2LNBA

Solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Z-DNA-binding protein 1
publication title Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A
rcsb
source organism Homo sapiens
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lnbA00
4KIBA 1R22A 1XGNA 5KK1A 4WXHA 4IRGA 4OMZA 2YX7A 4ZH4F 2NNNA 4A0XA 4LK1F 4KN7X 2VXZA 2OA4A 2KJBA 2XROA 1R00A 2A69F 4HF0A 4EJUA 3HOTA 1W5TA 3ZMDA 2D1VA 1G3WA 4CGZA 3TOBA 4WXCA 4MHGA 4A5NA 1IN4A 4L9VA 5DD4A 4CO8A 4ON0A 3L7WA 3C7JA 4A12A 1IAWA 2L54A 3P9KA 3FMRA 3KP2A 2M1BA 2M30A 2VBWA 1YW7A 3SZPA 2ZCWA 3FMQA 2ISYA 1SFEA 3MEXA 3H3ZA 3K1MA 1LNWA 4I0AA 1MKMA 3ZPLA 3CO6C 3L09A 1JXSA 4L18B 1K78B 2XAFA 4HLYA 3RTRA 2HYFA 2MLKA 2XUBA 1HSTA 5D5XB 2FMYA 1Z6TA 4U88A 3GUDA 3TO7A 1FC3A 1DPRA 3GFJA 3SFZA 3ZQ7A 3H3UA 3TDZC 4BQAA 4BHCA 2Y48A 3RKXA 4OOIA 1GXPA 5J6XA 1XCBA 1WWXA 4RAZA 3E6CC 5BPIA 4YFNF 2XASA 1P4XA 2ESHA 2WC2A 3T5XA 4IHTA 3B73A 3DV8A 1RUNA 2PLYA 1R36A 2L02A 3GYHX 2R7FA 2GXBA 5ICGA 2QBYB 2RVCA 3DEUA 2G7HA 3K1NA 4L0YB 2RV8A 1OYIA 4IRIA 3L00A 1YIOA 2DU9A 3ROUA 2K7LA 1IN5A 5AIQA 1DP7P 2P8TA 1HKTA 4CHUA 5FLXZ 3V8JA 3VODA 4F7ZA 2YX4A 1T39A 4AIHA 2DBBA 1K6OA 3WU0A 1RZ4A 3WTVC 4U0VA 4YIFA 1K78A 2GZWA 2W85A 4GGGA 3GFLA 3ZN1A 1IRGA 4UV8A 3U2RA 2OBPA 1ZRFA 3IL2A 1P92A 3JTGA 3JSOA 2BE5F 2PMUA 2F5CA 2V1DA 5DUIA 1XDSA 3LAPA 4HDUA 2IJLA 1H9GA 4WX9A 2ZXJA 3KE2A 3C3WA 3WTSC 2NRAC 5HLHA 3KP4A 4A5MA 2B0LA 5D6EA 4M71A 5DUKA 2IA2A 5L3DA 4UVCA 3E5QA 3RKYA 1WI9A 2FNPA 2MA3A 1W5SA 2IT0A 1U5TB 5ICEA 3ZMTA 3LA3A 2MH2A 1GXQA 2FMLA 1B9NA 5E18F 5L3EA 4DQ2A 4BHPA 3V7RA 1HQCA 4QLCU 1ZGAA 3HRMA 2QBYA 1Z91A 1Z7UA 2KIFA 4OINF 1EH8A 1YYVA 2H27A 3RPQA 5FD6A 4M6XA 1HW2A 3O2PE 4MGRA 2QQ9A 2ESNA 1BIAA 3TO9A 1YLFA 4Q48A 1CF7B 2P5KA 3JTHA 4CXFA 4M6YA 2RKHA 2L3DA 2Y75A 4PCQA 2QWWA 2YPRA 5D4RA 4ESBA 4XSZF 5F64A 1ZGJA 3ABUA 3EYIA 5J8CA 4O3MA 4XSXF 3DP7A 1LEBA 3HSFA 1S6LA 4ZZLA 1MJAA 1IN6A 3ISPA 2BGCA 2DPUA 4BYYA 2VBXA 3R4KA 1JHHA 1YW9A 4AWXB 4IXAA 1XCVA 4A0YA 4DNCA 1GHCA 3CUQB 3MAJA 3MWMA 3FM3A 4B8XA 5TRDA 3BROA 1D8JA 6PAXA 4NQWA 2Z3YA 2DPDA 3L9FA 1HXDA 5JFRA 2K27A 3RPUA 1DUXC 2XIGA 3O3KA 4M9XA 2W57A 4N9IA 2FXAA 2TDXA 3TOAA 1O3SA 4HX8A 3VOEA 1BN5A 4JBAA 2Z33A 2PMHA 1B9MA 1XN7A 2EA2A 3ELKA 2BV6A 3HRUA 1KYWA 5HDGA 2ISZA 1LDJA 2WWYA 4PDKA 2VOOA 2RGVA 5E17F 5BMZA 5LEJA 5K5RA 1CF7A 4EGYA 3W6KB 1IUYA 1V4RA 4P55A 1KQ0A 1EH7A 5FLXK 1LVAA 2E1CA 4L9TA 4LGWA 2DT5A 2EJRA 4I98B 3BJAA 5FFXA 3M8EA 4M72A 1IN8A 3NEUA 2K02A 2NS0A 2ZKZA 1F4KA 3R0AA 1ODDA 1RUOA 3BP8A 3V8LA 1C0WA 3F8CA 1HKQA 4EM2A 4Z2YA 3COAC 1F5TA 2ZBKA 5CVVA 1WSUA 2Z9OA 2P5LC 3K0LA 4M9ZA 3CUQA 2ZO4A 1L3LA 3WGIA 4HAMA 3QU3A 1BJAA 5K5OA 5CLSA 2RNJA 1B59A 4TV7A 3R6SA 2A6EF 5JR3A 1ZG3A 1XGOA 3ZMSA 1D8KA 1YG2A 1ON1A 2EK5A 2DW4A 2BBYA 3GFMA 4G94A 2EB7A 1OYYA 5AONA 2JT1A 2LDUA 2A61A 4LMYA 1S7OA 2V6CA 1UFMA 1QQIA 5ICFA 2P7CB 1FSHA 3G3ZA 1ZREA 5JI6A 3RYRA 4LB6B 2Y0MA 2O3FA 5HDNA 3DF8A 4ZYDA 2OQGA 2VT3A 3FHZA 4OIRF 3U1DA 3G73A 3MZHA 5LGTA 1FYLA 1JE8A 1U78A 3FZVA 3J81Z 4MQ9F 1XMAA 2ZFWA 1CGPA 3KETA 1FBQA 4G8XA 4KDPA 3FX3A 2FSWA 4G7HF 3KLOA 1O3TA 1TTYA 1EV7A 1T6SA 2NNYA 4ETSA 2UZKA 1I5ZA 2LF8A 2P4WA 3CJNA 4M74A 1ZLJA 3LWFA 4CICA 3LAJA 2OZ6A 1ZYRF 1XGMA 4R1HA 3HRSA 4JK1X 3QRFF 3F21A 1EH6A 1XGSA 2IW5A 2PG4A 2MC3A 4N9HA 2FBHA 5F1RA 1DDNA 2XKOA 1QO0D 4PGHA 2P7VB 4HX7A 1RI7A 1ZARA 1E2XA 3F23A 4Q5SF 4A0ZA 2DQLA 4P9FA 2IA0A 3LA7A 1G3YA 3AAFA 3LQRA 3M7GA 2G7UA 2FEZA 4G6QA 3HIFA 2P6SA 1V3FA 1BIBA 1ZH5A 3GO5A 3ZMZA 1PP8F 1P4AA 2WV0A 5ILSA 3WTWC 2KJCA 3RJPA 4I09A 5LBQA 3IWZA 2DO7A 2ZJ2A 3KLNA 3WTYC 2A5YB 3D5LA 4U7DA 1S3JA 3WODF 1XMKA 1O7LA 4HF1A 3E6DA 1R1VA 1KYZA 4R8HA 2HR3A 1BM9A 4P5OA 1Z1DA 2PEXA 2HEOA 4LJZF 1U8RA 1FY7A 3IHUA 1ZRDA 2XV4S 2A3SA 3I53A 2V1UA 3PQJA 2PFBA 4MNUA 1XSVA 5D6FA 4A6EA 4KIGA 2DK8A 1OKRA 2OAZA 4KIFA 3VEPA 3IKVA 2CO5A 1USSA 1J59A 2CYYA 2M45A 2IPQX 1FBSA 1J5YA 2QUFA 4S05A 2L4MA 3ECOA 2GQQA 1G6NA 1IF1A 3IKTA 1TBXA 5DEQA 3J80Z 1R58A 5IT9Z 4HZFA 4LLGF 4FX0A 2KIMA 4MQVA 1JHFA 4L0ZB 3KP3A 4UHTA 2F5EA 3F8MA 2KRFA 1BOAA 4IJAA 1L0OC 1OYWA 4RB1A 4OIQF 4KMUX 1UHWA 1MDMB 1HSJA 1QZYA 5CVJA 3I5UA 4HDVA 3QU6A 1B4AA 3E5XA 4M9SA 3V7CA 1BBYA 5D5VB 4FT8A 4OMYA 3JAMK 4KNYA 2GA2A 2VC0A 2EV0A 2VONA 4JQFA 5AIPA 5LHGA 3MQ0A 1W4MA 4E70A 1Y0UA 3J81K 3IWFA 2M5WA 1TNSA 2AXLA 2K4JA 4XLPF 4YFXF 2BYVE 4EJVA 4XRFA 5CYVA 1BI3A 1W7PB 3I64A 4BH9A 4WWCA 1G4DA 2L01A 3BJ6A 3M8FA 4KICA 2HKOA 1KQ9A 3W6JB 2VOPA 4GXOA 2Q0OA 3OOPA 1DPUA 4I02A 3GZ6A 1LB2A 3WE2A 3GW2A 3C1DA 2VE9A 2STTA 4CZZA 2PJPA 5HDKA 1REPC 3DPLC 1XSDA 3HTSB 1Z6RA 3GLXA 1E17A 2VODA 3DKWA 3MCZA 5D5WB 1O3QA 3BWGA 3ULQB 3QPHA 3I71A 1RNLA 3NRVA 3MFKA 3WTZA 2Q2EA 3E97A 4HQMA 2V1XA 4MTDA 1YO5C 2HDCA 2W24A 5EEHA 4L5JA 3LSTA 2R3SA 3VB2A 5HS7A 5FD5A 3ZN0A 2HOEA 2F2EA 1MDMA 3I58A 4EV0A 1O57A 1FT9A 3L2CA 3ZMUA 4UVAA 2HTSA 3RYPA 4IHSA 4BAYA 2XAQA 3RIRA 3V4GA 1U5TC 1OPCA 1K79A 4OU0A 4L9NA 4HQEA 1S8NA 2VBYA 2X4HA 3BPXA 3TKYA 5H6RA 1FSEA 3ABTA 1IXSB 1W7PA 2HFHA 3H92A 5KVRA 4KFCA 1SFXA 1FYMA 3DXJF 2Z99A 1O3RA 1XDUA 1FP1D 2AS5F 4HV5A 1U2WA 4RGRA 3WTTC 3I0TA 5DDGA 2RC4A 3R0JA 4N0BA 4O5VA 5ED4A 4XLNF 2LKPA 2FOKA 3O6BB 1TQPA 2RN7A 4BXUA 3RDIA 4EM0B 3R60A 2O61A 3QP6A 4L9JA 1XB4A 1BI0A 5LEKA 4GYGA 1X3UA 3DPTA 3P9CA 5IT9K 1SMTA 1AOYA 1IXCA 5LRRA 1T98A 1G3SA 4HV6A 3KP6A 1FZPB 4LLNA 4UNOA 2OD5A 2CSOA 2MH9A 3FXUA 3Q9VA 1PP7U 3CUQC 3BPVA 5FO5A 2FA5A 2KKOA 5LLQA 3BY6A 4HW0A 3K2ZA 4ZZDA 4BNCA 2HQRA 3FMSA 2JPCA 2PN6A 2CWEA 3CDHA 3QP5A 4YFKF 4RGXA 2D2WA 3RI4A 2UWMA 3M9AA 4CYDA 2OQRA 2XHKA 4XBFA 2D45A 4G9YA 2EFPA 4EJWA 1P2FA 5FFZA 3LFKA 2CG4A 4RB0A 2CQKA 4Q4ZF 1HW1A 2E7WA 4EQQA 3FXQA 3WTXC 3KEQA 1BI1A 2DK5A 4WCGA 3K9TA 1J0RA 2EFOA 3R61A 5LRSA 1PUEE 2IRFG 4YIIA 2XAJA 1ZG5A 4ENNA 2F5FA 2HZTA 3PQKA 2H09A 2E7XA 1R5GA 1WRJA 4RS8A 5CVRA 5IT3A 2L4AA 1TQIA 5JVTA 1USTA 5E1ZB 3B02A 1ZAOA 3WGGA 4MTEA 5D4SA 2QYOA 2HTJA 4RGSA 2E1NA 4UXNA 5HOOA 3F22A 2Q8KA 1AWCA 1IW7F 4LG0B 4KYWA 4HX4A 2YU3A 2RQPA 3HRTA 1H0MA 5E1XA 1YFHA 1TW2A 4Y13A 2VT2A 1WQ2A 1TW3A 1T2KA 3PFIA 3GWZA 2JPBA 3F8BA 4AIJA 4HA8A 4LD5A 2O6GE 2COMA 2FU4A 5LHIA 3CTAA 1UHMA 2YSRA 3E6BA 1JGSA 1IRFA 4NHJA 2P5VA 1QBJA 5K1YA 3IRQA 1Z9CA 3F6VA 4IRHA 2K86A 2ADUA 4HLXA 4WK8F 2HKXA 1I27A 2FNAA 1U6GA 1YW8A 3TO6A 3HHGA 4YG2F 2CW0F 3I4PA 2A68F 4KMFA 3P7NA 3LA2A 1J75A 2XKPA 2ZMEB 5L3BA 3QPTA 3BJOA 3CLOA 1R23A 5HVQC 2DTRA 5BQTA 3HHHA 2D1HA 1ON2A 5TJJA 5ICCA 2HS5A 4OIPF 1GVJA 2IA1A 3OV8A 2FQ3A 4ENJA 1SAXA 2EA4A 3WG9A 4WF2A 5HS9A 5D8KB 4K2EA 3I59B 3FWEA 4HOBA 2VC1A 3BOQA 3SHFA 5FB2A 3JSPA 2XGXA 1Q1HA 3Q5FA 1TQMA 3ZMVA 1NHAA 1T0FA 4OIOF 2J5OA 2PBIA 2ZNYA 5DYMA 2STWA 4LG0A 2XAGA 2O03A 4HBLA 1FOKA 5HLIA 2A07F 1H9TA 2K4BA 3F6OA 2MBFA 5EEGA 4S04A 3J7AO 3HTUA 3EYYA 1BC7C 3T0YA 4EGZA 3M1EA 4B09A 3BZ6A 3Q9SA 1MGTA 3V7SA 2FBKA 1SD4A 1B1BA 4A6DA 1FWZA 5DCMB 4GO1A 4GYIA 2VBZA 3SXYA 4I2OA 4BHBA 2EWNA 1LDKB 2EV5A 2GXGA 1KQ8A 3K1PA 5DCFA 4AVPA 1MJBA 1XD7A 2CGPA 3TQNA 1FNNA 4O6JA 1SD5A 1ZHFA 2QVOA 3JW4A 2JZYA 5J8FA 1Z05A 5A2QZ 5ILVA 4I7HA 2YR2A 2LSOA 2DQRA 2R7DA 4CDGA 1KU7A 3HSEA 5ERIA 2F5DA 2QQAA 1ZLKA 1I1GA 4Y17A 3EDPA 4LB5A 2EFQA 2ZMEA 3F8NA 1D5VA 4IVNA 3HOSA 2DAOA 4HYEA 2ETHA 5CJ9A 5JHUA 5LHHA 1MD0A 1KU2A 2H6BA 4EMSA 2FF4A 1WKMA 3QAHA 3D0SA 2VE8A 2MD5A 4UUVA 3SQNA 3I59A 2IP2A 1K7AA 3VFZA 4PZJA 1BC8C 1BI2A 2C6YA 4HF2A 2WTEA 1J2XA 2DLLA 3GEZA 4IPAA 2JTVA 3DQVC 3T8RA 1YTYA 4H0EA 3EQLF 1MZBA 1S7AA 3I54A 1HW5A 3F3XA 2EFNA 3U9GA 1I1SA 1LJ9A 4ESFA 1QZZA 4FX4A 3GVAA 2FE3A 2MLGA 1U3EM 2H6CA 2EFWA 5LGUA 1SMYF 5LGNA 2DFIA 4IF4A 1STZA 1R5HA 1YS6A 4RB2C 3T1BA 5BS6A 2CFXA 5DCMA 4G7OF 5K5QA 4KA4A 4ENKA 4ESJA 2JRTA 5BPDA 4RB3C 1ULYA 3C18A 4LFUA 4ENMA 4MEXF 1FX7A 2XAHA 2NAZA 3TDUC 3QOPA 4ZYHA 2O0YA 5F6FA 4D0PA 3GFIA 1RIOH 2UXNA 1P6RA 2ACJA 2HWVA 2QM3A 4KN4X 4I01A 1FBUA 1P4WA 2OU2A 4WXDA 2EV6A 1ZN2A 5L3FA 5DV5A 2GAUA 2XVCA 3F72A 1UCRA 2PQ8A 4G7ZF 2V9VA 4UVBA 4G6DA 5CVIA 4LK0F 1VTNC 4ZYEA 3P9IA 2QQBA 1T38A 1FP2A 3GZ5A 4KT5C 3HUGA 3KCCA 1FLIA 1SD7A 3E5UA 2Z5UA 5FGMA 3HSRA 2ZNZA 4Q47A 1QPMA 5HS8A 1KA8A 5CVUA 3ERED 4A2UA 1YQAA 1U5TA 1I6XA 1R1TA 2JSCA 3RKWA 1ONVA 1OR7A 3HYIA 3ZP5A 5D8LB 1KU9A 1J7KA 2UXXA 1A04A 1G3TA 1J9IA 4KUMA 4NB5A 4RAYA 5L3GA 4R79A 2XRNA 1LEAA 1W7PD 2QZ8A 4MEYF 2NYXA 1QNTA 2H94A 2V79A 3KZZA 4LLLA 2KIUA 1F1ZA 1TLHB 3KFWX 3EETA 5DD8A 2GIVA 2X0LA 3N4MA 4ASNA 4ZYGA 1IZ1A 1SD6A 3CUOA 3KP7A 1YS7A 2HGCA 2P6TA 2W84A 2OZUA 4GCVA 1R1UA 3J80K 2ELHA 2QENA 3WE3A 5E8GA 3E6MA 3V8KA 1F9NA 3IC7A 4AIKA 2RDPA 4U7BA 5D5UB 3T8TA 1ZRCA 5E20A 3REOA 3SZTA 2M8EA 3WTUC 5A2QK 5E1WA 3KEOA 5L3CA 2LF7A 4M73A 4P96A 4RGUA 2HYGD 3ECHA 4AD9A 3KP5A 2IVMA 1D3YA 3GX4X 1PDNC 4EM1A 1TNTA 3GF2A 3IRRA 4P9UA 3EUHA 5H6QA 5ILUA 5E8IA 3GXOA 1LQ1A 4UV9A 2PI0A 2QLZA 1IXRC 4QWQA 2A6HF 3WGHA 1R7JA 2BEOA 4I0BA 2FBIA 1FYKA 2M87A 1ZG1A 1LDDA 3WU1B 3ML6A 2G9WA 2O8XA 3DFGA 1S29A 1KU3A 2LNBA 3LQQA 4Y15A 3KZYA 1UB9A 2GWRA 4L5IA 4EVIA 3F8FA 1B6AA 1QGPA 3FF5A 1IN7A 2GA1A 5H20A 3TGNA 3BDDA 3E3VA 4U0YA 3FM5A 1FPQA 5HLGA 3NQOA 3CO7C 2DI3A 2FRHA 1SFUA 2W25A 3JAMZ 3FXRA 3MZYA 3N97A 1OMIA 1HBXG 1HKSA 2HQNA 5BOXA 3K69A 4U0WA 4EJOA 1MJ9A 1XSXA 1KGSA 2VN2A 4PGGA 1O7FA 4FHTA 4EJTA 3S2WA 2J5PA
chains in the Genus database with same CATH superfamily
4KIBA 1R22A 5HNHA 1XGNA 1DGRM 4V2FA 1MMNA 1E3OC 5KK1A 4WXHA 4IRGA 4OMZA 2YX7A 4HEA2 4C2MJ 5J47A 3KPHA 2NNNA 4ZH4F 3OYGA 4A0XA 4LK1F 4KN7X 2VKDA 2VXZA 2OA4A 2HPMA 1W0TA 4BE0A 2KJBA 2XROA 1R00A 2A69F 4HF0A 4JX4A 4EJUA 1HC8A 3OR1C 3HOTA 1W5TA 4FE7A 2ZB9A 4CZCA 3ZMDA 2K9MA 2D1VA 1G3WA 3DBLB 4CGZA 4ITVA 3TOBA 3NWSA 1Y56A 4WXCA 4MHGA 1EJ9A 3BC8A 4A5NA 1IN4A 1SAUA 4L9VA 5DD4A 4CO8A 4ON0A 3L7WA 4M6VA 3C7JA 3K4LA 2LP0A 4A12A 1PUFA 5EYRA 4XRSG 1IAWA 2L54A 3P9KA 3FMRA 3KP2A 2M1BA 2M30A 3HBLA 2VBWA 1YW7A 3SZPA 2ZCWA 3FMQA 1H8AC 5J40A 4A3JJ 3VSLA 2ISYA 3S1MJ 1IUFA 2WAFA 1SFEA 3MEXA 1NG6A 3H3ZA 4MLOA 4CH7A 3K1MA 4DYQA 1LNWA 4I0AA 3LSGA 1MKMA 3ZPLA 3BR3A 3CO6C 5IP9J 3L09A 4XIDA 1ETWA 1JXSA 4L18B 1K78B 2XAFA 3HM5A 5KAFC 3RTRA 2HYFA 2MLKA 2XUBA 1HSTA 1X1BA 2LKSA 2FMYA 3BG5A 2Z2SB 3K4NA 3LSIA 5D5XB 4Y3OA 3OYFA 1R9TJ 1Z6TA 1ZQ3P 4U88A 1UG2A 3GUDA 1D1AA 1K83J 4HPQA 3TO7A 1FC3A 1JTXA 1DPRA 5J4VA 1R6RA 4KISA 1V55H 4I6ZA 2OUMA 3GFJA 3SFZA 2COBA 1RPWA 3S8PA 4F93B 3ZQ7A 3H3UA 4J19A 2RAEA 3TDZC 4F3QA 4BQAA 4PUSA 3HOWJ 3IAM2 3JRAA 2Y30A 4BHCA 2Y48A 3D5RC 2CUEA 4OOIA 3RKXA 1GXPA 3ZQLA 1RKTA 5J6XA 1XCBA 2BY0A 1WWXA 1WJ5A 1BW5A 4RAZA 5DTDA 3E6CC 5BPIA 4YFNF 4BL0B 2KT0A 5IYBJ 3FHNA 2XASA 1P4XA 2A6TA 2R7VA 2ESHA 2RNGA 1LVKA 4ZDLA 2I5UA 2GOMA 1JT6A 3FBNB 2WC2A 3T5XA 3AL0B 2DDBA 3CCEI 2QF7A 1VQ9I 4IHTA 3B73A 3W2WA 2LYCA 2JQ7A 3DV8A 1RUNA 2PLYA 1R36A 2L02A 2XPWA 4UUTA 3GYHX 3OSGA 2VUMJ 3K2AA 3FKIJ 4ANJA 2R7FA 2K40A 5ICGA 2GXBA 4RA2A 4V2GA 5EEAA 2QBYB 2RVCA 4XR6A 3WU2C 4PFPA 3RZDJ 3UR3C 3H9QA 2KPMA 2DMPA 4XLFA 3CCMI 3CC4I 1E0EA 4B1RA 3DEUA 2G7HA 3K1NA 4L0YB 2NVXJ 2XB0X 2RV8A 1OYIA 1ETYA 4KT6A 3DEEA 4IRIA 3L00A 2X1CA 3TW6A 1MBJA 1YIOA 3K10A 2DU9A 4NUBA 3ROUA 4H4KC 2K7LA 5B66C 1IN5A 2Q1ZB 3LFUA 5AIQA 1DP7P 1JUPA 2BOLA 2P8TA 2XSDC 1HKTA 3IAS2 1IRZA 4CHUA 5FLXZ 4BXXJ 2HQ5A 2W82A 1S72I 3V8JA 2VJ4A 5H2FC 3FXOA 4AU7A 2Y0SA 3VODA 2JUGA 2YX4A 4F7ZA 2E60A 3NARA 1T39A 4QPQA 4AIHA 2DBBA 1HDDC 1K6OA 4HSTA 4IHXA 5JVGF 4M3BA 5IOYA 3WU0A 1RZ4A 3WTVC 4U0VA 4G6TB 5E79C 4YIFA 3CD6I 2IXSA 3LNQA 2ECBA 1K78A 2GZWA 2W85A 4GGGA 2KZVA 2JMWA 3GFLA 3ZN1A 1IRGA 3UNGC 1D5YA 2WB1A 4UV8A 3L2WA 2ZMEC 3KEYA 1QHHD 3U2RA 2OBPA 1QPIA 1ZRFA 3IL2A 1P92A 2DOFA 1BOBA 1RKWA 3JTGA 2EQRA 3TBIA 3JSOA 2BE5F 3S1RJ 5FRMA 3BR0A 5EGOB 3PL8A 2PMUA 1A35A 2F5CA 5DS9A 3O8HA 2V1DA 5DUIA 4BY1J 1XDSA 3LAPA 1MH4A 4HDUA 1WJFA 2IJLA 2LC2A 1H9GA 3LMMA 2L7ZA 4WX9A 2ZXJA 2LY2A 3C2HA 2VQCA 2NVTJ 3KE2A 4E7IA 4RDUA 2CU7A 3OIQA 3C3WA 1N25A 3WTSC 2NRAC 5HLHA 1QHGA 3KP4A 1W1WE 1X2NA 3E7LA 1X4OA 4A5MA 2B0LA 5D6EA 2XPUA 4M71A 2R7TA 4NQWB 5DUKA 2IA2A 3CCJI 4FCYA 5L3DA 4UVCA 3E5QA 3RKYA 1WI9A 2FNPA 2MA3A 1W5SA 3OYBA 2IT0A 1U5TB 1MMDA 2MG4A 5ICEA 3ZMTA 3CF5F 3LA3A 4PJLA 1OQYA 2M2EA 2DA4A 2MH2A 1BR1A 2K9NA 2JJ7A 1GXQA 2K9SA 2FMLA 1B9NA 5E18F 3QOEA 1N77A 5L3EA 2QSGX 4DQ2A 3A4CA 4BHPA 1R4MB 1GUUA 3KZIC 3V7RA 1HQCA 4QLCU 1ZGAA 4D7NA 3HRMA 4Y33A 4E7ZA 1Z91A 1Z7UA 2KIFA 3HC7A 3TP0A 2QBYA 4OINF 1EH8A 1YYVA 2H27A 3BG3A 3BLYA 4XLHA 3GTPJ 3RPQA 5FD6A 4M6XA 5C3EJ 1Q1VA 5F0HA 1HW2A 3GTMJ 3O2PE 2KZGA 1LFBA 5DM6F 2VQGA 2TRTA 4MGRA 1X3WB 2NVQJ 2QQ9A 1BIAA 2ESNA 3TO9A 4C2UA 1YLFA 1D1CA 4Q48A 5KAIC 3HOUJ 1CF7B 5EG0B 1W36C 2P5KA 3JTHA 4CXFA 4M6YA 2RKHA 2L3DA 2Y75A 4PCQA 2QWWA 3QYFA 2YPRA 2DMNA 5J1RA 2JRMA 3HEFA 1W36D 5D4RA 3GTGJ 3J7ZI 4ESBA 4XSZF 4IL6C 1SVOA 3BTLA 1YJWI 4M3DA 1VQNI 3LSHA 5F64A 1ZGJA 1GLNA 3BG9A 1NTCA 2WAQA 2QQ8A 3ABUA 3EYIA 5J8CA 4O3MA 1K4TA 1D1BA 4Z6YA 1GVDA 4ZTFA 4XSXF 2LKXA 5EDNA 3OYLA 2M0CA 4DW6A 3OS1A 2JA5J 1JI8A 3DP7A 1LEBA 3HSFA 4Y7NJ 2HVRA 1H88C 1S6LA 1UG0A 4ZZLA 1MJAA 1IN6A 3ISPA 3C2GA 1V5GA 2BGCA 2DPUA 3CCSI 4BYYA 2CQ7A 2VBXA 3U21A 1GT0C 3R4KA 1HA8A 3S2DJ 1A6QA 3LSJA 1JHHA 1YW9A 5EGOA 2VPRA 4AWXB 4IHYA 1E3HA 4IXAA 1XCVA 1WPKA 3J7YJ 1V54H 4A0YA 4DNCA 3VSKA 1DU0A 1GHCA 3CUQB 4XKVA 3MAJA 1MMGA 3MWMA 3A02A 3DCFA 3FM3A 4B8XA 5JHFA 2LR8A 1VQOI 5TRDA 3BROA 1D8JA 1A31A 1Y8RB 1SFOJ 6PAXA 4NQWA 2Z3YA 1X1DA 2DPDA 3L9FA 1HXDA 1TP4A 1Z77A 4XICA 5JFRA 5E3OA 2K27A 1MW7A 4F92B 3RPUA 1DUXC 1OR7C 3DLAA 2MC4A 2XIGA 4D5CA 4IOAF 3DU5A 1R71A 1UELB 3O3KA 1TWAJ 4M9XA 2W57A 4N9IA 2FXAA 5BNGA 4CCLA 2TDXA 3TOAA 1O3SA 3JREA 2GM4A 4HX8A 3VOEA 2WB1N 3PIOF 3HGYA 2O8KA 3AG2H 3OIOA 3G6EI 1BN5A 2EINH 4JBAA 2Z33A 2PMHA 2W7NA 1K61A 1R49A 2L9VA 1B9MA 4B47A 1XN7A 4PFOA 2EA2A 3ELKA 2BV6A 2E35A 2CV0A 3HRUA 1KYWA 5HDGA 2ISZA 1LDJA 3SFIA 2WWYA 5F0CA 4PDKA 3Q0WA 1MBFA 2VOOA 2RGVA 1TWCJ 5E17F 5BMZA 5LEJA 5K5RA 2R7SA 2LREA 1CF7A 4CSWA 5EG0A 3GBGA 2CW7A 2B63J 1IGNA 1ERDA 1JTYA 4EGYA 3W6KB 3M4OJ 1IUYA 3ZQCA 4I99C 4GDFA 1VQ5I 1V4RA 4P55A 4JP0A 3S15J 1GV5A 4V19K 1KQ0A 4M3GA 2H1KA 1EH7A 5FLXK 1LVAA 5IP6A 3DKXA 1HOMA 1KZHA 2X6OA 3PNTA 4BDYA 2NOGA 3MN2A 1TT0A 3I4NJ 2CFOA 1ETQA 3FXKA 2E1CA 4IEJA 1Y39A 4L9TA 4LGWA 4C3HJ 2DT5A 2EJRA 4I98B 3BJAA 4J00A 5FFXA 1JKPC 3M8EA 4M72A 1IN8A 3NEUA 3TMOA 4RLQA 2K02A 2NS0A 1SEUA 2K5CA 2FD5A 4QTRA 2ZKZA 1XG1A 1F4KA 3R0AA 4E7JA 1Y1VJ 1WH7A 3OWTA 1ODDA 1RUOA 3BP8A 3V8LA 1G59A 1C0WA 5M3FJ 3F8CA 1HKQA 2ZXHA 4EM2A 4A3MJ 4Z2YA 3PSFA 4D9JA 3COAC 1F5TA 3DTIA 5GTIC 2ZBKA 1OCRH 5CVVA 1WSUA 2Z9OA 2P5LC 3ZQFA 3G1LA 3K0LA 1Z7LA 4M9ZA 2X1EA 3CUQA 2ZO4A 5E3NA 1YJ9I 3VYRB 1L3LA 2DDAA 5LD2C 3B6AA 3WGIA 2E1MC 4HAMA 2VB6A 1VFCA 5FKOA 3QU3A 1BJAA 5K5OA 1I3AA 2R7WA 5CLSA 2JA6J 2E1OA 3G2BA 2NS8A 2RNJA 1B59A 5FJ8J 4TV7A 1V5EA 2NS7A 2DOAA 2L5QA 3CP8A 3R6SA 1OCPA 3ZXSA 1MSFC 2A6EF 5JR3A 5JLWA 1WJEA 2PX9A 2CQNA 2WAQN 3MKZA 5CQGA 4BACA 1ZG3A 1VF9A 1XGOA 4PSXA 3ZMSA 2BW3B 1VQ7I 1D8KA 1YG2A 2EH3A 1ON1A 1MMSA 2EK5A 2DW4A 1UAAA 2BBYA 2HDWA 4HNUA 3GFMA 3Q3SA 4G94A 2QA4I 2EB7A 1OYYA 5AONA 2JT1A 2LDUA 2A61A 2DFEA 5FKNA 2HQAA 3S16J 3HOYJ 2EZIA 4LMYA 1S7OA 2XF5A 2V6CA 1WZ2A 1UFMA 4XLEA 4E4HA 2M34A 1QQIA 4E7LA 2HPIA 4DIQA 5ICFA 2P7CB 1FSHA 3G3ZA 1ZREA 4ZDPA 3I4MJ 3OS2A 5JI6A 3RYRA 1FMWA 3FDYA 2EPFA 4LB6B 4MIMA 2Y0MA 2BXYA 2O3FA 3BT9A 1FOYA 4XKCA 2L9RA 3OMYA 5HDNA 3DF8A 1YE9A 3QYBA 4ZYDA 2LOOA 2OQGA 4ZJZA 2VT3A 2Y2ZA 3FHZA 3TP3A 1U9OA 4OIRF 4M3EA 3U1DA 3G73A 1Y1WJ 5GAGJ 2JN6A 3MZHA 5LGTA 1FYLA 1JE8A 1U78A 2X48A 4AUXA 4BY7J 4BGDA 1G2HA 2VPLA 3FZVA 4XQFA 5K7FA 3CJRB 4F52A 3J81Z 2LFBA 2K9QA 4MQ9F 4EATA 1XMAA 4AIDA 2ZFWA 1CGPA 2VXDA 3KETA 1VQ8I 3FXMA 1FBQA 4G8XA 4KDPA 3SDGA 1T95A 3FX3A 2FSWA 4G7HF 2FX0A 3MKWB 3KLOA 3WG7H 1O3TA 1TTYA 3HOVJ 3PNVA 1EV7A 1T6SA 3GTOJ 1FJLA 4FE4A 2NNYA 1YI2I 4ETSA 2UZKA 1AKHB 1I5ZA 2LF8A 2P4WA 2XPVA 4PJMA 3CJNA 4M74A 3DBRB 1ZLJA 3LWFA 4CICA 5FROA 3LAJA 1YITI 2OZ6A 1ZYRF 1XGMA 3BCBA 3OYDA 4R1HA 3HRSA 4JK1X 2ZXIA 2XGEA 3H35A 3QRFF 3F21A 1EH6A 4UB6C 1LFUP 3OIPA 1XGSA 1BA5A 2IW5A 2PG4A 1JKQC 2MC3A 2WBMA 4N9HA 2FBHA 1ZELA 5F1RA 5B1AH 3CJQB 1WH5A 3HG9A 1DDNA 1ITYA 3FXJA 3S17J 2XKOA 1QO0D 4JX5A 2ZSIB 4PGHA 2P7VB 4HX7A 1RI7A 1ZARA 2BW3A 3SZGA 3BR2A 3VDXA 3DKYA 1E2XA 3F23A 4Q5SF 1BW6A 3S93A 2DQLA 5EZGA 4A0ZA 4B3AA 5FKKA 3H5NA 4XK4A 4E6KG 2IGKA 5C44J 4B44A 2IS2A 1JGGA 4BE1A 4P9FA 2IA0A 3LA7A 2JUCA 1G3YA 3VYSB 4BUPA 3AAFA 2FQ4A 3LQRA 1RESA 3M7GA 1X1CA 2G7UA 4IQJA 2FEZA 4G6QA 2JSPA 1XTAA 3HIFA 4CUGA 2P6SA 3H9JA 2ZJPF 1OLTA 4X1EA 4BE2A 2L0KA 4RMNA 1V3FA 4PSWA 1T8IA 1BIBA 3HB9A 2M8GX 1ZH5A 3GO5A 3ZMZA 2D5VA 1PP8F 1P4AA 2WV0A 3OYJA 3BZKA 5ILSA 3WTWC 2KJCA 2CH0A 3DBHB 4OWRB 4I09A 4XN0A 3RJPA 1RETA 4BJTA 3IWZA 2DO7A 5LBQA 1SFKA 2ZJ2A 3WHCA 1QVUA 2W48A 3KLNA 3WTYC 2A5YB 2VQLA 3BTJA 2E5NA 1NK3P 3D5LA 1LKXA 4U7DA 5J4YA 1S3JA 2K3FA 2WV1A 3WODF 1XMKA 5C4JJ 1X1PA 1O7LA 2HXOA 2DMTA 3VPRA 4HF1A 1T0FC 1R1VA 3E6DA 3VYTB 3VWBA 3PIPF 1WCMJ 1KYZA 2UV1A 2E2HJ 4R8HA 2HR3A 3QQAA 1BM9A 4P5OA 1MBKA 3M8JA 1Z1DA 5F27A 2PEXA 2NOJB 2HEOA 1XPXA 2NXNB 5B5EC 3HOZJ 4LJZF 1U8RA 3U1KA 1LPQA 2GOXB 1FY7A 1TWGJ 3IHUA 1ZRDA 2XV4S 2A3SA 3I53A 2V1UA 4IHWA 1AKHA 3PQJA 2PFBA 1YX3A 4MNUA 1XSVA 2JVGA 5D6FA 4A6EA 3FISA 4KIGA 2HNHA 1MMAA 4MFDA 1OCZH 2DK8A 1RR8C 1OKRA 2OAZA 4KIFA 3VEPA 3IKVA 2CO5A 1USSA 1J59A 2CYYA 2M45A 2IPQX 1FBSA 1J5YA 4ZC3A 2QUFA 2KFDA 3M3YJ 4PK4A 1POGA 4S05A 2L4MA 3ECOA 1RRJA 3ZCOA 2GQQA 1G6NA 1IF1A 3BCAA 3LSPA 3IKTA 1PYVA 1TBXA 5DEQA 4E7SA 3J80Z 3LSKA 1R58A 3CMEI 2QCOA 5IT9Z 4HZFA 2XSJC 1RC9A 4LLGF 3HOXJ 4FX0A 5B3SH 2KIMA 2DJNA 3ESWB 4MQVA 4IX7A 1FTTA 1JHFA 2Q2EB 3LSMA 3KP3A 4UHTA 1JJ6C 4L0ZB 2F5EA 3F8MA 5IYCJ 2KRFA 1BOAA 4B3XA 2UUZA 4IJAA 1L0OC 1OYWA 3H5RA 4RB1A 3W2AA 2F4MB 1O4XA 4OIQF 3A0BC 4KMUX 5IOZA 2IS4A 4GRIA 1P7IA 3BZCA 1UHWA 3JRHA 1MDMB 1X19A 5GAEJ 1HSJA 1QZYA 2F4IA 5CVJA 3I5UA 1HDPA 4HDVA 2DA3A 3QU6A 1VQKI 3S14J 1B4AA 3E5XA 3IH3A 4M9SA 2OJED 3V7CA 4XOTA 1Z3YA 1BBYA 4PJNA 5D5VB 3LSRA 3GCMA 4FT8A 4OMYA 3ZQIA 3JAMK 4XLCA 1A6IA 4KNYA 2MYSA 5HNFA 2DA6A 2F6CA 2HU9A 2CV1A 2GA2A 2M7AA 4L5EA 2VC0A 4OAZA 3ZQQA 3SJMA 2EV0A 3HL2A 2VONA 3AL0C 2M7BA 4C3IJ 3K4CA 3L2RA 4JQFA 2K9LA 5K7ZA 5AIPA 5LHGA 3MQ0A 1W4MA 4E70A 1Y0UA 2CMPA 3J81K 3IWFA 2M5WA 2FUG2 4RLFA 2ELKA 2DMUA 1TNSA 2AXLA 2K4JA 4XLPF 1TZLA 2M9HA 4DOZA 5M5XJ 3L2UA 5LFAA 4YFXF 2BYVE 4EJVA 4XRFA 5CYVA 1BI3A 1W7PB 3I64A 3RCOA 1EA3A 2VKEA 1MNMC 4LITA 4BH9A 4WWCA 1G4DA 2IS1A 2L01A 2HOSA 3BJ6A 1VI0A 1YX5A 3FK6A 3M8FA 2HKOA 4KICA 5FKMA 2ZFUA 1KQ9A 3W6JB 3JRFA 2VOPA 3G4SI 3ABMH 4GXOA 2E5ZA 2L7MP 1P9QC 3IUOA 2Q0OA 3OOPA 2NVYJ 3A01B 1DPUA 4I02A 5EJCA 3GZ6A 1OFCX 2EZHA 3BG7A 1LB2A 3WE2A 2KMUA 4NC7A 1D0YA 3GW2A 3C1DA 3VYUB 2Z16A 2VE9A 2STTA 4CZZA 2PJPA 1YIJI 1XC5A 5HDKA 3FIWA 3MZ8A 3DPLC 1REPC 2LK2A 3CMAI 1XSDA 3HTSB 1Z6RA 3GLXA 1E17A 4CCKA 2VODA 3DKWA 1CQTA 2X51A 3I55I 1U9NA 3MCZA 5D5WB 1O3QA 3GLLA 1Z21A 1QZEA 3BWGA 3ULQB 3QPHA 2OCEA 3I71A 2VJIA 1RNLA 5GADJ 3NRVA 2HZDA 3BQYA 1X4PA 1BJZA 3MFKA 3WTZA 2E34A 2Q2EA 3E97A 4DYRA 3W6VA 4HQMA 2V1XA 1EF4A 3H0GJ 2M4KA 4MTDA 2DJIA 2TCTA 5J1UA 1YO5C 2HDCA 2W24A 5EEHA 3OYAA 3FBIB 1S9HA 3LSTA 2R3SA 4L5JA 4XKWA 3VB2A 5HS7A 1PJRA 2CUFA 5FD5A 3ZN0A 2HOEA 4IO9F 2F2EA 1MDMA 3I58A 3Q0UA 1O57A 2LVSA 4EV0A 4RAGA 5DM7F 1FT9A 3CMYA 3OYMA 3L2CA 3ZMUA 4UVAA 2HOAA 2PMZA 2DA2A 3ONQA 2HTSA 5CKTA 3PJRA 1HCRA 2IAIA 2CUJA 2Y0SN 1VQMI 2MGQA 1JKOC 2R5ZB 3RYPA 2E2JJ 1SVLA 4IHSA 4BAYA 2CQXA 4UY8I 2XAQA 3ZQHA 1S5LC 3CCRI 3RIRA 3NAUA 3V4GA 4RM2A 4W1UA 1V5FA 2EIKH 2R4GA 4XOPA 1U5TC 5JLXA 1A36A 1OPCA 4Y52J 2EZLA 3K4JA 4E7HA 1MBEA 2E36A 1K79A 4OU0A 3OYNA 4L9NA 3N05A 3KYCB 3MMYB 4HQEA 1S8NA 1SANA 1UHSA 2VBYA 2X4HA 2KRHA 3BPXA 3TKYA 5H6RA 1FSEA 3RPUD 3ABTA 2ZJQF 1IXSB 2G0EA 3PSIA 2YUSA 3H36A 2KDOA 2Z1DA 1W7PA 2HFHA 2ID6A 2OF7A 3DU6A 3H92A 5KVRA 4KFCA 1SFXA 5EF6A 2KLOA 3H0DA 1DP3A 1FYMA 3DXJF 2VKVA 2HVQA 1WGXA 2Z99A 1XDUA 4UB8C 1FP1D 1XX5A 2ZJRF 1O3RA 3EUAA 2E2IJ 2AS5F 4HV5A 4U87A 3BTIA 5GP9A 3Q0VA 3CF2A 2R7QA 1LFPA 3TW7A 1U2WA 3AG3H 4RGRA 2QSFX 3BTCA 2LG4A 3WTTC 2MSYA 2M0MA 3I0TA 3A01A 3IH4A 5DDGA 2RC4A 3R0JA 4N0BA 2R7ZJ 4O5VA 5ED4A 4XLNF 3L1PA 2LKPA 2FOKA 4DYCA 4FISA 3O6BB 1TQPA 2WADA 2PJRB 2RN7A 4BXUA 5J1YA 3RDIA 4EM0B 3EPZA 2ELJA 3R60A 2LBFB 2O61A 1T56A 3QP6A 4L9JA 1XB4A 4QIWN 1X1AA 1BI0A 3OS0A 3JRBA 5LEKA 5FKLA 4GYGA 1X3UA 3DPTA 4D5FA 4C2TA 2CUZA 3P9CA 4J01A 1BR2A 2ME6A 3PM1A 2BVLA 5IT9K 1A5JA 3IH2A 1SMTA 4IKFA 9ANTA 1AOYA 2XAUA 1IXCA 2HI3A 1EKEA 2V26A 3LL7A 5LRRA 1T98A 3QPLA 1G3SA 2V6EA 1VQLI 1RR7A 4HV6A 1BL0A 3KP6A 4IZZA 1FZPB 4BJ6C 3HDDA 4LLNA 4UNOA 2OD5A 2CSOA 2MH9A 4XONA 3X2QH 3JRIA 5F04A 2BVMA 3EUHC 2EILH 3FXUA 4LOCA 2ICWG 2JWTA 3Q9VA 2DTZA 2ID3A 3CUQC 4II3A 2VLAA 3BPVA 3S3MA 2YS9A 1PP7U 3JRGA 5FO5A 1DQUA 2FA5A 2KKOA 1YJNI 5LLQA 1B8IB 3BY6A 1F36A 2V9PA 4HW0A 3K2ZA 2EBIA 2LD5A 1VNDA 2XB5A 4Y4RA 4ZZDA 2F5VA 2R5ZA 2X9DA 2ZSHB 3P5JA 4BNCA 2HQRA 3FMSA 5IYDJ 2JPCA 2PN6A 2CWEA 3CDHA 2DA7A 3QP5A 4YFKF 3OL3A 2D2WA 4RGXA 1I50J 5IP7J 4A3KJ 4AYBA 3QPSA 3RI4A 4IOCF 2UWMA 3M9AA 2K3PA 2N8GA 4CYDA 1FOWA 2OQRA 1PVEA 4D1QA 2VKHA 2XHKA 4CCNA 4XBFA 2D45A 5F1JA 4G9YA 4LG3A 1QU3A 2EFPA 5GAHJ 4EJWA 1N75A 1LE8B 1P2FA 4HG2A 2H1LA 4RM3A 5FFZA 4NC6A 2BY2A 3ABKH 3LFKA 2CG4A 3OYKA 1W5CC 2CQKA 4RB0A 4DBQA 3BR6A 1WJCA 4Q4ZF 1HW1A 2DT6A 5HODA 1Z3XA 2E7WA 3CCQI 2PMZN 3A1YA 4EQQA 3FXQA 3WTXC 3CLQA 1TWFJ 3KEQA 1BI1A 2DK5A 5J3LA 4WCGA 3K9TA 3OSFA 1J0RA 1U0JA 2EFOA 2V4JC 3HJEA 3R61A 1MIJA 1IC8A 1I6HJ 5LRSA 1UJ8A 1PUEE 4B43A 3CDLA 4ZYAA 2IRFG 4YIIA 2PJRA 4N4NB 1ZKGA 3FXLA 3G1OA 2XGDA 1WI3A 2XAJA 1ZG5A 4ENNA 1Z0XA 2F5FA 2HZTA 3CCYA 3PQKA 2HOTA 2LBFA 3UKGA 2H09A 2E7XA 1G8XA 2EZKA 5GPCA 4DZPA 2E71A 2FOWA 3FK7A 1R5GA 1WRJA 4RS8A 5CVRA 2O7OA 5IT3A 2L4AA 1TQIA 2RREA 5JVTA 1WJBA 1USTA 5CQEA 3ASOH 3SYTA 1ORKA 5E1ZB 3PFYA 3B02A 1ZAOA 4LIUA 3WGGA 4MTEA 5D4SA 2QYOA 2HTJA 4A3EJ 3CMMA 1MH3A 2L9NA 1BR4A 2E1NA 2VQHA 4RGSA 4UXNA 2NVUB 2R7XA 1S7EA 4UUSB 5HOOA 3F22A 1JUSA 4KITB 2V7FA 2Q8KA 1IW7F 3BG6A 1AWCA 4LG0B 3DLLF 3KX2A 2KHMA 1IRXA 2R7UA 3H1CA 4KYWA 4HX4A 2YU3A 2RQPA 3HRTA 1H0MA 5E1XA 2XRLA 4C3JJ 1YFHA 1TW2A 2VT2A 4Y13A 1WQ2A 2E19A 1TW3A 1B8IA 3OR2C 1T2KA 3PFIA 3GWZA 2JPBA 3F8BA 4AIJA 1IV6A 4HA8A 3W2VA 4LD5A 2P0WA 2O6GE 4IHVA 2COMA 2BHZA 4ZDOA 2XDVA 2FU4A 5LHIA 1D0ZA 3BQZA 2R92J 3CTAA 3V42A 1UHMA 1WHUA 4AC0A 2WY7Q 3A0HC 2YSRA 4XL9A 2GBYA 2AO9A 3E6BA 3RSNA 1JGSA 4BBRJ 1IRFA 1MNEA 3JRCA 4NHJA 2GIZA 2P5VA 5KCMA 3DWLE 3GTLJ 1QBJA 5K1YA 2DODA 1ENHA 3IRQA 3CQZJ 1Z9CA 3F6VA 4IRHA 3FKJA 2K86A 1LE8A 2ADUA 1NH3A 4CCJA 1ETKA 2P81A 4HLXA 2K85A 4WK8F 2HKXA 1N78A 1I27A 2FNAA 2R0QC 1U6GA 4CCOA 1WFXA 3S3NA 1YW8A 3TO6A 1FEXA 3HHGA 3HKZA 3L2VA 2KRCA 1X2MA 3B6CA 4JX6A 4YG2F 2CW0F 3I4PA 2A68F 2BHYA 4DBRA 1LUJB 1Y0NA 2GLOA 4KMFA 2KIQA 3P7NA 3LA2A 2VIXA 3QYEA 4EEFG 1GDTA 2VI6A 1J75A 2XKPA 2ZMEB 1B72B 2DMQA 5L3BA 3QPTA 2QKMB 2IBDA 2V1NA 1ETXA 3BJOA 3CLOA 1R23A 3O8GA 4AYBN 2DTRA 5HVQC 4XRSA 5BQTA 5FRNA 3HHHA 2D1HA 2DXIA 1ON2A 5TJJA 1OJLA 4BQQA 5ICCA 2HS5A 3HGGA 4OIPF 1GVJA 2IA1A 3OV8A 2FQ3A 4ENJA 1SAXA 2EA4A 3WG9A 4WF2A 3GMEA 3GZNB 5F0FA 2A5WA 3C2BA 1AHDP 2MW8A 1R4NB 5FLMJ 1TT5B 5HS9A 4K2EA 5D8KB 3DEWA 3I59B 3FWEA 4HOBA 2VC1A 3BOQA 3SHFA 5FB2A 3JSPA 2XGXA 1Q1HA 3I9V2 2ECCA 2KL4A 1ZTRA 3Q5FA 3H5AA 1FOXA 1NG7A 2X1DA 1TQMA 1MSEC 2CW8A 3ZMVA 1NHAA 1T0FA 2MD0A 4OIOF 4BEHA 2J5OA 4BJ5C 2PBIA 2ZNYA 2GXAA 4UUSA 1Y8QB 5DYMA 1D0XA 2STWA 4LG0A 4CCMA 1M1EB 2XAGA 2O03A 5HLTA 2DYSH 4HBLA 2W1OA 1FOKA 3JCUC 2AHQA 4NBQA 3AFHA 3IP4B 4HRIA 5KHDA 5HLIA 2WY8Q 5K7HA 2XC7A 2A07F 1H9TA 2R5YB 2K4BA 3F6OA 3K4KA 2CQQA 2MBFA 2QSHX 2Y9ZA 2H8RA 5EEGA 4S04A 3J7AO 3HTUA 3EYYA 1BC7C 4A3GJ 4A3CJ 3WHBA 4HNTA 4G12A 3T0YA 2JK3A 4EGZA 1ZGWA 3ZRGA 3M1EA 4B09A 3BZ6A 3CC2I 4XMYA 3Q9SA 1MGTA 3V7SA 2FBKA 1SD4A 1B1BA 3KIOA 4A6DA 1FWZA 1HLVA 4BXFA 5DCMB 4CYCB 2L2OA 3CESA 4GO1A 4GYIA 4FASD 5F08A 2F48A 3QODA 2VBZA 3SXYA 4I2OA 4BHBA 2EWNA 1LDKB 2EV5A 1JJ8C 2DYRH 2GXGA 2WAEA 1KQ8A 2LRDA 2DOEA 3LOCA 3K1PA 3DTEA 5DCFA 4NC8A 4AVPA 1NK2P 3K6GA 1MJBA 1XD7A 2CGPA 3DPUA 3TQNA 4LIVA 1FNNA 4XNFA 4B4CA 4O6JA 1SD5A 1ZHFA 2QVOA 3JW4A 2JZYA 5GPAA 5J8FA 1Z05A 3CJTB 2CV2A 5A2QZ 5ILVA 4I7HA 2YR2A 3AKZA 2LSOA 2R7OA 3PUBA 2DQRA 5M3MJ 2R7DA 4CDGA 4MFEA 1KU7A 2OTJI 3HSEA 5ERIA 2EIMH 2F5DA 1T33A 3ERMA 3SEQA 1OCOH 2QQAA 4QPOA 1ZLKA 1I1GA 4Y17A 2L7FP 3EDPA 4LB5A 2EFQA 2ZMEA 3QWLA 1B72A 3F8NA 1D5VA 2EIJH 1JKRC 2VL8A 2DFFA 1TC3C 4IVNA 3HOSA 2DAOA 4HYEA 2AXTC 2Y31A 2IGMA 2ETHA 4FETA 5CJ9A 5JHUA 3H3VK 1VQ6I 5LHHA 1MD0A 1KU2A 2H6BA 3JR9A 4EMSA 4A3LJ 2FF4A 2HYJA 4NDLA 1WKMA 2AQFA 4A3FJ 1UMQA 3QAHA 1H89C 3D0SA 3PO2J 2VE8A 2MD5A 4YRVA 4UUVA 4HNVA 3HUGB 3SQNA 1SVMA 3I59A 4QSHA 2IP2A 2A05A 2CS3A 1K7AA 3VFZA 1APLC 5IPAA 4PZJA 1BC8C 1BI2A 2C6YA 4HF2A 2WTEA 1J2XA 2DLLA 3GEZA 4IPAA 2JTVA 3DQVC 3T8RA 4S0HB 4H0EA 1YTYA 1U8BA 3EQLF 1MZBA 1S7AA 3I54A 3HKZN 3GTKJ 2JVHA 2X85A 3K4BA 1HW5A 3F3XA 4CA0A 4YELA 2EFNA 3RQIA 3MKLA 3U9GA 4F91B 1I1SA 4GFBA 2MABA 1LJ9A 2X6XA 5FLVA 2R5YA 4ESFA 2OPTA 1QZZA 4BQNA 4FX4A 3GVAA 2FE3A 4YIRX 2MLGA 3OYIA 1U3EM 2R7RA 3TL4X 3GTJJ 2H6CA 4XLAA 2EFWA 3KYDB 1QRYA 5LGUA 3CCUI 3TEDA 1SMYF 5LGNA 2DFIA 4IF4A 2LLKA 1VQ4I 1STZA 1R5HA 1YS6A 2O5RA 3K4MA 4RB2C 2XF6A 3T1BA 5BS6A 2LMDA 2XGCA 2CFXA 5DCMA 2B9SA 4CYCA 4G7OF 5K5QA 4KA4A 1IJWC 2JA2A 4ENKA 2KISA 3PUFA 3RZOJ 4ESJA 2JRTA 3K70C 5BPDA 2LY1A 4RB3C 3OY9A 1QVTA 1YRNB 1P7JA 1ULYA 4DGWB 4II2A 4RBOA 3C18A 4LFUA 2CRGA 4XM3A 2FJ1A 4ENMA 4MEXF 1FX7A 2XAHA 2JA7J 1IO2A 1OISA 4XORA 2NAZA 4BBSJ 2HXIA 3K70D 3TDUC 3G71I 3QOPA 4ZYHA 2O0YA 5F6FA 1OCTC 4D0PA 2V9KA 3GFIA 1RIOH 3CC7I 2UXNA 4PJ0C 1P6RA 4HLYA 2ACJA 2YU9J 2HWVA 2QM3A 4YEJA 4A69C 4KN4X 1AA7A 4I01A 1FBUA 1P4WA 2OU2A 2WA0A 3AG1H 4BU2A 3I56I 4FTHA 4WXDA 1YHQI 2EV6A 2LH9A 1ZN2A 1DGWY 4C30A 3OYEA 1X58A 4ZTJA 4E7KA 5L3FA 1Y6IA 4OAYA 4X6AJ 1TWHJ 1K4SA 2HDDA 5DV5A 3RKQA 2GAUA 2XVCA 3HPGA 2O9LA 3F72A 1UCRA 4XRMA 1DU6A 2PQ8A 3F9KA 1FIPA 2IGOA 1W0UA 3ZQGA 4G7ZF 2V9VA 4UVBA 4NNJA 4G6DA 5CVIA 4LK0F 1VTNC 3K7AJ 4ZYEA 3P9IA 3GTQJ 2QQBA 1XMXA 1T38A 1FP2A 3GZ5A 4KT5C 2E1MB 3HUGA 1FMVA 3KCCA 3ABLH 1FLIA 1SD7A 3E5UA 2OC6A 2Z5UA 4W97A 5FGMA 1IDZA 1WJAA 3JRDA 3HSRA 2ZNZA 4Q47A 5GTHC 1QPMA 5HS8A 1I3QJ 5CPRB 1KA8A 5CVUA 3RQ4A 3MVPA 2X6WA 3NWTA 3ERED 2OV7A 4A2UA 2LTPA 3S3OA 1YQAA 1ETVA 1FIAA 1U5TA 1I6XA 1R1TA 1R5ID 2I10A 2JSCA 3RKWA 1ONVA 1OR7A 1XS9A 3J7AY 3HYIA 3ZP5A 5D8LB 2Y9YA 1KU9A 1J7KA 4AM3A 2UXXA 2CJJA 1A04A 1G3TA 2B7EA 1J9IA 3I3LA 4KUMA 4NB5A 4RAYA 3OYHA 4FQGA 4R79A 2XRNA 5L3GA 1LEAA 1W7PD 1FTZA 2QZ8A 4MEYF 2NYXA 1QNTA 1QA6A 2H94A 2I8DA 2V79A 2ZC2A 3KZZA 4LLLA 2KIUA 3CP2A 3SEZA 1F1ZA 1TLHB 3ASNH 3HZJA 2BY1A 3EETA 3KFWX 5DD8A 2VJ5A 5KNLA 2GIVA 2X0LA 3N4MA 2JA8J 1KONA 2H8WA 3S32A 4ASNA 1VZ0A 1IZ1A 4ZYGA 2QEXI 2M3AA 3EUKL 1SD6A 3CUOA 3KP7A 1IV8A 4ABZA 4A3BJ 2DN0A 2DT7B 1YS7A 3S1QJ 2HGCA 2IS6A 2P6TA 2ME0A 2W84A 4N4OB 2W00A 2OZUA 4GCVA 1K6YA 1UZCA 1R1UA 1YRNA 4JYKA 2KP6A 3J80K 2ELHA 3OL4A 4C9YA 2QENA 3WE3A 5E8GA 3E6MA 3V8KA 1F9NA 3IC7A 4AIKA 2RDPA 3OYCA 4U7BA 5D5UB 3T8TA 1ZRCA 4KJZA 1T08B 5E20A 3REOA 3D5SC 1AU7A 3ZOBA 3SZTA 3W3CA 1Z67A 2M8EA 3WTUC 1IG7A 2VASA 1IDYA 4BS9A 5A2QK 3AG4H 3CDIA 5E1WA 3KEOA 4X0GA 5L3CA 5TISC 2LF7A 3IV5A 4M73A 4P96A 4P1WA 1E3PA 1SC7A 4RGUA 5B1BH 2HYGD 3ECHA 2M4GA 2Y69H 3KP5A 2IVMA 4AD9A 3BR1A 3S2HJ 1D3YA 2BZTA 2BXZA 4PJJA 3GX4X 2XF7A 1PDNC 3E0JB 3SDBA 2KDZA 4EM1A 3MKYB 3L2QA 2R93J 1TNTA 3BR5A 1TL8A 2AQEA 3GF2A 3CCVI 3H9GA 3IRRA 2OCCH 4IQ4A 4P9UA 3EUHA 3HPHA 5H6QA 2QGUA 5ILUA 2W4SA 4I76A 4AVZA 3CCLI 5E8IA 3GXOA 3D1NI 4MO7A 1LQ1A 4UV9A 3A03A 2DFHA 2PI0A 1ZK8A 4M3FA 4A93J 2QLZA 1PUFB 1IXRC 5TGTA 1J09A 2DA5A 4QWQA 1ZR2A 2DCEA 2A6HF 1YOVB 5EZHA 3WGHA 1R7JA 3ZR8X 2BEOA 4I0BA 2FBIA 1FYKA 3CZ6A 3PO3J 2M87A 3M1CA 1ZG1A 1LDDA 3ZGKA 1F43A 3WU1B 1GV2A 3KYLA 3ML6A 2G9WA 1OCCH 5M5WJ 4A3DJ 2O8XA 3DFGA 1S29A 1KU3A 2L7KA 2LNBA 3LQQA 4Y15A 3S1NJ 3KZYA 1UB9A 2GWRA 4L5IA 4A3IJ 1HF0A 1WVRA 2X6YA 3F0CA 4EVIA 2L9SA 2BY3A 3F8FA 1B6AA 1QGPA 4D7MA 2IEKA 3FF5A 3MD2A 4BQOA 2HVSA 3DTKA 1ETOA 4JOMA 1JT0A 4BDZA 1IN7A 2LY9A 1X3ZB 4RAFA 3OOUA 2GA1A 1MBGA 4XN3A 5H20A 3TGNA 5C4XJ 3BDDA 3E3VA 1ACIA 4U0YA 3FM5A 1FPQA 4B48A 5HLGA 1JUMA 5M5YJ 3NQOA 2QKLB 4BKXA 3CO7C 2OTLI 3E1SA 3M07A 1WJDA 4DZJA 2DI3A 2MFZA 1MBHA 2FRHA 4DJAA 5IY5H 1ZR4A 1SFUA 2W25A 4F55A 3G1MA 3JAMZ 2VJJA 3FXRA 3MZYA 3N97A 3HXLA 1I39A 1OMIA 1VQPI 1MNDA 1HBXG 5E3MA 1HKSA 2HQNA 5BOXA 3K69A 2IGNA 4U0WA 4XKBA 2ZXWH 4EJOA 1MJ9A 2DA1A 4HSRA 1XSXA 5E3LA 1KGSA 2VN2A 2F4OB 4PGGA 1O7FA 4FHTA 3A2KA 3PNYA 4EJTA 2KQRA 4BEHB 3S2WA 2RQQA 2J5PA
chains in the Genus database with same CATH topology
4KIBA 1R22A 1XGNA 5KK1A 4WXHA 4IRGA 4OMZA 2YX7A 4ZH4F 2NNNA 4A0XA 4LK1F 4KN7X 2VXZA 2OA4A 2KJBA 2XROA 1R00A 2A69F 4HF0A 4EJUA 3HOTA 1W5TA 3ZMDA 2D1VA 1G3WA 4CGZA 3TOBA 4WXCA 4MHGA 4A5NA 1IN4A 4L9VA 5DD4A 4CO8A 4ON0A 3L7WA 3C7JA 4A12A 1IAWA 2L54A 3P9KA 3FMRA 3KP2A 2M1BA 2M30A 2VBWA 1YW7A 3SZPA 2ZCWA 3FMQA 2ISYA 1SFEA 3MEXA 3H3ZA 3K1MA 1LNWA 4I0AA 1MKMA 3ZPLA 3CO6C 3L09A 1JXSA 4L18B 1K78B 2XAFA 4HLYA 3RTRA 2HYFA 2MLKA 2XUBA 1HSTA 5D5XB 2FMYA 1Z6TA 4U88A 3GUDA 3TO7A 1FC3A 1DPRA 3GFJA 3SFZA 3ZQ7A 3H3UA 3TDZC 4BQAA 4BHCA 2Y48A 3RKXA 4OOIA 1GXPA 5J6XA 1XCBA 1WWXA 4RAZA 3E6CC 5BPIA 4YFNF 2XASA 1P4XA 2ESHA 2WC2A 3T5XA 4IHTA 3B73A 3DV8A 1RUNA 2PLYA 1R36A 2L02A 3GYHX 2R7FA 2GXBA 5ICGA 2QBYB 2RVCA 3DEUA 2G7HA 3K1NA 4L0YB 2RV8A 1OYIA 4IRIA 3L00A 1YIOA 2DU9A 3ROUA 2K7LA 1IN5A 5AIQA 1DP7P 2P8TA 1HKTA 4CHUA 5FLXZ 3V8JA 3VODA 4F7ZA 2YX4A 1T39A 4AIHA 2DBBA 1K6OA 3WU0A 1RZ4A 3WTVC 4U0VA 4YIFA 1K78A 2GZWA 2W85A 4GGGA 3GFLA 3ZN1A 1IRGA 4UV8A 3U2RA 2OBPA 1ZRFA 3IL2A 1P92A 3JTGA 3JSOA 2BE5F 2PMUA 2F5CA 2V1DA 5DUIA 1XDSA 3LAPA 4HDUA 2IJLA 1H9GA 4WX9A 2ZXJA 3KE2A 3C3WA 3WTSC 2NRAC 5HLHA 3KP4A 4A5MA 2B0LA 5D6EA 4M71A 5DUKA 2IA2A 5L3DA 4UVCA 3E5QA 3RKYA 1WI9A 2FNPA 2MA3A 1W5SA 2IT0A 1U5TB 5ICEA 3ZMTA 3LA3A 2MH2A 1GXQA 2FMLA 1B9NA 5E18F 5L3EA 4DQ2A 4BHPA 3V7RA 1HQCA 4QLCU 1ZGAA 3HRMA 2QBYA 1Z91A 1Z7UA 2KIFA 4OINF 1EH8A 1YYVA 2H27A 3RPQA 5FD6A 4M6XA 1HW2A 3O2PE 4MGRA 2QQ9A 2ESNA 1BIAA 3TO9A 1YLFA 4Q48A 1CF7B 2P5KA 3JTHA 4CXFA 4M6YA 2RKHA 2L3DA 2Y75A 4PCQA 2QWWA 2YPRA 5D4RA 4ESBA 4XSZF 5F64A 1ZGJA 3ABUA 3EYIA 5J8CA 4O3MA 4XSXF 3DP7A 1LEBA 3HSFA 1S6LA 4ZZLA 1MJAA 1IN6A 3ISPA 2BGCA 2DPUA 4BYYA 2VBXA 3R4KA 1JHHA 1YW9A 4AWXB 4IXAA 1XCVA 4A0YA 4DNCA 1GHCA 3CUQB 3MAJA 3MWMA 3FM3A 4B8XA 5TRDA 3BROA 1D8JA 6PAXA 4NQWA 2Z3YA 2DPDA 3L9FA 1HXDA 5JFRA 2K27A 3RPUA 1DUXC 2XIGA 3O3KA 4M9XA 2W57A 4N9IA 2FXAA 2TDXA 3TOAA 1O3SA 4HX8A 3VOEA 1BN5A 4JBAA 2Z33A 2PMHA 1B9MA 1XN7A 2EA2A 3ELKA 2BV6A 3HRUA 1KYWA 5HDGA 2ISZA 1LDJA 2WWYA 4PDKA 2VOOA 2RGVA 5E17F 5BMZA 5LEJA 5K5RA 1CF7A 4EGYA 3W6KB 1IUYA 1V4RA 4P55A 1KQ0A 1EH7A 5FLXK 1LVAA 2E1CA 4L9TA 4LGWA 2DT5A 2EJRA 4I98B 3BJAA 5FFXA 3M8EA 4M72A 1IN8A 3NEUA 2K02A 2NS0A 2ZKZA 1F4KA 3R0AA 1ODDA 1RUOA 3BP8A 3V8LA 1C0WA 3F8CA 1HKQA 4EM2A 4Z2YA 3COAC 1F5TA 2ZBKA 5CVVA 1WSUA 2Z9OA 2P5LC 3K0LA 4M9ZA 3CUQA 2ZO4A 1L3LA 3WGIA 4HAMA 3QU3A 1BJAA 5K5OA 5CLSA 2RNJA 1B59A 4TV7A 3R6SA 2A6EF 5JR3A 1ZG3A 1XGOA 3ZMSA 1D8KA 1YG2A 1ON1A 2EK5A 2DW4A 2BBYA 3GFMA 4G94A 2EB7A 1OYYA 5AONA 2JT1A 2LDUA 2A61A 4LMYA 1S7OA 2V6CA 1UFMA 1QQIA 5ICFA 2P7CB 1FSHA 3G3ZA 1ZREA 5JI6A 3RYRA 4LB6B 2Y0MA 2O3FA 5HDNA 3DF8A 4ZYDA 2OQGA 2VT3A 3FHZA 4OIRF 3U1DA 3G73A 3MZHA 5LGTA 1FYLA 1JE8A 1U78A 3FZVA 3J81Z 4MQ9F 1XMAA 2ZFWA 1CGPA 3KETA 1FBQA 4G8XA 4KDPA 3FX3A 2FSWA 4G7HF 3KLOA 1O3TA 1TTYA 1EV7A 1T6SA 2NNYA 4ETSA 2UZKA 1I5ZA 2LF8A 2P4WA 3CJNA 4M74A 1ZLJA 3LWFA 4CICA 3LAJA 2OZ6A 1ZYRF 1XGMA 4R1HA 3HRSA 4JK1X 3QRFF 3F21A 1EH6A 1XGSA 2IW5A 2PG4A 2MC3A 4N9HA 2FBHA 5F1RA 1DDNA 2XKOA 1QO0D 4PGHA 2P7VB 4HX7A 1RI7A 1ZARA 1E2XA 3F23A 4Q5SF 4A0ZA 2DQLA 4P9FA 2IA0A 3LA7A 1G3YA 3AAFA 3LQRA 3M7GA 2G7UA 2FEZA 4G6QA 3HIFA 2P6SA 1V3FA 1BIBA 1ZH5A 3GO5A 3ZMZA 1PP8F 1P4AA 2WV0A 5ILSA 3WTWC 2KJCA 3RJPA 4I09A 5LBQA 3IWZA 2DO7A 2ZJ2A 3KLNA 3WTYC 2A5YB 3D5LA 4U7DA 1S3JA 3WODF 1XMKA 1O7LA 4HF1A 3E6DA 1R1VA 1KYZA 4R8HA 2HR3A 1BM9A 4P5OA 1Z1DA 2PEXA 2HEOA 4LJZF 1U8RA 1FY7A 3IHUA 1ZRDA 2XV4S 2A3SA 3I53A 2V1UA 3PQJA 2PFBA 4MNUA 1XSVA 5D6FA 4A6EA 4KIGA 2DK8A 1OKRA 2OAZA 4KIFA 3VEPA 3IKVA 2CO5A 1USSA 1J59A 2CYYA 2M45A 2IPQX 1FBSA 1J5YA 2QUFA 4S05A 2L4MA 3ECOA 2GQQA 1G6NA 1IF1A 3IKTA 1TBXA 5DEQA 3J80Z 1R58A 5IT9Z 4HZFA 4LLGF 4FX0A 2KIMA 4MQVA 1JHFA 4L0ZB 3KP3A 4UHTA 2F5EA 3F8MA 2KRFA 1BOAA 4IJAA 1L0OC 1OYWA 4RB1A 4OIQF 4KMUX 1UHWA 1MDMB 1HSJA 1QZYA 5CVJA 3I5UA 4HDVA 3QU6A 1B4AA 3E5XA 4M9SA 3V7CA 1BBYA 5D5VB 4FT8A 4OMYA 3JAMK 4KNYA 2GA2A 2VC0A 2EV0A 2VONA 4JQFA 5AIPA 5LHGA 3MQ0A 1W4MA 4E70A 1Y0UA 3J81K 3IWFA 2M5WA 1TNSA 2AXLA 2K4JA 4XLPF 4YFXF 2BYVE 4EJVA 4XRFA 5CYVA 1BI3A 1W7PB 3I64A 4BH9A 4WWCA 1G4DA 2L01A 3BJ6A 3M8FA 4KICA 2HKOA 1KQ9A 3W6JB 2VOPA 4GXOA 2Q0OA 3OOPA 1DPUA 4I02A 3GZ6A 1LB2A 3WE2A 3GW2A 3C1DA 2VE9A 2STTA 4CZZA 2PJPA 5HDKA 1REPC 3DPLC 1XSDA 3HTSB 1Z6RA 3GLXA 1E17A 2VODA 3DKWA 3MCZA 5D5WB 1O3QA 3BWGA 3ULQB 3QPHA 3I71A 1RNLA 3NRVA 3MFKA 3WTZA 2Q2EA 3E97A 4HQMA 2V1XA 4MTDA 1YO5C 2HDCA 2W24A 5EEHA 4L5JA 3LSTA 2R3SA 3VB2A 5HS7A 5FD5A 3ZN0A 2HOEA 2F2EA 1MDMA 3I58A 4EV0A 1O57A 1FT9A 3L2CA 3ZMUA 4UVAA 2HTSA 3RYPA 4IHSA 4BAYA 2XAQA 3RIRA 3V4GA 1U5TC 1OPCA 1K79A 4OU0A 4L9NA 4HQEA 1S8NA 2VBYA 2X4HA 3BPXA 3TKYA 5H6RA 1FSEA 3ABTA 1IXSB 1W7PA 2HFHA 3H92A 5KVRA 4KFCA 1SFXA 1FYMA 3DXJF 2Z99A 1O3RA 1XDUA 1FP1D 2AS5F 4HV5A 1U2WA 4RGRA 3WTTC 3I0TA 5DDGA 2RC4A 3R0JA 4N0BA 4O5VA 5ED4A 4XLNF 2LKPA 2FOKA 3O6BB 1TQPA 2RN7A 4BXUA 3RDIA 4EM0B 3R60A 2O61A 3QP6A 4L9JA 1XB4A 1BI0A 5LEKA 4GYGA 1X3UA 3DPTA 3P9CA 5IT9K 1SMTA 1AOYA 1IXCA 5LRRA 1T98A 1G3SA 4HV6A 3KP6A 1FZPB 4LLNA 4UNOA 2OD5A 2CSOA 2MH9A 3FXUA 3Q9VA 1PP7U 3CUQC 3BPVA 5FO5A 2FA5A 2KKOA 5LLQA 3BY6A 4HW0A 3K2ZA 4ZZDA 4BNCA 2HQRA 3FMSA 2JPCA 2PN6A 2CWEA 3CDHA 3QP5A 4YFKF 4RGXA 2D2WA 3RI4A 2UWMA 3M9AA 4CYDA 2OQRA 2XHKA 4XBFA 2D45A 4G9YA 2EFPA 4EJWA 1P2FA 5FFZA 3LFKA 2CG4A 4RB0A 2CQKA 4Q4ZF 1HW1A 2E7WA 4EQQA 3FXQA 3WTXC 3KEQA 1BI1A 2DK5A 4WCGA 3K9TA 1J0RA 2EFOA 3R61A 5LRSA 1PUEE 2IRFG 4YIIA 2XAJA 1ZG5A 4ENNA 2F5FA 2HZTA 3PQKA 2H09A 2E7XA 1R5GA 1WRJA 4RS8A 5CVRA 5IT3A 2L4AA 1TQIA 5JVTA 1USTA 5E1ZB 3B02A 1ZAOA 3WGGA 4MTEA 5D4SA 2QYOA 2HTJA 4RGSA 2E1NA 4UXNA 5HOOA 3F22A 2Q8KA 1AWCA 1IW7F 4LG0B 4KYWA 4HX4A 2YU3A 2RQPA 3HRTA 1H0MA 5E1XA 1YFHA 1TW2A 4Y13A 2VT2A 1WQ2A 1TW3A 1T2KA 3PFIA 3GWZA 2JPBA 3F8BA 4AIJA 4HA8A 4LD5A 2O6GE 2COMA 2FU4A 5LHIA 3CTAA 1UHMA 2YSRA 3E6BA 1JGSA 1IRFA 4NHJA 2P5VA 1QBJA 5K1YA 3IRQA 1Z9CA 3F6VA 4IRHA 2K86A 2ADUA 4HLXA 4WK8F 2HKXA 1I27A 2FNAA 1U6GA 1YW8A 3TO6A 3HHGA 4YG2F 2CW0F 3I4PA 2A68F 4KMFA 3P7NA 3LA2A 1J75A 2XKPA 2ZMEB 5L3BA 3QPTA 3BJOA 3CLOA 1R23A 5HVQC 2DTRA 5BQTA 3HHHA 2D1HA 1ON2A 5TJJA 5ICCA 2HS5A 4OIPF 1GVJA 2IA1A 3OV8A 2FQ3A 4ENJA 1SAXA 2EA4A 3WG9A 4WF2A 5HS9A 5D8KB 4K2EA 3I59B 3FWEA 4HOBA 2VC1A 3BOQA 3SHFA 5FB2A 3JSPA 2XGXA 1Q1HA 3Q5FA 1TQMA 3ZMVA 1NHAA 1T0FA 4OIOF 2J5OA 2PBIA 2ZNYA 5DYMA 2STWA 4LG0A 2XAGA 2O03A 4HBLA 1FOKA 5HLIA 2A07F 1H9TA 2K4BA 3F6OA 2MBFA 5EEGA 4S04A 3J7AO 3HTUA 3EYYA 1BC7C 3T0YA 4EGZA 3M1EA 4B09A 3BZ6A 3Q9SA 1MGTA 3V7SA 2FBKA 1SD4A 1B1BA 4A6DA 1FWZA 5DCMB 4GO1A 4GYIA 2VBZA 3SXYA 4I2OA 4BHBA 2EWNA 1LDKB 2EV5A 2GXGA 1KQ8A 3K1PA 5DCFA 4AVPA 1MJBA 1XD7A 2CGPA 3TQNA 1FNNA 4O6JA 1SD5A 1ZHFA 2QVOA 3JW4A 2JZYA 5J8FA 1Z05A 5A2QZ 5ILVA 4I7HA 2YR2A 2LSOA 2DQRA 2R7DA 4CDGA 1KU7A 3HSEA 5ERIA 2F5DA 2QQAA 1ZLKA 1I1GA 4Y17A 3EDPA 4LB5A 2EFQA 2ZMEA 3F8NA 1D5VA 4IVNA 3HOSA 2DAOA 4HYEA 2ETHA 5CJ9A 5JHUA 5LHHA 1MD0A 1KU2A 2H6BA 4EMSA 2FF4A 1WKMA 3QAHA 3D0SA 2VE8A 2MD5A 4UUVA 3SQNA 3I59A 2IP2A 1K7AA 3VFZA 4PZJA 1BC8C 1BI2A 2C6YA 4HF2A 2WTEA 1J2XA 2DLLA 3GEZA 4IPAA 2JTVA 3DQVC 3T8RA 1YTYA 4H0EA 3EQLF 1MZBA 1S7AA 3I54A 1HW5A 3F3XA 2EFNA 3U9GA 1I1SA 1LJ9A 4ESFA 1QZZA 4FX4A 3GVAA 2FE3A 2MLGA 1U3EM 2H6CA 2EFWA 5LGUA 1SMYF 5LGNA 2DFIA 4IF4A 1STZA 1R5HA 1YS6A 4RB2C 3T1BA 5BS6A 2CFXA 5DCMA 4G7OF 5K5QA 4KA4A 4ENKA 4ESJA 2JRTA 5BPDA 4RB3C 1ULYA 3C18A 4LFUA 4ENMA 4MEXF 1FX7A 2XAHA 2NAZA 3TDUC 3QOPA 4ZYHA 2O0YA 5F6FA 4D0PA 3GFIA 1RIOH 2UXNA 1P6RA 2ACJA 2HWVA 2QM3A 4KN4X 4I01A 1FBUA 1P4WA 2OU2A 4WXDA 2EV6A 1ZN2A 5L3FA 5DV5A 2GAUA 2XVCA 3F72A 1UCRA 2PQ8A 4G7ZF 2V9VA 4UVBA 4G6DA 5CVIA 4LK0F 1VTNC 4ZYEA 3P9IA 2QQBA 1T38A 1FP2A 3GZ5A 4KT5C 3HUGA 3KCCA 1FLIA 1SD7A 3E5UA 2Z5UA 5FGMA 3HSRA 2ZNZA 4Q47A 1QPMA 5HS8A 1KA8A 5CVUA 3ERED 4A2UA 1YQAA 1U5TA 1I6XA 1R1TA 2JSCA 3RKWA 1ONVA 1OR7A 3HYIA 3ZP5A 5D8LB 1KU9A 1J7KA 2UXXA 1A04A 1G3TA 1J9IA 4KUMA 4NB5A 4RAYA 5L3GA 4R79A 2XRNA 1LEAA 1W7PD 2QZ8A 4MEYF 2NYXA 1QNTA 2H94A 2V79A 3KZZA 4LLLA 2KIUA 1F1ZA 1TLHB 3KFWX 3EETA 5DD8A 2GIVA 2X0LA 3N4MA 4ASNA 4ZYGA 1IZ1A 1SD6A 3CUOA 3KP7A 1YS7A 2HGCA 2P6TA 2W84A 2OZUA 4GCVA 1R1UA 3J80K 2ELHA 2QENA 3WE3A 5E8GA 3E6MA 3V8KA 1F9NA 3IC7A 4AIKA 2RDPA 4U7BA 5D5UB 3T8TA 1ZRCA 5E20A 3REOA 3SZTA 2M8EA 3WTUC 5A2QK 5E1WA 3KEOA 5L3CA 2LF7A 4M73A 4P96A 4RGUA 2HYGD 3ECHA 4AD9A 3KP5A 2IVMA 1D3YA 3GX4X 1PDNC 4EM1A 1TNTA 3GF2A 3IRRA 4P9UA 3EUHA 5H6QA 5ILUA 5E8IA 3GXOA 1LQ1A 4UV9A 2PI0A 2QLZA 1IXRC 4QWQA 2A6HF 3WGHA 1R7JA 2BEOA 4I0BA 2FBIA 1FYKA 2M87A 1ZG1A 1LDDA 3WU1B 3ML6A 2G9WA 2O8XA 3DFGA 1S29A 1KU3A 2LNBA 3LQQA 4Y15A 3KZYA 1UB9A 2GWRA 4L5IA 4EVIA 3F8FA 1B6AA 1QGPA 3FF5A 1IN7A 2GA1A 5H20A 3TGNA 3BDDA 3E3VA 4U0YA 3FM5A 1FPQA 5HLGA 3NQOA 3CO7C 2DI3A 2FRHA 1SFUA 2W25A 3JAMZ 3FXRA 3MZYA 3N97A 1OMIA 1HBXG 1HKSA 2HQNA 5BOXA 3K69A 4U0WA 4EJOA 1MJ9A 1XSXA 1KGSA 2VN2A 4PGGA 1O7FA 4FHTA 4EJTA 3S2WA 2J5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIB A;  1R22 A;  1XGN A;  5KK1 A;  4WXH A;  4IRG A;  4OMZ A;  2YX7 A;  4ZH4 F;  2NNN A;  4A0X A;  4LK1 F;  4KN7 X;  2VXZ A;  2OA4 A;  2KJB A;  2XRO A;  1R00 A;  2A69 F;  4HF0 A;  4EJU A;  3HOT A;  1W5T A;  3ZMD A;  2D1V A;  1G3W A;  4CGZ A;  3TOB A;  4WXC A;  4MHG A;  4A5N A;  1IN4 A;  4L9V A;  5DD4 A;  4CO8 A;  4ON0 A;  3L7W A;  3C7J A;  4A12 A;  1IAW A;  2L54 A;  3P9K A;  3FMR A;  3KP2 A;  2M1B A;  2M30 A;  2VBW A;  1YW7 A;  3SZP A;  2ZCW A;  3FMQ A;  2ISY A;  1SFE A;  3MEX A;  3H3Z A;  3K1M A;  1LNW A;  4I0A A;  1MKM A;  3ZPL A;  3CO6 C;  3L09 A;  1JXS A;  4L18 B;  1K78 B;  2XAF A;  4HLY A;  3RTR A;  2HYF A;  2MLK A;  2XUB A;  1HST A;  5D5X B;  2FMY A;  1Z6T A;  4U88 A;  3GUD A;  3TO7 A;  1FC3 A;  1DPR A;  3GFJ A;  3SFZ A;  3ZQ7 A;  3H3U A;  3TDZ C;  4BQA A;  4BHC A;  2Y48 A;  3RKX A;  4OOI A;  1GXP A;  5J6X A;  1XCB A;  1WWX A;  4RAZ A;  3E6C C;  5BPI A;  4YFN F;  2XAS A;  1P4X A;  2ESH A;  2WC2 A;  3T5X A;  4IHT A;  3B73 A;  3DV8 A;  1RUN A;  2PLY A;  1R36 A;  2L02 A;  3GYH X;  2R7F A;  2GXB A;  5ICG A;  2QBY B;  2RVC A;  3DEU A;  2G7H A;  3K1N A;  4L0Y B;  2RV8 A;  1OYI A;  4IRI A;  3L00 A;  1YIO A;  2DU9 A;  3ROU A;  2K7L A;  1IN5 A;  5AIQ A;  1DP7 P;  2P8T A;  1HKT A;  4CHU A;  5FLX Z;  3V8J A;  3VOD A;  4F7Z A;  2YX4 A;  1T39 A;  4AIH A;  2DBB A;  1K6O A;  3WU0 A;  1RZ4 A;  3WTV C;  4U0V A;  4YIF A;  1K78 A;  2GZW A;  2W85 A;  4GGG A;  3GFL A;  3ZN1 A;  1IRG A;  4UV8 A;  3U2R A;  2OBP A;  1ZRF A;  3IL2 A;  1P92 A;  3JTG A;  3JSO A;  2BE5 F;  2PMU A;  2F5C A;  2V1D A;  5DUI A;  1XDS A;  3LAP A;  4HDU A;  2IJL A;  1H9G A;  4WX9 A;  2ZXJ A;  3KE2 A;  3C3W A;  3WTS C;  2NRA C;  5HLH A;  3KP4 A;  4A5M A;  2B0L A;  5D6E A;  4M71 A;  5DUK A;  2IA2 A;  5L3D A;  4UVC A;  3E5Q A;  3RKY A;  1WI9 A;  2FNP A;  2MA3 A;  1W5S A;  2IT0 A;  1U5T B;  5ICE A;  3ZMT A;  3LA3 A;  2MH2 A;  1GXQ A;  2FML A;  1B9N A;  5E18 F;  5L3E A;  4DQ2 A;  4BHP A;  3V7R A;  1HQC A;  4QLC U;  1ZGA A;  3HRM A;  2QBY A;  1Z91 A;  1Z7U A;  2KIF A;  4OIN F;  1EH8 A;  1YYV A;  2H27 A;  3RPQ A;  5FD6 A;  4M6X A;  1HW2 A;  3O2P E;  4MGR A;  2QQ9 A;  2ESN A;  1BIA A;  3TO9 A;  1YLF A;  4Q48 A;  1CF7 B;  2P5K A;  3JTH A;  4CXF A;  4M6Y A;  2RKH A;  2L3D A;  2Y75 A;  4PCQ A;  2QWW A;  2YPR A;  5D4R A;  4ESB A;  4XSZ F;  5F64 A;  1ZGJ A;  3ABU A;  3EYI A;  5J8C A;  4O3M A;  4XSX F;  3DP7 A;  1LEB A;  3HSF A;  1S6L A;  4ZZL A;  1MJA A;  1IN6 A;  3ISP A;  2BGC A;  2DPU A;  4BYY A;  2VBX A;  3R4K A;  1JHH A;  1YW9 A;  4AWX B;  4IXA A;  1XCV A;  4A0Y A;  4DNC A;  1GHC A;  3CUQ B;  3MAJ A;  3MWM A;  3FM3 A;  4B8X A;  5TRD A;  3BRO A;  1D8J A;  6PAX A;  4NQW A;  2Z3Y A;  2DPD A;  3L9F A;  1HXD A;  5JFR A;  2K27 A;  3RPU A;  1DUX C;  2XIG A;  3O3K A;  4M9X A;  2W57 A;  4N9I A;  2FXA A;  2TDX A;  3TOA A;  1O3S A;  4HX8 A;  3VOE A;  1BN5 A;  4JBA A;  2Z33 A;  2PMH A;  1B9M A;  1XN7 A;  2EA2 A;  3ELK A;  2BV6 A;  3HRU A;  1KYW A;  5HDG A;  2ISZ A;  1LDJ A;  2WWY A;  4PDK A;  2VOO A;  2RGV A;  5E17 F;  5BMZ A;  5LEJ A;  5K5R A;  1CF7 A;  4EGY A;  3W6K B;  1IUY A;  1V4R A;  4P55 A;  1KQ0 A;  1EH7 A;  5FLX K;  1LVA A;  2E1C A;  4L9T A;  4LGW A;  2DT5 A;  2EJR A;  4I98 B;  3BJA A;  5FFX A;  3M8E A;  4M72 A;  1IN8 A;  3NEU A;  2K02 A;  2NS0 A;  2ZKZ A;  1F4K A;  3R0A A;  1ODD A;  1RUO A;  3BP8 A;  3V8L A;  1C0W A;  3F8C A;  1HKQ A;  4EM2 A;  4Z2Y A;  3COA C;  1F5T A;  2ZBK A;  5CVV A;  1WSU A;  2Z9O A;  2P5L C;  3K0L A;  4M9Z A;  3CUQ A;  2ZO4 A;  1L3L A;  3WGI A;  4HAM A;  3QU3 A;  1BJA A;  5K5O A;  5CLS A;  2RNJ A;  1B59 A;  4TV7 A;  3R6S A;  2A6E F;  5JR3 A;  1ZG3 A;  1XGO A;  3ZMS A;  1D8K A;  1YG2 A;  1ON1 A;  2EK5 A;  2DW4 A;  2BBY A;  3GFM A;  4G94 A;  2EB7 A;  1OYY A;  5AON A;  2JT1 A;  2LDU A;  2A61 A;  4LMY A;  1S7O A;  2V6C A;  1UFM A;  1QQI A;  5ICF A;  2P7C B;  1FSH A;  3G3Z A;  1ZRE A;  5JI6 A;  3RYR A;  4LB6 B;  2Y0M A;  2O3F A;  5HDN A;  3DF8 A;  4ZYD A;  2OQG A;  2VT3 A;  3FHZ A;  4OIR F;  3U1D A;  3G73 A;  3MZH A;  5LGT A;  1FYL A;  1JE8 A;  1U78 A;  3FZV A;  3J81 Z;  4MQ9 F;  1XMA A;  2ZFW A;  1CGP A;  3KET A;  1FBQ A;  4G8X A;  4KDP A;  3FX3 A;  2FSW A;  4G7H F;  3KLO A;  1O3T A;  1TTY A;  1EV7 A;  1T6S A;  2NNY A;  4ETS A;  2UZK A;  1I5Z A;  2LF8 A;  2P4W A;  3CJN A;  4M74 A;  1ZLJ A;  3LWF A;  4CIC A;  3LAJ A;  2OZ6 A;  1ZYR F;  1XGM A;  4R1H A;  3HRS A;  4JK1 X;  3QRF F;  3F21 A;  1EH6 A;  1XGS A;  2IW5 A;  2PG4 A;  2MC3 A;  4N9H A;  2FBH A;  5F1R A;  1DDN A;  2XKO A;  1QO0 D;  4PGH A;  2P7V B;  4HX7 A;  1RI7 A;  1ZAR A;  1E2X A;  3F23 A;  4Q5S F;  4A0Z A;  2DQL A;  4P9F A;  2IA0 A;  3LA7 A;  1G3Y A;  3AAF A;  3LQR A;  3M7G A;  2G7U A;  2FEZ A;  4G6Q A;  3HIF A;  2P6S A;  1V3F A;  1BIB A;  1ZH5 A;  3GO5 A;  3ZMZ A;  1PP8 F;  1P4A A;  2WV0 A;  5ILS A;  3WTW C;  2KJC A;  3RJP A;  4I09 A;  5LBQ A;  3IWZ A;  2DO7 A;  2ZJ2 A;  3KLN A;  3WTY C;  2A5Y B;  3D5L A;  4U7D A;  1S3J A;  3WOD F;  1XMK A;  1O7L A;  4HF1 A;  3E6D A;  1R1V A;  1KYZ A;  4R8H A;  2HR3 A;  1BM9 A;  4P5O A;  1Z1D A;  2PEX A;  2HEO A;  4LJZ F;  1U8R A;  1FY7 A;  3IHU A;  1ZRD A;  2XV4 S;  2A3S A;  3I53 A;  2V1U A;  3PQJ A;  2PFB A;  4MNU A;  1XSV A;  5D6F A;  4A6E A;  4KIG A;  2DK8 A;  1OKR A;  2OAZ A;  4KIF A;  3VEP A;  3IKV A;  2CO5 A;  1USS A;  1J59 A;  2CYY A;  2M45 A;  2IPQ X;  1FBS A;  1J5Y A;  2QUF A;  4S05 A;  2L4M A;  3ECO A;  2GQQ A;  1G6N A;  1IF1 A;  3IKT A;  1TBX A;  5DEQ A;  3J80 Z;  1R58 A;  5IT9 Z;  4HZF A;  4LLG F;  4FX0 A;  2KIM A;  4MQV A;  1JHF A;  4L0Z B;  3KP3 A;  4UHT A;  2F5E A;  3F8M A;  2KRF A;  1BOA A;  4IJA A;  1L0O C;  1OYW A;  4RB1 A;  4OIQ F;  4KMU X;  1UHW A;  1MDM B;  1HSJ A;  1QZY A;  5CVJ A;  3I5U A;  4HDV A;  3QU6 A;  1B4A A;  3E5X A;  4M9S A;  3V7C A;  1BBY A;  5D5V B;  4FT8 A;  4OMY A;  3JAM K;  4KNY A;  2GA2 A;  2VC0 A;  2EV0 A;  2VON A;  4JQF A;  5AIP A;  5LHG A;  3MQ0 A;  1W4M A;  4E70 A;  1Y0U A;  3J81 K;  3IWF A;  2M5W A;  1TNS A;  2AXL A;  2K4J A;  4XLP F;  4YFX F;  2BYV E;  4EJV A;  4XRF A;  5CYV A;  1BI3 A;  1W7P B;  3I64 A;  4BH9 A;  4WWC A;  1G4D A;  2L01 A;  3BJ6 A;  3M8F A;  4KIC A;  2HKO A;  1KQ9 A;  3W6J B;  2VOP A;  4GXO A;  2Q0O A;  3OOP A;  1DPU A;  4I02 A;  3GZ6 A;  1LB2 A;  3WE2 A;  3GW2 A;  3C1D A;  2VE9 A;  2STT A;  4CZZ A;  2PJP A;  5HDK A;  1REP C;  3DPL C;  1XSD A;  3HTS B;  1Z6R A;  3GLX A;  1E17 A;  2VOD A;  3DKW A;  3MCZ A;  5D5W B;  1O3Q A;  3BWG A;  3ULQ B;  3QPH A;  3I71 A;  1RNL A;  3NRV A;  3MFK A;  3WTZ A;  2Q2E A;  3E97 A;  4HQM A;  2V1X A;  4MTD A;  1YO5 C;  2HDC A;  2W24 A;  5EEH A;  4L5J A;  3LST A;  2R3S A;  3VB2 A;  5HS7 A;  5FD5 A;  3ZN0 A;  2HOE A;  2F2E A;  1MDM A;  3I58 A;  4EV0 A;  1O57 A;  1FT9 A;  3L2C A;  3ZMU A;  4UVA A;  2HTS A;  3RYP A;  4IHS A;  4BAY A;  2XAQ A;  3RIR A;  3V4G A;  1U5T C;  1OPC A;  1K79 A;  4OU0 A;  4L9N A;  4HQE A;  1S8N A;  2VBY A;  2X4H A;  3BPX A;  3TKY A;  5H6R A;  1FSE A;  3ABT A;  1IXS B;  1W7P A;  2HFH A;  3H92 A;  5KVR A;  4KFC A;  1SFX A;  1FYM A;  3DXJ F;  2Z99 A;  1O3R A;  1XDU A;  1FP1 D;  2AS5 F;  4HV5 A;  1U2W A;  4RGR A;  3WTT C;  3I0T A;  5DDG A;  2RC4 A;  3R0J A;  4N0B A;  4O5V A;  5ED4 A;  4XLN F;  2LKP A;  2FOK A;  3O6B B;  1TQP A;  2RN7 A;  4BXU A;  3RDI A;  4EM0 B;  3R60 A;  2O61 A;  3QP6 A;  4L9J A;  1XB4 A;  1BI0 A;  5LEK A;  4GYG A;  1X3U A;  3DPT A;  3P9C A;  5IT9 K;  1SMT A;  1AOY A;  1IXC A;  5LRR A;  1T98 A;  1G3S A;  4HV6 A;  3KP6 A;  1FZP B;  4LLN A;  4UNO A;  2OD5 A;  2CSO A;  2MH9 A;  3FXU A;  3Q9V A;  1PP7 U;  3CUQ C;  3BPV A;  5FO5 A;  2FA5 A;  2KKO A;  5LLQ A;  3BY6 A;  4HW0 A;  3K2Z A;  4ZZD A;  4BNC A;  2HQR A;  3FMS A;  2JPC A;  2PN6 A;  2CWE A;  3CDH A;  3QP5 A;  4YFK F;  4RGX A;  2D2W A;  3RI4 A;  2UWM A;  3M9A A;  4CYD A;  2OQR A;  2XHK A;  4XBF A;  2D45 A;  4G9Y A;  2EFP A;  4EJW A;  1P2F A;  5FFZ A;  3LFK A;  2CG4 A;  4RB0 A;  2CQK A;  4Q4Z F;  1HW1 A;  2E7W A;  4EQQ A;  3FXQ A;  3WTX C;  3KEQ A;  1BI1 A;  2DK5 A;  4WCG A;  3K9T A;  1J0R A;  2EFO A;  3R61 A;  5LRS A;  1PUE E;  2IRF G;  4YII A;  2XAJ A;  1ZG5 A;  4ENN A;  2F5F A;  2HZT A;  3PQK A;  2H09 A;  2E7X A;  1R5G A;  1WRJ A;  4RS8 A;  5CVR A;  5IT3 A;  2L4A A;  1TQI A;  5JVT A;  1UST A;  5E1Z B;  3B02 A;  1ZAO A;  3WGG A;  4MTE A;  5D4S A;  2QYO A;  2HTJ A;  4RGS A;  2E1N A;  4UXN A;  5HOO A;  3F22 A;  2Q8K A;  1AWC A;  1IW7 F;  4LG0 B;  4KYW A;  4HX4 A;  2YU3 A;  2RQP A;  3HRT A;  1H0M A;  5E1X A;  1YFH A;  1TW2 A;  4Y13 A;  2VT2 A;  1WQ2 A;  1TW3 A;  1T2K A;  3PFI A;  3GWZ A;  2JPB A;  3F8B A;  4AIJ A;  4HA8 A;  4LD5 A;  2O6G E;  2COM A;  2FU4 A;  5LHI A;  3CTA A;  1UHM A;  2YSR A;  3E6B A;  1JGS A;  1IRF A;  4NHJ A;  2P5V A;  1QBJ A;  5K1Y A;  3IRQ A;  1Z9C A;  3F6V A;  4IRH A;  2K86 A;  2ADU A;  4HLX A;  4WK8 F;  2HKX A;  1I27 A;  2FNA A;  1U6G A;  1YW8 A;  3TO6 A;  3HHG A;  4YG2 F;  2CW0 F;  3I4P A;  2A68 F;  4KMF A;  3P7N A;  3LA2 A;  1J75 A;  2XKP A;  2ZME B;  5L3B A;  3QPT A;  3BJO A;  3CLO A;  1R23 A;  5HVQ C;  2DTR A;  5BQT A;  3HHH A;  2D1H A;  1ON2 A;  5TJJ A;  5ICC A;  2HS5 A;  4OIP F;  1GVJ A;  2IA1 A;  3OV8 A;  2FQ3 A;  4ENJ A;  1SAX A;  2EA4 A;  3WG9 A;  4WF2 A;  5HS9 A;  5D8K B;  4K2E A;  3I59 B;  3FWE A;  4HOB A;  2VC1 A;  3BOQ A;  3SHF A;  5FB2 A;  3JSP A;  2XGX A;  1Q1H A;  3Q5F A;  1TQM A;  3ZMV A;  1NHA A;  1T0F A;  4OIO F;  2J5O A;  2PBI A;  2ZNY A;  5DYM A;  2STW A;  4LG0 A;  2XAG A;  2O03 A;  4HBL A;  1FOK A;  5HLI A;  2A07 F;  1H9T A;  2K4B A;  3F6O A;  2MBF A;  5EEG A;  4S04 A;  3J7A O;  3HTU A;  3EYY A;  1BC7 C;  3T0Y A;  4EGZ A;  3M1E A;  4B09 A;  3BZ6 A;  3Q9S A;  1MGT A;  3V7S A;  2FBK A;  1SD4 A;  1B1B A;  4A6D A;  1FWZ A;  5DCM B;  4GO1 A;  4GYI A;  2VBZ A;  3SXY A;  4I2O A;  4BHB A;  2EWN A;  1LDK B;  2EV5 A;  2GXG A;  1KQ8 A;  3K1P A;  5DCF A;  4AVP A;  1MJB A;  1XD7 A;  2CGP A;  3TQN A;  1FNN A;  4O6J A;  1SD5 A;  1ZHF A;  2QVO A;  3JW4 A;  2JZY A;  5J8F A;  1Z05 A;  5A2Q Z;  5ILV A;  4I7H A;  2YR2 A;  2LSO A;  2DQR A;  2R7D A;  4CDG A;  1KU7 A;  3HSE A;  5ERI A;  2F5D A;  2QQA A;  1ZLK A;  1I1G A;  4Y17 A;  3EDP A;  4LB5 A;  2EFQ A;  2ZME A;  3F8N A;  1D5V A;  4IVN A;  3HOS A;  2DAO A;  4HYE A;  2ETH A;  5CJ9 A;  5JHU A;  5LHH A;  1MD0 A;  1KU2 A;  2H6B A;  4EMS A;  2FF4 A;  1WKM A;  3QAH A;  3D0S A;  2VE8 A;  2MD5 A;  4UUV A;  3SQN A;  3I59 A;  2IP2 A;  1K7A A;  3VFZ A;  4PZJ A;  1BC8 C;  1BI2 A;  2C6Y A;  4HF2 A;  2WTE A;  1J2X A;  2DLL A;  3GEZ A;  4IPA A;  2JTV A;  3DQV C;  3T8R A;  1YTY A;  4H0E A;  3EQL F;  1MZB A;  1S7A A;  3I54 A;  1HW5 A;  3F3X A;  2EFN A;  3U9G A;  1I1S A;  1LJ9 A;  4ESF A;  1QZZ A;  4FX4 A;  3GVA A;  2FE3 A;  2MLG A;  1U3E M;  2H6C A;  2EFW A;  5LGU A;  1SMY F;  5LGN A;  2DFI A;  4IF4 A;  1STZ A;  1R5H A;  1YS6 A;  4RB2 C;  3T1B A;  5BS6 A;  2CFX A;  5DCM A;  4G7O F;  5K5Q A;  4KA4 A;  4ENK A;  4ESJ A;  2JRT A;  5BPD A;  4RB3 C;  1ULY A;  3C18 A;  4LFU A;  4ENM A;  4MEX F;  1FX7 A;  2XAH A;  2NAZ A;  3TDU C;  3QOP A;  4ZYH A;  2O0Y A;  5F6F A;  4D0P A;  3GFI A;  1RIO H;  2UXN A;  1P6R A;  2ACJ A;  2HWV A;  2QM3 A;  4KN4 X;  4I01 A;  1FBU A;  1P4W A;  2OU2 A;  4WXD A;  2EV6 A;  1ZN2 A;  5L3F A;  5DV5 A;  2GAU A;  2XVC A;  3F72 A;  1UCR A;  2PQ8 A;  4G7Z F;  2V9V A;  4UVB A;  4G6D A;  5CVI A;  4LK0 F;  1VTN C;  4ZYE A;  3P9I A;  2QQB A;  1T38 A;  1FP2 A;  3GZ5 A;  4KT5 C;  3HUG A;  3KCC A;  1FLI A;  1SD7 A;  3E5U A;  2Z5U A;  5FGM A;  3HSR A;  2ZNZ A;  4Q47 A;  1QPM A;  5HS8 A;  1KA8 A;  5CVU A;  3ERE D;  4A2U A;  1YQA A;  1U5T A;  1I6X A;  1R1T A;  2JSC A;  3RKW A;  1ONV A;  1OR7 A;  3HYI A;  3ZP5 A;  5D8L B;  1KU9 A;  1J7K A;  2UXX A;  1A04 A;  1G3T A;  1J9I A;  4KUM A;  4NB5 A;  4RAY A;  5L3G A;  4R79 A;  2XRN A;  1LEA A;  1W7P D;  2QZ8 A;  4MEY F;  2NYX A;  1QNT A;  2H94 A;  2V79 A;  3KZZ A;  4LLL A;  2KIU A;  1F1Z A;  1TLH B;  3KFW X;  3EET A;  5DD8 A;  2GIV A;  2X0L A;  3N4M A;  4ASN A;  4ZYG A;  1IZ1 A;  1SD6 A;  3CUO A;  3KP7 A;  1YS7 A;  2HGC A;  2P6T A;  2W84 A;  2OZU A;  4GCV A;  1R1U A;  3J80 K;  2ELH A;  2QEN A;  3WE3 A;  5E8G A;  3E6M A;  3V8K A;  1F9N A;  3IC7 A;  4AIK A;  2RDP A;  4U7B A;  5D5U B;  3T8T A;  1ZRC A;  5E20 A;  3REO A;  3SZT A;  2M8E A;  3WTU C;  5A2Q K;  5E1W A;  3KEO A;  5L3C A;  2LF7 A;  4M73 A;  4P96 A;  4RGU A;  2HYG D;  3ECH A;  4AD9 A;  3KP5 A;  2IVM A;  1D3Y A;  3GX4 X;  1PDN C;  4EM1 A;  1TNT A;  3GF2 A;  3IRR A;  4P9U A;  3EUH A;  5H6Q A;  5ILU A;  5E8I A;  3GXO A;  1LQ1 A;  4UV9 A;  2PI0 A;  2QLZ A;  1IXR C;  4QWQ A;  2A6H F;  3WGH A;  1R7J A;  2BEO A;  4I0B A;  2FBI A;  1FYK A;  2M87 A;  1ZG1 A;  1LDD A;  3WU1 B;  3ML6 A;  2G9W A;  2O8X A;  3DFG A;  1S29 A;  1KU3 A;  2LNB A;  3LQQ A;  4Y15 A;  3KZY A;  1UB9 A;  2GWR A;  4L5I A;  4EVI A;  3F8F A;  1B6A A;  1QGP A;  3FF5 A;  1IN7 A;  2GA1 A;  5H20 A;  3TGN A;  3BDD A;  3E3V A;  4U0Y A;  3FM5 A;  1FPQ A;  5HLG A;  3NQO A;  3CO7 C;  2DI3 A;  2FRH A;  1SFU A;  2W25 A;  3JAM Z;  3FXR A;  3MZY A;  3N97 A;  1OMI A;  1HBX G;  1HKS A;  2HQN A;  5BOX A;  3K69 A;  4U0W A;  4EJO A;  1MJ9 A;  1XSX A;  1KGS A;  2VN2 A;  4PGG A;  1O7F A;  4FHT A;  4EJT A;  3S2W A;  2J5P A; 
#chains in the Genus database with same CATH topology
 4KIB A;  1R22 A;  5HNH A;  1XGN A;  1DGR M;  4V2F A;  1MMN A;  1E3O C;  5KK1 A;  4WXH A;  4IRG A;  4OMZ A;  2YX7 A;  4HEA 2;  4C2M J;  5J47 A;  3KPH A;  2NNN A;  4ZH4 F;  3OYG A;  4A0X A;  4LK1 F;  4KN7 X;  2VKD A;  2VXZ A;  2OA4 A;  2HPM A;  1W0T A;  4BE0 A;  2KJB A;  2XRO A;  1R00 A;  2A69 F;  4HF0 A;  4JX4 A;  4EJU A;  1HC8 A;  3OR1 C;  3HOT A;  1W5T A;  4FE7 A;  2ZB9 A;  4CZC A;  3ZMD A;  2K9M A;  2D1V A;  1G3W A;  3DBL B;  4CGZ A;  4ITV A;  3TOB A;  3NWS A;  1Y56 A;  4WXC A;  4MHG A;  1EJ9 A;  3BC8 A;  4A5N A;  1IN4 A;  1SAU A;  4L9V A;  5DD4 A;  4CO8 A;  4ON0 A;  3L7W A;  4M6V A;  3C7J A;  3K4L A;  2LP0 A;  4A12 A;  1PUF A;  5EYR A;  4XRS G;  1IAW A;  2L54 A;  3P9K A;  3FMR A;  3KP2 A;  2M1B A;  2M30 A;  3HBL A;  2VBW A;  1YW7 A;  3SZP A;  2ZCW A;  3FMQ A;  1H8A C;  5J40 A;  4A3J J;  3VSL A;  2ISY A;  3S1M J;  1IUF A;  2WAF A;  1SFE A;  3MEX A;  1NG6 A;  3H3Z A;  4MLO A;  4CH7 A;  3K1M A;  4DYQ A;  1LNW A;  4I0A A;  3LSG A;  1MKM A;  3ZPL A;  3BR3 A;  3CO6 C;  5IP9 J;  3L09 A;  4XID A;  1ETW A;  1JXS A;  4L18 B;  1K78 B;  2XAF A;  3HM5 A;  5KAF C;  3RTR A;  2HYF A;  2MLK A;  2XUB A;  1HST A;  1X1B A;  2LKS A;  2FMY A;  3BG5 A;  2Z2S B;  3K4N A;  3LSI A;  5D5X B;  4Y3O A;  3OYF A;  1R9T J;  1Z6T A;  1ZQ3 P;  4U88 A;  1UG2 A;  3GUD A;  1D1A A;  1K83 J;  4HPQ A;  3TO7 A;  1FC3 A;  1JTX A;  1DPR A;  5J4V A;  1R6R A;  4KIS A;  1V55 H;  4I6Z A;  2OUM A;  3GFJ A;  3SFZ A;  2COB A;  1RPW A;  3S8P A;  4F93 B;  3ZQ7 A;  3H3U A;  4J19 A;  2RAE A;  3TDZ C;  4F3Q A;  4BQA A;  4PUS A;  3HOW J;  3IAM 2;  3JRA A;  2Y30 A;  4BHC A;  2Y48 A;  3D5R C;  2CUE A;  4OOI A;  3RKX A;  1GXP A;  3ZQL A;  1RKT A;  5J6X A;  1XCB A;  2BY0 A;  1WWX A;  1WJ5 A;  1BW5 A;  4RAZ A;  5DTD A;  3E6C C;  5BPI A;  4YFN F;  4BL0 B;  2KT0 A;  5IYB J;  3FHN A;  2XAS A;  1P4X A;  2A6T A;  2R7V A;  2ESH A;  2RNG A;  1LVK A;  4ZDL A;  2I5U A;  2GOM A;  1JT6 A;  3FBN B;  2WC2 A;  3T5X A;  3AL0 B;  2DDB A;  3CCE I;  2QF7 A;  1VQ9 I;  4IHT A;  3B73 A;  3W2W A;  2LYC A;  2JQ7 A;  3DV8 A;  1RUN A;  2PLY A;  1R36 A;  2L02 A;  2XPW A;  4UUT A;  3GYH X;  3OSG A;  2VUM J;  3K2A A;  3FKI J;  4ANJ A;  2R7F A;  2K40 A;  5ICG A;  2GXB A;  4RA2 A;  4V2G A;  5EEA A;  2QBY B;  2RVC A;  4XR6 A;  3WU2 C;  4PFP A;  3RZD J;  3UR3 C;  3H9Q A;  2KPM A;  2DMP A;  4XLF A;  3CCM I;  3CC4 I;  1E0E A;  4B1R A;  3DEU A;  2G7H A;  3K1N A;  4L0Y B;  2NVX J;  2XB0 X;  2RV8 A;  1OYI A;  1ETY A;  4KT6 A;  3DEE A;  4IRI A;  3L00 A;  2X1C A;  3TW6 A;  1MBJ A;  1YIO A;  3K10 A;  2DU9 A;  4NUB A;  3ROU A;  4H4K C;  2K7L A;  5B66 C;  1IN5 A;  2Q1Z B;  3LFU A;  5AIQ A;  1DP7 P;  1JUP A;  2BOL A;  2P8T A;  2XSD C;  1HKT A;  3IAS 2;  1IRZ A;  4CHU A;  5FLX Z;  4BXX J;  2HQ5 A;  2W82 A;  1S72 I;  3V8J A;  2VJ4 A;  5H2F C;  3FXO A;  4AU7 A;  2Y0S A;  3VOD A;  2JUG A;  2YX4 A;  4F7Z A;  2E60 A;  3NAR A;  1T39 A;  4QPQ A;  4AIH A;  2DBB A;  1HDD C;  1K6O A;  4HST A;  4IHX A;  5JVG F;  4M3B A;  5IOY A;  3WU0 A;  1RZ4 A;  3WTV C;  4U0V A;  4G6T B;  5E79 C;  4YIF A;  3CD6 I;  2IXS A;  3LNQ A;  2ECB A;  1K78 A;  2GZW A;  2W85 A;  4GGG A;  2KZV A;  2JMW A;  3GFL A;  3ZN1 A;  1IRG A;  3UNG C;  1D5Y A;  2WB1 A;  4UV8 A;  3L2W A;  2ZME C;  3KEY A;  1QHH D;  3U2R A;  2OBP A;  1QPI A;  1ZRF A;  3IL2 A;  1P92 A;  2DOF A;  1BOB A;  1RKW A;  3JTG A;  2EQR A;  3TBI A;  3JSO A;  2BE5 F;  3S1R J;  5FRM A;  3BR0 A;  5EGO B;  3PL8 A;  2PMU A;  1A35 A;  2F5C A;  5DS9 A;  3O8H A;  2V1D A;  5DUI A;  4BY1 J;  1XDS A;  3LAP A;  1MH4 A;  4HDU A;  1WJF A;  2IJL A;  2LC2 A;  1H9G A;  3LMM A;  2L7Z A;  4WX9 A;  2ZXJ A;  2LY2 A;  3C2H A;  2VQC A;  2NVT J;  3KE2 A;  4E7I A;  4RDU A;  2CU7 A;  3OIQ A;  3C3W A;  1N25 A;  3WTS C;  2NRA C;  5HLH A;  1QHG A;  3KP4 A;  1W1W E;  1X2N A;  3E7L A;  1X4O A;  4A5M A;  2B0L A;  5D6E A;  2XPU A;  4M71 A;  2R7T A;  4NQW B;  5DUK A;  2IA2 A;  3CCJ I;  4FCY A;  5L3D A;  4UVC A;  3E5Q A;  3RKY A;  1WI9 A;  2FNP A;  2MA3 A;  1W5S A;  3OYB A;  2IT0 A;  1U5T B;  1MMD A;  2MG4 A;  5ICE A;  3ZMT A;  3CF5 F;  3LA3 A;  4PJL A;  1OQY A;  2M2E A;  2DA4 A;  2MH2 A;  1BR1 A;  2K9N A;  2JJ7 A;  1GXQ A;  2K9S A;  2FML A;  1B9N A;  5E18 F;  3QOE A;  1N77 A;  5L3E A;  2QSG X;  4DQ2 A;  3A4C A;  4BHP A;  1R4M B;  1GUU A;  3KZI C;  3V7R A;  1HQC A;  4QLC U;  1ZGA A;  4D7N A;  3HRM A;  4Y33 A;  4E7Z A;  1Z91 A;  1Z7U A;  2KIF A;  3HC7 A;  3TP0 A;  2QBY A;  4OIN F;  1EH8 A;  1YYV A;  2H27 A;  3BG3 A;  3BLY A;  4XLH A;  3GTP J;  3RPQ A;  5FD6 A;  4M6X A;  5C3E J;  1Q1V A;  5F0H A;  1HW2 A;  3GTM J;  3O2P E;  2KZG A;  1LFB A;  5DM6 F;  2VQG A;  2TRT A;  4MGR A;  1X3W B;  2NVQ J;  2QQ9 A;  1BIA A;  2ESN A;  3TO9 A;  4C2U A;  1YLF A;  1D1C A;  4Q48 A;  5KAI C;  3HOU J;  1CF7 B;  5EG0 B;  1W36 C;  2P5K A;  3JTH A;  4CXF A;  4M6Y A;  2RKH A;  2L3D A;  2Y75 A;  4PCQ A;  2QWW A;  3QYF A;  2YPR A;  2DMN A;  5J1R A;  2JRM A;  3HEF A;  1W36 D;  5D4R A;  3GTG J;  3J7Z I;  4ESB A;  4XSZ F;  4IL6 C;  1SVO A;  3BTL A;  1YJW I;  4M3D A;  1VQN I;  3LSH A;  5F64 A;  1ZGJ A;  1GLN A;  3BG9 A;  1NTC A;  2WAQ A;  2QQ8 A;  3ABU A;  3EYI A;  5J8C A;  4O3M A;  1K4T A;  1D1B A;  4Z6Y A;  1GVD A;  4ZTF A;  4XSX F;  2LKX A;  5EDN A;  3OYL A;  2M0C A;  4DW6 A;  3OS1 A;  2JA5 J;  1JI8 A;  3DP7 A;  1LEB A;  3HSF A;  4Y7N J;  2HVR A;  1H88 C;  1S6L A;  1UG0 A;  4ZZL A;  1MJA A;  1IN6 A;  3ISP A;  3C2G A;  1V5G A;  2BGC A;  2DPU A;  3CCS I;  4BYY A;  2CQ7 A;  2VBX A;  3U21 A;  1GT0 C;  3R4K A;  1HA8 A;  3S2D J;  1A6Q A;  3LSJ A;  1JHH A;  1YW9 A;  5EGO A;  2VPR A;  4AWX B;  4IHY A;  1E3H A;  4IXA A;  1XCV A;  1WPK A;  3J7Y J;  1V54 H;  4A0Y A;  4DNC A;  3VSK A;  1DU0 A;  1GHC A;  3CUQ B;  4XKV A;  3MAJ A;  1MMG A;  3MWM A;  3A02 A;  3DCF A;  3FM3 A;  4B8X A;  5JHF A;  2LR8 A;  1VQO I;  5TRD A;  3BRO A;  1D8J A;  1A31 A;  1Y8R B;  1SFO J;  6PAX A;  4NQW A;  2Z3Y A;  1X1D A;  2DPD A;  3L9F A;  1HXD A;  1TP4 A;  1Z77 A;  4XIC A;  5JFR A;  5E3O A;  2K27 A;  1MW7 A;  4F92 B;  3RPU A;  1DUX C;  1OR7 C;  3DLA A;  2MC4 A;  2XIG A;  4D5C A;  4IOA F;  3DU5 A;  1R71 A;  1UEL B;  3O3K A;  1TWA J;  4M9X A;  2W57 A;  4N9I A;  2FXA A;  5BNG A;  4CCL A;  2TDX A;  3TOA A;  1O3S A;  3JRE A;  2GM4 A;  4HX8 A;  3VOE A;  2WB1 N;  3PIO F;  3HGY A;  2O8K A;  3AG2 H;  3OIO A;  3G6E I;  1BN5 A;  2EIN H;  4JBA A;  2Z33 A;  2PMH A;  2W7N A;  1K61 A;  1R49 A;  2L9V A;  1B9M A;  4B47 A;  1XN7 A;  4PFO A;  2EA2 A;  3ELK A;  2BV6 A;  2E35 A;  2CV0 A;  3HRU A;  1KYW A;  5HDG A;  2ISZ A;  1LDJ A;  3SFI A;  2WWY A;  5F0C A;  4PDK A;  3Q0W A;  1MBF A;  2VOO A;  2RGV A;  1TWC J;  5E17 F;  5BMZ A;  5LEJ A;  5K5R A;  2R7S A;  2LRE A;  1CF7 A;  4CSW A;  5EG0 A;  3GBG A;  2CW7 A;  2B63 J;  1IGN A;  1ERD A;  1JTY A;  4EGY A;  3W6K B;  3M4O J;  1IUY A;  3ZQC A;  4I99 C;  4GDF A;  1VQ5 I;  1V4R A;  4P55 A;  4JP0 A;  3S15 J;  1GV5 A;  4V19 K;  1KQ0 A;  4M3G A;  2H1K A;  1EH7 A;  5FLX K;  1LVA A;  5IP6 A;  3DKX A;  1HOM A;  1KZH A;  2X6O A;  3PNT A;  4BDY A;  2NOG A;  3MN2 A;  1TT0 A;  3I4N J;  2CFO A;  1ETQ A;  3FXK A;  2E1C A;  4IEJ A;  1Y39 A;  4L9T A;  4LGW A;  4C3H J;  2DT5 A;  2EJR A;  4I98 B;  3BJA A;  4J00 A;  5FFX A;  1JKP C;  3M8E A;  4M72 A;  1IN8 A;  3NEU A;  3TMO A;  4RLQ A;  2K02 A;  2NS0 A;  1SEU A;  2K5C A;  2FD5 A;  4QTR A;  2ZKZ A;  1XG1 A;  1F4K A;  3R0A A;  4E7J A;  1Y1V J;  1WH7 A;  3OWT A;  1ODD A;  1RUO A;  3BP8 A;  3V8L A;  1G59 A;  1C0W A;  5M3F J;  3F8C A;  1HKQ A;  2ZXH A;  4EM2 A;  4A3M J;  4Z2Y A;  3PSF A;  4D9J A;  3COA C;  1F5T A;  3DTI A;  5GTI C;  2ZBK A;  1OCR H;  5CVV A;  1WSU A;  2Z9O A;  2P5L C;  3ZQF A;  3G1L A;  3K0L A;  1Z7L A;  4M9Z A;  2X1E A;  3CUQ A;  2ZO4 A;  5E3N A;  1YJ9 I;  3VYR B;  1L3L A;  2DDA A;  5LD2 C;  3B6A A;  3WGI A;  2E1M C;  4HAM A;  2VB6 A;  1VFC A;  5FKO A;  3QU3 A;  1BJA A;  5K5O A;  1I3A A;  2R7W A;  5CLS A;  2JA6 J;  2E1O A;  3G2B A;  2NS8 A;  2RNJ A;  1B59 A;  5FJ8 J;  4TV7 A;  1V5E A;  2NS7 A;  2DOA A;  2L5Q A;  3CP8 A;  3R6S A;  1OCP A;  3ZXS A;  1MSF C;  2A6E F;  5JR3 A;  5JLW A;  1WJE A;  2PX9 A;  2CQN A;  2WAQ N;  3MKZ A;  5CQG A;  4BAC A;  1ZG3 A;  1VF9 A;  1XGO A;  4PSX A;  3ZMS A;  2BW3 B;  1VQ7 I;  1D8K A;  1YG2 A;  2EH3 A;  1ON1 A;  1MMS A;  2EK5 A;  2DW4 A;  1UAA A;  2BBY A;  2HDW A;  4HNU A;  3GFM A;  3Q3S A;  4G94 A;  2QA4 I;  2EB7 A;  1OYY A;  5AON A;  2JT1 A;  2LDU A;  2A61 A;  2DFE A;  5FKN A;  2HQA A;  3S16 J;  3HOY J;  2EZI A;  4LMY A;  1S7O A;  2XF5 A;  2V6C A;  1WZ2 A;  1UFM A;  4XLE A;  4E4H A;  2M34 A;  1QQI A;  4E7L A;  2HPI A;  4DIQ A;  5ICF A;  2P7C B;  1FSH A;  3G3Z A;  1ZRE A;  4ZDP A;  3I4M J;  3OS2 A;  5JI6 A;  3RYR A;  1FMW A;  3FDY A;  2EPF A;  4LB6 B;  4MIM A;  2Y0M A;  2BXY A;  2O3F A;  3BT9 A;  1FOY A;  4XKC A;  2L9R A;  3OMY A;  5HDN A;  3DF8 A;  1YE9 A;  3QYB A;  4ZYD A;  2LOO A;  2OQG A;  4ZJZ A;  2VT3 A;  2Y2Z A;  3FHZ A;  3TP3 A;  1U9O A;  4OIR F;  4M3E A;  3U1D A;  3G73 A;  1Y1W J;  5GAG J;  2JN6 A;  3MZH A;  5LGT A;  1FYL A;  1JE8 A;  1U78 A;  2X48 A;  4AUX A;  4BY7 J;  4BGD A;  1G2H A;  2VPL A;  3FZV A;  4XQF A;  5K7F A;  3CJR B;  4F52 A;  3J81 Z;  2LFB A;  2K9Q A;  4MQ9 F;  4EAT A;  1XMA A;  4AID A;  2ZFW A;  1CGP A;  2VXD A;  3KET A;  1VQ8 I;  3FXM A;  1FBQ A;  4G8X A;  4KDP A;  3SDG A;  1T95 A;  3FX3 A;  2FSW A;  4G7H F;  2FX0 A;  3MKW B;  3KLO A;  3WG7 H;  1O3T A;  1TTY A;  3HOV J;  3PNV A;  1EV7 A;  1T6S A;  3GTO J;  1FJL A;  4FE4 A;  2NNY A;  1YI2 I;  4ETS A;  2UZK A;  1AKH B;  1I5Z A;  2LF8 A;  2P4W A;  2XPV A;  4PJM A;  3CJN A;  4M74 A;  3DBR B;  1ZLJ A;  3LWF A;  4CIC A;  5FRO A;  3LAJ A;  1YIT I;  2OZ6 A;  1ZYR F;  1XGM A;  3BCB A;  3OYD A;  4R1H A;  3HRS A;  4JK1 X;  2ZXI A;  2XGE A;  3H35 A;  3QRF F;  3F21 A;  1EH6 A;  4UB6 C;  1LFU P;  3OIP A;  1XGS A;  1BA5 A;  2IW5 A;  2PG4 A;  1JKQ C;  2MC3 A;  2WBM A;  4N9H A;  2FBH A;  1ZEL A;  5F1R A;  5B1A H;  3CJQ B;  1WH5 A;  3HG9 A;  1DDN A;  1ITY A;  3FXJ A;  3S17 J;  2XKO A;  1QO0 D;  4JX5 A;  2ZSI B;  4PGH A;  2P7V B;  4HX7 A;  1RI7 A;  1ZAR A;  2BW3 A;  3SZG A;  3BR2 A;  3VDX A;  3DKY A;  1E2X A;  3F23 A;  4Q5S F;  1BW6 A;  3S93 A;  2DQL A;  5EZG A;  4A0Z A;  4B3A A;  5FKK A;  3H5N A;  4XK4 A;  4E6K G;  2IGK A;  5C44 J;  4B44 A;  2IS2 A;  1JGG A;  4BE1 A;  4P9F A;  2IA0 A;  3LA7 A;  2JUC A;  1G3Y A;  3VYS B;  4BUP A;  3AAF A;  2FQ4 A;  3LQR A;  1RES A;  3M7G A;  1X1C A;  2G7U A;  4IQJ A;  2FEZ A;  4G6Q A;  2JSP A;  1XTA A;  3HIF A;  4CUG A;  2P6S A;  3H9J A;  2ZJP F;  1OLT A;  4X1E A;  4BE2 A;  2L0K A;  4RMN A;  1V3F A;  4PSW A;  1T8I A;  1BIB A;  3HB9 A;  2M8G X;  1ZH5 A;  3GO5 A;  3ZMZ A;  2D5V A;  1PP8 F;  1P4A A;  2WV0 A;  3OYJ A;  3BZK A;  5ILS A;  3WTW C;  2KJC A;  2CH0 A;  3DBH B;  4OWR B;  4I09 A;  4XN0 A;  3RJP A;  1RET A;  4BJT A;  3IWZ A;  2DO7 A;  5LBQ A;  1SFK A;  2ZJ2 A;  3WHC A;  1QVU A;  2W48 A;  3KLN A;  3WTY C;  2A5Y B;  2VQL A;  3BTJ A;  2E5N A;  1NK3 P;  3D5L A;  1LKX A;  4U7D A;  5J4Y A;  1S3J A;  2K3F A;  2WV1 A;  3WOD F;  1XMK A;  5C4J J;  1X1P A;  1O7L A;  2HXO A;  2DMT A;  3VPR A;  4HF1 A;  1T0F C;  1R1V A;  3E6D A;  3VYT B;  3VWB A;  3PIP F;  1WCM J;  1KYZ A;  2UV1 A;  2E2H J;  4R8H A;  2HR3 A;  3QQA A;  1BM9 A;  4P5O A;  1MBK A;  3M8J A;  1Z1D A;  5F27 A;  2PEX A;  2NOJ B;  2HEO A;  1XPX A;  2NXN B;  5B5E C;  3HOZ J;  4LJZ F;  1U8R A;  3U1K A;  1LPQ A;  2GOX B;  1FY7 A;  1TWG J;  3IHU A;  1ZRD A;  2XV4 S;  2A3S A;  3I53 A;  2V1U A;  4IHW A;  1AKH A;  3PQJ A;  2PFB A;  1YX3 A;  4MNU A;  1XSV A;  2JVG A;  5D6F A;  4A6E A;  3FIS A;  4KIG A;  2HNH A;  1MMA A;  4MFD A;  1OCZ H;  2DK8 A;  1RR8 C;  1OKR A;  2OAZ A;  4KIF A;  3VEP A;  3IKV A;  2CO5 A;  1USS A;  1J59 A;  2CYY A;  2M45 A;  2IPQ X;  1FBS A;  1J5Y A;  4ZC3 A;  2QUF A;  2KFD A;  3M3Y J;  4PK4 A;  1POG A;  4S05 A;  2L4M A;  3ECO A;  1RRJ A;  3ZCO A;  2GQQ A;  1G6N A;  1IF1 A;  3BCA A;  3LSP A;  3IKT A;  1PYV A;  1TBX A;  5DEQ A;  4E7S A;  3J80 Z;  3LSK A;  1R58 A;  3CME I;  2QCO A;  5IT9 Z;  4HZF A;  2XSJ C;  1RC9 A;  4LLG F;  3HOX J;  4FX0 A;  5B3S H;  2KIM A;  2DJN A;  3ESW B;  4MQV A;  4IX7 A;  1FTT A;  1JHF A;  2Q2E B;  3LSM A;  3KP3 A;  4UHT A;  1JJ6 C;  4L0Z B;  2F5E A;  3F8M A;  5IYC J;  2KRF A;  1BOA A;  4B3X A;  2UUZ A;  4IJA A;  1L0O C;  1OYW A;  3H5R A;  4RB1 A;  3W2A A;  2F4M B;  1O4X A;  4OIQ F;  3A0B C;  4KMU X;  5IOZ A;  2IS4 A;  4GRI A;  1P7I A;  3BZC A;  1UHW A;  3JRH A;  1MDM B;  1X19 A;  5GAE J;  1HSJ A;  1QZY A;  2F4I A;  5CVJ A;  3I5U A;  1HDP A;  4HDV A;  2DA3 A;  3QU6 A;  1VQK I;  3S14 J;  1B4A A;  3E5X A;  3IH3 A;  4M9S A;  2OJE D;  3V7C A;  4XOT A;  1Z3Y A;  1BBY A;  4PJN A;  5D5V B;  3LSR A;  3GCM A;  4FT8 A;  4OMY A;  3ZQI A;  3JAM K;  4XLC A;  1A6I A;  4KNY A;  2MYS A;  5HNF A;  2DA6 A;  2F6C A;  2HU9 A;  2CV1 A;  2GA2 A;  2M7A A;  4L5E A;  2VC0 A;  4OAZ A;  3ZQQ A;  3SJM A;  2EV0 A;  3HL2 A;  2VON A;  3AL0 C;  2M7B A;  4C3I J;  3K4C A;  3L2R A;  4JQF A;  2K9L A;  5K7Z A;  5AIP A;  5LHG A;  3MQ0 A;  1W4M A;  4E70 A;  1Y0U A;  2CMP A;  3J81 K;  3IWF A;  2M5W A;  2FUG 2;  4RLF A;  2ELK A;  2DMU A;  1TNS A;  2AXL A;  2K4J A;  4XLP F;  1TZL A;  2M9H A;  4DOZ A;  5M5X J;  3L2U A;  5LFA A;  4YFX F;  2BYV E;  4EJV A;  4XRF A;  5CYV A;  1BI3 A;  1W7P B;  3I64 A;  3RCO A;  1EA3 A;  2VKE A;  1MNM C;  4LIT A;  4BH9 A;  4WWC A;  1G4D A;  2IS1 A;  2L01 A;  2HOS A;  3BJ6 A;  1VI0 A;  1YX5 A;  3FK6 A;  3M8F A;  2HKO A;  4KIC A;  5FKM A;  2ZFU A;  1KQ9 A;  3W6J B;  3JRF A;  2VOP A;  3G4S I;  3ABM H;  4GXO A;  2E5Z A;  2L7M P;  1P9Q C;  3IUO A;  2Q0O A;  3OOP A;  2NVY J;  3A01 B;  1DPU A;  4I02 A;  5EJC A;  3GZ6 A;  1OFC X;  2EZH A;  3BG7 A;  1LB2 A;  3WE2 A;  2KMU A;  4NC7 A;  1D0Y A;  3GW2 A;  3C1D A;  3VYU B;  2Z16 A;  2VE9 A;  2STT A;  4CZZ A;  2PJP A;  1YIJ I;  1XC5 A;  5HDK A;  3FIW A;  3MZ8 A;  3DPL C;  1REP C;  2LK2 A;  3CMA I;  1XSD A;  3HTS B;  1Z6R A;  3GLX A;  1E17 A;  4CCK A;  2VOD A;  3DKW A;  1CQT A;  2X51 A;  3I55 I;  1U9N A;  3MCZ A;  5D5W B;  1O3Q A;  3GLL A;  1Z21 A;  1QZE A;  3BWG A;  3ULQ B;  3QPH A;  2OCE A;  3I71 A;  2VJI A;  1RNL A;  5GAD J;  3NRV A;  2HZD A;  3BQY A;  1X4P A;  1BJZ A;  3MFK A;  3WTZ A;  2E34 A;  2Q2E A;  3E97 A;  4DYR A;  3W6V A;  4HQM A;  2V1X A;  1EF4 A;  3H0G J;  2M4K A;  4MTD A;  2DJI A;  2TCT A;  5J1U A;  1YO5 C;  2HDC A;  2W24 A;  5EEH A;  3OYA A;  3FBI B;  1S9H A;  3LST A;  2R3S A;  4L5J A;  4XKW A;  3VB2 A;  5HS7 A;  1PJR A;  2CUF A;  5FD5 A;  3ZN0 A;  2HOE A;  4IO9 F;  2F2E A;  1MDM A;  3I58 A;  3Q0U A;  1O57 A;  2LVS A;  4EV0 A;  4RAG A;  5DM7 F;  1FT9 A;  3CMY A;  3OYM A;  3L2C A;  3ZMU A;  4UVA A;  2HOA A;  2PMZ A;  2DA2 A;  3ONQ A;  2HTS A;  5CKT A;  3PJR A;  1HCR A;  2IAI A;  2CUJ A;  2Y0S N;  1VQM I;  2MGQ A;  1JKO C;  2R5Z B;  3RYP A;  2E2J J;  1SVL A;  4IHS A;  4BAY A;  2CQX A;  4UY8 I;  2XAQ A;  3ZQH A;  1S5L C;  3CCR I;  3RIR A;  3NAU A;  3V4G A;  4RM2 A;  4W1U A;  1V5F A;  2EIK H;  2R4G A;  4XOP A;  1U5T C;  5JLX A;  1A36 A;  1OPC A;  4Y52 J;  2EZL A;  3K4J A;  4E7H A;  1MBE A;  2E36 A;  1K79 A;  4OU0 A;  3OYN A;  4L9N A;  3N05 A;  3KYC B;  3MMY B;  4HQE A;  1S8N A;  1SAN A;  1UHS A;  2VBY A;  2X4H A;  2KRH A;  3BPX A;  3TKY A;  5H6R A;  1FSE A;  3RPU D;  3ABT A;  2ZJQ F;  1IXS B;  2G0E A;  3PSI A;  2YUS A;  3H36 A;  2KDO A;  2Z1D A;  1W7P A;  2HFH A;  2ID6 A;  2OF7 A;  3DU6 A;  3H92 A;  5KVR A;  4KFC A;  1SFX A;  5EF6 A;  2KLO A;  3H0D A;  1DP3 A;  1FYM A;  3DXJ F;  2VKV A;  2HVQ A;  1WGX A;  2Z99 A;  1XDU A;  4UB8 C;  1FP1 D;  1XX5 A;  2ZJR F;  1O3R A;  3EUA A;  2E2I J;  2AS5 F;  4HV5 A;  4U87 A;  3BTI A;  5GP9 A;  3Q0V A;  3CF2 A;  2R7Q A;  1LFP A;  3TW7 A;  1U2W A;  3AG3 H;  4RGR A;  2QSF X;  3BTC A;  2LG4 A;  3WTT C;  2MSY A;  2M0M A;  3I0T A;  3A01 A;  3IH4 A;  5DDG A;  2RC4 A;  3R0J A;  4N0B A;  2R7Z J;  4O5V A;  5ED4 A;  4XLN F;  3L1P A;  2LKP A;  2FOK A;  4DYC A;  4FIS A;  3O6B B;  1TQP A;  2WAD A;  2PJR B;  2RN7 A;  4BXU A;  5J1Y A;  3RDI A;  4EM0 B;  3EPZ A;  2ELJ A;  3R60 A;  2LBF B;  2O61 A;  1T56 A;  3QP6 A;  4L9J A;  1XB4 A;  4QIW N;  1X1A A;  1BI0 A;  3OS0 A;  3JRB A;  5LEK A;  5FKL A;  4GYG A;  1X3U A;  3DPT A;  4D5F A;  4C2T A;  2CUZ A;  3P9C A;  4J01 A;  1BR2 A;  2ME6 A;  3PM1 A;  2BVL A;  5IT9 K;  1A5J A;  3IH2 A;  1SMT A;  4IKF A;  9ANT A;  1AOY A;  2XAU A;  1IXC A;  2HI3 A;  1EKE A;  2V26 A;  3LL7 A;  5LRR A;  1T98 A;  3QPL A;  1G3S A;  2V6E A;  1VQL I;  1RR7 A;  4HV6 A;  1BL0 A;  3KP6 A;  4IZZ A;  1FZP B;  4BJ6 C;  3HDD A;  4LLN A;  4UNO A;  2OD5 A;  2CSO A;  2MH9 A;  4XON A;  3X2Q H;  3JRI A;  5F04 A;  2BVM A;  3EUH C;  2EIL H;  3FXU A;  4LOC A;  2ICW G;  2JWT A;  3Q9V A;  2DTZ A;  2ID3 A;  3CUQ C;  4II3 A;  2VLA A;  3BPV A;  3S3M A;  2YS9 A;  1PP7 U;  3JRG A;  5FO5 A;  1DQU A;  2FA5 A;  2KKO A;  1YJN I;  5LLQ A;  1B8I B;  3BY6 A;  1F36 A;  2V9P A;  4HW0 A;  3K2Z A;  2EBI A;  2LD5 A;  1VND A;  2XB5 A;  4Y4R A;  4ZZD A;  2F5V A;  2R5Z A;  2X9D A;  2ZSH B;  3P5J A;  4BNC A;  2HQR A;  3FMS A;  5IYD J;  2JPC A;  2PN6 A;  2CWE A;  3CDH A;  2DA7 A;  3QP5 A;  4YFK F;  3OL3 A;  2D2W A;  4RGX A;  1I50 J;  5IP7 J;  4A3K J;  4AYB A;  3QPS A;  3RI4 A;  4IOC F;  2UWM A;  3M9A A;  2K3P A;  2N8G A;  4CYD A;  1FOW A;  2OQR A;  1PVE A;  4D1Q A;  2VKH A;  2XHK A;  4CCN A;  4XBF A;  2D45 A;  5F1J A;  4G9Y A;  4LG3 A;  1QU3 A;  2EFP A;  5GAH J;  4EJW A;  1N75 A;  1LE8 B;  1P2F A;  4HG2 A;  2H1L A;  4RM3 A;  5FFZ A;  4NC6 A;  2BY2 A;  3ABK H;  3LFK A;  2CG4 A;  3OYK A;  1W5C C;  2CQK A;  4RB0 A;  4DBQ A;  3BR6 A;  1WJC A;  4Q4Z F;  1HW1 A;  2DT6 A;  5HOD A;  1Z3X A;  2E7W A;  3CCQ I;  2PMZ N;  3A1Y A;  4EQQ A;  3FXQ A;  3WTX C;  3CLQ A;  1TWF J;  3KEQ A;  1BI1 A;  2DK5 A;  5J3L A;  4WCG A;  3K9T A;  3OSF A;  1J0R A;  1U0J A;  2EFO A;  2V4J C;  3HJE A;  3R61 A;  1MIJ A;  1IC8 A;  1I6H J;  5LRS A;  1UJ8 A;  1PUE E;  4B43 A;  3CDL A;  4ZYA A;  2IRF G;  4YII A;  2PJR A;  4N4N B;  1ZKG A;  3FXL A;  3G1O A;  2XGD A;  1WI3 A;  2XAJ A;  1ZG5 A;  4ENN A;  1Z0X A;  2F5F A;  2HZT A;  3CCY A;  3PQK A;  2HOT A;  2LBF A;  3UKG A;  2H09 A;  2E7X A;  1G8X A;  2EZK A;  5GPC A;  4DZP A;  2E71 A;  2FOW A;  3FK7 A;  1R5G A;  1WRJ A;  4RS8 A;  5CVR A;  2O7O A;  5IT3 A;  2L4A A;  1TQI A;  2RRE A;  5JVT A;  1WJB A;  1UST A;  5CQE A;  3ASO H;  3SYT A;  1ORK A;  5E1Z B;  3PFY A;  3B02 A;  1ZAO A;  4LIU A;  3WGG A;  4MTE A;  5D4S A;  2QYO A;  2HTJ A;  4A3E J;  3CMM A;  1MH3 A;  2L9N A;  1BR4 A;  2E1N A;  2VQH A;  4RGS A;  4UXN A;  2NVU B;  2R7X A;  1S7E A;  4UUS B;  5HOO A;  3F22 A;  1JUS A;  4KIT B;  2V7F A;  2Q8K A;  1IW7 F;  3BG6 A;  1AWC A;  4LG0 B;  3DLL F;  3KX2 A;  2KHM A;  1IRX A;  2R7U A;  3H1C A;  4KYW A;  4HX4 A;  2YU3 A;  2RQP A;  3HRT A;  1H0M A;  5E1X A;  2XRL A;  4C3J J;  1YFH A;  1TW2 A;  2VT2 A;  4Y13 A;  1WQ2 A;  2E19 A;  1TW3 A;  1B8I A;  3OR2 C;  1T2K A;  3PFI A;  3GWZ A;  2JPB A;  3F8B A;  4AIJ A;  1IV6 A;  4HA8 A;  3W2V A;  4LD5 A;  2P0W A;  2O6G E;  4IHV A;  2COM A;  2BHZ A;  4ZDO A;  2XDV A;  2FU4 A;  5LHI A;  1D0Z A;  3BQZ A;  2R92 J;  3CTA A;  3V42 A;  1UHM A;  1WHU A;  4AC0 A;  2WY7 Q;  3A0H C;  2YSR A;  4XL9 A;  2GBY A;  2AO9 A;  3E6B A;  3RSN A;  1JGS A;  4BBR J;  1IRF A;  1MNE A;  3JRC A;  4NHJ A;  2GIZ A;  2P5V A;  5KCM A;  3DWL E;  3GTL J;  1QBJ A;  5K1Y A;  2DOD A;  1ENH A;  3IRQ A;  3CQZ J;  1Z9C A;  3F6V A;  4IRH A;  3FKJ A;  2K86 A;  1LE8 A;  2ADU A;  1NH3 A;  4CCJ A;  1ETK A;  2P81 A;  4HLX A;  2K85 A;  4WK8 F;  2HKX A;  1N78 A;  1I27 A;  2FNA A;  2R0Q C;  1U6G A;  4CCO A;  1WFX A;  3S3N A;  1YW8 A;  3TO6 A;  1FEX A;  3HHG A;  3HKZ A;  3L2V A;  2KRC A;  1X2M A;  3B6C A;  4JX6 A;  4YG2 F;  2CW0 F;  3I4P A;  2A68 F;  2BHY A;  4DBR A;  1LUJ B;  1Y0N A;  2GLO A;  4KMF A;  2KIQ A;  3P7N A;  3LA2 A;  2VIX A;  3QYE A;  4EEF G;  1GDT A;  2VI6 A;  1J75 A;  2XKP A;  2ZME B;  1B72 B;  2DMQ A;  5L3B A;  3QPT A;  2QKM B;  2IBD A;  2V1N A;  1ETX A;  3BJO A;  3CLO A;  1R23 A;  3O8G A;  4AYB N;  2DTR A;  5HVQ C;  4XRS A;  5BQT A;  5FRN A;  3HHH A;  2D1H A;  2DXI A;  1ON2 A;  5TJJ A;  1OJL A;  4BQQ A;  5ICC A;  2HS5 A;  3HGG A;  4OIP F;  1GVJ A;  2IA1 A;  3OV8 A;  2FQ3 A;  4ENJ A;  1SAX A;  2EA4 A;  3WG9 A;  4WF2 A;  3GME A;  3GZN B;  5F0F A;  2A5W A;  3C2B A;  1AHD P;  2MW8 A;  1R4N B;  5FLM J;  1TT5 B;  5HS9 A;  4K2E A;  5D8K B;  3DEW A;  3I59 B;  3FWE A;  4HOB A;  2VC1 A;  3BOQ A;  3SHF A;  5FB2 A;  3JSP A;  2XGX A;  1Q1H A;  3I9V 2;  2ECC A;  2KL4 A;  1ZTR A;  3Q5F A;  3H5A A;  1FOX A;  1NG7 A;  2X1D A;  1TQM A;  1MSE C;  2CW8 A;  3ZMV A;  1NHA A;  1T0F A;  2MD0 A;  4OIO F;  4BEH A;  2J5O A;  4BJ5 C;  2PBI A;  2ZNY A;  2GXA A;  4UUS A;  1Y8Q B;  5DYM A;  1D0X A;  2STW A;  4LG0 A;  4CCM A;  1M1E B;  2XAG A;  2O03 A;  5HLT A;  2DYS H;  4HBL A;  2W1O A;  1FOK A;  3JCU C;  2AHQ A;  4NBQ A;  3AFH A;  3IP4 B;  4HRI A;  5KHD A;  5HLI A;  2WY8 Q;  5K7H A;  2XC7 A;  2A07 F;  1H9T A;  2R5Y B;  2K4B A;  3F6O A;  3K4K A;  2CQQ A;  2MBF A;  2QSH X;  2Y9Z A;  2H8R A;  5EEG A;  4S04 A;  3J7A O;  3HTU A;  3EYY A;  1BC7 C;  4A3G J;  4A3C J;  3WHB A;  4HNT A;  4G12 A;  3T0Y A;  2JK3 A;  4EGZ A;  1ZGW A;  3ZRG A;  3M1E A;  4B09 A;  3BZ6 A;  3CC2 I;  4XMY A;  3Q9S A;  1MGT A;  3V7S A;  2FBK A;  1SD4 A;  1B1B A;  3KIO A;  4A6D A;  1FWZ A;  1HLV A;  4BXF A;  5DCM B;  4CYC B;  2L2O A;  3CES A;  4GO1 A;  4GYI A;  4FAS D;  5F08 A;  2F48 A;  3QOD A;  2VBZ A;  3SXY A;  4I2O A;  4BHB A;  2EWN A;  1LDK B;  2EV5 A;  1JJ8 C;  2DYR H;  2GXG A;  2WAE A;  1KQ8 A;  2LRD A;  2DOE A;  3LOC A;  3K1P A;  3DTE A;  5DCF A;  4NC8 A;  4AVP A;  1NK2 P;  3K6G A;  1MJB A;  1XD7 A;  2CGP A;  3DPU A;  3TQN A;  4LIV A;  1FNN A;  4XNF A;  4B4C A;  4O6J A;  1SD5 A;  1ZHF A;  2QVO A;  3JW4 A;  2JZY A;  5GPA A;  5J8F A;  1Z05 A;  3CJT B;  2CV2 A;  5A2Q Z;  5ILV A;  4I7H A;  2YR2 A;  3AKZ A;  2LSO A;  2R7O A;  3PUB A;  2DQR A;  5M3M J;  2R7D A;  4CDG A;  4MFE A;  1KU7 A;  2OTJ I;  3HSE A;  5ERI A;  2EIM H;  2F5D A;  1T33 A;  3ERM A;  3SEQ A;  1OCO H;  2QQA A;  4QPO A;  1ZLK A;  1I1G A;  4Y17 A;  2L7F P;  3EDP A;  4LB5 A;  2EFQ A;  2ZME A;  3QWL A;  1B72 A;  3F8N A;  1D5V A;  2EIJ H;  1JKR C;  2VL8 A;  2DFF A;  1TC3 C;  4IVN A;  3HOS A;  2DAO A;  4HYE A;  2AXT C;  2Y31 A;  2IGM A;  2ETH A;  4FET A;  5CJ9 A;  5JHU A;  3H3V K;  1VQ6 I;  5LHH A;  1MD0 A;  1KU2 A;  2H6B A;  3JR9 A;  4EMS A;  4A3L J;  2FF4 A;  2HYJ A;  4NDL A;  1WKM A;  2AQF A;  4A3F J;  1UMQ A;  3QAH A;  1H89 C;  3D0S A;  3PO2 J;  2VE8 A;  2MD5 A;  4YRV A;  4UUV A;  4HNV A;  3HUG B;  3SQN A;  1SVM A;  3I59 A;  4QSH A;  2IP2 A;  2A05 A;  2CS3 A;  1K7A A;  3VFZ A;  1APL C;  5IPA A;  4PZJ A;  1BC8 C;  1BI2 A;  2C6Y A;  4HF2 A;  2WTE A;  1J2X A;  2DLL A;  3GEZ A;  4IPA A;  2JTV A;  3DQV C;  3T8R A;  4S0H B;  4H0E A;  1YTY A;  1U8B A;  3EQL F;  1MZB A;  1S7A A;  3I54 A;  3HKZ N;  3GTK J;  2JVH A;  2X85 A;  3K4B A;  1HW5 A;  3F3X A;  4CA0 A;  4YEL A;  2EFN A;  3RQI A;  3MKL A;  3U9G A;  4F91 B;  1I1S A;  4GFB A;  2MAB A;  1LJ9 A;  2X6X A;  5FLV A;  2R5Y A;  4ESF A;  2OPT A;  1QZZ A;  4BQN A;  4FX4 A;  3GVA A;  2FE3 A;  4YIR X;  2MLG A;  3OYI A;  1U3E M;  2R7R A;  3TL4 X;  3GTJ J;  2H6C A;  4XLA A;  2EFW A;  3KYD B;  1QRY A;  5LGU A;  3CCU I;  3TED A;  1SMY F;  5LGN A;  2DFI A;  4IF4 A;  2LLK A;  1VQ4 I;  1STZ A;  1R5H A;  1YS6 A;  2O5R A;  3K4M A;  4RB2 C;  2XF6 A;  3T1B A;  5BS6 A;  2LMD A;  2XGC A;  2CFX A;  5DCM A;  2B9S A;  4CYC A;  4G7O F;  5K5Q A;  4KA4 A;  1IJW C;  2JA2 A;  4ENK A;  2KIS A;  3PUF A;  3RZO J;  4ESJ A;  2JRT A;  3K70 C;  5BPD A;  2LY1 A;  4RB3 C;  3OY9 A;  1QVT A;  1YRN B;  1P7J A;  1ULY A;  4DGW B;  4II2 A;  4RBO A;  3C18 A;  4LFU A;  2CRG A;  4XM3 A;  2FJ1 A;  4ENM A;  4MEX F;  1FX7 A;  2XAH A;  2JA7 J;  1IO2 A;  1OIS A;  4XOR A;  2NAZ A;  4BBS J;  2HXI A;  3K70 D;  3TDU C;  3G71 I;  3QOP A;  4ZYH A;  2O0Y A;  5F6F A;  1OCT C;  4D0P A;  2V9K A;  3GFI A;  1RIO H;  3CC7 I;  2UXN A;  4PJ0 C;  1P6R A;  4HLY A;  2ACJ A;  2YU9 J;  2HWV A;  2QM3 A;  4YEJ A;  4A69 C;  4KN4 X;  1AA7 A;  4I01 A;  1FBU A;  1P4W A;  2OU2 A;  2WA0 A;  3AG1 H;  4BU2 A;  3I56 I;  4FTH A;  4WXD A;  1YHQ I;  2EV6 A;  2LH9 A;  1ZN2 A;  1DGW Y;  4C30 A;  3OYE A;  1X58 A;  4ZTJ A;  4E7K A;  5L3F A;  1Y6I A;  4OAY A;  4X6A J;  1TWH J;  1K4S A;  2HDD A;  5DV5 A;  3RKQ A;  2GAU A;  2XVC A;  3HPG A;  2O9L A;  3F72 A;  1UCR A;  4XRM A;  1DU6 A;  2PQ8 A;  3F9K A;  1FIP A;  2IGO A;  1W0U A;  3ZQG A;  4G7Z F;  2V9V A;  4UVB A;  4NNJ A;  4G6D A;  5CVI A;  4LK0 F;  1VTN C;  3K7A J;  4ZYE A;  3P9I A;  3GTQ J;  2QQB A;  1XMX A;  1T38 A;  1FP2 A;  3GZ5 A;  4KT5 C;  2E1M B;  3HUG A;  1FMV A;  3KCC A;  3ABL H;  1FLI A;  1SD7 A;  3E5U A;  2OC6 A;  2Z5U A;  4W97 A;  5FGM A;  1IDZ A;  1WJA A;  3JRD A;  3HSR A;  2ZNZ A;  4Q47 A;  5GTH C;  1QPM A;  5HS8 A;  1I3Q J;  5CPR B;  1KA8 A;  5CVU A;  3RQ4 A;  3MVP A;  2X6W A;  3NWT A;  3ERE D;  2OV7 A;  4A2U A;  2LTP A;  3S3O A;  1YQA A;  1ETV A;  1FIA A;  1U5T A;  1I6X A;  1R1T A;  1R5I D;  2I10 A;  2JSC A;  3RKW A;  1ONV A;  1OR7 A;  1XS9 A;  3J7A Y;  3HYI A;  3ZP5 A;  5D8L B;  2Y9Y A;  1KU9 A;  1J7K A;  4AM3 A;  2UXX A;  2CJJ A;  1A04 A;  1G3T A;  2B7E A;  1J9I A;  3I3L A;  4KUM A;  4NB5 A;  4RAY A;  3OYH A;  4FQG A;  4R79 A;  2XRN A;  5L3G A;  1LEA A;  1W7P D;  1FTZ A;  2QZ8 A;  4MEY F;  2NYX A;  1QNT A;  1QA6 A;  2H94 A;  2I8D A;  2V79 A;  2ZC2 A;  3KZZ A;  4LLL A;  2KIU A;  3CP2 A;  3SEZ A;  1F1Z A;  1TLH B;  3ASN H;  3HZJ A;  2BY1 A;  3EET A;  3KFW X;  5DD8 A;  2VJ5 A;  5KNL A;  2GIV A;  2X0L A;  3N4M A;  2JA8 J;  1KON A;  2H8W A;  3S32 A;  4ASN A;  1VZ0 A;  1IZ1 A;  4ZYG A;  2QEX I;  2M3A A;  3EUK L;  1SD6 A;  3CUO A;  3KP7 A;  1IV8 A;  4ABZ A;  4A3B J;  2DN0 A;  2DT7 B;  1YS7 A;  3S1Q J;  2HGC A;  2IS6 A;  2P6T A;  2ME0 A;  2W84 A;  4N4O B;  2W00 A;  2OZU A;  4GCV A;  1K6Y A;  1UZC A;  1R1U A;  1YRN A;  4JYK A;  2KP6 A;  3J80 K;  2ELH A;  3OL4 A;  4C9Y A;  2QEN A;  3WE3 A;  5E8G A;  3E6M A;  3V8K A;  1F9N A;  3IC7 A;  4AIK A;  2RDP A;  3OYC A;  4U7B A;  5D5U B;  3T8T A;  1ZRC A;  4KJZ A;  1T08 B;  5E20 A;  3REO A;  3D5S C;  1AU7 A;  3ZOB A;  3SZT A;  3W3C A;  1Z67 A;  2M8E A;  3WTU C;  1IG7 A;  2VAS A;  1IDY A;  4BS9 A;  5A2Q K;  3AG4 H;  3CDI A;  5E1W A;  3KEO A;  4X0G A;  5L3C A;  5TIS C;  2LF7 A;  3IV5 A;  4M73 A;  4P96 A;  4P1W A;  1E3P A;  1SC7 A;  4RGU A;  5B1B H;  2HYG D;  3ECH A;  2M4G A;  2Y69 H;  3KP5 A;  2IVM A;  4AD9 A;  3BR1 A;  3S2H J;  1D3Y A;  2BZT A;  2BXZ A;  4PJJ A;  3GX4 X;  2XF7 A;  1PDN C;  3E0J B;  3SDB A;  2KDZ A;  4EM1 A;  3MKY B;  3L2Q A;  2R93 J;  1TNT A;  3BR5 A;  1TL8 A;  2AQE A;  3GF2 A;  3CCV I;  3H9G A;  3IRR A;  2OCC H;  4IQ4 A;  4P9U A;  3EUH A;  3HPH A;  5H6Q A;  2QGU A;  5ILU A;  2W4S A;  4I76 A;  4AVZ A;  3CCL I;  5E8I A;  3GXO A;  3D1N I;  4MO7 A;  1LQ1 A;  4UV9 A;  3A03 A;  2DFH A;  2PI0 A;  1ZK8 A;  4M3F A;  4A93 J;  2QLZ A;  1PUF B;  1IXR C;  5TGT A;  1J09 A;  2DA5 A;  4QWQ A;  1ZR2 A;  2DCE A;  2A6H F;  1YOV B;  5EZH A;  3WGH A;  1R7J A;  3ZR8 X;  2BEO A;  4I0B A;  2FBI A;  1FYK A;  3CZ6 A;  3PO3 J;  2M87 A;  3M1C A;  1ZG1 A;  1LDD A;  3ZGK A;  1F43 A;  3WU1 B;  1GV2 A;  3KYL A;  3ML6 A;  2G9W A;  1OCC H;  5M5W J;  4A3D J;  2O8X A;  3DFG A;  1S29 A;  1KU3 A;  2L7K A;  2LNB A;  3LQQ A;  4Y15 A;  3S1N J;  3KZY A;  1UB9 A;  2GWR A;  4L5I A;  4A3I J;  1HF0 A;  1WVR A;  2X6Y A;  3F0C A;  4EVI A;  2L9S A;  2BY3 A;  3F8F A;  1B6A A;  1QGP A;  4D7M A;  2IEK A;  3FF5 A;  3MD2 A;  4BQO A;  2HVS A;  3DTK A;  1ETO A;  4JOM A;  1JT0 A;  4BDZ A;  1IN7 A;  2LY9 A;  1X3Z B;  4RAF A;  3OOU A;  2GA1 A;  1MBG A;  4XN3 A;  5H20 A;  3TGN A;  5C4X J;  3BDD A;  3E3V A;  1ACI A;  4U0Y A;  3FM5 A;  1FPQ A;  4B48 A;  5HLG A;  1JUM A;  5M5Y J;  3NQO A;  2QKL B;  4BKX A;  3CO7 C;  2OTL I;  3E1S A;  3M07 A;  1WJD A;  4DZJ A;  2DI3 A;  2MFZ A;  1MBH A;  2FRH A;  4DJA A;  5IY5 H;  1ZR4 A;  1SFU A;  2W25 A;  4F55 A;  3G1M A;  3JAM Z;  2VJJ A;  3FXR A;  3MZY A;  3N97 A;  3HXL A;  1I39 A;  1OMI A;  1VQP I;  1MND A;  1HBX G;  5E3M A;  1HKS A;  2HQN A;  5BOX A;  3K69 A;  2IGN A;  4U0W A;  4XKB A;  2ZXW H;  4EJO A;  1MJ9 A;  2DA1 A;  4HSR A;  1XSX A;  5E3L A;  1KGS A;  2VN2 A;  2F4O B;  4PGG A;  1O7F A;  4FHT A;  3A2K A;  3PNY A;  4EJT A;  2KQR A;  4BEH B;  3S2W A;  2RQQ A;  2J5P A; 
#chains in the Genus database with same CATH homology
 4KIB A;  1R22 A;  1XGN A;  5KK1 A;  4WXH A;  4IRG A;  4OMZ A;  2YX7 A;  4ZH4 F;  2NNN A;  4A0X A;  4LK1 F;  4KN7 X;  2VXZ A;  2OA4 A;  2KJB A;  2XRO A;  1R00 A;  2A69 F;  4HF0 A;  4EJU A;  3HOT A;  1W5T A;  3ZMD A;  2D1V A;  1G3W A;  4CGZ A;  3TOB A;  4WXC A;  4MHG A;  4A5N A;  1IN4 A;  4L9V A;  5DD4 A;  4CO8 A;  4ON0 A;  3L7W A;  3C7J A;  4A12 A;  1IAW A;  2L54 A;  3P9K A;  3FMR A;  3KP2 A;  2M1B A;  2M30 A;  2VBW A;  1YW7 A;  3SZP A;  2ZCW A;  3FMQ A;  2ISY A;  1SFE A;  3MEX A;  3H3Z A;  3K1M A;  1LNW A;  4I0A A;  1MKM A;  3ZPL A;  3CO6 C;  3L09 A;  1JXS A;  4L18 B;  1K78 B;  2XAF A;  4HLY A;  3RTR A;  2HYF A;  2MLK A;  2XUB A;  1HST A;  5D5X B;  2FMY A;  1Z6T A;  4U88 A;  3GUD A;  3TO7 A;  1FC3 A;  1DPR A;  3GFJ A;  3SFZ A;  3ZQ7 A;  3H3U A;  3TDZ C;  4BQA A;  4BHC A;  2Y48 A;  3RKX A;  4OOI A;  1GXP A;  5J6X A;  1XCB A;  1WWX A;  4RAZ A;  3E6C C;  5BPI A;  4YFN F;  2XAS A;  1P4X A;  2ESH A;  2WC2 A;  3T5X A;  4IHT A;  3B73 A;  3DV8 A;  1RUN A;  2PLY A;  1R36 A;  2L02 A;  3GYH X;  2R7F A;  2GXB A;  5ICG A;  2QBY B;  2RVC A;  3DEU A;  2G7H A;  3K1N A;  4L0Y B;  2RV8 A;  1OYI A;  4IRI A;  3L00 A;  1YIO A;  2DU9 A;  3ROU A;  2K7L A;  1IN5 A;  5AIQ A;  1DP7 P;  2P8T A;  1HKT A;  4CHU A;  5FLX Z;  3V8J A;  3VOD A;  4F7Z A;  2YX4 A;  1T39 A;  4AIH A;  2DBB A;  1K6O A;  3WU0 A;  1RZ4 A;  3WTV C;  4U0V A;  4YIF A;  1K78 A;  2GZW A;  2W85 A;  4GGG A;  3GFL A;  3ZN1 A;  1IRG A;  4UV8 A;  3U2R A;  2OBP A;  1ZRF A;  3IL2 A;  1P92 A;  3JTG A;  3JSO A;  2BE5 F;  2PMU A;  2F5C A;  2V1D A;  5DUI A;  1XDS A;  3LAP A;  4HDU A;  2IJL A;  1H9G A;  4WX9 A;  2ZXJ A;  3KE2 A;  3C3W A;  3WTS C;  2NRA C;  5HLH A;  3KP4 A;  4A5M A;  2B0L A;  5D6E A;  4M71 A;  5DUK A;  2IA2 A;  5L3D A;  4UVC A;  3E5Q A;  3RKY A;  1WI9 A;  2FNP A;  2MA3 A;  1W5S A;  2IT0 A;  1U5T B;  5ICE A;  3ZMT A;  3LA3 A;  2MH2 A;  1GXQ A;  2FML A;  1B9N A;  5E18 F;  5L3E A;  4DQ2 A;  4BHP A;  3V7R A;  1HQC A;  4QLC U;  1ZGA A;  3HRM A;  2QBY A;  1Z91 A;  1Z7U A;  2KIF A;  4OIN F;  1EH8 A;  1YYV A;  2H27 A;  3RPQ A;  5FD6 A;  4M6X A;  1HW2 A;  3O2P E;  4MGR A;  2QQ9 A;  2ESN A;  1BIA A;  3TO9 A;  1YLF A;  4Q48 A;  1CF7 B;  2P5K A;  3JTH A;  4CXF A;  4M6Y A;  2RKH A;  2L3D A;  2Y75 A;  4PCQ A;  2QWW A;  2YPR A;  5D4R A;  4ESB A;  4XSZ F;  5F64 A;  1ZGJ A;  3ABU A;  3EYI A;  5J8C A;  4O3M A;  4XSX F;  3DP7 A;  1LEB A;  3HSF A;  1S6L A;  4ZZL A;  1MJA A;  1IN6 A;  3ISP A;  2BGC A;  2DPU A;  4BYY A;  2VBX A;  3R4K A;  1JHH A;  1YW9 A;  4AWX B;  4IXA A;  1XCV A;  4A0Y A;  4DNC A;  1GHC A;  3CUQ B;  3MAJ A;  3MWM A;  3FM3 A;  4B8X A;  5TRD A;  3BRO A;  1D8J A;  6PAX A;  4NQW A;  2Z3Y A;  2DPD A;  3L9F A;  1HXD A;  5JFR A;  2K27 A;  3RPU A;  1DUX C;  2XIG A;  3O3K A;  4M9X A;  2W57 A;  4N9I A;  2FXA A;  2TDX A;  3TOA A;  1O3S A;  4HX8 A;  3VOE A;  1BN5 A;  4JBA A;  2Z33 A;  2PMH A;  1B9M A;  1XN7 A;  2EA2 A;  3ELK A;  2BV6 A;  3HRU A;  1KYW A;  5HDG A;  2ISZ A;  1LDJ A;  2WWY A;  4PDK A;  2VOO A;  2RGV A;  5E17 F;  5BMZ A;  5LEJ A;  5K5R A;  1CF7 A;  4EGY A;  3W6K B;  1IUY A;  1V4R A;  4P55 A;  1KQ0 A;  1EH7 A;  5FLX K;  1LVA A;  2E1C A;  4L9T A;  4LGW A;  2DT5 A;  2EJR A;  4I98 B;  3BJA A;  5FFX A;  3M8E A;  4M72 A;  1IN8 A;  3NEU A;  2K02 A;  2NS0 A;  2ZKZ A;  1F4K A;  3R0A A;  1ODD A;  1RUO A;  3BP8 A;  3V8L A;  1C0W A;  3F8C A;  1HKQ A;  4EM2 A;  4Z2Y A;  3COA C;  1F5T A;  2ZBK A;  5CVV A;  1WSU A;  2Z9O A;  2P5L C;  3K0L A;  4M9Z A;  3CUQ A;  2ZO4 A;  1L3L A;  3WGI A;  4HAM A;  3QU3 A;  1BJA A;  5K5O A;  5CLS A;  2RNJ A;  1B59 A;  4TV7 A;  3R6S A;  2A6E F;  5JR3 A;  1ZG3 A;  1XGO A;  3ZMS A;  1D8K A;  1YG2 A;  1ON1 A;  2EK5 A;  2DW4 A;  2BBY A;  3GFM A;  4G94 A;  2EB7 A;  1OYY A;  5AON A;  2JT1 A;  2LDU A;  2A61 A;  4LMY A;  1S7O A;  2V6C A;  1UFM A;  1QQI A;  5ICF A;  2P7C B;  1FSH A;  3G3Z A;  1ZRE A;  5JI6 A;  3RYR A;  4LB6 B;  2Y0M A;  2O3F A;  5HDN A;  3DF8 A;  4ZYD A;  2OQG A;  2VT3 A;  3FHZ A;  4OIR F;  3U1D A;  3G73 A;  3MZH A;  5LGT A;  1FYL A;  1JE8 A;  1U78 A;  3FZV A;  3J81 Z;  4MQ9 F;  1XMA A;  2ZFW A;  1CGP A;  3KET A;  1FBQ A;  4G8X A;  4KDP A;  3FX3 A;  2FSW A;  4G7H F;  3KLO A;  1O3T A;  1TTY A;  1EV7 A;  1T6S A;  2NNY A;  4ETS A;  2UZK A;  1I5Z A;  2LF8 A;  2P4W A;  3CJN A;  4M74 A;  1ZLJ A;  3LWF A;  4CIC A;  3LAJ A;  2OZ6 A;  1ZYR F;  1XGM A;  4R1H A;  3HRS A;  4JK1 X;  3QRF F;  3F21 A;  1EH6 A;  1XGS A;  2IW5 A;  2PG4 A;  2MC3 A;  4N9H A;  2FBH A;  5F1R A;  1DDN A;  2XKO A;  1QO0 D;  4PGH A;  2P7V B;  4HX7 A;  1RI7 A;  1ZAR A;  1E2X A;  3F23 A;  4Q5S F;  4A0Z A;  2DQL A;  4P9F A;  2IA0 A;  3LA7 A;  1G3Y A;  3AAF A;  3LQR A;  3M7G A;  2G7U A;  2FEZ A;  4G6Q A;  3HIF A;  2P6S A;  1V3F A;  1BIB A;  1ZH5 A;  3GO5 A;  3ZMZ A;  1PP8 F;  1P4A A;  2WV0 A;  5ILS A;  3WTW C;  2KJC A;  3RJP A;  4I09 A;  5LBQ A;  3IWZ A;  2DO7 A;  2ZJ2 A;  3KLN A;  3WTY C;  2A5Y B;  3D5L A;  4U7D A;  1S3J A;  3WOD F;  1XMK A;  1O7L A;  4HF1 A;  3E6D A;  1R1V A;  1KYZ A;  4R8H A;  2HR3 A;  1BM9 A;  4P5O A;  1Z1D A;  2PEX A;  2HEO A;  4LJZ F;  1U8R A;  1FY7 A;  3IHU A;  1ZRD A;  2XV4 S;  2A3S A;  3I53 A;  2V1U A;  3PQJ A;  2PFB A;  4MNU A;  1XSV A;  5D6F A;  4A6E A;  4KIG A;  2DK8 A;  1OKR A;  2OAZ A;  4KIF A;  3VEP A;  3IKV A;  2CO5 A;  1USS A;  1J59 A;  2CYY A;  2M45 A;  2IPQ X;  1FBS A;  1J5Y A;  2QUF A;  4S05 A;  2L4M A;  3ECO A;  2GQQ A;  1G6N A;  1IF1 A;  3IKT A;  1TBX A;  5DEQ A;  3J80 Z;  1R58 A;  5IT9 Z;  4HZF A;  4LLG F;  4FX0 A;  2KIM A;  4MQV A;  1JHF A;  4L0Z B;  3KP3 A;  4UHT A;  2F5E A;  3F8M A;  2KRF A;  1BOA A;  4IJA A;  1L0O C;  1OYW A;  4RB1 A;  4OIQ F;  4KMU X;  1UHW A;  1MDM B;  1HSJ A;  1QZY A;  5CVJ A;  3I5U A;  4HDV A;  3QU6 A;  1B4A A;  3E5X A;  4M9S A;  3V7C A;  1BBY A;  5D5V B;  4FT8 A;  4OMY A;  3JAM K;  4KNY A;  2GA2 A;  2VC0 A;  2EV0 A;  2VON A;  4JQF A;  5AIP A;  5LHG A;  3MQ0 A;  1W4M A;  4E70 A;  1Y0U A;  3J81 K;  3IWF A;  2M5W A;  1TNS A;  2AXL A;  2K4J A;  4XLP F;  4YFX F;  2BYV E;  4EJV A;  4XRF A;  5CYV A;  1BI3 A;  1W7P B;  3I64 A;  4BH9 A;  4WWC A;  1G4D A;  2L01 A;  3BJ6 A;  3M8F A;  4KIC A;  2HKO A;  1KQ9 A;  3W6J B;  2VOP A;  4GXO A;  2Q0O A;  3OOP A;  1DPU A;  4I02 A;  3GZ6 A;  1LB2 A;  3WE2 A;  3GW2 A;  3C1D A;  2VE9 A;  2STT A;  4CZZ A;  2PJP A;  5HDK A;  1REP C;  3DPL C;  1XSD A;  3HTS B;  1Z6R A;  3GLX A;  1E17 A;  2VOD A;  3DKW A;  3MCZ A;  5D5W B;  1O3Q A;  3BWG A;  3ULQ B;  3QPH A;  3I71 A;  1RNL A;  3NRV A;  3MFK A;  3WTZ A;  2Q2E A;  3E97 A;  4HQM A;  2V1X A;  4MTD A;  1YO5 C;  2HDC A;  2W24 A;  5EEH A;  4L5J A;  3LST A;  2R3S A;  3VB2 A;  5HS7 A;  5FD5 A;  3ZN0 A;  2HOE A;  2F2E A;  1MDM A;  3I58 A;  4EV0 A;  1O57 A;  1FT9 A;  3L2C A;  3ZMU A;  4UVA A;  2HTS A;  3RYP A;  4IHS A;  4BAY A;  2XAQ A;  3RIR A;  3V4G A;  1U5T C;  1OPC A;  1K79 A;  4OU0 A;  4L9N A;  4HQE A;  1S8N A;  2VBY A;  2X4H A;  3BPX A;  3TKY A;  5H6R A;  1FSE A;  3ABT A;  1IXS B;  1W7P A;  2HFH A;  3H92 A;  5KVR A;  4KFC A;  1SFX A;  1FYM A;  3DXJ F;  2Z99 A;  1O3R A;  1XDU A;  1FP1 D;  2AS5 F;  4HV5 A;  1U2W A;  4RGR A;  3WTT C;  3I0T A;  5DDG A;  2RC4 A;  3R0J A;  4N0B A;  4O5V A;  5ED4 A;  4XLN F;  2LKP A;  2FOK A;  3O6B B;  1TQP A;  2RN7 A;  4BXU A;  3RDI A;  4EM0 B;  3R60 A;  2O61 A;  3QP6 A;  4L9J A;  1XB4 A;  1BI0 A;  5LEK A;  4GYG A;  1X3U A;  3DPT A;  3P9C A;  5IT9 K;  1SMT A;  1AOY A;  1IXC A;  5LRR A;  1T98 A;  1G3S A;  4HV6 A;  3KP6 A;  1FZP B;  4LLN A;  4UNO A;  2OD5 A;  2CSO A;  2MH9 A;  3FXU A;  3Q9V A;  1PP7 U;  3CUQ C;  3BPV A;  5FO5 A;  2FA5 A;  2KKO A;  5LLQ A;  3BY6 A;  4HW0 A;  3K2Z A;  4ZZD A;  4BNC A;  2HQR A;  3FMS A;  2JPC A;  2PN6 A;  2CWE A;  3CDH A;  3QP5 A;  4YFK F;  4RGX A;  2D2W A;  3RI4 A;  2UWM A;  3M9A A;  4CYD A;  2OQR A;  2XHK A;  4XBF A;  2D45 A;  4G9Y A;  2EFP A;  4EJW A;  1P2F A;  5FFZ A;  3LFK A;  2CG4 A;  4RB0 A;  2CQK A;  4Q4Z F;  1HW1 A;  2E7W A;  4EQQ A;  3FXQ A;  3WTX C;  3KEQ A;  1BI1 A;  2DK5 A;  4WCG A;  3K9T A;  1J0R A;  2EFO A;  3R61 A;  5LRS A;  1PUE E;  2IRF G;  4YII A;  2XAJ A;  1ZG5 A;  4ENN A;  2F5F A;  2HZT A;  3PQK A;  2H09 A;  2E7X A;  1R5G A;  1WRJ A;  4RS8 A;  5CVR A;  5IT3 A;  2L4A A;  1TQI A;  5JVT A;  1UST A;  5E1Z B;  3B02 A;  1ZAO A;  3WGG A;  4MTE A;  5D4S A;  2QYO A;  2HTJ A;  4RGS A;  2E1N A;  4UXN A;  5HOO A;  3F22 A;  2Q8K A;  1AWC A;  1IW7 F;  4LG0 B;  4KYW A;  4HX4 A;  2YU3 A;  2RQP A;  3HRT A;  1H0M A;  5E1X A;  1YFH A;  1TW2 A;  4Y13 A;  2VT2 A;  1WQ2 A;  1TW3 A;  1T2K A;  3PFI A;  3GWZ A;  2JPB A;  3F8B A;  4AIJ A;  4HA8 A;  4LD5 A;  2O6G E;  2COM A;  2FU4 A;  5LHI A;  3CTA A;  1UHM A;  2YSR A;  3E6B A;  1JGS A;  1IRF A;  4NHJ A;  2P5V A;  1QBJ A;  5K1Y A;  3IRQ A;  1Z9C A;  3F6V A;  4IRH A;  2K86 A;  2ADU A;  4HLX A;  4WK8 F;  2HKX A;  1I27 A;  2FNA A;  1U6G A;  1YW8 A;  3TO6 A;  3HHG A;  4YG2 F;  2CW0 F;  3I4P A;  2A68 F;  4KMF A;  3P7N A;  3LA2 A;  1J75 A;  2XKP A;  2ZME B;  5L3B A;  3QPT A;  3BJO A;  3CLO A;  1R23 A;  5HVQ C;  2DTR A;  5BQT A;  3HHH A;  2D1H A;  1ON2 A;  5TJJ A;  5ICC A;  2HS5 A;  4OIP F;  1GVJ A;  2IA1 A;  3OV8 A;  2FQ3 A;  4ENJ A;  1SAX A;  2EA4 A;  3WG9 A;  4WF2 A;  5HS9 A;  5D8K B;  4K2E A;  3I59 B;  3FWE A;  4HOB A;  2VC1 A;  3BOQ A;  3SHF A;  5FB2 A;  3JSP A;  2XGX A;  1Q1H A;  3Q5F A;  1TQM A;  3ZMV A;  1NHA A;  1T0F A;  4OIO F;  2J5O A;  2PBI A;  2ZNY A;  5DYM A;  2STW A;  4LG0 A;  2XAG A;  2O03 A;  4HBL A;  1FOK A;  5HLI A;  2A07 F;  1H9T A;  2K4B A;  3F6O A;  2MBF A;  5EEG A;  4S04 A;  3J7A O;  3HTU A;  3EYY A;  1BC7 C;  3T0Y A;  4EGZ A;  3M1E A;  4B09 A;  3BZ6 A;  3Q9S A;  1MGT A;  3V7S A;  2FBK A;  1SD4 A;  1B1B A;  4A6D A;  1FWZ A;  5DCM B;  4GO1 A;  4GYI A;  2VBZ A;  3SXY A;  4I2O A;  4BHB A;  2EWN A;  1LDK B;  2EV5 A;  2GXG A;  1KQ8 A;  3K1P A;  5DCF A;  4AVP A;  1MJB A;  1XD7 A;  2CGP A;  3TQN A;  1FNN A;  4O6J A;  1SD5 A;  1ZHF A;  2QVO A;  3JW4 A;  2JZY A;  5J8F A;  1Z05 A;  5A2Q Z;  5ILV A;  4I7H A;  2YR2 A;  2LSO A;  2DQR A;  2R7D A;  4CDG A;  1KU7 A;  3HSE A;  5ERI A;  2F5D A;  2QQA A;  1ZLK A;  1I1G A;  4Y17 A;  3EDP A;  4LB5 A;  2EFQ A;  2ZME A;  3F8N A;  1D5V A;  4IVN A;  3HOS A;  2DAO A;  4HYE A;  2ETH A;  5CJ9 A;  5JHU A;  5LHH A;  1MD0 A;  1KU2 A;  2H6B A;  4EMS A;  2FF4 A;  1WKM A;  3QAH A;  3D0S A;  2VE8 A;  2MD5 A;  4UUV A;  3SQN A;  3I59 A;  2IP2 A;  1K7A A;  3VFZ A;  4PZJ A;  1BC8 C;  1BI2 A;  2C6Y A;  4HF2 A;  2WTE A;  1J2X A;  2DLL A;  3GEZ A;  4IPA A;  2JTV A;  3DQV C;  3T8R A;  1YTY A;  4H0E A;  3EQL F;  1MZB A;  1S7A A;  3I54 A;  1HW5 A;  3F3X A;  2EFN A;  3U9G A;  1I1S A;  1LJ9 A;  4ESF A;  1QZZ A;  4FX4 A;  3GVA A;  2FE3 A;  2MLG A;  1U3E M;  2H6C A;  2EFW A;  5LGU A;  1SMY F;  5LGN A;  2DFI A;  4IF4 A;  1STZ A;  1R5H A;  1YS6 A;  4RB2 C;  3T1B A;  5BS6 A;  2CFX A;  5DCM A;  4G7O F;  5K5Q A;  4KA4 A;  4ENK A;  4ESJ A;  2JRT A;  5BPD A;  4RB3 C;  1ULY A;  3C18 A;  4LFU A;  4ENM A;  4MEX F;  1FX7 A;  2XAH A;  2NAZ A;  3TDU C;  3QOP A;  4ZYH A;  2O0Y A;  5F6F A;  4D0P A;  3GFI A;  1RIO H;  2UXN A;  1P6R A;  2ACJ A;  2HWV A;  2QM3 A;  4KN4 X;  4I01 A;  1FBU A;  1P4W A;  2OU2 A;  4WXD A;  2EV6 A;  1ZN2 A;  5L3F A;  5DV5 A;  2GAU A;  2XVC A;  3F72 A;  1UCR A;  2PQ8 A;  4G7Z F;  2V9V A;  4UVB A;  4G6D A;  5CVI A;  4LK0 F;  1VTN C;  4ZYE A;  3P9I A;  2QQB A;  1T38 A;  1FP2 A;  3GZ5 A;  4KT5 C;  3HUG A;  3KCC A;  1FLI A;  1SD7 A;  3E5U A;  2Z5U A;  5FGM A;  3HSR A;  2ZNZ A;  4Q47 A;  1QPM A;  5HS8 A;  1KA8 A;  5CVU A;  3ERE D;  4A2U A;  1YQA A;  1U5T A;  1I6X A;  1R1T A;  2JSC A;  3RKW A;  1ONV A;  1OR7 A;  3HYI A;  3ZP5 A;  5D8L B;  1KU9 A;  1J7K A;  2UXX A;  1A04 A;  1G3T A;  1J9I A;  4KUM A;  4NB5 A;  4RAY A;  5L3G A;  4R79 A;  2XRN A;  1LEA A;  1W7P D;  2QZ8 A;  4MEY F;  2NYX A;  1QNT A;  2H94 A;  2V79 A;  3KZZ A;  4LLL A;  2KIU A;  1F1Z A;  1TLH B;  3KFW X;  3EET A;  5DD8 A;  2GIV A;  2X0L A;  3N4M A;  4ASN A;  4ZYG A;  1IZ1 A;  1SD6 A;  3CUO A;  3KP7 A;  1YS7 A;  2HGC A;  2P6T A;  2W84 A;  2OZU A;  4GCV A;  1R1U A;  3J80 K;  2ELH A;  2QEN A;  3WE3 A;  5E8G A;  3E6M A;  3V8K A;  1F9N A;  3IC7 A;  4AIK A;  2RDP A;  4U7B A;  5D5U B;  3T8T A;  1ZRC A;  5E20 A;  3REO A;  3SZT A;  2M8E A;  3WTU C;  5A2Q K;  5E1W A;  3KEO A;  5L3C A;  2LF7 A;  4M73 A;  4P96 A;  4RGU A;  2HYG D;  3ECH A;  4AD9 A;  3KP5 A;  2IVM A;  1D3Y A;  3GX4 X;  1PDN C;  4EM1 A;  1TNT A;  3GF2 A;  3IRR A;  4P9U A;  3EUH A;  5H6Q A;  5ILU A;  5E8I A;  3GXO A;  1LQ1 A;  4UV9 A;  2PI0 A;  2QLZ A;  1IXR C;  4QWQ A;  2A6H F;  3WGH A;  1R7J A;  2BEO A;  4I0B A;  2FBI A;  1FYK A;  2M87 A;  1ZG1 A;  1LDD A;  3WU1 B;  3ML6 A;  2G9W A;  2O8X A;  3DFG A;  1S29 A;  1KU3 A;  2LNB A;  3LQQ A;  4Y15 A;  3KZY A;  1UB9 A;  2GWR A;  4L5I A;  4EVI A;  3F8F A;  1B6A A;  1QGP A;  3FF5 A;  1IN7 A;  2GA1 A;  5H20 A;  3TGN A;  3BDD A;  3E3V A;  4U0Y A;  3FM5 A;  1FPQ A;  5HLG A;  3NQO A;  3CO7 C;  2DI3 A;  2FRH A;  1SFU A;  2W25 A;  3JAM Z;  3FXR A;  3MZY A;  3N97 A;  1OMI A;  1HBX G;  1HKS A;  2HQN A;  5BOX A;  3K69 A;  4U0W A;  4EJO A;  1MJ9 A;  1XSX A;  1KGS A;  2VN2 A;  4PGG A;  1O7F A;  4FHT A;  4EJT A;  3S2W A;  2J5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...