3A01A

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeodomain-containing protein
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01A00
3IV5A 1HOMA 1W0TA 2XPVA 2HXOA 4B3AA 3BTLA 3HEFA 4IHYA 1G2HA 3RZDJ 4HNVA 1ITYA 3BG9A 5FKNA 2XPWA 1ETVA 2K40A 2R93J 5M5YJ 3LSRA 3ZQLA 1UG2A 1ETWA 4FE4A 1ETQA 3GTGJ 2QF7A 1IDYA 5C4JJ 1U9OA 1UHSA 1A6IA 2DTZA 4G12A 4V2FA 1UMQA 5DTDA 5FLMJ 1QVTA 1IDZA 1P7JA 2EH3A 3OSFA 1AU7A 4UUSA 4XRSG 3JRHA 2R92J 5FKOA 3HOUJ 2DA7A 3CMYA 1ETOA 2R5ZA 5FKKA 1T33A 4I76A 1RKTA 1I3QJ 2M8GX 3QPSA 5K7FA 1B8IB 3L1PA 3ZQIA 4IHXA 1LFBA 1GV5A 3S16J 2KT0A 1W0UA 3E7LA 3K2AA 4MIMA 2LTPA 2JA6J 3FIWA 2LKXA 1MBJA 2O7OA 1H88C 2ELKA 2ID6A 3WHBA 4AUXA 5HODA 3M3YJ 4W97A 1CQTA 3CQZJ 5IYDJ 2VI6A 1SFOJ 2ECBA 3D1NI 3ZOBA 3GTPJ 4JX5A 2HYJA 3MN2A 3TW6A 3BTIA 4BY7J 1WH5A 3Q0UA 2M0CA 3TEDA 3HDDA 1F43A 3UKGA 3Q0VA 3JRDA 4NDLA 2R5YB 1GDTA 4A3IJ 5F04A 2H8RA 1NK3P 2K9QA 5C44J 4JYKA 2GBYA 3A01A 5GPAA 3OOUA 1HDDC 3HM5A 3QPLA 2W48A 5M5XJ 1GT0C 2MSYA 3BQZA 2CU7A 3BR3A 2R0QC 3I4MJ 3VPRA 1ZTRA 5GPCA 5EG0B 2EQRA 3C2BA 5IP6A 1RESA 2MW8A 2YUSA 4A3LJ 3ZQCA 1H8AC 3BG3A 1LE8A 2XPUA 2M2EA 2DA1A 1XC5A 3IH2A 1Y1VJ 5F27A 1IGNA 1MSFC 4BY1J 2JA8J 2DA6A 1FTTA 4JX4A 2IBDA 3LSGA 5IOYA 5EF6A 4FISA 3GBGA 4JX6A 4AYBN 1DU0A 2CJJA 2E2JJ 5EGOA 4DZPA 1SANA 4DYQA 1BA5A 3MVPA 2NOGA 4X6AJ 5J3LA 1HCRA 1BW5A 5C3EJ 2EZKA 5F0HA 1A5JA 3HKZN 4XRMA 1MH3A 2OF7A 4FCYA 2DMNA 2MGQA 5E3MA 3BR6A 2EZHA 3S1NJ 1B72B 1JT6A 3O8HA 5K7ZA 3ZQFA 2JA5J 1OCPA 2Y9ZA 5IPAA 1WI3A 3HOZJ 1JUSA 2XB5A 3B6AA 2HDDA 2YU9J 1VNDA 1B8IA 1TWHJ 2VKVA 4M3DA 1MBHA 2WV1A 4MFDA 2LY9A 2DJNA 2ME6A 2L9RA 1JKRC 4A3JJ 4RDUA 1Z0XA 2XGDA 4DW6A 3IH4A 3HOVJ 4M3EA 2JN6A 4XK4A 2L0KA 1U78A 1X58A 4A3CJ 4M6VA 4BKXA 4ABZA 1IG7A 2AHQA 3BTCA 5IP7J 1YRNA 5JLXA 3ZQHA 2NS8A 2JJ7A 2L7FP 4FE7A 4D5CA 1ZQ3P 5FLVA 4V2GA 1R9TJ 1RR7A 1U9NA 2VKEA 3RZOJ 4IHWA 3HGYA 1X2NA 1QRYA 4A69C 1NK2P 2R5YA 2CUEA 1IUFA 1IJWC 5IP9J 2O8KA 2GLOA 5FKLA 5BNGA 2CRGA 5DS9A 1QPIA 2NVXJ 5J1YA 1IC8A 1APLC 2HOSA 2OPTA 4M3BA 4CYCB 1MBGA 2CQXA 4I6ZA 1S7EA 3GTMJ 2K9SA 2IAIA 1FIAA 2CUFA 2X6OA 1MSEC 3S14J 3ZQGA 4A3KJ 3S1MJ 2NVYJ 4IHVA 3JRGA 4UUSB 1K61A 3B6CA 5FJ8J 5M3FJ 1MBFA 2HXIA 1LFUP 2CQQA 2Y2ZA 1AKHA 2MG4A 1GUUA 2XSDC 3QQAA 3S2HJ 3GTKJ 4MLOA 1NTCA 3G1LA 3G1OA 3S1QJ 1H89C 5IYCJ 2XB0X 2LVSA 1HF0A 1HLVA 1TWAJ 1TWFJ 5J1UA 3GTOJ 1IV6A 5M5WJ 2TRTA 2HOAA 5E3NA 4A3MJ 1B72A 3PM1A 4EEFG 2M9HA 2Y0SN 5EEAA 2NVTJ 1JTYA 3GTQJ 1TWCJ 3JRIA 3JR9A 1PUFB 2M34A 3A03A 4A3BJ 2HI3A 3M4OJ 3LSPA 4GFBA 2JA7J 4L5EA 2DA2A 1WH7A 2AO9A 4D5FA 2FJ1A 5E3LA 4Y52J 5GP9A 3O8GA 2NVQJ 2DMUA 3CCYA 3Q3SA 1Z77A 2ECCA 4AC0A 5J1RA 3I4NJ 1D5YA 3A01B 2LLKA 2Y31A 2P81A 1WGXA 2EBIA 1I50J 3JRFA 2L7MP 3PO2J 4B1RA 4XRSA 2Y9YA 1FTZA 4J19A 4BBSJ 2LD5A 2XRLA 1MBEA 3TP0A 4BBRJ 4LOCA 1GVDA 3TP3A 3S17J 4X1EA 3BT9A 3IH3A 4B4CA 5F1JA 1ZR4A 1OFCX 3DEWA 3Q0WA 2LP0A 4A3DJ 3GTLJ 5FKMA 1E3OC 2DA5A 2RAEA 2TCTA 3A02A 4S0HB 4C3JJ 4C3HJ 3LNQA 3NARA 3RQIA 2XGCA 3SJMA 1ZKGA 3FISA 2DA4A 2LK2A 4QTRA 2LR8A 5F0FA 3F0CA 3BR5A 4C3IJ 1ZK8A 1ETKA 5IYBJ 2HOTA 1ENHA 2WAQN 4CYCA 3H0GJ 5EGOB 1JKOC 2O9LA 1TWGJ 3FKIJ 1JUPA 2DA3A 3BTJA 3JRCA 3JRBA 1OCTC 3WHCA 2EZLA 1VF9A 5C4XJ 9ANTA 1VI0A 1ETXA 4D7NA 3H3VK 1FEXA 3BR2A 3G1MA 1U8BA 1BL0A 2VPRA 1JJ8C 3HBLA 2FX0A 2E2IJ 1TC3C 4QIWN 5F0CA 4DZJA 2QCOA 5EDNA 3S2DJ 4A93J 2H1KA 4XICA 3SFIA 2B63J 1X2MA 4C2MJ 1FIPA 5EZGA 3JREA 1XG1A 1WCMJ 1ZR2A 2JK3A 4M3GA 2E1OA 5IOZA 1JJ6C 3LSJA 1IRZA 3MKLA 5M3MJ 5E3OA 5EG0A 3HOWJ 2K9NA 3CDLA 1JKPC 5F08A 4D7MA 1XS9A 2X9DA 4BXXJ 2IEKA 3OSGA 2Y30A 3HOYJ 2DMQA 4JP0A 2FQ4A 2E2HJ 4RBOA 1RETA 2R5ZB 1F36A 3BR0A 1YRNB 4W1UA 1JUMA 4A3FJ 1Q1VA 1PUFA 1FJLA 4Y7NJ 3S1RJ 5EZHA 1MNMC 3K7AJ 2X48A 2I10A 4A3GJ 4DYRA 2GM4A 2L7ZA 1ORKA 5EYRA 4XIDA 1OJLA 3PO3J 4M3FA 2D5VA 4QSHA 2R7ZJ 4MO7A 3BR1A 2LFBA 1POGA 3BQYA 1JKQC 2VUMJ 2JMWA 3LOCA 2DMPA 2PMZN 1BW6A 2YS9A 1P7IA 2DN0A 4DYCA 2E19A 1AHDP 1EF4A 1GV2A 2ZB9A 3NAUA 1T56A 3OIOA 1MH4A 2FD5A 1BJZA 3GTJJ 1O4XA 3RKQA 1WPKA 3BG5A 2ID3A 3HOXJ 4UUTA 4A3EJ 1Y1WJ 1RPWA 3TW7A 1RKWA 2WB1N 1ZGWA 1K83J 1ETYA 2DMTA 1JGGA 3FK7A 4IEJA 1AKHB 2XGEA 3DCFA 1JTXA 2KDZA 1QVUA 1VFCA 3S15J 1MBKA 2N8GA 2NS7A 3HB9A 2JWTA 3HGGA 4FTHA 2HQ5A 3JRAA 5K7HA 2G0EA 3FK6A 1DU6A 1I6HJ 3W6VA 1HDPA 2ME0A 2COBA 3SDGA 1JT0A 4MFEA 2EZIA 5JLWA 1LE8B
chains in the Genus database with same CATH superfamily
3T1BA 3HSFA 1W0TA 4V19K 4F7ZA 4G9YA 4ZDPA 2V4JC 1KGSA 3L2CA 1BR1A 3RZDJ 4HNVA 3CDIA 2NXNB 3A0HC 1S29A 2QQBA 2R93J 3LSRA 5DEQA 1UG2A 1LPQA 1X1AA 2ISZA 2OBPA 2PMUA 3DPLC 2JA2A 3P9CA 2PQ8A 3KP2A 3EYIA 4G12A 4DNCA 4HF0A 3CTAA 5J8FA 4CUGA 1LKXA 3J7ZI 1U5TB 4DBQA 1HW1A 3LSHA 1MJAA 4KN4X 5AIPA 2DK8A 1T98A 1S6LA 1T08B 1ETOA 1YX3A 1X4OA 2FOKA 1RKTA 2JRTA 3I71A 3H9QA 5CPRB 1F9NA 1R5HA 3K4JA 4KUMA 2F4OB 2VJJA 3VSLA 1V4RA 3E7LA 4MIMA 2LTPA 4IRIA 1Y8RB 2E5ZA 4OIRF 1MBJA 3J80K 1H88C 4FHTA 3WHBA 4AUXA 5HODA 1S72I 3DTIA 4W97A 2L4AA 4M6YA 3RJPA 2WAEA 3CQZJ 4MEYF 4UHTA 1NG7A 4IPAA 1SFUA 3ZOBA 3GTPJ 2F5VA 2ZJRF 1BIAA 3TW6A 3W6KB 4YG2F 3OYMA 2F5DA 3M1EA 2CFXA 3H1CA 2ADUA 4E7LA 3WU1B 4PSWA 4Y13A 1V5EA 5JVGF 2HKOA 3JTHA 3GZ6A 3JRDA 4NDLA 2EV6A 4AIHA 4XOTA 3OYKA 1GDTA 5IT3A 2K9QA 2ELJA 2KRHA 1YJNI 3IL2A 3OOUA 3S2WA 3JAMZ 1I1GA 4G7OF 3HM5A 5CVJA 1PYVA 2EFQA 2MSYA 3BZKA 2LBFA 4F93B 2K02A 4HV5A 3RYRA 3OIPA 3KCCA 1D1CA 1S9HA 3I4MJ 4M71A 2Z99A 5GPCA 2EQRA 2W82A 3K2ZA 2ZSHB 2MD0A 4IQ4A 3OS0A 3ECOA 2QLZA 2ZXJA 4XN0A 3ZQCA 1R6RA 1CF7B 3BG3A 2ZBKA 1LE8A 1HBXG 1BJAA 1FNNA 1E0EA 4BE2A 5F27A 3IH2A 2K7LA 2WAQA 4N0BA 1A36A 3A1YA 4BY1J 4KMFA 1FTTA 4JX4A 2F4MB 5ICCA 2R7UA 1BOBA 2FUG2 4BAYA 2UXXA 4UB6C 5IOYA 1IXSB 1VQMI 3I54A 3RQ4A 1W7PD 3FM5A 3K1MA 5FD5A 5FO5A 3DXJF 4ESJA 4RA2A 4DYQA 5DD8A 2HWVA 4KYWA 2HVQA 3SZGA 3GXOA 1HCRA 2D1VA 3E0JB 3U1DA 3MCZA 5C3EJ 4C9YA 1A04A 1TTYA 2EZKA 5F0HA 2LC2A 2OF7A 3DBHB 2ZCWA 5A2QK 3JSPA 2HEOA 3BR6A 3M7GA 2M4KA 4L9VA 1OYIA 2L9VA 1B72B 3S1NJ 1JT6A 4LMYA 1AOYA 1VZ0A 2WADA 3CP2A 4BJTA 1W5CC 3OYDA 5IPAA 1JUSA 2ZFUA 1GLNA 2HQNA 2KPMA 2VKVA 4XM3A 2WV1A 5B1AH 1OKRA 2DDAA 3V42A 1I3AA 1LQ1A 2RN7A 3OYAA 4H4KC 1Y8QB 4A3JJ 5E8IA 2OAZA 3BDDA 3IH4A 3KEOA 2IGNA 1X3WB 2JN6A 3I0TA 3ERMA 2EK5A 2GOXB 1IN5A 4F55A 2X51A 4BKXA 3KFWX 1R7JA 3QPHA 1IG7A 5KK1A 3I58A 1YRNA 1V55H 2OUMA 4CYDA 2ELHA 3NQOA 4E7ZA 3CC7I 2E36A 3U9GA 2A05A 2DTRA 1QRYA 4GYIA 4LIVA 2R5YA 4OIQF 2VIXA 1IUFA 3WGGA 3M9AA 2VE9A 2E35A 3M8FA 4XLCA 4OINF 1W7PA 2GLOA 4GRIA 2O8KA 5FKLA 2VE8A 1F5TA 1QNTA 2KLOA 2CRGA 4S04A 4NC6A 3CF2A 2BW3A 5CQGA 4ZDLA 2XROA 1IC8A 1MJ9A 2BOLA 3FXQA 3WTUC 3N4MA 1EA3A 4XBFA 2BY0A 1LEAA 4HYEA 3OYCA 4CYCB 4I6ZA 2WB1A 4G6DA 3FMSA 4RMNA 2OCCH 4RLFA 1J09A 1T2KA 1B4AA 3LSTA 2GA1A 3FHZA 2QEXI 2PN6A 5BPDA 3ZQGA 3S1MJ 4BYYA 4BE0A 1WQ2A 3QWLA 1SD6A 2FBIA 4FETA 4PDKA 1ZYRF 3P7NA 4ZYEA 2BBYA 5CVIA 4XKBA 4CDGA 3J7AO 3ABLH 4NC8A 2PJRA 2L01A 4P55A 4DBRA 2JTVA 2MFZA 2CW7A 2AS5F 1NG6A 2XAFA 2ISYA 2MD5A 3NWSA 1YW7A 1GUUA 3ONQA 1F4KA 2PLYA 2IS6A 4OAZA 3H36A 1O3SA 1J75A 2FMLA 4CA0A 4CO8A 3G1LA 3E1SA 4IF4A 5EEGA 4BGDA 1K78A 1H89C 5IYCJ 1XGSA 4CZCA 2DT6A 4GXOA 2IVMA 1P4WA 3FMQA 3MQ0A 2M45A 5HOOA 4A3MJ 3C2HA 3PM1A 4RM2A 4EEFG 4KJZA 2CV1A 1K6YA 3DPUA 2J5PA 4CSWA 2P5VA 1GVJA 1FSEA 3M4OJ 2AO9A 3OS1A 2FJ1A 3FXUA 3EETA 1Z77A 4AC0A 1QZZA 3MMYB 5J1RA 3I4NJ 3A01B 1HW2A 1YS7A 3BZ6A 4O5VA 2MA3A 4OAYA 2LRDA 3M1CA 5TJJA 4II2A 5DCMA 1WJDA 2Y75A 1OCRH 2VT2A 5ILUA 4ZYGA 1R1VA 3DU5A 2W24A 2MH2A 2Y9YA 2MABA 4BBSJ 3PFYA 2XRLA 1IN7A 3F3XA 3TP0A 3AL0C 2O0YA 3DPTA 1XSVA 2EA2A 5GADJ 4OOIA 4EGYA 4XLNF 5DM6F 3LQRA 3CJQB 3RYPA 3VYSB 1IXRC 4P1WA 3WTSC 1W36D 1H0MA 2HZDA 2ZJ2A 3E5XA 4QPQA 3GWZA 4C3JJ 2VQGA 1ODDA 1RZ4A 3LA3A 3SJMA 1FWZA 2RVCA 4HF2A 4B3XA 2Z2SB 2LK2A 1OCCH 3ZR8X 3SQNA 1DUXC 1ZK8A 3FXMA 4ENMA 1ETKA 1XD7A 3OYBA 5J8CA 3AAFA 4HPQA 1JKOC 2V6EA 2A68F 1FP1D 3RPQA 3QRFF 1OYWA 3RCOA 4LITA 1VF9A 4NHJA 3TQNA 2MYSA 3AKZA 3L2UA 5E1WA 3BR2A 1BL0A 3BY6A 2FNAA 4U0WA 1N77A 3V8JA 2QCOA 2R7TA 3ROUA 1UHWA 3WE2A 3TDUC 3UR3C 1T0FC 2HYFA 3GFJA 3GO5A 2WY7Q 2ZXHA 5DV5A 5EZGA 4A0ZA 1XG1A 1ZAOA 1YJWI 1Z3YA 2JK3A 5IOZA 3LSJA 5EG0A 2L7KA 1KYZA 2K9NA 4Q4ZF 1JKPC 4XLAA 5F08A 5FGMA 2Y0SA 3DBLB 1XX5A 1KQ0A 2NYXA 2ZMEB 4KIFA 3WGHA 4I7HA 2M0MA 2X6WA 2L9SA 4U0VA 2IEKA 2ZXWH 2OJED 3OSGA 2Y30A 2DMQA 2E2HJ 1J5YA 3BR0A 4D0PA 4AD9A 2E71A 3LA7A 2DAOA 1PUFA 5B5EC 3M8JA 3G6EI 2DO7A 4XNFA 2CW0F 3DLLF 1FBUA 1MNMC 2X48A 1U5TC 3WTXC 3JW4A 3QODA 4ENKA 2VOPA 2L7ZA 5AONA 1G3SA 2D5VA 3U2RA 4MO7A 3H0DA 2EFOA 3QU6A 2LFBA 2LSOA 2KRFA 4G7ZF 2DW4A 4PZJA 3F8FA 3FF5A 4YRVA 3GZNB 4DYCA 1R71A 1P7IA 4C2TA 3FWEA 4B48A 1GV2A 1YE9A 2IW5A 1MH4A 2RV8A 4I01A 1O3QA 1SD5A 5E1XA 1M1EB 1TL8A 3EQLF 5A2QZ 1ZG5A 3OYLA 2M8EA 2XDVA 5HS8A 1S3JA 5LLQA 3KLOA 1FSHA 3TW7A 3FBNB 3KP5A 2P6SA 4LFUA 3P5JA 3B02A 3TOAA 2PEXA 2VQLA 4G94A 4LB5A 2VJ4A 5IT9Z 1ZLJA 3IRRA 4ZZLA 3I55I 1QVUA 2RNJA 2N8GA 1IV8A 3F72A 2JWTA 2KFDA 3WTTC 4PSXA 2AQFA 1QBJA 2M3AA 5CVVA 5ICGA 3J7AY 1YI2I 2M5WA 3FK6A 1DU6A 3BLYA 3E97A 4HNUA 5LHHA 3ISPA 1TT5B 2KHMA 4MFEA 4NQWA 1FBSA 1LDJA 3K4KA 3IHUA 2K3PA 1YHQI 4B3AA 1OR7C 4P9FA 2VB6A 2EV5A 1BN5A 3VFZA 1H9TA 3K9TA 3BG9A 5FKNA 3G73A 3CC4I 2XC7A 5LGTA 3OIQA 5M5YJ 3ZQLA 2HYGD 1ON1A 1XPXA 2HS5A 3TO7A 3PSIA 4H0EA 4UNOA 1VQ7I 5F1RA 3GTGJ 1SAUA 2WY8Q 4KDPA 2X1CA 3PUFA 1BC7C 1IDYA 3N05A 1QA6A 1G3YA 1U9OA 3RSNA 1A6IA 2X4HA 3ZMUA 1FYMA 1UMQA 1CGPA 2VKHA 4E7KA 1B59A 3OY9A 4NC7A 1AU7A 2Q2EA 1WJAA 2KZGA 4UUSA 1V3FA 3JRHA 1DDNA 3HSEA 4PJMA 1S7OA 4M9SA 4MNUA 4ANJA 2ICWG 3HOUJ 2GWRA 2IXSA 4I98B 3GUDA 3CMYA 1VQ8I 2E34A 2LKPA 4S05A 4GYGA 2R5ZA 1T95A 1T33A 3H5AA 2VBXA 4XQFA 3O6BB 4N4OB 3QPSA 5K7FA 1WSUA 4BUPA 3AG2H 1RRJA 1B8IB 1J0RA 4FX4A 2E7WA 3MWMA 1GV5A 4XLFA 3DKWA 4M74A 4O6JA 3K2AA 3T8RA 4CCKA 5KCMA 1V54H 2JA6J 3FIWA 2O7OA 3EYYA 4Z6YA 2ID6A 5LGNA 3HOTA 4XSZF 3CCEI 2GXAA 5IYDJ 3I9V2 2MC3A 3F8BA 4FQGA 3CCJI 1WH5A 2VJ5A 3G3ZA 5DUKA 1LEBA 3ZQQA 2X1DA 1BM9A 3CJNA 3ZN1A 4PJLA 1F43A 4UB8C 2HPMA 3J7YJ 2H8RA 1NK3P 2O03A 2ETHA 5C44J 3WE3A 5J4YA 4M6XA 1Z91A 4EJVA 1HDDC 3N97A 3DV8A 1R49A 2VPLA 4UUVA 2CWEA 3QPLA 3SEZA 2W48A 5M5XJ 2EIJH 2DJIA 1X1PA 3I53A 4OMYA 3GVAA 1AA7A 2FMYA 4KT5C 4EJOA 2R0QC 1RI7A 2C6YA 3C2BA 1DP7P 1VQ5I 1RESA 4A3LJ 2YUSA 1X3ZB 5LGUA 1LVKA 4KICA 4Q48A 4PJNA 3WTVC 1H8AC 2RNGA 3AG3H 3HZJA 2XPUA 4B44A 3SZTA 4WWCA 1NH3A 1WI9A 3F8CA 5L3CA 2DA6A 4BEHA 4CCMA 3QPTA 3CCQI 5CLSA 5J40A 3L7WA 3LSGA 3ZGKA 4IO9F 2VL8A 5JR3A 2DYRH 1O3RA 1ZARA 1FOKA 4HDVA 3GBGA 4AYBN 1DU0A 4WCGA 4RB3C 4OU0A 5EGOA 4DZPA 1SANA 3OOPA 3LMMA 4YFXF 2CFOA 2F2EA 1VQPI 2VQHA 3HKZN 2HVRA 3HUGB 1MH3A 2VT3A 2DMNA 5E3MA 2L54A 3JSOA 2EZHA 4GGGA 1XSXA 4HAMA 1W5TA 3HRMA 5HS7A 2LF7A 2DXIA 2V6CA 3HPGA 2WBMA 2XAQA 5FLXK 3O8HA 3VB2A 1Z3XA 2D1HA 4QLCU 5L3FA 2JA5J 5BOXA 1OCPA 2CW8A 1YS6A 5E20A 3HOZJ 1W5SA 2HDDA 4U0YA 1VNDA 4FASD 1TWHJ 4HEA2 4HF1A 2VXZA 4MQVA 5FRMA 3A0BC 1Z6RA 4MFDA 1STZA 3I59B 2A69F 2LY9A 2Z1DA 2XAGA 2EILH 3COAC 4IHSA 4PGGA 3ELKA 3EUKL 4RB0A 2ME6A 4MGRA 4RGXA 4L0YB 2GXGA 4NNJA 2OV7A 1JKRC 2R7RA 3KZIC 1LFPA 3LQQA 4M3EA 1L3LA 3K4NA 1X58A 4ESBA 1G8XA 2F6CA 4A3CJ 3FXOA 3PQJA 2HQAA 2BVMA 2Q0OA 5IP7J 4X0GA 2WA0A 3IWFA 1ZQ3P 5D8KB 2LREA 2ESNA 3CF5F 1TT0A 1ZREA 1HKQA 1U9NA 3F22A 2QSHX 1EJ9A 3HGYA 4A69C 2F48A 4ITVA 1IO2A 4L0ZB 2EIKH 2CUEA 3L2RA 1KU3A 3HSRA 2DFEA 2ESHA 5IP9J 2LMDA 4IOCF 2QSFX 1IRFA 4Q5SF 1VQOI 2F5FA 1QPIA 3K0LA 5J1YA 3F6OA 1GXPA 4PJ0C 3J81K 1D1BA 4I99C 4M3BA 1MBGA 2CQXA 1OPCA 1JHFA 1FIAA 2DCEA 1FY7A 1P6RA 5B3SH 2O6GE 5F64A 3CCSI 4MTEA 3FX3A 1CF7A 2FF4A 3B6CA 4KISA 3QOPA 5FJ8J 2FU4A 5DDGA 4E6KG 3WODF 2YX7A 1AKHA 1YX5A 1BBYA 1XMAA 2UZKA 3H35A 5LHGA 2DFIA 3QQAA 2YR2A 5FFXA 1UZCA 1U2WA 5CKTA 3W2WA 3HXLA 4XR6A 4MLOA 1PP7U 3D5SC 4CH7A 3EUHA 1Y0NA 2HFHA 4ASNA 1VQKI 2HZTA 1FP2A 1Z1DA 1XCBA 3I4PA 5JVTA 2H6CA 2M30A 4CCNA 4U7BA 1XMXA 1HF0A 1UFMA 1TWFJ 5J1UA 2XKPA 3GTOJ 3K4BA 1IV6A 2BXYA 2OD5A 5KNLA 2MH9A 1B72A 5E3NA 3D5RC 1SFXA 3IC7A 2JVGA 2B0LA 4L9NA 2M9HA 1QZEA 1BI2A 4YFKF 2NVTJ 1JTYA 1QO0D 3BG7A 2M7BA 3JRIA 3JR9A 2PJPA 2QQAA 2ZC2A 2Q1ZB 3HRTA 2ZMEC 4E7SA 3CUQA 3LSPA 2WWYA 4DOZA 4L5EA 3SFZA 1D3YA 2GZWA 2XF6A 2KIFA 2W25A 4Y52J 5GP9A 3O8GA 3Q3SA 2KQRA 2PFBA 2JUCA 3EDPA 2LLKA 2HTJA 2CQKA 1YTYA 1WGXA 3ABKH 3JRFA 1I50J 1MMGA 1TW3A 4PFOA 3HL2A 1HSTA 1VQLI 1UG0A 2VC1A 3JCUC 3V7CA 4J19A 1SVOA 2KDOA 2LBFB 5TGTA 1Y0UA 5LFAA 1SEUA 4XOPA 1PUEE 1MBEA 1S5LC 2HVSA 1GVDA 3TP3A 4N9HA 1FYLA 5HLHA 3F23A 3BT9A 4B4CA 3OYIA 2IA0A 5F1JA 3OR2C 4EMSA 5D6EA 1OFCX 2LH9A 3CZ6A 3Q0WA 3GTLJ 4D9JA 1E3OC 1G4DA 1BR2A 2B7EA 1O57A 4S0HB 2EWNA 4QWQA 4ESFA 4E7IA 1P9QC 5LD2C 3ABTA 3NARA 1IN8A 1ZKGA 3LA2A 2R7VA 3LSKA 4QTRA 2LR8A 3FXLA 4GCVA 3F0CA 2YSRA 3BR5A 1R1TA 3CMMA 4E7HA 5HNFA 5HLIA 5KVRA 2WAQN 4CYCA 3V8LA 4XLPF 3SYTA 2O9LA 2EPFA 2O8XA 2K9LA 2M4GA 5D5UB 2EZLA 1IRXA 5C4XJ 1VI0A 1QGPA 3K10A 2XIGA 4D7NA 3L2VA 4A5MA 3DKYA 1ZRDA 1J2XA 3G1MA 4R8HA 4BDYA 4QIWN 5EDNA 1SVMA 3KLNA 2VBZA 3S2DJ 4A93J 5D8LB 4BHBA 4FT8A 3SFIA 4I0AA 2COMA 3ZMSA 4C2MJ 3K4CA 3G71I 1FIPA 2GIVA 3RI4A 2JVHA 2K27A 1WCMJ 1RUNA 1YQAA 2TDXA 4M3GA 2E1OA 5D6FA 2WAFA 5E3OA 2NS0A 2FBKA 2QBYA 3HOWJ 1I5ZA 4BNCA 1QU3A 3HRSA 3BJOA 1XS9A 3S3OA 4DJAA 2LYCA 2NNYA 3CMEI 2DOEA 2OZ6A 4RAZA 4JP0A 2XAUA 5DYMA 4L9JA 2BHYA 1RIOH 2KJBA 4WK8F 1JHHA 5FB2A 1YRNB 1REPC 3OR1C 4A3FJ 1Q1VA 1MMNA 2BGCA 2O61A 1YG2A 2VC0A 3Q5FA 3K7AJ 4NUBA 4JK1X 1ZELA 2EFNA 2GM4A 2DODA 3M07A 4YEJA 2L02A 4MTDA 4PUSA 3GF2A 3E5UA 1W7PB 4M3FA 3BR1A 2GXBA 3ZMVA 1YW8A 3Q9VA 4HLYA 2FBHA 1X19A 2LY2A 4RB2C 3UNGC 3BQYA 1HSJA 4M73A 2VUMJ 3KEYA 3LOCA 1DPUA 5F6FA 2P5LC 6PAXA 2PMZN 1BW6A 3LSMA 4DGWB 2VLAA 2DT5A 2OZUA 3BC8A 2W1OA 1P4AA 1G6NA 3L09A 3RKQA 3BG5A 2ID3A 4AIDA 3BOQA 3HOXJ 1XSDA 2OA4A 4UUTA 2CQ7A 3E6MA 3ASOH 1WHUA 2IRFG 5D5WB 3K70C 2V1UA 2IS1A 1RKWA 2WB1N 4IJAA 1JE8A 1ZGWA 1K83J 1ETYA 1YYVA 2DMTA 3KIOA 1U3EM 3FK7A 4GO1A 1QHGA 3BJAA 2XGEA 3S15J 4UY8I 2DI3A 4LK0F 3ML6A 1XGOA 3ZN0A 2NS7A 3PUBA 2XAJA 3HGGA 5ICEA 2P4WA 4U88A 1TQIA 4HG2A 1I6HJ 3ESWB 1HDPA 1MDMA 2COBA 1JT0A 1K78B 4F52A 3TO9A 2EZIA 1HOMA 2E1CA 3K4LA 2QYOA 2HQRA 4EJWA 2XPVA 4HQEA 2HXOA 1G2HA 3BTLA 4IHYA 2WTEA 4IZZA 2KISA 2PX9A 4Y4RA 2XPWA 2LF8A 5L3GA 2K40A 3V4GA 4U87A 1E3PA 4JBAA 1ETWA 2YPRA 4IVNA 5TISC 4ZTFA 1MD0A 3GFIA 3RKWA 5C4JJ 1K4TA 1UHSA 1FX7A 2NRAC 3J80Z 2LG4A 1DGRM 2DTZA 5DTDA 1QVTA 2CUJA 3SXYA 1IDZA 1P7JA 2EH3A 3PFIA 3H5RA 3ECHA 1ZRFA 4II3A 2K86A 2UUZA 5E17F 2AXLA 2HDCA 4BJ5C 1IN4A 3CESA 3J81Z 2R92J 2ZFWA 3ULQB 5FKOA 3DU6A 2UWMA 2DA7A 3CCRI 2EINH 3D5LA 3FZVA 2DBBA 1WFXA 5FKKA 1LDDA 3FBIB 1FOWA 5J47A 1LJ9A 1YOVB 2G7HA 3DBRB 1HXDA 2ZSIB 4IHXA 1LFBA 2DQRA 5ED4A 1RR8C 3MEXA 3ZMZA 1W0UA 2Z5UA 4A0XA 1D1AA 4HX4A 3R0JA 3TBIA 1ZG3A 2LKXA 3I56I 3VYRB 2ELKA 5JI6A 3FKJA 3DP7A 3PIPF 2OTJI 2IP2A 2K4BA 4KIGA 1SFOJ 2ECBA 4J01A 4P5OA 1HQCA 2EFWA 3C1DA 2HYJA 3PL8A 3MN2A 2XAHA 5D5XB 3GLLA 4BY7J 3Q0UA 1OCZH 4BXUA 1ZN2A 2ZJPF 3CJRB 1K4SA 2M0CA 3K69A 3R4KA 3GX4X 2P5KA 4RB1A 3TEDA 3HDDA 3TDZC 3T0YA 3UKGA 1FT9A 3O2PE 4P96A 4YIRX 5F04A 2VXDA 3VEPA 3CCLI 1GHCA 4ZYAA 4B47A 4CZZA 1UCRA 2EB7A 3SZPA 3KETA 2KZVA 5GPAA 5LBQA 2CV0A 2VBYA 4MEXF 1R36A 1LVAA 3CLOA 4LB6B 3RPUD 1XDSA 2UV1A 1LNWA 2IA2A 3BR3A 1MZBA 2Z16A 3K70D 1ZTRA 2E5NA 3KP4A 5EG0B 3TOBA 5IP6A 4ZH4F 3CO6C 3H9JA 4RGUA 3TO6A 1PDNC 1OYYA 4HZFA 2M2EA 1IN6A 2DA1A 4ENNA 1IGNA 2KIQA 4K2EA 1TZLA 4HW0A 4HX8A 4XMYA 4GDFA 2JSPA 1U0JA 4IOAF 5HLTA 1XDUA 2IS4A 3QP6A 5CJ9A 3AG4H 1BI1A 2DOAA 2WC2A 4B8XA 3JAMK 2ZO4A 5EF6A 3H5NA 3C3WA 4JX6A 5BQTA 2V1XA 2CJJA 3BCBA 3LFUA 5JFRA 2IPQX 2E2JJ 1BA5A 1DQUA 3PNTA 4WX9A 5J3LA 4X6AJ 1QPMA 1TNTA 2IA1A 3K1PA 5EEHA 3KEQA 4RLQA 1SC7A 5CYVA 2F5CA 1IUYA 2MGQA 2A3SA 2X1EA 4A5NA 3DTEA 4FX0A 2K4JA 4KT6A 5K7ZA 2QKLB 3ZQFA 1N75A 4QPOA 1E3HA 1B8IA 4XONA 2CSOA 4E7JA 1JXSA 2QVOA 5FRNA 5JHFA 1WJFA 2DJNA 3VWBA 2W00A 5E8GA 3MKYB 2DPUA 1EH7A 2L9RA 2ZNZA 1I1SA 4ZTJA 3RPUA 2XGDA 1W1WE 2PI0A 3HOVJ 4DIQA 1SD7A 4AWXB 2HNHA 2R7SA 1BI0A 2VASA 3WU2C 4ZJZA 1A35A 1USSA 3VYTB 3BZCA 3U21A 2AHQA 3BTCA 3CCUI 1G3WA 4KA4A 1LB2A 3PJRA 5JLXA 3ZQHA 2NS8A 2JJ7A 4FE7A 4D5CA 1Z21A 1EH8A 5GTHC 4LG3A 4V2GA 3JTGA 1R9TJ 3CCMI 4IHWA 4IX7A 4OWRB 2V9PA 5BNGA 4BH9A 4LG0B 5DS9A 2L3DA 1IF1A 4CHUA 3G2BA 1APLC 2HOSA 1SVLA 4CICA 2R3SA 2OPTA 1MMAA 2P6TA 2KP6A 3GTMJ 4WXCA 2K9SA 2CUFA 2XGXA 3KYLA 4OIPF 5ERIA 3WU0A 1VQ4I 3REOA 2NVYJ 3L9FA 3LL7A 4IHVA 4EM0B 3ERED 2RDPA 4UUSB 2E1NA 2FQ3A 1K61A 1FZPB 3OL3A 2W4SA 4AYBA 2A5YB 5M3FJ 1J7KA 1UJ8A 1MBFA 4XKVA 2HXIA 1OISA 1G3TA 1FPQA 1MMDA 3OL4A 5FROA 2ZXIA 2PBIA 2CQQA 5DD4A 1K6OA 2MG4A 2R4GA 1B9MA 3PSFA 2DQLA 2CMPA 3HKZA 3SEQA 2XSDC 3LAPA 3KP6A 3ZRGA 2K85A 4BU2A 4RGRA 1T0FA 1OCOH 2IJLA 4ZYHA 1UAAA 3G1OA 1ZG1A 3U1KA 4XKCA 3PIOF 1O3TA 2P0WA 2M7AA 3V8KA 3FHNA 2I5UA 5BMZA 2YX4A 4R1HA 1HLVA 4HQMA 3I3LA 5EJCA 3ZMDA 3IP4B 2TRTA 1X4PA 3OYNA 3CLQA 3EUAA 1ZGJA 1WJEA 2G9WA 2OCEA 1E17A 1P92A 5EEAA 2D2WA 5L3DA 4A6DA 3RIRA 2A5WA 3CUOA 2IGMA 2A61A 3A03A 2EV0A 4BHCA 2HI3A 4KFCA 4A3BJ 4ZZDA 3ABMH 1N25A 4MQ9F 2DA2A 5H20A 4GFBA 2JA7J 5L3EA 3IUOA 3I59A 1PP8F 3HRUA 3E3VA 3Q9SA 2DMUA 2NVQJ 2XF5A 3MKWB 1D5YA 3KP7A 1U5TA 4LLNA 4XKWA 2EBIA 4XN3A 3LFKA 4CCLA 2F4IA 1DPRA 1R00A 1EV7A 4B1RA 2B9SA 3PO2J 1HC8A 3S3MA 4RAFA 4IRGA 2KIUA 1N78A 2KMUA 2LD5A 3HOSA 1Y6IA 5LRSA 3HYIA 3L2QA 3VDXA 4BBRJ 5DM7F 3S17J 4X1EA 3OV8A 1XB4A 1RUOA 2FOWA 2W7NA 1YFHA 2DLLA 3DEWA 2L4MA 1FMVA 1QQIA 3FXRA 5FKMA 4PK4A 1S8NA 2UXNA 4BEHB 5DCFA 2XGCA 2JT1A 3I64A 4YIIA 2XF7A 2DFHA 3FISA 2DA4A 1D8JA 4JQFA 5F0FA 3RKYA 1O7FA 3LSIA 4C3IJ 3BP8A 4AIKA 1WZ2A 5IYBJ 2HOTA 1ENHA 3H0GJ 5EGOB 5KAFC 4XLEA 2STWA 3FKIJ 2DA3A 2JPBA 1MW7A 3BTJA 1MJBA 1R5ID 4C2UA 3WHCA 5LHIA 1TLHB 2GA2A 3CO7C 9ANTA 1Z6TA 5LRRA 1ZH5A 1X1DA 4BACA 3OYJA 4U7DA 2LY1A 1XTAA 3H3VK 1FEXA 1BR4A 1U8BA 1JJ8C 2BZTA 2E2IJ 5ILVA 5F0CA 2H6BA 4DZJA 5E79C 5LEKA 4A2UA 2JRMA 4HBLA 3ABUA 4XICA 2FXAA 1NHAA 3IRQA 3JREA 3FXKA 1OR7A 4BQOA 1ZR2A 5HNHA 5KAIC 2JPCA 3F8MA 1JJ6C 4OIOF 4HDUA 2DDBA 1KONA 4L5JA 5H2FC 5M3MJ 2ZNYA 1RNLA 3OYGA 4P9UA 4G8XA 1JGSA 3HHGA 3GYHX 3VSKA 2QM3A 4LK1F 4A0YA 5GAHJ 4YELA 2W57A 2DK5A 2HGCA 4J00A 2FQ4A 2BHZA 4HV6A 4RBOA 2RKHA 1P4XA 3GFLA 1F36A 4G6TB 1XCVA 5KHDA 1AWCA 5FD6A 1JUMA 2R7WA 1XN7A 2L5QA 4R79A 2KIMA 2QQ8A 5B66C 3B73A 3DF8A 3HIFA 1FJLA 4AU7A 3MZ8A 4C30A 5EZHA 4DYRA 3BROA 2AQEA 4Z2YA 3S3NA 2RQPA 5EYRA 3PO3J 1USTA 5HDKA 2W84A 1Z7LA 1T39A 2R7ZJ 2YU3A 3WTWC 2IT0A 2RGVA 1R1UA 5K5RA 3DFGA 1ZRCA 2P7VB 2LDUA 4E70A 2HOEA 2FA5A 2E1MC 4ENJA 1YO5C 4AM3A 1B6AA 2DN0A 2E19A 2O5RA 3MKZA 1EF4A 2ZB9A 3MD2A 3MZYA 3OIOA 1T56A 1ULYA 4ZYDA 1XGNA 3I5UA 4KMUX 1O4XA 3KYDB 1V5GA 5BS6A 5HDGA 1WJBA 3X2QH 5CVRA 4A3EJ 1FBQA 1Y1WJ 1VQ6I 5B1BH 4EATA 2H27A 3QU3A 5K5QA 4IRHA 2FNPA 4KNYA 1AKHB 3F9KA 2KJCA 3DCFA 1JTXA 2KDZA 1VFCA 1I27A 4WF2A 1MBKA 5HLGA 3HB9A 3KX2A 3QP5A 3V7RA 2STTA 1G59A 2H09A 2G0EA 5GAEJ 2ME0A 4WXHA 3KP3A 1GXQA 1R58A 4B09A 2V26A 5JLWA 1WWXA 3D0SA 1LE8B 5J4VA 3IV5A 2BYVE 4G7HF 3HC7A 1IAWA 3GW2A 3WTYC 3HEFA 4F91B 4AVPA 4WXDA 1ITYA 3R0AA 1X1CA 4BXFA 1ETVA 1FMWA 1O7LA 1Y56A 1ON2A 2BY2A 1SFKA 5GAGJ 4AIJA 3ZXSA 4FE4A 5E18F 1ETQA 5CVUA 2JSCA 2QWWA 3W2VA 5IY5H 3LAJA 2DPDA 2QF7A 5IT9K 3CUQB 1V5FA 2V1DA 4V2FA 5FLMJ 2K5CA 3V7SA 4G6QA 2HTSA 5L3BA 3OSFA 2NAZA 4XRSG 4BE1A 2MC4A 4XRFA 4M9XA 4UVBA 1W36C 2BY1A 1VQ9I 4O3MA 1JI8A 1E2XA 4I76A 1YIJI 1I3QJ 2M8GX 2M87A 2MLGA 1Q1HA 3F8NA 4N9IA 3L1PA 1QZYA 3M8EA 3ZQIA 1H9GA 3QAHA 4LGWA 4M72A 2QGUA 3T5XA 3S16J 2KT0A 3A4CA 3PQKA 2PMZA 1D0YA 2RC4A 3C2GA 3BCAA 1MMSA 4L5IA 3QYEA 4HX7A 1T8IA 3M3YJ 3DQVC 1WKMA 4TV7A 5H6QA 1CQTA 2VI6A 3PNYA 1VQNI 3D1NI 5D4RA 2W85A 1WJ5A 1FYKA 1ACIA 2FSWA 2K3FA 4JX5A 4Y17A 1KZHA 3BJ6A 3T8TA 3BTIA 4BQAA 4OMZA 3SDBA 1OMIA 1R22A 3FM3A 3KPHA 2JUGA 1J9IA 2HPIA 3K1NA 2JZYA 5E1ZB 3Q0VA 2R5YB 4ON0A 2Z3YA 4A3IJ 5AIQA 2V79A 1T38A 3R61A 1LDKB 4E4HA 4JYKA 2GBYA 3A01A 3PNVA 2Z9OA 4HOBA 2BW3B 1K7AA 3GMEA 1PJRA 3KYCB 2XHKA 1SFEA 4PCQA 4EVIA 3F6VA 1GT0C 3BQZA 1XGMA 3ZP5A 2CU7A 1MIJA 2QA4I 3CJTB 4XORA 2VN2A 3VPRA 4ZC3A 2QBYB 1SAXA 3W2AA 1BOAA 2MW8A 4Q47A 4BHPA 1SMTA 3ASNH 2DFFA 1T6SA 1U8RA 4I2OA 2A07F 1XC5A 2PJRB 1Y1VJ 4BJ6C 4M9ZA 5FLXZ 1MSFC 3CDHA 2JA8J 2CUZA 5H6RA 2LNBA 3GFMA 1KQ8A 3TMOA 2IBDA 1A31A 1R23A 3DKXA 4PJJA 2IGKA 2FE3A 2NNNA 1FLIA 4FISA 3AG1H 3TKYA 1TW2A 3RDIA 2VODA 3O3KA 4IXAA 3MVPA 1BI3A 2NOGA 1I6XA 1BW5A 2R7XA 3RKXA 1A5JA 4A12A 4XRMA 3ZPLA 2CQNA 4FCYA 3FDYA 4A6EA 4ETSA 5D5VB 3CC2I 4IHTA 1KQ9A 4UXNA 2VQCA 1R4NB 3P9KA 3SHFA 1Z05A 4YFNF 4BDZA 3KZZA 3WG9A 3DEEA 2Y9ZA 2RQQA 2VJIA 4LLGF 1BIBA 1WI3A 2XB5A 3B6AA 2YU9J 1Z7UA 2HKXA 3CP8A 4M3DA 1ZLKA 1MBHA 4CGZA 3HPHA 4ZDOA 2LKSA 1RC9A 1K79A 2BEOA 2ZMEA 4LJZF 4RDUA 1B1BA 4L18B 1Z0XA 3HTSB 4DW6A 5DCMB 3KZYA 2P7CB 4XK4A 1FOXA 2L0KA 1U78A 1F1ZA 4IL6C 1R4MB 2F5EA 3L2WA 1ERDA 2DT7B 1MKMA 4HLXA 4M6VA 4CCJA 4ABZA 2EJRA 2GOMA 5ILSA 3QYBA 1KU2A 4I02A 2L7FP 5FLVA 2XASA 3E6CC 3QOEA 2E1MB 4RGSA 1RR7A 1MDMB 2KRCA 3MFKA 2VKEA 2VOOA 3RZOJ 3AFHA 1X2NA 4HA8A 3E6BA 4YIFA 1WJCA 1NK2P 4UV8A 3GCMA 2BE5F 2EIMH 2R7QA 2WV0A 3S93A 3ZQ7A 3R60A 4XSXF 1IJWC 2Q8KA 2BY3A 3E5QA 2XVCA 1A6QA 3P9IA 1KU7A 2NVXJ 2XV4S 1YW9A 3WGIA 2GIZA 3K6GA 1WVRA 3ZCOA 3NWTA 1TNSA 1OQYA 1S7EA 3NEUA 2IAIA 4RAYA 2AXTC 2Y69H 2E7XA 3G4SI 2X6OA 2L9NA 2VONA 1MSEC 3S14J 3CCVI 1L0OC 4A3KJ 4HRIA 4NBQA 1OLTA 1VTNC 3JRGA 2KL4A 1U6GA 2LOOA 2HU9A 2ACJA 1EKEA 3EPZA 1LFUP 2Y2ZA 1LUJB 2L2OA 3A2KA 3IAS2 2V1NA 3L00A 3OS2A 1IW7F 1ZHFA 3E6DA 3S2HJ 1QHHD 1S7AA 2R7FA 4B43A 3GTKJ 4I09A 2VBWA 4XLHA 5GTIC 1NTCA 1X1BA 1DP3A 1HKSA 2A6TA 3S1QJ 3H3UA 1X3UA 3MAJA 1YJ9I 2XB0X 2H8WA 4BL0B 5K1YA 2P8TA 3DTKA 2LVSA 1IRGA 1TWAJ 3WTZA 1YLFA 3TGNA 1WRJA 2V9VA 5M5WJ 3GZ5A 3IAM2 5JHUA 2HOAA 5D4SA 2ZJQF 2G7UA 2Y0SN 2XSJC 4Y3OA 3GTQJ 1TWCJ 3C7JA 4D1QA 1PUFB 2M34A 4EQQA 5DUIA 1J59A 1FC3A 1WH7A 4HSRA 1Z67A 2Z33A 4D5FA 5E3LA 3HTUA 1HA8A 1KU9A 3CCYA 2Y48A 5FFZA 4PGHA 2ECCA 2XKOA 5K5OA 3BWGA 2E60A 2Y31A 2P81A 2R7DA 3F21A 3H92A 2L7MP 4XRSA 4BQQA 1FTZA 2H94A 2PMHA 4RS8A 2EFPA 2NVUB 4LLLA 2GAUA 3VYUB 4Y15A 4LOCA 5HVQC 5BPIA 1Y39A 5ICFA 3IH3A 3W6JB 1SD4A 3FMRA 3IWZA 4UVAA 1ZR4A 4DQ2A 4EJTA 2NOJB 2LP0A 4A3DJ 4LIUA 2DA5A 1UHMA 1EH6A 2O3FA 2RAEA 2TCTA 3A02A 2A6HF 2CG4A 2BVLA 2X6YA 4LG0A 4C3HJ 2BV6A 3LNQA 3RQIA 3NRVA 3MZHA 2QZ8A 4IKFA 2IS2A 4IQJA 4EV0A 3DEUA 4JOMA 3R6SA 4HNTA 2HR3A 1TWGJ 2QQ9A 3BG6A 1JUPA 1YIOA 1D8KA 4NB5A 1R5GA 4F92B 4RM3A 3JRBA 3JRCA 2HDWA 4NQWB 2J5OA 1OCTC 2M1BA 2CV2A 1ETXA 2K9MA 4CXFA 1TBXA 3BPVA 3OYHA 2VPRA 4BQNA 3HBLA 2FX0A 1MGTA 1TC3C 2QUFA 1BC8C 4KIBA 1FOYA 3RTRA 2H1KA 2GQQA 4BS9A 1X2MA 3EUHC 2B63J 3OWTA 4UV9A 1P2FA 3HHHA 2JQ7A 2OQGA 1TP4A 2X85A 4EM2A 3VOEA 2RREA 3FXJA 1IRZA 3S8PA 3HJEA 3MKLA 1MNEA 3CMAI 1KYWA 1UELB 2EA4A 2QENA 1YITI 3BPXA 3LWFA 3CDLA 2QKMB 2DYSH 4MHGA 3S32A 3C18A 4D7MA 3TL4X 2Q2EB 2X9DA 4BXXJ 5CQEA 2VKDA 3OMYA 5HS9A 2CH0A 3GLXA 2CYYA 3WG7H 4N4NB 1XMKA 3HOYJ 2OU2A 3CUQC 2D45A 1RETA 4Y33A 3IKTA 2R5ZB 4L9TA 2KKOA 3OYFA 4W1UA 1I39A 2MLKA 2OC6A 2I8DA 2CGPA 4Y7NJ 1W4MA 3S1RJ 1D0XA 4EM1A 2I10A 2Y0MA 4A3GJ 1KA8A 3AL0B 1IXCA 3GEZA 2V9KA 1ORKA 3K4MA 5HDNA 1OJLA 4XIDA 1UB9A 1Z9CA 2OTLI 1ZGAA 1TQMA 1IZ1A 4QSHA 2BXZA 5J6XA 3HUGA 3QYFA 1HW5A 1POGA 4UVCA 2CO5A 4AVZA 2H1LA 1JKQC 2R7OA 1C0WA 1D0ZA 2A6EF 2JMWA 2CS3A 2DMPA 1ONVA 2YS9A 2PG4A 2X6XA 1AHDP 4XL9A 4EJUA 1DGWY 2XRNA 2V7FA 3OYEA 3NAUA 1HKTA 2XUBA 5LEJA 4CCOA 2FD5A 1BJZA 3GTJJ 2OQRA 1WPKA 4RAGA 4HSTA 1SMYF 3W3CA 2IGOA 3H3ZA 1RPWA 3VODA 2QSGX 2MBFA 3ZMTA 1JGGA 3H9GA 2DOFA 4KN7X 4IEJA 4I0BA 2DU9A 3CD6I 2X0LA 3HG9A 1MNDA 3KE2A 1PVEA 4PFPA 1D5VA 1TQPA 3IKVA 4F3QA 3DLAA 1B9NA 4FTHA 2HQ5A 3JRAA 5K7HA 3DWLE 4EGZA 4KITB 3W6VA 2FEZA 5TRDA 2FRHA 3SDGA 2ZKZA 4LD5A
chains in the Genus database with same CATH topology
3IV5A 1HOMA 1W0TA 2XPVA 2HXOA 4B3AA 3BTLA 3HEFA 4IHYA 1G2HA 3RZDJ 4HNVA 1ITYA 3BG9A 5FKNA 2XPWA 1ETVA 2K40A 2R93J 5M5YJ 3LSRA 3ZQLA 1UG2A 1ETWA 4FE4A 1ETQA 3GTGJ 2QF7A 1IDYA 5C4JJ 1U9OA 1UHSA 1A6IA 2DTZA 4G12A 4V2FA 1UMQA 5DTDA 5FLMJ 1QVTA 1IDZA 1P7JA 2EH3A 3OSFA 1AU7A 4UUSA 4XRSG 3JRHA 2R92J 5FKOA 3HOUJ 2DA7A 3CMYA 1ETOA 2R5ZA 5FKKA 1T33A 4I76A 1RKTA 1I3QJ 2M8GX 3QPSA 5K7FA 1B8IB 3L1PA 3ZQIA 4IHXA 1LFBA 1GV5A 3S16J 2KT0A 1W0UA 3E7LA 3K2AA 4MIMA 2LTPA 2JA6J 3FIWA 2LKXA 1MBJA 2O7OA 1H88C 2ELKA 2ID6A 3WHBA 4AUXA 5HODA 3M3YJ 4W97A 1CQTA 3CQZJ 5IYDJ 2VI6A 1SFOJ 2ECBA 3D1NI 3ZOBA 3GTPJ 4JX5A 2HYJA 3MN2A 3TW6A 3BTIA 4BY7J 1WH5A 3Q0UA 2M0CA 3TEDA 3HDDA 1F43A 3UKGA 3Q0VA 3JRDA 4NDLA 2R5YB 1GDTA 4A3IJ 5F04A 2H8RA 1NK3P 2K9QA 5C44J 4JYKA 2GBYA 3A01A 5GPAA 3OOUA 1HDDC 3HM5A 3QPLA 2W48A 5M5XJ 1GT0C 2MSYA 3BQZA 2CU7A 3BR3A 2R0QC 3I4MJ 3VPRA 1ZTRA 5GPCA 5EG0B 2EQRA 3C2BA 5IP6A 1RESA 2MW8A 2YUSA 4A3LJ 3ZQCA 1H8AC 3BG3A 1LE8A 2XPUA 2M2EA 2DA1A 1XC5A 3IH2A 1Y1VJ 5F27A 1IGNA 1MSFC 4BY1J 2JA8J 2DA6A 1FTTA 4JX4A 2IBDA 3LSGA 5IOYA 5EF6A 4FISA 3GBGA 4JX6A 4AYBN 1DU0A 2CJJA 2E2JJ 5EGOA 4DZPA 1SANA 4DYQA 1BA5A 3MVPA 2NOGA 4X6AJ 5J3LA 1HCRA 1BW5A 5C3EJ 2EZKA 5F0HA 1A5JA 3HKZN 4XRMA 1MH3A 2OF7A 4FCYA 2DMNA 2MGQA 5E3MA 3BR6A 2EZHA 3S1NJ 1B72B 1JT6A 3O8HA 5K7ZA 3ZQFA 2JA5J 1OCPA 2Y9ZA 5IPAA 1WI3A 3HOZJ 1JUSA 2XB5A 3B6AA 2HDDA 2YU9J 1VNDA 1B8IA 1TWHJ 2VKVA 4M3DA 1MBHA 2WV1A 4MFDA 2LY9A 2DJNA 2ME6A 2L9RA 1JKRC 4A3JJ 4RDUA 1Z0XA 2XGDA 4DW6A 3IH4A 3HOVJ 4M3EA 2JN6A 4XK4A 2L0KA 1U78A 1X58A 4A3CJ 4M6VA 4BKXA 4ABZA 1IG7A 2AHQA 3BTCA 5IP7J 1YRNA 5JLXA 3ZQHA 2NS8A 2JJ7A 2L7FP 4FE7A 4D5CA 1ZQ3P 5FLVA 4V2GA 1R9TJ 1RR7A 1U9NA 2VKEA 3RZOJ 4IHWA 3HGYA 1X2NA 1QRYA 4A69C 1NK2P 2R5YA 2CUEA 1IUFA 1IJWC 5IP9J 2O8KA 2GLOA 5FKLA 5BNGA 2CRGA 5DS9A 1QPIA 2NVXJ 5J1YA 1IC8A 1APLC 2HOSA 2OPTA 4M3BA 4CYCB 1MBGA 2CQXA 4I6ZA 1S7EA 3GTMJ 2K9SA 2IAIA 1FIAA 2CUFA 2X6OA 1MSEC 3S14J 3ZQGA 4A3KJ 3S1MJ 2NVYJ 4IHVA 3JRGA 4UUSB 1K61A 3B6CA 5FJ8J 5M3FJ 1MBFA 2HXIA 1LFUP 2CQQA 2Y2ZA 1AKHA 2MG4A 1GUUA 2XSDC 3QQAA 3S2HJ 3GTKJ 4MLOA 1NTCA 3G1LA 3G1OA 3S1QJ 1H89C 5IYCJ 2XB0X 2LVSA 1HF0A 1HLVA 1TWAJ 1TWFJ 5J1UA 3GTOJ 1IV6A 5M5WJ 2TRTA 2HOAA 5E3NA 4A3MJ 1B72A 3PM1A 4EEFG 2M9HA 2Y0SN 5EEAA 2NVTJ 1JTYA 3GTQJ 1TWCJ 3JRIA 3JR9A 1PUFB 2M34A 3A03A 4A3BJ 2HI3A 3M4OJ 3LSPA 4GFBA 2JA7J 4L5EA 2DA2A 1WH7A 2AO9A 4D5FA 2FJ1A 5E3LA 4Y52J 5GP9A 3O8GA 2NVQJ 2DMUA 3CCYA 3Q3SA 1Z77A 2ECCA 4AC0A 5J1RA 3I4NJ 1D5YA 3A01B 2LLKA 2Y31A 2P81A 1WGXA 2EBIA 1I50J 3JRFA 2L7MP 3PO2J 4B1RA 4XRSA 2Y9YA 1FTZA 4J19A 4BBSJ 2LD5A 2XRLA 1MBEA 3TP0A 4BBRJ 4LOCA 1GVDA 3TP3A 3S17J 4X1EA 3BT9A 3IH3A 4B4CA 5F1JA 1ZR4A 1OFCX 3DEWA 3Q0WA 2LP0A 4A3DJ 3GTLJ 5FKMA 1E3OC 2DA5A 2RAEA 2TCTA 3A02A 4S0HB 4C3JJ 4C3HJ 3LNQA 3NARA 3RQIA 2XGCA 3SJMA 1ZKGA 3FISA 2DA4A 2LK2A 4QTRA 2LR8A 5F0FA 3F0CA 3BR5A 4C3IJ 1ZK8A 1ETKA 5IYBJ 2HOTA 1ENHA 2WAQN 4CYCA 3H0GJ 5EGOB 1JKOC 2O9LA 1TWGJ 3FKIJ 1JUPA 2DA3A 3BTJA 3JRCA 3JRBA 1OCTC 3WHCA 2EZLA 1VF9A 5C4XJ 9ANTA 1VI0A 1ETXA 4D7NA 3H3VK 1FEXA 3BR2A 3G1MA 1U8BA 1BL0A 2VPRA 1JJ8C 3HBLA 2FX0A 2E2IJ 1TC3C 4QIWN 5F0CA 4DZJA 2QCOA 5EDNA 3S2DJ 4A93J 2H1KA 4XICA 3SFIA 2B63J 1X2MA 4C2MJ 1FIPA 5EZGA 3JREA 1XG1A 1WCMJ 1ZR2A 2JK3A 4M3GA 2E1OA 5IOZA 1JJ6C 3LSJA 1IRZA 3MKLA 5M3MJ 5E3OA 5EG0A 3HOWJ 2K9NA 3CDLA 1JKPC 5F08A 4D7MA 1XS9A 2X9DA 4BXXJ 2IEKA 3OSGA 2Y30A 3HOYJ 2DMQA 4JP0A 2FQ4A 2E2HJ 4RBOA 1RETA 2R5ZB 1F36A 3BR0A 1YRNB 4W1UA 1JUMA 4A3FJ 1Q1VA 1PUFA 1FJLA 4Y7NJ 3S1RJ 5EZHA 1MNMC 3K7AJ 2X48A 2I10A 4A3GJ 4DYRA 2GM4A 2L7ZA 1ORKA 5EYRA 4XIDA 1OJLA 3PO3J 4M3FA 2D5VA 4QSHA 2R7ZJ 4MO7A 3BR1A 2LFBA 1POGA 3BQYA 1JKQC 2VUMJ 2JMWA 3LOCA 2DMPA 2PMZN 1BW6A 2YS9A 1P7IA 2DN0A 4DYCA 2E19A 1AHDP 1EF4A 1GV2A 2ZB9A 3NAUA 1T56A 3OIOA 1MH4A 2FD5A 1BJZA 3GTJJ 1O4XA 3RKQA 1WPKA 3BG5A 2ID3A 3HOXJ 4UUTA 4A3EJ 1Y1WJ 1RPWA 3TW7A 1RKWA 2WB1N 1ZGWA 1K83J 1ETYA 2DMTA 1JGGA 3FK7A 4IEJA 1AKHB 2XGEA 3DCFA 1JTXA 2KDZA 1QVUA 1VFCA 3S15J 1MBKA 2N8GA 2NS7A 3HB9A 2JWTA 3HGGA 4FTHA 2HQ5A 3JRAA 5K7HA 2G0EA 3FK6A 1DU6A 1I6HJ 3W6VA 1HDPA 2ME0A 2COBA 3SDGA 1JT0A 4MFEA 2EZIA 5JLWA 1LE8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV5 A;  1HOM A;  1W0T A;  2XPV A;  2HXO A;  4B3A A;  3BTL A;  3HEF A;  4IHY A;  1G2H A;  3RZD J;  4HNV A;  1ITY A;  3BG9 A;  5FKN A;  2XPW A;  1ETV A;  2K40 A;  2R93 J;  5M5Y J;  3LSR A;  3ZQL A;  1UG2 A;  1ETW A;  4FE4 A;  1ETQ A;  3GTG J;  2QF7 A;  1IDY A;  5C4J J;  1U9O A;  1UHS A;  1A6I A;  2DTZ A;  4G12 A;  4V2F A;  1UMQ A;  5DTD A;  5FLM J;  1QVT A;  1IDZ A;  1P7J A;  2EH3 A;  3OSF A;  1AU7 A;  4UUS A;  4XRS G;  3JRH A;  2R92 J;  5FKO A;  3HOU J;  2DA7 A;  3CMY A;  1ETO A;  2R5Z A;  5FKK A;  1T33 A;  4I76 A;  1RKT A;  1I3Q J;  2M8G X;  3QPS A;  5K7F A;  1B8I B;  3L1P A;  3ZQI A;  4IHX A;  1LFB A;  1GV5 A;  3S16 J;  2KT0 A;  1W0U A;  3E7L A;  3K2A A;  4MIM A;  2LTP A;  2JA6 J;  3FIW A;  2LKX A;  1MBJ A;  2O7O A;  1H88 C;  2ELK A;  2ID6 A;  3WHB A;  4AUX A;  5HOD A;  3M3Y J;  4W97 A;  1CQT A;  3CQZ J;  5IYD J;  2VI6 A;  1SFO J;  2ECB A;  3D1N I;  3ZOB A;  3GTP J;  4JX5 A;  2HYJ A;  3MN2 A;  3TW6 A;  3BTI A;  4BY7 J;  1WH5 A;  3Q0U A;  2M0C A;  3TED A;  3HDD A;  1F43 A;  3UKG A;  3Q0V A;  3JRD A;  4NDL A;  2R5Y B;  1GDT A;  4A3I J;  5F04 A;  2H8R A;  1NK3 P;  2K9Q A;  5C44 J;  4JYK A;  2GBY A;  3A01 A;  5GPA A;  3OOU A;  1HDD C;  3HM5 A;  3QPL A;  2W48 A;  5M5X J;  1GT0 C;  2MSY A;  3BQZ A;  2CU7 A;  3BR3 A;  2R0Q C;  3I4M J;  3VPR A;  1ZTR A;  5GPC A;  5EG0 B;  2EQR A;  3C2B A;  5IP6 A;  1RES A;  2MW8 A;  2YUS A;  4A3L J;  3ZQC A;  1H8A C;  3BG3 A;  1LE8 A;  2XPU A;  2M2E A;  2DA1 A;  1XC5 A;  3IH2 A;  1Y1V J;  5F27 A;  1IGN A;  1MSF C;  4BY1 J;  2JA8 J;  2DA6 A;  1FTT A;  4JX4 A;  2IBD A;  3LSG A;  5IOY A;  5EF6 A;  4FIS A;  3GBG A;  4JX6 A;  4AYB N;  1DU0 A;  2CJJ A;  2E2J J;  5EGO A;  4DZP A;  1SAN A;  4DYQ A;  1BA5 A;  3MVP A;  2NOG A;  4X6A J;  5J3L A;  1HCR A;  1BW5 A;  5C3E J;  2EZK A;  5F0H A;  1A5J A;  3HKZ N;  4XRM A;  1MH3 A;  2OF7 A;  4FCY A;  2DMN A;  2MGQ A;  5E3M A;  3BR6 A;  2EZH A;  3S1N J;  1B72 B;  1JT6 A;  3O8H A;  5K7Z A;  3ZQF A;  2JA5 J;  1OCP A;  2Y9Z A;  5IPA A;  1WI3 A;  3HOZ J;  1JUS A;  2XB5 A;  3B6A A;  2HDD A;  2YU9 J;  1VND A;  1B8I A;  1TWH J;  2VKV A;  4M3D A;  1MBH A;  2WV1 A;  4MFD A;  2LY9 A;  2DJN A;  2ME6 A;  2L9R A;  1JKR C;  4A3J J;  4RDU A;  1Z0X A;  2XGD A;  4DW6 A;  3IH4 A;  3HOV J;  4M3E A;  2JN6 A;  4XK4 A;  2L0K A;  1U78 A;  1X58 A;  4A3C J;  4M6V A;  4BKX A;  4ABZ A;  1IG7 A;  2AHQ A;  3BTC A;  5IP7 J;  1YRN A;  5JLX A;  3ZQH A;  2NS8 A;  2JJ7 A;  2L7F P;  4FE7 A;  4D5C A;  1ZQ3 P;  5FLV A;  4V2G A;  1R9T J;  1RR7 A;  1U9N A;  2VKE A;  3RZO J;  4IHW A;  3HGY A;  1X2N A;  1QRY A;  4A69 C;  1NK2 P;  2R5Y A;  2CUE A;  1IUF A;  1IJW C;  5IP9 J;  2O8K A;  2GLO A;  5FKL A;  5BNG A;  2CRG A;  5DS9 A;  1QPI A;  2NVX J;  5J1Y A;  1IC8 A;  1APL C;  2HOS A;  2OPT A;  4M3B A;  4CYC B;  1MBG A;  2CQX A;  4I6Z A;  1S7E A;  3GTM J;  2K9S A;  2IAI A;  1FIA A;  2CUF A;  2X6O A;  1MSE C;  3S14 J;  3ZQG A;  4A3K J;  3S1M J;  2NVY J;  4IHV A;  3JRG A;  4UUS B;  1K61 A;  3B6C A;  5FJ8 J;  5M3F J;  1MBF A;  2HXI A;  1LFU P;  2CQQ A;  2Y2Z A;  1AKH A;  2MG4 A;  1GUU A;  2XSD C;  3QQA A;  3S2H J;  3GTK J;  4MLO A;  1NTC A;  3G1L A;  3G1O A;  3S1Q J;  1H89 C;  5IYC J;  2XB0 X;  2LVS A;  1HF0 A;  1HLV A;  1TWA J;  1TWF J;  5J1U A;  3GTO J;  1IV6 A;  5M5W J;  2TRT A;  2HOA A;  5E3N A;  4A3M J;  1B72 A;  3PM1 A;  4EEF G;  2M9H A;  2Y0S N;  5EEA A;  2NVT J;  1JTY A;  3GTQ J;  1TWC J;  3JRI A;  3JR9 A;  1PUF B;  2M34 A;  3A03 A;  4A3B J;  2HI3 A;  3M4O J;  3LSP A;  4GFB A;  2JA7 J;  4L5E A;  2DA2 A;  1WH7 A;  2AO9 A;  4D5F A;  2FJ1 A;  5E3L A;  4Y52 J;  5GP9 A;  3O8G A;  2NVQ J;  2DMU A;  3CCY A;  3Q3S A;  1Z77 A;  2ECC A;  4AC0 A;  5J1R A;  3I4N J;  1D5Y A;  3A01 B;  2LLK A;  2Y31 A;  2P81 A;  1WGX A;  2EBI A;  1I50 J;  3JRF A;  2L7M P;  3PO2 J;  4B1R A;  4XRS A;  2Y9Y A;  1FTZ A;  4J19 A;  4BBS J;  2LD5 A;  2XRL A;  1MBE A;  3TP0 A;  4BBR J;  4LOC A;  1GVD A;  3TP3 A;  3S17 J;  4X1E A;  3BT9 A;  3IH3 A;  4B4C A;  5F1J A;  1ZR4 A;  1OFC X;  3DEW A;  3Q0W A;  2LP0 A;  4A3D J;  3GTL J;  5FKM A;  1E3O C;  2DA5 A;  2RAE A;  2TCT A;  3A02 A;  4S0H B;  4C3J J;  4C3H J;  3LNQ A;  3NAR A;  3RQI A;  2XGC A;  3SJM A;  1ZKG A;  3FIS A;  2DA4 A;  2LK2 A;  4QTR A;  2LR8 A;  5F0F A;  3F0C A;  3BR5 A;  4C3I J;  1ZK8 A;  1ETK A;  5IYB J;  2HOT A;  1ENH A;  2WAQ N;  4CYC A;  3H0G J;  5EGO B;  1JKO C;  2O9L A;  1TWG J;  3FKI J;  1JUP A;  2DA3 A;  3BTJ A;  3JRC A;  3JRB A;  1OCT C;  3WHC A;  2EZL A;  1VF9 A;  5C4X J;  9ANT A;  1VI0 A;  1ETX A;  4D7N A;  3H3V K;  1FEX A;  3BR2 A;  3G1M A;  1U8B A;  1BL0 A;  2VPR A;  1JJ8 C;  3HBL A;  2FX0 A;  2E2I J;  1TC3 C;  4QIW N;  5F0C A;  4DZJ A;  2QCO A;  5EDN A;  3S2D J;  4A93 J;  2H1K A;  4XIC A;  3SFI A;  2B63 J;  1X2M A;  4C2M J;  1FIP A;  5EZG A;  3JRE A;  1XG1 A;  1WCM J;  1ZR2 A;  2JK3 A;  4M3G A;  2E1O A;  5IOZ A;  1JJ6 C;  3LSJ A;  1IRZ A;  3MKL A;  5M3M J;  5E3O A;  5EG0 A;  3HOW J;  2K9N A;  3CDL A;  1JKP C;  5F08 A;  4D7M A;  1XS9 A;  2X9D A;  4BXX J;  2IEK A;  3OSG A;  2Y30 A;  3HOY J;  2DMQ A;  4JP0 A;  2FQ4 A;  2E2H J;  4RBO A;  1RET A;  2R5Z B;  1F36 A;  3BR0 A;  1YRN B;  4W1U A;  1JUM A;  4A3F J;  1Q1V A;  1PUF A;  1FJL A;  4Y7N J;  3S1R J;  5EZH A;  1MNM C;  3K7A J;  2X48 A;  2I10 A;  4A3G J;  4DYR A;  2GM4 A;  2L7Z A;  1ORK A;  5EYR A;  4XID A;  1OJL A;  3PO3 J;  4M3F A;  2D5V A;  4QSH A;  2R7Z J;  4MO7 A;  3BR1 A;  2LFB A;  1POG A;  3BQY A;  1JKQ C;  2VUM J;  2JMW A;  3LOC A;  2DMP A;  2PMZ N;  1BW6 A;  2YS9 A;  1P7I A;  2DN0 A;  4DYC A;  2E19 A;  1AHD P;  1EF4 A;  1GV2 A;  2ZB9 A;  3NAU A;  1T56 A;  3OIO A;  1MH4 A;  2FD5 A;  1BJZ A;  3GTJ J;  1O4X A;  3RKQ A;  1WPK A;  3BG5 A;  2ID3 A;  3HOX J;  4UUT A;  4A3E J;  1Y1W J;  1RPW A;  3TW7 A;  1RKW A;  2WB1 N;  1ZGW A;  1K83 J;  1ETY A;  2DMT A;  1JGG A;  3FK7 A;  4IEJ A;  1AKH B;  2XGE A;  3DCF A;  1JTX A;  2KDZ A;  1QVU A;  1VFC A;  3S15 J;  1MBK A;  2N8G A;  2NS7 A;  3HB9 A;  2JWT A;  3HGG A;  4FTH A;  2HQ5 A;  3JRA A;  5K7H A;  2G0E A;  3FK6 A;  1DU6 A;  1I6H J;  3W6V A;  1HDP A;  2ME0 A;  2COB A;  3SDG A;  1JT0 A;  4MFE A;  2EZI A;  5JLW A;  1LE8 B; 
#chains in the Genus database with same CATH topology
 3T1B A;  3HSF A;  1W0T A;  4V19 K;  4F7Z A;  4G9Y A;  4ZDP A;  2V4J C;  1KGS A;  3L2C A;  1BR1 A;  3RZD J;  4HNV A;  3CDI A;  2NXN B;  3A0H C;  1S29 A;  2QQB A;  2R93 J;  3LSR A;  5DEQ A;  1UG2 A;  1LPQ A;  1X1A A;  2ISZ A;  2OBP A;  2PMU A;  3DPL C;  2JA2 A;  3P9C A;  2PQ8 A;  3KP2 A;  3EYI A;  4G12 A;  4DNC A;  4HF0 A;  3CTA A;  5J8F A;  4CUG A;  1LKX A;  3J7Z I;  1U5T B;  4DBQ A;  1HW1 A;  3LSH A;  1MJA A;  4KN4 X;  5AIP A;  2DK8 A;  1T98 A;  1S6L A;  1T08 B;  1ETO A;  1YX3 A;  1X4O A;  2FOK A;  1RKT A;  2JRT A;  3I71 A;  3H9Q A;  5CPR B;  1F9N A;  1R5H A;  3K4J A;  4KUM A;  2F4O B;  2VJJ A;  3VSL A;  1V4R A;  3E7L A;  4MIM A;  2LTP A;  4IRI A;  1Y8R B;  2E5Z A;  4OIR F;  1MBJ A;  3J80 K;  1H88 C;  4FHT A;  3WHB A;  4AUX A;  5HOD A;  1S72 I;  3DTI A;  4W97 A;  2L4A A;  4M6Y A;  3RJP A;  2WAE A;  3CQZ J;  4MEY F;  4UHT A;  1NG7 A;  4IPA A;  1SFU A;  3ZOB A;  3GTP J;  2F5V A;  2ZJR F;  1BIA A;  3TW6 A;  3W6K B;  4YG2 F;  3OYM A;  2F5D A;  3M1E A;  2CFX A;  3H1C A;  2ADU A;  4E7L A;  3WU1 B;  4PSW A;  4Y13 A;  1V5E A;  5JVG F;  2HKO A;  3JTH A;  3GZ6 A;  3JRD A;  4NDL A;  2EV6 A;  4AIH A;  4XOT A;  3OYK A;  1GDT A;  5IT3 A;  2K9Q A;  2ELJ A;  2KRH A;  1YJN I;  3IL2 A;  3OOU A;  3S2W A;  3JAM Z;  1I1G A;  4G7O F;  3HM5 A;  5CVJ A;  1PYV A;  2EFQ A;  2MSY A;  3BZK A;  2LBF A;  4F93 B;  2K02 A;  4HV5 A;  3RYR A;  3OIP A;  3KCC A;  1D1C A;  1S9H A;  3I4M J;  4M71 A;  2Z99 A;  5GPC A;  2EQR A;  2W82 A;  3K2Z A;  2ZSH B;  2MD0 A;  4IQ4 A;  3OS0 A;  3ECO A;  2QLZ A;  2ZXJ A;  4XN0 A;  3ZQC A;  1R6R A;  1CF7 B;  3BG3 A;  2ZBK A;  1LE8 A;  1HBX G;  1BJA A;  1FNN A;  1E0E A;  4BE2 A;  5F27 A;  3IH2 A;  2K7L A;  2WAQ A;  4N0B A;  1A36 A;  3A1Y A;  4BY1 J;  4KMF A;  1FTT A;  4JX4 A;  2F4M B;  5ICC A;  2R7U A;  1BOB A;  2FUG 2;  4BAY A;  2UXX A;  4UB6 C;  5IOY A;  1IXS B;  1VQM I;  3I54 A;  3RQ4 A;  1W7P D;  3FM5 A;  3K1M A;  5FD5 A;  5FO5 A;  3DXJ F;  4ESJ A;  4RA2 A;  4DYQ A;  5DD8 A;  2HWV A;  4KYW A;  2HVQ A;  3SZG A;  3GXO A;  1HCR A;  2D1V A;  3E0J B;  3U1D A;  3MCZ A;  5C3E J;  4C9Y A;  1A04 A;  1TTY A;  2EZK A;  5F0H A;  2LC2 A;  2OF7 A;  3DBH B;  2ZCW A;  5A2Q K;  3JSP A;  2HEO A;  3BR6 A;  3M7G A;  2M4K A;  4L9V A;  1OYI A;  2L9V A;  1B72 B;  3S1N J;  1JT6 A;  4LMY A;  1AOY A;  1VZ0 A;  2WAD A;  3CP2 A;  4BJT A;  1W5C C;  3OYD A;  5IPA A;  1JUS A;  2ZFU A;  1GLN A;  2HQN A;  2KPM A;  2VKV A;  4XM3 A;  2WV1 A;  5B1A H;  1OKR A;  2DDA A;  3V42 A;  1I3A A;  1LQ1 A;  2RN7 A;  3OYA A;  4H4K C;  1Y8Q B;  4A3J J;  5E8I A;  2OAZ A;  3BDD A;  3IH4 A;  3KEO A;  2IGN A;  1X3W B;  2JN6 A;  3I0T A;  3ERM A;  2EK5 A;  2GOX B;  1IN5 A;  4F55 A;  2X51 A;  4BKX A;  3KFW X;  1R7J A;  3QPH A;  1IG7 A;  5KK1 A;  3I58 A;  1YRN A;  1V55 H;  2OUM A;  4CYD A;  2ELH A;  3NQO A;  4E7Z A;  3CC7 I;  2E36 A;  3U9G A;  2A05 A;  2DTR A;  1QRY A;  4GYI A;  4LIV A;  2R5Y A;  4OIQ F;  2VIX A;  1IUF A;  3WGG A;  3M9A A;  2VE9 A;  2E35 A;  3M8F A;  4XLC A;  4OIN F;  1W7P A;  2GLO A;  4GRI A;  2O8K A;  5FKL A;  2VE8 A;  1F5T A;  1QNT A;  2KLO A;  2CRG A;  4S04 A;  4NC6 A;  3CF2 A;  2BW3 A;  5CQG A;  4ZDL A;  2XRO A;  1IC8 A;  1MJ9 A;  2BOL A;  3FXQ A;  3WTU C;  3N4M A;  1EA3 A;  4XBF A;  2BY0 A;  1LEA A;  4HYE A;  3OYC A;  4CYC B;  4I6Z A;  2WB1 A;  4G6D A;  3FMS A;  4RMN A;  2OCC H;  4RLF A;  1J09 A;  1T2K A;  1B4A A;  3LST A;  2GA1 A;  3FHZ A;  2QEX I;  2PN6 A;  5BPD A;  3ZQG A;  3S1M J;  4BYY A;  4BE0 A;  1WQ2 A;  3QWL A;  1SD6 A;  2FBI A;  4FET A;  4PDK A;  1ZYR F;  3P7N A;  4ZYE A;  2BBY A;  5CVI A;  4XKB A;  4CDG A;  3J7A O;  3ABL H;  4NC8 A;  2PJR A;  2L01 A;  4P55 A;  4DBR A;  2JTV A;  2MFZ A;  2CW7 A;  2AS5 F;  1NG6 A;  2XAF A;  2ISY A;  2MD5 A;  3NWS A;  1YW7 A;  1GUU A;  3ONQ A;  1F4K A;  2PLY A;  2IS6 A;  4OAZ A;  3H36 A;  1O3S A;  1J75 A;  2FML A;  4CA0 A;  4CO8 A;  3G1L A;  3E1S A;  4IF4 A;  5EEG A;  4BGD A;  1K78 A;  1H89 C;  5IYC J;  1XGS A;  4CZC A;  2DT6 A;  4GXO A;  2IVM A;  1P4W A;  3FMQ A;  3MQ0 A;  2M45 A;  5HOO A;  4A3M J;  3C2H A;  3PM1 A;  4RM2 A;  4EEF G;  4KJZ A;  2CV1 A;  1K6Y A;  3DPU A;  2J5P A;  4CSW A;  2P5V A;  1GVJ A;  1FSE A;  3M4O J;  2AO9 A;  3OS1 A;  2FJ1 A;  3FXU A;  3EET A;  1Z77 A;  4AC0 A;  1QZZ A;  3MMY B;  5J1R A;  3I4N J;  3A01 B;  1HW2 A;  1YS7 A;  3BZ6 A;  4O5V A;  2MA3 A;  4OAY A;  2LRD A;  3M1C A;  5TJJ A;  4II2 A;  5DCM A;  1WJD A;  2Y75 A;  1OCR H;  2VT2 A;  5ILU A;  4ZYG A;  1R1V A;  3DU5 A;  2W24 A;  2MH2 A;  2Y9Y A;  2MAB A;  4BBS J;  3PFY A;  2XRL A;  1IN7 A;  3F3X A;  3TP0 A;  3AL0 C;  2O0Y A;  3DPT A;  1XSV A;  2EA2 A;  5GAD J;  4OOI A;  4EGY A;  4XLN F;  5DM6 F;  3LQR A;  3CJQ B;  3RYP A;  3VYS B;  1IXR C;  4P1W A;  3WTS C;  1W36 D;  1H0M A;  2HZD A;  2ZJ2 A;  3E5X A;  4QPQ A;  3GWZ A;  4C3J J;  2VQG A;  1ODD A;  1RZ4 A;  3LA3 A;  3SJM A;  1FWZ A;  2RVC A;  4HF2 A;  4B3X A;  2Z2S B;  2LK2 A;  1OCC H;  3ZR8 X;  3SQN A;  1DUX C;  1ZK8 A;  3FXM A;  4ENM A;  1ETK A;  1XD7 A;  3OYB A;  5J8C A;  3AAF A;  4HPQ A;  1JKO C;  2V6E A;  2A68 F;  1FP1 D;  3RPQ A;  3QRF F;  1OYW A;  3RCO A;  4LIT A;  1VF9 A;  4NHJ A;  3TQN A;  2MYS A;  3AKZ A;  3L2U A;  5E1W A;  3BR2 A;  1BL0 A;  3BY6 A;  2FNA A;  4U0W A;  1N77 A;  3V8J A;  2QCO A;  2R7T A;  3ROU A;  1UHW A;  3WE2 A;  3TDU C;  3UR3 C;  1T0F C;  2HYF A;  3GFJ A;  3GO5 A;  2WY7 Q;  2ZXH A;  5DV5 A;  5EZG A;  4A0Z A;  1XG1 A;  1ZAO A;  1YJW I;  1Z3Y A;  2JK3 A;  5IOZ A;  3LSJ A;  5EG0 A;  2L7K A;  1KYZ A;  2K9N A;  4Q4Z F;  1JKP C;  4XLA A;  5F08 A;  5FGM A;  2Y0S A;  3DBL B;  1XX5 A;  1KQ0 A;  2NYX A;  2ZME B;  4KIF A;  3WGH A;  4I7H A;  2M0M A;  2X6W A;  2L9S A;  4U0V A;  2IEK A;  2ZXW H;  2OJE D;  3OSG A;  2Y30 A;  2DMQ A;  2E2H J;  1J5Y A;  3BR0 A;  4D0P A;  4AD9 A;  2E71 A;  3LA7 A;  2DAO A;  1PUF A;  5B5E C;  3M8J A;  3G6E I;  2DO7 A;  4XNF A;  2CW0 F;  3DLL F;  1FBU A;  1MNM C;  2X48 A;  1U5T C;  3WTX C;  3JW4 A;  3QOD A;  4ENK A;  2VOP A;  2L7Z A;  5AON A;  1G3S A;  2D5V A;  3U2R A;  4MO7 A;  3H0D A;  2EFO A;  3QU6 A;  2LFB A;  2LSO A;  2KRF A;  4G7Z F;  2DW4 A;  4PZJ A;  3F8F A;  3FF5 A;  4YRV A;  3GZN B;  4DYC A;  1R71 A;  1P7I A;  4C2T A;  3FWE A;  4B48 A;  1GV2 A;  1YE9 A;  2IW5 A;  1MH4 A;  2RV8 A;  4I01 A;  1O3Q A;  1SD5 A;  5E1X A;  1M1E B;  1TL8 A;  3EQL F;  5A2Q Z;  1ZG5 A;  3OYL A;  2M8E A;  2XDV A;  5HS8 A;  1S3J A;  5LLQ A;  3KLO A;  1FSH A;  3TW7 A;  3FBN B;  3KP5 A;  2P6S A;  4LFU A;  3P5J A;  3B02 A;  3TOA A;  2PEX A;  2VQL A;  4G94 A;  4LB5 A;  2VJ4 A;  5IT9 Z;  1ZLJ A;  3IRR A;  4ZZL A;  3I55 I;  1QVU A;  2RNJ A;  2N8G A;  1IV8 A;  3F72 A;  2JWT A;  2KFD A;  3WTT C;  4PSX A;  2AQF A;  1QBJ A;  2M3A A;  5CVV A;  5ICG A;  3J7A Y;  1YI2 I;  2M5W A;  3FK6 A;  1DU6 A;  3BLY A;  3E97 A;  4HNU A;  5LHH A;  3ISP A;  1TT5 B;  2KHM A;  4MFE A;  4NQW A;  1FBS A;  1LDJ A;  3K4K A;  3IHU A;  2K3P A;  1YHQ I;  4B3A A;  1OR7 C;  4P9F A;  2VB6 A;  2EV5 A;  1BN5 A;  3VFZ A;  1H9T A;  3K9T A;  3BG9 A;  5FKN A;  3G73 A;  3CC4 I;  2XC7 A;  5LGT A;  3OIQ A;  5M5Y J;  3ZQL A;  2HYG D;  1ON1 A;  1XPX A;  2HS5 A;  3TO7 A;  3PSI A;  4H0E A;  4UNO A;  1VQ7 I;  5F1R A;  3GTG J;  1SAU A;  2WY8 Q;  4KDP A;  2X1C A;  3PUF A;  1BC7 C;  1IDY A;  3N05 A;  1QA6 A;  1G3Y A;  1U9O A;  3RSN A;  1A6I A;  2X4H A;  3ZMU A;  1FYM A;  1UMQ A;  1CGP A;  2VKH A;  4E7K A;  1B59 A;  3OY9 A;  4NC7 A;  1AU7 A;  2Q2E A;  1WJA A;  2KZG A;  4UUS A;  1V3F A;  3JRH A;  1DDN A;  3HSE A;  4PJM A;  1S7O A;  4M9S A;  4MNU A;  4ANJ A;  2ICW G;  3HOU J;  2GWR A;  2IXS A;  4I98 B;  3GUD A;  3CMY A;  1VQ8 I;  2E34 A;  2LKP A;  4S05 A;  4GYG A;  2R5Z A;  1T95 A;  1T33 A;  3H5A A;  2VBX A;  4XQF A;  3O6B B;  4N4O B;  3QPS A;  5K7F A;  1WSU A;  4BUP A;  3AG2 H;  1RRJ A;  1B8I B;  1J0R A;  4FX4 A;  2E7W A;  3MWM A;  1GV5 A;  4XLF A;  3DKW A;  4M74 A;  4O6J A;  3K2A A;  3T8R A;  4CCK A;  5KCM A;  1V54 H;  2JA6 J;  3FIW A;  2O7O A;  3EYY A;  4Z6Y A;  2ID6 A;  5LGN A;  3HOT A;  4XSZ F;  3CCE I;  2GXA A;  5IYD J;  3I9V 2;  2MC3 A;  3F8B A;  4FQG A;  3CCJ I;  1WH5 A;  2VJ5 A;  3G3Z A;  5DUK A;  1LEB A;  3ZQQ A;  2X1D A;  1BM9 A;  3CJN A;  3ZN1 A;  4PJL A;  1F43 A;  4UB8 C;  2HPM A;  3J7Y J;  2H8R A;  1NK3 P;  2O03 A;  2ETH A;  5C44 J;  3WE3 A;  5J4Y A;  4M6X A;  1Z91 A;  4EJV A;  1HDD C;  3N97 A;  3DV8 A;  1R49 A;  2VPL A;  4UUV A;  2CWE A;  3QPL A;  3SEZ A;  2W48 A;  5M5X J;  2EIJ H;  2DJI A;  1X1P A;  3I53 A;  4OMY A;  3GVA A;  1AA7 A;  2FMY A;  4KT5 C;  4EJO A;  2R0Q C;  1RI7 A;  2C6Y A;  3C2B A;  1DP7 P;  1VQ5 I;  1RES A;  4A3L J;  2YUS A;  1X3Z B;  5LGU A;  1LVK A;  4KIC A;  4Q48 A;  4PJN A;  3WTV C;  1H8A C;  2RNG A;  3AG3 H;  3HZJ A;  2XPU A;  4B44 A;  3SZT A;  4WWC A;  1NH3 A;  1WI9 A;  3F8C A;  5L3C A;  2DA6 A;  4BEH A;  4CCM A;  3QPT A;  3CCQ I;  5CLS A;  5J40 A;  3L7W A;  3LSG A;  3ZGK A;  4IO9 F;  2VL8 A;  5JR3 A;  2DYR H;  1O3R A;  1ZAR A;  1FOK A;  4HDV A;  3GBG A;  4AYB N;  1DU0 A;  4WCG A;  4RB3 C;  4OU0 A;  5EGO A;  4DZP A;  1SAN A;  3OOP A;  3LMM A;  4YFX F;  2CFO A;  2F2E A;  1VQP I;  2VQH A;  3HKZ N;  2HVR A;  3HUG B;  1MH3 A;  2VT3 A;  2DMN A;  5E3M A;  2L54 A;  3JSO A;  2EZH A;  4GGG A;  1XSX A;  4HAM A;  1W5T A;  3HRM A;  5HS7 A;  2LF7 A;  2DXI A;  2V6C A;  3HPG A;  2WBM A;  2XAQ A;  5FLX K;  3O8H A;  3VB2 A;  1Z3X A;  2D1H A;  4QLC U;  5L3F A;  2JA5 J;  5BOX A;  1OCP A;  2CW8 A;  1YS6 A;  5E20 A;  3HOZ J;  1W5S A;  2HDD A;  4U0Y A;  1VND A;  4FAS D;  1TWH J;  4HEA 2;  4HF1 A;  2VXZ A;  4MQV A;  5FRM A;  3A0B C;  1Z6R A;  4MFD A;  1STZ A;  3I59 B;  2A69 F;  2LY9 A;  2Z1D A;  2XAG A;  2EIL H;  3COA C;  4IHS A;  4PGG A;  3ELK A;  3EUK L;  4RB0 A;  2ME6 A;  4MGR A;  4RGX A;  4L0Y B;  2GXG A;  4NNJ A;  2OV7 A;  1JKR C;  2R7R A;  3KZI C;  1LFP A;  3LQQ A;  4M3E A;  1L3L A;  3K4N A;  1X58 A;  4ESB A;  1G8X A;  2F6C A;  4A3C J;  3FXO A;  3PQJ A;  2HQA A;  2BVM A;  2Q0O A;  5IP7 J;  4X0G A;  2WA0 A;  3IWF A;  1ZQ3 P;  5D8K B;  2LRE A;  2ESN A;  3CF5 F;  1TT0 A;  1ZRE A;  1HKQ A;  1U9N A;  3F22 A;  2QSH X;  1EJ9 A;  3HGY A;  4A69 C;  2F48 A;  4ITV A;  1IO2 A;  4L0Z B;  2EIK H;  2CUE A;  3L2R A;  1KU3 A;  3HSR A;  2DFE A;  2ESH A;  5IP9 J;  2LMD A;  4IOC F;  2QSF X;  1IRF A;  4Q5S F;  1VQO I;  2F5F A;  1QPI A;  3K0L A;  5J1Y A;  3F6O A;  1GXP A;  4PJ0 C;  3J81 K;  1D1B A;  4I99 C;  4M3B A;  1MBG A;  2CQX A;  1OPC A;  1JHF A;  1FIA A;  2DCE A;  1FY7 A;  1P6R A;  5B3S H;  2O6G E;  5F64 A;  3CCS I;  4MTE A;  3FX3 A;  1CF7 A;  2FF4 A;  3B6C A;  4KIS A;  3QOP A;  5FJ8 J;  2FU4 A;  5DDG A;  4E6K G;  3WOD F;  2YX7 A;  1AKH A;  1YX5 A;  1BBY A;  1XMA A;  2UZK A;  3H35 A;  5LHG A;  2DFI A;  3QQA A;  2YR2 A;  5FFX A;  1UZC A;  1U2W A;  5CKT A;  3W2W A;  3HXL A;  4XR6 A;  4MLO A;  1PP7 U;  3D5S C;  4CH7 A;  3EUH A;  1Y0N A;  2HFH A;  4ASN A;  1VQK I;  2HZT A;  1FP2 A;  1Z1D A;  1XCB A;  3I4P A;  5JVT A;  2H6C A;  2M30 A;  4CCN A;  4U7B A;  1XMX A;  1HF0 A;  1UFM A;  1TWF J;  5J1U A;  2XKP A;  3GTO J;  3K4B A;  1IV6 A;  2BXY A;  2OD5 A;  5KNL A;  2MH9 A;  1B72 A;  5E3N A;  3D5R C;  1SFX A;  3IC7 A;  2JVG A;  2B0L A;  4L9N A;  2M9H A;  1QZE A;  1BI2 A;  4YFK F;  2NVT J;  1JTY A;  1QO0 D;  3BG7 A;  2M7B A;  3JRI A;  3JR9 A;  2PJP A;  2QQA A;  2ZC2 A;  2Q1Z B;  3HRT A;  2ZME C;  4E7S A;  3CUQ A;  3LSP A;  2WWY A;  4DOZ A;  4L5E A;  3SFZ A;  1D3Y A;  2GZW A;  2XF6 A;  2KIF A;  2W25 A;  4Y52 J;  5GP9 A;  3O8G A;  3Q3S A;  2KQR A;  2PFB A;  2JUC A;  3EDP A;  2LLK A;  2HTJ A;  2CQK A;  1YTY A;  1WGX A;  3ABK H;  3JRF A;  1I50 J;  1MMG A;  1TW3 A;  4PFO A;  3HL2 A;  1HST A;  1VQL I;  1UG0 A;  2VC1 A;  3JCU C;  3V7C A;  4J19 A;  1SVO A;  2KDO A;  2LBF B;  5TGT A;  1Y0U A;  5LFA A;  1SEU A;  4XOP A;  1PUE E;  1MBE A;  1S5L C;  2HVS A;  1GVD A;  3TP3 A;  4N9H A;  1FYL A;  5HLH A;  3F23 A;  3BT9 A;  4B4C A;  3OYI A;  2IA0 A;  5F1J A;  3OR2 C;  4EMS A;  5D6E A;  1OFC X;  2LH9 A;  3CZ6 A;  3Q0W A;  3GTL J;  4D9J A;  1E3O C;  1G4D A;  1BR2 A;  2B7E A;  1O57 A;  4S0H B;  2EWN A;  4QWQ A;  4ESF A;  4E7I A;  1P9Q C;  5LD2 C;  3ABT A;  3NAR A;  1IN8 A;  1ZKG A;  3LA2 A;  2R7V A;  3LSK A;  4QTR A;  2LR8 A;  3FXL A;  4GCV A;  3F0C A;  2YSR A;  3BR5 A;  1R1T A;  3CMM A;  4E7H A;  5HNF A;  5HLI A;  5KVR A;  2WAQ N;  4CYC A;  3V8L A;  4XLP F;  3SYT A;  2O9L A;  2EPF A;  2O8X A;  2K9L A;  2M4G A;  5D5U B;  2EZL A;  1IRX A;  5C4X J;  1VI0 A;  1QGP A;  3K10 A;  2XIG A;  4D7N A;  3L2V A;  4A5M A;  3DKY A;  1ZRD A;  1J2X A;  3G1M A;  4R8H A;  4BDY A;  4QIW N;  5EDN A;  1SVM A;  3KLN A;  2VBZ A;  3S2D J;  4A93 J;  5D8L B;  4BHB A;  4FT8 A;  3SFI A;  4I0A A;  2COM A;  3ZMS A;  4C2M J;  3K4C A;  3G71 I;  1FIP A;  2GIV A;  3RI4 A;  2JVH A;  2K27 A;  1WCM J;  1RUN A;  1YQA A;  2TDX A;  4M3G A;  2E1O A;  5D6F A;  2WAF A;  5E3O A;  2NS0 A;  2FBK A;  2QBY A;  3HOW J;  1I5Z A;  4BNC A;  1QU3 A;  3HRS A;  3BJO A;  1XS9 A;  3S3O A;  4DJA A;  2LYC A;  2NNY A;  3CME I;  2DOE A;  2OZ6 A;  4RAZ A;  4JP0 A;  2XAU A;  5DYM A;  4L9J A;  2BHY A;  1RIO H;  2KJB A;  4WK8 F;  1JHH A;  5FB2 A;  1YRN B;  1REP C;  3OR1 C;  4A3F J;  1Q1V A;  1MMN A;  2BGC A;  2O61 A;  1YG2 A;  2VC0 A;  3Q5F A;  3K7A J;  4NUB A;  4JK1 X;  1ZEL A;  2EFN A;  2GM4 A;  2DOD A;  3M07 A;  4YEJ A;  2L02 A;  4MTD A;  4PUS A;  3GF2 A;  3E5U A;  1W7P B;  4M3F A;  3BR1 A;  2GXB A;  3ZMV A;  1YW8 A;  3Q9V A;  4HLY A;  2FBH A;  1X19 A;  2LY2 A;  4RB2 C;  3UNG C;  3BQY A;  1HSJ A;  4M73 A;  2VUM J;  3KEY A;  3LOC A;  1DPU A;  5F6F A;  2P5L C;  6PAX A;  2PMZ N;  1BW6 A;  3LSM A;  4DGW B;  2VLA A;  2DT5 A;  2OZU A;  3BC8 A;  2W1O A;  1P4A A;  1G6N A;  3L09 A;  3RKQ A;  3BG5 A;  2ID3 A;  4AID A;  3BOQ A;  3HOX J;  1XSD A;  2OA4 A;  4UUT A;  2CQ7 A;  3E6M A;  3ASO H;  1WHU A;  2IRF G;  5D5W B;  3K70 C;  2V1U A;  2IS1 A;  1RKW A;  2WB1 N;  4IJA A;  1JE8 A;  1ZGW A;  1K83 J;  1ETY A;  1YYV A;  2DMT A;  3KIO A;  1U3E M;  3FK7 A;  4GO1 A;  1QHG A;  3BJA A;  2XGE A;  3S15 J;  4UY8 I;  2DI3 A;  4LK0 F;  3ML6 A;  1XGO A;  3ZN0 A;  2NS7 A;  3PUB A;  2XAJ A;  3HGG A;  5ICE A;  2P4W A;  4U88 A;  1TQI A;  4HG2 A;  1I6H J;  3ESW B;  1HDP A;  1MDM A;  2COB A;  1JT0 A;  1K78 B;  4F52 A;  3TO9 A;  2EZI A;  1HOM A;  2E1C A;  3K4L A;  2QYO A;  2HQR A;  4EJW A;  2XPV A;  4HQE A;  2HXO A;  1G2H A;  3BTL A;  4IHY A;  2WTE A;  4IZZ A;  2KIS A;  2PX9 A;  4Y4R A;  2XPW A;  2LF8 A;  5L3G A;  2K40 A;  3V4G A;  4U87 A;  1E3P A;  4JBA A;  1ETW A;  2YPR A;  4IVN A;  5TIS C;  4ZTF A;  1MD0 A;  3GFI A;  3RKW A;  5C4J J;  1K4T A;  1UHS A;  1FX7 A;  2NRA C;  3J80 Z;  2LG4 A;  1DGR M;  2DTZ A;  5DTD A;  1QVT A;  2CUJ A;  3SXY A;  1IDZ A;  1P7J A;  2EH3 A;  3PFI A;  3H5R A;  3ECH A;  1ZRF A;  4II3 A;  2K86 A;  2UUZ A;  5E17 F;  2AXL A;  2HDC A;  4BJ5 C;  1IN4 A;  3CES A;  3J81 Z;  2R92 J;  2ZFW A;  3ULQ B;  5FKO A;  3DU6 A;  2UWM A;  2DA7 A;  3CCR I;  2EIN H;  3D5L A;  3FZV A;  2DBB A;  1WFX A;  5FKK A;  1LDD A;  3FBI B;  1FOW A;  5J47 A;  1LJ9 A;  1YOV B;  2G7H A;  3DBR B;  1HXD A;  2ZSI B;  4IHX A;  1LFB A;  2DQR A;  5ED4 A;  1RR8 C;  3MEX A;  3ZMZ A;  1W0U A;  2Z5U A;  4A0X A;  1D1A A;  4HX4 A;  3R0J A;  3TBI A;  1ZG3 A;  2LKX A;  3I56 I;  3VYR B;  2ELK A;  5JI6 A;  3FKJ A;  3DP7 A;  3PIP F;  2OTJ I;  2IP2 A;  2K4B A;  4KIG A;  1SFO J;  2ECB A;  4J01 A;  4P5O A;  1HQC A;  2EFW A;  3C1D A;  2HYJ A;  3PL8 A;  3MN2 A;  2XAH A;  5D5X B;  3GLL A;  4BY7 J;  3Q0U A;  1OCZ H;  4BXU A;  1ZN2 A;  2ZJP F;  3CJR B;  1K4S A;  2M0C A;  3K69 A;  3R4K A;  3GX4 X;  2P5K A;  4RB1 A;  3TED A;  3HDD A;  3TDZ C;  3T0Y A;  3UKG A;  1FT9 A;  3O2P E;  4P96 A;  4YIR X;  5F04 A;  2VXD A;  3VEP A;  3CCL I;  1GHC A;  4ZYA A;  4B47 A;  4CZZ A;  1UCR A;  2EB7 A;  3SZP A;  3KET A;  2KZV A;  5GPA A;  5LBQ A;  2CV0 A;  2VBY A;  4MEX F;  1R36 A;  1LVA A;  3CLO A;  4LB6 B;  3RPU D;  1XDS A;  2UV1 A;  1LNW A;  2IA2 A;  3BR3 A;  1MZB A;  2Z16 A;  3K70 D;  1ZTR A;  2E5N A;  3KP4 A;  5EG0 B;  3TOB A;  5IP6 A;  4ZH4 F;  3CO6 C;  3H9J A;  4RGU A;  3TO6 A;  1PDN C;  1OYY A;  4HZF A;  2M2E A;  1IN6 A;  2DA1 A;  4ENN A;  1IGN A;  2KIQ A;  4K2E A;  1TZL A;  4HW0 A;  4HX8 A;  4XMY A;  4GDF A;  2JSP A;  1U0J A;  4IOA F;  5HLT A;  1XDU A;  2IS4 A;  3QP6 A;  5CJ9 A;  3AG4 H;  1BI1 A;  2DOA A;  2WC2 A;  4B8X A;  3JAM K;  2ZO4 A;  5EF6 A;  3H5N A;  3C3W A;  4JX6 A;  5BQT A;  2V1X A;  2CJJ A;  3BCB A;  3LFU A;  5JFR A;  2IPQ X;  2E2J J;  1BA5 A;  1DQU A;  3PNT A;  4WX9 A;  5J3L A;  4X6A J;  1QPM A;  1TNT A;  2IA1 A;  3K1P A;  5EEH A;  3KEQ A;  4RLQ A;  1SC7 A;  5CYV A;  2F5C A;  1IUY A;  2MGQ A;  2A3S A;  2X1E A;  4A5N A;  3DTE A;  4FX0 A;  2K4J A;  4KT6 A;  5K7Z A;  2QKL B;  3ZQF A;  1N75 A;  4QPO A;  1E3H A;  1B8I A;  4XON A;  2CSO A;  4E7J A;  1JXS A;  2QVO A;  5FRN A;  5JHF A;  1WJF A;  2DJN A;  3VWB A;  2W00 A;  5E8G A;  3MKY B;  2DPU A;  1EH7 A;  2L9R A;  2ZNZ A;  1I1S A;  4ZTJ A;  3RPU A;  2XGD A;  1W1W E;  2PI0 A;  3HOV J;  4DIQ A;  1SD7 A;  4AWX B;  2HNH A;  2R7S A;  1BI0 A;  2VAS A;  3WU2 C;  4ZJZ A;  1A35 A;  1USS A;  3VYT B;  3BZC A;  3U21 A;  2AHQ A;  3BTC A;  3CCU I;  1G3W A;  4KA4 A;  1LB2 A;  3PJR A;  5JLX A;  3ZQH A;  2NS8 A;  2JJ7 A;  4FE7 A;  4D5C A;  1Z21 A;  1EH8 A;  5GTH C;  4LG3 A;  4V2G A;  3JTG A;  1R9T J;  3CCM I;  4IHW A;  4IX7 A;  4OWR B;  2V9P A;  5BNG A;  4BH9 A;  4LG0 B;  5DS9 A;  2L3D A;  1IF1 A;  4CHU A;  3G2B A;  1APL C;  2HOS A;  1SVL A;  4CIC A;  2R3S A;  2OPT A;  1MMA A;  2P6T A;  2KP6 A;  3GTM J;  4WXC A;  2K9S A;  2CUF A;  2XGX A;  3KYL A;  4OIP F;  5ERI A;  3WU0 A;  1VQ4 I;  3REO A;  2NVY J;  3L9F A;  3LL7 A;  4IHV A;  4EM0 B;  3ERE D;  2RDP A;  4UUS B;  2E1N A;  2FQ3 A;  1K61 A;  1FZP B;  3OL3 A;  2W4S A;  4AYB A;  2A5Y B;  5M3F J;  1J7K A;  1UJ8 A;  1MBF A;  4XKV A;  2HXI A;  1OIS A;  1G3T A;  1FPQ A;  1MMD A;  3OL4 A;  5FRO A;  2ZXI A;  2PBI A;  2CQQ A;  5DD4 A;  1K6O A;  2MG4 A;  2R4G A;  1B9M A;  3PSF A;  2DQL A;  2CMP A;  3HKZ A;  3SEQ A;  2XSD C;  3LAP A;  3KP6 A;  3ZRG A;  2K85 A;  4BU2 A;  4RGR A;  1T0F A;  1OCO H;  2IJL A;  4ZYH A;  1UAA A;  3G1O A;  1ZG1 A;  3U1K A;  4XKC A;  3PIO F;  1O3T A;  2P0W A;  2M7A A;  3V8K A;  3FHN A;  2I5U A;  5BMZ A;  2YX4 A;  4R1H A;  1HLV A;  4HQM A;  3I3L A;  5EJC A;  3ZMD A;  3IP4 B;  2TRT A;  1X4P A;  3OYN A;  3CLQ A;  3EUA A;  1ZGJ A;  1WJE A;  2G9W A;  2OCE A;  1E17 A;  1P92 A;  5EEA A;  2D2W A;  5L3D A;  4A6D A;  3RIR A;  2A5W A;  3CUO A;  2IGM A;  2A61 A;  3A03 A;  2EV0 A;  4BHC A;  2HI3 A;  4KFC A;  4A3B J;  4ZZD A;  3ABM H;  1N25 A;  4MQ9 F;  2DA2 A;  5H20 A;  4GFB A;  2JA7 J;  5L3E A;  3IUO A;  3I59 A;  1PP8 F;  3HRU A;  3E3V A;  3Q9S A;  2DMU A;  2NVQ J;  2XF5 A;  3MKW B;  1D5Y A;  3KP7 A;  1U5T A;  4LLN A;  4XKW A;  2EBI A;  4XN3 A;  3LFK A;  4CCL A;  2F4I A;  1DPR A;  1R00 A;  1EV7 A;  4B1R A;  2B9S A;  3PO2 J;  1HC8 A;  3S3M A;  4RAF A;  4IRG A;  2KIU A;  1N78 A;  2KMU A;  2LD5 A;  3HOS A;  1Y6I A;  5LRS A;  3HYI A;  3L2Q A;  3VDX A;  4BBR J;  5DM7 F;  3S17 J;  4X1E A;  3OV8 A;  1XB4 A;  1RUO A;  2FOW A;  2W7N A;  1YFH A;  2DLL A;  3DEW A;  2L4M A;  1FMV A;  1QQI A;  3FXR A;  5FKM A;  4PK4 A;  1S8N A;  2UXN A;  4BEH B;  5DCF A;  2XGC A;  2JT1 A;  3I64 A;  4YII A;  2XF7 A;  2DFH A;  3FIS A;  2DA4 A;  1D8J A;  4JQF A;  5F0F A;  3RKY A;  1O7F A;  3LSI A;  4C3I J;  3BP8 A;  4AIK A;  1WZ2 A;  5IYB J;  2HOT A;  1ENH A;  3H0G J;  5EGO B;  5KAF C;  4XLE A;  2STW A;  3FKI J;  2DA3 A;  2JPB A;  1MW7 A;  3BTJ A;  1MJB A;  1R5I D;  4C2U A;  3WHC A;  5LHI A;  1TLH B;  2GA2 A;  3CO7 C;  9ANT A;  1Z6T A;  5LRR A;  1ZH5 A;  1X1D A;  4BAC A;  3OYJ A;  4U7D A;  2LY1 A;  1XTA A;  3H3V K;  1FEX A;  1BR4 A;  1U8B A;  1JJ8 C;  2BZT A;  2E2I J;  5ILV A;  5F0C A;  2H6B A;  4DZJ A;  5E79 C;  5LEK A;  4A2U A;  2JRM A;  4HBL A;  3ABU A;  4XIC A;  2FXA A;  1NHA A;  3IRQ A;  3JRE A;  3FXK A;  1OR7 A;  4BQO A;  1ZR2 A;  5HNH A;  5KAI C;  2JPC A;  3F8M A;  1JJ6 C;  4OIO F;  4HDU A;  2DDB A;  1KON A;  4L5J A;  5H2F C;  5M3M J;  2ZNY A;  1RNL A;  3OYG A;  4P9U A;  4G8X A;  1JGS A;  3HHG A;  3GYH X;  3VSK A;  2QM3 A;  4LK1 F;  4A0Y A;  5GAH J;  4YEL A;  2W57 A;  2DK5 A;  2HGC A;  4J00 A;  2FQ4 A;  2BHZ A;  4HV6 A;  4RBO A;  2RKH A;  1P4X A;  3GFL A;  1F36 A;  4G6T B;  1XCV A;  5KHD A;  1AWC A;  5FD6 A;  1JUM A;  2R7W A;  1XN7 A;  2L5Q A;  4R79 A;  2KIM A;  2QQ8 A;  5B66 C;  3B73 A;  3DF8 A;  3HIF A;  1FJL A;  4AU7 A;  3MZ8 A;  4C30 A;  5EZH A;  4DYR A;  3BRO A;  2AQE A;  4Z2Y A;  3S3N A;  2RQP A;  5EYR A;  3PO3 J;  1UST A;  5HDK A;  2W84 A;  1Z7L A;  1T39 A;  2R7Z J;  2YU3 A;  3WTW C;  2IT0 A;  2RGV A;  1R1U A;  5K5R A;  3DFG A;  1ZRC A;  2P7V B;  2LDU A;  4E70 A;  2HOE A;  2FA5 A;  2E1M C;  4ENJ A;  1YO5 C;  4AM3 A;  1B6A A;  2DN0 A;  2E19 A;  2O5R A;  3MKZ A;  1EF4 A;  2ZB9 A;  3MD2 A;  3MZY A;  3OIO A;  1T56 A;  1ULY A;  4ZYD A;  1XGN A;  3I5U A;  4KMU X;  1O4X A;  3KYD B;  1V5G A;  5BS6 A;  5HDG A;  1WJB A;  3X2Q H;  5CVR A;  4A3E J;  1FBQ A;  1Y1W J;  1VQ6 I;  5B1B H;  4EAT A;  2H27 A;  3QU3 A;  5K5Q A;  4IRH A;  2FNP A;  4KNY A;  1AKH B;  3F9K A;  2KJC A;  3DCF A;  1JTX A;  2KDZ A;  1VFC A;  1I27 A;  4WF2 A;  1MBK A;  5HLG A;  3HB9 A;  3KX2 A;  3QP5 A;  3V7R A;  2STT A;  1G59 A;  2H09 A;  2G0E A;  5GAE J;  2ME0 A;  4WXH A;  3KP3 A;  1GXQ A;  1R58 A;  4B09 A;  2V26 A;  5JLW A;  1WWX A;  3D0S A;  1LE8 B;  5J4V A;  3IV5 A;  2BYV E;  4G7H F;  3HC7 A;  1IAW A;  3GW2 A;  3WTY C;  3HEF A;  4F91 B;  4AVP A;  4WXD A;  1ITY A;  3R0A A;  1X1C A;  4BXF A;  1ETV A;  1FMW A;  1O7L A;  1Y56 A;  1ON2 A;  2BY2 A;  1SFK A;  5GAG J;  4AIJ A;  3ZXS A;  4FE4 A;  5E18 F;  1ETQ A;  5CVU A;  2JSC A;  2QWW A;  3W2V A;  5IY5 H;  3LAJ A;  2DPD A;  2QF7 A;  5IT9 K;  3CUQ B;  1V5F A;  2V1D A;  4V2F A;  5FLM J;  2K5C A;  3V7S A;  4G6Q A;  2HTS A;  5L3B A;  3OSF A;  2NAZ A;  4XRS G;  4BE1 A;  2MC4 A;  4XRF A;  4M9X A;  4UVB A;  1W36 C;  2BY1 A;  1VQ9 I;  4O3M A;  1JI8 A;  1E2X A;  4I76 A;  1YIJ I;  1I3Q J;  2M8G X;  2M87 A;  2MLG A;  1Q1H A;  3F8N A;  4N9I A;  3L1P A;  1QZY A;  3M8E A;  3ZQI A;  1H9G A;  3QAH A;  4LGW A;  4M72 A;  2QGU A;  3T5X A;  3S16 J;  2KT0 A;  3A4C A;  3PQK A;  2PMZ A;  1D0Y A;  2RC4 A;  3C2G A;  3BCA A;  1MMS A;  4L5I A;  3QYE A;  4HX7 A;  1T8I A;  3M3Y J;  3DQV C;  1WKM A;  4TV7 A;  5H6Q A;  1CQT A;  2VI6 A;  3PNY A;  1VQN I;  3D1N I;  5D4R A;  2W85 A;  1WJ5 A;  1FYK A;  1ACI A;  2FSW A;  2K3F A;  4JX5 A;  4Y17 A;  1KZH A;  3BJ6 A;  3T8T A;  3BTI A;  4BQA A;  4OMZ A;  3SDB A;  1OMI A;  1R22 A;  3FM3 A;  3KPH A;  2JUG A;  1J9I A;  2HPI A;  3K1N A;  2JZY A;  5E1Z B;  3Q0V A;  2R5Y B;  4ON0 A;  2Z3Y A;  4A3I J;  5AIQ A;  2V79 A;  1T38 A;  3R61 A;  1LDK B;  4E4H A;  4JYK A;  2GBY A;  3A01 A;  3PNV A;  2Z9O A;  4HOB A;  2BW3 B;  1K7A A;  3GME A;  1PJR A;  3KYC B;  2XHK A;  1SFE A;  4PCQ A;  4EVI A;  3F6V A;  1GT0 C;  3BQZ A;  1XGM A;  3ZP5 A;  2CU7 A;  1MIJ A;  2QA4 I;  3CJT B;  4XOR A;  2VN2 A;  3VPR A;  4ZC3 A;  2QBY B;  1SAX A;  3W2A A;  1BOA A;  2MW8 A;  4Q47 A;  4BHP A;  1SMT A;  3ASN H;  2DFF A;  1T6S A;  1U8R A;  4I2O A;  2A07 F;  1XC5 A;  2PJR B;  1Y1V J;  4BJ6 C;  4M9Z A;  5FLX Z;  1MSF C;  3CDH A;  2JA8 J;  2CUZ A;  5H6R A;  2LNB A;  3GFM A;  1KQ8 A;  3TMO A;  2IBD A;  1A31 A;  1R23 A;  3DKX A;  4PJJ A;  2IGK A;  2FE3 A;  2NNN A;  1FLI A;  4FIS A;  3AG1 H;  3TKY A;  1TW2 A;  3RDI A;  2VOD A;  3O3K A;  4IXA A;  3MVP A;  1BI3 A;  2NOG A;  1I6X A;  1BW5 A;  2R7X A;  3RKX A;  1A5J A;  4A12 A;  4XRM A;  3ZPL A;  2CQN A;  4FCY A;  3FDY A;  4A6E A;  4ETS A;  5D5V B;  3CC2 I;  4IHT A;  1KQ9 A;  4UXN A;  2VQC A;  1R4N B;  3P9K A;  3SHF A;  1Z05 A;  4YFN F;  4BDZ A;  3KZZ A;  3WG9 A;  3DEE A;  2Y9Z A;  2RQQ A;  2VJI A;  4LLG F;  1BIB A;  1WI3 A;  2XB5 A;  3B6A A;  2YU9 J;  1Z7U A;  2HKX A;  3CP8 A;  4M3D A;  1ZLK A;  1MBH A;  4CGZ A;  3HPH A;  4ZDO A;  2LKS A;  1RC9 A;  1K79 A;  2BEO A;  2ZME A;  4LJZ F;  4RDU A;  1B1B A;  4L18 B;  1Z0X A;  3HTS B;  4DW6 A;  5DCM B;  3KZY A;  2P7C B;  4XK4 A;  1FOX A;  2L0K A;  1U78 A;  1F1Z A;  4IL6 C;  1R4M B;  2F5E A;  3L2W A;  1ERD A;  2DT7 B;  1MKM A;  4HLX A;  4M6V A;  4CCJ A;  4ABZ A;  2EJR A;  2GOM A;  5ILS A;  3QYB A;  1KU2 A;  4I02 A;  2L7F P;  5FLV A;  2XAS A;  3E6C C;  3QOE A;  2E1M B;  4RGS A;  1RR7 A;  1MDM B;  2KRC A;  3MFK A;  2VKE A;  2VOO A;  3RZO J;  3AFH A;  1X2N A;  4HA8 A;  3E6B A;  4YIF A;  1WJC A;  1NK2 P;  4UV8 A;  3GCM A;  2BE5 F;  2EIM H;  2R7Q A;  2WV0 A;  3S93 A;  3ZQ7 A;  3R60 A;  4XSX F;  1IJW C;  2Q8K A;  2BY3 A;  3E5Q A;  2XVC A;  1A6Q A;  3P9I A;  1KU7 A;  2NVX J;  2XV4 S;  1YW9 A;  3WGI A;  2GIZ A;  3K6G A;  1WVR A;  3ZCO A;  3NWT A;  1TNS A;  1OQY A;  1S7E A;  3NEU A;  2IAI A;  4RAY A;  2AXT C;  2Y69 H;  2E7X A;  3G4S I;  2X6O A;  2L9N A;  2VON A;  1MSE C;  3S14 J;  3CCV I;  1L0O C;  4A3K J;  4HRI A;  4NBQ A;  1OLT A;  1VTN C;  3JRG A;  2KL4 A;  1U6G A;  2LOO A;  2HU9 A;  2ACJ A;  1EKE A;  3EPZ A;  1LFU P;  2Y2Z A;  1LUJ B;  2L2O A;  3A2K A;  3IAS 2;  2V1N A;  3L00 A;  3OS2 A;  1IW7 F;  1ZHF A;  3E6D A;  3S2H J;  1QHH D;  1S7A A;  2R7F A;  4B43 A;  3GTK J;  4I09 A;  2VBW A;  4XLH A;  5GTI C;  1NTC A;  1X1B A;  1DP3 A;  1HKS A;  2A6T A;  3S1Q J;  3H3U A;  1X3U A;  3MAJ A;  1YJ9 I;  2XB0 X;  2H8W A;  4BL0 B;  5K1Y A;  2P8T A;  3DTK A;  2LVS A;  1IRG A;  1TWA J;  3WTZ A;  1YLF A;  3TGN A;  1WRJ A;  2V9V A;  5M5W J;  3GZ5 A;  3IAM 2;  5JHU A;  2HOA A;  5D4S A;  2ZJQ F;  2G7U A;  2Y0S N;  2XSJ C;  4Y3O A;  3GTQ J;  1TWC J;  3C7J A;  4D1Q A;  1PUF B;  2M34 A;  4EQQ A;  5DUI A;  1J59 A;  1FC3 A;  1WH7 A;  4HSR A;  1Z67 A;  2Z33 A;  4D5F A;  5E3L A;  3HTU A;  1HA8 A;  1KU9 A;  3CCY A;  2Y48 A;  5FFZ A;  4PGH A;  2ECC A;  2XKO A;  5K5O A;  3BWG A;  2E60 A;  2Y31 A;  2P81 A;  2R7D A;  3F21 A;  3H92 A;  2L7M P;  4XRS A;  4BQQ A;  1FTZ A;  2H94 A;  2PMH A;  4RS8 A;  2EFP A;  2NVU B;  4LLL A;  2GAU A;  3VYU B;  4Y15 A;  4LOC A;  5HVQ C;  5BPI A;  1Y39 A;  5ICF A;  3IH3 A;  3W6J B;  1SD4 A;  3FMR A;  3IWZ A;  4UVA A;  1ZR4 A;  4DQ2 A;  4EJT A;  2NOJ B;  2LP0 A;  4A3D J;  4LIU A;  2DA5 A;  1UHM A;  1EH6 A;  2O3F A;  2RAE A;  2TCT A;  3A02 A;  2A6H F;  2CG4 A;  2BVL A;  2X6Y A;  4LG0 A;  4C3H J;  2BV6 A;  3LNQ A;  3RQI A;  3NRV A;  3MZH A;  2QZ8 A;  4IKF A;  2IS2 A;  4IQJ A;  4EV0 A;  3DEU A;  4JOM A;  3R6S A;  4HNT A;  2HR3 A;  1TWG J;  2QQ9 A;  3BG6 A;  1JUP A;  1YIO A;  1D8K A;  4NB5 A;  1R5G A;  4F92 B;  4RM3 A;  3JRB A;  3JRC A;  2HDW A;  4NQW B;  2J5O A;  1OCT C;  2M1B A;  2CV2 A;  1ETX A;  2K9M A;  4CXF A;  1TBX A;  3BPV A;  3OYH A;  2VPR A;  4BQN A;  3HBL A;  2FX0 A;  1MGT A;  1TC3 C;  2QUF A;  1BC8 C;  4KIB A;  1FOY A;  3RTR A;  2H1K A;  2GQQ A;  4BS9 A;  1X2M A;  3EUH C;  2B63 J;  3OWT A;  4UV9 A;  1P2F A;  3HHH A;  2JQ7 A;  2OQG A;  1TP4 A;  2X85 A;  4EM2 A;  3VOE A;  2RRE A;  3FXJ A;  1IRZ A;  3S8P A;  3HJE A;  3MKL A;  1MNE A;  3CMA I;  1KYW A;  1UEL B;  2EA4 A;  2QEN A;  1YIT I;  3BPX A;  3LWF A;  3CDL A;  2QKM B;  2DYS H;  4MHG A;  3S32 A;  3C18 A;  4D7M A;  3TL4 X;  2Q2E B;  2X9D A;  4BXX J;  5CQE A;  2VKD A;  3OMY A;  5HS9 A;  2CH0 A;  3GLX A;  2CYY A;  3WG7 H;  4N4N B;  1XMK A;  3HOY J;  2OU2 A;  3CUQ C;  2D45 A;  1RET A;  4Y33 A;  3IKT A;  2R5Z B;  4L9T A;  2KKO A;  3OYF A;  4W1U A;  1I39 A;  2MLK A;  2OC6 A;  2I8D A;  2CGP A;  4Y7N J;  1W4M A;  3S1R J;  1D0X A;  4EM1 A;  2I10 A;  2Y0M A;  4A3G J;  1KA8 A;  3AL0 B;  1IXC A;  3GEZ A;  2V9K A;  1ORK A;  3K4M A;  5HDN A;  1OJL A;  4XID A;  1UB9 A;  1Z9C A;  2OTL I;  1ZGA A;  1TQM A;  1IZ1 A;  4QSH A;  2BXZ A;  5J6X A;  3HUG A;  3QYF A;  1HW5 A;  1POG A;  4UVC A;  2CO5 A;  4AVZ A;  2H1L A;  1JKQ C;  2R7O A;  1C0W A;  1D0Z A;  2A6E F;  2JMW A;  2CS3 A;  2DMP A;  1ONV A;  2YS9 A;  2PG4 A;  2X6X A;  1AHD P;  4XL9 A;  4EJU A;  1DGW Y;  2XRN A;  2V7F A;  3OYE A;  3NAU A;  1HKT A;  2XUB A;  5LEJ A;  4CCO A;  2FD5 A;  1BJZ A;  3GTJ J;  2OQR A;  1WPK A;  4RAG A;  4HST A;  1SMY F;  3W3C A;  2IGO A;  3H3Z A;  1RPW A;  3VOD A;  2QSG X;  2MBF A;  3ZMT A;  1JGG A;  3H9G A;  2DOF A;  4KN7 X;  4IEJ A;  4I0B A;  2DU9 A;  3CD6 I;  2X0L A;  3HG9 A;  1MND A;  3KE2 A;  1PVE A;  4PFP A;  1D5V A;  1TQP A;  3IKV A;  4F3Q A;  3DLA A;  1B9N A;  4FTH A;  2HQ5 A;  3JRA A;  5K7H A;  3DWL E;  4EGZ A;  4KIT B;  3W6V A;  2FEZ A;  5TRD A;  2FRH A;  3SDG A;  2ZKZ A;  4LD5 A; 
#chains in the Genus database with same CATH homology
 3IV5 A;  1HOM A;  1W0T A;  2XPV A;  2HXO A;  4B3A A;  3BTL A;  3HEF A;  4IHY A;  1G2H A;  3RZD J;  4HNV A;  1ITY A;  3BG9 A;  5FKN A;  2XPW A;  1ETV A;  2K40 A;  2R93 J;  5M5Y J;  3LSR A;  3ZQL A;  1UG2 A;  1ETW A;  4FE4 A;  1ETQ A;  3GTG J;  2QF7 A;  1IDY A;  5C4J J;  1U9O A;  1UHS A;  1A6I A;  2DTZ A;  4G12 A;  4V2F A;  1UMQ A;  5DTD A;  5FLM J;  1QVT A;  1IDZ A;  1P7J A;  2EH3 A;  3OSF A;  1AU7 A;  4UUS A;  4XRS G;  3JRH A;  2R92 J;  5FKO A;  3HOU J;  2DA7 A;  3CMY A;  1ETO A;  2R5Z A;  5FKK A;  1T33 A;  4I76 A;  1RKT A;  1I3Q J;  2M8G X;  3QPS A;  5K7F A;  1B8I B;  3L1P A;  3ZQI A;  4IHX A;  1LFB A;  1GV5 A;  3S16 J;  2KT0 A;  1W0U A;  3E7L A;  3K2A A;  4MIM A;  2LTP A;  2JA6 J;  3FIW A;  2LKX A;  1MBJ A;  2O7O A;  1H88 C;  2ELK A;  2ID6 A;  3WHB A;  4AUX A;  5HOD A;  3M3Y J;  4W97 A;  1CQT A;  3CQZ J;  5IYD J;  2VI6 A;  1SFO J;  2ECB A;  3D1N I;  3ZOB A;  3GTP J;  4JX5 A;  2HYJ A;  3MN2 A;  3TW6 A;  3BTI A;  4BY7 J;  1WH5 A;  3Q0U A;  2M0C A;  3TED A;  3HDD A;  1F43 A;  3UKG A;  3Q0V A;  3JRD A;  4NDL A;  2R5Y B;  1GDT A;  4A3I J;  5F04 A;  2H8R A;  1NK3 P;  2K9Q A;  5C44 J;  4JYK A;  2GBY A;  3A01 A;  5GPA A;  3OOU A;  1HDD C;  3HM5 A;  3QPL A;  2W48 A;  5M5X J;  1GT0 C;  2MSY A;  3BQZ A;  2CU7 A;  3BR3 A;  2R0Q C;  3I4M J;  3VPR A;  1ZTR A;  5GPC A;  5EG0 B;  2EQR A;  3C2B A;  5IP6 A;  1RES A;  2MW8 A;  2YUS A;  4A3L J;  3ZQC A;  1H8A C;  3BG3 A;  1LE8 A;  2XPU A;  2M2E A;  2DA1 A;  1XC5 A;  3IH2 A;  1Y1V J;  5F27 A;  1IGN A;  1MSF C;  4BY1 J;  2JA8 J;  2DA6 A;  1FTT A;  4JX4 A;  2IBD A;  3LSG A;  5IOY A;  5EF6 A;  4FIS A;  3GBG A;  4JX6 A;  4AYB N;  1DU0 A;  2CJJ A;  2E2J J;  5EGO A;  4DZP A;  1SAN A;  4DYQ A;  1BA5 A;  3MVP A;  2NOG A;  4X6A J;  5J3L A;  1HCR A;  1BW5 A;  5C3E J;  2EZK A;  5F0H A;  1A5J A;  3HKZ N;  4XRM A;  1MH3 A;  2OF7 A;  4FCY A;  2DMN A;  2MGQ A;  5E3M A;  3BR6 A;  2EZH A;  3S1N J;  1B72 B;  1JT6 A;  3O8H A;  5K7Z A;  3ZQF A;  2JA5 J;  1OCP A;  2Y9Z A;  5IPA A;  1WI3 A;  3HOZ J;  1JUS A;  2XB5 A;  3B6A A;  2HDD A;  2YU9 J;  1VND A;  1B8I A;  1TWH J;  2VKV A;  4M3D A;  1MBH A;  2WV1 A;  4MFD A;  2LY9 A;  2DJN A;  2ME6 A;  2L9R A;  1JKR C;  4A3J J;  4RDU A;  1Z0X A;  2XGD A;  4DW6 A;  3IH4 A;  3HOV J;  4M3E A;  2JN6 A;  4XK4 A;  2L0K A;  1U78 A;  1X58 A;  4A3C J;  4M6V A;  4BKX A;  4ABZ A;  1IG7 A;  2AHQ A;  3BTC A;  5IP7 J;  1YRN A;  5JLX A;  3ZQH A;  2NS8 A;  2JJ7 A;  2L7F P;  4FE7 A;  4D5C A;  1ZQ3 P;  5FLV A;  4V2G A;  1R9T J;  1RR7 A;  1U9N A;  2VKE A;  3RZO J;  4IHW A;  3HGY A;  1X2N A;  1QRY A;  4A69 C;  1NK2 P;  2R5Y A;  2CUE A;  1IUF A;  1IJW C;  5IP9 J;  2O8K A;  2GLO A;  5FKL A;  5BNG A;  2CRG A;  5DS9 A;  1QPI A;  2NVX J;  5J1Y A;  1IC8 A;  1APL C;  2HOS A;  2OPT A;  4M3B A;  4CYC B;  1MBG A;  2CQX A;  4I6Z A;  1S7E A;  3GTM J;  2K9S A;  2IAI A;  1FIA A;  2CUF A;  2X6O A;  1MSE C;  3S14 J;  3ZQG A;  4A3K J;  3S1M J;  2NVY J;  4IHV A;  3JRG A;  4UUS B;  1K61 A;  3B6C A;  5FJ8 J;  5M3F J;  1MBF A;  2HXI A;  1LFU P;  2CQQ A;  2Y2Z A;  1AKH A;  2MG4 A;  1GUU A;  2XSD C;  3QQA A;  3S2H J;  3GTK J;  4MLO A;  1NTC A;  3G1L A;  3G1O A;  3S1Q J;  1H89 C;  5IYC J;  2XB0 X;  2LVS A;  1HF0 A;  1HLV A;  1TWA J;  1TWF J;  5J1U A;  3GTO J;  1IV6 A;  5M5W J;  2TRT A;  2HOA A;  5E3N A;  4A3M J;  1B72 A;  3PM1 A;  4EEF G;  2M9H A;  2Y0S N;  5EEA A;  2NVT J;  1JTY A;  3GTQ J;  1TWC J;  3JRI A;  3JR9 A;  1PUF B;  2M34 A;  3A03 A;  4A3B J;  2HI3 A;  3M4O J;  3LSP A;  4GFB A;  2JA7 J;  4L5E A;  2DA2 A;  1WH7 A;  2AO9 A;  4D5F A;  2FJ1 A;  5E3L A;  4Y52 J;  5GP9 A;  3O8G A;  2NVQ J;  2DMU A;  3CCY A;  3Q3S A;  1Z77 A;  2ECC A;  4AC0 A;  5J1R A;  3I4N J;  1D5Y A;  3A01 B;  2LLK A;  2Y31 A;  2P81 A;  1WGX A;  2EBI A;  1I50 J;  3JRF A;  2L7M P;  3PO2 J;  4B1R A;  4XRS A;  2Y9Y A;  1FTZ A;  4J19 A;  4BBS J;  2LD5 A;  2XRL A;  1MBE A;  3TP0 A;  4BBR J;  4LOC A;  1GVD A;  3TP3 A;  3S17 J;  4X1E A;  3BT9 A;  3IH3 A;  4B4C A;  5F1J A;  1ZR4 A;  1OFC X;  3DEW A;  3Q0W A;  2LP0 A;  4A3D J;  3GTL J;  5FKM A;  1E3O C;  2DA5 A;  2RAE A;  2TCT A;  3A02 A;  4S0H B;  4C3J J;  4C3H J;  3LNQ A;  3NAR A;  3RQI A;  2XGC A;  3SJM A;  1ZKG A;  3FIS A;  2DA4 A;  2LK2 A;  4QTR A;  2LR8 A;  5F0F A;  3F0C A;  3BR5 A;  4C3I J;  1ZK8 A;  1ETK A;  5IYB J;  2HOT A;  1ENH A;  2WAQ N;  4CYC A;  3H0G J;  5EGO B;  1JKO C;  2O9L A;  1TWG J;  3FKI J;  1JUP A;  2DA3 A;  3BTJ A;  3JRC A;  3JRB A;  1OCT C;  3WHC A;  2EZL A;  1VF9 A;  5C4X J;  9ANT A;  1VI0 A;  1ETX A;  4D7N A;  3H3V K;  1FEX A;  3BR2 A;  3G1M A;  1U8B A;  1BL0 A;  2VPR A;  1JJ8 C;  3HBL A;  2FX0 A;  2E2I J;  1TC3 C;  4QIW N;  5F0C A;  4DZJ A;  2QCO A;  5EDN A;  3S2D J;  4A93 J;  2H1K A;  4XIC A;  3SFI A;  2B63 J;  1X2M A;  4C2M J;  1FIP A;  5EZG A;  3JRE A;  1XG1 A;  1WCM J;  1ZR2 A;  2JK3 A;  4M3G A;  2E1O A;  5IOZ A;  1JJ6 C;  3LSJ A;  1IRZ A;  3MKL A;  5M3M J;  5E3O A;  5EG0 A;  3HOW J;  2K9N A;  3CDL A;  1JKP C;  5F08 A;  4D7M A;  1XS9 A;  2X9D A;  4BXX J;  2IEK A;  3OSG A;  2Y30 A;  3HOY J;  2DMQ A;  4JP0 A;  2FQ4 A;  2E2H J;  4RBO A;  1RET A;  2R5Z B;  1F36 A;  3BR0 A;  1YRN B;  4W1U A;  1JUM A;  4A3F J;  1Q1V A;  1PUF A;  1FJL A;  4Y7N J;  3S1R J;  5EZH A;  1MNM C;  3K7A J;  2X48 A;  2I10 A;  4A3G J;  4DYR A;  2GM4 A;  2L7Z A;  1ORK A;  5EYR A;  4XID A;  1OJL A;  3PO3 J;  4M3F A;  2D5V A;  4QSH A;  2R7Z J;  4MO7 A;  3BR1 A;  2LFB A;  1POG A;  3BQY A;  1JKQ C;  2VUM J;  2JMW A;  3LOC A;  2DMP A;  2PMZ N;  1BW6 A;  2YS9 A;  1P7I A;  2DN0 A;  4DYC A;  2E19 A;  1AHD P;  1EF4 A;  1GV2 A;  2ZB9 A;  3NAU A;  1T56 A;  3OIO A;  1MH4 A;  2FD5 A;  1BJZ A;  3GTJ J;  1O4X A;  3RKQ A;  1WPK A;  3BG5 A;  2ID3 A;  3HOX J;  4UUT A;  4A3E J;  1Y1W J;  1RPW A;  3TW7 A;  1RKW A;  2WB1 N;  1ZGW A;  1K83 J;  1ETY A;  2DMT A;  1JGG A;  3FK7 A;  4IEJ A;  1AKH B;  2XGE A;  3DCF A;  1JTX A;  2KDZ A;  1QVU A;  1VFC A;  3S15 J;  1MBK A;  2N8G A;  2NS7 A;  3HB9 A;  2JWT A;  3HGG A;  4FTH A;  2HQ5 A;  3JRA A;  5K7H A;  2G0E A;  3FK6 A;  1DU6 A;  1I6H J;  3W6V A;  1HDP A;  2ME0 A;  2COB A;  3SDG A;  1JT0 A;  4MFE A;  2EZI A;  5JLW A;  1LE8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...