2K9MA

Structure of the core binding domain of sigma54
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
YTPSELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKRGKKLKPEIKGKLSRLRLFPLSSSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma factor RpoN
publication title Structure of the RNA polymerase core-binding domain of sigma(54) reveals a likely conformational fracture point
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 27
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1330 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2k9mA00
2K9MA 2K9LA
chains in the Genus database with same CATH superfamily
2LKXA 3GLXA 4AM3A 3CDHA 5D6EA 4A3LJ 1ZN2A 2WBMA 3TQNA 4DZJA 3BJ6A 2A6HF 2FNPA 2HPMA 4UNOA 3J7AY 1SVLA 4BUPA 1TQPA 3GEZA 3I59B 4R8HA 3FXKA 1KU9A 1FBSA 2F5CA 2AQFA 3GMEA 4LFUA 3CCRI 1K6OA 1MBKA 5CVVA 1WJFA 1A04A 1U8RA 2K9LA 5EZGA 3OYEA 2DJNA 2K40A 4IOCF 3CP2A 3WU0A 2VODA 3OIQA 1D8KA 3JRGA 4ENNA 3BTIA 2IBDA 2M8EA 2BXZA 2CG4A 5F08A 3OOPA 4HSTA 4U0WA 3GZNB 3LSIA 1LKXA 4L5JA 1R58A 2LC2A 2R93J 2NAZA 3E6BA 4RBOA 5BMZA 2V4JC 2IGKA 1B59A 1YYVA 4F3QA 1LEBA 5ICEA 3RKYA 2B7EA 5LLQA 4PGGA 2LD5A 3DEWA 3I53A 2M8GX 2ZKZA 3LA2A 2PEXA 3I3LA 4FISA 2OD5A 4MEXF 3GFIA 4JK1X 1FTZA 2E36A 4BJ5C 1JT6A 3O8GA 1QRYA 4WWCA 2W25A 1HOMA 2M5WA 3D5LA 4L5EA 2VJ4A 1K78A 4BH9A 4FX4A 2UXNA 3WTTC 1MNMC 2H09A 5HDGA 3ASOH 2BXYA 1UZCA 2NYXA 2Y0SN 3IC7A 4BQQA 4HDUA 2ZXJA 2P7CB 4HF1A 1OFCX 4L5IA 1RESA 2WAFA 2LY9A 3IAS2 3M9AA 1Y56A 4NHJA 4P9UA 4EQQA 2DJIA 2HDDA 3LA3A 4AVPA 4J00A 3KP4A 3LOCA 1Q1VA 1MSFC 3WTWC 3GBGA 2VQGA 2HQNA 1LB2A 3F8BA 2PMZN 5BQTA 5B1BH 5LD2C 1SANA 3CCQI 2R4GA 2BEOA 4ZZDA 3H36A 2QSHX 1VNDA 4OMZA 1NTCA 4D7NA 3PIOF 2DOAA 3KPHA 5CKTA 1BR4A 3OYFA 2HZDA 4L9TA 2IA2A 4HQEA 1C0WA 1Z1DA 2DFEA 5J6XA 1S3JA 4E7KA 4WX9A 2OQGA 2LFBA 2XIGA 2P5KA 5FLXZ 5F27A 1XG1A 1ETOA 4IQJA 1SEUA 3H92A 2HTSA 3FHNA 2FMYA 4CZCA 2ZXWH 3FXUA 1TW3A 2BZTA 1TC3C 1U5TC 3H5RA 1J5YA 4CCNA 2ZJQF 1AKHB 5H2FC 3K4JA 3COAC 2E1MC 3DTEA 3GWZA 3QODA 3ONQA 2BY1A 2DODA 3HB9A 4RS8A 3BP8A 4BXUA 3FXQA 4YEJA 3ZQ7A 4BBSJ 4U7BA 2Z5UA 2X6WA 2IGNA 4XORA 3FK7A 1R00A 2QQ8A 1RUOA 1SVMA 2PN6A 4U0YA 3WODF 1FOKA 1APLC 3BG7A 4GGGA 1BR1A 4P96A 4QTRA 3OR1C 1LQ1A 5LBQA 2F5EA 2XGEA 1IC8A 1W5SA 3BZ6A 1TQIA 3HC7A 4KJZA 2O9LA 2EV0A 3SJMA 1XCBA 9ANTA 3D0SA 1T38A 2CQQA 2JA6J 1GDTA 1T6SA 3S2WA 1IG7A 5AIQA 4LLGF 4XOPA 1BA5A 5FD6A 2EINH 2LH9A 5AIPA 1Z91A 2KT0A 3CESA 3OYGA 3F22A 5D4RA 1OCTC 3M3YJ 5GPAA 5ILVA 1YG2A 4OINF 4HX7A 3HUGA 1RETA 3HKZA 2L7KA 4RA2A 3QPLA 2ZC2A 3MKZA 3LL7A 1V5FA 5KAFC 4IQ4A 2E2IJ 3T8TA 3V42A 3WU2C 2CGPA 3TO7A 5JLXA 3EPZA 5B5EC 2VJ5A 3BTLA 3HSFA 4UVAA 4EV0A 1XC5A 1IO2A 5J1RA 1QPIA 3TL4X 1WPKA 1K78B 2V9PA 2LSOA 5A2QK 3IRQA 2QCOA 4N9HA 3GUDA 3P5JA 2V6EA 4HG2A 2XKOA 1NHAA 4PJMA 5C44J 3DP7A 4PFOA 2DLLA 3K7AJ 3KP6A 2XAJA 4KIFA 4KICA 2O03A 1JTXA 1PVEA 2ZXHA 3OS2A 1FIAA 3VOEA 4CA0A 2PJPA 2DT5A 4AD9A 3BCBA 4CZZA 2QKMB 4RB1A 4OOIA 1WJBA 1XGOA 4L9VA 1K4TA 1DU6A 3DV8A 3K1MA 3H0GJ 3MMYB 2IS1A 4IO9F 3DU6A 1HXDA 1XGSA 3A0BC 1YS6A 1Y1WJ 5EEAA 1ZRDA 4K2EA 5DS9A 4KMUX 4V19K 3J80Z 1G59A 5E3LA 3NARA 3KZIC 1IJWC 5EG0A 2XSJC 1ZK8A 1XMAA 1S5LC 1K83J 1D1AA 2XGDA 1JGSA 2HR3A 1FIPA 3P7NA 3UNGC 3QP5A 3S16J 1JGGA 3RKXA 1IN5A 1ZTRA 3DCFA 1PDNC 2JVGA 3HRUA 3CF5F 2O5RA 2EA4A 4A3BJ 3NWSA 5HNHA 4CCLA 5GTIC 4IHSA 2VLAA 1EF4A 2O8KA 3QPTA 5HLGA 2WY7Q 1S7AA 2I8DA 2W57A 2E1MB 3MWMA 1QBJA 4I0BA 4E7IA 2KFDA 1MNEA 3AAFA 4C2TA 2VB6A 1QPMA 1WH5A 4AC0A 1O3RA 1IXCA 3ELKA 4XLEA 2JZYA 4XLHA 1R6RA 1VZ0A 1WJ5A 1HQCA 1R71A 2EZIA 4CCMA 3GLLA 2HXIA 3ISPA 1QHHD 5ERIA 3SFZA 3C3WA 4KT5C 2XASA 2D2WA 4IHXA 2YU3A 1VQMI 4Y52J 2ME0A 5CQGA 4B48A 1IAWA 4UV9A 3DU5A 3BZCA 2MLKA 3ZMDA 1ZREA 5FRMA 1FOXA 3S8PA 1TQMA 4XRSA 3OY9A 1KA8A 1YIOA 3DFGA 4RB3C 3ZGKA 2W84A 3H9JA 3PNYA 3L2WA 3HUGB 3I71A 1JHHA 3EYYA 1DUXC 2F4MB 3HHHA 1X3WB 2K85A 4OAZA 1J9IA 3CDLA 4Q5SF 2CV0A 1MBJA 1SFUA 1X19A 2VN2A 2V1UA 3DKYA 4RGRA 1IN8A 5LGNA 2STWA 2H6CA 1VTNC 3EUAA 1OYYA 3OSGA 4DGWB 1MJAA 4F55A 1R4NB 5E3MA 4CO8A 3KLNA 2QA4I 3E97A 2EFPA 2KL4A 4B1RA 4D9JA 3CMEI 3GFJA 3PL8A 1ZG1A 3AKZA 3FISA 4ESBA 3W2AA 3PNTA 1SVOA 2O7OA 2EZLA 3RZOJ 1LJ9A 3BQYA 2V9VA 1W0TA 1X1DA 4RDUA 2GXAA 3HOWJ 3FXMA 2C6YA 3A03A 1VQLI 3CQZJ 4I09A 4L9JA 3CLOA 3JR9A 2CW7A 5D5WB 1T0FC 2MW8A 2COMA 1G8XA 3JTHA 1X1AA 3J7ZI 2ZJRF 1XX5A 2ZNZA 5TGTA 1ETYA 2R7ZJ 2TDXA 1LFUP 3RI4A 1VQ9I 2W82A 2HOEA 3WG9A 4WK8F 2ME6A 2CRGA 5J40A 5HNFA 2X6XA 1IV8A 3BWGA 2EA2A 5LRRA 4YFNF 2A6EF 2NS7A 1J7KA 4WF2A 4YIRX 5JR3A 2JA5J 2OBPA 1OYWA 4I76A 4HBLA 4HX4A 4F7ZA 4O5VA 5GPCA 3G71I 3DPUA 1BM9A 2FXAA 1MDMA 1S29A 4KFCA 3S32A 3DEEA 5EG0B 1Y8RB 2LKPA 2AXTC 3BG3A 5FO5A 2DDAA 3KE2A 1ODDA 1XB4A 1IDZA 5F1JA 2RN7A 2CQ7A 1J59A 3MQ0A 3P9IA 3WGGA 4YFXF 3SXYA 4I02A 2DYSH 1JKPC 5L3DA 3Q0WA 3GTJJ 2PQ8A 4OIOF 1MGTA 4PCQA 1BR2A 3LSKA 4LLLA 3K2AA 5K5OA 4G7ZF 2VBXA 1T2KA 3O6BB 1QVUA 2EZHA 1F1ZA 3RDIA 5BPDA 3CUQC 5IYBJ 2FA5A 1VQOI 4IL6C 4WCGA 4D1QA 1QHGA 1FEXA 2P6TA 1TW2A 3KYLA 4PFPA 1LFPA 3IH2A 2O6GE 3FBIB 1OYIA 3JW4A 3EUHC 1LFBA 1U9NA 4G6DA 4MEYF 1MW7A 1FZPB 4XK4A 1HBXG 2X1EA 3SZTA 4ESFA 3BY6A 2EFQA 1U6GA 2X1CA 3KX2A 1DP3A 2ZMEA 1DP7P 2Y9YA 2XRNA 1X1BA 3IP4B 2UWMA 2YUSA 4BDYA 2IA0A 1OCCH 2K9SA 4UV8A 1TWAJ 5GAHJ 4CXFA 2IPQX 6PAXA 2XUBA 2IGOA 1P2FA 2PMHA 1W7PD 2V7FA 4A3JJ 2BV6A 2QUFA 4YG2F 1TP4A 3PUFA 2VC1A 2ETHA 4M6VA 1OJLA 2Z9OA 4RGUA 2W48A 1AWCA 1WWXA 2XF6A 2E60A 4YIIA 3DPLC 2GWRA 3K69A 1E3HA 5K1YA 4CYCB 1LVKA 1B72B 2COBA 4GXOA 5EGOA 3IKTA 3RKQA 1ZRCA 3S1QJ 5H6RA 3BTJA 4YELA 2DA6A 2ICWG 3WTZA 2EIMH 3V7RA 3BPVA 2L3DA 4JYKA 2EH3A 3TOAA 4D7MA 1P7IA 3VYTB 3Q9VA 5LHIA 3OIPA 4E6KG 4EGYA 4EJTA 1S8NA 2EILH 2GIVA 2WV1A 1V4RA 2OQRA 4MO7A 4MTDA 3WTVC 1I6HJ 1X1PA 2R5ZA 2PMUA 3CC2I 4NDLA 1ULYA 1ETKA 2MG4A 3F8CA 1OR7A 4MFDA 1EV7A 2HZTA 2RNGA 3A01A 5K5RA 1R5ID 2N8GA 3QYEA 2J5OA 4D5CA 4NQWA 3T8RA 3TO9A 4KITB 2RQPA 2GOXB 4ZZLA 3GZ6A 2MC3A 4MQVA 2CFOA 1TT0A 1UHMA 2RVCA 1YFHA 4BU2A 2DOEA 4M6XA 3I4MJ 4M73A 2E7XA 2NNNA 3PO3J 4ZDLA 3ZN1A 1W36C 1XGNA 3HOVJ 3GFLA 1SFKA 2KJBA 4DYCA 2HVQA 1YO5C 2XAGA 1ZKGA 3TO6A 4XRMA 5D8LB 4XICA 2Y30A 4Y4RA 2IS6A 4GDFA 2GIZA 3JAMZ 5FKNA 2DBBA 2DAOA 2GBYA 4KT6A 1MBGA 1QO0D 2JUCA 1XPXA 4KNYA 1WJDA 2KRFA 1BI2A 1W7PA 3F3XA 1U8BA 1HSTA 1VFCA 1XD7A 2P5VA 1RNLA 4W97A 1GHCA 2KIMA 2LY2A 3HHGA 4AYBA 2VT2A 3KCCA 2WAQA 3SEZA 4DYRA 3QU3A 1Z9CA 1O4XA 3DTIA 4ZYGA 2KIQA 3FX3A 1MD0A 5D6FA 1STZA 2XV4S 4DIQA 4BBRJ 4IF4A 2HQAA 5FJ8J 5B3SH 2IJLA 2MH2A 2VONA 1T95A 4V2FA 2NOJB 5CVUA 1W1WE 1YX3A 2MBFA 2F5DA 4XR6A 1ZR2A 1YITI 2B0LA 3OS1A 3CMAI 4HF2A 2VE9A 2DW4A 4CCKA 4RM3A 4ABZA 3HOXJ 1IRZA 4BHBA 3K4MA 3BDDA 4J19A 4UVBA 1B9MA 2NXNB 1HW2A 3L7WA 4XM3A 4KIBA 4A3FJ 4HQMA 5LGTA 4XNFA 3DTKA 4ENJA 3M7GA 4XL9A 4KN4X 2DN0A 2R7OA 1EA3A 4H4KC 4HSRA 4UXNA 5CVIA 1G3TA 3CCYA 2BOLA 2GAUA 3OWTA 3CUQB 1HLVA 3HRSA 1EH6A 2K9NA 5JHFA 1FYKA 1HC8A 1LNWA 1Z3XA 5F1RA 3ABMH 3ZN0A 1N75A 1IV6A 2R7RA 3MFKA 1FNNA 3M8FA 2CUEA 2RDPA 2NVXJ 2CWEA 4A5MA 2XF7A 2K3FA 4A2UA 4M3EA 2KJCA 3CLQA 1FP1D 2GOMA 3LNQA 2FQ3A 2JA2A 1ZG3A 1JKOC 3CJNA 3PFYA 4MFEA 2DQRA 1SD5A 3PM1A 1DQUA 1LDJA 1ON1A 3F8FA 2HYFA 2R7XA 1A35A 3M1EA 1Z6RA 2JN6A 3SZPA 3PQJA 1ZH5A 3HKZN 4O6JA 3LSTA 5KCMA 2FU4A 4A93J 3RQIA 5FGMA 3DQVC 3H1CA 4BXFA 4OMYA 5E8IA 2HEOA 2WA0A 5E1ZB 1O7LA 2DTZA 2VQCA 2YX7A 3GW2A 3ZMVA 4OWRB 4AIKA 3UR3C 1A5JA 4OIRF 4HW0A 3U9GA 3S1MJ 4KUMA 4HPQA 3VYRB 2HTJA 4GYGA 5JHUA 1F36A 1WSUA 4PSXA 3RJPA 5IY5H 4A3GJ 2VPLA 1LPQA 3LFUA 2G9WA 4PJLA 4C3HJ 3WTYC 3T1BA 5HDNA 4RM2A 4NQWB 4Z6YA 1ZRFA 3CCVI 3S2DJ 2W85A 3HJEA 3U1KA 4FASD 2FMLA 1XDSA 4QPQA 4ANJA 2MABA 4M9XA 3C2GA 1K7AA 1KU2A 3GTKJ 3AG4H 3TEDA 2OPTA 1F5TA 2FX0A 1IDYA 1MBHA 3CMMA 1RPWA 2KRHA 5C3EJ 3D1NI 4BE0A 4U88A 4XONA 1OCZH 1LVAA 1UB9A 1KU7A 2ZSIB 3HOTA 3L2QA 1WGXA 3ZXSA 2ECCA 4RLFA 1VQ8I 4ASNA 3R6SA 2HYGD 4P9FA 1XSXA 3I58A 3C7JA 4XKVA 1W7PB 1Z3YA 2Z2SB 3QPSA 4BL0B 2E1CA 2Y69H 3ERMA 2Y9ZA 4XIDA 4A3MJ 2MD0A 2YX4A 1JHFA 3ZCOA 2E34A 2CS3A 2FOWA 3BTCA 5D5VB 3VODA 2FEZA 4W1UA 5E18F 4BY7J 1SFOJ 1SFXA 3TW7A 4X1EA 2XAUA 3MVPA 2G0EA 3OL4A 4E7LA 4XOTA 4HNTA 2FQ4A 1T39A 1DDNA 2OA4A 1R5GA 1EKEA 4CUGA 1IRXA 1YS7A 3CCMI 5FKLA 2VQHA 5JLWA 3K1PA 1BW5A 2ADUA 4FQGA 3LWFA 2JMWA 2WB1A 4N0BA 4ON0A 2P6SA 2BBYA 2ZFUA 3K4BA 4LJZF 4HV6A 4F91B 1IW7F 3IRRA 1JUMA 2M34A 2QSFX 5DTDA 1FX7A 3IUOA 5H6QA 2DXIA 3FWEA 3O8HA 1EH7A 4IZZA 2IAIA 5IT3A 4ENKA 2ISYA 4OU0A 1G3SA 3GTPJ 3T5XA 3BR3A 4BYYA 4C9YA 3E6CC 3K4NA 4JX5A 5TJJA 3I56I 3LFKA 3MZ8A 3WTUC 2K5CA 2DK5A 5E1XA 3HIFA 4BDZA 4EEFG 2R7FA 2R7VA 4FE7A 3HM5A 2HYJA 4BQNA 4F93B 1ZR4A 1EJ9A 3A0HC 2MD5A 2V6CA 3H3VK 3G6EI 1WH7A 3QU6A 2MH9A 3MZYA 1V5EA 2NS8A 3HBLA 2J5PA 3NEUA 5HS8A 2JPBA 3B6AA 1W4MA 2XGCA 5F6FA 1D0XA 4DZPA 2IEKA 3KFWX 3ZQLA 2F5VA 1FSHA 5IYCJ 1I3QJ 4M3BA 3SDBA 2X6OA 1RIOH 4BAYA 5M3MJ 1PJRA 2LLKA 3CJTB 3RCOA 1NG6A 2RGVA 2VKHA 3MCZA 3S17J 2HQ5A 1ZLKA 2HXOA 5EDNA 2YR2A 2X9DA 3BLYA 3HEFA 4L0ZB 5E79C 3SEQA 1BIBA 2BY0A 2QGUA 2VKEA 3IKVA 3WGHA 2O0YA 4FHTA 2IT0A 5EF6A 2QBYA 4L9NA 2MLGA 1YRNA 4QPOA 4G8XA 4LITA 5J4YA 3G4SI 2W1OA 1K61A 2ZCWA 2H8RA 1U0JA 5LHHA 4JX4A 5A2QZ 3HTSB 2Q0OA 3QWLA 4UUSA 3ZMSA 5CVJA 4XSZF 4A3CJ 3BPXA 1USTA 2VPRA 2E7WA 4KN7X 4BQAA 4HLYA 2JUGA 2EIKH 3FM3A 1ZG5A 4BJTA 3QOPA 3E1SA 4BACA 4IRIA 2P7VB 3Q3SA 4EMSA 4IRHA 2O61A 4LIVA 2JSPA 1VQPI 2AS5F 1IRFA 2OJED 5GTHC 4TV7A 5FLMJ 4GYIA 2DDBA 4L0YB 2DFIA 2G7UA 2XRLA 2L7FP 4RB0A 4B09A 1F9NA 3A4CA 3WHCA 4E70A 3CP8A 4XLNF 1QNTA 2VBZA 3TW6A 3BR2A 1GXQA 1FT9A 3HOSA 4II3A 2A07F 2E2JJ 3GX4X 4XRFA 1S7EA 3ABKH 3KIOA 2L7ZA 1ZGWA 4M72A 1KQ9A 1TNSA 5LFAA 4DJAA 1PUFA 4YRVA 4HZFA 1QA6A 3GO5A 3ZR8X 3I9V2 1PUEE 1IUFA 2VJIA 3BQZA 2BW3A 2M87A 1N77A 3BR5A 5HOOA 2LMDA 2DA4A 3SYTA 2A5WA 2ELHA 2RV8A 3QOEA 1H9TA 4P5OA 1XS9A 3LSHA 4ZYEA 2AHQA 1GVJA 3HOYJ 1SC7A 4B8XA 3B73A 4WXCA 2QF7A 1F4KA 2CO5A 3OYHA 2HQRA 4IRGA 3CO6C 4HDVA 2ZXIA 1Y39A 1TNTA 3X2QH 3JCUC 2M7AA 3L09A 2F4OB 3KYCB 4QSHA 1CF7A 2EWNA 4X6AJ 1WRJA 2M0CA 1ENHA 3H9QA 3T0YA 5M5YJ 2JQ7A 3V7CA 1I1SA 5F0CA 2QKLB 4JP0A 2JTVA 5DUKA 1K79A 3H35A 2HOSA 2F48A 4EJUA 3M07A 2WY8Q 3HOZJ 1O3SA 1HKTA 5J47A 1WFXA 2PFBA 2VXDA 4AIHA 4RAFA 3BT9A 3HXLA 2EJRA 1JUPA 3OS0A 2FOKA 3OR2C 3OYMA 2KHMA 2DCEA 2DI3A 3JRHA 3J80K 2V26A 3BG9A 1GVDA 4XLAA 2VL8A 3VSLA 1I6XA 5HLHA 3IWFA 3HG9A 2M7BA 3ESWB 4LG0A 2F4IA 2KMUA 3Q0UA 3OL3A 3R61A 4Y33A 2DPUA 1A31A 2JSCA 2NVQJ 4B4CA 3HGYA 1QVTA 2XAFA 5L3EA 1BN5A 1B4AA 3Q5FA 3E0JB 2NVUB 2H8WA 1S7OA 3U2RA 2EFWA 2Z33A 2Y0MA 3H3ZA 1R1TA 4HOBA 3QYFA 3R60A 5J4VA 3FMRA 4AU7A 1Z67A 2TCTA 1R4MB 3K1NA 3IWZA 2OC6A 5IP7J 3GTOJ 1YRNB 2GLOA 4NUBA 1SD6A 5HODA 1FLIA 3NWTA 3ROUA 2GM4A 2PJRA 5KHDA 1XMXA 3VYUB 3TDZC 4UUSB 4ZTJA 1BOAA 2RQQA 4N4NB 3K70D 2DA5A 4BHCA 3FXLA 4CDGA 3D5SC 2IVMA 1FPQA 5ILSA 3SDGA 2HGCA 1PYVA 2KDZA 5J3LA 2A05A 3W2VA 4CCJA 4PK4A 2VC0A 3ML6A 2WV0A 1TBXA 5LGUA 3ZQHA 3HZJA 2IXSA 3G1MA 5FB2A 1BL0A 3OYDA 3H5AA 2M3AA 2H6BA 4F52A 1IN6A 1R23A 1SMTA 1J09A 1GV5A 2UV1A 2F5FA 2H94A 5LRSA 2L7MP 1OLTA 2E5NA 3O2PE 2R5YA 1M1EB 2Z99A 1HA8A 2EFNA 2LY1A 2ZJPF 2O8XA 3DPTA 1AA7A 2RAEA 4AYBN 1JKRC 1Z0XA 1N78A 2WAQN 2G7HA 5L3BA 3HSEA 1LEAA 1LDKB 3I64A 1S9HA 2L5QA 2KISA 4M3FA 4DW6A 1FWZA 2KDOA 1S72I 2XSDC 3NAUA 2LDUA 2DTRA 1JI8A 3OIOA 1E3PA 2DOFA 3ZQQA 1OPCA 3AL0C 2BW3B 1YIJI 2OF7A 3BR0A 2CV1A 4LB6B 1TL8A 4CGZA 2OV7A 3K4KA 3CC4I 1FP2A 3G2BA 1TZLA 3GZ5A 4LK0F 3VSKA 3E3VA 1YW8A 1W5TA 1USSA 1YE9A 2OCCH 2L9SA 1ETQA 2MYSA 1IXRC 3ZP5A 2E19A 1BBYA 1O3TA 4M6YA 1Z77A 4XN0A 3E5QA 3VB2A 4CYDA 2PLYA 2LF7A 3M8EA 1CF7B 3SFIA 2A6TA 2HI3A 2P8TA 2V9KA 2K86A 1RRJA 4UUVA 4BE1A 3L00A 3RKWA 5DD8A 2XKPA 3CTAA 3KEOA 3ZRGA 2A69F 4E4HA 5KNLA 4LOCA 5L3CA 4PGHA 3LMMA 2JA8J 2VIXA 1H88C 1OCPA 5IT9Z 3I5UA 1XDUA 3GTLJ 3JTGA 2HNHA 1V54H 1HDDC 2F6CA 1R1UA 2ZMEC 1R7JA 2JVHA 1HSJA 2L9VA 4ZDPA 3L2RA 4ETSA 1SAUA 3CD6I 4E7SA 3N97A 3GXOA 4RMNA 2H27A 3ZMTA 4LG0B 2ZBKA 2IGMA 2LVSA 2QQAA 1WJEA 3PSIA 2E1OA 2E71A 3IH4A 3GF2A 4LB5A 3HGGA 4FT8A 2Z16A 2QENA 1RKWA 2DQLA 5DV5A 1JT0A 3V8KA 4BHPA 3I0TA 1BIAA 2DFHA 1ETVA 1VQKI 1UCRA 3BC8A 4R79A 3LSPA 4EM1A 4ZTFA 2K9QA 4A12A 3MZHA 2DO7A 4IXAA 2PJRB 2BHZA 3RIRA 4LK1F 1MJBA 2ACJA 1ZGAA 2M30A 3QRFF 2ISZA 5BNGA 1TWHJ 5C4JJ 1GT0C 4AUXA 1OR7C 1WVRA 3Q9SA 4D5FA 3KLOA 1BI0A 2K27A 3WE2A 1SMYF 4UB6C 2BVMA 2XGXA 5IP6A 1NH3A 3PNVA 3LSRA 3FF5A 2IRFG 1R49A 2DA2A 1K4SA 3J81Z 1TWCJ 4PJ0C 3DXJF 2M4GA 2BYVE 1D0ZA 1QZZA 3E6DA 2KZGA 3F72A 4XSXF 4UVCA 1PP7U 2K7LA 1PP8F 1X58A 3JRBA 3CMYA 4WXHA 4FE4A 1TWFJ 3LAJA 4C3JJ 3JRDA 2R5YB 1W5CC 3R0JA 1NK2P 2EB7A 2JJ7A 5ICFA 4LGWA 3ZQCA 2ESHA 4IX7A 1Y0NA 4NC6A 3OOUA 4E7HA 1WQ2A 2XPVA 4C2MJ 4B43A 3JRCA 4I2OA 2B9SA 5AONA 4BE2A 4IHVA 1TLHB 5H20A 3PIPF 1MMSA 4DQ2A 2GA2A 2KIUA 3E6MA 4QWQA 1E17A 1I39A 1I3AA 2BVLA 3ULQB 2FBHA 1MDMB 1MNDA 2XB5A 3AG1H 1RC9A 3IHUA 1UJ8A 4DOZA 1FC3A 3ABLH 3C18A 4JOMA 3L2UA 4HLXA 1OISA 3AL0B 4XBFA 1S6LA 5IPAA 1J75A 2JWTA 3CC7I 2WB1N 4B3XA 2LP0A 3S2HJ 2CJJA 1GV2A 3KEYA 1Z21A 4XRSG 1IUYA 3OYCA 2H1LA 1ORKA 3K4LA 3N05A 4ZH4F 5HDKA 2EFOA 2JRTA 4Q48A 2HS5A 2KQRA 4B44A 1WKMA 2IW5A 2V79A 2ZO4A 5ED4A 3F9KA 3PJRA 4NB5A 4U0VA 2P81A 3CJQB 3DWLE 4V2GA 2CV2A 1ETWA 2L9RA 2BE5F 4M71A 4KMFA 2DFFA 2XB0X 2X51A 2ZJ2A 1KQ8A 2A3SA 2PX9A 3IH3A 4EJVA 2KPMA 1CQTA 4JQFA 1L3LA 1Y1VJ 5F0FA 2A68F 5F04A 4C2UA 1RZ4A 5GAGJ 2B63J 3G73A 3M4OJ 1EH8A 3ASNH 5FFXA 4G9YA 2NS0A 1KYWA 4IEJA 3IAM2 1IF1A 2XAHA 2UZKA 2ZMEB 1P4WA 2DYRH 1T08B 2L4MA 5J1YA 4A0ZA 2XHKA 2HOAA 4J01A 1O7FA 4XLPF 1YTYA 1R5HA 4G94A 2R7WA 3RQ4A 2Z1DA 1BC7C 3PO2J 4O3MA 5ICGA 1H89C 5CJ9A 5J8FA 5KVRA 3F8NA 5EEHA 2Y31A 5M3FJ 4KIGA 1B6AA 4HAMA 3HRMA 1A6QA 4ITVA 1IXSB 1AKHA 2YPRA 2BY3A 4BGDA 1H8AC 4E7ZA 1WCMJ 2VOPA 3TP0A 1GUUA 3DKXA 1MMAA 4EM0B 3HSRA 5EGOB 3FXOA 5FD5A 3V7SA 2QYOA 4Y15A 1UELB 3FZVA 4A3KJ 1HCRA 2DA3A 4U87A 4IKFA 3ABUA 2F2EA 2K3PA 2L02A 3CCLI 4C3IJ 1YQAA 4G7OF 4JBAA 5F0HA 3JRIA 1ON2A 3HPGA 1KZHA 3PSFA 2GXBA 4AVZA 2R5ZB 3S1NJ 1HW5A 2E5ZA 3A01B 2IS4A 1O57A 1SFEA 2K4BA 3RYRA 2KZVA 4CCOA 4BJ6C 3LAPA 1W0UA 3U21A 1XSVA 2BY2A 2P4WA 3AFHA 4KISA 2QWWA 2PG4A 1D3YA 2KKOA 4EM2A 1VQ4I 4LLNA 3CUOA 5ILUA 4ZJZA 2WTEA 5K7FA 1ZQ3P 3K6GA 3PFIA 2CSOA 2FBKA 1MH4A 2OTJI 1V3FA 4DYQA 2M2EA 4RGXA 5E3NA 3W6KB 2MGQA 2CQXA 4XN3A 2HVSA 3EYIA 4UUTA 3BJAA 4Y13A 1VQ6I 4Y17A 2M9HA 3RPUD 2DMNA 2FJ1A 3S93A 4BY1J 1AU7A 3I4PA 5CLSA 4ZC3A 3DKWA 4CHUA 5IYDJ 2FF4A 2X0LA 3TKYA 5FLVA 3CF2A 4A5NA 3RSNA 4DNCA 3FBNB 4I0AA 3K2ZA 3EUKL 3SZGA 4HV5A 1P7JA 5M5WJ 2WC2A 2WADA 2FBIA 2HKXA 2L54A 1WHUA 4FTHA 2K9MA 3RYPA 3OYNA 1A36A 4XKWA 4AWXB 3CCSI 3VFZA 3AG2H 2Q2EA 4YFKF 5BPIA 3C2HA 3KZYA 3OYLA 5DDGA 4IOAF 1ACIA 3VEPA 2IS2A 4A6EA 2LBFA 5FKMA 1U9OA 1WJCA 3KYDB 1FYMA 2L9NA 1MH3A 4KDPA 1B1BA 3S14J 3A2KA 2K02A 3QYBA 1QGPA 3RZDJ 1X2MA 1A6IA 1DPUA 1KYZA 4IPAA 4RAZA 5IOYA 5HS9A 2XPUA 4S04A 1YJNI 3RPUA 2PBIA 1E3OC 3JSPA 1YJWI 2HFHA 3F6VA 2OUMA 2CUFA 4RAYA 2E2HJ 1ONVA 1BOBA 3A1YA 4CICA 2FSWA 4I6ZA 2XROA 2VT3A 2ZNYA 2HKOA 2JPCA 3MD2A 3RPQA 1DGWY 3V4GA 1WI3A 1U5TA 5FLXK 3UKGA 1FMWA 2LG4A 3OSFA 3KEQA 3ZQGA 5KK1A 2RC4A 4PUSA 3DBRB 2LRDA 2R3SA 1FOYA 1RKTA 5EJCA 1QZEA 3SQNA 4EVIA 1WZ2A 5KAIC 3L2CA 1LE8A 1I27A 4M3DA 3D5RC 2OZ6A 3I55I 3FDYA 3LSGA 2NNYA 2XC7A 4N9IA 3I4NJ 3KP5A 4MNUA 5JVGF 4I98B 5E20A 1D1BA 4BS9A 3MKWB 1RUNA 1NG7A 1H9GA 3WGIA 4GFBA 1P92A 2CFXA 4MGRA 1XSDA 1JJ8C 2LOOA 1I5ZA 1BC8C 1OKRA 2VOOA 3HPHA 2L2OA 2EPFA 2R92J 2ZB9A 2I10A 4OAYA 2LYCA 4EJWA 3FKIJ 5EZHA 3MEXA 1R36A 4FX0A 4RLQA 4ZYAA 2HU9A 3GFMA 3DBHB 3ZOBA 3J7YJ 4ENMA 2R0QC 3A02A 2DMUA 2X48A 5EYRA 2BGCA 3FM5A 1UMQA 1Z05A 5CYVA 2EK5A 3V8LA 1BI3A 2GQQA 2DU9A 3ZMZA 3EDPA 4I99C 3FMQA 1SD4A 1I50J 5DUIA 2VASA 5E8GA 3H9GA 4RGSA 4IJAA 5JVTA 3ERED 5BOXA 3VWBA 4XKCA 2ELJA 1Y8QB 4P1WA 1MSEC 5ICCA 2RREA 1DU0A 2EZKA 5B66C 2L01A 1POGA 2M4KA 3C2BA 3DBLB 3FIWA 2YU9J 3HOUJ 1R1VA 1R9TJ 3EETA 1MIJA 3K4CA 5CVRA 4S05A 2YS9A 1V55H 5K7HA 2Q2EB 1GLNA 2X6YA 4S0HB 1KGSA 4Q4ZF 3S3OA 1VI0A 1HKQA 5LEKA 1BW6A 2AO9A 2DK8A 1Q1HA 4FCYA 2JA7J 3BROA 4Y7NJ 2BHYA 2P5LC 1R22A 4A0YA 2HOTA 2Y0SA 2LBFB 3S15J 1MJ9A 4HRIA 2OTLI 3HDDA 3F21A 5HLIA 4YIFA 1X4PA 2QLZA 1G3WA 3R4KA 3TDUC 3TOBA 2CQKA 2NVYJ 3ECHA 4OIQF 2GZWA 1B8IA 1X2NA 3F0CA 3WU1B 4A3IJ 2LTPA 3KP7A 3BCAA 1P4AA 1T8IA 1TTYA 2FD5A 1KONA 3W6VA 1MBEA 2IA1A 3O3KA 2XPWA 2R7SA 2PMZA 1HF0A 3IL2A 3NQOA 1T33A 2DMPA 5BS6A 2EV5A 3AG3H 3W6JB 1XCVA 3P9KA 4MLOA 3VPRA 4HNUA 2OAZA 4DBRA 2AQEA 2VBYA 1RR7A 2A61A 3LSMA 2O3FA 2Y75A 1TWGJ 1N25A 3E5XA 3WTSC 2AXLA 1U5TB 2VI6A 1D5VA 4LD5A 2NRAC 2W00A 1JJ6C 5J8CA 2HDWA 3OYJA 1E0EA 3VYSB 2NOGA 1D0YA 1FBUA 1BJZA 2MFZA 3ZQIA 4B47A 3HL2A 2NVTJ 4BEHA 2V1XA 2LF8A 2QQ9A 3FXJA 2CMPA 4CH7A 3F6OA 3BJOA 1LE8B 1OQYA 2A5YB 1FYLA 4XKBA 1CGPA 3HRTA 3PUBA 4A6DA 2QSGX 2RKHA 3C1DA 2QBYB 3QP6A 1DPRA 3BG5A 3FXRA 3KZZA 3WE3A 4IVNA 2ZFWA 5B1AH 1T56A 4WXDA 3LA7A 4XLCA 4MHGA 2L4AA 1IN4A 3MKYB 3GYHX 1X3UA 1UAAA 1UHWA 2XDVA 1ZAOA 2CQNA 2QM3A 4UB8C 3GVAA 4IHWA 1YX5A 1BI1A 1ZHFA 2JK3A 3ZMUA 1FTTA 3RTRA 2UUZA 1OMIA 2HPIA 1X4OA 5DD4A 1JXSA 1OCOH 2ECBA 3MN2A 3FK6A 3L1PA 3H5NA 1ZGJA 4CYCA 1FBQA 1B72A 3R0AA 2R7QA 3OMYA 2Y2ZA 2QVOA 2V1NA 1KQ0A 3S3MA 3FKJA 5FFZA 1FOWA 3OV8A 1K6YA 2D5VA 4OIPF 2L0KA 3W3CA 1UFMA 1WI9A 2X85A 5DCFA 2LK2A 3FHZA 2QZ8A 4HX8A 1U78A 1T98A 2RNJA 3F8MA 3P9CA 1ZYRF 2FUG2 1PUFB 1YLFA 1RR8C 3LSJA 1ZARA 2TRTA 4PDKA 2LKSA 3HTUA 3M8JA 2KLOA 4A3EJ 3JRFA 3Q0VA 4GO1A 4MQ9F 1WJAA 2LREA 5FKKA 1YW7A 2DA1A 4FETA 4HYEA 3N4MA 1UG0A 2R7DA 4HF0A 1FY7A 4U7DA 1XN7A 1AOYA 3QPHA 3GTMJ 5CPRB 3KP3A 4A3DJ 1IRGA 4MIMA 4G6QA 5E3OA 1ZELA 2R7TA 1P4XA 2CW0F 2FRHA 2M0MA 4KA4A 1Z7UA 3ABTA 5GP9A 4GCVA 1T0FA 2IP2A 3JREA 4LG3A 4LMYA 3K70C 3OYBA 3ZQFA 2KRCA 3BR6A 5LHGA 5K5QA 4II2A 2M45A 3JRAA 5DM7F 3OYKA 5DM6F 3BOQA 1B8IB 4G7HF 1FJLA 2GXGA 5F64A 4H0EA 2E1NA 4F92B 4HA8A 1RI7A 4QLCU 1HW1A 3CJRB 2QEXI 2W7NA 2W4SA 2ELKA 5DCMA 4ZYDA 4BXXJ 4Z2YA 2OZUA 3TMOA 3S3NA 3EQLF 4QIWN 1AHDP 4KYWA 2KIFA 3K10A 2XAQA 1QU3A 3TGNA 3GTGJ 2I5UA 2EBIA 4XLFA 3QQAA 1JTYA 4UHTA 1V5GA 2MSYA 4PSWA 2PI0A 3E7LA 4PJNA 2YSRA 4JX6A 1X1CA 2ESNA 2GA1A 1MBFA 1KU3A 1ZLJA 3LQRA 2X1DA 3DEUA 4NBQA 2EIJH 5DEQA 5J1UA 3BG6A 1YW9A 4X0GA 1MMGA 2E35A 3KP2A 1J2XA 3GTQJ 2DT6A 2VJJA 3I54A 1G6NA 5TISC 3W2WA 4BEHB 1NK3P 1MKMA 1X3ZB 1BJAA 3G1OA 3U1DA 5EEGA 4RB2C 3TBIA 2CH0A 3S1RJ 1GXPA 3FMSA 4CSWA 1U3EM 3NRVA 5TRDA 1G4DA 3H0DA 2X4HA 3CUQA 1F43A 1I1GA 3BZKA 3EUHA 1W36D 1Y6IA 1YI2I 5IT9K 2D1HA 4R1HA 2DMQA 4Y3OA 3TP3A 3QAHA 1JUSA 5L3FA 2HVRA 4EGZA 4IHYA 4XMYA 2HDCA 1G3YA 3J7AO 2XVCA 4M3GA 4NC8A 4A69C 2DMTA 3L9FA 2VBWA 2Z3YA 1MZBA 3G3ZA 1IZ1A 4UY8I 3MAJA 5E17F 5FROA 4M9SA 4B3AA 1IGNA 1XTAA 3I59A 4GRIA 3WG7H 2VKDA 2VQLA 1VQNI 1FSEA 2VE8A 1REPC 2XF5A 3CCJI 2H1KA 3SHFA 2VXZA 3BR1A 1FMVA 1JE8A 3MKLA 2Q8KA 2LR8A 2M1BA 1D8JA 5L3GA 1P9QC 4BKXA 1HDPA 5FKOA 4Q47A 2CYYA 2D1VA 4D0PA 3CCUI 1O3QA 5D8KB 3VDXA 4HNVA 4G12A 4HEA2 1U2WA 1OCRH 2MA3A 4M74A 3CCEI 1SD7A 1LUJB 4AIJA 3L2VA 1ERDA 4ZDOA 2W24A 2R7UA 2LNBA 4PZJA 3WHBA 1G2HA 2JT1A 3G1LA 2OCEA 5E1WA 3IV5A 4I01A 4LIUA 2Q1ZB 1VF9A 2ZSHB 3J81K 3HYIA 2STTA 4C30A 2MC4A 2CU7A 2EQRA 1D1CA 3GCMA 4RAGA 4IHTA 1ITYA 4ESJA 2CUJA 2CUZA 1E2XA 2WWYA 4EATA 1B9NA 1QQIA 1Y0UA 2EV6A 3K9TA 3KETA 5C4XJ 1TT5B 5K7ZA 4ZYHA 3F23A 1JKQC 1P6RA 1UHSA 2VKVA 2JRMA 3M1CA 3K0LA 2UXXA 5D4SA 5DCMB 3V8JA 5GAEJ 2D45A 3REOA 3DLLF 5GADJ 1VQ7I 4E7JA 3DF8A 3ECOA 3H3UA 4PJJA 1L0OC 4NNJA 4P55A 3OYIA 5HS7A 3ZPLA 3CZ6A 2Y48A 2DPDA 2FNAA 2P0WA 3JAMK 3CO7C 2OU2A 1Z7LA 4BNCA 1J0RA 2KP6A 4M9ZA 4BQOA 5FRNA 1MMNA 4EJOA 4A0XA 1YHQI 3OYAA 2DT7B 5M5XJ 1Z6TA 2DA7A 2QQBA 4G6TB 3PQKA 2HWVA 5JI6A 5HVQC 5LEJA 1YOVB 1UG2A 1SAXA 1QZYA 2K4JA 3CDIA 1MMDA 4I7HA 4AIDA 1XGMA 3E5UA 2ID6A 1VQ5I 2VUMJ 2WAEA 1ETXA 2FE3A 1DGRM 4N4OB 1H0MA 3WTXC 5IOZA 3LQQA 4L18B 3B6CA 1XMKA 5CQEA 1IN7A 5HLTA 5D5UB 5JFRA 3JSOA 4DBQA 3B02A 1LDDA 5IP9J 4NC7A 1HKSA 2ID3A 4XQFA 3DLAA 5D5XB 1YJ9I 2CW8A 2V1DA 5DYMA 4MTEA 1D5YA
chains in the Genus database with same CATH topology
4BDYA 4PUSA 3E0JB 2LRDA 2WBMA 2IGOA 2V7FA 2HPMA 3J7AY 3D5RC 3QYFA 4BUPA 3FDYA 3LSGA 4AU7A 2XC7A 2OC6A 2XF6A 1D1BA 2E60A 4NUBA 3DPLC 2AQFA 4BS9A 3MKWB 1LVKA 1NG7A 3NWTA 2PJRA 1WJFA 5KHDA 4YELA 3VYUB 2K9LA 2LOOA 3OYEA 4ZTJA 2RQQA 4N4NB 3K70D 3CP2A 3HPHA 3VYTB 2L2OA 3OIPA 4E6KG 3D5SC 4OAYA 2LYCA 1PYVA 3OIQA 3W2VA 4CCJA 4PK4A 4RLQA 4ZYAA 2HU9A 4HSTA 2RNGA 3LSIA 1LKXA 2LC2A 3QYEA 2IXSA 4KITB 3OYDA 2GOXB 2V4JC 2IGKA 3H5AA 2M3AA 4F52A 2CFOA 1TT0A 4F3QA 1J09A 2UV1A 4BU2A 1OLTA 2E5NA 4ZDLA 3I3LA 1W36C 2UWMA 1HA8A 4BJ5C 2VASA 3H9GA 2LY1A 3DPTA 1AA7A 1SFKA 3D5LA 2VJ4A 2HVQA 4XKCA 3VWBA 1N78A 2ELJA 4P1WA 1LDKB 2RREA 1S9HA 2L5QA 4Y4RA 2IS6A 2KDOA 2M4KA 1JI8A 4BQQA 3ZQQA 4KT6A 3AL0C 2BW3B 2WAFA 3K4CA 3IAS2 2CV1A 1WJDA 1Y56A 2OV7A 2DJIA 1GLNA 2Q2EB 2X6YA 3K4KA 4J00A 2LY2A 3S3OA 4AYBA 3G2BA 1TZLA 2WAQA 3SEZA 3VSKA 3GBGA 2VQGA 3DTIA 1YE9A 2L9SA 4DIQA 2MYSA 5LD2C 2R4GA 2Y0SA 2LBFB 4HRIA 2HQAA 1T95A 1X4PA 4XN0A 2DOAA 2NOJB 5CKTA 1BR4A 1YX3A 3OYFA 2HZDA 2A6TA 4XR6A 3OS1A 2V9KA 4CCKA 4RM3A 3BCAA 4BE1A 4E7KA 3K4MA 1KONA 4XM3A 2R7SA 3ZRGA 2PMZA 4E4HA 5KNLA 4XNFA 3DTKA 4XL9A 3LMMA 4IQJA 2R7OA 1EA3A 2VIXA 4H4KC 4HSRA 3FHNA 4CZCA 4MLOA 2HNHA 2BOLA 4HNUA 2F6CA 3H5RA 4ZDPA 4CCNA 2JVHA 3OWTA 4DBRA 3L2RA 2AQEA 1SAUA 4E7SA 3LSMA 3K4JA 5JHFA 2E1MC 3DTEA 3QODA 4RMNA 1Z3XA 3ONQA 2IGMA 2W00A 4YEJA 2HDWA 1N75A 1WJEA 3OYJA 4U7BA 2R7RA 3PSIA 2X6WA 3VYSB 2IGNA 4XORA 1D0YA 2MFZA 4B47A 3HL2A 4BEHA 2XF7A 3BG7A 2CMPA 1BR1A 4CH7A 2Z16A 3OR1C 2GOMA 2JA2A 4KJZA 3HC7A 3PFYA 4XKBA 1DQUA 3PUBA 3BC8A 4R79A 2R7XA 4ZTFA 4XOPA 5KCMA 2LH9A 2PJRB 3DQVC 4BXFA 3CESA 4XLCA 3OYGA 2WA0A 3MKYB 2VQCA 1UAAA 2XDVA 4OWRB 3UR3C 1YX5A 1OR7C 4HPQA 3VYRB 3RTRA 2UUZA 2HPIA 3HKZA 1X4OA 2BVMA 2L7KA 4PSXA 3PNVA 2VPLA 3MKZA 3H5NA 3LFUA 3LL7A 1V5FA 4PJLA 4IQ4A 3V42A 4RM2A 4NQWB 2M4GA 1D0ZA 2R7QA 3OMYA 4FASD 2V1NA 3EPZA 4QPQA 3FKJA 2MABA 4ANJA 3S3MA 2VJ5A 3C2GA 1K6YA 3W3CA 2X85A 3CMMA 2KRHA 4BE0A 3TL4X 4IX7A 2FUG2 3OOUA 4XONA 4E7HA 4B43A 2ZSIB 3HOTA 3M8JA 3L2QA 2KLOA 3ZXSA 4BE2A 4RLFA 1WJAA 2LREA 2V6EA 4FETA 4HG2A 1UG0A 4PJMA 2BVLA 4PFOA 4XKVA 1MNDA 5CPRB 1Z3YA 2Z2SB 4DOZA 1ZELA 4BL0B 2ZXHA 3OS2A 4JOMA 3L2UA 2R7TA 2M0MA 3AL0B 4CA0A 2MD0A 3ZCOA 2CS3A 3BCBA 2QKMB 4LG3A 4B3XA 3K70C 3OYBA 1WJBA 2KRCA 3KEYA 1Z21A 2XAUA 4II2A 3OYCA 3OL4A 4E7LA 3MMYB 3K4LA 4XOTA 3N05A 3DU6A 4HNTA 2IS1A 3OYKA 2KQRA 4B44A 4CUGA 1IRXA 4F92B 1G59A 2VQHA 3CJRB 3F9KA 3PJRA 2W7NA 2W4SA 2XSJC 3TMOA 3CJQB 2WB1A 1D1AA 3DWLE 3S3NA 2CV2A 3K10A 1QU3A 2X51A 2ZFUA 3K4BA 3UNGC 4F91B 2KPMA 4XLFA 4JQFA 1V5GA 4C2UA 4PSWA 2JVGA 4PJNA 2O5RA 1X1CA 3IUOA 2DXIA 3NWSA 5HNHA 4IZZA 4CCLA 2X1DA 3IAM2 2VLAA 3BG6A 4X0GA 1MMGA 4C9YA 4J01A 3K4NA 2WY7Q 2I8DA 2DT6A 2VJJA 2E1MB 2K5CA 3W2WA 4E7IA 4BEHB 4BDZA 2R7WA 1E0EA 1MNEA 3RQ4A 2R7VA 4C2TA 2VB6A 4BQNA 4F93B 3TBIA 2CH0A 2Z1DA 4CSWA 4XLEA 4XLHA 1R6RA 1V5EA 1VZ0A 1WJ5A 3H0DA 4CCMA 4ITVA 1D0XA 1QHHD 4BGDA 4E7ZA 3DKXA 2F5VA 1MMAA 1W36D 1Y6IA 3SDBA 5CQGA 4B48A 1PJRA 3RCOA 3DU5A 1NG6A 1UELB 5FRMA 4Y3OA 2VKHA 3S8PA 4U87A 4IKFA 3OY9A 2K3PA 2HVRA 4XMYA 3BLYA 4NC8A 3ZGKA 3HPGA 3SEQA 3H9JA 3PNYA 3PSFA 3HUGB 3L2WA 5FROA 4AVZA 4GRIA 2E5ZA 2VKDA 2VQLA 4QPOA 2IS4A 2XF5A 4LITA 4OAZA 2W1OA 2VXZA 2CV0A 2KZVA 1FMVA 1X19A 4CCOA 1U0JA 4BJ6C 3DKYA 3U21A 3AFHA 4KISA 1P9QC 3EUAA 4DGWB 4F55A 4ZJZA 2JUGA 3K6GA 2KL4A 4BJTA 4D9JA 3PL8A 3E1SA 3VDXA 4BACA 3AKZA 3W2AA 3PNTA 4HEA2 2JSPA 4LIVA 4XN3A 2HVSA 1X1DA 3RPUD 3A4CA 3CP8A 1ERDA 3L2VA 3S93A 4ZDOA 2R7UA 2CW7A 1T0FC 3HOSA 4II3A 4ZC3A 1G8XA 4LIUA 1X1AA 5TGTA 2Q1ZB 2ZSHB 2W82A 3CF2A 4C30A 2MC4A 3RSNA 3FBNB 5HNFA 3EUKL 1D1CA 3SZGA 5LFAA 2X6XA 4DJAA 4YRVA 2CUJA 2CUZA 3ZR8X 3I9V2 2WADA 4EATA 2VJIA 2K9MA 3OYNA 3DPUA 2BW3A 4XKWA 1N77A 5HOOA 3M1CA 3SYTA 2A5WA 3S32A 3DEEA 3QOEA 4P5OA 3C2HA 4E7JA 3LSHA 3OYLA 4PJJA 4NNJA 2IS2A 3OYIA 3CZ6A 2P0WA 3OYHA 1Z7LA 2LBFA 2KP6A 4BQOA 5FRNA 2ZXIA 1MMNA 1WJCA 2M7AA 3OYAA 2L9NA 2DT7B 3H9QA 4G6TB 5HVQC 3A2KA 2QKLB 3QYBA 3H35A 1BR2A 3LSKA 1MMDA 2WY8Q 1WFXA 2VXDA 2WAEA 4D1QA 1QHGA 3HXLA 1DGRM 4N4OB 3KYLA 3OS0A 3OR2C 2OUMA 2KHMA 1LFPA 2DCEA 4PFPA 3OYMA 2V26A 1BOBA 3A1YA 3FBIB 3EUHC 5CQEA 4XLAA 5HLTA 1MW7A 2VL8A 3VSLA 3MD2A 1DGWY 3HG9A 2M7BA 2X1EA 4DBQA 2F4IA 2KMUA 2X1CA 3KX2A 4NC7A 3OL3A 1DP3A 4Y33A 4XQFA 3DLAA 1FMWA 2LG4A 2CW8A 1X1BA 3IP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9M A;  2K9L A; 
#chains in the Genus database with same CATH topology
 2LKX A;  3GLX A;  4AM3 A;  3CDH A;  5D6E A;  4A3L J;  1ZN2 A;  2WBM A;  3TQN A;  4DZJ A;  3BJ6 A;  2A6H F;  2FNP A;  2HPM A;  4UNO A;  3J7A Y;  1SVL A;  4BUP A;  1TQP A;  3GEZ A;  3I59 B;  4R8H A;  3FXK A;  1KU9 A;  1FBS A;  2F5C A;  2AQF A;  3GME A;  4LFU A;  3CCR I;  1K6O A;  1MBK A;  5CVV A;  1WJF A;  1A04 A;  1U8R A;  2K9L A;  5EZG A;  3OYE A;  2DJN A;  2K40 A;  4IOC F;  3CP2 A;  3WU0 A;  2VOD A;  3OIQ A;  1D8K A;  3JRG A;  4ENN A;  3BTI A;  2IBD A;  2M8E A;  2BXZ A;  2CG4 A;  5F08 A;  3OOP A;  4HST A;  4U0W A;  3GZN B;  3LSI A;  1LKX A;  4L5J A;  1R58 A;  2LC2 A;  2R93 J;  2NAZ A;  3E6B A;  4RBO A;  5BMZ A;  2V4J C;  2IGK A;  1B59 A;  1YYV A;  4F3Q A;  1LEB A;  5ICE A;  3RKY A;  2B7E A;  5LLQ A;  4PGG A;  2LD5 A;  3DEW A;  3I53 A;  2M8G X;  2ZKZ A;  3LA2 A;  2PEX A;  3I3L A;  4FIS A;  2OD5 A;  4MEX F;  3GFI A;  4JK1 X;  1FTZ A;  2E36 A;  4BJ5 C;  1JT6 A;  3O8G A;  1QRY A;  4WWC A;  2W25 A;  1HOM A;  2M5W A;  3D5L A;  4L5E A;  2VJ4 A;  1K78 A;  4BH9 A;  4FX4 A;  2UXN A;  3WTT C;  1MNM C;  2H09 A;  5HDG A;  3ASO H;  2BXY A;  1UZC A;  2NYX A;  2Y0S N;  3IC7 A;  4BQQ A;  4HDU A;  2ZXJ A;  2P7C B;  4HF1 A;  1OFC X;  4L5I A;  1RES A;  2WAF A;  2LY9 A;  3IAS 2;  3M9A A;  1Y56 A;  4NHJ A;  4P9U A;  4EQQ A;  2DJI A;  2HDD A;  3LA3 A;  4AVP A;  4J00 A;  3KP4 A;  3LOC A;  1Q1V A;  1MSF C;  3WTW C;  3GBG A;  2VQG A;  2HQN A;  1LB2 A;  3F8B A;  2PMZ N;  5BQT A;  5B1B H;  5LD2 C;  1SAN A;  3CCQ I;  2R4G A;  2BEO A;  4ZZD A;  3H36 A;  2QSH X;  1VND A;  4OMZ A;  1NTC A;  4D7N A;  3PIO F;  2DOA A;  3KPH A;  5CKT A;  1BR4 A;  3OYF A;  2HZD A;  4L9T A;  2IA2 A;  4HQE A;  1C0W A;  1Z1D A;  2DFE A;  5J6X A;  1S3J A;  4E7K A;  4WX9 A;  2OQG A;  2LFB A;  2XIG A;  2P5K A;  5FLX Z;  5F27 A;  1XG1 A;  1ETO A;  4IQJ A;  1SEU A;  3H92 A;  2HTS A;  3FHN A;  2FMY A;  4CZC A;  2ZXW H;  3FXU A;  1TW3 A;  2BZT A;  1TC3 C;  1U5T C;  3H5R A;  1J5Y A;  4CCN A;  2ZJQ F;  1AKH B;  5H2F C;  3K4J A;  3COA C;  2E1M C;  3DTE A;  3GWZ A;  3QOD A;  3ONQ A;  2BY1 A;  2DOD A;  3HB9 A;  4RS8 A;  3BP8 A;  4BXU A;  3FXQ A;  4YEJ A;  3ZQ7 A;  4BBS J;  4U7B A;  2Z5U A;  2X6W A;  2IGN A;  4XOR A;  3FK7 A;  1R00 A;  2QQ8 A;  1RUO A;  1SVM A;  2PN6 A;  4U0Y A;  3WOD F;  1FOK A;  1APL C;  3BG7 A;  4GGG A;  1BR1 A;  4P96 A;  4QTR A;  3OR1 C;  1LQ1 A;  5LBQ A;  2F5E A;  2XGE A;  1IC8 A;  1W5S A;  3BZ6 A;  1TQI A;  3HC7 A;  4KJZ A;  2O9L A;  2EV0 A;  3SJM A;  1XCB A;  9ANT A;  3D0S A;  1T38 A;  2CQQ A;  2JA6 J;  1GDT A;  1T6S A;  3S2W A;  1IG7 A;  5AIQ A;  4LLG F;  4XOP A;  1BA5 A;  5FD6 A;  2EIN H;  2LH9 A;  5AIP A;  1Z91 A;  2KT0 A;  3CES A;  3OYG A;  3F22 A;  5D4R A;  1OCT C;  3M3Y J;  5GPA A;  5ILV A;  1YG2 A;  4OIN F;  4HX7 A;  3HUG A;  1RET A;  3HKZ A;  2L7K A;  4RA2 A;  3QPL A;  2ZC2 A;  3MKZ A;  3LL7 A;  1V5F A;  5KAF C;  4IQ4 A;  2E2I J;  3T8T A;  3V42 A;  3WU2 C;  2CGP A;  3TO7 A;  5JLX A;  3EPZ A;  5B5E C;  2VJ5 A;  3BTL A;  3HSF A;  4UVA A;  4EV0 A;  1XC5 A;  1IO2 A;  5J1R A;  1QPI A;  3TL4 X;  1WPK A;  1K78 B;  2V9P A;  2LSO A;  5A2Q K;  3IRQ A;  2QCO A;  4N9H A;  3GUD A;  3P5J A;  2V6E A;  4HG2 A;  2XKO A;  1NHA A;  4PJM A;  5C44 J;  3DP7 A;  4PFO A;  2DLL A;  3K7A J;  3KP6 A;  2XAJ A;  4KIF A;  4KIC A;  2O03 A;  1JTX A;  1PVE A;  2ZXH A;  3OS2 A;  1FIA A;  3VOE A;  4CA0 A;  2PJP A;  2DT5 A;  4AD9 A;  3BCB A;  4CZZ A;  2QKM B;  4RB1 A;  4OOI A;  1WJB A;  1XGO A;  4L9V A;  1K4T A;  1DU6 A;  3DV8 A;  3K1M A;  3H0G J;  3MMY B;  2IS1 A;  4IO9 F;  3DU6 A;  1HXD A;  1XGS A;  3A0B C;  1YS6 A;  1Y1W J;  5EEA A;  1ZRD A;  4K2E A;  5DS9 A;  4KMU X;  4V19 K;  3J80 Z;  1G59 A;  5E3L A;  3NAR A;  3KZI C;  1IJW C;  5EG0 A;  2XSJ C;  1ZK8 A;  1XMA A;  1S5L C;  1K83 J;  1D1A A;  2XGD A;  1JGS A;  2HR3 A;  1FIP A;  3P7N A;  3UNG C;  3QP5 A;  3S16 J;  1JGG A;  3RKX A;  1IN5 A;  1ZTR A;  3DCF A;  1PDN C;  2JVG A;  3HRU A;  3CF5 F;  2O5R A;  2EA4 A;  4A3B J;  3NWS A;  5HNH A;  4CCL A;  5GTI C;  4IHS A;  2VLA A;  1EF4 A;  2O8K A;  3QPT A;  5HLG A;  2WY7 Q;  1S7A A;  2I8D A;  2W57 A;  2E1M B;  3MWM A;  1QBJ A;  4I0B A;  4E7I A;  2KFD A;  1MNE A;  3AAF A;  4C2T A;  2VB6 A;  1QPM A;  1WH5 A;  4AC0 A;  1O3R A;  1IXC A;  3ELK A;  4XLE A;  2JZY A;  4XLH A;  1R6R A;  1VZ0 A;  1WJ5 A;  1HQC A;  1R71 A;  2EZI A;  4CCM A;  3GLL A;  2HXI A;  3ISP A;  1QHH D;  5ERI A;  3SFZ A;  3C3W A;  4KT5 C;  2XAS A;  2D2W A;  4IHX A;  2YU3 A;  1VQM I;  4Y52 J;  2ME0 A;  5CQG A;  4B48 A;  1IAW A;  4UV9 A;  3DU5 A;  3BZC A;  2MLK A;  3ZMD A;  1ZRE A;  5FRM A;  1FOX A;  3S8P A;  1TQM A;  4XRS A;  3OY9 A;  1KA8 A;  1YIO A;  3DFG A;  4RB3 C;  3ZGK A;  2W84 A;  3H9J A;  3PNY A;  3L2W A;  3HUG B;  3I71 A;  1JHH A;  3EYY A;  1DUX C;  2F4M B;  3HHH A;  1X3W B;  2K85 A;  4OAZ A;  1J9I A;  3CDL A;  4Q5S F;  2CV0 A;  1MBJ A;  1SFU A;  1X19 A;  2VN2 A;  2V1U A;  3DKY A;  4RGR A;  1IN8 A;  5LGN A;  2STW A;  2H6C A;  1VTN C;  3EUA A;  1OYY A;  3OSG A;  4DGW B;  1MJA A;  4F55 A;  1R4N B;  5E3M A;  4CO8 A;  3KLN A;  2QA4 I;  3E97 A;  2EFP A;  2KL4 A;  4B1R A;  4D9J A;  3CME I;  3GFJ A;  3PL8 A;  1ZG1 A;  3AKZ A;  3FIS A;  4ESB A;  3W2A A;  3PNT A;  1SVO A;  2O7O A;  2EZL A;  3RZO J;  1LJ9 A;  3BQY A;  2V9V A;  1W0T A;  1X1D A;  4RDU A;  2GXA A;  3HOW J;  3FXM A;  2C6Y A;  3A03 A;  1VQL I;  3CQZ J;  4I09 A;  4L9J A;  3CLO A;  3JR9 A;  2CW7 A;  5D5W B;  1T0F C;  2MW8 A;  2COM A;  1G8X A;  3JTH A;  1X1A A;  3J7Z I;  2ZJR F;  1XX5 A;  2ZNZ A;  5TGT A;  1ETY A;  2R7Z J;  2TDX A;  1LFU P;  3RI4 A;  1VQ9 I;  2W82 A;  2HOE A;  3WG9 A;  4WK8 F;  2ME6 A;  2CRG A;  5J40 A;  5HNF A;  2X6X A;  1IV8 A;  3BWG A;  2EA2 A;  5LRR A;  4YFN F;  2A6E F;  2NS7 A;  1J7K A;  4WF2 A;  4YIR X;  5JR3 A;  2JA5 J;  2OBP A;  1OYW A;  4I76 A;  4HBL A;  4HX4 A;  4F7Z A;  4O5V A;  5GPC A;  3G71 I;  3DPU A;  1BM9 A;  2FXA A;  1MDM A;  1S29 A;  4KFC A;  3S32 A;  3DEE A;  5EG0 B;  1Y8R B;  2LKP A;  2AXT C;  3BG3 A;  5FO5 A;  2DDA A;  3KE2 A;  1ODD A;  1XB4 A;  1IDZ A;  5F1J A;  2RN7 A;  2CQ7 A;  1J59 A;  3MQ0 A;  3P9I A;  3WGG A;  4YFX F;  3SXY A;  4I02 A;  2DYS H;  1JKP C;  5L3D A;  3Q0W A;  3GTJ J;  2PQ8 A;  4OIO F;  1MGT A;  4PCQ A;  1BR2 A;  3LSK A;  4LLL A;  3K2A A;  5K5O A;  4G7Z F;  2VBX A;  1T2K A;  3O6B B;  1QVU A;  2EZH A;  1F1Z A;  3RDI A;  5BPD A;  3CUQ C;  5IYB J;  2FA5 A;  1VQO I;  4IL6 C;  4WCG A;  4D1Q A;  1QHG A;  1FEX A;  2P6T A;  1TW2 A;  3KYL A;  4PFP A;  1LFP A;  3IH2 A;  2O6G E;  3FBI B;  1OYI A;  3JW4 A;  3EUH C;  1LFB A;  1U9N A;  4G6D A;  4MEY F;  1MW7 A;  1FZP B;  4XK4 A;  1HBX G;  2X1E A;  3SZT A;  4ESF A;  3BY6 A;  2EFQ A;  1U6G A;  2X1C A;  3KX2 A;  1DP3 A;  2ZME A;  1DP7 P;  2Y9Y A;  2XRN A;  1X1B A;  3IP4 B;  2UWM A;  2YUS A;  4BDY A;  2IA0 A;  1OCC H;  2K9S A;  4UV8 A;  1TWA J;  5GAH J;  4CXF A;  2IPQ X;  6PAX A;  2XUB A;  2IGO A;  1P2F A;  2PMH A;  1W7P D;  2V7F A;  4A3J J;  2BV6 A;  2QUF A;  4YG2 F;  1TP4 A;  3PUF A;  2VC1 A;  2ETH A;  4M6V A;  1OJL A;  2Z9O A;  4RGU A;  2W48 A;  1AWC A;  1WWX A;  2XF6 A;  2E60 A;  4YII A;  3DPL C;  2GWR A;  3K69 A;  1E3H A;  5K1Y A;  4CYC B;  1LVK A;  1B72 B;  2COB A;  4GXO A;  5EGO A;  3IKT A;  3RKQ A;  1ZRC A;  3S1Q J;  5H6R A;  3BTJ A;  4YEL A;  2DA6 A;  2ICW G;  3WTZ A;  2EIM H;  3V7R A;  3BPV A;  2L3D A;  4JYK A;  2EH3 A;  3TOA A;  4D7M A;  1P7I A;  3VYT B;  3Q9V A;  5LHI A;  3OIP A;  4E6K G;  4EGY A;  4EJT A;  1S8N A;  2EIL H;  2GIV A;  2WV1 A;  1V4R A;  2OQR A;  4MO7 A;  4MTD A;  3WTV C;  1I6H J;  1X1P A;  2R5Z A;  2PMU A;  3CC2 I;  4NDL A;  1ULY A;  1ETK A;  2MG4 A;  3F8C A;  1OR7 A;  4MFD A;  1EV7 A;  2HZT A;  2RNG A;  3A01 A;  5K5R A;  1R5I D;  2N8G A;  3QYE A;  2J5O A;  4D5C A;  4NQW A;  3T8R A;  3TO9 A;  4KIT B;  2RQP A;  2GOX B;  4ZZL A;  3GZ6 A;  2MC3 A;  4MQV A;  2CFO A;  1TT0 A;  1UHM A;  2RVC A;  1YFH A;  4BU2 A;  2DOE A;  4M6X A;  3I4M J;  4M73 A;  2E7X A;  2NNN A;  3PO3 J;  4ZDL A;  3ZN1 A;  1W36 C;  1XGN A;  3HOV J;  3GFL A;  1SFK A;  2KJB A;  4DYC A;  2HVQ A;  1YO5 C;  2XAG A;  1ZKG A;  3TO6 A;  4XRM A;  5D8L B;  4XIC A;  2Y30 A;  4Y4R A;  2IS6 A;  4GDF A;  2GIZ A;  3JAM Z;  5FKN A;  2DBB A;  2DAO A;  2GBY A;  4KT6 A;  1MBG A;  1QO0 D;  2JUC A;  1XPX A;  4KNY A;  1WJD A;  2KRF A;  1BI2 A;  1W7P A;  3F3X A;  1U8B A;  1HST A;  1VFC A;  1XD7 A;  2P5V A;  1RNL A;  4W97 A;  1GHC A;  2KIM A;  2LY2 A;  3HHG A;  4AYB A;  2VT2 A;  3KCC A;  2WAQ A;  3SEZ A;  4DYR A;  3QU3 A;  1Z9C A;  1O4X A;  3DTI A;  4ZYG A;  2KIQ A;  3FX3 A;  1MD0 A;  5D6F A;  1STZ A;  2XV4 S;  4DIQ A;  4BBR J;  4IF4 A;  2HQA A;  5FJ8 J;  5B3S H;  2IJL A;  2MH2 A;  2VON A;  1T95 A;  4V2F A;  2NOJ B;  5CVU A;  1W1W E;  1YX3 A;  2MBF A;  2F5D A;  4XR6 A;  1ZR2 A;  1YIT I;  2B0L A;  3OS1 A;  3CMA I;  4HF2 A;  2VE9 A;  2DW4 A;  4CCK A;  4RM3 A;  4ABZ A;  3HOX J;  1IRZ A;  4BHB A;  3K4M A;  3BDD A;  4J19 A;  4UVB A;  1B9M A;  2NXN B;  1HW2 A;  3L7W A;  4XM3 A;  4KIB A;  4A3F J;  4HQM A;  5LGT A;  4XNF A;  3DTK A;  4ENJ A;  3M7G A;  4XL9 A;  4KN4 X;  2DN0 A;  2R7O A;  1EA3 A;  4H4K C;  4HSR A;  4UXN A;  5CVI A;  1G3T A;  3CCY A;  2BOL A;  2GAU A;  3OWT A;  3CUQ B;  1HLV A;  3HRS A;  1EH6 A;  2K9N A;  5JHF A;  1FYK A;  1HC8 A;  1LNW A;  1Z3X A;  5F1R A;  3ABM H;  3ZN0 A;  1N75 A;  1IV6 A;  2R7R A;  3MFK A;  1FNN A;  3M8F A;  2CUE A;  2RDP A;  2NVX J;  2CWE A;  4A5M A;  2XF7 A;  2K3F A;  4A2U A;  4M3E A;  2KJC A;  3CLQ A;  1FP1 D;  2GOM A;  3LNQ A;  2FQ3 A;  2JA2 A;  1ZG3 A;  1JKO C;  3CJN A;  3PFY A;  4MFE A;  2DQR A;  1SD5 A;  3PM1 A;  1DQU A;  1LDJ A;  1ON1 A;  3F8F A;  2HYF A;  2R7X A;  1A35 A;  3M1E A;  1Z6R A;  2JN6 A;  3SZP A;  3PQJ A;  1ZH5 A;  3HKZ N;  4O6J A;  3LST A;  5KCM A;  2FU4 A;  4A93 J;  3RQI A;  5FGM A;  3DQV C;  3H1C A;  4BXF A;  4OMY A;  5E8I A;  2HEO A;  2WA0 A;  5E1Z B;  1O7L A;  2DTZ A;  2VQC A;  2YX7 A;  3GW2 A;  3ZMV A;  4OWR B;  4AIK A;  3UR3 C;  1A5J A;  4OIR F;  4HW0 A;  3U9G A;  3S1M J;  4KUM A;  4HPQ A;  3VYR B;  2HTJ A;  4GYG A;  5JHU A;  1F36 A;  1WSU A;  4PSX A;  3RJP A;  5IY5 H;  4A3G J;  2VPL A;  1LPQ A;  3LFU A;  2G9W A;  4PJL A;  4C3H J;  3WTY C;  3T1B A;  5HDN A;  4RM2 A;  4NQW B;  4Z6Y A;  1ZRF A;  3CCV I;  3S2D J;  2W85 A;  3HJE A;  3U1K A;  4FAS D;  2FML A;  1XDS A;  4QPQ A;  4ANJ A;  2MAB A;  4M9X A;  3C2G A;  1K7A A;  1KU2 A;  3GTK J;  3AG4 H;  3TED A;  2OPT A;  1F5T A;  2FX0 A;  1IDY A;  1MBH A;  3CMM A;  1RPW A;  2KRH A;  5C3E J;  3D1N I;  4BE0 A;  4U88 A;  4XON A;  1OCZ H;  1LVA A;  1UB9 A;  1KU7 A;  2ZSI B;  3HOT A;  3L2Q A;  1WGX A;  3ZXS A;  2ECC A;  4RLF A;  1VQ8 I;  4ASN A;  3R6S A;  2HYG D;  4P9F A;  1XSX A;  3I58 A;  3C7J A;  4XKV A;  1W7P B;  1Z3Y A;  2Z2S B;  3QPS A;  4BL0 B;  2E1C A;  2Y69 H;  3ERM A;  2Y9Z A;  4XID A;  4A3M J;  2MD0 A;  2YX4 A;  1JHF A;  3ZCO A;  2E34 A;  2CS3 A;  2FOW A;  3BTC A;  5D5V B;  3VOD A;  2FEZ A;  4W1U A;  5E18 F;  4BY7 J;  1SFO J;  1SFX A;  3TW7 A;  4X1E A;  2XAU A;  3MVP A;  2G0E A;  3OL4 A;  4E7L A;  4XOT A;  4HNT A;  2FQ4 A;  1T39 A;  1DDN A;  2OA4 A;  1R5G A;  1EKE A;  4CUG A;  1IRX A;  1YS7 A;  3CCM I;  5FKL A;  2VQH A;  5JLW A;  3K1P A;  1BW5 A;  2ADU A;  4FQG A;  3LWF A;  2JMW A;  2WB1 A;  4N0B A;  4ON0 A;  2P6S A;  2BBY A;  2ZFU A;  3K4B A;  4LJZ F;  4HV6 A;  4F91 B;  1IW7 F;  3IRR A;  1JUM A;  2M34 A;  2QSF X;  5DTD A;  1FX7 A;  3IUO A;  5H6Q A;  2DXI A;  3FWE A;  3O8H A;  1EH7 A;  4IZZ A;  2IAI A;  5IT3 A;  4ENK A;  2ISY A;  4OU0 A;  1G3S A;  3GTP J;  3T5X A;  3BR3 A;  4BYY A;  4C9Y A;  3E6C C;  3K4N A;  4JX5 A;  5TJJ A;  3I56 I;  3LFK A;  3MZ8 A;  3WTU C;  2K5C A;  2DK5 A;  5E1X A;  3HIF A;  4BDZ A;  4EEF G;  2R7F A;  2R7V A;  4FE7 A;  3HM5 A;  2HYJ A;  4BQN A;  4F93 B;  1ZR4 A;  1EJ9 A;  3A0H C;  2MD5 A;  2V6C A;  3H3V K;  3G6E I;  1WH7 A;  3QU6 A;  2MH9 A;  3MZY A;  1V5E A;  2NS8 A;  3HBL A;  2J5P A;  3NEU A;  5HS8 A;  2JPB A;  3B6A A;  1W4M A;  2XGC A;  5F6F A;  1D0X A;  4DZP A;  2IEK A;  3KFW X;  3ZQL A;  2F5V A;  1FSH A;  5IYC J;  1I3Q J;  4M3B A;  3SDB A;  2X6O A;  1RIO H;  4BAY A;  5M3M J;  1PJR A;  2LLK A;  3CJT B;  3RCO A;  1NG6 A;  2RGV A;  2VKH A;  3MCZ A;  3S17 J;  2HQ5 A;  1ZLK A;  2HXO A;  5EDN A;  2YR2 A;  2X9D A;  3BLY A;  3HEF A;  4L0Z B;  5E79 C;  3SEQ A;  1BIB A;  2BY0 A;  2QGU A;  2VKE A;  3IKV A;  3WGH A;  2O0Y A;  4FHT A;  2IT0 A;  5EF6 A;  2QBY A;  4L9N A;  2MLG A;  1YRN A;  4QPO A;  4G8X A;  4LIT A;  5J4Y A;  3G4S I;  2W1O A;  1K61 A;  2ZCW A;  2H8R A;  1U0J A;  5LHH A;  4JX4 A;  5A2Q Z;  3HTS B;  2Q0O A;  3QWL A;  4UUS A;  3ZMS A;  5CVJ A;  4XSZ F;  4A3C J;  3BPX A;  1UST A;  2VPR A;  2E7W A;  4KN7 X;  4BQA A;  4HLY A;  2JUG A;  2EIK H;  3FM3 A;  1ZG5 A;  4BJT A;  3QOP A;  3E1S A;  4BAC A;  4IRI A;  2P7V B;  3Q3S A;  4EMS A;  4IRH A;  2O61 A;  4LIV A;  2JSP A;  1VQP I;  2AS5 F;  1IRF A;  2OJE D;  5GTH C;  4TV7 A;  5FLM J;  4GYI A;  2DDB A;  4L0Y B;  2DFI A;  2G7U A;  2XRL A;  2L7F P;  4RB0 A;  4B09 A;  1F9N A;  3A4C A;  3WHC A;  4E70 A;  3CP8 A;  4XLN F;  1QNT A;  2VBZ A;  3TW6 A;  3BR2 A;  1GXQ A;  1FT9 A;  3HOS A;  4II3 A;  2A07 F;  2E2J J;  3GX4 X;  4XRF A;  1S7E A;  3ABK H;  3KIO A;  2L7Z A;  1ZGW A;  4M72 A;  1KQ9 A;  1TNS A;  5LFA A;  4DJA A;  1PUF A;  4YRV A;  4HZF A;  1QA6 A;  3GO5 A;  3ZR8 X;  3I9V 2;  1PUE E;  1IUF A;  2VJI A;  3BQZ A;  2BW3 A;  2M87 A;  1N77 A;  3BR5 A;  5HOO A;  2LMD A;  2DA4 A;  3SYT A;  2A5W A;  2ELH A;  2RV8 A;  3QOE A;  1H9T A;  4P5O A;  1XS9 A;  3LSH A;  4ZYE A;  2AHQ A;  1GVJ A;  3HOY J;  1SC7 A;  4B8X A;  3B73 A;  4WXC A;  2QF7 A;  1F4K A;  2CO5 A;  3OYH A;  2HQR A;  4IRG A;  3CO6 C;  4HDV A;  2ZXI A;  1Y39 A;  1TNT A;  3X2Q H;  3JCU C;  2M7A A;  3L09 A;  2F4O B;  3KYC B;  4QSH A;  1CF7 A;  2EWN A;  4X6A J;  1WRJ A;  2M0C A;  1ENH A;  3H9Q A;  3T0Y A;  5M5Y J;  2JQ7 A;  3V7C A;  1I1S A;  5F0C A;  2QKL B;  4JP0 A;  2JTV A;  5DUK A;  1K79 A;  3H35 A;  2HOS A;  2F48 A;  4EJU A;  3M07 A;  2WY8 Q;  3HOZ J;  1O3S A;  1HKT A;  5J47 A;  1WFX A;  2PFB A;  2VXD A;  4AIH A;  4RAF A;  3BT9 A;  3HXL A;  2EJR A;  1JUP A;  3OS0 A;  2FOK A;  3OR2 C;  3OYM A;  2KHM A;  2DCE A;  2DI3 A;  3JRH A;  3J80 K;  2V26 A;  3BG9 A;  1GVD A;  4XLA A;  2VL8 A;  3VSL A;  1I6X A;  5HLH A;  3IWF A;  3HG9 A;  2M7B A;  3ESW B;  4LG0 A;  2F4I A;  2KMU A;  3Q0U A;  3OL3 A;  3R61 A;  4Y33 A;  2DPU A;  1A31 A;  2JSC A;  2NVQ J;  4B4C A;  3HGY A;  1QVT A;  2XAF A;  5L3E A;  1BN5 A;  1B4A A;  3Q5F A;  3E0J B;  2NVU B;  2H8W A;  1S7O A;  3U2R A;  2EFW A;  2Z33 A;  2Y0M A;  3H3Z A;  1R1T A;  4HOB A;  3QYF A;  3R60 A;  5J4V A;  3FMR A;  4AU7 A;  1Z67 A;  2TCT A;  1R4M B;  3K1N A;  3IWZ A;  2OC6 A;  5IP7 J;  3GTO J;  1YRN B;  2GLO A;  4NUB A;  1SD6 A;  5HOD A;  1FLI A;  3NWT A;  3ROU A;  2GM4 A;  2PJR A;  5KHD A;  1XMX A;  3VYU B;  3TDZ C;  4UUS B;  4ZTJ A;  1BOA A;  2RQQ A;  4N4N B;  3K70 D;  2DA5 A;  4BHC A;  3FXL A;  4CDG A;  3D5S C;  2IVM A;  1FPQ A;  5ILS A;  3SDG A;  2HGC A;  1PYV A;  2KDZ A;  5J3L A;  2A05 A;  3W2V A;  4CCJ A;  4PK4 A;  2VC0 A;  3ML6 A;  2WV0 A;  1TBX A;  5LGU A;  3ZQH A;  3HZJ A;  2IXS A;  3G1M A;  5FB2 A;  1BL0 A;  3OYD A;  3H5A A;  2M3A A;  2H6B A;  4F52 A;  1IN6 A;  1R23 A;  1SMT A;  1J09 A;  1GV5 A;  2UV1 A;  2F5F A;  2H94 A;  5LRS A;  2L7M P;  1OLT A;  2E5N A;  3O2P E;  2R5Y A;  1M1E B;  2Z99 A;  1HA8 A;  2EFN A;  2LY1 A;  2ZJP F;  2O8X A;  3DPT A;  1AA7 A;  2RAE A;  4AYB N;  1JKR C;  1Z0X A;  1N78 A;  2WAQ N;  2G7H A;  5L3B A;  3HSE A;  1LEA A;  1LDK B;  3I64 A;  1S9H A;  2L5Q A;  2KIS A;  4M3F A;  4DW6 A;  1FWZ A;  2KDO A;  1S72 I;  2XSD C;  3NAU A;  2LDU A;  2DTR A;  1JI8 A;  3OIO A;  1E3P A;  2DOF A;  3ZQQ A;  1OPC A;  3AL0 C;  2BW3 B;  1YIJ I;  2OF7 A;  3BR0 A;  2CV1 A;  4LB6 B;  1TL8 A;  4CGZ A;  2OV7 A;  3K4K A;  3CC4 I;  1FP2 A;  3G2B A;  1TZL A;  3GZ5 A;  4LK0 F;  3VSK A;  3E3V A;  1YW8 A;  1W5T A;  1USS A;  1YE9 A;  2OCC H;  2L9S A;  1ETQ A;  2MYS A;  1IXR C;  3ZP5 A;  2E19 A;  1BBY A;  1O3T A;  4M6Y A;  1Z77 A;  4XN0 A;  3E5Q A;  3VB2 A;  4CYD A;  2PLY A;  2LF7 A;  3M8E A;  1CF7 B;  3SFI A;  2A6T A;  2HI3 A;  2P8T A;  2V9K A;  2K86 A;  1RRJ A;  4UUV A;  4BE1 A;  3L00 A;  3RKW A;  5DD8 A;  2XKP A;  3CTA A;  3KEO A;  3ZRG A;  2A69 F;  4E4H A;  5KNL A;  4LOC A;  5L3C A;  4PGH A;  3LMM A;  2JA8 J;  2VIX A;  1H88 C;  1OCP A;  5IT9 Z;  3I5U A;  1XDU A;  3GTL J;  3JTG A;  2HNH A;  1V54 H;  1HDD C;  2F6C A;  1R1U A;  2ZME C;  1R7J A;  2JVH A;  1HSJ A;  2L9V A;  4ZDP A;  3L2R A;  4ETS A;  1SAU A;  3CD6 I;  4E7S A;  3N97 A;  3GXO A;  4RMN A;  2H27 A;  3ZMT A;  4LG0 B;  2ZBK A;  2IGM A;  2LVS A;  2QQA A;  1WJE A;  3PSI A;  2E1O A;  2E71 A;  3IH4 A;  3GF2 A;  4LB5 A;  3HGG A;  4FT8 A;  2Z16 A;  2QEN A;  1RKW A;  2DQL A;  5DV5 A;  1JT0 A;  3V8K A;  4BHP A;  3I0T A;  1BIA A;  2DFH A;  1ETV A;  1VQK I;  1UCR A;  3BC8 A;  4R79 A;  3LSP A;  4EM1 A;  4ZTF A;  2K9Q A;  4A12 A;  3MZH A;  2DO7 A;  4IXA A;  2PJR B;  2BHZ A;  3RIR A;  4LK1 F;  1MJB A;  2ACJ A;  1ZGA A;  2M30 A;  3QRF F;  2ISZ A;  5BNG A;  1TWH J;  5C4J J;  1GT0 C;  4AUX A;  1OR7 C;  1WVR A;  3Q9S A;  4D5F A;  3KLO A;  1BI0 A;  2K27 A;  3WE2 A;  1SMY F;  4UB6 C;  2BVM A;  2XGX A;  5IP6 A;  1NH3 A;  3PNV A;  3LSR A;  3FF5 A;  2IRF G;  1R49 A;  2DA2 A;  1K4S A;  3J81 Z;  1TWC J;  4PJ0 C;  3DXJ F;  2M4G A;  2BYV E;  1D0Z A;  1QZZ A;  3E6D A;  2KZG A;  3F72 A;  4XSX F;  4UVC A;  1PP7 U;  2K7L A;  1PP8 F;  1X58 A;  3JRB A;  3CMY A;  4WXH A;  4FE4 A;  1TWF J;  3LAJ A;  4C3J J;  3JRD A;  2R5Y B;  1W5C C;  3R0J A;  1NK2 P;  2EB7 A;  2JJ7 A;  5ICF A;  4LGW A;  3ZQC A;  2ESH A;  4IX7 A;  1Y0N A;  4NC6 A;  3OOU A;  4E7H A;  1WQ2 A;  2XPV A;  4C2M J;  4B43 A;  3JRC A;  4I2O A;  2B9S A;  5AON A;  4BE2 A;  4IHV A;  1TLH B;  5H20 A;  3PIP F;  1MMS A;  4DQ2 A;  2GA2 A;  2KIU A;  3E6M A;  4QWQ A;  1E17 A;  1I39 A;  1I3A A;  2BVL A;  3ULQ B;  2FBH A;  1MDM B;  1MND A;  2XB5 A;  3AG1 H;  1RC9 A;  3IHU A;  1UJ8 A;  4DOZ A;  1FC3 A;  3ABL H;  3C18 A;  4JOM A;  3L2U A;  4HLX A;  1OIS A;  3AL0 B;  4XBF A;  1S6L A;  5IPA A;  1J75 A;  2JWT A;  3CC7 I;  2WB1 N;  4B3X A;  2LP0 A;  3S2H J;  2CJJ A;  1GV2 A;  3KEY A;  1Z21 A;  4XRS G;  1IUY A;  3OYC A;  2H1L A;  1ORK A;  3K4L A;  3N05 A;  4ZH4 F;  5HDK A;  2EFO A;  2JRT A;  4Q48 A;  2HS5 A;  2KQR A;  4B44 A;  1WKM A;  2IW5 A;  2V79 A;  2ZO4 A;  5ED4 A;  3F9K A;  3PJR A;  4NB5 A;  4U0V A;  2P81 A;  3CJQ B;  3DWL E;  4V2G A;  2CV2 A;  1ETW A;  2L9R A;  2BE5 F;  4M71 A;  4KMF A;  2DFF A;  2XB0 X;  2X51 A;  2ZJ2 A;  1KQ8 A;  2A3S A;  2PX9 A;  3IH3 A;  4EJV A;  2KPM A;  1CQT A;  4JQF A;  1L3L A;  1Y1V J;  5F0F A;  2A68 F;  5F04 A;  4C2U A;  1RZ4 A;  5GAG J;  2B63 J;  3G73 A;  3M4O J;  1EH8 A;  3ASN H;  5FFX A;  4G9Y A;  2NS0 A;  1KYW A;  4IEJ A;  3IAM 2;  1IF1 A;  2XAH A;  2UZK A;  2ZME B;  1P4W A;  2DYR H;  1T08 B;  2L4M A;  5J1Y A;  4A0Z A;  2XHK A;  2HOA A;  4J01 A;  1O7F A;  4XLP F;  1YTY A;  1R5H A;  4G94 A;  2R7W A;  3RQ4 A;  2Z1D A;  1BC7 C;  3PO2 J;  4O3M A;  5ICG A;  1H89 C;  5CJ9 A;  5J8F A;  5KVR A;  3F8N A;  5EEH A;  2Y31 A;  5M3F J;  4KIG A;  1B6A A;  4HAM A;  3HRM A;  1A6Q A;  4ITV A;  1IXS B;  1AKH A;  2YPR A;  2BY3 A;  4BGD A;  1H8A C;  4E7Z A;  1WCM J;  2VOP A;  3TP0 A;  1GUU A;  3DKX A;  1MMA A;  4EM0 B;  3HSR A;  5EGO B;  3FXO A;  5FD5 A;  3V7S A;  2QYO A;  4Y15 A;  1UEL B;  3FZV A;  4A3K J;  1HCR A;  2DA3 A;  4U87 A;  4IKF A;  3ABU A;  2F2E A;  2K3P A;  2L02 A;  3CCL I;  4C3I J;  1YQA A;  4G7O F;  4JBA A;  5F0H A;  3JRI A;  1ON2 A;  3HPG A;  1KZH A;  3PSF A;  2GXB A;  4AVZ A;  2R5Z B;  3S1N J;  1HW5 A;  2E5Z A;  3A01 B;  2IS4 A;  1O57 A;  1SFE A;  2K4B A;  3RYR A;  2KZV A;  4CCO A;  4BJ6 C;  3LAP A;  1W0U A;  3U21 A;  1XSV A;  2BY2 A;  2P4W A;  3AFH A;  4KIS A;  2QWW A;  2PG4 A;  1D3Y A;  2KKO A;  4EM2 A;  1VQ4 I;  4LLN A;  3CUO A;  5ILU A;  4ZJZ A;  2WTE A;  5K7F A;  1ZQ3 P;  3K6G A;  3PFI A;  2CSO A;  2FBK A;  1MH4 A;  2OTJ I;  1V3F A;  4DYQ A;  2M2E A;  4RGX A;  5E3N A;  3W6K B;  2MGQ A;  2CQX A;  4XN3 A;  2HVS A;  3EYI A;  4UUT A;  3BJA A;  4Y13 A;  1VQ6 I;  4Y17 A;  2M9H A;  3RPU D;  2DMN A;  2FJ1 A;  3S93 A;  4BY1 J;  1AU7 A;  3I4P A;  5CLS A;  4ZC3 A;  3DKW A;  4CHU A;  5IYD J;  2FF4 A;  2X0L A;  3TKY A;  5FLV A;  3CF2 A;  4A5N A;  3RSN A;  4DNC A;  3FBN B;  4I0A A;  3K2Z A;  3EUK L;  3SZG A;  4HV5 A;  1P7J A;  5M5W J;  2WC2 A;  2WAD A;  2FBI A;  2HKX A;  2L54 A;  1WHU A;  4FTH A;  2K9M A;  3RYP A;  3OYN A;  1A36 A;  4XKW A;  4AWX B;  3CCS I;  3VFZ A;  3AG2 H;  2Q2E A;  4YFK F;  5BPI A;  3C2H A;  3KZY A;  3OYL A;  5DDG A;  4IOA F;  1ACI A;  3VEP A;  2IS2 A;  4A6E A;  2LBF A;  5FKM A;  1U9O A;  1WJC A;  3KYD B;  1FYM A;  2L9N A;  1MH3 A;  4KDP A;  1B1B A;  3S14 J;  3A2K A;  2K02 A;  3QYB A;  1QGP A;  3RZD J;  1X2M A;  1A6I A;  1DPU A;  1KYZ A;  4IPA A;  4RAZ A;  5IOY A;  5HS9 A;  2XPU A;  4S04 A;  1YJN I;  3RPU A;  2PBI A;  1E3O C;  3JSP A;  1YJW I;  2HFH A;  3F6V A;  2OUM A;  2CUF A;  4RAY A;  2E2H J;  1ONV A;  1BOB A;  3A1Y A;  4CIC A;  2FSW A;  4I6Z A;  2XRO A;  2VT3 A;  2ZNY A;  2HKO A;  2JPC A;  3MD2 A;  3RPQ A;  1DGW Y;  3V4G A;  1WI3 A;  1U5T A;  5FLX K;  3UKG A;  1FMW A;  2LG4 A;  3OSF A;  3KEQ A;  3ZQG A;  5KK1 A;  2RC4 A;  4PUS A;  3DBR B;  2LRD A;  2R3S A;  1FOY A;  1RKT A;  5EJC A;  1QZE A;  3SQN A;  4EVI A;  1WZ2 A;  5KAI C;  3L2C A;  1LE8 A;  1I27 A;  4M3D A;  3D5R C;  2OZ6 A;  3I55 I;  3FDY A;  3LSG A;  2NNY A;  2XC7 A;  4N9I A;  3I4N J;  3KP5 A;  4MNU A;  5JVG F;  4I98 B;  5E20 A;  1D1B A;  4BS9 A;  3MKW B;  1RUN A;  1NG7 A;  1H9G A;  3WGI A;  4GFB A;  1P92 A;  2CFX A;  4MGR A;  1XSD A;  1JJ8 C;  2LOO A;  1I5Z A;  1BC8 C;  1OKR A;  2VOO A;  3HPH A;  2L2O A;  2EPF A;  2R92 J;  2ZB9 A;  2I10 A;  4OAY A;  2LYC A;  4EJW A;  3FKI J;  5EZH A;  3MEX A;  1R36 A;  4FX0 A;  4RLQ A;  4ZYA A;  2HU9 A;  3GFM A;  3DBH B;  3ZOB A;  3J7Y J;  4ENM A;  2R0Q C;  3A02 A;  2DMU A;  2X48 A;  5EYR A;  2BGC A;  3FM5 A;  1UMQ A;  1Z05 A;  5CYV A;  2EK5 A;  3V8L A;  1BI3 A;  2GQQ A;  2DU9 A;  3ZMZ A;  3EDP A;  4I99 C;  3FMQ A;  1SD4 A;  1I50 J;  5DUI A;  2VAS A;  5E8G A;  3H9G A;  4RGS A;  4IJA A;  5JVT A;  3ERE D;  5BOX A;  3VWB A;  4XKC A;  2ELJ A;  1Y8Q B;  4P1W A;  1MSE C;  5ICC A;  2RRE A;  1DU0 A;  2EZK A;  5B66 C;  2L01 A;  1POG A;  2M4K A;  3C2B A;  3DBL B;  3FIW A;  2YU9 J;  3HOU J;  1R1V A;  1R9T J;  3EET A;  1MIJ A;  3K4C A;  5CVR A;  4S05 A;  2YS9 A;  1V55 H;  5K7H A;  2Q2E B;  1GLN A;  2X6Y A;  4S0H B;  1KGS A;  4Q4Z F;  3S3O A;  1VI0 A;  1HKQ A;  5LEK A;  1BW6 A;  2AO9 A;  2DK8 A;  1Q1H A;  4FCY A;  2JA7 J;  3BRO A;  4Y7N J;  2BHY A;  2P5L C;  1R22 A;  4A0Y A;  2HOT A;  2Y0S A;  2LBF B;  3S15 J;  1MJ9 A;  4HRI A;  2OTL I;  3HDD A;  3F21 A;  5HLI A;  4YIF A;  1X4P A;  2QLZ A;  1G3W A;  3R4K A;  3TDU C;  3TOB A;  2CQK A;  2NVY J;  3ECH A;  4OIQ F;  2GZW A;  1B8I A;  1X2N A;  3F0C A;  3WU1 B;  4A3I J;  2LTP A;  3KP7 A;  3BCA A;  1P4A A;  1T8I A;  1TTY A;  2FD5 A;  1KON A;  3W6V A;  1MBE A;  2IA1 A;  3O3K A;  2XPW A;  2R7S A;  2PMZ A;  1HF0 A;  3IL2 A;  3NQO A;  1T33 A;  2DMP A;  5BS6 A;  2EV5 A;  3AG3 H;  3W6J B;  1XCV A;  3P9K A;  4MLO A;  3VPR A;  4HNU A;  2OAZ A;  4DBR A;  2AQE A;  2VBY A;  1RR7 A;  2A61 A;  3LSM A;  2O3F A;  2Y75 A;  1TWG J;  1N25 A;  3E5X A;  3WTS C;  2AXL A;  1U5T B;  2VI6 A;  1D5V A;  4LD5 A;  2NRA C;  2W00 A;  1JJ6 C;  5J8C A;  2HDW A;  3OYJ A;  1E0E A;  3VYS B;  2NOG A;  1D0Y A;  1FBU A;  1BJZ A;  2MFZ A;  3ZQI A;  4B47 A;  3HL2 A;  2NVT J;  4BEH A;  2V1X A;  2LF8 A;  2QQ9 A;  3FXJ A;  2CMP A;  4CH7 A;  3F6O A;  3BJO A;  1LE8 B;  1OQY A;  2A5Y B;  1FYL A;  4XKB A;  1CGP A;  3HRT A;  3PUB A;  4A6D A;  2QSG X;  2RKH A;  3C1D A;  2QBY B;  3QP6 A;  1DPR A;  3BG5 A;  3FXR A;  3KZZ A;  3WE3 A;  4IVN A;  2ZFW A;  5B1A H;  1T56 A;  4WXD A;  3LA7 A;  4XLC A;  4MHG A;  2L4A A;  1IN4 A;  3MKY B;  3GYH X;  1X3U A;  1UAA A;  1UHW A;  2XDV A;  1ZAO A;  2CQN A;  2QM3 A;  4UB8 C;  3GVA A;  4IHW A;  1YX5 A;  1BI1 A;  1ZHF A;  2JK3 A;  3ZMU A;  1FTT A;  3RTR A;  2UUZ A;  1OMI A;  2HPI A;  1X4O A;  5DD4 A;  1JXS A;  1OCO H;  2ECB A;  3MN2 A;  3FK6 A;  3L1P A;  3H5N A;  1ZGJ A;  4CYC A;  1FBQ A;  1B72 A;  3R0A A;  2R7Q A;  3OMY A;  2Y2Z A;  2QVO A;  2V1N A;  1KQ0 A;  3S3M A;  3FKJ A;  5FFZ A;  1FOW A;  3OV8 A;  1K6Y A;  2D5V A;  4OIP F;  2L0K A;  3W3C A;  1UFM A;  1WI9 A;  2X85 A;  5DCF A;  2LK2 A;  3FHZ A;  2QZ8 A;  4HX8 A;  1U78 A;  1T98 A;  2RNJ A;  3F8M A;  3P9C A;  1ZYR F;  2FUG 2;  1PUF B;  1YLF A;  1RR8 C;  3LSJ A;  1ZAR A;  2TRT A;  4PDK A;  2LKS A;  3HTU A;  3M8J A;  2KLO A;  4A3E J;  3JRF A;  3Q0V A;  4GO1 A;  4MQ9 F;  1WJA A;  2LRE A;  5FKK A;  1YW7 A;  2DA1 A;  4FET A;  4HYE A;  3N4M A;  1UG0 A;  2R7D A;  4HF0 A;  1FY7 A;  4U7D A;  1XN7 A;  1AOY A;  3QPH A;  3GTM J;  5CPR B;  3KP3 A;  4A3D J;  1IRG A;  4MIM A;  4G6Q A;  5E3O A;  1ZEL A;  2R7T A;  1P4X A;  2CW0 F;  2FRH A;  2M0M A;  4KA4 A;  1Z7U A;  3ABT A;  5GP9 A;  4GCV A;  1T0F A;  2IP2 A;  3JRE A;  4LG3 A;  4LMY A;  3K70 C;  3OYB A;  3ZQF A;  2KRC A;  3BR6 A;  5LHG A;  5K5Q A;  4II2 A;  2M45 A;  3JRA A;  5DM7 F;  3OYK A;  5DM6 F;  3BOQ A;  1B8I B;  4G7H F;  1FJL A;  2GXG A;  5F64 A;  4H0E A;  2E1N A;  4F92 B;  4HA8 A;  1RI7 A;  4QLC U;  1HW1 A;  3CJR B;  2QEX I;  2W7N A;  2W4S A;  2ELK A;  5DCM A;  4ZYD A;  4BXX J;  4Z2Y A;  2OZU A;  3TMO A;  3S3N A;  3EQL F;  4QIW N;  1AHD P;  4KYW A;  2KIF A;  3K10 A;  2XAQ A;  1QU3 A;  3TGN A;  3GTG J;  2I5U A;  2EBI A;  4XLF A;  3QQA A;  1JTY A;  4UHT A;  1V5G A;  2MSY A;  4PSW A;  2PI0 A;  3E7L A;  4PJN A;  2YSR A;  4JX6 A;  1X1C A;  2ESN A;  2GA1 A;  1MBF A;  1KU3 A;  1ZLJ A;  3LQR A;  2X1D A;  3DEU A;  4NBQ A;  2EIJ H;  5DEQ A;  5J1U A;  3BG6 A;  1YW9 A;  4X0G A;  1MMG A;  2E35 A;  3KP2 A;  1J2X A;  3GTQ J;  2DT6 A;  2VJJ A;  3I54 A;  1G6N A;  5TIS C;  3W2W A;  4BEH B;  1NK3 P;  1MKM A;  1X3Z B;  1BJA A;  3G1O A;  3U1D A;  5EEG A;  4RB2 C;  3TBI A;  2CH0 A;  3S1R J;  1GXP A;  3FMS A;  4CSW A;  1U3E M;  3NRV A;  5TRD A;  1G4D A;  3H0D A;  2X4H A;  3CUQ A;  1F43 A;  1I1G A;  3BZK A;  3EUH A;  1W36 D;  1Y6I A;  1YI2 I;  5IT9 K;  2D1H A;  4R1H A;  2DMQ A;  4Y3O A;  3TP3 A;  3QAH A;  1JUS A;  5L3F A;  2HVR A;  4EGZ A;  4IHY A;  4XMY A;  2HDC A;  1G3Y A;  3J7A O;  2XVC A;  4M3G A;  4NC8 A;  4A69 C;  2DMT A;  3L9F A;  2VBW A;  2Z3Y A;  1MZB A;  3G3Z A;  1IZ1 A;  4UY8 I;  3MAJ A;  5E17 F;  5FRO A;  4M9S A;  4B3A A;  1IGN A;  1XTA A;  3I59 A;  4GRI A;  3WG7 H;  2VKD A;  2VQL A;  1VQN I;  1FSE A;  2VE8 A;  1REP C;  2XF5 A;  3CCJ I;  2H1K A;  3SHF A;  2VXZ A;  3BR1 A;  1FMV A;  1JE8 A;  3MKL A;  2Q8K A;  2LR8 A;  2M1B A;  1D8J A;  5L3G A;  1P9Q C;  4BKX A;  1HDP A;  5FKO A;  4Q47 A;  2CYY A;  2D1V A;  4D0P A;  3CCU I;  1O3Q A;  5D8K B;  3VDX A;  4HNV A;  4G12 A;  4HEA 2;  1U2W A;  1OCR H;  2MA3 A;  4M74 A;  3CCE I;  1SD7 A;  1LUJ B;  4AIJ A;  3L2V A;  1ERD A;  4ZDO A;  2W24 A;  2R7U A;  2LNB A;  4PZJ A;  3WHB A;  1G2H A;  2JT1 A;  3G1L A;  2OCE A;  5E1W A;  3IV5 A;  4I01 A;  4LIU A;  2Q1Z B;  1VF9 A;  2ZSH B;  3J81 K;  3HYI A;  2STT A;  4C30 A;  2MC4 A;  2CU7 A;  2EQR A;  1D1C A;  3GCM A;  4RAG A;  4IHT A;  1ITY A;  4ESJ A;  2CUJ A;  2CUZ A;  1E2X A;  2WWY A;  4EAT A;  1B9N A;  1QQI A;  1Y0U A;  2EV6 A;  3K9T A;  3KET A;  5C4X J;  1TT5 B;  5K7Z A;  4ZYH A;  3F23 A;  1JKQ C;  1P6R A;  1UHS A;  2VKV A;  2JRM A;  3M1C A;  3K0L A;  2UXX A;  5D4S A;  5DCM B;  3V8J A;  5GAE J;  2D45 A;  3REO A;  3DLL F;  5GAD J;  1VQ7 I;  4E7J A;  3DF8 A;  3ECO A;  3H3U A;  4PJJ A;  1L0O C;  4NNJ A;  4P55 A;  3OYI A;  5HS7 A;  3ZPL A;  3CZ6 A;  2Y48 A;  2DPD A;  2FNA A;  2P0W A;  3JAM K;  3CO7 C;  2OU2 A;  1Z7L A;  4BNC A;  1J0R A;  2KP6 A;  4M9Z A;  4BQO A;  5FRN A;  1MMN A;  4EJO A;  4A0X A;  1YHQ I;  3OYA A;  2DT7 B;  5M5X J;  1Z6T A;  2DA7 A;  2QQB A;  4G6T B;  3PQK A;  2HWV A;  5JI6 A;  5HVQ C;  5LEJ A;  1YOV B;  1UG2 A;  1SAX A;  1QZY A;  2K4J A;  3CDI A;  1MMD A;  4I7H A;  4AID A;  1XGM A;  3E5U A;  2ID6 A;  1VQ5 I;  2VUM J;  2WAE A;  1ETX A;  2FE3 A;  1DGR M;  4N4O B;  1H0M A;  3WTX C;  5IOZ A;  3LQQ A;  4L18 B;  3B6C A;  1XMK A;  5CQE A;  1IN7 A;  5HLT A;  5D5U B;  5JFR A;  3JSO A;  4DBQ A;  3B02 A;  1LDD A;  5IP9 J;  4NC7 A;  1HKS A;  2ID3 A;  4XQF A;  3DLA A;  5D5X B;  1YJ9 I;  2CW8 A;  2V1D A;  5DYM A;  4MTE A;  1D5Y A; 
#chains in the Genus database with same CATH homology
 4BDY A;  4PUS A;  3E0J B;  2LRD A;  2WBM A;  2IGO A;  2V7F A;  2HPM A;  3J7A Y;  3D5R C;  3QYF A;  4BUP A;  3FDY A;  3LSG A;  4AU7 A;  2XC7 A;  2OC6 A;  2XF6 A;  1D1B A;  2E60 A;  4NUB A;  3DPL C;  2AQF A;  4BS9 A;  3MKW B;  1LVK A;  1NG7 A;  3NWT A;  2PJR A;  1WJF A;  5KHD A;  4YEL A;  3VYU B;  2K9L A;  2LOO A;  3OYE A;  4ZTJ A;  2RQQ A;  4N4N B;  3K70 D;  3CP2 A;  3HPH A;  3VYT B;  2L2O A;  3OIP A;  4E6K G;  3D5S C;  4OAY A;  2LYC A;  1PYV A;  3OIQ A;  3W2V A;  4CCJ A;  4PK4 A;  4RLQ A;  4ZYA A;  2HU9 A;  4HST A;  2RNG A;  3LSI A;  1LKX A;  2LC2 A;  3QYE A;  2IXS A;  4KIT B;  3OYD A;  2GOX B;  2V4J C;  2IGK A;  3H5A A;  2M3A A;  4F52 A;  2CFO A;  1TT0 A;  4F3Q A;  1J09 A;  2UV1 A;  4BU2 A;  1OLT A;  2E5N A;  4ZDL A;  3I3L A;  1W36 C;  2UWM A;  1HA8 A;  4BJ5 C;  2VAS A;  3H9G A;  2LY1 A;  3DPT A;  1AA7 A;  1SFK A;  3D5L A;  2VJ4 A;  2HVQ A;  4XKC A;  3VWB A;  1N78 A;  2ELJ A;  4P1W A;  1LDK B;  2RRE A;  1S9H A;  2L5Q A;  4Y4R A;  2IS6 A;  2KDO A;  2M4K A;  1JI8 A;  4BQQ A;  3ZQQ A;  4KT6 A;  3AL0 C;  2BW3 B;  2WAF A;  3K4C A;  3IAS 2;  2CV1 A;  1WJD A;  1Y56 A;  2OV7 A;  2DJI A;  1GLN A;  2Q2E B;  2X6Y A;  3K4K A;  4J00 A;  2LY2 A;  3S3O A;  4AYB A;  3G2B A;  1TZL A;  2WAQ A;  3SEZ A;  3VSK A;  3GBG A;  2VQG A;  3DTI A;  1YE9 A;  2L9S A;  4DIQ A;  2MYS A;  5LD2 C;  2R4G A;  2Y0S A;  2LBF B;  4HRI A;  2HQA A;  1T95 A;  1X4P A;  4XN0 A;  2DOA A;  2NOJ B;  5CKT A;  1BR4 A;  1YX3 A;  3OYF A;  2HZD A;  2A6T A;  4XR6 A;  3OS1 A;  2V9K A;  4CCK A;  4RM3 A;  3BCA A;  4BE1 A;  4E7K A;  3K4M A;  1KON A;  4XM3 A;  2R7S A;  3ZRG A;  2PMZ A;  4E4H A;  5KNL A;  4XNF A;  3DTK A;  4XL9 A;  3LMM A;  4IQJ A;  2R7O A;  1EA3 A;  2VIX A;  4H4K C;  4HSR A;  3FHN A;  4CZC A;  4MLO A;  2HNH A;  2BOL A;  4HNU A;  2F6C A;  3H5R A;  4ZDP A;  4CCN A;  2JVH A;  3OWT A;  4DBR A;  3L2R A;  2AQE A;  1SAU A;  4E7S A;  3LSM A;  3K4J A;  5JHF A;  2E1M C;  3DTE A;  3QOD A;  4RMN A;  1Z3X A;  3ONQ A;  2IGM A;  2W00 A;  4YEJ A;  2HDW A;  1N75 A;  1WJE A;  3OYJ A;  4U7B A;  2R7R A;  3PSI A;  2X6W A;  3VYS B;  2IGN A;  4XOR A;  1D0Y A;  2MFZ A;  4B47 A;  3HL2 A;  4BEH A;  2XF7 A;  3BG7 A;  2CMP A;  1BR1 A;  4CH7 A;  2Z16 A;  3OR1 C;  2GOM A;  2JA2 A;  4KJZ A;  3HC7 A;  3PFY A;  4XKB A;  1DQU A;  3PUB A;  3BC8 A;  4R79 A;  2R7X A;  4ZTF A;  4XOP A;  5KCM A;  2LH9 A;  2PJR B;  3DQV C;  4BXF A;  3CES A;  4XLC A;  3OYG A;  2WA0 A;  3MKY B;  2VQC A;  1UAA A;  2XDV A;  4OWR B;  3UR3 C;  1YX5 A;  1OR7 C;  4HPQ A;  3VYR B;  3RTR A;  2UUZ A;  2HPI A;  3HKZ A;  1X4O A;  2BVM A;  2L7K A;  4PSX A;  3PNV A;  2VPL A;  3MKZ A;  3H5N A;  3LFU A;  3LL7 A;  1V5F A;  4PJL A;  4IQ4 A;  3V42 A;  4RM2 A;  4NQW B;  2M4G A;  1D0Z A;  2R7Q A;  3OMY A;  4FAS D;  2V1N A;  3EPZ A;  4QPQ A;  3FKJ A;  2MAB A;  4ANJ A;  3S3M A;  2VJ5 A;  3C2G A;  1K6Y A;  3W3C A;  2X85 A;  3CMM A;  2KRH A;  4BE0 A;  3TL4 X;  4IX7 A;  2FUG 2;  3OOU A;  4XON A;  4E7H A;  4B43 A;  2ZSI B;  3HOT A;  3M8J A;  3L2Q A;  2KLO A;  3ZXS A;  4BE2 A;  4RLF A;  1WJA A;  2LRE A;  2V6E A;  4FET A;  4HG2 A;  1UG0 A;  4PJM A;  2BVL A;  4PFO A;  4XKV A;  1MND A;  5CPR B;  1Z3Y A;  2Z2S B;  4DOZ A;  1ZEL A;  4BL0 B;  2ZXH A;  3OS2 A;  4JOM A;  3L2U A;  2R7T A;  2M0M A;  3AL0 B;  4CA0 A;  2MD0 A;  3ZCO A;  2CS3 A;  3BCB A;  2QKM B;  4LG3 A;  4B3X A;  3K70 C;  3OYB A;  1WJB A;  2KRC A;  3KEY A;  1Z21 A;  2XAU A;  4II2 A;  3OYC A;  3OL4 A;  4E7L A;  3MMY B;  3K4L A;  4XOT A;  3N05 A;  3DU6 A;  4HNT A;  2IS1 A;  3OYK A;  2KQR A;  4B44 A;  4CUG A;  1IRX A;  4F92 B;  1G59 A;  2VQH A;  3CJR B;  3F9K A;  3PJR A;  2W7N A;  2W4S A;  2XSJ C;  3TMO A;  3CJQ B;  2WB1 A;  1D1A A;  3DWL E;  3S3N A;  2CV2 A;  3K10 A;  1QU3 A;  2X51 A;  2ZFU A;  3K4B A;  3UNG C;  4F91 B;  2KPM A;  4XLF A;  4JQF A;  1V5G A;  4C2U A;  4PSW A;  2JVG A;  4PJN A;  2O5R A;  1X1C A;  3IUO A;  2DXI A;  3NWS A;  5HNH A;  4IZZ A;  4CCL A;  2X1D A;  3IAM 2;  2VLA A;  3BG6 A;  4X0G A;  1MMG A;  4C9Y A;  4J01 A;  3K4N A;  2WY7 Q;  2I8D A;  2DT6 A;  2VJJ A;  2E1M B;  2K5C A;  3W2W A;  4E7I A;  4BEH B;  4BDZ A;  2R7W A;  1E0E A;  1MNE A;  3RQ4 A;  2R7V A;  4C2T A;  2VB6 A;  4BQN A;  4F93 B;  3TBI A;  2CH0 A;  2Z1D A;  4CSW A;  4XLE A;  4XLH A;  1R6R A;  1V5E A;  1VZ0 A;  1WJ5 A;  3H0D A;  4CCM A;  4ITV A;  1D0X A;  1QHH D;  4BGD A;  4E7Z A;  3DKX A;  2F5V A;  1MMA A;  1W36 D;  1Y6I A;  3SDB A;  5CQG A;  4B48 A;  1PJR A;  3RCO A;  3DU5 A;  1NG6 A;  1UEL B;  5FRM A;  4Y3O A;  2VKH A;  3S8P A;  4U87 A;  4IKF A;  3OY9 A;  2K3P A;  2HVR A;  4XMY A;  3BLY A;  4NC8 A;  3ZGK A;  3HPG A;  3SEQ A;  3H9J A;  3PNY A;  3PSF A;  3HUG B;  3L2W A;  5FRO A;  4AVZ A;  4GRI A;  2E5Z A;  2VKD A;  2VQL A;  4QPO A;  2IS4 A;  2XF5 A;  4LIT A;  4OAZ A;  2W1O A;  2VXZ A;  2CV0 A;  2KZV A;  1FMV A;  1X19 A;  4CCO A;  1U0J A;  4BJ6 C;  3DKY A;  3U21 A;  3AFH A;  4KIS A;  1P9Q C;  3EUA A;  4DGW B;  4F55 A;  4ZJZ A;  2JUG A;  3K6G A;  2KL4 A;  4BJT A;  4D9J A;  3PL8 A;  3E1S A;  3VDX A;  4BAC A;  3AKZ A;  3W2A A;  3PNT A;  4HEA 2;  2JSP A;  4LIV A;  4XN3 A;  2HVS A;  1X1D A;  3RPU D;  3A4C A;  3CP8 A;  1ERD A;  3L2V A;  3S93 A;  4ZDO A;  2R7U A;  2CW7 A;  1T0F C;  3HOS A;  4II3 A;  4ZC3 A;  1G8X A;  4LIU A;  1X1A A;  5TGT A;  2Q1Z B;  2ZSH B;  2W82 A;  3CF2 A;  4C30 A;  2MC4 A;  3RSN A;  3FBN B;  5HNF A;  3EUK L;  1D1C A;  3SZG A;  5LFA A;  2X6X A;  4DJA A;  4YRV A;  2CUJ A;  2CUZ A;  3ZR8 X;  3I9V 2;  2WAD A;  4EAT A;  2VJI A;  2K9M A;  3OYN A;  3DPU A;  2BW3 A;  4XKW A;  1N77 A;  5HOO A;  3M1C A;  3SYT A;  2A5W A;  3S32 A;  3DEE A;  3QOE A;  4P5O A;  3C2H A;  4E7J A;  3LSH A;  3OYL A;  4PJJ A;  4NNJ A;  2IS2 A;  3OYI A;  3CZ6 A;  2P0W A;  3OYH A;  1Z7L A;  2LBF A;  2KP6 A;  4BQO A;  5FRN A;  2ZXI A;  1MMN A;  1WJC A;  2M7A A;  3OYA A;  2L9N A;  2DT7 B;  3H9Q A;  4G6T B;  5HVQ C;  3A2K A;  2QKL B;  3QYB A;  3H35 A;  1BR2 A;  3LSK A;  1MMD A;  2WY8 Q;  1WFX A;  2VXD A;  2WAE A;  4D1Q A;  1QHG A;  3HXL A;  1DGR M;  4N4O B;  3KYL A;  3OS0 A;  3OR2 C;  2OUM A;  2KHM A;  1LFP A;  2DCE A;  4PFP A;  3OYM A;  2V26 A;  1BOB A;  3A1Y A;  3FBI B;  3EUH C;  5CQE A;  4XLA A;  5HLT A;  1MW7 A;  2VL8 A;  3VSL A;  3MD2 A;  1DGW Y;  3HG9 A;  2M7B A;  2X1E A;  4DBQ A;  2F4I A;  2KMU A;  2X1C A;  3KX2 A;  4NC7 A;  3OL3 A;  1DP3 A;  4Y33 A;  4XQF A;  3DLA A;  1FMW A;  2LG4 A;  2CW8 A;  1X1B A;  3IP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...