6PAXA

Crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Gene regulation/dna
molecule keywords 26 NUCLEOTIDE DNA
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA02
4PDKA 3E97A 4OMYA 4FX0A 3FF5A 3R60A 1O3SA 1RUOA 1WSUA 3CLOA 5JI6A 5L3CA 2STTA 1OKRA 3HYIA 5D5XB 1R1VA 3K1NA 3HSEA 2VT2A 4HF0A 2IW5A 1BIAA 3I0TA 4BH9A 5J6XA 2STWA 3F8CA 2K27A 4UVBA 1ZG3A 5HLHA 2ZO4A 4RGXA 3AAFA 1RZ4A 2QENA 1DUXC 2R3SA 4BHPA 4WXHA 3KP3A 2F5CA 1ZN2A 2M87A 1USTA 2G7HA 5E1ZB 4R8HA 2OBPA 1REPC 4KYWA 4ESBA 5HVQC 4ZH4F 1R36A 4IRIA 5D5VB 1FSHA 1MD0A 2MC3A 1IN4A 2V6CA 5DUIA 1SFUA 2O3FA 4M6XA 4PCQA 1O7FA 4A6EA 2IRFG 1XSVA 1Z6TA 1IAWA 2FRHA 3ECOA 1ZYRF 1VTNC 2UWMA 4IJAA 2B0LA 1ZG5A 4K2EA 2GA1A 1FYMA 4BHCA 4U88A 4YFNF 3WGIA 3CUQC 1HKQA 1TBXA 3SQNA 2XIGA 4A2UA 4RS8A 4RB3C 2XROA 4XSXF 2HS5A 1U8RA 4M9XA 1IXCA 1UHWA 2XAQA 4YIIA 1CF7A 5BMZA 2KIMA 3F6OA 2ZFWA 3T0YA 1QZZA 4RGSA 4HOBA 1ZRFA 2K86A 4IHSA 4HDVA 1SMTA 1TQMA 2K7LA 2NNNA 3K1PA 1Y0UA 4RAYA 3EQLF 4EJTA 3RJPA 4ZZDA 5HDGA 1J9IA 3FZVA 1ZRDA 4MEXF 3DV8A 4LLGF 1KU7A 3HRTA 3V7SA 5CVVA 4G94A 4HLYA 2H27A 4I98B 4LMYA 3T1BA 4EM1A 5ICCA 4EQQA 4UUVA 2W24A 1MJAA 1XCBA 2EWNA 3LFKA 2DO7A 3BJ6A 3KLNA 2QZ8A 2ZJ2A 5ILSA 4EVIA 1P4WA 1G3YA 1I6XA 4P9FA 5DCMB 1B59A 5IT3A 4AIJA 1FY7A 1XB4A 2J5OA 2K02A 3SZPA 2W84A 2Q8KA 3GVAA 1H0MA 4LG0B 1LQ1A 1YTYA 3L00A 3CUOA 4LD5A 4LB5A 3LA2A 3R4KA 3TDZC 3QOPA 2IA2A 3M8FA 1HQCA 2HQNA 3QU3A 1D5VA 4HBLA 3BPVA 2WTEA 1RUNA 2Z99A 2P5KA 4BAYA 1O3RA 1QGPA 1FC3A 1FT9A 2GIVA 4L18B 4EJUA 4KMUX 3RYRA 4QWQA 1V4RA 2IPQX 2V1UA 2FMLA 2CGPA 4A5MA 2FNPA 4KFCA 3EDPA 4L0ZB 2L3DA 3CDHA 3KZZA 2VBXA 1HW2A 3V4GA 4A0ZA 1XMAA 4Q48A 2M30A 1T2KA 3TO7A 4GO1A 3RI4A 6PAXA 3WGHA 2HTJA 4R1HA 1YYVA 4G6DA 1TNSA 4AIKA 1XDUA 1TQPA 5DD4A 1JGSA 1J5YA 3IRRA 3PQKA 1PUEE 1HKTA 2M8EA 2ETHA 1R5GA 1LEBA 1C0WA 1FWZA 5D6FA 2DAOA 3COAC 2FBHA 4GCVA 3F6VA 3RYPA 1HXDA 3L9FA 4HF1A 5D4RA 2ZCWA 1I5ZA 3KLOA 1OYYA 4MQVA 2QLZA 3QP5A 3V8JA 1KA8A 3TDUC 5L3GA 5H6RA 2OA4A 4CDGA 3EETA 5D8LB 1FLIA 2OQGA 4ENJA 3GZ6A 2O61A 1F4KA 1R58A 2Y75A 2EK5A 3TOAA 1USSA 1MZBA 3LAJA 3L7WA 4TV7A 4XSZF 1G4DA 2BV6A 5H20A 1L0OC 4KT5C 4HX7A 4OU0A 2YX4A 3M9AA 3KP2A 3HRMA 2QQAA 5D5WB 1Z1DA 2R7FA 3W6KB 3HSFA 5LBQA 4NB5A 4E70A 2CQKA 2ZXJA 5FD5A 3GYHX 4KIBA 2PG4A 2X0LA 2NAZA 4KIGA 3ROUA 5L3FA 4HX8A 3H92A 3E6DA 4Y15A 4ENMA 5LHGA 3LAPA 2G9WA 2YU3A 3HRUA 3ZN0A 4Q5SF 1QO0D 3CTAA 5AIQA 1BBYA 2K4BA 4GXOA 2NRAC 4Y13A 1XGNA 3DFGA 3LA7A 5CVJA 4M71A 2P6TA 5ICFA 1ONVA 4WK8F 4LLNA 5HOOA 1BI1A 3WTZA 1FOKA 1XMKA 1XDSA 1W5SA 2DU9A 1Z05A 1W4MA 3CUQA 3NEUA 2IA0A 2LSOA 1K78A 1R23A 1WI9A 4MTDA 2E1CA 1D8KA 1KYZA 4UVAA 5D5UB 4IXAA 2WC2A 5E1XA 1WWXA 1FBQA 3QPHA 1K78B 3BZ6A 2JPBA 1R1UA 3TOBA 3RDIA 1T38A 2FQ3A 1W7PD 3GO5A 2LKPA 3RKWA 4S05A 2D1HA 2MA3A 1JXSA 1G3TA 5E8IA 2RKHA 5LGTA 1YW7A 3ELKA 2ZMEB 5BOXA 2BEOA 2XASA 2UZKA 1U5TA 4I7HA 2E7XA 2UXXA 4XLPF 3I71A 4PGGA 4LFUA 2E7WA 5F1RA 4M74A 5HLIA 2EFWA 1K7AA 3I53A 1XGSA 1SD7A 3GEZA 1HSJA 3TO9A 1FX7A 3GX4X 3DEUA 1BM9A 2A3SA 1QBJA 2CWEA 3FXUA 3U9GA 4LK0F 5E20A 3U1DA 2IVMA 3WTXC 4EJOA 4ZYEA 3IC7A 1JHFA 2XAJA 1FNNA 2XV4S 2PBIA 4LB6B 1ZLJA 5JVTA 1ZG1A 3U2RA 3E6MA 1BOAA 3T8TA 2G7UA 4ASNA 2Q2EA 3F21A 3G3ZA 1BN5A 2FSWA 3KEOA 3WTYC 2EV5A 5ILVA 4U0WA 1BIBA 3PFIA 3EYIA 2JTVA 2Z3YA 3VFZA 2ZNYA 1QPMA 3ZMDA 1UHMA 3BROA 1J0RA 2RC4A 1YLFA 4PGHA 2OZUA 3R6SA 5AIPA 1GVJA 2PJPA 3ZMVA 3FHZA 3JAMK 1FBUA 1MJBA 5F64A 1MGTA 4HQMA 1ODDA 2JRTA 4HYEA 3WGGA 2M5WA 1LJ9A 3OOPA 3Q9SA 2FBIA 3J81Z 5DD8A 3HHGA 3CO7C 3K2ZA 3P9KA 4I02A 2XKOA 4LG0A 1Q1HA 4RGUA 5J8FA 4CICA 1OYIA 2H94A 4LJZF 1TQIA 3FXRA 3WE2A 5D8KB 1ZAOA 2F5FA 1HKSA 3E6BA 5KVRA 4U0YA 4I09A 1G6NA 4Y17A 2YPRA 1BI3A 2CYYA 2IT0A 1DP7P 4KMFA 1O57A 2VONA 2VN2A 3P7NA 2EJRA 1LDJA 2A6EF 3O6BB 2FEZA 2VE9A 3VOEA 5LGUA 3KETA 3E5QA 3ZMZA 4F7ZA 4CHUA 3FM3A 1R1TA 3I59B 1IUYA 3KP4A 1WQ2A 2BBYA 5DEQA 1R5HA 1PP8F 4XLNF 3JTGA 3VEPA 3E3VA 2ADUA 4UHTA 1ZH5A 2HOEA 5LLQA 2A6HF 4L9VA 3K69A 5BQTA 2EA4A 4IF4A 2EV6A 3OV8A 2TDXA 1OYWA 2FXAA 1E17A 3MAJA 2VE8A 3ZMTA 3GWZA 4ZYDA 3RPQA 3O3KA 2RDPA 2VBWA 1RNLA 1B6AA 2O6GE 1ZARA 2XAGA 5IT9Z 2L54A 5FFXA 3D5LA 3FMQA 1LEAA 2IJLA 2FA5A 4EGZA 3F8MA 3BOQA 5CLSA 5J8CA 3J80K 3M8EA 4XBFA 1U2WA 5ILUA 2DQLA 2DQRA 3GUDA 1JE8A 3J81K 3O2PE 4JK1X 1OR7A 3KFWX 2P4WA 1T39A 2P5LC 4BYYA 2BGCA 2HZTA 2RNJA 4OMZA 3BJOA 2NYXA 5A2QK 1LB2A 2VBZA 3HOSA 1W7PA 1S7OA 1YW9A 1T0FA 4N9HA 4MNUA 1KGSA 1NHAA 1J2XA 3F8FA 4KN4X 1J75A 2L01A 4CYDA 1ZHFA 4HZFA 2XKPA 4WWCA 1P2FA 3S2WA 3L2CA 4HW0A 4KICA 1DPRA 2KIUA 2KKOA 3FX3A 1JHHA 4AWXB 1SD5A 2QQBA 3TQNA 3GW2A 3C7JA 1DPUA 1U3EM 3I64A 4EJVA 2GXBA 4DQ2A 3WU0A 3GZ5A 2FOKA 5L3BA 3JSPA 1D3YA 1PP7U 4HX4A 1E2XA 1I27A 2GA2A 4M73A 4CGZA 3TGNA 4YIFA 1U5TB 4EM0B 2IP2A 4M9SA 2CG4A 2Z33A 4O5VA 5JHUA 1QZYA 3ZPLA 1LDDA 1S6LA 5HDKA 1UCRA 1BI0A 1FP2A 1T6SA 3KEQA 2DTRA 1AOYA 2EA2A 4N9IA 1SD6A 1YS7A 5IT9K 3J7AO 4AVPA 2W57A 3ZMUA 4Z2YA 4ZYGA 2GQQA 3Q9VA 2OZ6A 5LEKA 4P5OA 2A61A 5AONA 3WTSC 5E8GA 1K6OA 4U0VA 2LNBA 1IXSB 1U78A 2VODA 2A69F 3F8BA 2YR2A 3K1MA 4GGGA 4M6YA 2PI0A 2MBFA 5FD6A 4N0BA 2HEOA 1IXRC 3KP6A 3HIFA 3M1EA 1ULYA 1F9NA 3H3ZA 5L3DA 4KA4A 1GHCA 5HDNA 2Y48A 3DP7A 2PQ8A 3RTRA 3FM5A 1K79A 2MH9A 2NNYA 2COMA 2QBYA 1LVAA 5DYMA 3P9CA 2ISYA 3R61A 2ZKZA 1KU3A 3BJAA 3GFJA 1WKMA 1IN5A 4HV6A 1UFMA 3ABUA 2M45A 5LEJA 2KJBA 3WTVC 4CO8A 3ZQ7A 3C1DA 1IN7A 3LSTA 2PMHA 4YFXF 2RVCA 2FE3A 2P5VA 2QYOA 3CO6C 1RIOH 4I2OA 3MCZA 3G73A 2D1VA 4NQWA 5JFRA 1XGOA 4L9NA 2XRNA 3SFZA 4ON0A 1D8JA 1FSEA 3ML6A 1RI7A 1ZGJA 3BDDA 3F8NA 2UXNA 1HSTA 1YIOA 2QUFA 4G7OF 3V7CA 4O6JA 1R22A 2QBYB 3TKYA 3IRQA 4IHTA 2V1XA 1YG2A 4UXNA 3EYYA 3MZYA 3ZN1A 3F72A 2F2EA 3FMSA 3GF2A 4P55A 2DI3A 3WU1B 1WRJA 4BHBA 2XGXA 3I59A 2ACJA 4JBAA 1B4AA 2AS5F 1FPQA 2HTSA 5E1WA 3V8LA 2MLGA 4EV0A 1X3UA 2DPDA 3LQQA 5FGMA 3RIRA 1HW1A 3CJNA 4ENKA 2K4JA 2RN7A 4OIOF 1IN6A 2HKOA 3WTWC 2L4AA 1U6GA 1BC8C 2FBKA 3DPTA 2O03A 4KN7X 3K0LA 2DPUA 2P7CB 4OIPF 2DFIA 1XGMA 3N4MA 4WXCA 1FYLA 5KK1A 4P96A 2Y0MA 1ON2A 1XCVA 1H9GA 3IHUA 4A0YA 4MEYF 4FHTA 3V8KA 4Q47A 1KQ8A 2GWRA 3I5UA 3T5XA 5LGNA 3C3WA 3WTTC 3HHHA 4XRFA 4OIRF 1ON1A 1TNTA 1STZA 5K5RA 3ABTA 1QNTA 3KE2A 4R79A 2OD5A 2P8TA 1MJ9A 1SAXA 3QP6A 1OPCA 5E17F 4U7BA 3BY6A 4RB1A 2ZNZA 4CXFA 2HYGD 3HRSA 3MQ0A 4Q4ZF 4D0PA 4G7HF 4G8XA 3Q5FA 3FMRA 2D45A 1G3WA 1W7PB 2ZMEA 1TW3A 2JZYA 2PN6A 4G7ZF 2EFPA 5LRRA 3H3UA 3HSRA 1TLHB 1HW5A 2XVCA 2EFQA 3BWGA 4L9JA 3FWEA 3FXQA 2LF8A 1SFEA 2HWVA 1PDNC 1A04A 1T98A 1XD7A 2X4HA 2EB7A 3I4PA 2IA1A 1IF1A 2LDUA 1B9NA 1CGPA 2P7VB 2RGVA 4ETSA 4LK1F 4RAZA 3HTUA 2DK5A 4HLXA 4MHGA 3HOTA 1SMYF 3VB2A 2HR3A 3DPLC 3IL2A 4RB2C 2XAFA 1F5TA 4KNYA 2MLKA 4HV5A 3V7RA 4L5JA 3IWZA 1KU9A 2DT5A 1V3FA 1DDNA 5FFZA 3HTSB 5F6FA 4DNCA 4QLCU 2Z5UA 3NQOA 3QAHA 5D4SA 4GYIA 4UNOA 2EV0A 4H0EA 1G3SA 4KIFA 1LDKB 3I54A 2L4MA 2QQ9A 1ZRCA 1B9MA 4BXUA 2DK8A 3GFIA 4IVNA 1FZPB 2HGCA 5FLXK 2MD5A 5DCMA 4IRGA 2OU2A 2V1DA 2H6CA 1GXQA 3F22A 2ELHA 4WX9A 4OIQF 1ZREA 1BC7C 4HDUA 2GZWA 5CJ9A 2YSRA 5FB2A 2M1BA 2PLYA 1S3JA 3R0AA 5JR3A 1Z7UA 1P6RA 2FNAA 4KUMA 3IKTA 4MQ9F 2OAZA 1O7LA 1B1BA 1FYKA 2BYVE 2Q0OA 3T8RA 3DKWA 1YS6A 3REOA 3QPTA 1TW2A 3D0SA 4NHJA 1FBSA 2VOOA 1IZ1A 4B8XA 5LRSA 1GXPA 4EM2A 2ZBKA 2H6BA 2WWYA 5DUKA 3MZHA 1YW8A 1FP1D 3NRVA 2FF4A 1J7KA 4OOIA 4RB0A 3WE3A 5K1YA 2HYFA 1ZGAA 4HQEA 2V79A 4BNCA 1SFXA 4G6QA 4M72A 3RPUA 2KIFA 1P4AA 4WF2A 1YQAA 4FX4A 5FO5A 3ERED 3JTHA 3B02A 3KCCA 4IPAA 5L3EA 2XUBA 3GFLA 5HS7A 3SZTA 4I01A 1SD4A 2QVOA 3DQVC 5ICGA 4ENNA 3E5UA 2PFBA 4IRHA 3M7GA 2VC0A 3LQRA 1MKMA 2FMYA 3BP8A 5FLXZ 2GAUA 4WXDA 2F5DA 1XN7A 2PEXA 4LLLA 4RGRA 3VODA 1YFHA 2A07F 3GXOA 3B73A 5HS8A 4YFKF 3LA3A 4WCGA 2HFHA 2VXZA 1KYWA 5BS6A 2XAHA 2DLLA 3JAMZ 4P9UA 5BPDA 4GYGA 4A0XA 3RKXA 1Z6RA 2VT3A 2CFXA 5CVUA 1EH6A 2CSOA 1TTYA 2Z9OA 4EGYA 3P9IA 3MFKA 1H9TA 1R00A 5LHHA 1XSDA 2VOPA 2D2WA 4B09A 2JSCA 3CUQB 3KP5A 1AWCA 1W5TA 4HA8A 2DBBA 1O3TA 3GFMA 3GLXA 2MH2A 3ECHA 4EMSA 4UV8A 4ESFA 1KQ9A 2AXLA 4FT8A 4M9ZA 5ED4A 1MDMB 1J59A 5ICEA 1U5TC 2E1NA 5DV5A 4CZZA 4L9TA 1OMIA 2HQRA 1Z9CA 5CYVA 3TO6A 1IRFA 2VC1A 1KU2A 4EJWA 4PZJA 1XSXA 2DW4A 3WG9A 2NS0A 2FU4A 3E5XA 1IRGA 2C6YA 3SHFA 3K9TA 4I0BA 3KZYA 1L3LA 3L09A 2ESHA 4A5NA 4A12A 5BPIA 3N97A 1LNWA 5DCFA 4LGWA 2VBYA 3IWFA 3C18A 1MDMA 4U7DA 4BQAA 5D6EA 3QRFF 2QM3A 3HUGA 3PQJA 2L02A 1CF7B 2WV0A 3DXJF 1IW7F 4AIHA 3J80Z 2A68F 5K5OA 1HBXG 4A6DA 2HKXA 1I1SA 1P4XA 3JW4A 4L0YB 2ISZA 1S7AA 4I0AA 4L5IA 2HDCA 3BPXA 2W85A 4JQFA 5A2QZ 3DF8A 1KQ0A 5H6QA 1R7JA 2JPCA 5LHIA 3KP7A 3W6JB 4UVCA 3R0JA 2O0YA 2A5YB 1EH8A 1O3QA 1IN8A 1QQIA 2PMUA 4ESJA 3IKVA 3WODF 3SXYA 1I1GA 3ULQB 2XHKA 2J5PA 4ZYHA 2W25A 2ESNA 2H09A 5EEGA 4HF2A 1BI2A 4OINF 2V9VA 2KJCA 3LWFA 2RQPA 2EFNA 3E6CC 1P92A 3QU6A 1UB9A 2JT1A 1EH7A 1BJAA 4MTEA 2EFOA 1YO5C 3F23A 5EEHA 3WTUC 1S29A 3EUHA 2O8XA 5HLGA 2P6SA 2QWWA 5HS9A 4KDPA 4G9YA 2CW0F 4O3MA 5TJJA 2BE5F 5K5QA 4AD9A 2GXGA 5CVRA 4ZZLA 2R7DA 1S8NA 3RKYA 3ZP5A 2KRFA 3MWMA 5CVIA 5E18F 1EV7A 1F1ZA 2F5EA 1ZLKA 4YG2F 3I58A 3ISPA 5TRDA 3F3XA 1Z91A 3ZMSA 2OQRA 5DDGA 3JSOA 2LF7A 3MEXA 4HAMA 2YX7A 2CO5A 2RV8A 5ERIA 4S04A 4UV9A 4MGRA
chains in the Genus database with same CATH superfamily
4PDKA 4ZTFA 3E97A 3ESWB 4OMYA 4FX0A 2E2HJ 3FF5A 2I10A 2W48A 3QPSA 3A01B 3R60A 4A3LJ 3ZGKA 1O3SA 1RUOA 5DM7F 3S1RJ 2DTZA 1WSUA 1VQ5I 2WBMA 3CLOA 1GVDA 2P81A 5JI6A 5L3CA 2STTA 1FOXA 1OKRA 3HYIA 3JRFA 3HXLA 5F08A 1GT0C 2VPRA 5D5XB 1R1VA 4IEJA 3LSPA 2L7FP 3K1NA 3HSEA 3M8JA 2VT2A 2R7QA 4HF0A 2IW5A 1BIAA 3RQ4A 4IZZA 3I0TA 1YOVB 4BH9A 5J6XA 2JN6A 4XK4A 2XAUA 2STWA 5M5XJ 3F8CA 2JJ7A 4BBRJ 3SZGA 5GPCA 2K27A 4UVBA 1ZG3A 5HLHA 2ZO4A 4RGXA 2H1KA 3AAFA 1RZ4A 1AKHA 2QENA 1DUXC 1TWGJ 2R3SA 4PSXA 4WXHA 4BHPA 3KP3A 2F5CA 2L5QA 5HNFA 3KYCB 3NWTA 1ZN2A 2M87A 1USTA 3S3MA 1Y39A 2G7HA 3OSGA 2R93J 1I3QJ 5E1ZB 1FTTA 4R8HA 4Y33A 2OBPA 4CCMA 1REPC 4KYWA 4ESBA 5HVQC 2M0CA 4ZH4F 1R36A 1PJRA 5CKTA 4IRIA 5D5VB 2Y0SN 2WAQN 5M5YJ 1FSHA 1MD0A 2WY7Q 4XRMA 3ZRGA 4LITA 2MC3A 4A3IJ 1IN4A 2V6CA 5DUIA 2XGCA 1SFUA 2O3FA 1X1AA 1ZKGA 2R4GA 3QPLA 4M6XA 3VYRB 4F3QA 4PCQA 2E36A 4D5CA 3K6GA 5HNHA 4XORA 1O7FA 5IYDJ 4A6EA 5C4JJ 2IRFG 1XSVA 4RAGA 1Z6TA 3JRAA 4BDYA 1IAWA 2EQRA 2FRHA 2E2JJ 3ECOA 1IO2A 1ZYRF 1VTNC 2UWMA 4IJAA 1EA3A 2B0LA 1ZG5A 2LY9A 4K2EA 3J7ZI 2GA1A 1T08B 1JJ8C 1FYMA 3CCUI 4BHCA 3H0DA 4XKBA 3DU6A 4U88A 4YFNF 1RR7A 4IHWA 3WGIA 2JA7J 3HKZA 4GRIA 1UZCA 1HKQA 3CUQC 1TBXA 3SQNA 2WB1N 4DYQA 3A2KA 2DA5A 2VJ5A 2XIGA 2ZSIB 4A2UA 5EJCA 4RS8A 2IEKA 2HVSA 4RB3C 2H8WA 2LP0A 3DLLF 1LKXA 2XROA 2IXSA 5GP9A 4XSXF 2EZIA 2HS5A 1QHHD 3FBIB 1U8RA 4M9XA 1K4TA 4IQJA 3S3NA 3HC7A 1IXCA 1UHWA 2XAQA 4YIIA 1CF7A 2DT7B 5BMZA 2KIMA 3OYJA 3F6OA 3JCUC 2ZFWA 1SAUA 3MZ8A 3T0YA 3WHCA 1QZZA 2COBA 2XGEA 4RGSA 2R7WA 4HOBA 1ZRFA 2K86A 4IHSA 2NNNA 1SMTA 1TQMA 2K7LA 3K1PA 4HDVA 1Y0UA 4RAYA 3EQLF 1LUJB 2O5RA 4EJTA 5FRMA 3M07A 3RJPA 3H0GJ 5HDGA 4ZZDA 3AG2H 5IPAA 1J9IA 2PMZA 3FZVA 4MEXF 1ZRDA 3DV8A 4LLGF 5FKKA 4BEHB 1MW7A 1KU7A 1G2HA 3HRTA 3V7SA 5CVVA 1VQPI 4G94A 2Y30A 4HLYA 3E0JB 2M8GX 3CJRB 4G6TB 2XGDA 2L9VA 2XRLA 4W97A 2DA3A 1KZHA 5C3EJ 2H27A 4C3JJ 4I98B 4LMYA 3T1BA 5E3OA 2JQ7A 4EM1A 5ICCA 4EQQA 5JHFA 4UUVA 2LLKA 2W24A 3CQZJ 1W0TA 2R0QC 1MJAA 5F1JA 1XCBA 3BTJA 2EWNA 3LFKA 2DO7A 3BJ6A 1VQMI 3KLNA 2QZ8A 2ZJ2A 5JVGF 2IGKA 3CJTB 5ILSA 3JREA 4EVIA 1DGWY 5B5EC 1P4WA 3A03A 1G3YA 5J3LA 5K7FA 1I6XA 3TW7A 3BT9A 4P9FA 4ABZA 5DCMB 1B59A 5IT3A 4AIJA 1FY7A 1XB4A 2J5OA 2K02A 1B72B 2IGOA 3SZPA 2W84A 1XTAA 2Q8KA 3GVAA 1H0MA 4LG0B 1LQ1A 3HJEA 1YTYA 3L00A 3CUOA 1ZELA 4LD5A 4LB5A 1WJCA 3LA2A 3R4KA 3TDZC 2Y9ZA 2OJED 3B6CA 3QOPA 2IA2A 3M8FA 1HQCA 2HQNA 1AHDP 3HOUJ 1DU6A 3OYEA 2DJIA 5KHDA 3QU3A 1D5VA 4HBLA 2OC6A 3BPVA 3N05A 4RMNA 1QVTA 2WTEA 1RUNA 2Z99A 3JRGA 2K5CA 2P5KA 3ABMH 4BAYA 1O3RA 4B3XA 1RC9A 1QGPA 2DFEA 3CCVI 2A05A 1FC3A 2BY0A 4JX5A 1FT9A 3AL0C 2GIVA 4L18B 4EJUA 4KMUX 3RYRA 4QWQA 3K70D 1A36A 4D9JA 1V4RA 2IPQX 2V1UA 2FMLA 1X2NA 2X85A 2CGPA 3M3YJ 4A5MA 2FNPA 4KFCA 3EDPA 4L0ZB 2QA4I 3HB9A 3W2AA 2GOMA 2L3DA 3CDHA 3DKYA 3KZZA 3BZCA 1MNMC 2VBXA 1HW2A 3V4GA 4A0ZA 4B3AA 2DJNA 1XMAA 4MFDA 1S5LC 1Z3YA 2VQCA 4Q48A 2M30A 1T2KA 3TO7A 4GO1A 3RI4A 2JSPA 2VUMJ 6PAXA 2UUZA 2EH3A 1XG1A 3WGHA 3KPHA 1YRNA 2HTJA 1RPWA 4R1HA 4CCNA 1YYVA 4G6DA 1XPXA 1TNSA 2ZXWH 4FE7A 3V42A 4AIKA 4ZDLA 1VQLI 1XDUA 1TQPA 5DD4A 2AQEA 2V6EA 1JGSA 1J5YA 3IRRA 1TP4A 4FETA 2DOAA 5DTDA 4A93J 3PQKA 3AFHA 1XX5A 1PUEE 1XMXA 2K9NA 3KX2A 3QQAA 1HKTA 2M8EA 2ETHA 1R5GA 2ZJQF 1LEBA 4C2TA 1C0WA 1T56A 4BXFA 1FWZA 5D6FA 2DAOA 5FKOA 3COAC 2FBHA 3ZQFA 3OYCA 4MFEA 4GCVA 1JUMA 3F6VA 2I5UA 3RYPA 1D0ZA 1HXDA 3L9FA 1VQ8I 4HF1A 3K4NA 3OIPA 3D5SC 5D4RA 2ZCWA 3L2UA 1I5ZA 3KLOA 2X48A 1LVKA 1OYYA 4MQVA 1F36A 2QLZA 3QP5A 2Z1DA 3V8JA 2VPLA 4ZJZA 4LIVA 3J7AY 2F5VA 5KNLA 5IYBJ 1KA8A 2XF5A 4ZDOA 4J00A 3TDUC 2LKXA 5L3GA 2HZDA 3CCSI 5H6RA 2OA4A 3RPUD 4CDGA 3PIOF 5E3LA 1DQUA 3PNVA 3GTMJ 3EETA 5D8LB 2BVMA 4CUGA 2OQGA 1FLIA 2ZXHA 4ZYAA 2R7OA 4ENJA 4RLFA 1WJAA 3GZ6A 3DBRB 3BR5A 2O61A 1U8BA 1F4KA 3PUBA 1MMSA 4X0GA 4CYCA 2LD5A 3MKZA 2X9DA 3OR2C 1R58A 2Y75A 2EK5A 2MC4A 3TOAA 1USSA 1IUFA 3E7LA 1MZBA 1MMNA 1MH4A 3L7WA 4TV7A 4E6KG 3LAJA 4XSZF 2B9SA 1A35A 1G4DA 2NS8A 4F52A 2BV6A 4A3EJ 5H20A 2MABA 1L0OC 2WADA 4HX7A 4KT5C 2R7RA 4OU0A 5F27A 3SYTA 2YX4A 2K9MA 3M9AA 3KP2A 4W1UA 3HRMA 2QQAA 5D5WB 3RZDJ 1Z1DA 2R7FA 3W6KB 3LSGA 4E7JA 4HG2A 5CQEA 3HSFA 5LBQA 1VQ9I 3AG3H 4NB5A 2L7ZA 5J1UA 4E70A 2CQKA 2ZXJA 5FD5A 3GYHX 3HOXJ 3BR3A 4YELA 4KIBA 4A3JJ 3IUOA 3A4CA 4BU2A 2GLOA 4FISA 3MMYB 1OLTA 2PG4A 2R5YB 2X0LA 4B43A 2NAZA 4KIGA 3ROUA 5L3FA 4HX8A 3H92A 1VF9A 2CJJA 3E6DA 4Y15A 5LHGA 3DEEA 3LAPA 2G9WA 2YU3A 3BG5A 3HRUA 4ENMA 2W1OA 3JRBA 3ZN0A 4Q5SF 3FXOA 1YIJI 1QO0D 3CTAA 1K83J 1WH7A 2OF7A 4M3BA 5AIQA 1BBYA 1WCMJ 4BS9A 4BBSJ 2KDZA 1SANA 2K4BA 2W00A 4GXOA 2NRAC 1P7IA 4Y13A 1ZGWA 1XGNA 3DFGA 3LA7A 5CVJA 1JKRC 1ITYA 4M71A 2P6TA 2BW3A 5ICFA 1ONVA 4WK8F 5GAHJ 2R5ZA 2K9SA 2BXYA 4V19K 2YUSA 4LLNA 3TP0A 3NWSA 2BHYA 5HOOA 4S0HB 1BI1A 3WTZA 4HNTA 5CPRB 4M3EA 2MYSA 4YIRX 3GTLJ 2ECCA 1FOKA 4HSTA 1XMKA 2V9KA 1XDSA 1N77A 1W5SA 2KZVA 1UG2A 2DU9A 1Z05A 1TZLA 2QF7A 5FJ8J 4E7LA 1W4MA 3CUQA 3NEUA 3X2QH 2IA0A 3GBGA 3CLQA 2LSOA 5HLTA 1VQKI 1K78A 3GTKJ 1R23A 1IGNA 3C2BA 1WI9A 3RQIA 4MTDA 2DOEA 3DTIA 3P5JA 1D8KA 2E1CA 2ID3A 1KYZA 4UVAA 1BR2A 5D5UB 3GMEA 2M4GA 2VL8A 4BKXA 4IXAA 2WC2A 3K4JA 1WWXA 1FBQA 2UV1A 5E1XA 2HPMA 3QPHA 1K78B 4RA2A 1WJBA 3BZ6A 2JPBA 4NC7A 4CSWA 1R1UA 2KIQA 3TOBA 3S15J 1WPKA 3RDIA 1T38A 3OYNA 4I6ZA 3S1QJ 2FQ3A 2OPTA 4DYCA 1W7PD 3GO5A 2LKPA 3BQZA 3RKWA 1QRYA 4S05A 2D1HA 2MA3A 2VKHA 2G0EA 2GIZA 1JXSA 5JLXA 1G3TA 5E8IA 3KYLA 2ELJA 2RKHA 5LGTA 3BLYA 4C9YA 2OTLI 4DBRA 1YW7A 3PL8A 2O9LA 2VJJA 4XIDA 2AHQA 3ELKA 1ETQA 2ZMEB 5BOXA 2BEOA 2XASA 3BR1A 1U5TA 2UZKA 4I7HA 2E7XA 1MBJA 3BTIA 3VYUB 4BXXJ 1V5FA 2JA8J 3FHNA 1ZK8A 2PMZN 2TRTA 2UXXA 4XLPF 3H9QA 3I71A 4PGGA 4LFUA 4P1WA 2GXAA 1QPIA 2E7WA 2K9LA 2F4OB 5F1RA 4M74A 5HLIA 2EFWA 4HNVA 3ZQLA 1WFXA 1K7AA 1Y1VJ 3I53A 3IH2A 5FKNA 1XGSA 1SD7A 2HVQA 3GEZA 1HSJA 5IOZA 2E2IJ 3TO9A 1VQ4I 2YU9J 3K70C 1FX7A 4NC6A 2K3PA 1I39A 2LFBA 4RLQA 3HEFA 3GX4X 3DEUA 1BM9A 2A3SA 1QBJA 3A1YA 2CWEA 3FXUA 3LSMA 4QIWN 3U9GA 3HKZN 2JMWA 4LK0F 5E20A 3DPUA 3U1DA 2Y69H 2IVMA 1HCRA 2Z16A 2M7BA 4RDUA 3WTXC 1PUFA 4EJOA 2V4JC 3DTEA 2NVUB 3IC7A 1JHFA 4ZYEA 2XAJA 3FBNB 1FNNA 2XV4S 4XR6A 3ZQCA 3VWBA 1T8IA 2PBIA 2ICWG 1PVEA 3LSIA 2X6YA 2CW7A 4LB6B 4FCYA 1N25A 3GTGJ 4XKCA 2IGMA 1ZLJA 2EINH 5C44J 5JVTA 3G4SI 1ZG1A 3U2RA 3E6MA 2BY1A 1ETWA 1ACIA 1BOAA 3T8TA 2M34A 2G7UA 4ASNA 1M1EB 5B1BH 2L7MP 2Q2EA 3F21A 1APLC 2KHMA 3G3ZA 1R71A 1JTXA 1BN5A 2FSWA 4XKVA 4BDZA 3KEOA 2PX9A 3WTYC 2EV5A 1TL8A 5ILVA 2E1MB 2QSGX 4U0WA 1BIBA 2QGUA 3PFIA 2VJIA 2JTVA 3EYIA 2Q1ZB 1WVRA 2M0MA 4II3A 2Z3YA 1TWFJ 3VFZA 4XRSA 3AL0B 2ZNYA 3GTJJ 4DZPA 4PJ0C 1QPMA 3KYDB 3ZMDA 3PFYA 1E0EA 1UHMA 3BROA 3BTCA 3W6VA 4PJMA 2M2EA 1J0RA 2RC4A 5IP6A 1YLFA 2LR8A 5EG0B 3TEDA 2ZFUA 4PGHA 2OZUA 3R6SA 5AIPA 5DM6F 2HPIA 1GVJA 3IAS2 5K7ZA 4XL9A 2PJPA 4FE4A 3EPZA 5FKLA 2XSDC 3ZMVA 3OL4A 3FHZA 3JAMK 1FBUA 1MJBA 3Q0UA 5F64A 1MGTA 4HQMA 1ODDA 2JRTA 4HYEA 3Q0VA 1U0JA 1Q1VA 3K7AJ 3WGGA 5GADJ 2M5WA 1V5GA 1LJ9A 3OOPA 2EIJH 1RESA 2FBIA 3Q9SA 3J81Z 5DD8A 3HHGA 1POGA 3CCEI 3KIOA 3CO7C 4X1EA 3K2ZA 3P9KA 1NTCA 3AKZA 2PJRA 4I02A 3CC7I 1SC7A 2XKOA 3F0CA 4LG0A 3CCJI 4A3DJ 1Q1HA 4RGUA 5J8FA 4CICA 1OYIA 2H94A 4LJZF 1TQIA 3FXRA 3WE2A 5D8KB 1ZAOA 2F5FA 3CMMA 1HKSA 1Z7LA 3E6BA 5KVRA 3VDXA 4U0YA 1XS9A 4I09A 1G6NA 3HOYJ 4AC0A 4A3CJ 3TP3A 1WJ5A 4Y17A 2YPRA 1BI3A 2A6TA 4B4CA 2CYYA 2IT0A 1DP7P 4KMFA 1O57A 2VONA 2VN2A 3P7NA 2EJRA 1GDTA 1WGXA 1LDJA 2A6EF 2NVXJ 3O6BB 2FEZA 1HLVA 3HDDA 2VE9A 2L2OA 1TWHJ 3VOEA 3BQYA 5LGUA 3KETA 3DBLB 3E5QA 1P9QC 1VNDA 3HPHA 3ZMZA 4F7ZA 1RETA 4CHUA 3OMYA 2H1LA 4BQQA 4E7IA 3FM3A 2ZXIA 2QSFX 3DTKA 4E7ZA 1R1TA 3I59B 1IUYA 3KP4A 3BR2A 3BG3A 2OCCH 1FTZA 2NXNB 1ETOA 1WQ2A 2BBYA 1OJLA 2BY3A 2ME0A 1R5ID 5DEQA 1WI3A 1GV5A 1R5HA 4RBOA 1PP8F 1UAAA 4XLNF 2E1OA 3JTGA 3VEPA 1T0FC 3E3VA 2ADUA 4UHTA 2HVRA 4ZC3A 1ZH5A 3MKWB 2CQNA 1UG0A 2HOEA 4I76A 5LLQA 2KISA 3GZNB 1EKEA 2A6HF 4L9VA 3K69A 3HGGA 5BQTA 3G1MA 2EA4A 1ZQ3P 4IF4A 4NC8A 2EV6A 5B1AH 3FIWA 3LSJA 3OV8A 3GLLA 3K10A 2TDXA 1OYWA 2FXAA 3O8HA 1E17A 3MAJA 5J4VA 4KISA 4BE2A 3I4NJ 2VKVA 2VE8A 2DN0A 3CCQI 5M5WJ 4HEA2 3ZMTA 3GWZA 3SDGA 4DYRA 4ZYDA 2ZC2A 3RPQA 2IS2A 2MSYA 3O3KA 1Z21A 2RDPA 1N75A 1JUSA 3H5AA 2VBWA 1GLNA 1RNLA 2VJ4A 2HQ5A 1R9TJ 1AKHB 1B6AA 1OCOH 2WY8Q 2O6GE 3H9GA 4AM3A 2JRMA 2XAGA 1ZARA 2FX0A 2LVSA 3VYTB 4F93B 1IRXA 2L54A 5IT9Z 5FFXA 3D5LA 2BY2A 4HRIA 1RRJA 3FMQA 3S3OA 1LEAA 4JX6A 2B7EA 3PUFA 2IJLA 2FA5A 1U9OA 4EGZA 3HOZJ 3F8MA 3SDBA 3BOQA 5CLSA 1FMWA 3UR3C 2MG4A 5J8CA 3J80K 2LKSA 3M8EA 4XBFA 1U2WA 2CS3A 5ILUA 4BQNA 2DQLA 2DQRA 3GUDA 1JE8A 3GTOJ 3J81K 3O2PE 2LY1A 4JK1X 1Z3XA 1X58A 1OR7A 3KFWX 2P4WA 1T39A 2P5LC 4BYYA 2BGCA 3HOVJ 2HZTA 2RNJA 2JUGA 3CJQB 4OMZA 3BJOA 2NYXA 5A2QK 1LB2A 2VBZA 1W7PA 3HOSA 2OV7A 5EGOB 1S7OA 1YW9A 1T0FA 4N9HA 1Z67A 3DKXA 1D0YA 4MNUA 1KGSA 2DDAA 1NHAA 5EZGA 1J2XA 2ZB9A 2E71A 3F8FA 4KN4X 4L5EA 3BG7A 3ZQIA 1J75A 3WG7H 4C3IJ 2L01A 4CYDA 1ZHFA 1O4XA 4HZFA 2XKPA 4WWCA 1P2FA 3S2WA 3L2CA 5KCMA 4HW0A 4KICA 2HDDA 1DPRA 2QKLB 2XF7A 2HXOA 2KFDA 2KIUA 2OCEA 4XOTA 2KKOA 3FX3A 1JHHA 4AWXB 2HYJA 1SD5A 2QQBA 3TQNA 2BXZA 4UUSA 4PSWA 4XICA 4CCLA 3GW2A 3C7JA 1DPUA 1MMAA 1U3EM 1QU3A 1BR1A 3I64A 1NH3A 4EJVA 1MBEA 2GXBA 5GAEJ 4DQ2A 3WU0A 2CMPA 3GZ5A 3FXLA 3O8GA 5B66C 5DS9A 3HOWJ 2FOKA 5L3BA 3G2BA 3JSPA 1D3YA 4EEFG 1PP7U 3H5NA 3DU5A 4HX4A 3PM1A 1E2XA 2AXTC 1I27A 2LRDA 2XPWA 3K4MA 4PJLA 2GA2A 3CMEI 1Y1WJ 1MMGA 4Y7NJ 4IKFA 3OYLA 1E3OC 4M73A 1S9HA 4CGZA 4A3FJ 3K2AA 5IYCJ 3TGNA 4YIFA 1GV2A 1W5CC 4UB6C 2VQHA 5EEAA 1U5TB 4EM0B 2IP2A 4M9SA 2CG4A 2Z33A 3HM5A 4OAZA 4O5VA 4XM3A 1DU0A 5JHUA 5GAGJ 2PJRB 3G1OA 1QZYA 3ZPLA 4XLFA 4J19A 3I3LA 1LDDA 1S6LA 3I9V2 5HDKA 3BZKA 3FXJA 1N78A 1UCRA 2O7OA 3BCAA 1BI0A 2LTPA 1FP2A 1T6SA 1NG7A 3D5RC 3KEQA 2DTRA 4GDFA 1AOYA 2EA2A 4N9IA 3CP8A 1A6IA 1SD6A 5J47A 2E5ZA 2E19A 4BUPA 2FJ1A 1YS7A 3I4MJ 5IT9K 2XPVA 3J7AO 1A5JA 4XOPA 3E1SA 4HPQA 4AVPA 3OSFA 4XLEA 2W57A 3U1KA 5CQGA 1E3HA 2I8DA 3ZMUA 4Z2YA 3QWLA 1LFPA 4ZYGA 3MKYB 1FOYA 4BE1A 3PO3J 4XNFA 1MSEC 2GQQA 3Q9VA 3S1NJ 2OZ6A 1JT6A 2VI6A 5LEKA 4P5OA 1MBHA 2A61A 1W36D 1RKTA 2F6CA 2X1DA 5AONA 2HI3A 3WTSC 4LG3A 5E8GA 4CCKA 1K6OA 3HUGB 4U0VA 1YRNB 2V26A 3H35A 2LNBA 2KZGA 1NK3P 1IXSB 3BTLA 4B44A 1U78A 2A69F 3J7YJ 2VODA 3CMAI 1SVOA 3F8BA 2EILH 4AYBA 2CUEA 2YR2A 4LOCA 3W2WA 3CCMI 4DGWB 1GUUA 3G6EI 3K1MA 4GGGA 2HU9A 2R92J 4ITVA 4EATA 1Y0NA 2KPMA 2KQRA 4M6YA 3OOUA 2KMUA 2PI0A 1T33A 5FRNA 2LH9A 2DMNA 2MBFA 5FD6A 2ZJPF 4N0BA 2V9PA 2HEOA 1IXRC 2E1MC 2LC2A 3CC2I 1XC5A 4NUBA 4D1QA 3KP6A 3HIFA 3M1EA 1ULYA 1F9NA 2CU7A 3H3ZA 1OCRH 1MIJA 5L3DA 4KA4A 2DYSH 1GHCA 5HDNA 3S17J 2Y48A 3DP7A 2PQ8A 3RTRA 5IP9J 3FM5A 2VASA 3OY9A 2R5YA 3VSLA 1K79A 2VB6A 4M3DA 4M3GA 1U9NA 3L2WA 2MH9A 2NNYA 2COMA 2QBYA 4IQ4A 3RSNA 3PSFA 1BR4A 1LVAA 5DYMA 3P9CA 4BACA 2HOAA 1J09A 4IHYA 4A3BJ 3HBLA 1A6QA 2DT6A 2ISYA 2JK3A 3R61A 4FASD 3ZQHA 1WHUA 2MD0A 4XKWA 2ZKZA 1KU3A 1S7EA 3BJAA 3GFJA 1WKMA 1H88C 1IN5A 4HV6A 1UFMA 3ABUA 2M45A 3BCBA 5LEJA 1B72A 4Y52J 2KJBA 3S14J 3A0HC 3WTVC 1MMDA 2CUFA 4CO8A 1V5EA 3ZQ7A 3C1DA 4DIQA 5J40A 1SFOJ 1QZEA 1QA6A 4OWRB 2DMPA 1IN7A 2XSJC 1LPQA 2TCTA 3LSTA 3WHBA 1T95A 1E3PA 3OIOA 2PMHA 4YFXF 1HDDC 3K4BA 2RVCA 1AU7A 4CYCB 1WJFA 2X51A 2FE3A 5FROA 2P5VA 3FXMA 2QYOA 3CO6C 2CQ7A 2D5VA 5LFAA 1RIOH 2A5WA 3MCZA 4I2OA 3G73A 2D1VA 4NQWA 5JFRA 1XGOA 4ZTJA 2ECBA 5EGOA 2BHZA 4L9NA 2XRNA 3SFZA 2NVQJ 2M4KA 2CH0A 2L9NA 1X1BA 4ON0A 4YRVA 1D8JA 2V1NA 4MO7A 1FSEA 2JVGA 3ML6A 1RI7A 1ZGJA 2VKEA 3BDDA 4PFOA 4E4HA 4A3MJ 3F8NA 2UXNA 1HSTA 1YIOA 2QUFA 4G7OF 1MH3A 3V7CA 4O6JA 1R22A 2X1EA 2QBYB 3TKYA 1OR7C 3IRQA 3QYEA 4IHTA 2HOTA 4D7NA 3FDYA 2V1XA 4MLOA 1I6HJ 1YG2A 4UXNA 3EYYA 1BW6A 3MZYA 3ZN1A 2VLAA 3F72A 2F2EA 3FMSA 3GF2A 4P55A 2DI3A 1WRJA 4BHBA 3ASOH 3WU1B 1VFCA 3M4OJ 2F48A 3OL3A 2XGXA 3I59A 2ACJA 4F91B 4JBAA 4E7SA 1B4AA 2AS5F 3I55I 1FPQA 4MIMA 2HTSA 3CF2A 5E1WA 3V8LA 1QVUA 5EF6A 2MLGA 3W3CA 4EV0A 1X3UA 2ZJRF 2DPDA 3CCLI 3RZOJ 3LQQA 4AIDA 3A02A 3IH3A 2DA4A 2CRGA 2IS1A 2L9RA 5FGMA 3RIRA 5LD2C 2DCEA 1HW1A 2Q2EB 3CJNA 4ENKA 1ZR2A 3UKGA 2K4JA 2RN7A 4OIOF 2AQFA 1IN6A 2HKOA 3OYMA 2X6XA 3WTWC 2K3FA 3BR0A 2L4AA 1U6GA 5B3SH 1BC8C 3OYGA 4QTRA 2FBKA 3DPTA 3AG4H 2O03A 4DZJA 4KN7X 4ZDPA 5HODA 1EF4A 1BJZA 3ASNH 3K0LA 2DPUA 2L7KA 2P7CB 3GCMA 2JVHA 4OIPF 5C4XJ 2DFIA 1XGMA 3N4MA 4LIUA 4WXCA 1FYLA 2FQ4A 5KK1A 4P96A 2Y0MA 1ON2A 3VPRA 1XCVA 1H9GA 1VQ7I 3IHUA 4A0YA 4MEYF 4FHTA 1YE9A 3V8KA 3LNQA 4Q47A 1KQ8A 2GWRA 3I5UA 4IX7A 3T5XA 5GPAA 3TW6A 9ANTA 3PNTA 3OYBA 4RM2A 5LGNA 2M9HA 3C3WA 3WTTC 3HHHA 1X1DA 4HNUA 4XRFA 4OIRF 2CFOA 1ON1A 1HC8A 4JOMA 3G1LA 4BL0B 1TNTA 2ZMEC 3BG6A 3ZR8X 1STZA 3BC8A 2ELKA 4BY1J 2MGQA 1MBFA 1WH5A 3CDLA 5K5RA 3ABTA 1QNTA 1Y56A 3KE2A 3CZ6A 2NOJB 1UJ8A 4R79A 2OD5A 2P8TA 1MJ9A 1SAXA 3QP6A 1OPCA 3CESA 5E17F 4U7BA 3MD2A 3BY6A 4RB1A 2Y31A 2ZNZA 4CXFA 2HYGD 2FUG2 3HRSA 3MQ0A 1NK2P 2F4MB 4Q4ZF 2R5ZB 1IG7A 4HSRA 4C3HJ 4D0PA 4G7HF 2K9QA 1ETYA 1OISA 3DBHB 4G8XA 3Q5FA 3FMRA 2D45A 2CV1A 2KT0A 1JGGA 1G3WA 1W7PB 2ZMEA 1TW3A 5F0HA 1WZ2A 2JZYA 4NNJA 3CD6I 2PN6A 2WAQA 3PJRA 4G7ZF 5FLVA 1FJLA 2RQQA 2EFPA 3U21A 1YI2I 5LRRA 3H3UA 4NDLA 3HSRA 1TLHB 4NQWB 1HW5A 2XVCA 5F0CA 2EFQA 3IH4A 4B47A 3OYKA 3BWGA 4L9JA 1ETXA 2VXDA 3FWEA 3FXQA 5IOYA 2LF8A 1SFEA 2HWVA 4AVZA 4DOZA 3OYDA 2VQLA 2X6OA 3S2DJ 1PDNC 3OYAA 1A04A 4KJZA 2CV2A 2DYRH 1T98A 1XD7A 5J1YA 2X4HA 4XN0A 2EB7A 3CCYA 2KP6A 3I4PA 2IA1A 1IF1A 4YEJA 4M6VA 2LDUA 1ORKA 5KAIC 1B9NA 2JA2A 4A69C 1JKOC 1CGPA 2P7VB 4II2A 2EZKA 2RGVA 1FIPA 2KL4A 4XRSG 4LK1F 4ETSA 3EUAA 4RAZA 3HTUA 1JTYA 2DK5A 4HLXA 2KRHA 2QCOA 4MHGA 3HOTA 1SMYF 3VB2A 2JA5J 2WA0A 4B1RA 2HR3A 2DFHA 3S32A 2DDBA 3DPLC 3KEYA 2E34A 2X1CA 4RB2C 3IL2A 3CF5F 2XAFA 1F5TA 1Z77A 2KRCA 3VSKA 4KNYA 1EJ9A 2MLKA 4HV5A 3V7RA 2FD5A 2EIKH 3IWZA 4L5JA 4BEHA 3OYFA 4XONA 1KU9A 2DT5A 3ZQGA 1V3FA 1DDNA 1ENHA 3H9JA 5FLMJ 5FFZA 1YHQI 1SVLA 3L2RA 3HTSB 2NS7A 5F6FA 3SJMA 5FKMA 2Z5UA 4DNCA 4QLCU 3NQOA 3QAHA 2EZLA 4GYIA 4PK4A 5D4SA 1JJ6C 2CW8A 4IO9F 4UNOA 2EV0A 4H0EA 1G3SA 4M3FA 4KIFA 2XB0X 1LDKB 1VZ0A 3I54A 5KAFC 2L4MA 5JLWA 2DA2A 2NOGA 2QQ9A 3H36A 1ZRCA 4BJ6C 2XC7A 1B9MA 4BXUA 1ERDA 3TL4X 2DK8A 3GFIA 4IVNA 1YITI 1OCPA 3L2QA 4GFBA 3TBIA 2RREA 4CCJA 5K7HA 3RCOA 1TWAJ 3PIPF 2HGCA 4V2FA 1FZPB 2MD5A 5FLXK 5DCMA 4IRGA 4AU7A 4ANJA 1UELB 2OU2A 1Y8RB 2H6CA 2QQ8A 2V1DA 4AYBN 1GXQA 3SEQA 1WJEA 1MBKA 3F22A 2ELHA 4WX9A 1ZREA 3FK6A 4OIQF 1BW5A 1BC7C 4HDUA 2GZWA 5CJ9A 2YSRA 5FB2A 2M1BA 5H2FC 2DA7A 2PLYA 4E7HA 1Z0XA 3VYSB 5M3FJ 1S3JA 5E79C 4KITB 1AA7A 2X6WA 2Z2SB 5GTIC 1BOBA 3PO2J 3R0AA 5JR3A 1Z7UA 1P6RA 3UNGC 4CH7A 2FNAA 4XLAA 4KUMA 4FQGA 3IKTA 4MQ9F 1FOWA 2OAZA 1O7LA 4DJAA 1R4NB 1YX5A 4U87A 1B1BA 2Y2ZA 2LBFB 3FKIJ 1FYKA 2HOSA 2BOLA 2E5NA 3SFIA 1HA8A 5F04A 2CUJA 1YX3A 2DODA 2BYVE 1I3AA 2Q0OA 1D0XA 1R6RA 3H1CA 1MNEA 3LMMA 3S8PA 2CUZA 3CCRI 2DMUA 2CQQA 3T8RA 3DKWA 1YS6A 1ZTRA 2IGNA 1OCTC 3REOA 3QPTA 1TW2A 3D0SA 5EZHA 1RR8C 4NHJA 1FBSA 3ZQQA 2VOOA 4DW6A 1IZ1A 4B8XA 5LRSA 1GXPA 2M7AA 3LSKA 3LFUA 1IJWC 4KT6A 2L9SA 4EM2A 2ZBKA 2H6BA 2WWYA 1IRZA 5DUKA 2MFZA 4RM3A 3HZJA 3MZHA 1YW8A 3JRHA 1UMQA 4A3KJ 1B8IB 1FP1D 4N4OB 2HDWA 3NRVA 3OS0A 3K4CA 2FF4A 1J7KA 4OOIA 4RB0A 2R7UA 3B6AA 3WE3A 5K1YA 1I50J 4JYKA 1X3WB 2HYFA 3FXKA 1KONA 1ZGAA 4HQEA 2IBDA 2V79A 4BNCA 1SFXA 1V54H 3EUHC 4G6QA 2JWTA 2KLOA 4M72A 2KIFA 3RPUA 1P4AA 4WF2A 3OR1C 4CCOA 1X3ZB 1YQAA 1YJ9I 4FX4A 5FO5A 3ERED 3JTHA 3DEWA 1QHGA 3B02A 3KCCA 4IPAA 3QOEA 3JRDA 5L3EA 2LYCA 1X1CA 3CMYA 2XUBA 3GFLA 5HS7A 3SZTA 1LE8B 4I01A 1SD4A 3OS2A 2QVOA 3DCFA 3DQVC 3K4KA 5ICGA 4PFPA 4ENNA 3E5UA 5GTHC 1W1WE 2PFBA 2GM4A 3MN2A 3M7GA 4IRHA 4IOCF 3RKQA 2VC0A 3CDIA 3LQRA 1MKMA 2FMYA 1F43A 1Y6IA 3BP8A 5BNGA 4UY8I 1LE8A 4D5FA 5FLXZ 1BL0A 2GAUA 2NVYJ 4WXDA 2F5DA 1PUFB 3HG9A 1MNDA 3D1NI 1XN7A 4IHXA 4FTHA 2PEXA 3C2GA 4LLLA 3BR6A 1V55H 4RGRA 1DP3A 2EBIA 3VODA 1YFHA 2A07F 3GXOA 3B73A 5HS8A 2DFFA 4YFKF 3LA3A 4WCGA 3FKJA 2HFHA 1NG6A 3GTQJ 4E7KA 2VXZA 4BQOA 2V7FA 2W7NA 1KYWA 5BS6A 2XAHA 3S16J 2DLLA 3ZOBA 4JX4A 3JAMZ 4P9UA 5BPDA 2IS6A 3HPGA 1HDPA 1OFCX 3PSIA 3C2HA 3CC4I 4GYGA 4A0XA 3RKXA 1OCZH 1R49A 1Z6RA 2DMTA 1JUPA 3ABLH 2DXIA 1DGRM 2HQAA 2XB5A 3K4LA 2VT3A 2CFXA 4XLCA 3L2VA 1UHSA 5CVUA 2EPFA 2LK2A 1EH6A 2JUCA 2CSOA 1IDZA 1TTYA 1K4SA 4BY7J 1VQOI 2GOXB 2LBFA 1IV6A 2Z9OA 4EGYA 3EUKL 3P9IA 2VIXA 3MFKA 1FEXA 4C30A 1H9TA 1R00A 2ID6A 3OS1A 5LHHA 4UUSB 2Y0SA 1XSDA 1FMVA 2VOPA 2D2WA 1OQYA 1IC8A 3FK7A 4BJTA 5EG0A 4B09A 2LMDA 2JSCA 3CUQB 3OYIA 3JRCA 3KP5A 1AWCA 1W5TA 4CA0A 4H4KC 2P0WA 3SEZA 4HA8A 1HOMA 2LOOA 1Y8QB 1A31A 2DOFA 2DBBA 1D1CA 5J1RA 2LY2A 1O3TA 3GFMA 2QSHX 3GLXA 4PJNA 4IL6C 2MH2A 4Z6YA 1H8AC 3ECHA 4EMSA 2CQXA 4UV8A 4ESFA 1KQ9A 2AXLA 1S72I 4FT8A 3IP4B 4V2GA 4M9ZA 5ED4A 3PNYA 1MDMB 3NARA 5E3MA 1J59A 2R7TA 3W2VA 4UUTA 5ICEA 1U5TC 3A0BC 1B8IA 1P7JA 2BW3B 2OUMA 2E1NA 5DV5A 2DA1A 4XMYA 4CZZA 4QPOA 1ZR4A 3MKLA 4L9TA 1OMIA 2HQRA 1SFKA 1Z9CA 2IS4A 5CYVA 3TO6A 1IRFA 2VC1A 1KU2A 2DA6A 4EJWA 4JP0A 4XLHA 1MSFC 4PZJA 2F4IA 1XSXA 4IOAF 4DBQA 3DWLE 2RAEA 1X1PA 2XDVA 3JR9A 2DW4A 3WG9A 2XPUA 5IY5H 2NS0A 4X6AJ 2VKDA 2FU4A 5TGTA 3E5XA 2MW8A 4NBQA 3F9KA 2H8RA 1IRGA 2C6YA 3DLAA 1IDYA 3SHFA 2RNGA 1OCCH 3K9TA 3M1CA 4I0BA 3I56I 1G59A 3H3VK 1MBGA 2W4SA 3KZYA 2L0KA 3LOCA 1L3LA 3L09A 2IAIA 2ESHA 2XF6A 1YJNI 4A5NA 1VQNI 4A12A 3ZXSA 4BE0A 3ZCOA 2EZHA 1HF0A 2BVLA 5BPIA 2K85A 2R7ZJ 5EYRA 3N97A 1LNWA 2R7SA 2NVTJ 3OYHA 1X4OA 5DCFA 4PUSA 4LGWA 3IAM2 4F92B 3OWTA 1SEUA 4AUXA 3Q0WA 2VBYA 1D5YA 3IWFA 4C2MJ 1D1AA 3C18A 2EIMH 3ABKH 3LL7A 1MDMA 1R4MB 4U7DA 4BQAA 5D6EA 3QRFF 2QM3A 3HUGA 2ME6A 3PQJA 2L02A 1CF7B 4C2UA 2WV0A 3DXJF 1W36C 1BA5A 2E35A 1TT5B 2K40A 1IW7F 4AIHA 3J80Z 3MVPA 2R7XA 2A68F 1PYVA 5K5OA 4I99C 3A01A 4QPQA 1HBXG 4A6DA 2AO9A 2HKXA 3S2HJ 2HNHA 3GTPJ 3QYFA 1I1SA 2W82A 4BGDA 3NAUA 1P4XA 3JW4A 1TT0A 4L0YB 3G71I 2ISZA 1S7AA 4I0AA 4L5IA 2WV1A 2HDCA 3WU2C 3BPXA 2W85A 4JQFA 5F0FA 5EDNA 5A2QZ 3DF8A 2WB1A 1KQ0A 3LSHA 5H6QA 1R7JA 1D1BA 1LFBA 2JPCA 3S93A 2DMQA 3ONQA 2YS9A 2FOWA 5M3MJ 5LHIA 1H89C 3KP7A 4D7MA 3BG9A 3W6JB 4RAFA 4G12A 1JKPC 2LG4A 3R0JA 4UVCA 4XQFA 1FIAA 1X19A 2O0YA 2CV0A 2A5YB 1EH8A 4Y3OA 1O3QA 1IN8A 1QQIA 2PMUA 3H5RA 4ESJA 4A3GJ 4B48A 1LFUP 2OTJI 1IV8A 2WAEA 3ERMA 3IKVA 3WODF 2BZTA 3SXYA 1I1GA 2M3AA 2JA6J 3ULQB 4F55A 2XHKA 2J5PA 1K61A 4ZYHA 2W25A 2ESNA 2H09A 5EEGA 2N8GA 4HF2A 1BI2A 4OINF 2GBYA 1ETKA 2V9VA 4QSHA 1JT0A 1JKQC 2KJCA 3LWFA 2RQPA 3HL2A 3KZIC 2EFNA 1JI8A 4N4NB 4OAYA 3E6CC 1ETVA 1K6YA 2E60A 3L1PA 1P92A 3Q3SA 3QU6A 3JRIA 1UB9A 4IHVA 2JT1A 1EH7A 1BJAA 5J4YA 4MTEA 2EFOA 1YO5C 3F23A 5EEHA 3WTUC 1S29A 3EUHA 2O8XA 5HLGA 2VQGA 3TMOA 3S1MJ 5TISC 1YJWI 2P6SA 1VQ6I 2Y9YA 2QWWA 5HS9A 4BJ5C 4KDPA 4G9YA 2CW0F 2ZSHB 4CZCA 4O3MA 5TJJA 2BE5F 5K5QA 4AD9A 2QEXI 2R7VA 2HXIA 1X4PA 4XN3A 1CQTA 2LREA 2GXGA 5CVRA 5IP7J 1VI0A 2KDOA 4ZZLA 2R7DA 1S8NA 3RKYA 2WAFA 4Y4RA 3ZP5A 3OIQA 2KRFA 3MWMA 5CVIA 3CP2A 2O8KA 3FISA 1W0UA 3HGYA 5E3NA 1G8XA 5E18F 1EV7A 3AG1H 4PJJA 1TWCJ 1F1ZA 2F5EA 1ZLKA 2B63J 4YG2F 1SVMA 1RKWA 1TC3C 1X2MA 1WJDA 3I58A 4J01A 3QODA 3ISPA 2QKMB 3QYBA 5TRDA 3F3XA 1Z91A 3ZMSA 2OQRA 3LSRA 5DDGA 3JSOA 2LF7A 3MEXA 4HAMA 2YX7A 2CO5A 2RV8A 5ERIA 4S04A 4UV9A 4UB8C 4MGRA 3IV5A
chains in the Genus database with same CATH topology
4PDKA 3E97A 4OMYA 4FX0A 3FF5A 3R60A 1O3SA 1RUOA 1WSUA 3CLOA 5JI6A 5L3CA 2STTA 1OKRA 3HYIA 5D5XB 1R1VA 3K1NA 3HSEA 2VT2A 4HF0A 2IW5A 1BIAA 3I0TA 4BH9A 5J6XA 2STWA 3F8CA 2K27A 4UVBA 1ZG3A 5HLHA 2ZO4A 4RGXA 3AAFA 1RZ4A 2QENA 1DUXC 2R3SA 4BHPA 4WXHA 3KP3A 2F5CA 1ZN2A 2M87A 1USTA 2G7HA 5E1ZB 4R8HA 2OBPA 1REPC 4KYWA 4ESBA 5HVQC 4ZH4F 1R36A 4IRIA 5D5VB 1FSHA 1MD0A 2MC3A 1IN4A 2V6CA 5DUIA 1SFUA 2O3FA 4M6XA 4PCQA 1O7FA 4A6EA 2IRFG 1XSVA 1Z6TA 1IAWA 2FRHA 3ECOA 1ZYRF 1VTNC 2UWMA 4IJAA 2B0LA 1ZG5A 4K2EA 2GA1A 1FYMA 4BHCA 4U88A 4YFNF 3WGIA 3CUQC 1HKQA 1TBXA 3SQNA 2XIGA 4A2UA 4RS8A 4RB3C 2XROA 4XSXF 2HS5A 1U8RA 4M9XA 1IXCA 1UHWA 2XAQA 4YIIA 1CF7A 5BMZA 2KIMA 3F6OA 2ZFWA 3T0YA 1QZZA 4RGSA 4HOBA 1ZRFA 2K86A 4IHSA 4HDVA 1SMTA 1TQMA 2K7LA 2NNNA 3K1PA 1Y0UA 4RAYA 3EQLF 4EJTA 3RJPA 4ZZDA 5HDGA 1J9IA 3FZVA 1ZRDA 4MEXF 3DV8A 4LLGF 1KU7A 3HRTA 3V7SA 5CVVA 4G94A 4HLYA 2H27A 4I98B 4LMYA 3T1BA 4EM1A 5ICCA 4EQQA 4UUVA 2W24A 1MJAA 1XCBA 2EWNA 3LFKA 2DO7A 3BJ6A 3KLNA 2QZ8A 2ZJ2A 5ILSA 4EVIA 1P4WA 1G3YA 1I6XA 4P9FA 5DCMB 1B59A 5IT3A 4AIJA 1FY7A 1XB4A 2J5OA 2K02A 3SZPA 2W84A 2Q8KA 3GVAA 1H0MA 4LG0B 1LQ1A 1YTYA 3L00A 3CUOA 4LD5A 4LB5A 3LA2A 3R4KA 3TDZC 3QOPA 2IA2A 3M8FA 1HQCA 2HQNA 3QU3A 1D5VA 4HBLA 3BPVA 2WTEA 1RUNA 2Z99A 2P5KA 4BAYA 1O3RA 1QGPA 1FC3A 1FT9A 2GIVA 4L18B 4EJUA 4KMUX 3RYRA 4QWQA 1V4RA 2IPQX 2V1UA 2FMLA 2CGPA 4A5MA 2FNPA 4KFCA 3EDPA 4L0ZB 2L3DA 3CDHA 3KZZA 2VBXA 1HW2A 3V4GA 4A0ZA 1XMAA 4Q48A 2M30A 1T2KA 3TO7A 4GO1A 3RI4A 6PAXA 3WGHA 2HTJA 4R1HA 1YYVA 4G6DA 1TNSA 4AIKA 1XDUA 1TQPA 5DD4A 1JGSA 1J5YA 3IRRA 3PQKA 1PUEE 1HKTA 2M8EA 2ETHA 1R5GA 1LEBA 1C0WA 1FWZA 5D6FA 2DAOA 3COAC 2FBHA 4GCVA 3F6VA 3RYPA 1HXDA 3L9FA 4HF1A 5D4RA 2ZCWA 1I5ZA 3KLOA 1OYYA 4MQVA 2QLZA 3QP5A 3V8JA 1KA8A 3TDUC 5L3GA 5H6RA 2OA4A 4CDGA 3EETA 5D8LB 1FLIA 2OQGA 4ENJA 3GZ6A 2O61A 1F4KA 1R58A 2Y75A 2EK5A 3TOAA 1USSA 1MZBA 3LAJA 3L7WA 4TV7A 4XSZF 1G4DA 2BV6A 5H20A 1L0OC 4KT5C 4HX7A 4OU0A 2YX4A 3M9AA 3KP2A 3HRMA 2QQAA 5D5WB 1Z1DA 2R7FA 3W6KB 3HSFA 5LBQA 4NB5A 4E70A 2CQKA 2ZXJA 5FD5A 3GYHX 4KIBA 2PG4A 2X0LA 2NAZA 4KIGA 3ROUA 5L3FA 4HX8A 3H92A 3E6DA 4Y15A 4ENMA 5LHGA 3LAPA 2G9WA 2YU3A 3HRUA 3ZN0A 4Q5SF 1QO0D 3CTAA 5AIQA 1BBYA 2K4BA 4GXOA 2NRAC 4Y13A 1XGNA 3DFGA 3LA7A 5CVJA 4M71A 2P6TA 5ICFA 1ONVA 4WK8F 4LLNA 5HOOA 1BI1A 3WTZA 1FOKA 1XMKA 1XDSA 1W5SA 2DU9A 1Z05A 1W4MA 3CUQA 3NEUA 2IA0A 2LSOA 1K78A 1R23A 1WI9A 4MTDA 2E1CA 1D8KA 1KYZA 4UVAA 5D5UB 4IXAA 2WC2A 5E1XA 1WWXA 1FBQA 3QPHA 1K78B 3BZ6A 2JPBA 1R1UA 3TOBA 3RDIA 1T38A 2FQ3A 1W7PD 3GO5A 2LKPA 3RKWA 4S05A 2D1HA 2MA3A 1JXSA 1G3TA 5E8IA 2RKHA 5LGTA 1YW7A 3ELKA 2ZMEB 5BOXA 2BEOA 2XASA 2UZKA 1U5TA 4I7HA 2E7XA 2UXXA 4XLPF 3I71A 4PGGA 4LFUA 2E7WA 5F1RA 4M74A 5HLIA 2EFWA 1K7AA 3I53A 1XGSA 1SD7A 3GEZA 1HSJA 3TO9A 1FX7A 3GX4X 3DEUA 1BM9A 2A3SA 1QBJA 2CWEA 3FXUA 3U9GA 4LK0F 5E20A 3U1DA 2IVMA 3WTXC 4EJOA 4ZYEA 3IC7A 1JHFA 2XAJA 1FNNA 2XV4S 2PBIA 4LB6B 1ZLJA 5JVTA 1ZG1A 3U2RA 3E6MA 1BOAA 3T8TA 2G7UA 4ASNA 2Q2EA 3F21A 3G3ZA 1BN5A 2FSWA 3KEOA 3WTYC 2EV5A 5ILVA 4U0WA 1BIBA 3PFIA 3EYIA 2JTVA 2Z3YA 3VFZA 2ZNYA 1QPMA 3ZMDA 1UHMA 3BROA 1J0RA 2RC4A 1YLFA 4PGHA 2OZUA 3R6SA 5AIPA 1GVJA 2PJPA 3ZMVA 3FHZA 3JAMK 1FBUA 1MJBA 5F64A 1MGTA 4HQMA 1ODDA 2JRTA 4HYEA 3WGGA 2M5WA 1LJ9A 3OOPA 3Q9SA 2FBIA 3J81Z 5DD8A 3HHGA 3CO7C 3K2ZA 3P9KA 4I02A 2XKOA 4LG0A 1Q1HA 4RGUA 5J8FA 4CICA 1OYIA 2H94A 4LJZF 1TQIA 3FXRA 3WE2A 5D8KB 1ZAOA 2F5FA 1HKSA 3E6BA 5KVRA 4U0YA 4I09A 1G6NA 4Y17A 2YPRA 1BI3A 2CYYA 2IT0A 1DP7P 4KMFA 1O57A 2VONA 2VN2A 3P7NA 2EJRA 1LDJA 2A6EF 3O6BB 2FEZA 2VE9A 3VOEA 5LGUA 3KETA 3E5QA 3ZMZA 4F7ZA 4CHUA 3FM3A 1R1TA 3I59B 1IUYA 3KP4A 1WQ2A 2BBYA 5DEQA 1R5HA 1PP8F 4XLNF 3JTGA 3VEPA 3E3VA 2ADUA 4UHTA 1ZH5A 2HOEA 5LLQA 2A6HF 4L9VA 3K69A 5BQTA 2EA4A 4IF4A 2EV6A 3OV8A 2TDXA 1OYWA 2FXAA 1E17A 3MAJA 2VE8A 3ZMTA 3GWZA 4ZYDA 3RPQA 3O3KA 2RDPA 2VBWA 1RNLA 1B6AA 2O6GE 1ZARA 2XAGA 5IT9Z 2L54A 5FFXA 3D5LA 3FMQA 1LEAA 2IJLA 2FA5A 4EGZA 3F8MA 3BOQA 5CLSA 5J8CA 3J80K 3M8EA 4XBFA 1U2WA 5ILUA 2DQLA 2DQRA 3GUDA 1JE8A 3J81K 3O2PE 4JK1X 1OR7A 3KFWX 2P4WA 1T39A 2P5LC 4BYYA 2BGCA 2HZTA 2RNJA 4OMZA 3BJOA 2NYXA 5A2QK 1LB2A 2VBZA 3HOSA 1W7PA 1S7OA 1YW9A 1T0FA 4N9HA 4MNUA 1KGSA 1NHAA 1J2XA 3F8FA 4KN4X 1J75A 2L01A 4CYDA 1ZHFA 4HZFA 2XKPA 4WWCA 1P2FA 3S2WA 3L2CA 4HW0A 4KICA 1DPRA 2KIUA 2KKOA 3FX3A 1JHHA 4AWXB 1SD5A 2QQBA 3TQNA 3GW2A 3C7JA 1DPUA 1U3EM 3I64A 4EJVA 2GXBA 4DQ2A 3WU0A 3GZ5A 2FOKA 5L3BA 3JSPA 1D3YA 1PP7U 4HX4A 1E2XA 1I27A 2GA2A 4M73A 4CGZA 3TGNA 4YIFA 1U5TB 4EM0B 2IP2A 4M9SA 2CG4A 2Z33A 4O5VA 5JHUA 1QZYA 3ZPLA 1LDDA 1S6LA 5HDKA 1UCRA 1BI0A 1FP2A 1T6SA 3KEQA 2DTRA 1AOYA 2EA2A 4N9IA 1SD6A 1YS7A 5IT9K 3J7AO 4AVPA 2W57A 3ZMUA 4Z2YA 4ZYGA 2GQQA 3Q9VA 2OZ6A 5LEKA 4P5OA 2A61A 5AONA 3WTSC 5E8GA 1K6OA 4U0VA 2LNBA 1IXSB 1U78A 2VODA 2A69F 3F8BA 2YR2A 3K1MA 4GGGA 4M6YA 2PI0A 2MBFA 5FD6A 4N0BA 2HEOA 1IXRC 3KP6A 3HIFA 3M1EA 1ULYA 1F9NA 3H3ZA 5L3DA 4KA4A 1GHCA 5HDNA 2Y48A 3DP7A 2PQ8A 3RTRA 3FM5A 1K79A 2MH9A 2NNYA 2COMA 2QBYA 1LVAA 5DYMA 3P9CA 2ISYA 3R61A 2ZKZA 1KU3A 3BJAA 3GFJA 1WKMA 1IN5A 4HV6A 1UFMA 3ABUA 2M45A 5LEJA 2KJBA 3WTVC 4CO8A 3ZQ7A 3C1DA 1IN7A 3LSTA 2PMHA 4YFXF 2RVCA 2FE3A 2P5VA 2QYOA 3CO6C 1RIOH 4I2OA 3MCZA 3G73A 2D1VA 4NQWA 5JFRA 1XGOA 4L9NA 2XRNA 3SFZA 4ON0A 1D8JA 1FSEA 3ML6A 1RI7A 1ZGJA 3BDDA 3F8NA 2UXNA 1HSTA 1YIOA 2QUFA 4G7OF 3V7CA 4O6JA 1R22A 2QBYB 3TKYA 3IRQA 4IHTA 2V1XA 1YG2A 4UXNA 3EYYA 3MZYA 3ZN1A 3F72A 2F2EA 3FMSA 3GF2A 4P55A 2DI3A 3WU1B 1WRJA 4BHBA 2XGXA 3I59A 2ACJA 4JBAA 1B4AA 2AS5F 1FPQA 2HTSA 5E1WA 3V8LA 2MLGA 4EV0A 1X3UA 2DPDA 3LQQA 5FGMA 3RIRA 1HW1A 3CJNA 4ENKA 2K4JA 2RN7A 4OIOF 1IN6A 2HKOA 3WTWC 2L4AA 1U6GA 1BC8C 2FBKA 3DPTA 2O03A 4KN7X 3K0LA 2DPUA 2P7CB 4OIPF 2DFIA 1XGMA 3N4MA 4WXCA 1FYLA 5KK1A 4P96A 2Y0MA 1ON2A 1XCVA 1H9GA 3IHUA 4A0YA 4MEYF 4FHTA 3V8KA 4Q47A 1KQ8A 2GWRA 3I5UA 3T5XA 5LGNA 3C3WA 3WTTC 3HHHA 4XRFA 4OIRF 1ON1A 1TNTA 1STZA 5K5RA 3ABTA 1QNTA 3KE2A 4R79A 2OD5A 2P8TA 1MJ9A 1SAXA 3QP6A 1OPCA 5E17F 4U7BA 3BY6A 4RB1A 2ZNZA 4CXFA 2HYGD 3HRSA 3MQ0A 4Q4ZF 4D0PA 4G7HF 4G8XA 3Q5FA 3FMRA 2D45A 1G3WA 1W7PB 2ZMEA 1TW3A 2JZYA 2PN6A 4G7ZF 2EFPA 5LRRA 3H3UA 3HSRA 1TLHB 1HW5A 2XVCA 2EFQA 3BWGA 4L9JA 3FWEA 3FXQA 2LF8A 1SFEA 2HWVA 1PDNC 1A04A 1T98A 1XD7A 2X4HA 2EB7A 3I4PA 2IA1A 1IF1A 2LDUA 1B9NA 1CGPA 2P7VB 2RGVA 4ETSA 4LK1F 4RAZA 3HTUA 2DK5A 4HLXA 4MHGA 3HOTA 1SMYF 3VB2A 2HR3A 3DPLC 3IL2A 4RB2C 2XAFA 1F5TA 4KNYA 2MLKA 4HV5A 3V7RA 4L5JA 3IWZA 1KU9A 2DT5A 1V3FA 1DDNA 5FFZA 3HTSB 5F6FA 4DNCA 4QLCU 2Z5UA 3NQOA 3QAHA 5D4SA 4GYIA 4UNOA 2EV0A 4H0EA 1G3SA 4KIFA 1LDKB 3I54A 2L4MA 2QQ9A 1ZRCA 1B9MA 4BXUA 2DK8A 3GFIA 4IVNA 1FZPB 2HGCA 5FLXK 2MD5A 5DCMA 4IRGA 2OU2A 2V1DA 2H6CA 1GXQA 3F22A 2ELHA 4WX9A 4OIQF 1ZREA 1BC7C 4HDUA 2GZWA 5CJ9A 2YSRA 5FB2A 2M1BA 2PLYA 1S3JA 3R0AA 5JR3A 1Z7UA 1P6RA 2FNAA 4KUMA 3IKTA 4MQ9F 2OAZA 1O7LA 1B1BA 1FYKA 2BYVE 2Q0OA 3T8RA 3DKWA 1YS6A 3REOA 3QPTA 1TW2A 3D0SA 4NHJA 1FBSA 2VOOA 1IZ1A 4B8XA 5LRSA 1GXPA 4EM2A 2ZBKA 2H6BA 2WWYA 5DUKA 3MZHA 1YW8A 1FP1D 3NRVA 2FF4A 1J7KA 4OOIA 4RB0A 3WE3A 5K1YA 2HYFA 1ZGAA 4HQEA 2V79A 4BNCA 1SFXA 4G6QA 4M72A 3RPUA 2KIFA 1P4AA 4WF2A 1YQAA 4FX4A 5FO5A 3ERED 3JTHA 3B02A 3KCCA 4IPAA 5L3EA 2XUBA 3GFLA 5HS7A 3SZTA 4I01A 1SD4A 2QVOA 3DQVC 5ICGA 4ENNA 3E5UA 2PFBA 4IRHA 3M7GA 2VC0A 3LQRA 1MKMA 2FMYA 3BP8A 5FLXZ 2GAUA 4WXDA 2F5DA 1XN7A 2PEXA 4LLLA 4RGRA 3VODA 1YFHA 2A07F 3GXOA 3B73A 5HS8A 4YFKF 3LA3A 4WCGA 2HFHA 2VXZA 1KYWA 5BS6A 2XAHA 2DLLA 3JAMZ 4P9UA 5BPDA 4GYGA 4A0XA 3RKXA 1Z6RA 2VT3A 2CFXA 5CVUA 1EH6A 2CSOA 1TTYA 2Z9OA 4EGYA 3P9IA 3MFKA 1H9TA 1R00A 5LHHA 1XSDA 2VOPA 2D2WA 4B09A 2JSCA 3CUQB 3KP5A 1AWCA 1W5TA 4HA8A 2DBBA 1O3TA 3GFMA 3GLXA 2MH2A 3ECHA 4EMSA 4UV8A 4ESFA 1KQ9A 2AXLA 4FT8A 4M9ZA 5ED4A 1MDMB 1J59A 5ICEA 1U5TC 2E1NA 5DV5A 4CZZA 4L9TA 1OMIA 2HQRA 1Z9CA 5CYVA 3TO6A 1IRFA 2VC1A 1KU2A 4EJWA 4PZJA 1XSXA 2DW4A 3WG9A 2NS0A 2FU4A 3E5XA 1IRGA 2C6YA 3SHFA 3K9TA 4I0BA 3KZYA 1L3LA 3L09A 2ESHA 4A5NA 4A12A 5BPIA 3N97A 1LNWA 5DCFA 4LGWA 2VBYA 3IWFA 3C18A 1MDMA 4U7DA 4BQAA 5D6EA 3QRFF 2QM3A 3HUGA 3PQJA 2L02A 1CF7B 2WV0A 3DXJF 1IW7F 4AIHA 3J80Z 2A68F 5K5OA 1HBXG 4A6DA 2HKXA 1I1SA 1P4XA 3JW4A 4L0YB 2ISZA 1S7AA 4I0AA 4L5IA 2HDCA 3BPXA 2W85A 4JQFA 5A2QZ 3DF8A 1KQ0A 5H6QA 1R7JA 2JPCA 5LHIA 3KP7A 3W6JB 4UVCA 3R0JA 2O0YA 2A5YB 1EH8A 1O3QA 1IN8A 1QQIA 2PMUA 4ESJA 3IKVA 3WODF 3SXYA 1I1GA 3ULQB 2XHKA 2J5PA 4ZYHA 2W25A 2ESNA 2H09A 5EEGA 4HF2A 1BI2A 4OINF 2V9VA 2KJCA 3LWFA 2RQPA 2EFNA 3E6CC 1P92A 3QU6A 1UB9A 2JT1A 1EH7A 1BJAA 4MTEA 2EFOA 1YO5C 3F23A 5EEHA 3WTUC 1S29A 3EUHA 2O8XA 5HLGA 2P6SA 2QWWA 5HS9A 4KDPA 4G9YA 2CW0F 4O3MA 5TJJA 2BE5F 5K5QA 4AD9A 2GXGA 5CVRA 4ZZLA 2R7DA 1S8NA 3RKYA 3ZP5A 2KRFA 3MWMA 5CVIA 5E18F 1EV7A 1F1ZA 2F5EA 1ZLKA 4YG2F 3I58A 3ISPA 5TRDA 3F3XA 1Z91A 3ZMSA 2OQRA 5DDGA 3JSOA 2LF7A 3MEXA 4HAMA 2YX7A 2CO5A 2RV8A 5ERIA 4S04A 4UV9A 4MGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDK A;  3E97 A;  4OMY A;  4FX0 A;  3FF5 A;  3R60 A;  1O3S A;  1RUO A;  1WSU A;  3CLO A;  5JI6 A;  5L3C A;  2STT A;  1OKR A;  3HYI A;  5D5X B;  1R1V A;  3K1N A;  3HSE A;  2VT2 A;  4HF0 A;  2IW5 A;  1BIA A;  3I0T A;  4BH9 A;  5J6X A;  2STW A;  3F8C A;  2K27 A;  4UVB A;  1ZG3 A;  5HLH A;  2ZO4 A;  4RGX A;  3AAF A;  1RZ4 A;  2QEN A;  1DUX C;  2R3S A;  4BHP A;  4WXH A;  3KP3 A;  2F5C A;  1ZN2 A;  2M87 A;  1UST A;  2G7H A;  5E1Z B;  4R8H A;  2OBP A;  1REP C;  4KYW A;  4ESB A;  5HVQ C;  4ZH4 F;  1R36 A;  4IRI A;  5D5V B;  1FSH A;  1MD0 A;  2MC3 A;  1IN4 A;  2V6C A;  5DUI A;  1SFU A;  2O3F A;  4M6X A;  4PCQ A;  1O7F A;  4A6E A;  2IRF G;  1XSV A;  1Z6T A;  1IAW A;  2FRH A;  3ECO A;  1ZYR F;  1VTN C;  2UWM A;  4IJA A;  2B0L A;  1ZG5 A;  4K2E A;  2GA1 A;  1FYM A;  4BHC A;  4U88 A;  4YFN F;  3WGI A;  3CUQ C;  1HKQ A;  1TBX A;  3SQN A;  2XIG A;  4A2U A;  4RS8 A;  4RB3 C;  2XRO A;  4XSX F;  2HS5 A;  1U8R A;  4M9X A;  1IXC A;  1UHW A;  2XAQ A;  4YII A;  1CF7 A;  5BMZ A;  2KIM A;  3F6O A;  2ZFW A;  3T0Y A;  1QZZ A;  4RGS A;  4HOB A;  1ZRF A;  2K86 A;  4IHS A;  4HDV A;  1SMT A;  1TQM A;  2K7L A;  2NNN A;  3K1P A;  1Y0U A;  4RAY A;  3EQL F;  4EJT A;  3RJP A;  4ZZD A;  5HDG A;  1J9I A;  3FZV A;  1ZRD A;  4MEX F;  3DV8 A;  4LLG F;  1KU7 A;  3HRT A;  3V7S A;  5CVV A;  4G94 A;  4HLY A;  2H27 A;  4I98 B;  4LMY A;  3T1B A;  4EM1 A;  5ICC A;  4EQQ A;  4UUV A;  2W24 A;  1MJA A;  1XCB A;  2EWN A;  3LFK A;  2DO7 A;  3BJ6 A;  3KLN A;  2QZ8 A;  2ZJ2 A;  5ILS A;  4EVI A;  1P4W A;  1G3Y A;  1I6X A;  4P9F A;  5DCM B;  1B59 A;  5IT3 A;  4AIJ A;  1FY7 A;  1XB4 A;  2J5O A;  2K02 A;  3SZP A;  2W84 A;  2Q8K A;  3GVA A;  1H0M A;  4LG0 B;  1LQ1 A;  1YTY A;  3L00 A;  3CUO A;  4LD5 A;  4LB5 A;  3LA2 A;  3R4K A;  3TDZ C;  3QOP A;  2IA2 A;  3M8F A;  1HQC A;  2HQN A;  3QU3 A;  1D5V A;  4HBL A;  3BPV A;  2WTE A;  1RUN A;  2Z99 A;  2P5K A;  4BAY A;  1O3R A;  1QGP A;  1FC3 A;  1FT9 A;  2GIV A;  4L18 B;  4EJU A;  4KMU X;  3RYR A;  4QWQ A;  1V4R A;  2IPQ X;  2V1U A;  2FML A;  2CGP A;  4A5M A;  2FNP A;  4KFC A;  3EDP A;  4L0Z B;  2L3D A;  3CDH A;  3KZZ A;  2VBX A;  1HW2 A;  3V4G A;  4A0Z A;  1XMA A;  4Q48 A;  2M30 A;  1T2K A;  3TO7 A;  4GO1 A;  3RI4 A;  6PAX A;  3WGH A;  2HTJ A;  4R1H A;  1YYV A;  4G6D A;  1TNS A;  4AIK A;  1XDU A;  1TQP A;  5DD4 A;  1JGS A;  1J5Y A;  3IRR A;  3PQK A;  1PUE E;  1HKT A;  2M8E A;  2ETH A;  1R5G A;  1LEB A;  1C0W A;  1FWZ A;  5D6F A;  2DAO A;  3COA C;  2FBH A;  4GCV A;  3F6V A;  3RYP A;  1HXD A;  3L9F A;  4HF1 A;  5D4R A;  2ZCW A;  1I5Z A;  3KLO A;  1OYY A;  4MQV A;  2QLZ A;  3QP5 A;  3V8J A;  1KA8 A;  3TDU C;  5L3G A;  5H6R A;  2OA4 A;  4CDG A;  3EET A;  5D8L B;  1FLI A;  2OQG A;  4ENJ A;  3GZ6 A;  2O61 A;  1F4K A;  1R58 A;  2Y75 A;  2EK5 A;  3TOA A;  1USS A;  1MZB A;  3LAJ A;  3L7W A;  4TV7 A;  4XSZ F;  1G4D A;  2BV6 A;  5H20 A;  1L0O C;  4KT5 C;  4HX7 A;  4OU0 A;  2YX4 A;  3M9A A;  3KP2 A;  3HRM A;  2QQA A;  5D5W B;  1Z1D A;  2R7F A;  3W6K B;  3HSF A;  5LBQ A;  4NB5 A;  4E70 A;  2CQK A;  2ZXJ A;  5FD5 A;  3GYH X;  4KIB A;  2PG4 A;  2X0L A;  2NAZ A;  4KIG A;  3ROU A;  5L3F A;  4HX8 A;  3H92 A;  3E6D A;  4Y15 A;  4ENM A;  5LHG A;  3LAP A;  2G9W A;  2YU3 A;  3HRU A;  3ZN0 A;  4Q5S F;  1QO0 D;  3CTA A;  5AIQ A;  1BBY A;  2K4B A;  4GXO A;  2NRA C;  4Y13 A;  1XGN A;  3DFG A;  3LA7 A;  5CVJ A;  4M71 A;  2P6T A;  5ICF A;  1ONV A;  4WK8 F;  4LLN A;  5HOO A;  1BI1 A;  3WTZ A;  1FOK A;  1XMK A;  1XDS A;  1W5S A;  2DU9 A;  1Z05 A;  1W4M A;  3CUQ A;  3NEU A;  2IA0 A;  2LSO A;  1K78 A;  1R23 A;  1WI9 A;  4MTD A;  2E1C A;  1D8K A;  1KYZ A;  4UVA A;  5D5U B;  4IXA A;  2WC2 A;  5E1X A;  1WWX A;  1FBQ A;  3QPH A;  1K78 B;  3BZ6 A;  2JPB A;  1R1U A;  3TOB A;  3RDI A;  1T38 A;  2FQ3 A;  1W7P D;  3GO5 A;  2LKP A;  3RKW A;  4S05 A;  2D1H A;  2MA3 A;  1JXS A;  1G3T A;  5E8I A;  2RKH A;  5LGT A;  1YW7 A;  3ELK A;  2ZME B;  5BOX A;  2BEO A;  2XAS A;  2UZK A;  1U5T A;  4I7H A;  2E7X A;  2UXX A;  4XLP F;  3I71 A;  4PGG A;  4LFU A;  2E7W A;  5F1R A;  4M74 A;  5HLI A;  2EFW A;  1K7A A;  3I53 A;  1XGS A;  1SD7 A;  3GEZ A;  1HSJ A;  3TO9 A;  1FX7 A;  3GX4 X;  3DEU A;  1BM9 A;  2A3S A;  1QBJ A;  2CWE A;  3FXU A;  3U9G A;  4LK0 F;  5E20 A;  3U1D A;  2IVM A;  3WTX C;  4EJO A;  4ZYE A;  3IC7 A;  1JHF A;  2XAJ A;  1FNN A;  2XV4 S;  2PBI A;  4LB6 B;  1ZLJ A;  5JVT A;  1ZG1 A;  3U2R A;  3E6M A;  1BOA A;  3T8T A;  2G7U A;  4ASN A;  2Q2E A;  3F21 A;  3G3Z A;  1BN5 A;  2FSW A;  3KEO A;  3WTY C;  2EV5 A;  5ILV A;  4U0W A;  1BIB A;  3PFI A;  3EYI A;  2JTV A;  2Z3Y A;  3VFZ A;  2ZNY A;  1QPM A;  3ZMD A;  1UHM A;  3BRO A;  1J0R A;  2RC4 A;  1YLF A;  4PGH A;  2OZU A;  3R6S A;  5AIP A;  1GVJ A;  2PJP A;  3ZMV A;  3FHZ A;  3JAM K;  1FBU A;  1MJB A;  5F64 A;  1MGT A;  4HQM A;  1ODD A;  2JRT A;  4HYE A;  3WGG A;  2M5W A;  1LJ9 A;  3OOP A;  3Q9S A;  2FBI A;  3J81 Z;  5DD8 A;  3HHG A;  3CO7 C;  3K2Z A;  3P9K A;  4I02 A;  2XKO A;  4LG0 A;  1Q1H A;  4RGU A;  5J8F A;  4CIC A;  1OYI A;  2H94 A;  4LJZ F;  1TQI A;  3FXR A;  3WE2 A;  5D8K B;  1ZAO A;  2F5F A;  1HKS A;  3E6B A;  5KVR A;  4U0Y A;  4I09 A;  1G6N A;  4Y17 A;  2YPR A;  1BI3 A;  2CYY A;  2IT0 A;  1DP7 P;  4KMF A;  1O57 A;  2VON A;  2VN2 A;  3P7N A;  2EJR A;  1LDJ A;  2A6E F;  3O6B B;  2FEZ A;  2VE9 A;  3VOE A;  5LGU A;  3KET A;  3E5Q A;  3ZMZ A;  4F7Z A;  4CHU A;  3FM3 A;  1R1T A;  3I59 B;  1IUY A;  3KP4 A;  1WQ2 A;  2BBY A;  5DEQ A;  1R5H A;  1PP8 F;  4XLN F;  3JTG A;  3VEP A;  3E3V A;  2ADU A;  4UHT A;  1ZH5 A;  2HOE A;  5LLQ A;  2A6H F;  4L9V A;  3K69 A;  5BQT A;  2EA4 A;  4IF4 A;  2EV6 A;  3OV8 A;  2TDX A;  1OYW A;  2FXA A;  1E17 A;  3MAJ A;  2VE8 A;  3ZMT A;  3GWZ A;  4ZYD A;  3RPQ A;  3O3K A;  2RDP A;  2VBW A;  1RNL A;  1B6A A;  2O6G E;  1ZAR A;  2XAG A;  5IT9 Z;  2L54 A;  5FFX A;  3D5L A;  3FMQ A;  1LEA A;  2IJL A;  2FA5 A;  4EGZ A;  3F8M A;  3BOQ A;  5CLS A;  5J8C A;  3J80 K;  3M8E A;  4XBF A;  1U2W A;  5ILU A;  2DQL A;  2DQR A;  3GUD A;  1JE8 A;  3J81 K;  3O2P E;  4JK1 X;  1OR7 A;  3KFW X;  2P4W A;  1T39 A;  2P5L C;  4BYY A;  2BGC A;  2HZT A;  2RNJ A;  4OMZ A;  3BJO A;  2NYX A;  5A2Q K;  1LB2 A;  2VBZ A;  3HOS A;  1W7P A;  1S7O A;  1YW9 A;  1T0F A;  4N9H A;  4MNU A;  1KGS A;  1NHA A;  1J2X A;  3F8F A;  4KN4 X;  1J75 A;  2L01 A;  4CYD A;  1ZHF A;  4HZF A;  2XKP A;  4WWC A;  1P2F A;  3S2W A;  3L2C A;  4HW0 A;  4KIC A;  1DPR A;  2KIU A;  2KKO A;  3FX3 A;  1JHH A;  4AWX B;  1SD5 A;  2QQB A;  3TQN A;  3GW2 A;  3C7J A;  1DPU A;  1U3E M;  3I64 A;  4EJV A;  2GXB A;  4DQ2 A;  3WU0 A;  3GZ5 A;  2FOK A;  5L3B A;  3JSP A;  1D3Y A;  1PP7 U;  4HX4 A;  1E2X A;  1I27 A;  2GA2 A;  4M73 A;  4CGZ A;  3TGN A;  4YIF A;  1U5T B;  4EM0 B;  2IP2 A;  4M9S A;  2CG4 A;  2Z33 A;  4O5V A;  5JHU A;  1QZY A;  3ZPL A;  1LDD A;  1S6L A;  5HDK A;  1UCR A;  1BI0 A;  1FP2 A;  1T6S A;  3KEQ A;  2DTR A;  1AOY A;  2EA2 A;  4N9I A;  1SD6 A;  1YS7 A;  5IT9 K;  3J7A O;  4AVP A;  2W57 A;  3ZMU A;  4Z2Y A;  4ZYG A;  2GQQ A;  3Q9V A;  2OZ6 A;  5LEK A;  4P5O A;  2A61 A;  5AON A;  3WTS C;  5E8G A;  1K6O A;  4U0V A;  2LNB A;  1IXS B;  1U78 A;  2VOD A;  2A69 F;  3F8B A;  2YR2 A;  3K1M A;  4GGG A;  4M6Y A;  2PI0 A;  2MBF A;  5FD6 A;  4N0B A;  2HEO A;  1IXR C;  3KP6 A;  3HIF A;  3M1E A;  1ULY A;  1F9N A;  3H3Z A;  5L3D A;  4KA4 A;  1GHC A;  5HDN A;  2Y48 A;  3DP7 A;  2PQ8 A;  3RTR A;  3FM5 A;  1K79 A;  2MH9 A;  2NNY A;  2COM A;  2QBY A;  1LVA A;  5DYM A;  3P9C A;  2ISY A;  3R61 A;  2ZKZ A;  1KU3 A;  3BJA A;  3GFJ A;  1WKM A;  1IN5 A;  4HV6 A;  1UFM A;  3ABU A;  2M45 A;  5LEJ A;  2KJB A;  3WTV C;  4CO8 A;  3ZQ7 A;  3C1D A;  1IN7 A;  3LST A;  2PMH A;  4YFX F;  2RVC A;  2FE3 A;  2P5V A;  2QYO A;  3CO6 C;  1RIO H;  4I2O A;  3MCZ A;  3G73 A;  2D1V A;  4NQW A;  5JFR A;  1XGO A;  4L9N A;  2XRN A;  3SFZ A;  4ON0 A;  1D8J A;  1FSE A;  3ML6 A;  1RI7 A;  1ZGJ A;  3BDD A;  3F8N A;  2UXN A;  1HST A;  1YIO A;  2QUF A;  4G7O F;  3V7C A;  4O6J A;  1R22 A;  2QBY B;  3TKY A;  3IRQ A;  4IHT A;  2V1X A;  1YG2 A;  4UXN A;  3EYY A;  3MZY A;  3ZN1 A;  3F72 A;  2F2E A;  3FMS A;  3GF2 A;  4P55 A;  2DI3 A;  3WU1 B;  1WRJ A;  4BHB A;  2XGX A;  3I59 A;  2ACJ A;  4JBA A;  1B4A A;  2AS5 F;  1FPQ A;  2HTS A;  5E1W A;  3V8L A;  2MLG A;  4EV0 A;  1X3U A;  2DPD A;  3LQQ A;  5FGM A;  3RIR A;  1HW1 A;  3CJN A;  4ENK A;  2K4J A;  2RN7 A;  4OIO F;  1IN6 A;  2HKO A;  3WTW C;  2L4A A;  1U6G A;  1BC8 C;  2FBK A;  3DPT A;  2O03 A;  4KN7 X;  3K0L A;  2DPU A;  2P7C B;  4OIP F;  2DFI A;  1XGM A;  3N4M A;  4WXC A;  1FYL A;  5KK1 A;  4P96 A;  2Y0M A;  1ON2 A;  1XCV A;  1H9G A;  3IHU A;  4A0Y A;  4MEY F;  4FHT A;  3V8K A;  4Q47 A;  1KQ8 A;  2GWR A;  3I5U A;  3T5X A;  5LGN A;  3C3W A;  3WTT C;  3HHH A;  4XRF A;  4OIR F;  1ON1 A;  1TNT A;  1STZ A;  5K5R A;  3ABT A;  1QNT A;  3KE2 A;  4R79 A;  2OD5 A;  2P8T A;  1MJ9 A;  1SAX A;  3QP6 A;  1OPC A;  5E17 F;  4U7B A;  3BY6 A;  4RB1 A;  2ZNZ A;  4CXF A;  2HYG D;  3HRS A;  3MQ0 A;  4Q4Z F;  4D0P A;  4G7H F;  4G8X A;  3Q5F A;  3FMR A;  2D45 A;  1G3W A;  1W7P B;  2ZME A;  1TW3 A;  2JZY A;  2PN6 A;  4G7Z F;  2EFP A;  5LRR A;  3H3U A;  3HSR A;  1TLH B;  1HW5 A;  2XVC A;  2EFQ A;  3BWG A;  4L9J A;  3FWE A;  3FXQ A;  2LF8 A;  1SFE A;  2HWV A;  1PDN C;  1A04 A;  1T98 A;  1XD7 A;  2X4H A;  2EB7 A;  3I4P A;  2IA1 A;  1IF1 A;  2LDU A;  1B9N A;  1CGP A;  2P7V B;  2RGV A;  4ETS A;  4LK1 F;  4RAZ A;  3HTU A;  2DK5 A;  4HLX A;  4MHG A;  3HOT A;  1SMY F;  3VB2 A;  2HR3 A;  3DPL C;  3IL2 A;  4RB2 C;  2XAF A;  1F5T A;  4KNY A;  2MLK A;  4HV5 A;  3V7R A;  4L5J A;  3IWZ A;  1KU9 A;  2DT5 A;  1V3F A;  1DDN A;  5FFZ A;  3HTS B;  5F6F A;  4DNC A;  4QLC U;  2Z5U A;  3NQO A;  3QAH A;  5D4S A;  4GYI A;  4UNO A;  2EV0 A;  4H0E A;  1G3S A;  4KIF A;  1LDK B;  3I54 A;  2L4M A;  2QQ9 A;  1ZRC A;  1B9M A;  4BXU A;  2DK8 A;  3GFI A;  4IVN A;  1FZP B;  2HGC A;  5FLX K;  2MD5 A;  5DCM A;  4IRG A;  2OU2 A;  2V1D A;  2H6C A;  1GXQ A;  3F22 A;  2ELH A;  4WX9 A;  4OIQ F;  1ZRE A;  1BC7 C;  4HDU A;  2GZW A;  5CJ9 A;  2YSR A;  5FB2 A;  2M1B A;  2PLY A;  1S3J A;  3R0A A;  5JR3 A;  1Z7U A;  1P6R A;  2FNA A;  4KUM A;  3IKT A;  4MQ9 F;  2OAZ A;  1O7L A;  1B1B A;  1FYK A;  2BYV E;  2Q0O A;  3T8R A;  3DKW A;  1YS6 A;  3REO A;  3QPT A;  1TW2 A;  3D0S A;  4NHJ A;  1FBS A;  2VOO A;  1IZ1 A;  4B8X A;  5LRS A;  1GXP A;  4EM2 A;  2ZBK A;  2H6B A;  2WWY A;  5DUK A;  3MZH A;  1YW8 A;  1FP1 D;  3NRV A;  2FF4 A;  1J7K A;  4OOI A;  4RB0 A;  3WE3 A;  5K1Y A;  2HYF A;  1ZGA A;  4HQE A;  2V79 A;  4BNC A;  1SFX A;  4G6Q A;  4M72 A;  3RPU A;  2KIF A;  1P4A A;  4WF2 A;  1YQA A;  4FX4 A;  5FO5 A;  3ERE D;  3JTH A;  3B02 A;  3KCC A;  4IPA A;  5L3E A;  2XUB A;  3GFL A;  5HS7 A;  3SZT A;  4I01 A;  1SD4 A;  2QVO A;  3DQV C;  5ICG A;  4ENN A;  3E5U A;  2PFB A;  4IRH A;  3M7G A;  2VC0 A;  3LQR A;  1MKM A;  2FMY A;  3BP8 A;  5FLX Z;  2GAU A;  4WXD A;  2F5D A;  1XN7 A;  2PEX A;  4LLL A;  4RGR A;  3VOD A;  1YFH A;  2A07 F;  3GXO A;  3B73 A;  5HS8 A;  4YFK F;  3LA3 A;  4WCG A;  2HFH A;  2VXZ A;  1KYW A;  5BS6 A;  2XAH A;  2DLL A;  3JAM Z;  4P9U A;  5BPD A;  4GYG A;  4A0X A;  3RKX A;  1Z6R A;  2VT3 A;  2CFX A;  5CVU A;  1EH6 A;  2CSO A;  1TTY A;  2Z9O A;  4EGY A;  3P9I A;  3MFK A;  1H9T A;  1R00 A;  5LHH A;  1XSD A;  2VOP A;  2D2W A;  4B09 A;  2JSC A;  3CUQ B;  3KP5 A;  1AWC A;  1W5T A;  4HA8 A;  2DBB A;  1O3T A;  3GFM A;  3GLX A;  2MH2 A;  3ECH A;  4EMS A;  4UV8 A;  4ESF A;  1KQ9 A;  2AXL A;  4FT8 A;  4M9Z A;  5ED4 A;  1MDM B;  1J59 A;  5ICE A;  1U5T C;  2E1N A;  5DV5 A;  4CZZ A;  4L9T A;  1OMI A;  2HQR A;  1Z9C A;  5CYV A;  3TO6 A;  1IRF A;  2VC1 A;  1KU2 A;  4EJW A;  4PZJ A;  1XSX A;  2DW4 A;  3WG9 A;  2NS0 A;  2FU4 A;  3E5X A;  1IRG A;  2C6Y A;  3SHF A;  3K9T A;  4I0B A;  3KZY A;  1L3L A;  3L09 A;  2ESH A;  4A5N A;  4A12 A;  5BPI A;  3N97 A;  1LNW A;  5DCF A;  4LGW A;  2VBY A;  3IWF A;  3C18 A;  1MDM A;  4U7D A;  4BQA A;  5D6E A;  3QRF F;  2QM3 A;  3HUG A;  3PQJ A;  2L02 A;  1CF7 B;  2WV0 A;  3DXJ F;  1IW7 F;  4AIH A;  3J80 Z;  2A68 F;  5K5O A;  1HBX G;  4A6D A;  2HKX A;  1I1S A;  1P4X A;  3JW4 A;  4L0Y B;  2ISZ A;  1S7A A;  4I0A A;  4L5I A;  2HDC A;  3BPX A;  2W85 A;  4JQF A;  5A2Q Z;  3DF8 A;  1KQ0 A;  5H6Q A;  1R7J A;  2JPC A;  5LHI A;  3KP7 A;  3W6J B;  4UVC A;  3R0J A;  2O0Y A;  2A5Y B;  1EH8 A;  1O3Q A;  1IN8 A;  1QQI A;  2PMU A;  4ESJ A;  3IKV A;  3WOD F;  3SXY A;  1I1G A;  3ULQ B;  2XHK A;  2J5P A;  4ZYH A;  2W25 A;  2ESN A;  2H09 A;  5EEG A;  4HF2 A;  1BI2 A;  4OIN F;  2V9V A;  2KJC A;  3LWF A;  2RQP A;  2EFN A;  3E6C C;  1P92 A;  3QU6 A;  1UB9 A;  2JT1 A;  1EH7 A;  1BJA A;  4MTE A;  2EFO A;  1YO5 C;  3F23 A;  5EEH A;  3WTU C;  1S29 A;  3EUH A;  2O8X A;  5HLG A;  2P6S A;  2QWW A;  5HS9 A;  4KDP A;  4G9Y A;  2CW0 F;  4O3M A;  5TJJ A;  2BE5 F;  5K5Q A;  4AD9 A;  2GXG A;  5CVR A;  4ZZL A;  2R7D A;  1S8N A;  3RKY A;  3ZP5 A;  2KRF A;  3MWM A;  5CVI A;  5E18 F;  1EV7 A;  1F1Z A;  2F5E A;  1ZLK A;  4YG2 F;  3I58 A;  3ISP A;  5TRD A;  3F3X A;  1Z91 A;  3ZMS A;  2OQR A;  5DDG A;  3JSO A;  2LF7 A;  3MEX A;  4HAM A;  2YX7 A;  2CO5 A;  2RV8 A;  5ERI A;  4S04 A;  4UV9 A;  4MGR A; 
#chains in the Genus database with same CATH topology
 4PDK A;  4ZTF A;  3E97 A;  3ESW B;  4OMY A;  4FX0 A;  2E2H J;  3FF5 A;  2I10 A;  2W48 A;  3QPS A;  3A01 B;  3R60 A;  4A3L J;  3ZGK A;  1O3S A;  1RUO A;  5DM7 F;  3S1R J;  2DTZ A;  1WSU A;  1VQ5 I;  2WBM A;  3CLO A;  1GVD A;  2P81 A;  5JI6 A;  5L3C A;  2STT A;  1FOX A;  1OKR A;  3HYI A;  3JRF A;  3HXL A;  5F08 A;  1GT0 C;  2VPR A;  5D5X B;  1R1V A;  4IEJ A;  3LSP A;  2L7F P;  3K1N A;  3HSE A;  3M8J A;  2VT2 A;  2R7Q A;  4HF0 A;  2IW5 A;  1BIA A;  3RQ4 A;  4IZZ A;  3I0T A;  1YOV B;  4BH9 A;  5J6X A;  2JN6 A;  4XK4 A;  2XAU A;  2STW A;  5M5X J;  3F8C A;  2JJ7 A;  4BBR J;  3SZG A;  5GPC A;  2K27 A;  4UVB A;  1ZG3 A;  5HLH A;  2ZO4 A;  4RGX A;  2H1K A;  3AAF A;  1RZ4 A;  1AKH A;  2QEN A;  1DUX C;  1TWG J;  2R3S A;  4PSX A;  4WXH A;  4BHP A;  3KP3 A;  2F5C A;  2L5Q A;  5HNF A;  3KYC B;  3NWT A;  1ZN2 A;  2M87 A;  1UST A;  3S3M A;  1Y39 A;  2G7H A;  3OSG A;  2R93 J;  1I3Q J;  5E1Z B;  1FTT A;  4R8H A;  4Y33 A;  2OBP A;  4CCM A;  1REP C;  4KYW A;  4ESB A;  5HVQ C;  2M0C A;  4ZH4 F;  1R36 A;  1PJR A;  5CKT A;  4IRI A;  5D5V B;  2Y0S N;  2WAQ N;  5M5Y J;  1FSH A;  1MD0 A;  2WY7 Q;  4XRM A;  3ZRG A;  4LIT A;  2MC3 A;  4A3I J;  1IN4 A;  2V6C A;  5DUI A;  2XGC A;  1SFU A;  2O3F A;  1X1A A;  1ZKG A;  2R4G A;  3QPL A;  4M6X A;  3VYR B;  4F3Q A;  4PCQ A;  2E36 A;  4D5C A;  3K6G A;  5HNH A;  4XOR A;  1O7F A;  5IYD J;  4A6E A;  5C4J J;  2IRF G;  1XSV A;  4RAG A;  1Z6T A;  3JRA A;  4BDY A;  1IAW A;  2EQR A;  2FRH A;  2E2J J;  3ECO A;  1IO2 A;  1ZYR F;  1VTN C;  2UWM A;  4IJA A;  1EA3 A;  2B0L A;  1ZG5 A;  2LY9 A;  4K2E A;  3J7Z I;  2GA1 A;  1T08 B;  1JJ8 C;  1FYM A;  3CCU I;  4BHC A;  3H0D A;  4XKB A;  3DU6 A;  4U88 A;  4YFN F;  1RR7 A;  4IHW A;  3WGI A;  2JA7 J;  3HKZ A;  4GRI A;  1UZC A;  1HKQ A;  3CUQ C;  1TBX A;  3SQN A;  2WB1 N;  4DYQ A;  3A2K A;  2DA5 A;  2VJ5 A;  2XIG A;  2ZSI B;  4A2U A;  5EJC A;  4RS8 A;  2IEK A;  2HVS A;  4RB3 C;  2H8W A;  2LP0 A;  3DLL F;  1LKX A;  2XRO A;  2IXS A;  5GP9 A;  4XSX F;  2EZI A;  2HS5 A;  1QHH D;  3FBI B;  1U8R A;  4M9X A;  1K4T A;  4IQJ A;  3S3N A;  3HC7 A;  1IXC A;  1UHW A;  2XAQ A;  4YII A;  1CF7 A;  2DT7 B;  5BMZ A;  2KIM A;  3OYJ A;  3F6O A;  3JCU C;  2ZFW A;  1SAU A;  3MZ8 A;  3T0Y A;  3WHC A;  1QZZ A;  2COB A;  2XGE A;  4RGS A;  2R7W A;  4HOB A;  1ZRF A;  2K86 A;  4IHS A;  2NNN A;  1SMT A;  1TQM A;  2K7L A;  3K1P A;  4HDV A;  1Y0U A;  4RAY A;  3EQL F;  1LUJ B;  2O5R A;  4EJT A;  5FRM A;  3M07 A;  3RJP A;  3H0G J;  5HDG A;  4ZZD A;  3AG2 H;  5IPA A;  1J9I A;  2PMZ A;  3FZV A;  4MEX F;  1ZRD A;  3DV8 A;  4LLG F;  5FKK A;  4BEH B;  1MW7 A;  1KU7 A;  1G2H A;  3HRT A;  3V7S A;  5CVV A;  1VQP I;  4G94 A;  2Y30 A;  4HLY A;  3E0J B;  2M8G X;  3CJR B;  4G6T B;  2XGD A;  2L9V A;  2XRL A;  4W97 A;  2DA3 A;  1KZH A;  5C3E J;  2H27 A;  4C3J J;  4I98 B;  4LMY A;  3T1B A;  5E3O A;  2JQ7 A;  4EM1 A;  5ICC A;  4EQQ A;  5JHF A;  4UUV A;  2LLK A;  2W24 A;  3CQZ J;  1W0T A;  2R0Q C;  1MJA A;  5F1J A;  1XCB A;  3BTJ A;  2EWN A;  3LFK A;  2DO7 A;  3BJ6 A;  1VQM I;  3KLN A;  2QZ8 A;  2ZJ2 A;  5JVG F;  2IGK A;  3CJT B;  5ILS A;  3JRE A;  4EVI A;  1DGW Y;  5B5E C;  1P4W A;  3A03 A;  1G3Y A;  5J3L A;  5K7F A;  1I6X A;  3TW7 A;  3BT9 A;  4P9F A;  4ABZ A;  5DCM B;  1B59 A;  5IT3 A;  4AIJ A;  1FY7 A;  1XB4 A;  2J5O A;  2K02 A;  1B72 B;  2IGO A;  3SZP A;  2W84 A;  1XTA A;  2Q8K A;  3GVA A;  1H0M A;  4LG0 B;  1LQ1 A;  3HJE A;  1YTY A;  3L00 A;  3CUO A;  1ZEL A;  4LD5 A;  4LB5 A;  1WJC A;  3LA2 A;  3R4K A;  3TDZ C;  2Y9Z A;  2OJE D;  3B6C A;  3QOP A;  2IA2 A;  3M8F A;  1HQC A;  2HQN A;  1AHD P;  3HOU J;  1DU6 A;  3OYE A;  2DJI A;  5KHD A;  3QU3 A;  1D5V A;  4HBL A;  2OC6 A;  3BPV A;  3N05 A;  4RMN A;  1QVT A;  2WTE A;  1RUN A;  2Z99 A;  3JRG A;  2K5C A;  2P5K A;  3ABM H;  4BAY A;  1O3R A;  4B3X A;  1RC9 A;  1QGP A;  2DFE A;  3CCV I;  2A05 A;  1FC3 A;  2BY0 A;  4JX5 A;  1FT9 A;  3AL0 C;  2GIV A;  4L18 B;  4EJU A;  4KMU X;  3RYR A;  4QWQ A;  3K70 D;  1A36 A;  4D9J A;  1V4R A;  2IPQ X;  2V1U A;  2FML A;  1X2N A;  2X85 A;  2CGP A;  3M3Y J;  4A5M A;  2FNP A;  4KFC A;  3EDP A;  4L0Z B;  2QA4 I;  3HB9 A;  3W2A A;  2GOM A;  2L3D A;  3CDH A;  3DKY A;  3KZZ A;  3BZC A;  1MNM C;  2VBX A;  1HW2 A;  3V4G A;  4A0Z A;  4B3A A;  2DJN A;  1XMA A;  4MFD A;  1S5L C;  1Z3Y A;  2VQC A;  4Q48 A;  2M30 A;  1T2K A;  3TO7 A;  4GO1 A;  3RI4 A;  2JSP A;  2VUM J;  6PAX A;  2UUZ A;  2EH3 A;  1XG1 A;  3WGH A;  3KPH A;  1YRN A;  2HTJ A;  1RPW A;  4R1H A;  4CCN A;  1YYV A;  4G6D A;  1XPX A;  1TNS A;  2ZXW H;  4FE7 A;  3V42 A;  4AIK A;  4ZDL A;  1VQL I;  1XDU A;  1TQP A;  5DD4 A;  2AQE A;  2V6E A;  1JGS A;  1J5Y A;  3IRR A;  1TP4 A;  4FET A;  2DOA A;  5DTD A;  4A93 J;  3PQK A;  3AFH A;  1XX5 A;  1PUE E;  1XMX A;  2K9N A;  3KX2 A;  3QQA A;  1HKT A;  2M8E A;  2ETH A;  1R5G A;  2ZJQ F;  1LEB A;  4C2T A;  1C0W A;  1T56 A;  4BXF A;  1FWZ A;  5D6F A;  2DAO A;  5FKO A;  3COA C;  2FBH A;  3ZQF A;  3OYC A;  4MFE A;  4GCV A;  1JUM A;  3F6V A;  2I5U A;  3RYP A;  1D0Z A;  1HXD A;  3L9F A;  1VQ8 I;  4HF1 A;  3K4N A;  3OIP A;  3D5S C;  5D4R A;  2ZCW A;  3L2U A;  1I5Z A;  3KLO A;  2X48 A;  1LVK A;  1OYY A;  4MQV A;  1F36 A;  2QLZ A;  3QP5 A;  2Z1D A;  3V8J A;  2VPL A;  4ZJZ A;  4LIV A;  3J7A Y;  2F5V A;  5KNL A;  5IYB J;  1KA8 A;  2XF5 A;  4ZDO A;  4J00 A;  3TDU C;  2LKX A;  5L3G A;  2HZD A;  3CCS I;  5H6R A;  2OA4 A;  3RPU D;  4CDG A;  3PIO F;  5E3L A;  1DQU A;  3PNV A;  3GTM J;  3EET A;  5D8L B;  2BVM A;  4CUG A;  2OQG A;  1FLI A;  2ZXH A;  4ZYA A;  2R7O A;  4ENJ A;  4RLF A;  1WJA A;  3GZ6 A;  3DBR B;  3BR5 A;  2O61 A;  1U8B A;  1F4K A;  3PUB A;  1MMS A;  4X0G A;  4CYC A;  2LD5 A;  3MKZ A;  2X9D A;  3OR2 C;  1R58 A;  2Y75 A;  2EK5 A;  2MC4 A;  3TOA A;  1USS A;  1IUF A;  3E7L A;  1MZB A;  1MMN A;  1MH4 A;  3L7W A;  4TV7 A;  4E6K G;  3LAJ A;  4XSZ F;  2B9S A;  1A35 A;  1G4D A;  2NS8 A;  4F52 A;  2BV6 A;  4A3E J;  5H20 A;  2MAB A;  1L0O C;  2WAD A;  4HX7 A;  4KT5 C;  2R7R A;  4OU0 A;  5F27 A;  3SYT A;  2YX4 A;  2K9M A;  3M9A A;  3KP2 A;  4W1U A;  3HRM A;  2QQA A;  5D5W B;  3RZD J;  1Z1D A;  2R7F A;  3W6K B;  3LSG A;  4E7J A;  4HG2 A;  5CQE A;  3HSF A;  5LBQ A;  1VQ9 I;  3AG3 H;  4NB5 A;  2L7Z A;  5J1U A;  4E70 A;  2CQK A;  2ZXJ A;  5FD5 A;  3GYH X;  3HOX J;  3BR3 A;  4YEL A;  4KIB A;  4A3J J;  3IUO A;  3A4C A;  4BU2 A;  2GLO A;  4FIS A;  3MMY B;  1OLT A;  2PG4 A;  2R5Y B;  2X0L A;  4B43 A;  2NAZ A;  4KIG A;  3ROU A;  5L3F A;  4HX8 A;  3H92 A;  1VF9 A;  2CJJ A;  3E6D A;  4Y15 A;  5LHG A;  3DEE A;  3LAP A;  2G9W A;  2YU3 A;  3BG5 A;  3HRU A;  4ENM A;  2W1O A;  3JRB A;  3ZN0 A;  4Q5S F;  3FXO A;  1YIJ I;  1QO0 D;  3CTA A;  1K83 J;  1WH7 A;  2OF7 A;  4M3B A;  5AIQ A;  1BBY A;  1WCM J;  4BS9 A;  4BBS J;  2KDZ A;  1SAN A;  2K4B A;  2W00 A;  4GXO A;  2NRA C;  1P7I A;  4Y13 A;  1ZGW A;  1XGN A;  3DFG A;  3LA7 A;  5CVJ A;  1JKR C;  1ITY A;  4M71 A;  2P6T A;  2BW3 A;  5ICF A;  1ONV A;  4WK8 F;  5GAH J;  2R5Z A;  2K9S A;  2BXY A;  4V19 K;  2YUS A;  4LLN A;  3TP0 A;  3NWS A;  2BHY A;  5HOO A;  4S0H B;  1BI1 A;  3WTZ A;  4HNT A;  5CPR B;  4M3E A;  2MYS A;  4YIR X;  3GTL J;  2ECC A;  1FOK A;  4HST A;  1XMK A;  2V9K A;  1XDS A;  1N77 A;  1W5S A;  2KZV A;  1UG2 A;  2DU9 A;  1Z05 A;  1TZL A;  2QF7 A;  5FJ8 J;  4E7L A;  1W4M A;  3CUQ A;  3NEU A;  3X2Q H;  2IA0 A;  3GBG A;  3CLQ A;  2LSO A;  5HLT A;  1VQK I;  1K78 A;  3GTK J;  1R23 A;  1IGN A;  3C2B A;  1WI9 A;  3RQI A;  4MTD A;  2DOE A;  3DTI A;  3P5J A;  1D8K A;  2E1C A;  2ID3 A;  1KYZ A;  4UVA A;  1BR2 A;  5D5U B;  3GME A;  2M4G A;  2VL8 A;  4BKX A;  4IXA A;  2WC2 A;  3K4J A;  1WWX A;  1FBQ A;  2UV1 A;  5E1X A;  2HPM A;  3QPH A;  1K78 B;  4RA2 A;  1WJB A;  3BZ6 A;  2JPB A;  4NC7 A;  4CSW A;  1R1U A;  2KIQ A;  3TOB A;  3S15 J;  1WPK A;  3RDI A;  1T38 A;  3OYN A;  4I6Z A;  3S1Q J;  2FQ3 A;  2OPT A;  4DYC A;  1W7P D;  3GO5 A;  2LKP A;  3BQZ A;  3RKW A;  1QRY A;  4S05 A;  2D1H A;  2MA3 A;  2VKH A;  2G0E A;  2GIZ A;  1JXS A;  5JLX A;  1G3T A;  5E8I A;  3KYL A;  2ELJ A;  2RKH A;  5LGT A;  3BLY A;  4C9Y A;  2OTL I;  4DBR A;  1YW7 A;  3PL8 A;  2O9L A;  2VJJ A;  4XID A;  2AHQ A;  3ELK A;  1ETQ A;  2ZME B;  5BOX A;  2BEO A;  2XAS A;  3BR1 A;  1U5T A;  2UZK A;  4I7H A;  2E7X A;  1MBJ A;  3BTI A;  3VYU B;  4BXX J;  1V5F A;  2JA8 J;  3FHN A;  1ZK8 A;  2PMZ N;  2TRT A;  2UXX A;  4XLP F;  3H9Q A;  3I71 A;  4PGG A;  4LFU A;  4P1W A;  2GXA A;  1QPI A;  2E7W A;  2K9L A;  2F4O B;  5F1R A;  4M74 A;  5HLI A;  2EFW A;  4HNV A;  3ZQL A;  1WFX A;  1K7A A;  1Y1V J;  3I53 A;  3IH2 A;  5FKN A;  1XGS A;  1SD7 A;  2HVQ A;  3GEZ A;  1HSJ A;  5IOZ A;  2E2I J;  3TO9 A;  1VQ4 I;  2YU9 J;  3K70 C;  1FX7 A;  4NC6 A;  2K3P A;  1I39 A;  2LFB A;  4RLQ A;  3HEF A;  3GX4 X;  3DEU A;  1BM9 A;  2A3S A;  1QBJ A;  3A1Y A;  2CWE A;  3FXU A;  3LSM A;  4QIW N;  3U9G A;  3HKZ N;  2JMW A;  4LK0 F;  5E20 A;  3DPU A;  3U1D A;  2Y69 H;  2IVM A;  1HCR A;  2Z16 A;  2M7B A;  4RDU A;  3WTX C;  1PUF A;  4EJO A;  2V4J C;  3DTE A;  2NVU B;  3IC7 A;  1JHF A;  4ZYE A;  2XAJ A;  3FBN B;  1FNN A;  2XV4 S;  4XR6 A;  3ZQC A;  3VWB A;  1T8I A;  2PBI A;  2ICW G;  1PVE A;  3LSI A;  2X6Y A;  2CW7 A;  4LB6 B;  4FCY A;  1N25 A;  3GTG J;  4XKC A;  2IGM A;  1ZLJ A;  2EIN H;  5C44 J;  5JVT A;  3G4S I;  1ZG1 A;  3U2R A;  3E6M A;  2BY1 A;  1ETW A;  1ACI A;  1BOA A;  3T8T A;  2M34 A;  2G7U A;  4ASN A;  1M1E B;  5B1B H;  2L7M P;  2Q2E A;  3F21 A;  1APL C;  2KHM A;  3G3Z A;  1R71 A;  1JTX A;  1BN5 A;  2FSW A;  4XKV A;  4BDZ A;  3KEO A;  2PX9 A;  3WTY C;  2EV5 A;  1TL8 A;  5ILV A;  2E1M B;  2QSG X;  4U0W A;  1BIB A;  2QGU A;  3PFI A;  2VJI A;  2JTV A;  3EYI A;  2Q1Z B;  1WVR A;  2M0M A;  4II3 A;  2Z3Y A;  1TWF J;  3VFZ A;  4XRS A;  3AL0 B;  2ZNY A;  3GTJ J;  4DZP A;  4PJ0 C;  1QPM A;  3KYD B;  3ZMD A;  3PFY A;  1E0E A;  1UHM A;  3BRO A;  3BTC A;  3W6V A;  4PJM A;  2M2E A;  1J0R A;  2RC4 A;  5IP6 A;  1YLF A;  2LR8 A;  5EG0 B;  3TED A;  2ZFU A;  4PGH A;  2OZU A;  3R6S A;  5AIP A;  5DM6 F;  2HPI A;  1GVJ A;  3IAS 2;  5K7Z A;  4XL9 A;  2PJP A;  4FE4 A;  3EPZ A;  5FKL A;  2XSD C;  3ZMV A;  3OL4 A;  3FHZ A;  3JAM K;  1FBU A;  1MJB A;  3Q0U A;  5F64 A;  1MGT A;  4HQM A;  1ODD A;  2JRT A;  4HYE A;  3Q0V A;  1U0J A;  1Q1V A;  3K7A J;  3WGG A;  5GAD J;  2M5W A;  1V5G A;  1LJ9 A;  3OOP A;  2EIJ H;  1RES A;  2FBI A;  3Q9S A;  3J81 Z;  5DD8 A;  3HHG A;  1POG A;  3CCE I;  3KIO A;  3CO7 C;  4X1E A;  3K2Z A;  3P9K A;  1NTC A;  3AKZ A;  2PJR A;  4I02 A;  3CC7 I;  1SC7 A;  2XKO A;  3F0C A;  4LG0 A;  3CCJ I;  4A3D J;  1Q1H A;  4RGU A;  5J8F A;  4CIC A;  1OYI A;  2H94 A;  4LJZ F;  1TQI A;  3FXR A;  3WE2 A;  5D8K B;  1ZAO A;  2F5F A;  3CMM A;  1HKS A;  1Z7L A;  3E6B A;  5KVR A;  3VDX A;  4U0Y A;  1XS9 A;  4I09 A;  1G6N A;  3HOY J;  4AC0 A;  4A3C J;  3TP3 A;  1WJ5 A;  4Y17 A;  2YPR A;  1BI3 A;  2A6T A;  4B4C A;  2CYY A;  2IT0 A;  1DP7 P;  4KMF A;  1O57 A;  2VON A;  2VN2 A;  3P7N A;  2EJR A;  1GDT A;  1WGX A;  1LDJ A;  2A6E F;  2NVX J;  3O6B B;  2FEZ A;  1HLV A;  3HDD A;  2VE9 A;  2L2O A;  1TWH J;  3VOE A;  3BQY A;  5LGU A;  3KET A;  3DBL B;  3E5Q A;  1P9Q C;  1VND A;  3HPH A;  3ZMZ A;  4F7Z A;  1RET A;  4CHU A;  3OMY A;  2H1L A;  4BQQ A;  4E7I A;  3FM3 A;  2ZXI A;  2QSF X;  3DTK A;  4E7Z A;  1R1T A;  3I59 B;  1IUY A;  3KP4 A;  3BR2 A;  3BG3 A;  2OCC H;  1FTZ A;  2NXN B;  1ETO A;  1WQ2 A;  2BBY A;  1OJL A;  2BY3 A;  2ME0 A;  1R5I D;  5DEQ A;  1WI3 A;  1GV5 A;  1R5H A;  4RBO A;  1PP8 F;  1UAA A;  4XLN F;  2E1O A;  3JTG A;  3VEP A;  1T0F C;  3E3V A;  2ADU A;  4UHT A;  2HVR A;  4ZC3 A;  1ZH5 A;  3MKW B;  2CQN A;  1UG0 A;  2HOE A;  4I76 A;  5LLQ A;  2KIS A;  3GZN B;  1EKE A;  2A6H F;  4L9V A;  3K69 A;  3HGG A;  5BQT A;  3G1M A;  2EA4 A;  1ZQ3 P;  4IF4 A;  4NC8 A;  2EV6 A;  5B1A H;  3FIW A;  3LSJ A;  3OV8 A;  3GLL A;  3K10 A;  2TDX A;  1OYW A;  2FXA A;  3O8H A;  1E17 A;  3MAJ A;  5J4V A;  4KIS A;  4BE2 A;  3I4N J;  2VKV A;  2VE8 A;  2DN0 A;  3CCQ I;  5M5W J;  4HEA 2;  3ZMT A;  3GWZ A;  3SDG A;  4DYR A;  4ZYD A;  2ZC2 A;  3RPQ A;  2IS2 A;  2MSY A;  3O3K A;  1Z21 A;  2RDP A;  1N75 A;  1JUS A;  3H5A A;  2VBW A;  1GLN A;  1RNL A;  2VJ4 A;  2HQ5 A;  1R9T J;  1AKH B;  1B6A A;  1OCO H;  2WY8 Q;  2O6G E;  3H9G A;  4AM3 A;  2JRM A;  2XAG A;  1ZAR A;  2FX0 A;  2LVS A;  3VYT B;  4F93 B;  1IRX A;  2L54 A;  5IT9 Z;  5FFX A;  3D5L A;  2BY2 A;  4HRI A;  1RRJ A;  3FMQ A;  3S3O A;  1LEA A;  4JX6 A;  2B7E A;  3PUF A;  2IJL A;  2FA5 A;  1U9O A;  4EGZ A;  3HOZ J;  3F8M A;  3SDB A;  3BOQ A;  5CLS A;  1FMW A;  3UR3 C;  2MG4 A;  5J8C A;  3J80 K;  2LKS A;  3M8E A;  4XBF A;  1U2W A;  2CS3 A;  5ILU A;  4BQN A;  2DQL A;  2DQR A;  3GUD A;  1JE8 A;  3GTO J;  3J81 K;  3O2P E;  2LY1 A;  4JK1 X;  1Z3X A;  1X58 A;  1OR7 A;  3KFW X;  2P4W A;  1T39 A;  2P5L C;  4BYY A;  2BGC A;  3HOV J;  2HZT A;  2RNJ A;  2JUG A;  3CJQ B;  4OMZ A;  3BJO A;  2NYX A;  5A2Q K;  1LB2 A;  2VBZ A;  1W7P A;  3HOS A;  2OV7 A;  5EGO B;  1S7O A;  1YW9 A;  1T0F A;  4N9H A;  1Z67 A;  3DKX A;  1D0Y A;  4MNU A;  1KGS A;  2DDA A;  1NHA A;  5EZG A;  1J2X A;  2ZB9 A;  2E71 A;  3F8F A;  4KN4 X;  4L5E A;  3BG7 A;  3ZQI A;  1J75 A;  3WG7 H;  4C3I J;  2L01 A;  4CYD A;  1ZHF A;  1O4X A;  4HZF A;  2XKP A;  4WWC A;  1P2F A;  3S2W A;  3L2C A;  5KCM A;  4HW0 A;  4KIC A;  2HDD A;  1DPR A;  2QKL B;  2XF7 A;  2HXO A;  2KFD A;  2KIU A;  2OCE A;  4XOT A;  2KKO A;  3FX3 A;  1JHH A;  4AWX B;  2HYJ A;  1SD5 A;  2QQB A;  3TQN A;  2BXZ A;  4UUS A;  4PSW A;  4XIC A;  4CCL A;  3GW2 A;  3C7J A;  1DPU A;  1MMA A;  1U3E M;  1QU3 A;  1BR1 A;  3I64 A;  1NH3 A;  4EJV A;  1MBE A;  2GXB A;  5GAE J;  4DQ2 A;  3WU0 A;  2CMP A;  3GZ5 A;  3FXL A;  3O8G A;  5B66 C;  5DS9 A;  3HOW J;  2FOK A;  5L3B A;  3G2B A;  3JSP A;  1D3Y A;  4EEF G;  1PP7 U;  3H5N A;  3DU5 A;  4HX4 A;  3PM1 A;  1E2X A;  2AXT C;  1I27 A;  2LRD A;  2XPW A;  3K4M A;  4PJL A;  2GA2 A;  3CME I;  1Y1W J;  1MMG A;  4Y7N J;  4IKF A;  3OYL A;  1E3O C;  4M73 A;  1S9H A;  4CGZ A;  4A3F J;  3K2A A;  5IYC J;  3TGN A;  4YIF A;  1GV2 A;  1W5C C;  4UB6 C;  2VQH A;  5EEA A;  1U5T B;  4EM0 B;  2IP2 A;  4M9S A;  2CG4 A;  2Z33 A;  3HM5 A;  4OAZ A;  4O5V A;  4XM3 A;  1DU0 A;  5JHU A;  5GAG J;  2PJR B;  3G1O A;  1QZY A;  3ZPL A;  4XLF A;  4J19 A;  3I3L A;  1LDD A;  1S6L A;  3I9V 2;  5HDK A;  3BZK A;  3FXJ A;  1N78 A;  1UCR A;  2O7O A;  3BCA A;  1BI0 A;  2LTP A;  1FP2 A;  1T6S A;  1NG7 A;  3D5R C;  3KEQ A;  2DTR A;  4GDF A;  1AOY A;  2EA2 A;  4N9I A;  3CP8 A;  1A6I A;  1SD6 A;  5J47 A;  2E5Z A;  2E19 A;  4BUP A;  2FJ1 A;  1YS7 A;  3I4M J;  5IT9 K;  2XPV A;  3J7A O;  1A5J A;  4XOP A;  3E1S A;  4HPQ A;  4AVP A;  3OSF A;  4XLE A;  2W57 A;  3U1K A;  5CQG A;  1E3H A;  2I8D A;  3ZMU A;  4Z2Y A;  3QWL A;  1LFP A;  4ZYG A;  3MKY B;  1FOY A;  4BE1 A;  3PO3 J;  4XNF A;  1MSE C;  2GQQ A;  3Q9V A;  3S1N J;  2OZ6 A;  1JT6 A;  2VI6 A;  5LEK A;  4P5O A;  1MBH A;  2A61 A;  1W36 D;  1RKT A;  2F6C A;  2X1D A;  5AON A;  2HI3 A;  3WTS C;  4LG3 A;  5E8G A;  4CCK A;  1K6O A;  3HUG B;  4U0V A;  1YRN B;  2V26 A;  3H35 A;  2LNB A;  2KZG A;  1NK3 P;  1IXS B;  3BTL A;  4B44 A;  1U78 A;  2A69 F;  3J7Y J;  2VOD A;  3CMA I;  1SVO A;  3F8B A;  2EIL H;  4AYB A;  2CUE A;  2YR2 A;  4LOC A;  3W2W A;  3CCM I;  4DGW B;  1GUU A;  3G6E I;  3K1M A;  4GGG A;  2HU9 A;  2R92 J;  4ITV A;  4EAT A;  1Y0N A;  2KPM A;  2KQR A;  4M6Y A;  3OOU A;  2KMU A;  2PI0 A;  1T33 A;  5FRN A;  2LH9 A;  2DMN A;  2MBF A;  5FD6 A;  2ZJP F;  4N0B A;  2V9P A;  2HEO A;  1IXR C;  2E1M C;  2LC2 A;  3CC2 I;  1XC5 A;  4NUB A;  4D1Q A;  3KP6 A;  3HIF A;  3M1E A;  1ULY A;  1F9N A;  2CU7 A;  3H3Z A;  1OCR H;  1MIJ A;  5L3D A;  4KA4 A;  2DYS H;  1GHC A;  5HDN A;  3S17 J;  2Y48 A;  3DP7 A;  2PQ8 A;  3RTR A;  5IP9 J;  3FM5 A;  2VAS A;  3OY9 A;  2R5Y A;  3VSL A;  1K79 A;  2VB6 A;  4M3D A;  4M3G A;  1U9N A;  3L2W A;  2MH9 A;  2NNY A;  2COM A;  2QBY A;  4IQ4 A;  3RSN A;  3PSF A;  1BR4 A;  1LVA A;  5DYM A;  3P9C A;  4BAC A;  2HOA A;  1J09 A;  4IHY A;  4A3B J;  3HBL A;  1A6Q A;  2DT6 A;  2ISY A;  2JK3 A;  3R61 A;  4FAS D;  3ZQH A;  1WHU A;  2MD0 A;  4XKW A;  2ZKZ A;  1KU3 A;  1S7E A;  3BJA A;  3GFJ A;  1WKM A;  1H88 C;  1IN5 A;  4HV6 A;  1UFM A;  3ABU A;  2M45 A;  3BCB A;  5LEJ A;  1B72 A;  4Y52 J;  2KJB A;  3S14 J;  3A0H C;  3WTV C;  1MMD A;  2CUF A;  4CO8 A;  1V5E A;  3ZQ7 A;  3C1D A;  4DIQ A;  5J40 A;  1SFO J;  1QZE A;  1QA6 A;  4OWR B;  2DMP A;  1IN7 A;  2XSJ C;  1LPQ A;  2TCT A;  3LST A;  3WHB A;  1T95 A;  1E3P A;  3OIO A;  2PMH A;  4YFX F;  1HDD C;  3K4B A;  2RVC A;  1AU7 A;  4CYC B;  1WJF A;  2X51 A;  2FE3 A;  5FRO A;  2P5V A;  3FXM A;  2QYO A;  3CO6 C;  2CQ7 A;  2D5V A;  5LFA A;  1RIO H;  2A5W A;  3MCZ A;  4I2O A;  3G73 A;  2D1V A;  4NQW A;  5JFR A;  1XGO A;  4ZTJ A;  2ECB A;  5EGO A;  2BHZ A;  4L9N A;  2XRN A;  3SFZ A;  2NVQ J;  2M4K A;  2CH0 A;  2L9N A;  1X1B A;  4ON0 A;  4YRV A;  1D8J A;  2V1N A;  4MO7 A;  1FSE A;  2JVG A;  3ML6 A;  1RI7 A;  1ZGJ A;  2VKE A;  3BDD A;  4PFO A;  4E4H A;  4A3M J;  3F8N A;  2UXN A;  1HST A;  1YIO A;  2QUF A;  4G7O F;  1MH3 A;  3V7C A;  4O6J A;  1R22 A;  2X1E A;  2QBY B;  3TKY A;  1OR7 C;  3IRQ A;  3QYE A;  4IHT A;  2HOT A;  4D7N A;  3FDY A;  2V1X A;  4MLO A;  1I6H J;  1YG2 A;  4UXN A;  3EYY A;  1BW6 A;  3MZY A;  3ZN1 A;  2VLA A;  3F72 A;  2F2E A;  3FMS A;  3GF2 A;  4P55 A;  2DI3 A;  1WRJ A;  4BHB A;  3ASO H;  3WU1 B;  1VFC A;  3M4O J;  2F48 A;  3OL3 A;  2XGX A;  3I59 A;  2ACJ A;  4F91 B;  4JBA A;  4E7S A;  1B4A A;  2AS5 F;  3I55 I;  1FPQ A;  4MIM A;  2HTS A;  3CF2 A;  5E1W A;  3V8L A;  1QVU A;  5EF6 A;  2MLG A;  3W3C A;  4EV0 A;  1X3U A;  2ZJR F;  2DPD A;  3CCL I;  3RZO J;  3LQQ A;  4AID A;  3A02 A;  3IH3 A;  2DA4 A;  2CRG A;  2IS1 A;  2L9R A;  5FGM A;  3RIR A;  5LD2 C;  2DCE A;  1HW1 A;  2Q2E B;  3CJN A;  4ENK A;  1ZR2 A;  3UKG A;  2K4J A;  2RN7 A;  4OIO F;  2AQF A;  1IN6 A;  2HKO A;  3OYM A;  2X6X A;  3WTW C;  2K3F A;  3BR0 A;  2L4A A;  1U6G A;  5B3S H;  1BC8 C;  3OYG A;  4QTR A;  2FBK A;  3DPT A;  3AG4 H;  2O03 A;  4DZJ A;  4KN7 X;  4ZDP A;  5HOD A;  1EF4 A;  1BJZ A;  3ASN H;  3K0L A;  2DPU A;  2L7K A;  2P7C B;  3GCM A;  2JVH A;  4OIP F;  5C4X J;  2DFI A;  1XGM A;  3N4M A;  4LIU A;  4WXC A;  1FYL A;  2FQ4 A;  5KK1 A;  4P96 A;  2Y0M A;  1ON2 A;  3VPR A;  1XCV A;  1H9G A;  1VQ7 I;  3IHU A;  4A0Y A;  4MEY F;  4FHT A;  1YE9 A;  3V8K A;  3LNQ A;  4Q47 A;  1KQ8 A;  2GWR A;  3I5U A;  4IX7 A;  3T5X A;  5GPA A;  3TW6 A;  9ANT A;  3PNT A;  3OYB A;  4RM2 A;  5LGN A;  2M9H A;  3C3W A;  3WTT C;  3HHH A;  1X1D A;  4HNU A;  4XRF A;  4OIR F;  2CFO A;  1ON1 A;  1HC8 A;  4JOM A;  3G1L A;  4BL0 B;  1TNT A;  2ZME C;  3BG6 A;  3ZR8 X;  1STZ A;  3BC8 A;  2ELK A;  4BY1 J;  2MGQ A;  1MBF A;  1WH5 A;  3CDL A;  5K5R A;  3ABT A;  1QNT A;  1Y56 A;  3KE2 A;  3CZ6 A;  2NOJ B;  1UJ8 A;  4R79 A;  2OD5 A;  2P8T A;  1MJ9 A;  1SAX A;  3QP6 A;  1OPC A;  3CES A;  5E17 F;  4U7B A;  3MD2 A;  3BY6 A;  4RB1 A;  2Y31 A;  2ZNZ A;  4CXF A;  2HYG D;  2FUG 2;  3HRS A;  3MQ0 A;  1NK2 P;  2F4M B;  4Q4Z F;  2R5Z B;  1IG7 A;  4HSR A;  4C3H J;  4D0P A;  4G7H F;  2K9Q A;  1ETY A;  1OIS A;  3DBH B;  4G8X A;  3Q5F A;  3FMR A;  2D45 A;  2CV1 A;  2KT0 A;  1JGG A;  1G3W A;  1W7P B;  2ZME A;  1TW3 A;  5F0H A;  1WZ2 A;  2JZY A;  4NNJ A;  3CD6 I;  2PN6 A;  2WAQ A;  3PJR A;  4G7Z F;  5FLV A;  1FJL A;  2RQQ A;  2EFP A;  3U21 A;  1YI2 I;  5LRR A;  3H3U A;  4NDL A;  3HSR A;  1TLH B;  4NQW B;  1HW5 A;  2XVC A;  5F0C A;  2EFQ A;  3IH4 A;  4B47 A;  3OYK A;  3BWG A;  4L9J A;  1ETX A;  2VXD A;  3FWE A;  3FXQ A;  5IOY A;  2LF8 A;  1SFE A;  2HWV A;  4AVZ A;  4DOZ A;  3OYD A;  2VQL A;  2X6O A;  3S2D J;  1PDN C;  3OYA A;  1A04 A;  4KJZ A;  2CV2 A;  2DYR H;  1T98 A;  1XD7 A;  5J1Y A;  2X4H A;  4XN0 A;  2EB7 A;  3CCY A;  2KP6 A;  3I4P A;  2IA1 A;  1IF1 A;  4YEJ A;  4M6V A;  2LDU A;  1ORK A;  5KAI C;  1B9N A;  2JA2 A;  4A69 C;  1JKO C;  1CGP A;  2P7V B;  4II2 A;  2EZK A;  2RGV A;  1FIP A;  2KL4 A;  4XRS G;  4LK1 F;  4ETS A;  3EUA A;  4RAZ A;  3HTU A;  1JTY A;  2DK5 A;  4HLX A;  2KRH A;  2QCO A;  4MHG A;  3HOT A;  1SMY F;  3VB2 A;  2JA5 J;  2WA0 A;  4B1R A;  2HR3 A;  2DFH A;  3S32 A;  2DDB A;  3DPL C;  3KEY A;  2E34 A;  2X1C A;  4RB2 C;  3IL2 A;  3CF5 F;  2XAF A;  1F5T A;  1Z77 A;  2KRC A;  3VSK A;  4KNY A;  1EJ9 A;  2MLK A;  4HV5 A;  3V7R A;  2FD5 A;  2EIK H;  3IWZ A;  4L5J A;  4BEH A;  3OYF A;  4XON A;  1KU9 A;  2DT5 A;  3ZQG A;  1V3F A;  1DDN A;  1ENH A;  3H9J A;  5FLM J;  5FFZ A;  1YHQ I;  1SVL A;  3L2R A;  3HTS B;  2NS7 A;  5F6F A;  3SJM A;  5FKM A;  2Z5U A;  4DNC A;  4QLC U;  3NQO A;  3QAH A;  2EZL A;  4GYI A;  4PK4 A;  5D4S A;  1JJ6 C;  2CW8 A;  4IO9 F;  4UNO A;  2EV0 A;  4H0E A;  1G3S A;  4M3F A;  4KIF A;  2XB0 X;  1LDK B;  1VZ0 A;  3I54 A;  5KAF C;  2L4M A;  5JLW A;  2DA2 A;  2NOG A;  2QQ9 A;  3H36 A;  1ZRC A;  4BJ6 C;  2XC7 A;  1B9M A;  4BXU A;  1ERD A;  3TL4 X;  2DK8 A;  3GFI A;  4IVN A;  1YIT I;  1OCP A;  3L2Q A;  4GFB A;  3TBI A;  2RRE A;  4CCJ A;  5K7H A;  3RCO A;  1TWA J;  3PIP F;  2HGC A;  4V2F A;  1FZP B;  2MD5 A;  5FLX K;  5DCM A;  4IRG A;  4AU7 A;  4ANJ A;  1UEL B;  2OU2 A;  1Y8R B;  2H6C A;  2QQ8 A;  2V1D A;  4AYB N;  1GXQ A;  3SEQ A;  1WJE A;  1MBK A;  3F22 A;  2ELH A;  4WX9 A;  1ZRE A;  3FK6 A;  4OIQ F;  1BW5 A;  1BC7 C;  4HDU A;  2GZW A;  5CJ9 A;  2YSR A;  5FB2 A;  2M1B A;  5H2F C;  2DA7 A;  2PLY A;  4E7H A;  1Z0X A;  3VYS B;  5M3F J;  1S3J A;  5E79 C;  4KIT B;  1AA7 A;  2X6W A;  2Z2S B;  5GTI C;  1BOB A;  3PO2 J;  3R0A A;  5JR3 A;  1Z7U A;  1P6R A;  3UNG C;  4CH7 A;  2FNA A;  4XLA A;  4KUM A;  4FQG A;  3IKT A;  4MQ9 F;  1FOW A;  2OAZ A;  1O7L A;  4DJA A;  1R4N B;  1YX5 A;  4U87 A;  1B1B A;  2Y2Z A;  2LBF B;  3FKI J;  1FYK A;  2HOS A;  2BOL A;  2E5N A;  3SFI A;  1HA8 A;  5F04 A;  2CUJ A;  1YX3 A;  2DOD A;  2BYV E;  1I3A A;  2Q0O A;  1D0X A;  1R6R A;  3H1C A;  1MNE A;  3LMM A;  3S8P A;  2CUZ A;  3CCR I;  2DMU A;  2CQQ A;  3T8R A;  3DKW A;  1YS6 A;  1ZTR A;  2IGN A;  1OCT C;  3REO A;  3QPT A;  1TW2 A;  3D0S A;  5EZH A;  1RR8 C;  4NHJ A;  1FBS A;  3ZQQ A;  2VOO A;  4DW6 A;  1IZ1 A;  4B8X A;  5LRS A;  1GXP A;  2M7A A;  3LSK A;  3LFU A;  1IJW C;  4KT6 A;  2L9S A;  4EM2 A;  2ZBK A;  2H6B A;  2WWY A;  1IRZ A;  5DUK A;  2MFZ A;  4RM3 A;  3HZJ A;  3MZH A;  1YW8 A;  3JRH A;  1UMQ A;  4A3K J;  1B8I B;  1FP1 D;  4N4O B;  2HDW A;  3NRV A;  3OS0 A;  3K4C A;  2FF4 A;  1J7K A;  4OOI A;  4RB0 A;  2R7U A;  3B6A A;  3WE3 A;  5K1Y A;  1I50 J;  4JYK A;  1X3W B;  2HYF A;  3FXK A;  1KON A;  1ZGA A;  4HQE A;  2IBD A;  2V79 A;  4BNC A;  1SFX A;  1V54 H;  3EUH C;  4G6Q A;  2JWT A;  2KLO A;  4M72 A;  2KIF A;  3RPU A;  1P4A A;  4WF2 A;  3OR1 C;  4CCO A;  1X3Z B;  1YQA A;  1YJ9 I;  4FX4 A;  5FO5 A;  3ERE D;  3JTH A;  3DEW A;  1QHG A;  3B02 A;  3KCC A;  4IPA A;  3QOE A;  3JRD A;  5L3E A;  2LYC A;  1X1C A;  3CMY A;  2XUB A;  3GFL A;  5HS7 A;  3SZT A;  1LE8 B;  4I01 A;  1SD4 A;  3OS2 A;  2QVO A;  3DCF A;  3DQV C;  3K4K A;  5ICG A;  4PFP A;  4ENN A;  3E5U A;  5GTH C;  1W1W E;  2PFB A;  2GM4 A;  3MN2 A;  3M7G A;  4IRH A;  4IOC F;  3RKQ A;  2VC0 A;  3CDI A;  3LQR A;  1MKM A;  2FMY A;  1F43 A;  1Y6I A;  3BP8 A;  5BNG A;  4UY8 I;  1LE8 A;  4D5F A;  5FLX Z;  1BL0 A;  2GAU A;  2NVY J;  4WXD A;  2F5D A;  1PUF B;  3HG9 A;  1MND A;  3D1N I;  1XN7 A;  4IHX A;  4FTH A;  2PEX A;  3C2G A;  4LLL A;  3BR6 A;  1V55 H;  4RGR A;  1DP3 A;  2EBI A;  3VOD A;  1YFH A;  2A07 F;  3GXO A;  3B73 A;  5HS8 A;  2DFF A;  4YFK F;  3LA3 A;  4WCG A;  3FKJ A;  2HFH A;  1NG6 A;  3GTQ J;  4E7K A;  2VXZ A;  4BQO A;  2V7F A;  2W7N A;  1KYW A;  5BS6 A;  2XAH A;  3S16 J;  2DLL A;  3ZOB A;  4JX4 A;  3JAM Z;  4P9U A;  5BPD A;  2IS6 A;  3HPG A;  1HDP A;  1OFC X;  3PSI A;  3C2H A;  3CC4 I;  4GYG A;  4A0X A;  3RKX A;  1OCZ H;  1R49 A;  1Z6R A;  2DMT A;  1JUP A;  3ABL H;  2DXI A;  1DGR M;  2HQA A;  2XB5 A;  3K4L A;  2VT3 A;  2CFX A;  4XLC A;  3L2V A;  1UHS A;  5CVU A;  2EPF A;  2LK2 A;  1EH6 A;  2JUC A;  2CSO A;  1IDZ A;  1TTY A;  1K4S A;  4BY7 J;  1VQO I;  2GOX B;  2LBF A;  1IV6 A;  2Z9O A;  4EGY A;  3EUK L;  3P9I A;  2VIX A;  3MFK A;  1FEX A;  4C30 A;  1H9T A;  1R00 A;  2ID6 A;  3OS1 A;  5LHH A;  4UUS B;  2Y0S A;  1XSD A;  1FMV A;  2VOP A;  2D2W A;  1OQY A;  1IC8 A;  3FK7 A;  4BJT A;  5EG0 A;  4B09 A;  2LMD A;  2JSC A;  3CUQ B;  3OYI A;  3JRC A;  3KP5 A;  1AWC A;  1W5T A;  4CA0 A;  4H4K C;  2P0W A;  3SEZ A;  4HA8 A;  1HOM A;  2LOO A;  1Y8Q B;  1A31 A;  2DOF A;  2DBB A;  1D1C A;  5J1R A;  2LY2 A;  1O3T A;  3GFM A;  2QSH X;  3GLX A;  4PJN A;  4IL6 C;  2MH2 A;  4Z6Y A;  1H8A C;  3ECH A;  4EMS A;  2CQX A;  4UV8 A;  4ESF A;  1KQ9 A;  2AXL A;  1S72 I;  4FT8 A;  3IP4 B;  4V2G A;  4M9Z A;  5ED4 A;  3PNY A;  1MDM B;  3NAR A;  5E3M A;  1J59 A;  2R7T A;  3W2V A;  4UUT A;  5ICE A;  1U5T C;  3A0B C;  1B8I A;  1P7J A;  2BW3 B;  2OUM A;  2E1N A;  5DV5 A;  2DA1 A;  4XMY A;  4CZZ A;  4QPO A;  1ZR4 A;  3MKL A;  4L9T A;  1OMI A;  2HQR A;  1SFK A;  1Z9C A;  2IS4 A;  5CYV A;  3TO6 A;  1IRF A;  2VC1 A;  1KU2 A;  2DA6 A;  4EJW A;  4JP0 A;  4XLH A;  1MSF C;  4PZJ A;  2F4I A;  1XSX A;  4IOA F;  4DBQ A;  3DWL E;  2RAE A;  1X1P A;  2XDV A;  3JR9 A;  2DW4 A;  3WG9 A;  2XPU A;  5IY5 H;  2NS0 A;  4X6A J;  2VKD A;  2FU4 A;  5TGT A;  3E5X A;  2MW8 A;  4NBQ A;  3F9K A;  2H8R A;  1IRG A;  2C6Y A;  3DLA A;  1IDY A;  3SHF A;  2RNG A;  1OCC H;  3K9T A;  3M1C A;  4I0B A;  3I56 I;  1G59 A;  3H3V K;  1MBG A;  2W4S A;  3KZY A;  2L0K A;  3LOC A;  1L3L A;  3L09 A;  2IAI A;  2ESH A;  2XF6 A;  1YJN I;  4A5N A;  1VQN I;  4A12 A;  3ZXS A;  4BE0 A;  3ZCO A;  2EZH A;  1HF0 A;  2BVL A;  5BPI A;  2K85 A;  2R7Z J;  5EYR A;  3N97 A;  1LNW A;  2R7S A;  2NVT J;  3OYH A;  1X4O A;  5DCF A;  4PUS A;  4LGW A;  3IAM 2;  4F92 B;  3OWT A;  1SEU A;  4AUX A;  3Q0W A;  2VBY A;  1D5Y A;  3IWF A;  4C2M J;  1D1A A;  3C18 A;  2EIM H;  3ABK H;  3LL7 A;  1MDM A;  1R4M B;  4U7D A;  4BQA A;  5D6E A;  3QRF F;  2QM3 A;  3HUG A;  2ME6 A;  3PQJ A;  2L02 A;  1CF7 B;  4C2U A;  2WV0 A;  3DXJ F;  1W36 C;  1BA5 A;  2E35 A;  1TT5 B;  2K40 A;  1IW7 F;  4AIH A;  3J80 Z;  3MVP A;  2R7X A;  2A68 F;  1PYV A;  5K5O A;  4I99 C;  3A01 A;  4QPQ A;  1HBX G;  4A6D A;  2AO9 A;  2HKX A;  3S2H J;  2HNH A;  3GTP J;  3QYF A;  1I1S A;  2W82 A;  4BGD A;  3NAU A;  1P4X A;  3JW4 A;  1TT0 A;  4L0Y B;  3G71 I;  2ISZ A;  1S7A A;  4I0A A;  4L5I A;  2WV1 A;  2HDC A;  3WU2 C;  3BPX A;  2W85 A;  4JQF A;  5F0F A;  5EDN A;  5A2Q Z;  3DF8 A;  2WB1 A;  1KQ0 A;  3LSH A;  5H6Q A;  1R7J A;  1D1B A;  1LFB A;  2JPC A;  3S93 A;  2DMQ A;  3ONQ A;  2YS9 A;  2FOW A;  5M3M J;  5LHI A;  1H89 C;  3KP7 A;  4D7M A;  3BG9 A;  3W6J B;  4RAF A;  4G12 A;  1JKP C;  2LG4 A;  3R0J A;  4UVC A;  4XQF A;  1FIA A;  1X19 A;  2O0Y A;  2CV0 A;  2A5Y B;  1EH8 A;  4Y3O A;  1O3Q A;  1IN8 A;  1QQI A;  2PMU A;  3H5R A;  4ESJ A;  4A3G J;  4B48 A;  1LFU P;  2OTJ I;  1IV8 A;  2WAE A;  3ERM A;  3IKV A;  3WOD F;  2BZT A;  3SXY A;  1I1G A;  2M3A A;  2JA6 J;  3ULQ B;  4F55 A;  2XHK A;  2J5P A;  1K61 A;  4ZYH A;  2W25 A;  2ESN A;  2H09 A;  5EEG A;  2N8G A;  4HF2 A;  1BI2 A;  4OIN F;  2GBY A;  1ETK A;  2V9V A;  4QSH A;  1JT0 A;  1JKQ C;  2KJC A;  3LWF A;  2RQP A;  3HL2 A;  3KZI C;  2EFN A;  1JI8 A;  4N4N B;  4OAY A;  3E6C C;  1ETV A;  1K6Y A;  2E60 A;  3L1P A;  1P92 A;  3Q3S A;  3QU6 A;  3JRI A;  1UB9 A;  4IHV A;  2JT1 A;  1EH7 A;  1BJA A;  5J4Y A;  4MTE A;  2EFO A;  1YO5 C;  3F23 A;  5EEH A;  3WTU C;  1S29 A;  3EUH A;  2O8X A;  5HLG A;  2VQG A;  3TMO A;  3S1M J;  5TIS C;  1YJW I;  2P6S A;  1VQ6 I;  2Y9Y A;  2QWW A;  5HS9 A;  4BJ5 C;  4KDP A;  4G9Y A;  2CW0 F;  2ZSH B;  4CZC A;  4O3M A;  5TJJ A;  2BE5 F;  5K5Q A;  4AD9 A;  2QEX I;  2R7V A;  2HXI A;  1X4P A;  4XN3 A;  1CQT A;  2LRE A;  2GXG A;  5CVR A;  5IP7 J;  1VI0 A;  2KDO A;  4ZZL A;  2R7D A;  1S8N A;  3RKY A;  2WAF A;  4Y4R A;  3ZP5 A;  3OIQ A;  2KRF A;  3MWM A;  5CVI A;  3CP2 A;  2O8K A;  3FIS A;  1W0U A;  3HGY A;  5E3N A;  1G8X A;  5E18 F;  1EV7 A;  3AG1 H;  4PJJ A;  1TWC J;  1F1Z A;  2F5E A;  1ZLK A;  2B63 J;  4YG2 F;  1SVM A;  1RKW A;  1TC3 C;  1X2M A;  1WJD A;  3I58 A;  4J01 A;  3QOD A;  3ISP A;  2QKM B;  3QYB A;  5TRD A;  3F3X A;  1Z91 A;  3ZMS A;  2OQR A;  3LSR A;  5DDG A;  3JSO A;  2LF7 A;  3MEX A;  4HAM A;  2YX7 A;  2CO5 A;  2RV8 A;  5ERI A;  4S04 A;  4UV9 A;  4UB8 C;  4MGR A;  3IV5 A; 
#chains in the Genus database with same CATH homology
 4PDK A;  3E97 A;  4OMY A;  4FX0 A;  3FF5 A;  3R60 A;  1O3S A;  1RUO A;  1WSU A;  3CLO A;  5JI6 A;  5L3C A;  2STT A;  1OKR A;  3HYI A;  5D5X B;  1R1V A;  3K1N A;  3HSE A;  2VT2 A;  4HF0 A;  2IW5 A;  1BIA A;  3I0T A;  4BH9 A;  5J6X A;  2STW A;  3F8C A;  2K27 A;  4UVB A;  1ZG3 A;  5HLH A;  2ZO4 A;  4RGX A;  3AAF A;  1RZ4 A;  2QEN A;  1DUX C;  2R3S A;  4BHP A;  4WXH A;  3KP3 A;  2F5C A;  1ZN2 A;  2M87 A;  1UST A;  2G7H A;  5E1Z B;  4R8H A;  2OBP A;  1REP C;  4KYW A;  4ESB A;  5HVQ C;  4ZH4 F;  1R36 A;  4IRI A;  5D5V B;  1FSH A;  1MD0 A;  2MC3 A;  1IN4 A;  2V6C A;  5DUI A;  1SFU A;  2O3F A;  4M6X A;  4PCQ A;  1O7F A;  4A6E A;  2IRF G;  1XSV A;  1Z6T A;  1IAW A;  2FRH A;  3ECO A;  1ZYR F;  1VTN C;  2UWM A;  4IJA A;  2B0L A;  1ZG5 A;  4K2E A;  2GA1 A;  1FYM A;  4BHC A;  4U88 A;  4YFN F;  3WGI A;  3CUQ C;  1HKQ A;  1TBX A;  3SQN A;  2XIG A;  4A2U A;  4RS8 A;  4RB3 C;  2XRO A;  4XSX F;  2HS5 A;  1U8R A;  4M9X A;  1IXC A;  1UHW A;  2XAQ A;  4YII A;  1CF7 A;  5BMZ A;  2KIM A;  3F6O A;  2ZFW A;  3T0Y A;  1QZZ A;  4RGS A;  4HOB A;  1ZRF A;  2K86 A;  4IHS A;  4HDV A;  1SMT A;  1TQM A;  2K7L A;  2NNN A;  3K1P A;  1Y0U A;  4RAY A;  3EQL F;  4EJT A;  3RJP A;  4ZZD A;  5HDG A;  1J9I A;  3FZV A;  1ZRD A;  4MEX F;  3DV8 A;  4LLG F;  1KU7 A;  3HRT A;  3V7S A;  5CVV A;  4G94 A;  4HLY A;  2H27 A;  4I98 B;  4LMY A;  3T1B A;  4EM1 A;  5ICC A;  4EQQ A;  4UUV A;  2W24 A;  1MJA A;  1XCB A;  2EWN A;  3LFK A;  2DO7 A;  3BJ6 A;  3KLN A;  2QZ8 A;  2ZJ2 A;  5ILS A;  4EVI A;  1P4W A;  1G3Y A;  1I6X A;  4P9F A;  5DCM B;  1B59 A;  5IT3 A;  4AIJ A;  1FY7 A;  1XB4 A;  2J5O A;  2K02 A;  3SZP A;  2W84 A;  2Q8K A;  3GVA A;  1H0M A;  4LG0 B;  1LQ1 A;  1YTY A;  3L00 A;  3CUO A;  4LD5 A;  4LB5 A;  3LA2 A;  3R4K A;  3TDZ C;  3QOP A;  2IA2 A;  3M8F A;  1HQC A;  2HQN A;  3QU3 A;  1D5V A;  4HBL A;  3BPV A;  2WTE A;  1RUN A;  2Z99 A;  2P5K A;  4BAY A;  1O3R A;  1QGP A;  1FC3 A;  1FT9 A;  2GIV A;  4L18 B;  4EJU A;  4KMU X;  3RYR A;  4QWQ A;  1V4R A;  2IPQ X;  2V1U A;  2FML A;  2CGP A;  4A5M A;  2FNP A;  4KFC A;  3EDP A;  4L0Z B;  2L3D A;  3CDH A;  3KZZ A;  2VBX A;  1HW2 A;  3V4G A;  4A0Z A;  1XMA A;  4Q48 A;  2M30 A;  1T2K A;  3TO7 A;  4GO1 A;  3RI4 A;  6PAX A;  3WGH A;  2HTJ A;  4R1H A;  1YYV A;  4G6D A;  1TNS A;  4AIK A;  1XDU A;  1TQP A;  5DD4 A;  1JGS A;  1J5Y A;  3IRR A;  3PQK A;  1PUE E;  1HKT A;  2M8E A;  2ETH A;  1R5G A;  1LEB A;  1C0W A;  1FWZ A;  5D6F A;  2DAO A;  3COA C;  2FBH A;  4GCV A;  3F6V A;  3RYP A;  1HXD A;  3L9F A;  4HF1 A;  5D4R A;  2ZCW A;  1I5Z A;  3KLO A;  1OYY A;  4MQV A;  2QLZ A;  3QP5 A;  3V8J A;  1KA8 A;  3TDU C;  5L3G A;  5H6R A;  2OA4 A;  4CDG A;  3EET A;  5D8L B;  1FLI A;  2OQG A;  4ENJ A;  3GZ6 A;  2O61 A;  1F4K A;  1R58 A;  2Y75 A;  2EK5 A;  3TOA A;  1USS A;  1MZB A;  3LAJ A;  3L7W A;  4TV7 A;  4XSZ F;  1G4D A;  2BV6 A;  5H20 A;  1L0O C;  4KT5 C;  4HX7 A;  4OU0 A;  2YX4 A;  3M9A A;  3KP2 A;  3HRM A;  2QQA A;  5D5W B;  1Z1D A;  2R7F A;  3W6K B;  3HSF A;  5LBQ A;  4NB5 A;  4E70 A;  2CQK A;  2ZXJ A;  5FD5 A;  3GYH X;  4KIB A;  2PG4 A;  2X0L A;  2NAZ A;  4KIG A;  3ROU A;  5L3F A;  4HX8 A;  3H92 A;  3E6D A;  4Y15 A;  4ENM A;  5LHG A;  3LAP A;  2G9W A;  2YU3 A;  3HRU A;  3ZN0 A;  4Q5S F;  1QO0 D;  3CTA A;  5AIQ A;  1BBY A;  2K4B A;  4GXO A;  2NRA C;  4Y13 A;  1XGN A;  3DFG A;  3LA7 A;  5CVJ A;  4M71 A;  2P6T A;  5ICF A;  1ONV A;  4WK8 F;  4LLN A;  5HOO A;  1BI1 A;  3WTZ A;  1FOK A;  1XMK A;  1XDS A;  1W5S A;  2DU9 A;  1Z05 A;  1W4M A;  3CUQ A;  3NEU A;  2IA0 A;  2LSO A;  1K78 A;  1R23 A;  1WI9 A;  4MTD A;  2E1C A;  1D8K A;  1KYZ A;  4UVA A;  5D5U B;  4IXA A;  2WC2 A;  5E1X A;  1WWX A;  1FBQ A;  3QPH A;  1K78 B;  3BZ6 A;  2JPB A;  1R1U A;  3TOB A;  3RDI A;  1T38 A;  2FQ3 A;  1W7P D;  3GO5 A;  2LKP A;  3RKW A;  4S05 A;  2D1H A;  2MA3 A;  1JXS A;  1G3T A;  5E8I A;  2RKH A;  5LGT A;  1YW7 A;  3ELK A;  2ZME B;  5BOX A;  2BEO A;  2XAS A;  2UZK A;  1U5T A;  4I7H A;  2E7X A;  2UXX A;  4XLP F;  3I71 A;  4PGG A;  4LFU A;  2E7W A;  5F1R A;  4M74 A;  5HLI A;  2EFW A;  1K7A A;  3I53 A;  1XGS A;  1SD7 A;  3GEZ A;  1HSJ A;  3TO9 A;  1FX7 A;  3GX4 X;  3DEU A;  1BM9 A;  2A3S A;  1QBJ A;  2CWE A;  3FXU A;  3U9G A;  4LK0 F;  5E20 A;  3U1D A;  2IVM A;  3WTX C;  4EJO A;  4ZYE A;  3IC7 A;  1JHF A;  2XAJ A;  1FNN A;  2XV4 S;  2PBI A;  4LB6 B;  1ZLJ A;  5JVT A;  1ZG1 A;  3U2R A;  3E6M A;  1BOA A;  3T8T A;  2G7U A;  4ASN A;  2Q2E A;  3F21 A;  3G3Z A;  1BN5 A;  2FSW A;  3KEO A;  3WTY C;  2EV5 A;  5ILV A;  4U0W A;  1BIB A;  3PFI A;  3EYI A;  2JTV A;  2Z3Y A;  3VFZ A;  2ZNY A;  1QPM A;  3ZMD A;  1UHM A;  3BRO A;  1J0R A;  2RC4 A;  1YLF A;  4PGH A;  2OZU A;  3R6S A;  5AIP A;  1GVJ A;  2PJP A;  3ZMV A;  3FHZ A;  3JAM K;  1FBU A;  1MJB A;  5F64 A;  1MGT A;  4HQM A;  1ODD A;  2JRT A;  4HYE A;  3WGG A;  2M5W A;  1LJ9 A;  3OOP A;  3Q9S A;  2FBI A;  3J81 Z;  5DD8 A;  3HHG A;  3CO7 C;  3K2Z A;  3P9K A;  4I02 A;  2XKO A;  4LG0 A;  1Q1H A;  4RGU A;  5J8F A;  4CIC A;  1OYI A;  2H94 A;  4LJZ F;  1TQI A;  3FXR A;  3WE2 A;  5D8K B;  1ZAO A;  2F5F A;  1HKS A;  3E6B A;  5KVR A;  4U0Y A;  4I09 A;  1G6N A;  4Y17 A;  2YPR A;  1BI3 A;  2CYY A;  2IT0 A;  1DP7 P;  4KMF A;  1O57 A;  2VON A;  2VN2 A;  3P7N A;  2EJR A;  1LDJ A;  2A6E F;  3O6B B;  2FEZ A;  2VE9 A;  3VOE A;  5LGU A;  3KET A;  3E5Q A;  3ZMZ A;  4F7Z A;  4CHU A;  3FM3 A;  1R1T A;  3I59 B;  1IUY A;  3KP4 A;  1WQ2 A;  2BBY A;  5DEQ A;  1R5H A;  1PP8 F;  4XLN F;  3JTG A;  3VEP A;  3E3V A;  2ADU A;  4UHT A;  1ZH5 A;  2HOE A;  5LLQ A;  2A6H F;  4L9V A;  3K69 A;  5BQT A;  2EA4 A;  4IF4 A;  2EV6 A;  3OV8 A;  2TDX A;  1OYW A;  2FXA A;  1E17 A;  3MAJ A;  2VE8 A;  3ZMT A;  3GWZ A;  4ZYD A;  3RPQ A;  3O3K A;  2RDP A;  2VBW A;  1RNL A;  1B6A A;  2O6G E;  1ZAR A;  2XAG A;  5IT9 Z;  2L54 A;  5FFX A;  3D5L A;  3FMQ A;  1LEA A;  2IJL A;  2FA5 A;  4EGZ A;  3F8M A;  3BOQ A;  5CLS A;  5J8C A;  3J80 K;  3M8E A;  4XBF A;  1U2W A;  5ILU A;  2DQL A;  2DQR A;  3GUD A;  1JE8 A;  3J81 K;  3O2P E;  4JK1 X;  1OR7 A;  3KFW X;  2P4W A;  1T39 A;  2P5L C;  4BYY A;  2BGC A;  2HZT A;  2RNJ A;  4OMZ A;  3BJO A;  2NYX A;  5A2Q K;  1LB2 A;  2VBZ A;  3HOS A;  1W7P A;  1S7O A;  1YW9 A;  1T0F A;  4N9H A;  4MNU A;  1KGS A;  1NHA A;  1J2X A;  3F8F A;  4KN4 X;  1J75 A;  2L01 A;  4CYD A;  1ZHF A;  4HZF A;  2XKP A;  4WWC A;  1P2F A;  3S2W A;  3L2C A;  4HW0 A;  4KIC A;  1DPR A;  2KIU A;  2KKO A;  3FX3 A;  1JHH A;  4AWX B;  1SD5 A;  2QQB A;  3TQN A;  3GW2 A;  3C7J A;  1DPU A;  1U3E M;  3I64 A;  4EJV A;  2GXB A;  4DQ2 A;  3WU0 A;  3GZ5 A;  2FOK A;  5L3B A;  3JSP A;  1D3Y A;  1PP7 U;  4HX4 A;  1E2X A;  1I27 A;  2GA2 A;  4M73 A;  4CGZ A;  3TGN A;  4YIF A;  1U5T B;  4EM0 B;  2IP2 A;  4M9S A;  2CG4 A;  2Z33 A;  4O5V A;  5JHU A;  1QZY A;  3ZPL A;  1LDD A;  1S6L A;  5HDK A;  1UCR A;  1BI0 A;  1FP2 A;  1T6S A;  3KEQ A;  2DTR A;  1AOY A;  2EA2 A;  4N9I A;  1SD6 A;  1YS7 A;  5IT9 K;  3J7A O;  4AVP A;  2W57 A;  3ZMU A;  4Z2Y A;  4ZYG A;  2GQQ A;  3Q9V A;  2OZ6 A;  5LEK A;  4P5O A;  2A61 A;  5AON A;  3WTS C;  5E8G A;  1K6O A;  4U0V A;  2LNB A;  1IXS B;  1U78 A;  2VOD A;  2A69 F;  3F8B A;  2YR2 A;  3K1M A;  4GGG A;  4M6Y A;  2PI0 A;  2MBF A;  5FD6 A;  4N0B A;  2HEO A;  1IXR C;  3KP6 A;  3HIF A;  3M1E A;  1ULY A;  1F9N A;  3H3Z A;  5L3D A;  4KA4 A;  1GHC A;  5HDN A;  2Y48 A;  3DP7 A;  2PQ8 A;  3RTR A;  3FM5 A;  1K79 A;  2MH9 A;  2NNY A;  2COM A;  2QBY A;  1LVA A;  5DYM A;  3P9C A;  2ISY A;  3R61 A;  2ZKZ A;  1KU3 A;  3BJA A;  3GFJ A;  1WKM A;  1IN5 A;  4HV6 A;  1UFM A;  3ABU A;  2M45 A;  5LEJ A;  2KJB A;  3WTV C;  4CO8 A;  3ZQ7 A;  3C1D A;  1IN7 A;  3LST A;  2PMH A;  4YFX F;  2RVC A;  2FE3 A;  2P5V A;  2QYO A;  3CO6 C;  1RIO H;  4I2O A;  3MCZ A;  3G73 A;  2D1V A;  4NQW A;  5JFR A;  1XGO A;  4L9N A;  2XRN A;  3SFZ A;  4ON0 A;  1D8J A;  1FSE A;  3ML6 A;  1RI7 A;  1ZGJ A;  3BDD A;  3F8N A;  2UXN A;  1HST A;  1YIO A;  2QUF A;  4G7O F;  3V7C A;  4O6J A;  1R22 A;  2QBY B;  3TKY A;  3IRQ A;  4IHT A;  2V1X A;  1YG2 A;  4UXN A;  3EYY A;  3MZY A;  3ZN1 A;  3F72 A;  2F2E A;  3FMS A;  3GF2 A;  4P55 A;  2DI3 A;  3WU1 B;  1WRJ A;  4BHB A;  2XGX A;  3I59 A;  2ACJ A;  4JBA A;  1B4A A;  2AS5 F;  1FPQ A;  2HTS A;  5E1W A;  3V8L A;  2MLG A;  4EV0 A;  1X3U A;  2DPD A;  3LQQ A;  5FGM A;  3RIR A;  1HW1 A;  3CJN A;  4ENK A;  2K4J A;  2RN7 A;  4OIO F;  1IN6 A;  2HKO A;  3WTW C;  2L4A A;  1U6G A;  1BC8 C;  2FBK A;  3DPT A;  2O03 A;  4KN7 X;  3K0L A;  2DPU A;  2P7C B;  4OIP F;  2DFI A;  1XGM A;  3N4M A;  4WXC A;  1FYL A;  5KK1 A;  4P96 A;  2Y0M A;  1ON2 A;  1XCV A;  1H9G A;  3IHU A;  4A0Y A;  4MEY F;  4FHT A;  3V8K A;  4Q47 A;  1KQ8 A;  2GWR A;  3I5U A;  3T5X A;  5LGN A;  3C3W A;  3WTT C;  3HHH A;  4XRF A;  4OIR F;  1ON1 A;  1TNT A;  1STZ A;  5K5R A;  3ABT A;  1QNT A;  3KE2 A;  4R79 A;  2OD5 A;  2P8T A;  1MJ9 A;  1SAX A;  3QP6 A;  1OPC A;  5E17 F;  4U7B A;  3BY6 A;  4RB1 A;  2ZNZ A;  4CXF A;  2HYG D;  3HRS A;  3MQ0 A;  4Q4Z F;  4D0P A;  4G7H F;  4G8X A;  3Q5F A;  3FMR A;  2D45 A;  1G3W A;  1W7P B;  2ZME A;  1TW3 A;  2JZY A;  2PN6 A;  4G7Z F;  2EFP A;  5LRR A;  3H3U A;  3HSR A;  1TLH B;  1HW5 A;  2XVC A;  2EFQ A;  3BWG A;  4L9J A;  3FWE A;  3FXQ A;  2LF8 A;  1SFE A;  2HWV A;  1PDN C;  1A04 A;  1T98 A;  1XD7 A;  2X4H A;  2EB7 A;  3I4P A;  2IA1 A;  1IF1 A;  2LDU A;  1B9N A;  1CGP A;  2P7V B;  2RGV A;  4ETS A;  4LK1 F;  4RAZ A;  3HTU A;  2DK5 A;  4HLX A;  4MHG A;  3HOT A;  1SMY F;  3VB2 A;  2HR3 A;  3DPL C;  3IL2 A;  4RB2 C;  2XAF A;  1F5T A;  4KNY A;  2MLK A;  4HV5 A;  3V7R A;  4L5J A;  3IWZ A;  1KU9 A;  2DT5 A;  1V3F A;  1DDN A;  5FFZ A;  3HTS B;  5F6F A;  4DNC A;  4QLC U;  2Z5U A;  3NQO A;  3QAH A;  5D4S A;  4GYI A;  4UNO A;  2EV0 A;  4H0E A;  1G3S A;  4KIF A;  1LDK B;  3I54 A;  2L4M A;  2QQ9 A;  1ZRC A;  1B9M A;  4BXU A;  2DK8 A;  3GFI A;  4IVN A;  1FZP B;  2HGC A;  5FLX K;  2MD5 A;  5DCM A;  4IRG A;  2OU2 A;  2V1D A;  2H6C A;  1GXQ A;  3F22 A;  2ELH A;  4WX9 A;  4OIQ F;  1ZRE A;  1BC7 C;  4HDU A;  2GZW A;  5CJ9 A;  2YSR A;  5FB2 A;  2M1B A;  2PLY A;  1S3J A;  3R0A A;  5JR3 A;  1Z7U A;  1P6R A;  2FNA A;  4KUM A;  3IKT A;  4MQ9 F;  2OAZ A;  1O7L A;  1B1B A;  1FYK A;  2BYV E;  2Q0O A;  3T8R A;  3DKW A;  1YS6 A;  3REO A;  3QPT A;  1TW2 A;  3D0S A;  4NHJ A;  1FBS A;  2VOO A;  1IZ1 A;  4B8X A;  5LRS A;  1GXP A;  4EM2 A;  2ZBK A;  2H6B A;  2WWY A;  5DUK A;  3MZH A;  1YW8 A;  1FP1 D;  3NRV A;  2FF4 A;  1J7K A;  4OOI A;  4RB0 A;  3WE3 A;  5K1Y A;  2HYF A;  1ZGA A;  4HQE A;  2V79 A;  4BNC A;  1SFX A;  4G6Q A;  4M72 A;  3RPU A;  2KIF A;  1P4A A;  4WF2 A;  1YQA A;  4FX4 A;  5FO5 A;  3ERE D;  3JTH A;  3B02 A;  3KCC A;  4IPA A;  5L3E A;  2XUB A;  3GFL A;  5HS7 A;  3SZT A;  4I01 A;  1SD4 A;  2QVO A;  3DQV C;  5ICG A;  4ENN A;  3E5U A;  2PFB A;  4IRH A;  3M7G A;  2VC0 A;  3LQR A;  1MKM A;  2FMY A;  3BP8 A;  5FLX Z;  2GAU A;  4WXD A;  2F5D A;  1XN7 A;  2PEX A;  4LLL A;  4RGR A;  3VOD A;  1YFH A;  2A07 F;  3GXO A;  3B73 A;  5HS8 A;  4YFK F;  3LA3 A;  4WCG A;  2HFH A;  2VXZ A;  1KYW A;  5BS6 A;  2XAH A;  2DLL A;  3JAM Z;  4P9U A;  5BPD A;  4GYG A;  4A0X A;  3RKX A;  1Z6R A;  2VT3 A;  2CFX A;  5CVU A;  1EH6 A;  2CSO A;  1TTY A;  2Z9O A;  4EGY A;  3P9I A;  3MFK A;  1H9T A;  1R00 A;  5LHH A;  1XSD A;  2VOP A;  2D2W A;  4B09 A;  2JSC A;  3CUQ B;  3KP5 A;  1AWC A;  1W5T A;  4HA8 A;  2DBB A;  1O3T A;  3GFM A;  3GLX A;  2MH2 A;  3ECH A;  4EMS A;  4UV8 A;  4ESF A;  1KQ9 A;  2AXL A;  4FT8 A;  4M9Z A;  5ED4 A;  1MDM B;  1J59 A;  5ICE A;  1U5T C;  2E1N A;  5DV5 A;  4CZZ A;  4L9T A;  1OMI A;  2HQR A;  1Z9C A;  5CYV A;  3TO6 A;  1IRF A;  2VC1 A;  1KU2 A;  4EJW A;  4PZJ A;  1XSX A;  2DW4 A;  3WG9 A;  2NS0 A;  2FU4 A;  3E5X A;  1IRG A;  2C6Y A;  3SHF A;  3K9T A;  4I0B A;  3KZY A;  1L3L A;  3L09 A;  2ESH A;  4A5N A;  4A12 A;  5BPI A;  3N97 A;  1LNW A;  5DCF A;  4LGW A;  2VBY A;  3IWF A;  3C18 A;  1MDM A;  4U7D A;  4BQA A;  5D6E A;  3QRF F;  2QM3 A;  3HUG A;  3PQJ A;  2L02 A;  1CF7 B;  2WV0 A;  3DXJ F;  1IW7 F;  4AIH A;  3J80 Z;  2A68 F;  5K5O A;  1HBX G;  4A6D A;  2HKX A;  1I1S A;  1P4X A;  3JW4 A;  4L0Y B;  2ISZ A;  1S7A A;  4I0A A;  4L5I A;  2HDC A;  3BPX A;  2W85 A;  4JQF A;  5A2Q Z;  3DF8 A;  1KQ0 A;  5H6Q A;  1R7J A;  2JPC A;  5LHI A;  3KP7 A;  3W6J B;  4UVC A;  3R0J A;  2O0Y A;  2A5Y B;  1EH8 A;  1O3Q A;  1IN8 A;  1QQI A;  2PMU A;  4ESJ A;  3IKV A;  3WOD F;  3SXY A;  1I1G A;  3ULQ B;  2XHK A;  2J5P A;  4ZYH A;  2W25 A;  2ESN A;  2H09 A;  5EEG A;  4HF2 A;  1BI2 A;  4OIN F;  2V9V A;  2KJC A;  3LWF A;  2RQP A;  2EFN A;  3E6C C;  1P92 A;  3QU6 A;  1UB9 A;  2JT1 A;  1EH7 A;  1BJA A;  4MTE A;  2EFO A;  1YO5 C;  3F23 A;  5EEH A;  3WTU C;  1S29 A;  3EUH A;  2O8X A;  5HLG A;  2P6S A;  2QWW A;  5HS9 A;  4KDP A;  4G9Y A;  2CW0 F;  4O3M A;  5TJJ A;  2BE5 F;  5K5Q A;  4AD9 A;  2GXG A;  5CVR A;  4ZZL A;  2R7D A;  1S8N A;  3RKY A;  3ZP5 A;  2KRF A;  3MWM A;  5CVI A;  5E18 F;  1EV7 A;  1F1Z A;  2F5E A;  1ZLK A;  4YG2 F;  3I58 A;  3ISP A;  5TRD A;  3F3X A;  1Z91 A;  3ZMS A;  2OQR A;  5DDG A;  3JSO A;  2LF7 A;  3MEX A;  4HAM A;  2YX7 A;  2CO5 A;  2RV8 A;  5ERI A;  4S04 A;  4UV9 A;  4MGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...