HOTA 3I54A 2B7EA 3SZTA 4A3FJ 2X1EA 3H3VK 3HG9A 1I3AA 2QUFA 1KGSA 3F22A 2HFHA 5K7HA 2R7OA 1IF1A 1ON1A 2M9HA 1YITI 2X6WA 5DEQA 1JJ8C 4MFEA 1O4XA 5F27A 2ACJA 4YFNF 3K4BA 4M3EA 3J7AO 4IPAA 2LK2A 1MMAA 4AUXA 2EBIA 2NXNB 2B63J 2K9NA 1WH7A 2JJ7A 2D2WA 4PJNA 2E34A 4RAYA 1JKOC 1MDMA 1PDNC 4BJ5C 2H8WA 1LQ1A 2E7WA 2QSFX 2VASA 4BEHA 1ZLKA 2XAQA 2DFFA 2I8DA 1ZELA 3OYNA 4KITB 1KYZA 1I1GA 1T95A 4HLXA 2O8KA 2HQRA 3IH2A 4JOMA 3LQQA 4IRIA 4BQOA 2FOKA 1FC3A 1MNEA 4RBOA 4I76A 1CGPA 4YRVA 3BG7A 2RREA 1J2XA 4D5CA 4XLCA 4HNTA 3CCUI 1NH3A 3T0YA 3PNVA 2L02A 1HQCA 1G3SA 1W36C 2ISYA 3B6AA 5B1BH 4UB8C 5KCMA 3G6EI 1VTNC 3VWBA 1MMGA 1A35A 2X6XA 4KISA 4EJUA 5HS8A 1G8XA 4EMSA 2ZO4A 4BY7J 4DW6A 1P4XA 4CSWA 4ENMA 3GCMA 2DT5A 1J0RA 3IKVA 1R4NB 2DK5A 3C18A 5LRSA 1Z6RA 4M6VA 1DDNA 1YG2A 4RGXA 3U9GA 4XBFA 2CSOA 2K9SA 3F0CA 3J7ZI 4CCNA 4KMFA 2ID6A 3M1CA 2R7SA 5LBQA 3LSJA 2HTSA 2VXDA 3JTHA 2HDCA 3K70D 4FISA 2M87A 1IRZA 4ZDLA 4GRIA 2VJIA 3HRTA 3L9FA 2YX4A 3MVPA 3TDZC 4U0YA 5JHUA 2HVQA 1YTYA 1XD7A 2DA4A 2ESHA 2IXSA 4UXNA 2HI3A 1HC8A 2VBZA 3KP7A 5B1AH 3ML6A 4RMNA 4RLFA 3NWSA 1RPWA 3OYEA 4A5NA 1Y1WJ 1WJBA 2V9PA 3PSFA 1ZG3A 2QQ8A 1QZEA 2VT3A 3FXMA 2XGEA 3TEDA 1E3HA 4XOTA 1BW6A 1FY7A 2LY2A 2VE8A 3J7YJ 3G1LA 1MD0A 1G3TA 3G2BA 2QYOA 4JYKA 1FLIA 3N05A 4PJ0C 1MH3A 2M2EA 5E18F 4E4HA 4F93B 4XLHA 4L18B 2EIKH 3B02A 1R4MB 1OYYA 2CS3A 4IKFA 2XUBA 5DS9A 4XICA 2LDUA 1RZ4A 3FXLA 1YS6A 1VQNI 3O8HA 1FYLA 1OJLA 2K4BA 1T39A 3MN2A 2GA2A 1G6NA 5IY5H 4HSTA 3BG9A 5HS9A 1B4AA 3M4OJ 2ZCWA 1C0WA 2DMNA 3IH4A 4V19K 1Z9CA 1RRJA 2M30A 2YPRA 4II3A 2K3PA 3RIRA 2W57A 4AIDA 1PUFB 2DMQA 4CO8A 1F43A 2Q2EA 2DMTA 2VJ5A 2NNYA 4XR6A 2R4GA 1HBXG 3WTXC 5L3GA 2Q2EB 5L3CA 4A3IJ 2JQ7A 2EH3A 1TBXA 3C7JA 3A1YA 2W48A 5CPRB 1JT6A 3WODF 1V55H 4ZJZA 3QPLA 5FD6A 2IVMA 4YEJA 5HLHA 1MBEA 3RKQA 3MFKA 2PN6A 2CUFA 4AWXB 1KU3A 3RQ4A 5BPIA 4QSHA 5J4VA 4DQ2A 2XAFA 4HF2A 4YFXF 3WG9A 1VQMI 2ZB9A 1WVRA 1B8IA 3SQNA 3F23A 1VI0A 1VQLI 3OOPA 2MLKA 3HSEA 1SVMA 3HEFA 2ECBA 5DYMA 4UB6C 2YU3A 3F8BA 1LNWA 3FM3A 1D1BA 3DKWA 1VQKI 4FE7A 1RI7A 2WV0A 4FQGA 2EQRA 4BNCA 3MWMA 3Q3SA 2F6CA 3H1CA 3OIOA 3MKWB 3KCCA 3F8FA 4LD5A 1ZG5A 3R60A 4FE4A 1IGNA 4ON0A 2DJIA 2X6YA 3A02A 4XLEA 4DYQA 5IYCJ 5E3LA 4B4CA 1GVJA 2OJED 2V26A 1Z05A 5E3NA 3H9JA 3LA7A 5LHHA 3K1MA 2RVCA 4JX5A 4HA8A 5EEAA 2M1BA 4ANJA 1B1BA 1BR2A 1K6YA 1IZ1A 3M9AA 1LDDA 1A36A 2A3SA 5C4JJ 4NNJA 3S2HJ 5TJJA 1STZA 1USTA 3V7SA 1LE8A 4D9JA 4ETSA 4G6QA 1R1TA 4AIKA 2RAEA 1ETQA 4KIFA 2DQLA 1VQ4I 2MLGA 2XDVA 1MJBA 1UMQA 4U7DA 4A12A 1O3TA 4LLNA 1UG0A 2O3FA 5BQTA 1TNSA 2L4AA 1SD6A 4KT6A 4GYIA 3M07A 1ZG1A 3QODA 2VQCA 2NRAC 3CTAA 1XC5A 2EZHA 4CH7A 2AQFA 3E6DA 4AU7A 3WHBA 2Z3YA 4M9ZA 1S5LC 5L3BA 2QQ9A 1W0UA 5KAFC 2DA5A 3WTVC 1SVOA 1K78A 3JSOA 4BQQA 4WCGA 1XMXA 3GUDA 2E71A 2O8XA 1R5HA 2QM3A 2KIFA 2L9VA 3LSKA 4H0EA 1GT0C 3FBNB 1ETOA 3D5SC 1LFUP 2C6YA 3RSNA 1AKHB 1T38A 2KFDA 5DM7F 1MIJA 5D5UB 3LAPA 1LDJA 4QIWN 3GTOJ 3OYDA 3OR1C 4NC8A 3DBHB 2DDBA 4XLAA 3JRHA 1X1DA 3BTCA 1OR7A 1MDMB 4LOCA 4DYRA 3BTLA 3HRSA 1B6AA 2L7KA 2CFOA 2K5CA 4PZJA 3E5UA 3K4KA 4CCKA 2JPBA 2ME6A 3BG5A 3CP2A 3L2UA 2GLOA 4B3XA 4I02A 2FXAA 4PJLA 2NAZA 3GF2A 1HSTA 5LHIA 1T33A 4XKVA 4OIQF 1K83J 1UZCA 1XG1A 2P7VB 3DWLE 3FHNA 4S0HB 5EF6A 4MFDA 5KNLA 4X6AJ 4BHPA 4DBRA 3R61A 2K4JA 2Y75A 4IQJA 1W36D 3ZR8X 2NS0A 2DT6A 2ZFWA 2K86A 3PM1A 3JAMK 2JN6A 1UHWA 1B59A 1OLTA 3L1PA 5E1ZB 2VI6A 3KX2A 4IHVA 3BT9A 2E36A 1F36A 1O7LA 1VQ7I 1ZGJA 3IAS2 1GXQA 1W5CC 3BJOA 1ZQ3P 5E3MA 4A3EJ 1Y8QB 5F08A 1BIBA 5CVIA 3KP2A 2BY0A 5LHGA 4OMZA 1ZTRA 5FB2A 4BQAA 3NAUA 4IO9F 3G73A 9ANTA 2V1UA 5C44J 1QZZA 3I5UA 2ZXJA 4UVCA 2JA6J 1IXCA 2WA0A 3BTJA 2CUJA 2PFBA 2RQQA 3DLLF 4N9HA 1U8BA 3HBLA 1U5TC 1QO0D 1X3WB 4A69C 1NG6A 2DDAA 3CP8A 4AC0A 3CO7C 1WI3A 4I2OA 2NOGA 1H8AC 2DI3A 2O5RA 4S04A 1X3UA 5JVTA 1FBUA 3JRAA 3CUOA 5K5QA 4IF4A 1IRGA 3OYMA 2ID3A 2IEKA 5JLXA 3QU3A 2HDDA 3MQ0A 2ESNA 4IRGA 5ILUA 5TRDA 1Z91A 3T5XA 4XLFA 4XL9A 3CZ6A 3LFUA 2HKXA 2TDXA 5L3FA 3IRQA 1XSXA 5IP6A 3GFJA 1ETYA 3GYHX 2BHZA 3OL3A 1PUEE 3ZQIA 3DPUA 4PJMA 5IT9K 3GTMJ 3OL4A 3Q9VA 2QCOA 2GZWA 3D5RC 2LF8A 4RGSA 3QP6A 2OTJI 4FX0A 1OR7C 2OZUA 2WAQA 5K5RA 5IYBJ 4XLNF 1X1CA 1ZN2A 1IXRC 1YQAA 3DKXA 3ZCOA 2W85A 4JX6A 2LG4A 4W97A 2KMUA 3DEUA 2E19A 1USSA 3S2DJ 1GUUA 4RB0A 2GXAA 4A6EA 4HQMA 3OYIA 5HDNA 5HDGA 1YJWI 4LG0A 2STWA 1BL0A 1JTXA 1WKMA 1XGSA 2KIMA 4C30A 1G3WA 1SD7A 2B0LA 4M3DA 1PP8F 4WXDA 4Y4RA 1T08B 1QBJA 1A31A 5A2QZ 5JLWA 4PFPA 1WZ2A 3FHZA 2OQRA 2GAUA 2DBBA 1TW3A 4LLGF 4ZH4F 3ERED 1RKWA 3LAJA 3HC7A 4A3KJ 3GZ5A 4EJWA 2ZNYA 4IHXA 2KP6A 4B43A 2BW3A 2H09A 2KISA 2OBPA 1LE8B 1Y1VJ 3EYYA 4IOCF 3VYUB 4M3BA 3VB2A 3CC2I 4BHCA 1EH8A 4CHUA 1LJ9A 1X19A 2MSYA 4L9TA 1WPKA 5CLSA 1BJZA 3FXUA 3OWTA 5J3LA 3IL2A 1MBJA 3ZMSA 1TLHB 2Z99A 1FBQA 2ELKA 1AWCA 2PG4A 2VQGA 1AHDP 1OMIA 4D1QA 2XVCA 4NB5A 5DV5A 5LFAA 4A93J 4B1RA 3A0HC 3BR3A 2DAOA 2FJ1A 3BR0A 4OIRF 3S93A 3T1BA 3VFZA 5B66C 1P4WA 1WH5A 1KU2A 2LOOA 2W82A 2IS1A 3QYEA 3FX3A 5JHFA 5H20A 2QSGX 3IH3A 4Y3OA 3TBIA 3FF5A 4I09A 2F4MB 1HLVA 4CYCB 1R00A 4OMYA 1WJDA 4Y52J 4IXAA 1WJ5A 5KHDA 3MKZA 1WGXA 3NWTA 3DKYA 4ZZDA 5AONA 4L0ZB 3O8GA 2OV7A 3WTWC 4P5OA 2D45A 2X9DA 1BI1A 2VN2A 3VODA 1OFCX 5E8GA 5GTHC 4OAZA 3UNGC 4BBSJ 5L3DA 4CZZA 5IP9J 3BG6A 3FK6A 5EG0A 1FIAA 1RUOA 2MW8A 2DW4A 2NYXA 4II2A 5GPCA 3PFIA 5H2FC 3W6KB 3GBGA 3TDUC 2ETHA 2BGCA 2CG4A 2ZJRF 2XRNA 1R1UA 1OCOH 2DA1A 4A5MA 4BH9A 4NC7A 2WADA 3AG2H 1ZGWA 3G3ZA 5F6FA 4RM2A 3DU5A 3MCZA 3CF5F 3SFZA 2L7ZA 4UNOA 1XDSA 3CESA 3E1SA 4W1UA 3C2BA 5LGUA 3DV8A 2JWTA 3OYHA 3BQYA 3ZMZA 1CF7A 1HW1A 3KP4A 3FKJA 3OIPA 3OV8A 5ICGA 2X85A 2MBFA 4X0GA 1FTTA 3KPHA 1LEAA 2MA3A 2I5UA 4E7JA 1IDYA 1U2WA 1PVEA 1PP7U 4P96A 3BJAA 3S2WA 2E2HJ 4M72A 2NVXJ 2K27A 4EJVA 3H3UA 1MNMC 4EJOA 2DPDA 2FX0A 3IAM2 3BY6A 4KICA 2AS5F 2QVOA 1EJ9A 2STTA 1Z3XA 4HV5A 3A01A 3OMYA 4M6XA 2CQQA 2X6OA 2E1OA 1MMNA 2KQRA 3EQLF 4KIGA 2H1KA 2LR8A 2EFQA 3TO9A 3VPRA 5E1XA 2CW7A 4I0AA 2HS5A 2VOPA 1S9HA 2CO5A 4OU0A 5DTDA 4DGWB 1BOAA 3BZCA 4OAYA 2R92J 3I3LA 1Z1DA 2IA0A 4BQNA 2Y48A 1XSDA 1RR7A 3K0LA 3L2RA 4M3FA 1T2KA 3K7AJ 5ICFA 3FZVA 3CCJI 2BVLA 3LWFA 1POGA 2GA1A 4PFOA 1L0OC 2JRTA 2JT1A 2HGCA 1Z6TA 2XPVA 3BC8A 2O6GE 2DFHA 1IN4A 2QLZA 4LG0B 1UB9A 2CW8A 2NOJB 4JQFA 2AQEA 2XAGA 3JAMZ 2L2OA 5IOYA 4JX4A 1YI2I 2ZKZA 3WGIA 4XN0A 1P4AA 2ZJPF 4C2UA 3T8RA 4MEXF 2P6TA 1IV6A 1JUMA 1OYIA 2IW5A 2V9VA 5M5WJ 2FUG2 1DGWY 3PQKA 2PJPA 4M74A 2V6EA 1SANA 4I99C 3W2VA 1JHHA 2K02A 5DUKA 3MEXA 2FNAA 5CJ9A 1KYWA 1TW2A 4IEJA 2BEOA 1YW9A 1Y0UA 2OZ6A 3WU0A 2LVSA 4L5IA 3G1MA 3KETA 3IV5A 1FOYA 5J1UA 1IN6A 1FP1D 1VF9A 4CICA 2CWEA 5ICCA 3C2HA 2GM4A 1FX7A 1MH4A 3W6JB 2WV1A 3WU2C 4F91B 5LLQA 1S6LA 2DA7A 3VSLA 1Z7LA 3KLNA 3FMQA 1D5YA 3PNTA 2BZTA 5D4SA 3ZN0A 2DXIA 1DU0A 3ZQCA 3E6MA 1PJRA 3A0BC 1QVTA 4IL6C 3BQZA 3AFHA 1JKQC 4AYBA 4HF0A 4PGHA 1XTAA 2KKOA 2WC2A 4M6YA 4G7HF 1I50J 2EV0A 4CCJA 2JA2A 2F5CA 2XHKA 2KZVA 2XV4S 2HTJA 5GADJ 2MH9A 1O57A 3K4MA 4O6JA 2WB1N 2DFIA 3AG4H 5FD5A 4GXOA 4LMYA 3IUOA 1QNTA 2D5VA 2FRHA 2XAHA 3ZMTA 1BW5A 5J40A 1VQ5I 2P5LC 4CCMA 1MMDA 1Z77A 1OPCA 3KZZA 1TQMA 3BZKA 2D1VA 5D6EA 2DFEA 2XRLA 2E2JJ 1QVUA 2P7CB 1RNLA 4D5FA 2IS2A 4RDUA 3R6SA 1P9QC 4B09A 1UHSA 2XIGA 2Z33A 3OS0A 5GTIC 3BTIA 1J59A 3FM5A 2QKMB 2E7XA 3WGHA 1P7IA 2DLLA 4E7HA 3FXQA 3HB9A 1E17A 3R0AA 3HOTA 5C3EJ 2FEZA 1TTYA 2XAJA 1IRXA 1LFPA 2L9NA 1R5ID 4HX8A 2QENA 3BR1A 2DMPA 1MNDA 1FZPB 3N4MA 5DDGA 2MABA 4XQFA 5FLVA 2L7MP 1XCBA 3FWEA 4KT5C 4R1HA 5DD4A 4CCLA 3U1KA 2CV0A 1TQIA 2EA4A 3C2GA 2HZDA 3OYCA 4CGZA 3R0JA 4HDVA 3JRBA 1X4PA 2X4HA 1IJWC 5CKTA 1UELB 3HUGB 3GTKJ 2OTLI 3HOUJ 1RETA 2CV1A 3LMMA 2ZJ2A 3V8KA 1K79A 4EVIA 3B6CA 2XF5A 4MIMA 2EZIA 3RI4A 2OAZA 1YX5A 3TO6A 1JKRC 3SYTA 3BZ6A 4EV0A 3ZQHA 1W7PD 1YOVB 4NQWA 2VONA 2F5EA 4R79A 1JUSA 2M7AA 4UUVA 2Z5UA 4EGYA 3ZGKA 1SFKA 2X51A 1R71A 2XSJC 3WTYC 1G59A 5F0FA 4Q48A 4LG3A 2X1DA 2Q8KA 4KA4A 2N8GA 2CH0A 3MAJA 2IP2A 1JUPA 1Y56A 2PJRB 3F8NA 4MLOA 3SDGA 3G4SI 1J75A 1R22A 5KAIC 5F1RA 5CVJA 4MQVA 1XGNA 4UHTA 1V4RA 2JSCA 1F9NA 3I59B 2R7RA 2KJBA 2H27A 5HODA 2VKEA 3P9IA 2NVYJ 4GFBA 2DYRH 4KJZA 1FBSA 2XASA 5EEHA 5BOXA 3BG3A 2KHMA 3FIWA 4YFKF 1HKSA 2VKDA 2M0CA 3CUQA 3M7GA 5HOOA 4ZYEA 1FTZA 3N97A 1H0MA 3PQJA 3CD6I 4WXCA 3S3OA 1Z3YA 2M3AA 2L54A 5FLXK 1XN7A 5EEGA 1SFUA 1TC3C 4E70A 4BACA 5HS7A 2FU4A 5F0HA 4CXFA 3HPHA 4L0YB 3X2QH 1QPMA 3S8PA 3ZPLA 2A68F 1QA6A 2PMZA 1YE9A 3V8JA 1BIAA 3TP3A 5H6RA 3JR9A 2WY8Q 3H0GJ 2VLAA 3PO2J 1TWFJ 4QTRA 2IS6A 3LNQA 2ZSIB 1ETVA 1LFBA 4BXFA 3HTSB 2XKOA 2EINH 2P4WA 3BP8A 3Q0VA 2V1DA 3E6BA 3NRVA 3P9CA 3KP5A 1R6RA 2QQAA 2XPUA 3I4PA 3LA3A 3V42A 2LNBA 2K7LA 3JTGA 3GTJJ 1LPQA 3K2AA 5FRNA 2EK5A 2LFBA 5F0CA 4C3JJ 3JREA 2LKXA 4IZZA 3WG7H 1IDZA 2XF7A 4G8XA 2PI0A 4U87A 2E5NA 2J5PA 3DTIA 3ONQA 2K9MA 2DYSH 4J00A 4A0ZA 3JCUC 3LOCA 3TGNA 3S17J 2WAFA 3E5XA 3D0SA 3G71I 3CMYA 1ZRCA 3GTPJ 4Y7NJ 4HEA2 4ZYGA 1I1SA 2EFWA 2JSPA 3S32A 4LGWA 4MO7A 5BPDA 2HNHA 1X1AA 5K5OA 1YRNA 4M9SA 3IRRA 2Y31A 3FMSA 1S3JA 4Z2YA 5JVGF 3QRFF 1B8IB 1K78B 2GQQA 3K6GA 1BR1A 2UV1A 3HKZN 5BS6A 1K4SA 4A3DJ 2FQ3A 5EJCA 1YLFA 2QA4I 3I4NJ 1VZ0A 3L2VA 2ME0A 1B9NA 3BOQA 3ABKH 2X1CA 3RJPA 1D1AA 5FRMA 1OQYA 3T8TA 3KEOA 2CQ7A 1YYVA 5IOZA 3OS1A 1YRNB 4XKCA 2M5WA 1S7EA 1XMAA 5HVQC 2VBYA 5EG0B 4E7SA 3JRCA 2ZSHB 3ZQQA 2WAEA 4YIIA 1FMVA 2LLKA 1XS9A 2GOXB 2VKVA 1AU7A 1HSJA 2XAUA 3OYLA 5EZHA 4PUSA 1S7OA 2QBYB 2ZFUA 3NQOA 3EUKL 3K4JA 1WJFA 4M71A 5D5VB 2Y69H 3JRDA 4I0BA 1EKEA 3W3CA 1FOXA 2BVMA 4NUBA 2HQ5A 3KEQA 3CJQB 3QWLA 1QPIA 2WY7Q 3P5JA 1SD4A 4FHTA 4JBAA 5JI6A 1ACIA 1R7JA 1H89C 3CMAI 1BI2A 2Z1DA 2DMUA 4YIFA 3Q5FA 2O03A 2QF7A 3QAHA 1JJ6C 1ZGAA 2A61A 2QBYA 2V1XA 4M9XA 1MSFC 5J4YA 3MZHA 2MGQA 4PSXA 2MFZA 2DN0A 4D7NA 3IHUA 1MBGA 4LLLA 2NVUB 1TZLA 3FXOA 3LSIA 2MD0A 4DBQA 1LVKA 3BR5A 2XPWA 1BA5A 2KZGA 1U6GA 2R93J 4KUMA 1WHUA 3GTQJ 5K7FA 1LDKB 4XNFA 3CCRI 1SFEA 4MTDA 1YS7A 3O6BB 1GV2A 2HQNA 4XSZF 1FOKA 4P1WA 4UUTA 1VQ6I 2M7BA 4L9NA 3KYDB 3HTUA 4UVBA 1B72B 2OUMA 3IP4B 3IC7A 2QEXI 2GIVA 1SC7A 2BY3A 2PLYA 4ITVA 2XGDA 2F5FA 3FDYA 1U8RA 2V9KA 3GW2A 3AL0B 1LUJB 1M1EB 2F4IA 3LQRA 3ZN1A 2FSWA 3SXYA 4CCOA 3G1OA 1ETKA 4LIUA 3PNYA 2VB6A 3LSGA 3HPGA 2W00A 2Y9ZA 1K61A 4M3GA 1R23A 1NK2P 1YW8A 1P92A 5CVUA 4JK1X 4ZZLA 4E7IA 3TOBA 1ODDA 3VYRB 3K9TA 3TW7A 2VE9A 2JVHA 3RQIA 2P0WA 1IV8A 1GVDA 3BCAA 4IHTA 5EYRA 2NNNA 1MBHA 2UXXA 4BDYA 1U9OA 1FOWA 4CYCA 1NTCA 2MC4A 3O3KA 4LIVA 2W7NA 5IT9Z 1GHCA 3AL0C 2KDOA 3DTEA 2XB5A 2HXOA 1MJAA 2P5VA 3KP6A 3QOPA 4RB3C 4CZCA 1LEBA 3CCYA 4DZJA 1Y6IA 1VQOI 3GO5A 3OSGA 2HYFA 2EWNA 2G7UA 4I7HA 3CDLA 1V3FA 3H92A 3ECOA 2L9RA 2K40A 3JRFA 1H9GA 5F1JA 4RGRA 3S1MJ 2K3FA 2LMDA 1I5ZA 2FNPA 1UJ8A 2GBYA 3TKYA 4K2EA 1BOBA 3GWZA 3K1PA 5EZGA 2JA7J 1SAUA 4HOBA 5DCMA 2CQKA 3L00A 1SVLA 4CUGA 3E5QA 4D7MA 2K9LA 2CW0F 3M8JA 4NC6A 5E1WA 3J80K 3OYFA 3HOVJ 1WJCA 5FLXZ 1KA8A 4KIBA 3HOWJ 1V54H 2HDWA 5C4XJ 4PSWA 3ZP5A 3HZJA 3I56I 5AIQA 3DTKA 3F72A 3I55I 3BJ6A 4RAGA 3L2CA 2V4JC 2O9LA 2F48A 5HLTA 1TQPA 1HDPA 5FLMJ 4ASNA 2E1CA 1D0XA 3H36A 3HGGA 4ZYHA 4OIPF 3DQVC 2VL8A 4B47A 2XGXA 2OC6A 3PO3J 3Q0WA 4IOAF 4H4KC 1I6XA 4LFUA 4G94A 1X1BA 2QQBA 2G0EA 2MG4A 1JE8A 1D8KA 1S29A 2FQ4A 1FEXA 2AXTC 4EM1A 4XRMA 3LSRA 2IJLA 1U0JA 5FFXA 3I0TA 3J81Z 4EQQA 1MBKA 5JR3A 4PJJA 1OCCH 1AKHA 4JP0A 2ZXWH 2EV6A 4FCYA 5E20A 5E8IA 2NVTJ 2R7VA 2FA5A 2KIUA 1D5VA 4A3JJ 1WSUA 4ESJA 1RIOH 2EA2A 1T98A 2H94A 2MD5A 3UKGA 4FT8A 3M8EA 2NS8A 4IRHA 1W7PB 1X1PA 1FP2A 2QKLB 5KK1A 4BHBA 5J1RA 2ZXIA 5IT3A 2OCCH 3KLOA 1I39A 1W7PA 4M73A 4HQEA 2JMWA 4LK0F 1OCTC 3P7NA 3FK7A 3NEUA 4NDLA 3OR2C 3LSTA 3FXKA 1YW7A 5F04A 2ELJA 1D0YA
chains in the Genus database with same CATH topology
5ILSA 3JSPA 1B9MA 1MGTA 4RAZA 4KN4X 2DPUA 2OA4A 4UVAA 1WI9A 3I53A 3FMRA 1O7FA 4OOIA 3WE3A 1HW2A 4PGGA 3IWZA 1ZYRF 2P5KA 1L3LA 2ELHA 4ZYDA 4Y17A 2X0LA 3RTRA 1O3QA 2L01A 5JFRA 3F3XA 5ERIA 2HYGD 3L09A 4A6DA 2R3SA 2HOEA 2M8EA 4U7BA 3MZYA 4GCVA 4LJZF 1DPRA 2EB7A 4OIOF 3RKWA 4HDUA 1FT9A 1JGSA 3LA2A 2ZMEA 4Q4ZF 1EH7A 1Z7UA 2DO7A 1MZBA 4DNCA 4KYWA 1U5TB 2FE3A 2O61A 1SD5A 3M1EA 1FNNA 1T6SA 1F5TA 4AIJA 1WRJA 1QZYA 4RS8A 2VC1A 2WWYA 2PQ8A 1KU9A 1J7KA 4CYDA 1K6OA 4TV7A 2KJCA 1KQ0A 4KDPA 4P9UA 3AAFA 2HKOA 1XSVA 5J8FA 4UV8A 2HWVA 1I27A 5LGTA 1F1ZA 1MJ9A 1XGMA 2BV6A 5BMZA 1SMYF 3QPTA 2R7FA 1O3RA 1LVAA 1T0FA 4G7OF 3V8LA 1BBYA 2Y0MA 3SHFA 1OKRA 4PDKA 2V79A 2CGPA 1OYWA 3U1DA 4A0XA 4HW0A 3V4GA 2RV8A 2PEXA 1FPQA 3RPUA 2VBWA 3DF8A 2P6SA 4WF2A 4N0BA 3EUHA 1IXSB 2OQGA 3WTTC 5ED4A 1D8JA 4B8XA 3WTSC 2EFOA 4O5VA 2W24A 2Q0OA 4AD9A 1P6RA 2EV5A 1WQ2A 1R5GA 1SMTA 3ZMVA 3TO7A 2O0YA 3VEPA 1DP7P 3GFMA 2CFXA 4IHSA 3HHGA 3GXOA 3BPXA 4EJTA 1UCRA 1G4DA 1R1VA 3ISPA 1FSEA 3K69A 3ULQB 1WWXA 3HSFA 3ABTA 3RYRA 3BROA 4GO1A 2BE5F 1CF7B 4BAYA 1ZRFA 2IRFG 2UXNA 1G3YA 4LB5A 5DCFA 3LFKA 2YSRA 2ZBKA 1UFMA 4ENKA 1A04A 2KRFA 4WX9A 4UV9A 1XGOA 2A5YB 5DD8A 1K7AA 1XB4A 2JPCA 2QZ8A 5L3EA 1EV7A 3HOSA 3RDIA 1H9TA 5FO5A 2JTVA 1S8NA 3F6OA 4HV6A 2YX7A 4QLCU 1SAXA 3Q9SA 2CYYA 2EFPA 2BYVE 2GXBA 1IRFA 5HLGA 3I58A 2FBHA 1EH6A 5LRRA 4XLPF 2EFNA 3GVAA 1BN5A 1ZARA 1S7AA 3KP3A 3HRUA 3DFGA 2GWRA 2JZYA 4HX7A 3WU1B 4ENNA 1YIOA 1F4KA 5FFZA 2E1NA 1KQ9A 1FYKA 3KZYA 5E17F 2D1HA 3DP7A 2A6EF 1YFHA 2IPQX 4EM0B 3I64A 3HIFA 3WE2A 5KVRA 1KQ8A 3BWGA 3TOAA 2W84A 3C3WA 4MNUA 4P9FA 2PMHA 1ULYA 3COAC 2RGVA 4R8HA 2RKHA 3R4KA 1D3YA 2DTRA 5D4RA 4HLYA 1BI0A 5LEKA 1IN8A 2QWWA 3GX4X 2RN7A 4WK8F 2V6CA 4L9JA 4G6DA 4HAMA 2ISZA 3BDDA 2W25A 4AIHA 2GXGA 1TNTA 2A69F 2RNJA 3E97A 1JXSA 2G9WA 3WTUC 1FYMA 4Y13A 3E3VA 4Y15A 3EYIA 4U88A 5LEJA 2H6BA 3C1DA 1BC8C 2DQRA 1BC7C 4WWCA 5A2QK 4ESBA 4EGZA 4OINF 3V7CA 5D8LB 5ILVA 1KU7A 4MEYF 3KE2A 3HSRA 4P55A 2XROA 4A2UA 4Q5SF 4N9IA 2IT0A 5DCMB 1DUXC 2MH2A 3QPHA 1ONVA 2VT2A 5D6FA 2F5DA 4L5JA 4MHGA 4U0VA 1ZAOA 2Z9OA 2ZNZA 1NHAA 5LGNA 4XRFA 4IJAA 1IUYA 2DU9A 3I71A 3K1NA 2J5OA 3RKYA 1XMKA 2L4MA 2VOOA 1R36A 3F8MA 1HKQA 1DPUA 1W5TA 5DUIA 3CJNA 2A07F 3ECHA 1XCVA 2FBKA 2MC3A 1QQIA 4KMUX 2RDPA 4GGGA 5K1YA 4CDGA 3F8CA 3IWFA 4D0PA 5H6QA 3CLOA 1REPC 5FGMA 3P9KA 1XDUA 4KN7X 4HF1A 1Q1HA 4MTEA 2LF7A 2XKPA 1JHFA 3QP5A 2IA1A 3BPVA 4Q47A 1ZH5A 1ON2A 1IN7A 4HX4A 1BJAA 3GFLA 4I01A 4U0WA 4O3MA 3RPQA 2HEOA 2ADUA 1U3EM 4MQ9F 5CVRA 1IW7F 1QGPA 3VOEA 5ICEA 4YG2F 1BM9A 5F64A 1MKMA 2P8TA 3HHHA 3JW4A 3CUQB 2FMYA 5J6XA 5HDKA 2A6HF 2UZKA 2AXLA 2PBIA 4BYYA 2RQPA 3TQNA 1P2FA 3QU6A 2L3DA 1YO5C 1FWZA 2FMLA 1GXPA 3GZ6A 4HYEA 4LB6B 3D5LA 1LB2A 2VBXA 1ZHFA 3WGGA 4EM2A 1U5TA 2F2EA 2R7DA 2ZMEB 4MGRA 1RUNA 3CO6C 4BXUA 1UHMA 3H3ZA 3GEZA 1IAWA 4G7ZF 3F6VA 2RC4A 5D8KB 4LK1F 2M45A 2BBYA 3M8FA 2LKPA 5J8CA 3DXJF 2ZMEC 1O3SA 1U78A 4NHJA 4KFCA 1BI3A 2H6CA 3GLXA 3REOA 1E2XA 2DK8A 2EJRA 3RYPA 4KNYA 3KFWX 1FSHA 2COMA 3FXRA 3K2ZA 1SFXA 5CYVA 1HKTA 4G9YA 2G7HA 1W4MA 6PAXA 4A0YA 1HXDA 3ABUA 1R58A 1W5SA 3EDPA 3ZMUA 1J9IA 3J80Z 2FF4A 3ROUA 2HZTA 3F21A 3I59A 3DPTA 1IN5A 4IVNA 4QWQA 2VODA 5D5WB 4RB1A 2PMUA 3HRMA 4XSXF 3L7WA 1ZREA 4RB2C 4WXHA 5AIPA 3O2PE 4F7ZA 1AOYA 4ENJA 3B73A 2LSOA 2IA2A 4ESFA 4RGUA 5CVVA 3J81K 2OU2A 4FX4A 4I98B 3HYIA 2WTEA 3CDHA 3E6CC 3U2RA 4HZFA 3WTZA 4GYGA 3RKXA 3CUQC 2FBIA 4HBLA 1ZRDA 3GFIA 3IKTA 3DPLC 1HW5A 2YR2A 4S05A 2VXZA 2VC0A 5HLIA 3HUGA 4PCQA 1J5YA 2OD5A 4L9VA 5D5XB 3ELKA 3EETA 1ZLJA 3SZPA 4AVPA 3V7RA 3ZMDA 2UWMA 2HR3A 3ZQ7A 3I54A 3SZTA 2QUFA 1KGSA 3F22A 2HFHA 1IF1A 1ON1A 5DEQA 2ACJA 4YFNF 3J7AO 4IPAA 2D2WA 4RAYA 1MDMA 1PDNC 1LQ1A 2E7WA 1ZLKA 2XAQA 1KYZA 1I1GA 4HLXA 2HQRA 3LQQA 4IRIA 2FOKA 1FC3A 1CGPA 1J2XA 3T0YA 2L02A 1HQCA 1G3SA 2ISYA 1VTNC 4EJUA 5HS8A 4EMSA 2ZO4A 1P4XA 4ENMA 2DT5A 1J0RA 3IKVA 3C18A 2DK5A 5LRSA 1Z6RA 1DDNA 1YG2A 4RGXA 3U9GA 4XBFA 2CSOA 4KMFA 5LBQA 2HTSA 3JTHA 2HDCA 2M87A 3L9FA 3HRTA 2YX4A 4U0YA 3TDZC 5JHUA 1YTYA 1XD7A 4UXNA 2ESHA 2VBZA 3KP7A 3ML6A 4A5NA 1ZG3A 2VT3A 1FY7A 2VE8A 1MD0A 1G3TA 2QYOA 1FLIA 5E18F 4L18B 3B02A 1OYYA 2XUBA 2LDUA 1RZ4A 1YS6A 1FYLA 2K4BA 1T39A 2GA2A 1G6NA 5HS9A 1B4AA 2ZCWA 1C0WA 1Z9CA 2M30A 2YPRA 3RIRA 2W57A 4CO8A 2Q2EA 2NNYA 1HBXG 3WTXC 5L3GA 5L3CA 1TBXA 3C7JA 3WODF 5FD6A 2IVMA 5HLHA 3MFKA 2PN6A 4AWXB 1KU3A 5BPIA 4DQ2A 2XAFA 4HF2A 4YFXF 3WG9A 3F23A 3SQNA 3OOPA 2MLKA 3HSEA 5DYMA 2YU3A 3F8BA 1LNWA 3FM3A 3DKWA 1RI7A 2WV0A 4BNCA 3MWMA 3KCCA 3F8FA 4LD5A 1ZG5A 3R60A 4ON0A 1GVJA 1Z05A 3LA7A 5LHHA 3K1MA 2RVCA 4HA8A 2M1BA 1B1BA 1IZ1A 3M9AA 1LDDA 2A3SA 5TJJA 1STZA 1USTA 3V7SA 4ETSA 4G6QA 1R1TA 4AIKA 4KIFA 2DQLA 2MLGA 1MJBA 4U7DA 4A12A 1O3TA 4LLNA 2O3FA 5BQTA 1TNSA 2L4AA 1SD6A 4GYIA 1ZG1A 2NRAC 3CTAA 3E6DA 2Z3YA 4M9ZA 5L3BA 2QQ9A 3WTVC 1K78A 3JSOA 4WCGA 3GUDA 2O8XA 1R5HA 2QM3A 2KIFA 4H0EA 2C6YA 1T38A 5D5UB 3LAPA 1LDJA 1OR7A 1MDMB 1B6AA 3HRSA 4PZJA 3E5UA 2JPBA 4I02A 2FXAA 2NAZA 3GF2A 1HSTA 5LHIA 4OIQF 2P7VB 4BHPA 3R61A 2K4JA 2Y75A 2NS0A 2ZFWA 3JAMK 2K86A 1UHWA 1B59A 5E1ZB 1O7LA 1ZGJA 1GXQA 3BJOA 1BIBA 5CVIA 3KP2A 5LHGA 4OMZA 5FB2A 4BQAA 3G73A 2V1UA 1QZZA 3I5UA 2ZXJA 4UVCA 1IXCA 2PFBA 4N9HA 1U5TC 1QO0D 3CO7C 4I2OA 2DI3A 4S04A 1X3UA 5JVTA 1FBUA 3CUOA 5K5QA 4IF4A 1IRGA 3QU3A 3MQ0A 2ESNA 4IRGA 5ILUA 5TRDA 1Z91A 3T5XA 2HKXA 2TDXA 5L3FA 3IRQA 1XSXA 3GFJA 3GYHX 1PUEE 5IT9K 3Q9VA 2GZWA 2LF8A 4RGSA 3QP6A 4FX0A 2OZUA 5K5RA 4XLNF 1ZN2A 1IXRC 1YQAA 2W85A 3DEUA 1USSA 4RB0A 4A6EA 4HQMA 5HDNA 5HDGA 4LG0A 2STWA 1WKMA 1XGSA 2KIMA 1G3WA 1SD7A 2B0LA 1PP8F 4WXDA 1QBJA 5A2QZ 3FHZA 2OQRA 2GAUA 2DBBA 1TW3A 4LLGF 4ZH4F 3ERED 3LAJA 3GZ5A 4EJWA 2ZNYA 2H09A 2OBPA 3EYYA 3VB2A 4BHCA 1EH8A 4CHUA 1LJ9A 4L9TA 5CLSA 3FXUA 3IL2A 3ZMSA 1TLHB 2Z99A 1FBQA 1AWCA 2PG4A 1OMIA 2XVCA 4NB5A 5DV5A 2DAOA 4OIRF 3T1BA 3VFZA 1P4WA 1KU2A 3FX3A 5H20A 3FF5A 4I09A 1R00A 4OMYA 4IXAA 4ZZDA 5AONA 4L0ZB 3WTWC 4P5OA 2D45A 1BI1A 2VN2A 3VODA 5E8GA 5L3DA 4CZZA 1RUOA 2DW4A 2NYXA 3PFIA 3W6KB 3TDUC 2ETHA 2BGCA 2CG4A 2XRNA 1R1UA 4A5MA 4BH9A 3G3ZA 5F6FA 3MCZA 3SFZA 4UNOA 1XDSA 5LGUA 3DV8A 3ZMZA 1CF7A 1HW1A 3KP4A 3OV8A 5ICGA 2MBFA 1LEAA 2MA3A 1U2WA 1PP7U 4P96A 3BJAA 3S2WA 4M72A 2K27A 4EJVA 3H3UA 4EJOA 2DPDA 3BY6A 4KICA 2AS5F 2QVOA 2STTA 4HV5A 4M6XA 3EQLF 4KIGA 3TO9A 2EFQA 5E1XA 4I0AA 2HS5A 2VOPA 2CO5A 4OU0A 1BOAA 1Z1DA 2IA0A 2Y48A 1XSDA 3K0LA 1T2KA 5ICFA 3FZVA 3LWFA 2GA1A 1L0OC 2JRTA 2JT1A 2HGCA 1Z6TA 2O6GE 1IN4A 2QLZA 4LG0B 1UB9A 4JQFA 2XAGA 3JAMZ 2ZKZA 3WGIA 1P4AA 3T8RA 4MEXF 2P6TA 1OYIA 2IW5A 2V9VA 3PQKA 2PJPA 4M74A 1JHHA 2K02A 5DUKA 3MEXA 2FNAA 5CJ9A 1KYWA 1TW2A 2BEOA 1YW9A 1Y0UA 2OZ6A 3WU0A 4L5IA 3KETA 1IN6A 1FP1D 4CICA 2CWEA 5ICCA 1FX7A 3W6JB 5LLQA 1S6LA 3KLNA 3FMQA 5D4SA 3ZN0A 3E6MA 4HF0A 4PGHA 2KKOA 2WC2A 4M6YA 4G7HF 2EV0A 2F5CA 2XHKA 2XV4S 2HTJA 2MH9A 1O57A 4O6JA 2DFIA 5FD5A 4GXOA 4LMYA 1QNTA 2FRHA 2XAHA 3ZMTA 2P5LC 1OPCA 3KZZA 1TQMA 2D1VA 5D6EA 2P7CB 1RNLA 3R6SA 4B09A 2XIGA 2Z33A 1J59A 3FM5A 2E7XA 3WGHA 2DLLA 3FXQA 1E17A 3R0AA 3HOTA 2FEZA 1TTYA 2XAJA 4HX8A 2QENA 1FZPB 3N4MA 5DDGA 1XCBA 3FWEA 4KT5C 4R1HA 5DD4A 1TQIA 2EA4A 4CGZA 3R0JA 4HDVA 2X4HA 2ZJ2A 3V8KA 1K79A 4EVIA 3RI4A 2OAZA 3TO6A 3BZ6A 4EV0A 1W7PD 4NQWA 2VONA 2F5EA 4R79A 4UUVA 2Z5UA 4EGYA 3WTYC 4Q48A 2Q8KA 4KA4A 3MAJA 2IP2A 3F8NA 1J75A 1R22A 5F1RA 5CVJA 4MQVA 1XGNA 4UHTA 1V4RA 2JSCA 1F9NA 3I59B 2KJBA 2H27A 3P9IA 5EEHA 1FBSA 2XASA 5BOXA 4YFKF 1HKSA 3CUQA 3M7GA 5HOOA 4ZYEA 3N97A 1H0MA 3PQJA 4WXCA 5FLXK 2L54A 1XN7A 5EEGA 1SFUA 4E70A 5HS7A 2FU4A 4CXFA 4L0YB 1QPMA 3ZPLA 2A68F 3V8JA 1BIAA 5H6RA 3HTSB 2XKOA 2P4WA 3BP8A 2V1DA 3E6BA 3NRVA 3P9CA 3KP5A 2QQAA 3I4PA 3LA3A 2LNBA 2K7LA 3JTGA 2EK5A 4G8XA 2PI0A 2J5PA 4A0ZA 3TGNA 3E5XA 3D0SA 1ZRCA 4ZYGA 1I1SA 2EFWA 4LGWA 5BPDA 5K5OA 4M9SA 3IRRA 3FMSA 1S3JA 4Z2YA 3QRFF 1K78B 2GQQA 5BS6A 2FQ3A 1YLFA 1B9NA 3BOQA 3RJPA 3T8TA 3KEOA 1YYVA 2M5WA 1XMAA 5HVQC 2VBYA 4YIIA 1HSJA 1S7OA 2QBYB 3NQOA 4M71A 5D5VB 4I0BA 3KEQA 4JBAA 1SD4A 4FHTA 5JI6A 1R7JA 3Q5FA 1BI2A 4YIFA 2O03A 3QAHA 1ZGAA 2A61A 2QBYA 2V1XA 4M9XA 3MZHA 3IHUA 4LLLA 1U6GA 4KUMA 1LDKB 1SFEA 4MTDA 1YS7A 3O6BB 2HQNA 4XSZF 1FOKA 4L9NA 4UVBA 3HTUA 3IC7A 2GIVA 2PLYA 2F5FA 1U8RA 3GW2A 3LQRA 3ZN1A 2FSWA 3SXYA 1R23A 1YW8A 1P92A 5CVUA 4JK1X 4ZZLA 3TOBA 1ODDA 3K9TA 2VE9A 4IHTA 2NNNA 2UXXA 3O3KA 5IT9Z 1GHCA 2P5VA 1MJAA 3KP6A 3QOPA 4RB3C 1LEBA 3GO5A 2HYFA 2EWNA 2G7UA 4I7HA 1V3FA 3H92A 3ECOA 1H9GA 4RGRA 1I5ZA 2FNPA 3TKYA 4K2EA 3GWZA 3K1PA 4HOBA 5DCMA 2CQKA 3L00A 3E5QA 2CW0F 5E1WA 3J80K 5FLXZ 1KA8A 4KIBA 3ZP5A 5AIQA 3F72A 3BJ6A 3L2CA 1TQPA 4ASNA 2E1CA 4ZYHA 4OIPF 3DQVC 2XGXA 1I6XA 4LFUA 4G94A 2QQBA 1JE8A 1D8KA 1S29A 4EM1A 2IJLA 5FFXA 3I0TA 3J81Z 4EQQA 5JR3A 2EV6A 5E20A 5E8IA 2FA5A 2KIUA 1D5VA 1WSUA 4ESJA 1RIOH 2EA2A 1T98A 2H94A 2MD5A 4FT8A 3M8EA 4IRHA 1W7PB 4BHBA 1FP2A 5KK1A 5IT3A 3KLOA 1W7PA 4M73A 4HQEA 4LK0F 3P7NA 3NEUA 3LSTA 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILS A;  3JSP A;  1B9M A;  1MGT A;  4RAZ A;  4KN4 X;  2DPU A;  2OA4 A;  4UVA A;  1WI9 A;  3I53 A;  3FMR A;  1O7F A;  4OOI A;  3WE3 A;  1HW2 A;  4PGG A;  3IWZ A;  1ZYR F;  2P5K A;  1L3L A;  2ELH A;  4ZYD A;  4Y17 A;  2X0L A;  3RTR A;  1O3Q A;  2L01 A;  5JFR A;  3F3X A;  5ERI A;  2HYG D;  3L09 A;  4A6D A;  2R3S A;  2HOE A;  2M8E A;  4U7B A;  3MZY A;  4GCV A;  4LJZ F;  1DPR A;  2EB7 A;  4OIO F;  3RKW A;  4HDU A;  1FT9 A;  1JGS A;  3LA2 A;  2ZME A;  4Q4Z F;  1EH7 A;  1Z7U A;  2DO7 A;  1MZB A;  4DNC A;  4KYW A;  1U5T B;  2FE3 A;  2O61 A;  1SD5 A;  3M1E A;  1FNN A;  1T6S A;  1F5T A;  4AIJ A;  1WRJ A;  1QZY A;  4RS8 A;  2VC1 A;  2WWY A;  2PQ8 A;  1KU9 A;  1J7K A;  4CYD A;  1K6O A;  4TV7 A;  2KJC A;  1KQ0 A;  4KDP A;  4P9U A;  3AAF A;  2HKO A;  1XSV A;  5J8F A;  4UV8 A;  2HWV A;  1I27 A;  5LGT A;  1F1Z A;  1MJ9 A;  1XGM A;  2BV6 A;  5BMZ A;  1SMY F;  3QPT A;  2R7F A;  1O3R A;  1LVA A;  1T0F A;  4G7O F;  3V8L A;  1BBY A;  2Y0M A;  3SHF A;  1OKR A;  4PDK A;  2V79 A;  2CGP A;  1OYW A;  3U1D A;  4A0X A;  4HW0 A;  3V4G A;  2RV8 A;  2PEX A;  1FPQ A;  3RPU A;  2VBW A;  3DF8 A;  2P6S A;  4WF2 A;  4N0B A;  3EUH A;  1IXS B;  2OQG A;  3WTT C;  5ED4 A;  1D8J A;  4B8X A;  3WTS C;  2EFO A;  4O5V A;  2W24 A;  2Q0O A;  4AD9 A;  1P6R A;  2EV5 A;  1WQ2 A;  1R5G A;  1SMT A;  3ZMV A;  3TO7 A;  2O0Y A;  3VEP A;  1DP7 P;  3GFM A;  2CFX A;  4IHS A;  3HHG A;  3GXO A;  3BPX A;  4EJT A;  1UCR A;  1G4D A;  1R1V A;  3ISP A;  1FSE A;  3K69 A;  3ULQ B;  1WWX A;  3HSF A;  3ABT A;  3RYR A;  3BRO A;  4GO1 A;  2BE5 F;  1CF7 B;  4BAY A;  1ZRF A;  2IRF G;  2UXN A;  1G3Y A;  4LB5 A;  5DCF A;  3LFK A;  2YSR A;  2ZBK A;  1UFM A;  4ENK A;  1A04 A;  2KRF A;  4WX9 A;  4UV9 A;  1XGO A;  2A5Y B;  5DD8 A;  1K7A A;  1XB4 A;  2JPC A;  2QZ8 A;  5L3E A;  1EV7 A;  3HOS A;  3RDI A;  1H9T A;  5FO5 A;  2JTV A;  1S8N A;  3F6O A;  4HV6 A;  2YX7 A;  4QLC U;  1SAX A;  3Q9S A;  2CYY A;  2EFP A;  2BYV E;  2GXB A;  1IRF A;  5HLG A;  3I58 A;  2FBH A;  1EH6 A;  5LRR A;  4XLP F;  2EFN A;  3GVA A;  1BN5 A;  1ZAR A;  1S7A A;  3KP3 A;  3HRU A;  3DFG A;  2GWR A;  2JZY A;  4HX7 A;  3WU1 B;  4ENN A;  1YIO A;  1F4K A;  5FFZ A;  2E1N A;  1KQ9 A;  1FYK A;  3KZY A;  5E17 F;  2D1H A;  3DP7 A;  2A6E F;  1YFH A;  2IPQ X;  4EM0 B;  3I64 A;  3HIF A;  3WE2 A;  5KVR A;  1KQ8 A;  3BWG A;  3TOA A;  2W84 A;  3C3W A;  4MNU A;  4P9F A;  2PMH A;  1ULY A;  3COA C;  2RGV A;  4R8H A;  2RKH A;  3R4K A;  1D3Y A;  2DTR A;  5D4R A;  4HLY A;  1BI0 A;  5LEK A;  1IN8 A;  2QWW A;  3GX4 X;  2RN7 A;  4WK8 F;  2V6C A;  4L9J A;  4G6D A;  4HAM A;  2ISZ A;  3BDD A;  2W25 A;  4AIH A;  2GXG A;  1TNT A;  2A69 F;  2RNJ A;  3E97 A;  1JXS A;  2G9W A;  3WTU C;  1FYM A;  4Y13 A;  3E3V A;  4Y15 A;  3EYI A;  4U88 A;  5LEJ A;  2H6B A;  3C1D A;  1BC8 C;  2DQR A;  1BC7 C;  4WWC A;  5A2Q K;  4ESB A;  4EGZ A;  4OIN F;  3V7C A;  5D8L B;  5ILV A;  1KU7 A;  4MEY F;  3KE2 A;  3HSR A;  4P55 A;  2XRO A;  4A2U A;  4Q5S F;  4N9I A;  2IT0 A;  5DCM B;  1DUX C;  2MH2 A;  3QPH A;  1ONV A;  2VT2 A;  5D6F A;  2F5D A;  4L5J A;  4MHG A;  4U0V A;  1ZAO A;  2Z9O A;  2ZNZ A;  1NHA A;  5LGN A;  4XRF A;  4IJA A;  1IUY A;  2DU9 A;  3I71 A;  3K1N A;  2J5O A;  3RKY A;  1XMK A;  2L4M A;  2VOO A;  1R36 A;  3F8M A;  1HKQ A;  1DPU A;  1W5T A;  5DUI A;  3CJN A;  2A07 F;  3ECH A;  1XCV A;  2FBK A;  2MC3 A;  1QQI A;  4KMU X;  2RDP A;  4GGG A;  5K1Y A;  4CDG A;  3F8C A;  3IWF A;  4D0P A;  5H6Q A;  3CLO A;  1REP C;  5FGM A;  3P9K A;  1XDU A;  4KN7 X;  4HF1 A;  1Q1H A;  4MTE A;  2LF7 A;  2XKP A;  1JHF A;  3QP5 A;  2IA1 A;  3BPV A;  4Q47 A;  1ZH5 A;  1ON2 A;  1IN7 A;  4HX4 A;  1BJA A;  3GFL A;  4I01 A;  4U0W A;  4O3M A;  3RPQ A;  2HEO A;  2ADU A;  1U3E M;  4MQ9 F;  5CVR A;  1IW7 F;  1QGP A;  3VOE A;  5ICE A;  4YG2 F;  1BM9 A;  5F64 A;  1MKM A;  2P8T A;  3HHH A;  3JW4 A;  3CUQ B;  2FMY A;  5J6X A;  5HDK A;  2A6H F;  2UZK A;  2AXL A;  2PBI A;  4BYY A;  2RQP A;  3TQN A;  1P2F A;  3QU6 A;  2L3D A;  1YO5 C;  1FWZ A;  2FML A;  1GXP A;  3GZ6 A;  4HYE A;  4LB6 B;  3D5L A;  1LB2 A;  2VBX A;  1ZHF A;  3WGG A;  4EM2 A;  1U5T A;  2F2E A;  2R7D A;  2ZME B;  4MGR A;  1RUN A;  3CO6 C;  4BXU A;  1UHM A;  3H3Z A;  3GEZ A;  1IAW A;  4G7Z F;  3F6V A;  2RC4 A;  5D8K B;  4LK1 F;  2M45 A;  2BBY A;  3M8F A;  2LKP A;  5J8C A;  3DXJ F;  2ZME C;  1O3S A;  1U78 A;  4NHJ A;  4KFC A;  1BI3 A;  2H6C A;  3GLX A;  3REO A;  1E2X A;  2DK8 A;  2EJR A;  3RYP A;  4KNY A;  3KFW X;  1FSH A;  2COM A;  3FXR A;  3K2Z A;  1SFX A;  5CYV A;  1HKT A;  4G9Y A;  2G7H A;  1W4M A;  6PAX A;  4A0Y A;  1HXD A;  3ABU A;  1R58 A;  1W5S A;  3EDP A;  3ZMU A;  1J9I A;  3J80 Z;  2FF4 A;  3ROU A;  2HZT A;  3F21 A;  3I59 A;  3DPT A;  1IN5 A;  4IVN A;  4QWQ A;  2VOD A;  5D5W B;  4RB1 A;  2PMU A;  3HRM A;  4XSX F;  3L7W A;  1ZRE A;  4RB2 C;  4WXH A;  5AIP A;  3O2P E;  4F7Z A;  1AOY A;  4ENJ A;  3B73 A;  2LSO A;  2IA2 A;  4ESF A;  4RGU A;  5CVV A;  3J81 K;  2OU2 A;  4FX4 A;  4I98 B;  3HYI A;  2WTE A;  3CDH A;  3E6C C;  3U2R A;  4HZF A;  3WTZ A;  4GYG A;  3RKX A;  3CUQ C;  2FBI A;  4HBL A;  1ZRD A;  3GFI A;  3IKT A;  3DPL C;  1HW5 A;  2YR2 A;  4S05 A;  2VXZ A;  2VC0 A;  5HLI A;  3HUG A;  4PCQ A;  1J5Y A;  2OD5 A;  4L9V A;  5D5X B;  3ELK A;  3EET A;  1ZLJ A;  3SZP A;  4AVP A;  3V7R A;  3ZMD A;  2UWM A;  2HR3 A;  3ZQ7 A;  3I54 A;  3SZT A;  2QUF A;  1KGS A;  3F22 A;  2HFH A;  1IF1 A;  1ON1 A;  5DEQ A;  2ACJ A;  4YFN F;  3J7A O;  4IPA A;  2D2W A;  4RAY A;  1MDM A;  1PDN C;  1LQ1 A;  2E7W A;  1ZLK A;  2XAQ A;  1KYZ A;  1I1G A;  4HLX A;  2HQR A;  3LQQ A;  4IRI A;  2FOK A;  1FC3 A;  1CGP A;  1J2X A;  3T0Y A;  2L02 A;  1HQC A;  1G3S A;  2ISY A;  1VTN C;  4EJU A;  5HS8 A;  4EMS A;  2ZO4 A;  1P4X A;  4ENM A;  2DT5 A;  1J0R A;  3IKV A;  3C18 A;  2DK5 A;  5LRS A;  1Z6R A;  1DDN A;  1YG2 A;  4RGX A;  3U9G A;  4XBF A;  2CSO A;  4KMF A;  5LBQ A;  2HTS A;  3JTH A;  2HDC A;  2M87 A;  3L9F A;  3HRT A;  2YX4 A;  4U0Y A;  3TDZ C;  5JHU A;  1YTY A;  1XD7 A;  4UXN A;  2ESH A;  2VBZ A;  3KP7 A;  3ML6 A;  4A5N A;  1ZG3 A;  2VT3 A;  1FY7 A;  2VE8 A;  1MD0 A;  1G3T A;  2QYO A;  1FLI A;  5E18 F;  4L18 B;  3B02 A;  1OYY A;  2XUB A;  2LDU A;  1RZ4 A;  1YS6 A;  1FYL A;  2K4B A;  1T39 A;  2GA2 A;  1G6N A;  5HS9 A;  1B4A A;  2ZCW A;  1C0W A;  1Z9C A;  2M30 A;  2YPR A;  3RIR A;  2W57 A;  4CO8 A;  2Q2E A;  2NNY A;  1HBX G;  3WTX C;  5L3G A;  5L3C A;  1TBX A;  3C7J A;  3WOD F;  5FD6 A;  2IVM A;  5HLH A;  3MFK A;  2PN6 A;  4AWX B;  1KU3 A;  5BPI A;  4DQ2 A;  2XAF A;  4HF2 A;  4YFX F;  3WG9 A;  3F23 A;  3SQN A;  3OOP A;  2MLK A;  3HSE A;  5DYM A;  2YU3 A;  3F8B A;  1LNW A;  3FM3 A;  3DKW A;  1RI7 A;  2WV0 A;  4BNC A;  3MWM A;  3KCC A;  3F8F A;  4LD5 A;  1ZG5 A;  3R60 A;  4ON0 A;  1GVJ A;  1Z05 A;  3LA7 A;  5LHH A;  3K1M A;  2RVC A;  4HA8 A;  2M1B A;  1B1B A;  1IZ1 A;  3M9A A;  1LDD A;  2A3S A;  5TJJ A;  1STZ A;  1UST A;  3V7S A;  4ETS A;  4G6Q A;  1R1T A;  4AIK A;  4KIF A;  2DQL A;  2MLG A;  1MJB A;  4U7D A;  4A12 A;  1O3T A;  4LLN A;  2O3F A;  5BQT A;  1TNS A;  2L4A A;  1SD6 A;  4GYI A;  1ZG1 A;  2NRA C;  3CTA A;  3E6D A;  2Z3Y A;  4M9Z A;  5L3B A;  2QQ9 A;  3WTV C;  1K78 A;  3JSO A;  4WCG A;  3GUD A;  2O8X A;  1R5H A;  2QM3 A;  2KIF A;  4H0E A;  2C6Y A;  1T38 A;  5D5U B;  3LAP A;  1LDJ A;  1OR7 A;  1MDM B;  1B6A A;  3HRS A;  4PZJ A;  3E5U A;  2JPB A;  4I02 A;  2FXA A;  2NAZ A;  3GF2 A;  1HST A;  5LHI A;  4OIQ F;  2P7V B;  4BHP A;  3R61 A;  2K4J A;  2Y75 A;  2NS0 A;  2ZFW A;  3JAM K;  2K86 A;  1UHW A;  1B59 A;  5E1Z B;  1O7L A;  1ZGJ A;  1GXQ A;  3BJO A;  1BIB A;  5CVI A;  3KP2 A;  5LHG A;  4OMZ A;  5FB2 A;  4BQA A;  3G73 A;  2V1U A;  1QZZ A;  3I5U A;  2ZXJ A;  4UVC A;  1IXC A;  2PFB A;  4N9H A;  1U5T C;  1QO0 D;  3CO7 C;  4I2O A;  2DI3 A;  4S04 A;  1X3U A;  5JVT A;  1FBU A;  3CUO A;  5K5Q A;  4IF4 A;  1IRG A;  3QU3 A;  3MQ0 A;  2ESN A;  4IRG A;  5ILU A;  5TRD A;  1Z91 A;  3T5X A;  2HKX A;  2TDX A;  5L3F A;  3IRQ A;  1XSX A;  3GFJ A;  3GYH X;  1PUE E;  5IT9 K;  3Q9V A;  2GZW A;  2LF8 A;  4RGS A;  3QP6 A;  4FX0 A;  2OZU A;  5K5R A;  4XLN F;  1ZN2 A;  1IXR C;  1YQA A;  2W85 A;  3DEU A;  1USS A;  4RB0 A;  4A6E A;  4HQM A;  5HDN A;  5HDG A;  4LG0 A;  2STW A;  1WKM A;  1XGS A;  2KIM A;  1G3W A;  1SD7 A;  2B0L A;  1PP8 F;  4WXD A;  1QBJ A;  5A2Q Z;  3FHZ A;  2OQR A;  2GAU A;  2DBB A;  1TW3 A;  4LLG F;  4ZH4 F;  3ERE D;  3LAJ A;  3GZ5 A;  4EJW A;  2ZNY A;  2H09 A;  2OBP A;  3EYY A;  3VB2 A;  4BHC A;  1EH8 A;  4CHU A;  1LJ9 A;  4L9T A;  5CLS A;  3FXU A;  3IL2 A;  3ZMS A;  1TLH B;  2Z99 A;  1FBQ A;  1AWC A;  2PG4 A;  1OMI A;  2XVC A;  4NB5 A;  5DV5 A;  2DAO A;  4OIR F;  3T1B A;  3VFZ A;  1P4W A;  1KU2 A;  3FX3 A;  5H20 A;  3FF5 A;  4I09 A;  1R00 A;  4OMY A;  4IXA A;  4ZZD A;  5AON A;  4L0Z B;  3WTW C;  4P5O A;  2D45 A;  1BI1 A;  2VN2 A;  3VOD A;  5E8G A;  5L3D A;  4CZZ A;  1RUO A;  2DW4 A;  2NYX A;  3PFI A;  3W6K B;  3TDU C;  2ETH A;  2BGC A;  2CG4 A;  2XRN A;  1R1U A;  4A5M A;  4BH9 A;  3G3Z A;  5F6F A;  3MCZ A;  3SFZ A;  4UNO A;  1XDS A;  5LGU A;  3DV8 A;  3ZMZ A;  1CF7 A;  1HW1 A;  3KP4 A;  3OV8 A;  5ICG A;  2MBF A;  1LEA A;  2MA3 A;  1U2W A;  1PP7 U;  4P96 A;  3BJA A;  3S2W A;  4M72 A;  2K27 A;  4EJV A;  3H3U A;  4EJO A;  2DPD A;  3BY6 A;  4KIC A;  2AS5 F;  2QVO A;  2STT A;  4HV5 A;  4M6X A;  3EQL F;  4KIG A;  3TO9 A;  2EFQ A;  5E1X A;  4I0A A;  2HS5 A;  2VOP A;  2CO5 A;  4OU0 A;  1BOA A;  1Z1D A;  2IA0 A;  2Y48 A;  1XSD A;  3K0L A;  1T2K A;  5ICF A;  3FZV A;  3LWF A;  2GA1 A;  1L0O C;  2JRT A;  2JT1 A;  2HGC A;  1Z6T A;  2O6G E;  1IN4 A;  2QLZ A;  4LG0 B;  1UB9 A;  4JQF A;  2XAG A;  3JAM Z;  2ZKZ A;  3WGI A;  1P4A A;  3T8R A;  4MEX F;  2P6T A;  1OYI A;  2IW5 A;  2V9V A;  3PQK A;  2PJP A;  4M74 A;  1JHH A;  2K02 A;  5DUK A;  3MEX A;  2FNA A;  5CJ9 A;  1KYW A;  1TW2 A;  2BEO A;  1YW9 A;  1Y0U A;  2OZ6 A;  3WU0 A;  4L5I A;  3KET A;  1IN6 A;  1FP1 D;  4CIC A;  2CWE A;  5ICC A;  1FX7 A;  3W6J B;  5LLQ A;  1S6L A;  3KLN A;  3FMQ A;  5D4S A;  3ZN0 A;  3E6M A;  4HF0 A;  4PGH A;  2KKO A;  2WC2 A;  4M6Y A;  4G7H F;  2EV0 A;  2F5C A;  2XHK A;  2XV4 S;  2HTJ A;  2MH9 A;  1O57 A;  4O6J A;  2DFI A;  5FD5 A;  4GXO A;  4LMY A;  1QNT A;  2FRH A;  2XAH A;  3ZMT A;  2P5L C;  1OPC A;  3KZZ A;  1TQM A;  2D1V A;  5D6E A;  2P7C B;  1RNL A;  3R6S A;  4B09 A;  2XIG A;  2Z33 A;  1J59 A;  3FM5 A;  2E7X A;  3WGH A;  2DLL A;  3FXQ A;  1E17 A;  3R0A A;  3HOT A;  2FEZ A;  1TTY A;  2XAJ A;  4HX8 A;  2QEN A;  1FZP B;  3N4M A;  5DDG A;  1XCB A;  3FWE A;  4KT5 C;  4R1H A;  5DD4 A;  1TQI A;  2EA4 A;  4CGZ A;  3R0J A;  4HDV A;  2X4H A;  2ZJ2 A;  3V8K A;  1K79 A;  4EVI A;  3RI4 A;  2OAZ A;  3TO6 A;  3BZ6 A;  4EV0 A;  1W7P D;  4NQW A;  2VON A;  2F5E A;  4R79 A;  4UUV A;  2Z5U A;  4EGY A;  3WTY C;  4Q48 A;  2Q8K A;  4KA4 A;  3MAJ A;  2IP2 A;  3F8N A;  1J75 A;  1R22 A;  5F1R A;  5CVJ A;  4MQV A;  1XGN A;  4UHT A;  1V4R A;  2JSC A;  1F9N A;  3I59 B;  2KJB A;  2H27 A;  3P9I A;  5EEH A;  1FBS A;  2XAS A;  5BOX A;  4YFK F;  1HKS A;  3CUQ A;  3M7G A;  5HOO A;  4ZYE A;  3N97 A;  1H0M A;  3PQJ A;  4WXC A;  5FLX K;  2L54 A;  1XN7 A;  5EEG A;  1SFU A;  4E70 A;  5HS7 A;  2FU4 A;  4CXF A;  4L0Y B;  1QPM A;  3ZPL A;  2A68 F;  3V8J A;  1BIA A;  5H6R A;  3HTS B;  2XKO A;  2P4W A;  3BP8 A;  2V1D A;  3E6B A;  3NRV A;  3P9C A;  3KP5 A;  2QQA A;  3I4P A;  3LA3 A;  2LNB A;  2K7L A;  3JTG A;  2EK5 A;  4G8X A;  2PI0 A;  2J5P A;  4A0Z A;  3TGN A;  3E5X A;  3D0S A;  1ZRC A;  4ZYG A;  1I1S A;  2EFW A;  4LGW A;  5BPD A;  5K5O A;  4M9S A;  3IRR A;  3FMS A;  1S3J A;  4Z2Y A;  3QRF F;  1K78 B;  2GQQ A;  5BS6 A;  2FQ3 A;  1YLF A;  1B9N A;  3BOQ A;  3RJP A;  3T8T A;  3KEO A;  1YYV A;  2M5W A;  1XMA A;  5HVQ C;  2VBY A;  4YII A;  1HSJ A;  1S7O A;  2QBY B;  3NQO A;  4M71 A;  5D5V B;  4I0B A;  3KEQ A;  4JBA A;  1SD4 A;  4FHT A;  5JI6 A;  1R7J A;  3Q5F A;  1BI2 A;  4YIF A;  2O03 A;  3QAH A;  1ZGA A;  2A61 A;  2QBY A;  2V1X A;  4M9X A;  3MZH A;  3IHU A;  4LLL A;  1U6G A;  4KUM A;  1LDK B;  1SFE A;  4MTD A;  1YS7 A;  3O6B B;  2HQN A;  4XSZ F;  1FOK A;  4L9N A;  4UVB A;  3HTU A;  3IC7 A;  2GIV A;  2PLY A;  2F5F A;  1U8R A;  3GW2 A;  3LQR A;  3ZN1 A;  2FSW A;  3SXY A;  1R23 A;  1YW8 A;  1P92 A;  5CVU A;  4JK1 X;  4ZZL A;  3TOB A;  1ODD A;  3K9T A;  2VE9 A;  4IHT A;  2NNN A;  2UXX A;  3O3K A;  5IT9 Z;  1GHC A;  2P5V A;  1MJA A;  3KP6 A;  3QOP A;  4RB3 C;  1LEB A;  3GO5 A;  2HYF A;  2EWN A;  2G7U A;  4I7H A;  1V3F A;  3H92 A;  3ECO A;  1H9G A;  4RGR A;  1I5Z A;  2FNP A;  3TKY A;  4K2E A;  3GWZ A;  3K1P A;  4HOB A;  5DCM A;  2CQK A;  3L00 A;  3E5Q A;  2CW0 F;  5E1W A;  3J80 K;  5FLX Z;  1KA8 A;  4KIB A;  3ZP5 A;  5AIQ A;  3F72 A;  3BJ6 A;  3L2C A;  1TQP A;  4ASN A;  2E1C A;  4ZYH A;  4OIP F;  3DQV C;  2XGX A;  1I6X A;  4LFU A;  4G94 A;  2QQB A;  1JE8 A;  1D8K A;  1S29 A;  4EM1 A;  2IJL A;  5FFX A;  3I0T A;  3J81 Z;  4EQQ A;  5JR3 A;  2EV6 A;  5E20 A;  5E8I A;  2FA5 A;  2KIU A;  1D5V A;  1WSU A;  4ESJ A;  1RIO H;  2EA2 A;  1T98 A;  2H94 A;  2MD5 A;  4FT8 A;  3M8E A;  4IRH A;  1W7P B;  4BHB A;  1FP2 A;  5KK1 A;  5IT3 A;  3KLO A;  1W7P A;  4M73 A;  4HQE A;  4LK0 F;  3P7N A;  3NEU A;  3LST A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 4DYC A;  3GME A;  5ILS A;  3JSP A;  1B9M A;  2DA2 A;  2XSD C;  1MGT A;  4RAZ A;  3JRI A;  2LBF A;  4KN4 X;  3VYT B;  2DPU A;  4NBQ A;  2OA4 A;  2KIQ A;  4UVA A;  2LC2 A;  1WI9 A;  3CCL I;  3D1N I;  2VPR A;  1KON A;  3CCQ I;  3QQA A;  3I53 A;  1DP3 A;  3FMR A;  1O7F A;  3PUB A;  4OOI A;  3PFY A;  3WE3 A;  1HW2 A;  2R7W A;  2ECC A;  3HXL A;  4PGG A;  1MW7 A;  3IWZ A;  2JA8 J;  3K4N A;  1ZYR F;  2P5K A;  1VQP I;  5IP7 J;  2VQH A;  1L3L A;  2ELH A;  2Q1Z B;  4ZYD A;  4Y17 A;  3CCM I;  1JI8 A;  2X0L A;  3RTR A;  1O3Q A;  1ZR4 A;  1DQU A;  3SJM A;  4IHW A;  2L01 A;  5JFR A;  3F3X A;  4DJA A;  3EUA A;  3MD2 A;  5ERI A;  2HYG D;  3L09 A;  3S14 J;  4A6D A;  4HNU A;  2R3S A;  1HOM A;  3EUH C;  3ERM A;  2HOE A;  4X1E A;  1X2N A;  2M8E A;  3ASO H;  4RM3 A;  3ZOB A;  3GTL J;  3ZXS A;  2TCT A;  4ABZ A;  3UR3 C;  4U7B A;  2IGN A;  3MZY A;  5GAE J;  3MKY B;  4GCV A;  2BY1 A;  3GZN B;  4LJZ F;  2A05 A;  1X58 A;  1DPR A;  2EB7 A;  4C2M J;  4OIO F;  1OCZ H;  2IBD A;  3H9Q A;  3RKW A;  4HDU A;  3ABL H;  2LYC A;  3KIO A;  3CME I;  1FT9 A;  1JGS A;  3LA2 A;  2ZME A;  4Q4Z F;  1EH7 A;  1Z7U A;  2DO7 A;  1MZB A;  4DNC A;  3GLL A;  4ZDP A;  4KYW A;  1U5T B;  2FE3 A;  4XMY A;  2O61 A;  5FKN A;  1SD5 A;  3M1E A;  4XKB A;  5GP9 A;  1FNN A;  1T6S A;  2ZJQ F;  1F5T A;  1A5J A;  4AIJ A;  4XON A;  1WRJ A;  2CUE A;  1QZY A;  4BL0 B;  4RS8 A;  2VC1 A;  2WWY A;  2PQ8 A;  3K10 A;  1KU9 A;  5M5X J;  1SFO J;  1J7K A;  4CYD A;  1TT5 B;  5TIS C;  1K6O A;  4TV7 A;  2KJC A;  1KQ0 A;  2EZK A;  3ASN H;  4KDP A;  4HPQ A;  3PJR A;  4P9U A;  2R5Z A;  3AAF A;  2QSH X;  1G2H A;  2YS9 A;  1T8I A;  1UAA A;  5DM6 F;  2HKO A;  4QPQ A;  1XSV A;  2R7X A;  2VQL A;  5J8F A;  4G12 A;  4UV8 A;  2H8R A;  2HWV A;  1I27 A;  5LGT A;  3VYS B;  1F1Z A;  2BXY A;  1MJ9 A;  2Y0S A;  1XGM A;  2BV6 A;  2PMZ N;  2VJJ A;  5BMZ A;  1FJL A;  3KEY A;  1SMY F;  3ZQL A;  3QPT A;  2R7F A;  1O3R A;  4HNV A;  1LVA A;  1X3Z B;  2COB A;  3HGY A;  5B3S H;  1W0T A;  3OYK A;  1XX5 A;  4UUS B;  1T0F A;  2E5Z A;  3BLY A;  4G7O F;  3V8L A;  1BBY A;  1Y0N A;  4B48 A;  2Y0M A;  3SHF A;  1OKR A;  4PDK A;  4YIR X;  2V79 A;  2HOS A;  2CGP A;  1OYW A;  2WBM A;  3U1D A;  2BXZ A;  4F55 A;  2CQX A;  4A0X A;  4HW0 A;  3V4G A;  3BR6 A;  2RV8 A;  2PEX A;  3PIO F;  1FPQ A;  4BJT A;  3A2K A;  3RPU A;  3U21 A;  2VBW A;  3DF8 A;  1IUF A;  2P6S A;  4WF2 A;  5FRO A;  4N0B A;  3EUH A;  1EF4 A;  1IXS B;  2DOD A;  2OQG A;  3WTT C;  2HU9 A;  2NVQ J;  2IGM A;  5ED4 A;  3RCO A;  1D8J A;  4C2T A;  2V1N A;  4B8X A;  3WTS C;  1YJN I;  2EFO A;  1JKP C;  1VQ8 I;  3H35 A;  4O5V A;  2W24 A;  3F9K A;  4ZTF A;  2M4K A;  2W4S A;  2Q0O A;  2Z16 A;  1P6R A;  4AD9 A;  2EV5 A;  1T0F C;  1WQ2 A;  1TP4 A;  1R5G A;  1SMT A;  4BE0 A;  3ZMV A;  3TO7 A;  4BU2 A;  3OY9 A;  2L0K A;  2Y9Y A;  1YIJ I;  1IC8 A;  2O0Y A;  1DU6 A;  1I6H J;  1OIS A;  1IO2 A;  3VEP A;  2K9Q A;  1HF0 A;  5EGO A;  4RLQ A;  3HOZ J;  1DP7 P;  2B9S A;  5EDN A;  3GFM A;  2CFX A;  3SDB A;  4IHS A;  3HHG A;  3GXO A;  3BPX A;  4RA2 A;  3OYA A;  4EJT A;  1UCR A;  1G4D A;  3DU6 A;  1J09 A;  2BY2 A;  3KZI C;  1UG2 A;  2H1L A;  3PIP F;  2R5Z B;  2R5Y B;  1R1V A;  1ITY A;  3ISP A;  4Y33 A;  1FSE A;  3K69 A;  3ULQ B;  3KYL A;  2JVG A;  1YX3 A;  3DEE A;  5LD2 C;  1TWG J;  1WWX A;  3HSF A;  2XC7 A;  1N25 A;  3ABT A;  2HPM A;  2EPF A;  3RYR A;  1EA3 A;  1RKT A;  3WHC A;  1VND A;  3BRO A;  4GO1 A;  2BE5 F;  1CF7 B;  4BAY A;  1ZRF A;  2IRF G;  2UXN A;  1G3Y A;  2BOL A;  3GTG J;  4LB5 A;  5DCF A;  2OPT A;  1ZR2 A;  3LFK A;  2YSR A;  2ZBK A;  3K70 C;  1UFM A;  4ENK A;  1A04 A;  2KRF A;  4WX9 A;  2DOA A;  4UV9 A;  1XGO A;  2A5Y B;  5DD8 A;  2K85 A;  1K7A A;  1XB4 A;  2JPC A;  2QZ8 A;  5L3E A;  1EV7 A;  4XKW A;  2E2I J;  4BS9 A;  3HOS A;  3RDI A;  1H9T A;  3S3N A;  5FO5 A;  2JTV A;  1S8N A;  3W2A A;  4HG2 A;  3F6O A;  3L2W A;  1NK3 P;  4HV6 A;  2NS7 A;  1RC9 A;  2YX7 A;  1Y39 A;  4QLC U;  1XPX A;  4EEF G;  1SAX A;  3Q9S A;  2GOM A;  3H9G A;  1YHQ I;  2X48 A;  1V5F A;  2CYY A;  2EFP A;  2BYV E;  2CUZ A;  1BR4 A;  2R7U A;  2GXB A;  2DJN A;  2IGK A;  3QOE A;  1IRF A;  4AYB N;  5HLG A;  3I58 A;  3CJT B;  1ORK A;  1OCP A;  3TL4 X;  1EH6 A;  1JTY A;  2DCE A;  2FBH A;  2VJ4 A;  2M0M A;  2EFN A;  5LRR A;  2O7O A;  3GVA A;  5GAG J;  4XLP F;  4V2F A;  1BN5 A;  1ZAR A;  1S7A A;  3KP3 A;  1N77 A;  3FIS A;  3HRU A;  3SFI A;  4E7K A;  3LSP A;  1V5G A;  4IX7 A;  2JRM A;  3E0J B;  2GWR A;  3DFG A;  4XOR A;  2JZY A;  2VIX A;  4HX7 A;  2HVS A;  3CMM A;  4YEL A;  3WU1 B;  1NG7 A;  1R9T J;  2KPM A;  4XK4 A;  4ENN A;  5IPA A;  1YIO A;  2BW3 B;  1F4K A;  2Y2Z A;  2E1N A;  2M34 A;  1KQ9 A;  5FFZ A;  1FYK A;  1HDD C;  2IS4 A;  3CCV I;  3KZY A;  5E79 C;  4N4O B;  4LIT A;  5E17 F;  4A3C J;  2D1H A;  3MZ8 A;  3DP7 A;  2R7T A;  3RZO J;  2A6E F;  3CQZ J;  2IPQ X;  1YFH A;  2BHY A;  2DOF A;  1X4O A;  2VKH A;  3I64 A;  2HYJ A;  2LH9 A;  2XGC A;  4EM0 B;  4FTH A;  3HIF A;  1U9N A;  1A6Q A;  1ZKG A;  1E3P A;  3WE2 A;  5KVR A;  3AG1 H;  2PX9 A;  2GIZ A;  3S16 J;  1KQ8 A;  1ETX A;  2OF7 A;  3BWG A;  4A3M J;  1TL8 A;  3TOA A;  4F52 A;  5TGT A;  2W84 A;  3C3W A;  4MNU A;  1E0E A;  3I9V 2;  4P9F A;  2PMH A;  1ULY A;  2W1O A;  3COA C;  2RGV A;  3BCB A;  4R8H A;  2JUC A;  2RKH A;  3QYF A;  1D3Y A;  3R4K A;  2LP0 A;  3HJE A;  2CQN A;  2VPL A;  2DTR A;  5D4R A;  3OS2 A;  4HLY A;  1BI0 A;  5LEK A;  4E7Z A;  4BEH B;  1IN8 A;  2QWW A;  3GX4 X;  1VQ9 I;  5FKM A;  2RN7 A;  1QHG A;  4WK8 F;  2ICW G;  2V6C A;  4L9J A;  4G6D A;  4HAM A;  4BJ6 C;  3E7L A;  1X2M A;  3A03 A;  2ISZ A;  3H5R A;  3BDD A;  2W25 A;  4AIH A;  2GXG A;  3TP0 A;  1TNT A;  2A69 F;  4XN3 A;  1FIP A;  2RNJ A;  3SEQ A;  3HOY J;  3E97 A;  1JXS A;  2G9W A;  3WTU C;  2DTZ A;  4F92 B;  4Y13 A;  1FYM A;  2LRE A;  3FXJ A;  2CV2 A;  3E3V A;  2Y30 A;  4Y15 A;  3EYI A;  2LY9 A;  1E3O C;  4U88 A;  3S15 J;  5LEJ A;  2H6B A;  3C1D A;  1WFX A;  1BC8 C;  2DQR A;  4HRI A;  1BC7 C;  3OYG A;  4WWC A;  4J01 A;  2LKS A;  5A2Q K;  4ESB A;  4EGZ A;  4OIN F;  3V7C A;  3W6V A;  5D8L B;  5ILV A;  1LKX A;  3TMO A;  1KU7 A;  4MEY F;  3KE2 A;  3HSR A;  4P55 A;  4B3A A;  1Y8R B;  2E60 A;  2XRO A;  3RPU D;  4A2U A;  4Q5S F;  4N9I A;  1CQT A;  2IT0 A;  4BE1 A;  5DCM B;  1WCM J;  4BY1 J;  2ZC2 A;  4Z6Y A;  2LBF B;  3EPZ A;  1YJ9 I;  1DUX C;  2MH2 A;  3CJR B;  3QPH A;  1ONV A;  1ETW A;  1N78 A;  4FET A;  2VT2 A;  5D6F A;  5FKL A;  2UUZ A;  3TW6 A;  2WB1 A;  2Z2S B;  3OSF A;  4E7L A;  3FBI B;  2YU9 J;  1TWC J;  4DZP A;  2F5D A;  5E3O A;  4A3B J;  5B5E C;  2MYS A;  4L5J A;  1WJE A;  4MHG A;  4U0V A;  2EZL A;  1ZAO A;  3OYJ A;  2Z9O A;  2ZNZ A;  3OOU A;  1NHA A;  1DGR M;  2KL4 A;  5LGN A;  3CDI A;  3HOX J;  4XRF A;  4BXX J;  3OIQ A;  4IJA A;  1IUY A;  2DU9 A;  2CJJ A;  4IHY A;  2P81 A;  3I71 A;  2QGU A;  3SZG A;  5BNG A;  3JRG A;  2M8G X;  3S1Q J;  2E35 A;  3K1N A;  2R5Y A;  2J5O A;  3RKY A;  5FKK A;  2XB0 X;  1HCR A;  1XMK A;  2KLO A;  2L4M A;  3LSM A;  5FJ8 J;  2VOO A;  1R36 A;  3F8M A;  4BDZ A;  3PL8 A;  1B72 A;  3A4C A;  1HKQ A;  1MSE C;  1DPU A;  1W5T A;  2RNG A;  4IQ4 A;  4HSR A;  5DUI A;  2CU7 A;  5CQG A;  3CJN A;  1OCR H;  5FKO A;  2A07 F;  2R7Q A;  3ECH A;  1XCV A;  2FBK A;  2MC3 A;  5EGO B;  1QQI A;  4KMU X;  3FKI J;  2RDP A;  4GGG A;  5K1Y A;  1PUF A;  1T56 A;  4CDG A;  2I10 A;  2V7F A;  3F8C A;  3S1R J;  3M3Y J;  4PK4 A;  3IWF A;  2FOW A;  2KRH A;  4D0P A;  1ENH A;  5H6Q A;  3CLO A;  1REP C;  3QPS A;  5FGM A;  3P9K A;  4C9Y A;  1XDU A;  4KN7 X;  3AKZ A;  4HF1 A;  3L2Q A;  1Z21 A;  1R49 A;  1Q1H A;  4MTE A;  2LF7 A;  2XKP A;  1JHF A;  3QP5 A;  3ZRG A;  2OCE A;  3CCE I;  3HKZ A;  3Q0U A;  2IA1 A;  3BPV A;  4Q47 A;  3S1N J;  1RES A;  1ZH5 A;  1ON2 A;  4XID A;  1IN7 A;  3HDD A;  3BR2 A;  4HX4 A;  3A01 B;  1APL C;  2WAQ N;  1BJA A;  2LRD A;  3GFL A;  4I01 A;  4U0W A;  3MMY B;  4O3M A;  3RPQ A;  2R7Z J;  2JK3 A;  2HEO A;  4F3Q A;  2ADU A;  1U3E M;  1TT0 A;  4MQ9 F;  5CVR A;  1IW7 F;  1GV5 A;  1QGP A;  3VOE A;  3VSK A;  5ICE A;  3AG3 H;  4YG2 F;  4FAS D;  1BM9 A;  2KDZ A;  3S3M A;  4BE2 A;  5F64 A;  1MKM A;  2P8T A;  4XOP A;  3RZD J;  3HHH A;  3H0D A;  1GLN A;  5M3M J;  4XM3 A;  5J1Y A;  5IYD J;  3JW4 A;  4XRS G;  1TWA J;  2AHQ A;  1AA7 A;  5GPA A;  3CUQ B;  2L5Q A;  2FMY A;  4A3L J;  5J6X A;  3CC4 I;  5HDK A;  1FMW A;  1Q1V A;  2A6H F;  2UZK A;  2AO9 A;  3DBL B;  2AXL A;  2PBI A;  4BYY A;  2RQP A;  3TQN A;  1P2F A;  2HVR A;  1QU3 A;  3QU6 A;  2L3D A;  1YO5 C;  4BKX A;  4A3G J;  1FWZ A;  2FML A;  1GXP A;  5M3F J;  3GZ6 A;  4HYE A;  1K4T A;  4LB6 B;  3D5L A;  1LB2 A;  4L5E A;  2VBX A;  2EIL H;  4DIQ A;  2HOA A;  1QHH D;  1ZHF A;  3WGG A;  4EM2 A;  1U5T A;  3J7A Y;  2ZXH A;  5J47 A;  5GAH J;  2F2E A;  3LSH A;  2R7D A;  2ZME B;  4MGR A;  4AVZ A;  3SEZ A;  2VUM J;  1JT0 A;  3DBR B;  1RUN A;  3ESW B;  3CO6 C;  4BXU A;  1UHM A;  3H3Z A;  3GEZ A;  3VDX A;  3CLQ A;  1IAW A;  1V5E A;  4OWR B;  3K4L A;  4G7Z F;  2DA6 A;  3W2W A;  4B44 A;  3F6V A;  2RC4 A;  5D8K B;  4LK1 F;  1IG7 A;  2M45 A;  2BBY A;  3M8F A;  2LKP A;  5J8C A;  2TRT A;  3DXJ F;  3CCS I;  1Z67 A;  2ZME C;  1O3S A;  3LL7 A;  1U78 A;  4N4N B;  4EAT A;  4NHJ A;  1D0Z A;  1A6I A;  4KFC A;  4ZYA A;  4UY8 I;  4BUP A;  2LD5 A;  2HQA A;  3OYB A;  1BI3 A;  2H6C A;  3PSI A;  1JGG A;  3GLX A;  3HM5 A;  2DOE A;  4ZTJ A;  5K7Z A;  3REO A;  4C3I J;  1E2X A;  2DK8 A;  2EJR A;  3RYP A;  1TWH J;  2YUS A;  3PUF A;  4KNY A;  3KFW X;  1FSH A;  2CRG A;  2KT0 A;  1PYV A;  2COM A;  2JUG A;  2LTP A;  3FXR A;  4ZC3 A;  3K2Z A;  1SFX A;  5CYV A;  2EIM H;  1HKT A;  2A6T A;  4G9Y A;  2G7H A;  1W4M A;  2IGO A;  4UUS A;  2A5W A;  3KYC B;  6PAX A;  5CQE A;  4A0Y A;  1HXD A;  4J19 A;  2L9S A;  1R58 A;  3ABU A;  1D1C A;  1W5S A;  3EDP A;  3ZMU A;  1J9I A;  3J80 Z;  2FF4 A;  1WJA A;  3ROU A;  2HZT A;  3F21 A;  3ZQG A;  2F5V A;  3I59 A;  3DPT A;  3ABM H;  1IN5 A;  4IVN A;  3K4C A;  4QWQ A;  1MMS A;  2VOD A;  1VFC A;  2HXI A;  4CA0 A;  5D5W B;  4RB1 A;  4C3H J;  2PMU A;  4BGD A;  2JA5 J;  1SEU A;  1H88 C;  1MBF A;  2L7F P;  3HRM A;  1QRY A;  4XSX F;  3L7W A;  1ZRE A;  4RB2 C;  3I4M J;  3MKL A;  5HNH A;  2F4O B;  4WXH A;  3QYB A;  5AIP A;  2EIJ H;  3O2P E;  4F7Z A;  1AOY A;  1GDT A;  4NQW B;  2FD5 A;  4ENJ A;  1P7J A;  3B73 A;  2M4G A;  2IAI A;  2LSO A;  4V2G A;  2IA2 A;  4ESF A;  2KRC A;  4RGU A;  5CVV A;  3J81 K;  1KZH A;  2OU2 A;  4FX4 A;  2E1M B;  4I98 B;  3HYI A;  2PJR A;  2WTE A;  3CDH A;  4BBR J;  4E6K G;  3E6C C;  1W1W E;  3U2R A;  4GDF A;  3ZQF A;  4HZF A;  3NAR A;  5HNF A;  1ZK8 A;  3DEW A;  3WTZ A;  2DA3 A;  4GYG A;  3DCF A;  1S72 I;  3RKX A;  3HL2 A;  3CUQ C;  2FBI A;  4HBL A;  1ZRD A;  4XRS A;  3GFI A;  3IKT A;  5M5Y J;  1N75 A;  3DPL C;  1HW5 A;  2YR2 A;  4S05 A;  2XF6 A;  2E1M C;  2Y0S N;  2R0Q C;  2VXZ A;  4G6T B;  2VC0 A;  3DLA A;  5HLI A;  3HUG A;  1Z0X A;  4DOZ A;  4ZDO A;  4PCQ A;  1HA8 A;  4I6Z A;  1I3Q J;  1ERD A;  1RR8 C;  1J5Y A;  3H5N A;  2OD5 A;  2HPI A;  2LY1 A;  4L9V A;  4AM3 A;  5D5X B;  3ELK A;  3CF2 A;  3EET A;  1ZLJ A;  3SZP A;  4AVP A;  3V7R A;  4RAF A;  3CC7 I;  3ZMD A;  2UWM A;  2DT7 B;  4QPO A;  2HR3 A;  3ZQ7 A;  3H5A A;  2CMP A;  2HOT A;  3I54 A;  2B7E A;  3SZT A;  4A3F J;  2X1E A;  3H3V K;  3HG9 A;  1I3A A;  2QUF A;  1KGS A;  3F22 A;  2HFH A;  5K7H A;  2R7O A;  1IF1 A;  1ON1 A;  2M9H A;  1YIT I;  2X6W A;  5DEQ A;  1JJ8 C;  4MFE A;  1O4X A;  5F27 A;  2ACJ A;  4YFN F;  3K4B A;  4M3E A;  3J7A O;  4IPA A;  2LK2 A;  1MMA A;  4AUX A;  2EBI A;  2NXN B;  2B63 J;  2K9N A;  1WH7 A;  2JJ7 A;  2D2W A;  4PJN A;  2E34 A;  4RAY A;  1JKO C;  1MDM A;  1PDN C;  4BJ5 C;  2H8W A;  1LQ1 A;  2E7W A;  2QSF X;  2VAS A;  4BEH A;  1ZLK A;  2XAQ A;  2DFF A;  2I8D A;  1ZEL A;  3OYN A;  4KIT B;  1KYZ A;  1I1G A;  1T95 A;  4HLX A;  2O8K A;  2HQR A;  3IH2 A;  4JOM A;  3LQQ A;  4IRI A;  4BQO A;  2FOK A;  1FC3 A;  1MNE A;  4RBO A;  4I76 A;  1CGP A;  4YRV A;  3BG7 A;  2RRE A;  1J2X A;  4D5C A;  4XLC A;  4HNT A;  3CCU I;  1NH3 A;  3T0Y A;  3PNV A;  2L02 A;  1HQC A;  1G3S A;  1W36 C;  2ISY A;  3B6A A;  5B1B H;  4UB8 C;  5KCM A;  3G6E I;  1VTN C;  3VWB A;  1MMG A;  1A35 A;  2X6X A;  4KIS A;  4EJU A;  5HS8 A;  1G8X A;  4EMS A;  2ZO4 A;  4BY7 J;  4DW6 A;  1P4X A;  4CSW A;  4ENM A;  3GCM A;  2DT5 A;  1J0R A;  3IKV A;  1R4N B;  2DK5 A;  3C18 A;  5LRS A;  1Z6R A;  4M6V A;  1DDN A;  1YG2 A;  4RGX A;  3U9G A;  4XBF A;  2CSO A;  2K9S A;  3F0C A;  3J7Z I;  4CCN A;  4KMF A;  2ID6 A;  3M1C A;  2R7S A;  5LBQ A;  3LSJ A;  2HTS A;  2VXD A;  3JTH A;  2HDC A;  3K70 D;  4FIS A;  2M87 A;  1IRZ A;  4ZDL A;  4GRI A;  2VJI A;  3HRT A;  3L9F A;  2YX4 A;  3MVP A;  3TDZ C;  4U0Y A;  5JHU A;  2HVQ A;  1YTY A;  1XD7 A;  2DA4 A;  2ESH A;  2IXS A;  4UXN A;  2HI3 A;  1HC8 A;  2VBZ A;  3KP7 A;  5B1A H;  3ML6 A;  4RMN A;  4RLF A;  3NWS A;  1RPW A;  3OYE A;  4A5N A;  1Y1W J;  1WJB A;  2V9P A;  3PSF A;  1ZG3 A;  2QQ8 A;  1QZE A;  2VT3 A;  3FXM A;  2XGE A;  3TED A;  1E3H A;  4XOT A;  1BW6 A;  1FY7 A;  2LY2 A;  2VE8 A;  3J7Y J;  3G1L A;  1MD0 A;  1G3T A;  3G2B A;  2QYO A;  4JYK A;  1FLI A;  3N05 A;  4PJ0 C;  1MH3 A;  2M2E A;  5E18 F;  4E4H A;  4F93 B;  4XLH A;  4L18 B;  2EIK H;  3B02 A;  1R4M B;  1OYY A;  2CS3 A;  4IKF A;  2XUB A;  5DS9 A;  4XIC A;  2LDU A;  1RZ4 A;  3FXL A;  1YS6 A;  1VQN I;  3O8H A;  1FYL A;  1OJL A;  2K4B A;  1T39 A;  3MN2 A;  2GA2 A;  1G6N A;  5IY5 H;  4HST A;  3BG9 A;  5HS9 A;  1B4A A;  3M4O J;  2ZCW A;  1C0W A;  2DMN A;  3IH4 A;  4V19 K;  1Z9C A;  1RRJ A;  2M30 A;  2YPR A;  4II3 A;  2K3P A;  3RIR A;  2W57 A;  4AID A;  1PUF B;  2DMQ A;  4CO8 A;  1F43 A;  2Q2E A;  2DMT A;  2VJ5 A;  2NNY A;  4XR6 A;  2R4G A;  1HBX G;  3WTX C;  5L3G A;  2Q2E B;  5L3C A;  4A3I J;  2JQ7 A;  2EH3 A;  1TBX A;  3C7J A;  3A1Y A;  2W48 A;  5CPR B;  1JT6 A;  3WOD F;  1V55 H;  4ZJZ A;  3QPL A;  5FD6 A;  2IVM A;  4YEJ A;  5HLH A;  1MBE A;  3RKQ A;  3MFK A;  2PN6 A;  2CUF A;  4AWX B;  1KU3 A;  3RQ4 A;  5BPI A;  4QSH A;  5J4V A;  4DQ2 A;  2XAF A;  4HF2 A;  4YFX F;  3WG9 A;  1VQM I;  2ZB9 A;  1WVR A;  1B8I A;  3SQN A;  3F23 A;  1VI0 A;  1VQL I;  3OOP A;  2MLK A;  3HSE A;  1SVM A;  3HEF A;  2ECB A;  5DYM A;  4UB6 C;  2YU3 A;  3F8B A;  1LNW A;  3FM3 A;  1D1B A;  3DKW A;  1VQK I;  4FE7 A;  1RI7 A;  2WV0 A;  4FQG A;  2EQR A;  4BNC A;  3MWM A;  3Q3S A;  2F6C A;  3H1C A;  3OIO A;  3MKW B;  3KCC A;  3F8F A;  4LD5 A;  1ZG5 A;  3R60 A;  4FE4 A;  1IGN A;  4ON0 A;  2DJI A;  2X6Y A;  3A02 A;  4XLE A;  4DYQ A;  5IYC J;  5E3L A;  4B4C A;  1GVJ A;  2OJE D;  2V26 A;  1Z05 A;  5E3N A;  3H9J A;  3LA7 A;  5LHH A;  3K1M A;  2RVC A;  4JX5 A;  4HA8 A;  5EEA A;  2M1B A;  4ANJ A;  1B1B A;  1BR2 A;  1K6Y A;  1IZ1 A;  3M9A A;  1LDD A;  1A36 A;  2A3S A;  5C4J J;  4NNJ A;  3S2H J;  5TJJ A;  1STZ A;  1UST A;  3V7S A;  1LE8 A;  4D9J A;  4ETS A;  4G6Q A;  1R1T A;  4AIK A;  2RAE A;  1ETQ A;  4KIF A;  2DQL A;  1VQ4 I;  2MLG A;  2XDV A;  1MJB A;  1UMQ A;  4U7D A;  4A12 A;  1O3T A;  4LLN A;  1UG0 A;  2O3F A;  5BQT A;  1TNS A;  2L4A A;  1SD6 A;  4KT6 A;  4GYI A;  3M07 A;  1ZG1 A;  3QOD A;  2VQC A;  2NRA C;  3CTA A;  1XC5 A;  2EZH A;  4CH7 A;  2AQF A;  3E6D A;  4AU7 A;  3WHB A;  2Z3Y A;  4M9Z A;  1S5L C;  5L3B A;  2QQ9 A;  1W0U A;  5KAF C;  2DA5 A;  3WTV C;  1SVO A;  1K78 A;  3JSO A;  4BQQ A;  4WCG A;  1XMX A;  3GUD A;  2E71 A;  2O8X A;  1R5H A;  2QM3 A;  2KIF A;  2L9V A;  3LSK A;  4H0E A;  1GT0 C;  3FBN B;  1ETO A;  3D5S C;  1LFU P;  2C6Y A;  3RSN A;  1AKH B;  1T38 A;  2KFD A;  5DM7 F;  1MIJ A;  5D5U B;  3LAP A;  1LDJ A;  4QIW N;  3GTO J;  3OYD A;  3OR1 C;  4NC8 A;  3DBH B;  2DDB A;  4XLA A;  3JRH A;  1X1D A;  3BTC A;  1OR7 A;  1MDM B;  4LOC A;  4DYR A;  3BTL A;  3HRS A;  1B6A A;  2L7K A;  2CFO A;  2K5C A;  4PZJ A;  3E5U A;  3K4K A;  4CCK A;  2JPB A;  2ME6 A;  3BG5 A;  3CP2 A;  3L2U A;  2GLO A;  4B3X A;  4I02 A;  2FXA A;  4PJL A;  2NAZ A;  3GF2 A;  1HST A;  5LHI A;  1T33 A;  4XKV A;  4OIQ F;  1K83 J;  1UZC A;  1XG1 A;  2P7V B;  3DWL E;  3FHN A;  4S0H B;  5EF6 A;  4MFD A;  5KNL A;  4X6A J;  4BHP A;  4DBR A;  3R61 A;  2K4J A;  2Y75 A;  4IQJ A;  1W36 D;  3ZR8 X;  2NS0 A;  2DT6 A;  2ZFW A;  2K86 A;  3PM1 A;  3JAM K;  2JN6 A;  1UHW A;  1B59 A;  1OLT A;  3L1P A;  5E1Z B;  2VI6 A;  3KX2 A;  4IHV A;  3BT9 A;  2E36 A;  1F36 A;  1O7L A;  1VQ7 I;  1ZGJ A;  3IAS 2;  1GXQ A;  1W5C C;  3BJO A;  1ZQ3 P;  5E3M A;  4A3E J;  1Y8Q B;  5F08 A;  1BIB A;  5CVI A;  3KP2 A;  2BY0 A;  5LHG A;  4OMZ A;  1ZTR A;  5FB2 A;  4BQA A;  3NAU A;  4IO9 F;  3G73 A;  9ANT A;  2V1U A;  5C44 J;  1QZZ A;  3I5U A;  2ZXJ A;  4UVC A;  2JA6 J;  1IXC A;  2WA0 A;  3BTJ A;  2CUJ A;  2PFB A;  2RQQ A;  3DLL F;  4N9H A;  1U8B A;  3HBL A;  1U5T C;  1QO0 D;  1X3W B;  4A69 C;  1NG6 A;  2DDA A;  3CP8 A;  4AC0 A;  3CO7 C;  1WI3 A;  4I2O A;  2NOG A;  1H8A C;  2DI3 A;  2O5R A;  4S04 A;  1X3U A;  5JVT A;  1FBU A;  3JRA A;  3CUO A;  5K5Q A;  4IF4 A;  1IRG A;  3OYM A;  2ID3 A;  2IEK A;  5JLX A;  3QU3 A;  2HDD A;  3MQ0 A;  2ESN A;  4IRG A;  5ILU A;  5TRD A;  1Z91 A;  3T5X A;  4XLF A;  4XL9 A;  3CZ6 A;  3LFU A;  2HKX A;  2TDX A;  5L3F A;  3IRQ A;  1XSX A;  5IP6 A;  3GFJ A;  1ETY A;  3GYH X;  2BHZ A;  3OL3 A;  1PUE E;  3ZQI A;  3DPU A;  4PJM A;  5IT9 K;  3GTM J;  3OL4 A;  3Q9V A;  2QCO A;  2GZW A;  3D5R C;  2LF8 A;  4RGS A;  3QP6 A;  2OTJ I;  4FX0 A;  1OR7 C;  2OZU A;  2WAQ A;  5K5R A;  5IYB J;  4XLN F;  1X1C A;  1ZN2 A;  1IXR C;  1YQA A;  3DKX A;  3ZCO A;  2W85 A;  4JX6 A;  2LG4 A;  4W97 A;  2KMU A;  3DEU A;  2E19 A;  1USS A;  3S2D J;  1GUU A;  4RB0 A;  2GXA A;  4A6E A;  4HQM A;  3OYI A;  5HDN A;  5HDG A;  1YJW I;  4LG0 A;  2STW A;  1BL0 A;  1JTX A;  1WKM A;  1XGS A;  2KIM A;  4C30 A;  1G3W A;  1SD7 A;  2B0L A;  4M3D A;  1PP8 F;  4WXD A;  4Y4R A;  1T08 B;  1QBJ A;  1A31 A;  5A2Q Z;  5JLW A;  4PFP A;  1WZ2 A;  3FHZ A;  2OQR A;  2GAU A;  2DBB A;  1TW3 A;  4LLG F;  4ZH4 F;  3ERE D;  1RKW A;  3LAJ A;  3HC7 A;  4A3K J;  3GZ5 A;  4EJW A;  2ZNY A;  4IHX A;  2KP6 A;  4B43 A;  2BW3 A;  2H09 A;  2KIS A;  2OBP A;  1LE8 B;  1Y1V J;  3EYY A;  4IOC F;  3VYU B;  4M3B A;  3VB2 A;  3CC2 I;  4BHC A;  1EH8 A;  4CHU A;  1LJ9 A;  1X19 A;  2MSY A;  4L9T A;  1WPK A;  5CLS A;  1BJZ A;  3FXU A;  3OWT A;  5J3L A;  3IL2 A;  1MBJ A;  3ZMS A;  1TLH B;  2Z99 A;  1FBQ A;  2ELK A;  1AWC A;  2PG4 A;  2VQG A;  1AHD P;  1OMI A;  4D1Q A;  2XVC A;  4NB5 A;  5DV5 A;  5LFA A;  4A93 J;  4B1R A;  3A0H C;  3BR3 A;  2DAO A;  2FJ1 A;  3BR0 A;  4OIR F;  3S93 A;  3T1B A;  3VFZ A;  5B66 C;  1P4W A;  1WH5 A;  1KU2 A;  2LOO A;  2W82 A;  2IS1 A;  3QYE A;  3FX3 A;  5JHF A;  5H20 A;  2QSG X;  3IH3 A;  4Y3O A;  3TBI A;  3FF5 A;  4I09 A;  2F4M B;  1HLV A;  4CYC B;  1R00 A;  4OMY A;  1WJD A;  4Y52 J;  4IXA A;  1WJ5 A;  5KHD A;  3MKZ A;  1WGX A;  3NWT A;  3DKY A;  4ZZD A;  5AON A;  4L0Z B;  3O8G A;  2OV7 A;  3WTW C;  4P5O A;  2D45 A;  2X9D A;  1BI1 A;  2VN2 A;  3VOD A;  1OFC X;  5E8G A;  5GTH C;  4OAZ A;  3UNG C;  4BBS J;  5L3D A;  4CZZ A;  5IP9 J;  3BG6 A;  3FK6 A;  5EG0 A;  1FIA A;  1RUO A;  2MW8 A;  2DW4 A;  2NYX A;  4II2 A;  5GPC A;  3PFI A;  5H2F C;  3W6K B;  3GBG A;  3TDU C;  2ETH A;  2BGC A;  2CG4 A;  2ZJR F;  2XRN A;  1R1U A;  1OCO H;  2DA1 A;  4A5M A;  4BH9 A;  4NC7 A;  2WAD A;  3AG2 H;  1ZGW A;  3G3Z A;  5F6F A;  4RM2 A;  3DU5 A;  3MCZ A;  3CF5 F;  3SFZ A;  2L7Z A;  4UNO A;  1XDS A;  3CES A;  3E1S A;  4W1U A;  3C2B A;  5LGU A;  3DV8 A;  2JWT A;  3OYH A;  3BQY A;  3ZMZ A;  1CF7 A;  1HW1 A;  3KP4 A;  3FKJ A;  3OIP A;  3OV8 A;  5ICG A;  2X85 A;  2MBF A;  4X0G A;  1FTT A;  3KPH A;  1LEA A;  2MA3 A;  2I5U A;  4E7J A;  1IDY A;  1U2W A;  1PVE A;  1PP7 U;  4P96 A;  3BJA A;  3S2W A;  2E2H J;  4M72 A;  2NVX J;  2K27 A;  4EJV A;  3H3U A;  1MNM C;  4EJO A;  2DPD A;  2FX0 A;  3IAM 2;  3BY6 A;  4KIC A;  2AS5 F;  2QVO A;  1EJ9 A;  2STT A;  1Z3X A;  4HV5 A;  3A01 A;  3OMY A;  4M6X A;  2CQQ A;  2X6O A;  2E1O A;  1MMN A;  2KQR A;  3EQL F;  4KIG A;  2H1K A;  2LR8 A;  2EFQ A;  3TO9 A;  3VPR A;  5E1X A;  2CW7 A;  4I0A A;  2HS5 A;  2VOP A;  1S9H A;  2CO5 A;  4OU0 A;  5DTD A;  4DGW B;  1BOA A;  3BZC A;  4OAY A;  2R92 J;  3I3L A;  1Z1D A;  2IA0 A;  4BQN A;  2Y48 A;  1XSD A;  1RR7 A;  3K0L A;  3L2R A;  4M3F A;  1T2K A;  3K7A J;  5ICF A;  3FZV A;  3CCJ I;  2BVL A;  3LWF A;  1POG A;  2GA1 A;  4PFO A;  1L0O C;  2JRT A;  2JT1 A;  2HGC A;  1Z6T A;  2XPV A;  3BC8 A;  2O6G E;  2DFH A;  1IN4 A;  2QLZ A;  4LG0 B;  1UB9 A;  2CW8 A;  2NOJ B;  4JQF A;  2AQE A;  2XAG A;  3JAM Z;  2L2O A;  5IOY A;  4JX4 A;  1YI2 I;  2ZKZ A;  3WGI A;  4XN0 A;  1P4A A;  2ZJP F;  4C2U A;  3T8R A;  4MEX F;  2P6T A;  1IV6 A;  1JUM A;  1OYI A;  2IW5 A;  2V9V A;  5M5W J;  2FUG 2;  1DGW Y;  3PQK A;  2PJP A;  4M74 A;  2V6E A;  1SAN A;  4I99 C;  3W2V A;  1JHH A;  2K02 A;  5DUK A;  3MEX A;  2FNA A;  5CJ9 A;  1KYW A;  1TW2 A;  4IEJ A;  2BEO A;  1YW9 A;  1Y0U A;  2OZ6 A;  3WU0 A;  2LVS A;  4L5I A;  3G1M A;  3KET A;  3IV5 A;  1FOY A;  5J1U A;  1IN6 A;  1FP1 D;  1VF9 A;  4CIC A;  2CWE A;  5ICC A;  3C2H A;  2GM4 A;  1FX7 A;  1MH4 A;  3W6J B;  2WV1 A;  3WU2 C;  4F91 B;  5LLQ A;  1S6L A;  2DA7 A;  3VSL A;  1Z7L A;  3KLN A;  3FMQ A;  1D5Y A;  3PNT A;  2BZT A;  5D4S A;  3ZN0 A;  2DXI A;  1DU0 A;  3ZQC A;  3E6M A;  1PJR A;  3A0B C;  1QVT A;  4IL6 C;  3BQZ A;  3AFH A;  1JKQ C;  4AYB A;  4HF0 A;  4PGH A;  1XTA A;  2KKO A;  2WC2 A;  4M6Y A;  4G7H F;  1I50 J;  2EV0 A;  4CCJ A;  2JA2 A;  2F5C A;  2XHK A;  2KZV A;  2XV4 S;  2HTJ A;  5GAD J;  2MH9 A;  1O57 A;  3K4M A;  4O6J A;  2WB1 N;  2DFI A;  3AG4 H;  5FD5 A;  4GXO A;  4LMY A;  3IUO A;  1QNT A;  2D5V A;  2FRH A;  2XAH A;  3ZMT A;  1BW5 A;  5J40 A;  1VQ5 I;  2P5L C;  4CCM A;  1MMD A;  1Z77 A;  1OPC A;  3KZZ A;  1TQM A;  3BZK A;  2D1V A;  5D6E A;  2DFE A;  2XRL A;  2E2J J;  1QVU A;  2P7C B;  1RNL A;  4D5F A;  2IS2 A;  4RDU A;  3R6S A;  1P9Q C;  4B09 A;  1UHS A;  2XIG A;  2Z33 A;  3OS0 A;  5GTI C;  3BTI A;  1J59 A;  3FM5 A;  2QKM B;  2E7X A;  3WGH A;  1P7I A;  2DLL A;  4E7H A;  3FXQ A;  3HB9 A;  1E17 A;  3R0A A;  3HOT A;  5C3E J;  2FEZ A;  1TTY A;  2XAJ A;  1IRX A;  1LFP A;  2L9N A;  1R5I D;  4HX8 A;  2QEN A;  3BR1 A;  2DMP A;  1MND A;  1FZP B;  3N4M A;  5DDG A;  2MAB A;  4XQF A;  5FLV A;  2L7M P;  1XCB A;  3FWE A;  4KT5 C;  4R1H A;  5DD4 A;  4CCL A;  3U1K A;  2CV0 A;  1TQI A;  2EA4 A;  3C2G A;  2HZD A;  3OYC A;  4CGZ A;  3R0J A;  4HDV A;  3JRB A;  1X4P A;  2X4H A;  1IJW C;  5CKT A;  1UEL B;  3HUG B;  3GTK J;  2OTL I;  3HOU J;  1RET A;  2CV1 A;  3LMM A;  2ZJ2 A;  3V8K A;  1K79 A;  4EVI A;  3B6C A;  2XF5 A;  4MIM A;  2EZI A;  3RI4 A;  2OAZ A;  1YX5 A;  3TO6 A;  1JKR C;  3SYT A;  3BZ6 A;  4EV0 A;  3ZQH A;  1W7P D;  1YOV B;  4NQW A;  2VON A;  2F5E A;  4R79 A;  1JUS A;  2M7A A;  4UUV A;  2Z5U A;  4EGY A;  3ZGK A;  1SFK A;  2X51 A;  1R71 A;  2XSJ C;  3WTY C;  1G59 A;  5F0F A;  4Q48 A;  4LG3 A;  2X1D A;  2Q8K A;  4KA4 A;  2N8G A;  2CH0 A;  3MAJ A;  2IP2 A;  1JUP A;  1Y56 A;  2PJR B;  3F8N A;  4MLO A;  3SDG A;  3G4S I;  1J75 A;  1R22 A;  5KAI C;  5F1R A;  5CVJ A;  4MQV A;  1XGN A;  4UHT A;  1V4R A;  2JSC A;  1F9N A;  3I59 B;  2R7R A;  2KJB A;  2H27 A;  5HOD A;  2VKE A;  3P9I A;  2NVY J;  4GFB A;  2DYR H;  4KJZ A;  1FBS A;  2XAS A;  5EEH A;  5BOX A;  3BG3 A;  2KHM A;  3FIW A;  4YFK F;  1HKS A;  2VKD A;  2M0C A;  3CUQ A;  3M7G A;  5HOO A;  4ZYE A;  1FTZ A;  3N97 A;  1H0M A;  3PQJ A;  3CD6 I;  4WXC A;  3S3O A;  1Z3Y A;  2M3A A;  2L54 A;  5FLX K;  1XN7 A;  5EEG A;  1SFU A;  1TC3 C;  4E70 A;  4BAC A;  5HS7 A;  2FU4 A;  5F0H A;  4CXF A;  3HPH A;  4L0Y B;  3X2Q H;  1QPM A;  3S8P A;  3ZPL A;  2A68 F;  1QA6 A;  2PMZ A;  1YE9 A;  3V8J A;  1BIA A;  3TP3 A;  5H6R A;  3JR9 A;  2WY8 Q;  3H0G J;  2VLA A;  3PO2 J;  1TWF J;  4QTR A;  2IS6 A;  3LNQ A;  2ZSI B;  1ETV A;  1LFB A;  4BXF A;  3HTS B;  2XKO A;  2EIN H;  2P4W A;  3BP8 A;  3Q0V A;  2V1D A;  3E6B A;  3NRV A;  3P9C A;  3KP5 A;  1R6R A;  2QQA A;  2XPU A;  3I4P A;  3LA3 A;  3V42 A;  2LNB A;  2K7L A;  3JTG A;  3GTJ J;  1LPQ A;  3K2A A;  5FRN A;  2EK5 A;  2LFB A;  5F0C A;  4C3J J;  3JRE A;  2LKX A;  4IZZ A;  3WG7 H;  1IDZ A;  2XF7 A;  4G8X A;  2PI0 A;  4U87 A;  2E5N A;  2J5P A;  3DTI A;  3ONQ A;  2K9M A;  2DYS H;  4J00 A;  4A0Z A;  3JCU C;  3LOC A;  3TGN A;  3S17 J;  2WAF A;  3E5X A;  3D0S A;  3G71 I;  3CMY A;  1ZRC A;  3GTP J;  4Y7N J;  4HEA 2;  4ZYG A;  1I1S A;  2EFW A;  2JSP A;  3S32 A;  4LGW A;  4MO7 A;  5BPD A;  2HNH A;  1X1A A;  5K5O A;  1YRN A;  4M9S A;  3IRR A;  2Y31 A;  3FMS A;  1S3J A;  4Z2Y A;  5JVG F;  3QRF F;  1B8I B;  1K78 B;  2GQQ A;  3K6G A;  1BR1 A;  2UV1 A;  3HKZ N;  5BS6 A;  1K4S A;  4A3D J;  2FQ3 A;  5EJC A;  1YLF A;  2QA4 I;  3I4N J;  1VZ0 A;  3L2V A;  2ME0 A;  1B9N A;  3BOQ A;  3ABK H;  2X1C A;  3RJP A;  1D1A A;  5FRM A;  1OQY A;  3T8T A;  3KEO A;  2CQ7 A;  1YYV A;  5IOZ A;  3OS1 A;  1YRN B;  4XKC A;  2M5W A;  1S7E A;  1XMA A;  5HVQ C;  2VBY A;  5EG0 B;  4E7S A;  3JRC A;  2ZSH B;  3ZQQ A;  2WAE A;  4YII A;  1FMV A;  2LLK A;  1XS9 A;  2GOX B;  2VKV A;  1AU7 A;  1HSJ A;  2XAU A;  3OYL A;  5EZH A;  4PUS A;  1S7O A;  2QBY B;  2ZFU A;  3NQO A;  3EUK L;  3K4J A;  1WJF A;  4M71 A;  5D5V B;  2Y69 H;  3JRD A;  4I0B A;  1EKE A;  3W3C A;  1FOX A;  2BVM A;  4NUB A;  2HQ5 A;  3KEQ A;  3CJQ B;  3QWL A;  1QPI A;  2WY7 Q;  3P5J A;  1SD4 A;  4FHT A;  4JBA A;  5JI6 A;  1ACI A;  1R7J A;  1H89 C;  3CMA I;  1BI2 A;  2Z1D A;  2DMU A;  4YIF A;  3Q5F A;  2O03 A;  2QF7 A;  3QAH A;  1JJ6 C;  1ZGA A;  2A61 A;  2QBY A;  2V1X A;  4M9X A;  1MSF C;  5J4Y A;  3MZH A;  2MGQ A;  4PSX A;  2MFZ A;  2DN0 A;  4D7N A;  3IHU A;  1MBG A;  4LLL A;  2NVU B;  1TZL A;  3FXO A;  3LSI A;  2MD0 A;  4DBQ A;  1LVK A;  3BR5 A;  2XPW A;  1BA5 A;  2KZG A;  1U6G A;  2R93 J;  4KUM A;  1WHU A;  3GTQ J;  5K7F A;  1LDK B;  4XNF A;  3CCR I;  1SFE A;  4MTD A;  1YS7 A;  3O6B B;  1GV2 A;  2HQN A;  4XSZ F;  1FOK A;  4P1W A;  4UUT A;  1VQ6 I;  2M7B A;  4L9N A;  3KYD B;  3HTU A;  4UVB A;  1B72 B;  2OUM A;  3IP4 B;  3IC7 A;  2QEX I;  2GIV A;  1SC7 A;  2BY3 A;  2PLY A;  4ITV A;  2XGD A;  2F5F A;  3FDY A;  1U8R A;  2V9K A;  3GW2 A;  3AL0 B;  1LUJ B;  1M1E B;  2F4I A;  3LQR A;  3ZN1 A;  2FSW A;  3SXY A;  4CCO A;  3G1O A;  1ETK A;  4LIU A;  3PNY A;  2VB6 A;  3LSG A;  3HPG A;  2W00 A;  2Y9Z A;  1K61 A;  4M3G A;  1R23 A;  1NK2 P;  1YW8 A;  1P92 A;  5CVU A;  4JK1 X;  4ZZL A;  4E7I A;  3TOB A;  1ODD A;  3VYR B;  3K9T A;  3TW7 A;  2VE9 A;  2JVH A;  3RQI A;  2P0W A;  1IV8 A;  1GVD A;  3BCA A;  4IHT A;  5EYR A;  2NNN A;  1MBH A;  2UXX A;  4BDY A;  1U9O A;  1FOW A;  4CYC A;  1NTC A;  2MC4 A;  3O3K A;  4LIV A;  2W7N A;  5IT9 Z;  1GHC A;  3AL0 C;  2KDO A;  3DTE A;  2XB5 A;  2HXO A;  1MJA A;  2P5V A;  3KP6 A;  3QOP A;  4RB3 C;  4CZC A;  1LEB A;  3CCY A;  4DZJ A;  1Y6I A;  1VQO I;  3GO5 A;  3OSG A;  2HYF A;  2EWN A;  2G7U A;  4I7H A;  3CDL A;  1V3F A;  3H92 A;  3ECO A;  2L9R A;  2K40 A;  3JRF A;  1H9G A;  5F1J A;  4RGR A;  3S1M J;  2K3F A;  2LMD A;  1I5Z A;  2FNP A;  1UJ8 A;  2GBY A;  3TKY A;  4K2E A;  1BOB A;  3GWZ A;  3K1P A;  5EZG A;  2JA7 J;  1SAU A;  4HOB A;  5DCM A;  2CQK A;  3L00 A;  1SVL A;  4CUG A;  3E5Q A;  4D7M A;  2K9L A;  2CW0 F;  3M8J A;  4NC6 A;  5E1W A;  3J80 K;  3OYF A;  3HOV J;  1WJC A;  5FLX Z;  1KA8 A;  4KIB A;  3HOW J;  1V54 H;  2HDW A;  5C4X J;  4PSW A;  3ZP5 A;  3HZJ A;  3I56 I;  5AIQ A;  3DTK A;  3F72 A;  3I55 I;  3BJ6 A;  4RAG A;  3L2C A;  2V4J C;  2O9L A;  2F48 A;  5HLT A;  1TQP A;  1HDP A;  5FLM J;  4ASN A;  2E1C A;  1D0X A;  3H36 A;  3HGG A;  4ZYH A;  4OIP F;  3DQV C;  2VL8 A;  4B47 A;  2XGX A;  2OC6 A;  3PO3 J;  3Q0W A;  4IOA F;  4H4K C;  1I6X A;  4LFU A;  4G94 A;  1X1B A;  2QQB A;  2G0E A;  2MG4 A;  1JE8 A;  1D8K A;  1S29 A;  2FQ4 A;  1FEX A;  2AXT C;  4EM1 A;  4XRM A;  3LSR A;  2IJL A;  1U0J A;  5FFX A;  3I0T A;  3J81 Z;  4EQQ A;  1MBK A;  5JR3 A;  4PJJ A;  1OCC H;  1AKH A;  4JP0 A;  2ZXW H;  2EV6 A;  4FCY A;  5E20 A;  5E8I A;  2NVT J;  2R7V A;  2FA5 A;  2KIU A;  1D5V A;  4A3J J;  1WSU A;  4ESJ A;  1RIO H;  2EA2 A;  1T98 A;  2H94 A;  2MD5 A;  3UKG A;  4FT8 A;  3M8E A;  2NS8 A;  4IRH A;  1W7P B;  1X1P A;  1FP2 A;  2QKL B;  5KK1 A;  4BHB A;  5J1R A;  2ZXI A;  5IT3 A;  2OCC H;  3KLO A;  1I39 A;  1W7P A;  4M73 A;  4HQE A;  2JMW A;  4LK0 F;  1OCT C;  3P7N A;  3FK7 A;  3NEU A;  4NDL A;  3OR2 C;  3LST A;  3FXK A;  1YW7 A;  5F04 A;  2ELJ A;  1D0Y A; 
#chains in the Genus database with same CATH homology
 5ILS A;  3JSP A;  1B9M A;  1MGT A;  4RAZ A;  4KN4 X;  2DPU A;  2OA4 A;  4UVA A;  1WI9 A;  3I53 A;  3FMR A;  1O7F A;  4OOI A;  3WE3 A;  1HW2 A;  4PGG A;  3IWZ A;  1ZYR F;  2P5K A;  1L3L A;  2ELH A;  4ZYD A;  4Y17 A;  2X0L A;  3RTR A;  1O3Q A;  2L01 A;  5JFR A;  3F3X A;  5ERI A;  2HYG D;  3L09 A;  4A6D A;  2R3S A;  2HOE A;  2M8E A;  4U7B A;  3MZY A;  4GCV A;  4LJZ F;  1DPR A;  2EB7 A;  4OIO F;  3RKW A;  4HDU A;  1FT9 A;  1JGS A;  3LA2 A;  2ZME A;  4Q4Z F;  1EH7 A;  1Z7U A;  2DO7 A;  1MZB A;  4DNC A;  4KYW A;  1U5T B;  2FE3 A;  2O61 A;  1SD5 A;  3M1E A;  1FNN A;  1T6S A;  1F5T A;  4AIJ A;  1WRJ A;  1QZY A;  4RS8 A;  2VC1 A;  2WWY A;  2PQ8 A;  1KU9 A;  1J7K A;  4CYD A;  1K6O A;  4TV7 A;  2KJC A;  1KQ0 A;  4KDP A;  4P9U A;  3AAF A;  2HKO A;  1XSV A;  5J8F A;  4UV8 A;  2HWV A;  1I27 A;  5LGT A;  1F1Z A;  1MJ9 A;  1XGM A;  2BV6 A;  5BMZ A;  1SMY F;  3QPT A;  2R7F A;  1O3R A;  1LVA A;  1T0F A;  4G7O F;  3V8L A;  1BBY A;  2Y0M A;  3SHF A;  1OKR A;  4PDK A;  2V79 A;  2CGP A;  1OYW A;  3U1D A;  4A0X A;  4HW0 A;  3V4G A;  2RV8 A;  2PEX A;  1FPQ A;  3RPU A;  2VBW A;  3DF8 A;  2P6S A;  4WF2 A;  4N0B A;  3EUH A;  1IXS B;  2OQG A;  3WTT C;  5ED4 A;  1D8J A;  4B8X A;  3WTS C;  2EFO A;  4O5V A;  2W24 A;  2Q0O A;  4AD9 A;  1P6R A;  2EV5 A;  1WQ2 A;  1R5G A;  1SMT A;  3ZMV A;  3TO7 A;  2O0Y A;  3VEP A;  1DP7 P;  3GFM A;  2CFX A;  4IHS A;  3HHG A;  3GXO A;  3BPX A;  4EJT A;  1UCR A;  1G4D A;  1R1V A;  3ISP A;  1FSE A;  3K69 A;  3ULQ B;  1WWX A;  3HSF A;  3ABT A;  3RYR A;  3BRO A;  4GO1 A;  2BE5 F;  1CF7 B;  4BAY A;  1ZRF A;  2IRF G;  2UXN A;  1G3Y A;  4LB5 A;  5DCF A;  3LFK A;  2YSR A;  2ZBK A;  1UFM A;  4ENK A;  1A04 A;  2KRF A;  4WX9 A;  4UV9 A;  1XGO A;  2A5Y B;  5DD8 A;  1K7A A;  1XB4 A;  2JPC A;  2QZ8 A;  5L3E A;  1EV7 A;  3HOS A;  3RDI A;  1H9T A;  5FO5 A;  2JTV A;  1S8N A;  3F6O A;  4HV6 A;  2YX7 A;  4QLC U;  1SAX A;  3Q9S A;  2CYY A;  2EFP A;  2BYV E;  2GXB A;  1IRF A;  5HLG A;  3I58 A;  2FBH A;  1EH6 A;  5LRR A;  4XLP F;  2EFN A;  3GVA A;  1BN5 A;  1ZAR A;  1S7A A;  3KP3 A;  3HRU A;  3DFG A;  2GWR A;  2JZY A;  4HX7 A;  3WU1 B;  4ENN A;  1YIO A;  1F4K A;  5FFZ A;  2E1N A;  1KQ9 A;  1FYK A;  3KZY A;  5E17 F;  2D1H A;  3DP7 A;  2A6E F;  1YFH A;  2IPQ X;  4EM0 B;  3I64 A;  3HIF A;  3WE2 A;  5KVR A;  1KQ8 A;  3BWG A;  3TOA A;  2W84 A;  3C3W A;  4MNU A;  4P9F A;  2PMH A;  1ULY A;  3COA C;  2RGV A;  4R8H A;  2RKH A;  3R4K A;  1D3Y A;  2DTR A;  5D4R A;  4HLY A;  1BI0 A;  5LEK A;  1IN8 A;  2QWW A;  3GX4 X;  2RN7 A;  4WK8 F;  2V6C A;  4L9J A;  4G6D A;  4HAM A;  2ISZ A;  3BDD A;  2W25 A;  4AIH A;  2GXG A;  1TNT A;  2A69 F;  2RNJ A;  3E97 A;  1JXS A;  2G9W A;  3WTU C;  1FYM A;  4Y13 A;  3E3V A;  4Y15 A;  3EYI A;  4U88 A;  5LEJ A;  2H6B A;  3C1D A;  1BC8 C;  2DQR A;  1BC7 C;  4WWC A;  5A2Q K;  4ESB A;  4EGZ A;  4OIN F;  3V7C A;  5D8L B;  5ILV A;  1KU7 A;  4MEY F;  3KE2 A;  3HSR A;  4P55 A;  2XRO A;  4A2U A;  4Q5S F;  4N9I A;  2IT0 A;  5DCM B;  1DUX C;  2MH2 A;  3QPH A;  1ONV A;  2VT2 A;  5D6F A;  2F5D A;  4L5J A;  4MHG A;  4U0V A;  1ZAO A;  2Z9O A;  2ZNZ A;  1NHA A;  5LGN A;  4XRF A;  4IJA A;  1IUY A;  2DU9 A;  3I71 A;  3K1N A;  2J5O A;  3RKY A;  1XMK A;  2L4M A;  2VOO A;  1R36 A;  3F8M A;  1HKQ A;  1DPU A;  1W5T A;  5DUI A;  3CJN A;  2A07 F;  3ECH A;  1XCV A;  2FBK A;  2MC3 A;  1QQI A;  4KMU X;  2RDP A;  4GGG A;  5K1Y A;  4CDG A;  3F8C A;  3IWF A;  4D0P A;  5H6Q A;  3CLO A;  1REP C;  5FGM A;  3P9K A;  1XDU A;  4KN7 X;  4HF1 A;  1Q1H A;  4MTE A;  2LF7 A;  2XKP A;  1JHF A;  3QP5 A;  2IA1 A;  3BPV A;  4Q47 A;  1ZH5 A;  1ON2 A;  1IN7 A;  4HX4 A;  1BJA A;  3GFL A;  4I01 A;  4U0W A;  4O3M A;  3RPQ A;  2HEO A;  2ADU A;  1U3E M;  4MQ9 F;  5CVR A;  1IW7 F;  1QGP A;  3VOE A;  5ICE A;  4YG2 F;  1BM9 A;  5F64 A;  1MKM A;  2P8T A;  3HHH A;  3JW4 A;  3CUQ B;  2FMY A;  5J6X A;  5HDK A;  2A6H F;  2UZK A;  2AXL A;  2PBI A;  4BYY A;  2RQP A;  3TQN A;  1P2F A;  3QU6 A;  2L3D A;  1YO5 C;  1FWZ A;  2FML A;  1GXP A;  3GZ6 A;  4HYE A;  4LB6 B;  3D5L A;  1LB2 A;  2VBX A;  1ZHF A;  3WGG A;  4EM2 A;  1U5T A;  2F2E A;  2R7D A;  2ZME B;  4MGR A;  1RUN A;  3CO6 C;  4BXU A;  1UHM A;  3H3Z A;  3GEZ A;  1IAW A;  4G7Z F;  3F6V A;  2RC4 A;  5D8K B;  4LK1 F;  2M45 A;  2BBY A;  3M8F A;  2LKP A;  5J8C A;  3DXJ F;  2ZME C;  1O3S A;  1U78 A;  4NHJ A;  4KFC A;  1BI3 A;  2H6C A;  3GLX A;  3REO A;  1E2X A;  2DK8 A;  2EJR A;  3RYP A;  4KNY A;  3KFW X;  1FSH A;  2COM A;  3FXR A;  3K2Z A;  1SFX A;  5CYV A;  1HKT A;  4G9Y A;  2G7H A;  1W4M A;  6PAX A;  4A0Y A;  1HXD A;  3ABU A;  1R58 A;  1W5S A;  3EDP A;  3ZMU A;  1J9I A;  3J80 Z;  2FF4 A;  3ROU A;  2HZT A;  3F21 A;  3I59 A;  3DPT A;  1IN5 A;  4IVN A;  4QWQ A;  2VOD A;  5D5W B;  4RB1 A;  2PMU A;  3HRM A;  4XSX F;  3L7W A;  1ZRE A;  4RB2 C;  4WXH A;  5AIP A;  3O2P E;  4F7Z A;  1AOY A;  4ENJ A;  3B73 A;  2LSO A;  2IA2 A;  4ESF A;  4RGU A;  5CVV A;  3J81 K;  2OU2 A;  4FX4 A;  4I98 B;  3HYI A;  2WTE A;  3CDH A;  3E6C C;  3U2R A;  4HZF A;  3WTZ A;  4GYG A;  3RKX A;  3CUQ C;  2FBI A;  4HBL A;  1ZRD A;  3GFI A;  3IKT A;  3DPL C;  1HW5 A;  2YR2 A;  4S05 A;  2VXZ A;  2VC0 A;  5HLI A;  3HUG A;  4PCQ A;  1J5Y A;  2OD5 A;  4L9V A;  5D5X B;  3ELK A;  3EET A;  1ZLJ A;  3SZP A;  4AVP A;  3V7R A;  3ZMD A;  2UWM A;  2HR3 A;  3ZQ7 A;  3I54 A;  3SZT A;  2QUF A;  1KGS A;  3F22 A;  2HFH A;  1IF1 A;  1ON1 A;  5DEQ A;  2ACJ A;  4YFN F;  3J7A O;  4IPA A;  2D2W A;  4RAY A;  1MDM A;  1PDN C;  1LQ1 A;  2E7W A;  1ZLK A;  2XAQ A;  1KYZ A;  1I1G A;  4HLX A;  2HQR A;  3LQQ A;  4IRI A;  2FOK A;  1FC3 A;  1CGP A;  1J2X A;  3T0Y A;  2L02 A;  1HQC A;  1G3S A;  2ISY A;  1VTN C;  4EJU A;  5HS8 A;  4EMS A;  2ZO4 A;  1P4X A;  4ENM A;  2DT5 A;  1J0R A;  3IKV A;  3C18 A;  2DK5 A;  5LRS A;  1Z6R A;  1DDN A;  1YG2 A;  4RGX A;  3U9G A;  4XBF A;  2CSO A;  4KMF A;  5LBQ A;  2HTS A;  3JTH A;  2HDC A;  2M87 A;  3L9F A;  3HRT A;  2YX4 A;  4U0Y A;  3TDZ C;  5JHU A;  1YTY A;  1XD7 A;  4UXN A;  2ESH A;  2VBZ A;  3KP7 A;  3ML6 A;  4A5N A;  1ZG3 A;  2VT3 A;  1FY7 A;  2VE8 A;  1MD0 A;  1G3T A;  2QYO A;  1FLI A;  5E18 F;  4L18 B;  3B02 A;  1OYY A;  2XUB A;  2LDU A;  1RZ4 A;  1YS6 A;  1FYL A;  2K4B A;  1T39 A;  2GA2 A;  1G6N A;  5HS9 A;  1B4A A;  2ZCW A;  1C0W A;  1Z9C A;  2M30 A;  2YPR A;  3RIR A;  2W57 A;  4CO8 A;  2Q2E A;  2NNY A;  1HBX G;  3WTX C;  5L3G A;  5L3C A;  1TBX A;  3C7J A;  3WOD F;  5FD6 A;  2IVM A;  5HLH A;  3MFK A;  2PN6 A;  4AWX B;  1KU3 A;  5BPI A;  4DQ2 A;  2XAF A;  4HF2 A;  4YFX F;  3WG9 A;  3F23 A;  3SQN A;  3OOP A;  2MLK A;  3HSE A;  5DYM A;  2YU3 A;  3F8B A;  1LNW A;  3FM3 A;  3DKW A;  1RI7 A;  2WV0 A;  4BNC A;  3MWM A;  3KCC A;  3F8F A;  4LD5 A;  1ZG5 A;  3R60 A;  4ON0 A;  1GVJ A;  1Z05 A;  3LA7 A;  5LHH A;  3K1M A;  2RVC A;  4HA8 A;  2M1B A;  1B1B A;  1IZ1 A;  3M9A A;  1LDD A;  2A3S A;  5TJJ A;  1STZ A;  1UST A;  3V7S A;  4ETS A;  4G6Q A;  1R1T A;  4AIK A;  4KIF A;  2DQL A;  2MLG A;  1MJB A;  4U7D A;  4A12 A;  1O3T A;  4LLN A;  2O3F A;  5BQT A;  1TNS A;  2L4A A;  1SD6 A;  4GYI A;  1ZG1 A;  2NRA C;  3CTA A;  3E6D A;  2Z3Y A;  4M9Z A;  5L3B A;  2QQ9 A;  3WTV C;  1K78 A;  3JSO A;  4WCG A;  3GUD A;  2O8X A;  1R5H A;  2QM3 A;  2KIF A;  4H0E A;  2C6Y A;  1T38 A;  5D5U B;  3LAP A;  1LDJ A;  1OR7 A;  1MDM B;  1B6A A;  3HRS A;  4PZJ A;  3E5U A;  2JPB A;  4I02 A;  2FXA A;  2NAZ A;  3GF2 A;  1HST A;  5LHI A;  4OIQ F;  2P7V B;  4BHP A;  3R61 A;  2K4J A;  2Y75 A;  2NS0 A;  2ZFW A;  3JAM K;  2K86 A;  1UHW A;  1B59 A;  5E1Z B;  1O7L A;  1ZGJ A;  1GXQ A;  3BJO A;  1BIB A;  5CVI A;  3KP2 A;  5LHG A;  4OMZ A;  5FB2 A;  4BQA A;  3G73 A;  2V1U A;  1QZZ A;  3I5U A;  2ZXJ A;  4UVC A;  1IXC A;  2PFB A;  4N9H A;  1U5T C;  1QO0 D;  3CO7 C;  4I2O A;  2DI3 A;  4S04 A;  1X3U A;  5JVT A;  1FBU A;  3CUO A;  5K5Q A;  4IF4 A;  1IRG A;  3QU3 A;  3MQ0 A;  2ESN A;  4IRG A;  5ILU A;  5TRD A;  1Z91 A;  3T5X A;  2HKX A;  2TDX A;  5L3F A;  3IRQ A;  1XSX A;  3GFJ A;  3GYH X;  1PUE E;  5IT9 K;  3Q9V A;  2GZW A;  2LF8 A;  4RGS A;  3QP6 A;  4FX0 A;  2OZU A;  5K5R A;  4XLN F;  1ZN2 A;  1IXR C;  1YQA A;  2W85 A;  3DEU A;  1USS A;  4RB0 A;  4A6E A;  4HQM A;  5HDN A;  5HDG A;  4LG0 A;  2STW A;  1WKM A;  1XGS A;  2KIM A;  1G3W A;  1SD7 A;  2B0L A;  1PP8 F;  4WXD A;  1QBJ A;  5A2Q Z;  3FHZ A;  2OQR A;  2GAU A;  2DBB A;  1TW3 A;  4LLG F;  4ZH4 F;  3ERE D;  3LAJ A;  3GZ5 A;  4EJW A;  2ZNY A;  2H09 A;  2OBP A;  3EYY A;  3VB2 A;  4BHC A;  1EH8 A;  4CHU A;  1LJ9 A;  4L9T A;  5CLS A;  3FXU A;  3IL2 A;  3ZMS A;  1TLH B;  2Z99 A;  1FBQ A;  1AWC A;  2PG4 A;  1OMI A;  2XVC A;  4NB5 A;  5DV5 A;  2DAO A;  4OIR F;  3T1B A;  3VFZ A;  1P4W A;  1KU2 A;  3FX3 A;  5H20 A;  3FF5 A;  4I09 A;  1R00 A;  4OMY A;  4IXA A;  4ZZD A;  5AON A;  4L0Z B;  3WTW C;  4P5O A;  2D45 A;  1BI1 A;  2VN2 A;  3VOD A;  5E8G A;  5L3D A;  4CZZ A;  1RUO A;  2DW4 A;  2NYX A;  3PFI A;  3W6K B;  3TDU C;  2ETH A;  2BGC A;  2CG4 A;  2XRN A;  1R1U A;  4A5M A;  4BH9 A;  3G3Z A;  5F6F A;  3MCZ A;  3SFZ A;  4UNO A;  1XDS A;  5LGU A;  3DV8 A;  3ZMZ A;  1CF7 A;  1HW1 A;  3KP4 A;  3OV8 A;  5ICG A;  2MBF A;  1LEA A;  2MA3 A;  1U2W A;  1PP7 U;  4P96 A;  3BJA A;  3S2W A;  4M72 A;  2K27 A;  4EJV A;  3H3U A;  4EJO A;  2DPD A;  3BY6 A;  4KIC A;  2AS5 F;  2QVO A;  2STT A;  4HV5 A;  4M6X A;  3EQL F;  4KIG A;  3TO9 A;  2EFQ A;  5E1X A;  4I0A A;  2HS5 A;  2VOP A;  2CO5 A;  4OU0 A;  1BOA A;  1Z1D A;  2IA0 A;  2Y48 A;  1XSD A;  3K0L A;  1T2K A;  5ICF A;  3FZV A;  3LWF A;  2GA1 A;  1L0O C;  2JRT A;  2JT1 A;  2HGC A;  1Z6T A;  2O6G E;  1IN4 A;  2QLZ A;  4LG0 B;  1UB9 A;  4JQF A;  2XAG A;  3JAM Z;  2ZKZ A;  3WGI A;  1P4A A;  3T8R A;  4MEX F;  2P6T A;  1OYI A;  2IW5 A;  2V9V A;  3PQK A;  2PJP A;  4M74 A;  1JHH A;  2K02 A;  5DUK A;  3MEX A;  2FNA A;  5CJ9 A;  1KYW A;  1TW2 A;  2BEO A;  1YW9 A;  1Y0U A;  2OZ6 A;  3WU0 A;  4L5I A;  3KET A;  1IN6 A;  1FP1 D;  4CIC A;  2CWE A;  5ICC A;  1FX7 A;  3W6J B;  5LLQ A;  1S6L A;  3KLN A;  3FMQ A;  5D4S A;  3ZN0 A;  3E6M A;  4HF0 A;  4PGH A;  2KKO A;  2WC2 A;  4M6Y A;  4G7H F;  2EV0 A;  2F5C A;  2XHK A;  2XV4 S;  2HTJ A;  2MH9 A;  1O57 A;  4O6J A;  2DFI A;  5FD5 A;  4GXO A;  4LMY A;  1QNT A;  2FRH A;  2XAH A;  3ZMT A;  2P5L C;  1OPC A;  3KZZ A;  1TQM A;  2D1V A;  5D6E A;  2P7C B;  1RNL A;  3R6S A;  4B09 A;  2XIG A;  2Z33 A;  1J59 A;  3FM5 A;  2E7X A;  3WGH A;  2DLL A;  3FXQ A;  1E17 A;  3R0A A;  3HOT A;  2FEZ A;  1TTY A;  2XAJ A;  4HX8 A;  2QEN A;  1FZP B;  3N4M A;  5DDG A;  1XCB A;  3FWE A;  4KT5 C;  4R1H A;  5DD4 A;  1TQI A;  2EA4 A;  4CGZ A;  3R0J A;  4HDV A;  2X4H A;  2ZJ2 A;  3V8K A;  1K79 A;  4EVI A;  3RI4 A;  2OAZ A;  3TO6 A;  3BZ6 A;  4EV0 A;  1W7P D;  4NQW A;  2VON A;  2F5E A;  4R79 A;  4UUV A;  2Z5U A;  4EGY A;  3WTY C;  4Q48 A;  2Q8K A;  4KA4 A;  3MAJ A;  2IP2 A;  3F8N A;  1J75 A;  1R22 A;  5F1R A;  5CVJ A;  4MQV A;  1XGN A;  4UHT A;  1V4R A;  2JSC A;  1F9N A;  3I59 B;  2KJB A;  2H27 A;  3P9I A;  5EEH A;  1FBS A;  2XAS A;  5BOX A;  4YFK F;  1HKS A;  3CUQ A;  3M7G A;  5HOO A;  4ZYE A;  3N97 A;  1H0M A;  3PQJ A;  4WXC A;  5FLX K;  2L54 A;  1XN7 A;  5EEG A;  1SFU A;  4E70 A;  5HS7 A;  2FU4 A;  4CXF A;  4L0Y B;  1QPM A;  3ZPL A;  2A68 F;  3V8J A;  1BIA A;  5H6R A;  3HTS B;  2XKO A;  2P4W A;  3BP8 A;  2V1D A;  3E6B A;  3NRV A;  3P9C A;  3KP5 A;  2QQA A;  3I4P A;  3LA3 A;  2LNB A;  2K7L A;  3JTG A;  2EK5 A;  4G8X A;  2PI0 A;  2J5P A;  4A0Z A;  3TGN A;  3E5X A;  3D0S A;  1ZRC A;  4ZYG A;  1I1S A;  2EFW A;  4LGW A;  5BPD A;  5K5O A;  4M9S A;  3IRR A;  3FMS A;  1S3J A;  4Z2Y A;  3QRF F;  1K78 B;  2GQQ A;  5BS6 A;  2FQ3 A;  1YLF A;  1B9N A;  3BOQ A;  3RJP A;  3T8T A;  3KEO A;  1YYV A;  2M5W A;  1XMA A;  5HVQ C;  2VBY A;  4YII A;  1HSJ A;  1S7O A;  2QBY B;  3NQO A;  4M71 A;  5D5V B;  4I0B A;  3KEQ A;  4JBA A;  1SD4 A;  4FHT A;  5JI6 A;  1R7J A;  3Q5F A;  1BI2 A;  4YIF A;  2O03 A;  3QAH A;  1ZGA A;  2A61 A;  2QBY A;  2V1X A;  4M9X A;  3MZH A;  3IHU A;  4LLL A;  1U6G A;  4KUM A;  1LDK B;  1SFE A;  4MTD A;  1YS7 A;  3O6B B;  2HQN A;  4XSZ F;  1FOK A;  4L9N A;  4UVB A;  3HTU A;  3IC7 A;  2GIV A;  2PLY A;  2F5F A;  1U8R A;  3GW2 A;  3LQR A;  3ZN1 A;  2FSW A;  3SXY A;  1R23 A;  1YW8 A;  1P92 A;  5CVU A;  4JK1 X;  4ZZL A;  3TOB A;  1ODD A;  3K9T A;  2VE9 A;  4IHT A;  2NNN A;  2UXX A;  3O3K A;  5IT9 Z;  1GHC A;  2P5V A;  1MJA A;  3KP6 A;  3QOP A;  4RB3 C;  1LEB A;  3GO5 A;  2HYF A;  2EWN A;  2G7U A;  4I7H A;  1V3F A;  3H92 A;  3ECO A;  1H9G A;  4RGR A;  1I5Z A;  2FNP A;  3TKY A;  4K2E A;  3GWZ A;  3K1P A;  4HOB A;  5DCM A;  2CQK A;  3L00 A;  3E5Q A;  2CW0 F;  5E1W A;  3J80 K;  5FLX Z;  1KA8 A;  4KIB A;  3ZP5 A;  5AIQ A;  3F72 A;  3BJ6 A;  3L2C A;  1TQP A;  4ASN A;  2E1C A;  4ZYH A;  4OIP F;  3DQV C;  2XGX A;  1I6X A;  4LFU A;  4G94 A;  2QQB A;  1JE8 A;  1D8K A;  1S29 A;  4EM1 A;  2IJL A;  5FFX A;  3I0T A;  3J81 Z;  4EQQ A;  5JR3 A;  2EV6 A;  5E20 A;  5E8I A;  2FA5 A;  2KIU A;  1D5V A;  1WSU A;  4ESJ A;  1RIO H;  2EA2 A;  1T98 A;  2H94 A;  2MD5 A;  4FT8 A;  3M8E A;  4IRH A;  1W7P B;  4BHB A;  1FP2 A;  5KK1 A;  5IT3 A;  3KLO A;  1W7P A;  4M73 A;  4HQE A;  4LK0 F;  3P7N A;  3NEU A;  3LST A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...