3A01A

Crystal structure of aristaless and clawless homeodomains bound to dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
molecule keywords Homeodomain-containing protein
total genus 26
structure length 78
sequence length 78
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a01A00
3MKLA 1NK3P 1F36A 4M3DA 4M3BA 2DMQA 4UUTA 3HOZJ 3BG3A 2Y9YA 3DCFA 2R5YB 2R0QC 1AHDP 1WI3A 1RPWA 2K40A 1IJWC 3RKQA 1Y1WJ 1YRNB 1UMQA 4XRSG 4JX4A 1QPIA 4IHVA 2DMTA 3TP3A 3WHBA 4V2FA 2XGCA 4A3GJ 3FKIJ 1IGNA 3ZOBA 3S1NJ 1H88C 3HOUJ 2O7OA 3A03A 3A01B 5EGOB 2MGQA 4FISA 1I6HJ 2HI3A 5EG0B 1LE8B 3S16J 3BG5A 5IP9J 4A3EJ 4IHXA 4QSHA 1ITYA 3GTQJ 3MVPA 2YUSA 3HGYA 4A3BJ 5GPAA 1TWHJ 3FISA 4BBSJ 1Z77A 2JMWA 2DJNA 4A3LJ 3ZQIA 5EEAA 2FJ1A 3O8GA 3Q0WA 1VFCA 4A69C 5GPCA 1K61A 2DA7A 2K9NA 4MLOA 1VI0A 2JN6A 4CYCA 1AU7A 3S2DJ 3G1MA 2I10A 1GV2A 1LFUP 1JKOC 2NS8A 2H8RA 2JA5J 1GVDA 2LVSA 3JR9A 2W48A 2OPTA 1Q1VA 3HOVJ 2R7ZJ 2XPVA 2DMNA 2Y2ZA 2DA3A 1IC8A 2X48A 5K7ZA 3SJMA 4JP0A 4QIWN 2XGEA 5FKOA 3BR0A 5C44J 3S1RJ 2DA4A 3BTJA 4EEFG 5F0CA 3LSJA 3BR2A 3A02A 3IH4A 3E7LA 3NAUA 5C3EJ 1HDDC 5IPAA 2ID3A 2N8GA 1T33A 1WH7A 2EZIA 2HDDA 2LK2A 2HQ5A 3HEFA 1F43A 1B72A 1U8BA 2TRTA 3GTMJ 2CU7A 1LFBA 4DYQA 5E3LA 4G12A 2JA7J 4DW6A 2ME0A 3QPLA 1B8IB 3I4MJ 2P81A 5EYRA 2VKVA 2XSDC 5DS9A 4QTRA 1QRYA 1BL0A 5IYBJ 4A3MJ 3O8HA 3LNQA 1AKHB 2IAIA 2CQQA 2XB5A 2HOTA 1W0TA 3HOWJ 1MBJA 4W97A 2CUFA 1TWCJ 2E2JJ 3HM5A 1RR7A 2CRGA 4L5EA 5FKNA 5FJ8J 2TCTA 1I50J 3HB9A 3BR3A 3TW7A 1JKRC 3LSPA 1XS9A 2E19A 1MH4A 2R5ZB 2JWTA 5IP6A 2JA8J 1E3OC 2M9HA 2IEKA 3ZQCA 4DZJA 2E2HJ 2LD5A 2CQXA 2WB1N 4MFEA 2ECCA 1MBHA 3BR5A 4X6AJ 5BNGA 3BTLA 4FTHA 1OCTC 3BTIA 1FTZA 1X2NA 1A5JA 2GBYA 3PO2J 2O8KA 4UUSA 4XRMA 1APLC 5J1UA 1G2HA 2Y0SN 2L7ZA 2EH3A 5FLMJ 3GTOJ 1BW5A 4A3CJ 3JREA 5M3MJ 3HGGA 4J19A 1ORKA 4FE7A 2DA2A 1ETKA 1TWFJ 3I4NJ 1K83J 2LKXA 4XICA 4A93J 2MG4A 1ZKGA 2CUEA 2L7MP 1ZK8A 3JRBA 1ZTRA 1RETA 1JTXA 1IRZA 2YU9J 1IDYA 2VKEA 4M6VA 1HCRA 4C3JJ 1HLVA 1U78A 2R93J 1WGXA 5JLWA 3VPRA 2COBA 3D1NI 3OSFA 4D7MA 5IYDJ 4HNVA 5IP7J 3BR1A 2DTZA 2AO9A 3JRGA 4Y52J 3FIWA 1XC5A 1MBGA 1P7JA 5F27A 2H1KA 1I3QJ 4IHYA 3JRFA 1PUFA 2GLOA 5GP9A 3HOYJ 2X6OA 2ECBA 2B63J 3OSGA 1VNDA 5J1YA 5HODA 2K9SA 1MBFA 1HF0A 3RZOJ 2DA6A 4DYRA 3HKZN 2QF7A 1POGA 2ZB9A 4M3EA 1SANA 1FJLA 2Y31A 3M4OJ 1T56A 2AHQA 3RQIA 3TW6A 5FKLA 1MH3A 4AC0A 4XK4A 1U9OA 4XRSA 3S1MJ 2R5YA 4D5CA 3S14J 3FK6A 4MO7A 5EZHA 5JLXA 1YRNA 1X58A 2DMUA 3DEWA 3QQAA 5FKMA 2LFBA 4A3IJ 1FIPA 1JT0A 4X1EA 5K7FA 1BJZA 2LTPA 4RBOA 3BR6A 2JK3A 4JX6A 4BBRJ 2DA1A 1JKQC 1MSFC 1JT6A 2M0CA 3A01A 2M2EA 5EGOA 1DU6A 5EG0A 3H3VK 3JRIA 1LE8A 3JRCA 1XG1A 2XPWA 2XPUA 4M3GA 3HOXJ 2HOSA 4W1UA 1ZR4A 1H8AC 3GBGA 3ZQLA 3BTCA 1BW6A 2LR8A 2OF7A 5FLVA 3LOCA 5FKKA 2XGDA 4C3IJ 4A3FJ 2DMPA 4M3FA 2DA5A 2NVQJ 5C4JJ 5M3FJ 1P7IA 2MW8A 5M5YJ 9ANTA 2ME6A 4CYCB 1WH5A 2WAQN 5F0FA 1NTCA 1FIAA 3Q3SA 5F0HA 3HDDA 1S7EA 2EQRA 2X9DA 4I76A 1VF9A 1GDTA 4MIMA 1JJ6C 1ETYA 1WPKA 2LY9A 1QVUA 1RESA 2FD5A 1IUFA 2E1OA 4A3JJ 2EZKA 1DU0A 4IHWA 3C2BA 4MFDA 4S0HB 1CQTA 5IOZA 2JJ7A 3S15J 3PO3J 4C2MJ 3PM1A 2XRLA 2O9LA 2FQ4A 2WV1A 4ABZA 2NVTJ 2NVYJ 2KT0A 5EDNA 1WCMJ 3S17J 3GTPJ 2HOAA 5EZGA 4FCYA 3IV5A 1JGGA 3G1OA 2FX0A 1B72B 2RAEA 3OIOA 5J3LA 3JRAA 1D5YA 3JRHA 2G0EA 2ID6A 5IYCJ 3QPSA 1B8IA 2VUMJ 1A6IA 1U9NA 3LSRA 2IBDA 3GTGJ 3IH3A 2Y9ZA 5F04A 3GTLJ 2EZLA 4JX5A 2M34A 1UG2A 2HXIA 5M5XJ 2YS9A 4DYCA 3WHCA 1HDPA 3MN2A 1AKHA 2L9RA 3CQZJ 1MBEA 5IOYA 3ZQHA 1ZGWA 1IV6A 5J1RA 3G1LA 3B6CA 3S1QJ 3K2AA 2EBIA 3HBLA 1EF4A 3S2HJ 1TWAJ 2XB0X 5M5WJ 4IEJA 1MNMC 2E2IJ 3FK7A 3TEDA 4A3DJ 3H0GJ 4FE4A 3GTJJ 3BQZA 3TP0A 1OJLA 1JTYA 4C3HJ 2R5ZA 1ZR2A 2GM4A 4JYKA 2HYJA 5K7HA 4BXXJ 2Y30A 4Y7NJ 4XIDA 4BY7J 3CMYA 3SDGA 1RKTA 1ETVA 2LP0A 4B3AA 1ETWA 2MSYA 3ZQFA 1FEXA 1X2MA 1JUMA 2PMZN 3CDLA 1JUPA 5DTDA 4UUSB 3K7AJ 1JKPC 1OFCX 4RDUA 4GFBA 1Y1VJ 4DZPA 1Z0XA 2VPRA 5E3MA 1QVTA 3B6AA 2R92J 1JJ8C 2ELKA 1ETQA 3Q0UA 1GV5A 3JRDA 1HOMA 2NVXJ 1H89C 2KDZA 4B1RA 1W0UA 4BKXA 1MSEC 1GUUA 1UHSA 3L1PA 3UKGA 1ETXA 3RZDJ 4I6ZA 2VI6A 4BY1J 4LOCA 1RKWA 2HXOA 1JUSA 1OCPA 1TWGJ 2M8GX 1FTTA 5F1JA 1IDZA 2DN0A 5E3OA 1SFOJ 1GT0C 2LLKA 3Q0VA 1IG7A 3IH2A 1ETOA 4B4CA 5E3NA 3M3YJ 1ENHA 3W6VA 4AYBN 1ZQ3P 1BA5A 3BG9A 1NK2P 3LSGA 2QCOA 5EF6A 2L0KA 3F0CA 2EZHA 1R9TJ 3BT9A 1PUFB 3NARA 2D5VA 2K9QA 2L7FP 4D7NA 5C4XJ 3CCYA 4NDLA 4A3KJ 3GTKJ 5F08A 1TC3C 3OOUA 2NOGA 3BQYA 2CJJA 3ZQGA 1MBKA 2NS7A 3SFIA 1O4XA 4V2GA 2JA6J 4AUXA 4D5FA
chains in the Genus database with same CATH superfamily
3MKLA 2OAZA 2ZBKA 4UUTA 1WZ2A 3BG3A 2W4SA 1QZEA 1AHDP 1ON1A 3O2PE 4AVPA 1WI3A 1BI3A 3U9GA 1RPWA 1PJRA 3NRVA 4WXCA 4E70A 4BNCA 4X0GA 1S29A 4L9TA 1YITI 3K4CA 3WTWC 2PMZA 3G71I 4CDGA 4IHVA 1FYMA 3IAM2 5CQEA 1Z9CA 2FBIA 4PFOA 2STWA 2V6CA 2DLLA 1HQCA 4Y3OA 3FKIJ 3I58A 3KP3A 2AQEA 2CG4A 4WXHA 3WTZA 3WTYC 1H88C 1R4MB 3S1NJ 3VWBA 1SFXA 2DU9A 3A03A 2UXXA 3A01B 4E7JA 4FISA 1X4OA 2HI3A 4L9NA 4MQ9F 4JQFA 4L9JA 3S16J 1PP7U 1KYZA 1UELB 1IN6A 4PJLA 3CUQB 4M6YA 2JQ7A 3MVPA 2YUSA 4A3BJ 4Y17A 3E97A 4HX4A 5GPAA 1U3EM 1X1AA 1TWHJ 3FISA 4BBSJ 2K27A 2XF5A 2HVSA 4M72A 3KCCA 2JMWA 4AU7A 2XGXA 2DJNA 3ZQIA 2DI3A 4PK4A 3Q0WA 2DFHA 5GPCA 1K61A 3ZMUA 4NC6A 1VI0A 3CCLI 1VQLI 2I10A 2VQCA 4G7ZF 4QLCU 2QKMB 2WAEA 3TOAA 2OQRA 5BS6A 2CYYA 3NQOA 4GGGA 2LVSA 2FSWA 5B3SH 2M7AA 2OPTA 2W48A 3HOVJ 1WJEA 4Y33A 2HS5A 4YFXF 5KNLA 2D1VA 5AONA 2V6EA 5DUKA 3E6DA 4QPQA 3ZMZA 2DA3A 4AIKA 2QQ9A 3ZXSA 1IC8A 2EFWA 4JP0A 2ZSHB 2KIMA 2MABA 3LAJA 1O3TA 3BTJA 5CVIA 4EEFG 1FP2A 1ON2A 4M9SA 2AS5F 2P7CB 1EKEA 3DXJF 5DEQA 1WH7A 2M4KA 2R7SA 2LK2A 2OTLI 1W7PB 2CU7A 1LFBA 1IV8A 2VL8A 1T98A 1N77A 4CHUA 3C1DA 4XBFA 3PNYA 3QPLA 4HOBA 1RUOA 3ABTA 2P81A 3OS1A 2HDCA 5EYRA 3IHUA 2XSDC 3DP7A 4A6DA 5IYBJ 2FF4A 4HF2A 5DD8A 4NHJA 4CSWA 4HQMA 3HOWJ 2MH9A 2YSRA 4Y15A 1MJAA 4ZYEA 4CZZA 4BJTA 2OA4A 5DV5A 2UWMA 1S3JA 2ETHA 2CRGA 4L5EA 2Y75A 3PQJA 1IXCA 2D2WA 3QWLA 1YIJI 3HB9A 3ASNH 4IZZA 1IUYA 1HKTA 1Y0UA 3BCBA 3GW2A 2LF8A 1P6RA 4BE0A 1TNSA 4ITVA 1ZYRF 2OCCH 5IP6A 3L2WA 4HQEA 1E3OC 2PJRB 3D0SA 2QENA 3HOSA 1D0ZA 4MFEA 2ECCA 3BR5A 1OCTC 2F6CA 5DUIA 1FTZA 3HXLA 2NXNB 1MMGA 3DQVC 2GBYA 3PO2J 5JI6A 4XRMA 2WAQA 3F9KA 2P5KA 2L7ZA 3FHZA 2EH3A 3FM5A 2IJLA 5FLMJ 1PYVA 1O7LA 1QZZA 5BPIA 3AL0C 4G6DA 3CC7I 4A3CJ 2DYRH 3JREA 3HGGA 1YG2A 3KLNA 1ORKA 4FE7A 4WCGA 3SZGA 1GXPA 2I8DA 1T8IA 1GXQA 1QO0D 4QPOA 4LIUA 2FE3A 2DAOA 1S6LA 3RPQA 1IRZA 1BOAA 1ZK8A 3J81K 1TQMA 3KLOA 3KP5A 1K6OA 1IDYA 2VKEA 2ZO4A 3U21A 5HLGA 1HLVA 2R93J 3I59B 4KYWA 5L3BA 3WE2A 5H2FC 4RGXA 4WXDA 3H9QA 3D1NI 5IP7J 1T95A 2KIFA 3BR1A 4M9XA 3BJOA 1VQ8I 1Z3YA 5F27A 4IHYA 1I3QJ 3A0HC 2E5NA 3PFIA 4UVBA 3VSKA 1ZELA 2DQLA 5GP9A 4WX9A 2XSJC 2R3SA 2HPIA 2X6OA 4F55A 2HZDA 1X1BA 1VNDA 3KP7A 1PVEA 1FY7A 3OS2A 1HXDA 1MBFA 2K9SA 5D5XB 2EV5A 1XGNA 1A35A 2KISA 1T0FA 1X1CA 4GYIA 5L3FA 1HA8A 2FNPA 4Z6YA 1TQPA 1E17A 2ZB9A 2V9PA 1BOBA 1T56A 2L7KA 3FXMA 1MH3A 3DFGA 4D5FA 2A69F 3M7GA 1RNLA 5GAEJ 1FBSA 4XRSA 5D6FA 3W3CA 2O8XA 1VQ7I 5K5QA 3DF8A 1B59A 1IRXA 2E1NA 2W82A 5JLXA 2DOFA 5J40A 2FA5A 4R79A 1TW3A 2XKPA 2B9SA 1U2WA 2VPLA 4A3IJ 5IY5H 1FIPA 2D1HA 2KIUA 4X1EA 4XORA 3J7YJ 4RBOA 1MIJA 1YS6A 1ZLKA 4BBRJ 1JKQC 1GLNA 4AWXB 3VB2A 2M0CA 4BJ5C 3GWZA 5EGOA 2B0LA 3A01A 2CV0A 2HOEA 1DU6A 2NOJB 3JRIA 1ZRFA 1XG1A 3REOA 2XPWA 4UNOA 1WJBA 1B1BA 4H0EA 3HOXJ 1ZR4A 4E4HA 2JTVA 2IGNA 2CW0F 4KFCA 3HRSA 3SHFA 3CCRI 4A12A 3ZQLA 4S04A 1BW6A 2LR8A 1U5TA 5FKKA 4XLCA 1SVOA 4D0PA 2P5VA 1HKSA 2KKOA 1FOWA 1UHWA 1KZHA 2CFOA 2IGMA 3ZP5A 4L5IA 2K02A 4XSXF 1WH5A 5F0FA 1K78B 1FIAA 2KP6A 3HDDA 4BDYA 3WTSC 2X9DA 2QKLB 2GIZA 1LEBA 1KONA 3ML6A 2HKOA 1GDTA 1IRFA 3BOQA 1SMYF 1BBYA 1WPKA 1X1DA 1RESA 4FT8A 4NC7A 1G3WA 3W2AA 2IS2A 2FRHA 2UXNA 1N75A 1MW7A 2CUJA 1R49A 1Y56A 1Z05A 2EFOA 3QYFA 2RQQA 4Q4ZF 2BGCA 1W5TA 4S0HB 3ABKH 5IOZA 3J7AO 2DFIA 1QU3A 2IS1A 2TDXA 3DKYA 2A6EF 4B44A 2PX9A 4C2MJ 2O9LA 5LBQA 5D5WB 4AVZA 1Z21A 5E1ZB 3ZQ7A 3GZ5A 4BHBA 2P5LC 3H9GA 2CMPA 3VYUB 1ZN2A 3OYNA 2NVTJ 5AIPA 4PGGA 4Q47A 3GTPJ 5KVRA 4FCYA 4EQQA 3RI4A 1IN8A 3GYHX 1ZH5A 1LDDA 2DPDA 1W7PA 2BVLA 2DPUA 1J2XA 1D5YA 2EFPA 3SXYA 3JRHA 3OYIA 5GTIC 3B73A 3SDBA 1ERDA 3H5NA 2ZMEA 3QPSA 3L2RA 1A6IA 1U9NA 3GTGJ 3QPTA 2BHYA 2HTSA 4IQJA 1UHMA 3S3NA 3T0YA 4CXFA 2L9NA 2BW3B 4A5MA 2RN7A 2G7HA 1SAXA 1UG2A 5FRNA 4DYCA 3WHCA 5CKTA 4C9YA 2EV0A 3RKYA 2L9RA 2OUMA 3ZQHA 2W24A 4EATA 1YTYA 1FSHA 2KJBA 4XSZF 1WRJA 1WVRA 3IP4B 1T6SA 4F92B 1SD6A 3LQRA 4DBRA 4IEJA 3FBNB 4BQNA 4MTDA 1KU9A 1AWCA 2GA2A 3H0GJ 5CLSA 5K5OA 4ZH4F 3OYHA 2HQNA 2M5WA 3AG2H 2CQNA 3BQZA 1OJLA 2DJIA 2X1CA 3TP0A 3I4PA 1LDKB 2VBZA 4XN0A 1ZR2A 2GM4A 4YIFA 2JZYA 1WJDA 1IAWA 3ONQA 1YO5C 5L3GA 4Y7NJ 2M0MA 2KHMA 3CMYA 3HOTA 3EPZA 1SEUA 4IOAF 1ETWA 1X2MA 1A36A 2MH2A 3CDLA 2V9VA 4LGWA 4EM1A 4ENKA 2QQBA 3O3KA 3VOEA 1OFCX 4RDUA 3TO9A 4ZZLA 1BI1A 4GFBA 3MZ8A 1MZBA 1Y1VJ 3OYDA 1ODDA 2VPRA 3B6AA 4RB2C 2CW7A 5FD5A 3JAMZ 4M6XA 3Q0UA 1DP3A 3JRDA 3ZMSA 4C2UA 3PL8A 1BM9A 1FBQA 2D45A 1R22A 1W0UA 4BKXA 4PCQA 3K6GA 4FETA 2R7OA 3I54A 1ETXA 1VZ0A 4I6ZA 2VI6A 2PQ8A 1LJ9A 4XNFA 3HKZA 3GXOA 1JUSA 3VEPA 2JA2A 1U0JA 1XDUA 2OD5A 3ESWB 1IDZA 3GLLA 1A6QA 2CV2A 2WWYA 3Q0VA 3I59A 4DOZA 1VQ4I 4L18B 4I7HA 4LITA 2JPBA 3HRTA 2EK5A 4BHCA 2JSPA 3FMQA 3MKZA 3IL2A 4XKVA 4HV6A 5EF6A 4PDKA 4Y13A 1J7KA 2EZHA 1R9TJ 4FASD 1PUFB 1VQMI 1LNWA 2QVOA 4O6JA 1VQOI 3PSIA 1QBJA 1UFMA 4NDLA 3DU6A 5LRSA 2RREA 2MD0A 3KIOA 1XSDA 3BQYA 1ZGAA 2L4AA 2F5FA 2Q2EB 1O4XA 3S3OA 4UUVA 5D5UB 5CVJA 3QOPA 3T8RA 2BVMA 2DMQA 1FOXA 4M74A 3HOZJ 2IGOA 2RGVA 2NNNA 4CH7A 2K40A 4L5JA 4YEJA 4E6KG 1J5YA 1IJWC 3HUGB 2R7RA 2Y0SA 2EFQA 2XUBA 1QPIA 4B3XA 2DMTA 3CJTB 3WU0A 3E6BA 2FMLA 1EA3A 3H9JA 4V2FA 1BIBA 4KJZA 2O7OA 2O5RA 5EGOB 5EG0B 3BG5A 5IP9J 5FLXK 2EIMH 2XF7A 3DKWA 3HSFA 5E79C 1UJ8A 4QSHA 3CESA 3NWTA 4PJMA 4C30A 3GTQJ 2JSCA 1IN4A 2YPRA 3HGYA 3RTRA 1A31A 1U5TB 2WTEA 1HBXG 4U0VA 1Z77A 3GX4X 1XMKA 1BR2A 3ZGKA 2BBYA 1ZG3A 1R00A 2FJ1A 1TT0A 2GXAA 1VFCA 4BL0B 4AIHA 2K9NA 3I71A 2IP2A 1K78A 3DPUA 2LBFA 4ENJA 4HDUA 4LK0F 3EUAA 3WTUC 5D8KB 2KFDA 1JKOC 2NS8A 2DT5A 3SFZA 2DT6A 4ASNA 4B48A 3FM3A 5E1XA 4GDFA 3V8LA 3H5AA 3FMRA 1RRJA 4XKCA 1X19A 2KRHA 1T08B 1MJBA 4ZDOA 3W6JB 5K7ZA 4QIWN 1V4RA 2FEZA 3I64A 1CGPA 5F1RA 4U0YA 3LSJA 3BR2A 3IH4A 3I56I 2WADA 3E7LA 1TTYA 4GYGA 4NBQA 5IPAA 2ID3A 3IUOA 4ZZDA 2G7UA 3F8BA 3BG6A 4XRFA 2M3AA 4OMZA 4Q5SF 2HQ5A 1XMXA 1F43A 2XDVA 3CO6C 5IT3A 3TMOA 1B9MA 5KAIC 1I6XA 3QU3A 4RA2A 3F8NA 4AM3A 1Y6IA 1KQ8A 2ZMEB 2VJ5A 1B4AA 4XLHA 1DDNA 1YX3A 4LB6B 5HOOA 4BH9A 5ILVA 2HVQA 5DS9A 2BW3A 4QTRA 3OYJA 2FU4A 1QRYA 2DFEA 4MTEA 4XOTA 3R6SA 4D9JA 1XCBA 3O8HA 4YELA 2IAIA 1W0TA 2EB7A 2GOMA 5JFRA 2IS4A 1SMTA 4W97A 3BROA 2BY3A 3CP2A 2E2JJ 3HM5A 3PIPF 2LKPA 1OCRH 4I0AA 5FJ8J 3MD2A 2Z5UA 2DDBA 1YW7A 1HW1A 2AXLA 3DBLB 2COMA 5J47A 4RB3C 1UCRA 1BI2A 3HHGA 4E7HA 3M8FA 1E0EA 1MH4A 1YW8A 3BDDA 3V7SA 4DQ2A 2M9HA 2IEKA 1YX5A 4DZJA 2CQ7A 2E2HJ 4YFNF 2LD5A 2CQXA 1T0FC 1SFEA 3WTTC 3FKJA 4ZTJA 3CF2A 1U5TC 3GZ6A 2O8KA 3AG3H 5A2QK 1APLC 3SZTA 2ZSIB 2Y0SN 3HYIA 3IRQA 2OZ6A 1ZG5A 2DO7A 1V54H 4ENMA 3GTOJ 4XQFA 1YI2I 5LFAA 2DBBA 4J19A 3ZPLA 2VIXA 1ZGJA 3O6BB 4EGZA 1EH8A 3GFIA 3V42A 2ZJRF 1ZRDA 3S2WA 5DCMA 5HDNA 1K83J 4A2UA 3OIPA 2LKXA 4LLLA 2JVGA 2BXYA 2MG4A 4BUPA 1FOKA 4A93J 4RGSA 3S93A 3CD6I 3NEUA 2VKHA 4HNUA 3JRBA 2QQ8A 1W7PD 3LQQA 1IRGA 3C3WA 2KRCA 4M6VA 3AKZA 2K4JA 4BE1A 3ZMDA 4C3JJ 4MEXF 5H6QA 3MQ0A 2PEXA 5LGTA 3MZHA 1FNNA 1ZREA 1W36C 3BLYA 2ELHA 2VJIA 3PIOF 4D7MA 3SZPA 3MEXA 1W5SA 4IPAA 3WODF 4HNVA 4LG0A 5LEJA 2E1CA 1TL8A 1R71A 2LNBA 2A5WA 3CUQC 2MLKA 3HZJA 3FIWA 2L9VA 3KYDB 4LK1F 4XN3A 3JRGA 1Z91A 1PUFA 2GLOA 3ERMA 3HOYJ 4KT5C 3J80K 1Q1HA 2K86A 1QPMA 2B63J 4G94A 5J1YA 2VE8A 4RGRA 1USSA 3PSFA 3CCJI 3OYAA 4KDPA 4CGZA 1AOYA 3J7AY 3BWGA 2XROA 4DYRA 3HKZN 2QF7A 3DEUA 2VB6A 1AA7A 3JCUC 2OV7A 3IC7A 4M3EA 1F1ZA 1SANA 3HHHA 3KZYA 4E7LA 1D1AA 1G3TA 1S8NA 2AHQA 2DW4A 2Q2EA 3GUDA 2W7NA 2RNGA 1IO2A 2M45A 3GCMA 3E3VA 1U9OA 3HSEA 4P1WA 4Y4RA 3MKYB 1KGSA 3S14J 3FK6A 3JTGA 5EZHA 2V9KA 3TOBA 3HUGA 4MGRA 3BZKA 1X58A 4B8XA 2IXSA 3DEWA 1G4DA 1R7JA 1JT0A 2VN2A 3U2RA 3MCZA 3Q9SA 1MSFC 4HF1A 2QA4I 3ABUA 5HS9A 3PNVA 3CUOA 2VXDA 5EG0A 4YFKF 4XL9A 4IHSA 3JRCA 3KEQA 2XKOA 4EJOA 3BPXA 3E5XA 2BV6A 1WI9A 4M3GA 2YR2A 1H8AC 2QUFA 1T2KA 4OWRB 2STTA 2OF7A 4EM2A 4Q48A 1D0YA 3T1BA 4U88A 2XGDA 4KN4X 3W6KB 2FOWA 2DMPA 4EGYA 3K10A 1O3QA 4KMFA 2HFHA 3HJEA 3ASOH 1Z6TA 3T5XA 4LG3A 2NVQJ 3CP8A 5J8FA 1P7IA 3FXUA 3LA3A 3JW4A 2CSOA 5JR3A 4I99C 1S7EA 2EQRA 4IRHA 2LBFB 2I5UA 2LRDA 2Z99A 1R36A 3C2GA 4IVNA 4RAZA 2UZKA 1ONVA 3CLOA 1QVUA 1XDSA 3D5LA 2R7WA 2EZKA 2CO5A 1S5LC 2JRTA 3P7NA 4MFDA 1FP1D 3M8JA 2LYCA 2LDUA 3OV8A 3OYEA 4U0WA 2XF6A 4D1QA 3G4SI 4I02A 2FQ4A 3KEOA 3AG1H 3GF2A 2HOAA 4F91B 3LSHA 3PJRA 2VC1A 2W1OA 2R7FA 1ULYA 2DQRA 2ZCWA 5ICFA 5J3LA 1VQKI 1I3AA 2G0EA 4OIOF 5L3CA 3J81Z 1EH7A 5IYCJ 1B8IA 2VUMJ 3LSRA 2R7TA 4IJAA 2Y9ZA 2W85A 5F04A 3GTLJ 2BEOA 4JX5A 3MWMA 1FPQA 4F52A 1GVJA 2M34A 3W2VA 2HXIA 2Y69H 3PUBA 2YS9A 1HDPA 1PDNC 3CJRB 1L3LA 4P5OA 3CQZJ 4XLAA 3TGNA 1ZGWA 3G1LA 3B6CA 3G73A 3K2AA 2GWRA 5F6FA 1TWAJ 2XB0X 2DK5A 3H36A 3I9V2 1WSUA 2WBMA 2BOLA 5HLTA 1K6YA 1W5CC 4KIGA 4UB6C 5JVTA 1MNMC 1D5VA 3HRMA 3FF5A 3FK7A 5LHHA 5LLQA 4A3DJ 4MHGA 4BQOA 2E1MB 3PFYA 2FMYA 2NYXA 1Z67A 1J75A 3B02A 1ACIA 4N9IA 4CCLA 2VQHA 3UNGC 3GZNB 2OBPA 1J9IA 4BY7J 3R0JA 4PGHA 1R5HA 1DPUA 4RS8A 1TW2A 3SEQA 2IPQX 5DTDA 4UUSB 4GRIA 4CO8A 4DBQA 1I1GA 3A0BC 3NWSA 1QVTA 2R92J 2MBFA 3F22A 5JHUA 1VQPI 1JJ8C 1FBUA 2ELKA 2X85A 3UR3C 3R4KA 1ETQA 4XMYA 2JT1A 3D5SC 4BQQA 3FDYA 4A6EA 1HOMA 5GAGJ 2NVXJ 1H89C 5DCMB 1X3ZB 4B1RA 3CJQB 2CGPA 1UHSA 3UKGA 4P96A 4RAFA 2GXGA 3W2WA 2F4IA 3ERED 1KQ9A 2HXOA 1O7FA 1MMNA 2H6CA 1TWGJ 5CPRB 1EH6A 4BU2A 2Z33A 2V1UA 2KQRA 4G6QA 3SYTA 5E3OA 3FMSA 5E8GA 1DGRM 1SFOJ 5CVUA 1G8XA 1ETOA 3MZYA 2R7QA 3KP4A 3A1YA 4LG0B 1ZLJA 2F48A 3CMAI 2DT7B 3QYBA 3ZMTA 1NK2P 3HTSB 4M73A 1KQ0A 1OISA 2ZJQF 3F0CA 4UB8C 1HSJA 2WY7Q 4QWQA 2D5VA 2K9QA 1XGSA 3ZMVA 5J4YA 2L7FP 4LD5A 3K1PA 4XLEA 3LL7A 5C4XJ 5CVRA 1V5FA 1XPXA 3VSLA 4A3KJ 2IW5A 1MMDA 5F08A 2LH9A 3ABLH 1CF7A 1TC3C 4HSRA 1UZCA 1N78A 3JTHA 3VODA 5IT9Z 3F6VA 2NS7A 3OYMA 2JA6J 4AUXA 4BS9A 4KN7X 1F36A 4M3BA 2VODA 2H6BA 2Z16A 4IRGA 3V4GA 2R5YB 4FQGA 3GVAA 4HLYA 4O5VA 3JSPA 3WTVC 2LMDA 4XONA 2E1MC 2VQGA 3RJPA 2CFXA 4G7OF 4BAYA 4ESBA 2BY1A 1QQIA 2F5DA 1YRNB 1UMQA 3BG7A 2DODA 3EDPA 4XRSG 3H0DA 4JX4A 3F8CA 2MYSA 4LMYA 5D8LB 1K4TA 3WGIA 2OJED 3TP3A 3WHBA 3KP2A 2HEOA 2L2OA 3CTAA 1IGNA 3DTKA 4EMSA 2PJPA 3HOUJ 1GHCA 3HTUA 1I6HJ 2HGCA 3E1SA 2EFNA 2ZC2A 5D4RA 3I5UA 1R1TA 4A3EJ 4IHXA 4OIRF 4BGDA 2H8WA 3GMEA 2VQLA 1JE8A 2V7FA 3CC2I 3TDUC 2OC6A 3VYTB 4IX7A 3FXQA 1OLTA 2VXZA 5EEAA 3O8GA 4A69C 3N97A 1WKMA 5ILSA 1VQ9I 2DA7A 3A4CA 3L2QA 4MLOA 2ZNZA 1FYLA 5DM6F 1AU7A 1UG0A 3G1MA 1GV2A 5ICGA 3ROUA 1LFUP 4DNCA 4P9FA 4A5NA 2KJCA 5LGNA 2V26A 1D0XA 2CWEA 5HDKA 4CYDA 2H8RA 4N4OB 2NRAC 2CS3A 3JR9A 4CCNA 3M9AA 1Q1VA 5F64A 3KZZA 2XPVA 1Y8QB 1K79A 5A2QZ 2Y2ZA 2JUGA 4E7SA 2DTRA 2VE9A 1BJAA 2ZXIA 3CLQA 1YHQI 3FXKA 2BE5F 2ESNA 1IXSB 1XGOA 2DA4A 5GTHC 2LKSA 2Z9OA 5F0CA 2IA1A 2PN6A 2HQAA 5L3DA 1O3SA 4NQWB 1Y8RB 1F4KA 2UUZA 3P9IA 1T33A 1XD7A 3HEFA 2P6TA 2TRTA 3GTMJ 1R58A 3WU2C 4DYQA 3QAHA 3LAPA 2IA2A 2QQAA 4G12A 1OKRA 2Z2SB 2M8EA 2ME0A 1B8IB 3I4MJ 3GEZA 2M87A 3DLAA 3V7RA 4KA4A 1FWZA 3OIQA 4RMNA 2QLZA 4HSTA 2G9WA 3ZQQA 3OL3A 2J5PA 1LFPA 4HDVA 1MJ9A 5TJJA 1AKHB 2CQQA 3L09A 4H4KC 2DYSH 3A2KA 1ZAOA 4HYEA 1SVLA 4EM0B 1OCZH 5HLHA 2CUFA 3DKXA 4YIRX 1RR7A 1S72I 2V4JC 1LKXA 4XKBA 2TCTA 5LGUA 3RKWA 2QYOA 2XAQA 5CVVA 2MA3A 3TW7A 3U1DA 3EYYA 3LSPA 1XS9A 4FX0A 3H3UA 1H0MA 1FC3A 3H5RA 2R5ZB 1KU3A 3ZQCA 4RAYA 3OYCA 1FT9A 1R1VA 3KP6A 2WB1N 4HA8A 5EEHA 4X6AJ 5E8IA 5BNGA 1MNDA 3BTIA 5D5VB 3CCVI 3E0JB 4BJ6C 3N05A 4UY8I 4UUSA 3K9TA 2L3DA 1R4NB 1G2HA 3IKVA 2OCEA 4A0XA 3KYLA 1VQ6I 4UHTA 2EIKH 5CQGA 2IRFG 1KA8A 2JUCA 1BW5A 1OCOH 3HL2A 1D1BA 1ZHFA 2F4OB 2VBWA 2EPFA 1R6RA 3CCQI 5CJ9A 4KUMA 1TWFJ 1O3RA 2MC3A 4BYYA 3COAC 1YOVB 1X1PA 1WWXA 3QYEA 2XRNA 1E2XA 2CUEA 2L7MP 3PQKA 1RETA 4HLXA 4HZFA 3K70C 2IT0A 2KZVA 2W57A 2KLOA 4U7BA 2V1NA 3LSMA 2V79A 1OYWA 1V5EA 1WGXA 2B7EA 5JLWA 2E35A 4CZCA 3AAFA 1KU7A 2WA0A 5BPDA 3VPRA 1PUEE 3OSFA 5IYDJ 2F5EA 2Q1ZB 4EV0A 2DTZA 1RR8C 4Y52J 1XC5A 3H35A 5FD6A 3CF5F 2GQQA 2H1KA 1JI8A 1D1CA 3JRFA 3LSTA 1XB4A 5K1YA 3T8TA 4GO1A 3P5JA 5B5EC 2ECBA 3CO7C 1S9HA 1P4AA 2A07F 5HODA 2QWWA 2HKXA 1TT5B 3VDXA 5LD2C 5IT9K 3J80Z 4I09A 1CF7B 2VT3A 1HW2A 4E7ZA 3DTIA 4AC0A 3OYLA 2W84A 2X6XA 3EUHC 3OOPA 4XR6A 2R5YA 1LUJB 2UV1A 4OIQF 1OCCH 4RB0A 4MO7A 2BZTA 2L01A 4M71A 1YRNA 2LY1A 4ESJA 1WJ5A 3QQAA 3LSIA 2K3PA 4AYBA 4XLFA 4RB1A 2EINH 2CW8A 4P9UA 1YS7A 1BJZA 1MGTA 2LTPA 4F7ZA 3KE2A 2PMUA 2K85A 3WG9A 3G6EI 2GXBA 2RNJA 3QP6A 3ZCOA 2JK3A 4JX6A 2DA1A 2PFBA 3CC4I 1JT6A 1XGMA 1WFXA 5BOXA 4CICA 3H3VK 3U1KA 1LE8A 2ZJ2A 4G7HF 5TRDA 4DIQA 2O03A 2HOSA 3GBGA 3LMMA 3K4NA 2LG4A 1SD4A 4NUBA 2X6YA 3BTCA 5TISC 3LOCA 1Z1DA 5DCFA 4C3IJ 3KEYA 3RDIA 2DA5A 5C4JJ 2HYGD 5M3FJ 5K5RA 3PUFA 1TP4A 4I2OA 2HR3A 4RM2A 3LWFA 2E7XA 2WAQN 1NTCA 3Q3SA 5F0HA 4HF0A 4OIPF 2E5ZA 3EUKL 4I76A 1VF9A 4L0YB 1PP8F 3QU6A 3TDZC 1VQNI 4G8XA 1JJ6C 2EILH 1YLFA 1D3YA 4HNTA 2DCEA 1OPCA 2LY9A 3FHNA 2FD5A 2W25A 4E7KA 2E1OA 2EJRA 5HNHA 4A3JJ 1DU0A 2XAJA 1LEAA 1XCVA 1D8KA 4B09A 4HBLA 1BIAA 1FSEA 4IHWA 2M7BA 1DGWY 1Z7UA 4AD9A 1P4WA 2KMUA 1WJFA 2LREA 2JJ7A 3D5RC 3S15J 4R8HA 2XAHA 3PO3J 4ETSA 2VLAA 2E36A 1E3HA 2Q8KA 3S8PA 3AL0B 2Q0OA 1BI0A 4ABZA 2WV1A 3KX2A 3QRFF 2NVYJ 2KT0A 4NQWA 3PNTA 4EJTA 1WCMJ 1W1WE 2VONA 2PG4A 1JGGA 4IRIA 3F6OA 1B72B 4PZJA 4CCMA 1FMWA 2ID6A 2R4GA 3G3ZA 1NH3A 3M07A 1H9GA 2EV6A 3VYRB 2HWVA 2IBDA 4IXAA 5DYMA 4PSWA 3JAMK 4ON0A 2EZLA 3M1EA 3BC8A 1P92A 1YJ9I 3IWFA 3LFKA 2FXAA 2JRMA 4ANJA 5M5XJ 1MMAA 4WK8F 4UV9A 1AKHA 3K69A 5LHIA 3K4MA 2XIGA 4HPQA 2ZJPF 3S1QJ 2EBIA 3FXJA 3E5UA 3HBLA 4XKWA 1XX5A 3C7JA 4BEHA 2HTJA 2R7XA 2E2IJ 3L00A 2HU9A 1LVAA 3HSRA 1IN7A 1WJAA 3GTJJ 2XAFA 4N9HA 4PJ0C 2ZXHA 5LHGA 4MQVA 3TO7A 3OS0A 1JTYA 4C3HJ 2R5ZA 2X4HA 2R7VA 3OMYA 1R23A 2AQFA 2H09A 4JYKA 2A3SA 5K7HA 4BXXJ 2WAFA 2FBHA 3DEEA 3DV8A 2DXIA 3OR1C 3SDGA 1RKTA 4NNJA 1ETVA 4B3AA 4G6TB 4KMUX 3WU1B 4HG2A 4IF4A 3RYRA 3LSKA 1N25A 1JUPA 1NHAA 2OZUA 1JKPC 4BE2A 3S32A 1LB2A 3M8EA 3MMYB 4DZPA 3CCSI 1RZ4A 2K9MA 1FZPB 1I27A 1XSXA 4U87A 2ZNYA 1QA6A 3AFHA 2LC2A 2P6SA 4A0YA 2VBXA 3I55I 2PMHA 1MDMB 4OAZA 2KRFA 2KDZA 3TO6A 2WV0A 3OL4A 4OAYA 1XMAA 2ESHA 4ZDLA 3K4BA 5HDGA 3RZDJ 4FX4A 1P9QC 2IA0A 3FX3A 4LOCA 5ICCA 1YJWI 1J0RA 1I1SA 3GLXA 2L54A 1V55H 3ZR8X 5HS8A 2A5YB 3H1CA 5LRRA 3Q9VA 2LLKA 1GT0C 3IH2A 4II2A 4B4CA 2K4BA 3M3YJ 1BR4A 5DM7F 4HW0A 3CZ6A 4K2EA 4V19K 1ENHA 1WHUA 3W6VA 4AYBN 1ZQ3P 3BG9A 2KIQA 2ICWG 1QZYA 2XHKA 2Y48A 3LSGA 5CYVA 2L0KA 4KNYA 4J00A 2EA2A 3FXOA 4UV8A 2GOXB 1XSVA 3NARA 2R7DA 2CUZA 4D7NA 4ZYHA 3CCYA 4DGWB 1OR7A 2DFFA 3GO5A 4BDZA 3GTKJ 1BN5A 2V1XA 1G3YA 2A68F 2HYFA 2NOGA 1ZARA 4UVAA 1BR1A 2XVCA 3KYCB 2CJJA 3RYPA 1YQAA 1E3PA 4RAGA 4LJZF 3SFIA 4V2GA 1F9NA 2M30A 2YX4A 1TQIA 1NK3P 2XV4S 4LLGF 3HRUA 4M3DA 3CCMI 3GFMA 2Y9YA 2FBKA 2X1EA 3DCFA 3F21A 2R0QC 4B43A 4MEYF 5B66C 1SFKA 1YFHA 3R0AA 3ZN1A 1JHHA 3RKQA 1RUNA 2BY0A 4LLNA 1LDJA 1OYIA 2O3FA 2MD5A 3EQLF 1Y1WJ 3QODA 3ZN0A 4BXFA 2BY2A 2ELJA 2GIVA 3BCAA 4YRVA 1KU2A 2P0WA 5BQTA 2XGCA 4A3GJ 1NG6A 2ADUA 3ZOBA 5FLXZ 1TNTA 4ZTFA 1ZRCA 4UVCA 3HG9A 2QZ8A 4OOIA 2MGQA 4UXNA 1OYYA 2A6HF 4KICA 2MLGA 5FO5A 4N0BA 1LE8B 3BP8A 2ZMEC 2H94A 4KISA 1S7AA 3ELKA 1DUXC 3WTXC 1B9NA 1REPC 2GA1A 1ITYA 1X3UA 2ZFWA 2R7UA 1MNEA 1USTA 1W4MA 4JBAA 1FYKA 4A3LJ 4DJAA 4ZYGA 4BHPA 1OMIA 2JN6A 1YW9A 3ABMH 4CYCA 4KITB 2LOOA 1BC8C 1VQ5I 1B6AA 1Z3XA 4O3MA 3S2DJ 1TBXA 2AXTC 5JHFA 3ZRGA 1G59A 2HDWA 4ZYDA 1GVDA 2JA5J 2WB1A 4LFUA 4G9YA 2EWNA 1RC9A 3OWTA 2R7ZJ 3H92A 3L9FA 4I98B 2X51A 3M1CA 3QP5A 4ESFA 2DMNA 2FNAA 1DPRA 3K4JA 4EJVA 2X48A 2KPMA 3SJMA 3RIRA 2XGEA 4CUGA 4KIBA 5FKOA 3K1MA 3BR0A 5C44J 3S1RJ 4GCVA 4YIIA 3A02A 5C3EJ 1HDDC 3NAUA 1R5GA 2N8GA 4ENNA 3ECHA 3OYGA 1X3WB 3FXLA 3CMEI 2EZIA 3IAS2 3IRRA 3MAJA 2HDDA 2EIJH 4AIJA 2LF7A 1B72A 1U8BA 4JK1X 1G6NA 3TQNA 5E3LA 2NS0A 1SVMA 4CA0A 4HV5A 2JA7J 4DW6A 4BACA 4BQAA 4ZDPA 3CCUI 5ED4A 2VKVA 2A05A 1HSTA 4RLFA 4CCJA 1BL0A 1FLIA 4XLPF 2DOAA 5H20A 4A3MJ 1D8JA 4HAMA 3LNQA 2VC0A 2XB5A 4J01A 2HOTA 1M1EB 1T38A 1MBJA 1FX7A 3RKXA 1TWCJ 3BZ6A 2FQ3A 2FOKA 4A0ZA 4BEHB 4FHTA 3QOEA 5FKNA 3AG4H 1T39A 1I50J 2VASA 1W36D 4ZYAA 3BR3A 3HC7A 1STZA 1JKRC 4HX8A 2P8TA 4OMYA 2E19A 4M9ZA 3K70D 1O57A 3RSNA 3HPHA 2JWTA 2JA8J 2HZTA 4R1HA 1LVKA 1TZLA 4NB5A 2X1DA 3SEZA 3V8KA 3F8FA 5ICEA 2C6YA 1MBHA 4FTHA 3BTLA 2HVRA 1X2NA 1A5JA 1DQUA 5GAHJ 2HNHA 2OU2A 2H27A 5DD4A 2MFZA 5J1UA 3X2QH 4I0BA 2XC7A 1RIOH 1Z6RA 3DLLF 4WWCA 3MFKA 2JVHA 5M3MJ 5BMZA 2GAUA 3L2CA 4IO9F 2K9LA 2Y0MA 2ZKZA 3N4MA 2DA2A 1WJCA 3ISPA 1Y0NA 2MC4A 1ETKA 3BJ6A 1A04A 1MDMA 3I4NJ 3K0LA 4XICA 1ZKGA 5TGTA 3DPTA 2CQKA 5E1WA 2CV1A 1ZTRA 1JTXA 2YU9J 3BZCA 2E7WA 2KL4A 3DU5A 1MMSA 1UAAA 1K4SA 3EETA 1HCRA 3E6MA 3FBIB 1U78A 4RLQA 3EUHA 2BHZA 2K7LA 2QGUA 2FUG2 1MKMA 2COBA 4PUSA 1QHHD 4IL6C 4OINF 2QBYB 2AO9A 1FMVA 1MBGA 1P2FA 1P7JA 2VJJA 3LA7A 2ACJA 2P4WA 3TKYA 5J6XA 4C2TA 1HC8A 5ERIA 1YIOA 2X0LA 3Q5FA 1IZ1A 1IXRC 5L3EA 2F5CA 2V1DA 3I0TA 3OSGA 1BC7C 1HF0A 4KIFA 1EV7A 2CH0A 2X6WA 5FFXA 3RZOJ 2DA6A 3KFWX 1JHFA 3K4LA 2XASA 3IKTA 1R5ID 1POGA 3BJAA 4HEA2 2HPMA 2RC4A 1FJLA 2Y31A 2OTJI 3M4OJ 3RPUA 3RQIA 3TW6A 5FKLA 1YJNI 1X4PA 3LA2A 1FOYA 3FXRA 4ZJZA 2M4GA 4XK4A 5LEKA 1R1UA 3S1MJ 2F5VA 5J8CA 3FWEA 3V8JA 4EVIA 4D5CA 4CCOA 3L2UA 2L9SA 4TV7A 1I39A 4IOCF 2DMUA 4RGUA 5FKMA 2LFBA 3FZVA 2M1BA 4LIVA 2Z1DA 4IQ4A 5K7FA 2E71A 1J09A 1J59A 3L7WA 3KPHA 3K4KA 5D6EA 3BR6A 5ILUA 3JSOA 1JGSA 3K2ZA 3V7CA 2QEXI 2M2EA 1H9TA 3CDIA 5AIQA 1YYVA 1S7OA 5HVQC 2XPUA 3TBIA 4OU0A 4W1UA 3CUQA 4ZC3A 2NAZA 2VJ4A 1SD5A 2L4MA 5FLVA 2YU3A 3G2BA 4A3FJ 1IW7F 4M3FA 4EJWA 5FFZA 1HKQA 4HX7A 1KYWA 4XLNF 2XAGA 2NVUB 2ISYA 6PAXA 2L02A 4EJUA 3P9CA 2MW8A 5M5YJ 9ANTA 2ME6A 4CYCB 3WG7H 1C0WA 2ZXWH 1Y39A 3WE3A 1LQ1A 4F3QA 5EJCA 4YG2F 2K3FA 4MIMA 3F8MA 3LFUA 2K5CA 1ETYA 1Z7LA 3F23A 1IUFA 4I01A 4P55A 3SQNA 5FROA 4CCKA 3R60A 3L2VA 3DWLE 2IVMA 3C18A 3OYFA 3C2BA 4S05A 1CQTA 3HPGA 2NNYA 2WC2A 2DDAA 2F4MB 2YX7A 5JVGF 3PM1A 2XRLA 4PJJA 3IWZA 1WQ2A 2RDPA 3OYBA 2P7VB 2KZGA 2QSFX 1IN5A 5KAFC 3GFLA 3K1NA 5E17F 5EDNA 3S17J 4Z2YA 1NG7A 5EEGA 5EZGA 4II3A 3VYSB 3IV5A 2JPCA 4IHTA 3G1OA 2FX0A 2RAEA 3OIOA 1SFUA 3RPUD 3JRAA 1I5ZA 2KDOA 5E20A 5HNFA 2W00A 5D4SA 2QSHX 3DPLC 5FB2A 1HW5A 1U8RA 1SD7A 5GADJ 1LPQA 1XN7A 3IH3A 1XTAA 2DOEA 2WY8Q 2IGKA 1SAUA 2RV8A 3CMMA 4IKFA 1G3SA 3EYIA 5KHDA 2XAUA 3MN2A 3J7ZI 5KK1A 1MBEA 5IOYA 3ECOA 4GXOA 3WGGA 4BXUA 5J1RA 1IV6A 4HRIA 2QSGX 1EF4A 2GZWA 3S2HJ 2VKDA 3DTEA 5M5WJ 2IS6A 1YE9A 3C2HA 4JOMA 5J4VA 3TEDA 1V3FA 4FE4A 2RKHA 1TLHB 2DK8A 3CJNA 3F3XA 5FRMA 1V5GA 1MD0A 5DDGA 2PJRA 2A6TA 3R61A 2H1LA 2RQPA 4NC8A 5H6RA 1IF1A 2HYJA 3OYKA 3MKWB 5B1AH 2Y30A 3CCEI 4XIDA 3DBHB 1L0OC 4E7IA 2LY2A 3WGHA 2LP0A 3ZQFA 2MSYA 4L0ZB 1FEXA 2EA4A 2VBYA 1VTNC 1JUMA 2PMZN 3I53A 5KCMA 3K7AJ 1RI7A 2F2EA 4N4NB 3RCOA 1OQYA 3HIFA 1SC7A 1Z0XA 5E3MA 4LB5A 3P9KA 2OQGA 4MNUA 2O61A 1UB9A 3GFJA 1K7AA 4AIDA 2A61A 3BPVA 1GV5A 2VT2A 3S3MA 3E6CC 3I3LA 5HS7A 2ZFUA 3QPHA 2PBIA 2ZXJA 1P4XA 1MSEC 1GUUA 3L1PA 2E34A 2J5OA 3RQ4A 4BY1J 3KETA 1DP7P 4B47A 2PLYA 1RKWA 1OCPA 2E60A 2L5QA 2M8GX 1FTTA 4PFPA 5F1JA 2DN0A 1ZG1A 1IG7A 1QGPA 5E3NA 2ISZA 3VFZA 4L9VA 4RM3A 4U7DA 2LSOA 4XM3A 3E5QA 2O6GE 1QHGA 4PSXA 1BA5A 2QBYA 2Z3YA 5B1BH 2QCOA 2PI0A 3ULQB 3KZIC 2BXZA 3OY9A 5HLIA 2HQRA 3BT9A 3BY6A 3DBRB 2VOPA 1QNTA 3CDHA 2BYVE 4PJNA 5FGMA 4WF2A 1OR7C 3TL4X 3F72A 1JXSA 2RVCA 3H3ZA 1U6GA 3OOUA 2QM3A 2VOOA 4KT6A 4F93B 4XOPA 3ZQGA 1MBKA 2O0YA 1F5TA 5E18F 1EJ9A 3OR2C
chains in the Genus database with same CATH topology
3MKLA 1NK3P 1F36A 4M3DA 4M3BA 2DMQA 4UUTA 3HOZJ 3BG3A 2Y9YA 3DCFA 2R5YB 2R0QC 1AHDP 1WI3A 1RPWA 2K40A 1IJWC 3RKQA 1Y1WJ 1YRNB 1UMQA 4XRSG 4JX4A 1QPIA 4IHVA 2DMTA 3TP3A 3WHBA 4V2FA 2XGCA 4A3GJ 3FKIJ 1IGNA 3ZOBA 3S1NJ 1H88C 3HOUJ 2O7OA 3A03A 3A01B 5EGOB 2MGQA 4FISA 1I6HJ 2HI3A 5EG0B 1LE8B 3S16J 3BG5A 5IP9J 4A3EJ 4IHXA 4QSHA 1ITYA 3GTQJ 3MVPA 2YUSA 3HGYA 4A3BJ 5GPAA 1TWHJ 3FISA 4BBSJ 1Z77A 2JMWA 2DJNA 4A3LJ 3ZQIA 5EEAA 2FJ1A 3O8GA 3Q0WA 1VFCA 4A69C 5GPCA 1K61A 2DA7A 2K9NA 4MLOA 1VI0A 2JN6A 4CYCA 1AU7A 3S2DJ 3G1MA 2I10A 1GV2A 1LFUP 1JKOC 2NS8A 2H8RA 2JA5J 1GVDA 2LVSA 3JR9A 2W48A 2OPTA 1Q1VA 3HOVJ 2R7ZJ 2XPVA 2DMNA 2Y2ZA 2DA3A 1IC8A 2X48A 5K7ZA 3SJMA 4JP0A 4QIWN 2XGEA 5FKOA 3BR0A 5C44J 3S1RJ 2DA4A 3BTJA 4EEFG 5F0CA 3LSJA 3BR2A 3A02A 3IH4A 3E7LA 3NAUA 5C3EJ 1HDDC 5IPAA 2ID3A 2N8GA 1T33A 1WH7A 2EZIA 2HDDA 2LK2A 2HQ5A 3HEFA 1F43A 1B72A 1U8BA 2TRTA 3GTMJ 2CU7A 1LFBA 4DYQA 5E3LA 4G12A 2JA7J 4DW6A 2ME0A 3QPLA 1B8IB 3I4MJ 2P81A 5EYRA 2VKVA 2XSDC 5DS9A 4QTRA 1QRYA 1BL0A 5IYBJ 4A3MJ 3O8HA 3LNQA 1AKHB 2IAIA 2CQQA 2XB5A 2HOTA 1W0TA 3HOWJ 1MBJA 4W97A 2CUFA 1TWCJ 2E2JJ 3HM5A 1RR7A 2CRGA 4L5EA 5FKNA 5FJ8J 2TCTA 1I50J 3HB9A 3BR3A 3TW7A 1JKRC 3LSPA 1XS9A 2E19A 1MH4A 2R5ZB 2JWTA 5IP6A 2JA8J 1E3OC 2M9HA 2IEKA 3ZQCA 4DZJA 2E2HJ 2LD5A 2CQXA 2WB1N 4MFEA 2ECCA 1MBHA 3BR5A 4X6AJ 5BNGA 3BTLA 4FTHA 1OCTC 3BTIA 1FTZA 1X2NA 1A5JA 2GBYA 3PO2J 2O8KA 4UUSA 4XRMA 1APLC 5J1UA 1G2HA 2Y0SN 2L7ZA 2EH3A 5FLMJ 3GTOJ 1BW5A 4A3CJ 3JREA 5M3MJ 3HGGA 4J19A 1ORKA 4FE7A 2DA2A 1ETKA 1TWFJ 3I4NJ 1K83J 2LKXA 4XICA 4A93J 2MG4A 1ZKGA 2CUEA 2L7MP 1ZK8A 3JRBA 1ZTRA 1RETA 1JTXA 1IRZA 2YU9J 1IDYA 2VKEA 4M6VA 1HCRA 4C3JJ 1HLVA 1U78A 2R93J 1WGXA 5JLWA 3VPRA 2COBA 3D1NI 3OSFA 4D7MA 5IYDJ 4HNVA 5IP7J 3BR1A 2DTZA 2AO9A 3JRGA 4Y52J 3FIWA 1XC5A 1MBGA 1P7JA 5F27A 2H1KA 1I3QJ 4IHYA 3JRFA 1PUFA 2GLOA 5GP9A 3HOYJ 2X6OA 2ECBA 2B63J 3OSGA 1VNDA 5J1YA 5HODA 2K9SA 1MBFA 1HF0A 3RZOJ 2DA6A 4DYRA 3HKZN 2QF7A 1POGA 2ZB9A 4M3EA 1SANA 1FJLA 2Y31A 3M4OJ 1T56A 2AHQA 3RQIA 3TW6A 5FKLA 1MH3A 4AC0A 4XK4A 1U9OA 4XRSA 3S1MJ 2R5YA 4D5CA 3S14J 3FK6A 4MO7A 5EZHA 5JLXA 1YRNA 1X58A 2DMUA 3DEWA 3QQAA 5FKMA 2LFBA 4A3IJ 1FIPA 1JT0A 4X1EA 5K7FA 1BJZA 2LTPA 4RBOA 3BR6A 2JK3A 4JX6A 4BBRJ 2DA1A 1JKQC 1MSFC 1JT6A 2M0CA 3A01A 2M2EA 5EGOA 1DU6A 5EG0A 3H3VK 3JRIA 1LE8A 3JRCA 1XG1A 2XPWA 2XPUA 4M3GA 3HOXJ 2HOSA 4W1UA 1ZR4A 1H8AC 3GBGA 3ZQLA 3BTCA 1BW6A 2LR8A 2OF7A 5FLVA 3LOCA 5FKKA 2XGDA 4C3IJ 4A3FJ 2DMPA 4M3FA 2DA5A 2NVQJ 5C4JJ 5M3FJ 1P7IA 2MW8A 5M5YJ 9ANTA 2ME6A 4CYCB 1WH5A 2WAQN 5F0FA 1NTCA 1FIAA 3Q3SA 5F0HA 3HDDA 1S7EA 2EQRA 2X9DA 4I76A 1VF9A 1GDTA 4MIMA 1JJ6C 1ETYA 1WPKA 2LY9A 1QVUA 1RESA 2FD5A 1IUFA 2E1OA 4A3JJ 2EZKA 1DU0A 4IHWA 3C2BA 4MFDA 4S0HB 1CQTA 5IOZA 2JJ7A 3S15J 3PO3J 4C2MJ 3PM1A 2XRLA 2O9LA 2FQ4A 2WV1A 4ABZA 2NVTJ 2NVYJ 2KT0A 5EDNA 1WCMJ 3S17J 3GTPJ 2HOAA 5EZGA 4FCYA 3IV5A 1JGGA 3G1OA 2FX0A 1B72B 2RAEA 3OIOA 5J3LA 3JRAA 1D5YA 3JRHA 2G0EA 2ID6A 5IYCJ 3QPSA 1B8IA 2VUMJ 1A6IA 1U9NA 3LSRA 2IBDA 3GTGJ 3IH3A 2Y9ZA 5F04A 3GTLJ 2EZLA 4JX5A 2M34A 1UG2A 2HXIA 5M5XJ 2YS9A 4DYCA 3WHCA 1HDPA 3MN2A 1AKHA 2L9RA 3CQZJ 1MBEA 5IOYA 3ZQHA 1ZGWA 1IV6A 5J1RA 3G1LA 3B6CA 3S1QJ 3K2AA 2EBIA 3HBLA 1EF4A 3S2HJ 1TWAJ 2XB0X 5M5WJ 4IEJA 1MNMC 2E2IJ 3FK7A 3TEDA 4A3DJ 3H0GJ 4FE4A 3GTJJ 3BQZA 3TP0A 1OJLA 1JTYA 4C3HJ 2R5ZA 1ZR2A 2GM4A 4JYKA 2HYJA 5K7HA 4BXXJ 2Y30A 4Y7NJ 4XIDA 4BY7J 3CMYA 3SDGA 1RKTA 1ETVA 2LP0A 4B3AA 1ETWA 2MSYA 3ZQFA 1FEXA 1X2MA 1JUMA 2PMZN 3CDLA 1JUPA 5DTDA 4UUSB 3K7AJ 1JKPC 1OFCX 4RDUA 4GFBA 1Y1VJ 4DZPA 1Z0XA 2VPRA 5E3MA 1QVTA 3B6AA 2R92J 1JJ8C 2ELKA 1ETQA 3Q0UA 1GV5A 3JRDA 1HOMA 2NVXJ 1H89C 2KDZA 4B1RA 1W0UA 4BKXA 1MSEC 1GUUA 1UHSA 3L1PA 3UKGA 1ETXA 3RZDJ 4I6ZA 2VI6A 4BY1J 4LOCA 1RKWA 2HXOA 1JUSA 1OCPA 1TWGJ 2M8GX 1FTTA 5F1JA 1IDZA 2DN0A 5E3OA 1SFOJ 1GT0C 2LLKA 3Q0VA 1IG7A 3IH2A 1ETOA 4B4CA 5E3NA 3M3YJ 1ENHA 3W6VA 4AYBN 1ZQ3P 1BA5A 3BG9A 1NK2P 3LSGA 2QCOA 5EF6A 2L0KA 3F0CA 2EZHA 1R9TJ 3BT9A 1PUFB 3NARA 2D5VA 2K9QA 2L7FP 4D7NA 5C4XJ 3CCYA 4NDLA 4A3KJ 3GTKJ 5F08A 1TC3C 3OOUA 2NOGA 3BQYA 2CJJA 3ZQGA 1MBKA 2NS7A 3SFIA 1O4XA 4V2GA 2JA6J 4AUXA 4D5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKL A;  1NK3 P;  1F36 A;  4M3D A;  4M3B A;  2DMQ A;  4UUT A;  3HOZ J;  3BG3 A;  2Y9Y A;  3DCF A;  2R5Y B;  2R0Q C;  1AHD P;  1WI3 A;  1RPW A;  2K40 A;  1IJW C;  3RKQ A;  1Y1W J;  1YRN B;  1UMQ A;  4XRS G;  4JX4 A;  1QPI A;  4IHV A;  2DMT A;  3TP3 A;  3WHB A;  4V2F A;  2XGC A;  4A3G J;  3FKI J;  1IGN A;  3ZOB A;  3S1N J;  1H88 C;  3HOU J;  2O7O A;  3A03 A;  3A01 B;  5EGO B;  2MGQ A;  4FIS A;  1I6H J;  2HI3 A;  5EG0 B;  1LE8 B;  3S16 J;  3BG5 A;  5IP9 J;  4A3E J;  4IHX A;  4QSH A;  1ITY A;  3GTQ J;  3MVP A;  2YUS A;  3HGY A;  4A3B J;  5GPA A;  1TWH J;  3FIS A;  4BBS J;  1Z77 A;  2JMW A;  2DJN A;  4A3L J;  3ZQI A;  5EEA A;  2FJ1 A;  3O8G A;  3Q0W A;  1VFC A;  4A69 C;  5GPC A;  1K61 A;  2DA7 A;  2K9N A;  4MLO A;  1VI0 A;  2JN6 A;  4CYC A;  1AU7 A;  3S2D J;  3G1M A;  2I10 A;  1GV2 A;  1LFU P;  1JKO C;  2NS8 A;  2H8R A;  2JA5 J;  1GVD A;  2LVS A;  3JR9 A;  2W48 A;  2OPT A;  1Q1V A;  3HOV J;  2R7Z J;  2XPV A;  2DMN A;  2Y2Z A;  2DA3 A;  1IC8 A;  2X48 A;  5K7Z A;  3SJM A;  4JP0 A;  4QIW N;  2XGE A;  5FKO A;  3BR0 A;  5C44 J;  3S1R J;  2DA4 A;  3BTJ A;  4EEF G;  5F0C A;  3LSJ A;  3BR2 A;  3A02 A;  3IH4 A;  3E7L A;  3NAU A;  5C3E J;  1HDD C;  5IPA A;  2ID3 A;  2N8G A;  1T33 A;  1WH7 A;  2EZI A;  2HDD A;  2LK2 A;  2HQ5 A;  3HEF A;  1F43 A;  1B72 A;  1U8B A;  2TRT A;  3GTM J;  2CU7 A;  1LFB A;  4DYQ A;  5E3L A;  4G12 A;  2JA7 J;  4DW6 A;  2ME0 A;  3QPL A;  1B8I B;  3I4M J;  2P81 A;  5EYR A;  2VKV A;  2XSD C;  5DS9 A;  4QTR A;  1QRY A;  1BL0 A;  5IYB J;  4A3M J;  3O8H A;  3LNQ A;  1AKH B;  2IAI A;  2CQQ A;  2XB5 A;  2HOT A;  1W0T A;  3HOW J;  1MBJ A;  4W97 A;  2CUF A;  1TWC J;  2E2J J;  3HM5 A;  1RR7 A;  2CRG A;  4L5E A;  5FKN A;  5FJ8 J;  2TCT A;  1I50 J;  3HB9 A;  3BR3 A;  3TW7 A;  1JKR C;  3LSP A;  1XS9 A;  2E19 A;  1MH4 A;  2R5Z B;  2JWT A;  5IP6 A;  2JA8 J;  1E3O C;  2M9H A;  2IEK A;  3ZQC A;  4DZJ A;  2E2H J;  2LD5 A;  2CQX A;  2WB1 N;  4MFE A;  2ECC A;  1MBH A;  3BR5 A;  4X6A J;  5BNG A;  3BTL A;  4FTH A;  1OCT C;  3BTI A;  1FTZ A;  1X2N A;  1A5J A;  2GBY A;  3PO2 J;  2O8K A;  4UUS A;  4XRM A;  1APL C;  5J1U A;  1G2H A;  2Y0S N;  2L7Z A;  2EH3 A;  5FLM J;  3GTO J;  1BW5 A;  4A3C J;  3JRE A;  5M3M J;  3HGG A;  4J19 A;  1ORK A;  4FE7 A;  2DA2 A;  1ETK A;  1TWF J;  3I4N J;  1K83 J;  2LKX A;  4XIC A;  4A93 J;  2MG4 A;  1ZKG A;  2CUE A;  2L7M P;  1ZK8 A;  3JRB A;  1ZTR A;  1RET A;  1JTX A;  1IRZ A;  2YU9 J;  1IDY A;  2VKE A;  4M6V A;  1HCR A;  4C3J J;  1HLV A;  1U78 A;  2R93 J;  1WGX A;  5JLW A;  3VPR A;  2COB A;  3D1N I;  3OSF A;  4D7M A;  5IYD J;  4HNV A;  5IP7 J;  3BR1 A;  2DTZ A;  2AO9 A;  3JRG A;  4Y52 J;  3FIW A;  1XC5 A;  1MBG A;  1P7J A;  5F27 A;  2H1K A;  1I3Q J;  4IHY A;  3JRF A;  1PUF A;  2GLO A;  5GP9 A;  3HOY J;  2X6O A;  2ECB A;  2B63 J;  3OSG A;  1VND A;  5J1Y A;  5HOD A;  2K9S A;  1MBF A;  1HF0 A;  3RZO J;  2DA6 A;  4DYR A;  3HKZ N;  2QF7 A;  1POG A;  2ZB9 A;  4M3E A;  1SAN A;  1FJL A;  2Y31 A;  3M4O J;  1T56 A;  2AHQ A;  3RQI A;  3TW6 A;  5FKL A;  1MH3 A;  4AC0 A;  4XK4 A;  1U9O A;  4XRS A;  3S1M J;  2R5Y A;  4D5C A;  3S14 J;  3FK6 A;  4MO7 A;  5EZH A;  5JLX A;  1YRN A;  1X58 A;  2DMU A;  3DEW A;  3QQA A;  5FKM A;  2LFB A;  4A3I J;  1FIP A;  1JT0 A;  4X1E A;  5K7F A;  1BJZ A;  2LTP A;  4RBO A;  3BR6 A;  2JK3 A;  4JX6 A;  4BBR J;  2DA1 A;  1JKQ C;  1MSF C;  1JT6 A;  2M0C A;  3A01 A;  2M2E A;  5EGO A;  1DU6 A;  5EG0 A;  3H3V K;  3JRI A;  1LE8 A;  3JRC A;  1XG1 A;  2XPW A;  2XPU A;  4M3G A;  3HOX J;  2HOS A;  4W1U A;  1ZR4 A;  1H8A C;  3GBG A;  3ZQL A;  3BTC A;  1BW6 A;  2LR8 A;  2OF7 A;  5FLV A;  3LOC A;  5FKK A;  2XGD A;  4C3I J;  4A3F J;  2DMP A;  4M3F A;  2DA5 A;  2NVQ J;  5C4J J;  5M3F J;  1P7I A;  2MW8 A;  5M5Y J;  9ANT A;  2ME6 A;  4CYC B;  1WH5 A;  2WAQ N;  5F0F A;  1NTC A;  1FIA A;  3Q3S A;  5F0H A;  3HDD A;  1S7E A;  2EQR A;  2X9D A;  4I76 A;  1VF9 A;  1GDT A;  4MIM A;  1JJ6 C;  1ETY A;  1WPK A;  2LY9 A;  1QVU A;  1RES A;  2FD5 A;  1IUF A;  2E1O A;  4A3J J;  2EZK A;  1DU0 A;  4IHW A;  3C2B A;  4MFD A;  4S0H B;  1CQT A;  5IOZ A;  2JJ7 A;  3S15 J;  3PO3 J;  4C2M J;  3PM1 A;  2XRL A;  2O9L A;  2FQ4 A;  2WV1 A;  4ABZ A;  2NVT J;  2NVY J;  2KT0 A;  5EDN A;  1WCM J;  3S17 J;  3GTP J;  2HOA A;  5EZG A;  4FCY A;  3IV5 A;  1JGG A;  3G1O A;  2FX0 A;  1B72 B;  2RAE A;  3OIO A;  5J3L A;  3JRA A;  1D5Y A;  3JRH A;  2G0E A;  2ID6 A;  5IYC J;  3QPS A;  1B8I A;  2VUM J;  1A6I A;  1U9N A;  3LSR A;  2IBD A;  3GTG J;  3IH3 A;  2Y9Z A;  5F04 A;  3GTL J;  2EZL A;  4JX5 A;  2M34 A;  1UG2 A;  2HXI A;  5M5X J;  2YS9 A;  4DYC A;  3WHC A;  1HDP A;  3MN2 A;  1AKH A;  2L9R A;  3CQZ J;  1MBE A;  5IOY A;  3ZQH A;  1ZGW A;  1IV6 A;  5J1R A;  3G1L A;  3B6C A;  3S1Q J;  3K2A A;  2EBI A;  3HBL A;  1EF4 A;  3S2H J;  1TWA J;  2XB0 X;  5M5W J;  4IEJ A;  1MNM C;  2E2I J;  3FK7 A;  3TED A;  4A3D J;  3H0G J;  4FE4 A;  3GTJ J;  3BQZ A;  3TP0 A;  1OJL A;  1JTY A;  4C3H J;  2R5Z A;  1ZR2 A;  2GM4 A;  4JYK A;  2HYJ A;  5K7H A;  4BXX J;  2Y30 A;  4Y7N J;  4XID A;  4BY7 J;  3CMY A;  3SDG A;  1RKT A;  1ETV A;  2LP0 A;  4B3A A;  1ETW A;  2MSY A;  3ZQF A;  1FEX A;  1X2M A;  1JUM A;  2PMZ N;  3CDL A;  1JUP A;  5DTD A;  4UUS B;  3K7A J;  1JKP C;  1OFC X;  4RDU A;  4GFB A;  1Y1V J;  4DZP A;  1Z0X A;  2VPR A;  5E3M A;  1QVT A;  3B6A A;  2R92 J;  1JJ8 C;  2ELK A;  1ETQ A;  3Q0U A;  1GV5 A;  3JRD A;  1HOM A;  2NVX J;  1H89 C;  2KDZ A;  4B1R A;  1W0U A;  4BKX A;  1MSE C;  1GUU A;  1UHS A;  3L1P A;  3UKG A;  1ETX A;  3RZD J;  4I6Z A;  2VI6 A;  4BY1 J;  4LOC A;  1RKW A;  2HXO A;  1JUS A;  1OCP A;  1TWG J;  2M8G X;  1FTT A;  5F1J A;  1IDZ A;  2DN0 A;  5E3O A;  1SFO J;  1GT0 C;  2LLK A;  3Q0V A;  1IG7 A;  3IH2 A;  1ETO A;  4B4C A;  5E3N A;  3M3Y J;  1ENH A;  3W6V A;  4AYB N;  1ZQ3 P;  1BA5 A;  3BG9 A;  1NK2 P;  3LSG A;  2QCO A;  5EF6 A;  2L0K A;  3F0C A;  2EZH A;  1R9T J;  3BT9 A;  1PUF B;  3NAR A;  2D5V A;  2K9Q A;  2L7F P;  4D7N A;  5C4X J;  3CCY A;  4NDL A;  4A3K J;  3GTK J;  5F08 A;  1TC3 C;  3OOU A;  2NOG A;  3BQY A;  2CJJ A;  3ZQG A;  1MBK A;  2NS7 A;  3SFI A;  1O4X A;  4V2G A;  2JA6 J;  4AUX A;  4D5F A; 
#chains in the Genus database with same CATH topology
 3MKL A;  2OAZ A;  2ZBK A;  4UUT A;  1WZ2 A;  3BG3 A;  2W4S A;  1QZE A;  1AHD P;  1ON1 A;  3O2P E;  4AVP A;  1WI3 A;  1BI3 A;  3U9G A;  1RPW A;  1PJR A;  3NRV A;  4WXC A;  4E70 A;  4BNC A;  4X0G A;  1S29 A;  4L9T A;  1YIT I;  3K4C A;  3WTW C;  2PMZ A;  3G71 I;  4CDG A;  4IHV A;  1FYM A;  3IAM 2;  5CQE A;  1Z9C A;  2FBI A;  4PFO A;  2STW A;  2V6C A;  2DLL A;  1HQC A;  4Y3O A;  3FKI J;  3I58 A;  3KP3 A;  2AQE A;  2CG4 A;  4WXH A;  3WTZ A;  3WTY C;  1H88 C;  1R4M B;  3S1N J;  3VWB A;  1SFX A;  2DU9 A;  3A03 A;  2UXX A;  3A01 B;  4E7J A;  4FIS A;  1X4O A;  2HI3 A;  4L9N A;  4MQ9 F;  4JQF A;  4L9J A;  3S16 J;  1PP7 U;  1KYZ A;  1UEL B;  1IN6 A;  4PJL A;  3CUQ B;  4M6Y A;  2JQ7 A;  3MVP A;  2YUS A;  4A3B J;  4Y17 A;  3E97 A;  4HX4 A;  5GPA A;  1U3E M;  1X1A A;  1TWH J;  3FIS A;  4BBS J;  2K27 A;  2XF5 A;  2HVS A;  4M72 A;  3KCC A;  2JMW A;  4AU7 A;  2XGX A;  2DJN A;  3ZQI A;  2DI3 A;  4PK4 A;  3Q0W A;  2DFH A;  5GPC A;  1K61 A;  3ZMU A;  4NC6 A;  1VI0 A;  3CCL I;  1VQL I;  2I10 A;  2VQC A;  4G7Z F;  4QLC U;  2QKM B;  2WAE A;  3TOA A;  2OQR A;  5BS6 A;  2CYY A;  3NQO A;  4GGG A;  2LVS A;  2FSW A;  5B3S H;  2M7A A;  2OPT A;  2W48 A;  3HOV J;  1WJE A;  4Y33 A;  2HS5 A;  4YFX F;  5KNL A;  2D1V A;  5AON A;  2V6E A;  5DUK A;  3E6D A;  4QPQ A;  3ZMZ A;  2DA3 A;  4AIK A;  2QQ9 A;  3ZXS A;  1IC8 A;  2EFW A;  4JP0 A;  2ZSH B;  2KIM A;  2MAB A;  3LAJ A;  1O3T A;  3BTJ A;  5CVI A;  4EEF G;  1FP2 A;  1ON2 A;  4M9S A;  2AS5 F;  2P7C B;  1EKE A;  3DXJ F;  5DEQ A;  1WH7 A;  2M4K A;  2R7S A;  2LK2 A;  2OTL I;  1W7P B;  2CU7 A;  1LFB A;  1IV8 A;  2VL8 A;  1T98 A;  1N77 A;  4CHU A;  3C1D A;  4XBF A;  3PNY A;  3QPL A;  4HOB A;  1RUO A;  3ABT A;  2P81 A;  3OS1 A;  2HDC A;  5EYR A;  3IHU A;  2XSD C;  3DP7 A;  4A6D A;  5IYB J;  2FF4 A;  4HF2 A;  5DD8 A;  4NHJ A;  4CSW A;  4HQM A;  3HOW J;  2MH9 A;  2YSR A;  4Y15 A;  1MJA A;  4ZYE A;  4CZZ A;  4BJT A;  2OA4 A;  5DV5 A;  2UWM A;  1S3J A;  2ETH A;  2CRG A;  4L5E A;  2Y75 A;  3PQJ A;  1IXC A;  2D2W A;  3QWL A;  1YIJ I;  3HB9 A;  3ASN H;  4IZZ A;  1IUY A;  1HKT A;  1Y0U A;  3BCB A;  3GW2 A;  2LF8 A;  1P6R A;  4BE0 A;  1TNS A;  4ITV A;  1ZYR F;  2OCC H;  5IP6 A;  3L2W A;  4HQE A;  1E3O C;  2PJR B;  3D0S A;  2QEN A;  3HOS A;  1D0Z A;  4MFE A;  2ECC A;  3BR5 A;  1OCT C;  2F6C A;  5DUI A;  1FTZ A;  3HXL A;  2NXN B;  1MMG A;  3DQV C;  2GBY A;  3PO2 J;  5JI6 A;  4XRM A;  2WAQ A;  3F9K A;  2P5K A;  2L7Z A;  3FHZ A;  2EH3 A;  3FM5 A;  2IJL A;  5FLM J;  1PYV A;  1O7L A;  1QZZ A;  5BPI A;  3AL0 C;  4G6D A;  3CC7 I;  4A3C J;  2DYR H;  3JRE A;  3HGG A;  1YG2 A;  3KLN A;  1ORK A;  4FE7 A;  4WCG A;  3SZG A;  1GXP A;  2I8D A;  1T8I A;  1GXQ A;  1QO0 D;  4QPO A;  4LIU A;  2FE3 A;  2DAO A;  1S6L A;  3RPQ A;  1IRZ A;  1BOA A;  1ZK8 A;  3J81 K;  1TQM A;  3KLO A;  3KP5 A;  1K6O A;  1IDY A;  2VKE A;  2ZO4 A;  3U21 A;  5HLG A;  1HLV A;  2R93 J;  3I59 B;  4KYW A;  5L3B A;  3WE2 A;  5H2F C;  4RGX A;  4WXD A;  3H9Q A;  3D1N I;  5IP7 J;  1T95 A;  2KIF A;  3BR1 A;  4M9X A;  3BJO A;  1VQ8 I;  1Z3Y A;  5F27 A;  4IHY A;  1I3Q J;  3A0H C;  2E5N A;  3PFI A;  4UVB A;  3VSK A;  1ZEL A;  2DQL A;  5GP9 A;  4WX9 A;  2XSJ C;  2R3S A;  2HPI A;  2X6O A;  4F55 A;  2HZD A;  1X1B A;  1VND A;  3KP7 A;  1PVE A;  1FY7 A;  3OS2 A;  1HXD A;  1MBF A;  2K9S A;  5D5X B;  2EV5 A;  1XGN A;  1A35 A;  2KIS A;  1T0F A;  1X1C A;  4GYI A;  5L3F A;  1HA8 A;  2FNP A;  4Z6Y A;  1TQP A;  1E17 A;  2ZB9 A;  2V9P A;  1BOB A;  1T56 A;  2L7K A;  3FXM A;  1MH3 A;  3DFG A;  4D5F A;  2A69 F;  3M7G A;  1RNL A;  5GAE J;  1FBS A;  4XRS A;  5D6F A;  3W3C A;  2O8X A;  1VQ7 I;  5K5Q A;  3DF8 A;  1B59 A;  1IRX A;  2E1N A;  2W82 A;  5JLX A;  2DOF A;  5J40 A;  2FA5 A;  4R79 A;  1TW3 A;  2XKP A;  2B9S A;  1U2W A;  2VPL A;  4A3I J;  5IY5 H;  1FIP A;  2D1H A;  2KIU A;  4X1E A;  4XOR A;  3J7Y J;  4RBO A;  1MIJ A;  1YS6 A;  1ZLK A;  4BBR J;  1JKQ C;  1GLN A;  4AWX B;  3VB2 A;  2M0C A;  4BJ5 C;  3GWZ A;  5EGO A;  2B0L A;  3A01 A;  2CV0 A;  2HOE A;  1DU6 A;  2NOJ B;  3JRI A;  1ZRF A;  1XG1 A;  3REO A;  2XPW A;  4UNO A;  1WJB A;  1B1B A;  4H0E A;  3HOX J;  1ZR4 A;  4E4H A;  2JTV A;  2IGN A;  2CW0 F;  4KFC A;  3HRS A;  3SHF A;  3CCR I;  4A12 A;  3ZQL A;  4S04 A;  1BW6 A;  2LR8 A;  1U5T A;  5FKK A;  4XLC A;  1SVO A;  4D0P A;  2P5V A;  1HKS A;  2KKO A;  1FOW A;  1UHW A;  1KZH A;  2CFO A;  2IGM A;  3ZP5 A;  4L5I A;  2K02 A;  4XSX F;  1WH5 A;  5F0F A;  1K78 B;  1FIA A;  2KP6 A;  3HDD A;  4BDY A;  3WTS C;  2X9D A;  2QKL B;  2GIZ A;  1LEB A;  1KON A;  3ML6 A;  2HKO A;  1GDT A;  1IRF A;  3BOQ A;  1SMY F;  1BBY A;  1WPK A;  1X1D A;  1RES A;  4FT8 A;  4NC7 A;  1G3W A;  3W2A A;  2IS2 A;  2FRH A;  2UXN A;  1N75 A;  1MW7 A;  2CUJ A;  1R49 A;  1Y56 A;  1Z05 A;  2EFO A;  3QYF A;  2RQQ A;  4Q4Z F;  2BGC A;  1W5T A;  4S0H B;  3ABK H;  5IOZ A;  3J7A O;  2DFI A;  1QU3 A;  2IS1 A;  2TDX A;  3DKY A;  2A6E F;  4B44 A;  2PX9 A;  4C2M J;  2O9L A;  5LBQ A;  5D5W B;  4AVZ A;  1Z21 A;  5E1Z B;  3ZQ7 A;  3GZ5 A;  4BHB A;  2P5L C;  3H9G A;  2CMP A;  3VYU B;  1ZN2 A;  3OYN A;  2NVT J;  5AIP A;  4PGG A;  4Q47 A;  3GTP J;  5KVR A;  4FCY A;  4EQQ A;  3RI4 A;  1IN8 A;  3GYH X;  1ZH5 A;  1LDD A;  2DPD A;  1W7P A;  2BVL A;  2DPU A;  1J2X A;  1D5Y A;  2EFP A;  3SXY A;  3JRH A;  3OYI A;  5GTI C;  3B73 A;  3SDB A;  1ERD A;  3H5N A;  2ZME A;  3QPS A;  3L2R A;  1A6I A;  1U9N A;  3GTG J;  3QPT A;  2BHY A;  2HTS A;  4IQJ A;  1UHM A;  3S3N A;  3T0Y A;  4CXF A;  2L9N A;  2BW3 B;  4A5M A;  2RN7 A;  2G7H A;  1SAX A;  1UG2 A;  5FRN A;  4DYC A;  3WHC A;  5CKT A;  4C9Y A;  2EV0 A;  3RKY A;  2L9R A;  2OUM A;  3ZQH A;  2W24 A;  4EAT A;  1YTY A;  1FSH A;  2KJB A;  4XSZ F;  1WRJ A;  1WVR A;  3IP4 B;  1T6S A;  4F92 B;  1SD6 A;  3LQR A;  4DBR A;  4IEJ A;  3FBN B;  4BQN A;  4MTD A;  1KU9 A;  1AWC A;  2GA2 A;  3H0G J;  5CLS A;  5K5O A;  4ZH4 F;  3OYH A;  2HQN A;  2M5W A;  3AG2 H;  2CQN A;  3BQZ A;  1OJL A;  2DJI A;  2X1C A;  3TP0 A;  3I4P A;  1LDK B;  2VBZ A;  4XN0 A;  1ZR2 A;  2GM4 A;  4YIF A;  2JZY A;  1WJD A;  1IAW A;  3ONQ A;  1YO5 C;  5L3G A;  4Y7N J;  2M0M A;  2KHM A;  3CMY A;  3HOT A;  3EPZ A;  1SEU A;  4IOA F;  1ETW A;  1X2M A;  1A36 A;  2MH2 A;  3CDL A;  2V9V A;  4LGW A;  4EM1 A;  4ENK A;  2QQB A;  3O3K A;  3VOE A;  1OFC X;  4RDU A;  3TO9 A;  4ZZL A;  1BI1 A;  4GFB A;  3MZ8 A;  1MZB A;  1Y1V J;  3OYD A;  1ODD A;  2VPR A;  3B6A A;  4RB2 C;  2CW7 A;  5FD5 A;  3JAM Z;  4M6X A;  3Q0U A;  1DP3 A;  3JRD A;  3ZMS A;  4C2U A;  3PL8 A;  1BM9 A;  1FBQ A;  2D45 A;  1R22 A;  1W0U A;  4BKX A;  4PCQ A;  3K6G A;  4FET A;  2R7O A;  3I54 A;  1ETX A;  1VZ0 A;  4I6Z A;  2VI6 A;  2PQ8 A;  1LJ9 A;  4XNF A;  3HKZ A;  3GXO A;  1JUS A;  3VEP A;  2JA2 A;  1U0J A;  1XDU A;  2OD5 A;  3ESW B;  1IDZ A;  3GLL A;  1A6Q A;  2CV2 A;  2WWY A;  3Q0V A;  3I59 A;  4DOZ A;  1VQ4 I;  4L18 B;  4I7H A;  4LIT A;  2JPB A;  3HRT A;  2EK5 A;  4BHC A;  2JSP A;  3FMQ A;  3MKZ A;  3IL2 A;  4XKV A;  4HV6 A;  5EF6 A;  4PDK A;  4Y13 A;  1J7K A;  2EZH A;  1R9T J;  4FAS D;  1PUF B;  1VQM I;  1LNW A;  2QVO A;  4O6J A;  1VQO I;  3PSI A;  1QBJ A;  1UFM A;  4NDL A;  3DU6 A;  5LRS A;  2RRE A;  2MD0 A;  3KIO A;  1XSD A;  3BQY A;  1ZGA A;  2L4A A;  2F5F A;  2Q2E B;  1O4X A;  3S3O A;  4UUV A;  5D5U B;  5CVJ A;  3QOP A;  3T8R A;  2BVM A;  2DMQ A;  1FOX A;  4M74 A;  3HOZ J;  2IGO A;  2RGV A;  2NNN A;  4CH7 A;  2K40 A;  4L5J A;  4YEJ A;  4E6K G;  1J5Y A;  1IJW C;  3HUG B;  2R7R A;  2Y0S A;  2EFQ A;  2XUB A;  1QPI A;  4B3X A;  2DMT A;  3CJT B;  3WU0 A;  3E6B A;  2FML A;  1EA3 A;  3H9J A;  4V2F A;  1BIB A;  4KJZ A;  2O7O A;  2O5R A;  5EGO B;  5EG0 B;  3BG5 A;  5IP9 J;  5FLX K;  2EIM H;  2XF7 A;  3DKW A;  3HSF A;  5E79 C;  1UJ8 A;  4QSH A;  3CES A;  3NWT A;  4PJM A;  4C30 A;  3GTQ J;  2JSC A;  1IN4 A;  2YPR A;  3HGY A;  3RTR A;  1A31 A;  1U5T B;  2WTE A;  1HBX G;  4U0V A;  1Z77 A;  3GX4 X;  1XMK A;  1BR2 A;  3ZGK A;  2BBY A;  1ZG3 A;  1R00 A;  2FJ1 A;  1TT0 A;  2GXA A;  1VFC A;  4BL0 B;  4AIH A;  2K9N A;  3I71 A;  2IP2 A;  1K78 A;  3DPU A;  2LBF A;  4ENJ A;  4HDU A;  4LK0 F;  3EUA A;  3WTU C;  5D8K B;  2KFD A;  1JKO C;  2NS8 A;  2DT5 A;  3SFZ A;  2DT6 A;  4ASN A;  4B48 A;  3FM3 A;  5E1X A;  4GDF A;  3V8L A;  3H5A A;  3FMR A;  1RRJ A;  4XKC A;  1X19 A;  2KRH A;  1T08 B;  1MJB A;  4ZDO A;  3W6J B;  5K7Z A;  4QIW N;  1V4R A;  2FEZ A;  3I64 A;  1CGP A;  5F1R A;  4U0Y A;  3LSJ A;  3BR2 A;  3IH4 A;  3I56 I;  2WAD A;  3E7L A;  1TTY A;  4GYG A;  4NBQ A;  5IPA A;  2ID3 A;  3IUO A;  4ZZD A;  2G7U A;  3F8B A;  3BG6 A;  4XRF A;  2M3A A;  4OMZ A;  4Q5S F;  2HQ5 A;  1XMX A;  1F43 A;  2XDV A;  3CO6 C;  5IT3 A;  3TMO A;  1B9M A;  5KAI C;  1I6X A;  3QU3 A;  4RA2 A;  3F8N A;  4AM3 A;  1Y6I A;  1KQ8 A;  2ZME B;  2VJ5 A;  1B4A A;  4XLH A;  1DDN A;  1YX3 A;  4LB6 B;  5HOO A;  4BH9 A;  5ILV A;  2HVQ A;  5DS9 A;  2BW3 A;  4QTR A;  3OYJ A;  2FU4 A;  1QRY A;  2DFE A;  4MTE A;  4XOT A;  3R6S A;  4D9J A;  1XCB A;  3O8H A;  4YEL A;  2IAI A;  1W0T A;  2EB7 A;  2GOM A;  5JFR A;  2IS4 A;  1SMT A;  4W97 A;  3BRO A;  2BY3 A;  3CP2 A;  2E2J J;  3HM5 A;  3PIP F;  2LKP A;  1OCR H;  4I0A A;  5FJ8 J;  3MD2 A;  2Z5U A;  2DDB A;  1YW7 A;  1HW1 A;  2AXL A;  3DBL B;  2COM A;  5J47 A;  4RB3 C;  1UCR A;  1BI2 A;  3HHG A;  4E7H A;  3M8F A;  1E0E A;  1MH4 A;  1YW8 A;  3BDD A;  3V7S A;  4DQ2 A;  2M9H A;  2IEK A;  1YX5 A;  4DZJ A;  2CQ7 A;  2E2H J;  4YFN F;  2LD5 A;  2CQX A;  1T0F C;  1SFE A;  3WTT C;  3FKJ A;  4ZTJ A;  3CF2 A;  1U5T C;  3GZ6 A;  2O8K A;  3AG3 H;  5A2Q K;  1APL C;  3SZT A;  2ZSI B;  2Y0S N;  3HYI A;  3IRQ A;  2OZ6 A;  1ZG5 A;  2DO7 A;  1V54 H;  4ENM A;  3GTO J;  4XQF A;  1YI2 I;  5LFA A;  2DBB A;  4J19 A;  3ZPL A;  2VIX A;  1ZGJ A;  3O6B B;  4EGZ A;  1EH8 A;  3GFI A;  3V42 A;  2ZJR F;  1ZRD A;  3S2W A;  5DCM A;  5HDN A;  1K83 J;  4A2U A;  3OIP A;  2LKX A;  4LLL A;  2JVG A;  2BXY A;  2MG4 A;  4BUP A;  1FOK A;  4A93 J;  4RGS A;  3S93 A;  3CD6 I;  3NEU A;  2VKH A;  4HNU A;  3JRB A;  2QQ8 A;  1W7P D;  3LQQ A;  1IRG A;  3C3W A;  2KRC A;  4M6V A;  3AKZ A;  2K4J A;  4BE1 A;  3ZMD A;  4C3J J;  4MEX F;  5H6Q A;  3MQ0 A;  2PEX A;  5LGT A;  3MZH A;  1FNN A;  1ZRE A;  1W36 C;  3BLY A;  2ELH A;  2VJI A;  3PIO F;  4D7M A;  3SZP A;  3MEX A;  1W5S A;  4IPA A;  3WOD F;  4HNV A;  4LG0 A;  5LEJ A;  2E1C A;  1TL8 A;  1R71 A;  2LNB A;  2A5W A;  3CUQ C;  2MLK A;  3HZJ A;  3FIW A;  2L9V A;  3KYD B;  4LK1 F;  4XN3 A;  3JRG A;  1Z91 A;  1PUF A;  2GLO A;  3ERM A;  3HOY J;  4KT5 C;  3J80 K;  1Q1H A;  2K86 A;  1QPM A;  2B63 J;  4G94 A;  5J1Y A;  2VE8 A;  4RGR A;  1USS A;  3PSF A;  3CCJ I;  3OYA A;  4KDP A;  4CGZ A;  1AOY A;  3J7A Y;  3BWG A;  2XRO A;  4DYR A;  3HKZ N;  2QF7 A;  3DEU A;  2VB6 A;  1AA7 A;  3JCU C;  2OV7 A;  3IC7 A;  4M3E A;  1F1Z A;  1SAN A;  3HHH A;  3KZY A;  4E7L A;  1D1A A;  1G3T A;  1S8N A;  2AHQ A;  2DW4 A;  2Q2E A;  3GUD A;  2W7N A;  2RNG A;  1IO2 A;  2M45 A;  3GCM A;  3E3V A;  1U9O A;  3HSE A;  4P1W A;  4Y4R A;  3MKY B;  1KGS A;  3S14 J;  3FK6 A;  3JTG A;  5EZH A;  2V9K A;  3TOB A;  3HUG A;  4MGR A;  3BZK A;  1X58 A;  4B8X A;  2IXS A;  3DEW A;  1G4D A;  1R7J A;  1JT0 A;  2VN2 A;  3U2R A;  3MCZ A;  3Q9S A;  1MSF C;  4HF1 A;  2QA4 I;  3ABU A;  5HS9 A;  3PNV A;  3CUO A;  2VXD A;  5EG0 A;  4YFK F;  4XL9 A;  4IHS A;  3JRC A;  3KEQ A;  2XKO A;  4EJO A;  3BPX A;  3E5X A;  2BV6 A;  1WI9 A;  4M3G A;  2YR2 A;  1H8A C;  2QUF A;  1T2K A;  4OWR B;  2STT A;  2OF7 A;  4EM2 A;  4Q48 A;  1D0Y A;  3T1B A;  4U88 A;  2XGD A;  4KN4 X;  3W6K B;  2FOW A;  2DMP A;  4EGY A;  3K10 A;  1O3Q A;  4KMF A;  2HFH A;  3HJE A;  3ASO H;  1Z6T A;  3T5X A;  4LG3 A;  2NVQ J;  3CP8 A;  5J8F A;  1P7I A;  3FXU A;  3LA3 A;  3JW4 A;  2CSO A;  5JR3 A;  4I99 C;  1S7E A;  2EQR A;  4IRH A;  2LBF B;  2I5U A;  2LRD A;  2Z99 A;  1R36 A;  3C2G A;  4IVN A;  4RAZ A;  2UZK A;  1ONV A;  3CLO A;  1QVU A;  1XDS A;  3D5L A;  2R7W A;  2EZK A;  2CO5 A;  1S5L C;  2JRT A;  3P7N A;  4MFD A;  1FP1 D;  3M8J A;  2LYC A;  2LDU A;  3OV8 A;  3OYE A;  4U0W A;  2XF6 A;  4D1Q A;  3G4S I;  4I02 A;  2FQ4 A;  3KEO A;  3AG1 H;  3GF2 A;  2HOA A;  4F91 B;  3LSH A;  3PJR A;  2VC1 A;  2W1O A;  2R7F A;  1ULY A;  2DQR A;  2ZCW A;  5ICF A;  5J3L A;  1VQK I;  1I3A A;  2G0E A;  4OIO F;  5L3C A;  3J81 Z;  1EH7 A;  5IYC J;  1B8I A;  2VUM J;  3LSR A;  2R7T A;  4IJA A;  2Y9Z A;  2W85 A;  5F04 A;  3GTL J;  2BEO A;  4JX5 A;  3MWM A;  1FPQ A;  4F52 A;  1GVJ A;  2M34 A;  3W2V A;  2HXI A;  2Y69 H;  3PUB A;  2YS9 A;  1HDP A;  1PDN C;  3CJR B;  1L3L A;  4P5O A;  3CQZ J;  4XLA A;  3TGN A;  1ZGW A;  3G1L A;  3B6C A;  3G73 A;  3K2A A;  2GWR A;  5F6F A;  1TWA J;  2XB0 X;  2DK5 A;  3H36 A;  3I9V 2;  1WSU A;  2WBM A;  2BOL A;  5HLT A;  1K6Y A;  1W5C C;  4KIG A;  4UB6 C;  5JVT A;  1MNM C;  1D5V A;  3HRM A;  3FF5 A;  3FK7 A;  5LHH A;  5LLQ A;  4A3D J;  4MHG A;  4BQO A;  2E1M B;  3PFY A;  2FMY A;  2NYX A;  1Z67 A;  1J75 A;  3B02 A;  1ACI A;  4N9I A;  4CCL A;  2VQH A;  3UNG C;  3GZN B;  2OBP A;  1J9I A;  4BY7 J;  3R0J A;  4PGH A;  1R5H A;  1DPU A;  4RS8 A;  1TW2 A;  3SEQ A;  2IPQ X;  5DTD A;  4UUS B;  4GRI A;  4CO8 A;  4DBQ A;  1I1G A;  3A0B C;  3NWS A;  1QVT A;  2R92 J;  2MBF A;  3F22 A;  5JHU A;  1VQP I;  1JJ8 C;  1FBU A;  2ELK A;  2X85 A;  3UR3 C;  3R4K A;  1ETQ A;  4XMY A;  2JT1 A;  3D5S C;  4BQQ A;  3FDY A;  4A6E A;  1HOM A;  5GAG J;  2NVX J;  1H89 C;  5DCM B;  1X3Z B;  4B1R A;  3CJQ B;  2CGP A;  1UHS A;  3UKG A;  4P96 A;  4RAF A;  2GXG A;  3W2W A;  2F4I A;  3ERE D;  1KQ9 A;  2HXO A;  1O7F A;  1MMN A;  2H6C A;  1TWG J;  5CPR B;  1EH6 A;  4BU2 A;  2Z33 A;  2V1U A;  2KQR A;  4G6Q A;  3SYT A;  5E3O A;  3FMS A;  5E8G A;  1DGR M;  1SFO J;  5CVU A;  1G8X A;  1ETO A;  3MZY A;  2R7Q A;  3KP4 A;  3A1Y A;  4LG0 B;  1ZLJ A;  2F48 A;  3CMA I;  2DT7 B;  3QYB A;  3ZMT A;  1NK2 P;  3HTS B;  4M73 A;  1KQ0 A;  1OIS A;  2ZJQ F;  3F0C A;  4UB8 C;  1HSJ A;  2WY7 Q;  4QWQ A;  2D5V A;  2K9Q A;  1XGS A;  3ZMV A;  5J4Y A;  2L7F P;  4LD5 A;  3K1P A;  4XLE A;  3LL7 A;  5C4X J;  5CVR A;  1V5F A;  1XPX A;  3VSL A;  4A3K J;  2IW5 A;  1MMD A;  5F08 A;  2LH9 A;  3ABL H;  1CF7 A;  1TC3 C;  4HSR A;  1UZC A;  1N78 A;  3JTH A;  3VOD A;  5IT9 Z;  3F6V A;  2NS7 A;  3OYM A;  2JA6 J;  4AUX A;  4BS9 A;  4KN7 X;  1F36 A;  4M3B A;  2VOD A;  2H6B A;  2Z16 A;  4IRG A;  3V4G A;  2R5Y B;  4FQG A;  3GVA A;  4HLY A;  4O5V A;  3JSP A;  3WTV C;  2LMD A;  4XON A;  2E1M C;  2VQG A;  3RJP A;  2CFX A;  4G7O F;  4BAY A;  4ESB A;  2BY1 A;  1QQI A;  2F5D A;  1YRN B;  1UMQ A;  3BG7 A;  2DOD A;  3EDP A;  4XRS G;  3H0D A;  4JX4 A;  3F8C A;  2MYS A;  4LMY A;  5D8L B;  1K4T A;  3WGI A;  2OJE D;  3TP3 A;  3WHB A;  3KP2 A;  2HEO A;  2L2O A;  3CTA A;  1IGN A;  3DTK A;  4EMS A;  2PJP A;  3HOU J;  1GHC A;  3HTU A;  1I6H J;  2HGC A;  3E1S A;  2EFN A;  2ZC2 A;  5D4R A;  3I5U A;  1R1T A;  4A3E J;  4IHX A;  4OIR F;  4BGD A;  2H8W A;  3GME A;  2VQL A;  1JE8 A;  2V7F A;  3CC2 I;  3TDU C;  2OC6 A;  3VYT B;  4IX7 A;  3FXQ A;  1OLT A;  2VXZ A;  5EEA A;  3O8G A;  4A69 C;  3N97 A;  1WKM A;  5ILS A;  1VQ9 I;  2DA7 A;  3A4C A;  3L2Q A;  4MLO A;  2ZNZ A;  1FYL A;  5DM6 F;  1AU7 A;  1UG0 A;  3G1M A;  1GV2 A;  5ICG A;  3ROU A;  1LFU P;  4DNC A;  4P9F A;  4A5N A;  2KJC A;  5LGN A;  2V26 A;  1D0X A;  2CWE A;  5HDK A;  4CYD A;  2H8R A;  4N4O B;  2NRA C;  2CS3 A;  3JR9 A;  4CCN A;  3M9A A;  1Q1V A;  5F64 A;  3KZZ A;  2XPV A;  1Y8Q B;  1K79 A;  5A2Q Z;  2Y2Z A;  2JUG A;  4E7S A;  2DTR A;  2VE9 A;  1BJA A;  2ZXI A;  3CLQ A;  1YHQ I;  3FXK A;  2BE5 F;  2ESN A;  1IXS B;  1XGO A;  2DA4 A;  5GTH C;  2LKS A;  2Z9O A;  5F0C A;  2IA1 A;  2PN6 A;  2HQA A;  5L3D A;  1O3S A;  4NQW B;  1Y8R B;  1F4K A;  2UUZ A;  3P9I A;  1T33 A;  1XD7 A;  3HEF A;  2P6T A;  2TRT A;  3GTM J;  1R58 A;  3WU2 C;  4DYQ A;  3QAH A;  3LAP A;  2IA2 A;  2QQA A;  4G12 A;  1OKR A;  2Z2S B;  2M8E A;  2ME0 A;  1B8I B;  3I4M J;  3GEZ A;  2M87 A;  3DLA A;  3V7R A;  4KA4 A;  1FWZ A;  3OIQ A;  4RMN A;  2QLZ A;  4HST A;  2G9W A;  3ZQQ A;  3OL3 A;  2J5P A;  1LFP A;  4HDV A;  1MJ9 A;  5TJJ A;  1AKH B;  2CQQ A;  3L09 A;  4H4K C;  2DYS H;  3A2K A;  1ZAO A;  4HYE A;  1SVL A;  4EM0 B;  1OCZ H;  5HLH A;  2CUF A;  3DKX A;  4YIR X;  1RR7 A;  1S72 I;  2V4J C;  1LKX A;  4XKB A;  2TCT A;  5LGU A;  3RKW A;  2QYO A;  2XAQ A;  5CVV A;  2MA3 A;  3TW7 A;  3U1D A;  3EYY A;  3LSP A;  1XS9 A;  4FX0 A;  3H3U A;  1H0M A;  1FC3 A;  3H5R A;  2R5Z B;  1KU3 A;  3ZQC A;  4RAY A;  3OYC A;  1FT9 A;  1R1V A;  3KP6 A;  2WB1 N;  4HA8 A;  5EEH A;  4X6A J;  5E8I A;  5BNG A;  1MND A;  3BTI A;  5D5V B;  3CCV I;  3E0J B;  4BJ6 C;  3N05 A;  4UY8 I;  4UUS A;  3K9T A;  2L3D A;  1R4N B;  1G2H A;  3IKV A;  2OCE A;  4A0X A;  3KYL A;  1VQ6 I;  4UHT A;  2EIK H;  5CQG A;  2IRF G;  1KA8 A;  2JUC A;  1BW5 A;  1OCO H;  3HL2 A;  1D1B A;  1ZHF A;  2F4O B;  2VBW A;  2EPF A;  1R6R A;  3CCQ I;  5CJ9 A;  4KUM A;  1TWF J;  1O3R A;  2MC3 A;  4BYY A;  3COA C;  1YOV B;  1X1P A;  1WWX A;  3QYE A;  2XRN A;  1E2X A;  2CUE A;  2L7M P;  3PQK A;  1RET A;  4HLX A;  4HZF A;  3K70 C;  2IT0 A;  2KZV A;  2W57 A;  2KLO A;  4U7B A;  2V1N A;  3LSM A;  2V79 A;  1OYW A;  1V5E A;  1WGX A;  2B7E A;  5JLW A;  2E35 A;  4CZC A;  3AAF A;  1KU7 A;  2WA0 A;  5BPD A;  3VPR A;  1PUE E;  3OSF A;  5IYD J;  2F5E A;  2Q1Z B;  4EV0 A;  2DTZ A;  1RR8 C;  4Y52 J;  1XC5 A;  3H35 A;  5FD6 A;  3CF5 F;  2GQQ A;  2H1K A;  1JI8 A;  1D1C A;  3JRF A;  3LST A;  1XB4 A;  5K1Y A;  3T8T A;  4GO1 A;  3P5J A;  5B5E C;  2ECB A;  3CO7 C;  1S9H A;  1P4A A;  2A07 F;  5HOD A;  2QWW A;  2HKX A;  1TT5 B;  3VDX A;  5LD2 C;  5IT9 K;  3J80 Z;  4I09 A;  1CF7 B;  2VT3 A;  1HW2 A;  4E7Z A;  3DTI A;  4AC0 A;  3OYL A;  2W84 A;  2X6X A;  3EUH C;  3OOP A;  4XR6 A;  2R5Y A;  1LUJ B;  2UV1 A;  4OIQ F;  1OCC H;  4RB0 A;  4MO7 A;  2BZT A;  2L01 A;  4M71 A;  1YRN A;  2LY1 A;  4ESJ A;  1WJ5 A;  3QQA A;  3LSI A;  2K3P A;  4AYB A;  4XLF A;  4RB1 A;  2EIN H;  2CW8 A;  4P9U A;  1YS7 A;  1BJZ A;  1MGT A;  2LTP A;  4F7Z A;  3KE2 A;  2PMU A;  2K85 A;  3WG9 A;  3G6E I;  2GXB A;  2RNJ A;  3QP6 A;  3ZCO A;  2JK3 A;  4JX6 A;  2DA1 A;  2PFB A;  3CC4 I;  1JT6 A;  1XGM A;  1WFX A;  5BOX A;  4CIC A;  3H3V K;  3U1K A;  1LE8 A;  2ZJ2 A;  4G7H F;  5TRD A;  4DIQ A;  2O03 A;  2HOS A;  3GBG A;  3LMM A;  3K4N A;  2LG4 A;  1SD4 A;  4NUB A;  2X6Y A;  3BTC A;  5TIS C;  3LOC A;  1Z1D A;  5DCF A;  4C3I J;  3KEY A;  3RDI A;  2DA5 A;  5C4J J;  2HYG D;  5M3F J;  5K5R A;  3PUF A;  1TP4 A;  4I2O A;  2HR3 A;  4RM2 A;  3LWF A;  2E7X A;  2WAQ N;  1NTC A;  3Q3S A;  5F0H A;  4HF0 A;  4OIP F;  2E5Z A;  3EUK L;  4I76 A;  1VF9 A;  4L0Y B;  1PP8 F;  3QU6 A;  3TDZ C;  1VQN I;  4G8X A;  1JJ6 C;  2EIL H;  1YLF A;  1D3Y A;  4HNT A;  2DCE A;  1OPC A;  2LY9 A;  3FHN A;  2FD5 A;  2W25 A;  4E7K A;  2E1O A;  2EJR A;  5HNH A;  4A3J J;  1DU0 A;  2XAJ A;  1LEA A;  1XCV A;  1D8K A;  4B09 A;  4HBL A;  1BIA A;  1FSE A;  4IHW A;  2M7B A;  1DGW Y;  1Z7U A;  4AD9 A;  1P4W A;  2KMU A;  1WJF A;  2LRE A;  2JJ7 A;  3D5R C;  3S15 J;  4R8H A;  2XAH A;  3PO3 J;  4ETS A;  2VLA A;  2E36 A;  1E3H A;  2Q8K A;  3S8P A;  3AL0 B;  2Q0O A;  1BI0 A;  4ABZ A;  2WV1 A;  3KX2 A;  3QRF F;  2NVY J;  2KT0 A;  4NQW A;  3PNT A;  4EJT A;  1WCM J;  1W1W E;  2VON A;  2PG4 A;  1JGG A;  4IRI A;  3F6O A;  1B72 B;  4PZJ A;  4CCM A;  1FMW A;  2ID6 A;  2R4G A;  3G3Z A;  1NH3 A;  3M07 A;  1H9G A;  2EV6 A;  3VYR B;  2HWV A;  2IBD A;  4IXA A;  5DYM A;  4PSW A;  3JAM K;  4ON0 A;  2EZL A;  3M1E A;  3BC8 A;  1P92 A;  1YJ9 I;  3IWF A;  3LFK A;  2FXA A;  2JRM A;  4ANJ A;  5M5X J;  1MMA A;  4WK8 F;  4UV9 A;  1AKH A;  3K69 A;  5LHI A;  3K4M A;  2XIG A;  4HPQ A;  2ZJP F;  3S1Q J;  2EBI A;  3FXJ A;  3E5U A;  3HBL A;  4XKW A;  1XX5 A;  3C7J A;  4BEH A;  2HTJ A;  2R7X A;  2E2I J;  3L00 A;  2HU9 A;  1LVA A;  3HSR A;  1IN7 A;  1WJA A;  3GTJ J;  2XAF A;  4N9H A;  4PJ0 C;  2ZXH A;  5LHG A;  4MQV A;  3TO7 A;  3OS0 A;  1JTY A;  4C3H J;  2R5Z A;  2X4H A;  2R7V A;  3OMY A;  1R23 A;  2AQF A;  2H09 A;  4JYK A;  2A3S A;  5K7H A;  4BXX J;  2WAF A;  2FBH A;  3DEE A;  3DV8 A;  2DXI A;  3OR1 C;  3SDG A;  1RKT A;  4NNJ A;  1ETV A;  4B3A A;  4G6T B;  4KMU X;  3WU1 B;  4HG2 A;  4IF4 A;  3RYR A;  3LSK A;  1N25 A;  1JUP A;  1NHA A;  2OZU A;  1JKP C;  4BE2 A;  3S32 A;  1LB2 A;  3M8E A;  3MMY B;  4DZP A;  3CCS I;  1RZ4 A;  2K9M A;  1FZP B;  1I27 A;  1XSX A;  4U87 A;  2ZNY A;  1QA6 A;  3AFH A;  2LC2 A;  2P6S A;  4A0Y A;  2VBX A;  3I55 I;  2PMH A;  1MDM B;  4OAZ A;  2KRF A;  2KDZ A;  3TO6 A;  2WV0 A;  3OL4 A;  4OAY A;  1XMA A;  2ESH A;  4ZDL A;  3K4B A;  5HDG A;  3RZD J;  4FX4 A;  1P9Q C;  2IA0 A;  3FX3 A;  4LOC A;  5ICC A;  1YJW I;  1J0R A;  1I1S A;  3GLX A;  2L54 A;  1V55 H;  3ZR8 X;  5HS8 A;  2A5Y B;  3H1C A;  5LRR A;  3Q9V A;  2LLK A;  1GT0 C;  3IH2 A;  4II2 A;  4B4C A;  2K4B A;  3M3Y J;  1BR4 A;  5DM7 F;  4HW0 A;  3CZ6 A;  4K2E A;  4V19 K;  1ENH A;  1WHU A;  3W6V A;  4AYB N;  1ZQ3 P;  3BG9 A;  2KIQ A;  2ICW G;  1QZY A;  2XHK A;  2Y48 A;  3LSG A;  5CYV A;  2L0K A;  4KNY A;  4J00 A;  2EA2 A;  3FXO A;  4UV8 A;  2GOX B;  1XSV A;  3NAR A;  2R7D A;  2CUZ A;  4D7N A;  4ZYH A;  3CCY A;  4DGW B;  1OR7 A;  2DFF A;  3GO5 A;  4BDZ A;  3GTK J;  1BN5 A;  2V1X A;  1G3Y A;  2A68 F;  2HYF A;  2NOG A;  1ZAR A;  4UVA A;  1BR1 A;  2XVC A;  3KYC B;  2CJJ A;  3RYP A;  1YQA A;  1E3P A;  4RAG A;  4LJZ F;  3SFI A;  4V2G A;  1F9N A;  2M30 A;  2YX4 A;  1TQI A;  1NK3 P;  2XV4 S;  4LLG F;  3HRU A;  4M3D A;  3CCM I;  3GFM A;  2Y9Y A;  2FBK A;  2X1E A;  3DCF A;  3F21 A;  2R0Q C;  4B43 A;  4MEY F;  5B66 C;  1SFK A;  1YFH A;  3R0A A;  3ZN1 A;  1JHH A;  3RKQ A;  1RUN A;  2BY0 A;  4LLN A;  1LDJ A;  1OYI A;  2O3F A;  2MD5 A;  3EQL F;  1Y1W J;  3QOD A;  3ZN0 A;  4BXF A;  2BY2 A;  2ELJ A;  2GIV A;  3BCA A;  4YRV A;  1KU2 A;  2P0W A;  5BQT A;  2XGC A;  4A3G J;  1NG6 A;  2ADU A;  3ZOB A;  5FLX Z;  1TNT A;  4ZTF A;  1ZRC A;  4UVC A;  3HG9 A;  2QZ8 A;  4OOI A;  2MGQ A;  4UXN A;  1OYY A;  2A6H F;  4KIC A;  2MLG A;  5FO5 A;  4N0B A;  1LE8 B;  3BP8 A;  2ZME C;  2H94 A;  4KIS A;  1S7A A;  3ELK A;  1DUX C;  3WTX C;  1B9N A;  1REP C;  2GA1 A;  1ITY A;  1X3U A;  2ZFW A;  2R7U A;  1MNE A;  1UST A;  1W4M A;  4JBA A;  1FYK A;  4A3L J;  4DJA A;  4ZYG A;  4BHP A;  1OMI A;  2JN6 A;  1YW9 A;  3ABM H;  4CYC A;  4KIT B;  2LOO A;  1BC8 C;  1VQ5 I;  1B6A A;  1Z3X A;  4O3M A;  3S2D J;  1TBX A;  2AXT C;  5JHF A;  3ZRG A;  1G59 A;  2HDW A;  4ZYD A;  1GVD A;  2JA5 J;  2WB1 A;  4LFU A;  4G9Y A;  2EWN A;  1RC9 A;  3OWT A;  2R7Z J;  3H92 A;  3L9F A;  4I98 B;  2X51 A;  3M1C A;  3QP5 A;  4ESF A;  2DMN A;  2FNA A;  1DPR A;  3K4J A;  4EJV A;  2X48 A;  2KPM A;  3SJM A;  3RIR A;  2XGE A;  4CUG A;  4KIB A;  5FKO A;  3K1M A;  3BR0 A;  5C44 J;  3S1R J;  4GCV A;  4YII A;  3A02 A;  5C3E J;  1HDD C;  3NAU A;  1R5G A;  2N8G A;  4ENN A;  3ECH A;  3OYG A;  1X3W B;  3FXL A;  3CME I;  2EZI A;  3IAS 2;  3IRR A;  3MAJ A;  2HDD A;  2EIJ H;  4AIJ A;  2LF7 A;  1B72 A;  1U8B A;  4JK1 X;  1G6N A;  3TQN A;  5E3L A;  2NS0 A;  1SVM A;  4CA0 A;  4HV5 A;  2JA7 J;  4DW6 A;  4BAC A;  4BQA A;  4ZDP A;  3CCU I;  5ED4 A;  2VKV A;  2A05 A;  1HST A;  4RLF A;  4CCJ A;  1BL0 A;  1FLI A;  4XLP F;  2DOA A;  5H20 A;  4A3M J;  1D8J A;  4HAM A;  3LNQ A;  2VC0 A;  2XB5 A;  4J01 A;  2HOT A;  1M1E B;  1T38 A;  1MBJ A;  1FX7 A;  3RKX A;  1TWC J;  3BZ6 A;  2FQ3 A;  2FOK A;  4A0Z A;  4BEH B;  4FHT A;  3QOE A;  5FKN A;  3AG4 H;  1T39 A;  1I50 J;  2VAS A;  1W36 D;  4ZYA A;  3BR3 A;  3HC7 A;  1STZ A;  1JKR C;  4HX8 A;  2P8T A;  4OMY A;  2E19 A;  4M9Z A;  3K70 D;  1O57 A;  3RSN A;  3HPH A;  2JWT A;  2JA8 J;  2HZT A;  4R1H A;  1LVK A;  1TZL A;  4NB5 A;  2X1D A;  3SEZ A;  3V8K A;  3F8F A;  5ICE A;  2C6Y A;  1MBH A;  4FTH A;  3BTL A;  2HVR A;  1X2N A;  1A5J A;  1DQU A;  5GAH J;  2HNH A;  2OU2 A;  2H27 A;  5DD4 A;  2MFZ A;  5J1U A;  3X2Q H;  4I0B A;  2XC7 A;  1RIO H;  1Z6R A;  3DLL F;  4WWC A;  3MFK A;  2JVH A;  5M3M J;  5BMZ A;  2GAU A;  3L2C A;  4IO9 F;  2K9L A;  2Y0M A;  2ZKZ A;  3N4M A;  2DA2 A;  1WJC A;  3ISP A;  1Y0N A;  2MC4 A;  1ETK A;  3BJ6 A;  1A04 A;  1MDM A;  3I4N J;  3K0L A;  4XIC A;  1ZKG A;  5TGT A;  3DPT A;  2CQK A;  5E1W A;  2CV1 A;  1ZTR A;  1JTX A;  2YU9 J;  3BZC A;  2E7W A;  2KL4 A;  3DU5 A;  1MMS A;  1UAA A;  1K4S A;  3EET A;  1HCR A;  3E6M A;  3FBI B;  1U78 A;  4RLQ A;  3EUH A;  2BHZ A;  2K7L A;  2QGU A;  2FUG 2;  1MKM A;  2COB A;  4PUS A;  1QHH D;  4IL6 C;  4OIN F;  2QBY B;  2AO9 A;  1FMV A;  1MBG A;  1P2F A;  1P7J A;  2VJJ A;  3LA7 A;  2ACJ A;  2P4W A;  3TKY A;  5J6X A;  4C2T A;  1HC8 A;  5ERI A;  1YIO A;  2X0L A;  3Q5F A;  1IZ1 A;  1IXR C;  5L3E A;  2F5C A;  2V1D A;  3I0T A;  3OSG A;  1BC7 C;  1HF0 A;  4KIF A;  1EV7 A;  2CH0 A;  2X6W A;  5FFX A;  3RZO J;  2DA6 A;  3KFW X;  1JHF A;  3K4L A;  2XAS A;  3IKT A;  1R5I D;  1POG A;  3BJA A;  4HEA 2;  2HPM A;  2RC4 A;  1FJL A;  2Y31 A;  2OTJ I;  3M4O J;  3RPU A;  3RQI A;  3TW6 A;  5FKL A;  1YJN I;  1X4P A;  3LA2 A;  1FOY A;  3FXR A;  4ZJZ A;  2M4G A;  4XK4 A;  5LEK A;  1R1U A;  3S1M J;  2F5V A;  5J8C A;  3FWE A;  3V8J A;  4EVI A;  4D5C A;  4CCO A;  3L2U A;  2L9S A;  4TV7 A;  1I39 A;  4IOC F;  2DMU A;  4RGU A;  5FKM A;  2LFB A;  3FZV A;  2M1B A;  4LIV A;  2Z1D A;  4IQ4 A;  5K7F A;  2E71 A;  1J09 A;  1J59 A;  3L7W A;  3KPH A;  3K4K A;  5D6E A;  3BR6 A;  5ILU A;  3JSO A;  1JGS A;  3K2Z A;  3V7C A;  2QEX I;  2M2E A;  1H9T A;  3CDI A;  5AIQ A;  1YYV A;  1S7O A;  5HVQ C;  2XPU A;  3TBI A;  4OU0 A;  4W1U A;  3CUQ A;  4ZC3 A;  2NAZ A;  2VJ4 A;  1SD5 A;  2L4M A;  5FLV A;  2YU3 A;  3G2B A;  4A3F J;  1IW7 F;  4M3F A;  4EJW A;  5FFZ A;  1HKQ A;  4HX7 A;  1KYW A;  4XLN F;  2XAG A;  2NVU B;  2ISY A;  6PAX A;  2L02 A;  4EJU A;  3P9C A;  2MW8 A;  5M5Y J;  9ANT A;  2ME6 A;  4CYC B;  3WG7 H;  1C0W A;  2ZXW H;  1Y39 A;  3WE3 A;  1LQ1 A;  4F3Q A;  5EJC A;  4YG2 F;  2K3F A;  4MIM A;  3F8M A;  3LFU A;  2K5C A;  1ETY A;  1Z7L A;  3F23 A;  1IUF A;  4I01 A;  4P55 A;  3SQN A;  5FRO A;  4CCK A;  3R60 A;  3L2V A;  3DWL E;  2IVM A;  3C18 A;  3OYF A;  3C2B A;  4S05 A;  1CQT A;  3HPG A;  2NNY A;  2WC2 A;  2DDA A;  2F4M B;  2YX7 A;  5JVG F;  3PM1 A;  2XRL A;  4PJJ A;  3IWZ A;  1WQ2 A;  2RDP A;  3OYB A;  2P7V B;  2KZG A;  2QSF X;  1IN5 A;  5KAF C;  3GFL A;  3K1N A;  5E17 F;  5EDN A;  3S17 J;  4Z2Y A;  1NG7 A;  5EEG A;  5EZG A;  4II3 A;  3VYS B;  3IV5 A;  2JPC A;  4IHT A;  3G1O A;  2FX0 A;  2RAE A;  3OIO A;  1SFU A;  3RPU D;  3JRA A;  1I5Z A;  2KDO A;  5E20 A;  5HNF A;  2W00 A;  5D4S A;  2QSH X;  3DPL C;  5FB2 A;  1HW5 A;  1U8R A;  1SD7 A;  5GAD J;  1LPQ A;  1XN7 A;  3IH3 A;  1XTA A;  2DOE A;  2WY8 Q;  2IGK A;  1SAU A;  2RV8 A;  3CMM A;  4IKF A;  1G3S A;  3EYI A;  5KHD A;  2XAU A;  3MN2 A;  3J7Z I;  5KK1 A;  1MBE A;  5IOY A;  3ECO A;  4GXO A;  3WGG A;  4BXU A;  5J1R A;  1IV6 A;  4HRI A;  2QSG X;  1EF4 A;  2GZW A;  3S2H J;  2VKD A;  3DTE A;  5M5W J;  2IS6 A;  1YE9 A;  3C2H A;  4JOM A;  5J4V A;  3TED A;  1V3F A;  4FE4 A;  2RKH A;  1TLH B;  2DK8 A;  3CJN A;  3F3X A;  5FRM A;  1V5G A;  1MD0 A;  5DDG A;  2PJR A;  2A6T A;  3R61 A;  2H1L A;  2RQP A;  4NC8 A;  5H6R A;  1IF1 A;  2HYJ A;  3OYK A;  3MKW B;  5B1A H;  2Y30 A;  3CCE I;  4XID A;  3DBH B;  1L0O C;  4E7I A;  2LY2 A;  3WGH A;  2LP0 A;  3ZQF A;  2MSY A;  4L0Z B;  1FEX A;  2EA4 A;  2VBY A;  1VTN C;  1JUM A;  2PMZ N;  3I53 A;  5KCM A;  3K7A J;  1RI7 A;  2F2E A;  4N4N B;  3RCO A;  1OQY A;  3HIF A;  1SC7 A;  1Z0X A;  5E3M A;  4LB5 A;  3P9K A;  2OQG A;  4MNU A;  2O61 A;  1UB9 A;  3GFJ A;  1K7A A;  4AID A;  2A61 A;  3BPV A;  1GV5 A;  2VT2 A;  3S3M A;  3E6C C;  3I3L A;  5HS7 A;  2ZFU A;  3QPH A;  2PBI A;  2ZXJ A;  1P4X A;  1MSE C;  1GUU A;  3L1P A;  2E34 A;  2J5O A;  3RQ4 A;  4BY1 J;  3KET A;  1DP7 P;  4B47 A;  2PLY A;  1RKW A;  1OCP A;  2E60 A;  2L5Q A;  2M8G X;  1FTT A;  4PFP A;  5F1J A;  2DN0 A;  1ZG1 A;  1IG7 A;  1QGP A;  5E3N A;  2ISZ A;  3VFZ A;  4L9V A;  4RM3 A;  4U7D A;  2LSO A;  4XM3 A;  3E5Q A;  2O6G E;  1QHG A;  4PSX A;  1BA5 A;  2QBY A;  2Z3Y A;  5B1B H;  2QCO A;  2PI0 A;  3ULQ B;  3KZI C;  2BXZ A;  3OY9 A;  5HLI A;  2HQR A;  3BT9 A;  3BY6 A;  3DBR B;  2VOP A;  1QNT A;  3CDH A;  2BYV E;  4PJN A;  5FGM A;  4WF2 A;  1OR7 C;  3TL4 X;  3F72 A;  1JXS A;  2RVC A;  3H3Z A;  1U6G A;  3OOU A;  2QM3 A;  2VOO A;  4KT6 A;  4F93 B;  4XOP A;  3ZQG A;  1MBK A;  2O0Y A;  1F5T A;  5E18 F;  1EJ9 A;  3OR2 C; 
#chains in the Genus database with same CATH homology
 3MKL A;  1NK3 P;  1F36 A;  4M3D A;  4M3B A;  2DMQ A;  4UUT A;  3HOZ J;  3BG3 A;  2Y9Y A;  3DCF A;  2R5Y B;  2R0Q C;  1AHD P;  1WI3 A;  1RPW A;  2K40 A;  1IJW C;  3RKQ A;  1Y1W J;  1YRN B;  1UMQ A;  4XRS G;  4JX4 A;  1QPI A;  4IHV A;  2DMT A;  3TP3 A;  3WHB A;  4V2F A;  2XGC A;  4A3G J;  3FKI J;  1IGN A;  3ZOB A;  3S1N J;  1H88 C;  3HOU J;  2O7O A;  3A03 A;  3A01 B;  5EGO B;  2MGQ A;  4FIS A;  1I6H J;  2HI3 A;  5EG0 B;  1LE8 B;  3S16 J;  3BG5 A;  5IP9 J;  4A3E J;  4IHX A;  4QSH A;  1ITY A;  3GTQ J;  3MVP A;  2YUS A;  3HGY A;  4A3B J;  5GPA A;  1TWH J;  3FIS A;  4BBS J;  1Z77 A;  2JMW A;  2DJN A;  4A3L J;  3ZQI A;  5EEA A;  2FJ1 A;  3O8G A;  3Q0W A;  1VFC A;  4A69 C;  5GPC A;  1K61 A;  2DA7 A;  2K9N A;  4MLO A;  1VI0 A;  2JN6 A;  4CYC A;  1AU7 A;  3S2D J;  3G1M A;  2I10 A;  1GV2 A;  1LFU P;  1JKO C;  2NS8 A;  2H8R A;  2JA5 J;  1GVD A;  2LVS A;  3JR9 A;  2W48 A;  2OPT A;  1Q1V A;  3HOV J;  2R7Z J;  2XPV A;  2DMN A;  2Y2Z A;  2DA3 A;  1IC8 A;  2X48 A;  5K7Z A;  3SJM A;  4JP0 A;  4QIW N;  2XGE A;  5FKO A;  3BR0 A;  5C44 J;  3S1R J;  2DA4 A;  3BTJ A;  4EEF G;  5F0C A;  3LSJ A;  3BR2 A;  3A02 A;  3IH4 A;  3E7L A;  3NAU A;  5C3E J;  1HDD C;  5IPA A;  2ID3 A;  2N8G A;  1T33 A;  1WH7 A;  2EZI A;  2HDD A;  2LK2 A;  2HQ5 A;  3HEF A;  1F43 A;  1B72 A;  1U8B A;  2TRT A;  3GTM J;  2CU7 A;  1LFB A;  4DYQ A;  5E3L A;  4G12 A;  2JA7 J;  4DW6 A;  2ME0 A;  3QPL A;  1B8I B;  3I4M J;  2P81 A;  5EYR A;  2VKV A;  2XSD C;  5DS9 A;  4QTR A;  1QRY A;  1BL0 A;  5IYB J;  4A3M J;  3O8H A;  3LNQ A;  1AKH B;  2IAI A;  2CQQ A;  2XB5 A;  2HOT A;  1W0T A;  3HOW J;  1MBJ A;  4W97 A;  2CUF A;  1TWC J;  2E2J J;  3HM5 A;  1RR7 A;  2CRG A;  4L5E A;  5FKN A;  5FJ8 J;  2TCT A;  1I50 J;  3HB9 A;  3BR3 A;  3TW7 A;  1JKR C;  3LSP A;  1XS9 A;  2E19 A;  1MH4 A;  2R5Z B;  2JWT A;  5IP6 A;  2JA8 J;  1E3O C;  2M9H A;  2IEK A;  3ZQC A;  4DZJ A;  2E2H J;  2LD5 A;  2CQX A;  2WB1 N;  4MFE A;  2ECC A;  1MBH A;  3BR5 A;  4X6A J;  5BNG A;  3BTL A;  4FTH A;  1OCT C;  3BTI A;  1FTZ A;  1X2N A;  1A5J A;  2GBY A;  3PO2 J;  2O8K A;  4UUS A;  4XRM A;  1APL C;  5J1U A;  1G2H A;  2Y0S N;  2L7Z A;  2EH3 A;  5FLM J;  3GTO J;  1BW5 A;  4A3C J;  3JRE A;  5M3M J;  3HGG A;  4J19 A;  1ORK A;  4FE7 A;  2DA2 A;  1ETK A;  1TWF J;  3I4N J;  1K83 J;  2LKX A;  4XIC A;  4A93 J;  2MG4 A;  1ZKG A;  2CUE A;  2L7M P;  1ZK8 A;  3JRB A;  1ZTR A;  1RET A;  1JTX A;  1IRZ A;  2YU9 J;  1IDY A;  2VKE A;  4M6V A;  1HCR A;  4C3J J;  1HLV A;  1U78 A;  2R93 J;  1WGX A;  5JLW A;  3VPR A;  2COB A;  3D1N I;  3OSF A;  4D7M A;  5IYD J;  4HNV A;  5IP7 J;  3BR1 A;  2DTZ A;  2AO9 A;  3JRG A;  4Y52 J;  3FIW A;  1XC5 A;  1MBG A;  1P7J A;  5F27 A;  2H1K A;  1I3Q J;  4IHY A;  3JRF A;  1PUF A;  2GLO A;  5GP9 A;  3HOY J;  2X6O A;  2ECB A;  2B63 J;  3OSG A;  1VND A;  5J1Y A;  5HOD A;  2K9S A;  1MBF A;  1HF0 A;  3RZO J;  2DA6 A;  4DYR A;  3HKZ N;  2QF7 A;  1POG A;  2ZB9 A;  4M3E A;  1SAN A;  1FJL A;  2Y31 A;  3M4O J;  1T56 A;  2AHQ A;  3RQI A;  3TW6 A;  5FKL A;  1MH3 A;  4AC0 A;  4XK4 A;  1U9O A;  4XRS A;  3S1M J;  2R5Y A;  4D5C A;  3S14 J;  3FK6 A;  4MO7 A;  5EZH A;  5JLX A;  1YRN A;  1X58 A;  2DMU A;  3DEW A;  3QQA A;  5FKM A;  2LFB A;  4A3I J;  1FIP A;  1JT0 A;  4X1E A;  5K7F A;  1BJZ A;  2LTP A;  4RBO A;  3BR6 A;  2JK3 A;  4JX6 A;  4BBR J;  2DA1 A;  1JKQ C;  1MSF C;  1JT6 A;  2M0C A;  3A01 A;  2M2E A;  5EGO A;  1DU6 A;  5EG0 A;  3H3V K;  3JRI A;  1LE8 A;  3JRC A;  1XG1 A;  2XPW A;  2XPU A;  4M3G A;  3HOX J;  2HOS A;  4W1U A;  1ZR4 A;  1H8A C;  3GBG A;  3ZQL A;  3BTC A;  1BW6 A;  2LR8 A;  2OF7 A;  5FLV A;  3LOC A;  5FKK A;  2XGD A;  4C3I J;  4A3F J;  2DMP A;  4M3F A;  2DA5 A;  2NVQ J;  5C4J J;  5M3F J;  1P7I A;  2MW8 A;  5M5Y J;  9ANT A;  2ME6 A;  4CYC B;  1WH5 A;  2WAQ N;  5F0F A;  1NTC A;  1FIA A;  3Q3S A;  5F0H A;  3HDD A;  1S7E A;  2EQR A;  2X9D A;  4I76 A;  1VF9 A;  1GDT A;  4MIM A;  1JJ6 C;  1ETY A;  1WPK A;  2LY9 A;  1QVU A;  1RES A;  2FD5 A;  1IUF A;  2E1O A;  4A3J J;  2EZK A;  1DU0 A;  4IHW A;  3C2B A;  4MFD A;  4S0H B;  1CQT A;  5IOZ A;  2JJ7 A;  3S15 J;  3PO3 J;  4C2M J;  3PM1 A;  2XRL A;  2O9L A;  2FQ4 A;  2WV1 A;  4ABZ A;  2NVT J;  2NVY J;  2KT0 A;  5EDN A;  1WCM J;  3S17 J;  3GTP J;  2HOA A;  5EZG A;  4FCY A;  3IV5 A;  1JGG A;  3G1O A;  2FX0 A;  1B72 B;  2RAE A;  3OIO A;  5J3L A;  3JRA A;  1D5Y A;  3JRH A;  2G0E A;  2ID6 A;  5IYC J;  3QPS A;  1B8I A;  2VUM J;  1A6I A;  1U9N A;  3LSR A;  2IBD A;  3GTG J;  3IH3 A;  2Y9Z A;  5F04 A;  3GTL J;  2EZL A;  4JX5 A;  2M34 A;  1UG2 A;  2HXI A;  5M5X J;  2YS9 A;  4DYC A;  3WHC A;  1HDP A;  3MN2 A;  1AKH A;  2L9R A;  3CQZ J;  1MBE A;  5IOY A;  3ZQH A;  1ZGW A;  1IV6 A;  5J1R A;  3G1L A;  3B6C A;  3S1Q J;  3K2A A;  2EBI A;  3HBL A;  1EF4 A;  3S2H J;  1TWA J;  2XB0 X;  5M5W J;  4IEJ A;  1MNM C;  2E2I J;  3FK7 A;  3TED A;  4A3D J;  3H0G J;  4FE4 A;  3GTJ J;  3BQZ A;  3TP0 A;  1OJL A;  1JTY A;  4C3H J;  2R5Z A;  1ZR2 A;  2GM4 A;  4JYK A;  2HYJ A;  5K7H A;  4BXX J;  2Y30 A;  4Y7N J;  4XID A;  4BY7 J;  3CMY A;  3SDG A;  1RKT A;  1ETV A;  2LP0 A;  4B3A A;  1ETW A;  2MSY A;  3ZQF A;  1FEX A;  1X2M A;  1JUM A;  2PMZ N;  3CDL A;  1JUP A;  5DTD A;  4UUS B;  3K7A J;  1JKP C;  1OFC X;  4RDU A;  4GFB A;  1Y1V J;  4DZP A;  1Z0X A;  2VPR A;  5E3M A;  1QVT A;  3B6A A;  2R92 J;  1JJ8 C;  2ELK A;  1ETQ A;  3Q0U A;  1GV5 A;  3JRD A;  1HOM A;  2NVX J;  1H89 C;  2KDZ A;  4B1R A;  1W0U A;  4BKX A;  1MSE C;  1GUU A;  1UHS A;  3L1P A;  3UKG A;  1ETX A;  3RZD J;  4I6Z A;  2VI6 A;  4BY1 J;  4LOC A;  1RKW A;  2HXO A;  1JUS A;  1OCP A;  1TWG J;  2M8G X;  1FTT A;  5F1J A;  1IDZ A;  2DN0 A;  5E3O A;  1SFO J;  1GT0 C;  2LLK A;  3Q0V A;  1IG7 A;  3IH2 A;  1ETO A;  4B4C A;  5E3N A;  3M3Y J;  1ENH A;  3W6V A;  4AYB N;  1ZQ3 P;  1BA5 A;  3BG9 A;  1NK2 P;  3LSG A;  2QCO A;  5EF6 A;  2L0K A;  3F0C A;  2EZH A;  1R9T J;  3BT9 A;  1PUF B;  3NAR A;  2D5V A;  2K9Q A;  2L7F P;  4D7N A;  5C4X J;  3CCY A;  4NDL A;  4A3K J;  3GTK J;  5F08 A;  1TC3 C;  3OOU A;  2NOG A;  3BQY A;  2CJJ A;  3ZQG A;  1MBK A;  2NS7 A;  3SFI A;  1O4X A;  4V2G A;  2JA6 J;  4AUX A;  4D5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...