6PAXA

Crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26 NUCLEOTIDE DNA
publication title Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA02
2RQPA 5IT3A 2RNJA 1EH6A 3GFIA 4RAYA 5LHHA 1XDUA 4ZYEA 1ULYA 1XDSA 1BBYA 1T0FA 4LB6B 3TQNA 2QENA 2OU2A 4WXHA 3U2RA 2VOOA 4WK8F 4G6DA 4P96A 2GAUA 3WTSC 3H3UA 2M87A 4XSZF 1FBSA 1G3WA 1O7FA 5JR3A 1TBXA 5LHGA 3L7WA 5ED4A 2WC2A 2VN2A 2O3FA 3WTXC 1IN4A 4I02A 1LDJA 2ZJ2A 5E20A 1B9NA 3F6VA 3HRMA 4M9ZA 3Q9VA 4U0VA 3WG9A 1QZYA 4M74A 5LRRA 3CTAA 4RGSA 2GIVA 4Q47A 4OIOF 4S05A 3LA2A 5L3GA 2BEOA 2Z99A 4L9JA 4IRGA 2VE9A 1XD7A 4HAMA 2GXBA 2YR2A 1S3JA 4EM2A 4CGZA 1D8JA 5FFZA 3COAC 3U1DA 1FBQA 2EWNA 1TW2A 2K4JA 2XROA 4Q5SF 2IPQX 3FM5A 4XRFA 1FC3A 2ZCWA 1H9TA 5FFXA 1MKMA 2FBHA 3IKTA 2RKHA 2DPDA 2NRAC 1JXSA 1DPRA 5ICEA 2H94A 2O8XA 3VEPA 4O3MA 3PQKA 1SFUA 2PMHA 1HW5A 1JHHA 5CYVA 1LVAA 2ESHA 1ODDA 2W24A 3CO6C 1UHMA 6PAXA 1B1BA 3VB2A 1BI0A 3K1NA 5CJ9A 2IT0A 1FP2A 2DBBA 1IXSB 2F5DA 2JSCA 1KU9A 3VOEA 1ZG3A 4P9FA 4WXCA 1SD6A 2ELHA 4BHCA 4LK0F 3GO5A 3D5LA 3Q9SA 2X4HA 1U6GA 3JAMZ 2OAZA 1P4WA 4IVNA 4KFCA 4BQAA 2Q0OA 3V7CA 2FMYA 3F8CA 3GLXA 4BHBA 3TKYA 1G3SA 2ESNA 5K5RA 2QZ8A 4M6YA 1Z6RA 4HLXA 2FSWA 1Z9CA 4HLYA 2PMUA 1FT9A 5HLHA 2P7CB 2EFNA 3BROA 5L3BA 3L00A 1GXPA 1QQIA 3HHGA 3EYYA 4UVAA 4AIHA 1TW3A 2KRFA 3BZ6A 3RI4A 1R58A 3RJPA 1XCBA 1D8KA 3ELKA 2NNYA 3FWEA 5D5XB 1YQAA 4ETSA 4UNOA 1F1ZA 3H92A 2EV0A 1BOAA 4KN4X 4LLGF 4L0YB 2ZMEB 1MDMB 1QNTA 2ZNZA 2DLLA 3RIRA 2UXNA 2GWRA 2MLKA 2STWA 3HRSA 2DAOA 5HDKA 4UXNA 3DF8A 1SFEA 4WCGA 1K78B 2XVCA 3GXOA 4D0PA 3F22A 1DDNA 5DCMB 2V1UA 3GFJA 3I5UA 2GXGA 4R1HA 3V4GA 5EEHA 5ICCA 1UCRA 3V7SA 2ZMEA 3MZHA 1MDMA 2FQ3A 3DPLC 1J7KA 4KDPA 2V6CA 1R1TA 4LK1F 2HS5A 4F7ZA 3F3XA 1I27A 4N0BA 2COMA 1UFMA 1ZHFA 1EV7A 3K1PA 2JZYA 5D6EA 1K78A 2W84A 5HVQC 1ZRFA 5DCMA 4LB5A 4L18B 3O6BB 5FLXK 4EM0B 3LQQA 2ZFWA 5HDGA 2XUBA 3TO9A 3VFZA 3I53A 5LRSA 3GVAA 1MZBA 2J5PA 2D1HA 4G94A 3CJNA 4I09A 3RKXA 2RDPA 3JTHA 2NYXA 1XGNA 1SAXA 3KP3A 4A0YA 4RS8A 4ZZLA 2CW0F 3R6SA 2PQ8A 2HQRA 4IRHA 3WGHA 5DV5A 3O2PE 2YX4A 2E7WA 4JQFA 3ZN0A 2LDUA 5LHIA 2V1XA 3F8FA 3O3KA 4AWXB 4RB0A 5HS8A 1U8RA 2HGCA 3DV8A 1PUEE 4FT8A 2YU3A 2OZUA 2QLZA 2AS5F 3ROUA 4HX8A 1BC7C 3RYPA 1R22A 5IT9K 3ABTA 4IXAA 3QPTA 2XKPA 2TDXA 2L54A 3H3ZA 3HSEA 1ZN2A 1R36A 3WE3A 2XAHA 2R7DA 4Y13A 4A6DA 1Z05A 5J8FA 3ZMZA 2CFXA 1R5GA 1O3QA 3LA7A 1TQIA 1PP7U 4ENKA 1I6XA 3SHFA 5DDGA 2YX7A 1Z6TA 2CQKA 1O3SA 3ECOA 5CVVA 3BJOA 1G3YA 3DQVC 3TDZC 5K5QA 3IL2A 4UV8A 5HLGA 2ISZA 3RKWA 1BI2A 4ZH4F 3R61A 3RKYA 5D5VB 1U2WA 1SD7A 1ZLKA 4LGWA 1HBXG 2XAQA 4ASNA 2MC3A 4HZFA 1J9IA 1TQPA 4O6JA 5LLQA 4KT5C 4BHPA 5DYMA 1F5TA 2MH2A 1AOYA 3LAJA 5K5OA 3NEUA 2LKPA 3MWMA 3OV8A 4M73A 1XB4A 3F72A 2PN6A 2A07F 2K86A 3DFGA 2WTEA 4KIBA 1TQMA 3M8EA 4U88A 4GXOA 1YIOA 3HIFA 3U9GA 3QRFF 2KIMA 4RB2C 3E97A 1IUYA 2OZ6A 1XGSA 3WTZA 3WTTC 4NQWA 3HSRA 1MJ9A 5E18F 1U3EM 1D3YA 4YIFA 3IRRA 3BY6A 1WQ2A 4A0ZA 2OBPA 2DQRA 3FMQA 3IRQA 1C0WA 2OA4A 1ZGAA 4KN7X 3K9TA 1QGPA 2HYGD 5ILUA 4R8HA 3LFKA 2KIFA 3K1MA 2HTSA 3T8RA 1WSUA 2DO7A 2EK5A 4L9TA 3WTYC 5TRDA 4KIGA 1E17A 4HF1A 1IN8A 1E2XA 2XAFA 1HXDA 3KEQA 2UXXA 1R00A 2FF4A 1Z1DA 2Z5UA 2JTVA 5AIPA 1LNWA 2NS0A 2VBZA 4QLCU 4WWCA 2Y75A 2BV6A 1L0OC 3P7NA 4HQEA 2HOEA 2DW4A 3PQJA 1HQCA 1YG2A 1JGSA 3KCCA 1R5HA 2D45A 3MEXA 3ECHA 1QPMA 2A61A 3J80Z 1J5YA 3GFLA 3QAHA 3SFZA 3HOSA 3I54A 2O61A 4GYGA 3V7RA 4RGRA 4HX7A 3SZPA 2P5VA 3SXYA 2P6TA 3DKWA 1G6NA 2L3DA 3K69A 2Q2EA 2FRHA 5ILSA 1I5ZA 2Z33A 4HQMA 2GA1A 2VODA 3E6CC 1U5TB 4MNUA 2DQLA 4KMFA 3MFKA 2XGXA 4K2EA 1FY7A 3HUGA 2EFOA 2IP2A 1IXRC 1RNLA 4ENMA 2VBXA 4GO1A 1WI9A 3KP7A 1Z91A 3E6MA 1D5VA 4G7ZF 3KP5A 1KQ8A 4PGGA 5D4RA 1Y0UA 1U5TA 5TJJA 4HDUA 2E1NA 1Q1HA 2A69F 2UZKA 3PFIA 4I7HA 3L09A 4DQ2A 3RPUA 2F5FA 5ILVA 1IZ1A 3J81Z 4LLNA 5LGNA 2H6CA 2XIGA 5F6FA 2FNPA 2JRTA 2E7XA 1V3FA 2LNBA 3K0LA 1PP8F 2PG4A 4ZYGA 5E1XA 2D2WA 5E8GA 2JPBA 1S29A 2MBFA 2CSOA 2FOKA 3Q5FA 3M8FA 1R1VA 4U7BA 5CVRA 1IF1A 1LJ9A 1SMTA 4IHSA 4FX4A 2ZBKA 2HEOA 4GCVA 4KUMA 1S8NA 2H6BA 3JAMK 4UHTA 1B4AA 1LEAA 3HYIA 1LEBA 4ZZDA 1PDNC 5LEKA 5HLIA 2IW5A 3WE2A 3T1BA 2OQRA 1IW7F 4L9NA 5BMZA 4B09A 2FBKA 4LD5A 1BM9A 2LSOA 2CGPA 2XKOA 4HF0A 3FM3A 3AAFA 1BI3A 2R3SA 2FU4A 5JHUA 2P4WA 1ZRDA 1S6LA 3SQNA 2HKXA 4M71A 2FE3A 1ZAOA 2HWVA 3T8TA 5JI6A 5DCFA 4HA8A 3E6DA 4CZZA 1IAWA 3GF2A 3F8MA 1P4AA 5HS7A 1R7JA 2HZTA 2ZKZA 2FXAA 2L01A 3REOA 1K6OA 1FSEA 3E3VA 5FB2A 5FD6A 2HDCA 3R0AA 1KA8A 3G3ZA 5F64A 3BPVA 3GZ6A 1I1GA 1DP7P 2IJLA 4YFKF 3HOTA 2V79A 3JW4A 4IF4A 4MTEA 3W6JB 1OMIA 2EV5A 2VC0A 2HQNA 4G6QA 2E1CA 3L9FA 2HR3A 1SD5A 4PGHA 3IWFA 2JT1A 3J7AO 3HRUA 4KNYA 2A5YB 1KYZA 2STTA 4JBAA 5FLXZ 1CF7B 1H0MA 4HYEA 4ESFA 5J6XA 4XLPF 2FBIA 4A12A 3CO7C 3S2WA 2QQ9A 3F8NA 3ZMVA 4I0AA 4RB3C 2QYOA 1J2XA 5DD4A 2Z9OA 4YFXF 1F4KA 1I1SA 1ZG5A 5L3FA 4U7DA 4EM1A 5H6QA 1T39A 1BIBA 1CF7A 3QU6A 3IWZA 3TOBA 3ZMUA 3E6BA 3DP7A 1B59A 3WODF 2L4AA 1X3UA 1FPQA 1KGSA 4BYYA 3MZYA 3CUQC 2PJPA 3KETA 1XSXA 4HF2A 4WXDA 1SMYF 3C18A 1J75A 5IT9Z 1U78A 3M1EA 3K2ZA 2ZXJA 3GW2A 1RUNA 4ESBA 2GZWA 2OD5A 5D6FA 5LGTA 1P4XA 4EJOA 2GQQA 2HYFA 5KVRA 3WTUC 1KQ0A 2XV4S 4LJZF 3FX3A 4G9YA 3CUOA 4XLNF 3R0JA 3EQLF 5H20A 2G7HA 2P7VB 4YG2F 5FGMA 1J0RA 3C3WA 3WGGA 1XGOA 1FYMA 4P55A 1P2FA 1REPC 1GXQA 4LMYA 3FXQA 4Q4ZF 1OKRA 3T0YA 5CVIA 3ULQB 4IJAA 2F2EA 1K7AA 2B0LA 2A68F 2VE8A 4WF2A 4IRIA 1ON2A 4DNCA 1IN7A 3I71A 4NB5A 3TDUC 2EFQA 2D1VA 4HOBA 1T38A 5FD5A 5EEGA 1BC8C 1TNTA 2P5KA 4UVBA 3FZVA 3TO7A 2ACJA 3BP8A 4MEXF 3HSFA 2MA3A 1OYWA 3BOQA 5D5WB 2EV6A 3T5XA 3W6KB 5D8KB 4EJTA 3FF5A 4IPAA 2P5LC 4GYIA 1XGMA 5E17F 2R7FA 4KIFA 3EYIA 2UWMA 1S7AA 1SFXA 1ZLJA 1P92A 5BPIA 2KJBA 2ZNYA 1ZYRF 5AIQA 2DU9A 1OYIA 2FNAA 2RN7A 5E1ZB 3WU0A 3TGNA 3V8JA 1DPUA 1BI1A 5BOXA 3F21A 4EGYA 5J8CA 4H0EA 2HKOA 4IHTA 4AIKA 4PCQA 1XSDA 2DT5A 2W25A 2ZO4A 2MD5A 2RV8A 2RGVA 3ISPA 2P6SA 1FWZA 3WU1B 4EQQA 3IKVA 2QQBA 4AD9A 1KU7A 4MEYF 4HV5A 4N9HA 1YW8A 2BYVE 4AVPA 1B6AA 3V8KA 2X0LA 3WGIA 4WX9A 3JSPA 3FMSA 1ON1A 3QPHA 2EA4A 3I0TA 3BDDA 5E8IA 3KZYA 1FSHA 2VXZA 3CDHA 5A2QK 1W7PD 1USTA 2VT2A 5FO5A 2QM3A 5CVJA 1YW9A 1WRJA 3E5QA 2V9VA 4ZYHA 1W7PB 1G4DA 2M45A 1ZARA 2VBWA 3EUHA 3F23A 2G7UA 3QOPA 1H9GA 1WWXA 3GZ5A 1XMKA 1V4RA 3F6OA 3QP6A 3N4MA 1ZG1A 3FXRA 2WV0A 4XSXF 2L02A 3P9CA 3ERED 1W5SA 3HTSB 2XHKA 2K27A 2DTRA 3NRVA 1B9MA 4ENNA 3SZTA 4RGUA 2GA2A 4EMSA 3GEZA 1W7PA 3V8LA 4ENJA 3B02A 3LQRA 4AIJA 1HKQA 5BS6A 3J80K 1XN7A 4O5VA 4HDVA 3DPTA 4EV0A 5LEJA 1MGTA 3I4PA 5H6RA 5HDNA 2FMLA 3RYRA 1YS7A 2QVOA 1SD4A 3GFMA 1BJAA 5D5UB 3KZZA 2W57A 4MGRA 1FX7A 3TOAA 2Q8KA 3ZQ7A 4R79A 4OMYA 3F8BA 3M7GA 5L3CA 4HX4A 3IHUA 1FNNA 1DUXC 1MD0A 3ZMSA 4FX0A 2KJCA 5F1RA 1ZRCA 2F5EA 4Z2YA 3MAJA 1ONVA 1QO0D 1OYYA 3E5UA 1IN6A 1KU2A 5HOOA 2OQGA 1K79A 1O3TA 1HW1A 3LA3A 1YO5C 3MQ0A 3ZP5A 3ML6A 3LSTA 3WTVC 3C1DA 2K7LA 3HRTA 2RVCA 3KEOA 1FBUA 2DPUA 2PI0A 2QBYB 4ON0A 4TV7A 3KP6A 1IRFA 1USSA 1LDKB 3CLOA 4XBFA 3GX4X 1S7OA 1VTNC 3B73A 1QZZA 1FZPB 1IXCA 2HFHA 1KYWA 3KLNA 3ZPLA 4BH9A 1MJBA 1UHWA 1HSJA 5CLSA 3J81K 3KFWX 1RI7A 2MH9A 3D0SA 1NHAA 2FEZA 3QU3A 4MQVA 2QBYA 3EDPA 4L5IA 2CWEA 4OINF 2FA5A 1FP1D 2VC1A 5LBQA 1W4MA 2Z3YA 4JK1X 1XSVA 3BPXA 4LFUA 1OPCA 2EB7A 2BGCA 2M30A 3DXJF 2F5CA 4YFNF 2LF8A 4ESJA 2YPRA 3OOPA 2AXLA 4L0ZB 2ETHA 2ADUA 2JPCA 4KMUX 1ZREA 2XAGA 2O03A 4PDKA 1R1UA 4M6XA 5DD8A 2K02A 1TNSA 2CO5A 1J59A 4CYDA 4OMZA 2KIUA 3DEUA 3KE2A 2IA2A 4MHGA 1Z7UA 4OOIA 2G9WA 4Q48A 2CG4A 1EH8A 3RDIA 4YIIA 1QBJA 4FHTA 4M9SA 4RAZA 1XCVA 1IRGA 4EJUA 3FHZA 2VOPA 1TLHB 1RIOH 3KLOA 3R4KA 4RGXA 2QUFA 2PFBA 4A5NA 5D8LB 5ICGA 3E5XA 4I01A 1BIAA 4CICA 3G73A 2M1BA 4G7OF 1JE8A 4CO8A 3ZMTA 2QQAA 2KKOA 1YFHA 2YSRA 2XAJA 4M72A 5ERIA 4OIRF 4HW0A 1ZH5A 3ZN1A 2PBIA 4U0WA 2XASA 3P9IA 3L2CA 1T2KA 3QP5A 3FXUA 5HS9A 2W85A 1L3LA 3I58A 1KQ9A 3BJAA 3I64A 5KK1A 1P6RA 2A6EF 1GVJA 2DFIA 2BBYA 3ZMDA 3KP2A 2H27A 4P5OA 5K1YA 4MQ9F 3TO6A 2DI3A 4A0XA 2LF7A 4OIQF 3IC7A 1T98A 3P9KA 4UV9A 4LG0B 2IA1A 2DK8A 2O0YA 1JHFA 1EH7A 3GUDA 2QWWA 1KU3A 2V1DA 2EFWA 4UUVA 3JTGA 1FYKA 5D4SA 3R60A 5BPDA 1STZA 4A6EA 2M8EA 1G3TA 1F9NA 1FYLA 4BXUA 4I2OA 1HKTA 1AWCA 3LWFA 2Y0MA 2XRNA 2MLGA 4B8XA 4G7HF 3GWZA 4PZJA 3HHHA 1W5TA 4Y17A 4BNCA 2K4BA 4P9UA 1R23A 4LG0A 4HBLA 3BJ6A 5JVTA 2CYYA 4U0YA 3KP4A 5E1WA 2C6YA 2Y48A 3LAPA 1OR7A 1LDDA 4L5JA 5ICFA 4EJWA 4OIPF 2O6GE 5JFRA 1YTYA 3I59B 4S04A 1MJAA 2WWYA 4MTDA 3VODA 1ZGJA 5BQTA 3BWGA 2M5WA 3WTWC 3N97A 1HKSA 1UB9A 2DK5A 2HTJA 5L3DA 2PEXA 2L4MA 3NQOA 2P8TA 4KA4A 1TTYA 1XMAA 1RUOA 3FMRA 5AONA 2EJRA 4GGGA 1YYVA 4QWQA 4ZYDA 2VT3A 1BN5A 1FLIA 1YS6A 5LGUA 1LQ1A 3I59A 1LB2A 5DUKA 3ABUA 3MCZA 2PLYA 4A5MA 4EGZA 1T6SA 4CHUA 2RC4A 2J5OA 4LLLA 4I0BA 1HSTA 1RZ4A 4BAYA 2BE5F 2A6HF 4I98B 2EA2A 4NHJA 2NAZA 4OU0A 4M9XA 1U5TC 1CGPA 4HV6A 1O7LA 2NNNA 4KYWA 3CUQB 5DEQA 4EJVA 3RTRA 1O3RA 2VONA 4RB1A 2IA0A 3JSOA 1GHCA 1O57A 5DUIA 1IN5A 1YW7A 2VBYA 5L3EA 1FOKA 3HTUA 3M9AA 1WKMA 1HW2A 4CDGA 1YLFA 4UVCA 1A04A 2H09A 4A2UA 3RPQA 5CVUA 4L9VA 5A2QZ 2IVMA 4Y15A 3GYHX 3EETA 2ISYA 2IRFG 3CUQA 4EVIA 4CXFA 3C7JA 2A3SA 2EFPA 4E70A 4KICA 4G8XA 4N9IA
chains in the Genus database with same CATH superfamily
2RQPA 5IT3A 4IOCF 2RNJA 1EH6A 3GFIA 4RAYA 3ZR8X 2K9MA 3A01B 1TWHJ 5LHHA 3PFYA 4E7HA 1XDUA 4ZYEA 1ULYA 1XDSA 2DA5A 1BBYA 1T0FA 4LB6B 3TQNA 3TW6A 2ZC2A 3GMEA 4NDLA 2QENA 2V9PA 3W2AA 2OU2A 3QOEA 4WXHA 3U2RA 2VOOA 3K4MA 4C2TA 1A6IA 4WK8F 4G6DA 1RESA 4P96A 3IH2A 2GAUA 1BR4A 4N4OB 3BT9A 4QSHA 3WTSC 2DOFA 3H3UA 2M87A 2W00A 2GIZA 3ESWB 1FBSA 4XSZF 4CYCB 1G3WA 3S8PA 2QQ8A 1O7FA 5JR3A 5EF6A 2V26A 1ACIA 1TBXA 5LHGA 2HYJA 3L7WA 3OYGA 5ED4A 2WC2A 2VN2A 2O3FA 3WTXC 2E34A 1IN4A 4I02A 1LDJA 2ZJ2A 3L2QA 5E20A 1B9NA 5GAEJ 4DW6A 3F6VA 3HRMA 1RKWA 2V4JC 4M9ZA 2VQGA 3Q9VA 1BR1A 4U0VA 3WG9A 1Y56A 3ZGKA 3A01A 4FETA 3MZ8A 1QZYA 4NNJA 4M74A 5LRRA 3CTAA 1HDPA 4RGSA 4BDYA 2GIVA 5JLWA 2X51A 1JI8A 4Q47A 4OIOF 4S05A 3LA2A 3K4BA 5L3GA 1JTYA 1T95A 2BEOA 1WVRA 2K9NA 3KYDB 4E7SA 1D0ZA 2Z99A 4L9JA 2HQAA 1H89C 2JJ7A 4IRGA 4CYCA 2JA8J 2VE9A 2WAFA 1XD7A 4HAMA 2GXBA 2YR2A 1N78A 4XOTA 1S3JA 2HXIA 4EM2A 2KP6A 4CGZA 5K7FA 1T8IA 5GTIC 1D8JA 5FFZA 3COAC 3U1DA 1FBQA 2EWNA 1PJRA 1TW2A 2EILH 2K4JA 1UAAA 2YU9J 2XROA 4F93B 3SDBA 4Q5SF 2L7MP 2IPQX 3W2WA 4YELA 1W0UA 3L1PA 2GM4A 4M3DA 3LSMA 2ZFUA 3HKZN 3BR5A 3D5SC 3FM5A 4XRFA 1FC3A 2ZCWA 1H9TA 5FFXA 1MKMA 2FBHA 3IKTA 1BW5A 1ZR4A 4BY1J 4CUGA 3OYEA 2O5RA 2RKHA 3FKJA 4DJAA 5B66C 2DPDA 2NRAC 1I3QJ 4ZTJA 1DPRA 1JXSA 2H94A 2O8XA 3HBLA 3VEPA 5ICEA 4O3MA 3PQKA 1SFUA 2PMHA 1HW5A 4CCKA 1DGWY 1JHHA 2W7NA 5CYVA 1LVAA 3GTJJ 2PMZA 2ESHA 3OL4A 2EQRA 4BS9A 4RAFA 1DP3A 1OFCX 1QHGA 1ODDA 2W24A 4PFOA 2CQXA 3CO6C 1UHMA 2K9SA 2LC2A 3QPLA 1B1BA 4ZDPA 6PAXA 3VB2A 1PUFB 1BI0A 3K1NA 4Y7NJ 5CJ9A 3U21A 2MC4A 2IT0A 1RETA 3FBNB 1FP2A 2DBBA 2JN6A 4IOAF 1IXSB 2F5DA 1SEUA 2JSCA 1KU9A 3VOEA 3AL0C 3C2HA 4LG3A 3K4LA 3HJEA 1ZG3A 4P9FA 4WXCA 1SD6A 4XLFA 2ELHA 4BHCA 3DBLB 3VYRB 4LK0F 1FOYA 3GO5A 3D5LA 4JOMA 5F0HA 3Q9SA 4Y4RA 1QVTA 2X4HA 1U6GA 1QVUA 3JAMZ 2OAZA 2CV0A 1P4WA 1Y8QB 5C4XJ 3BR6A 4DYRA 3CMYA 4IVNA 4KFCA 1N77A 4BQAA 2Q0OA 3V7CA 2FMYA 3F8CA 4CCOA 2DFEA 3GLXA 3CMAI 4BHBA 4IO9F 1PUFA 1K83J 3TKYA 1UG0A 1G3SA 1X58A 1E3HA 1ETOA 2ESNA 2QZ8A 4M6YA 5K5RA 1Z6RA 3ZXSA 5M3FJ 4HLXA 4ZJZA 1XS9A 2FSWA 3PJRA 1Z9CA 4HLYA 2PMUA 1Z0XA 2FJ1A 1FT9A 5HLHA 1HDDC 2E36A 3TMOA 2P7CB 2M4GA 3LSRA 2EFNA 2OJED 3BROA 5L3BA 4GFBA 3L00A 1GXPA 1QQIA 3BG6A 3PSIA 3HHGA 2H8WA 3JRHA 3EYYA 5IY5H 4I76A 4UVAA 2W4SA 4AIHA 4I99C 2XPWA 4XORA 1TW3A 2KRFA 3BZ6A 4IQ4A 3RI4A 1R58A 3RJPA 1XCBA 1D8KA 1MW7A 3ELKA 2DCEA 3FWEA 2NNYA 1MBFA 3CDLA 3VYSB 4A69C 2QEXI 3CC4I 5D5XB 1YQAA 3FK6A 3H5AA 3G1MA 3RQ4A 4ETSA 3H9GA 4UNOA 2X85A 3SEZA 1F1ZA 3H92A 1JKOC 2XPVA 2EV0A 2DA2A 2CRGA 5C44J 1BOAA 4KN4X 4LLGF 3JRBA 4AC0A 5M5YJ 5EJCA 4L0YB 2DA7A 1J09A 4IQJA 1V5FA 3K70C 3H9QA 2ZMEB 1BR2A 2BY2A 5IOYA 1MDMB 1QNTA 1YIJI 2ZNZA 2DLLA 3RIRA 3ZQIA 2UXNA 1OCRH 2GWRA 2MLKA 2STWA 3HRSA 4A93J 2GOXB 3OWTA 3BR1A 4XLHA 1O4XA 5CKTA 2DAOA 4HSTA 1GLNA 4UXNA 5HDKA 3D1NI 4Z6YA 2HVQA 3DF8A 4YEJA 1VQMI 1SFEA 1MBGA 1B72A 2CW7A 1E3PA 4WCGA 1K78B 2XVCA 3GXOA 4D0PA 3OS1A 3F22A 3NWSA 1DDNA 5DCMB 5B1BH 2V1UA 3GFJA 3I5UA 2GXGA 4R1HA 4B1RA 2HU9A 2X6XA 3V4GA 1HCRA 3K7AJ 5EEHA 5GP9A 5ICCA 1UCRA 3AG3H 3V7SA 4XQFA 2ZMEA 3MZHA 2V6EA 1MDMA 2FQ3A 5FKKA 4KT6A 3DPLC 1J7KA 2DDAA 2V6CA 4KDPA 1R1TA 4LK1F 1HC8A 2HS5A 3S2HJ 3BZKA 1TC3C 4F7ZA 3F3XA 1I27A 4BJTA 4N0BA 2VIXA 2COMA 1UFMA 1ZHFA 3CCUI 1TZLA 1EV7A 3K1PA 2JZYA 2PX9A 5D6EA 2MABA 1K78A 3A2KA 2VQHA 2W84A 5HVQC 1ZRFA 4QPQA 1MMDA 5DCMA 4LB5A 1ZGWA 4L18B 3FIWA 3O6BB 5FLXK 4BL0B 2LLKA 4EM0B 4HG2A 3LQQA 2ZFWA 3OYJA 5HDGA 2XUBA 1W1WE 4PJLA 5DTDA 3TO9A 2GBYA 4ZTFA 2XF6A 3H1CA 3VFZA 4ABZA 1IC8A 3CP2A 3I53A 2IXSA 3PNYA 5LRSA 3GVAA 1MZBA 2J5PA 1ZELA 2D1HA 4G94A 3WHBA 4B4CA 3CJNA 5M5XJ 3WHCA 1VQ4I 4HEA2 4I09A 1FOXA 2RNGA 3RKXA 2PMZN 3NARA 2RDPA 3JTHA 5CQGA 1A31A 2NYXA 1XGNA 2CQNA 3E0JB 4S0HB 1SAXA 3JR9A 3KP3A 1IRXA 1IV8A 4RS8A 4V2FA 1ETYA 4A0YA 4ZZLA 2CW0F 3R6SA 2PQ8A 2HQRA 5H2FC 2L2OA 2KZVA 4IRHA 2CH0A 3WGHA 5DV5A 1TL8A 2BXZA 2KRHA 1IV6A 2BY1A 3O2PE 5EEAA 2YX4A 4AU7A 5J4YA 2OTJI 2E7WA 4JQFA 1X1AA 3ZN0A 2LDUA 1RPWA 3HM5A 5FLVA 2VI6A 5E3LA 2M0CA 5TGTA 2X9DA 2L9NA 4QIWN 5LHIA 2I8DA 2V1XA 3F8FA 3OL3A 3O3KA 3VDXA 4AWXB 3JRDA 3S17J 4BU2A 4RB0A 5HS8A 1U8RA 2F48A 5HLTA 2NVQJ 1ZK8A 2XDVA 2HGCA 2V7FA 3E7LA 1WPKA 3HB9A 4E7KA 2VKEA 1SAUA 3DTEA 5B1AH 2VXDA 3FHNA 4XRSG 3DV8A 1PUEE 3GTOJ 4FT8A 2YU3A 2OZUA 2QLZA 4NUBA 3FK7A 2AS5F 2YUSA 3ROUA 3BZCA 1KONA 4HX8A 1BC7C 3BTIA 3RYPA 1R22A 5IT9K 3ABTA 4IXAA 4G12A 2IS1A 3OYLA 4RM3A 3EUHC 2XKPA 2DT7B 2M2EA 3QPTA 1VI0A 2TDXA 2L54A 2NVTJ 1S5LC 3H3ZA 3HSEA 2LKXA 2WADA 1ZN2A 3B6AA 4A3FJ 4X0GA 1R36A 1ZTRA 5J1UA 3WE3A 2CW8A 2K9QA 2R7DA 2XAHA 1OCPA 3FXKA 2LTPA 4Y13A 1UELB 3BCAA 4A6DA 2LKSA 3OR1C 1VQ6I 3RZDJ 3JCUC 1Z05A 2OV7A 1X1DA 5J8FA 2M7BA 3CCYA 3ZMZA 4Y3OA 4FCYA 2CUFA 2ZJPF 2XSDC 3S16J 2XB0X 3VYUB 1XMXA 2M34A 2CFXA 1R5GA 3H9JA 1TT5B 1K6YA 2UUZA 1O3QA 1VFCA 3LA7A 3HC7A 1X1PA 1TQIA 3NWTA 1PP7U 4ENKA 1I6XA 2P0WA 3SHFA 5DDGA 1ENHA 2ZXIA 5KCMA 4XOPA 2YX7A 2Y30A 1Z6TA 4RMNA 2CQKA 1O3SA 2B9SA 3A02A 3ECOA 2VQCA 1SFKA 5CVVA 2WAQA 1X2MA 1A5JA 3BJOA 1G3YA 2K85A 3DQVC 1X19A 3TDZC 1WJCA 2X1CA 5K5QA 3IL2A 4UV8A 3HZJA 5HLGA 4PJJA 2ISZA 3RKWA 3H35A 3GTMJ 3RCOA 5HODA 1BI2A 4ZH4F 1P7IA 3R61A 3RKYA 3H5NA 5D5VB 3ONQA 2R7WA 1ETVA 1U2WA 1SD7A 1ZLKA 4LGWA 2CS3A 1HBXG 2XAQA 4ASNA 4I6ZA 4DGWB 2MC3A 4HZFA 3VSLA 2KDZA 2E1OA 1J9IA 4HRIA 1TQPA 4O6JA 5LLQA 4KT5C 4NQWB 4PK4A 5DYMA 4BHPA 3A0HC 1F5TA 2MH2A 2V9KA 3LAJA 4B48A 3FXOA 5K5OA 1AOYA 3NEUA 1IJWC 2LKPA 3PNVA 3MWMA 4ZDLA 2X1DA 3OV8A 4M73A 1XB4A 2L5QA 3CMMA 3F72A 1S72I 2PN6A 1HF0A 4D5FA 3K2AA 1Z3XA 4EATA 2A07F 2JWTA 2K86A 3DFGA 3WG7H 1YI2I 2WTEA 2EZHA 4KIBA 3M4OJ 2DYRH 1TQMA 2DTZA 3M8EA 1GDTA 2VJ5A 4U88A 3JRIA 2CQQA 4GXOA 1YIOA 3HIFA 3U9GA 3QRFF 3LMMA 5TISC 4C2MJ 2KIMA 2M9HA 4RB2C 3E97A 4V2GA 3OYCA 1IUYA 5IP9J 1CQTA 1W36D 3MVPA 2OZ6A 1XGSA 3WTZA 4JX6A 3ASOH 4PJNA 3WTTC 2NXNB 2VQLA 4NQWA 4D9JA 3HSRA 1MJ9A 5E18F 1U3EM 3RZOJ 1D3YA 3KIOA 3MKLA 4YIFA 1WJDA 3IRRA 3DWLE 3BY6A 4FTHA 1WQ2A 2E1MC 4A0ZA 3Q3SA 1R5ID 2OBPA 2DQRA 1NTCA 2DFHA 3FMQA 3IRQA 1K4SA 2OA4A 1C0WA 1ZGAA 4KN7X 3K9TA 2MGQA 1WJBA 2ICWG 1NG6A 2HPMA 1QGPA 2HYGD 2CQ7A 4C3JJ 4F92B 3UR3C 5ILUA 4R8HA 1U0JA 2W48A 1FOWA 2L9VA 4GRIA 3LFKA 2KIFA 2VASA 3K1MA 2ZXHA 4IKFA 1Z3YA 3P5JA 2QCOA 2HTSA 1T56A 5M5WJ 3LSHA 3T8RA 1WSUA 2DO7A 2EK5A 4L9TA 3WTYC 5TRDA 2AQEA 3K6GA 4KIGA 2Y69H 4ITVA 2KQRA 1E17A 4HF1A 3HXLA 1IN8A 5GADJ 2L9SA 1E2XA 2XAFA 3CQZJ 5KAIC 1HLVA 1HXDA 2MW8A 1IDZA 3KEQA 2UXXA 4C9YA 1R00A 2FF4A 1Z1DA 2QKMB 2Z5UA 1JKPC 5F08A 2JTVA 1WHUA 2X6OA 4BE2A 1V55H 5AIPA 2E2IJ 2Y31A 1LNWA 2NS0A 2VBZA 2DT6A 4QLCU 4WWCA 2Q2EB 1GV5A 2Y75A 4M3BA 2BV6A 1L0OC 1MNEA 3LSJA 3AG4H 3P7NA 4HQEA 2QSHX 2HOEA 1TT0A 2DW4A 3PQJA 3NAUA 1HQCA 1YG2A 1JGSA 2HDDA 1EF4A 5BNGA 3C2BA 3KCCA 2Y9YA 1R5HA 2D45A 2KRCA 3MEXA 3ECHA 1QPMA 2X1EA 2A61A 1BL0A 2DODA 1SVLA 1FJLA 3J80Z 1VQ8I 2IGNA 2A05A 1J5YA 2DDBA 3GFLA 3QAHA 3UNGC 3LSKA 5KNLA 3SFZA 1FIPA 2O7OA 2R92J 3HOSA 3HUGB 3I54A 2O61A 4BJ6C 3BR0A 4GYGA 5C3EJ 3V7RA 4RGRA 3W6VA 2F6CA 2NOJB 4HX7A 3SZPA 1UMQA 1UZCA 1JUSA 2P5VA 2P6TA 3GZNB 3SXYA 3DKWA 4MFEA 1G6NA 3S3MA 3BG3A 2L3DA 3K69A 4BXXJ 2LK2A 2Q2EA 3F9KA 2FRHA 3RPUD 1DU6A 5ILSA 2Y0SA 4BQOA 3JRCA 1I5ZA 2TCTA 2R5YB 3OYNA 2Z33A 4HQMA 5B5EC 5KAFC 2IGOA 2GA1A 2VODA 1VQ7I 3GTQJ 2DA4A 3E6CC 2DXIA 1U5TB 4MNUA 2DQLA 4NC7A 4KMFA 3MFKA 3O8HA 3DLLF 4IHYA 1MMGA 1LFUP 2XGXA 2L7ZA 3DU5A 4BACA 4K2EA 1FY7A 3IH4A 3HUGA 3D5RC 2WAQN 3K4NA 2EFOA 2IP2A 3HEFA 1IXRC 1MBJA 5JHFA 1RNLA 4ENMA 2VBXA 3S32A 4GO1A 4A3GJ 3PUFA 2BVMA 1WI9A 1UHSA 3ASNH 3EPZA 3KP7A 3CD6I 1Y8RB 3AFHA 4U87A 1Z91A 2DMUA 3I3LA 5LFAA 1GV2A 2R5YA 5FJ8J 1D0XA 3E6MA 1D5VA 4G7ZF 2E5NA 3KP5A 2HQ5A 1K4TA 1KQ8A 2GLOA 2CV2A 4PGGA 3PNTA 5D4RA 1Y0UA 1T08B 1U5TA 5TJJA 5IYCJ 2E1NA 3CCEI 4HDUA 4E7LA 1Q1HA 2A69F 2UZKA 2VJ4A 3PFIA 1M1EB 4I7HA 3L09A 4DQ2A 3RPUA 4E4HA 2E71A 3GBGA 2F5FA 5ILVA 4BQNA 1IZ1A 3J81Z 4LLNA 2WY8Q 5LGNA 5GPCA 2DMPA 2F5VA 2H6CA 2XIGA 2CFOA 3BQZA 3HGGA 5F6FA 4FASD 2X6WA 2FNPA 2JRTA 2KL4A 3B6CA 1DU0A 2O8KA 1XC5A 2E7XA 1V3FA 2K9LA 4IZZA 1P7JA 1R4MB 2LNBA 3K0LA 2LRDA 4OAZA 5DS9A 2R7ZJ 4AYBN 2LY1A 3DKYA 3PIOF 1PP8F 1WH5A 2G0EA 2PG4A 4ZYGA 1X2NA 2HVRA 2E2HJ 5E1XA 2B7EA 1ETQA 3LSGA 3OYHA 1NG7A 1XX5A 2D2WA 4YIRX 5E8GA 3L2UA 2JPBA 4B44A 1S29A 4B43A 9ANTA 1A35A 2ME0A 2BHZA 2MBFA 2E2JJ 2QF7A 4BBRJ 2CSOA 2DA6A 1QRYA 2FOKA 1D0YA 3CCSI 1EJ9A 3Q5FA 4XKBA 3M8FA 1R1VA 2OTLI 4M3EA 2WY7Q 4U7BA 1YJNI 5CVRA 2R7XA 1IF1A 1LJ9A 1SMTA 4IHSA 2ECCA 4RLQA 4FX4A 4HNVA 2ZBKA 2HEOA 4GCVA 2QA4I 4NBQA 1HA8A 4JYKA 4KUMA 5IOZA 1MH4A 1S8NA 1MMAA 2H6BA 3JAMK 3VWBA 4UHTA 3QQAA 1B4AA 3S2DJ 1LEAA 3HYIA 1LEBA 4ZZDA 1PDNC 3CJRB 2M4KA 1LFBA 5LEKA 5HLIA 2IW5A 3MN2A 3WE2A 3S1RJ 1TP4A 3T1BA 2OQRA 1IW7F 4XN0A 2WBMA 4L9NA 2MSYA 5BMZA 3S15J 4B09A 3TW7A 4II3A 1WJFA 2FBKA 5FRNA 4ZYAA 4LD5A 1BM9A 2Q1ZB 4E7IA 2NVYJ 2UV1A 2E5ZA 2LSOA 2CGPA 2XKOA 2KLOA 2KPMA 3TEDA 4HF0A 3FM3A 4QPOA 4XONA 3AAFA 1BI3A 2R3SA 2FU4A 3ABKH 3Q0WA 1JT6A 1WZ2A 1TWGJ 1S9HA 2JSPA 5JHUA 4ZC3A 2P4WA 2LD5A 4KISA 1OR7C 2A6TA 3I4MJ 1ZRDA 3A1YA 1S6LA 1GUUA 3SQNA 2HKXA 4M71A 2E60A 2FE3A 1ZAOA 2HWVA 3K4CA 2LVSA 3T8TA 5DCFA 5F1JA 5JI6A 4HA8A 3E6DA 4CZZA 3J7AY 1I6HJ 1POGA 3ZOBA 5FKNA 4XLEA 5J1YA 4XN3A 1IAWA 2VKHA 3GF2A 3F8MA 1P4AA 5HS7A 1R7JA 3M3YJ 2VJJA 2HZTA 2ZKZA 1JJ6C 2FXAA 2L01A 3REOA 1K6OA 1WJAA 3LFUA 2XRLA 3BG9A 3PL8A 2OCCH 1FSEA 3E3VA 3LOCA 4Y33A 5FB2A 2N8GA 3OYAA 1QU3A 5FD6A 2DMTA 2HDCA 3R0AA 4M3FA 3DPUA 1ZR2A 2ME6A 3MKWB 1KA8A 3QYBA 3G3ZA 3OR2C 5F64A 3BPVA 1BW6A 3GZ6A 4BDZA 1I1GA 1DP7P 2IJLA 2XGDA 4XRSA 4YFKF 3HOTA 3M8JA 2V79A 3JW4A 4IF4A 4MTEA 3S3OA 2CUEA 3W6JB 4XLCA 1OMIA 3RKQA 2R7TA 2EV5A 1JT0A 3JRAA 2VC0A 2HQNA 1F36A 4G6QA 2BOLA 3L9FA 3DEWA 2E1CA 2HR3A 1SD5A 4A3DJ 4PGHA 1W0TA 3IWFA 1G2HA 2JT1A 5FKLA 3J7AO 5LD2C 5JLXA 4BEHB 2H8RA 3CP8A 3HRUA 1U9OA 2BHYA 4HNTA 4KNYA 2VPLA 1FTZA 2A5YB 5E3MA 1KYZA 1JKRC 2HNHA 3PM1A 2STTA 2Y0SN 1RRJA 1JUMA 2R5ZB 3AL0B 4JBAA 5FLXZ 1CF7B 4XLAA 3W3CA 4JX4A 1H0MA 4HYEA 5EZGA 4ESFA 5J6XA 1G8XA 2JMWA 4XLPF 2FBIA 1WJ5A 1OISA 4A12A 3QYFA 4DOZA 1WJEA 2K40A 4NC8A 3CO7C 4AVZA 2WA0A 4IL6C 2VL8A 4MIMA 2JK3A 3JREA 3S2WA 2QQ9A 3F8NA 2W1OA 1T33A 3ZMVA 4I0AA 4XNFA 4RB3C 2ZSHB 3MMYB 2QYOA 1YOVB 1J2XA 1WH7A 4XMYA 5DD4A 4BEHA 2Z9OA 4YFXF 1F4KA 1I1SA 1ZG5A 4PJ0C 5L3FA 4U7DA 2P81A 3RQIA 1IG7A 4CA0A 3H0DA 4EM1A 1APLC 5H6QA 2R5ZA 2WV1A 1BIBA 1T39A 1CF7A 3IH3A 3QU6A 3IWZA 1VQ5I 3TOBA 1ZQ3P 2IGKA 2Z1DA 3ZMUA 2EZKA 1WCMJ 2OF7A 1H8AC 3E6BA 1D5YA 3DP7A 4FISA 1MSFC 1B59A 3WODF 2L4AA 1X3UA 1FPQA 1RC9A 1KGSA 4XKVA 4UUTA 3ZQLA 1JJ8C 4D5CA 4BYYA 3S1NJ 3MZYA 2H1LA 3K70D 4KITB 3CUQC 2EINH 2PJPA 1N75A 3KETA 3S3NA 1XSXA 4HF2A 4WXDA 1SMYF 2F4MB 3C18A 1J75A 2XC7A 4MO7A 1VQLI 4DYQA 4ANJA 3HOXJ 3ZQFA 5IT9Z 4NC6A 2R7UA 1U78A 3DCFA 2CU7A 3M1EA 3K2ZA 2ZXJA 3GW2A 3E1SA 1RUNA 4ESBA 2GZWA 2OD5A 5D6FA 1T0FC 5LGTA 1P4XA 4EJOA 2GQQA 2OPTA 2HYFA 1YJ9I 4XICA 5KVRA 3WTUC 1KQ0A 3MD2A 3CCMI 2XV4S 3I55I 4LJZF 2VKVA 3FX3A 1IGNA 4G9YA 3CUOA 4XLNF 2HOSA 3DLAA 3R0JA 1MMNA 3EQLF 4BY7J 5H20A 2G7HA 2P7VB 3GTGJ 5GAGJ 2ELJA 4YG2F 2JRMA 5FGMA 3OSGA 1J0RA 2F4OB 3C3WA 3WGGA 1XGOA 1FYMA 4P55A 1ETWA 3GTLJ 2DJIA 1P2FA 1REPC 1DQUA 1GXQA 4LMYA 3SZGA 4CSWA 3CJQB 3FXQA 4Q4ZF 1Y0NA 1SFOJ 1JUPA 1OKRA 3CF2A 3T0YA 5CVIA 3ULQB 4IJAA 2F2EA 1K7AA 2B0LA 4XIDA 4D7MA 2A68F 2VE8A 3G1OA 4WF2A 3CMEI 4IRIA 1ON2A 3OIOA 4DNCA 1IN7A 2DYSH 3I71A 4NB5A 2EFQA 3TDUC 2D5VA 2D1VA 4HOBA 1R49A 4C2UA 4XR6A 2Y9ZA 1T38A 5FD5A 3SYTA 4DBQA 1E0EA 5EEGA 1BC8C 1TNTA 1WGXA 2P5KA 4UVBA 3FZVA 2HVSA 2DFFA 3TO7A 2ACJA 3BP8A 4MEXF 3HSFA 1LVKA 2MA3A 1OYWA 1H88C 2AO9A 2X6YA 3BOQA 4M6VA 3HOUJ 5D5WB 2EV6A 3BTJA 3T5XA 1GT0C 3W6KB 3S93A 2HOAA 1BOBA 3FF5A 4IPAA 4GYIA 5D8KB 2P5LC 4EJTA 3Q0UA 1XGMA 2JA2A 2R7FA 4FE4A 5E17F 1FMWA 3CDIA 2IAIA 2LREA 3BQYA 2FX0A 1LE8B 4KIFA 4IHVA 4LIVA 3EYIA 2UWMA 1S7AA 1SFXA 2KT0A 2LR8A 2ECBA 1ZLJA 2X48A 1YHQI 2CUZA 5GPAA 1P92A 5K7HA 5BPIA 4IEJA 5GTHC 2KJBA 2OUMA 1LPQA 5F0CA 2ZNYA 2WB1A 1ZYRF 2BXYA 1LFPA 1RR8C 5AIQA 4A3JJ 4CH7A 2DU9A 3OOUA 1OYIA 5J47A 4A3MJ 2FNAA 2RN7A 4RM2A 4QTRA 3H36A 5E1ZB 3WU0A 3OYMA 2ZJRF 1EA3A 2R7OA 3TGNA 2BY3A 1MSEC 1XG1A 1ZKGA 3V8JA 1DPUA 1R6RA 1BI1A 3CLQA 5BOXA 3F21A 2XAUA 4EGYA 5J8CA 4H0EA 2HKOA 2O9LA 4IHTA 2KISA 4AIKA 4PCQA 1XSDA 2DT5A 3K10A 2W25A 3IUOA 3J7ZI 2ZO4A 2MD5A 2RV8A 1P9QC 2RGVA 3OIPA 2VB6A 3ISPA 4J19A 2K5CA 2OCEA 3A0BC 4CCJA 2P6SA 1FWZA 3WU1B 4EQQA 2JQ7A 3IKVA 4J01A 2QQBA 2HI3A 4AD9A 2QKLB 4XKCA 1KU7A 2MYSA 1OCCH 4MEYF 4HV5A 2ZJQF 4X6AJ 1MMSA 4N9HA 2IS4A 1MBEA 1YW8A 1X3ZB 3C2GA 3GTPJ 2BYVE 4AVPA 3V42A 1B6AA 1Z67A 3V8KA 2X0LA 3ZQGA 3WGIA 4WX9A 3JSPA 3ERMA 3FMSA 3BG7A 1ON1A 3QPHA 1BA5A 2EA4A 4D1QA 3I0TA 2IS2A 1ORKA 3BDDA 3UKGA 2EPFA 2FD5A 5E8IA 3KZYA 1FSHA 2VXZA 3CDHA 5A2QK 1W7PD 2XF7A 1Y1WJ 1MNMC 2HDWA 1USTA 1IO2A 2LYCA 2VT2A 5FO5A 1MNDA 2QM3A 3DTIA 5CVJA 3TP0A 1YW9A 2JA6J 3SJMA 1WRJA 3CC2I 3HG9A 4W1UA 4N4NB 3E5QA 2LBFB 2V9VA 4ZYHA 4OAYA 2GXAA 4LIUA 1HOMA 3OMYA 2EIMH 1W7PB 3CJTB 2E35A 2M45A 1G4DA 3PSFA 1ZARA 2VBWA 3EUHA 3F23A 1FTTA 2G7UA 2H1KA 3QOPA 2GOMA 1H9GA 5EZHA 1ETKA 1WWXA 2LG4A 2K3PA 3GZ5A 1XMKA 1V4RA 1A36A 3F6OA 3QP6A 3N4MA 3OS0A 2EZLA 2W82A 4JX5A 4KJZA 1ZG1A 3FXRA 2WV0A 2BY0A 4XSXF 2R7RA 2L02A 3P9CA 3ERED 1W5SA 3HTSB 4W97A 2XHKA 2K27A 3OY9A 2DTRA 3NRVA 1B9MA 5E79C 5F04A 4II2A 4ENNA 1VQKI 3A4CA 3SZTA 4P1WA 4RGUA 4B3AA 1IRZA 2GA2A 3G71I 2LBFA 5E3OA 2K3FA 4EMSA 3G4SI 4A3LJ 3GEZA 1W7PA 4XM3A 3V8LA 4ENJA 4A3BJ 3B02A 3LQRA 4AIJA 1HKQA 2ID6A 5BS6A 3J80K 5FKMA 3QWLA 5IP6A 1XN7A 1TWFJ 4O5VA 4HDVA 3HDDA 1MBKA 2B63J 4UB6C 3DPTA 4EV0A 3QYEA 5LEJA 3OYKA 1MGTA 2NVUB 5M3MJ 4BBSJ 3I4PA 2KIQA 2I5UA 3BTLA 2DA1A 5H6RA 4CZCA 5HDNA 2FMLA 3DBRB 1EKEA 3RYRA 2ZMEC 1YS7A 2QVOA 3DTKA 1SD4A 3GFMA 1BJAA 3OYIA 5D5UB 3KZZA 3KX2A 3CCRI 3AG2H 1N25A 1R4NB 2W57A 2DJNA 4MGRA 1VQ9I 1FX7A 3TOAA 2Q8KA 3ZQ7A 3ZQCA 4R79A 4OMYA 3F8BA 3M7GA 1V5EA 2L0KA 1OCZH 4HX4A 4MFDA 3IHUA 5L3CA 3GTKJ 1D1AA 1FNNA 1IDYA 2HPIA 1DUXC 3OYFA 1MD0A 1JGGA 3ZMSA 4FX0A 2RQQA 2KJCA 1LUJB 2E1MB 5F1RA 1SANA 4C3IJ 1ZRCA 3G1LA 2F5EA 4Z2YA 1ONVA 1QO0D 1OYYA 3MAJA 3E5UA 3ZQQA 1IN6A 1KU2A 5HOOA 2A5WA 2XGCA 2OQGA 1K79A 1O3TA 2RREA 3CCLI 2CMPA 1HW1A 3LA3A 5EGOB 1YO5C 1VQPI 4MLOA 2YS9A 3MQ0A 1YJWI 3KYLA 2L7FP 2HOTA 3ZP5A 1PVEA 3ML6A 3LSTA 3WTVC 1TWCJ 4RBOA 3M1CA 3C1DA 2K7LA 3HRTA 2R7VA 3VSKA 3X2QH 2RVCA 2WB1N 4E7ZA 5IYDJ 3KEOA 1FBUA 4H4KC 2DPUA 2PI0A 4GDFA 2BZTA 4DZJA 2QBYB 1DGRM 3JRFA 4ON0A 1QHHD 4TV7A 3KP6A 3CCJI 1X3WB 1IRFA 1USSA 3OIQA 4BE0A 1LDKB 3ZCOA 3QODA 3CLOA 4XBFA 3KPHA 4D7NA 3GX4X 1S7OA 1VTNC 3B73A 4AIDA 1QZZA 1NK2P 4UUSB 1FZPB 1IXCA 2HFHA 4OWRB 1KYWA 3KLNA 4AUXA 4DBRA 3ZPLA 4BH9A 3LL7A 5FRMA 1MJBA 1UHWA 1X4PA 3SDGA 1HSJA 5EGOA 2FUG2 1Y6IA 5CLSA 3J81K 5KHDA 4PSXA 4V19K 3G2BA 3KFWX 1RI7A 2MH9A 3FXJA 4Y52J 3KYCB 2DMQA 1Z77A 5JVGF 3D0SA 3KEYA 1K61A 1NHAA 1X1BA 1YRNB 2FEZA 5FKOA 3HGYA 4IHWA 3QU3A 3S1QJ 1PYVA 4MQVA 2RAEA 2QBYA 2R7SA 5J3LA 2XB5A 3EDPA 4L5IA 4RLFA 2IS6A 4C30A 4YRVA 2DOEA 2CWEA 2L9RA 4OINF 2FA5A 3FXMA 1FP1D 1I3AA 2OC6A 4BUPA 2VC1A 2V1NA 5LBQA 3J7YJ 1W4MA 2Z3YA 2NVXJ 2LY9A 4JK1X 1I50J 1XSVA 2MG4A 4UUSA 5EDNA 2VPRA 3BPXA 4LFUA 1OPCA 2BW3B 1JTXA 2BGCA 2EB7A 2XGEA 2M30A 2M3AA 3DXJF 3OS2A 5J4VA 2EIJH 1Z21A 2VJIA 2F5CA 5C4JJ 4YFNF 2LF8A 4ESJA 2MFZA 2YPRA 3OOPA 2AXLA 1B72B 4L0ZB 1VNDA 2ETHA 2ADUA 3S14J 3DEEA 4B47A 1YRNA 4UY8I 2JUGA 2IEKA 2JPCA 3H5RA 4KMUX 4LITA 1ZREA 2XAGA 1F43A 2O03A 2AQFA 4PDKA 1R1UA 4M6XA 3L2VA 2XF5A 2Z16A 3ZQHA 5DD8A 1MBHA 2K02A 3N05A 5F27A 4CCMA 1TNSA 1VF9A 2LP0A 4IHXA 2FOWA 4L5EA 2CO5A 1Q1VA 4BXFA 3IV5A 3L2WA 2JUCA 1J59A 4CYDA 2CUJA 4OMZA 2KIUA 3DEUA 4F55A 3KE2A 2IA2A 1X1CA 2BVLA 3W2VA 1MH3A 2BW3A 2LOOA 3IAS2 2KHMA 1Z7UA 4MHGA 4OOIA 1ITYA 5FLMJ 2G9WA 4BE1A 1FEXA 4Q48A 2CG4A 1EH8A 3LSIA 3FXLA 2COBA 3RDIA 4A3EJ 4YIIA 1QBJA 4FHTA 4M9SA 5CPRB 5DM6F 4FE7A 4X1EA 5DM7F 1D1BA 4RAZA 1XCVA 1IRGA 4EJUA 3OYBA 5E3NA 1W5CC 3FHZA 2VOPA 1TLHB 1RIOH 2JVGA 3KLOA 3R4KA 4RGXA 2QUFA 3CESA 1R9TJ 2PFBA 1YE9A 4A5NA 3BTCA 1LKXA 5D8LB 5ICGA 3E5XA 3TP3A 3BR3A 4I01A 1GVDA 1Y39A 1BIAA 4CICA 2TRTA 3LNQA 3G73A 3AG1H 2M1BA 5J1RA 4G7OF 1JE8A 4CO8A 2CJJA 1SC7A 3ZMTA 3I56I 3K4JA 2QQAA 4F3QA 2KKOA 2R7QA 1YFHA 5EG0B 2YSRA 2XAJA 4M72A 3CF5F 2LFBA 5ERIA 4OIRF 4HW0A 2M8GX 4AM3A 1ZH5A 3ZN1A 1U8BA 2PBIA 4U0WA 3IP4B 1AKHB 2CV1A 2XASA 4B3XA 3P9IA 3L2CA 1T2KA 3FISA 1A6QA 3CZ6A 3QP5A 4A3CJ 3FXUA 1RKTA 5HS9A 2QSFX 2W85A 1L3LA 3I58A 5FROA 4ZDOA 1KQ9A 1E3OC 3BJAA 3I64A 2F4IA 4PUSA 1OCTC 5KK1A 1P6RA 2JA5J 1RR7A 2A6EF 1GVJA 4XRMA 3KZIC 3PO3J 2DFIA 1VQNI 1V5GA 2BBYA 3ZMDA 3CCQI 3KP2A 3K4KA 2H27A 4CCNA 4P5OA 5K1YA 3I9V2 1UJ8A 4MQ9F 4XK4A 3TO6A 2IGMA 3TBIA 4PFPA 2DI3A 4A0XA 1WFXA 2LF7A 5EG0A 4PSWA 4OIQF 3HOVJ 4HSRA 5J40A 2DOAA 3IC7A 4FQGA 1T98A 4E7JA 3P9KA 4UV9A 4LG0B 1YX3A 2AHQA 1UG2A 2IA1A 2DK8A 2DMNA 1JHFA 2O0YA 1QZEA 2ZB9A 1EH7A 4RAGA 3AKZA 3GUDA 2QWWA 1AKHA 1KU3A 2V1DA 2EFWA 3OYDA 4UUVA 3BLYA 2M7AA 1OJLA 2XPUA 3HPGA 3JTGA 5F0FA 1FYKA 1MIJA 3GCMA 3PO2J 5D4SA 3R60A 3FBIB 5BPDA 1STZA 3A03A 4A6EA 1QPIA 2M8EA 1G3TA 1F9NA 1FYLA 4BXUA 3G6EI 1QA6A 4I2OA 4RDUA 1HKTA 1WI3A 1AWCA 3HOZJ 3EUAA 3F0CA 5IP7J 2LMDA 4UB8C 3LWFA 2Y0MA 2XRNA 2XSJC 3PUBA 1W36C 2MLGA 4B8XA 4G7HF 1X4OA 3GWZA 4PZJA 1Z7LA 2EBIA 3HHHA 1XPXA 1G59A 4XL9A 1W5TA 3DKXA 2PJRB 4Y17A 4BNCA 2K4BA 5GAHJ 2LY2A 2QSGX 4P9UA 1R23A 5CQEA 4LG0A 4HBLA 3DBHB 3TL4X 3BJ6A 1YITI 4F91B 5JVTA 3LSPA 2CYYA 2DA3A 4U0YA 1AU7A 4IX7A 3KP4A 5B3SH 3I4NJ 5E1WA 2C6YA 2Y48A 3DU6A 3LAPA 1OR7A 4BJ5C 2JVHA 1LDDA 3ABMH 4L5JA 5ICFA 1TWAJ 4EJWA 1IUFA 4OIPF 2KZGA 2O6GE 3SFIA 5JFRA 2E19A 1ERDA 3ZRGA 2ZXWH 3O8GA 1YTYA 3I59B 1NH3A 4S04A 3RSNA 1MJAA 2WWYA 2QGUA 2KDOA 4MTDA 2R4GA 3VODA 4M3GA 4HPQA 3BC8A 3MKYB 3BR2A 1ZGJA 3GLLA 2NS8A 4G6TB 5BQTA 1NK3P 3BWGA 2M5WA 4BKXA 4BQQA 3HKZA 3WTWC 3N97A 1HKSA 1UB9A 1OLTA 2DK5A 4A3KJ 2PJRA 2HTJA 3QPSA 5L3DA 3SEQA 2PEXA 2L4MA 2Y2ZA 1FIAA 4C3HJ 3NQOA 2P8TA 4KA4A 1OCOH 1TTYA 1XMAA 1RUOA 3L2RA 3FMRA 5AONA 2EJRA 3M07A 5IPAA 2NS7A 1D1CA 4GGGA 2FQ4A 1VZ0A 1YYVA 4QWQA 5K7ZA 4XKWA 5HNFA 2HXOA 2L7KA 4ZYDA 2VT3A 1BN5A 1FLIA 2VKDA 1YS6A 2EH3A 5LGUA 2KFDA 2NOGA 3I59A 1LQ1A 1LB2A 5DUKA 3H0GJ 3ABUA 3HOYJ 3MCZA 3VYTB 3PIPF 2PLYA 4BGDA 5HNHA 5IYBJ 4A5MA 2EZIA 3HPHA 4EGZA 3EUKL 2M0MA 2AXTC 4HNUA 1T6SA 1S7EA 4CHUA 4DIQA 2RC4A 3H3VK 2Z2SB 4EEFG 2J5OA 4LLLA 2KMUA 3CC7I 4E6KG 2VLAA 3BCBA 3HOWJ 4I0BA 1HSTA 2WAEA 1RZ4A 3HL2A 4BAYA 3JRGA 2BE5F 2A6HF 4I98B 4RA2A 1KZHA 2ELKA 2EA2A 4NHJA 2NAZA 4JP0A 4OU0A 4M9XA 3WU2C 1U5TC 1LE8A 1OQYA 1CGPA 4HV6A 2MD0A 1V54H 1O7LA 2NNNA 4KYWA 1BJZA 3CUQB 5DEQA 4EJVA 4AYBA 4CCLA 1I39A 2EIKH 3RTRA 1O3RA 2HZDA 3OSFA 1YX5A 1B8IB 2VONA 1XTAA 4RB1A 2ID3A 1ETXA 2IA0A 3JSOA 1GHCA 1O57A 4A3IJ 5DUIA 3FDYA 1Y1VJ 1IN5A 1YW7A 2VBYA 5L3EA 1FOKA 3HTUA 3FKIJ 3S1MJ 2JA7J 3M9AA 1WKMA 2I10A 3ABLH 3U1KA 4CDGA 1HW2A 1YLFA 2ZSIB 4LOCA 4UVCA 1A04A 1AA7A 2LH9A 3BG5A 1SVOA 2R93J 1VQOI 2H09A 3VPRA 3IAM2 4A2UA 1AHDP 2R0QC 3RPQA 5CVUA 1R71A 4PJMA 1U9NA 4DZPA 4L9VA 2IBDA 5A2QZ 2IVMA 4Y15A 4DYCA 3GYHX 3EETA 4J00A 1SVMA 2DN0A 2ISYA 3Q0VA 4F52A 2IRFG 5EYRA 3CUQA 4EVIA 4CXFA 3C7JA 2A3SA 2VUMJ 2EFPA 3CCVI 4E70A 3MKZA 4KICA 1JKQC 4G8XA 4N9IA 1B8IA 1FMVA
chains in the Genus database with same CATH topology
2RQPA 5IT3A 2RNJA 1EH6A 3GFIA 4RAYA 5LHHA 1XDUA 4ZYEA 1ULYA 1XDSA 1BBYA 1T0FA 4LB6B 3TQNA 2QENA 2OU2A 4WXHA 3U2RA 2VOOA 4WK8F 4G6DA 4P96A 2GAUA 3WTSC 3H3UA 2M87A 4XSZF 1FBSA 1G3WA 1O7FA 5JR3A 1TBXA 5LHGA 3L7WA 5ED4A 2WC2A 2VN2A 2O3FA 3WTXC 1IN4A 4I02A 1LDJA 2ZJ2A 5E20A 1B9NA 3F6VA 3HRMA 4M9ZA 3Q9VA 4U0VA 3WG9A 1QZYA 4M74A 5LRRA 3CTAA 4RGSA 2GIVA 4Q47A 4OIOF 4S05A 3LA2A 5L3GA 2BEOA 2Z99A 4L9JA 4IRGA 2VE9A 1XD7A 4HAMA 2GXBA 2YR2A 1S3JA 4EM2A 4CGZA 1D8JA 5FFZA 3COAC 3U1DA 1FBQA 2EWNA 1TW2A 2K4JA 2XROA 4Q5SF 2IPQX 3FM5A 4XRFA 1FC3A 2ZCWA 1H9TA 5FFXA 1MKMA 2FBHA 3IKTA 2RKHA 2DPDA 2NRAC 1JXSA 1DPRA 5ICEA 2H94A 2O8XA 3VEPA 4O3MA 3PQKA 1SFUA 2PMHA 1HW5A 1JHHA 5CYVA 1LVAA 2ESHA 1ODDA 2W24A 3CO6C 1UHMA 6PAXA 1B1BA 3VB2A 1BI0A 3K1NA 5CJ9A 2IT0A 1FP2A 2DBBA 1IXSB 2F5DA 2JSCA 1KU9A 3VOEA 1ZG3A 4P9FA 4WXCA 1SD6A 2ELHA 4BHCA 4LK0F 3GO5A 3D5LA 3Q9SA 2X4HA 1U6GA 3JAMZ 2OAZA 1P4WA 4IVNA 4KFCA 4BQAA 2Q0OA 3V7CA 2FMYA 3F8CA 3GLXA 4BHBA 3TKYA 1G3SA 2ESNA 5K5RA 2QZ8A 4M6YA 1Z6RA 4HLXA 2FSWA 1Z9CA 4HLYA 2PMUA 1FT9A 5HLHA 2P7CB 2EFNA 3BROA 5L3BA 3L00A 1GXPA 1QQIA 3HHGA 3EYYA 4UVAA 4AIHA 1TW3A 2KRFA 3BZ6A 3RI4A 1R58A 3RJPA 1XCBA 1D8KA 3ELKA 2NNYA 3FWEA 5D5XB 1YQAA 4ETSA 4UNOA 1F1ZA 3H92A 2EV0A 1BOAA 4KN4X 4LLGF 4L0YB 2ZMEB 1MDMB 1QNTA 2ZNZA 2DLLA 3RIRA 2UXNA 2GWRA 2MLKA 2STWA 3HRSA 2DAOA 5HDKA 4UXNA 3DF8A 1SFEA 4WCGA 1K78B 2XVCA 3GXOA 4D0PA 3F22A 1DDNA 5DCMB 2V1UA 3GFJA 3I5UA 2GXGA 4R1HA 3V4GA 5EEHA 5ICCA 1UCRA 3V7SA 2ZMEA 3MZHA 1MDMA 2FQ3A 3DPLC 1J7KA 4KDPA 2V6CA 1R1TA 4LK1F 2HS5A 4F7ZA 3F3XA 1I27A 4N0BA 2COMA 1UFMA 1ZHFA 1EV7A 3K1PA 2JZYA 5D6EA 1K78A 2W84A 5HVQC 1ZRFA 5DCMA 4LB5A 4L18B 3O6BB 5FLXK 4EM0B 3LQQA 2ZFWA 5HDGA 2XUBA 3TO9A 3VFZA 3I53A 5LRSA 3GVAA 1MZBA 2J5PA 2D1HA 4G94A 3CJNA 4I09A 3RKXA 2RDPA 3JTHA 2NYXA 1XGNA 1SAXA 3KP3A 4A0YA 4RS8A 4ZZLA 2CW0F 3R6SA 2PQ8A 2HQRA 4IRHA 3WGHA 5DV5A 3O2PE 2YX4A 2E7WA 4JQFA 3ZN0A 2LDUA 5LHIA 2V1XA 3F8FA 3O3KA 4AWXB 4RB0A 5HS8A 1U8RA 2HGCA 3DV8A 1PUEE 4FT8A 2YU3A 2OZUA 2QLZA 2AS5F 3ROUA 4HX8A 1BC7C 3RYPA 1R22A 5IT9K 3ABTA 4IXAA 3QPTA 2XKPA 2TDXA 2L54A 3H3ZA 3HSEA 1ZN2A 1R36A 3WE3A 2XAHA 2R7DA 4Y13A 4A6DA 1Z05A 5J8FA 3ZMZA 2CFXA 1R5GA 1O3QA 3LA7A 1TQIA 1PP7U 4ENKA 1I6XA 3SHFA 5DDGA 2YX7A 1Z6TA 2CQKA 1O3SA 3ECOA 5CVVA 3BJOA 1G3YA 3DQVC 3TDZC 5K5QA 3IL2A 4UV8A 5HLGA 2ISZA 3RKWA 1BI2A 4ZH4F 3R61A 3RKYA 5D5VB 1U2WA 1SD7A 1ZLKA 4LGWA 1HBXG 2XAQA 4ASNA 2MC3A 4HZFA 1J9IA 1TQPA 4O6JA 5LLQA 4KT5C 4BHPA 5DYMA 1F5TA 2MH2A 1AOYA 3LAJA 5K5OA 3NEUA 2LKPA 3MWMA 3OV8A 4M73A 1XB4A 3F72A 2PN6A 2A07F 2K86A 3DFGA 2WTEA 4KIBA 1TQMA 3M8EA 4U88A 4GXOA 1YIOA 3HIFA 3U9GA 3QRFF 2KIMA 4RB2C 3E97A 1IUYA 2OZ6A 1XGSA 3WTZA 3WTTC 4NQWA 3HSRA 1MJ9A 5E18F 1U3EM 1D3YA 4YIFA 3IRRA 3BY6A 1WQ2A 4A0ZA 2OBPA 2DQRA 3FMQA 3IRQA 1C0WA 2OA4A 1ZGAA 4KN7X 3K9TA 1QGPA 2HYGD 5ILUA 4R8HA 3LFKA 2KIFA 3K1MA 2HTSA 3T8RA 1WSUA 2DO7A 2EK5A 4L9TA 3WTYC 5TRDA 4KIGA 1E17A 4HF1A 1IN8A 1E2XA 2XAFA 1HXDA 3KEQA 2UXXA 1R00A 2FF4A 1Z1DA 2Z5UA 2JTVA 5AIPA 1LNWA 2NS0A 2VBZA 4QLCU 4WWCA 2Y75A 2BV6A 1L0OC 3P7NA 4HQEA 2HOEA 2DW4A 3PQJA 1HQCA 1YG2A 1JGSA 3KCCA 1R5HA 2D45A 3MEXA 3ECHA 1QPMA 2A61A 3J80Z 1J5YA 3GFLA 3QAHA 3SFZA 3HOSA 3I54A 2O61A 4GYGA 3V7RA 4RGRA 4HX7A 3SZPA 2P5VA 3SXYA 2P6TA 3DKWA 1G6NA 2L3DA 3K69A 2Q2EA 2FRHA 5ILSA 1I5ZA 2Z33A 4HQMA 2GA1A 2VODA 3E6CC 1U5TB 4MNUA 2DQLA 4KMFA 3MFKA 2XGXA 4K2EA 1FY7A 3HUGA 2EFOA 2IP2A 1IXRC 1RNLA 4ENMA 2VBXA 4GO1A 1WI9A 3KP7A 1Z91A 3E6MA 1D5VA 4G7ZF 3KP5A 1KQ8A 4PGGA 5D4RA 1Y0UA 1U5TA 5TJJA 4HDUA 2E1NA 1Q1HA 2A69F 2UZKA 3PFIA 4I7HA 3L09A 4DQ2A 3RPUA 2F5FA 5ILVA 1IZ1A 3J81Z 4LLNA 5LGNA 2H6CA 2XIGA 5F6FA 2FNPA 2JRTA 2E7XA 1V3FA 2LNBA 3K0LA 1PP8F 2PG4A 4ZYGA 5E1XA 2D2WA 5E8GA 2JPBA 1S29A 2MBFA 2CSOA 2FOKA 3Q5FA 3M8FA 1R1VA 4U7BA 5CVRA 1IF1A 1LJ9A 1SMTA 4IHSA 4FX4A 2ZBKA 2HEOA 4GCVA 4KUMA 1S8NA 2H6BA 3JAMK 4UHTA 1B4AA 1LEAA 3HYIA 1LEBA 4ZZDA 1PDNC 5LEKA 5HLIA 2IW5A 3WE2A 3T1BA 2OQRA 1IW7F 4L9NA 5BMZA 4B09A 2FBKA 4LD5A 1BM9A 2LSOA 2CGPA 2XKOA 4HF0A 3FM3A 3AAFA 1BI3A 2R3SA 2FU4A 5JHUA 2P4WA 1ZRDA 1S6LA 3SQNA 2HKXA 4M71A 2FE3A 1ZAOA 2HWVA 3T8TA 5JI6A 5DCFA 4HA8A 3E6DA 4CZZA 1IAWA 3GF2A 3F8MA 1P4AA 5HS7A 1R7JA 2HZTA 2ZKZA 2FXAA 2L01A 3REOA 1K6OA 1FSEA 3E3VA 5FB2A 5FD6A 2HDCA 3R0AA 1KA8A 3G3ZA 5F64A 3BPVA 3GZ6A 1I1GA 1DP7P 2IJLA 4YFKF 3HOTA 2V79A 3JW4A 4IF4A 4MTEA 3W6JB 1OMIA 2EV5A 2VC0A 2HQNA 4G6QA 2E1CA 3L9FA 2HR3A 1SD5A 4PGHA 3IWFA 2JT1A 3J7AO 3HRUA 4KNYA 2A5YB 1KYZA 2STTA 4JBAA 5FLXZ 1CF7B 1H0MA 4HYEA 4ESFA 5J6XA 4XLPF 2FBIA 4A12A 3CO7C 3S2WA 2QQ9A 3F8NA 3ZMVA 4I0AA 4RB3C 2QYOA 1J2XA 5DD4A 2Z9OA 4YFXF 1F4KA 1I1SA 1ZG5A 5L3FA 4U7DA 4EM1A 5H6QA 1T39A 1BIBA 1CF7A 3QU6A 3IWZA 3TOBA 3ZMUA 3E6BA 3DP7A 1B59A 3WODF 2L4AA 1X3UA 1FPQA 1KGSA 4BYYA 3MZYA 3CUQC 2PJPA 3KETA 1XSXA 4HF2A 4WXDA 1SMYF 3C18A 1J75A 5IT9Z 1U78A 3M1EA 3K2ZA 2ZXJA 3GW2A 1RUNA 4ESBA 2GZWA 2OD5A 5D6FA 5LGTA 1P4XA 4EJOA 2GQQA 2HYFA 5KVRA 3WTUC 1KQ0A 2XV4S 4LJZF 3FX3A 4G9YA 3CUOA 4XLNF 3R0JA 3EQLF 5H20A 2G7HA 2P7VB 4YG2F 5FGMA 1J0RA 3C3WA 3WGGA 1XGOA 1FYMA 4P55A 1P2FA 1REPC 1GXQA 4LMYA 3FXQA 4Q4ZF 1OKRA 3T0YA 5CVIA 3ULQB 4IJAA 2F2EA 1K7AA 2B0LA 2A68F 2VE8A 4WF2A 4IRIA 1ON2A 4DNCA 1IN7A 3I71A 4NB5A 3TDUC 2EFQA 2D1VA 4HOBA 1T38A 5FD5A 5EEGA 1BC8C 1TNTA 2P5KA 4UVBA 3FZVA 3TO7A 2ACJA 3BP8A 4MEXF 3HSFA 2MA3A 1OYWA 3BOQA 5D5WB 2EV6A 3T5XA 3W6KB 5D8KB 4EJTA 3FF5A 4IPAA 2P5LC 4GYIA 1XGMA 5E17F 2R7FA 4KIFA 3EYIA 2UWMA 1S7AA 1SFXA 1ZLJA 1P92A 5BPIA 2KJBA 2ZNYA 1ZYRF 5AIQA 2DU9A 1OYIA 2FNAA 2RN7A 5E1ZB 3WU0A 3TGNA 3V8JA 1DPUA 1BI1A 5BOXA 3F21A 4EGYA 5J8CA 4H0EA 2HKOA 4IHTA 4AIKA 4PCQA 1XSDA 2DT5A 2W25A 2ZO4A 2MD5A 2RV8A 2RGVA 3ISPA 2P6SA 1FWZA 3WU1B 4EQQA 3IKVA 2QQBA 4AD9A 1KU7A 4MEYF 4HV5A 4N9HA 1YW8A 2BYVE 4AVPA 1B6AA 3V8KA 2X0LA 3WGIA 4WX9A 3JSPA 3FMSA 1ON1A 3QPHA 2EA4A 3I0TA 3BDDA 5E8IA 3KZYA 1FSHA 2VXZA 3CDHA 5A2QK 1W7PD 1USTA 2VT2A 5FO5A 2QM3A 5CVJA 1YW9A 1WRJA 3E5QA 2V9VA 4ZYHA 1W7PB 1G4DA 2M45A 1ZARA 2VBWA 3EUHA 3F23A 2G7UA 3QOPA 1H9GA 1WWXA 3GZ5A 1XMKA 1V4RA 3F6OA 3QP6A 3N4MA 1ZG1A 3FXRA 2WV0A 4XSXF 2L02A 3P9CA 3ERED 1W5SA 3HTSB 2XHKA 2K27A 2DTRA 3NRVA 1B9MA 4ENNA 3SZTA 4RGUA 2GA2A 4EMSA 3GEZA 1W7PA 3V8LA 4ENJA 3B02A 3LQRA 4AIJA 1HKQA 5BS6A 3J80K 1XN7A 4O5VA 4HDVA 3DPTA 4EV0A 5LEJA 1MGTA 3I4PA 5H6RA 5HDNA 2FMLA 3RYRA 1YS7A 2QVOA 1SD4A 3GFMA 1BJAA 5D5UB 3KZZA 2W57A 4MGRA 1FX7A 3TOAA 2Q8KA 3ZQ7A 4R79A 4OMYA 3F8BA 3M7GA 5L3CA 4HX4A 3IHUA 1FNNA 1DUXC 1MD0A 3ZMSA 4FX0A 2KJCA 5F1RA 1ZRCA 2F5EA 4Z2YA 3MAJA 1ONVA 1QO0D 1OYYA 3E5UA 1IN6A 1KU2A 5HOOA 2OQGA 1K79A 1O3TA 1HW1A 3LA3A 1YO5C 3MQ0A 3ZP5A 3ML6A 3LSTA 3WTVC 3C1DA 2K7LA 3HRTA 2RVCA 3KEOA 1FBUA 2DPUA 2PI0A 2QBYB 4ON0A 4TV7A 3KP6A 1IRFA 1USSA 1LDKB 3CLOA 4XBFA 3GX4X 1S7OA 1VTNC 3B73A 1QZZA 1FZPB 1IXCA 2HFHA 1KYWA 3KLNA 3ZPLA 4BH9A 1MJBA 1UHWA 1HSJA 5CLSA 3J81K 3KFWX 1RI7A 2MH9A 3D0SA 1NHAA 2FEZA 3QU3A 4MQVA 2QBYA 3EDPA 4L5IA 2CWEA 4OINF 2FA5A 1FP1D 2VC1A 5LBQA 1W4MA 2Z3YA 4JK1X 1XSVA 3BPXA 4LFUA 1OPCA 2EB7A 2BGCA 2M30A 3DXJF 2F5CA 4YFNF 2LF8A 4ESJA 2YPRA 3OOPA 2AXLA 4L0ZB 2ETHA 2ADUA 2JPCA 4KMUX 1ZREA 2XAGA 2O03A 4PDKA 1R1UA 4M6XA 5DD8A 2K02A 1TNSA 2CO5A 1J59A 4CYDA 4OMZA 2KIUA 3DEUA 3KE2A 2IA2A 4MHGA 1Z7UA 4OOIA 2G9WA 4Q48A 2CG4A 1EH8A 3RDIA 4YIIA 1QBJA 4FHTA 4M9SA 4RAZA 1XCVA 1IRGA 4EJUA 3FHZA 2VOPA 1TLHB 1RIOH 3KLOA 3R4KA 4RGXA 2QUFA 2PFBA 4A5NA 5D8LB 5ICGA 3E5XA 4I01A 1BIAA 4CICA 3G73A 2M1BA 4G7OF 1JE8A 4CO8A 3ZMTA 2QQAA 2KKOA 1YFHA 2YSRA 2XAJA 4M72A 5ERIA 4OIRF 4HW0A 1ZH5A 3ZN1A 2PBIA 4U0WA 2XASA 3P9IA 3L2CA 1T2KA 3QP5A 3FXUA 5HS9A 2W85A 1L3LA 3I58A 1KQ9A 3BJAA 3I64A 5KK1A 1P6RA 2A6EF 1GVJA 2DFIA 2BBYA 3ZMDA 3KP2A 2H27A 4P5OA 5K1YA 4MQ9F 3TO6A 2DI3A 4A0XA 2LF7A 4OIQF 3IC7A 1T98A 3P9KA 4UV9A 4LG0B 2IA1A 2DK8A 2O0YA 1JHFA 1EH7A 3GUDA 2QWWA 1KU3A 2V1DA 2EFWA 4UUVA 3JTGA 1FYKA 5D4SA 3R60A 5BPDA 1STZA 4A6EA 2M8EA 1G3TA 1F9NA 1FYLA 4BXUA 4I2OA 1HKTA 1AWCA 3LWFA 2Y0MA 2XRNA 2MLGA 4B8XA 4G7HF 3GWZA 4PZJA 3HHHA 1W5TA 4Y17A 4BNCA 2K4BA 4P9UA 1R23A 4LG0A 4HBLA 3BJ6A 5JVTA 2CYYA 4U0YA 3KP4A 5E1WA 2C6YA 2Y48A 3LAPA 1OR7A 1LDDA 4L5JA 5ICFA 4EJWA 4OIPF 2O6GE 5JFRA 1YTYA 3I59B 4S04A 1MJAA 2WWYA 4MTDA 3VODA 1ZGJA 5BQTA 3BWGA 2M5WA 3WTWC 3N97A 1HKSA 1UB9A 2DK5A 2HTJA 5L3DA 2PEXA 2L4MA 3NQOA 2P8TA 4KA4A 1TTYA 1XMAA 1RUOA 3FMRA 5AONA 2EJRA 4GGGA 1YYVA 4QWQA 4ZYDA 2VT3A 1BN5A 1FLIA 1YS6A 5LGUA 1LQ1A 3I59A 1LB2A 5DUKA 3ABUA 3MCZA 2PLYA 4A5MA 4EGZA 1T6SA 4CHUA 2RC4A 2J5OA 4LLLA 4I0BA 1HSTA 1RZ4A 4BAYA 2BE5F 2A6HF 4I98B 2EA2A 4NHJA 2NAZA 4OU0A 4M9XA 1U5TC 1CGPA 4HV6A 1O7LA 2NNNA 4KYWA 3CUQB 5DEQA 4EJVA 3RTRA 1O3RA 2VONA 4RB1A 2IA0A 3JSOA 1GHCA 1O57A 5DUIA 1IN5A 1YW7A 2VBYA 5L3EA 1FOKA 3HTUA 3M9AA 1WKMA 1HW2A 4CDGA 1YLFA 4UVCA 1A04A 2H09A 4A2UA 3RPQA 5CVUA 4L9VA 5A2QZ 2IVMA 4Y15A 3GYHX 3EETA 2ISYA 2IRFG 3CUQA 4EVIA 4CXFA 3C7JA 2A3SA 2EFPA 4E70A 4KICA 4G8XA 4N9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQP A;  5IT3 A;  2RNJ A;  1EH6 A;  3GFI A;  4RAY A;  5LHH A;  1XDU A;  4ZYE A;  1ULY A;  1XDS A;  1BBY A;  1T0F A;  4LB6 B;  3TQN A;  2QEN A;  2OU2 A;  4WXH A;  3U2R A;  2VOO A;  4WK8 F;  4G6D A;  4P96 A;  2GAU A;  3WTS C;  3H3U A;  2M87 A;  4XSZ F;  1FBS A;  1G3W A;  1O7F A;  5JR3 A;  1TBX A;  5LHG A;  3L7W A;  5ED4 A;  2WC2 A;  2VN2 A;  2O3F A;  3WTX C;  1IN4 A;  4I02 A;  1LDJ A;  2ZJ2 A;  5E20 A;  1B9N A;  3F6V A;  3HRM A;  4M9Z A;  3Q9V A;  4U0V A;  3WG9 A;  1QZY A;  4M74 A;  5LRR A;  3CTA A;  4RGS A;  2GIV A;  4Q47 A;  4OIO F;  4S05 A;  3LA2 A;  5L3G A;  2BEO A;  2Z99 A;  4L9J A;  4IRG A;  2VE9 A;  1XD7 A;  4HAM A;  2GXB A;  2YR2 A;  1S3J A;  4EM2 A;  4CGZ A;  1D8J A;  5FFZ A;  3COA C;  3U1D A;  1FBQ A;  2EWN A;  1TW2 A;  2K4J A;  2XRO A;  4Q5S F;  2IPQ X;  3FM5 A;  4XRF A;  1FC3 A;  2ZCW A;  1H9T A;  5FFX A;  1MKM A;  2FBH A;  3IKT A;  2RKH A;  2DPD A;  2NRA C;  1JXS A;  1DPR A;  5ICE A;  2H94 A;  2O8X A;  3VEP A;  4O3M A;  3PQK A;  1SFU A;  2PMH A;  1HW5 A;  1JHH A;  5CYV A;  1LVA A;  2ESH A;  1ODD A;  2W24 A;  3CO6 C;  1UHM A;  6PAX A;  1B1B A;  3VB2 A;  1BI0 A;  3K1N A;  5CJ9 A;  2IT0 A;  1FP2 A;  2DBB A;  1IXS B;  2F5D A;  2JSC A;  1KU9 A;  3VOE A;  1ZG3 A;  4P9F A;  4WXC A;  1SD6 A;  2ELH A;  4BHC A;  4LK0 F;  3GO5 A;  3D5L A;  3Q9S A;  2X4H A;  1U6G A;  3JAM Z;  2OAZ A;  1P4W A;  4IVN A;  4KFC A;  4BQA A;  2Q0O A;  3V7C A;  2FMY A;  3F8C A;  3GLX A;  4BHB A;  3TKY A;  1G3S A;  2ESN A;  5K5R A;  2QZ8 A;  4M6Y A;  1Z6R A;  4HLX A;  2FSW A;  1Z9C A;  4HLY A;  2PMU A;  1FT9 A;  5HLH A;  2P7C B;  2EFN A;  3BRO A;  5L3B A;  3L00 A;  1GXP A;  1QQI A;  3HHG A;  3EYY A;  4UVA A;  4AIH A;  1TW3 A;  2KRF A;  3BZ6 A;  3RI4 A;  1R58 A;  3RJP A;  1XCB A;  1D8K A;  3ELK A;  2NNY A;  3FWE A;  5D5X B;  1YQA A;  4ETS A;  4UNO A;  1F1Z A;  3H92 A;  2EV0 A;  1BOA A;  4KN4 X;  4LLG F;  4L0Y B;  2ZME B;  1MDM B;  1QNT A;  2ZNZ A;  2DLL A;  3RIR A;  2UXN A;  2GWR A;  2MLK A;  2STW A;  3HRS A;  2DAO A;  5HDK A;  4UXN A;  3DF8 A;  1SFE A;  4WCG A;  1K78 B;  2XVC A;  3GXO A;  4D0P A;  3F22 A;  1DDN A;  5DCM B;  2V1U A;  3GFJ A;  3I5U A;  2GXG A;  4R1H A;  3V4G A;  5EEH A;  5ICC A;  1UCR A;  3V7S A;  2ZME A;  3MZH A;  1MDM A;  2FQ3 A;  3DPL C;  1J7K A;  4KDP A;  2V6C A;  1R1T A;  4LK1 F;  2HS5 A;  4F7Z A;  3F3X A;  1I27 A;  4N0B A;  2COM A;  1UFM A;  1ZHF A;  1EV7 A;  3K1P A;  2JZY A;  5D6E A;  1K78 A;  2W84 A;  5HVQ C;  1ZRF A;  5DCM A;  4LB5 A;  4L18 B;  3O6B B;  5FLX K;  4EM0 B;  3LQQ A;  2ZFW A;  5HDG A;  2XUB A;  3TO9 A;  3VFZ A;  3I53 A;  5LRS A;  3GVA A;  1MZB A;  2J5P A;  2D1H A;  4G94 A;  3CJN A;  4I09 A;  3RKX A;  2RDP A;  3JTH A;  2NYX A;  1XGN A;  1SAX A;  3KP3 A;  4A0Y A;  4RS8 A;  4ZZL A;  2CW0 F;  3R6S A;  2PQ8 A;  2HQR A;  4IRH A;  3WGH A;  5DV5 A;  3O2P E;  2YX4 A;  2E7W A;  4JQF A;  3ZN0 A;  2LDU A;  5LHI A;  2V1X A;  3F8F A;  3O3K A;  4AWX B;  4RB0 A;  5HS8 A;  1U8R A;  2HGC A;  3DV8 A;  1PUE E;  4FT8 A;  2YU3 A;  2OZU A;  2QLZ A;  2AS5 F;  3ROU A;  4HX8 A;  1BC7 C;  3RYP A;  1R22 A;  5IT9 K;  3ABT A;  4IXA A;  3QPT A;  2XKP A;  2TDX A;  2L54 A;  3H3Z A;  3HSE A;  1ZN2 A;  1R36 A;  3WE3 A;  2XAH A;  2R7D A;  4Y13 A;  4A6D A;  1Z05 A;  5J8F A;  3ZMZ A;  2CFX A;  1R5G A;  1O3Q A;  3LA7 A;  1TQI A;  1PP7 U;  4ENK A;  1I6X A;  3SHF A;  5DDG A;  2YX7 A;  1Z6T A;  2CQK A;  1O3S A;  3ECO A;  5CVV A;  3BJO A;  1G3Y A;  3DQV C;  3TDZ C;  5K5Q A;  3IL2 A;  4UV8 A;  5HLG A;  2ISZ A;  3RKW A;  1BI2 A;  4ZH4 F;  3R61 A;  3RKY A;  5D5V B;  1U2W A;  1SD7 A;  1ZLK A;  4LGW A;  1HBX G;  2XAQ A;  4ASN A;  2MC3 A;  4HZF A;  1J9I A;  1TQP A;  4O6J A;  5LLQ A;  4KT5 C;  4BHP A;  5DYM A;  1F5T A;  2MH2 A;  1AOY A;  3LAJ A;  5K5O A;  3NEU A;  2LKP A;  3MWM A;  3OV8 A;  4M73 A;  1XB4 A;  3F72 A;  2PN6 A;  2A07 F;  2K86 A;  3DFG A;  2WTE A;  4KIB A;  1TQM A;  3M8E A;  4U88 A;  4GXO A;  1YIO A;  3HIF A;  3U9G A;  3QRF F;  2KIM A;  4RB2 C;  3E97 A;  1IUY A;  2OZ6 A;  1XGS A;  3WTZ A;  3WTT C;  4NQW A;  3HSR A;  1MJ9 A;  5E18 F;  1U3E M;  1D3Y A;  4YIF A;  3IRR A;  3BY6 A;  1WQ2 A;  4A0Z A;  2OBP A;  2DQR A;  3FMQ A;  3IRQ A;  1C0W A;  2OA4 A;  1ZGA A;  4KN7 X;  3K9T A;  1QGP A;  2HYG D;  5ILU A;  4R8H A;  3LFK A;  2KIF A;  3K1M A;  2HTS A;  3T8R A;  1WSU A;  2DO7 A;  2EK5 A;  4L9T A;  3WTY C;  5TRD A;  4KIG A;  1E17 A;  4HF1 A;  1IN8 A;  1E2X A;  2XAF A;  1HXD A;  3KEQ A;  2UXX A;  1R00 A;  2FF4 A;  1Z1D A;  2Z5U A;  2JTV A;  5AIP A;  1LNW A;  2NS0 A;  2VBZ A;  4QLC U;  4WWC A;  2Y75 A;  2BV6 A;  1L0O C;  3P7N A;  4HQE A;  2HOE A;  2DW4 A;  3PQJ A;  1HQC A;  1YG2 A;  1JGS A;  3KCC A;  1R5H A;  2D45 A;  3MEX A;  3ECH A;  1QPM A;  2A61 A;  3J80 Z;  1J5Y A;  3GFL A;  3QAH A;  3SFZ A;  3HOS A;  3I54 A;  2O61 A;  4GYG A;  3V7R A;  4RGR A;  4HX7 A;  3SZP A;  2P5V A;  3SXY A;  2P6T A;  3DKW A;  1G6N A;  2L3D A;  3K69 A;  2Q2E A;  2FRH A;  5ILS A;  1I5Z A;  2Z33 A;  4HQM A;  2GA1 A;  2VOD A;  3E6C C;  1U5T B;  4MNU A;  2DQL A;  4KMF A;  3MFK A;  2XGX A;  4K2E A;  1FY7 A;  3HUG A;  2EFO A;  2IP2 A;  1IXR C;  1RNL A;  4ENM A;  2VBX A;  4GO1 A;  1WI9 A;  3KP7 A;  1Z91 A;  3E6M A;  1D5V A;  4G7Z F;  3KP5 A;  1KQ8 A;  4PGG A;  5D4R A;  1Y0U A;  1U5T A;  5TJJ A;  4HDU A;  2E1N A;  1Q1H A;  2A69 F;  2UZK A;  3PFI A;  4I7H A;  3L09 A;  4DQ2 A;  3RPU A;  2F5F A;  5ILV A;  1IZ1 A;  3J81 Z;  4LLN A;  5LGN A;  2H6C A;  2XIG A;  5F6F A;  2FNP A;  2JRT A;  2E7X A;  1V3F A;  2LNB A;  3K0L A;  1PP8 F;  2PG4 A;  4ZYG A;  5E1X A;  2D2W A;  5E8G A;  2JPB A;  1S29 A;  2MBF A;  2CSO A;  2FOK A;  3Q5F A;  3M8F A;  1R1V A;  4U7B A;  5CVR A;  1IF1 A;  1LJ9 A;  1SMT A;  4IHS A;  4FX4 A;  2ZBK A;  2HEO A;  4GCV A;  4KUM A;  1S8N A;  2H6B A;  3JAM K;  4UHT A;  1B4A A;  1LEA A;  3HYI A;  1LEB A;  4ZZD A;  1PDN C;  5LEK A;  5HLI A;  2IW5 A;  3WE2 A;  3T1B A;  2OQR A;  1IW7 F;  4L9N A;  5BMZ A;  4B09 A;  2FBK A;  4LD5 A;  1BM9 A;  2LSO A;  2CGP A;  2XKO A;  4HF0 A;  3FM3 A;  3AAF A;  1BI3 A;  2R3S A;  2FU4 A;  5JHU A;  2P4W A;  1ZRD A;  1S6L A;  3SQN A;  2HKX A;  4M71 A;  2FE3 A;  1ZAO A;  2HWV A;  3T8T A;  5JI6 A;  5DCF A;  4HA8 A;  3E6D A;  4CZZ A;  1IAW A;  3GF2 A;  3F8M A;  1P4A A;  5HS7 A;  1R7J A;  2HZT A;  2ZKZ A;  2FXA A;  2L01 A;  3REO A;  1K6O A;  1FSE A;  3E3V A;  5FB2 A;  5FD6 A;  2HDC A;  3R0A A;  1KA8 A;  3G3Z A;  5F64 A;  3BPV A;  3GZ6 A;  1I1G A;  1DP7 P;  2IJL A;  4YFK F;  3HOT A;  2V79 A;  3JW4 A;  4IF4 A;  4MTE A;  3W6J B;  1OMI A;  2EV5 A;  2VC0 A;  2HQN A;  4G6Q A;  2E1C A;  3L9F A;  2HR3 A;  1SD5 A;  4PGH A;  3IWF A;  2JT1 A;  3J7A O;  3HRU A;  4KNY A;  2A5Y B;  1KYZ A;  2STT A;  4JBA A;  5FLX Z;  1CF7 B;  1H0M A;  4HYE A;  4ESF A;  5J6X A;  4XLP F;  2FBI A;  4A12 A;  3CO7 C;  3S2W A;  2QQ9 A;  3F8N A;  3ZMV A;  4I0A A;  4RB3 C;  2QYO A;  1J2X A;  5DD4 A;  2Z9O A;  4YFX F;  1F4K A;  1I1S A;  1ZG5 A;  5L3F A;  4U7D A;  4EM1 A;  5H6Q A;  1T39 A;  1BIB A;  1CF7 A;  3QU6 A;  3IWZ A;  3TOB A;  3ZMU A;  3E6B A;  3DP7 A;  1B59 A;  3WOD F;  2L4A A;  1X3U A;  1FPQ A;  1KGS A;  4BYY A;  3MZY A;  3CUQ C;  2PJP A;  3KET A;  1XSX A;  4HF2 A;  4WXD A;  1SMY F;  3C18 A;  1J75 A;  5IT9 Z;  1U78 A;  3M1E A;  3K2Z A;  2ZXJ A;  3GW2 A;  1RUN A;  4ESB A;  2GZW A;  2OD5 A;  5D6F A;  5LGT A;  1P4X A;  4EJO A;  2GQQ A;  2HYF A;  5KVR A;  3WTU C;  1KQ0 A;  2XV4 S;  4LJZ F;  3FX3 A;  4G9Y A;  3CUO A;  4XLN F;  3R0J A;  3EQL F;  5H20 A;  2G7H A;  2P7V B;  4YG2 F;  5FGM A;  1J0R A;  3C3W A;  3WGG A;  1XGO A;  1FYM A;  4P55 A;  1P2F A;  1REP C;  1GXQ A;  4LMY A;  3FXQ A;  4Q4Z F;  1OKR A;  3T0Y A;  5CVI A;  3ULQ B;  4IJA A;  2F2E A;  1K7A A;  2B0L A;  2A68 F;  2VE8 A;  4WF2 A;  4IRI A;  1ON2 A;  4DNC A;  1IN7 A;  3I71 A;  4NB5 A;  3TDU C;  2EFQ A;  2D1V A;  4HOB A;  1T38 A;  5FD5 A;  5EEG A;  1BC8 C;  1TNT A;  2P5K A;  4UVB A;  3FZV A;  3TO7 A;  2ACJ A;  3BP8 A;  4MEX F;  3HSF A;  2MA3 A;  1OYW A;  3BOQ A;  5D5W B;  2EV6 A;  3T5X A;  3W6K B;  5D8K B;  4EJT A;  3FF5 A;  4IPA A;  2P5L C;  4GYI A;  1XGM A;  5E17 F;  2R7F A;  4KIF A;  3EYI A;  2UWM A;  1S7A A;  1SFX A;  1ZLJ A;  1P92 A;  5BPI A;  2KJB A;  2ZNY A;  1ZYR F;  5AIQ A;  2DU9 A;  1OYI A;  2FNA A;  2RN7 A;  5E1Z B;  3WU0 A;  3TGN A;  3V8J A;  1DPU A;  1BI1 A;  5BOX A;  3F21 A;  4EGY A;  5J8C A;  4H0E A;  2HKO A;  4IHT A;  4AIK A;  4PCQ A;  1XSD A;  2DT5 A;  2W25 A;  2ZO4 A;  2MD5 A;  2RV8 A;  2RGV A;  3ISP A;  2P6S A;  1FWZ A;  3WU1 B;  4EQQ A;  3IKV A;  2QQB A;  4AD9 A;  1KU7 A;  4MEY F;  4HV5 A;  4N9H A;  1YW8 A;  2BYV E;  4AVP A;  1B6A A;  3V8K A;  2X0L A;  3WGI A;  4WX9 A;  3JSP A;  3FMS A;  1ON1 A;  3QPH A;  2EA4 A;  3I0T A;  3BDD A;  5E8I A;  3KZY A;  1FSH A;  2VXZ A;  3CDH A;  5A2Q K;  1W7P D;  1UST A;  2VT2 A;  5FO5 A;  2QM3 A;  5CVJ A;  1YW9 A;  1WRJ A;  3E5Q A;  2V9V A;  4ZYH A;  1W7P B;  1G4D A;  2M45 A;  1ZAR A;  2VBW A;  3EUH A;  3F23 A;  2G7U A;  3QOP A;  1H9G A;  1WWX A;  3GZ5 A;  1XMK A;  1V4R A;  3F6O A;  3QP6 A;  3N4M A;  1ZG1 A;  3FXR A;  2WV0 A;  4XSX F;  2L02 A;  3P9C A;  3ERE D;  1W5S A;  3HTS B;  2XHK A;  2K27 A;  2DTR A;  3NRV A;  1B9M A;  4ENN A;  3SZT A;  4RGU A;  2GA2 A;  4EMS A;  3GEZ A;  1W7P A;  3V8L A;  4ENJ A;  3B02 A;  3LQR A;  4AIJ A;  1HKQ A;  5BS6 A;  3J80 K;  1XN7 A;  4O5V A;  4HDV A;  3DPT A;  4EV0 A;  5LEJ A;  1MGT A;  3I4P A;  5H6R A;  5HDN A;  2FML A;  3RYR A;  1YS7 A;  2QVO A;  1SD4 A;  3GFM A;  1BJA A;  5D5U B;  3KZZ A;  2W57 A;  4MGR A;  1FX7 A;  3TOA A;  2Q8K A;  3ZQ7 A;  4R79 A;  4OMY A;  3F8B A;  3M7G A;  5L3C A;  4HX4 A;  3IHU A;  1FNN A;  1DUX C;  1MD0 A;  3ZMS A;  4FX0 A;  2KJC A;  5F1R A;  1ZRC A;  2F5E A;  4Z2Y A;  3MAJ A;  1ONV A;  1QO0 D;  1OYY A;  3E5U A;  1IN6 A;  1KU2 A;  5HOO A;  2OQG A;  1K79 A;  1O3T A;  1HW1 A;  3LA3 A;  1YO5 C;  3MQ0 A;  3ZP5 A;  3ML6 A;  3LST A;  3WTV C;  3C1D A;  2K7L A;  3HRT A;  2RVC A;  3KEO A;  1FBU A;  2DPU A;  2PI0 A;  2QBY B;  4ON0 A;  4TV7 A;  3KP6 A;  1IRF A;  1USS A;  1LDK B;  3CLO A;  4XBF A;  3GX4 X;  1S7O A;  1VTN C;  3B73 A;  1QZZ A;  1FZP B;  1IXC A;  2HFH A;  1KYW A;  3KLN A;  3ZPL A;  4BH9 A;  1MJB A;  1UHW A;  1HSJ A;  5CLS A;  3J81 K;  3KFW X;  1RI7 A;  2MH9 A;  3D0S A;  1NHA A;  2FEZ A;  3QU3 A;  4MQV A;  2QBY A;  3EDP A;  4L5I A;  2CWE A;  4OIN F;  2FA5 A;  1FP1 D;  2VC1 A;  5LBQ A;  1W4M A;  2Z3Y A;  4JK1 X;  1XSV A;  3BPX A;  4LFU A;  1OPC A;  2EB7 A;  2BGC A;  2M30 A;  3DXJ F;  2F5C A;  4YFN F;  2LF8 A;  4ESJ A;  2YPR A;  3OOP A;  2AXL A;  4L0Z B;  2ETH A;  2ADU A;  2JPC A;  4KMU X;  1ZRE A;  2XAG A;  2O03 A;  4PDK A;  1R1U A;  4M6X A;  5DD8 A;  2K02 A;  1TNS A;  2CO5 A;  1J59 A;  4CYD A;  4OMZ A;  2KIU A;  3DEU A;  3KE2 A;  2IA2 A;  4MHG A;  1Z7U A;  4OOI A;  2G9W A;  4Q48 A;  2CG4 A;  1EH8 A;  3RDI A;  4YII A;  1QBJ A;  4FHT A;  4M9S A;  4RAZ A;  1XCV A;  1IRG A;  4EJU A;  3FHZ A;  2VOP A;  1TLH B;  1RIO H;  3KLO A;  3R4K A;  4RGX A;  2QUF A;  2PFB A;  4A5N A;  5D8L B;  5ICG A;  3E5X A;  4I01 A;  1BIA A;  4CIC A;  3G73 A;  2M1B A;  4G7O F;  1JE8 A;  4CO8 A;  3ZMT A;  2QQA A;  2KKO A;  1YFH A;  2YSR A;  2XAJ A;  4M72 A;  5ERI A;  4OIR F;  4HW0 A;  1ZH5 A;  3ZN1 A;  2PBI A;  4U0W A;  2XAS A;  3P9I A;  3L2C A;  1T2K A;  3QP5 A;  3FXU A;  5HS9 A;  2W85 A;  1L3L A;  3I58 A;  1KQ9 A;  3BJA A;  3I64 A;  5KK1 A;  1P6R A;  2A6E F;  1GVJ A;  2DFI A;  2BBY A;  3ZMD A;  3KP2 A;  2H27 A;  4P5O A;  5K1Y A;  4MQ9 F;  3TO6 A;  2DI3 A;  4A0X A;  2LF7 A;  4OIQ F;  3IC7 A;  1T98 A;  3P9K A;  4UV9 A;  4LG0 B;  2IA1 A;  2DK8 A;  2O0Y A;  1JHF A;  1EH7 A;  3GUD A;  2QWW A;  1KU3 A;  2V1D A;  2EFW A;  4UUV A;  3JTG A;  1FYK A;  5D4S A;  3R60 A;  5BPD A;  1STZ A;  4A6E A;  2M8E A;  1G3T A;  1F9N A;  1FYL A;  4BXU A;  4I2O A;  1HKT A;  1AWC A;  3LWF A;  2Y0M A;  2XRN A;  2MLG A;  4B8X A;  4G7H F;  3GWZ A;  4PZJ A;  3HHH A;  1W5T A;  4Y17 A;  4BNC A;  2K4B A;  4P9U A;  1R23 A;  4LG0 A;  4HBL A;  3BJ6 A;  5JVT A;  2CYY A;  4U0Y A;  3KP4 A;  5E1W A;  2C6Y A;  2Y48 A;  3LAP A;  1OR7 A;  1LDD A;  4L5J A;  5ICF A;  4EJW A;  4OIP F;  2O6G E;  5JFR A;  1YTY A;  3I59 B;  4S04 A;  1MJA A;  2WWY A;  4MTD A;  3VOD A;  1ZGJ A;  5BQT A;  3BWG A;  2M5W A;  3WTW C;  3N97 A;  1HKS A;  1UB9 A;  2DK5 A;  2HTJ A;  5L3D A;  2PEX A;  2L4M A;  3NQO A;  2P8T A;  4KA4 A;  1TTY A;  1XMA A;  1RUO A;  3FMR A;  5AON A;  2EJR A;  4GGG A;  1YYV A;  4QWQ A;  4ZYD A;  2VT3 A;  1BN5 A;  1FLI A;  1YS6 A;  5LGU A;  1LQ1 A;  3I59 A;  1LB2 A;  5DUK A;  3ABU A;  3MCZ A;  2PLY A;  4A5M A;  4EGZ A;  1T6S A;  4CHU A;  2RC4 A;  2J5O A;  4LLL A;  4I0B A;  1HST A;  1RZ4 A;  4BAY A;  2BE5 F;  2A6H F;  4I98 B;  2EA2 A;  4NHJ A;  2NAZ A;  4OU0 A;  4M9X A;  1U5T C;  1CGP A;  4HV6 A;  1O7L A;  2NNN A;  4KYW A;  3CUQ B;  5DEQ A;  4EJV A;  3RTR A;  1O3R A;  2VON A;  4RB1 A;  2IA0 A;  3JSO A;  1GHC A;  1O57 A;  5DUI A;  1IN5 A;  1YW7 A;  2VBY A;  5L3E A;  1FOK A;  3HTU A;  3M9A A;  1WKM A;  1HW2 A;  4CDG A;  1YLF A;  4UVC A;  1A04 A;  2H09 A;  4A2U A;  3RPQ A;  5CVU A;  4L9V A;  5A2Q Z;  2IVM A;  4Y15 A;  3GYH X;  3EET A;  2ISY A;  2IRF G;  3CUQ A;  4EVI A;  4CXF A;  3C7J A;  2A3S A;  2EFP A;  4E70 A;  4KIC A;  4G8X A;  4N9I A; 
#chains in the Genus database with same CATH topology
 2RQP A;  5IT3 A;  4IOC F;  2RNJ A;  1EH6 A;  3GFI A;  4RAY A;  3ZR8 X;  2K9M A;  3A01 B;  1TWH J;  5LHH A;  3PFY A;  4E7H A;  1XDU A;  4ZYE A;  1ULY A;  1XDS A;  2DA5 A;  1BBY A;  1T0F A;  4LB6 B;  3TQN A;  3TW6 A;  2ZC2 A;  3GME A;  4NDL A;  2QEN A;  2V9P A;  3W2A A;  2OU2 A;  3QOE A;  4WXH A;  3U2R A;  2VOO A;  3K4M A;  4C2T A;  1A6I A;  4WK8 F;  4G6D A;  1RES A;  4P96 A;  3IH2 A;  2GAU A;  1BR4 A;  4N4O B;  3BT9 A;  4QSH A;  3WTS C;  2DOF A;  3H3U A;  2M87 A;  2W00 A;  2GIZ A;  3ESW B;  1FBS A;  4XSZ F;  4CYC B;  1G3W A;  3S8P A;  2QQ8 A;  1O7F A;  5JR3 A;  5EF6 A;  2V26 A;  1ACI A;  1TBX A;  5LHG A;  2HYJ A;  3L7W A;  3OYG A;  5ED4 A;  2WC2 A;  2VN2 A;  2O3F A;  3WTX C;  2E34 A;  1IN4 A;  4I02 A;  1LDJ A;  2ZJ2 A;  3L2Q A;  5E20 A;  1B9N A;  5GAE J;  4DW6 A;  3F6V A;  3HRM A;  1RKW A;  2V4J C;  4M9Z A;  2VQG A;  3Q9V A;  1BR1 A;  4U0V A;  3WG9 A;  1Y56 A;  3ZGK A;  3A01 A;  4FET A;  3MZ8 A;  1QZY A;  4NNJ A;  4M74 A;  5LRR A;  3CTA A;  1HDP A;  4RGS A;  4BDY A;  2GIV A;  5JLW A;  2X51 A;  1JI8 A;  4Q47 A;  4OIO F;  4S05 A;  3LA2 A;  3K4B A;  5L3G A;  1JTY A;  1T95 A;  2BEO A;  1WVR A;  2K9N A;  3KYD B;  4E7S A;  1D0Z A;  2Z99 A;  4L9J A;  2HQA A;  1H89 C;  2JJ7 A;  4IRG A;  4CYC A;  2JA8 J;  2VE9 A;  2WAF A;  1XD7 A;  4HAM A;  2GXB A;  2YR2 A;  1N78 A;  4XOT A;  1S3J A;  2HXI A;  4EM2 A;  2KP6 A;  4CGZ A;  5K7F A;  1T8I A;  5GTI C;  1D8J A;  5FFZ A;  3COA C;  3U1D A;  1FBQ A;  2EWN A;  1PJR A;  1TW2 A;  2EIL H;  2K4J A;  1UAA A;  2YU9 J;  2XRO A;  4F93 B;  3SDB A;  4Q5S F;  2L7M P;  2IPQ X;  3W2W A;  4YEL A;  1W0U A;  3L1P A;  2GM4 A;  4M3D A;  3LSM A;  2ZFU A;  3HKZ N;  3BR5 A;  3D5S C;  3FM5 A;  4XRF A;  1FC3 A;  2ZCW A;  1H9T A;  5FFX A;  1MKM A;  2FBH A;  3IKT A;  1BW5 A;  1ZR4 A;  4BY1 J;  4CUG A;  3OYE A;  2O5R A;  2RKH A;  3FKJ A;  4DJA A;  5B66 C;  2DPD A;  2NRA C;  1I3Q J;  4ZTJ A;  1DPR A;  1JXS A;  2H94 A;  2O8X A;  3HBL A;  3VEP A;  5ICE A;  4O3M A;  3PQK A;  1SFU A;  2PMH A;  1HW5 A;  4CCK A;  1DGW Y;  1JHH A;  2W7N A;  5CYV A;  1LVA A;  3GTJ J;  2PMZ A;  2ESH A;  3OL4 A;  2EQR A;  4BS9 A;  4RAF A;  1DP3 A;  1OFC X;  1QHG A;  1ODD A;  2W24 A;  4PFO A;  2CQX A;  3CO6 C;  1UHM A;  2K9S A;  2LC2 A;  3QPL A;  1B1B A;  4ZDP A;  6PAX A;  3VB2 A;  1PUF B;  1BI0 A;  3K1N A;  4Y7N J;  5CJ9 A;  3U21 A;  2MC4 A;  2IT0 A;  1RET A;  3FBN B;  1FP2 A;  2DBB A;  2JN6 A;  4IOA F;  1IXS B;  2F5D A;  1SEU A;  2JSC A;  1KU9 A;  3VOE A;  3AL0 C;  3C2H A;  4LG3 A;  3K4L A;  3HJE A;  1ZG3 A;  4P9F A;  4WXC A;  1SD6 A;  4XLF A;  2ELH A;  4BHC A;  3DBL B;  3VYR B;  4LK0 F;  1FOY A;  3GO5 A;  3D5L A;  4JOM A;  5F0H A;  3Q9S A;  4Y4R A;  1QVT A;  2X4H A;  1U6G A;  1QVU A;  3JAM Z;  2OAZ A;  2CV0 A;  1P4W A;  1Y8Q B;  5C4X J;  3BR6 A;  4DYR A;  3CMY A;  4IVN A;  4KFC A;  1N77 A;  4BQA A;  2Q0O A;  3V7C A;  2FMY A;  3F8C A;  4CCO A;  2DFE A;  3GLX A;  3CMA I;  4BHB A;  4IO9 F;  1PUF A;  1K83 J;  3TKY A;  1UG0 A;  1G3S A;  1X58 A;  1E3H A;  1ETO A;  2ESN A;  2QZ8 A;  4M6Y A;  5K5R A;  1Z6R A;  3ZXS A;  5M3F J;  4HLX A;  4ZJZ A;  1XS9 A;  2FSW A;  3PJR A;  1Z9C A;  4HLY A;  2PMU A;  1Z0X A;  2FJ1 A;  1FT9 A;  5HLH A;  1HDD C;  2E36 A;  3TMO A;  2P7C B;  2M4G A;  3LSR A;  2EFN A;  2OJE D;  3BRO A;  5L3B A;  4GFB A;  3L00 A;  1GXP A;  1QQI A;  3BG6 A;  3PSI A;  3HHG A;  2H8W A;  3JRH A;  3EYY A;  5IY5 H;  4I76 A;  4UVA A;  2W4S A;  4AIH A;  4I99 C;  2XPW A;  4XOR A;  1TW3 A;  2KRF A;  3BZ6 A;  4IQ4 A;  3RI4 A;  1R58 A;  3RJP A;  1XCB A;  1D8K A;  1MW7 A;  3ELK A;  2DCE A;  3FWE A;  2NNY A;  1MBF A;  3CDL A;  3VYS B;  4A69 C;  2QEX I;  3CC4 I;  5D5X B;  1YQA A;  3FK6 A;  3H5A A;  3G1M A;  3RQ4 A;  4ETS A;  3H9G A;  4UNO A;  2X85 A;  3SEZ A;  1F1Z A;  3H92 A;  1JKO C;  2XPV A;  2EV0 A;  2DA2 A;  2CRG A;  5C44 J;  1BOA A;  4KN4 X;  4LLG F;  3JRB A;  4AC0 A;  5M5Y J;  5EJC A;  4L0Y B;  2DA7 A;  1J09 A;  4IQJ A;  1V5F A;  3K70 C;  3H9Q A;  2ZME B;  1BR2 A;  2BY2 A;  5IOY A;  1MDM B;  1QNT A;  1YIJ I;  2ZNZ A;  2DLL A;  3RIR A;  3ZQI A;  2UXN A;  1OCR H;  2GWR A;  2MLK A;  2STW A;  3HRS A;  4A93 J;  2GOX B;  3OWT A;  3BR1 A;  4XLH A;  1O4X A;  5CKT A;  2DAO A;  4HST A;  1GLN A;  4UXN A;  5HDK A;  3D1N I;  4Z6Y A;  2HVQ A;  3DF8 A;  4YEJ A;  1VQM I;  1SFE A;  1MBG A;  1B72 A;  2CW7 A;  1E3P A;  4WCG A;  1K78 B;  2XVC A;  3GXO A;  4D0P A;  3OS1 A;  3F22 A;  3NWS A;  1DDN A;  5DCM B;  5B1B H;  2V1U A;  3GFJ A;  3I5U A;  2GXG A;  4R1H A;  4B1R A;  2HU9 A;  2X6X A;  3V4G A;  1HCR A;  3K7A J;  5EEH A;  5GP9 A;  5ICC A;  1UCR A;  3AG3 H;  3V7S A;  4XQF A;  2ZME A;  3MZH A;  2V6E A;  1MDM A;  2FQ3 A;  5FKK A;  4KT6 A;  3DPL C;  1J7K A;  2DDA A;  2V6C A;  4KDP A;  1R1T A;  4LK1 F;  1HC8 A;  2HS5 A;  3S2H J;  3BZK A;  1TC3 C;  4F7Z A;  3F3X A;  1I27 A;  4BJT A;  4N0B A;  2VIX A;  2COM A;  1UFM A;  1ZHF A;  3CCU I;  1TZL A;  1EV7 A;  3K1P A;  2JZY A;  2PX9 A;  5D6E A;  2MAB A;  1K78 A;  3A2K A;  2VQH A;  2W84 A;  5HVQ C;  1ZRF A;  4QPQ A;  1MMD A;  5DCM A;  4LB5 A;  1ZGW A;  4L18 B;  3FIW A;  3O6B B;  5FLX K;  4BL0 B;  2LLK A;  4EM0 B;  4HG2 A;  3LQQ A;  2ZFW A;  3OYJ A;  5HDG A;  2XUB A;  1W1W E;  4PJL A;  5DTD A;  3TO9 A;  2GBY A;  4ZTF A;  2XF6 A;  3H1C A;  3VFZ A;  4ABZ A;  1IC8 A;  3CP2 A;  3I53 A;  2IXS A;  3PNY A;  5LRS A;  3GVA A;  1MZB A;  2J5P A;  1ZEL A;  2D1H A;  4G94 A;  3WHB A;  4B4C A;  3CJN A;  5M5X J;  3WHC A;  1VQ4 I;  4HEA 2;  4I09 A;  1FOX A;  2RNG A;  3RKX A;  2PMZ N;  3NAR A;  2RDP A;  3JTH A;  5CQG A;  1A31 A;  2NYX A;  1XGN A;  2CQN A;  3E0J B;  4S0H B;  1SAX A;  3JR9 A;  3KP3 A;  1IRX A;  1IV8 A;  4RS8 A;  4V2F A;  1ETY A;  4A0Y A;  4ZZL A;  2CW0 F;  3R6S A;  2PQ8 A;  2HQR A;  5H2F C;  2L2O A;  2KZV A;  4IRH A;  2CH0 A;  3WGH A;  5DV5 A;  1TL8 A;  2BXZ A;  2KRH A;  1IV6 A;  2BY1 A;  3O2P E;  5EEA A;  2YX4 A;  4AU7 A;  5J4Y A;  2OTJ I;  2E7W A;  4JQF A;  1X1A A;  3ZN0 A;  2LDU A;  1RPW A;  3HM5 A;  5FLV A;  2VI6 A;  5E3L A;  2M0C A;  5TGT A;  2X9D A;  2L9N A;  4QIW N;  5LHI A;  2I8D A;  2V1X A;  3F8F A;  3OL3 A;  3O3K A;  3VDX A;  4AWX B;  3JRD A;  3S17 J;  4BU2 A;  4RB0 A;  5HS8 A;  1U8R A;  2F48 A;  5HLT A;  2NVQ J;  1ZK8 A;  2XDV A;  2HGC A;  2V7F A;  3E7L A;  1WPK A;  3HB9 A;  4E7K A;  2VKE A;  1SAU A;  3DTE A;  5B1A H;  2VXD A;  3FHN A;  4XRS G;  3DV8 A;  1PUE E;  3GTO J;  4FT8 A;  2YU3 A;  2OZU A;  2QLZ A;  4NUB A;  3FK7 A;  2AS5 F;  2YUS A;  3ROU A;  3BZC A;  1KON A;  4HX8 A;  1BC7 C;  3BTI A;  3RYP A;  1R22 A;  5IT9 K;  3ABT A;  4IXA A;  4G12 A;  2IS1 A;  3OYL A;  4RM3 A;  3EUH C;  2XKP A;  2DT7 B;  2M2E A;  3QPT A;  1VI0 A;  2TDX A;  2L54 A;  2NVT J;  1S5L C;  3H3Z A;  3HSE A;  2LKX A;  2WAD A;  1ZN2 A;  3B6A A;  4A3F J;  4X0G A;  1R36 A;  1ZTR A;  5J1U A;  3WE3 A;  2CW8 A;  2K9Q A;  2R7D A;  2XAH A;  1OCP A;  3FXK A;  2LTP A;  4Y13 A;  1UEL B;  3BCA A;  4A6D A;  2LKS A;  3OR1 C;  1VQ6 I;  3RZD J;  3JCU C;  1Z05 A;  2OV7 A;  1X1D A;  5J8F A;  2M7B A;  3CCY A;  3ZMZ A;  4Y3O A;  4FCY A;  2CUF A;  2ZJP F;  2XSD C;  3S16 J;  2XB0 X;  3VYU B;  1XMX A;  2M34 A;  2CFX A;  1R5G A;  3H9J A;  1TT5 B;  1K6Y A;  2UUZ A;  1O3Q A;  1VFC A;  3LA7 A;  3HC7 A;  1X1P A;  1TQI A;  3NWT A;  1PP7 U;  4ENK A;  1I6X A;  2P0W A;  3SHF A;  5DDG A;  1ENH A;  2ZXI A;  5KCM A;  4XOP A;  2YX7 A;  2Y30 A;  1Z6T A;  4RMN A;  2CQK A;  1O3S A;  2B9S A;  3A02 A;  3ECO A;  2VQC A;  1SFK A;  5CVV A;  2WAQ A;  1X2M A;  1A5J A;  3BJO A;  1G3Y A;  2K85 A;  3DQV C;  1X19 A;  3TDZ C;  1WJC A;  2X1C A;  5K5Q A;  3IL2 A;  4UV8 A;  3HZJ A;  5HLG A;  4PJJ A;  2ISZ A;  3RKW A;  3H35 A;  3GTM J;  3RCO A;  5HOD A;  1BI2 A;  4ZH4 F;  1P7I A;  3R61 A;  3RKY A;  3H5N A;  5D5V B;  3ONQ A;  2R7W A;  1ETV A;  1U2W A;  1SD7 A;  1ZLK A;  4LGW A;  2CS3 A;  1HBX G;  2XAQ A;  4ASN A;  4I6Z A;  4DGW B;  2MC3 A;  4HZF A;  3VSL A;  2KDZ A;  2E1O A;  1J9I A;  4HRI A;  1TQP A;  4O6J A;  5LLQ A;  4KT5 C;  4NQW B;  4PK4 A;  5DYM A;  4BHP A;  3A0H C;  1F5T A;  2MH2 A;  2V9K A;  3LAJ A;  4B48 A;  3FXO A;  5K5O A;  1AOY A;  3NEU A;  1IJW C;  2LKP A;  3PNV A;  3MWM A;  4ZDL A;  2X1D A;  3OV8 A;  4M73 A;  1XB4 A;  2L5Q A;  3CMM A;  3F72 A;  1S72 I;  2PN6 A;  1HF0 A;  4D5F A;  3K2A A;  1Z3X A;  4EAT A;  2A07 F;  2JWT A;  2K86 A;  3DFG A;  3WG7 H;  1YI2 I;  2WTE A;  2EZH A;  4KIB A;  3M4O J;  2DYR H;  1TQM A;  2DTZ A;  3M8E A;  1GDT A;  2VJ5 A;  4U88 A;  3JRI A;  2CQQ A;  4GXO A;  1YIO A;  3HIF A;  3U9G A;  3QRF F;  3LMM A;  5TIS C;  4C2M J;  2KIM A;  2M9H A;  4RB2 C;  3E97 A;  4V2G A;  3OYC A;  1IUY A;  5IP9 J;  1CQT A;  1W36 D;  3MVP A;  2OZ6 A;  1XGS A;  3WTZ A;  4JX6 A;  3ASO H;  4PJN A;  3WTT C;  2NXN B;  2VQL A;  4NQW A;  4D9J A;  3HSR A;  1MJ9 A;  5E18 F;  1U3E M;  3RZO J;  1D3Y A;  3KIO A;  3MKL A;  4YIF A;  1WJD A;  3IRR A;  3DWL E;  3BY6 A;  4FTH A;  1WQ2 A;  2E1M C;  4A0Z A;  3Q3S A;  1R5I D;  2OBP A;  2DQR A;  1NTC A;  2DFH A;  3FMQ A;  3IRQ A;  1K4S A;  2OA4 A;  1C0W A;  1ZGA A;  4KN7 X;  3K9T A;  2MGQ A;  1WJB A;  2ICW G;  1NG6 A;  2HPM A;  1QGP A;  2HYG D;  2CQ7 A;  4C3J J;  4F92 B;  3UR3 C;  5ILU A;  4R8H A;  1U0J A;  2W48 A;  1FOW A;  2L9V A;  4GRI A;  3LFK A;  2KIF A;  2VAS A;  3K1M A;  2ZXH A;  4IKF A;  1Z3Y A;  3P5J A;  2QCO A;  2HTS A;  1T56 A;  5M5W J;  3LSH A;  3T8R A;  1WSU A;  2DO7 A;  2EK5 A;  4L9T A;  3WTY C;  5TRD A;  2AQE A;  3K6G A;  4KIG A;  2Y69 H;  4ITV A;  2KQR A;  1E17 A;  4HF1 A;  3HXL A;  1IN8 A;  5GAD J;  2L9S A;  1E2X A;  2XAF A;  3CQZ J;  5KAI C;  1HLV A;  1HXD A;  2MW8 A;  1IDZ A;  3KEQ A;  2UXX A;  4C9Y A;  1R00 A;  2FF4 A;  1Z1D A;  2QKM B;  2Z5U A;  1JKP C;  5F08 A;  2JTV A;  1WHU A;  2X6O A;  4BE2 A;  1V55 H;  5AIP A;  2E2I J;  2Y31 A;  1LNW A;  2NS0 A;  2VBZ A;  2DT6 A;  4QLC U;  4WWC A;  2Q2E B;  1GV5 A;  2Y75 A;  4M3B A;  2BV6 A;  1L0O C;  1MNE A;  3LSJ A;  3AG4 H;  3P7N A;  4HQE A;  2QSH X;  2HOE A;  1TT0 A;  2DW4 A;  3PQJ A;  3NAU A;  1HQC A;  1YG2 A;  1JGS A;  2HDD A;  1EF4 A;  5BNG A;  3C2B A;  3KCC A;  2Y9Y A;  1R5H A;  2D45 A;  2KRC A;  3MEX A;  3ECH A;  1QPM A;  2X1E A;  2A61 A;  1BL0 A;  2DOD A;  1SVL A;  1FJL A;  3J80 Z;  1VQ8 I;  2IGN A;  2A05 A;  1J5Y A;  2DDB A;  3GFL A;  3QAH A;  3UNG C;  3LSK A;  5KNL A;  3SFZ A;  1FIP A;  2O7O A;  2R92 J;  3HOS A;  3HUG B;  3I54 A;  2O61 A;  4BJ6 C;  3BR0 A;  4GYG A;  5C3E J;  3V7R A;  4RGR A;  3W6V A;  2F6C A;  2NOJ B;  4HX7 A;  3SZP A;  1UMQ A;  1UZC A;  1JUS A;  2P5V A;  2P6T A;  3GZN B;  3SXY A;  3DKW A;  4MFE A;  1G6N A;  3S3M A;  3BG3 A;  2L3D A;  3K69 A;  4BXX J;  2LK2 A;  2Q2E A;  3F9K A;  2FRH A;  3RPU D;  1DU6 A;  5ILS A;  2Y0S A;  4BQO A;  3JRC A;  1I5Z A;  2TCT A;  2R5Y B;  3OYN A;  2Z33 A;  4HQM A;  5B5E C;  5KAF C;  2IGO A;  2GA1 A;  2VOD A;  1VQ7 I;  3GTQ J;  2DA4 A;  3E6C C;  2DXI A;  1U5T B;  4MNU A;  2DQL A;  4NC7 A;  4KMF A;  3MFK A;  3O8H A;  3DLL F;  4IHY A;  1MMG A;  1LFU P;  2XGX A;  2L7Z A;  3DU5 A;  4BAC A;  4K2E A;  1FY7 A;  3IH4 A;  3HUG A;  3D5R C;  2WAQ N;  3K4N A;  2EFO A;  2IP2 A;  3HEF A;  1IXR C;  1MBJ A;  5JHF A;  1RNL A;  4ENM A;  2VBX A;  3S32 A;  4GO1 A;  4A3G J;  3PUF A;  2BVM A;  1WI9 A;  1UHS A;  3ASN H;  3EPZ A;  3KP7 A;  3CD6 I;  1Y8R B;  3AFH A;  4U87 A;  1Z91 A;  2DMU A;  3I3L A;  5LFA A;  1GV2 A;  2R5Y A;  5FJ8 J;  1D0X A;  3E6M A;  1D5V A;  4G7Z F;  2E5N A;  3KP5 A;  2HQ5 A;  1K4T A;  1KQ8 A;  2GLO A;  2CV2 A;  4PGG A;  3PNT A;  5D4R A;  1Y0U A;  1T08 B;  1U5T A;  5TJJ A;  5IYC J;  2E1N A;  3CCE I;  4HDU A;  4E7L A;  1Q1H A;  2A69 F;  2UZK A;  2VJ4 A;  3PFI A;  1M1E B;  4I7H A;  3L09 A;  4DQ2 A;  3RPU A;  4E4H A;  2E71 A;  3GBG A;  2F5F A;  5ILV A;  4BQN A;  1IZ1 A;  3J81 Z;  4LLN A;  2WY8 Q;  5LGN A;  5GPC A;  2DMP A;  2F5V A;  2H6C A;  2XIG A;  2CFO A;  3BQZ A;  3HGG A;  5F6F A;  4FAS D;  2X6W A;  2FNP A;  2JRT A;  2KL4 A;  3B6C A;  1DU0 A;  2O8K A;  1XC5 A;  2E7X A;  1V3F A;  2K9L A;  4IZZ A;  1P7J A;  1R4M B;  2LNB A;  3K0L A;  2LRD A;  4OAZ A;  5DS9 A;  2R7Z J;  4AYB N;  2LY1 A;  3DKY A;  3PIO F;  1PP8 F;  1WH5 A;  2G0E A;  2PG4 A;  4ZYG A;  1X2N A;  2HVR A;  2E2H J;  5E1X A;  2B7E A;  1ETQ A;  3LSG A;  3OYH A;  1NG7 A;  1XX5 A;  2D2W A;  4YIR X;  5E8G A;  3L2U A;  2JPB A;  4B44 A;  1S29 A;  4B43 A;  9ANT A;  1A35 A;  2ME0 A;  2BHZ A;  2MBF A;  2E2J J;  2QF7 A;  4BBR J;  2CSO A;  2DA6 A;  1QRY A;  2FOK A;  1D0Y A;  3CCS I;  1EJ9 A;  3Q5F A;  4XKB A;  3M8F A;  1R1V A;  2OTL I;  4M3E A;  2WY7 Q;  4U7B A;  1YJN I;  5CVR A;  2R7X A;  1IF1 A;  1LJ9 A;  1SMT A;  4IHS A;  2ECC A;  4RLQ A;  4FX4 A;  4HNV A;  2ZBK A;  2HEO A;  4GCV A;  2QA4 I;  4NBQ A;  1HA8 A;  4JYK A;  4KUM A;  5IOZ A;  1MH4 A;  1S8N A;  1MMA A;  2H6B A;  3JAM K;  3VWB A;  4UHT A;  3QQA A;  1B4A A;  3S2D J;  1LEA A;  3HYI A;  1LEB A;  4ZZD A;  1PDN C;  3CJR B;  2M4K A;  1LFB A;  5LEK A;  5HLI A;  2IW5 A;  3MN2 A;  3WE2 A;  3S1R J;  1TP4 A;  3T1B A;  2OQR A;  1IW7 F;  4XN0 A;  2WBM A;  4L9N A;  2MSY A;  5BMZ A;  3S15 J;  4B09 A;  3TW7 A;  4II3 A;  1WJF A;  2FBK A;  5FRN A;  4ZYA A;  4LD5 A;  1BM9 A;  2Q1Z B;  4E7I A;  2NVY J;  2UV1 A;  2E5Z A;  2LSO A;  2CGP A;  2XKO A;  2KLO A;  2KPM A;  3TED A;  4HF0 A;  3FM3 A;  4QPO A;  4XON A;  3AAF A;  1BI3 A;  2R3S A;  2FU4 A;  3ABK H;  3Q0W A;  1JT6 A;  1WZ2 A;  1TWG J;  1S9H A;  2JSP A;  5JHU A;  4ZC3 A;  2P4W A;  2LD5 A;  4KIS A;  1OR7 C;  2A6T A;  3I4M J;  1ZRD A;  3A1Y A;  1S6L A;  1GUU A;  3SQN A;  2HKX A;  4M71 A;  2E60 A;  2FE3 A;  1ZAO A;  2HWV A;  3K4C A;  2LVS A;  3T8T A;  5DCF A;  5F1J A;  5JI6 A;  4HA8 A;  3E6D A;  4CZZ A;  3J7A Y;  1I6H J;  1POG A;  3ZOB A;  5FKN A;  4XLE A;  5J1Y A;  4XN3 A;  1IAW A;  2VKH A;  3GF2 A;  3F8M A;  1P4A A;  5HS7 A;  1R7J A;  3M3Y J;  2VJJ A;  2HZT A;  2ZKZ A;  1JJ6 C;  2FXA A;  2L01 A;  3REO A;  1K6O A;  1WJA A;  3LFU A;  2XRL A;  3BG9 A;  3PL8 A;  2OCC H;  1FSE A;  3E3V A;  3LOC A;  4Y33 A;  5FB2 A;  2N8G A;  3OYA A;  1QU3 A;  5FD6 A;  2DMT A;  2HDC A;  3R0A A;  4M3F A;  3DPU A;  1ZR2 A;  2ME6 A;  3MKW B;  1KA8 A;  3QYB A;  3G3Z A;  3OR2 C;  5F64 A;  3BPV A;  1BW6 A;  3GZ6 A;  4BDZ A;  1I1G A;  1DP7 P;  2IJL A;  2XGD A;  4XRS A;  4YFK F;  3HOT A;  3M8J A;  2V79 A;  3JW4 A;  4IF4 A;  4MTE A;  3S3O A;  2CUE A;  3W6J B;  4XLC A;  1OMI A;  3RKQ A;  2R7T A;  2EV5 A;  1JT0 A;  3JRA A;  2VC0 A;  2HQN A;  1F36 A;  4G6Q A;  2BOL A;  3L9F A;  3DEW A;  2E1C A;  2HR3 A;  1SD5 A;  4A3D J;  4PGH A;  1W0T A;  3IWF A;  1G2H A;  2JT1 A;  5FKL A;  3J7A O;  5LD2 C;  5JLX A;  4BEH B;  2H8R A;  3CP8 A;  3HRU A;  1U9O A;  2BHY A;  4HNT A;  4KNY A;  2VPL A;  1FTZ A;  2A5Y B;  5E3M A;  1KYZ A;  1JKR C;  2HNH A;  3PM1 A;  2STT A;  2Y0S N;  1RRJ A;  1JUM A;  2R5Z B;  3AL0 B;  4JBA A;  5FLX Z;  1CF7 B;  4XLA A;  3W3C A;  4JX4 A;  1H0M A;  4HYE A;  5EZG A;  4ESF A;  5J6X A;  1G8X A;  2JMW A;  4XLP F;  2FBI A;  1WJ5 A;  1OIS A;  4A12 A;  3QYF A;  4DOZ A;  1WJE A;  2K40 A;  4NC8 A;  3CO7 C;  4AVZ A;  2WA0 A;  4IL6 C;  2VL8 A;  4MIM A;  2JK3 A;  3JRE A;  3S2W A;  2QQ9 A;  3F8N A;  2W1O A;  1T33 A;  3ZMV A;  4I0A A;  4XNF A;  4RB3 C;  2ZSH B;  3MMY B;  2QYO A;  1YOV B;  1J2X A;  1WH7 A;  4XMY A;  5DD4 A;  4BEH A;  2Z9O A;  4YFX F;  1F4K A;  1I1S A;  1ZG5 A;  4PJ0 C;  5L3F A;  4U7D A;  2P81 A;  3RQI A;  1IG7 A;  4CA0 A;  3H0D A;  4EM1 A;  1APL C;  5H6Q A;  2R5Z A;  2WV1 A;  1BIB A;  1T39 A;  1CF7 A;  3IH3 A;  3QU6 A;  3IWZ A;  1VQ5 I;  3TOB A;  1ZQ3 P;  2IGK A;  2Z1D A;  3ZMU A;  2EZK A;  1WCM J;  2OF7 A;  1H8A C;  3E6B A;  1D5Y A;  3DP7 A;  4FIS A;  1MSF C;  1B59 A;  3WOD F;  2L4A A;  1X3U A;  1FPQ A;  1RC9 A;  1KGS A;  4XKV A;  4UUT A;  3ZQL A;  1JJ8 C;  4D5C A;  4BYY A;  3S1N J;  3MZY A;  2H1L A;  3K70 D;  4KIT B;  3CUQ C;  2EIN H;  2PJP A;  1N75 A;  3KET A;  3S3N A;  1XSX A;  4HF2 A;  4WXD A;  1SMY F;  2F4M B;  3C18 A;  1J75 A;  2XC7 A;  4MO7 A;  1VQL I;  4DYQ A;  4ANJ A;  3HOX J;  3ZQF A;  5IT9 Z;  4NC6 A;  2R7U A;  1U78 A;  3DCF A;  2CU7 A;  3M1E A;  3K2Z A;  2ZXJ A;  3GW2 A;  3E1S A;  1RUN A;  4ESB A;  2GZW A;  2OD5 A;  5D6F A;  1T0F C;  5LGT A;  1P4X A;  4EJO A;  2GQQ A;  2OPT A;  2HYF A;  1YJ9 I;  4XIC A;  5KVR A;  3WTU C;  1KQ0 A;  3MD2 A;  3CCM I;  2XV4 S;  3I55 I;  4LJZ F;  2VKV A;  3FX3 A;  1IGN A;  4G9Y A;  3CUO A;  4XLN F;  2HOS A;  3DLA A;  3R0J A;  1MMN A;  3EQL F;  4BY7 J;  5H20 A;  2G7H A;  2P7V B;  3GTG J;  5GAG J;  2ELJ A;  4YG2 F;  2JRM A;  5FGM A;  3OSG A;  1J0R A;  2F4O B;  3C3W A;  3WGG A;  1XGO A;  1FYM A;  4P55 A;  1ETW A;  3GTL J;  2DJI A;  1P2F A;  1REP C;  1DQU A;  1GXQ A;  4LMY A;  3SZG A;  4CSW A;  3CJQ B;  3FXQ A;  4Q4Z F;  1Y0N A;  1SFO J;  1JUP A;  1OKR A;  3CF2 A;  3T0Y A;  5CVI A;  3ULQ B;  4IJA A;  2F2E A;  1K7A A;  2B0L A;  4XID A;  4D7M A;  2A68 F;  2VE8 A;  3G1O A;  4WF2 A;  3CME I;  4IRI A;  1ON2 A;  3OIO A;  4DNC A;  1IN7 A;  2DYS H;  3I71 A;  4NB5 A;  2EFQ A;  3TDU C;  2D5V A;  2D1V A;  4HOB A;  1R49 A;  4C2U A;  4XR6 A;  2Y9Z A;  1T38 A;  5FD5 A;  3SYT A;  4DBQ A;  1E0E A;  5EEG A;  1BC8 C;  1TNT A;  1WGX A;  2P5K A;  4UVB A;  3FZV A;  2HVS A;  2DFF A;  3TO7 A;  2ACJ A;  3BP8 A;  4MEX F;  3HSF A;  1LVK A;  2MA3 A;  1OYW A;  1H88 C;  2AO9 A;  2X6Y A;  3BOQ A;  4M6V A;  3HOU J;  5D5W B;  2EV6 A;  3BTJ A;  3T5X A;  1GT0 C;  3W6K B;  3S93 A;  2HOA A;  1BOB A;  3FF5 A;  4IPA A;  4GYI A;  5D8K B;  2P5L C;  4EJT A;  3Q0U A;  1XGM A;  2JA2 A;  2R7F A;  4FE4 A;  5E17 F;  1FMW A;  3CDI A;  2IAI A;  2LRE A;  3BQY A;  2FX0 A;  1LE8 B;  4KIF A;  4IHV A;  4LIV A;  3EYI A;  2UWM A;  1S7A A;  1SFX A;  2KT0 A;  2LR8 A;  2ECB A;  1ZLJ A;  2X48 A;  1YHQ I;  2CUZ A;  5GPA A;  1P92 A;  5K7H A;  5BPI A;  4IEJ A;  5GTH C;  2KJB A;  2OUM A;  1LPQ A;  5F0C A;  2ZNY A;  2WB1 A;  1ZYR F;  2BXY A;  1LFP A;  1RR8 C;  5AIQ A;  4A3J J;  4CH7 A;  2DU9 A;  3OOU A;  1OYI A;  5J47 A;  4A3M J;  2FNA A;  2RN7 A;  4RM2 A;  4QTR A;  3H36 A;  5E1Z B;  3WU0 A;  3OYM A;  2ZJR F;  1EA3 A;  2R7O A;  3TGN A;  2BY3 A;  1MSE C;  1XG1 A;  1ZKG A;  3V8J A;  1DPU A;  1R6R A;  1BI1 A;  3CLQ A;  5BOX A;  3F21 A;  2XAU A;  4EGY A;  5J8C A;  4H0E A;  2HKO A;  2O9L A;  4IHT A;  2KIS A;  4AIK A;  4PCQ A;  1XSD A;  2DT5 A;  3K10 A;  2W25 A;  3IUO A;  3J7Z I;  2ZO4 A;  2MD5 A;  2RV8 A;  1P9Q C;  2RGV A;  3OIP A;  2VB6 A;  3ISP A;  4J19 A;  2K5C A;  2OCE A;  3A0B C;  4CCJ A;  2P6S A;  1FWZ A;  3WU1 B;  4EQQ A;  2JQ7 A;  3IKV A;  4J01 A;  2QQB A;  2HI3 A;  4AD9 A;  2QKL B;  4XKC A;  1KU7 A;  2MYS A;  1OCC H;  4MEY F;  4HV5 A;  2ZJQ F;  4X6A J;  1MMS A;  4N9H A;  2IS4 A;  1MBE A;  1YW8 A;  1X3Z B;  3C2G A;  3GTP J;  2BYV E;  4AVP A;  3V42 A;  1B6A A;  1Z67 A;  3V8K A;  2X0L A;  3ZQG A;  3WGI A;  4WX9 A;  3JSP A;  3ERM A;  3FMS A;  3BG7 A;  1ON1 A;  3QPH A;  1BA5 A;  2EA4 A;  4D1Q A;  3I0T A;  2IS2 A;  1ORK A;  3BDD A;  3UKG A;  2EPF A;  2FD5 A;  5E8I A;  3KZY A;  1FSH A;  2VXZ A;  3CDH A;  5A2Q K;  1W7P D;  2XF7 A;  1Y1W J;  1MNM C;  2HDW A;  1UST A;  1IO2 A;  2LYC A;  2VT2 A;  5FO5 A;  1MND A;  2QM3 A;  3DTI A;  5CVJ A;  3TP0 A;  1YW9 A;  2JA6 J;  3SJM A;  1WRJ A;  3CC2 I;  3HG9 A;  4W1U A;  4N4N B;  3E5Q A;  2LBF B;  2V9V A;  4ZYH A;  4OAY A;  2GXA A;  4LIU A;  1HOM A;  3OMY A;  2EIM H;  1W7P B;  3CJT B;  2E35 A;  2M45 A;  1G4D A;  3PSF A;  1ZAR A;  2VBW A;  3EUH A;  3F23 A;  1FTT A;  2G7U A;  2H1K A;  3QOP A;  2GOM A;  1H9G A;  5EZH A;  1ETK A;  1WWX A;  2LG4 A;  2K3P A;  3GZ5 A;  1XMK A;  1V4R A;  1A36 A;  3F6O A;  3QP6 A;  3N4M A;  3OS0 A;  2EZL A;  2W82 A;  4JX5 A;  4KJZ A;  1ZG1 A;  3FXR A;  2WV0 A;  2BY0 A;  4XSX F;  2R7R A;  2L02 A;  3P9C A;  3ERE D;  1W5S A;  3HTS B;  4W97 A;  2XHK A;  2K27 A;  3OY9 A;  2DTR A;  3NRV A;  1B9M A;  5E79 C;  5F04 A;  4II2 A;  4ENN A;  1VQK I;  3A4C A;  3SZT A;  4P1W A;  4RGU A;  4B3A A;  1IRZ A;  2GA2 A;  3G71 I;  2LBF A;  5E3O A;  2K3F A;  4EMS A;  3G4S I;  4A3L J;  3GEZ A;  1W7P A;  4XM3 A;  3V8L A;  4ENJ A;  4A3B J;  3B02 A;  3LQR A;  4AIJ A;  1HKQ A;  2ID6 A;  5BS6 A;  3J80 K;  5FKM A;  3QWL A;  5IP6 A;  1XN7 A;  1TWF J;  4O5V A;  4HDV A;  3HDD A;  1MBK A;  2B63 J;  4UB6 C;  3DPT A;  4EV0 A;  3QYE A;  5LEJ A;  3OYK A;  1MGT A;  2NVU B;  5M3M J;  4BBS J;  3I4P A;  2KIQ A;  2I5U A;  3BTL A;  2DA1 A;  5H6R A;  4CZC A;  5HDN A;  2FML A;  3DBR B;  1EKE A;  3RYR A;  2ZME C;  1YS7 A;  2QVO A;  3DTK A;  1SD4 A;  3GFM A;  1BJA A;  3OYI A;  5D5U B;  3KZZ A;  3KX2 A;  3CCR I;  3AG2 H;  1N25 A;  1R4N B;  2W57 A;  2DJN A;  4MGR A;  1VQ9 I;  1FX7 A;  3TOA A;  2Q8K A;  3ZQ7 A;  3ZQC A;  4R79 A;  4OMY A;  3F8B A;  3M7G A;  1V5E A;  2L0K A;  1OCZ H;  4HX4 A;  4MFD A;  3IHU A;  5L3C A;  3GTK J;  1D1A A;  1FNN A;  1IDY A;  2HPI A;  1DUX C;  3OYF A;  1MD0 A;  1JGG A;  3ZMS A;  4FX0 A;  2RQQ A;  2KJC A;  1LUJ B;  2E1M B;  5F1R A;  1SAN A;  4C3I J;  1ZRC A;  3G1L A;  2F5E A;  4Z2Y A;  1ONV A;  1QO0 D;  1OYY A;  3MAJ A;  3E5U A;  3ZQQ A;  1IN6 A;  1KU2 A;  5HOO A;  2A5W A;  2XGC A;  2OQG A;  1K79 A;  1O3T A;  2RRE A;  3CCL I;  2CMP A;  1HW1 A;  3LA3 A;  5EGO B;  1YO5 C;  1VQP I;  4MLO A;  2YS9 A;  3MQ0 A;  1YJW I;  3KYL A;  2L7F P;  2HOT A;  3ZP5 A;  1PVE A;  3ML6 A;  3LST A;  3WTV C;  1TWC J;  4RBO A;  3M1C A;  3C1D A;  2K7L A;  3HRT A;  2R7V A;  3VSK A;  3X2Q H;  2RVC A;  2WB1 N;  4E7Z A;  5IYD J;  3KEO A;  1FBU A;  4H4K C;  2DPU A;  2PI0 A;  4GDF A;  2BZT A;  4DZJ A;  2QBY B;  1DGR M;  3JRF A;  4ON0 A;  1QHH D;  4TV7 A;  3KP6 A;  3CCJ I;  1X3W B;  1IRF A;  1USS A;  3OIQ A;  4BE0 A;  1LDK B;  3ZCO A;  3QOD A;  3CLO A;  4XBF A;  3KPH A;  4D7N A;  3GX4 X;  1S7O A;  1VTN C;  3B73 A;  4AID A;  1QZZ A;  1NK2 P;  4UUS B;  1FZP B;  1IXC A;  2HFH A;  4OWR B;  1KYW A;  3KLN A;  4AUX A;  4DBR A;  3ZPL A;  4BH9 A;  3LL7 A;  5FRM A;  1MJB A;  1UHW A;  1X4P A;  3SDG A;  1HSJ A;  5EGO A;  2FUG 2;  1Y6I A;  5CLS A;  3J81 K;  5KHD A;  4PSX A;  4V19 K;  3G2B A;  3KFW X;  1RI7 A;  2MH9 A;  3FXJ A;  4Y52 J;  3KYC B;  2DMQ A;  1Z77 A;  5JVG F;  3D0S A;  3KEY A;  1K61 A;  1NHA A;  1X1B A;  1YRN B;  2FEZ A;  5FKO A;  3HGY A;  4IHW A;  3QU3 A;  3S1Q J;  1PYV A;  4MQV A;  2RAE A;  2QBY A;  2R7S A;  5J3L A;  2XB5 A;  3EDP A;  4L5I A;  4RLF A;  2IS6 A;  4C30 A;  4YRV A;  2DOE A;  2CWE A;  2L9R A;  4OIN F;  2FA5 A;  3FXM A;  1FP1 D;  1I3A A;  2OC6 A;  4BUP A;  2VC1 A;  2V1N A;  5LBQ A;  3J7Y J;  1W4M A;  2Z3Y A;  2NVX J;  2LY9 A;  4JK1 X;  1I50 J;  1XSV A;  2MG4 A;  4UUS A;  5EDN A;  2VPR A;  3BPX A;  4LFU A;  1OPC A;  2BW3 B;  1JTX A;  2BGC A;  2EB7 A;  2XGE A;  2M30 A;  2M3A A;  3DXJ F;  3OS2 A;  5J4V A;  2EIJ H;  1Z21 A;  2VJI A;  2F5C A;  5C4J J;  4YFN F;  2LF8 A;  4ESJ A;  2MFZ A;  2YPR A;  3OOP A;  2AXL A;  1B72 B;  4L0Z B;  1VND A;  2ETH A;  2ADU A;  3S14 J;  3DEE A;  4B47 A;  1YRN A;  4UY8 I;  2JUG A;  2IEK A;  2JPC A;  3H5R A;  4KMU X;  4LIT A;  1ZRE A;  2XAG A;  1F43 A;  2O03 A;  2AQF A;  4PDK A;  1R1U A;  4M6X A;  3L2V A;  2XF5 A;  2Z16 A;  3ZQH A;  5DD8 A;  1MBH A;  2K02 A;  3N05 A;  5F27 A;  4CCM A;  1TNS A;  1VF9 A;  2LP0 A;  4IHX A;  2FOW A;  4L5E A;  2CO5 A;  1Q1V A;  4BXF A;  3IV5 A;  3L2W A;  2JUC A;  1J59 A;  4CYD A;  2CUJ A;  4OMZ A;  2KIU A;  3DEU A;  4F55 A;  3KE2 A;  2IA2 A;  1X1C A;  2BVL A;  3W2V A;  1MH3 A;  2BW3 A;  2LOO A;  3IAS 2;  2KHM A;  1Z7U A;  4MHG A;  4OOI A;  1ITY A;  5FLM J;  2G9W A;  4BE1 A;  1FEX A;  4Q48 A;  2CG4 A;  1EH8 A;  3LSI A;  3FXL A;  2COB A;  3RDI A;  4A3E J;  4YII A;  1QBJ A;  4FHT A;  4M9S A;  5CPR B;  5DM6 F;  4FE7 A;  4X1E A;  5DM7 F;  1D1B A;  4RAZ A;  1XCV A;  1IRG A;  4EJU A;  3OYB A;  5E3N A;  1W5C C;  3FHZ A;  2VOP A;  1TLH B;  1RIO H;  2JVG A;  3KLO A;  3R4K A;  4RGX A;  2QUF A;  3CES A;  1R9T J;  2PFB A;  1YE9 A;  4A5N A;  3BTC A;  1LKX A;  5D8L B;  5ICG A;  3E5X A;  3TP3 A;  3BR3 A;  4I01 A;  1GVD A;  1Y39 A;  1BIA A;  4CIC A;  2TRT A;  3LNQ A;  3G73 A;  3AG1 H;  2M1B A;  5J1R A;  4G7O F;  1JE8 A;  4CO8 A;  2CJJ A;  1SC7 A;  3ZMT A;  3I56 I;  3K4J A;  2QQA A;  4F3Q A;  2KKO A;  2R7Q A;  1YFH A;  5EG0 B;  2YSR A;  2XAJ A;  4M72 A;  3CF5 F;  2LFB A;  5ERI A;  4OIR F;  4HW0 A;  2M8G X;  4AM3 A;  1ZH5 A;  3ZN1 A;  1U8B A;  2PBI A;  4U0W A;  3IP4 B;  1AKH B;  2CV1 A;  2XAS A;  4B3X A;  3P9I A;  3L2C A;  1T2K A;  3FIS A;  1A6Q A;  3CZ6 A;  3QP5 A;  4A3C J;  3FXU A;  1RKT A;  5HS9 A;  2QSF X;  2W85 A;  1L3L A;  3I58 A;  5FRO A;  4ZDO A;  1KQ9 A;  1E3O C;  3BJA A;  3I64 A;  2F4I A;  4PUS A;  1OCT C;  5KK1 A;  1P6R A;  2JA5 J;  1RR7 A;  2A6E F;  1GVJ A;  4XRM A;  3KZI C;  3PO3 J;  2DFI A;  1VQN I;  1V5G A;  2BBY A;  3ZMD A;  3CCQ I;  3KP2 A;  3K4K A;  2H27 A;  4CCN A;  4P5O A;  5K1Y A;  3I9V 2;  1UJ8 A;  4MQ9 F;  4XK4 A;  3TO6 A;  2IGM A;  3TBI A;  4PFP A;  2DI3 A;  4A0X A;  1WFX A;  2LF7 A;  5EG0 A;  4PSW A;  4OIQ F;  3HOV J;  4HSR A;  5J40 A;  2DOA A;  3IC7 A;  4FQG A;  1T98 A;  4E7J A;  3P9K A;  4UV9 A;  4LG0 B;  1YX3 A;  2AHQ A;  1UG2 A;  2IA1 A;  2DK8 A;  2DMN A;  1JHF A;  2O0Y A;  1QZE A;  2ZB9 A;  1EH7 A;  4RAG A;  3AKZ A;  3GUD A;  2QWW A;  1AKH A;  1KU3 A;  2V1D A;  2EFW A;  3OYD A;  4UUV A;  3BLY A;  2M7A A;  1OJL A;  2XPU A;  3HPG A;  3JTG A;  5F0F A;  1FYK A;  1MIJ A;  3GCM A;  3PO2 J;  5D4S A;  3R60 A;  3FBI B;  5BPD A;  1STZ A;  3A03 A;  4A6E A;  1QPI A;  2M8E A;  1G3T A;  1F9N A;  1FYL A;  4BXU A;  3G6E I;  1QA6 A;  4I2O A;  4RDU A;  1HKT A;  1WI3 A;  1AWC A;  3HOZ J;  3EUA A;  3F0C A;  5IP7 J;  2LMD A;  4UB8 C;  3LWF A;  2Y0M A;  2XRN A;  2XSJ C;  3PUB A;  1W36 C;  2MLG A;  4B8X A;  4G7H F;  1X4O A;  3GWZ A;  4PZJ A;  1Z7L A;  2EBI A;  3HHH A;  1XPX A;  1G59 A;  4XL9 A;  1W5T A;  3DKX A;  2PJR B;  4Y17 A;  4BNC A;  2K4B A;  5GAH J;  2LY2 A;  2QSG X;  4P9U A;  1R23 A;  5CQE A;  4LG0 A;  4HBL A;  3DBH B;  3TL4 X;  3BJ6 A;  1YIT I;  4F91 B;  5JVT A;  3LSP A;  2CYY A;  2DA3 A;  4U0Y A;  1AU7 A;  4IX7 A;  3KP4 A;  5B3S H;  3I4N J;  5E1W A;  2C6Y A;  2Y48 A;  3DU6 A;  3LAP A;  1OR7 A;  4BJ5 C;  2JVH A;  1LDD A;  3ABM H;  4L5J A;  5ICF A;  1TWA J;  4EJW A;  1IUF A;  4OIP F;  2KZG A;  2O6G E;  3SFI A;  5JFR A;  2E19 A;  1ERD A;  3ZRG A;  2ZXW H;  3O8G A;  1YTY A;  3I59 B;  1NH3 A;  4S04 A;  3RSN A;  1MJA A;  2WWY A;  2QGU A;  2KDO A;  4MTD A;  2R4G A;  3VOD A;  4M3G A;  4HPQ A;  3BC8 A;  3MKY B;  3BR2 A;  1ZGJ A;  3GLL A;  2NS8 A;  4G6T B;  5BQT A;  1NK3 P;  3BWG A;  2M5W A;  4BKX A;  4BQQ A;  3HKZ A;  3WTW C;  3N97 A;  1HKS A;  1UB9 A;  1OLT A;  2DK5 A;  4A3K J;  2PJR A;  2HTJ A;  3QPS A;  5L3D A;  3SEQ A;  2PEX A;  2L4M A;  2Y2Z A;  1FIA A;  4C3H J;  3NQO A;  2P8T A;  4KA4 A;  1OCO H;  1TTY A;  1XMA A;  1RUO A;  3L2R A;  3FMR A;  5AON A;  2EJR A;  3M07 A;  5IPA A;  2NS7 A;  1D1C A;  4GGG A;  2FQ4 A;  1VZ0 A;  1YYV A;  4QWQ A;  5K7Z A;  4XKW A;  5HNF A;  2HXO A;  2L7K A;  4ZYD A;  2VT3 A;  1BN5 A;  1FLI A;  2VKD A;  1YS6 A;  2EH3 A;  5LGU A;  2KFD A;  2NOG A;  3I59 A;  1LQ1 A;  1LB2 A;  5DUK A;  3H0G J;  3ABU A;  3HOY J;  3MCZ A;  3VYT B;  3PIP F;  2PLY A;  4BGD A;  5HNH A;  5IYB J;  4A5M A;  2EZI A;  3HPH A;  4EGZ A;  3EUK L;  2M0M A;  2AXT C;  4HNU A;  1T6S A;  1S7E A;  4CHU A;  4DIQ A;  2RC4 A;  3H3V K;  2Z2S B;  4EEF G;  2J5O A;  4LLL A;  2KMU A;  3CC7 I;  4E6K G;  2VLA A;  3BCB A;  3HOW J;  4I0B A;  1HST A;  2WAE A;  1RZ4 A;  3HL2 A;  4BAY A;  3JRG A;  2BE5 F;  2A6H F;  4I98 B;  4RA2 A;  1KZH A;  2ELK A;  2EA2 A;  4NHJ A;  2NAZ A;  4JP0 A;  4OU0 A;  4M9X A;  3WU2 C;  1U5T C;  1LE8 A;  1OQY A;  1CGP A;  4HV6 A;  2MD0 A;  1V54 H;  1O7L A;  2NNN A;  4KYW A;  1BJZ A;  3CUQ B;  5DEQ A;  4EJV A;  4AYB A;  4CCL A;  1I39 A;  2EIK H;  3RTR A;  1O3R A;  2HZD A;  3OSF A;  1YX5 A;  1B8I B;  2VON A;  1XTA A;  4RB1 A;  2ID3 A;  1ETX A;  2IA0 A;  3JSO A;  1GHC A;  1O57 A;  4A3I J;  5DUI A;  3FDY A;  1Y1V J;  1IN5 A;  1YW7 A;  2VBY A;  5L3E A;  1FOK A;  3HTU A;  3FKI J;  3S1M J;  2JA7 J;  3M9A A;  1WKM A;  2I10 A;  3ABL H;  3U1K A;  4CDG A;  1HW2 A;  1YLF A;  2ZSI B;  4LOC A;  4UVC A;  1A04 A;  1AA7 A;  2LH9 A;  3BG5 A;  1SVO A;  2R93 J;  1VQO I;  2H09 A;  3VPR A;  3IAM 2;  4A2U A;  1AHD P;  2R0Q C;  3RPQ A;  5CVU A;  1R71 A;  4PJM A;  1U9N A;  4DZP A;  4L9V A;  2IBD A;  5A2Q Z;  2IVM A;  4Y15 A;  4DYC A;  3GYH X;  3EET A;  4J00 A;  1SVM A;  2DN0 A;  2ISY A;  3Q0V A;  4F52 A;  2IRF G;  5EYR A;  3CUQ A;  4EVI A;  4CXF A;  3C7J A;  2A3S A;  2VUM J;  2EFP A;  3CCV I;  4E70 A;  3MKZ A;  4KIC A;  1JKQ C;  4G8X A;  4N9I A;  1B8I A;  1FMV A; 
#chains in the Genus database with same CATH homology
 2RQP A;  5IT3 A;  2RNJ A;  1EH6 A;  3GFI A;  4RAY A;  5LHH A;  1XDU A;  4ZYE A;  1ULY A;  1XDS A;  1BBY A;  1T0F A;  4LB6 B;  3TQN A;  2QEN A;  2OU2 A;  4WXH A;  3U2R A;  2VOO A;  4WK8 F;  4G6D A;  4P96 A;  2GAU A;  3WTS C;  3H3U A;  2M87 A;  4XSZ F;  1FBS A;  1G3W A;  1O7F A;  5JR3 A;  1TBX A;  5LHG A;  3L7W A;  5ED4 A;  2WC2 A;  2VN2 A;  2O3F A;  3WTX C;  1IN4 A;  4I02 A;  1LDJ A;  2ZJ2 A;  5E20 A;  1B9N A;  3F6V A;  3HRM A;  4M9Z A;  3Q9V A;  4U0V A;  3WG9 A;  1QZY A;  4M74 A;  5LRR A;  3CTA A;  4RGS A;  2GIV A;  4Q47 A;  4OIO F;  4S05 A;  3LA2 A;  5L3G A;  2BEO A;  2Z99 A;  4L9J A;  4IRG A;  2VE9 A;  1XD7 A;  4HAM A;  2GXB A;  2YR2 A;  1S3J A;  4EM2 A;  4CGZ A;  1D8J A;  5FFZ A;  3COA C;  3U1D A;  1FBQ A;  2EWN A;  1TW2 A;  2K4J A;  2XRO A;  4Q5S F;  2IPQ X;  3FM5 A;  4XRF A;  1FC3 A;  2ZCW A;  1H9T A;  5FFX A;  1MKM A;  2FBH A;  3IKT A;  2RKH A;  2DPD A;  2NRA C;  1JXS A;  1DPR A;  5ICE A;  2H94 A;  2O8X A;  3VEP A;  4O3M A;  3PQK A;  1SFU A;  2PMH A;  1HW5 A;  1JHH A;  5CYV A;  1LVA A;  2ESH A;  1ODD A;  2W24 A;  3CO6 C;  1UHM A;  6PAX A;  1B1B A;  3VB2 A;  1BI0 A;  3K1N A;  5CJ9 A;  2IT0 A;  1FP2 A;  2DBB A;  1IXS B;  2F5D A;  2JSC A;  1KU9 A;  3VOE A;  1ZG3 A;  4P9F A;  4WXC A;  1SD6 A;  2ELH A;  4BHC A;  4LK0 F;  3GO5 A;  3D5L A;  3Q9S A;  2X4H A;  1U6G A;  3JAM Z;  2OAZ A;  1P4W A;  4IVN A;  4KFC A;  4BQA A;  2Q0O A;  3V7C A;  2FMY A;  3F8C A;  3GLX A;  4BHB A;  3TKY A;  1G3S A;  2ESN A;  5K5R A;  2QZ8 A;  4M6Y A;  1Z6R A;  4HLX A;  2FSW A;  1Z9C A;  4HLY A;  2PMU A;  1FT9 A;  5HLH A;  2P7C B;  2EFN A;  3BRO A;  5L3B A;  3L00 A;  1GXP A;  1QQI A;  3HHG A;  3EYY A;  4UVA A;  4AIH A;  1TW3 A;  2KRF A;  3BZ6 A;  3RI4 A;  1R58 A;  3RJP A;  1XCB A;  1D8K A;  3ELK A;  2NNY A;  3FWE A;  5D5X B;  1YQA A;  4ETS A;  4UNO A;  1F1Z A;  3H92 A;  2EV0 A;  1BOA A;  4KN4 X;  4LLG F;  4L0Y B;  2ZME B;  1MDM B;  1QNT A;  2ZNZ A;  2DLL A;  3RIR A;  2UXN A;  2GWR A;  2MLK A;  2STW A;  3HRS A;  2DAO A;  5HDK A;  4UXN A;  3DF8 A;  1SFE A;  4WCG A;  1K78 B;  2XVC A;  3GXO A;  4D0P A;  3F22 A;  1DDN A;  5DCM B;  2V1U A;  3GFJ A;  3I5U A;  2GXG A;  4R1H A;  3V4G A;  5EEH A;  5ICC A;  1UCR A;  3V7S A;  2ZME A;  3MZH A;  1MDM A;  2FQ3 A;  3DPL C;  1J7K A;  4KDP A;  2V6C A;  1R1T A;  4LK1 F;  2HS5 A;  4F7Z A;  3F3X A;  1I27 A;  4N0B A;  2COM A;  1UFM A;  1ZHF A;  1EV7 A;  3K1P A;  2JZY A;  5D6E A;  1K78 A;  2W84 A;  5HVQ C;  1ZRF A;  5DCM A;  4LB5 A;  4L18 B;  3O6B B;  5FLX K;  4EM0 B;  3LQQ A;  2ZFW A;  5HDG A;  2XUB A;  3TO9 A;  3VFZ A;  3I53 A;  5LRS A;  3GVA A;  1MZB A;  2J5P A;  2D1H A;  4G94 A;  3CJN A;  4I09 A;  3RKX A;  2RDP A;  3JTH A;  2NYX A;  1XGN A;  1SAX A;  3KP3 A;  4A0Y A;  4RS8 A;  4ZZL A;  2CW0 F;  3R6S A;  2PQ8 A;  2HQR A;  4IRH A;  3WGH A;  5DV5 A;  3O2P E;  2YX4 A;  2E7W A;  4JQF A;  3ZN0 A;  2LDU A;  5LHI A;  2V1X A;  3F8F A;  3O3K A;  4AWX B;  4RB0 A;  5HS8 A;  1U8R A;  2HGC A;  3DV8 A;  1PUE E;  4FT8 A;  2YU3 A;  2OZU A;  2QLZ A;  2AS5 F;  3ROU A;  4HX8 A;  1BC7 C;  3RYP A;  1R22 A;  5IT9 K;  3ABT A;  4IXA A;  3QPT A;  2XKP A;  2TDX A;  2L54 A;  3H3Z A;  3HSE A;  1ZN2 A;  1R36 A;  3WE3 A;  2XAH A;  2R7D A;  4Y13 A;  4A6D A;  1Z05 A;  5J8F A;  3ZMZ A;  2CFX A;  1R5G A;  1O3Q A;  3LA7 A;  1TQI A;  1PP7 U;  4ENK A;  1I6X A;  3SHF A;  5DDG A;  2YX7 A;  1Z6T A;  2CQK A;  1O3S A;  3ECO A;  5CVV A;  3BJO A;  1G3Y A;  3DQV C;  3TDZ C;  5K5Q A;  3IL2 A;  4UV8 A;  5HLG A;  2ISZ A;  3RKW A;  1BI2 A;  4ZH4 F;  3R61 A;  3RKY A;  5D5V B;  1U2W A;  1SD7 A;  1ZLK A;  4LGW A;  1HBX G;  2XAQ A;  4ASN A;  2MC3 A;  4HZF A;  1J9I A;  1TQP A;  4O6J A;  5LLQ A;  4KT5 C;  4BHP A;  5DYM A;  1F5T A;  2MH2 A;  1AOY A;  3LAJ A;  5K5O A;  3NEU A;  2LKP A;  3MWM A;  3OV8 A;  4M73 A;  1XB4 A;  3F72 A;  2PN6 A;  2A07 F;  2K86 A;  3DFG A;  2WTE A;  4KIB A;  1TQM A;  3M8E A;  4U88 A;  4GXO A;  1YIO A;  3HIF A;  3U9G A;  3QRF F;  2KIM A;  4RB2 C;  3E97 A;  1IUY A;  2OZ6 A;  1XGS A;  3WTZ A;  3WTT C;  4NQW A;  3HSR A;  1MJ9 A;  5E18 F;  1U3E M;  1D3Y A;  4YIF A;  3IRR A;  3BY6 A;  1WQ2 A;  4A0Z A;  2OBP A;  2DQR A;  3FMQ A;  3IRQ A;  1C0W A;  2OA4 A;  1ZGA A;  4KN7 X;  3K9T A;  1QGP A;  2HYG D;  5ILU A;  4R8H A;  3LFK A;  2KIF A;  3K1M A;  2HTS A;  3T8R A;  1WSU A;  2DO7 A;  2EK5 A;  4L9T A;  3WTY C;  5TRD A;  4KIG A;  1E17 A;  4HF1 A;  1IN8 A;  1E2X A;  2XAF A;  1HXD A;  3KEQ A;  2UXX A;  1R00 A;  2FF4 A;  1Z1D A;  2Z5U A;  2JTV A;  5AIP A;  1LNW A;  2NS0 A;  2VBZ A;  4QLC U;  4WWC A;  2Y75 A;  2BV6 A;  1L0O C;  3P7N A;  4HQE A;  2HOE A;  2DW4 A;  3PQJ A;  1HQC A;  1YG2 A;  1JGS A;  3KCC A;  1R5H A;  2D45 A;  3MEX A;  3ECH A;  1QPM A;  2A61 A;  3J80 Z;  1J5Y A;  3GFL A;  3QAH A;  3SFZ A;  3HOS A;  3I54 A;  2O61 A;  4GYG A;  3V7R A;  4RGR A;  4HX7 A;  3SZP A;  2P5V A;  3SXY A;  2P6T A;  3DKW A;  1G6N A;  2L3D A;  3K69 A;  2Q2E A;  2FRH A;  5ILS A;  1I5Z A;  2Z33 A;  4HQM A;  2GA1 A;  2VOD A;  3E6C C;  1U5T B;  4MNU A;  2DQL A;  4KMF A;  3MFK A;  2XGX A;  4K2E A;  1FY7 A;  3HUG A;  2EFO A;  2IP2 A;  1IXR C;  1RNL A;  4ENM A;  2VBX A;  4GO1 A;  1WI9 A;  3KP7 A;  1Z91 A;  3E6M A;  1D5V A;  4G7Z F;  3KP5 A;  1KQ8 A;  4PGG A;  5D4R A;  1Y0U A;  1U5T A;  5TJJ A;  4HDU A;  2E1N A;  1Q1H A;  2A69 F;  2UZK A;  3PFI A;  4I7H A;  3L09 A;  4DQ2 A;  3RPU A;  2F5F A;  5ILV A;  1IZ1 A;  3J81 Z;  4LLN A;  5LGN A;  2H6C A;  2XIG A;  5F6F A;  2FNP A;  2JRT A;  2E7X A;  1V3F A;  2LNB A;  3K0L A;  1PP8 F;  2PG4 A;  4ZYG A;  5E1X A;  2D2W A;  5E8G A;  2JPB A;  1S29 A;  2MBF A;  2CSO A;  2FOK A;  3Q5F A;  3M8F A;  1R1V A;  4U7B A;  5CVR A;  1IF1 A;  1LJ9 A;  1SMT A;  4IHS A;  4FX4 A;  2ZBK A;  2HEO A;  4GCV A;  4KUM A;  1S8N A;  2H6B A;  3JAM K;  4UHT A;  1B4A A;  1LEA A;  3HYI A;  1LEB A;  4ZZD A;  1PDN C;  5LEK A;  5HLI A;  2IW5 A;  3WE2 A;  3T1B A;  2OQR A;  1IW7 F;  4L9N A;  5BMZ A;  4B09 A;  2FBK A;  4LD5 A;  1BM9 A;  2LSO A;  2CGP A;  2XKO A;  4HF0 A;  3FM3 A;  3AAF A;  1BI3 A;  2R3S A;  2FU4 A;  5JHU A;  2P4W A;  1ZRD A;  1S6L A;  3SQN A;  2HKX A;  4M71 A;  2FE3 A;  1ZAO A;  2HWV A;  3T8T A;  5JI6 A;  5DCF A;  4HA8 A;  3E6D A;  4CZZ A;  1IAW A;  3GF2 A;  3F8M A;  1P4A A;  5HS7 A;  1R7J A;  2HZT A;  2ZKZ A;  2FXA A;  2L01 A;  3REO A;  1K6O A;  1FSE A;  3E3V A;  5FB2 A;  5FD6 A;  2HDC A;  3R0A A;  1KA8 A;  3G3Z A;  5F64 A;  3BPV A;  3GZ6 A;  1I1G A;  1DP7 P;  2IJL A;  4YFK F;  3HOT A;  2V79 A;  3JW4 A;  4IF4 A;  4MTE A;  3W6J B;  1OMI A;  2EV5 A;  2VC0 A;  2HQN A;  4G6Q A;  2E1C A;  3L9F A;  2HR3 A;  1SD5 A;  4PGH A;  3IWF A;  2JT1 A;  3J7A O;  3HRU A;  4KNY A;  2A5Y B;  1KYZ A;  2STT A;  4JBA A;  5FLX Z;  1CF7 B;  1H0M A;  4HYE A;  4ESF A;  5J6X A;  4XLP F;  2FBI A;  4A12 A;  3CO7 C;  3S2W A;  2QQ9 A;  3F8N A;  3ZMV A;  4I0A A;  4RB3 C;  2QYO A;  1J2X A;  5DD4 A;  2Z9O A;  4YFX F;  1F4K A;  1I1S A;  1ZG5 A;  5L3F A;  4U7D A;  4EM1 A;  5H6Q A;  1T39 A;  1BIB A;  1CF7 A;  3QU6 A;  3IWZ A;  3TOB A;  3ZMU A;  3E6B A;  3DP7 A;  1B59 A;  3WOD F;  2L4A A;  1X3U A;  1FPQ A;  1KGS A;  4BYY A;  3MZY A;  3CUQ C;  2PJP A;  3KET A;  1XSX A;  4HF2 A;  4WXD A;  1SMY F;  3C18 A;  1J75 A;  5IT9 Z;  1U78 A;  3M1E A;  3K2Z A;  2ZXJ A;  3GW2 A;  1RUN A;  4ESB A;  2GZW A;  2OD5 A;  5D6F A;  5LGT A;  1P4X A;  4EJO A;  2GQQ A;  2HYF A;  5KVR A;  3WTU C;  1KQ0 A;  2XV4 S;  4LJZ F;  3FX3 A;  4G9Y A;  3CUO A;  4XLN F;  3R0J A;  3EQL F;  5H20 A;  2G7H A;  2P7V B;  4YG2 F;  5FGM A;  1J0R A;  3C3W A;  3WGG A;  1XGO A;  1FYM A;  4P55 A;  1P2F A;  1REP C;  1GXQ A;  4LMY A;  3FXQ A;  4Q4Z F;  1OKR A;  3T0Y A;  5CVI A;  3ULQ B;  4IJA A;  2F2E A;  1K7A A;  2B0L A;  2A68 F;  2VE8 A;  4WF2 A;  4IRI A;  1ON2 A;  4DNC A;  1IN7 A;  3I71 A;  4NB5 A;  3TDU C;  2EFQ A;  2D1V A;  4HOB A;  1T38 A;  5FD5 A;  5EEG A;  1BC8 C;  1TNT A;  2P5K A;  4UVB A;  3FZV A;  3TO7 A;  2ACJ A;  3BP8 A;  4MEX F;  3HSF A;  2MA3 A;  1OYW A;  3BOQ A;  5D5W B;  2EV6 A;  3T5X A;  3W6K B;  5D8K B;  4EJT A;  3FF5 A;  4IPA A;  2P5L C;  4GYI A;  1XGM A;  5E17 F;  2R7F A;  4KIF A;  3EYI A;  2UWM A;  1S7A A;  1SFX A;  1ZLJ A;  1P92 A;  5BPI A;  2KJB A;  2ZNY A;  1ZYR F;  5AIQ A;  2DU9 A;  1OYI A;  2FNA A;  2RN7 A;  5E1Z B;  3WU0 A;  3TGN A;  3V8J A;  1DPU A;  1BI1 A;  5BOX A;  3F21 A;  4EGY A;  5J8C A;  4H0E A;  2HKO A;  4IHT A;  4AIK A;  4PCQ A;  1XSD A;  2DT5 A;  2W25 A;  2ZO4 A;  2MD5 A;  2RV8 A;  2RGV A;  3ISP A;  2P6S A;  1FWZ A;  3WU1 B;  4EQQ A;  3IKV A;  2QQB A;  4AD9 A;  1KU7 A;  4MEY F;  4HV5 A;  4N9H A;  1YW8 A;  2BYV E;  4AVP A;  1B6A A;  3V8K A;  2X0L A;  3WGI A;  4WX9 A;  3JSP A;  3FMS A;  1ON1 A;  3QPH A;  2EA4 A;  3I0T A;  3BDD A;  5E8I A;  3KZY A;  1FSH A;  2VXZ A;  3CDH A;  5A2Q K;  1W7P D;  1UST A;  2VT2 A;  5FO5 A;  2QM3 A;  5CVJ A;  1YW9 A;  1WRJ A;  3E5Q A;  2V9V A;  4ZYH A;  1W7P B;  1G4D A;  2M45 A;  1ZAR A;  2VBW A;  3EUH A;  3F23 A;  2G7U A;  3QOP A;  1H9G A;  1WWX A;  3GZ5 A;  1XMK A;  1V4R A;  3F6O A;  3QP6 A;  3N4M A;  1ZG1 A;  3FXR A;  2WV0 A;  4XSX F;  2L02 A;  3P9C A;  3ERE D;  1W5S A;  3HTS B;  2XHK A;  2K27 A;  2DTR A;  3NRV A;  1B9M A;  4ENN A;  3SZT A;  4RGU A;  2GA2 A;  4EMS A;  3GEZ A;  1W7P A;  3V8L A;  4ENJ A;  3B02 A;  3LQR A;  4AIJ A;  1HKQ A;  5BS6 A;  3J80 K;  1XN7 A;  4O5V A;  4HDV A;  3DPT A;  4EV0 A;  5LEJ A;  1MGT A;  3I4P A;  5H6R A;  5HDN A;  2FML A;  3RYR A;  1YS7 A;  2QVO A;  1SD4 A;  3GFM A;  1BJA A;  5D5U B;  3KZZ A;  2W57 A;  4MGR A;  1FX7 A;  3TOA A;  2Q8K A;  3ZQ7 A;  4R79 A;  4OMY A;  3F8B A;  3M7G A;  5L3C A;  4HX4 A;  3IHU A;  1FNN A;  1DUX C;  1MD0 A;  3ZMS A;  4FX0 A;  2KJC A;  5F1R A;  1ZRC A;  2F5E A;  4Z2Y A;  3MAJ A;  1ONV A;  1QO0 D;  1OYY A;  3E5U A;  1IN6 A;  1KU2 A;  5HOO A;  2OQG A;  1K79 A;  1O3T A;  1HW1 A;  3LA3 A;  1YO5 C;  3MQ0 A;  3ZP5 A;  3ML6 A;  3LST A;  3WTV C;  3C1D A;  2K7L A;  3HRT A;  2RVC A;  3KEO A;  1FBU A;  2DPU A;  2PI0 A;  2QBY B;  4ON0 A;  4TV7 A;  3KP6 A;  1IRF A;  1USS A;  1LDK B;  3CLO A;  4XBF A;  3GX4 X;  1S7O A;  1VTN C;  3B73 A;  1QZZ A;  1FZP B;  1IXC A;  2HFH A;  1KYW A;  3KLN A;  3ZPL A;  4BH9 A;  1MJB A;  1UHW A;  1HSJ A;  5CLS A;  3J81 K;  3KFW X;  1RI7 A;  2MH9 A;  3D0S A;  1NHA A;  2FEZ A;  3QU3 A;  4MQV A;  2QBY A;  3EDP A;  4L5I A;  2CWE A;  4OIN F;  2FA5 A;  1FP1 D;  2VC1 A;  5LBQ A;  1W4M A;  2Z3Y A;  4JK1 X;  1XSV A;  3BPX A;  4LFU A;  1OPC A;  2EB7 A;  2BGC A;  2M30 A;  3DXJ F;  2F5C A;  4YFN F;  2LF8 A;  4ESJ A;  2YPR A;  3OOP A;  2AXL A;  4L0Z B;  2ETH A;  2ADU A;  2JPC A;  4KMU X;  1ZRE A;  2XAG A;  2O03 A;  4PDK A;  1R1U A;  4M6X A;  5DD8 A;  2K02 A;  1TNS A;  2CO5 A;  1J59 A;  4CYD A;  4OMZ A;  2KIU A;  3DEU A;  3KE2 A;  2IA2 A;  4MHG A;  1Z7U A;  4OOI A;  2G9W A;  4Q48 A;  2CG4 A;  1EH8 A;  3RDI A;  4YII A;  1QBJ A;  4FHT A;  4M9S A;  4RAZ A;  1XCV A;  1IRG A;  4EJU A;  3FHZ A;  2VOP A;  1TLH B;  1RIO H;  3KLO A;  3R4K A;  4RGX A;  2QUF A;  2PFB A;  4A5N A;  5D8L B;  5ICG A;  3E5X A;  4I01 A;  1BIA A;  4CIC A;  3G73 A;  2M1B A;  4G7O F;  1JE8 A;  4CO8 A;  3ZMT A;  2QQA A;  2KKO A;  1YFH A;  2YSR A;  2XAJ A;  4M72 A;  5ERI A;  4OIR F;  4HW0 A;  1ZH5 A;  3ZN1 A;  2PBI A;  4U0W A;  2XAS A;  3P9I A;  3L2C A;  1T2K A;  3QP5 A;  3FXU A;  5HS9 A;  2W85 A;  1L3L A;  3I58 A;  1KQ9 A;  3BJA A;  3I64 A;  5KK1 A;  1P6R A;  2A6E F;  1GVJ A;  2DFI A;  2BBY A;  3ZMD A;  3KP2 A;  2H27 A;  4P5O A;  5K1Y A;  4MQ9 F;  3TO6 A;  2DI3 A;  4A0X A;  2LF7 A;  4OIQ F;  3IC7 A;  1T98 A;  3P9K A;  4UV9 A;  4LG0 B;  2IA1 A;  2DK8 A;  2O0Y A;  1JHF A;  1EH7 A;  3GUD A;  2QWW A;  1KU3 A;  2V1D A;  2EFW A;  4UUV A;  3JTG A;  1FYK A;  5D4S A;  3R60 A;  5BPD A;  1STZ A;  4A6E A;  2M8E A;  1G3T A;  1F9N A;  1FYL A;  4BXU A;  4I2O A;  1HKT A;  1AWC A;  3LWF A;  2Y0M A;  2XRN A;  2MLG A;  4B8X A;  4G7H F;  3GWZ A;  4PZJ A;  3HHH A;  1W5T A;  4Y17 A;  4BNC A;  2K4B A;  4P9U A;  1R23 A;  4LG0 A;  4HBL A;  3BJ6 A;  5JVT A;  2CYY A;  4U0Y A;  3KP4 A;  5E1W A;  2C6Y A;  2Y48 A;  3LAP A;  1OR7 A;  1LDD A;  4L5J A;  5ICF A;  4EJW A;  4OIP F;  2O6G E;  5JFR A;  1YTY A;  3I59 B;  4S04 A;  1MJA A;  2WWY A;  4MTD A;  3VOD A;  1ZGJ A;  5BQT A;  3BWG A;  2M5W A;  3WTW C;  3N97 A;  1HKS A;  1UB9 A;  2DK5 A;  2HTJ A;  5L3D A;  2PEX A;  2L4M A;  3NQO A;  2P8T A;  4KA4 A;  1TTY A;  1XMA A;  1RUO A;  3FMR A;  5AON A;  2EJR A;  4GGG A;  1YYV A;  4QWQ A;  4ZYD A;  2VT3 A;  1BN5 A;  1FLI A;  1YS6 A;  5LGU A;  1LQ1 A;  3I59 A;  1LB2 A;  5DUK A;  3ABU A;  3MCZ A;  2PLY A;  4A5M A;  4EGZ A;  1T6S A;  4CHU A;  2RC4 A;  2J5O A;  4LLL A;  4I0B A;  1HST A;  1RZ4 A;  4BAY A;  2BE5 F;  2A6H F;  4I98 B;  2EA2 A;  4NHJ A;  2NAZ A;  4OU0 A;  4M9X A;  1U5T C;  1CGP A;  4HV6 A;  1O7L A;  2NNN A;  4KYW A;  3CUQ B;  5DEQ A;  4EJV A;  3RTR A;  1O3R A;  2VON A;  4RB1 A;  2IA0 A;  3JSO A;  1GHC A;  1O57 A;  5DUI A;  1IN5 A;  1YW7 A;  2VBY A;  5L3E A;  1FOK A;  3HTU A;  3M9A A;  1WKM A;  1HW2 A;  4CDG A;  1YLF A;  4UVC A;  1A04 A;  2H09 A;  4A2U A;  3RPQ A;  5CVU A;  4L9V A;  5A2Q Z;  2IVM A;  4Y15 A;  3GYH X;  3EET A;  2ISY A;  2IRF G;  3CUQ A;  4EVI A;  4CXF A;  3C7J A;  2A3S A;  2EFP A;  4E70 A;  4KIC A;  4G8X A;  4N9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...