5D8LB

Human hsf2 dna binding domain in complex with 3-site hse dna at 2.1 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*TP*GP*AP*AP*TP*AP*TP*TP*CP*TP*AP*GP*AP*AP*CP*
publication title Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 25
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d8lB00
3I71A 4RB3C 3RI4A 1QBJA 2CWEA 2MD5A 5IT3A 1S29A 1IXCA 1P6RA 3RKXA 1ZN2A 2LKPA 3R0JA 3VB2A 5CYVA 2EWNA 2EFNA 3P9IA 1WWXA 5JR3A 1RUOA 1YO5C 3F3XA 5FLXZ 5D5VB 1K6OA 3C18A 1FYMA 3T8TA 2A3SA 3CUQA 3KEOA 2P5VA 1IXRC 3CLOA 2H6BA 4P55A 3ZMUA 2GAUA 1FPQA 4ZYEA 2CSOA 4FX4A 4G6QA 4A6EA 2XVCA 3KEQA 3GXOA 4A6DA 2FMLA 4PZJA 2A68F 3I59B 3KE2A 2HOEA 2XUBA 1RIOH 4EMSA 3ZQ7A 1IN4A 2BE5F 5BPIA 2E7XA 4RAZA 1OYIA 1Z7UA 3HHHA 1XD7A 3J81K 1S7AA 3V4GA 3BJAA 1J9IA 3KP6A 4LFUA 1FX7A 5K5OA 2K27A 2P7VB 2V79A 1SMTA 1S6LA 4L9VA 1AWCA 1EH6A 5KVRA 4S04A 2V9VA 4JQFA 4GGGA 2Y75A 3ML6A 3ABTA 1BN5A 4HV5A 1W5TA 3IRRA 1XB4A 4IPAA 2MH2A 4LB6B 1U78A 4FT8A 4OIPF 2V6CA 1SD6A 4I0AA 4P9UA 1D8KA 3FXUA 2QZ8A 1TTYA 1LB2A 2ZFWA 4Z2YA 1QQIA 2OBPA 2HZTA 1BI3A 4PGGA 4BHPA 2J5PA 2FNPA 3ZPLA 3KP7A 3K69A 3FMQA 2FOKA 5E17F 4UXNA 5L3BA 3GZ6A 4EJWA 2H6CA 2VBZA 1GXPA 3PQKA 4KN7X 2P6TA 3OV8A 3P7NA 4LMYA 4EGZA 3FHZA 1RUNA 2FA5A 5F1RA 2RC4A 3AAFA 3Q9VA 4RGUA 4BH9A 2A69F 3N97A 2VE9A 4MQVA 4HA8A 4MGRA 5L3EA 4HX7A 2KIFA 1LVAA 4RB1A 2H27A 3QPTA 1LNWA 2QLZA 1J5YA 2ISZA 3KLOA 3DP7A 3WGGA 1BIBA 5KK1A 4IXAA 5FLXK 3GFLA 3K9TA 1USTA 4L5IA 2XKPA 5L3FA 4U7DA 1CGPA 3QOPA 4KMUX 4AIHA 4EV0A 2EV0A 1XMAA 1K7AA 2V1DA 1HXDA 2QBYB 2WV0A 3SFZA 5A2QZ 5FB2A 4Q48A 1FBQA 1QZYA 1HKTA 2FBKA 4L0ZB 1HQCA 2HYGD 3TDZC 2F5EA 4P5OA 3U2RA 3M1EA 5LGUA 3M9AA 3E6CC 4LJZF 2L3DA 1O3TA 2FEZA 3V8JA 3E6BA 4BAYA 3RDIA 5J8FA 1U2WA 3JSOA 4ZYGA 1DDNA 4KIGA 5DD4A 5H6RA 5BS6A 2VXZA 2W57A 3HIFA 2AXLA 2XGXA 4CDGA 5ERIA 1PDNC 3I0TA 5JHUA 3L00A 3H92A 1OYWA 3KZZA 3I59A 3HTUA 5HOOA 3M8EA 1ZLJA 4G6DA 3GF2A 4QWQA 1ZG3A 5E1XA 1ON2A 4ESBA 4WX9A 3TOBA 5H6QA 4CICA 1FSEA 4U0YA 1CF7B 4MQ9F 2HDCA 4UUVA 3GEZA 3WE2A 4KT5C 4WK8F 3HYIA 4LG0B 3KZYA 4G94A 2IA0A 3QPHA 1ZH5A 2R7DA 5HS8A 2DAOA 2D2WA 5F64A 4G9YA 4HX8A 1ZGJA 4GCVA 1YW9A 6PAXA 1G3WA 5AIPA 4NQWA 2UWMA 3R61A 4ESFA 2EA4A 2RQPA 1ZRFA 2A5YB 5HDKA 2HQNA 2RNJA 2BV6A 4EM2A 3C1DA 4HLYA 4BHBA 5HS7A 3K1NA 3WTSC 2IA2A 2YSRA 3KETA 5EEGA 2K86A 4WF2A 3MFKA 1J7KA 3SZTA 3BZ6A 4CXFA 1S8NA 2VBWA 1QO0D 3VEPA 3WGIA 2Q0OA 5A2QK 2IT0A 4AVPA 3HSEA 4WXDA 1HKSA 4WXHA 2P5KA 4YG2F 4IVNA 2EFWA 3EETA 3FWEA 1TW3A 4CGZA 2FQ3A 1BC7C 2O0YA 1SFXA 1TBXA 1J59A 4BYYA 1AOYA 4HBLA 2NNYA 2NRAC 2ZO4A 3FXRA 2GWRA 1U3EM 3F6VA 4U0VA 5LBQA 1EH8A 2W24A 2OA4A 2VC1A 3QAHA 3WU1B 2QBYA 2MLGA 4HQEA 4HX4A 1MJBA 3WTYC 3EDPA 3KLNA 2DK5A 3LQRA 1DP7P 4MTDA 3QP6A 3U1DA 2QQBA 3HOTA 1SAXA 1QZZA 3EUHA 1YS7A 5E1WA 1UB9A 3WE3A 1BOAA 5DYMA 2LSOA 1U8RA 2W25A 1P2FA 3VODA 4IHTA 1V4RA 1UHMA 3O2PE 4Q5SF 3FF5A 4LLGF 4Y15A 3C3WA 4M9SA 2EFOA 2HKOA 1B9MA 2QQ9A 3TDUC 4LLLA 1C0WA 2L4AA 3W6JB 3TGNA 4A5NA 5D6FA 4JK1X 3JW4A 2JSCA 2DTRA 4HF2A 3ABUA 1O7FA 4KMFA 1ZYRF 5DEQA 2YX7A 3MCZA 1FP2A 2FE3A 4K2EA 2XHKA 4PCQA 3ZMVA 1J0RA 2OU2A 3LAPA 4BNCA 2FMYA 2Z5UA 1CF7A 2XAGA 3ZP5A 4HDVA 3HSRA 1YW7A 1ZLKA 4LG0A 4EVIA 4OMZA 2MA3A 4ON0A 1JHFA 2O3FA 3LA7A 4A0XA 4YFNF 3GUDA 5J6XA 2PN6A 2AS5F 4RAYA 2XV4S 1ULYA 2LF8A 5K5QA 4CYDA 3WTTC 4JBAA 2QVOA 2B0LA 1ZREA 2KJCA 5HDNA 1OPCA 4P96A 3SQNA 2VBXA 1MD0A 2V1XA 5E8IA 3IL2A 1D5VA 2GZWA 2ZXJA 3GFIA 2DQLA 3G73A 2PJPA 1MKMA 4OU0A 2STTA 4KDPA 3GW2A 3BDDA 2ACJA 2DU9A 1YIOA 1KU9A 4CZZA 2JRTA 3CUQC 2EFPA 1HW5A 1Z05A 2O8XA 2OAZA 3WTZA 1K79A 4L9TA 1ZRDA 2M87A 3KCCA 3CO6C 1WRJA 3HRUA 3TO7A 3RYRA 2R3SA 4HYEA 1ZAOA 5HS9A 3BPXA 4EQQA 3CO7C 5DUIA 2YU3A 2PFBA 5JVTA 5H20A 1NHAA 2MBFA 2HYFA 2MH9A 2J5OA 3V7SA 2HTJA 3ECHA 2NAZA 2K7LA 3MEXA 1SFUA 5FD5A 5D4RA 1FYKA 2OZUA 2RV8A 4KA4A 2HFHA 3I4PA 1R1VA 4AD9A 1DPRA 5LGNA 3E5QA 1J75A 1Z1DA 2E1CA 1XGMA 4UVAA 1U5TC 4ENNA 3LWFA 3T1BA 1FBUA 1BC8C 1UHWA 4M9XA 2Z33A 3V8LA 5CLSA 2IVMA 1W7PD 5AIQA 4UV8A 1TW2A 5D5UB 3QRFF 5D5WB 1YYVA 2XAFA 3HRMA 1R00A 1YLFA 2KKOA 3K1MA 2Q8KA 4XBFA 1O3SA 3S2WA 3IKVA 5DDGA 3RIRA 1HW1A 1FSHA 2YX4A 1HSTA 5D8LB 2EK5A 1WQ2A 4Q4ZF 2ADUA 2BEOA 2DBBA 3IC7A 3ZMSA 3ECOA 1IRGA 1T38A 1F1ZA 1T0FA 3WTVC 4F7ZA 2P5LC 5D8KB 2CGPA 4R1HA 2EA2A 2XAQA 1R5HA 1FT9A 1FWZA 2H09A 3DF8A 3H3ZA 1F9NA 3MQ0A 1G3TA 4KIBA 1DPUA 3U9GA 5LLQA 1ODDA 1JHHA 2WWYA 1MGTA 3E3VA 1IN6A 4ESJA 4ENJA 5ILSA 4IRHA 4I01A 4UVCA 1VTNC 4NHJA 1LQ1A 3B73A 2RN7A 2LF7A 1FY7A 1LEBA 4KNYA 4HDUA 2DO7A 4BXUA 4M6XA 3BROA 1HSJA 2L4MA 4HV6A 4RS8A 1KQ0A 5HLHA 2K4JA 3IWFA 5AONA 1BJAA 3BWGA 3BOQA 5HVQC 1LDJA 5FGMA 4MTEA 1G4DA 2FBHA 3ZN0A 2KIUA 2X4HA 3FMSA 1KYZA 2IPQX 1Y0UA 1XCBA 3MZHA 2YPRA 1ZRCA 1TQMA 3FM5A 2VBYA 2FF4A 1I1SA 2ELHA 4OMYA 4RGSA 5K5RA 2ZCWA 1IW7F 1FYLA 4BQAA 3GFJA 2PG4A 3R0AA 1S3JA 1XCVA 3KP3A 3DXJF 3K2ZA 3ULQB 2CFXA 4HQMA 5LEJA 1BI2A 1ZARA 3HRTA 3L09A 1TQIA 3QU6A 4U7BA 1BI1A 1R7JA 3F72A 1XGNA 4XLNF 3F21A 2G9WA 4UV9A 5FD6A 3WODF 1KA8A 3HHGA 3GVAA 3ELKA 5LRRA 1K78A 3TKYA 4AWXB 1KU7A 1R22A 4GO1A 1B6AA 3CJNA 1XSDA 1TNTA 4WCGA 4GXOA 2STWA 3DQVC 1I5ZA 4L18B 1LDDA 5ICGA 2KRFA 3F8FA 1SMYF 1OR7A 5HLIA 2VC0A 1TNSA 1YS6A 2DFIA 4Y13A 4RGXA 4YFXF 1X3UA 1FBSA 2DI3A 2COMA 5LRSA 3NQOA 3TO9A 4OIOF 4EJUA 3V7CA 2NS0A 3G3ZA 4MNUA 3HTSB 3FMRA 2VT3A 5FFXA 2F2EA 1I6XA 4L9NA 1OYYA 3CDHA 2G7HA 3C7JA 1W5SA 4L9JA 2F5DA 4YFKF 1L3LA 1P4WA 2ESNA 1MZBA 3F8BA 1Z91A 2F5CA 1LJ9A 1FLIA 1B59A 3FZVA 2ESHA 4O6JA 1ONVA 5ICFA 3TQNA 1TLHB 2WC2A 1XGSA 1XGOA 1V3FA 2EV6A 2W85A 2QWWA 3RTRA 3IKTA 2Y48A 2DQRA 2JPBA 4TV7A 4A2UA 5HDGA 3E6DA 4S05A 3BJOA 1T2KA 2E1NA 2ZNZA 3ZN1A 3L9FA 3DEUA 4IJAA 4KN4X 1A04A 2M5WA 1UFMA 2DPUA 1W7PA 3KP4A 3J80Z 4KIFA 2Z9OA 5CVRA 2DW4A 3K1PA 3MAJA 4EGYA 3SHFA 4PDKA 2BBYA 2KJBA 5TRDA 5CVJA 2FNAA 4IRIA 4G7HF 2O03A 1MDMB 4I09A 3L2CA 2TDXA 2ZNYA 4UHTA 5E8GA 3REOA 3NEUA 2O6GE 4IRGA 2ETHA 3P9KA 4KICA 4MEXF 3M7GA 4IF4A 5CJ9A 5JI6A 2P4WA 4HW0A 1TQPA 1P4XA 5JFRA 1FOKA 1IF1A 1I27A 2OQGA 1IXSB 4EM1A 4HF1A 3CTAA 1ZGAA 4FHTA 1R1UA 4LD5A 4QLCU 4EJVA 3BJ6A 2Y0MA 3LA3A 3BPVA 3MWMA 2MC3A 4R8HA 1S7OA 4OOIA 2VODA 5LHGA 1HBXG 3QP5A 4L5JA 3RKYA 5E20A 2DK8A 1EH7A 1ON1A 1JXSA 2L02A 3V8KA 2R7FA 1B1BA 2RKHA 5E1ZB 3O6BB 3LFKA 2QYOA 5LEKA 1FZPB 2G7UA 5L3GA 3TOAA 2L01A 5CVIA 2PBIA 2LDUA 1HW2A 1YG2A 1IUYA 3FX3A 4I98B 2HQRA 2HR3A 4MHGA 3ZMZA 2L54A 2XASA 4WXCA 5IT9Z 1KGSA 1KYWA 5LHIA 1RZ4A 1P92A 3WTWC 1SFEA 5ILVA 4HLXA 3COAC 4ENMA 3F8MA 2RGVA 1H9TA 2NYXA 2CW0F 2FU4A 2VONA 1G6NA 2MLKA 4H0EA 2EFQA 4EM0B 4YIIA 5ICCA 4EJTA 2UXNA 3RKWA 3DV8A 3LA2A 3GFMA 1R36A 2X0LA 1STZA 1H0MA 4ZZDA 3J80K 4N9IA 5LHHA 4ZYDA 2A61A 1OMIA 1YW8A 3EYYA 1SD7A 3W6KB 5DD8A 2A6HF 4N0BA 3O3KA 1XDUA 3FXQA 1J2XA 4HZFA 1FC3A 2V1UA 3P9CA 4B8XA 1XSXA 1HKQA 3TO6A 1MJ9A 1K78B 4OINF 1MJAA 3M8FA 3IWZA 5BMZA 4LK0F 3CUOA 1LDKB 3B02A 5LGTA 1U5TA 4A0ZA 3NRVA 1G3SA 1R1TA 4DNCA 1O57A 1REPC 5D6EA 1BBYA 2EB7A 2OZ6A 4XSXF 3J7AO 1T6SA 2HTSA 2M30A 4OIQF 3HUGA 3EYIA 1XSVA 4I02A 4ASNA 1Z6RA 2VN2A 2FBIA 3JTGA 3EQLF 1I1GA 3DPLC 1GXQA 1MDMA 1SD4A 2YR2A 2GXGA 2XIGA 3WU0A 1JE8A 2GIVA 1JGSA 4G7OF 3ERED 1O3QA 2BYVE 3PQJA 2ZJ2A 2HS5A 4LGWA 2JT1A 3T0YA 2DT5A 3KP5A 2VT2A 1XN7A 2IRFG 4EJOA 4ZZLA 5J8CA 2K4BA 4LB5A 3IRQA 1OKRA 4M74A 3FM3A 4HAMA 4KFCA 4O3MA 4RB2C 1EV7A 1L0OC 4XRFA 2D1HA 3BP8A 2ZMEA 1IN7A 1W4MA 1Z6TA 5IT9K 3JAMZ 1F4KA 3L7WA 2KIMA 2QENA 4A5MA 4A0YA 3HSFA 2NNNA 1XDSA 3F22A 2W84A 2RVCA 5EEHA 1O3RA 1USSA 3F8CA 1E2XA 1R5GA 3RJPA 4RB0A 5BPDA 2VE8A 2M8EA 4CO8A 2A07F 3SXYA 2PEXA 4A12A 2DLLA 1FP1D 3WTUC 3H3UA 1W7PB 4G8XA 3SZPA 1O7LA 5CVVA 5BQTA 2H94A 2HEOA 2OD5A 3D5LA 3LSTA 2P7CB 4MEYF 2BGCA 2IA1A 3R60A 1IAWA 2XAHA 3PFIA 2XROA 4UNOA 2UXXA 1F5TA 1BIAA 1D3YA 4U0WA 2JPCA 3ISPA 1Z9CA 2O61A 4RGRA 3GYHX 1B9NA 3F6OA 4M73A 4IHSA 5DCMB 2EV5A 5L3DA 2FRHA 3E97A 3KP2A 4O5VA 5ILUA 3E5UA 4OIRF 4LK1F 1B4AA 4AIKA 2CO5A 3I64A 4HOBA 3T8RA 3BY6A 4GYGA 4PGHA 1UCRA 5D5XB 3RPUA 2GA1A 1BI0A 4NB5A 3F23A 1ZHFA 2OQRA 2D45A 4WWCA 4Q47A 2IW5A 2XRNA 1IN5A 2C6YA 1P4AA 3DKWA 2CQKA 3WTXC 1BM9A 1IRFA 3IHUA 3LQQA 3WGHA 4I0BA 3GO5A 2VOPA 3T5XA 3VFZA 1ZG1A 1YTYA 5D4SA 2QUFA 3JAMK 2ZBKA 2IP2A 2VOOA 3R6SA 1PP8F 2XKOA 2PI0A 5BOXA 2CG4A 2FSWA 4Y17A 4BHCA 4G7ZF 3GLXA 4D0PA 1KQ8A 3I54A 2XAJA 4U88A 3CUQB 2P6SA 2PMUA 3GZ5A 4ETSA 2IJLA 5E18F 4FX0A 4AIJA 1RNLA 1GHCA 5ED4A 2QQAA 3HRSA 4ZH4F 1GVJA 2E7WA 1RI7A 2EJRA 1IN8A 5HLGA 1E17A 1KQ9A 4YIFA 3RYPA 2CYYA 4I7HA 3GX4X 4KYWA 2PMHA 2Q2EA 4N9HA 4ENKA 3Q5FA 1PP7U 4P9FA 4DQ2A 1T39A 2DPDA 2HGCA 3JTHA 2M45A 2K02A 1KU2A 4KUMA 4M6YA 3QU3A 2PQ8A 2GA2A 5ICEA 3HOSA 3JSPA 1U6GA 2Z99A 1IZ1A 1U5TB 5DCFA 1QPMA 1G3YA 2JZYA 4HF0A 1ZG5A 4M72A 3KFWX 5DV5A 5FFZA 5F6FA 3ROUA 2JTVA 1PUEE 2GXBA 1WKMA 2WTEA 3Q9SA 3WG9A 4ZYHA 5CVUA 3E6MA 3J81Z 1H9GA 1KU3A 5K1YA 4LLNA 2QM3A 4B09A 3ZMTA 4GYIA 5L3CA 3GWZA 3OOPA 2PLYA 3R4KA 3I5UA 1DUXC 3LAJA 2A6EF 4UVBA 2LNBA 1YQAA 1WI9A 2RDPA 1T98A 3I58A 4R79A 3E5XA 1Q1HA 3DPTA 4M9ZA 3V7RA 2UZKA 1FNNA 4E70A 2HWVA 3MZYA 3DFGA 2HKXA 2P8TA 5DCMA 2ZMEB 5DUKA 3ZMDA 1QNTA 4CHUA 1WSUA 1YFHA 3RPQA 4XLPF 4M71A 3I53A 3F8NA 2FXAA 1R23A 4L0YB 2F5FA 4I2OA 1LEAA 2GQQA 1QGPA 1SD5A 1D8JA 5TJJA 5FO5A 3VOEA 3D0SA 2ZKZA 3N4MA 3K0LA 2Z3YA 1R58A 2M1BA 1XMKA 2D1VA 4XSZF 2ISYA
chains in the Genus database with same CATH superfamily
3I71A 4BJTA 3VYUB 1NK3P 4RB3C 3RI4A 1QBJA 2CWEA 1ITYA 2MD5A 5IT3A 4CH7A 4ABZA 1HA8A 1S29A 1IXCA 2ICWG 1P6RA 1BA5A 3RKXA 1ZN2A 4B1RA 1Z77A 2COBA 2X1DA 2LKPA 3R0JA 3VB2A 5CYVA 1MBHA 4DYQA 2EWNA 3H35A 3CQZJ 3OR1C 2EFNA 3P9IA 1WWXA 5CQEA 2XF6A 5JR3A 1XC5A 1YO5C 1RUOA 3F3XA 5FLXZ 5J40A 1MIJA 3G2BA 1XPXA 5D5VB 1K6OA 1IC8A 3C18A 2H8RA 2R7WA 2BY0A 1FYMA 3T8TA 2A3SA 2KL4A 2VJIA 1UG0A 3CUQA 3KEOA 5EG0A 2P5VA 2X1EA 5B1BH 1IXRC 2DOAA 2H6BA 3CLOA 4P55A 1T95A 3ZMUA 2GAUA 3A0BC 4XRMA 1FPQA 1Z67A 2CSOA 2CFOA 2WAFA 4ZYEA 4FX4A 2D5VA 2K40A 4G6QA 4A6EA 2XVCA 3KEQA 1HLVA 3GXOA 2DA7A 3PL8A 3CDLA 3UKGA 1POGA 4A6DA 4ZDOA 2FMLA 4PZJA 2A68F 3ONQA 5IYCJ 2DXIA 3I59B 4JOMA 3H5NA 3KE2A 1G59A 2HOEA 2XUBA 3VPRA 5GADJ 2Z2SB 3OS2A 4EMSA 1RIOH 4BGDA 1EA3A 2BVMA 3ZQ7A 2VJ4A 1IN4A 2W7NA 2BE5F 5BPIA 2E7XA 3MKLA 4Y52J 1Y56A 2E35A 1WJAA 4HPQA 5F0FA 3JRDA 4RAZA 3CMYA 2BY1A 1OYIA 3MZ8A 1Z7UA 4A3JJ 1R5ID 3HHHA 3QWLA 1XD7A 3J81K 2BW3A 1S7AA 1X4OA 3V4GA 5IOZA 3BJAA 1D0YA 3I4NJ 3VWBA 4HRIA 4IQJA 1J9IA 3KP6A 4LFUA 1FX7A 4NDLA 5K5OA 3ZQHA 4AVZA 2K27A 3OL4A 4HNUA 2P7VB 2V79A 3OYHA 5IOYA 1MNDA 1SMTA 1S6LA 4L9VA 1AWCA 1EH6A 5KVRA 1GVDA 4S04A 3MKWB 2V9VA 1X1CA 5JLWA 2BXYA 4JQFA 5E3NA 4GGGA 2Y75A 3G1OA 3ABTA 1BN5A 3ML6A 4HV5A 1W5TA 3IRRA 1XB4A 4IPAA 1SFKA 2MH2A 4LB6B 1JKOC 1U78A 2HOTA 4FT8A 4UUSB 4FCYA 3HB9A 2VI6A 4OIPF 2V6CA 1SD6A 4I0AA 4P9UA 2KZGA 1D8KA 3FXUA 3OIQA 2QZ8A 1TTYA 4V2GA 3HOXJ 1LB2A 2ZFWA 4Z2YA 1QQIA 2OBPA 3JRAA 2HZTA 4BE2A 2R7VA 1BI3A 4PGGA 3HOZJ 4BHPA 2J5PA 2FNPA 2LREA 3ZPLA 3KP7A 5IYBJ 3K69A 2PMZA 3FMQA 4A93J 2FOKA 3S8PA 2DMTA 5E17F 2E1OA 4UXNA 3A1YA 5L3BA 3GZ6A 2E19A 4EJWA 2H6CA 3DTEA 2VBZA 1GXPA 3PQKA 4KN7X 2LBFA 2P6TA 3OV8A 3P7NA 2HXIA 3WHBA 4LMYA 4UB8C 3BTIA 3FHZA 4EGZA 3M4OJ 2OTJI 1RUNA 2F48A 5JHFA 2R93J 5JVGF 2L5QA 3SEQA 1SFOJ 1T0FC 2M9HA 2FA5A 5F1RA 2RC4A 3AAFA 3DEWA 3L1PA 3Q9VA 3AL0C 4RGUA 4BH9A 2A69F 3N97A 3ESWB 2VE9A 4MQVA 2PMZN 4HA8A 4MGRA 5CPRB 5L3EA 1OCZH 4HX7A 2KIFA 1LVAA 3PO2J 1EKEA 4RB1A 2X6XA 1WHUA 2XF7A 2H27A 2LTPA 3QPTA 2R5YA 1LNWA 2QLZA 3HEFA 3BQZA 4B44A 3HL2A 4CCJA 5C4JJ 1J5YA 2ISZA 3KLOA 3BR3A 3DP7A 4BBRJ 3WGGA 1BIBA 5KK1A 4CYCB 5EJCA 4J01A 2EIMH 4BQNA 4IXAA 1FIPA 2LYCA 5FLXK 3GFLA 2Q2EB 3K9TA 1USTA 4L5IA 2XKPA 5L3FA 4XONA 2JUGA 4U7DA 1CGPA 3JRHA 4UUTA 5J1RA 1ERDA 1UZCA 3QOPA 4MFDA 3SYTA 1I50J 4KMUX 4AIHA 2K9LA 4EV0A 2WADA 2EV0A 1XMAA 3IH4A 5GPAA 1K7AA 2Y0SA 2V1DA 1ZR4A 4DBRA 3EPZA 1HXDA 2QBYB 2WV0A 3H5RA 4C2UA 3SFZA 2R7TA 5A2QZ 4XQFA 5FB2A 2E60A 3LSPA 2DFHA 2QKLB 4RMNA 4Q48A 1FBQA 3NARA 1QZYA 3DBHB 4X1EA 1HKTA 2FBKA 1LE8A 5DTDA 1OCPA 4L0ZB 1DU6A 4DW6A 1HQCA 2HYGD 3TDZC 3K4LA 2BHZA 3K4CA 2F5EA 2K85A 4DZJA 4P5OA 3U2RA 4ZC3A 3M1EA 3VYTB 5LGUA 1TC3C 1M1EB 2LY1A 2GBYA 3M9AA 3E6CC 4LJZF 4RM3A 4Z6YA 2L3DA 1WH5A 2Y0SN 4C3IJ 1O3TA 1GLNA 2FEZA 5LFAA 3V8JA 3E6BA 2HI3A 1Y1VJ 4BAYA 3H0DA 3RDIA 5J8FA 1U2WA 3JSOA 4ZYGA 1DDNA 4KIGA 5DD4A 5H6RA 5BS6A 3BLYA 4ZDPA 2MW8A 2R7SA 2VUMJ 2VXZA 2W57A 3HIFA 2AXLA 3JCUC 2XGXA 4CDGA 3K2AA 3JRIA 2X6WA 4BY1J 3PJRA 5ERIA 1D1BA 1Y6IA 1PDNC 3I0TA 5JHUA 3L00A 5GPCA 3SDBA 3BTCA 5J1UA 4DJAA 5EF6A 2AQFA 3ZGKA 3H92A 1RKTA 2X1CA 3DPUA 1OYWA 2JRMA 3I59A 3KZZA 3ZQCA 3ASNH 3S1NJ 1S5LC 4YIRX 4IHVA 2PX9A 1QVUA 3HTUA 2CW8A 5HOOA 3OWTA 2OC6A 5F0HA 3M8EA 4XKVA 1ZLJA 5F0CA 2CUEA 5F08A 1ETQA 3S3NA 3B6CA 4G6DA 2GLOA 2M0CA 3W2VA 1FOYA 3GF2A 4QWQA 1ZG3A 5E3OA 5E1XA 1ON2A 5GTHC 2DA1A 2XSJC 1A6IA 2EZLA 4ESBA 3CD6I 4WX9A 3GTOJ 3TOBA 2ZXHA 3P5JA 2V7FA 2QSGX 5H6QA 5M5YJ 4CICA 1MBKA 1FSEA 2NXNB 1RC9A 4U0YA 1FEXA 1CF7B 4MQ9F 2HDCA 4UUVA 3GEZA 3WE2A 2MC4A 4KT5C 4D9JA 4WK8F 3JRGA 3HYIA 4LG0B 3KZYA 4PUSA 4G94A 4V2FA 4E7LA 3OYGA 5FLMJ 1ETOA 5FKOA 2IA0A 1TWAJ 3QPHA 1ZH5A 2R7DA 3E1SA 4RAFA 5HS8A 1YITI 2DMQA 2DAOA 1TP4A 1TZLA 2D2WA 5F64A 3OYIA 4G9YA 4HX8A 2FUG2 2KRCA 4XL9A 4OWRB 1ZGJA 4GCVA 1S72I 1YW9A 6PAXA 2BXZA 1G3WA 3Q0VA 5AIPA 3WHCA 3NWTA 2LKSA 4NQWA 2YS9A 2UWMA 1X1PA 2HPIA 1Q1VA 2KFDA 3R61A 1XMXA 1AU7A 4KISA 4ESFA 2EA4A 2CQNA 2RQPA 3G1MA 2E5ZA 2A5YB 5HDKA 1ZRFA 2HQNA 4UB6C 2NVQJ 2RNJA 9ANTA 1WJDA 2BV6A 3D1NI 4EM2A 2RNGA 3C1DA 2B7EA 1GT0C 1U8BA 4HLYA 4BHBA 5HS7A 3K1NA 2KRHA 3WTSC 2IA2A 2XAUA 2YSRA 3LSKA 3KETA 5EEGA 2K86A 2MYSA 2VQCA 1I6HJ 4HSRA 4WF2A 4PJMA 3MFKA 1LFBA 1TT5B 1JUMA 1J7KA 3SZTA 3BZ6A 4CXFA 2AHQA 1S8NA 1MMSA 2DA2A 1UMQA 2VBWA 2X6OA 2Y9YA 1QO0D 4IL6C 3VEPA 3WGIA 2Q0OA 5A2QK 4A3FJ 2IT0A 2NVYJ 4AVPA 3HSEA 3PIPF 4A3GJ 2I10A 2BHYA 1U9OA 3MMYB 4WXDA 3JRCA 1PYVA 1LFPA 1HKSA 1XG1A 4BEHB 2HPMA 1HF0A 2M7BA 2P5KA 4WXHA 2HQ5A 4RLQA 1WZ2A 4YG2F 2Z16A 3Q0WA 4DYCA 4IVNA 2DT7B 2EFWA 3EETA 4BXXJ 2NOGA 3FWEA 3B6AA 1TW3A 2KP6A 4CGZA 2FQ3A 4XOPA 4CYCA 2O0YA 1SFXA 1NG7A 1BC7C 3VDXA 1TBXA 3LSGA 1J59A 2WBMA 4BYYA 1PJRA 1F36A 4XN0A 1AOYA 3AG2H 2HXOA 1AKHB 1A36A 4BBSJ 3O8HA 2DTZA 4HBLA 3ZRGA 2KHMA 3ZQGA 1P7IA 2NNYA 2NRAC 2ZO4A 3FXRA 4E7IA 2GWRA 4LIUA 1U3EM 4XOTA 3F6VA 3CF5F 1QA6A 4U0VA 4F92B 1TT0A 1NK2P 4XLFA 5LBQA 1EH8A 2W24A 1RESA 2OA4A 2VC1A 3OYAA 4B47A 3E7LA 3QAHA 1VI0A 3WU1B 2QBYA 2MLGA 4HQEA 4ZJZA 3RZDJ 4HX4A 4B4CA 2F5VA 3LSJA 4ZTJA 1MJBA 3WTYC 1HDDC 3EDPA 3KLNA 5M5XJ 4D1QA 2DK5A 3LQRA 5JLXA 1DP7P 4MTDA 1E3HA 3QP6A 3U1DA 2QQBA 3HOTA 1SAXA 3GZNB 1YJWI 3HDDA 1QZZA 4HNTA 2RREA 3EUHA 1HDPA 1YS7A 5E1WA 3S1MJ 1TWFJ 1UB9A 1MBFA 3WE3A 1IDYA 1BOAA 2TCTA 5GTIC 5DYMA 3W6VA 2LSOA 1U8RA 2HDWA 2LC2A 2R7OA 2W25A 2DOEA 1V5FA 1P2FA 3VODA 4IHTA 2EZKA 1V4RA 1UHMA 1Z21A 2XPVA 3OS1A 4V19K 1D5YA 3O2PE 1W1WE 4Q5SF 3FF5A 4HEA2 1SVLA 2H1KA 3GTKJ 3GTPJ 4LLGF 1KZHA 4Y15A 2KMUA 3C3WA 4M9SA 2EFOA 1B8IB 2HKOA 1B9MA 3HM5A 2QQ9A 3TDUC 4LLLA 2LBFB 1C0WA 2L4AA 3W6JB 2IXSA 4I76A 3TGNA 2PJRA 1LVKA 5C4XJ 3TP0A 3SEZA 4OAZA 4A5NA 4B3XA 4PSWA 5M3FJ 1JTXA 5D6FA 5GAHJ 4JK1X 3JW4A 2JSCA 4AYBA 2DTRA 4P1WA 1WJ5A 2FX0A 4HF2A 3ABUA 1R4MB 1O7FA 4KMFA 1ZYRF 5E3LA 5DEQA 2YX7A 3MCZA 1FP2A 4F93B 2FE3A 4K2EA 3W3CA 2XHKA 3NWSA 2DJIA 1ZR2A 1W0UA 4PCQA 3ZMVA 1J0RA 2OU2A 5EZHA 3RCOA 2GIZA 3O8GA 3LAPA 4BNCA 2FMYA 4DYRA 4BKXA 2VPRA 2EINH 2Z5UA 1CF7A 2XAGA 4HNVA 1ZQ3P 3ZP5A 4HDVA 2R5ZA 2W4SA 3BG3A 2M3AA 3HSRA 2CQXA 1YW7A 1ZLKA 4LG0A 3F9KA 1JKPC 5EDNA 4EVIA 4OMZA 2MA3A 3PNVA 2VPLA 3C2GA 4AYBN 4ON0A 1HC8A 1JHFA 2O3FA 3LA7A 3VYSB 2JK3A 3KPHA 4A0XA 4YFNF 3IAM2 3GUDA 1PUFB 5J6XA 2PN6A 1WGXA 2AS5F 4RAYA 4XIDA 2XV4S 1ULYA 2LF8A 3KYLA 5K5QA 3IAS2 3KIOA 2BVLA 4CYDA 3G6EI 3TW7A 3ZXSA 1SAUA 3H1CA 3WTTC 4JBAA 2JN6A 2QVOA 1LE8B 1QVTA 2B0LA 1APLC 3QPLA 1ZREA 2KJCA 5HDNA 2QF7A 1OPCA 4P96A 3SQNA 2VBXA 1MD0A 2E2HJ 2V1XA 5E8IA 1FOWA 4XRSG 1VQ8I 1MH4A 3IL2A 1D5VA 2GZWA 1MMDA 2ZXJA 1MBJA 1WCMJ 3GFIA 2DQLA 3BZKA 1FIAA 3G73A 2PJPA 1MKMA 4OU0A 2STTA 4KDPA 1BL0A 3GW2A 2DFEA 2WV1A 1QRYA 3GMEA 3BDDA 1ETVA 2DU9A 3CCLI 2ACJA 1YIOA 3OIOA 1KU9A 4CZZA 2EPFA 3K4JA 3TL4X 2JRTA 3CUQC 3GTJJ 2DDBA 2EFPA 1HW5A 2UUZA 3I56I 1Z05A 2O8XA 2OAZA 2HQAA 4C2TA 3WTZA 2WA0A 1K79A 4A3EJ 4L9TA 3HOUJ 2Q1ZB 4E7KA 2M87A 3FK6A 4BEHA 3KCCA 3OYNA 3CO6C 1ZRDA 2QSHX 1WRJA 4C9YA 3PUBA 3HRUA 3TO7A 2XRLA 1GDTA 3RYRA 4BDZA 2ELKA 2R3SA 4HYEA 4XK4A 3KX2A 1ZAOA 1H88C 2E1MC 1JJ8C 4KJZA 3BPXA 5HS9A 2NOJB 4XLAA 1VZ0A 1S7EA 2ME6A 4EQQA 1YX3A 4N4NB 3CO7C 5DUIA 4C3HJ 2YU3A 2DA4A 3W2WA 2PFBA 2Y31A 1AKHA 4E7SA 4D7MA 5JVTA 2L0KA 2VASA 2LVSA 5H20A 1NHAA 2MBFA 2HYFA 2MH9A 2J5OA 3BZCA 2JA5J 1JKRC 3V7SA 2HTJA 3ECHA 2AQEA 2NAZA 1BR1A 2K7LA 3MEXA 1SFUA 5FD5A 3W2AA 5D4RA 2VIXA 1FYKA 5C3EJ 2OZUA 2RV8A 4KA4A 1ZKGA 2HFHA 3I4PA 1R1VA 1WI3A 4AD9A 1DPRA 2XF5A 5K7ZA 5F1JA 5LGNA 1OISA 1MBGA 1S9HA 2KISA 4QSHA 4Y33A 4CCMA 5IP6A 4IHWA 2XPUA 3E5QA 3D5SC 1J75A 4II2A 1Z1DA 2E1CA 1XGMA 4UVAA 1U5TC 2WY8Q 4ENNA 3LWFA 5CQGA 4BUPA 3T1BA 4M3BA 1FBUA 3S16J 1BC8C 2OPTA 1OCCH 1UHWA 4M9XA 2Z33A 3OYFA 3V8LA 3CLQA 5CLSA 2CU7A 2IVMA 2ID6A 1VQPI 4PJNA 2LY9A 1W7PD 1N77A 5AIQA 3CJTB 4UV8A 1MMNA 1TW2A 5D5UB 3QRFF 5D5WB 1YYVA 2V9KA 4NQWB 2EBIA 2XAFA 3HRMA 1R00A 3I55I 1YLFA 1ETYA 5DM7F 2KKOA 4IOAF 3K1MA 1HOMA 1RETA 1B8IA 2BZTA 2JVHA 3LSMA 2Q8KA 4XBFA 2CUZA 1O3SA 3LFUA 3S2WA 3IKVA 5DDGA 3PUFA 2F4MB 3RIRA 2DYRH 4H4KC 1HW1A 1FSHA 1X1DA 3DBRB 3J7YJ 3HZJA 2YX4A 1HSTA 5D8LB 2DMUA 3BR1A 2O9LA 4CCKA 2EK5A 2HOAA 1WQ2A 2ID3A 4Q4ZF 2ADUA 1VQ4I 2M7AA 2BEOA 3IH3A 2DBBA 3IC7A 1DU0A 4A3BJ 1UG2A 4XN3A 1IJWC 2DFFA 3QOEA 3ZMSA 5KAFC 1I39A 5E3MA 3ECOA 1IRGA 2KDOA 1T38A 3BG5A 3OIPA 3PSIA 1F1ZA 1SVOA 4YELA 1T0FA 2M0MA 3WTVC 4F7ZA 1J09A 2P5LC 5D8KB 4F3QA 1Y8QB 2LR8A 2CGPA 4R1HA 2EA2A 2QSFX 2XAQA 2O8KA 1R5HA 2ZMEC 1FT9A 1FWZA 2FOWA 2H09A 3DF8A 3H3ZA 2BOLA 3AKZA 1P9QC 3ZQLA 4CSWA 1F9NA 3U1KA 1B72A 4QTRA 3CCSI 3MQ0A 1G3TA 3CMEI 4KT6A 4KIBA 1TWGJ 3IP4B 1V54H 1DPUA 3U9GA 2KQRA 1BW5A 2DN0A 5LLQA 3L2VA 1ODDA 2W00A 4XM3A 1JHHA 4RAGA 2WWYA 4XICA 1MGTA 3DTKA 4F52A 2ZSHB 3E3VA 1PUFA 2HZDA 1IN6A 1Z7LA 4ESJA 4ENJA 5ILSA 4IRHA 4I01A 1KONA 2CUJA 2DCEA 2VKHA 3DWLE 4UVCA 1P7JA 1VTNC 1Y0NA 4NHJA 1LQ1A 3B73A 2IAIA 1BR4A 2RN7A 4CCNA 2LF7A 4JX6A 1FY7A 1LEBA 4KNYA 3OSFA 2I8DA 2X9DA 4HDUA 1A5JA 4AIDA 2DO7A 4BXUA 3K7AJ 2R7QA 3PFYA 2A05A 2VKDA 4BY7J 4M6XA 3BROA 1HSJA 2L4MA 4HV6A 4RS8A 1KQ0A 1OCTC 5HLHA 4XRSA 4XLEA 2K4JA 3I3LA 3IWFA 5AONA 3CESA 1ETWA 1BOBA 1BJAA 2E2JJ 3BR0A 3RSNA 3BWGA 1Y39A 3BOQA 5FKNA 5HVQC 2ZXWH 5F27A 1LDJA 5FKKA 5DM6F 5EZGA 2R4GA 5FGMA 2QGUA 2KIQA 3OSGA 2EZHA 4MTEA 2K9NA 3SDGA 1ACIA 3SZGA 4XKWA 1G4DA 2CV1A 2HNHA 3K6GA 2EQRA 2FBHA 1I3AA 3LMMA 3ZN0A 1EF4A 2KIUA 2PJRB 4IZZA 2OJED 4HG2A 1GV5A 2X4HA 3FMSA 3HBLA 1KYZA 2IPQX 1Y0UA 1XCBA 3MZHA 5KAIC 2YPRA 1ZRCA 1TQMA 1TWHJ 3FM5A 2VBYA 3GCMA 1PVEA 2XGDA 2FF4A 3KYDB 3QPSA 3VSKA 3VYRB 1I1SA 2LK2A 2Z1DA 2ELHA 4L5EA 2DJNA 1T8IA 4OMYA 3H9QA 4RGSA 2CQ7A 1EJ9A 5K5RA 2ZCWA 1A6QA 1IW7F 1FYLA 1K83J 3MD2A 1X19A 4FISA 4BQAA 3GFJA 2PG4A 3R0AA 2K3FA 1S3JA 1XCVA 1WVRA 3DXJF 3K2ZA 3KP3A 2CFXA 3ULQB 1G2HA 4HQMA 5LEJA 1BI2A 1ZARA 3HRTA 3L09A 2ZJPF 4NBQA 1TQIA 2R5ZB 4ZYAA 3QU6A 3JREA 4JP0A 4NUBA 2EH3A 4DZPA 4U7BA 1BI1A 1R7JA 3EUKL 3F72A 1Y8RB 1XGNA 2M34A 4XLNF 3F21A 2G9WA 5C44J 2R7ZJ 4NC7A 4UV9A 3IH2A 4BXFA 5B66C 5FD6A 3WODF 1KA8A 4AC0A 5KCMA 3HHGA 3GVAA 3ELKA 5LRRA 3HPHA 1K78A 4BDYA 3TKYA 4F91B 2FQ4A 4AWXB 1H89C 3E0JB 4BJ5C 1KU7A 1R22A 4GO1A 1B6AA 3CJNA 3H9GA 2WB1A 2IGKA 2IGNA 1XSDA 2JJ7A 1TNTA 3TEDA 4WCGA 4GXOA 1OCRH 4BL0B 5K7HA 1W0TA 3TMOA 1V5EA 2STWA 2X6YA 1I5ZA 1ORKA 3DQVC 1LDDA 3FBNB 5ICGA 4L18B 1X58A 4PJ0C 2KRFA 1IUFA 3F8FA 3FXLA 3I9V2 1SMYF 4IHXA 1OR7A 5HLIA 2VC0A 5H2FC 2JA2A 1TNSA 1YS6A 2DFIA 2P0WA 3QYFA 4Y13A 1K4SA 4RGXA 4YFXF 1LKXA 1X3UA 1FBSA 5J4YA 1X2MA 2WB1N 4ZTFA 1YJNI 2DI3A 1N75A 2COMA 1E3OC 3H0GJ 5LRSA 3NQOA 3PNTA 3RKQA 3TO9A 4OIOF 4EJUA 1X1AA 3V7CA 3ZQIA 2B63J 3BT9A 1W5CC 2I5UA 2NS0A 5IPAA 1CQTA 3G3ZA 4YRVA 2LP0A 3HKZA 2CJJA 4MNUA 3HTSB 4LOCA 3FMRA 2VT3A 5FFXA 5GP9A 3CMMA 2F2EA 3S2DJ 1I6XA 4G12A 4L9NA 4RBOA 5TISC 3A02A 3A4CA 1OYYA 4XORA 1JKQC 3CDHA 3S32A 4W1UA 2FJ1A 2G7HA 1OQYA 3L2RA 3C7JA 5FLVA 1U0JA 4LG3A 3G1LA 1W5SA 1WJCA 4L9JA 3H36A 2F5DA 3JR9A 4YFKF 1JGGA 4Y7NJ 3DCFA 3MKZA 2BY2A 2GOMA 4A3MJ 1R9TJ 1L3LA 1P4WA 2ESNA 4CZCA 1MZBA 1YRNB 3F8BA 4D5CA 4ZDLA 1X1BA 1Z91A 4BQQA 2F5CA 3HKZN 3LSIA 1X3ZB 2ZB9A 3ABMH 1LJ9A 3OS0A 4IKFA 2UV1A 5HODA 5B1AH 1FLIA 2GXAA 4PK4A 1B59A 2X48A 3FZVA 3M07A 5KHDA 2ESHA 1MNEA 4O6JA 3CDIA 1ONVA 5ICFA 3TQNA 3DKXA 1TLHB 2WC2A 1XGSA 3OYDA 3G4SI 3CZ6A 3CCJI 1XGOA 1V3FA 2EV6A 3QQAA 3CCMI 2M2EA 2W85A 2QWWA 3RTRA 1ZTRA 3IKTA 2Y48A 3DTIA 4PJLA 2DQRA 4AUXA 2JPBA 4TV7A 4A2UA 5HDGA 3HOYJ 3PM1A 3E6DA 4S05A 2X51A 5FJ8J 3BJOA 3J7ZI 1T2KA 1NH3A 2E1NA 2ECBA 2ZNZA 3EUHC 2CUFA 1YX5A 2EIJH 1DGWY 4JYKA 3ZN1A 3L9FA 3FKJA 3DEUA 4IQ4A 4IJAA 2XDVA 4KN4X 2L7MP 3RQ4A 2R7XA 1A04A 2M4GA 2M5WA 1DP3A 1T08B 3SFIA 4IX7A 1UFMA 3BR6A 4FETA 3C2HA 1ETXA 1VQMI 3FKIJ 5FROA 2DPUA 1W7PA 2M4KA 4J00A 3KP4A 2CV2A 3J80Z 4UY8I 4KIFA 2Z9OA 2H1LA 1ZK8A 2L7FP 3GBGA 2V4JC 2DDAA 2JA7J 2R7UA 2L7ZA 5CVRA 2DW4A 1BW6A 3K1PA 3MAJA 3MN2A 3N05A 3SHFA 4EGYA 4PDKA 1IRZA 2BBYA 2KJBA 5TRDA 1VFCA 5CVJA 2LLKA 5DS9A 2FNAA 4IRIA 2NS7A 4G7HF 2O03A 1MDMB 3Q0UA 3BQYA 4I09A 1IO2A 3KZIC 5GAGJ 2ZFUA 3L2CA 1MSFC 3OMYA 2QQ8A 3WG7H 2TDXA 5HNHA 2ZNYA 4UHTA 5B5EC 5E8GA 4KITB 2R7RA 2W82A 3ABKH 3REOA 1R71A 3NEUA 2O6GE 4IRGA 1XTAA 2ETHA 3P9KA 2JSPA 1VQKI 2JA8J 4KICA 4MEXF 3M7GA 1XS9A 4IF4A 4XLHA 2WY7Q 3AL0B 2MFZA 5CJ9A 1IG7A 2HYJA 3JRBA 1JJ6C 3H3VK 2XGEA 1BJZA 5JI6A 3S15J 2P4WA 4HW0A 1TQPA 1P4XA 2VL8A 4N4OB 2LH9A 5JFRA 1B72B 2L9RA 1FOKA 2WAEA 1IF1A 1I27A 3FDYA 2OQGA 1IXSB 4EM1A 4HF1A 2GM4A 3CTAA 2K9QA 3D5RC 1ZGAA 2O5RA 4FHTA 1ETKA 1R1UA 3OYJA 3L2WA 4LD5A 1MMGA 4FE7A 4QLCU 4EJVA 5FKLA 3BJ6A 2Y0MA 2MSYA 3LA3A 3LL7A 3BPVA 3MWMA 2MC3A 2VQLA 2Y69H 4R8HA 1S7OA 4OOIA 3GTGJ 1IDZA 3RPUD 3LSHA 4IO9F 2VODA 5LHGA 1HBXG 1OCOH 1MNMC 3QP5A 4L5JA 3RKYA 5E20A 1FOXA 2IGMA 4I99C 2DK8A 4A3KJ 2IS4A 1EH7A 1ON1A 1JXSA 2E71A 2L02A 1SC7A 3V8KA 1U9NA 2R7FA 1B1BA 2RKHA 4FE4A 5FRNA 3BG7A 2CMPA 4A3LJ 5E1ZB 3O6BB 3LFKA 2QYOA 2IS2A 2KT0A 2G0EA 5LEKA 1FZPB 2G7UA 5L3GA 3AG4H 3TOAA 2WAQA 3ABLH 4M3FA 1JI8A 5BNGA 2L01A 2L7KA 5CVIA 2EILH 2PBIA 4PSXA 2LDUA 1HW2A 1YG2A 1IUYA 3FX3A 4I98B 4HSTA 3HXLA 1OFCX 2HQRA 2NVUB 2HR3A 4MHGA 1N25A 3ZMZA 2L54A 1RRJA 4XNFA 2XASA 4WXCA 4BS9A 5IT9Z 2Y2ZA 1MW7A 2K5CA 1FJLA 1X2NA 1KGSA 1KYWA 3ZR8X 5LHIA 2XSDC 4X6AJ 1LPQA 1LUJB 5J1YA 1T33A 1RZ4A 2QKMB 1P92A 1JT0A 2WAQN 3WTWC 1SFEA 2OCCH 5IY5H 1V55H 5ILVA 3JRFA 4GFBA 2V26A 4HLXA 3COAC 4ENMA 3F8MA 2RGVA 4LIVA 4QPOA 1H9TA 5HLTA 1X4PA 2NYXA 2ZSIB 2CW0F 2FU4A 2XPWA 2VONA 1G6NA 1QU3A 1JT6A 2MLKA 4H0EA 2CQQA 2EFQA 3H5AA 4M3DA 4EM0B 3VSLA 4YIIA 5ICCA 4BE1A 4EJTA 2UXNA 1GV2A 3RKWA 3DV8A 4ITVA 1YRNA 3LA2A 3GFMA 2JUCA 3OYLA 3S2HJ 1R36A 3LSRA 2OCEA 2X0LA 4DGWB 4DIQA 3S17J 3TW6A 3OYMA 1STZA 1WPKA 1H0MA 4FASD 4ZZDA 3J80K 4N9IA 5LHHA 4PFPA 1WFXA 1OMIA 2A61A 1YW8A 4ZYDA 3EYYA 1SD7A 4X0GA 3W6KB 3S3OA 3F0CA 5DD8A 4B3AA 1DGRM 5LD2C 2A6HF 1H8AC 3BR5A 1Z3XA 4N0BA 4BJ6C 3O3KA 2VB6A 3K4NA 1XDUA 1QHHD 3FXQA 1J2XA 1JTYA 3K10A 4HZFA 1FC3A 2V1UA 3P9CA 3DU6A 4B8XA 1XSXA 1HKQA 3TO6A 1MJ9A 1WH7A 3BC8A 3QODA 3X2QH 1K78B 2L9SA 2X85A 2TRTA 1VQ9I 1UELB 4CA0A 2GOXB 3ASOH 4OINF 1MJAA 1VNDA 2HVQA 2AXTC 3M8FA 2N8GA 3IWZA 5BMZA 4LK0F 3CUOA 1LDKB 3B02A 5LGTA 4IOCF 1U5TA 4A0ZA 3ERMA 3BCAA 3NRVA 1G3SA 1WJBA 2ZJQF 3PNYA 1R1TA 4DNCA 1O57A 4D5FA 3BR2A 5D6EA 1YHQI 1REPC 1BBYA 4RM2A 2EB7A 2OZ6A 3C2BA 1ENHA 3V42A 4XSXF 1ZELA 3DLLF 3J7AO 1T6SA 2JWTA 4XLCA 3DLAA 2HTSA 2M30A 2DA3A 2CH0A 4JX5A 4OIQF 2YUSA 3HUGA 3LOCA 3EYIA 2DMNA 5GAEJ 1XSVA 3FK7A 4I02A 3G71I 1JUPA 3HGGA 4ASNA 2HVRA 3OYKA 1Z6RA 2VN2A 2FBIA 2HDDA 2IBDA 4E7ZA 2IEKA 2ME0A 3CCEI 3JTGA 3AG1H 3EQLF 1I1GA 1AHDP 3DPLC 1GXQA 4U87A 3S3MA 1MDMA 1SD4A 4W97A 1FMWA 2HOSA 2YR2A 2DA5A 2GXGA 3OR2C 2XIGA 3WU0A 3S14J 1JE8A 3QYEA 2GIVA 1JGSA 4G7OF 3ERED 1UJ8A 2VJ5A 1O3QA 2BYVE 3PQJA 5CKTA 1K4TA 2ZJ2A 1FMVA 2HS5A 4LGWA 2JT1A 4S0HB 3OOUA 3CJQB 3T0YA 3CCQI 2DT5A 3KP5A 2L9NA 3OY9A 2VT2A 3BG6A 1XN7A 2IRFG 2RAEA 4EJOA 4ZZLA 5J8CA 1QHGA 2Y9ZA 5EGOA 2K4BA 4LB5A 2NVTJ 3IRQA 1OKRA 4M74A 1GUUA 3FM3A 4HAMA 1IV8A 4MLOA 4KFCA 1UHSA 2KZVA 2DODA 3TBIA 4O3MA 1EV7A 2K9SA 4RB2C 1L0OC 4XRFA 1HCRA 3DKYA 3S1RJ 2D1HA 3FIWA 2B9SA 3BP8A 2ZMEA 3ZOBA 3OYBA 1IN7A 2FD5A 4GDFA 1VF9A 2YU9J 1W4MA 2ZJRF 1Y1WJ 1Z6TA 2ZXIA 3BTLA 5IT9K 3HG9A 3HGYA 4QPQA 3FBIB 3GTMJ 3JAMZ 1MH3A 1F4KA 3L7WA 2KIMA 4E6KG 2QENA 4A5MA 3K70C 2CW7A 4A0YA 2IS6A 4YEJA 3HSFA 2NNNA 1XDSA 4I6ZA 3F22A 2W84A 2RVCA 2CRGA 5EEHA 1O3RA 2LD5A 1USSA 5E79C 3F8CA 3FXJA 4F55A 3BCBA 3AFHA 1E2XA 5EYRA 5FRMA 3L2QA 1R5GA 3HOWJ 4OAYA 4BU2A 3RJPA 4RB0A 4E4HA 5BPDA 2VQHA 2QEXI 1R6RA 2EIKH 3UNGC 5HNFA 2VE8A 2M8EA 4CO8A 2A07F 5IP7J 1F43A 3SXYA 1UAAA 1SVMA 2PEXA 3Q3SA 3CCYA 4A12A 2DLLA 1FP1D 3BTJA 4M3EA 3WTUC 1D1CA 3H3UA 2VJJA 2CV0A 5B3SH 1W7PB 2EZIA 4G8XA 3SZPA 2R0QC 1O7LA 5CVVA 3HC7A 2M8GX 5BQTA 2H94A 2XB5A 3M1CA 2HEOA 2OD5A 1MSEC 4PFOA 4M3GA 4C30A 4CUGA 3D5LA 1YE9A 3LSTA 2P7CB 2V9PA 2A6TA 2KPMA 4EEFG 2L2OA 3M8JA 1X3WB 3IUOA 2MABA 1SANA 4MEYF 2BGCA 2IA1A 2VKEA 3R60A 3LNQA 1R4NB 2P81A 1VQNI 4Y4RA 5IP9J 1IAWA 2MGQA 2XAHA 3PFIA 2XROA 4UNOA 2UXXA 1AA7A 3DBLB 1W36C 4EATA 1F5TA 1E3PA 2VQGA 1IGNA 3CCRI 1BIAA 4FTHA 2MD0A 3IV5A 1D3YA 4IEJA 4U0WA 2JPCA 1FTZA 3A01B 3FISA 3ISPA 2QCOA 3DU5A 2JQ7A 1Z9CA 2O61A 3FXKA 4RGRA 4BACA 2V6EA 4D7NA 1VQ6I 3GYHX 3HJEA 1K61A 1B9NA 3BG9A 5F04A 3F6OA 2DMPA 4M73A 4E7JA 4IHSA 5DCMB 4J19A 3S93A 2EV5A 5L3DA 2FRHA 2JVGA 2LG4A 3E97A 3HPGA 3KP2A 4O5VA 4XMYA 5ILUA 3FXOA 3L2UA 2OV7A 3S1QJ 1IRXA 3E5UA 4OIRF 4LK1F 1B4AA 4AIKA 2CO5A 3I64A 4HOBA 3T8RA 1A35A 1G8XA 1TWCJ 3BY6A 4GYGA 4A69C 3PSFA 1UCRA 4PGHA 5D5XB 3J7AY 3PIOF 3A2KA 2KDZA 3RPUA 2GA1A 1BI0A 4NB5A 1D0ZA 4UUSA 1ZHFA 1K6YA 2OQRA 3F23A 1IV6A 3GTQJ 4Y3OA 4XR6A 3A0HC 3CCVI 1Z3YA 1DQUA 2D45A 4WWCA 3PO3J 4M6VA 1FTTA 2LMDA 4AM3A 4Q47A 2IW5A 4NNJA 2XRNA 3OL3A 1IN5A 2C6YA 3FHNA 2ZC2A 1P4AA 3DKWA 1XX5A 1OR7C 2CQKA 4MIMA 3WTXC 1YJ9I 4XKBA 4QIWN 1BM9A 1IRFA 3IHUA 3LQQA 2ELJA 3WGHA 4I0BA 2AO9A 3GO5A 2VOPA 3T5XA 3VFZA 1ZG1A 3H9JA 1YTYA 5D4SA 2QUFA 3JAMK 2ZBKA 2HU9A 2IP2A 2VOOA 3R6SA 1PP8F 2XKOA 2PI0A 5BOXA 2CG4A 2W1OA 3CC4I 2A5WA 2XC7A 2XGCA 3I4MJ 2FSWA 4Y17A 4BHCA 4G7ZF 2HVSA 3GLXA 4D0PA 2NVXJ 4C2MJ 1KQ8A 4A3DJ 3I54A 2XAJA 4U88A 3AG3H 2ECCA 2LFBA 1YOVB 3CUQB 1RPWA 5EG0B 2K9MA 1N78A 2F6CA 2P6SA 2L9VA 2PMUA 4PJJA 3GZ5A 4ETSA 2IJLA 5E18F 2JA6J 3DEEA 2E5NA 4FX0A 4AIJA 1RNLA 3RZOJ 4BE0A 4C3JJ 5K7FA 1TL8A 1GHCA 2H8WA 2QQAA 5ED4A 3HRSA 3CF2A 4ZH4F 1GVJA 4RA2A 2E7WA 4XKCA 1RI7A 1OJLA 2W48A 1MBEA 2E1MB 2EJRA 1IN8A 5HLGA 1E17A 1Z0XA 1KQ9A 1LFUP 5J3LA 2BY3A 3FXMA 4YIFA 2F4IA 3OYCA 3RYPA 3CJRB 2CYYA 4I7HA 3GX4X 4KYWA 2PMHA 2Q2EA 1VQ5I 2IS1A 4N9HA 4ENKA 3Q5FA 1PP7U 2VXDA 4P9FA 4DQ2A 3K70D 3CC2I 1VQOI 1T39A 1O4XA 2DPDA 1T56A 2HGCA 3JTHA 2BW3B 2M45A 2K02A 1MMAA 2MG4A 1KU2A 1D1AA 4A3CJ 1RR7A 4II3A 4KUMA 5M3MJ 2VLAA 3EUAA 2DT6A 4M6YA 3QU3A 5M5WJ 2PQ8A 1NG6A 2GA2A 5ICEA 3KYCB 3HOSA 3JSPA 1U6GA 3ZQFA 4CCOA 2OF7A 1WJFA 2Z99A 3SJMA 1IZ1A 2E34A 1U5TB 5DCFA 1QPMA 2DA6A 1G3YA 2JZYA 4HF0A 4RDUA 1YI2I 1ZG5A 4M72A 1QPIA 2JMWA 5EEAA 3KFWX 5DV5A 5FFZA 5F6FA 3CP2A 3ROUA 2JTVA 1PUEE 3HOVJ 4E7HA 2GXBA 1WKMA 2E2IJ 5FKMA 2IGOA 3HUGB 2WTEA 3ZCOA 4G6TB 3Q9SA 5J47A 3WG9A 1NTCA 4ZYHA 3QYBA 5CVUA 2XB0X 1WJEA 3E6MA 1VQLI 3A03A 3J81Z 2VKVA 3K4KA 1H9GA 4DOZA 2E36A 3WU2C 1KU3A 4ANJA 5K1YA 4LLNA 2QM3A 4B09A 3ZMTA 1QZEA 1SEUA 4GYIA 4CCLA 2OTLI 4LITA 2F4OB 5L3CA 1RR8C 3GWZA 4IHYA 3OOPA 2PLYA 4MFEA 1VQ7I 3R4KA 3I5UA 1DUXC 4B43A 2K3PA 3LAJA 2A6EF 4NC8A 3GLLA 3K4BA 1W36D 4UVBA 2LNBA 4MO7A 1YQAA 3M3YJ 2LY2A 1WI9A 2RDPA 1T98A 3I58A 4R79A 3E5XA 1R49A 1Q1HA 3DPTA 2OUMA 4M9ZA 5EGOB 3A01A 4BQOA 3V7RA 2Y30A 2V1NA 2UZKA 4NC6A 2LRDA 1YIJI 3OYEA 4A3IJ 1FNNA 4E70A 2HWVA 4AU7A 3MZYA 2R92J 3DFGA 3CP8A 2HKXA 2P8TA 3MVPA 5DCMA 1I3QJ 2R5YB 3CCUI 2ZMEB 2DYSH 3TP3A 5DUKA 4FQGA 3ZMDA 3KEYA 5KNLA 1QNTA 4RLFA 4CHUA 1JUSA 3CMAI 2LOOA 1WSUA 3RQIA 1YFHA 3RPQA 1OLTA 4XLPF 3U21A 1BR2A 4M71A 3I53A 4JX4A 1ZGWA 3F8NA 4DBQA 3CC7I 2FXAA 1R23A 2DOFA 3UR3C 4L0YB 2F5FA 2RQQA 3NAUA 2QA4I 4I2OA 1LEAA 4GRIA 2GQQA 5IYDJ 1QGPA 3MKYB 1SD5A 1D8JA 1V5GA 3GTLJ 2KLOA 5TJJA 1A31A 2CS3A 5FO5A 3K4MA 3VOEA 3D0SA 2ZKZA 4B48A 3N4MA 2O7OA 1D0XA 2LKXA 3K0LA 2Z3YA 1E0EA 1RKWA 3ZQQA 5J4VA 1R58A 2M1BA 2NS8A 5TGTA 1XMKA 2D1VA 4XSZF 2ISYA
chains in the Genus database with same CATH topology
3I71A 4RB3C 3RI4A 1QBJA 2CWEA 2MD5A 5IT3A 1S29A 1IXCA 1P6RA 3RKXA 1ZN2A 2LKPA 3R0JA 3VB2A 5CYVA 2EWNA 2EFNA 3P9IA 1WWXA 5JR3A 1RUOA 1YO5C 3F3XA 5FLXZ 5D5VB 1K6OA 3C18A 1FYMA 3T8TA 2A3SA 3CUQA 3KEOA 2P5VA 1IXRC 3CLOA 2H6BA 4P55A 3ZMUA 2GAUA 1FPQA 4ZYEA 2CSOA 4FX4A 4G6QA 4A6EA 2XVCA 3KEQA 3GXOA 4A6DA 2FMLA 4PZJA 2A68F 3I59B 3KE2A 2HOEA 2XUBA 1RIOH 4EMSA 3ZQ7A 1IN4A 2BE5F 5BPIA 2E7XA 4RAZA 1OYIA 1Z7UA 3HHHA 1XD7A 3J81K 1S7AA 3V4GA 3BJAA 1J9IA 3KP6A 4LFUA 1FX7A 5K5OA 2K27A 2P7VB 2V79A 1SMTA 1S6LA 4L9VA 1AWCA 1EH6A 5KVRA 4S04A 2V9VA 4JQFA 4GGGA 2Y75A 3ML6A 3ABTA 1BN5A 4HV5A 1W5TA 3IRRA 1XB4A 4IPAA 2MH2A 4LB6B 1U78A 4FT8A 4OIPF 2V6CA 1SD6A 4I0AA 4P9UA 1D8KA 3FXUA 2QZ8A 1TTYA 1LB2A 2ZFWA 4Z2YA 1QQIA 2OBPA 2HZTA 1BI3A 4PGGA 4BHPA 2J5PA 2FNPA 3ZPLA 3KP7A 3K69A 3FMQA 2FOKA 5E17F 4UXNA 5L3BA 3GZ6A 4EJWA 2H6CA 2VBZA 1GXPA 3PQKA 4KN7X 2P6TA 3OV8A 3P7NA 4LMYA 4EGZA 3FHZA 1RUNA 2FA5A 5F1RA 2RC4A 3AAFA 3Q9VA 4RGUA 4BH9A 2A69F 3N97A 2VE9A 4MQVA 4HA8A 4MGRA 5L3EA 4HX7A 2KIFA 1LVAA 4RB1A 2H27A 3QPTA 1LNWA 2QLZA 1J5YA 2ISZA 3KLOA 3DP7A 3WGGA 1BIBA 5KK1A 4IXAA 5FLXK 3GFLA 3K9TA 1USTA 4L5IA 2XKPA 5L3FA 4U7DA 1CGPA 3QOPA 4KMUX 4AIHA 4EV0A 2EV0A 1XMAA 1K7AA 2V1DA 1HXDA 2QBYB 2WV0A 3SFZA 5A2QZ 5FB2A 4Q48A 1FBQA 1QZYA 1HKTA 2FBKA 4L0ZB 1HQCA 2HYGD 3TDZC 2F5EA 4P5OA 3U2RA 3M1EA 5LGUA 3M9AA 3E6CC 4LJZF 2L3DA 1O3TA 2FEZA 3V8JA 3E6BA 4BAYA 3RDIA 5J8FA 1U2WA 3JSOA 4ZYGA 1DDNA 4KIGA 5DD4A 5H6RA 5BS6A 2VXZA 2W57A 3HIFA 2AXLA 2XGXA 4CDGA 5ERIA 1PDNC 3I0TA 5JHUA 3L00A 3H92A 1OYWA 3KZZA 3I59A 3HTUA 5HOOA 3M8EA 1ZLJA 4G6DA 3GF2A 4QWQA 1ZG3A 5E1XA 1ON2A 4ESBA 4WX9A 3TOBA 5H6QA 4CICA 1FSEA 4U0YA 1CF7B 4MQ9F 2HDCA 4UUVA 3GEZA 3WE2A 4KT5C 4WK8F 3HYIA 4LG0B 3KZYA 4G94A 2IA0A 3QPHA 1ZH5A 2R7DA 5HS8A 2DAOA 2D2WA 5F64A 4G9YA 4HX8A 1ZGJA 4GCVA 1YW9A 6PAXA 1G3WA 5AIPA 4NQWA 2UWMA 3R61A 4ESFA 2EA4A 2RQPA 1ZRFA 2A5YB 5HDKA 2HQNA 2RNJA 2BV6A 4EM2A 3C1DA 4HLYA 4BHBA 5HS7A 3K1NA 3WTSC 2IA2A 2YSRA 3KETA 5EEGA 2K86A 4WF2A 3MFKA 1J7KA 3SZTA 3BZ6A 4CXFA 1S8NA 2VBWA 1QO0D 3VEPA 3WGIA 2Q0OA 5A2QK 2IT0A 4AVPA 3HSEA 4WXDA 1HKSA 4WXHA 2P5KA 4YG2F 4IVNA 2EFWA 3EETA 3FWEA 1TW3A 4CGZA 2FQ3A 1BC7C 2O0YA 1SFXA 1TBXA 1J59A 4BYYA 1AOYA 4HBLA 2NNYA 2NRAC 2ZO4A 3FXRA 2GWRA 1U3EM 3F6VA 4U0VA 5LBQA 1EH8A 2W24A 2OA4A 2VC1A 3QAHA 3WU1B 2QBYA 2MLGA 4HQEA 4HX4A 1MJBA 3WTYC 3EDPA 3KLNA 2DK5A 3LQRA 1DP7P 4MTDA 3QP6A 3U1DA 2QQBA 3HOTA 1SAXA 1QZZA 3EUHA 1YS7A 5E1WA 1UB9A 3WE3A 1BOAA 5DYMA 2LSOA 1U8RA 2W25A 1P2FA 3VODA 4IHTA 1V4RA 1UHMA 3O2PE 4Q5SF 3FF5A 4LLGF 4Y15A 3C3WA 4M9SA 2EFOA 2HKOA 1B9MA 2QQ9A 3TDUC 4LLLA 1C0WA 2L4AA 3W6JB 3TGNA 4A5NA 5D6FA 4JK1X 3JW4A 2JSCA 2DTRA 4HF2A 3ABUA 1O7FA 4KMFA 1ZYRF 5DEQA 2YX7A 3MCZA 1FP2A 2FE3A 4K2EA 2XHKA 4PCQA 3ZMVA 1J0RA 2OU2A 3LAPA 4BNCA 2FMYA 2Z5UA 1CF7A 2XAGA 3ZP5A 4HDVA 3HSRA 1YW7A 1ZLKA 4LG0A 4EVIA 4OMZA 2MA3A 4ON0A 1JHFA 2O3FA 3LA7A 4A0XA 4YFNF 3GUDA 5J6XA 2PN6A 2AS5F 4RAYA 2XV4S 1ULYA 2LF8A 5K5QA 4CYDA 3WTTC 4JBAA 2QVOA 2B0LA 1ZREA 2KJCA 5HDNA 1OPCA 4P96A 3SQNA 2VBXA 1MD0A 2V1XA 5E8IA 3IL2A 1D5VA 2GZWA 2ZXJA 3GFIA 2DQLA 3G73A 2PJPA 1MKMA 4OU0A 2STTA 4KDPA 3GW2A 3BDDA 2ACJA 2DU9A 1YIOA 1KU9A 4CZZA 2JRTA 3CUQC 2EFPA 1HW5A 1Z05A 2O8XA 2OAZA 3WTZA 1K79A 4L9TA 1ZRDA 2M87A 3KCCA 3CO6C 1WRJA 3HRUA 3TO7A 3RYRA 2R3SA 4HYEA 1ZAOA 5HS9A 3BPXA 4EQQA 3CO7C 5DUIA 2YU3A 2PFBA 5JVTA 5H20A 1NHAA 2MBFA 2HYFA 2MH9A 2J5OA 3V7SA 2HTJA 3ECHA 2NAZA 2K7LA 3MEXA 1SFUA 5FD5A 5D4RA 1FYKA 2OZUA 2RV8A 4KA4A 2HFHA 3I4PA 1R1VA 4AD9A 1DPRA 5LGNA 3E5QA 1J75A 1Z1DA 2E1CA 1XGMA 4UVAA 1U5TC 4ENNA 3LWFA 3T1BA 1FBUA 1BC8C 1UHWA 4M9XA 2Z33A 3V8LA 5CLSA 2IVMA 1W7PD 5AIQA 4UV8A 1TW2A 5D5UB 3QRFF 5D5WB 1YYVA 2XAFA 3HRMA 1R00A 1YLFA 2KKOA 3K1MA 2Q8KA 4XBFA 1O3SA 3S2WA 3IKVA 5DDGA 3RIRA 1HW1A 1FSHA 2YX4A 1HSTA 5D8LB 2EK5A 1WQ2A 4Q4ZF 2ADUA 2BEOA 2DBBA 3IC7A 3ZMSA 3ECOA 1IRGA 1T38A 1F1ZA 1T0FA 3WTVC 4F7ZA 2P5LC 5D8KB 2CGPA 4R1HA 2EA2A 2XAQA 1R5HA 1FT9A 1FWZA 2H09A 3DF8A 3H3ZA 1F9NA 3MQ0A 1G3TA 4KIBA 1DPUA 3U9GA 5LLQA 1ODDA 1JHHA 2WWYA 1MGTA 3E3VA 1IN6A 4ESJA 4ENJA 5ILSA 4IRHA 4I01A 4UVCA 1VTNC 4NHJA 1LQ1A 3B73A 2RN7A 2LF7A 1FY7A 1LEBA 4KNYA 4HDUA 2DO7A 4BXUA 4M6XA 3BROA 1HSJA 2L4MA 4HV6A 4RS8A 1KQ0A 5HLHA 2K4JA 3IWFA 5AONA 1BJAA 3BWGA 3BOQA 5HVQC 1LDJA 5FGMA 4MTEA 1G4DA 2FBHA 3ZN0A 2KIUA 2X4HA 3FMSA 1KYZA 2IPQX 1Y0UA 1XCBA 3MZHA 2YPRA 1ZRCA 1TQMA 3FM5A 2VBYA 2FF4A 1I1SA 2ELHA 4OMYA 4RGSA 5K5RA 2ZCWA 1IW7F 1FYLA 4BQAA 3GFJA 2PG4A 3R0AA 1S3JA 1XCVA 3KP3A 3DXJF 3K2ZA 3ULQB 2CFXA 4HQMA 5LEJA 1BI2A 1ZARA 3HRTA 3L09A 1TQIA 3QU6A 4U7BA 1BI1A 1R7JA 3F72A 1XGNA 4XLNF 3F21A 2G9WA 4UV9A 5FD6A 3WODF 1KA8A 3HHGA 3GVAA 3ELKA 5LRRA 1K78A 3TKYA 4AWXB 1KU7A 1R22A 4GO1A 1B6AA 3CJNA 1XSDA 1TNTA 4WCGA 4GXOA 2STWA 3DQVC 1I5ZA 4L18B 1LDDA 5ICGA 2KRFA 3F8FA 1SMYF 1OR7A 5HLIA 2VC0A 1TNSA 1YS6A 2DFIA 4Y13A 4RGXA 4YFXF 1X3UA 1FBSA 2DI3A 2COMA 5LRSA 3NQOA 3TO9A 4OIOF 4EJUA 3V7CA 2NS0A 3G3ZA 4MNUA 3HTSB 3FMRA 2VT3A 5FFXA 2F2EA 1I6XA 4L9NA 1OYYA 3CDHA 2G7HA 3C7JA 1W5SA 4L9JA 2F5DA 4YFKF 1L3LA 1P4WA 2ESNA 1MZBA 3F8BA 1Z91A 2F5CA 1LJ9A 1FLIA 1B59A 3FZVA 2ESHA 4O6JA 1ONVA 5ICFA 3TQNA 1TLHB 2WC2A 1XGSA 1XGOA 1V3FA 2EV6A 2W85A 2QWWA 3RTRA 3IKTA 2Y48A 2DQRA 2JPBA 4TV7A 4A2UA 5HDGA 3E6DA 4S05A 3BJOA 1T2KA 2E1NA 2ZNZA 3ZN1A 3L9FA 3DEUA 4IJAA 4KN4X 1A04A 2M5WA 1UFMA 2DPUA 1W7PA 3KP4A 3J80Z 4KIFA 2Z9OA 5CVRA 2DW4A 3K1PA 3MAJA 4EGYA 3SHFA 4PDKA 2BBYA 2KJBA 5TRDA 5CVJA 2FNAA 4IRIA 4G7HF 2O03A 1MDMB 4I09A 3L2CA 2TDXA 2ZNYA 4UHTA 5E8GA 3REOA 3NEUA 2O6GE 4IRGA 2ETHA 3P9KA 4KICA 4MEXF 3M7GA 4IF4A 5CJ9A 5JI6A 2P4WA 4HW0A 1TQPA 1P4XA 5JFRA 1FOKA 1IF1A 1I27A 2OQGA 1IXSB 4EM1A 4HF1A 3CTAA 1ZGAA 4FHTA 1R1UA 4LD5A 4QLCU 4EJVA 3BJ6A 2Y0MA 3LA3A 3BPVA 3MWMA 2MC3A 4R8HA 1S7OA 4OOIA 2VODA 5LHGA 1HBXG 3QP5A 4L5JA 3RKYA 5E20A 2DK8A 1EH7A 1ON1A 1JXSA 2L02A 3V8KA 2R7FA 1B1BA 2RKHA 5E1ZB 3O6BB 3LFKA 2QYOA 5LEKA 1FZPB 2G7UA 5L3GA 3TOAA 2L01A 5CVIA 2PBIA 2LDUA 1HW2A 1YG2A 1IUYA 3FX3A 4I98B 2HQRA 2HR3A 4MHGA 3ZMZA 2L54A 2XASA 4WXCA 5IT9Z 1KGSA 1KYWA 5LHIA 1RZ4A 1P92A 3WTWC 1SFEA 5ILVA 4HLXA 3COAC 4ENMA 3F8MA 2RGVA 1H9TA 2NYXA 2CW0F 2FU4A 2VONA 1G6NA 2MLKA 4H0EA 2EFQA 4EM0B 4YIIA 5ICCA 4EJTA 2UXNA 3RKWA 3DV8A 3LA2A 3GFMA 1R36A 2X0LA 1STZA 1H0MA 4ZZDA 3J80K 4N9IA 5LHHA 4ZYDA 2A61A 1OMIA 1YW8A 3EYYA 1SD7A 3W6KB 5DD8A 2A6HF 4N0BA 3O3KA 1XDUA 3FXQA 1J2XA 4HZFA 1FC3A 2V1UA 3P9CA 4B8XA 1XSXA 1HKQA 3TO6A 1MJ9A 1K78B 4OINF 1MJAA 3M8FA 3IWZA 5BMZA 4LK0F 3CUOA 1LDKB 3B02A 5LGTA 1U5TA 4A0ZA 3NRVA 1G3SA 1R1TA 4DNCA 1O57A 1REPC 5D6EA 1BBYA 2EB7A 2OZ6A 4XSXF 3J7AO 1T6SA 2HTSA 2M30A 4OIQF 3HUGA 3EYIA 1XSVA 4I02A 4ASNA 1Z6RA 2VN2A 2FBIA 3JTGA 3EQLF 1I1GA 3DPLC 1GXQA 1MDMA 1SD4A 2YR2A 2GXGA 2XIGA 3WU0A 1JE8A 2GIVA 1JGSA 4G7OF 3ERED 1O3QA 2BYVE 3PQJA 2ZJ2A 2HS5A 4LGWA 2JT1A 3T0YA 2DT5A 3KP5A 2VT2A 1XN7A 2IRFG 4EJOA 4ZZLA 5J8CA 2K4BA 4LB5A 3IRQA 1OKRA 4M74A 3FM3A 4HAMA 4KFCA 4O3MA 4RB2C 1EV7A 1L0OC 4XRFA 2D1HA 3BP8A 2ZMEA 1IN7A 1W4MA 1Z6TA 5IT9K 3JAMZ 1F4KA 3L7WA 2KIMA 2QENA 4A5MA 4A0YA 3HSFA 2NNNA 1XDSA 3F22A 2W84A 2RVCA 5EEHA 1O3RA 1USSA 3F8CA 1E2XA 1R5GA 3RJPA 4RB0A 5BPDA 2VE8A 2M8EA 4CO8A 2A07F 3SXYA 2PEXA 4A12A 2DLLA 1FP1D 3WTUC 3H3UA 1W7PB 4G8XA 3SZPA 1O7LA 5CVVA 5BQTA 2H94A 2HEOA 2OD5A 3D5LA 3LSTA 2P7CB 4MEYF 2BGCA 2IA1A 3R60A 1IAWA 2XAHA 3PFIA 2XROA 4UNOA 2UXXA 1F5TA 1BIAA 1D3YA 4U0WA 2JPCA 3ISPA 1Z9CA 2O61A 4RGRA 3GYHX 1B9NA 3F6OA 4M73A 4IHSA 5DCMB 2EV5A 5L3DA 2FRHA 3E97A 3KP2A 4O5VA 5ILUA 3E5UA 4OIRF 4LK1F 1B4AA 4AIKA 2CO5A 3I64A 4HOBA 3T8RA 3BY6A 4GYGA 4PGHA 1UCRA 5D5XB 3RPUA 2GA1A 1BI0A 4NB5A 3F23A 1ZHFA 2OQRA 2D45A 4WWCA 4Q47A 2IW5A 2XRNA 1IN5A 2C6YA 1P4AA 3DKWA 2CQKA 3WTXC 1BM9A 1IRFA 3IHUA 3LQQA 3WGHA 4I0BA 3GO5A 2VOPA 3T5XA 3VFZA 1ZG1A 1YTYA 5D4SA 2QUFA 3JAMK 2ZBKA 2IP2A 2VOOA 3R6SA 1PP8F 2XKOA 2PI0A 5BOXA 2CG4A 2FSWA 4Y17A 4BHCA 4G7ZF 3GLXA 4D0PA 1KQ8A 3I54A 2XAJA 4U88A 3CUQB 2P6SA 2PMUA 3GZ5A 4ETSA 2IJLA 5E18F 4FX0A 4AIJA 1RNLA 1GHCA 5ED4A 2QQAA 3HRSA 4ZH4F 1GVJA 2E7WA 1RI7A 2EJRA 1IN8A 5HLGA 1E17A 1KQ9A 4YIFA 3RYPA 2CYYA 4I7HA 3GX4X 4KYWA 2PMHA 2Q2EA 4N9HA 4ENKA 3Q5FA 1PP7U 4P9FA 4DQ2A 1T39A 2DPDA 2HGCA 3JTHA 2M45A 2K02A 1KU2A 4KUMA 4M6YA 3QU3A 2PQ8A 2GA2A 5ICEA 3HOSA 3JSPA 1U6GA 2Z99A 1IZ1A 1U5TB 5DCFA 1QPMA 1G3YA 2JZYA 4HF0A 1ZG5A 4M72A 3KFWX 5DV5A 5FFZA 5F6FA 3ROUA 2JTVA 1PUEE 2GXBA 1WKMA 2WTEA 3Q9SA 3WG9A 4ZYHA 5CVUA 3E6MA 3J81Z 1H9GA 1KU3A 5K1YA 4LLNA 2QM3A 4B09A 3ZMTA 4GYIA 5L3CA 3GWZA 3OOPA 2PLYA 3R4KA 3I5UA 1DUXC 3LAJA 2A6EF 4UVBA 2LNBA 1YQAA 1WI9A 2RDPA 1T98A 3I58A 4R79A 3E5XA 1Q1HA 3DPTA 4M9ZA 3V7RA 2UZKA 1FNNA 4E70A 2HWVA 3MZYA 3DFGA 2HKXA 2P8TA 5DCMA 2ZMEB 5DUKA 3ZMDA 1QNTA 4CHUA 1WSUA 1YFHA 3RPQA 4XLPF 4M71A 3I53A 3F8NA 2FXAA 1R23A 4L0YB 2F5FA 4I2OA 1LEAA 2GQQA 1QGPA 1SD5A 1D8JA 5TJJA 5FO5A 3VOEA 3D0SA 2ZKZA 3N4MA 3K0LA 2Z3YA 1R58A 2M1BA 1XMKA 2D1VA 4XSZF 2ISYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I71 A;  4RB3 C;  3RI4 A;  1QBJ A;  2CWE A;  2MD5 A;  5IT3 A;  1S29 A;  1IXC A;  1P6R A;  3RKX A;  1ZN2 A;  2LKP A;  3R0J A;  3VB2 A;  5CYV A;  2EWN A;  2EFN A;  3P9I A;  1WWX A;  5JR3 A;  1RUO A;  1YO5 C;  3F3X A;  5FLX Z;  5D5V B;  1K6O A;  3C18 A;  1FYM A;  3T8T A;  2A3S A;  3CUQ A;  3KEO A;  2P5V A;  1IXR C;  3CLO A;  2H6B A;  4P55 A;  3ZMU A;  2GAU A;  1FPQ A;  4ZYE A;  2CSO A;  4FX4 A;  4G6Q A;  4A6E A;  2XVC A;  3KEQ A;  3GXO A;  4A6D A;  2FML A;  4PZJ A;  2A68 F;  3I59 B;  3KE2 A;  2HOE A;  2XUB A;  1RIO H;  4EMS A;  3ZQ7 A;  1IN4 A;  2BE5 F;  5BPI A;  2E7X A;  4RAZ A;  1OYI A;  1Z7U A;  3HHH A;  1XD7 A;  3J81 K;  1S7A A;  3V4G A;  3BJA A;  1J9I A;  3KP6 A;  4LFU A;  1FX7 A;  5K5O A;  2K27 A;  2P7V B;  2V79 A;  1SMT A;  1S6L A;  4L9V A;  1AWC A;  1EH6 A;  5KVR A;  4S04 A;  2V9V A;  4JQF A;  4GGG A;  2Y75 A;  3ML6 A;  3ABT A;  1BN5 A;  4HV5 A;  1W5T A;  3IRR A;  1XB4 A;  4IPA A;  2MH2 A;  4LB6 B;  1U78 A;  4FT8 A;  4OIP F;  2V6C A;  1SD6 A;  4I0A A;  4P9U A;  1D8K A;  3FXU A;  2QZ8 A;  1TTY A;  1LB2 A;  2ZFW A;  4Z2Y A;  1QQI A;  2OBP A;  2HZT A;  1BI3 A;  4PGG A;  4BHP A;  2J5P A;  2FNP A;  3ZPL A;  3KP7 A;  3K69 A;  3FMQ A;  2FOK A;  5E17 F;  4UXN A;  5L3B A;  3GZ6 A;  4EJW A;  2H6C A;  2VBZ A;  1GXP A;  3PQK A;  4KN7 X;  2P6T A;  3OV8 A;  3P7N A;  4LMY A;  4EGZ A;  3FHZ A;  1RUN A;  2FA5 A;  5F1R A;  2RC4 A;  3AAF A;  3Q9V A;  4RGU A;  4BH9 A;  2A69 F;  3N97 A;  2VE9 A;  4MQV A;  4HA8 A;  4MGR A;  5L3E A;  4HX7 A;  2KIF A;  1LVA A;  4RB1 A;  2H27 A;  3QPT A;  1LNW A;  2QLZ A;  1J5Y A;  2ISZ A;  3KLO A;  3DP7 A;  3WGG A;  1BIB A;  5KK1 A;  4IXA A;  5FLX K;  3GFL A;  3K9T A;  1UST A;  4L5I A;  2XKP A;  5L3F A;  4U7D A;  1CGP A;  3QOP A;  4KMU X;  4AIH A;  4EV0 A;  2EV0 A;  1XMA A;  1K7A A;  2V1D A;  1HXD A;  2QBY B;  2WV0 A;  3SFZ A;  5A2Q Z;  5FB2 A;  4Q48 A;  1FBQ A;  1QZY A;  1HKT A;  2FBK A;  4L0Z B;  1HQC A;  2HYG D;  3TDZ C;  2F5E A;  4P5O A;  3U2R A;  3M1E A;  5LGU A;  3M9A A;  3E6C C;  4LJZ F;  2L3D A;  1O3T A;  2FEZ A;  3V8J A;  3E6B A;  4BAY A;  3RDI A;  5J8F A;  1U2W A;  3JSO A;  4ZYG A;  1DDN A;  4KIG A;  5DD4 A;  5H6R A;  5BS6 A;  2VXZ A;  2W57 A;  3HIF A;  2AXL A;  2XGX A;  4CDG A;  5ERI A;  1PDN C;  3I0T A;  5JHU A;  3L00 A;  3H92 A;  1OYW A;  3KZZ A;  3I59 A;  3HTU A;  5HOO A;  3M8E A;  1ZLJ A;  4G6D A;  3GF2 A;  4QWQ A;  1ZG3 A;  5E1X A;  1ON2 A;  4ESB A;  4WX9 A;  3TOB A;  5H6Q A;  4CIC A;  1FSE A;  4U0Y A;  1CF7 B;  4MQ9 F;  2HDC A;  4UUV A;  3GEZ A;  3WE2 A;  4KT5 C;  4WK8 F;  3HYI A;  4LG0 B;  3KZY A;  4G94 A;  2IA0 A;  3QPH A;  1ZH5 A;  2R7D A;  5HS8 A;  2DAO A;  2D2W A;  5F64 A;  4G9Y A;  4HX8 A;  1ZGJ A;  4GCV A;  1YW9 A;  6PAX A;  1G3W A;  5AIP A;  4NQW A;  2UWM A;  3R61 A;  4ESF A;  2EA4 A;  2RQP A;  1ZRF A;  2A5Y B;  5HDK A;  2HQN A;  2RNJ A;  2BV6 A;  4EM2 A;  3C1D A;  4HLY A;  4BHB A;  5HS7 A;  3K1N A;  3WTS C;  2IA2 A;  2YSR A;  3KET A;  5EEG A;  2K86 A;  4WF2 A;  3MFK A;  1J7K A;  3SZT A;  3BZ6 A;  4CXF A;  1S8N A;  2VBW A;  1QO0 D;  3VEP A;  3WGI A;  2Q0O A;  5A2Q K;  2IT0 A;  4AVP A;  3HSE A;  4WXD A;  1HKS A;  4WXH A;  2P5K A;  4YG2 F;  4IVN A;  2EFW A;  3EET A;  3FWE A;  1TW3 A;  4CGZ A;  2FQ3 A;  1BC7 C;  2O0Y A;  1SFX A;  1TBX A;  1J59 A;  4BYY A;  1AOY A;  4HBL A;  2NNY A;  2NRA C;  2ZO4 A;  3FXR A;  2GWR A;  1U3E M;  3F6V A;  4U0V A;  5LBQ A;  1EH8 A;  2W24 A;  2OA4 A;  2VC1 A;  3QAH A;  3WU1 B;  2QBY A;  2MLG A;  4HQE A;  4HX4 A;  1MJB A;  3WTY C;  3EDP A;  3KLN A;  2DK5 A;  3LQR A;  1DP7 P;  4MTD A;  3QP6 A;  3U1D A;  2QQB A;  3HOT A;  1SAX A;  1QZZ A;  3EUH A;  1YS7 A;  5E1W A;  1UB9 A;  3WE3 A;  1BOA A;  5DYM A;  2LSO A;  1U8R A;  2W25 A;  1P2F A;  3VOD A;  4IHT A;  1V4R A;  1UHM A;  3O2P E;  4Q5S F;  3FF5 A;  4LLG F;  4Y15 A;  3C3W A;  4M9S A;  2EFO A;  2HKO A;  1B9M A;  2QQ9 A;  3TDU C;  4LLL A;  1C0W A;  2L4A A;  3W6J B;  3TGN A;  4A5N A;  5D6F A;  4JK1 X;  3JW4 A;  2JSC A;  2DTR A;  4HF2 A;  3ABU A;  1O7F A;  4KMF A;  1ZYR F;  5DEQ A;  2YX7 A;  3MCZ A;  1FP2 A;  2FE3 A;  4K2E A;  2XHK A;  4PCQ A;  3ZMV A;  1J0R A;  2OU2 A;  3LAP A;  4BNC A;  2FMY A;  2Z5U A;  1CF7 A;  2XAG A;  3ZP5 A;  4HDV A;  3HSR A;  1YW7 A;  1ZLK A;  4LG0 A;  4EVI A;  4OMZ A;  2MA3 A;  4ON0 A;  1JHF A;  2O3F A;  3LA7 A;  4A0X A;  4YFN F;  3GUD A;  5J6X A;  2PN6 A;  2AS5 F;  4RAY A;  2XV4 S;  1ULY A;  2LF8 A;  5K5Q A;  4CYD A;  3WTT C;  4JBA A;  2QVO A;  2B0L A;  1ZRE A;  2KJC A;  5HDN A;  1OPC A;  4P96 A;  3SQN A;  2VBX A;  1MD0 A;  2V1X A;  5E8I A;  3IL2 A;  1D5V A;  2GZW A;  2ZXJ A;  3GFI A;  2DQL A;  3G73 A;  2PJP A;  1MKM A;  4OU0 A;  2STT A;  4KDP A;  3GW2 A;  3BDD A;  2ACJ A;  2DU9 A;  1YIO A;  1KU9 A;  4CZZ A;  2JRT A;  3CUQ C;  2EFP A;  1HW5 A;  1Z05 A;  2O8X A;  2OAZ A;  3WTZ A;  1K79 A;  4L9T A;  1ZRD A;  2M87 A;  3KCC A;  3CO6 C;  1WRJ A;  3HRU A;  3TO7 A;  3RYR A;  2R3S A;  4HYE A;  1ZAO A;  5HS9 A;  3BPX A;  4EQQ A;  3CO7 C;  5DUI A;  2YU3 A;  2PFB A;  5JVT A;  5H20 A;  1NHA A;  2MBF A;  2HYF A;  2MH9 A;  2J5O A;  3V7S A;  2HTJ A;  3ECH A;  2NAZ A;  2K7L A;  3MEX A;  1SFU A;  5FD5 A;  5D4R A;  1FYK A;  2OZU A;  2RV8 A;  4KA4 A;  2HFH A;  3I4P A;  1R1V A;  4AD9 A;  1DPR A;  5LGN A;  3E5Q A;  1J75 A;  1Z1D A;  2E1C A;  1XGM A;  4UVA A;  1U5T C;  4ENN A;  3LWF A;  3T1B A;  1FBU A;  1BC8 C;  1UHW A;  4M9X A;  2Z33 A;  3V8L A;  5CLS A;  2IVM A;  1W7P D;  5AIQ A;  4UV8 A;  1TW2 A;  5D5U B;  3QRF F;  5D5W B;  1YYV A;  2XAF A;  3HRM A;  1R00 A;  1YLF A;  2KKO A;  3K1M A;  2Q8K A;  4XBF A;  1O3S A;  3S2W A;  3IKV A;  5DDG A;  3RIR A;  1HW1 A;  1FSH A;  2YX4 A;  1HST A;  5D8L B;  2EK5 A;  1WQ2 A;  4Q4Z F;  2ADU A;  2BEO A;  2DBB A;  3IC7 A;  3ZMS A;  3ECO A;  1IRG A;  1T38 A;  1F1Z A;  1T0F A;  3WTV C;  4F7Z A;  2P5L C;  5D8K B;  2CGP A;  4R1H A;  2EA2 A;  2XAQ A;  1R5H A;  1FT9 A;  1FWZ A;  2H09 A;  3DF8 A;  3H3Z A;  1F9N A;  3MQ0 A;  1G3T A;  4KIB A;  1DPU A;  3U9G A;  5LLQ A;  1ODD A;  1JHH A;  2WWY A;  1MGT A;  3E3V A;  1IN6 A;  4ESJ A;  4ENJ A;  5ILS A;  4IRH A;  4I01 A;  4UVC A;  1VTN C;  4NHJ A;  1LQ1 A;  3B73 A;  2RN7 A;  2LF7 A;  1FY7 A;  1LEB A;  4KNY A;  4HDU A;  2DO7 A;  4BXU A;  4M6X A;  3BRO A;  1HSJ A;  2L4M A;  4HV6 A;  4RS8 A;  1KQ0 A;  5HLH A;  2K4J A;  3IWF A;  5AON A;  1BJA A;  3BWG A;  3BOQ A;  5HVQ C;  1LDJ A;  5FGM A;  4MTE A;  1G4D A;  2FBH A;  3ZN0 A;  2KIU A;  2X4H A;  3FMS A;  1KYZ A;  2IPQ X;  1Y0U A;  1XCB A;  3MZH A;  2YPR A;  1ZRC A;  1TQM A;  3FM5 A;  2VBY A;  2FF4 A;  1I1S A;  2ELH A;  4OMY A;  4RGS A;  5K5R A;  2ZCW A;  1IW7 F;  1FYL A;  4BQA A;  3GFJ A;  2PG4 A;  3R0A A;  1S3J A;  1XCV A;  3KP3 A;  3DXJ F;  3K2Z A;  3ULQ B;  2CFX A;  4HQM A;  5LEJ A;  1BI2 A;  1ZAR A;  3HRT A;  3L09 A;  1TQI A;  3QU6 A;  4U7B A;  1BI1 A;  1R7J A;  3F72 A;  1XGN A;  4XLN F;  3F21 A;  2G9W A;  4UV9 A;  5FD6 A;  3WOD F;  1KA8 A;  3HHG A;  3GVA A;  3ELK A;  5LRR A;  1K78 A;  3TKY A;  4AWX B;  1KU7 A;  1R22 A;  4GO1 A;  1B6A A;  3CJN A;  1XSD A;  1TNT A;  4WCG A;  4GXO A;  2STW A;  3DQV C;  1I5Z A;  4L18 B;  1LDD A;  5ICG A;  2KRF A;  3F8F A;  1SMY F;  1OR7 A;  5HLI A;  2VC0 A;  1TNS A;  1YS6 A;  2DFI A;  4Y13 A;  4RGX A;  4YFX F;  1X3U A;  1FBS A;  2DI3 A;  2COM A;  5LRS A;  3NQO A;  3TO9 A;  4OIO F;  4EJU A;  3V7C A;  2NS0 A;  3G3Z A;  4MNU A;  3HTS B;  3FMR A;  2VT3 A;  5FFX A;  2F2E A;  1I6X A;  4L9N A;  1OYY A;  3CDH A;  2G7H A;  3C7J A;  1W5S A;  4L9J A;  2F5D A;  4YFK F;  1L3L A;  1P4W A;  2ESN A;  1MZB A;  3F8B A;  1Z91 A;  2F5C A;  1LJ9 A;  1FLI A;  1B59 A;  3FZV A;  2ESH A;  4O6J A;  1ONV A;  5ICF A;  3TQN A;  1TLH B;  2WC2 A;  1XGS A;  1XGO A;  1V3F A;  2EV6 A;  2W85 A;  2QWW A;  3RTR A;  3IKT A;  2Y48 A;  2DQR A;  2JPB A;  4TV7 A;  4A2U A;  5HDG A;  3E6D A;  4S05 A;  3BJO A;  1T2K A;  2E1N A;  2ZNZ A;  3ZN1 A;  3L9F A;  3DEU A;  4IJA A;  4KN4 X;  1A04 A;  2M5W A;  1UFM A;  2DPU A;  1W7P A;  3KP4 A;  3J80 Z;  4KIF A;  2Z9O A;  5CVR A;  2DW4 A;  3K1P A;  3MAJ A;  4EGY A;  3SHF A;  4PDK A;  2BBY A;  2KJB A;  5TRD A;  5CVJ A;  2FNA A;  4IRI A;  4G7H F;  2O03 A;  1MDM B;  4I09 A;  3L2C A;  2TDX A;  2ZNY A;  4UHT A;  5E8G A;  3REO A;  3NEU A;  2O6G E;  4IRG A;  2ETH A;  3P9K A;  4KIC A;  4MEX F;  3M7G A;  4IF4 A;  5CJ9 A;  5JI6 A;  2P4W A;  4HW0 A;  1TQP A;  1P4X A;  5JFR A;  1FOK A;  1IF1 A;  1I27 A;  2OQG A;  1IXS B;  4EM1 A;  4HF1 A;  3CTA A;  1ZGA A;  4FHT A;  1R1U A;  4LD5 A;  4QLC U;  4EJV A;  3BJ6 A;  2Y0M A;  3LA3 A;  3BPV A;  3MWM A;  2MC3 A;  4R8H A;  1S7O A;  4OOI A;  2VOD A;  5LHG A;  1HBX G;  3QP5 A;  4L5J A;  3RKY A;  5E20 A;  2DK8 A;  1EH7 A;  1ON1 A;  1JXS A;  2L02 A;  3V8K A;  2R7F A;  1B1B A;  2RKH A;  5E1Z B;  3O6B B;  3LFK A;  2QYO A;  5LEK A;  1FZP B;  2G7U A;  5L3G A;  3TOA A;  2L01 A;  5CVI A;  2PBI A;  2LDU A;  1HW2 A;  1YG2 A;  1IUY A;  3FX3 A;  4I98 B;  2HQR A;  2HR3 A;  4MHG A;  3ZMZ A;  2L54 A;  2XAS A;  4WXC A;  5IT9 Z;  1KGS A;  1KYW A;  5LHI A;  1RZ4 A;  1P92 A;  3WTW C;  1SFE A;  5ILV A;  4HLX A;  3COA C;  4ENM A;  3F8M A;  2RGV A;  1H9T A;  2NYX A;  2CW0 F;  2FU4 A;  2VON A;  1G6N A;  2MLK A;  4H0E A;  2EFQ A;  4EM0 B;  4YII A;  5ICC A;  4EJT A;  2UXN A;  3RKW A;  3DV8 A;  3LA2 A;  3GFM A;  1R36 A;  2X0L A;  1STZ A;  1H0M A;  4ZZD A;  3J80 K;  4N9I A;  5LHH A;  4ZYD A;  2A61 A;  1OMI A;  1YW8 A;  3EYY A;  1SD7 A;  3W6K B;  5DD8 A;  2A6H F;  4N0B A;  3O3K A;  1XDU A;  3FXQ A;  1J2X A;  4HZF A;  1FC3 A;  2V1U A;  3P9C A;  4B8X A;  1XSX A;  1HKQ A;  3TO6 A;  1MJ9 A;  1K78 B;  4OIN F;  1MJA A;  3M8F A;  3IWZ A;  5BMZ A;  4LK0 F;  3CUO A;  1LDK B;  3B02 A;  5LGT A;  1U5T A;  4A0Z A;  3NRV A;  1G3S A;  1R1T A;  4DNC A;  1O57 A;  1REP C;  5D6E A;  1BBY A;  2EB7 A;  2OZ6 A;  4XSX F;  3J7A O;  1T6S A;  2HTS A;  2M30 A;  4OIQ F;  3HUG A;  3EYI A;  1XSV A;  4I02 A;  4ASN A;  1Z6R A;  2VN2 A;  2FBI A;  3JTG A;  3EQL F;  1I1G A;  3DPL C;  1GXQ A;  1MDM A;  1SD4 A;  2YR2 A;  2GXG A;  2XIG A;  3WU0 A;  1JE8 A;  2GIV A;  1JGS A;  4G7O F;  3ERE D;  1O3Q A;  2BYV E;  3PQJ A;  2ZJ2 A;  2HS5 A;  4LGW A;  2JT1 A;  3T0Y A;  2DT5 A;  3KP5 A;  2VT2 A;  1XN7 A;  2IRF G;  4EJO A;  4ZZL A;  5J8C A;  2K4B A;  4LB5 A;  3IRQ A;  1OKR A;  4M74 A;  3FM3 A;  4HAM A;  4KFC A;  4O3M A;  4RB2 C;  1EV7 A;  1L0O C;  4XRF A;  2D1H A;  3BP8 A;  2ZME A;  1IN7 A;  1W4M A;  1Z6T A;  5IT9 K;  3JAM Z;  1F4K A;  3L7W A;  2KIM A;  2QEN A;  4A5M A;  4A0Y A;  3HSF A;  2NNN A;  1XDS A;  3F22 A;  2W84 A;  2RVC A;  5EEH A;  1O3R A;  1USS A;  3F8C A;  1E2X A;  1R5G A;  3RJP A;  4RB0 A;  5BPD A;  2VE8 A;  2M8E A;  4CO8 A;  2A07 F;  3SXY A;  2PEX A;  4A12 A;  2DLL A;  1FP1 D;  3WTU C;  3H3U A;  1W7P B;  4G8X A;  3SZP A;  1O7L A;  5CVV A;  5BQT A;  2H94 A;  2HEO A;  2OD5 A;  3D5L A;  3LST A;  2P7C B;  4MEY F;  2BGC A;  2IA1 A;  3R60 A;  1IAW A;  2XAH A;  3PFI A;  2XRO A;  4UNO A;  2UXX A;  1F5T A;  1BIA A;  1D3Y A;  4U0W A;  2JPC A;  3ISP A;  1Z9C A;  2O61 A;  4RGR A;  3GYH X;  1B9N A;  3F6O A;  4M73 A;  4IHS A;  5DCM B;  2EV5 A;  5L3D A;  2FRH A;  3E97 A;  3KP2 A;  4O5V A;  5ILU A;  3E5U A;  4OIR F;  4LK1 F;  1B4A A;  4AIK A;  2CO5 A;  3I64 A;  4HOB A;  3T8R A;  3BY6 A;  4GYG A;  4PGH A;  1UCR A;  5D5X B;  3RPU A;  2GA1 A;  1BI0 A;  4NB5 A;  3F23 A;  1ZHF A;  2OQR A;  2D45 A;  4WWC A;  4Q47 A;  2IW5 A;  2XRN A;  1IN5 A;  2C6Y A;  1P4A A;  3DKW A;  2CQK A;  3WTX C;  1BM9 A;  1IRF A;  3IHU A;  3LQQ A;  3WGH A;  4I0B A;  3GO5 A;  2VOP A;  3T5X A;  3VFZ A;  1ZG1 A;  1YTY A;  5D4S A;  2QUF A;  3JAM K;  2ZBK A;  2IP2 A;  2VOO A;  3R6S A;  1PP8 F;  2XKO A;  2PI0 A;  5BOX A;  2CG4 A;  2FSW A;  4Y17 A;  4BHC A;  4G7Z F;  3GLX A;  4D0P A;  1KQ8 A;  3I54 A;  2XAJ A;  4U88 A;  3CUQ B;  2P6S A;  2PMU A;  3GZ5 A;  4ETS A;  2IJL A;  5E18 F;  4FX0 A;  4AIJ A;  1RNL A;  1GHC A;  5ED4 A;  2QQA A;  3HRS A;  4ZH4 F;  1GVJ A;  2E7W A;  1RI7 A;  2EJR A;  1IN8 A;  5HLG A;  1E17 A;  1KQ9 A;  4YIF A;  3RYP A;  2CYY A;  4I7H A;  3GX4 X;  4KYW A;  2PMH A;  2Q2E A;  4N9H A;  4ENK A;  3Q5F A;  1PP7 U;  4P9F A;  4DQ2 A;  1T39 A;  2DPD A;  2HGC A;  3JTH A;  2M45 A;  2K02 A;  1KU2 A;  4KUM A;  4M6Y A;  3QU3 A;  2PQ8 A;  2GA2 A;  5ICE A;  3HOS A;  3JSP A;  1U6G A;  2Z99 A;  1IZ1 A;  1U5T B;  5DCF A;  1QPM A;  1G3Y A;  2JZY A;  4HF0 A;  1ZG5 A;  4M72 A;  3KFW X;  5DV5 A;  5FFZ A;  5F6F A;  3ROU A;  2JTV A;  1PUE E;  2GXB A;  1WKM A;  2WTE A;  3Q9S A;  3WG9 A;  4ZYH A;  5CVU A;  3E6M A;  3J81 Z;  1H9G A;  1KU3 A;  5K1Y A;  4LLN A;  2QM3 A;  4B09 A;  3ZMT A;  4GYI A;  5L3C A;  3GWZ A;  3OOP A;  2PLY A;  3R4K A;  3I5U A;  1DUX C;  3LAJ A;  2A6E F;  4UVB A;  2LNB A;  1YQA A;  1WI9 A;  2RDP A;  1T98 A;  3I58 A;  4R79 A;  3E5X A;  1Q1H A;  3DPT A;  4M9Z A;  3V7R A;  2UZK A;  1FNN A;  4E70 A;  2HWV A;  3MZY A;  3DFG A;  2HKX A;  2P8T A;  5DCM A;  2ZME B;  5DUK A;  3ZMD A;  1QNT A;  4CHU A;  1WSU A;  1YFH A;  3RPQ A;  4XLP F;  4M71 A;  3I53 A;  3F8N A;  2FXA A;  1R23 A;  4L0Y B;  2F5F A;  4I2O A;  1LEA A;  2GQQ A;  1QGP A;  1SD5 A;  1D8J A;  5TJJ A;  5FO5 A;  3VOE A;  3D0S A;  2ZKZ A;  3N4M A;  3K0L A;  2Z3Y A;  1R58 A;  2M1B A;  1XMK A;  2D1V A;  4XSZ F;  2ISY A; 
#chains in the Genus database with same CATH topology
 3I71 A;  4BJT A;  3VYU B;  1NK3 P;  4RB3 C;  3RI4 A;  1QBJ A;  2CWE A;  1ITY A;  2MD5 A;  5IT3 A;  4CH7 A;  4ABZ A;  1HA8 A;  1S29 A;  1IXC A;  2ICW G;  1P6R A;  1BA5 A;  3RKX A;  1ZN2 A;  4B1R A;  1Z77 A;  2COB A;  2X1D A;  2LKP A;  3R0J A;  3VB2 A;  5CYV A;  1MBH A;  4DYQ A;  2EWN A;  3H35 A;  3CQZ J;  3OR1 C;  2EFN A;  3P9I A;  1WWX A;  5CQE A;  2XF6 A;  5JR3 A;  1XC5 A;  1YO5 C;  1RUO A;  3F3X A;  5FLX Z;  5J40 A;  1MIJ A;  3G2B A;  1XPX A;  5D5V B;  1K6O A;  1IC8 A;  3C18 A;  2H8R A;  2R7W A;  2BY0 A;  1FYM A;  3T8T A;  2A3S A;  2KL4 A;  2VJI A;  1UG0 A;  3CUQ A;  3KEO A;  5EG0 A;  2P5V A;  2X1E A;  5B1B H;  1IXR C;  2DOA A;  2H6B A;  3CLO A;  4P55 A;  1T95 A;  3ZMU A;  2GAU A;  3A0B C;  4XRM A;  1FPQ A;  1Z67 A;  2CSO A;  2CFO A;  2WAF A;  4ZYE A;  4FX4 A;  2D5V A;  2K40 A;  4G6Q A;  4A6E A;  2XVC A;  3KEQ A;  1HLV A;  3GXO A;  2DA7 A;  3PL8 A;  3CDL A;  3UKG A;  1POG A;  4A6D A;  4ZDO A;  2FML A;  4PZJ A;  2A68 F;  3ONQ A;  5IYC J;  2DXI A;  3I59 B;  4JOM A;  3H5N A;  3KE2 A;  1G59 A;  2HOE A;  2XUB A;  3VPR A;  5GAD J;  2Z2S B;  3OS2 A;  4EMS A;  1RIO H;  4BGD A;  1EA3 A;  2BVM A;  3ZQ7 A;  2VJ4 A;  1IN4 A;  2W7N A;  2BE5 F;  5BPI A;  2E7X A;  3MKL A;  4Y52 J;  1Y56 A;  2E35 A;  1WJA A;  4HPQ A;  5F0F A;  3JRD A;  4RAZ A;  3CMY A;  2BY1 A;  1OYI A;  3MZ8 A;  1Z7U A;  4A3J J;  1R5I D;  3HHH A;  3QWL A;  1XD7 A;  3J81 K;  2BW3 A;  1S7A A;  1X4O A;  3V4G A;  5IOZ A;  3BJA A;  1D0Y A;  3I4N J;  3VWB A;  4HRI A;  4IQJ A;  1J9I A;  3KP6 A;  4LFU A;  1FX7 A;  4NDL A;  5K5O A;  3ZQH A;  4AVZ A;  2K27 A;  3OL4 A;  4HNU A;  2P7V B;  2V79 A;  3OYH A;  5IOY A;  1MND A;  1SMT A;  1S6L A;  4L9V A;  1AWC A;  1EH6 A;  5KVR A;  1GVD A;  4S04 A;  3MKW B;  2V9V A;  1X1C A;  5JLW A;  2BXY A;  4JQF A;  5E3N A;  4GGG A;  2Y75 A;  3G1O A;  3ABT A;  1BN5 A;  3ML6 A;  4HV5 A;  1W5T A;  3IRR A;  1XB4 A;  4IPA A;  1SFK A;  2MH2 A;  4LB6 B;  1JKO C;  1U78 A;  2HOT A;  4FT8 A;  4UUS B;  4FCY A;  3HB9 A;  2VI6 A;  4OIP F;  2V6C A;  1SD6 A;  4I0A A;  4P9U A;  2KZG A;  1D8K A;  3FXU A;  3OIQ A;  2QZ8 A;  1TTY A;  4V2G A;  3HOX J;  1LB2 A;  2ZFW A;  4Z2Y A;  1QQI A;  2OBP A;  3JRA A;  2HZT A;  4BE2 A;  2R7V A;  1BI3 A;  4PGG A;  3HOZ J;  4BHP A;  2J5P A;  2FNP A;  2LRE A;  3ZPL A;  3KP7 A;  5IYB J;  3K69 A;  2PMZ A;  3FMQ A;  4A93 J;  2FOK A;  3S8P A;  2DMT A;  5E17 F;  2E1O A;  4UXN A;  3A1Y A;  5L3B A;  3GZ6 A;  2E19 A;  4EJW A;  2H6C A;  3DTE A;  2VBZ A;  1GXP A;  3PQK A;  4KN7 X;  2LBF A;  2P6T A;  3OV8 A;  3P7N A;  2HXI A;  3WHB A;  4LMY A;  4UB8 C;  3BTI A;  3FHZ A;  4EGZ A;  3M4O J;  2OTJ I;  1RUN A;  2F48 A;  5JHF A;  2R93 J;  5JVG F;  2L5Q A;  3SEQ A;  1SFO J;  1T0F C;  2M9H A;  2FA5 A;  5F1R A;  2RC4 A;  3AAF A;  3DEW A;  3L1P A;  3Q9V A;  3AL0 C;  4RGU A;  4BH9 A;  2A69 F;  3N97 A;  3ESW B;  2VE9 A;  4MQV A;  2PMZ N;  4HA8 A;  4MGR A;  5CPR B;  5L3E A;  1OCZ H;  4HX7 A;  2KIF A;  1LVA A;  3PO2 J;  1EKE A;  4RB1 A;  2X6X A;  1WHU A;  2XF7 A;  2H27 A;  2LTP A;  3QPT A;  2R5Y A;  1LNW A;  2QLZ A;  3HEF A;  3BQZ A;  4B44 A;  3HL2 A;  4CCJ A;  5C4J J;  1J5Y A;  2ISZ A;  3KLO A;  3BR3 A;  3DP7 A;  4BBR J;  3WGG A;  1BIB A;  5KK1 A;  4CYC B;  5EJC A;  4J01 A;  2EIM H;  4BQN A;  4IXA A;  1FIP A;  2LYC A;  5FLX K;  3GFL A;  2Q2E B;  3K9T A;  1UST A;  4L5I A;  2XKP A;  5L3F A;  4XON A;  2JUG A;  4U7D A;  1CGP A;  3JRH A;  4UUT A;  5J1R A;  1ERD A;  1UZC A;  3QOP A;  4MFD A;  3SYT A;  1I50 J;  4KMU X;  4AIH A;  2K9L A;  4EV0 A;  2WAD A;  2EV0 A;  1XMA A;  3IH4 A;  5GPA A;  1K7A A;  2Y0S A;  2V1D A;  1ZR4 A;  4DBR A;  3EPZ A;  1HXD A;  2QBY B;  2WV0 A;  3H5R A;  4C2U A;  3SFZ A;  2R7T A;  5A2Q Z;  4XQF A;  5FB2 A;  2E60 A;  3LSP A;  2DFH A;  2QKL B;  4RMN A;  4Q48 A;  1FBQ A;  3NAR A;  1QZY A;  3DBH B;  4X1E A;  1HKT A;  2FBK A;  1LE8 A;  5DTD A;  1OCP A;  4L0Z B;  1DU6 A;  4DW6 A;  1HQC A;  2HYG D;  3TDZ C;  3K4L A;  2BHZ A;  3K4C A;  2F5E A;  2K85 A;  4DZJ A;  4P5O A;  3U2R A;  4ZC3 A;  3M1E A;  3VYT B;  5LGU A;  1TC3 C;  1M1E B;  2LY1 A;  2GBY A;  3M9A A;  3E6C C;  4LJZ F;  4RM3 A;  4Z6Y A;  2L3D A;  1WH5 A;  2Y0S N;  4C3I J;  1O3T A;  1GLN A;  2FEZ A;  5LFA A;  3V8J A;  3E6B A;  2HI3 A;  1Y1V J;  4BAY A;  3H0D A;  3RDI A;  5J8F A;  1U2W A;  3JSO A;  4ZYG A;  1DDN A;  4KIG A;  5DD4 A;  5H6R A;  5BS6 A;  3BLY A;  4ZDP A;  2MW8 A;  2R7S A;  2VUM J;  2VXZ A;  2W57 A;  3HIF A;  2AXL A;  3JCU C;  2XGX A;  4CDG A;  3K2A A;  3JRI A;  2X6W A;  4BY1 J;  3PJR A;  5ERI A;  1D1B A;  1Y6I A;  1PDN C;  3I0T A;  5JHU A;  3L00 A;  5GPC A;  3SDB A;  3BTC A;  5J1U A;  4DJA A;  5EF6 A;  2AQF A;  3ZGK A;  3H92 A;  1RKT A;  2X1C A;  3DPU A;  1OYW A;  2JRM A;  3I59 A;  3KZZ A;  3ZQC A;  3ASN H;  3S1N J;  1S5L C;  4YIR X;  4IHV A;  2PX9 A;  1QVU A;  3HTU A;  2CW8 A;  5HOO A;  3OWT A;  2OC6 A;  5F0H A;  3M8E A;  4XKV A;  1ZLJ A;  5F0C A;  2CUE A;  5F08 A;  1ETQ A;  3S3N A;  3B6C A;  4G6D A;  2GLO A;  2M0C A;  3W2V A;  1FOY A;  3GF2 A;  4QWQ A;  1ZG3 A;  5E3O A;  5E1X A;  1ON2 A;  5GTH C;  2DA1 A;  2XSJ C;  1A6I A;  2EZL A;  4ESB A;  3CD6 I;  4WX9 A;  3GTO J;  3TOB A;  2ZXH A;  3P5J A;  2V7F A;  2QSG X;  5H6Q A;  5M5Y J;  4CIC A;  1MBK A;  1FSE A;  2NXN B;  1RC9 A;  4U0Y A;  1FEX A;  1CF7 B;  4MQ9 F;  2HDC A;  4UUV A;  3GEZ A;  3WE2 A;  2MC4 A;  4KT5 C;  4D9J A;  4WK8 F;  3JRG A;  3HYI A;  4LG0 B;  3KZY A;  4PUS A;  4G94 A;  4V2F A;  4E7L A;  3OYG A;  5FLM J;  1ETO A;  5FKO A;  2IA0 A;  1TWA J;  3QPH A;  1ZH5 A;  2R7D A;  3E1S A;  4RAF A;  5HS8 A;  1YIT I;  2DMQ A;  2DAO A;  1TP4 A;  1TZL A;  2D2W A;  5F64 A;  3OYI A;  4G9Y A;  4HX8 A;  2FUG 2;  2KRC A;  4XL9 A;  4OWR B;  1ZGJ A;  4GCV A;  1S72 I;  1YW9 A;  6PAX A;  2BXZ A;  1G3W A;  3Q0V A;  5AIP A;  3WHC A;  3NWT A;  2LKS A;  4NQW A;  2YS9 A;  2UWM A;  1X1P A;  2HPI A;  1Q1V A;  2KFD A;  3R61 A;  1XMX A;  1AU7 A;  4KIS A;  4ESF A;  2EA4 A;  2CQN A;  2RQP A;  3G1M A;  2E5Z A;  2A5Y B;  5HDK A;  1ZRF A;  2HQN A;  4UB6 C;  2NVQ J;  2RNJ A;  9ANT A;  1WJD A;  2BV6 A;  3D1N I;  4EM2 A;  2RNG A;  3C1D A;  2B7E A;  1GT0 C;  1U8B A;  4HLY A;  4BHB A;  5HS7 A;  3K1N A;  2KRH A;  3WTS C;  2IA2 A;  2XAU A;  2YSR A;  3LSK A;  3KET A;  5EEG A;  2K86 A;  2MYS A;  2VQC A;  1I6H J;  4HSR A;  4WF2 A;  4PJM A;  3MFK A;  1LFB A;  1TT5 B;  1JUM A;  1J7K A;  3SZT A;  3BZ6 A;  4CXF A;  2AHQ A;  1S8N A;  1MMS A;  2DA2 A;  1UMQ A;  2VBW A;  2X6O A;  2Y9Y A;  1QO0 D;  4IL6 C;  3VEP A;  3WGI A;  2Q0O A;  5A2Q K;  4A3F J;  2IT0 A;  2NVY J;  4AVP A;  3HSE A;  3PIP F;  4A3G J;  2I10 A;  2BHY A;  1U9O A;  3MMY B;  4WXD A;  3JRC A;  1PYV A;  1LFP A;  1HKS A;  1XG1 A;  4BEH B;  2HPM A;  1HF0 A;  2M7B A;  2P5K A;  4WXH A;  2HQ5 A;  4RLQ A;  1WZ2 A;  4YG2 F;  2Z16 A;  3Q0W A;  4DYC A;  4IVN A;  2DT7 B;  2EFW A;  3EET A;  4BXX J;  2NOG A;  3FWE A;  3B6A A;  1TW3 A;  2KP6 A;  4CGZ A;  2FQ3 A;  4XOP A;  4CYC A;  2O0Y A;  1SFX A;  1NG7 A;  1BC7 C;  3VDX A;  1TBX A;  3LSG A;  1J59 A;  2WBM A;  4BYY A;  1PJR A;  1F36 A;  4XN0 A;  1AOY A;  3AG2 H;  2HXO A;  1AKH B;  1A36 A;  4BBS J;  3O8H A;  2DTZ A;  4HBL A;  3ZRG A;  2KHM A;  3ZQG A;  1P7I A;  2NNY A;  2NRA C;  2ZO4 A;  3FXR A;  4E7I A;  2GWR A;  4LIU A;  1U3E M;  4XOT A;  3F6V A;  3CF5 F;  1QA6 A;  4U0V A;  4F92 B;  1TT0 A;  1NK2 P;  4XLF A;  5LBQ A;  1EH8 A;  2W24 A;  1RES A;  2OA4 A;  2VC1 A;  3OYA A;  4B47 A;  3E7L A;  3QAH A;  1VI0 A;  3WU1 B;  2QBY A;  2MLG A;  4HQE A;  4ZJZ A;  3RZD J;  4HX4 A;  4B4C A;  2F5V A;  3LSJ A;  4ZTJ A;  1MJB A;  3WTY C;  1HDD C;  3EDP A;  3KLN A;  5M5X J;  4D1Q A;  2DK5 A;  3LQR A;  5JLX A;  1DP7 P;  4MTD A;  1E3H A;  3QP6 A;  3U1D A;  2QQB A;  3HOT A;  1SAX A;  3GZN B;  1YJW I;  3HDD A;  1QZZ A;  4HNT A;  2RRE A;  3EUH A;  1HDP A;  1YS7 A;  5E1W A;  3S1M J;  1TWF J;  1UB9 A;  1MBF A;  3WE3 A;  1IDY A;  1BOA A;  2TCT A;  5GTI C;  5DYM A;  3W6V A;  2LSO A;  1U8R A;  2HDW A;  2LC2 A;  2R7O A;  2W25 A;  2DOE A;  1V5F A;  1P2F A;  3VOD A;  4IHT A;  2EZK A;  1V4R A;  1UHM A;  1Z21 A;  2XPV A;  3OS1 A;  4V19 K;  1D5Y A;  3O2P E;  1W1W E;  4Q5S F;  3FF5 A;  4HEA 2;  1SVL A;  2H1K A;  3GTK J;  3GTP J;  4LLG F;  1KZH A;  4Y15 A;  2KMU A;  3C3W A;  4M9S A;  2EFO A;  1B8I B;  2HKO A;  1B9M A;  3HM5 A;  2QQ9 A;  3TDU C;  4LLL A;  2LBF B;  1C0W A;  2L4A A;  3W6J B;  2IXS A;  4I76 A;  3TGN A;  2PJR A;  1LVK A;  5C4X J;  3TP0 A;  3SEZ A;  4OAZ A;  4A5N A;  4B3X A;  4PSW A;  5M3F J;  1JTX A;  5D6F A;  5GAH J;  4JK1 X;  3JW4 A;  2JSC A;  4AYB A;  2DTR A;  4P1W A;  1WJ5 A;  2FX0 A;  4HF2 A;  3ABU A;  1R4M B;  1O7F A;  4KMF A;  1ZYR F;  5E3L A;  5DEQ A;  2YX7 A;  3MCZ A;  1FP2 A;  4F93 B;  2FE3 A;  4K2E A;  3W3C A;  2XHK A;  3NWS A;  2DJI A;  1ZR2 A;  1W0U A;  4PCQ A;  3ZMV A;  1J0R A;  2OU2 A;  5EZH A;  3RCO A;  2GIZ A;  3O8G A;  3LAP A;  4BNC A;  2FMY A;  4DYR A;  4BKX A;  2VPR A;  2EIN H;  2Z5U A;  1CF7 A;  2XAG A;  4HNV A;  1ZQ3 P;  3ZP5 A;  4HDV A;  2R5Z A;  2W4S A;  3BG3 A;  2M3A A;  3HSR A;  2CQX A;  1YW7 A;  1ZLK A;  4LG0 A;  3F9K A;  1JKP C;  5EDN A;  4EVI A;  4OMZ A;  2MA3 A;  3PNV A;  2VPL A;  3C2G A;  4AYB N;  4ON0 A;  1HC8 A;  1JHF A;  2O3F A;  3LA7 A;  3VYS B;  2JK3 A;  3KPH A;  4A0X A;  4YFN F;  3IAM 2;  3GUD A;  1PUF B;  5J6X A;  2PN6 A;  1WGX A;  2AS5 F;  4RAY A;  4XID A;  2XV4 S;  1ULY A;  2LF8 A;  3KYL A;  5K5Q A;  3IAS 2;  3KIO A;  2BVL A;  4CYD A;  3G6E I;  3TW7 A;  3ZXS A;  1SAU A;  3H1C A;  3WTT C;  4JBA A;  2JN6 A;  2QVO A;  1LE8 B;  1QVT A;  2B0L A;  1APL C;  3QPL A;  1ZRE A;  2KJC A;  5HDN A;  2QF7 A;  1OPC A;  4P96 A;  3SQN A;  2VBX A;  1MD0 A;  2E2H J;  2V1X A;  5E8I A;  1FOW A;  4XRS G;  1VQ8 I;  1MH4 A;  3IL2 A;  1D5V A;  2GZW A;  1MMD A;  2ZXJ A;  1MBJ A;  1WCM J;  3GFI A;  2DQL A;  3BZK A;  1FIA A;  3G73 A;  2PJP A;  1MKM A;  4OU0 A;  2STT A;  4KDP A;  1BL0 A;  3GW2 A;  2DFE A;  2WV1 A;  1QRY A;  3GME A;  3BDD A;  1ETV A;  2DU9 A;  3CCL I;  2ACJ A;  1YIO A;  3OIO A;  1KU9 A;  4CZZ A;  2EPF A;  3K4J A;  3TL4 X;  2JRT A;  3CUQ C;  3GTJ J;  2DDB A;  2EFP A;  1HW5 A;  2UUZ A;  3I56 I;  1Z05 A;  2O8X A;  2OAZ A;  2HQA A;  4C2T A;  3WTZ A;  2WA0 A;  1K79 A;  4A3E J;  4L9T A;  3HOU J;  2Q1Z B;  4E7K A;  2M87 A;  3FK6 A;  4BEH A;  3KCC A;  3OYN A;  3CO6 C;  1ZRD A;  2QSH X;  1WRJ A;  4C9Y A;  3PUB A;  3HRU A;  3TO7 A;  2XRL A;  1GDT A;  3RYR A;  4BDZ A;  2ELK A;  2R3S A;  4HYE A;  4XK4 A;  3KX2 A;  1ZAO A;  1H88 C;  2E1M C;  1JJ8 C;  4KJZ A;  3BPX A;  5HS9 A;  2NOJ B;  4XLA A;  1VZ0 A;  1S7E A;  2ME6 A;  4EQQ A;  1YX3 A;  4N4N B;  3CO7 C;  5DUI A;  4C3H J;  2YU3 A;  2DA4 A;  3W2W A;  2PFB A;  2Y31 A;  1AKH A;  4E7S A;  4D7M A;  5JVT A;  2L0K A;  2VAS A;  2LVS A;  5H20 A;  1NHA A;  2MBF A;  2HYF A;  2MH9 A;  2J5O A;  3BZC A;  2JA5 J;  1JKR C;  3V7S A;  2HTJ A;  3ECH A;  2AQE A;  2NAZ A;  1BR1 A;  2K7L A;  3MEX A;  1SFU A;  5FD5 A;  3W2A A;  5D4R A;  2VIX A;  1FYK A;  5C3E J;  2OZU A;  2RV8 A;  4KA4 A;  1ZKG A;  2HFH A;  3I4P A;  1R1V A;  1WI3 A;  4AD9 A;  1DPR A;  2XF5 A;  5K7Z A;  5F1J A;  5LGN A;  1OIS A;  1MBG A;  1S9H A;  2KIS A;  4QSH A;  4Y33 A;  4CCM A;  5IP6 A;  4IHW A;  2XPU A;  3E5Q A;  3D5S C;  1J75 A;  4II2 A;  1Z1D A;  2E1C A;  1XGM A;  4UVA A;  1U5T C;  2WY8 Q;  4ENN A;  3LWF A;  5CQG A;  4BUP A;  3T1B A;  4M3B A;  1FBU A;  3S16 J;  1BC8 C;  2OPT A;  1OCC H;  1UHW A;  4M9X A;  2Z33 A;  3OYF A;  3V8L A;  3CLQ A;  5CLS A;  2CU7 A;  2IVM A;  2ID6 A;  1VQP I;  4PJN A;  2LY9 A;  1W7P D;  1N77 A;  5AIQ A;  3CJT B;  4UV8 A;  1MMN A;  1TW2 A;  5D5U B;  3QRF F;  5D5W B;  1YYV A;  2V9K A;  4NQW B;  2EBI A;  2XAF A;  3HRM A;  1R00 A;  3I55 I;  1YLF A;  1ETY A;  5DM7 F;  2KKO A;  4IOA F;  3K1M A;  1HOM A;  1RET A;  1B8I A;  2BZT A;  2JVH A;  3LSM A;  2Q8K A;  4XBF A;  2CUZ A;  1O3S A;  3LFU A;  3S2W A;  3IKV A;  5DDG A;  3PUF A;  2F4M B;  3RIR A;  2DYR H;  4H4K C;  1HW1 A;  1FSH A;  1X1D A;  3DBR B;  3J7Y J;  3HZJ A;  2YX4 A;  1HST A;  5D8L B;  2DMU A;  3BR1 A;  2O9L A;  4CCK A;  2EK5 A;  2HOA A;  1WQ2 A;  2ID3 A;  4Q4Z F;  2ADU A;  1VQ4 I;  2M7A A;  2BEO A;  3IH3 A;  2DBB A;  3IC7 A;  1DU0 A;  4A3B J;  1UG2 A;  4XN3 A;  1IJW C;  2DFF A;  3QOE A;  3ZMS A;  5KAF C;  1I39 A;  5E3M A;  3ECO A;  1IRG A;  2KDO A;  1T38 A;  3BG5 A;  3OIP A;  3PSI A;  1F1Z A;  1SVO A;  4YEL A;  1T0F A;  2M0M A;  3WTV C;  4F7Z A;  1J09 A;  2P5L C;  5D8K B;  4F3Q A;  1Y8Q B;  2LR8 A;  2CGP A;  4R1H A;  2EA2 A;  2QSF X;  2XAQ A;  2O8K A;  1R5H A;  2ZME C;  1FT9 A;  1FWZ A;  2FOW A;  2H09 A;  3DF8 A;  3H3Z A;  2BOL A;  3AKZ A;  1P9Q C;  3ZQL A;  4CSW A;  1F9N A;  3U1K A;  1B72 A;  4QTR A;  3CCS I;  3MQ0 A;  1G3T A;  3CME I;  4KT6 A;  4KIB A;  1TWG J;  3IP4 B;  1V54 H;  1DPU A;  3U9G A;  2KQR A;  1BW5 A;  2DN0 A;  5LLQ A;  3L2V A;  1ODD A;  2W00 A;  4XM3 A;  1JHH A;  4RAG A;  2WWY A;  4XIC A;  1MGT A;  3DTK A;  4F52 A;  2ZSH B;  3E3V A;  1PUF A;  2HZD A;  1IN6 A;  1Z7L A;  4ESJ A;  4ENJ A;  5ILS A;  4IRH A;  4I01 A;  1KON A;  2CUJ A;  2DCE A;  2VKH A;  3DWL E;  4UVC A;  1P7J A;  1VTN C;  1Y0N A;  4NHJ A;  1LQ1 A;  3B73 A;  2IAI A;  1BR4 A;  2RN7 A;  4CCN A;  2LF7 A;  4JX6 A;  1FY7 A;  1LEB A;  4KNY A;  3OSF A;  2I8D A;  2X9D A;  4HDU A;  1A5J A;  4AID A;  2DO7 A;  4BXU A;  3K7A J;  2R7Q A;  3PFY A;  2A05 A;  2VKD A;  4BY7 J;  4M6X A;  3BRO A;  1HSJ A;  2L4M A;  4HV6 A;  4RS8 A;  1KQ0 A;  1OCT C;  5HLH A;  4XRS A;  4XLE A;  2K4J A;  3I3L A;  3IWF A;  5AON A;  3CES A;  1ETW A;  1BOB A;  1BJA A;  2E2J J;  3BR0 A;  3RSN A;  3BWG A;  1Y39 A;  3BOQ A;  5FKN A;  5HVQ C;  2ZXW H;  5F27 A;  1LDJ A;  5FKK A;  5DM6 F;  5EZG A;  2R4G A;  5FGM A;  2QGU A;  2KIQ A;  3OSG A;  2EZH A;  4MTE A;  2K9N A;  3SDG A;  1ACI A;  3SZG A;  4XKW A;  1G4D A;  2CV1 A;  2HNH A;  3K6G A;  2EQR A;  2FBH A;  1I3A A;  3LMM A;  3ZN0 A;  1EF4 A;  2KIU A;  2PJR B;  4IZZ A;  2OJE D;  4HG2 A;  1GV5 A;  2X4H A;  3FMS A;  3HBL A;  1KYZ A;  2IPQ X;  1Y0U A;  1XCB A;  3MZH A;  5KAI C;  2YPR A;  1ZRC A;  1TQM A;  1TWH J;  3FM5 A;  2VBY A;  3GCM A;  1PVE A;  2XGD A;  2FF4 A;  3KYD B;  3QPS A;  3VSK A;  3VYR B;  1I1S A;  2LK2 A;  2Z1D A;  2ELH A;  4L5E A;  2DJN A;  1T8I A;  4OMY A;  3H9Q A;  4RGS A;  2CQ7 A;  1EJ9 A;  5K5R A;  2ZCW A;  1A6Q A;  1IW7 F;  1FYL A;  1K83 J;  3MD2 A;  1X19 A;  4FIS A;  4BQA A;  3GFJ A;  2PG4 A;  3R0A A;  2K3F A;  1S3J A;  1XCV A;  1WVR A;  3DXJ F;  3K2Z A;  3KP3 A;  2CFX A;  3ULQ B;  1G2H A;  4HQM A;  5LEJ A;  1BI2 A;  1ZAR A;  3HRT A;  3L09 A;  2ZJP F;  4NBQ A;  1TQI A;  2R5Z B;  4ZYA A;  3QU6 A;  3JRE A;  4JP0 A;  4NUB A;  2EH3 A;  4DZP A;  4U7B A;  1BI1 A;  1R7J A;  3EUK L;  3F72 A;  1Y8R B;  1XGN A;  2M34 A;  4XLN F;  3F21 A;  2G9W A;  5C44 J;  2R7Z J;  4NC7 A;  4UV9 A;  3IH2 A;  4BXF A;  5B66 C;  5FD6 A;  3WOD F;  1KA8 A;  4AC0 A;  5KCM A;  3HHG A;  3GVA A;  3ELK A;  5LRR A;  3HPH A;  1K78 A;  4BDY A;  3TKY A;  4F91 B;  2FQ4 A;  4AWX B;  1H89 C;  3E0J B;  4BJ5 C;  1KU7 A;  1R22 A;  4GO1 A;  1B6A A;  3CJN A;  3H9G A;  2WB1 A;  2IGK A;  2IGN A;  1XSD A;  2JJ7 A;  1TNT A;  3TED A;  4WCG A;  4GXO A;  1OCR H;  4BL0 B;  5K7H A;  1W0T A;  3TMO A;  1V5E A;  2STW A;  2X6Y A;  1I5Z A;  1ORK A;  3DQV C;  1LDD A;  3FBN B;  5ICG A;  4L18 B;  1X58 A;  4PJ0 C;  2KRF A;  1IUF A;  3F8F A;  3FXL A;  3I9V 2;  1SMY F;  4IHX A;  1OR7 A;  5HLI A;  2VC0 A;  5H2F C;  2JA2 A;  1TNS A;  1YS6 A;  2DFI A;  2P0W A;  3QYF A;  4Y13 A;  1K4S A;  4RGX A;  4YFX F;  1LKX A;  1X3U A;  1FBS A;  5J4Y A;  1X2M A;  2WB1 N;  4ZTF A;  1YJN I;  2DI3 A;  1N75 A;  2COM A;  1E3O C;  3H0G J;  5LRS A;  3NQO A;  3PNT A;  3RKQ A;  3TO9 A;  4OIO F;  4EJU A;  1X1A A;  3V7C A;  3ZQI A;  2B63 J;  3BT9 A;  1W5C C;  2I5U A;  2NS0 A;  5IPA A;  1CQT A;  3G3Z A;  4YRV A;  2LP0 A;  3HKZ A;  2CJJ A;  4MNU A;  3HTS B;  4LOC A;  3FMR A;  2VT3 A;  5FFX A;  5GP9 A;  3CMM A;  2F2E A;  3S2D J;  1I6X A;  4G12 A;  4L9N A;  4RBO A;  5TIS C;  3A02 A;  3A4C A;  1OYY A;  4XOR A;  1JKQ C;  3CDH A;  3S32 A;  4W1U A;  2FJ1 A;  2G7H A;  1OQY A;  3L2R A;  3C7J A;  5FLV A;  1U0J A;  4LG3 A;  3G1L A;  1W5S A;  1WJC A;  4L9J A;  3H36 A;  2F5D A;  3JR9 A;  4YFK F;  1JGG A;  4Y7N J;  3DCF A;  3MKZ A;  2BY2 A;  2GOM A;  4A3M J;  1R9T J;  1L3L A;  1P4W A;  2ESN A;  4CZC A;  1MZB A;  1YRN B;  3F8B A;  4D5C A;  4ZDL A;  1X1B A;  1Z91 A;  4BQQ A;  2F5C A;  3HKZ N;  3LSI A;  1X3Z B;  2ZB9 A;  3ABM H;  1LJ9 A;  3OS0 A;  4IKF A;  2UV1 A;  5HOD A;  5B1A H;  1FLI A;  2GXA A;  4PK4 A;  1B59 A;  2X48 A;  3FZV A;  3M07 A;  5KHD A;  2ESH A;  1MNE A;  4O6J A;  3CDI A;  1ONV A;  5ICF A;  3TQN A;  3DKX A;  1TLH B;  2WC2 A;  1XGS A;  3OYD A;  3G4S I;  3CZ6 A;  3CCJ I;  1XGO A;  1V3F A;  2EV6 A;  3QQA A;  3CCM I;  2M2E A;  2W85 A;  2QWW A;  3RTR A;  1ZTR A;  3IKT A;  2Y48 A;  3DTI A;  4PJL A;  2DQR A;  4AUX A;  2JPB A;  4TV7 A;  4A2U A;  5HDG A;  3HOY J;  3PM1 A;  3E6D A;  4S05 A;  2X51 A;  5FJ8 J;  3BJO A;  3J7Z I;  1T2K A;  1NH3 A;  2E1N A;  2ECB A;  2ZNZ A;  3EUH C;  2CUF A;  1YX5 A;  2EIJ H;  1DGW Y;  4JYK A;  3ZN1 A;  3L9F A;  3FKJ A;  3DEU A;  4IQ4 A;  4IJA A;  2XDV A;  4KN4 X;  2L7M P;  3RQ4 A;  2R7X A;  1A04 A;  2M4G A;  2M5W A;  1DP3 A;  1T08 B;  3SFI A;  4IX7 A;  1UFM A;  3BR6 A;  4FET A;  3C2H A;  1ETX A;  1VQM I;  3FKI J;  5FRO A;  2DPU A;  1W7P A;  2M4K A;  4J00 A;  3KP4 A;  2CV2 A;  3J80 Z;  4UY8 I;  4KIF A;  2Z9O A;  2H1L A;  1ZK8 A;  2L7F P;  3GBG A;  2V4J C;  2DDA A;  2JA7 J;  2R7U A;  2L7Z A;  5CVR A;  2DW4 A;  1BW6 A;  3K1P A;  3MAJ A;  3MN2 A;  3N05 A;  3SHF A;  4EGY A;  4PDK A;  1IRZ A;  2BBY A;  2KJB A;  5TRD A;  1VFC A;  5CVJ A;  2LLK A;  5DS9 A;  2FNA A;  4IRI A;  2NS7 A;  4G7H F;  2O03 A;  1MDM B;  3Q0U A;  3BQY A;  4I09 A;  1IO2 A;  3KZI C;  5GAG J;  2ZFU A;  3L2C A;  1MSF C;  3OMY A;  2QQ8 A;  3WG7 H;  2TDX A;  5HNH A;  2ZNY A;  4UHT A;  5B5E C;  5E8G A;  4KIT B;  2R7R A;  2W82 A;  3ABK H;  3REO A;  1R71 A;  3NEU A;  2O6G E;  4IRG A;  1XTA A;  2ETH A;  3P9K A;  2JSP A;  1VQK I;  2JA8 J;  4KIC A;  4MEX F;  3M7G A;  1XS9 A;  4IF4 A;  4XLH A;  2WY7 Q;  3AL0 B;  2MFZ A;  5CJ9 A;  1IG7 A;  2HYJ A;  3JRB A;  1JJ6 C;  3H3V K;  2XGE A;  1BJZ A;  5JI6 A;  3S15 J;  2P4W A;  4HW0 A;  1TQP A;  1P4X A;  2VL8 A;  4N4O B;  2LH9 A;  5JFR A;  1B72 B;  2L9R A;  1FOK A;  2WAE A;  1IF1 A;  1I27 A;  3FDY A;  2OQG A;  1IXS B;  4EM1 A;  4HF1 A;  2GM4 A;  3CTA A;  2K9Q A;  3D5R C;  1ZGA A;  2O5R A;  4FHT A;  1ETK A;  1R1U A;  3OYJ A;  3L2W A;  4LD5 A;  1MMG A;  4FE7 A;  4QLC U;  4EJV A;  5FKL A;  3BJ6 A;  2Y0M A;  2MSY A;  3LA3 A;  3LL7 A;  3BPV A;  3MWM A;  2MC3 A;  2VQL A;  2Y69 H;  4R8H A;  1S7O A;  4OOI A;  3GTG J;  1IDZ A;  3RPU D;  3LSH A;  4IO9 F;  2VOD A;  5LHG A;  1HBX G;  1OCO H;  1MNM C;  3QP5 A;  4L5J A;  3RKY A;  5E20 A;  1FOX A;  2IGM A;  4I99 C;  2DK8 A;  4A3K J;  2IS4 A;  1EH7 A;  1ON1 A;  1JXS A;  2E71 A;  2L02 A;  1SC7 A;  3V8K A;  1U9N A;  2R7F A;  1B1B A;  2RKH A;  4FE4 A;  5FRN A;  3BG7 A;  2CMP A;  4A3L J;  5E1Z B;  3O6B B;  3LFK A;  2QYO A;  2IS2 A;  2KT0 A;  2G0E A;  5LEK A;  1FZP B;  2G7U A;  5L3G A;  3AG4 H;  3TOA A;  2WAQ A;  3ABL H;  4M3F A;  1JI8 A;  5BNG A;  2L01 A;  2L7K A;  5CVI A;  2EIL H;  2PBI A;  4PSX A;  2LDU A;  1HW2 A;  1YG2 A;  1IUY A;  3FX3 A;  4I98 B;  4HST A;  3HXL A;  1OFC X;  2HQR A;  2NVU B;  2HR3 A;  4MHG A;  1N25 A;  3ZMZ A;  2L54 A;  1RRJ A;  4XNF A;  2XAS A;  4WXC A;  4BS9 A;  5IT9 Z;  2Y2Z A;  1MW7 A;  2K5C A;  1FJL A;  1X2N A;  1KGS A;  1KYW A;  3ZR8 X;  5LHI A;  2XSD C;  4X6A J;  1LPQ A;  1LUJ B;  5J1Y A;  1T33 A;  1RZ4 A;  2QKM B;  1P92 A;  1JT0 A;  2WAQ N;  3WTW C;  1SFE A;  2OCC H;  5IY5 H;  1V55 H;  5ILV A;  3JRF A;  4GFB A;  2V26 A;  4HLX A;  3COA C;  4ENM A;  3F8M A;  2RGV A;  4LIV A;  4QPO A;  1H9T A;  5HLT A;  1X4P A;  2NYX A;  2ZSI B;  2CW0 F;  2FU4 A;  2XPW A;  2VON A;  1G6N A;  1QU3 A;  1JT6 A;  2MLK A;  4H0E A;  2CQQ A;  2EFQ A;  3H5A A;  4M3D A;  4EM0 B;  3VSL A;  4YII A;  5ICC A;  4BE1 A;  4EJT A;  2UXN A;  1GV2 A;  3RKW A;  3DV8 A;  4ITV A;  1YRN A;  3LA2 A;  3GFM A;  2JUC A;  3OYL A;  3S2H J;  1R36 A;  3LSR A;  2OCE A;  2X0L A;  4DGW B;  4DIQ A;  3S17 J;  3TW6 A;  3OYM A;  1STZ A;  1WPK A;  1H0M A;  4FAS D;  4ZZD A;  3J80 K;  4N9I A;  5LHH A;  4PFP A;  1WFX A;  1OMI A;  2A61 A;  1YW8 A;  4ZYD A;  3EYY A;  1SD7 A;  4X0G A;  3W6K B;  3S3O A;  3F0C A;  5DD8 A;  4B3A A;  1DGR M;  5LD2 C;  2A6H F;  1H8A C;  3BR5 A;  1Z3X A;  4N0B A;  4BJ6 C;  3O3K A;  2VB6 A;  3K4N A;  1XDU A;  1QHH D;  3FXQ A;  1J2X A;  1JTY A;  3K10 A;  4HZF A;  1FC3 A;  2V1U A;  3P9C A;  3DU6 A;  4B8X A;  1XSX A;  1HKQ A;  3TO6 A;  1MJ9 A;  1WH7 A;  3BC8 A;  3QOD A;  3X2Q H;  1K78 B;  2L9S A;  2X85 A;  2TRT A;  1VQ9 I;  1UEL B;  4CA0 A;  2GOX B;  3ASO H;  4OIN F;  1MJA A;  1VND A;  2HVQ A;  2AXT C;  3M8F A;  2N8G A;  3IWZ A;  5BMZ A;  4LK0 F;  3CUO A;  1LDK B;  3B02 A;  5LGT A;  4IOC F;  1U5T A;  4A0Z A;  3ERM A;  3BCA A;  3NRV A;  1G3S A;  1WJB A;  2ZJQ F;  3PNY A;  1R1T A;  4DNC A;  1O57 A;  4D5F A;  3BR2 A;  5D6E A;  1YHQ I;  1REP C;  1BBY A;  4RM2 A;  2EB7 A;  2OZ6 A;  3C2B A;  1ENH A;  3V42 A;  4XSX F;  1ZEL A;  3DLL F;  3J7A O;  1T6S A;  2JWT A;  4XLC A;  3DLA A;  2HTS A;  2M30 A;  2DA3 A;  2CH0 A;  4JX5 A;  4OIQ F;  2YUS A;  3HUG A;  3LOC A;  3EYI A;  2DMN A;  5GAE J;  1XSV A;  3FK7 A;  4I02 A;  3G71 I;  1JUP A;  3HGG A;  4ASN A;  2HVR A;  3OYK A;  1Z6R A;  2VN2 A;  2FBI A;  2HDD A;  2IBD A;  4E7Z A;  2IEK A;  2ME0 A;  3CCE I;  3JTG A;  3AG1 H;  3EQL F;  1I1G A;  1AHD P;  3DPL C;  1GXQ A;  4U87 A;  3S3M A;  1MDM A;  1SD4 A;  4W97 A;  1FMW A;  2HOS A;  2YR2 A;  2DA5 A;  2GXG A;  3OR2 C;  2XIG A;  3WU0 A;  3S14 J;  1JE8 A;  3QYE A;  2GIV A;  1JGS A;  4G7O F;  3ERE D;  1UJ8 A;  2VJ5 A;  1O3Q A;  2BYV E;  3PQJ A;  5CKT A;  1K4T A;  2ZJ2 A;  1FMV A;  2HS5 A;  4LGW A;  2JT1 A;  4S0H B;  3OOU A;  3CJQ B;  3T0Y A;  3CCQ I;  2DT5 A;  3KP5 A;  2L9N A;  3OY9 A;  2VT2 A;  3BG6 A;  1XN7 A;  2IRF G;  2RAE A;  4EJO A;  4ZZL A;  5J8C A;  1QHG A;  2Y9Z A;  5EGO A;  2K4B A;  4LB5 A;  2NVT J;  3IRQ A;  1OKR A;  4M74 A;  1GUU A;  3FM3 A;  4HAM A;  1IV8 A;  4MLO A;  4KFC A;  1UHS A;  2KZV A;  2DOD A;  3TBI A;  4O3M A;  1EV7 A;  2K9S A;  4RB2 C;  1L0O C;  4XRF A;  1HCR A;  3DKY A;  3S1R J;  2D1H A;  3FIW A;  2B9S A;  3BP8 A;  2ZME A;  3ZOB A;  3OYB A;  1IN7 A;  2FD5 A;  4GDF A;  1VF9 A;  2YU9 J;  1W4M A;  2ZJR F;  1Y1W J;  1Z6T A;  2ZXI A;  3BTL A;  5IT9 K;  3HG9 A;  3HGY A;  4QPQ A;  3FBI B;  3GTM J;  3JAM Z;  1MH3 A;  1F4K A;  3L7W A;  2KIM A;  4E6K G;  2QEN A;  4A5M A;  3K70 C;  2CW7 A;  4A0Y A;  2IS6 A;  4YEJ A;  3HSF A;  2NNN A;  1XDS A;  4I6Z A;  3F22 A;  2W84 A;  2RVC A;  2CRG A;  5EEH A;  1O3R A;  2LD5 A;  1USS A;  5E79 C;  3F8C A;  3FXJ A;  4F55 A;  3BCB A;  3AFH A;  1E2X A;  5EYR A;  5FRM A;  3L2Q A;  1R5G A;  3HOW J;  4OAY A;  4BU2 A;  3RJP A;  4RB0 A;  4E4H A;  5BPD A;  2VQH A;  2QEX I;  1R6R A;  2EIK H;  3UNG C;  5HNF A;  2VE8 A;  2M8E A;  4CO8 A;  2A07 F;  5IP7 J;  1F43 A;  3SXY A;  1UAA A;  1SVM A;  2PEX A;  3Q3S A;  3CCY A;  4A12 A;  2DLL A;  1FP1 D;  3BTJ A;  4M3E A;  3WTU C;  1D1C A;  3H3U A;  2VJJ A;  2CV0 A;  5B3S H;  1W7P B;  2EZI A;  4G8X A;  3SZP A;  2R0Q C;  1O7L A;  5CVV A;  3HC7 A;  2M8G X;  5BQT A;  2H94 A;  2XB5 A;  3M1C A;  2HEO A;  2OD5 A;  1MSE C;  4PFO A;  4M3G A;  4C30 A;  4CUG A;  3D5L A;  1YE9 A;  3LST A;  2P7C B;  2V9P A;  2A6T A;  2KPM A;  4EEF G;  2L2O A;  3M8J A;  1X3W B;  3IUO A;  2MAB A;  1SAN A;  4MEY F;  2BGC A;  2IA1 A;  2VKE A;  3R60 A;  3LNQ A;  1R4N B;  2P81 A;  1VQN I;  4Y4R A;  5IP9 J;  1IAW A;  2MGQ A;  2XAH A;  3PFI A;  2XRO A;  4UNO A;  2UXX A;  1AA7 A;  3DBL B;  1W36 C;  4EAT A;  1F5T A;  1E3P A;  2VQG A;  1IGN A;  3CCR I;  1BIA A;  4FTH A;  2MD0 A;  3IV5 A;  1D3Y A;  4IEJ A;  4U0W A;  2JPC A;  1FTZ A;  3A01 B;  3FIS A;  3ISP A;  2QCO A;  3DU5 A;  2JQ7 A;  1Z9C A;  2O61 A;  3FXK A;  4RGR A;  4BAC A;  2V6E A;  4D7N A;  1VQ6 I;  3GYH X;  3HJE A;  1K61 A;  1B9N A;  3BG9 A;  5F04 A;  3F6O A;  2DMP A;  4M73 A;  4E7J A;  4IHS A;  5DCM B;  4J19 A;  3S93 A;  2EV5 A;  5L3D A;  2FRH A;  2JVG A;  2LG4 A;  3E97 A;  3HPG A;  3KP2 A;  4O5V A;  4XMY A;  5ILU A;  3FXO A;  3L2U A;  2OV7 A;  3S1Q J;  1IRX A;  3E5U A;  4OIR F;  4LK1 F;  1B4A A;  4AIK A;  2CO5 A;  3I64 A;  4HOB A;  3T8R A;  1A35 A;  1G8X A;  1TWC J;  3BY6 A;  4GYG A;  4A69 C;  3PSF A;  1UCR A;  4PGH A;  5D5X B;  3J7A Y;  3PIO F;  3A2K A;  2KDZ A;  3RPU A;  2GA1 A;  1BI0 A;  4NB5 A;  1D0Z A;  4UUS A;  1ZHF A;  1K6Y A;  2OQR A;  3F23 A;  1IV6 A;  3GTQ J;  4Y3O A;  4XR6 A;  3A0H C;  3CCV I;  1Z3Y A;  1DQU A;  2D45 A;  4WWC A;  3PO3 J;  4M6V A;  1FTT A;  2LMD A;  4AM3 A;  4Q47 A;  2IW5 A;  4NNJ A;  2XRN A;  3OL3 A;  1IN5 A;  2C6Y A;  3FHN A;  2ZC2 A;  1P4A A;  3DKW A;  1XX5 A;  1OR7 C;  2CQK A;  4MIM A;  3WTX C;  1YJ9 I;  4XKB A;  4QIW N;  1BM9 A;  1IRF A;  3IHU A;  3LQQ A;  2ELJ A;  3WGH A;  4I0B A;  2AO9 A;  3GO5 A;  2VOP A;  3T5X A;  3VFZ A;  1ZG1 A;  3H9J A;  1YTY A;  5D4S A;  2QUF A;  3JAM K;  2ZBK A;  2HU9 A;  2IP2 A;  2VOO A;  3R6S A;  1PP8 F;  2XKO A;  2PI0 A;  5BOX A;  2CG4 A;  2W1O A;  3CC4 I;  2A5W A;  2XC7 A;  2XGC A;  3I4M J;  2FSW A;  4Y17 A;  4BHC A;  4G7Z F;  2HVS A;  3GLX A;  4D0P A;  2NVX J;  4C2M J;  1KQ8 A;  4A3D J;  3I54 A;  2XAJ A;  4U88 A;  3AG3 H;  2ECC A;  2LFB A;  1YOV B;  3CUQ B;  1RPW A;  5EG0 B;  2K9M A;  1N78 A;  2F6C A;  2P6S A;  2L9V A;  2PMU A;  4PJJ A;  3GZ5 A;  4ETS A;  2IJL A;  5E18 F;  2JA6 J;  3DEE A;  2E5N A;  4FX0 A;  4AIJ A;  1RNL A;  3RZO J;  4BE0 A;  4C3J J;  5K7F A;  1TL8 A;  1GHC A;  2H8W A;  2QQA A;  5ED4 A;  3HRS A;  3CF2 A;  4ZH4 F;  1GVJ A;  4RA2 A;  2E7W A;  4XKC A;  1RI7 A;  1OJL A;  2W48 A;  1MBE A;  2E1M B;  2EJR A;  1IN8 A;  5HLG A;  1E17 A;  1Z0X A;  1KQ9 A;  1LFU P;  5J3L A;  2BY3 A;  3FXM A;  4YIF A;  2F4I A;  3OYC A;  3RYP A;  3CJR B;  2CYY A;  4I7H A;  3GX4 X;  4KYW A;  2PMH A;  2Q2E A;  1VQ5 I;  2IS1 A;  4N9H A;  4ENK A;  3Q5F A;  1PP7 U;  2VXD A;  4P9F A;  4DQ2 A;  3K70 D;  3CC2 I;  1VQO I;  1T39 A;  1O4X A;  2DPD A;  1T56 A;  2HGC A;  3JTH A;  2BW3 B;  2M45 A;  2K02 A;  1MMA A;  2MG4 A;  1KU2 A;  1D1A A;  4A3C J;  1RR7 A;  4II3 A;  4KUM A;  5M3M J;  2VLA A;  3EUA A;  2DT6 A;  4M6Y A;  3QU3 A;  5M5W J;  2PQ8 A;  1NG6 A;  2GA2 A;  5ICE A;  3KYC B;  3HOS A;  3JSP A;  1U6G A;  3ZQF A;  4CCO A;  2OF7 A;  1WJF A;  2Z99 A;  3SJM A;  1IZ1 A;  2E34 A;  1U5T B;  5DCF A;  1QPM A;  2DA6 A;  1G3Y A;  2JZY A;  4HF0 A;  4RDU A;  1YI2 I;  1ZG5 A;  4M72 A;  1QPI A;  2JMW A;  5EEA A;  3KFW X;  5DV5 A;  5FFZ A;  5F6F A;  3CP2 A;  3ROU A;  2JTV A;  1PUE E;  3HOV J;  4E7H A;  2GXB A;  1WKM A;  2E2I J;  5FKM A;  2IGO A;  3HUG B;  2WTE A;  3ZCO A;  4G6T B;  3Q9S A;  5J47 A;  3WG9 A;  1NTC A;  4ZYH A;  3QYB A;  5CVU A;  2XB0 X;  1WJE A;  3E6M A;  1VQL I;  3A03 A;  3J81 Z;  2VKV A;  3K4K A;  1H9G A;  4DOZ A;  2E36 A;  3WU2 C;  1KU3 A;  4ANJ A;  5K1Y A;  4LLN A;  2QM3 A;  4B09 A;  3ZMT A;  1QZE A;  1SEU A;  4GYI A;  4CCL A;  2OTL I;  4LIT A;  2F4O B;  5L3C A;  1RR8 C;  3GWZ A;  4IHY A;  3OOP A;  2PLY A;  4MFE A;  1VQ7 I;  3R4K A;  3I5U A;  1DUX C;  4B43 A;  2K3P A;  3LAJ A;  2A6E F;  4NC8 A;  3GLL A;  3K4B A;  1W36 D;  4UVB A;  2LNB A;  4MO7 A;  1YQA A;  3M3Y J;  2LY2 A;  1WI9 A;  2RDP A;  1T98 A;  3I58 A;  4R79 A;  3E5X A;  1R49 A;  1Q1H A;  3DPT A;  2OUM A;  4M9Z A;  5EGO B;  3A01 A;  4BQO A;  3V7R A;  2Y30 A;  2V1N A;  2UZK A;  4NC6 A;  2LRD A;  1YIJ I;  3OYE A;  4A3I J;  1FNN A;  4E70 A;  2HWV A;  4AU7 A;  3MZY A;  2R92 J;  3DFG A;  3CP8 A;  2HKX A;  2P8T A;  3MVP A;  5DCM A;  1I3Q J;  2R5Y B;  3CCU I;  2ZME B;  2DYS H;  3TP3 A;  5DUK A;  4FQG A;  3ZMD A;  3KEY A;  5KNL A;  1QNT A;  4RLF A;  4CHU A;  1JUS A;  3CMA I;  2LOO A;  1WSU A;  3RQI A;  1YFH A;  3RPQ A;  1OLT A;  4XLP F;  3U21 A;  1BR2 A;  4M71 A;  3I53 A;  4JX4 A;  1ZGW A;  3F8N A;  4DBQ A;  3CC7 I;  2FXA A;  1R23 A;  2DOF A;  3UR3 C;  4L0Y B;  2F5F A;  2RQQ A;  3NAU A;  2QA4 I;  4I2O A;  1LEA A;  4GRI A;  2GQQ A;  5IYD J;  1QGP A;  3MKY B;  1SD5 A;  1D8J A;  1V5G A;  3GTL J;  2KLO A;  5TJJ A;  1A31 A;  2CS3 A;  5FO5 A;  3K4M A;  3VOE A;  3D0S A;  2ZKZ A;  4B48 A;  3N4M A;  2O7O A;  1D0X A;  2LKX A;  3K0L A;  2Z3Y A;  1E0E A;  1RKW A;  3ZQQ A;  5J4V A;  1R58 A;  2M1B A;  2NS8 A;  5TGT A;  1XMK A;  2D1V A;  4XSZ F;  2ISY A; 
#chains in the Genus database with same CATH homology
 3I71 A;  4RB3 C;  3RI4 A;  1QBJ A;  2CWE A;  2MD5 A;  5IT3 A;  1S29 A;  1IXC A;  1P6R A;  3RKX A;  1ZN2 A;  2LKP A;  3R0J A;  3VB2 A;  5CYV A;  2EWN A;  2EFN A;  3P9I A;  1WWX A;  5JR3 A;  1RUO A;  1YO5 C;  3F3X A;  5FLX Z;  5D5V B;  1K6O A;  3C18 A;  1FYM A;  3T8T A;  2A3S A;  3CUQ A;  3KEO A;  2P5V A;  1IXR C;  3CLO A;  2H6B A;  4P55 A;  3ZMU A;  2GAU A;  1FPQ A;  4ZYE A;  2CSO A;  4FX4 A;  4G6Q A;  4A6E A;  2XVC A;  3KEQ A;  3GXO A;  4A6D A;  2FML A;  4PZJ A;  2A68 F;  3I59 B;  3KE2 A;  2HOE A;  2XUB A;  1RIO H;  4EMS A;  3ZQ7 A;  1IN4 A;  2BE5 F;  5BPI A;  2E7X A;  4RAZ A;  1OYI A;  1Z7U A;  3HHH A;  1XD7 A;  3J81 K;  1S7A A;  3V4G A;  3BJA A;  1J9I A;  3KP6 A;  4LFU A;  1FX7 A;  5K5O A;  2K27 A;  2P7V B;  2V79 A;  1SMT A;  1S6L A;  4L9V A;  1AWC A;  1EH6 A;  5KVR A;  4S04 A;  2V9V A;  4JQF A;  4GGG A;  2Y75 A;  3ML6 A;  3ABT A;  1BN5 A;  4HV5 A;  1W5T A;  3IRR A;  1XB4 A;  4IPA A;  2MH2 A;  4LB6 B;  1U78 A;  4FT8 A;  4OIP F;  2V6C A;  1SD6 A;  4I0A A;  4P9U A;  1D8K A;  3FXU A;  2QZ8 A;  1TTY A;  1LB2 A;  2ZFW A;  4Z2Y A;  1QQI A;  2OBP A;  2HZT A;  1BI3 A;  4PGG A;  4BHP A;  2J5P A;  2FNP A;  3ZPL A;  3KP7 A;  3K69 A;  3FMQ A;  2FOK A;  5E17 F;  4UXN A;  5L3B A;  3GZ6 A;  4EJW A;  2H6C A;  2VBZ A;  1GXP A;  3PQK A;  4KN7 X;  2P6T A;  3OV8 A;  3P7N A;  4LMY A;  4EGZ A;  3FHZ A;  1RUN A;  2FA5 A;  5F1R A;  2RC4 A;  3AAF A;  3Q9V A;  4RGU A;  4BH9 A;  2A69 F;  3N97 A;  2VE9 A;  4MQV A;  4HA8 A;  4MGR A;  5L3E A;  4HX7 A;  2KIF A;  1LVA A;  4RB1 A;  2H27 A;  3QPT A;  1LNW A;  2QLZ A;  1J5Y A;  2ISZ A;  3KLO A;  3DP7 A;  3WGG A;  1BIB A;  5KK1 A;  4IXA A;  5FLX K;  3GFL A;  3K9T A;  1UST A;  4L5I A;  2XKP A;  5L3F A;  4U7D A;  1CGP A;  3QOP A;  4KMU X;  4AIH A;  4EV0 A;  2EV0 A;  1XMA A;  1K7A A;  2V1D A;  1HXD A;  2QBY B;  2WV0 A;  3SFZ A;  5A2Q Z;  5FB2 A;  4Q48 A;  1FBQ A;  1QZY A;  1HKT A;  2FBK A;  4L0Z B;  1HQC A;  2HYG D;  3TDZ C;  2F5E A;  4P5O A;  3U2R A;  3M1E A;  5LGU A;  3M9A A;  3E6C C;  4LJZ F;  2L3D A;  1O3T A;  2FEZ A;  3V8J A;  3E6B A;  4BAY A;  3RDI A;  5J8F A;  1U2W A;  3JSO A;  4ZYG A;  1DDN A;  4KIG A;  5DD4 A;  5H6R A;  5BS6 A;  2VXZ A;  2W57 A;  3HIF A;  2AXL A;  2XGX A;  4CDG A;  5ERI A;  1PDN C;  3I0T A;  5JHU A;  3L00 A;  3H92 A;  1OYW A;  3KZZ A;  3I59 A;  3HTU A;  5HOO A;  3M8E A;  1ZLJ A;  4G6D A;  3GF2 A;  4QWQ A;  1ZG3 A;  5E1X A;  1ON2 A;  4ESB A;  4WX9 A;  3TOB A;  5H6Q A;  4CIC A;  1FSE A;  4U0Y A;  1CF7 B;  4MQ9 F;  2HDC A;  4UUV A;  3GEZ A;  3WE2 A;  4KT5 C;  4WK8 F;  3HYI A;  4LG0 B;  3KZY A;  4G94 A;  2IA0 A;  3QPH A;  1ZH5 A;  2R7D A;  5HS8 A;  2DAO A;  2D2W A;  5F64 A;  4G9Y A;  4HX8 A;  1ZGJ A;  4GCV A;  1YW9 A;  6PAX A;  1G3W A;  5AIP A;  4NQW A;  2UWM A;  3R61 A;  4ESF A;  2EA4 A;  2RQP A;  1ZRF A;  2A5Y B;  5HDK A;  2HQN A;  2RNJ A;  2BV6 A;  4EM2 A;  3C1D A;  4HLY A;  4BHB A;  5HS7 A;  3K1N A;  3WTS C;  2IA2 A;  2YSR A;  3KET A;  5EEG A;  2K86 A;  4WF2 A;  3MFK A;  1J7K A;  3SZT A;  3BZ6 A;  4CXF A;  1S8N A;  2VBW A;  1QO0 D;  3VEP A;  3WGI A;  2Q0O A;  5A2Q K;  2IT0 A;  4AVP A;  3HSE A;  4WXD A;  1HKS A;  4WXH A;  2P5K A;  4YG2 F;  4IVN A;  2EFW A;  3EET A;  3FWE A;  1TW3 A;  4CGZ A;  2FQ3 A;  1BC7 C;  2O0Y A;  1SFX A;  1TBX A;  1J59 A;  4BYY A;  1AOY A;  4HBL A;  2NNY A;  2NRA C;  2ZO4 A;  3FXR A;  2GWR A;  1U3E M;  3F6V A;  4U0V A;  5LBQ A;  1EH8 A;  2W24 A;  2OA4 A;  2VC1 A;  3QAH A;  3WU1 B;  2QBY A;  2MLG A;  4HQE A;  4HX4 A;  1MJB A;  3WTY C;  3EDP A;  3KLN A;  2DK5 A;  3LQR A;  1DP7 P;  4MTD A;  3QP6 A;  3U1D A;  2QQB A;  3HOT A;  1SAX A;  1QZZ A;  3EUH A;  1YS7 A;  5E1W A;  1UB9 A;  3WE3 A;  1BOA A;  5DYM A;  2LSO A;  1U8R A;  2W25 A;  1P2F A;  3VOD A;  4IHT A;  1V4R A;  1UHM A;  3O2P E;  4Q5S F;  3FF5 A;  4LLG F;  4Y15 A;  3C3W A;  4M9S A;  2EFO A;  2HKO A;  1B9M A;  2QQ9 A;  3TDU C;  4LLL A;  1C0W A;  2L4A A;  3W6J B;  3TGN A;  4A5N A;  5D6F A;  4JK1 X;  3JW4 A;  2JSC A;  2DTR A;  4HF2 A;  3ABU A;  1O7F A;  4KMF A;  1ZYR F;  5DEQ A;  2YX7 A;  3MCZ A;  1FP2 A;  2FE3 A;  4K2E A;  2XHK A;  4PCQ A;  3ZMV A;  1J0R A;  2OU2 A;  3LAP A;  4BNC A;  2FMY A;  2Z5U A;  1CF7 A;  2XAG A;  3ZP5 A;  4HDV A;  3HSR A;  1YW7 A;  1ZLK A;  4LG0 A;  4EVI A;  4OMZ A;  2MA3 A;  4ON0 A;  1JHF A;  2O3F A;  3LA7 A;  4A0X A;  4YFN F;  3GUD A;  5J6X A;  2PN6 A;  2AS5 F;  4RAY A;  2XV4 S;  1ULY A;  2LF8 A;  5K5Q A;  4CYD A;  3WTT C;  4JBA A;  2QVO A;  2B0L A;  1ZRE A;  2KJC A;  5HDN A;  1OPC A;  4P96 A;  3SQN A;  2VBX A;  1MD0 A;  2V1X A;  5E8I A;  3IL2 A;  1D5V A;  2GZW A;  2ZXJ A;  3GFI A;  2DQL A;  3G73 A;  2PJP A;  1MKM A;  4OU0 A;  2STT A;  4KDP A;  3GW2 A;  3BDD A;  2ACJ A;  2DU9 A;  1YIO A;  1KU9 A;  4CZZ A;  2JRT A;  3CUQ C;  2EFP A;  1HW5 A;  1Z05 A;  2O8X A;  2OAZ A;  3WTZ A;  1K79 A;  4L9T A;  1ZRD A;  2M87 A;  3KCC A;  3CO6 C;  1WRJ A;  3HRU A;  3TO7 A;  3RYR A;  2R3S A;  4HYE A;  1ZAO A;  5HS9 A;  3BPX A;  4EQQ A;  3CO7 C;  5DUI A;  2YU3 A;  2PFB A;  5JVT A;  5H20 A;  1NHA A;  2MBF A;  2HYF A;  2MH9 A;  2J5O A;  3V7S A;  2HTJ A;  3ECH A;  2NAZ A;  2K7L A;  3MEX A;  1SFU A;  5FD5 A;  5D4R A;  1FYK A;  2OZU A;  2RV8 A;  4KA4 A;  2HFH A;  3I4P A;  1R1V A;  4AD9 A;  1DPR A;  5LGN A;  3E5Q A;  1J75 A;  1Z1D A;  2E1C A;  1XGM A;  4UVA A;  1U5T C;  4ENN A;  3LWF A;  3T1B A;  1FBU A;  1BC8 C;  1UHW A;  4M9X A;  2Z33 A;  3V8L A;  5CLS A;  2IVM A;  1W7P D;  5AIQ A;  4UV8 A;  1TW2 A;  5D5U B;  3QRF F;  5D5W B;  1YYV A;  2XAF A;  3HRM A;  1R00 A;  1YLF A;  2KKO A;  3K1M A;  2Q8K A;  4XBF A;  1O3S A;  3S2W A;  3IKV A;  5DDG A;  3RIR A;  1HW1 A;  1FSH A;  2YX4 A;  1HST A;  5D8L B;  2EK5 A;  1WQ2 A;  4Q4Z F;  2ADU A;  2BEO A;  2DBB A;  3IC7 A;  3ZMS A;  3ECO A;  1IRG A;  1T38 A;  1F1Z A;  1T0F A;  3WTV C;  4F7Z A;  2P5L C;  5D8K B;  2CGP A;  4R1H A;  2EA2 A;  2XAQ A;  1R5H A;  1FT9 A;  1FWZ A;  2H09 A;  3DF8 A;  3H3Z A;  1F9N A;  3MQ0 A;  1G3T A;  4KIB A;  1DPU A;  3U9G A;  5LLQ A;  1ODD A;  1JHH A;  2WWY A;  1MGT A;  3E3V A;  1IN6 A;  4ESJ A;  4ENJ A;  5ILS A;  4IRH A;  4I01 A;  4UVC A;  1VTN C;  4NHJ A;  1LQ1 A;  3B73 A;  2RN7 A;  2LF7 A;  1FY7 A;  1LEB A;  4KNY A;  4HDU A;  2DO7 A;  4BXU A;  4M6X A;  3BRO A;  1HSJ A;  2L4M A;  4HV6 A;  4RS8 A;  1KQ0 A;  5HLH A;  2K4J A;  3IWF A;  5AON A;  1BJA A;  3BWG A;  3BOQ A;  5HVQ C;  1LDJ A;  5FGM A;  4MTE A;  1G4D A;  2FBH A;  3ZN0 A;  2KIU A;  2X4H A;  3FMS A;  1KYZ A;  2IPQ X;  1Y0U A;  1XCB A;  3MZH A;  2YPR A;  1ZRC A;  1TQM A;  3FM5 A;  2VBY A;  2FF4 A;  1I1S A;  2ELH A;  4OMY A;  4RGS A;  5K5R A;  2ZCW A;  1IW7 F;  1FYL A;  4BQA A;  3GFJ A;  2PG4 A;  3R0A A;  1S3J A;  1XCV A;  3KP3 A;  3DXJ F;  3K2Z A;  3ULQ B;  2CFX A;  4HQM A;  5LEJ A;  1BI2 A;  1ZAR A;  3HRT A;  3L09 A;  1TQI A;  3QU6 A;  4U7B A;  1BI1 A;  1R7J A;  3F72 A;  1XGN A;  4XLN F;  3F21 A;  2G9W A;  4UV9 A;  5FD6 A;  3WOD F;  1KA8 A;  3HHG A;  3GVA A;  3ELK A;  5LRR A;  1K78 A;  3TKY A;  4AWX B;  1KU7 A;  1R22 A;  4GO1 A;  1B6A A;  3CJN A;  1XSD A;  1TNT A;  4WCG A;  4GXO A;  2STW A;  3DQV C;  1I5Z A;  4L18 B;  1LDD A;  5ICG A;  2KRF A;  3F8F A;  1SMY F;  1OR7 A;  5HLI A;  2VC0 A;  1TNS A;  1YS6 A;  2DFI A;  4Y13 A;  4RGX A;  4YFX F;  1X3U A;  1FBS A;  2DI3 A;  2COM A;  5LRS A;  3NQO A;  3TO9 A;  4OIO F;  4EJU A;  3V7C A;  2NS0 A;  3G3Z A;  4MNU A;  3HTS B;  3FMR A;  2VT3 A;  5FFX A;  2F2E A;  1I6X A;  4L9N A;  1OYY A;  3CDH A;  2G7H A;  3C7J A;  1W5S A;  4L9J A;  2F5D A;  4YFK F;  1L3L A;  1P4W A;  2ESN A;  1MZB A;  3F8B A;  1Z91 A;  2F5C A;  1LJ9 A;  1FLI A;  1B59 A;  3FZV A;  2ESH A;  4O6J A;  1ONV A;  5ICF A;  3TQN A;  1TLH B;  2WC2 A;  1XGS A;  1XGO A;  1V3F A;  2EV6 A;  2W85 A;  2QWW A;  3RTR A;  3IKT A;  2Y48 A;  2DQR A;  2JPB A;  4TV7 A;  4A2U A;  5HDG A;  3E6D A;  4S05 A;  3BJO A;  1T2K A;  2E1N A;  2ZNZ A;  3ZN1 A;  3L9F A;  3DEU A;  4IJA A;  4KN4 X;  1A04 A;  2M5W A;  1UFM A;  2DPU A;  1W7P A;  3KP4 A;  3J80 Z;  4KIF A;  2Z9O A;  5CVR A;  2DW4 A;  3K1P A;  3MAJ A;  4EGY A;  3SHF A;  4PDK A;  2BBY A;  2KJB A;  5TRD A;  5CVJ A;  2FNA A;  4IRI A;  4G7H F;  2O03 A;  1MDM B;  4I09 A;  3L2C A;  2TDX A;  2ZNY A;  4UHT A;  5E8G A;  3REO A;  3NEU A;  2O6G E;  4IRG A;  2ETH A;  3P9K A;  4KIC A;  4MEX F;  3M7G A;  4IF4 A;  5CJ9 A;  5JI6 A;  2P4W A;  4HW0 A;  1TQP A;  1P4X A;  5JFR A;  1FOK A;  1IF1 A;  1I27 A;  2OQG A;  1IXS B;  4EM1 A;  4HF1 A;  3CTA A;  1ZGA A;  4FHT A;  1R1U A;  4LD5 A;  4QLC U;  4EJV A;  3BJ6 A;  2Y0M A;  3LA3 A;  3BPV A;  3MWM A;  2MC3 A;  4R8H A;  1S7O A;  4OOI A;  2VOD A;  5LHG A;  1HBX G;  3QP5 A;  4L5J A;  3RKY A;  5E20 A;  2DK8 A;  1EH7 A;  1ON1 A;  1JXS A;  2L02 A;  3V8K A;  2R7F A;  1B1B A;  2RKH A;  5E1Z B;  3O6B B;  3LFK A;  2QYO A;  5LEK A;  1FZP B;  2G7U A;  5L3G A;  3TOA A;  2L01 A;  5CVI A;  2PBI A;  2LDU A;  1HW2 A;  1YG2 A;  1IUY A;  3FX3 A;  4I98 B;  2HQR A;  2HR3 A;  4MHG A;  3ZMZ A;  2L54 A;  2XAS A;  4WXC A;  5IT9 Z;  1KGS A;  1KYW A;  5LHI A;  1RZ4 A;  1P92 A;  3WTW C;  1SFE A;  5ILV A;  4HLX A;  3COA C;  4ENM A;  3F8M A;  2RGV A;  1H9T A;  2NYX A;  2CW0 F;  2FU4 A;  2VON A;  1G6N A;  2MLK A;  4H0E A;  2EFQ A;  4EM0 B;  4YII A;  5ICC A;  4EJT A;  2UXN A;  3RKW A;  3DV8 A;  3LA2 A;  3GFM A;  1R36 A;  2X0L A;  1STZ A;  1H0M A;  4ZZD A;  3J80 K;  4N9I A;  5LHH A;  4ZYD A;  2A61 A;  1OMI A;  1YW8 A;  3EYY A;  1SD7 A;  3W6K B;  5DD8 A;  2A6H F;  4N0B A;  3O3K A;  1XDU A;  3FXQ A;  1J2X A;  4HZF A;  1FC3 A;  2V1U A;  3P9C A;  4B8X A;  1XSX A;  1HKQ A;  3TO6 A;  1MJ9 A;  1K78 B;  4OIN F;  1MJA A;  3M8F A;  3IWZ A;  5BMZ A;  4LK0 F;  3CUO A;  1LDK B;  3B02 A;  5LGT A;  1U5T A;  4A0Z A;  3NRV A;  1G3S A;  1R1T A;  4DNC A;  1O57 A;  1REP C;  5D6E A;  1BBY A;  2EB7 A;  2OZ6 A;  4XSX F;  3J7A O;  1T6S A;  2HTS A;  2M30 A;  4OIQ F;  3HUG A;  3EYI A;  1XSV A;  4I02 A;  4ASN A;  1Z6R A;  2VN2 A;  2FBI A;  3JTG A;  3EQL F;  1I1G A;  3DPL C;  1GXQ A;  1MDM A;  1SD4 A;  2YR2 A;  2GXG A;  2XIG A;  3WU0 A;  1JE8 A;  2GIV A;  1JGS A;  4G7O F;  3ERE D;  1O3Q A;  2BYV E;  3PQJ A;  2ZJ2 A;  2HS5 A;  4LGW A;  2JT1 A;  3T0Y A;  2DT5 A;  3KP5 A;  2VT2 A;  1XN7 A;  2IRF G;  4EJO A;  4ZZL A;  5J8C A;  2K4B A;  4LB5 A;  3IRQ A;  1OKR A;  4M74 A;  3FM3 A;  4HAM A;  4KFC A;  4O3M A;  4RB2 C;  1EV7 A;  1L0O C;  4XRF A;  2D1H A;  3BP8 A;  2ZME A;  1IN7 A;  1W4M A;  1Z6T A;  5IT9 K;  3JAM Z;  1F4K A;  3L7W A;  2KIM A;  2QEN A;  4A5M A;  4A0Y A;  3HSF A;  2NNN A;  1XDS A;  3F22 A;  2W84 A;  2RVC A;  5EEH A;  1O3R A;  1USS A;  3F8C A;  1E2X A;  1R5G A;  3RJP A;  4RB0 A;  5BPD A;  2VE8 A;  2M8E A;  4CO8 A;  2A07 F;  3SXY A;  2PEX A;  4A12 A;  2DLL A;  1FP1 D;  3WTU C;  3H3U A;  1W7P B;  4G8X A;  3SZP A;  1O7L A;  5CVV A;  5BQT A;  2H94 A;  2HEO A;  2OD5 A;  3D5L A;  3LST A;  2P7C B;  4MEY F;  2BGC A;  2IA1 A;  3R60 A;  1IAW A;  2XAH A;  3PFI A;  2XRO A;  4UNO A;  2UXX A;  1F5T A;  1BIA A;  1D3Y A;  4U0W A;  2JPC A;  3ISP A;  1Z9C A;  2O61 A;  4RGR A;  3GYH X;  1B9N A;  3F6O A;  4M73 A;  4IHS A;  5DCM B;  2EV5 A;  5L3D A;  2FRH A;  3E97 A;  3KP2 A;  4O5V A;  5ILU A;  3E5U A;  4OIR F;  4LK1 F;  1B4A A;  4AIK A;  2CO5 A;  3I64 A;  4HOB A;  3T8R A;  3BY6 A;  4GYG A;  4PGH A;  1UCR A;  5D5X B;  3RPU A;  2GA1 A;  1BI0 A;  4NB5 A;  3F23 A;  1ZHF A;  2OQR A;  2D45 A;  4WWC A;  4Q47 A;  2IW5 A;  2XRN A;  1IN5 A;  2C6Y A;  1P4A A;  3DKW A;  2CQK A;  3WTX C;  1BM9 A;  1IRF A;  3IHU A;  3LQQ A;  3WGH A;  4I0B A;  3GO5 A;  2VOP A;  3T5X A;  3VFZ A;  1ZG1 A;  1YTY A;  5D4S A;  2QUF A;  3JAM K;  2ZBK A;  2IP2 A;  2VOO A;  3R6S A;  1PP8 F;  2XKO A;  2PI0 A;  5BOX A;  2CG4 A;  2FSW A;  4Y17 A;  4BHC A;  4G7Z F;  3GLX A;  4D0P A;  1KQ8 A;  3I54 A;  2XAJ A;  4U88 A;  3CUQ B;  2P6S A;  2PMU A;  3GZ5 A;  4ETS A;  2IJL A;  5E18 F;  4FX0 A;  4AIJ A;  1RNL A;  1GHC A;  5ED4 A;  2QQA A;  3HRS A;  4ZH4 F;  1GVJ A;  2E7W A;  1RI7 A;  2EJR A;  1IN8 A;  5HLG A;  1E17 A;  1KQ9 A;  4YIF A;  3RYP A;  2CYY A;  4I7H A;  3GX4 X;  4KYW A;  2PMH A;  2Q2E A;  4N9H A;  4ENK A;  3Q5F A;  1PP7 U;  4P9F A;  4DQ2 A;  1T39 A;  2DPD A;  2HGC A;  3JTH A;  2M45 A;  2K02 A;  1KU2 A;  4KUM A;  4M6Y A;  3QU3 A;  2PQ8 A;  2GA2 A;  5ICE A;  3HOS A;  3JSP A;  1U6G A;  2Z99 A;  1IZ1 A;  1U5T B;  5DCF A;  1QPM A;  1G3Y A;  2JZY A;  4HF0 A;  1ZG5 A;  4M72 A;  3KFW X;  5DV5 A;  5FFZ A;  5F6F A;  3ROU A;  2JTV A;  1PUE E;  2GXB A;  1WKM A;  2WTE A;  3Q9S A;  3WG9 A;  4ZYH A;  5CVU A;  3E6M A;  3J81 Z;  1H9G A;  1KU3 A;  5K1Y A;  4LLN A;  2QM3 A;  4B09 A;  3ZMT A;  4GYI A;  5L3C A;  3GWZ A;  3OOP A;  2PLY A;  3R4K A;  3I5U A;  1DUX C;  3LAJ A;  2A6E F;  4UVB A;  2LNB A;  1YQA A;  1WI9 A;  2RDP A;  1T98 A;  3I58 A;  4R79 A;  3E5X A;  1Q1H A;  3DPT A;  4M9Z A;  3V7R A;  2UZK A;  1FNN A;  4E70 A;  2HWV A;  3MZY A;  3DFG A;  2HKX A;  2P8T A;  5DCM A;  2ZME B;  5DUK A;  3ZMD A;  1QNT A;  4CHU A;  1WSU A;  1YFH A;  3RPQ A;  4XLP F;  4M71 A;  3I53 A;  3F8N A;  2FXA A;  1R23 A;  4L0Y B;  2F5F A;  4I2O A;  1LEA A;  2GQQ A;  1QGP A;  1SD5 A;  1D8J A;  5TJJ A;  5FO5 A;  3VOE A;  3D0S A;  2ZKZ A;  3N4M A;  3K0L A;  2Z3Y A;  1R58 A;  2M1B A;  1XMK A;  2D1V A;  4XSZ F;  2ISY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...