2LNBA

Solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Z-DNA-binding protein 1
publication title Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lnbA00
4IXAA 3MCZA 1F1ZA 3ZP5A 2EV5A 3HUGA 2MH2A 5LLQA 1S29A 1SD6A 3LFKA 2XAQA 3C1DA 2VXZA 1K6OA 3WTWC 5L3FA 1MDMB 1FP2A 1EH6A 4GXOA 2VBYA 5FD5A 1XMKA 3RYRA 5CJ9A 1ZARA 3V4GA 5A2QZ 3ISPA 1T39A 1E2XA 4IRHA 4WK8F 1R5GA 3IRRA 1BIAA 1R22A 2FE3A 2D2WA 3JW4A 4ENMA 2IJLA 2HWVA 3I0TA 3WE3A 1CF7A 4I0AA 4L9JA 2W25A 3CDHA 3ELKA 3LAJA 4PZJA 2JRTA 4G7HF 2QYOA 2TDXA 2ZO4A 1U3EM 2QWWA 1XDSA 3I4PA 5FO5A 4UUVA 2GA2A 2JSCA 1TQIA 1QZYA 2ESNA 1P2FA 1FYMA 2QQ9A 3GO5A 2DW4A 1XGNA 4IPAA 3E5XA 2RQPA 5L3DA 2XVCA 5FLXK 2DAOA 4IRIA 5LHGA 2H94A 3SXYA 1R1VA 2H6CA 3VODA 2EJRA 3KP7A 2ZBKA 4IRGA 5AIQA 4CZZA 4UV9A 2X0LA 4KIBA 2M1BA 1ONVA 2FXAA 3HOTA 2WWYA 2ISYA 2FRHA 1BI0A 3BPXA 5F64A 1RNLA 1MJBA 1R5HA 4EGYA 2DBBA 2QZ8A 1OYYA 2XAJA 1I5ZA 2HQNA 3OV8A 2DPDA 1FY7A 5L3EA 2CSOA 4KYWA 4ESFA 1IF1A 2VT3A 3KFWX 1O3QA 2EV0A 3IL2A 2F2EA 4L9TA 4RAZA 2D45A 1QGPA 4U88A 3U2RA 1ZRCA 3E3VA 4CDGA 4YFKF 2NNYA 2VODA 2XRNA 3KP3A 3JSOA 3GZ6A 2DT5A 3E6BA 4HF2A 1RI7A 4LG0A 3REOA 4G7ZF 3HIFA 3HTSB 2ZNZA 3U1DA 5CYVA 5TJJA 1S6LA 5BMZA 1HKTA 5ILVA 2CG4A 4IHSA 2Z33A 4OMZA 1DP7P 3FHZA 1FNNA 3CTAA 3HRTA 3I53A 1FBUA 4RGRA 3N4MA 4D0PA 4BNCA 2Z99A 2L54A 5HS9A 1D5VA 1I27A 3CLOA 4LG0B 4L0YB 3LAPA 1BIBA 3COAC 5ICCA 1YTYA 3GUDA 1Y0UA 1ZLKA 4WF2A 4NQWA 4S04A 4EQQA 4L0ZB 2BV6A 2RKHA 5D8LB 3G73A 3GYHX 3V7SA 3R4KA 5D4RA 4OU0A 4KNYA 4A5NA 2XROA 2VE8A 1U78A 5CVJA 1J59A 2YR2A 5J8CA 1D8KA 2Q8KA 2FNAA 3K0LA 3J81K 2FNPA 2COMA 3IHUA 2DPUA 2E1CA 2P6SA 4A0ZA 2IW5A 3T0YA 2W57A 3WU0A 5BQTA 3BJOA 3HSFA 2FOKA 3RJPA 3VFZA 3GFIA 2ZXJA 3M9AA 1U2WA 1YS7A 2K4JA 1ZRDA 1W7PA 3TDUC 3KETA 4U0YA 1F5TA 4QLCU 1P6RA 1FBSA 1V3FA 3F3XA 1STZA 4RB0A 5LGTA 2QLZA 5AIPA 1FOKA 4EV0A 4BH9A 3K1MA 4ZYHA 2VOPA 1U8RA 3F23A 1Q1HA 2PEXA 4I98B 2VBZA 2EFQA 3CUQA 1O7FA 4KN7X 2M45A 1ZH5A 1T0FA 4EMSA 3VOEA 3CUQC 3T1BA 1KU7A 3LQRA 5E8GA 4EJTA 4ZZDA 5J8FA 3EYYA 3DP7A 3VB2A 4HQEA 2UWMA 4HX4A 4HBLA 2ISZA 1ZGJA 1ZGAA 3HTUA 3RKXA 1AWCA 2XHKA 3OOPA 1IN8A 2HR3A 1J5YA 2HEOA 3V7RA 1LDKB 4PDKA 2IA2A 1PP8F 2A6EF 1KQ9A 2P4WA 2IPQX 3CUQB 2JZYA 3G3ZA 5FGMA 4RGUA 1BI3A 1FZPB 1QPMA 1Z7UA 2P6TA 5L3BA 1TW3A 1KU9A 5D5XB 1LEBA 2OU2A 4FX4A 3JTGA 1SMTA 5J6XA 1Z91A 1ZREA 1XGOA 3WTUC 2RNJA 2F5FA 1J2XA 1ON1A 1T98A 2HS5A 3TO7A 2A61A 4KDPA 3KEOA 4R1HA 4M6XA 3GFJA 3D0SA 1R1UA 3FMQA 5LHIA 3TKYA 1Z9CA 1J0RA 2GXGA 3QPHA 4P96A 1DDNA 2HKOA 3MZHA 2K4BA 1YW9A 3M8FA 1QBJA 4PGHA 4CYDA 2L4AA 4BHPA 4EJOA 2JPBA 2OA4A 3HRSA 2MLKA 3GW2A 5KVRA 2KKOA 3I64A 5TRDA 4HF0A 1USTA 1WQ2A 3CO7C 2EB7A 2NNNA 2GAUA 1XD7A 1HSTA 1WWXA 1XCVA 2YX7A 1XCBA 4EM0B 2HYFA 4KUMA 4I0BA 2PMHA 1S3JA 1G4DA 1FPQA 4LMYA 2LKPA 2RDPA 4JQFA 2CGPA 3FXUA 3T8TA 3I5UA 3KLNA 1S8NA 1GHCA 3EUHA 2DQLA 1HXDA 3QPTA 1IXCA 2M30A 1FBQA 2MH9A 1V4RA 2IA1A 3IRQA 4EVIA 3IWZA 2NS0A 3RKWA 3FX3A 3F8FA 4MTDA 1FT9A 4MHGA 2QQAA 1B59A 1SFXA 1VTNC 2E1NA 4MNUA 4OIPF 1YW7A 5JI6A 2FA5A 1LJ9A 3BROA 4QWQA 2RGVA 3RIRA 2E7WA 2FBHA 4XLPF 1JE8A 1R7JA 5HDNA 1ZAOA 5K1YA 4EM2A 4WWCA 3RPUA 2K27A 6PAXA 1IXRC 2QM3A 2GQQA 2XUBA 1HSJA 1KU2A 1SFEA 4O6JA 1SD7A 3F8MA 2F5EA 4HDUA 1FLIA 1W5TA 1XSXA 2O8XA 4U7BA 4P9UA 1TQPA 2D1HA 1YO5C 3DQVC 1K78A 4MQVA 3TOAA 1UHMA 3F22A 4ON0A 4OIQF 3J7AO 3TDZC 5ED4A 1RUNA 1O3SA 2DI3A 1TQMA 3ZMZA 4CGZA 4AWXB 4UV8A 1SD5A 3D5LA 4MEXF 3E6DA 4R79A 4I7HA 1LEAA 1BC8C 2L02A 3V8LA 3L9FA 3H92A 2FSWA 2BBYA 2H09A 4ZH4F 4RB2C 4RB1A 1O7LA 2P5LC 1K78B 3SQNA 3F8BA 1X3UA 1HBXG 3TQNA 1EV7A 4I09A 2HQRA 2O6GE 1HKQA 3BP8A 1YG2A 2OQRA 1F4KA 1DPUA 2W85A 5FLXZ 3FMSA 4A0YA 3NEUA 4CHUA 1BOAA 3QP5A 4HZFA 1ZLJA 3ECOA 1NHAA 1QO0D 4ASNA 2DLLA 4CICA 2MLGA 1R1TA 1W5SA 1I1GA 1JHFA 3RI4A 2EFNA 1P4XA 1FX7A 2QVOA 3WU1B 2RN7A 1OYWA 1XDUA 5CVVA 4G7OF 1Z05A 4HF1A 5DCFA 2DK5A 3MQ0A 4FT8A 4AIJA 2Y0MA 3WODF 2DFIA 2P5KA 3I71A 3HSEA 3IWFA 1IW7F 1YLFA 3EQLF 3WTYC 2HFHA 3MWMA 4HOBA 3BJAA 1AOYA 3MFKA 3P9IA 1U5TA 1BN5A 4OINF 2OD5A 4MEYF 1IN5A 3TOBA 5L3CA 1PP7U 1GVJA 1U5TC 2KIUA 1BJAA 5D5VB 1K7AA 3VEPA 2HYGD 3CJNA 4ENNA 1P4WA 3ABUA 3AAFA 2G7HA 5BPDA 2OAZA 4LLLA 2WTEA 5E17F 2KIMA 1SAXA 5IT9K 5HS7A 1YW8A 4HX8A 4BHCA 2QBYA 2HTJA 3ZMVA 4LB6B 4ENJA 2DO7A 1U5TB 2KIFA 1HQCA 2A68F 2GZWA 3ABTA 2X4HA 4M9ZA 1WSUA 2HDCA 3ROUA 1ODDA 1H0MA 2PI0A 2MC3A 5CVRA 4GGGA 4UVCA 2PLYA 2BEOA 2FF4A 2K7LA 2V6CA 5HDKA 2JTVA 3QU6A 1QQIA 2AS5F 2QBYB 3F6VA 4G94A 3C7JA 3B73A 1Z6RA 5CVIA 1B6AA 2NYXA 1IRGA 5F1RA 2CO5A 2GA1A 4G8XA 5HOOA 4YIIA 1RUOA 2EFOA 3K69A 3B02A 5ERIA 4XRFA 2MA3A 3J81Z 2UZKA 1IUYA 2A5YB 3FXQA 5K5OA 2AXLA 1G3YA 2GIVA 4LB5A 3E97A 1C0WA 5LHHA 1G3WA 4RAYA 3RPQA 2FQ3A 4L9NA 4DQ2A 1YYVA 1KYZA 2ZFWA 3LSTA 5JHUA 4M73A 2VOOA 3CO6C 1UHWA 4L5JA 3O2PE 3O3KA 2P7CB 3R61A 3WE2A 5DUKA 5AONA 3RKYA 4N9IA 5DD8A 4M72A 4JK1X 5CVUA 3JSPA 2LF7A 3BOQA 3M8EA 5FB2A 2CFXA 2VBWA 4Z2YA 4G6QA 4H0EA 3LA3A 2VC0A 5JFRA 2NAZA 4LJZF 2ZJ2A 2IRFG 3GWZA 2ZCWA 1F9NA 4KT5C 5ILUA 1J75A 4U0WA 1USSA 3WG9A 5LEJA 3L2CA 2ACJA 3WGHA 4OIOF 1U6GA 5LRSA 4Y13A 4XSZF 3KP5A 4R8HA 2FMYA 2VONA 1JGSA 2P8TA 1YFHA 1GXPA 3DKWA 1UFMA 2W84A 3BY6A 4UHTA 1GXQA 4M71A 1KQ8A 3W6KB 4M9XA 1B9NA 1LQ1A 3EDPA 2J5PA 3WTXC 1ZN2A 1P4AA 3JTHA 4P5OA 2IVMA 3KP6A 2D1VA 3EYIA 2O0YA 1XB4A 3EETA 1O3TA 4N0BA 5E8IA 3L00A 5LGUA 3U9GA 1FSEA 4UVAA 2FU4A 4TV7A 1W4MA 2XGXA 3JAMK 1IRFA 4Y15A 3J80Z 3TGNA 1PDNC 2V1UA 4Q47A 3WTTC 5DYMA 4HLXA 2LDUA 2P5VA 1FYLA 5E1XA 4YFXF 1DPRA 4HX7A 4HAMA 4WX9A 2LF8A 2DQRA 3N97A 4HYEA 2KJCA 3K2ZA 2XASA 5IT3A 1L0OC 2CQKA 2O61A 3KE2A 4WXHA 4G9YA 1D8JA 1ZRFA 2Z9OA 5D4SA 3GX4X 3K1PA 5D5UB 2RV8A 2V1DA 3HRMA 3M1EA 3H3ZA 1E17A 2QENA 1FSHA 1D3YA 4KFCA 4Q5SF 3S2WA 1HKSA 3CUOA 3E6CC 3F8NA 5BS6A 4EJUA 4NB5A 5CLSA 5D5WB 2GWRA 3FF5A 2LNBA 2ZKZA 3V7CA 1Z6TA 1S7AA 1T6SA 1BI2A 2OZ6A 1IN6A 4AD9A 2L4MA 2CW0F 1MKMA 4XSXF 2UXNA 4DNCA 3MAJA 3R6SA 2KRFA 4N9HA 3WTZA 5E20A 2PBIA 2IP2A 1ZYRF 3RDIA 3WGGA 5K5RA 3FZVA 4MGRA 4EGZA 3V8JA 3ZQ7A 4KA4A 3GFMA 2Z5UA 5FFXA 4FHTA 1LDDA 1IN7A 1ON2A 4L5IA 4EJWA 2YSRA 2WC2A 4BYYA 3KP4A 1PUEE 5H20A 3I58A 3PFIA 3QU3A 4JBAA 2MBFA 3KP2A 1TW2A 2A6HF 4O3MA 4UNOA 3L7WA 4UXNA 1OYIA 2BYVE 1BC7C 3WGIA 3RTRA 2M8EA 2ETHA 2XIGA 5K5QA 2MD5A 4A12A 3F21A 5HS8A 1FP1D 4HW0A 5JR3A 4ZYDA 2OBPA 2EK5A 5F6FA 4WXDA 4KICA 3HRUA 1W7PD 1ZG3A 3SZTA 5A2QK 4HLYA 5H6QA 2HOEA 4P9FA 3ULQB 1BM9A 1KU3A 2EA4A 1RIOH 3IKVA 3BPVA 3PQJA 1WI9A 2HZTA 2B0LA 3KCCA 4YG2F 1XN7A 4YFNF 4AVPA 1IN4A 2EV6A 3P7NA 5FFZA 1J7KA 1JHHA 3Q9VA 2V9VA 3ZMUA 4EM1A 2K86A 3T8RA 3ZPLA 3P9KA 1XSDA 2PMUA 2YPRA 3K9TA 5HLGA 4A6DA 2FMLA 1TNSA 3K1NA 3ERED 3R60A 3ZMDA 2VT2A 4Q48A 3F8CA 4I01A 1TTYA 3F72A 3TO9A 5KK1A 2QUFA 2YU3A 1G3TA 2HTSA 4YIFA 3DF8A 1J9IA 2V1XA 2Q2EA 2E7XA 1CF7B 2O03A 3HYIA 4BXUA 1Z1DA 1G3SA 1MD0A 1BBYA 1SMYF 1HW1A 4O5VA 2ELHA 5D6FA 4LLNA 4MQ9F 3Q5FA 4A2UA 3F6OA 5LGNA 4KIGA 4OIRF 1KQ0A 4ESBA 3LA2A 2P7VB 5BPIA 4LLGF 2PJPA 2PQ8A 1QZZA 2W24A 2FEZA 2OQGA 1KGSA 2JPCA 3BZ6A 1MJAA 2NRAC 1HW2A 5HDGA 1IZ1A 4ZZLA 4K2EA 3O6BB 2Y48A 4Y17A 1KA8A 3E5QA 1HW5A 2A69F 3RYPA 5ICEA 1EH8A 3GXOA 1TBXA 3I59A 3MZYA 2WV0A 5D6EA 5DD4A 5L3GA 2ZNYA 3DPLC 2Z3YA 2EWNA 3T5XA 2XAHA 3NQOA 3BDDA 4AIHA 4FX0A 1XMAA 2XKOA 2EFWA 4WXCA 5IT9Z 3C18A 2F5DA 4IVNA 4GCVA 1ZG1A 3ECHA 4L18B 3GZ5A 2PG4A 2R7DA 1BI1A 4KMUX 4IF4A 3I54A 2IA0A 4M74A 2IT0A 3I59B 1MZBA 5ICGA 4AIKA 2K02A 2F5CA 2DK8A 4A5MA 1L3LA 5ILSA 4LK1F 3GF2A 1ZHFA 1I6XA 3W6JB 4GYGA 2A07F 4B09A 4IHTA 1IXSB 1B1BA 3ZMSA 3DPTA 5HVQC 2R3SA 4XBFA 3ZMTA 4CO8A 2HGCA 2PN6A 5H6RA 3LWFA 3WTVC 1TLHB 2Y75A 4Q4ZF 4XLNF 3NRVA 4LFUA 5ICFA 3TO6A 2VE9A 4ESJA 2A3SA 4RGXA 3HHGA 4L9VA 3LQQA 3IC7A 2L01A 1SFUA 3ML6A 2R7FA 4S05A 4NHJA 1XGMA 2STTA 2CWEA 2UXXA 4LD5A 2M87A 5HLHA 2QQBA 5EEGA 3R0JA 4OOIA 4PGGA 3FWEA 5DDGA 2VC1A 4GO1A 3HOSA 1ZG5A 3DV8A 1OMIA 2CYYA 4U0VA 3E6MA 1DUXC 5FD6A 1JXSA 1SD4A 5LEKA 2RC4A 2YX4A 5BOXA 1W7PB 1B4AA 4P55A 1WRJA 3SFZA 1MGTA 2STWA 4KIFA 3E5UA 3C3WA 3QRFF 5HLIA 2ADUA 2XAGA 4B8XA 3R0AA 5JVTA 3DFGA 3LA7A 5DCMA 2ZMEA 3BWGA 1FYKA 4KN4X 4A0XA 1XSVA 1R58A 3GFLA 1LDJA 3ZN0A 3GVAA 3GLXA 1ULYA 5DV5A 2OZUA 2BE5F 4BQAA 3SZPA 2O3FA 1EH7A 2EA2A 2H6BA 4BAYA 1OKRA 1MJ9A 2LSOA 3J80K 1KYWA 1B9MA 2ESHA 3JAMZ 1O3RA 2M5WA 1OR7A 1YIOA 4A6EA 4RGSA 3KZYA 1CGPA 5DCMB 2ZMEB 4I02A 3KEQA 4HA8A 2RVCA 3HHHA 4HV5A 3DEUA 3HSRA 3Q9SA 3QAHA 4GYIA 2VN2A 3PQKA 4RS8A 2DU9A 1T2KA 1REPC 2XAFA 3QP6A 2FBIA 3L09A 2GXBA 4CXFA 3KZZA 4OMYA 2EFPA 2H27A 1FC3A 4HDVA 1WKMA 2G9WA 4WCGA 2BGCA 5EEHA 2G7UA 4ZYEA 4ENKA 4ZYGA 4U7DA 1OPCA 4UVBA 1UCRA 1O57A 3IKTA 5DUIA 1YS6A 4E70A 1K79A 3V8KA 2HKXA 1UB9A 2XV4S 4F7ZA 1FWZA 1LVAA 1RZ4A 4IJAA 3BJ6A 2J5OA 2KJBA 1YQAA 2PFBA 2FBKA 4HQMA 1R36A 1TNTA 5LBQA 4M6YA 5DEQA 1R23A 4KMFA 2DTRA 5LRRA 3QOPA 3FMRA 1S7OA 3M7GA 3P9CA 5E1WA 3MEXA 3KLOA 4EJVA 1A04A 1LB2A 1XGSA 4LK0F 3DXJF 3GEZA 2V79A 4G6DA 2JT1A 1H9GA 1T38A 1I1SA 3ZN1A 1H9TA 3SHFA 4RB3C 5D8KB 3FXRA 3H3UA 3FM3A 4ETSA 4M9SA 1R00A 4MTEA 2VBXA 1MDMA 4LGWA 3FM5A 2C6YA 3WTSC 5E18F 2Q0OA 1IAWA 2L3DA 4I2OA 4BHBA 4HV6A 1P92A 1QNTA 1G6NA 5E1ZB 4PCQA 1LNWA 2XKPA
chains in the Genus database with same CATH superfamily
1TWFJ 4IXAA 1SVOA 5LFAA 4BL0B 3MCZA 1F1ZA 2HPIA 3QPLA 3ZP5A 2EV5A 3HUGA 2G0EA 2MH2A 2QGUA 4RM2A 5LLQA 1S29A 2IAIA 4J19A 1LUJB 1SD6A 2DJNA 3LFKA 2XAQA 3OYAA 3C1DA 4B3XA 4B43A 2VXZA 1K6OA 1GV5A 2QSHX 3WTWC 4JX6A 1X1CA 5L3FA 1MBHA 3SYTA 4P1WA 5TISC 1A36A 1MDMB 1JI8A 1FP2A 1EH6A 2M34A 1HOMA 4GXOA 2LP0A 2VBYA 2ZJQF 2JRMA 3PSFA 1P7JA 5FD5A 1XMKA 3RYRA 5FJ8J 4LIVA 3K4CA 5CJ9A 5FRMA 2NS7A 2Z2SB 1ZARA 2QA4I 2CV0A 3V4GA 5A2QZ 3ISPA 1T39A 1E2XA 4IRHA 4WK8F 3CP8A 5BNGA 1R5GA 3IRRA 1TT5B 3U21A 1BIAA 1R22A 2FE3A 2D2WA 3JW4A 4ENMA 3HUGB 2IJLA 2HWVA 4CUGA 3I0TA 3WE3A 5J4YA 1CF7A 4I0AA 2HYJA 4L9JA 2W25A 3CDHA 3D1NI 1MNDA 2HZDA 1R5ID 3O8GA 3ELKA 3LAJA 4PZJA 5EF6A 2JRTA 4G7HF 3K2AA 2QYOA 2TDXA 4HRIA 2ZO4A 1U3EM 2QWWA 4E7SA 1XDSA 3I4PA 4CCMA 3E7LA 4RAGA 3OL4A 5FO5A 4UUVA 3H36A 2GA2A 2JSCA 2E1OA 3X2QH 3I4NJ 1TQIA 1QZYA 2ESNA 1P2FA 1FYMA 2QQ9A 3S1RJ 4ZJZA 3GO5A 3FK6A 3PNTA 2ZSIB 3F0CA 2DDAA 3JRDA 2DW4A 2X6WA 3EUKL 1XGNA 4IPAA 1QVUA 1X2MA 3E5XA 5J4VA 2RQPA 5L3DA 2XVCA 4CCNA 5FLXK 2DAOA 4IRIA 2UUZA 5LHGA 2H94A 3SXYA 1W36C 1R1VA 2H6CA 4IHWA 3VODA 2EJRA 3KP7A 2ZBKA 4IRGA 5AIQA 3ZQQA 4CZZA 3L2RA 1YX5A 4V19K 4UV9A 2X0LA 3PIPF 4KIBA 3BCBA 3OYFA 2JK3A 2M1BA 1LFUP 1ONVA 2FXAA 3HOTA 4L5EA 2WWYA 2ISYA 2FRHA 5IP9J 1BI0A 1ETQA 5K7ZA 1WJCA 1TT0A 2LTPA 3BPXA 2NVXJ 3FXLA 5F64A 1RNLA 2AQFA 1MJBA 1QHHD 3PIOF 3LSRA 2R7SA 3ZQLA 1R5HA 1F43A 1V5GA 2KDOA 4EGYA 4J01A 2OF7A 2L9VA 3MN2A 4QTRA 4E7JA 3TEDA 3OS1A 2DBBA 4CH7A 2F5VA 1T33A 3LSGA 2QZ8A 1OYYA 2DT6A 2XAJA 1I5ZA 1WHUA 2HQNA 3CDLA 3K7AJ 3OV8A 4MFDA 2B63J 3QWLA 2DPDA 1LKXA 4QIWN 1FY7A 4OAYA 3JCUC 3OIQA 4BJTA 5L3EA 2CSOA 2YS9A 4KYWA 4ESFA 1IF1A 3RZDJ 3HM5A 1ACIA 2VT3A 3KFWX 2R7XA 1FTTA 1A6IA 5EGOA 1O3QA 2EV0A 3IL2A 2F2EA 4L9TA 4RAZA 5B5EC 1QGPA 2D45A 4U88A 3U2RA 1ZRCA 1DU0A 3E3VA 4ZTFA 4CDGA 2XC7A 4YFKF 2BY3A 2Y0SA 2X1DA 1TL8A 2MABA 2NNYA 2EBIA 2VODA 4PSWA 1MBEA 2XRNA 1POGA 2L9SA 5IYBJ 3ESWB 3KP3A 3JSOA 5EDNA 3GZ6A 2DT5A 3E6BA 4HF2A 1RI7A 3K4MA 4LG0A 3REOA 4G7ZF 3HIFA 4PFOA 1Z77A 1ZELA 2L7FP 3HTSB 2OUMA 3OS0A 2ZNZA 1YIJI 3U1DA 1BR4A 3H3VK 5CYVA 1SAUA 5TJJA 1S6LA 5BMZA 1HKTA 4X1EA 2R92J 3FISA 2KPMA 5ILVA 2RAEA 3DTIA 2CG4A 1Y1VJ 1Y6IA 5FROA 4IHSA 1I3QJ 4OMZA 5EGOB 2Z33A 1DP7P 5FLVA 3FHZA 1MBKA 2E19A 1FNNA 3BG7A 3CTAA 2WADA 2IGOA 3HRTA 3I53A 3P5JA 1FBUA 2GXAA 4RGRA 3N4MA 4D0PA 4BNCA 3PSIA 1LFPA 2Z99A 2L54A 5DM6F 3CJTB 3ABMH 5HS9A 3TL4X 3H9JA 1D5VA 3OYKA 3HG9A 1I27A 3CLOA 3K4KA 4LG0B 4L0YB 3LAPA 4JOMA 1BIBA 3COAC 3FKJA 5ICCA 1YTYA 3AFHA 3TW6A 3GUDA 3PNVA 2X51A 1SEUA 3S3MA 1HDPA 1Y0UA 3SDBA 1ZLKA 1CQTA 2R7RA 4WF2A 4NQWA 4AUXA 4EQQA 1KZHA 4S04A 4L0ZB 2DDBA 1VQLI 2BV6A 2RKHA 3ASOH 2VKDA 4DYQA 2Y30A 5D8LB 2ECCA 3G73A 4BE1A 3GYHX 3HZJA 2AO9A 1YE9A 3V7SA 2M7AA 4GRIA 3OYMA 3R4KA 5D4RA 4OU0A 4KNYA 3FIWA 2H8WA 1NG7A 3M3YJ 2X6YA 1VF9A 4A5NA 2XROA 2VE8A 3HGGA 1U78A 5CVJA 1J59A 3BG3A 2YR2A 5J8CA 3LSHA 1D8KA 2Q8KA 5E3OA 2FNAA 5EZHA 3K0LA 1IDZA 3J81K 2FNPA 2COMA 4ZDPA 1A5JA 2K85A 3IHUA 2JN6A 4XLEA 4C3IJ 2DPUA 2E1CA 3CCYA 2P6SA 4A0ZA 1D1BA 4YRVA 3ASNH 2IW5A 3T0YA 2W57A 2VJJA 4NQWB 3FXOA 3WU0A 3WG7H 5BQTA 2ZFUA 3BJOA 1UZCA 2FOKA 3HSFA 2YUSA 3K4JA 3RJPA 3VFZA 3GFIA 1IG7A 4NNJA 2ZXJA 4UUTA 1FOYA 3M9AA 1MW7A 1U2WA 1YS7A 4XOPA 3CF2A 1WGXA 2DFFA 1IDYA 2K4JA 3JRCA 1ZRDA 3ABLH 1OLTA 1BOBA 4DW6A 1DGWY 1W7PA 3TDUC 4A3BJ 3CQZJ 2VQHA 3KETA 3SZGA 2FQ4A 3LMMA 4U0YA 3NWTA 4QLCU 1F5TA 1P6RA 1FBSA 1V3FA 3F3XA 3DU6A 2Z16A 1STZA 3GTJJ 4IKFA 4RB0A 2EZKA 5LGTA 2QLZA 5AIPA 3KPHA 1FOKA 3BZKA 3UNGC 3DLLF 4EV0A 2ZXWH 2LC2A 1EF4A 4BH9A 3K1MA 2IGKA 4ZYHA 2VOPA 1U8RA 5F1JA 1OCPA 3F23A 1Q1HA 2PEXA 3H35A 4I98B 3BTJA 2VBZA 3CCQI 4XNFA 1HA8A 1XMXA 2EFQA 3CUQA 2OTJI 1O7FA 3BG6A 2MYSA 2EPFA 4V2FA 2X1CA 4KN7X 2M45A 4A3EJ 1ZH5A 3BTLA 1I6HJ 2XB0X 1T0FA 1V5FA 4EMSA 5F27A 3VOEA 3CUQC 3OL3A 1GT0C 2DFEA 3MKWB 3T1BA 4DZJA 4EATA 1EJ9A 1K4TA 1FOXA 1KU7A 3LQRA 1WFXA 5E8GA 1Y0NA 4EJTA 1T0FC 4N4OB 4ZZDA 4BY7J 5J8FA 3EYYA 3DP7A 3VB2A 3MKLA 3QYEA 4HQEA 2F6CA 1QRYA 3A1YA 2UWMA 1MMDA 4HX4A 1LE8A 4HBLA 1MNEA 2ISZA 1ZGJA 1ZGAA 3HTUA 3RKXA 1AWCA 2XHKA 3OOPA 1OCCH 1IN8A 2HR3A 4ZC3A 1J5YA 2HEOA 3V7RA 1LDKB 2CQ7A 4PDKA 2IA2A 1PP8F 1JGGA 2V26A 2A6EF 1KQ9A 2P4WA 2IPQX 1FIAA 3CUQB 2JZYA 3G3ZA 2F48A 5FGMA 4RGUA 1BI3A 3PNYA 2L2OA 1FZPB 5IYDJ 1QPMA 1Z7UA 3JRBA 2P6TA 3ZR8X 5L3BA 1TW3A 1KU9A 5D5XB 1LEBA 1D5YA 2OU2A 1N77A 3IP4B 3LSKA 3L2QA 1PUFA 2BW3A 3CCUI 4FX4A 2EIJH 3W2VA 3BG9A 5B3SH 3JTGA 1SMTA 3LSIA 5J6XA 1Z21A 1Z91A 1ZREA 1ZTRA 1YX3A 2B9SA 1XGOA 1LE8B 1MH3A 4E6KG 5IY5H 3HDDA 3WTUC 1RC9A 2EIMH 4XK4A 4RDUA 2RNJA 2GIZA 3F9KA 4ZDLA 2F5FA 4XOTA 3S16J 1IC8A 4CCLA 5FLMJ 1J2XA 1GUUA 1ON1A 3OYHA 2Y9YA 2FOWA 4JYKA 1T98A 2HS5A 2LY2A 3TO7A 3QPSA 2A61A 4KDPA 3KEOA 4R1HA 5FRNA 1N75A 4S0HB 1JTXA 4M6XA 3LSJA 2XSJC 2KDZA 2HNHA 3GFJA 3D0SA 1R1UA 3IH2A 2IXSA 2MG4A 3FMQA 1HCRA 5B1BH 1PUFB 2R7VA 2BW3B 2KRCA 4C30A 1X1PA 5LHIA 3TKYA 2VLAA 5GTIC 1Z9CA 1J0RA 2GXGA 3QPHA 4P96A 1DDNA 2BHYA 2HKOA 3DEEA 3MZHA 2K4BA 1YW9A 2ELKA 3HOWJ 3M8FA 1QBJA 1AA7A 4B48A 3VSKA 4PGHA 3CD6I 4CYDA 3PUBA 2L4AA 3OYJA 3LSPA 4BHPA 2JJ7A 3J7ZI 1WJAA 2LBFA 4EJOA 2JPBA 2OA4A 4BJ5C 3H0GJ 2LKSA 3HRSA 1VQNI 2MLKA 3GW2A 4W1UA 5KVRA 1K4SA 2KKOA 1FJLA 3I64A 1UJ8A 1DGRM 3CMAI 5TRDA 4HF0A 1USTA 4CCKA 1WQ2A 3CO7C 2JA7J 2MFZA 2EB7A 2NNNA 2O8KA 1RRJA 3HOVJ 4XLCA 2GAUA 1XD7A 2XPWA 2HXOA 3K4LA 1HSTA 1WWXA 1XCVA 2YX7A 3CCMI 3TBIA 3I55I 3HKZA 3GTOJ 1XCBA 4EM0B 2HYFA 4C9YA 2ZJPF 3OYIA 4XRSA 4KUMA 2VPRA 4I0BA 2PMHA 1ZGWA 3G1LA 1S3JA 1G4DA 1FPQA 4LMYA 2LKPA 2RDPA 4JQFA 2GOMA 2CGPA 3FXUA 3T8TA 1QZEA 3U1KA 2M0MA 3I5UA 2LBFB 3KLNA 4BACA 1S8NA 2XDVA 4AC0A 3NARA 1GHCA 1Z0XA 2DQLA 3EUHA 4CYCA 1RKWA 1HXDA 3QPTA 1IXCA 3KYCB 2M4KA 2M30A 1FBQA 1WJ5A 2MH9A 1OCZH 1V4RA 3KYLA 2IA1A 2CV1A 2VI6A 4EVIA 3IRQA 3EUHC 3IWZA 2NS0A 3RKWA 1Q1VA 2CMPA 3FX3A 2OCEA 3F8FA 5TGTA 4MTDA 1FT9A 3HOYJ 4MHGA 2QQAA 1B59A 1SFXA 1VTNC 3GTQJ 2M0CA 1JUMA 1ETOA 1R4MB 1VQKI 2E1NA 4MNUA 4OIPF 4H4KC 1YW7A 4A3CJ 1T8IA 5JI6A 3G4SI 2FA5A 1LJ9A 2KRHA 3BROA 4QWQA 2RGVA 3RIRA 3K6GA 5DS9A 2E7WA 2FBHA 1RKTA 4XLPF 2BVLA 3AL0C 2Y9ZA 1WI3A 2JA6J 5IOZA 4HSRA 1JE8A 4A3GJ 2K9QA 1R7JA 4CYCB 1SC7A 1IRXA 5HDNA 4E7IA 4GFBA 1J09A 1ZAOA 1FTZA 2ZSHB 2KFDA 3G1OA 5K1YA 4EM2A 4Y4RA 3RPUA 4WWCA 2K27A 6PAXA 2HI3A 1S5LC 3H5AA 1TP4A 1IXRC 2EINH 3CCVI 1KONA 2IS6A 2DA6A 3HKZN 2KHMA 3M8JA 4A3MJ 2DA7A 2QM3A 2GQQA 2XUBA 1HSJA 1KU2A 1SFEA 2R4GA 4O6JA 1SD7A 3F8MA 2F5EA 4UUSA 4HDUA 3B6CA 4AYBN 3AL0B 1FLIA 1W5TA 1X4PA 1XSXA 2O8XA 3SEQA 4U7BA 3SJMA 4ITVA 3S32A 4P9UA 2R0QC 1TQPA 2D1HA 1YO5C 3GTKJ 3DTKA 1K83J 1X58A 3DQVC 1K78A 2LKXA 4MQVA 1Z3YA 3TOAA 3HXLA 5IP6A 1UHMA 3F22A 2M2EA 4ON0A 2CFOA 3DBHB 1W5CC 4OIQF 3J7AO 1HLVA 3TDZC 5ED4A 5IP7J 1RUNA 3W6VA 2TCTA 3LFUA 1O3SA 1WJDA 1H88C 2DI3A 1TQMA 3ZMZA 5JHFA 4CGZA 4AWXB 4UV8A 1SD5A 1UMQA 1W1WE 3ZQFA 3D5LA 4MEXF 4E7LA 2VL8A 3E6DA 4R79A 3OS2A 2TRTA 4I7HA 4A3IJ 2QSGX 3HBLA 1LEAA 3CMEI 1BC8C 2EH3A 4AIDA 4RAFA 3TW7A 2L02A 3H5NA 3V8LA 3L9FA 3ZRGA 5GAEJ 4UUSB 3H92A 2BY1A 4DGWB 4A93J 2FSWA 2BBYA 2H09A 4ZH4F 4RB2C 2L0KA 2DA1A 2WAQA 2CV2A 4RB1A 1O7LA 3L1PA 2P5LC 1K78B 2ME0A 3SQNA 3F8BA 3J7YJ 1X3UA 1HBXG 2X48A 3BCAA 1EA3A 3TQNA 1EV7A 3WU2C 4I09A 2HQRA 2O6GE 3MVPA 1HKQA 2P0WA 1WCMJ 2XB5A 3BP8A 4PJ0C 4V2GA 1YG2A 2IS1A 3ZGKA 5GTHC 2FX0A 2IBDA 4Y3OA 4JX4A 2JUCA 2OQRA 4I6ZA 1F4KA 2NVTJ 1MSEC 1DPUA 4M6VA 2W85A 5FLXZ 3FMSA 2X1EA 1PJRA 4A0YA 2BZTA 3NEUA 4CHUA 1BOAA 1IRZA 3L2UA 1G8XA 1X1BA 3QP5A 4HZFA 1D1AA 1ZLJA 1JTYA 4YELA 3ECOA 1NHAA 1QO0D 3Q3SA 2E71A 4ASNA 4FCYA 1FEXA 2DLLA 2VIXA 3CP2A 4CICA 2MLGA 1R1TA 1W5SA 5K7HA 1I1GA 1JHFA 3OR2C 3RI4A 2EFNA 1P4XA 5IPAA 1DU6A 1K61A 2FUG2 1FX7A 2QVOA 1RPWA 2HU9A 3WU1B 1Y8QB 1S7EA 2RN7A 5J1UA 1OYWA 1XDUA 2CQXA 2DTZA 5KAFC 5CVVA 4G7OF 4U87A 2XGEA 3CLQA 2DA2A 1Z05A 4HF1A 4DBRA 1ZR2A 3GTPJ 2DFHA 3G1MA 5DCFA 2DK5A 3MQ0A 4FT8A 4AIJA 4GDFA 2Y0MA 3WODF 2XAUA 2DFIA 2KZGA 4D5CA 2P5KA 3HPGA 2GBYA 3ERMA 4XKCA 3I71A 3HSEA 3IWFA 1IUFA 5M5XJ 2V6EA 1IW7F 1YLFA 3WHCA 3EQLF 2WAQN 3WTYC 2HFHA 2MD0A 3MWMA 4HOBA 1ETYA 3BJAA 2HQ5A 1AOYA 2Q2EB 3MFKA 3P9IA 2FJ1A 1U5TA 3BR6A 1BN5A 5FKOA 1VQOI 3HOZJ 3GTGJ 4OINF 2OD5A 4DZPA 4MEYF 2M8GX 4MFEA 2KQRA 1IN5A 3TOBA 5L3CA 1PP7U 1GVJA 1U5TC 2KIUA 5DM7F 1BJAA 3PUFA 5D5VB 4XONA 1K7AA 1TZLA 3VEPA 2HYGD 2JA5J 3S2DJ 3CJNA 4KJZA 5J1YA 4ENNA 2CRGA 1P4WA 1SFKA 3ABUA 3AAFA 2G7HA 3VDXA 5BPDA 2OAZA 4LLLA 2WTEA 5E17F 2KIMA 1SAXA 3G6EI 1X1DA 3S3OA 4BBSJ 5IT9K 4AVZA 1MIJA 4F55A 4NC7A 5HS7A 2OTLI 1YW8A 2XGDA 4XR6A 4HX8A 4BHCA 1X2NA 2QBYA 2HTJA 1JKQC 1YRNB 3ZMVA 4LB6B 4ENJA 2DO7A 3OY9A 1U5TB 2KIFA 4W97A 4NUBA 3L2WA 1HQCA 2A68F 2GZWA 3ABTA 4Y7NJ 2X4HA 4M9ZA 1WSUA 2HPMA 1BR1A 3HPHA 1U9NA 2HDCA 3ROUA 1ODDA 1JUSA 2XRLA 4PUSA 3FK7A 4BGDA 1H0MA 1E0EA 2PI0A 1LPQA 1R9TJ 2KL4A 2IEKA 2MC3A 1B72A 4IOCF 5CVRA 3OSFA 2DMPA 3D5RC 2PJRA 4GGGA 3BLYA 1MNMC 4OWRB 3CDIA 2OJED 2E5ZA 2LY9A 1MMAA 4UVCA 2EZHA 3G71I 2PLYA 1LFBA 2BEOA 2FF4A 2DYRH 2K7LA 2V6CA 3FXKA 2JTVA 5HDKA 3OSGA 3QU6A 1QQIA 4QPQA 2AS5F 2QBYB 4B1RA 5M5WJ 3F6VA 4G94A 1GV2A 3PL8A 1GVDA 3C7JA 3Q0WA 3S2HJ 3B73A 5F08A 1MMGA 1A6QA 1Z6RA 5CVIA 1B6AA 3MMYB 2NYXA 1IRGA 5F1RA 2CO5A 2GA1A 4G8XA 1XPXA 3RCOA 3TMOA 1HC8A 5HOOA 4YIIA 1D1CA 1RUOA 2EFOA 3K69A 4DJAA 3B02A 5ERIA 4FTHA 1B72B 4XRFA 3FDYA 2MA3A 2GOXB 3JRAA 3J81Z 2PJRB 4CZCA 2UZKA 1IUYA 2A5YB 1JT6A 1OCRH 3FXQA 4ZYAA 5K5OA 5IOYA 2AXLA 3K70D 2JA2A 2XF5A 1G3YA 2HVQA 2GIVA 4LB5A 3E97A 2BY2A 1C0WA 3BR5A 2KT0A 4CSWA 3V42A 5LHHA 1G3WA 4XLAA 4RAYA 1UHSA 4DYCA 5H2FC 3RPQA 2FQ3A 2ELJA 3KX2A 1Y8RB 3VYUB 4L9NA 2ICWG 2COBA 4IHXA 5J47A 4DQ2A 1YYVA 2A05A 1KYZA 2K9NA 2ZFWA 3BQYA 1V5EA 3LSTA 5JHUA 3W2WA 3HOXJ 2ZC2A 4M73A 2QSFX 1NH3A 3DU5A 2VOOA 4IEJA 5C44J 3CO6C 1UHWA 4L5JA 3O2PE 3O3KA 2P7CB 3R61A 3WE2A 1D0XA 5DUKA 3MKZA 1VI0A 3OYBA 5AONA 2ID6A 5GPAA 3RKYA 3H0DA 4N9IA 3RSNA 3O8HA 5DD8A 4ZTJA 1RESA 4M72A 4JK1X 5CVUA 1GLNA 1BL0A 3M1CA 3JSPA 2LF7A 4MIMA 5HNHA 3BOQA 3M8EA 5FB2A 2CFXA 2VBWA 4Z2YA 2HVSA 4G6QA 4H0EA 3GTLJ 3LA3A 2VC0A 3OWTA 5JFRA 2NAZA 4BQQA 3W2AA 3I4MJ 4LJZF 2ZJ2A 2IRFG 2CS3A 3DTEA 2R7OA 3KEYA 4JX5A 4J00A 3GWZA 2CJJA 2ZCWA 1F9NA 2VKEA 4KT5C 3JR9A 5ILUA 1J75A 4U0WA 1USSA 2KZVA 3WG9A 4HNUA 1M1EB 5LEJA 3L2CA 2ACJA 2XSDC 3NWSA 3ZQGA 3WGHA 4OIOF 1U6GA 2L9NA 5LRSA 4BQNA 4Y13A 4XSZF 3KP5A 4R8HA 2KLOA 2FMYA 4XM3A 4C3JJ 1R71A 2VONA 1JGSA 2P8TA 1YFHA 1GXPA 3DKWA 1UFMA 5EG0A 2VASA 2W84A 5M3FJ 3BY6A 4UHTA 4XKBA 1GXQA 2H8RA 1OCOH 2R7TA 4II3A 4A3FJ 3I3LA 4M71A 3VPRA 1KQ8A 3W6KB 4M9XA 1B9NA 1LQ1A 5J3LA 3EDPA 2J5PA 1W36D 5HNFA 1ZN2A 4DIQA 3WTXC 1P4AA 3JTHA 1AHDP 4IQJA 4P5OA 2IVMA 3KP6A 1X4OA 2D1VA 2Z1DA 3EYIA 2O0YA 1XB4A 3OYDA 3I56I 1MBGA 4X0GA 3EETA 1FMVA 1YHQI 2JQ7A 3FHNA 2VQCA 1O3TA 1K6YA 4N0BA 5E8IA 1QHGA 3L00A 5LGUA 3U9GA 1FSEA 4UVAA 2FU4A 4TV7A 3ZQCA 1AKHA 1W4MA 2LOOA 2XGXA 3JAMK 1IRFA 2WB1N 4XRSG 4Y15A 3J80Z 3SEZA 3TGNA 1PDNC 2WY8Q 1Y39A 2V1UA 4Q47A 5EG0B 3WTTC 3DWLE 5DYMA 3AG3H 3DEWA 1TC3C 1XS9A 4HLXA 3ZCOA 2LDUA 2P5VA 1FYLA 3IAS2 3VYRB 5F0CA 5E1XA 4HNTA 3H1CA 3H9GA 4YFXF 4N4NB 1DPRA 4HX7A 4HAMA 3A03A 4WX9A 2LF8A 2DQRA 3PM1A 1YJ9I 1W0UA 4QPOA 3N97A 3BC8A 4HYEA 3FBIB 4G12A 2KJCA 3K2ZA 2JWTA 2XASA 4XLHA 1U8BA 5IT3A 1L0OC 2CQKA 2LH9A 2O61A 3KE2A 4WXHA 4G9YA 1UG0A 2GM4A 1P7IA 1AKHB 1D8JA 2F4IA 4FETA 5DTDA 1ZRFA 3C2HA 1BJZA 2Z9OA 1ITYA 4HEA2 1NG6A 5D4SA 3GX4X 2HQAA 3K1PA 4DBQA 4Z6YA 3FXJA 5D5UB 2RV8A 2V1DA 3HRMA 3M1EA 3H3ZA 1E17A 3CMMA 2QENA 2WA0A 1FOWA 1FSHA 4ANJA 1D3YA 2DA4A 1ORKA 4XLFA 4KFCA 3AG4H 1Y1WJ 4Q5SF 2XPUA 3S2WA 4B44A 1WH5A 1HKSA 3CUOA 4BU2A 3E6CC 2EQRA 1MH4A 2P81A 3F8NA 4IQ4A 1F36A 5BS6A 1T08B 4EJUA 4BKXA 2WBMA 4NB5A 5CLSA 1JT0A 3A02A 5D5WB 3JRGA 2GWRA 3FF5A 4NDLA 1TWCJ 2LNBA 2ZKZA 4CCOA 3CESA 3V7CA 1Z6TA 4A69C 1S7AA 3PO2J 1T6SA 1BI2A 2NVUB 2OZ6A 3RQ4A 2OV7A 1XX5A 1WJBA 3ZQHA 1IN6A 1TWHJ 4AD9A 1X1AA 4AYBA 2AHQA 2L4MA 1BW5A 2CW0F 2CUZA 3M4OJ 5CKTA 3ZXSA 4X6AJ 1MKMA 1UAAA 2R7WA 4XSXF 2ECBA 3G2BA 2V7FA 2UXNA 4DNCA 2LFBA 4XICA 3MAJA 2LMDA 1IV6A 3R6SA 3PO3J 1OISA 2KRFA 1WJFA 2CW8A 1SFOJ 2HDDA 1ETWA 2DJIA 1QU3A 3HL2A 4LITA 2K5CA 4N9HA 3WTZA 1WJEA 3KZIC 4A3KJ 2F4MB 5E20A 2PBIA 3AG1H 5FKKA 2IP2A 4BS9A 1ZYRF 3RDIA 3WGGA 5K5RA 3FZVA 4MGRA 4EGZA 3V8JA 4M3BA 2CU7A 1ETKA 3ZQ7A 4KA4A 3LNQA 2Q1ZB 4XN0A 3GZNB 4RLQA 3GFMA 2Z5UA 5FFXA 2DMNA 4FHTA 4MLOA 1LDDA 4BXXJ 1IN7A 1ON2A 5CPRB 4L5IA 2W82A 4EJWA 2WAFA 2W7NA 2YSRA 4IO9F 4G6TB 2WC2A 4FQGA 4BYYA 2VQGA 1X3WB 3KP4A 1PUEE 5H20A 2CW7A 2MC4A 3I58A 3PFIA 3QU3A 4JBAA 3LL7A 2MBFA 1GDTA 3CCLI 2X9DA 3KP2A 1TW2A 2A6HF 4O3MA 1P9QC 4UNOA 5FKMA 3CJRB 3L7WA 3M07A 3BTIA 2LK2A 3S17J 1ETXA 4UXNA 3BR1A 1OYIA 4RMNA 5F0HA 5F0FA 2BYVE 2AQEA 3K4NA 1BC7C 2I8DA 2ZJRF 3WGIA 2EILH 3RTRA 3H9QA 5GADJ 1E3HA 2QF7A 1RR8C 2M8EA 2ETHA 2XIGA 5K5QA 4I99C 2MD5A 4A12A 4LOCA 3F21A 3JREA 2K9LA 5HS8A 1FP1D 2CH0A 3VYTB 1JKOC 2R7QA 4HW0A 5JR3A 4ZYDA 3JRHA 2OBPA 2EK5A 5F6FA 4B47A 4WXDA 2JVHA 4KICA 5CQGA 3HRUA 5J40A 2I5UA 5KNLA 2IS2A 2M9HA 1W7PD 1ZG3A 3SZTA 5A2QK 4E7ZA 3FXMA 2JVGA 4HLYA 2OCCH 5H6QA 3TP3A 1HDDC 1W0TA 2HOEA 4P9FA 3ULQB 1BM9A 1KU3A 2EA4A 5HODA 1B8IA 3IV5A 1RIOH 2LRDA 3IKVA 5B1AH 3BPVA 3PQJA 1WI9A 4ZDOA 2HZTA 2XF7A 2B0LA 3KCCA 4YG2F 1XN7A 2QKLB 3ZQIA 4AVPA 4YFNF 1PYVA 1IN4A 4IHVA 2EV6A 2L5QA 3S1QJ 3P7NA 2K40A 2VKHA 5FFZA 5CQEA 1J7KA 1JHHA 1MBFA 3Q9VA 3PJRA 2V9VA 3RKQA 3ZMUA 2ZB9A 5EZGA 2HOTA 4EM1A 2K86A 5LD2C 3T8RA 3UKGA 3ZPLA 3P9KA 3HGYA 3MD2A 2JA8J 2W1OA 2M7BA 1VQMI 2EIKH 1XSDA 4RBOA 5GPCA 2A5WA 2PMUA 2YPRA 3K9TA 5HLGA 1H8AC 1Y56A 3CCJI 4A6DA 2FMLA 2NXNB 1TNSA 4D1QA 3K1NA 3BZCA 3ERED 1MSFC 2CUFA 3R60A 3ZMDA 3RZOJ 2VT2A 4Q48A 1B8IB 3F8CA 4I01A 3I9V2 1TTYA 5GAGJ 3F72A 3TO9A 2CUJA 4PJMA 5KK1A 2R5ZA 2QUFA 1ZR4A 1A31A 2YU3A 3QYFA 2QEXI 1Z3XA 2D5VA 4F52A 4MO7A 1G3TA 2NOGA 2DOEA 2HTSA 1JKPC 1I50J 1LVKA 4YIFA 3DF8A 1J9IA 2V1XA 3HB9A 2VJ5A 4QSHA 2WY7Q 2Q2EA 2E7XA 3A0HC 2F4OB 2O03A 1CF7B 3CZ6A 2V4JC 4BQOA 3HYIA 4BXUA 1Z1DA 3DBRB 2MW8A 1G3SA 1MD0A 2K9SA 1BBYA 1SMYF 3W3CA 1T95A 1HW1A 4O5VA 2ELHA 3GCMA 1VQ4I 5D6FA 2L7ZA 4LLNA 4XQFA 4RA2A 2VQLA 4MQ9F 3Q5FA 4A2UA 3F6OA 4BJ6C 4E4HA 5LGNA 4RM3A 2LYCA 4KIGA 1I39A 4OIRF 2R5ZB 2E36A 3EUAA 1KQ0A 4ESBA 3LA2A 2P7VB 3ZOBA 3A01A 5BPIA 4LLGF 2PJPA 2E34A 2KP6A 3FKIJ 1MBJA 4PJLA 4KITB 2PQ8A 1QZZA 2W24A 2FEZA 2OQGA 4EEFG 1KGSA 2R5YA 1YRNA 3VWBA 5EYRA 2JPCA 3BZ6A 4D9JA 1VFCA 1MJAA 4BY1J 4PK4A 2NRAC 1ERDA 2HOSA 1HW2A 3QYBA 5HDGA 2BXYA 5HLTA 1IZ1A 1FMWA 4ZZLA 4K2EA 1IGNA 1MMSA 3O6BB 2BXZA 1V54H 2Y48A 4Y17A 1KA8A 1NTCA 3E5QA 1VQ6I 1HW5A 2A69F 3RYPA 5ICEA 1EH8A 2K9MA 2RREA 3GXOA 3QODA 1TBXA 1IJWC 2V9KA 1G59A 3I59A 3HC7A 2DMTA 2WV0A 2E60A 3MZYA 5D6EA 5DD4A 5L3GA 2ZNYA 2VXDA 3DPLC 3A01B 2Z3YA 2EWNA 3T5XA 2XAHA 2DCEA 3BDDA 3NQOA 4AIHA 3A2KA 3OYLA 2E35A 2EZLA 4FX0A 2R5YB 4BBRJ 3ONQA 1WVRA 1XMAA 2PMZA 2RNGA 3KIOA 2XKOA 3IUOA 2DYSH 4WXCA 3JRIA 2EFWA 3E0JB 2HXIA 9ANTA 5IT9Z 5GAHJ 2VPLA 3BR3A 2E2IJ 3C18A 2K3PA 2F5DA 2Y31A 4IVNA 4GCVA 1ZG1A 3ECHA 1YJWI 4L18B 1BA5A 4XL9A 3GZ5A 1SVLA 2LVSA 3DCFA 2PG4A 2R7DA 1ENHA 4FE4A 1BI1A 1UG2A 3IH4A 2KIQA 4KMUX 2M4GA 2GLOA 3OIOA 3CC2I 4KISA 1RR7A 2E1MC 4IF4A 3I54A 3SDGA 2IA0A 3NAUA 4M74A 2IT0A 3I59B 3H5RA 4C3HJ 1MZBA 5ICGA 3EPZA 2E2JJ 4AIKA 1PVEA 3VYSB 1SVMA 3OIPA 1R4NB 2K02A 2F5CA 2DK8A 4A5MA 1L3LA 5ILSA 2BOLA 2ZXIA 4LK1F 1U9OA 2O5RA 3GF2A 4IHYA 4M3GA 3S1MJ 3BQZA 5GP9A 5IYCJ 4RLFA 1ZHFA 1I6XA 1WH7A 1NK2P 1DQUA 3W6JB 3CC4I 2Y0SN 4D7NA 2E1MB 4GYGA 1E3PA 3IH3A 4BUPA 2A07F 2X85A 4B09A 2IS4A 3VSLA 2MGQA 4M3EA 4IHTA 1IXSB 1B1BA 1D0ZA 1WZ2A 4F92B 1TWAJ 2EZIA 3DLAA 3CJQB 2CUEA 2X6OA 1XC5A 3ZMSA 3KYDB 3DPTA 5HVQC 2R3SA 1VQ7I 4XBFA 1V55H 3BTCA 2W00A 3ZMTA 4CO8A 2HGCA 5EJCA 2PMZN 2DMUA 4XRMA 2PN6A 5H6RA 5C4XJ 3OYEA 4C2UA 3LWFA 4D5FA 3WTVC 1TLHB 2NOJB 2M3AA 1G2HA 3HEFA 2V1NA 2Y75A 4Q4ZF 3CMYA 2ID3A 4XLNF 2O9LA 4B4CA 3NRVA 3L2VA 4LFUA 5ICFA 3TO6A 4YIRX 2VE9A 3OYNA 4NC8A 4FASD 4ESJA 3MZ8A 2HDWA 4C2TA 2A3SA 3RPUD 4RGXA 3HHGA 1QVTA 3GTMJ 4L9VA 4BEHA 1AU7A 3LQQA 5E3NA 3IC7A 5M3MJ 2L7MP 2L01A 4XORA 1E3OC 3S14J 1SFUA 3ML6A 2R7FA 4S05A 1ZK8A 2IGNA 4NHJA 1XGMA 4NC6A 2STTA 3B6AA 1T56A 4XIDA 1OCTC 2H1KA 2BHZA 3BR0A 5KAIC 2CWEA 2BVMA 2WB1A 2UXXA 4LD5A 2V9PA 4CCJA 3CC7I 2M87A 4XMYA 5HLHA 5JLXA 2QQBA 5EEGA 3R0JA 4OOIA 4PGGA 5E3LA 4UY8I 2VJIA 3FWEA 5DDGA 2VC1A 3CF5F 1VQ9I 2NVQJ 3D5SC 4GO1A 3HOSA 1ZG5A 3DV8A 3J7AY 1OMIA 3JRFA 3S1NJ 4F91B 2CYYA 4U0VA 1UELB 3E6MA 1DUXC 4BXFA 5FD6A 2WAEA 4IOAF 2A6TA 4Y52J 2UV1A 1JUPA 2RQQA 1JXSA 3S8PA 4BEHB 1SD4A 5LEKA 2RC4A 3C2GA 4FE7A 2LG4A 3QQAA 1X3ZB 2YX4A 2Y2ZA 1W7PB 5BOXA 4DOZA 1N25A 5C3EJ 2DXIA 2R7ZJ 4DYRA 1B4AA 3CCRI 4P55A 1WRJA 2IGMA 4AU7A 4IX7A 2DMQA 2PX9A 3SFZA 1MGTA 2HOAA 2E2HJ 1OQYA 2STWA 2W4SA 3S93A 1YI2I 1Z67A 1I3AA 4KIFA 3E5UA 4NBQA 2DOFA 4XKVA 3C3WA 3QRFF 2K3FA 1D0YA 5HLIA 2ADUA 2XF6A 5J1RA 2XAGA 1APLC 1NK3P 4B8XA 3R0AA 5JLWA 1N78A 5JVTA 3OMYA 3DFGA 3LA7A 1JJ8C 5DCMA 2ZMEA 2JUGA 2XPVA 3MKYB 3BWGA 1FYKA 4KN4X 4A0XA 2ZXHA 1XSVA 1R58A 3S3NA 3LSMA 4F93B 3GFLA 1LDJA 3ZN0A 3GVAA 4XN3A 4BE2A 3GLXA 4CA0A 2ZMEC 1ULYA 2BY0A 2NS8A 1S9HA 5DV5A 2OZUA 2BE5F 2NVYJ 4BQAA 4D7MA 3SZPA 1S72I 1H89C 2O3FA 1U0JA 1EH7A 3OYCA 2EA2A 4ABZA 2XGCA 2H6BA 3DKYA 4BAYA 1ZQ3P 4OAZA 1OKRA 1MJ9A 2LSOA 3J80K 1KYWA 4A3DJ 1B9MA 2ESHA 4KT6A 3JAMZ 1O3RA 4M3FA 2M5WA 1DP3A 1OR7A 1YIOA 4A6EA 5C4JJ 2LD5A 2KMUA 1BW6A 4I76A 2LR8A 4RGSA 4LIUA 3KZYA 3UR3C 1Z7LA 1CGPA 1OR7C 4IZZA 5DCMB 2ZMEB 3WHBA 3HOUJ 2OPTA 4I02A 3RQIA 1IV8A 5KHDA 3KEQA 4HA8A 2RVCA 4UB8C 2QCOA 3OOUA 3HHHA 2JSPA 3DEUA 4HV5A 3HSRA 4F3QA 1YJNI 1EKEA 1ETVA 2L7KA 3QAHA 3Q9SA 4GYIA 3SFIA 1QPIA 1BR2A 2VN2A 3PQKA 4RS8A 2DU9A 4BE0A 1SANA 1T2KA 3OYGA 3ABKH 1REPC 2XAFA 3QP6A 2FBIA 4HNVA 3GMEA 4B3AA 3L09A 1XTAA 1VQ5I 2HVRA 2GXBA 1R49A 5E79C 4CXFA 3KZZA 4HSTA 4OMYA 2DT7B 4M3DA 1QA6A 2EFPA 2VKVA 1HF0A 2H27A 2FD5A 1FC3A 4HDVA 1RETA 1WKMA 3BT9A 3TP0A 3S15J 2G9WA 4WCGA 2Y69H 2BGCA 1X19A 2CQNA 4C2MJ 1YITI 5K7FA 4Y33A 2DOAA 5EEHA 2G7UA 4ZYEA 4ENKA 4ZYGA 4U7DA 1OPCA 4UVBA 5FKNA 3AG2H 4E7KA 1UCRA 3FBNB 1O57A 5E3MA 3IKTA 3AKZA 1VZ0A 3QOEA 5DUIA 1YS6A 4E70A 1JJ6C 1K79A 1VQ8I 3V8KA 2VJ4A 2HKXA 4BDYA 1UB9A 1TWGJ 2XV4S 4F7ZA 2DA3A 4PFPA 1FWZA 3BG5A 1LVAA 1RZ4A 4PSXA 4IJAA 3BJ6A 2J5OA 2KJBA 2MSYA 1YQAA 2N8GA 2DN0A 2PFBA 3A4CA 5FKLA 2QQ8A 2FBKA 2OC6A 4HQMA 1R36A 1TNTA 2YU9J 5LBQA 4M6YA 2KISA 4IL6C 5DEQA 4A3LJ 3C2BA 1VQPI 1YOVB 1R23A 4KMFA 2W48A 2DTRA 1VNDA 3E1SA 5LRRA 3IAM2 1WPKA 3QOPA 3CCSI 3FMRA 1S7OA 3M7GA 3BR2A 2DODA 3P9CA 5E1WA 3MEXA 3DKXA 3KLOA 4EJVA 2CQQA 3CCEI 4JP0A 1A04A 1LB2A 2LY1A 1XGSA 2R93J 2AXTC 4HPQA 4HG2A 3DXJF 3GEZA 4LK0F 2VB6A 4BDZA 1R6RA 1OJLA 2V79A 2H1LA 4G6DA 1JKRC 2JT1A 2E5NA 1FIPA 1H9GA 1T38A 1I1SA 4XKWA 3GLLA 3ZN1A 1H9TA 3SHFA 2I10A 1IO2A 4FISA 4RB3C 5D8KB 3K10A 3FXRA 3H3UA 3FM3A 4ETSA 2JMWA 5JVGF 3A0BC 3K4BA 1A35A 4M9SA 1R00A 2X6XA 2DA5A 2B7EA 4MTEA 4AM3A 5KCMA 2QKMB 3HJEA 4PJNA 4PJJA 2VBXA 3LOCA 1MDMA 1OFCX 2VUMJ 4LG3A 3OR1C 2R7UA 4LGWA 3FM5A 4A3JJ 2C6YA 5M5YJ 3WTSC 5E18F 2WV1A 1ZKGA 2Q0OA 3PFYA 4YEJA 1IAWA 2L3DA 3GBGA 1O4XA 4I2OA 5F04A 4BHBA 2ME6A 3DPUA 4II2A 3N05A 3Q0VA 3K70C 5EEAA 2LREA 4HV6A 1P92A 1QNTA 2O7OA 1XG1A 1G6NA 3DBLB 5E1ZB 4E7HA 4PCQA 4UB6C 3Q0UA 1MMNA 2L9RA 2LLKA 5B66C 1LNWA 2XKPA
chains in the Genus database with same CATH topology
4IXAA 3MCZA 1F1ZA 3ZP5A 2EV5A 3HUGA 2MH2A 5LLQA 1S29A 1SD6A 3LFKA 2XAQA 3C1DA 2VXZA 1K6OA 3WTWC 5L3FA 1MDMB 1FP2A 1EH6A 4GXOA 2VBYA 5FD5A 1XMKA 3RYRA 5CJ9A 1ZARA 3V4GA 5A2QZ 3ISPA 1T39A 1E2XA 4IRHA 4WK8F 1R5GA 3IRRA 1BIAA 1R22A 2FE3A 2D2WA 3JW4A 4ENMA 2IJLA 2HWVA 3I0TA 3WE3A 1CF7A 4I0AA 4L9JA 2W25A 3CDHA 3ELKA 3LAJA 4PZJA 2JRTA 4G7HF 2QYOA 2TDXA 2ZO4A 1U3EM 2QWWA 1XDSA 3I4PA 5FO5A 4UUVA 2GA2A 2JSCA 1TQIA 1QZYA 2ESNA 1P2FA 1FYMA 2QQ9A 3GO5A 2DW4A 1XGNA 4IPAA 3E5XA 2RQPA 5L3DA 2XVCA 5FLXK 2DAOA 4IRIA 5LHGA 2H94A 3SXYA 1R1VA 2H6CA 3VODA 2EJRA 3KP7A 2ZBKA 4IRGA 5AIQA 4CZZA 4UV9A 2X0LA 4KIBA 2M1BA 1ONVA 2FXAA 3HOTA 2WWYA 2ISYA 2FRHA 1BI0A 3BPXA 5F64A 1RNLA 1MJBA 1R5HA 4EGYA 2DBBA 2QZ8A 1OYYA 2XAJA 1I5ZA 2HQNA 3OV8A 2DPDA 1FY7A 5L3EA 2CSOA 4KYWA 4ESFA 1IF1A 2VT3A 3KFWX 1O3QA 2EV0A 3IL2A 2F2EA 4L9TA 4RAZA 2D45A 1QGPA 4U88A 3U2RA 1ZRCA 3E3VA 4CDGA 4YFKF 2NNYA 2VODA 2XRNA 3KP3A 3JSOA 3GZ6A 2DT5A 3E6BA 4HF2A 1RI7A 4LG0A 3REOA 4G7ZF 3HIFA 3HTSB 2ZNZA 3U1DA 5CYVA 5TJJA 1S6LA 5BMZA 1HKTA 5ILVA 2CG4A 4IHSA 2Z33A 4OMZA 1DP7P 3FHZA 1FNNA 3CTAA 3HRTA 3I53A 1FBUA 4RGRA 3N4MA 4D0PA 4BNCA 2Z99A 2L54A 5HS9A 1D5VA 1I27A 3CLOA 4LG0B 4L0YB 3LAPA 1BIBA 3COAC 5ICCA 1YTYA 3GUDA 1Y0UA 1ZLKA 4WF2A 4NQWA 4S04A 4EQQA 4L0ZB 2BV6A 2RKHA 5D8LB 3G73A 3GYHX 3V7SA 3R4KA 5D4RA 4OU0A 4KNYA 4A5NA 2XROA 2VE8A 1U78A 5CVJA 1J59A 2YR2A 5J8CA 1D8KA 2Q8KA 2FNAA 3K0LA 3J81K 2FNPA 2COMA 3IHUA 2DPUA 2E1CA 2P6SA 4A0ZA 2IW5A 3T0YA 2W57A 3WU0A 5BQTA 3BJOA 3HSFA 2FOKA 3RJPA 3VFZA 3GFIA 2ZXJA 3M9AA 1U2WA 1YS7A 2K4JA 1ZRDA 1W7PA 3TDUC 3KETA 4U0YA 1F5TA 4QLCU 1P6RA 1FBSA 1V3FA 3F3XA 1STZA 4RB0A 5LGTA 2QLZA 5AIPA 1FOKA 4EV0A 4BH9A 3K1MA 4ZYHA 2VOPA 1U8RA 3F23A 1Q1HA 2PEXA 4I98B 2VBZA 2EFQA 3CUQA 1O7FA 4KN7X 2M45A 1ZH5A 1T0FA 4EMSA 3VOEA 3CUQC 3T1BA 1KU7A 3LQRA 5E8GA 4EJTA 4ZZDA 5J8FA 3EYYA 3DP7A 3VB2A 4HQEA 2UWMA 4HX4A 4HBLA 2ISZA 1ZGJA 1ZGAA 3HTUA 3RKXA 1AWCA 2XHKA 3OOPA 1IN8A 2HR3A 1J5YA 2HEOA 3V7RA 1LDKB 4PDKA 2IA2A 1PP8F 2A6EF 1KQ9A 2P4WA 2IPQX 3CUQB 2JZYA 3G3ZA 5FGMA 4RGUA 1BI3A 1FZPB 1QPMA 1Z7UA 2P6TA 5L3BA 1TW3A 1KU9A 5D5XB 1LEBA 2OU2A 4FX4A 3JTGA 1SMTA 5J6XA 1Z91A 1ZREA 1XGOA 3WTUC 2RNJA 2F5FA 1J2XA 1ON1A 1T98A 2HS5A 3TO7A 2A61A 4KDPA 3KEOA 4R1HA 4M6XA 3GFJA 3D0SA 1R1UA 3FMQA 5LHIA 3TKYA 1Z9CA 1J0RA 2GXGA 3QPHA 4P96A 1DDNA 2HKOA 3MZHA 2K4BA 1YW9A 3M8FA 1QBJA 4PGHA 4CYDA 2L4AA 4BHPA 4EJOA 2JPBA 2OA4A 3HRSA 2MLKA 3GW2A 5KVRA 2KKOA 3I64A 5TRDA 4HF0A 1USTA 1WQ2A 3CO7C 2EB7A 2NNNA 2GAUA 1XD7A 1HSTA 1WWXA 1XCVA 2YX7A 1XCBA 4EM0B 2HYFA 4KUMA 4I0BA 2PMHA 1S3JA 1G4DA 1FPQA 4LMYA 2LKPA 2RDPA 4JQFA 2CGPA 3FXUA 3T8TA 3I5UA 3KLNA 1S8NA 1GHCA 3EUHA 2DQLA 1HXDA 3QPTA 1IXCA 2M30A 1FBQA 2MH9A 1V4RA 2IA1A 3IRQA 4EVIA 3IWZA 2NS0A 3RKWA 3FX3A 3F8FA 4MTDA 1FT9A 4MHGA 2QQAA 1B59A 1SFXA 1VTNC 2E1NA 4MNUA 4OIPF 1YW7A 5JI6A 2FA5A 1LJ9A 3BROA 4QWQA 2RGVA 3RIRA 2E7WA 2FBHA 4XLPF 1JE8A 1R7JA 5HDNA 1ZAOA 5K1YA 4EM2A 4WWCA 3RPUA 2K27A 6PAXA 1IXRC 2QM3A 2GQQA 2XUBA 1HSJA 1KU2A 1SFEA 4O6JA 1SD7A 3F8MA 2F5EA 4HDUA 1FLIA 1W5TA 1XSXA 2O8XA 4U7BA 4P9UA 1TQPA 2D1HA 1YO5C 3DQVC 1K78A 4MQVA 3TOAA 1UHMA 3F22A 4ON0A 4OIQF 3J7AO 3TDZC 5ED4A 1RUNA 1O3SA 2DI3A 1TQMA 3ZMZA 4CGZA 4AWXB 4UV8A 1SD5A 3D5LA 4MEXF 3E6DA 4R79A 4I7HA 1LEAA 1BC8C 2L02A 3V8LA 3L9FA 3H92A 2FSWA 2BBYA 2H09A 4ZH4F 4RB2C 4RB1A 1O7LA 2P5LC 1K78B 3SQNA 3F8BA 1X3UA 1HBXG 3TQNA 1EV7A 4I09A 2HQRA 2O6GE 1HKQA 3BP8A 1YG2A 2OQRA 1F4KA 1DPUA 2W85A 5FLXZ 3FMSA 4A0YA 3NEUA 4CHUA 1BOAA 3QP5A 4HZFA 1ZLJA 3ECOA 1NHAA 1QO0D 4ASNA 2DLLA 4CICA 2MLGA 1R1TA 1W5SA 1I1GA 1JHFA 3RI4A 2EFNA 1P4XA 1FX7A 2QVOA 3WU1B 2RN7A 1OYWA 1XDUA 5CVVA 4G7OF 1Z05A 4HF1A 5DCFA 2DK5A 3MQ0A 4FT8A 4AIJA 2Y0MA 3WODF 2DFIA 2P5KA 3I71A 3HSEA 3IWFA 1IW7F 1YLFA 3EQLF 3WTYC 2HFHA 3MWMA 4HOBA 3BJAA 1AOYA 3MFKA 3P9IA 1U5TA 1BN5A 4OINF 2OD5A 4MEYF 1IN5A 3TOBA 5L3CA 1PP7U 1GVJA 1U5TC 2KIUA 1BJAA 5D5VB 1K7AA 3VEPA 2HYGD 3CJNA 4ENNA 1P4WA 3ABUA 3AAFA 2G7HA 5BPDA 2OAZA 4LLLA 2WTEA 5E17F 2KIMA 1SAXA 5IT9K 5HS7A 1YW8A 4HX8A 4BHCA 2QBYA 2HTJA 3ZMVA 4LB6B 4ENJA 2DO7A 1U5TB 2KIFA 1HQCA 2A68F 2GZWA 3ABTA 2X4HA 4M9ZA 1WSUA 2HDCA 3ROUA 1ODDA 1H0MA 2PI0A 2MC3A 5CVRA 4GGGA 4UVCA 2PLYA 2BEOA 2FF4A 2K7LA 2V6CA 5HDKA 2JTVA 3QU6A 1QQIA 2AS5F 2QBYB 3F6VA 4G94A 3C7JA 3B73A 1Z6RA 5CVIA 1B6AA 2NYXA 1IRGA 5F1RA 2CO5A 2GA1A 4G8XA 5HOOA 4YIIA 1RUOA 2EFOA 3K69A 3B02A 5ERIA 4XRFA 2MA3A 3J81Z 2UZKA 1IUYA 2A5YB 3FXQA 5K5OA 2AXLA 1G3YA 2GIVA 4LB5A 3E97A 1C0WA 5LHHA 1G3WA 4RAYA 3RPQA 2FQ3A 4L9NA 4DQ2A 1YYVA 1KYZA 2ZFWA 3LSTA 5JHUA 4M73A 2VOOA 3CO6C 1UHWA 4L5JA 3O2PE 3O3KA 2P7CB 3R61A 3WE2A 5DUKA 5AONA 3RKYA 4N9IA 5DD8A 4M72A 4JK1X 5CVUA 3JSPA 2LF7A 3BOQA 3M8EA 5FB2A 2CFXA 2VBWA 4Z2YA 4G6QA 4H0EA 3LA3A 2VC0A 5JFRA 2NAZA 4LJZF 2ZJ2A 2IRFG 3GWZA 2ZCWA 1F9NA 4KT5C 5ILUA 1J75A 4U0WA 1USSA 3WG9A 5LEJA 3L2CA 2ACJA 3WGHA 4OIOF 1U6GA 5LRSA 4Y13A 4XSZF 3KP5A 4R8HA 2FMYA 2VONA 1JGSA 2P8TA 1YFHA 1GXPA 3DKWA 1UFMA 2W84A 3BY6A 4UHTA 1GXQA 4M71A 1KQ8A 3W6KB 4M9XA 1B9NA 1LQ1A 3EDPA 2J5PA 3WTXC 1ZN2A 1P4AA 3JTHA 4P5OA 2IVMA 3KP6A 2D1VA 3EYIA 2O0YA 1XB4A 3EETA 1O3TA 4N0BA 5E8IA 3L00A 5LGUA 3U9GA 1FSEA 4UVAA 2FU4A 4TV7A 1W4MA 2XGXA 3JAMK 1IRFA 4Y15A 3J80Z 3TGNA 1PDNC 2V1UA 4Q47A 3WTTC 5DYMA 4HLXA 2LDUA 2P5VA 1FYLA 5E1XA 4YFXF 1DPRA 4HX7A 4HAMA 4WX9A 2LF8A 2DQRA 3N97A 4HYEA 2KJCA 3K2ZA 2XASA 5IT3A 1L0OC 2CQKA 2O61A 3KE2A 4WXHA 4G9YA 1D8JA 1ZRFA 2Z9OA 5D4SA 3GX4X 3K1PA 5D5UB 2RV8A 2V1DA 3HRMA 3M1EA 3H3ZA 1E17A 2QENA 1FSHA 1D3YA 4KFCA 4Q5SF 3S2WA 1HKSA 3CUOA 3E6CC 3F8NA 5BS6A 4EJUA 4NB5A 5CLSA 5D5WB 2GWRA 3FF5A 2LNBA 2ZKZA 3V7CA 1Z6TA 1S7AA 1T6SA 1BI2A 2OZ6A 1IN6A 4AD9A 2L4MA 2CW0F 1MKMA 4XSXF 2UXNA 4DNCA 3MAJA 3R6SA 2KRFA 4N9HA 3WTZA 5E20A 2PBIA 2IP2A 1ZYRF 3RDIA 3WGGA 5K5RA 3FZVA 4MGRA 4EGZA 3V8JA 3ZQ7A 4KA4A 3GFMA 2Z5UA 5FFXA 4FHTA 1LDDA 1IN7A 1ON2A 4L5IA 4EJWA 2YSRA 2WC2A 4BYYA 3KP4A 1PUEE 5H20A 3I58A 3PFIA 3QU3A 4JBAA 2MBFA 3KP2A 1TW2A 2A6HF 4O3MA 4UNOA 3L7WA 4UXNA 1OYIA 2BYVE 1BC7C 3WGIA 3RTRA 2M8EA 2ETHA 2XIGA 5K5QA 2MD5A 4A12A 3F21A 5HS8A 1FP1D 4HW0A 5JR3A 4ZYDA 2OBPA 2EK5A 5F6FA 4WXDA 4KICA 3HRUA 1W7PD 1ZG3A 3SZTA 5A2QK 4HLYA 5H6QA 2HOEA 4P9FA 3ULQB 1BM9A 1KU3A 2EA4A 1RIOH 3IKVA 3BPVA 3PQJA 1WI9A 2HZTA 2B0LA 3KCCA 4YG2F 1XN7A 4YFNF 4AVPA 1IN4A 2EV6A 3P7NA 5FFZA 1J7KA 1JHHA 3Q9VA 2V9VA 3ZMUA 4EM1A 2K86A 3T8RA 3ZPLA 3P9KA 1XSDA 2PMUA 2YPRA 3K9TA 5HLGA 4A6DA 2FMLA 1TNSA 3K1NA 3ERED 3R60A 3ZMDA 2VT2A 4Q48A 3F8CA 4I01A 1TTYA 3F72A 3TO9A 5KK1A 2QUFA 2YU3A 1G3TA 2HTSA 4YIFA 3DF8A 1J9IA 2V1XA 2Q2EA 2E7XA 1CF7B 2O03A 3HYIA 4BXUA 1Z1DA 1G3SA 1MD0A 1BBYA 1SMYF 1HW1A 4O5VA 2ELHA 5D6FA 4LLNA 4MQ9F 3Q5FA 4A2UA 3F6OA 5LGNA 4KIGA 4OIRF 1KQ0A 4ESBA 3LA2A 2P7VB 5BPIA 4LLGF 2PJPA 2PQ8A 1QZZA 2W24A 2FEZA 2OQGA 1KGSA 2JPCA 3BZ6A 1MJAA 2NRAC 1HW2A 5HDGA 1IZ1A 4ZZLA 4K2EA 3O6BB 2Y48A 4Y17A 1KA8A 3E5QA 1HW5A 2A69F 3RYPA 5ICEA 1EH8A 3GXOA 1TBXA 3I59A 3MZYA 2WV0A 5D6EA 5DD4A 5L3GA 2ZNYA 3DPLC 2Z3YA 2EWNA 3T5XA 2XAHA 3NQOA 3BDDA 4AIHA 4FX0A 1XMAA 2XKOA 2EFWA 4WXCA 5IT9Z 3C18A 2F5DA 4IVNA 4GCVA 1ZG1A 3ECHA 4L18B 3GZ5A 2PG4A 2R7DA 1BI1A 4KMUX 4IF4A 3I54A 2IA0A 4M74A 2IT0A 3I59B 1MZBA 5ICGA 4AIKA 2K02A 2F5CA 2DK8A 4A5MA 1L3LA 5ILSA 4LK1F 3GF2A 1ZHFA 1I6XA 3W6JB 4GYGA 2A07F 4B09A 4IHTA 1IXSB 1B1BA 3ZMSA 3DPTA 5HVQC 2R3SA 4XBFA 3ZMTA 4CO8A 2HGCA 2PN6A 5H6RA 3LWFA 3WTVC 1TLHB 2Y75A 4Q4ZF 4XLNF 3NRVA 4LFUA 5ICFA 3TO6A 2VE9A 4ESJA 2A3SA 4RGXA 3HHGA 4L9VA 3LQQA 3IC7A 2L01A 1SFUA 3ML6A 2R7FA 4S05A 4NHJA 1XGMA 2STTA 2CWEA 2UXXA 4LD5A 2M87A 5HLHA 2QQBA 5EEGA 3R0JA 4OOIA 4PGGA 3FWEA 5DDGA 2VC1A 4GO1A 3HOSA 1ZG5A 3DV8A 1OMIA 2CYYA 4U0VA 3E6MA 1DUXC 5FD6A 1JXSA 1SD4A 5LEKA 2RC4A 2YX4A 5BOXA 1W7PB 1B4AA 4P55A 1WRJA 3SFZA 1MGTA 2STWA 4KIFA 3E5UA 3C3WA 3QRFF 5HLIA 2ADUA 2XAGA 4B8XA 3R0AA 5JVTA 3DFGA 3LA7A 5DCMA 2ZMEA 3BWGA 1FYKA 4KN4X 4A0XA 1XSVA 1R58A 3GFLA 1LDJA 3ZN0A 3GVAA 3GLXA 1ULYA 5DV5A 2OZUA 2BE5F 4BQAA 3SZPA 2O3FA 1EH7A 2EA2A 2H6BA 4BAYA 1OKRA 1MJ9A 2LSOA 3J80K 1KYWA 1B9MA 2ESHA 3JAMZ 1O3RA 2M5WA 1OR7A 1YIOA 4A6EA 4RGSA 3KZYA 1CGPA 5DCMB 2ZMEB 4I02A 3KEQA 4HA8A 2RVCA 3HHHA 4HV5A 3DEUA 3HSRA 3Q9SA 3QAHA 4GYIA 2VN2A 3PQKA 4RS8A 2DU9A 1T2KA 1REPC 2XAFA 3QP6A 2FBIA 3L09A 2GXBA 4CXFA 3KZZA 4OMYA 2EFPA 2H27A 1FC3A 4HDVA 1WKMA 2G9WA 4WCGA 2BGCA 5EEHA 2G7UA 4ZYEA 4ENKA 4ZYGA 4U7DA 1OPCA 4UVBA 1UCRA 1O57A 3IKTA 5DUIA 1YS6A 4E70A 1K79A 3V8KA 2HKXA 1UB9A 2XV4S 4F7ZA 1FWZA 1LVAA 1RZ4A 4IJAA 3BJ6A 2J5OA 2KJBA 1YQAA 2PFBA 2FBKA 4HQMA 1R36A 1TNTA 5LBQA 4M6YA 5DEQA 1R23A 4KMFA 2DTRA 5LRRA 3QOPA 3FMRA 1S7OA 3M7GA 3P9CA 5E1WA 3MEXA 3KLOA 4EJVA 1A04A 1LB2A 1XGSA 4LK0F 3DXJF 3GEZA 2V79A 4G6DA 2JT1A 1H9GA 1T38A 1I1SA 3ZN1A 1H9TA 3SHFA 4RB3C 5D8KB 3FXRA 3H3UA 3FM3A 4ETSA 4M9SA 1R00A 4MTEA 2VBXA 1MDMA 4LGWA 3FM5A 2C6YA 3WTSC 5E18F 2Q0OA 1IAWA 2L3DA 4I2OA 4BHBA 4HV6A 1P92A 1QNTA 1G6NA 5E1ZB 4PCQA 1LNWA 2XKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IXA A;  3MCZ A;  1F1Z A;  3ZP5 A;  2EV5 A;  3HUG A;  2MH2 A;  5LLQ A;  1S29 A;  1SD6 A;  3LFK A;  2XAQ A;  3C1D A;  2VXZ A;  1K6O A;  3WTW C;  5L3F A;  1MDM B;  1FP2 A;  1EH6 A;  4GXO A;  2VBY A;  5FD5 A;  1XMK A;  3RYR A;  5CJ9 A;  1ZAR A;  3V4G A;  5A2Q Z;  3ISP A;  1T39 A;  1E2X A;  4IRH A;  4WK8 F;  1R5G A;  3IRR A;  1BIA A;  1R22 A;  2FE3 A;  2D2W A;  3JW4 A;  4ENM A;  2IJL A;  2HWV A;  3I0T A;  3WE3 A;  1CF7 A;  4I0A A;  4L9J A;  2W25 A;  3CDH A;  3ELK A;  3LAJ A;  4PZJ A;  2JRT A;  4G7H F;  2QYO A;  2TDX A;  2ZO4 A;  1U3E M;  2QWW A;  1XDS A;  3I4P A;  5FO5 A;  4UUV A;  2GA2 A;  2JSC A;  1TQI A;  1QZY A;  2ESN A;  1P2F A;  1FYM A;  2QQ9 A;  3GO5 A;  2DW4 A;  1XGN A;  4IPA A;  3E5X A;  2RQP A;  5L3D A;  2XVC A;  5FLX K;  2DAO A;  4IRI A;  5LHG A;  2H94 A;  3SXY A;  1R1V A;  2H6C A;  3VOD A;  2EJR A;  3KP7 A;  2ZBK A;  4IRG A;  5AIQ A;  4CZZ A;  4UV9 A;  2X0L A;  4KIB A;  2M1B A;  1ONV A;  2FXA A;  3HOT A;  2WWY A;  2ISY A;  2FRH A;  1BI0 A;  3BPX A;  5F64 A;  1RNL A;  1MJB A;  1R5H A;  4EGY A;  2DBB A;  2QZ8 A;  1OYY A;  2XAJ A;  1I5Z A;  2HQN A;  3OV8 A;  2DPD A;  1FY7 A;  5L3E A;  2CSO A;  4KYW A;  4ESF A;  1IF1 A;  2VT3 A;  3KFW X;  1O3Q A;  2EV0 A;  3IL2 A;  2F2E A;  4L9T A;  4RAZ A;  2D45 A;  1QGP A;  4U88 A;  3U2R A;  1ZRC A;  3E3V A;  4CDG A;  4YFK F;  2NNY A;  2VOD A;  2XRN A;  3KP3 A;  3JSO A;  3GZ6 A;  2DT5 A;  3E6B A;  4HF2 A;  1RI7 A;  4LG0 A;  3REO A;  4G7Z F;  3HIF A;  3HTS B;  2ZNZ A;  3U1D A;  5CYV A;  5TJJ A;  1S6L A;  5BMZ A;  1HKT A;  5ILV A;  2CG4 A;  4IHS A;  2Z33 A;  4OMZ A;  1DP7 P;  3FHZ A;  1FNN A;  3CTA A;  3HRT A;  3I53 A;  1FBU A;  4RGR A;  3N4M A;  4D0P A;  4BNC A;  2Z99 A;  2L54 A;  5HS9 A;  1D5V A;  1I27 A;  3CLO A;  4LG0 B;  4L0Y B;  3LAP A;  1BIB A;  3COA C;  5ICC A;  1YTY A;  3GUD A;  1Y0U A;  1ZLK A;  4WF2 A;  4NQW A;  4S04 A;  4EQQ A;  4L0Z B;  2BV6 A;  2RKH A;  5D8L B;  3G73 A;  3GYH X;  3V7S A;  3R4K A;  5D4R A;  4OU0 A;  4KNY A;  4A5N A;  2XRO A;  2VE8 A;  1U78 A;  5CVJ A;  1J59 A;  2YR2 A;  5J8C A;  1D8K A;  2Q8K A;  2FNA A;  3K0L A;  3J81 K;  2FNP A;  2COM A;  3IHU A;  2DPU A;  2E1C A;  2P6S A;  4A0Z A;  2IW5 A;  3T0Y A;  2W57 A;  3WU0 A;  5BQT A;  3BJO A;  3HSF A;  2FOK A;  3RJP A;  3VFZ A;  3GFI A;  2ZXJ A;  3M9A A;  1U2W A;  1YS7 A;  2K4J A;  1ZRD A;  1W7P A;  3TDU C;  3KET A;  4U0Y A;  1F5T A;  4QLC U;  1P6R A;  1FBS A;  1V3F A;  3F3X A;  1STZ A;  4RB0 A;  5LGT A;  2QLZ A;  5AIP A;  1FOK A;  4EV0 A;  4BH9 A;  3K1M A;  4ZYH A;  2VOP A;  1U8R A;  3F23 A;  1Q1H A;  2PEX A;  4I98 B;  2VBZ A;  2EFQ A;  3CUQ A;  1O7F A;  4KN7 X;  2M45 A;  1ZH5 A;  1T0F A;  4EMS A;  3VOE A;  3CUQ C;  3T1B A;  1KU7 A;  3LQR A;  5E8G A;  4EJT A;  4ZZD A;  5J8F A;  3EYY A;  3DP7 A;  3VB2 A;  4HQE A;  2UWM A;  4HX4 A;  4HBL A;  2ISZ A;  1ZGJ A;  1ZGA A;  3HTU A;  3RKX A;  1AWC A;  2XHK A;  3OOP A;  1IN8 A;  2HR3 A;  1J5Y A;  2HEO A;  3V7R A;  1LDK B;  4PDK A;  2IA2 A;  1PP8 F;  2A6E F;  1KQ9 A;  2P4W A;  2IPQ X;  3CUQ B;  2JZY A;  3G3Z A;  5FGM A;  4RGU A;  1BI3 A;  1FZP B;  1QPM A;  1Z7U A;  2P6T A;  5L3B A;  1TW3 A;  1KU9 A;  5D5X B;  1LEB A;  2OU2 A;  4FX4 A;  3JTG A;  1SMT A;  5J6X A;  1Z91 A;  1ZRE A;  1XGO A;  3WTU C;  2RNJ A;  2F5F A;  1J2X A;  1ON1 A;  1T98 A;  2HS5 A;  3TO7 A;  2A61 A;  4KDP A;  3KEO A;  4R1H A;  4M6X A;  3GFJ A;  3D0S A;  1R1U A;  3FMQ A;  5LHI A;  3TKY A;  1Z9C A;  1J0R A;  2GXG A;  3QPH A;  4P96 A;  1DDN A;  2HKO A;  3MZH A;  2K4B A;  1YW9 A;  3M8F A;  1QBJ A;  4PGH A;  4CYD A;  2L4A A;  4BHP A;  4EJO A;  2JPB A;  2OA4 A;  3HRS A;  2MLK A;  3GW2 A;  5KVR A;  2KKO A;  3I64 A;  5TRD A;  4HF0 A;  1UST A;  1WQ2 A;  3CO7 C;  2EB7 A;  2NNN A;  2GAU A;  1XD7 A;  1HST A;  1WWX A;  1XCV A;  2YX7 A;  1XCB A;  4EM0 B;  2HYF A;  4KUM A;  4I0B A;  2PMH A;  1S3J A;  1G4D A;  1FPQ A;  4LMY A;  2LKP A;  2RDP A;  4JQF A;  2CGP A;  3FXU A;  3T8T A;  3I5U A;  3KLN A;  1S8N A;  1GHC A;  3EUH A;  2DQL A;  1HXD A;  3QPT A;  1IXC A;  2M30 A;  1FBQ A;  2MH9 A;  1V4R A;  2IA1 A;  3IRQ A;  4EVI A;  3IWZ A;  2NS0 A;  3RKW A;  3FX3 A;  3F8F A;  4MTD A;  1FT9 A;  4MHG A;  2QQA A;  1B59 A;  1SFX A;  1VTN C;  2E1N A;  4MNU A;  4OIP F;  1YW7 A;  5JI6 A;  2FA5 A;  1LJ9 A;  3BRO A;  4QWQ A;  2RGV A;  3RIR A;  2E7W A;  2FBH A;  4XLP F;  1JE8 A;  1R7J A;  5HDN A;  1ZAO A;  5K1Y A;  4EM2 A;  4WWC A;  3RPU A;  2K27 A;  6PAX A;  1IXR C;  2QM3 A;  2GQQ A;  2XUB A;  1HSJ A;  1KU2 A;  1SFE A;  4O6J A;  1SD7 A;  3F8M A;  2F5E A;  4HDU A;  1FLI A;  1W5T A;  1XSX A;  2O8X A;  4U7B A;  4P9U A;  1TQP A;  2D1H A;  1YO5 C;  3DQV C;  1K78 A;  4MQV A;  3TOA A;  1UHM A;  3F22 A;  4ON0 A;  4OIQ F;  3J7A O;  3TDZ C;  5ED4 A;  1RUN A;  1O3S A;  2DI3 A;  1TQM A;  3ZMZ A;  4CGZ A;  4AWX B;  4UV8 A;  1SD5 A;  3D5L A;  4MEX F;  3E6D A;  4R79 A;  4I7H A;  1LEA A;  1BC8 C;  2L02 A;  3V8L A;  3L9F A;  3H92 A;  2FSW A;  2BBY A;  2H09 A;  4ZH4 F;  4RB2 C;  4RB1 A;  1O7L A;  2P5L C;  1K78 B;  3SQN A;  3F8B A;  1X3U A;  1HBX G;  3TQN A;  1EV7 A;  4I09 A;  2HQR A;  2O6G E;  1HKQ A;  3BP8 A;  1YG2 A;  2OQR A;  1F4K A;  1DPU A;  2W85 A;  5FLX Z;  3FMS A;  4A0Y A;  3NEU A;  4CHU A;  1BOA A;  3QP5 A;  4HZF A;  1ZLJ A;  3ECO A;  1NHA A;  1QO0 D;  4ASN A;  2DLL A;  4CIC A;  2MLG A;  1R1T A;  1W5S A;  1I1G A;  1JHF A;  3RI4 A;  2EFN A;  1P4X A;  1FX7 A;  2QVO A;  3WU1 B;  2RN7 A;  1OYW A;  1XDU A;  5CVV A;  4G7O F;  1Z05 A;  4HF1 A;  5DCF A;  2DK5 A;  3MQ0 A;  4FT8 A;  4AIJ A;  2Y0M A;  3WOD F;  2DFI A;  2P5K A;  3I71 A;  3HSE A;  3IWF A;  1IW7 F;  1YLF A;  3EQL F;  3WTY C;  2HFH A;  3MWM A;  4HOB A;  3BJA A;  1AOY A;  3MFK A;  3P9I A;  1U5T A;  1BN5 A;  4OIN F;  2OD5 A;  4MEY F;  1IN5 A;  3TOB A;  5L3C A;  1PP7 U;  1GVJ A;  1U5T C;  2KIU A;  1BJA A;  5D5V B;  1K7A A;  3VEP A;  2HYG D;  3CJN A;  4ENN A;  1P4W A;  3ABU A;  3AAF A;  2G7H A;  5BPD A;  2OAZ A;  4LLL A;  2WTE A;  5E17 F;  2KIM A;  1SAX A;  5IT9 K;  5HS7 A;  1YW8 A;  4HX8 A;  4BHC A;  2QBY A;  2HTJ A;  3ZMV A;  4LB6 B;  4ENJ A;  2DO7 A;  1U5T B;  2KIF A;  1HQC A;  2A68 F;  2GZW A;  3ABT A;  2X4H A;  4M9Z A;  1WSU A;  2HDC A;  3ROU A;  1ODD A;  1H0M A;  2PI0 A;  2MC3 A;  5CVR A;  4GGG A;  4UVC A;  2PLY A;  2BEO A;  2FF4 A;  2K7L A;  2V6C A;  5HDK A;  2JTV A;  3QU6 A;  1QQI A;  2AS5 F;  2QBY B;  3F6V A;  4G94 A;  3C7J A;  3B73 A;  1Z6R A;  5CVI A;  1B6A A;  2NYX A;  1IRG A;  5F1R A;  2CO5 A;  2GA1 A;  4G8X A;  5HOO A;  4YII A;  1RUO A;  2EFO A;  3K69 A;  3B02 A;  5ERI A;  4XRF A;  2MA3 A;  3J81 Z;  2UZK A;  1IUY A;  2A5Y B;  3FXQ A;  5K5O A;  2AXL A;  1G3Y A;  2GIV A;  4LB5 A;  3E97 A;  1C0W A;  5LHH A;  1G3W A;  4RAY A;  3RPQ A;  2FQ3 A;  4L9N A;  4DQ2 A;  1YYV A;  1KYZ A;  2ZFW A;  3LST A;  5JHU A;  4M73 A;  2VOO A;  3CO6 C;  1UHW A;  4L5J A;  3O2P E;  3O3K A;  2P7C B;  3R61 A;  3WE2 A;  5DUK A;  5AON A;  3RKY A;  4N9I A;  5DD8 A;  4M72 A;  4JK1 X;  5CVU A;  3JSP A;  2LF7 A;  3BOQ A;  3M8E A;  5FB2 A;  2CFX A;  2VBW A;  4Z2Y A;  4G6Q A;  4H0E A;  3LA3 A;  2VC0 A;  5JFR A;  2NAZ A;  4LJZ F;  2ZJ2 A;  2IRF G;  3GWZ A;  2ZCW A;  1F9N A;  4KT5 C;  5ILU A;  1J75 A;  4U0W A;  1USS A;  3WG9 A;  5LEJ A;  3L2C A;  2ACJ A;  3WGH A;  4OIO F;  1U6G A;  5LRS A;  4Y13 A;  4XSZ F;  3KP5 A;  4R8H A;  2FMY A;  2VON A;  1JGS A;  2P8T A;  1YFH A;  1GXP A;  3DKW A;  1UFM A;  2W84 A;  3BY6 A;  4UHT A;  1GXQ A;  4M71 A;  1KQ8 A;  3W6K B;  4M9X A;  1B9N A;  1LQ1 A;  3EDP A;  2J5P A;  3WTX C;  1ZN2 A;  1P4A A;  3JTH A;  4P5O A;  2IVM A;  3KP6 A;  2D1V A;  3EYI A;  2O0Y A;  1XB4 A;  3EET A;  1O3T A;  4N0B A;  5E8I A;  3L00 A;  5LGU A;  3U9G A;  1FSE A;  4UVA A;  2FU4 A;  4TV7 A;  1W4M A;  2XGX A;  3JAM K;  1IRF A;  4Y15 A;  3J80 Z;  3TGN A;  1PDN C;  2V1U A;  4Q47 A;  3WTT C;  5DYM A;  4HLX A;  2LDU A;  2P5V A;  1FYL A;  5E1X A;  4YFX F;  1DPR A;  4HX7 A;  4HAM A;  4WX9 A;  2LF8 A;  2DQR A;  3N97 A;  4HYE A;  2KJC A;  3K2Z A;  2XAS A;  5IT3 A;  1L0O C;  2CQK A;  2O61 A;  3KE2 A;  4WXH A;  4G9Y A;  1D8J A;  1ZRF A;  2Z9O A;  5D4S A;  3GX4 X;  3K1P A;  5D5U B;  2RV8 A;  2V1D A;  3HRM A;  3M1E A;  3H3Z A;  1E17 A;  2QEN A;  1FSH A;  1D3Y A;  4KFC A;  4Q5S F;  3S2W A;  1HKS A;  3CUO A;  3E6C C;  3F8N A;  5BS6 A;  4EJU A;  4NB5 A;  5CLS A;  5D5W B;  2GWR A;  3FF5 A;  2LNB A;  2ZKZ A;  3V7C A;  1Z6T A;  1S7A A;  1T6S A;  1BI2 A;  2OZ6 A;  1IN6 A;  4AD9 A;  2L4M A;  2CW0 F;  1MKM A;  4XSX F;  2UXN A;  4DNC A;  3MAJ A;  3R6S A;  2KRF A;  4N9H A;  3WTZ A;  5E20 A;  2PBI A;  2IP2 A;  1ZYR F;  3RDI A;  3WGG A;  5K5R A;  3FZV A;  4MGR A;  4EGZ A;  3V8J A;  3ZQ7 A;  4KA4 A;  3GFM A;  2Z5U A;  5FFX A;  4FHT A;  1LDD A;  1IN7 A;  1ON2 A;  4L5I A;  4EJW A;  2YSR A;  2WC2 A;  4BYY A;  3KP4 A;  1PUE E;  5H20 A;  3I58 A;  3PFI A;  3QU3 A;  4JBA A;  2MBF A;  3KP2 A;  1TW2 A;  2A6H F;  4O3M A;  4UNO A;  3L7W A;  4UXN A;  1OYI A;  2BYV E;  1BC7 C;  3WGI A;  3RTR A;  2M8E A;  2ETH A;  2XIG A;  5K5Q A;  2MD5 A;  4A12 A;  3F21 A;  5HS8 A;  1FP1 D;  4HW0 A;  5JR3 A;  4ZYD A;  2OBP A;  2EK5 A;  5F6F A;  4WXD A;  4KIC A;  3HRU A;  1W7P D;  1ZG3 A;  3SZT A;  5A2Q K;  4HLY A;  5H6Q A;  2HOE A;  4P9F A;  3ULQ B;  1BM9 A;  1KU3 A;  2EA4 A;  1RIO H;  3IKV A;  3BPV A;  3PQJ A;  1WI9 A;  2HZT A;  2B0L A;  3KCC A;  4YG2 F;  1XN7 A;  4YFN F;  4AVP A;  1IN4 A;  2EV6 A;  3P7N A;  5FFZ A;  1J7K A;  1JHH A;  3Q9V A;  2V9V A;  3ZMU A;  4EM1 A;  2K86 A;  3T8R A;  3ZPL A;  3P9K A;  1XSD A;  2PMU A;  2YPR A;  3K9T A;  5HLG A;  4A6D A;  2FML A;  1TNS A;  3K1N A;  3ERE D;  3R60 A;  3ZMD A;  2VT2 A;  4Q48 A;  3F8C A;  4I01 A;  1TTY A;  3F72 A;  3TO9 A;  5KK1 A;  2QUF A;  2YU3 A;  1G3T A;  2HTS A;  4YIF A;  3DF8 A;  1J9I A;  2V1X A;  2Q2E A;  2E7X A;  1CF7 B;  2O03 A;  3HYI A;  4BXU A;  1Z1D A;  1G3S A;  1MD0 A;  1BBY A;  1SMY F;  1HW1 A;  4O5V A;  2ELH A;  5D6F A;  4LLN A;  4MQ9 F;  3Q5F A;  4A2U A;  3F6O A;  5LGN A;  4KIG A;  4OIR F;  1KQ0 A;  4ESB A;  3LA2 A;  2P7V B;  5BPI A;  4LLG F;  2PJP A;  2PQ8 A;  1QZZ A;  2W24 A;  2FEZ A;  2OQG A;  1KGS A;  2JPC A;  3BZ6 A;  1MJA A;  2NRA C;  1HW2 A;  5HDG A;  1IZ1 A;  4ZZL A;  4K2E A;  3O6B B;  2Y48 A;  4Y17 A;  1KA8 A;  3E5Q A;  1HW5 A;  2A69 F;  3RYP A;  5ICE A;  1EH8 A;  3GXO A;  1TBX A;  3I59 A;  3MZY A;  2WV0 A;  5D6E A;  5DD4 A;  5L3G A;  2ZNY A;  3DPL C;  2Z3Y A;  2EWN A;  3T5X A;  2XAH A;  3NQO A;  3BDD A;  4AIH A;  4FX0 A;  1XMA A;  2XKO A;  2EFW A;  4WXC A;  5IT9 Z;  3C18 A;  2F5D A;  4IVN A;  4GCV A;  1ZG1 A;  3ECH A;  4L18 B;  3GZ5 A;  2PG4 A;  2R7D A;  1BI1 A;  4KMU X;  4IF4 A;  3I54 A;  2IA0 A;  4M74 A;  2IT0 A;  3I59 B;  1MZB A;  5ICG A;  4AIK A;  2K02 A;  2F5C A;  2DK8 A;  4A5M A;  1L3L A;  5ILS A;  4LK1 F;  3GF2 A;  1ZHF A;  1I6X A;  3W6J B;  4GYG A;  2A07 F;  4B09 A;  4IHT A;  1IXS B;  1B1B A;  3ZMS A;  3DPT A;  5HVQ C;  2R3S A;  4XBF A;  3ZMT A;  4CO8 A;  2HGC A;  2PN6 A;  5H6R A;  3LWF A;  3WTV C;  1TLH B;  2Y75 A;  4Q4Z F;  4XLN F;  3NRV A;  4LFU A;  5ICF A;  3TO6 A;  2VE9 A;  4ESJ A;  2A3S A;  4RGX A;  3HHG A;  4L9V A;  3LQQ A;  3IC7 A;  2L01 A;  1SFU A;  3ML6 A;  2R7F A;  4S05 A;  4NHJ A;  1XGM A;  2STT A;  2CWE A;  2UXX A;  4LD5 A;  2M87 A;  5HLH A;  2QQB A;  5EEG A;  3R0J A;  4OOI A;  4PGG A;  3FWE A;  5DDG A;  2VC1 A;  4GO1 A;  3HOS A;  1ZG5 A;  3DV8 A;  1OMI A;  2CYY A;  4U0V A;  3E6M A;  1DUX C;  5FD6 A;  1JXS A;  1SD4 A;  5LEK A;  2RC4 A;  2YX4 A;  5BOX A;  1W7P B;  1B4A A;  4P55 A;  1WRJ A;  3SFZ A;  1MGT A;  2STW A;  4KIF A;  3E5U A;  3C3W A;  3QRF F;  5HLI A;  2ADU A;  2XAG A;  4B8X A;  3R0A A;  5JVT A;  3DFG A;  3LA7 A;  5DCM A;  2ZME A;  3BWG A;  1FYK A;  4KN4 X;  4A0X A;  1XSV A;  1R58 A;  3GFL A;  1LDJ A;  3ZN0 A;  3GVA A;  3GLX A;  1ULY A;  5DV5 A;  2OZU A;  2BE5 F;  4BQA A;  3SZP A;  2O3F A;  1EH7 A;  2EA2 A;  2H6B A;  4BAY A;  1OKR A;  1MJ9 A;  2LSO A;  3J80 K;  1KYW A;  1B9M A;  2ESH A;  3JAM Z;  1O3R A;  2M5W A;  1OR7 A;  1YIO A;  4A6E A;  4RGS A;  3KZY A;  1CGP A;  5DCM B;  2ZME B;  4I02 A;  3KEQ A;  4HA8 A;  2RVC A;  3HHH A;  4HV5 A;  3DEU A;  3HSR A;  3Q9S A;  3QAH A;  4GYI A;  2VN2 A;  3PQK A;  4RS8 A;  2DU9 A;  1T2K A;  1REP C;  2XAF A;  3QP6 A;  2FBI A;  3L09 A;  2GXB A;  4CXF A;  3KZZ A;  4OMY A;  2EFP A;  2H27 A;  1FC3 A;  4HDV A;  1WKM A;  2G9W A;  4WCG A;  2BGC A;  5EEH A;  2G7U A;  4ZYE A;  4ENK A;  4ZYG A;  4U7D A;  1OPC A;  4UVB A;  1UCR A;  1O57 A;  3IKT A;  5DUI A;  1YS6 A;  4E70 A;  1K79 A;  3V8K A;  2HKX A;  1UB9 A;  2XV4 S;  4F7Z A;  1FWZ A;  1LVA A;  1RZ4 A;  4IJA A;  3BJ6 A;  2J5O A;  2KJB A;  1YQA A;  2PFB A;  2FBK A;  4HQM A;  1R36 A;  1TNT A;  5LBQ A;  4M6Y A;  5DEQ A;  1R23 A;  4KMF A;  2DTR A;  5LRR A;  3QOP A;  3FMR A;  1S7O A;  3M7G A;  3P9C A;  5E1W A;  3MEX A;  3KLO A;  4EJV A;  1A04 A;  1LB2 A;  1XGS A;  4LK0 F;  3DXJ F;  3GEZ A;  2V79 A;  4G6D A;  2JT1 A;  1H9G A;  1T38 A;  1I1S A;  3ZN1 A;  1H9T A;  3SHF A;  4RB3 C;  5D8K B;  3FXR A;  3H3U A;  3FM3 A;  4ETS A;  4M9S A;  1R00 A;  4MTE A;  2VBX A;  1MDM A;  4LGW A;  3FM5 A;  2C6Y A;  3WTS C;  5E18 F;  2Q0O A;  1IAW A;  2L3D A;  4I2O A;  4BHB A;  4HV6 A;  1P92 A;  1QNT A;  1G6N A;  5E1Z B;  4PCQ A;  1LNW A;  2XKP A; 
#chains in the Genus database with same CATH topology
 1TWF J;  4IXA A;  1SVO A;  5LFA A;  4BL0 B;  3MCZ A;  1F1Z A;  2HPI A;  3QPL A;  3ZP5 A;  2EV5 A;  3HUG A;  2G0E A;  2MH2 A;  2QGU A;  4RM2 A;  5LLQ A;  1S29 A;  2IAI A;  4J19 A;  1LUJ B;  1SD6 A;  2DJN A;  3LFK A;  2XAQ A;  3OYA A;  3C1D A;  4B3X A;  4B43 A;  2VXZ A;  1K6O A;  1GV5 A;  2QSH X;  3WTW C;  4JX6 A;  1X1C A;  5L3F A;  1MBH A;  3SYT A;  4P1W A;  5TIS C;  1A36 A;  1MDM B;  1JI8 A;  1FP2 A;  1EH6 A;  2M34 A;  1HOM A;  4GXO A;  2LP0 A;  2VBY A;  2ZJQ F;  2JRM A;  3PSF A;  1P7J A;  5FD5 A;  1XMK A;  3RYR A;  5FJ8 J;  4LIV A;  3K4C A;  5CJ9 A;  5FRM A;  2NS7 A;  2Z2S B;  1ZAR A;  2QA4 I;  2CV0 A;  3V4G A;  5A2Q Z;  3ISP A;  1T39 A;  1E2X A;  4IRH A;  4WK8 F;  3CP8 A;  5BNG A;  1R5G A;  3IRR A;  1TT5 B;  3U21 A;  1BIA A;  1R22 A;  2FE3 A;  2D2W A;  3JW4 A;  4ENM A;  3HUG B;  2IJL A;  2HWV A;  4CUG A;  3I0T A;  3WE3 A;  5J4Y A;  1CF7 A;  4I0A A;  2HYJ A;  4L9J A;  2W25 A;  3CDH A;  3D1N I;  1MND A;  2HZD A;  1R5I D;  3O8G A;  3ELK A;  3LAJ A;  4PZJ A;  5EF6 A;  2JRT A;  4G7H F;  3K2A A;  2QYO A;  2TDX A;  4HRI A;  2ZO4 A;  1U3E M;  2QWW A;  4E7S A;  1XDS A;  3I4P A;  4CCM A;  3E7L A;  4RAG A;  3OL4 A;  5FO5 A;  4UUV A;  3H36 A;  2GA2 A;  2JSC A;  2E1O A;  3X2Q H;  3I4N J;  1TQI A;  1QZY A;  2ESN A;  1P2F A;  1FYM A;  2QQ9 A;  3S1R J;  4ZJZ A;  3GO5 A;  3FK6 A;  3PNT A;  2ZSI B;  3F0C A;  2DDA A;  3JRD A;  2DW4 A;  2X6W A;  3EUK L;  1XGN A;  4IPA A;  1QVU A;  1X2M A;  3E5X A;  5J4V A;  2RQP A;  5L3D A;  2XVC A;  4CCN A;  5FLX K;  2DAO A;  4IRI A;  2UUZ A;  5LHG A;  2H94 A;  3SXY A;  1W36 C;  1R1V A;  2H6C A;  4IHW A;  3VOD A;  2EJR A;  3KP7 A;  2ZBK A;  4IRG A;  5AIQ A;  3ZQQ A;  4CZZ A;  3L2R A;  1YX5 A;  4V19 K;  4UV9 A;  2X0L A;  3PIP F;  4KIB A;  3BCB A;  3OYF A;  2JK3 A;  2M1B A;  1LFU P;  1ONV A;  2FXA A;  3HOT A;  4L5E A;  2WWY A;  2ISY A;  2FRH A;  5IP9 J;  1BI0 A;  1ETQ A;  5K7Z A;  1WJC A;  1TT0 A;  2LTP A;  3BPX A;  2NVX J;  3FXL A;  5F64 A;  1RNL A;  2AQF A;  1MJB A;  1QHH D;  3PIO F;  3LSR A;  2R7S A;  3ZQL A;  1R5H A;  1F43 A;  1V5G A;  2KDO A;  4EGY A;  4J01 A;  2OF7 A;  2L9V A;  3MN2 A;  4QTR A;  4E7J A;  3TED A;  3OS1 A;  2DBB A;  4CH7 A;  2F5V A;  1T33 A;  3LSG A;  2QZ8 A;  1OYY A;  2DT6 A;  2XAJ A;  1I5Z A;  1WHU A;  2HQN A;  3CDL A;  3K7A J;  3OV8 A;  4MFD A;  2B63 J;  3QWL A;  2DPD A;  1LKX A;  4QIW N;  1FY7 A;  4OAY A;  3JCU C;  3OIQ A;  4BJT A;  5L3E A;  2CSO A;  2YS9 A;  4KYW A;  4ESF A;  1IF1 A;  3RZD J;  3HM5 A;  1ACI A;  2VT3 A;  3KFW X;  2R7X A;  1FTT A;  1A6I A;  5EGO A;  1O3Q A;  2EV0 A;  3IL2 A;  2F2E A;  4L9T A;  4RAZ A;  5B5E C;  1QGP A;  2D45 A;  4U88 A;  3U2R A;  1ZRC A;  1DU0 A;  3E3V A;  4ZTF A;  4CDG A;  2XC7 A;  4YFK F;  2BY3 A;  2Y0S A;  2X1D A;  1TL8 A;  2MAB A;  2NNY A;  2EBI A;  2VOD A;  4PSW A;  1MBE A;  2XRN A;  1POG A;  2L9S A;  5IYB J;  3ESW B;  3KP3 A;  3JSO A;  5EDN A;  3GZ6 A;  2DT5 A;  3E6B A;  4HF2 A;  1RI7 A;  3K4M A;  4LG0 A;  3REO A;  4G7Z F;  3HIF A;  4PFO A;  1Z77 A;  1ZEL A;  2L7F P;  3HTS B;  2OUM A;  3OS0 A;  2ZNZ A;  1YIJ I;  3U1D A;  1BR4 A;  3H3V K;  5CYV A;  1SAU A;  5TJJ A;  1S6L A;  5BMZ A;  1HKT A;  4X1E A;  2R92 J;  3FIS A;  2KPM A;  5ILV A;  2RAE A;  3DTI A;  2CG4 A;  1Y1V J;  1Y6I A;  5FRO A;  4IHS A;  1I3Q J;  4OMZ A;  5EGO B;  2Z33 A;  1DP7 P;  5FLV A;  3FHZ A;  1MBK A;  2E19 A;  1FNN A;  3BG7 A;  3CTA A;  2WAD A;  2IGO A;  3HRT A;  3I53 A;  3P5J A;  1FBU A;  2GXA A;  4RGR A;  3N4M A;  4D0P A;  4BNC A;  3PSI A;  1LFP A;  2Z99 A;  2L54 A;  5DM6 F;  3CJT B;  3ABM H;  5HS9 A;  3TL4 X;  3H9J A;  1D5V A;  3OYK A;  3HG9 A;  1I27 A;  3CLO A;  3K4K A;  4LG0 B;  4L0Y B;  3LAP A;  4JOM A;  1BIB A;  3COA C;  3FKJ A;  5ICC A;  1YTY A;  3AFH A;  3TW6 A;  3GUD A;  3PNV A;  2X51 A;  1SEU A;  3S3M A;  1HDP A;  1Y0U A;  3SDB A;  1ZLK A;  1CQT A;  2R7R A;  4WF2 A;  4NQW A;  4AUX A;  4EQQ A;  1KZH A;  4S04 A;  4L0Z B;  2DDB A;  1VQL I;  2BV6 A;  2RKH A;  3ASO H;  2VKD A;  4DYQ A;  2Y30 A;  5D8L B;  2ECC A;  3G73 A;  4BE1 A;  3GYH X;  3HZJ A;  2AO9 A;  1YE9 A;  3V7S A;  2M7A A;  4GRI A;  3OYM A;  3R4K A;  5D4R A;  4OU0 A;  4KNY A;  3FIW A;  2H8W A;  1NG7 A;  3M3Y J;  2X6Y A;  1VF9 A;  4A5N A;  2XRO A;  2VE8 A;  3HGG A;  1U78 A;  5CVJ A;  1J59 A;  3BG3 A;  2YR2 A;  5J8C A;  3LSH A;  1D8K A;  2Q8K A;  5E3O A;  2FNA A;  5EZH A;  3K0L A;  1IDZ A;  3J81 K;  2FNP A;  2COM A;  4ZDP A;  1A5J A;  2K85 A;  3IHU A;  2JN6 A;  4XLE A;  4C3I J;  2DPU A;  2E1C A;  3CCY A;  2P6S A;  4A0Z A;  1D1B A;  4YRV A;  3ASN H;  2IW5 A;  3T0Y A;  2W57 A;  2VJJ A;  4NQW B;  3FXO A;  3WU0 A;  3WG7 H;  5BQT A;  2ZFU A;  3BJO A;  1UZC A;  2FOK A;  3HSF A;  2YUS A;  3K4J A;  3RJP A;  3VFZ A;  3GFI A;  1IG7 A;  4NNJ A;  2ZXJ A;  4UUT A;  1FOY A;  3M9A A;  1MW7 A;  1U2W A;  1YS7 A;  4XOP A;  3CF2 A;  1WGX A;  2DFF A;  1IDY A;  2K4J A;  3JRC A;  1ZRD A;  3ABL H;  1OLT A;  1BOB A;  4DW6 A;  1DGW Y;  1W7P A;  3TDU C;  4A3B J;  3CQZ J;  2VQH A;  3KET A;  3SZG A;  2FQ4 A;  3LMM A;  4U0Y A;  3NWT A;  4QLC U;  1F5T A;  1P6R A;  1FBS A;  1V3F A;  3F3X A;  3DU6 A;  2Z16 A;  1STZ A;  3GTJ J;  4IKF A;  4RB0 A;  2EZK A;  5LGT A;  2QLZ A;  5AIP A;  3KPH A;  1FOK A;  3BZK A;  3UNG C;  3DLL F;  4EV0 A;  2ZXW H;  2LC2 A;  1EF4 A;  4BH9 A;  3K1M A;  2IGK A;  4ZYH A;  2VOP A;  1U8R A;  5F1J A;  1OCP A;  3F23 A;  1Q1H A;  2PEX A;  3H35 A;  4I98 B;  3BTJ A;  2VBZ A;  3CCQ I;  4XNF A;  1HA8 A;  1XMX A;  2EFQ A;  3CUQ A;  2OTJ I;  1O7F A;  3BG6 A;  2MYS A;  2EPF A;  4V2F A;  2X1C A;  4KN7 X;  2M45 A;  4A3E J;  1ZH5 A;  3BTL A;  1I6H J;  2XB0 X;  1T0F A;  1V5F A;  4EMS A;  5F27 A;  3VOE A;  3CUQ C;  3OL3 A;  1GT0 C;  2DFE A;  3MKW B;  3T1B A;  4DZJ A;  4EAT A;  1EJ9 A;  1K4T A;  1FOX A;  1KU7 A;  3LQR A;  1WFX A;  5E8G A;  1Y0N A;  4EJT A;  1T0F C;  4N4O B;  4ZZD A;  4BY7 J;  5J8F A;  3EYY A;  3DP7 A;  3VB2 A;  3MKL A;  3QYE A;  4HQE A;  2F6C A;  1QRY A;  3A1Y A;  2UWM A;  1MMD A;  4HX4 A;  1LE8 A;  4HBL A;  1MNE A;  2ISZ A;  1ZGJ A;  1ZGA A;  3HTU A;  3RKX A;  1AWC A;  2XHK A;  3OOP A;  1OCC H;  1IN8 A;  2HR3 A;  4ZC3 A;  1J5Y A;  2HEO A;  3V7R A;  1LDK B;  2CQ7 A;  4PDK A;  2IA2 A;  1PP8 F;  1JGG A;  2V26 A;  2A6E F;  1KQ9 A;  2P4W A;  2IPQ X;  1FIA A;  3CUQ B;  2JZY A;  3G3Z A;  2F48 A;  5FGM A;  4RGU A;  1BI3 A;  3PNY A;  2L2O A;  1FZP B;  5IYD J;  1QPM A;  1Z7U A;  3JRB A;  2P6T A;  3ZR8 X;  5L3B A;  1TW3 A;  1KU9 A;  5D5X B;  1LEB A;  1D5Y A;  2OU2 A;  1N77 A;  3IP4 B;  3LSK A;  3L2Q A;  1PUF A;  2BW3 A;  3CCU I;  4FX4 A;  2EIJ H;  3W2V A;  3BG9 A;  5B3S H;  3JTG A;  1SMT A;  3LSI A;  5J6X A;  1Z21 A;  1Z91 A;  1ZRE A;  1ZTR A;  1YX3 A;  2B9S A;  1XGO A;  1LE8 B;  1MH3 A;  4E6K G;  5IY5 H;  3HDD A;  3WTU C;  1RC9 A;  2EIM H;  4XK4 A;  4RDU A;  2RNJ A;  2GIZ A;  3F9K A;  4ZDL A;  2F5F A;  4XOT A;  3S16 J;  1IC8 A;  4CCL A;  5FLM J;  1J2X A;  1GUU A;  1ON1 A;  3OYH A;  2Y9Y A;  2FOW A;  4JYK A;  1T98 A;  2HS5 A;  2LY2 A;  3TO7 A;  3QPS A;  2A61 A;  4KDP A;  3KEO A;  4R1H A;  5FRN A;  1N75 A;  4S0H B;  1JTX A;  4M6X A;  3LSJ A;  2XSJ C;  2KDZ A;  2HNH A;  3GFJ A;  3D0S A;  1R1U A;  3IH2 A;  2IXS A;  2MG4 A;  3FMQ A;  1HCR A;  5B1B H;  1PUF B;  2R7V A;  2BW3 B;  2KRC A;  4C30 A;  1X1P A;  5LHI A;  3TKY A;  2VLA A;  5GTI C;  1Z9C A;  1J0R A;  2GXG A;  3QPH A;  4P96 A;  1DDN A;  2BHY A;  2HKO A;  3DEE A;  3MZH A;  2K4B A;  1YW9 A;  2ELK A;  3HOW J;  3M8F A;  1QBJ A;  1AA7 A;  4B48 A;  3VSK A;  4PGH A;  3CD6 I;  4CYD A;  3PUB A;  2L4A A;  3OYJ A;  3LSP A;  4BHP A;  2JJ7 A;  3J7Z I;  1WJA A;  2LBF A;  4EJO A;  2JPB A;  2OA4 A;  4BJ5 C;  3H0G J;  2LKS A;  3HRS A;  1VQN I;  2MLK A;  3GW2 A;  4W1U A;  5KVR A;  1K4S A;  2KKO A;  1FJL A;  3I64 A;  1UJ8 A;  1DGR M;  3CMA I;  5TRD A;  4HF0 A;  1UST A;  4CCK A;  1WQ2 A;  3CO7 C;  2JA7 J;  2MFZ A;  2EB7 A;  2NNN A;  2O8K A;  1RRJ A;  3HOV J;  4XLC A;  2GAU A;  1XD7 A;  2XPW A;  2HXO A;  3K4L A;  1HST A;  1WWX A;  1XCV A;  2YX7 A;  3CCM I;  3TBI A;  3I55 I;  3HKZ A;  3GTO J;  1XCB A;  4EM0 B;  2HYF A;  4C9Y A;  2ZJP F;  3OYI A;  4XRS A;  4KUM A;  2VPR A;  4I0B A;  2PMH A;  1ZGW A;  3G1L A;  1S3J A;  1G4D A;  1FPQ A;  4LMY A;  2LKP A;  2RDP A;  4JQF A;  2GOM A;  2CGP A;  3FXU A;  3T8T A;  1QZE A;  3U1K A;  2M0M A;  3I5U A;  2LBF B;  3KLN A;  4BAC A;  1S8N A;  2XDV A;  4AC0 A;  3NAR A;  1GHC A;  1Z0X A;  2DQL A;  3EUH A;  4CYC A;  1RKW A;  1HXD A;  3QPT A;  1IXC A;  3KYC B;  2M4K A;  2M30 A;  1FBQ A;  1WJ5 A;  2MH9 A;  1OCZ H;  1V4R A;  3KYL A;  2IA1 A;  2CV1 A;  2VI6 A;  4EVI A;  3IRQ A;  3EUH C;  3IWZ A;  2NS0 A;  3RKW A;  1Q1V A;  2CMP A;  3FX3 A;  2OCE A;  3F8F A;  5TGT A;  4MTD A;  1FT9 A;  3HOY J;  4MHG A;  2QQA A;  1B59 A;  1SFX A;  1VTN C;  3GTQ J;  2M0C A;  1JUM A;  1ETO A;  1R4M B;  1VQK I;  2E1N A;  4MNU A;  4OIP F;  4H4K C;  1YW7 A;  4A3C J;  1T8I A;  5JI6 A;  3G4S I;  2FA5 A;  1LJ9 A;  2KRH A;  3BRO A;  4QWQ A;  2RGV A;  3RIR A;  3K6G A;  5DS9 A;  2E7W A;  2FBH A;  1RKT A;  4XLP F;  2BVL A;  3AL0 C;  2Y9Z A;  1WI3 A;  2JA6 J;  5IOZ A;  4HSR A;  1JE8 A;  4A3G J;  2K9Q A;  1R7J A;  4CYC B;  1SC7 A;  1IRX A;  5HDN A;  4E7I A;  4GFB A;  1J09 A;  1ZAO A;  1FTZ A;  2ZSH B;  2KFD A;  3G1O A;  5K1Y A;  4EM2 A;  4Y4R A;  3RPU A;  4WWC A;  2K27 A;  6PAX A;  2HI3 A;  1S5L C;  3H5A A;  1TP4 A;  1IXR C;  2EIN H;  3CCV I;  1KON A;  2IS6 A;  2DA6 A;  3HKZ N;  2KHM A;  3M8J A;  4A3M J;  2DA7 A;  2QM3 A;  2GQQ A;  2XUB A;  1HSJ A;  1KU2 A;  1SFE A;  2R4G A;  4O6J A;  1SD7 A;  3F8M A;  2F5E A;  4UUS A;  4HDU A;  3B6C A;  4AYB N;  3AL0 B;  1FLI A;  1W5T A;  1X4P A;  1XSX A;  2O8X A;  3SEQ A;  4U7B A;  3SJM A;  4ITV A;  3S32 A;  4P9U A;  2R0Q C;  1TQP A;  2D1H A;  1YO5 C;  3GTK J;  3DTK A;  1K83 J;  1X58 A;  3DQV C;  1K78 A;  2LKX A;  4MQV A;  1Z3Y A;  3TOA A;  3HXL A;  5IP6 A;  1UHM A;  3F22 A;  2M2E A;  4ON0 A;  2CFO A;  3DBH B;  1W5C C;  4OIQ F;  3J7A O;  1HLV A;  3TDZ C;  5ED4 A;  5IP7 J;  1RUN A;  3W6V A;  2TCT A;  3LFU A;  1O3S A;  1WJD A;  1H88 C;  2DI3 A;  1TQM A;  3ZMZ A;  5JHF A;  4CGZ A;  4AWX B;  4UV8 A;  1SD5 A;  1UMQ A;  1W1W E;  3ZQF A;  3D5L A;  4MEX F;  4E7L A;  2VL8 A;  3E6D A;  4R79 A;  3OS2 A;  2TRT A;  4I7H A;  4A3I J;  2QSG X;  3HBL A;  1LEA A;  3CME I;  1BC8 C;  2EH3 A;  4AID A;  4RAF A;  3TW7 A;  2L02 A;  3H5N A;  3V8L A;  3L9F A;  3ZRG A;  5GAE J;  4UUS B;  3H92 A;  2BY1 A;  4DGW B;  4A93 J;  2FSW A;  2BBY A;  2H09 A;  4ZH4 F;  4RB2 C;  2L0K A;  2DA1 A;  2WAQ A;  2CV2 A;  4RB1 A;  1O7L A;  3L1P A;  2P5L C;  1K78 B;  2ME0 A;  3SQN A;  3F8B A;  3J7Y J;  1X3U A;  1HBX G;  2X48 A;  3BCA A;  1EA3 A;  3TQN A;  1EV7 A;  3WU2 C;  4I09 A;  2HQR A;  2O6G E;  3MVP A;  1HKQ A;  2P0W A;  1WCM J;  2XB5 A;  3BP8 A;  4PJ0 C;  4V2G A;  1YG2 A;  2IS1 A;  3ZGK A;  5GTH C;  2FX0 A;  2IBD A;  4Y3O A;  4JX4 A;  2JUC A;  2OQR A;  4I6Z A;  1F4K A;  2NVT J;  1MSE C;  1DPU A;  4M6V A;  2W85 A;  5FLX Z;  3FMS A;  2X1E A;  1PJR A;  4A0Y A;  2BZT A;  3NEU A;  4CHU A;  1BOA A;  1IRZ A;  3L2U A;  1G8X A;  1X1B A;  3QP5 A;  4HZF A;  1D1A A;  1ZLJ A;  1JTY A;  4YEL A;  3ECO A;  1NHA A;  1QO0 D;  3Q3S A;  2E71 A;  4ASN A;  4FCY A;  1FEX A;  2DLL A;  2VIX A;  3CP2 A;  4CIC A;  2MLG A;  1R1T A;  1W5S A;  5K7H A;  1I1G A;  1JHF A;  3OR2 C;  3RI4 A;  2EFN A;  1P4X A;  5IPA A;  1DU6 A;  1K61 A;  2FUG 2;  1FX7 A;  2QVO A;  1RPW A;  2HU9 A;  3WU1 B;  1Y8Q B;  1S7E A;  2RN7 A;  5J1U A;  1OYW A;  1XDU A;  2CQX A;  2DTZ A;  5KAF C;  5CVV A;  4G7O F;  4U87 A;  2XGE A;  3CLQ A;  2DA2 A;  1Z05 A;  4HF1 A;  4DBR A;  1ZR2 A;  3GTP J;  2DFH A;  3G1M A;  5DCF A;  2DK5 A;  3MQ0 A;  4FT8 A;  4AIJ A;  4GDF A;  2Y0M A;  3WOD F;  2XAU A;  2DFI A;  2KZG A;  4D5C A;  2P5K A;  3HPG A;  2GBY A;  3ERM A;  4XKC A;  3I71 A;  3HSE A;  3IWF A;  1IUF A;  5M5X J;  2V6E A;  1IW7 F;  1YLF A;  3WHC A;  3EQL F;  2WAQ N;  3WTY C;  2HFH A;  2MD0 A;  3MWM A;  4HOB A;  1ETY A;  3BJA A;  2HQ5 A;  1AOY A;  2Q2E B;  3MFK A;  3P9I A;  2FJ1 A;  1U5T A;  3BR6 A;  1BN5 A;  5FKO A;  1VQO I;  3HOZ J;  3GTG J;  4OIN F;  2OD5 A;  4DZP A;  4MEY F;  2M8G X;  4MFE A;  2KQR A;  1IN5 A;  3TOB A;  5L3C A;  1PP7 U;  1GVJ A;  1U5T C;  2KIU A;  5DM7 F;  1BJA A;  3PUF A;  5D5V B;  4XON A;  1K7A A;  1TZL A;  3VEP A;  2HYG D;  2JA5 J;  3S2D J;  3CJN A;  4KJZ A;  5J1Y A;  4ENN A;  2CRG A;  1P4W A;  1SFK A;  3ABU A;  3AAF A;  2G7H A;  3VDX A;  5BPD A;  2OAZ A;  4LLL A;  2WTE A;  5E17 F;  2KIM A;  1SAX A;  3G6E I;  1X1D A;  3S3O A;  4BBS J;  5IT9 K;  4AVZ A;  1MIJ A;  4F55 A;  4NC7 A;  5HS7 A;  2OTL I;  1YW8 A;  2XGD A;  4XR6 A;  4HX8 A;  4BHC A;  1X2N A;  2QBY A;  2HTJ A;  1JKQ C;  1YRN B;  3ZMV A;  4LB6 B;  4ENJ A;  2DO7 A;  3OY9 A;  1U5T B;  2KIF A;  4W97 A;  4NUB A;  3L2W A;  1HQC A;  2A68 F;  2GZW A;  3ABT A;  4Y7N J;  2X4H A;  4M9Z A;  1WSU A;  2HPM A;  1BR1 A;  3HPH A;  1U9N A;  2HDC A;  3ROU A;  1ODD A;  1JUS A;  2XRL A;  4PUS A;  3FK7 A;  4BGD A;  1H0M A;  1E0E A;  2PI0 A;  1LPQ A;  1R9T J;  2KL4 A;  2IEK A;  2MC3 A;  1B72 A;  4IOC F;  5CVR A;  3OSF A;  2DMP A;  3D5R C;  2PJR A;  4GGG A;  3BLY A;  1MNM C;  4OWR B;  3CDI A;  2OJE D;  2E5Z A;  2LY9 A;  1MMA A;  4UVC A;  2EZH A;  3G71 I;  2PLY A;  1LFB A;  2BEO A;  2FF4 A;  2DYR H;  2K7L A;  2V6C A;  3FXK A;  2JTV A;  5HDK A;  3OSG A;  3QU6 A;  1QQI A;  4QPQ A;  2AS5 F;  2QBY B;  4B1R A;  5M5W J;  3F6V A;  4G94 A;  1GV2 A;  3PL8 A;  1GVD A;  3C7J A;  3Q0W A;  3S2H J;  3B73 A;  5F08 A;  1MMG A;  1A6Q A;  1Z6R A;  5CVI A;  1B6A A;  3MMY B;  2NYX A;  1IRG A;  5F1R A;  2CO5 A;  2GA1 A;  4G8X A;  1XPX A;  3RCO A;  3TMO A;  1HC8 A;  5HOO A;  4YII A;  1D1C A;  1RUO A;  2EFO A;  3K69 A;  4DJA A;  3B02 A;  5ERI A;  4FTH A;  1B72 B;  4XRF A;  3FDY A;  2MA3 A;  2GOX B;  3JRA A;  3J81 Z;  2PJR B;  4CZC A;  2UZK A;  1IUY A;  2A5Y B;  1JT6 A;  1OCR H;  3FXQ A;  4ZYA A;  5K5O A;  5IOY A;  2AXL A;  3K70 D;  2JA2 A;  2XF5 A;  1G3Y A;  2HVQ A;  2GIV A;  4LB5 A;  3E97 A;  2BY2 A;  1C0W A;  3BR5 A;  2KT0 A;  4CSW A;  3V42 A;  5LHH A;  1G3W A;  4XLA A;  4RAY A;  1UHS A;  4DYC A;  5H2F C;  3RPQ A;  2FQ3 A;  2ELJ A;  3KX2 A;  1Y8R B;  3VYU B;  4L9N A;  2ICW G;  2COB A;  4IHX A;  5J47 A;  4DQ2 A;  1YYV A;  2A05 A;  1KYZ A;  2K9N A;  2ZFW A;  3BQY A;  1V5E A;  3LST A;  5JHU A;  3W2W A;  3HOX J;  2ZC2 A;  4M73 A;  2QSF X;  1NH3 A;  3DU5 A;  2VOO A;  4IEJ A;  5C44 J;  3CO6 C;  1UHW A;  4L5J A;  3O2P E;  3O3K A;  2P7C B;  3R61 A;  3WE2 A;  1D0X A;  5DUK A;  3MKZ A;  1VI0 A;  3OYB A;  5AON A;  2ID6 A;  5GPA A;  3RKY A;  3H0D A;  4N9I A;  3RSN A;  3O8H A;  5DD8 A;  4ZTJ A;  1RES A;  4M72 A;  4JK1 X;  5CVU A;  1GLN A;  1BL0 A;  3M1C A;  3JSP A;  2LF7 A;  4MIM A;  5HNH A;  3BOQ A;  3M8E A;  5FB2 A;  2CFX A;  2VBW A;  4Z2Y A;  2HVS A;  4G6Q A;  4H0E A;  3GTL J;  3LA3 A;  2VC0 A;  3OWT A;  5JFR A;  2NAZ A;  4BQQ A;  3W2A A;  3I4M J;  4LJZ F;  2ZJ2 A;  2IRF G;  2CS3 A;  3DTE A;  2R7O A;  3KEY A;  4JX5 A;  4J00 A;  3GWZ A;  2CJJ A;  2ZCW A;  1F9N A;  2VKE A;  4KT5 C;  3JR9 A;  5ILU A;  1J75 A;  4U0W A;  1USS A;  2KZV A;  3WG9 A;  4HNU A;  1M1E B;  5LEJ A;  3L2C A;  2ACJ A;  2XSD C;  3NWS A;  3ZQG A;  3WGH A;  4OIO F;  1U6G A;  2L9N A;  5LRS A;  4BQN A;  4Y13 A;  4XSZ F;  3KP5 A;  4R8H A;  2KLO A;  2FMY A;  4XM3 A;  4C3J J;  1R71 A;  2VON A;  1JGS A;  2P8T A;  1YFH A;  1GXP A;  3DKW A;  1UFM A;  5EG0 A;  2VAS A;  2W84 A;  5M3F J;  3BY6 A;  4UHT A;  4XKB A;  1GXQ A;  2H8R A;  1OCO H;  2R7T A;  4II3 A;  4A3F J;  3I3L A;  4M71 A;  3VPR A;  1KQ8 A;  3W6K B;  4M9X A;  1B9N A;  1LQ1 A;  5J3L A;  3EDP A;  2J5P A;  1W36 D;  5HNF A;  1ZN2 A;  4DIQ A;  3WTX C;  1P4A A;  3JTH A;  1AHD P;  4IQJ A;  4P5O A;  2IVM A;  3KP6 A;  1X4O A;  2D1V A;  2Z1D A;  3EYI A;  2O0Y A;  1XB4 A;  3OYD A;  3I56 I;  1MBG A;  4X0G A;  3EET A;  1FMV A;  1YHQ I;  2JQ7 A;  3FHN A;  2VQC A;  1O3T A;  1K6Y A;  4N0B A;  5E8I A;  1QHG A;  3L00 A;  5LGU A;  3U9G A;  1FSE A;  4UVA A;  2FU4 A;  4TV7 A;  3ZQC A;  1AKH A;  1W4M A;  2LOO A;  2XGX A;  3JAM K;  1IRF A;  2WB1 N;  4XRS G;  4Y15 A;  3J80 Z;  3SEZ A;  3TGN A;  1PDN C;  2WY8 Q;  1Y39 A;  2V1U A;  4Q47 A;  5EG0 B;  3WTT C;  3DWL E;  5DYM A;  3AG3 H;  3DEW A;  1TC3 C;  1XS9 A;  4HLX A;  3ZCO A;  2LDU A;  2P5V A;  1FYL A;  3IAS 2;  3VYR B;  5F0C A;  5E1X A;  4HNT A;  3H1C A;  3H9G A;  4YFX F;  4N4N B;  1DPR A;  4HX7 A;  4HAM A;  3A03 A;  4WX9 A;  2LF8 A;  2DQR A;  3PM1 A;  1YJ9 I;  1W0U A;  4QPO A;  3N97 A;  3BC8 A;  4HYE A;  3FBI B;  4G12 A;  2KJC A;  3K2Z A;  2JWT A;  2XAS A;  4XLH A;  1U8B A;  5IT3 A;  1L0O C;  2CQK A;  2LH9 A;  2O61 A;  3KE2 A;  4WXH A;  4G9Y A;  1UG0 A;  2GM4 A;  1P7I A;  1AKH B;  1D8J A;  2F4I A;  4FET A;  5DTD A;  1ZRF A;  3C2H A;  1BJZ A;  2Z9O A;  1ITY A;  4HEA 2;  1NG6 A;  5D4S A;  3GX4 X;  2HQA A;  3K1P A;  4DBQ A;  4Z6Y A;  3FXJ A;  5D5U B;  2RV8 A;  2V1D A;  3HRM A;  3M1E A;  3H3Z A;  1E17 A;  3CMM A;  2QEN A;  2WA0 A;  1FOW A;  1FSH A;  4ANJ A;  1D3Y A;  2DA4 A;  1ORK A;  4XLF A;  4KFC A;  3AG4 H;  1Y1W J;  4Q5S F;  2XPU A;  3S2W A;  4B44 A;  1WH5 A;  1HKS A;  3CUO A;  4BU2 A;  3E6C C;  2EQR A;  1MH4 A;  2P81 A;  3F8N A;  4IQ4 A;  1F36 A;  5BS6 A;  1T08 B;  4EJU A;  4BKX A;  2WBM A;  4NB5 A;  5CLS A;  1JT0 A;  3A02 A;  5D5W B;  3JRG A;  2GWR A;  3FF5 A;  4NDL A;  1TWC J;  2LNB A;  2ZKZ A;  4CCO A;  3CES A;  3V7C A;  1Z6T A;  4A69 C;  1S7A A;  3PO2 J;  1T6S A;  1BI2 A;  2NVU B;  2OZ6 A;  3RQ4 A;  2OV7 A;  1XX5 A;  1WJB A;  3ZQH A;  1IN6 A;  1TWH J;  4AD9 A;  1X1A A;  4AYB A;  2AHQ A;  2L4M A;  1BW5 A;  2CW0 F;  2CUZ A;  3M4O J;  5CKT A;  3ZXS A;  4X6A J;  1MKM A;  1UAA A;  2R7W A;  4XSX F;  2ECB A;  3G2B A;  2V7F A;  2UXN A;  4DNC A;  2LFB A;  4XIC A;  3MAJ A;  2LMD A;  1IV6 A;  3R6S A;  3PO3 J;  1OIS A;  2KRF A;  1WJF A;  2CW8 A;  1SFO J;  2HDD A;  1ETW A;  2DJI A;  1QU3 A;  3HL2 A;  4LIT A;  2K5C A;  4N9H A;  3WTZ A;  1WJE A;  3KZI C;  4A3K J;  2F4M B;  5E20 A;  2PBI A;  3AG1 H;  5FKK A;  2IP2 A;  4BS9 A;  1ZYR F;  3RDI A;  3WGG A;  5K5R A;  3FZV A;  4MGR A;  4EGZ A;  3V8J A;  4M3B A;  2CU7 A;  1ETK A;  3ZQ7 A;  4KA4 A;  3LNQ A;  2Q1Z B;  4XN0 A;  3GZN B;  4RLQ A;  3GFM A;  2Z5U A;  5FFX A;  2DMN A;  4FHT A;  4MLO A;  1LDD A;  4BXX J;  1IN7 A;  1ON2 A;  5CPR B;  4L5I A;  2W82 A;  4EJW A;  2WAF A;  2W7N A;  2YSR A;  4IO9 F;  4G6T B;  2WC2 A;  4FQG A;  4BYY A;  2VQG A;  1X3W B;  3KP4 A;  1PUE E;  5H20 A;  2CW7 A;  2MC4 A;  3I58 A;  3PFI A;  3QU3 A;  4JBA A;  3LL7 A;  2MBF A;  1GDT A;  3CCL I;  2X9D A;  3KP2 A;  1TW2 A;  2A6H F;  4O3M A;  1P9Q C;  4UNO A;  5FKM A;  3CJR B;  3L7W A;  3M07 A;  3BTI A;  2LK2 A;  3S17 J;  1ETX A;  4UXN A;  3BR1 A;  1OYI A;  4RMN A;  5F0H A;  5F0F A;  2BYV E;  2AQE A;  3K4N A;  1BC7 C;  2I8D A;  2ZJR F;  3WGI A;  2EIL H;  3RTR A;  3H9Q A;  5GAD J;  1E3H A;  2QF7 A;  1RR8 C;  2M8E A;  2ETH A;  2XIG A;  5K5Q A;  4I99 C;  2MD5 A;  4A12 A;  4LOC A;  3F21 A;  3JRE A;  2K9L A;  5HS8 A;  1FP1 D;  2CH0 A;  3VYT B;  1JKO C;  2R7Q A;  4HW0 A;  5JR3 A;  4ZYD A;  3JRH A;  2OBP A;  2EK5 A;  5F6F A;  4B47 A;  4WXD A;  2JVH A;  4KIC A;  5CQG A;  3HRU A;  5J40 A;  2I5U A;  5KNL A;  2IS2 A;  2M9H A;  1W7P D;  1ZG3 A;  3SZT A;  5A2Q K;  4E7Z A;  3FXM A;  2JVG A;  4HLY A;  2OCC H;  5H6Q A;  3TP3 A;  1HDD C;  1W0T A;  2HOE A;  4P9F A;  3ULQ B;  1BM9 A;  1KU3 A;  2EA4 A;  5HOD A;  1B8I A;  3IV5 A;  1RIO H;  2LRD A;  3IKV A;  5B1A H;  3BPV A;  3PQJ A;  1WI9 A;  4ZDO A;  2HZT A;  2XF7 A;  2B0L A;  3KCC A;  4YG2 F;  1XN7 A;  2QKL B;  3ZQI A;  4AVP A;  4YFN F;  1PYV A;  1IN4 A;  4IHV A;  2EV6 A;  2L5Q A;  3S1Q J;  3P7N A;  2K40 A;  2VKH A;  5FFZ A;  5CQE A;  1J7K A;  1JHH A;  1MBF A;  3Q9V A;  3PJR A;  2V9V A;  3RKQ A;  3ZMU A;  2ZB9 A;  5EZG A;  2HOT A;  4EM1 A;  2K86 A;  5LD2 C;  3T8R A;  3UKG A;  3ZPL A;  3P9K A;  3HGY A;  3MD2 A;  2JA8 J;  2W1O A;  2M7B A;  1VQM I;  2EIK H;  1XSD A;  4RBO A;  5GPC A;  2A5W A;  2PMU A;  2YPR A;  3K9T A;  5HLG A;  1H8A C;  1Y56 A;  3CCJ I;  4A6D A;  2FML A;  2NXN B;  1TNS A;  4D1Q A;  3K1N A;  3BZC A;  3ERE D;  1MSF C;  2CUF A;  3R60 A;  3ZMD A;  3RZO J;  2VT2 A;  4Q48 A;  1B8I B;  3F8C A;  4I01 A;  3I9V 2;  1TTY A;  5GAG J;  3F72 A;  3TO9 A;  2CUJ A;  4PJM A;  5KK1 A;  2R5Z A;  2QUF A;  1ZR4 A;  1A31 A;  2YU3 A;  3QYF A;  2QEX I;  1Z3X A;  2D5V A;  4F52 A;  4MO7 A;  1G3T A;  2NOG A;  2DOE A;  2HTS A;  1JKP C;  1I50 J;  1LVK A;  4YIF A;  3DF8 A;  1J9I A;  2V1X A;  3HB9 A;  2VJ5 A;  4QSH A;  2WY7 Q;  2Q2E A;  2E7X A;  3A0H C;  2F4O B;  2O03 A;  1CF7 B;  3CZ6 A;  2V4J C;  4BQO A;  3HYI A;  4BXU A;  1Z1D A;  3DBR B;  2MW8 A;  1G3S A;  1MD0 A;  2K9S A;  1BBY A;  1SMY F;  3W3C A;  1T95 A;  1HW1 A;  4O5V A;  2ELH A;  3GCM A;  1VQ4 I;  5D6F A;  2L7Z A;  4LLN A;  4XQF A;  4RA2 A;  2VQL A;  4MQ9 F;  3Q5F A;  4A2U A;  3F6O A;  4BJ6 C;  4E4H A;  5LGN A;  4RM3 A;  2LYC A;  4KIG A;  1I39 A;  4OIR F;  2R5Z B;  2E36 A;  3EUA A;  1KQ0 A;  4ESB A;  3LA2 A;  2P7V B;  3ZOB A;  3A01 A;  5BPI A;  4LLG F;  2PJP A;  2E34 A;  2KP6 A;  3FKI J;  1MBJ A;  4PJL A;  4KIT B;  2PQ8 A;  1QZZ A;  2W24 A;  2FEZ A;  2OQG A;  4EEF G;  1KGS A;  2R5Y A;  1YRN A;  3VWB A;  5EYR A;  2JPC A;  3BZ6 A;  4D9J A;  1VFC A;  1MJA A;  4BY1 J;  4PK4 A;  2NRA C;  1ERD A;  2HOS A;  1HW2 A;  3QYB A;  5HDG A;  2BXY A;  5HLT A;  1IZ1 A;  1FMW A;  4ZZL A;  4K2E A;  1IGN A;  1MMS A;  3O6B B;  2BXZ A;  1V54 H;  2Y48 A;  4Y17 A;  1KA8 A;  1NTC A;  3E5Q A;  1VQ6 I;  1HW5 A;  2A69 F;  3RYP A;  5ICE A;  1EH8 A;  2K9M A;  2RRE A;  3GXO A;  3QOD A;  1TBX A;  1IJW C;  2V9K A;  1G59 A;  3I59 A;  3HC7 A;  2DMT A;  2WV0 A;  2E60 A;  3MZY A;  5D6E A;  5DD4 A;  5L3G A;  2ZNY A;  2VXD A;  3DPL C;  3A01 B;  2Z3Y A;  2EWN A;  3T5X A;  2XAH A;  2DCE A;  3BDD A;  3NQO A;  4AIH A;  3A2K A;  3OYL A;  2E35 A;  2EZL A;  4FX0 A;  2R5Y B;  4BBR J;  3ONQ A;  1WVR A;  1XMA A;  2PMZ A;  2RNG A;  3KIO A;  2XKO A;  3IUO A;  2DYS H;  4WXC A;  3JRI A;  2EFW A;  3E0J B;  2HXI A;  9ANT A;  5IT9 Z;  5GAH J;  2VPL A;  3BR3 A;  2E2I J;  3C18 A;  2K3P A;  2F5D A;  2Y31 A;  4IVN A;  4GCV A;  1ZG1 A;  3ECH A;  1YJW I;  4L18 B;  1BA5 A;  4XL9 A;  3GZ5 A;  1SVL A;  2LVS A;  3DCF A;  2PG4 A;  2R7D A;  1ENH A;  4FE4 A;  1BI1 A;  1UG2 A;  3IH4 A;  2KIQ A;  4KMU X;  2M4G A;  2GLO A;  3OIO A;  3CC2 I;  4KIS A;  1RR7 A;  2E1M C;  4IF4 A;  3I54 A;  3SDG A;  2IA0 A;  3NAU A;  4M74 A;  2IT0 A;  3I59 B;  3H5R A;  4C3H J;  1MZB A;  5ICG A;  3EPZ A;  2E2J J;  4AIK A;  1PVE A;  3VYS B;  1SVM A;  3OIP A;  1R4N B;  2K02 A;  2F5C A;  2DK8 A;  4A5M A;  1L3L A;  5ILS A;  2BOL A;  2ZXI A;  4LK1 F;  1U9O A;  2O5R A;  3GF2 A;  4IHY A;  4M3G A;  3S1M J;  3BQZ A;  5GP9 A;  5IYC J;  4RLF A;  1ZHF A;  1I6X A;  1WH7 A;  1NK2 P;  1DQU A;  3W6J B;  3CC4 I;  2Y0S N;  4D7N A;  2E1M B;  4GYG A;  1E3P A;  3IH3 A;  4BUP A;  2A07 F;  2X85 A;  4B09 A;  2IS4 A;  3VSL A;  2MGQ A;  4M3E A;  4IHT A;  1IXS B;  1B1B A;  1D0Z A;  1WZ2 A;  4F92 B;  1TWA J;  2EZI A;  3DLA A;  3CJQ B;  2CUE A;  2X6O A;  1XC5 A;  3ZMS A;  3KYD B;  3DPT A;  5HVQ C;  2R3S A;  1VQ7 I;  4XBF A;  1V55 H;  3BTC A;  2W00 A;  3ZMT A;  4CO8 A;  2HGC A;  5EJC A;  2PMZ N;  2DMU A;  4XRM A;  2PN6 A;  5H6R A;  5C4X J;  3OYE A;  4C2U A;  3LWF A;  4D5F A;  3WTV C;  1TLH B;  2NOJ B;  2M3A A;  1G2H A;  3HEF A;  2V1N A;  2Y75 A;  4Q4Z F;  3CMY A;  2ID3 A;  4XLN F;  2O9L A;  4B4C A;  3NRV A;  3L2V A;  4LFU A;  5ICF A;  3TO6 A;  4YIR X;  2VE9 A;  3OYN A;  4NC8 A;  4FAS D;  4ESJ A;  3MZ8 A;  2HDW A;  4C2T A;  2A3S A;  3RPU D;  4RGX A;  3HHG A;  1QVT A;  3GTM J;  4L9V A;  4BEH A;  1AU7 A;  3LQQ A;  5E3N A;  3IC7 A;  5M3M J;  2L7M P;  2L01 A;  4XOR A;  1E3O C;  3S14 J;  1SFU A;  3ML6 A;  2R7F A;  4S05 A;  1ZK8 A;  2IGN A;  4NHJ A;  1XGM A;  4NC6 A;  2STT A;  3B6A A;  1T56 A;  4XID A;  1OCT C;  2H1K A;  2BHZ A;  3BR0 A;  5KAI C;  2CWE A;  2BVM A;  2WB1 A;  2UXX A;  4LD5 A;  2V9P A;  4CCJ A;  3CC7 I;  2M87 A;  4XMY A;  5HLH A;  5JLX A;  2QQB A;  5EEG A;  3R0J A;  4OOI A;  4PGG A;  5E3L A;  4UY8 I;  2VJI A;  3FWE A;  5DDG A;  2VC1 A;  3CF5 F;  1VQ9 I;  2NVQ J;  3D5S C;  4GO1 A;  3HOS A;  1ZG5 A;  3DV8 A;  3J7A Y;  1OMI A;  3JRF A;  3S1N J;  4F91 B;  2CYY A;  4U0V A;  1UEL B;  3E6M A;  1DUX C;  4BXF A;  5FD6 A;  2WAE A;  4IOA F;  2A6T A;  4Y52 J;  2UV1 A;  1JUP A;  2RQQ A;  1JXS A;  3S8P A;  4BEH B;  1SD4 A;  5LEK A;  2RC4 A;  3C2G A;  4FE7 A;  2LG4 A;  3QQA A;  1X3Z B;  2YX4 A;  2Y2Z A;  1W7P B;  5BOX A;  4DOZ A;  1N25 A;  5C3E J;  2DXI A;  2R7Z J;  4DYR A;  1B4A A;  3CCR I;  4P55 A;  1WRJ A;  2IGM A;  4AU7 A;  4IX7 A;  2DMQ A;  2PX9 A;  3SFZ A;  1MGT A;  2HOA A;  2E2H J;  1OQY A;  2STW A;  2W4S A;  3S93 A;  1YI2 I;  1Z67 A;  1I3A A;  4KIF A;  3E5U A;  4NBQ A;  2DOF A;  4XKV A;  3C3W A;  3QRF F;  2K3F A;  1D0Y A;  5HLI A;  2ADU A;  2XF6 A;  5J1R A;  2XAG A;  1APL C;  1NK3 P;  4B8X A;  3R0A A;  5JLW A;  1N78 A;  5JVT A;  3OMY A;  3DFG A;  3LA7 A;  1JJ8 C;  5DCM A;  2ZME A;  2JUG A;  2XPV A;  3MKY B;  3BWG A;  1FYK A;  4KN4 X;  4A0X A;  2ZXH A;  1XSV A;  1R58 A;  3S3N A;  3LSM A;  4F93 B;  3GFL A;  1LDJ A;  3ZN0 A;  3GVA A;  4XN3 A;  4BE2 A;  3GLX A;  4CA0 A;  2ZME C;  1ULY A;  2BY0 A;  2NS8 A;  1S9H A;  5DV5 A;  2OZU A;  2BE5 F;  2NVY J;  4BQA A;  4D7M A;  3SZP A;  1S72 I;  1H89 C;  2O3F A;  1U0J A;  1EH7 A;  3OYC A;  2EA2 A;  4ABZ A;  2XGC A;  2H6B A;  3DKY A;  4BAY A;  1ZQ3 P;  4OAZ A;  1OKR A;  1MJ9 A;  2LSO A;  3J80 K;  1KYW A;  4A3D J;  1B9M A;  2ESH A;  4KT6 A;  3JAM Z;  1O3R A;  4M3F A;  2M5W A;  1DP3 A;  1OR7 A;  1YIO A;  4A6E A;  5C4J J;  2LD5 A;  2KMU A;  1BW6 A;  4I76 A;  2LR8 A;  4RGS A;  4LIU A;  3KZY A;  3UR3 C;  1Z7L A;  1CGP A;  1OR7 C;  4IZZ A;  5DCM B;  2ZME B;  3WHB A;  3HOU J;  2OPT A;  4I02 A;  3RQI A;  1IV8 A;  5KHD A;  3KEQ A;  4HA8 A;  2RVC A;  4UB8 C;  2QCO A;  3OOU A;  3HHH A;  2JSP A;  3DEU A;  4HV5 A;  3HSR A;  4F3Q A;  1YJN I;  1EKE A;  1ETV A;  2L7K A;  3QAH A;  3Q9S A;  4GYI A;  3SFI A;  1QPI A;  1BR2 A;  2VN2 A;  3PQK A;  4RS8 A;  2DU9 A;  4BE0 A;  1SAN A;  1T2K A;  3OYG A;  3ABK H;  1REP C;  2XAF A;  3QP6 A;  2FBI A;  4HNV A;  3GME A;  4B3A A;  3L09 A;  1XTA A;  1VQ5 I;  2HVR A;  2GXB A;  1R49 A;  5E79 C;  4CXF A;  3KZZ A;  4HST A;  4OMY A;  2DT7 B;  4M3D A;  1QA6 A;  2EFP A;  2VKV A;  1HF0 A;  2H27 A;  2FD5 A;  1FC3 A;  4HDV A;  1RET A;  1WKM A;  3BT9 A;  3TP0 A;  3S15 J;  2G9W A;  4WCG A;  2Y69 H;  2BGC A;  1X19 A;  2CQN A;  4C2M J;  1YIT I;  5K7F A;  4Y33 A;  2DOA A;  5EEH A;  2G7U A;  4ZYE A;  4ENK A;  4ZYG A;  4U7D A;  1OPC A;  4UVB A;  5FKN A;  3AG2 H;  4E7K A;  1UCR A;  3FBN B;  1O57 A;  5E3M A;  3IKT A;  3AKZ A;  1VZ0 A;  3QOE A;  5DUI A;  1YS6 A;  4E70 A;  1JJ6 C;  1K79 A;  1VQ8 I;  3V8K A;  2VJ4 A;  2HKX A;  4BDY A;  1UB9 A;  1TWG J;  2XV4 S;  4F7Z A;  2DA3 A;  4PFP A;  1FWZ A;  3BG5 A;  1LVA A;  1RZ4 A;  4PSX A;  4IJA A;  3BJ6 A;  2J5O A;  2KJB A;  2MSY A;  1YQA A;  2N8G A;  2DN0 A;  2PFB A;  3A4C A;  5FKL A;  2QQ8 A;  2FBK A;  2OC6 A;  4HQM A;  1R36 A;  1TNT A;  2YU9 J;  5LBQ A;  4M6Y A;  2KIS A;  4IL6 C;  5DEQ A;  4A3L J;  3C2B A;  1VQP I;  1YOV B;  1R23 A;  4KMF A;  2W48 A;  2DTR A;  1VND A;  3E1S A;  5LRR A;  3IAM 2;  1WPK A;  3QOP A;  3CCS I;  3FMR A;  1S7O A;  3M7G A;  3BR2 A;  2DOD A;  3P9C A;  5E1W A;  3MEX A;  3DKX A;  3KLO A;  4EJV A;  2CQQ A;  3CCE I;  4JP0 A;  1A04 A;  1LB2 A;  2LY1 A;  1XGS A;  2R93 J;  2AXT C;  4HPQ A;  4HG2 A;  3DXJ F;  3GEZ A;  4LK0 F;  2VB6 A;  4BDZ A;  1R6R A;  1OJL A;  2V79 A;  2H1L A;  4G6D A;  1JKR C;  2JT1 A;  2E5N A;  1FIP A;  1H9G A;  1T38 A;  1I1S A;  4XKW A;  3GLL A;  3ZN1 A;  1H9T A;  3SHF A;  2I10 A;  1IO2 A;  4FIS A;  4RB3 C;  5D8K B;  3K10 A;  3FXR A;  3H3U A;  3FM3 A;  4ETS A;  2JMW A;  5JVG F;  3A0B C;  3K4B A;  1A35 A;  4M9S A;  1R00 A;  2X6X A;  2DA5 A;  2B7E A;  4MTE A;  4AM3 A;  5KCM A;  2QKM B;  3HJE A;  4PJN A;  4PJJ A;  2VBX A;  3LOC A;  1MDM A;  1OFC X;  2VUM J;  4LG3 A;  3OR1 C;  2R7U A;  4LGW A;  3FM5 A;  4A3J J;  2C6Y A;  5M5Y J;  3WTS C;  5E18 F;  2WV1 A;  1ZKG A;  2Q0O A;  3PFY A;  4YEJ A;  1IAW A;  2L3D A;  3GBG A;  1O4X A;  4I2O A;  5F04 A;  4BHB A;  2ME6 A;  3DPU A;  4II2 A;  3N05 A;  3Q0V A;  3K70 C;  5EEA A;  2LRE A;  4HV6 A;  1P92 A;  1QNT A;  2O7O A;  1XG1 A;  1G6N A;  3DBL B;  5E1Z B;  4E7H A;  4PCQ A;  4UB6 C;  3Q0U A;  1MMN A;  2L9R A;  2LLK A;  5B66 C;  1LNW A;  2XKP A; 
#chains in the Genus database with same CATH homology
 4IXA A;  3MCZ A;  1F1Z A;  3ZP5 A;  2EV5 A;  3HUG A;  2MH2 A;  5LLQ A;  1S29 A;  1SD6 A;  3LFK A;  2XAQ A;  3C1D A;  2VXZ A;  1K6O A;  3WTW C;  5L3F A;  1MDM B;  1FP2 A;  1EH6 A;  4GXO A;  2VBY A;  5FD5 A;  1XMK A;  3RYR A;  5CJ9 A;  1ZAR A;  3V4G A;  5A2Q Z;  3ISP A;  1T39 A;  1E2X A;  4IRH A;  4WK8 F;  1R5G A;  3IRR A;  1BIA A;  1R22 A;  2FE3 A;  2D2W A;  3JW4 A;  4ENM A;  2IJL A;  2HWV A;  3I0T A;  3WE3 A;  1CF7 A;  4I0A A;  4L9J A;  2W25 A;  3CDH A;  3ELK A;  3LAJ A;  4PZJ A;  2JRT A;  4G7H F;  2QYO A;  2TDX A;  2ZO4 A;  1U3E M;  2QWW A;  1XDS A;  3I4P A;  5FO5 A;  4UUV A;  2GA2 A;  2JSC A;  1TQI A;  1QZY A;  2ESN A;  1P2F A;  1FYM A;  2QQ9 A;  3GO5 A;  2DW4 A;  1XGN A;  4IPA A;  3E5X A;  2RQP A;  5L3D A;  2XVC A;  5FLX K;  2DAO A;  4IRI A;  5LHG A;  2H94 A;  3SXY A;  1R1V A;  2H6C A;  3VOD A;  2EJR A;  3KP7 A;  2ZBK A;  4IRG A;  5AIQ A;  4CZZ A;  4UV9 A;  2X0L A;  4KIB A;  2M1B A;  1ONV A;  2FXA A;  3HOT A;  2WWY A;  2ISY A;  2FRH A;  1BI0 A;  3BPX A;  5F64 A;  1RNL A;  1MJB A;  1R5H A;  4EGY A;  2DBB A;  2QZ8 A;  1OYY A;  2XAJ A;  1I5Z A;  2HQN A;  3OV8 A;  2DPD A;  1FY7 A;  5L3E A;  2CSO A;  4KYW A;  4ESF A;  1IF1 A;  2VT3 A;  3KFW X;  1O3Q A;  2EV0 A;  3IL2 A;  2F2E A;  4L9T A;  4RAZ A;  2D45 A;  1QGP A;  4U88 A;  3U2R A;  1ZRC A;  3E3V A;  4CDG A;  4YFK F;  2NNY A;  2VOD A;  2XRN A;  3KP3 A;  3JSO A;  3GZ6 A;  2DT5 A;  3E6B A;  4HF2 A;  1RI7 A;  4LG0 A;  3REO A;  4G7Z F;  3HIF A;  3HTS B;  2ZNZ A;  3U1D A;  5CYV A;  5TJJ A;  1S6L A;  5BMZ A;  1HKT A;  5ILV A;  2CG4 A;  4IHS A;  2Z33 A;  4OMZ A;  1DP7 P;  3FHZ A;  1FNN A;  3CTA A;  3HRT A;  3I53 A;  1FBU A;  4RGR A;  3N4M A;  4D0P A;  4BNC A;  2Z99 A;  2L54 A;  5HS9 A;  1D5V A;  1I27 A;  3CLO A;  4LG0 B;  4L0Y B;  3LAP A;  1BIB A;  3COA C;  5ICC A;  1YTY A;  3GUD A;  1Y0U A;  1ZLK A;  4WF2 A;  4NQW A;  4S04 A;  4EQQ A;  4L0Z B;  2BV6 A;  2RKH A;  5D8L B;  3G73 A;  3GYH X;  3V7S A;  3R4K A;  5D4R A;  4OU0 A;  4KNY A;  4A5N A;  2XRO A;  2VE8 A;  1U78 A;  5CVJ A;  1J59 A;  2YR2 A;  5J8C A;  1D8K A;  2Q8K A;  2FNA A;  3K0L A;  3J81 K;  2FNP A;  2COM A;  3IHU A;  2DPU A;  2E1C A;  2P6S A;  4A0Z A;  2IW5 A;  3T0Y A;  2W57 A;  3WU0 A;  5BQT A;  3BJO A;  3HSF A;  2FOK A;  3RJP A;  3VFZ A;  3GFI A;  2ZXJ A;  3M9A A;  1U2W A;  1YS7 A;  2K4J A;  1ZRD A;  1W7P A;  3TDU C;  3KET A;  4U0Y A;  1F5T A;  4QLC U;  1P6R A;  1FBS A;  1V3F A;  3F3X A;  1STZ A;  4RB0 A;  5LGT A;  2QLZ A;  5AIP A;  1FOK A;  4EV0 A;  4BH9 A;  3K1M A;  4ZYH A;  2VOP A;  1U8R A;  3F23 A;  1Q1H A;  2PEX A;  4I98 B;  2VBZ A;  2EFQ A;  3CUQ A;  1O7F A;  4KN7 X;  2M45 A;  1ZH5 A;  1T0F A;  4EMS A;  3VOE A;  3CUQ C;  3T1B A;  1KU7 A;  3LQR A;  5E8G A;  4EJT A;  4ZZD A;  5J8F A;  3EYY A;  3DP7 A;  3VB2 A;  4HQE A;  2UWM A;  4HX4 A;  4HBL A;  2ISZ A;  1ZGJ A;  1ZGA A;  3HTU A;  3RKX A;  1AWC A;  2XHK A;  3OOP A;  1IN8 A;  2HR3 A;  1J5Y A;  2HEO A;  3V7R A;  1LDK B;  4PDK A;  2IA2 A;  1PP8 F;  2A6E F;  1KQ9 A;  2P4W A;  2IPQ X;  3CUQ B;  2JZY A;  3G3Z A;  5FGM A;  4RGU A;  1BI3 A;  1FZP B;  1QPM A;  1Z7U A;  2P6T A;  5L3B A;  1TW3 A;  1KU9 A;  5D5X B;  1LEB A;  2OU2 A;  4FX4 A;  3JTG A;  1SMT A;  5J6X A;  1Z91 A;  1ZRE A;  1XGO A;  3WTU C;  2RNJ A;  2F5F A;  1J2X A;  1ON1 A;  1T98 A;  2HS5 A;  3TO7 A;  2A61 A;  4KDP A;  3KEO A;  4R1H A;  4M6X A;  3GFJ A;  3D0S A;  1R1U A;  3FMQ A;  5LHI A;  3TKY A;  1Z9C A;  1J0R A;  2GXG A;  3QPH A;  4P96 A;  1DDN A;  2HKO A;  3MZH A;  2K4B A;  1YW9 A;  3M8F A;  1QBJ A;  4PGH A;  4CYD A;  2L4A A;  4BHP A;  4EJO A;  2JPB A;  2OA4 A;  3HRS A;  2MLK A;  3GW2 A;  5KVR A;  2KKO A;  3I64 A;  5TRD A;  4HF0 A;  1UST A;  1WQ2 A;  3CO7 C;  2EB7 A;  2NNN A;  2GAU A;  1XD7 A;  1HST A;  1WWX A;  1XCV A;  2YX7 A;  1XCB A;  4EM0 B;  2HYF A;  4KUM A;  4I0B A;  2PMH A;  1S3J A;  1G4D A;  1FPQ A;  4LMY A;  2LKP A;  2RDP A;  4JQF A;  2CGP A;  3FXU A;  3T8T A;  3I5U A;  3KLN A;  1S8N A;  1GHC A;  3EUH A;  2DQL A;  1HXD A;  3QPT A;  1IXC A;  2M30 A;  1FBQ A;  2MH9 A;  1V4R A;  2IA1 A;  3IRQ A;  4EVI A;  3IWZ A;  2NS0 A;  3RKW A;  3FX3 A;  3F8F A;  4MTD A;  1FT9 A;  4MHG A;  2QQA A;  1B59 A;  1SFX A;  1VTN C;  2E1N A;  4MNU A;  4OIP F;  1YW7 A;  5JI6 A;  2FA5 A;  1LJ9 A;  3BRO A;  4QWQ A;  2RGV A;  3RIR A;  2E7W A;  2FBH A;  4XLP F;  1JE8 A;  1R7J A;  5HDN A;  1ZAO A;  5K1Y A;  4EM2 A;  4WWC A;  3RPU A;  2K27 A;  6PAX A;  1IXR C;  2QM3 A;  2GQQ A;  2XUB A;  1HSJ A;  1KU2 A;  1SFE A;  4O6J A;  1SD7 A;  3F8M A;  2F5E A;  4HDU A;  1FLI A;  1W5T A;  1XSX A;  2O8X A;  4U7B A;  4P9U A;  1TQP A;  2D1H A;  1YO5 C;  3DQV C;  1K78 A;  4MQV A;  3TOA A;  1UHM A;  3F22 A;  4ON0 A;  4OIQ F;  3J7A O;  3TDZ C;  5ED4 A;  1RUN A;  1O3S A;  2DI3 A;  1TQM A;  3ZMZ A;  4CGZ A;  4AWX B;  4UV8 A;  1SD5 A;  3D5L A;  4MEX F;  3E6D A;  4R79 A;  4I7H A;  1LEA A;  1BC8 C;  2L02 A;  3V8L A;  3L9F A;  3H92 A;  2FSW A;  2BBY A;  2H09 A;  4ZH4 F;  4RB2 C;  4RB1 A;  1O7L A;  2P5L C;  1K78 B;  3SQN A;  3F8B A;  1X3U A;  1HBX G;  3TQN A;  1EV7 A;  4I09 A;  2HQR A;  2O6G E;  1HKQ A;  3BP8 A;  1YG2 A;  2OQR A;  1F4K A;  1DPU A;  2W85 A;  5FLX Z;  3FMS A;  4A0Y A;  3NEU A;  4CHU A;  1BOA A;  3QP5 A;  4HZF A;  1ZLJ A;  3ECO A;  1NHA A;  1QO0 D;  4ASN A;  2DLL A;  4CIC A;  2MLG A;  1R1T A;  1W5S A;  1I1G A;  1JHF A;  3RI4 A;  2EFN A;  1P4X A;  1FX7 A;  2QVO A;  3WU1 B;  2RN7 A;  1OYW A;  1XDU A;  5CVV A;  4G7O F;  1Z05 A;  4HF1 A;  5DCF A;  2DK5 A;  3MQ0 A;  4FT8 A;  4AIJ A;  2Y0M A;  3WOD F;  2DFI A;  2P5K A;  3I71 A;  3HSE A;  3IWF A;  1IW7 F;  1YLF A;  3EQL F;  3WTY C;  2HFH A;  3MWM A;  4HOB A;  3BJA A;  1AOY A;  3MFK A;  3P9I A;  1U5T A;  1BN5 A;  4OIN F;  2OD5 A;  4MEY F;  1IN5 A;  3TOB A;  5L3C A;  1PP7 U;  1GVJ A;  1U5T C;  2KIU A;  1BJA A;  5D5V B;  1K7A A;  3VEP A;  2HYG D;  3CJN A;  4ENN A;  1P4W A;  3ABU A;  3AAF A;  2G7H A;  5BPD A;  2OAZ A;  4LLL A;  2WTE A;  5E17 F;  2KIM A;  1SAX A;  5IT9 K;  5HS7 A;  1YW8 A;  4HX8 A;  4BHC A;  2QBY A;  2HTJ A;  3ZMV A;  4LB6 B;  4ENJ A;  2DO7 A;  1U5T B;  2KIF A;  1HQC A;  2A68 F;  2GZW A;  3ABT A;  2X4H A;  4M9Z A;  1WSU A;  2HDC A;  3ROU A;  1ODD A;  1H0M A;  2PI0 A;  2MC3 A;  5CVR A;  4GGG A;  4UVC A;  2PLY A;  2BEO A;  2FF4 A;  2K7L A;  2V6C A;  5HDK A;  2JTV A;  3QU6 A;  1QQI A;  2AS5 F;  2QBY B;  3F6V A;  4G94 A;  3C7J A;  3B73 A;  1Z6R A;  5CVI A;  1B6A A;  2NYX A;  1IRG A;  5F1R A;  2CO5 A;  2GA1 A;  4G8X A;  5HOO A;  4YII A;  1RUO A;  2EFO A;  3K69 A;  3B02 A;  5ERI A;  4XRF A;  2MA3 A;  3J81 Z;  2UZK A;  1IUY A;  2A5Y B;  3FXQ A;  5K5O A;  2AXL A;  1G3Y A;  2GIV A;  4LB5 A;  3E97 A;  1C0W A;  5LHH A;  1G3W A;  4RAY A;  3RPQ A;  2FQ3 A;  4L9N A;  4DQ2 A;  1YYV A;  1KYZ A;  2ZFW A;  3LST A;  5JHU A;  4M73 A;  2VOO A;  3CO6 C;  1UHW A;  4L5J A;  3O2P E;  3O3K A;  2P7C B;  3R61 A;  3WE2 A;  5DUK A;  5AON A;  3RKY A;  4N9I A;  5DD8 A;  4M72 A;  4JK1 X;  5CVU A;  3JSP A;  2LF7 A;  3BOQ A;  3M8E A;  5FB2 A;  2CFX A;  2VBW A;  4Z2Y A;  4G6Q A;  4H0E A;  3LA3 A;  2VC0 A;  5JFR A;  2NAZ A;  4LJZ F;  2ZJ2 A;  2IRF G;  3GWZ A;  2ZCW A;  1F9N A;  4KT5 C;  5ILU A;  1J75 A;  4U0W A;  1USS A;  3WG9 A;  5LEJ A;  3L2C A;  2ACJ A;  3WGH A;  4OIO F;  1U6G A;  5LRS A;  4Y13 A;  4XSZ F;  3KP5 A;  4R8H A;  2FMY A;  2VON A;  1JGS A;  2P8T A;  1YFH A;  1GXP A;  3DKW A;  1UFM A;  2W84 A;  3BY6 A;  4UHT A;  1GXQ A;  4M71 A;  1KQ8 A;  3W6K B;  4M9X A;  1B9N A;  1LQ1 A;  3EDP A;  2J5P A;  3WTX C;  1ZN2 A;  1P4A A;  3JTH A;  4P5O A;  2IVM A;  3KP6 A;  2D1V A;  3EYI A;  2O0Y A;  1XB4 A;  3EET A;  1O3T A;  4N0B A;  5E8I A;  3L00 A;  5LGU A;  3U9G A;  1FSE A;  4UVA A;  2FU4 A;  4TV7 A;  1W4M A;  2XGX A;  3JAM K;  1IRF A;  4Y15 A;  3J80 Z;  3TGN A;  1PDN C;  2V1U A;  4Q47 A;  3WTT C;  5DYM A;  4HLX A;  2LDU A;  2P5V A;  1FYL A;  5E1X A;  4YFX F;  1DPR A;  4HX7 A;  4HAM A;  4WX9 A;  2LF8 A;  2DQR A;  3N97 A;  4HYE A;  2KJC A;  3K2Z A;  2XAS A;  5IT3 A;  1L0O C;  2CQK A;  2O61 A;  3KE2 A;  4WXH A;  4G9Y A;  1D8J A;  1ZRF A;  2Z9O A;  5D4S A;  3GX4 X;  3K1P A;  5D5U B;  2RV8 A;  2V1D A;  3HRM A;  3M1E A;  3H3Z A;  1E17 A;  2QEN A;  1FSH A;  1D3Y A;  4KFC A;  4Q5S F;  3S2W A;  1HKS A;  3CUO A;  3E6C C;  3F8N A;  5BS6 A;  4EJU A;  4NB5 A;  5CLS A;  5D5W B;  2GWR A;  3FF5 A;  2LNB A;  2ZKZ A;  3V7C A;  1Z6T A;  1S7A A;  1T6S A;  1BI2 A;  2OZ6 A;  1IN6 A;  4AD9 A;  2L4M A;  2CW0 F;  1MKM A;  4XSX F;  2UXN A;  4DNC A;  3MAJ A;  3R6S A;  2KRF A;  4N9H A;  3WTZ A;  5E20 A;  2PBI A;  2IP2 A;  1ZYR F;  3RDI A;  3WGG A;  5K5R A;  3FZV A;  4MGR A;  4EGZ A;  3V8J A;  3ZQ7 A;  4KA4 A;  3GFM A;  2Z5U A;  5FFX A;  4FHT A;  1LDD A;  1IN7 A;  1ON2 A;  4L5I A;  4EJW A;  2YSR A;  2WC2 A;  4BYY A;  3KP4 A;  1PUE E;  5H20 A;  3I58 A;  3PFI A;  3QU3 A;  4JBA A;  2MBF A;  3KP2 A;  1TW2 A;  2A6H F;  4O3M A;  4UNO A;  3L7W A;  4UXN A;  1OYI A;  2BYV E;  1BC7 C;  3WGI A;  3RTR A;  2M8E A;  2ETH A;  2XIG A;  5K5Q A;  2MD5 A;  4A12 A;  3F21 A;  5HS8 A;  1FP1 D;  4HW0 A;  5JR3 A;  4ZYD A;  2OBP A;  2EK5 A;  5F6F A;  4WXD A;  4KIC A;  3HRU A;  1W7P D;  1ZG3 A;  3SZT A;  5A2Q K;  4HLY A;  5H6Q A;  2HOE A;  4P9F A;  3ULQ B;  1BM9 A;  1KU3 A;  2EA4 A;  1RIO H;  3IKV A;  3BPV A;  3PQJ A;  1WI9 A;  2HZT A;  2B0L A;  3KCC A;  4YG2 F;  1XN7 A;  4YFN F;  4AVP A;  1IN4 A;  2EV6 A;  3P7N A;  5FFZ A;  1J7K A;  1JHH A;  3Q9V A;  2V9V A;  3ZMU A;  4EM1 A;  2K86 A;  3T8R A;  3ZPL A;  3P9K A;  1XSD A;  2PMU A;  2YPR A;  3K9T A;  5HLG A;  4A6D A;  2FML A;  1TNS A;  3K1N A;  3ERE D;  3R60 A;  3ZMD A;  2VT2 A;  4Q48 A;  3F8C A;  4I01 A;  1TTY A;  3F72 A;  3TO9 A;  5KK1 A;  2QUF A;  2YU3 A;  1G3T A;  2HTS A;  4YIF A;  3DF8 A;  1J9I A;  2V1X A;  2Q2E A;  2E7X A;  1CF7 B;  2O03 A;  3HYI A;  4BXU A;  1Z1D A;  1G3S A;  1MD0 A;  1BBY A;  1SMY F;  1HW1 A;  4O5V A;  2ELH A;  5D6F A;  4LLN A;  4MQ9 F;  3Q5F A;  4A2U A;  3F6O A;  5LGN A;  4KIG A;  4OIR F;  1KQ0 A;  4ESB A;  3LA2 A;  2P7V B;  5BPI A;  4LLG F;  2PJP A;  2PQ8 A;  1QZZ A;  2W24 A;  2FEZ A;  2OQG A;  1KGS A;  2JPC A;  3BZ6 A;  1MJA A;  2NRA C;  1HW2 A;  5HDG A;  1IZ1 A;  4ZZL A;  4K2E A;  3O6B B;  2Y48 A;  4Y17 A;  1KA8 A;  3E5Q A;  1HW5 A;  2A69 F;  3RYP A;  5ICE A;  1EH8 A;  3GXO A;  1TBX A;  3I59 A;  3MZY A;  2WV0 A;  5D6E A;  5DD4 A;  5L3G A;  2ZNY A;  3DPL C;  2Z3Y A;  2EWN A;  3T5X A;  2XAH A;  3NQO A;  3BDD A;  4AIH A;  4FX0 A;  1XMA A;  2XKO A;  2EFW A;  4WXC A;  5IT9 Z;  3C18 A;  2F5D A;  4IVN A;  4GCV A;  1ZG1 A;  3ECH A;  4L18 B;  3GZ5 A;  2PG4 A;  2R7D A;  1BI1 A;  4KMU X;  4IF4 A;  3I54 A;  2IA0 A;  4M74 A;  2IT0 A;  3I59 B;  1MZB A;  5ICG A;  4AIK A;  2K02 A;  2F5C A;  2DK8 A;  4A5M A;  1L3L A;  5ILS A;  4LK1 F;  3GF2 A;  1ZHF A;  1I6X A;  3W6J B;  4GYG A;  2A07 F;  4B09 A;  4IHT A;  1IXS B;  1B1B A;  3ZMS A;  3DPT A;  5HVQ C;  2R3S A;  4XBF A;  3ZMT A;  4CO8 A;  2HGC A;  2PN6 A;  5H6R A;  3LWF A;  3WTV C;  1TLH B;  2Y75 A;  4Q4Z F;  4XLN F;  3NRV A;  4LFU A;  5ICF A;  3TO6 A;  2VE9 A;  4ESJ A;  2A3S A;  4RGX A;  3HHG A;  4L9V A;  3LQQ A;  3IC7 A;  2L01 A;  1SFU A;  3ML6 A;  2R7F A;  4S05 A;  4NHJ A;  1XGM A;  2STT A;  2CWE A;  2UXX A;  4LD5 A;  2M87 A;  5HLH A;  2QQB A;  5EEG A;  3R0J A;  4OOI A;  4PGG A;  3FWE A;  5DDG A;  2VC1 A;  4GO1 A;  3HOS A;  1ZG5 A;  3DV8 A;  1OMI A;  2CYY A;  4U0V A;  3E6M A;  1DUX C;  5FD6 A;  1JXS A;  1SD4 A;  5LEK A;  2RC4 A;  2YX4 A;  5BOX A;  1W7P B;  1B4A A;  4P55 A;  1WRJ A;  3SFZ A;  1MGT A;  2STW A;  4KIF A;  3E5U A;  3C3W A;  3QRF F;  5HLI A;  2ADU A;  2XAG A;  4B8X A;  3R0A A;  5JVT A;  3DFG A;  3LA7 A;  5DCM A;  2ZME A;  3BWG A;  1FYK A;  4KN4 X;  4A0X A;  1XSV A;  1R58 A;  3GFL A;  1LDJ A;  3ZN0 A;  3GVA A;  3GLX A;  1ULY A;  5DV5 A;  2OZU A;  2BE5 F;  4BQA A;  3SZP A;  2O3F A;  1EH7 A;  2EA2 A;  2H6B A;  4BAY A;  1OKR A;  1MJ9 A;  2LSO A;  3J80 K;  1KYW A;  1B9M A;  2ESH A;  3JAM Z;  1O3R A;  2M5W A;  1OR7 A;  1YIO A;  4A6E A;  4RGS A;  3KZY A;  1CGP A;  5DCM B;  2ZME B;  4I02 A;  3KEQ A;  4HA8 A;  2RVC A;  3HHH A;  4HV5 A;  3DEU A;  3HSR A;  3Q9S A;  3QAH A;  4GYI A;  2VN2 A;  3PQK A;  4RS8 A;  2DU9 A;  1T2K A;  1REP C;  2XAF A;  3QP6 A;  2FBI A;  3L09 A;  2GXB A;  4CXF A;  3KZZ A;  4OMY A;  2EFP A;  2H27 A;  1FC3 A;  4HDV A;  1WKM A;  2G9W A;  4WCG A;  2BGC A;  5EEH A;  2G7U A;  4ZYE A;  4ENK A;  4ZYG A;  4U7D A;  1OPC A;  4UVB A;  1UCR A;  1O57 A;  3IKT A;  5DUI A;  1YS6 A;  4E70 A;  1K79 A;  3V8K A;  2HKX A;  1UB9 A;  2XV4 S;  4F7Z A;  1FWZ A;  1LVA A;  1RZ4 A;  4IJA A;  3BJ6 A;  2J5O A;  2KJB A;  1YQA A;  2PFB A;  2FBK A;  4HQM A;  1R36 A;  1TNT A;  5LBQ A;  4M6Y A;  5DEQ A;  1R23 A;  4KMF A;  2DTR A;  5LRR A;  3QOP A;  3FMR A;  1S7O A;  3M7G A;  3P9C A;  5E1W A;  3MEX A;  3KLO A;  4EJV A;  1A04 A;  1LB2 A;  1XGS A;  4LK0 F;  3DXJ F;  3GEZ A;  2V79 A;  4G6D A;  2JT1 A;  1H9G A;  1T38 A;  1I1S A;  3ZN1 A;  1H9T A;  3SHF A;  4RB3 C;  5D8K B;  3FXR A;  3H3U A;  3FM3 A;  4ETS A;  4M9S A;  1R00 A;  4MTE A;  2VBX A;  1MDM A;  4LGW A;  3FM5 A;  2C6Y A;  3WTS C;  5E18 F;  2Q0O A;  1IAW A;  2L3D A;  4I2O A;  4BHB A;  4HV6 A;  1P92 A;  1QNT A;  1G6N A;  5E1Z B;  4PCQ A;  1LNW A;  2XKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...