6PAXA

Crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
b'SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26 NUCLEOTIDE DNA
publication title Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA02
3EYIA 4Y13A 1I1GA 1HSJA 1BM9A 4U88A 1KA8A 5ICGA 2AS5F 2C6YA 3MQ0A 3E6MA 2XUBA 3O2PE 4WXCA 5J6XA 2RDPA 2K4JA 3VEPA 2M1BA 4L5IA 2HTSA 3R60A 1WKMA 4RGUA 1LQ1A 2CGPA 2EFNA 3QAHA 1IW7F 3F72A 2ZNZA 3TQNA 3QPTA 1YW7A 1H9GA 4L9JA 4YFNF 5LGUA 2QBYA 3FXRA 1DDNA 5DD4A 1YLFA 2DI3A 1XGMA 2FSWA 2P6TA 3HTSB 4O5VA 4HYEA 1F1ZA 3HYIA 1KYZA 3I54A 3SZPA 1FP1D 1PP7U 1P2FA 2X4HA 2ISYA 1W5SA 4KA4A 3ZPLA 4WWCA 2QZ8A 2OU2A 3KZZA 3H92A 4ENMA 1O7FA 3I64A 2FBIA 4YIIA 2EFPA 3KE2A 3FMRA 3BJAA 4WF2A 3F3XA 5HLHA 2IRFG 2QQAA 5E1XA 1XMKA 4BHBA 2DT5A 1JHHA 1U5TA 1RUNA 2KIFA 3ZMVA 1XSXA 2VE9A 1ZYRF 2CFXA 2R7FA 2GIVA 2ESHA 3IWFA 3GFLA 3F8CA 4HDUA 3WE2A 3K2ZA 1SD6A 2EWNA 4IRHA 3GXOA 3TDZC 5LEKA 3J80K 1YYVA 4DQ2A 5FFXA 5ILVA 3AAFA 4ZYEA 3NQOA 4GYGA 3C7JA 2PJPA 2FOKA 3ZQ7A 3DP7A 3C18A 5ICFA 3TGNA 2HQRA 4EGZA 3ZMZA 3K1MA 4EJTA 2MH9A 2BV6A 3U9GA 2COMA 4UV8A 4BHPA 1T6SA 2E1CA 4A5MA 3BPVA 3NEUA 4ESJA 1RIOH 5E17F 1OPCA 5ERIA 4M9XA 1ZLJA 4WCGA 5ICEA 2O03A 2FU4A 3M9AA 4I98B 3C1DA 4MNUA 5HS7A 1J0RA 2P5LC 2EV6A 2P6SA 3TO9A 2M30A 2XAQA 6PAXA 4GXOA 4EM1A 2G7HA 2HGCA 2J5OA 2QUFA 3F21A 1BC8C 2TDXA 3GZ5A 4UNOA 2XAGA 4E70A 3V8KA 5BPDA 4LB5A 4ENKA 4RGXA 1XSVA 1PP8F 2UXXA 2CW0F 5FFZA 2OZ6A 3TOBA 4U0YA 4CYDA 4EGYA 2BEOA 1HQCA 3KEOA 1O57A 2QENA 2FRHA 4AD9A 2H6BA 3BDDA 3ZMDA 2DBBA 2XAJA 2KJCA 3U1DA 5L3BA 1YO5C 2CO5A 1U78A 2IP2A 2D2WA 3OV8A 3NRVA 5LEJA 2UWMA 4HLYA 4TV7A 1IN5A 1T39A 2ADUA 4RGSA 5E8GA 3BPXA 4N9HA 5IT9K 2G9WA 4YFXF 1K6OA 3E3VA 1LDJA 2P7CB 3L09A 3HOSA 1BOAA 5CVUA 4LG0A 3TDUC 1JHFA 3KP5A 5EEGA 4KNYA 1D5VA 4RGRA 3WTXC 1J7KA 1UB9A 3FWEA 3V8LA 5H6QA 2HDCA 1R1TA 3E5UA 2JPCA 2BBYA 2KJBA 4KYWA 3C3WA 5DD8A 3SXYA 1WSUA 1YTYA 2EA2A 1YS6A 3LAJA 1MD0A 2YPRA 2LKPA 3T0YA 1U6GA 4EJVA 2P5KA 4MHGA 1USSA 4BNCA 1I27A 4IPAA 2XAHA 2DU9A 4N9IA 1FZPB 3EUHA 2D45A 1W7PD 1ZAOA 3ZN1A 3HRTA 4B09A 3JSPA 3P9KA 1PDNC 2R7DA 1IXSB 2DPDA 2VONA 1RZ4A 4UV9A 1O3SA 1P4AA 5LGTA 1JXSA 2E7WA 3RKXA 4OIOF 1B9MA 3QU3A 1O3QA 3F6OA 2DQLA 2Q0OA 1KU7A 4PZJA 1OMIA 5LGNA 3VODA 1P6RA 4IXAA 3KP6A 1Y0UA 1ULYA 4XSXF 3ROUA 2QYOA 1FNNA 5L3CA 3LA2A 5FD6A 5L3DA 3CTAA 2R3SA 2VT2A 1O3RA 1R1VA 1FBUA 4A12A 1NHAA 2V79A 5ICCA 5LBQA 1K78A 3F8BA 4M73A 4L0ZB 2VBWA 1I6XA 1X3UA 2Z3YA 5KK1A 3IKVA 2G7UA 4OIRF 2ETHA 3W6JB 4KIFA 3QOPA 1U8RA 4LB6B 3GFIA 2BGCA 2RGVA 2XHKA 2ACJA 3JTGA 2GXBA 5JHUA 3V7CA 5F64A 2XKPA 1ZN2A 2ZMEA 4I09A 3K1PA 3IL2A 4U7BA 3F8NA 2E1NA 3EETA 4L18B 1SFXA 3GFMA 3GX4X 4ASNA 4FT8A 1T2KA 4Q48A 2HYGD 1ZREA 2A07F 4OU0A 1QNTA 5AIQA 3CO7C 2RQPA 3G3ZA 5E1ZB 2W25A 5CJ9A 2LF7A 3QRFF 4G8XA 4HF0A 3I53A 5LLQA 3D5LA 3GO5A 3F23A 3HSFA 4MEXF 4OIQF 1ZG5A 3WU0A 5LHHA 4LJZF 3KEQA 4R1HA 2FE3A 3LAPA 4MTEA 1DPRA 4HX8A 2DPUA 2EV5A 5ED4A 1TTYA 4FHTA 2K27A 3RYPA 2VODA 4HV5A 2ISZA 3T8TA 4L5JA 4CO8A 4ZZDA 4P9FA 3MCZA 4L9VA 2DW4A 1J5YA 1TQMA 2O3FA 3VFZA 1SD4A 1Z9CA 3Q9SA 3RDIA 4AIKA 2Z99A 2V1XA 3R4KA 1QQIA 1O3TA 4FX0A 3IRRA 3Q5FA 2A3SA 4XSZF 5ILUA 4A0ZA 4XLNF 2P5VA 1KU2A 4I0AA 2WV0A 3F8MA 4LLGF 3HSRA 5D4RA 4BH9A 4QLCU 5FLXZ 2UXNA 1CGPA 4KDPA 1OYYA 2ZNYA 1BBYA 2FBHA 1OKRA 4RAZA 4H0EA 1MKMA 3JTHA 2M5WA 5D6EA 1F4KA 3S2WA 4MGRA 1BI3A 4O6JA 2GWRA 5A2QZ 3MAJA 2XROA 1EH6A 1QO0D 1G3SA 2L4MA 4P5OA 1MZBA 5BOXA 1IXCA 1R7JA 2ESNA 3IKTA 1H9TA 2ZBKA 2FXAA 1XMAA 2EJRA 2A61A 4EQQA 1BC7C 3M7GA 2EFWA 1MDMB 1IN6A 2L01A 3KP4A 5K5OA 3CUOA 2GA1A 1QGPA 2YX7A 2MD5A 2XAFA 1MJBA 4HDVA 2QVOA 1WI9A 3ECHA 4NHJA 5J8CA 4AIHA 4UVBA 1T0FA 3QP5A 1CF7A 5JVTA 5HDKA 3LWFA 3CUQB 4I02A 5D5VB 1GHCA 3N97A 2PBIA 5BPIA 1SD7A 3RPUA 4HV6A 1WRJA 3RIRA 3FHZA 2OZUA 1HBXG 2ZCWA 3B02A 4KIGA 1XN7A 1J2XA 3ISPA 1PUEE 1YW8A 4G6QA 4UXNA 3COAC 2HYFA 1LDDA 2K86A 1IXRC 4BYYA 3ZP5A 2Y75A 3M1EA 2X0LA 3JAMZ 1J75A 1E2XA 2RNJA 1B4AA 3GW2A 3LA7A 2AXLA 2P7VB 1LEAA 3ECOA 2RV8A 1HXDA 3B73A 3I59B 4Q47A 2HZTA 3HRMA 3ZN0A 3GWZA 3ELKA 3ZMUA 3FX3A 2EFQA 3EYYA 1Z1DA 4ZYDA 1DUXC 3JSOA 3BJ6A 4ETSA 3QU6A 1ON2A 2ELHA 2P8TA 1FSEA 2M8EA 4CGZA 3R6SA 1R5GA 1EH7A 3V8JA 2VBYA 1S6LA 5E18F 3K9TA 3F22A 3KCCA 4I01A 4EMSA 1R23A 3CJNA 2PI0A 1YFHA 5TJJA 2V6CA 1O7LA 2V9VA 1D8JA 1IAWA 1FLIA 5HVQC 2D1VA 3U2RA 1IN8A 1G3WA 4UUVA 4CICA 4IHTA 3LSTA 2IA0A 4HF1A 4HQEA 1RUOA 1TQPA 5E1WA 4I2OA 2DK5A 1W7PB 2MLKA 1WQ2A 4BAYA 2FQ3A 2K02A 3WGIA 4L9NA 5LHGA 2HWVA 4M72A 3KP3A 1KYWA 5HS9A 1WWXA 1S29A 3R0AA 4YIFA 2STTA 3SHFA 1TLHB 2F5CA 5EEHA 2A6HF 1TNTA 2MA3A 3KP2A 2FMYA 3JAMK 1AWCA 1Z91A 2GZWA 4QWQA 3CUQA 3FXQA 4R79A 1FWZA 3TKYA 3O3KA 4ENNA 2L3DA 4NB5A 3WTWC 2PQ8A 3E97A 1ZG1A 1XGSA 1ZHFA 2NRAC 4UVAA 2NNNA 1ODDA 3M8FA 2MLGA 5LRRA 2L02A 3T1BA 3DXJF 1Q1HA 2QWWA 1UHMA 4RB0A 1FPQA 4G7HF 1ZRFA 2QQBA 3GF2A 4Q4ZF 2YR2A 3EDPA 2E7XA 2F5FA 2CG4A 3L2CA 2PMUA 2Q2EA 2FNPA 1J9IA 2H94A 1TW3A 1I5ZA 4S05A 1K7AA 4KFCA 1QZZA 1H0MA 3R0JA 4UHTA 3H3ZA 2YSRA 1FT9A 3RI4A 1LVAA 1BIAA 5E8IA 1YW9A 3MZHA 4OMYA 2CWEA 2JPBA 2DLLA 2VBZA 2DO7A 2HS5A 4HAMA 4M9ZA 4HQMA 4BHCA 4CHUA 4A6DA 1ZARA 1P92A 3CO6C 3E6DA 3K69A 5D5WB 1KQ0A 3E6CC 2VT3A 1EH8A 2NAZA 4PGGA 2QBYB 4MTDA 3RPQA 4IVNA 4IRIA 1L3LA 2Q8KA 2H27A 2O61A 5LRSA 1E17A 2KIMA 3EQLF 1YS7A 5CVRA 1BI1A 4P9UA 3WTUC 1KQ8A 1MJAA 1MJ9A 5LHIA 5FD5A 4EJUA 3ERED 5FGMA 2IA1A 2QM3A 5DV5A 3FM3A 4ENJA 2Y48A 3GZ6A 1LDKB 2JSCA 5FO5A 3RYRA 4ZYHA 1QBJA 1ZG3A 1OR7A 4KIBA 3I71A 3M8EA 2O6GE 1AOYA 3E5QA 1FX7A 1XCBA 3LQQA 4HLXA 2KIUA 2VN2A 4RAYA 4HOBA 3HRUA 4UVCA 1U3EM 1R00A 4KN7X 2V1DA 3VB2A 1GVJA 4G6DA 1T98A 3P9CA 1FC3A 4L9TA 2XGXA 4MQVA 1U5TB 1B6AA 1KQ9A 3BWGA 1XB4A 1ZGAA 4RS8A 2H6CA 3DPTA 2RC4A 3I5UA 3GLXA 1ON1A 1KU9A 1SD5A 1IN4A 4HA8A 5DCMB 1B9NA 1DPUA 2IA2A 3KLOA 1YG2A 2KKOA 5CVJA 3MFKA 3LFKA 2GAUA 1FBQA 2FMLA 1FBSA 3K1NA 1S3JA 1XDSA 5D4SA 3BZ6A 4RB3C 1ZLKA 4EVIA 3V7RA 2O8XA 2YU3A 5CYVA 4IHSA 4JBAA 2MBFA 3J80Z 3GFJA 3P9IA 1Z05A 2W57A 4KUMA 2PMHA 4NQWA 5AONA 3WTVC 4U0WA 2CQKA 2ZJ2A 2Z33A 3QP6A 3TO6A 3GEZA 2YX4A 2Y0MA 1BIBA 2DAOA 1F9NA 1LNWA 2BE5F 1OYWA 2Z9OA 1JGSA 5BMZA 3IWZA 2L4AA 3SFZA 3HTUA 2KRFA 2D1HA 1IF1A 4CXFA 2EK5A 4YG2F 5HDNA 4LK1F 5KVRA 5BS6A 4I7HA 4EV0A 3F6VA 1BI0A 4M6XA 3I4PA 3RJPA 1REPC 2K4BA 2OAZA 2IVMA 2EB7A 5J8FA 4OOIA 2IT0A 1IUYA 2FF4A 4WK8F 1Z7UA 3FM5A 1BI2A 1MGTA 3T5XA 4A0YA 1UCRA 2PG4A 3BROA 3WU1B 3KLNA 4IRGA 2STWA 4YFKF 1YQAA 2GQQA 4OINF 2J5PA 5DUIA 2LSOA 5D8KB 1TQIA 4RB2C 4FX4A 1HKTA 2PFBA 3V4GA 1G4DA 1XCVA 2F2EA 1SAXA 3DKWA 3FMQA 2DFIA 4EJWA 1OYIA 4LFUA 4A0XA 1F5TA 5HLIA 5HOOA 1HKSA 3FF5A 3J81Z 3WE3A 1K79A 4HZFA 2LNBA 4M71A 2JT1A 3FXUA 3CUQC 2ZXJA 2PEXA 4EM0B 3REOA 2OD5A 3ABTA 3IHUA 1FYMA 3ML6A 1XGOA 4PDKA 5DYMA 4LG0B 4P55A 1ZRDA 4F7ZA 2OQRA 5DCMA 1U2WA 1TNSA 1V3FA 2QLZA 2IJLA 3J7AO 4Y17A 3DF8A 1XSDA 2XASA 3JW4A 4Y15A 1Z6TA 2WTEA 4LGWA 3KFWX 1J59A 3FZVA 2LDUA 1ZRCA 5IT9Z 5FLXK 1R58A 2CYYA 5DCFA 4LMYA 1HW5A 4M6YA 3WTZA 5JR3A 4G7ZF 2P4WA 4KICA 4ZYGA 3T8RA 3MWMA 3I0TA 3VOEA 4A5NA 5A2QK 1W4MA 3P7NA 2DQRA 2Z5UA 4S04A 4P96A 5D8LB 3CLOA 4ESBA 3FMSA 1R22A 1IRGA 1GXQA 3L00A 2FBKA 2VE8A 1BN5A 5DUKA 2HKOA 2ZO4A 5ILSA 3QPHA 2JTVA 3SQNA 4I0BA 5TRDA 3HHGA 4IJAA 2EFOA 3CDHA 1SMYF 5K1YA 4AIJA 5CVIA 4G9YA 4OMZA 5DEQA 1B1BA 3LQRA 3E6BA 2HR3A 2CSOA 4KT5C 1V4RA 1XGNA 3GVAA 2VBXA 4LLLA 2RKHA 4M74A 4DNCA 3BY6A 3KZYA 1G3YA 1KU3A 2HTJA 5HDGA 2K7LA 2F5DA 2IPQX 4O3MA 2A68F 4K2EA 3G73A 1ZH5A 1XDUA 5F6FA 1G3TA 1QPMA 3DEUA 1UFMA 1K78B 4HX4A 2HKXA 4G7OF 3J81K 1FYKA 2HEOA 5K5RA 5H6RA 4Z2YA 2F5EA 1MDMA 2JZYA 2GXGA 2H09A 2VC0A 2NS0A 1UHWA 4G94A 1GXPA 2W84A 2EA4A 3N4MA 2VC1A 4WXHA 3ABUA 3DQVC 2XRNA 3F8FA 1DP7P 3Q9VA 2ZMEB 2L54A 1LB2A 4L0YB 4N0BA 1S7AA 2MC3A 2FNAA 5BQTA 5D6FA 2DK8A 4B8XA 3HOTA 5CVVA 3MEXA 1IZ1A 2HOEA 3WG9A 4EJOA 1TW2A 1USTA 1R1UA 3K0LA 4OIPF 1C0WA 1P4WA 5K5QA 1I1SA 1G6NA 3SZTA 1S8NA 2RN7A 1TBXA 3HIFA 3WTSC 1YIOA 1FSHA 3GYHX 1S7OA 1Z6RA 4MQ9F 5D5UB 4WXDA 4GCVA 4CDGA 1FY7A 3E5XA 1LJ9A 3I59A 4ON0A 4KMUX 2XKOA 2LF8A 3ZMSA 5L3EA 4ZH4F 2NNYA 2V1UA 1RI7A 4AVPA 5CLSA 5IT3A 3RTRA 5F1RA 3BJOA 4M9SA 4MEYF 2ZFWA 1BJAA 4HW0A 4CZZA 3TOAA 3WTTC 1SFUA 2VOOA 3DPLC 2HQNA 1KGSA 1ONVA 2VOPA 3DFGA 3GUDA 4HBLA 2RVCA 2PLYA 2IW5A 1HKQA 3IC7A 3WGHA 4IF4A 4KN4X 4GGGA 3MZYA 5AIPA 1EV7A 3RKWA 1SMTA 1B59A 3PQKA 3WTYC 2PN6A 3D0SA 3L7WA 4PGHA 1A04A 5L3GA 4A6EA 4D0PA 3RKYA 1JE8A 2FEZA 3OOPA 1IN7A 1P4XA 2XV4S 1W5TA 3R61A 4XBFA 4HF2A 3ZMTA 5L3FA 2GA2A 2XVCA 3HHHA 4WX9A 1FP2A 3BP8A 1W7PA 1VTNC 1HW1A 2UZKA 4ESFA 4ZZLA 4KMFA 2QQ9A 2FA5A 4BXUA 1D3YA 1RNLA 3TO7A 3HUGA 4GO1A 2VXZA 2W85A 4U0VA 4JK1X 5HLGA 2JRTA 3I58A 5E20A 3H3UA 3IRQA 2OA4A 5JI6A 1D8KA 4U7DA 5H20A 1ZGJA 2M45A 1XD7A 2NYXA 4PCQA 3PFIA 1QZYA 5HS8A 3WGGA 2EV0A 5DDGA 1L0OC 2A69F 1FYLA 3PQJA 2O0YA 3HRSA 4EM2A 1IRFA 2B0LA 4JQFA 2M87A 3WODF 2DTRA 1CF7B 3L9FA 1FOKA 1LEBA 2BYVE 1U5TC 3DV8A 1STZA 2MH2A 4LD5A 2A6EF 4R8HA 3KP7A 3W6KB 2HFHA 4LK0F 4XRFA 3ULQB 4A2UA 3HSEA 4RB1A 3LA3A 2A5YB 2XIGA 2OQGA 2W24A 3KETA 1SFEA 4BQAA 3V7SA 4XLPF 1HW2A 3O6BB 2OBPA 5FB2A 3BOQA 5D5XB 1R5HA 2WWYA 4LLNA 1R36A 1T38A 4Q5SF 4HX7A 2WC2A 4AWXB 5JFRA 4GYIA 1HSTA 2ZKZA
chains in the Genus database with same CATH superfamily
3DEWA 3S3OA 3EYIA 2LLKA 4Y13A 3G71I 1I39A 1I1GA 2FOWA 1TL8A 3PL8A 1HSJA 1BM9A 4U88A 1KA8A 5ICGA 4Z6YA 2CW7A 2AS5F 2C6YA 2EINH 3MQ0A 5M5WJ 3E6MA 2XUBA 1ZKGA 3PM1A 3O2PE 4WXCA 2HQ5A 4MFDA 5J6XA 2ZXHA 4PJLA 2RDPA 3ABKH 2KIQA 5GADJ 2F4MB 2K4JA 1BJZA 3NWTA 1UJ8A 3VEPA 1JKQC 4BJ6C 2M1BA 2F6CA 4L5IA 2HTSA 1E3HA 2EZHA 5HNFA 3R60A 3Q0WA 1VI0A 1WKMA 1X3WB 4UB8C 4RGUA 3ABMH 1LQ1A 3LSGA 2CGPA 2NVTJ 2DXIA 2EFNA 2DT7B 4A3CJ 3QAHA 1IW7F 4NUBA 2V1NA 2EIMH 3TL4X 3F72A 2ZNZA 4BE2A 1F36A 3TQNA 3JRHA 3QPTA 1YW7A 4QTRA 1H9GA 4L9JA 1SAUA 3DTEA 4YFNF 5LGUA 2JMWA 2QBYA 2QCOA 3FXRA 1DDNA 5DD4A 2W48A 3RZOJ 1UAAA 1XC5A 1VF9A 1YLFA 3SDGA 2DI3A 3OYMA 4IOAF 1XGMA 2FSWA 2P6TA 3HTSB 4O5VA 1QRYA 4HYEA 2O9LA 3MKYB 5FKNA 1HF0A 3CDIA 3FK6A 1F1ZA 1Y1VJ 3M4OJ 1VQ8I 2BVMA 3HYIA 1RR8C 1TZLA 1KYZA 3S3NA 3I54A 2JA5J 2XPVA 3SZPA 2WB1A 1FP1D 1PP7U 1P2FA 2X4HA 2ISYA 1W5SA 4OAZA 4XICA 4KA4A 3CJRB 3RCOA 1NG6A 2CMPA 3ZPLA 1VFCA 2OUMA 2ECBA 3L2UA 3E0JB 4V2FA 4WWCA 2A05A 2QZ8A 2HVSA 1OCPA 1VNDA 2OU2A 3D5SC 2MABA 2ZFUA 2LRDA 2HU9A 3KZZA 3H92A 4ENMA 2DYSH 2OCEA 4FCYA 5JLXA 1O7FA 3I64A 2QSHX 2FBIA 2IEKA 4YIIA 3M3YJ 3L1PA 2EFPA 2E5ZA 3KE2A 1VQOI 3AG2H 3FMRA 2JJ7A 1RKWA 4RAGA 3BJAA 4UB6C 3F3XA 4WF2A 4DYRA 1FIAA 3RKQA 1LKXA 5HLHA 2IRFG 1TC3C 2QQAA 5E1XA 5JHFA 1XMKA 4BHBA 3A2KA 2DT5A 1JHHA 1U5TA 1RUNA 2KIFA 3ZMVA 1XSXA 4DOZA 2XC7A 2VE9A 3CJQB 1SVMA 3QYEA 3HGYA 1ZYRF 2CFXA 1HCRA 2R7FA 2GIVA 1Y8QB 2ESHA 3IWFA 3CZ6A 4ABZA 3PFYA 3GFLA 4C3IJ 3VYSB 3F8CA 4HDUA 3ZQCA 3ASNH 3WE2A 3K2ZA 1SD6A 2EWNA 4IRHA 3GXOA 3TDZC 1A5JA 5LEKA 2XGEA 2JUGA 1YYVA 1RETA 2Q1ZB 4XK4A 4C3JJ 5FFXA 4DQ2A 3J80K 5ILVA 3AAFA 2XF6A 4C2TA 4ZYEA 3NQOA 4A3BJ 4GYGA 4D7MA 3C7JA 2WY8Q 1IJWC 2PJPA 4E4HA 3BR2A 4BXXJ 4PK4A 2FOKA 3ZXSA 3PJRA 1J09A 2E1OA 2X6OA 3OYJA 2BY2A 3MKZA 3ZQ7A 2OPTA 3DP7A 3C18A 3BZCA 2CUJA 2NVQJ 1YE9A 1T8IA 5CKTA 5ICFA 3ESWB 3TGNA 2HQRA 3WHBA 1QPIA 4ZC3A 2GBYA 4EGZA 2BY0A 3ZMZA 1YJNI 4KITB 3GZNB 3BQZA 3K1MA 2Q2EB 3BTCA 3FK7A 3BR3A 4EJTA 2MH9A 4AC0A 4DIQA 2WBMA 2BV6A 4U87A 3K10A 3U9GA 4XOTA 1S72I 3H0GJ 2XB0X 2COMA 4UV8A 2V9KA 3RSNA 4BHPA 2GOXB 1T6SA 5F0FA 2W4SA 3S16J 1IO2A 2VXDA 2E1CA 4HSTA 2LBFB 4A5MA 2VLAA 4RA2A 1TWCJ 2LY1A 3DU6A 4F91B 3EUHC 3A02A 3BPVA 3NEUA 3HL2A 1Z7LA 4ESJA 1RIOH 2LY2A 1BOBA 4RLQA 2RNGA 5E17F 1OPCA 3OIPA 3BR0A 5ERIA 4M9XA 2BHYA 1GV5A 2X9DA 1XG1A 1ZLJA 3W2WA 5E3OA 1Y8RB 1W1WE 2QGUA 4WCGA 1JUPA 3ZQFA 1X2MA 4LOCA 2LK2A 4PJ0C 2E60A 2FU4A 2O03A 3M9AA 5ICEA 4I98B 3C1DA 4MNUA 5HS7A 4IO9F 1IDYA 3AL0C 1J0RA 2ICWG 2P5LC 3IH4A 3CP2A 2DTZA 1K61A 2EV6A 2P6SA 3TO9A 2M30A 2WAFA 2XAQA 6PAXA 4BBRJ 4GXOA 4XKVA 4EM1A 2DA2A 2G7HA 2DCEA 2L9SA 2HGCA 2J5OA 2KMUA 2QUFA 3F21A 1BC8C 1OFCX 1A31A 2TDXA 3W6VA 3GZ5A 3KYLA 4UNOA 2XAGA 4CCOA 2XDVA 2DYRH 4E70A 4RMNA 1DU0A 1V55H 4XN0A 1NK3P 3LL7A 3V8KA 1R6RA 3JRIA 3H5NA 5BPDA 2I8DA 3H9GA 3PUBA 2ZJQF 2R5YA 3GTPJ 4JYKA 3FBIB 4LB5A 4ENKA 5DS9A 4IHXA 2B9SA 4RGXA 4F93B 2NS7A 1XSVA 3PO2J 1PP8F 3GBGA 2UXXA 3JR9A 2CW0F 4X1EA 5FFZA 2OZ6A 3DPUA 1RC9A 3TOBA 4II3A 2LVSA 4U0YA 4CYDA 3ZQLA 5F27A 3IV5A 4EGYA 2BEOA 3CMYA 4EEFG 1HQCA 2EQRA 4IL6C 3KEOA 1O57A 2E34A 2QENA 3GMEA 2FRHA 4AD9A 4BACA 2H6BA 3BDDA 3ZMDA 2QKMB 2DBBA 5FRMA 2XAJA 2H1KA 2DMUA 2KJCA 4II2A 2IS4A 2BZTA 3HG9A 3U1DA 5L3BA 1YX3A 1YO5C 2CO5A 1U78A 2IP2A 2D2WA 3OV8A 3NRVA 4CA0A 5LEJA 3CCRI 2UWMA 4ITVA 3VPRA 4EATA 4HLYA 4TV7A 2L2OA 4E7LA 2ZMEC 3DCFA 5FKOA 2ELKA 2L7FP 1IN5A 5M5YJ 1T39A 2ADUA 4RGSA 1SEUA 2IGNA 3BPXA 4N9HA 5E8GA 2KZVA 5IT9K 2G9WA 4YFXF 3QYBA 1K6OA 3E3VA 1LDJA 2E1MC 2P7CB 3BG7A 1IGNA 3L09A 3HOSA 1BOAA 3OYIA 5CVUA 4LG0A 2AQFA 3LSJA 3TDUC 1JHFA 3KP5A 5EEGA 4KNYA 3A1YA 2WAQA 3ZCOA 1X4OA 1D5VA 4RGRA 1J7KA 3WTXC 1X4PA 5J1YA 1UB9A 2DFFA 3BQYA 3FWEA 1N75A 4E6KG 3V8LA 4D5CA 4NC8A 5H6QA 1DGRM 3OYHA 2HDCA 1R1TA 4NC6A 4AYBA 5KAIC 3E5UA 1ACIA 1ZTRA 2JPCA 2BBYA 2KJBA 4KYWA 3OR2C 3C3WA 5IP9J 5DD8A 3SXYA 1FIPA 1WSUA 3BG3A 1YTYA 2EA2A 3S8PA 1YS6A 3LAJA 1MD0A 3FKIJ 2XB5A 4ANJA 2VKHA 4W97A 2E5NA 2VKVA 1G59A 2YPRA 1OJLA 2LKPA 3T0YA 1U6GA 4EJVA 2P5KA 4IOCF 2VJ4A 4MHGA 2Y9ZA 5EGOB 1USSA 4BNCA 1I27A 4IPAA 3K7AJ 2XAHA 2DU9A 4YEJA 4A3IJ 2NXNB 3KX2A 4N9IA 3HBLA 1FZPB 1ETOA 4RBOA 3EUHA 2D45A 1W7PD 4XL9A 1ZAOA 3AG1H 5GAHJ 3ZN1A 3HRTA 4M3GA 1XMXA 4B09A 3JSPA 2JSPA 3P9KA 1PDNC 2VQCA 2MG4A 1V54H 1JKPC 2R7DA 1JTYA 1IXSB 2DPDA 2VONA 1WJAA 1OCOH 3DBRB 1FJLA 2E2IJ 1HOMA 5B1BH 2VL8A 1RZ4A 4UV9A 1O3SA 4KISA 3S2DJ 4FTHA 1P4AA 5LGTA 1JXSA 2E7WA 1E0EA 3RKXA 2X6XA 4NQWB 4OIOF 4OAYA 1B9MA 1HC8A 1K4TA 3IAM2 3HDDA 2WADA 3QU3A 1O3QA 2DFHA 2DMTA 3MKWB 3F6OA 5IP6A 3DTIA 2DQLA 2Q0OA 1SC7A 1KU7A 4PZJA 4JX5A 1OMIA 2DDBA 3J7AY 5LGNA 2PJRA 4CH7A 3J7ZI 4ZDOA 4N4NB 3VODA 5HODA 1P6RA 1YX5A 2R7WA 4IXAA 2NVYJ 3KP6A 1Y0UA 1ULYA 4XSXF 4M3FA 2HOAA 4QPQA 3ROUA 5FJ8J 3HKZN 3GTLJ 5GTHC 2ZSIB 3CC4I 2QYOA 1FNNA 1FOWA 2AXTC 5L3CA 2CU7A 2HDDA 2Y31A 3LA2A 4Y7NJ 5FD6A 5F1JA 5L3DA 3OYKA 2CFOA 2W1OA 3GTGJ 3CTAA 3FKJA 1I3AA 1FMVA 2R3SA 9ANTA 2VT2A 1O3RA 1R1VA 3SEQA 2E71A 1FBUA 3M1CA 4A12A 2BVLA 1NHAA 3CDLA 2V79A 4YRVA 3S17J 5ICCA 5LBQA 3TP0A 1K78A 3F8BA 4M73A 3VSKA 4L0ZB 2VBWA 1I6XA 1E3PA 3GTKJ 1X3UA 2Z3YA 5KK1A 3LSMA 3IKVA 1H8AC 2NOJB 2G7UA 4CZCA 4OIRF 1Z3YA 4B1RA 1WVRA 3IH2A 2ETHA 2NVXJ 4G12A 4UUTA 3TW6A 3A0HC 3W6JB 5IP7J 3HZJA 4KIFA 3QOPA 1W5CC 1U8RA 2IS2A 4LB6B 5KNLA 3GFIA 3G4SI 2BGCA 2RGVA 2XHKA 3CF2A 2VUMJ 2ACJA 3JTGA 1WI3A 1BR4A 3A01A 2GXBA 1WJFA 3BG5A 3DLLF 3LSHA 2R4GA 5JHUA 1BL0A 3V7CA 5F64A 2XKPA 1ZN2A 2ZMEA 2V4JC 4I09A 3K1PA 5DM6F 3IL2A 3ASOH 4U7BA 1K4SA 5FKMA 2DFEA 3F8NA 2E1NA 2EILH 1ETXA 3EETA 4B44A 4L18B 2JA2A 1SFXA 3GFMA 3GX4X 4ASNA 2DMPA 1X1CA 4FT8A 4M6VA 3B6AA 4XMYA 4B47A 1T2KA 5EG0A 4XKBA 5IY5H 2KZGA 4N4OB 4HSRA 2QF7A 2OV7A 5F04A 4D7NA 4DGWB 1F43A 4Q48A 2V7FA 2R7QA 5JVGF 2HYGD 3K4NA 1ZREA 4XLHA 2A07F 4OU0A 1QNTA 1RESA 5AIQA 3CO7C 2R7RA 3KPHA 3SJMA 1T0FC 2RQPA 3HM5A 2JRMA 3K4MA 1NH3A 3G3ZA 3RQIA 5E1ZB 2W25A 5E3LA 1OCTC 2Y30A 5CJ9A 1B72A 2LF7A 3QRFF 4XLAA 3BZKA 2A5WA 3V42A 4G8XA 2XF5A 3DBHB 2GIZA 3I53A 4HF0A 4MIMA 5LLQA 3D5LA 3GO5A 2IXSA 3HSFA 2NVUB 3F23A 2GM4A 4MEXF 4OIQF 3K70D 1E3OC 2BW3A 1ZG5A 3WU0A 5LHHA 1DU6A 2M4KA 3DWLE 4GDFA 2P81A 4XKCA 4LJZF 3KEQA 3W2AA 1PUFB 5M3FJ 1VQPI 4XRSG 4R1HA 2FE3A 3LAPA 1R4NB 3ZGKA 4XRSA 4MTEA 3ZRGA 3AG3H 3LOCA 1LE8A 3HC7A 1DPRA 3Q3SA 4HX8A 5K7FA 2EV5A 5ED4A 1AKHB 2DPUA 1TTYA 4FHTA 5E79C 2K27A 1R9TJ 1LVKA 3PUFA 3I4NJ 3RYPA 2CV2A 2VODA 1GUUA 4XOPA 4HV5A 3BCBA 2QA4I 2K3PA 2ISZA 1YRNA 3T8TA 3ERMA 4L5JA 4CO8A 4ZZDA 1S7EA 4P9FA 4M3DA 1MMSA 3MCZA 4L9VA 4B43A 2DW4A 4BE1A 1J5YA 1RPWA 4CCMA 1TQMA 2O3FA 3VFZA 4XLCA 1SD4A 1Z9CA 3Q9SA 3RDIA 4AIKA 5EEAA 2LP0A 2VPRA 1R4MB 2Z99A 2V1XA 3R4KA 1W36C 4BS9A 1QQIA 1O3TA 2Z16A 1YJWI 2ELJA 4FX0A 3IRRA 3Q5FA 5B3SH 2A3SA 4XSZF 5ILUA 4A0ZA 4XLNF 3KEYA 2Y0SN 2P5VA 4I76A 5GAGJ 2CUZA 2OF7A 3H5AA 1KU2A 4I0AA 2WV0A 3F8MA 1PYVA 4LLGF 3HSRA 5D4RA 3HGGA 4BH9A 3K2AA 3LMMA 4HNTA 1A6IA 4QLCU 5FLXZ 2UXNA 1ZGWA 1CGPA 4KDPA 3HOUJ 2CUFA 1V5EA 1OYYA 2ZNYA 2K40A 1BBYA 2FBHA 1OKRA 2EZIA 3KYDB 4RAZA 2E36A 4H0EA 2HOTA 1VQ6I 1MKMA 2ZXWH 3LSPA 2VIXA 3PSFA 1MBHA 1ZR2A 3JTHA 2M5WA 5D6EA 2JA7J 1F4KA 3K4BA 3S2WA 4AUXA 2LD5A 3O8GA 3I4MJ 4MGRA 1BI3A 4O6JA 2GWRA 5A2QZ 3MAJA 1JUSA 2XROA 1EH6A 1QO0D 1G3SA 5IOYA 2L4MA 2KRHA 4P5OA 4PJNA 1MZBA 1D1AA 5FROA 2LYCA 5BOXA 1IXCA 1R7JA 1ETKA 2ESNA 3OWTA 4CSWA 3IKTA 1H9TA 2ZBKA 2FXAA 4Y4RA 2TCTA 5E3NA 3OYNA 2ZXIA 3BLYA 2VQGA 1XMAA 3W3CA 4CCLA 2X48A 2EJRA 2A61A 4EQQA 1U8BA 1Y39A 3H36A 1BC7C 4CUGA 3M7GA 2OTJI 4JX6A 2EFWA 1CQTA 2MYSA 4ZDLA 1ETWA 2K9SA 2LREA 1MDMB 1IN6A 1QVTA 2L01A 3KP4A 5K5OA 3CUOA 2GA1A 3PNTA 4DBRA 3DLAA 4C3HJ 1QGPA 2YX7A 2MD5A 2M0CA 2M2EA 1BR1A 3K4LA 2XAFA 4F52A 1MJBA 4HDVA 2QVOA 1T08B 2DA7A 1T33A 2R0QC 5M3MJ 1UG2A 1WI9A 5FLMJ 2HXIA 3ECHA 4NHJA 5J8CA 1Y1WJ 1YJ9I 4AIHA 4LG3A 4A3JJ 4UVBA 4CYCB 2L0KA 3G6EI 1B8IA 1QA6A 1T0FA 3QP5A 4NC7A 4FQGA 1CF7A 3UR3C 5J47A 5JVTA 2R7TA 5HDKA 2BXZA 4IQJA 3LWFA 3CUQB 4I02A 4RLFA 5D5VB 1GHCA 1P7JA 5HNHA 2PBIA 3N97A 5KCMA 1SD7A 4CCKA 3RPUA 5BPIA 3OOUA 2E2HJ 1U9OA 4HV6A 1WRJA 3RIRA 3FHZA 3P5JA 2OZUA 1HBXG 3VYRB 2ZCWA 3B02A 4KIGA 2EZKA 1XN7A 1JJ6C 1J2XA 1LUJB 3ISPA 1PUEE 1YW8A 4G6QA 3CD6I 3LSRA 1K6YA 4UXNA 3COAC 4E7HA 2HYFA 2HNHA 4GYIA 3E7LA 1LDDA 2K86A 3JRBA 1IXRC 3OSFA 3EPZA 4BYYA 5C44J 2Y75A 3CCVI 3M1EA 2X0LA 2EBIA 3JAMZ 3ZP5A 1J75A 1E2XA 2IGMA 2RNJA 1FTZA 1B4AA 3FXJA 3GW2A 3CC7I 3VSLA 3OYBA 4FE4A 3LA7A 4DJAA 2AXLA 2P7VB 2XSDC 4E7JA 1LEAA 3ECOA 2RV8A 2M7AA 1YOVB 2FX0A 1HXDA 3B73A 2K5CA 3I59B 4Q47A 4V2GA 3CCSI 5FKKA 2OJED 5E3MA 2HZTA 3HRMA 5F0CA 2CQNA 3ZN0A 5C4XJ 3GWZA 3ELKA 3ZMUA 3FX3A 3DU5A 2EFQA 2LKSA 3EYYA 1Z1DA 4ZYDA 3OS1A 1DUXC 3A0BC 3CCJI 3JSOA 1HDPA 3OY9A 3BJ6A 4ETSA 3QU6A 1ON2A 1FTTA 2ELHA 2P8TA 4V19K 3AKZA 1FSEA 2M8EA 4CGZA 3R6SA 1R5GA 1EH7A 1PJRA 3V8JA 2VBYA 3H3VK 1S6LA 4QIWN 5E18F 1HA8A 3TBIA 1D0YA 3K9TA 4ZYAA 2CQXA 3F22A 3KCCA 4I01A 3HKZA 3UNGC 4UY8I 1NTCA 4EMSA 1R23A 2B7EA 3CJNA 4KT6A 2PI0A 1YFHA 3E1SA 2DJNA 5TJJA 3BG6A 1IV6A 2V6CA 3QQAA 2KP6A 5CPRB 1EF4A 1PVEA 4W1UA 1O7LA 2V9VA 1D8JA 5F08A 3DEEA 5LD2C 2H8WA 2F4IA 3D1NI 1IAWA 1FLIA 5HVQC 2IAIA 3SZGA 2D1VA 3U2RA 1IN8A 4BXFA 1G3WA 3VYUB 4UUVA 3PNYA 3JRGA 2QEXI 3HOXJ 4BQNA 2XSJC 4CICA 4IHTA 3LSTA 2IA0A 2LKXA 4HF1A 1EKEA 1P7IA 2ID3A 1BW5A 1WCMJ 4HQEA 1N25A 3BTIA 3H1CA 4LIVA 2F4OB 3OYEA 5EF6A 1RUOA 1TQPA 2XF7A 5E1WA 3FISA 4L5EA 3MMYB 4PFOA 1SVLA 4HNVA 3OYAA 4I2OA 2DK5A 3CLQA 4A93J 4RM3A 2VASA 3CC2I 3PIPF 2ZB9A 1W7PB 1Y6IA 1LFBA 2MLKA 2D5VA 2X1CA 2LY9A 1G2HA 1IRXA 1WQ2A 4BAYA 1Z77A 1ETYA 3HUGB 2FQ3A 3IAS2 1VZ0A 2K02A 2L5QA 3WGIA 4L9NA 2FUG2 5LHGA 2BY1A 3VWBA 3I3LA 2HWVA 4M72A 1UMQA 3KP3A 2DMQA 3CCQI 1KYWA 5HS9A 3JCUC 3S93A 1WWXA 3ZQQA 3OSGA 3S3MA 2KFDA 3QODA 2PMZN 1S29A 2DODA 1K83J 3R0AA 3ONQA 4YIFA 3L2VA 2STTA 4I99C 3HOWJ 4S0HB 3SHFA 3LSKA 1VQ7I 2H8RA 2X1EA 1TLHB 2F5CA 5EEHA 2A6HF 2CQQA 2X51A 5F0HA 2COBA 3F0CA 1TNTA 2MA3A 1JUMA 3KP2A 2ZJPF 4HEA2 1POGA 2FMYA 1X1DA 1DQUA 2CJJA 2KPMA 3JAMK 2KRCA 1AWCA 2VQHA 2GXAA 2HPIA 1Z91A 2GZWA 2L9NA 3G1MA 4QWQA 2BOLA 3JRFA 3G1OA 3CUQA 3FXQA 4R79A 4OWRB 1FWZA 1IG7A 3TKYA 3O3KA 4Y3OA 2L3DA 4ENNA 2E1MB 4NB5A 4UUSB 3WTWC 2PQ8A 4BJ5C 3E97A 5J1RA 1ZG1A 1OISA 2CRGA 1RRJA 4HRIA 1XGSA 1DP3A 1ZHFA 2NRAC 1RR7A 4UVAA 4BGDA 2NNNA 1ODDA 3OS0A 3M8FA 2R7UA 4BQQA 2KHMA 2MLGA 5LRRA 1JT0A 3I55I 1GDTA 2R7SA 1I3QJ 3HPGA 4BEHB 2OC6A 1ZK8A 2L02A 3DXJF 3T1BA 3PNVA 4IHWA 1Q1HA 2QWWA 2V6EA 1UHMA 2DOAA 2HVRA 4RB0A 3H9QA 1FPQA 4G7HF 1ZRFA 2QQBA 3GF2A 3IUOA 3U1KA 4Q4ZF 3OYDA 2YR2A 3A03A 1MMGA 3EDPA 4DZPA 1EA3A 1OCCH 2R5ZB 5EZHA 2E7XA 2F5FA 1MBFA 4BY7J 4HPQA 1X1BA 4ZTFA 2CG4A 2ZC2A 3L2CA 1WGXA 2PMUA 2Q2EA 2FNPA 3WU2C 1J9IA 2H94A 1TW3A 1I5ZA 4S05A 4J00A 1K7AA 1QZZA 1Y56A 3MZ8A 1H0MA 4KFCA 3R0JA 4UHTA 3H3ZA 1YHQI 2DA1A 2YSRA 2R93J 1FT9A 2KQRA 3RI4A 4BKXA 1LVAA 1XS9A 1BIAA 5E8IA 2LBFA 1ZELA 1YW9A 2EZLA 4FASD 3MZHA 4OMYA 1GT0C 2CWEA 1JKOC 2Y69H 2JPBA 3OIQA 3QYFA 2MD0A 2DLLA 4ZDPA 3JREA 5B66C 1XTAA 3HXLA 2VBZA 5IYDJ 2DO7A 1G8XA 2HS5A 4HAMA 4M9ZA 3OYCA 2V26A 4HQMA 2OCCH 4BHCA 2WAEA 4CHUA 4A6DA 1XPXA 4RDUA 1ZARA 1P92A 3CO6C 3E6DA 1H89C 1TWHJ 3K69A 3GLLA 1LFUP 5D5WB 1FOYA 2W00A 2R7VA 1IDZA 1KQ0A 3E6CC 3SEZA 2VT3A 1EH8A 2I5UA 2NAZA 4PGGA 2QBYB 1WJ5A 4MTDA 3SFIA 3RPQA 5DTDA 4IVNA 4M3EA 3L2RA 4IRIA 2W82A 1L3LA 2XGDA 2Q8KA 2H27A 4C2MJ 2P0WA 2O61A 5LRSA 1E17A 4BUPA 3S1NJ 2KIMA 4CCNA 3JRCA 3EQLF 1YS7A 5CVRA 5FRNA 1BI1A 1X3ZB 4P9UA 1MSEC 4F3QA 3WTUC 4JX4A 1KQ8A 2IS6A 1MJAA 4IEJA 1MJ9A 3AFHA 5LHIA 5FD5A 4EJUA 3ERED 1MMAA 2VKEA 1UELB 5FGMA 1M1EB 2IA1A 2BY3A 2QM3A 3W2VA 1WZ2A 5TGTA 1XX5A 1QU3A 5K7ZA 3KYCB 3G2BA 5DV5A 1IUFA 3OYFA 1OQYA 1JKRC 3FM3A 2YUSA 4ENJA 3FXOA 3MKLA 2Y48A 3GZ6A 1LDKB 3NARA 4BDZA 2JSCA 5FO5A 1VQMI 3RYRA 3OMYA 4ZYHA 1ZG3A 1QBJA 1OR7A 4F55A 3S14J 4KIBA 3I71A 3M8EA 2O6GE 1AOYA 3E5QA 2VKDA 1FX7A 1XCBA 3LQQA 4HLXA 2KIUA 2VN2A 4E7SA 1VQ9I 4RAYA 3EUAA 4MFEA 3CQZJ 2JA6J 4HOBA 2M9HA 3HRUA 4UVCA 3KIOA 1U3EM 1UG0A 5IYBJ 1QZEA 1ZQ3P 1R00A 1AHDP 3TEDA 3I9V2 4BU2A 4XRMA 2DOFA 2H1LA 2E19A 4KN7X 4Y52J 3CMAI 2DA5A 2V1DA 3VB2A 1GVJA 4G6DA 1T98A 3P9CA 1FC3A 4L9TA 2R92J 2XGXA 4YELA 4MQVA 1U5TB 1B6AA 3HEFA 2RAEA 4HNUA 1KQ9A 2BXYA 3BWGA 3ZQHA 1XB4A 1ZGAA 4AU7A 2AO9A 5KHDA 4BE0A 4RS8A 2H6CA 1IV8A 3DPTA 2RC4A 2FD5A 2PX9A 2TRTA 3I5UA 2WV1A 3GLXA 5GTIC 1ON1A 1R5ID 1D0ZA 2M0MA 3HB9A 1MNDA 1KU9A 3PSIA 1SD5A 3TW7A 1IN4A 4HA8A 4B3XA 5DCMB 1B9NA 4DBQA 1DPUA 2CUEA 3EUKL 2IA2A 3KLOA 1YG2A 2KKOA 5CVJA 2CH0A 1DGWY 3BG9A 3ZQIA 3MFKA 2XAUA 3QPSA 3LFKA 5BNGA 5EYRA 4LITA 3PO3J 1MIJA 2GAUA 1FBQA 5B1AH 4NBQA 1N77A 2FMLA 1FBSA 2EIJH 4XQFA 2F5VA 2RREA 2UV1A 2YU9J 3K1NA 2VQLA 1S3JA 1XDSA 2O5RA 4RM2A 5EGOA 5D4SA 2L7MP 1SFOJ 3CCMI 1RKTA 3BZ6A 5IPAA 4I6ZA 4RB3C 1T95A 1ZLKA 4EVIA 3V7RA 2WAQN 2O8XA 2NS8A 4A69C 2YU3A 3J7YJ 1MMDA 4D1QA 1TT5B 4P1WA 5CYVA 1X58A 4IHSA 4JBAA 2MBFA 3J80Z 3GFJA 2G0EA 4AYBN 3P9IA 3SDBA 4HG2A 3ZOBA 3UKGA 1Z05A 4A3MJ 2CV1A 1U0JA 1BA5A 5FKLA 2W57A 2X1DA 2PMHA 2F48A 2RQQA 4KUMA 4NQWA 4PSXA 3FDYA 5AONA 1WH7A 3WTVC 3A4CA 4U0WA 2A6TA 5FLVA 2CQKA 2ZJ2A 2Z33A 3QP6A 3TO6A 2KDZA 4D5FA 2XGCA 3GEZA 4E7KA 2YX4A 2Y0MA 1BIBA 2DAOA 1F9NA 1LNWA 2BE5F 1OYWA 2Z9OA 1JGSA 3S2HJ 2JA8J 3Q0VA 5BMZA 3IWZA 2Z2SB 2MC4A 2L4AA 1NG7A 3SFZA 1Z67A 3HTUA 4JP0A 3S15J 2KRFA 2DOEA 1FOXA 4DYCA 1V5GA 2D1HA 3G1LA 1IF1A 4CXFA 3GCMA 5TISC 3H0DA 3HOZJ 1Z0XA 2EK5A 4YG2F 5HDNA 4LK1F 5KVRA 5BS6A 3NAUA 2QSGX 1H88C 2VI6A 1YIJI 2PMZA 4I7HA 1S9HA 3F6VA 4EV0A 1BI0A 3K4KA 4M6XA 3I4PA 3RJPA 3RPUD 1REPC 2K4BA 3MVPA 2JVHA 2OAZA 2IVMA 3CESA 1P9QC 2R5YB 1W0TA 2EB7A 5J8FA 3N05A 4OOIA 3L2WA 2EPFA 2IT0A 4BY1J 4A3LJ 1IUYA 1YI2I 2FF4A 2EIKH 4XONA 4WK8F 1I6HJ 3S1MJ 1Z7UA 3FM5A 3FHNA 3CCEI 4DW6A 1BI2A 1MGTA 3T5XA 1TWFJ 3CMMA 2DA6A 4A0YA 1UCRA 2PG4A 3BROA 1VQ5I 2DMNA 3ZQGA 3WU1B 2ECCA 3KLNA 1AA7A 4PJMA 3CCLI 4J01A 4AM3A 2L7ZA 2K85A 1R49A 1TWAJ 1ETQA 4IRGA 2STWA 4YFKF 1YQAA 3CMEI 4JOMA 2GQQA 4OINF 2J5PA 1A36A 5DUIA 2L7KA 2BHZA 1TQIA 2LSOA 1ENHA 5D8KB 4RB2C 4FX4A 1FMWA 2HDWA 3OYLA 1HKTA 2LMDA 2PFBA 3V4GA 1G4DA 1XCVA 3BR5A 3ZR8X 4C2UA 2F2EA 1SAXA 2HPMA 3H35A 3DKWA 4FETA 1D0XA 3FMQA 3HOVJ 2DFIA 3GTQJ 4EJWA 1OYIA 2M4GA 4LFUA 4MO7A 2ME6A 4FE7A 1X2NA 4A0XA 1F5TA 5HLIA 5HOOA 2K9NA 1VQNI 1HKSA 3FF5A 3WE3A 3J81Z 1K79A 2XRLA 4HZFA 1W36D 4BJTA 2LNBA 4M71A 3DTKA 2JT1A 3FXUA 2MGQA 3CUQC 2ZXJA 2PEXA 4EM0B 3REOA 2LTPA 2JVGA 4BL0B 4AVZA 5C4JJ 2OD5A 1WHUA 2VJIA 3ABTA 3IHUA 4CCJA 1FYMA 3ML6A 1XGOA 4PDKA 5DYMA 4G6TB 4LG0B 4P55A 1ZRDA 1WJCA 3OYGA 4F7ZA 2OQRA 5DCMA 1OCZH 1U2WA 3FXKA 2K9QA 3I56I 3BCAA 3CJTB 1TNSA 1V3FA 3F9KA 2QLZA 3B6CA 2IJLA 1LFPA 3H9JA 3DF8A 4Y17A 3J7AO 1PUFA 1XSDA 2XASA 3JW4A 1R71A 4Y15A 1NK2P 1Z6TA 2WTEA 4LGWA 1Z21A 2LR8A 1D1CA 3LFUA 3KFWX 5GP9A 1TT0A 1TWGJ 1AKHA 1J59A 3FZVA 1YITI 2CW8A 2LDUA 4C30A 1ZRCA 1A6QA 3H5RA 2WA0A 5IT9Z 5FLXK 5GPCA 1R58A 1HLVA 2CYYA 5DCFA 2V9PA 4LMYA 1APLC 1Z3XA 1HW5A 4M6YA 3WTZA 3TP3A 3IH3A 3S32A 5JR3A 4G7ZF 3FXMA 2P4WA 4KICA 2Z1DA 4ZYGA 5IYCJ 4XIDA 4IZZA 2R7ZJ 3T8RA 3MWMA 3I0TA 2L9RA 3FBNB 1WJDA 3M8JA 4J19A 3VOEA 4ZTJA 4E7ZA 4A5NA 1HDDC 2JUCA 5A2QK 2DJIA 1W4MA 4A3DJ 1UZCA 1X1PA 3BT9A 3P7NA 3DKXA 2DQRA 1LPQA 1MSFC 2Z5UA 4S04A 4FISA 4P96A 5D8LB 3CLOA 4ESBA 3FMSA 1R22A 3CF5F 1MBGA 3AL0B 1IRGA 3LNQA 1GXQA 3L00A 2FBKA 1T56A 2VE8A 1BN5A 3HJEA 3O8HA 2HKOA 5DUKA 3K4JA 2ZO4A 5ILSA 3QPHA 1ZR4A 2JTVA 2GLOA 3SQNA 3TMOA 5DM7F 4E7IA 4I0BA 5K7HA 4D9JA 5TRDA 3HHGA 4IJAA 4A3FJ 2EFOA 2DT6A 3OR1C 1S5LC 3JRDA 3CDHA 1SMYF 5K1YA 5CQEA 2VJ5A 4B48A 2M7BA 2NOGA 4AIJA 5CVIA 1I50J 2Y2ZA 4IQ4A 4G9YA 2IS1A 2PJRB 1A35A 4OMZA 5DEQA 1B1BA 3C2GA 3LQRA 3E6BA 1QHHD 2HR3A 2JN6A 2CSOA 4KT5C 1V4RA 1GV2A 3S1RJ 1XGNA 3RQ4A 3GVAA 2VBXA 4QPOA 4LLLA 4C9YA 2RKHA 4BQOA 4M74A 4DNCA 1EJ9A 3BY6A 2HZDA 3KZYA 3CCUI 1IRZA 3HOYJ 2M34A 1G3YA 4BDYA 2MW8A 1MW7A 1KU3A 3U21A 2HTJA 5HDGA 3OS2A 3PIOF 2K7LA 2F5DA 2FJ1A 2IPQX 4O3MA 2A68F 5EDNA 1OLTA 3K6GA 4KJZA 4K2EA 2DA4A 3G73A 2HOSA 1ZH5A 2L9VA 1XDUA 5F6FA 1G3TA 1QPMA 3DEUA 4QSHA 3WHCA 1OCRH 1VQKI 1UFMA 4X6AJ 1K78B 1JGGA 4HX4A 2HKXA 5CQGA 3BR1A 4G7OF 3J81K 2W7NA 1FYKA 3OL4A 3AG4H 2HEOA 5K5RA 2JWTA 5H6RA 2YS9A 4Z2YA 2F5EA 2KDOA 3FXLA 1MDMA 1N78A 2JZYA 1WFXA 2GXGA 2H09A 4XR6A 2K9LA 2VC0A 3GTJJ 2NS0A 1UHWA 2IGKA 1QHGA 4XLEA 4BBSJ 2LG4A 4G94A 1GXPA 2W84A 1OR7C 4XNFA 2EA4A 2B63J 3IP4B 3N4MA 2WB1N 2VC1A 4WXHA 2KT0A 3A01B 2QQ8A 3ABUA 3D5RC 1KZHA 2JQ7A 2AHQA 2FQ4A 3DQVC 4NDLA 2XRNA 3F8FA 4CYCA 2HYJA 5C3EJ 1DP7P 3Q9VA 2ZMEB 2L54A 1LB2A 4L0YB 1SVOA 4N0BA 1S7AA 2MC3A 5GAEJ 2FNAA 2ID6A 5BQTA 2HXOA 2QKLB 5D6FA 2DK8A 4B8XA 3HOTA 2E2JJ 3NWSA 1UHSA 3VDXA 5CVVA 5EG0B 2IGOA 4A3EJ 4X0GA 3MEXA 5J40A 1IZ1A 2HOEA 1WPKA 2Y9YA 3WG9A 3QOEA 1TW2A 4EJOA 1USTA 4ZJZA 4IHYA 2R7XA 2MSYA 2XPWA 2VB6A 3K0LA 3HPHA 5H2FC 3BTLA 5J4YA 3MD2A 1C0WA 5EJCA 4OIPF 1P4WA 5K5QA 2DDAA 5IOZA 4NNJA 1I1SA 1G6NA 3SZTA 5JLWA 1S8NA 2RN7A 1TBXA 3SYTA 2UUZA 3HIFA 1B72B 3WTSC 1YIOA 1FSHA 3GYHX 1S7OA 4IHVA 4PUSA 2OTLI 2O7OA 1MNEA 1Z6RA 1ERDA 2BW3B 3WG7H 2E35A 2DN0A 4MQ9F 2X6WA 5D5UB 4WXDA 4GCVA 4CDGA 1FY7A 3E5XA 2M3AA 1LJ9A 3DBLB 3I59A 2KISA 4GRIA 4ON0A 4KMUX 2XKOA 2LF8A 3ZMSA 2VPLA 1SANA 2Y0SA 5L3EA 2DA3A 4ZH4F 2NNYA 1LE8B 2V1UA 1SFKA 2ZSHB 1RI7A 4AVPA 5CLSA 5IT3A 3BC8A 3RTRA 5F1RA 1QVUA 3BJOA 4M9SA 4MEYF 2ZFWA 4Y33A 4MLOA 3JRAA 1BJAA 2HI3A 3FIWA 4HW0A 1MMNA 4CZZA 4XORA 3GTMJ 3TOAA 3WTTC 1SFUA 1AU7A 1YRNB 2VOOA 3DPLC 2HQNA 4H4KC 1KGSA 4IKFA 1ONVA 2ZJRF 2AQEA 2VOPA 3QPLA 5J3LA 5HLTA 3DFGA 3GUDA 2KLOA 4HBLA 2RVCA 2ME0A 2PLYA 2IW5A 2QSFX 1MBEA 1HKQA 1V5FA 2VJJA 1D1BA 3IC7A 3WGHA 3M07A 4B4CA 4IF4A 4KN4X 4B3AA 2K3FA 2GOMA 1IC8A 2IBDA 4GGGA 3CP8A 3MZYA 2O8KA 1Y0NA 5AIPA 1EV7A 1ORKA 3RKWA 1JJ8C 1SMTA 1O4XA 1B59A 4DYQA 3PQKA 3WTYC 3BTJA 3Q0UA 1U9NA 2PN6A 2K9MA 1X19A 5GPAA 3K70C 3C2BA 3D0SA 3L7WA 3QWLA 1A04A 4PGHA 5L3GA 1BR2A 1MBJA 4A6EA 4XM3A 1MH3A 4D0PA 4XKWA 3RKYA 1JE8A 2FEZA 2X6YA 4GFBA 3OOPA 3RZDJ 5M5XJ 1IN7A 5EZGA 1P4XA 2XV4S 3CCYA 1W5TA 3R61A 4XBFA 4HF2A 5J1UA 3ZMTA 5LFAA 5L3FA 2GA2A 2XVCA 3HHHA 4WX9A 1FP2A 3BP8A 1W7PA 1VTNC 1HW1A 3L2QA 2UZKA 4ESFA 4ZZLA 3GTOJ 2CQ7A 4M3BA 4XN3A 1JI8A 1JTXA 4KMFA 2QQ9A 2FA5A 4RAFA 4BXUA 1D3YA 1RNLA 3TO7A 1VQLI 2CV0A 3HUGA 2XPUA 4GO1A 2VXZA 2HQAA 2W85A 4U0VA 2LC2A 4JK1X 5HLGA 1TP4A 4F92B 2JRTA 3I58A 2CS3A 2LOOA 5E20A 3ABLH 3H3UA 2LFBA 3IRQA 2OA4A 5JI6A 1D8KA 4U7DA 5B5EC 5H20A 1ZGJA 2M45A 1XD7A 2NYXA 4PCQA 1W0UA 1GVDA 2R7OA 4DZJA 3PFIA 1WJBA 1QZYA 1WJEA 2MFZA 5HS8A 3WGGA 2EV0A 5DDGA 1D5YA 1FEXA 1L0OC 2A69F 1FYLA 2HVQA 2N8GA 2I10A 3PQJA 4XLFA 5J4VA 4PSWA 2O0YA 3HRSA 4EM2A 1IRFA 2B0LA 4JQFA 4A3KJ 3S1QJ 2M8GX 2M87A 2WY7Q 1MBKA 1B8IB 3WODF 2DTRA 2LH9A 1CF7B 3L9FA 1FOKA 1LEBA 2BYVE 5KAFC 4PJJA 4UUSA 1X1AA 3C2HA 3OL3A 1MH4A 3LSIA 3KZIC 1U5TC 1ITYA 1Q1VA 3DV8A 4A3GJ 1STZA 2MH2A 3BR6A 3K4CA 3OIOA 2A6EF 2JK3A 4LD5A 4R8HA 1GLNA 3KP7A 4LIUA 3W6KB 2HFHA 4LK0F 4XRFA 3ULQB 4A2UA 1WH5A 3HSEA 4RB1A 3LA3A 1KONA 4BEHA 2A5YB 2XIGA 2OQGA 2W24A 1BW6A 3KETA 1SFEA 4BQAA 3V7SA 4XLPF 1HW2A 3O6BB 3X2QH 2EH3A 2OBPA 5FB2A 2KL4A 3BOQA 5D5XB 4YIRX 1ETVA 1R5HA 2WWYA 2R5ZA 1JT6A 2X85A 3MN2A 4LLNA 1MNMC 3VYTB 1R36A 4PFPA 1T38A 4Q5SF 4HX7A 4AIDA 2WC2A 4IX7A 1VQ4I 4AWXB 5JFRA 3DKYA 1R1UA 1HSTA 2ZKZA
chains in the Genus database with same CATH topology
3EYIA 4Y13A 1I1GA 1HSJA 1BM9A 4U88A 1KA8A 5ICGA 2AS5F 2C6YA 3MQ0A 3E6MA 2XUBA 3O2PE 4WXCA 5J6XA 2RDPA 2K4JA 3VEPA 2M1BA 4L5IA 2HTSA 3R60A 1WKMA 4RGUA 1LQ1A 2CGPA 2EFNA 3QAHA 1IW7F 3F72A 2ZNZA 3TQNA 3QPTA 1YW7A 1H9GA 4L9JA 4YFNF 5LGUA 2QBYA 3FXRA 1DDNA 5DD4A 1YLFA 2DI3A 1XGMA 2FSWA 2P6TA 3HTSB 4O5VA 4HYEA 1F1ZA 3HYIA 1KYZA 3I54A 3SZPA 1FP1D 1PP7U 1P2FA 2X4HA 2ISYA 1W5SA 4KA4A 3ZPLA 4WWCA 2QZ8A 2OU2A 3KZZA 3H92A 4ENMA 1O7FA 3I64A 2FBIA 4YIIA 2EFPA 3KE2A 3FMRA 3BJAA 4WF2A 3F3XA 5HLHA 2IRFG 2QQAA 5E1XA 1XMKA 4BHBA 2DT5A 1JHHA 1U5TA 1RUNA 2KIFA 3ZMVA 1XSXA 2VE9A 1ZYRF 2CFXA 2R7FA 2GIVA 2ESHA 3IWFA 3GFLA 3F8CA 4HDUA 3WE2A 3K2ZA 1SD6A 2EWNA 4IRHA 3GXOA 3TDZC 5LEKA 3J80K 1YYVA 4DQ2A 5FFXA 5ILVA 3AAFA 4ZYEA 3NQOA 4GYGA 3C7JA 2PJPA 2FOKA 3ZQ7A 3DP7A 3C18A 5ICFA 3TGNA 2HQRA 4EGZA 3ZMZA 3K1MA 4EJTA 2MH9A 2BV6A 3U9GA 2COMA 4UV8A 4BHPA 1T6SA 2E1CA 4A5MA 3BPVA 3NEUA 4ESJA 1RIOH 5E17F 1OPCA 5ERIA 4M9XA 1ZLJA 4WCGA 5ICEA 2O03A 2FU4A 3M9AA 4I98B 3C1DA 4MNUA 5HS7A 1J0RA 2P5LC 2EV6A 2P6SA 3TO9A 2M30A 2XAQA 6PAXA 4GXOA 4EM1A 2G7HA 2HGCA 2J5OA 2QUFA 3F21A 1BC8C 2TDXA 3GZ5A 4UNOA 2XAGA 4E70A 3V8KA 5BPDA 4LB5A 4ENKA 4RGXA 1XSVA 1PP8F 2UXXA 2CW0F 5FFZA 2OZ6A 3TOBA 4U0YA 4CYDA 4EGYA 2BEOA 1HQCA 3KEOA 1O57A 2QENA 2FRHA 4AD9A 2H6BA 3BDDA 3ZMDA 2DBBA 2XAJA 2KJCA 3U1DA 5L3BA 1YO5C 2CO5A 1U78A 2IP2A 2D2WA 3OV8A 3NRVA 5LEJA 2UWMA 4HLYA 4TV7A 1IN5A 1T39A 2ADUA 4RGSA 5E8GA 3BPXA 4N9HA 5IT9K 2G9WA 4YFXF 1K6OA 3E3VA 1LDJA 2P7CB 3L09A 3HOSA 1BOAA 5CVUA 4LG0A 3TDUC 1JHFA 3KP5A 5EEGA 4KNYA 1D5VA 4RGRA 3WTXC 1J7KA 1UB9A 3FWEA 3V8LA 5H6QA 2HDCA 1R1TA 3E5UA 2JPCA 2BBYA 2KJBA 4KYWA 3C3WA 5DD8A 3SXYA 1WSUA 1YTYA 2EA2A 1YS6A 3LAJA 1MD0A 2YPRA 2LKPA 3T0YA 1U6GA 4EJVA 2P5KA 4MHGA 1USSA 4BNCA 1I27A 4IPAA 2XAHA 2DU9A 4N9IA 1FZPB 3EUHA 2D45A 1W7PD 1ZAOA 3ZN1A 3HRTA 4B09A 3JSPA 3P9KA 1PDNC 2R7DA 1IXSB 2DPDA 2VONA 1RZ4A 4UV9A 1O3SA 1P4AA 5LGTA 1JXSA 2E7WA 3RKXA 4OIOF 1B9MA 3QU3A 1O3QA 3F6OA 2DQLA 2Q0OA 1KU7A 4PZJA 1OMIA 5LGNA 3VODA 1P6RA 4IXAA 3KP6A 1Y0UA 1ULYA 4XSXF 3ROUA 2QYOA 1FNNA 5L3CA 3LA2A 5FD6A 5L3DA 3CTAA 2R3SA 2VT2A 1O3RA 1R1VA 1FBUA 4A12A 1NHAA 2V79A 5ICCA 5LBQA 1K78A 3F8BA 4M73A 4L0ZB 2VBWA 1I6XA 1X3UA 2Z3YA 5KK1A 3IKVA 2G7UA 4OIRF 2ETHA 3W6JB 4KIFA 3QOPA 1U8RA 4LB6B 3GFIA 2BGCA 2RGVA 2XHKA 2ACJA 3JTGA 2GXBA 5JHUA 3V7CA 5F64A 2XKPA 1ZN2A 2ZMEA 4I09A 3K1PA 3IL2A 4U7BA 3F8NA 2E1NA 3EETA 4L18B 1SFXA 3GFMA 3GX4X 4ASNA 4FT8A 1T2KA 4Q48A 2HYGD 1ZREA 2A07F 4OU0A 1QNTA 5AIQA 3CO7C 2RQPA 3G3ZA 5E1ZB 2W25A 5CJ9A 2LF7A 3QRFF 4G8XA 4HF0A 3I53A 5LLQA 3D5LA 3GO5A 3F23A 3HSFA 4MEXF 4OIQF 1ZG5A 3WU0A 5LHHA 4LJZF 3KEQA 4R1HA 2FE3A 3LAPA 4MTEA 1DPRA 4HX8A 2DPUA 2EV5A 5ED4A 1TTYA 4FHTA 2K27A 3RYPA 2VODA 4HV5A 2ISZA 3T8TA 4L5JA 4CO8A 4ZZDA 4P9FA 3MCZA 4L9VA 2DW4A 1J5YA 1TQMA 2O3FA 3VFZA 1SD4A 1Z9CA 3Q9SA 3RDIA 4AIKA 2Z99A 2V1XA 3R4KA 1QQIA 1O3TA 4FX0A 3IRRA 3Q5FA 2A3SA 4XSZF 5ILUA 4A0ZA 4XLNF 2P5VA 1KU2A 4I0AA 2WV0A 3F8MA 4LLGF 3HSRA 5D4RA 4BH9A 4QLCU 5FLXZ 2UXNA 1CGPA 4KDPA 1OYYA 2ZNYA 1BBYA 2FBHA 1OKRA 4RAZA 4H0EA 1MKMA 3JTHA 2M5WA 5D6EA 1F4KA 3S2WA 4MGRA 1BI3A 4O6JA 2GWRA 5A2QZ 3MAJA 2XROA 1EH6A 1QO0D 1G3SA 2L4MA 4P5OA 1MZBA 5BOXA 1IXCA 1R7JA 2ESNA 3IKTA 1H9TA 2ZBKA 2FXAA 1XMAA 2EJRA 2A61A 4EQQA 1BC7C 3M7GA 2EFWA 1MDMB 1IN6A 2L01A 3KP4A 5K5OA 3CUOA 2GA1A 1QGPA 2YX7A 2MD5A 2XAFA 1MJBA 4HDVA 2QVOA 1WI9A 3ECHA 4NHJA 5J8CA 4AIHA 4UVBA 1T0FA 3QP5A 1CF7A 5JVTA 5HDKA 3LWFA 3CUQB 4I02A 5D5VB 1GHCA 3N97A 2PBIA 5BPIA 1SD7A 3RPUA 4HV6A 1WRJA 3RIRA 3FHZA 2OZUA 1HBXG 2ZCWA 3B02A 4KIGA 1XN7A 1J2XA 3ISPA 1PUEE 1YW8A 4G6QA 4UXNA 3COAC 2HYFA 1LDDA 2K86A 1IXRC 4BYYA 3ZP5A 2Y75A 3M1EA 2X0LA 3JAMZ 1J75A 1E2XA 2RNJA 1B4AA 3GW2A 3LA7A 2AXLA 2P7VB 1LEAA 3ECOA 2RV8A 1HXDA 3B73A 3I59B 4Q47A 2HZTA 3HRMA 3ZN0A 3GWZA 3ELKA 3ZMUA 3FX3A 2EFQA 3EYYA 1Z1DA 4ZYDA 1DUXC 3JSOA 3BJ6A 4ETSA 3QU6A 1ON2A 2ELHA 2P8TA 1FSEA 2M8EA 4CGZA 3R6SA 1R5GA 1EH7A 3V8JA 2VBYA 1S6LA 5E18F 3K9TA 3F22A 3KCCA 4I01A 4EMSA 1R23A 3CJNA 2PI0A 1YFHA 5TJJA 2V6CA 1O7LA 2V9VA 1D8JA 1IAWA 1FLIA 5HVQC 2D1VA 3U2RA 1IN8A 1G3WA 4UUVA 4CICA 4IHTA 3LSTA 2IA0A 4HF1A 4HQEA 1RUOA 1TQPA 5E1WA 4I2OA 2DK5A 1W7PB 2MLKA 1WQ2A 4BAYA 2FQ3A 2K02A 3WGIA 4L9NA 5LHGA 2HWVA 4M72A 3KP3A 1KYWA 5HS9A 1WWXA 1S29A 3R0AA 4YIFA 2STTA 3SHFA 1TLHB 2F5CA 5EEHA 2A6HF 1TNTA 2MA3A 3KP2A 2FMYA 3JAMK 1AWCA 1Z91A 2GZWA 4QWQA 3CUQA 3FXQA 4R79A 1FWZA 3TKYA 3O3KA 4ENNA 2L3DA 4NB5A 3WTWC 2PQ8A 3E97A 1ZG1A 1XGSA 1ZHFA 2NRAC 4UVAA 2NNNA 1ODDA 3M8FA 2MLGA 5LRRA 2L02A 3T1BA 3DXJF 1Q1HA 2QWWA 1UHMA 4RB0A 1FPQA 4G7HF 1ZRFA 2QQBA 3GF2A 4Q4ZF 2YR2A 3EDPA 2E7XA 2F5FA 2CG4A 3L2CA 2PMUA 2Q2EA 2FNPA 1J9IA 2H94A 1TW3A 1I5ZA 4S05A 1K7AA 4KFCA 1QZZA 1H0MA 3R0JA 4UHTA 3H3ZA 2YSRA 1FT9A 3RI4A 1LVAA 1BIAA 5E8IA 1YW9A 3MZHA 4OMYA 2CWEA 2JPBA 2DLLA 2VBZA 2DO7A 2HS5A 4HAMA 4M9ZA 4HQMA 4BHCA 4CHUA 4A6DA 1ZARA 1P92A 3CO6C 3E6DA 3K69A 5D5WB 1KQ0A 3E6CC 2VT3A 1EH8A 2NAZA 4PGGA 2QBYB 4MTDA 3RPQA 4IVNA 4IRIA 1L3LA 2Q8KA 2H27A 2O61A 5LRSA 1E17A 2KIMA 3EQLF 1YS7A 5CVRA 1BI1A 4P9UA 3WTUC 1KQ8A 1MJAA 1MJ9A 5LHIA 5FD5A 4EJUA 3ERED 5FGMA 2IA1A 2QM3A 5DV5A 3FM3A 4ENJA 2Y48A 3GZ6A 1LDKB 2JSCA 5FO5A 3RYRA 4ZYHA 1QBJA 1ZG3A 1OR7A 4KIBA 3I71A 3M8EA 2O6GE 1AOYA 3E5QA 1FX7A 1XCBA 3LQQA 4HLXA 2KIUA 2VN2A 4RAYA 4HOBA 3HRUA 4UVCA 1U3EM 1R00A 4KN7X 2V1DA 3VB2A 1GVJA 4G6DA 1T98A 3P9CA 1FC3A 4L9TA 2XGXA 4MQVA 1U5TB 1B6AA 1KQ9A 3BWGA 1XB4A 1ZGAA 4RS8A 2H6CA 3DPTA 2RC4A 3I5UA 3GLXA 1ON1A 1KU9A 1SD5A 1IN4A 4HA8A 5DCMB 1B9NA 1DPUA 2IA2A 3KLOA 1YG2A 2KKOA 5CVJA 3MFKA 3LFKA 2GAUA 1FBQA 2FMLA 1FBSA 3K1NA 1S3JA 1XDSA 5D4SA 3BZ6A 4RB3C 1ZLKA 4EVIA 3V7RA 2O8XA 2YU3A 5CYVA 4IHSA 4JBAA 2MBFA 3J80Z 3GFJA 3P9IA 1Z05A 2W57A 4KUMA 2PMHA 4NQWA 5AONA 3WTVC 4U0WA 2CQKA 2ZJ2A 2Z33A 3QP6A 3TO6A 3GEZA 2YX4A 2Y0MA 1BIBA 2DAOA 1F9NA 1LNWA 2BE5F 1OYWA 2Z9OA 1JGSA 5BMZA 3IWZA 2L4AA 3SFZA 3HTUA 2KRFA 2D1HA 1IF1A 4CXFA 2EK5A 4YG2F 5HDNA 4LK1F 5KVRA 5BS6A 4I7HA 4EV0A 3F6VA 1BI0A 4M6XA 3I4PA 3RJPA 1REPC 2K4BA 2OAZA 2IVMA 2EB7A 5J8FA 4OOIA 2IT0A 1IUYA 2FF4A 4WK8F 1Z7UA 3FM5A 1BI2A 1MGTA 3T5XA 4A0YA 1UCRA 2PG4A 3BROA 3WU1B 3KLNA 4IRGA 2STWA 4YFKF 1YQAA 2GQQA 4OINF 2J5PA 5DUIA 2LSOA 5D8KB 1TQIA 4RB2C 4FX4A 1HKTA 2PFBA 3V4GA 1G4DA 1XCVA 2F2EA 1SAXA 3DKWA 3FMQA 2DFIA 4EJWA 1OYIA 4LFUA 4A0XA 1F5TA 5HLIA 5HOOA 1HKSA 3FF5A 3J81Z 3WE3A 1K79A 4HZFA 2LNBA 4M71A 2JT1A 3FXUA 3CUQC 2ZXJA 2PEXA 4EM0B 3REOA 2OD5A 3ABTA 3IHUA 1FYMA 3ML6A 1XGOA 4PDKA 5DYMA 4LG0B 4P55A 1ZRDA 4F7ZA 2OQRA 5DCMA 1U2WA 1TNSA 1V3FA 2QLZA 2IJLA 3J7AO 4Y17A 3DF8A 1XSDA 2XASA 3JW4A 4Y15A 1Z6TA 2WTEA 4LGWA 3KFWX 1J59A 3FZVA 2LDUA 1ZRCA 5IT9Z 5FLXK 1R58A 2CYYA 5DCFA 4LMYA 1HW5A 4M6YA 3WTZA 5JR3A 4G7ZF 2P4WA 4KICA 4ZYGA 3T8RA 3MWMA 3I0TA 3VOEA 4A5NA 5A2QK 1W4MA 3P7NA 2DQRA 2Z5UA 4S04A 4P96A 5D8LB 3CLOA 4ESBA 3FMSA 1R22A 1IRGA 1GXQA 3L00A 2FBKA 2VE8A 1BN5A 5DUKA 2HKOA 2ZO4A 5ILSA 3QPHA 2JTVA 3SQNA 4I0BA 5TRDA 3HHGA 4IJAA 2EFOA 3CDHA 1SMYF 5K1YA 4AIJA 5CVIA 4G9YA 4OMZA 5DEQA 1B1BA 3LQRA 3E6BA 2HR3A 2CSOA 4KT5C 1V4RA 1XGNA 3GVAA 2VBXA 4LLLA 2RKHA 4M74A 4DNCA 3BY6A 3KZYA 1G3YA 1KU3A 2HTJA 5HDGA 2K7LA 2F5DA 2IPQX 4O3MA 2A68F 4K2EA 3G73A 1ZH5A 1XDUA 5F6FA 1G3TA 1QPMA 3DEUA 1UFMA 1K78B 4HX4A 2HKXA 4G7OF 3J81K 1FYKA 2HEOA 5K5RA 5H6RA 4Z2YA 2F5EA 1MDMA 2JZYA 2GXGA 2H09A 2VC0A 2NS0A 1UHWA 4G94A 1GXPA 2W84A 2EA4A 3N4MA 2VC1A 4WXHA 3ABUA 3DQVC 2XRNA 3F8FA 1DP7P 3Q9VA 2ZMEB 2L54A 1LB2A 4L0YB 4N0BA 1S7AA 2MC3A 2FNAA 5BQTA 5D6FA 2DK8A 4B8XA 3HOTA 5CVVA 3MEXA 1IZ1A 2HOEA 3WG9A 4EJOA 1TW2A 1USTA 1R1UA 3K0LA 4OIPF 1C0WA 1P4WA 5K5QA 1I1SA 1G6NA 3SZTA 1S8NA 2RN7A 1TBXA 3HIFA 3WTSC 1YIOA 1FSHA 3GYHX 1S7OA 1Z6RA 4MQ9F 5D5UB 4WXDA 4GCVA 4CDGA 1FY7A 3E5XA 1LJ9A 3I59A 4ON0A 4KMUX 2XKOA 2LF8A 3ZMSA 5L3EA 4ZH4F 2NNYA 2V1UA 1RI7A 4AVPA 5CLSA 5IT3A 3RTRA 5F1RA 3BJOA 4M9SA 4MEYF 2ZFWA 1BJAA 4HW0A 4CZZA 3TOAA 3WTTC 1SFUA 2VOOA 3DPLC 2HQNA 1KGSA 1ONVA 2VOPA 3DFGA 3GUDA 4HBLA 2RVCA 2PLYA 2IW5A 1HKQA 3IC7A 3WGHA 4IF4A 4KN4X 4GGGA 3MZYA 5AIPA 1EV7A 3RKWA 1SMTA 1B59A 3PQKA 3WTYC 2PN6A 3D0SA 3L7WA 4PGHA 1A04A 5L3GA 4A6EA 4D0PA 3RKYA 1JE8A 2FEZA 3OOPA 1IN7A 1P4XA 2XV4S 1W5TA 3R61A 4XBFA 4HF2A 3ZMTA 5L3FA 2GA2A 2XVCA 3HHHA 4WX9A 1FP2A 3BP8A 1W7PA 1VTNC 1HW1A 2UZKA 4ESFA 4ZZLA 4KMFA 2QQ9A 2FA5A 4BXUA 1D3YA 1RNLA 3TO7A 3HUGA 4GO1A 2VXZA 2W85A 4U0VA 4JK1X 5HLGA 2JRTA 3I58A 5E20A 3H3UA 3IRQA 2OA4A 5JI6A 1D8KA 4U7DA 5H20A 1ZGJA 2M45A 1XD7A 2NYXA 4PCQA 3PFIA 1QZYA 5HS8A 3WGGA 2EV0A 5DDGA 1L0OC 2A69F 1FYLA 3PQJA 2O0YA 3HRSA 4EM2A 1IRFA 2B0LA 4JQFA 2M87A 3WODF 2DTRA 1CF7B 3L9FA 1FOKA 1LEBA 2BYVE 1U5TC 3DV8A 1STZA 2MH2A 4LD5A 2A6EF 4R8HA 3KP7A 3W6KB 2HFHA 4LK0F 4XRFA 3ULQB 4A2UA 3HSEA 4RB1A 3LA3A 2A5YB 2XIGA 2OQGA 2W24A 3KETA 1SFEA 4BQAA 3V7SA 4XLPF 1HW2A 3O6BB 2OBPA 5FB2A 3BOQA 5D5XB 1R5HA 2WWYA 4LLNA 1R36A 1T38A 4Q5SF 4HX7A 2WC2A 4AWXB 5JFRA 4GYIA 1HSTA 2ZKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYI A;  4Y13 A;  1I1G A;  1HSJ A;  1BM9 A;  4U88 A;  1KA8 A;  5ICG A;  2AS5 F;  2C6Y A;  3MQ0 A;  3E6M A;  2XUB A;  3O2P E;  4WXC A;  5J6X A;  2RDP A;  2K4J A;  3VEP A;  2M1B A;  4L5I A;  2HTS A;  3R60 A;  1WKM A;  4RGU A;  1LQ1 A;  2CGP A;  2EFN A;  3QAH A;  1IW7 F;  3F72 A;  2ZNZ A;  3TQN A;  3QPT A;  1YW7 A;  1H9G A;  4L9J A;  4YFN F;  5LGU A;  2QBY A;  3FXR A;  1DDN A;  5DD4 A;  1YLF A;  2DI3 A;  1XGM A;  2FSW A;  2P6T A;  3HTS B;  4O5V A;  4HYE A;  1F1Z A;  3HYI A;  1KYZ A;  3I54 A;  3SZP A;  1FP1 D;  1PP7 U;  1P2F A;  2X4H A;  2ISY A;  1W5S A;  4KA4 A;  3ZPL A;  4WWC A;  2QZ8 A;  2OU2 A;  3KZZ A;  3H92 A;  4ENM A;  1O7F A;  3I64 A;  2FBI A;  4YII A;  2EFP A;  3KE2 A;  3FMR A;  3BJA A;  4WF2 A;  3F3X A;  5HLH A;  2IRF G;  2QQA A;  5E1X A;  1XMK A;  4BHB A;  2DT5 A;  1JHH A;  1U5T A;  1RUN A;  2KIF A;  3ZMV A;  1XSX A;  2VE9 A;  1ZYR F;  2CFX A;  2R7F A;  2GIV A;  2ESH A;  3IWF A;  3GFL A;  3F8C A;  4HDU A;  3WE2 A;  3K2Z A;  1SD6 A;  2EWN A;  4IRH A;  3GXO A;  3TDZ C;  5LEK A;  3J80 K;  1YYV A;  4DQ2 A;  5FFX A;  5ILV A;  3AAF A;  4ZYE A;  3NQO A;  4GYG A;  3C7J A;  2PJP A;  2FOK A;  3ZQ7 A;  3DP7 A;  3C18 A;  5ICF A;  3TGN A;  2HQR A;  4EGZ A;  3ZMZ A;  3K1M A;  4EJT A;  2MH9 A;  2BV6 A;  3U9G A;  2COM A;  4UV8 A;  4BHP A;  1T6S A;  2E1C A;  4A5M A;  3BPV A;  3NEU A;  4ESJ A;  1RIO H;  5E17 F;  1OPC A;  5ERI A;  4M9X A;  1ZLJ A;  4WCG A;  5ICE A;  2O03 A;  2FU4 A;  3M9A A;  4I98 B;  3C1D A;  4MNU A;  5HS7 A;  1J0R A;  2P5L C;  2EV6 A;  2P6S A;  3TO9 A;  2M30 A;  2XAQ A;  6PAX A;  4GXO A;  4EM1 A;  2G7H A;  2HGC A;  2J5O A;  2QUF A;  3F21 A;  1BC8 C;  2TDX A;  3GZ5 A;  4UNO A;  2XAG A;  4E70 A;  3V8K A;  5BPD A;  4LB5 A;  4ENK A;  4RGX A;  1XSV A;  1PP8 F;  2UXX A;  2CW0 F;  5FFZ A;  2OZ6 A;  3TOB A;  4U0Y A;  4CYD A;  4EGY A;  2BEO A;  1HQC A;  3KEO A;  1O57 A;  2QEN A;  2FRH A;  4AD9 A;  2H6B A;  3BDD A;  3ZMD A;  2DBB A;  2XAJ A;  2KJC A;  3U1D A;  5L3B A;  1YO5 C;  2CO5 A;  1U78 A;  2IP2 A;  2D2W A;  3OV8 A;  3NRV A;  5LEJ A;  2UWM A;  4HLY A;  4TV7 A;  1IN5 A;  1T39 A;  2ADU A;  4RGS A;  5E8G A;  3BPX A;  4N9H A;  5IT9 K;  2G9W A;  4YFX F;  1K6O A;  3E3V A;  1LDJ A;  2P7C B;  3L09 A;  3HOS A;  1BOA A;  5CVU A;  4LG0 A;  3TDU C;  1JHF A;  3KP5 A;  5EEG A;  4KNY A;  1D5V A;  4RGR A;  3WTX C;  1J7K A;  1UB9 A;  3FWE A;  3V8L A;  5H6Q A;  2HDC A;  1R1T A;  3E5U A;  2JPC A;  2BBY A;  2KJB A;  4KYW A;  3C3W A;  5DD8 A;  3SXY A;  1WSU A;  1YTY A;  2EA2 A;  1YS6 A;  3LAJ A;  1MD0 A;  2YPR A;  2LKP A;  3T0Y A;  1U6G A;  4EJV A;  2P5K A;  4MHG A;  1USS A;  4BNC A;  1I27 A;  4IPA A;  2XAH A;  2DU9 A;  4N9I A;  1FZP B;  3EUH A;  2D45 A;  1W7P D;  1ZAO A;  3ZN1 A;  3HRT A;  4B09 A;  3JSP A;  3P9K A;  1PDN C;  2R7D A;  1IXS B;  2DPD A;  2VON A;  1RZ4 A;  4UV9 A;  1O3S A;  1P4A A;  5LGT A;  1JXS A;  2E7W A;  3RKX A;  4OIO F;  1B9M A;  3QU3 A;  1O3Q A;  3F6O A;  2DQL A;  2Q0O A;  1KU7 A;  4PZJ A;  1OMI A;  5LGN A;  3VOD A;  1P6R A;  4IXA A;  3KP6 A;  1Y0U A;  1ULY A;  4XSX F;  3ROU A;  2QYO A;  1FNN A;  5L3C A;  3LA2 A;  5FD6 A;  5L3D A;  3CTA A;  2R3S A;  2VT2 A;  1O3R A;  1R1V A;  1FBU A;  4A12 A;  1NHA A;  2V79 A;  5ICC A;  5LBQ A;  1K78 A;  3F8B A;  4M73 A;  4L0Z B;  2VBW A;  1I6X A;  1X3U A;  2Z3Y A;  5KK1 A;  3IKV A;  2G7U A;  4OIR F;  2ETH A;  3W6J B;  4KIF A;  3QOP A;  1U8R A;  4LB6 B;  3GFI A;  2BGC A;  2RGV A;  2XHK A;  2ACJ A;  3JTG A;  2GXB A;  5JHU A;  3V7C A;  5F64 A;  2XKP A;  1ZN2 A;  2ZME A;  4I09 A;  3K1P A;  3IL2 A;  4U7B A;  3F8N A;  2E1N A;  3EET A;  4L18 B;  1SFX A;  3GFM A;  3GX4 X;  4ASN A;  4FT8 A;  1T2K A;  4Q48 A;  2HYG D;  1ZRE A;  2A07 F;  4OU0 A;  1QNT A;  5AIQ A;  3CO7 C;  2RQP A;  3G3Z A;  5E1Z B;  2W25 A;  5CJ9 A;  2LF7 A;  3QRF F;  4G8X A;  4HF0 A;  3I53 A;  5LLQ A;  3D5L A;  3GO5 A;  3F23 A;  3HSF A;  4MEX F;  4OIQ F;  1ZG5 A;  3WU0 A;  5LHH A;  4LJZ F;  3KEQ A;  4R1H A;  2FE3 A;  3LAP A;  4MTE A;  1DPR A;  4HX8 A;  2DPU A;  2EV5 A;  5ED4 A;  1TTY A;  4FHT A;  2K27 A;  3RYP A;  2VOD A;  4HV5 A;  2ISZ A;  3T8T A;  4L5J A;  4CO8 A;  4ZZD A;  4P9F A;  3MCZ A;  4L9V A;  2DW4 A;  1J5Y A;  1TQM A;  2O3F A;  3VFZ A;  1SD4 A;  1Z9C A;  3Q9S A;  3RDI A;  4AIK A;  2Z99 A;  2V1X A;  3R4K A;  1QQI A;  1O3T A;  4FX0 A;  3IRR A;  3Q5F A;  2A3S A;  4XSZ F;  5ILU A;  4A0Z A;  4XLN F;  2P5V A;  1KU2 A;  4I0A A;  2WV0 A;  3F8M A;  4LLG F;  3HSR A;  5D4R A;  4BH9 A;  4QLC U;  5FLX Z;  2UXN A;  1CGP A;  4KDP A;  1OYY A;  2ZNY A;  1BBY A;  2FBH A;  1OKR A;  4RAZ A;  4H0E A;  1MKM A;  3JTH A;  2M5W A;  5D6E A;  1F4K A;  3S2W A;  4MGR A;  1BI3 A;  4O6J A;  2GWR A;  5A2Q Z;  3MAJ A;  2XRO A;  1EH6 A;  1QO0 D;  1G3S A;  2L4M A;  4P5O A;  1MZB A;  5BOX A;  1IXC A;  1R7J A;  2ESN A;  3IKT A;  1H9T A;  2ZBK A;  2FXA A;  1XMA A;  2EJR A;  2A61 A;  4EQQ A;  1BC7 C;  3M7G A;  2EFW A;  1MDM B;  1IN6 A;  2L01 A;  3KP4 A;  5K5O A;  3CUO A;  2GA1 A;  1QGP A;  2YX7 A;  2MD5 A;  2XAF A;  1MJB A;  4HDV A;  2QVO A;  1WI9 A;  3ECH A;  4NHJ A;  5J8C A;  4AIH A;  4UVB A;  1T0F A;  3QP5 A;  1CF7 A;  5JVT A;  5HDK A;  3LWF A;  3CUQ B;  4I02 A;  5D5V B;  1GHC A;  3N97 A;  2PBI A;  5BPI A;  1SD7 A;  3RPU A;  4HV6 A;  1WRJ A;  3RIR A;  3FHZ A;  2OZU A;  1HBX G;  2ZCW A;  3B02 A;  4KIG A;  1XN7 A;  1J2X A;  3ISP A;  1PUE E;  1YW8 A;  4G6Q A;  4UXN A;  3COA C;  2HYF A;  1LDD A;  2K86 A;  1IXR C;  4BYY A;  3ZP5 A;  2Y75 A;  3M1E A;  2X0L A;  3JAM Z;  1J75 A;  1E2X A;  2RNJ A;  1B4A A;  3GW2 A;  3LA7 A;  2AXL A;  2P7V B;  1LEA A;  3ECO A;  2RV8 A;  1HXD A;  3B73 A;  3I59 B;  4Q47 A;  2HZT A;  3HRM A;  3ZN0 A;  3GWZ A;  3ELK A;  3ZMU A;  3FX3 A;  2EFQ A;  3EYY A;  1Z1D A;  4ZYD A;  1DUX C;  3JSO A;  3BJ6 A;  4ETS A;  3QU6 A;  1ON2 A;  2ELH A;  2P8T A;  1FSE A;  2M8E A;  4CGZ A;  3R6S A;  1R5G A;  1EH7 A;  3V8J A;  2VBY A;  1S6L A;  5E18 F;  3K9T A;  3F22 A;  3KCC A;  4I01 A;  4EMS A;  1R23 A;  3CJN A;  2PI0 A;  1YFH A;  5TJJ A;  2V6C A;  1O7L A;  2V9V A;  1D8J A;  1IAW A;  1FLI A;  5HVQ C;  2D1V A;  3U2R A;  1IN8 A;  1G3W A;  4UUV A;  4CIC A;  4IHT A;  3LST A;  2IA0 A;  4HF1 A;  4HQE A;  1RUO A;  1TQP A;  5E1W A;  4I2O A;  2DK5 A;  1W7P B;  2MLK A;  1WQ2 A;  4BAY A;  2FQ3 A;  2K02 A;  3WGI A;  4L9N A;  5LHG A;  2HWV A;  4M72 A;  3KP3 A;  1KYW A;  5HS9 A;  1WWX A;  1S29 A;  3R0A A;  4YIF A;  2STT A;  3SHF A;  1TLH B;  2F5C A;  5EEH A;  2A6H F;  1TNT A;  2MA3 A;  3KP2 A;  2FMY A;  3JAM K;  1AWC A;  1Z91 A;  2GZW A;  4QWQ A;  3CUQ A;  3FXQ A;  4R79 A;  1FWZ A;  3TKY A;  3O3K A;  4ENN A;  2L3D A;  4NB5 A;  3WTW C;  2PQ8 A;  3E97 A;  1ZG1 A;  1XGS A;  1ZHF A;  2NRA C;  4UVA A;  2NNN A;  1ODD A;  3M8F A;  2MLG A;  5LRR A;  2L02 A;  3T1B A;  3DXJ F;  1Q1H A;  2QWW A;  1UHM A;  4RB0 A;  1FPQ A;  4G7H F;  1ZRF A;  2QQB A;  3GF2 A;  4Q4Z F;  2YR2 A;  3EDP A;  2E7X A;  2F5F A;  2CG4 A;  3L2C A;  2PMU A;  2Q2E A;  2FNP A;  1J9I A;  2H94 A;  1TW3 A;  1I5Z A;  4S05 A;  1K7A A;  4KFC A;  1QZZ A;  1H0M A;  3R0J A;  4UHT A;  3H3Z A;  2YSR A;  1FT9 A;  3RI4 A;  1LVA A;  1BIA A;  5E8I A;  1YW9 A;  3MZH A;  4OMY A;  2CWE A;  2JPB A;  2DLL A;  2VBZ A;  2DO7 A;  2HS5 A;  4HAM A;  4M9Z A;  4HQM A;  4BHC A;  4CHU A;  4A6D A;  1ZAR A;  1P92 A;  3CO6 C;  3E6D A;  3K69 A;  5D5W B;  1KQ0 A;  3E6C C;  2VT3 A;  1EH8 A;  2NAZ A;  4PGG A;  2QBY B;  4MTD A;  3RPQ A;  4IVN A;  4IRI A;  1L3L A;  2Q8K A;  2H27 A;  2O61 A;  5LRS A;  1E17 A;  2KIM A;  3EQL F;  1YS7 A;  5CVR A;  1BI1 A;  4P9U A;  3WTU C;  1KQ8 A;  1MJA A;  1MJ9 A;  5LHI A;  5FD5 A;  4EJU A;  3ERE D;  5FGM A;  2IA1 A;  2QM3 A;  5DV5 A;  3FM3 A;  4ENJ A;  2Y48 A;  3GZ6 A;  1LDK B;  2JSC A;  5FO5 A;  3RYR A;  4ZYH A;  1QBJ A;  1ZG3 A;  1OR7 A;  4KIB A;  3I71 A;  3M8E A;  2O6G E;  1AOY A;  3E5Q A;  1FX7 A;  1XCB A;  3LQQ A;  4HLX A;  2KIU A;  2VN2 A;  4RAY A;  4HOB A;  3HRU A;  4UVC A;  1U3E M;  1R00 A;  4KN7 X;  2V1D A;  3VB2 A;  1GVJ A;  4G6D A;  1T98 A;  3P9C A;  1FC3 A;  4L9T A;  2XGX A;  4MQV A;  1U5T B;  1B6A A;  1KQ9 A;  3BWG A;  1XB4 A;  1ZGA A;  4RS8 A;  2H6C A;  3DPT A;  2RC4 A;  3I5U A;  3GLX A;  1ON1 A;  1KU9 A;  1SD5 A;  1IN4 A;  4HA8 A;  5DCM B;  1B9N A;  1DPU A;  2IA2 A;  3KLO A;  1YG2 A;  2KKO A;  5CVJ A;  3MFK A;  3LFK A;  2GAU A;  1FBQ A;  2FML A;  1FBS A;  3K1N A;  1S3J A;  1XDS A;  5D4S A;  3BZ6 A;  4RB3 C;  1ZLK A;  4EVI A;  3V7R A;  2O8X A;  2YU3 A;  5CYV A;  4IHS A;  4JBA A;  2MBF A;  3J80 Z;  3GFJ A;  3P9I A;  1Z05 A;  2W57 A;  4KUM A;  2PMH A;  4NQW A;  5AON A;  3WTV C;  4U0W A;  2CQK A;  2ZJ2 A;  2Z33 A;  3QP6 A;  3TO6 A;  3GEZ A;  2YX4 A;  2Y0M A;  1BIB A;  2DAO A;  1F9N A;  1LNW A;  2BE5 F;  1OYW A;  2Z9O A;  1JGS A;  5BMZ A;  3IWZ A;  2L4A A;  3SFZ A;  3HTU A;  2KRF A;  2D1H A;  1IF1 A;  4CXF A;  2EK5 A;  4YG2 F;  5HDN A;  4LK1 F;  5KVR A;  5BS6 A;  4I7H A;  4EV0 A;  3F6V A;  1BI0 A;  4M6X A;  3I4P A;  3RJP A;  1REP C;  2K4B A;  2OAZ A;  2IVM A;  2EB7 A;  5J8F A;  4OOI A;  2IT0 A;  1IUY A;  2FF4 A;  4WK8 F;  1Z7U A;  3FM5 A;  1BI2 A;  1MGT A;  3T5X A;  4A0Y A;  1UCR A;  2PG4 A;  3BRO A;  3WU1 B;  3KLN A;  4IRG A;  2STW A;  4YFK F;  1YQA A;  2GQQ A;  4OIN F;  2J5P A;  5DUI A;  2LSO A;  5D8K B;  1TQI A;  4RB2 C;  4FX4 A;  1HKT A;  2PFB A;  3V4G A;  1G4D A;  1XCV A;  2F2E A;  1SAX A;  3DKW A;  3FMQ A;  2DFI A;  4EJW A;  1OYI A;  4LFU A;  4A0X A;  1F5T A;  5HLI A;  5HOO A;  1HKS A;  3FF5 A;  3J81 Z;  3WE3 A;  1K79 A;  4HZF A;  2LNB A;  4M71 A;  2JT1 A;  3FXU A;  3CUQ C;  2ZXJ A;  2PEX A;  4EM0 B;  3REO A;  2OD5 A;  3ABT A;  3IHU A;  1FYM A;  3ML6 A;  1XGO A;  4PDK A;  5DYM A;  4LG0 B;  4P55 A;  1ZRD A;  4F7Z A;  2OQR A;  5DCM A;  1U2W A;  1TNS A;  1V3F A;  2QLZ A;  2IJL A;  3J7A O;  4Y17 A;  3DF8 A;  1XSD A;  2XAS A;  3JW4 A;  4Y15 A;  1Z6T A;  2WTE A;  4LGW A;  3KFW X;  1J59 A;  3FZV A;  2LDU A;  1ZRC A;  5IT9 Z;  5FLX K;  1R58 A;  2CYY A;  5DCF A;  4LMY A;  1HW5 A;  4M6Y A;  3WTZ A;  5JR3 A;  4G7Z F;  2P4W A;  4KIC A;  4ZYG A;  3T8R A;  3MWM A;  3I0T A;  3VOE A;  4A5N A;  5A2Q K;  1W4M A;  3P7N A;  2DQR A;  2Z5U A;  4S04 A;  4P96 A;  5D8L B;  3CLO A;  4ESB A;  3FMS A;  1R22 A;  1IRG A;  1GXQ A;  3L00 A;  2FBK A;  2VE8 A;  1BN5 A;  5DUK A;  2HKO A;  2ZO4 A;  5ILS A;  3QPH A;  2JTV A;  3SQN A;  4I0B A;  5TRD A;  3HHG A;  4IJA A;  2EFO A;  3CDH A;  1SMY F;  5K1Y A;  4AIJ A;  5CVI A;  4G9Y A;  4OMZ A;  5DEQ A;  1B1B A;  3LQR A;  3E6B A;  2HR3 A;  2CSO A;  4KT5 C;  1V4R A;  1XGN A;  3GVA A;  2VBX A;  4LLL A;  2RKH A;  4M74 A;  4DNC A;  3BY6 A;  3KZY A;  1G3Y A;  1KU3 A;  2HTJ A;  5HDG A;  2K7L A;  2F5D A;  2IPQ X;  4O3M A;  2A68 F;  4K2E A;  3G73 A;  1ZH5 A;  1XDU A;  5F6F A;  1G3T A;  1QPM A;  3DEU A;  1UFM A;  1K78 B;  4HX4 A;  2HKX A;  4G7O F;  3J81 K;  1FYK A;  2HEO A;  5K5R A;  5H6R A;  4Z2Y A;  2F5E A;  1MDM A;  2JZY A;  2GXG A;  2H09 A;  2VC0 A;  2NS0 A;  1UHW A;  4G94 A;  1GXP A;  2W84 A;  2EA4 A;  3N4M A;  2VC1 A;  4WXH A;  3ABU A;  3DQV C;  2XRN A;  3F8F A;  1DP7 P;  3Q9V A;  2ZME B;  2L54 A;  1LB2 A;  4L0Y B;  4N0B A;  1S7A A;  2MC3 A;  2FNA A;  5BQT A;  5D6F A;  2DK8 A;  4B8X A;  3HOT A;  5CVV A;  3MEX A;  1IZ1 A;  2HOE A;  3WG9 A;  4EJO A;  1TW2 A;  1UST A;  1R1U A;  3K0L A;  4OIP F;  1C0W A;  1P4W A;  5K5Q A;  1I1S A;  1G6N A;  3SZT A;  1S8N A;  2RN7 A;  1TBX A;  3HIF A;  3WTS C;  1YIO A;  1FSH A;  3GYH X;  1S7O A;  1Z6R A;  4MQ9 F;  5D5U B;  4WXD A;  4GCV A;  4CDG A;  1FY7 A;  3E5X A;  1LJ9 A;  3I59 A;  4ON0 A;  4KMU X;  2XKO A;  2LF8 A;  3ZMS A;  5L3E A;  4ZH4 F;  2NNY A;  2V1U A;  1RI7 A;  4AVP A;  5CLS A;  5IT3 A;  3RTR A;  5F1R A;  3BJO A;  4M9S A;  4MEY F;  2ZFW A;  1BJA A;  4HW0 A;  4CZZ A;  3TOA A;  3WTT C;  1SFU A;  2VOO A;  3DPL C;  2HQN A;  1KGS A;  1ONV A;  2VOP A;  3DFG A;  3GUD A;  4HBL A;  2RVC A;  2PLY A;  2IW5 A;  1HKQ A;  3IC7 A;  3WGH A;  4IF4 A;  4KN4 X;  4GGG A;  3MZY A;  5AIP A;  1EV7 A;  3RKW A;  1SMT A;  1B59 A;  3PQK A;  3WTY C;  2PN6 A;  3D0S A;  3L7W A;  4PGH A;  1A04 A;  5L3G A;  4A6E A;  4D0P A;  3RKY A;  1JE8 A;  2FEZ A;  3OOP A;  1IN7 A;  1P4X A;  2XV4 S;  1W5T A;  3R61 A;  4XBF A;  4HF2 A;  3ZMT A;  5L3F A;  2GA2 A;  2XVC A;  3HHH A;  4WX9 A;  1FP2 A;  3BP8 A;  1W7P A;  1VTN C;  1HW1 A;  2UZK A;  4ESF A;  4ZZL A;  4KMF A;  2QQ9 A;  2FA5 A;  4BXU A;  1D3Y A;  1RNL A;  3TO7 A;  3HUG A;  4GO1 A;  2VXZ A;  2W85 A;  4U0V A;  4JK1 X;  5HLG A;  2JRT A;  3I58 A;  5E20 A;  3H3U A;  3IRQ A;  2OA4 A;  5JI6 A;  1D8K A;  4U7D A;  5H20 A;  1ZGJ A;  2M45 A;  1XD7 A;  2NYX A;  4PCQ A;  3PFI A;  1QZY A;  5HS8 A;  3WGG A;  2EV0 A;  5DDG A;  1L0O C;  2A69 F;  1FYL A;  3PQJ A;  2O0Y A;  3HRS A;  4EM2 A;  1IRF A;  2B0L A;  4JQF A;  2M87 A;  3WOD F;  2DTR A;  1CF7 B;  3L9F A;  1FOK A;  1LEB A;  2BYV E;  1U5T C;  3DV8 A;  1STZ A;  2MH2 A;  4LD5 A;  2A6E F;  4R8H A;  3KP7 A;  3W6K B;  2HFH A;  4LK0 F;  4XRF A;  3ULQ B;  4A2U A;  3HSE A;  4RB1 A;  3LA3 A;  2A5Y B;  2XIG A;  2OQG A;  2W24 A;  3KET A;  1SFE A;  4BQA A;  3V7S A;  4XLP F;  1HW2 A;  3O6B B;  2OBP A;  5FB2 A;  3BOQ A;  5D5X B;  1R5H A;  2WWY A;  4LLN A;  1R36 A;  1T38 A;  4Q5S F;  4HX7 A;  2WC2 A;  4AWX B;  5JFR A;  4GYI A;  1HST A;  2ZKZ A; 
#chains in the Genus database with same CATH topology
 3DEW A;  3S3O A;  3EYI A;  2LLK A;  4Y13 A;  3G71 I;  1I39 A;  1I1G A;  2FOW A;  1TL8 A;  3PL8 A;  1HSJ A;  1BM9 A;  4U88 A;  1KA8 A;  5ICG A;  4Z6Y A;  2CW7 A;  2AS5 F;  2C6Y A;  2EIN H;  3MQ0 A;  5M5W J;  3E6M A;  2XUB A;  1ZKG A;  3PM1 A;  3O2P E;  4WXC A;  2HQ5 A;  4MFD A;  5J6X A;  2ZXH A;  4PJL A;  2RDP A;  3ABK H;  2KIQ A;  5GAD J;  2F4M B;  2K4J A;  1BJZ A;  3NWT A;  1UJ8 A;  3VEP A;  1JKQ C;  4BJ6 C;  2M1B A;  2F6C A;  4L5I A;  2HTS A;  1E3H A;  2EZH A;  5HNF A;  3R60 A;  3Q0W A;  1VI0 A;  1WKM A;  1X3W B;  4UB8 C;  4RGU A;  3ABM H;  1LQ1 A;  3LSG A;  2CGP A;  2NVT J;  2DXI A;  2EFN A;  2DT7 B;  4A3C J;  3QAH A;  1IW7 F;  4NUB A;  2V1N A;  2EIM H;  3TL4 X;  3F72 A;  2ZNZ A;  4BE2 A;  1F36 A;  3TQN A;  3JRH A;  3QPT A;  1YW7 A;  4QTR A;  1H9G A;  4L9J A;  1SAU A;  3DTE A;  4YFN F;  5LGU A;  2JMW A;  2QBY A;  2QCO A;  3FXR A;  1DDN A;  5DD4 A;  2W48 A;  3RZO J;  1UAA A;  1XC5 A;  1VF9 A;  1YLF A;  3SDG A;  2DI3 A;  3OYM A;  4IOA F;  1XGM A;  2FSW A;  2P6T A;  3HTS B;  4O5V A;  1QRY A;  4HYE A;  2O9L A;  3MKY B;  5FKN A;  1HF0 A;  3CDI A;  3FK6 A;  1F1Z A;  1Y1V J;  3M4O J;  1VQ8 I;  2BVM A;  3HYI A;  1RR8 C;  1TZL A;  1KYZ A;  3S3N A;  3I54 A;  2JA5 J;  2XPV A;  3SZP A;  2WB1 A;  1FP1 D;  1PP7 U;  1P2F A;  2X4H A;  2ISY A;  1W5S A;  4OAZ A;  4XIC A;  4KA4 A;  3CJR B;  3RCO A;  1NG6 A;  2CMP A;  3ZPL A;  1VFC A;  2OUM A;  2ECB A;  3L2U A;  3E0J B;  4V2F A;  4WWC A;  2A05 A;  2QZ8 A;  2HVS A;  1OCP A;  1VND A;  2OU2 A;  3D5S C;  2MAB A;  2ZFU A;  2LRD A;  2HU9 A;  3KZZ A;  3H92 A;  4ENM A;  2DYS H;  2OCE A;  4FCY A;  5JLX A;  1O7F A;  3I64 A;  2QSH X;  2FBI A;  2IEK A;  4YII A;  3M3Y J;  3L1P A;  2EFP A;  2E5Z A;  3KE2 A;  1VQO I;  3AG2 H;  3FMR A;  2JJ7 A;  1RKW A;  4RAG A;  3BJA A;  4UB6 C;  3F3X A;  4WF2 A;  4DYR A;  1FIA A;  3RKQ A;  1LKX A;  5HLH A;  2IRF G;  1TC3 C;  2QQA A;  5E1X A;  5JHF A;  1XMK A;  4BHB A;  3A2K A;  2DT5 A;  1JHH A;  1U5T A;  1RUN A;  2KIF A;  3ZMV A;  1XSX A;  4DOZ A;  2XC7 A;  2VE9 A;  3CJQ B;  1SVM A;  3QYE A;  3HGY A;  1ZYR F;  2CFX A;  1HCR A;  2R7F A;  2GIV A;  1Y8Q B;  2ESH A;  3IWF A;  3CZ6 A;  4ABZ A;  3PFY A;  3GFL A;  4C3I J;  3VYS B;  3F8C A;  4HDU A;  3ZQC A;  3ASN H;  3WE2 A;  3K2Z A;  1SD6 A;  2EWN A;  4IRH A;  3GXO A;  3TDZ C;  1A5J A;  5LEK A;  2XGE A;  2JUG A;  1YYV A;  1RET A;  2Q1Z B;  4XK4 A;  4C3J J;  5FFX A;  4DQ2 A;  3J80 K;  5ILV A;  3AAF A;  2XF6 A;  4C2T A;  4ZYE A;  3NQO A;  4A3B J;  4GYG A;  4D7M A;  3C7J A;  2WY8 Q;  1IJW C;  2PJP A;  4E4H A;  3BR2 A;  4BXX J;  4PK4 A;  2FOK A;  3ZXS A;  3PJR A;  1J09 A;  2E1O A;  2X6O A;  3OYJ A;  2BY2 A;  3MKZ A;  3ZQ7 A;  2OPT A;  3DP7 A;  3C18 A;  3BZC A;  2CUJ A;  2NVQ J;  1YE9 A;  1T8I A;  5CKT A;  5ICF A;  3ESW B;  3TGN A;  2HQR A;  3WHB A;  1QPI A;  4ZC3 A;  2GBY A;  4EGZ A;  2BY0 A;  3ZMZ A;  1YJN I;  4KIT B;  3GZN B;  3BQZ A;  3K1M A;  2Q2E B;  3BTC A;  3FK7 A;  3BR3 A;  4EJT A;  2MH9 A;  4AC0 A;  4DIQ A;  2WBM A;  2BV6 A;  4U87 A;  3K10 A;  3U9G A;  4XOT A;  1S72 I;  3H0G J;  2XB0 X;  2COM A;  4UV8 A;  2V9K A;  3RSN A;  4BHP A;  2GOX B;  1T6S A;  5F0F A;  2W4S A;  3S16 J;  1IO2 A;  2VXD A;  2E1C A;  4HST A;  2LBF B;  4A5M A;  2VLA A;  4RA2 A;  1TWC J;  2LY1 A;  3DU6 A;  4F91 B;  3EUH C;  3A02 A;  3BPV A;  3NEU A;  3HL2 A;  1Z7L A;  4ESJ A;  1RIO H;  2LY2 A;  1BOB A;  4RLQ A;  2RNG A;  5E17 F;  1OPC A;  3OIP A;  3BR0 A;  5ERI A;  4M9X A;  2BHY A;  1GV5 A;  2X9D A;  1XG1 A;  1ZLJ A;  3W2W A;  5E3O A;  1Y8R B;  1W1W E;  2QGU A;  4WCG A;  1JUP A;  3ZQF A;  1X2M A;  4LOC A;  2LK2 A;  4PJ0 C;  2E60 A;  2FU4 A;  2O03 A;  3M9A A;  5ICE A;  4I98 B;  3C1D A;  4MNU A;  5HS7 A;  4IO9 F;  1IDY A;  3AL0 C;  1J0R A;  2ICW G;  2P5L C;  3IH4 A;  3CP2 A;  2DTZ A;  1K61 A;  2EV6 A;  2P6S A;  3TO9 A;  2M30 A;  2WAF A;  2XAQ A;  6PAX A;  4BBR J;  4GXO A;  4XKV A;  4EM1 A;  2DA2 A;  2G7H A;  2DCE A;  2L9S A;  2HGC A;  2J5O A;  2KMU A;  2QUF A;  3F21 A;  1BC8 C;  1OFC X;  1A31 A;  2TDX A;  3W6V A;  3GZ5 A;  3KYL A;  4UNO A;  2XAG A;  4CCO A;  2XDV A;  2DYR H;  4E70 A;  4RMN A;  1DU0 A;  1V55 H;  4XN0 A;  1NK3 P;  3LL7 A;  3V8K A;  1R6R A;  3JRI A;  3H5N A;  5BPD A;  2I8D A;  3H9G A;  3PUB A;  2ZJQ F;  2R5Y A;  3GTP J;  4JYK A;  3FBI B;  4LB5 A;  4ENK A;  5DS9 A;  4IHX A;  2B9S A;  4RGX A;  4F93 B;  2NS7 A;  1XSV A;  3PO2 J;  1PP8 F;  3GBG A;  2UXX A;  3JR9 A;  2CW0 F;  4X1E A;  5FFZ A;  2OZ6 A;  3DPU A;  1RC9 A;  3TOB A;  4II3 A;  2LVS A;  4U0Y A;  4CYD A;  3ZQL A;  5F27 A;  3IV5 A;  4EGY A;  2BEO A;  3CMY A;  4EEF G;  1HQC A;  2EQR A;  4IL6 C;  3KEO A;  1O57 A;  2E34 A;  2QEN A;  3GME A;  2FRH A;  4AD9 A;  4BAC A;  2H6B A;  3BDD A;  3ZMD A;  2QKM B;  2DBB A;  5FRM A;  2XAJ A;  2H1K A;  2DMU A;  2KJC A;  4II2 A;  2IS4 A;  2BZT A;  3HG9 A;  3U1D A;  5L3B A;  1YX3 A;  1YO5 C;  2CO5 A;  1U78 A;  2IP2 A;  2D2W A;  3OV8 A;  3NRV A;  4CA0 A;  5LEJ A;  3CCR I;  2UWM A;  4ITV A;  3VPR A;  4EAT A;  4HLY A;  4TV7 A;  2L2O A;  4E7L A;  2ZME C;  3DCF A;  5FKO A;  2ELK A;  2L7F P;  1IN5 A;  5M5Y J;  1T39 A;  2ADU A;  4RGS A;  1SEU A;  2IGN A;  3BPX A;  4N9H A;  5E8G A;  2KZV A;  5IT9 K;  2G9W A;  4YFX F;  3QYB A;  1K6O A;  3E3V A;  1LDJ A;  2E1M C;  2P7C B;  3BG7 A;  1IGN A;  3L09 A;  3HOS A;  1BOA A;  3OYI A;  5CVU A;  4LG0 A;  2AQF A;  3LSJ A;  3TDU C;  1JHF A;  3KP5 A;  5EEG A;  4KNY A;  3A1Y A;  2WAQ A;  3ZCO A;  1X4O A;  1D5V A;  4RGR A;  1J7K A;  3WTX C;  1X4P A;  5J1Y A;  1UB9 A;  2DFF A;  3BQY A;  3FWE A;  1N75 A;  4E6K G;  3V8L A;  4D5C A;  4NC8 A;  5H6Q A;  1DGR M;  3OYH A;  2HDC A;  1R1T A;  4NC6 A;  4AYB A;  5KAI C;  3E5U A;  1ACI A;  1ZTR A;  2JPC A;  2BBY A;  2KJB A;  4KYW A;  3OR2 C;  3C3W A;  5IP9 J;  5DD8 A;  3SXY A;  1FIP A;  1WSU A;  3BG3 A;  1YTY A;  2EA2 A;  3S8P A;  1YS6 A;  3LAJ A;  1MD0 A;  3FKI J;  2XB5 A;  4ANJ A;  2VKH A;  4W97 A;  2E5N A;  2VKV A;  1G59 A;  2YPR A;  1OJL A;  2LKP A;  3T0Y A;  1U6G A;  4EJV A;  2P5K A;  4IOC F;  2VJ4 A;  4MHG A;  2Y9Z A;  5EGO B;  1USS A;  4BNC A;  1I27 A;  4IPA A;  3K7A J;  2XAH A;  2DU9 A;  4YEJ A;  4A3I J;  2NXN B;  3KX2 A;  4N9I A;  3HBL A;  1FZP B;  1ETO A;  4RBO A;  3EUH A;  2D45 A;  1W7P D;  4XL9 A;  1ZAO A;  3AG1 H;  5GAH J;  3ZN1 A;  3HRT A;  4M3G A;  1XMX A;  4B09 A;  3JSP A;  2JSP A;  3P9K A;  1PDN C;  2VQC A;  2MG4 A;  1V54 H;  1JKP C;  2R7D A;  1JTY A;  1IXS B;  2DPD A;  2VON A;  1WJA A;  1OCO H;  3DBR B;  1FJL A;  2E2I J;  1HOM A;  5B1B H;  2VL8 A;  1RZ4 A;  4UV9 A;  1O3S A;  4KIS A;  3S2D J;  4FTH A;  1P4A A;  5LGT A;  1JXS A;  2E7W A;  1E0E A;  3RKX A;  2X6X A;  4NQW B;  4OIO F;  4OAY A;  1B9M A;  1HC8 A;  1K4T A;  3IAM 2;  3HDD A;  2WAD A;  3QU3 A;  1O3Q A;  2DFH A;  2DMT A;  3MKW B;  3F6O A;  5IP6 A;  3DTI A;  2DQL A;  2Q0O A;  1SC7 A;  1KU7 A;  4PZJ A;  4JX5 A;  1OMI A;  2DDB A;  3J7A Y;  5LGN A;  2PJR A;  4CH7 A;  3J7Z I;  4ZDO A;  4N4N B;  3VOD A;  5HOD A;  1P6R A;  1YX5 A;  2R7W A;  4IXA A;  2NVY J;  3KP6 A;  1Y0U A;  1ULY A;  4XSX F;  4M3F A;  2HOA A;  4QPQ A;  3ROU A;  5FJ8 J;  3HKZ N;  3GTL J;  5GTH C;  2ZSI B;  3CC4 I;  2QYO A;  1FNN A;  1FOW A;  2AXT C;  5L3C A;  2CU7 A;  2HDD A;  2Y31 A;  3LA2 A;  4Y7N J;  5FD6 A;  5F1J A;  5L3D A;  3OYK A;  2CFO A;  2W1O A;  3GTG J;  3CTA A;  3FKJ A;  1I3A A;  1FMV A;  2R3S A;  9ANT A;  2VT2 A;  1O3R A;  1R1V A;  3SEQ A;  2E71 A;  1FBU A;  3M1C A;  4A12 A;  2BVL A;  1NHA A;  3CDL A;  2V79 A;  4YRV A;  3S17 J;  5ICC A;  5LBQ A;  3TP0 A;  1K78 A;  3F8B A;  4M73 A;  3VSK A;  4L0Z B;  2VBW A;  1I6X A;  1E3P A;  3GTK J;  1X3U A;  2Z3Y A;  5KK1 A;  3LSM A;  3IKV A;  1H8A C;  2NOJ B;  2G7U A;  4CZC A;  4OIR F;  1Z3Y A;  4B1R A;  1WVR A;  3IH2 A;  2ETH A;  2NVX J;  4G12 A;  4UUT A;  3TW6 A;  3A0H C;  3W6J B;  5IP7 J;  3HZJ A;  4KIF A;  3QOP A;  1W5C C;  1U8R A;  2IS2 A;  4LB6 B;  5KNL A;  3GFI A;  3G4S I;  2BGC A;  2RGV A;  2XHK A;  3CF2 A;  2VUM J;  2ACJ A;  3JTG A;  1WI3 A;  1BR4 A;  3A01 A;  2GXB A;  1WJF A;  3BG5 A;  3DLL F;  3LSH A;  2R4G A;  5JHU A;  1BL0 A;  3V7C A;  5F64 A;  2XKP A;  1ZN2 A;  2ZME A;  2V4J C;  4I09 A;  3K1P A;  5DM6 F;  3IL2 A;  3ASO H;  4U7B A;  1K4S A;  5FKM A;  2DFE A;  3F8N A;  2E1N A;  2EIL H;  1ETX A;  3EET A;  4B44 A;  4L18 B;  2JA2 A;  1SFX A;  3GFM A;  3GX4 X;  4ASN A;  2DMP A;  1X1C A;  4FT8 A;  4M6V A;  3B6A A;  4XMY A;  4B47 A;  1T2K A;  5EG0 A;  4XKB A;  5IY5 H;  2KZG A;  4N4O B;  4HSR A;  2QF7 A;  2OV7 A;  5F04 A;  4D7N A;  4DGW B;  1F43 A;  4Q48 A;  2V7F A;  2R7Q A;  5JVG F;  2HYG D;  3K4N A;  1ZRE A;  4XLH A;  2A07 F;  4OU0 A;  1QNT A;  1RES A;  5AIQ A;  3CO7 C;  2R7R A;  3KPH A;  3SJM A;  1T0F C;  2RQP A;  3HM5 A;  2JRM A;  3K4M A;  1NH3 A;  3G3Z A;  3RQI A;  5E1Z B;  2W25 A;  5E3L A;  1OCT C;  2Y30 A;  5CJ9 A;  1B72 A;  2LF7 A;  3QRF F;  4XLA A;  3BZK A;  2A5W A;  3V42 A;  4G8X A;  2XF5 A;  3DBH B;  2GIZ A;  3I53 A;  4HF0 A;  4MIM A;  5LLQ A;  3D5L A;  3GO5 A;  2IXS A;  3HSF A;  2NVU B;  3F23 A;  2GM4 A;  4MEX F;  4OIQ F;  3K70 D;  1E3O C;  2BW3 A;  1ZG5 A;  3WU0 A;  5LHH A;  1DU6 A;  2M4K A;  3DWL E;  4GDF A;  2P81 A;  4XKC A;  4LJZ F;  3KEQ A;  3W2A A;  1PUF B;  5M3F J;  1VQP I;  4XRS G;  4R1H A;  2FE3 A;  3LAP A;  1R4N B;  3ZGK A;  4XRS A;  4MTE A;  3ZRG A;  3AG3 H;  3LOC A;  1LE8 A;  3HC7 A;  1DPR A;  3Q3S A;  4HX8 A;  5K7F A;  2EV5 A;  5ED4 A;  1AKH B;  2DPU A;  1TTY A;  4FHT A;  5E79 C;  2K27 A;  1R9T J;  1LVK A;  3PUF A;  3I4N J;  3RYP A;  2CV2 A;  2VOD A;  1GUU A;  4XOP A;  4HV5 A;  3BCB A;  2QA4 I;  2K3P A;  2ISZ A;  1YRN A;  3T8T A;  3ERM A;  4L5J A;  4CO8 A;  4ZZD A;  1S7E A;  4P9F A;  4M3D A;  1MMS A;  3MCZ A;  4L9V A;  4B43 A;  2DW4 A;  4BE1 A;  1J5Y A;  1RPW A;  4CCM A;  1TQM A;  2O3F A;  3VFZ A;  4XLC A;  1SD4 A;  1Z9C A;  3Q9S A;  3RDI A;  4AIK A;  5EEA A;  2LP0 A;  2VPR A;  1R4M B;  2Z99 A;  2V1X A;  3R4K A;  1W36 C;  4BS9 A;  1QQI A;  1O3T A;  2Z16 A;  1YJW I;  2ELJ A;  4FX0 A;  3IRR A;  3Q5F A;  5B3S H;  2A3S A;  4XSZ F;  5ILU A;  4A0Z A;  4XLN F;  3KEY A;  2Y0S N;  2P5V A;  4I76 A;  5GAG J;  2CUZ A;  2OF7 A;  3H5A A;  1KU2 A;  4I0A A;  2WV0 A;  3F8M A;  1PYV A;  4LLG F;  3HSR A;  5D4R A;  3HGG A;  4BH9 A;  3K2A A;  3LMM A;  4HNT A;  1A6I A;  4QLC U;  5FLX Z;  2UXN A;  1ZGW A;  1CGP A;  4KDP A;  3HOU J;  2CUF A;  1V5E A;  1OYY A;  2ZNY A;  2K40 A;  1BBY A;  2FBH A;  1OKR A;  2EZI A;  3KYD B;  4RAZ A;  2E36 A;  4H0E A;  2HOT A;  1VQ6 I;  1MKM A;  2ZXW H;  3LSP A;  2VIX A;  3PSF A;  1MBH A;  1ZR2 A;  3JTH A;  2M5W A;  5D6E A;  2JA7 J;  1F4K A;  3K4B A;  3S2W A;  4AUX A;  2LD5 A;  3O8G A;  3I4M J;  4MGR A;  1BI3 A;  4O6J A;  2GWR A;  5A2Q Z;  3MAJ A;  1JUS A;  2XRO A;  1EH6 A;  1QO0 D;  1G3S A;  5IOY A;  2L4M A;  2KRH A;  4P5O A;  4PJN A;  1MZB A;  1D1A A;  5FRO A;  2LYC A;  5BOX A;  1IXC A;  1R7J A;  1ETK A;  2ESN A;  3OWT A;  4CSW A;  3IKT A;  1H9T A;  2ZBK A;  2FXA A;  4Y4R A;  2TCT A;  5E3N A;  3OYN A;  2ZXI A;  3BLY A;  2VQG A;  1XMA A;  3W3C A;  4CCL A;  2X48 A;  2EJR A;  2A61 A;  4EQQ A;  1U8B A;  1Y39 A;  3H36 A;  1BC7 C;  4CUG A;  3M7G A;  2OTJ I;  4JX6 A;  2EFW A;  1CQT A;  2MYS A;  4ZDL A;  1ETW A;  2K9S A;  2LRE A;  1MDM B;  1IN6 A;  1QVT A;  2L01 A;  3KP4 A;  5K5O A;  3CUO A;  2GA1 A;  3PNT A;  4DBR A;  3DLA A;  4C3H J;  1QGP A;  2YX7 A;  2MD5 A;  2M0C A;  2M2E A;  1BR1 A;  3K4L A;  2XAF A;  4F52 A;  1MJB A;  4HDV A;  2QVO A;  1T08 B;  2DA7 A;  1T33 A;  2R0Q C;  5M3M J;  1UG2 A;  1WI9 A;  5FLM J;  2HXI A;  3ECH A;  4NHJ A;  5J8C A;  1Y1W J;  1YJ9 I;  4AIH A;  4LG3 A;  4A3J J;  4UVB A;  4CYC B;  2L0K A;  3G6E I;  1B8I A;  1QA6 A;  1T0F A;  3QP5 A;  4NC7 A;  4FQG A;  1CF7 A;  3UR3 C;  5J47 A;  5JVT A;  2R7T A;  5HDK A;  2BXZ A;  4IQJ A;  3LWF A;  3CUQ B;  4I02 A;  4RLF A;  5D5V B;  1GHC A;  1P7J A;  5HNH A;  2PBI A;  3N97 A;  5KCM A;  1SD7 A;  4CCK A;  3RPU A;  5BPI A;  3OOU A;  2E2H J;  1U9O A;  4HV6 A;  1WRJ A;  3RIR A;  3FHZ A;  3P5J A;  2OZU A;  1HBX G;  3VYR B;  2ZCW A;  3B02 A;  4KIG A;  2EZK A;  1XN7 A;  1JJ6 C;  1J2X A;  1LUJ B;  3ISP A;  1PUE E;  1YW8 A;  4G6Q A;  3CD6 I;  3LSR A;  1K6Y A;  4UXN A;  3COA C;  4E7H A;  2HYF A;  2HNH A;  4GYI A;  3E7L A;  1LDD A;  2K86 A;  3JRB A;  1IXR C;  3OSF A;  3EPZ A;  4BYY A;  5C44 J;  2Y75 A;  3CCV I;  3M1E A;  2X0L A;  2EBI A;  3JAM Z;  3ZP5 A;  1J75 A;  1E2X A;  2IGM A;  2RNJ A;  1FTZ A;  1B4A A;  3FXJ A;  3GW2 A;  3CC7 I;  3VSL A;  3OYB A;  4FE4 A;  3LA7 A;  4DJA A;  2AXL A;  2P7V B;  2XSD C;  4E7J A;  1LEA A;  3ECO A;  2RV8 A;  2M7A A;  1YOV B;  2FX0 A;  1HXD A;  3B73 A;  2K5C A;  3I59 B;  4Q47 A;  4V2G A;  3CCS I;  5FKK A;  2OJE D;  5E3M A;  2HZT A;  3HRM A;  5F0C A;  2CQN A;  3ZN0 A;  5C4X J;  3GWZ A;  3ELK A;  3ZMU A;  3FX3 A;  3DU5 A;  2EFQ A;  2LKS A;  3EYY A;  1Z1D A;  4ZYD A;  3OS1 A;  1DUX C;  3A0B C;  3CCJ I;  3JSO A;  1HDP A;  3OY9 A;  3BJ6 A;  4ETS A;  3QU6 A;  1ON2 A;  1FTT A;  2ELH A;  2P8T A;  4V19 K;  3AKZ A;  1FSE A;  2M8E A;  4CGZ A;  3R6S A;  1R5G A;  1EH7 A;  1PJR A;  3V8J A;  2VBY A;  3H3V K;  1S6L A;  4QIW N;  5E18 F;  1HA8 A;  3TBI A;  1D0Y A;  3K9T A;  4ZYA A;  2CQX A;  3F22 A;  3KCC A;  4I01 A;  3HKZ A;  3UNG C;  4UY8 I;  1NTC A;  4EMS A;  1R23 A;  2B7E A;  3CJN A;  4KT6 A;  2PI0 A;  1YFH A;  3E1S A;  2DJN A;  5TJJ A;  3BG6 A;  1IV6 A;  2V6C A;  3QQA A;  2KP6 A;  5CPR B;  1EF4 A;  1PVE A;  4W1U A;  1O7L A;  2V9V A;  1D8J A;  5F08 A;  3DEE A;  5LD2 C;  2H8W A;  2F4I A;  3D1N I;  1IAW A;  1FLI A;  5HVQ C;  2IAI A;  3SZG A;  2D1V A;  3U2R A;  1IN8 A;  4BXF A;  1G3W A;  3VYU B;  4UUV A;  3PNY A;  3JRG A;  2QEX I;  3HOX J;  4BQN A;  2XSJ C;  4CIC A;  4IHT A;  3LST A;  2IA0 A;  2LKX A;  4HF1 A;  1EKE A;  1P7I A;  2ID3 A;  1BW5 A;  1WCM J;  4HQE A;  1N25 A;  3BTI A;  3H1C A;  4LIV A;  2F4O B;  3OYE A;  5EF6 A;  1RUO A;  1TQP A;  2XF7 A;  5E1W A;  3FIS A;  4L5E A;  3MMY B;  4PFO A;  1SVL A;  4HNV A;  3OYA A;  4I2O A;  2DK5 A;  3CLQ A;  4A93 J;  4RM3 A;  2VAS A;  3CC2 I;  3PIP F;  2ZB9 A;  1W7P B;  1Y6I A;  1LFB A;  2MLK A;  2D5V A;  2X1C A;  2LY9 A;  1G2H A;  1IRX A;  1WQ2 A;  4BAY A;  1Z77 A;  1ETY A;  3HUG B;  2FQ3 A;  3IAS 2;  1VZ0 A;  2K02 A;  2L5Q A;  3WGI A;  4L9N A;  2FUG 2;  5LHG A;  2BY1 A;  3VWB A;  3I3L A;  2HWV A;  4M72 A;  1UMQ A;  3KP3 A;  2DMQ A;  3CCQ I;  1KYW A;  5HS9 A;  3JCU C;  3S93 A;  1WWX A;  3ZQQ A;  3OSG A;  3S3M A;  2KFD A;  3QOD A;  2PMZ N;  1S29 A;  2DOD A;  1K83 J;  3R0A A;  3ONQ A;  4YIF A;  3L2V A;  2STT A;  4I99 C;  3HOW J;  4S0H B;  3SHF A;  3LSK A;  1VQ7 I;  2H8R A;  2X1E A;  1TLH B;  2F5C A;  5EEH A;  2A6H F;  2CQQ A;  2X51 A;  5F0H A;  2COB A;  3F0C A;  1TNT A;  2MA3 A;  1JUM A;  3KP2 A;  2ZJP F;  4HEA 2;  1POG A;  2FMY A;  1X1D A;  1DQU A;  2CJJ A;  2KPM A;  3JAM K;  2KRC A;  1AWC A;  2VQH A;  2GXA A;  2HPI A;  1Z91 A;  2GZW A;  2L9N A;  3G1M A;  4QWQ A;  2BOL A;  3JRF A;  3G1O A;  3CUQ A;  3FXQ A;  4R79 A;  4OWR B;  1FWZ A;  1IG7 A;  3TKY A;  3O3K A;  4Y3O A;  2L3D A;  4ENN A;  2E1M B;  4NB5 A;  4UUS B;  3WTW C;  2PQ8 A;  4BJ5 C;  3E97 A;  5J1R A;  1ZG1 A;  1OIS A;  2CRG A;  1RRJ A;  4HRI A;  1XGS A;  1DP3 A;  1ZHF A;  2NRA C;  1RR7 A;  4UVA A;  4BGD A;  2NNN A;  1ODD A;  3OS0 A;  3M8F A;  2R7U A;  4BQQ A;  2KHM A;  2MLG A;  5LRR A;  1JT0 A;  3I55 I;  1GDT A;  2R7S A;  1I3Q J;  3HPG A;  4BEH B;  2OC6 A;  1ZK8 A;  2L02 A;  3DXJ F;  3T1B A;  3PNV A;  4IHW A;  1Q1H A;  2QWW A;  2V6E A;  1UHM A;  2DOA A;  2HVR A;  4RB0 A;  3H9Q A;  1FPQ A;  4G7H F;  1ZRF A;  2QQB A;  3GF2 A;  3IUO A;  3U1K A;  4Q4Z F;  3OYD A;  2YR2 A;  3A03 A;  1MMG A;  3EDP A;  4DZP A;  1EA3 A;  1OCC H;  2R5Z B;  5EZH A;  2E7X A;  2F5F A;  1MBF A;  4BY7 J;  4HPQ A;  1X1B A;  4ZTF A;  2CG4 A;  2ZC2 A;  3L2C A;  1WGX A;  2PMU A;  2Q2E A;  2FNP A;  3WU2 C;  1J9I A;  2H94 A;  1TW3 A;  1I5Z A;  4S05 A;  4J00 A;  1K7A A;  1QZZ A;  1Y56 A;  3MZ8 A;  1H0M A;  4KFC A;  3R0J A;  4UHT A;  3H3Z A;  1YHQ I;  2DA1 A;  2YSR A;  2R93 J;  1FT9 A;  2KQR A;  3RI4 A;  4BKX A;  1LVA A;  1XS9 A;  1BIA A;  5E8I A;  2LBF A;  1ZEL A;  1YW9 A;  2EZL A;  4FAS D;  3MZH A;  4OMY A;  1GT0 C;  2CWE A;  1JKO C;  2Y69 H;  2JPB A;  3OIQ A;  3QYF A;  2MD0 A;  2DLL A;  4ZDP A;  3JRE A;  5B66 C;  1XTA A;  3HXL A;  2VBZ A;  5IYD J;  2DO7 A;  1G8X A;  2HS5 A;  4HAM A;  4M9Z A;  3OYC A;  2V26 A;  4HQM A;  2OCC H;  4BHC A;  2WAE A;  4CHU A;  4A6D A;  1XPX A;  4RDU A;  1ZAR A;  1P92 A;  3CO6 C;  3E6D A;  1H89 C;  1TWH J;  3K69 A;  3GLL A;  1LFU P;  5D5W B;  1FOY A;  2W00 A;  2R7V A;  1IDZ A;  1KQ0 A;  3E6C C;  3SEZ A;  2VT3 A;  1EH8 A;  2I5U A;  2NAZ A;  4PGG A;  2QBY B;  1WJ5 A;  4MTD A;  3SFI A;  3RPQ A;  5DTD A;  4IVN A;  4M3E A;  3L2R A;  4IRI A;  2W82 A;  1L3L A;  2XGD A;  2Q8K A;  2H27 A;  4C2M J;  2P0W A;  2O61 A;  5LRS A;  1E17 A;  4BUP A;  3S1N J;  2KIM A;  4CCN A;  3JRC A;  3EQL F;  1YS7 A;  5CVR A;  5FRN A;  1BI1 A;  1X3Z B;  4P9U A;  1MSE C;  4F3Q A;  3WTU C;  4JX4 A;  1KQ8 A;  2IS6 A;  1MJA A;  4IEJ A;  1MJ9 A;  3AFH A;  5LHI A;  5FD5 A;  4EJU A;  3ERE D;  1MMA A;  2VKE A;  1UEL B;  5FGM A;  1M1E B;  2IA1 A;  2BY3 A;  2QM3 A;  3W2V A;  1WZ2 A;  5TGT A;  1XX5 A;  1QU3 A;  5K7Z A;  3KYC B;  3G2B A;  5DV5 A;  1IUF A;  3OYF A;  1OQY A;  1JKR C;  3FM3 A;  2YUS A;  4ENJ A;  3FXO A;  3MKL A;  2Y48 A;  3GZ6 A;  1LDK B;  3NAR A;  4BDZ A;  2JSC A;  5FO5 A;  1VQM I;  3RYR A;  3OMY A;  4ZYH A;  1ZG3 A;  1QBJ A;  1OR7 A;  4F55 A;  3S14 J;  4KIB A;  3I71 A;  3M8E A;  2O6G E;  1AOY A;  3E5Q A;  2VKD A;  1FX7 A;  1XCB A;  3LQQ A;  4HLX A;  2KIU A;  2VN2 A;  4E7S A;  1VQ9 I;  4RAY A;  3EUA A;  4MFE A;  3CQZ J;  2JA6 J;  4HOB A;  2M9H A;  3HRU A;  4UVC A;  3KIO A;  1U3E M;  1UG0 A;  5IYB J;  1QZE A;  1ZQ3 P;  1R00 A;  1AHD P;  3TED A;  3I9V 2;  4BU2 A;  4XRM A;  2DOF A;  2H1L A;  2E19 A;  4KN7 X;  4Y52 J;  3CMA I;  2DA5 A;  2V1D A;  3VB2 A;  1GVJ A;  4G6D A;  1T98 A;  3P9C A;  1FC3 A;  4L9T A;  2R92 J;  2XGX A;  4YEL A;  4MQV A;  1U5T B;  1B6A A;  3HEF A;  2RAE A;  4HNU A;  1KQ9 A;  2BXY A;  3BWG A;  3ZQH A;  1XB4 A;  1ZGA A;  4AU7 A;  2AO9 A;  5KHD A;  4BE0 A;  4RS8 A;  2H6C A;  1IV8 A;  3DPT A;  2RC4 A;  2FD5 A;  2PX9 A;  2TRT A;  3I5U A;  2WV1 A;  3GLX A;  5GTI C;  1ON1 A;  1R5I D;  1D0Z A;  2M0M A;  3HB9 A;  1MND A;  1KU9 A;  3PSI A;  1SD5 A;  3TW7 A;  1IN4 A;  4HA8 A;  4B3X A;  5DCM B;  1B9N A;  4DBQ A;  1DPU A;  2CUE A;  3EUK L;  2IA2 A;  3KLO A;  1YG2 A;  2KKO A;  5CVJ A;  2CH0 A;  1DGW Y;  3BG9 A;  3ZQI A;  3MFK A;  2XAU A;  3QPS A;  3LFK A;  5BNG A;  5EYR A;  4LIT A;  3PO3 J;  1MIJ A;  2GAU A;  1FBQ A;  5B1A H;  4NBQ A;  1N77 A;  2FML A;  1FBS A;  2EIJ H;  4XQF A;  2F5V A;  2RRE A;  2UV1 A;  2YU9 J;  3K1N A;  2VQL A;  1S3J A;  1XDS A;  2O5R A;  4RM2 A;  5EGO A;  5D4S A;  2L7M P;  1SFO J;  3CCM I;  1RKT A;  3BZ6 A;  5IPA A;  4I6Z A;  4RB3 C;  1T95 A;  1ZLK A;  4EVI A;  3V7R A;  2WAQ N;  2O8X A;  2NS8 A;  4A69 C;  2YU3 A;  3J7Y J;  1MMD A;  4D1Q A;  1TT5 B;  4P1W A;  5CYV A;  1X58 A;  4IHS A;  4JBA A;  2MBF A;  3J80 Z;  3GFJ A;  2G0E A;  4AYB N;  3P9I A;  3SDB A;  4HG2 A;  3ZOB A;  3UKG A;  1Z05 A;  4A3M J;  2CV1 A;  1U0J A;  1BA5 A;  5FKL A;  2W57 A;  2X1D A;  2PMH A;  2F48 A;  2RQQ A;  4KUM A;  4NQW A;  4PSX A;  3FDY A;  5AON A;  1WH7 A;  3WTV C;  3A4C A;  4U0W A;  2A6T A;  5FLV A;  2CQK A;  2ZJ2 A;  2Z33 A;  3QP6 A;  3TO6 A;  2KDZ A;  4D5F A;  2XGC A;  3GEZ A;  4E7K A;  2YX4 A;  2Y0M A;  1BIB A;  2DAO A;  1F9N A;  1LNW A;  2BE5 F;  1OYW A;  2Z9O A;  1JGS A;  3S2H J;  2JA8 J;  3Q0V A;  5BMZ A;  3IWZ A;  2Z2S B;  2MC4 A;  2L4A A;  1NG7 A;  3SFZ A;  1Z67 A;  3HTU A;  4JP0 A;  3S15 J;  2KRF A;  2DOE A;  1FOX A;  4DYC A;  1V5G A;  2D1H A;  3G1L A;  1IF1 A;  4CXF A;  3GCM A;  5TIS C;  3H0D A;  3HOZ J;  1Z0X A;  2EK5 A;  4YG2 F;  5HDN A;  4LK1 F;  5KVR A;  5BS6 A;  3NAU A;  2QSG X;  1H88 C;  2VI6 A;  1YIJ I;  2PMZ A;  4I7H A;  1S9H A;  3F6V A;  4EV0 A;  1BI0 A;  3K4K A;  4M6X A;  3I4P A;  3RJP A;  3RPU D;  1REP C;  2K4B A;  3MVP A;  2JVH A;  2OAZ A;  2IVM A;  3CES A;  1P9Q C;  2R5Y B;  1W0T A;  2EB7 A;  5J8F A;  3N05 A;  4OOI A;  3L2W A;  2EPF A;  2IT0 A;  4BY1 J;  4A3L J;  1IUY A;  1YI2 I;  2FF4 A;  2EIK H;  4XON A;  4WK8 F;  1I6H J;  3S1M J;  1Z7U A;  3FM5 A;  3FHN A;  3CCE I;  4DW6 A;  1BI2 A;  1MGT A;  3T5X A;  1TWF J;  3CMM A;  2DA6 A;  4A0Y A;  1UCR A;  2PG4 A;  3BRO A;  1VQ5 I;  2DMN A;  3ZQG A;  3WU1 B;  2ECC A;  3KLN A;  1AA7 A;  4PJM A;  3CCL I;  4J01 A;  4AM3 A;  2L7Z A;  2K85 A;  1R49 A;  1TWA J;  1ETQ A;  4IRG A;  2STW A;  4YFK F;  1YQA A;  3CME I;  4JOM A;  2GQQ A;  4OIN F;  2J5P A;  1A36 A;  5DUI A;  2L7K A;  2BHZ A;  1TQI A;  2LSO A;  1ENH A;  5D8K B;  4RB2 C;  4FX4 A;  1FMW A;  2HDW A;  3OYL A;  1HKT A;  2LMD A;  2PFB A;  3V4G A;  1G4D A;  1XCV A;  3BR5 A;  3ZR8 X;  4C2U A;  2F2E A;  1SAX A;  2HPM A;  3H35 A;  3DKW A;  4FET A;  1D0X A;  3FMQ A;  3HOV J;  2DFI A;  3GTQ J;  4EJW A;  1OYI A;  2M4G A;  4LFU A;  4MO7 A;  2ME6 A;  4FE7 A;  1X2N A;  4A0X A;  1F5T A;  5HLI A;  5HOO A;  2K9N A;  1VQN I;  1HKS A;  3FF5 A;  3WE3 A;  3J81 Z;  1K79 A;  2XRL A;  4HZF A;  1W36 D;  4BJT A;  2LNB A;  4M71 A;  3DTK A;  2JT1 A;  3FXU A;  2MGQ A;  3CUQ C;  2ZXJ A;  2PEX A;  4EM0 B;  3REO A;  2LTP A;  2JVG A;  4BL0 B;  4AVZ A;  5C4J J;  2OD5 A;  1WHU A;  2VJI A;  3ABT A;  3IHU A;  4CCJ A;  1FYM A;  3ML6 A;  1XGO A;  4PDK A;  5DYM A;  4G6T B;  4LG0 B;  4P55 A;  1ZRD A;  1WJC A;  3OYG A;  4F7Z A;  2OQR A;  5DCM A;  1OCZ H;  1U2W A;  3FXK A;  2K9Q A;  3I56 I;  3BCA A;  3CJT B;  1TNS A;  1V3F A;  3F9K A;  2QLZ A;  3B6C A;  2IJL A;  1LFP A;  3H9J A;  3DF8 A;  4Y17 A;  3J7A O;  1PUF A;  1XSD A;  2XAS A;  3JW4 A;  1R71 A;  4Y15 A;  1NK2 P;  1Z6T A;  2WTE A;  4LGW A;  1Z21 A;  2LR8 A;  1D1C A;  3LFU A;  3KFW X;  5GP9 A;  1TT0 A;  1TWG J;  1AKH A;  1J59 A;  3FZV A;  1YIT I;  2CW8 A;  2LDU A;  4C30 A;  1ZRC A;  1A6Q A;  3H5R A;  2WA0 A;  5IT9 Z;  5FLX K;  5GPC A;  1R58 A;  1HLV A;  2CYY A;  5DCF A;  2V9P A;  4LMY A;  1APL C;  1Z3X A;  1HW5 A;  4M6Y A;  3WTZ A;  3TP3 A;  3IH3 A;  3S32 A;  5JR3 A;  4G7Z F;  3FXM A;  2P4W A;  4KIC A;  2Z1D A;  4ZYG A;  5IYC J;  4XID A;  4IZZ A;  2R7Z J;  3T8R A;  3MWM A;  3I0T A;  2L9R A;  3FBN B;  1WJD A;  3M8J A;  4J19 A;  3VOE A;  4ZTJ A;  4E7Z A;  4A5N A;  1HDD C;  2JUC A;  5A2Q K;  2DJI A;  1W4M A;  4A3D J;  1UZC A;  1X1P A;  3BT9 A;  3P7N A;  3DKX A;  2DQR A;  1LPQ A;  1MSF C;  2Z5U A;  4S04 A;  4FIS A;  4P96 A;  5D8L B;  3CLO A;  4ESB A;  3FMS A;  1R22 A;  3CF5 F;  1MBG A;  3AL0 B;  1IRG A;  3LNQ A;  1GXQ A;  3L00 A;  2FBK A;  1T56 A;  2VE8 A;  1BN5 A;  3HJE A;  3O8H A;  2HKO A;  5DUK A;  3K4J A;  2ZO4 A;  5ILS A;  3QPH A;  1ZR4 A;  2JTV A;  2GLO A;  3SQN A;  3TMO A;  5DM7 F;  4E7I A;  4I0B A;  5K7H A;  4D9J A;  5TRD A;  3HHG A;  4IJA A;  4A3F J;  2EFO A;  2DT6 A;  3OR1 C;  1S5L C;  3JRD A;  3CDH A;  1SMY F;  5K1Y A;  5CQE A;  2VJ5 A;  4B48 A;  2M7B A;  2NOG A;  4AIJ A;  5CVI A;  1I50 J;  2Y2Z A;  4IQ4 A;  4G9Y A;  2IS1 A;  2PJR B;  1A35 A;  4OMZ A;  5DEQ A;  1B1B A;  3C2G A;  3LQR A;  3E6B A;  1QHH D;  2HR3 A;  2JN6 A;  2CSO A;  4KT5 C;  1V4R A;  1GV2 A;  3S1R J;  1XGN A;  3RQ4 A;  3GVA A;  2VBX A;  4QPO A;  4LLL A;  4C9Y A;  2RKH A;  4BQO A;  4M74 A;  4DNC A;  1EJ9 A;  3BY6 A;  2HZD A;  3KZY A;  3CCU I;  1IRZ A;  3HOY J;  2M34 A;  1G3Y A;  4BDY A;  2MW8 A;  1MW7 A;  1KU3 A;  3U21 A;  2HTJ A;  5HDG A;  3OS2 A;  3PIO F;  2K7L A;  2F5D A;  2FJ1 A;  2IPQ X;  4O3M A;  2A68 F;  5EDN A;  1OLT A;  3K6G A;  4KJZ A;  4K2E A;  2DA4 A;  3G73 A;  2HOS A;  1ZH5 A;  2L9V A;  1XDU A;  5F6F A;  1G3T A;  1QPM A;  3DEU A;  4QSH A;  3WHC A;  1OCR H;  1VQK I;  1UFM A;  4X6A J;  1K78 B;  1JGG A;  4HX4 A;  2HKX A;  5CQG A;  3BR1 A;  4G7O F;  3J81 K;  2W7N A;  1FYK A;  3OL4 A;  3AG4 H;  2HEO A;  5K5R A;  2JWT A;  5H6R A;  2YS9 A;  4Z2Y A;  2F5E A;  2KDO A;  3FXL A;  1MDM A;  1N78 A;  2JZY A;  1WFX A;  2GXG A;  2H09 A;  4XR6 A;  2K9L A;  2VC0 A;  3GTJ J;  2NS0 A;  1UHW A;  2IGK A;  1QHG A;  4XLE A;  4BBS J;  2LG4 A;  4G94 A;  1GXP A;  2W84 A;  1OR7 C;  4XNF A;  2EA4 A;  2B63 J;  3IP4 B;  3N4M A;  2WB1 N;  2VC1 A;  4WXH A;  2KT0 A;  3A01 B;  2QQ8 A;  3ABU A;  3D5R C;  1KZH A;  2JQ7 A;  2AHQ A;  2FQ4 A;  3DQV C;  4NDL A;  2XRN A;  3F8F A;  4CYC A;  2HYJ A;  5C3E J;  1DP7 P;  3Q9V A;  2ZME B;  2L54 A;  1LB2 A;  4L0Y B;  1SVO A;  4N0B A;  1S7A A;  2MC3 A;  5GAE J;  2FNA A;  2ID6 A;  5BQT A;  2HXO A;  2QKL B;  5D6F A;  2DK8 A;  4B8X A;  3HOT A;  2E2J J;  3NWS A;  1UHS A;  3VDX A;  5CVV A;  5EG0 B;  2IGO A;  4A3E J;  4X0G A;  3MEX A;  5J40 A;  1IZ1 A;  2HOE A;  1WPK A;  2Y9Y A;  3WG9 A;  3QOE A;  1TW2 A;  4EJO A;  1UST A;  4ZJZ A;  4IHY A;  2R7X A;  2MSY A;  2XPW A;  2VB6 A;  3K0L A;  3HPH A;  5H2F C;  3BTL A;  5J4Y A;  3MD2 A;  1C0W A;  5EJC A;  4OIP F;  1P4W A;  5K5Q A;  2DDA A;  5IOZ A;  4NNJ A;  1I1S A;  1G6N A;  3SZT A;  5JLW A;  1S8N A;  2RN7 A;  1TBX A;  3SYT A;  2UUZ A;  3HIF A;  1B72 B;  3WTS C;  1YIO A;  1FSH A;  3GYH X;  1S7O A;  4IHV A;  4PUS A;  2OTL I;  2O7O A;  1MNE A;  1Z6R A;  1ERD A;  2BW3 B;  3WG7 H;  2E35 A;  2DN0 A;  4MQ9 F;  2X6W A;  5D5U B;  4WXD A;  4GCV A;  4CDG A;  1FY7 A;  3E5X A;  2M3A A;  1LJ9 A;  3DBL B;  3I59 A;  2KIS A;  4GRI A;  4ON0 A;  4KMU X;  2XKO A;  2LF8 A;  3ZMS A;  2VPL A;  1SAN A;  2Y0S A;  5L3E A;  2DA3 A;  4ZH4 F;  2NNY A;  1LE8 B;  2V1U A;  1SFK A;  2ZSH B;  1RI7 A;  4AVP A;  5CLS A;  5IT3 A;  3BC8 A;  3RTR A;  5F1R A;  1QVU A;  3BJO A;  4M9S A;  4MEY F;  2ZFW A;  4Y33 A;  4MLO A;  3JRA A;  1BJA A;  2HI3 A;  3FIW A;  4HW0 A;  1MMN A;  4CZZ A;  4XOR A;  3GTM J;  3TOA A;  3WTT C;  1SFU A;  1AU7 A;  1YRN B;  2VOO A;  3DPL C;  2HQN A;  4H4K C;  1KGS A;  4IKF A;  1ONV A;  2ZJR F;  2AQE A;  2VOP A;  3QPL A;  5J3L A;  5HLT A;  3DFG A;  3GUD A;  2KLO A;  4HBL A;  2RVC A;  2ME0 A;  2PLY A;  2IW5 A;  2QSF X;  1MBE A;  1HKQ A;  1V5F A;  2VJJ A;  1D1B A;  3IC7 A;  3WGH A;  3M07 A;  4B4C A;  4IF4 A;  4KN4 X;  4B3A A;  2K3F A;  2GOM A;  1IC8 A;  2IBD A;  4GGG A;  3CP8 A;  3MZY A;  2O8K A;  1Y0N A;  5AIP A;  1EV7 A;  1ORK A;  3RKW A;  1JJ8 C;  1SMT A;  1O4X A;  1B59 A;  4DYQ A;  3PQK A;  3WTY C;  3BTJ A;  3Q0U A;  1U9N A;  2PN6 A;  2K9M A;  1X19 A;  5GPA A;  3K70 C;  3C2B A;  3D0S A;  3L7W A;  3QWL A;  1A04 A;  4PGH A;  5L3G A;  1BR2 A;  1MBJ A;  4A6E A;  4XM3 A;  1MH3 A;  4D0P A;  4XKW A;  3RKY A;  1JE8 A;  2FEZ A;  2X6Y A;  4GFB A;  3OOP A;  3RZD J;  5M5X J;  1IN7 A;  5EZG A;  1P4X A;  2XV4 S;  3CCY A;  1W5T A;  3R61 A;  4XBF A;  4HF2 A;  5J1U A;  3ZMT A;  5LFA A;  5L3F A;  2GA2 A;  2XVC A;  3HHH A;  4WX9 A;  1FP2 A;  3BP8 A;  1W7P A;  1VTN C;  1HW1 A;  3L2Q A;  2UZK A;  4ESF A;  4ZZL A;  3GTO J;  2CQ7 A;  4M3B A;  4XN3 A;  1JI8 A;  1JTX A;  4KMF A;  2QQ9 A;  2FA5 A;  4RAF A;  4BXU A;  1D3Y A;  1RNL A;  3TO7 A;  1VQL I;  2CV0 A;  3HUG A;  2XPU A;  4GO1 A;  2VXZ A;  2HQA A;  2W85 A;  4U0V A;  2LC2 A;  4JK1 X;  5HLG A;  1TP4 A;  4F92 B;  2JRT A;  3I58 A;  2CS3 A;  2LOO A;  5E20 A;  3ABL H;  3H3U A;  2LFB A;  3IRQ A;  2OA4 A;  5JI6 A;  1D8K A;  4U7D A;  5B5E C;  5H20 A;  1ZGJ A;  2M45 A;  1XD7 A;  2NYX A;  4PCQ A;  1W0U A;  1GVD A;  2R7O A;  4DZJ A;  3PFI A;  1WJB A;  1QZY A;  1WJE A;  2MFZ A;  5HS8 A;  3WGG A;  2EV0 A;  5DDG A;  1D5Y A;  1FEX A;  1L0O C;  2A69 F;  1FYL A;  2HVQ A;  2N8G A;  2I10 A;  3PQJ A;  4XLF A;  5J4V A;  4PSW A;  2O0Y A;  3HRS A;  4EM2 A;  1IRF A;  2B0L A;  4JQF A;  4A3K J;  3S1Q J;  2M8G X;  2M87 A;  2WY7 Q;  1MBK A;  1B8I B;  3WOD F;  2DTR A;  2LH9 A;  1CF7 B;  3L9F A;  1FOK A;  1LEB A;  2BYV E;  5KAF C;  4PJJ A;  4UUS A;  1X1A A;  3C2H A;  3OL3 A;  1MH4 A;  3LSI A;  3KZI C;  1U5T C;  1ITY A;  1Q1V A;  3DV8 A;  4A3G J;  1STZ A;  2MH2 A;  3BR6 A;  3K4C A;  3OIO A;  2A6E F;  2JK3 A;  4LD5 A;  4R8H A;  1GLN A;  3KP7 A;  4LIU A;  3W6K B;  2HFH A;  4LK0 F;  4XRF A;  3ULQ B;  4A2U A;  1WH5 A;  3HSE A;  4RB1 A;  3LA3 A;  1KON A;  4BEH A;  2A5Y B;  2XIG A;  2OQG A;  2W24 A;  1BW6 A;  3KET A;  1SFE A;  4BQA A;  3V7S A;  4XLP F;  1HW2 A;  3O6B B;  3X2Q H;  2EH3 A;  2OBP A;  5FB2 A;  2KL4 A;  3BOQ A;  5D5X B;  4YIR X;  1ETV A;  1R5H A;  2WWY A;  2R5Z A;  1JT6 A;  2X85 A;  3MN2 A;  4LLN A;  1MNM C;  3VYT B;  1R36 A;  4PFP A;  1T38 A;  4Q5S F;  4HX7 A;  4AID A;  2WC2 A;  4IX7 A;  1VQ4 I;  4AWX B;  5JFR A;  3DKY A;  1R1U A;  1HST A;  2ZKZ A; 
#chains in the Genus database with same CATH homology
 3EYI A;  4Y13 A;  1I1G A;  1HSJ A;  1BM9 A;  4U88 A;  1KA8 A;  5ICG A;  2AS5 F;  2C6Y A;  3MQ0 A;  3E6M A;  2XUB A;  3O2P E;  4WXC A;  5J6X A;  2RDP A;  2K4J A;  3VEP A;  2M1B A;  4L5I A;  2HTS A;  3R60 A;  1WKM A;  4RGU A;  1LQ1 A;  2CGP A;  2EFN A;  3QAH A;  1IW7 F;  3F72 A;  2ZNZ A;  3TQN A;  3QPT A;  1YW7 A;  1H9G A;  4L9J A;  4YFN F;  5LGU A;  2QBY A;  3FXR A;  1DDN A;  5DD4 A;  1YLF A;  2DI3 A;  1XGM A;  2FSW A;  2P6T A;  3HTS B;  4O5V A;  4HYE A;  1F1Z A;  3HYI A;  1KYZ A;  3I54 A;  3SZP A;  1FP1 D;  1PP7 U;  1P2F A;  2X4H A;  2ISY A;  1W5S A;  4KA4 A;  3ZPL A;  4WWC A;  2QZ8 A;  2OU2 A;  3KZZ A;  3H92 A;  4ENM A;  1O7F A;  3I64 A;  2FBI A;  4YII A;  2EFP A;  3KE2 A;  3FMR A;  3BJA A;  4WF2 A;  3F3X A;  5HLH A;  2IRF G;  2QQA A;  5E1X A;  1XMK A;  4BHB A;  2DT5 A;  1JHH A;  1U5T A;  1RUN A;  2KIF A;  3ZMV A;  1XSX A;  2VE9 A;  1ZYR F;  2CFX A;  2R7F A;  2GIV A;  2ESH A;  3IWF A;  3GFL A;  3F8C A;  4HDU A;  3WE2 A;  3K2Z A;  1SD6 A;  2EWN A;  4IRH A;  3GXO A;  3TDZ C;  5LEK A;  3J80 K;  1YYV A;  4DQ2 A;  5FFX A;  5ILV A;  3AAF A;  4ZYE A;  3NQO A;  4GYG A;  3C7J A;  2PJP A;  2FOK A;  3ZQ7 A;  3DP7 A;  3C18 A;  5ICF A;  3TGN A;  2HQR A;  4EGZ A;  3ZMZ A;  3K1M A;  4EJT A;  2MH9 A;  2BV6 A;  3U9G A;  2COM A;  4UV8 A;  4BHP A;  1T6S A;  2E1C A;  4A5M A;  3BPV A;  3NEU A;  4ESJ A;  1RIO H;  5E17 F;  1OPC A;  5ERI A;  4M9X A;  1ZLJ A;  4WCG A;  5ICE A;  2O03 A;  2FU4 A;  3M9A A;  4I98 B;  3C1D A;  4MNU A;  5HS7 A;  1J0R A;  2P5L C;  2EV6 A;  2P6S A;  3TO9 A;  2M30 A;  2XAQ A;  6PAX A;  4GXO A;  4EM1 A;  2G7H A;  2HGC A;  2J5O A;  2QUF A;  3F21 A;  1BC8 C;  2TDX A;  3GZ5 A;  4UNO A;  2XAG A;  4E70 A;  3V8K A;  5BPD A;  4LB5 A;  4ENK A;  4RGX A;  1XSV A;  1PP8 F;  2UXX A;  2CW0 F;  5FFZ A;  2OZ6 A;  3TOB A;  4U0Y A;  4CYD A;  4EGY A;  2BEO A;  1HQC A;  3KEO A;  1O57 A;  2QEN A;  2FRH A;  4AD9 A;  2H6B A;  3BDD A;  3ZMD A;  2DBB A;  2XAJ A;  2KJC A;  3U1D A;  5L3B A;  1YO5 C;  2CO5 A;  1U78 A;  2IP2 A;  2D2W A;  3OV8 A;  3NRV A;  5LEJ A;  2UWM A;  4HLY A;  4TV7 A;  1IN5 A;  1T39 A;  2ADU A;  4RGS A;  5E8G A;  3BPX A;  4N9H A;  5IT9 K;  2G9W A;  4YFX F;  1K6O A;  3E3V A;  1LDJ A;  2P7C B;  3L09 A;  3HOS A;  1BOA A;  5CVU A;  4LG0 A;  3TDU C;  1JHF A;  3KP5 A;  5EEG A;  4KNY A;  1D5V A;  4RGR A;  3WTX C;  1J7K A;  1UB9 A;  3FWE A;  3V8L A;  5H6Q A;  2HDC A;  1R1T A;  3E5U A;  2JPC A;  2BBY A;  2KJB A;  4KYW A;  3C3W A;  5DD8 A;  3SXY A;  1WSU A;  1YTY A;  2EA2 A;  1YS6 A;  3LAJ A;  1MD0 A;  2YPR A;  2LKP A;  3T0Y A;  1U6G A;  4EJV A;  2P5K A;  4MHG A;  1USS A;  4BNC A;  1I27 A;  4IPA A;  2XAH A;  2DU9 A;  4N9I A;  1FZP B;  3EUH A;  2D45 A;  1W7P D;  1ZAO A;  3ZN1 A;  3HRT A;  4B09 A;  3JSP A;  3P9K A;  1PDN C;  2R7D A;  1IXS B;  2DPD A;  2VON A;  1RZ4 A;  4UV9 A;  1O3S A;  1P4A A;  5LGT A;  1JXS A;  2E7W A;  3RKX A;  4OIO F;  1B9M A;  3QU3 A;  1O3Q A;  3F6O A;  2DQL A;  2Q0O A;  1KU7 A;  4PZJ A;  1OMI A;  5LGN A;  3VOD A;  1P6R A;  4IXA A;  3KP6 A;  1Y0U A;  1ULY A;  4XSX F;  3ROU A;  2QYO A;  1FNN A;  5L3C A;  3LA2 A;  5FD6 A;  5L3D A;  3CTA A;  2R3S A;  2VT2 A;  1O3R A;  1R1V A;  1FBU A;  4A12 A;  1NHA A;  2V79 A;  5ICC A;  5LBQ A;  1K78 A;  3F8B A;  4M73 A;  4L0Z B;  2VBW A;  1I6X A;  1X3U A;  2Z3Y A;  5KK1 A;  3IKV A;  2G7U A;  4OIR F;  2ETH A;  3W6J B;  4KIF A;  3QOP A;  1U8R A;  4LB6 B;  3GFI A;  2BGC A;  2RGV A;  2XHK A;  2ACJ A;  3JTG A;  2GXB A;  5JHU A;  3V7C A;  5F64 A;  2XKP A;  1ZN2 A;  2ZME A;  4I09 A;  3K1P A;  3IL2 A;  4U7B A;  3F8N A;  2E1N A;  3EET A;  4L18 B;  1SFX A;  3GFM A;  3GX4 X;  4ASN A;  4FT8 A;  1T2K A;  4Q48 A;  2HYG D;  1ZRE A;  2A07 F;  4OU0 A;  1QNT A;  5AIQ A;  3CO7 C;  2RQP A;  3G3Z A;  5E1Z B;  2W25 A;  5CJ9 A;  2LF7 A;  3QRF F;  4G8X A;  4HF0 A;  3I53 A;  5LLQ A;  3D5L A;  3GO5 A;  3F23 A;  3HSF A;  4MEX F;  4OIQ F;  1ZG5 A;  3WU0 A;  5LHH A;  4LJZ F;  3KEQ A;  4R1H A;  2FE3 A;  3LAP A;  4MTE A;  1DPR A;  4HX8 A;  2DPU A;  2EV5 A;  5ED4 A;  1TTY A;  4FHT A;  2K27 A;  3RYP A;  2VOD A;  4HV5 A;  2ISZ A;  3T8T A;  4L5J A;  4CO8 A;  4ZZD A;  4P9F A;  3MCZ A;  4L9V A;  2DW4 A;  1J5Y A;  1TQM A;  2O3F A;  3VFZ A;  1SD4 A;  1Z9C A;  3Q9S A;  3RDI A;  4AIK A;  2Z99 A;  2V1X A;  3R4K A;  1QQI A;  1O3T A;  4FX0 A;  3IRR A;  3Q5F A;  2A3S A;  4XSZ F;  5ILU A;  4A0Z A;  4XLN F;  2P5V A;  1KU2 A;  4I0A A;  2WV0 A;  3F8M A;  4LLG F;  3HSR A;  5D4R A;  4BH9 A;  4QLC U;  5FLX Z;  2UXN A;  1CGP A;  4KDP A;  1OYY A;  2ZNY A;  1BBY A;  2FBH A;  1OKR A;  4RAZ A;  4H0E A;  1MKM A;  3JTH A;  2M5W A;  5D6E A;  1F4K A;  3S2W A;  4MGR A;  1BI3 A;  4O6J A;  2GWR A;  5A2Q Z;  3MAJ A;  2XRO A;  1EH6 A;  1QO0 D;  1G3S A;  2L4M A;  4P5O A;  1MZB A;  5BOX A;  1IXC A;  1R7J A;  2ESN A;  3IKT A;  1H9T A;  2ZBK A;  2FXA A;  1XMA A;  2EJR A;  2A61 A;  4EQQ A;  1BC7 C;  3M7G A;  2EFW A;  1MDM B;  1IN6 A;  2L01 A;  3KP4 A;  5K5O A;  3CUO A;  2GA1 A;  1QGP A;  2YX7 A;  2MD5 A;  2XAF A;  1MJB A;  4HDV A;  2QVO A;  1WI9 A;  3ECH A;  4NHJ A;  5J8C A;  4AIH A;  4UVB A;  1T0F A;  3QP5 A;  1CF7 A;  5JVT A;  5HDK A;  3LWF A;  3CUQ B;  4I02 A;  5D5V B;  1GHC A;  3N97 A;  2PBI A;  5BPI A;  1SD7 A;  3RPU A;  4HV6 A;  1WRJ A;  3RIR A;  3FHZ A;  2OZU A;  1HBX G;  2ZCW A;  3B02 A;  4KIG A;  1XN7 A;  1J2X A;  3ISP A;  1PUE E;  1YW8 A;  4G6Q A;  4UXN A;  3COA C;  2HYF A;  1LDD A;  2K86 A;  1IXR C;  4BYY A;  3ZP5 A;  2Y75 A;  3M1E A;  2X0L A;  3JAM Z;  1J75 A;  1E2X A;  2RNJ A;  1B4A A;  3GW2 A;  3LA7 A;  2AXL A;  2P7V B;  1LEA A;  3ECO A;  2RV8 A;  1HXD A;  3B73 A;  3I59 B;  4Q47 A;  2HZT A;  3HRM A;  3ZN0 A;  3GWZ A;  3ELK A;  3ZMU A;  3FX3 A;  2EFQ A;  3EYY A;  1Z1D A;  4ZYD A;  1DUX C;  3JSO A;  3BJ6 A;  4ETS A;  3QU6 A;  1ON2 A;  2ELH A;  2P8T A;  1FSE A;  2M8E A;  4CGZ A;  3R6S A;  1R5G A;  1EH7 A;  3V8J A;  2VBY A;  1S6L A;  5E18 F;  3K9T A;  3F22 A;  3KCC A;  4I01 A;  4EMS A;  1R23 A;  3CJN A;  2PI0 A;  1YFH A;  5TJJ A;  2V6C A;  1O7L A;  2V9V A;  1D8J A;  1IAW A;  1FLI A;  5HVQ C;  2D1V A;  3U2R A;  1IN8 A;  1G3W A;  4UUV A;  4CIC A;  4IHT A;  3LST A;  2IA0 A;  4HF1 A;  4HQE A;  1RUO A;  1TQP A;  5E1W A;  4I2O A;  2DK5 A;  1W7P B;  2MLK A;  1WQ2 A;  4BAY A;  2FQ3 A;  2K02 A;  3WGI A;  4L9N A;  5LHG A;  2HWV A;  4M72 A;  3KP3 A;  1KYW A;  5HS9 A;  1WWX A;  1S29 A;  3R0A A;  4YIF A;  2STT A;  3SHF A;  1TLH B;  2F5C A;  5EEH A;  2A6H F;  1TNT A;  2MA3 A;  3KP2 A;  2FMY A;  3JAM K;  1AWC A;  1Z91 A;  2GZW A;  4QWQ A;  3CUQ A;  3FXQ A;  4R79 A;  1FWZ A;  3TKY A;  3O3K A;  4ENN A;  2L3D A;  4NB5 A;  3WTW C;  2PQ8 A;  3E97 A;  1ZG1 A;  1XGS A;  1ZHF A;  2NRA C;  4UVA A;  2NNN A;  1ODD A;  3M8F A;  2MLG A;  5LRR A;  2L02 A;  3T1B A;  3DXJ F;  1Q1H A;  2QWW A;  1UHM A;  4RB0 A;  1FPQ A;  4G7H F;  1ZRF A;  2QQB A;  3GF2 A;  4Q4Z F;  2YR2 A;  3EDP A;  2E7X A;  2F5F A;  2CG4 A;  3L2C A;  2PMU A;  2Q2E A;  2FNP A;  1J9I A;  2H94 A;  1TW3 A;  1I5Z A;  4S05 A;  1K7A A;  4KFC A;  1QZZ A;  1H0M A;  3R0J A;  4UHT A;  3H3Z A;  2YSR A;  1FT9 A;  3RI4 A;  1LVA A;  1BIA A;  5E8I A;  1YW9 A;  3MZH A;  4OMY A;  2CWE A;  2JPB A;  2DLL A;  2VBZ A;  2DO7 A;  2HS5 A;  4HAM A;  4M9Z A;  4HQM A;  4BHC A;  4CHU A;  4A6D A;  1ZAR A;  1P92 A;  3CO6 C;  3E6D A;  3K69 A;  5D5W B;  1KQ0 A;  3E6C C;  2VT3 A;  1EH8 A;  2NAZ A;  4PGG A;  2QBY B;  4MTD A;  3RPQ A;  4IVN A;  4IRI A;  1L3L A;  2Q8K A;  2H27 A;  2O61 A;  5LRS A;  1E17 A;  2KIM A;  3EQL F;  1YS7 A;  5CVR A;  1BI1 A;  4P9U A;  3WTU C;  1KQ8 A;  1MJA A;  1MJ9 A;  5LHI A;  5FD5 A;  4EJU A;  3ERE D;  5FGM A;  2IA1 A;  2QM3 A;  5DV5 A;  3FM3 A;  4ENJ A;  2Y48 A;  3GZ6 A;  1LDK B;  2JSC A;  5FO5 A;  3RYR A;  4ZYH A;  1QBJ A;  1ZG3 A;  1OR7 A;  4KIB A;  3I71 A;  3M8E A;  2O6G E;  1AOY A;  3E5Q A;  1FX7 A;  1XCB A;  3LQQ A;  4HLX A;  2KIU A;  2VN2 A;  4RAY A;  4HOB A;  3HRU A;  4UVC A;  1U3E M;  1R00 A;  4KN7 X;  2V1D A;  3VB2 A;  1GVJ A;  4G6D A;  1T98 A;  3P9C A;  1FC3 A;  4L9T A;  2XGX A;  4MQV A;  1U5T B;  1B6A A;  1KQ9 A;  3BWG A;  1XB4 A;  1ZGA A;  4RS8 A;  2H6C A;  3DPT A;  2RC4 A;  3I5U A;  3GLX A;  1ON1 A;  1KU9 A;  1SD5 A;  1IN4 A;  4HA8 A;  5DCM B;  1B9N A;  1DPU A;  2IA2 A;  3KLO A;  1YG2 A;  2KKO A;  5CVJ A;  3MFK A;  3LFK A;  2GAU A;  1FBQ A;  2FML A;  1FBS A;  3K1N A;  1S3J A;  1XDS A;  5D4S A;  3BZ6 A;  4RB3 C;  1ZLK A;  4EVI A;  3V7R A;  2O8X A;  2YU3 A;  5CYV A;  4IHS A;  4JBA A;  2MBF A;  3J80 Z;  3GFJ A;  3P9I A;  1Z05 A;  2W57 A;  4KUM A;  2PMH A;  4NQW A;  5AON A;  3WTV C;  4U0W A;  2CQK A;  2ZJ2 A;  2Z33 A;  3QP6 A;  3TO6 A;  3GEZ A;  2YX4 A;  2Y0M A;  1BIB A;  2DAO A;  1F9N A;  1LNW A;  2BE5 F;  1OYW A;  2Z9O A;  1JGS A;  5BMZ A;  3IWZ A;  2L4A A;  3SFZ A;  3HTU A;  2KRF A;  2D1H A;  1IF1 A;  4CXF A;  2EK5 A;  4YG2 F;  5HDN A;  4LK1 F;  5KVR A;  5BS6 A;  4I7H A;  4EV0 A;  3F6V A;  1BI0 A;  4M6X A;  3I4P A;  3RJP A;  1REP C;  2K4B A;  2OAZ A;  2IVM A;  2EB7 A;  5J8F A;  4OOI A;  2IT0 A;  1IUY A;  2FF4 A;  4WK8 F;  1Z7U A;  3FM5 A;  1BI2 A;  1MGT A;  3T5X A;  4A0Y A;  1UCR A;  2PG4 A;  3BRO A;  3WU1 B;  3KLN A;  4IRG A;  2STW A;  4YFK F;  1YQA A;  2GQQ A;  4OIN F;  2J5P A;  5DUI A;  2LSO A;  5D8K B;  1TQI A;  4RB2 C;  4FX4 A;  1HKT A;  2PFB A;  3V4G A;  1G4D A;  1XCV A;  2F2E A;  1SAX A;  3DKW A;  3FMQ A;  2DFI A;  4EJW A;  1OYI A;  4LFU A;  4A0X A;  1F5T A;  5HLI A;  5HOO A;  1HKS A;  3FF5 A;  3J81 Z;  3WE3 A;  1K79 A;  4HZF A;  2LNB A;  4M71 A;  2JT1 A;  3FXU A;  3CUQ C;  2ZXJ A;  2PEX A;  4EM0 B;  3REO A;  2OD5 A;  3ABT A;  3IHU A;  1FYM A;  3ML6 A;  1XGO A;  4PDK A;  5DYM A;  4LG0 B;  4P55 A;  1ZRD A;  4F7Z A;  2OQR A;  5DCM A;  1U2W A;  1TNS A;  1V3F A;  2QLZ A;  2IJL A;  3J7A O;  4Y17 A;  3DF8 A;  1XSD A;  2XAS A;  3JW4 A;  4Y15 A;  1Z6T A;  2WTE A;  4LGW A;  3KFW X;  1J59 A;  3FZV A;  2LDU A;  1ZRC A;  5IT9 Z;  5FLX K;  1R58 A;  2CYY A;  5DCF A;  4LMY A;  1HW5 A;  4M6Y A;  3WTZ A;  5JR3 A;  4G7Z F;  2P4W A;  4KIC A;  4ZYG A;  3T8R A;  3MWM A;  3I0T A;  3VOE A;  4A5N A;  5A2Q K;  1W4M A;  3P7N A;  2DQR A;  2Z5U A;  4S04 A;  4P96 A;  5D8L B;  3CLO A;  4ESB A;  3FMS A;  1R22 A;  1IRG A;  1GXQ A;  3L00 A;  2FBK A;  2VE8 A;  1BN5 A;  5DUK A;  2HKO A;  2ZO4 A;  5ILS A;  3QPH A;  2JTV A;  3SQN A;  4I0B A;  5TRD A;  3HHG A;  4IJA A;  2EFO A;  3CDH A;  1SMY F;  5K1Y A;  4AIJ A;  5CVI A;  4G9Y A;  4OMZ A;  5DEQ A;  1B1B A;  3LQR A;  3E6B A;  2HR3 A;  2CSO A;  4KT5 C;  1V4R A;  1XGN A;  3GVA A;  2VBX A;  4LLL A;  2RKH A;  4M74 A;  4DNC A;  3BY6 A;  3KZY A;  1G3Y A;  1KU3 A;  2HTJ A;  5HDG A;  2K7L A;  2F5D A;  2IPQ X;  4O3M A;  2A68 F;  4K2E A;  3G73 A;  1ZH5 A;  1XDU A;  5F6F A;  1G3T A;  1QPM A;  3DEU A;  1UFM A;  1K78 B;  4HX4 A;  2HKX A;  4G7O F;  3J81 K;  1FYK A;  2HEO A;  5K5R A;  5H6R A;  4Z2Y A;  2F5E A;  1MDM A;  2JZY A;  2GXG A;  2H09 A;  2VC0 A;  2NS0 A;  1UHW A;  4G94 A;  1GXP A;  2W84 A;  2EA4 A;  3N4M A;  2VC1 A;  4WXH A;  3ABU A;  3DQV C;  2XRN A;  3F8F A;  1DP7 P;  3Q9V A;  2ZME B;  2L54 A;  1LB2 A;  4L0Y B;  4N0B A;  1S7A A;  2MC3 A;  2FNA A;  5BQT A;  5D6F A;  2DK8 A;  4B8X A;  3HOT A;  5CVV A;  3MEX A;  1IZ1 A;  2HOE A;  3WG9 A;  4EJO A;  1TW2 A;  1UST A;  1R1U A;  3K0L A;  4OIP F;  1C0W A;  1P4W A;  5K5Q A;  1I1S A;  1G6N A;  3SZT A;  1S8N A;  2RN7 A;  1TBX A;  3HIF A;  3WTS C;  1YIO A;  1FSH A;  3GYH X;  1S7O A;  1Z6R A;  4MQ9 F;  5D5U B;  4WXD A;  4GCV A;  4CDG A;  1FY7 A;  3E5X A;  1LJ9 A;  3I59 A;  4ON0 A;  4KMU X;  2XKO A;  2LF8 A;  3ZMS A;  5L3E A;  4ZH4 F;  2NNY A;  2V1U A;  1RI7 A;  4AVP A;  5CLS A;  5IT3 A;  3RTR A;  5F1R A;  3BJO A;  4M9S A;  4MEY F;  2ZFW A;  1BJA A;  4HW0 A;  4CZZ A;  3TOA A;  3WTT C;  1SFU A;  2VOO A;  3DPL C;  2HQN A;  1KGS A;  1ONV A;  2VOP A;  3DFG A;  3GUD A;  4HBL A;  2RVC A;  2PLY A;  2IW5 A;  1HKQ A;  3IC7 A;  3WGH A;  4IF4 A;  4KN4 X;  4GGG A;  3MZY A;  5AIP A;  1EV7 A;  3RKW A;  1SMT A;  1B59 A;  3PQK A;  3WTY C;  2PN6 A;  3D0S A;  3L7W A;  4PGH A;  1A04 A;  5L3G A;  4A6E A;  4D0P A;  3RKY A;  1JE8 A;  2FEZ A;  3OOP A;  1IN7 A;  1P4X A;  2XV4 S;  1W5T A;  3R61 A;  4XBF A;  4HF2 A;  3ZMT A;  5L3F A;  2GA2 A;  2XVC A;  3HHH A;  4WX9 A;  1FP2 A;  3BP8 A;  1W7P A;  1VTN C;  1HW1 A;  2UZK A;  4ESF A;  4ZZL A;  4KMF A;  2QQ9 A;  2FA5 A;  4BXU A;  1D3Y A;  1RNL A;  3TO7 A;  3HUG A;  4GO1 A;  2VXZ A;  2W85 A;  4U0V A;  4JK1 X;  5HLG A;  2JRT A;  3I58 A;  5E20 A;  3H3U A;  3IRQ A;  2OA4 A;  5JI6 A;  1D8K A;  4U7D A;  5H20 A;  1ZGJ A;  2M45 A;  1XD7 A;  2NYX A;  4PCQ A;  3PFI A;  1QZY A;  5HS8 A;  3WGG A;  2EV0 A;  5DDG A;  1L0O C;  2A69 F;  1FYL A;  3PQJ A;  2O0Y A;  3HRS A;  4EM2 A;  1IRF A;  2B0L A;  4JQF A;  2M87 A;  3WOD F;  2DTR A;  1CF7 B;  3L9F A;  1FOK A;  1LEB A;  2BYV E;  1U5T C;  3DV8 A;  1STZ A;  2MH2 A;  4LD5 A;  2A6E F;  4R8H A;  3KP7 A;  3W6K B;  2HFH A;  4LK0 F;  4XRF A;  3ULQ B;  4A2U A;  3HSE A;  4RB1 A;  3LA3 A;  2A5Y B;  2XIG A;  2OQG A;  2W24 A;  3KET A;  1SFE A;  4BQA A;  3V7S A;  4XLP F;  1HW2 A;  3O6B B;  2OBP A;  5FB2 A;  3BOQ A;  5D5X B;  1R5H A;  2WWY A;  4LLN A;  1R36 A;  1T38 A;  4Q5S F;  4HX7 A;  2WC2 A;  4AWX B;  5JFR A;  4GYI A;  1HST A;  2ZKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...