3V42A

Crystal structure of renal tumor suppressor protein, folliculin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
196
Chain Sequence
LPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAASLSKYEFVVTSGSPRVGPTILNKIEAALTNQNLSVDVVDQALVALKEEWMNKVKVLFKFTKVPKEDTQKLLSILGASEEDNVKLLKFWMTGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Folliculin
total genus 70
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16692 Folliculin_C Folliculin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3v42A02
3.40.50.12430 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v42A01
3V42A
chains in the Genus database with same CATH superfamily
4ZQEA 3GGOA 3U31A 2AK2A 5LOVF 1D2NA 1GA1A 4AKSA 3SYRA 4L27A 4GC5A 3INTA 5SYMA 4GGMX 1O5IA 2C9OA 2LLKA 2WIJA 4F8EA 3BRCA 4LNUA 3RVDA 4YMGA 3KT3A 3LA3A 4G0ZA 2OV8A 4ALIA 2K7LA 4IJQA 1IV6A 1V39A 3ED5A 3G9ZA 4ZCPA 4ACBA 5C8YF 5JZVA 4NXMB 2NTYC 2E5FA 3JYPA 1UBCA 1V35A 2Q5IA 3EG9B 2BEUB 3Q72A 4MK4A 4ZV4A 4QG7A 3RTAA 1FYMA 3KLBA 4JXKA 2L7MP 3VH4A 4B6JA 1D2HA 4CMGA 1OZAA 3MUEA 4Y98A 1OFHA 4I1YA 3TDMA 3DPTA 1LDMA 3EEYA 4KQEA 5SYAA 1U90A 3OTGA 2L54A 3JYNA 1A04A 1ZOOA 1DPUA 1G4UR 1DWPA 3IVCA 2J4DA 4LDQA 1WJDA 4ISBA 5EE1A 4D5EA 1R16A 3RUIA 5BN3B 3EFEA 2FPXA 2W25A 4YV2A 3R7LA 2OCCH 3O94A 3QTTA 4NQWB 2WJZB 4MKZA 2WHEA 2KYRA 1GLVA 3P26A 4CUZA 2QU8A 4HQMA 2FETA 4X24A 2FZ5A 1GZ4A 2FOXA 3IQIX 3WLFA 1QQ6A 4J19A 4O4IF 2IEKA 5A05A 1NWHA 1M2EA 5BXYA 3NB0A 3WIVA 1GXPA 1WDWB 2C03A 2G6TA 2JFHA 4J4TA 1U6GA 2YWRA 4FK8A 5ADWA 2SHKA 4QPPA 2DAPA 3NUGA 2VPYA 3B48A 3Q3CA 4DL9A 5T8KA 3FA2A 3IH5A 2W6NA 2CVPA 2ZAMA 1T9KA 2CEAA 3H8SA 5A1JA 1R8QA 1WZNA 4ER3A 4CEHA 5BNIA 5JHUA 4P92A 2LNDA 3RU7A 4C9BA 3PF8A 3MFYA 4A2UA 5E6UB 3HPQA 1FTQA 1EV7A 3MRSA 4JXJA 4EA7A 4RTLA 3DH0A 4Z9FA 2WPDA 3NM4A 2GVDC 1OI2A 3OKCA 1V41E 1QPIA 2BGKA 2YWDA 4JBAA 3QKWA 3T5DA 2DA4A 3PQKA 3JAMA 4JLAA 3MTDA 1Z2EA 3ESRA 4K86A 3HCAA 3A0RB 4KEAA 5J43A 2NXWA 1P60A 4IIJF 2C5SA 3CWCA 3ND8A 4B4WA 1JLSA 2K9QA 1Z6PA 1HY3A 3ZZNA 3LD9A 2EFOA 1N7GA 5CJJA 3DW3X 1WH5A 2VLAA 4OIQF 1H4VB 4GM0A 4QDKA 5IDVA 3ZD9A 3K4CA 2V98A 5D51S 4DFDA 4IHTA 3SDBA 1KAOA 2X8LA 2QMYA 2JRTA 4ZJYA 1P2FA 3EAQA 1P29A 1OU0A 3BIXA 4Q4HA 4ZAGA 5HYVA 2GDJA 4BBSJ 1I14A 1X3LA 2ZTMA 4BWGA 2GX6A 5EJ7A 4PGHA 1X38A 1ZH4A 1OOEA 3RH0A 1WB6A 1GVDA 1RLTA 2D4HA 1N6LA 3KKEA 1TIPA 1HDOA 2ZYAA 1BKYA 2GIVA 1GPKA 1AKYA 3ELUA 1AV7A 2IPMA 3PR3A 4G5RA 5AI0A 2DFNA 4D0LB 3V1YA 4RVNA 1Q7TA 1FP1D 2O8CB 4Z0PA 1NJGA 5JR3A 2CLFB 4ESVA 4MTLA 1LDGA 3BGIA 2XI4A 4PO9A 3QOWA 5JWHA 3RIEA 1KGSA 4WCFB 1ZNXA 3ZEIA 2PKXA 3K8QA 1KORA 3PIIA 3LQ2A 1DCTA 1DPGA 4Y33A 1LNSA 2V3VA 1XZJA 4FOTA 3T3PB 4QM7A 4XPZA 2OT3B 3JARB 2VPLA 3ETHA 5JYBA 2F8SA 3OL4A 4ARSA 5HIKA 1D1SA 4GW3A 5ITVA 1KA8A 1E7MA 2BY0A 3D5RC 2E6KA 1QF9A 2C58A 4ZJUA 1QU2A 3DMDA 5TJJA 2A6EF 3ZDCA 3DNPA 3ABLH 1F1ZA 4E6KG 1PCXA 2P69A 4MR8A 3ZMZA 3NEPX 1KPIA 1KO1A 4ZO6A 2COBA 2J5KA 2R7KA 2MG4A 1UIMA 1Y3AA 2O1EA 2F4MB 4TTSA 5TPWB 3NV7A 1T1EA 3GTKJ 3RS2A 4ZREA 2NYXA 3SS7X 4WAUA 1BROA 3F47A 3U37A 5JZ9A 4CF5A 1YW8A 3VKGA 2STWA 4BUPA 4NYIR 3IVAA 5CIWA 3WLTA 3YASA 4EG8A 1KH1A 1QO0D 1K5HA 1YKGA 3L8HA 3OJEA 4TLLB 5BNGA 1PNQA 3OFVA 4YI5A 2XVCA 4ARAA 1MC1A 2DT8A 4LBZA 4BV8A 4B81A 1HDPA 1OWPA 4CQMA 2WAQN 4YMTA 3ZW7A 5GAGJ 3H6HA 3ZZ0A 3KSBC 4Q4JB 2A0FA 2NVBA 4ZCQA 2Q29A 3IJEB 3HKEA 5HQJA 5JDCA 4GWGA 4BY9E 5BNZA 1FQKA 5D00A 1SUCA 3UPDA 2QLJA 3LT4A 4RPKA 3I5XA 1FYXA 3FUUA 3CKKA 3KXDA 3Q85A 3GNQA 2BJWA 4A69C 1AHDP 2ANCA 4LHVA 4LKRA 4PBSA 5DTQA 3TRDA 4A0ZA 2ZTHA 5K6AA 4BVGA 3LE8A 1R1UA 4G7HF 1FEZA 3BJ6A 3CCLI 4G2TA 4CYCB 2DFTA 1P8AA 2JFUA 3M6VA 3PIOF 3OIYA 2W42A 4F11A 4BMXA 3EVNA 1X1AA 1YR9A 5EUMA 5I4IA 3B8EA 4MQFB 5FLKA 1I5EA 1UIRA 1LBIA 4L6CA 4Q34A 2V97A 5H2FC 5HF8A 2GA1A 3PSHA 4KI7A 1MIOA 4LTMA 3K0EA 4DDVA 4EOGA 5IABA 5J2UA 4EJSC 5IJXA 1JHYA 1HT2E 4IHKA 4RFSB 2MR6A 3R3VA 3UENA 3AUKA 1FX0A 2X13A 1GAWA 3KT8A 1FC3A 4CW7A 1QVZA 1F06A 3UJ6A 1CQZA 1Q6ZA 1NOKA 2A7XA 2XB8A 1GVJA 3F2IA 3QX8A 2ZBDA 1W2HA 2XVYA 4G4GA 4KSBA 2FSFA 2A1UB 2GJ9A 3E7FA 3NXKA 4RDUA 3DXZA 4FN4A 2ZJQF 3M81A 4Z5XA 4Z4EA 4KU4A 3W9YA 1O5TA 4C0SA 1PK8A 5JD4A 1YD7A 1U2EA 4KRGA 1PHRA 2XNJA 3DF8A 1U2ZA 2I8CA 4KPUB 2WR8A 4Y2JA 3FW1A 1JKJA 1M1UA 1S4MA 1IWBB 2C88A 2RGDA 4HL6A 5LN1A 1OHHD 2OAQ1 4IV5A 2R60A 4D0SA 4D45A 2AOUA 3L3BA 5IT9A 1RKWA 5DXFA 4LF6B 3BIFA 1JGTA 1R10A 4QWWA 2YNMD 3WMFA 3REQB 2I65A 5AW9A 3FROA 4OXXA 4J91A 3ADBA 5LBQA 1ZO8A 2XGOA 4MQVA 4H6XA 1OC2A 4IFTA 7REQB 4MPPA 1VSUA 4G1VA 3FTNA 4AJKA 2HU7A 2C96A 1E18A 3D8NA 3BE5A 1TA9A 2JGIA 3DZKA 2H2DA 1FFYA 3VPBA 1JHPA 2FX0A 5JS8A 3KZIC 1E4OA 2P4UA 4BAUA 1TO1E 4B8XA 1OR7A 1SUIA 4ESBA 2VKEA 3GVXA 4QFBA 1P73A 4HQ6A 5LMUB 2JG3A 4H59A 4K2EA 1Z2OX 4QOJA 4K9SA 3RUPA 3HR4A 5E1XA 2ZROA 3R4VA 3TTTA 3T5PA 4YRIA 2I5PO 4NKRA 5IZCA 1JDVA 4AYBA 1BDJA 4JP5A 1KDTA 5L7WA 2O8EA 4I55F 4XFKA 3SC2B 4D0PA 3W2WA 2QW1A 3I28A 5AVSA 1BWPA 1CQIB 1UQRA 2IHUA 4L1KA 4PX5A 2QD1A 2XF5A 1EVLA 1NJ5A 3UHFA 4D81A 3VNUA 4HH0A 2YIMA 5IYCJ 2HJ9A 3ZMUA 3FPKA 4NICA 3U3ZA 3KQQA 4EY7A 3M8KA 4ZYUA 3CR8A 2EKBA 4DIFA 4NC8A 2P6RA 1F2DA 1TA0A 3T3IA 2CBGA 3LNQA 3F3YA 5INTA 3GTPJ 1WHSA 3RKUA 5ADVA 1R0CA 2Z3WA 4KN7X 2FMTA 1WMBA 4XQGA 1DJOA 3GDWA 3K30A 4OF4A 3LCVB 1Q3TA 3KYCA 4OXNA 4RVOA 2O54A 4AZ3A 1W7PD 3OOPA 4EEZA 1PEYA 3KOYA 3IV6A 3NWJA 3NM5A 1OPXA 1T25A 2IEAA 3ICWA 3IVRA 4MVJE 5CVIA 1ONVA 2LCFA 4XN0A 1CJUC 1ONBA 1VA4A 1VP3A 4Y15A 3EYAA 3IIEA 3ITNA 3NDIA 4Q6WA 4G8DA 4B7ZA 5B3JC 1Y6GA 1LSUA 2DJNA 2X8WA 3NZEA 3QEJA 3IQFA 1CF9A 4B4OA 5K0CA 1UZMA 5BSMA 4Y6GB 2J87A 1RUOA 4CNQA 3WGQA 3A11A 4V3CA 4YMSA 2P9HA 4DNFA 3OOHA 1OZ0A 3CWZA 2ZO4A 3CTAA 2IDKA 3M3PA 3QBVA 5CLGA 3AETA 5D84A 4AB1A 4EX7A 1DGQA 4LGCA 3NTVA 4DM7A 2IXAA 3EA0A 4ZAZA 1Q20A 5CG1A 1G4HA 1H6DA 3HHEA 3QXXA 4O1IA 5HCUA 5FBZA 4TWRA 4EUFA 3LWDA 4IXWA 4K3VA 2J7PD 4KT5C 3BTOA 5BWMA 4NSNA 1CRZA 1K92A 2XPWA 4OQXA 4HEA1 3T5MA 4PICA 1GL6A 2IEBA 1I2CA 4LGYA 4BLUA 1C0WA 5CBPA 4KOAA 2EK5A 2FZCA 3K9BA 4HJXA 1W6UA 4MLPA 1ICEA 1TVKB 4LXGA 4U9UA 2Q4DA 3A03A 3ZQ4A 3WMGA 2PLAA 5D85A 3TRFA 1TVCA 2E48A 3BFPA 1N6HA 4KGDA 1XZMA 4QT0A 4IHXA 3U3MA 3WHPA 3I3OA 4GE3A 4M1SA 3X2SA 4KGVA 1G9TA 4A8HA 3AI3A 1AQUA 2A5YB 2HWUA 4WJKB 1K6MA 3WHLA 2IAIA 4A3SA 3L2WA 2Y4NA 2CLIB 5FPKA 5JTTA 1BDMA 1ZFNA 4CLHA 5LDHA 1AU9A 5AUPB 1JSRA 4DRZA 3B1ZA 2DFFA 3DXFA 2C84A 2PRIA 5LD2B 4Y9DA 3NHSA 1K8RA 3B3JA 1SU8A 5PNTA 3CC2I 3HUDA 3VSBA 4AICA 2WP0A 4YH1A 2FW0A 4PW0A 1FYWA 1UBEA 4IRUB 1AUQA 1OI4A 2MSEB 2YTZA 3QA3E 3BPVA 1I2DA 1RT9A 1X4OA 1BMTA 2MYNA 2X5OA 3B36A 5AWFC 2CLCX 2QMHA 3HRHA 4BE4A 1PUEE 1N3YA 5COQA 2WTUA 1B8VA 3OIQA 1N2OA 2YFQA 3WLHA 3X1DA 1JLLB 3HA3A 4IJVA 3WDKA 1NV9A 2ZWPA 3OA2A 2HPIA 1NZDA 1TYCA 1BEEA 1F0PA 2BFBB 1BBYA 1OIVA 1XSVA 1CQIA 2JZNA 2YVAA 2NQ2C 1E59A 4U0WA 3QPHA 1FSFA 2X1VA 3E5NA 2CMFA 1D4OA 4G0QA 5KTNA 1QRUA 3EVAA 1W8IA 2Y0CA 3EW7A 3JW4A 3ME5A 2ZUFA 1PEDA 3THXB 1FRFS 4JD5A 4X63A 3TGLA 3TLAA 1X8XA 1YE3A 3PD0A 3QFCA 1TKBA 1U80A 1FMWA 1LTHR 2JSCA 1VMDA 2JKYA 3QXHA 4JJ4A 5DMXA 2ZRMA 3ZI7A 1AVTA 3FJ1A 3FTPA 1URPA 4QUAA 3JX9A 5I7OA 4YHHB 2I4MA 1HPLA 3PQ8A 4HT3B 2X51A 1SH7A 2Q2QA 3NC0C 3R76A 1H2ZA 4F4DA 1AO3A 1ODLA 2V4UA 4L57A 1BJTA 2EFPA 2ES4A 4CT4B 2CQKA 1U2GC 2XDQA 4XN3A 3WU1B 2VVTA 5DDGA 2HMAA 2YZ2A 4Y2UA 3KP3A 2EW8A 1QZEA 1FY7A 3GTJJ 1G7CA 4H1TA 5LYJA 4JX9A 3PXUA 2L42A 1PUXA 1XA0A 2WG0A 2ZUTA 1P9OA 2B83A 3RLFA 4CQLA 3TE7A 5JMTA 2V9KA 4LZJA 3NU1A 3WDLA 4NBQA 3KJXA 3TW8A 2OD5A 2PMBA 3STTA 5G3ZA 1D1AA 3A0HC 3UK0A 1EESA 1DAGA 2FW7A 1CPYA 1WULS 1LV7A 2JH8A 1QP8A 2WWXA 4GC9A 4XLEA 4H3VA 1EK5A 1W94A 5EL0A 3VBCA 1O9GA 1NASA 3IDOA 3QYEA 2N9UA 5JS6A 5KOHA 1X1CA 2ZIAA 3BA1A 2R7FA 4YAOA 2RQQA 1WJEA 1V96A 2R6FA 3KB2A 2VHWA 5IEJA 1AGPA 1X87A 5IAEA 2WA0A 2PGJA 4YAEA 3U13A 4EYQA 4MEYF 1WXQA 3HYLA 4PFOA 2HF7A 5ERGB 2AO9A 2EKDA 5J4KA 1QFJA 4ND4A 2VUHB 2LF7A 3B1VA 3D6MA 2W00A 3BG7A 1WWKA 2N0SA 1MEEA 3H42B 1WHUA 1GCAA 4B3TB 4J00A 1T5OA 2BTQA 1HMYA 1V26A 1FMCA 1HDIA 5DXAA 4BDSA 2NOAA 3AEUB 3UGKA 1TEXA 1V5GA 2V6IA 3FDFA 1X1PA 4M87A 2NACA 1F14A 4KQCA 1EFRD 4PZLA 5AJZA 5EPUA 4C4AA 5CDGA 3DTYA 4OHYA 2HDWA 2ERXA 1M1YE 2A0KA 3IBYA 3FK7A 4GAEA 5M34A 3X3HA 4NPHA 1WMDA 2FRVA 1LU9A 4YCAA 1IONA 3B5IA 5HS4A 1XDGA 2PLFA 1KIMA 1L3LA 2HZ7A 1U5TB 3S5JA 3A7EA 1SELA 1A97A 1WCIB 2BR3A 4AWBA 4RUKA 2JAHA 5BNWA 2XCTB 1ONNA 3DE4X 5IJAA 1Z33A 3BTCA 2XMDA 5IBQA 5JH7A 1FYLA 1M75A 3KX2A 1PP4A 2FN4A 1JBKA 3EXIA 3PO3J 2KP6A 3FMQA 1FOKA 3L0BA 3LH5A 3NHUA 3ZX5A 4J0JA 5I7AA 2APJA 1NXXA 2ETHA 4BKQA 2R6ZA 5LMNB 4YAKA 2Q3FA 1NULA 3DEJA 3N0VA 5JQGA 2R8ZA 3Q3JB 5AI9A 4IXMA 5ALPA 1CXZA 2KISA 2V6BA 1F43A 2X0JA 3GG9A 1MAVA 4LTNA 3SM3A 1KYZA 6ADHA 1MEOA 2AQIA 2PTHA 4FYMA 1UT5A 5SYNA 4NJOA 2WV0A 2M0CA 3QXSA 4BV3A 3AESA 4TMVA 2J6BA 1L5OA 2ZYTX 2AL7A 3NH6A 1IZ1A 3PV0A 4ZKDA 3O2SB 5IYZA 2C4UA 3HCRA 4R2MA 5F5NA 2ISSD 5DHQA 4KPGA 1QK4A 1QTRA 3S5UA 3N07A 1JWAB 3D81A 2WY2D 2V4JC 2K2QB 4LDPA 1XCPA 3GRVA 1Z18A 2ATEA 3F6SA 4YUZA 4RAYA 1EVKA 5LGNA 3HSRA 1IHXA 1ZN7A 4JBIA 2C98A 1YJ5A 1IUOA 1AIPA 5CXQA 5HRAA 1K06A 3VO2A 4P38A 2OJED 4BCBA 4DSOA 4UCXA 1YQGA 3COAC 3U61B 2I0FA 1FU4A 4I1VA 4V2GA 1UH5A 4IOCF 4IHQA 4OEHA 2ZJ4A 4W8OA 5ALFA 5ALMA 1OGJA 1QS0A 1M67A 2WJWA 3SOPA 4JV5B 3H1CA 5D5WB 4DJ5X 3ZU6A 4OXYA 3ETDA 1L3BA 3FBWA 4TKMA 2QL5A 4ZYDA 4I4TF 3A4CA 1H8HD 1PO7A 2QJRA 5K5RA 2X5NA 2Z2JA 3CF6R 3MJ4A 4MQEA 4M8LA 4X20A 3DWLE 3BGDA 1Z25A 5J1TB 2VK1A 4C0JA 1M66A 1NSFA 2IEGA 3L6CA 4MRMA 3N05A 4RTSA 1MENA 3KJQA 2C8JA 3ZGNA 3DFUA 3HA7A 3ND7A 2NYRA 2DZDA 3QH4A 3ZGZA 2AXQA 2L69A 4E5SA 1AKTA 1NVVR 1O0CA 1G8GA 2ZIWB 3AKYA 4OA8A 3S2SA 3TZQA 5F12A 4BFVA 3DOCA 4B7XA 1Z6TA 1EUDA 1TBXA 2XOXA 3RM3A 1FT9A 2HPHA 1K78B 2AWOA 3DZJA 4PYIA 1MBFA 2WTBA 1ZJJA 1JALA 1KIAA 1KVRA 2WEKA 3PEFA 4EUEA 4I9HA 4LA4A 1WETA 3E48A 3CSUA 4BU1A 2YJ5A 3SHFA 1Y3HA 4JB3A 1GNPA 2IUFA 3P9YA 3C6BA 2B99A 4FONA 4CQNA 2QD3A 2XQJA 3MLEA 5AH0A 1OY1A 5E4TA 1JT6A 1LDJA 3M4OJ 5T6MA 2P8JA 4C3VA 2PJDA 3FH0A 5C4MA 3DBRB 2QJFA 4L78A 2W9XA 4WN9B 4CETA 1TWCJ 3SEFA 3ZDAA 1HDCA 3UGQA 2J9GA 4I5GA 3D5EA 2FEPA 4WPGA 3QF4A 1EFRA 3H84A 3EPJA 1RCUA 3ZUGA 4KGZA 2LK2A 3A8TA 4TUYB 1D0VA 3HCNA 1O58A 2O3FA 1Y7TA 4OYYA 1CZKA 4MS4A 4TTJA 2PUDA 2PUGA 3R6WA 1MHPA 3QWBA 4QATA 4P9UA 1H4SA 3KD2A 2PMDA 2H63A 3ZV7A 4TYQA 4MW5A 4D8YA 4YUVA 5JZMA 1HO3A 4L50A 1DAHA 2F5DA 1HMPA 4F71A 4FB5A 4ZZDA 1LXCA 3PTAA 1MRNA 1VYHA 1XZEA 2BISA 2ZRJA 4YECA 5EHXA 3OEWA 5EJMA 1RC8A 3NCHA 1E2KA 1P62B 1SPXA 2IHJA 2JBAA 4AJHA 4YCLA 3HP4A 5A4FS 4MX8A 4PXAA 1Q44A 4UXIA 4Y6RA 3VR0A 5M5YJ 5JOQA 3F5FA 2MSYA 3UNGC 2GOYA 3JYOA 4HADA 1O4WA 3FXOA 4IFIA 1JVSA 3RYCA 3PR1A 3B60A 1QE5A 4U0JA 1UC5B 2CLEB 1EFPA 4BNHA 1WAMA 1VCHA 821PA 4OIOF 2GJ8A 2Y93A 3RLIA 4ZEXA 4G94A 4FXPA 2Z8YM 1N5DA 1DQUA 1NMXA 4FGSA 2E18A 3AG3H 1DBRA 2HR1A 2F3TA 1IIBA 3R3XA 2B94A 1JDPA 1QP4A 1HFEL 3G2HA 4N18A 4HNAB 4OUDB 3ZNOA 4DYDA 2C2OA 2GYYA 5MN5A 2YWXA 3BD6A 1R6VA 3OA0A 1CKEA 3JZDA 3DZHA 4IZHA 4RMIA 3KFXA 4U3JB 4WVFA 5FEMA 2G4VA 4JC8A 3W3CA 4PFJA 3ZHZA 3CVWA 2BGNA 2H6BA 2KRHA 2XCOA 2F3UA 1BNCA 4RA9A 3TLMA 2BFOA 1SD1A 3MSXA 3P4UA 4JVNA 4X1OA 3NWPA 3N5CA 1WG8A 4RD1A 4RB2C 1PR2A 1Z83A 5J8CA 2HW8A 2RQPA 2LDXA 3QVJA 3W2GA 4YK7A 2P3SA 2XXBA 4A8JC 5F76A 1ENYA 1RLOA 1FUIA 2GDZA 3TDNA 4UTXA 2VJMB 5LIPA 3GJZA 3BXPA 5JXHA 1PZEA 3KVOA 3E5MA 4G5HA 3GLGE 3BMCA 1JLMA 1WB4A 1HC8A 2WD7B 4DCOA 3WLMA 3E6CC 2E1MC 3OQHA 5H5JA 2PKEA 2D2IA 4IXNA 4MVJD 4TKUA 1JGSA 3OC0A 3HJCA 3TOXA 3VI3B 2VPIA 3H19A 3MYRA 4FCWA 5TQJA 1AS2A 5KBYA 5LR6A 1KQ0A 4GPD1 4PBTA 1QXSA 5HJ7A 3GD7A 5EPEA 1H6BA 3W5DA 2WYOA 2GA2A 2BLLA 3K4JA 3DD5A 5T3UA 1PT6A 4M36A 1ETQA 1OXMA 1S7EA 1X15A 2Z5GA 1E7SA 2C4WA 3DA8A 3L7MA 3ZUPA 1E0AA 4CEIA 4BFWA 3BCAA 2JHCA 4H9GA 3TSCA 5C7LO 3SJ7A 2XOKD 2E0IA 4MIYA 3W05A 2EQ5A 1VLJA 1YVEI 4HA8A 3HG9A 4LF5B 1A27A 4IDGA 3EDOA 3L07A 1KQ8A 5FWYB 2BTQB 3M4JA 3P71T 4YP1A 3QELB 4CL3A 1LW7A 3EEOA 1S5LC 1R00A 3ENNA 2LBFA 1K8QA 2BGCA 5GTHC 1TAHA 1CUYA 2QX4A 3AOEC 4PZZA 2DOFA 2QLLA 2L9SA 1ADGA 2ZSEA 2HYGD 2WWTA 3EQ9A 3OTQA 3ZWWA 1DWQA 4XM0A 4R0MA 1U63A 1MIHA 4BE1A 1KTIA 1EE2A 3ZQHA 1OBCA 1RVDA 2KW5A 2RB5A 3AB8A 3I1IA 1FFCA 1MT3A 2REQA 1O6GA 2YL2A 4CZ2A 2DMQA 3KO8A 1K7AA 2BF7A 3F9CA 1DC6A 3MCVA 5HZKA 2BBSA 3QAHA 2DOKA 2WZBA 2FWIA 3LQKA 1CDDA 4YLGA 1MHTA 2NZ2A 3FSEA 1N0WA 3OMXA 3FY4A 4L0MA 4C6RA 5KX5B 2Y71A 1SXQA 1E1YA 1YNSA 4FE7A 2H4JA 3CH7A 2RK3A 1NPDA 3RS3A 4MGRA 3ZV5A 3L2QA 3IPCA 3NONA 4DYRA 3BTVA 3QLEA 2X6WA 4J49A 5KSZA 1GSHA 1KR2A 2H1WA 5L3GA 1A8QA 2R7OA 1U0NA 1YITI 4A3KJ 2ANBA 1XMPA 3AG2H 3VC2A 1XJQA 4A73A 2ID4A 4IDQA 4UEWA 5E6SA 1C1DA 4LVOA 5E3OA 1A7UA 2K9LA 4O4LA 1CUGA 1GL7A 5EJEA 1VKNA 3UMSA 2YFYA 3C43A 1TDJA 1UR5A 2XCSB 3OVMA 1OFVA 2EEZA 1DQPA 1IBSA 3VYVA 3WK9A 2BMFA 2MINB 3X2FA 3R0JA 3ZCRA 2B8WA 4GVLA 4ENRA 6PFKA 4JEIA 1JT9A 4BLRA 3U1KA 1J8QA 4LOIA 4YV1A 3LPAA 4GWKA 4BQIA 2DLNA 4FDLA 1QWOA 4FYYA 1S2LA 5TVKA 4YCSA 1IK6A 3EAFA 3VSKA 1IHDA 2ZKLA 1AUVA 4IHWA 4NESA 2X85A 2QN8A 5DX0A 4KO3S 4B76A 4X92A 1PWXA 5K2MA 2PH1A 3VR5D 5C46F 1DPRA 5BN4B 1UZCA 4URYR 1SPBS 5EYRA 1XDDA 4PJMA 4CLEA 1ODKA 2IYVA 2R8PA 1KKMA 5HVQC 2AG0A 4CCAA 1QRTA 1M2NA 5B1EA 2A9RA 4WJZA 3A4TA 4LHYA 1Y8RA 2ERYA 3MTGA 2VJBA 1JLHA 2HSJA 5F5LA 3ZQ6A 4ZICA 2ENUA 1HX7A 1SEPA 5HLTA 4XR9A 2XAUA 3WTUC 1FP4A 1R8JA 1ORHA 3NHWA 4Q1FA 3LSTA 1LC3A 1PT5A 4DJFC 4QTXA 4F72A 3ZHCA 2PRYA 1IVYA 4HXFB 4TMXA 1JMYA 1OGYA 3IBTA 2BFFA 3CEPB 2Q5LA 3R8CA 1ATZA 1MVOA 1XMAA 1F4VA 1U7PA 2LR8A 4TTIA 3JWIA 3LL4A 1BQ3A 1CBUA 3GJRA 4QRDA 3CQZJ 3QEMB 2TMGA 3O03A 1KEZA 5E4FA 2WSSA 1VE1A 3P96A 4AURA 1L8AA 4FNOA 1I3CA 1M1YA 2OBNA 3CGWA 3DULA 1ZG3A 5MGBA 2P90A 2VDJA 2ZPTX 4K6MA 3AR3A 1FPMA 1E3MA 1JIKA 1PZFA 1J9ZA 1E7QA 1II0A 2PZFA 3VNAA 2ZKZA 5I8ZA 4JX6A 2GF2A 4I55B 4RVUA 1NVFA 1QG4A 4I99C 3HJFA 4NENA 1S8FA 4NQZA 2GXAA 3BQNB 1XFDA 4XSXF 2BY2A 1F9EA 2OEPA 3FM9A 5DW3A 1XIVA 3W1VA 2OBFA 5GTIC 2R5ZA 4FBLA 5IFLA 3U4MA 3R6SA 1D04A 3HN2A 5JYEA 3NDPA 3G2LA 2A68F 4UBIA 2H2GA 5KKAA 1IDZA 3S29A 5B64A 2FPOA 4YV0A 5FEUA 3KZZA 3EETA 3ECHA 2RGNC 3O3NB 4HGRA 1K6JA 4MB0A 1OFUA 4RD3A 3QVOA 4N3BA 5G3YA 3VPHA 4N3AA 3IP1A 3MJVA 3TKAA 3ZK8A 3EZ6A 4RS4A 2IXSA 1IH8A 2CB9A 2BE9A 2Z43A 4TL6A 5EMJA 3M9AA 1R9GA 4YP6A 1SFKA 4HVTA 4NG4A 3E6AA 2ZSBA 4MI6A 2PDAA 3L1UA 1Q6YA 3NIBA 3QY0A 4WK2B 1P4XA 3THYB 4DLYA 3ZHVA 3W6PA 2A88A 2QMUA 3PC3A 3UCEA 1W4AA 2IP4A 1R3DA 2XCQA 3ZHXA 2P6NA 1V2GA 3ZLJA 1C3XA 1Z5NA 2E5ZA 4LCEA 3D7MA 3BT9A 4UDOA 1JYEA 1R0KA 2O2ZA 2NO1A 1YJWI 3MOSA 5F9FA 1DC8A 2YV1A 1N36B 3RSGA 2I3GA 4ZC1A 1E58A 1SRRA 5M2QA 4UB8C 3KR0A 1X7ZA 2H1RA 2G25A 2QGNA 3AINA 1N92A 3NP7A 5LYYA 2PL1A 1XD2B 1ZUNA 2C3PA 3FWHA 3HJNA 1BDHA 2FXAA 1X7DA 5AFSA 1JEQA 4W1PA 5JWOA 1N2CA 2ECCA 1RQPA 3V8JA 2JHAA 3HV0A 4DA0A 3F8FA 1P0MA 2E1NA 4DR5B 1W5BA 2AR9A 5KTTA 3DMFA 2AYYA 2RFLA 1JQBA 2IUTA 2QAGA 4N5HX 1OPRA 3E6MA 1B3RA 3NBZC 1IBRA 3RU3A 2O2CA 2LKPA 5SZHB 2GBFA 4HQLA 2IT1A 2AKYA 2C83A 4W5TA 2CJPA 2P1DA 4A6XA 2XXAA 1HOTA 1O3RA 3L7NA 3M4XA 4DBVO 1SG0A 4LLLA 3DAPA 4FX0A 3RABA 2ECFA 3P2MA 2G3YA 3ZZMA 2WADA 1XYYA 2A8YA 2B25A 2DQKA 1Y42X 3NWBA 2EA2A 3PUYA 1Y5NA 1YRYE 4K9NA 1WO8A 3UAXA 5C8YB 1B74A 1WSAA 3N2ZB 1DADA 4PCQA 4M83A 4MW0A 1N0VC 1RQNA 3OQOA 2QRLA 2B82A 3D7RA 4PLZA 4YRTA 4IX9A 5K99A 1LV8A 2AJTA 3OLQA 1F1JA 2NXNB 1JHRA 1SQ5A 2CK3A 3H97A 5EEGA 5UKDA 3WMWA 1KFJB 4EYSA 3DKIA 5E4YA 4X6LA 5F1YA 2C6YA 2P11A 5B1DA 4EVQA 1PJQA 4XLZA 4BMDA 4TKUB 4TXMA 2FW8A 1X7WA 5JW6A 4LK3A 1GZHB 3GFFA 1SCAA 2IE0A 4UUMA 1I1NA 4GYJA 3Q7TA 1TO2E 3WLLA 2C2BA 2PWPA 1YBVA 2WMOB 4JJFA 3RZOJ 3A9VA 4FS8A 4CCWA 3SBDA 1OYIA 3CLRC 1BWRA 3F72A 3JRAA 1VL1A 4UXHA 5AT1A 2A9KA 2VUSA 1EVZA 2XDYA 3ABKH 1ESNA 3FPBA 3MW8A 4K05A 5EFOA 5EGSA 1BCSA 1D0ZA 4WF2A 4DIMA 1KL7A 2I3DA 3K0AA 4PYMA 5I8PA 1MAUA 2Z6VA 1NQAO 3F21A 1E5LA 2HWVA 2R11A 3HA2A 1X7YA 2AVDA 3EN0A 4KLRA 3HTUA 1NVMB 1Z7WA 4JUAA 4D92A 3F5MA 4OUKX 4D41A 1UHSA 1R9JA 5BV1A 2GKGA 2XF7A 2HPAA 4C4SA 2ETXA 4KRXA 2INGX 4MW4A 4DMCA 5L3EA 4CIBA 4KR7A 4QICA 4R2KA 3SCZA 2A05A 2IWRA 3SHWA 4BL5A 2JDIA 4I6EA 2GYVA 5ALZA 3JCUC 2QUBA 3AM3A 5IT4A 5DYNA 4JJIA 4WOPA 1GU1A 1WDTA 3FR7A 5E7MA 1ZW6A 5HUJA 5DYMA 1GQYA 2QXTA 2NGRA 4IGKA 6LDHA 5AVQA 4J29A 3BROA 2HZBA 4NOMA 1B0PA 4JLKA 1AT1A 4EM6A 1MCZA 3SDZA 3VPDA 2F3QA 1RYNA 3T9CA 1DEOA 4RC9A 4AO6A 1DU6A 2OU2A 3FTCA 3QF4B 5CCBA 3CURA 4YHBA 2E5LB 1WA5A 2CHFA 3HLKA 1RHRA 2FH5B 5GJVC 2ZUWA 1LVGA 2EZTA 2W98A 2XKJE 3H17A 3ADCA 2KRFA 5EF6A 1K6EA 1DJPA 4HATA 4RKWA 4X3OA 1JT2A 4XVRA 1P0IA 3INGA 3KVVA 3WJ2A 2QX8A 1JIUA 1U02A 1RRPA 3K4QA 1TD9A 1TEHA 2OTJI 2I71A 2YMLA 4HK4A 3OSUA 3RKXA 3KSRA 3DYIA 4J03A 1EFDN 2FOKA 3NRVA 2Q3MA 3LTNC 1B7GO 2Z2XA 4I5FA 3VJMA 1ST2A 2O8BA 1UF9A 5A6VA 1R7JA 1QLHA 1Q0QA 3E7PA 3RKRA 2C99A 4N47A 1PL0A 1Z8HA 2IJGX 1T10A 4O1MA 3LLCA 4V0LA 2YXNA 2JQ7A 3CO5A 1LDEA 1N2ZA 3EXFA 4K81B 2W4QA 3T7KA 1EUDB 2J6HA 5ILSA 2WVAA 4LECA 2WV9A 3IEKA 5KNDA 3CMMA 3ZYZA 2R8XA 1C4OA 4BVHA 2RE8A 3G71I 1RQGA 2OXCA 1I6WA 2G5PA 4A6DA 3DTIA 1P9WA 2XYGA 3SEQA 1U2WA 5K0LA 3X0DA 4HAWA 1FVXA 2NUAB 1TFRA 2C92A 5CJPA 1GZDA 5E7IA 4KMFA 3EZYA 4M7WA 4YP5A 2XSJC 5JSYA 2YS7A 4IVPA 1I1HA 1E9VA 4OYRA 2GPTA 2P6PA 2ZQ5A 2RDMA 5IAOA 5ICEA 4XGNA 2ZJPF 2Y0SA 2P91A 3DDUA 1I94B 3HBFA 4NEQA 5HODA 3RS4A 3WBKA 1HNWB 4P4NA 4QLBA 3JD1A 1CE8A 1DTSA 2MMGA 2KIFA 2QNRA 1D0SA 5CX1B 1VSQA 5FL7D 5AXBA 1RSZA 3KSAC 3OYHA 1PD1A 4Q4HB 3NQ41 2I7VA 2JZYA 3RJTA 4HSEA 1RRFA 3TD9A 4OFWA 1WGXA 3SR4A 3VX3A 1DEAA 2FMHA 5DNYB 1OXSC 2C7RA 2LH9A 1T5LA 3CN7A 4GOJA 4HRXA 3U19A 1GTJ1 2JJMA 3BSSA 4HQFA 4XB2A 2Q7XA 3Q11A 2W71A 4C88A 3GDGA 5FKMA 4LOCA 1CY2A 1S0UA 2Z9OA 1B0ZA 3M7GA 1BA3A 5G4KB 3PPIA 2J3EA 3VPSA 3WV4A 1TGYA 5K8VA 5DI9A 4KCGA 3ZCVA 3A27A 3HU2A 3NNSA 5HNKA 2RIRA 4HBGA 1Y4UA 3GGSA 1L6IA 4M1KA 3R7SA 4AG6A 3BTIA 4HF1A 2ETVA 4LYYA 3FDXA 1ETUA 2FZKA 5ABPA 2NV6A 1SC6A 4EGAA 4CBVA 3T12A 3EXHA 4TROA 4BVEA 2PX9A 5HNFA 2WWIA 4Y6PA 2CLDX 3GP3A 2PBFA 4H4CA 5AK5A 5LUBA 2QGZA 1TPYA 4ZAYA 4PGFA 1NBOA 1UAAA 4PG8A 4L0CA 2CSXA 3M3DA 2FEZA 4ITUA 1HFWA 2OO5C 1RZ3A 4EQZA 1YU9A 4G0WA 2QJWA 4PG7A 2HUPA 3QVSA 1RIFA 3IPLA 2H18A 4H0CA 3IDZA 3TSOA 3IUBA 2FPIB 1Q0RA 2EFHB 1EDOA 2YZKA 1LWOA 2CVOA 1VG9B 3A4VA 4BFZA 4DMRA 3PICA 1D0IA 5E9WA 2GAIA 1XN7A 4IRIA 1EH6A 2H6EA 1TT5B 3BDVA 1I10A 4MYHA 4YJ3F 4D4IA 2BDTA 5KU1A 4ZTBA 3ZE1B 4KWCA 3NASA 3PHBE 1V8ZA 1QH8B 4NBVA 4GDMA 4NCNA 5JAOA 3PFYA 3H3FA 3K05A 4UU0A 3S7TA 1UELB 3FXLA 5L3BA 1R15A 2ATVA 2B1GA 2BCEA 3BMXA 3KWLA 1Z1DA 5FA8A 1HW2A 3A6DA 3VISA 4UASA 3O8RA 1Z4LA 3IUSA 4OHMA 4LBVA 1ZVQA 3W5SA 1G6OA 4DQXA 3VDMA 3DU5A 2HI3A 3H3UA 4KN5A 4OU5A 2DA1A 4QVKA 1CULC 2GN9A 4UE3S 3AEUA 3DV2A 4YXFA 3EDPA 5KC9A 1CFZA 2P0YA 3RS8A 2EW2A 2WAXA 1K4YA 2IXDA 2QAGC 1JKPC 2ZDGA 3AUTA 3FG9A 3NHYA 4LI0A 4V19K 4U2DA 2FW9A 4JIGA 2BLNA 4ND2A 2V8OA 1E1CB 4WBNF 1QGZA 2POCA 2ASEA 2WBMA 3F1KA 5IC4A 3H5OA 1AQYA 2MSCB 1AB5A 1B93A 3MAAC 3RHFA 4TUYF 3RJ9A 3RJMA 1SVSA 2IIQA 3L4KA 4C29A 3TBIA 4IO0A 1GFWA 4LITA 4REQB 1JX6A 3EH2A 4R2IA 3R5HA 2KFDA 3HTSB 2GR9A 2WMDA 3IILA 2PZBA 1QIMA 3A9SA 1ULSA 4JBNA 4JVMA 3SEAA 3OYCA 4DA6A 3VRHA 2Z2SB 2IVZA 4W5OA 4OPMA 4HMPA 3LA2A 1GOTA 1SKUA 5T67A 2OVBA 1YJAA 4WA7A 1BCRA 3AFGA 4YT4A 4GPTA 4GP9A 4YONB 3DVAA 5C5EA 3I61A 3L8FA 2IDMA 1VMAA 1DMSA 1XZDA 1KVUA 2FPUA 2G67A 4JBYA 1SC9A 3KM0A 2ODQA 4RH1A 3KJNA 1RWQA 3UJBA 1VPTA 4LAFA 5FQNA 4E7ZA 4XPIA 4LWQA 3K9FC 3N59A 1TYEB 4HRYA 2XUBA 4XEUA 2FY8A 4CMJA 5KSOA 1XCLA 1N0UA 4TKVB 4WZ6A 2BZSA 1RJGA 4BOYA 3D6FA 2XOEA 3JAMK 1GUUA 4I1RA 1P2SA 1DO8A 1XTKA 4PC1A 2P9GA 1V3FA 5JD5A 3WL4A 3U3XA 5I9MA 1E9RA 2QLBA 1KR5A 5KZMB 5TQ2A 2ELHA 4CICA 5JLJA 4C3IJ 1CUFA 4MV4A 2ZR8A 4DEVA 4MR9B 3T5TA 3F6EX 3N3BC 2QROA 4GVXA 4PEVA 1HQCA 5B66C 5KS2A 1Y7LA 3AEKA 3D8BA 3SOZA 3AVXA 2X8JA 5AD1A 1U28C 2EJTA 3CGGA 4YQZA 1RUNA 5K5EA 4E5MA 2JIOA 2PU5A 2BJHA 3NHZA 2HU8A 3CNBA 3T52A 1VM6A 2JD0A 5FROA 3LOUA 2QN3A 2JLSA 3I05A 3D5TA 5H9VA 1AURA 5EIAA 2V6JA 1QKKA 1FOXA 4TLCA 2ZQYA 4POOA 5I7WA 4B3JA 2YH2A 1EFCA 1NTOA 1COWA 2PT5A 2YN2A 3AUAA 3D2CA 3GEMA 3ILHA 4GWLA 4PZYA 4XPIB 3P2YA 5AW4A 2O2SA 3PUHA 3HH8A 3OAAA 4ESEA 2CDRA 1QPZA 1MGPA 3BTUA 3IUPA 4U5QA 2C9ZA 4NMLA 1UXHA 2EINH 3NORA 2VKTA 4B2PA 3DQPA 3GC6A 4HC4A 1W76A 5IVKA 2JUGA 1K61A 1XCGB 1MB4A 5DV9A 2B63J 4F3CA 2G07A 2ID6A 1KF0A 4HFNA 5DM60 2YV2A 5B57C 2XT0A 4BVLA 1H69A 1N7JA 1R36A 1L6RA 3FMOB 4BMOB 4EG6A 4BU2A 3PFIA 2WJAA 3IPYA 2JLBA 2BTOA 2DBZA 4PJ0C 2QP4A 1NMQA 2HUNA 3N0RA 2E4WA 3F7OA 1RWNA 4NVRA 4UDNA 1YI2I 4BTVA 1HKHA 3SQNA 1DKOA 2D59A 1W581 3S1MJ 1UFKA 1NI5A 1TM2A 3H16A 3JYHA 2IBMA 4RLQA 3ICEA 1Z3CA 4FFPA 1H3EA 3EF0A 4WKOA 3ZG6A 3B5EA 2V9VA 4CKBA 3BG6A 1NVEA 2O6HA 2R7WA 1JEYA 2IOQA 1TWHJ 1CWUA 4G1BA 4XNFA 4O63O 1T08B 1TZMA 3TS1A 2B3DA 1AO0A 3BC8A 5JMWA 4R1NA 2GPYA 1K5DA 1MO5A 1WVMA 1UZUA 3QXJA 4EBFA 1KO4A 2D0PB 2JFXA 2X1DA 1U3CA 2NVXJ 1P4WA 3B6IA 2VBCA 3ZN0A 3UMYA 2HSWA 2VJCA 4FINA 1U9IC 4NYJQ 5LU9A 2Q9AA 4QLCU 4FFSA 4YV7A 2RAUA 4I8IA 5HIAA 4RFSA 2Q5OA 4NY1A 3EXFB 2XX3A 5DHAA 1M34B 5C34B 5CXXA 3AUUA 2HHLA 3K0LA 2AG1A 1QM5A 4EY8A 4CUGA 2QG6A 3HUGA 2O8KA 1WSBA 3ZXIA 3C1DA 5LLSA 1KU7A 3OCVA 2B9VA 3RPEA 2QTWB 3MMYB 5CGZA 3S8PA 1YHQI 4Y52J 1J39A 2B6HA 3AX6A 3KR2A 4LSGA 3V32A 1WE2A 3R61A 4YRQA 1V9SA 2B8JA 2RGNA 2Y1GA 2EG5A 3DBOB 3DZBA 3VOEA 3D2BA 3L04A 3OM8A 4MCHA 4KQ6A 1H85A 1GZ3A 1GU7A 4ZT6A 1FIAA 1DZIA 3G1TA 2JF0A 6PAXA 3PNMA 3ZRGA 4I09A 4YFXF 4M9CA 5TQVA 3I4PA 4F5EA 2GFHA 3V34A 2E34A 2REXB 3QPAA 1J2UA 2YJZA 1J1ZA 3LSYA 1TVEA 3OHMA 3C4VA 1ZU5A 3JQDA 1JQ3A 1Q1EA 1SZPA 1LDBA 3D5QA 4ZQBA 2ZUUA 2BE7A 3LP6A 1O0BA 2AQEA 4OX9Y 1T9BA 1TZKA 1SOAA 1U4NA 2UUOA 1YQEA 3I32A 4B82A 3JQAB 4MGYR 4FHTA 3AFIA 1BWQA 3K1TA 1I2ZA 1K7EB 1U0RA 1NKVA 4TMTA 5FUXA 1X8KA 4EA8A 4CXFA 1NF3A 4B6FA 1JA0A 1KYYA 2OHGA 3QEAZ 3UWKA 2V6CA 2A6TA 1Z0ZA 4AMUA 5JCPA 2R48A 4ZYWA 3DOEA 3PE3A 4B34A 3O4VA 4HBLA 2W2LD 2IEDA 2VODA 2XADA 1AV6A 3CCCA 4G0YA 1RJDA 4M0CA 3I0NA 4E07A 4O4JF 1J2TA 4G0NA 4HH3C 1LX6A 5D5VB 2V6MA 4FGJA 4G8JA 5AKYA 3NAQA 3FZGA 5ALLA 5LA6F 2CSOA 5KCMA 3G9TA 1V8DA 2M8EA 1Z0UA 1UFRA 1WABA 3GPBA 3KZYA 4C7XA 1BOAA 1GTVA 5ANRB 1Y48E 4EJ0A 4N4OB 1P6RA 1K79A 4GM4A 1USVA 1TW2A 5EA2A 4D4HA 3R41A 4WY8A 1WPQA 4ND7A 4MFEA 3HFGA 1GZ5A 2PWZA 3EPKA 2JGDB 4BQOA 1ISMA 3LZCA 3OIVA 5EESA 3ZK9A 1P7PA 2NSYA 1HDYA 1CNMA 3HDJA 4IHYA 4RZIA 4UM9D 4G41A 3THSA 1NZFA 2ZATA 5JSZB 4MVJF 3H87A 3G6KA 5JH7F 3V8KA 2WG2A 2JHFA 4NMXB 1F6BA 5E4JA 3GUDA 1BMFD 4WZAA 1KEKA 3OI7A 2XKOA 4ENMA 1F4PA 1H94A 1KAMA 4CF4A 5K20A 4MI9A 1C3EA 1IXRC 4L8YA 1FU7A 5E3LA 2FPPA 5KSYA 3U44B 1GPYA 5J5VA 1P4HA 1J9IA 4JKIA 5K4GA 1JYFA 1HE8B 2VOOA 1S8OA 2IUEA 4O4IA 4Y9SA 3M0EA 4GYGA 5AICA 4NHJA 4RA2A 3QQAA 1LEBA 1T0HB 1NI3A 1HT0A 1HW5A 1KMMA 1VJGA 1W46A 1XWIA 1ZM4A 4XARA 5IBPA 1WLSA 2JJYA 2H92A 1Q0LA 2CNOA 4BV2A 1FQWA 4ENUA 4UTPA 4HPJB 5TC4A 1R4NA 1E89A 1PLJA 4HDSB 2ZANA 3AW8A 3LXMA 3FPFA 4KPEC 2VAPA 2QUJA 3EEQA 1IHYA 2XJ9A 2ZLBA 3ESXA 3SZRA 4CCYA 4Y3OA 3GJSA 1L1FA 1NXTA 1YB2A 3L8ZA 4NZMA 3GTGJ 5ICSA 1PE0A 4HZUB 3L6OO 3OE7D 2IHTA 2RMKA 4NU8X 4CMIB 4ZTZB 1VQ5I 3JQCA 1U3TA 2J3QA 3JQ9C 3QYJA 3EC1A 1JBEA 2WZDA 3R6GA 5DLYA 5DLQC 3UV3A 4RGRA 4I1SA 2H6CA 3AILA 1Q5PA 4HNTA 1GG9A 1BHSA 3O21A 1TU0A 1XVAA 4O8CA 5GP1A 5EQJB 3ORYA 1J21A 3RTBA 3NHRA 4BC1A 4K9DA 2BY1A 2AJBA 3OYKA 4KLZA 3UR3C 2H16A 1FFEA 1DIBA 3JATA 5FD8A 3TTVA 3N0WA 4L4ZA 5DBFA 4C3OB 1HDRA 2PGOA 4Z8YA 4FGUA 1ZJZA 1X7ZB 5JCJA 3UUGA 4JLJA 4GFBA 4V3BA 3A6KA 3T1OA 3OESA 2QTVB 2FWPA 3K32A 3N1UA 2OQRA 4HWTA 3ER9A 5AJUA 4LHWA 1F1BA 2E36A 1PK7A 2CF6A 3DS8A 3PHGA 4N5NA 1DX6A 1YZVA 3STUA 5HX7A 4LJRA 1UDXA 1T5DX 1ZHFA 1OREA 3OIWA 1T0IA 4X20B 2IITA 4MGKR 3SZGA 1SD6A 1E17A 4IXTA 3F6VA 3OWXA 2GESA 3L1JA 4BE9A 3OMLA 5KVSA 1HLDA 3OZAA 4MSUA 4JOCA 1G20A 4G37A 3TINA 2VF7A 4XL9A 4UCQA 1X9IA 2BEVB 1NG1A 2QN2A 4L8WB 4HTAA 1SBYA 4W82A 5EXSA 2V45A 1RJ9B 3BD9A 2JJ2D 1FJGB 1TZBA 4FZVA 2XUZA 2YWCA 1NBME 3B2NA 5KNCD 4I50F 4F4FA 3QTLA 3ZN1A 1VI6A 5L3QB 4Y0VA 2HSDA 2VOJA 3V46A 4DR1B 2HIAA 2VPPA 3U7QB 1AZLA 5DHRA 4KA4A 4N65A 4OBWA 2WJPA 3NJ4A 1L8QA 1AS0A 1TOAA 2YJTD 4MW7A 1R5JA 1QIHA 1BIBA 5B37A 4AMYA 5HJEA 4LXHA 3QE4A 2FW1A 5CP8A 9ATCA 1TK9A 3AESB 1RM4A 4UULA 1DUXC 5CW2A 5FAKA 1M6EX 1JKFA 3MZYA 1J33A 1X7WB 3GCWA 2BHZA 3TEMA 3D4OA 3OYMA 4GOXA 3ER6A 4DIUA 2WMNB 4KSCA 2UZIR 2V26A 1TJNA 2N47A 1CVRA 1PU2A 3D4PA 2KHMA 2P5VA 3PGKA 3ZK7A 1POGA 2DPGA 2K9MA 3S2WA 3DMGA 4KNYA 1H65A 3GGJA 3H1AA 5H4GA 1KWKA 1H23A 4R1PA 4WGGA 3EZ9A 4XSVA 3QEMA 3E7LA 1GITA 2XMQA 3IDFA 2PM8A 3IQZA 3O1HB 1QBKC 2IPNA 1EWVA 1RC1A 1CS4C 1LI7A 1ZREA 4BXFA 4LPKA 5FV7A 1QF7A 1VOTA 1V1JA 1AZTA 2NTVA 2VIIA 2DTXA 2Q2OA 3ELYA 4M98A 4MZDA 4R0VA 4YFYA 5JFGA 2DEUA 1PK9A 2J85A 2QQEA 1SURA 3KOUA 2NXNA 3I6MA 3M4ZA 1E2QA 2OXRA 1K6OA 2VSNA 2ZXWH 1YL5A 3BMNA 2R6CA 4DR3B 4V0SA 4R6WA 3MTAA 3DXJF 4W7HA 4UTVA 2YZMA 1G21B 3DVRX 2Z8YA 3SEZA 2YRXA 4HWKA 1REQB 2OPHA 1NQTA 3D3QA 1GQOA 1GA4A 2OCPA 3CSDA 4HPXB 4DXAA 5JWRA 3CRZA 1JKQC 2XKAA 4US2R 2UZ1A 1SVKA 5IVIA 3JR9A 5DSTA 3H83A 5TJ9A 3N2LA 4C05A 3PEWA 1G20E 2VXYA 1FRQA 2UUAB 1ZJYA 2O8XA 4AD8A 3BMCB 1NJFA 3DCIA 3QU9A 5MN6A 3Q9SA 4HV6A 1P7JA 1N2HA 2HCJB 1VPEA 4X6UA 1DL5A 3S4YA 1F2TA 4HPWA 1UBMS 1T9AA 4A23A 3W6ZA 1ZUNB 2OMEA 4MHOA 4HMOA 3DQQA 3WMEA 1Y1LA 3G3EA 4IQFA 1LI5A 5IMSA 4RYLA 3G1OA 1WCXA 4KFTA 2VAXA 1DCMA 5F3RA 2FUCA 3ZQKA 1FC0A 4XFDA 1ETXA 5B2ZA 5KJFA 1BRMA 4MRSA 1HUQA 2VK2A 3GMSA 4L51A 3ESAA 5E1MA 3DDNA 3KP4A 4DLAA 4F60A 1TEZA 1T4CA 2Y1LA 3DP7A 3PJFA 5B3JA 2PQ8A 3WTBA 1Z7EA 4KH1A 5DYWA 1XG1A 2FE1A 4ZVSA 4R1TA 2F48A 1TTQB 2RBEA 1FNNA 1UWVA 4QJBA 5D1NA 1LFDB 4AUKA 2G8NA 4IDDA 4YAFA 2IHZA 4DNQA 5D6EA 2H00A 1ZG5A 5C37A 1OZGA 2XUDA 3D7KA 3IQHX 3K1JA 2V7QA 4I55A 4PSDA 3OZSA 5F7JA 1OMOA 1PTJC 3D02A 4AD9A 3LCUA 3PYLA 4LB5A 2E60A 1C80A 4MUIA 4QNMA 5HS7A 1NVAA 1L5FA 1GKYA 3FWPA 3O31A 2WILA 4Y2GA 4YRCA 4IUDS 3S28A 2P8TA 1T2NA 4OINF 2TSYB 4DCVA 1XJWA 2JRMA 1U8XX 2XBUA 4KBFA 3ZLUA 2H9IA 4UUVA 4PNPA 3DHYA 5I9TA 2VBZA 4RVDA 3RSLA 4CCNA 2KM1A 1KYTA 1J56A 4MUHA 2IZ7A 4R8KA 4BACA 1IEXA 1ST3A 4IF6A 3URMA 4A8JB 4CXMA 3CWQA 2G7HA 1FFBA 3FTDA 1KSFX 3OHSX 1UK7A 4LQCA 4O4JB 5EXPA 4P33A 4J3NA 4CM7A 4UQPA 2I80A 5IT3A 3TZKA 3BR0A 5C5DA 3ONDA 1J75A 1M5TA 4KDPA 4BO3A 3IP3A 1ORDA 4PXSA 4GX0A 5EFZA 2PMHA 4RFVA 1A6QA 4L18B 2JASA 3DOOA 3Q3IA 4ECEA 4TQGA 1KRXA 1VDMA 1C14A 2C3MA 1DWUA 2XYPA 3AC0A 5FYDA 3KHKA 3BR5A 3PUXA 1KH3A 1DGWY 4M9UA 5IN5A 1B8PA 1B72B 2OWEA 4KLCA 1XQ9A 1HA3A 4M22A 3VGJA 4A82A 2ZSDA 2AN1A 1L5MA 2E7ZA 2YR2A 3E8XA 3WLSA 1NJ8A 1GPBA 2I62A 1WXDA 4B4DA 1E9CA 2BW3B 1Q83A 2OCIA 3KCNA 3RC3A 1E79A 2C9BA 3RBVA 1QR6A 3GFLA 4G6QA 3FKSD 4PCUA 4QREA 3UK2A 4QXOA 3G82C 2I6QA 2GLUA 3GELA 2WHXA 1K27A 2BHNA 3L05A 3JASA 5A0TA 3OMWA 2I7CA 2FA5A 1XZQA 4U3JA 5J2UF 2ISYA 4D25A 2ENWA 2JWTA 1SOVA 1DX9A 4NAHA 4YJ2A 1E1QA 3LY7A 1ULYA 4BBRJ 3QJYA 2PBIA 3PDWA 3L9XA 1M7GA 4MPJA 4WEQA 1YB1A 3GBGA 4DMGA 5C81A 1MNMC 2YCBA 4IIFA 4UVCA 5ICMA 5ILOA 1A9RA 5FFZA 2C95A 2JIRA 1JVNA 2YVKA 4FYKA 1G8YA 4B6RA 3THWB 1N33B 2XZTA 1X2MA 2A59A 3F97A 1ANKA 1UBHS 2YBDA 2IRFG 1CUEA 4FR0A 2NPFA 1U8YA 4OU4A 2ID3A 2XE4A 3RCOA 4ARZA 3WB1A 4PE5B 2XUFA 4AYXA 4LMPA 1XCMA 3MT0A 4QHSA 1FL9A 4H1VA 4M60A 3SZMA 3E03A 3W4IA 1EMDA 3ZHSA 2RKHA 4ZDOA 3P4YA 5KTSA 2JRCA 3UNXA 2O3JA 3QY9A 5D3MB 3X1MA 1H2EA 1P2BA 2REQB 1FFXB 3CF0A 4ZOQI 3G5LA 1L1QA 4KQGA 4EFKA 3D3WB 4P58A 1SKAA 4YJFA 4G24A 2OK8A 3SMVA 2ORIA 1MJBA 2A33A 3KZMA 1YTYA 3DJFA 4EY3A 3WLNA 2DETA 4YR9A 2QENA 4WNAB 3L4BA 4AJ1A 3IIJA 1NXVA 1R6AA 3GUZA 4RJ2A 5FNVF 1NSYA 1NYTA 3IJRA 4GM1A 4MS4B 1SKMA 4OXIA 2XB4A 4OVKA 1VB3A 2YWBA 2C4NA 3C7AA 3RVOA 4DCJA 2ZSHB 4PAGA 1TUBB 4Z54A 4Q9HA 1REQA 3OF3A 1CD5A 1F2TB 2ZT6A 2EL7A 4RA6B 4WBNB 4HTFA 3KUKA 3P2OA 4P36A 4S3MA 1Q2XA 3VPAA 4IOJA 4FFDA 1ONOA 1KZ6A 3J7YJ 2AFIA 5JNRA 2HXSA 1W44A 4ZOLB 4ZOCA 3GJ0A 1RLUA 2XASA 1K63A 1U6JA 1Z4NA 3G8BA 4ESJA 2LBFB 1RE1A 1KPGA 4M72A 1PJBA 5AK0A 3X1KA 4EAQA 1G5HA 3LHDA 4Y17A 4KFRA 3AJ8A 2VJ5A 4O2RA 1BX3A 3GROA 3NGLA 3PSAA 2I54A 2QVBA 5TPZD 3R0ZA 4L3VA 3R7FA 2Q46A 2DQLA 2B4RO 3D6UA 3OS1A 4D4GA 4U63A 5BSKA 1H93A 3K4KA 1PWEA 1J1IA 1SQGA 1K1EA 5DCUA 1TYAE 1GKKA 4HH1A 4QX6A 3WKDA 4ES6A 2Y05A 5DGIA 2NU7A 4MUKA 4XUCA 1NOIA 3NBUA 1N9GB 2FMIA 4DCGA 7REQA 1E0JA 4GUAA 4WLNA 2NTEA 4MLDA 1WCMJ 3IAUA 3MMNA 2FV8A 4M0KA 4ZZ0A 4DADA 3ZR8X 4JYZA 1UBSB 3FIJA 4KIUA 2WF7A 1XNRB 5HGXA 2ZBGA 3C5VA 4OI1A 4B85A 1NJ6A 4RY2A 3VDRA 1ETOA 2OZEA 5JSHA 3ZBUA 1EVJA 3IIIA 4YNBA 1QG0A 4GBED 4NK4A 5I7VA 4UBLA 2PSDA 1GGHA 1N5JA 1XCBA 2DBBA 2LOOA 1TCUA 3ICCA 3VC3A 2AOTA 2GZMA 1Z5UA 2XGEA 4XRGA 4KUEA 3CZPA 4MDEA 3TCXB 3A2KA 1EFLA 2EHJA 2C3OA 2V58A 3CE9A 4RA9B 2OGSA 4TYPA 4CN8A 1QFXA 2G09A 5A9SA 2Q49A 4G01B 4UHEA 4WESA 2QMOA 5DHSA 2BF4A 2RGVA 1OYVA 3F6CA 1RCTE 4BZWA 4R1OA 4ZI7B 1UDCA 1YO5C 1HNNA 4RKYA 1Z22A 5J59A 2Q99A 1B00A 4ALKA 5HSGA 5LP6A 4JEHA 1C4XA 1TQ4A 2XF2A 3FBTA 3H8JA 1YQXA 2P2NA 1R0RE 3R3JA 1E4YA 4KR0A 1UMBB 2L7KA 1DARA 1NVGA 1U7DA 4RGYA 3G2OA 3T8YA 1WNFA 2O07A 2Q41A 2BVNA 2I4NA 3OX2A 1PQ4A 2OQVA 4B3SB 3BFKA 4L07A 2XTMA 3WS7A 3R9XB 1V6CA 4C3JJ 4E4HA 1N1DA 4JLPA 3WICA 4F4HA 2YC4C 3FSGA 4L9AA 1ABEA 4ZI3A 1SIUA 3OHPA 3VTKA 4Y2QA 1FB5A 2EFNA 3KFWX 1EM8A 2MJLA 2W6QA 3NIDB 1YKSA 1QYXA 4HYTA 1ZM2A 5DOVA 4WMLA 5GAEJ 1C0LA 1M34E 1RAEA 2IXEA 3NALA 3NRBA 4F4UA 2Z1MA 2EFWA 2HT1A 1PJ3A 2VXCA 1EX9A 1XHEA 4G6TB 1NPYA 3GTQJ 4OJNA 5T8KC 1Z07A 2OSVA 4MO9A 4DCUA 3DBRA 1RIOH 3LSHA 5ALVA 1GNLA 3JQ6A 5KNDD 5JSUA 4M6WA 4XGRA 5D86A 3LKVA 4C7KA 2WBLC 4IHVA 1ECGA 1M2VA 2F9LA 3GEEA 1RYHA 3EFOA 4OMDA 4R31A 3UCXA 2DHEA 3CUSA 1EVIA 1ZMTA 3VH3A 1UCFA 1Y9DA 5A3SA 3ONQA 5K0BA 4CKCB 3LMKA 4GGOA 5U9CA 3GYHX 1T6XA 1SOWA 4J07A 4J0DA 1W0UA 1U1EA 2G9UA 4NV0A 5FFNA 1B1AA 5DHUA 1K8ZB 3W8DA 1NUTA 1A36A 2FEWB 5JFRA 2OFWA 2VTEA 2WWFA 4CN9A 9LDBA 2O2DA 2FGJA 1YHZA 4NU0A 1PJZA 1EVEA 1EINA 3C7KA 4J1NA 3D0OA 3E9MA 3C3PA 4ZMRA 2JI8A 2AMFA 3EB9A 4WVLA 4BNFA 3V1NA 1FDWA 2CQ7A 2ZNYA 1KMCA 3BF8A 3VYWA 5JAUA 1A71A 2OQ2A 3GVAA 2P9JA 2Q9CA 2X77A 5ALYA 3W04A 2EX4A 5BURA 4BQSA 2ZJ5A 3HDDA 1DC4A 2PCLA 1XB2A 3GEIA 1E2FA 3ZWMA 3AR5A 3QZUA 4XD7A 1MBKA 3I4CA 4FD3A 3SXUB 3A26A 4MAAA 1U5TC 3C8MA 1ZD3A 4MRMB 4PX9A 4DW8A 1ZICA 4ZMBA 1MD9A 3AEZA 1PWZA 4ZV9A 3RVQA 5REQA 3WK8A 2QQ5A 5C8DA 4Q3CA 2CV0A 3HO6A 4PNEA 2XEXA 1YC5A 4W4TA 2CNDA 5D5PA 4R1UA 1B9MA 1ITZA 1G66A 3I8XA 2OF7A 3QU7A 2Z8XA 2DUJA 2GEUA 4TOIA 2WTEA 3M6FA 3BDDA 2XTZA 3LZDA 2RKBA 4M0DA 1EAYA 2IOFK 2L4MA 5AI5A 2JGNA 2G82A 1S8NA 2BGUA 5IUNC 4GO1A 2HRDA 2MWMA 3EZGA 3P4XA 1JR2A 4FHGA 4OU0A 3O1LA 3RNOA 2I55A 2MYUA 1JHFA 2N3ZA 5H02A 2PUEA 3B51X 2HBRA 5ITWA 1ZEJA 4AF7A 2W11A 4GPAA 4CU5A 3V33A 1AK9A 2CVQA 2IYYA 2IYPA 1Y3DE 1MLDA 4XWKA 3ZE7A 5BMVB 3UXEA 1I0LA 1G8KA 3I5MA 4EI9A 5TMPA 1L7EA 2XT9A 1V71A 4GL2A 1GWNA 1TT7A 1TAUA 2HJGA 2VN2A 4NZ9A 4LYEA 5LJLA 5BPIA 5D5UB 4JEUA 3DQVC 3ZWPA 1M6WA 4F97A 1L5YA 3WA7A 1K7YA 5COBA 3TZ6A 1QHFA 1V6AA 4YQFA 3STHA 1O6BA 3FLMA 3KOOA 1J07A 3OQVA 5AKEA 3GFVA 3BXOA 2P78A 3PD1A 5JH7B 4FTWA 3V8BA 4HOBA 3WP1B 2QQGA 5LQCA 4MQMA 1MJHA 2IXGA 1ZRMA 2O23A 4GD3Q 3SYKA 5BVHA 4U0KA 3EBOA 3HXOA 2OZLA 2CK3D 2YOHA 1D4FA 1RRGA 2GN6A 5FTKA 1P0PA 3WFIA 4DDTA 1OH6A 1D2RA 3WNBA 3FUXA 2ISCA 4B3AA 3P7NA 1YRQA 1MB3A 1IJWC 1RMQA 4QPOA 2B7BA 4TMFA 5JQGB 4ICIA 3M3HA 3C48A 4HKTA 5IARA 5TRTA 3QPLA 2Z5FA 4RL6A 2GM4A 3HDGA 3OCUA 3TZHA 4WDRA 1XSXA 4XLHA 3IS3A 1A8IA 5J5AA 2HS5A 2NUBA 2ZI3A 3V6LA 4JODA 3VH2A 1XVUA 2YXDA 4UTOA 2OG1A 5DPMA 4OX9B 3G2NA 3KSUA 5JAQA 2QUFA 3AI2A 4LMRA 1CNEA 1E8NA 2M98A 1MJNA 4YDQA 4DV1B 3QBDA 2F1RA 5HVNA 3HUGB 1C3VA 4MA0A 3FOAA 3VU1A 1GG5A 2IPAB 2HXYA 1RAFA 2W2PA 3I9LA 4LWPA 3CUTA 2AGVA 3FDZB 1HTWA 3ANTA 1XRMA 4BRWA 2JAXA 2YICA 3V1KA 2WSLA 1M0TA 2RC4A 2QMZA 1AA7A 4N82A 5EWLA 4DG5A 4X5OA 2F4OB 3LDAA 1KEWA 1BFKA 3I09A 5E1ZB 1S3GA 3N8NA 3P97A 5IP5A 1F60A 4EJSA 2P40A 2QAIA 1I5RA 3C6ZA 2P9TA 4LF9B 3TQFA 1JR3A 4EW2A 1P6XA 3DFMA 3Q0IA 4KNVA 3VU0A 2JFNA 3ZGKA 2C5LA 3R3YA 4BX2A 4BN5A 4BPRA 5BUQA 3ONFA 4PQEA 3GXOA 1R4ZA 4Y30A 3BTSA 4D57A 3P2EA 4DQVA 4N48A 4CGZA 4GKVA 1YVDA 2WHQA 2MW8A 4A3BJ 3AV0B 2NXJA 3EISA 3L7IA 4FLFA 4WA8A 2B5VA 2B1QA 2IZ1A 2M6RA 1WDMA 4JL8A 4QEZA 4UPDA 3PUVA 5GJCA 1L5KA 1JTYA 1E1KA 1JQKA 2JFOA 5IDXA 3U6BA 3PI6A 3RC2A 1FW6A 3UWPA 4G1FA 2R7MA 2WZCA 3DT6A 2R4QA 5JI6A 4KN6A 3A4NA 1I01A 4RDXA 4GCVA 5DS9A 3B7GA 4FFOA 3NTRA 2GKOA 2EGGA 3LX5A 4DIQA 4IINA 5L3ZA 1VHQA 3DZFA 4AN4A 1E60A 2YX7A 3HYCA 1SUWA 4JELA 1WHSB 1VJ1A 2VR1A 1E9DA 3NHFA 2FK8A 2HKOA 1AKMA 4AW9A 1G5IA 1WDKA 1SZDA 2AG5A 4H6VA 1P7YA 2CNKA 1NQ5A 3RV4A 2DA6A 1QKIA 5JEDA 3N53A 4IPTA 1EUZA 5BUSA 1Q11A 5K3AA 4PC6A 4WQMA 5H3LA 2O8VA 2L01A 4YAJA 3W1EA 2AOXA 3KPVA 1XWWA 3LA8A 2RKWA 2XYHA 5EJ4A 4J1QA 3I4NJ 5KYUA 1FPQA 5IASA 3FCOA 1QHEA 1ECFA 4IHAA 4MPDA 1O87A 4HLXA 3JAKB 1ZN8A 4U6SA 3OEHA 2QRJA 4O1HA 5AI4A 4BYMA 3HOUJ 2VQCA 4EKYA 3DEWA 1SCUA 1TIBA 1OJ7A 1NNSA 4DYCA 1PL8A 1YUBA 2ARKA 3TM5A 4FIZA 5F0FA 1NMYA 1P5RA 4UTZA 1RC9A 5JCOC 4ENPA 1JI3A 4Q7KA 1VFPA 1BCRB 3W9BA 4UUPA 4YYZA 1ACLA 2Q8QA 1F9AA 2D8MA 2V0CA 2QL7A 3FOZA 1USWA 2R96A 3M6XA 4XQFA 3Q12A 5IKXA 3KQPA 3PUFA 2FQ1A 2R3SA 3VSCA 3THXA 3ERMA 1PYOA 1TVKA 1NW4A 2GD6A 3D4IA 1M7BA 3M6UA 4UFNA 2EJBA 4DC0A 4KUMA 1AY0A 4L4YA 4HDMA 2G9RA 3L06A 2DWUA 2FOIA 2UYGA 3EOAI 2M8GX 4XRMA 5CK5A 1Z5OA 1DC5A 1GGMA 3HB1A 3Q7QA 2CXUA 2WUWE 1PNVA 4HEA2 5IU6A 3K6SB 2F5EA 5DI3A 4QPQA 1EGVB 1BYIA 3OZEA 3DC7A 1HGXA 1SCIA 2TMDA 3RYFB 4D4LA 1XQWA 3BXGA 3MQ4A 4XIIA 2HX1A 3VKVA 2GN4A 3PUKA 2JFBA 1C2TA 4HVAA 2EV5A 4I6JA 2DKFA 3JRFA 3WY9A 1O4VA 4JSYA 4J1TC 2HNBA 4OB6A 4L02A 1YKFA 2AOVA 4HB0A 2WKPA 1W85B 2A3NA 4AO7A 1QZYA 3DCYA 1L7OA 4KE7A 5H81A 4D5GA 5BV0A 3F49S 1DJQA 1U9JA 1DP7P 1KGDA 4BJ3A 2AMYA 3T8TA 1RXIA 3S1NJ 1DV2A 1G3MA 4ZQFA 2GCGA 1W0JD 1KK0A 1OAOC 2IGOA 1SVNA 3I0TA 1Y9ZA 4G65A 3K0CA 1R4MB 1M2WA 4QUEA 2ZJZA 4IXDA 4Y6QA 4IBOA 2JHPA 3AHGA 3RSOA 3SY8A 2UU9B 4KMMA 4WH0A 4EM2A 2EZ9A 2PMUA 2C2XA 4JOSA 4BVAA 3MZ0A 5ALXA 2X0NA 4UOEA 4UDXX 3I1JA 1MX1A 4Q9JA 4DGWB 5KWJA 2HHCA 3ASUA 4R9UC 3MWDB 1LLUA 1TQ2A 3KUUA 1GNTA 4OHWA 3Q5EA 3QU6A 3GRFA 3S68A 3A4LA 1KMQA 4GI3A 5TVGA 2M7AA 1ML4A 2O9LA 3PUZA 1TT5A 4OIPF 3U2RA 3BL6A 1V3QE 3FF4A 2K27A 3M07A 4I0BA 1A8HA 4GPZA 2XT6A 3SK0A 1BI0A 3E9QA 4LCBA 4BHCA 1Q14A 3C0KA 3RQ4A 2DBRA 2JH3A 1PL6A 2PKCA 4B6PA 3K2ZA 2JPDA 5H82A 4JI5B 3J81A 1EJBA 1CUHA 1W0KA 4JQZA 5C4IA 4ABYA 2R7TA 5JS7A 5LQMA 3CF5F 2NO9A 3LDHA 4UHFA 1POXA 2R8EA 2XOKA 3BOQA 1RYFA 4IGEA 2BBOA 1H9GA 4FGKA 4US0R 1GAJA 4JIMA 4BO0A 2OFPA 4KFCA 2JANA 3KQYA 3VVBA 5H80A 3GP8A 5FDFA 1GTZA 3D7NA 3LU1A 2P62A 1FNDA 3AUFA 3BXXA 2HYFA 4X8MA 1RQRA 1Z4QA 1CQPA 3WGIA 1PS8A 3K9LA 4YEDA 5I7EA 4GICA 3DLBA 3R0XA 4GI1A 2HLHA 3KQWA 2FVYA 1W36B 3LPNA 3QBTA 2D45A 4NWIA 4DCSA 2VQEB 5EMMA 2R8BA 1HOXA 4WX2B 2O61A 3PPVA 2KMUA 1SHTX 4L5BA 5E3JA 3EMDA 5AW7A 4EGFA 3REQA 1W93A 1SCBA 1ZNYA 2D7JA 2RC5A 4UNIA 4GNRA 1OYOA 2EPFA 1AKRA 1Z8DA 3E0QA 4HXGA 1I7NA 1G9SA 2PX8A 3LYHA 4OLBA 3L7CA 2OHFA 3I9V6 3JZFA 3LGXA 4NCXA 5LP6C 1U0LA 3O4HA 4AZWA 1KJQA 2J9FA 1NQXA 2ZI6A 4B33A 3PQ4A 4E7IA 1PG5A 2ZULA 3ASYA 3KBBA 4P35A 3V8RA 3TZLA 2O8CA 1MQ9A 1YCHA 4HQNA 1GNSA 4DDMA 2O3UA 6GPBA 2KX7A 2UUCB 3Q3GE 4CIXA 2HF2A 1NF2A 3OYJA 1KMIY 1KRHA 1U8CB 2B4YA 4MQUA 3SC6A 4QTYA 3SYTA 4N4NB 1JG3A 1YL7A 1YJXA 3L79A 4U9HS 1BE1A 2C9YA 1LBTA 2H57A 5J2UB 3OYIA 3ML6A 2LCIA 2QTGA 3LG2A 4S35A 3ZV6A 3B9RA 3EWNA 1XTJA 3CEMA 4UM5A 4E08A 2P2YA 2HQRA 5FWXB 3BJEA 3RC1A 3RVLA 1U98A 4AJ4A 2DXIA 2VNHA 2FPMA 2RGEA 1EBBA 2W22A 2XMGA 3FVTA 3JQFA 3L8YA 4KX3A 4YRSA 2BYVE 1B41A 1ZK0A 3OFNA 3OM1A 5CPBA 3ZHQA 4CL8A 1ZQ9A 3V8QA 2DR0A 1MTZA 2EWWA 3B6EA 3G0DA 3PC8C 4HR7A 3VPRA 2EF0A 4BKPA 2CE7A 2GPNA 4L0QA 4NL4H 3BR3A 1HETA 1SC1A 2M5WA 4ZYXA 5CB4B 3HJTA 4N7JA 2FRHA 3LOCA 3HWRA 5EIOA 3R24A 3FCXA 3NYQA 4IQ4A 3PX3A 1HSOA 3MAJA 1QNFA 1QIGA 1HF0A 4EGCB 3HB7A 1YQDA 2NWQA 1RBQA 5CT4A 4IEFB 2XRYA 4IIHA 3MM4A 3VWBA 4PONA 4RH3A 4F06A 3W5AA 2J46A 4G7OF 2V3WA 1Y8CA 4BU0A 3CBGA 1JQDA 1N75A 3BQ9A 3G79A 1EZ1A 5JNLA 1P9LA 4RJIA 4KRFA 3KEQA 4P1WA 4W63A 1MIJA 2OORA 3NEJA 3NC4A 2H1KA 4OKNA 1SWVA 3F9RA 3G2IA 3KU4A 1QHNA 4M1ZA 4MWZA 1S2IA 4GYWA 2V5AA 2JIBA 4YA6A 3QOPA 4B73A 1JILA 1RHMA 1YBMA 1PZMA 2YHIA 1EA5A 2GNOA 2ST1A 4BAGA 2JI9A 3V4RA 2EKPA 3FUVA 1UG0A 3EA5A 1Q1GA 2W2VA 5T4BA 1GNRA 3EGIA 4Q4JA 1VZ0A 1DKLA 3GO4A 4L9RA 1J1UA 3MERA 4RVHA 5LBUA 4XIDA 1WJ5A 2CWDA 2EFCB 1D6JA 2Q4OA 4IH1A 2XB0X 4QHYA 3RHTA 3GPLA 4ETMA 4X65B 5IC5A 4ZDIA 1UFMA 3LC0A 3NI2A 1G291 4X6YA 3I8OA 4BO5A 4XKCA 3WGNA 3EPLA 1VIAA 5A9SB 5EMKA 3D8SA 2HMVA 5CLJA 4TX1A 2XE7A 1UK9A 5CG2A 2B5WA 3GBPA 3OJOA 1TC2A 3NBXX 1L4BA 4TTQA 4WI1A 1YK1A 3F8CA 2D5AA 3AERA 3HMQA 3M2TA 2PZAA 3PXBA 4LJ7A 1LNQA 1RM5A 3SD7A 1II8A 2OP1A 2Z4SA 3KSZO 5E8RA 4IZZA 5B1AH 1EEXB 2ME6A 2QVGA 1DELA 2AG8A 2UUPA 3H2GA 3KXPA 4J43A 4GQAA 4LJSA 4UUAA 3QE0A 4EGSA 1CB7A 1VLZA 1R9NA 2HMUA 2QDKA 3KJHA 2WJ3A 2R7ZJ 4J4BA 3UWOA 1T9HA 4MKXA 3FAZA 1UAGA 4FISA 2IOFA 3KK0A 1Z4KA 3W8NA 5J2TB 4OFBA 1JIJA 4DANA 2K4BA 3CLVA 4DWWA 3FMRA 4XIYA 1YH3A 4GXRA 4MW9A 1T1IA 4NECA 2R6AA 1NNUA 1G8PA 3UMCA 3H0GJ 1I36A 1T8SA 2RJNA 1V11B 1MDBA 3CR7A 2I1QA 1VFCA 3C7DB 4LSMA 2P5TB 1XWFA 4RENA 4GG1A 1D2EA 2MMCA 1WF3A 1X3SA 4G0XA 1CF2O 3N0TA 4HYYA 4B7UA 1SVUA 4C6HA 1NX9A 3ZU4A 1UM9B 4FR5A 1U0TA 4IG4A 1PGNA 1N4DA 1R74A 2RJOA 3Q98A 1V3UA 1RRCA 3DBLB 3TOAA 2B37A 2QM0A 3AFOA 3TMOA 3E23A 4COKA 4EB0A 1FJ2A 1P1KA 3BR1A 1QHSA 4FJ1A 4TN5A 1F0NA 1UDRA 2VWQA 4DIEA 1QIIA 1W1WA 5AVZA 3KG2A 2ZJ0A 1T8YA 2H7VA 1JPJA 2Q3BA 4ON9A 4ENQA 4NDZA 3DEIA 3HSSA 4Q3LA 2I1LA 4OQZA 1DCKA 1FZTA 2KLBA 4W1QA 1P92A 2BBYA 1NV8A 1SVMA 1PD0A 1WOYA 1ZY2A 2V5UA 3FPLA 3OLCX 4H4EA 4WEOA 4CM4B 3U4CA 3ESYA 2XXAB 1CDEA 2PK3A 3D8TA 3MOGA 4GYYA 1JDTA 3GCMA 1PWHA 2BFWA 4PCLA 2RNGA 2HTJA 3I71A 5KAIC 1KC3A 1YR3A 4J3JA 2ZRKA 4CV3A 2D1YA 3WQSB 3AW9A 3EIQA 3UB4A 3C7TA 2EU8A 3N39C 1CY1A 2XA1A 3D3WA 2AF3C 2KPOA 2R25B 5ALOA 3V2HA 3WIUA 1IB0A 1L4FA 1CUBA 1QC5A 2QRVB 1P7WA 3LUAA 4BGVA 3C3YA 1T13A 2G88A 3IAHA 3T6KA 5LZ9A 4F9FA 2QD4A 4M53A 4WFJA 4EATA 3F8NA 1AGYA 1KY5A 1THTA 1UXGA 3LAJA 5B3KA 4RTNA 3A6PC 4I3HA 1R12A 2PMWB 3AEQA 3CB4A 3KKNA 2JEZA 5F04A 5CURA 5EPOA 2P4SA 3T5XA 4WZAE 4HNQA 3VO1A 3BILA 2Z3ZA 3HVRA 1NC1A 2OM2A 4GHWA 4WK4B 2AQHA 4RF3A 3BX1A 1YR7A 1QOPB 2VHQA 1NVKA 4PGGA 5KU7A 4ZZLA 1I51A 4RO0A 2O1SA 3T3EA 2FUG1 2FI1A 3Q9NA 4J16C 4UVHA 5CAEB 3EMVA 3FOFC 2IYSA 2REBA 4CM5A 2QTTA 3RS9A 1FDIA 2CLKB 3EG9A 1HW1A 3RZDJ 2YOGA 3HL0A 2VNIA 4GI2A 5DHFA 5EGNA 4PPYA 1USGA 2BM9A 3AXTA 3JQRA 5BN3A 3ER8A 3OZTA 1HZZA 1I50J 1GTMA 4Q7MB 4O2AA 3VR5H 3G0CA 4UREA 2IQIA 1DTWA 1WOMA 3S3NA 3O0TA 3OG9A 2PGNA 2PCJA 4AZSA 5K2OA 4CYDA 1Z73A 1EFVB 5HRCA 2QGUA 1PG2A 1AQ6A 3GTMJ 3R20A 3OTOB 3HB9A 2IUUA 3ASZA 1D3YA 5AQEA 1C0IA 2PVCA 3ZHOA 2HTSA 3DD1A 2O0KA 4QOGA 3F46A 2VDQB 2E6UX 4E11A 2HMWA 2PKQO 1EDZA 1UQTA 3GLGB 2OXTA 3KP2A 3AUJB 4DRXB 3UPUA 2BZ0A 2JGKA 4YRNA 3RK0A 3MWYW 3FXAA 2I3BA 1ZJ6A 3EQ6A 4RETA 1E2BA 2OGZA 1G2HA 2Q6LA 1Z47A 1T9ZA 5LA6B 3FUTA 1BJZA 5AK6A 3MGKA 5A0FA 1TTTA 2R65A 3A01A 4BVBA 2AE1A 3JD4A 5CLLA 3GAAA 1C8VB 1E0EA 1WXIA 3ORHA 3OZWA 3CVUA 3LJKA 5AHWA 1ZCJA 3G02A 3I8SA 4ZVOA 3WNDA 3GRRA 1T0FC 521PA 1X14A 3C14C 3FB1A 2AMJA 4P3OA 3SHVA 4IKEA 1C9KA 2C5EA 1B72A 1E99A 4LY9A 3WL5A 2VQGA 1S6YA 4FXOA 4CVNA 2WQ7A 4EI2A 3IBGA 4OATA 2WTXA 3W5IA 1FTSA 5E7QA 1Z4PX 2AS5F 3L7AA 2JJ8A 4PIVA 1P39A 4TSFA 2J6CA 3ASNH 5DEQA 2WVHA 4XRSA 1AQLA 2UYOA 1T8UA 3ECCA 3KQVA 1QGAA 3DAHA 4UNRA 3A1TA 3OLXA 5HDGA 2CFCA 3UIEA 4OQYA 3EUFA 5BR7A 4DV7B 1HK7A 3PRKE 1JEDA 2IOHA 3HEFA 4JA0A 3C5HA 4NHOA 5L9AA 1AJEA 2PJZA 4F9TA 5K45A 2DDAA 3CO0S 2FWAA 1E3WB 1YBHA 4GLBA 3RW9A 5CXSA 4EK9A 4YMVA 2VPZA 3EXEB 3IUOA 3C7CB 5IG2A 3L93A 4GKJB 4A3MJ 2MSLA 4NMWA 3WKEA 1XTAA 3U56A 5LP6F 3DTTA 4DUGA 1OWOA 2XV4S 3CPHA 3OD1A 1E4EA 3ZGLA 4AJLA 4Q3EA 1AMOA 4X93A 1MAHA 3RIMA 1DBPA 1QKJA 1LPPA 2O8FB 1UMDA 4N03A 1KKUA 4XTCS 4RAOA 4BQAA 1QR2A 4J90A 3SXYA 3DTVD 1C1HA 2VAWA 3AH8A 3E9DA 3I52A 3PVZA 5H70A 3ZIAA 1IXCA 1NIJA 1LTKA 5E1OA 5KYYB 5CB4F 2FSVA 4NTZA 1YVPA 5B1YA 5JAPA 2WAMA 2X7JA 4CUJA 5GPAA 1C1DB 4BY7J 5G1OA 4LRYA 3UJPA 4FUTA 1US8B 4P0TA 1JKRC 5KYWB 1ZGZA 2Z3YA 3AP3A 3F4LA 1DSSG 2PHZA 3O5AA 5HGJA 3K4BA 3P9PA 4P54A 4LUCA 4ENNA 2C61A 1IUPA 3I3SR 3I72A 3WTTC 1GPUA 3LXUX 2UWMA 4I0WB 4YREA 4RTKA 5F3WB 1NUSA 3MELA 4Q16A 3SQDA 1ZVMA 5CPFA 4BLOA 1MMSA 5DEOA 4BO2A 2AFVA 1YE9A 5CFOA 2GB4A 3PU6A 4FSDA 3I53A 1H6CA 2XUGA 1RZVA 1NN1A 3K9HA 3KXLA 1TYDE 3OF2A 1KE1A 1JWBB 4DWJA 1CUSA 3ELBA 5F4ZA 4EZBA 4BKUA 2C04A 1AMUA 4NJMA 4OXQA 2J33A 4PO8A 3WWDA 3D6AA 2C9DA 5H6RA 3IAEA 1IU9A 2QRVA 1T3ZA 4YACA 2RI0A 3KYIB 4MKGA 1IUKA 1RJEA 3BL5A 3HGQA 1V7PC 1ETYA 2PNJA 1C30A 1BHO1 2PUVA 4FNMA 3UH0A 5K7ZA 5MGNA 4BS9A 1Z16A 2OFOA 2Q27A 3AHJA 3K2EA 1QYIA 4QU0A 5ALGA 4DC9A 4CUKA 1UXOA 3V3TA 1R0XA 1CUUA 4JI3B 3RAFC 9ANTA 3CLUC 1OI7A 4RACA 3CC7I 4YIKA 3DGFC 5H83A 1MJAA 2EBFX 2VKQA 4PS1A 4R1SA 1R23A 1PEKE 3LSIA 1FBQA 1J2JA 2UDPA 2GM3A 3G8AA 2DCEA 3H9CA 3HKZN 1IUNA 1QFZA 4FHDA 4KRYA 3C3XA 1R5HA 3AR9A 1NN0A 4WCGA 2QA5A 3I2JA 3L0PA 4KXWA 5D7NA 1N2IA 2W6ZA 4K9QA 5JS2A 4YYEA 4D0NA 4X97A 3WZMA 1VQPI 1SJ9A 1V11A 1YUNA 5J2TF 1JIXA 3KB8A 1I30A 2WT9A 4HLUA 3ZVLA 5I4KA 2O8DB 2DRIA 2R7QA 2R7VA 1W9HA 1MH3A 5K5OA 2K6GA 2FBKA 1ZG1A 1JT0A 2YY7A