5D8LB

Human hsf2 dna binding domain in complex with 3-site hse dna at 2.1 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*GP*TP*GP*AP*AP*TP*AP*TP*TP*CP*TP*AP*GP*AP*AP*CP*
publication title Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d8lB00
2IJLA 3F8NA 4G6QA 3V8KA 1FSHA 1WSUA 2PJPA 1P4XA 3HHGA 1KU3A 4OU0A 2YX4A 4KFCA 4ENNA 5EEHA 4NHJA 1TQMA 1F9NA 4BYYA 4S04A 1LQ1A 5D6FA 1HKQA 1HKSA 2NNNA 2MBFA 2PEXA 2QZ8A 2L3DA 1B6AA 1BIBA 3I4PA 2A6EF 3RKYA 1FSEA 2ESHA 4WK8F 2EV6A 3F8FA 1USTA 3WGIA 3G73A 3JAMK 3HRSA 1R1VA 1USSA 3LA2A 4LK1F 3FMSA 2ISYA 3FMQA 4R79A 2HQNA 2BE5F 1I1GA 1QQIA 2Y75A 2BBYA 3L00A 2ELHA 5JVTA 1BI0A 4ON0A 3V8JA 2OA4A 4Y13A 2M30A 1OYIA 2IA0A 3LAJA 5HS7A 1ZG5A 2RV8A 3KCCA 2HKXA 4WF2A 3IRQA 4WCGA 1YIOA 2DQLA 2HZTA 1B4AA 2DLLA 4FHTA 3CO6C 4HF0A 3COAC 1XGNA 5CYVA 2YPRA 3MZHA 3ABUA 2BV6A 5D4RA 1W7PB 3F72A 3BZ6A 3GZ6A 2JZYA 5E17F 5HDKA 3QU3A 2LNBA 1J2XA 4OIQF 4P55A 2KJBA 4MGRA 4I98B 3DPTA 1FLIA 3DP7A 4WXHA 1SD5A 5E1XA 1OR7A 4IRGA 2Y48A 1V3FA 3HIFA 2E1CA 3PFIA 2OU2A 2RN7A 4JK1X 3DF8A 4R1HA 1FPQA 3HSRA 1Z1DA 4ESFA 1ZARA 4L5JA 3ZPLA 1D5VA 2VODA 4RGSA 2OBPA 5HLHA 2EWNA 1BJAA 4KDPA 5CVVA 3IRRA 2CYYA 4KMFA 3WE3A 4MQ9F 1YG2A 3RYRA 1QZYA 1ZGAA 5KK1A 3GFIA 3SQNA 2X0LA 3WTTC 4RB0A 3GW2A 1FP1D 2IA2A 5AIQA 1YS6A 1IXCA 2EV5A 1Z05A 5DUIA 1LVAA 1TW2A 1OYWA 4BH9A 3TKYA 2EFNA 4EJTA 1P4WA 4N9HA 2OQGA 1BBYA 3JTGA 1MZBA 4LK0F 2P7CB 3KE2A 4DQ2A 3MWMA 3EETA 1G6NA 3MCZA 1IXSB 2BGCA 2X4HA 4P9FA 4DNCA 3CUQB 1O57A 1R1UA 4HW0A 4ESJA 1CF7A 3ZMDA 4CXFA 2O61A 1LJ9A 3VEPA 4UHTA 3QRFF 1KQ0A 1ZYRF 1BOAA 3F22A 1G3WA 4QLCU 4G7HF 4I09A 2XHKA 5CJ9A 1R5GA 4EMSA 3RIRA 3ZMVA 2LF8A 4TV7A 3IHUA 1GHCA 1XB4A 2W85A 4OMYA 2CGPA 3RPUA 1P92A 3ABTA 1S7OA 2HR3A 2V1XA 1HXDA 1WI9A 1XN7A 2L54A 4IRHA 5DEQA 1U78A 5DCMA 3K1NA 1SFXA 1H9TA 4LG0B 3HTUA 1HKTA 4MNUA 4A6DA 4OIRF 2M5WA 2O3FA 1YW7A 3FM3A 2DPDA 2B0LA 5A2QZ 2HOEA 5HDNA 4HBLA 2QQBA 3WTUC 5D8KB 1K7AA 5K5OA 2L02A 1WQ2A 5BMZA 2P5KA 2PN6A 2H27A 4OOIA 2PFBA 5E1WA 1BI2A 2WV0A 2UXNA 4EQQA 2XV4S 3F8BA 1JXSA 2P5LC 1HQCA 2RVCA 2VBYA 1QNTA 1W4MA 2R3SA 5IT3A 3LQRA 5CVRA 5ICCA 3KEQA 4KN7X 2XKOA 3LWFA 3EQLF 2NS0A 4M6XA 2V1DA 2ZO4A 3TDZC 4ENJA 3I59A 4U7BA 4FX0A 2ZKZA 3B73A 5HDGA 3RKWA 3QPTA 2D1HA 4Y15A 4O6JA 3V7CA 5DDGA 1H0MA 1D8JA 3CJNA 1IXRC 1PP8F 2VE8A 4NQWA 1HW1A 4LLLA 3E6DA 3P9CA 4CZZA 4GYGA 3KEOA 2H6BA 5L3FA 4CGZA 1O3QA 5TRDA 1R58A 3M1EA 1LDDA 3QOPA 2FBKA 2G7UA 2XAFA 1ZRFA 5DCMB 3HRMA 5JHUA 1R22A 4ZZDA 4A5MA 2P4WA 4EV0A 5LRSA 4M74A 1KYWA 4HA8A 2L4AA 2MH9A 1YQAA 2K7LA 1CGPA 4HF2A 3WG9A 2M1BA 2GA1A 3EUHA 2OZUA 2FU4A 5LHHA 1BN5A 3MQ0A 3IL2A 2HEOA 3E6CC 2KIUA 2HGCA 2EA2A 4O5VA 2HFHA 5A2QK 5LHIA 3MZYA 2VE9A 4G8XA 3L2CA 2F5FA 5F6FA 3F3XA 3CLOA 3WTWC 4MEXF 4BHPA 2A5YB 5ILVA 5HLGA 2K86A 4HAMA 2RQPA 3TDUC 2PG4A 2V79A 3TO9A 3BPVA 2G7HA 4ZYHA 4IF4A 2AS5F 3O2PE 5ILSA 4I0AA 1SFUA 4LFUA 4HOBA 1TNSA 3H3UA 4EGYA 5D5XB 5FLXZ 1F5TA 5L3BA 5CVJA 1FNNA 3QU6A 4I0BA 3KP2A 2M45A 4NB5A 1K79A 2BYVE 3V7RA 4XBFA 1KYZA 1UFMA 2IW5A 4L9VA 2Q2EA 2UXXA 4A0YA 2RGVA 1T0FA 3O3KA 3P7NA 4EVIA 5L3CA 1T38A 4RAZA 1UB9A 1AWCA 5DUKA 4LGWA 3B02A 4G7OF 3HSFA 1ON1A 1RNLA 1WKMA 2STWA 2P8TA 1U5TC 2QUFA 1Z7UA 1RUOA 2P7VB 4L18B 2Z5UA 4WXCA 3F21A 3MFKA 4RS8A 1J75A 2Z33A 3FM5A 3RKXA 1ZLJA 1W7PA 3U9GA 2XAQA 3V7SA 5BS6A 1LDKB 2IP2A 4MTDA 2VBXA 1YO5C 4Y17A 1IN6A 2HYFA 3R60A 3OV8A 2FF4A 3M7GA 2DK8A 1OYYA 5IT9K 1R36A 5F1RA 4KYWA 3WTSC 5HLIA 3GVAA 2H09A 2YU3A 4CHUA 4UVAA 4KUMA 4G9YA 1GXQA 4IJAA 3TO7A 3GUDA 2GQQA 4YG2F 5H6RA 1U2WA 1RI7A 5BPIA 3M9AA 1U5TB 2VBWA 2ZNYA 1O3TA 3T5XA 2YR2A 1BI1A 3FXRA 4G94A 1STZA 5LEJA 5D4SA 3N97A 4K2EA 2XGXA 1D8KA 1QZZA 4GGGA 3DEUA 3ZN1A 4GCVA 3WTYC 1O7LA 2V1UA 3BDDA 2IVMA 4GO1A 2AXLA 3V4GA 2RNJA 1PP7U 1ZLKA 4KN4X 4U0WA 1P2FA 4AIJA 5L3EA 3BY6A 3V8LA 3R61A 3BPXA 5TJJA 2VOOA 4XSZF 3ERED 3SZPA 3LQQA 1J0RA 1IZ1A 1MD0A 4RGRA 4N0BA 4EM2A 1F4KA 1TQPA 2EFOA 2ZMEB 5K1YA 2JPBA 3CTAA 4YFNF 3CUQA 3BROA 4KT5C 1FBQA 1MDMB 4EJUA 2Y0MA 3HSEA 4I01A 5HOOA 1FX7A 2OD5A 5DV5A 5L3GA 2MD5A 4A6EA 4LD5A 3I0TA 4LB5A 3KFWX 3GX4X 1UHMA 3I53A 2FNAA 1UCRA 3D5LA 3RTRA 3HUGA 2FBIA 3ZQ7A 5LRRA 2XRNA 2L01A 3RYPA 1S7AA 4HF1A 3T8TA 2FXAA 3ZMZA 3TOBA 4L0YB 4M9ZA 3SFZA 2XAJA 2Q8KA 1NHAA 3FXQA 3NQOA 2VXZA 2EFWA 4LG0A 3WTVC 3IWFA 5D6EA 3KP5A 4KIBA 4UV9A 1G3TA 4L0ZB 1TW3A 2HTJA 4YIIA 2VOPA 3K1MA 4L5IA 1BC7C 1ZH5A 1S29A 2O6GE 4IXAA 2LSOA 4PGGA 1ON2A 4JQFA 3JW4A 1BC8C 1IF1A 5K5QA 3TGNA 3E5UA 2E7WA 1ZRCA 4U88A 1LDJA 2IT0A 2W57A 2EA4A 5BPDA 2DO7A 1UHWA 2WTEA 2OQRA 4EM1A 3N4MA 4PCQA 5LLQA 1SMYF 5ICEA 5J6XA 1SD7A 3GEZA 1ONVA 3KZZA 3WGHA 1ZAOA 2EV0A 2MH2A 1KQ9A 2MLGA 3T8RA 5CVIA 2RC4A 2IRFG 4BNCA 4LLGF 3ISPA 3EDPA 2HTSA 4ESBA 2PI0A 1IN8A 4AVPA 2FRHA 3W6KB 4ENKA 4AIKA 3Q9VA 1QPMA 3C1DA 5F64A 4A5NA 3F23A 4N9IA 3FHZA 2ZCWA 1YS7A 1I27A 4S05A 3Q9SA 2Q0OA 1FYMA 1QBJA 1S8NA 3BP8A 2F5CA 2W25A 3I54A 3BWGA 2COMA 4A2UA 1MGTA 2J5PA 2CO5A 2STTA 5H6QA 3IC7A 3T1BA 3GF2A 3C18A 4MTEA 1XSDA 2VONA 2V6CA 3VFZA 2FMYA 4IHSA 5LGUA 3EYYA 4G6DA 4YIFA 5ED4A 5FB2A 5ICFA 2A6HF 3LA7A 1O3SA 4H0EA 4XLNF 4P96A 1O7FA 1IRFA 2Z99A 4RAYA 4MHGA 4KMUX 4HLXA 1S3JA 1TTYA 2FQ3A 2QVOA 3L09A 3G3ZA 4EM0B 4FT8A 4FX4A 1BM9A 3E5QA 3DXJF 4YFXF 1YW9A 2DW4A 2NYXA 4PZJA 2JT1A 1A04A 4ASNA 3ZN0A 3WGGA 3TOAA 2DBBA 2WC2A 2A3SA 4Q5SF 1HW2A 3T0YA 4HLYA 1Z91A 5LBQA 3GFMA 1W5SA 2KRFA 3TO6A 1LB2A 4PGHA 3CUOA 2UWMA 3JSPA 4AIHA 3REOA 3RPQA 3ECHA 2IA1A 5K5RA 3RI4A 3KLNA 5E8IA 2ETHA 3R0AA 3QPHA 4OIOF 4I2OA 3IKTA 1EH8A 3MEXA 1XMKA 3P9KA 4P9UA 2LDUA 5DD8A 4P5OA 1YTYA 2RKHA 3WTXC 4IRIA 1FP2A 4XRFA 1T2KA 3KP7A 5HVQC 1YW8A 4KA4A 2PLYA 5HS9A 1R7JA 2LF7A 3IKVA 5E20A 3I58A 4M73A 3WTZA 2VT2A 3CO7C 3NRVA 1FT9A 3HOTA 1IUYA 2XASA 5BOXA 4EJVA 1MJ9A 1LEBA 1TQIA 2XIGA 2IPQX 3C7JA 1O3RA 2D1VA 3M8FA 4KIGA 1LEAA 2CW0F 2QQ9A 1SAXA 5JI6A 1PUEE 5FD6A 4QWQA 2GXBA 3ROUA 2FOKA 1ODDA 3P9IA 3BJOA 4RB2C 3JTHA 3DKWA 3QAHA 1IN5A 2XVCA 1I5ZA 3ZP5A 3AAFA 4RGUA 2K4JA 2ISZA 1G3YA 2GIVA 1U5TA 5FO5A 1FC3A 1C0WA 1SD6A 2FMLA 1X3UA 4EGZA 1QO0D 4G7ZF 2HQRA 3W6JB 4MQVA 2DPUA 4KICA 1XDSA 1K78B 2FBHA 1OPCA 1SD4A 3QP5A 2K4BA 4ZH4F 2DT5A 2ACJA 3GO5A 3F8MA 4LLNA 3JSOA 1GVJA 3GFJA 4HQMA 3K2ZA 4A0ZA 2XAHA 2KIMA 1ULYA 3WE2A 1FY7A 3FMRA 1KGSA 3OOPA 2ZMEA 2CSOA 1T98A 3R6SA 3CDHA 1FYKA 3DFGA 3ZMTA 1MDMA 2HDCA 1Z9CA 5E8GA 4HV5A 1YLFA 5ICGA 2F5DA 4U7DA 2MLKA 3KZYA 4ENMA 1IN7A 3ECOA 4I7HA 2TDXA 1ZN2A 3FX3A 5HS8A 1XDUA 4XSXF 5FLXK 2J5OA 4HV6A 5LGTA 5DD4A 3HOSA 3S2WA 1WRJA 1FWZA 3K0LA 4AWXB 2DI3A 3VODA 1JE8A 5JFRA 1KU2A 2VBZA 2PQ8A 3DPLC 3L7WA 5H20A 5LGNA 3SXYA 2KKOA 1BIAA 4B8XA 1XD7A 2GA2A 5DCFA 3GLXA 2R7FA 2QQAA 1RUNA 1FOKA 2FA5A 3J81Z 4YFKF 2BEOA 1ZREA 1HSJA 2QLZA 1FZPB 3HRTA 3E3VA 3KP6A 1GXPA 4U0YA 1IN4A 2DAOA 2XROA 1J9IA 1KQ8A 2F2EA 2C6YA 1Q1HA 4BHBA 4OMZA 3E97A 2W24A 1B59A 2E1NA 4XLPF 1L3LA 3BOQA 1Y0UA 3F8CA 3ZMSA 1XSXA 2JPCA 3RJPA 1RIOH 3E6MA 4WWCA 3FXUA 5KVRA 4A0XA 1SFEA 3R4KA 2ESNA 5D5UB 4WX9A 1JHHA 3GWZA 2XUBA 3PQJA 1R23A 3EYIA 3GXOA 3ZMUA 1J7KA 3GFLA 4CICA 1DP7P 2UZKA 1T39A 3HYIA 1RZ4A 1WWXA 3CUQC 2GZWA 3U2RA 3FF5A 1B9NA 4LB6B 3C3WA 2XAGA 4UNOA 1IRGA 1LNWA 5AONA 2MA3A 3NEUA 1V4RA 2R7DA 4EJOA 3H3ZA 5AIPA 2VC1A 4HYEA 2QM3A 4ZYGA 4GXOA 3M8EA 2EB7A 2YX7A 3SZTA 3VB2A 3R0JA 1I6XA 2VC0A 1ZHFA 3ML6A 2HKOA 3ELKA 3K1PA 2ZNZA 1KU7A 3J81K 1IW7F 5D5VB 2D2WA 4UV8A 4IHTA 4HQEA 2FNPA 6PAXA 5ILUA 1F1ZA 2QBYA 4HZFA 2Z3YA 1KA8A 4RGXA 4CYDA 1XGOA 1MJBA 2FE3A 1AOYA 1VTNC 4CO8A 1ZG1A 4ETSA 4Q48A 5J8CA 1E17A 2PMUA 2EFPA 3QP6A 3KP4A 5CLSA 3L9FA 1H9GA 3TQNA 2A61A 2A69F 2GXGA 5BQTA 3I64A 2FEZA 2WWYA 2DU9A 3WODF 4LJZF 4IVNA 4OINF 4RB3C 1P4AA 3HTSB 4ZYEA 2VN2A 3I71A 1U8RA 2D45A 3FWEA 2QWWA 2EJRA 4IPAA 1MJAA 1L0OC 4UXNA 4UUVA 3IWZA 1U3EM 1R5HA 4Q4ZF 2QENA 1TNTA 1K6OA 4M9XA 1T6SA 2M8EA 2P6SA 2P6TA 1E2XA 1J59A 3HHHA 3U1DA 1HBXG 3F6VA 4CDGA 4M6YA 3LA3A 4EJWA 3VOEA 4M71A 2ZJ2A 2ZBKA 4R8HA 1B1BA 4PDKA 1YFHA 1HW5A 3K69A 2DQRA 4F7ZA 1QGPA 2QBYB 4MEYF 4ZYDA 3J7AO 2A68F 1S6LA 2PBIA 4JBAA 4O3MA 2HYGD 2NAZA 4AD9A 2E7XA 3E5XA 4LMYA 4BXUA 5E18F 1FBSA 4A12A 1XMAA 1ZG3A 4HX8A 3LFKA 1FYLA 3J80Z 3Q5FA 1YYVA 1OMIA 5FFZA 2G9WA 5L3DA 2M87A 5FFXA 2DTRA 1CF7B 1JHFA 2RDPA 3E6BA 3GYHX 5JR3A 1DPUA 1HSTA 3LSTA 2ADUA 1B9MA 4UVBA 4B09A 4GYIA 3MAJA 2V9VA 2ZFWA 1P6RA 3HRUA 2JRTA 5DYMA 1G3SA 1EV7A 1EH6A 1JGSA 4U0VA 1MKMA 1Z6RA 5EEGA 1EH7A 3KP3A 5LEKA 2HS5A 5D8LB 3LAPA 1IAWA 3D0SA 3K9TA 3PQKA 2NNYA 1XCBA 4Z2YA 1XGSA 1K78A 4I02A 4BAYA 1ZRDA 4KNYA 4RB1A 5E1ZB 3RDIA 4M9SA 2EFQA 2GAUA 1W5TA 3BJ6A 1G4DA 2PMHA 1Z6TA 2LKPA 3DV8A 3FZVA 2ZXJA 3O6BB 1ZGJA 2A07F 1U6GA 2L4MA 1W7PD 1R00A 5LHGA 3KLOA 5ERIA 1OKRA 4KIFA 3BJAA 2CQKA 2QYOA 4HDUA 2P5VA 1I1SA 2W84A 2DK5A 1TLHB 1KU9A 4E70A 4ZZLA 3ULQB 2O8XA 2OAZA 4BHCA 2XKPA 3SHFA 5IT9Z 1DPRA 2CFXA 5J8FA 2EK5A 4HX4A 1BI3A 5CVUA 3WU1B 2NRAC 3J80K 4UVCA 4HX7A 4OIPF 3JAMZ 1DUXC 3I59B 4L9JA 4M72A 2K02A 2KJCA 2DFIA 4L9TA 2F5EA 5FD5A 4BQAA 3H92A 2CG4A 1REPC 4D0PA 3KETA 4Q47A 2Z9OA 2JTVA 2H6CA 2KIFA 2CWEA 1D3YA 1SMTA 5FGMA 1XGMA 2FSWA 1XCVA 3WU0A 4WXDA 2OZ6A 1R1TA 1FBUA 3I5UA 3GZ5A 1J5YA 1PDNC 2K27A 4L9NA 2HWVA 2O0YA 2GWRA 1DDNA 4HDVA 2H94A 1TBXA 2VT3A 2JSCA 2MC3A 3F6OA 2O03A 5D5WB 2YSRA 3DQVC 1XSVA
chains in the Genus database with same CATH superfamily
4ABZA 2IJLA 3F8NA 4G6QA 3V8KA 1VF9A 2KL4A 1FSHA 1WSUA 2CQQA 1IV6A 2PJPA 1P4XA 3QODA 4XKVA 3FXJA 5F0FA 2BW3A 3HHGA 1KU3A 3W2AA 2R7UA 4OU0A 2CW7A 2YX4A 4KFCA 1W0UA 4ENNA 5EEHA 4NHJA 2VJ4A 2DJNA 1TQMA 2CJJA 2MFZA 9ANTA 4BS9A 3H5NA 1F9NA 4BYYA 3HPGA 4S04A 3FBIB 1LQ1A 3TW6A 4XONA 2WADA 5D6FA 4XIDA 2LC2A 1HKQA 1HKSA 2NNNA 3FK6A 2MBFA 2PEXA 2QZ8A 4NC7A 2L3DA 1B6AA 2XGDA 1Z7LA 4PSXA 4J00A 2EZIA 2K85A 2LR8A 2BY1A 1BIBA 3I4PA 3G4SI 2ZMEC 2A6EF 2E36A 2IBDA 3RKYA 3D5RC 1FSEA 2ESHA 4CCLA 2EV6A 4WK8F 3H9QA 3UKGA 3S3NA 3HOXJ 3F8FA 3HOWJ 1USTA 3WGIA 3G73A 2FUG2 3JAMK 3BCAA 1R1VA 3HRSA 1USSA 2F4MB 2DA2A 2WAFA 2Q2EB 3LA2A 4LK1F 2CMPA 4M3DA 2WBMA 3FMSA 4MO7A 1X2NA 2ISYA 3FMQA 2DMUA 4BL0B 4ZTJA 4R79A 4XN0A 2AHQA 3A1YA 1RPWA 2NS8A 1JJ6C 2HQNA 3BTCA 1I1GA 1QQIA 2BE5F 2Y75A 2BBYA 1MW7A 3L00A 2ELHA 5F0HA 4XLCA 5JVTA 1BI0A 4ON0A 3JR9A 2LTPA 3PM1A 2WAEA 4II2A 3V8JA 2OA4A 4Y13A 2A6TA 2M30A 1Y8RB 2LRDA 1W0TA 1BW5A 1OYIA 3OYHA 5CQEA 3JRAA 2IA0A 3ABMH 5EF6A 5HS7A 3LAJA 1ZG5A 2R7RA 2RV8A 2VASA 3KCCA 2HKXA 4WF2A 3VDXA 3S16J 5C4XJ 3IRQA 3LNQA 1VQ8I 2ID3A 2BVMA 4A3FJ 3VPRA 3DPUA 4PK4A 4JX4A 4WCGA 1YIOA 2DQLA 2HZTA 1B4AA 2DLLA 4FHTA 3CO6C 4HF0A 3COAC 3FK7A 1XGNA 4JX5A 5CYVA 2VPRA 2YPRA 3OYAA 2ZJPF 3MZHA 3ABUA 2BV6A 1HOMA 5D4RA 1W7PB 1TWHJ 2GM4A 2V9PA 5FKKA 2L7ZA 2W1OA 2YU9J 3F72A 3BZ6A 3TP3A 3GZ6A 4I76A 2JZYA 4XOTA 3K70C 5E17F 5HDKA 3QU3A 2LNBA 1J2XA 5IP9J 3QYEA 2CUZA 3PIPF 4OIQF 1A35A 2VL8A 4FQGA 3ZQHA 2E2JJ 4P55A 2Q1ZB 4CYCA 2EPFA 2KJBA 3CP8A 2BVLA 4MGRA 3Q0UA 4I98B 3DPTA 3TP0A 4FTHA 1VQ5I 3OYGA 4NBQA 5B3SH 1FLIA 2R7QA 3CCRI 3DP7A 4NUBA 2E34A 4WXHA 1SD5A 5E1XA 2LFBA 1OR7A 4IRGA 3GZNB 3OSGA 2Y48A 1V3FA 2LOOA 3HIFA 3NAUA 2E1CA 2E60A 3PFIA 1HA8A 2OU2A 2IS6A 2HZDA 2RN7A 4JK1X 4OAYA 3DF8A 4R1HA 1FPQA 3HSRA 3RSNA 1Z1DA 4PFPA 4ESFA 1ZARA 4L5JA 3BR6A 4Y33A 1QPIA 3ZPLA 1D5VA 2VKVA 3TBIA 4A3EJ 3DBHB 1ETWA 2VODA 4RGSA 2BZTA 3ZQQA 1NH3A 3H5RA 2OBPA 2NOJB 5HLHA 2EWNA 1BJAA 4KDPA 5CVVA 3IRRA 2CYYA 1JI8A 4KMFA 5FRNA 3WE3A 4MQ9F 1FOWA 3FXKA 1YG2A 1WI3A 3RYRA 5K7HA 1QZYA 1QVTA 1ZGAA 4XKBA 5KK1A 3GFIA 2JA2A 2WV1A 3SQNA 4CA0A 3DWLE 2X0LA 3L2QA 5GTHC 3WTTC 2VUMJ 1AKHA 2QSFX 4RB0A 3GW2A 1FP1D 2IA2A 1FIPA 5AIQA 2QCOA 1YS6A 1IXCA 3CCUI 2EV5A 2F5VA 1WJBA 1Z05A 4GRIA 5DUIA 1LVAA 2M4KA 4Y7NJ 1TW2A 3W3CA 1OYWA 4BH9A 3TKYA 5J3LA 1FOYA 2L7KA 2EFNA 4EJTA 4Y4RA 1P4WA 5FROA 4N9HA 2OQGA 2IS2A 1BBYA 4N4NB 3B6CA 1OCCH 3JTGA 1MZBA 1G8XA 4LK0F 5TGTA 2P7CB 3KE2A 3K4NA 4DQ2A 2BY0A 1Z67A 1RKTA 3MWMA 2XF5A 1DQUA 4NC6A 2VKEA 3EETA 1G6NA 3MCZA 1IXSB 3FISA 2BGCA 2X4HA 4P9FA 4DNCA 3CUQB 4BU2A 1WJFA 2V4JC 1SANA 2K9QA 2XB5A 1RRJA 2X6YA 1RESA 1O57A 1R1UA 4HW0A 4ESJA 1CF7A 3ZMDA 4B4CA 4YRVA 4CXFA 2O61A 4MLOA 1LJ9A 1IG7A 3VEPA 3B6AA 1A31A 4QPOA 2H8WA 4UHTA 3QRFF 1KQ0A 2R7TA 2E1OA 2DOEA 2CU7A 2L0KA 1ZYRF 1BOAA 4BXFA 2VXDA 3F22A 1G3WA 4QLCU 2FD5A 4BJ6C 4FCYA 5J1YA 4G7HF 3CC2I 3JREA 3HGYA 4I09A 1FIAA 2XHKA 5CJ9A 1R5GA 4EMSA 3RIRA 3ZMVA 5HODA 2BHYA 2LF8A 1D0ZA 4HNUA 1T8IA 3HUGB 4TV7A 3IHUA 5EGOA 1GHCA 4PJMA 2O8KA 2R7ZJ 3ABKH 2KDOA 4AYBA 5C3EJ 1XB4A 4V19K 3LMMA 4HNVA 1Y1WJ 3ONQA 1PUFA 2W85A 4OMYA 2CGPA 2BOLA 4A3LJ 3JRBA 2AXTC 4IQJA 1G2HA 3RPUA 3MKYB 2V26A 1P92A 3ABTA 1W36D 3CLQA 3PNTA 1XG1A 1S7OA 1UMQA 2HR3A 3A03A 3FDYA 2HVSA 2VJJA 2X1EA 2V1XA 1HXDA 1WI9A 1XN7A 5J1UA 1OCRH 2L54A 4IRHA 3WU2C 4C30A 2PMZN 5B1BH 5DEQA 2VQLA 1V5FA 3K1NA 5DCMA 2QGUA 3S93A 1SFXA 1U78A 1H9TA 4LG0B 3HTUA 1HKTA 3IP4B 3I4MJ 4M3EA 4MNUA 1TWAJ 3K4BA 4A6DA 5HNHA 4OIRF 2M5WA 3O8HA 1F43A 2JSPA 2QSHX 2O3FA 1A6IA 1YW7A 2AQEA 2IGOA 3FM3A 2DPDA 2OTLI 1Y8QB 2B0LA 3DEEA 4D7NA 3JRIA 2KMUA 5A2QZ 2HOEA 2JRMA 5HDNA 5JLWA 4BE0A 1VQNI 4HBLA 2QQBA 1YE9A 5C44J 3WTUC 5D8KB 1K7AA 5K5OA 2L02A 1WQ2A 3OYIA 5BMZA 4C3HJ 2COBA 2P5KA 2PN6A 2X85A 2H27A 1B72A 1MBJA 4OOIA 2PFBA 2OUMA 5E1WA 4BJ5C 1BI2A 1JKQC 4RLFA 3L1PA 4XNFA 2WV0A 4X0GA 2UXNA 4RA2A 4EQQA 3CCSI 2XV4S 2EZKA 3F8BA 3JCUC 1JXSA 2P5LC 1HQCA 2RVCA 1MH4A 2VBYA 1QNTA 1W4MA 1WJAA 2R3SA 5IT3A 3UR3C 3LQRA 3K4KA 5CVRA 4DGWB 5ICCA 3KEQA 4A3MJ 3HC7A 4KN7X 2ME0A 1WH7A 2XKOA 3QPLA 3LWFA 3EQLF 2NS0A 3G1LA 2AQFA 3RQIA 1WVRA 3OMYA 4M6XA 2V1DA 1RKWA 2DMQA 2ZO4A 1ZQ3P 3TDZC 4ENJA 3I59A 3PSIA 4DZPA 4U7BA 1ETYA 4FX0A 2PJRB 2ZKZA 2K9SA 3LSGA 3A01A 4E7JA 1N78A 3B73A 5HDGA 3RKWA 4KISA 3QPTA 2D1HA 4Y15A 4O6JA 2KRCA 3V7CA 5DDGA 1H0MA 4DYQA 1D8JA 3CJNA 1IXRC 2K3PA 1PP8F 5FJ8J 4ZYAA 2VE8A 4NQWA 1HW1A 4LLLA 1HCRA 3E6DA 3ZR8X 5C4JJ 3P9CA 1SVLA 4CZZA 4Y3OA 4XKWA 4GYGA 3OYNA 2R7XA 4XICA 3KEOA 4BEHB 2H6BA 5L3FA 3J7YJ 4CGZA 1O3QA 1N75A 3OYBA 5TRDA 1R58A 3M1EA 1LDDA 4BQOA 3QOPA 1AU7A 1AHDP 4A93J 2FBKA 2JA8J 3JRFA 1JUPA 2L7FP 2G7UA 3L2VA 2XAFA 2LP0A 1ZRFA 5DCMB 4UUSA 2K9NA 3HRMA 5JHUA 2L9SA 1R22A 4A5MA 4ZZDA 4CSWA 4B48A 2P4WA 4EV0A 5LRSA 1W36C 4AVZA 4M74A 1KYWA 2ZFUA 4HA8A 2HXOA 5H2FC 2L4AA 1S5LC 2MH9A 4XMYA 1YQAA 2K7LA 4IEJA 1CGPA 1IC8A 4HF2A 3HXLA 3WG9A 2M1BA 2E5NA 2GA1A 3EUHA 2OZUA 5IP7J 3SDGA 2FU4A 3CDLA 5LHHA 1BN5A 2Y0SN 3AG2H 3MQ0A 4PJNA 4BGDA 3IL2A 2ZJQF 2QA4I 2YUSA 3S14J 1M1EB 2HEOA 3BG7A 3E6CC 2KIUA 2HGCA 5EZHA 2EA2A 2GBYA 4O5VA 2HFHA 2MW8A 2DMPA 3F0CA 1S9HA 5A2QK 3EPZA 5LHIA 2AO9A 3MZYA 4E7LA 1QHGA 1QZEA 2VE9A 4G8XA 2ZSIB 2F5FA 3L2CA 4FE7A 5F6FA 3F3XA 3G1OA 3CLOA 2GOXB 3WTWC 3X2QH 4ZTFA 4MEXF 2XSJC 1CQTA 3SZGA 3MKLA 4BHPA 2A5YB 5ILVA 5HLGA 2JVGA 2K86A 3BG3A 3BTIA 4HAMA 2MSYA 2RQPA 3TDUC 2PG4A 2V79A 5J40A 3TO9A 3LSIA 3BPVA 1U9OA 1V5GA 1YX3A 2G7HA 4ZYHA 2I5UA 4IF4A 2AS5F 5GAHJ 4JX6A 1Y56A 3O2PE 2VQCA 5ILSA 2E19A 3JRDA 4I0AA 1APLC 1SFUA 2DFEA 4LFUA 4HOBA 2QEXI 1TNSA 3H3UA 4EGYA 1VFCA 5D5XB 5FLXZ 1TT0A 1F5TA 2KIQA 5CVJA 5L3BA 1FNNA 1IJWC 2IGMA 3QU6A 4I0BA 5HLTA 1V54H 3KP2A 2H1LA 2M34A 2M45A 4NB5A 1K79A 2ICWG 2BYVE 1MH3A 3V7RA 1DU0A 2WAQN 2HVRA 2MABA 1X1PA 4XBFA 1KYZA 3PNYA 1UFMA 2M7BA 2IW5A 4L9VA 2Q2EA 2I10A 2UXXA 4A0YA 1T33A 4J19A 3PIOF 2RGVA 3H0DA 1T0FA 3O3KA 3P7NA 5E79C 3KYDB 4EVIA 3OWTA 1K6YA 4BBSJ 5L3CA 3FBNB 4V2GA 2OTJI 3GMEA 4IOCF 2DA7A 1T38A 4RAZA 4UUSB 1TT5B 3KYCB 1UB9A 3BG6A 1AWCA 5DUKA 1E0EA 4LGWA 4UB8C 3B02A 4D1QA 4G7OF 3HSFA 1ON1A 3MVPA 1RNLA 1IUFA 1WKMA 1YITI 1HDDC 2CV1A 2STWA 2P8TA 4PUSA 3GCMA 1U5TC 2QUFA 1Z7UA 4DW6A 1B8IB 4XRSA 1RUOA 1R5ID 2X6XA 3L2RA 3K70D 2P7VB 2W82A 4L18B 2Z5UA 4WXCA 3ZQCA 4BJTA 4PJLA 5E3OA 3F21A 1XS9A 3MFKA 1IV8A 4RS8A 1J75A 2Z33A 3FM5A 1ETVA 5TISC 3RKXA 3K7AJ 1ZLJA 3N05A 3VWBA 1I6HJ 4FETA 1WH5A 1W7PA 3BTLA 2FQ4A 3U9GA 2XAQA 3CC4I 2EH3A 4HSRA 3V7SA 4BKXA 3IH4A 5HNFA 5E3LA 2JVHA 5BS6A 2LMDA 1SFOJ 1Y0NA 4CCOA 1LDKB 2IP2A 4FE4A 4MTDA 4CCMA 1HLVA 2K3FA 2E71A 4E6KG 2ZJRF 2VBXA 3DTIA 2QSGX 2XPUA 1YO5C 4Y17A 1YJWI 1E3PA 5KAFC 2TRTA 4G6TB 3LSRA 1IN6A 3I4NJ 2ZXWH 2JJ7A 4CCNA 1EJ9A 2HYFA 3R60A 3GTLJ 2HPIA 3OV8A 2FF4A 3M7GA 3A0HC 3I9V2 5DM7F 2DK8A 1ZK8A 1YJ9I 1OYYA 4ANJA 3LSHA 5IT9K 4ZDPA 5J1RA 1R36A 1XPXA 1Z77A 5F1RA 3EUKL 2Z1DA 2N8GA 4KYWA 1JTXA 3WTSC 3OYCA 3I3LA 3ZCOA 5HLIA 3GVAA 2H09A 2YU3A 4CHUA 4UVAA 1T08B 4KUMA 2R7VA 4G9YA 3CCEI 1GXQA 3J7AY 1ZR2A 3GTGJ 4IJAA 3TO7A 2QKMB 3DCFA 3GUDA 2GQQA 4IHXA 4YG2F 5H6RA 1U2WA 5DS9A 1RI7A 5BPIA 2RQQA 3M9AA 3RCOA 3LSJA 1U5TB 2VBWA 2ZNYA 2CQNA 2A5WA 1O3TA 3T5XA 2YR2A 2V6EA 3FIWA 2P81A 1BI1A 2L7MP 3FXRA 4G94A 1X1AA 1STZA 5LEJA 5D4SA 1GDTA 3HJEA 3N97A 4K2EA 2XGXA 5M5XJ 4A3JJ 1D8KA 3ASOH 1QZZA 4GGGA 4RM3A 3DEUA 1EA3A 3ZN1A 1TZLA 3D1NI 2LK2A 4GCVA 4BY7J 3S1RJ 2I8DA 2W48A 4XLHA 3WTYC 2DFHA 1O7LA 2V1UA 1ETXA 3BDDA 2X48A 2R92J 2IVMA 4GO1A 1VQPI 2AXLA 3V4GA 2RNJA 1PP7U 1ZLKA 4KN4X 4U0WA 1P2FA 4AIJA 3C2GA 2KLOA 3K2AA 3BY6A 5L3EA 3R61A 5TJJA 3BPXA 3V8LA 2VOOA 1FEXA 5B1AH 4XSZF 3ERED 3SZPA 1X19A 2HQAA 3LQQA 1J0RA 1P7JA 2M2EA 1IZ1A 1MD0A 2JA5J 5DTDA 2DCEA 4RGRA 4N0BA 4EM2A 1F4KA 2M3AA 1TQPA 2E2HJ 1TWFJ 3CCYA 2EFOA 4HPQA 2LYCA 3U1KA 2ZMEB 2XRLA 2DA5A 5K1YA 2JPBA 4LOCA 1YX5A 3CTAA 4YFNF 1DP3A 3CUQA 1QRYA 3PUFA 3BROA 4BQQA 5F1JA 3OIOA 4KT5C 1FBQA 3GTQJ 1MDMB 4EJUA 2Y0MA 1R71A 2Y30A 4FASD 3HSEA 3QOEA 4I01A 2JK3A 3OYLA 3PSFA 3H35A 5HOOA 3FXLA 3K4CA 1FX7A 2OD5A 4B3AA 5DV5A 1VQMI 5L3GA 1WZ2A 2MD5A 1D0XA 1MMGA 3HKZN 1OFCX 3PUBA 4A6EA 1YRNA 4LD5A 3I0TA 4LB5A 3KFWX 4IOAF 3GX4X 1ETOA 1UG2A 1UHMA 3I53A 1EF4A 2FNAA 1UCRA 4MFDA 3D5LA 3RTRA 3HUGA 2FBIA 3ZQ7A 5LRRA 1YIJI 1SEUA 3BR3A 2XRNA 1A6QA 3CMAI 2L01A 1I50J 3RYPA 1S7AA 3BQYA 2DA3A 3H5AA 4HF1A 3A2KA 3T8TA 2FXAA 3ZMZA 1ORKA 4G12A 5F04A 3MMYB 3TOBA 4L0YB 1LVKA 1OR7C 4M9ZA 1WGXA 3SFZA 2XAJA 3DTEA 4ZJZA 2Q8KA 1NHAA 2HDWA 3FXQA 3NQOA 2VXZA 2EFWA 4LG0A 3WTVC 1NK3P 3IWFA 5D6EA 2MG4A 1FMWA 2JMWA 3TEDA 2HOSA 3KP5A 1SVOA 4KIBA 4UV9A 1G3TA 4L0ZB 4CUGA 5J47A 1TW3A 2HTJA 2GOMA 4ITVA 1PVEA 1MIJA 4YIIA 2ZB9A 5M3MJ 2VOPA 5DM6F 3K1MA 3E0JB 2F6CA 4L5IA 4PSWA 2DT6A 1BC7C 4MFEA 3CJTB 1ZH5A 1S29A 3ZGKA 4EEFG 3OYJA 3CCJI 2M0MA 4HG2A 2O6GE 2V7FA 2B63J 1R6RA 4IXAA 4XLAA 2LSOA 4BACA 4PGGA 3NWSA 1ON2A 4JQFA 2HU9A 2WA0A 2LD5A 1MNEA 4C3IJ 1X58A 4LIUA 2DOAA 3JW4A 1BC8C 1IF1A 5K5QA 1VI0A 3TGNA 1FTZA 3E5UA 4UUTA 3HG9A 1JT0A 2E7WA 1ZRCA 4U88A 1LDJA 2IT0A 3HDDA 5JHFA 1BR1A 2W57A 4E7HA 1NTCA 2EA4A 3QWLA 3CCVI 2EZLA 5BPDA 1X3ZB 2DO7A 1UHWA 2WTEA 1JGGA 2OQRA 2DMNA 4EM1A 1LE8B 4DBRA 3N4MA 4PCQA 3W2WA 5LLQA 1SMYF 5ICEA 5J6XA 2Z16A 5EDNA 1SD7A 3MZ8A 1H88C 1WJEA 3GEZA 1ONVA 3KZZA 2JUGA 3WGHA 5JVGF 1ZAOA 3S1NJ 3BR1A 4KT6A 2EV0A 2MH2A 3ZQIA 1RR8C 1KQ9A 1POGA 2MLGA 2PJRA 3T8RA 3G1MA 3AG1H 1ETKA 3BT9A 1YRNB 5CVIA 2RC4A 2DYSH 2IRFG 3GTOJ 1VQKI 3OIQA 4BNCA 4LLGF 3ISPA 1U0JA 2LBFB 3ZOBA 3EDPA 2HTSA 4ESBA 2PI0A 4MIMA 4BUPA 1IN8A 2IEKA 4AVPA 2FRHA 4E7KA 3BZCA 3W6KB 2UUZA 1MSEC 4ENKA 3MKWB 3Q9VA 1EKEA 4AIKA 3RKQA 3H0GJ 4RAFA 4Y52J 1QPMA 3C1DA 5F64A 3L2UA 4A5NA 3F23A 4ZC3A 4N9IA 3FHZA 4BEHA 2ZCWA 1VQLI 2DDBA 1YS7A 2BY2A 1BL0A 1I27A 2XB0X 4S05A 2LKSA 3CMMA 3Q9SA 5FRMA 4C2MJ 4F52A 5IP6A 2E1MC 2Q0OA 1FYMA 1QBJA 1S8NA 3BP8A 2F5CA 2W25A 4S0HB 3HGGA 1N77A 3OL4A 4C9YA 1UG0A 4OAZA 4AM3A 2R5YB 2QQ8A 3I54A 2XGCA 3E7LA 3BWGA 3WHCA 3BR0A 2COMA 3J7ZI 4A2UA 1MGTA 2J5PA 3A02A 3W2VA 1H89C 2K5CA 2CO5A 2STTA 1S72I 2OV7A 5H6QA 5FKLA 3IC7A 3T1BA 1YI2I 3GF2A 2HOAA 3GTKJ 3S15J 3C18A 1AA7A 4MTEA 3SEZA 1XSDA 4JP0A 2DFFA 2VONA 2V6CA 4NNJA 3VFZA 5J4YA 2FMYA 3DKXA 2R0QC 4EATA 4IHSA 5LGUA 3EYYA 4G6DA 1R49A 1X3WB 4CCKA 4YIFA 3AL0C 5ED4A 4XN3A 5LFAA 5FB2A 5ICFA 2A6HF 3AFHA 3LA7A 1GT0C 3H36A 2HI3A 2Y69H 1O3SA 1JKRC 1MMDA 4H0EA 3Q0VA 4XLNF 2DMTA 2X6WA 2IXSA 2LH9A 4P96A 4UY8I 1O7FA 3M07A 5KNLA 1IRZA 4KJZA 1I39A 2W7NA 2BHZA 1IRFA 2Z99A 3C2HA 4RAYA 2HDDA 3V42A 4MHGA 5GAEJ 4KMUX 2DXIA 4HLXA 1S3JA 1TTYA 4DZJA 2FQ3A 2QVOA 3L09A 1HDPA 3G3ZA 2OF7A 4XQFA 4EM0B 5BNGA 4FT8A 4FX4A 1BM9A 3K4LA 3U21A 2CUEA 1LFPA 3E5QA 3EUAA 2G0EA 5IPAA 2CV2A 5GADJ 3DXJF 4YFXF 1YW9A 2VKHA 2DW4A 4IHVA 2O9LA 2NYXA 4PZJA 4XKCA 2JT1A 1A04A 2O5RA 4ASNA 1D0YA 3DU6A 3ZN0A 2IS4A 2XAUA 3WGGA 3TOAA 3CJRB 2R7OA 2DBBA 1VQ6I 3HOUJ 2ELKA 3OL3A 2ZXIA 4A3CJ 2WC2A 2A3SA 1K61A 4Q5SF 1HW2A 2Y9YA 3T0YA 4HLYA 1WCMJ 1Z3YA 2TCTA 1Z91A 3K10A 4XL9A 4RLQA 1MMNA 3GFMA 5LBQA 1RETA 1IO2A 1W5SA 2KRFA 3TO6A 1LB2A 1Y6IA 3CUOA 4PGHA 2UWMA 3JSPA 4AIHA 3REOA 3RPQA 3ECHA 2Z2SB 4C3JJ 2EIMH 2IA1A 5K5RA 2KHMA 3RI4A 3KLNA 5E8IA 2KQRA 3M8JA 2ETHA 3R0AA 4BXXJ 3GLLA 3QPHA 4OIOF 1DU6A 1B8IA 1DGWY 4I2OA 4IZZA 1I3AA 4B47A 3IKTA 1EH8A 3MEXA 1XMKA 3P9KA 4C2UA 2HYJA 2LDUA 5DD8A 4P5OA 4P9UA 1FTTA 1YTYA 2RKHA 2VJIA 3WTXC 3SJMA 4IRIA 1FP2A 4XRFA 1T2KA 3KP7A 2LG4A 5HVQC 1YW8A 2R4GA 4KA4A 2ZXHA 2WB1N 3ABLH 2A05A 2K9LA 3HOVJ 2PLYA 3HBLA 5HS9A 1LUJB 1R7JA 2LF7A 3S8PA 3IKVA 2LY9A 5E20A 3NWTA 2E5ZA 2HNHA 4HEA2 1RC9A 4QSHA 3I58A 4M73A 3WTZA 2PMZA 5IYDJ 3OIPA 2VT2A 3EUHC 2M7AA 4CCJA 2VKDA 3CO7C 3C2BA 2ELJA 3NRVA 1FT9A 5EZGA 3HOTA 1IUYA 2XASA 5BOXA 4EJVA 1LKXA 1MJ9A 1LEBA 1TQIA 2XIGA 2IPQX 4E7IA 1X1BA 3C7JA 1O3RA 1U9NA 2D1VA 4JOMA 3UNGC 3M8FA 4KIGA 1LEAA 1P7IA 2CW0F 2QQ9A 1SAXA 4A3DJ 1WFXA 1BJZA 5JI6A 5FD6A 1PUEE 4QWQA 3PJRA 3DKYA 2GXBA 5E3NA 3ROUA 2FOKA 1ODDA 3P9IA 3ESWB 3BJOA 4RB2C 3KIOA 2XPWA 2F4IA 2IGKA 3JTHA 1OISA 3IH2A 3DKWA 3QAHA 1IN5A 3FXOA 1YOVB 2XVCA 1I5ZA 3ZP5A 2MYSA 4BE1A 3HZJA 4RMNA 3AAFA 4X6AJ 4RGUA 2K4JA 4FISA 2ISZA 1G3YA 2GIVA 1U5TA 3O8GA 5FO5A 1E3HA 2GLOA 2DDAA 5IOYA 1FC3A 1T56A 2MC4A 2KRHA 1C0WA 2NVTJ 4XORA 1SD6A 1Z21A 2FMLA 1X3UA 2R5ZB 2VB6A 3S17J 1LPQA 4EGZA 1QO0D 4G7ZF 1UZCA 2HQRA 3W6JB 1ITYA 1VNDA 4MQVA 5JLXA 2DPUA 4KICA 1X2MA 2RNGA 1XDSA 1R9TJ 1K78B 1Z3XA 3BQZA 4E7SA 2FBHA 2XF6A 1T0FC 4M6VA 3NARA 1OPCA 1SD4A 3LSPA 3QP5A 2K4BA 4ZH4F 1OCOH 1VZ0A 2DT5A 2ACJA 3GO5A 1GV5A 3F8MA 3I55I 4LLNA 1GVJA 3GFJA 2X1DA 3JSOA 4P1WA 4HQMA 4I6ZA 5GTIC 1V55H 3K2ZA 2LVSA 4A0ZA 1OQYA 4CH7A 2W4SA 2KIMA 2XAHA 1ULYA 3WE2A 2UV1A 1FY7A 3CCQI 3FMRA 1KGSA 3OOPA 1ZTRA 1Z0XA 2ZMEA 3P5JA 3S3OA 2CSOA 1T98A 1FJLA 1UAAA 3AG4H 1K83J 3MKZA 3R6SA 3CDHA 2LY2A 2XDVA 3BR5A 3SYTA 3ERMA 1FYKA 3DFGA 2HPMA 3ZMTA 1MDMA 2HDCA 3GTMJ 1Z9CA 5E8GA 2CQXA 4HV5A 1YLFA 5ICGA 2F5DA 4U7DA 2OJED 2MLKA 3KZYA 2EBIA 4ENMA 2KISA 5FKNA 3A0BC 1IN7A 3ECOA 4I7HA 2M9HA 2OPTA 3S2HJ 2TDXA 2L5QA 2Y0SA 1ZN2A 2X1CA 3FX3A 3IAM2 5HS8A 1XDUA 4GDFA 4XSXF 1NK2P 2ZC2A 5FLXK 2J5OA 4HV6A 5LGTA 1LFBA 1W5CC 5DD4A 3HOSA 2WB1A 3CP2A 3S2WA 1WRJA 1E3OC 1FWZA 3K0LA 4AWXB 1T95A 5CPRB 2DI3A 2X51A 3VODA 4IL6C 5KAIC 1LFUP 1JE8A 5JFRA 2L2OA 1KU2A 2DA4A 2BXYA 1FOXA 2FX0A 2VBZA 1MBKA 2PQ8A 2QF7A 3DBRB 4NDLA 1K4SA 3DPLC 4M3GA 3L7WA 5B5EC 3KZIC 5H20A 5LGNA 3SXYA 2KKOA 1BIAA 3QYBA 2R7WA 1FMVA 4B8XA 4F93B 1XD7A 2BY3A 5IOZA 2GA2A 5DCFA 3GLXA 2XPVA 2R7FA 2QQAA 1RUNA 2V9KA 3Q0WA 4CZCA 2CRGA 4X1EA 1ACIA 1FOKA 3PNVA 1VQ9I 2DT7B 2FA5A 3J81Z 4YFKF 2BEOA 1ZREA 1HSJA 1JTYA 3H1CA 2ME6A 2DODA 2QLZA 3HRTA 3HEFA 1FZPB 2WAQA 3E3VA 4NC8A 3KP6A 1GXPA 2F48A 2K40A 1SC7A 3LOCA 4U0YA 1IN4A 2DAOA 2XROA 1J9IA 1KQ8A 2F2EA 1OCPA 2C6YA 4F3QA 1Q1HA 1QVUA 4BHBA 1UHSA 3TW7A 4OMZA 3E97A 3I56I 2W24A 1MBHA 4DJAA 2NVUB 1JUMA 1W1WE 1B59A 2E1NA 3OYEA 1JKOC 4XLPF 2EINH 2JN6A 3BOQA 1L3LA 1G59A 1Y0UA 1JT6A 3RZDJ 3F8CA 3ASNH 3ZMSA 1XSXA 2JPCA 3RJPA 1RIOH 3E6MA 4WWCA 4A3IJ 2JQ7A 3CCLI 2Y31A 3QQAA 4D7MA 1LE8A 2BW3B 5FLMJ 3FXUA 4AYBN 4A3KJ 2HQ5A 5LD2C 5KVRA 3VYRB 3PO3J 2DOFA 4A0XA 1SFEA 3QYFA 2W00A 2D5VA 3R4KA 4B3XA 1QHHD 5KCMA 2CW8A 2ESNA 1N25A 5D5UB 4E4HA 4WX9A 2LY1A 1WJ5A 3CMEI 1JHHA 3H9GA 1U8BA 2HOTA 3GWZA 2XUBA 2CUFA 1R4NB 3JRHA 3L2WA 3PQJA 1R23A 1OCTC 2ECCA 3S1QJ 3EYIA 3GXOA 3OS0A 4W1UA 3ZMUA 1J7KA 2LBFA 1SFKA 3GFLA 4CICA 2Y9ZA 1DP7P 3DU5A 2UZKA 1OCZH 1T39A 3HYIA 3VYTB 3HM5A 3OOUA 3S3MA 1RZ4A 1WWXA 4RM2A 3CUQC 4B1RA 3VYSB 2GZWA 3OYFA 3U2RA 1ENHA 3BG9A 3FF5A 1KONA 4J01A 1B9NA 4ZDLA 4B43A 2M0CA 4B44A 4LB6B 3ZQLA 1SVMA 1Q1VA 4D5CA 3M3YJ 2DA6A 2JWTA 3C3WA 2XAGA 3M1CA 1J09A 2XGEA 5IYBJ 4BBRJ 4UNOA 1HC8A 1IRGA 3LFUA 1LNWA 5AONA 4DYRA 3HB9A 3RPUD 2MA3A 3OS2A 3NEUA 1V4RA 4L5EA 1KZHA 2R7DA 4EJOA 1JUSA 5K7FA 3H3ZA 5AIPA 3QPSA 4YIRX 2VC1A 2R5YA 4HYEA 2QM3A 4XLEA 1ZKGA 1H8AC 5IYCJ 1QU3A 1X1DA 4ZYGA 4GXOA 3M8EA 2EB7A 2YX7A 3SZTA 3VB2A 3E1SA 3R0JA 1I6XA 1XTAA 1ZELA 3AKZA 2VC0A 1TWCJ 1ZHFA 4A69C 4BY1J 3ML6A 3JRCA 2B9SA 2HKOA 3ELKA 3K1PA 3WHBA 2ZNZA 4QIWN 1KU7A 4A3GJ 5IY5H 1MMAA 3J81K 1IW7F 2CQ7A 5D5VB 3FKJA 3FHNA 1JJ8C 3FKIJ 3GTJJ 2D2WA 4UV8A 4DOZA 4IHTA 4HQEA 2FNPA 6PAXA 5F0CA 5ILUA 3TMOA 1F1ZA 3BTJA 2QBYA 4QTRA 2MD0A 4IX7A 2JA7J 1D1AA 4HZFA 3ZRGA 1ZGWA 2Z3YA 2H1KA 4AC0A 1KA8A 4RGXA 4CYDA 1XGOA 1MJBA 2JUCA 2FE3A 2XC7A 1AOYA 1XC5A 1VTNC 4Z6YA 4CO8A 1ZG1A 2O7OA 2LLKA 4ETSA 2DA1A 4Q48A 5CKTA 2M8GX 3VSLA 3LSKA 2KZGA 4BDZA 2FOWA 5J8CA 1E17A 3HL2A 1WJDA 1BR2A 2PMUA 2EFPA 4CYCB 3QP6A 2OCEA 3KP4A 4I99C 4QPQA 1ETQA 3S2DJ 2KZVA 5CLSA 3IAS2 3L9FA 2CH0A 4BDYA 1H9GA 1DGRM 2XSDC 2R7SA 5EG0A 3OYDA 3TQNA 2OC6A 2A61A 3G71I 2A69F 3W6VA 4HRIA 2GXGA 1VQ4I 5BQTA 3I64A 2EIKH 2FEZA 3ZQFA 2WWYA 3OY9A 2DU9A 3TL4X 4LJZF 3WODF 4IVNA 5FKMA 2R93J 4OINF 4RB3C 1P4AA 4V2FA 3HTSB 5B66C 4ZYEA 2VN2A 4M3FA 2ZSHB 3S32A 3PL8A 1MBFA 3I71A 3VYUB 1U8RA 2D45A 4W97A 3FWEA 1XX5A 2H8RA 2QWWA 4U87A 4DYCA 3IV5A 1VQOI 2EJRA 4IPAA 4RBOA 3BG5A 1MJAA 1OLTA 3WG7H 1GV2A 2RREA 1L0OC 4UXNA 4UUVA 3IWZA 1RR7A 4BQNA 1U3EM 1MNMC 1R5HA 2L9RA 4Q4ZF 2ECBA 1MBEA 4OWRB 2KDZA 2QENA 3KPHA 1TNTA 1K6OA 1X4PA 4M9XA 1T6SA 1WJCA 2BXZA 3HKZA 2M8EA 2OCCH 2P6SA 3LSMA 3KYLA 2GXAA 2P6TA 4JYKA 2E35A 5GPCA 1A5JA 1E2XA 1J59A 1AKHB 3HHHA 3U1DA 1UJ8A 3GBGA 1HBXG 5FLVA 3DLLF 3F6VA 3RZOJ 4CDGA 4M6YA 3LA3A 4EJWA 4HNTA 3CESA 3VOEA 4M71A 1I3QJ 2ZJ2A 4PJJA 2ZBKA 2IAIA 5GAGJ 4R8HA 1D1CA 1B1BA 4PDKA 1YFHA 1V5EA 1HW5A 2DTZA 2P0WA 3K69A 2DQRA 4HSTA 3RQ4A 4F7ZA 2VIXA 1QGPA 3MN2A 2L9VA 2QBYB 1BA5A 4MEYF 4ZYDA 3J7AO 2A68F 3CCMI 1S6LA 4KITB 3PFYA 2PBIA 4JBAA 4O3MA 2HYGD 3HOZJ 1XMXA 2NAZA 4AD9A 2E7XA 1OJLA 3E5XA 4AU7A 2DYRH 3DBLB 4LMYA 4UB6C 3SFIA 4BXUA 5E18F 1FBSA 4A12A 1XMAA 2NS7A 4D9JA 2KT0A 1ZG3A 3K6GA 1GUUA 4HX8A 4PFOA 5CQGA 3LFKA 1GVDA 1FYLA 4YELA 3J80Z 4RAGA 3Q5FA 1YYVA 1OMIA 5FFZA 2B7EA 2G9WA 5L3DA 2Y2ZA 2M87A 4IHYA 1A36A 3F9KA 1IDZA 2PX9A 5FFXA 2DTRA 1CF7B 1JHFA 3AG3H 2IGNA 2RDPA 3E6BA 1K4TA 3DTKA 5EG0B 3CF2A 4ZDOA 3GYHX 4PJ0C 1HF0A 2KFDA 5JR3A 1HSTA 1X4OA 3FXMA 1DPUA 1IRXA 2E1MB 1QA6A 3LSTA 2ADUA 1B9MA 4UVBA 3CC7I 2XF7A 2EZHA 4B09A 4GYIA 2VI6A 3CDIA 4YEJA 3GTPJ 4AUXA 5FKOA 3CMYA 3MAJA 2CFOA 2V9VA 2ZFWA 3CD6I 3IUOA 2VPLA 2ID6A 3IH3A 1P6RA 3BR2A 3HRUA 2JRTA 4XM3A 4IQ4A 5DYMA 5K7ZA 1G3SA 1EV7A 3H9JA 1EH6A 1JGSA 3G2BA 5EGOB 5GPAA 4U0VA 1MKMA 1NG7A 1Z6RA 5EEGA 1PUFB 1PJRA 4XK4A 3M4OJ 1EH7A 3KP3A 5LEKA 4XRSG 2EQRA 2VQHA 4A3BJ 4XRMA 2HS5A 5D8LB 3BZKA 3OR1C 2R5ZA 3LAPA 1IAWA 3D0SA 2E2IJ 2HVQA 2L9NA 3BCBA 1D5YA 3K9TA 2NOGA 3PQKA 2NNYA 3ZXSA 1TL8A 1XCBA 4Z2YA 1XGSA 5M5YJ 3BLYA 5M5WJ 2V1NA 1K78A 4I02A 4BAYA 3SDBA 3A4CA 4BE2A 1ZRDA 2YS9A 3AL0B 5EJCA 1IGNA 1P9QC 4RB1A 4KNYA 3D5SC 5E1ZB 3OR2C 4LG3A 3RDIA 4C2TA 2WY8Q 4M9SA 2EFQA 3BC8A 4XR6A 3OS1A 1BR4A 1VQ7I 2GAUA 2JA6J 1W5TA 3BJ6A 3PO2J 1G4DA 2PMHA 3KEYA 1BOBA 1Z6TA 2LKPA 4F91B 1D1BA 3DV8A 3FZVA 2ZXJA 3O6BB 3HOYJ 1ZGJA 4M3BA 2IS1A 2A07F 1U6GA 2L4MA 1W7PD 1R00A 2CS3A 5LHGA 3KLOA 5ERIA 1B72B 1OKRA 4KIFA 2FJ1A 5J4VA 4LITA 5GP9A 4IHWA 3BJAA 1PYVA 2CQKA 2QYOA 2QKLB 3LL7A 4HDUA 2EIJH 2P5VA 1I1SA 3K4MA 3DEWA 1ZR4A 2F4OB 2W84A 1BW6A 2DJIA 1X1CA 1TLHB 2CUJA 2DK5A 2EILH 3KX2A 3H3VK 2MGQA 1KU9A 2RAEA 3K4JA 1Y1VJ 4E70A 4DBQA 4D5FA 1WHUA 4ZZLA 3ULQB 1YHQI 2O8XA 2OAZA 2WY7Q 4BHCA 1TC3C 2XKPA 3SHFA 4N4OB 4AIDA 1MMSA 5IT9Z 1DPRA 2CFXA 5J8FA 2EK5A 4HX4A 1BI3A 5CVUA 3CZ6A 4RDUA 1MNDA 3WU1B 2NRAC 4DIQA 3J80K 3CJQB 4UVCA 5E3MA 4HX7A 2CV0A 4OIPF 3JAMZ 1DUXC 3I59B 4L9JA 4H4KC 2NVXJ 4M72A 1F36A 2NXNB 3A01B 2K02A 1WPKA 2KJCA 2X6OA 2M4GA 2DFIA 3JRGA 4L9TA 5F08A 2F5EA 2NVYJ 4F92B 3DLAA 4LIVA 5FD5A 3OYKA 5F27A 4NQWB 1R4MB 4BQAA 1TP4A 3H92A 3HPHA 2CG4A 4XOPA 1REPC 3OSFA 1O4XA 4D0PA 1SAUA 3KETA 4IKFA 2NVQJ 4Q47A 3OYMA 2Z9OA 2JTVA 2X9DA 3G6EI 2LKXA 2H6CA 2KIFA 1IDYA 2CWEA 1ERDA 3CQZJ 2DN0A 3Q3SA 1D3YA 1SMTA 5FGMA 1XGMA 2FSWA 4XLFA 4IO9F 1XCVA 3WU0A 4WXDA 2OZ6A 1R1TA 2KPMA 1FBUA 1S7EA 1Y39A 1JKPC 3I5UA 1TWGJ 3S1MJ 3MD2A 3GZ5A 1UELB 1J5YA 5KHDA 1PDNC 2VLAA 2K27A 4L9NA 5EEAA 5M3FJ 4E7ZA 2HWVA 1MBGA 2O0YA 2GWRA 2K9MA 3SEQA 1DDNA 2LREA 4F55A 1YJNI 2VQGA 4HDVA 3CF5F 2H94A 1TBXA 2HXIA 1GLNA 2VT3A 4GFBA 2JSCA 1MSFC 2MC3A 3F6OA 2KP6A 2O03A 5D5WB 2YSRA 3DQVC 2GIZA 4II3A 1XSVA 3ZQGA 1NG6A 5EYRA 2VJ5A 3VSKA
chains in the Genus database with same CATH topology
2IJLA 3F8NA 4G6QA 3V8KA 1FSHA 1WSUA 2PJPA 1P4XA 3HHGA 1KU3A 4OU0A 2YX4A 4KFCA 4ENNA 5EEHA 4NHJA 1TQMA 1F9NA 4BYYA 4S04A 1LQ1A 5D6FA 1HKQA 1HKSA 2NNNA 2MBFA 2PEXA 2QZ8A 2L3DA 1B6AA 1BIBA 3I4PA 2A6EF 3RKYA 1FSEA 2ESHA 4WK8F 2EV6A 3F8FA 1USTA 3WGIA 3G73A 3JAMK 3HRSA 1R1VA 1USSA 3LA2A 4LK1F 3FMSA 2ISYA 3FMQA 4R79A 2HQNA 2BE5F 1I1GA 1QQIA 2Y75A 2BBYA 3L00A 2ELHA 5JVTA 1BI0A 4ON0A 3V8JA 2OA4A 4Y13A 2M30A 1OYIA 2IA0A 3LAJA 5HS7A 1ZG5A 2RV8A 3KCCA 2HKXA 4WF2A 3IRQA 4WCGA 1YIOA 2DQLA 2HZTA 1B4AA 2DLLA 4FHTA 3CO6C 4HF0A 3COAC 1XGNA 5CYVA 2YPRA 3MZHA 3ABUA 2BV6A 5D4RA 1W7PB 3F72A 3BZ6A 3GZ6A 2JZYA 5E17F 5HDKA 3QU3A 2LNBA 1J2XA 4OIQF 4P55A 2KJBA 4MGRA 4I98B 3DPTA 1FLIA 3DP7A 4WXHA 1SD5A 5E1XA 1OR7A 4IRGA 2Y48A 1V3FA 3HIFA 2E1CA 3PFIA 2OU2A 2RN7A 4JK1X 3DF8A 4R1HA 1FPQA 3HSRA 1Z1DA 4ESFA 1ZARA 4L5JA 3ZPLA 1D5VA 2VODA 4RGSA 2OBPA 5HLHA 2EWNA 1BJAA 4KDPA 5CVVA 3IRRA 2CYYA 4KMFA 3WE3A 4MQ9F 1YG2A 3RYRA 1QZYA 1ZGAA 5KK1A 3GFIA 3SQNA 2X0LA 3WTTC 4RB0A 3GW2A 1FP1D 2IA2A 5AIQA 1YS6A 1IXCA 2EV5A 1Z05A 5DUIA 1LVAA 1TW2A 1OYWA 4BH9A 3TKYA 2EFNA 4EJTA 1P4WA 4N9HA 2OQGA 1BBYA 3JTGA 1MZBA 4LK0F 2P7CB 3KE2A 4DQ2A 3MWMA 3EETA 1G6NA 3MCZA 1IXSB 2BGCA 2X4HA 4P9FA 4DNCA 3CUQB 1O57A 1R1UA 4HW0A 4ESJA 1CF7A 3ZMDA 4CXFA 2O61A 1LJ9A 3VEPA 4UHTA 3QRFF 1KQ0A 1ZYRF 1BOAA 3F22A 1G3WA 4QLCU 4G7HF 4I09A 2XHKA 5CJ9A 1R5GA 4EMSA 3RIRA 3ZMVA 2LF8A 4TV7A 3IHUA 1GHCA 1XB4A 2W85A 4OMYA 2CGPA 3RPUA 1P92A 3ABTA 1S7OA 2HR3A 2V1XA 1HXDA 1WI9A 1XN7A 2L54A 4IRHA 5DEQA 1U78A 5DCMA 3K1NA 1SFXA 1H9TA 4LG0B 3HTUA 1HKTA 4MNUA 4A6DA 4OIRF 2M5WA 2O3FA 1YW7A 3FM3A 2DPDA 2B0LA 5A2QZ 2HOEA 5HDNA 4HBLA 2QQBA 3WTUC 5D8KB 1K7AA 5K5OA 2L02A 1WQ2A 5BMZA 2P5KA 2PN6A 2H27A 4OOIA 2PFBA 5E1WA 1BI2A 2WV0A 2UXNA 4EQQA 2XV4S 3F8BA 1JXSA 2P5LC 1HQCA 2RVCA 2VBYA 1QNTA 1W4MA 2R3SA 5IT3A 3LQRA 5CVRA 5ICCA 3KEQA 4KN7X 2XKOA 3LWFA 3EQLF 2NS0A 4M6XA 2V1DA 2ZO4A 3TDZC 4ENJA 3I59A 4U7BA 4FX0A 2ZKZA 3B73A 5HDGA 3RKWA 3QPTA 2D1HA 4Y15A 4O6JA 3V7CA 5DDGA 1H0MA 1D8JA 3CJNA 1IXRC 1PP8F 2VE8A 4NQWA 1HW1A 4LLLA 3E6DA 3P9CA 4CZZA 4GYGA 3KEOA 2H6BA 5L3FA 4CGZA 1O3QA 5TRDA 1R58A 3M1EA 1LDDA 3QOPA 2FBKA 2G7UA 2XAFA 1ZRFA 5DCMB 3HRMA 5JHUA 1R22A 4ZZDA 4A5MA 2P4WA 4EV0A 5LRSA 4M74A 1KYWA 4HA8A 2L4AA 2MH9A 1YQAA 2K7LA 1CGPA 4HF2A 3WG9A 2M1BA 2GA1A 3EUHA 2OZUA 2FU4A 5LHHA 1BN5A 3MQ0A 3IL2A 2HEOA 3E6CC 2KIUA 2HGCA 2EA2A 4O5VA 2HFHA 5A2QK 5LHIA 3MZYA 2VE9A 4G8XA 3L2CA 2F5FA 5F6FA 3F3XA 3CLOA 3WTWC 4MEXF 4BHPA 2A5YB 5ILVA 5HLGA 2K86A 4HAMA 2RQPA 3TDUC 2PG4A 2V79A 3TO9A 3BPVA 2G7HA 4ZYHA 4IF4A 2AS5F 3O2PE 5ILSA 4I0AA 1SFUA 4LFUA 4HOBA 1TNSA 3H3UA 4EGYA 5D5XB 5FLXZ 1F5TA 5L3BA 5CVJA 1FNNA 3QU6A 4I0BA 3KP2A 2M45A 4NB5A 1K79A 2BYVE 3V7RA 4XBFA 1KYZA 1UFMA 2IW5A 4L9VA 2Q2EA 2UXXA 4A0YA 2RGVA 1T0FA 3O3KA 3P7NA 4EVIA 5L3CA 1T38A 4RAZA 1UB9A 1AWCA 5DUKA 4LGWA 3B02A 4G7OF 3HSFA 1ON1A 1RNLA 1WKMA 2STWA 2P8TA 1U5TC 2QUFA 1Z7UA 1RUOA 2P7VB 4L18B 2Z5UA 4WXCA 3F21A 3MFKA 4RS8A 1J75A 2Z33A 3FM5A 3RKXA 1ZLJA 1W7PA 3U9GA 2XAQA 3V7SA 5BS6A 1LDKB 2IP2A 4MTDA 2VBXA 1YO5C 4Y17A 1IN6A 2HYFA 3R60A 3OV8A 2FF4A 3M7GA 2DK8A 1OYYA 5IT9K 1R36A 5F1RA 4KYWA 3WTSC 5HLIA 3GVAA 2H09A 2YU3A 4CHUA 4UVAA 4KUMA 4G9YA 1GXQA 4IJAA 3TO7A 3GUDA 2GQQA 4YG2F 5H6RA 1U2WA 1RI7A 5BPIA 3M9AA 1U5TB 2VBWA 2ZNYA 1O3TA 3T5XA 2YR2A 1BI1A 3FXRA 4G94A 1STZA 5LEJA 5D4SA 3N97A 4K2EA 2XGXA 1D8KA 1QZZA 4GGGA 3DEUA 3ZN1A 4GCVA 3WTYC 1O7LA 2V1UA 3BDDA 2IVMA 4GO1A 2AXLA 3V4GA 2RNJA 1PP7U 1ZLKA 4KN4X 4U0WA 1P2FA 4AIJA 5L3EA 3BY6A 3V8LA 3R61A 3BPXA 5TJJA 2VOOA 4XSZF 3ERED 3SZPA 3LQQA 1J0RA 1IZ1A 1MD0A 4RGRA 4N0BA 4EM2A 1F4KA 1TQPA 2EFOA 2ZMEB 5K1YA 2JPBA 3CTAA 4YFNF 3CUQA 3BROA 4KT5C 1FBQA 1MDMB 4EJUA 2Y0MA 3HSEA 4I01A 5HOOA 1FX7A 2OD5A 5DV5A 5L3GA 2MD5A 4A6EA 4LD5A 3I0TA 4LB5A 3KFWX 3GX4X 1UHMA 3I53A 2FNAA 1UCRA 3D5LA 3RTRA 3HUGA 2FBIA 3ZQ7A 5LRRA 2XRNA 2L01A 3RYPA 1S7AA 4HF1A 3T8TA 2FXAA 3ZMZA 3TOBA 4L0YB 4M9ZA 3SFZA 2XAJA 2Q8KA 1NHAA 3FXQA 3NQOA 2VXZA 2EFWA 4LG0A 3WTVC 3IWFA 5D6EA 3KP5A 4KIBA 4UV9A 1G3TA 4L0ZB 1TW3A 2HTJA 4YIIA 2VOPA 3K1MA 4L5IA 1BC7C 1ZH5A 1S29A 2O6GE 4IXAA 2LSOA 4PGGA 1ON2A 4JQFA 3JW4A 1BC8C 1IF1A 5K5QA 3TGNA 3E5UA 2E7WA 1ZRCA 4U88A 1LDJA 2IT0A 2W57A 2EA4A 5BPDA 2DO7A 1UHWA 2WTEA 2OQRA 4EM1A 3N4MA 4PCQA 5LLQA 1SMYF 5ICEA 5J6XA 1SD7A 3GEZA 1ONVA 3KZZA 3WGHA 1ZAOA 2EV0A 2MH2A 1KQ9A 2MLGA 3T8RA 5CVIA 2RC4A 2IRFG 4BNCA 4LLGF 3ISPA 3EDPA 2HTSA 4ESBA 2PI0A 1IN8A 4AVPA 2FRHA 3W6KB 4ENKA 4AIKA 3Q9VA 1QPMA 3C1DA 5F64A 4A5NA 3F23A 4N9IA 3FHZA 2ZCWA 1YS7A 1I27A 4S05A 3Q9SA 2Q0OA 1FYMA 1QBJA 1S8NA 3BP8A 2F5CA 2W25A 3I54A 3BWGA 2COMA 4A2UA 1MGTA 2J5PA 2CO5A 2STTA 5H6QA 3IC7A 3T1BA 3GF2A 3C18A 4MTEA 1XSDA 2VONA 2V6CA 3VFZA 2FMYA 4IHSA 5LGUA 3EYYA 4G6DA 4YIFA 5ED4A 5FB2A 5ICFA 2A6HF 3LA7A 1O3SA 4H0EA 4XLNF 4P96A 1O7FA 1IRFA 2Z99A 4RAYA 4MHGA 4KMUX 4HLXA 1S3JA 1TTYA 2FQ3A 2QVOA 3L09A 3G3ZA 4EM0B 4FT8A 4FX4A 1BM9A 3E5QA 3DXJF 4YFXF 1YW9A 2DW4A 2NYXA 4PZJA 2JT1A 1A04A 4ASNA 3ZN0A 3WGGA 3TOAA 2DBBA 2WC2A 2A3SA 4Q5SF 1HW2A 3T0YA 4HLYA 1Z91A 5LBQA 3GFMA 1W5SA 2KRFA 3TO6A 1LB2A 4PGHA 3CUOA 2UWMA 3JSPA 4AIHA 3REOA 3RPQA 3ECHA 2IA1A 5K5RA 3RI4A 3KLNA 5E8IA 2ETHA 3R0AA 3QPHA 4OIOF 4I2OA 3IKTA 1EH8A 3MEXA 1XMKA 3P9KA 4P9UA 2LDUA 5DD8A 4P5OA 1YTYA 2RKHA 3WTXC 4IRIA 1FP2A 4XRFA 1T2KA 3KP7A 5HVQC 1YW8A 4KA4A 2PLYA 5HS9A 1R7JA 2LF7A 3IKVA 5E20A 3I58A 4M73A 3WTZA 2VT2A 3CO7C 3NRVA 1FT9A 3HOTA 1IUYA 2XASA 5BOXA 4EJVA 1MJ9A 1LEBA 1TQIA 2XIGA 2IPQX 3C7JA 1O3RA 2D1VA 3M8FA 4KIGA 1LEAA 2CW0F 2QQ9A 1SAXA 5JI6A 1PUEE 5FD6A 4QWQA 2GXBA 3ROUA 2FOKA 1ODDA 3P9IA 3BJOA 4RB2C 3JTHA 3DKWA 3QAHA 1IN5A 2XVCA 1I5ZA 3ZP5A 3AAFA 4RGUA 2K4JA 2ISZA 1G3YA 2GIVA 1U5TA 5FO5A 1FC3A 1C0WA 1SD6A 2FMLA 1X3UA 4EGZA 1QO0D 4G7ZF 2HQRA 3W6JB 4MQVA 2DPUA 4KICA 1XDSA 1K78B 2FBHA 1OPCA 1SD4A 3QP5A 2K4BA 4ZH4F 2DT5A 2ACJA 3GO5A 3F8MA 4LLNA 3JSOA 1GVJA 3GFJA 4HQMA 3K2ZA 4A0ZA 2XAHA 2KIMA 1ULYA 3WE2A 1FY7A 3FMRA 1KGSA 3OOPA 2ZMEA 2CSOA 1T98A 3R6SA 3CDHA 1FYKA 3DFGA 3ZMTA 1MDMA 2HDCA 1Z9CA 5E8GA 4HV5A 1YLFA 5ICGA 2F5DA 4U7DA 2MLKA 3KZYA 4ENMA 1IN7A 3ECOA 4I7HA 2TDXA 1ZN2A 3FX3A 5HS8A 1XDUA 4XSXF 5FLXK 2J5OA 4HV6A 5LGTA 5DD4A 3HOSA 3S2WA 1WRJA 1FWZA 3K0LA 4AWXB 2DI3A 3VODA 1JE8A 5JFRA 1KU2A 2VBZA 2PQ8A 3DPLC 3L7WA 5H20A 5LGNA 3SXYA 2KKOA 1BIAA 4B8XA 1XD7A 2GA2A 5DCFA 3GLXA 2R7FA 2QQAA 1RUNA 1FOKA 2FA5A 3J81Z 4YFKF 2BEOA 1ZREA 1HSJA 2QLZA 1FZPB 3HRTA 3E3VA 3KP6A 1GXPA 4U0YA 1IN4A 2DAOA 2XROA 1J9IA 1KQ8A 2F2EA 2C6YA 1Q1HA 4BHBA 4OMZA 3E97A 2W24A 1B59A 2E1NA 4XLPF 1L3LA 3BOQA 1Y0UA 3F8CA 3ZMSA 1XSXA 2JPCA 3RJPA 1RIOH 3E6MA 4WWCA 3FXUA 5KVRA 4A0XA 1SFEA 3R4KA 2ESNA 5D5UB 4WX9A 1JHHA 3GWZA 2XUBA 3PQJA 1R23A 3EYIA 3GXOA 3ZMUA 1J7KA 3GFLA 4CICA 1DP7P 2UZKA 1T39A 3HYIA 1RZ4A 1WWXA 3CUQC 2GZWA 3U2RA 3FF5A 1B9NA 4LB6B 3C3WA 2XAGA 4UNOA 1IRGA 1LNWA 5AONA 2MA3A 3NEUA 1V4RA 2R7DA 4EJOA 3H3ZA 5AIPA 2VC1A 4HYEA 2QM3A 4ZYGA 4GXOA 3M8EA 2EB7A 2YX7A 3SZTA 3VB2A 3R0JA 1I6XA 2VC0A 1ZHFA 3ML6A 2HKOA 3ELKA 3K1PA 2ZNZA 1KU7A 3J81K 1IW7F 5D5VB 2D2WA 4UV8A 4IHTA 4HQEA 2FNPA 6PAXA 5ILUA 1F1ZA 2QBYA 4HZFA 2Z3YA 1KA8A 4RGXA 4CYDA 1XGOA 1MJBA 2FE3A 1AOYA 1VTNC 4CO8A 1ZG1A 4ETSA 4Q48A 5J8CA 1E17A 2PMUA 2EFPA 3QP6A 3KP4A 5CLSA 3L9FA 1H9GA 3TQNA 2A61A 2A69F 2GXGA 5BQTA 3I64A 2FEZA 2WWYA 2DU9A 3WODF 4LJZF 4IVNA 4OINF 4RB3C 1P4AA 3HTSB 4ZYEA 2VN2A 3I71A 1U8RA 2D45A 3FWEA 2QWWA 2EJRA 4IPAA 1MJAA 1L0OC 4UXNA 4UUVA 3IWZA 1U3EM 1R5HA 4Q4ZF 2QENA 1TNTA 1K6OA 4M9XA 1T6SA 2M8EA 2P6SA 2P6TA 1E2XA 1J59A 3HHHA 3U1DA 1HBXG 3F6VA 4CDGA 4M6YA 3LA3A 4EJWA 3VOEA 4M71A 2ZJ2A 2ZBKA 4R8HA 1B1BA 4PDKA 1YFHA 1HW5A 3K69A 2DQRA 4F7ZA 1QGPA 2QBYB 4MEYF 4ZYDA 3J7AO 2A68F 1S6LA 2PBIA 4JBAA 4O3MA 2HYGD 2NAZA 4AD9A 2E7XA 3E5XA 4LMYA 4BXUA 5E18F 1FBSA 4A12A 1XMAA 1ZG3A 4HX8A 3LFKA 1FYLA 3J80Z 3Q5FA 1YYVA 1OMIA 5FFZA 2G9WA 5L3DA 2M87A 5FFXA 2DTRA 1CF7B 1JHFA 2RDPA 3E6BA 3GYHX 5JR3A 1DPUA 1HSTA 3LSTA 2ADUA 1B9MA 4UVBA 4B09A 4GYIA 3MAJA 2V9VA 2ZFWA 1P6RA 3HRUA 2JRTA 5DYMA 1G3SA 1EV7A 1EH6A 1JGSA 4U0VA 1MKMA 1Z6RA 5EEGA 1EH7A 3KP3A 5LEKA 2HS5A 5D8LB 3LAPA 1IAWA 3D0SA 3K9TA 3PQKA 2NNYA 1XCBA 4Z2YA 1XGSA 1K78A 4I02A 4BAYA 1ZRDA 4KNYA 4RB1A 5E1ZB 3RDIA 4M9SA 2EFQA 2GAUA 1W5TA 3BJ6A 1G4DA 2PMHA 1Z6TA 2LKPA 3DV8A 3FZVA 2ZXJA 3O6BB 1ZGJA 2A07F 1U6GA 2L4MA 1W7PD 1R00A 5LHGA 3KLOA 5ERIA 1OKRA 4KIFA 3BJAA 2CQKA 2QYOA 4HDUA 2P5VA 1I1SA 2W84A 2DK5A 1TLHB 1KU9A 4E70A 4ZZLA 3ULQB 2O8XA 2OAZA 4BHCA 2XKPA 3SHFA 5IT9Z 1DPRA 2CFXA 5J8FA 2EK5A 4HX4A 1BI3A 5CVUA 3WU1B 2NRAC 3J80K 4UVCA 4HX7A 4OIPF 3JAMZ 1DUXC 3I59B 4L9JA 4M72A 2K02A 2KJCA 2DFIA 4L9TA 2F5EA 5FD5A 4BQAA 3H92A 2CG4A 1REPC 4D0PA 3KETA 4Q47A 2Z9OA 2JTVA 2H6CA 2KIFA 2CWEA 1D3YA 1SMTA 5FGMA 1XGMA 2FSWA 1XCVA 3WU0A 4WXDA 2OZ6A 1R1TA 1FBUA 3I5UA 3GZ5A 1J5YA 1PDNC 2K27A 4L9NA 2HWVA 2O0YA 2GWRA 1DDNA 4HDVA 2H94A 1TBXA 2VT3A 2JSCA 2MC3A 3F6OA 2O03A 5D5WB 2YSRA 3DQVC 1XSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJL A;  3F8N A;  4G6Q A;  3V8K A;  1FSH A;  1WSU A;  2PJP A;  1P4X A;  3HHG A;  1KU3 A;  4OU0 A;  2YX4 A;  4KFC A;  4ENN A;  5EEH A;  4NHJ A;  1TQM A;  1F9N A;  4BYY A;  4S04 A;  1LQ1 A;  5D6F A;  1HKQ A;  1HKS A;  2NNN A;  2MBF A;  2PEX A;  2QZ8 A;  2L3D A;  1B6A A;  1BIB A;  3I4P A;  2A6E F;  3RKY A;  1FSE A;  2ESH A;  4WK8 F;  2EV6 A;  3F8F A;  1UST A;  3WGI A;  3G73 A;  3JAM K;  3HRS A;  1R1V A;  1USS A;  3LA2 A;  4LK1 F;  3FMS A;  2ISY A;  3FMQ A;  4R79 A;  2HQN A;  2BE5 F;  1I1G A;  1QQI A;  2Y75 A;  2BBY A;  3L00 A;  2ELH A;  5JVT A;  1BI0 A;  4ON0 A;  3V8J A;  2OA4 A;  4Y13 A;  2M30 A;  1OYI A;  2IA0 A;  3LAJ A;  5HS7 A;  1ZG5 A;  2RV8 A;  3KCC A;  2HKX A;  4WF2 A;  3IRQ A;  4WCG A;  1YIO A;  2DQL A;  2HZT A;  1B4A A;  2DLL A;  4FHT A;  3CO6 C;  4HF0 A;  3COA C;  1XGN A;  5CYV A;  2YPR A;  3MZH A;  3ABU A;  2BV6 A;  5D4R A;  1W7P B;  3F72 A;  3BZ6 A;  3GZ6 A;  2JZY A;  5E17 F;  5HDK A;  3QU3 A;  2LNB A;  1J2X A;  4OIQ F;  4P55 A;  2KJB A;  4MGR A;  4I98 B;  3DPT A;  1FLI A;  3DP7 A;  4WXH A;  1SD5 A;  5E1X A;  1OR7 A;  4IRG A;  2Y48 A;  1V3F A;  3HIF A;  2E1C A;  3PFI A;  2OU2 A;  2RN7 A;  4JK1 X;  3DF8 A;  4R1H A;  1FPQ A;  3HSR A;  1Z1D A;  4ESF A;  1ZAR A;  4L5J A;  3ZPL A;  1D5V A;  2VOD A;  4RGS A;  2OBP A;  5HLH A;  2EWN A;  1BJA A;  4KDP A;  5CVV A;  3IRR A;  2CYY A;  4KMF A;  3WE3 A;  4MQ9 F;  1YG2 A;  3RYR A;  1QZY A;  1ZGA A;  5KK1 A;  3GFI A;  3SQN A;  2X0L A;  3WTT C;  4RB0 A;  3GW2 A;  1FP1 D;  2IA2 A;  5AIQ A;  1YS6 A;  1IXC A;  2EV5 A;  1Z05 A;  5DUI A;  1LVA A;  1TW2 A;  1OYW A;  4BH9 A;  3TKY A;  2EFN A;  4EJT A;  1P4W A;  4N9H A;  2OQG A;  1BBY A;  3JTG A;  1MZB A;  4LK0 F;  2P7C B;  3KE2 A;  4DQ2 A;  3MWM A;  3EET A;  1G6N A;  3MCZ A;  1IXS B;  2BGC A;  2X4H A;  4P9F A;  4DNC A;  3CUQ B;  1O57 A;  1R1U A;  4HW0 A;  4ESJ A;  1CF7 A;  3ZMD A;  4CXF A;  2O61 A;  1LJ9 A;  3VEP A;  4UHT A;  3QRF F;  1KQ0 A;  1ZYR F;  1BOA A;  3F22 A;  1G3W A;  4QLC U;  4G7H F;  4I09 A;  2XHK A;  5CJ9 A;  1R5G A;  4EMS A;  3RIR A;  3ZMV A;  2LF8 A;  4TV7 A;  3IHU A;  1GHC A;  1XB4 A;  2W85 A;  4OMY A;  2CGP A;  3RPU A;  1P92 A;  3ABT A;  1S7O A;  2HR3 A;  2V1X A;  1HXD A;  1WI9 A;  1XN7 A;  2L54 A;  4IRH A;  5DEQ A;  1U78 A;  5DCM A;  3K1N A;  1SFX A;  1H9T A;  4LG0 B;  3HTU A;  1HKT A;  4MNU A;  4A6D A;  4OIR F;  2M5W A;  2O3F A;  1YW7 A;  3FM3 A;  2DPD A;  2B0L A;  5A2Q Z;  2HOE A;  5HDN A;  4HBL A;  2QQB A;  3WTU C;  5D8K B;  1K7A A;  5K5O A;  2L02 A;  1WQ2 A;  5BMZ A;  2P5K A;  2PN6 A;  2H27 A;  4OOI A;  2PFB A;  5E1W A;  1BI2 A;  2WV0 A;  2UXN A;  4EQQ A;  2XV4 S;  3F8B A;  1JXS A;  2P5L C;  1HQC A;  2RVC A;  2VBY A;  1QNT A;  1W4M A;  2R3S A;  5IT3 A;  3LQR A;  5CVR A;  5ICC A;  3KEQ A;  4KN7 X;  2XKO A;  3LWF A;  3EQL F;  2NS0 A;  4M6X A;  2V1D A;  2ZO4 A;  3TDZ C;  4ENJ A;  3I59 A;  4U7B A;  4FX0 A;  2ZKZ A;  3B73 A;  5HDG A;  3RKW A;  3QPT A;  2D1H A;  4Y15 A;  4O6J A;  3V7C A;  5DDG A;  1H0M A;  1D8J A;  3CJN A;  1IXR C;  1PP8 F;  2VE8 A;  4NQW A;  1HW1 A;  4LLL A;  3E6D A;  3P9C A;  4CZZ A;  4GYG A;  3KEO A;  2H6B A;  5L3F A;  4CGZ A;  1O3Q A;  5TRD A;  1R58 A;  3M1E A;  1LDD A;  3QOP A;  2FBK A;  2G7U A;  2XAF A;  1ZRF A;  5DCM B;  3HRM A;  5JHU A;  1R22 A;  4ZZD A;  4A5M A;  2P4W A;  4EV0 A;  5LRS A;  4M74 A;  1KYW A;  4HA8 A;  2L4A A;  2MH9 A;  1YQA A;  2K7L A;  1CGP A;  4HF2 A;  3WG9 A;  2M1B A;  2GA1 A;  3EUH A;  2OZU A;  2FU4 A;  5LHH A;  1BN5 A;  3MQ0 A;  3IL2 A;  2HEO A;  3E6C C;  2KIU A;  2HGC A;  2EA2 A;  4O5V A;  2HFH A;  5A2Q K;  5LHI A;  3MZY A;  2VE9 A;  4G8X A;  3L2C A;  2F5F A;  5F6F A;  3F3X A;  3CLO A;  3WTW C;  4MEX F;  4BHP A;  2A5Y B;  5ILV A;  5HLG A;  2K86 A;  4HAM A;  2RQP A;  3TDU C;  2PG4 A;  2V79 A;  3TO9 A;  3BPV A;  2G7H A;  4ZYH A;  4IF4 A;  2AS5 F;  3O2P E;  5ILS A;  4I0A A;  1SFU A;  4LFU A;  4HOB A;  1TNS A;  3H3U A;  4EGY A;  5D5X B;  5FLX Z;  1F5T A;  5L3B A;  5CVJ A;  1FNN A;  3QU6 A;  4I0B A;  3KP2 A;  2M45 A;  4NB5 A;  1K79 A;  2BYV E;  3V7R A;  4XBF A;  1KYZ A;  1UFM A;  2IW5 A;  4L9V A;  2Q2E A;  2UXX A;  4A0Y A;  2RGV A;  1T0F A;  3O3K A;  3P7N A;  4EVI A;  5L3C A;  1T38 A;  4RAZ A;  1UB9 A;  1AWC A;  5DUK A;  4LGW A;  3B02 A;  4G7O F;  3HSF A;  1ON1 A;  1RNL A;  1WKM A;  2STW A;  2P8T A;  1U5T C;  2QUF A;  1Z7U A;  1RUO A;  2P7V B;  4L18 B;  2Z5U A;  4WXC A;  3F21 A;  3MFK A;  4RS8 A;  1J75 A;  2Z33 A;  3FM5 A;  3RKX A;  1ZLJ A;  1W7P A;  3U9G A;  2XAQ A;  3V7S A;  5BS6 A;  1LDK B;  2IP2 A;  4MTD A;  2VBX A;  1YO5 C;  4Y17 A;  1IN6 A;  2HYF A;  3R60 A;  3OV8 A;  2FF4 A;  3M7G A;  2DK8 A;  1OYY A;  5IT9 K;  1R36 A;  5F1R A;  4KYW A;  3WTS C;  5HLI A;  3GVA A;  2H09 A;  2YU3 A;  4CHU A;  4UVA A;  4KUM A;  4G9Y A;  1GXQ A;  4IJA A;  3TO7 A;  3GUD A;  2GQQ A;  4YG2 F;  5H6R A;  1U2W A;  1RI7 A;  5BPI A;  3M9A A;  1U5T B;  2VBW A;  2ZNY A;  1O3T A;  3T5X A;  2YR2 A;  1BI1 A;  3FXR A;  4G94 A;  1STZ A;  5LEJ A;  5D4S A;  3N97 A;  4K2E A;  2XGX A;  1D8K A;  1QZZ A;  4GGG A;  3DEU A;  3ZN1 A;  4GCV A;  3WTY C;  1O7L A;  2V1U A;  3BDD A;  2IVM A;  4GO1 A;  2AXL A;  3V4G A;  2RNJ A;  1PP7 U;  1ZLK A;  4KN4 X;  4U0W A;  1P2F A;  4AIJ A;  5L3E A;  3BY6 A;  3V8L A;  3R61 A;  3BPX A;  5TJJ A;  2VOO A;  4XSZ F;  3ERE D;  3SZP A;  3LQQ A;  1J0R A;  1IZ1 A;  1MD0 A;  4RGR A;  4N0B A;  4EM2 A;  1F4K A;  1TQP A;  2EFO A;  2ZME B;  5K1Y A;  2JPB A;  3CTA A;  4YFN F;  3CUQ A;  3BRO A;  4KT5 C;  1FBQ A;  1MDM B;  4EJU A;  2Y0M A;  3HSE A;  4I01 A;  5HOO A;  1FX7 A;  2OD5 A;  5DV5 A;  5L3G A;  2MD5 A;  4A6E A;  4LD5 A;  3I0T A;  4LB5 A;  3KFW X;  3GX4 X;  1UHM A;  3I53 A;  2FNA A;  1UCR A;  3D5L A;  3RTR A;  3HUG A;  2FBI A;  3ZQ7 A;  5LRR A;  2XRN A;  2L01 A;  3RYP A;  1S7A A;  4HF1 A;  3T8T A;  2FXA A;  3ZMZ A;  3TOB A;  4L0Y B;  4M9Z A;  3SFZ A;  2XAJ A;  2Q8K A;  1NHA A;  3FXQ A;  3NQO A;  2VXZ A;  2EFW A;  4LG0 A;  3WTV C;  3IWF A;  5D6E A;  3KP5 A;  4KIB A;  4UV9 A;  1G3T A;  4L0Z B;  1TW3 A;  2HTJ A;  4YII A;  2VOP A;  3K1M A;  4L5I A;  1BC7 C;  1ZH5 A;  1S29 A;  2O6G E;  4IXA A;  2LSO A;  4PGG A;  1ON2 A;  4JQF A;  3JW4 A;  1BC8 C;  1IF1 A;  5K5Q A;  3TGN A;  3E5U A;  2E7W A;  1ZRC A;  4U88 A;  1LDJ A;  2IT0 A;  2W57 A;  2EA4 A;  5BPD A;  2DO7 A;  1UHW A;  2WTE A;  2OQR A;  4EM1 A;  3N4M A;  4PCQ A;  5LLQ A;  1SMY F;  5ICE A;  5J6X A;  1SD7 A;  3GEZ A;  1ONV A;  3KZZ A;  3WGH A;  1ZAO A;  2EV0 A;  2MH2 A;  1KQ9 A;  2MLG A;  3T8R A;  5CVI A;  2RC4 A;  2IRF G;  4BNC A;  4LLG F;  3ISP A;  3EDP A;  2HTS A;  4ESB A;  2PI0 A;  1IN8 A;  4AVP A;  2FRH A;  3W6K B;  4ENK A;  4AIK A;  3Q9V A;  1QPM A;  3C1D A;  5F64 A;  4A5N A;  3F23 A;  4N9I A;  3FHZ A;  2ZCW A;  1YS7 A;  1I27 A;  4S05 A;  3Q9S A;  2Q0O A;  1FYM A;  1QBJ A;  1S8N A;  3BP8 A;  2F5C A;  2W25 A;  3I54 A;  3BWG A;  2COM A;  4A2U A;  1MGT A;  2J5P A;  2CO5 A;  2STT A;  5H6Q A;  3IC7 A;  3T1B A;  3GF2 A;  3C18 A;  4MTE A;  1XSD A;  2VON A;  2V6C A;  3VFZ A;  2FMY A;  4IHS A;  5LGU A;  3EYY A;  4G6D A;  4YIF A;  5ED4 A;  5FB2 A;  5ICF A;  2A6H F;  3LA7 A;  1O3S A;  4H0E A;  4XLN F;  4P96 A;  1O7F A;  1IRF A;  2Z99 A;  4RAY A;  4MHG A;  4KMU X;  4HLX A;  1S3J A;  1TTY A;  2FQ3 A;  2QVO A;  3L09 A;  3G3Z A;  4EM0 B;  4FT8 A;  4FX4 A;  1BM9 A;  3E5Q A;  3DXJ F;  4YFX F;  1YW9 A;  2DW4 A;  2NYX A;  4PZJ A;  2JT1 A;  1A04 A;  4ASN A;  3ZN0 A;  3WGG A;  3TOA A;  2DBB A;  2WC2 A;  2A3S A;  4Q5S F;  1HW2 A;  3T0Y A;  4HLY A;  1Z91 A;  5LBQ A;  3GFM A;  1W5S A;  2KRF A;  3TO6 A;  1LB2 A;  4PGH A;  3CUO A;  2UWM A;  3JSP A;  4AIH A;  3REO A;  3RPQ A;  3ECH A;  2IA1 A;  5K5R A;  3RI4 A;  3KLN A;  5E8I A;  2ETH A;  3R0A A;  3QPH A;  4OIO F;  4I2O A;  3IKT A;  1EH8 A;  3MEX A;  1XMK A;  3P9K A;  4P9U A;  2LDU A;  5DD8 A;  4P5O A;  1YTY A;  2RKH A;  3WTX C;  4IRI A;  1FP2 A;  4XRF A;  1T2K A;  3KP7 A;  5HVQ C;  1YW8 A;  4KA4 A;  2PLY A;  5HS9 A;  1R7J A;  2LF7 A;  3IKV A;  5E20 A;  3I58 A;  4M73 A;  3WTZ A;  2VT2 A;  3CO7 C;  3NRV A;  1FT9 A;  3HOT A;  1IUY A;  2XAS A;  5BOX A;  4EJV A;  1MJ9 A;  1LEB A;  1TQI A;  2XIG A;  2IPQ X;  3C7J A;  1O3R A;  2D1V A;  3M8F A;  4KIG A;  1LEA A;  2CW0 F;  2QQ9 A;  1SAX A;  5JI6 A;  1PUE E;  5FD6 A;  4QWQ A;  2GXB A;  3ROU A;  2FOK A;  1ODD A;  3P9I A;  3BJO A;  4RB2 C;  3JTH A;  3DKW A;  3QAH A;  1IN5 A;  2XVC A;  1I5Z A;  3ZP5 A;  3AAF A;  4RGU A;  2K4J A;  2ISZ A;  1G3Y A;  2GIV A;  1U5T A;  5FO5 A;  1FC3 A;  1C0W A;  1SD6 A;  2FML A;  1X3U A;  4EGZ A;  1QO0 D;  4G7Z F;  2HQR A;  3W6J B;  4MQV A;  2DPU A;  4KIC A;  1XDS A;  1K78 B;  2FBH A;  1OPC A;  1SD4 A;  3QP5 A;  2K4B A;  4ZH4 F;  2DT5 A;  2ACJ A;  3GO5 A;  3F8M A;  4LLN A;  3JSO A;  1GVJ A;  3GFJ A;  4HQM A;  3K2Z A;  4A0Z A;  2XAH A;  2KIM A;  1ULY A;  3WE2 A;  1FY7 A;  3FMR A;  1KGS A;  3OOP A;  2ZME A;  2CSO A;  1T98 A;  3R6S A;  3CDH A;  1FYK A;  3DFG A;  3ZMT A;  1MDM A;  2HDC A;  1Z9C A;  5E8G A;  4HV5 A;  1YLF A;  5ICG A;  2F5D A;  4U7D A;  2MLK A;  3KZY A;  4ENM A;  1IN7 A;  3ECO A;  4I7H A;  2TDX A;  1ZN2 A;  3FX3 A;  5HS8 A;  1XDU A;  4XSX F;  5FLX K;  2J5O A;  4HV6 A;  5LGT A;  5DD4 A;  3HOS A;  3S2W A;  1WRJ A;  1FWZ A;  3K0L A;  4AWX B;  2DI3 A;  3VOD A;  1JE8 A;  5JFR A;  1KU2 A;  2VBZ A;  2PQ8 A;  3DPL C;  3L7W A;  5H20 A;  5LGN A;  3SXY A;  2KKO A;  1BIA A;  4B8X A;  1XD7 A;  2GA2 A;  5DCF A;  3GLX A;  2R7F A;  2QQA A;  1RUN A;  1FOK A;  2FA5 A;  3J81 Z;  4YFK F;  2BEO A;  1ZRE A;  1HSJ A;  2QLZ A;  1FZP B;  3HRT A;  3E3V A;  3KP6 A;  1GXP A;  4U0Y A;  1IN4 A;  2DAO A;  2XRO A;  1J9I A;  1KQ8 A;  2F2E A;  2C6Y A;  1Q1H A;  4BHB A;  4OMZ A;  3E97 A;  2W24 A;  1B59 A;  2E1N A;  4XLP F;  1L3L A;  3BOQ A;  1Y0U A;  3F8C A;  3ZMS A;  1XSX A;  2JPC A;  3RJP A;  1RIO H;  3E6M A;  4WWC A;  3FXU A;  5KVR A;  4A0X A;  1SFE A;  3R4K A;  2ESN A;  5D5U B;  4WX9 A;  1JHH A;  3GWZ A;  2XUB A;  3PQJ A;  1R23 A;  3EYI A;  3GXO A;  3ZMU A;  1J7K A;  3GFL A;  4CIC A;  1DP7 P;  2UZK A;  1T39 A;  3HYI A;  1RZ4 A;  1WWX A;  3CUQ C;  2GZW A;  3U2R A;  3FF5 A;  1B9N A;  4LB6 B;  3C3W A;  2XAG A;  4UNO A;  1IRG A;  1LNW A;  5AON A;  2MA3 A;  3NEU A;  1V4R A;  2R7D A;  4EJO A;  3H3Z A;  5AIP A;  2VC1 A;  4HYE A;  2QM3 A;  4ZYG A;  4GXO A;  3M8E A;  2EB7 A;  2YX7 A;  3SZT A;  3VB2 A;  3R0J A;  1I6X A;  2VC0 A;  1ZHF A;  3ML6 A;  2HKO A;  3ELK A;  3K1P A;  2ZNZ A;  1KU7 A;  3J81 K;  1IW7 F;  5D5V B;  2D2W A;  4UV8 A;  4IHT A;  4HQE A;  2FNP A;  6PAX A;  5ILU A;  1F1Z A;  2QBY A;  4HZF A;  2Z3Y A;  1KA8 A;  4RGX A;  4CYD A;  1XGO A;  1MJB A;  2FE3 A;  1AOY A;  1VTN C;  4CO8 A;  1ZG1 A;  4ETS A;  4Q48 A;  5J8C A;  1E17 A;  2PMU A;  2EFP A;  3QP6 A;  3KP4 A;  5CLS A;  3L9F A;  1H9G A;  3TQN A;  2A61 A;  2A69 F;  2GXG A;  5BQT A;  3I64 A;  2FEZ A;  2WWY A;  2DU9 A;  3WOD F;  4LJZ F;  4IVN A;  4OIN F;  4RB3 C;  1P4A A;  3HTS B;  4ZYE A;  2VN2 A;  3I71 A;  1U8R A;  2D45 A;  3FWE A;  2QWW A;  2EJR A;  4IPA A;  1MJA A;  1L0O C;  4UXN A;  4UUV A;  3IWZ A;  1U3E M;  1R5H A;  4Q4Z F;  2QEN A;  1TNT A;  1K6O A;  4M9X A;  1T6S A;  2M8E A;  2P6S A;  2P6T A;  1E2X A;  1J59 A;  3HHH A;  3U1D A;  1HBX G;  3F6V A;  4CDG A;  4M6Y A;  3LA3 A;  4EJW A;  3VOE A;  4M71 A;  2ZJ2 A;  2ZBK A;  4R8H A;  1B1B A;  4PDK A;  1YFH A;  1HW5 A;  3K69 A;  2DQR A;  4F7Z A;  1QGP A;  2QBY B;  4MEY F;  4ZYD A;  3J7A O;  2A68 F;  1S6L A;  2PBI A;  4JBA A;  4O3M A;  2HYG D;  2NAZ A;  4AD9 A;  2E7X A;  3E5X A;  4LMY A;  4BXU A;  5E18 F;  1FBS A;  4A12 A;  1XMA A;  1ZG3 A;  4HX8 A;  3LFK A;  1FYL A;  3J80 Z;  3Q5F A;  1YYV A;  1OMI A;  5FFZ A;  2G9W A;  5L3D A;  2M87 A;  5FFX A;  2DTR A;  1CF7 B;  1JHF A;  2RDP A;  3E6B A;  3GYH X;  5JR3 A;  1DPU A;  1HST A;  3LST A;  2ADU A;  1B9M A;  4UVB A;  4B09 A;  4GYI A;  3MAJ A;  2V9V A;  2ZFW A;  1P6R A;  3HRU A;  2JRT A;  5DYM A;  1G3S A;  1EV7 A;  1EH6 A;  1JGS A;  4U0V A;  1MKM A;  1Z6R A;  5EEG A;  1EH7 A;  3KP3 A;  5LEK A;  2HS5 A;  5D8L B;  3LAP A;  1IAW A;  3D0S A;  3K9T A;  3PQK A;  2NNY A;  1XCB A;  4Z2Y A;  1XGS A;  1K78 A;  4I02 A;  4BAY A;  1ZRD A;  4KNY A;  4RB1 A;  5E1Z B;  3RDI A;  4M9S A;  2EFQ A;  2GAU A;  1W5T A;  3BJ6 A;  1G4D A;  2PMH A;  1Z6T A;  2LKP A;  3DV8 A;  3FZV A;  2ZXJ A;  3O6B B;  1ZGJ A;  2A07 F;  1U6G A;  2L4M A;  1W7P D;  1R00 A;  5LHG A;  3KLO A;  5ERI A;  1OKR A;  4KIF A;  3BJA A;  2CQK A;  2QYO A;  4HDU A;  2P5V A;  1I1S A;  2W84 A;  2DK5 A;  1TLH B;  1KU9 A;  4E70 A;  4ZZL A;  3ULQ B;  2O8X A;  2OAZ A;  4BHC A;  2XKP A;  3SHF A;  5IT9 Z;  1DPR A;  2CFX A;  5J8F A;  2EK5 A;  4HX4 A;  1BI3 A;  5CVU A;  3WU1 B;  2NRA C;  3J80 K;  4UVC A;  4HX7 A;  4OIP F;  3JAM Z;  1DUX C;  3I59 B;  4L9J A;  4M72 A;  2K02 A;  2KJC A;  2DFI A;  4L9T A;  2F5E A;  5FD5 A;  4BQA A;  3H92 A;  2CG4 A;  1REP C;  4D0P A;  3KET A;  4Q47 A;  2Z9O A;  2JTV A;  2H6C A;  2KIF A;  2CWE A;  1D3Y A;  1SMT A;  5FGM A;  1XGM A;  2FSW A;  1XCV A;  3WU0 A;  4WXD A;  2OZ6 A;  1R1T A;  1FBU A;  3I5U A;  3GZ5 A;  1J5Y A;  1PDN C;  2K27 A;  4L9N A;  2HWV A;  2O0Y A;  2GWR A;  1DDN A;  4HDV A;  2H94 A;  1TBX A;  2VT3 A;  2JSC A;  2MC3 A;  3F6O A;  2O03 A;  5D5W B;  2YSR A;  3DQV C;  1XSV A; 
#chains in the Genus database with same CATH topology
 4ABZ A;  2IJL A;  3F8N A;  4G6Q A;  3V8K A;  1VF9 A;  2KL4 A;  1FSH A;  1WSU A;  2CQQ A;  1IV6 A;  2PJP A;  1P4X A;  3QOD A;  4XKV A;  3FXJ A;  5F0F A;  2BW3 A;  3HHG A;  1KU3 A;  3W2A A;  2R7U A;  4OU0 A;  2CW7 A;  2YX4 A;  4KFC A;  1W0U A;  4ENN A;  5EEH A;  4NHJ A;  2VJ4 A;  2DJN A;  1TQM A;  2CJJ A;  2MFZ A;  9ANT A;  4BS9 A;  3H5N A;  1F9N A;  4BYY A;  3HPG A;  4S04 A;  3FBI B;  1LQ1 A;  3TW6 A;  4XON A;  2WAD A;  5D6F A;  4XID A;  2LC2 A;  1HKQ A;  1HKS A;  2NNN A;  3FK6 A;  2MBF A;  2PEX A;  2QZ8 A;  4NC7 A;  2L3D A;  1B6A A;  2XGD A;  1Z7L A;  4PSX A;  4J00 A;  2EZI A;  2K85 A;  2LR8 A;  2BY1 A;  1BIB A;  3I4P A;  3G4S I;  2ZME C;  2A6E F;  2E36 A;  2IBD A;  3RKY A;  3D5R C;  1FSE A;  2ESH A;  4CCL A;  2EV6 A;  4WK8 F;  3H9Q A;  3UKG A;  3S3N A;  3HOX J;  3F8F A;  3HOW J;  1UST A;  3WGI A;  3G73 A;  2FUG 2;  3JAM K;  3BCA A;  1R1V A;  3HRS A;  1USS A;  2F4M B;  2DA2 A;  2WAF A;  2Q2E B;  3LA2 A;  4LK1 F;  2CMP A;  4M3D A;  2WBM A;  3FMS A;  4MO7 A;  1X2N A;  2ISY A;  3FMQ A;  2DMU A;  4BL0 B;  4ZTJ A;  4R79 A;  4XN0 A;  2AHQ A;  3A1Y A;  1RPW A;  2NS8 A;  1JJ6 C;  2HQN A;  3BTC A;  1I1G A;  1QQI A;  2BE5 F;  2Y75 A;  2BBY A;  1MW7 A;  3L00 A;  2ELH A;  5F0H A;  4XLC A;  5JVT A;  1BI0 A;  4ON0 A;  3JR9 A;  2LTP A;  3PM1 A;  2WAE A;  4II2 A;  3V8J A;  2OA4 A;  4Y13 A;  2A6T A;  2M30 A;  1Y8R B;  2LRD A;  1W0T A;  1BW5 A;  1OYI A;  3OYH A;  5CQE A;  3JRA A;  2IA0 A;  3ABM H;  5EF6 A;  5HS7 A;  3LAJ A;  1ZG5 A;  2R7R A;  2RV8 A;  2VAS A;  3KCC A;  2HKX A;  4WF2 A;  3VDX A;  3S16 J;  5C4X J;  3IRQ A;  3LNQ A;  1VQ8 I;  2ID3 A;  2BVM A;  4A3F J;  3VPR A;  3DPU A;  4PK4 A;  4JX4 A;  4WCG A;  1YIO A;  2DQL A;  2HZT A;  1B4A A;  2DLL A;  4FHT A;  3CO6 C;  4HF0 A;  3COA C;  3FK7 A;  1XGN A;  4JX5 A;  5CYV A;  2VPR A;  2YPR A;  3OYA A;  2ZJP F;  3MZH A;  3ABU A;  2BV6 A;  1HOM A;  5D4R A;  1W7P B;  1TWH J;  2GM4 A;  2V9P A;  5FKK A;  2L7Z A;  2W1O A;  2YU9 J;  3F72 A;  3BZ6 A;  3TP3 A;  3GZ6 A;  4I76 A;  2JZY A;  4XOT A;  3K70 C;  5E17 F;  5HDK A;  3QU3 A;  2LNB A;  1J2X A;  5IP9 J;  3QYE A;  2CUZ A;  3PIP F;  4OIQ F;  1A35 A;  2VL8 A;  4FQG A;  3ZQH A;  2E2J J;  4P55 A;  2Q1Z B;  4CYC A;  2EPF A;  2KJB A;  3CP8 A;  2BVL A;  4MGR A;  3Q0U A;  4I98 B;  3DPT A;  3TP0 A;  4FTH A;  1VQ5 I;  3OYG A;  4NBQ A;  5B3S H;  1FLI A;  2R7Q A;  3CCR I;  3DP7 A;  4NUB A;  2E34 A;  4WXH A;  1SD5 A;  5E1X A;  2LFB A;  1OR7 A;  4IRG A;  3GZN B;  3OSG A;  2Y48 A;  1V3F A;  2LOO A;  3HIF A;  3NAU A;  2E1C A;  2E60 A;  3PFI A;  1HA8 A;  2OU2 A;  2IS6 A;  2HZD A;  2RN7 A;  4JK1 X;  4OAY A;  3DF8 A;  4R1H A;  1FPQ A;  3HSR A;  3RSN A;  1Z1D A;  4PFP A;  4ESF A;  1ZAR A;  4L5J A;  3BR6 A;  4Y33 A;  1QPI A;  3ZPL A;  1D5V A;  2VKV A;  3TBI A;  4A3E J;  3DBH B;  1ETW A;  2VOD A;  4RGS A;  2BZT A;  3ZQQ A;  1NH3 A;  3H5R A;  2OBP A;  2NOJ B;  5HLH A;  2EWN A;  1BJA A;  4KDP A;  5CVV A;  3IRR A;  2CYY A;  1JI8 A;  4KMF A;  5FRN A;  3WE3 A;  4MQ9 F;  1FOW A;  3FXK A;  1YG2 A;  1WI3 A;  3RYR A;  5K7H A;  1QZY A;  1QVT A;  1ZGA A;  4XKB A;  5KK1 A;  3GFI A;  2JA2 A;  2WV1 A;  3SQN A;  4CA0 A;  3DWL E;  2X0L A;  3L2Q A;  5GTH C;  3WTT C;  2VUM J;  1AKH A;  2QSF X;  4RB0 A;  3GW2 A;  1FP1 D;  2IA2 A;  1FIP A;  5AIQ A;  2QCO A;  1YS6 A;  1IXC A;  3CCU I;  2EV5 A;  2F5V A;  1WJB A;  1Z05 A;  4GRI A;  5DUI A;  1LVA A;  2M4K A;  4Y7N J;  1TW2 A;  3W3C A;  1OYW A;  4BH9 A;  3TKY A;  5J3L A;  1FOY A;  2L7K A;  2EFN A;  4EJT A;  4Y4R A;  1P4W A;  5FRO A;  4N9H A;  2OQG A;  2IS2 A;  1BBY A;  4N4N B;  3B6C A;  1OCC H;  3JTG A;  1MZB A;  1G8X A;  4LK0 F;  5TGT A;  2P7C B;  3KE2 A;  3K4N A;  4DQ2 A;  2BY0 A;  1Z67 A;  1RKT A;  3MWM A;  2XF5 A;  1DQU A;  4NC6 A;  2VKE A;  3EET A;  1G6N A;  3MCZ A;  1IXS B;  3FIS A;  2BGC A;  2X4H A;  4P9F A;  4DNC A;  3CUQ B;  4BU2 A;  1WJF A;  2V4J C;  1SAN A;  2K9Q A;  2XB5 A;  1RRJ A;  2X6Y A;  1RES A;  1O57 A;  1R1U A;  4HW0 A;  4ESJ A;  1CF7 A;  3ZMD A;  4B4C A;  4YRV A;  4CXF A;  2O61 A;  4MLO A;  1LJ9 A;  1IG7 A;  3VEP A;  3B6A A;  1A31 A;  4QPO A;  2H8W A;  4UHT A;  3QRF F;  1KQ0 A;  2R7T A;  2E1O A;  2DOE A;  2CU7 A;  2L0K A;  1ZYR F;  1BOA A;  4BXF A;  2VXD A;  3F22 A;  1G3W A;  4QLC U;  2FD5 A;  4BJ6 C;  4FCY A;  5J1Y A;  4G7H F;  3CC2 I;  3JRE A;  3HGY A;  4I09 A;  1FIA A;  2XHK A;  5CJ9 A;  1R5G A;  4EMS A;  3RIR A;  3ZMV A;  5HOD A;  2BHY A;  2LF8 A;  1D0Z A;  4HNU A;  1T8I A;  3HUG B;  4TV7 A;  3IHU A;  5EGO A;  1GHC A;  4PJM A;  2O8K A;  2R7Z J;  3ABK H;  2KDO A;  4AYB A;  5C3E J;  1XB4 A;  4V19 K;  3LMM A;  4HNV A;  1Y1W J;  3ONQ A;  1PUF A;  2W85 A;  4OMY A;  2CGP A;  2BOL A;  4A3L J;  3JRB A;  2AXT C;  4IQJ A;  1G2H A;  3RPU A;  3MKY B;  2V26 A;  1P92 A;  3ABT A;  1W36 D;  3CLQ A;  3PNT A;  1XG1 A;  1S7O A;  1UMQ A;  2HR3 A;  3A03 A;  3FDY A;  2HVS A;  2VJJ A;  2X1E A;  2V1X A;  1HXD A;  1WI9 A;  1XN7 A;  5J1U A;  1OCR H;  2L54 A;  4IRH A;  3WU2 C;  4C30 A;  2PMZ N;  5B1B H;  5DEQ A;  2VQL A;  1V5F A;  3K1N A;  5DCM A;  2QGU A;  3S93 A;  1SFX A;  1U78 A;  1H9T A;  4LG0 B;  3HTU A;  1HKT A;  3IP4 B;  3I4M J;  4M3E A;  4MNU A;  1TWA J;  3K4B A;  4A6D A;  5HNH A;  4OIR F;  2M5W A;  3O8H A;  1F43 A;  2JSP A;  2QSH X;  2O3F A;  1A6I A;  1YW7 A;  2AQE A;  2IGO A;  3FM3 A;  2DPD A;  2OTL I;  1Y8Q B;  2B0L A;  3DEE A;  4D7N A;  3JRI A;  2KMU A;  5A2Q Z;  2HOE A;  2JRM A;  5HDN A;  5JLW A;  4BE0 A;  1VQN I;  4HBL A;  2QQB A;  1YE9 A;  5C44 J;  3WTU C;  5D8K B;  1K7A A;  5K5O A;  2L02 A;  1WQ2 A;  3OYI A;  5BMZ A;  4C3H J;  2COB A;  2P5K A;  2PN6 A;  2X85 A;  2H27 A;  1B72 A;  1MBJ A;  4OOI A;  2PFB A;  2OUM A;  5E1W A;  4BJ5 C;  1BI2 A;  1JKQ C;  4RLF A;  3L1P A;  4XNF A;  2WV0 A;  4X0G A;  2UXN A;  4RA2 A;  4EQQ A;  3CCS I;  2XV4 S;  2EZK A;  3F8B A;  3JCU C;  1JXS A;  2P5L C;  1HQC A;  2RVC A;  1MH4 A;  2VBY A;  1QNT A;  1W4M A;  1WJA A;  2R3S A;  5IT3 A;  3UR3 C;  3LQR A;  3K4K A;  5CVR A;  4DGW B;  5ICC A;  3KEQ A;  4A3M J;  3HC7 A;  4KN7 X;  2ME0 A;  1WH7 A;  2XKO A;  3QPL A;  3LWF A;  3EQL F;  2NS0 A;  3G1L A;  2AQF A;  3RQI A;  1WVR A;  3OMY A;  4M6X A;  2V1D A;  1RKW A;  2DMQ A;  2ZO4 A;  1ZQ3 P;  3TDZ C;  4ENJ A;  3I59 A;  3PSI A;  4DZP A;  4U7B A;  1ETY A;  4FX0 A;  2PJR B;  2ZKZ A;  2K9S A;  3LSG A;  3A01 A;  4E7J A;  1N78 A;  3B73 A;  5HDG A;  3RKW A;  4KIS A;  3QPT A;  2D1H A;  4Y15 A;  4O6J A;  2KRC A;  3V7C A;  5DDG A;  1H0M A;  4DYQ A;  1D8J A;  3CJN A;  1IXR C;  2K3P A;  1PP8 F;  5FJ8 J;  4ZYA A;  2VE8 A;  4NQW A;  1HW1 A;  4LLL A;  1HCR A;  3E6D A;  3ZR8 X;  5C4J J;  3P9C A;  1SVL A;  4CZZ A;  4Y3O A;  4XKW A;  4GYG A;  3OYN A;  2R7X A;  4XIC A;  3KEO A;  4BEH B;  2H6B A;  5L3F A;  3J7Y J;  4CGZ A;  1O3Q A;  1N75 A;  3OYB A;  5TRD A;  1R58 A;  3M1E A;  1LDD A;  4BQO A;  3QOP A;  1AU7 A;  1AHD P;  4A93 J;  2FBK A;  2JA8 J;  3JRF A;  1JUP A;  2L7F P;  2G7U A;  3L2V A;  2XAF A;  2LP0 A;  1ZRF A;  5DCM B;  4UUS A;  2K9N A;  3HRM A;  5JHU A;  2L9S A;  1R22 A;  4A5M A;  4ZZD A;  4CSW A;  4B48 A;  2P4W A;  4EV0 A;  5LRS A;  1W36 C;  4AVZ A;  4M74 A;  1KYW A;  2ZFU A;  4HA8 A;  2HXO A;  5H2F C;  2L4A A;  1S5L C;  2MH9 A;  4XMY A;  1YQA A;  2K7L A;  4IEJ A;  1CGP A;  1IC8 A;  4HF2 A;  3HXL A;  3WG9 A;  2M1B A;  2E5N A;  2GA1 A;  3EUH A;  2OZU A;  5IP7 J;  3SDG A;  2FU4 A;  3CDL A;  5LHH A;  1BN5 A;  2Y0S N;  3AG2 H;  3MQ0 A;  4PJN A;  4BGD A;  3IL2 A;  2ZJQ F;  2QA4 I;  2YUS A;  3S14 J;  1M1E B;  2HEO A;  3BG7 A;  3E6C C;  2KIU A;  2HGC A;  5EZH A;  2EA2 A;  2GBY A;  4O5V A;  2HFH A;  2MW8 A;  2DMP A;  3F0C A;  1S9H A;  5A2Q K;  3EPZ A;  5LHI A;  2AO9 A;  3MZY A;  4E7L A;  1QHG A;  1QZE A;  2VE9 A;  4G8X A;  2ZSI B;  2F5F A;  3L2C A;  4FE7 A;  5F6F A;  3F3X A;  3G1O A;  3CLO A;  2GOX B;  3WTW C;  3X2Q H;  4ZTF A;  4MEX F;  2XSJ C;  1CQT A;  3SZG A;  3MKL A;  4BHP A;  2A5Y B;  5ILV A;  5HLG A;  2JVG A;  2K86 A;  3BG3 A;  3BTI A;  4HAM A;  2MSY A;  2RQP A;  3TDU C;  2PG4 A;  2V79 A;  5J40 A;  3TO9 A;  3LSI A;  3BPV A;  1U9O A;  1V5G A;  1YX3 A;  2G7H A;  4ZYH A;  2I5U A;  4IF4 A;  2AS5 F;  5GAH J;  4JX6 A;  1Y56 A;  3O2P E;  2VQC A;  5ILS A;  2E19 A;  3JRD A;  4I0A A;  1APL C;  1SFU A;  2DFE A;  4LFU A;  4HOB A;  2QEX I;  1TNS A;  3H3U A;  4EGY A;  1VFC A;  5D5X B;  5FLX Z;  1TT0 A;  1F5T A;  2KIQ A;  5CVJ A;  5L3B A;  1FNN A;  1IJW C;  2IGM A;  3QU6 A;  4I0B A;  5HLT A;  1V54 H;  3KP2 A;  2H1L A;  2M34 A;  2M45 A;  4NB5 A;  1K79 A;  2ICW G;  2BYV E;  1MH3 A;  3V7R A;  1DU0 A;  2WAQ N;  2HVR A;  2MAB A;  1X1P A;  4XBF A;  1KYZ A;  3PNY A;  1UFM A;  2M7B A;  2IW5 A;  4L9V A;  2Q2E A;  2I10 A;  2UXX A;  4A0Y A;  1T33 A;  4J19 A;  3PIO F;  2RGV A;  3H0D A;  1T0F A;  3O3K A;  3P7N A;  5E79 C;  3KYD B;  4EVI A;  3OWT A;  1K6Y A;  4BBS J;  5L3C A;  3FBN B;  4V2G A;  2OTJ I;  3GME A;  4IOC F;  2DA7 A;  1T38 A;  4RAZ A;  4UUS B;  1TT5 B;  3KYC B;  1UB9 A;  3BG6 A;  1AWC A;  5DUK A;  1E0E A;  4LGW A;  4UB8 C;  3B02 A;  4D1Q A;  4G7O F;  3HSF A;  1ON1 A;  3MVP A;  1RNL A;  1IUF A;  1WKM A;  1YIT I;  1HDD C;  2CV1 A;  2STW A;  2P8T A;  4PUS A;  3GCM A;  1U5T C;  2QUF A;  1Z7U A;  4DW6 A;  1B8I B;  4XRS A;  1RUO A;  1R5I D;  2X6X A;  3L2R A;  3K70 D;  2P7V B;  2W82 A;  4L18 B;  2Z5U A;  4WXC A;  3ZQC A;  4BJT A;  4PJL A;  5E3O A;  3F21 A;  1XS9 A;  3MFK A;  1IV8 A;  4RS8 A;  1J75 A;  2Z33 A;  3FM5 A;  1ETV A;  5TIS C;  3RKX A;  3K7A J;  1ZLJ A;  3N05 A;  3VWB A;  1I6H J;  4FET A;  1WH5 A;  1W7P A;  3BTL A;  2FQ4 A;  3U9G A;  2XAQ A;  3CC4 I;  2EH3 A;  4HSR A;  3V7S A;  4BKX A;  3IH4 A;  5HNF A;  5E3L A;  2JVH A;  5BS6 A;  2LMD A;  1SFO J;  1Y0N A;  4CCO A;  1LDK B;  2IP2 A;  4FE4 A;  4MTD A;  4CCM A;  1HLV A;  2K3F A;  2E71 A;  4E6K G;  2ZJR F;  2VBX A;  3DTI A;  2QSG X;  2XPU A;  1YO5 C;  4Y17 A;  1YJW I;  1E3P A;  5KAF C;  2TRT A;  4G6T B;  3LSR A;  1IN6 A;  3I4N J;  2ZXW H;  2JJ7 A;  4CCN A;  1EJ9 A;  2HYF A;  3R60 A;  3GTL J;  2HPI A;  3OV8 A;  2FF4 A;  3M7G A;  3A0H C;  3I9V 2;  5DM7 F;  2DK8 A;  1ZK8 A;  1YJ9 I;  1OYY A;  4ANJ A;  3LSH A;  5IT9 K;  4ZDP A;  5J1R A;  1R36 A;  1XPX A;  1Z77 A;  5F1R A;  3EUK L;  2Z1D A;  2N8G A;  4KYW A;  1JTX A;  3WTS C;  3OYC A;  3I3L A;  3ZCO A;  5HLI A;  3GVA A;  2H09 A;  2YU3 A;  4CHU A;  4UVA A;  1T08 B;  4KUM A;  2R7V A;  4G9Y A;  3CCE I;  1GXQ A;  3J7A Y;  1ZR2 A;  3GTG J;  4IJA A;  3TO7 A;  2QKM B;  3DCF A;  3GUD A;  2GQQ A;  4IHX A;  4YG2 F;  5H6R A;  1U2W A;  5DS9 A;  1RI7 A;  5BPI A;  2RQQ A;  3M9A A;  3RCO A;  3LSJ A;  1U5T B;  2VBW A;  2ZNY A;  2CQN A;  2A5W A;  1O3T A;  3T5X A;  2YR2 A;  2V6E A;  3FIW A;  2P81 A;  1BI1 A;  2L7M P;  3FXR A;  4G94 A;  1X1A A;  1STZ A;  5LEJ A;  5D4S A;  1GDT A;  3HJE A;  3N97 A;  4K2E A;  2XGX A;  5M5X J;  4A3J J;  1D8K A;  3ASO H;  1QZZ A;  4GGG A;  4RM3 A;  3DEU A;  1EA3 A;  3ZN1 A;  1TZL A;  3D1N I;  2LK2 A;  4GCV A;  4BY7 J;  3S1R J;  2I8D A;  2W48 A;  4XLH A;  3WTY C;  2DFH A;  1O7L A;  2V1U A;  1ETX A;  3BDD A;  2X48 A;  2R92 J;  2IVM A;  4GO1 A;  1VQP I;  2AXL A;  3V4G A;  2RNJ A;  1PP7 U;  1ZLK A;  4KN4 X;  4U0W A;  1P2F A;  4AIJ A;  3C2G A;  2KLO A;  3K2A A;  3BY6 A;  5L3E A;  3R61 A;  5TJJ A;  3BPX A;  3V8L A;  2VOO A;  1FEX A;  5B1A H;  4XSZ F;  3ERE D;  3SZP A;  1X19 A;  2HQA A;  3LQQ A;  1J0R A;  1P7J A;  2M2E A;  1IZ1 A;  1MD0 A;  2JA5 J;  5DTD A;  2DCE A;  4RGR A;  4N0B A;  4EM2 A;  1F4K A;  2M3A A;  1TQP A;  2E2H J;  1TWF J;  3CCY A;  2EFO A;  4HPQ A;  2LYC A;  3U1K A;  2ZME B;  2XRL A;  2DA5 A;  5K1Y A;  2JPB A;  4LOC A;  1YX5 A;  3CTA A;  4YFN F;  1DP3 A;  3CUQ A;  1QRY A;  3PUF A;  3BRO A;  4BQQ A;  5F1J A;  3OIO A;  4KT5 C;  1FBQ A;  3GTQ J;  1MDM B;  4EJU A;  2Y0M A;  1R71 A;  2Y30 A;  4FAS D;  3HSE A;  3QOE A;  4I01 A;  2JK3 A;  3OYL A;  3PSF A;  3H35 A;  5HOO A;  3FXL A;  3K4C A;  1FX7 A;  2OD5 A;  4B3A A;  5DV5 A;  1VQM I;  5L3G A;  1WZ2 A;  2MD5 A;  1D0X A;  1MMG A;  3HKZ N;  1OFC X;  3PUB A;  4A6E A;  1YRN A;  4LD5 A;  3I0T A;  4LB5 A;  3KFW X;  4IOA F;  3GX4 X;  1ETO A;  1UG2 A;  1UHM A;  3I53 A;  1EF4 A;  2FNA A;  1UCR A;  4MFD A;  3D5L A;  3RTR A;  3HUG A;  2FBI A;  3ZQ7 A;  5LRR A;  1YIJ I;  1SEU A;  3BR3 A;  2XRN A;  1A6Q A;  3CMA I;  2L01 A;  1I50 J;  3RYP A;  1S7A A;  3BQY A;  2DA3 A;  3H5A A;  4HF1 A;  3A2K A;  3T8T A;  2FXA A;  3ZMZ A;  1ORK A;  4G12 A;  5F04 A;  3MMY B;  3TOB A;  4L0Y B;  1LVK A;  1OR7 C;  4M9Z A;  1WGX A;  3SFZ A;  2XAJ A;  3DTE A;  4ZJZ A;  2Q8K A;  1NHA A;  2HDW A;  3FXQ A;  3NQO A;  2VXZ A;  2EFW A;  4LG0 A;  3WTV C;  1NK3 P;  3IWF A;  5D6E A;  2MG4 A;  1FMW A;  2JMW A;  3TED A;  2HOS A;  3KP5 A;  1SVO A;  4KIB A;  4UV9 A;  1G3T A;  4L0Z B;  4CUG A;  5J47 A;  1TW3 A;  2HTJ A;  2GOM A;  4ITV A;  1PVE A;  1MIJ A;  4YII A;  2ZB9 A;  5M3M J;  2VOP A;  5DM6 F;  3K1M A;  3E0J B;  2F6C A;  4L5I A;  4PSW A;  2DT6 A;  1BC7 C;  4MFE A;  3CJT B;  1ZH5 A;  1S29 A;  3ZGK A;  4EEF G;  3OYJ A;  3CCJ I;  2M0M A;  4HG2 A;  2O6G E;  2V7F A;  2B63 J;  1R6R A;  4IXA A;  4XLA A;  2LSO A;  4BAC A;  4PGG A;  3NWS A;  1ON2 A;  4JQF A;  2HU9 A;  2WA0 A;  2LD5 A;  1MNE A;  4C3I J;  1X58 A;  4LIU A;  2DOA A;  3JW4 A;  1BC8 C;  1IF1 A;  5K5Q A;  1VI0 A;  3TGN A;  1FTZ A;  3E5U A;  4UUT A;  3HG9 A;  1JT0 A;  2E7W A;  1ZRC A;  4U88 A;  1LDJ A;  2IT0 A;  3HDD A;  5JHF A;  1BR1 A;  2W57 A;  4E7H A;  1NTC A;  2EA4 A;  3QWL A;  3CCV I;  2EZL A;  5BPD A;  1X3Z B;  2DO7 A;  1UHW A;  2WTE A;  1JGG A;  2OQR A;  2DMN A;  4EM1 A;  1LE8 B;  4DBR A;  3N4M A;  4PCQ A;  3W2W A;  5LLQ A;  1SMY F;  5ICE A;  5J6X A;  2Z16 A;  5EDN A;  1SD7 A;  3MZ8 A;  1H88 C;  1WJE A;  3GEZ A;  1ONV A;  3KZZ A;  2JUG A;  3WGH A;  5JVG F;  1ZAO A;  3S1N J;  3BR1 A;  4KT6 A;  2EV0 A;  2MH2 A;  3ZQI A;  1RR8 C;  1KQ9 A;  1POG A;  2MLG A;  2PJR A;  3T8R A;  3G1M A;  3AG1 H;  1ETK A;  3BT9 A;  1YRN B;  5CVI A;  2RC4 A;  2DYS H;  2IRF G;  3GTO J;  1VQK I;  3OIQ A;  4BNC A;  4LLG F;  3ISP A;  1U0J A;  2LBF B;  3ZOB A;  3EDP A;  2HTS A;  4ESB A;  2PI0 A;  4MIM A;  4BUP A;  1IN8 A;  2IEK A;  4AVP A;  2FRH A;  4E7K A;  3BZC A;  3W6K B;  2UUZ A;  1MSE C;  4ENK A;  3MKW B;  3Q9V A;  1EKE A;  4AIK A;  3RKQ A;  3H0G J;  4RAF A;  4Y52 J;  1QPM A;  3C1D A;  5F64 A;  3L2U A;  4A5N A;  3F23 A;  4ZC3 A;  4N9I A;  3FHZ A;  4BEH A;  2ZCW A;  1VQL I;  2DDB A;  1YS7 A;  2BY2 A;  1BL0 A;  1I27 A;  2XB0 X;  4S05 A;  2LKS A;  3CMM A;  3Q9S A;  5FRM A;  4C2M J;  4F52 A;  5IP6 A;  2E1M C;  2Q0O A;  1FYM A;  1QBJ A;  1S8N A;  3BP8 A;  2F5C A;  2W25 A;  4S0H B;  3HGG A;  1N77 A;  3OL4 A;  4C9Y A;  1UG0 A;  4OAZ A;  4AM3 A;  2R5Y B;  2QQ8 A;  3I54 A;  2XGC A;  3E7L A;  3BWG A;  3WHC A;  3BR0 A;  2COM A;  3J7Z I;  4A2U A;  1MGT A;  2J5P A;  3A02 A;  3W2V A;  1H89 C;  2K5C A;  2CO5 A;  2STT A;  1S72 I;  2OV7 A;  5H6Q A;  5FKL A;  3IC7 A;  3T1B A;  1YI2 I;  3GF2 A;  2HOA A;  3GTK J;  3S15 J;  3C18 A;  1AA7 A;  4MTE A;  3SEZ A;  1XSD A;  4JP0 A;  2DFF A;  2VON A;  2V6C A;  4NNJ A;  3VFZ A;  5J4Y A;  2FMY A;  3DKX A;  2R0Q C;  4EAT A;  4IHS A;  5LGU A;  3EYY A;  4G6D A;  1R49 A;  1X3W B;  4CCK A;  4YIF A;  3AL0 C;  5ED4 A;  4XN3 A;  5LFA A;  5FB2 A;  5ICF A;  2A6H F;  3AFH A;  3LA7 A;  1GT0 C;  3H36 A;  2HI3 A;  2Y69 H;  1O3S A;  1JKR C;  1MMD A;  4H0E A;  3Q0V A;  4XLN F;  2DMT A;  2X6W A;  2IXS A;  2LH9 A;  4P96 A;  4UY8 I;  1O7F A;  3M07 A;  5KNL A;  1IRZ A;  4KJZ A;  1I39 A;  2W7N A;  2BHZ A;  1IRF A;  2Z99 A;  3C2H A;  4RAY A;  2HDD A;  3V42 A;  4MHG A;  5GAE J;  4KMU X;  2DXI A;  4HLX A;  1S3J A;  1TTY A;  4DZJ A;  2FQ3 A;  2QVO A;  3L09 A;  1HDP A;  3G3Z A;  2OF7 A;  4XQF A;  4EM0 B;  5BNG A;  4FT8 A;  4FX4 A;  1BM9 A;  3K4L A;  3U21 A;  2CUE A;  1LFP A;  3E5Q A;  3EUA A;  2G0E A;  5IPA A;  2CV2 A;  5GAD J;  3DXJ F;  4YFX F;  1YW9 A;  2VKH A;  2DW4 A;  4IHV A;  2O9L A;  2NYX A;  4PZJ A;  4XKC A;  2JT1 A;  1A04 A;  2O5R A;  4ASN A;  1D0Y A;  3DU6 A;  3ZN0 A;  2IS4 A;  2XAU A;  3WGG A;  3TOA A;  3CJR B;  2R7O A;  2DBB A;  1VQ6 I;  3HOU J;  2ELK A;  3OL3 A;  2ZXI A;  4A3C J;  2WC2 A;  2A3S A;  1K61 A;  4Q5S F;  1HW2 A;  2Y9Y A;  3T0Y A;  4HLY A;  1WCM J;  1Z3Y A;  2TCT A;  1Z91 A;  3K10 A;  4XL9 A;  4RLQ A;  1MMN A;  3GFM A;  5LBQ A;  1RET A;  1IO2 A;  1W5S A;  2KRF A;  3TO6 A;  1LB2 A;  1Y6I A;  3CUO A;  4PGH A;  2UWM A;  3JSP A;  4AIH A;  3REO A;  3RPQ A;  3ECH A;  2Z2S B;  4C3J J;  2EIM H;  2IA1 A;  5K5R A;  2KHM A;  3RI4 A;  3KLN A;  5E8I A;  2KQR A;  3M8J A;  2ETH A;  3R0A A;  4BXX J;  3GLL A;  3QPH A;  4OIO F;  1DU6 A;  1B8I A;  1DGW Y;  4I2O A;  4IZZ A;  1I3A A;  4B47 A;  3IKT A;  1EH8 A;  3MEX A;  1XMK A;  3P9K A;  4C2U A;  2HYJ A;  2LDU A;  5DD8 A;  4P5O A;  4P9U A;  1FTT A;  1YTY A;  2RKH A;  2VJI A;  3WTX C;  3SJM A;  4IRI A;  1FP2 A;  4XRF A;  1T2K A;  3KP7 A;  2LG4 A;  5HVQ C;  1YW8 A;  2R4G A;  4KA4 A;  2ZXH A;  2WB1 N;  3ABL H;  2A05 A;  2K9L A;  3HOV J;  2PLY A;  3HBL A;  5HS9 A;  1LUJ B;  1R7J A;  2LF7 A;  3S8P A;  3IKV A;  2LY9 A;  5E20 A;  3NWT A;  2E5Z A;  2HNH A;  4HEA 2;  1RC9 A;  4QSH A;  3I58 A;  4M73 A;  3WTZ A;  2PMZ A;  5IYD J;  3OIP A;  2VT2 A;  3EUH C;  2M7A A;  4CCJ A;  2VKD A;  3CO7 C;  3C2B A;  2ELJ A;  3NRV A;  1FT9 A;  5EZG A;  3HOT A;  1IUY A;  2XAS A;  5BOX A;  4EJV A;  1LKX A;  1MJ9 A;  1LEB A;  1TQI A;  2XIG A;  2IPQ X;  4E7I A;  1X1B A;  3C7J A;  1O3R A;  1U9N A;  2D1V A;  4JOM A;  3UNG C;  3M8F A;  4KIG A;  1LEA A;  1P7I A;  2CW0 F;  2QQ9 A;  1SAX A;  4A3D J;  1WFX A;  1BJZ A;  5JI6 A;  5FD6 A;  1PUE E;  4QWQ A;  3PJR A;  3DKY A;  2GXB A;  5E3N A;  3ROU A;  2FOK A;  1ODD A;  3P9I A;  3ESW B;  3BJO A;  4RB2 C;  3KIO A;  2XPW A;  2F4I A;  2IGK A;  3JTH A;  1OIS A;  3IH2 A;  3DKW A;  3QAH A;  1IN5 A;  3FXO A;  1YOV B;  2XVC A;  1I5Z A;  3ZP5 A;  2MYS A;  4BE1 A;  3HZJ A;  4RMN A;  3AAF A;  4X6A J;  4RGU A;  2K4J A;  4FIS A;  2ISZ A;  1G3Y A;  2GIV A;  1U5T A;  3O8G A;  5FO5 A;  1E3H A;  2GLO A;  2DDA A;  5IOY A;  1FC3 A;  1T56 A;  2MC4 A;  2KRH A;  1C0W A;  2NVT J;  4XOR A;  1SD6 A;  1Z21 A;  2FML A;  1X3U A;  2R5Z B;  2VB6 A;  3S17 J;  1LPQ A;  4EGZ A;  1QO0 D;  4G7Z F;  1UZC A;  2HQR A;  3W6J B;  1ITY A;  1VND A;  4MQV A;  5JLX A;  2DPU A;  4KIC A;  1X2M A;  2RNG A;  1XDS A;  1R9T J;  1K78 B;  1Z3X A;  3BQZ A;  4E7S A;  2FBH A;  2XF6 A;  1T0F C;  4M6V A;  3NAR A;  1OPC A;  1SD4 A;  3LSP A;  3QP5 A;  2K4B A;  4ZH4 F;  1OCO H;  1VZ0 A;  2DT5 A;  2ACJ A;  3GO5 A;  1GV5 A;  3F8M A;  3I55 I;  4LLN A;  1GVJ A;  3GFJ A;  2X1D A;  3JSO A;  4P1W A;  4HQM A;  4I6Z A;  5GTI C;  1V55 H;  3K2Z A;  2LVS A;  4A0Z A;  1OQY A;  4CH7 A;  2W4S A;  2KIM A;  2XAH A;  1ULY A;  3WE2 A;  2UV1 A;  1FY7 A;  3CCQ I;  3FMR A;  1KGS A;  3OOP A;  1ZTR A;  1Z0X A;  2ZME A;  3P5J A;  3S3O A;  2CSO A;  1T98 A;  1FJL A;  1UAA A;  3AG4 H;  1K83 J;  3MKZ A;  3R6S A;  3CDH A;  2LY2 A;  2XDV A;  3BR5 A;  3SYT A;  3ERM A;  1FYK A;  3DFG A;  2HPM A;  3ZMT A;  1MDM A;  2HDC A;  3GTM J;  1Z9C A;  5E8G A;  2CQX A;  4HV5 A;  1YLF A;  5ICG A;  2F5D A;  4U7D A;  2OJE D;  2MLK A;  3KZY A;  2EBI A;  4ENM A;  2KIS A;  5FKN A;  3A0B C;  1IN7 A;  3ECO A;  4I7H A;  2M9H A;  2OPT A;  3S2H J;  2TDX A;  2L5Q A;  2Y0S A;  1ZN2 A;  2X1C A;  3FX3 A;  3IAM 2;  5HS8 A;  1XDU A;  4GDF A;  4XSX F;  1NK2 P;  2ZC2 A;  5FLX K;  2J5O A;  4HV6 A;  5LGT A;  1LFB A;  1W5C C;  5DD4 A;  3HOS A;  2WB1 A;  3CP2 A;  3S2W A;  1WRJ A;  1E3O C;  1FWZ A;  3K0L A;  4AWX B;  1T95 A;  5CPR B;  2DI3 A;  2X51 A;  3VOD A;  4IL6 C;  5KAI C;  1LFU P;  1JE8 A;  5JFR A;  2L2O A;  1KU2 A;  2DA4 A;  2BXY A;  1FOX A;  2FX0 A;  2VBZ A;  1MBK A;  2PQ8 A;  2QF7 A;  3DBR B;  4NDL A;  1K4S A;  3DPL C;  4M3G A;  3L7W A;  5B5E C;  3KZI C;  5H20 A;  5LGN A;  3SXY A;  2KKO A;  1BIA A;  3QYB A;  2R7W A;  1FMV A;  4B8X A;  4F93 B;  1XD7 A;  2BY3 A;  5IOZ A;  2GA2 A;  5DCF A;  3GLX A;  2XPV A;  2R7F A;  2QQA A;  1RUN A;  2V9K A;  3Q0W A;  4CZC A;  2CRG A;  4X1E A;  1ACI A;  1FOK A;  3PNV A;  1VQ9 I;  2DT7 B;  2FA5 A;  3J81 Z;  4YFK F;  2BEO A;  1ZRE A;  1HSJ A;  1JTY A;  3H1C A;  2ME6 A;  2DOD A;  2QLZ A;  3HRT A;  3HEF A;  1FZP B;  2WAQ A;  3E3V A;  4NC8 A;  3KP6 A;  1GXP A;  2F48 A;  2K40 A;  1SC7 A;  3LOC A;  4U0Y A;  1IN4 A;  2DAO A;  2XRO A;  1J9I A;  1KQ8 A;  2F2E A;  1OCP A;  2C6Y A;  4F3Q A;  1Q1H A;  1QVU A;  4BHB A;  1UHS A;  3TW7 A;  4OMZ A;  3E97 A;  3I56 I;  2W24 A;  1MBH A;  4DJA A;  2NVU B;  1JUM A;  1W1W E;  1B59 A;  2E1N A;  3OYE A;  1JKO C;  4XLP F;  2EIN H;  2JN6 A;  3BOQ A;  1L3L A;  1G59 A;  1Y0U A;  1JT6 A;  3RZD J;  3F8C A;  3ASN H;  3ZMS A;  1XSX A;  2JPC A;  3RJP A;  1RIO H;  3E6M A;  4WWC A;  4A3I J;  2JQ7 A;  3CCL I;  2Y31 A;  3QQA A;  4D7M A;  1LE8 A;  2BW3 B;  5FLM J;  3FXU A;  4AYB N;  4A3K J;  2HQ5 A;  5LD2 C;  5KVR A;  3VYR B;  3PO3 J;  2DOF A;  4A0X A;  1SFE A;  3QYF A;  2W00 A;  2D5V A;  3R4K A;  4B3X A;  1QHH D;  5KCM A;  2CW8 A;  2ESN A;  1N25 A;  5D5U B;  4E4H A;  4WX9 A;  2LY1 A;  1WJ5 A;  3CME I;  1JHH A;  3H9G A;  1U8B A;  2HOT A;  3GWZ A;  2XUB A;  2CUF A;  1R4N B;  3JRH A;  3L2W A;  3PQJ A;  1R23 A;  1OCT C;  2ECC A;  3S1Q J;  3EYI A;  3GXO A;  3OS0 A;  4W1U A;  3ZMU A;  1J7K A;  2LBF A;  1SFK A;  3GFL A;  4CIC A;  2Y9Z A;  1DP7 P;  3DU5 A;  2UZK A;  1OCZ H;  1T39 A;  3HYI A;  3VYT B;  3HM5 A;  3OOU A;  3S3M A;  1RZ4 A;  1WWX A;  4RM2 A;  3CUQ C;  4B1R A;  3VYS B;  2GZW A;  3OYF A;  3U2R A;  1ENH A;  3BG9 A;  3FF5 A;  1KON A;  4J01 A;  1B9N A;  4ZDL A;  4B43 A;  2M0C A;  4B44 A;  4LB6 B;  3ZQL A;  1SVM A;  1Q1V A;  4D5C A;  3M3Y J;  2DA6 A;  2JWT A;  3C3W A;  2XAG A;  3M1C A;  1J09 A;  2XGE A;  5IYB J;  4BBR J;  4UNO A;  1HC8 A;  1IRG A;  3LFU A;  1LNW A;  5AON A;  4DYR A;  3HB9 A;  3RPU D;  2MA3 A;  3OS2 A;  3NEU A;  1V4R A;  4L5E A;  1KZH A;  2R7D A;  4EJO A;  1JUS A;  5K7F A;  3H3Z A;  5AIP A;  3QPS A;  4YIR X;  2VC1 A;  2R5Y A;  4HYE A;  2QM3 A;  4XLE A;  1ZKG A;  1H8A C;  5IYC J;  1QU3 A;  1X1D A;  4ZYG A;  4GXO A;  3M8E A;  2EB7 A;  2YX7 A;  3SZT A;  3VB2 A;  3E1S A;  3R0J A;  1I6X A;  1XTA A;  1ZEL A;  3AKZ A;  2VC0 A;  1TWC J;  1ZHF A;  4A69 C;  4BY1 J;  3ML6 A;  3JRC A;  2B9S A;  2HKO A;  3ELK A;  3K1P A;  3WHB A;  2ZNZ A;  4QIW N;  1KU7 A;  4A3G J;  5IY5 H;  1MMA A;  3J81 K;  1IW7 F;  2CQ7 A;  5D5V B;  3FKJ A;  3FHN A;  1JJ8 C;  3FKI J;  3GTJ J;  2D2W A;  4UV8 A;  4DOZ A;  4IHT A;  4HQE A;  2FNP A;  6PAX A;  5F0C A;  5ILU A;  3TMO A;  1F1Z A;  3BTJ A;  2QBY A;  4QTR A;  2MD0 A;  4IX7 A;  2JA7 J;  1D1A A;  4HZF A;  3ZRG A;  1ZGW A;  2Z3Y A;  2H1K A;  4AC0 A;  1KA8 A;  4RGX A;  4CYD A;  1XGO A;  1MJB A;  2JUC A;  2FE3 A;  2XC7 A;  1AOY A;  1XC5 A;  1VTN C;  4Z6Y A;  4CO8 A;  1ZG1 A;  2O7O A;  2LLK A;  4ETS A;  2DA1 A;  4Q48 A;  5CKT A;  2M8G X;  3VSL A;  3LSK A;  2KZG A;  4BDZ A;  2FOW A;  5J8C A;  1E17 A;  3HL2 A;  1WJD A;  1BR2 A;  2PMU A;  2EFP A;  4CYC B;  3QP6 A;  2OCE A;  3KP4 A;  4I99 C;  4QPQ A;  1ETQ A;  3S2D J;  2KZV A;  5CLS A;  3IAS 2;  3L9F A;  2CH0 A;  4BDY A;  1H9G A;  1DGR M;  2XSD C;  2R7S A;  5EG0 A;  3OYD A;  3TQN A;  2OC6 A;  2A61 A;  3G71 I;  2A69 F;  3W6V A;  4HRI A;  2GXG A;  1VQ4 I;  5BQT A;  3I64 A;  2EIK H;  2FEZ A;  3ZQF A;  2WWY A;  3OY9 A;  2DU9 A;  3TL4 X;  4LJZ F;  3WOD F;  4IVN A;  5FKM A;  2R93 J;  4OIN F;  4RB3 C;  1P4A A;  4V2F A;  3HTS B;  5B66 C;  4ZYE A;  2VN2 A;  4M3F A;  2ZSH B;  3S32 A;  3PL8 A;  1MBF A;  3I71 A;  3VYU B;  1U8R A;  2D45 A;  4W97 A;  3FWE A;  1XX5 A;  2H8R A;  2QWW A;  4U87 A;  4DYC A;  3IV5 A;  1VQO I;  2EJR A;  4IPA A;  4RBO A;  3BG5 A;  1MJA A;  1OLT A;  3WG7 H;  1GV2 A;  2RRE A;  1L0O C;  4UXN A;  4UUV A;  3IWZ A;  1RR7 A;  4BQN A;  1U3E M;  1MNM C;  1R5H A;  2L9R A;  4Q4Z F;  2ECB A;  1MBE A;  4OWR B;  2KDZ A;  2QEN A;  3KPH A;  1TNT A;  1K6O A;  1X4P A;  4M9X A;  1T6S A;  1WJC A;  2BXZ A;  3HKZ A;  2M8E A;  2OCC H;  2P6S A;  3LSM A;  3KYL A;  2GXA A;  2P6T A;  4JYK A;  2E35 A;  5GPC A;  1A5J A;  1E2X A;  1J59 A;  1AKH B;  3HHH A;  3U1D A;  1UJ8 A;  3GBG A;  1HBX G;  5FLV A;  3DLL F;  3F6V A;  3RZO J;  4CDG A;  4M6Y A;  3LA3 A;  4EJW A;  4HNT A;  3CES A;  3VOE A;  4M71 A;  1I3Q J;  2ZJ2 A;  4PJJ A;  2ZBK A;  2IAI A;  5GAG J;  4R8H A;  1D1C A;  1B1B A;  4PDK A;  1YFH A;  1V5E A;  1HW5 A;  2DTZ A;  2P0W A;  3K69 A;  2DQR A;  4HST A;  3RQ4 A;  4F7Z A;  2VIX A;  1QGP A;  3MN2 A;  2L9V A;  2QBY B;  1BA5 A;  4MEY F;  4ZYD A;  3J7A O;  2A68 F;  3CCM I;  1S6L A;  4KIT B;  3PFY A;  2PBI A;  4JBA A;  4O3M A;  2HYG D;  3HOZ J;  1XMX A;  2NAZ A;  4AD9 A;  2E7X A;  1OJL A;  3E5X A;  4AU7 A;  2DYR H;  3DBL B;  4LMY A;  4UB6 C;  3SFI A;  4BXU A;  5E18 F;  1FBS A;  4A12 A;  1XMA A;  2NS7 A;  4D9J A;  2KT0 A;  1ZG3 A;  3K6G A;  1GUU A;  4HX8 A;  4PFO A;  5CQG A;  3LFK A;  1GVD A;  1FYL A;  4YEL A;  3J80 Z;  4RAG A;  3Q5F A;  1YYV A;  1OMI A;  5FFZ A;  2B7E A;  2G9W A;  5L3D A;  2Y2Z A;  2M87 A;  4IHY A;  1A36 A;  3F9K A;  1IDZ A;  2PX9 A;  5FFX A;  2DTR A;  1CF7 B;  1JHF A;  3AG3 H;  2IGN A;  2RDP A;  3E6B A;  1K4T A;  3DTK A;  5EG0 B;  3CF2 A;  4ZDO A;  3GYH X;  4PJ0 C;  1HF0 A;  2KFD A;  5JR3 A;  1HST A;  1X4O A;  3FXM A;  1DPU A;  1IRX A;  2E1M B;  1QA6 A;  3LST A;  2ADU A;  1B9M A;  4UVB A;  3CC7 I;  2XF7 A;  2EZH A;  4B09 A;  4GYI A;  2VI6 A;  3CDI A;  4YEJ A;  3GTP J;  4AUX A;  5FKO A;  3CMY A;  3MAJ A;  2CFO A;  2V9V A;  2ZFW A;  3CD6 I;  3IUO A;  2VPL A;  2ID6 A;  3IH3 A;  1P6R A;  3BR2 A;  3HRU A;  2JRT A;  4XM3 A;  4IQ4 A;  5DYM A;  5K7Z A;  1G3S A;  1EV7 A;  3H9J A;  1EH6 A;  1JGS A;  3G2B A;  5EGO B;  5GPA A;  4U0V A;  1MKM A;  1NG7 A;  1Z6R A;  5EEG A;  1PUF B;  1PJR A;  4XK4 A;  3M4O J;  1EH7 A;  3KP3 A;  5LEK A;  4XRS G;  2EQR A;  2VQH A;  4A3B J;  4XRM A;  2HS5 A;  5D8L B;  3BZK A;  3OR1 C;  2R5Z A;  3LAP A;  1IAW A;  3D0S A;  2E2I J;  2HVQ A;  2L9N A;  3BCB A;  1D5Y A;  3K9T A;  2NOG A;  3PQK A;  2NNY A;  3ZXS A;  1TL8 A;  1XCB A;  4Z2Y A;  1XGS A;  5M5Y J;  3BLY A;  5M5W J;  2V1N A;  1K78 A;  4I02 A;  4BAY A;  3SDB A;  3A4C A;  4BE2 A;  1ZRD A;  2YS9 A;  3AL0 B;  5EJC A;  1IGN A;  1P9Q C;  4RB1 A;  4KNY A;  3D5S C;  5E1Z B;  3OR2 C;  4LG3 A;  3RDI A;  4C2T A;  2WY8 Q;  4M9S A;  2EFQ A;  3BC8 A;  4XR6 A;  3OS1 A;  1BR4 A;  1VQ7 I;  2GAU A;  2JA6 J;  1W5T A;  3BJ6 A;  3PO2 J;  1G4D A;  2PMH A;  3KEY A;  1BOB A;  1Z6T A;  2LKP A;  4F91 B;  1D1B A;  3DV8 A;  3FZV A;  2ZXJ A;  3O6B B;  3HOY J;  1ZGJ A;  4M3B A;  2IS1 A;  2A07 F;  1U6G A;  2L4M A;  1W7P D;  1R00 A;  2CS3 A;  5LHG A;  3KLO A;  5ERI A;  1B72 B;  1OKR A;  4KIF A;  2FJ1 A;  5J4V A;  4LIT A;  5GP9 A;  4IHW A;  3BJA A;  1PYV A;  2CQK A;  2QYO A;  2QKL B;  3LL7 A;  4HDU A;  2EIJ H;  2P5V A;  1I1S A;  3K4M A;  3DEW A;  1ZR4 A;  2F4O B;  2W84 A;  1BW6 A;  2DJI A;  1X1C A;  1TLH B;  2CUJ A;  2DK5 A;  2EIL H;  3KX2 A;  3H3V K;  2MGQ A;  1KU9 A;  2RAE A;  3K4J A;  1Y1V J;  4E70 A;  4DBQ A;  4D5F A;  1WHU A;  4ZZL A;  3ULQ B;  1YHQ I;  2O8X A;  2OAZ A;  2WY7 Q;  4BHC A;  1TC3 C;  2XKP A;  3SHF A;  4N4O B;  4AID A;  1MMS A;  5IT9 Z;  1DPR A;  2CFX A;  5J8F A;  2EK5 A;  4HX4 A;  1BI3 A;  5CVU A;  3CZ6 A;  4RDU A;  1MND A;  3WU1 B;  2NRA C;  4DIQ A;  3J80 K;  3CJQ B;  4UVC A;  5E3M A;  4HX7 A;  2CV0 A;  4OIP F;  3JAM Z;  1DUX C;  3I59 B;  4L9J A;  4H4K C;  2NVX J;  4M72 A;  1F36 A;  2NXN B;  3A01 B;  2K02 A;  1WPK A;  2KJC A;  2X6O A;  2M4G A;  2DFI A;  3JRG A;  4L9T A;  5F08 A;  2F5E A;  2NVY J;  4F92 B;  3DLA A;  4LIV A;  5FD5 A;  3OYK A;  5F27 A;  4NQW B;  1R4M B;  4BQA A;  1TP4 A;  3H92 A;  3HPH A;  2CG4 A;  4XOP A;  1REP C;  3OSF A;  1O4X A;  4D0P A;  1SAU A;  3KET A;  4IKF A;  2NVQ J;  4Q47 A;  3OYM A;  2Z9O A;  2JTV A;  2X9D A;  3G6E I;  2LKX A;  2H6C A;  2KIF A;  1IDY A;  2CWE A;  1ERD A;  3CQZ J;  2DN0 A;  3Q3S A;  1D3Y A;  1SMT A;  5FGM A;  1XGM A;  2FSW A;  4XLF A;  4IO9 F;  1XCV A;  3WU0 A;  4WXD A;  2OZ6 A;  1R1T A;  2KPM A;  1FBU A;  1S7E A;  1Y39 A;  1JKP C;  3I5U A;  1TWG J;  3S1M J;  3MD2 A;  3GZ5 A;  1UEL B;  1J5Y A;  5KHD A;  1PDN C;  2VLA A;  2K27 A;  4L9N A;  5EEA A;  5M3F J;  4E7Z A;  2HWV A;  1MBG A;  2O0Y A;  2GWR A;  2K9M A;  3SEQ A;  1DDN A;  2LRE A;  4F55 A;  1YJN I;  2VQG A;  4HDV A;  3CF5 F;  2H94 A;  1TBX A;  2HXI A;  1GLN A;  2VT3 A;  4GFB A;  2JSC A;  1MSF C;  2MC3 A;  3F6O A;  2KP6 A;  2O03 A;  5D5W B;  2YSR A;  3DQV C;  2GIZ A;  4II3 A;  1XSV A;  3ZQG A;  1NG6 A;  5EYR A;  2VJ5 A;  3VSK A; 
#chains in the Genus database with same CATH homology
 2IJL A;  3F8N A;  4G6Q A;  3V8K A;  1FSH A;  1WSU A;  2PJP A;  1P4X A;  3HHG A;  1KU3 A;  4OU0 A;  2YX4 A;  4KFC A;  4ENN A;  5EEH A;  4NHJ A;  1TQM A;  1F9N A;  4BYY A;  4S04 A;  1LQ1 A;  5D6F A;  1HKQ A;  1HKS A;  2NNN A;  2MBF A;  2PEX A;  2QZ8 A;  2L3D A;  1B6A A;  1BIB A;  3I4P A;  2A6E F;  3RKY A;  1FSE A;  2ESH A;  4WK8 F;  2EV6 A;  3F8F A;  1UST A;  3WGI A;  3G73 A;  3JAM K;  3HRS A;  1R1V A;  1USS A;  3LA2 A;  4LK1 F;  3FMS A;  2ISY A;  3FMQ A;  4R79 A;  2HQN A;  2BE5 F;  1I1G A;  1QQI A;  2Y75 A;  2BBY A;  3L00 A;  2ELH A;  5JVT A;  1BI0 A;  4ON0 A;  3V8J A;  2OA4 A;  4Y13 A;  2M30 A;  1OYI A;  2IA0 A;  3LAJ A;  5HS7 A;  1ZG5 A;  2RV8 A;  3KCC A;  2HKX A;  4WF2 A;  3IRQ A;  4WCG A;  1YIO A;  2DQL A;  2HZT A;  1B4A A;  2DLL A;  4FHT A;  3CO6 C;  4HF0 A;  3COA C;  1XGN A;  5CYV A;  2YPR A;  3MZH A;  3ABU A;  2BV6 A;  5D4R A;  1W7P B;  3F72 A;  3BZ6 A;  3GZ6 A;  2JZY A;  5E17 F;  5HDK A;  3QU3 A;  2LNB A;  1J2X A;  4OIQ F;  4P55 A;  2KJB A;  4MGR A;  4I98 B;  3DPT A;  1FLI A;  3DP7 A;  4WXH A;  1SD5 A;  5E1X A;  1OR7 A;  4IRG A;  2Y48 A;  1V3F A;  3HIF A;  2E1C A;  3PFI A;  2OU2 A;  2RN7 A;  4JK1 X;  3DF8 A;  4R1H A;  1FPQ A;  3HSR A;  1Z1D A;  4ESF A;  1ZAR A;  4L5J A;  3ZPL A;  1D5V A;  2VOD A;  4RGS A;  2OBP A;  5HLH A;  2EWN A;  1BJA A;  4KDP A;  5CVV A;  3IRR A;  2CYY A;  4KMF A;  3WE3 A;  4MQ9 F;  1YG2 A;  3RYR A;  1QZY A;  1ZGA A;  5KK1 A;  3GFI A;  3SQN A;  2X0L A;  3WTT C;  4RB0 A;  3GW2 A;  1FP1 D;  2IA2 A;  5AIQ A;  1YS6 A;  1IXC A;  2EV5 A;  1Z05 A;  5DUI A;  1LVA A;  1TW2 A;  1OYW A;  4BH9 A;  3TKY A;  2EFN A;  4EJT A;  1P4W A;  4N9H A;  2OQG A;  1BBY A;  3JTG A;  1MZB A;  4LK0 F;  2P7C B;  3KE2 A;  4DQ2 A;  3MWM A;  3EET A;  1G6N A;  3MCZ A;  1IXS B;  2BGC A;  2X4H A;  4P9F A;  4DNC A;  3CUQ B;  1O57 A;  1R1U A;  4HW0 A;  4ESJ A;  1CF7 A;  3ZMD A;  4CXF A;  2O61 A;  1LJ9 A;  3VEP A;  4UHT A;  3QRF F;  1KQ0 A;  1ZYR F;  1BOA A;  3F22 A;  1G3W A;  4QLC U;  4G7H F;  4I09 A;  2XHK A;  5CJ9 A;  1R5G A;  4EMS A;  3RIR A;  3ZMV A;  2LF8 A;  4TV7 A;  3IHU A;  1GHC A;  1XB4 A;  2W85 A;  4OMY A;  2CGP A;  3RPU A;  1P92 A;  3ABT A;  1S7O A;  2HR3 A;  2V1X A;  1HXD A;  1WI9 A;  1XN7 A;  2L54 A;  4IRH A;  5DEQ A;  1U78 A;  5DCM A;  3K1N A;  1SFX A;  1H9T A;  4LG0 B;  3HTU A;  1HKT A;  4MNU A;  4A6D A;  4OIR F;  2M5W A;  2O3F A;  1YW7 A;  3FM3 A;  2DPD A;  2B0L A;  5A2Q Z;  2HOE A;  5HDN A;  4HBL A;  2QQB A;  3WTU C;  5D8K B;  1K7A A;  5K5O A;  2L02 A;  1WQ2 A;  5BMZ A;  2P5K A;  2PN6 A;  2H27 A;  4OOI A;  2PFB A;  5E1W A;  1BI2 A;  2WV0 A;  2UXN A;  4EQQ A;  2XV4 S;  3F8B A;  1JXS A;  2P5L C;  1HQC A;  2RVC A;  2VBY A;  1QNT A;  1W4M A;  2R3S A;  5IT3 A;  3LQR A;  5CVR A;  5ICC A;  3KEQ A;  4KN7 X;  2XKO A;  3LWF A;  3EQL F;  2NS0 A;  4M6X A;  2V1D A;  2ZO4 A;  3TDZ C;  4ENJ A;  3I59 A;  4U7B A;  4FX0 A;  2ZKZ A;  3B73 A;  5HDG A;  3RKW A;  3QPT A;  2D1H A;  4Y15 A;  4O6J A;  3V7C A;  5DDG A;  1H0M A;  1D8J A;  3CJN A;  1IXR C;  1PP8 F;  2VE8 A;  4NQW A;  1HW1 A;  4LLL A;  3E6D A;  3P9C A;  4CZZ A;  4GYG A;  3KEO A;  2H6B A;  5L3F A;  4CGZ A;  1O3Q A;  5TRD A;  1R58 A;  3M1E A;  1LDD A;  3QOP A;  2FBK A;  2G7U A;  2XAF A;  1ZRF A;  5DCM B;  3HRM A;  5JHU A;  1R22 A;  4ZZD A;  4A5M A;  2P4W A;  4EV0 A;  5LRS A;  4M74 A;  1KYW A;  4HA8 A;  2L4A A;  2MH9 A;  1YQA A;  2K7L A;  1CGP A;  4HF2 A;  3WG9 A;  2M1B A;  2GA1 A;  3EUH A;  2OZU A;  2FU4 A;  5LHH A;  1BN5 A;  3MQ0 A;  3IL2 A;  2HEO A;  3E6C C;  2KIU A;  2HGC A;  2EA2 A;  4O5V A;  2HFH A;  5A2Q K;  5LHI A;  3MZY A;  2VE9 A;  4G8X A;  3L2C A;  2F5F A;  5F6F A;  3F3X A;  3CLO A;  3WTW C;  4MEX F;  4BHP A;  2A5Y B;  5ILV A;  5HLG A;  2K86 A;  4HAM A;  2RQP A;  3TDU C;  2PG4 A;  2V79 A;  3TO9 A;  3BPV A;  2G7H A;  4ZYH A;  4IF4 A;  2AS5 F;  3O2P E;  5ILS A;  4I0A A;  1SFU A;  4LFU A;  4HOB A;  1TNS A;  3H3U A;  4EGY A;  5D5X B;  5FLX Z;  1F5T A;  5L3B A;  5CVJ A;  1FNN A;  3QU6 A;  4I0B A;  3KP2 A;  2M45 A;  4NB5 A;  1K79 A;  2BYV E;  3V7R A;  4XBF A;  1KYZ A;  1UFM A;  2IW5 A;  4L9V A;  2Q2E A;  2UXX A;  4A0Y A;  2RGV A;  1T0F A;  3O3K A;  3P7N A;  4EVI A;  5L3C A;  1T38 A;  4RAZ A;  1UB9 A;  1AWC A;  5DUK A;  4LGW A;  3B02 A;  4G7O F;  3HSF A;  1ON1 A;  1RNL A;  1WKM A;  2STW A;  2P8T A;  1U5T C;  2QUF A;  1Z7U A;  1RUO A;  2P7V B;  4L18 B;  2Z5U A;  4WXC A;  3F21 A;  3MFK A;  4RS8 A;  1J75 A;  2Z33 A;  3FM5 A;  3RKX A;  1ZLJ A;  1W7P A;  3U9G A;  2XAQ A;  3V7S A;  5BS6 A;  1LDK B;  2IP2 A;  4MTD A;  2VBX A;  1YO5 C;  4Y17 A;  1IN6 A;  2HYF A;  3R60 A;  3OV8 A;  2FF4 A;  3M7G A;  2DK8 A;  1OYY A;  5IT9 K;  1R36 A;  5F1R A;  4KYW A;  3WTS C;  5HLI A;  3GVA A;  2H09 A;  2YU3 A;  4CHU A;  4UVA A;  4KUM A;  4G9Y A;  1GXQ A;  4IJA A;  3TO7 A;  3GUD A;  2GQQ A;  4YG2 F;  5H6R A;  1U2W A;  1RI7 A;  5BPI A;  3M9A A;  1U5T B;  2VBW A;  2ZNY A;  1O3T A;  3T5X A;  2YR2 A;  1BI1 A;  3FXR A;  4G94 A;  1STZ A;  5LEJ A;  5D4S A;  3N97 A;  4K2E A;  2XGX A;  1D8K A;  1QZZ A;  4GGG A;  3DEU A;  3ZN1 A;  4GCV A;  3WTY C;  1O7L A;  2V1U A;  3BDD A;  2IVM A;  4GO1 A;  2AXL A;  3V4G A;  2RNJ A;  1PP7 U;  1ZLK A;  4KN4 X;  4U0W A;  1P2F A;  4AIJ A;  5L3E A;  3BY6 A;  3V8L A;  3R61 A;  3BPX A;  5TJJ A;  2VOO A;  4XSZ F;  3ERE D;  3SZP A;  3LQQ A;  1J0R A;  1IZ1 A;  1MD0 A;  4RGR A;  4N0B A;  4EM2 A;  1F4K A;  1TQP A;  2EFO A;  2ZME B;  5K1Y A;  2JPB A;  3CTA A;  4YFN F;  3CUQ A;  3BRO A;  4KT5 C;  1FBQ A;  1MDM B;  4EJU A;  2Y0M A;  3HSE A;  4I01 A;  5HOO A;  1FX7 A;  2OD5 A;  5DV5 A;  5L3G A;  2MD5 A;  4A6E A;  4LD5 A;  3I0T A;  4LB5 A;  3KFW X;  3GX4 X;  1UHM A;  3I53 A;  2FNA A;  1UCR A;  3D5L A;  3RTR A;  3HUG A;  2FBI A;  3ZQ7 A;  5LRR A;  2XRN A;  2L01 A;  3RYP A;  1S7A A;  4HF1 A;  3T8T A;  2FXA A;  3ZMZ A;  3TOB A;  4L0Y B;  4M9Z A;  3SFZ A;  2XAJ A;  2Q8K A;  1NHA A;  3FXQ A;  3NQO A;  2VXZ A;  2EFW A;  4LG0 A;  3WTV C;  3IWF A;  5D6E A;  3KP5 A;  4KIB A;  4UV9 A;  1G3T A;  4L0Z B;  1TW3 A;  2HTJ A;  4YII A;  2VOP A;  3K1M A;  4L5I A;  1BC7 C;  1ZH5 A;  1S29 A;  2O6G E;  4IXA A;  2LSO A;  4PGG A;  1ON2 A;  4JQF A;  3JW4 A;  1BC8 C;  1IF1 A;  5K5Q A;  3TGN A;  3E5U A;  2E7W A;  1ZRC A;  4U88 A;  1LDJ A;  2IT0 A;  2W57 A;  2EA4 A;  5BPD A;  2DO7 A;  1UHW A;  2WTE A;  2OQR A;  4EM1 A;  3N4M A;  4PCQ A;  5LLQ A;  1SMY F;  5ICE A;  5J6X A;  1SD7 A;  3GEZ A;  1ONV A;  3KZZ A;  3WGH A;  1ZAO A;  2EV0 A;  2MH2 A;  1KQ9 A;  2MLG A;  3T8R A;  5CVI A;  2RC4 A;  2IRF G;  4BNC A;  4LLG F;  3ISP A;  3EDP A;  2HTS A;  4ESB A;  2PI0 A;  1IN8 A;  4AVP A;  2FRH A;  3W6K B;  4ENK A;  4AIK A;  3Q9V A;  1QPM A;  3C1D A;  5F64 A;  4A5N A;  3F23 A;  4N9I A;  3FHZ A;  2ZCW A;  1YS7 A;  1I27 A;  4S05 A;  3Q9S A;  2Q0O A;  1FYM A;  1QBJ A;  1S8N A;  3BP8 A;  2F5C A;  2W25 A;  3I54 A;  3BWG A;  2COM A;  4A2U A;  1MGT A;  2J5P A;  2CO5 A;  2STT A;  5H6Q A;  3IC7 A;  3T1B A;  3GF2 A;  3C18 A;  4MTE A;  1XSD A;  2VON A;  2V6C A;  3VFZ A;  2FMY A;  4IHS A;  5LGU A;  3EYY A;  4G6D A;  4YIF A;  5ED4 A;  5FB2 A;  5ICF A;  2A6H F;  3LA7 A;  1O3S A;  4H0E A;  4XLN F;  4P96 A;  1O7F A;  1IRF A;  2Z99 A;  4RAY A;  4MHG A;  4KMU X;  4HLX A;  1S3J A;  1TTY A;  2FQ3 A;  2QVO A;  3L09 A;  3G3Z A;  4EM0 B;  4FT8 A;  4FX4 A;  1BM9 A;  3E5Q A;  3DXJ F;  4YFX F;  1YW9 A;  2DW4 A;  2NYX A;  4PZJ A;  2JT1 A;  1A04 A;  4ASN A;  3ZN0 A;  3WGG A;  3TOA A;  2DBB A;  2WC2 A;  2A3S A;  4Q5S F;  1HW2 A;  3T0Y A;  4HLY A;  1Z91 A;  5LBQ A;  3GFM A;  1W5S A;  2KRF A;  3TO6 A;  1LB2 A;  4PGH A;  3CUO A;  2UWM A;  3JSP A;  4AIH A;  3REO A;  3RPQ A;  3ECH A;  2IA1 A;  5K5R A;  3RI4 A;  3KLN A;  5E8I A;  2ETH A;  3R0A A;  3QPH A;  4OIO F;  4I2O A;  3IKT A;  1EH8 A;  3MEX A;  1XMK A;  3P9K A;  4P9U A;  2LDU A;  5DD8 A;  4P5O A;  1YTY A;  2RKH A;  3WTX C;  4IRI A;  1FP2 A;  4XRF A;  1T2K A;  3KP7 A;  5HVQ C;  1YW8 A;  4KA4 A;  2PLY A;  5HS9 A;  1R7J A;  2LF7 A;  3IKV A;  5E20 A;  3I58 A;  4M73 A;  3WTZ A;  2VT2 A;  3CO7 C;  3NRV A;  1FT9 A;  3HOT A;  1IUY A;  2XAS A;  5BOX A;  4EJV A;  1MJ9 A;  1LEB A;  1TQI A;  2XIG A;  2IPQ X;  3C7J A;  1O3R A;  2D1V A;  3M8F A;  4KIG A;  1LEA A;  2CW0 F;  2QQ9 A;  1SAX A;  5JI6 A;  1PUE E;  5FD6 A;  4QWQ A;  2GXB A;  3ROU A;  2FOK A;  1ODD A;  3P9I A;  3BJO A;  4RB2 C;  3JTH A;  3DKW A;  3QAH A;  1IN5 A;  2XVC A;  1I5Z A;  3ZP5 A;  3AAF A;  4RGU A;  2K4J A;  2ISZ A;  1G3Y A;  2GIV A;  1U5T A;  5FO5 A;  1FC3 A;  1C0W A;  1SD6 A;  2FML A;  1X3U A;  4EGZ A;  1QO0 D;  4G7Z F;  2HQR A;  3W6J B;  4MQV A;  2DPU A;  4KIC A;  1XDS A;  1K78 B;  2FBH A;  1OPC A;  1SD4 A;  3QP5 A;  2K4B A;  4ZH4 F;  2DT5 A;  2ACJ A;  3GO5 A;  3F8M A;  4LLN A;  3JSO A;  1GVJ A;  3GFJ A;  4HQM A;  3K2Z A;  4A0Z A;  2XAH A;  2KIM A;  1ULY A;  3WE2 A;  1FY7 A;  3FMR A;  1KGS A;  3OOP A;  2ZME A;  2CSO A;  1T98 A;  3R6S A;  3CDH A;  1FYK A;  3DFG A;  3ZMT A;  1MDM A;  2HDC A;  1Z9C A;  5E8G A;  4HV5 A;  1YLF A;  5ICG A;  2F5D A;  4U7D A;  2MLK A;  3KZY A;  4ENM A;  1IN7 A;  3ECO A;  4I7H A;  2TDX A;  1ZN2 A;  3FX3 A;  5HS8 A;  1XDU A;  4XSX F;  5FLX K;  2J5O A;  4HV6 A;  5LGT A;  5DD4 A;  3HOS A;  3S2W A;  1WRJ A;  1FWZ A;  3K0L A;  4AWX B;  2DI3 A;  3VOD A;  1JE8 A;  5JFR A;  1KU2 A;  2VBZ A;  2PQ8 A;  3DPL C;  3L7W A;  5H20 A;  5LGN A;  3SXY A;  2KKO A;  1BIA A;  4B8X A;  1XD7 A;  2GA2 A;  5DCF A;  3GLX A;  2R7F A;  2QQA A;  1RUN A;  1FOK A;  2FA5 A;  3J81 Z;  4YFK F;  2BEO A;  1ZRE A;  1HSJ A;  2QLZ A;  1FZP B;  3HRT A;  3E3V A;  3KP6 A;  1GXP A;  4U0Y A;  1IN4 A;  2DAO A;  2XRO A;  1J9I A;  1KQ8 A;  2F2E A;  2C6Y A;  1Q1H A;  4BHB A;  4OMZ A;  3E97 A;  2W24 A;  1B59 A;  2E1N A;  4XLP F;  1L3L A;  3BOQ A;  1Y0U A;  3F8C A;  3ZMS A;  1XSX A;  2JPC A;  3RJP A;  1RIO H;  3E6M A;  4WWC A;  3FXU A;  5KVR A;  4A0X A;  1SFE A;  3R4K A;  2ESN A;  5D5U B;  4WX9 A;  1JHH A;  3GWZ A;  2XUB A;  3PQJ A;  1R23 A;  3EYI A;  3GXO A;  3ZMU A;  1J7K A;  3GFL A;  4CIC A;  1DP7 P;  2UZK A;  1T39 A;  3HYI A;  1RZ4 A;  1WWX A;  3CUQ C;  2GZW A;  3U2R A;  3FF5 A;  1B9N A;  4LB6 B;  3C3W A;  2XAG A;  4UNO A;  1IRG A;  1LNW A;  5AON A;  2MA3 A;  3NEU A;  1V4R A;  2R7D A;  4EJO A;  3H3Z A;  5AIP A;  2VC1 A;  4HYE A;  2QM3 A;  4ZYG A;  4GXO A;  3M8E A;  2EB7 A;  2YX7 A;  3SZT A;  3VB2 A;  3R0J A;  1I6X A;  2VC0 A;  1ZHF A;  3ML6 A;  2HKO A;  3ELK A;  3K1P A;  2ZNZ A;  1KU7 A;  3J81 K;  1IW7 F;  5D5V B;  2D2W A;  4UV8 A;  4IHT A;  4HQE A;  2FNP A;  6PAX A;  5ILU A;  1F1Z A;  2QBY A;  4HZF A;  2Z3Y A;  1KA8 A;  4RGX A;  4CYD A;  1XGO A;  1MJB A;  2FE3 A;  1AOY A;  1VTN C;  4CO8 A;  1ZG1 A;  4ETS A;  4Q48 A;  5J8C A;  1E17 A;  2PMU A;  2EFP A;  3QP6 A;  3KP4 A;  5CLS A;  3L9F A;  1H9G A;  3TQN A;  2A61 A;  2A69 F;  2GXG A;  5BQT A;  3I64 A;  2FEZ A;  2WWY A;  2DU9 A;  3WOD F;  4LJZ F;  4IVN A;  4OIN F;  4RB3 C;  1P4A A;  3HTS B;  4ZYE A;  2VN2 A;  3I71 A;  1U8R A;  2D45 A;  3FWE A;  2QWW A;  2EJR A;  4IPA A;  1MJA A;  1L0O C;  4UXN A;  4UUV A;  3IWZ A;  1U3E M;  1R5H A;  4Q4Z F;  2QEN A;  1TNT A;  1K6O A;  4M9X A;  1T6S A;  2M8E A;  2P6S A;  2P6T A;  1E2X A;  1J59 A;  3HHH A;  3U1D A;  1HBX G;  3F6V A;  4CDG A;  4M6Y A;  3LA3 A;  4EJW A;  3VOE A;  4M71 A;  2ZJ2 A;  2ZBK A;  4R8H A;  1B1B A;  4PDK A;  1YFH A;  1HW5 A;  3K69 A;  2DQR A;  4F7Z A;  1QGP A;  2QBY B;  4MEY F;  4ZYD A;  3J7A O;  2A68 F;  1S6L A;  2PBI A;  4JBA A;  4O3M A;  2HYG D;  2NAZ A;  4AD9 A;  2E7X A;  3E5X A;  4LMY A;  4BXU A;  5E18 F;  1FBS A;  4A12 A;  1XMA A;  1ZG3 A;  4HX8 A;  3LFK A;  1FYL A;  3J80 Z;  3Q5F A;  1YYV A;  1OMI A;  5FFZ A;  2G9W A;  5L3D A;  2M87 A;  5FFX A;  2DTR A;  1CF7 B;  1JHF A;  2RDP A;  3E6B A;  3GYH X;  5JR3 A;  1DPU A;  1HST A;  3LST A;  2ADU A;  1B9M A;  4UVB A;  4B09 A;  4GYI A;  3MAJ A;  2V9V A;  2ZFW A;  1P6R A;  3HRU A;  2JRT A;  5DYM A;  1G3S A;  1EV7 A;  1EH6 A;  1JGS A;  4U0V A;  1MKM A;  1Z6R A;  5EEG A;  1EH7 A;  3KP3 A;  5LEK A;  2HS5 A;  5D8L B;  3LAP A;  1IAW A;  3D0S A;  3K9T A;  3PQK A;  2NNY A;  1XCB A;  4Z2Y A;  1XGS A;  1K78 A;  4I02 A;  4BAY A;  1ZRD A;  4KNY A;  4RB1 A;  5E1Z B;  3RDI A;  4M9S A;  2EFQ A;  2GAU A;  1W5T A;  3BJ6 A;  1G4D A;  2PMH A;  1Z6T A;  2LKP A;  3DV8 A;  3FZV A;  2ZXJ A;  3O6B B;  1ZGJ A;  2A07 F;  1U6G A;  2L4M A;  1W7P D;  1R00 A;  5LHG A;  3KLO A;  5ERI A;  1OKR A;  4KIF A;  3BJA A;  2CQK A;  2QYO A;  4HDU A;  2P5V A;  1I1S A;  2W84 A;  2DK5 A;  1TLH B;  1KU9 A;  4E70 A;  4ZZL A;  3ULQ B;  2O8X A;  2OAZ A;  4BHC A;  2XKP A;  3SHF A;  5IT9 Z;  1DPR A;  2CFX A;  5J8F A;  2EK5 A;  4HX4 A;  1BI3 A;  5CVU A;  3WU1 B;  2NRA C;  3J80 K;  4UVC A;  4HX7 A;  4OIP F;  3JAM Z;  1DUX C;  3I59 B;  4L9J A;  4M72 A;  2K02 A;  2KJC A;  2DFI A;  4L9T A;  2F5E A;  5FD5 A;  4BQA A;  3H92 A;  2CG4 A;  1REP C;  4D0P A;  3KET A;  4Q47 A;  2Z9O A;  2JTV A;  2H6C A;  2KIF A;  2CWE A;  1D3Y A;  1SMT A;  5FGM A;  1XGM A;  2FSW A;  1XCV A;  3WU0 A;  4WXD A;  2OZ6 A;  1R1T A;  1FBU A;  3I5U A;  3GZ5 A;  1J5Y A;  1PDN C;  2K27 A;  4L9N A;  2HWV A;  2O0Y A;  2GWR A;  1DDN A;  4HDV A;  2H94 A;  1TBX A;  2VT3 A;  2JSC A;  2MC3 A;  3F6O A;  2O03 A;  5D5W B;  2YSR A;  3DQV C;  1XSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...