3V42A

Crystal structure of renal tumor suppressor protein, folliculin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
196
Chain Sequence
b'LPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAASLSKYEFVVTSGSPRVGPTILNKIEAALTNQNLSVDVVDQALVALKEEWMNKVKVLFKFTKVPKEDTQKLLSILGASEEDNVKLLKFWMTGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Folliculin
publication title Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 70
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16692 Folliculin_C Folliculin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3v42A02
3.40.50.12430 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v42A01
3V42A
chains in the Genus database with same CATH superfamily
3N2IA 5KAFC 5CYPA 4FWIB 3WFZA 5CG1A 1L4MA 3G2MA 3FWHA 2B7BA 1Z7WA 4D7MA 4INPA 2M1ZA 1DAEA 2ZS7A 5FR2A 3N2YA 5TQ0B 2BZSA 3UZUA 3CPEA 3DDWA 3CUQB 4CZCA 3H35A 2XKOA 2IX3A 4J49A 4YK7A 1FUKA 4CKYA 2C07A 1P0IA 3TZKA 3HJGA 2WHYA 2ZBVA 4Q3EA 2DLNA 2VSXA 3CUVA 4CEIA 5DXJA 3VV3A 3BE8A 6REQA 1RZ4A 4QKQA 1Z75A 3GJQA 1EUYA 2P11A 5K0EA 3QA9A 1SFUA 3WMEA 5CCBA 1GL9B 3IOEA 3DBIA 5GAGJ 5DSXA 4ARIA 5CB6A 3WG7H 3HDGA 2R79A 4COKA 3GLFA 9ABPA 1FQWA 4J9UE 3UJ9A 1EFRD 2C7PA 3FJYA 4YLEA 1W0UA 1E9EA 1HE3A 2IA1A 1RCUA 1V16A 5EJ4A 1QH9A 1YAHA 3RVOA 1C9EA 4FGZA 3R0VA 1GRNA 5CAEB 3DG9A 3S6JA 1NM5C 3TLMA 4BVFA 1FW6A 2EH3A 3LCVB 2G09A 2OKCA 3G0GA 5AXDA 1UMDB 5L7WA 3TRFA 3EIOA 1KEPA 4WK6A 1G4DA 3GTKJ 3OYAA 4V39A 1X7ZB 1SD7A 1T2NA 4DEVA 1JLLB 4B6SA 3GRRA 3MKWB 3LVBA 4ZYYA 4EQ6B 1FFCA 1XTKA 3K0BA 3S1QJ 4MYTA 4HQRA 2XGGA 3D81A 1TMKA 4EYGA 4MHSA 3RLFA 4WK2B 3EXEB 2PY6A 2IOYA 3IEUA 1Z08A 1QO0A 4RTLA 2P2SA 1BR1A 4K05A 3K2BA 3DC7A 5FBQB 1B00A 1JPUA 4LWOA 3FM3A 1CUGA 5MHTA 5I7FA 4R84A 1TM2A 1PFGA 4JX5A 2VT3A 4YT8A 4UUSA 4TOIA 3SQLA 1PGPA 2HRBA 1Z0SA 2XVXA 4MFDA 3GO4A 1PBTA 1LVUA 1I4WA 2BV6A 1JDSA 5HILA 5BOSA 3NRJA 4MUYA 2WWVD 5FNVA 1E1RA 4H4KC 4JBIA 3O9MA 3DE0X 2P5YA 2R5YA 2EFPA 5A62A 1MABA 1D4AA 4CHTA 5HG0A 4NXMB 3MCWA 3TR0A 3FVTA 1ECBA 4M9UA 1V96A 2N9UA 2OLJA 3TOSA 4RQBA 1LH0A 3DCNA 1DZ3A 2KQUA 3SR0A 3BJMA 5DNUA 1OYYA 3N7AA 4QASA 1ZY2A 3AFIA 3GPLA 3KZZA 4B85A 5AESA 2VYCA 4Y0NA 2LF8A 5BWNA 3TDMA 3NVKI 3RSQA 4E7JA 3ZD7A 1C0KA 2PBLA 2ECFA 2HMUA 1P2GA 2VSQA 3K8YA 2O2CA 4IO0A 3A25A 1E92A 3CG4A 3SY8A 4YAIA 2C4VA 1KF0A 2WM9B 2VCHA 4CQMA 2Z8YA 3BA6A 4OHUA 1J23A 4YUZA 1B3BA 3NDIA 5FJIA 5BMVA 1ZA2A 1O5OA 4EG1A 1ZG3A 4Z4QA 3R77A 3CRW1 2B5WA 5EHGA 4YJ3F 4GQBA 5FUXA 3EAQA 3G0CA 3WGTA 3MKLA 2ET6A 2R00C 3BBPA 4B3CA 1UJ5A 3EUHA 1F20A 5ALNA 3KQSA 2RC5A 1O96A 4ENTA 1E6CA 1PTJC 4HDQB 1KP2A 1W2HA 3TM4A 3LP8A 4L08A 4CKXA 1WB4A 1HE5A 1I6HJ 2VLIA 3S32A 2NYUA 5JLXA 4QYXA 3QY9A 3KCNA 2ZAIA 2FQ3A 2HL6A 3NH6A 3K71B 3EXFA 4NJMA 1DQRA 3RI3A 4TM8A 3TNJA 1COWD 1JA9A 1NUPA 3IT2A 3Q9UA 1JG1A 4MR8A 4HWPA 1EFPB 1YI1A 4N0MA 3H8JA 5FNVF 2GBIA 1S7GA 4TQGA 1GKYA 4FFSA 1WJAA 3R2JA 3JRXA 3A58B 3TGNA 5ICMA 2QA5A 3VU1A 3E82A 4CEJB 1Y33E 3OKAA 4IH9A 4I4NA 3RYTC 1Y3DE 1TM5E 1ESMA 1U2PA 4ALMA 5FPTA 8GPBA 4X0EA 1LVGA 3KHUA 2Q50A 3RYIA 1ZARA 1PNTA 1JEQA 4H7KA 1XYGA 3ZVMA 3OYGA 2HK6A 4TMZA 4ZDKA 4QELA 3KYJB 5LUAA 4QPOA 3WSVA 3S15J 1VXOA 4JI5B 4G4JA 3ASZA 2JZCA 3JCUC 4JZYA 3H6KA 1KJYA 2QV0A 1RVDA 4QFMA 1G3SA 2PFGA 2SNIE 2P9QA 4R8HA 1ZI9A 1SCNE 5ITVA 3FBIB 3JY6A 3FTNA 2FUNB 3OY7A 5K6AA 1JG2A 4TN1A 2PMZA 1ZXLA 3Q8MA 1VYVA 1DGRM 3MWFA 1T1GA 2PZBA 4B9AA 1C3EA 2HSGA 4RETA 2XNKA 2XDVA 4KSYA 5DLEA 3N2NA 4MV7A 2FOXA 1ZLKA 4LGMA 5BT9A 1T08B 2UUOA 1U7WA 3W78A 2PNFA 3E7LA 2QDKA 4ZMSA 3ROMA 3OWOA 5EQDA 1AHIA 1W36D 5EJEA 5E9QA 2B0LA 3N8GA 2PEYA 3PC8C 3S2GA 4QDJA 2WJHA 3ERMA 3G8YA 1RYBA 4QOIA 1OYWA 3U44A 3HMKA 4F3CA 5FKOA 1VJGA 2FPXA 3FN4A 5ITSA 5KJEA 5JO0A 4C07A 4WJKB 5TDHA 5K0CA 4XRSA 3MJSA 2DYSH 2VBWA 1J9EA 2G36A 3B52X 3GL9A 3R3SA 2QGZA 1OZFA 5BR8B 4ZICA 1B41A 5E1BA 1Y8QB 4QUDA 1ECLA 3I71A 2KJBA 3D5LA 3BJRA 3IKJA 1HY3A 1XTTA 1L8OA 2HGZA 1OXVA 2SICE 3LLUA 3WKDA 3G59A 3DJYA 4TMYA 5T64A 2XASA 4MCHA 5KSYA 3VC3A 2V58A 3EVAA 4QXAA 5CDFE 3P0FA 4TWRA 2J3QA 2IOFA 1CRQA 4MUXA 1MO5A 1ZK2A 1E2MA 3PTLA 1PJCA 3ET5A 1QCYA 5I01A 3DDCA 4FKBA 1R5ID 3NB0A 1Q3HA 2PGJA 2M3AA 1EJ2A 1PJSA 5C5IA 2AE1A 3B6AA 1XWFA 4FHTA 1EK2A 3TOVA 4UD2A 2EV0A 1T6XA 2MOKA 4HDVA 1SKBA 2QRZA 4OXRA 3L07A 3N39C 1GUAA 2FW1A 4EJOA 2WM2A 3BCBA 3T6KA 3Q7SA 2E4WA 2RJNA 2FMLA 3Q0IA 3S93A 1PN3A 2BEKA 2JAOA 3JU3A 4C3JJ 4IHJF 3ECSA 4Y6RA 4ZDWA 1ZINA 4MLDA 2WFLA 3UENA 2SHKA 3T5GA 1X1DA 2E37A 3WLPA 5AH0A 1ETKA 2BHYA 4GBMA 4BP8A 1U6GA 4YONB 4Q18A 5H5JA 2JA2A 4PR3A 3WGVA 4OI1A 3I9V2 2VK1A 1HMYA 4IXTA 2W71A 1NXWA 3LA6A 1SUCA 3MIZA 3Q7QA 5L7YA 3P9YA 1A69A 3IMKA 3VTAA 4F7WA 4KISA 2NO0A 1XI2A 2DHEA 2V1XA 1W34A 1KDOA 5EMMA 3S3NA 1BHQ1 1SHTX 4J1TA 2AUTA 1WKCA 1ZL0A 5KNDA 4A0GA 3CINA 2YY6A 1VP9A 5CU7A 2AYZA 3GCMA 4Q16A 3H5OA 2EKBA 1WTAA 2R25B 1EE2A 3ZWQA 3HUEA 2D3TA 3CG0A 5CXXA 2JAHA 4W8HA 4IVRA 1L5HB 1CQWA 3NHLA 3IALA 5IJZA 3CCBA 3AL0B 4GWGA 3EH2A 4V0RA 3CLKA 3IIIA 1E6EA 2LKCA 4NIMA 1IRXA 3C6BA 3TLAA 4M1MA 1NG6A 3CEMA 1GT0C 4DMCA 1BKSB 1XCJA 1DFIA 2FQYA 2IZZA 1GCAA 3GARA 1HKTA 4QARA 1U3FA 4NY1A 2G1UA 5A0FA 1SA0A 3D0KA 1XMIA 3OEWA 5DTQA 3M1EA 2VP3A 1XWWA 1PP7U 3VVMA 1G21A 5T6MA 2NU8A 1SD5A 3HZZA 2GBCA 3D8HA 3DVRX 3IUQA 1T9GS 4LLGF 4ZYUA 2QSHX 2VPIA 3UFXB 3AERB 3VZRA 3MRSA 1WJCA 2Q5CA 2FWAA 5C1DA 2QYSA 4EKEA 2DBZA 4YREA 2Z2ZA 3AVUA 1JSZA 4OGWA 2W4IA 1BJRE 1EM6A 3ZVNA 4CE6A 4G63A 4U7PB 1KEVA 2IV7A 4PSVA 2VJOA 3OPYI 1WJEA 3G0OA 2ZT6A 3UYLA 3CMYA 1YJBA 4ALNA 3W8RA 3AUAA 3OEED 2NU9A 1OWMA 5F35A 3LS2A 2F64A 4NV1A 4U7JA 3FX3A 3GFRA 1ZFNA 4TTRA 1T43A 3MSCA 1NRJB 4O4HF 2A0FA 2WJAA 1F3LA 5K3SA 1CK4A 3GFQA 3ILSA 1K4YA 1XZKA 1MEOA 5J1TB 1YNSA 4FOOA 1YA6A 4B31A 3B7WA 3DDHA 2VPQA 4JSRA 2DQZA 3U49A 5A1JA 3O3MB 2VDNB 4G65A 4X97A 2WM3A 5L6LB 3A8TA 4ERNA 1KU9A 3INTA 2Q99A 4D81A 2B5OA 3HJBA 2D5IA 5SZIA 4L3OA 5EYPA 4YT2A 1JZQA 4P33A 4CNQA 5FPKA 1ZCBA 3D2BA 5KNBD 4BRUA 2HBZA 3GUHA 3QUQA 3IUSA 4UULA 1RXVA 1YS9A 3ERCA 4LOJA 4TV8B 3L2WA 2PUJA 4YP7A 4MVJP 3DDOA 2QUFA 3D1LA 1KH3A 4UUPA 1F06A 2R7KA 2N1BA 4YI5A 3BZ6A 3Q2OA 1OFUX 5GGXA 1YFJA 4DSZA 4QBGB 4OLAA 5MDHA 4G9YA 3K6SB 4M9QA 1JDPA 4LHZA 4DA4A 3R0XA 3F8SA 9MHTA 5E18F 4NU5A 4FGKA 2JFNA 1J8DA 5ESWA 2QX7A 5ICFA 1JH9A 1O5TA 4QQRA 3STUA 1XDDA 2HA6A 2YZ2A 2UZ3A 4P4LA 4U6QA 3J80Z 2IYQA 1RRGA 2GBYA 2BBOA 5T3YA 2OHIA 5E9JA 3RSGA 5DN6D 3MJTA 4YCDA 4PV7A 2I8DA 1LFPA 1D1QA 1TLFA 3PIIA 1JDTA 2HQNA 3Q98A 1SBZA 1GVHA 4TZ6A 3KYDB 1X38A 4LQ4A 4C7JA 2P6PA 4DUZB 3EYAA 4LV8B 3E7FA 1XA3A 3W5VA 1B6RA 4LI3X 2AF4C 5IRCD 2JRCA 1AA6A 1JBKA 1AK1A 3II6X 2PZAA 4UVHA 3WHCA 2ZJ7A 2DAPA 4CQJA 1YB6A 1LLFA 3UH1A 4OA5A 1ZH0A 1BDMA 3BOQA 2R8XA 3HA2A 4NYJQ 3QWHA 1CRLA 2XVYA 3LUGA 4G4SO 3RAPR 3MQ2A 5HR5A 4S35A 1RHKA 3FTCA 3COWA 3ZDAA 4E12A 2V6GA 3PIOF 2YWEA 2CH0A 1L0BA 4OJNA 4ZYLA 1XHFA 1D2RA 4PUSA 1YR7A 2P9TA 4BNZA 5ESRA 3SF0A 4KPYA 2JA1A 1GNLA 5GAJA 1A9XA 2IF2A 3SJCA 3PXCX 3U5ZB 3E5UA 2PFBA 3LPAA 2MR5A 4MV5A 4LCJA 2CLCX 3U81A 2I10A 3P2JA 5FV4A 1MJFA 1IQ0A 4NBRA 2D1FA 1K7YA 5JAMA 4EO4A 5FTMA 2MYTA 2HPAA 4PIVA 4OFBA 1O8BA 3V4SA 2IOHA 4AAYA 1QG4A 2GF0A 3DOCA 2B34A 5ALZA 4ZVSA 2XSDC 2GPAA 1KU7A 3G3EA 1DTEA 4PZUA 3SPXA 3TOXA 4DB4A 4FCWA 1KP3A 1NNEA 2EJTA 3EULA 3QPUA 1WD7A 3FPHA 1WW2A 1T35A 4RKFA 1M8FA 5MN4A 1PFVA 1QYXA 4JB8A 3HUGA 1G1AA 5SYAA 1CY2A 2O14A 1BQ4A 3WLIA 4L5BA 4XSVA 1MNEA 4I4CA 4CBVA 4OX9Y 1OFGA 5IT9K 1IHPA 5JNRA 1DUXC 3TBHA 4NATA 2KW5A 4E5YA 4KR9A 3IRRA 5JRZA 4DBLC 3EHDA 3IQDB 2P8JA 5JI6A 5E8JA 3V2HA 4ARSA 2AFIE 1YO5C 1LDYA 3VR6D 3EDPA 3KOXA 2M4KA 2X23A 5HLTA 1O95C 1OLTA 2ERYA 1U98A 4RPIA 1DJQA 4XM1A 1CLUA 1B0ZA 4P82A 1T9HA 1WVIA 3RROA 3DNMA 5GQSA 2ZI7A 1ZN8A 1YLFA 4D3YA 4P36A 3M4XA 3FCCA 4FFLA 2O2EA 4HX4A 2C2YA 3FISA 4RVHA 1G7TA 5K0ZA 2AL7A 3DJFA 4RV4A 3HSFA 1Z5ZA 1P18A 1AUXA 1EVZA 2VJMB 2Q5HA 1HYEA 3EIXA 3M0EA 1WLYA 1U5TC 3IPRA 4MUGA 4QSMA 1C9JA 5IMSA 2X9QA 1TLLA 4EJ0A 2O07A 1ST3A 2RHTA 4QTZA 4IWXA 1RPTA 5FL3A 1LJ9A 3RDPA 5HMMA 1LPQA 3GVCA 1IK4A 4WFJA 3E2IA 2X0IA 3P1JA 2A9QA 3LZDA 3RJ9A 2QEXI 3DXJF 3BQZA 3ASYA 3TYXA 1U63A 1FVFA 1X1TA 1KQOA 1XGSA 1ERDA 2G1KA 2XYHA 4NMLA 1SCAA 3ACBA 2HU8A 2BMAA 1NJSA 3OYHA 4EY5A 1WJ5A 2D1SA 1H6AA 2PH1A 2D2IA 5C34B 4CCYB 1FBSA 3TOZA 1GITA 1PSZA 3JVDA 3SFIA 5CJJA 3B73A 5FLMJ 3I4LA 3CFYA 4NR0A 5BQFA 2GK6A 3SOZA 4PZCA 3C3PA 4XCQA 2WFMA 4OQXA 4DT1A 1WOMA 5LZ9A 3GEEA 1AJEA 2Q1YA 3C8UA 1G20E 2CSOA 1A7UA 2DT8A 3QXCA 1MXHA 5D00A 4ZQFA 2F43B 3WHKA 4RVCA 3OWTA 1HT0A 4LMRA 2DLCX 3EXG2 3BWYA 4BL0B 2C7RA 2PJPA 1R6UA 1HQKA 5IT3A 2OCCH 4Q7MB 5TT1A 3OYJA 2HRDA 4IMPA 1NW9B 1B74A 1YI8A 1LK5A 2WILA 4RVOA 1JTVA 1AHHA 3WS7A 5DYNA 3Q3VA 4M73A 3P9PA 1QKKA 3A6DA 3WGQA 1K3UB 3PDIA 2WFZA 4FUTA 1YBAA 4CF6A 2LY2A 1GUUA 3T38A 1O57A 2YFYA 6PFKA 2J5XA 2K4MA 3PNQA 3P94A 3W04A 3HP7A 4ZEXA 1TNTA 1SKAA 3AJ8A 2ZIFA 2J0VA 1XF9A 4NBQA 3VPSA 2A14A 4Q24A 4OJYA 3N6VA 4MP3A 2QX6A 4YX9A 1Z3CA 5JZMA 4DM4A 4PYQA 3DXYA 3VBCA 3MMYB 1T0BA 3UGJA 2FZ4A 3PDUA 5K5OA 1TKRA 3H0CA 1EGMB 2I6GA 2IIPA 3C6MA 2E1OA 3OQNA 3LAWA 3JWHA 4HADA 2DKNA 1YHZA 4FONA 3RSHA 1E77A 1P7YA 4YJFB 2IS2A 3MEQA 1VMAA 2P27A 1RR6A 5BVGA 2PUEA 1AM4D 5HZHA 1B8IB 4L9WA 3RVQA 4MQFA 4NZMA 2J85A 3MF4A 3AVTA 1CY6A 2ZJOA 1NJ5A 3G8DA 4FP9A 1RBYA 2OZUA 1T8YA 3CW9A 1AB6A 4JU9A 3UXEA 1A5BB 1FDUA 3LOQA 3E05A 1MJHA 3B6ZA 3R6TA 3OPVA 2JMWA 1T9DA 4ZOLB 5FP0A 1UL1X 1OY1A 5CA0B 1FY2A 4HC4A 1Y6FA 4H17A 3UJAA 2NVUA 2OYRA 4UNRA 2IYLD 5G3ZA 1RAFA 4B84A 2EEZA 2Q62A 2GPSA 4BN4A 4GOJA 5DISB 3GLVA 4X65B 3H19A 2W85A 2A86A 5DTEA 4NONA 3J81Z 1CYDA 4OBEA 4V03A 2KS6A 1XG1A 1Y6RA 2IBMA 2JIZD 1AUPA 1MLDA 3F3KA 3HXPA 4I55F 3CUUA 5KHLB 3CEHA 2XQIA 3UK6A 1TYCA 4TTQA 5B7GA 2XV1A 5AJVB 4BNVA 1ORKA 2BF7A 1UKZA 2QT1A 1PGOA 4X94A 2V1NA 2E4UA 2BFCA 2HK9A 1CULC 2VNKA 3ZEIA 1K6OA 4BMSA 1ETVA 5G4KA 3T7JA 1CUCA 4P22A 2PL3A 1T98A 2IHJA 2VUIB 1A88A 2Y0CA 3A28A 5CW1A 3CV3A 1UPCA 3ZH2A 4QBIA 4LRUA 5D3KA 1I4TD 2VP4A 2Q6LA 3M8JA 4KE7A 3T3PB 1KERA 5TEWA 1BMTA 3E3NA 2QE7A 2Y1OA 3TE6A 4PX2A 2VPZA 3FJ1A 1HNZB 1P4RA 3P0RA 3A70A 5T8KC 4MROA 4B79A 2GF2A 3LUBA 2VDVE 3OD5A 5F2OA 5IASA 1P4WA 1OLXA 1P3DA 1S1MA 2HCJB 2FDCA 2YXLA 3EODA 2N1MA 3QWBA 2P0YA 4AN0A 1DXQA 4PJ0C 4AMUA 2ZE7A 2A0UA 1V4RA 2H8GA 1UWLA 4FB4A 2JW5A 3N3BC 4BNXA 4AN1A 1YBHA 1YIDA 2ACEA 1W36B 2XHKA 1UKAA 4MUHA 4X63A 2NMVA 2DFIA 2OV6A 4UTRA 3I61A 4F2DA 2PH7A 4PICA 2BM0A 2J5PA 3MD2A 2UYOA 1DBIA 5AVOA 2B63J 2QM8A 5CK4A 4D6YA 3AFGA 4LKOA 3JZIA 4MRSA 3ADCA 1GR0A 3DOEA 1PFKA 1I0IA 2YXEA 4AIKA 4RGBA 3WMRA 4IJQA 1W85A 2C0QA 3OC6A 1Z5GA 4WJLA 1MFPA 1BCRA 4JSTA 3G79A 3K8ZA 2C7BA 3N0TA 4HQ0A 4WY8A 2RE8A 2X9LA 1WMBA 2B9EA 1MAUA 5DT9A 2DF8A 4WUTA 1QGPA 5FUVA 3UWKA 3FCSB 2D3WA 2RB5A 2DR0A 4OQFA 4Z1MD 4DMRA 1JDNA 2OHHA 1W0JD 1SQGA 1YCFA 1MN6A 3L8DA 5FNZA 2A9OA 2FVYA 3WBFA 4AS1A 1QK4A 2ZEJA 1YL6A 5PNTA 3CSSA 2R6ZA 4MKGA 4ZVOA 5BURA 2ATVA 5E1WA 1JAYA 1LRKA 2Q7DA 4M72A 4YQEA 5FKNA 1HEYA 1E2KA 1BWRA 2YHSA 1PT6A 2KMLA 3CTPA 3BD7A 3TB6A 3HU5A 1AK2A 2HXGA 3LD9A 1JE0A 3UNXA 5AOBA 1N2CB 3ILHA 2Z3WA 3CN9A 2PD4A 3VNBA 4EX7A 2HJVA 1OX5A 4M38A 1NY6A 1O95D 1R5OA 1W94A 4XJVA 1WXGA 4WLFA 4PSCA 2ISQA 3OLZA 4ZPJA 3SJZA 4UNQA 5KPDA 4IFTA 4HF1A 2XKBA 1OXKB 1IHDA 4I1YA 5JR3A 1I3LA 3L0PA 4F5WA 2GN0A 4MIYA 2YS7A 3UAOA 1TYBE 4GMGA 5HDQA 4YCLA 4RQAA 1FDIA 1EXDA 1BL0A 5GOZA 1HDPA 3MLEA 2IZOA 2B1GA 4MPRA 4YMHA 3IA7A 2AXTC 3D6FA 4ZYVA 5TS3A 2HMTA 1II0A 3ZDXB 2PX3A 1ZK8A 3LP5A 3OX1A 1MIOB 1P1CA 4YP0A 3DVQX 2WYHA 5AOAA 3L8ZA 2E4YA 3HSSA 3FF5A 1DMSA 4LDJA 1VKNA 1TEVA 4TTAA 2WI8A 1N9GA 3TQTA 1NU6A 3U3KA 4RSHA 2RKOA 1E2PA 4ANFA 3KZKA 4K9OA 2IUEA 1T4CB 3BMOB 3W6OA 3JREA 2XVAA 4R0VA 2GYWA 4DMMA 2P65A 3NWPA 2H48A 4UCQA 4F8JA 2IBDA 5FL7D 2GEJA 2VZEA 5J59A 4PG6A 3DR5A 5JPCA 2HTJA 1VCHA 3NBQA 5DGHA 3STTA 3DLIA 2CFXA 1SUPA 1IG7A 2PMHA 2O20A 2VODA 1BHO1 4UCFA 1MZBA 1V55H 1J0DA 3VX3A 2P41A 5A3SA 4BDSA 2HMSA 2O6GE 4WCGA 2R5ZA 2IVFA 4Z5XA 3DVAB 3W8NA 3WA6A 1XEXA 2DUJA 2NTEA 2Q46A 3K2AA 1GPLA 3GLIA 2B4TO 1YIJI 1AOYA 3GT4A 1EK5A 1CEXA 1NPDA 4E7KA 4C3VA 3RC9A 3VSBA 4UUAA 2DQYA 4CZ2A 4GI7A 2ZR7A 5C9ZA 4QWQA 1C8BA 4MVWA 3KUKA 3QP5A 4YGXB 1ILWA 2VNJA 4JP2A 4BVEA 4YI3A 4F97A 1QP4A 3ROZA 4ER6A 4NS4A 4PRLA 1VG8A 2ZVQX 2O2ZA 3TDKA 5M29A 4CW7A 1GUFA 1PJRA 3EVTA 3TGWA 4PFKA 4ACAA 3T7IA 7MHTA 2II6A 3VDXA 4B46A 4CMJA 1G55A 5CVJA 4JB3A 2W8ZA 2HT6A 4HDRB 4MLZA 4OOEA 3QX9A 4M0MA 3BC8A 4AWBA 3WO0A 1YL7A 5AVKA 4ZJPA 2ZJ5A 4TZKA 3LSHA 1XRPA 3GJ8A 1F7VA 2WT9A 5FEUA 2XUJA 1ODKA 3H0EA 5KREA 4YY3B 1S7CA 4Z7NB 4L5AA 3UK1A 1EDOA 1U31A 4HWKA 4PBTA 1IEQA 3IHUA 3DOJA 5DM70 3BGWA 3I3LA 1YO6A 4MI3A 4ILEA 1X7GA 3ABIA 3W5JA 1U65A 1OAOC 4MWBA 2VZ8A 1AMNA 2W0MA 4D4IA 3MG9A 3CUOA 5K9ZA 1I2ZA 2A58A 1YK0A 2HHJA 3NASA 3V5NA 3I4CA 1RESA 4LF4B 2JNWA 2MSWA 4KQCA 2X9NA 3DLPX 4QYIA 3UMCA 4FHDA 4IRXA 2F8LA 3K69A 1Z0XA 3CCMI 3U4DA 1CUWA 3M3HA 4F6RB 4P4SA 4EEXA 1J8YF 3HBLA 1RFLA 1FVXA 2YV4A 3OIOA 4MKHA 1A8SA 3KQYA 3C43A 1OHHD 4IQ0A 3L1JA 5F76A 3JARA 2Y05A 5JHHB 1MT3A 1ZPDA 1YAJA 5FLYA 5AO9A 2G83A 3HEFA 4KZKA 3HMQA 3WJ1A 5B3JA 1OV4A 4CM7A 3GCWA 2P6OA 2J08A 3FAKA 2CWEA 4IDPA 4P8RA 1I10A 2WJ4A 2PTGA 4NNPA 5ILQA 4KDFA 2QTVA 3G1OA 3KR0A 4JV5B 5TGZA 3PXAA 5YASA 3IT1A 3WTBA 2V7EA 3E7PA 2N75A 4IXDA 4NNOA 3W2AA 2CMDA 3D7SA 4RAGA 2J32A 1THZA 1SIBE 3IRUA 1ETYA 4XB1A 4NDLA 3DTIA 4D25A 2ZBRA 1FBTA 4ADSG 2RVCA 3E6CC 4CDMA 1G6OA 3SJAA 1JB9A 4DC0A 3F2IA 1W73A 1P0PA 4I6JA 3EXIB 1CY1A 2PGDA 3UAGA 1T4BA 4OSOA 1R37A 3MXOA 1ODSA 4D8TA 4H4CA 3R3XA 4FW9A 3HVIA 3CRQA 2C9OA 4DZRA 4PHFA 3K4MA 1BMFA 4CDGA 2O3RA 4CWAA 3N1UA 4KLZA 4I2OA 3L0CA 2KLHA 4EHNA 1JSXA 2CC2A 4U0JA 5HM8A 4NMMA 2JH3A 5FRDA 1Z12A 1NIPA 3EW9A 5BRAA 4P86A 3E8SA 2XMGA 3M70A 1F6DA 2VDQB 3K9BA 2A61A 4MS1B 4XDYA 3Q0TA 4K8RB 3S2DJ 2O8DB 1H2RS 1JDBB 1YVDA 4B3JA 1NG9A 2ZC2A 1OIWA 5IMBA 3D8SA 4YV1A 1GV5A 2BFFA 1FUEA 1KRHA 4V38A 1Z62A 1GHCA 1AKVA 3FOWA 3V46A 4AUKA 1A2BA 1CUAA 1NN3A 3GFOA 4G4SP 2W6IA 4KO3S 3WLQA 5CT9A 4EUKA 1XXLA 4QUGA 3U3ZA 5LZ2A 3DMRA 1H3FA 2C5LA 3W6JB 4IQ4A 4R1NA 3Q2KA 3SIPA 2EK5A 3T61A 4E2XA 5LBIA 5COAA 2HBRA 3E0XA 5H9VA 1YZKA 1GGKA 4X84A 3EIUA 1X0XA 3CIFA 4ETIA 3ZCUA 3C7KA 1TWHJ 2MIIA 5TGDA 1ISRA 1MOPA 4DCCA 3WNQA 2NUPA 3GP3A 1QPBA 1H2AS 1VZ3A 2H09A 5HE8A 3M4ZA 2X0FA 1L2TA 4OY3A 2ZPUA 1YBFA 4CPDA 4K1LA 4H1UA 3TM5A 1NP6A 3UWOA 3EPLA 1OTYA 5BSTA 4P98A 5KWVA 2NTJA 1XZBA 3JQQA 2WU4A 2FRDA 4MQ6A 3CZ6A 3JZMA 4OI2A 3HJEA 4Z4HA 4RK5A 4AROA 2A5LA 2YXDA 3STVA 1P2DA 2OHXA 5C51B 3B60A 1XEWY 1R6VA 4KMFA 4M21A 1R4ZA 4RMHA 2Y66A 1D6JA 1OFTA 3T94A 4RM2A 2VSFA 4IX7A 3B9RA 4B35A 1KU6A 4NZZA 2NYVA 5CNIA 4JP0A 4UXIA 5ISMA 2RJOA 2XCLA 5IS2A 2HMVA 3JXEA 1DPFA 2NT3A 4CQLB 5JD3A 5K09A 1BDBA 2X9GA 2UUPA 1ZWKA 1EUCA 4E1AA 5CJ2A 4A0YA 3PLAE 3Q7PA 4IIJB 4NUBA 5I4CA 4G1MB 4QOHA 2R1TB 1C7FA 2H7YA 3ZBPA 4RAYA 2XECA 4JVNA 4WOKA 4YFVA 4PLGA 3KWJA 4HR7A 3NT4A 4WH0A 1FJ2A 4NK5A 2F8TA 5LXTF 3BQNB 3VEPA 3QF4A 2QG9A 4ZQGA 4QRIA 1PUXA 3IAS6 3GJYA 2VP9A 4RE5A 4G5XA 3SS9X 3EVDA 3GBSA 3C16C 4EM6A 1JKJB 4KI7A 2H2FA 5AVSA 5DS9A 3JWGA 3WV4A 3ZUGA 5TF0A 1AURA 4Z0NA 2YZNA 4EYKA 3OVMA 1BQ3A 1FXWA 1LU9A 4X1YB 3KJIA 5K0GA 3ZHQA 4U2EA 3GVIA 3CA8A 5AJYA 5AM1A 4CLRB 2YHAA 2FLVA 4QO7A 1PSDA 1ZAYA 1CUEA 2O2YA 1N5JA 1T0IA 1XTPA 3RG2A 3E1GA 2AQEA 1AS2A 4AICA 5G1PA 1ZD4A 4KH0A 5FLXZ 4LG0B 2BBSA 5I8PA 4RB1A 3ETEA 1CCWA 1SXJC 3GCDA 2TSYB 3MWGA 2RCNA 4BNFA 4NBNA 3KJQA 3OQ1A 3ZDDA 5EJ9A 2FN3A 4BKPA 1QYIA 2ZZKA 4ZYGA 1VDZA 3AY6A 3SZUA 3LRXA 4DC1A 4PLTA 2OUIA 1R8JA 4F91B 3NQOA 2CT8A 3BG6A 2C95A 2YZKA 1WKBA 1TCAA 5EFOA 4A3LJ 5TRDA 4JXZA 4ZV7A 1ZOIA 4HVTA 4ZO6A 5DH9A 1MOZA 2M9HA 2HNAA 2JEZA 4FEEA 1ZYUA 5DTJA 1XPJA 3R74A 1KBQA 2PBIA 2WTAA 1OI3A 1TQPA 1B1AA 1U11A 4R5MA 4XDHA 1X1AA 4AZWA 4B3GA 4W6ZA 1N7GA 3QV1A 3CXUA 3DAYA 3A27A 5F6FA 3WRXA 1G4UR 2OP0A 2EGUA 1Y1SA 4YJ3A 1JKOC 3C8ZA 2G82A 4DV3B 2R8BA 4HXYA 3TUJC 2BN4A 1ECGA 1ZSYA 1MH1A 3H1TA 2ZB9A 3TVDA 3M9WA 3GZNA 4DLLA 2D5CA 3WL6A 3OF3A 5G0WA 3H7IA 3R3UA 1ZN2A 1Y4UA 1N78A 1FXWF 1OBFO 2DQ4A 3HVRA 3H5LA 4NH4A 4FFOA 2PE5A 1BS9A 2EBHX 2C7OA 1Q74A 2P9GA 4RIFA 1RJ9A 5DVZA 4XFKA 4ZZDA 1RYFA 2FWPA 2I6TA 4CM3A 1GXQA 4IDQA 3LOUA 4YCAA 5FADA 2DERA 4RMIA 4WZBA 1KQ0A 3WLNA 3TOAA 4OIQF 4Y2TA 1D0ZA 1LB2A 2FW8A 1VHDA 5KYXB 1NI4A 1SU6A 4CDNA 1YE3A 1GPDG 1QLWA 1OU0A 5G1OA 2QL6A 3A1DA 2MLKA 1XKQA 4FFVA 2OTCA 1GPKA 4BPRA 2NXNA 5TMEA 3CLVA 4B48A 3FPGA 5JJBA 1Z91A 2WZBA 4RTJA 3IP8A 3FF4A 4BWGA 1NP7A 4M49A 2G25A 2GCOB 2R93J 3PRYA 5KMGB 1E2JA 5DCLA 3DMTA 4R1QA 4L9NA 1TECE 3PTZA 1IHYA 4B33A 2RHHA 1JEJA 1U3EM 3H2YA 3WB0A 4L4SA 2Z8ZA 3ZYCA 1GILA 4Y6QA 3UMYA 3NPAA 2Q9CA 2DOFA 2IS6A 4KP7A 1GNRA 3P4YA 1QK3A 2EJBA 3ZIAD 3FTEA 1QVRA 3GGGA 3CCCA 1Z88A 3BZCA 4TMVA 4YMUA 2FPUA 2XMDA 3G6WA 4M6WA 4D57A 4B2LA 1E3IA 2ONCA 1E9SA 5EG0A 1SC3A 3NXKA 3O4RA 4EECA 3ISPA 1VQ5I 3AESA 2PUVA 2VAMA 2R6JA 2CDNA 3IVMA 4JUBA 2FFRA 2LE0A 4C3IJ 4QICA 3UPDA 1YCHA 1M10A 1MD0A 1JVSA 1WULS 1UKYA 2LY9A 1Z68A 3N7UA 2XXBA 1HCRA 1UH5A 3HL4A 3LHIA 5LDDC 4BQSA 1ADBA 3CO6C 4EGFA 2OMKA 2BY2A 4JBYA 2LR8A 4ROSA 3WC4A 1XFAA 2CFCA 4DTCA 1YH3A 2AF3C 4XQEA 2H07A 5BMOA 4JR0A 1SC7A 2XB5A 3L5KA 5J1YA 2AQHA 4RSRA 1H94A 5H81A 1V4NA 3UJ8A 3D5RC 2W6JD 4FINA 3AQ4A 3ZWDA 2B21A 1QMPA 1SXIA 1PYOA 2TMDA 2IGNA 3BGDA 1Y82A 5JHUA 1ZHHA 1SVLA 1MAHA 2B20A 3OZRA 2DH6A 3L0IB 1C3OB 3T1NA 2FP4A 4Q3AA 4TL9A 1FP4B 3I3SR 2DA4A 5HEKA 3W4IA 3OZIA 3CCQI 2I29A 1E3JA 1HDOA 3T5MA 2Q5LA 3SC4A 4FPXA 3CT6A 1BX0A 3FNEA 1KO1A 1XMQB 5D6NA 2CEAA 3RD5A 3NUQA 3DZDA 3NS7A 4JY7A 4BY9E 1L7DA 3FVVA 2F4NA 1IAWA 3IHWA 2LMDA 5LQAA 4B4KA 1OR8A 4R68A 3CZCA 3CCJI 5DKFA 3BFPA 5L3DA 1JQKA 4IHJA 4EHHA 3HHPA 1I0ZA 5JHFA 3LBAA 3VZPA 2XYPA 1VQ6I 1U8YA 3VVCA 3A9RA 4J76A 3AP1A 2PSHA 5M5YJ 3BAZA 2GBGA 2VTBA 3CZ5A 4OP2A 2NW6A 1K4MA 3K9HA 2C4MA 2JHAA 4DWWA 5JXGA 1E3PA 4FFWA 5ILSA 2LP4Y 3AKEA 1NT2A 4W5WA 4NJEB 1QE0A 5KQGA 4DCJA 2CFIA 2FPIA 1DUVG 5A4DA 4K6MA 1JF8A 1JLHA 1UDXA 3OZUA 4ZANA 1HFWA 4ZVVA 3ZCTA 2PUBA 4UUQA 3WNZA 2ZKIA 3RVLA 3HZHA 1WW8A 4REOA 2O19A 1VQPI 1ZIYA 3CO5A 1JU3A 1KMIY 4QDOA 1G1MA 4BLQA 4W5QA 4LRTB 1RKXA 5CVDA 3HEBA 1ZOPA 3KP2A 3Q3HA 1MV8A 2P2LA 1NBIA 1W30A 2JHCA 3TWOA 4Q9JA 4FN5A 2L9VA 4LKRA 2UV8A 3L6OO 3BN3A 2HMWA 5JWRA 3MN2A 1AKYA 4UNSA 4XLTA 4C6SA 3WISA 2JJ1A 3A1FA 4E7LA 4EFKA 3VPRA 3T5CA 5LIPA 3MAGA 1CUYA 4BJ6A 5BW6B 1D1BA 3SQOA 5DRYA 4URXR 1EH6A 1M1ZA 1ZOOA 3AUYA 2ZYRA 4ZFNA 3N0VA 3GAFA 3OQBA 2XPVA 5HFAA 1U0JA 1EFLA 3RBAA 2VHEA 1X92A 4PLWA 1ZK4A 2Z16A 1XALA 3TLGB 1DARA 4L8YA 4JX6A 4D3DA 3ONVA 1BA3A 1VE5A 4LMYA 5FOQA 3ONWA 3SQWA 3IUOA 1D1AA 2C4KA 3PGA1 5BOXA 4S1VA 3SHVA 3G5MA 4CLOA 2FYTA 3QKUA 2QZSA 1M1YA 2FQ4A 4WGGA 3UWPA 2KLBA 1RHMA 2WABA 3CUWA 2H1HA 3QLVC 1EK1A 3CZQA 3K9WA 4O8CA 1UIRA 2W7TA 3ND9A 1PFWA 2PX2A 2QRJA 1NBME 4EG3A 1VXRA 3JV7A 2UXCB 3JQFC 4O4HA 1U0NA 2OKGA 1O9GA 3HCDA 4S0XA 2BVNA 3LMKA 5T4BA 5HRUA 1LD3A 3JYQA 4C6HA 1SXJD 4ED9A 3HFGA 3AR8A 5I4BA 1SXPA 3P26A 2K9SA 5JMOA 3IERA 5C8YA 2HUNA 3FYDA 3KQNA 5F0FA 2MC3A 2QRLA 1FX0A 1SIOA 4D3FA 1E3DA 3F9KA 3FDJA 3DU6A 1ZD9A 2RCYA 3HCCA 3CO7C 2WUVA 2E36A 1J2EA 1P8AA 4A8PA 4ND1A 4BFUA 3HKEA 3DA8A 2IW5A 1LPOA 4HTAA 2IXBA 4B7AA 2R7FA 5HLHA 4LZPA 1WWKA 3SC2B 1F9EA 2GJ4A 3EUWA 1SFKA 2E1MC 4E5VA 1OFHA 1A5ZA 3M49A 2VXOA 3JSPA 3E15A 3NJRA 2BEUB 5ECDA 3FHOA 3FMPB 1R7JA 5KTKA 4QJ4A 5JO9A 3QEKA 1WZ2A 2YN0A 3E3MA 5JSZB 8ADHA 2DX7A 1JHYA 3OSFA 2BFDB 3QHQA 2HLPA 3OTOB 3C7TA 4EGZA 4M1YA 2J67A 1ZRHA 4F8EA 3VQTA 2ZSEA 4XVHA 4DMKA 1ECFA 4L2IA 5KQPA 3CWZA 4Q1FA 1IK6A 1YQXA 1XN4A 3ZQHA 3RYFB 4EPVA 5BSWA 3GTJJ 2WWTA 1YZYA 4JGGA 3TD6A 2PBZA 3GAAA 4FD2A 2ISYA 2E7XA 2FX5A 5IJ0B 3R9WA 3FTPA 3UPTA 3ZJ5A 2D1QA 3D64A 3VZCA 1LLDA 2FPMA 1DG1G 1RI4A 4JH0A 3DTVA 3KP3A 4LSZA 1IBCA 5C8YF 2F1IA 3FZQA 3TEJA 2R6HA 3HNRA 3WE3A 1PS0A 3DLCA 3BGVA 4G9BA 4JWKA 1HC8A 2PJRA 1QDEA 1OZHA 1I7SB 2IXAA 1HZZC 4F21A 3DEEA 5B2EA 3LQRA 2E4XA 1X4OA 1E6LA 2LF7A 2NLOA 3ZDEA 1UWCA 2CN1A 1JIIA 4TWBA 2ADOA 1AU9A 4F56A 2FY8A 3LG2A 4YDRA 1MTZA 3I4NJ 3RGGA 4JNCA 1VPEA 5BSMA 1SOVA 1DC5A 3OJXA 5HS7A 3G1WA 1KYTA 3TQQA 2Y1LA 3P71T 1QQBA 2ZUTA 2O50A 3B6EA 4KIJA 3QRFF 5TPZA 2J6IA 1KIMA 1ICEA 2A2ZA 1GN8A 4U5XA 4R81A 4WHMA 2G5CA 1GU7A 4RPHA 5DYYA 1C8KA 4AP6A 4OQQA 4OCZA 4D5GA 1AT1A 4IJKA 1SUIA 2HSEA 5HGJA 1C0LA 2RIPA 2BZTA 1T1SA 1TAGA 5EAIA 3B02A 3S0JA 1M72A 1YU6A 1L5KA 1R9TJ 3PYXA 3KP6A 4QNRA 3AEKB 3HBAA 2XWJI 2GD6A 4YUYA 2A9RA 2ROQA 1UDRA 1EI9A 1XDSA 3BVPA 2YIDA 1Y1TA 5BSKA 4ZTZB 4P7FA 4HF0A 1Q6ZA 221PA 5LQMA 4X8MA 3IQEA 1XX6A 4MICA 1ZQ1A 4MR7A 4I1RA 1KO4A 5HA5A 1OX4A 1D03A 3UTDA 3CVYA 2QL5A 3CRMA 1CJTC 1EWYA 4I1VA 4MVJE 2Y0MA 1JHQA 2OB2A 1EB9A 4TXMA 2G5TA 2YWGA 2JGKA 1Y1LA 1KQ9A 3I28A 4JX8A 4ES6A 1XNGA 1PCXA 1UWKA 3IUJA 5K4AA 3LX6A 2A1UB 4MW5A 2K86A 4IIEA 3VKWA 1R64A 1CJKC 3DL4A 1B1BA 2ZSFA 4JI4B 4TXNA 3QKRB 1M1NB 2ZUDA 3FIUA 1QRYA 2O0LA 3IO5A 4LQLA 1NRIA 3LBHA 1FSHA 5J1SB 3RQIA 2QPTA 5IYBJ 3N05A 2FDRA 4M7WA 4OU0A 5DGXA 1YITI 2P90A 1T5SA 3H2SA 5AFSA 1PS9A 2RHMA 2XUAA 3STHA 2OP1A 4DLTA 4B4OA 5CIQA 4K28A 2NNNA 1ABEA 3CURA 4OXYA 1OCPA 2JLYA 1U9IA 1U0RA 4IHXA 5CFNA 2V1UA 1J07A 1E9VA 2FGKA 5JMPA 1NN1A 1OLUB 3C3YA 4U9HS 4F7ZA 1DHTA 4E5DA 4WIAA 4FC6A 3K94A 2ID6A 3PUFA 4BVGA 3E6DA 5DGDA 2YJ5A 3Q0EA 4OJMX 2AS5F 3ZLVA 4ZVQA 1V3UA 2JGNA 3BZKA 4ZOEA 3L9XA 1LPBB 1Z16A 2ERXA 3JAKA 2WR8A 3GYHX 3IAM6 2BTOA 2OCGA 1P6QA 4WY2A 3B1ZA 4JGIA 1M2KA 3BH7A 1CE8A 1RPAA 3SYKA 2XGSA 4EAAA 3ELYA 3F74A 5DYMA 3SXYA 5BVHA 4A0XA 1KI1A 4W1SA 4WCVA 4JOBA 1UFVA 4X54A 2ZUFA 4F3TA 4X91A 4XLPF 3DUFB 2YQZA 2QJOA 1JN0A 2PJDA 3ZI7A 1NMQA 1KFEB 1FEZA 1KA8A 5FROA 3S1SA 4HUJA 1H5NA 4FQ5A 3GLGA 4M74A 1ARZA 1HG1A 4NAUA 5JNSA 2HYJA 4HUQB 3NG1A 4FC7A 1ZUD1 3FOAA 1WD5A 2D8MA 4G4GA 5T7BA 2J31A 2CVZA 3ZMDA 2P4SA 1N8KA 1XTSA 4IYRA 2F17A 3I83A 3I59A 2QAGC 4LRSB 1YVRA 1R5NA 2CEKA 3HM2A 2FE3A 3DXZA 4DL9A 2IQ5A 2Q3CA 3S2ZA 3ZVRA 3LL4A 4MX8A 1JKIA 1TQ8A 4A91A 1VQMI 1QHFA 4RIIA 3TIVA 4B6JA 4CIXA 4B5KA 5ALTA 1S4MA 4YRFA 4FI3F 1RAHA 1CF4A 4XIJA 4FFBA 3D3JA 1R8QA 3CVOA 4E5PA 2X6OA 1B9MA 1Z7BA 3PPXA 2JGDA 5FWXB 3RAJA 2V6EA 3S5UA 4FFPA 5I5EA 3HKCA 4RHXA 1XTIA 2GJSA 2FX3A 2I4NA 3PHBE 2DR3A 1TUBA 1KKUA 1ADJA 5I5GA 3Q8WA 4D3SA 4URWR 4DR6B 3SP1A 2R751 1NV9A 3FPCA 3EASA 4X1OA 3L4KA 1I4DD 2YIMA 5DHTA 1CTQA 3JQ8B 1EJ6A 3G2KA 5CCEA 4HXFB 5EZYF 4YWJA 4YRTA 5L3RA 3ZZ0A 2FUG2 1B8UA 5EWMB 5AXBA 1V25A 4H3VA 4XKBA 3KSMA 2ZSKA 3RVMA 3UR3C 4BNDA 3AR9A 4ZRMA 1GKUB 3PYLA 4XSHA 1E3EA 1YJNI 3KNZA 3PEEA 1Z9BA 4PGAA 3HG9A 3ADOA 2RARA 5EZQA 3U4IA 1CLEA 4OQNA 1CHDA 4KGDA 2JA6J 2QKYA 3DB2A 2UVPB 3AG4H 3VGJA 4LD5A 4IHKA 1KK0A 1P4GA 4A10A 4XPZA 3O4GA 4WSOA 3A7EA 2ZSHA 3QIAA 2ZTHA 1I5ZA 1DAKA 4OFXA 2P9YA 3SFZA 3OYEA 3OZSA 3SOPA 4DPKA 2R6DA 3QZUA 1H22A 4K1XA 5ALKA 3KYIB 1GYPA 1HH4A 4Z54A 4MGIR 5FUQA 2ZITA 4I55A 3HXMA 3D7NA 3KZYA 1L5SA 3M07A 1P5JA 2XE4A 3ANMA 1AQIA 2VPWA 1Q83A 5D7NA 3GELA 3FSGD 5IVPA 4D8VA 3REQA 1J0CA 5DD8A 4K6OA 1ZCZA 5JCZA 2XSZD 4IGKA 2MD5A 3IV5A 2Q6OA 3UH0A 5CG2A 1PZGA 4FHZA 3ZMSA 4FJ2A 2I55A 2IA5A 4R8KA 2R7OA 2GAUA 1MTOA 1C41A 5LC1A 2YHBA 4OYRA 2OUMA 2G6TA 4KPUB 2FLKA 1YACA 3U37A 1VJCA 2FKNA 1RIOH 4O2LA 1MVLA 2J8ZA 1E3TA 1SMYF 4KUGA 3P27A 3L0YA 3KJXA 2WAEA 4YMTA 5LJLA 1HF0A 4N3AA 2F62A 2B2NA 2N47A 2BI8A 1Z6GA 3U4CA 2VB6A 2UWMA 3FDFA 3ZQJA 3H36A 3QWAA 4MRRA 5K51A 2Y71A 4KNWA 3WGLA 4CCKA 4HAMA 1ZH6A 2LY1A 3EG5A 2WMYA 3W2GA 2KB0A 3ILXA 2FAXA 3ZXIA 4BKQA 4OP1A 1ZNXA 1QS0A 2Y93A 2XNHA 4ZC1A 1RLJA 5AK3A 3ZD6A 2H4JA 1XF1A 3OI7A 3IPAA 5L45A 3KDAA 2RGYA 3PUKA 4HLDA 1I6MA 5F7XA 3RTGA 1MAVA 3F5DA 2ID9A 5C1OA 3HL0A 2A0WA 5K4HA 1ECJA 2H7VA 3CWCA 3NDPA 3AAFA 2W90A 4BJHB 2ELHA 4Z51A 2VRNA 1G5RA 4AVYA 3PFYA 1Z25A 3LRTA 4JMPA 1Q0UA 4IDDA 2J9YB 4I46A 3TDZC 1I8TA 3QH4A 1WUHS 3GF4A 1O58A 2QY9A 3K92A 1Y1WJ 1F1JA 2NT4A 2QVBA 1OOEA 3EUHC 2UU9B 3VYWA 4BX0A 4LBZA 4L74A 1QIGA 2ZWMA 2QIPA 4CKBB 3BXPA 1XQWA 5HCIA 4M7RA 4MQMA 4LHXA 3OLWA 3RADC 5F08A 5H80A 2XTZA 3O8QB 5I9MA 4Z2YA 1N57A 3QFSA 4L0DA 4PG4A 4PYNA 1ONBA 2WU3A 3WL7A 4I5DA 4UJ3A 4HEA2 5DHAA 4UZFA 1RXUA 3NJ4A 1QGAA 3ZR8X 4F0JA 3G71I 2Y9YA 2XE8A 2H4HA 1TF7A 4O4JA 3LSGA 4KZPA 1Z56C 2QRHA 3RT9A 3GLLA 2F4MB 4Q7EA 3VI4B 1BMDA 1T6BY 4RGRA 3T7EA 1FA9A 4R8RA 2JFFA 4U5QA 3CF4G 5KDLA 2A5YB 3I01A 4CMIB 2ZJ1A 2PRKA 3FMIA 2R87A 2A57A 1EQUA 4PSWA 3CUKA 1E2UA 2I2DA 4KPGA 2H2DA 1R3DA 4RDCA 5CDGA 1ZGBA 4RGYA 2F4IA 2NSDA 1FMJA 4UQLA 1P4XA 4B32A 2D00A 3ICWA 2XX3A 2A33A 2RHJA 2DQKA 4BJ1A 1VI0A 2VLAA 1TAHA 5GPAA 4W7SA 2Z9CA 3ZNQA 3HFRA 5ECGC 3L8YA 3C1DA 1N2HA 3I9JA 3RRFA 5K6AC 3DEZA 1ZM3A 5D8KB 2WE8A 2IT1A 3RNOA 2YINC 1IIBA 3ROKA 4K9KA 1HDIA 4XYLA 1CP3A 2G40A 2DCEA 1XRSB 2AXLA 2FDXA 2C6YA 3FXJA 4QOJA 4DR1B 4DVJA 2ZR0A 3IDQA 1GPBA 2E4ZA 2A94A 1Y3BE 4R8VA 4J07A 4YRSA 4HV4A 1A8PA 2XQVA 3O90A 2W58A 1L7BA 1GCOA 1H8ED 3L6EA 2OTLI 4EOGA 1TMOA 4BMZA 4KHZA 2EZUA 4LNUA 4RK7A 1DZIA 4ZTJA 1TT5A 2EC5A 4L4XA 3NCTA 1E9CA 2PL1A 4MTEA 4O4JF 4M3EA 5LQSA 4EQQA 4RZIA 1BZYA 1DV2A 1FW8A 1U5BB 1ULBA 1Z37A 5I9IA 4BP3A 3JCZA 4G2NA 4ZGBA 4LIVA 1UBOS 3U31A 3OR2C 3UHOA 5CLHA 4EKNB 4CLXA 3DPIA 2E2WA 2Q3EA 2RFLA 3QSYA 3EQ9A 2A9JA 3T1TA 2X2EA 1Z5VA 4MV3A 4AC9A 1C0EA 3PFIA 1B3RA 1NR5A 1NHWA 1SVKA 2YVLA 1V11B 2ZT5A 3ZMVA 4P92A 5KHDA 1MF7A 4F11A 4GNRA 3QFCA 4BQEA 4FFNA 3RNLA 5CITA 2VTKA 3KPHA 4KL8S 4OIFA 3MEXA 1W5AA 2ZWAA 4MQUA 1R36A 1J8MF 3AFNA 2M1XA 4BBPA 2W2TA 4RANA 4E7ZA 3GRKA 1NX6A 2IWHA 5DRTA 4X5OA 4B4WA 3PDWA 2YOGA 1G3QA 2QM7A 2POQX 3UK2A 4P5OA 3X1XA 1LKZA 1VLHA 2H0RA 4RMJA 1XCBA 3A6GA 2ZCJA 4BAGA 4L4UA 2V9VA 1WEHA 2GTIA 4EPWA 2Z30A 4CMBA 4UVAA 1VHWA 1NW3A 4U9IS 3OC0A 1Z2OX 4MWOA 3EDMA 2IZ0A 1VJ0A 1FSGA 1WHTA 1U3WA 2EA2A 3NAUA 1EH5A 1YR6A 1RRKA 2COMA 4J7CA 3EYIA 2GM9A 3IP4B 3IHKA 3NGMA 2X0DA 1R2QA 1TWGJ 1GCUA 1DLIA 1NQAO 3RM3A 1RTTA 4DLVA 1QFYA 2YHUA 1J1ZA 3BSWA 3S1NJ 1QYVA 5FKLA 1XVIA 1I27A 1FBNA 2FNAA 4J1TC 3SS8A 3I0ZA 5EDNA 3FHNA 4WBSA 4G01B 5DEQA 1T3SA 1TVEA 3QOWA 7MDHA 3DDSA 2D2VA 4HW0A 2HWVA 2OMEA 4RDIA 3DOUA 4AURA 1SCUB 5AKXA 3B2EA 1OCEA 1EX1A 4ZKDA 3U5TA 3K0FB 2FSIA 1GTL1 5ESXA 1ZVJA 1JE8A 3U62A 4HNGA 4XEUA 2C7GA 3BH6A 4AF7A 4QU5A 3VKHA 2QMOA 1FWZA 4NYIR 3O91A 2CF5A 4OOIA 3G88A 3L7JA 2UUBB 5KDDA 1B8PA 5F1KA 2BFAA 3L46A 4AP9A 1L5VA 2C3YA 3F21A 4C2AA 3W8EA 3AL3A 3TQIA 3HZOA 1POXA 3K2QA 1R00A 4OB7A 5BO5A 1JUMA 3CX3A 2AJ8A 2LKXA 4FDVA 2HR3A 1JQJC 4RH0A 4DRXB 2Q07A 3RTAA 4KIUA 4FMCF 1U9CA 3OYMA 2BTQA 1YGPA 1OH6A 1Z2EA 2DPHA 3KJEA 2VDJA 3S1AA 1RBZA 3S2IA 4RELA 2O06A 4HY3A 4NQRA 4K2AA 4ZVKA 3DQZA 3PFNA 2VI5A 3RSZA 1SRQA 1KDTA 1Z2AA 2WAAA 4LVUA 1QO0D 3F49S 3IC7A 2FA5A 4GKKB 5LEKA 2XE6A 4DHWA 2OE2A 4GXOA 4E7HA 3VSDA 1PNQA 3CZRA 1VBFA 4XRGA 4AKHA 3B20A 3MJCA 3QU2A 4RDXA 5LMUB 3F0TA 2ZAOA 2RHCA 3ZMTA 1N0UA 1LLUA 4LDZA 3PE3A 3MHTA 1I6LA 4AZ0B 3IQWA 1J5XA 5LYJB 1VQ1A 2HA2A 3IYLW 1UAYA 2ZIWB 2Q3JA 3C3XA 1E1RD 3TJRA 2ZO4A 1XZHA 4R9RA 2JJ7A 2BHSA 4PPQA 5ICEA 1E0JA 3ZTYA 2W2KB 2QI9F 4DEYA 3TI9A 2JVIA 4IS2A 4KQMA 2V7GA 1HXHA 1DDIA 1OZAA 4CYCB 4JHXA 3CZ9A 4EW2A 4REMA 4XIIA 4MPPA 1GWNA 2W93A 4BFXA 2AW5A 2ZRMA 4CV0A 3BG7A 2QVZX 4GNKA 1P7WA 1YR3A 4WKCA 2P91A 1CF7B 1A8HA 2WTBA 4CDRA 4DCMA 3OQPA 2HRZA 2KHZA 5LHHA 3ZQLA 3SEQA 2IX9A 1CR4A 4CQMD 3MB8A 1U8XX 2HYGD 2IYSA 1H1DA 1DMRA 2V65A 4EUSA 1VL0A 1GN9A 1YD7A 3RKWA 1M5UA 4Q01A 4HPXB 2QJFA 4ARUA 3WLTA 4AKTA 1ODCA 4Z4GA 3B1YA 3BHNA 4DA7A 4CMEA 3D8UA 2ECKA 5DLPA 3RIHA 2P2DA 5KOHB 2VIXA 1M67A 2J87A 3TLKA 5DLQC 4DCGA 1DJMA 3KE9A 2ZRHA 1YUNA 1P4SA 3HCAA 3O47A 4F9GA 4GYGA 2XXJA 1XRMA 4F6LA 4YNBA 2J9XB 4UC0A 1E2FA 4BGDA 1U81A 3OP4A 5FH9A 1GG9A 1HOTA 1IRGA 1SB8A 3ANSA 3TLBA 3CCUI 3TZQA 2QYTA 4KAXA 2ZSIB 4AUEA 1D2GA 4C0QC 3PIPF 4OGKA 4I9UA 2XDAA 3PJFA 3FH0A 1KYWA 3OPXA 2FTKE 2JN6A 3CE6A 1GKIA 5F4BA 3HKZA 2VJPA 3QELB 4N6NA 4YBZA 1LKXA 2E18A 3LLMA 2QGUA 4WN9B 4MCJA 3PI7A 3FBNB 1JE1A 5G0TA 2OCEA 1ORRA 1SAUA 1EEXB 1QVVA 5CD1A 2V7BA 3D5SC 1V37A 1ZQ9A 2EGGA 3BB3A 4ZAYA 5C1BA 1E4EB 2ODQA 4V19K 2QORA 3RU7A 1T0FA 3FXLA 1I1GA 1E1LA 5LLQA 5C7LO 3NIBA 1C3LA 3NDBB 1Y3IA 1JKFA 2HMYB 3G2NA 2NOJB 4RQTA 1EH8A 1EZ1A 5LA6F 3LQFA 3RRNA 5KO2A 5DGTA 3HEAA 3BXFA 3LYAA 3AVWA 2O2IA 4RULA 2DA3A 2VYQA 1R88A 4BVLA 4DR5B 2WWYA 4KN8A 4E13A 1B1CA 5GY7A 3WX0A 3KZIC 3KQVA 1MAWA 4U9UA 4ZXFA 2QNRA 2P4EA 2UZKA 2RQQA 4XYGA 1YQAA 2PPLA 3NUGA 3S7ZA 5FOSA 5I45A 2L0XA 2D0OB 3ZHUA 2LYCA 4GKBA 4R9NA 1G59A 1TQ2A 3FZYA 5HQ3A 2IEIA 4O2BA 3M1AA 3C8DA 1W1WE 4LLLA 4LXGA 1Z9CA 3ER9A 1LBHA 4LXIA 1K4KA 3CGGA 4I6EA 4RUKA 4TQUS 4NICA 8LDHA 4NENA 2FW7A 4EJVA 5GJCA 1E2HA 3NFYA 5LXTA 1JU9A 4RZHA 3BM5A 1MSEC 5CM8B 4PVDA 1HBJA 1GYRA 1TQMA 1ESDA 4LDAA 1UAAA 1GGMA 1P4AA 1JQLB 3BWXA 2D59A 2P78A 5C4IA 1XTRA 3DULA 2Z08A 1K7SN 2DQRA 4JP5A 5AVUA 2R44A 1JL3A 4KR3A 3HB0A 3CT4A 1XAJA 3UAVA 4Q12A 4LWPA 4ARVA 5IXYA 1VCNA 4Y9TA 1BOOA 3HYSA 2NTYC 5ITWA 7ADHA 5F5NA 1JEYA 4GP7A 1OQAA 2V6JA 4BIIA 1C5KA 1W2GA 1S7AA 1QFZA 2EKZA 2E21A 4UU8A 4PQYA 4EO9A 2V9ZA 3G2PA 1RS0A 2XAHA 4G89A 1GL6A 2BMVA 1G7CA 4N03A 1M8JA 3UOAB 3SIXA 4LPSA 4W8OA 1Z7LA 1YQEA 2W4SA 4RESA 4QATA 3FIWA 3TZBA 1B4DA 2P5UA 3CKYA 4Z1OA 3SGLA 4OP3A 1ZR4A 5B5SA 2VBZA 5C35A 2HJ9A 1IQRA 3GFSA 3WB2A 1WCIA 3EDRA 4QEKA 1QX3A 5LZ4A 1TM1E 5HP4A 3PICA 1YZLA 3VBEA 2QQGA 3KR9A 2G5PA 5K7SA 2I3GA 4D98A 1NMSA 4O2BF 5F9MA 3ZY2A 4BBAA 5EJ8A 3RUPA 3AF1A 4BZWA 1FYWA 3L8FA 4LXXA 3RVDA 5K7ZA 5B58C 3GLRA 3LX5A 1RC0A 2CVFA 3PXDA 3BSFA 3JQGA 5F9HA 2NNYA 3QYFA 1QHSA 3E3OA 4DYQA 1BEEA 1CW2B 2BUBA 1C2YA 1ZCJA 2GM4A 4FD3A 4D82A 1R5GA 1OMIA 1MRZA 4L0QA 1LZLA 4MRPA 2X2OA 4WVLA 3ZN0A 2PG4A 3QBVA 4IW3B 4M1ZA 2VHJA 5JBQA 5LQNA 5JXJA 3ZEAA 5KNDD 2KRCA 5B53A 4RVSA 2R8EA 1M83A 4UARA 3F9IA 5IPFA 1J2JA 4HB0A 5CDYA 4JVOA 1N6HA 1HLPA 2WMOB 3TQOA 2CYYA 2QTGA 2E1MB 3T3OA 2BVLA 3K5PA 5KQSA 2PT7A 1BIAA 1FUUA 5ALSA 2JIMA 3ZGOA 4BATA 1IY9A 3F6YA 3Q8KA 3EPPA 3HGGA 3EIWA 3DMFA 2O2JA 3LK7A 2STWA 3OTIA 2LIVA 3TQCA 3VI3B 1Y7IA 2PL9A 4PO9A 3BERA 3IP6A 3ESQA 1ZKMA 4ZHQF 3E22A 2NO5A 1DC4A 1ITZA 5A6VA 1TADA 2QOEA 3SBDA 1VIMA 1QC5B 2XF2A 4M37A 1HW1A 2GVNA 3HA5A 1ZSNA 5LMZA 2FBIA 2FEWB 4OUKX 1ZK3A 3EC7A 2WZCA 4JVSB 1VIVA 3IWFA 2CXNA 1NC1A 2HKXA 1OYVA 2ZBPA 4CTOA 1N7JA 4G3XA 1CUFA 3OPYA 1E20A 3DLHA 4RZSA 4MH0R 5ALIA 3KQQA 3FG9A 3C41J 4R54A 2P35A 1SELA 4OQZA 2ID7A 2STTA 4LTDA 4M2LA 3L0ZA 1G0OA 3O0TA 2JIBA 1US8A 4HS4A 1K5HA 4CODB 5CYOA 3TOBA 1ZGWA 3U3MA 3FJOA 4JD5A 3V4LA 4AJKA 4GM0A 4EG4A 4AS2A 5E2IA 4FGSA 2XIJA 4K3VA 1USKA 3R9IA 3L6UA 3TIGA 4IDAA 2HOAA 4U0KA 3GHYA 3N86A 2AQIA 2MTBA 3CESA 1N77A 3KQHA 1B23P 3PC7A 5B7PA 2G07A 1T8UA 1W4MA 1I6XA 3O6VA 1TVMA 5DX0A 1MX1A 2HI0A 1G5PA 2CJWA 5EGOA 1QIFA 2QEQA 2W2MA 2DMPA 2M2EA 2HV8A 1JIVA 4BQNA 3EXAA 2REQA 4OD0A 3H05A 4QE3A 3OMLA 5F5LA 4YG2F 1GPUA 4FOPA 2C29D 3HOWJ 2VJDA 4MLCA 1F8UA 4OI4A 4D9IA 1BX3A 2ZSUA 1VQ4I 4XMYA 3DZFA 4KPEC 5BOVA 4CCJA 5COBA 4CT0A 3ZDZB 4UMFA 3TPCA 1A5JA 1H2EA 1WH7A 1BKDR 2LBPA 5CRIA 3FNIA 1MW9X 1FDOA 3UJDA 2GK7A 2NZUG 1SZCA 3NHUA 4OQPA 1PWZA 3GRFA 1CY8A 3P9RA 1OASA 2AOTB 4FQ8A 1I1SA 3FVRA 3BFXA 4D5EA 4LMAA 2KRFA 1SAXA 1V54H 4LBVA 1L5NA 2HLDA 3HRKA 1Y1RA 4BYMA 4L5EA 5F12A 1MEJA 4ISCA 1WB5A 5IJ9A 1SD4A 1WUKS 4GF5A 2JI4A 2IAIA 2QQ9A 1EIWA 4A8JA 1JXSA 1KJQA 3QU7A 2V5VA 4ZVNA 3A1YA 3G2HA 1ISGA 1WDTA 4BZQA 3QU5A 3TO7A 2M34A 4Z7OB 1GUYA 2OG1A 4KAJA 2WT8A 1SOAA 3S2YA 4ZEWA 3KEQA 4G41A 1NA5A 1Q95A 1NDQA 4YCMA 2QLLA 4TTPA 1JQ5A 5FOTA 2WQZA 3P0IA 4HS9A 2WVGA 4KYVA 1RPZA 1Y3HA 2QKLB 2G17A 1DDNA 3OWXA 1SXQA 1CQIB 3ZGLA 2Q29A 4N01A 2XCOA 1RI2A 3VISA 1BVRA 4A3KJ 5HIJA 3EK2A 2X42A 1P62B 5BNTA 1AH2A 2ZYWX 1LJLA 4TN5A 2HNHA 3WO1A 4BU0A 1SZDA 3HGQA 3MRTA 1M74A 3ZK9A 1UKBA 4XIFA 3PB3A 4F9FA 3T7AA 1R0SA 3OX2A 3WXMA 3NWBA 1OUMA 2GIVA 3FNRA 4DJJA 1VNDA 3A4NA 4BO7A 4DR7B 4XWYA 5J4YA 4B2YA 4D02A 1ZMOA 5F73A 4CMKA 3LKDA 1A76A 4MUIA 3N2EA 4LDPA 3T54A 1XPRA 1PEAA 2QSGX 3R5TA 2C3UA 1XD2B 2K3FA 2RH4A 4MUNA 2QQBA 2G9RA 4R0MA 4BB9A 1CB7A 2I3DA 3N6RA 4JLPA 4G5FA 5DCUA 5ICGA 1J24A 4UM5A 5FBWB 3OH8A 4P1ZA 1SBCA 4XGKA 2PZKA 2HIGA 2BGMA 1ZGAA 4CL8A 5E6SA 5GWXA 3OU6A 4GPIB 2NZJA 4B3BA 3KTFA 2R8RA 3B3GA 3SK0A 3UWMA 1KXJA 5LLSA 4F3YA 2WZQA 1J8QA 1Y48E 4Y30A 3ZDFA 5IYZA 1RM4A 4W9RA 1C1XA 3Q7EA 3QPAA 2CJFA 3PGVA 3ACDA 4CGZA 1CVRA 2PX0A 1LA2A 5AM4A 4R05A 3FNHA 1XPUA 4YCNA 2QAGB 2XQGA 2WSMA 1VC2A 1GGEA 1SU4A 3L1KA 2W2NA 2DBBA 3VPCA 2DRIA 4DR4B 1A9ZA 4MYRA 3DNFA 1FSPA 3PFKA 3HHEA 3E35A 2C8JA 3L0BA 1FJGB 2YFHA 2IYZA 2X41A 1U5TB 3FOFC 3H84A 3OE7D 3C6ZA 4PONA 4EBFA 2Q0QA 3BGIA 2EFJA 5DGCA 2WAQN 4J4TA 2DKFA 3U60B 5DCWA 1JTXA 4ETSA 2BF4A 1RYZA 4CEIB 3FKSA 2UYYA 1MGTA 1N0HA 3VFZA 3LC2O 6REQB 4JQYA 4RNCA 1YVUA 3RFUA 3X2SA 5FBKA 2Z5FA 3NIFB 4MIEA 1YFZA 2ZQZA 3VU9A 3VJMA 5HNFA 3FVWA 4ROTA 2P1RA 2XZTA 4TKUB 3L2QA 2IU6A 3ZW9A 1D8KA 1R6BX 1EYZA 3D6UA 1J1UA 3EDOA 3ZWBA 3GLFB 3ZE8A 1B59A 2P62A 2ZB4A 4R2KA 4XRFA 4M0UA 4FOSA 2CXXA 2PKRA 1GDTA 1TD9A 1V16B 3TZCA 4QPCA 4XJXA 4EW1A 4WESA 4QLCU 5B1BH 3ST7A 4MI1A 4HI0E 1G4AE 4MEBA 1SIWA 4MTDA 1Z0KA 3EAFA 2XVMA 1LGYA 2L02A 1Q77A 1JSCA 1DP3A 3QAHA 2OFXA 2F8MA 2R48A 1XGMA 4KN9S 1SOUA 5IYZF 1MJAA 2IKQA 1RLUA 3ZW7A 1Y7PA 4MKIA 2CUJA 3OCYA 2H4ZA 3JZDA 2JRLA 3AHEA 4O6VA 3K4BA 4DBVO 2A4MA 5EFZA 4JOSA 1KZ6A 1GGFA 4AX8A 4PAGA 3ZWMA 4OQLA 4JJEA 2DAOA 1DJLA 1ID8A 4HAVA 1USVA 1ENZA 1PAUA 4BKXA 2DMTA 1UBTS 4ONEA 2J4FA 1YYVA 4UUSB 5BPFA 2QWWA 3QQPA 1PL6A 2ZJAA 3AHJA 1QGDA 4IEEA 3TVTA 2QYHA 5IFKA 3PUIA 5WRFA 2VKQA 4F12A 3GZ5A 3LT5A 1RXCA 2R5YB 3SI7A 3K15A 1M2VA 4NC7A 3C3JA 3D54D 4JC4A 1OH5A 3H83A 1GPWB 2EFYA 5G02A 3R7NA 1IJFA 3WJ2A 1P5ZB 4IF6A 2CLKB 3H1AA 1II8A 4G8DA 1TAQA 5TPWA 4CKCA 2IU3A 2M0CA 4DILA 4QPNA 1VHLA 3SMQA 5J23A 1JHOA 3ESZA 1FYLA 1DCMA 1TYAE 1FYMA 3INGA 3V6LA 1G8XA 4HMQA 2HY7A 3O21A 4NEHB 1X0VA 2AKAB 4L22A 1G8FA 3SBXA 3GRZA 3IAFA 2IH5A 4CQMB 1RRJA 4IEFB 2NVQJ 4WCDA 2B30A 2D7CA 5EC8A 3GTMJ 5CFLA 4JYMA 4FHCA 3IOYA 5BMVB 1Q0ZA 4JUDX 2X6QA 4YFNF 3IT3A 3MW8A 3NFRA 3VYUB 3HBFA 4QQFA 4D0NA 4TWZA 3QVMA 3AFMA 3RUHA 1QXSA 1H65A 4E94A 4L8VA 4LXQA 4COOA 1JDJA 4WOCA 2ANBA 3F96A 4M3NA 1JT9A 3R8CA 1RAGA 1IAVA 4QDTA 1O96B 4XFJA 1WXFA 3WIDA 5CIWA 3IEXA 2XKJE 3M83A 1CWUA 2TMYA 2P77A 2WD8A 5LU9A 3VMMA 3DEJA 3ZCQA 1OA1A 2AUMA 4GU5A 1OD6A 4GXNA 1YQDA 3ITKA 2WMDA 5LGUA 4CCMA 2ZG6A 1T6ZA 4R1OA 4NB5A 4NJMB 2F5VA 4DLUA 3C3BA 2HOSA 4Y2RA 3PLRA 4L9JA 3RK1A 1P5HA 3NVDA 4AF8A 4V0MA 4P08A 1TT7A 2DBRA 3WXBA 4TKVA 4INOA 3P9KA 2K7ZA 5JEEA 3BSSA 2RGRA 4YMGA 3FB1A 4H60A 5H6QA 4I66A 4XBFA 4BV2A 5HTKA 1LB1B 3RWOA 3V4GA 1YRNA 1KOJA 3VA7A 4FB5A 2VHCA 4UXJA 2O52A 4LJKA 2CMFA 3BE4A 5B3JC 3ADKA 1RU3A 2P40A 3NV7A 3CNLA 3ABLH 3IDFA 1D0IA 1XSDA 3JS5A 3NT5A 5ALMA 1SUAA 1TJ4A 5MGBA 3AF3A 4P31A 2XHEA 3RYIB 2YPRA 3TFOA 1XNQB 2R4TA 4Q3LA 4N8EA 3T9DA 2B0JA 4HDUA 2IEYA 3OIVA 2HZBA 1IE3A 3DC2A 3A3NA 3H4TA 1CY4A 2O3JA 4PHHA 2PQMA 4X24A 4Y4RA 4BDYA 4ESJA 1BR4A 1X3ZB 4JHLA 3JQCA 4L6AA 1EXWA 2FPGA 3ZP5A 3DHYA 5KAMA 2QE7D 3CW8X 1U1EA 2OXFA 2JH9A 1EVEA 5L51A 1RRFA 2G9NA 2PSJA 3LQ4A 2G9UA 1QHYA 2IL1A 1J5EB 4CMHA 1KETA 4A1OA 1AIPA 4WLOA 4BV8A 4L4RA 4WCFC 3WI7A 3TB4A 4DJEC 5DM0A 1D6SA 4RK0A 1V35A 1XZJA 3PF8A 3SZLA 3PUVA 3L06A 2WIAA 1ORTA 2JLCA 1Z0JA 1CR1A 1FFXA 2VHYA 3NC1C 1FBUA 1RQ7A 2ZJ6A 2KPMA 1GUBA 4KLCA 2OECA 2BUAA 3ZXXA 2F1RA 4ASNA 3FMGA 4A0QA 3Q8LA 2MYPA 3AL2A 1BRTA 4M7OA 1CIPA 1U9JA 1ONPA 4B83A 2WKSA 2MJLA 2SCUA 3U44B 4C22A 3RSFA 1C1YA 2VWHA 2C31A 3LDUA 4EJMA 5LP1A 2J0UB 2QSYA 5ILVA 3GVPA 2O9JA 2RONA 2H18A 4MW0A 3BS4A 1KRWA 3LL7A 5EEHA 4ZXPA 2ZYGA 4ID9A 3I9V1 4DQLA 4TLCA 3HXLA 3OOUA 1LC3A 1IDZA 1GEEA 2ZE6A 4H0EA 2Y1CA 3UCXA 5BN3A 1NK3P 4I4TB 2EXXA 1FCJA 3Q6MA 2G0TA 4M60A 1N2JA 1WMSA 3KQPA 4XOPA 1UOOA 3H0KA 4WXDA 3TQRA 2QW1A 2XNSA 4H7HA 4U0VA 2GVZC 1VB3A 5CB0A 2FJ1A 1KEEA 4JUAA 3QPSA 3VR2A 5TT0A 4IDEA 1KZGB 3BFKA 3WGYA 3R9XA 2XB6A 2ARKA 5SV2A 1BI1A 1XVUA 2O4UX 2IHZA 4MW1A 1MD9A 3K4KA 2V3CC 2WWHA 1OR7C 2C2ZA 3HNPA 2FRDC 4G24A 4A2PA 2NU7B 4RJJA 3DEIA 4U7WA 1AO3A 5EZYA 3WIUA 4PNEA 4JFRA 1VPLA 2NZYA 1X8JA 4PJJA 4Q1DA 2JH8A 2K2WA 3ELUA 1PR1A 3RYCA 3AVOA 3SDSA 2XUHA 4C06A 1A2KC 3MD0A 2X6TA 5JIBA 5FKMA 3M6WA 1SC6A 3BMCA 3UJBA 4RF3A 2HNBA 4XX0A 1NLMA 4JKIA 3WGMA 3TW6A 4RAFA 1V95A 4JOCA 2GKOA 1I3OA 1TYEB 4MJLA 3ET4A 4PE5B 3H6HA 1J56A 2ZIXA 2JKVA 3N8HA 3EUEA 2EPFA 5LEJA 3KPVA 4RX1A 1DTWA 2V4ZA 3Q85A 1ZRNA 2ZJRF 3OCZA 3I2YX 3MJDA 3AZQA 4CM1A 2GOXB 3E9ZA 3QX8A 4F7DA 1NP3A 2Z99A 5JCPA 3JRFA 2I2WA 4G9GA 3RUEA 3GC6A 4YCSA 4P53A 3DBRB 1TKCA 3D2AA 5ERGB 2BGKA 2HEGA 2WD9A 1UXHA 2X0RA 4YV7A 2RD2A 4HK4A 1XP8A 3AY3A 5KYVA 3GFBA 4DLXA 4IINA 2CSUA 1H85A 4BU1A 1KJIA 3L8MA 1GHTA 4L6IA 4EHDA 3ENWA 3LUPA 2WJWA 1Z4PX 4OGLA 4PSAA 5A9TA 1YF3A 2AZMA 1PT8A 4DCTA 2GHRA 1IC8A 5JAIA 3VJRA 3FSRA 3BB1A 4KICA 1X13A 4HAWA 4US0R 5DHFA 2FOWA 1GY8A 4OAZA 1KFKB 1Z6YA 1DIBA 1T9GR 1JKQC 1G21B 3VPGA 5MFZA 2XAAA 1UHMA 1KAMA 4CG2A 3O2NA 3UO8B 3S55A 1NF3A 1IZ9A 3KKZA 5IT9A 5EPEA 2ZU6A 2JFVA 5FJJA 1SFEA 3QKSA 2R7AA 4M0PA 2C2XA 5AVQA 5B30A 3JRAA 5FULA 1E6UA 2ANCA 2HU9A 4LJSA 1GPNA 4XD7A 2ZB2A 3EGEA 4E03A 3DL2A 3NEPX 3BZUA 4P4TA 2C4WA 5M04A 3LY5A 2K3PA 1E7MA 1VPDA 1U0SY 1CD5A 4LZJA 4W5JA 4B09A 1ZISA 3TW8A 3WLAA 3Q9NA 3QE4A 4PAOA 2ESHA 1J33A 3K16A 4IM7A 3HU3A 2NV0A 4DSNA 3IE0A 1ISPA 3GT3A 1D2AA 3JPWA 5IAJA 4PHGA 1MB2A 3PHCA 1IL0A 3H3UA 1EESA 1WQ3A 4F5ZA 4WZAB 4B8YA 2C99A 2IPNA 5JJCA 4JYBA 1L4KA 1UT8A 2I8LA 2ZTMA 4RFVA 2PX6A 2HH9A 1JILA 4URFA 4A5MA 3P4UA 5CKTA 4ZYTA 3MRXA 4UTPA 4QODA 2M9MA 4Q6WA 1V1JA 2OGTA 2ZZMA 3WRXC 1SG6A 1P5FA 4A0HA 5AW6A 2NV6A 4G6TB 2XUQA 2B9VA 3I37X 2EZIA 3ZCXA 2QAIA 4JA2A 4ZT6A 4AW9A 5I4KA 5F0HA 2XYVA 1FF9A 4CV3A 4HFMA 2OQRA 2DO7A 2DY1A 3ITDA 2PUWA 2LREA 4ZALA 5EP4A 1X77A 3EA4A 1BROA 1RYNA 5KQRA 1M6EX 2JFYA 2O3UA 4B44A 3TLJA 3KL4A 1R4MA 1RHRA 3O8LA 2ZRFA 3THSA 3HBMA 4AO6A 4YIIA 1U0BB 4WZ6A 2E7WA 3ZJVA 3JD4A 2RC6A 4ER3A 4QAQA 3F90A 4EA9A 1FFGA 1KMMA 1LXCA 1GTVA 1MRNA 2CL0X 3D8TA 3BJAA 4PX3A 4JC8A 3EQ7A 3L8EA 1T1EA 2H1LA 1Q21A 4X1KA 2AT1A 2KKOA 3B9BA 5CPRB 4RCYA 4BO4A 3D8BA 2D0IA 3TIIA 3IP9A 2NS8A 3WE2A 5CXUA 4IDHA 5I7EA 4KR7A 3RASA 4JROA 3CCEI 2PT5A 4IICA 1DIHA 4IX1A 2CBXA 2IJGX 3EEYA 4Q19A 1ZNWA 3WHBA 1YSCA 4TXLA 5AUNB 4V3BA 4RBNA 5DBEX 5J5VA 3PNPA 4X20A 3WL3A 1VE9A 4A2UA 5JW6A 1ZHOA 3RKYA 3AOEA 2ZCUA 2ODAA 1MMFB 1E32A 1UZUA 2L82A 5A3QA 1RWWA 4MAMA 3SYMA 3HJUA 2J46A 4CVNA 2G67A 1S96A 2VBFA 5LJIA 4BNWA 1RRPA 3WGGA 1RYMA 3SSAA 5H4HA 3DV9A 2RGBA 2C04A 2IHYA 5GP9A 2WJPA 2YRXA 3CDLA 3CJTA 3E7XA 1T9AA 4NQZA 1QF9A 1RJEA 4A92A 1LE8B 2QMQA 4FE3A 3F8FA 4B1RA 4KMRA 1P2VA 4J1SA 3SJMA 5D6FA 3QLUA 5GVSA 2RNGA 4DDTA 1UMKA 5CTAA 1GG2A 3AIIA 3A1NA 4KQFA 3LKVA 1KFBB 4AJHA 3G0IA 3AF5A 3M34A 2QCOA 2X76A 1TC3C 1NTCA 2EKPA 4YIFA 2OV7A 3IC5A 4AWXA 1TCVA 1RW4A 5DT2A 1HR0B 1WUYA 2BJVA 1ZC4A 3DKIA 4F1WA 3RTDA 1BYIA 2R8ZA 1O7JA 3WQSB 3DMPA 2JJ2A 3EZ9A 5EXTA 4CKEA 3MA0A 3THWA 2Z3ZA 3SYNA 1BR2A 1I36A 4IXWA 5BY2A 2IEZA 4X7MA 2JCSA 2HPZA 3G13A 4PG7A 1BMFD 1L7XA 1UZAA 2VE9A 1I39A 1RHQA 1V4BA 1QOZA 2R3SA 1ZAOA 1EK0A 2CQ7A 4IZHA 2H8RA 5FBHA 4JI6B 1U5CA 3U09A 1T3GA 1ZOLA 1DHRA 1SNYA 5IKXA 2B4YA 4KT5C 3VZSA 3B48A 5AVZA 4C20A 5LL6P 3GLQA 1Q0LA 4R1UA 1MC8A 1H0MA 4CM4B 2JAXA 2W22A 3S8EA 1G2IA 3A9SA 3FA2A 3QOPA 1NVVR 2BLLA 2VF2A 3NI2A 3H8SA 5K0JA 3GEDA 1EXVA 2JFWA 1PO7A 4P38A 2QX4A 2XGXA 2W6ID 4KSBA 5E2AA 4RA6A 5AXAA 2IEBA 4UBKA 4H0FA 2E19A 1NJ2A 2CUEA 3ISTA 1DIRA 2NYAA 1T2KA 5D5UB 4FNOA 3AR2A 4ZT2A 3K1MA 1GQQA 4ESBA 1Z0FA 4J00A 4HWTA 3GUZA 1ZI8A 2P0WA 2ALJA 2NUTA 2XTAA 3A26A 4YAWA 4ZTFA 5HUHA 4ZVPA 3DR3A 1GR1A 2LOOA 4PGMA 4DUYB 3A1TA 3H2IA 3UKJA 3CB2A 1FOKA 3FM9A 3EEBA 1V8DA 1YB2A 1TJYA 3IVXA 3N3AC 5I8WA 3W2FA 3QVXA 3JR3A 2HOQA 3Q5GA 3W5CA 1F7UA 4RF4A 2B25A 3TLZA 1XQXA 4RJTA 2CHVA 2RGEA 1F2UB 4ZT3A 4FHEA 4X66B 3X2FA 4HA8A 1K7AA 3OQIB 2AQFA 1PZEA 1SKQA 4QJ5A 1IU9A 3KSBC 3QLTA 5HE9A 4Q02A 4G1VA 1C2TA 5C1IA 1SVWA 3M7IA 1PD0A 3WTCA 2MINA 2AHRA 1XTVA 3H17A 1UJ6A 4N48A 4PWZA 4PJNA 1ZD5A 3EGWA 3MTJA 4AY6A 3T7TA 4I8IA 4GR5A 4NU8X 4N9HA 3K0CA 1NAIA 4OUDB 4BJ6C 4ZDJA 4HWRA 1R0CA 4Z4CA 2NAFA 1GSHA 1T2VA 2I9PA 3V6MA 1ACMA 1V9LA 2CKMA 4D9KA 3PPWA 4G0VA 1D4FA 3G5UA 4IIYA 2I7XA 4DJFC 1XR3A 2BHZA 5AI8A 3SZRA 2D0PB 3ONQA 4EHKA 3B82A 4O4IF 1AKTA 4TMXA 3VZBA 2DGDA 4EM2A 4Y3UA 3EPZA 3ENQA 2E34A 2W8BA 3NKVA 1SXJB 4A6XA 3W9SA 5CFOA 3DPSA 3HRHA 4MW7A 2IU0A 1GGVA 3C87A 3O4VA 4LF9B 3NETA 2O05A 2YJNA 2GD1O 4BQQA 5I7AA 4I9NA 1RDFA 4KQWA 2YW2A 4H15A 5IULC 3NALA 4XICA 1JEEA 5J43A 1ZW6A 5FWAA 4EG6A 1ZA1A 5LNK6 5FB2A 3I1FA 3FFAA 4YWHA 2QJWA 1C7QA 2VJQA 3MLBA 1QWOA 3K5HA 2X86A 1UJMA 2V7TA 5AK6A 2D5VA 5A5VA 3JW8A 5I7VA 3O4HA 3ESCA 3GYBA 5B1IA 3OCUA 2AC2A 2IDZA 2PUGA 3QOEA 1GSOA 1L5YA 5HNHA 4FXPA 4HYQA 2BXYA 2W24A 5JFRA 3DFMA 3JYPA 3PG5A 3F8TA 1O6FA 3V8QA 4HDMA 3CCRI 4NZPA 5LLDA 4X1IB 5AKLA 3PEYA 3RPUA 1JXQA 5DDIP 2TECE 1BGXT 5A3RA 3RFTA 1YZGA 3V1NA 1JALA 1VPTA 5BVGB 4LYGA 4MQFB 2XRZA 4C87A 5JASA 1TW3A 4RIHA 1F17A 3ZVKA 1P39A 3SR3A 3K0LA 4YYEA 4BXUA 2AUNA 4B4CA 4M8SA 5GV8A 3WIVA 3LXXA 3LHFA 2QW8A 1VKOA 4YP9A 4F3KA 3TRKA 3ABQB 3M4NA 1QGUB 2HEOA 2GPYA 2IGBA 2PS9A 2H5JA 4LXYA 1NQXA 2JQ7A 1SM4A 4GXTA 3GD5A 4WK0B 5ADHA 1DEHA 3P20A 1N2CE 4QREA 5TNXA 3DLBA 1POWA 1D04A 1JVBA 2OC9A 3ANLA 3F5QA 1EG7A 3GEGA 1WWXA 3RYRA 1IEWA 1VYHA 2BFNA 1UM9B 2R96A 1CUBA 3ABRB 2WVHA 1H42A 3EZ6A 4LF7B 3ORYA 3CF6R 1LDNA 5KYUA 1J21A 3IHLA 4C2UA 2J41A 1V6AA 3ZZUA 4RTSA 4GVXA 3GLHB 1L6RA 2EFCB 2IPXA 4N5NA 3DPTA 5EJGA 3EWAA 3OFJA 3ZHOA