3V42A

Crystal structure of renal tumor suppressor protein, folliculin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
196
Chain Sequence
LPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAASLSKYEFVVTSGSPRVGPTILNKIEAALTNQNLSVDVVDQALVALKEEWMNKVKVLFKFTKVPKEDTQKLLSILGASEEDNVKLLKFWMTGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Folliculin
total genus 70
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16692 Folliculin_C Folliculin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3v42A02
3.40.50.12430 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v42A01
3V42A
chains in the Genus database with same CATH superfamily
1A31A 4IOAF 2GK6A 4MDFA 5BVHA 1LCIA 5B64A 2DDBA 1GUDA 1MW7A 2PGJA 2E7WA 4FJ0A 4Q9DA 1T9CA 5TPWB 1CQXA 4YP1A 1MJGA 2F1IA 5HRCA 1ODJA 1V8PA 3MINA 4ER5A 1FBNA 3SKYA 2DETA 1UMBB 1QF9A 2RGCA 3KB6A 2XRLA 4LF4B 3LPCA 5IU6A 4L0QA 4GWKA 2H1VA 5F2KA 2P5LC 2QVCA 1N5OX 3MUNA 2HPMA 2FW1A 3BCUA 4N4NB 3ROKA 3S1LA 4NC7A 4TSKA 3J80Z 4NY1A 4P4NA 3L4BC 1COWA 2GS9A 5IKOA 4DQKA 2ZMEB 1IBMB 3IWZA 4FCWA 5CRIA 3RVQA 3V8RA 5KVSA 3IPRA 3SX2A 2HWVA 1AA9A 1QK3A 3PTAA 5HMLA 1MJNA 2VCYA 3ABKH 5DM6F 1UM9B 1AZSC 1UBKS 2JK0A 4LJ5A 3EPJA 5JPDA 5K9ZA 1NAHA 3Q9UA 3NFRA 3T3EA 3HUGA 2G04A 1QCYA 4RAGA 4KC0A 5LYJA 2ZUUA 3ACBA 3ET4A 1Y3FE 1TBXA 2GPTA 3M34A 2VBZA 1R7RA 2F9LA 3ABZA 3PD7A 4LI3X 4YI3A 4UM9B 2O8FB 4OQZA 1SCNE 5JNWA 4O2BB 4EMSA 4P4SA 2AX4A 4FMCB 4CF6A 1ZSYA 2JFXA 4WDRA 5CPBA 4YRCA 2VSYA 3CNLA 2XVZA 4G9BA 4J0FA 4OFWA 4OHRA 4TWJA 1HO3A 3KSUA 1EP1B 4I8XA 4URXR 4PGGA 1VJCA 2JH8A 4QJ4A 4AZSA 1GL3A 4BO3A 4M99A 2V7QD 1KEUA 4NU6A 1M1EB 4XTRA 3NETA 4MGEA 1GGEA 5KVAA 5F6FA 1O2DA 5GOTA 4TXJA 1CK4A 3L2VA 4RPIA 1GFIA 1PBTA 4E6PA 1RPNA 3H19A 1M6YA 3BTIA 3GCMA 1QHSA 2QRJA 4MITA 5TQ2B 5JQGB 1SG0A 4CKXA 4OHWA 4XQGA 5K8CA 5AJWA 4GQIA 2FP4B 2J3MA 4ACAA 3U1BA 3AKEA 1LS1A 2BISA 1W5BA 2VTBA 4JI3B 3D43A 1XELA 1ZOOA 1V4NA 2EXXA 4EPWA 3GX4X 1LU9A 2X1CA 4W8OA 3GLIA 5AHRA 2FN7A 2BL4A 5HF5A 5M5BA 3UVEA 1O4VA 2BKEA 2EHDA 2P6PA 3N8GA 4NC8A 3QYAA 4B6GA 4DCCA 1EXNA 1T2NA 5IC5A 5A06A 5B3JA 3J81A 4LZZA 4HNAA 1Y7IA 4FYJA 5CVRA 3O8QA 1OW3B 1TAHA 3CF6R 2FWNA 3NYQA 1CUEA 4JSTA 1KVSA 2IPNA 1F2VA 2RGEA 4ZC8A 4JOCA 5T67A 1OY1A 3IVXA 3WGOA 1V41E 5HF6A 3N2GB 3I0NA 4ZQBA 2AF3C 3EODA 3OE7A 4MYUA 4YFXF 4CG2A 5AIBA 5KOYA 1KIFA 3K2EA 3MGKA 1GPH1 3DMTC 3GTQJ 4DBZA 1IB6A 3KQYA 4O33A 1TVCA 1Y3IA 3PTLA 1L8XA 1CRZA 2G6TA 1UBTS 3VFZA 1U2TA 2I65A 3IA7A 3Q98A 4QQFA 3JQAB 2VYFA 4O2AA 3G8BA 2M0MA 3JZMA 1A9XA 2CH0A 3ANSA 4UV8A 1WXIA 2B6HA 1GTJ1 2R11A 3P27A 2ZCJA 3BA6A 4B31A 1J2XA 4QQRA 2RE8A 2C2OA 4JWTA 1SXQA 1TO2E 2D2XA 1LPPA 2XCSB 3AUJB 2IYZA 4JDPA 2W43A 4IQ0A 2ZU0C 2ETHA 1H2RS 3KAQA 4LCEA 4Y2YA 1QR6A 1MSEC 2Z2SB 2QKYA 4EPXA 3TGLA 2QU8A 1SGWA 3WWDA 1EA3A 1U7ZA 5LCXA 3DPUA 2MMCA 1Q1QA 3V42A 1XZIA 3G1UA 3SVTA 2YVKA 3HXOA 2IEIA 2FEAA 1LQ2A 3MCUA 4H16A 2JZYA 2D3TA 4I4TB 3GT4A 3IURA 5AT1A 3M7IA 5ADUS 1C9MA 1KJJA 1SKYB 2V59A 2W2KB 3DMGA 3LBIA 4M36A 5K3OA 4BBJA 1Y8QB 2PRIA 3BIXA 3LC1O 2XBUA 1YF3A 2IF2A 1Z6XA 2AW5A 3LFUA 3H5VA 4AUKA 2AKEA 2Z5UA 4ZH4F 4QQKA 3JYHA 3HDJA 2MCFA 4V2UA 3AAFA 3LH5A 2ZXEA 5GINE 3A7EA 1P77A 4H7DA 121PA 4NK4A 2DTRA 2FOXA 1ODFA 3I5AA 1MB3A 3DWEX 2XZPA 3OWHA 2IXFA 5ER9A 1TYZA 4M6YA 1FRNA 1U3GA 5D8KB 1RIOH 2V65A 1QV6A 4QJBA 3PC2A 4HDKA 5B53A 3OD5A 1OI7A 3I4CA 3HRTA 1L1QA 1MBHA 4ASUD 1OH7A 1JAIA 4OM7A 5GZ1A 1MEEA 1XN4A 2Y0PA 1ZL2A 4TUYB 3HWSA 1NY6A 3NUGA 2XB6A 1X39A 3E6AA 1B8IB 2QTCA 3FJOA 2CXQA 1QLWA 5FKJA 4HHEA 3TSCA 3AY6A 4AJ1A 5HOEA 1JHVA 4YC7A 2WC2A 2OQ2A 4HLUA 4U2DA 1BVYF 3OIGA 4EB6B 4X62B 1XLWA 2P91A 3AESA 4BWYA 4C4XA 3PPWA 4RABA 1II8A 1A2OA 5DEQA 3L8FA 3IR5A 4L1KA 4ZEOA 3WYAA 4PG5A 3S70A 3K69A 2OZLA 2P4UA 4Z4CA 1S4QA 1JJBA 3WGLA 4OQLA 3JAMA 1G4AE 1KKLA 2PO7A 2W0SA 3HZZA 3Q9VA 3EUFA 1DKRA 3PFFA 4V24A 1IM8A 5EMMA 3V1KA 2HOQA 4D46A 2X6WA 1RC1A 4G26A 2NRAC 3E70C 5CA0A 3VTAA 4L4XA 1J8FA 4YG2F 4AS1A 1VFNA 1GARA 3IV9A 1IUKA 1R9MA 1JT9A 2HWXA 2YBDA 4RY8A 3SF8B 1KQGA 2H1SA 2WU3A 1V9LA 2ZIFA 4HFMA 3UY4A 3SS8A 1W5FA 4DXAA 1AV7A 1T43A 1Y9ZA 2NTJA 1PX2A 4C3ZA 4M9SA 1OHHD 2A5GA 1CFZA 1FU8A 5JXHA 1Z7LA 2VDNB 4KWCA 1PJLA 2PA3A 4RKYA 2R8ZA 4TTTS 1GVDA 5B7QA 1WBBA 5D6NA 2YMLA 1P80A 2WTAA 3CH5A 4R0VA 2FSUA 3PNPA 5ENVA 1KOLA 4F5ZA 4XARA 2DLLA 5DHFA 2JIRA 1WA5A 2R44A 2V5VA 1GNTA 5JAHA 2R62A 4MINA 4X7PA 4UMEA 2EP8A 3WDSA 4BFSA 1DPFA 1EVQA 1WD7A 2Q6OA 3A6ZA 1SVUA 3KP5A 2HYJA 1CJSA 2NX2A 4IZ6A 3LNQA 3H9UA 3WKDA 2YS7A 5KTTA 4DREA 2BGJA 2KB0A 2G77B 3AFOA 1VPTA 5F0CA 1Y42X 4XBFA 1SKYE 3A0BC 3GN2A 3ZDBA 3SQMA 2FSVA 4MK4A 4UCFA 4O1HA 1N2XA 3S55A 3VNBA 1ZD1A 3R60A 3AUSA 4TKLA 4B6QA 3UOWA 2ZYTX 3M9XA 2Q2OA 1Y8RA 1ZITA 2WSBA 3MB5A 1CBUA 1KJ8A 1QV9A 5C1BA 3C4JA 1ZK8A 1PV2A 1FIPA 3IVGA 3NEUA 3SJMA 4GECA 3IOEA 5KPJA 1JTXA 7ABPA 4YELA 4OXQA 1ABBA 3FUVA 3PIIA 1LK7A 3DNPA 1GN8A 1BE1A 1G2OA 2QP9X 1PNQA 2P2YA 5HA5A 5CLSA 3TTTA 2R7ZJ 4F1WA 2D6FA 3GBGA 2HDNB 4QVGA 3TZLA 3UW1A 4NKRA 1Z8HA 3Q72A 5F1YA 3LNTA 3QPDA 1XXLA 5J2TF 3VO8A 2JJ2D 2E1OA 4RZHA 4NECA 1NPDA 4R1SA 4DM4A 2BDTA 1GPNA 2HIGA 1CIJA 1LLCA 1PSZA 2WNIA 2X4LA 3EY4A 1Q0RA 1LRLA 2C5BA 4XDZA 4IIGA 1MNAA 2DP4E 1IRIA 2D0PB 4Q3KA 1C3LA 1PNRA 1OAOC 2IHKA 2P2ZA 1NJ8A 1WABA 3H86A 3R23A 4JBIA 4FMDB 3DAOA 5DX0A 1H9GA 4EM1A 4EYOA 2NUTA 4GI7A 2G09A 1PQYA 3SK0A 2CQXA 4B3RB 1F3OA 5ARDA 4QEKA 2GAIA 4M98A 1U28A 4OHOA 1EAYA 5AK4A 4BGEA 2YOGA 1K97A 1UJ5A 2X1HA 4LBWA 2ZROA 3ZC3A 4D4GA 2AK2A 1OC2A 1RQPA 1W2WB 3CVOA 3L7YA 1XQWA 4IHSA 1U3CA 3A1DA 3EMKA 5ERGB 2V6MA 1YVPA 4M9ZA 2R1ZA 3D8HA 3HEFA 1JKJB 1CKEA 1RVV1 1WMDA 4INOA 4ENKA 4UEJA 5GTDA 3KZXA 2DQSA 4CSWA 4JJ8A 3CTMA 4MB6A 3UHFA 4BMXA 3H2IA 1VLLA 3E4CA 3ID6C 3LIIA 3WLIA 5I3CA 1MEJA 3AHDA 1G4HA 4RS3A 4Z7OB 3UAOA 3F3SA 4A8JA 3F8SA 2IHNA 3TSWA 3OOPA 1QZZA 3NH9A 3J81Z 1VQLI 1IU9A 1VIAA 4G6QA 3LF2A 4MUBA 4YO7A 5I48A 3OZUA 1WSWA 4KQMA 2R8RA 4UNNA 2W48A 4WVFA 1FL9A 4LGMA 4X8OA 3MOGA 5IT9Z 3WNBA 2X9NA 2GKOA 3DPIA 3EGDA 3NHJA 4M8IA 4OJKA 1JHDA 4Y0AA 4EKYA 5J1SB 1UP4A 4S2EA 3KFLA 2D62A 3OTWA 3TIGA 4DR2B 2DYRH 1VIMA 3CZMA 4U9UA 4UKDA 3VVLA 4D4JA 1L6RA 5B5EC 3HCNA 4Z4EA 4U7HA 4G5XA 3IH3A 3ZGKA 1DDOA 4PW0A 1WJAA 2HM7A 1LVKA 3JRBA 3RCOA 1B8VA 2XOKD 2G0EA 1F12A 3SQDA 2EBWA 1EFRA 2J9GA 2GLXA 1UFQA 2G36A 2QTVB 3S2UA 1KI7A 3U17A 4MP6A 4TL7A 3TUJC 4NJEB 3ON5A 2CWWA 1ZARA 4LCJA 1PWXA 3ZY2A 1H2BA 1QOQB 1Q44A 1XDGA 2CVHA 2QX8A 1E9AA 1R15A 2GEDA 3A1FA 3MIZA 5LLDA 2P75A 3DHNA 2TMGA 1MXHA 1TQIA 1I4DD 4I99A 4BNMA 3MAJA 3PHBE 1RJFA 2VS1A 2P4WA 3CJNA 3MMZA 3O82A 1TZKA 1ZLKA 3GXOA 1D1PA 1DOZA 3AWDA 3BWDD 3QFCA 4H15A 4IDHA 4JU8A 4ND7A 5FLKA 4ZV7A 4OIMA 16PKA 3PVSA 1Z0XA 4PUSA 2CLMB 2ZPAA 1QPIA 3R2JA 4GS5A 4JT4A 5IKXA 1JUSA 4Q47A 3CH6A 4MUMA 3GGOA 1PR5A 3D4OA 2D2WA 3KYDA 4P4GA 1TWCJ 1H8AC 2BFOA 5IMSA 2CBGA 2VKVA 3A1CA 5EJ8A 5H70A 2P7VB 4H4CA 3HHGA 1VJ1A 4YRTA 1Q1VA 5D5PA 1UHMA 5FLEX 1O8BA 4YV7A 2IYNA 1SCQA 1W76A 2J7KA 3G5UA 4G5HA 4JP2A 4H7IA 4M6WB 3L6RA 4BGIA 2GZ1A 1JAYA 2MGQA 1CZRA 2NV0A 1VQMI 1ZJ6A 2JW5A 3I4LA 2PX0A 3KQOA 4M1KA 4MVWA 4N8SA 1ZGHA 4XW2A 7AT1A 4JHLA 1NLUA 1DELA 1UK7A 2Q1TA 4DIQA 4YWHA 3RC3A 1VBFA 4MV5A 5HR5A 1JHQA 4LAFA 4EQ6B 3OOYA 2Q6KA 4HPQA 4G1UC 4F4DA 5ARCA 1GUZA 1TTQB 5ALHA 2DFHA 2BHTA 2FWAA 3WV4A 1MP0A 4B74A 1DC6A 1HFEL 2H3EA 5JCZA 1SFOJ 4IGKA 3ZV3A 1AKVA 2VSQA 4FDUA 3B51X 3ABQB 4RXTA 2B83A 2FE1A 3CRRA 4G4SO 4QBFA 3JQAA 4RU1A 3OEHD 3NXKA 1G98A 3E1SA 1GTMA 4XLPF 4RV9A 2AL7A 3FNIA 4JMPA 3T5DA 5F2NA 2RGWA 2REQA 1U1DA 3MGAA 1E1LA 3W8RA 2PKQP 3EDQA 4DWJA 4GDFA 4WW0A 5D01A 2ECBA 3MGGA 2ZYDA 4GGGA 1VL6A 5LD2C 3C98A 4KUEA 2VWGA 4JQSA 5DNCA 3KQLA 3WGQA 1IZ1A 3C3PA 2O8KA 1S02A 4FHZA 2M2EA 4ESVA 4RGUA 2GN6A 3L7CA 3U4GA 3FE2A 2GRUA 1LS6A 3OZFA 3EIXA 5A5VA 4C7VA 4NATA 2DY1A 2QL7A 4L76A 4QPNA 4RHUA 3R3XA 5C3MA 2XC7A 5F1JA 1SCAA 1TKBA 2BSAA 3I8SA 3IAAA 3D5LA 1JAZA 3H8WA 1TCBA 3IOMA 1L4YA 2SICE 1RCUA 4QPOA 1XVLA 5E1XA 1SCJA 3R3UA 1U0NA 4WZBE 1K4SA 3S3TA 2FN4A 3AP1A 1R00A 1OLOA 4NF2A 5DKFA 2VK4A 1QGUB 3G0OA 1I3QJ 3DU6A 5AHKA 3RZDJ 1J06A 1GKKA 3E1KA 3O21A 4O08A 1OISA 2VPTA 5F3WB 1JGTA 3A4NA 3H9CA 1QCCA 3TCNA 4F21A 4LYEA 2CO5A 3KQPA 1XZJA 4UOQA 4KX5A 3HABA 1TVKA 3NP9A 4U39A 3STYA 3PUIA 1O6ZA 4NUBA 2EFWA 3OZWA 1YE8A 3NKVA 4RV4A 2VTEA 1CETA 1NBHA 2J9ZB 3WTSC 1KU7A 3DD1A 1AS3A 1IZ8A 1F0YA 1XA4A 2ORIA 2R8BA 1OFCX 2V6IA 3WOVA 3MWDB 5AK5A 5TX7A 4R6WA 1U2DA 3ANNA 5JANA 1UT8A 2PJRB 4JL6A 2IK8A 2M34A 1NVDA 3H97A 3P45A 5DI3A 2R7VA 3GGCA 4XJXA 4UBNA 2WIKA 1ZGWA 3IPCA 2PG4A 5GTHC 5D5HA 1ZZGA 1U8UA 4ENSA 2G5CA 1GAEO 2HSEA 3RVPA 4IG9A 1ETQA 3K2BA 5K5EA 1SVOA 3CZAA 3HYIA 2XVXA 5HZMA 2P1DA 4HAMA 4XQCA 4YTEA 2H2IA 3LY9A 4OWRB 2V1NA 3VR2A 2QJFA 3KKLA 1CQZA 3M33A 2K7ZA 2OO5C 3HJHA 2AMVA 4CV1A 3S1RJ 4EFLA 4K5QA 4LYJA 1Y3CE 3L3BA 1I3NA 1P1BA 5A2QZ 2YIVX 2ZETA 3BPVA 4CEIA 4L6IA 3K35A 5FRDA 4ZQFA 1R0KA 1OVMA 1NTRA 3QX3A 2X42A 1B72B 3CD6I 1HG0A 3W3AD 1R5JA 4CEHA 3KYCB 1QH1A 5A4DA 3A10A 1CDZA 1A5TA 1ECGA 4EJVA 3RK1A 5AVXA 2QXUA 4FWTA 1JDBB 4EYKA 2HAEA 4WN9B 1E4VA 4MUEA 2NS7A 1V4BA 4JLNA 3RCBA 5M34A 2JH3A 4O2AF 2W2LA 4XRGA 5JVDF 3WKCA 3G71I 3UPUA 5C7LO 1R9GA 4JVLA 4H08A 4WL0A 2WRZA 3G73A 3S32A 4G1FA 1OXUA 3IAXA 1UR5A 4L4YA 5J2TB 5D86A 3IVCA 4FD2A 3KLNA 3W9BA 4AVYA 3TG2A 1KVQA 3TRDA 2VNAA 2BKXA 2H0RA 3F8MA 2IX3A 2A0FA 2OBFA 4ER6A 3MB8A 1AGNA 5EIXA 3EEBA 1JZTA 1Y5IA 2BOVA 521PA 3ZQLA 3DVAA 5B57C 2YY6A 2AJCA 2R84A 4EGAA 2FHPA 5JOQA 4MW1A 4TM7A 3MPUA 2FZWA 1F9NA 4ZCMA 2AFIB 2AKAB 3W3AH 3GJZA 3GFSA 3LWNA 1N9KA 1FSZA 4IFEA 1V6SA 1PNOA 2P67A 1W6RA 3DG9A 4EJMA 1NXWA 4V3BA 1ZWLA 5J1RA 1XDWA 2XUZA 3BWYA 4UBMA 2K3PA 1NMZA 2VQDA 5L3SB 1XEXB 4AJ4A 3HL4A 4WASA 4D5CA 2HB6A 4UVGA 5CYVA 2A86A 3CJRB 1U9CA 2WG2A 1M2GA 3ORFA 1GLVA 2Q6IA 4IW3B 3HDHA 2UKDA 4ND4A 5FNVF 1NM5C 1Q74A 2OXIA 4R2MA 4P83A 5L45A 4L9TA 3PIRA 1U1CA 3G9XA 2W6CX 5D4SA 2Z5VA 3WWZA 5K5OA 4UVHA 4IXDA 5JYBA 5C1OA 4R69A 4ZMRA 2ZFUA 3EISA 5HTOA 4FW8A 4B7CA 1WTCA 1E3WB 2ZWVA 2GN8A 1K7EB 1K98A 4A6EA 3O38A 4ADSG 2FU5C 2FP3A 1W9MA 4OEHA 1AF4A 2XZLA 3IXLA 1TMOA 2VYCA 4DCTA 1O9GA 4DMHA 4CDMA 5IN5A 4M0PA 1BOOA 2P5SA 4I08A 1I24A 2XH8A 2IXEA 3MRTA 1AKYA 3L5OA 5EY5B 3UAYA 2WSSA 2PG3A 1LDYA 1TQHA 3JQBA 1FSFA 1R10A 2H2HA 3L2WA 1K4YA 1U7DA 2WMDA 3LUGA 3NIDB 3URMA 4ISCA 3L7IA 2HMAA 3NASA 2K9QA 4F4CA 4EB8A 3HBNA 3KO8A 4I66A 4W9NC 4JVOA 3FCEA 3OZVA 3SHFA 5DWQA 2YC4C 1U8TA 2ZB3A 3IERA 4FU0A 4D9GA 4BL0B 2OO5A 4K6MA 3IMKA 3JVIA 5M3FJ 1X1DA 4RSHA 1YJXA 1YUNA 1YULA 2XYQA 1ADCA 3KG2A 3SLRA 2WU1A 3IT3A 4FYIA 2O5RA 2O2DA 4EA7A 3HC7A 1J70A 1EJ0A 3KAKA 3L8HA 4MTCA 1W6UA 4Z9BA 1WHUA 2CXRA 4G63A 3D6FA 1C9DB 1NKSA 2IYXA 3IS3A 3CUYA 3L07A 4QXQA 3VX4A 1SD4A 3BT7A 1PFWA 2AFVA 1DZ3A 4BLOA 1HW5A 1T2FA 4X6YA 1EH7A 2P1RA 3AT1A 2DVMA 1TIPA 3X0DA 1YCDA 3KCCA 4QOHA 4TSFA 4EHBA 3L8ZA 1C7ZA 2YN0A 3ZLTA 1CUIA 1GYRA 3KZCA 4IUDS 3SE7A 1U0OC 2PV0A 3O03A 4Z9AA 5C8ZA 2XBLA 4PSKA 3GDHA 2EAUA 3FXMA 2HSJA 3KM0A 5DHQA 2JFNA 1EH6A 3LSMA 1NRIA 2NN3C 3LBYA 3Q1KA 4HB3A 5F4BA 2RI6A 4HJXA 5HFAA 2PAAA 1F06A 4HBLA 3GEPA 3NTRA 4PZLA 4ZYZA 1KXJA 2EZ4A 3O2QB 3P2OA 1XKTA 3DF7A 1C7IA 2E1NA 4WNIA 1ISHA 5E20A 2ODAA 3QPAA 1Q3HA 1YA4A 1B59A 4R1TA 1Y1PA 3ADOA 5AKKA 3RSQA 3BMOB 1XGNA 1G8XA 1NF8A 2F3PA 3UIEA 4E15A 4F2PA 4OOFA 4YRVA 3ZWYA 1LQ1A 3LRPA 3VUFA 2ZJ3A 1QUEA 2EV0A 1NKTA 2M1BA 3GO4A 4DS3A 1R0YA 2E85A 1ONPA 3OF2A 3KEOA 1FTNA 3U4QA 3DEZA 1KQ9A 1NF9A 1U0HC 5CPFA 3A11A 1ADJA 2OCKA 4XSZF 2AG5A 3A4LA 3KPVA 2NTVA 1ULSA 4OYRA 3U3JA 2JCVA 1AZTA 3JREA 2ZIUB 1K78B 1IZ0A 4AF6A 4DAOA 4JKOA 3FIWA 3PE3A 4QOGA 2SKCA 1MLDA 2NO9A 1JKXA 5DLEA 1MIHA 5L53A 3KTAA 4Q48A 2WF6A 3IBFA 5JD4A 3R0AA 4IX1A 1DHTA 1K08A 2Z33A 2CVOA 4WKCA 1I4LD 5BV1A 1ECCA 4Y98A 2G63A 2X85A 3G59A 1I7SB 2Q8KA 2O06A 1AA6A 1XKXA 1NVFA 5PGMA 1R50A 1TCUA 5ALMA 2BFEB 1W19A 2GFQA 2FSWA 3DAPA 5IY5H 3GAZA 4WCGA 4FGUA 4FKZA 3M9AA 3UK2A 3WDMA 1HNZB 3EPHA 2JC3A 4PC2A 2VE8A 1QAOA 5ER6A 4MCHA 2C2XA 1EGQA 3FPBA 1DIBA 1DWQA 1Z38A 5IKPA 3CRVA 4GG1A 3TNLA 4EFKA 5F78A 1VMKA 1Z33A 5IDWA 2YJZA 5C8YA 3QA9A 5IM5A 4JITA 3B1WA 3R6LA 4DTIA 2EQBA 4CCAA 3MF4A 3RFVA 3AG3H 1DJLA 3IQDB 3VZPA 5JUWA 5LGNA 1E4EB 1VDMA 2DOEA 1W47A 2E82A 2GKGA 4FWIB 1NUTA 4PC7A 2GBCA 1KEWA 3PC7A 1GPBA 3ZS8A 2AK3A 1SCUB 1N3LA 2V98A 3UM9A 3IC5A 3NH6A 4PC6A 1PO7A 4NXMB 5E3OA 3FKSD 3OIPA 3CNQS 3QNUA 2W7NA 1D2HA 4YRSA 1ZUD1 2B4YA 4P54A 4YRPA 3TTXA 2PUHA 4D92A 2H1OA 1IQUA 2F48A 1B0UA 1VJGA 1H2YA 1JLLA 2AH5A 1C3OA 5G1PA 3OYLA 2NO0A 2HF9A 3CX6A 5CB4A 4FGKA 4HLYA 2GMWA 4C7OB 4FEEA 1JF8A 1LC3A 4NHEA 3OP1A 1E1DA 3B9QA 5DGXA 5LEJA 1DG9A 2IZ0A 3THWB 1YQDA 2DTEA 3FWYA 1T0IA 3AFMA 2YNMC 1CUWA 1GPMA 4J94A 3GG2A 4KQKA 3AEYA 1B4AA 3ADPA 1N9GA 1P73A 4IXNA 5FA5A 5HFJA 4RK4A 4IIDA 5EGOB 1BHJA 4RETA 3IAM2 1N1GA 3GROA 1E7WA 1Z6GA 6ABPA 4ERXA 4OREX 3T8YA 2Z6UA 2W6IA 1XROA 4L6CA 4A03A 2BM8A 5T41A 2JAQA 2I10A 1J59A 1AN9A 2C8LA 4UPVA 4L7QA 4LBYA 1J97A 2GAUA 1UQRA 2I1WA 3E6CC 1A77A 2VJMB 1YQUA 3BCRA 2D0OB 3IDZA 3F8TA 1UEXC 2QW8A 2KIQA 3F5QA 3A1UA 3N0RA 2YMPA 4NDLA 4V02A 3VWBA 1ZI6A 2ZQZA 5AXDA 1BS9A 1H8HD 3DO6A 1NWCA 2GNOA 1AHDP 1J0DA 1K6JA 5H1YA 4YX9A 1X74A 2KZVA 3T3HA 1E9SA 1MAWA 2AWOA 3PEVA 3TW8A 3HY3A 1RBQA 3F46A 1TA0A 2DBZA 3OFNA 3OZTA 1UBJS 4FVTA 3R7WA 3UJPA 2XXBA 4U87A 4JOMA 4ITVA 3HEMA 4LHEA 3VGPA 4QLBA 1PUFA 4B3DA 3FYTA 1RC0A 4J7XA 3R7NA 1F43A 2CG4A 3OPVA 3D8SA 3G85A 3M1IA 1DQYA 4RMJA 2GBIA 3TL3A 4BRUA 3GJ0A 3U3MA 3JYQA 1KFBB 2CYYA 4CTMA 2IS1A 2K9MA 5KAIC 2C4KA 2DMUA 3BFXA 3MWFA 3KKQA 3RS7A 4CM1A 3IAEA 3N0XA 4FQ5A 2KT0A 4BN5A 3TMOA 4H2DA 4LMRA 2CHVA 3GUHA 1DLJA 5T4HA 1H05A 4D42A 4XX0A 3J80K 3D4BA 2ADMA 5H59A 3DQQA 4NULA 5JDCC 1EXVA 4BHTA 1XK7A 1TUIA 5AI4A 1SXHA 2H5IA 2FRVA 3GDGA 2KX7A 4CLDA 4IL6C 4UTRA 3ZHOA 1YDWA 3FM3A 3OZRA 2N0SA 4ZAGA 1IXKA 2LOOA 4GOND 1D03A 3SG0A 4AZ3A 2G8LA 4BRWA 3RIEA 4YBRA 5CJ9A 1CDOA 4EENA 5GIOE 4FFDA 3I62A 2YTZA 4MTEA 5FWAA 2ZLBA 2QR2A 1E0SA 4JBAA 3CF0A 2BR3A 1ML3A 3QW2A 4EUKA 1QMGA 3AGPA 2HRBA 1NAIA 3KKMA 5TLSA 4LFUA 1L8AA 1IJEA 2VHZA 4R3WA 1BDMA 3EXHC 1S7AA 3ZHXA 5L3DA 1YMUA 3K1ZA 5LQNA 2ZIXA 3UB3A 1U2SA 3SC6A 1P45A 1NOJA 1AJEA 1WPQA 4BBSJ 2YJGA 3NHYA 3P9SA 2FCAA 4Y9UA 5DTQA 1OU4A 2XMSA 4HGOA 1UJNA 4HZGA 4E6EA 4HGQA 4DA4A 2DLCX 1RQXA 3MJSA 1DAIA 1RWVA 3WISA 4X60A 4FTWA 3SEFA 3I45A 1ZINA 3MCAA 2EPFA 3IT0A 3UXHA 2CFIA 4EA6A 2AJDA 1IG7A 2G9QA 3BSWA 2ISSD 3IMEA 2ZVQX 5KWJA 1J4AA 2BBWA 2JAHA 3P9QA 1K6IA 1N6LA 1T8YA 4DZJA 1UBFA 1PG5A 2QW0X 3IJPA 4GBED 4UJ3A 4YT4A 1G6OA 2WJWA 1S7EA 3RAGA 1Z2NX 1XVTA 1RKVA 3VOBA 3CINA 2WJZB 2JA8J 3CXRA 4EB6A 5A4KA 1FFYA 2V7EA 1OKRA 3WGIA 1WCIA 1LBIA 3UWPA 3ZY6A 3KKOA 5H2FC 1P33A 3VZSA 4FQ7A 3GFRA 3K0CC 3NHZA 1R74A 1LW7A 3O1HB 3MMYB 1WVGA 3ZIUA 3ZDDA 3PQEA 3DMRA 5AW8A 2WAXA 5JHUA 4MEXF 2PMUA 2Q9UA 2PGLA 5LP6C 4HV5A 3E0XA 1MGOA 1JFFA 4FKMA 5CK4A 3SXUA 2D06A 2M4GA 2ZIAA 4BCCA 2JPDA 3SIXA 3EFEA 2PL9A 4HFJA 4JLBA 4R7GA 5HW0A 2UYQA 6ADHA 1VKNA 2JGEA 3HYNA 3I2KA 4B40A 3K4HA 5L9AA 3DGFC 2OA0A 3VZQA 1MBFA 1Z5VA 2DH5A 4B4DA 4J1SA 4Q24A 3WTZA 4MVJH 4ZYTA 2WF7A 2ZXFA 3HTUA 3QTTA 4AI6A 3PHJA 4IFIA 4IOKA 3CO5A 3DKXA 3OMWA 2OZ6A 1WPRA 3P5BA 5DLQC 2BUBA 1FYDA 1XZEA 4HGZA 3VNVA 1E1MA 4F9EA 1M0TA 1BN6A 5HDKA 2RGUA 1LK5A 2EIHA 5BOSB 2PKCA 1A50B 4XH9B 1FQWA 3A70A 5D2CA 4OIQF 3PEFA 4MKXA 4X90A 4KN7X 3CZ9A 4B83A 1KJIA 1A8UA 2CHGA 2BY3A 1PYGA 2J5BA 4NDNE 2OECA 1ZXXA 1XJ5A 2ZJ8A 4XUGB 3AF5A 1QGPA 3FFTA 3G6KA 4OAPA 2L3DA 2VRNA 2EKQA 3F8FA 1GQYA 1C41A 2ZTMA 1PJAA 3UAZA 5EGSA 3KZYA 2QQ0A 3H0GJ 3S14J 2X4GA 1JSXA 1DCMA 2DZDA 3E23A 4MPTA 3MT7A 5BW5A 2B30A 4V0LA 2GEUA 4P5DA 2QWWA 2R7MA 1K9SA 2CS3A 4FFLA 4LY0A 4O2AB 5DCWA 5JWHA 3D0OA 1GV0A 2B7CA 4OHPA 4WZAA 3ZHBA 2EQRA 3K9TA 3L82B 2KI5A 3PFKA 2VUMJ 4FNGA 4B9AA 2HDWA 2BJHA 4P80A 5KSYA 4MIKA 1CULC 3S44A 4WUVA 4GOKA 1T33A 2IA0A 1F8UA 1CZKA 1V8DA 4IWYA 4PQGA 3W90A 2ONYA 3RI3A 1YDFA 4R1LA 4BXXJ 5HEKA 3WLKX 5KQRA 5LLQA 3Q87B 3UYLA 2QYSA 3C5HA 4MS4B 4U2KA 4WFIA 1P7ZA 1OR8A 3E97A 1ZIOA 4RZUA 1HA8A 1E2MA 2Q6VA 2RC6A 5K0FA 1BTOA 1HYHA 5IAJA 4ENMA 2J4DA 4IDOA 2I54A 4W7HA 4HQFA 3FY4A 2CDRA 3WFJA 2WWXA 2E6KA 1I10A 1MNEA 1I2CA 1X1SA 3QE4A 3WP0A 3ZIAD 2I5PO 2JCXA 4CCYA 2R7SA 4MUGA 3AJ8A 3OIVA 2GCGA 3VI4B 2C0PA 4XJSA 1VKHA 1UWKA 1KR2A 3D7RA 3R0QA 4KXYA 5LNK6 3VJRA 4TYYA 1FBTA 4RBNA 2FCRA 1J21A 4UM5A 2DFPA 3WVNA 4DABA 1ENZA 3HVKA 3WG7H 1HK7A 4UUAA 3E53A 3KYIB 2IF0A 3PLNA 2A30A 3TLJA 1QHXA 3S27A 1K8QA 3SDSA 3V4OA 4D4IA 5ERXA 4RELA 2QD4A 2WWVD 1A5BB 2JCSA 5BSKA 1J9GA 2WV1A 1ODSA 3TTUA 4RPCA 3AP2A 1JUPA 4HB2A 1W1UA 1RRFA 3JARB 3GFMA 4EJUA 3DNFA 3OA2A 1E7MA 2VQLA 2BFEA 3R5XA 4YUAA 1BQEA 1G3TA 3EEFA 5H7XA 5GOZA 1OB5A 2HCRA 1KRWA 4UUOA 1RR6A 1P5FA 3LS2A 4KIBA 2PJDA 4N5HX 2ID7A 1DUVG 2XA1A 4PYIA 2ZAOA 4MV6A 5EL0A 3ZK8A 4DV5B 2FFBA 4DGWB 1MUUA 5DBHX 2AW3A 3CONA 1YE3A 4MQ4A 2FK7A 1SEUA 1K7FB 1XL1A 2GT1A 3ONNA 4XNFA 2KMLA 5HF8A 3TD9A 4EARA 5A9SB 4Q4AB 4KAJA 1BYUA 1TJ3A 1Z21A 4GMXA 4K9MA 2CYBA 3LSPA 3WU0A 4KV9A 4BCDA 1H23A 2W6QA 4TGLA 2PUDA 3O26A 1ZM2A 4CTNA 2JEYA 3LFKA 1E8NA 1EQ2A 1PNTA 3FWHA 3Q12A 2QTZA 2MYPA 3N6RA 1IB0A 5H82A 2D4HA 1WZCA 5EN4A 4WKBA 4XOTA 3P19A 4RXUA 1JR4A 2B9EA 2BJVA 3ISTA 4EB0A 3HOUJ 4M1ZA 2M5WA 2ZRAA 3I9JA 4V2FA 5BPIA 4ZZ3A 1QVTA 1KJ9A 1AGXA 1T9DA 1OUMA 4KQXA 4L50A 2VYVA 3C3EA 4FEAA 4TWAA 2VBXA 4XIYA 1E9CA 3LC0A 3O83A 4F5YA 3LHKA 2IEBA 1JYFA 1K8ZB 3ORSA 2ZXUA 2QEQA 1WTAA 3ECSA 1P0PA 3EVEA 1ULZA 3N0WA 2ZTVA 1EK1A 4LA4A 4MA5A 4EW1A 1RHKA 3DF9A 5DCLA 4YV1A 2L4AA 2EFOA 1EJ9A 1ESEA 5D5XB 1C1XB 3PV0A 3HWX1 2WE8A 4GNRA 4RA9B 3TFQA 2OYSA 1GA1A 3M7GA 4P55A 1BI3A 4ZTJA 2NU7B 4CGYA 2J0QA 1X7YA 3CUWA 4N39A 4BE0A 1TW2A 1KFKB 5AIPA 2AG0A 2FLWA 3MMNA 5IK2A 4F4FA 4QUAA 3UFXA 2PWBA 3QKRA 3HNPA 4G07A 1DO8A 1OA1A 2VJIA 3DPTA 3WU1B 5DW3A 2QTHA 4LPKA 4MKRA 3AKZA 1BIBA 4D44A 2QX6A 1Z75A 4LYAA 4WNYA 1CQJB 2E21A 2GBGA 4H1WA 1X7HA 1Z67A 1YKGA 1FTYA 1WUKS 2AB0A 3W79A 4PPGA 3Q0TA 2WUFA 2ZE6A 4UVAA 4UPEA 2AI3A 2QMHA 5KSPA 1EESA 3N2KB 4XKWA 2Y0DA 3PDCA 3ERMA 4XSHA 1ADYA 8LDHA 1XD8A 1NW6A 2VXBA 4UD6A 4BAUA 1N8TA 3MZHA 2ODWA 3OY9A 4Q6BA 5TVGA 4DA7A 5IJWA 3V48A 4I7HA 1PR9A 4TLCA 3CRQA 4EGJA 5C8VA 4QWMA 2I7DA 1HT0A 2WBMA 2H2GA 1D1TA 5FUMA 3GFTA 1FS4A 5KDDA 3IMFA 2AN4A 3PEUA 4DYHA 5BR1A 1MJ5A 1OLUB 1GNVA 2ZSHA 3NATA 1B8UA 2QZJA 1HM5A 3P0IA 5KWVA 1KP3A 2O1WA 3W6VA 2XNJA 4P0PB 1M1YB 1B6TA 1RWOA 1WQ4A 1YJAA 2ABWA 2UUPA 3IEKA 3N76A 4IGIA 4MP8A 4BU2A 3K9LA 1R1VA 1SK9A 1YAJA 2BI8A 4G0MA 9ABPA 3ASYA 1KZ7B 4BH9A 1TJ4A 1YE5A 3EG9B 3SYNA 4AIDA 1JJFA 2HN9A 2Q1YA 3VYUB 3QBJA 2WFMA 4TV9A 3F3XA 4C76A 1UJCA 1Z5WA 1GTG1 3DC7A 2O5CA 4FE4A 3ZMDA 1UFOA 1UODA 3DV9A 2BCGY 4ISBA 2EERA 2CUTA 3H3UA 4DR5B 3PHHA 2Q62A 2IWHA 2ZR7A 2RHOA 3OSUA 4N0BA 2AHOA 1DEOA 2JGIA 4YMUA 1RBYA 3UA4A 3I8XA 4CQMB 1UMDA 2JBHA 2Q5LA 4J43A 4WCDA 1M2WA 3CP2A 4G7ZF 3DSRA 2OEPA 4H59A 4TVSA 3AG2H 1TLTA 2XWSA 3GNSA 3MWEB 3ZE8A 2H92A 1NUAA 4JJIA 5D8LB 4QDZA 1VLZA 1GKLA 1U6GA 2FYTA 4GC9A 1FTSA 1JMVA 4PF1A 4YJ3B 3QELB 3JZAA 4CL0A 4EMBA 1TF2A 5CH3A 1WI3A 2JA5J 1N6PA 3GRFA 1IZZA 1RXIA 2JA1A 2HVRA 1O3RA 3AZOA 4LVNA 1I6MA 4Q1CA 5DH9A 1ZJJA 2RGNC 2OAP1 2E1MB 4QARA 5AJTA 3JQGA 2WWHA 2OKGA 4PSAA 5DYNA 5CB4F 3EYIA 2J5RA 1JRLA 4LRTB 3KTDA 2X51A 4O6VA 2H2FA 2XB9A 4TS9A 1E4EA 5DBIA 2YHIA 2D5VA 3TBHA 3EUKL 4YXFA 3VVBA 3BXEA 4QNNA 3CO7C 2HFJA 1EAMA 4E5PA 3OIYA 1AKHA 5ILGA 2QLFA 4PG6A 5KQGA 4KXVA 4MH0R 4B46A 4R1QA 1BAPA 4OTZA 4WBNF 1HQDA 2J48A 1X38A 4WK2B 3IEPA 1P3JA 2J3QA 4ND8B 1HMYA 3UV3A 2MSKA 5KTKA 4UZEA 1U8EA 7MDHA 1S5LC 2VPYA 3OEED 1YUBA 1CD5A 1NW3A 1Z6ZA 1IEWA 2LIPA 1P6QA 1FF9A 1KZ6A 3JD1A 1AKWA 1DQSA 4WLEA 1SKAA 1OBFO 2R751 1MSFC 3VJLA 5F64A 3OYIA 4K3UA 3K8OE 3UG7A 1G6HA 2I6GA 4FE3A 3TZQA 4L02A 4YIKA 5LQRA 1GUFA 3VEPA 2H0QA 3BBLA 1RJ9B 1CF2O 1QIJA 1U7XA 5FR2A 1D0XA 1WCWA 1XZGA 4KISA 4N8EA 4TV8A 3SEAA 3U9SA 3WIDA 3AI2A 4Y6GB 1QLJA 4WWCA 2A35A 3F7TA 4MOWA 1EZZA 5I5GA 3DFGA 4BRZA 3SZRA 3DLTA 2WYHA 5NLLA 1HSZA 4U9HS 2CD7A 2D2VA 1OMIA 2PKWA 4NOJA 3HB5X 4OFBA 1JIJA 2X6YA 1ETKA 3BDIA 1ENYA 3AVUA 3NHUA 4RJLA 3ZJYA 1E62A 1GRQA 4MR7A 1ZEJA 2E7XA 1YJQA 2AFRA 3VU8A 4TMTA 1CV2A 2PMFA 3LSJA 4HDSB 4F72A 3VV3A 4IQFA 2G4CA 3ZD8A 3MWDA 1SMTA 1QKIA 4RE6A 5SZKB 1H2AS 4UD2A 5KHAA 2L54A 1R8XA 4F91B 1HDOA 1HNNA 1MT0A 1P5JA 1CUJA 2P9JA 2YWXA 3GLHB 3OBBA 5FUYA 4B79A 2DMPA 1QVUA 2L9VA 1NF3A 1ZSVA 2IYUA 2PFGA 4A16A 1PAUA 2WTBA 1DRVA 3BWXA 1GV5A 2VUHB 4CHGA 4F9FA 4RDXA 1SBZA 2IZ6A 2FE3A 2VDRB 2YZKA 1QP0A 2G17A 3OO0A 1C5KA 4HQ6A 1IXCA 4LQ4A 1FW8A 4PQYA 1L7PA 4NE9A 4LYDA 4MS1B 3VC1A 4CM8A 1Q7TA 1E6MA 2QPOA 1AWCA 2QUIA 3FPHA 3GGGA 1SMYF 3KQVA 3PVCA 4HAWA 3T34A 4DIDA 1N2CE 5IJXA 1Y1WJ 3D0QA 2QVLA 3HA3A 3PC8C 4M88A 3PCTA 1P4SA 3ENKA 2DA6A 5FIUA 1YG2A 3ZKWB 5HLTA 1H0SA 4XOPA 3T99A 3F21A 3ETCA 3KD3A 3DYIA 1FEXA 3GW2A 1A95A 2PT6A 2R7AA 4D8WA 3OZEA 1A04A 4KDPA 4TKUA 3ROEA 2D5IA 3IDOA 1DEXA 1WLYA 1Y7LA 4U7BA 2DKFA 3WGGA 2WWGA 3JQCA 1XCOA 4PLYA 4K46A 4MWZA 1IXSB 3HCAA 3MLEA 2VR1A 5HQTA 4E7ZA 5EUCA 3PHCA 3JY6A 3RANA 4KN9S 3AL0B 4Q4HA 2VQ3A 3WU2C 4ZRMA 3WOHA 4OPMA 3RYTC 4DYRA 2M45A 1NFFA 1A1SA 4BGDA 1NJ2A 1YQTA 1BSVA 2FF5A 2CV0A 2NUPA 4JJ6A 4M9CA 6REQB 5HZHA 2C6YA 3E9ZA 1NZJA 2C82A 1EM8B 3QK7A 4HS4A 3QU2A 3UB2A 1KP9A 3EDYA 4RD6A 2TMDA 5HNKA 2GM4A 4I99C 3PGA1 1IVYA 1BC8C 2A88A 1EE2A 2ZULA 5CHEA 3WRYC 1RLTA 1GD1O 2C92A 1P1HA 2HPAA 4RNCA 4HGYA 3E9EA 2G80A 3K92A 5H4HA 3TJZA 3ZKWA 3COJA 4J1TA 5L40A 3PUKA 4HWGA 1APLC 5D3QA 1QANA 3QEOA 3LQFA 4X7RA 1SXJD 2Q0HA 4GW3A 3KVRA 4JEMA 5DISB 4E1AA 2HXIA 4A23A 3WI7A 2P65A 3U3ZA 2FNAA 1QX3A 3BG6A 5A0FA 3V4SA 5JCJD 3O2SB 3QU4A 2PRSA 1YDMA 1DXHA 3DTEA 2HCTA 2J9YB 2II6A 1F0KA 3D7NA 3ETNA 4EQ6A 2XKOA 1BDHA 1U6JA 3NNNA 2M7AA 3DZKA 1HZJA 1IAVA 3AC0A 3MJVA 3TW6A 1P7VA 5CPRB 1BHO1 3AIKA 3ET5A 4HQLA 3RC2A 3RJ5A 3UAVA 4B4VA 5CD9A 5A2QK 1C1HA 4LWOA 4UU0A 3MQ4A 3BIFA 3IUQA 4BDTA 2FSGA 3A1TA 2CW0F 2B99A 3U3OA 4G89A 2Q21A 2BC9A 3O95A 2IUEA 2RHMA 4QO7A 4CMGA 3SFTA 5JH7F 4OU0A 2AG6A 4DLAA 1XOIA 3ZGYA 3KT3A 4LC9A 3MBIA 3E6MA 2WIJA 3DUFA 5CVTA 1ECFA 3ZW9A 1ISMA 5K99A 4MGRA 4IGAA 3F9KA 2JPCA 4RQBA 4AF7A 3ZWBA 2A4MA 3DXYA 1D0YA 1G5RA 1TUEA 2HGCA 3FK7A 1IY0A 1JAXA 1GGHA 3IHWA 3K20A 5EXXA 3THSA 1IXRC 3Q6MA 2XQJA 1L4FA 1JR6A 4EKDA 1NH3A 4LJLA 2VHTA 3ZV7A 3VPSA 3MJFA 3HEBA 4ZTBA 5LP6A 2L9NA 1ZW1A 3JASA 1XRLA 1L5GB 2QSGX 2AD1A 4PLWA 4JX4A 4RQUA 1SUEA 2BFAA 1ZHFA 4ZZ1A 1NN0A 1KJYA 2O2SA 3EMBA 3L7LA 1A9TA 4RVFA 4AJHA 5F52A 4G5YA 5BY2A 2C29D 1YQ9A 1C8LA 4OM8A 3QOEA 4BFUA 3S1SA 1Y1RA 4WN9A 1DS6A 2X2OA 3WXBA 1M2NA 5T3YA 1SVWA 1XI2A 1HDYA 4FUTA 2P7IA 3G2IA 3KELA 5KJCA 2WSIA 5E7IA 1QGYA 3M6XA 3CLRC 2OHVA 1L2TA 4XDGA 4BVBA 1WMEA 4MHSA 1QB7A 3AR8A 1EPUA 3V1MA 1TQPA 4GLJA 1KAMA 1RQRA 2W98A 4N0MA 1TDJA 3B36A 4RS4A 2ZDGA 2LCIA 3AERB 3H4MA 1ZRSA 2PBIA 5AKZA 4ZXFA 3ZCRA 2ZSDA 3K9BA 3L0ZA 2GJSA 2A67A 1H1DA 2VWHA 3AV3A 3IP7A 4K9PA 5G0SA 5JVDB 3AF3A 3LV8A 2GOMA 2G9VA 4QBTA 3HL2A 3LZDA 1F36A 4RGBA 4ARVA 1KU3A 1U28C 3ABTA 1QC5B 1X7ZB 1Z56C 4WK8F 3AUXA 4CIBA 5K3BA 1I1QB 2HPVA 4AULA 4BHBA 3ZVKA 3GNLA 3DTTA 4YV0A 1JB1A 1L0OC 3E2PA 4CQMA 2ZBFA 4BACA 1OLXB 2G28A 3BZKA 2EJBA 1S3GA 4NBQA 3I6MA 4CI0B 3QLTA 1GIAA 5LIPA 2OFWA 3GIWA 2XMCA 2FJ0A 4XYLA 2IHYA 1VPLA 1ZCZA 2L19A 4Y6PA 3FXOA 2VAXA 4E12A 1LV7A 4XIGS 4CKBA 1TQMA 4YRAA 4AKIA 2WAQN 3JW4A 1XX6A 3RV3A 3F6EX 1A27A 1UC5B 5EJEA 4GMFA 1FFAA 4AT1A 2WHPA 3F6OA 1J2RA 1P7PA 3CLVA 3DV0A 4LJAA 3UAGA 3ERCA 2IDZA 4GPZA 4UQPA 2VT3A 5HJEA 4ND5A 5K0ZA 3A9TA 4NX2A 3GT0A 4NZYA 2OHIA 4M21A 3FLBA 3MERA 1XVAA 1W0JD 3ND7A 2ID4A 4ZI2A 4P84A 1L0BA 5IP9J 2TECE 1C8KA 9LDBA 1IPFA 1DADA 1MO4A 4M9UA 3BWCA 1JHOA 4CG3A 3ZEIA 2N46A 2QRNA 3HMQA 3EZXA 2BFWA 2WWFA 4NBUA 4TTQA 3RS0A 2WG1A 2VJQA 1ZGAA 4LSGA 4ENNA 2JGMA 1IM2A 3HP1A 4BEHA 2W00A 3JQDA 1NI4A 2IU6A 3OT1B 4J7CA 4YCSA 2LY9A 3N1UA 2MHCA 3N2KA 2YWFA 1YHQI 4F9GA 2RGDA 1JAHA 4G0ZA 1FFHA 3QFHA 4BP9A 3OWTA 2JVKA 2CK3D 4KV7A 1TT0A 2PX9A 1P72A 3VPDA 3RSFA 1X3ZB 2O23A 2BMWA 4CIVA 2WMNB 4U02A 3DEYX 2HU2A 4BO9A 3F73A 3D6UA 2Z6AA 2BEWA 1COWD 3TWOA 4AICA 4NR0A 2LY2A 1JIUA 1CHNA 1PW5A 1U9OA 1XRSB 2O6LA 3IHLA 1C50A 1UPAA 1JEDA 1I4WA 1Y4AE 3H1PA 4YJGA 3DBLB 3L2OB 1V5GA 2A5YB 2FDRA 2QUHA 4R3UC 2VIXA 1UC9A 3M4NA 5FTWA 1C8BA 3PQ2A 4KVAA 5KCMA 3J81K 5GGXA 5HOQA 2HNBA 5ADHA 4J2TA 1YR1A 5JAMA 1LI4A 5K0TA 3AUKA 3WJAA 4CKCB 3DAFA 4HDVA 3MQ0A 3BXZA 3GOQA 4LMBA 5BSMA 1LH0A 1QPBA 4I81A 4QU9A 2MWMA 5K8JB 4B1RA 3TZBA 4CCKA 1AK9A 4OLFA 1DAEA 4KSBA 1BJRE 4D3DA 4L3WA 1A9RA 5K3FA 5GZ3A 4K0KB 1YNOA 4INZA 3CEMA 5IVIA 4LDRA 2FR8A 1L5SA 2ZIZA 1QHHD 1TT5A 3GUCA 1EKXA 2Z2KA 4P0TA 3ZK9A 3OYJA 3AXTA 5FB3A 3ACCA 5I8PA 5EG5A 3LBAA 1RAEA 3P0HA 1SHLA 3LDHA 4E5MA 1N6IA 4ANJA 4MR8B 1QZYA 2EINH 2EZ9A 2WJPA 3O94A 3QKIA 1DBQA 1DO0A 1ELOA 4JYKA 5BMVF 3RYRA 2IYYA 4FNAA 1MAUA 1K1EA 2QBYB 1V96A 2XGSA 3JVDA 2HSZA 1I3MA 4YNBA 1G5TA 3I64A 4RAFA 1VKOA 1XNHA 5EWMA 2FBHA 2IIPA 3FMGA 3HUDA 2OT3B 1XBTA 3CWQA 3NAZA 2QE7D 4ZIRB 4L3OA 5ALDA 4I2OA 4DVJA 2E35A 5IX8A 1ZELA 4WAUA 4IIFA 1F7VA 4IOCF 1WRJA 3TQOA 4YXWD 1UH5A 5HLIA 4QU5A 5ALNA 1N9ZA 2Z6VA 3EA4A 5HVQC 3WNDA 1MVLA 3WWYA 5B4VA 2MFZA 1AKTA 4MROA 5FI3A 3GLSA 2OAEA 1U2PA 2O03A 1BW5A 2YR0A 1GU0A 4IMPA 5LA6F 1GNPA 3QUBA 5G3ZA 3TDNA 4F6RB 4UUSB 1OX4A 4QO8A 2QSHX 4YVFA 2NVXJ 4N0PA 4XPIB 4J16C 1BMDA 2P6UA 1WB4A 3VR6A 1M7BA 2K02A 1FP1D 1ZUIA 1SBCA 4ZIRA 5CH5A 2WT8A 3UXYA 2X6XA 5FPKA 4UAUA 4CEJA 2O1SA 4FFNA 4NABA 1XRNA 5T4BA 3KEQA 3FCOA 1DQPA 3A32A 4JJKA 3PKZA 3CV3A 1F8YA 4Q12A 4OHCA 1PGQA 1NXPA 2C78A 1BVHA 2G8NA 3O2PE 4DPMA 2A3NA 4GC5A 3UJBA 5CG2A 4UQLA 1SOMA 2VP5A 4TLLB 5JFOA 5HRUA 1GPUA 2RK6A 3TB4A 4FFSA 1N2SA 3RGWS 2PT5A 3BMCB 3JZIA 5D5WB 3RTEA 3VKFA 3P2IA 2LW7A 1YB6A 1Z35A 2FPPA 5LRRA 4LIUA 1LF5A 3QVVA 4OUKX 1BO6A 4CLOB 2VJLA 3TQRA 1N5RA 4BIMA 2H7VA 2PUTA 3EUWA 3L02A 1NM5A 2ZIEA 2HUNA 1Z3IX 2QM8A 1K75A 4U0JA 2VH5R 2XVMA 1O5IA 4RCVA 4UDYX 1ESMA 1GZSA 4OLJA 1N32B 1W87A 5HP4A 2VQ6A 3OU7A 4A3SA 4BBZA 4MWCA 4AMBA 5BT8A 3M1LA 1CJUC 2B69A 4KGDA 3A14A 2HA0A 3VSBA 3HU3A 2EJRA 2TRTA 5SY9A 3ZS9A 2XYHA 2QENA 1BRMA 4CPDA 3OLZA 3PEWA 3KD2A 5ALTA 3A3YA 2EKPA 4P32A 2EF1A 4PU0A 4BQSA 3RADC 3BTUA 5FBQB 3A25A 2Q41A 4QOIA 4ENUA 3UO8B 3LHSA 5EIFA 4KR2A 1DTWB 2JD2A 4RVGA 3IUJA 3FUXA 1I1NA 3I9V2 1TFUA 2HOSA 1VL0A 2EKBA 3GK3A 3K9FC 3OTHA 5JISA 2IUFA 4G4GA 2BGRA 3RI4A 4HQRA 4PRKA 4U6NA 3S8MA 3CBQA 5CA1F 1FFSA 1U80A 2CSOA 2JHGA 3W3AA 2G70A 2C2WA 2YBEA 5JZBA 5K0BA 3ISPA 3OCZA 1P9LA 3OQOA 2VF5X 2AXQA 4AO8A 4M76B 1QKJA 1OQYA 5A7FA 4L5JA 4D82A 1YI2I 5IN4A 1ZVVA 1I1HA 4HTAA 3PB3A 4MWGA 2ID8A 3D4NA 3ZWNA 3K73O 4BOYA 2I7XA 1A7UA 1ZC4A 3BILA 2JK1A 3MSXA 4ARZA 1E3PA 3EXHA 5CFRA 3DDNA 1RHJA 3KDAA 2Y9MB 3C3BA 3VBCA 1ESCA 1Z18A 2A92A 3NVDA 5EWJB 5IK2D 1ZM4A 1UCFA 1YRBA 4PTLA 4AW9A 1D1AA 4FXOA 4PE5B 4L0CA 2GYVA 4RCYA 2BONA 3E5HA 2LY1A 4NJMA 4JLVA 1A8IA 4Y33A 1FDSA 1JXAA 4GHWA 5D3MA 3DLLF 1NRWA 5T5QA 2C9DA 3WA7A 3QITA 4BQFA 1P39A 5LZ8A 4HNSA 3A0RB 4B34A 4D0NA 4QM6A 2A9OA 2FEWB 3C6KA 4DCVA 1QHYA 1QRDA 3NXSA 3EPLA 2MSCB 2C9ZA 2Z2ZA 3MN1A 2VJKA 5TGZA 3DKKA 4GXNA 4MS3B 4KIGA 1GRNA 3FVRA 3DFUA 5M7EA 4EX7A 4CIWA 1F1ZA 2E55A 3ZEAA 2V9VA 1KH2A 3EMVA 1ADFA 3A6FA 2IPQX 1CGPA 3DDWA 4FGSA 4LKRA 3PXAA 2CW7A 4IDFA 5DGIA 4DKJA 3ZZTA 1J5PA 4JNKA 2AX3A 5A4MS 2W6ZA 2LUOA 3IELA 3RAPR 4M54A 2M0CA 3CDLA 2D1RA 2FMFA 1VQ9I 1IBSA 4LOIA 5HS7A 2E4UA 3V97A 4EW6A 3HOXJ 4B82A 4KE8A 4HZUB 3PITA 4JB3A 3H3FA 3MS2A 4LF8B 1XGKA 3T7KA 4YH1A 1T38A 3RG8A 2FV8A 4CR8A 2CEKA 3INTA 5JVDA 1A7JA 1HW2A 2MH2A 3IUSA 3G2BA 2FRHA 4AJJA 2CFCA 2Q5CA 3ND5A 2Q5FA 3K4PA 5HKOA 2XAQA 3EC2A 5CJ2A 1Z6RA 2JHFA 4UDOA 2EWMA 4EEKA 3QU5A 2VBWA 2HV9A 3OKCA 1O3SA 5AESA 4BO5A 1MNDA 2OO3A 4S35A 2WR8A 1J5EB 3PNOA 3TO6A 4CW7A 5J4YA 4BNGA 1RZ4A 2XGDA 3NEAA 2LDUA 5HNFA 4PIPA 2C7RA 3H7AA 4KWIA 3RODA 2X0IA 5KS2A 5F7JA 2ZB9A 1ZK3A 3KVVA 1DDNA 4G0NA 1Q1EA 4PO9A 3VOAA 4EG4A 5BR8B 1KZGB 3E03A 1NMQA 4Q1BA 2AWNA 4BQRA 4C5AA 2UVPA 2P77A 1HNWB 4B71A 3T8RA 2CNLA 5BW8A 1WH7A 2OQGA 3ITKA 1S2IA 5JO9A 4FK8A 1Y3AA 1ZH0A 2A5FA 3OD1A 2W2VA 3KJFA 5EJ9A 2D0IA 2QQAA 1FYEA 4A3DJ 3OJFA 4Q4JA 3SZGA 4EG0A 3WL3A 1EA7A 2RGGA 1SFUA 1W1WA 2V3CC 2LKXA 3BJZA 1PL8A 2X13A 5G40A 4C4PA 3SYTA 4YT2A 4J9UE 2A5WA 1OV6A 3HE3A 5EE9A 1SVSA 2V3VA 1MX5A 1N34B 3AR7A 1JFVA 2ONCA 1IQRA 3GEIA 4C7BA 3IAFA 3LLSA 5CX4A 1G8JA 1MORA 4KFRA 4N6NA 4F38A 2R48A 5KWSA 2P0EA 2JJ8A 2XX3A 4S04A 3KOWA 5DHTA 4BJ1A 4EZIA 3R4VA 3S3OA 2O3RA 3OYHA 1JJ6C 2P7CB 1BOFA 1V6CA 3ELUA 3H9EO 2GDZA 4FONA 4Z4HA 2I8LA 2V5UA 3H2JA 4L57A 5K6AA 1JKFA 3FHLA 2XVYA 3HN7A 1IZ9A 2BHZA 1QYIA 3K8ZA 1T26A 5ALYA 4F2GA 5KYYA 1EXDA 1HI9A 5I5EA 1Z05A 4UTXA 1J8MF 1YO6A 4XVCA 5C53B 3UK7A 2BGLA 4W9RA 5BV0A 5KSWB 5EZYB 2J5KA 4AJKA 5J47A 5BNTA 2VATA 3ADDA 2O2IA 2BPOA 2O2GA 4M7RA 1KO8A 4K05A 3OZSA 3R8XA 3ESAA 4JR2A 3AW9A 3E7LA 5HS8A 4AX4A 2PBZA 1H3NA 3WJ7A 3A1EA 3GTKJ 1A9XB 2RK4A 3BXOA 2QX7A 4YWJA 3HGQA 4LTNA 2W7TA 3HZJA 3CJTA 5DEOA 1BCSA 8ABPA 1UJ2A 2XF8A 3N59A 2RQPA 3OYCA 3JR7A 3PI7A 3CC8A 3G0DA 4JCCA 4QTTB 4C0JA 3C3CA 3LNCA 3U7QB 1GQFA 1PNVA 3ASUA 5ALZA 3S68A 1V1RA 1Q6ZA 5CEFA 4L2IB 4A26A 1D5CA 1DJOA 3GRRA 2NUPB 1DCTA 2DI3A 1Z0JA 4YAFA 1APBA 2H9YA 1VMIA 1MA3A 2DC1A 3DYVA 3JQQA 4YDSA 4I3HA 3O8RA 2J9RA 3QE2A 4I1OA 4ZTFA 3HB4X 4JLOA 4OK5A 3RRXA 4C05A 1K6XA 4HQKA 2WIAA 1ZUNA 5FBRB 2BMVA 4HNHA 3WQHA 1CE8A 4CMIB 3NAQA 3GLIB 2ZZMA 1J1IA 1Y63A 2DT8A 3RV4A 1H8EA 1YS9A 1QIGA 821PA 3ZJTA 1AQLA 3S3MA 2FSSA 4BP8A 3RVSA 1H2FA 2IBDA 3SEZA 5GAGJ 2IS4A 4R05A 1VHDA 5HDNA 3MQFA 3W8DA 2E2WA 3ICCA 4NBKA 3UANA 3V8BA 1KMMA 1SURA 4JJEA 1MQAA 5F2EA 4ENRA 4EDHA 4D99A 1M5RA 1AURA 1DJQA 1C7JA 4OAZA 3HFGA 4ZN6A 1TQ8A 2ZI4A 4OQ4A 3GFIA 1CVIA 5KYUA 3ZNPA 2IEYA 1L5HB 3ENQA 5IKMA 1FOXA 5T6BA 2PZEA 3N7AA 2O5VA 4OMYA 4S24A 3WLMA 2I9KA 1T1SA 3K1MA 1WX1A 3CUVA 3I04M 3M82A 3QHAA 4N3NA 5CH8A 5LQJA 3K9WA 1CUDA 1FOKA 1T34A 3AKYA 3L0IB 3F6BX 3KR0A 4EI7A 3QG1A 4OMDA 1N36B 1WE2A 4ON9A 1LLDA 5TJ9A 1X1TA 3BX1A 2XIGA 4DILA 5AJYA 4CL3A 1BVRA 3AGQA 4KUHA 3PPVA 5J1TB 3DBIA 5DM1A 1V4RA 1I4EB 2PSJA 1MTZA 1Z0DA 1ZMXA 1MMNA 2OC6A 1KI6B 1RMYA 2XE8A 3H83A 4JR1A 4MLCA 5DTMA 5TXGA 3ROPA 1I4OA 4RH0A 1TTTA 1STOA 1XKLA 3PTZA 4QYTA 4M8NE 2R5YB 2UXDB 2JUCA 1RJ9A 2IAIA 1V7PC 3BN3A 1IEQA 2FG7C 4YDHB 4MO9A 1F2DA 3I5MA 4X20B 3DXFA 4MVYA 5EE3A 4QM7A 4DIMA 3TQIA 8OHMA 4YJFB 3NHFA 3U7EB 3KVOA 2GD6A 2GF2A 3DFFA 4KDRA 4CLOA 4MUAA 1P7IA 3BMOA 1Y1TA 3L4SO 1UKVY 3I2FA 1I6KA 1CUYA 3AOEC 1G291 4DWWA 2WWIA 2AS5F 1USGA 2IDMA 5IULC 1NVVR 1VMEA 4LSMA 2J6IA 5EE0A 5K4AA 2AOWA 3I01A 1AKHB 3LGSA 4XEUA 5L6MB 4OOEA 4RSGA 4RY2A 3RKQA 4BE2A 2XV4S 1HFJA 1KAHA 2UZ1B 4P3NA 3NEYA 3QA3E 1XMVA 4UTZA 2VFAA 2PS9A 4WH0A 1DPRA 1MNMC 4OGKA 5AOBA 4ZDPA 4JWKA 4D98A 3CFYA 3V1LA 5CJPA 3B89A 1Y6IA 4NSNA 4LBZA 3TDKA 2IHVA 3M49A 2YXNA 4ZVNA 1DEKA 2HA2A 1NOIA 4P92A 3L43A 2PVCA 4Q03A 5IM4F 3RS3A 5MN5A 4GRIA 3PO3J 3LYHA 4N3GA 1JIQA 2D1QA 2QTMA 4D8YA 1WBDA 2HSDA 2CNWA 4D2IA 2JHAA 1YKSA 1IDZA 3KYBA 3LT2A 2AGVA 4KI7A 1ZU4A 1Z5NA 4K9NA 1C7RA 2WUGA 1TXGA 2EZLA 3FYSA 3VPFA 3ZXYA 1SXGA 2GF0A 2P2LA 2JD1A 2WLTA 3KJNA 1YK1A 1CJCA 1ZNWA 2CJFA 3BD6A 3KQMA 4L0DA 3TINA 3BJRA 3TCXB 3VR4H 2BW3B 3OT5A 4LSWA 4EHKA 4F11A 1FUYB 4TT3D 1VQNI 2VBIA 1FJGB 3VR3A 2DHCA 3SIWA 1QHNA 4NICA 2ISYA 2R4QA 4MA0A 4Y2VA 3CCQI 2BEOA 1N5LA 2PH5A 4GXTA 4Q3DA 1JH9A 3ABLH 5EI5A 1BVUA 4EHJA 2ANBA 4UXNA 4CKYA 1SBHA 3WB2A 3LSGA 2OLKA 2B2XA 3FFBA 2UVDA 4A1FA 5J4LA 4KT6A 1PW7A 1XEAA 4FYVA 4I1PA 4I01A 1UJ4A 5H16A 3MOIA 3VR0A 1G38A 1UG0A 2HQ1A 5K8TA 3KU1A 1J0CA 3AIOA 4LJ6A 3PYMA 3VPGA 4RTSA 4QRDA 1RLUA 3FW1A 2X9GA 1XFDA 1MMFB 4ZPJA 1C9NA 4P34A 2AXPA 2GA2A 4B3JA 4XLEA 1SULA 1U7HA 4FN5A 2ZJAA 4PFJA 2PS3A 5E1OA 2BGNA 3B3JA 3KL2A 2X22A 4A92A 1U0GA 2EFDB 5IXJA 4TL8A 4F04A 5KTOA 3TEMA 2QDXA 2YIJA 4DMKA 2FQ1A 1KS2A 3THXB 3HKDA 4C7MA 4AYTA 2WYOA 3NOOA 4F9TA 2AFHB 5HQ3A 4B0PA 5G2OA 1H22A 5DO9A 5BSVA 5EYRA 2YZMA 1KVRA 5CB0A 4EPRA 3H3VK 4CV0A 5K7ZA 3KSMA 1QGAA 1N2CA 1T08B 5JTUA 2SCUA 4OJYA 1TEZA 1ZU5A 1NHAA 3SMQA 4CTOA 3C1UA 2ZRFA 2XNDD 5L3BA 2R6ZA 2CJWA 5E8IA 3TXAA 4BNUA 3ASVA 1PZXA 3BJEA 4LS3A 4U2EA 3WY9A 3AI7A 1HFKA 3A6HA 3GIDA 5DBOA 1UDBA 5FEMA 3OQMA 5MHTA 2Z09A 2CDCA 1T29A 3K6JA 5BNZA 2ZM5A 3BWMA 2GOXB 1W25A 1JQLB 2AZ4A 2Y6UA 2AOUA 4ZO7A 1RWNA 5IF9A 5JZ9A 3CSUA 3TGPA 1NQAO 3EEQA 3GH1A 5J63A 4HZFA 3W2VA 1M9NA 1QH1B 4PYKA 2CUZA 3FH0A 4RS8A 4P3PA 1MB4A 2Z83A 3FHOA 3OJWA 3Q5EA 3FMSA 3X1WA 4BE4A 3TOBA 4CU5A 1O94A 3AUFA 4YRNA 1FSEA 3Q9NA 3OKFA 2Q0OA 1L1RA 4RV5A 4XB1A 2AC2A 3OOHA 3CLUC 2HMWA 1QU2A 3RZOJ 1DWPA 2ZI5A 1EDDA 1W4AA 4QECA 5E4FA 3I9LA 4CXMA 1H6DA 4E22A 2SNIE 3HXKA 1WZNA 1TCVA 1G8PA 3EGVA 1U0EA 2QN8A 2WD7A 1RRPA 3LOPA 2YY5A 4RIGA 2DSNA 1TZJA 2YYSA 3N2LA 1OIWA 5EVJA 3KUUA 3TLAA 1Z0KA 2QGUA 1KU2A 2IVFA 4GT1A 1F38A 1KONA 1XLTA 2WVAA 4PLCA 3H4VA 5ALOA 1ZIPA 4ZC3A 3C5EA 4ZAWA 4M7PA 2UUCB 3RUAA 4D79A 3CSDA 4AY3A 4K8RB 3FJYA 4KIWA 1RI7A 5DIZA 5DIFA 1SHJA 3IP6A 3MFYA 2LRHA 3K1AB 4YCDA 2CC2A 3TFWA 1TGVA 2Z57A 2ZRMA 5AK6A 4XFKA 5J4KA 2EWWA 4A5MA 1UZNA 4YACA 5IZCC 1JFRA 5EKUA 1I2ZA 1B6SA 1I3LA 1Z12A 3R8FA 1EVZA 4AIKA 3DS8A 1WDKA 1OFUX 4LW8A 2QW1A 3GTMJ 3HB0A 2M8GX 4I50B 2PQ2A 4JN6B 1WVRA 1ZQ9A 2E2IJ 3REQA 1RWBA 1ZH5A 3BC1A 2ZKLA 4DDVA 2JFHA 4EHHA 4JI8B 3ILHA 2GXBA 4EGQA 3JTHA 1J23A 2DTDA 4IP0A 2PMEA 4F3CA 3W2FA 2HNHA 3VOEA 1THGA 3M70A 1RDFA 1IN5A 1ATIA 4BO7A 1TAGA 2GEBA 2O1XA 4TKVA 4A8HA 2Q2NA 4DYQA 2YMMA 4CCYB 1T5BA 4TZ0A 1NSYA 2A1UB 1MZVA 3WDLA 5KVRA 5FDFA 2R0QC 1VPEA 4PXAA 1MXFA 5DN9A 1EVKA 4JX5A 2LK2A 1WXEA 3GVCA 3PZBA 4O29A 1QUFA 2A05A 3QXSA 5LL6P 2QD5A 1U1FA 3RJPA 3AY0A 1XXHE 3JRIA 3AYXB 1XDBA 1N7HA 1CZOA 1PWHA 1RM3A 4RF4A 3SHOA 3T6KA 1NPTO 3ZE0B 1DQUA 5J40A 5EMLA 4LHXA 2AMJA 2BY4A 4JT9A 1WSBA 4Q9NA 5ALJA 1Y9DA 3ZHVA 5C46F 4B3XA 1CUHA 4GKVA 1W1IA 1Y7PA 2JJ7A 1RXYA 4N54A 4ZYGA 2OORA 3ISJA 3PXBA 3LP8A 4JOSA 4OGLA 4D8UA 1VHLA 3FROA 4MKGA 4WOPA 2BYTA 3GLXA 5KYXA 1W7PA 1JKMA 1T9ZA 4M6XA 2HTSA 1EVJA 1SKUA 2C9BA 2GSWA 2UZ3A 3Q4GA 4R8HA 1YR3A 4FNOA 3KB1A 1TJ5A 4OMFG 1YIAA 5M29A 3NDJA 1KMCA 3QY9A 1JHXA 1YJBA 5IAGA 3UJ9A 2NPOA 2NAPA 1TP4A 3A01A 3FSGD 1CUZA 5LZ9A 3E48A 5EZYA 5L7TA 2K86A 2Y9PB 5KMGA 1YAHA 2XUFA 2C57A 3EIWA 5TRTA 1IAWA 4EKIA 2QN2A 3UUEA 4KQGA 3AF0A 2E4XA 2VEOA 3U16A 3G5LA 3JSXA 5ANRB 1CZNA 2ZFWA 3LXXA 2QD1A 4XB2A 4HAZA 3OHMA 3DH0A 4ENQA 1CJBA 4G1MB 4MHGA 5KI6A 1OSNA 3WE7A 2VLAA 1A7AA 5I8ZA 4A1OA 1K5DA 3IUBA 4CNBA 4PBSA 1QX4A 1QQ6A 2BFNA 2INGX 3UENA 4NL4H 4FN4A 4KPUB 4YFNF 2FFHA 5D7NA 2K9NA 1VHTA 2JL1A 3NTXA 4M8SA 4LZPA 2R7LA 1TO6A 1DNPA 2XXAA 2D5AA 4AXBA 2NP6A 1E3SA 2ZQYA 4TLBA 2LLKA 5AWFC 3GHHA 4X65B 1YFJA 1PHPA 4XVHA 1TEHA 3KT6A 1ACJA 3U1VA 1I0IA 1JVSA 1SBQA 3DKIA 2PLNA 3GQVA 3GPIA 1TI7A 1IN4A 2VNJA 1QRYA 5DSZA 3RT9A 1IY1A 1XHFA 3IT2A 3UK1A 2H8RA 5FFZA 1M72A 2HLDA 3BQ9A 3DVRX 2DA7A 3JAMK 4YEJA 4M1QA 2P40A 4MQMA 4GGMX 4U63A 4UNPA 2J87A 5CYOA 1BROA 2LTAA 3KQTA 2K4JA 2BLNA 5JSZA 5CCEA 2HHLA 5FROA 4JI0B 3K4JA 4JI7B 3ZU4A 4DC0A 4NJEA 1SU6A 1JFSA 2V4UA 3TP0A 3B73A 3TRIA 4C9YA 1WXWA 1DXYA 9ATCA 1AQYA 2M2IA 1J75A 1XYGA 3LUKA 3O3NB 5GTIC 1JWAB 1OAOA 1UXOA 1P0CA 2X4DA 3BGWA 3BMXA 1QJ4A 4NBNA 1P7JA 1G20B 4NBLA 2NV2B 4ODIA 2SHKA 4P7KA 4G9GA 1UBLS 4QL3A 3MCVA 4QLAA 5GM2A 1E9VA 3ADCA 4I19A 1BI0A 3HTXA 3BWVA 3T7IA 1E4YA 2PIDA 1AGYA 2GO1A 3EXAA 3G9QA 1S2LA 3QF4B 1SH7A 2G82A 1I27A 2F4MB 3J7AO 2Y2VA 4QEDA 4B4WA 4QC2A 2XGOA 4US1R 2K2QB 1WD5A 4N40A 4G9YA 1A98A 3BORA 2VO1A 1E7RA 3AF2A 2GQQA 3GJ6A 1NP3A 4MVXA 4DA6A 5CDHA 4FNMA 4POAA 3B5JA 3C3AA 1KSJA 4A0FA 5EYPB 1K8XB 3GFOA 6YASA 2EQAA 5DU2A 4G7OF 1XPUA 3GLHA 1Z63A 2WZCA 5HE8A 2XNCA 3QX9A 5F08A 3TDZC 2AEMA 2O0KA 3IVAA 4RPJA 3UJCA 3WYEA 1SWVA 4ZYUA 5LNK1 4MWDA 3ZH9B 3T7RA 1LI5A 4Y6RA 4JYMA 4PN7A 1P7WA 2BZ0A 1FDOA 2XRYA 3H6KA 4RUKA 3T38A 4A5OA 2CMFA 1XO1A 2P6NA 2WLSA 3L9WA 4PJJA 3ICPA 3ZXIA 1Y82A 3D3WB 5EG0B 5BURA 2V7TA 3GLIE 3IULA 2OB1A 2Z9DA 3I54A 1CLUA 3OPYI 4K87A 1KYZA 4LG3A 3U39A 4EA9A 1KYWA 5E0OA 4J1QA 2AMLA 5JY6A 4RGVA 2RHJA 4MKIA 2W2MA 2GJAA 5IEBA 2UZ0A 4UHTA 2NOAA 2XYRA 1VKZA 2NUTB 2ZPUA 1GAQA 3JWJA 4YMWA 4DMUB 4ZYXA 2HEIA 3N8DA 2GI4A 4D6PA 3FFWA 5LQKA 5E7JA 4B3BA 4NMLA 3ZDFA 4XX0B 3VO2A 3W6NA 1O9HA 3FZYA 4ALLA 4BNCA 5AVKA 3RBXA 3NPMA 2RI0A 3SHWA 2VA9A 3ZLVA 1RSZA 4KITB 2WP0A 3SZOA 1SVNA 2CYAA 4D5GA 4G97A 3CEAA 3D3QA 5FBKA 1VSQA 3PPYA 4HAIA 4WLVA 1V7ZA 3AF1A 3B6MA 4LXQA 2GETA 4UJ5A 3UYKA 2W84A 2QAGB 3RNLA 4BEBA 1AT1A 3U3RA 3ZQCA 3E5RA 3PQ4A 3LECA 4AZVA 1YFHA 1PR4A 2F1OA 5YASA 2PX5A 3FTCA 1VPVA 5BUCA 1E6WA 4JBNA 4HTFB 2FW0A 4CIXA 1DIAA 2JJYA 1S2DA 5B3KA 1IBLB 1Y8RB 5JXGA 3JYOA 2GBLA 2A9JA 3STWA 2IT0A 1SG6A 2OO7A 2V96A 4HOYA 1L5KA 3BZBA 3ZZ0A 2F5VA 2PPVA 2A6HF 4KMOA 2IVZA 4KT5C 2JFPA 4NMXB 2WI8A 2TMKA 3E9QA 1U5BB 4OQMA 3TO5A 4BASA 3I6QA 3DULA 2DOFA 3SFVA 4EKNB 1OCTC 2CUEA 3QELA 4TMVA 5EJGA 5FJJA 4LF5B 1XU7A 5FD8A 1TOAA 2XE7A 3MKZA 4XB6B 4I1UA 3DBRA 3MJCA 3U7FB 3A3NA 5KQSA 3E5QA 1NVTA 1O97D 1PDWA 1R6DA 1S4MA 1U8FO 2BBSA 1QV7A 3AHFA 2V7PA 4V2IA 3RHFA 2MW8A 4AWBA 5ADWA 3TOSA 3HKDB 5GQSA 2DPUA 2OFOA 4JUDX 1S6LA 1FJHA 2EFJA 3ZG6A 4BE7B 1ZREA 3HFRA 5LP6F 5EXPA 3N2YA 1T5TA 4XORA 5EZ5A 2C2ZA 3DOHA 3EF3A 3I4FA 4AYXA 1VFPA 1PJRA 4HQ0A 1Z4JA 3Q6NA 4DLUA 3ZVLA 4NMMA 1EINA 2MYTA 3UZUA 4DDMA 3OUUA 1ZCBA 4NJOA 3EVTA 2BFPA 4IKFA 3P52A 3PIDA 3G9TA 4GM0A 4L85A 4RD3A 3ZDRA 3QYEA 1RBZA 3BDAA 1K3FA 3VH1A 1GT91 1QFSA 3ES9A 2BGIA 2HXSA 3I61A 1LPSA 1W52X 1DU0A 5CMLA 5HQJA 3AR5A 3K4KA 3LMMA 2YQ5A 4U0VA 2BBOA 3MMXA 4N03A 1KI8A 1PWZA 1XTTA 2ADOA 4PGMA 2VF7A 4HF1A 3CG0A 1PI3A 1ULHA 3PS9A 1AX9A 3HXQA 5A2QA 2HO4A 3R3VA 2OVFA 3DCNA 2OCLA 1R4AA 3IDQA 2P2CA 4YDQA 1O03A 3NTQA 2O8DB 3S5UA 2X0KA 2H6CA 4I55B 5FTNA 4IIYA 5DI9A 5LBTA 2GTIA 1II8B 4I0WB 5JBNA 4OHFA 1KWKA 1NU6A 1EFUA 3EGEA 5LC1A 2VOPA 1DIHA 5FHRA 1SQ6A 1TAQA 4LX0A 3P7MA 2EX1A 4A2UA 1FUUA 2WTXA 1T13A 2JGFA 2QNRA 3R0ZA 4C03A 2A9KA 1SIBE 2J30A 1QK4A 1LUJB 1WS6A 2VPQA 2ZIGA 3NM5A 4IUBS 5J2UA 5EZGA 4ZVLA 5AVYA 3AVYA 2QVBA 3UF0A 2Q27A 5IYCJ 2EIKH 1CY0A 4JBLA 3I12A 1BJZA 4Y2HA 2H08A 3UFXB 3UJHA 4AC9A 3O8BA 1K7AA 1C4OA 2GZAA 4V0QA 4RAZA 4I50F 3MZ0A 4XIIA 3FKSA 2NU7A 1T5DX 3GUUA 4M38A 1KXZA 3BPSA 3IBSA 4F85A 2C07A 4U7GA 2E71A 1E64A 3UMYA 3PLAE 2H8WA 4IKPA 2ZJ4A 1ZA1A 1NDQA 1SEPA 3Q41A 2QLLA 4OSPA 1DU4A 1U1GA 3LCRA 2YVUA 4I4LA 4MYRA 4BYGA 1U65A 2Y1GA 4CN9A 5HUHA 1G3UA 3LA7A 3LPNA 4M1TA 1JU4A 4OHUA 3PXCX 3BL5A 3UT5B 1VLJA 3OQIA 4LF6B 5TE9A 3V4RA 2VASA 2XJ4A 4DIOA 4V0SA 1B14A 1IEXA 1NE7A 3BYZA 4OP2A 2C31A 4WX2B 4UNRA 1FRVA 3K2ZA 1JEQA 3OE7D 1MH1A 1J39A 2FPLA 3E5NA 3P0RA 4XYEA 2FRDC 4YJFA 5JSKA 1F8XA 2ROQA 1PGOA 4R8VA 3KP4A 1TU0A 2OBPA 2A07F 3TKYA 1YQXA 4PGAA 5JJBA 1GA4A 1Q19A 4YJ2A 4FHGA 4R16A 5L3CA 1TA9A 3V1TC 5B3AA 3EXIA 4DV3B 3GCWA 2N42A 4EI2A 5HLHA 3NUQA 2K3FA 2XMZA 3COWA 4IQ8A 1VJRA 4F46A 4HV4A 3F0TA 1QAMA 4NPAA 2CLSA 2NNLD 3W2GA 5TGTA 4HLQB 1I2AA 4OKIA 2X9VA 4F3TA 4O4LF 1F8FA 1G8HA 4MW9A 4PINA 3QNMA 1T9BA 3Q3IA 5GVRA 1TMKA 1T5SA 2BM0A 2H7CA 2YJ4A 1YKFA 4KK4A 4EQZA 3IUEA 3M2PA 1VQKI 2EBHX 4Y7NJ 2I3ZA 4DR1B 3SPXA 3UOGA 1HE8B 1RETA 1BE0A 1S2MA 2C7PA 2G7UA 3R5SA 3HKCB 4HDAA 1I5EA 4HNAB 2ZDHA 3QWAA 5ICGA 2LNBA 3K32A 5C8DA 2BI7A 5I45A 4PCAA 4CMCA 1ZMBA 3RAEC 4I5GA 3HSSA 2CVPA 3GR6A 2GLTA 4W9NA 3SHQA 2JJQA 5CFPA 2HLHA 1N2GA 3LLMA 4OI2A 2VBFA 4R81A 2VAWA 4F5WA 5AVVA 1SFRA 3R9IA 3HWWA 3QNWA 4QIHA 1ECLA 2QT0A 3HJNA 3QLVA 4YONB 1RD4A 2OFPA 3QXGA 5JFTA 4KVZA 1P5HA 3CX4A 1E5TA 2D3WA 5IT3A 5A2GA 5JHGB 4S0ZA 4NCBA 1EFRD 3PO2J 2VK8A 2HR3A 1F1JA 2BYVE 1Q0ZA 4BKXA 2Q4RA 1UOPA 1HW1A 1US8A 3FR8A 3M6FA 1FU4A 2A1IA 2IYEA 3LA8A 3N5CA 1SXPA 5F0HA 5A4AA 2QY6A 4TN5A 4G0UA 3GF2A 3QLVC 5FAXA 4RLQA 1ITZA 1IDOA 1WJ5A 1T25A 1UP7A 2ATCA 4JB8A 4KWEA 3V4GA 4WA8A 4ALKA 3FF1A 1GXSB 1S72I 4X1YA 2IWRA 1EUYA 2D1SA 2ZJFA 4W8GA 3U2RA 1A2BA 4ZAFA 3CLQA 1JV2B 2Y1CA 3ZH2A 2E1RA 1RAAA 3PSHA 2VYND 4ESBA 3NOXA 2Y1KA 5TF4A 1MQ8B 4ESEA 4O2BA 1O5TA 3EAFA 2FSFA 1BCSB 1NVWQ 3CJTB 2ECCA 4KBFA 5C9ZA 4DAEA 2R6R1 1Z17A 2ZI3A 4KH0A 4ENPA 3MYYA 1ORDA 3AUTA 2AIRA 3G88A 2H9AA 4Q1VA 4BVEA 3WHCA 1MJAA 3L7DA 1BMFD 1D8AA 3EF0A 1Z4KA 4Z1MD 4Y6QA 1UM9A 1XJ0A 3OLXA 3R61A 4YYEA 3OICA 3DTIA 2RGRA 1W4RA 2VXCA 3AF4A 2IUTA 2X6RA 2ZRBA 1Q0PA 4LYYA 4HGNA 4BKRA 1FFGA 3UXMA 1YX3A 2WHYA 4XXHA 5JCXA 3I6IA 4Z9YA 2LYCA 2R85A 4FXPA 1FSHA 4ZKDA 4ZCIA 2F3RA 3OMLA 4JYPA 4D9JA 2UYYA 5FO1A 1RXWA 3S2HJ 3I4NJ 1TT7A 1U1EA 1V3VA 1Y98A 4IYJA 3K09A 4DQ0A 4LJSA 4BZWA 2XAJA 3CUSA 2C77A 3H1FA 4JHXA 5E2AA 3AINA 2ZR8A 3HSKA 5JS7A 1G5PA 2J41A 1V6AA 2X3UA 2Y66A 1V0JA 4L95C 3EPKA 4ZVMA 3IRRA 3E9RA 5LDDC 2BT4A 3KYCA 1YWGO 1S8OA 1KJNA 4RYLA 2E18A 5E6SB 4Y18A 3RUCA 3TUZC 3USCS 1AN0A 2DLNA 3H5LA 3KJIA 4KBYA 4S1PA 4CXFA 1DARA 1NXQA 1X1QA 2QV0A 4H7FA 4PX9A 5CLQA 3VU0A 4E46A 3JRCA 1JEAA 4X95A 1QA6A 1PFQA 2XWPA 4M86A 3CCBA 4D80A 1D04A 2QNIA 1SBTA 1HOXA 1FRQA 1NJ6A 1ZJYA 1PG0A 3B1YA 3EZFA 3I42A 3LAJA 3DLBA 1EA5A 3OFND 2XUPA 2BE9A 1ZQ1A 1ZICA 1SD2A 2X7XA 2P35A 5KPDA 5FWYB 2Q4BA 3G2PA 3GVPA 3RS9A 3CE9A 3K1YA 4KXXA 2ZNZA 1U8XX 2PL3A 4Z7JA 2RG1A 1A9QA 1VF9A 5JAQA 2G5PA 2V7WA 4IUCS 2VQHA 1FFBA 3K4MA 3QLJA 2E5ZA 2KKOA 3TO9A 1PJCA 2H29A 1I13A 2O6HA 2F6CA 1EFHA 1PLKA 3F90A 4OVKA 1AU9A 1N1EA 2F8MA 1JLMA 1R8JA 3SSMA 4ZYAA 5A6VA 1TF5A 1ZXLA 3IEUA 4INPA 3CZ6A 2PXHA 4DZRA 4P8RA 2VZLA 2GN1A 2P9HA 1U8ZA 1WU8A 3ZUPA 5FAKA