6PAXA

Crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 26 NUCLEOTIDE DNA
publication title Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
pubmed rcsb
source organism Homo sapiens
total genus 39
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1999-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 6paxA02
1HSTA 4I09A 3ELKA 4I98B 2V9VA 3BP8A 2F5FA 1DDNA 1OPCA 2MA3A 3KZZA 5KK1A 1KU7A 5J6XA 1KU2A 3R4KA 1UHWA 4IJAA 2F2EA 2IA0A 3TOBA 2M8EA 3P7NA 2MC3A 3GLXA 3MZHA 1RUOA 1PP8F 2KJBA 1S7AA 1R1UA 1R5GA 3WTVC 2JTVA 2DU9A 1S3JA 3EYIA 1J9IA 4UHTA 1G3WA 2W57A 5BOXA 1QNTA 5FO5A 1KA8A 3HHHA 2PJPA 5E1XA 2E1CA 1SD7A 3HRTA 1HQCA 1BI2A 4OINF 2QQ9A 4G94A 3K1MA 1ON2A 2FBIA 2XAJA 3CLOA 2OQRA 2Z9OA 2BE5F 1HBXG 3DQVC 2L02A 2B0LA 1HKSA 2COMA 5K5QA 4O3MA 2VODA 2QVOA 2RNJA 3TOAA 2VONA 4L0ZB 2KIFA 1TBXA 1R7JA 4M71A 3TKYA 2NYXA 5DEQA 4L9NA 5FD5A 4WXCA 4I02A 3WG9A 3GEZA 4EM0B 1FSEA 5DV5A 1QZZA 3U9GA 1Z6RA 3TO7A 1R00A 1Q1HA 2AXLA 3DP7A 3J81K 3SXYA 4A5NA 1XCVA 1U5TA 3ZMDA 1YYVA 1SFEA 4KUMA 1USTA 1U5TC 3I59A 1REPC 3P9IA 3MWMA 3TO6A 1JHHA 3I64A 2P6TA 2DQRA 2LNBA 2EK5A 2PI0A 4XRFA 1MKMA 2HFHA 4K2EA 3RYRA 2YR2A 1O57A 4IHSA 3QPHA 1IN4A 4IHTA 1TLHB 1R5HA 1FYKA 5EEGA 1LEBA 1U2WA 1FP2A 1D5VA 2XAGA 5A2QZ 2RQPA 5FGMA 3ABTA 3CJNA 4M6XA 4EGYA 5HLGA 1RZ4A 4Q48A 1U8RA 2HQNA 4MGRA 2YPRA 1K6OA 3F3XA 4AIHA 3D0SA 5AIPA 5AIQA 4ENJA 5JFRA 3JSPA 1G4DA 3K69A 4G7OF 1AOYA 2UXNA 3CO7C 4N0BA 4CXFA 3KEOA 3HTUA 1TTYA 3BJ6A 5L3FA 2CG4A 2G7UA 4HLXA 4ESBA 1HKTA 1I6XA 3DKWA 4EM1A 4KN4X 4JK1X 5F64A 1BBYA 3QAHA 4OIPF 1X3UA 2ZNYA 3R60A 5A2QK 2XGXA 5D4RA 4U7DA 3RYPA 2BBYA 2W84A 1IN8A 4I0BA 4L0YB 1Y0UA 2DI3A 4B8XA 4KIFA 2HWVA 1V4RA 3HUGA 5HDNA 4HV6A 3FHZA 1XD7A 4I2OA 5E20A 3N4MA 3W6KB 2IT0A 3V7RA 5BS6A 1R23A 3U1DA 4UUVA 3QP5A 5DUKA 5D5VB 3KZYA 2NNNA 2F5CA 1FBUA 1H9GA 2M45A 2QWWA 3LA7A 4ZH4F 3V8LA 2JSCA 3KCCA 2EV6A 1S29A 4XSXF 5BQTA 2ISZA 2IA1A 4HOBA 4EV0A 3GW2A 2GQQA 5ILSA 3BOQA 1IN6A 4EMSA 1YS6A 2PLYA 2GIVA 3HSEA 1YW9A 4HW0A 4Q47A 4CHUA 1ZAOA 2ISYA 3L9FA 4MEXF 4H0EA 2IJLA 5JHUA 4A5MA 1ZHFA 3RKWA 4KFCA 3TDZC 4NQWA 1YS7A 1QPMA 4G7HF 3P9KA 4PZJA 3FZVA 2FF4A 3WGHA 3QOPA 1GXQA 1I27A 3ZMVA 3MAJA 1IXCA 2O61A 5FLXZ 1YFHA 3E6MA 3HOSA 4EJOA 4PGGA 5DCMB 2A69F 1J7KA 4YFNF 4RGSA 3IHUA 1DUXC 3WTZA 4QLCU 5E1ZB 3BJAA 2YU3A 4PGHA 2GXBA 5ICEA 2K86A 3IWZA 4R79A 3T8TA 5BPIA 2XVCA 1JGSA 2VN2A 2BGCA 1I5ZA 1FSHA 2ZKZA 4LMYA 4ZYHA 3SHFA 1F4KA 2O6GE 1TQPA 2YSRA 3QRFF 2Y48A 4RB1A 5HS9A 3BY6A 3G73A 1P4XA 4HA8A 2O3FA 5CVJA 1MD0A 3DXJF 2GZWA 2W24A 3F8MA 1T6SA 3LQQA 1SMYF 2A6EF 1OYYA 1BI0A 1ON1A 5J8CA 1KU9A 2EB7A 2HQRA 3GFIA 2JRTA 4LJZF 1J0RA 1O7LA 2G7HA 3KP7A 3L2CA 2O8XA 2GAUA 2E1NA 3DEUA 4BYYA 1LEAA 1SMTA 4PCQA 2LF7A 4XLNF 3ZMUA 4LD5A 5HDKA 3SFZA 2ZBKA 2HR3A 1IW7F 2WWYA 5LEJA 4IPAA 3RJPA 4I0AA 5FFZA 1BIAA 3HRUA 1J75A 3I58A 2DT5A 2HKOA 3F8FA 2XKPA 3PFIA 3HRSA 5AONA 4MTDA 2JPCA 4FHTA 3Q9VA 1T2KA 1R1TA 3COAC 2KIUA 3V7SA 5LGTA 1R58A 1G3SA 2P5LC 4U7BA 3KFWX 5IT9K 1XMAA 3IKVA 5ILVA 3FXUA 1QBJA 2DK8A 5LBQA 2FA5A 1LJ9A 1DPRA 1GXPA 4RB2C 3CUQB 2P7VB 4R1HA 1P6RA 3WTWC 2ZCWA 2O03A 2QYOA 3E5UA 2DO7A 1BIBA 2ZMEB 1OKRA 3ZP5A 4G7ZF 4CYDA 2LF8A 3E97A 1HW2A 5D5UB 1FLIA 1BN5A 5CVRA 3K1NA 3ISPA 1B59A 4BHBA 2DPUA 4Z2YA 4RGUA 2RKHA 3DPTA 5EEHA 4N9IA 1L0OC 3IL2A 1V3FA 3I5UA 5HLHA 4Q5SF 2FNPA 4L5IA 4GYIA 3LSTA 1BC7C 2P4WA 3GFLA 1ULYA 4U0WA 4NHJA 5CYVA 2XIGA 4LB6B 2YX7A 3F22A 2VBXA 3BPXA 5BMZA 5DCMA 2FBHA 1KQ9A 2HYFA 2J5OA 3ZN0A 4RB3C 3F23A 1ZG3A 2PG4A 3JW4A 3C3WA 2OQGA 4UXNA 3WU1B 4M6YA 4G6QA 2FOKA 2BYVE 3ZQ7A 4HDUA 4L5JA 2CYYA 2A68F 2CFXA 5E18F 4PDKA 1ZGAA 1IXRC 1OYIA 1R22A 2O0YA 4L18B 4M74A 2UXXA 5J8FA 4KDPA 2HDCA 2DW4A 3FM5A 3Q9SA 1KYWA 4MTEA 3M9AA 5E17F 3KP4A 2QBYB 4HX8A 2OZUA 2PEXA 2Y75A 4CO8A 3WE2A 2VBZA 1MJAA 3J7AO 5HOOA 1O3RA 4ON0A 3MCZA 1FT9A 2A6HF 3VEPA 2GA2A 1G3YA 2RVCA 3E6CC 4N9HA 1NHAA 4HYEA 1T98A 2AS5F 3KEQA 1J2XA 2IPQX 2QQBA 1XDUA 2NRAC 1P4AA 4S05A 2ESNA 4NB5A 2MD5A 2ZNZA 5JI6A 1ZRCA 5D8LB 3QU3A 4RS8A 3BWGA 4LFUA 1W5SA 1MZBA 1WI9A 1WSUA 3KLNA 4UVCA 4F7ZA 2V6CA 1A04A 3ZN1A 4GYGA 4QWQA 4OMZA 1K78B 3E3VA 2MLGA 3M1EA 5DCFA 2XASA 5JVTA 3V8KA 3GVAA 2XRNA 4Q4ZF 1Z91A 2FU4A 2VT2A 4GO1A 4LLLA 1JE8A 3BPVA 4RAZA 2XAHA 4G9YA 2H94A 4HF0A 3NQOA 4LG0B 4P9FA 3T1BA 5L3CA 2PQ8A 5D4SA 2C6YA 1FPQA 3C1DA 5D5WB 4BNCA 4M72A 5K5RA 4A0XA 3DFGA 2FSWA 1IZ1A 1HW5A 2VE8A 1XSXA 2P6SA 3CUQA 4A0ZA 3JAMZ 1XGOA 4HF1A 2QZ8A 2FRHA 4ZZDA 3CUQC 1LVAA 1ONVA 4A6DA 1O3TA 1H0MA 2ZMEA 2Z99A 3SZTA 2CO5A 3KP2A 5CVUA 2IW5A 1FZPB 3U2RA 4P5OA 1UCRA 2ESHA 3GO5A 4M9ZA 3EETA 1S7OA 3BJOA 3ZPLA 1HSJA 4I7HA 2ETHA 2V1DA 2A5YB 5DYMA 1RUNA 1B6AA 5HDGA 1P2FA 1W4MA 1H9TA 2G9WA 3I54A 2HTSA 4DNCA 4OOIA 3I4PA 1T0FA 2ZFWA 1ZLJA 4L9VA 4E70A 2H27A 1FNNA 3ZMZA 2GA1A 5DD4A 3K2ZA 4YG2F 2EWNA 5LHIA 3JAMK 4GCVA 3F72A 2VC0A 5LHHA 1UFMA 3LFKA 4CDGA 3GFMA 4YFKF 4R8HA 2X4HA 4AD9A 1ZREA 2DK5A 5K1YA 1YW7A 3C18A 2HEOA 2Y0MA 4U88A 2EV0A 4AVPA 4EQQA 4KA4A 4KYWA 2RN7A 1K79A 2QM3A 2XV4S 2H09A 1S8NA 1TQMA 4OU0A 5H6RA 3VB2A 2WC2A 1UHMA 1XB4A 4BXUA 4UV9A 4AWXB 1YLFA 3WE3A 3KLOA 2QBYA 2K02A 5HVQC 1SFXA 1STZA 1ZARA 1HW1A 3HRMA 4OIOF 2UZKA 4KICA 4HAMA 2D45A 5HS7A 5ILUA 2VT3A 3FXQA 4KT5C 5L3EA 1XMKA 2HTJA 2EA2A 4KIBA 2EJRA 4EJUA 1C0WA 4HBLA 4RB0A 2EV5A 1LDDA 3Q5FA 1W5TA 5HLIA 5L3BA 4HQMA 5LEKA 4M9XA 1K7AA 4EM2A 1F5TA 2Z5UA 4Y15A 1KYZA 3EDPA 3WTTC 1EH7A 1YIOA 4IVNA 5FD6A 3WGIA 4B09A 1O7FA 1LDJA 3O6BB 3B73A 2OAZA 5CJ9A 2EFWA 2EFQA 4CICA 2VE9A 2CWEA 2H6CA 3GZ6A 1OR7A 4WF2A 3RIRA 2GWRA 1YTYA 3REOA 3PQKA 3KP6A 4MQVA 4M73A 1Z05A 2HYGD 3GF2A 5FLXK 2MBFA 2QQAA 3T5XA 3M8FA 1P92A 1CGPA 4XLPF 1IAWA 4LG0A 5FB2A 4IRIA 1ZRFA 4YIFA 1Z9CA 3CTAA 4D0PA 3KP5A 1YO5C 3TGNA 5CVIA 1KQ8A 1OYWA 4I01A 1U5TB 2M5WA 2HOEA 5BPDA 1Z7UA 1IRFA 1QZYA 4A12A 3DF8A 1TQIA 3WODF 2KKOA 2WV0A 1B4AA 4KMFA 4ESJA 2FEZA 5DUIA 4KN7X 2H6BA 3GUDA 3JTHA 2DPDA 4MEYF 1AWCA 3HIFA 3H92A 1HKQA 1LQ1A 1EH6A 1RI7A 4HZFA 4LK0F 1DP7P 3VOEA 1WRJA 4BAYA 5LRRA 5E8GA 4FX4A 3WGGA 3V4GA 1FYLA 2DQLA 4KIGA 2Z33A 3GX4X 3RPUA 2P5VA 3IC7A 1LB2A 5LHGA 2JZYA 5CLSA 3LA2A 2STTA 1BI1A 1XGNA 3AAFA 1G6NA 3KP3A 3O2PE 2OU2A 1FC3A 2A61A 4WX9A 4WK8F 3DV8A 3E6BA 1BOAA 2KIMA 3F21A 3V8JA 2Q8KA 3I71A 1ZRDA 3EUHA 2LKPA 2XAFA 2ZO4A 3FWEA 6PAXA 2PMUA 1XCBA 4O6JA 1TNTA 1SD4A 3NRVA 3BDDA 2IA2A 5D6EA 3KE2A 4GXOA 3ZMTA 2GXGA 1MJBA 3K9TA 3IRQA 1IXSB 3ERED 4LGWA 3H3ZA 2CGPA 1PUEE 4ENKA 4Y13A 2FE3A 4HV5A 1XSVA 2UWMA 1WQ2A 3RKXA 2R3SA 1FOKA 4TV7A 3TO9A 1PDNC 3GYHX 3B02A 2L4MA 1JXSA 5D5XB 1J59A 2P8TA 2JT1A 5HS8A 2JPBA 4P96A 4KNYA 1GHCA 3P9CA 4MHGA 3MFKA 1U6GA 3J81Z 1ZLKA 4BHCA 2STWA 5F6FA 3RTRA 2MH9A 2YX4A 1MDMB 3J80Z 4ZYGA 2K7LA 4EJVA 1FY7A 4HX7A 3ABUA 5ICGA 3HYIA 1UB9A 3RPQA 2XUBA 3HOTA 2FMYA 4RGRA 4P9UA 3F8CA 5H20A 2OZ6A 3FF5A 5IT3A 3E5XA 3MQ0A 4HX4A 3GZ5A 3F6VA 2M30A 4Y17A 1XSDA 1Z1DA 1BC8C 2PFBA 3E6DA 3MEXA 1YQAA 2VBYA 5E8IA 1BI3A 5FFXA 4IRGA 2VOOA 3ULQB 3I0TA 2HZTA 1FBQA 3IKTA 4KMUX 1FBSA 3W6JB 3OV8A 4U0VA 3T8RA 2MH2A 2PMHA 4WXDA 4OMYA 2XAQA 1LDKB 5TJJA 2ACJA 1D8KA 3F8NA 3HTSB 5H6QA 2ZJ2A 1D8JA 3J80K 5K5OA 2CQKA 3H3UA 4WXHA 1O3QA 1R1VA 2V1XA 1OMIA 4MQ9F 2F5EA 2EFOA 3L7WA 3GWZA 4UV8A 4UVBA 2DTRA 3JSOA 5F1RA 2CSOA 1O3SA 1W7PB 1ZYRF 1QGPA 3KETA 1YW8A 5ERIA 3CO6C 1IUYA 1ZG5A 2NAZA 1W7PD 5ICCA 3F6OA 3GFJA 4JBAA 2HGCA 2K27A 3QU6A 2OA4A 2QENA 1TW2A 2Z3YA 3EQLF 3WTYC 1DPUA 1F9NA 1KGSA 4ENMA 3JTGA 3MZYA 4WCGA 1E17A 2RGVA 2QUFA 3F8BA 4A2UA 2FMLA 3IWFA 1BM9A 3FMQA 1QQIA 4UVAA 2XROA 2HKXA 4LB5A 1USSA 4JQFA 4HDVA 3LWFA 3ZMSA 1J5YA 4LLNA 4ASNA 2A07F 5E1WA 2A3SA 3FMSA 2DFIA 1MGTA 1I1SA 2NS0A 2P7CB 4HLYA 2TDXA 2P5KA 1FYMA 2BV6A 4LLGF 3QPTA 2PBIA 2IP2A 5L3DA 4EGZA 4G8XA 3QP6A 1E2XA 4AIJA 4RGXA 2EA4A 1FWZA 3NEUA 4AIKA 4ZYDA 3BZ6A 1CF7B 3K1PA 2DAOA 2VXZA 3TDUC 3M8EA 4BQAA 1T39A 1FP1D 2M1BA 1SD5A 2EFPA 4ZYEA 2CW0F 1QO0D 5LLQA 2OD5A 3ROUA 4BH9A 1RIOH 1SD6A 2KRFA 2DLLA 2EFNA 2LSOA 1MDMA 4EJWA 4UNOA 4ENNA 2OBPA 4IRHA 4YFXF 4RAYA 3TQNA 1JHFA 3ECOA 3CUOA 2ADUA 4ESFA 3FMRA 3S2WA 1TNSA 1BJAA 2V79A 3LAPA 1IN7A 2QLZA 3E5QA 3IRRA 2X0LA 3BROA 2VC1A 1B1BA 3PQJA 3N97A 3SZPA 4S04A 2D2WA 2J5PA 2D1VA 3G3ZA 2HS5A 1TW3A 1SFUA 1KU3A 2IVMA 1IN5A 4A6EA 1L3LA 2RV8A 4O5VA 4CZZA 1R36A 4L9TA 2PN6A 2M87A 2Q0OA 3O3KA 4XBFA 1XN7A 1Z6TA 2FQ3A 2D1HA 2BEOA 1KQ0A 4A0YA 2RC4A 2F5DA 2FBKA 3WTSC 5L3GA 4IF4A 1W7PA 3VODA 3RKYA 3T0YA 4FX0A 3OOPA 2ELHA 3I53A 3FX3A 3V7CA 2L54A 4P55A 4WWCA 1G3TA 5D8KB 1K78A 3EYYA 4EVIA 5ED4A 2Q2EA 4HF2A 2E7WA 3RDIA 4OIRF 5KVRA 1EH8A 1PP7U 3HSFA 3D5LA 1MJ9A 3R61A 5D6FA 2VBWA 2XHKA 2L3DA 3LA3A 3M7GA 4CGZA 2L4AA 1IRGA 1WKMA 3VFZA 1I1GA 3WTUC 4YIIA 3R0JA 1ZH5A 1VTNC 1IF1A 1ZN2A 3WTXC 3I59B 5TRDA 1WWXA 3C7JA 3DPLC 4U0YA 5DD8A 2WTEA 1RNLA 5LGUA 5IT9Z 2VOPA 4M9SA 4ETSA 2XKOA 1EV7A 2V1UA 3SQNA 2DBBA 4MNUA 1B9MA 3R6SA 4G6DA 4EJTA 1T38A 1FX7A 4IXAA 1YG2A 2R7DA 5LRSA 1GVJA 5JR3A 1HXDA 1U78A 3ML6A 4XSZF 3HSRA 2LDUA 2RDPA 4BHPA 1XGSA 2ZXJA 1ZG1A 5ICFA 3K0LA 3LAJA 5DDGA 2K4JA 3RI4A 1SAXA 5LGNA 1XDSA 1CF7A 3CDHA 2IRFG 1ODDA 4LK1F 3ECHA 3GXOA 1F1ZA 3LQRA 1B9NA 1XGMA 4FT8A 5CVVA 3HHGA 2NNYA 3FXRA 4L9JA 1S6LA 2R7FA 2W25A 3L09A 1P4WA 2FXAA 4GGGA 3L00A 3WU0A 3R0AA 4ZZLA 1LNWA 4DQ2A 1D3YA 2FNAA 1ZGJA 2KJCA 3FM3A 2W85A 2MLKA 4OIQF 2L01A 2K4BA 1U3EM 4HQEA 2E7XA
chains in the Genus database with same CATH superfamily
1HSTA 4EEFG 3ZQLA 1JT6A 4I09A 4F93B 2Z16A 3FXOA 3ELKA 2LTPA 4I98B 2V9VA 3BP8A 2F4OB 2F5FA 1DDNA 1OPCA 2MA3A 3KZZA 5KK1A 1KU7A 3J7ZI 5J6XA 1KU2A 3R4KA 1UHWA 4IJAA 2AXTC 3OYNA 2DOFA 4CYCB 2F2EA 4BUPA 3HDDA 3SFIA 2VQHA 2IA0A 3D5SC 3TOBA 2M8EA 3H1CA 4FISA 4GDFA 3P7NA 2BXZA 2IAIA 3ZQCA 4OAZA 2MC3A 3GLXA 3MZHA 1VQ7I 2L2OA 2QA4I 1RUOA 1PP8F 2KJBA 3E1SA 3JRIA 1S7AA 2AQFA 3S1NJ 3HG9A 1R1UA 1R5GA 3WTVC 2JTVA 2JVGA 2DU9A 1W36D 2XRLA 1SFKA 1S3JA 4PJNA 3EYIA 3PM1A 2HQAA 1J9IA 4UHTA 1G3WA 1YITI 1I50J 2W57A 5BOXA 1QNTA 5FO5A 1KA8A 3HHHA 2VKDA 4QPQA 2NVYJ 4LG3A 1X19A 2GM4A 1D5YA 3A01A 2PJPA 5E1XA 1WJDA 5EG0A 2FJ1A 2E1CA 3S17J 1QHHD 1SD7A 3HRTA 5HNHA 1B72B 1HQCA 1BI2A 4OINF 2QQ9A 4G94A 3OSGA 4F3QA 2LVSA 3K1MA 1WHUA 1ON2A 4E7KA 1YX3A 2FBIA 3CLOA 2XAJA 2OQRA 1V5GA 2VXDA 2Z9OA 3PIPF 4JP0A 4FCYA 2BE5F 3GCMA 3L2VA 3MN2A 1PUFB 2K9LA 1HBXG 2MYSA 3DQVC 2L02A 2B0LA 1HKSA 2COMA 5K5QA 4O3MA 2K9SA 2X6YA 2VJJA 2BZTA 2VODA 1XS9A 1E3OC 2ZSIB 2QVOA 2RNJA 1VQPI 2EBIA 4HNTA 3TOAA 2VONA 4L0ZB 2KIFA 1TBXA 3CDIA 1R7JA 1TWHJ 4M71A 3TKYA 2MD0A 2NYXA 5K7ZA 3S93A 4ZDOA 4J19A 5DEQA 4L9NA 5FD5A 1UG2A 2R7UA 4WXCA 4I02A 5GPAA 5KAIC 4DBRA 3H0DA 4NQWB 1BL0A 3WG9A 1T33A 3GEZA 2RQQA 3AG1H 1ORKA 4EM0B 1FSEA 5IOYA 3HOZJ 1Z3YA 1ZTRA 5DV5A 1QZZA 3U9GA 1JKOC 1Z6RA 4A3EJ 1YIJI 2WADA 3TO7A 1XTAA 3TEDA 1R00A 3OYMA 1Q1HA 2AXLA 3DP7A 3J81K 2M2EA 2BHZA 3P5JA 3SXYA 1XCVA 4A5NA 2V1NA 1U5TA 3ZMDA 1YYVA 1SFEA 2HVQA 4KUMA 1USTA 1U5TC 2W4SA 3I59A 3K10A 1REPC 4U87A 3RQIA 3P9IA 3MVPA 3MWMA 3TO6A 1JHHA 1N77A 3I64A 2P6TA 2DQRA 5J4VA 2LNBA 2EK5A 3BQZA 4XICA 1DGWY 2PI0A 4XRFA 1HC8A 1MKMA 2HFHA 2L7ZA 1JGGA 4AUXA 1MMSA 4K2EA 4XMYA 1A6IA 3RYRA 2ID3A 3OYKA 3JREA 2YR2A 3G4SI 1O57A 4IHSA 3QPHA 1IN4A 4IHTA 2XAUA 1WGXA 1TLHB 5J47A 1R5HA 2XGDA 1FYKA 5EEGA 2ECBA 2R7XA 1LEBA 1U2WA 1HDDC 2N8GA 1MBEA 2ZC2A 4XRSG 3OR2C 1FP2A 1D5VA 2PMZA 3K4LA 2XAGA 5A2QZ 3CCJI 1POGA 2RQPA 2BOLA 3ABTA 5FGMA 1IRXA 3A0HC 3CJNA 4M6XA 2LRDA 4PUSA 3ABKH 4EGYA 1ETVA 5HLGA 1RZ4A 3BG6A 4Q48A 1U8RA 2W82A 2HQNA 3DWLE 1IGNA 2XPUA 2M4GA 2PJRA 1Z67A 2YPRA 4MGRA 3F3XA 2X6WA 4AIHA 1K6OA 3D0SA 3Q0UA 5AIPA 5AIQA 2EINH 1S7EA 3CCLI 2GBYA 1AU7A 1Y1WJ 4ENJA 5JFRA 3JSPA 1G4DA 3K69A 3QQAA 4G7OF 3AG2H 1AOYA 2UXNA 3CO7C 1DU0A 4N0BA 4CXFA 5J1UA 3KEOA 1E3PA 3HTUA 1TTYA 2IS6A 3BJ6A 5L3FA 2CG4A 1FMWA 2G7UA 5GTHC 3CJTB 3HPHA 4HLXA 4XRSA 2E1OA 3NWSA 3JRFA 3TL4X 2HXIA 4ESBA 1HKTA 2Y9ZA 3DU5A 3RZDJ 1I6XA 3DKWA 1NK3P 3WU2C 4EM1A 4KN4X 3IH2A 3AG3H 4JK1X 5F64A 2XF5A 1BBYA 3QAHA 4OIPF 1X3UA 2ZNYA 4BY7J 1PVEA 3MZ8A 3R60A 5A2QK 4JX4A 3FISA 4IHWA 4XNFA 1XPXA 1ITYA 2DMNA 3O8GA 4ABZA 3HOWJ 2Y30A 2XGXA 5D4RA 3BR6A 2YS9A 3RYPA 2BBYA 2JJ7A 2W84A 4CYCA 4U7DA 1IN8A 4I0BA 4L0YB 1Y0UA 2DI3A 4B8XA 2BVLA 4XIDA 4KIFA 4E7SA 1BA5A 2DYRH 2HWVA 1TT0A 3W2WA 1V4RA 2E36A 1D0XA 2JA2A 3FXMA 3HUGA 4XLHA 5HDNA 4HV6A 3FHZA 1XD7A 1VQ5I 1ZGWA 1T8IA 4I2OA 5E20A 2DTZA 3H5AA 4IEJA 3N4MA 3W6KB 4D9JA 2ME6A 3V7RA 5BS6A 5M3FJ 2IT0A 1R23A 3U1DA 3QPLA 4BL0B 4UUVA 3QP5A 5DUKA 5D5VB 4E7IA 3KZYA 2NNNA 5B1BH 4JYKA 2F5CA 1FBUA 2EH3A 3ASOH 1S72I 4D5CA 1H9GA 2M45A 3BG7A 2QWWA 2R7ZJ 3LA7A 4ZH4F 3RSNA 3V8LA 1RKTA 1MBHA 4XOTA 4J01A 4NC7A 2JSCA 3KCCA 3RPUD 2UV1A 2EV6A 1X1BA 4PSXA 1B72A 1EA3A 1S29A 4OWRB 4XSXF 1BW5A 2LOOA 1QZEA 2M34A 5BQTA 1JKQC 1UMQA 2VQCA 2ISZA 1D0YA 2IA1A 4KT6A 4X1EA 4HOBA 4EV0A 3GW2A 2GQQA 2B63J 3N05A 3BOQA 3FIWA 5ILSA 4YEJA 5JLXA 1IN6A 2MSYA 1N78A 4DIQA 3OIQA 3K4KA 4EMSA 1YS6A 5GADJ 5M5WJ 4GFBA 3TW6A 2PLYA 4E7ZA 2GIVA 3HSEA 2NVUB 3CCVI 3HM5A 1YW9A 3LSMA 5DS9A 4HW0A 4Q47A 2L9VA 4A3IJ 2RAEA 3L2QA 4CHUA 3TP3A 1ZAOA 2ISYA 3OIPA 3L9FA 1WJ5A 2R4GA 4PJ0C 4MEXF 2OF7A 3ZGKA 4H0EA 1Y1VJ 4PK4A 2I5UA 3K4NA 4X6AJ 2IJLA 4FTHA 3LFUA 4JX5A 4ZC3A 5FRMA 3BCBA 5JHUA 4A5MA 1ZHFA 3RKWA 2LYCA 4BS9A 2IGMA 4KFCA 1B8IB 2JA8J 4A3CJ 3MD2A 1YHQI 3TDZC 3KEYA 4NQWA 5E79C 1RC9A 1YS7A 2EIKH 1QPMA 2DA3A 2DDAA 3P9KA 4IL6C 4G7HF 1LFUP 4PZJA 3FZVA 1GLNA 2FF4A 2K3FA 2LY9A 3QOPA 3WGHA 1GXQA 1I27A 5GAEJ 2VKVA 3OYFA 3ZMVA 3HL2A 2IBDA 3MAJA 1IXCA 2O61A 4IHVA 3H9QA 5FLXZ 1YFHA 3E6MA 3HOSA 3FKIJ 4EJOA 4PGGA 1YI2I 5DCMB 2A69F 1J7KA 4CCJA 4YFNF 4RGSA 3IHUA 1DUXC 4M3BA 3WTZA 1AHDP 1Y39A 4QLCU 4XKCA 5E1ZB 3FK7A 2E2JJ 3BJAA 1QPIA 2HPMA 2YU3A 4PGHA 3OL3A 2M0MA 2GXBA 4NC6A 1ZK8A 5ICEA 3DEEA 2K86A 3ZCOA 4Y33A 3J7AY 3IWZA 4R79A 1W5CC 3T8TA 2FOWA 5BPIA 2JSPA 4CA0A 2XVCA 1JGSA 2BW3B 2DA4A 1XG1A 2VN2A 5M3MJ 3PFYA 4BJTA 2BGCA 1I5ZA 4UUTA 4AU7A 5FKMA 1FSHA 2EZKA 2ZKZA 1N75A 4LMYA 1NG6A 5KAFC 4ZYHA 5K7FA 2L9RA 1ZKGA 3SHFA 1F4KA 3CMYA 2O6GE 4XLAA 1TQPA 3D1NI 3H0GJ 3LSRA 1P7IA 5FKKA 1G2HA 2YSRA 3QRFF 2Y48A 1K61A 3BC8A 3Q0WA 5FKLA 4RB1A 2QQ8A 3GTJJ 5F08A 4BXXJ 1ETYA 5HS9A 3BY6A 3G73A 3RQ4A 4MO7A 1P4XA 4HA8A 1YJNI 5IY5H 2O3FA 1T08B 5CVJA 1MD0A 4Y7NJ 2XGCA 3DXJF 1HDPA 3OYJA 1K83J 2GZWA 2L7FP 4KITB 2W24A 3CLQA 3F8MA 1T6SA 3LQQA 1SMYF 1LKXA 2A6EF 1OYYA 4A3JJ 1NTCA 1BI0A 5F0CA 1ON1A 5J8CA 1KU9A 2CUEA 2EB7A 3KYDB 4J00A 2HQRA 5IYDJ 3GFIA 3RKQA 1H89C 1PYVA 2JRTA 2R0QC 4LJZF 1D1CA 1J0RA 1O7LA 1HCRA 2G7HA 2HDWA 3IV5A 4LITA 4BE2A 3KP7A 2IGNA 2LMDA 3L2CA 4ZTFA 2W00A 2O8XA 3S32A 2Y69H 4C3JJ 2GAUA 2E1NA 3DEUA 4BYYA 1LEAA 2L7KA 1SMTA 2ME0A 4PCQA 4DZPA 1MW7A 3ABMH 2CUZA 2LF7A 2Y2ZA 3K4JA 1TWAJ 2CQXA 4XLNF 1SVOA 2JUGA 3ZMUA 1WI3A 1BR4A 2DOEA 5J1YA 3NAUA 4LD5A 1ACIA 5HDKA 3CJQB 3SFZA 5GAHJ 2ZBKA 2HR3A 1IW7F 2G0EA 1WVRA 2WWYA 5LEJA 1J09A 4F92B 3OYIA 4IPAA 1R71A 2LKXA 3PNVA 3RJPA 2K5CA 4W1UA 1VQOI 2DCEA 4I0AA 2O5RA 5FFZA 1BIAA 3HRUA 1J75A 3I58A 3GTLJ 2DT5A 4FE7A 1ETXA 2HKOA 1LVKA 3F8FA 2XKPA 3PFIA 3HOYJ 2L5QA 3HRSA 5AONA 3BG9A 4MTDA 3OY9A 2HDDA 2JPCA 2R5ZA 5DM6F 3FDYA 4FHTA 3Q9VA 1T2KA 3FBNB 1R1TA 2Y31A 4CCNA 3COAC 2KIUA 3DPUA 3V7SA 5LGTA 3W2AA 3K70C 1R58A 3PSFA 5TISC 3CF5F 2M9HA 3GTOJ 1G3SA 2P5LC 2K9QA 4XONA 2QF7A 3SYTA 3HXLA 4NBQA 4U7BA 3KFWX 3I9V2 5IT9K 2TRTA 4A3BJ 1XMAA 3OYLA 3IKVA 5ILVA 3FXUA 1QBJA 3A1YA 1MNDA 2KLOA 2DK8A 4BBRJ 3ZQIA 5LBQA 4XQFA 2JA7J 1FOXA 2BY1A 4YELA 2FA5A 1LJ9A 3PUFA 2DFEA 4NC8A 2QCOA 1DPRA 3MMYB 1GXPA 4RB2C 2Z2SB 3CUQB 2P7VB 1IV8A 4R1HA 4YIRX 1P6RA 3GTKJ 2HXOA 3WTWC 2ZCWA 4A3GJ 2O03A 2QYOA 3E5UA 2DO7A 1BIBA 3MKZA 2ZMEB 1OKRA 3ZP5A 4G7ZF 4CYDA 2H1LA 2LF8A 3E97A 1HW2A 5D5UB 1FLIA 2LR8A 3QWLA 2ZJRF 1BN5A 5KNLA 5CVRA 4A69C 3A0BC 3S1RJ 3K1NA 5M5XJ 3ISPA 1B59A 5JLWA 4BHBA 2DPUA 4Z2YA 4RAFA 4RGUA 1VQ4I 1E0EA 2RKHA 2X48A 3DPTA 1WH5A 5EEHA 1BW6A 4XKVA 1B8IA 4N9IA 1L0OC 3IL2A 1V3FA 3I5UA 3HBLA 5HLHA 4Q5SF 4IOAF 2FNPA 2R7TA 1MNEA 1T56A 4L5IA 1OCOH 4GYIA 2GIZA 2HU9A 3K4MA 3LSTA 1BC7C 2P4WA 3GFLA 1MMNA 1ULYA 4AIDA 1TWFJ 5EEAA 4U0WA 4CZCA 4NHJA 1GDTA 5CYVA 2QSGX 2XIGA 5FJ8J 4LB6B 1QVTA 2YX7A 5F0HA 3BR3A 4RDUA 3F22A 2VBXA 3BPXA 5CQGA 2E5ZA 5BMZA 5DCMA 2FBHA 1KQ9A 3GTPJ 2HYFA 2J5OA 3ZN0A 4RB3C 3F23A 2VB6A 1ZG3A 2CQNA 4IQ4A 4XL9A 2PG4A 4V2GA 3JW4A 1X2NA 3C3WA 4ANJA 2OQGA 4UXNA 3OYHA 3WU1B 3OMYA 4YRVA 4M6YA 1OCRH 4G6QA 1TP4A 2FOKA 2BYVE 3ZQ7A 4HDUA 4L5JA 2CYYA 1KONA 2A68F 5KCMA 4MLOA 3G71I 2CFXA 2MG4A 5E18F 4PDKA 1ZGAA 1VZ0A 4E7HA 1IXRC 1OYIA 1R22A 2O0YA 4L18B 4M74A 5CKTA 2UXXA 5E3LA 5J8FA 4KDPA 1A35A 4ZTJA 2BW3A 1R4NB 2HDCA 2DA2A 2DW4A 2ZXIA 1X2MA 4C3HJ 1H8AC 2WAFA 2ZFUA 4KJZA 1U0JA 5B5EC 2V6EA 3C2BA 1MBGA 2XGEA 3FM5A 3Q9SA 5F27A 1KYWA 3PJRA 4MTEA 3M9AA 5FLMJ 3G1MA 3KP4A 4DYQA 4CH7A 5E17F 2ICWG 3JRCA 4HX8A 2QBYB 2OZUA 2PEXA 2Y75A 2XSDC 5IYBJ 4CO8A 3BLYA 3K4BA 3WE2A 2VBZA 1MJAA 3ZQHA 1FOWA 3J7AO 4BKXA 5HOOA 1O3RA 4BQOA 2LP0A 2DXIA 3LSGA 4ON0A 3MCZA 2R5YB 3BTCA 1FT9A 2VLAA 3DU6A 2A6HF 3VEPA 2DT7B 1X58A 2E34A 2GA2A 4Y4RA 3H5RA 1G3YA 1RESA 4N4NB 3QPSA 2RVCA 4F55A 3E6CC 3DLAA 4N9HA 4MFEA 1NHAA 4HYEA 2KT0A 1T98A 2AS5F 3LSJA 3KEQA 4RMNA 1J2XA 2HZDA 5EF6A 2QSFX 2IPQX 2QQBA 1XDUA 3VYRB 1Q1VA 2WB1N 2CFOA 2CRGA 4MIMA 2NRAC 2VUMJ 1P4AA 4S05A 2ESNA 2R93J 1AKHA 2IS2A 4NB5A 2MD5A 4A3MJ 2ZNZA 4XLCA 1TT5B 4EATA 3L2UA 5JI6A 5IPAA 1ZRCA 2XF6A 5D8LB 3PO2J 3QU3A 5GTIC 3F9KA 4NDLA 1QA6A 4G12A 4RS8A 2RREA 3BWGA 1R4MB 4LFUA 1W5SA 1MZBA 1WI9A 1OCCH 3DTIA 3HC7A 4QPOA 1HA8A 4BU2A 4IKFA 1WSUA 2KISA 3KLNA 4UVCA 3S1MJ 4F7ZA 5H2FC 2V6CA 1A04A 3ZN1A 2CJJA 3B6CA 4BACA 3DBRB 2BXYA 4GYGA 4UB6C 2R7RA 4BJ5C 4QWQA 2ECCA 3AKZA 3S3MA 4OMZA 1UAAA 2HVRA 3FXLA 1K78B 3E3VA 1SVMA 2Q2EB 2Z1DA 2MLGA 3M1EA 3BR2A 5DCFA 3AL0C 2XASA 4B1RA 5JVTA 3V8KA 1APLC 3GVAA 3LSPA 4PJJA 1UG0A 2XRNA 4Q4ZF 1Z91A 3CDLA 3HJEA 4G6TB 3Q3SA 2FU4A 2VT2A 4GO1A 4LLLA 1Z7LA 1JE8A 3BPVA 4RAZA 3G1OA 2LY2A 2XAHA 1WH7A 1IV6A 4G9YA 4X0GA 1LPQA 2H94A 1T95A 5C44J 4HF0A 1X3WB 2YU9J 3NQOA 4LG0B 4P9FA 3AFHA 3T1BA 5L3CA 2PQ8A 3M07A 5D4SA 1YRNB 4OAYA 2C6YA 2TCTA 3K2AA 2F4MB 4B47A 4V2FA 1FPQA 1K6YA 2GOXB 3HZJA 3C1DA 3VYTB 1GVDA 1JUPA 3QYEA 5D5WB 3DEWA 4CCOA 3J7YJ 4BNCA 1WJBA 2MC4A 4M72A 5K5RA 2LREA 4A0XA 3DFGA 3ZOBA 2FSWA 1IZ1A 1HW5A 2VE8A 1R5ID 1XSXA 4CSWA 2R7WA 2P6SA 1D1AA 3QYFA 2NOGA 3CUQA 4A0ZA 3JAMZ 1PJRA 1XGOA 2OJED 4HF1A 2QZ8A 2FRHA 4ZZDA 2LBFB 1JTYA 3CUQC 1LVAA 2ZXHA 1ONVA 3CF2A 2CUFA 2ELKA 4S0HB 3CCUI 2KRHA 4A6DA 1O3TA 1RRJA 1H0MA 4BXFA 2VKEA 2VQGA 1VF9A 2ZMEA 3GTGJ 2Z99A 1E3HA 1JUMA 2EZHA 3SZTA 2NOJB 4LOCA 1W0UA 2ZMEC 2CO5A 3KP2A 4BGDA 5CVUA 2IW5A 1GT0C 1FZPB 3U2RA 4P5OA 1UCRA 2ESHA 3GO5A 2H8WA 4M9ZA 4CCLA 4XN3A 2CV0A 2EZLA 4B43A 1ZR2A 2NVQJ 3EETA 5EYRA 1OQYA 3H36A 5J4YA 1F43A 1S7OA 3BJOA 3ZPLA 1W36C 2A6TA 1HSJA 3FKJA 4I7HA 2ETHA 2V1DA 2A5YB 2VKHA 2DA1A 2FD5A 4C2MJ 1A36A 5DYMA 1LFPA 1RUNA 2H8RA 1B6AA 5HDGA 1MMGA 1P2FA 2K40A 3IAM2 4ZDPA 1W4MA 2V9PA 1WJFA 1H9TA 2G9WA 4P1WA 5EZGA 3OYDA 3I54A 4DZJA 2HTSA 4DNCA 5B66C 4OOIA 3I4PA 1Z0XA 1T0FA 5EJCA 1VQNI 2ZFWA 3HEFA 2X1EA 1ZLJA 4QTRA 4L9VA 4BEHB 1T0FC 4E70A 2DA5A 2H27A 1FNNA 1JKRC 3ZMZA 2GA1A 5DD4A 1DGRM 3JRDA 3K2ZA 2CW7A 3CCMI 4YG2F 2EWNA 4A3KJ 5LHIA 3DLLF 3JAMK 4GCVA 3F72A 2F4IA 2V7FA 2VJ4A 3AG4H 2VC0A 5LHHA 3W3CA 1ENHA 2MW8A 3HKZN 1R9TJ 4II2A 1UFMA 3LFKA 3GLLA 4CDGA 4XRMA 3GFMA 1V54H 1PUFA 2WAEA 4YFKF 4C30A 1JJ8C 4R8HA 1RPWA 1Z3XA 2X4HA 4AD9A 1YOVB 4M3EA 1ZREA 2DK5A 5K1YA 1I39A 1YW7A 3C18A 2HEOA 1JJ6C 1A5JA 2Y0MA 4U88A 4B44A 2EV0A 4AVPA 1MH3A 4EQQA 4II3A 3U21A 4KA4A 4KYWA 2RN7A 1K79A 4IHYA 5FKNA 2QM3A 2XV4S 4ZJZA 4JOMA 2H09A 1S8NA 1TQMA 3DKYA 4OU0A 4RM2A 2HOAA 2L9SA 3CCYA 3HOUJ 2JVHA 5H6RA 1WPKA 1I3QJ 2VJIA 3VB2A 3G1LA 5JHFA 2WC2A 1UHMA 4F91B 1XB4A 4BXUA 2KRCA 3VYSB 4UV9A 2DJIA 4KISA 2I10A 1YLFA 3WE3A 4AWXB 3BZCA 3KLOA 2QBYA 3JRHA 4FASD 2IEKA 3M3YJ 4E6KG 1MNMC 2K02A 5HVQC 1SFXA 1BR1A 1STZA 1ZARA 1EJ9A 1HW1A 1FTZA 3HRMA 1BOBA 4OIOF 2UZKA 4KICA 4HAMA 2D45A 5HS7A 1R6RA 2ZXWH 1W1WE 2DFFA 5ILUA 3QODA 2KZGA 2VT3A 3FXQA 4KT5C 5L3EA 1XMKA 2HTJA 1WJEA 2M3AA 2EA2A 2R92J 3VYUB 2IGOA 4KIBA 4M6VA 2EJRA 2XPVA 4EJUA 2X9DA 3LNQA 1C0WA 4HBLA 4RB0A 3MKWB 2EV5A 1LDDA 3Q5FA 1W5TA 5HLIA 5L3BA 4HQMA 5F1JA 5LEKA 4M9XA 1SAUA 1K7AA 4EM2A 3BZKA 2HVSA 4I99C 1YJ9I 1F5TA 2Z5UA 2WA0A 4Y15A 1KYZA 2XDVA 3EDPA 4BE1A 3WTTC 1EH7A 3A01B 1YIOA 4V19K 3RZOJ 2KIQA 2A05A 2VASA 4IVNA 4BQQA 1WJCA 5FD6A 3WGIA 4PFOA 4B09A 3CCRI 1O7FA 2Q1ZB 1LFBA 3HGYA 1OCTC 1LDJA 3O6BB 5E3MA 3B73A 4LIVA 2OAZA 5CJ9A 2EFWA 3MKYB 2EFQA 4UUSB 4CICA 2VE9A 2CWEA 2H6CA 2NVXJ 4CCKA 3E0JB 1LE8B 4DW6A 3GZ6A 1OR7A 1S9HA 4WF2A 3RIRA 3VSKA 1EKEA 2GWRA 2X1CA 3PSIA 5IP7J 3OYGA 5F04A 3SJMA 1YTYA 1X1PA 1OR7C 2OUMA 3QYBA 1SFOJ 2LH9A 3REOA 4XORA 1MBKA 3PQKA 3OIOA 4DGWB 1IRZA 3KP6A 3DTEA 4MQVA 4M73A 1Z05A 2DFHA 2WB1A 2HYGD 3GF2A 3X2QH 2LY1A 5FLXK 1F36A 2MBFA 2QQAA 2EIJH 1WCMJ 3LSKA 3T5XA 1UHSA 3M8FA 1P92A 1RKWA 1CGPA 4XLPF 1IAWA 1OFCX 3CJRB 1Y56A 4B48A 1IG7A 4LG0A 5FB2A 4IRIA 1ZRFA 2WY8Q 3HB9A 4YIFA 1Z9CA 1YRNA 1X3ZB 3CTAA 2W1OA 4D0PA 3KP5A 1YO5C 3HGGA 2E35A 3TGNA 5CVIA 3JCUC 1KQ8A 1OYWA 2O9LA 3LMMA 4I01A 3SEZA 1U5TB 2M5WA 2HOEA 2GXAA 2P0WA 2BHYA 3BT9A 5BPDA 3ASNH 4DYCA 1Z7UA 3LSIA 1IRFA 1QZYA 4A12A 3M4OJ 3S3NA 4ZDLA 3DF8A 3C2HA 3PIOF 1TQIA 2EPFA 3WODF 2KKOA 2WV0A 1B4AA 2LBFA 2WBMA 2CU7A 2AO9A 4KMFA 1FOYA 4BY1J 1MIJA 4A3LJ 4ESJA 2FEZA 3GZNB 2FQ4A 5DUIA 2HOTA 1QU3A 4KN7X 2LK2A 3JR9A 3FHNA 2H6BA 3GUDA 3JTHA 4XLFA 2DPDA 5LFAA 1JT0A 3BQYA 3F0CA 4AYBN 3FBIB 4MEYF 1AWCA 1OLTA 3HIFA 1HF0A 2NS8A 2NS7A 1XX5A 2X1DA 3H92A 3H9JA 3OWTA 3VWBA 1HKQA 3DTKA 1LQ1A 5CPRB 1FEXA 1EH6A 1RI7A 1UJ8A 4HZFA 3SEQA 4LK0F 1RR8C 1DP7P 3A4CA 3VOEA 1WRJA 2A5WA 4BAYA 2B7EA 5LRRA 5E8GA 2WV1A 4FX4A 3WGGA 1TWCJ 1MMAA 3V4GA 1FYLA 3I55I 2DQLA 1VQKI 4KIGA 2Z33A 3GX4X 5IP6A 3RPUA 2P5VA 3IC7A 2IS1A 1ETWA 3OSFA 1LB2A 5LHGA 2JZYA 2ZJQF 5CLSA 3LA2A 2IGKA 1Y0NA 2STTA 1BI1A 1XGNA 3AAFA 1W0TA 1G6NA 3KP3A 4BEHA 1FTTA 3O2PE 2OU2A 2MABA 3S16J 1FC3A 1TL8A 4XN0A 1ETOA 1O4XA 2A61A 4WX9A 4WK8F 3DV8A 2IXSA 2L9NA 1V55H 3E6BA 1BOAA 2KIMA 3F21A 3V8JA 2FUG2 3OS0A 2Q8KA 3I71A 1ZRDA 2M0CA 1EF4A 5C3EJ 3EUHA 2LKPA 2XAFA 2ZO4A 3FWEA 6PAXA 4AC0A 1UZCA 2CV1A 3EUHC 2PMUA 2DMTA 1XCBA 1GV5A 2BY0A 4O6JA 1TNTA 1U8BA 1SD4A 3NRVA 3BDDA 1ZELA 2IA2A 2QKMB 4I76A 1M1EB 2VI6A 3UR3C 1HLVA 1P7JA 2K3PA 5D6EA 1MBFA 3S15J 3KE2A 1ZQ3P 2XSJC 2VJ5A 4GXOA 4PJLA 3ZMTA 2KFDA 2GXGA 1MJBA 3DKXA 3CMMA 3K9TA 3IRQA 4Z6YA 1IXSB 2X6XA 4B4CA 3ERED 4LGWA 1U9OA 3SDGA 3H3ZA 2CGPA 3FXKA 3ZQQA 1PUEE 3S14J 3H3VK 5BNGA 4ENKA 3CCQI 3ABLH 4HEA2 4Y13A 2FE3A 4HV5A 1G59A 4UY8I 3GMEA 3HKZA 2KHMA 1XSVA 2UWMA 3UKGA 1WQ2A 3RKXA 2R3SA 2XF7A 3S3OA 4B3AA 1FOKA 4TV7A 2ID6A 3TO9A 3WHBA 1PDNC 3GYHX 3D5RC 3B02A 2L4MA 3HUGB 1JXSA 5FKOA 1NH3A 1VQ8I 5D5XB 1J59A 2P8TA 2JT1A 3IH3A 5HS8A 2M7BA 3CQZJ 2JPBA 4P96A 4KNYA 1GHCA 3P9CA 4MHGA 3MFKA 1QHGA 1U6GA 2XB0X 1RR7A 1D0ZA 1GV2A 1A31A 4HPQA 3J81Z 2DMQA 2UUZA 2X6OA 1ZLKA 4BHCA 3CP8A 4BDYA 2EIMH 2STWA 2JK3A 3HOVJ 5F6FA 3M8JA 4RLFA 3LL7A 3RTRA 2VPLA 2MH9A 2YX4A 3IP4B 2BVMA 5GPCA 3J80Z 4ZYGA 1MDMB 3M1CA 2K7LA 3ESWB 4EJVA 1WJAA 1FY7A 1VFCA 4HX7A 1ETQA 3ABUA 5ICGA 2KDZA 3HYIA 1UB9A 3RPQA 2XUBA 3HOTA 5EZHA 1IDYA 2WAQN 3ZR8X 4Y52J 2FMYA 4UUSA 1VQ6I 2KQRA 4RGRA 4UB8C 4P9UA 2E1MB 3F8CA 1ZR4A 5H20A 1DQUA 1YX5A 2OZ6A 3KPHA 1LE8A 2QEXI 3CC4I 3CP2A 2DN0A 1JUSA 3FF5A 5HNFA 5C4XJ 5IT3A 1ETKA 3NWTA 3E5XA 3OL4A 3MQ0A 1VNDA 4HX4A 4D1QA 1Y8RB 3GZ5A 3F6VA 2ELJA 2M30A 4Y17A 3TBIA 1XSDA 4XKWA 1Z1DA 2HNHA 5EGOB 1BC8C 2PFBA 3E6DA 3MEXA 1YQAA 2W7NA 2VBYA 2CV2A 2LFBA 5E8IA 1BI3A 5FFXA 2KMUA 4IRGA 2VOOA 4PJMA 3ULQB 1X1DA 3I0TA 1BR2A 2HZTA 4E7LA 4QSHA 1FBQA 3IKTA 4KMUX 3OR1C 4RA2A 1FBSA 3W6JB 3GTMJ 3OV8A 2M7AA 4PSWA 4U0VA 3T8RA 2MH2A 4DOZA 2PMHA 4WXDA 4OMYA 2XAQA 1MSEC 1LDKB 3K7AJ 4E7JA 5TJJA 2ACJA 2VPRA 2R7OA 1D8KA 3F8NA 2Y0SN 5TGTA 5H6QA 1JKPC 2L7MP 3HTSB 5DTDA 5JVGF 1MSFC 2ZJ2A 2NVTJ 3J80K 5KHDA 1D8JA 4LIUA 3H35A 3OS1A 2OCEA 2CQKA 1NG7A 3TW7A 5K5OA 3H3UA 3I4MJ 2X51A 4WXHA 4XK4A 1Z21A 2Y9YA 1O3QA 5FLVA 1R1VA 3RCOA 2V1XA 1OMIA 3EUAA 4MQ9F 2F5EA 2EFOA 4IHXA 3L7WA 3S2HJ 3KYLA 3A03A 5IYCJ 2XPWA 3IH4A 4ITVA 5E3OA 3GWZA 4UV8A 4UVBA 2DTRA 3JSOA 5F1RA 2CSOA 1QRYA 1O3SA 1A6QA 2JQ7A 1W7PB 3OS2A 1ZYRF 5J40A 1QGPA 3QOEA 3KETA 5E3NA 1YW8A 5ERIA 1DP3A 3CO6C 1IUYA 3CCEI 2E2IJ 1ZG5A 2NAZA 3JRAA 3O8HA 1W7PD 5ICCA 3FXJA 2E5NA 3F6OA 3GFJA 4D5FA 2CQQA 4CCMA 4JBAA 3CMEI 2D5VA 2OPTA 3WHCA 2M4KA 2OTLI 4NNJA 1DU6A 3I56I 1HOMA 2HGCA 2BY2A 2LKSA 4W97A 3JRBA 2K27A 3QU6A 2OA4A 2QENA 3I3LA 1TW2A 1TZLA 2DDBA 2Z3YA 3EQLF 3ZXSA 3WTYC 3CZ6A 5EDNA 1DPUA 2HQ5A 1F9NA 2X85A 1KGSA 1S5LC 4ENMA 4F52A 1MH4A 3JTGA 2GLOA 2VQLA 3MZYA 4WCGA 1E17A 2RGVA 1IUFA 3B6AA 2QUFA 2JMWA 3F8BA 4A2UA 2DMPA 2AQEA 2FMLA 2CQ7A 3IWFA 4AYBA 1BM9A 5GAGJ 4NUBA 3KIOA 2QGUA 3FMQA 3BTJA 1VQMI 1QQIA 4UVAA 5J3LA 2XROA 2HKXA 4N4OB 1ERDA 2LLKA 1TWGJ 4LB5A 1USSA 2E19A 4JQFA 3VDXA 4HDVA 3LWFA 1I6HJ 3ZMSA 1J5YA 4LLNA 2OTJI 2F48A 4ASNA 2XB5A 2A07F 5LD2C 5E1WA 2A3SA 4MFDA 4C9YA 3FMSA 3C2GA 3ZQFA 4I6ZA 4M3DA 2B9SA 2DFIA 1P9QC 1MGTA 1I1SA 1VI0A 2NS0A 2P7CB 1LUJB 4RLQA 4HLYA 1X1AA 1N25A 4HNVA 1FIPA 2P5KA 2TDXA 1FYMA 5GP9A 2BV6A 2KZVA 4LLGF 2CH0A 3QPTA 2V9KA 2PBIA 3VPRA 2IP2A 5L3DA 3G6EI 4IQJA 4EGZA 4RBOA 1BJZA 1VQ9I 1CQTA 4G8XA 2JUCA 4E4HA 1JI8A 1AA7A 3QP6A 1R49A 1E2XA 4AM3A 4AIJA 1SC7A 4XLEA 3S8PA 3KX2A 4RGXA 4BJ6C 2EA4A 1FWZA 3NEUA 4AIKA 2YUSA 4ZYDA 4IO9F 3CESA 2HYJA 3BZ6A 1CF7B 3WG7H 2R5ZB 3K1PA 2DAOA 4DBQA 2VXZA 3TDUC 1K4SA 3M8EA 3BG3A 3Q0VA 3UNGC 2CUJA 4BQAA 4A3FJ 3LOCA 1T39A 1FP1D 2M1BA 1SD5A 2EFPA 4AVZA 2V4JC 1IC8A 4ZYEA 2RNGA 2CW0F 1QO0D 5LLQA 2OD5A 3K70D 4A93J 2EQRA 3PL8A 3A2KA 3ROUA 4BH9A 1WZ2A 3W6VA 1RIOH 1SD6A 2KRFA 2DLLA 2KPMA 2EFNA 1OCZH 2LSOA 1MDMA 5FROA 4EJWA 4UNOA 1FJLA 1FMVA 1V5FA 1RETA 2COBA 1Z77A 1I3AA 4ENNA 2QSHX 2OBPA 4IRHA 1Y6IA 4YFXF 2LG4A 2F6CA 3BR0A 1MBJA 1U9NA 5CQEA 4RAYA 3TQNA 1JHFA 3ECOA 3CUOA 1TC3C 2ADUA 4ESFA 3FMRA 3S2WA 4C3IJ 1TNSA 1BJAA 1FIAA 1UELB 3E7LA 1XMXA 3SZGA 2LD5A 2V79A 2E1MC 3LAPA 1IN7A 2QLZA 3E5QA 2ZJPF 3IRRA 2X0LA 3BROA 3CMAI 3A02A 3IUOA 2VC1A 3ZQGA 2NXNB 5IOZA 1B1BA 5F0FA 3PQJA 2V26A 2JN6A 3N97A 2BY3A 3PNYA 2DYSH 3SZPA 5EGOA 4S04A 2R5YA 2JRMA 2D2WA 4M3GA 2DA6A 5B1AH 2J5PA 2D1VA 3G3ZA 2HS5A 3CC2I 1TW3A 1SFUA 2K85A 3H5NA 4IZZA 1KU3A 2XC7A 2IVMA 4RM3A 1IN5A 4DYRA 4BE0A 2E71A 2HI3A 4A6EA 1L3LA 2RV8A 4O5VA 4CZZA 1R36A 3JRGA 4L9TA 1IJWC 2PN6A 2WAQA 3PO3J 2ZSHB 2MGQA 4D7NA 3BTLA 2DA7A 2M87A 4GRIA 3VSLA 2DJNA 2DOAA 2Q0OA 3EPZA 3TMOA 2DMUA 3O3KA 1X4PA 4XBFA 2CW8A 3L2RA 3BTIA 5EG0B 1IO2A 2K9MA 3BR5A 1XN7A 1Z6TA 2FQ3A 2D1HA 2M8GX 4FETA 1KZHA 2BEOA 1KQ0A 4A0YA 2RC4A 3V42A 4QIWN 1VQLI 2OV7A 2F5DA 2FBKA 4PFPA 3WTSC 5L3GA 4IF4A 2ZB9A 2F5VA 2LC2A 1W7PA 3VODA 3RKYA 2GOMA 9ANTA 3T0YA 4FX0A 3OOPA 3CCSI 2ELHA 1G8XA 1X4OA 3I53A 3FX3A 3DCFA 3V7CA 1V5EA 4A3DJ 2L54A 4P55A 4WWCA 3K4CA 2HOSA 1G3TA 5D8KB 1K78A 3EYYA 4EVIA 3BG5A 5ED4A 1OJLA 2Q2EA 2JA5J 1X1CA 4HF2A 2E7WA 3RDIA 4OIRF 4XKBA 2VIXA 5KVRA 1EH8A 2L0KA 1PP7U 4L5EA 4RAGA 3IAS2 4H4KC 2KDOA 1WFXA 2E2HJ 2FX0A 4C2UA 3HSFA 3GTQJ 3D5LA 5FRNA 1OCPA 2WY7Q 1MJ9A 2Y0SA 2AHQA 1JTXA 3R61A 5D6FA 2VBWA 2XHKA 2DT6A 1NK2P 1H88C 2L3DA 3LA3A 1SVLA 3GBGA 3PNTA 4HSRA 1K4TA 4BBSJ 3HOXJ 3M7GA 4CGZA 2L4AA 2HPIA 1IRGA 1WKMA 3VFZA 1I1GA 3WTUC 2KL4A 2PMZN 3KYCB 3TP0A 5IP9J 5M5YJ 4IOCF 4YIIA 3R0JA 3DBLB 1Y8QB 3W2VA 1ZH5A 1VTNC 1IF1A 1ZN2A 3HPGA 4BDZA 3WTXC 3K6GA 3I59B 3MKLA 1GUUA 3ERMA 1WWXA 5TRDA 3C7JA 3DPLC 4DJAA 2MFZA 4U0YA 5DD8A 2JWTA 2WTEA 2R7SA 1RNLA 5LGUA 5IT9Z 4FQGA 1YE9A 3H9GA 2VOPA 4M9SA 4ETSA 2KP6A 3U1KA 1OISA 2DODA 2XKOA 1EV7A 3OOUA 3ONQA 1AKHB 4C2TA 2V1UA 3SQNA 2DBBA 4MNUA 2OC6A 2PX9A 3BCAA 1B9MA 3R6SA 3KZIC 2O8KA 4HNUA 2W48A 4HRIA 4G6DA 4EJTA 1T38A 1IDZA 1FX7A 4IXAA 1YG2A 2R7DA 3OYBA 5LRSA 5DM7F 3PUBA 1GVJA 5JR3A 1HXDA 1XC5A 2R7QA 2VL8A 1U78A 3CC7I 3ML6A 2JA6J 4XSZF 1D1BA 3HSRA 1SEUA 3OYAA 2LDUA 2EZIA 2RDPA 4BHPA 1MMDA 3L2WA 1XGSA 2ZXJA 4HG2A 3AL0B 2O7OA 4Y3OA 1ZG1A 4D7MA 5ICFA 3K0LA 3LAJA 5DDGA 4IX7A 2K4JA 2PJRB 4M3FA 1SANA 3RI4A 1SAXA 5LGNA 1XDSA 2OCCH 4XOPA 1CF7A 2QKLB 2CMPA 3L1PA 3CDHA 2IRFG 2EILH 2H1KA 1ODDA 4LK1F 3SDBA 3ECHA 3GXOA 5K7HA 1F1ZA 3G2BA 3DBHB 3LQRA 3OYCA 4JX6A 5HLTA 2CS3A 1B9NA 4FE4A 1XGMA 4FT8A 5CVVA 3HHGA 2IS4A 5HODA 2K9NA 3EUKL 2NNYA 3FXRA 2P81A 4L9JA 1S6LA 2R7FA 4CUGA 3FK6A 2W25A 3L09A 1P4WA 3ZRGA 3BR1A 2FXAA 4GGGA 3S2DJ 3L00A 4B3XA 2R7VA 3WU0A 5J1RA 3R0AA 3NARA 4ZZLA 3OYEA 1LNWA 4DQ2A 3CD6I 3S1QJ 1D3YA 2FNAA 1ZGJA 4XM3A 1QVUA 4HSTA 2KJCA 3FM3A 2W85A 2MLKA 2E60A 4OIQF 5B3SH 3LSHA 2I8DA 4ZYAA 1YJWI 3I4NJ 2L01A 2K4BA 4BQNA 1U3EM 4XR6A 4HQEA 5C4JJ 2E7XA
chains in the Genus database with same CATH topology
1HSTA 4I09A 3ELKA 4I98B 2V9VA 3BP8A 2F5FA 1DDNA 1OPCA 2MA3A 3KZZA 5KK1A 1KU7A 5J6XA 1KU2A 3R4KA 1UHWA 4IJAA 2F2EA 2IA0A 3TOBA 2M8EA 3P7NA 2MC3A 3GLXA 3MZHA 1RUOA 1PP8F 2KJBA 1S7AA 1R1UA 1R5GA 3WTVC 2JTVA 2DU9A 1S3JA 3EYIA 1J9IA 4UHTA 1G3WA 2W57A 5BOXA 1QNTA 5FO5A 1KA8A 3HHHA 2PJPA 5E1XA 2E1CA 1SD7A 3HRTA 1HQCA 1BI2A 4OINF 2QQ9A 4G94A 3K1MA 1ON2A 2FBIA 2XAJA 3CLOA 2OQRA 2Z9OA 2BE5F 1HBXG 3DQVC 2L02A 2B0LA 1HKSA 2COMA 5K5QA 4O3MA 2VODA 2QVOA 2RNJA 3TOAA 2VONA 4L0ZB 2KIFA 1TBXA 1R7JA 4M71A 3TKYA 2NYXA 5DEQA 4L9NA 5FD5A 4WXCA 4I02A 3WG9A 3GEZA 4EM0B 1FSEA 5DV5A 1QZZA 3U9GA 1Z6RA 3TO7A 1R00A 1Q1HA 2AXLA 3DP7A 3J81K 3SXYA 4A5NA 1XCVA 1U5TA 3ZMDA 1YYVA 1SFEA 4KUMA 1USTA 1U5TC 3I59A 1REPC 3P9IA 3MWMA 3TO6A 1JHHA 3I64A 2P6TA 2DQRA 2LNBA 2EK5A 2PI0A 4XRFA 1MKMA 2HFHA 4K2EA 3RYRA 2YR2A 1O57A 4IHSA 3QPHA 1IN4A 4IHTA 1TLHB 1R5HA 1FYKA 5EEGA 1LEBA 1U2WA 1FP2A 1D5VA 2XAGA 5A2QZ 2RQPA 5FGMA 3ABTA 3CJNA 4M6XA 4EGYA 5HLGA 1RZ4A 4Q48A 1U8RA 2HQNA 4MGRA 2YPRA 1K6OA 3F3XA 4AIHA 3D0SA 5AIPA 5AIQA 4ENJA 5JFRA 3JSPA 1G4DA 3K69A 4G7OF 1AOYA 2UXNA 3CO7C 4N0BA 4CXFA 3KEOA 3HTUA 1TTYA 3BJ6A 5L3FA 2CG4A 2G7UA 4HLXA 4ESBA 1HKTA 1I6XA 3DKWA 4EM1A 4KN4X 4JK1X 5F64A 1BBYA 3QAHA 4OIPF 1X3UA 2ZNYA 3R60A 5A2QK 2XGXA 5D4RA 4U7DA 3RYPA 2BBYA 2W84A 1IN8A 4I0BA 4L0YB 1Y0UA 2DI3A 4B8XA 4KIFA 2HWVA 1V4RA 3HUGA 5HDNA 4HV6A 3FHZA 1XD7A 4I2OA 5E20A 3N4MA 3W6KB 2IT0A 3V7RA 5BS6A 1R23A 3U1DA 4UUVA 3QP5A 5DUKA 5D5VB 3KZYA 2NNNA 2F5CA 1FBUA 1H9GA 2M45A 2QWWA 3LA7A 4ZH4F 3V8LA 2JSCA 3KCCA 2EV6A 1S29A 4XSXF 5BQTA 2ISZA 2IA1A 4HOBA 4EV0A 3GW2A 2GQQA 5ILSA 3BOQA 1IN6A 4EMSA 1YS6A 2PLYA 2GIVA 3HSEA 1YW9A 4HW0A 4Q47A 4CHUA 1ZAOA 2ISYA 3L9FA 4MEXF 4H0EA 2IJLA 5JHUA 4A5MA 1ZHFA 3RKWA 4KFCA 3TDZC 4NQWA 1YS7A 1QPMA 4G7HF 3P9KA 4PZJA 3FZVA 2FF4A 3WGHA 3QOPA 1GXQA 1I27A 3ZMVA 3MAJA 1IXCA 2O61A 5FLXZ 1YFHA 3E6MA 3HOSA 4EJOA 4PGGA 5DCMB 2A69F 1J7KA 4YFNF 4RGSA 3IHUA 1DUXC 3WTZA 4QLCU 5E1ZB 3BJAA 2YU3A 4PGHA 2GXBA 5ICEA 2K86A 3IWZA 4R79A 3T8TA 5BPIA 2XVCA 1JGSA 2VN2A 2BGCA 1I5ZA 1FSHA 2ZKZA 4LMYA 4ZYHA 3SHFA 1F4KA 2O6GE 1TQPA 2YSRA 3QRFF 2Y48A 4RB1A 5HS9A 3BY6A 3G73A 1P4XA 4HA8A 2O3FA 5CVJA 1MD0A 3DXJF 2GZWA 2W24A 3F8MA 1T6SA 3LQQA 1SMYF 2A6EF 1OYYA 1BI0A 1ON1A 5J8CA 1KU9A 2EB7A 2HQRA 3GFIA 2JRTA 4LJZF 1J0RA 1O7LA 2G7HA 3KP7A 3L2CA 2O8XA 2GAUA 2E1NA 3DEUA 4BYYA 1LEAA 1SMTA 4PCQA 2LF7A 4XLNF 3ZMUA 4LD5A 5HDKA 3SFZA 2ZBKA 2HR3A 1IW7F 2WWYA 5LEJA 4IPAA 3RJPA 4I0AA 5FFZA 1BIAA 3HRUA 1J75A 3I58A 2DT5A 2HKOA 3F8FA 2XKPA 3PFIA 3HRSA 5AONA 4MTDA 2JPCA 4FHTA 3Q9VA 1T2KA 1R1TA 3COAC 2KIUA 3V7SA 5LGTA 1R58A 1G3SA 2P5LC 4U7BA 3KFWX 5IT9K 1XMAA 3IKVA 5ILVA 3FXUA 1QBJA 2DK8A 5LBQA 2FA5A 1LJ9A 1DPRA 1GXPA 4RB2C 3CUQB 2P7VB 4R1HA 1P6RA 3WTWC 2ZCWA 2O03A 2QYOA 3E5UA 2DO7A 1BIBA 2ZMEB 1OKRA 3ZP5A 4G7ZF 4CYDA 2LF8A 3E97A 1HW2A 5D5UB 1FLIA 1BN5A 5CVRA 3K1NA 3ISPA 1B59A 4BHBA 2DPUA 4Z2YA 4RGUA 2RKHA 3DPTA 5EEHA 4N9IA 1L0OC 3IL2A 1V3FA 3I5UA 5HLHA 4Q5SF 2FNPA 4L5IA 4GYIA 3LSTA 1BC7C 2P4WA 3GFLA 1ULYA 4U0WA 4NHJA 5CYVA 2XIGA 4LB6B 2YX7A 3F22A 2VBXA 3BPXA 5BMZA 5DCMA 2FBHA 1KQ9A 2HYFA 2J5OA 3ZN0A 4RB3C 3F23A 1ZG3A 2PG4A 3JW4A 3C3WA 2OQGA 4UXNA 3WU1B 4M6YA 4G6QA 2FOKA 2BYVE 3ZQ7A 4HDUA 4L5JA 2CYYA 2A68F 2CFXA 5E18F 4PDKA 1ZGAA 1IXRC 1OYIA 1R22A 2O0YA 4L18B 4M74A 2UXXA 5J8FA 4KDPA 2HDCA 2DW4A 3FM5A 3Q9SA 1KYWA 4MTEA 3M9AA 5E17F 3KP4A 2QBYB 4HX8A 2OZUA 2PEXA 2Y75A 4CO8A 3WE2A 2VBZA 1MJAA 3J7AO 5HOOA 1O3RA 4ON0A 3MCZA 1FT9A 2A6HF 3VEPA 2GA2A 1G3YA 2RVCA 3E6CC 4N9HA 1NHAA 4HYEA 1T98A 2AS5F 3KEQA 1J2XA 2IPQX 2QQBA 1XDUA 2NRAC 1P4AA 4S05A 2ESNA 4NB5A 2MD5A 2ZNZA 5JI6A 1ZRCA 5D8LB 3QU3A 4RS8A 3BWGA 4LFUA 1W5SA 1MZBA 1WI9A 1WSUA 3KLNA 4UVCA 4F7ZA 2V6CA 1A04A 3ZN1A 4GYGA 4QWQA 4OMZA 1K78B 3E3VA 2MLGA 3M1EA 5DCFA 2XASA 5JVTA 3V8KA 3GVAA 2XRNA 4Q4ZF 1Z91A 2FU4A 2VT2A 4GO1A 4LLLA 1JE8A 3BPVA 4RAZA 2XAHA 4G9YA 2H94A 4HF0A 3NQOA 4LG0B 4P9FA 3T1BA 5L3CA 2PQ8A 5D4SA 2C6YA 1FPQA 3C1DA 5D5WB 4BNCA 4M72A 5K5RA 4A0XA 3DFGA 2FSWA 1IZ1A 1HW5A 2VE8A 1XSXA 2P6SA 3CUQA 4A0ZA 3JAMZ 1XGOA 4HF1A 2QZ8A 2FRHA 4ZZDA 3CUQC 1LVAA 1ONVA 4A6DA 1O3TA 1H0MA 2ZMEA 2Z99A 3SZTA 2CO5A 3KP2A 5CVUA 2IW5A 1FZPB 3U2RA 4P5OA 1UCRA 2ESHA 3GO5A 4M9ZA 3EETA 1S7OA 3BJOA 3ZPLA 1HSJA 4I7HA 2ETHA 2V1DA 2A5YB 5DYMA 1RUNA 1B6AA 5HDGA 1P2FA 1W4MA 1H9TA 2G9WA 3I54A 2HTSA 4DNCA 4OOIA 3I4PA 1T0FA 2ZFWA 1ZLJA 4L9VA 4E70A 2H27A 1FNNA 3ZMZA 2GA1A 5DD4A 3K2ZA 4YG2F 2EWNA 5LHIA 3JAMK 4GCVA 3F72A 2VC0A 5LHHA 1UFMA 3LFKA 4CDGA 3GFMA 4YFKF 4R8HA 2X4HA 4AD9A 1ZREA 2DK5A 5K1YA 1YW7A 3C18A 2HEOA 2Y0MA 4U88A 2EV0A 4AVPA 4EQQA 4KA4A 4KYWA 2RN7A 1K79A 2QM3A 2XV4S 2H09A 1S8NA 1TQMA 4OU0A 5H6RA 3VB2A 2WC2A 1UHMA 1XB4A 4BXUA 4UV9A 4AWXB 1YLFA 3WE3A 3KLOA 2QBYA 2K02A 5HVQC 1SFXA 1STZA 1ZARA 1HW1A 3HRMA 4OIOF 2UZKA 4KICA 4HAMA 2D45A 5HS7A 5ILUA 2VT3A 3FXQA 4KT5C 5L3EA 1XMKA 2HTJA 2EA2A 4KIBA 2EJRA 4EJUA 1C0WA 4HBLA 4RB0A 2EV5A 1LDDA 3Q5FA 1W5TA 5HLIA 5L3BA 4HQMA 5LEKA 4M9XA 1K7AA 4EM2A 1F5TA 2Z5UA 4Y15A 1KYZA 3EDPA 3WTTC 1EH7A 1YIOA 4IVNA 5FD6A 3WGIA 4B09A 1O7FA 1LDJA 3O6BB 3B73A 2OAZA 5CJ9A 2EFWA 2EFQA 4CICA 2VE9A 2CWEA 2H6CA 3GZ6A 1OR7A 4WF2A 3RIRA 2GWRA 1YTYA 3REOA 3PQKA 3KP6A 4MQVA 4M73A 1Z05A 2HYGD 3GF2A 5FLXK 2MBFA 2QQAA 3T5XA 3M8FA 1P92A 1CGPA 4XLPF 1IAWA 4LG0A 5FB2A 4IRIA 1ZRFA 4YIFA 1Z9CA 3CTAA 4D0PA 3KP5A 1YO5C 3TGNA 5CVIA 1KQ8A 1OYWA 4I01A 1U5TB 2M5WA 2HOEA 5BPDA 1Z7UA 1IRFA 1QZYA 4A12A 3DF8A 1TQIA 3WODF 2KKOA 2WV0A 1B4AA 4KMFA 4ESJA 2FEZA 5DUIA 4KN7X 2H6BA 3GUDA 3JTHA 2DPDA 4MEYF 1AWCA 3HIFA 3H92A 1HKQA 1LQ1A 1EH6A 1RI7A 4HZFA 4LK0F 1DP7P 3VOEA 1WRJA 4BAYA 5LRRA 5E8GA 4FX4A 3WGGA 3V4GA 1FYLA 2DQLA 4KIGA 2Z33A 3GX4X 3RPUA 2P5VA 3IC7A 1LB2A 5LHGA 2JZYA 5CLSA 3LA2A 2STTA 1BI1A 1XGNA 3AAFA 1G6NA 3KP3A 3O2PE 2OU2A 1FC3A 2A61A 4WX9A 4WK8F 3DV8A 3E6BA 1BOAA 2KIMA 3F21A 3V8JA 2Q8KA 3I71A 1ZRDA 3EUHA 2LKPA 2XAFA 2ZO4A 3FWEA 6PAXA 2PMUA 1XCBA 4O6JA 1TNTA 1SD4A 3NRVA 3BDDA 2IA2A 5D6EA 3KE2A 4GXOA 3ZMTA 2GXGA 1MJBA 3K9TA 3IRQA 1IXSB 3ERED 4LGWA 3H3ZA 2CGPA 1PUEE 4ENKA 4Y13A 2FE3A 4HV5A 1XSVA 2UWMA 1WQ2A 3RKXA 2R3SA 1FOKA 4TV7A 3TO9A 1PDNC 3GYHX 3B02A 2L4MA 1JXSA 5D5XB 1J59A 2P8TA 2JT1A 5HS8A 2JPBA 4P96A 4KNYA 1GHCA 3P9CA 4MHGA 3MFKA 1U6GA 3J81Z 1ZLKA 4BHCA 2STWA 5F6FA 3RTRA 2MH9A 2YX4A 1MDMB 3J80Z 4ZYGA 2K7LA 4EJVA 1FY7A 4HX7A 3ABUA 5ICGA 3HYIA 1UB9A 3RPQA 2XUBA 3HOTA 2FMYA 4RGRA 4P9UA 3F8CA 5H20A 2OZ6A 3FF5A 5IT3A 3E5XA 3MQ0A 4HX4A 3GZ5A 3F6VA 2M30A 4Y17A 1XSDA 1Z1DA 1BC8C 2PFBA 3E6DA 3MEXA 1YQAA 2VBYA 5E8IA 1BI3A 5FFXA 4IRGA 2VOOA 3ULQB 3I0TA 2HZTA 1FBQA 3IKTA 4KMUX 1FBSA 3W6JB 3OV8A 4U0VA 3T8RA 2MH2A 2PMHA 4WXDA 4OMYA 2XAQA 1LDKB 5TJJA 2ACJA 1D8KA 3F8NA 3HTSB 5H6QA 2ZJ2A 1D8JA 3J80K 5K5OA 2CQKA 3H3UA 4WXHA 1O3QA 1R1VA 2V1XA 1OMIA 4MQ9F 2F5EA 2EFOA 3L7WA 3GWZA 4UV8A 4UVBA 2DTRA 3JSOA 5F1RA 2CSOA 1O3SA 1W7PB 1ZYRF 1QGPA 3KETA 1YW8A 5ERIA 3CO6C 1IUYA 1ZG5A 2NAZA 1W7PD 5ICCA 3F6OA 3GFJA 4JBAA 2HGCA 2K27A 3QU6A 2OA4A 2QENA 1TW2A 2Z3YA 3EQLF 3WTYC 1DPUA 1F9NA 1KGSA 4ENMA 3JTGA 3MZYA 4WCGA 1E17A 2RGVA 2QUFA 3F8BA 4A2UA 2FMLA 3IWFA 1BM9A 3FMQA 1QQIA 4UVAA 2XROA 2HKXA 4LB5A 1USSA 4JQFA 4HDVA 3LWFA 3ZMSA 1J5YA 4LLNA 4ASNA 2A07F 5E1WA 2A3SA 3FMSA 2DFIA 1MGTA 1I1SA 2NS0A 2P7CB 4HLYA 2TDXA 2P5KA 1FYMA 2BV6A 4LLGF 3QPTA 2PBIA 2IP2A 5L3DA 4EGZA 4G8XA 3QP6A 1E2XA 4AIJA 4RGXA 2EA4A 1FWZA 3NEUA 4AIKA 4ZYDA 3BZ6A 1CF7B 3K1PA 2DAOA 2VXZA 3TDUC 3M8EA 4BQAA 1T39A 1FP1D 2M1BA 1SD5A 2EFPA 4ZYEA 2CW0F 1QO0D 5LLQA 2OD5A 3ROUA 4BH9A 1RIOH 1SD6A 2KRFA 2DLLA 2EFNA 2LSOA 1MDMA 4EJWA 4UNOA 4ENNA 2OBPA 4IRHA 4YFXF 4RAYA 3TQNA 1JHFA 3ECOA 3CUOA 2ADUA 4ESFA 3FMRA 3S2WA 1TNSA 1BJAA 2V79A 3LAPA 1IN7A 2QLZA 3E5QA 3IRRA 2X0LA 3BROA 2VC1A 1B1BA 3PQJA 3N97A 3SZPA 4S04A 2D2WA 2J5PA 2D1VA 3G3ZA 2HS5A 1TW3A 1SFUA 1KU3A 2IVMA 1IN5A 4A6EA 1L3LA 2RV8A 4O5VA 4CZZA 1R36A 4L9TA 2PN6A 2M87A 2Q0OA 3O3KA 4XBFA 1XN7A 1Z6TA 2FQ3A 2D1HA 2BEOA 1KQ0A 4A0YA 2RC4A 2F5DA 2FBKA 3WTSC 5L3GA 4IF4A 1W7PA 3VODA 3RKYA 3T0YA 4FX0A 3OOPA 2ELHA 3I53A 3FX3A 3V7CA 2L54A 4P55A 4WWCA 1G3TA 5D8KB 1K78A 3EYYA 4EVIA 5ED4A 2Q2EA 4HF2A 2E7WA 3RDIA 4OIRF 5KVRA 1EH8A 1PP7U 3HSFA 3D5LA 1MJ9A 3R61A 5D6FA 2VBWA 2XHKA 2L3DA 3LA3A 3M7GA 4CGZA 2L4AA 1IRGA 1WKMA 3VFZA 1I1GA 3WTUC 4YIIA 3R0JA 1ZH5A 1VTNC 1IF1A 1ZN2A 3WTXC 3I59B 5TRDA 1WWXA 3C7JA 3DPLC 4U0YA 5DD8A 2WTEA 1RNLA 5LGUA 5IT9Z 2VOPA 4M9SA 4ETSA 2XKOA 1EV7A 2V1UA 3SQNA 2DBBA 4MNUA 1B9MA 3R6SA 4G6DA 4EJTA 1T38A 1FX7A 4IXAA 1YG2A 2R7DA 5LRSA 1GVJA 5JR3A 1HXDA 1U78A 3ML6A 4XSZF 3HSRA 2LDUA 2RDPA 4BHPA 1XGSA 2ZXJA 1ZG1A 5ICFA 3K0LA 3LAJA 5DDGA 2K4JA 3RI4A 1SAXA 5LGNA 1XDSA 1CF7A 3CDHA 2IRFG 1ODDA 4LK1F 3ECHA 3GXOA 1F1ZA 3LQRA 1B9NA 1XGMA 4FT8A 5CVVA 3HHGA 2NNYA 3FXRA 4L9JA 1S6LA 2R7FA 2W25A 3L09A 1P4WA 2FXAA 4GGGA 3L00A 3WU0A 3R0AA 4ZZLA 1LNWA 4DQ2A 1D3YA 2FNAA 1ZGJA 2KJCA 3FM3A 2W85A 2MLKA 4OIQF 2L01A 2K4BA 1U3EM 4HQEA 2E7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HST A;  4I09 A;  3ELK A;  4I98 B;  2V9V A;  3BP8 A;  2F5F A;  1DDN A;  1OPC A;  2MA3 A;  3KZZ A;  5KK1 A;  1KU7 A;  5J6X A;  1KU2 A;  3R4K A;  1UHW A;  4IJA A;  2F2E A;  2IA0 A;  3TOB A;  2M8E A;  3P7N A;  2MC3 A;  3GLX A;  3MZH A;  1RUO A;  1PP8 F;  2KJB A;  1S7A A;  1R1U A;  1R5G A;  3WTV C;  2JTV A;  2DU9 A;  1S3J A;  3EYI A;  1J9I A;  4UHT A;  1G3W A;  2W57 A;  5BOX A;  1QNT A;  5FO5 A;  1KA8 A;  3HHH A;  2PJP A;  5E1X A;  2E1C A;  1SD7 A;  3HRT A;  1HQC A;  1BI2 A;  4OIN F;  2QQ9 A;  4G94 A;  3K1M A;  1ON2 A;  2FBI A;  2XAJ A;  3CLO A;  2OQR A;  2Z9O A;  2BE5 F;  1HBX G;  3DQV C;  2L02 A;  2B0L A;  1HKS A;  2COM A;  5K5Q A;  4O3M A;  2VOD A;  2QVO A;  2RNJ A;  3TOA A;  2VON A;  4L0Z B;  2KIF A;  1TBX A;  1R7J A;  4M71 A;  3TKY A;  2NYX A;  5DEQ A;  4L9N A;  5FD5 A;  4WXC A;  4I02 A;  3WG9 A;  3GEZ A;  4EM0 B;  1FSE A;  5DV5 A;  1QZZ A;  3U9G A;  1Z6R A;  3TO7 A;  1R00 A;  1Q1H A;  2AXL A;  3DP7 A;  3J81 K;  3SXY A;  4A5N A;  1XCV A;  1U5T A;  3ZMD A;  1YYV A;  1SFE A;  4KUM A;  1UST A;  1U5T C;  3I59 A;  1REP C;  3P9I A;  3MWM A;  3TO6 A;  1JHH A;  3I64 A;  2P6T A;  2DQR A;  2LNB A;  2EK5 A;  2PI0 A;  4XRF A;  1MKM A;  2HFH A;  4K2E A;  3RYR A;  2YR2 A;  1O57 A;  4IHS A;  3QPH A;  1IN4 A;  4IHT A;  1TLH B;  1R5H A;  1FYK A;  5EEG A;  1LEB A;  1U2W A;  1FP2 A;  1D5V A;  2XAG A;  5A2Q Z;  2RQP A;  5FGM A;  3ABT A;  3CJN A;  4M6X A;  4EGY A;  5HLG A;  1RZ4 A;  4Q48 A;  1U8R A;  2HQN A;  4MGR A;  2YPR A;  1K6O A;  3F3X A;  4AIH A;  3D0S A;  5AIP A;  5AIQ A;  4ENJ A;  5JFR A;  3JSP A;  1G4D A;  3K69 A;  4G7O F;  1AOY A;  2UXN A;  3CO7 C;  4N0B A;  4CXF A;  3KEO A;  3HTU A;  1TTY A;  3BJ6 A;  5L3F A;  2CG4 A;  2G7U A;  4HLX A;  4ESB A;  1HKT A;  1I6X A;  3DKW A;  4EM1 A;  4KN4 X;  4JK1 X;  5F64 A;  1BBY A;  3QAH A;  4OIP F;  1X3U A;  2ZNY A;  3R60 A;  5A2Q K;  2XGX A;  5D4R A;  4U7D A;  3RYP A;  2BBY A;  2W84 A;  1IN8 A;  4I0B A;  4L0Y B;  1Y0U A;  2DI3 A;  4B8X A;  4KIF A;  2HWV A;  1V4R A;  3HUG A;  5HDN A;  4HV6 A;  3FHZ A;  1XD7 A;  4I2O A;  5E20 A;  3N4M A;  3W6K B;  2IT0 A;  3V7R A;  5BS6 A;  1R23 A;  3U1D A;  4UUV A;  3QP5 A;  5DUK A;  5D5V B;  3KZY A;  2NNN A;  2F5C A;  1FBU A;  1H9G A;  2M45 A;  2QWW A;  3LA7 A;  4ZH4 F;  3V8L A;  2JSC A;  3KCC A;  2EV6 A;  1S29 A;  4XSX F;  5BQT A;  2ISZ A;  2IA1 A;  4HOB A;  4EV0 A;  3GW2 A;  2GQQ A;  5ILS A;  3BOQ A;  1IN6 A;  4EMS A;  1YS6 A;  2PLY A;  2GIV A;  3HSE A;  1YW9 A;  4HW0 A;  4Q47 A;  4CHU A;  1ZAO A;  2ISY A;  3L9F A;  4MEX F;  4H0E A;  2IJL A;  5JHU A;  4A5M A;  1ZHF A;  3RKW A;  4KFC A;  3TDZ C;  4NQW A;  1YS7 A;  1QPM A;  4G7H F;  3P9K A;  4PZJ A;  3FZV A;  2FF4 A;  3WGH A;  3QOP A;  1GXQ A;  1I27 A;  3ZMV A;  3MAJ A;  1IXC A;  2O61 A;  5FLX Z;  1YFH A;  3E6M A;  3HOS A;  4EJO A;  4PGG A;  5DCM B;  2A69 F;  1J7K A;  4YFN F;  4RGS A;  3IHU A;  1DUX C;  3WTZ A;  4QLC U;  5E1Z B;  3BJA A;  2YU3 A;  4PGH A;  2GXB A;  5ICE A;  2K86 A;  3IWZ A;  4R79 A;  3T8T A;  5BPI A;  2XVC A;  1JGS A;  2VN2 A;  2BGC A;  1I5Z A;  1FSH A;  2ZKZ A;  4LMY A;  4ZYH A;  3SHF A;  1F4K A;  2O6G E;  1TQP A;  2YSR A;  3QRF F;  2Y48 A;  4RB1 A;  5HS9 A;  3BY6 A;  3G73 A;  1P4X A;  4HA8 A;  2O3F A;  5CVJ A;  1MD0 A;  3DXJ F;  2GZW A;  2W24 A;  3F8M A;  1T6S A;  3LQQ A;  1SMY F;  2A6E F;  1OYY A;  1BI0 A;  1ON1 A;  5J8C A;  1KU9 A;  2EB7 A;  2HQR A;  3GFI A;  2JRT A;  4LJZ F;  1J0R A;  1O7L A;  2G7H A;  3KP7 A;  3L2C A;  2O8X A;  2GAU A;  2E1N A;  3DEU A;  4BYY A;  1LEA A;  1SMT A;  4PCQ A;  2LF7 A;  4XLN F;  3ZMU A;  4LD5 A;  5HDK A;  3SFZ A;  2ZBK A;  2HR3 A;  1IW7 F;  2WWY A;  5LEJ A;  4IPA A;  3RJP A;  4I0A A;  5FFZ A;  1BIA A;  3HRU A;  1J75 A;  3I58 A;  2DT5 A;  2HKO A;  3F8F A;  2XKP A;  3PFI A;  3HRS A;  5AON A;  4MTD A;  2JPC A;  4FHT A;  3Q9V A;  1T2K A;  1R1T A;  3COA C;  2KIU A;  3V7S A;  5LGT A;  1R58 A;  1G3S A;  2P5L C;  4U7B A;  3KFW X;  5IT9 K;  1XMA A;  3IKV A;  5ILV A;  3FXU A;  1QBJ A;  2DK8 A;  5LBQ A;  2FA5 A;  1LJ9 A;  1DPR A;  1GXP A;  4RB2 C;  3CUQ B;  2P7V B;  4R1H A;  1P6R A;  3WTW C;  2ZCW A;  2O03 A;  2QYO A;  3E5U A;  2DO7 A;  1BIB A;  2ZME B;  1OKR A;  3ZP5 A;  4G7Z F;  4CYD A;  2LF8 A;  3E97 A;  1HW2 A;  5D5U B;  1FLI A;  1BN5 A;  5CVR A;  3K1N A;  3ISP A;  1B59 A;  4BHB A;  2DPU A;  4Z2Y A;  4RGU A;  2RKH A;  3DPT A;  5EEH A;  4N9I A;  1L0O C;  3IL2 A;  1V3F A;  3I5U A;  5HLH A;  4Q5S F;  2FNP A;  4L5I A;  4GYI A;  3LST A;  1BC7 C;  2P4W A;  3GFL A;  1ULY A;  4U0W A;  4NHJ A;  5CYV A;  2XIG A;  4LB6 B;  2YX7 A;  3F22 A;  2VBX A;  3BPX A;  5BMZ A;  5DCM A;  2FBH A;  1KQ9 A;  2HYF A;  2J5O A;  3ZN0 A;  4RB3 C;  3F23 A;  1ZG3 A;  2PG4 A;  3JW4 A;  3C3W A;  2OQG A;  4UXN A;  3WU1 B;  4M6Y A;  4G6Q A;  2FOK A;  2BYV E;  3ZQ7 A;  4HDU A;  4L5J A;  2CYY A;  2A68 F;  2CFX A;  5E18 F;  4PDK A;  1ZGA A;  1IXR C;  1OYI A;  1R22 A;  2O0Y A;  4L18 B;  4M74 A;  2UXX A;  5J8F A;  4KDP A;  2HDC A;  2DW4 A;  3FM5 A;  3Q9S A;  1KYW A;  4MTE A;  3M9A A;  5E17 F;  3KP4 A;  2QBY B;  4HX8 A;  2OZU A;  2PEX A;  2Y75 A;  4CO8 A;  3WE2 A;  2VBZ A;  1MJA A;  3J7A O;  5HOO A;  1O3R A;  4ON0 A;  3MCZ A;  1FT9 A;  2A6H F;  3VEP A;  2GA2 A;  1G3Y A;  2RVC A;  3E6C C;  4N9H A;  1NHA A;  4HYE A;  1T98 A;  2AS5 F;  3KEQ A;  1J2X A;  2IPQ X;  2QQB A;  1XDU A;  2NRA C;  1P4A A;  4S05 A;  2ESN A;  4NB5 A;  2MD5 A;  2ZNZ A;  5JI6 A;  1ZRC A;  5D8L B;  3QU3 A;  4RS8 A;  3BWG A;  4LFU A;  1W5S A;  1MZB A;  1WI9 A;  1WSU A;  3KLN A;  4UVC A;  4F7Z A;  2V6C A;  1A04 A;  3ZN1 A;  4GYG A;  4QWQ A;  4OMZ A;  1K78 B;  3E3V A;  2MLG A;  3M1E A;  5DCF A;  2XAS A;  5JVT A;  3V8K A;  3GVA A;  2XRN A;  4Q4Z F;  1Z91 A;  2FU4 A;  2VT2 A;  4GO1 A;  4LLL A;  1JE8 A;  3BPV A;  4RAZ A;  2XAH A;  4G9Y A;  2H94 A;  4HF0 A;  3NQO A;  4LG0 B;  4P9F A;  3T1B A;  5L3C A;  2PQ8 A;  5D4S A;  2C6Y A;  1FPQ A;  3C1D A;  5D5W B;  4BNC A;  4M72 A;  5K5R A;  4A0X A;  3DFG A;  2FSW A;  1IZ1 A;  1HW5 A;  2VE8 A;  1XSX A;  2P6S A;  3CUQ A;  4A0Z A;  3JAM Z;  1XGO A;  4HF1 A;  2QZ8 A;  2FRH A;  4ZZD A;  3CUQ C;  1LVA A;  1ONV A;  4A6D A;  1O3T A;  1H0M A;  2ZME A;  2Z99 A;  3SZT A;  2CO5 A;  3KP2 A;  5CVU A;  2IW5 A;  1FZP B;  3U2R A;  4P5O A;  1UCR A;  2ESH A;  3GO5 A;  4M9Z A;  3EET A;  1S7O A;  3BJO A;  3ZPL A;  1HSJ A;  4I7H A;  2ETH A;  2V1D A;  2A5Y B;  5DYM A;  1RUN A;  1B6A A;  5HDG A;  1P2F A;  1W4M A;  1H9T A;  2G9W A;  3I54 A;  2HTS A;  4DNC A;  4OOI A;  3I4P A;  1T0F A;  2ZFW A;  1ZLJ A;  4L9V A;  4E70 A;  2H27 A;  1FNN A;  3ZMZ A;  2GA1 A;  5DD4 A;  3K2Z A;  4YG2 F;  2EWN A;  5LHI A;  3JAM K;  4GCV A;  3F72 A;  2VC0 A;  5LHH A;  1UFM A;  3LFK A;  4CDG A;  3GFM A;  4YFK F;  4R8H A;  2X4H A;  4AD9 A;  1ZRE A;  2DK5 A;  5K1Y A;  1YW7 A;  3C18 A;  2HEO A;  2Y0M A;  4U88 A;  2EV0 A;  4AVP A;  4EQQ A;  4KA4 A;  4KYW A;  2RN7 A;  1K79 A;  2QM3 A;  2XV4 S;  2H09 A;  1S8N A;  1TQM A;  4OU0 A;  5H6R A;  3VB2 A;  2WC2 A;  1UHM A;  1XB4 A;  4BXU A;  4UV9 A;  4AWX B;  1YLF A;  3WE3 A;  3KLO A;  2QBY A;  2K02 A;  5HVQ C;  1SFX A;  1STZ A;  1ZAR A;  1HW1 A;  3HRM A;  4OIO F;  2UZK A;  4KIC A;  4HAM A;  2D45 A;  5HS7 A;  5ILU A;  2VT3 A;  3FXQ A;  4KT5 C;  5L3E A;  1XMK A;  2HTJ A;  2EA2 A;  4KIB A;  2EJR A;  4EJU A;  1C0W A;  4HBL A;  4RB0 A;  2EV5 A;  1LDD A;  3Q5F A;  1W5T A;  5HLI A;  5L3B A;  4HQM A;  5LEK A;  4M9X A;  1K7A A;  4EM2 A;  1F5T A;  2Z5U A;  4Y15 A;  1KYZ A;  3EDP A;  3WTT C;  1EH7 A;  1YIO A;  4IVN A;  5FD6 A;  3WGI A;  4B09 A;  1O7F A;  1LDJ A;  3O6B B;  3B73 A;  2OAZ A;  5CJ9 A;  2EFW A;  2EFQ A;  4CIC A;  2VE9 A;  2CWE A;  2H6C A;  3GZ6 A;  1OR7 A;  4WF2 A;  3RIR A;  2GWR A;  1YTY A;  3REO A;  3PQK A;  3KP6 A;  4MQV A;  4M73 A;  1Z05 A;  2HYG D;  3GF2 A;  5FLX K;  2MBF A;  2QQA A;  3T5X A;  3M8F A;  1P92 A;  1CGP A;  4XLP F;  1IAW A;  4LG0 A;  5FB2 A;  4IRI A;  1ZRF A;  4YIF A;  1Z9C A;  3CTA A;  4D0P A;  3KP5 A;  1YO5 C;  3TGN A;  5CVI A;  1KQ8 A;  1OYW A;  4I01 A;  1U5T B;  2M5W A;  2HOE A;  5BPD A;  1Z7U A;  1IRF A;  1QZY A;  4A12 A;  3DF8 A;  1TQI A;  3WOD F;  2KKO A;  2WV0 A;  1B4A A;  4KMF A;  4ESJ A;  2FEZ A;  5DUI A;  4KN7 X;  2H6B A;  3GUD A;  3JTH A;  2DPD A;  4MEY F;  1AWC A;  3HIF A;  3H92 A;  1HKQ A;  1LQ1 A;  1EH6 A;  1RI7 A;  4HZF A;  4LK0 F;  1DP7 P;  3VOE A;  1WRJ A;  4BAY A;  5LRR A;  5E8G A;  4FX4 A;  3WGG A;  3V4G A;  1FYL A;  2DQL A;  4KIG A;  2Z33 A;  3GX4 X;  3RPU A;  2P5V A;  3IC7 A;  1LB2 A;  5LHG A;  2JZY A;  5CLS A;  3LA2 A;  2STT A;  1BI1 A;  1XGN A;  3AAF A;  1G6N A;  3KP3 A;  3O2P E;  2OU2 A;  1FC3 A;  2A61 A;  4WX9 A;  4WK8 F;  3DV8 A;  3E6B A;  1BOA A;  2KIM A;  3F21 A;  3V8J A;  2Q8K A;  3I71 A;  1ZRD A;  3EUH A;  2LKP A;  2XAF A;  2ZO4 A;  3FWE A;  6PAX A;  2PMU A;  1XCB A;  4O6J A;  1TNT A;  1SD4 A;  3NRV A;  3BDD A;  2IA2 A;  5D6E A;  3KE2 A;  4GXO A;  3ZMT A;  2GXG A;  1MJB A;  3K9T A;  3IRQ A;  1IXS B;  3ERE D;  4LGW A;  3H3Z A;  2CGP A;  1PUE E;  4ENK A;  4Y13 A;  2FE3 A;  4HV5 A;  1XSV A;  2UWM A;  1WQ2 A;  3RKX A;  2R3S A;  1FOK A;  4TV7 A;  3TO9 A;  1PDN C;  3GYH X;  3B02 A;  2L4M A;  1JXS A;  5D5X B;  1J59 A;  2P8T A;  2JT1 A;  5HS8 A;  2JPB A;  4P96 A;  4KNY A;  1GHC A;  3P9C A;  4MHG A;  3MFK A;  1U6G A;  3J81 Z;  1ZLK A;  4BHC A;  2STW A;  5F6F A;  3RTR A;  2MH9 A;  2YX4 A;  1MDM B;  3J80 Z;  4ZYG A;  2K7L A;  4EJV A;  1FY7 A;  4HX7 A;  3ABU A;  5ICG A;  3HYI A;  1UB9 A;  3RPQ A;  2XUB A;  3HOT A;  2FMY A;  4RGR A;  4P9U A;  3F8C A;  5H20 A;  2OZ6 A;  3FF5 A;  5IT3 A;  3E5X A;  3MQ0 A;  4HX4 A;  3GZ5 A;  3F6V A;  2M30 A;  4Y17 A;  1XSD A;  1Z1D A;  1BC8 C;  2PFB A;  3E6D A;  3MEX A;  1YQA A;  2VBY A;  5E8I A;  1BI3 A;  5FFX A;  4IRG A;  2VOO A;  3ULQ B;  3I0T A;  2HZT A;  1FBQ A;  3IKT A;  4KMU X;  1FBS A;  3W6J B;  3OV8 A;  4U0V A;  3T8R A;  2MH2 A;  2PMH A;  4WXD A;  4OMY A;  2XAQ A;  1LDK B;  5TJJ A;  2ACJ A;  1D8K A;  3F8N A;  3HTS B;  5H6Q A;  2ZJ2 A;  1D8J A;  3J80 K;  5K5O A;  2CQK A;  3H3U A;  4WXH A;  1O3Q A;  1R1V A;  2V1X A;  1OMI A;  4MQ9 F;  2F5E A;  2EFO A;  3L7W A;  3GWZ A;  4UV8 A;  4UVB A;  2DTR A;  3JSO A;  5F1R A;  2CSO A;  1O3S A;  1W7P B;  1ZYR F;  1QGP A;  3KET A;  1YW8 A;  5ERI A;  3CO6 C;  1IUY A;  1ZG5 A;  2NAZ A;  1W7P D;  5ICC A;  3F6O A;  3GFJ A;  4JBA A;  2HGC A;  2K27 A;  3QU6 A;  2OA4 A;  2QEN A;  1TW2 A;  2Z3Y A;  3EQL F;  3WTY C;  1DPU A;  1F9N A;  1KGS A;  4ENM A;  3JTG A;  3MZY A;  4WCG A;  1E17 A;  2RGV A;  2QUF A;  3F8B A;  4A2U A;  2FML A;  3IWF A;  1BM9 A;  3FMQ A;  1QQI A;  4UVA A;  2XRO A;  2HKX A;  4LB5 A;  1USS A;  4JQF A;  4HDV A;  3LWF A;  3ZMS A;  1J5Y A;  4LLN A;  4ASN A;  2A07 F;  5E1W A;  2A3S A;  3FMS A;  2DFI A;  1MGT A;  1I1S A;  2NS0 A;  2P7C B;  4HLY A;  2TDX A;  2P5K A;  1FYM A;  2BV6 A;  4LLG F;  3QPT A;  2PBI A;  2IP2 A;  5L3D A;  4EGZ A;  4G8X A;  3QP6 A;  1E2X A;  4AIJ A;  4RGX A;  2EA4 A;  1FWZ A;  3NEU A;  4AIK A;  4ZYD A;  3BZ6 A;  1CF7 B;  3K1P A;  2DAO A;  2VXZ A;  3TDU C;  3M8E A;  4BQA A;  1T39 A;  1FP1 D;  2M1B A;  1SD5 A;  2EFP A;  4ZYE A;  2CW0 F;  1QO0 D;  5LLQ A;  2OD5 A;  3ROU A;  4BH9 A;  1RIO H;  1SD6 A;  2KRF A;  2DLL A;  2EFN A;  2LSO A;  1MDM A;  4EJW A;  4UNO A;  4ENN A;  2OBP A;  4IRH A;  4YFX F;  4RAY A;  3TQN A;  1JHF A;  3ECO A;  3CUO A;  2ADU A;  4ESF A;  3FMR A;  3S2W A;  1TNS A;  1BJA A;  2V79 A;  3LAP A;  1IN7 A;  2QLZ A;  3E5Q A;  3IRR A;  2X0L A;  3BRO A;  2VC1 A;  1B1B A;  3PQJ A;  3N97 A;  3SZP A;  4S04 A;  2D2W A;  2J5P A;  2D1V A;  3G3Z A;  2HS5 A;  1TW3 A;  1SFU A;  1KU3 A;  2IVM A;  1IN5 A;  4A6E A;  1L3L A;  2RV8 A;  4O5V A;  4CZZ A;  1R36 A;  4L9T A;  2PN6 A;  2M87 A;  2Q0O A;  3O3K A;  4XBF A;  1XN7 A;  1Z6T A;  2FQ3 A;  2D1H A;  2BEO A;  1KQ0 A;  4A0Y A;  2RC4 A;  2F5D A;  2FBK A;  3WTS C;  5L3G A;  4IF4 A;  1W7P A;  3VOD A;  3RKY A;  3T0Y A;  4FX0 A;  3OOP A;  2ELH A;  3I53 A;  3FX3 A;  3V7C A;  2L54 A;  4P55 A;  4WWC A;  1G3T A;  5D8K B;  1K78 A;  3EYY A;  4EVI A;  5ED4 A;  2Q2E A;  4HF2 A;  2E7W A;  3RDI A;  4OIR F;  5KVR A;  1EH8 A;  1PP7 U;  3HSF A;  3D5L A;  1MJ9 A;  3R61 A;  5D6F A;  2VBW A;  2XHK A;  2L3D A;  3LA3 A;  3M7G A;  4CGZ A;  2L4A A;  1IRG A;  1WKM A;  3VFZ A;  1I1G A;  3WTU C;  4YII A;  3R0J A;  1ZH5 A;  1VTN C;  1IF1 A;  1ZN2 A;  3WTX C;  3I59 B;  5TRD A;  1WWX A;  3C7J A;  3DPL C;  4U0Y A;  5DD8 A;  2WTE A;  1RNL A;  5LGU A;  5IT9 Z;  2VOP A;  4M9S A;  4ETS A;  2XKO A;  1EV7 A;  2V1U A;  3SQN A;  2DBB A;  4MNU A;  1B9M A;  3R6S A;  4G6D A;  4EJT A;  1T38 A;  1FX7 A;  4IXA A;  1YG2 A;  2R7D A;  5LRS A;  1GVJ A;  5JR3 A;  1HXD A;  1U78 A;  3ML6 A;  4XSZ F;  3HSR A;  2LDU A;  2RDP A;  4BHP A;  1XGS A;  2ZXJ A;  1ZG1 A;  5ICF A;  3K0L A;  3LAJ A;  5DDG A;  2K4J A;  3RI4 A;  1SAX A;  5LGN A;  1XDS A;  1CF7 A;  3CDH A;  2IRF G;  1ODD A;  4LK1 F;  3ECH A;  3GXO A;  1F1Z A;  3LQR A;  1B9N A;  1XGM A;  4FT8 A;  5CVV A;  3HHG A;  2NNY A;  3FXR A;  4L9J A;  1S6L A;  2R7F A;  2W25 A;  3L09 A;  1P4W A;  2FXA A;  4GGG A;  3L00 A;  3WU0 A;  3R0A A;  4ZZL A;  1LNW A;  4DQ2 A;  1D3Y A;  2FNA A;  1ZGJ A;  2KJC A;  3FM3 A;  2W85 A;  2MLK A;  4OIQ F;  2L01 A;  2K4B A;  1U3E M;  4HQE A;  2E7X A; 
#chains in the Genus database with same CATH topology
 1HST A;  4EEF G;  3ZQL A;  1JT6 A;  4I09 A;  4F93 B;  2Z16 A;  3FXO A;  3ELK A;  2LTP A;  4I98 B;  2V9V A;  3BP8 A;  2F4O B;  2F5F A;  1DDN A;  1OPC A;  2MA3 A;  3KZZ A;  5KK1 A;  1KU7 A;  3J7Z I;  5J6X A;  1KU2 A;  3R4K A;  1UHW A;  4IJA A;  2AXT C;  3OYN A;  2DOF A;  4CYC B;  2F2E A;  4BUP A;  3HDD A;  3SFI A;  2VQH A;  2IA0 A;  3D5S C;  3TOB A;  2M8E A;  3H1C A;  4FIS A;  4GDF A;  3P7N A;  2BXZ A;  2IAI A;  3ZQC A;  4OAZ A;  2MC3 A;  3GLX A;  3MZH A;  1VQ7 I;  2L2O A;  2QA4 I;  1RUO A;  1PP8 F;  2KJB A;  3E1S A;  3JRI A;  1S7A A;  2AQF A;  3S1N J;  3HG9 A;  1R1U A;  1R5G A;  3WTV C;  2JTV A;  2JVG A;  2DU9 A;  1W36 D;  2XRL A;  1SFK A;  1S3J A;  4PJN A;  3EYI A;  3PM1 A;  2HQA A;  1J9I A;  4UHT A;  1G3W A;  1YIT I;  1I50 J;  2W57 A;  5BOX A;  1QNT A;  5FO5 A;  1KA8 A;  3HHH A;  2VKD A;  4QPQ A;  2NVY J;  4LG3 A;  1X19 A;  2GM4 A;  1D5Y A;  3A01 A;  2PJP A;  5E1X A;  1WJD A;  5EG0 A;  2FJ1 A;  2E1C A;  3S17 J;  1QHH D;  1SD7 A;  3HRT A;  5HNH A;  1B72 B;  1HQC A;  1BI2 A;  4OIN F;  2QQ9 A;  4G94 A;  3OSG A;  4F3Q A;  2LVS A;  3K1M A;  1WHU A;  1ON2 A;  4E7K A;  1YX3 A;  2FBI A;  3CLO A;  2XAJ A;  2OQR A;  1V5G A;  2VXD A;  2Z9O A;  3PIP F;  4JP0 A;  4FCY A;  2BE5 F;  3GCM A;  3L2V A;  3MN2 A;  1PUF B;  2K9L A;  1HBX G;  2MYS A;  3DQV C;  2L02 A;  2B0L A;  1HKS A;  2COM A;  5K5Q A;  4O3M A;  2K9S A;  2X6Y A;  2VJJ A;  2BZT A;  2VOD A;  1XS9 A;  1E3O C;  2ZSI B;  2QVO A;  2RNJ A;  1VQP I;  2EBI A;  4HNT A;  3TOA A;  2VON A;  4L0Z B;  2KIF A;  1TBX A;  3CDI A;  1R7J A;  1TWH J;  4M71 A;  3TKY A;  2MD0 A;  2NYX A;  5K7Z A;  3S93 A;  4ZDO A;  4J19 A;  5DEQ A;  4L9N A;  5FD5 A;  1UG2 A;  2R7U A;  4WXC A;  4I02 A;  5GPA A;  5KAI C;  4DBR A;  3H0D A;  4NQW B;  1BL0 A;  3WG9 A;  1T33 A;  3GEZ A;  2RQQ A;  3AG1 H;  1ORK A;  4EM0 B;  1FSE A;  5IOY A;  3HOZ J;  1Z3Y A;  1ZTR A;  5DV5 A;  1QZZ A;  3U9G A;  1JKO C;  1Z6R A;  4A3E J;  1YIJ I;  2WAD A;  3TO7 A;  1XTA A;  3TED A;  1R00 A;  3OYM A;  1Q1H A;  2AXL A;  3DP7 A;  3J81 K;  2M2E A;  2BHZ A;  3P5J A;  3SXY A;  1XCV A;  4A5N A;  2V1N A;  1U5T A;  3ZMD A;  1YYV A;  1SFE A;  2HVQ A;  4KUM A;  1UST A;  1U5T C;  2W4S A;  3I59 A;  3K10 A;  1REP C;  4U87 A;  3RQI A;  3P9I A;  3MVP A;  3MWM A;  3TO6 A;  1JHH A;  1N77 A;  3I64 A;  2P6T A;  2DQR A;  5J4V A;  2LNB A;  2EK5 A;  3BQZ A;  4XIC A;  1DGW Y;  2PI0 A;  4XRF A;  1HC8 A;  1MKM A;  2HFH A;  2L7Z A;  1JGG A;  4AUX A;  1MMS A;  4K2E A;  4XMY A;  1A6I A;  3RYR A;  2ID3 A;  3OYK A;  3JRE A;  2YR2 A;  3G4S I;  1O57 A;  4IHS A;  3QPH A;  1IN4 A;  4IHT A;  2XAU A;  1WGX A;  1TLH B;  5J47 A;  1R5H A;  2XGD A;  1FYK A;  5EEG A;  2ECB A;  2R7X A;  1LEB A;  1U2W A;  1HDD C;  2N8G A;  1MBE A;  2ZC2 A;  4XRS G;  3OR2 C;  1FP2 A;  1D5V A;  2PMZ A;  3K4L A;  2XAG A;  5A2Q Z;  3CCJ I;  1POG A;  2RQP A;  2BOL A;  3ABT A;  5FGM A;  1IRX A;  3A0H C;  3CJN A;  4M6X A;  2LRD A;  4PUS A;  3ABK H;  4EGY A;  1ETV A;  5HLG A;  1RZ4 A;  3BG6 A;  4Q48 A;  1U8R A;  2W82 A;  2HQN A;  3DWL E;  1IGN A;  2XPU A;  2M4G A;  2PJR A;  1Z67 A;  2YPR A;  4MGR A;  3F3X A;  2X6W A;  4AIH A;  1K6O A;  3D0S A;  3Q0U A;  5AIP A;  5AIQ A;  2EIN H;  1S7E A;  3CCL I;  2GBY A;  1AU7 A;  1Y1W J;  4ENJ A;  5JFR A;  3JSP A;  1G4D A;  3K69 A;  3QQA A;  4G7O F;  3AG2 H;  1AOY A;  2UXN A;  3CO7 C;  1DU0 A;  4N0B A;  4CXF A;  5J1U A;  3KEO A;  1E3P A;  3HTU A;  1TTY A;  2IS6 A;  3BJ6 A;  5L3F A;  2CG4 A;  1FMW A;  2G7U A;  5GTH C;  3CJT B;  3HPH A;  4HLX A;  4XRS A;  2E1O A;  3NWS A;  3JRF A;  3TL4 X;  2HXI A;  4ESB A;  1HKT A;  2Y9Z A;  3DU5 A;  3RZD J;  1I6X A;  3DKW A;  1NK3 P;  3WU2 C;  4EM1 A;  4KN4 X;  3IH2 A;  3AG3 H;  4JK1 X;  5F64 A;  2XF5 A;  1BBY A;  3QAH A;  4OIP F;  1X3U A;  2ZNY A;  4BY7 J;  1PVE A;  3MZ8 A;  3R60 A;  5A2Q K;  4JX4 A;  3FIS A;  4IHW A;  4XNF A;  1XPX A;  1ITY A;  2DMN A;  3O8G A;  4ABZ A;  3HOW J;  2Y30 A;  2XGX A;  5D4R A;  3BR6 A;  2YS9 A;  3RYP A;  2BBY A;  2JJ7 A;  2W84 A;  4CYC A;  4U7D A;  1IN8 A;  4I0B A;  4L0Y B;  1Y0U A;  2DI3 A;  4B8X A;  2BVL A;  4XID A;  4KIF A;  4E7S A;  1BA5 A;  2DYR H;  2HWV A;  1TT0 A;  3W2W A;  1V4R A;  2E36 A;  1D0X A;  2JA2 A;  3FXM A;  3HUG A;  4XLH A;  5HDN A;  4HV6 A;  3FHZ A;  1XD7 A;  1VQ5 I;  1ZGW A;  1T8I A;  4I2O A;  5E20 A;  2DTZ A;  3H5A A;  4IEJ A;  3N4M A;  3W6K B;  4D9J A;  2ME6 A;  3V7R A;  5BS6 A;  5M3F J;  2IT0 A;  1R23 A;  3U1D A;  3QPL A;  4BL0 B;  4UUV A;  3QP5 A;  5DUK A;  5D5V B;  4E7I A;  3KZY A;  2NNN A;  5B1B H;  4JYK A;  2F5C A;  1FBU A;  2EH3 A;  3ASO H;  1S72 I;  4D5C A;  1H9G A;  2M45 A;  3BG7 A;  2QWW A;  2R7Z J;  3LA7 A;  4ZH4 F;  3RSN A;  3V8L A;  1RKT A;  1MBH A;  4XOT A;  4J01 A;  4NC7 A;  2JSC A;  3KCC A;  3RPU D;  2UV1 A;  2EV6 A;  1X1B A;  4PSX A;  1B72 A;  1EA3 A;  1S29 A;  4OWR B;  4XSX F;  1BW5 A;  2LOO A;  1QZE A;  2M34 A;  5BQT A;  1JKQ C;  1UMQ A;  2VQC A;  2ISZ A;  1D0Y A;  2IA1 A;  4KT6 A;  4X1E A;  4HOB A;  4EV0 A;  3GW2 A;  2GQQ A;  2B63 J;  3N05 A;  3BOQ A;  3FIW A;  5ILS A;  4YEJ A;  5JLX A;  1IN6 A;  2MSY A;  1N78 A;  4DIQ A;  3OIQ A;  3K4K A;  4EMS A;  1YS6 A;  5GAD J;  5M5W J;  4GFB A;  3TW6 A;  2PLY A;  4E7Z A;  2GIV A;  3HSE A;  2NVU B;  3CCV I;  3HM5 A;  1YW9 A;  3LSM A;  5DS9 A;  4HW0 A;  4Q47 A;  2L9V A;  4A3I J;  2RAE A;  3L2Q A;  4CHU A;  3TP3 A;  1ZAO A;  2ISY A;  3OIP A;  3L9F A;  1WJ5 A;  2R4G A;  4PJ0 C;  4MEX F;  2OF7 A;  3ZGK A;  4H0E A;  1Y1V J;  4PK4 A;  2I5U A;  3K4N A;  4X6A J;  2IJL A;  4FTH A;  3LFU A;  4JX5 A;  4ZC3 A;  5FRM A;  3BCB A;  5JHU A;  4A5M A;  1ZHF A;  3RKW A;  2LYC A;  4BS9 A;  2IGM A;  4KFC A;  1B8I B;  2JA8 J;  4A3C J;  3MD2 A;  1YHQ I;  3TDZ C;  3KEY A;  4NQW A;  5E79 C;  1RC9 A;  1YS7 A;  2EIK H;  1QPM A;  2DA3 A;  2DDA A;  3P9K A;  4IL6 C;  4G7H F;  1LFU P;  4PZJ A;  3FZV A;  1GLN A;  2FF4 A;  2K3F A;  2LY9 A;  3QOP A;  3WGH A;  1GXQ A;  1I27 A;  5GAE J;  2VKV A;  3OYF A;  3ZMV A;  3HL2 A;  2IBD A;  3MAJ A;  1IXC A;  2O61 A;  4IHV A;  3H9Q A;  5FLX Z;  1YFH A;  3E6M A;  3HOS A;  3FKI J;  4EJO A;  4PGG A;  1YI2 I;  5DCM B;  2A69 F;  1J7K A;  4CCJ A;  4YFN F;  4RGS A;  3IHU A;  1DUX C;  4M3B A;  3WTZ A;  1AHD P;  1Y39 A;  4QLC U;  4XKC A;  5E1Z B;  3FK7 A;  2E2J J;  3BJA A;  1QPI A;  2HPM A;  2YU3 A;  4PGH A;  3OL3 A;  2M0M A;  2GXB A;  4NC6 A;  1ZK8 A;  5ICE A;  3DEE A;  2K86 A;  3ZCO A;  4Y33 A;  3J7A Y;  3IWZ A;  4R79 A;  1W5C C;  3T8T A;  2FOW A;  5BPI A;  2JSP A;  4CA0 A;  2XVC A;  1JGS A;  2BW3 B;  2DA4 A;  1XG1 A;  2VN2 A;  5M3M J;  3PFY A;  4BJT A;  2BGC A;  1I5Z A;  4UUT A;  4AU7 A;  5FKM A;  1FSH A;  2EZK A;  2ZKZ A;  1N75 A;  4LMY A;  1NG6 A;  5KAF C;  4ZYH A;  5K7F A;  2L9R A;  1ZKG A;  3SHF A;  1F4K A;  3CMY A;  2O6G E;  4XLA A;  1TQP A;  3D1N I;  3H0G J;  3LSR A;  1P7I A;  5FKK A;  1G2H A;  2YSR A;  3QRF F;  2Y48 A;  1K61 A;  3BC8 A;  3Q0W A;  5FKL A;  4RB1 A;  2QQ8 A;  3GTJ J;  5F08 A;  4BXX J;  1ETY A;  5HS9 A;  3BY6 A;  3G73 A;  3RQ4 A;  4MO7 A;  1P4X A;  4HA8 A;  1YJN I;  5IY5 H;  2O3F A;  1T08 B;  5CVJ A;  1MD0 A;  4Y7N J;  2XGC A;  3DXJ F;  1HDP A;  3OYJ A;  1K83 J;  2GZW A;  2L7F P;  4KIT B;  2W24 A;  3CLQ A;  3F8M A;  1T6S A;  3LQQ A;  1SMY F;  1LKX A;  2A6E F;  1OYY A;  4A3J J;  1NTC A;  1BI0 A;  5F0C A;  1ON1 A;  5J8C A;  1KU9 A;  2CUE A;  2EB7 A;  3KYD B;  4J00 A;  2HQR A;  5IYD J;  3GFI A;  3RKQ A;  1H89 C;  1PYV A;  2JRT A;  2R0Q C;  4LJZ F;  1D1C A;  1J0R A;  1O7L A;  1HCR A;  2G7H A;  2HDW A;  3IV5 A;  4LIT A;  4BE2 A;  3KP7 A;  2IGN A;  2LMD A;  3L2C A;  4ZTF A;  2W00 A;  2O8X A;  3S32 A;  2Y69 H;  4C3J J;  2GAU A;  2E1N A;  3DEU A;  4BYY A;  1LEA A;  2L7K A;  1SMT A;  2ME0 A;  4PCQ A;  4DZP A;  1MW7 A;  3ABM H;  2CUZ A;  2LF7 A;  2Y2Z A;  3K4J A;  1TWA J;  2CQX A;  4XLN F;  1SVO A;  2JUG A;  3ZMU A;  1WI3 A;  1BR4 A;  2DOE A;  5J1Y A;  3NAU A;  4LD5 A;  1ACI A;  5HDK A;  3CJQ B;  3SFZ A;  5GAH J;  2ZBK A;  2HR3 A;  1IW7 F;  2G0E A;  1WVR A;  2WWY A;  5LEJ A;  1J09 A;  4F92 B;  3OYI A;  4IPA A;  1R71 A;  2LKX A;  3PNV A;  3RJP A;  2K5C A;  4W1U A;  1VQO I;  2DCE A;  4I0A A;  2O5R A;  5FFZ A;  1BIA A;  3HRU A;  1J75 A;  3I58 A;  3GTL J;  2DT5 A;  4FE7 A;  1ETX A;  2HKO A;  1LVK A;  3F8F A;  2XKP A;  3PFI A;  3HOY J;  2L5Q A;  3HRS A;  5AON A;  3BG9 A;  4MTD A;  3OY9 A;  2HDD A;  2JPC A;  2R5Z A;  5DM6 F;  3FDY A;  4FHT A;  3Q9V A;  1T2K A;  3FBN B;  1R1T A;  2Y31 A;  4CCN A;  3COA C;  2KIU A;  3DPU A;  3V7S A;  5LGT A;  3W2A A;  3K70 C;  1R58 A;  3PSF A;  5TIS C;  3CF5 F;  2M9H A;  3GTO J;  1G3S A;  2P5L C;  2K9Q A;  4XON A;  2QF7 A;  3SYT A;  3HXL A;  4NBQ A;  4U7B A;  3KFW X;  3I9V 2;  5IT9 K;  2TRT A;  4A3B J;  1XMA A;  3OYL A;  3IKV A;  5ILV A;  3FXU A;  1QBJ A;  3A1Y A;  1MND A;  2KLO A;  2DK8 A;  4BBR J;  3ZQI A;  5LBQ A;  4XQF A;  2JA7 J;  1FOX A;  2BY1 A;  4YEL A;  2FA5 A;  1LJ9 A;  3PUF A;  2DFE A;  4NC8 A;  2QCO A;  1DPR A;  3MMY B;  1GXP A;  4RB2 C;  2Z2S B;  3CUQ B;  2P7V B;  1IV8 A;  4R1H A;  4YIR X;  1P6R A;  3GTK J;  2HXO A;  3WTW C;  2ZCW A;  4A3G J;  2O03 A;  2QYO A;  3E5U A;  2DO7 A;  1BIB A;  3MKZ A;  2ZME B;  1OKR A;  3ZP5 A;  4G7Z F;  4CYD A;  2H1L A;  2LF8 A;  3E97 A;  1HW2 A;  5D5U B;  1FLI A;  2LR8 A;  3QWL A;  2ZJR F;  1BN5 A;  5KNL A;  5CVR A;  4A69 C;  3A0B C;  3S1R J;  3K1N A;  5M5X J;  3ISP A;  1B59 A;  5JLW A;  4BHB A;  2DPU A;  4Z2Y A;  4RAF A;  4RGU A;  1VQ4 I;  1E0E A;  2RKH A;  2X48 A;  3DPT A;  1WH5 A;  5EEH A;  1BW6 A;  4XKV A;  1B8I A;  4N9I A;  1L0O C;  3IL2 A;  1V3F A;  3I5U A;  3HBL A;  5HLH A;  4Q5S F;  4IOA F;  2FNP A;  2R7T A;  1MNE A;  1T56 A;  4L5I A;  1OCO H;  4GYI A;  2GIZ A;  2HU9 A;  3K4M A;  3LST A;  1BC7 C;  2P4W A;  3GFL A;  1MMN A;  1ULY A;  4AID A;  1TWF J;  5EEA A;  4U0W A;  4CZC A;  4NHJ A;  1GDT A;  5CYV A;  2QSG X;  2XIG A;  5FJ8 J;  4LB6 B;  1QVT A;  2YX7 A;  5F0H A;  3BR3 A;  4RDU A;  3F22 A;  2VBX A;  3BPX A;  5CQG A;  2E5Z A;  5BMZ A;  5DCM A;  2FBH A;  1KQ9 A;  3GTP J;  2HYF A;  2J5O A;  3ZN0 A;  4RB3 C;  3F23 A;  2VB6 A;  1ZG3 A;  2CQN A;  4IQ4 A;  4XL9 A;  2PG4 A;  4V2G A;  3JW4 A;  1X2N A;  3C3W A;  4ANJ A;  2OQG A;  4UXN A;  3OYH A;  3WU1 B;  3OMY A;  4YRV A;  4M6Y A;  1OCR H;  4G6Q A;  1TP4 A;  2FOK A;  2BYV E;  3ZQ7 A;  4HDU A;  4L5J A;  2CYY A;  1KON A;  2A68 F;  5KCM A;  4MLO A;  3G71 I;  2CFX A;  2MG4 A;  5E18 F;  4PDK A;  1ZGA A;  1VZ0 A;  4E7H A;  1IXR C;  1OYI A;  1R22 A;  2O0Y A;  4L18 B;  4M74 A;  5CKT A;  2UXX A;  5E3L A;  5J8F A;  4KDP A;  1A35 A;  4ZTJ A;  2BW3 A;  1R4N B;  2HDC A;  2DA2 A;  2DW4 A;  2ZXI A;  1X2M A;  4C3H J;  1H8A C;  2WAF A;  2ZFU A;  4KJZ A;  1U0J A;  5B5E C;  2V6E A;  3C2B A;  1MBG A;  2XGE A;  3FM5 A;  3Q9S A;  5F27 A;  1KYW A;  3PJR A;  4MTE A;  3M9A A;  5FLM J;  3G1M A;  3KP4 A;  4DYQ A;  4CH7 A;  5E17 F;  2ICW G;  3JRC A;  4HX8 A;  2QBY B;  2OZU A;  2PEX A;  2Y75 A;  2XSD C;  5IYB J;  4CO8 A;  3BLY A;  3K4B A;  3WE2 A;  2VBZ A;  1MJA A;  3ZQH A;  1FOW A;  3J7A O;  4BKX A;  5HOO A;  1O3R A;  4BQO A;  2LP0 A;  2DXI A;  3LSG A;  4ON0 A;  3MCZ A;  2R5Y B;  3BTC A;  1FT9 A;  2VLA A;  3DU6 A;  2A6H F;  3VEP A;  2DT7 B;  1X58 A;  2E34 A;  2GA2 A;  4Y4R A;  3H5R A;  1G3Y A;  1RES A;  4N4N B;  3QPS A;  2RVC A;  4F55 A;  3E6C C;  3DLA A;  4N9H A;  4MFE A;  1NHA A;  4HYE A;  2KT0 A;  1T98 A;  2AS5 F;  3LSJ A;  3KEQ A;  4RMN A;  1J2X A;  2HZD A;  5EF6 A;  2QSF X;  2IPQ X;  2QQB A;  1XDU A;  3VYR B;  1Q1V A;  2WB1 N;  2CFO A;  2CRG A;  4MIM A;  2NRA C;  2VUM J;  1P4A A;  4S05 A;  2ESN A;  2R93 J;  1AKH A;  2IS2 A;  4NB5 A;  2MD5 A;  4A3M J;  2ZNZ A;  4XLC A;  1TT5 B;  4EAT A;  3L2U A;  5JI6 A;  5IPA A;  1ZRC A;  2XF6 A;  5D8L B;  3PO2 J;  3QU3 A;  5GTI C;  3F9K A;  4NDL A;  1QA6 A;  4G12 A;  4RS8 A;  2RRE A;  3BWG A;  1R4M B;  4LFU A;  1W5S A;  1MZB A;  1WI9 A;  1OCC H;  3DTI A;  3HC7 A;  4QPO A;  1HA8 A;  4BU2 A;  4IKF A;  1WSU A;  2KIS A;  3KLN A;  4UVC A;  3S1M J;  4F7Z A;  5H2F C;  2V6C A;  1A04 A;  3ZN1 A;  2CJJ A;  3B6C A;  4BAC A;  3DBR B;  2BXY A;  4GYG A;  4UB6 C;  2R7R A;  4BJ5 C;  4QWQ A;  2ECC A;  3AKZ A;  3S3M A;  4OMZ A;  1UAA A;  2HVR A;  3FXL A;  1K78 B;  3E3V A;  1SVM A;  2Q2E B;  2Z1D A;  2MLG A;  3M1E A;  3BR2 A;  5DCF A;  3AL0 C;  2XAS A;  4B1R A;  5JVT A;  3V8K A;  1APL C;  3GVA A;  3LSP A;  4PJJ A;  1UG0 A;  2XRN A;  4Q4Z F;  1Z91 A;  3CDL A;  3HJE A;  4G6T B;  3Q3S A;  2FU4 A;  2VT2 A;  4GO1 A;  4LLL A;  1Z7L A;  1JE8 A;  3BPV A;  4RAZ A;  3G1O A;  2LY2 A;  2XAH A;  1WH7 A;  1IV6 A;  4G9Y A;  4X0G A;  1LPQ A;  2H94 A;  1T95 A;  5C44 J;  4HF0 A;  1X3W B;  2YU9 J;  3NQO A;  4LG0 B;  4P9F A;  3AFH A;  3T1B A;  5L3C A;  2PQ8 A;  3M07 A;  5D4S A;  1YRN B;  4OAY A;  2C6Y A;  2TCT A;  3K2A A;  2F4M B;  4B47 A;  4V2F A;  1FPQ A;  1K6Y A;  2GOX B;  3HZJ A;  3C1D A;  3VYT B;  1GVD A;  1JUP A;  3QYE A;  5D5W B;  3DEW A;  4CCO A;  3J7Y J;  4BNC A;  1WJB A;  2MC4 A;  4M72 A;  5K5R A;  2LRE A;  4A0X A;  3DFG A;  3ZOB A;  2FSW A;  1IZ1 A;  1HW5 A;  2VE8 A;  1R5I D;  1XSX A;  4CSW A;  2R7W A;  2P6S A;  1D1A A;  3QYF A;  2NOG A;  3CUQ A;  4A0Z A;  3JAM Z;  1PJR A;  1XGO A;  2OJE D;  4HF1 A;  2QZ8 A;  2FRH A;  4ZZD A;  2LBF B;  1JTY A;  3CUQ C;  1LVA A;  2ZXH A;  1ONV A;  3CF2 A;  2CUF A;  2ELK A;  4S0H B;  3CCU I;  2KRH A;  4A6D A;  1O3T A;  1RRJ A;  1H0M A;  4BXF A;  2VKE A;  2VQG A;  1VF9 A;  2ZME A;  3GTG J;  2Z99 A;  1E3H A;  1JUM A;  2EZH A;  3SZT A;  2NOJ B;  4LOC A;  1W0U A;  2ZME C;  2CO5 A;  3KP2 A;  4BGD A;  5CVU A;  2IW5 A;  1GT0 C;  1FZP B;  3U2R A;  4P5O A;  1UCR A;  2ESH A;  3GO5 A;  2H8W A;  4M9Z A;  4CCL A;  4XN3 A;  2CV0 A;  2EZL A;  4B43 A;  1ZR2 A;  2NVQ J;  3EET A;  5EYR A;  1OQY A;  3H36 A;  5J4Y A;  1F43 A;  1S7O A;  3BJO A;  3ZPL A;  1W36 C;  2A6T A;  1HSJ A;  3FKJ A;  4I7H A;  2ETH A;  2V1D A;  2A5Y B;  2VKH A;  2DA1 A;  2FD5 A;  4C2M J;  1A36 A;  5DYM A;  1LFP A;  1RUN A;  2H8R A;  1B6A A;  5HDG A;  1MMG A;  1P2F A;  2K40 A;  3IAM 2;  4ZDP A;  1W4M A;  2V9P A;  1WJF A;  1H9T A;  2G9W A;  4P1W A;  5EZG A;  3OYD A;  3I54 A;  4DZJ A;  2HTS A;  4DNC A;  5B66 C;  4OOI A;  3I4P A;  1Z0X A;  1T0F A;  5EJC A;  1VQN I;  2ZFW A;  3HEF A;  2X1E A;  1ZLJ A;  4QTR A;  4L9V A;  4BEH B;  1T0F C;  4E70 A;  2DA5 A;  2H27 A;  1FNN A;  1JKR C;  3ZMZ A;  2GA1 A;  5DD4 A;  1DGR M;  3JRD A;  3K2Z A;  2CW7 A;  3CCM I;  4YG2 F;  2EWN A;  4A3K J;  5LHI A;  3DLL F;  3JAM K;  4GCV A;  3F72 A;  2F4I A;  2V7F A;  2VJ4 A;  3AG4 H;  2VC0 A;  5LHH A;  3W3C A;  1ENH A;  2MW8 A;  3HKZ N;  1R9T J;  4II2 A;  1UFM A;  3LFK A;  3GLL A;  4CDG A;  4XRM A;  3GFM A;  1V54 H;  1PUF A;  2WAE A;  4YFK F;  4C30 A;  1JJ8 C;  4R8H A;  1RPW A;  1Z3X A;  2X4H A;  4AD9 A;  1YOV B;  4M3E A;  1ZRE A;  2DK5 A;  5K1Y A;  1I39 A;  1YW7 A;  3C18 A;  2HEO A;  1JJ6 C;  1A5J A;  2Y0M A;  4U88 A;  4B44 A;  2EV0 A;  4AVP A;  1MH3 A;  4EQQ A;  4II3 A;  3U21 A;  4KA4 A;  4KYW A;  2RN7 A;  1K79 A;  4IHY A;  5FKN A;  2QM3 A;  2XV4 S;  4ZJZ A;  4JOM A;  2H09 A;  1S8N A;  1TQM A;  3DKY A;  4OU0 A;  4RM2 A;  2HOA A;  2L9S A;  3CCY A;  3HOU J;  2JVH A;  5H6R A;  1WPK A;  1I3Q J;  2VJI A;  3VB2 A;  3G1L A;  5JHF A;  2WC2 A;  1UHM A;  4F91 B;  1XB4 A;  4BXU A;  2KRC A;  3VYS B;  4UV9 A;  2DJI A;  4KIS A;  2I10 A;  1YLF A;  3WE3 A;  4AWX B;  3BZC A;  3KLO A;  2QBY A;  3JRH A;  4FAS D;  2IEK A;  3M3Y J;  4E6K G;  1MNM C;  2K02 A;  5HVQ C;  1SFX A;  1BR1 A;  1STZ A;  1ZAR A;  1EJ9 A;  1HW1 A;  1FTZ A;  3HRM A;  1BOB A;  4OIO F;  2UZK A;  4KIC A;  4HAM A;  2D45 A;  5HS7 A;  1R6R A;  2ZXW H;  1W1W E;  2DFF A;  5ILU A;  3QOD A;  2KZG A;  2VT3 A;  3FXQ A;  4KT5 C;  5L3E A;  1XMK A;  2HTJ A;  1WJE A;  2M3A A;  2EA2 A;  2R92 J;  3VYU B;  2IGO A;  4KIB A;  4M6V A;  2EJR A;  2XPV A;  4EJU A;  2X9D A;  3LNQ A;  1C0W A;  4HBL A;  4RB0 A;  3MKW B;  2EV5 A;  1LDD A;  3Q5F A;  1W5T A;  5HLI A;  5L3B A;  4HQM A;  5F1J A;  5LEK A;  4M9X A;  1SAU A;  1K7A A;  4EM2 A;  3BZK A;  2HVS A;  4I99 C;  1YJ9 I;  1F5T A;  2Z5U A;  2WA0 A;  4Y15 A;  1KYZ A;  2XDV A;  3EDP A;  4BE1 A;  3WTT C;  1EH7 A;  3A01 B;  1YIO A;  4V19 K;  3RZO J;  2KIQ A;  2A05 A;  2VAS A;  4IVN A;  4BQQ A;  1WJC A;  5FD6 A;  3WGI A;  4PFO A;  4B09 A;  3CCR I;  1O7F A;  2Q1Z B;  1LFB A;  3HGY A;  1OCT C;  1LDJ A;  3O6B B;  5E3M A;  3B73 A;  4LIV A;  2OAZ A;  5CJ9 A;  2EFW A;  3MKY B;  2EFQ A;  4UUS B;  4CIC A;  2VE9 A;  2CWE A;  2H6C A;  2NVX J;  4CCK A;  3E0J B;  1LE8 B;  4DW6 A;  3GZ6 A;  1OR7 A;  1S9H A;  4WF2 A;  3RIR A;  3VSK A;  1EKE A;  2GWR A;  2X1C A;  3PSI A;  5IP7 J;  3OYG A;  5F04 A;  3SJM A;  1YTY A;  1X1P A;  1OR7 C;  2OUM A;  3QYB A;  1SFO J;  2LH9 A;  3REO A;  4XOR A;  1MBK A;  3PQK A;  3OIO A;  4DGW B;  1IRZ A;  3KP6 A;  3DTE A;  4MQV A;  4M73 A;  1Z05 A;  2DFH A;  2WB1 A;  2HYG D;  3GF2 A;  3X2Q H;  2LY1 A;  5FLX K;  1F36 A;  2MBF A;  2QQA A;  2EIJ H;  1WCM J;  3LSK A;  3T5X A;  1UHS A;  3M8F A;  1P92 A;  1RKW A;  1CGP A;  4XLP F;  1IAW A;  1OFC X;  3CJR B;  1Y56 A;  4B48 A;  1IG7 A;  4LG0 A;  5FB2 A;  4IRI A;  1ZRF A;  2WY8 Q;  3HB9 A;  4YIF A;  1Z9C A;  1YRN A;  1X3Z B;  3CTA A;  2W1O A;  4D0P A;  3KP5 A;  1YO5 C;  3HGG A;  2E35 A;  3TGN A;  5CVI A;  3JCU C;  1KQ8 A;  1OYW A;  2O9L A;  3LMM A;  4I01 A;  3SEZ A;  1U5T B;  2M5W A;  2HOE A;  2GXA A;  2P0W A;  2BHY A;  3BT9 A;  5BPD A;  3ASN H;  4DYC A;  1Z7U A;  3LSI A;  1IRF A;  1QZY A;  4A12 A;  3M4O J;  3S3N A;  4ZDL A;  3DF8 A;  3C2H A;  3PIO F;  1TQI A;  2EPF A;  3WOD F;  2KKO A;  2WV0 A;  1B4A A;  2LBF A;  2WBM A;  2CU7 A;  2AO9 A;  4KMF A;  1FOY A;  4BY1 J;  1MIJ A;  4A3L J;  4ESJ A;  2FEZ A;  3GZN B;  2FQ4 A;  5DUI A;  2HOT A;  1QU3 A;  4KN7 X;  2LK2 A;  3JR9 A;  3FHN A;  2H6B A;  3GUD A;  3JTH A;  4XLF A;  2DPD A;  5LFA A;  1JT0 A;  3BQY A;  3F0C A;  4AYB N;  3FBI B;  4MEY F;  1AWC A;  1OLT A;  3HIF A;  1HF0 A;  2NS8 A;  2NS7 A;  1XX5 A;  2X1D A;  3H92 A;  3H9J A;  3OWT A;  3VWB A;  1HKQ A;  3DTK A;  1LQ1 A;  5CPR B;  1FEX A;  1EH6 A;  1RI7 A;  1UJ8 A;  4HZF A;  3SEQ A;  4LK0 F;  1RR8 C;  1DP7 P;  3A4C A;  3VOE A;  1WRJ A;  2A5W A;  4BAY A;  2B7E A;  5LRR A;  5E8G A;  2WV1 A;  4FX4 A;  3WGG A;  1TWC J;  1MMA A;  3V4G A;  1FYL A;  3I55 I;  2DQL A;  1VQK I;  4KIG A;  2Z33 A;  3GX4 X;  5IP6 A;  3RPU A;  2P5V A;  3IC7 A;  2IS1 A;  1ETW A;  3OSF A;  1LB2 A;  5LHG A;  2JZY A;  2ZJQ F;  5CLS A;  3LA2 A;  2IGK A;  1Y0N A;  2STT A;  1BI1 A;  1XGN A;  3AAF A;  1W0T A;  1G6N A;  3KP3 A;  4BEH A;  1FTT A;  3O2P E;  2OU2 A;  2MAB A;  3S16 J;  1FC3 A;  1TL8 A;  4XN0 A;  1ETO A;  1O4X A;  2A61 A;  4WX9 A;  4WK8 F;  3DV8 A;  2IXS A;  2L9N A;  1V55 H;  3E6B A;  1BOA A;  2KIM A;  3F21 A;  3V8J A;  2FUG 2;  3OS0 A;  2Q8K A;  3I71 A;  1ZRD A;  2M0C A;  1EF4 A;  5C3E J;  3EUH A;  2LKP A;  2XAF A;  2ZO4 A;  3FWE A;  6PAX A;  4AC0 A;  1UZC A;  2CV1 A;  3EUH C;  2PMU A;  2DMT A;  1XCB A;  1GV5 A;  2BY0 A;  4O6J A;  1TNT A;  1U8B A;  1SD4 A;  3NRV A;  3BDD A;  1ZEL A;  2IA2 A;  2QKM B;  4I76 A;  1M1E B;  2VI6 A;  3UR3 C;  1HLV A;  1P7J A;  2K3P A;  5D6E A;  1MBF A;  3S15 J;  3KE2 A;  1ZQ3 P;  2XSJ C;  2VJ5 A;  4GXO A;  4PJL A;  3ZMT A;  2KFD A;  2GXG A;  1MJB A;  3DKX A;  3CMM A;  3K9T A;  3IRQ A;  4Z6Y A;  1IXS B;  2X6X A;  4B4C A;  3ERE D;  4LGW A;  1U9O A;  3SDG A;  3H3Z A;  2CGP A;  3FXK A;  3ZQQ A;  1PUE E;  3S14 J;  3H3V K;  5BNG A;  4ENK A;  3CCQ I;  3ABL H;  4HEA 2;  4Y13 A;  2FE3 A;  4HV5 A;  1G59 A;  4UY8 I;  3GME A;  3HKZ A;  2KHM A;  1XSV A;  2UWM A;  3UKG A;  1WQ2 A;  3RKX A;  2R3S A;  2XF7 A;  3S3O A;  4B3A A;  1FOK A;  4TV7 A;  2ID6 A;  3TO9 A;  3WHB A;  1PDN C;  3GYH X;  3D5R C;  3B02 A;  2L4M A;  3HUG B;  1JXS A;  5FKO A;  1NH3 A;  1VQ8 I;  5D5X B;  1J59 A;  2P8T A;  2JT1 A;  3IH3 A;  5HS8 A;  2M7B A;  3CQZ J;  2JPB A;  4P96 A;  4KNY A;  1GHC A;  3P9C A;  4MHG A;  3MFK A;  1QHG A;  1U6G A;  2XB0 X;  1RR7 A;  1D0Z A;  1GV2 A;  1A31 A;  4HPQ A;  3J81 Z;  2DMQ A;  2UUZ A;  2X6O A;  1ZLK A;  4BHC A;  3CP8 A;  4BDY A;  2EIM H;  2STW A;  2JK3 A;  3HOV J;  5F6F A;  3M8J A;  4RLF A;  3LL7 A;  3RTR A;  2VPL A;  2MH9 A;  2YX4 A;  3IP4 B;  2BVM A;  5GPC A;  3J80 Z;  4ZYG A;  1MDM B;  3M1C A;  2K7L A;  3ESW B;  4EJV A;  1WJA A;  1FY7 A;  1VFC A;  4HX7 A;  1ETQ A;  3ABU A;  5ICG A;  2KDZ A;  3HYI A;  1UB9 A;  3RPQ A;  2XUB A;  3HOT A;  5EZH A;  1IDY A;  2WAQ N;  3ZR8 X;  4Y52 J;  2FMY A;  4UUS A;  1VQ6 I;  2KQR A;  4RGR A;  4UB8 C;  4P9U A;  2E1M B;  3F8C A;  1ZR4 A;  5H20 A;  1DQU A;  1YX5 A;  2OZ6 A;  3KPH A;  1LE8 A;  2QEX I;  3CC4 I;  3CP2 A;  2DN0 A;  1JUS A;  3FF5 A;  5HNF A;  5C4X J;  5IT3 A;  1ETK A;  3NWT A;  3E5X A;  3OL4 A;  3MQ0 A;  1VND A;  4HX4 A;  4D1Q A;  1Y8R B;  3GZ5 A;  3F6V A;  2ELJ A;  2M30 A;  4Y17 A;  3TBI A;  1XSD A;  4XKW A;  1Z1D A;  2HNH A;  5EGO B;  1BC8 C;  2PFB A;  3E6D A;  3MEX A;  1YQA A;  2W7N A;  2VBY A;  2CV2 A;  2LFB A;  5E8I A;  1BI3 A;  5FFX A;  2KMU A;  4IRG A;  2VOO A;  4PJM A;  3ULQ B;  1X1D A;  3I0T A;  1BR2 A;  2HZT A;  4E7L A;  4QSH A;  1FBQ A;  3IKT A;  4KMU X;  3OR1 C;  4RA2 A;  1FBS A;  3W6J B;  3GTM J;  3OV8 A;  2M7A A;  4PSW A;  4U0V A;  3T8R A;  2MH2 A;  4DOZ A;  2PMH A;  4WXD A;  4OMY A;  2XAQ A;  1MSE C;  1LDK B;  3K7A J;  4E7J A;  5TJJ A;  2ACJ A;  2VPR A;  2R7O A;  1D8K A;  3F8N A;  2Y0S N;  5TGT A;  5H6Q A;  1JKP C;  2L7M P;  3HTS B;  5DTD A;  5JVG F;  1MSF C;  2ZJ2 A;  2NVT J;  3J80 K;  5KHD A;  1D8J A;  4LIU A;  3H35 A;  3OS1 A;  2OCE A;  2CQK A;  1NG7 A;  3TW7 A;  5K5O A;  3H3U A;  3I4M J;  2X51 A;  4WXH A;  4XK4 A;  1Z21 A;  2Y9Y A;  1O3Q A;  5FLV A;  1R1V A;  3RCO A;  2V1X A;  1OMI A;  3EUA A;  4MQ9 F;  2F5E A;  2EFO A;  4IHX A;  3L7W A;  3S2H J;  3KYL A;  3A03 A;  5IYC J;  2XPW A;  3IH4 A;  4ITV A;  5E3O A;  3GWZ A;  4UV8 A;  4UVB A;  2DTR A;  3JSO A;  5F1R A;  2CSO A;  1QRY A;  1O3S A;  1A6Q A;  2JQ7 A;  1W7P B;  3OS2 A;  1ZYR F;  5J40 A;  1QGP A;  3QOE A;  3KET A;  5E3N A;  1YW8 A;  5ERI A;  1DP3 A;  3CO6 C;  1IUY A;  3CCE I;  2E2I J;  1ZG5 A;  2NAZ A;  3JRA A;  3O8H A;  1W7P D;  5ICC A;  3FXJ A;  2E5N A;  3F6O A;  3GFJ A;  4D5F A;  2CQQ A;  4CCM A;  4JBA A;  3CME I;  2D5V A;  2OPT A;  3WHC A;  2M4K A;  2OTL I;  4NNJ A;  1DU6 A;  3I56 I;  1HOM A;  2HGC A;  2BY2 A;  2LKS A;  4W97 A;  3JRB A;  2K27 A;  3QU6 A;  2OA4 A;  2QEN A;  3I3L A;  1TW2 A;  1TZL A;  2DDB A;  2Z3Y A;  3EQL F;  3ZXS A;  3WTY C;  3CZ6 A;  5EDN A;  1DPU A;  2HQ5 A;  1F9N A;  2X85 A;  1KGS A;  1S5L C;  4ENM A;  4F52 A;  1MH4 A;  3JTG A;  2GLO A;  2VQL A;  3MZY A;  4WCG A;  1E17 A;  2RGV A;  1IUF A;  3B6A A;  2QUF A;  2JMW A;  3F8B A;  4A2U A;  2DMP A;  2AQE A;  2FML A;  2CQ7 A;  3IWF A;  4AYB A;  1BM9 A;  5GAG J;  4NUB A;  3KIO A;  2QGU A;  3FMQ A;  3BTJ A;  1VQM I;  1QQI A;  4UVA A;  5J3L A;  2XRO A;  2HKX A;  4N4O B;  1ERD A;  2LLK A;  1TWG J;  4LB5 A;  1USS A;  2E19 A;  4JQF A;  3VDX A;  4HDV A;  3LWF A;  1I6H J;  3ZMS A;  1J5Y A;  4LLN A;  2OTJ I;  2F48 A;  4ASN A;  2XB5 A;  2A07 F;  5LD2 C;  5E1W A;  2A3S A;  4MFD A;  4C9Y A;  3FMS A;  3C2G A;  3ZQF A;  4I6Z A;  4M3D A;  2B9S A;  2DFI A;  1P9Q C;  1MGT A;  1I1S A;  1VI0 A;  2NS0 A;  2P7C B;  1LUJ B;  4RLQ A;  4HLY A;  1X1A A;  1N25 A;  4HNV A;  1FIP A;  2P5K A;  2TDX A;  1FYM A;  5GP9 A;  2BV6 A;  2KZV A;  4LLG F;  2CH0 A;  3QPT A;  2V9K A;  2PBI A;  3VPR A;  2IP2 A;  5L3D A;  3G6E I;  4IQJ A;  4EGZ A;  4RBO A;  1BJZ A;  1VQ9 I;  1CQT A;  4G8X A;  2JUC A;  4E4H A;  1JI8 A;  1AA7 A;  3QP6 A;  1R49 A;  1E2X A;  4AM3 A;  4AIJ A;  1SC7 A;  4XLE A;  3S8P A;  3KX2 A;  4RGX A;  4BJ6 C;  2EA4 A;  1FWZ A;  3NEU A;  4AIK A;  2YUS A;  4ZYD A;  4IO9 F;  3CES A;  2HYJ A;  3BZ6 A;  1CF7 B;  3WG7 H;  2R5Z B;  3K1P A;  2DAO A;  4DBQ A;  2VXZ A;  3TDU C;  1K4S A;  3M8E A;  3BG3 A;  3Q0V A;  3UNG C;  2CUJ A;  4BQA A;  4A3F J;  3LOC A;  1T39 A;  1FP1 D;  2M1B A;  1SD5 A;  2EFP A;  4AVZ A;  2V4J C;  1IC8 A;  4ZYE A;  2RNG A;  2CW0 F;  1QO0 D;  5LLQ A;  2OD5 A;  3K70 D;  4A93 J;  2EQR A;  3PL8 A;  3A2K A;  3ROU A;  4BH9 A;  1WZ2 A;  3W6V A;  1RIO H;  1SD6 A;  2KRF A;  2DLL A;  2KPM A;  2EFN A;  1OCZ H;  2LSO A;  1MDM A;  5FRO A;  4EJW A;  4UNO A;  1FJL A;  1FMV A;  1V5F A;  1RET A;  2COB A;  1Z77 A;  1I3A A;  4ENN A;  2QSH X;  2OBP A;  4IRH A;  1Y6I A;  4YFX F;  2LG4 A;  2F6C A;  3BR0 A;  1MBJ A;  1U9N A;  5CQE A;  4RAY A;  3TQN A;  1JHF A;  3ECO A;  3CUO A;  1TC3 C;  2ADU A;  4ESF A;  3FMR A;  3S2W A;  4C3I J;  1TNS A;  1BJA A;  1FIA A;  1UEL B;  3E7L A;  1XMX A;  3SZG A;  2LD5 A;  2V79 A;  2E1M C;  3LAP A;  1IN7 A;  2QLZ A;  3E5Q A;  2ZJP F;  3IRR A;  2X0L A;  3BRO A;  3CMA I;  3A02 A;  3IUO A;  2VC1 A;  3ZQG A;  2NXN B;  5IOZ A;  1B1B A;  5F0F A;  3PQJ A;  2V26 A;  2JN6 A;  3N97 A;  2BY3 A;  3PNY A;  2DYS H;  3SZP A;  5EGO A;  4S04 A;  2R5Y A;  2JRM A;  2D2W A;  4M3G A;  2DA6 A;  5B1A H;  2J5P A;  2D1V A;  3G3Z A;  2HS5 A;  3CC2 I;  1TW3 A;  1SFU A;  2K85 A;  3H5N A;  4IZZ A;  1KU3 A;  2XC7 A;  2IVM A;  4RM3 A;  1IN5 A;  4DYR A;  4BE0 A;  2E71 A;  2HI3 A;  4A6E A;  1L3L A;  2RV8 A;  4O5V A;  4CZZ A;  1R36 A;  3JRG A;  4L9T A;  1IJW C;  2PN6 A;  2WAQ A;  3PO3 J;  2ZSH B;  2MGQ A;  4D7N A;  3BTL A;  2DA7 A;  2M87 A;  4GRI A;  3VSL A;  2DJN A;  2DOA A;  2Q0O A;  3EPZ A;  3TMO A;  2DMU A;  3O3K A;  1X4P A;  4XBF A;  2CW8 A;  3L2R A;  3BTI A;  5EG0 B;  1IO2 A;  2K9M A;  3BR5 A;  1XN7 A;  1Z6T A;  2FQ3 A;  2D1H A;  2M8G X;  4FET A;  1KZH A;  2BEO A;  1KQ0 A;  4A0Y A;  2RC4 A;  3V42 A;  4QIW N;  1VQL I;  2OV7 A;  2F5D A;  2FBK A;  4PFP A;  3WTS C;  5L3G A;  4IF4 A;  2ZB9 A;  2F5V A;  2LC2 A;  1W7P A;  3VOD A;  3RKY A;  2GOM A;  9ANT A;  3T0Y A;  4FX0 A;  3OOP A;  3CCS I;  2ELH A;  1G8X A;  1X4O A;  3I53 A;  3FX3 A;  3DCF A;  3V7C A;  1V5E A;  4A3D J;  2L54 A;  4P55 A;  4WWC A;  3K4C A;  2HOS A;  1G3T A;  5D8K B;  1K78 A;  3EYY A;  4EVI A;  3BG5 A;  5ED4 A;  1OJL A;  2Q2E A;  2JA5 J;  1X1C A;  4HF2 A;  2E7W A;  3RDI A;  4OIR F;  4XKB A;  2VIX A;  5KVR A;  1EH8 A;  2L0K A;  1PP7 U;  4L5E A;  4RAG A;  3IAS 2;  4H4K C;  2KDO A;  1WFX A;  2E2H J;  2FX0 A;  4C2U A;  3HSF A;  3GTQ J;  3D5L A;  5FRN A;  1OCP A;  2WY7 Q;  1MJ9 A;  2Y0S A;  2AHQ A;  1JTX A;  3R61 A;  5D6F A;  2VBW A;  2XHK A;  2DT6 A;  1NK2 P;  1H88 C;  2L3D A;  3LA3 A;  1SVL A;  3GBG A;  3PNT A;  4HSR A;  1K4T A;  4BBS J;  3HOX J;  3M7G A;  4CGZ A;  2L4A A;  2HPI A;  1IRG A;  1WKM A;  3VFZ A;  1I1G A;  3WTU C;  2KL4 A;  2PMZ N;  3KYC B;  3TP0 A;  5IP9 J;  5M5Y J;  4IOC F;  4YII A;  3R0J A;  3DBL B;  1Y8Q B;  3W2V A;  1ZH5 A;  1VTN C;  1IF1 A;  1ZN2 A;  3HPG A;  4BDZ A;  3WTX C;  3K6G A;  3I59 B;  3MKL A;  1GUU A;  3ERM A;  1WWX A;  5TRD A;  3C7J A;  3DPL C;  4DJA A;  2MFZ A;  4U0Y A;  5DD8 A;  2JWT A;  2WTE A;  2R7S A;  1RNL A;  5LGU A;  5IT9 Z;  4FQG A;  1YE9 A;  3H9G A;  2VOP A;  4M9S A;  4ETS A;  2KP6 A;  3U1K A;  1OIS A;  2DOD A;  2XKO A;  1EV7 A;  3OOU A;  3ONQ A;  1AKH B;  4C2T A;  2V1U A;  3SQN A;  2DBB A;  4MNU A;  2OC6 A;  2PX9 A;  3BCA A;  1B9M A;  3R6S A;  3KZI C;  2O8K A;  4HNU A;  2W48 A;  4HRI A;  4G6D A;  4EJT A;  1T38 A;  1IDZ A;  1FX7 A;  4IXA A;  1YG2 A;  2R7D A;  3OYB A;  5LRS A;  5DM7 F;  3PUB A;  1GVJ A;  5JR3 A;  1HXD A;  1XC5 A;  2R7Q A;  2VL8 A;  1U78 A;  3CC7 I;  3ML6 A;  2JA6 J;  4XSZ F;  1D1B A;  3HSR A;  1SEU A;  3OYA A;  2LDU A;  2EZI A;  2RDP A;  4BHP A;  1MMD A;  3L2W A;  1XGS A;  2ZXJ A;  4HG2 A;  3AL0 B;  2O7O A;  4Y3O A;  1ZG1 A;  4D7M A;  5ICF A;  3K0L A;  3LAJ A;  5DDG A;  4IX7 A;  2K4J A;  2PJR B;  4M3F A;  1SAN A;  3RI4 A;  1SAX A;  5LGN A;  1XDS A;  2OCC H;  4XOP A;  1CF7 A;  2QKL B;  2CMP A;  3L1P A;  3CDH A;  2IRF G;  2EIL H;  2H1K A;  1ODD A;  4LK1 F;  3SDB A;  3ECH A;  3GXO A;  5K7H A;  1F1Z A;  3G2B A;  3DBH B;  3LQR A;  3OYC A;  4JX6 A;  5HLT A;  2CS3 A;  1B9N A;  4FE4 A;  1XGM A;  4FT8 A;  5CVV A;  3HHG A;  2IS4 A;  5HOD A;  2K9N A;  3EUK L;  2NNY A;  3FXR A;  2P81 A;  4L9J A;  1S6L A;  2R7F A;  4CUG A;  3FK6 A;  2W25 A;  3L09 A;  1P4W A;  3ZRG A;  3BR1 A;  2FXA A;  4GGG A;  3S2D J;  3L00 A;  4B3X A;  2R7V A;  3WU0 A;  5J1R A;  3R0A A;  3NAR A;  4ZZL A;  3OYE A;  1LNW A;  4DQ2 A;  3CD6 I;  3S1Q J;  1D3Y A;  2FNA A;  1ZGJ A;  4XM3 A;  1QVU A;  4HST A;  2KJC A;  3FM3 A;  2W85 A;  2MLK A;  2E60 A;  4OIQ F;  5B3S H;  3LSH A;  2I8D A;  4ZYA A;  1YJW I;  3I4N J;  2L01 A;  2K4B A;  4BQN A;  1U3E M;  4XR6 A;  4HQE A;  5C4J J;  2E7X A; 
#chains in the Genus database with same CATH homology
 1HST A;  4I09 A;  3ELK A;  4I98 B;  2V9V A;  3BP8 A;  2F5F A;  1DDN A;  1OPC A;  2MA3 A;  3KZZ A;  5KK1 A;  1KU7 A;  5J6X A;  1KU2 A;  3R4K A;  1UHW A;  4IJA A;  2F2E A;  2IA0 A;  3TOB A;  2M8E A;  3P7N A;  2MC3 A;  3GLX A;  3MZH A;  1RUO A;  1PP8 F;  2KJB A;  1S7A A;  1R1U A;  1R5G A;  3WTV C;  2JTV A;  2DU9 A;  1S3J A;  3EYI A;  1J9I A;  4UHT A;  1G3W A;  2W57 A;  5BOX A;  1QNT A;  5FO5 A;  1KA8 A;  3HHH A;  2PJP A;  5E1X A;  2E1C A;  1SD7 A;  3HRT A;  1HQC A;  1BI2 A;  4OIN F;  2QQ9 A;  4G94 A;  3K1M A;  1ON2 A;  2FBI A;  2XAJ A;  3CLO A;  2OQR A;  2Z9O A;  2BE5 F;  1HBX G;  3DQV C;  2L02 A;  2B0L A;  1HKS A;  2COM A;  5K5Q A;  4O3M A;  2VOD A;  2QVO A;  2RNJ A;  3TOA A;  2VON A;  4L0Z B;  2KIF A;  1TBX A;  1R7J A;  4M71 A;  3TKY A;  2NYX A;  5DEQ A;  4L9N A;  5FD5 A;  4WXC A;  4I02 A;  3WG9 A;  3GEZ A;  4EM0 B;  1FSE A;  5DV5 A;  1QZZ A;  3U9G A;  1Z6R A;  3TO7 A;  1R00 A;  1Q1H A;  2AXL A;  3DP7 A;  3J81 K;  3SXY A;  4A5N A;  1XCV A;  1U5T A;  3ZMD A;  1YYV A;  1SFE A;  4KUM A;  1UST A;  1U5T C;  3I59 A;  1REP C;  3P9I A;  3MWM A;  3TO6 A;  1JHH A;  3I64 A;  2P6T A;  2DQR A;  2LNB A;  2EK5 A;  2PI0 A;  4XRF A;  1MKM A;  2HFH A;  4K2E A;  3RYR A;  2YR2 A;  1O57 A;  4IHS A;  3QPH A;  1IN4 A;  4IHT A;  1TLH B;  1R5H A;  1FYK A;  5EEG A;  1LEB A;  1U2W A;  1FP2 A;  1D5V A;  2XAG A;  5A2Q Z;  2RQP A;  5FGM A;  3ABT A;  3CJN A;  4M6X A;  4EGY A;  5HLG A;  1RZ4 A;  4Q48 A;  1U8R A;  2HQN A;  4MGR A;  2YPR A;  1K6O A;  3F3X A;  4AIH A;  3D0S A;  5AIP A;  5AIQ A;  4ENJ A;  5JFR A;  3JSP A;  1G4D A;  3K69 A;  4G7O F;  1AOY A;  2UXN A;  3CO7 C;  4N0B A;  4CXF A;  3KEO A;  3HTU A;  1TTY A;  3BJ6 A;  5L3F A;  2CG4 A;  2G7U A;  4HLX A;  4ESB A;  1HKT A;  1I6X A;  3DKW A;  4EM1 A;  4KN4 X;  4JK1 X;  5F64 A;  1BBY A;  3QAH A;  4OIP F;  1X3U A;  2ZNY A;  3R60 A;  5A2Q K;  2XGX A;  5D4R A;  4U7D A;  3RYP A;  2BBY A;  2W84 A;  1IN8 A;  4I0B A;  4L0Y B;  1Y0U A;  2DI3 A;  4B8X A;  4KIF A;  2HWV A;  1V4R A;  3HUG A;  5HDN A;  4HV6 A;  3FHZ A;  1XD7 A;  4I2O A;  5E20 A;  3N4M A;  3W6K B;  2IT0 A;  3V7R A;  5BS6 A;  1R23 A;  3U1D A;  4UUV A;  3QP5 A;  5DUK A;  5D5V B;  3KZY A;  2NNN A;  2F5C A;  1FBU A;  1H9G A;  2M45 A;  2QWW A;  3LA7 A;  4ZH4 F;  3V8L A;  2JSC A;  3KCC A;  2EV6 A;  1S29 A;  4XSX F;  5BQT A;  2ISZ A;  2IA1 A;  4HOB A;  4EV0 A;  3GW2 A;  2GQQ A;  5ILS A;  3BOQ A;  1IN6 A;  4EMS A;  1YS6 A;  2PLY A;  2GIV A;  3HSE A;  1YW9 A;  4HW0 A;  4Q47 A;  4CHU A;  1ZAO A;  2ISY A;  3L9F A;  4MEX F;  4H0E A;  2IJL A;  5JHU A;  4A5M A;  1ZHF A;  3RKW A;  4KFC A;  3TDZ C;  4NQW A;  1YS7 A;  1QPM A;  4G7H F;  3P9K A;  4PZJ A;  3FZV A;  2FF4 A;  3WGH A;  3QOP A;  1GXQ A;  1I27 A;  3ZMV A;  3MAJ A;  1IXC A;  2O61 A;  5FLX Z;  1YFH A;  3E6M A;  3HOS A;  4EJO A;  4PGG A;  5DCM B;  2A69 F;  1J7K A;  4YFN F;  4RGS A;  3IHU A;  1DUX C;  3WTZ A;  4QLC U;  5E1Z B;  3BJA A;  2YU3 A;  4PGH A;  2GXB A;  5ICE A;  2K86 A;  3IWZ A;  4R79 A;  3T8T A;  5BPI A;  2XVC A;  1JGS A;  2VN2 A;  2BGC A;  1I5Z A;  1FSH A;  2ZKZ A;  4LMY A;  4ZYH A;  3SHF A;  1F4K A;  2O6G E;  1TQP A;  2YSR A;  3QRF F;  2Y48 A;  4RB1 A;  5HS9 A;  3BY6 A;  3G73 A;  1P4X A;  4HA8 A;  2O3F A;  5CVJ A;  1MD0 A;  3DXJ F;  2GZW A;  2W24 A;  3F8M A;  1T6S A;  3LQQ A;  1SMY F;  2A6E F;  1OYY A;  1BI0 A;  1ON1 A;  5J8C A;  1KU9 A;  2EB7 A;  2HQR A;  3GFI A;  2JRT A;  4LJZ F;  1J0R A;  1O7L A;  2G7H A;  3KP7 A;  3L2C A;  2O8X A;  2GAU A;  2E1N A;  3DEU A;  4BYY A;  1LEA A;  1SMT A;  4PCQ A;  2LF7 A;  4XLN F;  3ZMU A;  4LD5 A;  5HDK A;  3SFZ A;  2ZBK A;  2HR3 A;  1IW7 F;  2WWY A;  5LEJ A;  4IPA A;  3RJP A;  4I0A A;  5FFZ A;  1BIA A;  3HRU A;  1J75 A;  3I58 A;  2DT5 A;  2HKO A;  3F8F A;  2XKP A;  3PFI A;  3HRS A;  5AON A;  4MTD A;  2JPC A;  4FHT A;  3Q9V A;  1T2K A;  1R1T A;  3COA C;  2KIU A;  3V7S A;  5LGT A;  1R58 A;  1G3S A;  2P5L C;  4U7B A;  3KFW X;  5IT9 K;  1XMA A;  3IKV A;  5ILV A;  3FXU A;  1QBJ A;  2DK8 A;  5LBQ A;  2FA5 A;  1LJ9 A;  1DPR A;  1GXP A;  4RB2 C;  3CUQ B;  2P7V B;  4R1H A;  1P6R A;  3WTW C;  2ZCW A;  2O03 A;  2QYO A;  3E5U A;  2DO7 A;  1BIB A;  2ZME B;  1OKR A;  3ZP5 A;  4G7Z F;  4CYD A;  2LF8 A;  3E97 A;  1HW2 A;  5D5U B;  1FLI A;  1BN5 A;  5CVR A;  3K1N A;  3ISP A;  1B59 A;  4BHB A;  2DPU A;  4Z2Y A;  4RGU A;  2RKH A;  3DPT A;  5EEH A;  4N9I A;  1L0O C;  3IL2 A;  1V3F A;  3I5U A;  5HLH A;  4Q5S F;  2FNP A;  4L5I A;  4GYI A;  3LST A;  1BC7 C;  2P4W A;  3GFL A;  1ULY A;  4U0W A;  4NHJ A;  5CYV A;  2XIG A;  4LB6 B;  2YX7 A;  3F22 A;  2VBX A;  3BPX A;  5BMZ A;  5DCM A;  2FBH A;  1KQ9 A;  2HYF A;  2J5O A;  3ZN0 A;  4RB3 C;  3F23 A;  1ZG3 A;  2PG4 A;  3JW4 A;  3C3W A;  2OQG A;  4UXN A;  3WU1 B;  4M6Y A;  4G6Q A;  2FOK A;  2BYV E;  3ZQ7 A;  4HDU A;  4L5J A;  2CYY A;  2A68 F;  2CFX A;  5E18 F;  4PDK A;  1ZGA A;  1IXR C;  1OYI A;  1R22 A;  2O0Y A;  4L18 B;  4M74 A;  2UXX A;  5J8F A;  4KDP A;  2HDC A;  2DW4 A;  3FM5 A;  3Q9S A;  1KYW A;  4MTE A;  3M9A A;  5E17 F;  3KP4 A;  2QBY B;  4HX8 A;  2OZU A;  2PEX A;  2Y75 A;  4CO8 A;  3WE2 A;  2VBZ A;  1MJA A;  3J7A O;  5HOO A;  1O3R A;  4ON0 A;  3MCZ A;  1FT9 A;  2A6H F;  3VEP A;  2GA2 A;  1G3Y A;  2RVC A;  3E6C C;  4N9H A;  1NHA A;  4HYE A;  1T98 A;  2AS5 F;  3KEQ A;  1J2X A;  2IPQ X;  2QQB A;  1XDU A;  2NRA C;  1P4A A;  4S05 A;  2ESN A;  4NB5 A;  2MD5 A;  2ZNZ A;  5JI6 A;  1ZRC A;  5D8L B;  3QU3 A;  4RS8 A;  3BWG A;  4LFU A;  1W5S A;  1MZB A;  1WI9 A;  1WSU A;  3KLN A;  4UVC A;  4F7Z A;  2V6C A;  1A04 A;  3ZN1 A;  4GYG A;  4QWQ A;  4OMZ A;  1K78 B;  3E3V A;  2MLG A;  3M1E A;  5DCF A;  2XAS A;  5JVT A;  3V8K A;  3GVA A;  2XRN A;  4Q4Z F;  1Z91 A;  2FU4 A;  2VT2 A;  4GO1 A;  4LLL A;  1JE8 A;  3BPV A;  4RAZ A;  2XAH A;  4G9Y A;  2H94 A;  4HF0 A;  3NQO A;  4LG0 B;  4P9F A;  3T1B A;  5L3C A;  2PQ8 A;  5D4S A;  2C6Y A;  1FPQ A;  3C1D A;  5D5W B;  4BNC A;  4M72 A;  5K5R A;  4A0X A;  3DFG A;  2FSW A;  1IZ1 A;  1HW5 A;  2VE8 A;  1XSX A;  2P6S A;  3CUQ A;  4A0Z A;  3JAM Z;  1XGO A;  4HF1 A;  2QZ8 A;  2FRH A;  4ZZD A;  3CUQ C;  1LVA A;  1ONV A;  4A6D A;  1O3T A;  1H0M A;  2ZME A;  2Z99 A;  3SZT A;  2CO5 A;  3KP2 A;  5CVU A;  2IW5 A;  1FZP B;  3U2R A;  4P5O A;  1UCR A;  2ESH A;  3GO5 A;  4M9Z A;  3EET A;  1S7O A;  3BJO A;  3ZPL A;  1HSJ A;  4I7H A;  2ETH A;  2V1D A;  2A5Y B;  5DYM A;  1RUN A;  1B6A A;  5HDG A;  1P2F A;  1W4M A;  1H9T A;  2G9W A;  3I54 A;  2HTS A;  4DNC A;  4OOI A;  3I4P A;  1T0F A;  2ZFW A;  1ZLJ A;  4L9V A;  4E70 A;  2H27 A;  1FNN A;  3ZMZ A;  2GA1 A;  5DD4 A;  3K2Z A;  4YG2 F;  2EWN A;  5LHI A;  3JAM K;  4GCV A;  3F72 A;  2VC0 A;  5LHH A;  1UFM A;  3LFK A;  4CDG A;  3GFM A;  4YFK F;  4R8H A;  2X4H A;  4AD9 A;  1ZRE A;  2DK5 A;  5K1Y A;  1YW7 A;  3C18 A;  2HEO A;  2Y0M A;  4U88 A;  2EV0 A;  4AVP A;  4EQQ A;  4KA4 A;  4KYW A;  2RN7 A;  1K79 A;  2QM3 A;  2XV4 S;  2H09 A;  1S8N A;  1TQM A;  4OU0 A;  5H6R A;  3VB2 A;  2WC2 A;  1UHM A;  1XB4 A;  4BXU A;  4UV9 A;  4AWX B;  1YLF A;  3WE3 A;  3KLO A;  2QBY A;  2K02 A;  5HVQ C;  1SFX A;  1STZ A;  1ZAR A;  1HW1 A;  3HRM A;  4OIO F;  2UZK A;  4KIC A;  4HAM A;  2D45 A;  5HS7 A;  5ILU A;  2VT3 A;  3FXQ A;  4KT5 C;  5L3E A;  1XMK A;  2HTJ A;  2EA2 A;  4KIB A;  2EJR A;  4EJU A;  1C0W A;  4HBL A;  4RB0 A;  2EV5 A;  1LDD A;  3Q5F A;  1W5T A;  5HLI A;  5L3B A;  4HQM A;  5LEK A;  4M9X A;  1K7A A;  4EM2 A;  1F5T A;  2Z5U A;  4Y15 A;  1KYZ A;  3EDP A;  3WTT C;  1EH7 A;  1YIO A;  4IVN A;  5FD6 A;  3WGI A;  4B09 A;  1O7F A;  1LDJ A;  3O6B B;  3B73 A;  2OAZ A;  5CJ9 A;  2EFW A;  2EFQ A;  4CIC A;  2VE9 A;  2CWE A;  2H6C A;  3GZ6 A;  1OR7 A;  4WF2 A;  3RIR A;  2GWR A;  1YTY A;  3REO A;  3PQK A;  3KP6 A;  4MQV A;  4M73 A;  1Z05 A;  2HYG D;  3GF2 A;  5FLX K;  2MBF A;  2QQA A;  3T5X A;  3M8F A;  1P92 A;  1CGP A;  4XLP F;  1IAW A;  4LG0 A;  5FB2 A;  4IRI A;  1ZRF A;  4YIF A;  1Z9C A;  3CTA A;  4D0P A;  3KP5 A;  1YO5 C;  3TGN A;  5CVI A;  1KQ8 A;  1OYW A;  4I01 A;  1U5T B;  2M5W A;  2HOE A;  5BPD A;  1Z7U A;  1IRF A;  1QZY A;  4A12 A;  3DF8 A;  1TQI A;  3WOD F;  2KKO A;  2WV0 A;  1B4A A;  4KMF A;  4ESJ A;  2FEZ A;  5DUI A;  4KN7 X;  2H6B A;  3GUD A;  3JTH A;  2DPD A;  4MEY F;  1AWC A;  3HIF A;  3H92 A;  1HKQ A;  1LQ1 A;  1EH6 A;  1RI7 A;  4HZF A;  4LK0 F;  1DP7 P;  3VOE A;  1WRJ A;  4BAY A;  5LRR A;  5E8G A;  4FX4 A;  3WGG A;  3V4G A;  1FYL A;  2DQL A;  4KIG A;  2Z33 A;  3GX4 X;  3RPU A;  2P5V A;  3IC7 A;  1LB2 A;  5LHG A;  2JZY A;  5CLS A;  3LA2 A;  2STT A;  1BI1 A;  1XGN A;  3AAF A;  1G6N A;  3KP3 A;  3O2P E;  2OU2 A;  1FC3 A;  2A61 A;  4WX9 A;  4WK8 F;  3DV8 A;  3E6B A;  1BOA A;  2KIM A;  3F21 A;  3V8J A;  2Q8K A;  3I71 A;  1ZRD A;  3EUH A;  2LKP A;  2XAF A;  2ZO4 A;  3FWE A;  6PAX A;  2PMU A;  1XCB A;  4O6J A;  1TNT A;  1SD4 A;  3NRV A;  3BDD A;  2IA2 A;  5D6E A;  3KE2 A;  4GXO A;  3ZMT A;  2GXG A;  1MJB A;  3K9T A;  3IRQ A;  1IXS B;  3ERE D;  4LGW A;  3H3Z A;  2CGP A;  1PUE E;  4ENK A;  4Y13 A;  2FE3 A;  4HV5 A;  1XSV A;  2UWM A;  1WQ2 A;  3RKX A;  2R3S A;  1FOK A;  4TV7 A;  3TO9 A;  1PDN C;  3GYH X;  3B02 A;  2L4M A;  1JXS A;  5D5X B;  1J59 A;  2P8T A;  2JT1 A;  5HS8 A;  2JPB A;  4P96 A;  4KNY A;  1GHC A;  3P9C A;  4MHG A;  3MFK A;  1U6G A;  3J81 Z;  1ZLK A;  4BHC A;  2STW A;  5F6F A;  3RTR A;  2MH9 A;  2YX4 A;  1MDM B;  3J80 Z;  4ZYG A;  2K7L A;  4EJV A;  1FY7 A;  4HX7 A;  3ABU A;  5ICG A;  3HYI A;  1UB9 A;  3RPQ A;  2XUB A;  3HOT A;  2FMY A;  4RGR A;  4P9U A;  3F8C A;  5H20 A;  2OZ6 A;  3FF5 A;  5IT3 A;  3E5X A;  3MQ0 A;  4HX4 A;  3GZ5 A;  3F6V A;  2M30 A;  4Y17 A;  1XSD A;  1Z1D A;  1BC8 C;  2PFB A;  3E6D A;  3MEX A;  1YQA A;  2VBY A;  5E8I A;  1BI3 A;  5FFX A;  4IRG A;  2VOO A;  3ULQ B;  3I0T A;  2HZT A;  1FBQ A;  3IKT A;  4KMU X;  1FBS A;  3W6J B;  3OV8 A;  4U0V A;  3T8R A;  2MH2 A;  2PMH A;  4WXD A;  4OMY A;  2XAQ A;  1LDK B;  5TJJ A;  2ACJ A;  1D8K A;  3F8N A;  3HTS B;  5H6Q A;  2ZJ2 A;  1D8J A;  3J80 K;  5K5O A;  2CQK A;  3H3U A;  4WXH A;  1O3Q A;  1R1V A;  2V1X A;  1OMI A;  4MQ9 F;  2F5E A;  2EFO A;  3L7W A;  3GWZ A;  4UV8 A;  4UVB A;  2DTR A;  3JSO A;  5F1R A;  2CSO A;  1O3S A;  1W7P B;  1ZYR F;  1QGP A;  3KET A;  1YW8 A;  5ERI A;  3CO6 C;  1IUY A;  1ZG5 A;  2NAZ A;  1W7P D;  5ICC A;  3F6O A;  3GFJ A;  4JBA A;  2HGC A;  2K27 A;  3QU6 A;  2OA4 A;  2QEN A;  1TW2 A;  2Z3Y A;  3EQL F;  3WTY C;  1DPU A;  1F9N A;  1KGS A;  4ENM A;  3JTG A;  3MZY A;  4WCG A;  1E17 A;  2RGV A;  2QUF A;  3F8B A;  4A2U A;  2FML A;  3IWF A;  1BM9 A;  3FMQ A;  1QQI A;  4UVA A;  2XRO A;  2HKX A;  4LB5 A;  1USS A;  4JQF A;  4HDV A;  3LWF A;  3ZMS A;  1J5Y A;  4LLN A;  4ASN A;  2A07 F;  5E1W A;  2A3S A;  3FMS A;  2DFI A;  1MGT A;  1I1S A;  2NS0 A;  2P7C B;  4HLY A;  2TDX A;  2P5K A;  1FYM A;  2BV6 A;  4LLG F;  3QPT A;  2PBI A;  2IP2 A;  5L3D A;  4EGZ A;  4G8X A;  3QP6 A;  1E2X A;  4AIJ A;  4RGX A;  2EA4 A;  1FWZ A;  3NEU A;  4AIK A;  4ZYD A;  3BZ6 A;  1CF7 B;  3K1P A;  2DAO A;  2VXZ A;  3TDU C;  3M8E A;  4BQA A;  1T39 A;  1FP1 D;  2M1B A;  1SD5 A;  2EFP A;  4ZYE A;  2CW0 F;  1QO0 D;  5LLQ A;  2OD5 A;  3ROU A;  4BH9 A;  1RIO H;  1SD6 A;  2KRF A;  2DLL A;  2EFN A;  2LSO A;  1MDM A;  4EJW A;  4UNO A;  4ENN A;  2OBP A;  4IRH A;  4YFX F;  4RAY A;  3TQN A;  1JHF A;  3ECO A;  3CUO A;  2ADU A;  4ESF A;  3FMR A;  3S2W A;  1TNS A;  1BJA A;  2V79 A;  3LAP A;  1IN7 A;  2QLZ A;  3E5Q A;  3IRR A;  2X0L A;  3BRO A;  2VC1 A;  1B1B A;  3PQJ A;  3N97 A;  3SZP A;  4S04 A;  2D2W A;  2J5P A;  2D1V A;  3G3Z A;  2HS5 A;  1TW3 A;  1SFU A;  1KU3 A;  2IVM A;  1IN5 A;  4A6E A;  1L3L A;  2RV8 A;  4O5V A;  4CZZ A;  1R36 A;  4L9T A;  2PN6 A;  2M87 A;  2Q0O A;  3O3K A;  4XBF A;  1XN7 A;  1Z6T A;  2FQ3 A;  2D1H A;  2BEO A;  1KQ0 A;  4A0Y A;  2RC4 A;  2F5D A;  2FBK A;  3WTS C;  5L3G A;  4IF4 A;  1W7P A;  3VOD A;  3RKY A;  3T0Y A;  4FX0 A;  3OOP A;  2ELH A;  3I53 A;  3FX3 A;  3V7C A;  2L54 A;  4P55 A;  4WWC A;  1G3T A;  5D8K B;  1K78 A;  3EYY A;  4EVI A;  5ED4 A;  2Q2E A;  4HF2 A;  2E7W A;  3RDI A;  4OIR F;  5KVR A;  1EH8 A;  1PP7 U;  3HSF A;  3D5L A;  1MJ9 A;  3R61 A;  5D6F A;  2VBW A;  2XHK A;  2L3D A;  3LA3 A;  3M7G A;  4CGZ A;  2L4A A;  1IRG A;  1WKM A;  3VFZ A;  1I1G A;  3WTU C;  4YII A;  3R0J A;  1ZH5 A;  1VTN C;  1IF1 A;  1ZN2 A;  3WTX C;  3I59 B;  5TRD A;  1WWX A;  3C7J A;  3DPL C;  4U0Y A;  5DD8 A;  2WTE A;  1RNL A;  5LGU A;  5IT9 Z;  2VOP A;  4M9S A;  4ETS A;  2XKO A;  1EV7 A;  2V1U A;  3SQN A;  2DBB A;  4MNU A;  1B9M A;  3R6S A;  4G6D A;  4EJT A;  1T38 A;  1FX7 A;  4IXA A;  1YG2 A;  2R7D A;  5LRS A;  1GVJ A;  5JR3 A;  1HXD A;  1U78 A;  3ML6 A;  4XSZ F;  3HSR A;  2LDU A;  2RDP A;  4BHP A;  1XGS A;  2ZXJ A;  1ZG1 A;  5ICF A;  3K0L A;  3LAJ A;  5DDG A;  2K4J A;  3RI4 A;  1SAX A;  5LGN A;  1XDS A;  1CF7 A;  3CDH A;  2IRF G;  1ODD A;  4LK1 F;  3ECH A;  3GXO A;  1F1Z A;  3LQR A;  1B9N A;  1XGM A;  4FT8 A;  5CVV A;  3HHG A;  2NNY A;  3FXR A;  4L9J A;  1S6L A;  2R7F A;  2W25 A;  3L09 A;  1P4W A;  2FXA A;  4GGG A;  3L00 A;  3WU0 A;  3R0A A;  4ZZL A;  1LNW A;  4DQ2 A;  1D3Y A;  2FNA A;  1ZGJ A;  2KJC A;  3FM3 A;  2W85 A;  2MLK A;  4OIQ F;  2L01 A;  2K4B A;  1U3E M;  4HQE A;  2E7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...