5D8LB

Human hsf2 dna binding domain in complex with 3-site hse dna at 2.1 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*GP*TP*GP*AP*AP*TP*AP*TP*TP*CP*TP*AP*GP*AP*AP*CP*
publication title Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 25
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d8lB00
1AWCA 4O5VA 3HRUA 1KU9A 2QQBA 4EM0B 2M5WA 1E17A 1FC3A 1ULYA 3L09A 3E5UA 3F8BA 4U0WA 1SMTA 5BQTA 1R1UA 3T1BA 2AS5F 1FBUA 2GAUA 1FSHA 3RIRA 2PN6A 3HUGA 1ODDA 4KN4X 5JI6A 2FBHA 4B09A 5E1ZB 3K0LA 3ABUA 1YIOA 2DU9A 3GWZA 4LLGF 3K69A 1U6GA 3F6VA 1B6AA 2W84A 2VT3A 1IUYA 4U7BA 5DYMA 2K7LA 4OIQF 2KRFA 4EVIA 5J8FA 1KU7A 4YFXF 1BM9A 1MJBA 2NNYA 4EJVA 5J8CA 1Q1HA 1P6RA 2K4BA 2Y48A 1VTNC 3TO9A 3HIFA 2BYVE 4G6QA 2HQNA 2FSWA 3JAMZ 2YX7A 3N97A 4G7OF 2H27A 2ZNZA 4P9FA 4RB2C 3IKTA 4KA4A 2HFHA 4A5MA 4Q5SF 2D2WA 2K27A 1QQIA 4UVCA 3QPTA 2H94A 3GEZA 1R00A 2YU3A 3KCCA 2ZO4A 2HS5A 1TQMA 1RI7A 1FX7A 4LJZF 4AIKA 4A0XA 2QLZA 3OV8A 4IPAA 5JVTA 3E6CC 2P5LC 2MH2A 4R8HA 4RAYA 5AIPA 1J0RA 2EK5A 3RJPA 3C7JA 1R5GA 2STWA 1T6SA 3EDPA 3IRRA 1YW8A 4O3MA 5DUKA 3F8MA 1L3LA 1ON1A 3RPQA 3M1EA 1G6NA 5E17F 2HR3A 2ESNA 3TO6A 3WTVC 2Q0OA 2R7FA 1K6OA 2G9WA 3WTWC 4S05A 2P7VB 5ICFA 3W6KB 4M9ZA 3RKWA 5FB2A 1B1BA 1WI9A 2FF4A 2VT2A 3NRVA 5JHUA 2XGXA 3FXUA 1IW7F 3SXYA 4KMFA 3KETA 2FA5A 1O3QA 2ACJA 3QRFF 4ESJA 4P9UA 2QQAA 4MTEA 1O7LA 5BOXA 3SQNA 3OOPA 2V1DA 2UZKA 2EFNA 3HRMA 4Q4ZF 4IXAA 2VBYA 2HEOA 4ESBA 3ZP5A 1HXDA 2CO5A 5KVRA 1ZGAA 4KIBA 3Q5FA 1DUXC 4FX4A 2ELHA 5FD6A 4HOBA 1LEBA 3C18A 2DW4A 2DT5A 1IF1A 3KFWX 3PFIA 1YTYA 3G3ZA 3IRQA 3GF2A 5CJ9A 1J75A 5HS7A 5CVIA 4JQFA 3CDHA 1MD0A 2BE5F 2HWVA 3NQOA 5DDGA 1YW9A 4M71A 1FY7A 3V8JA 1V3FA 1TNTA 5D6FA 3F23A 2FEZA 3GW2A 1MDMA 3ZMUA 3WE3A 3WTUC 4G94A 2XHKA 1K78A 3GZ5A 2BEOA 1LDDA 5HDNA 1Z6TA 1BBYA 1XB4A 2GA1A 2VOPA 3EUHA 4YFNF 3HOSA 1KQ8A 2V6CA 4EJUA 2DPDA 5FO5A 1L0OC 3J81Z 5A2QZ 1F4KA 3KLNA 4HQMA 1SD5A 4XBFA 4L18B 2FU4A 1EV7A 3ABTA 4UNOA 2ISYA 3J81K 2OU2A 1J59A 5LRSA 5L3EA 4LB5A 2JRTA 2XKOA 4HX7A 1XCVA 2FNPA 3WU0A 3RTRA 4U0YA 2FBIA 1F5TA 2EFOA 1MDMB 1KQ9A 1ZG5A 3WTYC 1O7FA 2QWWA 1K7AA 1SD7A 4MEXF 1XSDA 1GXQA 4IRHA 4A6EA 2W24A 1P92A 3T8RA 2VODA 2KKOA 3HHHA 1LNWA 2HZTA 2M8EA 5JFRA 1HSTA 2DFIA 2R3SA 3QP6A 1FNNA 2E1CA 3EYIA 1SFXA 3GX4X 2MD5A 2Z3YA 4LLNA 3HOTA 2DTRA 4Y17A 1QZYA 2K02A 1IN4A 2ISZA 1ZYRF 1RIOH 1HW2A 4CZZA 1YS7A 1FBQA 4HA8A 3V7SA 1ZARA 2CFXA 2YX4A 2IPQX 1P4WA 4P5OA 3LAJA 3R0AA 1XGNA 2Y75A 1QZZA 3BPVA 2FMYA 2C6YA 3IC7A 3L9FA 1R1TA 3MZYA 4HLXA 4AWXB 5CVJA 4CHUA 2CQKA 2GWRA 3VOEA 3I64A 5D4SA 1YLFA 4OIOF 2CG4A 1SAXA 5FFXA 4UVBA 1JHFA 3RKXA 2PG4A 3KE2A 1I6XA 4WCGA 1H9TA 3FXQA 2XAHA 3ROUA 2RKHA 4K2EA 5BS6A 4OMYA 3HSRA 1BN5A 3F21A 1S7AA 2XVCA 2L01A 4M74A 2PBIA 2P6TA 3SFZA 2VC0A 2A61A 5LGNA 3TKYA 3GFLA 4D0PA 3GFMA 2LDUA 1FWZA 1B9NA 4KYWA 2TDXA 2OQRA 3JTGA 3H92A 1O3SA 4XSZF 1HBXG 5K1YA 2F5CA 3KZYA 1ZGJA 5LEJA 2KJBA 3FZVA 2HQRA 4E70A 3R61A 1XN7A 4M6XA 3M8FA 4A0ZA 2OZ6A 3IHUA 1O3TA 5L3GA 5CVRA 2RGVA 3R6SA 5IT9K 4HYEA 4ENNA 4A5NA 5D4RA 1KQ0A 3K2ZA 2W85A 3GVAA 4WXHA 1MJ9A 3BY6A 3VODA 3DXJF 3W6JB 1QGPA 5DEQA 1R1VA 3COAC 2R7DA 1I27A 2DQRA 3M8EA 4N9IA 4I09A 1C0WA 4PCQA 3ZMSA 2B0LA 4LK1F 4HX8A 3RKYA 2HGCA 1S6LA 1T98A 1U5TB 1KGSA 2PI0A 1J7KA 5L3CA 3WGGA 3HSFA 1KU3A 2D1HA 2Y0MA 3IWFA 3ECOA 2EFQA 4WXDA 2VN2A 4LG0B 5L3FA 1W5TA 3KP3A 1WQ2A 4EQQA 2D45A 2BBYA 3J80K 1XD7A 5DD8A 2OZUA 2YPRA 1LB2A 2D1VA 5H6QA 3KLOA 1QNTA 3SZPA 4MNUA 1Z1DA 1RZ4A 1YFHA 1FOKA 1T2KA 1DPRA 3G73A 4GCVA 2ETHA 5H6RA 5LRRA 1IN5A 5D8KB 4KN7X 2LNBA 2M30A 1TTYA 1BJAA 2VBWA 5F6FA 3T0YA 1JGSA 1JXSA 4U0VA 1J2XA 5LHHA 3ZMVA 1QPMA 2L02A 5BMZA 3R4KA 3FM5A 2Z5UA 4HBLA 3E97A 1FSEA 1OYWA 1YW7A 4ZZLA 4AD9A 3BJ6A 3ZPLA 3RDIA 5LHGA 4KDPA 5E1WA 3IWZA 2A69F 5EEGA 2OD5A 3WGIA 2DAOA 2F5DA 1HKTA 3FXRA 1ZG3A 2VBZA 2QENA 1WRJA 2NRAC 1PP8F 4RB1A 5D5WB 3L2CA 1BOAA 2XAGA 3HSEA 1PUEE 1ZN2A 3LA2A 1FP2A 3GXOA 5JR3A 2CSOA 2OBPA 1O3RA 1Y0UA 1LEAA 3JSPA 2QM3A 2XUBA 4U7DA 5HVQC 3FF5A 3DPLC 4FX0A 4BXUA 2EFWA 1BI0A 2O8XA 2ZMEA 3ISPA 1B9MA 2O61A 4QLCU 2DPUA 5ICEA 2A68F 1S7OA 4BHBA 3J7AO 3LWFA 1USSA 4ON0A 2P7CB 3F6OA 1GHCA 3RPUA 1ZAOA 3VB2A 3T5XA 2GXGA 4L5IA 1J9IA 5L3BA 5ILVA 2VE8A 1FYMA 5D6EA 2VC1A 2L3DA 1D5VA 1ZLJA 2WV0A 5FGMA 4GYGA 2DK8A 3WTXC 4A0YA 2P5KA 2EV0A 2IA2A 1FYKA 4FT8A 2X0LA 3I71A 4YFKF 4BHCA 5BPIA 2DQLA 2H6CA 4XLNF 2P4WA 1XGMA 2HYFA 3ZMDA 4B8XA 3F3XA 5TJJA 4RGXA 1IXRC 4A2UA 3KP6A 2YSRA 3LA3A 3MFKA 2XAJA 3CLOA 3DP7A 4HV6A 2GA2A 4YIIA 3TO7A 3CJNA 1UB9A 1S29A 1S8NA 1D8KA 2ZMEB 3U1DA 1E2XA 4Y15A 1IXCA 1SD4A 4G6DA 3KZZA 3CUOA 4L0ZB 5IT3A 2LF7A 2V79A 1SMYF 4HZFA 3FHZA 2O6GE 4HF2A 2KJCA 1FPQA 3KEOA 6PAXA 3E3VA 3TQNA 1BI1A 2STTA 3BJAA 4L9VA 1ZHFA 4EGZA 2VOOA 5L3DA 5TRDA 4LK0F 3QAHA 5F64A 4DQ2A 2O03A 4UVAA 2UWMA 2JT1A 4KIFA 2ZBKA 3VEPA 4M72A 3FM3A 1G3YA 4NB5A 2FRHA 1YO5C 4RB0A 4L5JA 4M9SA 3ZQ7A 1O57A 3JW4A 1UHMA 3KP2A 3O2PE 4EM2A 1B59A 3P9CA 4Z2YA 3REOA 2J5OA 4PGHA 3E6MA 1DPUA 3V8LA 4HW0A 3K1MA 1D8JA 2K4JA 1W7PD 4UV8A 4H0EA 2EFPA 3E6DA 2E1NA 2JZYA 1W4MA 3ERED 1OR7A 2DLLA 2NNNA 3B02A 1LQ1A 3GLXA 3RYPA 2O3FA 1W7PB 2RN7A 4LGWA 2XIGA 2QYOA 2RQPA 1Z6RA 3VFZA 3FMSA 2MH9A 3LSTA 3BPXA 2M45A 4HAMA 2HDCA 2ZKZA 4KICA 3U9GA 1LDKB 2NYXA 3E5QA 3MZHA 3RYRA 1TLHB 2HOEA 3MWMA 1CF7B 4KIGA 1HSJA 5LLQA 1KYZA 1WSUA 2COMA 4BYYA 4G9YA 1WKMA 1ZH5A 1GXPA 3E6BA 4BAYA 1XMAA 1T39A 1QO0D 4I02A 4CXFA 4WWCA 5LHIA 2GXBA 2UXNA 1TW3A 1U8RA 1B4AA 1HW1A 2EJRA 1XGOA 1F9NA 2GQQA 1IN8A 5BPDA 3PQKA 4RGSA 2A6HF 3DKWA 1EH6A 3I59A 3O6BB 1JE8A 4HDVA 3BDDA 3GYHX 1U5TC 3K1PA 2G7HA 4ENJA 2KIUA 4TV7A 4AVPA 3ZN0A 1STZA 1G3WA 4L9JA 3PQJA 3BP8A 1ZG1A 1XMKA 1KU2A 2QZ8A 4GO1A 1XDSA 4OMZA 2VXZA 1IAWA 3Q9SA 4ESFA 5DV5A 2XAQA 4P55A 1AOYA 2F5FA 2F5EA 4RAZA 4L0YB 1TQIA 2H09A 3HYIA 1U5TA 3HTUA 4CO8A 3QU6A 3I5UA 4YIFA 2OAZA 2ESHA 5DCMB 3L7WA 1IN7A 4LG0A 1A04A 4WK8F 2WC2A 3I53A 4CICA 2XKPA 2FXAA 1WWXA 3WODF 4S04A 4LMYA 5IT9Z 4IHTA 2RDPA 4ZYEA 1R7JA 3F72A 3HTSB 3I59B 4GGGA 4KNYA 2HTJA 4OU0A 4AIHA 4RB3C 3TDUC 2Q2EA 4IRGA 1DDNA 3C1DA 4CDGA 2JPCA 5CLSA 3F8FA 4UV9A 5LGUA 4A12A 1FT9A 2A5YB 1I1GA 4ETSA 4Q48A 3FMRA 1Z05A 2QBYB 5HDKA 5K5QA 1D3YA 3D5LA 1I5ZA 1LDJA 3CO6C 2FMLA 2IRFG 5E1XA 2IA0A 2FBKA 3GFJA 2Z33A 2HYGD 3R0JA 4KT5C 2RV8A 3SZTA 2HKXA 2LKPA 3TOBA 1BC8C 3WGHA 2EA4A 3EETA 4NHJA 2WTEA 3J80Z 3KEQA 3L00A 3R60A 4MGRA 1SFEA 2JPBA 3CUQB 1R58A 1Z7UA 4G7ZF 4I7HA 4QWQA 1T0FA 3KP5A 1TW2A 3FWEA 4DNCA 3TGNA 4ZYGA 2V9VA 4I98B 5K5RA 1J5YA 1USTA 2XASA 2A3SA 2ZCWA 2ZNYA 3N4MA 3LA7A 1LJ9A 3SHFA 4XRFA 5J6XA 3LAPA 2JTVA 3EYYA 5ILSA 3P7NA 1YG2A 1NHAA 2PLYA 5DD4A 2J5PA 4HX4A 3HRSA 5HDGA 1EH7A 4HDUA 1IRFA 1ZRCA 1XSVA 3ZN1A 1BI3A 1XCBA 1ZLKA 2V1UA 2CYYA 3F8NA 4OOIA 5HLGA 3B73A 4R79A 1OYYA 2YR2A 2VONA 4EGYA 3FX3A 3Q9VA 4WF2A 5ICGA 1UCRA 4XSXF 3D0SA 1FZPB 2NAZA 1OKRA 3JAMK 2VBXA 2BGCA 2DK5A 2HKOA 2OA4A 5F1RA 5ILUA 5D5XB 1H9GA 4R1HA 1XDUA 3CTAA 1HKQA 3I58A 1ZRFA 1R22A 3RI4A 3WTZA 3V7CA 4I01A 1G3TA 2FE3A 2EB7A 3MQ0A 1YS6A 2IA1A 2E7WA 4MQVA 1XGSA 5HLIA 5HOOA 2A07F 4PGGA 1R5HA 4PZJA 1Z91A 4I2OA 4Y13A 3ZMZA 2LSOA 5CYVA 4YG2F 3IL2A 1MGTA 2A6EF 4LB6B 3I0TA 4F7ZA 2OQGA 3WE2A 1LVAA 5D5UB 4HF1A 1FLIA 4ZH4F 1T38A 1BIBA 1R36A 2CW0F 4GXOA 5EEHA 3ULQB 3HRTA 3F8CA 1H0MA 2MC3A 4A6DA 3LQQA 2MLKA 5D5VB 2IT0A 4FHTA 2L54A 4ZZDA 2EV5A 2AXLA 2QUFA 5AIQA 2L4MA 3BZ6A 5FFZA 4LLLA 3TDZC 2CGPA 3U2RA 2MBFA 3ZMTA 2Z9OA 4WXCA 2XAFA 2ADUA 4ZYDA 4P96A 4IJAA 4OINF 3QPHA 1QBJA 1P4AA 1UFMA 2ZFWA 3JSOA 1ZREA 2MLGA 4EMSA 4BNCA 3BROA 1FYLA 3E5XA 1I1SA 3QU3A 4Q47A 4WX9A 1W7PA 5LEKA 2IW5A 2L4AA 1HKSA 3NEUA 4N9HA 4EJOA 3DEUA 4RGRA 3AAFA 5ERIA 5HS9A 3GO5A 2FQ3A 4CGZA 2F2EA 1P4XA 4N0BA 3EQLF 1X3UA 5CVVA 1ONVA 5H20A 4JK1X 1F1ZA 2G7UA 3O3KA 1CF7A 2IJLA 2DI3A 3V8KA 1MZBA 2PJPA 1PDNC 4KMUX 5LBQA 2MA3A 1KA8A 3ELKA 2PMUA 4L9NA 3K1NA 1K79A 2GZWA 3WTTC 1XSXA 2CWEA 4G8XA 4PDKA 1MKMA 1GVJA 4ENKA 2K86A 4KUMA 5AONA 4MEYF 2NS0A 4BQAA 5E8IA 1REPC 3C3WA 1S3JA 2UXXA 2IP2A 1RNLA 5A2QK 5DUIA 1JHHA 2M1BA 3DQVC 1R23A 5E8GA 2X4HA 1BC7C 3MAJA 1U78A 1KYWA 5ED4A 4LD5A 3KP4A 3H3UA 2IVMA 2EA2A 2RC4A 3CO7C 4MTDA 2LF8A 4UHTA 2P8TA 4I0BA 3DPTA 1V4RA 3M7GA 4LFUA 4IRIA 3FMQA 2QVOA 3T8TA 4UUVA 5CVUA 3DF8A 3I4PA 2XROA 1K78B 2O0YA 1W5SA 2PFBA 2KIFA 1IN6A 4M9XA 2EV6A 2BV6A 3GZ6A 4O6JA 4OIPF 2FOKA 3GUDA 4MQ9F 5DCMA 4EV0A 5KK1A 1OPCA 1IZ1A 3H3ZA 4AIJA 4ENMA 1PP7U 3V4GA 3WU1B 4IVNA 2H6BA 2E7XA 3QOPA 3LQRA 1U2WA 3BOQA 3M9AA 1ZRDA 4KFCA 1P2FA 4XLPF 1EH8A 3QP5A 3P9KA 1IRGA 5FLXZ 4IHSA 4EJWA 2P5VA 4EJTA 1G4DA 4MHGA 3CUQC 2XV4S 4HLYA 2QBYA 1DP7P 2P6SA 1IXSB 1CGPA 2QQ9A 1TBXA 5HLHA 5FLXK 3GFIA 5D8LB 2HTSA 3ECHA 2ZJ2A 1MJAA 4U88A 2XRNA 4RGUA 5K5OA 4L9TA 1OYIA 1U3EM 1FBSA 5LGTA 2VE9A 1SFUA 4G7HF 3WG9A 1TNSA 2Z99A 2V1XA 2DBBA 4HV5A 5ICCA 1BIAA 4GYIA 4ZYHA 3CUQA 4EM1A 2PQ8A 2W25A 1G3SA 3V7RA 5E20A 1YQAA 3JTHA 3IKVA 3ML6A 2M87A 2WWYA 4IF4A 3MEXA 3DFGA 4JBAA 5DCFA 4NQWA 2JSCA 2KIMA 4HQEA 2ZXJA 3BJOA 4M73A 3S2WA 3HHGA 3KP7A 2RNJA 4CYDA 1SD6A 2PEXA 1RUNA 1RUOA 3DV8A 4M6YA 1FP1D 2W57A 4BH9A 1HQCA 3K9TA 2RVCA 1ON2A 2DO7A 2Q8KA 5HS8A 5E18F 3I54A 5FD5A 1TQPA 4BHPA 3LFKA 3BWGA 2GIVA 4ASNA 1UHWA 2FNAA 3MCZA 3F22A 4OIRF 4I0AA 1YYVA 4RS8A 1Z9CA 3P9IA 1OMIA 4HF0A 3WTSC 2PMHA 2EWNA 4UXNA 1BI2A 3TOAA 1HW5A
chains in the Genus database with same CATH superfamily
1AWCA 2IBDA 5B1AH 3NAUA 3HRUA 4O5VA 3AG2H 1KU9A 2QQBA 4EM0B 1N25A 2CH0A 3GTKJ 2M5WA 1E17A 1FC3A 1ULYA 1Z3YA 3L09A 5J1YA 3LSPA 3E5UA 2B63J 3F8BA 2O7OA 4XLCA 2NVXJ 4U0WA 1SMTA 1OJLA 1Z77A 5BQTA 1R1UA 3T1BA 2F6CA 1P7IA 2M7AA 2AS5F 1FBUA 1D0YA 4PK4A 2GAUA 1FSHA 4PJMA 3RIRA 2PN6A 3L2VA 3MKZA 4BUPA 4CCJA 4JP0A 5HNFA 3DLLF 3HUGA 1ODDA 3BG6A 4FE4A 1VQ9I 1E3HA 2EIMH 4KN4X 5JI6A 2FBHA 2FQ4A 4B09A 5E1ZB 3K0LA 3ABUA 3HZJA 1YIOA 2DU9A 3GWZA 4NBQA 2QKLB 4LLGF 3K69A 2FJ1A 1U6GA 3F6VA 4ZC3A 1B6AA 2W84A 2VT3A 2P0WA 3BT9A 1IUYA 4U7BA 3A2KA 4FETA 5DYMA 2W00A 4XRMA 5FJ8J 2DOFA 2K7LA 2M4GA 4OIQF 3V42A 2KRFA 4EVIA 1TZLA 2LK2A 2X1EA 2CUEA 2K9MA 5J8FA 2JUCA 1KU7A 2JA6J 4YFXF 1BM9A 1MJBA 2GBYA 2KQRA 4EJVA 5GAEJ 2NNYA 1SFOJ 5J8CA 2M34A 1Q1HA 3SDGA 3O8HA 1I6HJ 1P6RA 1SVOA 2K4BA 2Y48A 3K70D 1VTNC 3S3NA 3K4KA 3TO9A 2H8RA 3HIFA 3DLAA 2BYVE 4G6QA 2DJNA 4UY8I 2HDDA 2HQNA 2CUFA 2FSWA 3JAMZ 2YX7A 4DGWB 3N97A 3I3LA 2QEXI 2OC6A 4G7OF 2H27A 2ZNZA 4P9FA 4CCKA 4RB2C 5HLTA 3IKTA 4KA4A 3BTJA 1BJZA 2HFHA 4A5MA 2DMUA 4Q5SF 2JVGA 2D2WA 2K27A 2YU9J 1QQIA 4UVCA 3OYGA 3QPTA 2H94A 3GEZA 3MKLA 4A3BJ 1R00A 5IP9J 2JA2A 2LY1A 2YU3A 5FKKA 3KCCA 1T33A 2HS5A 2ZO4A 4KISA 3GZNB 1TQMA 1PUFB 1RI7A 1NH3A 1FX7A 4LJZF 1OCCH 4AIKA 4A0XA 1YI2I 2QLZA 1BL0A 1D1BA 3OV8A 4IPAA 5JVTA 3DBRB 2OV7A 3E6CC 2P5LC 2EILH 2CFOA 2MH2A 4R8HA 4RAYA 2DODA 3HGYA 5AIPA 2E36A 1J0RA 2EK5A 5GP9A 2OTJI 4XN3A 1RR7A 3RJPA 1MSFC 1R49A 3C7JA 2KHMA 1R5GA 2STWA 1JJ8C 1F43A 1T6SA 3EDPA 3IRRA 2XSDC 4A3FJ 1YW8A 2K9LA 4O3MA 5DUKA 4IOCF 3F8MA 4HNUA 1L3LA 1ON1A 2LH9A 3OR2C 3ZGKA 2ICWG 2IXSA 2VPRA 1BR1A 2XGEA 3K7AJ 5GAGJ 2Y0SA 3RPQA 3W6VA 3M1EA 2RQQA 2Z1DA 4I99C 1G6NA 2L7KA 4G12A 5E17F 4B48A 2HR3A 2X1DA 2ESNA 3TO6A 3WTVC 2OPTA 1JTYA 2Q0OA 2R7FA 1K6OA 2G9WA 2MG4A 3WTWC 4S05A 4D7NA 2JN6A 2P7VB 5ICFA 3JR9A 1UG0A 1GVDA 2R7UA 3W6KB 4M9ZA 1ETKA 3RKWA 5FB2A 4V2GA 1B1BA 3BTCA 4Z6YA 1WI9A 2FF4A 2VT2A 5DM7F 1JUMA 3NRVA 2AQFA 2XF6A 5JHUA 2XGXA 2XPVA 3FXUA 5J4YA 1P9QC 2X6OA 1QZEA 2ZSHB 2R7ZJ 1IW7F 2XRLA 1VF9A 3SXYA 3CCRI 4KMFA 3RQIA 3KETA 2FA5A 1O3QA 4YEJA 3JREA 3SEQA 1FOXA 2VB6A 2ACJA 3QRFF 3LSJA 4ESJA 3K4BA 4P9UA 3G1OA 2QQAA 3H0GJ 4RAFA 1O7LA 4MTEA 3L1PA 5BOXA 3SQNA 3M4OJ 2R7TA 2QKMB 3HG9A 1RC9A 3A02A 1WPKA 2TCTA 3OOPA 1FIAA 1IV6A 2V1DA 2UZKA 3BR6A 2EFNA 2JA5J 2LY2A 1K6YA 3HRMA 4Q4ZF 1HDPA 1IRXA 3A4CA 4IXAA 2VBYA 2HEOA 4ESBA 2XPWA 3CC2I 3ZP5A 2LG4A 1HXDA 3D5SC 1VQKI 1E3OC 2CO5A 5KAIC 4PJNA 4CYCB 1UJ8A 2VXDA 5KVRA 1ZGAA 4KIBA 4J01A 3Q5FA 1DUXC 4BXXJ 4FX4A 2ELHA 5FD6A 2XB0X 4HOBA 3PO3J 2M0MA 1UAAA 1LEBA 3VWBA 3C18A 2MGQA 2DW4A 2DT5A 1IF1A 1WJAA 1HF0A 1ERDA 2JVHA 3OMYA 3E1SA 3U21A 2DCEA 2EPFA 2AHQA 5F0CA 3KFWX 5FKMA 3ZQHA 3PFIA 1YTYA 3G3ZA 3IRQA 5FROA 3GF2A 5CJ9A 1J75A 1FEXA 5HS7A 3RPUD 3PUFA 4AUXA 2HXOA 4JQFA 5CVIA 2ZJQF 3CDHA 1MD0A 2IS4A 2BE5F 2HWVA 1G59A 3S3OA 3IP4B 1MBEA 3NQOA 2XPUA 3EUHC 1ACIA 4CUGA 5DDGA 2W1OA 4HNTA 4BE2A 2BW3A 1YW9A 2LR8A 2W7NA 1VZ0A 4M71A 1FY7A 1SAUA 2IEKA 3V8JA 3CMYA 1V3FA 2DDBA 4BL0B 1RETA 3LMMA 2BXZA 1TNTA 5D6FA 5FLMJ 3F23A 2WY7Q 2FEZA 3GW2A 1MDMA 4A3KJ 3ZMUA 3WE3A 3OYBA 1X3ZB 4YRVA 3GTJJ 2I5UA 3WTUC 3QYEA 4G94A 4Y4RA 2XHKA 1XS9A 1MMNA 1MNEA 2QSHX 3S1RJ 2CQQA 1K78A 3GZ5A 2VJ5A 2BEOA 1LDDA 5C3EJ 2VQLA 5EJCA 5HDNA 1Z6TA 3ZQIA 3IV5A 3SZGA 3S8PA 1BBYA 2NXNB 3OYMA 2R7OA 3DEWA 1XB4A 2GA1A 2IS6A 1JKQC 3A03A 2PX9A 2VOPA 3EUHA 3EUKL 4YFNF 3HOSA 3L2WA 1KQ8A 3FKIJ 1YJNI 2KFDA 2V6CA 4RDUA 4EJUA 1IUFA 3A1YA 3AG4H 4ZDPA 4C30A 4BQNA 1TWAJ 2MYSA 2DPDA 5FO5A 3CCSI 2R7XA 1ZKGA 3BR0A 1L0OC 4BY1J 4XMYA 3J81Z 3BCBA 4KT6A 5A2QZ 1LE8B 1F4KA 3KLNA 2AO9A 2KP6A 4HQMA 1SD5A 3JRGA 2KZGA 3G6EI 4XBFA 4A3EJ 4L18B 2R7WA 2E60A 1V5GA 2FU4A 2LOOA 1EV7A 3ABTA 1CQTA 2ISYA 4UNOA 4J19A 3J81K 2OU2A 1J59A 5LRSA 2E2IJ 5L3EA 4BBRJ 5EG0A 1QPIA 4LB5A 2BVLA 2PMZA 2JRTA 4XL9A 2XKOA 2WAQA 4HX7A 1XCVA 2FNPA 2VQGA 2KMUA 5EGOB 1BW6A 3WU0A 4QTRA 2HDWA 2MD0A 5EZHA 3RTRA 1IV8A 4U0YA 3HKZN 2R5ZB 2FBIA 3S2DJ 1F5TA 2EFOA 1MDMB 1KQ9A 1ZG5A 3WTYC 2JMWA 1O7FA 3EPZA 2QWWA 4QPOA 1K7AA 2M3AA 1SD7A 4MEXF 1XSDA 1X19A 1GXQA 4IL6C 1Z0XA 3FXOA 4M3DA 4IRHA 4A6EA 2W24A 1DP3A 1P92A 3T8RA 2VODA 3OIPA 2KKOA 3G1MA 3HHHA 1T08B 1LNWA 2HZTA 4ZTFA 1GV5A 3Q0VA 2M8EA 1MMDA 4HNVA 4ITVA 1X1CA 3KYCB 5JFRA 1HSTA 1X58A 2DFIA 2R3SA 4F93B 3QP6A 1FNNA 3TW6A 2E1CA 3EYIA 1SFXA 3GX4X 1MBKA 2MD5A 3CD6I 2Z3YA 4XKBA 4A3CJ 2E1OA 4NUBA 1Z3XA 3OWTA 4XOPA 4LLNA 1D1AA 3HOTA 1XX5A 2DTRA 1A36A 4Y17A 2ZXWH 1QZYA 1U9NA 2K02A 1IN4A 2ISZA 1ZYRF 5KAFC 1RIOH 2PJRA 3ERMA 4CCNA 2ELJA 1HW2A 2L5QA 1X1PA 4CZZA 1YS7A 4XLAA 1FBQA 1K83J 2X6YA 4HA8A 1SANA 3V7SA 1ZARA 1DGRM 5GTIC 2CFXA 2F48A 2YX4A 1POGA 2IPQX 1LPQA 4IKFA 1P4WA 4E7HA 4ANJA 3CF5F 4NC7A 4P5OA 3JRFA 1X1BA 2DXIA 3LAJA 3R0AA 1FMWA 1ZK8A 1XGNA 4E7IA 2Y75A 1QZZA 2JSPA 3IAM2 3BPVA 2TRTA 2FMYA 2C6YA 2E5NA 3IC7A 3L9FA 1W36C 1R1TA 3MZYA 4HLXA 4AWXB 5CVJA 4CHUA 2CQKA 2JK3A 3WHCA 2GWRA 3OIOA 3QPSA 2VL8A 3VOEA 3I64A 5D4SA 5IY5H 2JA7J 2MC4A 1YLFA 2V4JC 3HOWJ 4ZDOA 4OIOF 4YIRX 3DKYA 3W2VA 2CG4A 1SAXA 5FFXA 4UVBA 1OCTC 1JHFA 3RKXA 2PG4A 3KE2A 1I6XA 4F91B 1Z67A 4WCGA 1F36A 1H9TA 3B6AA 3FXQA 2XAHA 3ROUA 1TWHJ 3N05A 1VFCA 1NK2P 2RKHA 1A35A 2EQRA 3ABMH 1A6IA 4K2EA 1G8XA 5BS6A 4OMYA 3HSRA 1BN5A 3F21A 4PFOA 4EATA 2XGCA 1S7AA 2WAFA 2XVCA 3BTIA 2L01A 4M74A 2PBIA 4AIDA 2P6TA 4AU7A 3SFZA 3CLQA 3DCFA 2VC0A 4XN0A 1FMVA 3ASOH 2A61A 3LSHA 5LGNA 4BU2A 3TKYA 2E2JJ 3GFLA 2X6WA 4IQ4A 4D0PA 3GFMA 2LYCA 4PJJA 4BE0A 1H89C 2LDUA 1FWZA 3TL4X 1B9NA 5J47A 4KYWA 3OYCA 2TDXA 1UELB 2OQRA 3ABLH 4HEA2 1R4MB 3JTGA 3G2BA 3PO2J 3H92A 1D0ZA 5M3MJ 1W5CC 1O3SA 3DTEA 4XSZF 1HBXG 3QOEA 3S17J 5KHDA 5K1YA 2F5CA 1AA7A 3KZYA 1YRNB 2BY3A 3OR1C 3CC4I 1ZGJA 5LEJA 3AL0B 2KJBA 2KZVA 2DA7A 3FZVA 1B72B 3K70C 3GTPJ 2FX0A 2HQRA 4E70A 4PSXA 4UUSB 3R61A 1XN7A 2R93J 5FKNA 4U87A 4M6XA 3M8FA 2R7VA 4BKXA 4A0ZA 1WJFA 2OZ6A 3IHUA 1O3TA 5L3GA 1TWGJ 5CVRA 2RGVA 1MNMC 3R6SA 2GOXB 3BR1A 2VIXA 5IT9K 1ZQ3P 3GMEA 5F0HA 3OYAA 4HYEA 4ENNA 9ANTA 4A5NA 5D4RA 3JRCA 1KQ0A 2KRHA 3K2ZA 2W85A 2JWTA 3SYTA 4S0HB 4ABZA 5CKTA 4AC0A 3GTMJ 3GVAA 1AHDP 2K9QA 4WXHA 3RZOJ 1MJ9A 3S1MJ 1ENHA 3BY6A 3VODA 3DXJF 1W1WE 3W6JB 1QGPA 2CMPA 5DEQA 4B43A 2Y31A 3JRDA 5E3OA 1JKPC 2R7RA 4CH7A 1R1VA 3COAC 2R7DA 1I27A 2DQRA 2ZC2A 1ETVA 4XNFA 3F0CA 4CCLA 3M8EA 3OYLA 4N9IA 4I09A 1C0WA 4PCQA 3A01B 4II3A 3DPUA 3ZMSA 2B0LA 2QA4I 4LK1F 3J7ZI 4HX8A 3RKYA 1PUFA 1VQ4I 5E3NA 2HGCA 1Y6IA 1S6LA 1T98A 1U5TB 5GADJ 1KGSA 2PI0A 1WGXA 1W0TA 2L9NA 4DBQA 1K4TA 1J7KA 5L3CA 3WGGA 3HSFA 1KU3A 2D1HA 4FISA 2Y0MA 3IWFA 3ECOA 2EFQA 4WXDA 2VN2A 4LG0B 4E7ZA 5L3FA 1T95A 5E3MA 1PVEA 1W5TA 1WJEA 3KP3A 5B3SH 1WQ2A 4EQQA 3HL2A 2CUZA 1WJCA 2BBYA 2D45A 3AFHA 2AQEA 3J80K 1XD7A 5DD8A 4M3EA 3HM5A 4AM3A 2OZUA 3KYDB 2MW8A 2ZJRF 4I6ZA 4JX6A 4A3DJ 2YPRA 4DW6A 1LB2A 2HPIA 4LIVA 2D1VA 5JLWA 5H6QA 3KLOA 1QNTA 4FASD 3SZPA 1MBFA 5IP7J 2Q2EB 4MNUA 5C4JJ 1Z1DA 5FRNA 1RZ4A 2L2OA 1YFHA 1FOYA 1OFCX 1FOKA 1T2KA 3QYBA 1ETQA 1DPRA 4UB6C 3P5JA 3G73A 1Z7LA 2CS3A 4GCVA 2LFBA 2ETHA 5H6RA 2KDOA 5LRRA 1IN5A 5D8KB 3LOCA 4RM3A 5K7ZA 4KN7X 3PNVA 1FTZA 3TEDA 2LNBA 2M30A 2R7QA 4BY7J 4E6KG 4B3AA 2L7FP 1TTYA 3HPHA 4IEJA 4B1RA 1BJAA 4IQJA 2VBWA 5F6FA 3T0YA 1NTCA 3K4MA 3FXMA 3IUOA 1JGSA 1JXSA 4U0VA 1J2XA 5LHHA 3C2BA 3ZMVA 1QPMA 2NVYJ 2L02A 5BMZA 3I55I 4X0GA 3R4KA 3FM5A 3BG5A 2Z5UA 4HBLA 3E97A 3CJRB 3Q3SA 4IHWA 1FSEA 1OYWA 3KEYA 3CP2A 1U9OA 3HEFA 1YW7A 4ZZLA 1R9TJ 1BW5A 4AD9A 2L9RA 3BJ6A 5C44J 3ZPLA 2ZMEC 3RDIA 5LHGA 4KDPA 5E1WA 3IWZA 2A69F 5EEGA 3HB9A 3K4LA 2OD5A 1KONA 1XPXA 2M2EA 5B66C 3WGIA 2DAOA 2F5DA 2FD5A 1HKTA 3FXRA 1ZG3A 2VBZA 4XRSA 2QENA 3OYKA 1JI8A 4W1UA 4C9YA 3S3MA 4XORA 1WRJA 2NRAC 3UNGC 1PP8F 4RB1A 5D5WB 3L2CA 1BOAA 2XAGA 3HSEA 4CYCA 1PUEE 1ZN2A 3LA2A 1FP2A 3GXOA 4XQFA 4GFBA 5JR3A 2JUGA 2CSOA 2K85A 2OBPA 1O3RA 1N75A 1Y0UA 3QWLA 1LEAA 3JSPA 3KYLA 2WAEA 2QM3A 2HOTA 2WBMA 2VKHA 2A05A 1T8IA 2CU7A 2XUBA 2Y69H 4U7DA 2HQAA 4I76A 5HVQC 2DA2A 2X1CA 2X85A 3FF5A 3DPLC 4FX0A 1S5LC 3H0DA 1MNDA 4BXUA 3K10A 2EFWA 3CCVI 1BI0A 2OCCH 2O8XA 2ZMEA 3ISPA 1QRYA 1B9MA 2O61A 2DYSH 4QLCU 2H1KA 3L2UA 2DPUA 1UG2A 5ICEA 2A68F 1S7OA 1UZCA 4BHBA 1K4SA 3J7AO 3FBNB 3LWFA 4MFEA 1TWFJ 1USSA 2BOLA 2F4OB 4ON0A 2P7CB 1MSEC 2CV1A 3TP3A 3CCLI 3F6OA 3LSIA 1GHCA 3RPUA 1DU0A 1RRJA 1ZAOA 3EUAA 3VB2A 3T5XA 3D1NI 2ELKA 2GXGA 1MH4A 4L5IA 1J9IA 3ASNH 2M9HA 1V55H 5L3BA 4P1WA 5ILVA 3DU5A 2VE8A 3LNQA 1FYMA 1IO2A 5D6EA 2VC1A 2L3DA 5DTDA 1EF4A 2EZHA 3VYTB 4ZJZA 1ZLJA 2WV0A 1D5VA 4C3JJ 2CUJA 4DOZA 4LOCA 4JX4A 5FGMA 3J7YJ 3MMYB 4GYGA 2DK8A 1DU6A 3WG7H 3WTXC 1WH5A 3LL7A 3JRIA 1S9HA 5J1UA 4A0YA 2P5KA 2RNGA 1VQOI 2OCEA 4BGDA 2EV0A 2IA2A 4F3QA 1QVTA 1FYKA 4FT8A 2X0LA 4HRIA 3L2QA 3I71A 1A5JA 4YFKF 2B9SA 4BHCA 5BPIA 2DQLA 2H6CA 4XLNF 3KX2A 2P4WA 2K40A 3HJEA 5BNGA 2WV1A 1JKOC 3QODA 1BA5A 1XGMA 2HYFA 2YUSA 1LKXA 1R71A 3ZMDA 4B8XA 3F3XA 2DMPA 2HYJA 5TJJA 4RGXA 1IXRC 2R5YB 1LE8A 2I10A 4A2UA 3KP6A 1GLNA 2YSRA 3LA3A 1Y0NA 2XAJA 3MFKA 1SVLA 2CQXA 3JRHA 3CLOA 3S15J 4CZCA 3DP7A 1V54H 3FHNA 4Y33A 1ZTRA 3KZIC 3DTKA 5GTHC 4HV6A 2GA2A 4YIIA 3TO7A 3CJNA 4QPQA 3VPRA 2L7MP 1UB9A 3S2HJ 1S29A 1S8NA 1D8KA 3JRBA 2ZMEB 1O4XA 3U1DA 1E2XA 4Y15A 1IXCA 5LFAA 2DDAA 4Y7NJ 1SD4A 4G6DA 3K6GA 3KZZA 3CUOA 4L0ZB 2LF7A 2V79A 5IT3A 4E7KA 5F1JA 2E35A 1S72I 1SMYF 4HZFA 3FHZA 3CZ6A 2O6GE 4HF2A 5EGOA 3S1NJ 1UMQA 3WU2C 2KJCA 2E19A 1FPQA 3KEOA 6PAXA 3E3VA 3TQNA 1BI1A 2R5ZA 1OCZH 2PMZN 3IH3A 3H5NA 2STTA 4DBRA 3BJAA 2HVSA 4L9VA 1HLVA 1HDDC 1ZHFA 4EGZA 2VOOA 1ETWA 2Q1ZB 5L3DA 3S16J 5TRDA 2HOSA 4LK0F 2EIKH 3QAHA 1YX5A 5F64A 3BCAA 5IOYA 2BVMA 2LKXA 4A69C 1DQUA 4DQ2A 2O03A 4UVAA 2UWMA 2LTPA 2JT1A 1IDYA 4KIFA 1FIPA 3OYDA 3VDXA 2ZBKA 3VEPA 1I3AA 3FM3A 4M72A 1G3YA 4NB5A 5LD2C 2FRHA 3ZQFA 2LD5A 1YO5C 1OR7C 2W82A 4RB0A 1U8BA 4L5JA 3B6CA 4M9SA 3ZQ7A 4BDYA 1A6QA 1O57A 3JW4A 4LG3A 3GTQJ 2ZXHA 1UHMA 3KP2A 3O2PE 4EM2A 3LSKA 1B59A 3P9CA 4PJLA 4Z2YA 5IYDJ 4C2MJ 3REOA 4J00A 3K4CA 3MKWB 2J5OA 1APLC 3PFYA 4PGHA 3CMAI 2Z16A 3E6MA 3PSFA 5JVGF 1DPUA 3OS1A 3FKJA 3V8LA 4HW0A 1HOMA 4W97A 3K1MA 1P7JA 1LFBA 2KRCA 3VSLA 3LSRA 5M5YJ 1D8JA 1SEUA 2K4JA 5F08A 1W7PD 4UV8A 3FDYA 4H0EA 2LY9A 2EFPA 5HODA 4UB8C 3E6DA 2E1NA 3DKXA 4BACA 2JZYA 1W4MA 2LC2A 1VQPI 1UHSA 3HC7A 3ERED 1OR7A 2DLLA 2NNNA 3IAS2 1IDZA 3B02A 3DWLE 1LQ1A 4ZYAA 2ZFUA 3GLXA 3RYPA 2O3FA 1QA6A 3ZXSA 1W7PB 2RN7A 4LGWA 2WY8Q 2XIGA 4HSRA 2QYOA 2RQPA 4RLQA 1J09A 1Z6RA 2B7EA 4M3FA 4A3GJ 2DOAA 3A0HC 3VFZA 3FMSA 2MH9A 3OL3A 2XAUA 2VASA 3Q0WA 3LSTA 1EKEA 3BPXA 4LIUA 2M45A 4HAMA 2HDCA 2ZKZA 4KICA 4D7MA 3U9GA 1LDKB 1WI3A 2NYXA 3E5QA 4MO7A 3CDIA 3H9QA 3MZHA 3RYRA 3AL0C 1TLHB 3HOVJ 2HOEA 3BG9A 3MWMA 1CF7B 1E3PA 3OYHA 2CJJA 4KIGA 1HSJA 2KLOA 2AXTC 5LLQA 1KYZA 1WSUA 2NS8A 2COMA 4BYYA 4ZDLA 4G9YA 1WKMA 5FKLA 1ZH5A 4BQQA 1GXPA 1VNDA 3BTLA 3E6BA 4BAYA 1XMAA 1T39A 2WB1N 4E7SA 4C3IJ 4IX7A 1S7EA 4XIDA 1QO0D 4I02A 2NVTJ 4CXFA 4NDLA 1BOBA 5GPCA 4WWCA 5LHIA 2GXBA 2X6XA 3PUBA 2UXNA 2F4MB 1TW3A 3BZKA 1U8RA 4IHXA 4F55A 1B4AA 3DBHB 1HW1A 4E7JA 4JOMA 2LP0A 1YJ9I 3RKQA 4B3XA 2EJRA 1XGOA 1AKHB 1F9NA 4M3BA 3OY9A 1VQLI 1YRNA 4A3LJ 2GQQA 3MD2A 3J7AY 1IN8A 2DA5A 5BPDA 3PQKA 4RGSA 2A6HF 1B72A 3DKWA 1OCRH 4UUSA 1EH6A 3I59A 3PSIA 5HNHA 1Y8QB 3OS2A 3ESWB 3O6BB 1JE8A 3M07A 1YITI 4HDVA 4NC8A 3PNYA 2L9SA 2BZTA 4X1EA 3BDDA 4HPQA 3GYHX 1U5TC 2BY2A 3K1PA 2G7HA 4ENJA 4XICA 1VQ6I 5IP6A 2KIUA 4TV7A 4AVPA 2NOJB 3ZN0A 3H36A 4AYBN 1M1EB 2QF7A 5KNLA 2VQHA 2LMDA 2ID3A 2DOEA 2UUZA 1JT0A 2FUG2 1STZA 2LRDA 1HCRA 1G3WA 4L9JA 3FK6A 3PQJA 4BEHB 3VYUB 3OL4A 3FXLA 3W3CA 3BP8A 1ZG1A 1XMKA 3CMMA 1KU2A 2QZ8A 4GO1A 3A0BC 1XDSA 4OMZA 1ETXA 1BR2A 1MBHA 2VXZA 1LFUP 1VQ8I 3E0JB 2FOWA 3Q9SA 5GAHJ 2HU9A 1IAWA 3AG3H 4N4NB 4C2TA 4ESFA 3NARA 4OAZA 5DV5A 2XAQA 3A01A 1YOVB 4XKWA 4P55A 1AOYA 1G2HA 2F5FA 2R4GA 2F5EA 3TMOA 3BQZA 1IG7A 4RAZA 4L0YB 1TQIA 1JUPA 2H09A 3HYIA 1U5TA 4A3IJ 3HTUA 4CO8A 3PIOF 3QU6A 1T56A 2Y9ZA 2DA3A 2RAEA 2LBFB 2JJ7A 3I5UA 2F4IA 4YIFA 2OAZA 1V5EA 2ESHA 4BJ6C 5DCMB 1MMGA 3L7WA 1VQ5I 1IN7A 4LG0A 1A04A 4WK8F 1A31A 2WC2A 3I53A 4NNJA 4CICA 2XKPA 1VI0A 3OIQA 2FXAA 1WWXA 5JHFA 3WODF 4S04A 1MMSA 4LMYA 3K4NA 1B8IB 1X2NA 2GM4A 1IC8A 4B44A 4IHTA 5IT9Z 2RDPA 3NWSA 4M6VA 1R7JA 3F72A 4ZYEA 3HTSB 2M0CA 3C2GA 3I59B 4GGGA 2HTJA 3OOUA 4KNYA 3HOYJ 4OU0A 5EEAA 4AIHA 4RB3C 3TDUC 2Q2EA 4IRGA 1DDNA 3C1DA 4CDGA 2JPCA 5CLSA 3F8FA 1WJ5A 3HPGA 3VYSB 4UV9A 5LGUA 4A12A 1FT9A 1JT6A 3HOUJ 2A5YB 1I1GA 2DMQA 3W2AA 4IO9F 4ETSA 4Q48A 1GDTA 4D5CA 3FMRA 1Z05A 2QBYB 3DU6A 5HDKA 2VJ4A 1D3YA 2IGNA 5K5QA 3D5LA 3L2RA 1I5ZA 1LDJA 4IHVA 3C2HA 3CO6C 1T0FC 2FMLA 2IRFG 5E1XA 5EF6A 4KITB 2IA0A 2FBKA 3GFJA 3SJMA 2Z33A 3BZCA 2HYGD 2I8DA 4V19K 1GV2A 3R0JA 2KDZA 2QSFX 4KT5C 2DTZA 2E1MB 2QQ8A 2RV8A 3SZTA 3CCJI 2HKXA 2LKPA 2IGMA 1H8AC 3TOBA 1BC8C 3WGHA 4V2FA 4XLHA 2EA4A 3EETA 4NHJA 3BLYA 1YJWI 3FXJA 2ME6A 2Z2SB 4MIMA 1X1DA 3FXKA 2HI3A 4XONA 5FRMA 2WTEA 3S32A 3LSGA 4LITA 4A3JJ 3J80Z 2A6TA 3KEQA 2R92J 3L00A 5DM6F 2WADA 2M8GX 1YIJI 3I56I 2OTLI 3UR3C 1NG7A 3R60A 4MGRA 1SFEA 2JPBA 4PSWA 3CUQB 3X2QH 4DJAA 3CCMI 1R58A 1Z7UA 4G7ZF 4I7HA 3O8GA 4QWQA 1T0FA 2EZLA 3KP5A 1OLTA 2DYRH 2XF5A 1TW2A 3FWEA 4DNCA 3TGNA 1XMXA 1YX3A 3OSFA 4ZYGA 2V9VA 4I98B 2ZSIB 2EBIA 4XLFA 1NK3P 5K5RA 1J5YA 2BHZA 2QGUA 1USTA 3MN2A 2XASA 3CCUI 1Y1VJ 4RBOA 2A3SA 2QSGX 2ZCWA 4XK4A 4NQWB 2ZNYA 3N4MA 3LA7A 1LJ9A 2M4KA 1R4NB 3SHFA 4XRFA 1E0EA 3OYEA 1ORKA 4BS9A 5J6XA 1MW7A 2IGOA 3LAPA 3FIWA 2JTVA 3EYYA 1I39A 5M5XJ 4Y52J 5ILSA 2EH3A 2KIQA 3P7NA 1X4PA 1YG2A 2HQ5A 1NHAA 2Y0SN 2PLYA 3I4NJ 5DD4A 5IOZA 2J5PA 3ZOBA 2ME0A 4HX4A 2XC7A 3HRSA 5KCMA 3CJTB 5HDGA 4IZZA 1ETYA 2A5WA 1EH7A 4HDUA 2E2HJ 1IRFA 1ZRCA 1XSVA 3ZN1A 1BI3A 1FOWA 1GT0C 1XCBA 1ZLKA 2V1UA 2CYYA 3F8NA 1Y1WJ 4OOIA 5HLGA 3B73A 2K5CA 4R79A 1OYYA 2YR2A 3G4SI 2VONA 3PIPF 1D5YA 4RAGA 5EDNA 3IH4A 4EGYA 4RA2A 4FCYA 3FX3A 3Q9VA 3KIOA 4WF2A 5ICGA 3PNTA 4GRIA 1UCRA 1WJDA 1SFKA 2GOMA 4XSXF 2YS9A 1Q1VA 3ZQGA 5F04A 2V9PA 3D0SA 1FZPB 2ZJPF 1W0UA 2NAZA 5IYBJ 2MABA 1VQMI 1OKRA 3JAMK 2VBXA 2BGCA 3RZDJ 3H3VK 2DK5A 3CCYA 3QQAA 2HKOA 2OA4A 4XR6A 5F1RA 5ILUA 3GTGJ 3BC8A 3G1LA 5D5XB 2GXAA 4PUSA 2L7ZA 1H9GA 4R1HA 1XDUA 2IS1A 3CTAA 1HKQA 3I58A 2E71A 5IPAA 1ZRFA 4KJZA 2E34A 4OAYA 3S93A 1D0XA 1R22A 3RI4A 3WTZA 4NC6A 3CJQB 3V7CA 3I9V2 4F92B 1JJ6C 4I01A 3F9KA 1D1CA 1G3TA 3DEEA 2FE3A 1KZHA 1RKWA 3HUGB 3FISA 4IHYA 2MFZA 2EB7A 4E4HA 2R5YA 2G0EA 3MQ0A 5CQGA 3DTIA 2LKSA 1YS6A 2CW7A 4XRSG 2IA1A 2E7WA 4MQVA 1XGSA 5HLIA 5HOOA 3H5RA 1LVKA 4XM3A 3VSKA 2BY1A 2KT0A 2A07F 2QCOA 4PGGA 1Y8RB 4CCMA 1ITYA 1R5HA 4PZJA 1Z91A 5E3LA 4I2OA 2NS7A 1QHHD 3SEZA 2KL4A 3ZMZA 4Y13A 2DJIA 2LSOA 5CYVA 4YG2F 3IL2A 1IRZA 1MGTA 2A6EF 2HXIA 4LB6B 3I0TA 4F7ZA 1EJ9A 2OQGA 5FKOA 2F5VA 1LVAA 3WE2A 5D5UB 4HF1A 1FLIA 2XB5A 1V5FA 2DT7B 5J1RA 4ZH4F 2D5VA 1WVRA 1T38A 2CRGA 4MFDA 1BIBA 4F52A 2N8GA 4JX5A 1R36A 2CW0F 4FTHA 4GXOA 5EEHA 3ULQB 3HRTA 3LSMA 3F8CA 1H0MA 2OJED 2MC3A 4A6DA 2UV1A 3LQQA 2BY0A 2HVQA 3TW7A 2MLKA 4B4CA 1H88C 4QSHA 5D5VB 1TL8A 3CESA 2IT0A 4FHTA 3SDBA 3MVPA 3QPLA 2L54A 1JUSA 1QHGA 4ZZDA 2DFHA 3RSNA 2EV5A 3H5AA 2NOGA 3GCMA 2R7SA 2AXLA 2QUFA 4C3HJ 3H1CA 1JKRC 5AIQA 2L4MA 1WJBA 2ID6A 3BZ6A 5FFZA 2W48A 4LLLA 3TDZC 4D5FA 2VUMJ 2CGPA 5E79C 3U2RA 1EA3A 4B47A 2MBFA 3ZMTA 2Z9OA 2VKVA 2GIZA 4WXCA 2XAFA 1Z21A 2ADUA 4XKCA 3ABKH 4A93J 3D5RC 4ZYDA 4P96A 4IJAA 3PJRA 1MBJA 2COBA 3QPHA 4OINF 1ZGWA 1QBJA 4D1QA 1P4AA 2L9VA 1UFMA 2ZFWA 4X6AJ 3JSOA 5M5WJ 1ZREA 2JRMA 2MLGA 4EMSA 4BNCA 3BROA 1VQ7I 2VPLA 4HSTA 4DIQA 1FYLA 3BR2A 3HOZJ 3U1KA 1RESA 3HDDA 4HG2A 3E5XA 2ECBA 1I1SA 3QU3A 4Q47A 2E5ZA 3BG7A 4DYRA 4WX9A 1W7PA 5LEKA 1TC3C 1RPWA 2IW5A 3GTLJ 4DYQA 3CCEI 2L4AA 3E7LA 4BQOA 2WAQN 3RQ4A 1LUJB 1HKSA 2IGKA 3NEUA 4N9HA 5J40A 3DEUA 4RGRA 4EJOA 4PJ0C 5EYRA 3AAFA 5ERIA 5M3FJ 4YELA 3ZRGA 3CF2A 3PM1A 2NVUB 2K9NA 5HS9A 3GO5A 3DBLB 1X4OA 2FQ3A 4CGZA 2F2EA 3CC7I 2V7FA 1OCOH 1P4XA 4N0BA 1JTXA 3EQLF 1X3UA 1ZR4A 2VJJA 5CVVA 2X51A 1ONVA 2DN0A 2CW8A 2XSJC 3BQYA 4L5EA 5H20A 4JK1X 1F1ZA 5DS9A 1TWCJ 2EINH 2DMNA 2G7UA 1MH3A 3O3KA 3FK7A 1CF7A 3BR5A 2DT6A 4RMNA 4UUTA 3ONQA 2IJLA 1WCMJ 1U0JA 2XGDA 2Y30A 2DI3A 2OF7A 4C2UA 3V8KA 3VYRB 1MZBA 2PJPA 4Y3OA 4EEFG 1PDNC 1TT0A 4KMUX 4BJTA 4XLEA 1XC5A 5LBQA 5IYCJ 1BR4A 2MA3A 5J4VA 1KA8A 3ELKA 3K4JA 1FJLA 5GPAA 2PMUA 4GDFA 4L9NA 3K1NA 2VKEA 5CQEA 1K79A 2DMTA 4DYCA 4XKVA 3BR3A 2V26A 2GZWA 4D9JA 3ZQCA 3WTTC 2DA6A 1XSXA 4DZJA 1Y56A 2CWEA 3NWTA 2H1LA 4G8XA 3AKZA 4PDKA 1AKHA 1MKMA 3AG1H 1GVJA 4ENKA 2HOAA 2RREA 2K86A 4KUMA 5AONA 4MEYF 1R6RA 5TGTA 4H4KC 2NS0A 5B5EC 5E8IA 4BQAA 2V9KA 1REPC 2K9SA 3C3WA 2VQCA 1MBGA 3GLLA 3G71I 3OYFA 3S14J 3W2WA 2OUMA 3OYIA 1S3JA 1OCPA 2UXXA 2CQ7A 2IP2A 1RNLA 5A2QK 3M3YJ 2O5RA 2KPMA 5DUIA 4PFPA 1JHHA 2M1BA 1SVMA 3DQVC 5TISC 2BW3B 4IOAF 1R23A 2R0QC 5E8GA 2X4HA 1HA8A 1BC7C 3MAJA 1U78A 1KYWA 5ED4A 4LD5A 3KP4A 3H3UA 2VLAA 1MMAA 2JA8J 2IVMA 1TT5B 2EA2A 2RC4A 3ZQLA 4RLFA 3WHBA 2LREA 2HZDA 3CO7C 1X1AA 1WFXA 3KPHA 5F27A 4MTDA 2LF8A 4UHTA 4BEHA 2P8TA 4I0BA 3BG3A 3DPTA 2GLOA 1V4RA 3M7GA 4LFUA 4IRIA 3FMQA 2CV2A 2QVOA 3UKGA 3M8JA 5JLXA 3T8TA 1WH7A 5CVUA 3DF8A 3ZQQA 3I4PA 2XROA 4UUVA 1K78B 3OYJA 4RM2A 3SFIA 2O0YA 4CA0A 1W5SA 2PFBA 5C4XJ 2KIFA 3QYFA 1IN6A 4M9XA 2O9LA 3S1QJ 2EV6A 2XF7A 2BV6A 3GZ6A 1PYVA 3H9JA 4O6JA 2K3PA 2VKDA 2Y9YA 3ZCOA 4CSWA 3HBLA 2LBFA 4CCOA 4OIPF 2FOKA 3GUDA 4MQ9F 5DCMA 4EV0A 1XTAA 4E7LA 5KK1A 1OPCA 1IZ1A 3H3ZA 5B1BH 3LFUA 1I3QJ 4AIJA 3CDLA 2ECCA 3HGGA 1OQYA 4FE7A 4ENMA 4BXFA 2E1MC 2CQNA 3OSGA 1B8IA 3H9GA 2VJIA 1PP7U 1QVUA 3V4GA 2IAIA 3WU1B 3MKYB 4IVNA 2H6BA 3CP8A 2ZXIA 4XOTA 2E7XA 3QOPA 1IGNA 1LFPA 2EZIA 3LQRA 1U2WA 3BOQA 3M9AA 1ZRDA 1ETOA 3TP0A 4KFCA 1P2FA 4XLPF 1EH8A 4AVZA 3QP5A 5F0FA 5EG0B 1RR8C 3P9KA 3Q0UA 3HKZA 1IRGA 5FLXZ 4IHSA 4EJWA 2P5VA 4EJTA 2M7BA 1G4DA 4MHGA 2DA1A 1WHUA 3CUQC 2XV4S 3ZR8X 4HLYA 2QBYA 2X48A 2XDVA 3TBIA 1QU3A 3IH2A 1DP7P 2P6SA 1IXSB 5K7FA 2KISA 5FLVA 1YHQI 1CGPA 2QQ9A 1TBXA 5HLHA 1IJWC 5FLXK 3CMEI 3GFIA 5D8LB 3JCUC 2HTSA 3ECHA 5EZGA 2ZJ2A 3OS0A 1WZ2A 1MJAA 2P81A 4U88A 2XRNA 2LLKA 4RGUA 2X9DA 2NVQJ 5K5OA 4L9TA 1OYIA 3RCOA 1U3EM 1FBSA 5K7HA 2ZB9A 5LGTA 2VE9A 1PJRA 1SFUA 4FQGA 4JYKA 4G7HF 1SC7A 1AU7A 1GUUA 3WG9A 1TNSA 2Z99A 1OISA 2DFEA 2V1XA 2DBBA 4HV5A 4BBSJ 1K61A 5ICCA 1BIAA 4GYIA 2WB1A 4ZYHA 3CUQA 1VQNI 4EM1A 2PQ8A 2W25A 1G3SA 1ZELA 4BJ5C 2CV0A 3I4MJ 2LVSA 2EIJH 1RKTA 3V7RA 1R5ID 5E20A 1YQAA 3JTHA 2PJRB 1I50J 4M3GA 2V6EA 3GBGA 3IKVA 2BXYA 3ML6A 2M87A 3MZ8A 2WWYA 4IF4A 3MEXA 3DFGA 4JBAA 5DCFA 2O8KA 1TP4A 2BHYA 3PL8A 4NQWA 4QIWN 2JSCA 2KIMA 2W4SA 3FBIB 2ZXJA 3BJOA 4M73A 4HQEA 5J3LA 3HHGA 3S2WA 3KP7A 2RNJA 2HPMA 4ZTJA 1Y39A 3HOXJ 4CYDA 1X2MA 3H35A 1SD6A 2PEXA 5H2FC 1RUNA 1RUOA 3DV8A 4M6YA 1FP1D 3HXLA 1N77A 2DA4A 2W57A 4A3MJ 1MIJA 4BH9A 3CQZJ 1HQCA 2K3FA 2MSYA 4G6TB 3K9TA 3CCQI 2RVCA 1ON2A 1HC8A 4MLOA 2DO7A 4N4OB 2HVRA 3K2AA 1NG6A 3M1CA 2Q8KA 5HS8A 4II2A 2L0KA 1XG1A 2WA0A 1N78A 2IS2A 4AYBA 5E18F 3I54A 5FD5A 3GTOJ 1TQPA 4BHPA 3JRAA 3LFKA 3BWGA 2HNHA 2GIVA 4ASNA 1W36D 2DFFA 1UHWA 2FNAA 5CPRB 3MCZA 4BDZA 3F22A 4OWRB 4I0AA 2V1NA 4OIRF 1YYVA 4RS8A 1Z9CA 2Y2ZA 1ZR2A 3P9IA 3OYNA 1JGGA 1OMIA 4HF0A 2JQ7A 3WTSC 1YE9A 2H8WA 2PMHA 2EWNA 4UXNA 1X3WB 1BI2A 1DGWY 1FTTA 4BE1A 3TOAA 2VI6A 2EZKA 1HW5A 4DZPA
chains in the Genus database with same CATH topology
1AWCA 4O5VA 3HRUA 1KU9A 2QQBA 4EM0B 2M5WA 1E17A 1FC3A 1ULYA 3L09A 3E5UA 3F8BA 4U0WA 1SMTA 5BQTA 1R1UA 3T1BA 2AS5F 1FBUA 2GAUA 1FSHA 3RIRA 2PN6A 3HUGA 1ODDA 4KN4X 5JI6A 2FBHA 4B09A 5E1ZB 3K0LA 3ABUA 1YIOA 2DU9A 3GWZA 4LLGF 3K69A 1U6GA 3F6VA 1B6AA 2W84A 2VT3A 1IUYA 4U7BA 5DYMA 2K7LA 4OIQF 2KRFA 4EVIA 5J8FA 1KU7A 4YFXF 1BM9A 1MJBA 2NNYA 4EJVA 5J8CA 1Q1HA 1P6RA 2K4BA 2Y48A 1VTNC 3TO9A 3HIFA 2BYVE 4G6QA 2HQNA 2FSWA 3JAMZ 2YX7A 3N97A 4G7OF 2H27A 2ZNZA 4P9FA 4RB2C 3IKTA 4KA4A 2HFHA 4A5MA 4Q5SF 2D2WA 2K27A 1QQIA 4UVCA 3QPTA 2H94A 3GEZA 1R00A 2YU3A 3KCCA 2ZO4A 2HS5A 1TQMA 1RI7A 1FX7A 4LJZF 4AIKA 4A0XA 2QLZA 3OV8A 4IPAA 5JVTA 3E6CC 2P5LC 2MH2A 4R8HA 4RAYA 5AIPA 1J0RA 2EK5A 3RJPA 3C7JA 1R5GA 2STWA 1T6SA 3EDPA 3IRRA 1YW8A 4O3MA 5DUKA 3F8MA 1L3LA 1ON1A 3RPQA 3M1EA 1G6NA 5E17F 2HR3A 2ESNA 3TO6A 3WTVC 2Q0OA 2R7FA 1K6OA 2G9WA 3WTWC 4S05A 2P7VB 5ICFA 3W6KB 4M9ZA 3RKWA 5FB2A 1B1BA 1WI9A 2FF4A 2VT2A 3NRVA 5JHUA 2XGXA 3FXUA 1IW7F 3SXYA 4KMFA 3KETA 2FA5A 1O3QA 2ACJA 3QRFF 4ESJA 4P9UA 2QQAA 4MTEA 1O7LA 5BOXA 3SQNA 3OOPA 2V1DA 2UZKA 2EFNA 3HRMA 4Q4ZF 4IXAA 2VBYA 2HEOA 4ESBA 3ZP5A 1HXDA 2CO5A 5KVRA 1ZGAA 4KIBA 3Q5FA 1DUXC 4FX4A 2ELHA 5FD6A 4HOBA 1LEBA 3C18A 2DW4A 2DT5A 1IF1A 3KFWX 3PFIA 1YTYA 3G3ZA 3IRQA 3GF2A 5CJ9A 1J75A 5HS7A 5CVIA 4JQFA 3CDHA 1MD0A 2BE5F 2HWVA 3NQOA 5DDGA 1YW9A 4M71A 1FY7A 3V8JA 1V3FA 1TNTA 5D6FA 3F23A 2FEZA 3GW2A 1MDMA 3ZMUA 3WE3A 3WTUC 4G94A 2XHKA 1K78A 3GZ5A 2BEOA 1LDDA 5HDNA 1Z6TA 1BBYA 1XB4A 2GA1A 2VOPA 3EUHA 4YFNF 3HOSA 1KQ8A 2V6CA 4EJUA 2DPDA 5FO5A 1L0OC 3J81Z 5A2QZ 1F4KA 3KLNA 4HQMA 1SD5A 4XBFA 4L18B 2FU4A 1EV7A 3ABTA 4UNOA 2ISYA 3J81K 2OU2A 1J59A 5LRSA 5L3EA 4LB5A 2JRTA 2XKOA 4HX7A 1XCVA 2FNPA 3WU0A 3RTRA 4U0YA 2FBIA 1F5TA 2EFOA 1MDMB 1KQ9A 1ZG5A 3WTYC 1O7FA 2QWWA 1K7AA 1SD7A 4MEXF 1XSDA 1GXQA 4IRHA 4A6EA 2W24A 1P92A 3T8RA 2VODA 2KKOA 3HHHA 1LNWA 2HZTA 2M8EA 5JFRA 1HSTA 2DFIA 2R3SA 3QP6A 1FNNA 2E1CA 3EYIA 1SFXA 3GX4X 2MD5A 2Z3YA 4LLNA 3HOTA 2DTRA 4Y17A 1QZYA 2K02A 1IN4A 2ISZA 1ZYRF 1RIOH 1HW2A 4CZZA 1YS7A 1FBQA 4HA8A 3V7SA 1ZARA 2CFXA 2YX4A 2IPQX 1P4WA 4P5OA 3LAJA 3R0AA 1XGNA 2Y75A 1QZZA 3BPVA 2FMYA 2C6YA 3IC7A 3L9FA 1R1TA 3MZYA 4HLXA 4AWXB 5CVJA 4CHUA 2CQKA 2GWRA 3VOEA 3I64A 5D4SA 1YLFA 4OIOF 2CG4A 1SAXA 5FFXA 4UVBA 1JHFA 3RKXA 2PG4A 3KE2A 1I6XA 4WCGA 1H9TA 3FXQA 2XAHA 3ROUA 2RKHA 4K2EA 5BS6A 4OMYA 3HSRA 1BN5A 3F21A 1S7AA 2XVCA 2L01A 4M74A 2PBIA 2P6TA 3SFZA 2VC0A 2A61A 5LGNA 3TKYA 3GFLA 4D0PA 3GFMA 2LDUA 1FWZA 1B9NA 4KYWA 2TDXA 2OQRA 3JTGA 3H92A 1O3SA 4XSZF 1HBXG 5K1YA 2F5CA 3KZYA 1ZGJA 5LEJA 2KJBA 3FZVA 2HQRA 4E70A 3R61A 1XN7A 4M6XA 3M8FA 4A0ZA 2OZ6A 3IHUA 1O3TA 5L3GA 5CVRA 2RGVA 3R6SA 5IT9K 4HYEA 4ENNA 4A5NA 5D4RA 1KQ0A 3K2ZA 2W85A 3GVAA 4WXHA 1MJ9A 3BY6A 3VODA 3DXJF 3W6JB 1QGPA 5DEQA 1R1VA 3COAC 2R7DA 1I27A 2DQRA 3M8EA 4N9IA 4I09A 1C0WA 4PCQA 3ZMSA 2B0LA 4LK1F 4HX8A 3RKYA 2HGCA 1S6LA 1T98A 1U5TB 1KGSA 2PI0A 1J7KA 5L3CA 3WGGA 3HSFA 1KU3A 2D1HA 2Y0MA 3IWFA 3ECOA 2EFQA 4WXDA 2VN2A 4LG0B 5L3FA 1W5TA 3KP3A 1WQ2A 4EQQA 2D45A 2BBYA 3J80K 1XD7A 5DD8A 2OZUA 2YPRA 1LB2A 2D1VA 5H6QA 3KLOA 1QNTA 3SZPA 4MNUA 1Z1DA 1RZ4A 1YFHA 1FOKA 1T2KA 1DPRA 3G73A 4GCVA 2ETHA 5H6RA 5LRRA 1IN5A 5D8KB 4KN7X 2LNBA 2M30A 1TTYA 1BJAA 2VBWA 5F6FA 3T0YA 1JGSA 1JXSA 4U0VA 1J2XA 5LHHA 3ZMVA 1QPMA 2L02A 5BMZA 3R4KA 3FM5A 2Z5UA 4HBLA 3E97A 1FSEA 1OYWA 1YW7A 4ZZLA 4AD9A 3BJ6A 3ZPLA 3RDIA 5LHGA 4KDPA 5E1WA 3IWZA 2A69F 5EEGA 2OD5A 3WGIA 2DAOA 2F5DA 1HKTA 3FXRA 1ZG3A 2VBZA 2QENA 1WRJA 2NRAC 1PP8F 4RB1A 5D5WB 3L2CA 1BOAA 2XAGA 3HSEA 1PUEE 1ZN2A 3LA2A 1FP2A 3GXOA 5JR3A 2CSOA 2OBPA 1O3RA 1Y0UA 1LEAA 3JSPA 2QM3A 2XUBA 4U7DA 5HVQC 3FF5A 3DPLC 4FX0A 4BXUA 2EFWA 1BI0A 2O8XA 2ZMEA 3ISPA 1B9MA 2O61A 4QLCU 2DPUA 5ICEA 2A68F 1S7OA 4BHBA 3J7AO 3LWFA 1USSA 4ON0A 2P7CB 3F6OA 1GHCA 3RPUA 1ZAOA 3VB2A 3T5XA 2GXGA 4L5IA 1J9IA 5L3BA 5ILVA 2VE8A 1FYMA 5D6EA 2VC1A 2L3DA 1D5VA 1ZLJA 2WV0A 5FGMA 4GYGA 2DK8A 3WTXC 4A0YA 2P5KA 2EV0A 2IA2A 1FYKA 4FT8A 2X0LA 3I71A 4YFKF 4BHCA 5BPIA 2DQLA 2H6CA 4XLNF 2P4WA 1XGMA 2HYFA 3ZMDA 4B8XA 3F3XA 5TJJA 4RGXA 1IXRC 4A2UA 3KP6A 2YSRA 3LA3A 3MFKA 2XAJA 3CLOA 3DP7A 4HV6A 2GA2A 4YIIA 3TO7A 3CJNA 1UB9A 1S29A 1S8NA 1D8KA 2ZMEB 3U1DA 1E2XA 4Y15A 1IXCA 1SD4A 4G6DA 3KZZA 3CUOA 4L0ZB 5IT3A 2LF7A 2V79A 1SMYF 4HZFA 3FHZA 2O6GE 4HF2A 2KJCA 1FPQA 3KEOA 6PAXA 3E3VA 3TQNA 1BI1A 2STTA 3BJAA 4L9VA 1ZHFA 4EGZA 2VOOA 5L3DA 5TRDA 4LK0F 3QAHA 5F64A 4DQ2A 2O03A 4UVAA 2UWMA 2JT1A 4KIFA 2ZBKA 3VEPA 4M72A 3FM3A 1G3YA 4NB5A 2FRHA 1YO5C 4RB0A 4L5JA 4M9SA 3ZQ7A 1O57A 3JW4A 1UHMA 3KP2A 3O2PE 4EM2A 1B59A 3P9CA 4Z2YA 3REOA 2J5OA 4PGHA 3E6MA 1DPUA 3V8LA 4HW0A 3K1MA 1D8JA 2K4JA 1W7PD 4UV8A 4H0EA 2EFPA 3E6DA 2E1NA 2JZYA 1W4MA 3ERED 1OR7A 2DLLA 2NNNA 3B02A 1LQ1A 3GLXA 3RYPA 2O3FA 1W7PB 2RN7A 4LGWA 2XIGA 2QYOA 2RQPA 1Z6RA 3VFZA 3FMSA 2MH9A 3LSTA 3BPXA 2M45A 4HAMA 2HDCA 2ZKZA 4KICA 3U9GA 1LDKB 2NYXA 3E5QA 3MZHA 3RYRA 1TLHB 2HOEA 3MWMA 1CF7B 4KIGA 1HSJA 5LLQA 1KYZA 1WSUA 2COMA 4BYYA 4G9YA 1WKMA 1ZH5A 1GXPA 3E6BA 4BAYA 1XMAA 1T39A 1QO0D 4I02A 4CXFA 4WWCA 5LHIA 2GXBA 2UXNA 1TW3A 1U8RA 1B4AA 1HW1A 2EJRA 1XGOA 1F9NA 2GQQA 1IN8A 5BPDA 3PQKA 4RGSA 2A6HF 3DKWA 1EH6A 3I59A 3O6BB 1JE8A 4HDVA 3BDDA 3GYHX 1U5TC 3K1PA 2G7HA 4ENJA 2KIUA 4TV7A 4AVPA 3ZN0A 1STZA 1G3WA 4L9JA 3PQJA 3BP8A 1ZG1A 1XMKA 1KU2A 2QZ8A 4GO1A 1XDSA 4OMZA 2VXZA 1IAWA 3Q9SA 4ESFA 5DV5A 2XAQA 4P55A 1AOYA 2F5FA 2F5EA 4RAZA 4L0YB 1TQIA 2H09A 3HYIA 1U5TA 3HTUA 4CO8A 3QU6A 3I5UA 4YIFA 2OAZA 2ESHA 5DCMB 3L7WA 1IN7A 4LG0A 1A04A 4WK8F 2WC2A 3I53A 4CICA 2XKPA 2FXAA 1WWXA 3WODF 4S04A 4LMYA 5IT9Z 4IHTA 2RDPA 4ZYEA 1R7JA 3F72A 3HTSB 3I59B 4GGGA 4KNYA 2HTJA 4OU0A 4AIHA 4RB3C 3TDUC 2Q2EA 4IRGA 1DDNA 3C1DA 4CDGA 2JPCA 5CLSA 3F8FA 4UV9A 5LGUA 4A12A 1FT9A 2A5YB 1I1GA 4ETSA 4Q48A 3FMRA 1Z05A 2QBYB 5HDKA 5K5QA 1D3YA 3D5LA 1I5ZA 1LDJA 3CO6C 2FMLA 2IRFG 5E1XA 2IA0A 2FBKA 3GFJA 2Z33A 2HYGD 3R0JA 4KT5C 2RV8A 3SZTA 2HKXA 2LKPA 3TOBA 1BC8C 3WGHA 2EA4A 3EETA 4NHJA 2WTEA 3J80Z 3KEQA 3L00A 3R60A 4MGRA 1SFEA 2JPBA 3CUQB 1R58A 1Z7UA 4G7ZF 4I7HA 4QWQA 1T0FA 3KP5A 1TW2A 3FWEA 4DNCA 3TGNA 4ZYGA 2V9VA 4I98B 5K5RA 1J5YA 1USTA 2XASA 2A3SA 2ZCWA 2ZNYA 3N4MA 3LA7A 1LJ9A 3SHFA 4XRFA 5J6XA 3LAPA 2JTVA 3EYYA 5ILSA 3P7NA 1YG2A 1NHAA 2PLYA 5DD4A 2J5PA 4HX4A 3HRSA 5HDGA 1EH7A 4HDUA 1IRFA 1ZRCA 1XSVA 3ZN1A 1BI3A 1XCBA 1ZLKA 2V1UA 2CYYA 3F8NA 4OOIA 5HLGA 3B73A 4R79A 1OYYA 2YR2A 2VONA 4EGYA 3FX3A 3Q9VA 4WF2A 5ICGA 1UCRA 4XSXF 3D0SA 1FZPB 2NAZA 1OKRA 3JAMK 2VBXA 2BGCA 2DK5A 2HKOA 2OA4A 5F1RA 5ILUA 5D5XB 1H9GA 4R1HA 1XDUA 3CTAA 1HKQA 3I58A 1ZRFA 1R22A 3RI4A 3WTZA 3V7CA 4I01A 1G3TA 2FE3A 2EB7A 3MQ0A 1YS6A 2IA1A 2E7WA 4MQVA 1XGSA 5HLIA 5HOOA 2A07F 4PGGA 1R5HA 4PZJA 1Z91A 4I2OA 4Y13A 3ZMZA 2LSOA 5CYVA 4YG2F 3IL2A 1MGTA 2A6EF 4LB6B 3I0TA 4F7ZA 2OQGA 3WE2A 1LVAA 5D5UB 4HF1A 1FLIA 4ZH4F 1T38A 1BIBA 1R36A 2CW0F 4GXOA 5EEHA 3ULQB 3HRTA 3F8CA 1H0MA 2MC3A 4A6DA 3LQQA 2MLKA 5D5VB 2IT0A 4FHTA 2L54A 4ZZDA 2EV5A 2AXLA 2QUFA 5AIQA 2L4MA 3BZ6A 5FFZA 4LLLA 3TDZC 2CGPA 3U2RA 2MBFA 3ZMTA 2Z9OA 4WXCA 2XAFA 2ADUA 4ZYDA 4P96A 4IJAA 4OINF 3QPHA 1QBJA 1P4AA 1UFMA 2ZFWA 3JSOA 1ZREA 2MLGA 4EMSA 4BNCA 3BROA 1FYLA 3E5XA 1I1SA 3QU3A 4Q47A 4WX9A 1W7PA 5LEKA 2IW5A 2L4AA 1HKSA 3NEUA 4N9HA 4EJOA 3DEUA 4RGRA 3AAFA 5ERIA 5HS9A 3GO5A 2FQ3A 4CGZA 2F2EA 1P4XA 4N0BA 3EQLF 1X3UA 5CVVA 1ONVA 5H20A 4JK1X 1F1ZA 2G7UA 3O3KA 1CF7A 2IJLA 2DI3A 3V8KA 1MZBA 2PJPA 1PDNC 4KMUX 5LBQA 2MA3A 1KA8A 3ELKA 2PMUA 4L9NA 3K1NA 1K79A 2GZWA 3WTTC 1XSXA 2CWEA 4G8XA 4PDKA 1MKMA 1GVJA 4ENKA 2K86A 4KUMA 5AONA 4MEYF 2NS0A 4BQAA 5E8IA 1REPC 3C3WA 1S3JA 2UXXA 2IP2A 1RNLA 5A2QK 5DUIA 1JHHA 2M1BA 3DQVC 1R23A 5E8GA 2X4HA 1BC7C 3MAJA 1U78A 1KYWA 5ED4A 4LD5A 3KP4A 3H3UA 2IVMA 2EA2A 2RC4A 3CO7C 4MTDA 2LF8A 4UHTA 2P8TA 4I0BA 3DPTA 1V4RA 3M7GA 4LFUA 4IRIA 3FMQA 2QVOA 3T8TA 4UUVA 5CVUA 3DF8A 3I4PA 2XROA 1K78B 2O0YA 1W5SA 2PFBA 2KIFA 1IN6A 4M9XA 2EV6A 2BV6A 3GZ6A 4O6JA 4OIPF 2FOKA 3GUDA 4MQ9F 5DCMA 4EV0A 5KK1A 1OPCA 1IZ1A 3H3ZA 4AIJA 4ENMA 1PP7U 3V4GA 3WU1B 4IVNA 2H6BA 2E7XA 3QOPA 3LQRA 1U2WA 3BOQA 3M9AA 1ZRDA 4KFCA 1P2FA 4XLPF 1EH8A 3QP5A 3P9KA 1IRGA 5FLXZ 4IHSA 4EJWA 2P5VA 4EJTA 1G4DA 4MHGA 3CUQC 2XV4S 4HLYA 2QBYA 1DP7P 2P6SA 1IXSB 1CGPA 2QQ9A 1TBXA 5HLHA 5FLXK 3GFIA 5D8LB 2HTSA 3ECHA 2ZJ2A 1MJAA 4U88A 2XRNA 4RGUA 5K5OA 4L9TA 1OYIA 1U3EM 1FBSA 5LGTA 2VE9A 1SFUA 4G7HF 3WG9A 1TNSA 2Z99A 2V1XA 2DBBA 4HV5A 5ICCA 1BIAA 4GYIA 4ZYHA 3CUQA 4EM1A 2PQ8A 2W25A 1G3SA 3V7RA 5E20A 1YQAA 3JTHA 3IKVA 3ML6A 2M87A 2WWYA 4IF4A 3MEXA 3DFGA 4JBAA 5DCFA 4NQWA 2JSCA 2KIMA 4HQEA 2ZXJA 3BJOA 4M73A 3S2WA 3HHGA 3KP7A 2RNJA 4CYDA 1SD6A 2PEXA 1RUNA 1RUOA 3DV8A 4M6YA 1FP1D 2W57A 4BH9A 1HQCA 3K9TA 2RVCA 1ON2A 2DO7A 2Q8KA 5HS8A 5E18F 3I54A 5FD5A 1TQPA 4BHPA 3LFKA 3BWGA 2GIVA 4ASNA 1UHWA 2FNAA 3MCZA 3F22A 4OIRF 4I0AA 1YYVA 4RS8A 1Z9CA 3P9IA 1OMIA 4HF0A 3WTSC 2PMHA 2EWNA 4UXNA 1BI2A 3TOAA 1HW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC A;  4O5V A;  3HRU A;  1KU9 A;  2QQB A;  4EM0 B;  2M5W A;  1E17 A;  1FC3 A;  1ULY A;  3L09 A;  3E5U A;  3F8B A;  4U0W A;  1SMT A;  5BQT A;  1R1U A;  3T1B A;  2AS5 F;  1FBU A;  2GAU A;  1FSH A;  3RIR A;  2PN6 A;  3HUG A;  1ODD A;  4KN4 X;  5JI6 A;  2FBH A;  4B09 A;  5E1Z B;  3K0L A;  3ABU A;  1YIO A;  2DU9 A;  3GWZ A;  4LLG F;  3K69 A;  1U6G A;  3F6V A;  1B6A A;  2W84 A;  2VT3 A;  1IUY A;  4U7B A;  5DYM A;  2K7L A;  4OIQ F;  2KRF A;  4EVI A;  5J8F A;  1KU7 A;  4YFX F;  1BM9 A;  1MJB A;  2NNY A;  4EJV A;  5J8C A;  1Q1H A;  1P6R A;  2K4B A;  2Y48 A;  1VTN C;  3TO9 A;  3HIF A;  2BYV E;  4G6Q A;  2HQN A;  2FSW A;  3JAM Z;  2YX7 A;  3N97 A;  4G7O F;  2H27 A;  2ZNZ A;  4P9F A;  4RB2 C;  3IKT A;  4KA4 A;  2HFH A;  4A5M A;  4Q5S F;  2D2W A;  2K27 A;  1QQI A;  4UVC A;  3QPT A;  2H94 A;  3GEZ A;  1R00 A;  2YU3 A;  3KCC A;  2ZO4 A;  2HS5 A;  1TQM A;  1RI7 A;  1FX7 A;  4LJZ F;  4AIK A;  4A0X A;  2QLZ A;  3OV8 A;  4IPA A;  5JVT A;  3E6C C;  2P5L C;  2MH2 A;  4R8H A;  4RAY A;  5AIP A;  1J0R A;  2EK5 A;  3RJP A;  3C7J A;  1R5G A;  2STW A;  1T6S A;  3EDP A;  3IRR A;  1YW8 A;  4O3M A;  5DUK A;  3F8M A;  1L3L A;  1ON1 A;  3RPQ A;  3M1E A;  1G6N A;  5E17 F;  2HR3 A;  2ESN A;  3TO6 A;  3WTV C;  2Q0O A;  2R7F A;  1K6O A;  2G9W A;  3WTW C;  4S05 A;  2P7V B;  5ICF A;  3W6K B;  4M9Z A;  3RKW A;  5FB2 A;  1B1B A;  1WI9 A;  2FF4 A;  2VT2 A;  3NRV A;  5JHU A;  2XGX A;  3FXU A;  1IW7 F;  3SXY A;  4KMF A;  3KET A;  2FA5 A;  1O3Q A;  2ACJ A;  3QRF F;  4ESJ A;  4P9U A;  2QQA A;  4MTE A;  1O7L A;  5BOX A;  3SQN A;  3OOP A;  2V1D A;  2UZK A;  2EFN A;  3HRM A;  4Q4Z F;  4IXA A;  2VBY A;  2HEO A;  4ESB A;  3ZP5 A;  1HXD A;  2CO5 A;  5KVR A;  1ZGA A;  4KIB A;  3Q5F A;  1DUX C;  4FX4 A;  2ELH A;  5FD6 A;  4HOB A;  1LEB A;  3C18 A;  2DW4 A;  2DT5 A;  1IF1 A;  3KFW X;  3PFI A;  1YTY A;  3G3Z A;  3IRQ A;  3GF2 A;  5CJ9 A;  1J75 A;  5HS7 A;  5CVI A;  4JQF A;  3CDH A;  1MD0 A;  2BE5 F;  2HWV A;  3NQO A;  5DDG A;  1YW9 A;  4M71 A;  1FY7 A;  3V8J A;  1V3F A;  1TNT A;  5D6F A;  3F23 A;  2FEZ A;  3GW2 A;  1MDM A;  3ZMU A;  3WE3 A;  3WTU C;  4G94 A;  2XHK A;  1K78 A;  3GZ5 A;  2BEO A;  1LDD A;  5HDN A;  1Z6T A;  1BBY A;  1XB4 A;  2GA1 A;  2VOP A;  3EUH A;  4YFN F;  3HOS A;  1KQ8 A;  2V6C A;  4EJU A;  2DPD A;  5FO5 A;  1L0O C;  3J81 Z;  5A2Q Z;  1F4K A;  3KLN A;  4HQM A;  1SD5 A;  4XBF A;  4L18 B;  2FU4 A;  1EV7 A;  3ABT A;  4UNO A;  2ISY A;  3J81 K;  2OU2 A;  1J59 A;  5LRS A;  5L3E A;  4LB5 A;  2JRT A;  2XKO A;  4HX7 A;  1XCV A;  2FNP A;  3WU0 A;  3RTR A;  4U0Y A;  2FBI A;  1F5T A;  2EFO A;  1MDM B;  1KQ9 A;  1ZG5 A;  3WTY C;  1O7F A;  2QWW A;  1K7A A;  1SD7 A;  4MEX F;  1XSD A;  1GXQ A;  4IRH A;  4A6E A;  2W24 A;  1P92 A;  3T8R A;  2VOD A;  2KKO A;  3HHH A;  1LNW A;  2HZT A;  2M8E A;  5JFR A;  1HST A;  2DFI A;  2R3S A;  3QP6 A;  1FNN A;  2E1C A;  3EYI A;  1SFX A;  3GX4 X;  2MD5 A;  2Z3Y A;  4LLN A;  3HOT A;  2DTR A;  4Y17 A;  1QZY A;  2K02 A;  1IN4 A;  2ISZ A;  1ZYR F;  1RIO H;  1HW2 A;  4CZZ A;  1YS7 A;  1FBQ A;  4HA8 A;  3V7S A;  1ZAR A;  2CFX A;  2YX4 A;  2IPQ X;  1P4W A;  4P5O A;  3LAJ A;  3R0A A;  1XGN A;  2Y75 A;  1QZZ A;  3BPV A;  2FMY A;  2C6Y A;  3IC7 A;  3L9F A;  1R1T A;  3MZY A;  4HLX A;  4AWX B;  5CVJ A;  4CHU A;  2CQK A;  2GWR A;  3VOE A;  3I64 A;  5D4S A;  1YLF A;  4OIO F;  2CG4 A;  1SAX A;  5FFX A;  4UVB A;  1JHF A;  3RKX A;  2PG4 A;  3KE2 A;  1I6X A;  4WCG A;  1H9T A;  3FXQ A;  2XAH A;  3ROU A;  2RKH A;  4K2E A;  5BS6 A;  4OMY A;  3HSR A;  1BN5 A;  3F21 A;  1S7A A;  2XVC A;  2L01 A;  4M74 A;  2PBI A;  2P6T A;  3SFZ A;  2VC0 A;  2A61 A;  5LGN A;  3TKY A;  3GFL A;  4D0P A;  3GFM A;  2LDU A;  1FWZ A;  1B9N A;  4KYW A;  2TDX A;  2OQR A;  3JTG A;  3H92 A;  1O3S A;  4XSZ F;  1HBX G;  5K1Y A;  2F5C A;  3KZY A;  1ZGJ A;  5LEJ A;  2KJB A;  3FZV A;  2HQR A;  4E70 A;  3R61 A;  1XN7 A;  4M6X A;  3M8F A;  4A0Z A;  2OZ6 A;  3IHU A;  1O3T A;  5L3G A;  5CVR A;  2RGV A;  3R6S A;  5IT9 K;  4HYE A;  4ENN A;  4A5N A;  5D4R A;  1KQ0 A;  3K2Z A;  2W85 A;  3GVA A;  4WXH A;  1MJ9 A;  3BY6 A;  3VOD A;  3DXJ F;  3W6J B;  1QGP A;  5DEQ A;  1R1V A;  3COA C;  2R7D A;  1I27 A;  2DQR A;  3M8E A;  4N9I A;  4I09 A;  1C0W A;  4PCQ A;  3ZMS A;  2B0L A;  4LK1 F;  4HX8 A;  3RKY A;  2HGC A;  1S6L A;  1T98 A;  1U5T B;  1KGS A;  2PI0 A;  1J7K A;  5L3C A;  3WGG A;  3HSF A;  1KU3 A;  2D1H A;  2Y0M A;  3IWF A;  3ECO A;  2EFQ A;  4WXD A;  2VN2 A;  4LG0 B;  5L3F A;  1W5T A;  3KP3 A;  1WQ2 A;  4EQQ A;  2D45 A;  2BBY A;  3J80 K;  1XD7 A;  5DD8 A;  2OZU A;  2YPR A;  1LB2 A;  2D1V A;  5H6Q A;  3KLO A;  1QNT A;  3SZP A;  4MNU A;  1Z1D A;  1RZ4 A;  1YFH A;  1FOK A;  1T2K A;  1DPR A;  3G73 A;  4GCV A;  2ETH A;  5H6R A;  5LRR A;  1IN5 A;  5D8K B;  4KN7 X;  2LNB A;  2M30 A;  1TTY A;  1BJA A;  2VBW A;  5F6F A;  3T0Y A;  1JGS A;  1JXS A;  4U0V A;  1J2X A;  5LHH A;  3ZMV A;  1QPM A;  2L02 A;  5BMZ A;  3R4K A;  3FM5 A;  2Z5U A;  4HBL A;  3E97 A;  1FSE A;  1OYW A;  1YW7 A;  4ZZL A;  4AD9 A;  3BJ6 A;  3ZPL A;  3RDI A;  5LHG A;  4KDP A;  5E1W A;  3IWZ A;  2A69 F;  5EEG A;  2OD5 A;  3WGI A;  2DAO A;  2F5D A;  1HKT A;  3FXR A;  1ZG3 A;  2VBZ A;  2QEN A;  1WRJ A;  2NRA C;  1PP8 F;  4RB1 A;  5D5W B;  3L2C A;  1BOA A;  2XAG A;  3HSE A;  1PUE E;  1ZN2 A;  3LA2 A;  1FP2 A;  3GXO A;  5JR3 A;  2CSO A;  2OBP A;  1O3R A;  1Y0U A;  1LEA A;  3JSP A;  2QM3 A;  2XUB A;  4U7D A;  5HVQ C;  3FF5 A;  3DPL C;  4FX0 A;  4BXU A;  2EFW A;  1BI0 A;  2O8X A;  2ZME A;  3ISP A;  1B9M A;  2O61 A;  4QLC U;  2DPU A;  5ICE A;  2A68 F;  1S7O A;  4BHB A;  3J7A O;  3LWF A;  1USS A;  4ON0 A;  2P7C B;  3F6O A;  1GHC A;  3RPU A;  1ZAO A;  3VB2 A;  3T5X A;  2GXG A;  4L5I A;  1J9I A;  5L3B A;  5ILV A;  2VE8 A;  1FYM A;  5D6E A;  2VC1 A;  2L3D A;  1D5V A;  1ZLJ A;  2WV0 A;  5FGM A;  4GYG A;  2DK8 A;  3WTX C;  4A0Y A;  2P5K A;  2EV0 A;  2IA2 A;  1FYK A;  4FT8 A;  2X0L A;  3I71 A;  4YFK F;  4BHC A;  5BPI A;  2DQL A;  2H6C A;  4XLN F;  2P4W A;  1XGM A;  2HYF A;  3ZMD A;  4B8X A;  3F3X A;  5TJJ A;  4RGX A;  1IXR C;  4A2U A;  3KP6 A;  2YSR A;  3LA3 A;  3MFK A;  2XAJ A;  3CLO A;  3DP7 A;  4HV6 A;  2GA2 A;  4YII A;  3TO7 A;  3CJN A;  1UB9 A;  1S29 A;  1S8N A;  1D8K A;  2ZME B;  3U1D A;  1E2X A;  4Y15 A;  1IXC A;  1SD4 A;  4G6D A;  3KZZ A;  3CUO A;  4L0Z B;  5IT3 A;  2LF7 A;  2V79 A;  1SMY F;  4HZF A;  3FHZ A;  2O6G E;  4HF2 A;  2KJC A;  1FPQ A;  3KEO A;  6PAX A;  3E3V A;  3TQN A;  1BI1 A;  2STT A;  3BJA A;  4L9V A;  1ZHF A;  4EGZ A;  2VOO A;  5L3D A;  5TRD A;  4LK0 F;  3QAH A;  5F64 A;  4DQ2 A;  2O03 A;  4UVA A;  2UWM A;  2JT1 A;  4KIF A;  2ZBK A;  3VEP A;  4M72 A;  3FM3 A;  1G3Y A;  4NB5 A;  2FRH A;  1YO5 C;  4RB0 A;  4L5J A;  4M9S A;  3ZQ7 A;  1O57 A;  3JW4 A;  1UHM A;  3KP2 A;  3O2P E;  4EM2 A;  1B59 A;  3P9C A;  4Z2Y A;  3REO A;  2J5O A;  4PGH A;  3E6M A;  1DPU A;  3V8L A;  4HW0 A;  3K1M A;  1D8J A;  2K4J A;  1W7P D;  4UV8 A;  4H0E A;  2EFP A;  3E6D A;  2E1N A;  2JZY A;  1W4M A;  3ERE D;  1OR7 A;  2DLL A;  2NNN A;  3B02 A;  1LQ1 A;  3GLX A;  3RYP A;  2O3F A;  1W7P B;  2RN7 A;  4LGW A;  2XIG A;  2QYO A;  2RQP A;  1Z6R A;  3VFZ A;  3FMS A;  2MH9 A;  3LST A;  3BPX A;  2M45 A;  4HAM A;  2HDC A;  2ZKZ A;  4KIC A;  3U9G A;  1LDK B;  2NYX A;  3E5Q A;  3MZH A;  3RYR A;  1TLH B;  2HOE A;  3MWM A;  1CF7 B;  4KIG A;  1HSJ A;  5LLQ A;  1KYZ A;  1WSU A;  2COM A;  4BYY A;  4G9Y A;  1WKM A;  1ZH5 A;  1GXP A;  3E6B A;  4BAY A;  1XMA A;  1T39 A;  1QO0 D;  4I02 A;  4CXF A;  4WWC A;  5LHI A;  2GXB A;  2UXN A;  1TW3 A;  1U8R A;  1B4A A;  1HW1 A;  2EJR A;  1XGO A;  1F9N A;  2GQQ A;  1IN8 A;  5BPD A;  3PQK A;  4RGS A;  2A6H F;  3DKW A;  1EH6 A;  3I59 A;  3O6B B;  1JE8 A;  4HDV A;  3BDD A;  3GYH X;  1U5T C;  3K1P A;  2G7H A;  4ENJ A;  2KIU A;  4TV7 A;  4AVP A;  3ZN0 A;  1STZ A;  1G3W A;  4L9J A;  3PQJ A;  3BP8 A;  1ZG1 A;  1XMK A;  1KU2 A;  2QZ8 A;  4GO1 A;  1XDS A;  4OMZ A;  2VXZ A;  1IAW A;  3Q9S A;  4ESF A;  5DV5 A;  2XAQ A;  4P55 A;  1AOY A;  2F5F A;  2F5E A;  4RAZ A;  4L0Y B;  1TQI A;  2H09 A;  3HYI A;  1U5T A;  3HTU A;  4CO8 A;  3QU6 A;  3I5U A;  4YIF A;  2OAZ A;  2ESH A;  5DCM B;  3L7W A;  1IN7 A;  4LG0 A;  1A04 A;  4WK8 F;  2WC2 A;  3I53 A;  4CIC A;  2XKP A;  2FXA A;  1WWX A;  3WOD F;  4S04 A;  4LMY A;  5IT9 Z;  4IHT A;  2RDP A;  4ZYE A;  1R7J A;  3F72 A;  3HTS B;  3I59 B;  4GGG A;  4KNY A;  2HTJ A;  4OU0 A;  4AIH A;  4RB3 C;  3TDU C;  2Q2E A;  4IRG A;  1DDN A;  3C1D A;  4CDG A;  2JPC A;  5CLS A;  3F8F A;  4UV9 A;  5LGU A;  4A12 A;  1FT9 A;  2A5Y B;  1I1G A;  4ETS A;  4Q48 A;  3FMR A;  1Z05 A;  2QBY B;  5HDK A;  5K5Q A;  1D3Y A;  3D5L A;  1I5Z A;  1LDJ A;  3CO6 C;  2FML A;  2IRF G;  5E1X A;  2IA0 A;  2FBK A;  3GFJ A;  2Z33 A;  2HYG D;  3R0J A;  4KT5 C;  2RV8 A;  3SZT A;  2HKX A;  2LKP A;  3TOB A;  1BC8 C;  3WGH A;  2EA4 A;  3EET A;  4NHJ A;  2WTE A;  3J80 Z;  3KEQ A;  3L00 A;  3R60 A;  4MGR A;  1SFE A;  2JPB A;  3CUQ B;  1R58 A;  1Z7U A;  4G7Z F;  4I7H A;  4QWQ A;  1T0F A;  3KP5 A;  1TW2 A;  3FWE A;  4DNC A;  3TGN A;  4ZYG A;  2V9V A;  4I98 B;  5K5R A;  1J5Y A;  1UST A;  2XAS A;  2A3S A;  2ZCW A;  2ZNY A;  3N4M A;  3LA7 A;  1LJ9 A;  3SHF A;  4XRF A;  5J6X A;  3LAP A;  2JTV A;  3EYY A;  5ILS A;  3P7N A;  1YG2 A;  1NHA A;  2PLY A;  5DD4 A;  2J5P A;  4HX4 A;  3HRS A;  5HDG A;  1EH7 A;  4HDU A;  1IRF A;  1ZRC A;  1XSV A;  3ZN1 A;  1BI3 A;  1XCB A;  1ZLK A;  2V1U A;  2CYY A;  3F8N A;  4OOI A;  5HLG A;  3B73 A;  4R79 A;  1OYY A;  2YR2 A;  2VON A;  4EGY A;  3FX3 A;  3Q9V A;  4WF2 A;  5ICG A;  1UCR A;  4XSX F;  3D0S A;  1FZP B;  2NAZ A;  1OKR A;  3JAM K;  2VBX A;  2BGC A;  2DK5 A;  2HKO A;  2OA4 A;  5F1R A;  5ILU A;  5D5X B;  1H9G A;  4R1H A;  1XDU A;  3CTA A;  1HKQ A;  3I58 A;  1ZRF A;  1R22 A;  3RI4 A;  3WTZ A;  3V7C A;  4I01 A;  1G3T A;  2FE3 A;  2EB7 A;  3MQ0 A;  1YS6 A;  2IA1 A;  2E7W A;  4MQV A;  1XGS A;  5HLI A;  5HOO A;  2A07 F;  4PGG A;  1R5H A;  4PZJ A;  1Z91 A;  4I2O A;  4Y13 A;  3ZMZ A;  2LSO A;  5CYV A;  4YG2 F;  3IL2 A;  1MGT A;  2A6E F;  4LB6 B;  3I0T A;  4F7Z A;  2OQG A;  3WE2 A;  1LVA A;  5D5U B;  4HF1 A;  1FLI A;  4ZH4 F;  1T38 A;  1BIB A;  1R36 A;  2CW0 F;  4GXO A;  5EEH A;  3ULQ B;  3HRT A;  3F8C A;  1H0M A;  2MC3 A;  4A6D A;  3LQQ A;  2MLK A;  5D5V B;  2IT0 A;  4FHT A;  2L54 A;  4ZZD A;  2EV5 A;  2AXL A;  2QUF A;  5AIQ A;  2L4M A;  3BZ6 A;  5FFZ A;  4LLL A;  3TDZ C;  2CGP A;  3U2R A;  2MBF A;  3ZMT A;  2Z9O A;  4WXC A;  2XAF A;  2ADU A;  4ZYD A;  4P96 A;  4IJA A;  4OIN F;  3QPH A;  1QBJ A;  1P4A A;  1UFM A;  2ZFW A;  3JSO A;  1ZRE A;  2MLG A;  4EMS A;  4BNC A;  3BRO A;  1FYL A;  3E5X A;  1I1S A;  3QU3 A;  4Q47 A;  4WX9 A;  1W7P A;  5LEK A;  2IW5 A;  2L4A A;  1HKS A;  3NEU A;  4N9H A;  4EJO A;  3DEU A;  4RGR A;  3AAF A;  5ERI A;  5HS9 A;  3GO5 A;  2FQ3 A;  4CGZ A;  2F2E A;  1P4X A;  4N0B A;  3EQL F;  1X3U A;  5CVV A;  1ONV A;  5H20 A;  4JK1 X;  1F1Z A;  2G7U A;  3O3K A;  1CF7 A;  2IJL A;  2DI3 A;  3V8K A;  1MZB A;  2PJP A;  1PDN C;  4KMU X;  5LBQ A;  2MA3 A;  1KA8 A;  3ELK A;  2PMU A;  4L9N A;  3K1N A;  1K79 A;  2GZW A;  3WTT C;  1XSX A;  2CWE A;  4G8X A;  4PDK A;  1MKM A;  1GVJ A;  4ENK A;  2K86 A;  4KUM A;  5AON A;  4MEY F;  2NS0 A;  4BQA A;  5E8I A;  1REP C;  3C3W A;  1S3J A;  2UXX A;  2IP2 A;  1RNL A;  5A2Q K;  5DUI A;  1JHH A;  2M1B A;  3DQV C;  1R23 A;  5E8G A;  2X4H A;  1BC7 C;  3MAJ A;  1U78 A;  1KYW A;  5ED4 A;  4LD5 A;  3KP4 A;  3H3U A;  2IVM A;  2EA2 A;  2RC4 A;  3CO7 C;  4MTD A;  2LF8 A;  4UHT A;  2P8T A;  4I0B A;  3DPT A;  1V4R A;  3M7G A;  4LFU A;  4IRI A;  3FMQ A;  2QVO A;  3T8T A;  4UUV A;  5CVU A;  3DF8 A;  3I4P A;  2XRO A;  1K78 B;  2O0Y A;  1W5S A;  2PFB A;  2KIF A;  1IN6 A;  4M9X A;  2EV6 A;  2BV6 A;  3GZ6 A;  4O6J A;  4OIP F;  2FOK A;  3GUD A;  4MQ9 F;  5DCM A;  4EV0 A;  5KK1 A;  1OPC A;  1IZ1 A;  3H3Z A;  4AIJ A;  4ENM A;  1PP7 U;  3V4G A;  3WU1 B;  4IVN A;  2H6B A;  2E7X A;  3QOP A;  3LQR A;  1U2W A;  3BOQ A;  3M9A A;  1ZRD A;  4KFC A;  1P2F A;  4XLP F;  1EH8 A;  3QP5 A;  3P9K A;  1IRG A;  5FLX Z;  4IHS A;  4EJW A;  2P5V A;  4EJT A;  1G4D A;  4MHG A;  3CUQ C;  2XV4 S;  4HLY A;  2QBY A;  1DP7 P;  2P6S A;  1IXS B;  1CGP A;  2QQ9 A;  1TBX A;  5HLH A;  5FLX K;  3GFI A;  5D8L B;  2HTS A;  3ECH A;  2ZJ2 A;  1MJA A;  4U88 A;  2XRN A;  4RGU A;  5K5O A;  4L9T A;  1OYI A;  1U3E M;  1FBS A;  5LGT A;  2VE9 A;  1SFU A;  4G7H F;  3WG9 A;  1TNS A;  2Z99 A;  2V1X A;  2DBB A;  4HV5 A;  5ICC A;  1BIA A;  4GYI A;  4ZYH A;  3CUQ A;  4EM1 A;  2PQ8 A;  2W25 A;  1G3S A;  3V7R A;  5E20 A;  1YQA A;  3JTH A;  3IKV A;  3ML6 A;  2M87 A;  2WWY A;  4IF4 A;  3MEX A;  3DFG A;  4JBA A;  5DCF A;  4NQW A;  2JSC A;  2KIM A;  4HQE A;  2ZXJ A;  3BJO A;  4M73 A;  3S2W A;  3HHG A;  3KP7 A;  2RNJ A;  4CYD A;  1SD6 A;  2PEX A;  1RUN A;  1RUO A;  3DV8 A;  4M6Y A;  1FP1 D;  2W57 A;  4BH9 A;  1HQC A;  3K9T A;  2RVC A;  1ON2 A;  2DO7 A;  2Q8K A;  5HS8 A;  5E18 F;  3I54 A;  5FD5 A;  1TQP A;  4BHP A;  3LFK A;  3BWG A;  2GIV A;  4ASN A;  1UHW A;  2FNA A;  3MCZ A;  3F22 A;  4OIR F;  4I0A A;  1YYV A;  4RS8 A;  1Z9C A;  3P9I A;  1OMI A;  4HF0 A;  3WTS C;  2PMH A;  2EWN A;  4UXN A;  1BI2 A;  3TOA A;  1HW5 A; 
#chains in the Genus database with same CATH topology
 1AWC A;  2IBD A;  5B1A H;  3NAU A;  3HRU A;  4O5V A;  3AG2 H;  1KU9 A;  2QQB A;  4EM0 B;  1N25 A;  2CH0 A;  3GTK J;  2M5W A;  1E17 A;  1FC3 A;  1ULY A;  1Z3Y A;  3L09 A;  5J1Y A;  3LSP A;  3E5U A;  2B63 J;  3F8B A;  2O7O A;  4XLC A;  2NVX J;  4U0W A;  1SMT A;  1OJL A;  1Z77 A;  5BQT A;  1R1U A;  3T1B A;  2F6C A;  1P7I A;  2M7A A;  2AS5 F;  1FBU A;  1D0Y A;  4PK4 A;  2GAU A;  1FSH A;  4PJM A;  3RIR A;  2PN6 A;  3L2V A;  3MKZ A;  4BUP A;  4CCJ A;  4JP0 A;  5HNF A;  3DLL F;  3HUG A;  1ODD A;  3BG6 A;  4FE4 A;  1VQ9 I;  1E3H A;  2EIM H;  4KN4 X;  5JI6 A;  2FBH A;  2FQ4 A;  4B09 A;  5E1Z B;  3K0L A;  3ABU A;  3HZJ A;  1YIO A;  2DU9 A;  3GWZ A;  4NBQ A;  2QKL B;  4LLG F;  3K69 A;  2FJ1 A;  1U6G A;  3F6V A;  4ZC3 A;  1B6A A;  2W84 A;  2VT3 A;  2P0W A;  3BT9 A;  1IUY A;  4U7B A;  3A2K A;  4FET A;  5DYM A;  2W00 A;  4XRM A;  5FJ8 J;  2DOF A;  2K7L A;  2M4G A;  4OIQ F;  3V42 A;  2KRF A;  4EVI A;  1TZL A;  2LK2 A;  2X1E A;  2CUE A;  2K9M A;  5J8F A;  2JUC A;  1KU7 A;  2JA6 J;  4YFX F;  1BM9 A;  1MJB A;  2GBY A;  2KQR A;  4EJV A;  5GAE J;  2NNY A;  1SFO J;  5J8C A;  2M34 A;  1Q1H A;  3SDG A;  3O8H A;  1I6H J;  1P6R A;  1SVO A;  2K4B A;  2Y48 A;  3K70 D;  1VTN C;  3S3N A;  3K4K A;  3TO9 A;  2H8R A;  3HIF A;  3DLA A;  2BYV E;  4G6Q A;  2DJN A;  4UY8 I;  2HDD A;  2HQN A;  2CUF A;  2FSW A;  3JAM Z;  2YX7 A;  4DGW B;  3N97 A;  3I3L A;  2QEX I;  2OC6 A;  4G7O F;  2H27 A;  2ZNZ A;  4P9F A;  4CCK A;  4RB2 C;  5HLT A;  3IKT A;  4KA4 A;  3BTJ A;  1BJZ A;  2HFH A;  4A5M A;  2DMU A;  4Q5S F;  2JVG A;  2D2W A;  2K27 A;  2YU9 J;  1QQI A;  4UVC A;  3OYG A;  3QPT A;  2H94 A;  3GEZ A;  3MKL A;  4A3B J;  1R00 A;  5IP9 J;  2JA2 A;  2LY1 A;  2YU3 A;  5FKK A;  3KCC A;  1T33 A;  2HS5 A;  2ZO4 A;  4KIS A;  3GZN B;  1TQM A;  1PUF B;  1RI7 A;  1NH3 A;  1FX7 A;  4LJZ F;  1OCC H;  4AIK A;  4A0X A;  1YI2 I;  2QLZ A;  1BL0 A;  1D1B A;  3OV8 A;  4IPA A;  5JVT A;  3DBR B;  2OV7 A;  3E6C C;  2P5L C;  2EIL H;  2CFO A;  2MH2 A;  4R8H A;  4RAY A;  2DOD A;  3HGY A;  5AIP A;  2E36 A;  1J0R A;  2EK5 A;  5GP9 A;  2OTJ I;  4XN3 A;  1RR7 A;  3RJP A;  1MSF C;  1R49 A;  3C7J A;  2KHM A;  1R5G A;  2STW A;  1JJ8 C;  1F43 A;  1T6S A;  3EDP A;  3IRR A;  2XSD C;  4A3F J;  1YW8 A;  2K9L A;  4O3M A;  5DUK A;  4IOC F;  3F8M A;  4HNU A;  1L3L A;  1ON1 A;  2LH9 A;  3OR2 C;  3ZGK A;  2ICW G;  2IXS A;  2VPR A;  1BR1 A;  2XGE A;  3K7A J;  5GAG J;  2Y0S A;  3RPQ A;  3W6V A;  3M1E A;  2RQQ A;  2Z1D A;  4I99 C;  1G6N A;  2L7K A;  4G12 A;  5E17 F;  4B48 A;  2HR3 A;  2X1D A;  2ESN A;  3TO6 A;  3WTV C;  2OPT A;  1JTY A;  2Q0O A;  2R7F A;  1K6O A;  2G9W A;  2MG4 A;  3WTW C;  4S05 A;  4D7N A;  2JN6 A;  2P7V B;  5ICF A;  3JR9 A;  1UG0 A;  1GVD A;  2R7U A;  3W6K B;  4M9Z A;  1ETK A;  3RKW A;  5FB2 A;  4V2G A;  1B1B A;  3BTC A;  4Z6Y A;  1WI9 A;  2FF4 A;  2VT2 A;  5DM7 F;  1JUM A;  3NRV A;  2AQF A;  2XF6 A;  5JHU A;  2XGX A;  2XPV A;  3FXU A;  5J4Y A;  1P9Q C;  2X6O A;  1QZE A;  2ZSH B;  2R7Z J;  1IW7 F;  2XRL A;  1VF9 A;  3SXY A;  3CCR I;  4KMF A;  3RQI A;  3KET A;  2FA5 A;  1O3Q A;  4YEJ A;  3JRE A;  3SEQ A;  1FOX A;  2VB6 A;  2ACJ A;  3QRF F;  3LSJ A;  4ESJ A;  3K4B A;  4P9U A;  3G1O A;  2QQA A;  3H0G J;  4RAF A;  1O7L A;  4MTE A;  3L1P A;  5BOX A;  3SQN A;  3M4O J;  2R7T A;  2QKM B;  3HG9 A;  1RC9 A;  3A02 A;  1WPK A;  2TCT A;  3OOP A;  1FIA A;  1IV6 A;  2V1D A;  2UZK A;  3BR6 A;  2EFN A;  2JA5 J;  2LY2 A;  1K6Y A;  3HRM A;  4Q4Z F;  1HDP A;  1IRX A;  3A4C A;  4IXA A;  2VBY A;  2HEO A;  4ESB A;  2XPW A;  3CC2 I;  3ZP5 A;  2LG4 A;  1HXD A;  3D5S C;  1VQK I;  1E3O C;  2CO5 A;  5KAI C;  4PJN A;  4CYC B;  1UJ8 A;  2VXD A;  5KVR A;  1ZGA A;  4KIB A;  4J01 A;  3Q5F A;  1DUX C;  4BXX J;  4FX4 A;  2ELH A;  5FD6 A;  2XB0 X;  4HOB A;  3PO3 J;  2M0M A;  1UAA A;  1LEB A;  3VWB A;  3C18 A;  2MGQ A;  2DW4 A;  2DT5 A;  1IF1 A;  1WJA A;  1HF0 A;  1ERD A;  2JVH A;  3OMY A;  3E1S A;  3U21 A;  2DCE A;  2EPF A;  2AHQ A;  5F0C A;  3KFW X;  5FKM A;  3ZQH A;  3PFI A;  1YTY A;  3G3Z A;  3IRQ A;  5FRO A;  3GF2 A;  5CJ9 A;  1J75 A;  1FEX A;  5HS7 A;  3RPU D;  3PUF A;  4AUX A;  2HXO A;  4JQF A;  5CVI A;  2ZJQ F;  3CDH A;  1MD0 A;  2IS4 A;  2BE5 F;  2HWV A;  1G59 A;  3S3O A;  3IP4 B;  1MBE A;  3NQO A;  2XPU A;  3EUH C;  1ACI A;  4CUG A;  5DDG A;  2W1O A;  4HNT A;  4BE2 A;  2BW3 A;  1YW9 A;  2LR8 A;  2W7N A;  1VZ0 A;  4M71 A;  1FY7 A;  1SAU A;  2IEK A;  3V8J A;  3CMY A;  1V3F A;  2DDB A;  4BL0 B;  1RET A;  3LMM A;  2BXZ A;  1TNT A;  5D6F A;  5FLM J;  3F23 A;  2WY7 Q;  2FEZ A;  3GW2 A;  1MDM A;  4A3K J;  3ZMU A;  3WE3 A;  3OYB A;  1X3Z B;  4YRV A;  3GTJ J;  2I5U A;  3WTU C;  3QYE A;  4G94 A;  4Y4R A;  2XHK A;  1XS9 A;  1MMN A;  1MNE A;  2QSH X;  3S1R J;  2CQQ A;  1K78 A;  3GZ5 A;  2VJ5 A;  2BEO A;  1LDD A;  5C3E J;  2VQL A;  5EJC A;  5HDN A;  1Z6T A;  3ZQI A;  3IV5 A;  3SZG A;  3S8P A;  1BBY A;  2NXN B;  3OYM A;  2R7O A;  3DEW A;  1XB4 A;  2GA1 A;  2IS6 A;  1JKQ C;  3A03 A;  2PX9 A;  2VOP A;  3EUH A;  3EUK L;  4YFN F;  3HOS A;  3L2W A;  1KQ8 A;  3FKI J;  1YJN I;  2KFD A;  2V6C A;  4RDU A;  4EJU A;  1IUF A;  3A1Y A;  3AG4 H;  4ZDP A;  4C30 A;  4BQN A;  1TWA J;  2MYS A;  2DPD A;  5FO5 A;  3CCS I;  2R7X A;  1ZKG A;  3BR0 A;  1L0O C;  4BY1 J;  4XMY A;  3J81 Z;  3BCB A;  4KT6 A;  5A2Q Z;  1LE8 B;  1F4K A;  3KLN A;  2AO9 A;  2KP6 A;  4HQM A;  1SD5 A;  3JRG A;  2KZG A;  3G6E I;  4XBF A;  4A3E J;  4L18 B;  2R7W A;  2E60 A;  1V5G A;  2FU4 A;  2LOO A;  1EV7 A;  3ABT A;  1CQT A;  2ISY A;  4UNO A;  4J19 A;  3J81 K;  2OU2 A;  1J59 A;  5LRS A;  2E2I J;  5L3E A;  4BBR J;  5EG0 A;  1QPI A;  4LB5 A;  2BVL A;  2PMZ A;  2JRT A;  4XL9 A;  2XKO A;  2WAQ A;  4HX7 A;  1XCV A;  2FNP A;  2VQG A;  2KMU A;  5EGO B;  1BW6 A;  3WU0 A;  4QTR A;  2HDW A;  2MD0 A;  5EZH A;  3RTR A;  1IV8 A;  4U0Y A;  3HKZ N;  2R5Z B;  2FBI A;  3S2D J;  1F5T A;  2EFO A;  1MDM B;  1KQ9 A;  1ZG5 A;  3WTY C;  2JMW A;  1O7F A;  3EPZ A;  2QWW A;  4QPO A;  1K7A A;  2M3A A;  1SD7 A;  4MEX F;  1XSD A;  1X19 A;  1GXQ A;  4IL6 C;  1Z0X A;  3FXO A;  4M3D A;  4IRH A;  4A6E A;  2W24 A;  1DP3 A;  1P92 A;  3T8R A;  2VOD A;  3OIP A;  2KKO A;  3G1M A;  3HHH A;  1T08 B;  1LNW A;  2HZT A;  4ZTF A;  1GV5 A;  3Q0V A;  2M8E A;  1MMD A;  4HNV A;  4ITV A;  1X1C A;  3KYC B;  5JFR A;  1HST A;  1X58 A;  2DFI A;  2R3S A;  4F93 B;  3QP6 A;  1FNN A;  3TW6 A;  2E1C A;  3EYI A;  1SFX A;  3GX4 X;  1MBK A;  2MD5 A;  3CD6 I;  2Z3Y A;  4XKB A;  4A3C J;  2E1O A;  4NUB A;  1Z3X A;  3OWT A;  4XOP A;  4LLN A;  1D1A A;  3HOT A;  1XX5 A;  2DTR A;  1A36 A;  4Y17 A;  2ZXW H;  1QZY A;  1U9N A;  2K02 A;  1IN4 A;  2ISZ A;  1ZYR F;  5KAF C;  1RIO H;  2PJR A;  3ERM A;  4CCN A;  2ELJ A;  1HW2 A;  2L5Q A;  1X1P A;  4CZZ A;  1YS7 A;  4XLA A;  1FBQ A;  1K83 J;  2X6Y A;  4HA8 A;  1SAN A;  3V7S A;  1ZAR A;  1DGR M;  5GTI C;  2CFX A;  2F48 A;  2YX4 A;  1POG A;  2IPQ X;  1LPQ A;  4IKF A;  1P4W A;  4E7H A;  4ANJ A;  3CF5 F;  4NC7 A;  4P5O A;  3JRF A;  1X1B A;  2DXI A;  3LAJ A;  3R0A A;  1FMW A;  1ZK8 A;  1XGN A;  4E7I A;  2Y75 A;  1QZZ A;  2JSP A;  3IAM 2;  3BPV A;  2TRT A;  2FMY A;  2C6Y A;  2E5N A;  3IC7 A;  3L9F A;  1W36 C;  1R1T A;  3MZY A;  4HLX A;  4AWX B;  5CVJ A;  4CHU A;  2CQK A;  2JK3 A;  3WHC A;  2GWR A;  3OIO A;  3QPS A;  2VL8 A;  3VOE A;  3I64 A;  5D4S A;  5IY5 H;  2JA7 J;  2MC4 A;  1YLF A;  2V4J C;  3HOW J;  4ZDO A;  4OIO F;  4YIR X;  3DKY A;  3W2V A;  2CG4 A;  1SAX A;  5FFX A;  4UVB A;  1OCT C;  1JHF A;  3RKX A;  2PG4 A;  3KE2 A;  1I6X A;  4F91 B;  1Z67 A;  4WCG A;  1F36 A;  1H9T A;  3B6A A;  3FXQ A;  2XAH A;  3ROU A;  1TWH J;  3N05 A;  1VFC A;  1NK2 P;  2RKH A;  1A35 A;  2EQR A;  3ABM H;  1A6I A;  4K2E A;  1G8X A;  5BS6 A;  4OMY A;  3HSR A;  1BN5 A;  3F21 A;  4PFO A;  4EAT A;  2XGC A;  1S7A A;  2WAF A;  2XVC A;  3BTI A;  2L01 A;  4M74 A;  2PBI A;  4AID A;  2P6T A;  4AU7 A;  3SFZ A;  3CLQ A;  3DCF A;  2VC0 A;  4XN0 A;  1FMV A;  3ASO H;  2A61 A;  3LSH A;  5LGN A;  4BU2 A;  3TKY A;  2E2J J;  3GFL A;  2X6W A;  4IQ4 A;  4D0P A;  3GFM A;  2LYC A;  4PJJ A;  4BE0 A;  1H89 C;  2LDU A;  1FWZ A;  3TL4 X;  1B9N A;  5J47 A;  4KYW A;  3OYC A;  2TDX A;  1UEL B;  2OQR A;  3ABL H;  4HEA 2;  1R4M B;  3JTG A;  3G2B A;  3PO2 J;  3H92 A;  1D0Z A;  5M3M J;  1W5C C;  1O3S A;  3DTE A;  4XSZ F;  1HBX G;  3QOE A;  3S17 J;  5KHD A;  5K1Y A;  2F5C A;  1AA7 A;  3KZY A;  1YRN B;  2BY3 A;  3OR1 C;  3CC4 I;  1ZGJ A;  5LEJ A;  3AL0 B;  2KJB A;  2KZV A;  2DA7 A;  3FZV A;  1B72 B;  3K70 C;  3GTP J;  2FX0 A;  2HQR A;  4E70 A;  4PSX A;  4UUS B;  3R61 A;  1XN7 A;  2R93 J;  5FKN A;  4U87 A;  4M6X A;  3M8F A;  2R7V A;  4BKX A;  4A0Z A;  1WJF A;  2OZ6 A;  3IHU A;  1O3T A;  5L3G A;  1TWG J;  5CVR A;  2RGV A;  1MNM C;  3R6S A;  2GOX B;  3BR1 A;  2VIX A;  5IT9 K;  1ZQ3 P;  3GME A;  5F0H A;  3OYA A;  4HYE A;  4ENN A;  9ANT A;  4A5N A;  5D4R A;  3JRC A;  1KQ0 A;  2KRH A;  3K2Z A;  2W85 A;  2JWT A;  3SYT A;  4S0H B;  4ABZ A;  5CKT A;  4AC0 A;  3GTM J;  3GVA A;  1AHD P;  2K9Q A;  4WXH A;  3RZO J;  1MJ9 A;  3S1M J;  1ENH A;  3BY6 A;  3VOD A;  3DXJ F;  1W1W E;  3W6J B;  1QGP A;  2CMP A;  5DEQ A;  4B43 A;  2Y31 A;  3JRD A;  5E3O A;  1JKP C;  2R7R A;  4CH7 A;  1R1V A;  3COA C;  2R7D A;  1I27 A;  2DQR A;  2ZC2 A;  1ETV A;  4XNF A;  3F0C A;  4CCL A;  3M8E A;  3OYL A;  4N9I A;  4I09 A;  1C0W A;  4PCQ A;  3A01 B;  4II3 A;  3DPU A;  3ZMS A;  2B0L A;  2QA4 I;  4LK1 F;  3J7Z I;  4HX8 A;  3RKY A;  1PUF A;  1VQ4 I;  5E3N A;  2HGC A;  1Y6I A;  1S6L A;  1T98 A;  1U5T B;  5GAD J;  1KGS A;  2PI0 A;  1WGX A;  1W0T A;  2L9N A;  4DBQ A;  1K4T A;  1J7K A;  5L3C A;  3WGG A;  3HSF A;  1KU3 A;  2D1H A;  4FIS A;  2Y0M A;  3IWF A;  3ECO A;  2EFQ A;  4WXD A;  2VN2 A;  4LG0 B;  4E7Z A;  5L3F A;  1T95 A;  5E3M A;  1PVE A;  1W5T A;  1WJE A;  3KP3 A;  5B3S H;  1WQ2 A;  4EQQ A;  3HL2 A;  2CUZ A;  1WJC A;  2BBY A;  2D45 A;  3AFH A;  2AQE A;  3J80 K;  1XD7 A;  5DD8 A;  4M3E A;  3HM5 A;  4AM3 A;  2OZU A;  3KYD B;  2MW8 A;  2ZJR F;  4I6Z A;  4JX6 A;  4A3D J;  2YPR A;  4DW6 A;  1LB2 A;  2HPI A;  4LIV A;  2D1V A;  5JLW A;  5H6Q A;  3KLO A;  1QNT A;  4FAS D;  3SZP A;  1MBF A;  5IP7 J;  2Q2E B;  4MNU A;  5C4J J;  1Z1D A;  5FRN A;  1RZ4 A;  2L2O A;  1YFH A;  1FOY A;  1OFC X;  1FOK A;  1T2K A;  3QYB A;  1ETQ A;  1DPR A;  4UB6 C;  3P5J A;  3G73 A;  1Z7L A;  2CS3 A;  4GCV A;  2LFB A;  2ETH A;  5H6R A;  2KDO A;  5LRR A;  1IN5 A;  5D8K B;  3LOC A;  4RM3 A;  5K7Z A;  4KN7 X;  3PNV A;  1FTZ A;  3TED A;  2LNB A;  2M30 A;  2R7Q A;  4BY7 J;  4E6K G;  4B3A A;  2L7F P;  1TTY A;  3HPH A;  4IEJ A;  4B1R A;  1BJA A;  4IQJ A;  2VBW A;  5F6F A;  3T0Y A;  1NTC A;  3K4M A;  3FXM A;  3IUO A;  1JGS A;  1JXS A;  4U0V A;  1J2X A;  5LHH A;  3C2B A;  3ZMV A;  1QPM A;  2NVY J;  2L02 A;  5BMZ A;  3I55 I;  4X0G A;  3R4K A;  3FM5 A;  3BG5 A;  2Z5U A;  4HBL A;  3E97 A;  3CJR B;  3Q3S A;  4IHW A;  1FSE A;  1OYW A;  3KEY A;  3CP2 A;  1U9O A;  3HEF A;  1YW7 A;  4ZZL A;  1R9T J;  1BW5 A;  4AD9 A;  2L9R A;  3BJ6 A;  5C44 J;  3ZPL A;  2ZME C;  3RDI A;  5LHG A;  4KDP A;  5E1W A;  3IWZ A;  2A69 F;  5EEG A;  3HB9 A;  3K4L A;  2OD5 A;  1KON A;  1XPX A;  2M2E A;  5B66 C;  3WGI A;  2DAO A;  2F5D A;  2FD5 A;  1HKT A;  3FXR A;  1ZG3 A;  2VBZ A;  4XRS A;  2QEN A;  3OYK A;  1JI8 A;  4W1U A;  4C9Y A;  3S3M A;  4XOR A;  1WRJ A;  2NRA C;  3UNG C;  1PP8 F;  4RB1 A;  5D5W B;  3L2C A;  1BOA A;  2XAG A;  3HSE A;  4CYC A;  1PUE E;  1ZN2 A;  3LA2 A;  1FP2 A;  3GXO A;  4XQF A;  4GFB A;  5JR3 A;  2JUG A;  2CSO A;  2K85 A;  2OBP A;  1O3R A;  1N75 A;  1Y0U A;  3QWL A;  1LEA A;  3JSP A;  3KYL A;  2WAE A;  2QM3 A;  2HOT A;  2WBM A;  2VKH A;  2A05 A;  1T8I A;  2CU7 A;  2XUB A;  2Y69 H;  4U7D A;  2HQA A;  4I76 A;  5HVQ C;  2DA2 A;  2X1C A;  2X85 A;  3FF5 A;  3DPL C;  4FX0 A;  1S5L C;  3H0D A;  1MND A;  4BXU A;  3K10 A;  2EFW A;  3CCV I;  1BI0 A;  2OCC H;  2O8X A;  2ZME A;  3ISP A;  1QRY A;  1B9M A;  2O61 A;  2DYS H;  4QLC U;  2H1K A;  3L2U A;  2DPU A;  1UG2 A;  5ICE A;  2A68 F;  1S7O A;  1UZC A;  4BHB A;  1K4S A;  3J7A O;  3FBN B;  3LWF A;  4MFE A;  1TWF J;  1USS A;  2BOL A;  2F4O B;  4ON0 A;  2P7C B;  1MSE C;  2CV1 A;  3TP3 A;  3CCL I;  3F6O A;  3LSI A;  1GHC A;  3RPU A;  1DU0 A;  1RRJ A;  1ZAO A;  3EUA A;  3VB2 A;  3T5X A;  3D1N I;  2ELK A;  2GXG A;  1MH4 A;  4L5I A;  1J9I A;  3ASN H;  2M9H A;  1V55 H;  5L3B A;  4P1W A;  5ILV A;  3DU5 A;  2VE8 A;  3LNQ A;  1FYM A;  1IO2 A;  5D6E A;  2VC1 A;  2L3D A;  5DTD A;  1EF4 A;  2EZH A;  3VYT B;  4ZJZ A;  1ZLJ A;  2WV0 A;  1D5V A;  4C3J J;  2CUJ A;  4DOZ A;  4LOC A;  4JX4 A;  5FGM A;  3J7Y J;  3MMY B;  4GYG A;  2DK8 A;  1DU6 A;  3WG7 H;  3WTX C;  1WH5 A;  3LL7 A;  3JRI A;  1S9H A;  5J1U A;  4A0Y A;  2P5K A;  2RNG A;  1VQO I;  2OCE A;  4BGD A;  2EV0 A;  2IA2 A;  4F3Q A;  1QVT A;  1FYK A;  4FT8 A;  2X0L A;  4HRI A;  3L2Q A;  3I71 A;  1A5J A;  4YFK F;  2B9S A;  4BHC A;  5BPI A;  2DQL A;  2H6C A;  4XLN F;  3KX2 A;  2P4W A;  2K40 A;  3HJE A;  5BNG A;  2WV1 A;  1JKO C;  3QOD A;  1BA5 A;  1XGM A;  2HYF A;  2YUS A;  1LKX A;  1R71 A;  3ZMD A;  4B8X A;  3F3X A;  2DMP A;  2HYJ A;  5TJJ A;  4RGX A;  1IXR C;  2R5Y B;  1LE8 A;  2I10 A;  4A2U A;  3KP6 A;  1GLN A;  2YSR A;  3LA3 A;  1Y0N A;  2XAJ A;  3MFK A;  1SVL A;  2CQX A;  3JRH A;  3CLO A;  3S15 J;  4CZC A;  3DP7 A;  1V54 H;  3FHN A;  4Y33 A;  1ZTR A;  3KZI C;  3DTK A;  5GTH C;  4HV6 A;  2GA2 A;  4YII A;  3TO7 A;  3CJN A;  4QPQ A;  3VPR A;  2L7M P;  1UB9 A;  3S2H J;  1S29 A;  1S8N A;  1D8K A;  3JRB A;  2ZME B;  1O4X A;  3U1D A;  1E2X A;  4Y15 A;  1IXC A;  5LFA A;  2DDA A;  4Y7N J;  1SD4 A;  4G6D A;  3K6G A;  3KZZ A;  3CUO A;  4L0Z B;  2LF7 A;  2V79 A;  5IT3 A;  4E7K A;  5F1J A;  2E35 A;  1S72 I;  1SMY F;  4HZF A;  3FHZ A;  3CZ6 A;  2O6G E;  4HF2 A;  5EGO A;  3S1N J;  1UMQ A;  3WU2 C;  2KJC A;  2E19 A;  1FPQ A;  3KEO A;  6PAX A;  3E3V A;  3TQN A;  1BI1 A;  2R5Z A;  1OCZ H;  2PMZ N;  3IH3 A;  3H5N A;  2STT A;  4DBR A;  3BJA A;  2HVS A;  4L9V A;  1HLV A;  1HDD C;  1ZHF A;  4EGZ A;  2VOO A;  1ETW A;  2Q1Z B;  5L3D A;  3S16 J;  5TRD A;  2HOS A;  4LK0 F;  2EIK H;  3QAH A;  1YX5 A;  5F64 A;  3BCA A;  5IOY A;  2BVM A;  2LKX A;  4A69 C;  1DQU A;  4DQ2 A;  2O03 A;  4UVA A;  2UWM A;  2LTP A;  2JT1 A;  1IDY A;  4KIF A;  1FIP A;  3OYD A;  3VDX A;  2ZBK A;  3VEP A;  1I3A A;  3FM3 A;  4M72 A;  1G3Y A;  4NB5 A;  5LD2 C;  2FRH A;  3ZQF A;  2LD5 A;  1YO5 C;  1OR7 C;  2W82 A;  4RB0 A;  1U8B A;  4L5J A;  3B6C A;  4M9S A;  3ZQ7 A;  4BDY A;  1A6Q A;  1O57 A;  3JW4 A;  4LG3 A;  3GTQ J;  2ZXH A;  1UHM A;  3KP2 A;  3O2P E;  4EM2 A;  3LSK A;  1B59 A;  3P9C A;  4PJL A;  4Z2Y A;  5IYD J;  4C2M J;  3REO A;  4J00 A;  3K4C A;  3MKW B;  2J5O A;  1APL C;  3PFY A;  4PGH A;  3CMA I;  2Z16 A;  3E6M A;  3PSF A;  5JVG F;  1DPU A;  3OS1 A;  3FKJ A;  3V8L A;  4HW0 A;  1HOM A;  4W97 A;  3K1M A;  1P7J A;  1LFB A;  2KRC A;  3VSL A;  3LSR A;  5M5Y J;  1D8J A;  1SEU A;  2K4J A;  5F08 A;  1W7P D;  4UV8 A;  3FDY A;  4H0E A;  2LY9 A;  2EFP A;  5HOD A;  4UB8 C;  3E6D A;  2E1N A;  3DKX A;  4BAC A;  2JZY A;  1W4M A;  2LC2 A;  1VQP I;  1UHS A;  3HC7 A;  3ERE D;  1OR7 A;  2DLL A;  2NNN A;  3IAS 2;  1IDZ A;  3B02 A;  3DWL E;  1LQ1 A;  4ZYA A;  2ZFU A;  3GLX A;  3RYP A;  2O3F A;  1QA6 A;  3ZXS A;  1W7P B;  2RN7 A;  4LGW A;  2WY8 Q;  2XIG A;  4HSR A;  2QYO A;  2RQP A;  4RLQ A;  1J09 A;  1Z6R A;  2B7E A;  4M3F A;  4A3G J;  2DOA A;  3A0H C;  3VFZ A;  3FMS A;  2MH9 A;  3OL3 A;  2XAU A;  2VAS A;  3Q0W A;  3LST A;  1EKE A;  3BPX A;  4LIU A;  2M45 A;  4HAM A;  2HDC A;  2ZKZ A;  4KIC A;  4D7M A;  3U9G A;  1LDK B;  1WI3 A;  2NYX A;  3E5Q A;  4MO7 A;  3CDI A;  3H9Q A;  3MZH A;  3RYR A;  3AL0 C;  1TLH B;  3HOV J;  2HOE A;  3BG9 A;  3MWM A;  1CF7 B;  1E3P A;  3OYH A;  2CJJ A;  4KIG A;  1HSJ A;  2KLO A;  2AXT C;  5LLQ A;  1KYZ A;  1WSU A;  2NS8 A;  2COM A;  4BYY A;  4ZDL A;  4G9Y A;  1WKM A;  5FKL A;  1ZH5 A;  4BQQ A;  1GXP A;  1VND A;  3BTL A;  3E6B A;  4BAY A;  1XMA A;  1T39 A;  2WB1 N;  4E7S A;  4C3I J;  4IX7 A;  1S7E A;  4XID A;  1QO0 D;  4I02 A;  2NVT J;  4CXF A;  4NDL A;  1BOB A;  5GPC A;  4WWC A;  5LHI A;  2GXB A;  2X6X A;  3PUB A;  2UXN A;  2F4M B;  1TW3 A;  3BZK A;  1U8R A;  4IHX A;  4F55 A;  1B4A A;  3DBH B;  1HW1 A;  4E7J A;  4JOM A;  2LP0 A;  1YJ9 I;  3RKQ A;  4B3X A;  2EJR A;  1XGO A;  1AKH B;  1F9N A;  4M3B A;  3OY9 A;  1VQL I;  1YRN A;  4A3L J;  2GQQ A;  3MD2 A;  3J7A Y;  1IN8 A;  2DA5 A;  5BPD A;  3PQK A;  4RGS A;  2A6H F;  1B72 A;  3DKW A;  1OCR H;  4UUS A;  1EH6 A;  3I59 A;  3PSI A;  5HNH A;  1Y8Q B;  3OS2 A;  3ESW B;  3O6B B;  1JE8 A;  3M07 A;  1YIT I;  4HDV A;  4NC8 A;  3PNY A;  2L9S A;  2BZT A;  4X1E A;  3BDD A;  4HPQ A;  3GYH X;  1U5T C;  2BY2 A;  3K1P A;  2G7H A;  4ENJ A;  4XIC A;  1VQ6 I;  5IP6 A;  2KIU A;  4TV7 A;  4AVP A;  2NOJ B;  3ZN0 A;  3H36 A;  4AYB N;  1M1E B;  2QF7 A;  5KNL A;  2VQH A;  2LMD A;  2ID3 A;  2DOE A;  2UUZ A;  1JT0 A;  2FUG 2;  1STZ A;  2LRD A;  1HCR A;  1G3W A;  4L9J A;  3FK6 A;  3PQJ A;  4BEH B;  3VYU B;  3OL4 A;  3FXL A;  3W3C A;  3BP8 A;  1ZG1 A;  1XMK A;  3CMM A;  1KU2 A;  2QZ8 A;  4GO1 A;  3A0B C;  1XDS A;  4OMZ A;  1ETX A;  1BR2 A;  1MBH A;  2VXZ A;  1LFU P;  1VQ8 I;  3E0J B;  2FOW A;  3Q9S A;  5GAH J;  2HU9 A;  1IAW A;  3AG3 H;  4N4N B;  4C2T A;  4ESF A;  3NAR A;  4OAZ A;  5DV5 A;  2XAQ A;  3A01 A;  1YOV B;  4XKW A;  4P55 A;  1AOY A;  1G2H A;  2F5F A;  2R4G A;  2F5E A;  3TMO A;  3BQZ A;  1IG7 A;  4RAZ A;  4L0Y B;  1TQI A;  1JUP A;  2H09 A;  3HYI A;  1U5T A;  4A3I J;  3HTU A;  4CO8 A;  3PIO F;  3QU6 A;  1T56 A;  2Y9Z A;  2DA3 A;  2RAE A;  2LBF B;  2JJ7 A;  3I5U A;  2F4I A;  4YIF A;  2OAZ A;  1V5E A;  2ESH A;  4BJ6 C;  5DCM B;  1MMG A;  3L7W A;  1VQ5 I;  1IN7 A;  4LG0 A;  1A04 A;  4WK8 F;  1A31 A;  2WC2 A;  3I53 A;  4NNJ A;  4CIC A;  2XKP A;  1VI0 A;  3OIQ A;  2FXA A;  1WWX A;  5JHF A;  3WOD F;  4S04 A;  1MMS A;  4LMY A;  3K4N A;  1B8I B;  1X2N A;  2GM4 A;  1IC8 A;  4B44 A;  4IHT A;  5IT9 Z;  2RDP A;  3NWS A;  4M6V A;  1R7J A;  3F72 A;  4ZYE A;  3HTS B;  2M0C A;  3C2G A;  3I59 B;  4GGG A;  2HTJ A;  3OOU A;  4KNY A;  3HOY J;  4OU0 A;  5EEA A;  4AIH A;  4RB3 C;  3TDU C;  2Q2E A;  4IRG A;  1DDN A;  3C1D A;  4CDG A;  2JPC A;  5CLS A;  3F8F A;  1WJ5 A;  3HPG A;  3VYS B;  4UV9 A;  5LGU A;  4A12 A;  1FT9 A;  1JT6 A;  3HOU J;  2A5Y B;  1I1G A;  2DMQ A;  3W2A A;  4IO9 F;  4ETS A;  4Q48 A;  1GDT A;  4D5C A;  3FMR A;  1Z05 A;  2QBY B;  3DU6 A;  5HDK A;  2VJ4 A;  1D3Y A;  2IGN A;  5K5Q A;  3D5L A;  3L2R A;  1I5Z A;  1LDJ A;  4IHV A;  3C2H A;  3CO6 C;  1T0F C;  2FML A;  2IRF G;  5E1X A;  5EF6 A;  4KIT B;  2IA0 A;  2FBK A;  3GFJ A;  3SJM A;  2Z33 A;  3BZC A;  2HYG D;  2I8D A;  4V19 K;  1GV2 A;  3R0J A;  2KDZ A;  2QSF X;  4KT5 C;  2DTZ A;  2E1M B;  2QQ8 A;  2RV8 A;  3SZT A;  3CCJ I;  2HKX A;  2LKP A;  2IGM A;  1H8A C;  3TOB A;  1BC8 C;  3WGH A;  4V2F A;  4XLH A;  2EA4 A;  3EET A;  4NHJ A;  3BLY A;  1YJW I;  3FXJ A;  2ME6 A;  2Z2S B;  4MIM A;  1X1D A;  3FXK A;  2HI3 A;  4XON A;  5FRM A;  2WTE A;  3S32 A;  3LSG A;  4LIT A;  4A3J J;  3J80 Z;  2A6T A;  3KEQ A;  2R92 J;  3L00 A;  5DM6 F;  2WAD A;  2M8G X;  1YIJ I;  3I56 I;  2OTL I;  3UR3 C;  1NG7 A;  3R60 A;  4MGR A;  1SFE A;  2JPB A;  4PSW A;  3CUQ B;  3X2Q H;  4DJA A;  3CCM I;  1R58 A;  1Z7U A;  4G7Z F;  4I7H A;  3O8G A;  4QWQ A;  1T0F A;  2EZL A;  3KP5 A;  1OLT A;  2DYR H;  2XF5 A;  1TW2 A;  3FWE A;  4DNC A;  3TGN A;  1XMX A;  1YX3 A;  3OSF A;  4ZYG A;  2V9V A;  4I98 B;  2ZSI B;  2EBI A;  4XLF A;  1NK3 P;  5K5R A;  1J5Y A;  2BHZ A;  2QGU A;  1UST A;  3MN2 A;  2XAS A;  3CCU I;  1Y1V J;  4RBO A;  2A3S A;  2QSG X;  2ZCW A;  4XK4 A;  4NQW B;  2ZNY A;  3N4M A;  3LA7 A;  1LJ9 A;  2M4K A;  1R4N B;  3SHF A;  4XRF A;  1E0E A;  3OYE A;  1ORK A;  4BS9 A;  5J6X A;  1MW7 A;  2IGO A;  3LAP A;  3FIW A;  2JTV A;  3EYY A;  1I39 A;  5M5X J;  4Y52 J;  5ILS A;  2EH3 A;  2KIQ A;  3P7N A;  1X4P A;  1YG2 A;  2HQ5 A;  1NHA A;  2Y0S N;  2PLY A;  3I4N J;  5DD4 A;  5IOZ A;  2J5P A;  3ZOB A;  2ME0 A;  4HX4 A;  2XC7 A;  3HRS A;  5KCM A;  3CJT B;  5HDG A;  4IZZ A;  1ETY A;  2A5W A;  1EH7 A;  4HDU A;  2E2H J;  1IRF A;  1ZRC A;  1XSV A;  3ZN1 A;  1BI3 A;  1FOW A;  1GT0 C;  1XCB A;  1ZLK A;  2V1U A;  2CYY A;  3F8N A;  1Y1W J;  4OOI A;  5HLG A;  3B73 A;  2K5C A;  4R79 A;  1OYY A;  2YR2 A;  3G4S I;  2VON A;  3PIP F;  1D5Y A;  4RAG A;  5EDN A;  3IH4 A;  4EGY A;  4RA2 A;  4FCY A;  3FX3 A;  3Q9V A;  3KIO A;  4WF2 A;  5ICG A;  3PNT A;  4GRI A;  1UCR A;  1WJD A;  1SFK A;  2GOM A;  4XSX F;  2YS9 A;  1Q1V A;  3ZQG A;  5F04 A;  2V9P A;  3D0S A;  1FZP B;  2ZJP F;  1W0U A;  2NAZ A;  5IYB J;  2MAB A;  1VQM I;  1OKR A;  3JAM K;  2VBX A;  2BGC A;  3RZD J;  3H3V K;  2DK5 A;  3CCY A;  3QQA A;  2HKO A;  2OA4 A;  4XR6 A;  5F1R A;  5ILU A;  3GTG J;  3BC8 A;  3G1L A;  5D5X B;  2GXA A;  4PUS A;  2L7Z A;  1H9G A;  4R1H A;  1XDU A;  2IS1 A;  3CTA A;  1HKQ A;  3I58 A;  2E71 A;  5IPA A;  1ZRF A;  4KJZ A;  2E34 A;  4OAY A;  3S93 A;  1D0X A;  1R22 A;  3RI4 A;  3WTZ A;  4NC6 A;  3CJQ B;  3V7C A;  3I9V 2;  4F92 B;  1JJ6 C;  4I01 A;  3F9K A;  1D1C A;  1G3T A;  3DEE A;  2FE3 A;  1KZH A;  1RKW A;  3HUG B;  3FIS A;  4IHY A;  2MFZ A;  2EB7 A;  4E4H A;  2R5Y A;  2G0E A;  3MQ0 A;  5CQG A;  3DTI A;  2LKS A;  1YS6 A;  2CW7 A;  4XRS G;  2IA1 A;  2E7W A;  4MQV A;  1XGS A;  5HLI A;  5HOO A;  3H5R A;  1LVK A;  4XM3 A;  3VSK A;  2BY1 A;  2KT0 A;  2A07 F;  2QCO A;  4PGG A;  1Y8R B;  4CCM A;  1ITY A;  1R5H A;  4PZJ A;  1Z91 A;  5E3L A;  4I2O A;  2NS7 A;  1QHH D;  3SEZ A;  2KL4 A;  3ZMZ A;  4Y13 A;  2DJI A;  2LSO A;  5CYV A;  4YG2 F;  3IL2 A;  1IRZ A;  1MGT A;  2A6E F;  2HXI A;  4LB6 B;  3I0T A;  4F7Z A;  1EJ9 A;  2OQG A;  5FKO A;  2F5V A;  1LVA A;  3WE2 A;  5D5U B;  4HF1 A;  1FLI A;  2XB5 A;  1V5F A;  2DT7 B;  5J1R A;  4ZH4 F;  2D5V A;  1WVR A;  1T38 A;  2CRG A;  4MFD A;  1BIB A;  4F52 A;  2N8G A;  4JX5 A;  1R36 A;  2CW0 F;  4FTH A;  4GXO A;  5EEH A;  3ULQ B;  3HRT A;  3LSM A;  3F8C A;  1H0M A;  2OJE D;  2MC3 A;  4A6D A;  2UV1 A;  3LQQ A;  2BY0 A;  2HVQ A;  3TW7 A;  2MLK A;  4B4C A;  1H88 C;  4QSH A;  5D5V B;  1TL8 A;  3CES A;  2IT0 A;  4FHT A;  3SDB A;  3MVP A;  3QPL A;  2L54 A;  1JUS A;  1QHG A;  4ZZD A;  2DFH A;  3RSN A;  2EV5 A;  3H5A A;  2NOG A;  3GCM A;  2R7S A;  2AXL A;  2QUF A;  4C3H J;  3H1C A;  1JKR C;  5AIQ A;  2L4M A;  1WJB A;  2ID6 A;  3BZ6 A;  5FFZ A;  2W48 A;  4LLL A;  3TDZ C;  4D5F A;  2VUM J;  2CGP A;  5E79 C;  3U2R A;  1EA3 A;  4B47 A;  2MBF A;  3ZMT A;  2Z9O A;  2VKV A;  2GIZ A;  4WXC A;  2XAF A;  1Z21 A;  2ADU A;  4XKC A;  3ABK H;  4A93 J;  3D5R C;  4ZYD A;  4P96 A;  4IJA A;  3PJR A;  1MBJ A;  2COB A;  3QPH A;  4OIN F;  1ZGW A;  1QBJ A;  4D1Q A;  1P4A A;  2L9V A;  1UFM A;  2ZFW A;  4X6A J;  3JSO A;  5M5W J;  1ZRE A;  2JRM A;  2MLG A;  4EMS A;  4BNC A;  3BRO A;  1VQ7 I;  2VPL A;  4HST A;  4DIQ A;  1FYL A;  3BR2 A;  3HOZ J;  3U1K A;  1RES A;  3HDD A;  4HG2 A;  3E5X A;  2ECB A;  1I1S A;  3QU3 A;  4Q47 A;  2E5Z A;  3BG7 A;  4DYR A;  4WX9 A;  1W7P A;  5LEK A;  1TC3 C;  1RPW A;  2IW5 A;  3GTL J;  4DYQ A;  3CCE I;  2L4A A;  3E7L A;  4BQO A;  2WAQ N;  3RQ4 A;  1LUJ B;  1HKS A;  2IGK A;  3NEU A;  4N9H A;  5J40 A;  3DEU A;  4RGR A;  4EJO A;  4PJ0 C;  5EYR A;  3AAF A;  5ERI A;  5M3F J;  4YEL A;  3ZRG A;  3CF2 A;  3PM1 A;  2NVU B;  2K9N A;  5HS9 A;  3GO5 A;  3DBL B;  1X4O A;  2FQ3 A;  4CGZ A;  2F2E A;  3CC7 I;  2V7F A;  1OCO H;  1P4X A;  4N0B A;  1JTX A;  3EQL F;  1X3U A;  1ZR4 A;  2VJJ A;  5CVV A;  2X51 A;  1ONV A;  2DN0 A;  2CW8 A;  2XSJ C;  3BQY A;  4L5E A;  5H20 A;  4JK1 X;  1F1Z A;  5DS9 A;  1TWC J;  2EIN H;  2DMN A;  2G7U A;  1MH3 A;  3O3K A;  3FK7 A;  1CF7 A;  3BR5 A;  2DT6 A;  4RMN A;  4UUT A;  3ONQ A;  2IJL A;  1WCM J;  1U0J A;  2XGD A;  2Y30 A;  2DI3 A;  2OF7 A;  4C2U A;  3V8K A;  3VYR B;  1MZB A;  2PJP A;  4Y3O A;  4EEF G;  1PDN C;  1TT0 A;  4KMU X;  4BJT A;  4XLE A;  1XC5 A;  5LBQ A;  5IYC J;  1BR4 A;  2MA3 A;  5J4V A;  1KA8 A;  3ELK A;  3K4J A;  1FJL A;  5GPA A;  2PMU A;  4GDF A;  4L9N A;  3K1N A;  2VKE A;  5CQE A;  1K79 A;  2DMT A;  4DYC A;  4XKV A;  3BR3 A;  2V26 A;  2GZW A;  4D9J A;  3ZQC A;  3WTT C;  2DA6 A;  1XSX A;  4DZJ A;  1Y56 A;  2CWE A;  3NWT A;  2H1L A;  4G8X A;  3AKZ A;  4PDK A;  1AKH A;  1MKM A;  3AG1 H;  1GVJ A;  4ENK A;  2HOA A;  2RRE A;  2K86 A;  4KUM A;  5AON A;  4MEY F;  1R6R A;  5TGT A;  4H4K C;  2NS0 A;  5B5E C;  5E8I A;  4BQA A;  2V9K A;  1REP C;  2K9S A;  3C3W A;  2VQC A;  1MBG A;  3GLL A;  3G71 I;  3OYF A;  3S14 J;  3W2W A;  2OUM A;  3OYI A;  1S3J A;  1OCP A;  2UXX A;  2CQ7 A;  2IP2 A;  1RNL A;  5A2Q K;  3M3Y J;  2O5R A;  2KPM A;  5DUI A;  4PFP A;  1JHH A;  2M1B A;  1SVM A;  3DQV C;  5TIS C;  2BW3 B;  4IOA F;  1R23 A;  2R0Q C;  5E8G A;  2X4H A;  1HA8 A;  1BC7 C;  3MAJ A;  1U78 A;  1KYW A;  5ED4 A;  4LD5 A;  3KP4 A;  3H3U A;  2VLA A;  1MMA A;  2JA8 J;  2IVM A;  1TT5 B;  2EA2 A;  2RC4 A;  3ZQL A;  4RLF A;  3WHB A;  2LRE A;  2HZD A;  3CO7 C;  1X1A A;  1WFX A;  3KPH A;  5F27 A;  4MTD A;  2LF8 A;  4UHT A;  4BEH A;  2P8T A;  4I0B A;  3BG3 A;  3DPT A;  2GLO A;  1V4R A;  3M7G A;  4LFU A;  4IRI A;  3FMQ A;  2CV2 A;  2QVO A;  3UKG A;  3M8J A;  5JLX A;  3T8T A;  1WH7 A;  5CVU A;  3DF8 A;  3ZQQ A;  3I4P A;  2XRO A;  4UUV A;  1K78 B;  3OYJ A;  4RM2 A;  3SFI A;  2O0Y A;  4CA0 A;  1W5S A;  2PFB A;  5C4X J;  2KIF A;  3QYF A;  1IN6 A;  4M9X A;  2O9L A;  3S1Q J;  2EV6 A;  2XF7 A;  2BV6 A;  3GZ6 A;  1PYV A;  3H9J A;  4O6J A;  2K3P A;  2VKD A;  2Y9Y A;  3ZCO A;  4CSW A;  3HBL A;  2LBF A;  4CCO A;  4OIP F;  2FOK A;  3GUD A;  4MQ9 F;  5DCM A;  4EV0 A;  1XTA A;  4E7L A;  5KK1 A;  1OPC A;  1IZ1 A;  3H3Z A;  5B1B H;  3LFU A;  1I3Q J;  4AIJ A;  3CDL A;  2ECC A;  3HGG A;  1OQY A;  4FE7 A;  4ENM A;  4BXF A;  2E1M C;  2CQN A;  3OSG A;  1B8I A;  3H9G A;  2VJI A;  1PP7 U;  1QVU A;  3V4G A;  2IAI A;  3WU1 B;  3MKY B;  4IVN A;  2H6B A;  3CP8 A;  2ZXI A;  4XOT A;  2E7X A;  3QOP A;  1IGN A;  1LFP A;  2EZI A;  3LQR A;  1U2W A;  3BOQ A;  3M9A A;  1ZRD A;  1ETO A;  3TP0 A;  4KFC A;  1P2F A;  4XLP F;  1EH8 A;  4AVZ A;  3QP5 A;  5F0F A;  5EG0 B;  1RR8 C;  3P9K A;  3Q0U A;  3HKZ A;  1IRG A;  5FLX Z;  4IHS A;  4EJW A;  2P5V A;  4EJT A;  2M7B A;  1G4D A;  4MHG A;  2DA1 A;  1WHU A;  3CUQ C;  2XV4 S;  3ZR8 X;  4HLY A;  2QBY A;  2X48 A;  2XDV A;  3TBI A;  1QU3 A;  3IH2 A;  1DP7 P;  2P6S A;  1IXS B;  5K7F A;  2KIS A;  5FLV A;  1YHQ I;  1CGP A;  2QQ9 A;  1TBX A;  5HLH A;  1IJW C;  5FLX K;  3CME I;  3GFI A;  5D8L B;  3JCU C;  2HTS A;  3ECH A;  5EZG A;  2ZJ2 A;  3OS0 A;  1WZ2 A;  1MJA A;  2P81 A;  4U88 A;  2XRN A;  2LLK A;  4RGU A;  2X9D A;  2NVQ J;  5K5O A;  4L9T A;  1OYI A;  3RCO A;  1U3E M;  1FBS A;  5K7H A;  2ZB9 A;  5LGT A;  2VE9 A;  1PJR A;  1SFU A;  4FQG A;  4JYK A;  4G7H F;  1SC7 A;  1AU7 A;  1GUU A;  3WG9 A;  1TNS A;  2Z99 A;  1OIS A;  2DFE A;  2V1X A;  2DBB A;  4HV5 A;  4BBS J;  1K61 A;  5ICC A;  1BIA A;  4GYI A;  2WB1 A;  4ZYH A;  3CUQ A;  1VQN I;  4EM1 A;  2PQ8 A;  2W25 A;  1G3S A;  1ZEL A;  4BJ5 C;  2CV0 A;  3I4M J;  2LVS A;  2EIJ H;  1RKT A;  3V7R A;  1R5I D;  5E20 A;  1YQA A;  3JTH A;  2PJR B;  1I50 J;  4M3G A;  2V6E A;  3GBG A;  3IKV A;  2BXY A;  3ML6 A;  2M87 A;  3MZ8 A;  2WWY A;  4IF4 A;  3MEX A;  3DFG A;  4JBA A;  5DCF A;  2O8K A;  1TP4 A;  2BHY A;  3PL8 A;  4NQW A;  4QIW N;  2JSC A;  2KIM A;  2W4S A;  3FBI B;  2ZXJ A;  3BJO A;  4M73 A;  4HQE A;  5J3L A;  3HHG A;  3S2W A;  3KP7 A;  2RNJ A;  2HPM A;  4ZTJ A;  1Y39 A;  3HOX J;  4CYD A;  1X2M A;  3H35 A;  1SD6 A;  2PEX A;  5H2F C;  1RUN A;  1RUO A;  3DV8 A;  4M6Y A;  1FP1 D;  3HXL A;  1N77 A;  2DA4 A;  2W57 A;  4A3M J;  1MIJ A;  4BH9 A;  3CQZ J;  1HQC A;  2K3F A;  2MSY A;  4G6T B;  3K9T A;  3CCQ I;  2RVC A;  1ON2 A;  1HC8 A;  4MLO A;  2DO7 A;  4N4O B;  2HVR A;  3K2A A;  1NG6 A;  3M1C A;  2Q8K A;  5HS8 A;  4II2 A;  2L0K A;  1XG1 A;  2WA0 A;  1N78 A;  2IS2 A;  4AYB A;  5E18 F;  3I54 A;  5FD5 A;  3GTO J;  1TQP A;  4BHP A;  3JRA A;  3LFK A;  3BWG A;  2HNH A;  2GIV A;  4ASN A;  1W36 D;  2DFF A;  1UHW A;  2FNA A;  5CPR B;  3MCZ A;  4BDZ A;  3F22 A;  4OWR B;  4I0A A;  2V1N A;  4OIR F;  1YYV A;  4RS8 A;  1Z9C A;  2Y2Z A;  1ZR2 A;  3P9I A;  3OYN A;  1JGG A;  1OMI A;  4HF0 A;  2JQ7 A;  3WTS C;  1YE9 A;  2H8W A;  2PMH A;  2EWN A;  4UXN A;  1X3W B;  1BI2 A;  1DGW Y;  1FTT A;  4BE1 A;  3TOA A;  2VI6 A;  2EZK A;  1HW5 A;  4DZP A; 
#chains in the Genus database with same CATH homology
 1AWC A;  4O5V A;  3HRU A;  1KU9 A;  2QQB A;  4EM0 B;  2M5W A;  1E17 A;  1FC3 A;  1ULY A;  3L09 A;  3E5U A;  3F8B A;  4U0W A;  1SMT A;  5BQT A;  1R1U A;  3T1B A;  2AS5 F;  1FBU A;  2GAU A;  1FSH A;  3RIR A;  2PN6 A;  3HUG A;  1ODD A;  4KN4 X;  5JI6 A;  2FBH A;  4B09 A;  5E1Z B;  3K0L A;  3ABU A;  1YIO A;  2DU9 A;  3GWZ A;  4LLG F;  3K69 A;  1U6G A;  3F6V A;  1B6A A;  2W84 A;  2VT3 A;  1IUY A;  4U7B A;  5DYM A;  2K7L A;  4OIQ F;  2KRF A;  4EVI A;  5J8F A;  1KU7 A;  4YFX F;  1BM9 A;  1MJB A;  2NNY A;  4EJV A;  5J8C A;  1Q1H A;  1P6R A;  2K4B A;  2Y48 A;  1VTN C;  3TO9 A;  3HIF A;  2BYV E;  4G6Q A;  2HQN A;  2FSW A;  3JAM Z;  2YX7 A;  3N97 A;  4G7O F;  2H27 A;  2ZNZ A;  4P9F A;  4RB2 C;  3IKT A;  4KA4 A;  2HFH A;  4A5M A;  4Q5S F;  2D2W A;  2K27 A;  1QQI A;  4UVC A;  3QPT A;  2H94 A;  3GEZ A;  1R00 A;  2YU3 A;  3KCC A;  2ZO4 A;  2HS5 A;  1TQM A;  1RI7 A;  1FX7 A;  4LJZ F;  4AIK A;  4A0X A;  2QLZ A;  3OV8 A;  4IPA A;  5JVT A;  3E6C C;  2P5L C;  2MH2 A;  4R8H A;  4RAY A;  5AIP A;  1J0R A;  2EK5 A;  3RJP A;  3C7J A;  1R5G A;  2STW A;  1T6S A;  3EDP A;  3IRR A;  1YW8 A;  4O3M A;  5DUK A;  3F8M A;  1L3L A;  1ON1 A;  3RPQ A;  3M1E A;  1G6N A;  5E17 F;  2HR3 A;  2ESN A;  3TO6 A;  3WTV C;  2Q0O A;  2R7F A;  1K6O A;  2G9W A;  3WTW C;  4S05 A;  2P7V B;  5ICF A;  3W6K B;  4M9Z A;  3RKW A;  5FB2 A;  1B1B A;  1WI9 A;  2FF4 A;  2VT2 A;  3NRV A;  5JHU A;  2XGX A;  3FXU A;  1IW7 F;  3SXY A;  4KMF A;  3KET A;  2FA5 A;  1O3Q A;  2ACJ A;  3QRF F;  4ESJ A;  4P9U A;  2QQA A;  4MTE A;  1O7L A;  5BOX A;  3SQN A;  3OOP A;  2V1D A;  2UZK A;  2EFN A;  3HRM A;  4Q4Z F;  4IXA A;  2VBY A;  2HEO A;  4ESB A;  3ZP5 A;  1HXD A;  2CO5 A;  5KVR A;  1ZGA A;  4KIB A;  3Q5F A;  1DUX C;  4FX4 A;  2ELH A;  5FD6 A;  4HOB A;  1LEB A;  3C18 A;  2DW4 A;  2DT5 A;  1IF1 A;  3KFW X;  3PFI A;  1YTY A;  3G3Z A;  3IRQ A;  3GF2 A;  5CJ9 A;  1J75 A;  5HS7 A;  5CVI A;  4JQF A;  3CDH A;  1MD0 A;  2BE5 F;  2HWV A;  3NQO A;  5DDG A;  1YW9 A;  4M71 A;  1FY7 A;  3V8J A;  1V3F A;  1TNT A;  5D6F A;  3F23 A;  2FEZ A;  3GW2 A;  1MDM A;  3ZMU A;  3WE3 A;  3WTU C;  4G94 A;  2XHK A;  1K78 A;  3GZ5 A;  2BEO A;  1LDD A;  5HDN A;  1Z6T A;  1BBY A;  1XB4 A;  2GA1 A;  2VOP A;  3EUH A;  4YFN F;  3HOS A;  1KQ8 A;  2V6C A;  4EJU A;  2DPD A;  5FO5 A;  1L0O C;  3J81 Z;  5A2Q Z;  1F4K A;  3KLN A;  4HQM A;  1SD5 A;  4XBF A;  4L18 B;  2FU4 A;  1EV7 A;  3ABT A;  4UNO A;  2ISY A;  3J81 K;  2OU2 A;  1J59 A;  5LRS A;  5L3E A;  4LB5 A;  2JRT A;  2XKO A;  4HX7 A;  1XCV A;  2FNP A;  3WU0 A;  3RTR A;  4U0Y A;  2FBI A;  1F5T A;  2EFO A;  1MDM B;  1KQ9 A;  1ZG5 A;  3WTY C;  1O7F A;  2QWW A;  1K7A A;  1SD7 A;  4MEX F;  1XSD A;  1GXQ A;  4IRH A;  4A6E A;  2W24 A;  1P92 A;  3T8R A;  2VOD A;  2KKO A;  3HHH A;  1LNW A;  2HZT A;  2M8E A;  5JFR A;  1HST A;  2DFI A;  2R3S A;  3QP6 A;  1FNN A;  2E1C A;  3EYI A;  1SFX A;  3GX4 X;  2MD5 A;  2Z3Y A;  4LLN A;  3HOT A;  2DTR A;  4Y17 A;  1QZY A;  2K02 A;  1IN4 A;  2ISZ A;  1ZYR F;  1RIO H;  1HW2 A;  4CZZ A;  1YS7 A;  1FBQ A;  4HA8 A;  3V7S A;  1ZAR A;  2CFX A;  2YX4 A;  2IPQ X;  1P4W A;  4P5O A;  3LAJ A;  3R0A A;  1XGN A;  2Y75 A;  1QZZ A;  3BPV A;  2FMY A;  2C6Y A;  3IC7 A;  3L9F A;  1R1T A;  3MZY A;  4HLX A;  4AWX B;  5CVJ A;  4CHU A;  2CQK A;  2GWR A;  3VOE A;  3I64 A;  5D4S A;  1YLF A;  4OIO F;  2CG4 A;  1SAX A;  5FFX A;  4UVB A;  1JHF A;  3RKX A;  2PG4 A;  3KE2 A;  1I6X A;  4WCG A;  1H9T A;  3FXQ A;  2XAH A;  3ROU A;  2RKH A;  4K2E A;  5BS6 A;  4OMY A;  3HSR A;  1BN5 A;  3F21 A;  1S7A A;  2XVC A;  2L01 A;  4M74 A;  2PBI A;  2P6T A;  3SFZ A;  2VC0 A;  2A61 A;  5LGN A;  3TKY A;  3GFL A;  4D0P A;  3GFM A;  2LDU A;  1FWZ A;  1B9N A;  4KYW A;  2TDX A;  2OQR A;  3JTG A;  3H92 A;  1O3S A;  4XSZ F;  1HBX G;  5K1Y A;  2F5C A;  3KZY A;  1ZGJ A;  5LEJ A;  2KJB A;  3FZV A;  2HQR A;  4E70 A;  3R61 A;  1XN7 A;  4M6X A;  3M8F A;  4A0Z A;  2OZ6 A;  3IHU A;  1O3T A;  5L3G A;  5CVR A;  2RGV A;  3R6S A;  5IT9 K;  4HYE A;  4ENN A;  4A5N A;  5D4R A;  1KQ0 A;  3K2Z A;  2W85 A;  3GVA A;  4WXH A;  1MJ9 A;  3BY6 A;  3VOD A;  3DXJ F;  3W6J B;  1QGP A;  5DEQ A;  1R1V A;  3COA C;  2R7D A;  1I27 A;  2DQR A;  3M8E A;  4N9I A;  4I09 A;  1C0W A;  4PCQ A;  3ZMS A;  2B0L A;  4LK1 F;  4HX8 A;  3RKY A;  2HGC A;  1S6L A;  1T98 A;  1U5T B;  1KGS A;  2PI0 A;  1J7K A;  5L3C A;  3WGG A;  3HSF A;  1KU3 A;  2D1H A;  2Y0M A;  3IWF A;  3ECO A;  2EFQ A;  4WXD A;  2VN2 A;  4LG0 B;  5L3F A;  1W5T A;  3KP3 A;  1WQ2 A;  4EQQ A;  2D45 A;  2BBY A;  3J80 K;  1XD7 A;  5DD8 A;  2OZU A;  2YPR A;  1LB2 A;  2D1V A;  5H6Q A;  3KLO A;  1QNT A;  3SZP A;  4MNU A;  1Z1D A;  1RZ4 A;  1YFH A;  1FOK A;  1T2K A;  1DPR A;  3G73 A;  4GCV A;  2ETH A;  5H6R A;  5LRR A;  1IN5 A;  5D8K B;  4KN7 X;  2LNB A;  2M30 A;  1TTY A;  1BJA A;  2VBW A;  5F6F A;  3T0Y A;  1JGS A;  1JXS A;  4U0V A;  1J2X A;  5LHH A;  3ZMV A;  1QPM A;  2L02 A;  5BMZ A;  3R4K A;  3FM5 A;  2Z5U A;  4HBL A;  3E97 A;  1FSE A;  1OYW A;  1YW7 A;  4ZZL A;  4AD9 A;  3BJ6 A;  3ZPL A;  3RDI A;  5LHG A;  4KDP A;  5E1W A;  3IWZ A;  2A69 F;  5EEG A;  2OD5 A;  3WGI A;  2DAO A;  2F5D A;  1HKT A;  3FXR A;  1ZG3 A;  2VBZ A;  2QEN A;  1WRJ A;  2NRA C;  1PP8 F;  4RB1 A;  5D5W B;  3L2C A;  1BOA A;  2XAG A;  3HSE A;  1PUE E;  1ZN2 A;  3LA2 A;  1FP2 A;  3GXO A;  5JR3 A;  2CSO A;  2OBP A;  1O3R A;  1Y0U A;  1LEA A;  3JSP A;  2QM3 A;  2XUB A;  4U7D A;  5HVQ C;  3FF5 A;  3DPL C;  4FX0 A;  4BXU A;  2EFW A;  1BI0 A;  2O8X A;  2ZME A;  3ISP A;  1B9M A;  2O61 A;  4QLC U;  2DPU A;  5ICE A;  2A68 F;  1S7O A;  4BHB A;  3J7A O;  3LWF A;  1USS A;  4ON0 A;  2P7C B;  3F6O A;  1GHC A;  3RPU A;  1ZAO A;  3VB2 A;  3T5X A;  2GXG A;  4L5I A;  1J9I A;  5L3B A;  5ILV A;  2VE8 A;  1FYM A;  5D6E A;  2VC1 A;  2L3D A;  1D5V A;  1ZLJ A;  2WV0 A;  5FGM A;  4GYG A;  2DK8 A;  3WTX C;  4A0Y A;  2P5K A;  2EV0 A;  2IA2 A;  1FYK A;  4FT8 A;  2X0L A;  3I71 A;  4YFK F;  4BHC A;  5BPI A;  2DQL A;  2H6C A;  4XLN F;  2P4W A;  1XGM A;  2HYF A;  3ZMD A;  4B8X A;  3F3X A;  5TJJ A;  4RGX A;  1IXR C;  4A2U A;  3KP6 A;  2YSR A;  3LA3 A;  3MFK A;  2XAJ A;  3CLO A;  3DP7 A;  4HV6 A;  2GA2 A;  4YII A;  3TO7 A;  3CJN A;  1UB9 A;  1S29 A;  1S8N A;  1D8K A;  2ZME B;  3U1D A;  1E2X A;  4Y15 A;  1IXC A;  1SD4 A;  4G6D A;  3KZZ A;  3CUO A;  4L0Z B;  5IT3 A;  2LF7 A;  2V79 A;  1SMY F;  4HZF A;  3FHZ A;  2O6G E;  4HF2 A;  2KJC A;  1FPQ A;  3KEO A;  6PAX A;  3E3V A;  3TQN A;  1BI1 A;  2STT A;  3BJA A;  4L9V A;  1ZHF A;  4EGZ A;  2VOO A;  5L3D A;  5TRD A;  4LK0 F;  3QAH A;  5F64 A;  4DQ2 A;  2O03 A;  4UVA A;  2UWM A;  2JT1 A;  4KIF A;  2ZBK A;  3VEP A;  4M72 A;  3FM3 A;  1G3Y A;  4NB5 A;  2FRH A;  1YO5 C;  4RB0 A;  4L5J A;  4M9S A;  3ZQ7 A;  1O57 A;  3JW4 A;  1UHM A;  3KP2 A;  3O2P E;  4EM2 A;  1B59 A;  3P9C A;  4Z2Y A;  3REO A;  2J5O A;  4PGH A;  3E6M A;  1DPU A;  3V8L A;  4HW0 A;  3K1M A;  1D8J A;  2K4J A;  1W7P D;  4UV8 A;  4H0E A;  2EFP A;  3E6D A;  2E1N A;  2JZY A;  1W4M A;  3ERE D;  1OR7 A;  2DLL A;  2NNN A;  3B02 A;  1LQ1 A;  3GLX A;  3RYP A;  2O3F A;  1W7P B;  2RN7 A;  4LGW A;  2XIG A;  2QYO A;  2RQP A;  1Z6R A;  3VFZ A;  3FMS A;  2MH9 A;  3LST A;  3BPX A;  2M45 A;  4HAM A;  2HDC A;  2ZKZ A;  4KIC A;  3U9G A;  1LDK B;  2NYX A;  3E5Q A;  3MZH A;  3RYR A;  1TLH B;  2HOE A;  3MWM A;  1CF7 B;  4KIG A;  1HSJ A;  5LLQ A;  1KYZ A;  1WSU A;  2COM A;  4BYY A;  4G9Y A;  1WKM A;  1ZH5 A;  1GXP A;  3E6B A;  4BAY A;  1XMA A;  1T39 A;  1QO0 D;  4I02 A;  4CXF A;  4WWC A;  5LHI A;  2GXB A;  2UXN A;  1TW3 A;  1U8R A;  1B4A A;  1HW1 A;  2EJR A;  1XGO A;  1F9N A;  2GQQ A;  1IN8 A;  5BPD A;  3PQK A;  4RGS A;  2A6H F;  3DKW A;  1EH6 A;  3I59 A;  3O6B B;  1JE8 A;  4HDV A;  3BDD A;  3GYH X;  1U5T C;  3K1P A;  2G7H A;  4ENJ A;  2KIU A;  4TV7 A;  4AVP A;  3ZN0 A;  1STZ A;  1G3W A;  4L9J A;  3PQJ A;  3BP8 A;  1ZG1 A;  1XMK A;  1KU2 A;  2QZ8 A;  4GO1 A;  1XDS A;  4OMZ A;  2VXZ A;  1IAW A;  3Q9S A;  4ESF A;  5DV5 A;  2XAQ A;  4P55 A;  1AOY A;  2F5F A;  2F5E A;  4RAZ A;  4L0Y B;  1TQI A;  2H09 A;  3HYI A;  1U5T A;  3HTU A;  4CO8 A;  3QU6 A;  3I5U A;  4YIF A;  2OAZ A;  2ESH A;  5DCM B;  3L7W A;  1IN7 A;  4LG0 A;  1A04 A;  4WK8 F;  2WC2 A;  3I53 A;  4CIC A;  2XKP A;  2FXA A;  1WWX A;  3WOD F;  4S04 A;  4LMY A;  5IT9 Z;  4IHT A;  2RDP A;  4ZYE A;  1R7J A;  3F72 A;  3HTS B;  3I59 B;  4GGG A;  4KNY A;  2HTJ A;  4OU0 A;  4AIH A;  4RB3 C;  3TDU C;  2Q2E A;  4IRG A;  1DDN A;  3C1D A;  4CDG A;  2JPC A;  5CLS A;  3F8F A;  4UV9 A;  5LGU A;  4A12 A;  1FT9 A;  2A5Y B;  1I1G A;  4ETS A;  4Q48 A;  3FMR A;  1Z05 A;  2QBY B;  5HDK A;  5K5Q A;  1D3Y A;  3D5L A;  1I5Z A;  1LDJ A;  3CO6 C;  2FML A;  2IRF G;  5E1X A;  2IA0 A;  2FBK A;  3GFJ A;  2Z33 A;  2HYG D;  3R0J A;  4KT5 C;  2RV8 A;  3SZT A;  2HKX A;  2LKP A;  3TOB A;  1BC8 C;  3WGH A;  2EA4 A;  3EET A;  4NHJ A;  2WTE A;  3J80 Z;  3KEQ A;  3L00 A;  3R60 A;  4MGR A;  1SFE A;  2JPB A;  3CUQ B;  1R58 A;  1Z7U A;  4G7Z F;  4I7H A;  4QWQ A;  1T0F A;  3KP5 A;  1TW2 A;  3FWE A;  4DNC A;  3TGN A;  4ZYG A;  2V9V A;  4I98 B;  5K5R A;  1J5Y A;  1UST A;  2XAS A;  2A3S A;  2ZCW A;  2ZNY A;  3N4M A;  3LA7 A;  1LJ9 A;  3SHF A;  4XRF A;  5J6X A;  3LAP A;  2JTV A;  3EYY A;  5ILS A;  3P7N A;  1YG2 A;  1NHA A;  2PLY A;  5DD4 A;  2J5P A;  4HX4 A;  3HRS A;  5HDG A;  1EH7 A;  4HDU A;  1IRF A;  1ZRC A;  1XSV A;  3ZN1 A;  1BI3 A;  1XCB A;  1ZLK A;  2V1U A;  2CYY A;  3F8N A;  4OOI A;  5HLG A;  3B73 A;  4R79 A;  1OYY A;  2YR2 A;  2VON A;  4EGY A;  3FX3 A;  3Q9V A;  4WF2 A;  5ICG A;  1UCR A;  4XSX F;  3D0S A;  1FZP B;  2NAZ A;  1OKR A;  3JAM K;  2VBX A;  2BGC A;  2DK5 A;  2HKO A;  2OA4 A;  5F1R A;  5ILU A;  5D5X B;  1H9G A;  4R1H A;  1XDU A;  3CTA A;  1HKQ A;  3I58 A;  1ZRF A;  1R22 A;  3RI4 A;  3WTZ A;  3V7C A;  4I01 A;  1G3T A;  2FE3 A;  2EB7 A;  3MQ0 A;  1YS6 A;  2IA1 A;  2E7W A;  4MQV A;  1XGS A;  5HLI A;  5HOO A;  2A07 F;  4PGG A;  1R5H A;  4PZJ A;  1Z91 A;  4I2O A;  4Y13 A;  3ZMZ A;  2LSO A;  5CYV A;  4YG2 F;  3IL2 A;  1MGT A;  2A6E F;  4LB6 B;  3I0T A;  4F7Z A;  2OQG A;  3WE2 A;  1LVA A;  5D5U B;  4HF1 A;  1FLI A;  4ZH4 F;  1T38 A;  1BIB A;  1R36 A;  2CW0 F;  4GXO A;  5EEH A;  3ULQ B;  3HRT A;  3F8C A;  1H0M A;  2MC3 A;  4A6D A;  3LQQ A;  2MLK A;  5D5V B;  2IT0 A;  4FHT A;  2L54 A;  4ZZD A;  2EV5 A;  2AXL A;  2QUF A;  5AIQ A;  2L4M A;  3BZ6 A;  5FFZ A;  4LLL A;  3TDZ C;  2CGP A;  3U2R A;  2MBF A;  3ZMT A;  2Z9O A;  4WXC A;  2XAF A;  2ADU A;  4ZYD A;  4P96 A;  4IJA A;  4OIN F;  3QPH A;  1QBJ A;  1P4A A;  1UFM A;  2ZFW A;  3JSO A;  1ZRE A;  2MLG A;  4EMS A;  4BNC A;  3BRO A;  1FYL A;  3E5X A;  1I1S A;  3QU3 A;  4Q47 A;  4WX9 A;  1W7P A;  5LEK A;  2IW5 A;  2L4A A;  1HKS A;  3NEU A;  4N9H A;  4EJO A;  3DEU A;  4RGR A;  3AAF A;  5ERI A;  5HS9 A;  3GO5 A;  2FQ3 A;  4CGZ A;  2F2E A;  1P4X A;  4N0B A;  3EQL F;  1X3U A;  5CVV A;  1ONV A;  5H20 A;  4JK1 X;  1F1Z A;  2G7U A;  3O3K A;  1CF7 A;  2IJL A;  2DI3 A;  3V8K A;  1MZB A;  2PJP A;  1PDN C;  4KMU X;  5LBQ A;  2MA3 A;  1KA8 A;  3ELK A;  2PMU A;  4L9N A;  3K1N A;  1K79 A;  2GZW A;  3WTT C;  1XSX A;  2CWE A;  4G8X A;  4PDK A;  1MKM A;  1GVJ A;  4ENK A;  2K86 A;  4KUM A;  5AON A;  4MEY F;  2NS0 A;  4BQA A;  5E8I A;  1REP C;  3C3W A;  1S3J A;  2UXX A;  2IP2 A;  1RNL A;  5A2Q K;  5DUI A;  1JHH A;  2M1B A;  3DQV C;  1R23 A;  5E8G A;  2X4H A;  1BC7 C;  3MAJ A;  1U78 A;  1KYW A;  5ED4 A;  4LD5 A;  3KP4 A;  3H3U A;  2IVM A;  2EA2 A;  2RC4 A;  3CO7 C;  4MTD A;  2LF8 A;  4UHT A;  2P8T A;  4I0B A;  3DPT A;  1V4R A;  3M7G A;  4LFU A;  4IRI A;  3FMQ A;  2QVO A;  3T8T A;  4UUV A;  5CVU A;  3DF8 A;  3I4P A;  2XRO A;  1K78 B;  2O0Y A;  1W5S A;  2PFB A;  2KIF A;  1IN6 A;  4M9X A;  2EV6 A;  2BV6 A;  3GZ6 A;  4O6J A;  4OIP F;  2FOK A;  3GUD A;  4MQ9 F;  5DCM A;  4EV0 A;  5KK1 A;  1OPC A;  1IZ1 A;  3H3Z A;  4AIJ A;  4ENM A;  1PP7 U;  3V4G A;  3WU1 B;  4IVN A;  2H6B A;  2E7X A;  3QOP A;  3LQR A;  1U2W A;  3BOQ A;  3M9A A;  1ZRD A;  4KFC A;  1P2F A;  4XLP F;  1EH8 A;  3QP5 A;  3P9K A;  1IRG A;  5FLX Z;  4IHS A;  4EJW A;  2P5V A;  4EJT A;  1G4D A;  4MHG A;  3CUQ C;  2XV4 S;  4HLY A;  2QBY A;  1DP7 P;  2P6S A;  1IXS B;  1CGP A;  2QQ9 A;  1TBX A;  5HLH A;  5FLX K;  3GFI A;  5D8L B;  2HTS A;  3ECH A;  2ZJ2 A;  1MJA A;  4U88 A;  2XRN A;  4RGU A;  5K5O A;  4L9T A;  1OYI A;  1U3E M;  1FBS A;  5LGT A;  2VE9 A;  1SFU A;  4G7H F;  3WG9 A;  1TNS A;  2Z99 A;  2V1X A;  2DBB A;  4HV5 A;  5ICC A;  1BIA A;  4GYI A;  4ZYH A;  3CUQ A;  4EM1 A;  2PQ8 A;  2W25 A;  1G3S A;  3V7R A;  5E20 A;  1YQA A;  3JTH A;  3IKV A;  3ML6 A;  2M87 A;  2WWY A;  4IF4 A;  3MEX A;  3DFG A;  4JBA A;  5DCF A;  4NQW A;  2JSC A;  2KIM A;  4HQE A;  2ZXJ A;  3BJO A;  4M73 A;  3S2W A;  3HHG A;  3KP7 A;  2RNJ A;  4CYD A;  1SD6 A;  2PEX A;  1RUN A;  1RUO A;  3DV8 A;  4M6Y A;  1FP1 D;  2W57 A;  4BH9 A;  1HQC A;  3K9T A;  2RVC A;  1ON2 A;  2DO7 A;  2Q8K A;  5HS8 A;  5E18 F;  3I54 A;  5FD5 A;  1TQP A;  4BHP A;  3LFK A;  3BWG A;  2GIV A;  4ASN A;  1UHW A;  2FNA A;  3MCZ A;  3F22 A;  4OIR F;  4I0A A;  1YYV A;  4RS8 A;  1Z9C A;  3P9I A;  1OMI A;  4HF0 A;  3WTS C;  2PMH A;  2EWN A;  4UXN A;  1BI2 A;  3TOA A;  1HW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...