3A01A

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
molecule keywords Homeodomain-containing protein
total genus 26
structure length 78
sequence length 78
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01A00
1Y1WJ 2P81A 3JRDA 2R5ZA 3GBGA 5FKOA 5FKLA 5F04A 4DZPA 1DU0A 3OSGA 3HOUJ 3WHCA 2ID3A 4X6AJ 1MH4A 1Z0XA 3S17J 1WH5A 3PO2J 1JT0A 1FJLA 2NVTJ 1O4XA 3S16J 3BTLA 2XGCA 1MBGA 3QPLA 3BR5A 1OCTC 3LSGA 1T56A 1WCMJ 3HOZJ 1IJWC 3A03A 2NOGA 2XGDA 1GV5A 1TWGJ 5C4JJ 1AU7A 1TWFJ 3SFIA 5J1RA 4M6VA 1K61A 2COBA 2HI3A 2VUMJ 3NARA 5F0FA 3H3VK 1JGGA 1ITYA 2OF7A 3D1NI 1S7EA 1ETVA 5E3LA 3W6VA 5IYBJ 2JWTA 4S0HB 2M2EA 3S1NJ 4BBRJ 1JT6A 2Y31A 3ZQCA 3LSPA 3FKIJ 4G12A 1XS9A 5EYRA 2VKEA 3G1LA 2AO9A 3S1RJ 1UG2A 4C3HJ 1ZR4A 4B4CA 2WB1N 5FLMJ 5K7HA 3B6CA 3BG3A 2DMUA 1GVDA 2IAIA 2CRGA 5DS9A 2MGQA 2QCOA 1PUFB 2ECCA 5J1UA 5BNGA 2XSDC 4A3IJ 4IHXA 3S1QJ 3F0CA 1RKWA 5M3MJ 3A01B 3BTJA 3LSRA 4D7NA 1FIPA 1Y1VJ 3Q0VA 1SANA 1BW6A 1YRNA 2LR8A 2Y2ZA 1ETKA 2LLKA 3MKLA 1VI0A 4Y52J 4XICA 4EEFG 2EQRA 3S15J 1LFUP 3VPRA 2R0QC 2E2IJ 1YRNB 2TCTA 2DMPA 2EZIA 1W0TA 1P7IA 1APLC 3SJMA 2L9RA 4NDLA 1IG7A 1XC5A 4UUTA 1DU6A 3A02A 2R7ZJ 2EZHA 1RESA 1IDZA 2HDDA 1WGXA 1WPKA 4C2MJ 1X2NA 3BQYA 4B1RA 4UUSB 3BR6A 2ID6A 2EZLA 1RR7A 2NVXJ 1LFBA 5E3NA 4X1EA 3B6AA 2CJJA 2DN0A 1QVTA 4MLOA 3HOWJ 1IRZA 5J1YA 1JTYA 1X58A 2DA7A 4B3AA 4J19A 4ABZA 1OFCX 2NS7A 3CMYA 5HODA 2PMZN 2NVYJ 2NS8A 3TEDA 1EF4A 2YU9J 3A01A 4I6ZA 4IHYA 4A3MJ 4DYQA 3BR3A 1IV6A 5GP9A 3S2DJ 5IP9J 1RETA 5GPAA 2JA6J 4V2FA 2XRLA 3HOVJ 2DA3A 1TWAJ 4M3DA 3OSFA 1NK2P 1B8IB 3HGYA 1MBKA 2HYJA 4RDUA 1GDTA 3PM1A 3FK7A 4JX6A 1WI3A 4I76A 1SFOJ 1MNMC 2LFBA 2LY9A 4W97A 1U9OA 3JRBA 5C3EJ 2KDZA 1A6IA 4QSHA 2DA1A 4A3LJ 4DYRA 2L7MP 4D7MA 5FKKA 1JJ8C 1ORKA 1FEXA 2E2JJ 1PUFA 3RZOJ 3ZQGA 5F0HA 2TRTA 3ZQIA 4UUSA 4QIWN 3GTQJ 3JRHA 2I10A 4HNVA 1JUPA 4IHWA 4DYCA 4JYKA 3BG5A 2R92J 4IHVA 4L5EA 2LVSA 1FTZA 3O8GA 3ZQFA 4C3IJ 3IV5A 3JRGA 3UKGA 2MG4A 1ETWA 1F43A 5K7ZA 2GM4A 3CCYA 2HXOA 2M34A 4BXXJ 3ZQHA 1H8AC 2JMWA 1FTTA 2XPVA 3Q3SA 5C44J 4A93J 2R93J 3TP3A 5IP7J 1HDDC 1E3OC 3FISA 5E3OA 1W0UA 5GPCA 1XG1A 1LE8A 2LD5A 2E19A 1NTCA 5FKMA 2M9HA 5IP6A 2XB0X 2CQQA 1JKPC 1I6HJ 2G0EA 4MFEA 1HLVA 3GTMJ 5IPAA 2XPUA 1CQTA 1BL0A 1BW5A 3TP0A 2DTZA 3HOYJ 5IYDJ 2JJ7A 3PO3J 1Z77A 5EZHA 2H1KA 1B72A 5M5WJ 5IYCJ 2VKVA 4A69C 1QRYA 3Q0UA 4XRMA 4AC0A 1JJ6C 3GTLJ 3FK6A 5EEAA 1RKTA 3JRCA 2K9NA 1LE8B 2ELKA 4BBSJ 3OOUA 1MBFA 1H88C 4Y7NJ 2VPRA 1UMQA 3OIOA 1JKQC 2D5VA 4CYCA 1OJLA 1MBEA 4XRSG 3JRAA 1IDYA 3NAUA 5K7FA 4XK4A 3O8HA 4A3CJ 3HDDA 1IGNA 1AHDP 2LKXA 3G1OA 1MSEC 2DMQA 4A3GJ 2NVQJ 3BQZA 2DA5A 1ETOA 2LK2A 1B72B 3HBLA 1TWCJ 2AHQA 3LOCA 1B8IA 1R9TJ 4QTRA 3SDGA 5M5YJ 1P7JA 3DEWA 4A3FJ 1JKOC 4MIMA 2XPWA 2GLOA 1JTXA 3IH2A 3TW6A 1AKHA 4JP0A 2CU7A 1VNDA 2M8GX 5EG0B 2KT0A 2K9QA 3DCFA 2M0CA 2X6OA 1G2HA 3QQAA 4MFDA 2YUSA 1ENHA 2EBIA 3RQIA 4A3JJ 3WHBA 1U8BA 5JLXA 1MSFC 2JA5J 3CDLA 2GBYA 2MW8A 3JRIA 1VF9A 2Y30A 4XIDA 2XGEA 1ZKGA 4BY1J 2W48A 5FLVA 4A3KJ 3S1MJ 2FX0A 1TWHJ 3LSJA 3BTIA 4A3BJ 2WV1A 4RBOA 5F08A 2IBDA 3ZOBA 1HDPA 1BA5A 2L7FP 1U78A 3HB9A 5DTDA 3GTGJ 3BR1A 2Y9ZA 5EG0A 3E7LA 4V2GA 5M3FJ 1JUMA 1MH3A 9ANTA 3FIWA 2DA2A 4MO7A 1HOMA 3TW7A 1HCRA 4CYCB 2R5YB 2HQ5A 1QPIA 4FE7A 1X2MA 3MN2A 2YS9A 4W1UA 1GT0C 2EZKA 1IC8A 1IUFA 3GTKJ 1RPWA 2Y0SN 2ME6A 5M5XJ 1ETXA 3L1PA 3IH3A 2R5YA 3HGGA 5EGOB 4FTHA 4FCYA 2XB5A 3G1MA 1NK3P 2CQXA 4JX4A 2N8GA 2OPTA 2FQ4A 3RKQA 3S14J 4BY7J 3S2HJ 3Q0WA 4AYBN 4DW6A 4GFBA 2K9SA 5F27A 1UHSA 3CQZJ 1BJZA 2DMTA 5EZGA 3RZDJ 3LNQA 4LOCA 1AKHB 1I50J 4JX5A 3JREA 2H8RA 2ECBA 5IOYA 3MVPA 1OCPA 1K83J 2JA7J 2Y9YA 4D5CA 1MBHA 2E1OA 1ZGWA 1F36A 1POGA 2R5ZB 2X48A 2LP0A 1FIAA 4A3DJ 2LTPA 3I4NJ 4M3FA 2FD5A 2E2HJ 2O8KA 3GTJJ 2CUEA 3I4MJ 5F0CA 3M4OJ 2VI6A 3HKZN 1JUSA 1WH7A 2L7ZA 1A5JA 4A3EJ 2O7OA 1GUUA 2DMNA 5EF6A 4BKXA 2HOAA 3ZQLA 1VFCA 2WAQN 3BT9A 2ZB9A 2L0KA 3GTOJ 5C4XJ 2DA6A 2JK3A 1I3QJ 3BR0A 3C2BA 1Q1VA 5IOZA 3BR2A 3K2AA 5FJ8J 4M3BA 1ZTRA 2O9LA 2EH3A 1TC3C 2HXIA 4AUXA 2ME0A 4M3GA 4FISA 2JA8J 2DA4A 4M3EA 2RAEA 2HOTA 5J3LA 1U9NA 2JN6A 2FJ1A 1HF0A 3IH4A 3JR9A 3HM5A 3QPSA 5EGOA 1ZR2A 2QF7A 5FKNA 1ZQ3P 1ZK8A 3JRFA 3BTCA 5JLWA 3H0GJ 2HOSA 1H89C 1T33A 4C3JJ 1MBJA 3BG9A 2B63J 5E3MA 1D5YA 2K40A 3HEFA 4DZJA 3HOXJ 4XRSA 4IEJA 1GV2A 1QVUA 1JKRC 2DJNA 2X9DA 3K7AJ 1ETQA 4D5FA 1ETYA 2IEKA 4FE4A 5F1JA 3GTPJ 2MSYA 5EDNA 2CUFA 3M3YJ
chains in the Genus database with same CATH superfamily
1Y1WJ 3C2GA 2KRFA 3HTSB 2ZJRF 4E7JA 5FKOA 2Y69H 3T8RA 4NB5A 4PGGA 4DZPA 1IXSB 4PJNA 3HOUJ 1MNEA 3ML6A 1ZHFA 3ELKA 4FQGA 1Z0XA 1USSA 3BZKA 3S17J 3OS2A 2FA5A 3PNVA 2HR3A 1JT0A 2NVTJ 1MBGA 3BR5A 1U0JA 1OCTC 4HNTA 1T56A 1XGNA 2P7VB 1HW1A 2MABA 4EJVA 1BJAA 3PL8A 4BJTA 2XSJC 3CCLI 4KNYA 1B59A 2Z9OA 3CF2A 1YTYA 4M6VA 3RQ4A 2R7XA 1W1WE 1IZ1A 2NOJB 3ZN0A 1R36A 4ZJZA 5HVQC 3NARA 1KYWA 3KEOA 5K5RA 3CTAA 2D1VA 1ETVA 4LG3A 2RQQA 4LD5A 2ZNYA 2ZC2A 4BQOA 2L2OA 1YQAA 5H6RA 1ACIA 1V55H 2JUGA 2Y31A 3DU6A 3ZQCA 2HTSA 4PK4A 3I71A 1E17A 4E7IA 4KISA 2VKEA 1OQYA 2RNJA 3J81Z 4KUMA 3S1RJ 3CDIA 5DCFA 4A5NA 5LHIA 4CDGA 1USTA 2OQGA 3GCMA 2L7KA 4UNOA 3EYIA 3LSHA 4BEHB 3FWEA 4IQJA 3I4PA 3BG3A 3RDIA 3KYLA 4KT6A 2IAIA 5AONA 2CRGA 3VSLA 1K6YA 1IN6A 3QODA 2DPDA 1LFPA 2X1DA 3S1QJ 5LGTA 4CCOA 4PFOA 5FLXZ 1RKWA 4A6EA 4GO1A 4BXFA 3GX4X 3A01B 3BTJA 3HZJA 2K4BA 3I9V2 3ZN1A 4D7NA 3DP7A 4IRGA 1IUYA 2E1CA 4RAGA 4AWXB 2K27A 3T5XA 1OR7A 4PGHA 4LG0B 2R7TA 3WTXC 2LLKA 3BJ6A 4DBRA 4Y52J 4XICA 2EPFA 1R5GA 4OMZA 1Z3XA 3GFJA 4I2OA 2EQRA 3I59A 1QU3A 1W7PB 1LFUP 2X4HA 2R0QC 2VB6A 3LL7A 5D5WB 3ZMUA 3DFGA 2W85A 1APLC 2BEOA 2DFFA 2VONA 1XMKA 2X51A 1RRJA 5DCMB 4B44A 4NDLA 1ZG1A 1BR2A 1XC5A 1R23A 1X3ZB 2A68F 2AXTC 4PJLA 4LB5A 2CFOA 2KMUA 1RC9A 4NHJA 1R1VA 2MLGA 1RESA 3CZ6A 1G3SA 2M45A 4A12A 2HDDA 2YU3A 2WC2A 1YW9A 2O3FA 3U21A 3BR6A 2ID6A 2IA2A 1GLNA 3GXOA 3SZPA 4E7HA 2DT6A 4OOIA 2GWRA 3BCBA 2NVXJ 5E3NA 4X1EA 3EETA 1P9QC 1IW7F 1WJ5A 4MLOA 1DDNA 4CO8A 1IRZA 2VQGA 4AIHA 2QWWA 5DUKA 1JTYA 1WKMA 2NNNA 3H9JA 1HBXG 3HIFA 2NVUB 4ABZA 2R7QA 3HRMA 3ZR8X 3CMYA 1BC8C 1FBQA 1Y0UA 4WF2A 2NNYA 1EV7A 1D0ZA 2ZXHA 2X6XA 3C7JA 2JZYA 4I6ZA 2EFQA 4ENJA 4ZTFA 3T1BA 4ZDOA 3AFHA 1RETA 1FZPB 2ETHA 3J80Z 3PUBA 3WODF 2IW5A 3HOVJ 5E20A 4Y15A 3O2PE 2MLKA 3HRTA 4RGRA 1B8IB 5FFXA 2K9MA 1SFOJ 5KAIC 1R1TA 1TNTA 2H6BA 5ILVA 5C3EJ 2ELHA 2DA1A 4OAYA 4A3LJ 1XDUA 5ILSA 2BVMA 3WE3A 5FKKA 5CVVA 1EJ9A 4M9SA 4L9VA 2GA1A 4GYIA 2E2JJ 2ZO4A 1IRGA 3U1KA 3TMOA 1U8RA 2WV0A 5D5VB 2CH0A 4XQFA 2ZXIA 2KISA 1CF7A 4XKVA 3ZRGA 2EV0A 2UXXA 4U88A 3KETA 3JRHA 3J7ZI 4Y3OA 1JUPA 4BAYA 3V7RA 1YI2I 1V54H 2UV1A 3KFWX 2LKSA 3QP5A 4AU7A 5JVGF 4E7KA 2MYSA 4IHVA 1T0FA 4L5EA 4BL0B 4PFPA 2VE8A 1X19A 3O8GA 2CO5A 3K4MA 2KKOA 2MG4A 5ICGA 1F43A 3SXYA 5L3GA 2HZTA 2FQ3A 2I8DA 4ITVA 1HKSA 1S29A 3ZQHA 1LB2A 4KIGA 2AS5F 3O6BB 5BS6A 4A93J 2R93J 3L9FA 1N25A 5J40A 1W0UA 2L02A 1J9IA 3C2HA 3HSRA 1R49A 4NC8A 5FKMA 2M9HA 3E5QA 1Z6TA 2XB0X 2JUCA 3QYEA 3REOA 3QWLA 2AQFA 3R0AA 4N9HA 4XKWA 3V4GA 1JKPC 3VFZA 2XPUA 4L0YB 3DLAA 4HX8A 4EM0B 3OS1A 1YX5A 4RAZA 2JJ7A 5D4RA 2MD0A 4GYGA 4DOZA 1XTAA 3CCSI 4GRIA 3AAFA 1BC7C 1Z7UA 3Q0UA 3RSNA 2LOOA 5EEAA 2PJRA 3JRCA 2K9NA 1LE8B 2RVCA 4G6QA 2PN6A 3IC7A 1A35A 4Y7NJ 1LNWA 2V7FA 4ETSA 1MBEA 4XRSG 3KPHA 3ZQ7A 4EJUA 4XM3A 3HSFA 1DGRM 4IJAA 2WAQA 2EFOA 2OBPA 4A3CJ 1AHDP 2LKXA 4DIQA 2PQ8A 3TBIA 1QO0D 1B6AA 1FC3A 3HBLA 1Y8QB 2BY1A 1FMWA 1WSUA 3LOCA 4I98B 3UNGC 4RGUA 2R7WA 5M5YJ 1RIOH 5BOXA 4GGGA 1B4AA 1O7LA 4II2A 3QOEA 4HSTA 1YS6A 4LK1F 2GLOA 4LMYA 1JTXA 1KU9A 4JOMA 3AG3H 3TW6A 2HNHA 4CCJA 1VNDA 3E6CC 2M8GX 4EMSA 1T6SA 2RNGA 3DCFA 4GXOA 4EJWA 2M0CA 2X6OA 4EJTA 1K79A 1FBUA 2PBIA 5E1WA 1Z05A 2F5DA 2CV0A 5GAGJ 1VQ6I 2XF7A 1UJ8A 4PUSA 3TO6A 1P6RA 4YFKF 3WGIA 3OR1C 2MW8A 1XD7A 4XIDA 4BJ5C 4BY1J 3S1MJ 4A3KJ 1K4SA 3ESWB 1TWHJ 4Y17A 4A3BJ 2X0LA 2L9SA 4A0XA 4RBOA 3ZOBA 3TDUC 2MC3A 2E7XA 3HB9A 1LKXA 4HEA2 1QZYA 3VOEA 1R4NB 3DKWA 3N4MA 3SFZA 2CUJA 4V2GA 4F55A 4U7DA 5M3FJ 1MIJA 1JUMA 4CYCB 2QYOA 1Z91A 2KIMA 4P9FA 4FE7A 2HQNA 1H9TA 4BH9A 4F3QA 4DQ2A 4RM2A 3GTKJ 1RPWA 2IGMA 2V4JC 3OS0A 5ICCA 3DPLC 1FP1D 4AIKA 5EGOB 4J00A 2XB5A 3G1MA 1NK3P 1LDKB 3MZYA 4RAYA 1N77A 1VQNI 2M7BA 1V4RA 4FX0A 2FQ4A 4Q47A 1SMTA 2LH9A 3C3WA 3Q0WA 4DW6A 3KZYA 4C2UA 1UHSA 4B09A 1K7AA 2M5WA 3D0SA 3DU5A 4RM3A 4ESBA 1P92A 1XDSA 4ESFA 5DDGA 3ABUA 3RZDJ 1TW2A 1H9GA 3PQKA 1T98A 2V1UA 1E3PA 2OAZA 4JX5A 2H8RA 1L0OC 1YOVB 5IOYA 5HDKA 1K78A 1E0EA 1L3LA 1O3SA 1KQ9A 2OA4A 3AG1H 1SC7A 1I1SA 4PCQA 2E1OA 1XGSA 1WHUA 1FIAA 1J7KA 1QHGA 1KZHA 3I4NJ 4UB6C 4XLFA 4CCLA 4M3FA 4FT8A 1TQIA 4MTDA 4D0PA 5CVUA 4IRHA 4E6KG 3M4OJ 4AVPA 2WY7Q 1UCRA 3HKZN 5B3SH 1R71A 2ELJA 1IN5A 2A6HF 2DMNA 1SFXA 4DBQA 3ZQLA 4MNUA 2WAQN 2M1BA 5F64A 1OCCH 4L5IA 1RZ4A 3HJEA 5E18F 4RB1A 1MJBA 2XVCA 2ESHA 2QQAA 4I09A 4I02A 2DA6A 3OYFA 2W7NA 2FRHA 3K2AA 5FJ8J 3W2AA 2CS3A 2EH3A 4JBAA 4HDVA 1TC3C 3H5RA 3R61A 3G6EI 4FISA 2ZJ2A 1TBXA 2HOTA 1RUNA 3RIRA 1HF0A 1G8XA 1Y0NA 3FXLA 3JR9A 1Z67A 1D1BA 3QPSA 3J81K 3BDDA 4ENMA 2QF7A 3VB2A 1JE8A 5LGNA 4ZH4F 1S3JA 2JVGA 4LLNA 2R7UA 5DV5A 4O3MA 3CJTB 3M07A 2IGNA 4XOTA 3IUOA 4R1HA 1TLHB 1D5YA 1I5ZA 3CC4I 4XRSA 1DUXC 1LEAA 1GV2A 1QVUA 2RREA 3QYFA 2VXDA 3FXJA 1ETQA 5FO5A 3EDPA 1ETYA 2XAJA 1DP7P 3AG2H 2TDXA 3GTPJ 3JCUC 2CUFA 2RN7A 5HNFA 4P96A 3PUFA 3CCUI 3JRDA 1OPCA 3GBGA 3F21A 5FKLA 5F04A 4CCMA 1GXPA 2EA2A 4M71A 2BW3A 3OSGA 5D6FA 2EB7A 2HOEA 3BPVA 4YEJA 4X6AJ 2A6TA 1VQMI 1QNTA 4OU0A 4N0BA 1WH5A 4G7ZF 2OU2A 1FJLA 2RC4A 3MKYB 3S16J 2XGCA 2Y0MA 4R8HA 2IS6A 2K4JA 1WCMJ 2IP2A 3HOZJ 1JXSA 1VQ8I 1DGWY 3VODA 2BV6A 3H5NA 1Z7LA 2FMYA 1TWGJ 2W82A 1W4MA 5C4JJ 2CSOA 1TWFJ 1W7PA 2LMDA 2PMUA 1YS7A 3P9KA 3K4CA 2DI3A 2VUMJ 3CDHA 4BACA 4U7BA 3PIOF 3MAJA 3PSIA 1KONA 1ITYA 4DJAA 2IS2A 3W3CA 2RGVA 3LAPA 1O7FA 2C6YA 4XRFA 2M2EA 2P5VA 3S1NJ 4EVIA 5IY5H 2V9PA 2VOPA 4B3XA 1OCRH 2P6TA 2LDUA 2HVRA 2IS4A 2Q1ZB 3LMMA 4BEHA 3BC8A 2XIGA 2EFNA 3E5XA 4NC7A 1UG2A 3TDZC 4C3HJ 2QA4I 2LG4A 2NS0A 1G6NA 4CHUA 3V7CA 1IN7A 4BHCA 3DTIA 2XRNA 4Y33A 5K7HA 1I27A 3B6CA 1YHQI 1V5FA 4AD9A 2QENA 5DM6F 3JTHA 3RI4A 2QCOA 1PUFB 3HPHA 3P7NA 2ECCA 1DQUA 5BNGA 3J80K 1BN5A 4A3IJ 1YFHA 4BXUA 1TTYA 3I58A 3KEYA 1IV8A 3LSRA 3OR2C 3CC2I 2MH2A 3L2VA 2RQPA 5ILUA 1I6XA 1IO2A 2DK5A 2VQLA 2NXNB 3LFUA 1YRNA 2Y2ZA 1WJDA 3KE2A 2B9SA 3Q9SA 4UV8A 3PQJA 3S3OA 1A6QA 4NNJA 4WK8F 1P2FA 1MDMB 3GW2A 2KJBA 2E2IJ 4UUVA 3BG7A 2TCTA 2DMPA 2K9LA 2L9RA 4FETA 2CW7A 1U5TA 1YYVA 3CP2A 4BNCA 1DU6A 5KAFC 2NAZA 1D0YA 2VBZA 1GXQA 2V1NA 4IOAF 4XONA 5DCMA 3GVAA 1LVKA 2HDWA 1RR7A 3OV8A 3B6AA 3DTEA 1FT9A 2DN0A 1QVTA 1BOBA 3G71I 3HOWJ 3RCOA 5J1YA 3UR3C 2CQNA 1WZ2A 1IRXA 4F91B 1YJNI 3ABMH 1U5TC 4N4NB 5L3BA 2NS7A 4QLCU 1S7AA 5HODA 3MFKA 2HQRA 1CGPA 2NS8A 2P8TA 2YU9J 2R7FA 3IRRA 3HL2A 4IHYA 4RAFA 2IA1A 1KQ8A 4YFXF 2LBFA 2L9NA 2M87A 4HV5A 4MQ9F 1S72I 2JA6J 2W24A 1MMAA 3FXOA 1BI2A 2W57A 3GWZA 4XBFA 3OSFA 5HS7A 1FBSA 1J75A 2K7LA 1DPUA 1X1PA 5BQTA 1BBYA 1WI9A 2A5WA 2KP6A 2GXBA 2DFIA 2DQLA 3E1SA 4RGSA 5LHGA 1VQLI 1FSEA 4IVNA 4A6DA 1G3YA 4QSHA 3L2QA 5TJJA 1MZBA 3CCJI 2HEOA 2L7MP 1KA8A 4D7MA 3S32A 2HFHA 4BHBA 1PUFA 2F5EA 3FMQA 3TOBA 3BZCA 3ZQGA 3I0TA 2TRTA 2AXLA 4I01A 3A0BC 5CYVA 4MGRA 4QIWN 5AIQA 2JSPA 3H3ZA 3K4BA 5E79C 4WX9A 2BXZA 3EUAA 4HNVA 2DT5A 1SFKA 4KT5C 4HX7A 1ONVA 2L4MA 4XR6A 3GLXA 4JYKA 2VC0A 2VQHA 4DYCA 2R92J 2E60A 1ZELA 1T38A 4MEYF 2CUZA 3R0JA 2LVSA 1FTZA 2STWA 3ZQFA 2FSWA 1G4DA 1R5HA 3TKYA 3IV5A 3AG4H 3I54A 2E71A 3MKZA 2HXOA 4JQFA 5H20A 5CPRB 1WQ2A 2M34A 4BXXJ 1H8AC 1XB4A 2XPVA 4IKFA 2WAFA 4XSZF 1QA6A 5E3OA 3GZ5A 5HOOA 2Q2EB 2KRHA 1UELB 2Z5UA 4P1WA 1NTCA 4RLFA 3LQRA 3OYBA 2CQQA 2H6CA 1KGSA 1EKEA 1I6HJ 1HLVA 5IPAA 1HC8A 1BL0A 2OCEA 1J09A 3TP0A 3FM5A 3H0DA 3HOYJ 1FYMA 3PO3J 1REPC 5EZHA 1WWXA 1NH3A 2O0YA 2LRDA 3JAMZ 3S2WA 5KVRA 5M5WJ 2VKVA 1JGSA 3FXMA 4A69C 3FX3A 4H4KC 2WBMA 1JJ6C 3NRVA 5EEGA 3T8TA 1TT0A 3BP8A 2CGPA 1VQOI 1W36D 4BBSJ 3VSKA 1RI7A 4PSXA 3ISPA 2VPRA 4I0AA 3PIPF 5D6EA 3QU3A 1OJLA 1KU2A 2A61A 4ZYHA 2ZBKA 4UVAA 3ERMA 3O8HA 5A2QZ 1MSEC 3ECOA 1W5TA 2OZUA 3BQZA 2DA5A 3ZMSA 1ETOA 4S05A 1B72B 3IRQA 2AHQA 3H92A 3OYNA 3CMAI 1R9TJ 2MH9A 5FFZA 5FRNA 3SDGA 3FKJA 3DQVC 1P7JA 1SVOA 1ZAOA 1ZN2A 3A0HC 3SYTA 2CV1A 2V6CA 2PMHA 2XAUA 1AA7A 2IGKA 1SD4A 2F4MB 3OYCA 4Z6YA 1JHFA 2CU7A 2K9QA 4A0YA 2CMPA 2COMA 3EUKL 3QQAA 3F23A 3L09A 5J8CA 5ICEA 4XLEA 1RR8C 3V8LA 3AL0C 1ENHA 2A07F 3CF5F 3K4NA 4HX4A 5JLXA 1MSFC 3CDLA 4U87A 3BJOA 4OMYA 4XOPA 1VF9A 2LF8A 3W6JB 1ZKGA 4RB2C 3IWZA 2DQRA 3CC7I 3LFKA 2ZXWH 3BTIA 4PJJA 3DTKA 5LGUA 2O61A 1DPRA 1D8JA 3S3NA 4XKCA 5F08A 5GADJ 3VDXA 4RA2A 1A31A 2DODA 2F5FA 4UVCA 1YJ9I 2VE9A 1U78A 5DTDA 3GTGJ 3F8CA 2Y9ZA 3VWBA 5EG0A 3RKYA 3E7LA 3WG7H 2HVSA 3OYDA 2XV4S 3GUDA 3FIWA 4WCGA 3TW7A 3E6MA 3OL3A 3WGGA 1X2MA 2EZKA 1IUFA 3K4KA 3WTSC 3JTGA 1LDDA 5J6XA 1WJFA 3M8JA 4ANJA 5LEKA 2Y0SN 4EM1A 2ME6A 5M5XJ 1PVEA 4RGXA 2VJJA 2A5YB 4QPOA 1HKQA 2QQ9A 3FHNA 3HKZA 5FD6A 3HGGA 4FTHA 1JI8A 4F92B 2DXIA 4LLGF 4R79A 2EWNA 2M4KA 2N8GA 4ON0A 2BZTA 2DOAA 3CJRB 3RKQA 3P9IA 2Z3YA 4BY7J 3S2HJ 3GYHX 2DTRA 4AYBN 4G94A 1BOAA 5F27A 3CQZJ 3OYKA 1BJZA 2DMTA 4D9JA 1TQMA 5K5OA 1YX3A 3ZP5A 3LAJA 2E5ZA 4KMFA 2ECBA 3K0LA 1QPMA 2JRMA 2HS5A 3K70D 4D5CA 4A3DJ 1ZGWA 1WJAA 4OIQF 2KRCA 3GFIA 2LP0A 1T95A 1ZG5A 3KP5A 3F8NA 2HKOA 2O8KA 3BG6A 3G4SI 1UFMA 3I4MJ 5F0CA 2OV7A 4HW0A 3B02A 2L3DA 1JUSA 4BUPA 2V9KA 3CP8A 1F9NA 4ZDPA 1A5JA 5EF6A 1UG0A 1RNLA 5CQEA 2ZB9A 2EV5A 2VJ5A 3GTOJ 3RPUA 1HW5A 3HUGA 2X1CA 5C4XJ 3DF8A 2YX4A 2W4SA 1IXRC 4M6YA 5IOZA 3KZZA 2VBWA 2XKPA 5D5XB 1HW2A 1ZTRA 5A2QK 1HSJA 3U9GA 2YX7A 5IT9Z 4IRIA 2DA4A 2XAGA 2K5CA 2RAEA 4XLAA 3RYRA 3OYLA 2HTJA 1PDNC 2HDCA 3DKYA 3HM5A 3WU0A 5EGOA 1ZR2A 1SAUA 4DNCA 1W36C 3ASNH 2QZ8A 3BTCA 3H0GJ 3F8FA 3HRSA 4ZYGA 1MBJA 1XMXA 3Q9VA 2K40A 3ERED 4RB3C 1XSXA 2NYXA 5LRSA 1HSTA 1FOKA 2DJNA 4IX7A 3NWTA 5GTHC 1TT5B 4FE4A 4UB8C 4IHSA 3SQNA 4M74A 3M3YJ 3OYJA 3ECHA 2A69F 3D5RC 3M9AA 1LVAA 4I7HA 4D1QA 1GHCA 3FHZA 2P81A 3J7AY 4MTEA 1B1BA 1LQ1A 4F52A 1QGPA 2RV8A 5HLTA 4CICA 2IT0A 3ZMVA 1Z6RA 3G2BA 4AVZA 3DPUA 1XCBA 2JPCA 1DU0A 4Z2YA 4YRVA 2M30A 4HRIA 3WHCA 4BE2A 2Y0SA 1MH4A 4X0GA 2QBYB 3FBIB 1STZA 3ZQQA 3PO2J 2VJIA 1O4XA 3BTLA 2V26A 3HYIA 3LSTA 3QPLA 5IT3A 2CFXA 3K9TA 2CW0F 4XLCA 3KZIC 3W6KB 2ZJQF 4IF4A 2XGDA 3VYTB 1GV5A 1AU7A 2A05A 1M1EB 2HU9A 1MMNA 3L00A 2VL8A 3SFIA 3V8KA 5J1RA 1F1ZA 1ZLJA 2FNPA 1TNSA 2ISYA 1OCOH 4XLPF 4IZZA 1K61A 4KIFA 2WAEA 4NUBA 2XUBA 3KYDB 3E0JB 2B7EA 2EV6A 3HC7A 1ZH5A 2GQQA 2OF7A 4G9YA 4ZYDA 2AQEA 3D1NI 3W6VA 3WTYC 4U0VA 5FRMA 2JWTA 4S0HB 3MCZA 2BGCA 4E7LA 2BY3A 4BBRJ 1JT6A 2MC4A 1T0FC 3F72A 5D8KB 3IL2A 3N05A 3P9CA 2QM3A 1VQ4I 4XORA 3FKIJ 3K6GA 4G12A 1XS9A 5EYRA 5L3CA 2VODA 2X6WA 2AO9A 5TISC 3JSPA 3B73A 4BYYA 3TL4X 1I1GA 1R00A 4G8XA 4L18B 3E3VA 4BE0A 3GO5A 3WE2A 4WXCA 1X1AA 2P5KA 3RJPA 3QPHA 2DMUA 1BI1A 4BGDA 1GVDA 4OAZA 4CCKA 2IGOA 2MGQA 3PSFA 3OYIA 2ISZA 5J1UA 3RKXA 2XSDC 3AKZA 4IHXA 4BHPA 2D45A 4IL6C 3HRUA 2QEXI 2QVOA 5M3MJ 5LFAA 2GIVA 1BI3A 2XROA 4KIBA 1S5LC 2F48A 1Y1VJ 2DOFA 5ERIA 2QGUA 1BW6A 1IN8A 3JAMK 2LR8A 2MFZA 4YG2F 3KIOA 2ESNA 3MKLA 4E4HA 1VI0A 2LF7A 3M1CA 1FYLA 2KZVA 4EEFG 2DLLA 4IXAA 3M8FA 3BROA 4ASNA 3COAC 3S15J 4F7ZA 1O3TA 4KYWA 3VPRA 1YRNB 2ZSIB 3L2WA 1P7IA 1RUOA 3OWTA 2XHKA 1YJWI 3V7SA 4G7OF 5GAEJ 2QLZA 2DDAA 2VT3A 4UUTA 4CH7A 1T2KA 3A02A 3SHFA 5J4YA 5JVTA 1IDZA 3R6SA 2JRTA 1WGXA 4V19K 3VEPA 1D1CA 1FWZA 3BQYA 1SMYF 2I5UA 2BY2A 4UUSB 4LG0A 3CUOA 4B47A 1FNNA 3J7YJ 2EZLA 5E8GA 3RPUD 3A4CA 3WTWC 2BYVE 2CJJA 3IWFA 1E2XA 5J4VA 1UHMA 2KHMA 1DP3A 2PJRB 1X58A 4WXDA 4QPQA 2DW4A 1O3QA 4UY8I 2DA7A 3QYBA 1OFCX 2PMZN 3MKWB 2NVYJ 3FM3A 3U1DA 1EF4A 1EH6A 4M9XA 4HBLA 1ZRFA 1IXCA 4EGZA 3M7GA 4A3MJ 1X4OA 3TOAA 1X3WB 1S6LA 3BR3A 5BPIA 5GP9A 1IV6A 3MQ0A 5J47A 1UB9A 1ZREA 1O3RA 1TWAJ 3CESA 2CV2A 1NK2P 3DEEA 4P5OA 3HGYA 3NEUA 3G3ZA 1MBKA 4PJ0C 5FROA 1GDTA 2IVMA 1Z3YA 3PM1A 3I55I 4LB6B 1MNMC 2LFBA 1U9OA 2ZNZA 2O6GE 1HKTA 3L7WA 1A6IA 2DOEA 4HA8A 1VQPI 4KJZA 4ZZLA 1LEBA 1TP4A 2W00A 4LITA 1MNDA 5DD4A 1FEXA 4I0BA 3WTZA 3V42A 5DM7F 3QRFF 2G9WA 5F0HA 3ZQIA 5JI6A 3GTQJ 4J01A 4HPQA 2FMLA 3FF5A 3TO7A 4IHWA 1Q1HA 1YIOA 4CSWA 2IXSA 2VKHA 3HPGA 4CYDA 1F5TA 1MGTA 4C2TA 3WTVC 2WTEA 3UKGA 1HXDA 4LGWA 4BS9A 5K7ZA 4IOCF 3H9GA 1FYKA 3CCYA 5K1YA 2H1LA 2GOXB 1BR1A 1KYZA 2JMWA 3CCMI 3BJAA 1FTTA 4BU2A 1VQ9I 4Q5SF 3TP3A 2DT7B 3IKVA 2VIXA 3ASOH 1E3HA 3GEZA 2CWEA 1HDDC 1HA8A 1BI0A 1LE8A 5GPCA 5L3EA 2FBHA 1NG7A 4M73A 2R7OA 2LBFB 3SEQA 3X2QH 3TQNA 4BJ6C 3DBHB 1OR7C 3QOPA 3Q5FA 2G0EA 3H35A 3GTMJ 4XN0A 1CQTA 2DAOA 1BW5A 1FOXA 2DTZA 4N4OB 5IYDJ 2VLAA 2JVHA 1Z77A 4PDKA 2H1KA 2PI0A 1SEUA 5E17F 1VQ5I 2DU9A 2KDOA 4AYBA 2MA3A 4XRMA 1UHWA 2D2WA 3DLLF 3FK6A 3GTLJ 4XLNF 2R4GA 2RKHA 1RKTA 3K1PA 5LD2C 4HOBA 4LIVA 2HPIA 4AIJA 1H88C 2DFHA 2W84A 1R7JA 1UMQA 3OIOA 5HS9A 1JKQC 4U0WA 2P0WA 3JRAA 2OTJI 3VYUB 2EFPA 1OYYA 4YIIA 3MEXA 1SD5A 3HOTA 1IAWA 2F5CA 1IGNA 2LKPA 1QQIA 3G1OA 1NG6A 2DMQA 3FXKA 2NVQJ 2E7WA 4HAMA 2Q8KA 1WJCA 1MW7A 1OYWA 1W5CC 1WJEA 3RYPA 1XMAA 1B8IA 2R7DA 5CVRA 3OYHA 1VTNC 4NC6A 2UXNA 1T8IA 2PG4A 2F4OB 4AM3A 2HGCA 3DEWA 5LBQA 4A3FJ 2QUFA 1JKOC 4XL9A 1WJBA 3ZGKA 1AKHA 2CW8A 3RKWA 3DBLB 4B48A 5HLIA 2KPMA 4RMNA 2XC7A 2H27A 1FOYA 3K4LA 3P5JA 4CUGA 2K86A 1EH7A 2RDPA 2OUMA 3HOSA 3E5UA 3WHBA 2GXAA 3QP6A 3K70C 2QSFX 2JA5J 3FDYA 2GBYA 4G7HF 3JRIA 3BPXA 4XN3A 2Y30A 2XGEA 2O8XA 3MD2A 2W48A 5J8FA 5FLVA 3ABKH 2LC2A 1LPQA 2FX0A 2M3AA 3LSJA 5E8IA 2YSRA 1WRJA 5CJ9A 1G3WA 3CCVI 2IBDA 1HDPA 1WFXA 2L7FP 2QQ8A 3F8MA 1BA5A 4GDFA 2F4IA 1X1DA 3S8PA 4RB0A 5DD8A 1C0WA 2LY1A 1B9MA 9ANTA 4MO7A 2FXAA 4K2EA 1D5VA 3ABLH 2R5YB 2M0MA 2HQ5A 2OZ6A 1QPIA 4YELA 1X1BA 4W1UA 1IC8A 2BXYA 4A0ZA 3FMRA 1K78B 1XSVA 1J59A 2DFEA 1ETXA 2IJLA 3T0YA 4HQMA 2HWVA 4KFCA 2KQRA 4C9YA 2CQXA 5B1BH 3L2CA 5BMZA 2FOKA 4DGWB 2Y75A 3S14J 3JSOA 1UAAA 1S9HA 3CLQA 2K9SA 2VC1A 3OYMA 5CLSA 1ZGAA 3ABTA 5EZGA 5HNHA 1GVJA 1ODDA 2XASA 1P4XA 2Z16A 3E6DA 3GMEA 4UXNA 4N9IA 4TV7A 3LNQA 3OIQA 1VQKI 1I50J 3JREA 1MD0A 3BY6A 3SZTA 3R60A 3EUHC 3HG9A 1OKRA 4Q4ZF 5FLXK 2MD5A 2JA7J 2NRAC 4H0EA 1POGA 2JT1A 2R7RA 2ZJPF 3E6BA 2FD5A 2E2HJ 4ZC3A 2CUEA 4NBQA 3HHHA 3LQQA 4KMUX 3VYSB 2VI6A 3SEZA 1WH7A 2H09A 2L7ZA 4CCNA 4BDYA 5KCMA 4BDZA 3O3KA 3I53A 2DCEA 5JHUA 2HZDA 2LY2A 2Y48A 2X6YA 3HTUA 1HQCA 3BT9A 3OYAA 2G7HA 3M8EA 2L0KA 4P55A 3OIPA 4OIRF 3CJNA 3LSIA 2E5NA 1Q1VA 1BM9A 3H1CA 3CUQA 3KP4A 2ZXJA 1R4MB 3BR2A 4M3BA 3ULQB 2HXIA 2XF5A 3LA3A 5JR3A 2ME0A 4M3GA 2IRFG 5F6FA 2JA8J 3BWGA 3V8JA 2JN6A 4WWCA 2FJ1A 3I64A 2W1OA 2E35A 4MHGA 4MQVA 3IH4A 2QSHX 4MEXF 1MKMA 2R3SA 1QZZA 5FKNA 3CCEI 2E34A 1SVLA 5JLWA 1W5SA 2HOSA 3HXLA 1T33A 3KLOA 3HHGA 2VT2A 3BZ6A 3DKXA 3HEFA 1YW8A 4DZJA 1PP7U 2FOWA 2GA2A 2IS1A 4PZJA 2DYRH 2X9DA 5FD5A 4BQQA 2Z33A 1R58A 1D8KA 2MSYA 2XKOA 2FNAA 2Q0OA 4FASD 2V79A 2YPRA 1U5TB 2R5ZA 2QBYA 5D4SA 4BQNA 3OYEA 4KN7X 2WY8Q 4IPAA 2W25A 1S7OA 2EIMH 1F4KA 1FP2A 2P7CB 4XLHA 3EYYA 3CMEI 5E1ZB 3NWSA 2ID3A 1T08B 4ENKA 3HSEA 3LA2A 1PJRA 5JHFA 2OQRA 3I5UA 1ZLKA 3C1DA 3LSGA 3IHUA 4EM2A 3A1YA 4ZYAA 2JSCA 3GFLA 3BLYA 3VYRB 5L3FA 1IJWC 1MMSA 3A03A 2NOGA 2PFBA 4YIRX 3KP3A 2ZFUA 3H36A 5HLHA 1WVRA 3ROUA 2IA0A 4U0YA 2P5LC 4M6XA 4LK0F 2COBA 2HI3A 5F0FA 3H3VK 1R5ID 2KJCA 2LSOA 4A5MA 4LLLA 1JGGA 3KP2A 2E1NA 2JQ7A 4XKBA 1S7EA 5E3LA 2D1HA 3QPTA 4HNUA 5IYBJ 3F8BA 3D5SC 2V1XA 1BR4A 1Y8RB 3A2KA 2HVQA 3F22A 3OL4A 2FF4A 2X1EA 1QBJA 3LSPA 2VASA 3F9KA 1EH8A 2VXZA 1FMVA 1BIBA 1EA3A 2E1MB 4L0ZB 3G1LA 2XAHA 4L9JA 1TQPA 3PNTA 5FGMA 1ZR4A 2EIKH 4GCVA 1ON1A 2WB1N 3OOPA 4B4CA 3FXRA 3RPQA 4E7ZA 5FLMJ 4JK1X 2Z2SB 2BHZA 5AIPA 1XN7A 1O57A 3CUQB 2PJPA 4CZCA 2MBFA 5DS9A 1IRFA 1J0RA 2UWMA 3K69A 4OWRB 5CVJA 2H8WA 2M4GA 4O5VA 3F0CA 2FU4A 2A3SA 2DPUA 1YG2A 3KLNA 5CKTA 1XGMA 5FB2A 1V5EA 1FIPA 2FBKA 4NQWB 2ZSHB 2ZMEB 1UZCA 3Q0VA 1SANA 2M8EA 2QKLB 2O03A 3LSKA 1ETKA 1V3FA 2VOOA 3D5LA 3BOQA 2ZCWA 3LSMA 4QWQA 1IF1A 2LYCA 5D8LB 3PFYA 4HSRA 2OTLI 3ZXSA 5D5UB 1K6OA 2EZIA 1W0TA 3SJMA 2HKXA 1TZLA 1IG7A 2PEXA 2R7VA 3FXQA 2R7ZJ 4NQWA 2EZHA 1SD7A 2ZMEA 2M7AA 1WPKA 4HLXA 4FHTA 1X2NA 5H6QA 4C2MJ 4OIOF 1U6GA 2HQAA 5TGTA 4B1RA 1Y56A 1D1AA 4HZFA 3ZMZA 3KP6A 5DEQA 3S93A 5EJCA 5KHDA 3L2UA 1Y6IA 1A36A 2GAUA 4HV6A 2VQCA 2LREA 1LFBA 3TO9A 2L5QA 2K3FA 1YIJI 3KP7A 2CYYA 1K4TA 1MJ9A 4BQAA 2GOMA 2J5PA 2ZMEC 1ZYRF 3K2ZA 4LJZF 2A6EF 5K5QA 1OMIA 3JW4A 3TGNA 4B3AA 4J19A 4RLQA 4I99C 1P4WA 4CA0A 4YFNF 3J7AO 2PX9A 4IHTA 2F5VA 3TEDA 2K02A 5LEJA 2XDVA 1ON2A 3MZHA 4HLYA 2DYSH 2WA0A 3CCRI 1FX7A 2X85A 2K3PA 3A01A 3CO6C 4DYQA 2HYGD 3S2DJ 5IP9J 3F3XA 1ZGJA 3H9QA 4Q48A 5GPAA 4WXHA 4V2FA 2XRLA 1OCZH 1U3EM 2DA3A 1LDJA 2KIQA 4M3DA 4Y13A 2QKMB 1SFUA 2E1MC 2HYJA 3R4KA 2K85A 4RDUA 1V5GA 3I59B 3FK7A 4JX6A 3GZ6A 4YIFA 1WI3A 4I76A 2LY9A 4W97A 1BIAA 1ERDA 2F6CA 3JRBA 2KDZA 4AIDA 4DYRA 2VN2A 1JJ8C 1Y39A 4B43A 1ORKA 2BOLA 2V9VA 2BHYA 2J5OA 5BPDA 2KIUA 3RZOJ 4EGYA 1YLFA 4M9ZA 1AOYA 3RTRA 2H94A 1G3TA 4UUSA 2L9VA 1XPXA 3CO7C 2PLYA 2Q2EA 3CMMA 2I10A 5ED4A 2KLOA 5L3DA 2DK8A 3BG5A 2OJED 3K10A 1R22A 3GZNB 4C3IJ 3JRGA 5HDNA 3S3MA 1J5YA 1ETWA 1KQ0A 3FZVA 5EEHA 2GM4A 4ZTJA 1MDMA 2VBYA 4L5JA 3E97A 3Q3SA 5C44J 1ULYA 1G59A 3H5AA 5IP7J 4XMYA 2EIJH 2HYFA 2L01A 1E3OC 3FISA 4BE1A 1XG1A 2DO7A 2LD5A 4FX4A 3EQLF 5ICFA 2KZGA 1R6RA 2E19A 2EJRA 2KL4A 3WU2C 5IP6A 2VKDA 1FOWA 1OLTA 4KICA 3IP4B 4MFEA 4PJMA 3PJRA 3IKTA 4XNFA 1A04A 2FEZA 1YE9A 3OMYA 4HG2A 1IN4A 2FBIA 2GZWA 4F93B 3M1EA 1N75A 2XAFA 3EPZA 1B72A 1D3YA 2L54A 5IYCJ 1FSHA 2STTA 4HYEA 1QRYA 4AC0A 3CJQB 2O5RA 2QSGX 2ELKA 1QHHD 4ENNA 4UHTA 3OOUA 1NHAA 1MBFA 5CVIA 4E70A 3ZPLA 1Z1DA 2JA2A 1D0XA 2VJ4A 4PSWA 5LLQA 3KCCA 2D5VA 4CYCA 4HQEA 1XSDA 1CF7B 1JHHA 1S8NA 2DBBA 4EQQA 1IDYA 1OISA 2OC6A 3NAUA 5K7FA 2ADUA 4XK4A 3WTUC 3HDDA 2ACJA 4A3GJ 3W2VA 2DDBA 1YITI 5E1XA 4EV0A 5IT9K 5B5EC 1MMDA 2LK2A 2JPBA 1KU3A 2HPMA 1TWCJ 3WG9A 3KX2A 3QAHA 4UV9A 2CQKA 3FBNB 3H3UA 2F2EA 3K1MA 5DUIA 4QTRA 3CD6I 1R1UA 3PNYA 2IPQX 4A2UA 5LRRA 1KU7A 5KK1A 3L2RA 4MIMA 1YW7A 3ZMTA 2XPWA 3MWMA 1SFEA 3IH2A 4O6JA 4HDUA 2XF6A 4HF1A 4JP0A 3LWFA 1X3UA 5EG0B 2KT0A 3ZCOA 3I56I 4G6TB 3KEQA 1G2HA 1MJAA 3GLLA 4MFDA 3QU6A 2YUSA 4CZZA 3G73A 2DJIA 4KN4X 3DPTA 1X1CA 1B9NA 1ZARA 2EBIA 3C18A 3RQIA 4A3JJ 3OYGA 1U8BA 6PAXA 3IAM2 4L9NA 1SD6A 2Z99A 2P4WA 4HF2A 4B8XA 3GF2A 3WU1B 3ZMDA 4KITB 1FLIA 2WV1A 5DYMA 4E7SA 4CGZA 3GFMA 1OYIA 4ZDLA 2ICWG 2BBYA 3BR1A 4XSXF 4Y4RA 1MH3A 2DA2A 4OINF 1HOMA 1HCRA 2OCCH 3WTTC 3DV8A 4M72A 1SVMA 1H0MA 2ZFWA 2VPLA 3DXJF 2XAQA 3SZGA 3MN2A 2YS9A 1GT0C 4EATA 4G6DA 2QQBA 4IQ4A 5CQGA 1FY7A 2GIZA 5H2FC 1N78A 1I3AA 5GAHJ 3L1PA 2EK5A 2V1DA 3IH3A 2R5YA 3DBRB 2UUZA 3I3LA 4FCYA 4ZZDA 5B66C 1XX5A 5GTIC 1I39A 2BVLA 4JX4A 4KA4A 3OY9A 2OPTA 5LHHA 3DWLE 3SDBA 1LJ9A 2JTVA 4II3A 4ESJA 1LUJB 2VBXA 4L9TA 3CCQI 2WWYA 1YO5C 3FXUA 2FE3A 2FUG2 2OD5A 3MZ8A 4ZYEA 1ZRDA 4GFBA 4RS8A 2EA4A 2L4AA 2V6EA 2CG4A 4LOCA 3MMYB 2EINH 1AKHB 1Z21A 3CUQC 1MMGA 2B0LA 4LFUA 3MVPA 1QZEA 1Z9CA 1TL8A 4KDPA 1OCPA 1K83J 3DEUA 2EFWA 2EILH 2P6SA 2Y9YA 2R7SA 1MBHA 1SAXA 2Z1DA 1F36A 3W2WA 2X48A 3WGHA 2R5ZB 2LTPA 3ONQA 1X4PA 4HF0A 3GTJJ 1U2WA 4P9UA 1J2XA 1XGOA 2GXGA 4IO9F 5JFRA 5TRDA 4A3EJ 2O7OA 1VQ7I 4S04A 5HDGA 1GUUA 2UZKA 4BKXA 2HOAA 1VFCA 2KFDA 1ZRCA 2CQ7A 3U2RA 3AL0B 3F6OA 1PYVA 1FPQA 2ZKZA 1W7PD 2JK3A 2WB1A 1I3QJ 1XCVA 5KNLA 2G7UA 3BR0A 3C2BA 3EUHA 2WADA 3N97A 1P4AA 2O9LA 4AUXA 2KIFA 4OIPF 2E36A 3IAS2 4M3EA 4C30A 5J3LA 1U9NA 2PMZA 5B1AH 4CXFA 1TW3A 1AWCA 3K4JA 5F1RA 3F6VA 5HLGA 1ZQ3P 1ZK8A 3JRFA 1VZ0A 1PP8F 1H89C 2LNBA 4C3JJ 3BG9A 4UVBA 2XGXA 2B63J 3HUGB 2BE5F 2BY0A 3FMSA 5E3MA 1T39A 5HS8A 3HOXJ 3PFIA 4EJOA 3CLOA 4IEJA 3BCAA 1JKRC 3K7AJ 3K1NA 1PUEE 4D5FA 2IEKA 1ZG3A 5F1JA 2YR2A 5EDNA 2BW3B 3LA7A 3KYCB 3NQOA 4LIUA
chains in the Genus database with same CATH topology
1Y1WJ 2P81A 3JRDA 2R5ZA 3GBGA 5FKOA 5FKLA 5F04A 4DZPA 1DU0A 3OSGA 3HOUJ 3WHCA 2ID3A 4X6AJ 1MH4A 1Z0XA 3S17J 1WH5A 3PO2J 1JT0A 1FJLA 2NVTJ 1O4XA 3S16J 3BTLA 2XGCA 1MBGA 3QPLA 3BR5A 1OCTC 3LSGA 1T56A 1WCMJ 3HOZJ 1IJWC 3A03A 2NOGA 2XGDA 1GV5A 1TWGJ 5C4JJ 1AU7A 1TWFJ 3SFIA 5J1RA 4M6VA 1K61A 2COBA 2HI3A 2VUMJ 3NARA 5F0FA 3H3VK 1JGGA 1ITYA 2OF7A 3D1NI 1S7EA 1ETVA 5E3LA 3W6VA 5IYBJ 2JWTA 4S0HB 2M2EA 3S1NJ 4BBRJ 1JT6A 2Y31A 3ZQCA 3LSPA 3FKIJ 4G12A 1XS9A 5EYRA 2VKEA 3G1LA 2AO9A 3S1RJ 1UG2A 4C3HJ 1ZR4A 4B4CA 2WB1N 5FLMJ 5K7HA 3B6CA 3BG3A 2DMUA 1GVDA 2IAIA 2CRGA 5DS9A 2MGQA 2QCOA 1PUFB 2ECCA 5J1UA 5BNGA 2XSDC 4A3IJ 4IHXA 3S1QJ 3F0CA 1RKWA 5M3MJ 3A01B 3BTJA 3LSRA 4D7NA 1FIPA 1Y1VJ 3Q0VA 1SANA 1BW6A 1YRNA 2LR8A 2Y2ZA 1ETKA 2LLKA 3MKLA 1VI0A 4Y52J 4XICA 4EEFG 2EQRA 3S15J 1LFUP 3VPRA 2R0QC 2E2IJ 1YRNB 2TCTA 2DMPA 2EZIA 1W0TA 1P7IA 1APLC 3SJMA 2L9RA 4NDLA 1IG7A 1XC5A 4UUTA 1DU6A 3A02A 2R7ZJ 2EZHA 1RESA 1IDZA 2HDDA 1WGXA 1WPKA 4C2MJ 1X2NA 3BQYA 4B1RA 4UUSB 3BR6A 2ID6A 2EZLA 1RR7A 2NVXJ 1LFBA 5E3NA 4X1EA 3B6AA 2CJJA 2DN0A 1QVTA 4MLOA 3HOWJ 1IRZA 5J1YA 1JTYA 1X58A 2DA7A 4B3AA 4J19A 4ABZA 1OFCX 2NS7A 3CMYA 5HODA 2PMZN 2NVYJ 2NS8A 3TEDA 1EF4A 2YU9J 3A01A 4I6ZA 4IHYA 4A3MJ 4DYQA 3BR3A 1IV6A 5GP9A 3S2DJ 5IP9J 1RETA 5GPAA 2JA6J 4V2FA 2XRLA 3HOVJ 2DA3A 1TWAJ 4M3DA 3OSFA 1NK2P 1B8IB 3HGYA 1MBKA 2HYJA 4RDUA 1GDTA 3PM1A 3FK7A 4JX6A 1WI3A 4I76A 1SFOJ 1MNMC 2LFBA 2LY9A 4W97A 1U9OA 3JRBA 5C3EJ 2KDZA 1A6IA 4QSHA 2DA1A 4A3LJ 4DYRA 2L7MP 4D7MA 5FKKA 1JJ8C 1ORKA 1FEXA 2E2JJ 1PUFA 3RZOJ 3ZQGA 5F0HA 2TRTA 3ZQIA 4UUSA 4QIWN 3GTQJ 3JRHA 2I10A 4HNVA 1JUPA 4IHWA 4DYCA 4JYKA 3BG5A 2R92J 4IHVA 4L5EA 2LVSA 1FTZA 3O8GA 3ZQFA 4C3IJ 3IV5A 3JRGA 3UKGA 2MG4A 1ETWA 1F43A 5K7ZA 2GM4A 3CCYA 2HXOA 2M34A 4BXXJ 3ZQHA 1H8AC 2JMWA 1FTTA 2XPVA 3Q3SA 5C44J 4A93J 2R93J 3TP3A 5IP7J 1HDDC 1E3OC 3FISA 5E3OA 1W0UA 5GPCA 1XG1A 1LE8A 2LD5A 2E19A 1NTCA 5FKMA 2M9HA 5IP6A 2XB0X 2CQQA 1JKPC 1I6HJ 2G0EA 4MFEA 1HLVA 3GTMJ 5IPAA 2XPUA 1CQTA 1BL0A 1BW5A 3TP0A 2DTZA 3HOYJ 5IYDJ 2JJ7A 3PO3J 1Z77A 5EZHA 2H1KA 1B72A 5M5WJ 5IYCJ 2VKVA 4A69C 1QRYA 3Q0UA 4XRMA 4AC0A 1JJ6C 3GTLJ 3FK6A 5EEAA 1RKTA 3JRCA 2K9NA 1LE8B 2ELKA 4BBSJ 3OOUA 1MBFA 1H88C 4Y7NJ 2VPRA 1UMQA 3OIOA 1JKQC 2D5VA 4CYCA 1OJLA 1MBEA 4XRSG 3JRAA 1IDYA 3NAUA 5K7FA 4XK4A 3O8HA 4A3CJ 3HDDA 1IGNA 1AHDP 2LKXA 3G1OA 1MSEC 2DMQA 4A3GJ 2NVQJ 3BQZA 2DA5A 1ETOA 2LK2A 1B72B 3HBLA 1TWCJ 2AHQA 3LOCA 1B8IA 1R9TJ 4QTRA 3SDGA 5M5YJ 1P7JA 3DEWA 4A3FJ 1JKOC 4MIMA 2XPWA 2GLOA 1JTXA 3IH2A 3TW6A 1AKHA 4JP0A 2CU7A 1VNDA 2M8GX 5EG0B 2KT0A 2K9QA 3DCFA 2M0CA 2X6OA 1G2HA 3QQAA 4MFDA 2YUSA 1ENHA 2EBIA 3RQIA 4A3JJ 3WHBA 1U8BA 5JLXA 1MSFC 2JA5J 3CDLA 2GBYA 2MW8A 3JRIA 1VF9A 2Y30A 4XIDA 2XGEA 1ZKGA 4BY1J 2W48A 5FLVA 4A3KJ 3S1MJ 2FX0A 1TWHJ 3LSJA 3BTIA 4A3BJ 2WV1A 4RBOA 5F08A 2IBDA 3ZOBA 1HDPA 1BA5A 2L7FP 1U78A 3HB9A 5DTDA 3GTGJ 3BR1A 2Y9ZA 5EG0A 3E7LA 4V2GA 5M3FJ 1JUMA 1MH3A 9ANTA 3FIWA 2DA2A 4MO7A 1HOMA 3TW7A 1HCRA 4CYCB 2R5YB 2HQ5A 1QPIA 4FE7A 1X2MA 3MN2A 2YS9A 4W1UA 1GT0C 2EZKA 1IC8A 1IUFA 3GTKJ 1RPWA 2Y0SN 2ME6A 5M5XJ 1ETXA 3L1PA 3IH3A 2R5YA 3HGGA 5EGOB 4FTHA 4FCYA 2XB5A 3G1MA 1NK3P 2CQXA 4JX4A 2N8GA 2OPTA 2FQ4A 3RKQA 3S14J 4BY7J 3S2HJ 3Q0WA 4AYBN 4DW6A 4GFBA 2K9SA 5F27A 1UHSA 3CQZJ 1BJZA 2DMTA 5EZGA 3RZDJ 3LNQA 4LOCA 1AKHB 1I50J 4JX5A 3JREA 2H8RA 2ECBA 5IOYA 3MVPA 1OCPA 1K83J 2JA7J 2Y9YA 4D5CA 1MBHA 2E1OA 1ZGWA 1F36A 1POGA 2R5ZB 2X48A 2LP0A 1FIAA 4A3DJ 2LTPA 3I4NJ 4M3FA 2FD5A 2E2HJ 2O8KA 3GTJJ 2CUEA 3I4MJ 5F0CA 3M4OJ 2VI6A 3HKZN 1JUSA 1WH7A 2L7ZA 1A5JA 4A3EJ 2O7OA 1GUUA 2DMNA 5EF6A 4BKXA 2HOAA 3ZQLA 1VFCA 2WAQN 3BT9A 2ZB9A 2L0KA 3GTOJ 5C4XJ 2DA6A 2JK3A 1I3QJ 3BR0A 3C2BA 1Q1VA 5IOZA 3BR2A 3K2AA 5FJ8J 4M3BA 1ZTRA 2O9LA 2EH3A 1TC3C 2HXIA 4AUXA 2ME0A 4M3GA 4FISA 2JA8J 2DA4A 4M3EA 2RAEA 2HOTA 5J3LA 1U9NA 2JN6A 2FJ1A 1HF0A 3IH4A 3JR9A 3HM5A 3QPSA 5EGOA 1ZR2A 2QF7A 5FKNA 1ZQ3P 1ZK8A 3JRFA 3BTCA 5JLWA 3H0GJ 2HOSA 1H89C 1T33A 4C3JJ 1MBJA 3BG9A 2B63J 5E3MA 1D5YA 2K40A 3HEFA 4DZJA 3HOXJ 4XRSA 4IEJA 1GV2A 1QVUA 1JKRC 2DJNA 2X9DA 3K7AJ 1ETQA 4D5FA 1ETYA 2IEKA 4FE4A 5F1JA 3GTPJ 2MSYA 5EDNA 2CUFA 3M3YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W J;  2P81 A;  3JRD A;  2R5Z A;  3GBG A;  5FKO A;  5FKL A;  5F04 A;  4DZP A;  1DU0 A;  3OSG A;  3HOU J;  3WHC A;  2ID3 A;  4X6A J;  1MH4 A;  1Z0X A;  3S17 J;  1WH5 A;  3PO2 J;  1JT0 A;  1FJL A;  2NVT J;  1O4X A;  3S16 J;  3BTL A;  2XGC A;  1MBG A;  3QPL A;  3BR5 A;  1OCT C;  3LSG A;  1T56 A;  1WCM J;  3HOZ J;  1IJW C;  3A03 A;  2NOG A;  2XGD A;  1GV5 A;  1TWG J;  5C4J J;  1AU7 A;  1TWF J;  3SFI A;  5J1R A;  4M6V A;  1K61 A;  2COB A;  2HI3 A;  2VUM J;  3NAR A;  5F0F A;  3H3V K;  1JGG A;  1ITY A;  2OF7 A;  3D1N I;  1S7E A;  1ETV A;  5E3L A;  3W6V A;  5IYB J;  2JWT A;  4S0H B;  2M2E A;  3S1N J;  4BBR J;  1JT6 A;  2Y31 A;  3ZQC A;  3LSP A;  3FKI J;  4G12 A;  1XS9 A;  5EYR A;  2VKE A;  3G1L A;  2AO9 A;  3S1R J;  1UG2 A;  4C3H J;  1ZR4 A;  4B4C A;  2WB1 N;  5FLM J;  5K7H A;  3B6C A;  3BG3 A;  2DMU A;  1GVD A;  2IAI A;  2CRG A;  5DS9 A;  2MGQ A;  2QCO A;  1PUF B;  2ECC A;  5J1U A;  5BNG A;  2XSD C;  4A3I J;  4IHX A;  3S1Q J;  3F0C A;  1RKW A;  5M3M J;  3A01 B;  3BTJ A;  3LSR A;  4D7N A;  1FIP A;  1Y1V J;  3Q0V A;  1SAN A;  1BW6 A;  1YRN A;  2LR8 A;  2Y2Z A;  1ETK A;  2LLK A;  3MKL A;  1VI0 A;  4Y52 J;  4XIC A;  4EEF G;  2EQR A;  3S15 J;  1LFU P;  3VPR A;  2R0Q C;  2E2I J;  1YRN B;  2TCT A;  2DMP A;  2EZI A;  1W0T A;  1P7I A;  1APL C;  3SJM A;  2L9R A;  4NDL A;  1IG7 A;  1XC5 A;  4UUT A;  1DU6 A;  3A02 A;  2R7Z J;  2EZH A;  1RES A;  1IDZ A;  2HDD A;  1WGX A;  1WPK A;  4C2M J;  1X2N A;  3BQY A;  4B1R A;  4UUS B;  3BR6 A;  2ID6 A;  2EZL A;  1RR7 A;  2NVX J;  1LFB A;  5E3N A;  4X1E A;  3B6A A;  2CJJ A;  2DN0 A;  1QVT A;  4MLO A;  3HOW J;  1IRZ A;  5J1Y A;  1JTY A;  1X58 A;  2DA7 A;  4B3A A;  4J19 A;  4ABZ A;  1OFC X;  2NS7 A;  3CMY A;  5HOD A;  2PMZ N;  2NVY J;  2NS8 A;  3TED A;  1EF4 A;  2YU9 J;  3A01 A;  4I6Z A;  4IHY A;  4A3M J;  4DYQ A;  3BR3 A;  1IV6 A;  5GP9 A;  3S2D J;  5IP9 J;  1RET A;  5GPA A;  2JA6 J;  4V2F A;  2XRL A;  3HOV J;  2DA3 A;  1TWA J;  4M3D A;  3OSF A;  1NK2 P;  1B8I B;  3HGY A;  1MBK A;  2HYJ A;  4RDU A;  1GDT A;  3PM1 A;  3FK7 A;  4JX6 A;  1WI3 A;  4I76 A;  1SFO J;  1MNM C;  2LFB A;  2LY9 A;  4W97 A;  1U9O A;  3JRB A;  5C3E J;  2KDZ A;  1A6I A;  4QSH A;  2DA1 A;  4A3L J;  4DYR A;  2L7M P;  4D7M A;  5FKK A;  1JJ8 C;  1ORK A;  1FEX A;  2E2J J;  1PUF A;  3RZO J;  3ZQG A;  5F0H A;  2TRT A;  3ZQI A;  4UUS A;  4QIW N;  3GTQ J;  3JRH A;  2I10 A;  4HNV A;  1JUP A;  4IHW A;  4DYC A;  4JYK A;  3BG5 A;  2R92 J;  4IHV A;  4L5E A;  2LVS A;  1FTZ A;  3O8G A;  3ZQF A;  4C3I J;  3IV5 A;  3JRG A;  3UKG A;  2MG4 A;  1ETW A;  1F43 A;  5K7Z A;  2GM4 A;  3CCY A;  2HXO A;  2M34 A;  4BXX J;  3ZQH A;  1H8A C;  2JMW A;  1FTT A;  2XPV A;  3Q3S A;  5C44 J;  4A93 J;  2R93 J;  3TP3 A;  5IP7 J;  1HDD C;  1E3O C;  3FIS A;  5E3O A;  1W0U A;  5GPC A;  1XG1 A;  1LE8 A;  2LD5 A;  2E19 A;  1NTC A;  5FKM A;  2M9H A;  5IP6 A;  2XB0 X;  2CQQ A;  1JKP C;  1I6H J;  2G0E A;  4MFE A;  1HLV A;  3GTM J;  5IPA A;  2XPU A;  1CQT A;  1BL0 A;  1BW5 A;  3TP0 A;  2DTZ A;  3HOY J;  5IYD J;  2JJ7 A;  3PO3 J;  1Z77 A;  5EZH A;  2H1K A;  1B72 A;  5M5W J;  5IYC J;  2VKV A;  4A69 C;  1QRY A;  3Q0U A;  4XRM A;  4AC0 A;  1JJ6 C;  3GTL J;  3FK6 A;  5EEA A;  1RKT A;  3JRC A;  2K9N A;  1LE8 B;  2ELK A;  4BBS J;  3OOU A;  1MBF A;  1H88 C;  4Y7N J;  2VPR A;  1UMQ A;  3OIO A;  1JKQ C;  2D5V A;  4CYC A;  1OJL A;  1MBE A;  4XRS G;  3JRA A;  1IDY A;  3NAU A;  5K7F A;  4XK4 A;  3O8H A;  4A3C J;  3HDD A;  1IGN A;  1AHD P;  2LKX A;  3G1O A;  1MSE C;  2DMQ A;  4A3G J;  2NVQ J;  3BQZ A;  2DA5 A;  1ETO A;  2LK2 A;  1B72 B;  3HBL A;  1TWC J;  2AHQ A;  3LOC A;  1B8I A;  1R9T J;  4QTR A;  3SDG A;  5M5Y J;  1P7J A;  3DEW A;  4A3F J;  1JKO C;  4MIM A;  2XPW A;  2GLO A;  1JTX A;  3IH2 A;  3TW6 A;  1AKH A;  4JP0 A;  2CU7 A;  1VND A;  2M8G X;  5EG0 B;  2KT0 A;  2K9Q A;  3DCF A;  2M0C A;  2X6O A;  1G2H A;  3QQA A;  4MFD A;  2YUS A;  1ENH A;  2EBI A;  3RQI A;  4A3J J;  3WHB A;  1U8B A;  5JLX A;  1MSF C;  2JA5 J;  3CDL A;  2GBY A;  2MW8 A;  3JRI A;  1VF9 A;  2Y30 A;  4XID A;  2XGE A;  1ZKG A;  4BY1 J;  2W48 A;  5FLV A;  4A3K J;  3S1M J;  2FX0 A;  1TWH J;  3LSJ A;  3BTI A;  4A3B J;  2WV1 A;  4RBO A;  5F08 A;  2IBD A;  3ZOB A;  1HDP A;  1BA5 A;  2L7F P;  1U78 A;  3HB9 A;  5DTD A;  3GTG J;  3BR1 A;  2Y9Z A;  5EG0 A;  3E7L A;  4V2G A;  5M3F J;  1JUM A;  1MH3 A;  9ANT A;  3FIW A;  2DA2 A;  4MO7 A;  1HOM A;  3TW7 A;  1HCR A;  4CYC B;  2R5Y B;  2HQ5 A;  1QPI A;  4FE7 A;  1X2M A;  3MN2 A;  2YS9 A;  4W1U A;  1GT0 C;  2EZK A;  1IC8 A;  1IUF A;  3GTK J;  1RPW A;  2Y0S N;  2ME6 A;  5M5X J;  1ETX A;  3L1P A;  3IH3 A;  2R5Y A;  3HGG A;  5EGO B;  4FTH A;  4FCY A;  2XB5 A;  3G1M A;  1NK3 P;  2CQX A;  4JX4 A;  2N8G A;  2OPT A;  2FQ4 A;  3RKQ A;  3S14 J;  4BY7 J;  3S2H J;  3Q0W A;  4AYB N;  4DW6 A;  4GFB A;  2K9S A;  5F27 A;  1UHS A;  3CQZ J;  1BJZ A;  2DMT A;  5EZG A;  3RZD J;  3LNQ A;  4LOC A;  1AKH B;  1I50 J;  4JX5 A;  3JRE A;  2H8R A;  2ECB A;  5IOY A;  3MVP A;  1OCP A;  1K83 J;  2JA7 J;  2Y9Y A;  4D5C A;  1MBH A;  2E1O A;  1ZGW A;  1F36 A;  1POG A;  2R5Z B;  2X48 A;  2LP0 A;  1FIA A;  4A3D J;  2LTP A;  3I4N J;  4M3F A;  2FD5 A;  2E2H J;  2O8K A;  3GTJ J;  2CUE A;  3I4M J;  5F0C A;  3M4O J;  2VI6 A;  3HKZ N;  1JUS A;  1WH7 A;  2L7Z A;  1A5J A;  4A3E J;  2O7O A;  1GUU A;  2DMN A;  5EF6 A;  4BKX A;  2HOA A;  3ZQL A;  1VFC A;  2WAQ N;  3BT9 A;  2ZB9 A;  2L0K A;  3GTO J;  5C4X J;  2DA6 A;  2JK3 A;  1I3Q J;  3BR0 A;  3C2B A;  1Q1V A;  5IOZ A;  3BR2 A;  3K2A A;  5FJ8 J;  4M3B A;  1ZTR A;  2O9L A;  2EH3 A;  1TC3 C;  2HXI A;  4AUX A;  2ME0 A;  4M3G A;  4FIS A;  2JA8 J;  2DA4 A;  4M3E A;  2RAE A;  2HOT A;  5J3L A;  1U9N A;  2JN6 A;  2FJ1 A;  1HF0 A;  3IH4 A;  3JR9 A;  3HM5 A;  3QPS A;  5EGO A;  1ZR2 A;  2QF7 A;  5FKN A;  1ZQ3 P;  1ZK8 A;  3JRF A;  3BTC A;  5JLW A;  3H0G J;  2HOS A;  1H89 C;  1T33 A;  4C3J J;  1MBJ A;  3BG9 A;  2B63 J;  5E3M A;  1D5Y A;  2K40 A;  3HEF A;  4DZJ A;  3HOX J;  4XRS A;  4IEJ A;  1GV2 A;  1QVU A;  1JKR C;  2DJN A;  2X9D A;  3K7A J;  1ETQ A;  4D5F A;  1ETY A;  2IEK A;  4FE4 A;  5F1J A;  3GTP J;  2MSY A;  5EDN A;  2CUF A;  3M3Y J; 
#chains in the Genus database with same CATH topology
 1Y1W J;  3C2G A;  2KRF A;  3HTS B;  2ZJR F;  4E7J A;  5FKO A;  2Y69 H;  3T8R A;  4NB5 A;  4PGG A;  4DZP A;  1IXS B;  4PJN A;  3HOU J;  1MNE A;  3ML6 A;  1ZHF A;  3ELK A;  4FQG A;  1Z0X A;  1USS A;  3BZK A;  3S17 J;  3OS2 A;  2FA5 A;  3PNV A;  2HR3 A;  1JT0 A;  2NVT J;  1MBG A;  3BR5 A;  1U0J A;  1OCT C;  4HNT A;  1T56 A;  1XGN A;  2P7V B;  1HW1 A;  2MAB A;  4EJV A;  1BJA A;  3PL8 A;  4BJT A;  2XSJ C;  3CCL I;  4KNY A;  1B59 A;  2Z9O A;  3CF2 A;  1YTY A;  4M6V A;  3RQ4 A;  2R7X A;  1W1W E;  1IZ1 A;  2NOJ B;  3ZN0 A;  1R36 A;  4ZJZ A;  5HVQ C;  3NAR A;  1KYW A;  3KEO A;  5K5R A;  3CTA A;  2D1V A;  1ETV A;  4LG3 A;  2RQQ A;  4LD5 A;  2ZNY A;  2ZC2 A;  4BQO A;  2L2O A;  1YQA A;  5H6R A;  1ACI A;  1V55 H;  2JUG A;  2Y31 A;  3DU6 A;  3ZQC A;  2HTS A;  4PK4 A;  3I71 A;  1E17 A;  4E7I A;  4KIS A;  2VKE A;  1OQY A;  2RNJ A;  3J81 Z;  4KUM A;  3S1R J;  3CDI A;  5DCF A;  4A5N A;  5LHI A;  4CDG A;  1UST A;  2OQG A;  3GCM A;  2L7K A;  4UNO A;  3EYI A;  3LSH A;  4BEH B;  3FWE A;  4IQJ A;  3I4P A;  3BG3 A;  3RDI A;  3KYL A;  4KT6 A;  2IAI A;  5AON A;  2CRG A;  3VSL A;  1K6Y A;  1IN6 A;  3QOD A;  2DPD A;  1LFP A;  2X1D A;  3S1Q J;  5LGT A;  4CCO A;  4PFO A;  5FLX Z;  1RKW A;  4A6E A;  4GO1 A;  4BXF A;  3GX4 X;  3A01 B;  3BTJ A;  3HZJ A;  2K4B A;  3I9V 2;  3ZN1 A;  4D7N A;  3DP7 A;  4IRG A;  1IUY A;  2E1C A;  4RAG A;  4AWX B;  2K27 A;  3T5X A;  1OR7 A;  4PGH A;  4LG0 B;  2R7T A;  3WTX C;  2LLK A;  3BJ6 A;  4DBR A;  4Y52 J;  4XIC A;  2EPF A;  1R5G A;  4OMZ A;  1Z3X A;  3GFJ A;  4I2O A;  2EQR A;  3I59 A;  1QU3 A;  1W7P B;  1LFU P;  2X4H A;  2R0Q C;  2VB6 A;  3LL7 A;  5D5W B;  3ZMU A;  3DFG A;  2W85 A;  1APL C;  2BEO A;  2DFF A;  2VON A;  1XMK A;  2X51 A;  1RRJ A;  5DCM B;  4B44 A;  4NDL A;  1ZG1 A;  1BR2 A;  1XC5 A;  1R23 A;  1X3Z B;  2A68 F;  2AXT C;  4PJL A;  4LB5 A;  2CFO A;  2KMU A;  1RC9 A;  4NHJ A;  1R1V A;  2MLG A;  1RES A;  3CZ6 A;  1G3S A;  2M45 A;  4A12 A;  2HDD A;  2YU3 A;  2WC2 A;  1YW9 A;  2O3F A;  3U21 A;  3BR6 A;  2ID6 A;  2IA2 A;  1GLN A;  3GXO A;  3SZP A;  4E7H A;  2DT6 A;  4OOI A;  2GWR A;  3BCB A;  2NVX J;  5E3N A;  4X1E A;  3EET A;  1P9Q C;  1IW7 F;  1WJ5 A;  4MLO A;  1DDN A;  4CO8 A;  1IRZ A;  2VQG A;  4AIH A;  2QWW A;  5DUK A;  1JTY A;  1WKM A;  2NNN A;  3H9J A;  1HBX G;  3HIF A;  2NVU B;  4ABZ A;  2R7Q A;  3HRM A;  3ZR8 X;  3CMY A;  1BC8 C;  1FBQ A;  1Y0U A;  4WF2 A;  2NNY A;  1EV7 A;  1D0Z A;  2ZXH A;  2X6X A;  3C7J A;  2JZY A;  4I6Z A;  2EFQ A;  4ENJ A;  4ZTF A;  3T1B A;  4ZDO A;  3AFH A;  1RET A;  1FZP B;  2ETH A;  3J80 Z;  3PUB A;  3WOD F;  2IW5 A;  3HOV J;  5E20 A;  4Y15 A;  3O2P E;  2MLK A;  3HRT A;  4RGR A;  1B8I B;  5FFX A;  2K9M A;  1SFO J;  5KAI C;  1R1T A;  1TNT A;  2H6B A;  5ILV A;  5C3E J;  2ELH A;  2DA1 A;  4OAY A;  4A3L J;  1XDU A;  5ILS A;  2BVM A;  3WE3 A;  5FKK A;  5CVV A;  1EJ9 A;  4M9S A;  4L9V A;  2GA1 A;  4GYI A;  2E2J J;  2ZO4 A;  1IRG A;  3U1K A;  3TMO A;  1U8R A;  2WV0 A;  5D5V B;  2CH0 A;  4XQF A;  2ZXI A;  2KIS A;  1CF7 A;  4XKV A;  3ZRG A;  2EV0 A;  2UXX A;  4U88 A;  3KET A;  3JRH A;  3J7Z I;  4Y3O A;  1JUP A;  4BAY A;  3V7R A;  1YI2 I;  1V54 H;  2UV1 A;  3KFW X;  2LKS A;  3QP5 A;  4AU7 A;  5JVG F;  4E7K A;  2MYS A;  4IHV A;  1T0F A;  4L5E A;  4BL0 B;  4PFP A;  2VE8 A;  1X19 A;  3O8G A;  2CO5 A;  3K4M A;  2KKO A;  2MG4 A;  5ICG A;  1F43 A;  3SXY A;  5L3G A;  2HZT A;  2FQ3 A;  2I8D A;  4ITV A;  1HKS A;  1S29 A;  3ZQH A;  1LB2 A;  4KIG A;  2AS5 F;  3O6B B;  5BS6 A;  4A93 J;  2R93 J;  3L9F A;  1N25 A;  5J40 A;  1W0U A;  2L02 A;  1J9I A;  3C2H A;  3HSR A;  1R49 A;  4NC8 A;  5FKM A;  2M9H A;  3E5Q A;  1Z6T A;  2XB0 X;  2JUC A;  3QYE A;  3REO A;  3QWL A;  2AQF A;  3R0A A;  4N9H A;  4XKW A;  3V4G A;  1JKP C;  3VFZ A;  2XPU A;  4L0Y B;  3DLA A;  4HX8 A;  4EM0 B;  3OS1 A;  1YX5 A;  4RAZ A;  2JJ7 A;  5D4R A;  2MD0 A;  4GYG A;  4DOZ A;  1XTA A;  3CCS I;  4GRI A;  3AAF A;  1BC7 C;  1Z7U A;  3Q0U A;  3RSN A;  2LOO A;  5EEA A;  2PJR A;  3JRC A;  2K9N A;  1LE8 B;  2RVC A;  4G6Q A;  2PN6 A;  3IC7 A;  1A35 A;  4Y7N J;  1LNW A;  2V7F A;  4ETS A;  1MBE A;  4XRS G;  3KPH A;  3ZQ7 A;  4EJU A;  4XM3 A;  3HSF A;  1DGR M;  4IJA A;  2WAQ A;  2EFO A;  2OBP A;  4A3C J;  1AHD P;  2LKX A;  4DIQ A;  2PQ8 A;  3TBI A;  1QO0 D;  1B6A A;  1FC3 A;  3HBL A;  1Y8Q B;  2BY1 A;  1FMW A;  1WSU A;  3LOC A;  4I98 B;  3UNG C;  4RGU A;  2R7W A;  5M5Y J;  1RIO H;  5BOX A;  4GGG A;  1B4A A;  1O7L A;  4II2 A;  3QOE A;  4HST A;  1YS6 A;  4LK1 F;  2GLO A;  4LMY A;  1JTX A;  1KU9 A;  4JOM A;  3AG3 H;  3TW6 A;  2HNH A;  4CCJ A;  1VND A;  3E6C C;  2M8G X;  4EMS A;  1T6S A;  2RNG A;  3DCF A;  4GXO A;  4EJW A;  2M0C A;  2X6O A;  4EJT A;  1K79 A;  1FBU A;  2PBI A;  5E1W A;  1Z05 A;  2F5D A;  2CV0 A;  5GAG J;  1VQ6 I;  2XF7 A;  1UJ8 A;  4PUS A;  3TO6 A;  1P6R A;  4YFK F;  3WGI A;  3OR1 C;  2MW8 A;  1XD7 A;  4XID A;  4BJ5 C;  4BY1 J;  3S1M J;  4A3K J;  1K4S A;  3ESW B;  1TWH J;  4Y17 A;  4A3B J;  2X0L A;  2L9S A;  4A0X A;  4RBO A;  3ZOB A;  3TDU C;  2MC3 A;  2E7X A;  3HB9 A;  1LKX A;  4HEA 2;  1QZY A;  3VOE A;  1R4N B;  3DKW A;  3N4M A;  3SFZ A;  2CUJ A;  4V2G A;  4F55 A;  4U7D A;  5M3F J;  1MIJ A;  1JUM A;  4CYC B;  2QYO A;  1Z91 A;  2KIM A;  4P9F A;  4FE7 A;  2HQN A;  1H9T A;  4BH9 A;  4F3Q A;  4DQ2 A;  4RM2 A;  3GTK J;  1RPW A;  2IGM A;  2V4J C;  3OS0 A;  5ICC A;  3DPL C;  1FP1 D;  4AIK A;  5EGO B;  4J00 A;  2XB5 A;  3G1M A;  1NK3 P;  1LDK B;  3MZY A;  4RAY A;  1N77 A;  1VQN I;  2M7B A;  1V4R A;  4FX0 A;  2FQ4 A;  4Q47 A;  1SMT A;  2LH9 A;  3C3W A;  3Q0W A;  4DW6 A;  3KZY A;  4C2U A;  1UHS A;  4B09 A;  1K7A A;  2M5W A;  3D0S A;  3DU5 A;  4RM3 A;  4ESB A;  1P92 A;  1XDS A;  4ESF A;  5DDG A;  3ABU A;  3RZD J;  1TW2 A;  1H9G A;  3PQK A;  1T98 A;  2V1U A;  1E3P A;  2OAZ A;  4JX5 A;  2H8R A;  1L0O C;  1YOV B;  5IOY A;  5HDK A;  1K78 A;  1E0E A;  1L3L A;  1O3S A;  1KQ9 A;  2OA4 A;  3AG1 H;  1SC7 A;  1I1S A;  4PCQ A;  2E1O A;  1XGS A;  1WHU A;  1FIA A;  1J7K A;  1QHG A;  1KZH A;  3I4N J;  4UB6 C;  4XLF A;  4CCL A;  4M3F A;  4FT8 A;  1TQI A;  4MTD A;  4D0P A;  5CVU A;  4IRH A;  4E6K G;  3M4O J;  4AVP A;  2WY7 Q;  1UCR A;  3HKZ N;  5B3S H;  1R71 A;  2ELJ A;  1IN5 A;  2A6H F;  2DMN A;  1SFX A;  4DBQ A;  3ZQL A;  4MNU A;  2WAQ N;  2M1B A;  5F64 A;  1OCC H;  4L5I A;  1RZ4 A;  3HJE A;  5E18 F;  4RB1 A;  1MJB A;  2XVC A;  2ESH A;  2QQA A;  4I09 A;  4I02 A;  2DA6 A;  3OYF A;  2W7N A;  2FRH A;  3K2A A;  5FJ8 J;  3W2A A;  2CS3 A;  2EH3 A;  4JBA A;  4HDV A;  1TC3 C;  3H5R A;  3R61 A;  3G6E I;  4FIS A;  2ZJ2 A;  1TBX A;  2HOT A;  1RUN A;  3RIR A;  1HF0 A;  1G8X A;  1Y0N A;  3FXL A;  3JR9 A;  1Z67 A;  1D1B A;  3QPS A;  3J81 K;  3BDD A;  4ENM A;  2QF7 A;  3VB2 A;  1JE8 A;  5LGN A;  4ZH4 F;  1S3J A;  2JVG A;  4LLN A;  2R7U A;  5DV5 A;  4O3M A;  3CJT B;  3M07 A;  2IGN A;  4XOT A;  3IUO A;  4R1H A;  1TLH B;  1D5Y A;  1I5Z A;  3CC4 I;  4XRS A;  1DUX C;  1LEA A;  1GV2 A;  1QVU A;  2RRE A;  3QYF A;  2VXD A;  3FXJ A;  1ETQ A;  5FO5 A;  3EDP A;  1ETY A;  2XAJ A;  1DP7 P;  3AG2 H;  2TDX A;  3GTP J;  3JCU C;  2CUF A;  2RN7 A;  5HNF A;  4P96 A;  3PUF A;  3CCU I;  3JRD A;  1OPC A;  3GBG A;  3F21 A;  5FKL A;  5F04 A;  4CCM A;  1GXP A;  2EA2 A;  4M71 A;  2BW3 A;  3OSG A;  5D6F A;  2EB7 A;  2HOE A;  3BPV A;  4YEJ A;  4X6A J;  2A6T A;  1VQM I;  1QNT A;  4OU0 A;  4N0B A;  1WH5 A;  4G7Z F;  2OU2 A;  1FJL A;  2RC4 A;  3MKY B;  3S16 J;  2XGC A;  2Y0M A;  4R8H A;  2IS6 A;  2K4J A;  1WCM J;  2IP2 A;  3HOZ J;  1JXS A;  1VQ8 I;  1DGW Y;  3VOD A;  2BV6 A;  3H5N A;  1Z7L A;  2FMY A;  1TWG J;  2W82 A;  1W4M A;  5C4J J;  2CSO A;  1TWF J;  1W7P A;  2LMD A;  2PMU A;  1YS7 A;  3P9K A;  3K4C A;  2DI3 A;  2VUM J;  3CDH A;  4BAC A;  4U7B A;  3PIO F;  3MAJ A;  3PSI A;  1KON A;  1ITY A;  4DJA A;  2IS2 A;  3W3C A;  2RGV A;  3LAP A;  1O7F A;  2C6Y A;  4XRF A;  2M2E A;  2P5V A;  3S1N J;  4EVI A;  5IY5 H;  2V9P A;  2VOP A;  4B3X A;  1OCR H;  2P6T A;  2LDU A;  2HVR A;  2IS4 A;  2Q1Z B;  3LMM A;  4BEH A;  3BC8 A;  2XIG A;  2EFN A;  3E5X A;  4NC7 A;  1UG2 A;  3TDZ C;  4C3H J;  2QA4 I;  2LG4 A;  2NS0 A;  1G6N A;  4CHU A;  3V7C A;  1IN7 A;  4BHC A;  3DTI A;  2XRN A;  4Y33 A;  5K7H A;  1I27 A;  3B6C A;  1YHQ I;  1V5F A;  4AD9 A;  2QEN A;  5DM6 F;  3JTH A;  3RI4 A;  2QCO A;  1PUF B;  3HPH A;  3P7N A;  2ECC A;  1DQU A;  5BNG A;  3J80 K;  1BN5 A;  4A3I J;  1YFH A;  4BXU A;  1TTY A;  3I58 A;  3KEY A;  1IV8 A;  3LSR A;  3OR2 C;  3CC2 I;  2MH2 A;  3L2V A;  2RQP A;  5ILU A;  1I6X A;  1IO2 A;  2DK5 A;  2VQL A;  2NXN B;  3LFU A;  1YRN A;  2Y2Z A;  1WJD A;  3KE2 A;  2B9S A;  3Q9S A;  4UV8 A;  3PQJ A;  3S3O A;  1A6Q A;  4NNJ A;  4WK8 F;  1P2F A;  1MDM B;  3GW2 A;  2KJB A;  2E2I J;  4UUV A;  3BG7 A;  2TCT A;  2DMP A;  2K9L A;  2L9R A;  4FET A;  2CW7 A;  1U5T A;  1YYV A;  3CP2 A;  4BNC A;  1DU6 A;  5KAF C;  2NAZ A;  1D0Y A;  2VBZ A;  1GXQ A;  2V1N A;  4IOA F;  4XON A;  5DCM A;  3GVA A;  1LVK A;  2HDW A;  1RR7 A;  3OV8 A;  3B6A A;  3DTE A;  1FT9 A;  2DN0 A;  1QVT A;  1BOB A;  3G71 I;  3HOW J;  3RCO A;  5J1Y A;  3UR3 C;  2CQN A;  1WZ2 A;  1IRX A;  4F91 B;  1YJN I;  3ABM H;  1U5T C;  4N4N B;  5L3B A;  2NS7 A;  4QLC U;  1S7A A;  5HOD A;  3MFK A;  2HQR A;  1CGP A;  2NS8 A;  2P8T A;  2YU9 J;  2R7F A;  3IRR A;  3HL2 A;  4IHY A;  4RAF A;  2IA1 A;  1KQ8 A;  4YFX F;  2LBF A;  2L9N A;  2M87 A;  4HV5 A;  4MQ9 F;  1S72 I;  2JA6 J;  2W24 A;  1MMA A;  3FXO A;  1BI2 A;  2W57 A;  3GWZ A;  4XBF A;  3OSF A;  5HS7 A;  1FBS A;  1J75 A;  2K7L A;  1DPU A;  1X1P A;  5BQT A;  1BBY A;  1WI9 A;  2A5W A;  2KP6 A;  2GXB A;  2DFI A;  2DQL A;  3E1S A;  4RGS A;  5LHG A;  1VQL I;  1FSE A;  4IVN A;  4A6D A;  1G3Y A;  4QSH A;  3L2Q A;  5TJJ A;  1MZB A;  3CCJ I;  2HEO A;  2L7M P;  1KA8 A;  4D7M A;  3S32 A;  2HFH A;  4BHB A;  1PUF A;  2F5E A;  3FMQ A;  3TOB A;  3BZC A;  3ZQG A;  3I0T A;  2TRT A;  2AXL A;  4I01 A;  3A0B C;  5CYV A;  4MGR A;  4QIW N;  5AIQ A;  2JSP A;  3H3Z A;  3K4B A;  5E79 C;  4WX9 A;  2BXZ A;  3EUA A;  4HNV A;  2DT5 A;  1SFK A;  4KT5 C;  4HX7 A;  1ONV A;  2L4M A;  4XR6 A;  3GLX A;  4JYK A;  2VC0 A;  2VQH A;  4DYC A;  2R92 J;  2E60 A;  1ZEL A;  1T38 A;  4MEY F;  2CUZ A;  3R0J A;  2LVS A;  1FTZ A;  2STW A;  3ZQF A;  2FSW A;  1G4D A;  1R5H A;  3TKY A;  3IV5 A;  3AG4 H;  3I54 A;  2E71 A;  3MKZ A;  2HXO A;  4JQF A;  5H20 A;  5CPR B;  1WQ2 A;  2M34 A;  4BXX J;  1H8A C;  1XB4 A;  2XPV A;  4IKF A;  2WAF A;  4XSZ F;  1QA6 A;  5E3O A;  3GZ5 A;  5HOO A;  2Q2E B;  2KRH A;  1UEL B;  2Z5U A;  4P1W A;  1NTC A;  4RLF A;  3LQR A;  3OYB A;  2CQQ A;  2H6C A;  1KGS A;  1EKE A;  1I6H J;  1HLV A;  5IPA A;  1HC8 A;  1BL0 A;  2OCE A;  1J09 A;  3TP0 A;  3FM5 A;  3H0D A;  3HOY J;  1FYM A;  3PO3 J;  1REP C;  5EZH A;  1WWX A;  1NH3 A;  2O0Y A;  2LRD A;  3JAM Z;  3S2W A;  5KVR A;  5M5W J;  2VKV A;  1JGS A;  3FXM A;  4A69 C;  3FX3 A;  4H4K C;  2WBM A;  1JJ6 C;  3NRV A;  5EEG A;  3T8T A;  1TT0 A;  3BP8 A;  2CGP A;  1VQO I;  1W36 D;  4BBS J;  3VSK A;  1RI7 A;  4PSX A;  3ISP A;  2VPR A;  4I0A A;  3PIP F;  5D6E A;  3QU3 A;  1OJL A;  1KU2 A;  2A61 A;  4ZYH A;  2ZBK A;  4UVA A;  3ERM A;  3O8H A;  5A2Q Z;  1MSE C;  3ECO A;  1W5T A;  2OZU A;  3BQZ A;  2DA5 A;  3ZMS A;  1ETO A;  4S05 A;  1B72 B;  3IRQ A;  2AHQ A;  3H92 A;  3OYN A;  3CMA I;  1R9T J;  2MH9 A;  5FFZ A;  5FRN A;  3SDG A;  3FKJ A;  3DQV C;  1P7J A;  1SVO A;  1ZAO A;  1ZN2 A;  3A0H C;  3SYT A;  2CV1 A;  2V6C A;  2PMH A;  2XAU A;  1AA7 A;  2IGK A;  1SD4 A;  2F4M B;  3OYC A;  4Z6Y A;  1JHF A;  2CU7 A;  2K9Q A;  4A0Y A;  2CMP A;  2COM A;  3EUK L;  3QQA A;  3F23 A;  3L09 A;  5J8C A;  5ICE A;  4XLE A;  1RR8 C;  3V8L A;  3AL0 C;  1ENH A;  2A07 F;  3CF5 F;  3K4N A;  4HX4 A;  5JLX A;  1MSF C;  3CDL A;  4U87 A;  3BJO A;  4OMY A;  4XOP A;  1VF9 A;  2LF8 A;  3W6J B;  1ZKG A;  4RB2 C;  3IWZ A;  2DQR A;  3CC7 I;  3LFK A;  2ZXW H;  3BTI A;  4PJJ A;  3DTK A;  5LGU A;  2O61 A;  1DPR A;  1D8J A;  3S3N A;  4XKC A;  5F08 A;  5GAD J;  3VDX A;  4RA2 A;  1A31 A;  2DOD A;  2F5F A;  4UVC A;  1YJ9 I;  2VE9 A;  1U78 A;  5DTD A;  3GTG J;  3F8C A;  2Y9Z A;  3VWB A;  5EG0 A;  3RKY A;  3E7L A;  3WG7 H;  2HVS A;  3OYD A;  2XV4 S;  3GUD A;  3FIW A;  4WCG A;  3TW7 A;  3E6M A;  3OL3 A;  3WGG A;  1X2M A;  2EZK A;  1IUF A;  3K4K A;  3WTS C;  3JTG A;  1LDD A;  5J6X A;  1WJF A;  3M8J A;  4ANJ A;  5LEK A;  2Y0S N;  4EM1 A;  2ME6 A;  5M5X J;  1PVE A;  4RGX A;  2VJJ A;  2A5Y B;  4QPO A;  1HKQ A;  2QQ9 A;  3FHN A;  3HKZ A;  5FD6 A;  3HGG A;  4FTH A;  1JI8 A;  4F92 B;  2DXI A;  4LLG F;  4R79 A;  2EWN A;  2M4K A;  2N8G A;  4ON0 A;  2BZT A;  2DOA A;  3CJR B;  3RKQ A;  3P9I A;  2Z3Y A;  4BY7 J;  3S2H J;  3GYH X;  2DTR A;  4AYB N;  4G94 A;  1BOA A;  5F27 A;  3CQZ J;  3OYK A;  1BJZ A;  2DMT A;  4D9J A;  1TQM A;  5K5O A;  1YX3 A;  3ZP5 A;  3LAJ A;  2E5Z A;  4KMF A;  2ECB A;  3K0L A;  1QPM A;  2JRM A;  2HS5 A;  3K70 D;  4D5C A;  4A3D J;  1ZGW A;  1WJA A;  4OIQ F;  2KRC A;  3GFI A;  2LP0 A;  1T95 A;  1ZG5 A;  3KP5 A;  3F8N A;  2HKO A;  2O8K A;  3BG6 A;  3G4S I;  1UFM A;  3I4M J;  5F0C A;  2OV7 A;  4HW0 A;  3B02 A;  2L3D A;  1JUS A;  4BUP A;  2V9K A;  3CP8 A;  1F9N A;  4ZDP A;  1A5J A;  5EF6 A;  1UG0 A;  1RNL A;  5CQE A;  2ZB9 A;  2EV5 A;  2VJ5 A;  3GTO J;  3RPU A;  1HW5 A;  3HUG A;  2X1C A;  5C4X J;  3DF8 A;  2YX4 A;  2W4S A;  1IXR C;  4M6Y A;  5IOZ A;  3KZZ A;  2VBW A;  2XKP A;  5D5X B;  1HW2 A;  1ZTR A;  5A2Q K;  1HSJ A;  3U9G A;  2YX7 A;  5IT9 Z;  4IRI A;  2DA4 A;  2XAG A;  2K5C A;  2RAE A;  4XLA A;  3RYR A;  3OYL A;  2HTJ A;  1PDN C;  2HDC A;  3DKY A;  3HM5 A;  3WU0 A;  5EGO A;  1ZR2 A;  1SAU A;  4DNC A;  1W36 C;  3ASN H;  2QZ8 A;  3BTC A;  3H0G J;  3F8F A;  3HRS A;  4ZYG A;  1MBJ A;  1XMX A;  3Q9V A;  2K40 A;  3ERE D;  4RB3 C;  1XSX A;  2NYX A;  5LRS A;  1HST A;  1FOK A;  2DJN A;  4IX7 A;  3NWT A;  5GTH C;  1TT5 B;  4FE4 A;  4UB8 C;  4IHS A;  3SQN A;  4M74 A;  3M3Y J;  3OYJ A;  3ECH A;  2A69 F;  3D5R C;  3M9A A;  1LVA A;  4I7H A;  4D1Q A;  1GHC A;  3FHZ A;  2P81 A;  3J7A Y;  4MTE A;  1B1B A;  1LQ1 A;  4F52 A;  1QGP A;  2RV8 A;  5HLT A;  4CIC A;  2IT0 A;  3ZMV A;  1Z6R A;  3G2B A;  4AVZ A;  3DPU A;  1XCB A;  2JPC A;  1DU0 A;  4Z2Y A;  4YRV A;  2M30 A;  4HRI A;  3WHC A;  4BE2 A;  2Y0S A;  1MH4 A;  4X0G A;  2QBY B;  3FBI B;  1STZ A;  3ZQQ A;  3PO2 J;  2VJI A;  1O4X A;  3BTL A;  2V26 A;  3HYI A;  3LST A;  3QPL A;  5IT3 A;  2CFX A;  3K9T A;  2CW0 F;  4XLC A;  3KZI C;  3W6K B;  2ZJQ F;  4IF4 A;  2XGD A;  3VYT B;  1GV5 A;  1AU7 A;  2A05 A;  1M1E B;  2HU9 A;  1MMN A;  3L00 A;  2VL8 A;  3SFI A;  3V8K A;  5J1R A;  1F1Z A;  1ZLJ A;  2FNP A;  1TNS A;  2ISY A;  1OCO H;  4XLP F;  4IZZ A;  1K61 A;  4KIF A;  2WAE A;  4NUB A;  2XUB A;  3KYD B;  3E0J B;  2B7E A;  2EV6 A;  3HC7 A;  1ZH5 A;  2GQQ A;  2OF7 A;  4G9Y A;  4ZYD A;  2AQE A;  3D1N I;  3W6V A;  3WTY C;  4U0V A;  5FRM A;  2JWT A;  4S0H B;  3MCZ A;  2BGC A;  4E7L A;  2BY3 A;  4BBR J;  1JT6 A;  2MC4 A;  1T0F C;  3F72 A;  5D8K B;  3IL2 A;  3N05 A;  3P9C A;  2QM3 A;  1VQ4 I;  4XOR A;  3FKI J;  3K6G A;  4G12 A;  1XS9 A;  5EYR A;  5L3C A;  2VOD A;  2X6W A;  2AO9 A;  5TIS C;  3JSP A;  3B73 A;  4BYY A;  3TL4 X;  1I1G A;  1R00 A;  4G8X A;  4L18 B;  3E3V A;  4BE0 A;  3GO5 A;  3WE2 A;  4WXC A;  1X1A A;  2P5K A;  3RJP A;  3QPH A;  2DMU A;  1BI1 A;  4BGD A;  1GVD A;  4OAZ A;  4CCK A;  2IGO A;  2MGQ A;  3PSF A;  3OYI A;  2ISZ A;  5J1U A;  3RKX A;  2XSD C;  3AKZ A;  4IHX A;  4BHP A;  2D45 A;  4IL6 C;  3HRU A;  2QEX I;  2QVO A;  5M3M J;  5LFA A;  2GIV A;  1BI3 A;  2XRO A;  4KIB A;  1S5L C;  2F48 A;  1Y1V J;  2DOF A;  5ERI A;  2QGU A;  1BW6 A;  1IN8 A;  3JAM K;  2LR8 A;  2MFZ A;  4YG2 F;  3KIO A;  2ESN A;  3MKL A;  4E4H A;  1VI0 A;  2LF7 A;  3M1C A;  1FYL A;  2KZV A;  4EEF G;  2DLL A;  4IXA A;  3M8F A;  3BRO A;  4ASN A;  3COA C;  3S15 J;  4F7Z A;  1O3T A;  4KYW A;  3VPR A;  1YRN B;  2ZSI B;  3L2W A;  1P7I A;  1RUO A;  3OWT A;  2XHK A;  1YJW I;  3V7S A;  4G7O F;  5GAE J;  2QLZ A;  2DDA A;  2VT3 A;  4UUT A;  4CH7 A;  1T2K A;  3A02 A;  3SHF A;  5J4Y A;  5JVT A;  1IDZ A;  3R6S A;  2JRT A;  1WGX A;  4V19 K;  3VEP A;  1D1C A;  1FWZ A;  3BQY A;  1SMY F;  2I5U A;  2BY2 A;  4UUS B;  4LG0 A;  3CUO A;  4B47 A;  1FNN A;  3J7Y J;  2EZL A;  5E8G A;  3RPU D;  3A4C A;  3WTW C;  2BYV E;  2CJJ A;  3IWF A;  1E2X A;  5J4V A;  1UHM A;  2KHM A;  1DP3 A;  2PJR B;  1X58 A;  4WXD A;  4QPQ A;  2DW4 A;  1O3Q A;  4UY8 I;  2DA7 A;  3QYB A;  1OFC X;  2PMZ N;  3MKW B;  2NVY J;  3FM3 A;  3U1D A;  1EF4 A;  1EH6 A;  4M9X A;  4HBL A;  1ZRF A;  1IXC A;  4EGZ A;  3M7G A;  4A3M J;  1X4O A;  3TOA A;  1X3W B;  1S6L A;  3BR3 A;  5BPI A;  5GP9 A;  1IV6 A;  3MQ0 A;  5J47 A;  1UB9 A;  1ZRE A;  1O3R A;  1TWA J;  3CES A;  2CV2 A;  1NK2 P;  3DEE A;  4P5O A;  3HGY A;  3NEU A;  3G3Z A;  1MBK A;  4PJ0 C;  5FRO A;  1GDT A;  2IVM A;  1Z3Y A;  3PM1 A;  3I55 I;  4LB6 B;  1MNM C;  2LFB A;  1U9O A;  2ZNZ A;  2O6G E;  1HKT A;  3L7W A;  1A6I A;  2DOE A;  4HA8 A;  1VQP I;  4KJZ A;  4ZZL A;  1LEB A;  1TP4 A;  2W00 A;  4LIT A;  1MND A;  5DD4 A;  1FEX A;  4I0B A;  3WTZ A;  3V42 A;  5DM7 F;  3QRF F;  2G9W A;  5F0H A;  3ZQI A;  5JI6 A;  3GTQ J;  4J01 A;  4HPQ A;  2FML A;  3FF5 A;  3TO7 A;  4IHW A;  1Q1H A;  1YIO A;  4CSW A;  2IXS A;  2VKH A;  3HPG A;  4CYD A;  1F5T A;  1MGT A;  4C2T A;  3WTV C;  2WTE A;  3UKG A;  1HXD A;  4LGW A;  4BS9 A;  5K7Z A;  4IOC F;  3H9G A;  1FYK A;  3CCY A;  5K1Y A;  2H1L A;  2GOX B;  1BR1 A;  1KYZ A;  2JMW A;  3CCM I;  3BJA A;  1FTT A;  4BU2 A;  1VQ9 I;  4Q5S F;  3TP3 A;  2DT7 B;  3IKV A;  2VIX A;  3ASO H;  1E3H A;  3GEZ A;  2CWE A;  1HDD C;  1HA8 A;  1BI0 A;  1LE8 A;  5GPC A;  5L3E A;  2FBH A;  1NG7 A;  4M73 A;  2R7O A;  2LBF B;  3SEQ A;  3X2Q H;  3TQN A;  4BJ6 C;  3DBH B;  1OR7 C;  3QOP A;  3Q5F A;  2G0E A;  3H35 A;  3GTM J;  4XN0 A;  1CQT A;  2DAO A;  1BW5 A;  1FOX A;  2DTZ A;  4N4O B;  5IYD J;  2VLA A;  2JVH A;  1Z77 A;  4PDK A;  2H1K A;  2PI0 A;  1SEU A;  5E17 F;  1VQ5 I;  2DU9 A;  2KDO A;  4AYB A;  2MA3 A;  4XRM A;  1UHW A;  2D2W A;  3DLL F;  3FK6 A;  3GTL J;  4XLN F;  2R4G A;  2RKH A;  1RKT A;  3K1P A;  5LD2 C;  4HOB A;  4LIV A;  2HPI A;  4AIJ A;  1H88 C;  2DFH A;  2W84 A;  1R7J A;  1UMQ A;  3OIO A;  5HS9 A;  1JKQ C;  4U0W A;  2P0W A;  3JRA A;  2OTJ I;  3VYU B;  2EFP A;  1OYY A;  4YII A;  3MEX A;  1SD5 A;  3HOT A;  1IAW A;  2F5C A;  1IGN A;  2LKP A;  1QQI A;  3G1O A;  1NG6 A;  2DMQ A;  3FXK A;  2NVQ J;  2E7W A;  4HAM A;  2Q8K A;  1WJC A;  1MW7 A;  1OYW A;  1W5C C;  1WJE A;  3RYP A;  1XMA A;  1B8I A;  2R7D A;  5CVR A;  3OYH A;  1VTN C;  4NC6 A;  2UXN A;  1T8I A;  2PG4 A;  2F4O B;  4AM3 A;  2HGC A;  3DEW A;  5LBQ A;  4A3F J;  2QUF A;  1JKO C;  4XL9 A;  1WJB A;  3ZGK A;  1AKH A;  2CW8 A;  3RKW A;  3DBL B;  4B48 A;  5HLI A;  2KPM A;  4RMN A;  2XC7 A;  2H27 A;  1FOY A;  3K4L A;  3P5J A;  4CUG A;  2K86 A;  1EH7 A;  2RDP A;  2OUM A;  3HOS A;  3E5U A;  3WHB A;  2GXA A;  3QP6 A;  3K70 C;  2QSF X;  2JA5 J;  3FDY A;  2GBY A;  4G7H F;  3JRI A;  3BPX A;  4XN3 A;  2Y30 A;  2XGE A;  2O8X A;  3MD2 A;  2W48 A;  5J8F A;  5FLV A;  3ABK H;  2LC2 A;  1LPQ A;  2FX0 A;  2M3A A;  3LSJ A;  5E8I A;  2YSR A;  1WRJ A;  5CJ9 A;  1G3W A;  3CCV I;  2IBD A;  1HDP A;  1WFX A;  2L7F P;  2QQ8 A;  3F8M A;  1BA5 A;  4GDF A;  2F4I A;  1X1D A;  3S8P A;  4RB0 A;  5DD8 A;  1C0W A;  2LY1 A;  1B9M A;  9ANT A;  4MO7 A;  2FXA A;  4K2E A;  1D5V A;  3ABL H;  2R5Y B;  2M0M A;  2HQ5 A;  2OZ6 A;  1QPI A;  4YEL A;  1X1B A;  4W1U A;  1IC8 A;  2BXY A;  4A0Z A;  3FMR A;  1K78 B;  1XSV A;  1J59 A;  2DFE A;  1ETX A;  2IJL A;  3T0Y A;  4HQM A;  2HWV A;  4KFC A;  2KQR A;  4C9Y A;  2CQX A;  5B1B H;  3L2C A;  5BMZ A;  2FOK A;  4DGW B;  2Y75 A;  3S14 J;  3JSO A;  1UAA A;  1S9H A;  3CLQ A;  2K9S A;  2VC1 A;  3OYM A;  5CLS A;  1ZGA A;  3ABT A;  5EZG A;  5HNH A;  1GVJ A;  1ODD A;  2XAS A;  1P4X A;  2Z16 A;  3E6D A;  3GME A;  4UXN A;  4N9I A;  4TV7 A;  3LNQ A;  3OIQ A;  1VQK I;  1I50 J;  3JRE A;  1MD0 A;  3BY6 A;  3SZT A;  3R60 A;  3EUH C;  3HG9 A;  1OKR A;  4Q4Z F;  5FLX K;  2MD5 A;  2JA7 J;  2NRA C;  4H0E A;  1POG A;  2JT1 A;  2R7R A;  2ZJP F;  3E6B A;  2FD5 A;  2E2H J;  4ZC3 A;  2CUE A;  4NBQ A;  3HHH A;  3LQQ A;  4KMU X;  3VYS B;  2VI6 A;  3SEZ A;  1WH7 A;  2H09 A;  2L7Z A;  4CCN A;  4BDY A;  5KCM A;  4BDZ A;  3O3K A;  3I53 A;  2DCE A;  5JHU A;  2HZD A;  2LY2 A;  2Y48 A;  2X6Y A;  3HTU A;  1HQC A;  3BT9 A;  3OYA A;  2G7H A;  3M8E A;  2L0K A;  4P55 A;  3OIP A;  4OIR F;  3CJN A;  3LSI A;  2E5N A;  1Q1V A;  1BM9 A;  3H1C A;  3CUQ A;  3KP4 A;  2ZXJ A;  1R4M B;  3BR2 A;  4M3B A;  3ULQ B;  2HXI A;  2XF5 A;  3LA3 A;  5JR3 A;  2ME0 A;  4M3G A;  2IRF G;  5F6F A;  2JA8 J;  3BWG A;  3V8J A;  2JN6 A;  4WWC A;  2FJ1 A;  3I64 A;  2W1O A;  2E35 A;  4MHG A;  4MQV A;  3IH4 A;  2QSH X;  4MEX F;  1MKM A;  2R3S A;  1QZZ A;  5FKN A;  3CCE I;  2E34 A;  1SVL A;  5JLW A;  1W5S A;  2HOS A;  3HXL A;  1T33 A;  3KLO A;  3HHG A;  2VT2 A;  3BZ6 A;  3DKX A;  3HEF A;  1YW8 A;  4DZJ A;  1PP7 U;  2FOW A;  2GA2 A;  2IS1 A;  4PZJ A;  2DYR H;  2X9D A;  5FD5 A;  4BQQ A;  2Z33 A;  1R58 A;  1D8K A;  2MSY A;  2XKO A;  2FNA A;  2Q0O A;  4FAS D;  2V79 A;  2YPR A;  1U5T B;  2R5Z A;  2QBY A;  5D4S A;  4BQN A;  3OYE A;  4KN7 X;  2WY8 Q;  4IPA A;  2W25 A;  1S7O A;  2EIM H;  1F4K A;  1FP2 A;  2P7C B;  4XLH A;  3EYY A;  3CME I;  5E1Z B;  3NWS A;  2ID3 A;  1T08 B;  4ENK A;  3HSE A;  3LA2 A;  1PJR A;  5JHF A;  2OQR A;  3I5U A;  1ZLK A;  3C1D A;  3LSG A;  3IHU A;  4EM2 A;  3A1Y A;  4ZYA A;  2JSC A;  3GFL A;  3BLY A;  3VYR B;  5L3F A;  1IJW C;  1MMS A;  3A03 A;  2NOG A;  2PFB A;  4YIR X;  3KP3 A;  2ZFU A;  3H36 A;  5HLH A;  1WVR A;  3ROU A;  2IA0 A;  4U0Y A;  2P5L C;  4M6X A;  4LK0 F;  2COB A;  2HI3 A;  5F0F A;  3H3V K;  1R5I D;  2KJC A;  2LSO A;  4A5M A;  4LLL A;  1JGG A;  3KP2 A;  2E1N A;  2JQ7 A;  4XKB A;  1S7E A;  5E3L A;  2D1H A;  3QPT A;  4HNU A;  5IYB J;  3F8B A;  3D5S C;  2V1X A;  1BR4 A;  1Y8R B;  3A2K A;  2HVQ A;  3F22 A;  3OL4 A;  2FF4 A;  2X1E A;  1QBJ A;  3LSP A;  2VAS A;  3F9K A;  1EH8 A;  2VXZ A;  1FMV A;  1BIB A;  1EA3 A;  2E1M B;  4L0Z B;  3G1L A;  2XAH A;  4L9J A;  1TQP A;  3PNT A;  5FGM A;  1ZR4 A;  2EIK H;  4GCV A;  1ON1 A;  2WB1 N;  3OOP A;  4B4C A;  3FXR A;  3RPQ A;  4E7Z A;  5FLM J;  4JK1 X;  2Z2S B;  2BHZ A;  5AIP A;  1XN7 A;  1O57 A;  3CUQ B;  2PJP A;  4CZC A;  2MBF A;  5DS9 A;  1IRF A;  1J0R A;  2UWM A;  3K69 A;  4OWR B;  5CVJ A;  2H8W A;  2M4G A;  4O5V A;  3F0C A;  2FU4 A;  2A3S A;  2DPU A;  1YG2 A;  3KLN A;  5CKT A;  1XGM A;  5FB2 A;  1V5E A;  1FIP A;  2FBK A;  4NQW B;  2ZSH B;  2ZME B;  1UZC A;  3Q0V A;  1SAN A;  2M8E A;  2QKL B;  2O03 A;  3LSK A;  1ETK A;  1V3F A;  2VOO A;  3D5L A;  3BOQ A;  2ZCW A;  3LSM A;  4QWQ A;  1IF1 A;  2LYC A;  5D8L B;  3PFY A;  4HSR A;  2OTL I;  3ZXS A;  5D5U B;  1K6O A;  2EZI A;  1W0T A;  3SJM A;  2HKX A;  1TZL A;  1IG7 A;  2PEX A;  2R7V A;  3FXQ A;  2R7Z J;  4NQW A;  2EZH A;  1SD7 A;  2ZME A;  2M7A A;  1WPK A;  4HLX A;  4FHT A;  1X2N A;  5H6Q A;  4C2M J;  4OIO F;  1U6G A;  2HQA A;  5TGT A;  4B1R A;  1Y56 A;  1D1A A;  4HZF A;  3ZMZ A;  3KP6 A;  5DEQ A;  3S93 A;  5EJC A;  5KHD A;  3L2U A;  1Y6I A;  1A36 A;  2GAU A;  4HV6 A;  2VQC A;  2LRE A;  1LFB A;  3TO9 A;  2L5Q A;  2K3F A;  1YIJ I;  3KP7 A;  2CYY A;  1K4T A;  1MJ9 A;  4BQA A;  2GOM A;  2J5P A;  2ZME C;  1ZYR F;  3K2Z A;  4LJZ F;  2A6E F;  5K5Q A;  1OMI A;  3JW4 A;  3TGN A;  4B3A A;  4J19 A;  4RLQ A;  4I99 C;  1P4W A;  4CA0 A;  4YFN F;  3J7A O;  2PX9 A;  4IHT A;  2F5V A;  3TED A;  2K02 A;  5LEJ A;  2XDV A;  1ON2 A;  3MZH A;  4HLY A;  2DYS H;  2WA0 A;  3CCR I;  1FX7 A;  2X85 A;  2K3P A;  3A01 A;  3CO6 C;  4DYQ A;  2HYG D;  3S2D J;  5IP9 J;  3F3X A;  1ZGJ A;  3H9Q A;  4Q48 A;  5GPA A;  4WXH A;  4V2F A;  2XRL A;  1OCZ H;  1U3E M;  2DA3 A;  1LDJ A;  2KIQ A;  4M3D A;  4Y13 A;  2QKM B;  1SFU A;  2E1M C;  2HYJ A;  3R4K A;  2K85 A;  4RDU A;  1V5G A;  3I59 B;  3FK7 A;  4JX6 A;  3GZ6 A;  4YIF A;  1WI3 A;  4I76 A;  2LY9 A;  4W97 A;  1BIA A;  1ERD A;  2F6C A;  3JRB A;  2KDZ A;  4AID A;  4DYR A;  2VN2 A;  1JJ8 C;  1Y39 A;  4B43 A;  1ORK A;  2BOL A;  2V9V A;  2BHY A;  2J5O A;  5BPD A;  2KIU A;  3RZO J;  4EGY A;  1YLF A;  4M9Z A;  1AOY A;  3RTR A;  2H94 A;  1G3T A;  4UUS A;  2L9V A;  1XPX A;  3CO7 C;  2PLY A;  2Q2E A;  3CMM A;  2I10 A;  5ED4 A;  2KLO A;  5L3D A;  2DK8 A;  3BG5 A;  2OJE D;  3K10 A;  1R22 A;  3GZN B;  4C3I J;  3JRG A;  5HDN A;  3S3M A;  1J5Y A;  1ETW A;  1KQ0 A;  3FZV A;  5EEH A;  2GM4 A;  4ZTJ A;  1MDM A;  2VBY A;  4L5J A;  3E97 A;  3Q3S A;  5C44 J;  1ULY A;  1G59 A;  3H5A A;  5IP7 J;  4XMY A;  2EIJ H;  2HYF A;  2L01 A;  1E3O C;  3FIS A;  4BE1 A;  1XG1 A;  2DO7 A;  2LD5 A;  4FX4 A;  3EQL F;  5ICF A;  2KZG A;  1R6R A;  2E19 A;  2EJR A;  2KL4 A;  3WU2 C;  5IP6 A;  2VKD A;  1FOW A;  1OLT A;  4KIC A;  3IP4 B;  4MFE A;  4PJM A;  3PJR A;  3IKT A;  4XNF A;  1A04 A;  2FEZ A;  1YE9 A;  3OMY A;  4HG2 A;  1IN4 A;  2FBI A;  2GZW A;  4F93 B;  3M1E A;  1N75 A;  2XAF A;  3EPZ A;  1B72 A;  1D3Y A;  2L54 A;  5IYC J;  1FSH A;  2STT A;  4HYE A;  1QRY A;  4AC0 A;  3CJQ B;  2O5R A;  2QSG X;  2ELK A;  1QHH D;  4ENN A;  4UHT A;  3OOU A;  1NHA A;  1MBF A;  5CVI A;  4E70 A;  3ZPL A;  1Z1D A;  2JA2 A;  1D0X A;  2VJ4 A;  4PSW A;  5LLQ A;  3KCC A;  2D5V A;  4CYC A;  4HQE A;  1XSD A;  1CF7 B;  1JHH A;  1S8N A;  2DBB A;  4EQQ A;  1IDY A;  1OIS A;  2OC6 A;  3NAU A;  5K7F A;  2ADU A;  4XK4 A;  3WTU C;  3HDD A;  2ACJ A;  4A3G J;  3W2V A;  2DDB A;  1YIT I;  5E1X A;  4EV0 A;  5IT9 K;  5B5E C;  1MMD A;  2LK2 A;  2JPB A;  1KU3 A;  2HPM A;  1TWC J;  3WG9 A;  3KX2 A;  3QAH A;  4UV9 A;  2CQK A;  3FBN B;  3H3U A;  2F2E A;  3K1M A;  5DUI A;  4QTR A;  3CD6 I;  1R1U A;  3PNY A;  2IPQ X;  4A2U A;  5LRR A;  1KU7 A;  5KK1 A;  3L2R A;  4MIM A;  1YW7 A;  3ZMT A;  2XPW A;  3MWM A;  1SFE A;  3IH2 A;  4O6J A;  4HDU A;  2XF6 A;  4HF1 A;  4JP0 A;  3LWF A;  1X3U A;  5EG0 B;  2KT0 A;  3ZCO A;  3I56 I;  4G6T B;  3KEQ A;  1G2H A;  1MJA A;  3GLL A;  4MFD A;  3QU6 A;  2YUS A;  4CZZ A;  3G73 A;  2DJI A;  4KN4 X;  3DPT A;  1X1C A;  1B9N A;  1ZAR A;  2EBI A;  3C18 A;  3RQI A;  4A3J J;  3OYG A;  1U8B A;  6PAX A;  3IAM 2;  4L9N A;  1SD6 A;  2Z99 A;  2P4W A;  4HF2 A;  4B8X A;  3GF2 A;  3WU1 B;  3ZMD A;  4KIT B;  1FLI A;  2WV1 A;  5DYM A;  4E7S A;  4CGZ A;  3GFM A;  1OYI A;  4ZDL A;  2ICW G;  2BBY A;  3BR1 A;  4XSX F;  4Y4R A;  1MH3 A;  2DA2 A;  4OIN F;  1HOM A;  1HCR A;  2OCC H;  3WTT C;  3DV8 A;  4M72 A;  1SVM A;  1H0M A;  2ZFW A;  2VPL A;  3DXJ F;  2XAQ A;  3SZG A;  3MN2 A;  2YS9 A;  1GT0 C;  4EAT A;  4G6D A;  2QQB A;  4IQ4 A;  5CQG A;  1FY7 A;  2GIZ A;  5H2F C;  1N78 A;  1I3A A;  5GAH J;  3L1P A;  2EK5 A;  2V1D A;  3IH3 A;  2R5Y A;  3DBR B;  2UUZ A;  3I3L A;  4FCY A;  4ZZD A;  5B66 C;  1XX5 A;  5GTI C;  1I39 A;  2BVL A;  4JX4 A;  4KA4 A;  3OY9 A;  2OPT A;  5LHH A;  3DWL E;  3SDB A;  1LJ9 A;  2JTV A;  4II3 A;  4ESJ A;  1LUJ B;  2VBX A;  4L9T A;  3CCQ I;  2WWY A;  1YO5 C;  3FXU A;  2FE3 A;  2FUG 2;  2OD5 A;  3MZ8 A;  4ZYE A;  1ZRD A;  4GFB A;  4RS8 A;  2EA4 A;  2L4A A;  2V6E A;  2CG4 A;  4LOC A;  3MMY B;  2EIN H;  1AKH B;  1Z21 A;  3CUQ C;  1MMG A;  2B0L A;  4LFU A;  3MVP A;  1QZE A;  1Z9C A;  1TL8 A;  4KDP A;  1OCP A;  1K83 J;  3DEU A;  2EFW A;  2EIL H;  2P6S A;  2Y9Y A;  2R7S A;  1MBH A;  1SAX A;  2Z1D A;  1F36 A;  3W2W A;  2X48 A;  3WGH A;  2R5Z B;  2LTP A;  3ONQ A;  1X4P A;  4HF0 A;  3GTJ J;  1U2W A;  4P9U A;  1J2X A;  1XGO A;  2GXG A;  4IO9 F;  5JFR A;  5TRD A;  4A3E J;  2O7O A;  1VQ7 I;  4S04 A;  5HDG A;  1GUU A;  2UZK A;  4BKX A;  2HOA A;  1VFC A;  2KFD A;  1ZRC A;  2CQ7 A;  3U2R A;  3AL0 B;  3F6O A;  1PYV A;  1FPQ A;  2ZKZ A;  1W7P D;  2JK3 A;  2WB1 A;  1I3Q J;  1XCV A;  5KNL A;  2G7U A;  3BR0 A;  3C2B A;  3EUH A;  2WAD A;  3N97 A;  1P4A A;  2O9L A;  4AUX A;  2KIF A;  4OIP F;  2E36 A;  3IAS 2;  4M3E A;  4C30 A;  5J3L A;  1U9N A;  2PMZ A;  5B1A H;  4CXF A;  1TW3 A;  1AWC A;  3K4J A;  5F1R A;  3F6V A;  5HLG A;  1ZQ3 P;  1ZK8 A;  3JRF A;  1VZ0 A;  1PP8 F;  1H89 C;  2LNB A;  4C3J J;  3BG9 A;  4UVB A;  2XGX A;  2B63 J;  3HUG B;  2BE5 F;  2BY0 A;  3FMS A;  5E3M A;  1T39 A;  5HS8 A;  3HOX J;  3PFI A;  4EJO A;  3CLO A;  4IEJ A;  3BCA A;  1JKR C;  3K7A J;  3K1N A;  1PUE E;  4D5F A;  2IEK A;  1ZG3 A;  5F1J A;  2YR2 A;  5EDN A;  2BW3 B;  3LA7 A;  3KYC B;  3NQO A;  4LIU A; 
#chains in the Genus database with same CATH homology
 1Y1W J;  2P81 A;  3JRD A;  2R5Z A;  3GBG A;  5FKO A;  5FKL A;  5F04 A;  4DZP A;  1DU0 A;  3OSG A;  3HOU J;  3WHC A;  2ID3 A;  4X6A J;  1MH4 A;  1Z0X A;  3S17 J;  1WH5 A;  3PO2 J;  1JT0 A;  1FJL A;  2NVT J;  1O4X A;  3S16 J;  3BTL A;  2XGC A;  1MBG A;  3QPL A;  3BR5 A;  1OCT C;  3LSG A;  1T56 A;  1WCM J;  3HOZ J;  1IJW C;  3A03 A;  2NOG A;  2XGD A;  1GV5 A;  1TWG J;  5C4J J;  1AU7 A;  1TWF J;  3SFI A;  5J1R A;  4M6V A;  1K61 A;  2COB A;  2HI3 A;  2VUM J;  3NAR A;  5F0F A;  3H3V K;  1JGG A;  1ITY A;  2OF7 A;  3D1N I;  1S7E A;  1ETV A;  5E3L A;  3W6V A;  5IYB J;  2JWT A;  4S0H B;  2M2E A;  3S1N J;  4BBR J;  1JT6 A;  2Y31 A;  3ZQC A;  3LSP A;  3FKI J;  4G12 A;  1XS9 A;  5EYR A;  2VKE A;  3G1L A;  2AO9 A;  3S1R J;  1UG2 A;  4C3H J;  1ZR4 A;  4B4C A;  2WB1 N;  5FLM J;  5K7H A;  3B6C A;  3BG3 A;  2DMU A;  1GVD A;  2IAI A;  2CRG A;  5DS9 A;  2MGQ A;  2QCO A;  1PUF B;  2ECC A;  5J1U A;  5BNG A;  2XSD C;  4A3I J;  4IHX A;  3S1Q J;  3F0C A;  1RKW A;  5M3M J;  3A01 B;  3BTJ A;  3LSR A;  4D7N A;  1FIP A;  1Y1V J;  3Q0V A;  1SAN A;  1BW6 A;  1YRN A;  2LR8 A;  2Y2Z A;  1ETK A;  2LLK A;  3MKL A;  1VI0 A;  4Y52 J;  4XIC A;  4EEF G;  2EQR A;  3S15 J;  1LFU P;  3VPR A;  2R0Q C;  2E2I J;  1YRN B;  2TCT A;  2DMP A;  2EZI A;  1W0T A;  1P7I A;  1APL C;  3SJM A;  2L9R A;  4NDL A;  1IG7 A;  1XC5 A;  4UUT A;  1DU6 A;  3A02 A;  2R7Z J;  2EZH A;  1RES A;  1IDZ A;  2HDD A;  1WGX A;  1WPK A;  4C2M J;  1X2N A;  3BQY A;  4B1R A;  4UUS B;  3BR6 A;  2ID6 A;  2EZL A;  1RR7 A;  2NVX J;  1LFB A;  5E3N A;  4X1E A;  3B6A A;  2CJJ A;  2DN0 A;  1QVT A;  4MLO A;  3HOW J;  1IRZ A;  5J1Y A;  1JTY A;  1X58 A;  2DA7 A;  4B3A A;  4J19 A;  4ABZ A;  1OFC X;  2NS7 A;  3CMY A;  5HOD A;  2PMZ N;  2NVY J;  2NS8 A;  3TED A;  1EF4 A;  2YU9 J;  3A01 A;  4I6Z A;  4IHY A;  4A3M J;  4DYQ A;  3BR3 A;  1IV6 A;  5GP9 A;  3S2D J;  5IP9 J;  1RET A;  5GPA A;  2JA6 J;  4V2F A;  2XRL A;  3HOV J;  2DA3 A;  1TWA J;  4M3D A;  3OSF A;  1NK2 P;  1B8I B;  3HGY A;  1MBK A;  2HYJ A;  4RDU A;  1GDT A;  3PM1 A;  3FK7 A;  4JX6 A;  1WI3 A;  4I76 A;  1SFO J;  1MNM C;  2LFB A;  2LY9 A;  4W97 A;  1U9O A;  3JRB A;  5C3E J;  2KDZ A;  1A6I A;  4QSH A;  2DA1 A;  4A3L J;  4DYR A;  2L7M P;  4D7M A;  5FKK A;  1JJ8 C;  1ORK A;  1FEX A;  2E2J J;  1PUF A;  3RZO J;  3ZQG A;  5F0H A;  2TRT A;  3ZQI A;  4UUS A;  4QIW N;  3GTQ J;  3JRH A;  2I10 A;  4HNV A;  1JUP A;  4IHW A;  4DYC A;  4JYK A;  3BG5 A;  2R92 J;  4IHV A;  4L5E A;  2LVS A;  1FTZ A;  3O8G A;  3ZQF A;  4C3I J;  3IV5 A;  3JRG A;  3UKG A;  2MG4 A;  1ETW A;  1F43 A;  5K7Z A;  2GM4 A;  3CCY A;  2HXO A;  2M34 A;  4BXX J;  3ZQH A;  1H8A C;  2JMW A;  1FTT A;  2XPV A;  3Q3S A;  5C44 J;  4A93 J;  2R93 J;  3TP3 A;  5IP7 J;  1HDD C;  1E3O C;  3FIS A;  5E3O A;  1W0U A;  5GPC A;  1XG1 A;  1LE8 A;  2LD5 A;  2E19 A;  1NTC A;  5FKM A;  2M9H A;  5IP6 A;  2XB0 X;  2CQQ A;  1JKP C;  1I6H J;  2G0E A;  4MFE A;  1HLV A;  3GTM J;  5IPA A;  2XPU A;  1CQT A;  1BL0 A;  1BW5 A;  3TP0 A;  2DTZ A;  3HOY J;  5IYD J;  2JJ7 A;  3PO3 J;  1Z77 A;  5EZH A;  2H1K A;  1B72 A;  5M5W J;  5IYC J;  2VKV A;  4A69 C;  1QRY A;  3Q0U A;  4XRM A;  4AC0 A;  1JJ6 C;  3GTL J;  3FK6 A;  5EEA A;  1RKT A;  3JRC A;  2K9N A;  1LE8 B;  2ELK A;  4BBS J;  3OOU A;  1MBF A;  1H88 C;  4Y7N J;  2VPR A;  1UMQ A;  3OIO A;  1JKQ C;  2D5V A;  4CYC A;  1OJL A;  1MBE A;  4XRS G;  3JRA A;  1IDY A;  3NAU A;  5K7F A;  4XK4 A;  3O8H A;  4A3C J;  3HDD A;  1IGN A;  1AHD P;  2LKX A;  3G1O A;  1MSE C;  2DMQ A;  4A3G J;  2NVQ J;  3BQZ A;  2DA5 A;  1ETO A;  2LK2 A;  1B72 B;  3HBL A;  1TWC J;  2AHQ A;  3LOC A;  1B8I A;  1R9T J;  4QTR A;  3SDG A;  5M5Y J;  1P7J A;  3DEW A;  4A3F J;  1JKO C;  4MIM A;  2XPW A;  2GLO A;  1JTX A;  3IH2 A;  3TW6 A;  1AKH A;  4JP0 A;  2CU7 A;  1VND A;  2M8G X;  5EG0 B;  2KT0 A;  2K9Q A;  3DCF A;  2M0C A;  2X6O A;  1G2H A;  3QQA A;  4MFD A;  2YUS A;  1ENH A;  2EBI A;  3RQI A;  4A3J J;  3WHB A;  1U8B A;  5JLX A;  1MSF C;  2JA5 J;  3CDL A;  2GBY A;  2MW8 A;  3JRI A;  1VF9 A;  2Y30 A;  4XID A;  2XGE A;  1ZKG A;  4BY1 J;  2W48 A;  5FLV A;  4A3K J;  3S1M J;  2FX0 A;  1TWH J;  3LSJ A;  3BTI A;  4A3B J;  2WV1 A;  4RBO A;  5F08 A;  2IBD A;  3ZOB A;  1HDP A;  1BA5 A;  2L7F P;  1U78 A;  3HB9 A;  5DTD A;  3GTG J;  3BR1 A;  2Y9Z A;  5EG0 A;  3E7L A;  4V2G A;  5M3F J;  1JUM A;  1MH3 A;  9ANT A;  3FIW A;  2DA2 A;  4MO7 A;  1HOM A;  3TW7 A;  1HCR A;  4CYC B;  2R5Y B;  2HQ5 A;  1QPI A;  4FE7 A;  1X2M A;  3MN2 A;  2YS9 A;  4W1U A;  1GT0 C;  2EZK A;  1IC8 A;  1IUF A;  3GTK J;  1RPW A;  2Y0S N;  2ME6 A;  5M5X J;  1ETX A;  3L1P A;  3IH3 A;  2R5Y A;  3HGG A;  5EGO B;  4FTH A;  4FCY A;  2XB5 A;  3G1M A;  1NK3 P;  2CQX A;  4JX4 A;  2N8G A;  2OPT A;  2FQ4 A;  3RKQ A;  3S14 J;  4BY7 J;  3S2H J;  3Q0W A;  4AYB N;  4DW6 A;  4GFB A;  2K9S A;  5F27 A;  1UHS A;  3CQZ J;  1BJZ A;  2DMT A;  5EZG A;  3RZD J;  3LNQ A;  4LOC A;  1AKH B;  1I50 J;  4JX5 A;  3JRE A;  2H8R A;  2ECB A;  5IOY A;  3MVP A;  1OCP A;  1K83 J;  2JA7 J;  2Y9Y A;  4D5C A;  1MBH A;  2E1O A;  1ZGW A;  1F36 A;  1POG A;  2R5Z B;  2X48 A;  2LP0 A;  1FIA A;  4A3D J;  2LTP A;  3I4N J;  4M3F A;  2FD5 A;  2E2H J;  2O8K A;  3GTJ J;  2CUE A;  3I4M J;  5F0C A;  3M4O J;  2VI6 A;  3HKZ N;  1JUS A;  1WH7 A;  2L7Z A;  1A5J A;  4A3E J;  2O7O A;  1GUU A;  2DMN A;  5EF6 A;  4BKX A;  2HOA A;  3ZQL A;  1VFC A;  2WAQ N;  3BT9 A;  2ZB9 A;  2L0K A;  3GTO J;  5C4X J;  2DA6 A;  2JK3 A;  1I3Q J;  3BR0 A;  3C2B A;  1Q1V A;  5IOZ A;  3BR2 A;  3K2A A;  5FJ8 J;  4M3B A;  1ZTR A;  2O9L A;  2EH3 A;  1TC3 C;  2HXI A;  4AUX A;  2ME0 A;  4M3G A;  4FIS A;  2JA8 J;  2DA4 A;  4M3E A;  2RAE A;  2HOT A;  5J3L A;  1U9N A;  2JN6 A;  2FJ1 A;  1HF0 A;  3IH4 A;  3JR9 A;  3HM5 A;  3QPS A;  5EGO A;  1ZR2 A;  2QF7 A;  5FKN A;  1ZQ3 P;  1ZK8 A;  3JRF A;  3BTC A;  5JLW A;  3H0G J;  2HOS A;  1H89 C;  1T33 A;  4C3J J;  1MBJ A;  3BG9 A;  2B63 J;  5E3M A;  1D5Y A;  2K40 A;  3HEF A;  4DZJ A;  3HOX J;  4XRS A;  4IEJ A;  1GV2 A;  1QVU A;  1JKR C;  2DJN A;  2X9D A;  3K7A J;  1ETQ A;  4D5F A;  1ETY A;  2IEK A;  4FE4 A;  5F1J A;  3GTP J;  2MSY A;  5EDN A;  2CUF A;  3M3Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...