3V42A

Crystal structure of renal tumor suppressor protein, folliculin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
196
Chain Sequence
LPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAASLSKYEFVVTSGSPRVGPTILNKIEAALTNQNLSVDVVDQALVALKEEWMNKVKVLFKFTKVPKEDTQKLLSILGASEEDNVKLLKFWMTGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Folliculin
publication title Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 70
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16692 Folliculin_C Folliculin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3v42A02
3.40.50.12430 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v42A01
3V42A
chains in the Genus database with same CATH superfamily
4I1RA 1UFOA 1WZ2A 2N3ZA 4I6JA 3WRVA 2HK8A 4MV1A 1SUFA 2ZUVA 2LRDA 3HP7A 4TRJA 3FBIB 1W1IA 1TFRA 1Y1LA 3GOHA 2HMAA 4YUZA 1XVAA 3USCS 3KBOA 2EH3A 2UUOA 3MJ4A 2BTQA 3N97A 5M5WJ 3TW6A 2V59A 3WMGA 1IVSA 2NTYC 2ZS9A 2O7NA 4FFDA 2P30A 1L5LA 2Z3YA 3BTCA 3BL5A 3D3KA 4ZO4A 4C2TA 4NIMA 5K0ZA 1CC1S 1K8XB 3QE3A 4HFRA 3RDPA 3TN7A 3E3MA 2JK0A 3KZIC 1WJ5A 1X1BA 5JPIA 5BN5B 4ENTA 4ZANA 4OFWA 1PJSA 2JIBA 2LIPA 1VXOA 5CU7A 2PWBA 4RE5A 4A6XA 1ZK3A 1C3OA 1NNEA 1AGNA 1NU6A 1BJZA 1LJUA 1VC2A 2PVCA 1TUIA 1RJWA 3WGHA 2KBEA 4DV3B 2BGUA 3V3KA 2A1IA 2XPCA 4GECA 5DCMA 3AX6A 1R0RE 2ZLBA 5HEKA 1UP6A 4D9KA 1RC0A 3A9WA 1XAIA 1VFCA 4EB6B 4GX5A 1LFAA 4NCBA 3IDQA 4H60A 4A03A 2Q2OA 3OYMA 5DLEA 3BM5A 4NECA 4A5OA 3ISPA 3DTIA 2B4RO 4XKJA 3PD0A 4K6CA 4OK6A 2BFFA 1KSGA 1IZ1A 2HHHB 2JHFA 3B9PA 3JWEA 2QEQA 4MYSA 1RFGE 1MA0A 2GBGA 2VHEA 3MIZA 1N2ZA 5KMGB 4QGFA 4N8SA 1W6RA 4F4JA 3QX9A 1G38A 1E9DA 3ANMA 1XJWA 2VJAA 4RCVA 4X20B 1SR8A 4LRWA 5ALMA 1IHDA 1RQGA 1T91A 1QH9A 5FX2A 3H9CA 2ZAOA 3U4DA 3QYAA 3SOZA 2REQB 3CJQB 4B6QA 3WNCA 1YRLA 3F7TA 3RWBA 1YQEA 4OJYA 1Y7TA 1U11A 1KSFX 4QJBA 2RKOA 1F1JA 3ONVA 1XLVA 2ORWA 2HGCA 1K86A 1PG2A 1R0XA 3N2EA 4KDEA 4E7PA 2ELKA 1FDVA 3WL7A 3C97A 3D6MA 2Z1MA 3SM3A 1DUXC 5EWJB 4I6EA 3PNSA 2KIUA 2NIPA 2G72A 3HXOA 3S1MJ 2A57A 1J9EA 5LP6B 1KZGB 3VSKA 2NTEA 3OURA 3VB2A 2AEMA 4RPIA 4B9EA 1R8YA 2VP4A 4XI9A 3TEJA 4G4SO 3EH2A 1JQKA 1N6OA 2W4MA 2UUZA 2JVKA 2LDUA 5BYJA 4V38A 1YJ5A 2XZTA 3K7EA 3RTGA 4FYVA 3ULKA 2BW0A 3HCDA 2CZQA 3L05A 2NU8B 2PKCA 1CY4A 1BMQA 2G88A 4RIFA 1ETHA 3O92A 1JTYA 3JQGB 4UDYX 1DT5A 1FCJA 4L1KA 1M73E 2DBVO 3N8DA 1MJ5A 1U2GC 1QJCA 3QNUA 2IF2A 2A69F 1R4NB 3Q7IA 4GYYA 4HF7A 3OPNA 4CA0A 4Q4JB 5KZMB 1WHTA 1QV6A 5C31A 4O2AF 2O2SA 2HNBA 4JASB 1QRRA 3MS7A 2WU0A 4MZXA 3F8CA 1MTOA 2Q7XA 4F11A 3F2IA 4DOZA 4OTZA 4P5DA 3LCCA 1BI3A 4A9AA 1USVA 3B38A 5H9VA 3IESA 2ZU6A 1QAMA 4RVNA 2HR3A 1OV6A 1QFJA 4PPYA 5C0OE 3LLVA 3ST7A 5AVVA 4BOYA 3ZY4A 3GBPA 3WNBA 3NAQA 1BR1A 1CZRA 2XDWA 2XX3A 1HFKA 2OC4A 3IUNA 4ZD6A 4ESFA 1TP4A 1DOZA 3HOTA 2ZXEA 1KMCA 1Y7IA 2PH5A 4Q9HA 2R7UA 2VP9A 4KYVA 5BVGB 3W3CA 1FS4A 4PHCA 3D6HA 1SD6A 2C88A 1EGHA 1RI2A 3U7IA 4IJ6A 3E7FA 5I7SA 3ELWA 2G0AA 2FH5B 3QWBA 3K1YA 1AUXA 4NZ9A 5JW6A 4MP6A 1XCPA 5LLDA 5EJ8A 5TJHA 1JKMA 2WUGA 4OFBA 3UJ9A 3QXXA 2JVGA 3ENWA 1C0WA 1WJEA 3OTGA 2F4IA 1VKNA 3DMRA 4GIBA 1XTTA 4EENA 2VWPA 2JLBA 3C3JA 3FI0A 2C0PA 4Z7JA 5CX1A 3ZCUA 1RQLA 1J5XA 2R60A 5GADJ 2DFDA 3L0DA 2JDIA 3OM0A 4O2BA 3PC8C 2C00A 2CW5A 1Q2XA 1IWOA 3HV0A 2ZI9A 1FWZA 2V6FA 4C01A 3K8ZA 3U2QA 1Z0XA 1HR0B 3MCVA 2ONKA 4IGIA 3NO4A 2F4NA 4FFNA 4WBNA 2NRAC 2VK1A 1XZHA 4CLRA 4UFNA 5DGCA 3WGLA 4FMDB 3DTVA 3THOA 1TVKB 4MPPA 4FINA 2O5EA 3OM9A 4AI6A 2Q62A 4YPVA 1TZJA 3ONQA 5HJEA 1MQ9A 4BVLA 1KDTA 2Q0HA 4CT4B 3HDYA 2R9VA 4KO4S 1PO7A 3DBVO 1G3WA 2BEUB 4NCXA 3VKUA 1GUFA 5I4IA 1O96B 1I4DD 3AW8A 1O9BA 4HDOB 3QQ5A 1YHNA 4D9GA 1ZNQO 4EMBA 2C96A 1REPC 2BFPA 1PT7A 2H5JA 3NOXA 5EWLA 2J9XB 1L5ZA 1HL3A 2Q3JA 1U1GA 4PJNA 1YACA 1Z7UA 3T52A 3ZMVA 5L3CA 3MMPA 5J43A 3N9IA 2FLVA 4DA8A 2H0RA 1VL8A 3EA4A 1OGJA 3ZWWA 2X1DA 4YH1A 1JIXA 3EBLA 3ZDBA 1HMYA 4I4TB 3HTSB 1UBFA 3W6ZA 4AP9A 5FBHA 4KQHA 4NE7A 3TF5A 1HNNA 1UMQA 1TYEB 2PZAA 1D1PA 5EFOA 1KA8A 3ODGA 4YCDA 5JSZA 1XCBA 1QNTA 3U1VA 5JECA 1GTL1 2QB5A 1IUKA 2VEDA 2H5LA 5CCXA 2BR5A 3IO5A 1IXCA 4MULA 1UPFA 4IHWA 4WBXC 3KZCA 5TPZA 1H8AC 2L02A 3TQQA 3UMFA 3C5WP 2QR3A 5EXDA 1XRJA 3VPXA 5HKLA 5FOQA 2IJGX 3T7CA 4DZTA 3CZ6A 2YICA 4R3WA 3GIDA 3H1TA 3DTNA 4IWXA 3MGGA 4XYLA 3B1WA 1VDMA 4EI8A 1YS4A 2H2HA 2RGNC 4FMBB 4PHFA 3VH1A 1OROA 3O8DA 3U62A 5LEJA 3CCBA 1R9MA 2HWWA 3CNHA 3HOVJ 4M9XA 1NUAA 1UBMS 1NJ5A 2YC4C 4LA4A 3MWMA 2HWVA 4MYCA 3QFCA 1J0DA 3V8KA 4XNFA 2DKFA 4BPBA 2AKEA 1RKTA 3I2YX 3DFIA 1X1CA 4JL8A 3U7QB 4UXJA 3L92A 4BATA 5E3OA 3CVUA 2MJLA 2HAEA 1JHHA 4B0PA 3I58A 2GT1A 3A8TA 3L8YA 2YJ6A 4GPTA 2I2CA 3C6QA 3CMMA 2BZ1A 1GG5A 4UULA 5JRZA 3L0PA 1M6YA 1YB2A 4F92B 5JCJA 3GUYA 1DCFA 4QODA 1YA4A 2XE6A 3DEKA 2OLJA 2FMXA 1GP2A 1SQ6A 2XVCA 2XRLA 1MKMA 4M54A 9LDBA 2R93J 1YVEI 2K4BA 2DG2A 4MDYA 2VJLA 4DIKA 1X7XB 4FGLA 2UXBB 3Q7RA 3AU8A 4B2YA 4DQ2A 2Q9BA 1QK3A 4HV4A 3AFNA 2JPDA 1I7PA 2JGFA 3PQ5A 5DP1A 5AIQA 3OQIB 3V1YA 1I3NA 2MYUA 4W63A 1T1EA 4TS4A 3V6MA 1CKEA 1VQ7I 1TO2E 5C5IA 4TKLA 1P3DA 4EJWA 1MENA 5IK2A 4DARA 5C37A 3CCVI 4R1SA 5T8KA 4CKYA 1C29B 3WAJA 3BZKA 2P35A 2DYKA 1Z08A 2FXAA 3Q3SA 4L27A 4H7DA 3A1UA 2QZ4A 3H19A 1RCTE 4EGJA 3RYCA 2RREA 1FOYA 1IC8A 5LLTA 2YH2A 1A4IA 1UWKA 1ZZEA 1FK8A 4CCOA 4RK6A 1PT8A 1F7VA 4TS3A 2QD1A 3II6X 5ILGA 2V7XA 3KTFA 2C20A 3H99A 4KDPA 3DE3X 1X7WA 1P2UA 4OHWA 2AN9A 3UGJA 2FUKA 3ZKWB 4AS1A 5A2GA 5GVSA 3AETA 2GTIA 3QOPA 1NWHA 3JYNA 4EY6A 4MUAA 2KKOA 3HJCA 1YRNA 1YDMA 1QFMA 3I4NJ 3WTZA 1T4CA 4I98B 1IUOA 2CJPA 3ZE2B 4UD6A 3TSZA 2QM3A 4AKHA 5HG0A 2QVOA 1N6PA 2QRPA 2WJ6A 1D4AA 2G06A 2DUUA 3KKQA 1PNQA 3WHCA 5HA5A 2ISCA 4BJ3A 3G0CA 3R8CA 4I3HA 1FRVA 5T57A 4YPOA 3GLTA 4L50A 1IDYA 1I3AA 3JSAA 5BW6B 4MR8A 1VJ1A 5HUJA 1E1QD 1XV5A 3QA3E 5FI1B 1OV4A 4N5LA 2E1MB 3GVAA 2YIJA 1PSZA 3ZWQA 1SKYE 4LF5B 3CMCO 3BWEA 3PTZA 1YRAA 3IEIA 1IEWA 1YQXA 2VJCA 3ADCA 3OX2A 5AO9A 3IBCA 2VWQA 5G0SA 4TGLA 4JOMA 3DTTA 1L3BA 3QUQA 3HZOA 4IGKA 1F7UA 4DSOA 4BMVA 4N0PA 2FMLA 4EKDA 4CM6A 3NEUA 1QZUA 1LH0A 1E59A 2JARA 3WNZA 2O8EA 2C5HA 4ETNA 3AESB 2H7CA 5C8DA 2YU9J 3IAAA 1CUHA 4G0XA 2HK7A 3V8JA 1Z91A 4P92A 1WMFA 3M81A 3L9FA 1BFKA 3QUSA 4I46A 3W3AD 2JFWA 2ON6A 2GPYA 4R3UC 1B2RA 4BBPA 1PG0A 4XLTA 2NZ8A 3FTQA 5T3UA 1P4JA 2EARA 2AOTA 3AF6A 2KLOA 1D2GA 1WJFA 4BVEA 5LL6P 1ZD3A 2FAXA 2PD3A 1MJAA 3ECOA 3GUDA 3GJ3A 5I4KA 2VHCA 4FC6A 2H18A 1LU9A 1LI7A 3PKJA 4BBSJ 4ARUA 4WQMA 2FV8A 3M70A 4XJXA 3ASZA 2PGNA 3N0TA 5EXPA 3PNYA 2FOXA 1GRVA 3MW8A 4UPEA 3RYRA 4KDRA 2ZUBA 5LKAA 4CEHA 5CM8B 2R6DA 3L7DA 1P29A 1C2YA 4RD6A 4LNUA 1OLTA 1GDDA 1IUNA 3ZWCA 1NDHA 3TAHA 1ODFA 2IHZA 2RGVA 5EIFA 1N9ZA 2B8JA 4EX7A 2GCIA 1YS6A 3HXQA 3FNHA 4J4BA 1PV2A 4PAOA 2QL6A 2XYRA 4MNUA 4NDAA 2FQ4A 2X19A 3LSKA 2VLAA 2ZRJA 4JKIA 3B60A 5JNLA 4G8JA 1GNQA 3AF1A 3TB4A 1E2LA 1NF2A 2NUAA 1AB6A 5B2FA 1YB6A 1ZARA 2LD5A 2VAPA 2ZUDA 1XZEA 2ID8A 4LV6A 2AWOA 1VQKI 4US1R 1XMJA 3ZXXA 3A28A 4YAJA 3C7CB 4DBZA 2AJ8A 3JQDA 4YASA 2QP3A 5KPJA 4X66B 3DB1A 2Q5OA 2EKZA 2D1FA 5KTNA 2NOJB 3N2GB 1W5CC 3TR0A 3WO1A 1RPZA 1U7DA 2HGZA 3FPAA 1DRKA 1PJQA 4RV9A 3WIBA 4XM1A 2PMDA 3AYXB 4ZQBA 3RT7A 2NQ2C 3IUYA 1E7QA 4D7NA 4XR6A 2ZNZA 1YTLA 2DWPA 3BHJA 4M1ZA 2QSHX 4IRMA 5AMXA 1NVTA 4P7BA 4LMAA 2IOFA 3IUMA 2V3WA 2ZT8A 3KYDA 2P3LA 4FDVA 3L8ZA 3TW7A 4ER6A 1VPLA 4Y0VA 3BG7A 1R0BA 5J5VA 2I5PO 4DBLE 2QPOA 1PWHA 2JS7A 4TSFA 3ETGA 4GI2A 1ULHA 2FE1A 4C7JA 4E6EA 3I62A 4KXXA 2P65A 5D3QA 4Q39A 2C5FA 2C42A 3FKJA 1PUXA 2BBSA 3QU7A 2C3OA 2OFXA 3VZQA 3OP4A 1D3YA 4DR2B 3W6PA 2ZBDA 5HP4A 3WE7A 4DIOA 2DPYA 2O06A 3A3YA 3CUWA 5LYJF 1Q1NA 4BWFB 3VR3D 3JAMK 1T6YA 3ZTWA 1XTJA 3K1ZA 2O0YA 4MAAA 2H6EA 2ROQA 2WAEA 5FA8A 3V4GA 1IL0A 4G0WA 5TQ2B 4TTVA 3JR7A 3CC4I 1X38A 4Q24A 5ILQA 1P73A 2FA9A 3RS0A 5IDXA 3ICPA 1XWWA 4G7OF 5KOJB 1LBQA 3M7GA 4MTLA 4ZOCA 2EZ8A 1DELA 1AX9A 3NNSA 3OAAA 5JANA 4PC6A 3F8WA 2H29A 1F8XA 3IOMA 5DB4A 5CX4A 4Q9IA 3CR3C 5G1NA 3ZBQA 1C3EA 3NV7A 3B3GA 2XVXA 2ZAGA 4F60A 2YXEA 4ENNA 5BNIA 5FTWA 2J6IA 5EE3A 5ADHA 1A9XA 3E5UA 4NPHA 1OILA 2ATCA 1V11B 3OSFA 3O1HB 5DDIP 4Y1EA 3BTOA 1OCRH 1JBEA 3SP1A 4LITA 4WZAA 2X9NA 3TVYA 5GQSA 3RRFA 3SY8A 4ZCQA 1L1FA 2VUIB 3R0VA 4C7OB 3I9LA 5J1SB 1Z4JA 3PHBE 1SC1A 1XJ0A 2F8SA 1ZD9A 2EAUA 1RKXA 1ZMTA 3IC7A 2G83A 3NEAA 1SUPA 2Q1XA 3E3LA 3WTVC 3P26A 1M2WA 3F3YA 1N33B 2R8ZA 4DXDA 4IIUA 2XKBA 2WWTA 2PWPA 3ZE9A 3V1LA 3ETNA 3GJ0A 1U7XA 3LQ1A 1ZVQA 3AERA 3O2NA 3RANA 1MDBA 2PG4A 1V2GA 3PHLA 4DFDA 2VDJA 3ECAA 4NH0A 5K20A 2OORC 4OA8A 3C3DA 2F00A 2WWHA 4RXTA 5BNTA 2WF6A 4DQDA 2X4HA 1AKRA 2OCXA 4XUEA 1H8HD 1Q0LA 3AI1A 3RGWS 4FNAA 3CLSC 3DA8A 3PT9A 4MVJP 2JZNA 3QLTA 1LZLA 1LDEA 3BXEA 3FHTA 3DV0B 3QJYA 4MROA 3IBYA 1EFDN 5EXTA 4V24A 3TTVA 1T0HB 2L0XA 4RTQA 5IMBA 5JSUA 2CFXA 2B1GA 2HCTA 2HOSA 4HFNA 2VHQA 4Q9AA 4BNNA 3LVFO 1P4AA 1GUAA 3FCAA 5FAXA 1I4WA 2JKYA 3CRZA 3LFKA 2H07A 2RVCA 1E2PA 3CJTA 1G8HA 2WG0A 4JJFA 3M4YA 1N7GA 4GPD1 3S2FA 4RS8A 5KEIA 3C5EA 5E0OA 1HT0A 3WTCA 1GSOA 3ZQJA 4YRCA 3GRVA 4Y6OA 4G1MB 4QYMA 5JBNA 3OS1A 2HK6A 2R7MA 5HJ5A 1Y6ZA 2BVLA 3PZBA 4OB7A 3T5GA 2QN6A 2FFHA 4RTOA 4CCMA 5TRTA 2FX2A 3T0IA 3SJMA 4BYMA 2Q2QA 4MWEA 3AGPA 3IPCA 4C21A 3I2FA 2IK8A 2HBZA 3IQXA 5D6FA 1DSSG 1MJBA 4WESB 5KTYA 1DKMA 3B13B 2K5CA 4NDNE 1RC8A 1TRHA 1USGA 4OQQA 3UJCA 3VNBA 5IBRA 4EAAA 4K87A 2P4UA 3KYJB 1G9SA 4KUMA 2JLRA 3AUJB 1XC7A 1NM5A 4MWSA 1EH7A 1CUBA 1UFRA 2FBHA 5FD5A 3LQKA 5FL7A 1SA0A 5AP9A 3BMNB 2RI0A 2ZRFA 2FU4A 5M3BA 2OECA 4NESA 3ZGXA 2TSYB 3FYTA 3NC1C 3E22B 2O9LA 1WEKA 2R1TB 4Y9DA 1J0AA 4JGGA 3HWRA 2NO7A 4I9UA 4D45A 2JGNA 4QG7A 2BFAA 4P7GA 5AT1A 2EZUA 3R5TA 3DVRX 3QPUA 2QYOA 2GAFA 1EX7A 3KSMA 4Q4AB 4H3SA 1YQGA 1N6IA 1CJCA 1IHYA 3KHTA 4FHTA 3THWB 1QFYA 3W9UA 1QRTA 2HHLA 2P8JA 1DEOA 6REQA 4M6XA 3K0AB 4UBOA 4XJTA 2DOFA 2QI9C 1TTHA 3QVKA 2YDXA 2I0FA 4KYTA 3T38A 4R1LA 3Q98A 1N1MA 3R7DA 3U39A 4I19A 5D5VB 4DA9A 3BQYA 1UT5A 4N0MA 3WSVA 2B4AA 3S0JA 3HA2A 4RABA 4BACA 3UATA 4P0QB 2MCFA 2I2FA 3BS4A 3O95A 5U4XA 3VDMA 4ZVQA 4AY6A 2RKHA 2HI3A 1XZLA 5T4EA 3EE6A 4YJGB 3V33A 4L4XA 3AT1A 4H6VA 2D5AA 1GDTA 1HTBA 2XXBA 3ZPXA 1EUYA 1HKQA 5KTTA 2I7DA 4PHTA 5A62A 4L8LA 4Q9NA 1IQPA 3HB0A 3OUUA 5H3LA 4J2TA 1XMSA 5CVUA 1C81A 3AR9A 3T3DA 4OI1A 3E9YA 4NBSA 3H92A 5T7BA 3WNQA 3A4NA 3FOBA 1HOXA 4LEIA 1JG7A 3MTBA 4P86A 2POCA 2PZFA 3S7TA 2NVXJ 1XD2B 4BEJA 3LIIA 1PTJA 3OWOA 3OE1A 1ZIXA 1Z3YA 1KEWA 2P5LC 3A4VA 1IUPA 4H2DA 3EDCA 1SBHA 4LD5A 4C0KA 3NPAA 1JEQA 1N6KA 4QG3A 3Q3CA 2K3FA 2EKPA 3WQHA 4MVJE 3PVCA 2E7XA 1W5EA 3DE5X 1LQUA 2QSUA 3LQYA 4L4UA 4BVBA 2AK2A 3KQMA 4HEQA 1H23A 5AM5A 4GX2A 4ARVA 5HQTA 4C5CA 5K5RA 1HA8A 4ZI7F 5BV2P 4EI2A 4RELA 1N2OA 4LLGF 2J67A 2IT1A 1U0BB 3M0EA 4OHBA 4ZOLB 2HXGA 4TROA 2VRWA 3S93A 4IVPA 1H2YA 4PZ9A 4PLVA 2D1RA 1VMAA 1EB8A 2LR8A 1UT8A 5B6JA 2DX7A 4PZJA 2ECPA 1F5TA 4MJLA 1VB5A 3OIUA 4JJ4A 3EDPA 1A7JA 5A1JA 3PDJA 5HCUA 2QVZX 4BQOA 3DTKA 3GQBA 1AMNA 5LQJA 1SUSA 1Y1TA 2YVAA 1A8UA 1E64A 4N03A 1HNWB 1R6RA 3ECHA 1JTXA 5CYVA 3HR8A 2OCDA 1PVVA 2F64A 2RFLA 1VQ4I 4PZCA 1GILA 2HSWA 1Q1ZA 4DIQA 1NNLA 4U6QA 1OFTA 2H92A 3S2WA 3EEBA 3OZ7A 2IEYA 3KUKA 4LJKA 5KNCA 1X3UA 4PS1A 4BVGA 4NXMB 2D7JA 4JGIA 4YT2A 4FDTA 2X2PA 1ORIA 2WP8J 2HQSA 1JPVA 5IZCC 5BR8B 4LIPD 3QBTA 4Z53A 1XTQA 3HEAA 4IZIA 2GESA 4KN4X 2ZAMA 5DYNA 4TKMA 3HDHA 4GGMX 3L7JA 1Q44A 4ZIRA 2OF7A 1D5CA 2ZJ4A 3WLIA 4CJXA 4AMYA 1ETQA 2E5ZA 4OXQA 4TQGA 4KTVE 5HM6A 3NWSA 2PT6A 2IHVA 1G2QA 3ME5A 4F45A 3V8MA 1Q1EA 4WGFA 2YWGA 4NEGA 4G0NA 3MJEA 3I1IA 4O5VA 4HGQA 2G9VA 4FSXA 1P9QC 2OZLA 3F73A 3Q6IA 4CQMD 3SYTA 1IXKA 4DN6A 3ZQKA 2BFEA 3TO6A 5GPBA 2XYPA 2TMDA 4BTLA 2BWJA 2I76A 5CLFA 3VTAA 1IVYA 2OZUA 4H17A 4MWGA 4XICA 4QO7A 1QHHD 2PT7A 1E5VA 3UNGC 4OSEA 1T5BA 4XR4A 3KYBA 3TP3A 2O8CB 1EHCA 4UU8A 4Q47A 4XQCA 2D1QA 2FR0A 1T8RA 2UV8A 3GLFA 1EUQA 3BMQA 2VQFB 1RJFA 3FB4A 1VSVA 5IDYA 4G65A 3X1YA 4GWLA 3TX2A 3N70A 4KEAA 3DYIA 2JH3A 3BJOA 2Y1EA 2QRNA 4QTTB 3VJKA 2PZEA 2FPGA 4WW0A 2FMYA 1G5PA 3R20A 1Z8FA 2ZYDA 1ORDA 1JUPA 1C1YA 4EPYA 2JCGA 5J2UA 2IP4A 5DX0A 4FYPA 2Y9MB 3U1KA 3IJ5A 2YN2A 2XMBA 5AK4A 5IOZA 5DVZA 4PNHA 3GTLJ 3TW8A 2G4CA 2ID7A 1KNXA 2LK2A 4JJGA 3V4OA 4NYMR 4K2AA 1QPZA 4FE4A 3MVEA 1ZRMA 3PUVA 3LQFA 2FGKA 1NC1A 2XQKA 2IU6A 1KQPA 3CUKA 1PLJA 2VDPB 1LJ9A 1NLYA 4V0MA 4BP3A 2FPOA 3G5TA 2E4VA 1HE8B 3RTDA 2BM1A 4GEGA 2H1WA 2I4MA 3KP4A 3RK0A 5E7MA 2FCAA 4XD7A 1SKBA 4V1CA 4FZ5A 1E6UA 4UDNA 3I54A 1II9A 2J5PA 2PBRA 1NYQA 4KFTA 4OUKX 2EW1A 2VQ3A 2OFWA 4U02A 1KI7A 1ZOSA 3MG9A 1RYYA 1VYUA 3X2QH 3M89A 2VZ0A 4LNHA 4JD5A 1DJQA 1KKLA 3QNMA 3HXKA 3UB4A 2KB0A 3BXOA 1XT6A 1P6RA 3AJ8A 3QPCA 2A9QA 3E53A 3T4UA 1U28C 3W6UA 4B3DA 3G82C 4J0HA 4Q82A 3PQEA 2C8KA 4A16A 1RYEA 1QDUA 4DMKA 2QLMA 1AM4D 2BFMA 5BN1A 2LP0A 3VZSA 1HRDA 3LZDA 1T3TA 3OLZA 1QVRA 1NMQA 1QTNA 3D0SA 1W0UA 4YX9A 3WHLA 4IZOA 5IVPA 4YP9A 1GKYA 2Q4TA 1SIOA 1BI2A 3CDLA 1Q95A 4F4UA 4HSRA 5AI0A 1VF9A 3BB4A 1Z68A 2C6YA 3ZBUA 2BY0A 1L6IA 4AF6A 1N92A 3EEFA 2DFVA 3E05A 1NMYA 1WCYA 2X14A 4CODB 3C7AA 3PFWO 2QV7A 3NHJA 2PKYX 2BLLA 2ZCUA 1ZSVA 2AZMA 2BKVA 4V19K 1FYEA 3L6EA 3J7TA 3CCUI 1BQEA 4MS1B 3TGWA 3PEUA 3CX3A 3ORRA 2VK4A 4BUJA 2ZTHA 2Q6IA 1EEXB 2ZZNA 3J80A 2Z95A 2ZROA 1X1DA 1NK3P 5AVRA 1MJGM 4P33A 1FQKA 1ZKDA 1B8NA 3FDZA 2WYIA 5FUQA 1XLWA 3CGWA 1A71A 4Y1RA 1L0BA 4L6AA 1PUJA 4U7HA 3QEMB 2GSDA 1O7FA 2K4JA 4EEFG 3V7RA 1B8OA 2IUFA 1KU2A 3FM9A 5K7HA 3IVCA 2EW8A 1HSOA 4O4JB 1ESDA 4ZT6A 4TTTS 3RARA 3WGNA 1MB9A 4KXFB 4GP6A 5MHTA 4YP0A 3GAMA 2JIRA 1F1ZA 2EFQA 3ZKAA 5D2CA 5CK4A 2VBZA 2WAXA 1B72B 1Q0TA 4BNDB 1ISIA 1NA5A 5TC4A 3FXKA 5ALQA 2PJRA 2GO1A 3O2QB 3LT5A 1O03A 1OKKA 3F3XA 2Q0SA 5CCEA 1WMEA 2QKYA 5DGXA 3CNOA 1WD7A 3SS9X 1E1CB 1VIDA 4FN4A 2GOXB 1I01A 5HIAA 1U0SY 3W06A 1JVSA 2ZFWA 5L6MB 1V3QE 1E1LA 1QB7A 3IELA 2AFIB 3DV2A 2PRSA 5JEEA 2RD2A 2EYQA 2ZZKA 4URZR 1G8FA 4OAPA 3AUUA 1LVKA 3UHPA 4XEHA 2YX1A 1PJCA 5AKJA 3CA8A 3GN2A 4AU7A 3TPZA 3I5MA 1N7HA 2YVQA 1VFNA 3TSYA 2C58A 5CFQA 3AOEC 4M3DA 2FGJA 2ZJ3A 4CMIA 4LXUA 2HWKA 3TZ6A 4NCAA 1LZKA 3EIHA 2OGWA 1JR4A 1TL7C 4M89A 3W3AH 4DSNA 4D9EA 3L7WA 2KX7A 5HFAA 4GFBA 3LWDA 4A23A 3GMDA 1OPCA 3OFJA 4HUJA 2XYQA 1B59A 2PL9A 2IE0A 3H8SA 1FRQA 1ADGA 1MD0A 2B2NA 2J0EA 5E6RA 2IYOA 4BKOA 3PQJA 1N0VC 1DBQA 3F7MA 4FZVA 4CHGA 5AVZA 4HHEA 2OWDA 4W7HA 2Q8KA 1Z0FA 2NTJA 5H81A 1VGQA 5A71A 1UZUA 5DSXA 1ONSA 1V5EA 1P6QA 2IQ5A 4PHGA 1Y1WJ 1HLFA 3OOEA 4A93J 4G63A 3TTYA 5GJCA 1XTIA 3E9ZA 3KKZA 3T5MA 5TNXA 4UDXX 3Q7TA 3KQLA 4CM9A 5D87A 4PG8A 2GZSA 1YZVA 2JJ8A 3DMYA 4A0SA 1W5AA 5BPFA 1W0JA 1LFDB 4KXWA 4D6YA 2H2FA 2J7PD 1ZRHA 2X2OA 4FYMA 1G19A 2XASA 3T7SA 1B73A 5HKKA 1GPH1 5BT8A 5LWHA 3Q7PA 2DI3A 1DRUA 4PRLA 3AHCA 1YJ9I 5A6VA 2NADA 3COSA 1YO6A 2IGNA 3QWLA 3U1TA 4AJKA 3OIYA 4R51A 4HVAA 3G1MA 4Q9JA 2EB7A 2I1VB 4YT5A 1W1WE 2P8TA 5DX8A 3LW7A 3OZFA 3DLLF 3ZQQA 1ETUA 1BC7C 3ZEIA 4EYKA 3FG9A 3QXHA 3UPUA 4IF4A 3RW9A 1A9OA 2OUMA 2XLBA 2YFKA 2GZDA 4J00A 2RH4A 1X70A 4AG6A 3QYPA 2ZBGA 5KNBD 5FXMA 4ETIA 4XOIA 4NMXB 1AU9A 3QFSA 2YRFA 4X3PA 3LAJA 4CV0A 5FUYA 2FW7A 4CZ2A 4M8LA 5FEUA 3A1NA 5AW8A 4N5NA 4KIWA 2P3SA 4G5HA 4F4FA 4U7BA 3EMDA 4WTOA 4YUXA 4NONA 1W36C 1G63A 5JALA 3CZ4A 4QWMA 4K05A 1XKLA 2OILA 4KMUX 4FLMA 1PFKA 1ZJ5A 1L1EA 4U7DA 1I3LA 1BL0A 2CK3A 1OX4B 3WK6A 1KDYA 3V4FA 2BM9A 3WYDA 2X6XA 3KQTA 1BX0A 5ICCA 1X86B 4DDKA 4DLVA 5JTUA 2VNAA 1SM4A 4CF4A 3BX1A 4IWYA 1WXDA 5LMZA 4D0GA 4R40A 1DO8A 5IM5A 3SF8A 2X8JB 3H5TA 1EVKA 3S28A 5F98A 1ISJA 3K16A 1X6VA 5HS8A 1O94D 4P34A 3FPCA 4JR1A 2D2WA 3IUEA 4QYIA 5J1RA 1NYRA 3QYJA 1NX9A 1W96A 4N47A 3H87A 4KLZA 1XK6A 3ZCOA 5JH7F 4C7BA 2RHMA 2WAQA 3EARA 2AEFA 4YMWA 2JJMA 3A37A 3MFQA 4L0YB 5CVCA 3FKIJ 4Q7KA 4UVHA 4IF6A 5D8KB 4CN8A 3FX3A 2X0EA 3FF1A 3Q3HA 3U4QA 4OB6A 3AG6A 1EQAA 2GWHA 5CMLA 2JJ1A 4UE3S 1U2SA 1B3RA 2L9NA 3LY9A 4RESA 2AJBA 2YWDA 2ZIXA 1FFWA 2YQ4A 4RB3C 1ZDMA 3MQFA 2I65A 4RIGA 3IKVA 3FXQA 5ED0A 5FBZA 4BKPA 3W5JA 2DMTA 1ULZA 4IJAA 2PX6A 2C2BA 1TYAE 3C3CA 2EV6A 1KXJA 3Q10A 3OYFA 1LBEA 3EASA 4W5WA 3WLHA 4P55A 2FSUA 2JFUA 3SD7A 3WYBA 3FKSD 2C5BA 1A5JA 2DCUA 4RV5A 3T9FA 2AXTC 2IU0A 5FQOA 1J8VA 2FDXA 5BSVA 2DPHA 3DOHA 3KQHA 1YT5A 3CZ9A 3AUSA 4PAMA 4YHHB 1FW6A 3KKMA 4F38A 1QTRA 1VTNC 2PT9A 3K0FB 3FYSA 3H4IA 2ZMEC 1UDCA 3WL3A 1ORTA 1VZ3A 2W2NA 3VYVA 2V58A 2HEGA 3N6VA 3TS1A 2QRGA 1PHRA 4BNIA 2VT6A 3PDIA 2ZZMA 1RKWA 1WW8A 2BTOA 1GUBA 3JSXA 2UUCB 5C1DA 4LSZA 1NBMD 3RAEC 3G2PA 2Q6TA 2XGDA 4M8IA 2XRZA 5E2BA 4Q3OA 3EVFA 2JWTA 5HLTA 2IVZA 1T1JA 2XR1A 2O1EA 1FB5A 5A4IS 1KIAA 2VF2A 4AKIA 1A04A 2VF8A 5EJMA 4P08A 4ARIA 2IS1A 3BTSA 1Y9DA 3K9TA 1KZ1A 1R8QA 2CLOB 3UXYA 2F4VB 1LPBB 3HKEA 1G21A 4IX1A 4R0NA 3ZJUA 1XEXA 2O07A 4JFAA 5A7HA 5K8UA 3CMEI 5THQA 5H3CA 3I64A 4WK4B 2DLCX 1C50A 5THKA 3SS7X 1EVZA 2CUFA 4MVYA 4WA7A 3RPEA 4Q6WA 3E7WA 2EDAA 4I4NA 3RIGA 5AW5A 1H85A 1I2CA 1H8EA 4YT4A 2K7FA 4G9YA 2FEPA 3EIOA 2DA2A 1KEEA 2DMRA 3HA3A 5EJAA 5DHQA 1RM5A 3T3PB 4LOHA 1CY2A 4KNWA 2AKYA 1IEVA 1VHTA 4BMYA 4KH0A 3KAQA 1G64A 1W36B 1TTTA 2CFCA 2MTBA 4FOSA 2LUOA 4BPRA 4EOGA 3TI9A 3NAUA 1XAGA 1P1FA 2CW7A 1XSEA 2Y1GA 5JCOA 3OMWA 3E5QA 2QVYX 4EPVA 3NC0C 1GV2A 2QROA 3VJRA 1W19A 2AX3A 4NG5A 2QSYA 1MEOA 1QHGA 1M5TA 4YQEA 4D0RA 1TGVA 3EGDB 1QBGA 2GDJA 3FMQA 3S27A 5H5JA 4G4GA 1F2VA 5LZ4A 4WNCA 2RJ3A 2G40A 1AF4A 5HF5A 1FVFA 3J81k 2XZPA 4BZQA 3W6OA 2E71A 1HEYA 1YBVA 4ZYUA 1WA5A 4YN3A 5CA0B 5CT9A 5JI2E 5F2NA 5ADVA 4PGAA 2X5XA 3CLHA 4RDIA 3TDZC 4ARBA 2HA2A 4TV9B 3OCVA 5AK5A 4LF6B 3UK6A 3V8BA 4CR7A 1WWXA 2AXNA 2FA5A 1RHKA 4BLVA 2BLNA 1UM8A 2VXDA 4ETSA 4KXMA 4PCVA 3MVPA 3MELA 2ZSIB 1J0CA 2WG1A 3M8JA 5I9TA 3O8LA 2VJOA 4F7WA 1YFHA 2B2XA 4BGIA 5C8ZA 3EGXB 4UUSA 1TK2A 3RTEA 3D2AA 1R22A 4FS3A 1N0WA 4R2LA 3BJMA 1T9AA 5CVTA 4NG4A 3AL0C 5C4MA 2V1UA 3SE7A 4I0BA 3MTQA 1XVIA 1JI8A 1UFQA 2NXNA 1JL3A 3COVA 1YFZA 5ELLA 4PUSA 3JATB 1UM9B 3OWTA 4XKVA 1BGVA 2XMSA 2WBMA 2IYPA 4DV1B 4X60A 2Q0QA 4Z51A 1HEIA 3I6MA 2V79A 2WZCA 2Q21A 2CYYA 3DOJA 4L28A 3OZWA 1KEUA 2FW0A 4MV3A 4W6ZA 2MGQA 1U3WA 3U21A 1NF3A 1XCGB 5GWXA 1TWFJ 3OE7D 2ZMEB 3IPLA 1R0WA 2PBZA 4UNOA 3A9RA 1V5IA 5FUXA 1RAGA 3K70D 3V8QA 3QPLA 1OSNA 2IGTA 4YRBA 5HKBA 4PONA 1ZH6A 4UMVA 1GPKA 5HZMA 1ZJZA 3COWA 3DEJA 2I7XA 3K0SA 4IIYA 1NQOA 1G20E 5D86A 1SZPA 4CM4B 1CQIB 1URPA 4KMOA 1M2HA 3P2EA 4OHUA 3K9FC 1IWPB 3G7UA 3PQ6A 1ZEMA 3QXGA 2Z57A 3PEFA 3M1LA 4MICA 3Q1LA 1HURA 2X5JO 1LBHA 1QYDA 2Q3MA 2FKAA 3HRMA 2AI3A 2LVSA 1GGFA 4G0OA 3EAGA 2MHCA 3DMNA 2B34A 4JNKA 5IKXA 2VHTA 2MYNA 5CQEA 3NQ41 1XEAA 2WT9A 1MN6A 4LGVA 2CL0X 1N9GA 3ZEAA 4OHZA 3V7CA 3U6KA 3L1IA 1SQSA 3R23A 2LREA 1Q21A 4XCXA 2GBYA 1A8SA 3RK1A 2JFGA 3ESWB 2VNKA 2Q1YA 2HA7A 3DMTC 5E9JA 3L6DA 1ZQ9A 2R5WA 5HDKA 3PNLA 4KZPA 3W5AA 4YWHA 1MNMC 3KO8A 4I99A 3BJZA 1SCBA 1TBXA 4B85A 4JQOA 1S6YA 4ZO7A 3DM5A 4H7FA 3KB8A 1Y6FA 3LP5A 2IZ7A 4AZ3A 3JWJA 3QMPA 1IOZA 3R61A 3DWLE 1VE5A 4KQ2A 4OXNA 1CS4C 4AFNA 1O7LA 2AE2A 1G1MA 5E3JA 2O3TA 4R8LA 4XX0A 5T5QA 1X42A 3IBFA 2GVDC 3TBIA 3ERED 2KIMA 2DFLA 2BUAA 3O4HA 4YV1A 3R7LA 3K0HA 1I3MA 5EPOA 4F9FA 3UJBA 4EKGA 4L5EA 3UUWA 5AVQA 3LOCA 4FDUA 3LY8A 5IS2A 4J49A 4BO8A 3GGOA 1H2RS 4MQBA 4ZAVA 3L8MA 3PUFA 1QG6A 2XCQA 1NSTA 2A7XA 3BDIA 1RYBA 3UJAA 4DAOA 1BR4A 1OU4A 1IZZA 1KE1A 4EVQA 5JMPA 2LH9A 3BH0A 4X7RA 1BSVA 1XA0A 1MG0A 2BFDB 4I9FA 3BGSA 4BGVA 5FBLB 1G7CA 1QAQA 2PA3A 3FOZA 4PTYA 2B21A 1E2FA 4C87A 3AHFA 4MKHA 3CEAA 3M1YA 3OZEA 1EHIA 3HUUA 2FN9A 1HE1C 4GLFA 4LI3X 2MSDB 3DHEA 1U8CB 5EUCA 4R2JA 4LS3A 2BOLA 5I4CA 4A0HA 4KDFA 3CLUD 5BN4A 4I14A 2VJQA 2VT2A 4IIVA 4IDNA 1S89A 3B7GA 1T2DA 4N9HA 4U2BA 3AG3H 2BFBB 4MPTA 3WQSB 3HC7A 4HQRA 1CUZA 1B42A 4WNIA 3THXA 1TU4A 4KK4A 3DW3X 1ABEA 4REMA 4KU4A 4B4VA 4CKXA 2Q3DA 3GARA 5JBIA 1D8AA 3B6EA 4WNAB 3JD1A 3OJXA 4LKRA 3KVNA 3AL0B 4JWKA 1YULA 5BWCA 1KTVA 2X15A 3LECA 3K9BA 3TLCA 2XNKA 5C5EA 4IL5A 3H4VA 3QLUA 4IUBS 2G04A 1JMVA 2OE2A 2IC5A 3UTDA 4C03A 4DZRA 3MPUA 1F51E 1STOA 1XQWA 4Y2JA 1R0CA 3AEKA 1VQ8I 3P5SA 1EM6A 1MBKA 4EZBA 2Q4BA 1HF0A 2ZE5A 1GGMA 1R74A 3ZTTA 5E6SA 4QKQA 3QKSB 5MFZA 1ZIOA 2B61A 1Z5VA 3IO3A 3IP5A 4OMUA 4PHHA 4LF4B 5GAEJ 2JBAA 4DWJA 5CKTA 1EDOA 4KP7A 5H8WA 1IJFA 4IDOA 2PJZA 4HTAA 2W6JA 1CZKA 4HFMA 3KYCB 3I1FA 1DC5A 3EVEA 5KHAA 5KYVA 1L4EA 5JAZA 2PMBA 3AFOA 2XE8A 1PX2A 1FDRA 1RE0A 3RVDA 2P5YA 4U4AA 2J5XA 5IUKC 5FOXA 4PNEA 1XRNA 4O0LA 5JC1A 1TE2A 2P91A 1GL3A 4R41A 4UNQA 2CT8A 3K2AA 1YE5A 4L4RA 5B53A 4PW0A 4AJOA 4IXNA 4IIDA 2GHQA 3K0CA 5L6LB 3WKCA 3T3HA 4CTKA 2ATEA 4IVRA 2XUDA 1T8SA 4US2R 2ZUWA 4G0ZA 3I71A 3U4MA 5LIPA 2GM9A 4OXXA 4MTCA 1THMA 3OKAA 3D5TA 2D5IA 1WXWA 3OBIA 1BN6A 1CBUA 1RS0A 2XB4A 3DZKA 3GW8A 3FTCA 1K2VN 4S1PA 3DE0X 1QQ7A 1F4VA 1V1RA 1NVFA 4C22A 4GVPA 1G21E 4I50A 4Q5IA 3OF5A 4ML3A 3E2PA 4QPPA 4L07A 1HDDC 2R7KA 1C8VB 1IB0A 2MSKA 2H1CA 1G98A 2LWIA 1Y5NA 2VZ9A 5LQSA 3WE2A 1ZHHA 3OD5A 1VA5A 1TC3C 2QS9A 1L1QA 3RYHB 3A2KA 3OT5A 1IUFA 2R11A 4P81A 3AR8A 1FJLA 4R1OA 3VKFA 1CHNA 4IHTA 5B1IA 1C9KA 4D3YA 1HFJA 1Q11A 3B7PA 4GRDA 1BEUB 4QYWA 3NC4A 3QFRA 3KZOA 1F0KA 2Y67A 3AF2A 2IPMA 1Z67A 2CXUA 1J6UA 1DBVO 4X7PA 4ZCSA 1MR3F 1M1ZA 3LNQA 1X7DA 1E0SA 1SXPA 3HOZJ 2Q5CA 2ENUA 4WGGA 1EXDA 1UJNA 3IDAA 4WOKA 1YE9A 3DNMA 1TC2A 4WT7A 4UNIA 4CKCB 3TJMA 4B3HA 2Y9YA 4HQKA 1PG5A 2BEWA 2P2YA 3GO4A 5DTIA 4RH1A 1AKUA 4Y9UA 5ALUA 4JB2A 4LMPA 5DYMA 1LDDA 3TRFA 1SJ9A 1Z0IA 1MDMA 2FR8A 1QVAA 4DA7A 1OUMA 4G0UA 3QFFA 2VHZA 2EGUA 3GJZA 3SFIA 1ID1A 5LB2A 1Y8RA 3DKPA 1TX4B 5E9WA 1KFJB 2ZVPX 3M5DA 3R0QA 1ICIA 1W8DA 4PYOA 2M0CA 3CLVA 4O2RA 1DCTA 3RVOA 5J47A 4II7A 4CG3A 2DTZA 2FN4A 3E4CA 3JZFA 5C1BA 5K0CA 4JCOA 1ETYA 1OC2A 4ARAA 1W581 3K73O 1U2WA 1DAPA 3R3WA 3C48A 4MQ5A 3QU5A 3C0KA 4ICIA 1W2WB 1HDXA 3L79A 5HQJA 4TMTA 1LK5A 4AZVA 4PSWA 4EZIA 1NXXA 1SD1A 1CJBA 3OPYB 3AFIA 2R6R1 3TXXA 4PX3A 4TLMB 5BWMA 3LKDA 4B40A 3SKVA 1YL5A 5FOWA 2QY9A 4L22A 2QY6A 5FLVA 3Q15C 1G66A 4LWPA 4Q4DA 5KVCA 1I6LA 4JA2A 2QVBA 4XTCS 4G1CA 2D8MA 2WWRA 3HU3A 4MS4A 1Z75A 2C82A 2C3UA 4X54A 3HY6A 3V4LA 3GRAA 3MPOA 3E6AA 3TNLA 1X3SA 3STWA 1X1EA 3FNGA 2QRKA 1LFBA 1JX6A 3K1NA 1PUEE 1CF7B 3Q6NA 3R3VA 3RSQA 1KH1A 5JMOA 2Y99A 3ZHUA 4ZDWA 3E9QA 5EE5B 4WCDA 5I9LA 1KSHA 4OGFA 3L1KA 1E18A 2XUAA 4NENA 2KISA 4BMPB 3DQPA 1FYXA 3NBMA 1L4BA 4DNCA 3QLVA 1WCXA 3ROGA 1U6IA 3D5QA 3IALA 1T9GS 1SCIA 2A05A 5CA1A 4GBGA 1O95D 4KRYA 2RAVA 2Z9CA 1MSFC 4H1VA 1E0AA 5BSHA 1SBYA 4KYIB 2PS3A 1FVOA 1Y3DE 1RWKA 2ELHA 3JRHA 3R0AA 1OLUB 1WXEA 2ZKIA 5JMTA 4IS3A 4M1MA 3VAYA 3H6KA 4FWBA 1SIBE 1XZCA 4R9UC 1XHLA 1L7MA 4HDRA 1N7JA 5FWXA 3A70A 4PTZA 4R01A 4DVJA 3NVKI 3GJRA 5AUQA 3FTNA 1IRIA 4QXPA 1QR2A 3CCYA 3MT7A 1XFAA 3DEHA 2R7OA 4LTMA 1VIVA 1EUDA 3QSYA 1XZDA 4RWEA 3LHKA 5H02A 3TFQA 4XUCA 2IF0A 4WCFC 1ZI9A 3ZWDA 4AZSA 4UHFA 5DSTA 5KYXB 3B85A 2VPTA 2V03A 1VE1A 4NC7A 1W35A 2XMRA 1UCFA 3MMXA 2O03A 3GFIA 2JT1A 5TPWA 5K8LA 2KRFA 4BYGA 4F2HA 4UCWA 4GF5A 5GP9A 1ZUD1 2YXPX 2FZ4A 3ABUA 5A6SA 3O7WA 3COJA 4AYXA 5DN6D 4B4CA 4MW5A 4TLEA 2FEAA 1S3IA 3AKDA 1F4LA 4JLOA 2IW5A 4D6XA 5LQDA 4DG8A 2ONYA 1MVLA 1E1RA 3O8HA 4COKA 4A12A 1BRMA 1AWCA 3OVMA 3U56A 1E1NA 1SUWA 4NNJA 2WSSA 2J45A 5L3ZA 2G17A 3L4BC 2Y1KA 1V6CA 5J63A 1XSDA 4LRXA 4TQ9A 4IHXA 2FNAA 3JQQA 4Z4IA 3SVTA 4HB0A 1PYOA 1KDPA 4ZARA 3BTUA 1QRUA 2XF6A 1YE3A 3H65A 3RUFA 2C9DA 1VMIA 1J49A 3N1UA 1M1YB 3PFKA 4RVSA 1JG2A 3RQ4A 2FEWB 5EIHA 1JDBC 1K1EA 1KAGA 1EFRD 3H42B 1FDSA 4J16A 2Z1NA 3EPJA 1JE1A 3A2LA 5KNBH 2P3OA 3QF4A 2H8GA 4ZC3A 4QU9A 4B79A 5L51A 3AUFA 5D5UB 4UUTA 1K5HA 2XF2A 3LOQA 2XRNA 4DA0A 4JL6A 4KUHA 1H9AA 3ETEA 1ZK2A 4E21A 4XR9A 1WXXA 2E4XA 4J4TA 2J46A 5CB8A 5AVUA 2ZDHA 3WLRA 2YHSA 2V6MA 4ALMA 2W6ID 4BY7J 1OIWA 3TLEA 4MUJA 3KBBA 4HAXA 4MRVA 3LY5A 2HWYA 2PX2A 5IYDJ 4PC3A 2WYWA 1XQVA 4CV1A 1Y3FE 2P62A 3ZU2A 4DHEA 4RPKA 4PQEA 5TRDA 4FZ3A 4O4HF 4HQNA 1JBQA 1PYGA 1GPBA 1EXNA 1GKIA 3S99A 2GCGA 3I9KA 3MRXA 4DRZA 2W6NA 1VRVA 3QSGA 5LQRA 4PYLA 4OU0A 4AYTA 1GPMA 2ECBA 5L95A 5EHGA 3WYFA 2AE1A 2ZTSA 3F0TA 2NZJA 1YRWA 3ZJYA 2BCEA 4CUKA 1QORA 5EUBA 3BOQA 1GLGA 4QTRA 3S2HJ 4AUEA 4JXXA 4A6PA 5B37A 2GHIA 2FX3A 3BIWA 2F1IA 2E5LB 3BN3A 5GPAA 3U4AA 2O8VA 4D1QA 3EPKA 1C7FA 2JB9A 2XV4S 3UHJA 4XSHA 3PVZA 1VKHA 3LUBA 1OFHA 2Z2XA 3L7YA 3ICQB 4EUFA 1W73A 3CNBA 4Y2XA 3EK2A 3W5IA 3BXHA 3T0YA 4S05A 2J9FA 4G5XA 1P2BA 2V9KA 2OK8A 5F5NA 2CNWD 3U7JA 2ODQA 1FNCA 4D5CA 1MCZA 4KN9S 1GNRA 3GDOA 4A0FA 4NZPA 3EN0A 4JITA 4X1OA 4NH4A 4L75A 2WJAA 3KG2A 4FX2A 4X6LA 5BW4A 3ITNA 3WAGA 4GNKA 5AXDA 4LK0F 4IJMA 3H1PA 3WRYC 3I59B 4I01A 1CR0A 5EZYB 2VQGA 1JECA 1P0PA 2DDAA 1DKRA 1D2CA 1NRXA 3BMOA 1UQTA 2G1KA 4A82A 2JHCA 4FR0A 4CBVA 6YASA 2G70A 3JZAA 4WCFB 1NG6A 1AUVA 4BXOB 2FMUA 4TZTA 3ROKA 3HKDB 4KVGA 3ZVMA 1HCRA 1JEYA 2GA2A 3QOYA 1TZLA 1NW5A 2DDBA 4OQXA 4COOA 1D0VA 3FOEC 3G23A 3ZN0A 2J4FA 2WPDA 3GVXA 1GGNA 4YQYA 3IX7A 4X6AJ 1GD1O 5IYBJ 1G6KA 4HF1A 1I3OA 3FR8A 5CHEA 1PFWA 4OHVA 4CMEC 1L8LA 4EVSA 1JG4A 3PQCA 3H0EA 3BGOS 3ZP5A 4DSTA 4KW7A 2D2IA 1GNLA 2ZTMA 3N7AA 4OYYA 3NYQA 4UTRA 2EL9A 2VWGA 1E3JA 1L8OA 3ZW8A 3FUWA 4EYEA 4XLPF 4X93A 3KT3A 4ZO6A 2OCLA 1XTRA 3D0KA 2HY7A 4WXRA 3LXMA 3REQA 5F1OA 1RSZA 3WGZA 2R7NA 5E8RA 4RGVA 1JT6A 1HUQA 2WFMA 1XYVA 1X77A 5ALJA 1GTRA 3I6ZA 3EGIA 2ZRHA 1BOFA 4LKOA 4ZAGA 1ZXBA 2ZS7A 1GAQA 4FJ0A 2ZGVA 4ITUA 4NJMA 1RYHA 3LY7A 4QUKA 1ZIYA 3HCCA 1ZGCA 2BHTA 3JASA 5HYVA 2CWDA 3SG0A 3BCBA 2C0CA 4GR9A 3T9DA 1N5KA 4XYGA 1PSDA 2NS8A 3PSIA 1S7AA 1WDKA 3WG7H 5FUMA 4DS3A 1QV9A 2B7CA 3HOWJ 1KMNA 1SIUA 1MMNA 3NT4A 4NP6A 2DFKB 2I9PA 1JFRA 4QFMA 1G18A 1AO0A 1FXUA 3UUGA 4MWDA 4DJFC 4IQ8A 2PMZA 1Y37A 4TQUS 1SXIA 1BDIA 4XDGA 3AI7A 3O4FA 3WB2A 3DP7A 2X7XA 3GNTA 4WPGA 3BG5A 1FYDA 3RZDJ 2R68A 3H3FA 3H75A 2YV5A 2R96A 1FDIA 4DWVA 4RU1A 4EI9A 3KQPA 3BERA 4PCAA 4NOKA 2VQ6A 1WCV1 4I1SA 5BYBA 2DTDA 5JWRA 4D98A 5ULLA 1FBQA 2OP1A 1XRPA 4YVFA 5L3RA 3QH4A 1OC4A 1FLDA 2CD9A 2LR0A 1K4SA 2DUJA 2ZULA 3TRIA 2W90A 1FSHA 1SZCA 3HBMA 1I24A 4RFLA 3I2KA 2Q50A 2HMSA 4UMFA 3NHBA 1QH1B 3WWOA 3R8FA 3CQZJ 3KJHA 1DWOA 1Y8QB 3RQSA 1Q1BA 4ALLA 3HRUA 1WETA 2QG4A 2BFNA 2XSJC 3DL0A 1GA1A 3LQ4A 4C0HA 1CDEA 4D9FA 3HB4X 1RZRD 4BWVA 3PPIA 2Z16A 2EJVA 4QFDA 4CTMA 3BIJA 1IM2A 1D03A 3PGVA 3K35A 3L4EA 2JRMA 1OTHA 2CFSA 4GYGA 2COEA 1B9MA 3BWXA 1QYRA 4P5OA 2NN3C 3NT5A 4FKMA 4JQFA 1X1RA 1CRQA 2Y1LA 4C0WA 3WL6A 1N2CA 1M5RA 4W82A 2A5LA 3Q8MA 1ZG3A 4DBVO 4S24A 2GJSA 2BY2A 3ND7A 2E19A 1A2QA 1W6UA 4IM7A 3M5WA 1TIPA 4AC9A 1X1TA 3NJRA 4WZAE 3AF3A 1S02A 4EV0A 2WJWA 2WFZA 1UMCB 5E17F 2O0KA 3UBMA 1N2JA 5CGZA 3U37A 4J90A 5SZKB 3RS7A 1YQWA 4YUWA 3K10A 3I61A 4L9VA 4RACA 4Y52J 5KYKA 4CKEA 1E7MA 1EAMA 1Q50A 4MYTA 1RUOA 4Y2YA 1YZ3A 4NX2A 3SLGA 1SG9A 3KELA 2VSXA 5F6FA 3GFTA 1BM9A 3Q3IA 2KQRA 1QG4A 3NBKA 1G2HA 1LS6A 2C31A 1E3TA 4AJEA 4KIFA 1PUIA 3HLTA 4RJJA 3F1KA 3E6BA 2PWAA 5K8JB 4JB8A 3R0JA 3O3NB 2V6JA 3KS9A 2JAOA 3W2TA 1T8TA 5FCDA 2FWBA 1UP7A 4FILA 3FIWA 1Z7GA 1W4RA 1X9IA 4X6YA 1DIAA 1TPYA 2JC3A 2X0IA 2IY7A 4KFRA 5HJ2A 3FIJA 1E61A 2A67A 3PHCA 3BJ6A 5H68A 3M8EA 2VNSA 1CR1A 3WDSA 5DLDA 2NSDA 4JUFA 1UMKA 3LJKA 1J75A 1SCKA 6ADHA 4FHFA 2AD5A 5JARA 4OYHA 2P9YA 1X8KA 1ZGZA 3WU2C 1QR6A 4FR5A 3DJFA 4PXYA 4ATNA 1EUCB 3FLAA 4PG6A 2Y92A 3BMCA 3FOCA 1BAPA 1TK3A 4C08A 4DSUA 2HLDD 1TZ2A 3HUGA 3UJ6A 2IS6A 4Y7DA 3KR2A 1TJPB 1ZUIA 1EVLA 3UB3A 2EV0A 5A4MS 3I2JA 3V97A 5BNGA 4KGXA 1TVEA 1U5BB 2NVUB 3OEHA 4TS9A 1QE0A 3AVPA 1JFSA 2J0SA 4DOMA 4DLSA 1ZD2P 3OV8A 4HSTA 4R5HA 1Z5PA 5KX5A 4HOBA 2IH2A 3UFXB 1V39A 3AONB 2HDWA 4EL0A 4RSMA 1T9KA 2QXTA 2HRQA 5C4IA 1V9LA 2DLDA 1EWTA 1Z6PA 4OFXA 3GYHX 1YKFA 4X61A 4EUSA 2CVFA 2VKDA 2GXAA 1OYWA 3DWEX 2PXXA 3TTUA 3JRCA 1U1FA 5JPDA 3JTGA 4ZMRA 3IEPA 4IXWA 1CJTC 4AWAA 1VLQA 1UJMA 2CEKA 3ZQLA 3CO5A 2Y66A 4ZZLA 3R6LA 4FHDA 4EHHA 2NAFA 5H59A 4AYWA 1GNTA 1KS9A 3W5UA 3DKKA 3DE6X 4EGFA 2K9NA 4JIMA 4JX4A 4LPKA 1O3RA 3B2QA 4ZT3A 2G76A 3DXFA 3GCZA 4HYEA 4A92A 3PDHA 1DQUA 1WJAA 1ERDA 1N8TA 4G7HF 2J3JA 4XWAA 3HDQA 2IZ5A 4B34A 1M6EX 1FU4A 2W2KA 1DE0A 4HAUA 2WU8A 1POGA 2I1LA 3EEYA 4BFYA 3K32A 1PZMA 1PR2A 3W9BA 3T5TA 3W2VA 1JNYA 1FUKA 2YXBA 2YDYA 2LTPA 1UOEA 2AR9A 5AHKA 2FPRA 1XXHA 1C3VA 3C45A 4PPNA 1M8FA 2XECA 4KVAA 3VNVA 2QVXX 1C7ZA 3HR4A 1U04A 1GCUA 2XSZA 3ZH2A 3PPWA 4LY3A 1SHJA 3TZHA 1SMKA 2I66A 5AIAA 3G89A 3GQVA 3MGBA 3L4JA 2FWAA 3KDAA 1ESZA 3HDTA 3CZRA 3UN1A 1U0FA 1U5CA 2FQYA 2UU9B 1VE6A 5KOIA 2I7CA 1LRJA 4NC9A 5LA6F 2HD4A 4IOMA 4YLEA 4KI7A 4ZO9A 5JVDB 3AWIA 2QTZA 2VHXA 1WUTA 2WJHA 4Y6QA 4GI5A 4BNTA 1DC8A 2FETA 1YDFA 3AIKA 1Y9JA 1G4HA 4ID9A 5D6NA 1R5NA 3D8RA 2F5DA 1ZVKA 2W6QA 4IDDA 2R7ZJ 1B0AA 1QK4A 2YS7A 4IHJF 1K6EA 4J2HA 4O3FA 5K3SA 1QV7A 2XNDD 1YJBA 4DNQA 3BD9A 2I6QA 4BX2A 2X9DA 2I6TA 5TS2A 2BUCA 2QMHA 1DFHA 1A8QA 2IV3A 1OXXK 1L7OA 3QU3A 4DZZA 1K75A 2BH9A 2YYAA 3M82A 1R50A 3W2FA 4EJFA 1IGNA 1N57A 2NO6A 3L4SO 1OLOA 2N0SA 1JYFA 1M7BA 1QONA 1FSFA 4AP6A 3IVRA 5CFMA 4AC0A 1TNSA 2C7BA 3ZD9A 3R9XA 1F0NA 3CKMA 4K9LA 4EHKA 4KNYA 3GG2A 2MLKA 1OLSB 3NH6A 3B9BA 4N76A 1R4ZA 1UUFA 3F9IA 2I2BA 3CX8A 1I0LA 1RJ9B 1EU1A 4P3XA 1RWWA 3LTEA 2VRCD 4FDLA 2Q5HA 5KNDA 4I6ZA 2RC5A 2V97A 1P7VA 2FSFA 3C6XA 4H7HA 5LQAA 1OPXA 1FEZA 4D92A 3T9EA 3Q8WA 4JU9A 5A04A 5CFPA 3HLKA 3BT9A 2IDKA 2OEPA 4OAZA 3NIBA 1LWOA 2NT4A 4U0WA 1WXHA 1P2GA 2NGRA 4RSHA 2B30A 2CVOA 5EJ6A 5CFOA 3RE1A 2W6PA 2SNIE 1PDVA 4U5QA 3FNFA 5EIOA 3L46A 1KZ4A 2XB2A 2CHUA 3VH3A 2MA3A 4JT2A 1QPBA 4F2DA 3VYUB 4KYUA 3A1EA 4RBNA 4K9PA 4A36A 1K9SA 3BP8A 4KPUB 4D3SA 4RZUA 2J7KA 2HZ7A 2XODA 2FW9A 4HX4A 1ZN7A 1T2CA 1D5YA 1H94A 5CHYA 1HI9A 5FROA 2YS6A 3WE3A 4C2BA 1MIOB 3LPCA 3WX0A 4MJ7A 4GT1A 4TMZA 3CIFA 1DP4A 1AHNA 1CRPA 3GYBA 1TMYA 2OCIA 2GEUA 3AUTA 1LSOA 1D8JA 1T0FA 5F7OA 1J20A 3P9XA 1F2TA 3OMLA 2ZCVA 3ABMH 1FP4B 2Y1XA 1YJWI 2R8YA 2UAGA 3F6BX 4N3BA 2UZ0A 5CTJA 2V54A 4F3CA 2OT3B 3PXCX 2GPSA 5IAKA 1EFPB 1Z35A 4EHLA 4TUYB 3A1FA 4WFQA 1LPSA 1BJKA 4A8HA 3PUJA 5C3UA 3BZWA 4XOTA 3EQ8A 2ACWA 4Q4HB 3ROFA 3DEFA 3LCJA 5HMMA 3DC7A 3K15A 4NK5A 3VX4A 1HLGA 1GPYA 1WNFA 1USWA 3B3FA 3CONA 4N9WA 4FX4A 5F1RA 1JJAA 1XDUA 2XKJE 3Q8KA 5G4LA 1QHEA 1WOYA 3AINA 2IA0A 5EKTA 4KR9A 4EMTA 1AZSC 3WAKA 3QPAA 1FU8A 8OHMA 2R6HA 1DMSA 4CLEA 2M8GX 5FTNA 3MT8A 4CCLA 2KQUA 3FDFA 3LFTA 1TQPA 3N2YA 2VP5A 5BSMA 2L01A 3ONEA 3MERA 3GELA 2O05A 2VC0A 4Y9SA 4Q1DA 5FGMA 2ORYA 3V8LA 4NTZA 3GLFE 1WGXA 2RQPA 4BUPA 3HGQA 1L7QA 3LL7A 5D1HA 3RUIA 1OBOA 1QYVA 1CE8B 1D1AA 3HCEA 1Y7LA 3C6MA 2V5UA 4BQAA 5L4LA 4EG6A 2C83A 4EG4A 2EHDA 1YC5A 3NEYA 3QW2A 1WKVA 3GGPA 4M6WA 1JHAA 1MHPA 3OMXA 3HRIA 2VJIA 4TMKA 4GZ6A 4ZK2A 2M7AA 5IJ9A 3WMRA 1MVNA 3FWHA 4BLWA 5A9TA 4A2CA 3I9V6 1RTTA 2H8WA 4J3JA 5LUBA 3U3RA 4DXHA 3F4LA 4E4YA 4U6SA 2LSOA 1OI2A 3KJEA 2CMPA 3B6MA 4N48A 3PHHA 1LSUA 3LSMA 4NEQA 1L6RA 4JL5A 3JRXA 3K1AA 3ZJ4A 2G8NA 4V0ME 3VEPA 1IMJA 2HOEA 2ZCWA 4X6UA 1FEXA 3VGJA 2GF0A 2FSIA 4OA5A 4V0RA 3AAFA 4Y0NA 5LCXA 1G1AA 1MNAA 5JSFA 3EEIA 3NTUA 2P2ZA 3RABA 4A3BJ 1Y7PA 5FPKA 4INOA 1FXSA 3WS7A 5GMOA 3K9WA 1MW8X 3RBVA 4XPIB 4UUAA 4RCYA 3LSTA 4I09A 3PIPF 5GZ3A 3ZWMA 1P9RA 2PMFA 2QD5A 2YKGA 3MTDA 1FOKA 3IBGA 2DJNA 5IY5H 4M7OA 4MXDA 5CYOA 2KDZA 1CV2A 4S04A 1B7GO 3KLNA 1SVIA 2FPWA 5FI3A 2L4AA 3N8IA 3BZBA 2V74B 2H4YA 5JSKA 3EVCA 5HZGA 4YJ3A 2IFTA 2ZATA 1TLHB 4F9GA 3WP1B 2O0LA 1XLTC 4XB1A 5T41A 2PKXA 1E2UA 4N82A 4RA9B 1N5JA 1AKHA 4ZEOA 4K0KB 2M1XA 1V7PC 2PPVA 2NS0A 3G0HA 3OIWA 4LJ8A 4LYJA 3BE4A 4RO0A 3M9WA 3NYWA 3TW4A 4UHJA 1E96A 1MGTA 3GFGA 1N6RA 1I5EA 2L9SA 5KYYB 4C2UA 1M3SA 5FKMA 4HXYA 3ZGZA 3V8RA 1EJ9A 1C3XA 2V5AA 1WJBA 1DXHA 1D2RA 3OQJA 4BGEA 2WC2A 3CWQA 4FSDA 3CSUA 2ZYRA 2GYVA 3JARA 2RAPA 1VQ5I 3RYTC 1S72I 1SANA 3L7NA 1NJ6A 3JRAA 4F5WA 1BXRA 2L7ZA 3N3AC 1W9HA 5TR9A 3UGKA 3GMEA 4LK3A 3PGA1 2JG3A 2IPNA 3GHYA 1SEUA 3AY6A 1F3LA 1J9GA 2QQ5A 5EP2A 1RWBA 2VAVA 1M0EA 3N6RA 4H3KB 4M0MA 1HT3A 3MWYW 2M6RA 2JZOA 2CLEB 5ALYA 2OOKA 4X8MA 2Q2EB 4HX7A 5DN9A 4WZZA 1JAZA 3W1WA 3L40A 3T0GA 4XD2A 2J6HA 1QP8A 1J8FA 2M3AA 4HEA6 3LOPA 4N5IX 1SBQA 4EPRA 4RLSA 4PIMA 2BKAA 1RVV1 3VDRA 5D4RA 4RANA 1N2EA 1RXSA 1P1BA 1HBXG 4H4DA 4RVCA 3S8YA 5LYJB 2DUNA 5BSUA 3T95A 4CNBA 4FUQA 3I4PA 3OCYA 2QUHA 1DPFA 1DMRA 2C78A 3OX1A 4LK1F 4XB6B 4KH1A 3HB1A 3OYKA 1G55A 1GAXA 5KJ1A 4DJAA 2IGBA 3AHJA 3G2NA 4FYXA 3EIFA 1CSEE 3MXTA 2R8PA 1AXGA 1JKJA 5ALOA 2QD3A 3GAFA 2NX2A 1V5GA 2NACA 3ORFA 1C0KA 2P7VB 5HIJA 2VPYA 1NVBA 5JTTA 1A8HA 4LRQA 5EJ5A 2A5DA 5LFAA 5IDQA 1Y0UA 1FTQA 3ZGVA 1NOJA 5KQGA 4O4IA 1GV1A 2DLNA 3Q3JB 1E99A 2XYVA 2FPPB 4F4HA 2B6HA 3I9MA 1HG1A 1QCDA 2YV2A 3P0RA 3RCBA 4B6PA 2JAUA 3HWWA 3KQNA 3AFGA 5ESDA 4YIKA 2IYVA 3FGOA 5L3GA 2W43A 1NOKA 1I94B 4JQYA 5CW1A 5G0UA 2G9NA 2JGDA 3QW4B 3ASVA 5GJBA 3A01A 1ECCA 4Q0MA 1E9AA 4MI6A 1BW9B 3OYHA 3CUYA 5CD1A 2HT1A 4CEJA 3H2GA 4B5KA 2NUBA 4A73A 2IOQA 4IIHA 2IHUA 3UH1A 4UBLA 1PDWA 3INYA 4MEBA 2KLHA 2JN6A 2VTKA 3LUDA 1G5HA 3HG9A 1Q0UA 4HN2A 1OFUX 2Q46A 4QTXA 1IZYA 4UAUA 1LRKA 4I55A 1XVTA 4ZTUB 3VPCA 2G7MC 4CIBA 2Q27A 4S0XA 4ALIA 4RZ2A 5AM3A 4DV4B 4XLHA 4IMPA 5KWJA 1J56A 4CW7A 5FUWA 2QD2A 2V4MA 3J81A 4E14A 2YU3A 2BHYA 4OLFA 3KPWA 3DSRA 3RC2A 2ZJZA 1GA4A 4B7AA 2JD0A 4S2EA 1GSIA 2BEKA 1P7IA 2C57A 1WE2A 1YRHA 1NKSA 2LD4A 2YJ5A 3AQIA 3TPCA 1SAXA 2F8TA 1PZXA 5DTEA 1FLNA 4LQ4A 5J23A 3NJ8A 5E3HA 2IVFA 1DIHA 3T1YB 2NO5A 4D82A 3NKLA 2FFAA 3E3NA 2HYDA 2YJGA 1MOQA 3K4PA 2HZDA 5JYBA 1L5YA 2WY7Q 2OYSA 3UHOA 3EWIA 2WNIA 3NARA 3FJYA 5CFNA 3KPHA 3GLKA 3IKJA 4FGKA 4AN4A 3AR5A 4X1KB 5A1TA 4ZQHA 5FBVB 2X4IA 1P2VA 2DUMA 1MIHA 3VU3A 2WJZB 4BNZA 3WL8A 2ZJAA 2OO5C 5FKOA 3L6BA 1CGPA 2GPJA 2HFKA 5BOSB 2WD7A 4ZV7A 4G2NA 4ZCTA 4A0RA 2HF2A 1OU0A 4YJFB 4BKQA 4EY4A 2AOUA 1WG8A 3DAGA 4A3MJ 1XALA 2X3YA 3BH7A 3QG5A 5I9BA 1QX3A 2C7RA 3NHZA 2R4GA 5KYNA 1LD3A 1ZNYA 2BRUA 2ODNA 4DMFA 4DA4A 2OHVA 2QMOA 3FHJA 4JC0A 3SLRA 5EYRA 1GUDA 2Z1DA 2RNGA 2FJUA 5D5PA 2HSZA 3GVPA 3JQ9C 3A1YA 4LJYA 4TLAA 3THSA 1ZH0A 4OU4A 4TN1A 3RRYA 4D9MA 1GCOA 4Z9AA 3GJ4A 1OB2A 2AG6A 4YCMA 1YV9A 4L2IB 1FBTA 4ZDKA 3KLOA 1VQ9I 1EINA 4FCYA 5AVTA 3RRBA 3D5SC 3CF5F 4YRZA 1I10A 1I8TA 5F2OA 4W97A 1HPLA 4N6OA 1YB5A 1B2LA 3JQFA 3HSEA 1F1BA 1ESMA 4A8JA 5EP1A 2VQCA 1SXJD 3PPYA 1A82A 4PSCA 1N8NA 4RL4A 4W1RA 3HA7A 5E2IA 5LOVF 3NBUA 1YHYA 3V2IA 3EG9A 2X76A 4WXCA 1CT9A 2H9AA 3NXKA 5KWSA 1PV4A 3ZIUA 2XIGA 5JDCC 3HJAA 2QDKA 5LU8A 4PO8A 2VG8A 2Z6AA 4CF6A 2REXB 2R5NA 2LDBA 3RVJA 3FA2A 4FBLA 4IOAF 3AHHA 3QZUA 3V8EA 1YRBA 3PG5A 3N8KA 3RJ9A 1ZCBA 1YCDA 3M6UA 1Y3CE 3UHAA 3V4SA 3Q2OA 3KLMX 3IJPA 1F6WA 2I8CA 4DLRA 4JX9A 1ZZGA 1A9ZA 4C7KA 3I04M 2XUFA 1UC9A 1SC9A 3RTAA 3P5BA 2QTTA 1PEKE 1J24A 5F33A 1N2SA 3OR1C 2B9VA 3RVLA 2E6UX 1P17A 4IHQA 3VPAA 3IKMB 3H3UA 1KDRA 2D3WA 3E03A 4PLYA 1GYPA 2AHOA 4LC1A 1P1CA 4BMSA 1U0NA 4TLCA 3QA9A 2GKSA 3I6IA 2BFCA 4K9SA 4L3OA 2O8DA 1CRZA 4RUKA 3BILA 1KYQA 4AJ4A 2O5CA 4KR3A 3W7AA 3FE2A 3ICWA 1N1DA 1EHYA 4EARA 3C7DB 1IM5A 3BWYA 3QU6A 2OFOA 4IDGA 1ZTRA 1R6DA 4BL5A 3NHUA 4QATA 1OHHD 4C3OB 4OX9Y 1K92A 3ZWKA 3ZU6A 5ALEA 4LDRA 1IZ8A 2CL7X 4RQTA 3MXOA 5IMSA 4JFRA 2HJSA 4BO0A 3DEIA 5KC8A 3M33A 2VKQA 3HFSA 3NAMA 3OYLA 4PQFA 4AUNA 3V7UA 1FTTA 5AR1A 1GNVA 4BB5A 3TMYA 2YTZA 2GB4A 2V9CA 4H3VA 2EYUA 3ZXSA 1KI1A 4YTEA 2WEKA 4PG4A 1JTFA 2DTXA 5EC8A 1EH6A 3P45A 5A03A 2ZXHA 3TXYA 3MD0A 3VFDA 1W48A 1K68A 4NHJA 1ZELA 2I4RA 4DGWB 1E9RA 4XQ0A 1JLKA 1XHFA 1CZHA 3YASA 4IVNA 2R5YA 4YBZA 1MB3A 1B9NA 1ILWA 4C2AA 3ELUA 5F5XA 3E3VA 3EZLA 7ABPA 3AG5A 1J21A 4ZTZB 1NNSA 2Q3CA 4MLZA 4C7XA 4QA9A 5CJ2A 1XA4A 4S1OA 1JG1A 1R15A 4ZI7B 4F84A 2UZ1B 1H0RA 1HEUA 4ZZ0A 4Q9KA 2A6TA 1T9HA 3H11A 5FNVA 4Y30A 2X7HA 2VTBB 4NV0A 1Z2OX 4ETWA 1QYCA 4PZPA 2IITA 3BF7A 1HDCA 5IYZA 5HS6A 1ZN8A 4Q34A 5C46F 1GEGA 4IQFA 5I7AA 2BP7A 3HSSA 3MOGA 1O4VA 3DBRB 5JJCA 4A6DA 1M74A 3LLMA 3UKDA 4AG3A 4WASA 4AY2A 2O3UA 1Q1GA 4UNRA 3HY3A 1Q1HA 1HH4A 5EN4A 3EYYA 4DKXA 3RPUD 3A4CA 2VH2A 2C7QA 3KUXA 2OHGA 4GZMA 3EVTA 4NCNA 2BISA 3KFVA 4BJ6A 2JW5A 4KSCA 5IUJC 3ZHBA 2WDZA 2ZXIA 5IWCA 4E46A 3BF8A 2FN7A 2X5NA 3PENA 3GLXA 4YP5A 4A26A 3ICVA 5CFZA 3KSUA 4L5IA 5HOEA 4AF8A 4DRXA 1XUOA 1TD1A 1PHPA 2DOAA 2R66A 5ARBA 3U44A 4BXXJ 1T3SA 2EZHA 4OAOA 3L43A 3UYKA 1E4EA 1BKYA 2I4OA 1NVDA 3ACCA 3DNFA 3WBJA 4RKRA 1B93A 2AZTA 1KVQA 3KEYA 4WXPA 4LOAA 4K6GA 1ZW1A 3LA3A 1N0IA 3KLPX 5LPNA 2OQ2A 2Q9UA 3P9YA 3WYCA 2VAXA 2LPMA 2CJJA 4J94A 2Z98A 5JZVA 3ZE1B 3AUKA 3VH4A 1S8OA 1QQBA 2FMTA 2VDVE 3TOCA 4ZVNA 2Q4DA 2H4ZA 1IN5A 2WP0A 4ZYVA 5JAHA 3FUVA 1JE8A 4FD3A 1WX1A 2FI1A 2MLGA 2WA1A 3MBOA 3L4KA 3O73A 1E69A 3I52A 4MCJA 4ZCIA 2ID6A 4L5CA 2OXIA 2JH8A 4XUDA 2VN2A 1UFMA 1F4KA 3EQ9A 4M87A 3TK1A 4RFSB 1KFEB 4N65A 3TIVA 4XORA 4ZMSA 1THTA 2R6AA 2QX8A 4CTOA 2VRBA 2V9PA 3PICA 1KQOA 5LXTA 1ORWA 1IG7A 1IPEA 4M7PA 5JZBA 1R16A 1PT5A 3E9RA 1H9CA 5EG0A 4MA0A 5ES4B 1F38A 3F23A 2XGXA 2JD2A 4K9KA 3KRTA 2JF0A 2CV1A 5AKEA 2ZM6B 1T9GR 4NSNA 5SV2A 2WT4A 2GRUA 1LB1B 3OEEA 4BC0A 4RK4A 3QM1A 1MSEC 3EQZA 3OQ6A 2LV8A 4JVNA 1MZBA 1YG2A 1NZJA 1LE8A 1BWSA 3UENA 1VJCA 1E7WA 2EKLA 5CBPB 1MJ9A 1MC5A 2ZSDA 3PI6A 4AIHA 2J85A 4YV0A 4DMLA 1FS5A 3U13A 3C8UA 2ZRMA 3V4VB 4KYWA 1BFUA 2Z5LA 2VZLA 2A59A 4P3YA 3GRYA 2HTJA 5EE0A 2QX7A 2R5ZB 3WVNA 2RE8A 4GXRA 4HNHA 4LXYA 3O8OA 5CT8A 4XWYA 1EYZA 3W2WA 1CP2A 4I1IA 2GX6A 1VKRA 1AA6A 5JISA 2VPWA 5BMVF 5G53C 4TL6A 2RH9B 2QE7D 1E79D 2R62A 1CNFA 4EVIA 3O4GA 4DR5B 4F2GA 3W4IA 1O0SA 1T8UA 2X6OA 1KY4A 4HDUA 1YJAA 1HKSA 2ZB3A 5CTAA 2Q1UA 1B6RA 4ZXFA 1ZXLA 3GUHA 3BRQA 3PLNA 1IRZA 4EHDA 5AW4A 4JOBA 1EX1A 4GC9A 3WZMA 3K8QA 5L3QA 2YS9A 4W9NC 2BF7A 2QTLA 2VNJA 5DGIA 3EF1A 4WZBA 3R7SA 1SVSA 4PLTA 1R3UA 3VR4D 1ZNZA 1Y9EA 2JGJA 1OZ0A 3NYIA 2NT3A 4YHBA 2LY1A 4DCGA 2AFRA 4HAWA 3QPHA 1JFFB 4FGSA 4MQFA 3I12A 1IHUA 1SVWA 3I9V1 1UFVA 4D0SA 4CR6A 3NVMB 4ENWA 3CYFA 4W7SA 3PRKE 2DODA 5JO0A 4G5QA 4LJ9A 1RADA 2IJLA 5IG2A 5JNWA 3OPVA 1E0KA 5HKAA 3OL4A 3OIFA 4B0OA 1D1BA 2C59A 1QSGA 2E2HJ 1DBWA 3H5LA 5CB6A 3ZCXA 1SC3A 4YRPA 3FDXA 3K9HA 1CIJA 3UJ8A 3K0BA 1CZNA 1VL2A 1Y8CA 3TEDA 5E8IA 4YJHA 2AFHA 2CUKA 3ZI0A 4PYMA 2WYHA 3H5WA 3H2YA 2PCJA 1DEKA 5AW0A 1QHSA 3T9CA 1TMGE 3K70C 1R0KA 1ZVVA 2PJDA 3R6WA 3NPMA 2BOVA 4AJHA 1LTQA 3LI2A 4IGFA 2JHPA 5HVQC 3FMRA 1CWUA 1KMHA 2QLNA 2GUGA 3JAKB 1LPMA 4TKVB 2IGOA 2R2GA 3DFZA 3GFQA 2HU2A 1BE0A 1IONA 3ZHCA 2Y93A 1JDTA 5DBIA 3P9IA 1Z22A 1R6TA 2VQHA 1UMDB 2CUNA 3U49A 4M0EA 1Q0RA 4XWKA 4RSRA 5D5HA 3BORA 5TMEA 4IFBA 3DDSA 3Q7SA 3WWCA 3VV2A 2QPAA 5AJTA 2VFAA 4D8XA 4IXDA 4P1WA 3WODF 4YV7A 2DMQA 1WI3A 3LHDA 1MOSA 1SHKA 1KAHA 4MOWA 4PY2A 4PLZA 5ADUS 2PK3A 3SZRA 4ZAWA 5KQRA 3S16J 1F48A 2PKWA 5FA5A 1YFLA 3M1IA 3B1YA 1WIWA 3CE6A 2ECFA 7REQA 2P6MA 1IAQA 2Y1DA 3FHOA 4KB5A 3IQWA 1PR0A 2AUTA 4PLPA 1WSBA 2AMYA 3LLUA 4MH0R 2LVBA 5IJXA 3UW3A 1G17A 4YAEA 2K40A 2G0NA 2HPZA 2QE6A 2BDEA 3U7RA 3EJWA 3UIEA 2PZJA 4FOOA 4UY8I 1MAHA 3DKWA 3FUCA 4HEA1 3ZUGA 1RLOA 4MYRA 3TBKA 4EG1A 2IPLA 3RU7A 3OYEA 3SGLA 1MC8A 2VPQA 3NI2A 1KA9H 3QRWA 3WLMA 1IV6A 1R5GA 3H1CA 4B3FX 4G6TB 2P69A 5GAHJ 1E4OA 3B3AA 721PA 1D04A 4DABA 3T3OA 2I4LA 1WNTA 1P33A 1GV5A 2BW3A 1A8IA 5GTIC 1W85B 3AVTA 5I7EA 3UK7A 4BHTA 3DZFA 4KFUA 2VDUE 4BP1A 3RHSA 1YB7A 2VHJA 3QVOA 5TMDA 1AK9A 4WKNA 2XB5A 4TWZA 4HLUC 1D7OA 1VYVA 3A6PC 5JXJA 4KLRA 2K9LA 4IIJF 2AWNA 2AEJA 2R1VB 1EWVA 1Y4SA 4MEJA 4R1TA 4KCGA 3MLBA 4UNSA 5JQGF 1M1XB 3CLUC 4YMIA 4EM6A 1W30A 4NS1A 4IZHA 1PJ2A 4H7JA 3SYMA 1U1IA 5JAUA 1X7ZB 1XZQA 5CLQA 2WSBA 3DUFA 4AXBA 1QHXA 2ZDQA 4F2WA 2ZTUA 4GM1A 4TV8A 4BGDA 2YVLA 1EJ0A 2KZVA 4IEIA 1LVHA 4N0EA 2N42A 2GEJA 2XGMA 4UZFA 2VYCA 3L0CA 5HFNA 5CR9A 2ZFUA 1KOFA 5IAJA 1L7PA 2G7HA 2XEDA 1Q12A 1OLXB 3K5WA 1RAEA 3NWBA 2DBZA 1ZN2A 4HAVA 1IJBA 5D5XB 4ZT4A 2OD5A 3BHMA 3PQFA 3BFKA 1JIQA 3WV4A 3BA6A 2R3SA 2HA4A 2C9BA 1U78A 4QL3A 4BUZA 4BWGA 1GCGA 4URUR 3DOUA 4D4MA 5E7QA 5ESRA 4DZPA 1JLHA 4PR3A 5BORA 1BNCA 1BXGB 3DDUA 2PMKA 1MO6A 3EXHA 1U4SA 1P9LA 5KTMA 1YMQA 3K70B 1YR7A 4PVCA 4RY2A 4JODA 5JHUA 4N8EA 1MDFA 2IWRA 4OIQF 1WPKA 2ODTX 5L7WA 5GONF 4FONA 5JWHA 4L16A 2LTAA 4EGSA 2QORA 1VIMA 4YRLA 3UBTA 3LD9A 3Q88A 4D7MA 5JCZA 2XCUA 2P4WA 2RAUA 2OAZA 5HQ3B 4NEHB 2D45A 2XDVA 4NZYA 5DCWA 2C84A 1JDBB 3QI2A 4GAEA 2NZWA 5ALNA 1ITZA 2YHAA 2XD9A 5KU1A 1ZQ1A 4Q3EA 1R4AA 1XN1A 2AL7A 2E1RA 3MUEA 2A94A 4YCSA 3NOOA 3BK1A 4D9JA 1D2HA 1V96A 1NP7A 2D1SA 3JQ7A 2IV2X 2W98A 2EF1A 3MRVA 1AZTA 3PWTA 2HXOA 4IW3B 1FSSA 4FWTA 3DR3A 4PGFA 4ABYA 1XI2A 3LNCA 3G71I 3S68A 2XEXA 4Y98A 1K98A 2F9LA 4HWSA 1DAOA 4L85A 3BGDA 5JH7B 3JCUC 3R44A 2AG1A 3KOYA 3AL2A 2VOOA 4E0BA 2DCEA 4JSTA 1RKVA 4P4NA 2IUTA 4M74A 1A97A 5BSGA 4ALKA 2AOWA 2QTRA 4Q3LA 5EZHA 2W84A 1JQJC 4FNGA 4UAVA 3B1XA 2HOAA 2AHRA 4Y2HA 5JXIA 4GE3A 4S0HB 1T0BA 4PZ0A 3LFUA 3JAMA 4DR1B 2Z0MA 4MUFA 3DLPX 3IUBA 2XY4A 4ZVVA 6PAXA 1W5SA 3PYMA 3A3KA 2Y68A 4R2HA 3NTOA 3R7BA 3IV6A 1BDJA 1Y80A 4ZEMA 4MQVA 3MCUA 4NFYA 5C52B 1F5SA 2FFRA 2YX7A 3HFRA 3DBHB 1QZXA 5K3FA 2VKVA 4CH7A 3V00A 2BGNA 3K05A 2X3FA 4NFLA 2CSOA 5FADA 4ZYYA 5FYQA 2JJ2D 2LGJA 4YAWA 2XNHA 1YGYA 1R18A 2CMDA 3KFLA 4ZHQA 5A0VA 4RKWA 2QL7A 3CNQS 2VYVD 2WG2A 4O2AB 4E88A 1UMBB 4LVCA 4X1IA 5AOVA 5TY0A 1NI4B 5DNUA 2ETXA 3G79A 2JQ7A 2XAFA 2IYQA 3O8CA 3IA7A 4AS3A 4N49A 3HB7A 3L01A 3LC0A 4RZIA 4Q4ZF 4CFYA 2TRTA 5F7JA 2Z6VA 3JQBC 2OBMA 2ZITA 1TZCA 1J8MF 4QDZA 5CK5A 3ZGLA 3PE4A 1BKDR 4NU8X 5DI3A 4J7AA 4UUVA 2BJWA 4MQLA 1FFEA 2O3QA 1TLFA 2OCEA 2V4JC 3OZUA 2GFHA 4CKWB 4EA6A 3AJAA 4G86A 4DDTA 4OHXA 1SEVA 4Z5XA 2Q07A 2M98A 3EZYA 2Q2VA 4MAFA 4C0QC 1CEXA 1F43A 3RU3A 1OTXA 4BQPA 4RKQA 1JDUA 2GM5A 5A0FA 4IVQA 3IDOA 4YAGA 5F5LA 4L95C 1EXMA 5EMKA 1G8AA 4F3NA 2F1JA 1FIUA 5FPHA 2C2WA 4N7BA