3A01A

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords Homeodomain-containing protein
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 26
structure length 78
sequence length 78
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01A00
5IYBJ 2NVYJ 3OSFA 4M3FA 3BR2A 3S2DJ 3GTQJ 1HLVA 3CCYA 1I3QJ 1VI0A 1ZKGA 2LVSA 3ZQCA 1LE8A 1HCRA 4GFBA 1H89C 2EZKA 4V2GA 4CYCB 4A3LJ 2ID6A 2OPTA 3M4OJ 2NOGA 4A3JJ 2TRTA 3WHBA 1JTXA 2KDZA 1I50J 4FCYA 2K9NA 3FIWA 2CQXA 4JYKA 3HM5A 2LLKA 3FKIJ 2CUFA 2DA6A 5F0HA 1TWCJ 4C3HJ 2CU7A 2FD5A 3GTLJ 1WI3A 1IGNA 3M3YJ 3C2BA 4AUXA 4M3GA 1LE8B 1O4XA 4D7MA 1ETOA 5K7HA 1TC3C 1ETWA 2X6OA 2Y0SN 3BQYA 1AHDP 1S7EA 5F04A 1MNMC 2MSYA 2WAQN 4FE7A 3D1NI 2AHQA 2XRLA 4MFEA 1RR7A 4EEFG 5IPAA 3VPRA 4A3MJ 2QCOA 3W6VA 1JUMA 2X9DA 3HBLA 3L1PA 3ZQLA 5FLVA 2R5ZA 1CQTA 3F0CA 2R5YB 2PMZN 2TCTA 4QSHA 4C3JJ 1B8IA 1MSEC 2H8RA 1G2HA 3RKQA 1ETVA 3ZQFA 5FLMJ 3A01B 3GTOJ 2XB0X 4L5EA 3WHCA 2LP0A 4LOCA 2HOAA 1XS9A 4BXXJ 5EF6A 3BTJA 2AO9A 3S1QJ 1JUPA 3FK6A 1ZQ3P 2VKEA 4MLOA 2DA2A 3JRHA 2IBDA 1TWHJ 5IYDJ 1IG7A 2NVTJ 3B6AA 1R9TJ 3BR3A 5E3LA 2R0QC 5EZHA 3BTLA 1MBGA 4BY1J 3BTCA 3IH3A 2K9QA 5DTDA 1FTZA 1JJ8C 3BQZA 3K2AA 4A3KJ 3TW6A 3FISA 3TW7A 2DMTA 2LKXA 1RESA 5M5XJ 2R7ZJ 1JKPC 3BR6A 3GTJJ 4A69C 1HDDC 3LSJA 2CRGA 2ECBA 1X58A 2HOTA 1U9NA 2M9HA 3NAUA 5K7FA 3GTMJ 2JK3A 3HOWJ 3NARA 2VUMJ 3JRGA 1B72A 4DYCA 4W97A 1BW6A 1ETKA 2XGDA 1ZGWA 3I4NJ 1GUUA 4S0HB 1YRNA 5IYCJ 1DU6A 4HNVA 1ETXA 3GTGJ 3HGGA 5EGOB 2H1KA 2ELKA 4I76A 2LK2A 1MBHA 1SFOJ 2VPRA 4XRSA 2DMUA 2MG4A 3O8HA 2GBYA 2O7OA 1X2MA 2XGCA 1QVUA 5GP9A 2LY9A 3S1NJ 1IDYA 4I6ZA 1FEXA 1JT6A 1RKTA 1B72B 2Y30A 4M6VA 4UUTA 2M34A 3OIOA 3HOZJ 4FISA 1YRNB 1NTCA 1XG1A 4A3EJ 5C4JJ 3CQZJ 2DN0A 2E2HJ 5C3EJ 3S2HJ 3IH2A 4RDUA 2HXIA 3GBGA 1WCMJ 2JA8J 2CJJA 3RQIA 2LR8A 3BR1A 1WH5A 1ENHA 3GTPJ 4D5CA 5EDNA 3O8GA 1IJWC 1AU7A 4W1UA 2FQ4A 3LSPA 1RETA 3JRAA 1IDZA 1RKWA 1IC8A 2EQRA 2NS7A 2B63J 3QPSA 1I6HJ 1POGA 3ZQGA 5DS9A 1DU0A 1MH3A 1FTTA 3S1MJ 3GTKJ 2YUSA 2R92J 1W0TA 2DJNA 3LSRA 4BY7J 5GPCA 4M3DA 3JREA 5E3OA 2M2EA 3PO3J 4JP0A 5J1RA 1D5YA 5GPAA 2YS9A 5FKOA 2XPUA 3LNQA 3S14J 1SANA 1MSFC 2R93J 3B6CA 4BBSJ 1NK3P 1Y1VJ 2M8GX 4IEJA 5F0FA 3JRDA 5IP6A 3BT9A 1FJLA 2JA6J 4XRSG 1E3OC 1BW5A 1Y1WJ 1TWAJ 4RBOA 2JJ7A 4G12A 4QTRA 3IV5A 3HOUJ 1GT0C 2DMQA 3E7LA 3TP0A 2EZHA 2O9LA 3JRFA 1W0UA 3Q3SA 1ZR4A 2R5ZB 4B1RA 4A3GJ 1OCPA 1RPWA 5JLXA 1B8IB 2HYJA 4XK4A 4C2MJ 4IHXA 1U8BA 2JA7J 1AKHA 4MFDA 1Q1VA 3TEDA 5J3LA 2XSDC 2VKVA 1HDPA 1U9OA 2DA1A 4A3IJ 1HF0A 5HODA 1T56A 5K7ZA 1H88C 1K61A 1HOMA 2E2IJ 1BA5A 2DA5A 2ME6A 5EEAA 3HGYA 2E1OA 2GLOA 2X48A 1ORKA 2LFBA 5J1UA 3I4MJ 4JX4A 1JKOC 3HOXJ 2WB1N 1QVTA 5FKMA 1MBKA 1VNDA 3ZQIA 4D7NA 2E19A 3H3VK 2WV1A 1BJZA 3ZQHA 3SFIA 1ETYA 3LSGA 3BG5A 1QRYA 2HDDA 4DYQA 2XB5A 2MW8A 1GVDA 2DMPA 3S1RJ 2CUEA 3JRCA 2I10A 5C44J 2FJ1A 2Y9YA 1TWGJ 1Z77A 3RZOJ 2NS8A 3A02A 1F36A 5BNGA 2FX0A 3BTIA 4A3FJ 1F43A 3A03A 2IEKA 5M5WJ 2Y31A 5EG0A 3BG3A 3QQAA 1U78A 9ANTA 1MBJA 1Z0XA 1ZTRA 2EBIA 5J1YA 4J19A 1QPIA 4QIWN 2OF7A 1A6IA 4BKXA 1IRZA 1BL0A 1WGXA 1GDTA 1WH7A 2NVQJ 1UMQA 3HOVJ 4DW6A 1APLC 1ZR2A 2DA4A 4ABZA 4DZPA 5IP7J 1EF4A 3QPLA 2ME0A 2COBA 3OOUA 2HXOA 1OJLA 5EG0B 2LTPA 3CDLA 3TP3A 2DA7A 3PM1A 1IV6A 2RAEA 3S17J 2Y2ZA 1GV2A 2CQQA 3LOCA 2XPWA 1XC5A 5FJ8J 2Y9ZA 1MBEA 3G1LA 2D5VA 2DMNA 5F27A 4A3DJ 2LD5A 3SDGA 5M3FJ 2K40A 3BG9A 3BR5A 3DEWA 4M3BA 3G1OA 2R5YA 4DZJA 5M3MJ 3HOYJ 3MKLA 2JA5J 5IP9J 3JR9A 1JJ6C 4IHVA 3PO2J 1P7IA 2K9SA 4FE4A 3A01A 3JRBA 4XRMA 3RZDJ 2L9RA 2ID3A 5FKKA 3JRIA 3SJMA 1LFBA 1ITYA 3Q0VA 3MVPA 5EYRA 3HEFA 2ECCA 3S16J 3G1MA 2E2JJ 1ZK8A 2YU9J 3UKGA 2O8KA 2N8GA 4JX5A 5FKNA 1JT0A 3Q0UA 4XICA 2GM4A 3CMYA 5IOYA 1ETQA 2MGQA 4B4CA 3OSGA 2HOSA 5EZGA 1P7JA 1T33A 3BR0A 4AYBN 2IAIA 3Q0WA 2HQ5A 2P81A 2QF7A 4AC0A 1MH4A 2KT0A 3HDDA 1PUFA 4Y7NJ 5JLWA 3MN2A 3K7AJ 1X2NA 4A93J 1TWFJ 4IHYA 5F1JA 1IUFA 2M0CA 4A3BJ 4FTHA 1NK2P 3DCFA 2JMWA 2G0EA 4A3CJ 2DA3A 4B3AA 3IH4A 5F08A 4BBRJ 1K83J 4DYRA 4X6AJ 4XIDA 3HKZN 2L7MP 4MO7A 3ZOBA 4X1EA 1FIPA 2EZLA 2XGEA 2HI3A 2W48A 1GV5A 4C3IJ 3H0GJ 1JTYA 3HB9A 1VF9A 1AKHB 2L7ZA 4V2FA 4UUSA 1PUFB 1JKRC 1OFCX 4Y52J 2JN6A 5EGOA 2JWTA 1A5JA 1MBFA 2NVXJ 5IOZA 4MIMA 5C4XJ 4JX6A 2L0KA 1OCTC 2EZIA 1UHSA 3FK7A 4D5FA 5FKLA 1VFCA 5M5YJ 1UG2A 2L7FP 4IHWA 4CYCA 5F0CA 1JUSA 1WPKA 1JGGA 5E3MA 5E3NA 2ZB9A 3S15J 2VI6A 4UUSB 1FIAA 4M3EA 1H8AC 2DTZA 2EH3A 4NDLA 2XPVA 1LFUP 1JKQC
chains in the Genus database with same CATH superfamily
2Y48A 1TLHB 2M7AA 3BR2A 1HLVA 3CCYA 1UFMA 1H89C 3OYDA 2DOAA 2KIFA 1R00A 1MNDA 2FBKA 2CV0A 5HLGA 2GA2A 3WTWC 2X6WA 4IRHA 4XKWA 3T1BA 2KIMA 3M4OJ 1Z9CA 3FMSA 4G9YA 3J7ZI 1Z3YA 5DCMA 4LG0A 2KRFA 1I50J 4RAZA 3P9IA 1WWXA 1GXQA 2LLKA 1OR7A 1XGOA 3H1CA 1TWCJ 1OISA 3RI4A 2JSPA 3WG9A 3C2BA 4U87A 1LE8B 2KISA 3VSLA 3L09A 1R1UA 3KLNA 2EB7A 3QU6A 3K70D 1X3UA 3KP7A 1RIOH 1TC3C 2OC6A 4I98B 2Y0SN 4KT6A 4E70A 1AHDP 4HSTA 4LLGF 4EJUA 3OYIA 1WRJA 5HS9A 4DOZA 2WAQN 2GOMA 1XMXA 2CV2A 1KGSA 2PMZA 5LD2C 2LC2A 3REOA 5EEGA 2MH2A 4EEFG 1P6RA 4NB5A 2G7UA 3R0JA 3K69A 4L9JA 5BPIA 2VBZA 4KYWA 3PNTA 3RPUD 1CF7B 3FXOA 2VJ4A 2Z16A 3F21A 2UUZA 1VQ5I 3M8FA 4LB6B 3ZQLA 2XAFA 2KMUA 5ED4A 4CYDA 2K7LA 1YITI 2CYYA 2R5YB 3WU2C 1LB2A 3H36A 1B8IA 2TCTA 4QSHA 1R4MB 4KA4A 1T8IA 2XRNA 4BEHB 3C2GA 2XB0X 4Q5SF 1OR7C 2GWRA 3TKYA 1X1BA 3OYJA 3BROA 1N77A 4CSWA 1ZGJA 1YS6A 5E17F 3QU3A 2VXDA 2M7BA 3H5NA 2J5OA 1R1TA 1Y0UA 3WGIA 3CC4I 4MLOA 1USSA 2DA2A 2E34A 4MEXF 5E8IA 1IG7A 2LSOA 2BHYA 1WJEA 2KFDA 3RDIA 2HYFA 2JRMA 3OYLA 4RM2A 3HHGA 2HQNA 3SDBA 5H2FC 2ZC2A 5E3LA 2R0QC 2DI3A 2PMHA 3DEEA 2DDAA 2R7VA 3CF2A 1DQUA 3WU0A 1TZLA 2GIVA 3TW6A 5D4RA 5J6XA 1Y56A 2P5VA 4G8XA 2HOEA 3CLOA 2HKOA 2OCCH 2Z33A 2R7ZJ 2DK8A 2RC4A 1JKPC 3E0JB 1WJBA 1ZELA 3EUAA 3GTJJ 1BC8C 4HV5A 1K78A 1FYKA 3KEQA 1ON2A 2L02A 3F8CA 4ENMA 4HBLA 3OYFA 2FUG2 2M9HA 3KIOA 3NAUA 2KDOA 1QA6A 3GTMJ 1S72I 3HOWJ 1ZARA 2V9PA 2GQQA 2FRHA 3JRGA 5CQGA 1ZGWA 1J75A 3I4NJ 3NWTA 4S0HB 2G9WA 2OAZA 3LA7A 3GTGJ 2P8TA 3TOBA 4UVCA 2UXXA 4DBQA 2LK2A 3KP5A 4KUMA 2FEZA 2MC3A 1ZH5A 2ZSIB 2VPRA 3N05A 1ZRCA 2IT0A 4WWCA 2AXTC 1HBXG 4CCNA 3BC8A 5D8KB 3K2ZA 3O8HA 1MMAA 2GBYA 2O7OA 1W36D 1FMVA 1FLIA 4M6XA 3EETA 4AU7A 2XGCA 3Q5FA 5ILVA 1QVUA 1XMAA 4A12A 4I02A 1BOBA 1FZPB 3S1NJ 1IDYA 4I6ZA 5DCFA 3AL0C 4O5VA 1JT6A 1OQYA 2ZJRF 4Q4ZF 1W4MA 2EILH 2BY2A 4JOMA 1B72B 5J4YA 3OIOA 2ZNYA 4M9XA 1KU7A 2ISYA 3HOZJ 1NTCA 4GGGA 3S3OA 1UHMA 2D1HA 5DM6F 2EFOA 5C3EJ 3S2HJ 3GBGA 2RQPA 2VT2A 2R7DA 2LR8A 3LAPA 2OJED 4GCVA 3BZ6A 2CW8A 1S6LA 1YHQI 5K5OA 1IJWC 1AU7A 4MHGA 2DYRH 2VJJA 4K2EA 1RETA 3LSPA 3JRAA 4L0YB 3RYPA 3BCBA 4UXNA 2D45A 2F5EA 4RMNA 2B63J 4F55A 5DCMB 1I6HJ 1E17A 4KJZA 4LG0B 1POGA 3ZQ7A 4LFUA 1RRJA 1SAUA 3CLQA 2R92J 1W0TA 3P5JA 4YFKF 4OWRB 4EJOA 3LSRA 2GAUA 3EYIA 1SVOA 5DUIA 4IQ4A 2VE8A 2M2EA 4JP0A 4B43A 1D5YA 3CDHA 4N4NB 5E1WA 4BACA 1REPC 1ZREA 1WJCA 2WADA 3S14J 3UNGC 2E5ZA 3B6CA 3Q9SA 3ZMVA 4HV6A 2VQLA 5F0FA 3BT9A 5E79C 1BW5A 4YRVA 3PQJA 1LNWA 1O3QA 4DQ2A 4QTRA 5JHUA 3CCSI 3PFIA 4ON0A 1GT0C 1DP7P 1U2WA 2DMQA 4HLYA 2VIXA 1R4NB 3QODA 4YG2F 1XGNA 1F1ZA 1D1AA 1FOWA 4A6DA 1O3TA 4B1RA 4NC8A 4AIJA 4U7DA 2JPBA 2WY7Q 3SEZA 1B8IB 2F48A 3T5XA 4G6TB 1U8BA 1AKHA 4BUPA 4PJ0C 1R7JA 3W3CA 2GIZA 2ZKZA 5J3LA 2WB1A 2XSDC 4EJTA 5L3BA 1TT0A 1YTYA 1H88C 4A2UA 1P9QC 4FETA 2V9VA 2E2IJ 1BA5A 2HZDA 2GOXB 2DT5A 2E1OA 4EATA 1VQMI 4RLQA 2L9NA 3NQOA 2X6XA 1O3RA 4UUVA 5K1YA 1X4OA 4JX4A 4PUSA 1I5ZA 2TDXA 4EVIA 3ZP5A 1VNDA 3SQNA 2DT6A 2DODA 1ONVA 2EA2A 3OYAA 1D0XA 3CMEI 5KNLA 3AL0B 3K4LA 1ZAOA 2KKOA 1RUOA 2G7HA 3LSGA 3O2PE 2HDDA 4BE0A 2IGMA 4DYQA 4EJVA 2MW8A 1GVDA 3ZR8X 4B44A 3OS1A 1W1WE 2L4AA 2X0LA 2Y9YA 2AQFA 1YJWI 1K78B 2P0WA 2QVOA 2ZJQF 1IN6A 2NS8A 2WC2A 4CCOA 3A02A 3V42A 2M3AA 2IS6A 2FX0A 3BTIA 1I3AA 4NC7A 3JSOA 1HA8A 3ELKA 1I1GA 3GX4X 2Y31A 1O7FA 2PJRA 3RKXA 2VPLA 1MBJA 2JA2A 4J19A 2OQGA 4IZZA 3PL8A 4QIWN 1DPUA 4XL9A 3KEOA 4Y4RA 1IRZA 1FBQA 3TDUC 1K6YA 1T95A 3GZNB 1APLC 1ZR2A 2F4MB 4Y15A 2PJPA 3IUOA 3BP8A 1LVAA 5IP7J 4F52A 1EF4A 2V7FA 3BG6A 4O6JA 2VLAA 3OOUA 2IVMA 1QGPA 2HXOA 5B1AH 1WVRA 3CDLA 1K4SA 1ZGAA 1TBXA 4P1WA 1RUNA 3QYBA 4M9ZA 5FD5A 1BC7C 2WBMA 2A6HF 5E8GA 1TL8A 2Y2ZA 3VOEA 3AKZA 4B3XA 4BL0B 2XPWA 2Y9ZA 2MD5A 1FOKA 1MBEA 2VE9A 1L3LA 1WI9A 3KP3A 1YYVA 1SD7A 1EH7A 3FBNB 3CCQI 1HQCA 4AM3A 1R71A 3QP6A 4A3DJ 2R7SA 4HQEA 5M3FJ 2K40A 2MC4A 2CUZA 3G73A 1QQIA 3G1OA 3SFZA 1EH8A 3SXYA 1ON1A 4F91B 1EH6A 4DZJA 5M3MJ 2W24A 5HLHA 3KX2A 2E5NA 4UVAA 1QO0D 3A01A 3CCMI 1J9IA 2NVUB 5D5VB 1U3EM 2RNJA 4FQGA 3DLLF 4MTEA 5EYRA 2R4GA 1F4KA 5D4SA 4GO1A 2XSJC 3BJOA 3LMMA 4RGXA 1G8XA 2H09A 3CCLI 2QGUA 2L9VA 2N8GA 3CP8A 3QOEA 4JX5A 5FKNA 1JT0A 3Q0UA 4LD5A 5D6FA 1I27A 2MGQA 2FMLA 3FMRA 3L7WA 3L2CA 5EZGA 1T33A 3BR0A 3CP2A 2IAIA 3ZGKA 1SEUA 3QPHA 3J7AY 4AC0A 5HS8A 3S32A 2BY0A 3FXKA 5JLWA 3L2QA 4CGZA 3MKWB 3BPVA 1X2NA 1GLNA 3SYTA 4A93J 3K4BA 1TWFJ 1R22A 5J4VA 1IUFA 5L3GA 2HGCA 4FTHA 5CVIA 2EV5A 1NK2P 2JMWA 1AWCA 4AWXB 3H9JA 2VQHA 3DQVC 3MWMA 4LK0F 4BBRJ 4QPOA 1IXSB 1LQ1A 2HTSA 4XIDA 4MO7A 1FOXA 2OCEA 1B9NA 2HI3A 1W7PA 3V4GA 4LIVA 3N97A 4L0ZB 1AKHB 3E3VA 3GYHX 2X85A 1XGSA 2VT3A 3SZPA 2WY8Q 3GFIA 3ABUA 2JWTA 1VZ0A 2ZXJA 4RGSA 4P96A 1QBJA 2CS3A 1YJ9I 1HSJA 3U21A 4B8XA 2H27A 5C4XJ 3WTXC 2RN7A 4N9HA 2AXLA 2C6YA 1X1PA 2EZIA 3BLYA 1TQIA 1S7OA 1UHSA 2XV4S 3K0LA 3ML6A 4U88A 5FKLA 1VFCA 1AOYA 2XHKA 3M7GA 4LGWA 3OYNA 1UG2A 2HNHA 1QPMA 1PDNC 2BW3A 5E3NA 2R7XA 2CFXA 2CQNA 3TBIA 4UUSB 2JQ7A 3OS2A 5DDGA 1T98A 3HRSA 1Y6IA 2DAOA 2K9LA 1JKQC 2DPDA 2NVYJ 4KITB 2V1NA 1BR2A 3NRVA 5B1BH 4CHUA 3HRMA 2V1DA 3D5SC 1SFXA 3HRUA 1YG2A 3HTUA 3S3MA 5TJJA 1VI0A 1ZKGA 2FNAA 2JUCA 4TV7A 4U0WA 4CICA 3ZQCA 1LE8A 4V19K 2EZKA 3ZPLA 5E18F 1DPRA 1XX5A 4CYCB 2V4JC 3DV8A 2HQAA 5HDKA 4A3JJ 2QZ8A 4PJMA 1JTXA 5L3FA 4DNCA 2LY1A 2KDZA 4ZZDA 4ZYAA 4FCYA 2PJRB 3G6EI 2CQXA 3HM5A 4E7HA 2QM3A 2R7UA 1IZ1A 2CUFA 2DA6A 5F0HA 2CQKA 2CU7A 3GTLJ 3ZCOA 1XCVA 4ZTFA 1BR1A 3M3YJ 2IJLA 3OOPA 1S7AA 3BY6A 1O4XA 2DT7B 4D7MA 4MNUA 3FXUA 3RPQA 1XD7A 2HS5A 2H6BA 1ETWA 2X6OA 1S7EA 2M45A 5JR3A 4BEHA 4F92B 2MSYA 1ZRFA 3R61A 4FHTA 3CF5F 1FSHA 2XIGA 2CV1A 4Z6YA 2DU9A 4P9FA 3W6VA 4HRIA 1JUMA 2X9DA 1O3SA 4L18B 3HBLA 4BNCA 3E6BA 5D6EA 1OMIA 2R5ZA 3CC7I 3KZIC 2PFBA 2PMZN 1MSEC 2WAEA 4L5IA 2GXBA 1ETVA 2KRCA 3VYSB 3A01B 3GTOJ 2ACJA 3HOSA 4L5EA 3WHCA 2L54A 2LP0A 4LOCA 1LDDA 2HOAA 3DTIA 1XS9A 3OYBA 5EF6A 3HTSB 4Y17A 3E6CC 2AQEA 2VKEA 3FHZA 1FSEA 1WJDA 3J81K 2IBDA 5E1ZB 1ZG1A 2XAUA 4UV9A 4ZYHA 5GAHJ 1MZBA 2Y69H 3A0BC 2NVTJ 1XDUA 3WE2A 2A69F 2ZXIA 2CO5A 2XROA 5EZHA 2VOPA 2W85A 2BBYA 1KU3A 3IH3A 1P92A 3K6GA 2K9QA 3K2AA 2MLGA 4E7ZA 3FISA 3IAS2 4HDVA 2MH9A 1E2XA 1OYYA 4HAMA 2LKXA 1RESA 2E35A 4KNYA 3DFGA 4IF4A 3WTUC 3BR6A 1FWZA 4BDZA 4IO9F 5LFAA 4KN4X 3GO5A 2ECBA 4HF0A 1FBSA 4QWQA 1NG7A 3NARA 2IS1A 1B72A 2P6SA 4DYCA 1W7PB 2XGDA 4CUGA 5BS6A 2EINH 4E7KA 2HVSA 2VODA 5BQTA 4NHJA 1ETXA 4HZFA 4I76A 4J01A 4KMFA 1SFOJ 3HC7A 2DMUA 3MZHA 5HLTA 2HPMA 3K4CA 1UB9A 1KU2A 2X1EA 5GP9A 3I58A 3MAJA 2L01A 5EEHA 1R58A 2BW3B 2FBIA 2FSWA 3WE3A 1LDJA 2Y30A 4M6VA 4UUTA 4EM2A 3COAC 4XOPA 2I8DA 4FT8A 2CSOA 5C4JJ 1J2XA 4NQWB 4HNTA 1ZG5A 1Y39A 4LMYA 3KFWX 4PK4A 4ESBA 2E2HJ 1Y8QB 1BI3A 4RLFA 3FMQA 4PSWA 1HKTA 2JA8J 2CJJA 3RQIA 4CA0A 2B0LA 1Y0NA 4G7HF 4CZCA 1BBYA 5EDNA 1NG6A 2Q1ZB 2QA4I 4Q48A 4W1UA 4ANJA 4R79A 1IDZA 5FRMA 1H9GA 1STZA 3EUHA 4YEJA 4XLPF 1BR4A 1WFXA 2K3PA 2NS7A 3ZMSA 4OIQF 5D5UB 1FPQA 4Y33A 4XLFA 3OYCA 5J40A 5IT3A 1FTTA 3S1MJ 2V1XA 3GTKJ 4HX8A 3CO6C 2CFOA 5FFXA 2DCEA 2DJNA 2M5WA 1J59A 4IXAA 5GPCA 2K86A 3GZ6A 4HDUA 3JREA 3K4JA 5E3OA 3PO3J 5J1RA 1PYVA 2KPMA 2LMDA 2HKXA 2XPUA 4QLCU 5L3EA 3ZMDA 2R93J 3HSFA 4BBSJ 1NK3P 1Y1VJ 3J7AO 1Q1HA 1P2FA 2OV7A 4OIPF 3WTVC 5IP6A 2W00A 3IKVA 2KIUA 1FJLA 3PFYA 4C2TA 1Y1WJ 1IXRC 3GWZA 3EDPA 2K5CA 2JJ7A 4G12A 2XF7A 3VDXA 3M1CA 2F5VA 3BJAA 2UXNA 3EUHC 4A0YA 3JRFA 1PP7U 2R5ZB 2EA4A 1OCPA 1OCCH 2A05A 3DKWA 3W2VA 4A3GJ 5JLXA 1YLFA 4XK4A 4IHXA 4JK1X 1U8RA 2VL8A 4OAZA 2BXYA 2QWWA 3O6BB 4A0ZA 3CCJI 3VFZA 1Q1VA 4PZJA 4A3IJ 1TNTA 3TO7A 2ETHA 3DKYA 3CO7C 1G6NA 5HODA 1T56A 5HLIA 5K7ZA 1N78A 4XSZF 3OYEA 2XDVA 3L2VA 1HOMA 5EEAA 1DDNA 1FT9A 3HGYA 1HW2A 2HWVA 3RCOA 1ACIA 4MQ9F 5JVTA 2E1MB 1ORKA 2ZFUA 2DQRA 1J0RA 2LDUA 3I0TA 4D0PA 2IS2A 2WB1N 3CDIA 2PG4A 5FKMA 4F7ZA 4M74A 1MBKA 3ZQIA 4D7NA 5LRSA 4FX0A 5BOXA 3JW4A 2CUJA 2YR2A 4BQNA 2WV1A 3QP5A 4LITA 4P55A 1BIAA 3ZQHA 2F4IA 2FU4A 1QRYA 2XB5A 3FZVA 2EFNA 2F5DA 5CVVA 2LYCA 3S1RJ 1OCZH 2I10A 5C44J 2FJ1A 2RVCA 4BQAA 3HOTA 1FMWA 2XF5A 3RZOJ 4G6QA 2HVQA 1F5TA 3IRQA 2VOOA 2B7EA 2XAJA 1I1SA 3H5RA 3MKZA 3TQNA 4M9SA 9ANTA 1Z0XA 1ZTRA 5J1YA 3ZMUA 3PNYA 2MYSA 1A6IA 1BL0A 3L2WA 1WH7A 2NVQJ 3KEYA 3JAMK 4DW6A 1ZLKA 4O3MA 1BOAA 2QQ9A 4DZPA 4BHCA 3KZYA 5L3CA 2ZO4A 3KPHA 2ME0A 1YW7A 2COBA 1IO2A 1M1EB 3WTYC 4DJAA 1KYZA 3K4NA 4BDYA 2XF6A 1R36A 4Y3OA 5KAFC 3ABLH 2DA7A 1FP1D 2DFHA 3HG9A 3PM1A 3TOAA 1WZ2A 3LOCA 1XC5A 5LGUA 2P5KA 1EKEA 3E5XA 3G1LA 5CVUA 1LVKA 4KFCA 3GXOA 3OIQA 1UG0A 3ONQA 3GUDA 2MLKA 5DM7F 3IC7A 2LH9A 2VBYA 1XSVA 1KONA 1PP8F 3CMAI 1IN7A 2WWYA 4IHVA 1P7IA 2K9SA 4IOAF 1ZHFA 3JRBA 3RZDJ 4BQOA 2L9RA 4E7IA 2GZWA 2ID3A 2OZ6A 5TRDA 4AYBA 1R5HA 4BXUA 3SJMA 1ITYA 2HDCA 4HPQA 3Q0VA 3H9GA 2D1VA 1SMTA 3MEXA 1YX3A 1V4RA 1WKMA 4PJJA 5KHDA 4UVBA 2ZSHB 1OPCA 2O8KA 5FO5A 2IS4A 4XICA 3LSKA 2GM4A 3G2BA 2H94A 3PSIA 3LFUA 4CZZA 5HDNA 1P7JA 3HSRA 3RPUA 3Q0WA 2KHMA 2QSFX 3RYRA 2P81A 2QF7A 2A61A 4P5OA 2Y0MA 3MZ8A 2Z3YA 1Z7LA 4Y7NJ 5B5EC 4OIOF 3MN2A 3K7AJ 3ZMZA 4MTDA 1K79A 3GF2A 3DTEA 4A3BJ 2PX9A 3I71A 1ZYRF 3HPGA 3K1NA 5LHHA 4ENJA 3Q9VA 2K9MA 4PSXA 1A36A 4C9YA 3D0SA 2IW5A 4B3AA 1UHWA 2X6YA 4CH7A 2HTJA 3IH4A 3IRRA 4RB0A 1IN5A 4DYRA 4X6AJ 3HKZN 3ZOBA 1S29A 1FIPA 1GV5A 1HKQA 4C3IJ 5LLQA 4UUSA 3DLAA 4V2FA 1PUFB 3PJRA 1JKRC 2LBFA 3S93A 1EV7A 4F93B 1VQ8I 4BAYA 4HF2A 1D1BA 2EIKH 4AD9A 2JZYA 1T08B 2NVXJ 2BVMA 3ZXSA 1BM9A 5IOZA 1RZ4A 4IPAA 4MIMA 2F4OB 3F8MA 1KA8A 2FE3A 3J81Z 1OCTC 1IV8A 2NRAC 2XC7A 4D5FA 2VC0A 3W6KB 1WQ2A 1PVEA 4HX7A 4G7ZF 3A2KA 4CYCA 3J80K 5F0CA 1ZRDA 2LNBA 5E3MA 1CGPA 5A2QZ 2IA1A 3T8TA 3ROUA 2BEOA 2Z2SB 4M6YA 3DTKA 5GTHC 1V55H 3CUQA 2XPVA 3OY9A 1GXPA 2LF7A 5IYBJ 3OSFA 2VXZA 3B02A 2YSRA 4M3FA 4IJAA 3S2DJ 2UV1A 2LG4A 4BS9A 5DV5A 2ESHA 3F72A 4CO8A 3AG4H 2L5QA 3QPTA 3LWFA 2HZTA 4A3LJ 2QQBA 2NOGA 1QZYA 4I99C 3WHBA 1VQ7I 2VBWA 3HUGB 3F9KA 3T0YA 3DP7A 2QQAA 2EV0A 3V7RA 3M07A 4E6KG 5KK1A 4JYKA 3DBRB 3FKIJ 2ZJPF 4RA2A 5DYMA 4C3HJ 2FD5A 1JGSA 4RGUA 4OAYA 1IGNA 4OOIA 1VQLI 1T2KA 4AUXA 4M3GA 2BE5F 1G4DA 1HXDA 3DPLC 1ETOA 4FASD 3MFKA 1VQ6I 2I5UA 2Z99A 5K7HA 2JSCA 1D0YA 4I09A 4U0VA 5LRRA 5F04A 3CUQC 1MNMC 3F8NA 2KZVA 1QZEA 4FE7A 2CW0F 1IXCA 2XRLA 1RR7A 1MJ9A 2H1LA 1KYWA 1R5ID 2F2EA 5IPAA 1MKMA 3IWZA 3P9KA 3VPRA 4XLAA 5HNHA 2R7WA 1FYLA 4A3MJ 4LIUA 4YIRX 3E6DA 1IAWA 1A31A 2V9KA 3SZGA 1J7KA 5FLVA 3I59A 3O3KA 3GLXA 3TL4X 4XN3A 3F22A 1W36C 2O8XA 2HQRA 4YFXF 1OYIA 3IL2A 3RKQA 2A68F 3ZQFA 5FLMJ 3BDDA 3KP6A 1V54H 1QNTA 1BI1A 1TW2A 1VTNC 2BXZA 4BXXJ 1V5EA 3HKZA 3BTJA 1IN8A 4CDGA 2FOKA 1N25A 2AO9A 2CH0A 3S1QJ 1JUPA 1ZLJA 2QSGX 4A6EA 3JRHA 4EQQA 4PGHA 2HYGD 4GYGA 5IYDJ 4P9UA 3ABKH 1BN5A 1LUJB 2V26A 2BYVE 1V3FA 3WTZA 2O6GE 2KRHA 2JVGA 3FXQA 2KQRA 2W7NA 1MBGA 4BY1J 1Z3XA 3ZQQA 3E97A 3N4MA 3L2RA 3WTTC 5DTDA 4ESJA 4B09A 3BQZA 4A3KJ 3KCCA 2ZXWH 2R7RA 5IT9K 3OWTA 5LEJA 5KAIC 2DJIA 2FA5A 3TW7A 3S2WA 1U5TA 2YX4A 2WA0A 1O7LA 3AG3H 5M5XJ 2QLZA 3K10A 2Z1DA 5CKTA 3I9V2 2FBHA 3LSJA 2CRGA 3ECOA 4A5MA 2QBYB 2DFEA 2QENA 2VUMJ 1P4AA 4W97A 1BW6A 1ETKA 3PQKA 2VONA 1GUUA 3WODF 2PQ8A 5IYCJ 4ENKA 2LBFB 3HGGA 4NQWA 4BQQA 4OINF 4CCJA 2ELKA 2W84A 4L9VA 2IPQX 3FX3A 2BHZA 2DYSH 3CJRB 4U7BA 5ICCA 1E3HA 5IY5H 1Z91A 1X2MA 2R7QA 5H6QA 2RNGA 4I01A 4LLNA 1R49A 2PI0A 1FEXA 2R7FA 1A35A 1ZN2A 4FISA 1YRNB 3BWGA 4OIRF 1U5TC 1XG1A 5D5XB 4B47A 2V6EA 2R7TA 4PFOA 4XLEA 2DN0A 2A5WA 4ZDLA 3FHNA 1X1AA 3CUQB 3IH2A 2HXIA 5TGTA 2ZMEA 3BJ6A 3VYTB 5AIPA 2MA3A 2ZXHA 3BR1A 3F8BA 3GTPJ 3GEZA 4D5CA 1SFEA 2YU3A 3WGGA 1FBUA 1BIBA 2K3FA 4D1QA 4BU2A 2JVHA 2KJBA 3PUBA 1MDMA 1MJBA 4XKVA 4NUBA 2STTA 1IC8A 2EK5A 2Y75A 1H0MA 4HYEA 4ZTJA 2CMPA 3V7SA 1YIOA 1YS7A 2NAZA 4UV8A 4XNFA 3ZQGA 5DS9A 1DU0A 5K5QA 2V1UA 3QYFA 5JVGF 4AIKA 1J5YA 2YUSA 1ERDA 2LY2A 2W57A 3WG7H 4ZYEA 3FM3A 5TISC 4BY7J 4M3DA 1FX7A 4JQFA 5KVRA 4BJTA 2ICWG 2UZKA 4IX7A 1UCRA 5GPAA 2YS9A 5FKOA 3CC2I 1S5LC 1SANA 3D5LA 3CZ6A 2R3SA 4AIDA 2ZMEC 3ZRGA 2XAQA 2M8GX 5KCMA 4IEJA 3JRDA 4LLLA 3H0DA 4XRSG 4EGZA 1KQ8A 4EGYA 2KP6A 2EJRA 5CPRB 3PUFA 3M1EA 5GAEJ 3I64A 3E7LA 1SFUA 5CVRA 3LQRA 3GFJA 2W4SA 3CJQB 3S3NA 2O9LA 4E7JA 4EJWA 3I59B 1B4AA 1D1CA 1RPWA 3M8EA 4YIFA 3ULQB 3K1PA 1W5SA 5BMZA 2XUBA 1IUYA 1G59A 2XGXA 2IA2A 2B9SA 2JA7J 1IRXA 4MGRA 4GDFA 1YOVB 3TEDA 2PBIA 2VKVA 1HDPA 1U9OA 3W6JB 4YELA 1BJAA 4UB8C 2XKPA 4H0EA 1QU3A 4QPQA 2VBXA 2X4HA 3AG2H 1K61A 1OCOH 1SC7A 2ME6A 4BE1A 3DU5A 3R4KA 4IL6C 2GLOA 4HW0A 5FGMA 2X48A 1UAAA 2YX7A 4Y13A 3MMYB 3DU6A 5F6FA 3HOXJ 4HQMA 1QHGA 1QVTA 5J47A 2PMUA 4ZJZA 3FXRA 2E19A 3M8JA 4XM3A 2DFFA 3H3VK 1BJZA 4NC6A 2NYXA 1HKSA 1U5TB 2M8EA 2ADUA 4RAGA 2DBBA 3C1DA 2E1MC 2CUEA 4BHBA 1YE9A 4BH9A 3IAM2 4E4HA 1UELB 4CXFA 1TWGJ 4X0GA 1OLTA 2OUMA 1D3YA 3ISPA 3DBLB 3KLOA 1JE8A 4KIBA 2FQ3A 4Z2YA 1F43A 2K85A 3C7JA 6PAXA 1MGTA 2KL4A 4BJ6C 3A03A 2IEKA 5LBQA 2LF8A 5M5WJ 4OMYA 1JXSA 1MMSA 4XR6A 1HW5A 3QQAA 1U78A 3OYKA 2EBIA 4XLCA 2HVRA 1K7AA 1QPIA 1X19A 3G71I 4XKBA 1TT5B 3HOVJ 1W5CC 5ILSA 2DXIA 2EFWA 1BI2A 1R5GA 4LK1F 4ABZA 1WJ5A 3V8KA 1JHHA 2NNNA 3FXJA 3OYHA 2DTRA 5FFZA 2QQ8A 1R1VA 3EUKL 1LKXA 3J80Z 5EG0B 3JTHA 2LTPA 1G3SA 1T6SA 3TP3A 5FLXK 1FNNA 1T0FA 2CQQA 1G3WA 5FJ8J 1IN4A 3MCZA 1G3YA 2ZMEB 3WU1B 4R1HA 3SEQA 2D5VA 2W25A 2P7VB 3IWFA 2W82A 5F27A 2LD5A 1T38A 3SDGA 3HHHA 1ULYA 2CG4A 3C18A 3LSHA 3OV8A 3DEWA 3LA2A 4YFNF 1DP3A 3ZN1A 3ZN0A 1XGMA 1R23A 3HOYJ 1XMKA 3MKLA 4HNUA 1MDMB 5IP9J 3JR9A 2JA5J 2LOOA 2IGOA 1TQPA 1YJNI 3IP4B 4EM1A 2M30A 3CJTB 5FKKA 3JRIA 3HL2A 2P6TA 3ERED 1X3ZB 3PIOF 4WK8F 4LG3A 1B59A 2E7WA 1A6QA 3HEFA 2CGPA 2E7XA 3GZ5A 2Q2EA 3S16J 5J8CA 3OR2C 2X1DA 2O03A 2F6CA 3G1MA 2E2JJ 2YU9J 3UKGA 2BVLA 2DOEA 2EWNA 4WXDA 1YQAA 2MD0A 5LGTA 2XKOA 3A0HC 5IOYA 4ZDPA 5B66C 2VASA 4A0XA 1VQ4I 3OSGA 2DLLA 3ABMH 4G6DA 4XMYA 2XAHA 4AYBN 2MBFA 1T0FC 3I55I 2M1BA 3U1KA 3LSTA 3KYLA 1PUFA 3AFHA 1S9HA 2DDBA 5F64A 2ZCWA 3QWLA 3R0AA 4I2OA 5F1JA 1HW1A 3LAJA 2OZUA 1Y8RB 3I56I 3DCFA 4L5JA 3L00A 2DA3A 3BCAA 3ASOH 1ODDA 4NBQA 3JCUC 4XKCA 1K83J 3DBHB 3RKYA 2Q8KA 5JI6A 2L7MP 4X1EA 2EZLA 2XGEA 2W48A 4IKFA 3H0GJ 3FWEA 1VF9A 3HB9A 3K4KA 2L7ZA 4PDKA 3WTSC 1P4WA 1OFCX 3KE2A 1WJFA 2JN6A 4XONA 5EGOA 3UR3C 2K27A 1GVJA 1YW9A 3FXLA 1Z7UA 4ESFA 2VN2A 3OL4A 4JX6A 3LFKA 4N4OB 5ERIA 1H9TA 1N75A 4N9IA 2R7OA 2RKHA 1BI0A 5L3DA 4PJLA 2L7FP 2O0YA 4HLXA 4IHWA 3U2RA 2JTVA 4XLNF 1S8NA 3SZTA 1JUSA 4IRGA 1JGGA 1Z1DA 3ABTA 2DW4A 3A1YA 3GVAA 4ITVA 2CWEA 4KIFA 2W1OA 1FIAA 3HUGA 4XSXF 1H8AC 2DTZA 2EH3A 2STWA 4NDLA 4AIHA 2QSHX 5IT9Z 3CJNA 5DD4A 2DPUA 4RS8A 2LRDA 2ZBKA 5DUKA 2VKDA 2FXAA 2EFQA 2K02A 3GTQJ 1DGRM 2HEOA 3VYRB 1I3QJ 1HCRA 4GFBA 1B1BA 2HFHA 1W5TA 2LVSA 3K4MA 5E1XA 3H35A 2L2OA 4V2GA 4I0AA 1SFKA 2L7KA 2ID6A 2OPTA 3TO6A 2GXGA 2TRTA 3KYDB 3RQ4A 2E60A 3DWLE 2Y0SA 4KISA 2K4JA 4N0BA 1OYWA 3H3UA 2K9NA 3FIWA 2WAQA 1X1CA 2QUFA 3OIPA 4I0BA 4U0YA 1S3JA 1WI3A 3I5UA 5D8LB 4HSRA 5HS7A 5AONA 2V79A 1V5GA 4ASNA 2MABA 4RB3C 2IRFG 1Z05A 3BQYA 3D1NI 2UWMA 2AHQA 2M87A 2VKHA 4MFEA 1XPXA 4ZYGA 4II3A 4AVPA 1WSUA 2XVCA 4L9TA 3CCEI 4WCGA 3VWBA 2QCOA 4PFPA 4II2A 3FM5A 1I6XA 3F8FA 1MMNA 2ELJA 1XTAA 3L1PA 2E1NA 1LJ9A 3I53A 3C3WA 1CQTA 1E0EA 3H92A 3F0CA 2HDWA 1IRFA 4C3JJ 2QKMB 3RJPA 5J8FA 5FD6A 2H8RA 1G2HA 1MMGA 2BY1A 4BYYA 2FMYA 3LSMA 2F5FA 1SD6A 3HSEA 3RIRA 3BOQA 3EQLF 2KIQA 1U6GA 2LKSA 4RM3A 1IW7F 3BZKA 3DPTA 3FK6A 2Q2EB 3VEPA 1W7PD 4S04A 1ZQ3P 2IGKA 2GA1A 3HJEA 1MJAA 1TWHJ 3EYYA 2L9SA 5CJ9A 4OMZA 3G4SI 3H5AA 3B6AA 4CCLA 3VSKA 1R9TJ 3BR3A 2NXNB 4ZYDA 2QBYA 3BTLA 4MEYF 3BTCA 2VJIA 3K70C 4UHTA 4NNJA 2ISZA 1FTZA 3P9CA 2K4BA 3E5QA 1JJ8C 1KQ0A 4EM0B 5FRNA 4ENNA 4CCMA 2DMTA 3HYIA 4WXHA 2H8WA 5GAGJ 1UJ8A 1Z6TA 4EV0A 3MD2A 4UY8I 2PN6A 4RB2C 3W2AA 2JT1A 3W2WA 4HG2A 4A69C 1HDDC 3FKJA 2DFIA 4CCKA 3RSNA 1B9MA 1LPQA 1X58A 4DBRA 3KZZA 1NH3A 2HOTA 1U9NA 5K7FA 2JK3A 4HEA2 3U1DA 1YO5C 1D5VA 4KICA 4FX4A 1YRNA 1DU6A 4HNVA 5DEQA 4IVNA 2IXSA 5LGNA 5FROA 5EGOB 2H1KA 4ZC3A 4UNOA 1USTA 4PJNA 5JHFA 1MBHA 2ESNA 4S05A 4XRSA 1D8JA 3IKTA 1DGWY 1X3WB 2MG4A 2XAGA 2LREA 4RB1A 3KYCB 4C30A 2Q0OA 2HU9A 3F3XA 1XSDA 1K6OA 1VQKI 2LY9A 3HXLA 2PLYA 3ESWB 1XB4A 4ZH4F 1QHHD 4IHTA 5E20A 1RKTA 3TO9A 2KZGA 4AVZA 2M34A 2VC1A 3QYEA 4BHPA 4A3EJ 4WF2A 3CQZJ 5FB2A 4RDUA 1FOYA 1WCMJ 1HC8A 2QYOA 4XBFA 1WH5A 2LKPA 1ENHA 3NWSA 1EA3A 3O8GA 2O61A 1KQ9A 1I39A 4KN7X 3DEUA 1IF1A 5ICGA 1TP4A 3HIFA 2J5PA 2FQ4A 2JUGA 2WTEA 5ILUA 1RKWA 2ZJ2A 4XRFA 1X4PA 4WX9A 2EQRA 3GFLA 4LB5A 1V5FA 2RQQA 4UB6C 1K4TA 3QPSA 3LSIA 1KU9A 2CW7A 3VB2A 3CD6I 1PUEE 2CQ7A 3V8LA 1VQPI 1XDSA 1MH3A 2H6CA 2PEXA 5BPDA 3T8RA 4M71A 3WGHA 4B48A 5ICFA 4RAFA 3GW2A 2F5CA 3V8JA 2KLOA 3QOPA 4MQVA 4PGGA 2VJ5A 1SVMA 3HRTA 2JPCA 5EJCA 4KMUX 2WAFA 3OR1C 2A6TA 2NS0A 4ZDOA 2X51A 3AAFA 5HDGA 3LNQA 3RKWA 2NNYA 1MSFC 3AG1H 3TDZC 5LHGA 3B73A 1YW8A 4YIIA 1G3TA 3OYGA 2A07F 3JSPA 3GCMA 1JI8A 3PSFA 1SD4A 5K5RA 3D5RC 5FLXZ 3BG7A 1Z21A 2JA6J 1E3OC 1TWAJ 3M9AA 4RBOA 1LEAA 3HOUJ 3IV5A 3FBIB 4BJ5C 4XLHA 5HNFA 1QZZA 1E3PA 1RI7A 1SAXA 5AIQA 3TP0A 2D2WA 2EZHA 3GFMA 1VQNI 1UZCA 3Q3SA 3LQQA 3X2QH 1ZR4A 1W0UA 2OTJI 2E1CA 2HPIA 1OCRH 3JTGA 2OBPA 3I4PA 2HYJA 4C2MJ 3V7CA 3CCVI 3ZMTA 2V6CA 4HA8A 1ZG3A 4MFDA 3H3ZA 2HR3A 2DA1A 3E5UA 4I7HA 4KDPA 1HF0A 4Q47A 1KZHA 5D5WB 1R6RA 1RC9A 1MMDA 2RGVA 2EPFA 3TGNA 2E36A 4ETSA 3CCRI 1FP2A 2DA5A 3LA3A 3SHFA 2OA4A 1YFHA 1OKRA 2AS5F 1HSTA 2EV6A 3ECHA 2VB6A 4M73A 2LFBA 5J1UA 3I4MJ 2X1CA 2Z5UA 1JKOC 4A5NA 5H20A 1JHFA 3J7YJ 2M4GA 3MZYA 4GYIA 1YI2I 1FY7A 3GLLA 4DGWB 1MD0A 4LJZF 1TNSA 4RAYA 5JFRA 1B6AA 1MNEA 4IHSA 3FXMA 3MQ0A 1ETYA 1SMYF 3CUOA 3SFIA 3BG5A 3KP2A 1SVLA 3K1MA 2DMPA 2A6EF 4IQJA 3JRCA 2P7CB 2COMA 1TQMA 1Z77A 2RV8A 4JBAA 2ZFWA 1F36A 2FOWA 5BNGA 4A3FJ 2L4MA 4WXCA 3VYUB 1XCBA 1IRGA 3CTAA 1FC3A 5CYVA 1WHUA 5EG0A 5GADJ 4BE2A 3BG3A 5HVQC 3S8PA 3BPXA 3CCUI 5GTIC 3F6OA 1RNLA 3R60A 2YPRA 2OF7A 4BKXA 4IRIA 1WGXA 3KP4A 1GDTA 1PJRA 1UMQA 4GXOA 1LFPA 2BV6A 4D9JA 3ASNH 3R6SA 2DA4A 1RR8C 4PCQA 3QPLA 3FF5A 1MIJA 3U9GA 3IHUA 4E7LA 1WJAA 3GMEA 2VQGA 2EFPA 4C2UA 1XN7A 1OJLA 1SD5A 3OYMA 3CESA 2ZNZA 2A5YB 5LHIA 1IV6A 3S17J 2RAEA 3BZCA 3H9QA 1GV2A 5H6RA 2OU2A 3MKYB 2IGNA 2MFZA 2E71A 4H4KC 3F23A 4DIQA 1CF7A 2WV0A 1O57A 3NEUA 2DMNA 2A3SA 3OMYA 1U0JA 4XOTA 3BG9A 3JAMZ 4IOCF 2OD5A 3BR5A 3F6VA 4XN0A 3FDYA 4M3BA 3QRFF 2R5YA 2M4KA 1JJ6C 3PO2J 2RDPA 4FE4A 2Z9OA 2IA0A 4XRMA 3HZJA 2BY3A 3E6MA 2EIJH 5CQEA 1LFBA 3PIPF 1F9NA 2DK5A 3MVPA 1C0WA 2QEXI 3K9TA 4R8HA 2ECCA 2RREA 4L9NA 4F3QA 4HOBA 4G94A 1ZK8A 1FYMA 3CMMA 1Z6RA 3DKXA 1GHCA 3CMYA 1ETQA 3KETA 4B4CA 2HOSA 2OTLI 2VQCA 1YX5A 2OQRA 2P4WA 2FNPA 3PNVA 3TMOA 2GXAA 2HQ5A 4GRIA 3QAHA 1MH4A 2KT0A 3HDDA 1EJ9A 4BXFA 2L3DA 4BGDA 1NHAA 4IHYA 4XQFA 2M0CA 1L0OC 1DUXC 5DD8A 3OL3A 1TW3A 3DPUA 4KT5C 4M72A 5B3SH 3ERMA 3G3ZA 2G0EA 4A3CJ 1TTYA 2BOLA 3L9FA 4J00A 2O5RA 5F08A 3VODA 2EIMH 1A04A 3E1SA 5A2QK 3EPZA 2ELHA 2DO7A 1JTYA 5CVJA 3P7NA 2M0MA 2P5LC 2DOFA 3C2HA 4Y52J 1P4XA 3I3LA 4EMSA 1A5JA 1YIJI 5LEKA 1AA7A 1Z67A 2FF4A 1MBFA 1X1DA 4HX4A 4ZZLA 5ICEA 3I54A 2NOJB 1XSXA 3HPHA 5F1RA 3OS0A 4G7OF 2L0KA 2JRTA 2O3FA 1VQOI 3L2UA 2KJCA 4E7SA 3FK7A 3DXJF 3LL7A 2IP2A 5M5YJ 4KIGA 1LDKB 2BGCA 1VQ9I 2XASA 5HOOA 1T39A 1WPKA 1MW7A 1J09A 1LEBA 2ZB9A 3S15J 2VI6A 4XORA 4RGRA 4HF1A 3A4CA 5CLSA 4M3EA 2DQLA 4OU0A 1D8KA 3DF8A 1D0ZA 1LFUP 2BZTA 3RTRA 2QKLB
chains in the Genus database with same CATH topology
5IYBJ 2NVYJ 3OSFA 4M3FA 3BR2A 3S2DJ 3GTQJ 1HLVA 3CCYA 1I3QJ 1VI0A 1ZKGA 2LVSA 3ZQCA 1LE8A 1HCRA 4GFBA 1H89C 2EZKA 4V2GA 4CYCB 4A3LJ 2ID6A 2OPTA 3M4OJ 2NOGA 4A3JJ 2TRTA 3WHBA 1JTXA 2KDZA 1I50J 4FCYA 2K9NA 3FIWA 2CQXA 4JYKA 3HM5A 2LLKA 3FKIJ 2CUFA 2DA6A 5F0HA 1TWCJ 4C3HJ 2CU7A 2FD5A 3GTLJ 1WI3A 1IGNA 3M3YJ 3C2BA 4AUXA 4M3GA 1LE8B 1O4XA 4D7MA 1ETOA 5K7HA 1TC3C 1ETWA 2X6OA 2Y0SN 3BQYA 1AHDP 1S7EA 5F04A 1MNMC 2MSYA 2WAQN 4FE7A 3D1NI 2AHQA 2XRLA 4MFEA 1RR7A 4EEFG 5IPAA 3VPRA 4A3MJ 2QCOA 3W6VA 1JUMA 2X9DA 3HBLA 3L1PA 3ZQLA 5FLVA 2R5ZA 1CQTA 3F0CA 2R5YB 2PMZN 2TCTA 4QSHA 4C3JJ 1B8IA 1MSEC 2H8RA 1G2HA 3RKQA 1ETVA 3ZQFA 5FLMJ 3A01B 3GTOJ 2XB0X 4L5EA 3WHCA 2LP0A 4LOCA 2HOAA 1XS9A 4BXXJ 5EF6A 3BTJA 2AO9A 3S1QJ 1JUPA 3FK6A 1ZQ3P 2VKEA 4MLOA 2DA2A 3JRHA 2IBDA 1TWHJ 5IYDJ 1IG7A 2NVTJ 3B6AA 1R9TJ 3BR3A 5E3LA 2R0QC 5EZHA 3BTLA 1MBGA 4BY1J 3BTCA 3IH3A 2K9QA 5DTDA 1FTZA 1JJ8C 3BQZA 3K2AA 4A3KJ 3TW6A 3FISA 3TW7A 2DMTA 2LKXA 1RESA 5M5XJ 2R7ZJ 1JKPC 3BR6A 3GTJJ 4A69C 1HDDC 3LSJA 2CRGA 2ECBA 1X58A 2HOTA 1U9NA 2M9HA 3NAUA 5K7FA 3GTMJ 2JK3A 3HOWJ 3NARA 2VUMJ 3JRGA 1B72A 4DYCA 4W97A 1BW6A 1ETKA 2XGDA 1ZGWA 3I4NJ 1GUUA 4S0HB 1YRNA 5IYCJ 1DU6A 4HNVA 1ETXA 3GTGJ 3HGGA 5EGOB 2H1KA 2ELKA 4I76A 2LK2A 1MBHA 1SFOJ 2VPRA 4XRSA 2DMUA 2MG4A 3O8HA 2GBYA 2O7OA 1X2MA 2XGCA 1QVUA 5GP9A 2LY9A 3S1NJ 1IDYA 4I6ZA 1FEXA 1JT6A 1RKTA 1B72B 2Y30A 4M6VA 4UUTA 2M34A 3OIOA 3HOZJ 4FISA 1YRNB 1NTCA 1XG1A 4A3EJ 5C4JJ 3CQZJ 2DN0A 2E2HJ 5C3EJ 3S2HJ 3IH2A 4RDUA 2HXIA 3GBGA 1WCMJ 2JA8J 2CJJA 3RQIA 2LR8A 3BR1A 1WH5A 1ENHA 3GTPJ 4D5CA 5EDNA 3O8GA 1IJWC 1AU7A 4W1UA 2FQ4A 3LSPA 1RETA 3JRAA 1IDZA 1RKWA 1IC8A 2EQRA 2NS7A 2B63J 3QPSA 1I6HJ 1POGA 3ZQGA 5DS9A 1DU0A 1MH3A 1FTTA 3S1MJ 3GTKJ 2YUSA 2R92J 1W0TA 2DJNA 3LSRA 4BY7J 5GPCA 4M3DA 3JREA 5E3OA 2M2EA 3PO3J 4JP0A 5J1RA 1D5YA 5GPAA 2YS9A 5FKOA 2XPUA 3LNQA 3S14J 1SANA 1MSFC 2R93J 3B6CA 4BBSJ 1NK3P 1Y1VJ 2M8GX 4IEJA 5F0FA 3JRDA 5IP6A 3BT9A 1FJLA 2JA6J 4XRSG 1E3OC 1BW5A 1Y1WJ 1TWAJ 4RBOA 2JJ7A 4G12A 4QTRA 3IV5A 3HOUJ 1GT0C 2DMQA 3E7LA 3TP0A 2EZHA 2O9LA 3JRFA 1W0UA 3Q3SA 1ZR4A 2R5ZB 4B1RA 4A3GJ 1OCPA 1RPWA 5JLXA 1B8IB 2HYJA 4XK4A 4C2MJ 4IHXA 1U8BA 2JA7J 1AKHA 4MFDA 1Q1VA 3TEDA 5J3LA 2XSDC 2VKVA 1HDPA 1U9OA 2DA1A 4A3IJ 1HF0A 5HODA 1T56A 5K7ZA 1H88C 1K61A 1HOMA 2E2IJ 1BA5A 2DA5A 2ME6A 5EEAA 3HGYA 2E1OA 2GLOA 2X48A 1ORKA 2LFBA 5J1UA 3I4MJ 4JX4A 1JKOC 3HOXJ 2WB1N 1QVTA 5FKMA 1MBKA 1VNDA 3ZQIA 4D7NA 2E19A 3H3VK 2WV1A 1BJZA 3ZQHA 3SFIA 1ETYA 3LSGA 3BG5A 1QRYA 2HDDA 4DYQA 2XB5A 2MW8A 1GVDA 2DMPA 3S1RJ 2CUEA 3JRCA 2I10A 5C44J 2FJ1A 2Y9YA 1TWGJ 1Z77A 3RZOJ 2NS8A 3A02A 1F36A 5BNGA 2FX0A 3BTIA 4A3FJ 1F43A 3A03A 2IEKA 5M5WJ 2Y31A 5EG0A 3BG3A 3QQAA 1U78A 9ANTA 1MBJA 1Z0XA 1ZTRA 2EBIA 5J1YA 4J19A 1QPIA 4QIWN 2OF7A 1A6IA 4BKXA 1IRZA 1BL0A 1WGXA 1GDTA 1WH7A 2NVQJ 1UMQA 3HOVJ 4DW6A 1APLC 1ZR2A 2DA4A 4ABZA 4DZPA 5IP7J 1EF4A 3QPLA 2ME0A 2COBA 3OOUA 2HXOA 1OJLA 5EG0B 2LTPA 3CDLA 3TP3A 2DA7A 3PM1A 1IV6A 2RAEA 3S17J 2Y2ZA 1GV2A 2CQQA 3LOCA 2XPWA 1XC5A 5FJ8J 2Y9ZA 1MBEA 3G1LA 2D5VA 2DMNA 5F27A 4A3DJ 2LD5A 3SDGA 5M3FJ 2K40A 3BG9A 3BR5A 3DEWA 4M3BA 3G1OA 2R5YA 4DZJA 5M3MJ 3HOYJ 3MKLA 2JA5J 5IP9J 3JR9A 1JJ6C 4IHVA 3PO2J 1P7IA 2K9SA 4FE4A 3A01A 3JRBA 4XRMA 3RZDJ 2L9RA 2ID3A 5FKKA 3JRIA 3SJMA 1LFBA 1ITYA 3Q0VA 3MVPA 5EYRA 3HEFA 2ECCA 3S16J 3G1MA 2E2JJ 1ZK8A 2YU9J 3UKGA 2O8KA 2N8GA 4JX5A 5FKNA 1JT0A 3Q0UA 4XICA 2GM4A 3CMYA 5IOYA 1ETQA 2MGQA 4B4CA 3OSGA 2HOSA 5EZGA 1P7JA 1T33A 3BR0A 4AYBN 2IAIA 3Q0WA 2HQ5A 2P81A 2QF7A 4AC0A 1MH4A 2KT0A 3HDDA 1PUFA 4Y7NJ 5JLWA 3MN2A 3K7AJ 1X2NA 4A93J 1TWFJ 4IHYA 5F1JA 1IUFA 2M0CA 4A3BJ 4FTHA 1NK2P 3DCFA 2JMWA 2G0EA 4A3CJ 2DA3A 4B3AA 3IH4A 5F08A 4BBRJ 1K83J 4DYRA 4X6AJ 4XIDA 3HKZN 2L7MP 4MO7A 3ZOBA 4X1EA 1FIPA 2EZLA 2XGEA 2HI3A 2W48A 1GV5A 4C3IJ 3H0GJ 1JTYA 3HB9A 1VF9A 1AKHB 2L7ZA 4V2FA 4UUSA 1PUFB 1JKRC 1OFCX 4Y52J 2JN6A 5EGOA 2JWTA 1A5JA 1MBFA 2NVXJ 5IOZA 4MIMA 5C4XJ 4JX6A 2L0KA 1OCTC 2EZIA 1UHSA 3FK7A 4D5FA 5FKLA 1VFCA 5M5YJ 1UG2A 2L7FP 4IHWA 4CYCA 5F0CA 1JUSA 1WPKA 1JGGA 5E3MA 5E3NA 2ZB9A 3S15J 2VI6A 4UUSB 1FIAA 4M3EA 1H8AC 2DTZA 2EH3A 4NDLA 2XPVA 1LFUP 1JKQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB J;  2NVY J;  3OSF A;  4M3F A;  3BR2 A;  3S2D J;  3GTQ J;  1HLV A;  3CCY A;  1I3Q J;  1VI0 A;  1ZKG A;  2LVS A;  3ZQC A;  1LE8 A;  1HCR A;  4GFB A;  1H89 C;  2EZK A;  4V2G A;  4CYC B;  4A3L J;  2ID6 A;  2OPT A;  3M4O J;  2NOG A;  4A3J J;  2TRT A;  3WHB A;  1JTX A;  2KDZ A;  1I50 J;  4FCY A;  2K9N A;  3FIW A;  2CQX A;  4JYK A;  3HM5 A;  2LLK A;  3FKI J;  2CUF A;  2DA6 A;  5F0H A;  1TWC J;  4C3H J;  2CU7 A;  2FD5 A;  3GTL J;  1WI3 A;  1IGN A;  3M3Y J;  3C2B A;  4AUX A;  4M3G A;  1LE8 B;  1O4X A;  4D7M A;  1ETO A;  5K7H A;  1TC3 C;  1ETW A;  2X6O A;  2Y0S N;  3BQY A;  1AHD P;  1S7E A;  5F04 A;  1MNM C;  2MSY A;  2WAQ N;  4FE7 A;  3D1N I;  2AHQ A;  2XRL A;  4MFE A;  1RR7 A;  4EEF G;  5IPA A;  3VPR A;  4A3M J;  2QCO A;  3W6V A;  1JUM A;  2X9D A;  3HBL A;  3L1P A;  3ZQL A;  5FLV A;  2R5Z A;  1CQT A;  3F0C A;  2R5Y B;  2PMZ N;  2TCT A;  4QSH A;  4C3J J;  1B8I A;  1MSE C;  2H8R A;  1G2H A;  3RKQ A;  1ETV A;  3ZQF A;  5FLM J;  3A01 B;  3GTO J;  2XB0 X;  4L5E A;  3WHC A;  2LP0 A;  4LOC A;  2HOA A;  1XS9 A;  4BXX J;  5EF6 A;  3BTJ A;  2AO9 A;  3S1Q J;  1JUP A;  3FK6 A;  1ZQ3 P;  2VKE A;  4MLO A;  2DA2 A;  3JRH A;  2IBD A;  1TWH J;  5IYD J;  1IG7 A;  2NVT J;  3B6A A;  1R9T J;  3BR3 A;  5E3L A;  2R0Q C;  5EZH A;  3BTL A;  1MBG A;  4BY1 J;  3BTC A;  3IH3 A;  2K9Q A;  5DTD A;  1FTZ A;  1JJ8 C;  3BQZ A;  3K2A A;  4A3K J;  3TW6 A;  3FIS A;  3TW7 A;  2DMT A;  2LKX A;  1RES A;  5M5X J;  2R7Z J;  1JKP C;  3BR6 A;  3GTJ J;  4A69 C;  1HDD C;  3LSJ A;  2CRG A;  2ECB A;  1X58 A;  2HOT A;  1U9N A;  2M9H A;  3NAU A;  5K7F A;  3GTM J;  2JK3 A;  3HOW J;  3NAR A;  2VUM J;  3JRG A;  1B72 A;  4DYC A;  4W97 A;  1BW6 A;  1ETK A;  2XGD A;  1ZGW A;  3I4N J;  1GUU A;  4S0H B;  1YRN A;  5IYC J;  1DU6 A;  4HNV A;  1ETX A;  3GTG J;  3HGG A;  5EGO B;  2H1K A;  2ELK A;  4I76 A;  2LK2 A;  1MBH A;  1SFO J;  2VPR A;  4XRS A;  2DMU A;  2MG4 A;  3O8H A;  2GBY A;  2O7O A;  1X2M A;  2XGC A;  1QVU A;  5GP9 A;  2LY9 A;  3S1N J;  1IDY A;  4I6Z A;  1FEX A;  1JT6 A;  1RKT A;  1B72 B;  2Y30 A;  4M6V A;  4UUT A;  2M34 A;  3OIO A;  3HOZ J;  4FIS A;  1YRN B;  1NTC A;  1XG1 A;  4A3E J;  5C4J J;  3CQZ J;  2DN0 A;  2E2H J;  5C3E J;  3S2H J;  3IH2 A;  4RDU A;  2HXI A;  3GBG A;  1WCM J;  2JA8 J;  2CJJ A;  3RQI A;  2LR8 A;  3BR1 A;  1WH5 A;  1ENH A;  3GTP J;  4D5C A;  5EDN A;  3O8G A;  1IJW C;  1AU7 A;  4W1U A;  2FQ4 A;  3LSP A;  1RET A;  3JRA A;  1IDZ A;  1RKW A;  1IC8 A;  2EQR A;  2NS7 A;  2B63 J;  3QPS A;  1I6H J;  1POG A;  3ZQG A;  5DS9 A;  1DU0 A;  1MH3 A;  1FTT A;  3S1M J;  3GTK J;  2YUS A;  2R92 J;  1W0T A;  2DJN A;  3LSR A;  4BY7 J;  5GPC A;  4M3D A;  3JRE A;  5E3O A;  2M2E A;  3PO3 J;  4JP0 A;  5J1R A;  1D5Y A;  5GPA A;  2YS9 A;  5FKO A;  2XPU A;  3LNQ A;  3S14 J;  1SAN A;  1MSF C;  2R93 J;  3B6C A;  4BBS J;  1NK3 P;  1Y1V J;  2M8G X;  4IEJ A;  5F0F A;  3JRD A;  5IP6 A;  3BT9 A;  1FJL A;  2JA6 J;  4XRS G;  1E3O C;  1BW5 A;  1Y1W J;  1TWA J;  4RBO A;  2JJ7 A;  4G12 A;  4QTR A;  3IV5 A;  3HOU J;  1GT0 C;  2DMQ A;  3E7L A;  3TP0 A;  2EZH A;  2O9L A;  3JRF A;  1W0U A;  3Q3S A;  1ZR4 A;  2R5Z B;  4B1R A;  4A3G J;  1OCP A;  1RPW A;  5JLX A;  1B8I B;  2HYJ A;  4XK4 A;  4C2M J;  4IHX A;  1U8B A;  2JA7 J;  1AKH A;  4MFD A;  1Q1V A;  3TED A;  5J3L A;  2XSD C;  2VKV A;  1HDP A;  1U9O A;  2DA1 A;  4A3I J;  1HF0 A;  5HOD A;  1T56 A;  5K7Z A;  1H88 C;  1K61 A;  1HOM A;  2E2I J;  1BA5 A;  2DA5 A;  2ME6 A;  5EEA A;  3HGY A;  2E1O A;  2GLO A;  2X48 A;  1ORK A;  2LFB A;  5J1U A;  3I4M J;  4JX4 A;  1JKO C;  3HOX J;  2WB1 N;  1QVT A;  5FKM A;  1MBK A;  1VND A;  3ZQI A;  4D7N A;  2E19 A;  3H3V K;  2WV1 A;  1BJZ A;  3ZQH A;  3SFI A;  1ETY A;  3LSG A;  3BG5 A;  1QRY A;  2HDD A;  4DYQ A;  2XB5 A;  2MW8 A;  1GVD A;  2DMP A;  3S1R J;  2CUE A;  3JRC A;  2I10 A;  5C44 J;  2FJ1 A;  2Y9Y A;  1TWG J;  1Z77 A;  3RZO J;  2NS8 A;  3A02 A;  1F36 A;  5BNG A;  2FX0 A;  3BTI A;  4A3F J;  1F43 A;  3A03 A;  2IEK A;  5M5W J;  2Y31 A;  5EG0 A;  3BG3 A;  3QQA A;  1U78 A;  9ANT A;  1MBJ A;  1Z0X A;  1ZTR A;  2EBI A;  5J1Y A;  4J19 A;  1QPI A;  4QIW N;  2OF7 A;  1A6I A;  4BKX A;  1IRZ A;  1BL0 A;  1WGX A;  1GDT A;  1WH7 A;  2NVQ J;  1UMQ A;  3HOV J;  4DW6 A;  1APL C;  1ZR2 A;  2DA4 A;  4ABZ A;  4DZP A;  5IP7 J;  1EF4 A;  3QPL A;  2ME0 A;  2COB A;  3OOU A;  2HXO A;  1OJL A;  5EG0 B;  2LTP A;  3CDL A;  3TP3 A;  2DA7 A;  3PM1 A;  1IV6 A;  2RAE A;  3S17 J;  2Y2Z A;  1GV2 A;  2CQQ A;  3LOC A;  2XPW A;  1XC5 A;  5FJ8 J;  2Y9Z A;  1MBE A;  3G1L A;  2D5V A;  2DMN A;  5F27 A;  4A3D J;  2LD5 A;  3SDG A;  5M3F J;  2K40 A;  3BG9 A;  3BR5 A;  3DEW A;  4M3B A;  3G1O A;  2R5Y A;  4DZJ A;  5M3M J;  3HOY J;  3MKL A;  2JA5 J;  5IP9 J;  3JR9 A;  1JJ6 C;  4IHV A;  3PO2 J;  1P7I A;  2K9S A;  4FE4 A;  3A01 A;  3JRB A;  4XRM A;  3RZD J;  2L9R A;  2ID3 A;  5FKK A;  3JRI A;  3SJM A;  1LFB A;  1ITY A;  3Q0V A;  3MVP A;  5EYR A;  3HEF A;  2ECC A;  3S16 J;  3G1M A;  2E2J J;  1ZK8 A;  2YU9 J;  3UKG A;  2O8K A;  2N8G A;  4JX5 A;  5FKN A;  1JT0 A;  3Q0U A;  4XIC A;  2GM4 A;  3CMY A;  5IOY A;  1ETQ A;  2MGQ A;  4B4C A;  3OSG A;  2HOS A;  5EZG A;  1P7J A;  1T33 A;  3BR0 A;  4AYB N;  2IAI A;  3Q0W A;  2HQ5 A;  2P81 A;  2QF7 A;  4AC0 A;  1MH4 A;  2KT0 A;  3HDD A;  1PUF A;  4Y7N J;  5JLW A;  3MN2 A;  3K7A J;  1X2N A;  4A93 J;  1TWF J;  4IHY A;  5F1J A;  1IUF A;  2M0C A;  4A3B J;  4FTH A;  1NK2 P;  3DCF A;  2JMW A;  2G0E A;  4A3C J;  2DA3 A;  4B3A A;  3IH4 A;  5F08 A;  4BBR J;  1K83 J;  4DYR A;  4X6A J;  4XID A;  3HKZ N;  2L7M P;  4MO7 A;  3ZOB A;  4X1E A;  1FIP A;  2EZL A;  2XGE A;  2HI3 A;  2W48 A;  1GV5 A;  4C3I J;  3H0G J;  1JTY A;  3HB9 A;  1VF9 A;  1AKH B;  2L7Z A;  4V2F A;  4UUS A;  1PUF B;  1JKR C;  1OFC X;  4Y52 J;  2JN6 A;  5EGO A;  2JWT A;  1A5J A;  1MBF A;  2NVX J;  5IOZ A;  4MIM A;  5C4X J;  4JX6 A;  2L0K A;  1OCT C;  2EZI A;  1UHS A;  3FK7 A;  4D5F A;  5FKL A;  1VFC A;  5M5Y J;  1UG2 A;  2L7F P;  4IHW A;  4CYC A;  5F0C A;  1JUS A;  1WPK A;  1JGG A;  5E3M A;  5E3N A;  2ZB9 A;  3S15 J;  2VI6 A;  4UUS B;  1FIA A;  4M3E A;  1H8A C;  2DTZ A;  2EH3 A;  4NDL A;  2XPV A;  1LFU P;  1JKQ C; 
#chains in the Genus database with same CATH topology
 2Y48 A;  1TLH B;  2M7A A;  3BR2 A;  1HLV A;  3CCY A;  1UFM A;  1H89 C;  3OYD A;  2DOA A;  2KIF A;  1R00 A;  1MND A;  2FBK A;  2CV0 A;  5HLG A;  2GA2 A;  3WTW C;  2X6W A;  4IRH A;  4XKW A;  3T1B A;  2KIM A;  3M4O J;  1Z9C A;  3FMS A;  4G9Y A;  3J7Z I;  1Z3Y A;  5DCM A;  4LG0 A;  2KRF A;  1I50 J;  4RAZ A;  3P9I A;  1WWX A;  1GXQ A;  2LLK A;  1OR7 A;  1XGO A;  3H1C A;  1TWC J;  1OIS A;  3RI4 A;  2JSP A;  3WG9 A;  3C2B A;  4U87 A;  1LE8 B;  2KIS A;  3VSL A;  3L09 A;  1R1U A;  3KLN A;  2EB7 A;  3QU6 A;  3K70 D;  1X3U A;  3KP7 A;  1RIO H;  1TC3 C;  2OC6 A;  4I98 B;  2Y0S N;  4KT6 A;  4E70 A;  1AHD P;  4HST A;  4LLG F;  4EJU A;  3OYI A;  1WRJ A;  5HS9 A;  4DOZ A;  2WAQ N;  2GOM A;  1XMX A;  2CV2 A;  1KGS A;  2PMZ A;  5LD2 C;  2LC2 A;  3REO A;  5EEG A;  2MH2 A;  4EEF G;  1P6R A;  4NB5 A;  2G7U A;  3R0J A;  3K69 A;  4L9J A;  5BPI A;  2VBZ A;  4KYW A;  3PNT A;  3RPU D;  1CF7 B;  3FXO A;  2VJ4 A;  2Z16 A;  3F21 A;  2UUZ A;  1VQ5 I;  3M8F A;  4LB6 B;  3ZQL A;  2XAF A;  2KMU A;  5ED4 A;  4CYD A;  2K7L A;  1YIT I;  2CYY A;  2R5Y B;  3WU2 C;  1LB2 A;  3H36 A;  1B8I A;  2TCT A;  4QSH A;  1R4M B;  4KA4 A;  1T8I A;  2XRN A;  4BEH B;  3C2G A;  2XB0 X;  4Q5S F;  1OR7 C;  2GWR A;  3TKY A;  1X1B A;  3OYJ A;  3BRO A;  1N77 A;  4CSW A;  1ZGJ A;  1YS6 A;  5E17 F;  3QU3 A;  2VXD A;  2M7B A;  3H5N A;  2J5O A;  1R1T A;  1Y0U A;  3WGI A;  3CC4 I;  4MLO A;  1USS A;  2DA2 A;  2E34 A;  4MEX F;  5E8I A;  1IG7 A;  2LSO A;  2BHY A;  1WJE A;  2KFD A;  3RDI A;  2HYF A;  2JRM A;  3OYL A;  4RM2 A;  3HHG A;  2HQN A;  3SDB A;  5H2F C;  2ZC2 A;  5E3L A;  2R0Q C;  2DI3 A;  2PMH A;  3DEE A;  2DDA A;  2R7V A;  3CF2 A;  1DQU A;  3WU0 A;  1TZL A;  2GIV A;  3TW6 A;  5D4R A;  5J6X A;  1Y56 A;  2P5V A;  4G8X A;  2HOE A;  3CLO A;  2HKO A;  2OCC H;  2Z33 A;  2R7Z J;  2DK8 A;  2RC4 A;  1JKP C;  3E0J B;  1WJB A;  1ZEL A;  3EUA A;  3GTJ J;  1BC8 C;  4HV5 A;  1K78 A;  1FYK A;  3KEQ A;  1ON2 A;  2L02 A;  3F8C A;  4ENM A;  4HBL A;  3OYF A;  2FUG 2;  2M9H A;  3KIO A;  3NAU A;  2KDO A;  1QA6 A;  3GTM J;  1S72 I;  3HOW J;  1ZAR A;  2V9P A;  2GQQ A;  2FRH A;  3JRG A;  5CQG A;  1ZGW A;  1J75 A;  3I4N J;  3NWT A;  4S0H B;  2G9W A;  2OAZ A;  3LA7 A;  3GTG J;  2P8T A;  3TOB A;  4UVC A;  2UXX A;  4DBQ A;  2LK2 A;  3KP5 A;  4KUM A;  2FEZ A;  2MC3 A;  1ZH5 A;  2ZSI B;  2VPR A;  3N05 A;  1ZRC A;  2IT0 A;  4WWC A;  2AXT C;  1HBX G;  4CCN A;  3BC8 A;  5D8K B;  3K2Z A;  3O8H A;  1MMA A;  2GBY A;  2O7O A;  1W36 D;  1FMV A;  1FLI A;  4M6X A;  3EET A;  4AU7 A;  2XGC A;  3Q5F A;  5ILV A;  1QVU A;  1XMA A;  4A12 A;  4I02 A;  1BOB A;  1FZP B;  3S1N J;  1IDY A;  4I6Z A;  5DCF A;  3AL0 C;  4O5V A;  1JT6 A;  1OQY A;  2ZJR F;  4Q4Z F;  1W4M A;  2EIL H;  2BY2 A;  4JOM A;  1B72 B;  5J4Y A;  3OIO A;  2ZNY A;  4M9X A;  1KU7 A;  2ISY A;  3HOZ J;  1NTC A;  4GGG A;  3S3O A;  1UHM A;  2D1H A;  5DM6 F;  2EFO A;  5C3E J;  3S2H J;  3GBG A;  2RQP A;  2VT2 A;  2R7D A;  2LR8 A;  3LAP A;  2OJE D;  4GCV A;  3BZ6 A;  2CW8 A;  1S6L A;  1YHQ I;  5K5O A;  1IJW C;  1AU7 A;  4MHG A;  2DYR H;  2VJJ A;  4K2E A;  1RET A;  3LSP A;  3JRA A;  4L0Y B;  3RYP A;  3BCB A;  4UXN A;  2D45 A;  2F5E A;  4RMN A;  2B63 J;  4F55 A;  5DCM B;  1I6H J;  1E17 A;  4KJZ A;  4LG0 B;  1POG A;  3ZQ7 A;  4LFU A;  1RRJ A;  1SAU A;  3CLQ A;  2R92 J;  1W0T A;  3P5J A;  4YFK F;  4OWR B;  4EJO A;  3LSR A;  2GAU A;  3EYI A;  1SVO A;  5DUI A;  4IQ4 A;  2VE8 A;  2M2E A;  4JP0 A;  4B43 A;  1D5Y A;  3CDH A;  4N4N B;  5E1W A;  4BAC A;  1REP C;  1ZRE A;  1WJC A;  2WAD A;  3S14 J;  3UNG C;  2E5Z A;  3B6C A;  3Q9S A;  3ZMV A;  4HV6 A;  2VQL A;  5F0F A;  3BT9 A;  5E79 C;  1BW5 A;  4YRV A;  3PQJ A;  1LNW A;  1O3Q A;  4DQ2 A;  4QTR A;  5JHU A;  3CCS I;  3PFI A;  4ON0 A;  1GT0 C;  1DP7 P;  1U2W A;  2DMQ A;  4HLY A;  2VIX A;  1R4N B;  3QOD A;  4YG2 F;  1XGN A;  1F1Z A;  1D1A A;  1FOW A;  4A6D A;  1O3T A;  4B1R A;  4NC8 A;  4AIJ A;  4U7D A;  2JPB A;  2WY7 Q;  3SEZ A;  1B8I B;  2F48 A;  3T5X A;  4G6T B;  1U8B A;  1AKH A;  4BUP A;  4PJ0 C;  1R7J A;  3W3C A;  2GIZ A;  2ZKZ A;  5J3L A;  2WB1 A;  2XSD C;  4EJT A;  5L3B A;  1TT0 A;  1YTY A;  1H88 C;  4A2U A;  1P9Q C;  4FET A;  2V9V A;  2E2I J;  1BA5 A;  2HZD A;  2GOX B;  2DT5 A;  2E1O A;  4EAT A;  1VQM I;  4RLQ A;  2L9N A;  3NQO A;  2X6X A;  1O3R A;  4UUV A;  5K1Y A;  1X4O A;  4JX4 A;  4PUS A;  1I5Z A;  2TDX A;  4EVI A;  3ZP5 A;  1VND A;  3SQN A;  2DT6 A;  2DOD A;  1ONV A;  2EA2 A;  3OYA A;  1D0X A;  3CME I;  5KNL A;  3AL0 B;  3K4L A;  1ZAO A;  2KKO A;  1RUO A;  2G7H A;  3LSG A;  3O2P E;  2HDD A;  4BE0 A;  2IGM A;  4DYQ A;  4EJV A;  2MW8 A;  1GVD A;  3ZR8 X;  4B44 A;  3OS1 A;  1W1W E;  2L4A A;  2X0L A;  2Y9Y A;  2AQF A;  1YJW I;  1K78 B;  2P0W A;  2QVO A;  2ZJQ F;  1IN6 A;  2NS8 A;  2WC2 A;  4CCO A;  3A02 A;  3V42 A;  2M3A A;  2IS6 A;  2FX0 A;  3BTI A;  1I3A A;  4NC7 A;  3JSO A;  1HA8 A;  3ELK A;  1I1G A;  3GX4 X;  2Y31 A;  1O7F A;  2PJR A;  3RKX A;  2VPL A;  1MBJ A;  2JA2 A;  4J19 A;  2OQG A;  4IZZ A;  3PL8 A;  4QIW N;  1DPU A;  4XL9 A;  3KEO A;  4Y4R A;  1IRZ A;  1FBQ A;  3TDU C;  1K6Y A;  1T95 A;  3GZN B;  1APL C;  1ZR2 A;  2F4M B;  4Y15 A;  2PJP A;  3IUO A;  3BP8 A;  1LVA A;  5IP7 J;  4F52 A;  1EF4 A;  2V7F A;  3BG6 A;  4O6J A;  2VLA A;  3OOU A;  2IVM A;  1QGP A;  2HXO A;  5B1A H;  1WVR A;  3CDL A;  1K4S A;  1ZGA A;  1TBX A;  4P1W A;  1RUN A;  3QYB A;  4M9Z A;  5FD5 A;  1BC7 C;  2WBM A;  2A6H F;  5E8G A;  1TL8 A;  2Y2Z A;  3VOE A;  3AKZ A;  4B3X A;  4BL0 B;  2XPW A;  2Y9Z A;  2MD5 A;  1FOK A;  1MBE A;  2VE9 A;  1L3L A;  1WI9 A;  3KP3 A;  1YYV A;  1SD7 A;  1EH7 A;  3FBN B;  3CCQ I;  1HQC A;  4AM3 A;  1R71 A;  3QP6 A;  4A3D J;  2R7S A;  4HQE A;  5M3F J;  2K40 A;  2MC4 A;  2CUZ A;  3G73 A;  1QQI A;  3G1O A;  3SFZ A;  1EH8 A;  3SXY A;  1ON1 A;  4F91 B;  1EH6 A;  4DZJ A;  5M3M J;  2W24 A;  5HLH A;  3KX2 A;  2E5N A;  4UVA A;  1QO0 D;  3A01 A;  3CCM I;  1J9I A;  2NVU B;  5D5V B;  1U3E M;  2RNJ A;  4FQG A;  3DLL F;  4MTE A;  5EYR A;  2R4G A;  1F4K A;  5D4S A;  4GO1 A;  2XSJ C;  3BJO A;  3LMM A;  4RGX A;  1G8X A;  2H09 A;  3CCL I;  2QGU A;  2L9V A;  2N8G A;  3CP8 A;  3QOE A;  4JX5 A;  5FKN A;  1JT0 A;  3Q0U A;  4LD5 A;  5D6F A;  1I27 A;  2MGQ A;  2FML A;  3FMR A;  3L7W A;  3L2C A;  5EZG A;  1T33 A;  3BR0 A;  3CP2 A;  2IAI A;  3ZGK A;  1SEU A;  3QPH A;  3J7A Y;  4AC0 A;  5HS8 A;  3S32 A;  2BY0 A;  3FXK A;  5JLW A;  3L2Q A;  4CGZ A;  3MKW B;  3BPV A;  1X2N A;  1GLN A;  3SYT A;  4A93 J;  3K4B A;  1TWF J;  1R22 A;  5J4V A;  1IUF A;  5L3G A;  2HGC A;  4FTH A;  5CVI A;  2EV5 A;  1NK2 P;  2JMW A;  1AWC A;  4AWX B;  3H9J A;  2VQH A;  3DQV C;  3MWM A;  4LK0 F;  4BBR J;  4QPO A;  1IXS B;  1LQ1 A;  2HTS A;  4XID A;  4MO7 A;  1FOX A;  2OCE A;  1B9N A;  2HI3 A;  1W7P A;  3V4G A;  4LIV A;  3N97 A;  4L0Z B;  1AKH B;  3E3V A;  3GYH X;  2X85 A;  1XGS A;  2VT3 A;  3SZP A;  2WY8 Q;  3GFI A;  3ABU A;  2JWT A;  1VZ0 A;  2ZXJ A;  4RGS A;  4P96 A;  1QBJ A;  2CS3 A;  1YJ9 I;  1HSJ A;  3U21 A;  4B8X A;  2H27 A;  5C4X J;  3WTX C;  2RN7 A;  4N9H A;  2AXL A;  2C6Y A;  1X1P A;  2EZI A;  3BLY A;  1TQI A;  1S7O A;  1UHS A;  2XV4 S;  3K0L A;  3ML6 A;  4U88 A;  5FKL A;  1VFC A;  1AOY A;  2XHK A;  3M7G A;  4LGW A;  3OYN A;  1UG2 A;  2HNH A;  1QPM A;  1PDN C;  2BW3 A;  5E3N A;  2R7X A;  2CFX A;  2CQN A;  3TBI A;  4UUS B;  2JQ7 A;  3OS2 A;  5DDG A;  1T98 A;  3HRS A;  1Y6I A;  2DAO A;  2K9L A;  1JKQ C;  2DPD A;  2NVY J;  4KIT B;  2V1N A;  1BR2 A;  3NRV A;  5B1B H;  4CHU A;  3HRM A;  2V1D A;  3D5S C;  1SFX A;  3HRU A;  1YG2 A;  3HTU A;  3S3M A;  5TJJ A;  1VI0 A;  1ZKG A;  2FNA A;  2JUC A;  4TV7 A;  4U0W A;  4CIC A;  3ZQC A;  1LE8 A;  4V19 K;  2EZK A;  3ZPL A;  5E18 F;  1DPR A;  1XX5 A;  4CYC B;  2V4J C;  3DV8 A;  2HQA A;  5HDK A;  4A3J J;  2QZ8 A;  4PJM A;  1JTX A;  5L3F A;  4DNC A;  2LY1 A;  2KDZ A;  4ZZD A;  4ZYA A;  4FCY A;  2PJR B;  3G6E I;  2CQX A;  3HM5 A;  4E7H A;  2QM3 A;  2R7U A;  1IZ1 A;  2CUF A;  2DA6 A;  5F0H A;  2CQK A;  2CU7 A;  3GTL J;  3ZCO A;  1XCV A;  4ZTF A;  1BR1 A;  3M3Y J;  2IJL A;  3OOP A;  1S7A A;  3BY6 A;  1O4X A;  2DT7 B;  4D7M A;  4MNU A;  3FXU A;  3RPQ A;  1XD7 A;  2HS5 A;  2H6B A;  1ETW A;  2X6O A;  1S7E A;  2M45 A;  5JR3 A;  4BEH A;  4F92 B;  2MSY A;  1ZRF A;  3R61 A;  4FHT A;  3CF5 F;  1FSH A;  2XIG A;  2CV1 A;  4Z6Y A;  2DU9 A;  4P9F A;  3W6V A;  4HRI A;  1JUM A;  2X9D A;  1O3S A;  4L18 B;  3HBL A;  4BNC A;  3E6B A;  5D6E A;  1OMI A;  2R5Z A;  3CC7 I;  3KZI C;  2PFB A;  2PMZ N;  1MSE C;  2WAE A;  4L5I A;  2GXB A;  1ETV A;  2KRC A;  3VYS B;  3A01 B;  3GTO J;  2ACJ A;  3HOS A;  4L5E A;  3WHC A;  2L54 A;  2LP0 A;  4LOC A;  1LDD A;  2HOA A;  3DTI A;  1XS9 A;  3OYB A;  5EF6 A;  3HTS B;  4Y17 A;  3E6C C;  2AQE A;  2VKE A;  3FHZ A;  1FSE A;  1WJD A;  3J81 K;  2IBD A;  5E1Z B;  1ZG1 A;  2XAU A;  4UV9 A;  4ZYH A;  5GAH J;  1MZB A;  2Y69 H;  3A0B C;  2NVT J;  1XDU A;  3WE2 A;  2A69 F;  2ZXI A;  2CO5 A;  2XRO A;  5EZH A;  2VOP A;  2W85 A;  2BBY A;  1KU3 A;  3IH3 A;  1P92 A;  3K6G A;  2K9Q A;  3K2A A;  2MLG A;  4E7Z A;  3FIS A;  3IAS 2;  4HDV A;  2MH9 A;  1E2X A;  1OYY A;  4HAM A;  2LKX A;  1RES A;  2E35 A;  4KNY A;  3DFG A;  4IF4 A;  3WTU C;  3BR6 A;  1FWZ A;  4BDZ A;  4IO9 F;  5LFA A;  4KN4 X;  3GO5 A;  2ECB A;  4HF0 A;  1FBS A;  4QWQ A;  1NG7 A;  3NAR A;  2IS1 A;  1B72 A;  2P6S A;  4DYC A;  1W7P B;  2XGD A;  4CUG A;  5BS6 A;  2EIN H;  4E7K A;  2HVS A;  2VOD A;  5BQT A;  4NHJ A;  1ETX A;  4HZF A;  4I76 A;  4J01 A;  4KMF A;  1SFO J;  3HC7 A;  2DMU A;  3MZH A;  5HLT A;  2HPM A;  3K4C A;  1UB9 A;  1KU2 A;  2X1E A;  5GP9 A;  3I58 A;  3MAJ A;  2L01 A;  5EEH A;  1R58 A;  2BW3 B;  2FBI A;  2FSW A;  3WE3 A;  1LDJ A;  2Y30 A;  4M6V A;  4UUT A;  4EM2 A;  3COA C;  4XOP A;  2I8D A;  4FT8 A;  2CSO A;  5C4J J;  1J2X A;  4NQW B;  4HNT A;  1ZG5 A;  1Y39 A;  4LMY A;  3KFW X;  4PK4 A;  4ESB A;  2E2H J;  1Y8Q B;  1BI3 A;  4RLF A;  3FMQ A;  4PSW A;  1HKT A;  2JA8 J;  2CJJ A;  3RQI A;  4CA0 A;  2B0L A;  1Y0N A;  4G7H F;  4CZC A;  1BBY A;  5EDN A;  1NG6 A;  2Q1Z B;  2QA4 I;  4Q48 A;  4W1U A;  4ANJ A;  4R79 A;  1IDZ A;  5FRM A;  1H9G A;  1STZ A;  3EUH A;  4YEJ A;  4XLP F;  1BR4 A;  1WFX A;  2K3P A;  2NS7 A;  3ZMS A;  4OIQ F;  5D5U B;  1FPQ A;  4Y33 A;  4XLF A;  3OYC A;  5J40 A;  5IT3 A;  1FTT A;  3S1M J;  2V1X A;  3GTK J;  4HX8 A;  3CO6 C;  2CFO A;  5FFX A;  2DCE A;  2DJN A;  2M5W A;  1J59 A;  4IXA A;  5GPC A;  2K86 A;  3GZ6 A;  4HDU A;  3JRE A;  3K4J A;  5E3O A;  3PO3 J;  5J1R A;  1PYV A;  2KPM A;  2LMD A;  2HKX A;  2XPU A;  4QLC U;  5L3E A;  3ZMD A;  2R93 J;  3HSF A;  4BBS J;  1NK3 P;  1Y1V J;  3J7A O;  1Q1H A;  1P2F A;  2OV7 A;  4OIP F;  3WTV C;  5IP6 A;  2W00 A;  3IKV A;  2KIU A;  1FJL A;  3PFY A;  4C2T A;  1Y1W J;  1IXR C;  3GWZ A;  3EDP A;  2K5C A;  2JJ7 A;  4G12 A;  2XF7 A;  3VDX A;  3M1C A;  2F5V A;  3BJA A;  2UXN A;  3EUH C;  4A0Y A;  3JRF A;  1PP7 U;  2R5Z B;  2EA4 A;  1OCP A;  1OCC H;  2A05 A;  3DKW A;  3W2V A;  4A3G J;  5JLX A;  1YLF A;  4XK4 A;  4IHX A;  4JK1 X;  1U8R A;  2VL8 A;  4OAZ A;  2BXY A;  2QWW A;  3O6B B;  4A0Z A;  3CCJ I;  3VFZ A;  1Q1V A;  4PZJ A;  4A3I J;  1TNT A;  3TO7 A;  2ETH A;  3DKY A;  3CO7 C;  1G6N A;  5HOD A;  1T56 A;  5HLI A;  5K7Z A;  1N78 A;  4XSZ F;  3OYE A;  2XDV A;  3L2V A;  1HOM A;  5EEA A;  1DDN A;  1FT9 A;  3HGY A;  1HW2 A;  2HWV A;  3RCO A;  1ACI A;  4MQ9 F;  5JVT A;  2E1M B;  1ORK A;  2ZFU A;  2DQR A;  1J0R A;  2LDU A;  3I0T A;  4D0P A;  2IS2 A;  2WB1 N;  3CDI A;  2PG4 A;  5FKM A;  4F7Z A;  4M74 A;  1MBK A;  3ZQI A;  4D7N A;  5LRS A;  4FX0 A;  5BOX A;  3JW4 A;  2CUJ A;  2YR2 A;  4BQN A;  2WV1 A;  3QP5 A;  4LIT A;  4P55 A;  1BIA A;  3ZQH A;  2F4I A;  2FU4 A;  1QRY A;  2XB5 A;  3FZV A;  2EFN A;  2F5D A;  5CVV A;  2LYC A;  3S1R J;  1OCZ H;  2I10 A;  5C44 J;  2FJ1 A;  2RVC A;  4BQA A;  3HOT A;  1FMW A;  2XF5 A;  3RZO J;  4G6Q A;  2HVQ A;  1F5T A;  3IRQ A;  2VOO A;  2B7E A;  2XAJ A;  1I1S A;  3H5R A;  3MKZ A;  3TQN A;  4M9S A;  9ANT A;  1Z0X A;  1ZTR A;  5J1Y A;  3ZMU A;  3PNY A;  2MYS A;  1A6I A;  1BL0 A;  3L2W A;  1WH7 A;  2NVQ J;  3KEY A;  3JAM K;  4DW6 A;  1ZLK A;  4O3M A;  1BOA A;  2QQ9 A;  4DZP A;  4BHC A;  3KZY A;  5L3C A;  2ZO4 A;  3KPH A;  2ME0 A;  1YW7 A;  2COB A;  1IO2 A;  1M1E B;  3WTY C;  4DJA A;  1KYZ A;  3K4N A;  4BDY A;  2XF6 A;  1R36 A;  4Y3O A;  5KAF C;  3ABL H;  2DA7 A;  1FP1 D;  2DFH A;  3HG9 A;  3PM1 A;  3TOA A;  1WZ2 A;  3LOC A;  1XC5 A;  5LGU A;  2P5K A;  1EKE A;  3E5X A;  3G1L A;  5CVU A;  1LVK A;  4KFC A;  3GXO A;  3OIQ A;  1UG0 A;  3ONQ A;  3GUD A;  2MLK A;  5DM7 F;  3IC7 A;  2LH9 A;  2VBY A;  1XSV A;  1KON A;  1PP8 F;  3CMA I;  1IN7 A;  2WWY A;  4IHV A;  1P7I A;  2K9S A;  4IOA F;  1ZHF A;  3JRB A;  3RZD J;  4BQO A;  2L9R A;  4E7I A;  2GZW A;  2ID3 A;  2OZ6 A;  5TRD A;  4AYB A;  1R5H A;  4BXU A;  3SJM A;  1ITY A;  2HDC A;  4HPQ A;  3Q0V A;  3H9G A;  2D1V A;  1SMT A;  3MEX A;  1YX3 A;  1V4R A;  1WKM A;  4PJJ A;  5KHD A;  4UVB A;  2ZSH B;  1OPC A;  2O8K A;  5FO5 A;  2IS4 A;  4XIC A;  3LSK A;  2GM4 A;  3G2B A;  2H94 A;  3PSI A;  3LFU A;  4CZZ A;  5HDN A;  1P7J A;  3HSR A;  3RPU A;  3Q0W A;  2KHM A;  2QSF X;  3RYR A;  2P81 A;  2QF7 A;  2A61 A;  4P5O A;  2Y0M A;  3MZ8 A;  2Z3Y A;  1Z7L A;  4Y7N J;  5B5E C;  4OIO F;  3MN2 A;  3K7A J;  3ZMZ A;  4MTD A;  1K79 A;  3GF2 A;  3DTE A;  4A3B J;  2PX9 A;  3I71 A;  1ZYR F;  3HPG A;  3K1N A;  5LHH A;  4ENJ A;  3Q9V A;  2K9M A;  4PSX A;  1A36 A;  4C9Y A;  3D0S A;  2IW5 A;  4B3A A;  1UHW A;  2X6Y A;  4CH7 A;  2HTJ A;  3IH4 A;  3IRR A;  4RB0 A;  1IN5 A;  4DYR A;  4X6A J;  3HKZ N;  3ZOB A;  1S29 A;  1FIP A;  1GV5 A;  1HKQ A;  4C3I J;  5LLQ A;  4UUS A;  3DLA A;  4V2F A;  1PUF B;  3PJR A;  1JKR C;  2LBF A;  3S93 A;  1EV7 A;  4F93 B;  1VQ8 I;  4BAY A;  4HF2 A;  1D1B A;  2EIK H;  4AD9 A;  2JZY A;  1T08 B;  2NVX J;  2BVM A;  3ZXS A;  1BM9 A;  5IOZ A;  1RZ4 A;  4IPA A;  4MIM A;  2F4O B;  3F8M A;  1KA8 A;  2FE3 A;  3J81 Z;  1OCT C;  1IV8 A;  2NRA C;  2XC7 A;  4D5F A;  2VC0 A;  3W6K B;  1WQ2 A;  1PVE A;  4HX7 A;  4G7Z F;  3A2K A;  4CYC A;  3J80 K;  5F0C A;  1ZRD A;  2LNB A;  5E3M A;  1CGP A;  5A2Q Z;  2IA1 A;  3T8T A;  3ROU A;  2BEO A;  2Z2S B;  4M6Y A;  3DTK A;  5GTH C;  1V55 H;  3CUQ A;  2XPV A;  3OY9 A;  1GXP A;  2LF7 A;  5IYB J;  3OSF A;  2VXZ A;  3B02 A;  2YSR A;  4M3F A;  4IJA A;  3S2D J;  2UV1 A;  2LG4 A;  4BS9 A;  5DV5 A;  2ESH A;  3F72 A;  4CO8 A;  3AG4 H;  2L5Q A;  3QPT A;  3LWF A;  2HZT A;  4A3L J;  2QQB A;  2NOG A;  1QZY A;  4I99 C;  3WHB A;  1VQ7 I;  2VBW A;  3HUG B;  3F9K A;  3T0Y A;  3DP7 A;  2QQA A;  2EV0 A;  3V7R A;  3M07 A;  4E6K G;  5KK1 A;  4JYK A;  3DBR B;  3FKI J;  2ZJP F;  4RA2 A;  5DYM A;  4C3H J;  2FD5 A;  1JGS A;  4RGU A;  4OAY A;  1IGN A;  4OOI A;  1VQL I;  1T2K A;  4AUX A;  4M3G A;  2BE5 F;  1G4D A;  1HXD A;  3DPL C;  1ETO A;  4FAS D;  3MFK A;  1VQ6 I;  2I5U A;  2Z99 A;  5K7H A;  2JSC A;  1D0Y A;  4I09 A;  4U0V A;  5LRR A;  5F04 A;  3CUQ C;  1MNM C;  3F8N A;  2KZV A;  1QZE A;  4FE7 A;  2CW0 F;  1IXC A;  2XRL A;  1RR7 A;  1MJ9 A;  2H1L A;  1KYW A;  1R5I D;  2F2E A;  5IPA A;  1MKM A;  3IWZ A;  3P9K A;  3VPR A;  4XLA A;  5HNH A;  2R7W A;  1FYL A;  4A3M J;  4LIU A;  4YIR X;  3E6D A;  1IAW A;  1A31 A;  2V9K A;  3SZG A;  1J7K A;  5FLV A;  3I59 A;  3O3K A;  3GLX A;  3TL4 X;  4XN3 A;  3F22 A;  1W36 C;  2O8X A;  2HQR A;  4YFX F;  1OYI A;  3IL2 A;  3RKQ A;  2A68 F;  3ZQF A;  5FLM J;  3BDD A;  3KP6 A;  1V54 H;  1QNT A;  1BI1 A;  1TW2 A;  1VTN C;  2BXZ A;  4BXX J;  1V5E A;  3HKZ A;  3BTJ A;  1IN8 A;  4CDG A;  2FOK A;  1N25 A;  2AO9 A;  2CH0 A;  3S1Q J;  1JUP A;  1ZLJ A;  2QSG X;  4A6E A;  3JRH A;  4EQQ A;  4PGH A;  2HYG D;  4GYG A;  5IYD J;  4P9U A;  3ABK H;  1BN5 A;  1LUJ B;  2V26 A;  2BYV E;  1V3F A;  3WTZ A;  2O6G E;  2KRH A;  2JVG A;  3FXQ A;  2KQR A;  2W7N A;  1MBG A;  4BY1 J;  1Z3X A;  3ZQQ A;  3E97 A;  3N4M A;  3L2R A;  3WTT C;  5DTD A;  4ESJ A;  4B09 A;  3BQZ A;  4A3K J;  3KCC A;  2ZXW H;  2R7R A;  5IT9 K;  3OWT A;  5LEJ A;  5KAI C;  2DJI A;  2FA5 A;  3TW7 A;  3S2W A;  1U5T A;  2YX4 A;  2WA0 A;  1O7L A;  3AG3 H;  5M5X J;  2QLZ A;  3K10 A;  2Z1D A;  5CKT A;  3I9V 2;  2FBH A;  3LSJ A;  2CRG A;  3ECO A;  4A5M A;  2QBY B;  2DFE A;  2QEN A;  2VUM J;  1P4A A;  4W97 A;  1BW6 A;  1ETK A;  3PQK A;  2VON A;  1GUU A;  3WOD F;  2PQ8 A;  5IYC J;  4ENK A;  2LBF B;  3HGG A;  4NQW A;  4BQQ A;  4OIN F;  4CCJ A;  2ELK A;  2W84 A;  4L9V A;  2IPQ X;  3FX3 A;  2BHZ A;  2DYS H;  3CJR B;  4U7B A;  5ICC A;  1E3H A;  5IY5 H;  1Z91 A;  1X2M A;  2R7Q A;  5H6Q A;  2RNG A;  4I01 A;  4LLN A;  1R49 A;  2PI0 A;  1FEX A;  2R7F A;  1A35 A;  1ZN2 A;  4FIS A;  1YRN B;  3BWG A;  4OIR F;  1U5T C;  1XG1 A;  5D5X B;  4B47 A;  2V6E A;  2R7T A;  4PFO A;  4XLE A;  2DN0 A;  2A5W A;  4ZDL A;  3FHN A;  1X1A A;  3CUQ B;  3IH2 A;  2HXI A;  5TGT A;  2ZME A;  3BJ6 A;  3VYT B;  5AIP A;  2MA3 A;  2ZXH A;  3BR1 A;  3F8B A;  3GTP J;  3GEZ A;  4D5C A;  1SFE A;  2YU3 A;  3WGG A;  1FBU A;  1BIB A;  2K3F A;  4D1Q A;  4BU2 A;  2JVH A;  2KJB A;  3PUB A;  1MDM A;  1MJB A;  4XKV A;  4NUB A;  2STT A;  1IC8 A;  2EK5 A;  2Y75 A;  1H0M A;  4HYE A;  4ZTJ A;  2CMP A;  3V7S A;  1YIO A;  1YS7 A;  2NAZ A;  4UV8 A;  4XNF A;  3ZQG A;  5DS9 A;  1DU0 A;  5K5Q A;  2V1U A;  3QYF A;  5JVG F;  4AIK A;  1J5Y A;  2YUS A;  1ERD A;  2LY2 A;  2W57 A;  3WG7 H;  4ZYE A;  3FM3 A;  5TIS C;  4BY7 J;  4M3D A;  1FX7 A;  4JQF A;  5KVR A;  4BJT A;  2ICW G;  2UZK A;  4IX7 A;  1UCR A;  5GPA A;  2YS9 A;  5FKO A;  3CC2 I;  1S5L C;  1SAN A;  3D5L A;  3CZ6 A;  2R3S A;  4AID A;  2ZME C;  3ZRG A;  2XAQ A;  2M8G X;  5KCM A;  4IEJ A;  3JRD A;  4LLL A;  3H0D A;  4XRS G;  4EGZ A;  1KQ8 A;  4EGY A;  2KP6 A;  2EJR A;  5CPR B;  3PUF A;  3M1E A;  5GAE J;  3I64 A;  3E7L A;  1SFU A;  5CVR A;  3LQR A;  3GFJ A;  2W4S A;  3CJQ B;  3S3N A;  2O9L A;  4E7J A;  4EJW A;  3I59 B;  1B4A A;  1D1C A;  1RPW A;  3M8E A;  4YIF A;  3ULQ B;  3K1P A;  1W5S A;  5BMZ A;  2XUB A;  1IUY A;  1G59 A;  2XGX A;  2IA2 A;  2B9S A;  2JA7 J;  1IRX A;  4MGR A;  4GDF A;  1YOV B;  3TED A;  2PBI A;  2VKV A;  1HDP A;  1U9O A;  3W6J B;  4YEL A;  1BJA A;  4UB8 C;  2XKP A;  4H0E A;  1QU3 A;  4QPQ A;  2VBX A;  2X4H A;  3AG2 H;  1K61 A;  1OCO H;  1SC7 A;  2ME6 A;  4BE1 A;  3DU5 A;  3R4K A;  4IL6 C;  2GLO A;  4HW0 A;  5FGM A;  2X48 A;  1UAA A;  2YX7 A;  4Y13 A;  3MMY B;  3DU6 A;  5F6F A;  3HOX J;  4HQM A;  1QHG A;  1QVT A;  5J47 A;  2PMU A;  4ZJZ A;  3FXR A;  2E19 A;  3M8J A;  4XM3 A;  2DFF A;  3H3V K;  1BJZ A;  4NC6 A;  2NYX A;  1HKS A;  1U5T B;  2M8E A;  2ADU A;  4RAG A;  2DBB A;  3C1D A;  2E1M C;  2CUE A;  4BHB A;  1YE9 A;  4BH9 A;  3IAM 2;  4E4H A;  1UEL B;  4CXF A;  1TWG J;  4X0G A;  1OLT A;  2OUM A;  1D3Y A;  3ISP A;  3DBL B;  3KLO A;  1JE8 A;  4KIB A;  2FQ3 A;  4Z2Y A;  1F43 A;  2K85 A;  3C7J A;  6PAX A;  1MGT A;  2KL4 A;  4BJ6 C;  3A03 A;  2IEK A;  5LBQ A;  2LF8 A;  5M5W J;  4OMY A;  1JXS A;  1MMS A;  4XR6 A;  1HW5 A;  3QQA A;  1U78 A;  3OYK A;  2EBI A;  4XLC A;  2HVR A;  1K7A A;  1QPI A;  1X19 A;  3G71 I;  4XKB A;  1TT5 B;  3HOV J;  1W5C C;  5ILS A;  2DXI A;  2EFW A;  1BI2 A;  1R5G A;  4LK1 F;  4ABZ A;  1WJ5 A;  3V8K A;  1JHH A;  2NNN A;  3FXJ A;  3OYH A;  2DTR A;  5FFZ A;  2QQ8 A;  1R1V A;  3EUK L;  1LKX A;  3J80 Z;  5EG0 B;  3JTH A;  2LTP A;  1G3S A;  1T6S A;  3TP3 A;  5FLX K;  1FNN A;  1T0F A;  2CQQ A;  1G3W A;  5FJ8 J;  1IN4 A;  3MCZ A;  1G3Y A;  2ZME B;  3WU1 B;  4R1H A;  3SEQ A;  2D5V A;  2W25 A;  2P7V B;  3IWF A;  2W82 A;  5F27 A;  2LD5 A;  1T38 A;  3SDG A;  3HHH A;  1ULY A;  2CG4 A;  3C18 A;  3LSH A;  3OV8 A;  3DEW A;  3LA2 A;  4YFN F;  1DP3 A;  3ZN1 A;  3ZN0 A;  1XGM A;  1R23 A;  3HOY J;  1XMK A;  3MKL A;  4HNU A;  1MDM B;  5IP9 J;  3JR9 A;  2JA5 J;  2LOO A;  2IGO A;  1TQP A;  1YJN I;  3IP4 B;  4EM1 A;  2M30 A;  3CJT B;  5FKK A;  3JRI A;  3HL2 A;  2P6T A;  3ERE D;  1X3Z B;  3PIO F;  4WK8 F;  4LG3 A;  1B59 A;  2E7W A;  1A6Q A;  3HEF A;  2CGP A;  2E7X A;  3GZ5 A;  2Q2E A;  3S16 J;  5J8C A;  3OR2 C;  2X1D A;  2O03 A;  2F6C A;  3G1M A;  2E2J J;  2YU9 J;  3UKG A;  2BVL A;  2DOE A;  2EWN A;  4WXD A;  1YQA A;  2MD0 A;  5LGT A;  2XKO A;  3A0H C;  5IOY A;  4ZDP A;  5B66 C;  2VAS A;  4A0X A;  1VQ4 I;  3OSG A;  2DLL A;  3ABM H;  4G6D A;  4XMY A;  2XAH A;  4AYB N;  2MBF A;  1T0F C;  3I55 I;  2M1B A;  3U1K A;  3LST A;  3KYL A;  1PUF A;  3AFH A;  1S9H A;  2DDB A;  5F64 A;  2ZCW A;  3QWL A;  3R0A A;  4I2O A;  5F1J A;  1HW1 A;  3LAJ A;  2OZU A;  1Y8R B;  3I56 I;  3DCF A;  4L5J A;  3L00 A;  2DA3 A;  3BCA A;  3ASO H;  1ODD A;  4NBQ A;  3JCU C;  4XKC A;  1K83 J;  3DBH B;  3RKY A;  2Q8K A;  5JI6 A;  2L7M P;  4X1E A;  2EZL A;  2XGE A;  2W48 A;  4IKF A;  3H0G J;  3FWE A;  1VF9 A;  3HB9 A;  3K4K A;  2L7Z A;  4PDK A;  3WTS C;  1P4W A;  1OFC X;  3KE2 A;  1WJF A;  2JN6 A;  4XON A;  5EGO A;  3UR3 C;  2K27 A;  1GVJ A;  1YW9 A;  3FXL A;  1Z7U A;  4ESF A;  2VN2 A;  3OL4 A;  4JX6 A;  3LFK A;  4N4O B;  5ERI A;  1H9T A;  1N75 A;  4N9I A;  2R7O A;  2RKH A;  1BI0 A;  5L3D A;  4PJL A;  2L7F P;  2O0Y A;  4HLX A;  4IHW A;  3U2R A;  2JTV A;  4XLN F;  1S8N A;  3SZT A;  1JUS A;  4IRG A;  1JGG A;  1Z1D A;  3ABT A;  2DW4 A;  3A1Y A;  3GVA A;  4ITV A;  2CWE A;  4KIF A;  2W1O A;  1FIA A;  3HUG A;  4XSX F;  1H8A C;  2DTZ A;  2EH3 A;  2STW A;  4NDL A;  4AIH A;  2QSH X;  5IT9 Z;  3CJN A;  5DD4 A;  2DPU A;  4RS8 A;  2LRD A;  2ZBK A;  5DUK A;  2VKD A;  2FXA A;  2EFQ A;  2K02 A;  3GTQ J;  1DGR M;  2HEO A;  3VYR B;  1I3Q J;  1HCR A;  4GFB A;  1B1B A;  2HFH A;  1W5T A;  2LVS A;  3K4M A;  5E1X A;  3H35 A;  2L2O A;  4V2G A;  4I0A A;  1SFK A;  2L7K A;  2ID6 A;  2OPT A;  3TO6 A;  2GXG A;  2TRT A;  3KYD B;  3RQ4 A;  2E60 A;  3DWL E;  2Y0S A;  4KIS A;  2K4J A;  4N0B A;  1OYW A;  3H3U A;  2K9N A;  3FIW A;  2WAQ A;  1X1C A;  2QUF A;  3OIP A;  4I0B A;  4U0Y A;  1S3J A;  1WI3 A;  3I5U A;  5D8L B;  4HSR A;  5HS7 A;  5AON A;  2V79 A;  1V5G A;  4ASN A;  2MAB A;  4RB3 C;  2IRF G;  1Z05 A;  3BQY A;  3D1N I;  2UWM A;  2AHQ A;  2M87 A;  2VKH A;  4MFE A;  1XPX A;  4ZYG A;  4II3 A;  4AVP A;  1WSU A;  2XVC A;  4L9T A;  3CCE I;  4WCG A;  3VWB A;  2QCO A;  4PFP A;  4II2 A;  3FM5 A;  1I6X A;  3F8F A;  1MMN A;  2ELJ A;  1XTA A;  3L1P A;  2E1N A;  1LJ9 A;  3I53 A;  3C3W A;  1CQT A;  1E0E A;  3H92 A;  3F0C A;  2HDW A;  1IRF A;  4C3J J;  2QKM B;  3RJP A;  5J8F A;  5FD6 A;  2H8R A;  1G2H A;  1MMG A;  2BY1 A;  4BYY A;  2FMY A;  3LSM A;  2F5F A;  1SD6 A;  3HSE A;  3RIR A;  3BOQ A;  3EQL F;  2KIQ A;  1U6G A;  2LKS A;  4RM3 A;  1IW7 F;  3BZK A;  3DPT A;  3FK6 A;  2Q2E B;  3VEP A;  1W7P D;  4S04 A;  1ZQ3 P;  2IGK A;  2GA1 A;  3HJE A;  1MJA A;  1TWH J;  3EYY A;  2L9S A;  5CJ9 A;  4OMZ A;  3G4S I;  3H5A A;  3B6A A;  4CCL A;  3VSK A;  1R9T J;  3BR3 A;  2NXN B;  4ZYD A;  2QBY A;  3BTL A;  4MEY F;  3BTC A;  2VJI A;  3K70 C;  4UHT A;  4NNJ A;  2ISZ A;  1FTZ A;  3P9C A;  2K4B A;  3E5Q A;  1JJ8 C;  1KQ0 A;  4EM0 B;  5FRN A;  4ENN A;  4CCM A;  2DMT A;  3HYI A;  4WXH A;  2H8W A;  5GAG J;  1UJ8 A;  1Z6T A;  4EV0 A;  3MD2 A;  4UY8 I;  2PN6 A;  4RB2 C;  3W2A A;  2JT1 A;  3W2W A;  4HG2 A;  4A69 C;  1HDD C;  3FKJ A;  2DFI A;  4CCK A;  3RSN A;  1B9M A;  1LPQ A;  1X58 A;  4DBR A;  3KZZ A;  1NH3 A;  2HOT A;  1U9N A;  5K7F A;  2JK3 A;  4HEA 2;  3U1D A;  1YO5 C;  1D5V A;  4KIC A;  4FX4 A;  1YRN A;  1DU6 A;  4HNV A;  5DEQ A;  4IVN A;  2IXS A;  5LGN A;  5FRO A;  5EGO B;  2H1K A;  4ZC3 A;  4UNO A;  1UST A;  4PJN A;  5JHF A;  1MBH A;  2ESN A;  4S05 A;  4XRS A;  1D8J A;  3IKT A;  1DGW Y;  1X3W B;  2MG4 A;  2XAG A;  2LRE A;  4RB1 A;  3KYC B;  4C30 A;  2Q0O A;  2HU9 A;  3F3X A;  1XSD A;  1K6O A;  1VQK I;  2LY9 A;  3HXL A;  2PLY A;  3ESW B;  1XB4 A;  4ZH4 F;  1QHH D;  4IHT A;  5E20 A;  1RKT A;  3TO9 A;  2KZG A;  4AVZ A;  2M34 A;  2VC1 A;  3QYE A;  4BHP A;  4A3E J;  4WF2 A;  3CQZ J;  5FB2 A;  4RDU A;  1FOY A;  1WCM J;  1HC8 A;  2QYO A;  4XBF A;  1WH5 A;  2LKP A;  1ENH A;  3NWS A;  1EA3 A;  3O8G A;  2O61 A;  1KQ9 A;  1I39 A;  4KN7 X;  3DEU A;  1IF1 A;  5ICG A;  1TP4 A;  3HIF A;  2J5P A;  2FQ4 A;  2JUG A;  2WTE A;  5ILU A;  1RKW A;  2ZJ2 A;  4XRF A;  1X4P A;  4WX9 A;  2EQR A;  3GFL A;  4LB5 A;  1V5F A;  2RQQ A;  4UB6 C;  1K4T A;  3QPS A;  3LSI A;  1KU9 A;  2CW7 A;  3VB2 A;  3CD6 I;  1PUE E;  2CQ7 A;  3V8L A;  1VQP I;  1XDS A;  1MH3 A;  2H6C A;  2PEX A;  5BPD A;  3T8R A;  4M71 A;  3WGH A;  4B48 A;  5ICF A;  4RAF A;  3GW2 A;  2F5C A;  3V8J A;  2KLO A;  3QOP A;  4MQV A;  4PGG A;  2VJ5 A;  1SVM A;  3HRT A;  2JPC A;  5EJC A;  4KMU X;  2WAF A;  3OR1 C;  2A6T A;  2NS0 A;  4ZDO A;  2X51 A;  3AAF A;  5HDG A;  3LNQ A;  3RKW A;  2NNY A;  1MSF C;  3AG1 H;  3TDZ C;  5LHG A;  3B73 A;  1YW8 A;  4YII A;  1G3T A;  3OYG A;  2A07 F;  3JSP A;  3GCM A;  1JI8 A;  3PSF A;  1SD4 A;  5K5R A;  3D5R C;  5FLX Z;  3BG7 A;  1Z21 A;  2JA6 J;  1E3O C;  1TWA J;  3M9A A;  4RBO A;  1LEA A;  3HOU J;  3IV5 A;  3FBI B;  4BJ5 C;  4XLH A;  5HNF A;  1QZZ A;  1E3P A;  1RI7 A;  1SAX A;  5AIQ A;  3TP0 A;  2D2W A;  2EZH A;  3GFM A;  1VQN I;  1UZC A;  3Q3S A;  3LQQ A;  3X2Q H;  1ZR4 A;  1W0U A;  2OTJ I;  2E1C A;  2HPI A;  1OCR H;  3JTG A;  2OBP A;  3I4P A;  2HYJ A;  4C2M J;  3V7C A;  3CCV I;  3ZMT A;  2V6C A;  4HA8 A;  1ZG3 A;  4MFD A;  3H3Z A;  2HR3 A;  2DA1 A;  3E5U A;  4I7H A;  4KDP A;  1HF0 A;  4Q47 A;  1KZH A;  5D5W B;  1R6R A;  1RC9 A;  1MMD A;  2RGV A;  2EPF A;  3TGN A;  2E36 A;  4ETS A;  3CCR I;  1FP2 A;  2DA5 A;  3LA3 A;  3SHF A;  2OA4 A;  1YFH A;  1OKR A;  2AS5 F;  1HST A;  2EV6 A;  3ECH A;  2VB6 A;  4M73 A;  2LFB A;  5J1U A;  3I4M J;  2X1C A;  2Z5U A;  1JKO C;  4A5N A;  5H20 A;  1JHF A;  3J7Y J;  2M4G A;  3MZY A;  4GYI A;  1YI2 I;  1FY7 A;  3GLL A;  4DGW B;  1MD0 A;  4LJZ F;  1TNS A;  4RAY A;  5JFR A;  1B6A A;  1MNE A;  4IHS A;  3FXM A;  3MQ0 A;  1ETY A;  1SMY F;  3CUO A;  3SFI A;  3BG5 A;  3KP2 A;  1SVL A;  3K1M A;  2DMP A;  2A6E F;  4IQJ A;  3JRC A;  2P7C B;  2COM A;  1TQM A;  1Z77 A;  2RV8 A;  4JBA A;  2ZFW A;  1F36 A;  2FOW A;  5BNG A;  4A3F J;  2L4M A;  4WXC A;  3VYU B;  1XCB A;  1IRG A;  3CTA A;  1FC3 A;  5CYV A;  1WHU A;  5EG0 A;  5GAD J;  4BE2 A;  3BG3 A;  5HVQ C;  3S8P A;  3BPX A;  3CCU I;  5GTI C;  3F6O A;  1RNL A;  3R60 A;  2YPR A;  2OF7 A;  4BKX A;  4IRI A;  1WGX A;  3KP4 A;  1GDT A;  1PJR A;  1UMQ A;  4GXO A;  1LFP A;  2BV6 A;  4D9J A;  3ASN H;  3R6S A;  2DA4 A;  1RR8 C;  4PCQ A;  3QPL A;  3FF5 A;  1MIJ A;  3U9G A;  3IHU A;  4E7L A;  1WJA A;  3GME A;  2VQG A;  2EFP A;  4C2U A;  1XN7 A;  1OJL A;  1SD5 A;  3OYM A;  3CES A;  2ZNZ A;  2A5Y B;  5LHI A;  1IV6 A;  3S17 J;  2RAE A;  3BZC A;  3H9Q A;  1GV2 A;  5H6R A;  2OU2 A;  3MKY B;  2IGN A;  2MFZ A;  2E71 A;  4H4K C;  3F23 A;  4DIQ A;  1CF7 A;  2WV0 A;  1O57 A;  3NEU A;  2DMN A;  2A3S A;  3OMY A;  1U0J A;  4XOT A;  3BG9 A;  3JAM Z;  4IOC F;  2OD5 A;  3BR5 A;  3F6V A;  4XN0 A;  3FDY A;  4M3B A;  3QRF F;  2R5Y A;  2M4K A;  1JJ6 C;  3PO2 J;  2RDP A;  4FE4 A;  2Z9O A;  2IA0 A;  4XRM A;  3HZJ A;  2BY3 A;  3E6M A;  2EIJ H;  5CQE A;  1LFB A;  3PIP F;  1F9N A;  2DK5 A;  3MVP A;  1C0W A;  2QEX I;  3K9T A;  4R8H A;  2ECC A;  2RRE A;  4L9N A;  4F3Q A;  4HOB A;  4G94 A;  1ZK8 A;  1FYM A;  3CMM A;  1Z6R A;  3DKX A;  1GHC A;  3CMY A;  1ETQ A;  3KET A;  4B4C A;  2HOS A;  2OTL I;  2VQC A;  1YX5 A;  2OQR A;  2P4W A;  2FNP A;  3PNV A;  3TMO A;  2GXA A;  2HQ5 A;  4GRI A;  3QAH A;  1MH4 A;  2KT0 A;  3HDD A;  1EJ9 A;  4BXF A;  2L3D A;  4BGD A;  1NHA A;  4IHY A;  4XQF A;  2M0C A;  1L0O C;  1DUX C;  5DD8 A;  3OL3 A;  1TW3 A;  3DPU A;  4KT5 C;  4M72 A;  5B3S H;  3ERM A;  3G3Z A;  2G0E A;  4A3C J;  1TTY A;  2BOL A;  3L9F A;  4J00 A;  2O5R A;  5F08 A;  3VOD A;  2EIM H;  1A04 A;  3E1S A;  5A2Q K;  3EPZ A;  2ELH A;  2DO7 A;  1JTY A;  5CVJ A;  3P7N A;  2M0M A;  2P5L C;  2DOF A;  3C2H A;  4Y52 J;  1P4X A;  3I3L A;  4EMS A;  1A5J A;  1YIJ I;  5LEK A;  1AA7 A;  1Z67 A;  2FF4 A;  1MBF A;  1X1D A;  4HX4 A;  4ZZL A;  5ICE A;  3I54 A;  2NOJ B;  1XSX A;  3HPH A;  5F1R A;  3OS0 A;  4G7O F;  2L0K A;  2JRT A;  2O3F A;  1VQO I;  3L2U A;  2KJC A;  4E7S A;  3FK7 A;  3DXJ F;  3LL7 A;  2IP2 A;  5M5Y J;  4KIG A;  1LDK B;  2BGC A;  1VQ9 I;  2XAS A;  5HOO A;  1T39 A;  1WPK A;  1MW7 A;  1J09 A;  1LEB A;  2ZB9 A;  3S15 J;  2VI6 A;  4XOR A;  4RGR A;  4HF1 A;  3A4C A;  5CLS A;  4M3E A;  2DQL A;  4OU0 A;  1D8K A;  3DF8 A;  1D0Z A;  1LFU P;  2BZT A;  3RTR A;  2QKL B; 
#chains in the Genus database with same CATH homology
 5IYB J;  2NVY J;  3OSF A;  4M3F A;  3BR2 A;  3S2D J;  3GTQ J;  1HLV A;  3CCY A;  1I3Q J;  1VI0 A;  1ZKG A;  2LVS A;  3ZQC A;  1LE8 A;  1HCR A;  4GFB A;  1H89 C;  2EZK A;  4V2G A;  4CYC B;  4A3L J;  2ID6 A;  2OPT A;  3M4O J;  2NOG A;  4A3J J;  2TRT A;  3WHB A;  1JTX A;  2KDZ A;  1I50 J;  4FCY A;  2K9N A;  3FIW A;  2CQX A;  4JYK A;  3HM5 A;  2LLK A;  3FKI J;  2CUF A;  2DA6 A;  5F0H A;  1TWC J;  4C3H J;  2CU7 A;  2FD5 A;  3GTL J;  1WI3 A;  1IGN A;  3M3Y J;  3C2B A;  4AUX A;  4M3G A;  1LE8 B;  1O4X A;  4D7M A;  1ETO A;  5K7H A;  1TC3 C;  1ETW A;  2X6O A;  2Y0S N;  3BQY A;  1AHD P;  1S7E A;  5F04 A;  1MNM C;  2MSY A;  2WAQ N;  4FE7 A;  3D1N I;  2AHQ A;  2XRL A;  4MFE A;  1RR7 A;  4EEF G;  5IPA A;  3VPR A;  4A3M J;  2QCO A;  3W6V A;  1JUM A;  2X9D A;  3HBL A;  3L1P A;  3ZQL A;  5FLV A;  2R5Z A;  1CQT A;  3F0C A;  2R5Y B;  2PMZ N;  2TCT A;  4QSH A;  4C3J J;  1B8I A;  1MSE C;  2H8R A;  1G2H A;  3RKQ A;  1ETV A;  3ZQF A;  5FLM J;  3A01 B;  3GTO J;  2XB0 X;  4L5E A;  3WHC A;  2LP0 A;  4LOC A;  2HOA A;  1XS9 A;  4BXX J;  5EF6 A;  3BTJ A;  2AO9 A;  3S1Q J;  1JUP A;  3FK6 A;  1ZQ3 P;  2VKE A;  4MLO A;  2DA2 A;  3JRH A;  2IBD A;  1TWH J;  5IYD J;  1IG7 A;  2NVT J;  3B6A A;  1R9T J;  3BR3 A;  5E3L A;  2R0Q C;  5EZH A;  3BTL A;  1MBG A;  4BY1 J;  3BTC A;  3IH3 A;  2K9Q A;  5DTD A;  1FTZ A;  1JJ8 C;  3BQZ A;  3K2A A;  4A3K J;  3TW6 A;  3FIS A;  3TW7 A;  2DMT A;  2LKX A;  1RES A;  5M5X J;  2R7Z J;  1JKP C;  3BR6 A;  3GTJ J;  4A69 C;  1HDD C;  3LSJ A;  2CRG A;  2ECB A;  1X58 A;  2HOT A;  1U9N A;  2M9H A;  3NAU A;  5K7F A;  3GTM J;  2JK3 A;  3HOW J;  3NAR A;  2VUM J;  3JRG A;  1B72 A;  4DYC A;  4W97 A;  1BW6 A;  1ETK A;  2XGD A;  1ZGW A;  3I4N J;  1GUU A;  4S0H B;  1YRN A;  5IYC J;  1DU6 A;  4HNV A;  1ETX A;  3GTG J;  3HGG A;  5EGO B;  2H1K A;  2ELK A;  4I76 A;  2LK2 A;  1MBH A;  1SFO J;  2VPR A;  4XRS A;  2DMU A;  2MG4 A;  3O8H A;  2GBY A;  2O7O A;  1X2M A;  2XGC A;  1QVU A;  5GP9 A;  2LY9 A;  3S1N J;  1IDY A;  4I6Z A;  1FEX A;  1JT6 A;  1RKT A;  1B72 B;  2Y30 A;  4M6V A;  4UUT A;  2M34 A;  3OIO A;  3HOZ J;  4FIS A;  1YRN B;  1NTC A;  1XG1 A;  4A3E J;  5C4J J;  3CQZ J;  2DN0 A;  2E2H J;  5C3E J;  3S2H J;  3IH2 A;  4RDU A;  2HXI A;  3GBG A;  1WCM J;  2JA8 J;  2CJJ A;  3RQI A;  2LR8 A;  3BR1 A;  1WH5 A;  1ENH A;  3GTP J;  4D5C A;  5EDN A;  3O8G A;  1IJW C;  1AU7 A;  4W1U A;  2FQ4 A;  3LSP A;  1RET A;  3JRA A;  1IDZ A;  1RKW A;  1IC8 A;  2EQR A;  2NS7 A;  2B63 J;  3QPS A;  1I6H J;  1POG A;  3ZQG A;  5DS9 A;  1DU0 A;  1MH3 A;  1FTT A;  3S1M J;  3GTK J;  2YUS A;  2R92 J;  1W0T A;  2DJN A;  3LSR A;  4BY7 J;  5GPC A;  4M3D A;  3JRE A;  5E3O A;  2M2E A;  3PO3 J;  4JP0 A;  5J1R A;  1D5Y A;  5GPA A;  2YS9 A;  5FKO A;  2XPU A;  3LNQ A;  3S14 J;  1SAN A;  1MSF C;  2R93 J;  3B6C A;  4BBS J;  1NK3 P;  1Y1V J;  2M8G X;  4IEJ A;  5F0F A;  3JRD A;  5IP6 A;  3BT9 A;  1FJL A;  2JA6 J;  4XRS G;  1E3O C;  1BW5 A;  1Y1W J;  1TWA J;  4RBO A;  2JJ7 A;  4G12 A;  4QTR A;  3IV5 A;  3HOU J;  1GT0 C;  2DMQ A;  3E7L A;  3TP0 A;  2EZH A;  2O9L A;  3JRF A;  1W0U A;  3Q3S A;  1ZR4 A;  2R5Z B;  4B1R A;  4A3G J;  1OCP A;  1RPW A;  5JLX A;  1B8I B;  2HYJ A;  4XK4 A;  4C2M J;  4IHX A;  1U8B A;  2JA7 J;  1AKH A;  4MFD A;  1Q1V A;  3TED A;  5J3L A;  2XSD C;  2VKV A;  1HDP A;  1U9O A;  2DA1 A;  4A3I J;  1HF0 A;  5HOD A;  1T56 A;  5K7Z A;  1H88 C;  1K61 A;  1HOM A;  2E2I J;  1BA5 A;  2DA5 A;  2ME6 A;  5EEA A;  3HGY A;  2E1O A;  2GLO A;  2X48 A;  1ORK A;  2LFB A;  5J1U A;  3I4M J;  4JX4 A;  1JKO C;  3HOX J;  2WB1 N;  1QVT A;  5FKM A;  1MBK A;  1VND A;  3ZQI A;  4D7N A;  2E19 A;  3H3V K;  2WV1 A;  1BJZ A;  3ZQH A;  3SFI A;  1ETY A;  3LSG A;  3BG5 A;  1QRY A;  2HDD A;  4DYQ A;  2XB5 A;  2MW8 A;  1GVD A;  2DMP A;  3S1R J;  2CUE A;  3JRC A;  2I10 A;  5C44 J;  2FJ1 A;  2Y9Y A;  1TWG J;  1Z77 A;  3RZO J;  2NS8 A;  3A02 A;  1F36 A;  5BNG A;  2FX0 A;  3BTI A;  4A3F J;  1F43 A;  3A03 A;  2IEK A;  5M5W J;  2Y31 A;  5EG0 A;  3BG3 A;  3QQA A;  1U78 A;  9ANT A;  1MBJ A;  1Z0X A;  1ZTR A;  2EBI A;  5J1Y A;  4J19 A;  1QPI A;  4QIW N;  2OF7 A;  1A6I A;  4BKX A;  1IRZ A;  1BL0 A;  1WGX A;  1GDT A;  1WH7 A;  2NVQ J;  1UMQ A;  3HOV J;  4DW6 A;  1APL C;  1ZR2 A;  2DA4 A;  4ABZ A;  4DZP A;  5IP7 J;  1EF4 A;  3QPL A;  2ME0 A;  2COB A;  3OOU A;  2HXO A;  1OJL A;  5EG0 B;  2LTP A;  3CDL A;  3TP3 A;  2DA7 A;  3PM1 A;  1IV6 A;  2RAE A;  3S17 J;  2Y2Z A;  1GV2 A;  2CQQ A;  3LOC A;  2XPW A;  1XC5 A;  5FJ8 J;  2Y9Z A;  1MBE A;  3G1L A;  2D5V A;  2DMN A;  5F27 A;  4A3D J;  2LD5 A;  3SDG A;  5M3F J;  2K40 A;  3BG9 A;  3BR5 A;  3DEW A;  4M3B A;  3G1O A;  2R5Y A;  4DZJ A;  5M3M J;  3HOY J;  3MKL A;  2JA5 J;  5IP9 J;  3JR9 A;  1JJ6 C;  4IHV A;  3PO2 J;  1P7I A;  2K9S A;  4FE4 A;  3A01 A;  3JRB A;  4XRM A;  3RZD J;  2L9R A;  2ID3 A;  5FKK A;  3JRI A;  3SJM A;  1LFB A;  1ITY A;  3Q0V A;  3MVP A;  5EYR A;  3HEF A;  2ECC A;  3S16 J;  3G1M A;  2E2J J;  1ZK8 A;  2YU9 J;  3UKG A;  2O8K A;  2N8G A;  4JX5 A;  5FKN A;  1JT0 A;  3Q0U A;  4XIC A;  2GM4 A;  3CMY A;  5IOY A;  1ETQ A;  2MGQ A;  4B4C A;  3OSG A;  2HOS A;  5EZG A;  1P7J A;  1T33 A;  3BR0 A;  4AYB N;  2IAI A;  3Q0W A;  2HQ5 A;  2P81 A;  2QF7 A;  4AC0 A;  1MH4 A;  2KT0 A;  3HDD A;  1PUF A;  4Y7N J;  5JLW A;  3MN2 A;  3K7A J;  1X2N A;  4A93 J;  1TWF J;  4IHY A;  5F1J A;  1IUF A;  2M0C A;  4A3B J;  4FTH A;  1NK2 P;  3DCF A;  2JMW A;  2G0E A;  4A3C J;  2DA3 A;  4B3A A;  3IH4 A;  5F08 A;  4BBR J;  1K83 J;  4DYR A;  4X6A J;  4XID A;  3HKZ N;  2L7M P;  4MO7 A;  3ZOB A;  4X1E A;  1FIP A;  2EZL A;  2XGE A;  2HI3 A;  2W48 A;  1GV5 A;  4C3I J;  3H0G J;  1JTY A;  3HB9 A;  1VF9 A;  1AKH B;  2L7Z A;  4V2F A;  4UUS A;  1PUF B;  1JKR C;  1OFC X;  4Y52 J;  2JN6 A;  5EGO A;  2JWT A;  1A5J A;  1MBF A;  2NVX J;  5IOZ A;  4MIM A;  5C4X J;  4JX6 A;  2L0K A;  1OCT C;  2EZI A;  1UHS A;  3FK7 A;  4D5F A;  5FKL A;  1VFC A;  5M5Y J;  1UG2 A;  2L7F P;  4IHW A;  4CYC A;  5F0C A;  1JUS A;  1WPK A;  1JGG A;  5E3M A;  5E3N A;  2ZB9 A;  3S15 J;  2VI6 A;  4UUS B;  1FIA A;  4M3E A;  1H8A C;  2DTZ A;  2EH3 A;  4NDL A;  2XPV A;  1LFU P;  1JKQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...