2LNBA

Solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Z-DNA-binding protein 1
publication title Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lnbA00
4RB0A 2E7WA 1FBQA 2PBIA 4U7BA 1KYZA 5D5WB 6PAXA 1LEBA 3O2PE 4U7DA 4YFKF 3AAFA 1KU2A 3D0SA 3I64A 2JSCA 2CQKA 1QZZA 1ZG5A 1KU3A 2MH9A 5JVTA 3IKTA 3HIFA 4O6JA 1XSXA 1TNTA 3CUQA 5CVUA 1RZ4A 1FPQA 3I0TA 2H6BA 3MFKA 1BN5A 1KQ9A 1NHAA 2L3DA 1LQ1A 2FMYA 5E17F 4OMYA 3I4PA 5HVQC 3OOPA 4HF0A 2IW5A 3Q9SA 1FSEA 3ML6A 5A2QK 3B73A 5LRRA 2R7FA 2QYOA 4AIJA 1S7AA 3HHHA 2O8XA 2JPBA 2GWRA 5D4SA 1IZ1A 5LGNA 1UFMA 3GX4X 4WXCA 4HX4A 1W7PB 2VT3A 5IT3A 4L9NA 1HKTA 2YSRA 4WWCA 2XASA 3WTZA 2P4WA 2QBYB 1DUXC 2HR3A 2NRAC 1VTNC 4EM2A 2Y48A 2RDPA 5F64A 3GUDA 2M87A 1Q1HA 1TW2A 2B0LA 5JI6A 2Q0OA 1MDMA 4F7ZA 1XMAA 4LMYA 4UNOA 2K02A 4WF2A 1HW2A 2HKXA 3V4GA 3I59A 3HRSA 4HQEA 1J59A 1JHFA 1J7KA 3FMQA 4UV8A 1BI3A 1B59A 1ZYRF 3KEOA 3F8NA 3KP3A 3L09A 1FYLA 1T38A 2CO5A 5L3CA 4KT5C 2P5KA 3RIRA 4Y13A 4ZYEA 2EFWA 2KRFA 2P5LC 2FA5A 5IT9K 1UHMA 1R5GA 1ZG3A 4KIFA 4YFNF 2M45A 2WV0A 3QU6A 5ILUA 1JXSA 2ZXJA 1K78B 2ADUA 2QUFA 4S04A 3FMSA 1FWZA 2QWWA 4MTEA 1BIAA 5JFRA 1KQ0A 1O3RA 2VODA 4WK8F 4MQVA 4YIIA 2P6TA 1QNTA 2PLYA 4PDKA 2D2WA 1B9MA 4PGGA 3BOQA 2BE5F 3REOA 4LLNA 3QAHA 2OU2A 2DPDA 1G3WA 3K9TA 2NAZA 2FU4A 4UV9A 4LLLA 1YTYA 1D3YA 1P4XA 4KUMA 3KZZA 5ICGA 3TOBA 2EFPA 5JR3A 3FXQA 1WRJA 3ZN0A 2CWEA 3C3WA 2Y0MA 1IXCA 1BC7C 2JT1A 3WGHA 3FZVA 1ON2A 2X4HA 1R1TA 3E5UA 4HDUA 1EV7A 2XHKA 1EH8A 1YQAA 5BQTA 2LNBA 4FX0A 3GFIA 5D5VB 1HSJA 2DAOA 1RUOA 2A6EF 1J0RA 3G3ZA 2L02A 1LVAA 1D8KA 2PJPA 1T2KA 1X3UA 3EETA 2YX7A 5LEJA 1EH6A 3M9AA 2QVOA 1IRFA 3DF8A 3WG9A 3SQNA 1R00A 2JTVA 5FGMA 4BHBA 4M71A 2COMA 1IUYA 2FMLA 1ZARA 3F6OA 2K7LA 1MJ9A 3F8BA 4RAZA 4UUVA 1SMTA 5LHGA 1J2XA 2RGVA 2FSWA 1XGOA 3GYHX 3T5XA 2M5WA 2VE9A 2DK8A 2UXXA 4ASNA 3D5LA 4EM0B 3F23A 2FF4A 2R3SA 1QO0D 1UB9A 3CUOA 3JAMZ 2XKPA 2ISYA 1DPUA 5KVRA 4IHSA 1FZPB 2DFIA 2E1NA 2P7CB 5D5XB 1R58A 4OIQF 3V8LA 3DPTA 5KK1A 3ZP5A 2CG4A 3ZMSA 4BH9A 1FSHA 2CYYA 1KYWA 4XSXF 3Q5FA 4ZH4F 2FXAA 4KNYA 3GF2A 1SD5A 5H6RA 2PFBA 2ISZA 2M8EA 1YLFA 4EJTA 4YFXF 3B02A 5CYVA 4OIOF 4LK1F 5HDNA 4BHPA 3SHFA 3TDZC 4HX8A 2HFHA 3ECOA 2MLKA 3MEXA 2P7VB 1FP1D 3VOEA 1FBUA 4KFCA 4IHTA 3JSOA 2ESHA 5DCFA 4LB6B 2ZO4A 4B8XA 2LKPA 5J6XA 2D1HA 4R79A 4N9IA 3WGIA 2DLLA 4MNUA 4RGRA 3CLOA 1U2WA 2HKOA 1QBJA 4OOIA 4RGSA 1YO5C 2P8TA 3S2WA 2MLGA 3F6VA 1K7AA 5LBQA 3DP7A 4FX4A 1QGPA 4IF4A 4RGUA 2HTJA 4GO1A 5LGUA 3QP5A 1DP7P 2ZBKA 2V1XA 4CXFA 4P9UA 2ZMEA 3HHGA 3DXJF 1IXRC 2ZCWA 3HRMA 3J7AO 1PP7U 3HUGA 3R6SA 4G7HF 5FLXZ 3LAPA 2BBYA 1ZLJA 1S29A 4A0ZA 1B1BA 2DQLA 1BC8C 2MA3A 3GFJA 4G7OF 3F22A 3NEUA 4AIKA 3EUHA 2P6SA 1H0MA 1G4DA 5E20A 1W5SA 2HTSA 4I09A 1FYKA 4IPAA 2A61A 4RS8A 2XAQA 3HSFA 1GHCA 4A5MA 3FWEA 4HA8A 1LEAA 5F6FA 3WE3A 2BEOA 1WI9A 4HBLA 3L2CA 1WKMA 1OKRA 2KJCA 1IN6A 1OMIA 2Z99A 4L9JA 1T39A 5BOXA 4Q48A 3GXOA 4A12A 1U5TC 1J75A 4KDPA 4UVCA 1U78A 3KCCA 1A04A 4EJVA 5FD6A 2W85A 2HGCA 3BPVA 2JZYA 1V3FA 1YW8A 2QENA 2EV5A 2GA1A 3TGNA 4AD9A 2EK5A 2R7DA 1YFHA 1LB2A 2F2EA 2QQAA 1R23A 4HYEA 5LGTA 3VFZA 2AS5F 3JTHA 5FFXA 3ISPA 1ZREA 2XAGA 4I98B 4ENMA 1XGNA 2NYXA 2GZWA 2VOOA 2O6GE 3I54A 3ABUA 1YS6A 4IRGA 2IT0A 5CJ9A 3BJOA 2EFNA 2QQ9A 4KMFA 2HWVA 3KP4A 1YW9A 1U5TB 5J8CA 2W84A 5DD8A 3H3UA 2YPRA 2RN7A 5DD4A 2RVCA 1FY7A 3R0AA 1OYWA 3HOTA 5DDGA 1CF7A 3WGGA 2K4BA 3CO6C 2OZUA 3BPXA 1HW5A 3R60A 3MQ0A 5ERIA 5E1XA 4CICA 4GYIA 3ZQ7A 3N97A 4HZFA 3IKVA 2DO7A 3RKXA 1XDSA 1RNLA 3RYRA 4D0PA 4AIHA 3JAMK 3KETA 3BY6A 4L9VA 5FB2A 1G3TA 4EV0A 5L3FA 2A3SA 1XB4A 1KA8A 4ENNA 3ULQB 3P9CA 2HYFA 1SFUA 2A68F 2L4AA 3GLXA 3PQKA 3VODA 2EA4A 4ESFA 3G73A 3V8JA 3GWZA 1HBXG 2VBYA 3TDUC 1IAWA 1FLIA 4GYGA 2DTRA 1XD7A 5HDKA 2GXGA 2C6YA 4M74A 4IVNA 3HYIA 1HW1A 4JQFA 3CO7C 2DI3A 1TQMA 2MC3A 3QU3A 4HAMA 1JE8A 2BYVE 2XIGA 5H20A 2EA2A 2FBHA 4I02A 3R4KA 1ZRDA 5DEQA 3RKWA 4LG0A 1G6NA 5ILVA 5BS6A 2DQRA 1XCVA 1F9NA 4I2OA 2V9VA 3ZMDA 1USSA 3O3KA 2WC2A 3WTTC 5K5QA 2H09A 1IN4A 1P4WA 1T98A 1R1VA 2DBBA 2EV0A 3V7CA 3KP5A 5L3BA 3Q9VA 1F5TA 1W7PD 3HOSA 3M8FA 3FM5A 3GZ6A 4MQ9F 2IA0A 3L7WA 3ZMTA 1Z1DA 4M9XA 2RKHA 3V7RA 1B4AA 4G94A 5FLXK 2LDUA 2Q2EA 1T6SA 3T1BA 3L9FA 4XLPF 3ECHA 4RB3C 3SFZA 5L3EA 3RYPA 3PFIA 2YX4A 4HW0A 5FD5A 1BOAA 1TLHB 4Q4ZF 1XSDA 5AONA 3LQRA 3E3VA 4E70A 1LDDA 3MAJA 2CFXA 2STTA 1IXSB 4ESBA 2V79A 2WWYA 5HLIA 4KYWA 5FO5A 2IA1A 5F1RA 1K79A 3K2ZA 1AWCA 1TNSA 5ED4A 4P55A 2NNNA 2A69F 3GFMA 3LFKA 2QBYA 2KIMA 2V1UA 3GVAA 1S6LA 4ZYDA 3QPHA 2L01A 2RNJA 1L0OC 4Q47A 2XUBA 4IRHA 4S05A 1QQIA 2QLZA 1MGTA 2GIVA 1TQIA 1REPC 4HV6A 4HF2A 1OYYA 4M6YA 4EJUA 2FBKA 4GGGA 2VT2A 2HS5A 2MH2A 3LA7A 1BIBA 4K2EA 4ZZLA 2GQQA 3ZMVA 2IA2A 5L3GA 3ERED 4HOBA 5TJJA 1Z7UA 4U0YA 3I5UA 3BP8A 3IC7A 1J5YA 1IRGA 4ZYGA 5HS9A 2EV6A 1ZAOA 1WWXA 5BPIA 3NQOA 1SFXA 1LDJA 4EVIA 2XROA 3DQVC 1K78A 3IHUA 2JRTA 1RUNA 1DDNA 5ILSA 1TQPA 1U3EM 5LHHA 3FHZA 3IRQA 3HRUA 2NS0A 5K1YA 2J5OA 1MKMA 4NQWA 2E1CA 3KLNA 5HS7A 3WTSC 4ESJA 2D45A 4CDGA 2ZNZA 2GXBA 5CVVA 3LSTA 2DK5A 5CVJA 1O57A 4QLCU 3BWGA 1J9IA 2VN2A 2PMUA 4A0YA 2UXNA 2LF7A 2QQBA 4GCVA 1UCRA 4HX7A 4R8HA 2OZ6A 4LD5A 3JTGA 1ODDA 5LEKA 5AIQA 1MJAA 1BJAA 3FXUA 4O3MA 5H6QA 1QPMA 4G7ZF 1ZRFA 4HLXA 2NNYA 1PP8F 4L5JA 1FX7A 1IW7F 2YR2A 2FNAA 4AVPA 3CUQC 1P4AA 5FFZA 2FRHA 2EFOA 5HS8A 5D6FA 1OR7A 2RC4A 2RV8A 3FM3A 3H92A 2HOEA 3IWZA 2DW4A 2EB7A 4ENKA 4RGXA 3MWMA 3E6CC 3K0LA 4OU0A 3R61A 1AOYA 3E6MA 3LWFA 3TO9A 2K86A 3T8RA 2CW0F 4HQMA 3WU1B 1O3TA 4EJOA 1EH7A 2AXLA 1DPRA 2OD5A 3CUQB 1LNWA 2VBXA 1I6XA 4AWXB 1R5HA 5DYMA 4R1HA 2G7HA 2LSOA 4MEXF 5D5UB 3U9GA 2M30A 2XAFA 2BGCA 2VXZA 5CVRA 2J5PA 3ZMUA 3M7GA 1P6RA 2W24A 4MGRA 1SD6A 3WTVC 3E6DA 3SZPA 1MJBA 2F5FA 3DFGA 3RPUA 1Z6TA 5DCMA 2BV6A 3WTYC 4N9HA 3I58A 2F5CA 1IF1A 1PDNC 3O6BB 4IXAA 3V7SA 3BJAA 1ON1A 3F8MA 4U88A 1OYIA 4KA4A 3RDIA 4B09A 1HKQA 1XGSA 2L4MA 2HDCA 3E97A 2H6CA 2OA4A 5J8FA 5E8IA 3KFWX 1TTYA 1I1GA 2O0YA 2OQRA 4XRFA 3HSEA 3N4MA 1B6AA 4L18B 3M1EA 3L00A 3F3XA 4LFUA 1ZLKA 1MDMB 1ONVA 4LK0F 3J81Z 1C0WA 2YU3A 3ZPLA 1IN5A 4BYYA 3I59B 2IPQX 1ZGJA 3I71A 1I1SA 3C18A 4M6XA 4CHUA 3P7NA 1BBYA 4MHGA 4XBFA 3IRRA 4ZZDA 3HRTA 3F8CA 1RI7A 2ELHA 2IP2A 2FQ3A 5E1WA 4P96A 4RB2C 4XSZF 2Q8KA 3K69A 1R1UA 2CSOA 1XMKA 1CGPA 3PQJA 2HQRA 3E6BA 2K27A 1XDUA 2ZNYA 2Z3YA 5HOOA 4EGYA 2HZTA 3FX3A 4UHTA 2VC0A 4L0YB 1H9TA 1XCBA 1V4RA 3LAJA 2P5VA 2O3FA 1ZGAA 5LLQA 3K1MA 4JBAA 4Y15A 1XGMA 2MD5A 3P9IA 1QZYA 1I27A 3WTUC 5ICEA 5HLGA 3LQQA 3MCZA 2K4JA 3TO6A 4A6DA 2XAJA 1XN7A 3P9KA 3BJ6A 2CGPA 3WTXC 2F5DA 4EGZA 4G9YA 2O03A 1G3YA 2EJRA 4OMZA 5BMZA 2RQPA 4LGWA 2HEOA 5E8GA 4BAYA 5JHUA 1HXDA 2FE3A 1SAXA 2KIUA 2LF8A 1BM9A 1FC3A 4UVAA 4EMSA 3ZMZA 2OQGA 3MZYA 1S8NA 4Q5SF 1O3SA 2QM3A 4OIRF 1BI0A 4M73A 2XV4S 3GEZA 2VOPA 3SZTA 5DV5A 3KLOA 2W57A 3E5QA 3FXRA 4YIFA 1MD0A 3IL2A 4CZZA 1RIOH 4CGZA 2XVCA 4RAYA 1U5TA 2ZKZA 4KIBA 5LHIA 5DUKA 1T0FA 4Z2YA 5D8KB 5LRSA 4NHJA 1D8JA 1Z9CA 3WU0A 3I53A 2XGXA 2XKOA 3CTAA 1OPCA 3HTUA 1FOKA 2XAHA 1D5VA 3DV8A 4G8XA 3LA2A 1SD4A 3K1PA 2L54A 3SXYA 3CJNA 1Z05A 4H0EA 2VBWA 3KZYA 2OBPA 4HDVA 1ULYA 4KICA 1R7JA 1Y0UA 2ESNA 1GXPA 4I7HA 3BROA 3W6KB 3W6JB 3J80Z 1GVJA 4ETSA 2A07F 2PEXA 4CYDA 1O7FA 3C1DA 1W7PA 1LJ9A 3U2RA 3TQNA 4HV5A 2HQNA 3T8TA 3WTWC 2Z33A 4ENJA 4CO8A 2UWMA 3NRVA 4KN7X 4I01A 3QPTA 2EWNA 3GO5A 1YIOA 1E17A 1I5ZA 2H94A 3GZ5A 5EEGA 5TRDA 1W5TA 1GXQA 3F8FA 1KQ8A 4EM1A 2WTEA 2D1VA 1Z91A 4WCGA 4LB5A 2H27A 4YG2F 2DT5A 5L3DA 3QOPA 3F72A 4I0AA 5DUIA 3CDHA 4LJZF 5BPDA 1BI2A 2KJBA 2VBZA 4ON0A 2ETHA 2F5EA 1WSUA 2W25A 5CVIA 1R36A 4FT8A 4XLNF 4NB5A 2ZJ2A 4L0ZB 1F4KA 4O5VA 3K1NA 3J81K 1YG2A 2G9WA 5D8LB 3C7JA 2ZMEB 3JW4A 3ROUA 4KIGA 3EQLF 5E1ZB 1YYVA 3M8EA 1FBSA 2FEZA 3ABTA 1UHWA 4HLYA 1IN7A 4PZJA 4G6DA 1SFEA 3RTRA 2Y75A 1B9NA 2VONA 2EFQA 2E7XA 4A5NA 5A2QZ 3V8KA 2UZKA 3GW2A 4FHTA 2GA2A 1HSTA 4WXHA 4Y17A 4PGHA 1S3JA 1FT9A 4P9FA 2DU9A 4L9TA 1FYMA 4EJWA 2PI0A 3COAC 5K5RA 4M9SA 2O61A 2PMHA 1U8RA 1P92A 3QRFF 5E18F 3R0JA 1G3SA 1O7LA 3KP7A 2IRFG 1IN8A 5CLSA 3ZN1A 3KP2A 3IWFA 1MZBA 3KEQA 3T0YA 1LDKB 2KIFA 5DCMB 2IVMA 2A6HF 2QZ8A 1P2FA 3TKYA 4HF1A 3E5XA 2PQ8A 4IRIA 3HSRA 1L3LA 2V6CA 3EYYA 1HKSA 3TO7A 1USTA 3EDPA 2MBFA 5D6EA 4UXNA 4BNCA 4I0BA 5EEHA 4M72A 3QP6A 4GXOA 4BHCA 3HTSB 1E2XA 4A2UA 3KE2A 1Z6RA 4MEYF 1KGSA 4OINF 1H9GA 2OAZA 5AIPA 3ELKA 4U0VA 4DQ2A 1FP2A 1F1ZA 4A0XA 1ZN2A 1XSVA 3FF5A 1TBXA 4WXDA 2M1BA 5IT9Z 1S7OA 1YW7A 1STZA 4TV7A 4QWQA 4U0WA 3JSPA 2PG4A 2ZFWA 1O3QA 1WQ2A 4MTDA 3KP6A 3VEPA 1KU7A 1CF7B 2X0LA 5ICCA 2GAUA 5HLHA 4RB1A 2A5YB 4BQAA 4N0BA 3VB2A 2TDXA 2DPUA 3DKWA 1HQCA 1KU9A 1PUEE 2HYGD 4ZYHA 1ZRCA 3EYIA 1SMYF 2PN6A 2JPCA 1ZHFA 2Z9OA 3WODF 4G6QA 1FNNA 4A6EA 1U6GA 4EQQA 3H3ZA 4LLGF 2VE8A 1ZH5A 1K6OA 3RKYA 3OV8A 1W4MA 3FMRA 3RI4A 2V1DA 4BXUA 2FBIA 2Z5UA 2FOKA 3F21A 4P5OA 3BDDA 4M9ZA 3J80K 4OIPF 2KKOA 1R22A 3DEUA 4PCQA 3RJPA 3GFLA 2FNPA 4UVBA 1YS7A 4JK1X 3DPLC 5K5OA 3LA3A 4DNCA 1ZG1A 2XRNA 1JGSA 2STWA 4L5IA 1SD7A 1JHHA 4IJAA 2G7UA 3RPQA 5HDGA 2IJLA 3WE2A 1TW3A 4KN4X 5ICFA 3BZ6A 1BI1A 3MZHA 2VC1A 2ACJA 4LG0B 4KMUX 3U1DA 3TOAA 5D4RA 4WX9A
chains in the Genus database with same CATH superfamily
3CESA 3BTIA 4RB0A 1SVMA 2E7WA 1FBQA 2EZHA 1ITYA 2PBIA 2NXNB 3GCMA 4U7BA 1KYZA 3HOUJ 5D5WB 6PAXA 2OTJI 1UMQA 1ETKA 2M4GA 1MBHA 1LEBA 3O2PE 3ZQGA 4U7DA 5FKOA 1AA7A 1TZLA 4YFKF 3AAFA 5J1RA 1KU2A 3D0SA 1QPIA 4XORA 3I64A 2JSCA 3HDDA 2CQKA 3J7ZI 1QZZA 1ZG5A 4A3IJ 1KU3A 2MH9A 5JVTA 3IKTA 4XKCA 4RBOA 2LOOA 4AYBA 2K40A 4F92B 3JRHA 1MNEA 3HIFA 4O6JA 1VQ9I 1XSXA 1TNTA 1V54H 3CUQA 5CVUA 4DW6A 2JSPA 1RZ4A 1FPQA 3I0TA 2H6BA 3MFKA 1BN5A 3K4BA 2ZXIA 1KQ9A 3S1NJ 2PJRA 2WAFA 4LITA 3ZQFA 2Q2EB 1NHAA 1H88C 3CCJI 2L3DA 1Y8RB 2W82A 3TL4X 2EH3A 3QQAA 1LQ1A 2FMYA 2V9KA 3OYKA 3D1NI 5E17F 4OMYA 2JA8J 4CCKA 3I4PA 4CYCB 2HYJA 5HVQC 3OOPA 4HF0A 2XAUA 2IW5A 3Q3SA 3Q9SA 1FSEA 3ML6A 5A2QK 3B73A 4IOCF 3VSKA 4NDLA 2R7FA 2QYOA 5LRRA 1A36A 4XKVA 4AIJA 2L2OA 1S7AA 2L5QA 3HHHA 2O8XA 5M5WJ 1QVTA 5FROA 2JPBA 2GWRA 5D4SA 2LBFB 2X85A 1IZ1A 5LGNA 1UFMA 4LIUA 1MMNA 3GX4X 4XRSG 4WXCA 1D0XA 4HX4A 1W7PB 2R7RA 3PO3J 1PVEA 2VT3A 3OYAA 5IT3A 2ZJQF 5IYDJ 2VKVA 1FTTA 4L9NA 2DA6A 3RQIA 2L7KA 1HKTA 2NVUB 4D5CA 2YSRA 2I5UA 4WWCA 2XASA 3WTZA 4PSXA 3CC2I 2LY1A 1X3ZB 4E7ZA 2P4WA 3VWBA 4NC6A 2QBYB 1JTXA 1NG6A 3IAS2 1DUXC 5DTDA 2HR3A 1TWGJ 2NRAC 2F4OB 2DMQA 2VKDA 1VTNC 2M7AA 4EM2A 1UG0A 2Y48A 3HKZA 2RDPA 5F64A 2JUGA 3GUDA 1LE8A 2M87A 1Q1HA 4BJ5C 1TW2A 1MW7A 2B0LA 4ABZA 1AKHA 2IS6A 5JI6A 2Q0OA 4DYQA 1ZQ3P 1MDMA 4F7ZA 1XMAA 4LMYA 4UNOA 2K02A 4WF2A 4IOAF 3BG9A 1HW2A 2HKXA 4B43A 1TWHJ 3V4GA 3I59A 2EIJH 3BTCA 3HRSA 4HQEA 4I99C 4BEHA 1J59A 1HA8A 2WB1N 2JK3A 2LMDA 3VYRB 1JHFA 1J7KA 1ETVA 1MBFA 2COBA 3FMQA 4UV8A 1BI3A 4BXFA 1B59A 1ZYRF 3KEOA 4QPOA 3F8NA 3KYCB 3KP3A 2X9DA 3LOCA 3H0DA 4Y52J 3L09A 1FYLA 1T38A 1TT5B 2CO5A 5L3CA 2R5ZA 2IS1A 4KT5C 2P5KA 2R5YB 2OC6A 3H36A 2MD0A 3RIRA 4Y13A 1VQ6I 4ZYEA 1B72A 2EFWA 2KRFA 2AO9A 3CF2A 2R7UA 2P5LC 2LH9A 2FA5A 3A2KA 5IT9K 1LPQA 2WY7Q 2Z1DA 1UHMA 5F0CA 1R5GA 1WZ2A 1ZG3A 4KIFA 4YFNF 2M45A 2WV0A 3QU6A 5GAHJ 5ILUA 3H35A 1JKOC 1JXSA 2ZXJA 4A3KJ 2GOMA 1K78B 2ADUA 2QUFA 4S04A 3FMSA 1FWZA 2QWWA 3ABKH 4MTEA 1BIAA 1XTAA 3O8GA 5JFRA 1KQ0A 3CCVI 1O3RA 3AL0C 1K83J 1HDPA 2ID3A 4WK8F 3K70C 3E1SA 4MQVA 4NQWB 3RSNA 2VODA 4YIIA 2P6TA 1QNTA 4IHYA 3ASNH 3MN2A 2PLYA 4PDKA 2D2WA 2VQGA 1B9MA 2DDAA 4PGGA 1D0ZA 3BOQA 1RKWA 2BE5F 3REOA 4LLNA 2W1OA 2R7VA 3QAHA 2JA5J 3ZQIA 2EQRA 2OU2A 3QPLA 2DPDA 4UY8I 1G3WA 2L9NA 3K9TA 5LD2C 1YJWI 2EZLA 3TW7A 2NAZA 5J3LA 2FU4A 4UV9A 4LLLA 3DTIA 1YTYA 1ZGWA 1D3YA 3RQ4A 1P4XA 4KUMA 3A0BC 3KZZA 3TOBA 5ICGA 5IP7J 2EFPA 2ZMEC 3OYEA 5JR3A 3LSPA 2JVGA 1ERDA 1MMDA 2HNHA 3FXQA 2ZSHB 3CJRB 1WRJA 3ZN0A 1TWAJ 4OWRB 2CWEA 3C3WA 2Y0MA 1IXCA 1OCOH 1BC7C 2JT1A 1XMXA 1JT6A 2JUCA 3WGHA 3DTKA 3FZVA 1GUUA 2KRCA 2L7MP 5FRNA 2YU9J 4RM2A 3ZQLA 4BBSJ 3QOEA 1ON2A 2JVHA 2X4HA 1R1TA 4D1QA 3E5UA 4HDUA 1G8XA 1WI3A 1Y56A 1V55H 1EV7A 2XHKA 1EH8A 1YQAA 2I10A 4IQ4A 5BQTA 3LSKA 2LNBA 3H9QA 4FX0A 1HCRA 4FETA 5D5VB 1HSJA 3GFIA 1R71A 2DAOA 1RUOA 3FKJA 2A6EF 4HPQA 1VNDA 5FLVA 5C3EJ 1J0RA 2MSYA 4A3EJ 3G3ZA 1JKRC 2L02A 5IOYA 1LVAA 1D8KA 2PJPA 2L7FP 4BKXA 1T2KA 1X3UA 2VQHA 2TCTA 3RCOA 3DLAA 1MNMC 1WVRA 3ZOBA 3EETA 3OS2A 2YX7A 5LEJA 4U87A 3CD6I 1EH6A 2CQNA 2O8KA 1FMVA 3M9AA 2QVOA 1IRFA 2X6OA 3DF8A 4HNUA 1K4SA 3WG9A 3S1MJ 3SQNA 3GTGJ 2CQ7A 3S93A 4C3HJ 1R00A 5C44J 2LKSA 2JTVA 2DODA 5FGMA 4BHBA 4IO9F 2LG4A 4M71A 2VQCA 1YRNB 2COMA 2KPMA 2UUZA 1G59A 1IUYA 2MYSA 2FMLA 1ZARA 4B4CA 4JX4A 3F6OA 2K7LA 3SEQA 1MJ9A 3F8BA 1E3PA 4RAZA 4UUVA 1SMTA 5LHGA 1J2XA 2RGVA 3CCYA 4G6TB 2FSWA 3GMEA 4DZPA 1XGOA 3A01A 3GYHX 3LSJA 3T5XA 2M5WA 4DBQA 5B5EC 2VE9A 2DK8A 2UXXA 2LKXA 3ONQA 1WJFA 2R7QA 4MO7A 4ASNA 2NVTJ 3D5LA 3BG3A 1HDDC 4EM0B 3F23A 3S3NA 2W48A 2FF4A 2R3SA 4A3JJ 5F0FA 1QO0D 3K4LA 1UB9A 3OL4A 3CUOA 3JAMZ 2XKPA 4CUGA 5E3OA 2ISYA 1DPUA 5KVRA 3MKYB 4E7HA 3MMYB 5IPAA 4IHSA 1FZPB 1DU6A 2DFIA 2E1NA 1MSEC 2H8WA 2P7CB 5D5XB 1R58A 5DM6F 2QKMB 3GTKJ 5M5YJ 3OYNA 4OIQF 5E79C 3V8LA 3DPTA 1P7IA 1U9OA 3BR1A 4W97A 5KK1A 3A03A 3ZP5A 5EGOA 1X4PA 1ETXA 2CG4A 3ZMSA 4BH9A 3MD2A 1T8IA 1FSHA 4PFOA 2CYYA 1KYWA 3PM1A 2F48A 2DDBA 3OYFA 1DGRM 2O9LA 4BUPA 4XSXF 3OIOA 3JRIA 2FXAA 4ZH4F 2M0MA 3Q5FA 3GF2A 4KNYA 1SD5A 5H6RA 1MBJA 2OCEA 2P81A 2PFBA 2YS9A 1LUJB 3X2QH 2ISZA 2M8EA 1IDZA 1YLFA 4EJTA 4HEA2 4YFXF 4X0GA 1A35A 3B02A 5CYVA 3S2DJ 2JA7J 4OIOF 1ETYA 4LK1F 3FKIJ 5HDNA 4BHPA 3SHFA 3TDZC 2CV1A 4HX8A 2HFHA 3ECOA 1MH4A 3I4NJ 3CZ6A 2MLKA 2R7SA 5GTHC 3MEXA 2P7VB 1VQPI 4AC0A 1FP1D 2OV7A 1WPKA 2XB0X 3VOEA 1FBUA 2BVMA 4KFCA 2HVQA 1VF9A 4IHTA 1CQTA 3JSOA 2ESHA 1F36A 5DCFA 1P9QC 2Y2ZA 4LB6B 1Y1WJ 2ZO4A 3H5RA 4B8XA 2LKPA 3DWLE 5J6XA 2D1HA 4R79A 4N9IA 3WGIA 2DLLA 3VDXA 2XDVA 1QU3A 3OR1C 4MNUA 4RGRA 3BCBA 1R5ID 3CLOA 2Y9ZA 1MSFC 2FD5A 2E1MC 1U2WA 2CFOA 3HKZN 1OCZH 2HKOA 2EIKH 1QBJA 1SVOA 2E2JJ 4OOIA 4RGSA 1YO5C 4XN3A 3I56I 2P8TA 2VXDA 4XMYA 5HNFA 3S2WA 3AG1H 2MLGA 3F6VA 1K7AA 4XL9A 5LBQA 1IG7A 3GTQJ 3DP7A 4FX4A 2CJJA 5CPRB 1QGPA 4IF4A 4IHXA 4RGUA 1RETA 2HTJA 2CUFA 4GO1A 2EBIA 5FKMA 4BY7J 4DYRA 5LGUA 3LMMA 2QQ8A 1QHGA 3QP5A 2E19A 4XLAA 2KLOA 1DP7P 2ZBKA 2V1XA 4IKFA 4CXFA 2VL8A 3CQZJ 4P9UA 2ZMEA 3HHGA 1IRXA 3DXJF 1IXRC 2ICWG 2ZCWA 2ELKA 5KAIC 3BTLA 3HRMA 3J7AO 1PP7U 3HUGA 3R6SA 4G7HF 2X6WA 2DXIA 1Q1VA 4DIQA 5FLXZ 4M6VA 4D7MA 3LAPA 2BBYA 1ZLJA 1S29A 4A0ZA 3WG7H 1B1BA 2DQLA 4C2MJ 1BC8C 2VJJA 2MA3A 3GFJA 4G7OF 2W00A 3F22A 1WH5A 3NEUA 4AIKA 2RAEA 3EUHA 4LOCA 2P6SA 3IP4B 1H0MA 1BA5A 1G4DA 2KL4A 3UNGC 2W4SA 5J40A 5E20A 1W5SA 5JLWA 2HTSA 4I09A 2E1MB 3ABMH 1FYKA 5C4XJ 1MH3A 1NG7A 4IPAA 1VQ8I 3OYLA 1R49A 2A61A 5EG0B 2KQRA 4RS8A 2XAQA 2B9SA 3HSFA 4V19K 1GHCA 4GRIA 5B1AH 4A5MA 3FWEA 4HA8A 5FRMA 3DU6A 1LEAA 1OQYA 5F6FA 3WE3A 2BEOA 3GTPJ 1WI9A 4HBLA 3L2CA 1WKMA 1OKRA 3KIOA 2KJCA 1IN6A 5J1UA 5FKNA 1OMIA 2Z99A 3ABLH 4L9JA 1T39A 5FKLA 3CDIA 2QF7A 5BOXA 3OOUA 4Q48A 3GXOA 4A12A 1I6HJ 3P5JA 5F04A 1U5TC 4XIDA 1J75A 3KZIC 4KDPA 3CCUI 4UVCA 1X1AA 3OSGA 1B8IA 1U78A 3KCCA 1N25A 2E36A 1A04A 4H4KC 1ORKA 1T0FC 4JOMA 4EJVA 1HLVA 4XR6A 5FD6A 2LY2A 2DYSH 2W85A 2HGCA 3BPVA 2JZYA 1V3FA 1Y39A 1YW8A 3KYDB 2BY3A 2QENA 2EV5A 2LP0A 3SEZA 2GA1A 3OYMA 3TGNA 4AD9A 2MW8A 2EK5A 2R7DA 3F9KA 4BACA 1YFHA 1LB2A 4XRMA 2IEKA 2F2EA 2QQAA 3ERMA 5E3NA 4J00A 1U0JA 1R23A 4A3GJ 3BQYA 5TGTA 5BNGA 1M1EB 4HYEA 5LGTA 3OYGA 1TL8A 4Y7NJ 2V6EA 3VFZA 4JX5A 2AS5F 3JTHA 4HNTA 1RRJA 5FFXA 4A3MJ 3ISPA 1ZREA 2XAGA 4I98B 1SANA 4ENMA 2BW3B 4P1WA 2WY8Q 1XGNA 4BXXJ 3LNQA 2NYXA 3SJMA 2GZWA 1Z21A 2VOOA 2O6GE 3I54A 2CW8A 2L0KA 3ABUA 1YS6A 4IRGA 4C3IJ 2IT0A 1U9NA 5CJ9A 3BJOA 2EFNA 2MC4A 3GLLA 2QQ9A 2JJ7A 4KMFA 5IYBJ 2ZC2A 3A0HC 3HOWJ 2HWVA 3KP4A 3BLYA 4HG2A 1YW9A 1U5TB 5J8CA 2W84A 5DD8A 4HRIA 4NNJA 3GTMJ 2KISA 3H3UA 1IV6A 2YPRA 2RN7A 5DD4A 2RVCA 1P7JA 1W1WE 3DKXA 2K5CA 5JLXA 1FY7A 1DU0A 3G1LA 3R0AA 1OYWA 2KT0A 3HOTA 5DDGA 3E7LA 2HPMA 1CF7A 3WGGA 3S15J 2K4BA 2Z2SB 1VQOI 3CO6C 4F55A 1JJ8C 1B72B 2OZUA 3BPXA 2VPLA 1HW5A 1Z3YA 3FBIB 2DFFA 1H8AC 1W36C 3R60A 3MQ0A 5ERIA 2H1LA 3D5SC 2DMNA 5E1XA 4CICA 4GYIA 3ZQ7A 3N97A 2Y69H 3I55I 4HZFA 3IKVA 3K6GA 2QEXI 2DO7A 3RKXA 4ZTFA 2LYCA 1XDSA 1RPWA 2IGNA 4KT6A 2HZDA 1RNLA 3RYRA 4D0PA 4AIHA 3JAMK 2DMTA 3KETA 1OISA 1JT0A 3BY6A 4L9VA 5FB2A 1ETOA 3PNVA 1GT0C 1G3TA 4EV0A 5L3FA 2A3SA 4XLEA 1XB4A 1BW6A 1KA8A 2NS8A 3PSIA 4BE0A 4ENNA 3ULQB 3RZOJ 4B3XA 1D1BA 2HYFA 3P9CA 1FMWA 1SFUA 5HODA 2DA2A 4PK4A 4DOZA 3S32A 2ID6A 2A68F 2L4AA 2WAQN 4E7JA 2E5NA 3PUFA 2DA4A 2VKHA 3CDLA 3GLXA 2YUSA 3PQKA 4PJLA 3VODA 3JRFA 5K7ZA 2EA4A 1V5GA 4ESFA 2JWTA 3G73A 4XOTA 3V8JA 3ASOH 3GWZA 3FBNB 4B1RA 1HBXG 1X19A 3DPUA 2VBYA 3TDUC 3MKLA 1IAWA 2MGQA 1F43A 1LFBA 1OCRH 2CMPA 2V1NA 2E60A 4GYGA 1FLIA 5GAGJ 3FXOA 2DTRA 1XD7A 2K3PA 3W2VA 2CV0A 1MBKA 1WHUA 2GXGA 5HDKA 2C6YA 1ZELA 4M74A 4Y33A 3UKGA 4IVNA 4S0HB 5K7HA 3HYIA 1FOXA 4XQFA 1UHSA 1Y0NA 5EZHA 3JRBA 3PNTA 3H5AA 2Y0SN 5KCMA 2DTZA 1HW1A 4JQFA 2DJIA 4B3AA 3KYLA 2R7XA 3CO7C 2DI3A 1TQMA 2MC3A 1D1CA 3BR0A 3QU3A 2BYVE 4HAMA 1JE8A 4GDFA 4N4OB 2BY2A 2XIGA 3K2AA 5H20A 1XPXA 2EA2A 3S14J 2IS4A 1NK2P 2FBHA 3GTOJ 4I02A 3R4KA 4A3BJ 1ZRDA 5DEQA 1YHQI 3RKWA 4LG0A 1G6NA 2JMWA 4PJ0C 1V5EA 2XRLA 5ILVA 5BS6A 2DQRA 1XCVA 1F9NA 4I2OA 3J7YJ 2V9VA 3ZMDA 1USSA 3O3KA 2WC2A 3VPRA 1SFKA 3WTTC 2PMZA 3IUOA 3ZQHA 5K5QA 2H09A 3DBHB 1IN4A 3J7AY 1P4WA 2QCOA 1T98A 1R1VA 2DBBA 2EV0A 3V7CA 3KP5A 5L3BA 1Z3XA 3Q9VA 1F5TA 1W7PD 3BR6A 4BDZA 3HG9A 3HOSA 3M8FA 4YELA 1MIJA 1AU7A 3FM5A 4FASD 3GZ6A 2DA3A 2XPVA 4IZZA 4MQ9F 2IA0A 3L7WA 3ZMTA 3UR3C 2JA6J 1Z1DA 1TP4A 1X2NA 2CW7A 4M9XA 1A6QA 2L7ZA 2A5WA 1MMGA 2ZB9A 4NUBA 2RKHA 3V7RA 1B4AA 4G94A 3CF5F 5FLXK 2LDUA 2Q2EA 2DT6A 3Q0UA 1T6SA 4B47A 3T1BA 3L9FA 3AG4H 4XLPF 3ECHA 1OR7C 2E5ZA 4RB3C 3SFZA 2Y30A 5L3EA 1Y1VJ 4CYCA 1OCCH 3RYPA 3CCMI 2H1KA 3PFIA 1QHHD 2YX4A 4HW0A 3CMEI 5IY5H 2HVRA 1R4MB 3N05A 5FD5A 1BOAA 4XLCA 1TLHB 4Q4ZF 2LR8A 4CCJA 2LFBA 1XSDA 5AONA 4PJNA 3LQRA 5F08A 3E3VA 4E70A 2LBFA 5IYCJ 1LDDA 3MAJA 3DCFA 2CFXA 1MBEA 2EILH 2STTA 1IXSB 2HDWA 4PUSA 3QPSA 4ESBA 2V79A 2WWYA 5HLIA 3EPZA 3G2BA 4KYWA 5FO5A 1IRZA 2R7ZJ 3HPGA 2BXZA 5HNHA 1VZ0A 2IA1A 2DT7B 3BTJA 3PUBA 5F1RA 2R7WA 1K79A 3K2ZA 1AWCA 4XONA 1TNSA 3HL2A 1WCMJ 3U21A 5ED4A 4MFEA 2EIMH 4P55A 1IDYA 2NNNA 2A69F 3GFMA 3LFKA 1Z0XA 3OYHA 5FLMJ 2QBYA 2KIMA 2V1UA 3GVAA 3B6CA 1S6LA 4ZYDA 2W7NA 3QPHA 2L01A 2RNJA 1L0OC 1X2MA 2KZVA 2E71A 1WJBA 2XUBA 4IRHA 4Q47A 4A3LJ 3G71I 4S05A 4RDUA 1QQIA 2QLZA 4IHWA 1MGTA 2GIVA 1TQIA 1REPC 5DM7F 2LY9A 4HV6A 2VJ4A 5GP9A 4HF2A 1OYYA 4M6YA 2IGMA 3HBLA 4EJUA 1X4OA 3SDBA 2FBKA 4FQGA 4I76A 5E3LA 4GGGA 5CQGA 2ELJA 5IOZA 3FIWA 2L9RA 3CCQI 2VT2A 3ZQCA 5FJ8J 3H9GA 4IEJA 1G2HA 2HS5A 2KRHA 2MH2A 3LA7A 1BIBA 4K2EA 1OCPA 3VYSB 4ZZLA 2GQQA 3ZMVA 2IA2A 1PJRA 3WU2C 3JREA 3ZXSA 1AHDP 2GLOA 3QYBA 4PFPA 3FXLA 5L3GA 2M34A 3PJRA 1QZEA 3OIQA 4XM3A 4J19A 4BGDA 4UUSB 5FKKA 3ERED 4HOBA 5TJJA 3CJQB 1Z7UA 2DOAA 4U0YA 2R5YA 2HXOA 5GADJ 3Q0VA 3I5UA 3M3YJ 3BP8A 3IC7A 5JHFA 1J5YA 1IRGA 2M4KA 4ZYGA 5HS9A 4X6AJ 1IJWC 1YITI 2EV6A 2V4JC 1ZAOA 2DA5A 1WWXA 5KAFC 5BPIA 3NQOA 1SFXA 1LDJA 4EVIA 2XROA 3JR9A 3DQVC 4AYBN 1RKTA 1K78A 3IHUA 4GFBA 4E7SA 2JRTA 1RUNA 1DDNA 4YIRX 3LSHA 5ILSA 2L9VA 1TQPA 1U3EM 3ZCOA 2AXTC 4CCMA 2IXSA 5LHHA 3FHZA 3IRQA 3HRUA 2NS0A 5K1YA 2J5OA 1MKMA 4NQWA 3OYCA 2E1CA 3I3LA 3TP3A 3KLNA 5HS7A 3K70D 3WTSC 1EJ9A 4ESJA 4KJZA 2D45A 2ME6A 4LG3A 4CDGA 2ZNZA 2GXBA 3OYIA 1JUMA 3DKYA 3LSTA 5CVVA 1MBGA 1DQUA 2BHZA 2DYRH 5IP6A 1MMSA 3SDGA 2DK5A 2KP6A 5CVJA 2XSDC 3FK6A 5HLTA 1O57A 4EEFG 4AU7A 4QLCU 5GTIC 3C2BA 3BWGA 4CSWA 4ZTJA 2R7TA 2EINH 4ZDLA 2RNGA 1W0UA 1J9IA 1WFXA 1A5JA 4XKWA 2VN2A 2PMUA 1S72I 2CU7A 4G12A 4A0YA 2UXNA 2LF7A 2XB5A 3O8HA 1LVKA 2GBYA 1Y6IA 3HGGA 3PSFA 2MABA 2XSJC 4II3A 2QQBA 1SFOJ 1ZR2A 3S16J 2BOLA 4GCVA 1UCRA 2QSHX 4HX7A 4R8HA 4E6KG 2OZ6A 4LD5A 4Z6YA 3JTGA 1ODDA 5LEKA 4RAFA 3K4NA 3S3OA 3HOYJ 4CCOA 5AIQA 1MJAA 3M07A 1NH3A 1FIPA 3PO2J 1BJAA 3FXUA 4O3MA 2VJ5A 5H6QA 1QPMA 4G7ZF 1ZRFA 4HLXA 2NNYA 1PP8F 4L5JA 1FX7A 2DOFA 1JI8A 1IW7F 2YR2A 1IUFA 2FNAA 4D9JA 4AVPA 2DFEA 3CUQC 4CCNA 1BJZA 1WJEA 1P4AA 2HOAA 5FFZA 2FRHA 2EFOA 2A6TA 3FK7A 3TMOA 4DYCA 5HS8A 2BY1A 5D6FA 3BG5A 1OR7A 2RC4A 1MNDA 2RV8A 3FM3A 3H92A 2JQ7A 2HOEA 3IWZA 2XF6A 4B48A 1JKPC 1VQ4I 4M3DA 2DW4A 2EB7A 4V2GA 1JUSA 1IC8A 3CP2A 2FX0A 2IGKA 4RGXA 3MWMA 4ENKA 2NVXJ 3E6CC 3K0LA 4OU0A 3R61A 2M8GX 1AOYA 3S8PA 1ETWA 3S3MA 3E6MA 2DA1A 3K10A 4F52A 1A31A 3LWFA 1T95A 5J1YA 1ZTRA 4C2UA 3TO9A 4E4HA 4ZYAA 4HSTA 1YRNA 2K86A 3T8RA 3RPUD 3LL7A 1X1DA 2CW0F 4HQMA 4BDYA 2LREA 4AVZA 1WJCA 1J09A 2PMZN 3WU1B 2RREA 4IQJA 3BQZA 5M3MJ 2HI3A 2Z16A 1E3OC 4E7IA 5EYRA 2NOJB 1O3TA 4BE1A 2R4GA 1I50J 4EJOA 1EH7A 4M3FA 1RESA 2AXLA 1YIJI 1DPRA 1LFPA 2OD5A 1LFUP 1VQ5I 2PX9A 3EUKL 1HC8A 4CCLA 2GXAA 4AUXA 3CUQB 1LNWA 2VBXA 3BR5A 1I6XA 1E3HA 3LSGA 4AWXB 1R5HA 2F4IA 5DYMA 4R1HA 2G7HA 2LSOA 4MEXF 2PJRB 5D5UB 3U9GA 5J4YA 2M30A 2XAFA 3GTLJ 2BGCA 3BT9A 3SZGA 1YX5A 2DCEA 2VXZA 3FXKA 1U8BA 5CVRA 2J5PA 4FISA 1IV8A 3ZMUA 3M7GA 3OYDA 3HZJA 4A3CJ 1P6RA 2W24A 4MGRA 2M9HA 1ACIA 2CRGA 1SD6A 3M1CA 3WTVC 1JJ6C 1OJLA 3E6DA 3SZPA 1MJBA 2F5FA 2RQQA 1H89C 1ZR4A 3DFGA 1QA6A 3CC4I 2VI6A 4ANJA 4NBQA 3RPUA 4OAZA 3L2WA 1SEUA 2DJNA 1Z6TA 5DCMA 3H9JA 1PUFA 1HF0A 3CCLI 4RMNA 2BV6A 1TT0A 4XKBA 3WTYC 3BG7A 4N9HA 3I58A 2F5CA 1IF1A 2OF7A 1PDNC 3O6BB 4IXAA 2O7OA 2QA4I 3V7SA 3BJAA 2K9LA 1ON1A 1X1BA 3F8MA 2XPWA 4U88A 4BY1J 1OYIA 4KA4A 3RDIA 4B09A 1HKQA 4YRVA 1APLC 1XGSA 2L4MA 5GAEJ 3KPHA 2HDCA 3W6VA 1GVDA 3IH2A 2ZXWH 3OS1A 3E97A 2H6CA 2OA4A 5J8FA 2OTLI 5E8IA 3CMMA 3KFWX 3HGYA 1TTYA 4J01A 4ZC3A 1I1GA 2O0YA 2CUZA 2OQRA 4XRFA 3HSEA 2X51A 1LE8B 4MFDA 5M5XJ 1FOYA 1B6AA 3N4MA 2F4MB 4OAYA 3M1EA 4Y3OA 5J4VA 2ZJPF 4L18B 2BHYA 1T56A 2GOXB 3L00A 1AKHB 2N8GA 3F3XA 4LFUA 4DJAA 4I6ZA 1ZLKA 4QTRA 1MDMB 1ONVA 1RC9A 3L2UA 4LK0F 3J81Z 1C0WA 3I4MJ 2IBDA 2YU3A 3ZPLA 3DLLF 1IN5A 4BYYA 2DOEA 3I59B 2HQ5A 4KITB 1TWCJ 2IPQX 1I3QJ 1ZGJA 2K85A 3I71A 1I1SA 2XGEA 5M3FJ 4BEHB 3C18A 4M6XA 4CHUA 3P7NA 1BBYA 1K61A 4MHGA 4XBFA 3IRRA 2XF5A 2M3AA 3S17J 4ZZDA 3HRTA 3F8CA 3K4JA 1RI7A 2ELHA 4AM3A 2IP2A 4E7LA 3OYJA 2GM4A 2FQ3A 5E1WA 5CKTA 5K7FA 2R92J 2LK2A 4P96A 4RB2C 1TC3C 1FTZA 4XSZF 3AKZA 2LLKA 4UB8C 1W0TA 2R5ZB 2Q8KA 3EUAA 3K69A 1R1UA 4RLQA 1K4TA 2CSOA 2LVSA 1XMKA 4X1EA 1YJNI 1CGPA 4C30A 3PQJA 2R7OA 3AG3H 3BG6A 2HQRA 4QSHA 3E6BA 2K27A 5DS9A 2JRMA 1OLTA 3L2RA 1ENHA 1XDUA 2ZNYA 4ITVA 2Z3YA 5HOOA 4EGYA 2HZTA 4A93J 3FX3A 5EG0A 4UHTA 1SVLA 2VC0A 4L0YB 5B66C 1H9TA 1XCBA 3HJEA 1WJAA 1V4RA 2X1DA 5J47A 4D7NA 3LAJA 2P5VA 2O3FA 1Z7LA 1ZGAA 2M7BA 3CJTB 3BR3A 5LLQA 5B1BH 3K1MA 4JBAA 4Y15A 2ZJRF 4NC8A 2NVYJ 1OCTC 2VKEA 1JGGA 1XGMA 2ECBA 2MD5A 1WJDA 3P9IA 1QZYA 1I27A 1SAUA 3WTUC 5ICEA 5HLGA 3LQQA 1R4NB 4M3GA 3MCZA 3QYEA 4M3BA 1D1AA 2K4JA 3TO6A 4A6DA 4F93B 2XAJA 1XN7A 1JKQC 3P9KA 2XC7A 2F6CA 5C4JJ 3BJ6A 3W3CA 3K4MA 3A4CA 1VQLI 2X1EA 3JRGA 2CGPA 3WTXC 1FEXA 1S9HA 2F5DA 1S7EA 3PIPF 4EGZA 3OWTA 3TW6A 2ZXHA 3VSLA 4W1UA 4G9YA 2O03A 1G3YA 2EJRA 4OMZA 5BMZA 5EF6A 2RQPA 4LGWA 4BS9A 1YJ9I 2HEOA 5E8GA 4BAYA 5JHUA 5TISC 3WHCA 2HOTA 5E3MA 3JRDA 1HXDA 2FE3A 1SAXA 2KIUA 2LF8A 4MLOA 1BM9A 4BJ6C 2OJED 1FC3A 1UG2A 4UVAA 4EMSA 3ZMZA 2OQGA 3MZYA 4C9YA 2CUEA 3DEEA 4M3EA 2LTPA 1S8NA 2VASA 2BXYA 1O3SA 4Q5SF 2E1OA 2QM3A 3GBGA 2CH0A 4OIRF 1YX3A 3OL3A 1BI0A 1XS9A 4M73A 2XV4S 2BW3A 3GEZA 2VOPA 3SZTA 5DV5A 3QODA 3KLOA 2W57A 2HPIA 2XGDA 3E5QA 3FXRA 4LIVA 3OY9A 2KZGA 4YIFA 1MD0A 3IL2A 4CZZA 4UB6C 1VI0A 1RIOH 1DGWY 4CGZA 2LC2A 2XVCA 1VFCA 2XGCA 5EEAA 1DP3A 1YI2I 4RAYA 3HOXJ 2K3FA 1NK3P 4C2TA 1U5TA 2CQXA 2P0WA 4HSRA 2E34A 3G1OA 4CA0A 2E35A 2ZKZA 4KIBA 1BR4A 5LHIA 2R93J 5DUKA 1T0FA 4Z2YA 5D8KB 5KHDA 5LRSA 3TEDA 4NHJA 3K4CA 2H8RA 1E0EA 2FOWA 1N78A 1D8JA 2EZIA 4XICA 3TP0A 1Z9CA 3WU0A 3I53A 3W2WA 2XGXA 2XKOA 2VLAA 3CTAA 3K7AJ 1OPCA 3HTUA 1FOKA 2XAHA 3OMYA 1D5VA 2TRTA 3DV8A 4G8XA 3LA2A 1SD4A 3K1PA 2L54A 3A01B 2HVSA 1W36D 2Q1ZB 4DGWB 4E7KA 3SXYA 3CJNA 3NAUA 3PIOF 3CP8A 4JX6A 5EJCA 4RLFA 1W5CC 1Z05A 4H0EA 4QIWN 2HXIA 2VBWA 3KZYA 2LRDA 2OBPA 1SC7A 5EDNA 4HDVA 2BVLA 2KDZA 4B44A 3B6AA 3MKWB 1ULYA 3F0CA 4KICA 3CMYA 1R7JA 1Y0UA 2ESNA 1GXPA 4F91B 4I7HA 3ZRGA 4BBRJ 3FXMA 2EPFA 3BROA 4FE7A 3DU5A 3W6KB 3W6JB 3J80Z 1GDTA 3S2HJ 4BE2A 5EGOB 1GVJA 4ETSA 2A07F 2PEXA 4CYDA 1O7FA 3C1DA 4IL6C 3OSFA 3QWLA 1UZCA 1QRYA 1W7PA 4BQQA 1LJ9A 2KMUA 3U2RA 3TQNA 4HV5A 1T08B 3MKZA 4HNVA 2HQNA 3T8TA 2O5RA 3WTWC 2Z33A 4ENJA 3M8JA 3A02A 4CO8A 1TWFJ 2UWMA 3NRVA 4PJJA 2K9MA 1BW5A 3MZ8A 4N4NB 4KN7X 1I3AA 3K4KA 4I01A 3QPTA 5KNLA 2QSGX 3H3VK 4A3FJ 3BZKA 2DMUA 2EWNA 3GO5A 4FTHA 1YIOA 5F0HA 1X1PA 4ZDPA 1KZHA 1E17A 1I5ZA 2A05A 2H94A 3GZ5A 5EEGA 5TRDA 1RR8C 1W5TA 3EUHC 1N75A 1GXQA 4XNFA 4BU2A 4YEJA 3F8FA 1O4XA 1KQ8A 4EM1A 1BL0A 1JUPA 2D1VA 2WTEA 4XLHA 3L2QA 1Z91A 4WCGA 4LB5A 2H27A 2DN0A 4YG2F 1WH7A 2DT5A 3QOPA 5L3DA 3BR2A 3F72A 3AL0B 1OFCX 1XG1A 1N77A 2X6YA 3PNYA 4I0AA 5EZGA 5DUIA 3CDHA 3FDYA 4LJZF 5BPDA 1BI2A 2KDOA 2KJBA 2VBZA 3DBLB 4ON0A 2X6XA 4IHVA 3L1PA 2ETHA 3HEFA 2F5EA 1BR1A 1WSUA 2F5VA 2W25A 5CVIA 1R36A 4FT8A 4A69C 4XLNF 3IH3A 4NB5A 2ZJ2A 4L0ZB 1F4KA 4O5VA 3K1NA 4L5EA 2UV1A 3J81K 1YG2A 4F3QA 2G9WA 5D8LB 1UJ8A 4DZJA 2NVQJ 3H0GJ 3C7JA 1EKEA 4XLFA 2ZMEB 2VIXA 3JW4A 3HXLA 2HDDA 2B63J 2K9NA 3ROUA 3HUGB 4KIGA 3EQLF 5E1ZB 1A6IA 3C2GA 2K9SA 2FUG2 2OUMA 1YYVA 2FJ1A 3DBRB 3M8EA 1FBSA 2FEZA 3ABTA 1R6RA 1UHWA 4HLYA 1IN7A 4PZJA 2WA0A 2DA7A 2JA2A 4G6DA 1SFEA 3JCUC 3I9V2 4RA2A 3RTRA 4CH7A 2NOGA 3L2VA 2Y75A 1B9NA 2VONA 4RAGA 3SFIA 2EFQA 2HU9A 2ME0A 1KONA 2L9SA 2X1CA 2IS2A 2Y9YA 2E7XA 4A5NA 5A2QZ 1XC5A 3V8KA 2UZKA 3GW2A 4FHTA 2CV2A 2GA2A 1HSTA 4JYKA 4WXHA 4Y17A 4BL0B 3A1YA 4QPQA 3HOVJ 3S1QJ 2VB6A 4PGHA 4AIDA 1S3JA 1X3WB 1FT9A 2V9PA 4P9FA 3JRAA 2DU9A 3HM5A 2KHMA 4L9TA 4XN0A 4FE4A 1FYMA 4EJWA 3V42A 2PI0A 3COAC 5K5RA 4C3JJ 2AQFA 4M9SA 2O61A 1VQKI 2PMHA 2XF7A 2NS7A 3NWSA 2QSFX 3G4SI 2OPTA 2IAIA 1U8RA 1P92A 3HC7A 3QRFF 5E18F 3R0JA 1G3SA 2WAQA 2JN6A 1O7LA 3FISA 3KP7A 4A3DJ 2IRFG 5JVGF 1IN8A 2ECCA 5CLSA 2CS3A 3ZN1A 1V5FA 3KP2A 3IWFA 1MZBA 2ZFUA 3KEQA 3T0YA 3G1MA 1LDKB 2KIFA 2BY0A 2GIZA 3HB9A 5DCMB 3DEWA 5IP9J 1B8IB 2IVMA 1PUFB 2QKLB 2A6HF 2QZ8A 5F1JA 3GZNB 1P2FA 3TKYA 4HF1A 3SYTA 1FOWA 1BR2A 1MMAA 3HPHA 1D5YA 2WBMA 3E5XA 3IV5A 1VQMI 2PQ8A 3IH4A 3PL8A 4IRIA 1FJLA 1Z67A 3HSRA 3FXJA 1L3LA 2M2EA 4CZCA 1GV5A 5F27A 3CCEI 2V6CA 2EZKA 1HKSA 3EYYA 1IO2A 1EA3A 2B7EA 1USTA 3TO7A 3ESWB 3LSRA 3EDPA 2MBFA 3RKQA 5D6EA 4UXNA 4BNCA 3MVPA 4I0BA 2D5VA 5EEHA 4M72A 3QP6A 3CCRI 4GXOA 4BHCA 2Y0SA 3HTSB 1S5LC 4JP0A 4II2A 4BJTA 3PFYA 1E2XA 3JRCA 2K9QA 9ANTA 4A2UA 3ZGKA 2AHQA 1VQ7I 5GPAA 3QYFA 3KE2A 3H1CA 3W2AA 4FCYA 1HOMA 1Z6RA 2WB1A 1KGSA 4MEYF 4NC7A 2V26A 1Z77A 2M0CA 3G6EI 3E0JB 4OINF 1I39A 3WHBA 1H9GA 2KFDA 2OAZA 1GV2A 3ELKA 5AIPA 1ZK8A 2MG4A 4U0VA 1ETQA 1Y8QB 1PYVA 2CQQA 4DQ2A 1FP2A 4UUSA 1F1ZA 4A0XA 4DBRA 1ZN2A 1XSVA 5LFAA 4KISA 3FF5A 3HOZJ 2WV1A 4PSWA 1TBXA 4WXDA 2M1BA 1D0YA 5IT9Z 1S7OA 3AG2H 2G0EA 3OR2C 4RM3A 1EF4A 1YW7A 1R9TJ 2WADA 2VUMJ 1STZA 1GLNA 3OYBA 4TV7A 3TBIA 4QWQA 4U0WA 3JSPA 3GTJJ 1X58A 2PG4A 2ZFWA 1FIAA 3IAM2 1O3QA 3VYUB 5CQEA 1WQ2A 3FHNA 4MTDA 3KP6A 3VEPA 4XK4A 1XX5A 1KU7A 1CF7B 2LD5A 1ZKGA 2X0LA 3U1KA 5ICCA 2GAUA 5HLHA 4RB1A 2A5YB 4BQAA 3LFUA 4N0BA 3VB2A 2TDXA 2DPUA 2VQLA 3DKWA 3OS0A 1HQCA 1KU9A 1PUEE 5GPCA 2HYGD 2FQ4A 4ZYHA 1ZRCA 3EYIA 1SMYF 2PN6A 1YE9A 1ZHFA 2JPCA 1YOVB 2Z9OA 1RR7A 3WODF 4G6QA 1IGNA 1FNNA 3ZQQA 4A6EA 1U6GA 1WJ5A 1POGA 4EQQA 3H3ZA 4LLGF 4XOPA 3NWTA 3CC7I 2VE8A 1ZH5A 2VPRA 1K6OA 3RKYA 3OV8A 4ZJZA 1W4MA 5H2FC 3FMRA 2V7FA 3RI4A 2V1DA 4BXUA 3M4OJ 2FBIA 3BCAA 2Z5UA 3AFHA 2Y31A 1UELB 2AQEA 3ZR8X 4ZDOA 3D5RC 2FOKA 4Y4RA 4PJMA 3F21A 3RZDJ 4P5OA 3BDDA 4M9ZA 3DTEA 3J80K 4OIPF 2E2HJ 2KKOA 1QVUA 4XRSA 1R22A 2DMPA 3DEUA 4V2FA 4PCQA 3LSMA 3VYTB 1X1CA 3BC8A 2VJIA 4MIMA 3OIPA 3RJPA 2WAEA 3GFLA 2FNPA 3C2HA 2ZSIB 4UVBA 1YS7A 1WGXA 1K6YA 5B3SH 2I8DA 2QGUA 4JK1X 3DPLC 5K5OA 3LA3A 4DNCA 3LSIA 3Q0WA 1ZG1A 2HQAA 2XRNA 1JGSA 3BZCA 2STWA 4BQOA 1UAAA 1T33A 3KEYA 2DFHA 4L5IA 1SD7A 2IGOA 1JHHA 3S1RJ 1VQNI 2E2IJ 4IJAA 1LKXA 1NTCA 1JTYA 3CCSI 4BQNA 2R0QC 2G7UA 3RPQA 2KIQA 5HDGA 2IJLA 4IX7A 2X48A 4UUTA 3WE2A 2XPUA 3NARA 1TW3A 4KN4X 5ICFA 3H5NA 3BZ6A 3CMAI 3KX2A 1BI1A 4EATA 3MZHA 4D5FA 2MFZA 2VC1A 2HOSA 2ACJA 4LG0B 2OCCH 1BOBA 4KMUX 3U1DA 3TOAA 2BZTA 3CLQA 2CUJA 5D4RA 4WX9A
chains in the Genus database with same CATH topology
4RB0A 2E7WA 1FBQA 2PBIA 4U7BA 1KYZA 5D5WB 6PAXA 1LEBA 3O2PE 4U7DA 4YFKF 3AAFA 1KU2A 3D0SA 3I64A 2JSCA 2CQKA 1QZZA 1ZG5A 1KU3A 2MH9A 5JVTA 3IKTA 3HIFA 4O6JA 1XSXA 1TNTA 3CUQA 5CVUA 1RZ4A 1FPQA 3I0TA 2H6BA 3MFKA 1BN5A 1KQ9A 1NHAA 2L3DA 1LQ1A 2FMYA 5E17F 4OMYA 3I4PA 5HVQC 3OOPA 4HF0A 2IW5A 3Q9SA 1FSEA 3ML6A 5A2QK 3B73A 5LRRA 2R7FA 2QYOA 4AIJA 1S7AA 3HHHA 2O8XA 2JPBA 2GWRA 5D4SA 1IZ1A 5LGNA 1UFMA 3GX4X 4WXCA 4HX4A 1W7PB 2VT3A 5IT3A 4L9NA 1HKTA 2YSRA 4WWCA 2XASA 3WTZA 2P4WA 2QBYB 1DUXC 2HR3A 2NRAC 1VTNC 4EM2A 2Y48A 2RDPA 5F64A 3GUDA 2M87A 1Q1HA 1TW2A 2B0LA 5JI6A 2Q0OA 1MDMA 4F7ZA 1XMAA 4LMYA 4UNOA 2K02A 4WF2A 1HW2A 2HKXA 3V4GA 3I59A 3HRSA 4HQEA 1J59A 1JHFA 1J7KA 3FMQA 4UV8A 1BI3A 1B59A 1ZYRF 3KEOA 3F8NA 3KP3A 3L09A 1FYLA 1T38A 2CO5A 5L3CA 4KT5C 2P5KA 3RIRA 4Y13A 4ZYEA 2EFWA 2KRFA 2P5LC 2FA5A 5IT9K 1UHMA 1R5GA 1ZG3A 4KIFA 4YFNF 2M45A 2WV0A 3QU6A 5ILUA 1JXSA 2ZXJA 1K78B 2ADUA 2QUFA 4S04A 3FMSA 1FWZA 2QWWA 4MTEA 1BIAA 5JFRA 1KQ0A 1O3RA 2VODA 4WK8F 4MQVA 4YIIA 2P6TA 1QNTA 2PLYA 4PDKA 2D2WA 1B9MA 4PGGA 3BOQA 2BE5F 3REOA 4LLNA 3QAHA 2OU2A 2DPDA 1G3WA 3K9TA 2NAZA 2FU4A 4UV9A 4LLLA 1YTYA 1D3YA 1P4XA 4KUMA 3KZZA 5ICGA 3TOBA 2EFPA 5JR3A 3FXQA 1WRJA 3ZN0A 2CWEA 3C3WA 2Y0MA 1IXCA 1BC7C 2JT1A 3WGHA 3FZVA 1ON2A 2X4HA 1R1TA 3E5UA 4HDUA 1EV7A 2XHKA 1EH8A 1YQAA 5BQTA 2LNBA 4FX0A 3GFIA 5D5VB 1HSJA 2DAOA 1RUOA 2A6EF 1J0RA 3G3ZA 2L02A 1LVAA 1D8KA 2PJPA 1T2KA 1X3UA 3EETA 2YX7A 5LEJA 1EH6A 3M9AA 2QVOA 1IRFA 3DF8A 3WG9A 3SQNA 1R00A 2JTVA 5FGMA 4BHBA 4M71A 2COMA 1IUYA 2FMLA 1ZARA 3F6OA 2K7LA 1MJ9A 3F8BA 4RAZA 4UUVA 1SMTA 5LHGA 1J2XA 2RGVA 2FSWA 1XGOA 3GYHX 3T5XA 2M5WA 2VE9A 2DK8A 2UXXA 4ASNA 3D5LA 4EM0B 3F23A 2FF4A 2R3SA 1QO0D 1UB9A 3CUOA 3JAMZ 2XKPA 2ISYA 1DPUA 5KVRA 4IHSA 1FZPB 2DFIA 2E1NA 2P7CB 5D5XB 1R58A 4OIQF 3V8LA 3DPTA 5KK1A 3ZP5A 2CG4A 3ZMSA 4BH9A 1FSHA 2CYYA 1KYWA 4XSXF 3Q5FA 4ZH4F 2FXAA 4KNYA 3GF2A 1SD5A 5H6RA 2PFBA 2ISZA 2M8EA 1YLFA 4EJTA 4YFXF 3B02A 5CYVA 4OIOF 4LK1F 5HDNA 4BHPA 3SHFA 3TDZC 4HX8A 2HFHA 3ECOA 2MLKA 3MEXA 2P7VB 1FP1D 3VOEA 1FBUA 4KFCA 4IHTA 3JSOA 2ESHA 5DCFA 4LB6B 2ZO4A 4B8XA 2LKPA 5J6XA 2D1HA 4R79A 4N9IA 3WGIA 2DLLA 4MNUA 4RGRA 3CLOA 1U2WA 2HKOA 1QBJA 4OOIA 4RGSA 1YO5C 2P8TA 3S2WA 2MLGA 3F6VA 1K7AA 5LBQA 3DP7A 4FX4A 1QGPA 4IF4A 4RGUA 2HTJA 4GO1A 5LGUA 3QP5A 1DP7P 2ZBKA 2V1XA 4CXFA 4P9UA 2ZMEA 3HHGA 3DXJF 1IXRC 2ZCWA 3HRMA 3J7AO 1PP7U 3HUGA 3R6SA 4G7HF 5FLXZ 3LAPA 2BBYA 1ZLJA 1S29A 4A0ZA 1B1BA 2DQLA 1BC8C 2MA3A 3GFJA 4G7OF 3F22A 3NEUA 4AIKA 3EUHA 2P6SA 1H0MA 1G4DA 5E20A 1W5SA 2HTSA 4I09A 1FYKA 4IPAA 2A61A 4RS8A 2XAQA 3HSFA 1GHCA 4A5MA 3FWEA 4HA8A 1LEAA 5F6FA 3WE3A 2BEOA 1WI9A 4HBLA 3L2CA 1WKMA 1OKRA 2KJCA 1IN6A 1OMIA 2Z99A 4L9JA 1T39A 5BOXA 4Q48A 3GXOA 4A12A 1U5TC 1J75A 4KDPA 4UVCA 1U78A 3KCCA 1A04A 4EJVA 5FD6A 2W85A 2HGCA 3BPVA 2JZYA 1V3FA 1YW8A 2QENA 2EV5A 2GA1A 3TGNA 4AD9A 2EK5A 2R7DA 1YFHA 1LB2A 2F2EA 2QQAA 1R23A 4HYEA 5LGTA 3VFZA 2AS5F 3JTHA 5FFXA 3ISPA 1ZREA 2XAGA 4I98B 4ENMA 1XGNA 2NYXA 2GZWA 2VOOA 2O6GE 3I54A 3ABUA 1YS6A 4IRGA 2IT0A 5CJ9A 3BJOA 2EFNA 2QQ9A 4KMFA 2HWVA 3KP4A 1YW9A 1U5TB 5J8CA 2W84A 5DD8A 3H3UA 2YPRA 2RN7A 5DD4A 2RVCA 1FY7A 3R0AA 1OYWA 3HOTA 5DDGA 1CF7A 3WGGA 2K4BA 3CO6C 2OZUA 3BPXA 1HW5A 3R60A 3MQ0A 5ERIA 5E1XA 4CICA 4GYIA 3ZQ7A 3N97A 4HZFA 3IKVA 2DO7A 3RKXA 1XDSA 1RNLA 3RYRA 4D0PA 4AIHA 3JAMK 3KETA 3BY6A 4L9VA 5FB2A 1G3TA 4EV0A 5L3FA 2A3SA 1XB4A 1KA8A 4ENNA 3ULQB 3P9CA 2HYFA 1SFUA 2A68F 2L4AA 3GLXA 3PQKA 3VODA 2EA4A 4ESFA 3G73A 3V8JA 3GWZA 1HBXG 2VBYA 3TDUC 1IAWA 1FLIA 4GYGA 2DTRA 1XD7A 5HDKA 2GXGA 2C6YA 4M74A 4IVNA 3HYIA 1HW1A 4JQFA 3CO7C 2DI3A 1TQMA 2MC3A 3QU3A 4HAMA 1JE8A 2BYVE 2XIGA 5H20A 2EA2A 2FBHA 4I02A 3R4KA 1ZRDA 5DEQA 3RKWA 4LG0A 1G6NA 5ILVA 5BS6A 2DQRA 1XCVA 1F9NA 4I2OA 2V9VA 3ZMDA 1USSA 3O3KA 2WC2A 3WTTC 5K5QA 2H09A 1IN4A 1P4WA 1T98A 1R1VA 2DBBA 2EV0A 3V7CA 3KP5A 5L3BA 3Q9VA 1F5TA 1W7PD 3HOSA 3M8FA 3FM5A 3GZ6A 4MQ9F 2IA0A 3L7WA 3ZMTA 1Z1DA 4M9XA 2RKHA 3V7RA 1B4AA 4G94A 5FLXK 2LDUA 2Q2EA 1T6SA 3T1BA 3L9FA 4XLPF 3ECHA 4RB3C 3SFZA 5L3EA 3RYPA 3PFIA 2YX4A 4HW0A 5FD5A 1BOAA 1TLHB 4Q4ZF 1XSDA 5AONA 3LQRA 3E3VA 4E70A 1LDDA 3MAJA 2CFXA 2STTA 1IXSB 4ESBA 2V79A 2WWYA 5HLIA 4KYWA 5FO5A 2IA1A 5F1RA 1K79A 3K2ZA 1AWCA 1TNSA 5ED4A 4P55A 2NNNA 2A69F 3GFMA 3LFKA 2QBYA 2KIMA 2V1UA 3GVAA 1S6LA 4ZYDA 3QPHA 2L01A 2RNJA 1L0OC 4Q47A 2XUBA 4IRHA 4S05A 1QQIA 2QLZA 1MGTA 2GIVA 1TQIA 1REPC 4HV6A 4HF2A 1OYYA 4M6YA 4EJUA 2FBKA 4GGGA 2VT2A 2HS5A 2MH2A 3LA7A 1BIBA 4K2EA 4ZZLA 2GQQA 3ZMVA 2IA2A 5L3GA 3ERED 4HOBA 5TJJA 1Z7UA 4U0YA 3I5UA 3BP8A 3IC7A 1J5YA 1IRGA 4ZYGA 5HS9A 2EV6A 1ZAOA 1WWXA 5BPIA 3NQOA 1SFXA 1LDJA 4EVIA 2XROA 3DQVC 1K78A 3IHUA 2JRTA 1RUNA 1DDNA 5ILSA 1TQPA 1U3EM 5LHHA 3FHZA 3IRQA 3HRUA 2NS0A 5K1YA 2J5OA 1MKMA 4NQWA 2E1CA 3KLNA 5HS7A 3WTSC 4ESJA 2D45A 4CDGA 2ZNZA 2GXBA 5CVVA 3LSTA 2DK5A 5CVJA 1O57A 4QLCU 3BWGA 1J9IA 2VN2A 2PMUA 4A0YA 2UXNA 2LF7A 2QQBA 4GCVA 1UCRA 4HX7A 4R8HA 2OZ6A 4LD5A 3JTGA 1ODDA 5LEKA 5AIQA 1MJAA 1BJAA 3FXUA 4O3MA 5H6QA 1QPMA 4G7ZF 1ZRFA 4HLXA 2NNYA 1PP8F 4L5JA 1FX7A 1IW7F 2YR2A 2FNAA 4AVPA 3CUQC 1P4AA 5FFZA 2FRHA 2EFOA 5HS8A 5D6FA 1OR7A 2RC4A 2RV8A 3FM3A 3H92A 2HOEA 3IWZA 2DW4A 2EB7A 4ENKA 4RGXA 3MWMA 3E6CC 3K0LA 4OU0A 3R61A 1AOYA 3E6MA 3LWFA 3TO9A 2K86A 3T8RA 2CW0F 4HQMA 3WU1B 1O3TA 4EJOA 1EH7A 2AXLA 1DPRA 2OD5A 3CUQB 1LNWA 2VBXA 1I6XA 4AWXB 1R5HA 5DYMA 4R1HA 2G7HA 2LSOA 4MEXF 5D5UB 3U9GA 2M30A 2XAFA 2BGCA 2VXZA 5CVRA 2J5PA 3ZMUA 3M7GA 1P6RA 2W24A 4MGRA 1SD6A 3WTVC 3E6DA 3SZPA 1MJBA 2F5FA 3DFGA 3RPUA 1Z6TA 5DCMA 2BV6A 3WTYC 4N9HA 3I58A 2F5CA 1IF1A 1PDNC 3O6BB 4IXAA 3V7SA 3BJAA 1ON1A 3F8MA 4U88A 1OYIA 4KA4A 3RDIA 4B09A 1HKQA 1XGSA 2L4MA 2HDCA 3E97A 2H6CA 2OA4A 5J8FA 5E8IA 3KFWX 1TTYA 1I1GA 2O0YA 2OQRA 4XRFA 3HSEA 3N4MA 1B6AA 4L18B 3M1EA 3L00A 3F3XA 4LFUA 1ZLKA 1MDMB 1ONVA 4LK0F 3J81Z 1C0WA 2YU3A 3ZPLA 1IN5A 4BYYA 3I59B 2IPQX 1ZGJA 3I71A 1I1SA 3C18A 4M6XA 4CHUA 3P7NA 1BBYA 4MHGA 4XBFA 3IRRA 4ZZDA 3HRTA 3F8CA 1RI7A 2ELHA 2IP2A 2FQ3A 5E1WA 4P96A 4RB2C 4XSZF 2Q8KA 3K69A 1R1UA 2CSOA 1XMKA 1CGPA 3PQJA 2HQRA 3E6BA 2K27A 1XDUA 2ZNYA 2Z3YA 5HOOA 4EGYA 2HZTA 3FX3A 4UHTA 2VC0A 4L0YB 1H9TA 1XCBA 1V4RA 3LAJA 2P5VA 2O3FA 1ZGAA 5LLQA 3K1MA 4JBAA 4Y15A 1XGMA 2MD5A 3P9IA 1QZYA 1I27A 3WTUC 5ICEA 5HLGA 3LQQA 3MCZA 2K4JA 3TO6A 4A6DA 2XAJA 1XN7A 3P9KA 3BJ6A 2CGPA 3WTXC 2F5DA 4EGZA 4G9YA 2O03A 1G3YA 2EJRA 4OMZA 5BMZA 2RQPA 4LGWA 2HEOA 5E8GA 4BAYA 5JHUA 1HXDA 2FE3A 1SAXA 2KIUA 2LF8A 1BM9A 1FC3A 4UVAA 4EMSA 3ZMZA 2OQGA 3MZYA 1S8NA 4Q5SF 1O3SA 2QM3A 4OIRF 1BI0A 4M73A 2XV4S 3GEZA 2VOPA 3SZTA 5DV5A 3KLOA 2W57A 3E5QA 3FXRA 4YIFA 1MD0A 3IL2A 4CZZA 1RIOH 4CGZA 2XVCA 4RAYA 1U5TA 2ZKZA 4KIBA 5LHIA 5DUKA 1T0FA 4Z2YA 5D8KB 5LRSA 4NHJA 1D8JA 1Z9CA 3WU0A 3I53A 2XGXA 2XKOA 3CTAA 1OPCA 3HTUA 1FOKA 2XAHA 1D5VA 3DV8A 4G8XA 3LA2A 1SD4A 3K1PA 2L54A 3SXYA 3CJNA 1Z05A 4H0EA 2VBWA 3KZYA 2OBPA 4HDVA 1ULYA 4KICA 1R7JA 1Y0UA 2ESNA 1GXPA 4I7HA 3BROA 3W6KB 3W6JB 3J80Z 1GVJA 4ETSA 2A07F 2PEXA 4CYDA 1O7FA 3C1DA 1W7PA 1LJ9A 3U2RA 3TQNA 4HV5A 2HQNA 3T8TA 3WTWC 2Z33A 4ENJA 4CO8A 2UWMA 3NRVA 4KN7X 4I01A 3QPTA 2EWNA 3GO5A 1YIOA 1E17A 1I5ZA 2H94A 3GZ5A 5EEGA 5TRDA 1W5TA 1GXQA 3F8FA 1KQ8A 4EM1A 2WTEA 2D1VA 1Z91A 4WCGA 4LB5A 2H27A 4YG2F 2DT5A 5L3DA 3QOPA 3F72A 4I0AA 5DUIA 3CDHA 4LJZF 5BPDA 1BI2A 2KJBA 2VBZA 4ON0A 2ETHA 2F5EA 1WSUA 2W25A 5CVIA 1R36A 4FT8A 4XLNF 4NB5A 2ZJ2A 4L0ZB 1F4KA 4O5VA 3K1NA 3J81K 1YG2A 2G9WA 5D8LB 3C7JA 2ZMEB 3JW4A 3ROUA 4KIGA 3EQLF 5E1ZB 1YYVA 3M8EA 1FBSA 2FEZA 3ABTA 1UHWA 4HLYA 1IN7A 4PZJA 4G6DA 1SFEA 3RTRA 2Y75A 1B9NA 2VONA 2EFQA 2E7XA 4A5NA 5A2QZ 3V8KA 2UZKA 3GW2A 4FHTA 2GA2A 1HSTA 4WXHA 4Y17A 4PGHA 1S3JA 1FT9A 4P9FA 2DU9A 4L9TA 1FYMA 4EJWA 2PI0A 3COAC 5K5RA 4M9SA 2O61A 2PMHA 1U8RA 1P92A 3QRFF 5E18F 3R0JA 1G3SA 1O7LA 3KP7A 2IRFG 1IN8A 5CLSA 3ZN1A 3KP2A 3IWFA 1MZBA 3KEQA 3T0YA 1LDKB 2KIFA 5DCMB 2IVMA 2A6HF 2QZ8A 1P2FA 3TKYA 4HF1A 3E5XA 2PQ8A 4IRIA 3HSRA 1L3LA 2V6CA 3EYYA 1HKSA 3TO7A 1USTA 3EDPA 2MBFA 5D6EA 4UXNA 4BNCA 4I0BA 5EEHA 4M72A 3QP6A 4GXOA 4BHCA 3HTSB 1E2XA 4A2UA 3KE2A 1Z6RA 4MEYF 1KGSA 4OINF 1H9GA 2OAZA 5AIPA 3ELKA 4U0VA 4DQ2A 1FP2A 1F1ZA 4A0XA 1ZN2A 1XSVA 3FF5A 1TBXA 4WXDA 2M1BA 5IT9Z 1S7OA 1YW7A 1STZA 4TV7A 4QWQA 4U0WA 3JSPA 2PG4A 2ZFWA 1O3QA 1WQ2A 4MTDA 3KP6A 3VEPA 1KU7A 1CF7B 2X0LA 5ICCA 2GAUA 5HLHA 4RB1A 2A5YB 4BQAA 4N0BA 3VB2A 2TDXA 2DPUA 3DKWA 1HQCA 1KU9A 1PUEE 2HYGD 4ZYHA 1ZRCA 3EYIA 1SMYF 2PN6A 2JPCA 1ZHFA 2Z9OA 3WODF 4G6QA 1FNNA 4A6EA 1U6GA 4EQQA 3H3ZA 4LLGF 2VE8A 1ZH5A 1K6OA 3RKYA 3OV8A 1W4MA 3FMRA 3RI4A 2V1DA 4BXUA 2FBIA 2Z5UA 2FOKA 3F21A 4P5OA 3BDDA 4M9ZA 3J80K 4OIPF 2KKOA 1R22A 3DEUA 4PCQA 3RJPA 3GFLA 2FNPA 4UVBA 1YS7A 4JK1X 3DPLC 5K5OA 3LA3A 4DNCA 1ZG1A 2XRNA 1JGSA 2STWA 4L5IA 1SD7A 1JHHA 4IJAA 2G7UA 3RPQA 5HDGA 2IJLA 3WE2A 1TW3A 4KN4X 5ICFA 3BZ6A 1BI1A 3MZHA 2VC1A 2ACJA 4LG0B 4KMUX 3U1DA 3TOAA 5D4RA 4WX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RB0 A;  2E7W A;  1FBQ A;  2PBI A;  4U7B A;  1KYZ A;  5D5W B;  6PAX A;  1LEB A;  3O2P E;  4U7D A;  4YFK F;  3AAF A;  1KU2 A;  3D0S A;  3I64 A;  2JSC A;  2CQK A;  1QZZ A;  1ZG5 A;  1KU3 A;  2MH9 A;  5JVT A;  3IKT A;  3HIF A;  4O6J A;  1XSX A;  1TNT A;  3CUQ A;  5CVU A;  1RZ4 A;  1FPQ A;  3I0T A;  2H6B A;  3MFK A;  1BN5 A;  1KQ9 A;  1NHA A;  2L3D A;  1LQ1 A;  2FMY A;  5E17 F;  4OMY A;  3I4P A;  5HVQ C;  3OOP A;  4HF0 A;  2IW5 A;  3Q9S A;  1FSE A;  3ML6 A;  5A2Q K;  3B73 A;  5LRR A;  2R7F A;  2QYO A;  4AIJ A;  1S7A A;  3HHH A;  2O8X A;  2JPB A;  2GWR A;  5D4S A;  1IZ1 A;  5LGN A;  1UFM A;  3GX4 X;  4WXC A;  4HX4 A;  1W7P B;  2VT3 A;  5IT3 A;  4L9N A;  1HKT A;  2YSR A;  4WWC A;  2XAS A;  3WTZ A;  2P4W A;  2QBY B;  1DUX C;  2HR3 A;  2NRA C;  1VTN C;  4EM2 A;  2Y48 A;  2RDP A;  5F64 A;  3GUD A;  2M87 A;  1Q1H A;  1TW2 A;  2B0L A;  5JI6 A;  2Q0O A;  1MDM A;  4F7Z A;  1XMA A;  4LMY A;  4UNO A;  2K02 A;  4WF2 A;  1HW2 A;  2HKX A;  3V4G A;  3I59 A;  3HRS A;  4HQE A;  1J59 A;  1JHF A;  1J7K A;  3FMQ A;  4UV8 A;  1BI3 A;  1B59 A;  1ZYR F;  3KEO A;  3F8N A;  3KP3 A;  3L09 A;  1FYL A;  1T38 A;  2CO5 A;  5L3C A;  4KT5 C;  2P5K A;  3RIR A;  4Y13 A;  4ZYE A;  2EFW A;  2KRF A;  2P5L C;  2FA5 A;  5IT9 K;  1UHM A;  1R5G A;  1ZG3 A;  4KIF A;  4YFN F;  2M45 A;  2WV0 A;  3QU6 A;  5ILU A;  1JXS A;  2ZXJ A;  1K78 B;  2ADU A;  2QUF A;  4S04 A;  3FMS A;  1FWZ A;  2QWW A;  4MTE A;  1BIA A;  5JFR A;  1KQ0 A;  1O3R A;  2VOD A;  4WK8 F;  4MQV A;  4YII A;  2P6T A;  1QNT A;  2PLY A;  4PDK A;  2D2W A;  1B9M A;  4PGG A;  3BOQ A;  2BE5 F;  3REO A;  4LLN A;  3QAH A;  2OU2 A;  2DPD A;  1G3W A;  3K9T A;  2NAZ A;  2FU4 A;  4UV9 A;  4LLL A;  1YTY A;  1D3Y A;  1P4X A;  4KUM A;  3KZZ A;  5ICG A;  3TOB A;  2EFP A;  5JR3 A;  3FXQ A;  1WRJ A;  3ZN0 A;  2CWE A;  3C3W A;  2Y0M A;  1IXC A;  1BC7 C;  2JT1 A;  3WGH A;  3FZV A;  1ON2 A;  2X4H A;  1R1T A;  3E5U A;  4HDU A;  1EV7 A;  2XHK A;  1EH8 A;  1YQA A;  5BQT A;  2LNB A;  4FX0 A;  3GFI A;  5D5V B;  1HSJ A;  2DAO A;  1RUO A;  2A6E F;  1J0R A;  3G3Z A;  2L02 A;  1LVA A;  1D8K A;  2PJP A;  1T2K A;  1X3U A;  3EET A;  2YX7 A;  5LEJ A;  1EH6 A;  3M9A A;  2QVO A;  1IRF A;  3DF8 A;  3WG9 A;  3SQN A;  1R00 A;  2JTV A;  5FGM A;  4BHB A;  4M71 A;  2COM A;  1IUY A;  2FML A;  1ZAR A;  3F6O A;  2K7L A;  1MJ9 A;  3F8B A;  4RAZ A;  4UUV A;  1SMT A;  5LHG A;  1J2X A;  2RGV A;  2FSW A;  1XGO A;  3GYH X;  3T5X A;  2M5W A;  2VE9 A;  2DK8 A;  2UXX A;  4ASN A;  3D5L A;  4EM0 B;  3F23 A;  2FF4 A;  2R3S A;  1QO0 D;  1UB9 A;  3CUO A;  3JAM Z;  2XKP A;  2ISY A;  1DPU A;  5KVR A;  4IHS A;  1FZP B;  2DFI A;  2E1N A;  2P7C B;  5D5X B;  1R58 A;  4OIQ F;  3V8L A;  3DPT A;  5KK1 A;  3ZP5 A;  2CG4 A;  3ZMS A;  4BH9 A;  1FSH A;  2CYY A;  1KYW A;  4XSX F;  3Q5F A;  4ZH4 F;  2FXA A;  4KNY A;  3GF2 A;  1SD5 A;  5H6R A;  2PFB A;  2ISZ A;  2M8E A;  1YLF A;  4EJT A;  4YFX F;  3B02 A;  5CYV A;  4OIO F;  4LK1 F;  5HDN A;  4BHP A;  3SHF A;  3TDZ C;  4HX8 A;  2HFH A;  3ECO A;  2MLK A;  3MEX A;  2P7V B;  1FP1 D;  3VOE A;  1FBU A;  4KFC A;  4IHT A;  3JSO A;  2ESH A;  5DCF A;  4LB6 B;  2ZO4 A;  4B8X A;  2LKP A;  5J6X A;  2D1H A;  4R79 A;  4N9I A;  3WGI A;  2DLL A;  4MNU A;  4RGR A;  3CLO A;  1U2W A;  2HKO A;  1QBJ A;  4OOI A;  4RGS A;  1YO5 C;  2P8T A;  3S2W A;  2MLG A;  3F6V A;  1K7A A;  5LBQ A;  3DP7 A;  4FX4 A;  1QGP A;  4IF4 A;  4RGU A;  2HTJ A;  4GO1 A;  5LGU A;  3QP5 A;  1DP7 P;  2ZBK A;  2V1X A;  4CXF A;  4P9U A;  2ZME A;  3HHG A;  3DXJ F;  1IXR C;  2ZCW A;  3HRM A;  3J7A O;  1PP7 U;  3HUG A;  3R6S A;  4G7H F;  5FLX Z;  3LAP A;  2BBY A;  1ZLJ A;  1S29 A;  4A0Z A;  1B1B A;  2DQL A;  1BC8 C;  2MA3 A;  3GFJ A;  4G7O F;  3F22 A;  3NEU A;  4AIK A;  3EUH A;  2P6S A;  1H0M A;  1G4D A;  5E20 A;  1W5S A;  2HTS A;  4I09 A;  1FYK A;  4IPA A;  2A61 A;  4RS8 A;  2XAQ A;  3HSF A;  1GHC A;  4A5M A;  3FWE A;  4HA8 A;  1LEA A;  5F6F A;  3WE3 A;  2BEO A;  1WI9 A;  4HBL A;  3L2C A;  1WKM A;  1OKR A;  2KJC A;  1IN6 A;  1OMI A;  2Z99 A;  4L9J A;  1T39 A;  5BOX A;  4Q48 A;  3GXO A;  4A12 A;  1U5T C;  1J75 A;  4KDP A;  4UVC A;  1U78 A;  3KCC A;  1A04 A;  4EJV A;  5FD6 A;  2W85 A;  2HGC A;  3BPV A;  2JZY A;  1V3F A;  1YW8 A;  2QEN A;  2EV5 A;  2GA1 A;  3TGN A;  4AD9 A;  2EK5 A;  2R7D A;  1YFH A;  1LB2 A;  2F2E A;  2QQA A;  1R23 A;  4HYE A;  5LGT A;  3VFZ A;  2AS5 F;  3JTH A;  5FFX A;  3ISP A;  1ZRE A;  2XAG A;  4I98 B;  4ENM A;  1XGN A;  2NYX A;  2GZW A;  2VOO A;  2O6G E;  3I54 A;  3ABU A;  1YS6 A;  4IRG A;  2IT0 A;  5CJ9 A;  3BJO A;  2EFN A;  2QQ9 A;  4KMF A;  2HWV A;  3KP4 A;  1YW9 A;  1U5T B;  5J8C A;  2W84 A;  5DD8 A;  3H3U A;  2YPR A;  2RN7 A;  5DD4 A;  2RVC A;  1FY7 A;  3R0A A;  1OYW A;  3HOT A;  5DDG A;  1CF7 A;  3WGG A;  2K4B A;  3CO6 C;  2OZU A;  3BPX A;  1HW5 A;  3R60 A;  3MQ0 A;  5ERI A;  5E1X A;  4CIC A;  4GYI A;  3ZQ7 A;  3N97 A;  4HZF A;  3IKV A;  2DO7 A;  3RKX A;  1XDS A;  1RNL A;  3RYR A;  4D0P A;  4AIH A;  3JAM K;  3KET A;  3BY6 A;  4L9V A;  5FB2 A;  1G3T A;  4EV0 A;  5L3F A;  2A3S A;  1XB4 A;  1KA8 A;  4ENN A;  3ULQ B;  3P9C A;  2HYF A;  1SFU A;  2A68 F;  2L4A A;  3GLX A;  3PQK A;  3VOD A;  2EA4 A;  4ESF A;  3G73 A;  3V8J A;  3GWZ A;  1HBX G;  2VBY A;  3TDU C;  1IAW A;  1FLI A;  4GYG A;  2DTR A;  1XD7 A;  5HDK A;  2GXG A;  2C6Y A;  4M74 A;  4IVN A;  3HYI A;  1HW1 A;  4JQF A;  3CO7 C;  2DI3 A;  1TQM A;  2MC3 A;  3QU3 A;  4HAM A;  1JE8 A;  2BYV E;  2XIG A;  5H20 A;  2EA2 A;  2FBH A;  4I02 A;  3R4K A;  1ZRD A;  5DEQ A;  3RKW A;  4LG0 A;  1G6N A;  5ILV A;  5BS6 A;  2DQR A;  1XCV A;  1F9N A;  4I2O A;  2V9V A;  3ZMD A;  1USS A;  3O3K A;  2WC2 A;  3WTT C;  5K5Q A;  2H09 A;  1IN4 A;  1P4W A;  1T98 A;  1R1V A;  2DBB A;  2EV0 A;  3V7C A;  3KP5 A;  5L3B A;  3Q9V A;  1F5T A;  1W7P D;  3HOS A;  3M8F A;  3FM5 A;  3GZ6 A;  4MQ9 F;  2IA0 A;  3L7W A;  3ZMT A;  1Z1D A;  4M9X A;  2RKH A;  3V7R A;  1B4A A;  4G94 A;  5FLX K;  2LDU A;  2Q2E A;  1T6S A;  3T1B A;  3L9F A;  4XLP F;  3ECH A;  4RB3 C;  3SFZ A;  5L3E A;  3RYP A;  3PFI A;  2YX4 A;  4HW0 A;  5FD5 A;  1BOA A;  1TLH B;  4Q4Z F;  1XSD A;  5AON A;  3LQR A;  3E3V A;  4E70 A;  1LDD A;  3MAJ A;  2CFX A;  2STT A;  1IXS B;  4ESB A;  2V79 A;  2WWY A;  5HLI A;  4KYW A;  5FO5 A;  2IA1 A;  5F1R A;  1K79 A;  3K2Z A;  1AWC A;  1TNS A;  5ED4 A;  4P55 A;  2NNN A;  2A69 F;  3GFM A;  3LFK A;  2QBY A;  2KIM A;  2V1U A;  3GVA A;  1S6L A;  4ZYD A;  3QPH A;  2L01 A;  2RNJ A;  1L0O C;  4Q47 A;  2XUB A;  4IRH A;  4S05 A;  1QQI A;  2QLZ A;  1MGT A;  2GIV A;  1TQI A;  1REP C;  4HV6 A;  4HF2 A;  1OYY A;  4M6Y A;  4EJU A;  2FBK A;  4GGG A;  2VT2 A;  2HS5 A;  2MH2 A;  3LA7 A;  1BIB A;  4K2E A;  4ZZL A;  2GQQ A;  3ZMV A;  2IA2 A;  5L3G A;  3ERE D;  4HOB A;  5TJJ A;  1Z7U A;  4U0Y A;  3I5U A;  3BP8 A;  3IC7 A;  1J5Y A;  1IRG A;  4ZYG A;  5HS9 A;  2EV6 A;  1ZAO A;  1WWX A;  5BPI A;  3NQO A;  1SFX A;  1LDJ A;  4EVI A;  2XRO A;  3DQV C;  1K78 A;  3IHU A;  2JRT A;  1RUN A;  1DDN A;  5ILS A;  1TQP A;  1U3E M;  5LHH A;  3FHZ A;  3IRQ A;  3HRU A;  2NS0 A;  5K1Y A;  2J5O A;  1MKM A;  4NQW A;  2E1C A;  3KLN A;  5HS7 A;  3WTS C;  4ESJ A;  2D45 A;  4CDG A;  2ZNZ A;  2GXB A;  5CVV A;  3LST A;  2DK5 A;  5CVJ A;  1O57 A;  4QLC U;  3BWG A;  1J9I A;  2VN2 A;  2PMU A;  4A0Y A;  2UXN A;  2LF7 A;  2QQB A;  4GCV A;  1UCR A;  4HX7 A;  4R8H A;  2OZ6 A;  4LD5 A;  3JTG A;  1ODD A;  5LEK A;  5AIQ A;  1MJA A;  1BJA A;  3FXU A;  4O3M A;  5H6Q A;  1QPM A;  4G7Z F;  1ZRF A;  4HLX A;  2NNY A;  1PP8 F;  4L5J A;  1FX7 A;  1IW7 F;  2YR2 A;  2FNA A;  4AVP A;  3CUQ C;  1P4A A;  5FFZ A;  2FRH A;  2EFO A;  5HS8 A;  5D6F A;  1OR7 A;  2RC4 A;  2RV8 A;  3FM3 A;  3H92 A;  2HOE A;  3IWZ A;  2DW4 A;  2EB7 A;  4ENK A;  4RGX A;  3MWM A;  3E6C C;  3K0L A;  4OU0 A;  3R61 A;  1AOY A;  3E6M A;  3LWF A;  3TO9 A;  2K86 A;  3T8R A;  2CW0 F;  4HQM A;  3WU1 B;  1O3T A;  4EJO A;  1EH7 A;  2AXL A;  1DPR A;  2OD5 A;  3CUQ B;  1LNW A;  2VBX A;  1I6X A;  4AWX B;  1R5H A;  5DYM A;  4R1H A;  2G7H A;  2LSO A;  4MEX F;  5D5U B;  3U9G A;  2M30 A;  2XAF A;  2BGC A;  2VXZ A;  5CVR A;  2J5P A;  3ZMU A;  3M7G A;  1P6R A;  2W24 A;  4MGR A;  1SD6 A;  3WTV C;  3E6D A;  3SZP A;  1MJB A;  2F5F A;  3DFG A;  3RPU A;  1Z6T A;  5DCM A;  2BV6 A;  3WTY C;  4N9H A;  3I58 A;  2F5C A;  1IF1 A;  1PDN C;  3O6B B;  4IXA A;  3V7S A;  3BJA A;  1ON1 A;  3F8M A;  4U88 A;  1OYI A;  4KA4 A;  3RDI A;  4B09 A;  1HKQ A;  1XGS A;  2L4M A;  2HDC A;  3E97 A;  2H6C A;  2OA4 A;  5J8F A;  5E8I A;  3KFW X;  1TTY A;  1I1G A;  2O0Y A;  2OQR A;  4XRF A;  3HSE A;  3N4M A;  1B6A A;  4L18 B;  3M1E A;  3L00 A;  3F3X A;  4LFU A;  1ZLK A;  1MDM B;  1ONV A;  4LK0 F;  3J81 Z;  1C0W A;  2YU3 A;  3ZPL A;  1IN5 A;  4BYY A;  3I59 B;  2IPQ X;  1ZGJ A;  3I71 A;  1I1S A;  3C18 A;  4M6X A;  4CHU A;  3P7N A;  1BBY A;  4MHG A;  4XBF A;  3IRR A;  4ZZD A;  3HRT A;  3F8C A;  1RI7 A;  2ELH A;  2IP2 A;  2FQ3 A;  5E1W A;  4P96 A;  4RB2 C;  4XSZ F;  2Q8K A;  3K69 A;  1R1U A;  2CSO A;  1XMK A;  1CGP A;  3PQJ A;  2HQR A;  3E6B A;  2K27 A;  1XDU A;  2ZNY A;  2Z3Y A;  5HOO A;  4EGY A;  2HZT A;  3FX3 A;  4UHT A;  2VC0 A;  4L0Y B;  1H9T A;  1XCB A;  1V4R A;  3LAJ A;  2P5V A;  2O3F A;  1ZGA A;  5LLQ A;  3K1M A;  4JBA A;  4Y15 A;  1XGM A;  2MD5 A;  3P9I A;  1QZY A;  1I27 A;  3WTU C;  5ICE A;  5HLG A;  3LQQ A;  3MCZ A;  2K4J A;  3TO6 A;  4A6D A;  2XAJ A;  1XN7 A;  3P9K A;  3BJ6 A;  2CGP A;  3WTX C;  2F5D A;  4EGZ A;  4G9Y A;  2O03 A;  1G3Y A;  2EJR A;  4OMZ A;  5BMZ A;  2RQP A;  4LGW A;  2HEO A;  5E8G A;  4BAY A;  5JHU A;  1HXD A;  2FE3 A;  1SAX A;  2KIU A;  2LF8 A;  1BM9 A;  1FC3 A;  4UVA A;  4EMS A;  3ZMZ A;  2OQG A;  3MZY A;  1S8N A;  4Q5S F;  1O3S A;  2QM3 A;  4OIR F;  1BI0 A;  4M73 A;  2XV4 S;  3GEZ A;  2VOP A;  3SZT A;  5DV5 A;  3KLO A;  2W57 A;  3E5Q A;  3FXR A;  4YIF A;  1MD0 A;  3IL2 A;  4CZZ A;  1RIO H;  4CGZ A;  2XVC A;  4RAY A;  1U5T A;  2ZKZ A;  4KIB A;  5LHI A;  5DUK A;  1T0F A;  4Z2Y A;  5D8K B;  5LRS A;  4NHJ A;  1D8J A;  1Z9C A;  3WU0 A;  3I53 A;  2XGX A;  2XKO A;  3CTA A;  1OPC A;  3HTU A;  1FOK A;  2XAH A;  1D5V A;  3DV8 A;  4G8X A;  3LA2 A;  1SD4 A;  3K1P A;  2L54 A;  3SXY A;  3CJN A;  1Z05 A;  4H0E A;  2VBW A;  3KZY A;  2OBP A;  4HDV A;  1ULY A;  4KIC A;  1R7J A;  1Y0U A;  2ESN A;  1GXP A;  4I7H A;  3BRO A;  3W6K B;  3W6J B;  3J80 Z;  1GVJ A;  4ETS A;  2A07 F;  2PEX A;  4CYD A;  1O7F A;  3C1D A;  1W7P A;  1LJ9 A;  3U2R A;  3TQN A;  4HV5 A;  2HQN A;  3T8T A;  3WTW C;  2Z33 A;  4ENJ A;  4CO8 A;  2UWM A;  3NRV A;  4KN7 X;  4I01 A;  3QPT A;  2EWN A;  3GO5 A;  1YIO A;  1E17 A;  1I5Z A;  2H94 A;  3GZ5 A;  5EEG A;  5TRD A;  1W5T A;  1GXQ A;  3F8F A;  1KQ8 A;  4EM1 A;  2WTE A;  2D1V A;  1Z91 A;  4WCG A;  4LB5 A;  2H27 A;  4YG2 F;  2DT5 A;  5L3D A;  3QOP A;  3F72 A;  4I0A A;  5DUI A;  3CDH A;  4LJZ F;  5BPD A;  1BI2 A;  2KJB A;  2VBZ A;  4ON0 A;  2ETH A;  2F5E A;  1WSU A;  2W25 A;  5CVI A;  1R36 A;  4FT8 A;  4XLN F;  4NB5 A;  2ZJ2 A;  4L0Z B;  1F4K A;  4O5V A;  3K1N A;  3J81 K;  1YG2 A;  2G9W A;  5D8L B;  3C7J A;  2ZME B;  3JW4 A;  3ROU A;  4KIG A;  3EQL F;  5E1Z B;  1YYV A;  3M8E A;  1FBS A;  2FEZ A;  3ABT A;  1UHW A;  4HLY A;  1IN7 A;  4PZJ A;  4G6D A;  1SFE A;  3RTR A;  2Y75 A;  1B9N A;  2VON A;  2EFQ A;  2E7X A;  4A5N A;  5A2Q Z;  3V8K A;  2UZK A;  3GW2 A;  4FHT A;  2GA2 A;  1HST A;  4WXH A;  4Y17 A;  4PGH A;  1S3J A;  1FT9 A;  4P9F A;  2DU9 A;  4L9T A;  1FYM A;  4EJW A;  2PI0 A;  3COA C;  5K5R A;  4M9S A;  2O61 A;  2PMH A;  1U8R A;  1P92 A;  3QRF F;  5E18 F;  3R0J A;  1G3S A;  1O7L A;  3KP7 A;  2IRF G;  1IN8 A;  5CLS A;  3ZN1 A;  3KP2 A;  3IWF A;  1MZB A;  3KEQ A;  3T0Y A;  1LDK B;  2KIF A;  5DCM B;  2IVM A;  2A6H F;  2QZ8 A;  1P2F A;  3TKY A;  4HF1 A;  3E5X A;  2PQ8 A;  4IRI A;  3HSR A;  1L3L A;  2V6C A;  3EYY A;  1HKS A;  3TO7 A;  1UST A;  3EDP A;  2MBF A;  5D6E A;  4UXN A;  4BNC A;  4I0B A;  5EEH A;  4M72 A;  3QP6 A;  4GXO A;  4BHC A;  3HTS B;  1E2X A;  4A2U A;  3KE2 A;  1Z6R A;  4MEY F;  1KGS A;  4OIN F;  1H9G A;  2OAZ A;  5AIP A;  3ELK A;  4U0V A;  4DQ2 A;  1FP2 A;  1F1Z A;  4A0X A;  1ZN2 A;  1XSV A;  3FF5 A;  1TBX A;  4WXD A;  2M1B A;  5IT9 Z;  1S7O A;  1YW7 A;  1STZ A;  4TV7 A;  4QWQ A;  4U0W A;  3JSP A;  2PG4 A;  2ZFW A;  1O3Q A;  1WQ2 A;  4MTD A;  3KP6 A;  3VEP A;  1KU7 A;  1CF7 B;  2X0L A;  5ICC A;  2GAU A;  5HLH A;  4RB1 A;  2A5Y B;  4BQA A;  4N0B A;  3VB2 A;  2TDX A;  2DPU A;  3DKW A;  1HQC A;  1KU9 A;  1PUE E;  2HYG D;  4ZYH A;  1ZRC A;  3EYI A;  1SMY F;  2PN6 A;  2JPC A;  1ZHF A;  2Z9O A;  3WOD F;  4G6Q A;  1FNN A;  4A6E A;  1U6G A;  4EQQ A;  3H3Z A;  4LLG F;  2VE8 A;  1ZH5 A;  1K6O A;  3RKY A;  3OV8 A;  1W4M A;  3FMR A;  3RI4 A;  2V1D A;  4BXU A;  2FBI A;  2Z5U A;  2FOK A;  3F21 A;  4P5O A;  3BDD A;  4M9Z A;  3J80 K;  4OIP F;  2KKO A;  1R22 A;  3DEU A;  4PCQ A;  3RJP A;  3GFL A;  2FNP A;  4UVB A;  1YS7 A;  4JK1 X;  3DPL C;  5K5O A;  3LA3 A;  4DNC A;  1ZG1 A;  2XRN A;  1JGS A;  2STW A;  4L5I A;  1SD7 A;  1JHH A;  4IJA A;  2G7U A;  3RPQ A;  5HDG A;  2IJL A;  3WE2 A;  1TW3 A;  4KN4 X;  5ICF A;  3BZ6 A;  1BI1 A;  3MZH A;  2VC1 A;  2ACJ A;  4LG0 B;  4KMU X;  3U1D A;  3TOA A;  5D4R A;  4WX9 A; 
#chains in the Genus database with same CATH topology
 3CES A;  3BTI A;  4RB0 A;  1SVM A;  2E7W A;  1FBQ A;  2EZH A;  1ITY A;  2PBI A;  2NXN B;  3GCM A;  4U7B A;  1KYZ A;  3HOU J;  5D5W B;  6PAX A;  2OTJ I;  1UMQ A;  1ETK A;  2M4G A;  1MBH A;  1LEB A;  3O2P E;  3ZQG A;  4U7D A;  5FKO A;  1AA7 A;  1TZL A;  4YFK F;  3AAF A;  5J1R A;  1KU2 A;  3D0S A;  1QPI A;  4XOR A;  3I64 A;  2JSC A;  3HDD A;  2CQK A;  3J7Z I;  1QZZ A;  1ZG5 A;  4A3I J;  1KU3 A;  2MH9 A;  5JVT A;  3IKT A;  4XKC A;  4RBO A;  2LOO A;  4AYB A;  2K40 A;  4F92 B;  3JRH A;  1MNE A;  3HIF A;  4O6J A;  1VQ9 I;  1XSX A;  1TNT A;  1V54 H;  3CUQ A;  5CVU A;  4DW6 A;  2JSP A;  1RZ4 A;  1FPQ A;  3I0T A;  2H6B A;  3MFK A;  1BN5 A;  3K4B A;  2ZXI A;  1KQ9 A;  3S1N J;  2PJR A;  2WAF A;  4LIT A;  3ZQF A;  2Q2E B;  1NHA A;  1H88 C;  3CCJ I;  2L3D A;  1Y8R B;  2W82 A;  3TL4 X;  2EH3 A;  3QQA A;  1LQ1 A;  2FMY A;  2V9K A;  3OYK A;  3D1N I;  5E17 F;  4OMY A;  2JA8 J;  4CCK A;  3I4P A;  4CYC B;  2HYJ A;  5HVQ C;  3OOP A;  4HF0 A;  2XAU A;  2IW5 A;  3Q3S A;  3Q9S A;  1FSE A;  3ML6 A;  5A2Q K;  3B73 A;  4IOC F;  3VSK A;  4NDL A;  2R7F A;  2QYO A;  5LRR A;  1A36 A;  4XKV A;  4AIJ A;  2L2O A;  1S7A A;  2L5Q A;  3HHH A;  2O8X A;  5M5W J;  1QVT A;  5FRO A;  2JPB A;  2GWR A;  5D4S A;  2LBF B;  2X85 A;  1IZ1 A;  5LGN A;  1UFM A;  4LIU A;  1MMN A;  3GX4 X;  4XRS G;  4WXC A;  1D0X A;  4HX4 A;  1W7P B;  2R7R A;  3PO3 J;  1PVE A;  2VT3 A;  3OYA A;  5IT3 A;  2ZJQ F;  5IYD J;  2VKV A;  1FTT A;  4L9N A;  2DA6 A;  3RQI A;  2L7K A;  1HKT A;  2NVU B;  4D5C A;  2YSR A;  2I5U A;  4WWC A;  2XAS A;  3WTZ A;  4PSX A;  3CC2 I;  2LY1 A;  1X3Z B;  4E7Z A;  2P4W A;  3VWB A;  4NC6 A;  2QBY B;  1JTX A;  1NG6 A;  3IAS 2;  1DUX C;  5DTD A;  2HR3 A;  1TWG J;  2NRA C;  2F4O B;  2DMQ A;  2VKD A;  1VTN C;  2M7A A;  4EM2 A;  1UG0 A;  2Y48 A;  3HKZ A;  2RDP A;  5F64 A;  2JUG A;  3GUD A;  1LE8 A;  2M87 A;  1Q1H A;  4BJ5 C;  1TW2 A;  1MW7 A;  2B0L A;  4ABZ A;  1AKH A;  2IS6 A;  5JI6 A;  2Q0O A;  4DYQ A;  1ZQ3 P;  1MDM A;  4F7Z A;  1XMA A;  4LMY A;  4UNO A;  2K02 A;  4WF2 A;  4IOA F;  3BG9 A;  1HW2 A;  2HKX A;  4B43 A;  1TWH J;  3V4G A;  3I59 A;  2EIJ H;  3BTC A;  3HRS A;  4HQE A;  4I99 C;  4BEH A;  1J59 A;  1HA8 A;  2WB1 N;  2JK3 A;  2LMD A;  3VYR B;  1JHF A;  1J7K A;  1ETV A;  1MBF A;  2COB A;  3FMQ A;  4UV8 A;  1BI3 A;  4BXF A;  1B59 A;  1ZYR F;  3KEO A;  4QPO A;  3F8N A;  3KYC B;  3KP3 A;  2X9D A;  3LOC A;  3H0D A;  4Y52 J;  3L09 A;  1FYL A;  1T38 A;  1TT5 B;  2CO5 A;  5L3C A;  2R5Z A;  2IS1 A;  4KT5 C;  2P5K A;  2R5Y B;  2OC6 A;  3H36 A;  2MD0 A;  3RIR A;  4Y13 A;  1VQ6 I;  4ZYE A;  1B72 A;  2EFW A;  2KRF A;  2AO9 A;  3CF2 A;  2R7U A;  2P5L C;  2LH9 A;  2FA5 A;  3A2K A;  5IT9 K;  1LPQ A;  2WY7 Q;  2Z1D A;  1UHM A;  5F0C A;  1R5G A;  1WZ2 A;  1ZG3 A;  4KIF A;  4YFN F;  2M45 A;  2WV0 A;  3QU6 A;  5GAH J;  5ILU A;  3H35 A;  1JKO C;  1JXS A;  2ZXJ A;  4A3K J;  2GOM A;  1K78 B;  2ADU A;  2QUF A;  4S04 A;  3FMS A;  1FWZ A;  2QWW A;  3ABK H;  4MTE A;  1BIA A;  1XTA A;  3O8G A;  5JFR A;  1KQ0 A;  3CCV I;  1O3R A;  3AL0 C;  1K83 J;  1HDP A;  2ID3 A;  4WK8 F;  3K70 C;  3E1S A;  4MQV A;  4NQW B;  3RSN A;  2VOD A;  4YII A;  2P6T A;  1QNT A;  4IHY A;  3ASN H;  3MN2 A;  2PLY A;  4PDK A;  2D2W A;  2VQG A;  1B9M A;  2DDA A;  4PGG A;  1D0Z A;  3BOQ A;  1RKW A;  2BE5 F;  3REO A;  4LLN A;  2W1O A;  2R7V A;  3QAH A;  2JA5 J;  3ZQI A;  2EQR A;  2OU2 A;  3QPL A;  2DPD A;  4UY8 I;  1G3W A;  2L9N A;  3K9T A;  5LD2 C;  1YJW I;  2EZL A;  3TW7 A;  2NAZ A;  5J3L A;  2FU4 A;  4UV9 A;  4LLL A;  3DTI A;  1YTY A;  1ZGW A;  1D3Y A;  3RQ4 A;  1P4X A;  4KUM A;  3A0B C;  3KZZ A;  3TOB A;  5ICG A;  5IP7 J;  2EFP A;  2ZME C;  3OYE A;  5JR3 A;  3LSP A;  2JVG A;  1ERD A;  1MMD A;  2HNH A;  3FXQ A;  2ZSH B;  3CJR B;  1WRJ A;  3ZN0 A;  1TWA J;  4OWR B;  2CWE A;  3C3W A;  2Y0M A;  1IXC A;  1OCO H;  1BC7 C;  2JT1 A;  1XMX A;  1JT6 A;  2JUC A;  3WGH A;  3DTK A;  3FZV A;  1GUU A;  2KRC A;  2L7M P;  5FRN A;  2YU9 J;  4RM2 A;  3ZQL A;  4BBS J;  3QOE A;  1ON2 A;  2JVH A;  2X4H A;  1R1T A;  4D1Q A;  3E5U A;  4HDU A;  1G8X A;  1WI3 A;  1Y56 A;  1V55 H;  1EV7 A;  2XHK A;  1EH8 A;  1YQA A;  2I10 A;  4IQ4 A;  5BQT A;  3LSK A;  2LNB A;  3H9Q A;  4FX0 A;  1HCR A;  4FET A;  5D5V B;  1HSJ A;  3GFI A;  1R71 A;  2DAO A;  1RUO A;  3FKJ A;  2A6E F;  4HPQ A;  1VND A;  5FLV A;  5C3E J;  1J0R A;  2MSY A;  4A3E J;  3G3Z A;  1JKR C;  2L02 A;  5IOY A;  1LVA A;  1D8K A;  2PJP A;  2L7F P;  4BKX A;  1T2K A;  1X3U A;  2VQH A;  2TCT A;  3RCO A;  3DLA A;  1MNM C;  1WVR A;  3ZOB A;  3EET A;  3OS2 A;  2YX7 A;  5LEJ A;  4U87 A;  3CD6 I;  1EH6 A;  2CQN A;  2O8K A;  1FMV A;  3M9A A;  2QVO A;  1IRF A;  2X6O A;  3DF8 A;  4HNU A;  1K4S A;  3WG9 A;  3S1M J;  3SQN A;  3GTG J;  2CQ7 A;  3S93 A;  4C3H J;  1R00 A;  5C44 J;  2LKS A;  2JTV A;  2DOD A;  5FGM A;  4BHB A;  4IO9 F;  2LG4 A;  4M71 A;  2VQC A;  1YRN B;  2COM A;  2KPM A;  2UUZ A;  1G59 A;  1IUY A;  2MYS A;  2FML A;  1ZAR A;  4B4C A;  4JX4 A;  3F6O A;  2K7L A;  3SEQ A;  1MJ9 A;  3F8B A;  1E3P A;  4RAZ A;  4UUV A;  1SMT A;  5LHG A;  1J2X A;  2RGV A;  3CCY A;  4G6T B;  2FSW A;  3GME A;  4DZP A;  1XGO A;  3A01 A;  3GYH X;  3LSJ A;  3T5X A;  2M5W A;  4DBQ A;  5B5E C;  2VE9 A;  2DK8 A;  2UXX A;  2LKX A;  3ONQ A;  1WJF A;  2R7Q A;  4MO7 A;  4ASN A;  2NVT J;  3D5L A;  3BG3 A;  1HDD C;  4EM0 B;  3F23 A;  3S3N A;  2W48 A;  2FF4 A;  2R3S A;  4A3J J;  5F0F A;  1QO0 D;  3K4L A;  1UB9 A;  3OL4 A;  3CUO A;  3JAM Z;  2XKP A;  4CUG A;  5E3O A;  2ISY A;  1DPU A;  5KVR A;  3MKY B;  4E7H A;  3MMY B;  5IPA A;  4IHS A;  1FZP B;  1DU6 A;  2DFI A;  2E1N A;  1MSE C;  2H8W A;  2P7C B;  5D5X B;  1R58 A;  5DM6 F;  2QKM B;  3GTK J;  5M5Y J;  3OYN A;  4OIQ F;  5E79 C;  3V8L A;  3DPT A;  1P7I A;  1U9O A;  3BR1 A;  4W97 A;  5KK1 A;  3A03 A;  3ZP5 A;  5EGO A;  1X4P A;  1ETX A;  2CG4 A;  3ZMS A;  4BH9 A;  3MD2 A;  1T8I A;  1FSH A;  4PFO A;  2CYY A;  1KYW A;  3PM1 A;  2F48 A;  2DDB A;  3OYF A;  1DGR M;  2O9L A;  4BUP A;  4XSX F;  3OIO A;  3JRI A;  2FXA A;  4ZH4 F;  2M0M A;  3Q5F A;  3GF2 A;  4KNY A;  1SD5 A;  5H6R A;  1MBJ A;  2OCE A;  2P81 A;  2PFB A;  2YS9 A;  1LUJ B;  3X2Q H;  2ISZ A;  2M8E A;  1IDZ A;  1YLF A;  4EJT A;  4HEA 2;  4YFX F;  4X0G A;  1A35 A;  3B02 A;  5CYV A;  3S2D J;  2JA7 J;  4OIO F;  1ETY A;  4LK1 F;  3FKI J;  5HDN A;  4BHP A;  3SHF A;  3TDZ C;  2CV1 A;  4HX8 A;  2HFH A;  3ECO A;  1MH4 A;  3I4N J;  3CZ6 A;  2MLK A;  2R7S A;  5GTH C;  3MEX A;  2P7V B;  1VQP I;  4AC0 A;  1FP1 D;  2OV7 A;  1WPK A;  2XB0 X;  3VOE A;  1FBU A;  2BVM A;  4KFC A;  2HVQ A;  1VF9 A;  4IHT A;  1CQT A;  3JSO A;  2ESH A;  1F36 A;  5DCF A;  1P9Q C;  2Y2Z A;  4LB6 B;  1Y1W J;  2ZO4 A;  3H5R A;  4B8X A;  2LKP A;  3DWL E;  5J6X A;  2D1H A;  4R79 A;  4N9I A;  3WGI A;  2DLL A;  3VDX A;  2XDV A;  1QU3 A;  3OR1 C;  4MNU A;  4RGR A;  3BCB A;  1R5I D;  3CLO A;  2Y9Z A;  1MSF C;  2FD5 A;  2E1M C;  1U2W A;  2CFO A;  3HKZ N;  1OCZ H;  2HKO A;  2EIK H;  1QBJ A;  1SVO A;  2E2J J;  4OOI A;  4RGS A;  1YO5 C;  4XN3 A;  3I56 I;  2P8T A;  2VXD A;  4XMY A;  5HNF A;  3S2W A;  3AG1 H;  2MLG A;  3F6V A;  1K7A A;  4XL9 A;  5LBQ A;  1IG7 A;  3GTQ J;  3DP7 A;  4FX4 A;  2CJJ A;  5CPR B;  1QGP A;  4IF4 A;  4IHX A;  4RGU A;  1RET A;  2HTJ A;  2CUF A;  4GO1 A;  2EBI A;  5FKM A;  4BY7 J;  4DYR A;  5LGU A;  3LMM A;  2QQ8 A;  1QHG A;  3QP5 A;  2E19 A;  4XLA A;  2KLO A;  1DP7 P;  2ZBK A;  2V1X A;  4IKF A;  4CXF A;  2VL8 A;  3CQZ J;  4P9U A;  2ZME A;  3HHG A;  1IRX A;  3DXJ F;  1IXR C;  2ICW G;  2ZCW A;  2ELK A;  5KAI C;  3BTL A;  3HRM A;  3J7A O;  1PP7 U;  3HUG A;  3R6S A;  4G7H F;  2X6W A;  2DXI A;  1Q1V A;  4DIQ A;  5FLX Z;  4M6V A;  4D7M A;  3LAP A;  2BBY A;  1ZLJ A;  1S29 A;  4A0Z A;  3WG7 H;  1B1B A;  2DQL A;  4C2M J;  1BC8 C;  2VJJ A;  2MA3 A;  3GFJ A;  4G7O F;  2W00 A;  3F22 A;  1WH5 A;  3NEU A;  4AIK A;  2RAE A;  3EUH A;  4LOC A;  2P6S A;  3IP4 B;  1H0M A;  1BA5 A;  1G4D A;  2KL4 A;  3UNG C;  2W4S A;  5J40 A;  5E20 A;  1W5S A;  5JLW A;  2HTS A;  4I09 A;  2E1M B;  3ABM H;  1FYK A;  5C4X J;  1MH3 A;  1NG7 A;  4IPA A;  1VQ8 I;  3OYL A;  1R49 A;  2A61 A;  5EG0 B;  2KQR A;  4RS8 A;  2XAQ A;  2B9S A;  3HSF A;  4V19 K;  1GHC A;  4GRI A;  5B1A H;  4A5M A;  3FWE A;  4HA8 A;  5FRM A;  3DU6 A;  1LEA A;  1OQY A;  5F6F A;  3WE3 A;  2BEO A;  3GTP J;  1WI9 A;  4HBL A;  3L2C A;  1WKM A;  1OKR A;  3KIO A;  2KJC A;  1IN6 A;  5J1U A;  5FKN A;  1OMI A;  2Z99 A;  3ABL H;  4L9J A;  1T39 A;  5FKL A;  3CDI A;  2QF7 A;  5BOX A;  3OOU A;  4Q48 A;  3GXO A;  4A12 A;  1I6H J;  3P5J A;  5F04 A;  1U5T C;  4XID A;  1J75 A;  3KZI C;  4KDP A;  3CCU I;  4UVC A;  1X1A A;  3OSG A;  1B8I A;  1U78 A;  3KCC A;  1N25 A;  2E36 A;  1A04 A;  4H4K C;  1ORK A;  1T0F C;  4JOM A;  4EJV A;  1HLV A;  4XR6 A;  5FD6 A;  2LY2 A;  2DYS H;  2W85 A;  2HGC A;  3BPV A;  2JZY A;  1V3F A;  1Y39 A;  1YW8 A;  3KYD B;  2BY3 A;  2QEN A;  2EV5 A;  2LP0 A;  3SEZ A;  2GA1 A;  3OYM A;  3TGN A;  4AD9 A;  2MW8 A;  2EK5 A;  2R7D A;  3F9K A;  4BAC A;  1YFH A;  1LB2 A;  4XRM A;  2IEK A;  2F2E A;  2QQA A;  3ERM A;  5E3N A;  4J00 A;  1U0J A;  1R23 A;  4A3G J;  3BQY A;  5TGT A;  5BNG A;  1M1E B;  4HYE A;  5LGT A;  3OYG A;  1TL8 A;  4Y7N J;  2V6E A;  3VFZ A;  4JX5 A;  2AS5 F;  3JTH A;  4HNT A;  1RRJ A;  5FFX A;  4A3M J;  3ISP A;  1ZRE A;  2XAG A;  4I98 B;  1SAN A;  4ENM A;  2BW3 B;  4P1W A;  2WY8 Q;  1XGN A;  4BXX J;  3LNQ A;  2NYX A;  3SJM A;  2GZW A;  1Z21 A;  2VOO A;  2O6G E;  3I54 A;  2CW8 A;  2L0K A;  3ABU A;  1YS6 A;  4IRG A;  4C3I J;  2IT0 A;  1U9N A;  5CJ9 A;  3BJO A;  2EFN A;  2MC4 A;  3GLL A;  2QQ9 A;  2JJ7 A;  4KMF A;  5IYB J;  2ZC2 A;  3A0H C;  3HOW J;  2HWV A;  3KP4 A;  3BLY A;  4HG2 A;  1YW9 A;  1U5T B;  5J8C A;  2W84 A;  5DD8 A;  4HRI A;  4NNJ A;  3GTM J;  2KIS A;  3H3U A;  1IV6 A;  2YPR A;  2RN7 A;  5DD4 A;  2RVC A;  1P7J A;  1W1W E;  3DKX A;  2K5C A;  5JLX A;  1FY7 A;  1DU0 A;  3G1L A;  3R0A A;  1OYW A;  2KT0 A;  3HOT A;  5DDG A;  3E7L A;  2HPM A;  1CF7 A;  3WGG A;  3S15 J;  2K4B A;  2Z2S B;  1VQO I;  3CO6 C;  4F55 A;  1JJ8 C;  1B72 B;  2OZU A;  3BPX A;  2VPL A;  1HW5 A;  1Z3Y A;  3FBI B;  2DFF A;  1H8A C;  1W36 C;  3R60 A;  3MQ0 A;  5ERI A;  2H1L A;  3D5S C;  2DMN A;  5E1X A;  4CIC A;  4GYI A;  3ZQ7 A;  3N97 A;  2Y69 H;  3I55 I;  4HZF A;  3IKV A;  3K6G A;  2QEX I;  2DO7 A;  3RKX A;  4ZTF A;  2LYC A;  1XDS A;  1RPW A;  2IGN A;  4KT6 A;  2HZD A;  1RNL A;  3RYR A;  4D0P A;  4AIH A;  3JAM K;  2DMT A;  3KET A;  1OIS A;  1JT0 A;  3BY6 A;  4L9V A;  5FB2 A;  1ETO A;  3PNV A;  1GT0 C;  1G3T A;  4EV0 A;  5L3F A;  2A3S A;  4XLE A;  1XB4 A;  1BW6 A;  1KA8 A;  2NS8 A;  3PSI A;  4BE0 A;  4ENN A;  3ULQ B;  3RZO J;  4B3X A;  1D1B A;  2HYF A;  3P9C A;  1FMW A;  1SFU A;  5HOD A;  2DA2 A;  4PK4 A;  4DOZ A;  3S32 A;  2ID6 A;  2A68 F;  2L4A A;  2WAQ N;  4E7J A;  2E5N A;  3PUF A;  2DA4 A;  2VKH A;  3CDL A;  3GLX A;  2YUS A;  3PQK A;  4PJL A;  3VOD A;  3JRF A;  5K7Z A;  2EA4 A;  1V5G A;  4ESF A;  2JWT A;  3G73 A;  4XOT A;  3V8J A;  3ASO H;  3GWZ A;  3FBN B;  4B1R A;  1HBX G;  1X19 A;  3DPU A;  2VBY A;  3TDU C;  3MKL A;  1IAW A;  2MGQ A;  1F43 A;  1LFB A;  1OCR H;  2CMP A;  2V1N A;  2E60 A;  4GYG A;  1FLI A;  5GAG J;  3FXO A;  2DTR A;  1XD7 A;  2K3P A;  3W2V A;  2CV0 A;  1MBK A;  1WHU A;  2GXG A;  5HDK A;  2C6Y A;  1ZEL A;  4M74 A;  4Y33 A;  3UKG A;  4IVN A;  4S0H B;  5K7H A;  3HYI A;  1FOX A;  4XQF A;  1UHS A;  1Y0N A;  5EZH A;  3JRB A;  3PNT A;  3H5A A;  2Y0S N;  5KCM A;  2DTZ A;  1HW1 A;  4JQF A;  2DJI A;  4B3A A;  3KYL A;  2R7X A;  3CO7 C;  2DI3 A;  1TQM A;  2MC3 A;  1D1C A;  3BR0 A;  3QU3 A;  2BYV E;  4HAM A;  1JE8 A;  4GDF A;  4N4O B;  2BY2 A;  2XIG A;  3K2A A;  5H20 A;  1XPX A;  2EA2 A;  3S14 J;  2IS4 A;  1NK2 P;  2FBH A;  3GTO J;  4I02 A;  3R4K A;  4A3B J;  1ZRD A;  5DEQ A;  1YHQ I;  3RKW A;  4LG0 A;  1G6N A;  2JMW A;  4PJ0 C;  1V5E A;  2XRL A;  5ILV A;  5BS6 A;  2DQR A;  1XCV A;  1F9N A;  4I2O A;  3J7Y J;  2V9V A;  3ZMD A;  1USS A;  3O3K A;  2WC2 A;  3VPR A;  1SFK A;  3WTT C;  2PMZ A;  3IUO A;  3ZQH A;  5K5Q A;  2H09 A;  3DBH B;  1IN4 A;  3J7A Y;  1P4W A;  2QCO A;  1T98 A;  1R1V A;  2DBB A;  2EV0 A;  3V7C A;  3KP5 A;  5L3B A;  1Z3X A;  3Q9V A;  1F5T A;  1W7P D;  3BR6 A;  4BDZ A;  3HG9 A;  3HOS A;  3M8F A;  4YEL A;  1MIJ A;  1AU7 A;  3FM5 A;  4FAS D;  3GZ6 A;  2DA3 A;  2XPV A;  4IZZ A;  4MQ9 F;  2IA0 A;  3L7W A;  3ZMT A;  3UR3 C;  2JA6 J;  1Z1D A;  1TP4 A;  1X2N A;  2CW7 A;  4M9X A;  1A6Q A;  2L7Z A;  2A5W A;  1MMG A;  2ZB9 A;  4NUB A;  2RKH A;  3V7R A;  1B4A A;  4G94 A;  3CF5 F;  5FLX K;  2LDU A;  2Q2E A;  2DT6 A;  3Q0U A;  1T6S A;  4B47 A;  3T1B A;  3L9F A;  3AG4 H;  4XLP F;  3ECH A;  1OR7 C;  2E5Z A;  4RB3 C;  3SFZ A;  2Y30 A;  5L3E A;  1Y1V J;  4CYC A;  1OCC H;  3RYP A;  3CCM I;  2H1K A;  3PFI A;  1QHH D;  2YX4 A;  4HW0 A;  3CME I;  5IY5 H;  2HVR A;  1R4M B;  3N05 A;  5FD5 A;  1BOA A;  4XLC A;  1TLH B;  4Q4Z F;  2LR8 A;  4CCJ A;  2LFB A;  1XSD A;  5AON A;  4PJN A;  3LQR A;  5F08 A;  3E3V A;  4E70 A;  2LBF A;  5IYC J;  1LDD A;  3MAJ A;  3DCF A;  2CFX A;  1MBE A;  2EIL H;  2STT A;  1IXS B;  2HDW A;  4PUS A;  3QPS A;  4ESB A;  2V79 A;  2WWY A;  5HLI A;  3EPZ A;  3G2B A;  4KYW A;  5FO5 A;  1IRZ A;  2R7Z J;  3HPG A;  2BXZ A;  5HNH A;  1VZ0 A;  2IA1 A;  2DT7 B;  3BTJ A;  3PUB A;  5F1R A;  2R7W A;  1K79 A;  3K2Z A;  1AWC A;  4XON A;  1TNS A;  3HL2 A;  1WCM J;  3U21 A;  5ED4 A;  4MFE A;  2EIM H;  4P55 A;  1IDY A;  2NNN A;  2A69 F;  3GFM A;  3LFK A;  1Z0X A;  3OYH A;  5FLM J;  2QBY A;  2KIM A;  2V1U A;  3GVA A;  3B6C A;  1S6L A;  4ZYD A;  2W7N A;  3QPH A;  2L01 A;  2RNJ A;  1L0O C;  1X2M A;  2KZV A;  2E71 A;  1WJB A;  2XUB A;  4IRH A;  4Q47 A;  4A3L J;  3G71 I;  4S05 A;  4RDU A;  1QQI A;  2QLZ A;  4IHW A;  1MGT A;  2GIV A;  1TQI A;  1REP C;  5DM7 F;  2LY9 A;  4HV6 A;  2VJ4 A;  5GP9 A;  4HF2 A;  1OYY A;  4M6Y A;  2IGM A;  3HBL A;  4EJU A;  1X4O A;  3SDB A;  2FBK A;  4FQG A;  4I76 A;  5E3L A;  4GGG A;  5CQG A;  2ELJ A;  5IOZ A;  3FIW A;  2L9R A;  3CCQ I;  2VT2 A;  3ZQC A;  5FJ8 J;  3H9G A;  4IEJ A;  1G2H A;  2HS5 A;  2KRH A;  2MH2 A;  3LA7 A;  1BIB A;  4K2E A;  1OCP A;  3VYS B;  4ZZL A;  2GQQ A;  3ZMV A;  2IA2 A;  1PJR A;  3WU2 C;  3JRE A;  3ZXS A;  1AHD P;  2GLO A;  3QYB A;  4PFP A;  3FXL A;  5L3G A;  2M34 A;  3PJR A;  1QZE A;  3OIQ A;  4XM3 A;  4J19 A;  4BGD A;  4UUS B;  5FKK A;  3ERE D;  4HOB A;  5TJJ A;  3CJQ B;  1Z7U A;  2DOA A;  4U0Y A;  2R5Y A;  2HXO A;  5GAD J;  3Q0V A;  3I5U A;  3M3Y J;  3BP8 A;  3IC7 A;  5JHF A;  1J5Y A;  1IRG A;  2M4K A;  4ZYG A;  5HS9 A;  4X6A J;  1IJW C;  1YIT I;  2EV6 A;  2V4J C;  1ZAO A;  2DA5 A;  1WWX A;  5KAF C;  5BPI A;  3NQO A;  1SFX A;  1LDJ A;  4EVI A;  2XRO A;  3JR9 A;  3DQV C;  4AYB N;  1RKT A;  1K78 A;  3IHU A;  4GFB A;  4E7S A;  2JRT A;  1RUN A;  1DDN A;  4YIR X;  3LSH A;  5ILS A;  2L9V A;  1TQP A;  1U3E M;  3ZCO A;  2AXT C;  4CCM A;  2IXS A;  5LHH A;  3FHZ A;  3IRQ A;  3HRU A;  2NS0 A;  5K1Y A;  2J5O A;  1MKM A;  4NQW A;  3OYC A;  2E1C A;  3I3L A;  3TP3 A;  3KLN A;  5HS7 A;  3K70 D;  3WTS C;  1EJ9 A;  4ESJ A;  4KJZ A;  2D45 A;  2ME6 A;  4LG3 A;  4CDG A;  2ZNZ A;  2GXB A;  3OYI A;  1JUM A;  3DKY A;  3LST A;  5CVV A;  1MBG A;  1DQU A;  2BHZ A;  2DYR H;  5IP6 A;  1MMS A;  3SDG A;  2DK5 A;  2KP6 A;  5CVJ A;  2XSD C;  3FK6 A;  5HLT A;  1O57 A;  4EEF G;  4AU7 A;  4QLC U;  5GTI C;  3C2B A;  3BWG A;  4CSW A;  4ZTJ A;  2R7T A;  2EIN H;  4ZDL A;  2RNG A;  1W0U A;  1J9I A;  1WFX A;  1A5J A;  4XKW A;  2VN2 A;  2PMU A;  1S72 I;  2CU7 A;  4G12 A;  4A0Y A;  2UXN A;  2LF7 A;  2XB5 A;  3O8H A;  1LVK A;  2GBY A;  1Y6I A;  3HGG A;  3PSF A;  2MAB A;  2XSJ C;  4II3 A;  2QQB A;  1SFO J;  1ZR2 A;  3S16 J;  2BOL A;  4GCV A;  1UCR A;  2QSH X;  4HX7 A;  4R8H A;  4E6K G;  2OZ6 A;  4LD5 A;  4Z6Y A;  3JTG A;  1ODD A;  5LEK A;  4RAF A;  3K4N A;  3S3O A;  3HOY J;  4CCO A;  5AIQ A;  1MJA A;  3M07 A;  1NH3 A;  1FIP A;  3PO2 J;  1BJA A;  3FXU A;  4O3M A;  2VJ5 A;  5H6Q A;  1QPM A;  4G7Z F;  1ZRF A;  4HLX A;  2NNY A;  1PP8 F;  4L5J A;  1FX7 A;  2DOF A;  1JI8 A;  1IW7 F;  2YR2 A;  1IUF A;  2FNA A;  4D9J A;  4AVP A;  2DFE A;  3CUQ C;  4CCN A;  1BJZ A;  1WJE A;  1P4A A;  2HOA A;  5FFZ A;  2FRH A;  2EFO A;  2A6T A;  3FK7 A;  3TMO A;  4DYC A;  5HS8 A;  2BY1 A;  5D6F A;  3BG5 A;  1OR7 A;  2RC4 A;  1MND A;  2RV8 A;  3FM3 A;  3H92 A;  2JQ7 A;  2HOE A;  3IWZ A;  2XF6 A;  4B48 A;  1JKP C;  1VQ4 I;  4M3D A;  2DW4 A;  2EB7 A;  4V2G A;  1JUS A;  1IC8 A;  3CP2 A;  2FX0 A;  2IGK A;  4RGX A;  3MWM A;  4ENK A;  2NVX J;  3E6C C;  3K0L A;  4OU0 A;  3R61 A;  2M8G X;  1AOY A;  3S8P A;  1ETW A;  3S3M A;  3E6M A;  2DA1 A;  3K10 A;  4F52 A;  1A31 A;  3LWF A;  1T95 A;  5J1Y A;  1ZTR A;  4C2U A;  3TO9 A;  4E4H A;  4ZYA A;  4HST A;  1YRN A;  2K86 A;  3T8R A;  3RPU D;  3LL7 A;  1X1D A;  2CW0 F;  4HQM A;  4BDY A;  2LRE A;  4AVZ A;  1WJC A;  1J09 A;  2PMZ N;  3WU1 B;  2RRE A;  4IQJ A;  3BQZ A;  5M3M J;  2HI3 A;  2Z16 A;  1E3O C;  4E7I A;  5EYR A;  2NOJ B;  1O3T A;  4BE1 A;  2R4G A;  1I50 J;  4EJO A;  1EH7 A;  4M3F A;  1RES A;  2AXL A;  1YIJ I;  1DPR A;  1LFP A;  2OD5 A;  1LFU P;  1VQ5 I;  2PX9 A;  3EUK L;  1HC8 A;  4CCL A;  2GXA A;  4AUX A;  3CUQ B;  1LNW A;  2VBX A;  3BR5 A;  1I6X A;  1E3H A;  3LSG A;  4AWX B;  1R5H A;  2F4I A;  5DYM A;  4R1H A;  2G7H A;  2LSO A;  4MEX F;  2PJR B;  5D5U B;  3U9G A;  5J4Y A;  2M30 A;  2XAF A;  3GTL J;  2BGC A;  3BT9 A;  3SZG A;  1YX5 A;  2DCE A;  2VXZ A;  3FXK A;  1U8B A;  5CVR A;  2J5P A;  4FIS A;  1IV8 A;  3ZMU A;  3M7G A;  3OYD A;  3HZJ A;  4A3C J;  1P6R A;  2W24 A;  4MGR A;  2M9H A;  1ACI A;  2CRG A;  1SD6 A;  3M1C A;  3WTV C;  1JJ6 C;  1OJL A;  3E6D A;  3SZP A;  1MJB A;  2F5F A;  2RQQ A;  1H89 C;  1ZR4 A;  3DFG A;  1QA6 A;  3CC4 I;  2VI6 A;  4ANJ A;  4NBQ A;  3RPU A;  4OAZ A;  3L2W A;  1SEU A;  2DJN A;  1Z6T A;  5DCM A;  3H9J A;  1PUF A;  1HF0 A;  3CCL I;  4RMN A;  2BV6 A;  1TT0 A;  4XKB A;  3WTY C;  3BG7 A;  4N9H A;  3I58 A;  2F5C A;  1IF1 A;  2OF7 A;  1PDN C;  3O6B B;  4IXA A;  2O7O A;  2QA4 I;  3V7S A;  3BJA A;  2K9L A;  1ON1 A;  1X1B A;  3F8M A;  2XPW A;  4U88 A;  4BY1 J;  1OYI A;  4KA4 A;  3RDI A;  4B09 A;  1HKQ A;  4YRV A;  1APL C;  1XGS A;  2L4M A;  5GAE J;  3KPH A;  2HDC A;  3W6V A;  1GVD A;  3IH2 A;  2ZXW H;  3OS1 A;  3E97 A;  2H6C A;  2OA4 A;  5J8F A;  2OTL I;  5E8I A;  3CMM A;  3KFW X;  3HGY A;  1TTY A;  4J01 A;  4ZC3 A;  1I1G A;  2O0Y A;  2CUZ A;  2OQR A;  4XRF A;  3HSE A;  2X51 A;  1LE8 B;  4MFD A;  5M5X J;  1FOY A;  1B6A A;  3N4M A;  2F4M B;  4OAY A;  3M1E A;  4Y3O A;  5J4V A;  2ZJP F;  4L18 B;  2BHY A;  1T56 A;  2GOX B;  3L00 A;  1AKH B;  2N8G A;  3F3X A;  4LFU A;  4DJA A;  4I6Z A;  1ZLK A;  4QTR A;  1MDM B;  1ONV A;  1RC9 A;  3L2U A;  4LK0 F;  3J81 Z;  1C0W A;  3I4M J;  2IBD A;  2YU3 A;  3ZPL A;  3DLL F;  1IN5 A;  4BYY A;  2DOE A;  3I59 B;  2HQ5 A;  4KIT B;  1TWC J;  2IPQ X;  1I3Q J;  1ZGJ A;  2K85 A;  3I71 A;  1I1S A;  2XGE A;  5M3F J;  4BEH B;  3C18 A;  4M6X A;  4CHU A;  3P7N A;  1BBY A;  1K61 A;  4MHG A;  4XBF A;  3IRR A;  2XF5 A;  2M3A A;  3S17 J;  4ZZD A;  3HRT A;  3F8C A;  3K4J A;  1RI7 A;  2ELH A;  4AM3 A;  2IP2 A;  4E7L A;  3OYJ A;  2GM4 A;  2FQ3 A;  5E1W A;  5CKT A;  5K7F A;  2R92 J;  2LK2 A;  4P96 A;  4RB2 C;  1TC3 C;  1FTZ A;  4XSZ F;  3AKZ A;  2LLK A;  4UB8 C;  1W0T A;  2R5Z B;  2Q8K A;  3EUA A;  3K69 A;  1R1U A;  4RLQ A;  1K4T A;  2CSO A;  2LVS A;  1XMK A;  4X1E A;  1YJN I;  1CGP A;  4C30 A;  3PQJ A;  2R7O A;  3AG3 H;  3BG6 A;  2HQR A;  4QSH A;  3E6B A;  2K27 A;  5DS9 A;  2JRM A;  1OLT A;  3L2R A;  1ENH A;  1XDU A;  2ZNY A;  4ITV A;  2Z3Y A;  5HOO A;  4EGY A;  2HZT A;  4A93 J;  3FX3 A;  5EG0 A;  4UHT A;  1SVL A;  2VC0 A;  4L0Y B;  5B66 C;  1H9T A;  1XCB A;  3HJE A;  1WJA A;  1V4R A;  2X1D A;  5J47 A;  4D7N A;  3LAJ A;  2P5V A;  2O3F A;  1Z7L A;  1ZGA A;  2M7B A;  3CJT B;  3BR3 A;  5LLQ A;  5B1B H;  3K1M A;  4JBA A;  4Y15 A;  2ZJR F;  4NC8 A;  2NVY J;  1OCT C;  2VKE A;  1JGG A;  1XGM A;  2ECB A;  2MD5 A;  1WJD A;  3P9I A;  1QZY A;  1I27 A;  1SAU A;  3WTU C;  5ICE A;  5HLG A;  3LQQ A;  1R4N B;  4M3G A;  3MCZ A;  3QYE A;  4M3B A;  1D1A A;  2K4J A;  3TO6 A;  4A6D A;  4F93 B;  2XAJ A;  1XN7 A;  1JKQ C;  3P9K A;  2XC7 A;  2F6C A;  5C4J J;  3BJ6 A;  3W3C A;  3K4M A;  3A4C A;  1VQL I;  2X1E A;  3JRG A;  2CGP A;  3WTX C;  1FEX A;  1S9H A;  2F5D A;  1S7E A;  3PIP F;  4EGZ A;  3OWT A;  3TW6 A;  2ZXH A;  3VSL A;  4W1U A;  4G9Y A;  2O03 A;  1G3Y A;  2EJR A;  4OMZ A;  5BMZ A;  5EF6 A;  2RQP A;  4LGW A;  4BS9 A;  1YJ9 I;  2HEO A;  5E8G A;  4BAY A;  5JHU A;  5TIS C;  3WHC A;  2HOT A;  5E3M A;  3JRD A;  1HXD A;  2FE3 A;  1SAX A;  2KIU A;  2LF8 A;  4MLO A;  1BM9 A;  4BJ6 C;  2OJE D;  1FC3 A;  1UG2 A;  4UVA A;  4EMS A;  3ZMZ A;  2OQG A;  3MZY A;  4C9Y A;  2CUE A;  3DEE A;  4M3E A;  2LTP A;  1S8N A;  2VAS A;  2BXY A;  1O3S A;  4Q5S F;  2E1O A;  2QM3 A;  3GBG A;  2CH0 A;  4OIR F;  1YX3 A;  3OL3 A;  1BI0 A;  1XS9 A;  4M73 A;  2XV4 S;  2BW3 A;  3GEZ A;  2VOP A;  3SZT A;  5DV5 A;  3QOD A;  3KLO A;  2W57 A;  2HPI A;  2XGD A;  3E5Q A;  3FXR A;  4LIV A;  3OY9 A;  2KZG A;  4YIF A;  1MD0 A;  3IL2 A;  4CZZ A;  4UB6 C;  1VI0 A;  1RIO H;  1DGW Y;  4CGZ A;  2LC2 A;  2XVC A;  1VFC A;  2XGC A;  5EEA A;  1DP3 A;  1YI2 I;  4RAY A;  3HOX J;  2K3F A;  1NK3 P;  4C2T A;  1U5T A;  2CQX A;  2P0W A;  4HSR A;  2E34 A;  3G1O A;  4CA0 A;  2E35 A;  2ZKZ A;  4KIB A;  1BR4 A;  5LHI A;  2R93 J;  5DUK A;  1T0F A;  4Z2Y A;  5D8K B;  5KHD A;  5LRS A;  3TED A;  4NHJ A;  3K4C A;  2H8R A;  1E0E A;  2FOW A;  1N78 A;  1D8J A;  2EZI A;  4XIC A;  3TP0 A;  1Z9C A;  3WU0 A;  3I53 A;  3W2W A;  2XGX A;  2XKO A;  2VLA A;  3CTA A;  3K7A J;  1OPC A;  3HTU A;  1FOK A;  2XAH A;  3OMY A;  1D5V A;  2TRT A;  3DV8 A;  4G8X A;  3LA2 A;  1SD4 A;  3K1P A;  2L54 A;  3A01 B;  2HVS A;  1W36 D;  2Q1Z B;  4DGW B;  4E7K A;  3SXY A;  3CJN A;  3NAU A;  3PIO F;  3CP8 A;  4JX6 A;  5EJC A;  4RLF A;  1W5C C;  1Z05 A;  4H0E A;  4QIW N;  2HXI A;  2VBW A;  3KZY A;  2LRD A;  2OBP A;  1SC7 A;  5EDN A;  4HDV A;  2BVL A;  2KDZ A;  4B44 A;  3B6A A;  3MKW B;  1ULY A;  3F0C A;  4KIC A;  3CMY A;  1R7J A;  1Y0U A;  2ESN A;  1GXP A;  4F91 B;  4I7H A;  3ZRG A;  4BBR J;  3FXM A;  2EPF A;  3BRO A;  4FE7 A;  3DU5 A;  3W6K B;  3W6J B;  3J80 Z;  1GDT A;  3S2H J;  4BE2 A;  5EGO B;  1GVJ A;  4ETS A;  2A07 F;  2PEX A;  4CYD A;  1O7F A;  3C1D A;  4IL6 C;  3OSF A;  3QWL A;  1UZC A;  1QRY A;  1W7P A;  4BQQ A;  1LJ9 A;  2KMU A;  3U2R A;  3TQN A;  4HV5 A;  1T08 B;  3MKZ A;  4HNV A;  2HQN A;  3T8T A;  2O5R A;  3WTW C;  2Z33 A;  4ENJ A;  3M8J A;  3A02 A;  4CO8 A;  1TWF J;  2UWM A;  3NRV A;  4PJJ A;  2K9M A;  1BW5 A;  3MZ8 A;  4N4N B;  4KN7 X;  1I3A A;  3K4K A;  4I01 A;  3QPT A;  5KNL A;  2QSG X;  3H3V K;  4A3F J;  3BZK A;  2DMU A;  2EWN A;  3GO5 A;  4FTH A;  1YIO A;  5F0H A;  1X1P A;  4ZDP A;  1KZH A;  1E17 A;  1I5Z A;  2A05 A;  2H94 A;  3GZ5 A;  5EEG A;  5TRD A;  1RR8 C;  1W5T A;  3EUH C;  1N75 A;  1GXQ A;  4XNF A;  4BU2 A;  4YEJ A;  3F8F A;  1O4X A;  1KQ8 A;  4EM1 A;  1BL0 A;  1JUP A;  2D1V A;  2WTE A;  4XLH A;  3L2Q A;  1Z91 A;  4WCG A;  4LB5 A;  2H27 A;  2DN0 A;  4YG2 F;  1WH7 A;  2DT5 A;  3QOP A;  5L3D A;  3BR2 A;  3F72 A;  3AL0 B;  1OFC X;  1XG1 A;  1N77 A;  2X6Y A;  3PNY A;  4I0A A;  5EZG A;  5DUI A;  3CDH A;  3FDY A;  4LJZ F;  5BPD A;  1BI2 A;  2KDO A;  2KJB A;  2VBZ A;  3DBL B;  4ON0 A;  2X6X A;  4IHV A;  3L1P A;  2ETH A;  3HEF A;  2F5E A;  1BR1 A;  1WSU A;  2F5V A;  2W25 A;  5CVI A;  1R36 A;  4FT8 A;  4A69 C;  4XLN F;  3IH3 A;  4NB5 A;  2ZJ2 A;  4L0Z B;  1F4K A;  4O5V A;  3K1N A;  4L5E A;  2UV1 A;  3J81 K;  1YG2 A;  4F3Q A;  2G9W A;  5D8L B;  1UJ8 A;  4DZJ A;  2NVQ J;  3H0G J;  3C7J A;  1EKE A;  4XLF A;  2ZME B;  2VIX A;  3JW4 A;  3HXL A;  2HDD A;  2B63 J;  2K9N A;  3ROU A;  3HUG B;  4KIG A;  3EQL F;  5E1Z B;  1A6I A;  3C2G A;  2K9S A;  2FUG 2;  2OUM A;  1YYV A;  2FJ1 A;  3DBR B;  3M8E A;  1FBS A;  2FEZ A;  3ABT A;  1R6R A;  1UHW A;  4HLY A;  1IN7 A;  4PZJ A;  2WA0 A;  2DA7 A;  2JA2 A;  4G6D A;  1SFE A;  3JCU C;  3I9V 2;  4RA2 A;  3RTR A;  4CH7 A;  2NOG A;  3L2V A;  2Y75 A;  1B9N A;  2VON A;  4RAG A;  3SFI A;  2EFQ A;  2HU9 A;  2ME0 A;  1KON A;  2L9S A;  2X1C A;  2IS2 A;  2Y9Y A;  2E7X A;  4A5N A;  5A2Q Z;  1XC5 A;  3V8K A;  2UZK A;  3GW2 A;  4FHT A;  2CV2 A;  2GA2 A;  1HST A;  4JYK A;  4WXH A;  4Y17 A;  4BL0 B;  3A1Y A;  4QPQ A;  3HOV J;  3S1Q J;  2VB6 A;  4PGH A;  4AID A;  1S3J A;  1X3W B;  1FT9 A;  2V9P A;  4P9F A;  3JRA A;  2DU9 A;  3HM5 A;  2KHM A;  4L9T A;  4XN0 A;  4FE4 A;  1FYM A;  4EJW A;  3V42 A;  2PI0 A;  3COA C;  5K5R A;  4C3J J;  2AQF A;  4M9S A;  2O61 A;  1VQK I;  2PMH A;  2XF7 A;  2NS7 A;  3NWS A;  2QSF X;  3G4S I;  2OPT A;  2IAI A;  1U8R A;  1P92 A;  3HC7 A;  3QRF F;  5E18 F;  3R0J A;  1G3S A;  2WAQ A;  2JN6 A;  1O7L A;  3FIS A;  3KP7 A;  4A3D J;  2IRF G;  5JVG F;  1IN8 A;  2ECC A;  5CLS A;  2CS3 A;  3ZN1 A;  1V5F A;  3KP2 A;  3IWF A;  1MZB A;  2ZFU A;  3KEQ A;  3T0Y A;  3G1M A;  1LDK B;  2KIF A;  2BY0 A;  2GIZ A;  3HB9 A;  5DCM B;  3DEW A;  5IP9 J;  1B8I B;  2IVM A;  1PUF B;  2QKL B;  2A6H F;  2QZ8 A;  5F1J A;  3GZN B;  1P2F A;  3TKY A;  4HF1 A;  3SYT A;  1FOW A;  1BR2 A;  1MMA A;  3HPH A;  1D5Y A;  2WBM A;  3E5X A;  3IV5 A;  1VQM I;  2PQ8 A;  3IH4 A;  3PL8 A;  4IRI A;  1FJL A;  1Z67 A;  3HSR A;  3FXJ A;  1L3L A;  2M2E A;  4CZC A;  1GV5 A;  5F27 A;  3CCE I;  2V6C A;  2EZK A;  1HKS A;  3EYY A;  1IO2 A;  1EA3 A;  2B7E A;  1UST A;  3TO7 A;  3ESW B;  3LSR A;  3EDP A;  2MBF A;  3RKQ A;  5D6E A;  4UXN A;  4BNC A;  3MVP A;  4I0B A;  2D5V A;  5EEH A;  4M72 A;  3QP6 A;  3CCR I;  4GXO A;  4BHC A;  2Y0S A;  3HTS B;  1S5L C;  4JP0 A;  4II2 A;  4BJT A;  3PFY A;  1E2X A;  3JRC A;  2K9Q A;  9ANT A;  4A2U A;  3ZGK A;  2AHQ A;  1VQ7 I;  5GPA A;  3QYF A;  3KE2 A;  3H1C A;  3W2A A;  4FCY A;  1HOM A;  1Z6R A;  2WB1 A;  1KGS A;  4MEY F;  4NC7 A;  2V26 A;  1Z77 A;  2M0C A;  3G6E I;  3E0J B;  4OIN F;  1I39 A;  3WHB A;  1H9G A;  2KFD A;  2OAZ A;  1GV2 A;  3ELK A;  5AIP A;  1ZK8 A;  2MG4 A;  4U0V A;  1ETQ A;  1Y8Q B;  1PYV A;  2CQQ A;  4DQ2 A;  1FP2 A;  4UUS A;  1F1Z A;  4A0X A;  4DBR A;  1ZN2 A;  1XSV A;  5LFA A;  4KIS A;  3FF5 A;  3HOZ J;  2WV1 A;  4PSW A;  1TBX A;  4WXD A;  2M1B A;  1D0Y A;  5IT9 Z;  1S7O A;  3AG2 H;  2G0E A;  3OR2 C;  4RM3 A;  1EF4 A;  1YW7 A;  1R9T J;  2WAD A;  2VUM J;  1STZ A;  1GLN A;  3OYB A;  4TV7 A;  3TBI A;  4QWQ A;  4U0W A;  3JSP A;  3GTJ J;  1X58 A;  2PG4 A;  2ZFW A;  1FIA A;  3IAM 2;  1O3Q A;  3VYU B;  5CQE A;  1WQ2 A;  3FHN A;  4MTD A;  3KP6 A;  3VEP A;  4XK4 A;  1XX5 A;  1KU7 A;  1CF7 B;  2LD5 A;  1ZKG A;  2X0L A;  3U1K A;  5ICC A;  2GAU A;  5HLH A;  4RB1 A;  2A5Y B;  4BQA A;  3LFU A;  4N0B A;  3VB2 A;  2TDX A;  2DPU A;  2VQL A;  3DKW A;  3OS0 A;  1HQC A;  1KU9 A;  1PUE E;  5GPC A;  2HYG D;  2FQ4 A;  4ZYH A;  1ZRC A;  3EYI A;  1SMY F;  2PN6 A;  1YE9 A;  1ZHF A;  2JPC A;  1YOV B;  2Z9O A;  1RR7 A;  3WOD F;  4G6Q A;  1IGN A;  1FNN A;  3ZQQ A;  4A6E A;  1U6G A;  1WJ5 A;  1POG A;  4EQQ A;  3H3Z A;  4LLG F;  4XOP A;  3NWT A;  3CC7 I;  2VE8 A;  1ZH5 A;  2VPR A;  1K6O A;  3RKY A;  3OV8 A;  4ZJZ A;  1W4M A;  5H2F C;  3FMR A;  2V7F A;  3RI4 A;  2V1D A;  4BXU A;  3M4O J;  2FBI A;  3BCA A;  2Z5U A;  3AFH A;  2Y31 A;  1UEL B;  2AQE A;  3ZR8 X;  4ZDO A;  3D5R C;  2FOK A;  4Y4R A;  4PJM A;  3F21 A;  3RZD J;  4P5O A;  3BDD A;  4M9Z A;  3DTE A;  3J80 K;  4OIP F;  2E2H J;  2KKO A;  1QVU A;  4XRS A;  1R22 A;  2DMP A;  3DEU A;  4V2F A;  4PCQ A;  3LSM A;  3VYT B;  1X1C A;  3BC8 A;  2VJI A;  4MIM A;  3OIP A;  3RJP A;  2WAE A;  3GFL A;  2FNP A;  3C2H A;  2ZSI B;  4UVB A;  1YS7 A;  1WGX A;  1K6Y A;  5B3S H;  2I8D A;  2QGU A;  4JK1 X;  3DPL C;  5K5O A;  3LA3 A;  4DNC A;  3LSI A;  3Q0W A;  1ZG1 A;  2HQA A;  2XRN A;  1JGS A;  3BZC A;  2STW A;  4BQO A;  1UAA A;  1T33 A;  3KEY A;  2DFH A;  4L5I A;  1SD7 A;  2IGO A;  1JHH A;  3S1R J;  1VQN I;  2E2I J;  4IJA A;  1LKX A;  1NTC A;  1JTY A;  3CCS I;  4BQN A;  2R0Q C;  2G7U A;  3RPQ A;  2KIQ A;  5HDG A;  2IJL A;  4IX7 A;  2X48 A;  4UUT A;  3WE2 A;  2XPU A;  3NAR A;  1TW3 A;  4KN4 X;  5ICF A;  3H5N A;  3BZ6 A;  3CMA I;  3KX2 A;  1BI1 A;  4EAT A;  3MZH A;  4D5F A;  2MFZ A;  2VC1 A;  2HOS A;  2ACJ A;  4LG0 B;  2OCC H;  1BOB A;  4KMU X;  3U1D A;  3TOA A;  2BZT A;  3CLQ A;  2CUJ A;  5D4R A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 4RB0 A;  2E7W A;  1FBQ A;  2PBI A;  4U7B A;  1KYZ A;  5D5W B;  6PAX A;  1LEB A;  3O2P E;  4U7D A;  4YFK F;  3AAF A;  1KU2 A;  3D0S A;  3I64 A;  2JSC A;  2CQK A;  1QZZ A;  1ZG5 A;  1KU3 A;  2MH9 A;  5JVT A;  3IKT A;  3HIF A;  4O6J A;  1XSX A;  1TNT A;  3CUQ A;  5CVU A;  1RZ4 A;  1FPQ A;  3I0T A;  2H6B A;  3MFK A;  1BN5 A;  1KQ9 A;  1NHA A;  2L3D A;  1LQ1 A;  2FMY A;  5E17 F;  4OMY A;  3I4P A;  5HVQ C;  3OOP A;  4HF0 A;  2IW5 A;  3Q9S A;  1FSE A;  3ML6 A;  5A2Q K;  3B73 A;  5LRR A;  2R7F A;  2QYO A;  4AIJ A;  1S7A A;  3HHH A;  2O8X A;  2JPB A;  2GWR A;  5D4S A;  1IZ1 A;  5LGN A;  1UFM A;  3GX4 X;  4WXC A;  4HX4 A;  1W7P B;  2VT3 A;  5IT3 A;  4L9N A;  1HKT A;  2YSR A;  4WWC A;  2XAS A;  3WTZ A;  2P4W A;  2QBY B;  1DUX C;  2HR3 A;  2NRA C;  1VTN C;  4EM2 A;  2Y48 A;  2RDP A;  5F64 A;  3GUD A;  2M87 A;  1Q1H A;  1TW2 A;  2B0L A;  5JI6 A;  2Q0O A;  1MDM A;  4F7Z A;  1XMA A;  4LMY A;  4UNO A;  2K02 A;  4WF2 A;  1HW2 A;  2HKX A;  3V4G A;  3I59 A;  3HRS A;  4HQE A;  1J59 A;  1JHF A;  1J7K A;  3FMQ A;  4UV8 A;  1BI3 A;  1B59 A;  1ZYR F;  3KEO A;  3F8N A;  3KP3 A;  3L09 A;  1FYL A;  1T38 A;  2CO5 A;  5L3C A;  4KT5 C;  2P5K A;  3RIR A;  4Y13 A;  4ZYE A;  2EFW A;  2KRF A;  2P5L C;  2FA5 A;  5IT9 K;  1UHM A;  1R5G A;  1ZG3 A;  4KIF A;  4YFN F;  2M45 A;  2WV0 A;  3QU6 A;  5ILU A;  1JXS A;  2ZXJ A;  1K78 B;  2ADU A;  2QUF A;  4S04 A;  3FMS A;  1FWZ A;  2QWW A;  4MTE A;  1BIA A;  5JFR A;  1KQ0 A;  1O3R A;  2VOD A;  4WK8 F;  4MQV A;  4YII A;  2P6T A;  1QNT A;  2PLY A;  4PDK A;  2D2W A;  1B9M A;  4PGG A;  3BOQ A;  2BE5 F;  3REO A;  4LLN A;  3QAH A;  2OU2 A;  2DPD A;  1G3W A;  3K9T A;  2NAZ A;  2FU4 A;  4UV9 A;  4LLL A;  1YTY A;  1D3Y A;  1P4X A;  4KUM A;  3KZZ A;  5ICG A;  3TOB A;  2EFP A;  5JR3 A;  3FXQ A;  1WRJ A;  3ZN0 A;  2CWE A;  3C3W A;  2Y0M A;  1IXC A;  1BC7 C;  2JT1 A;  3WGH A;  3FZV A;  1ON2 A;  2X4H A;  1R1T A;  3E5U A;  4HDU A;  1EV7 A;  2XHK A;  1EH8 A;  1YQA A;  5BQT A;  2LNB A;  4FX0 A;  3GFI A;  5D5V B;  1HSJ A;  2DAO A;  1RUO A;  2A6E F;  1J0R A;  3G3Z A;  2L02 A;  1LVA A;  1D8K A;  2PJP A;  1T2K A;  1X3U A;  3EET A;  2YX7 A;  5LEJ A;  1EH6 A;  3M9A A;  2QVO A;  1IRF A;  3DF8 A;  3WG9 A;  3SQN A;  1R00 A;  2JTV A;  5FGM A;  4BHB A;  4M71 A;  2COM A;  1IUY A;  2FML A;  1ZAR A;  3F6O A;  2K7L A;  1MJ9 A;  3F8B A;  4RAZ A;  4UUV A;  1SMT A;  5LHG A;  1J2X A;  2RGV A;  2FSW A;  1XGO A;  3GYH X;  3T5X A;  2M5W A;  2VE9 A;  2DK8 A;  2UXX A;  4ASN A;  3D5L A;  4EM0 B;  3F23 A;  2FF4 A;  2R3S A;  1QO0 D;  1UB9 A;  3CUO A;  3JAM Z;  2XKP A;  2ISY A;  1DPU A;  5KVR A;  4IHS A;  1FZP B;  2DFI A;  2E1N A;  2P7C B;  5D5X B;  1R58 A;  4OIQ F;  3V8L A;  3DPT A;  5KK1 A;  3ZP5 A;  2CG4 A;  3ZMS A;  4BH9 A;  1FSH A;  2CYY A;  1KYW A;  4XSX F;  3Q5F A;  4ZH4 F;  2FXA A;  4KNY A;  3GF2 A;  1SD5 A;  5H6R A;  2PFB A;  2ISZ A;  2M8E A;  1YLF A;  4EJT A;  4YFX F;  3B02 A;  5CYV A;  4OIO F;  4LK1 F;  5HDN A;  4BHP A;  3SHF A;  3TDZ C;  4HX8 A;  2HFH A;  3ECO A;  2MLK A;  3MEX A;  2P7V B;  1FP1 D;  3VOE A;  1FBU A;  4KFC A;  4IHT A;  3JSO A;  2ESH A;  5DCF A;  4LB6 B;  2ZO4 A;  4B8X A;  2LKP A;  5J6X A;  2D1H A;  4R79 A;  4N9I A;  3WGI A;  2DLL A;  4MNU A;  4RGR A;  3CLO A;  1U2W A;  2HKO A;  1QBJ A;  4OOI A;  4RGS A;  1YO5 C;  2P8T A;  3S2W A;  2MLG A;  3F6V A;  1K7A A;  5LBQ A;  3DP7 A;  4FX4 A;  1QGP A;  4IF4 A;  4RGU A;  2HTJ A;  4GO1 A;  5LGU A;  3QP5 A;  1DP7 P;  2ZBK A;  2V1X A;  4CXF A;  4P9U A;  2ZME A;  3HHG A;  3DXJ F;  1IXR C;  2ZCW A;  3HRM A;  3J7A O;  1PP7 U;  3HUG A;  3R6S A;  4G7H F;  5FLX Z;  3LAP A;  2BBY A;  1ZLJ A;  1S29 A;  4A0Z A;  1B1B A;  2DQL A;  1BC8 C;  2MA3 A;  3GFJ A;  4G7O F;  3F22 A;  3NEU A;  4AIK A;  3EUH A;  2P6S A;  1H0M A;  1G4D A;  5E20 A;  1W5S A;  2HTS A;  4I09 A;  1FYK A;  4IPA A;  2A61 A;  4RS8 A;  2XAQ A;  3HSF A;  1GHC A;  4A5M A;  3FWE A;  4HA8 A;  1LEA A;  5F6F A;  3WE3 A;  2BEO A;  1WI9 A;  4HBL A;  3L2C A;  1WKM A;  1OKR A;  2KJC A;  1IN6 A;  1OMI A;  2Z99 A;  4L9J A;  1T39 A;  5BOX A;  4Q48 A;  3GXO A;  4A12 A;  1U5T C;  1J75 A;  4KDP A;  4UVC A;  1U78 A;  3KCC A;  1A04 A;  4EJV A;  5FD6 A;  2W85 A;  2HGC A;  3BPV A;  2JZY A;  1V3F A;  1YW8 A;  2QEN A;  2EV5 A;  2GA1 A;  3TGN A;  4AD9 A;  2EK5 A;  2R7D A;  1YFH A;  1LB2 A;  2F2E A;  2QQA A;  1R23 A;  4HYE A;  5LGT A;  3VFZ A;  2AS5 F;  3JTH A;  5FFX A;  3ISP A;  1ZRE A;  2XAG A;  4I98 B;  4ENM A;  1XGN A;  2NYX A;  2GZW A;  2VOO A;  2O6G E;  3I54 A;  3ABU A;  1YS6 A;  4IRG A;  2IT0 A;  5CJ9 A;  3BJO A;  2EFN A;  2QQ9 A;  4KMF A;  2HWV A;  3KP4 A;  1YW9 A;  1U5T B;  5J8C A;  2W84 A;  5DD8 A;  3H3U A;  2YPR A;  2RN7 A;  5DD4 A;  2RVC A;  1FY7 A;  3R0A A;  1OYW A;  3HOT A;  5DDG A;  1CF7 A;  3WGG A;  2K4B A;  3CO6 C;  2OZU A;  3BPX A;  1HW5 A;  3R60 A;  3MQ0 A;  5ERI A;  5E1X A;  4CIC A;  4GYI A;  3ZQ7 A;  3N97 A;  4HZF A;  3IKV A;  2DO7 A;  3RKX A;  1XDS A;  1RNL A;  3RYR A;  4D0P A;  4AIH A;  3JAM K;  3KET A;  3BY6 A;  4L9V A;  5FB2 A;  1G3T A;  4EV0 A;  5L3F A;  2A3S A;  1XB4 A;  1KA8 A;  4ENN A;  3ULQ B;  3P9C A;  2HYF A;  1SFU A;  2A68 F;  2L4A A;  3GLX A;  3PQK A;  3VOD A;  2EA4 A;  4ESF A;  3G73 A;  3V8J A;  3GWZ A;  1HBX G;  2VBY A;  3TDU C;  1IAW A;  1FLI A;  4GYG A;  2DTR A;  1XD7 A;  5HDK A;  2GXG A;  2C6Y A;  4M74 A;  4IVN A;  3HYI A;  1HW1 A;  4JQF A;  3CO7 C;  2DI3 A;  1TQM A;  2MC3 A;  3QU3 A;  4HAM A;  1JE8 A;  2BYV E;  2XIG A;  5H20 A;  2EA2 A;  2FBH A;  4I02 A;  3R4K A;  1ZRD A;  5DEQ A;  3RKW A;  4LG0 A;  1G6N A;  5ILV A;  5BS6 A;  2DQR A;  1XCV A;  1F9N A;  4I2O A;  2V9V A;  3ZMD A;  1USS A;  3O3K A;  2WC2 A;  3WTT C;  5K5Q A;  2H09 A;  1IN4 A;  1P4W A;  1T98 A;  1R1V A;  2DBB A;  2EV0 A;  3V7C A;  3KP5 A;  5L3B A;  3Q9V A;  1F5T A;  1W7P D;  3HOS A;  3M8F A;  3FM5 A;  3GZ6 A;  4MQ9 F;  2IA0 A;  3L7W A;  3ZMT A;  1Z1D A;  4M9X A;  2RKH A;  3V7R A;  1B4A A;  4G94 A;  5FLX K;  2LDU A;  2Q2E A;  1T6S A;  3T1B A;  3L9F A;  4XLP F;  3ECH A;  4RB3 C;  3SFZ A;  5L3E A;  3RYP A;  3PFI A;  2YX4 A;  4HW0 A;  5FD5 A;  1BOA A;  1TLH B;  4Q4Z F;  1XSD A;  5AON A;  3LQR A;  3E3V A;  4E70 A;  1LDD A;  3MAJ A;  2CFX A;  2STT A;  1IXS B;  4ESB A;  2V79 A;  2WWY A;  5HLI A;  4KYW A;  5FO5 A;  2IA1 A;  5F1R A;  1K79 A;  3K2Z A;  1AWC A;  1TNS A;  5ED4 A;  4P55 A;  2NNN A;  2A69 F;  3GFM A;  3LFK A;  2QBY A;  2KIM A;  2V1U A;  3GVA A;  1S6L A;  4ZYD A;  3QPH A;  2L01 A;  2RNJ A;  1L0O C;  4Q47 A;  2XUB A;  4IRH A;  4S05 A;  1QQI A;  2QLZ A;  1MGT A;  2GIV A;  1TQI A;  1REP C;  4HV6 A;  4HF2 A;  1OYY A;  4M6Y A;  4EJU A;  2FBK A;  4GGG A;  2VT2 A;  2HS5 A;  2MH2 A;  3LA7 A;  1BIB A;  4K2E A;  4ZZL A;  2GQQ A;  3ZMV A;  2IA2 A;  5L3G A;  3ERE D;  4HOB A;  5TJJ A;  1Z7U A;  4U0Y A;  3I5U A;  3BP8 A;  3IC7 A;  1J5Y A;  1IRG A;  4ZYG A;  5HS9 A;  2EV6 A;  1ZAO A;  1WWX A;  5BPI A;  3NQO A;  1SFX A;  1LDJ A;  4EVI A;  2XRO A;  3DQV C;  1K78 A;  3IHU A;  2JRT A;  1RUN A;  1DDN A;  5ILS A;  1TQP A;  1U3E M;  5LHH A;  3FHZ A;  3IRQ A;  3HRU A;  2NS0 A;  5K1Y A;  2J5O A;  1MKM A;  4NQW A;  2E1C A;  3KLN A;  5HS7 A;  3WTS C;  4ESJ A;  2D45 A;  4CDG A;  2ZNZ A;  2GXB A;  5CVV A;  3LST A;  2DK5 A;  5CVJ A;  1O57 A;  4QLC U;  3BWG A;  1J9I A;  2VN2 A;  2PMU A;  4A0Y A;  2UXN A;  2LF7 A;  2QQB A;  4GCV A;  1UCR A;  4HX7 A;  4R8H A;  2OZ6 A;  4LD5 A;  3JTG A;  1ODD A;  5LEK A;  5AIQ A;  1MJA A;  1BJA A;  3FXU A;  4O3M A;  5H6Q A;  1QPM A;  4G7Z F;  1ZRF A;  4HLX A;  2NNY A;  1PP8 F;  4L5J A;  1FX7 A;  1IW7 F;  2YR2 A;  2FNA A;  4AVP A;  3CUQ C;  1P4A A;  5FFZ A;  2FRH A;  2EFO A;  5HS8 A;  5D6F A;  1OR7 A;  2RC4 A;  2RV8 A;  3FM3 A;  3H92 A;  2HOE A;  3IWZ A;  2DW4 A;  2EB7 A;  4ENK A;  4RGX A;  3MWM A;  3E6C C;  3K0L A;  4OU0 A;  3R61 A;  1AOY A;  3E6M A;  3LWF A;  3TO9 A;  2K86 A;  3T8R A;  2CW0 F;  4HQM A;  3WU1 B;  1O3T A;  4EJO A;  1EH7 A;  2AXL A;  1DPR A;  2OD5 A;  3CUQ B;  1LNW A;  2VBX A;  1I6X A;  4AWX B;  1R5H A;  5DYM A;  4R1H A;  2G7H A;  2LSO A;  4MEX F;  5D5U B;  3U9G A;  2M30 A;  2XAF A;  2BGC A;  2VXZ A;  5CVR A;  2J5P A;  3ZMU A;  3M7G A;  1P6R A;  2W24 A;  4MGR A;  1SD6 A;  3WTV C;  3E6D A;  3SZP A;  1MJB A;  2F5F A;  3DFG A;  3RPU A;  1Z6T A;  5DCM A;  2BV6 A;  3WTY C;  4N9H A;  3I58 A;  2F5C A;  1IF1 A;  1PDN C;  3O6B B;  4IXA A;  3V7S A;  3BJA A;  1ON1 A;  3F8M A;  4U88 A;  1OYI A;  4KA4 A;  3RDI A;  4B09 A;  1HKQ A;  1XGS A;  2L4M A;  2HDC A;  3E97 A;  2H6C A;  2OA4 A;  5J8F A;  5E8I A;  3KFW X;  1TTY A;  1I1G A;  2O0Y A;  2OQR A;  4XRF A;  3HSE A;  3N4M A;  1B6A A;  4L18 B;  3M1E A;  3L00 A;  3F3X A;  4LFU A;  1ZLK A;  1MDM B;  1ONV A;  4LK0 F;  3J81 Z;  1C0W A;  2YU3 A;  3ZPL A;  1IN5 A;  4BYY A;  3I59 B;  2IPQ X;  1ZGJ A;  3I71 A;  1I1S A;  3C18 A;  4M6X A;  4CHU A;  3P7N A;  1BBY A;  4MHG A;  4XBF A;  3IRR A;  4ZZD A;  3HRT A;  3F8C A;  1RI7 A;  2ELH A;  2IP2 A;  2FQ3 A;  5E1W A;  4P96 A;  4RB2 C;  4XSZ F;  2Q8K A;  3K69 A;  1R1U A;  2CSO A;  1XMK A;  1CGP A;  3PQJ A;  2HQR A;  3E6B A;  2K27 A;  1XDU A;  2ZNY A;  2Z3Y A;  5HOO A;  4EGY A;  2HZT A;  3FX3 A;  4UHT A;  2VC0 A;  4L0Y B;  1H9T A;  1XCB A;  1V4R A;  3LAJ A;  2P5V A;  2O3F A;  1ZGA A;  5LLQ A;  3K1M A;  4JBA A;  4Y15 A;  1XGM A;  2MD5 A;  3P9I A;  1QZY A;  1I27 A;  3WTU C;  5ICE A;  5HLG A;  3LQQ A;  3MCZ A;  2K4J A;  3TO6 A;  4A6D A;  2XAJ A;  1XN7 A;  3P9K A;  3BJ6 A;  2CGP A;  3WTX C;  2F5D A;  4EGZ A;  4G9Y A;  2O03 A;  1G3Y A;  2EJR A;  4OMZ A;  5BMZ A;  2RQP A;  4LGW A;  2HEO A;  5E8G A;  4BAY A;  5JHU A;  1HXD A;  2FE3 A;  1SAX A;  2KIU A;  2LF8 A;  1BM9 A;  1FC3 A;  4UVA A;  4EMS A;  3ZMZ A;  2OQG A;  3MZY A;  1S8N A;  4Q5S F;  1O3S A;  2QM3 A;  4OIR F;  1BI0 A;  4M73 A;  2XV4 S;  3GEZ A;  2VOP A;  3SZT A;  5DV5 A;  3KLO A;  2W57 A;  3E5Q A;  3FXR A;  4YIF A;  1MD0 A;  3IL2 A;  4CZZ A;  1RIO H;  4CGZ A;  2XVC A;  4RAY A;  1U5T A;  2ZKZ A;  4KIB A;  5LHI A;  5DUK A;  1T0F A;  4Z2Y A;  5D8K B;  5LRS A;  4NHJ A;  1D8J A;  1Z9C A;  3WU0 A;  3I53 A;  2XGX A;  2XKO A;  3CTA A;  1OPC A;  3HTU A;  1FOK A;  2XAH A;  1D5V A;  3DV8 A;  4G8X A;  3LA2 A;  1SD4 A;  3K1P A;  2L54 A;  3SXY A;  3CJN A;  1Z05 A;  4H0E A;  2VBW A;  3KZY A;  2OBP A;  4HDV A;  1ULY A;  4KIC A;  1R7J A;  1Y0U A;  2ESN A;  1GXP A;  4I7H A;  3BRO A;  3W6K B;  3W6J B;  3J80 Z;  1GVJ A;  4ETS A;  2A07 F;  2PEX A;  4CYD A;  1O7F A;  3C1D A;  1W7P A;  1LJ9 A;  3U2R A;  3TQN A;  4HV5 A;  2HQN A;  3T8T A;  3WTW C;  2Z33 A;  4ENJ A;  4CO8 A;  2UWM A;  3NRV A;  4KN7 X;  4I01 A;  3QPT A;  2EWN A;  3GO5 A;  1YIO A;  1E17 A;  1I5Z A;  2H94 A;  3GZ5 A;  5EEG A;  5TRD A;  1W5T A;  1GXQ A;  3F8F A;  1KQ8 A;  4EM1 A;  2WTE A;  2D1V A;  1Z91 A;  4WCG A;  4LB5 A;  2H27 A;  4YG2 F;  2DT5 A;  5L3D A;  3QOP A;  3F72 A;  4I0A A;  5DUI A;  3CDH A;  4LJZ F;  5BPD A;  1BI2 A;  2KJB A;  2VBZ A;  4ON0 A;  2ETH A;  2F5E A;  1WSU A;  2W25 A;  5CVI A;  1R36 A;  4FT8 A;  4XLN F;  4NB5 A;  2ZJ2 A;  4L0Z B;  1F4K A;  4O5V A;  3K1N A;  3J81 K;  1YG2 A;  2G9W A;  5D8L B;  3C7J A;  2ZME B;  3JW4 A;  3ROU A;  4KIG A;  3EQL F;  5E1Z B;  1YYV A;  3M8E A;  1FBS A;  2FEZ A;  3ABT A;  1UHW A;  4HLY A;  1IN7 A;  4PZJ A;  4G6D A;  1SFE A;  3RTR A;  2Y75 A;  1B9N A;  2VON A;  2EFQ A;  2E7X A;  4A5N A;  5A2Q Z;  3V8K A;  2UZK A;  3GW2 A;  4FHT A;  2GA2 A;  1HST A;  4WXH A;  4Y17 A;  4PGH A;  1S3J A;  1FT9 A;  4P9F A;  2DU9 A;  4L9T A;  1FYM A;  4EJW A;  2PI0 A;  3COA C;  5K5R A;  4M9S A;  2O61 A;  2PMH A;  1U8R A;  1P92 A;  3QRF F;  5E18 F;  3R0J A;  1G3S A;  1O7L A;  3KP7 A;  2IRF G;  1IN8 A;  5CLS A;  3ZN1 A;  3KP2 A;  3IWF A;  1MZB A;  3KEQ A;  3T0Y A;  1LDK B;  2KIF A;  5DCM B;  2IVM A;  2A6H F;  2QZ8 A;  1P2F A;  3TKY A;  4HF1 A;  3E5X A;  2PQ8 A;  4IRI A;  3HSR A;  1L3L A;  2V6C A;  3EYY A;  1HKS A;  3TO7 A;  1UST A;  3EDP A;  2MBF A;  5D6E A;  4UXN A;  4BNC A;  4I0B A;  5EEH A;  4M72 A;  3QP6 A;  4GXO A;  4BHC A;  3HTS B;  1E2X A;  4A2U A;  3KE2 A;  1Z6R A;  4MEY F;  1KGS A;  4OIN F;  1H9G A;  2OAZ A;  5AIP A;  3ELK A;  4U0V A;  4DQ2 A;  1FP2 A;  1F1Z A;  4A0X A;  1ZN2 A;  1XSV A;  3FF5 A;  1TBX A;  4WXD A;  2M1B A;  5IT9 Z;  1S7O A;  1YW7 A;  1STZ A;  4TV7 A;  4QWQ A;  4U0W A;  3JSP A;  2PG4 A;  2ZFW A;  1O3Q A;  1WQ2 A;  4MTD A;  3KP6 A;  3VEP A;  1KU7 A;  1CF7 B;  2X0L A;  5ICC A;  2GAU A;  5HLH A;  4RB1 A;  2A5Y B;  4BQA A;  4N0B A;  3VB2 A;  2TDX A;  2DPU A;  3DKW A;  1HQC A;  1KU9 A;  1PUE E;  2HYG D;  4ZYH A;  1ZRC A;  3EYI A;  1SMY F;  2PN6 A;  2JPC A;  1ZHF A;  2Z9O A;  3WOD F;  4G6Q A;  1FNN A;  4A6E A;  1U6G A;  4EQQ A;  3H3Z A;  4LLG F;  2VE8 A;  1ZH5 A;  1K6O A;  3RKY A;  3OV8 A;  1W4M A;  3FMR A;  3RI4 A;  2V1D A;  4BXU A;  2FBI A;  2Z5U A;  2FOK A;  3F21 A;  4P5O A;  3BDD A;  4M9Z A;  3J80 K;  4OIP F;  2KKO A;  1R22 A;  3DEU A;  4PCQ A;  3RJP A;  3GFL A;  2FNP A;  4UVB A;  1YS7 A;  4JK1 X;  3DPL C;  5K5O A;  3LA3 A;  4DNC A;  1ZG1 A;  2XRN A;  1JGS A;  2STW A;  4L5I A;  1SD7 A;  1JHH A;  4IJA A;  2G7U A;  3RPQ A;  5HDG A;  2IJL A;  3WE2 A;  1TW3 A;  4KN4 X;  5ICF A;  3BZ6 A;  1BI1 A;  3MZH A;  2VC1 A;  2ACJ A;  4LG0 B;  4KMU X;  3U1D A;  3TOA A;  5D4R A;  4WX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...