2K9MA

Structure of the core binding domain of sigma54
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
YTPSELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVEELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKRGKKLKPEIKGKLSRLRLFPLSSSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor RpoN
publication title Structure of the RNA polymerase core-binding domain of sigma(54) reveals a likely conformational fracture point
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 27
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2008-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1330 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2k9mA00
2K9LA 2K9MA
chains in the Genus database with same CATH superfamily
1ZKGA 1OCOH 4F55A 1LDDA 2R7WA 2G7UA 4RM2A 1Y1WJ 3A1YA 2M7BA 2PG4A 3CJTB 3OL3A 4LITA 5F6FA 2XB5A 1SVOA 1ZR4A 4L9VA 2P5VA 4UB6C 1XS9A 4FTHA 2M8GX 3V8LA 2QKLB 2RGVA 4RGXA 1O3TA 2QYOA 3DKYA 5FKOA 3M8EA 2H8RA 1E0EA 4XNFA 4ENKA 5H2FC 1EF4A 1KA8A 5HLHA 4P5OA 5FD6A 1X3UA 1T8IA 2EFOA 2DA3A 3CCMI 2D5VA 3QOPA 3ESWB 4XLHA 1MMDA 3CUQA 2VC1A 3JSPA 2ZJPF 2R0QC 3HOVJ 1DP3A 3SFZA 2V6CA 4DOZA 3QYEA 4E7JA 3BT9A 3BP8A 1QPIA 3A2KA 5AONA 2Z1DA 5L3FA 1LE8A 2ISYA 2YX7A 5L3CA 2QWWA 2TRTA 4X1EA 5E8IA 4I0BA 2FJ1A 4ZJZA 3PIOF 4RS8A 4RA2A 2DMUA 1LFPA 1ETKA 3HOYJ 3EDPA 3PIPF 1VF9A 2VQLA 5GTIC 1J59A 3VWBA 3SXYA 4IL6C 3VYRB 1V5EA 3BJAA 1B1BA 4BYYA 4MFEA 3DP7A 4R79A 5D8LB 1G3WA 3CLOA 1YLFA 3K10A 3S15J 4OAYA 3GTMJ 1A6QA 1UG2A 4G6TB 5H20A 3MAJA 4C9YA 4U0VA 5LBQA 6PAXA 4LD5A 1LVKA 5F64A 1PJRA 3FM5A 1EA3A 2E7XA 3SDBA 1W7PA 3BG7A 2HU9A 3E97A 4RMNA 2L7MP 2D1VA 4N9IA 3COAC 3G1MA 1KU9A 1T2KA 2RREA 5J47A 3OYEA 3LSPA 4FE7A 1I6HJ 2XASA 2R3SA 3GTKJ 3LMMA 4EM2A 4NBQA 4XSXF 1U9OA 4WWCA 4BBRJ 1SC7A 3OIPA 5ILSA 3GVAA 4B47A 3WTUC 3W2VA 3ABLH 2OQGA 2QM3A 4UUSB 2W84A 5CQGA 4CYCB 1AKHA 3CP8A 4OIQF 3U1DA 1ZK8A 4PDKA 3BROA 3L9FA 3VOEA 3CF5F 4XR6A 1XPXA 4PGGA 5J8FA 2JUCA 2KRCA 2DFEA 2L54A 4NHJA 5FJ8J 2WY8Q 3GFJA 3FMSA 2ZSIB 2HZDA 4C30A 2WAEA 2TCTA 2A68F 1W0TA 4YIFA 1GVJA 3P7NA 4A6EA 2DOFA 1L3LA 3E5QA 4XKCA 2LR8A 1ZARA 2FNAA 1P2FA 4KFCA 4AU7A 1N25A 1SD5A 1XD7A 3MZYA 5FGMA 2CUEA 2RNGA 4YFXF 3F8CA 3BY6A 3AKZA 2HQRA 4BL0B 3DU5A 2AS5F 2M4GA 3RKWA 3ZQFA 5FO5A 4KIGA 1GXPA 4A93J 2LC2A 4LK1F 1WPKA 2PMZN 1ETOA 3MCZA 1BIAA 3R0JA 3UNGC 5E3OA 2WWYA 3M1CA 3HGGA 5M5WJ 3MKWB 1MH3A 3VPRA 1KYWA 4BUPA 3HOUJ 2B7EA 4IXAA 2PX9A 3Q9SA 5L3EA 2EFWA 2P6SA 1K7AA 3H0DA 2GA2A 2L3DA 3H9GA 4UB8C 4Y33A 4BY7J 4W1UA 5ED4A 4RLQA 3ERED 4L0YB 1YITI 1UHMA 2LOOA 1OFCX 1V3FA 2ZXWH 2K5CA 1T39A 3ZRGA 4LGWA 1YIJI 1FPQA 1IV6A 3TEDA 2IGKA 5FFZA 1UCRA 3K2AA 1FBQA 3HKZN 4KT5C 2Q1ZB 1YE9A 3PM1A 5M3MJ 2BBYA 2MSYA 2JUGA 4XSZF 3TGNA 3KZYA 3BR1A 3O3KA 4XLAA 2DOAA 2CSOA 3ABUA 2ME6A 4UVAA 2EZKA 1WJEA 2ZCWA 3K4KA 2Y69H 3IH2A 4G7OF 4L9NA 4DJAA 1E17A 3ZXSA 1FIAA 2ZMEB 2DPUA 1H88C 3T8RA 1A5JA 4IKFA 3HOZJ 1QVUA 2I5UA 2L9RA 1QZEA 3EPZA 4XLFA 1FNNA 3L2RA 1ZG3A 4DYRA 3F8BA 3LSMA 4XLPF 4E6KG 3HEFA 2F5CA 2WB1A 2XF5A 2R7VA 3PQKA 4KJZA 4EEFG 4JP0A 4ZTFA 2L9NA 4EM1A 3LOCA 1B9MA 1BJAA 4PCQA 4ZYGA 4F91B 1U8BA 1R5ID 2VBYA 2V9KA 3KCCA 3OYDA 4XRMA 3UKGA 1JHHA 3BOQA 1ZAOA 2JK3A 5D5WB 3DBRB 1N75A 4HLXA 2EINH 2V1XA 4GYGA 1R58A 1FY7A 2CJJA 2PMHA 2R7OA 4EVIA 1GDTA 2PEXA 3IL2A 2FBHA 1TT0A 1SFEA 1V5GA 4DBQA 3MWMA 5J1UA 5ILVA 3OYIA 3NARA 2EFQA 3PFIA 4XORA 3OYJA 3GXOA 4XKBA 5EG0A 2BE5F 2VKEA 3WGGA 2NYXA 3EYIA 3NRVA 2OTLI 1JKRC 4O3MA 3JAMK 3CCSI 3GLLA 3OYKA 1TQMA 2QF7A 2BHYA 2IA2A 5CVVA 4CHUA 2H6BA 3N4MA 3WU2C 2CW8A 3ML6A 4HQMA 5JHUA 3IKTA 4BBSJ 3GTOJ 2OJED 4A3IJ 2LBFB 2DOEA 2P7VB 5C4JJ 4CCMA 3EYYA 3F6VA 2IPQX 1W1WE 3I4MJ 4PFPA 2E60A 3BTCA 4PFOA 1FZPB 2EIKH 2GOMA 2Y0SA 3TW7A 3JTHA 5AIQA 2CQQA 2LP0A 3KZZA 4XM3A 4RGSA 2FU4A 3GWZA 2P7CB 2DMQA 5HVQC 2M8EA 4YFNF 2F5DA 2A69F 1FMWA 3M07A 1LQ1A 1IDZA 2O6GE 1HC8A 1Z0XA 4HDUA 3BG5A 2NRAC 3K9TA 3I9V2 1J5YA 4HAMA 3DBLB 1KU7A 2Q0OA 2M34A 1IC8A 2WAFA 5HOOA 2OAZA 3LWFA 5EYRA 1BW6A 3RYRA 2HI3A 2RVCA 2XUBA 3HG9A 1H9TA 1SD7A 2Q2EA 4BHBA 1OCPA 2LKXA 3PUBA 3W2WA 1JI8A 1J09A 3BJOA 5KAIC 1B8IA 1XN7A 4LB6B 4D7NA 4WK8F 2DXIA 2ZJRF 4KICA 4U0YA 1XG1A 2DO7A 3OIOA 3DPLC 3AL0C 3KP7A 3O8GA 3H5AA 4U7BA 1QBJA 1J75A 4F92B 5JLXA 1W4MA 3CO7C 3KE2A 3TO9A 5E20A 1TW2A 2CQXA 1MMAA 3MKYB 4L9TA 4KIBA 3ONQA 5KNLA 2RDPA 1T95A 2IW5A 2OC6A 3AG1H 3JRDA 1YJWI 1TW3A 2IP2A 4G9YA 3HRMA 1KQ9A 1LJ9A 4S04A 4ABZA 1XX5A 2BHZA 5DD4A 4A3CJ 1XGMA 3SZPA 1H0MA 4D7MA 4KYWA 3JR9A 1YRNA 2HS5A 1HOMA 2HYGD 4B48A 3OYGA 3W3CA 2HXIA 3QPSA 3V7SA 2HVQA 2NVTJ 2PN6A 3FDYA 4A3FJ 3OYAA 2WV1A 3EUKL 3PNVA 3MN2A 4B3XA 2DTRA 1FEXA 4B3AA 2FMLA 4KT6A 3VDXA 2BXYA 2XROA 3OSFA 1D8JA 1JXSA 5LEKA 3FK6A 5CYVA 3L09A 4B1RA 4A69C 1IN6A 3ZMZA 1IAWA 5K7ZA 2QEXI 3PL8A 4NC7A 4F93B 3M9AA 3ZN1A 3CCLI 3KYDB 2DMTA 4E7IA 1IXRC 2OV7A 5E1WA 3WGIA 1YW9A 2XAFA 3ZMDA 1NH3A 5LRRA 5FLXZ 4I76A 1I1SA 3RPQA 1FP2A 2EILH 1J7KA 3IKVA 1IO2A 4KIFA 5J6XA 4RB2C 4IO9F 5H6RA 2D1HA 4A6DA 1P4WA 3FM3A 3CMYA 1JKOC 3VODA 4IPAA 2VJ5A 1R4NB 2BY0A 3U1KA 2Y30A 1RKTA 2CW0F 2HOAA 1XMXA 3I54A 1JJ6C 4PJJA 3V7CA 2K9QA 3TP3A 2M0CA 2WTEA 5FKMA 1MMNA 2O5RA 3CD6I 1Y39A 2L02A 2G0EA 3GLXA 3VSKA 2JPBA 2IS1A 4IRIA 5LHHA 4UNOA 3BG6A 3LL7A 2VE9A 2DT7B 1QZYA 1SANA 3D5SC 3T5XA 4IHSA 2NVUB 1EJ9A 1G3YA 3OSGA 2F5VA 1ETVA 3S2WA 3M1EA 5BMZA 3KPHA 3CCRI 2BXZA 2F4IA 3HYIA 2FBKA 2CO5A 1MNEA 2UZKA 4UHTA 1STZA 1UAAA 4CUGA 3OYBA 2EFPA 5CPRB 1Z9CA 2C6YA 2WV0A 3I0TA 4E7HA 1W5TA 5M3FJ 4D0PA 3OR1C 1XDUA 2M1BA 3TL4X 1XSXA 2M0MA 4DW6A 4KISA 3KP4A 1Z21A 2X48A 1HW1A 2R5ZA 4XONA 1SAXA 1UG0A 1VQ5I 1IN7A 1RUOA 1ZQ3P 2MH2A 4IVNA 5E8GA 3LSTA 4QWQA 2VUMJ 1I3AA 1Z77A 4NC8A 4QPQA 4BJ6C 3PSFA 1MDMA 1FSEA 4PJLA 1IN5A 3G4SI 2H1KA 3L2UA 3JCUC 3HIFA 3S17J 2DI3A 2A05A 3A02A 4XOPA 1M1EB 3ISPA 5EF6A 1U6GA 3ABMH 2FX0A 3QP5A 4ZYDA 2VE8A 2FRHA 2NXNB 4IJAA 4XLEA 4II3A 2BW3B 2AQFA 3ZMUA 3GYHX 1U5TC 3D5LA 4FQGA 4HBLA 3R60A 1LKXA 4Y4RA 1U0JA 1ZELA 2VQGA 4GXOA 4F52A 1U9NA 1UZCA 2X51A 3BQYA 3FZVA 3X2QH 2VN2A 5J1RA 2R7DA 3JRCA 3R4KA 3WHBA 2IBDA 5J3LA 4EJVA 5D4RA 4R1HA 4GGGA 2ZSHB 2J5OA 2EV5A 1D0XA 3WTYC 5CVRA 3F8NA 2EK5A 2HTJA 2ID3A 3GZ6A 1V55H 3VB2A 2RV8A 3FKJA 4HZFA 4HNTA 1IJWC 3K2ZA 1VQNI 2JA8J 1S9HA 5J8CA 1QA6A 1ON2A 3R6SA 4XOTA 2K9NA 3HSEA 4YG2F 2IS4A 4UVBA 3WTXC 5LFAA 3KZIC 1TLHB 1Z3XA 2QVOA 4LB5A 2L4AA 3LQRA 5D6FA 2FBIA 1G8XA 2PFBA 1PUFB 2F48A 2Z9OA 2X85A 4JYKA 1JKQC 2V6EA 1ZHFA 3CCEI 1JKPC 2MABA 3BCBA 1U8RA 2JMWA 1BI3A 1MIJA 3CDIA 4G7ZF 5F27A 1R23A 4C3JJ 3JRAA 2HDCA 5IYBJ 2VKDA 3DLLF 1X19A 2R92J 3S8PA 1R6RA 2ELJA 1MGTA 1U5TA 5DTDA 2LG4A 2BYVE 4M72A 1R7JA 2W82A 3J81K 3HOSA 4FETA 1OPCA 4NQWA 2V1DA 3MZ8A 2CGPA 4E4HA 2LH9A 1JUPA 1V5FA 3LA3A 3IV5A 1YTYA 2N8GA 2O03A 2HVRA 3A0BC 2DMNA 3DF8A 4LIVA 3ULQB 1R9TJ 1LFBA 2QA4I 4A5NA 3AG4H 4HG2A 3D0SA 4Q4ZF 1VQOI 2DA7A 2CG4A 3ASNH 1HSJA 4EMSA 3KETA 4K2EA 1OCTC 1BW5A 3QWLA 2M30A 4HX8A 1C0WA 2FEZA 1ON1A 3HBLA 4JX6A 3ZOBA 2E5NA 3L2QA 1CF7B 4ZZLA 1P4XA 3S14J 2QQAA 2LRDA 5C44J 5EJCA 1RRJA 1N78A 1ETYA 2FD5A 2NVXJ 2CMPA 1VQPI 4EJUA 3ZQQA 1YW8A 3ASOH 1QNTA 3LSHA 3ZQHA 2CV2A 2ZC2A 1VQMI 2DA5A 3LFUA 3B02A 4LFUA 2CRGA 1TNSA 2GXGA 2YR2A 3S3OA 4M3EA 3QQAA 3LA7A 3GTQJ 4HW0A 2E2HJ 3RPUA 1ORKA 1MMGA 3G73A 2MW8A 1OQYA 1MBHA 2YSRA 4XRSG 2HKOA 2X1EA 3IWFA 2V79A 2XPUA 3A01A 4IQJA 1IRFA 3AG3H 2KRFA 2DBBA 4KMFA 2MH9A 4KNYA 2VASA 2DK5A 2CV1A 3AG2H 3AL0B 4P1WA 1A04A 3KP2A 4M6VA 2BY2A 2O7OA 3I64A 2KISA 2VC0A 5B1BH 5F1JA 2Z3YA 3WG7H 4ESJA 2VKVA 1MJBA 3L00A 1Z7UA 3F23A 2K7LA 2OQRA 1T33A 4U87A 2HFHA 3ZP5A 2K40A 1RR8C 2V9VA 1YOVB 3FXJA 1FBSA 4I01A 5GAGJ 2DTZA 5HS8A 5FLMJ 1ZYRF 2HZTA 4Q48A 1NG7A 2R7TA 2Z99A 4BH9A 2V7FA 1HW2A 4GO1A 1N77A 2FQ3A 4CZCA 4MIMA 2K27A 2PQ8A 4MEYF 4IHXA 3FX3A 1TZLA 1TTYA 1TL8A 1USSA 4EV0A 4KN7X 2K9LA 2O8XA 1F1ZA 4JX5A 3V4GA 3H5NA 3J7YJ 4BQAA 3Q0UA 1QU3A 3H92A 2HDWA 3QODA 4UVCA 4WCGA 5GADJ 1AWCA 2JQ7A 5K5OA 3P5JA 2WY7Q 5JLWA 1MZBA 1Z1DA 5K5QA 1V4RA 4JQFA 3E5UA 5LEJA 4CXFA 2DN0A 3SZTA 2XAHA 1TWHJ 3IRRA 2Y75A 4AYBA 3M7GA 2H09A 5HNHA 1SD4A 4P55A 3GEZA 5BNGA 2Y9ZA 4LOCA 4Q47A 1FTTA 5C3EJ 3HPGA 3AFHA 4AWXB 2IA1A 5E1ZB 3L2WA 1ZRDA 2E2IJ 1JTXA 1UB9A 2ZXIA 2NVYJ 5DM7F 1NHAA 5ILUA 3I71A 1MBGA 2AQEA 3FHZA 1D1AA 4A0XA 1CQTA 1DP7P 3HC7A 4HV5A 3VSLA 1JUMA 4V2FA 2K85A 4EATA 3K1MA 3QPHA 1ERDA 1LEAA 2STWA 2L7FP 1KQ8A 3FF5A 2VJ4A 5BPDA 4CDGA 4BXUA 4KUMA 3S32A 2OCCH 4ESFA 1UFMA 3ZQIA 4CGZA 3LA2A 5BQTA 2J5PA 2LVSA 4E70A 2QSHX 2GWRA 3G71I 5E3NA 1R1VA 4A12A 1PVEA 3ZQ7A 4CCKA 4NB5A 3IH4A 4P9UA 1OCZH 3A03A 4DBRA 3W6VA 2KJCA 2R5YA 1X1BA 1T08B 1IN4A 2LF8A 4IHTA 1EH6A 5GAEJ 1IDYA 3E6BA 1NG6A 2PBIA 3ZR8X 5A2QZ 1TWAJ 2Y9YA 1VQKI 2L01A 2DFFA 3E5XA 1FIPA 4N0BA 2R93J 2MLKA 2H94A 2VXDA 1W5SA 3K4JA 3JRGA 3OS0A 2XF6A 2DMPA 1DU6A 2DT5A 5FD5A 2OBPA 3DWLE 2R7QA 2RN7A 3DEEA 3FMQA 3DPUA 2GA1A 3V7RA 3F0CA 1Z6TA 2ADUA 2M3AA 1RUNA 4PJMA 1G2HA 4ZDOA 1ZRFA 4XRFA 1FOKA 3ZGKA 4LG3A 2F4MB 1IRGA 3I59B 3W6JB 2VBXA 2LF7A 3DBHB 3G1OA 3I5UA 1B59A 5EZHA 4BHPA 1QHHD 2RNJA 3C2GA 4M73A 3GZ5A 5FRMA 1X1DA 4IRGA 3J80Z 2M2EA 5JVGF 4ENJA 5GTHC 2ZFUA 1D0ZA 3GX4X 3K69A 5ERIA 3IAM2 4BAYA 3BLYA 5LRSA 1QZZA 2KZVA 2X4HA 4G12A 1HKTA 1ZLKA 4I2OA 3HUGB 5D5XB 5J4VA 1YX3A 1BA5A 2OZUA 4LG0B 4EQQA 4UY8I 3O2PE 1FC3A 4M71A 1S7AA 2B9SA 2COMA 4CCJA 1POGA 2HPMA 1VTNC 1QVTA 1U78A 2IVMA 4BEHA 2JA2A 1BI2A 3RIRA 3RYPA 2IAIA 4M9ZA 5DEQA 1X1AA 4IHVA 3CF2A 4QSHA 5F1RA 3G6EI 3CJQB 1YJ9I 2E1OA 1P4AA 3TO7A 1JJ8C 2CQKA 2MBFA 4FT8A 4CA0A 5BS6A 3LFKA 5KCMA 2K9SA 4NDLA 5FFXA 2VOPA 3CDHA 3I56I 1PP7U 2F4OB 4C3HJ 3KEQA 4ZYEA 4CO8A 4RB3C 4HF2A 4EGZA 2F5FA 4FX4A 1YO5C 1K61A 4S0HB 5B5EC 3NWTA 3K6GA 3WHCA 2NVQJ 3A0HC 3ECHA 4Y7NJ 4RB1A 3ELKA 4WXCA 2KDZA 3G3ZA 3IC7A 5DCMA 2RQPA 5GP9A 4XBFA 3ZPLA 3BDDA 3GO5A 2KZGA 2WB1N 2OPTA 3CESA 1OCCH 3QPLA 2QBYA 1BI1A 1MSEC 1HSTA 1WQ2A 2W4SA 3QYFA 2H1LA 3SJMA 1T38A 3E6DA 3DQVC 4XLNF 2MLGA 3PUFA 1WJDA 3TKYA 4C2TA 3PFYA 2GAUA 2LKPA 1P7JA 3Q0WA 5FROA 3WTTC 3GTJJ 2W24A 4CYDA 3JRBA 1ONVA 1WGXA 4HX7A 4B4CA 1WJ5A 3DKXA 3SZGA 4BQQA 4BS9A 3CUQB 2I8DA 2CWEA 4YIRX 2K9MA 1V54H 4UXNA 2CUJA 4DQ2A 4OIOF 2VT2A 4EJWA 1HA8A 3ZQLA 2DQLA 2UV1A 3GW2A 5BOXA 1Y8RB 2ESHA 5TJJA 2IEKA 2ECBA 3BQZA 5FKNA 1LE8B 5ICFA 1OKRA 2L4MA 3HB9A 2O8KA 2STTA 4GYIA 4QPOA 3FISA 3KX2A 2CV0A 5LD2C 1CGPA 4RB0A 3W6KB 1B6AA 3IAS2 2VPLA 4IZZA 4ENMA 2R7SA 2VL8A 4G8XA 2WA0A 2CS3A 2NAZA 4MGRA 2DT6A 1TC3C 3EUHC 3VEPA 1R22A 4MEXF 1RESA 3DXJF 4W97A 4CCLA 2CQ7A 3BTIA 3SHFA 5EEAA 1XC5A 4HF1A 3I4NJ 1UMQA 2Y0SN 5CKTA 2ZNZA 2AHQA 3F8FA 5HDGA 3Q3SA 1DDNA 3DV8A 1W0UA 1GT0C 1EV7A 3TDUC 3JREA 2D45A 2E1NA 1BJZA 1HKQA 2F2EA 1WFXA 2R7UA 1DPUA 1W7PB 2TDXA 1MBJA 3H36A 3K70C 4J01A 2FE3A 1U2WA 1NTCA 2BVLA 1WCMJ 5HNFA 5GPCA 4II2A 2V9PA 1FT9A 3MQ0A 3S2HJ 5GAHJ 3IUOA 4CH7A 4J00A 2A61A 3CCJI 2XSDC 4N9HA 1MH4A 3CMMA 4Y3OA 2ICWG 1XCVA 2KKOA 1AKHB 1IUYA 2XGEA 5LHIA 4MNUA 3O6BB 3BZCA 3HRUA 1XB4A 2E7WA 1S6LA 2BY3A 3P9KA 1XGNA 4WXHA 1AHDP 4I99C 3BR5A 3CCUI 5FRNA 2JA7J 3SQNA 3HOWJ 1I27A 3EUHA 4EM0B 3OV8A 1PP8F 3CC4I 3BJ6A 4KITB 3SYTA 2MG4A 4IEJA 3OS1A 4BE0A 3REOA 1NK2P 3LSKA 1O3SA 4UV8A 2PJRA 2LFBA 1WVRA 2ZJQF 3ZMVA 2XRLA 5HLIA 3KFWX 2LSOA 2X6XA 2GXAA 2FXAA 2RC4A 5JR3A 4XKWA 1ETWA 2HNHA 2DA6A 1WI9A 2JTVA 4PSXA 1YS6A 3H9QA 4E7SA 2FUG2 4RGUA 2L7KA 1AOYA 4ON0A 5EGOB 3BPVA 2HQ5A 2OU2A 1S72I 1FLIA 3CP2A 3H3ZA 4AM3A 2XSJC 3M8FA 1OMIA 4UV9A 2CW7A 1K4SA 2LY1A 3J7AY 2E71A 3TW6A 1XGSA 3KP3A 3MD2A 4OIPF 3S1MJ 1IN8A 5KVRA 1I50J 1Q1HA 2FSWA 4L9JA 2W25A 2LMDA 3K4NA 1FJLA 1ZG1A 2A6EF 3FXUA 2QCOA 2K4BA 2W48A 1S8NA 1USTA 4DZPA 2R7XA 2KHMA 4IOAF 3CCQI 4EGYA 2LTPA 2WAQA 3CZ6A 4M9SA 1O7LA 2FQ4A 3L2VA 2GBYA 2L0KA 4HX4A 1YG2A 1BC8C 1YJNI 2YPRA 4MLOA 2HOSA 1RPWA 1Z67A 4OAZA 1XSVA 3MKZA 4HSTA 4AUXA 1OCRH 1WHUA 2VB6A 4GRIA 4AIKA 5DCFA 1ZRCA 3LSGA 4MO7A 4ZC3A 5ICEA 1R5HA 5TGTA 5IYDJ 4AIDA 2DFHA 4OIRF 4HRIA 1X1PA 3RQ4A 1LUJB 3QRFF 1IZ1A 2BEOA 2K02A 3HOXJ 1D3YA 4LLNA 2ZB9A 1TQPA 4M3GA 3K1PA 3F72A 1GV5A 5CJ9A 5E79C 3IWZA 1D5YA 1IF1A 3OOPA 4H4KC 1DQUA 4JOMA 4ZDPA 2FA5A 2GIVA 2QSFX 3D5RC 3K7AJ 4DIQA 4S05A 1T56A 1VQ6I 2R7FA 5LHGA 4UUTA 3OL4A 4MTEA 3K4CA 3C7JA 1HCRA 2HOTA 3BR2A 1O57A 1R1UA 2YU9J 4L5EA 1IRZA 4D5FA 3NWSA 2NS7A 3FXQA 2IGOA 4Z2YA 3A4CA 3RPUD 3FWEA 1TWGJ 3FHNA 4BKXA 3ZQCA 1AA7A 2KRHA 2XAUA 5HDNA 2ZNYA 2MYSA 2ISZA 2WBMA 2Z16A 3KP6A 2Y0MA 5LGUA 3FXKA 3H1CA 3CJRB 1ZR2A 3ECOA 3LSJA 1XDSA 4OMYA 2FOWA 2MGQA 2VJIA 2X1DA 2HQAA 1MMSA 2VI6A 1GVDA 4JBAA 2HGCA 3LQQA 3J7AO 1QPMA 2Q8KA 4N4OB 4YIIA 3HTUA 2OF7A 1BN5A 2JA6J 3PSIA 1WWXA 2XDVA 3FKIJ 5EG0B 1FYMA 1BC7C 2KP6A 2KIUA 4PK4A 4EJOA 1TNTA 3OMYA 4UUSA 2ID6A 1X3WB 2RAEA 4CYCA 5CVUA 1A31A 3BR3A 2DYSH 1PDNC 2IGNA 3E0JB 3NAUA 2EZIA 3N97A 2A6TA 2WADA 1WJAA 1HXDA 3DLAA 2O61A 2XGDA 2A5YB 2NNYA 2O3FA 2XC7A 2O0YA 4PZJA 1XTAA 4V19K 4XN0A 4BQNA 5JVTA 2JN6A 1FMVA 4YEJA 3DPTA 4A3EJ 3S3MA 4BNCA 4XLCA 1D1BA 1QRYA 1G3TA 3UR3C 3JRIA 2LYCA 3S2DJ 1B9NA 4CZZA 1ACIA 3E7LA 2XAJA 4MHGA 1QGPA 5C4XJ 2ZMEC 2DODA 1IW7F 5ICGA 3PNYA 4Y15A 1JTYA 1X58A 2BV6A 3DU6A 2AO9A 3V8KA 3OYFA 3ZMSA 2DQRA 2XB0X 4BJTA 5DUIA 5BPIA 3OYMA 2P5LC 2E1CA 5FLXK 1K78A 2H8WA 1S29A 4BU2A 5IY5H 4X0GA 3BR0A 5B3SH 4OWRB 4ZYAA 3IRQA 3Q5FA 3PO3J 2Q2EB 2WC2A 4I7HA 3CO6C 1I39A 3JTGA 2B63J 5CQEA 2G9WA 1KONA 1B8IB 1ZREA 4FHTA 3W2AA 1IV8A 2VPRA 3V42A 2EQRA 4IF4A 3TMOA 4Y17A 2BVMA 2E1MC 3BZ6A 3C3WA 3GFIA 1O7FA 3I58A 4E7ZA 3ZN0A 4IX7A 4BDYA 2L5QA 1VZ0A 3O8HA 2P81A 4HNVA 3SDGA 4DGWB 4A3LJ 1EH7A 2EWNA 4CCOA 4PSWA 2DK8A 1B72A 3S16J 4E7LA 2D2WA 1MJAA 3BC8A 1FOXA 1JE8A 4A3JJ 3CC7I 2EIMH 2E19A 3R0AA 4BE1A 2E36A 1ULYA 2ZMEA 4G7HF 1LPQA 1TWCJ 2K3FA 5EZGA 4B44A 4PJNA 1Y0UA 5F0CA 1JGSA 4UUVA 1O3RA 3HM5A 1W36D 3DTEA 1TWFJ 5L3DA 3CMAI 2CUZA 1YRNB 5K5RA 1K6YA 2XPWA 2VBWA 1IXSB 1YX5A 3RZDJ 2L7ZA 2EB7A 1WH7A 3HSFA 2ACJA 4AVZA 2JSPA 5FB2A 3RTRA 1OYYA 3U21A 3T0YA 4RLFA 3GTGJ 2E2JJ 3U2RA 2HWVA 1FYLA 4ZDLA 2GIZA 4Z6YA 3F8MA 2L9VA 1OLTA 2EA4A 2F6CA 2PLYA 2EJRA 1H89C 1OYWA 2HYJA 3DEUA 5DD8A 1GXQA 4F7ZA 3WTVC 3C2BA 1HDPA 1KU2A 1REPC 1OR7C 3I3LA 3GF2A 1T0FA 1QO0D 2PMUA 3DTIA 4M6YA 3TBIA 1SD6A 1SVLA 3G1LA 5E3LA 1SFKA 2DDAA 3WTZA 4N4NB 4I6ZA 3MVPA 1TQIA 5KAFC 4G6QA 2DLLA 3N05A 1LDKB 1LFUP 1QQIA 4V2GA 4L0ZB 1BOBA 1GUUA 2Z33A 1R36A 4HLYA 2KJBA 4NUBA 4XK4A 3WGHA 1K6OA 3PNTA 2QENA 3MFKA 3RI4A 1IXCA 1RZ4A 1JUSA 4XICA 1MNDA 1XGOA 2GZWA 2AXTC 2W7NA 5F0FA 2VIXA 2LBFA 4M3BA 2W00A 2IS6A 2VQCA 3H0GJ 1E2XA 5ICCA 1D8KA 1BOAA 2H27A 2EZHA 1G6NA 2YX4A 5IP6A 4X6AJ 3KP5A 1J2XA 4MFDA 4L5JA 2EV6A 4RAYA 2MFZA 2HR3A 3CUOA 2Z5UA 2XIGA 1YQAA 2DW4A 3WU0A 4C2UA 2EFNA 1OR7A 5D6EA 4AC0A 4HA8A 2BGCA 1SEUA 1W36C 3OYLA 4A3KJ 3BTJA 1DUXC 4DYQA 2GQQA 2O9LA 4G6DA 1MJ9A 4M3FA 1E3PA 4XQFA 2R7ZJ 1ZGWA 2COBA 4U0WA 3I55I 2IT0A 5H6QA 2CFOA 2R5ZB 2K4JA 3HRSA 2ZBKA 4U7DA 1W5CC 2M45A 1H9GA 2EIJH 4FX0A 2W1OA 1OISA 3S1RJ 2FF4A 2MC4A 2Z2SB 1MDMB 4J19A 4WF2A 2X6OA 3RKXA 1WJFA 2V26A 1MSFC 1YS7A 3HPHA 3RSNA 4AYBN 3B6CA 2KFDA 2PJPA 1KQ0A 3RKYA 2VT3A 1SVMA 2KL4A 4RM3A 3F9KA 3H3VK 4YFKF 2A3SA 1IUFA 1HW5A 1SMYF 5CVJA 4P96A 2LY2A 5IT9K 3OIQA 3ZQGA 4M6XA 2XGCA 1D0YA 4A3DJ 2XRNA 5F0HA 3C18A 4GCVA 5E17F 2QQBA 2HKXA 1ENHA 3JAMZ 1X3ZB 1MNMC 2X6YA 4QLCU 2GLOA 2E5ZA 4CICA 2PMZA 1BR4A 3HSRA 3MKLA 4B09A 1ITYA 1GHCA 4EJTA 1I1GA 3VFZA 2DA2A 4D9JA 1U3EM 1X1CA 4MQVA 4XN3A 4YELA 2B0LA 1J0RA 3GUDA 3RDIA 5J1YA 1RKWA 2ZXJA 5IOZA 1RETA 2NOGA 1R71A 3CTAA 2RKHA 2BY1A 3CJNA 1WKMA 2KT0A 2A07F 4A0YA 3PO2J 5J40A 3TOAA 2QLZA 3ZMTA 2CQNA 2LKSA 2V4JC 1FWZA 2KIQA 3S93A 5JHFA 2QZ8A 3FMRA 2HPIA 2QQ9A 2JZYA 3HKZA 4HQEA 4ENNA 4ZTJA 1K78B 1F4KA 4BXXJ 1KGSA 4HSRA 3TOBA 2CUFA 3I53A 1QHGA 3EQLF 1U5TB 1JGGA 4DZJA 2DCEA 4C3IJ 3DFGA 2CFXA 5DYMA 1O3QA 2FMYA 3RCOA 2DU9A 3OYNA 2XKPA 4NQWB 3CCVI 2NS8A 4KDPA 1R4MB 3TO6A 2Y2ZA 4IRHA 1MD0A 1RR7A 5DUKA 5HLTA 3OYHA 1YIOA 4JX4A 3M3YJ 2KDOA 1SAUA 3ROUA 4IHWA 4QTRA 3G2BA 5LLQA 4XRSA 4XIDA 2XF7A 2XKOA 1OYIA 5HS9A 5JFRA 1VQ4I 1B72B 2R7RA 3P9CA 1X2NA 4HF0A 3F3XA 1WRJA 2HYFA 5JI6A 3K0LA 3L2CA 3IH3A 3VYUB 2P0WA 1I5ZA 1S7OA 1XMKA 2JT1A 4LLGF 1KU3A 3FIWA 3F21A 4Q5SF 2OUMA 3FXMA 1Q1VA 3K70D 1HDDC 4A2UA 1BBYA 2UXXA 2L9SA 3E1SA 5IYCJ 1DGWY 1ZN2A 1G4DA 1R49A 3J7ZI 3WG9A 2VONA 1FYKA 4M74A 1WZ2A 1HLVA 1FOYA 2CYYA 1GV2A 3L7WA 5EEGA 3H35A 2NOJB 3Q9VA 3BPXA 2W57A 2OZ6A 4M3DA 4NC6A 4B8XA 4IQ4A 3A01B 1A35A 4NNJA 1RIOH 2E1MB 1ETXA 4WX9A 1KZHA 2EZLA 3CLQA 1F5TA 5D4SA 1A36A 4GDFA 1GLNA 2QUFA 2VQHA 1T98A 1JHFA 2DFIA 5DV5A 1WI3A 1E3OC 2LDUA 4BDZA 3RZOJ 3S3NA 2XHKA 5J4YA 1ZGJA 4O5VA 1DGRM 1ETQA 2BW3A 2HEOA 3QP6A 4JK1X 5DM6F 2OCEA 1FSHA 5A2QK 1HBXG 2HDDA 2RQQA 1X2MA 9ANTA 1P7IA 1RI7A 1FOWA 1ZH5A 1ZTRA 2ELHA 3WE3A 1IGNA 1VNDA 3WE2A 3HZJA 4ASNA 3WTSC 4E7KA 3CDLA 1FTZA 1K4TA 2JRTA 2E34A 2M87A 4AIHA 3GFMA 1JT6A 5IP7J 1VQLI 2MD0A 3H5RA 3M4OJ 1D1CA 2NNNA 2GXBA 2XAQA 1P6RA 1TBXA 2XV4S 4HYEA 5M5XJ 3LAPA 4ESBA 1ZGAA 3D1NI 4A3MJ 4PGHA 4KN4X 4BE2A 1K83J 2DJNA 1ODDA 3EETA 4HNUA 1J9IA 1PUFA 3IHUA 3DCFA 1YFHA 1BI0A 3TP0A 1F36A 3J80K 1PUEE 3BG3A 1I6XA 4RGRA 4CSWA 2YS9A 1UELB 2X0LA 2YU3A 4BGDA 3T1BA 5TISC 4I09A 1E3HA 3L1PA 2IGMA 2F5EA 3CCYA 5F04A 1G59A 5D5UB 1Y56A 2GOXB 2P5KA 4I02A 2ME0A 4AVPA 4LIUA 3RQIA 2JA5J 1MBKA 4HDVA 1IG7A 3VYTB 3HDDA 2W85A 3KEOA 4PUSA 2IS2A 1SFOJ 1BR1A 3PQJA 5KHDA 2VOOA 1WJBA 2E35A 2LNBA 4AD9A 4H0EA 4LJZF 3E6CC 1L0OC 1XCBA 4OINF 2ZKZA 2VJJA 4WXDA 1VQ7I 2ESNA 2JVHA 1LVAA 1FP1D 4Y13A 4IOCF 3HHHA 3I4PA 1FBUA 1HKSA 2DPDA 2I10A 1G3SA 1RNLA 4LK0F 1D5VA 2EH3A 2KIFA 2R5YB 1CF7A 2IRFG 2XPVA 3E6MA 1JT0A 3DEWA 2DA1A 4ETSA 3OYCA 1VQ9I 4ZZDA 1YHQI 4YRVA 2EBIA 4I0AA 1MKMA 1RC9A 4KA4A 1A6IA 1IRXA 4HPQA 4A5MA 4Y52J 1ZLJA 2JVGA 3GCMA 2XAGA 2K86A 4BHCA 2LY9A 1S5LC 3HHGA 5CLSA 2M4KA 5L3GA 3GTPJ 4LLLA 1PYVA 2JSCA 4ITVA 3B73A 1SFXA 1F43A 1BM9A 5EEHA 3MZHA 1BR2A 1HF0A 3C2HA 4OOIA 1UHSA 1Z3YA 2EA2A 3RJPA 3OY9A 2OTJI 3S1QJ 3DKWA 5K1YA 3GTLJ 2MA3A 2MC3A 4B43A 2ECCA 1BL0A 4RBOA 2IA0A 2R4GA 4HEA2 2DAOA 4FASD 3OR2C 2HVSA 4CCNA 3BWGA 3WTWC 3Q0VA 5D8KB 2LLKA 3F6OA 1R00A 2ZFWA 3KYCB 3KEYA 2AXLA 2IXSA 5LGNA 5EGOA 3C1DA 3IP4B 4G94A 2GM4A 2YUSA 3CQZJ 4BY1J 1MBEA 2JRMA 3M8JA 3J81Z 2HOEA 2WAQN 4BEHB 3SEZA 3V8JA 2XGXA 1SFUA 4R8HA 3OS2A 2M9HA 2NS0A 2KPMA 2LREA 4RAFA 3HJEA 3LSIA 5F08A 4M9XA 1FX7A 5FKKA 1UJ8A 4LMYA 3FXRA 2Y31A 2QQ8A 5DDGA 1EH8A 3KLNA 2JJ7A 3BR6A 2OA4A 1X4PA 2CU7A 2HXOA 1Y6IA 2FOKA 1B4AA 2ELKA 1O4XA 3ABTA 3EUAA 1Z7LA 3TQNA 2MD5A 2ZO4A 4KMUX 3SEQA 3LAJA 2JWTA 4C2MJ 4A3GJ 4PJ0C 1Y1VJ 5K7FA 3CC2I 2OD5A 3FXOA 5DCMB 2A6HF 4QIWN 3JRHA 2P4WA 3F22A 1LB2A 3JRFA 1Y0NA 2V1NA 4D5CA 2XVCA 3GBGA 5B66C 1H8AC 2EPFA 2QGUA 5D5VB 3AAFA 1WSUA 2QBYB 3ERMA 2LD5A 2UXNA 1X4OA 1TT5B 3P9IA 2UWMA 4FCYA 3KLOA 3K4BA 1HQCA 2VKHA 4FISA 2L2OA 1YI2I 2UUZA 5HLGA 1Y8QB 2VLAA 4RDUA 3NEUA 4XKVA 2LK2A 2KIMA 3K4LA 1LEBA 3VYSB 1SMTA 2X1CA 3HRTA 3WODF 5FLVA 2X6WA 3K1NA 4L5IA 2V1UA 1WJCA 3T8TA 1AU7A 4A0ZA 4RAZA 4P9FA 4TV7A 4ZH4F 2QSGX 4XMYA 3S1NJ 4D1QA 5LGTA 3E3VA 4MQ9F 2VBZA 2G7HA 5E18F 3QAHA 5GPAA 1I3QJ 2M7AA 1WH5A 1UHWA 2DDBA 4BXFA 2P6TA 3GFLA 4HV6A 1KYZA 4DYCA 1S7EA 3HOTA 1Z05A 2A5WA 2BZTA 2DJIA 3QU3A 5FKLA 5AIPA 5M5YJ 2HQNA 2K3PA 3BTLA 4FE4A 2PI0A 4A3BJ 4XL9A 2M5WA 3BZKA 3MMYB 4BQOA 2FNPA 5TRDA 3QU6A 3ZCOA 4U88A 1MBFA 1P92A 2VXZA 2P8TA 3I59A 2KLOA 1XSDA 5K7HA 1TP4A 1W7PD 2H6CA 1YYVA 3R61A 1K79A 3LSRA 1DU0A 1VFCA 4F3QA 1XMAA 4I98B 1OJLA 1YW7A 4DNCA 5IPAA 3OOUA 4OMZA 3RKQA 1T0FC 3PJRA 4ZYHA 3CMEI 1BIBA 2X9DA 2DA4A 1VQ8I 2KMUA 3HUGA 5EDNA 3HXLA 5L3BA 2IJLA 3GMEA 4LG0A 5KK1A 1NK3P 3BG9A 3FK7A 3K4MA 2HTSA 3HL2A 4O6JA 2QKMB 3LNQA 1APLC 3BCAA 2ZJ2A 3U9GA 4MTDA 3SFIA 3GZNB 5HDKA 3JW4A 5B1AH 5IT3A 3B6AA 3FBIB 3HTSB 1LDJA 3H3UA 4GFBA 2VODA 3FXLA 5E3MA 3FBNB 2JPCA 5HS7A 2BOLA 3QYBA 5IP9J 4HOBA 2Y48A 1EKEA 3CUQC 1S3JA 3KYLA 3WU1B 3NQOA 1T6SA 1F9NA 3MEXA 2PJRB 2KQRA 3OWTA 1R1TA 1Z6RA 4BACA 2ETHA 5DS9A 3ABKH 3DTKA 3QOEA 5E1XA 1Z91A 4BJ5C 1VI0A 1ZG5A 4ANJA 5IT9Z 2EV0A 3HGYA 3H9JA 5CVIA 4IHYA 1R5GA 2DYRH 3TDZC 5HODA 4RAGA 1DPRA 2CH0A 2ZXHA 3KIOA 1LNWA 3JSOA 4L18B 1MW7A 4OU0A 5IOYA 1P9QC 3QPTA 4AIJA
chains in the Genus database with same CATH topology
5CKTA 4F55A 3OR1C 2R7WA 3TL4X 2M0MA 4RM2A 3A1YA 4KISA 1Z21A 2M7BA 3OL3A 4LITA 2V4JC 4XONA 1UG0A 3S93A 5JHFA 1WFXA 2R7UA 2HPIA 4J01A 3HKZA 3K70C 2QKLB 4NC8A 2BVLA 4ZTJA 3DKYA 5HNFA 4II2A 4HSRA 4QPQA 1E0EA 4XNFA 4BJ6C 3PSFA 1QHGA 4PJLA 4P5OA 3L2UA 3IUOA 4CH7A 2DCEA 4J00A 3RCOA 3OYNA 4XOPA 4XLHA 4NQWB 3CMMA 1MMDA 4Y3OA 5HLTA 4XLEA 3OYHA 1DP3A 4II3A 2BW3B 2KDOA 1SAUA 2AQFA 3D5LA 4DOZA 3G2BA 1LKXA 4Y4RA 2XF7A 1U0JA 1ZELA 2VQGA 4F52A 3QYEA 4E7JA 2X51A 5FRNA 2R7RA 3A2KA 2Z1DA 3SYTA 4KITB 3OS1A 2ZSHB 4BE0A 3LSKA 2PJRA 1D0XA 4ZJZA 3VYUB 2P0WA 2X6XA 3FKJA 4HNTA 1LFPA 1S9HA 4XKWA 2VQLA 2HNHA 2OUMA 4PSXA 3VWBA 3K70D 3H9QA 3VYRB 4E7SA 2FUG2 1V5EA 4XOTA 2IS4A 2L9SA 3E1SA 2L7KA 5LFAA 1DGWY 4R79A 1Z3XA 3CP2A 3K10A 2XSJC 1G8XA 4OAYA 2CW7A 2X85A 2V6EA 4G6TB 2LY1A 4C9YA 3J7AY 2MABA 3BCBA 2NOJB 3H35A 3MD2A 1LVKA 3SDBA 1PJRA 1EA3A 3BG7A 2HU9A 4IQ4A 4RMNA 2VKDA 1X19A 3S8PA 3K4NA 1R6RA 2E1MB 4NNJA 2RREA 2ELJA 3OYEA 2R7XA 2KHMA 2LG4A 3LMMA 1GLNA 2WAQA 2W82A 3CZ6A 2VQHA 3HOSA 4FETA 3OIPA 3L2VA 4B47A 3W2VA 4MLOA 4BDZA 5CQGA 4E4HA 3CP8A 4OAZA 3MKZA 2LH9A 3S3NA 4HSTA 1V5FA 2VB6A 1DGRM 2BW3A 4GRIA 2HVRA 4XR6A 3LSGA 4LIVA 4ZC3A 2KRCA 5TGTA 4HG2A 2RQQA 2WY8Q 4HRIA 2ZSIB 2HZDA 4C30A 2WAEA 3RQ4A 4E7KA 4XKCA 2E5NA 3L2QA 2LRDA 4ZDPA 4H4KC 1DQUA 4JOMA 4AU7A 4DIQA 3D5RC 1N78A 2MD0A 3H5RA 2RNGA 1D1CA 2CMPA 3OL4A 3K4CA 3ZQQA 3LSHA 2CV2A 3AKZA 4BL0B 3DU5A 3LFUA 2M4GA 3NWSA 2IGOA 3A4CA 4BE2A 3RPUD 4HNUA 2LC2A 3S3OA 3FHNA 1AA7A 2KRHA 2XAUA 1MMGA 2MYSA 3UNGC 2WBMA 2Z16A 3M1CA 4CSWA 1UELB 3MKWB 4BGDA 4BUPA 3CJRB 2X1EA 4IQJA 2IGMA 1G59A 3H0DA 2VASA 2VJIA 3H9GA 2X1DA 2CV1A 3AL0B 2HQAA 4Y33A 1Y56A 4P1WA 2GOXB 4RLQA 4LIUA 4N4OB 2LOOA 3VYTB 2K5CA 4PUSA 3PSIA 2XDVA 3ZRGA 2IS2A 2KP6A 4PK4A 2IGKA 1BR1A 3OMYA 5KHDA 1WJBA 4U87A 2Q1ZB 1YE9A 2IGNA 3E0JB 2JUGA 2VJJA 3DLAA 2A6TA 1WJAA 2JVHA 2WADA 4XLAA 2DOAA 2XC7A 1NG7A 2R7TA 1WJEA 3K4KA 2V7FA 4XN0A 1N77A 4DJAA 3ZXSA 4CZCA 4BQNA 1FMVA 4YEJA 3DPTA 3S3MA 1TZLA 4XLCA 2K9LA 4IKFA 1D1BA 3OYCA 3EPZA 4XLFA 3H5NA 4YRVA 1QU3A 3L2RA 3UR3C 2LYCA 1IRXA 2HDWA 3QODA 3LSMA 4HPQA 2JVGA 4E6KG 2WB1A 2XF5A 2R7VA 4KJZA 2WY7Q 4ZTFA 2L9NA 2M4KA 3PNYA 1PYVA 4JQFA 4ITVA 3DU6A 4F91B 2V9KA 1BR2A 3OYDA 3OYFA 4BJTA 1N75A 3C2HA 3OYMA 4AYBA 5HNHA 2R7OA 1Z3YA 3OY9A 4BU2A 4X0GA 4OWRB 4ZYAA 3HPGA 2Q2EB 1TT0A 1V5GA 3AFHA 3L2WA 2ZXIA 4B43A 4DBQA 5CQEA 3OYIA 1KONA 3W2AA 2AQEA 4XORA 3OYJA 1D1AA 2R4GA 4HEA2 3V42A 3TMOA 4FASD 3OR2C 2BVMA 2HVSA 2E1MC 3HC7A 4XKBA 3VSLA 4CCNA 4EATA 4E7ZA 4IX7A 4BDYA 1ERDA 2L5QA 1VZ0A 2VJ4A 4DGWB 3S32A 4CCOA 3KEYA 4PSWA 3OYKA 2IXSA 4E7LA 3IP4B 2CW8A 3M8JA 3BC8A 4CCKA 4BEHB 2LBFB 3SEZA 4CCMA 4DBRA 4BE1A 3OS2A 1X1BA 2KPMA 2LREA 4PFPA 2E60A 3LSIA 4PFOA 4B44A 4PJNA 2GOMA 2Y0SA 1NG6A 3ZR8X 4XM3A 1W36D 3DTEA 2CUZA 1X4PA 1K6YA 1YX5A 1Y6IA 5HVQC 4AVZA 2JSPA 2VXDA 3RTRA 3U21A 3K4JA 1FMWA 3OS0A 2XF6A 3EUAA 4RLFA 1Z7LA 3I9V2 4ZDLA 3SEQA 3DWLE 1OLTA 2R7QA 2F6CA 3DEEA 3DPUA 2WAFA 5HOOA 2M3AA 4PJMA 4ZDOA 2V1NA 3GBGA 3HG9A 4LG3A 3ZGKA 1OR7C 3I3LA 3TBIA 3DTIA 3PUBA 1X4OA 2UWMA 3W2WA 1JI8A 1SFKA 1J09A 4N4NB 1QHHD 3C2GA 5FRMA 2DXIA 1X1DA 3K4BA 2VKHA 2ZFUA 1D0ZA 2L2OA 3DPLC 3IAM2 3BLYA 3N05A 2KZVA 2UUZA 3AL0C 1LDKB 2VLAA 3H5AA 4U7BA 3HUGB 4XKVA 1YX3A 1BOBA 4F92B 3K4LA 3VYSB 2X1CA 1MMAA 3MKYB 4NUBA 2X6WA 3PNTA 1WJCA 3ONQA 5KNLA 1MNDA 4CCJA 2HPMA 1T95A 2W7NA 2OC6A 2LBFA 2JA2A 2VIXA 4BEHA 2W00A 1X1AA 2IS6A 2VQCA 3CF2A 4XMYA 4D1QA 3CJQB 4CA0A 5KCMA 2M7AA 4BXFA 2MFZA 4B48A 3OYGA 3W3CA 3HOTA 2HVQA 4C2UA 2A5WA 2DJIA 3FDYA 3OYAA 3NWTA 3K6GA 3EUKL 3PNVA 3OYLA 1W36C 2K3PA 4B3XA 4KT6A 4XL9A 3VDXA 4XQFA 3MMYB 4BQOA 3ZCOA 2CFOA 3CESA 2VXZA 2KLOA 3PL8A 4NC7A 4F93B 2W1OA 3QYFA 2W4SA 4F3QA 2MC4A 2Z2SB 4E7IA 2OV7A 3DQVC 1WJDA 4C2TA 3PFYA 3OOUA 1WJFA 2V26A 1T0FC 5FROA 3HPHA 3RSNA 3PJRA 2KMUA 2KL4A 4RM3A 3HXLA 3F9KA 1WJ5A 3DKXA 3SZGA 4BQQA 4BS9A 2I8DA 3K4MA 2VJ5A 2K9MA 3HL2A 2QKMB 2CUJA 2LY2A 3BCAA 3OIQA 4PJJA 1HA8A 2UV1A 1D0YA 3FBIB 1MMNA 2O5RA 3VSKA 3FBNB 2IS1A 2BOLA 3QYBA 3KYLA 3BG6A 3LL7A 2DT7B 2X6YA 3D5SC 2PJRB 2KQRA 3OWTA 4QPOA 2CV0A 2E5ZA 3KX2A 2F5VA 2PMZA 1BR4A 4BACA 5LD2C 3IAS2 2VPLA 3DTKA 4IZZA 3QOEA 2R7SA 2VL8A 4D9JA 1X1CA 4BJ5C 4XN3A 4YELA 2WA0A 2CS3A 2F4IA 4ANJA 3H9JA 1MNEA 2DT6A 3EUHC 4CUGA 1UAAA 3OYBA 4CCLA 2CH0A 2ZXHA 5CPRB 1MW7A 1P9QC 4E7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9L A;  2K9M A; 
#chains in the Genus database with same CATH topology
 1ZKG A;  1OCO H;  4F55 A;  1LDD A;  2R7W A;  2G7U A;  4RM2 A;  1Y1W J;  3A1Y A;  2M7B A;  2PG4 A;  3CJT B;  3OL3 A;  4LIT A;  5F6F A;  2XB5 A;  1SVO A;  1ZR4 A;  4L9V A;  2P5V A;  4UB6 C;  1XS9 A;  4FTH A;  2M8G X;  3V8L A;  2QKL B;  2RGV A;  4RGX A;  1O3T A;  2QYO A;  3DKY A;  5FKO A;  3M8E A;  2H8R A;  1E0E A;  4XNF A;  4ENK A;  5H2F C;  1EF4 A;  1KA8 A;  5HLH A;  4P5O A;  5FD6 A;  1X3U A;  1T8I A;  2EFO A;  2DA3 A;  3CCM I;  2D5V A;  3QOP A;  3ESW B;  4XLH A;  1MMD A;  3CUQ A;  2VC1 A;  3JSP A;  2ZJP F;  2R0Q C;  3HOV J;  1DP3 A;  3SFZ A;  2V6C A;  4DOZ A;  3QYE A;  4E7J A;  3BT9 A;  3BP8 A;  1QPI A;  3A2K A;  5AON A;  2Z1D A;  5L3F A;  1LE8 A;  2ISY A;  2YX7 A;  5L3C A;  2QWW A;  2TRT A;  4X1E A;  5E8I A;  4I0B A;  2FJ1 A;  4ZJZ A;  3PIO F;  4RS8 A;  4RA2 A;  2DMU A;  1LFP A;  1ETK A;  3HOY J;  3EDP A;  3PIP F;  1VF9 A;  2VQL A;  5GTI C;  1J59 A;  3VWB A;  3SXY A;  4IL6 C;  3VYR B;  1V5E A;  3BJA A;  1B1B A;  4BYY A;  4MFE A;  3DP7 A;  4R79 A;  5D8L B;  1G3W A;  3CLO A;  1YLF A;  3K10 A;  3S15 J;  4OAY A;  3GTM J;  1A6Q A;  1UG2 A;  4G6T B;  5H20 A;  3MAJ A;  4C9Y A;  4U0V A;  5LBQ A;  6PAX A;  4LD5 A;  1LVK A;  5F64 A;  1PJR A;  3FM5 A;  1EA3 A;  2E7X A;  3SDB A;  1W7P A;  3BG7 A;  2HU9 A;  3E97 A;  4RMN A;  2L7M P;  2D1V A;  4N9I A;  3COA C;  3G1M A;  1KU9 A;  1T2K A;  2RRE A;  5J47 A;  3OYE A;  3LSP A;  4FE7 A;  1I6H J;  2XAS A;  2R3S A;  3GTK J;  3LMM A;  4EM2 A;  4NBQ A;  4XSX F;  1U9O A;  4WWC A;  4BBR J;  1SC7 A;  3OIP A;  5ILS A;  3GVA A;  4B47 A;  3WTU C;  3W2V A;  3ABL H;  2OQG A;  2QM3 A;  4UUS B;  2W84 A;  5CQG A;  4CYC B;  1AKH A;  3CP8 A;  4OIQ F;  3U1D A;  1ZK8 A;  4PDK A;  3BRO A;  3L9F A;  3VOE A;  3CF5 F;  4XR6 A;  1XPX A;  4PGG A;  5J8F A;  2JUC A;  2KRC A;  2DFE A;  2L54 A;  4NHJ A;  5FJ8 J;  2WY8 Q;  3GFJ A;  3FMS A;  2ZSI B;  2HZD A;  4C30 A;  2WAE A;  2TCT A;  2A68 F;  1W0T A;  4YIF A;  1GVJ A;  3P7N A;  4A6E A;  2DOF A;  1L3L A;  3E5Q A;  4XKC A;  2LR8 A;  1ZAR A;  2FNA A;  1P2F A;  4KFC A;  4AU7 A;  1N25 A;  1SD5 A;  1XD7 A;  3MZY A;  5FGM A;  2CUE A;  2RNG A;  4YFX F;  3F8C A;  3BY6 A;  3AKZ A;  2HQR A;  4BL0 B;  3DU5 A;  2AS5 F;  2M4G A;  3RKW A;  3ZQF A;  5FO5 A;  4KIG A;  1GXP A;  4A93 J;  2LC2 A;  4LK1 F;  1WPK A;  2PMZ N;  1ETO A;  3MCZ A;  1BIA A;  3R0J A;  3UNG C;  5E3O A;  2WWY A;  3M1C A;  3HGG A;  5M5W J;  3MKW B;  1MH3 A;  3VPR A;  1KYW A;  4BUP A;  3HOU J;  2B7E A;  4IXA A;  2PX9 A;  3Q9S A;  5L3E A;  2EFW A;  2P6S A;  1K7A A;  3H0D A;  2GA2 A;  2L3D A;  3H9G A;  4UB8 C;  4Y33 A;  4BY7 J;  4W1U A;  5ED4 A;  4RLQ A;  3ERE D;  4L0Y B;  1YIT I;  1UHM A;  2LOO A;  1OFC X;  1V3F A;  2ZXW H;  2K5C A;  1T39 A;  3ZRG A;  4LGW A;  1YIJ I;  1FPQ A;  1IV6 A;  3TED A;  2IGK A;  5FFZ A;  1UCR A;  3K2A A;  1FBQ A;  3HKZ N;  4KT5 C;  2Q1Z B;  1YE9 A;  3PM1 A;  5M3M J;  2BBY A;  2MSY A;  2JUG A;  4XSZ F;  3TGN A;  3KZY A;  3BR1 A;  3O3K A;  4XLA A;  2DOA A;  2CSO A;  3ABU A;  2ME6 A;  4UVA A;  2EZK A;  1WJE A;  2ZCW A;  3K4K A;  2Y69 H;  3IH2 A;  4G7O F;  4L9N A;  4DJA A;  1E17 A;  3ZXS A;  1FIA A;  2ZME B;  2DPU A;  1H88 C;  3T8R A;  1A5J A;  4IKF A;  3HOZ J;  1QVU A;  2I5U A;  2L9R A;  1QZE A;  3EPZ A;  4XLF A;  1FNN A;  3L2R A;  1ZG3 A;  4DYR A;  3F8B A;  3LSM A;  4XLP F;  4E6K G;  3HEF A;  2F5C A;  2WB1 A;  2XF5 A;  2R7V A;  3PQK A;  4KJZ A;  4EEF G;  4JP0 A;  4ZTF A;  2L9N A;  4EM1 A;  3LOC A;  1B9M A;  1BJA A;  4PCQ A;  4ZYG A;  4F91 B;  1U8B A;  1R5I D;  2VBY A;  2V9K A;  3KCC A;  3OYD A;  4XRM A;  3UKG A;  1JHH A;  3BOQ A;  1ZAO A;  2JK3 A;  5D5W B;  3DBR B;  1N75 A;  4HLX A;  2EIN H;  2V1X A;  4GYG A;  1R58 A;  1FY7 A;  2CJJ A;  2PMH A;  2R7O A;  4EVI A;  1GDT A;  2PEX A;  3IL2 A;  2FBH A;  1TT0 A;  1SFE A;  1V5G A;  4DBQ A;  3MWM A;  5J1U A;  5ILV A;  3OYI A;  3NAR A;  2EFQ A;  3PFI A;  4XOR A;  3OYJ A;  3GXO A;  4XKB A;  5EG0 A;  2BE5 F;  2VKE A;  3WGG A;  2NYX A;  3EYI A;  3NRV A;  2OTL I;  1JKR C;  4O3M A;  3JAM K;  3CCS I;  3GLL A;  3OYK A;  1TQM A;  2QF7 A;  2BHY A;  2IA2 A;  5CVV A;  4CHU A;  2H6B A;  3N4M A;  3WU2 C;  2CW8 A;  3ML6 A;  4HQM A;  5JHU A;  3IKT A;  4BBS J;  3GTO J;  2OJE D;  4A3I J;  2LBF B;  2DOE A;  2P7V B;  5C4J J;  4CCM A;  3EYY A;  3F6V A;  2IPQ X;  1W1W E;  3I4M J;  4PFP A;  2E60 A;  3BTC A;  4PFO A;  1FZP B;  2EIK H;  2GOM A;  2Y0S A;  3TW7 A;  3JTH A;  5AIQ A;  2CQQ A;  2LP0 A;  3KZZ A;  4XM3 A;  4RGS A;  2FU4 A;  3GWZ A;  2P7C B;  2DMQ A;  5HVQ C;  2M8E A;  4YFN F;  2F5D A;  2A69 F;  1FMW A;  3M07 A;  1LQ1 A;  1IDZ A;  2O6G E;  1HC8 A;  1Z0X A;  4HDU A;  3BG5 A;  2NRA C;  3K9T A;  3I9V 2;  1J5Y A;  4HAM A;  3DBL B;  1KU7 A;  2Q0O A;  2M34 A;  1IC8 A;  2WAF A;  5HOO A;  2OAZ A;  3LWF A;  5EYR A;  1BW6 A;  3RYR A;  2HI3 A;  2RVC A;  2XUB A;  3HG9 A;  1H9T A;  1SD7 A;  2Q2E A;  4BHB A;  1OCP A;  2LKX A;  3PUB A;  3W2W A;  1JI8 A;  1J09 A;  3BJO A;  5KAI C;  1B8I A;  1XN7 A;  4LB6 B;  4D7N A;  4WK8 F;  2DXI A;  2ZJR F;  4KIC A;  4U0Y A;  1XG1 A;  2DO7 A;  3OIO A;  3DPL C;  3AL0 C;  3KP7 A;  3O8G A;  3H5A A;  4U7B A;  1QBJ A;  1J75 A;  4F92 B;  5JLX A;  1W4M A;  3CO7 C;  3KE2 A;  3TO9 A;  5E20 A;  1TW2 A;  2CQX A;  1MMA A;  3MKY B;  4L9T A;  4KIB A;  3ONQ A;  5KNL A;  2RDP A;  1T95 A;  2IW5 A;  2OC6 A;  3AG1 H;  3JRD A;  1YJW I;  1TW3 A;  2IP2 A;  4G9Y A;  3HRM A;  1KQ9 A;  1LJ9 A;  4S04 A;  4ABZ A;  1XX5 A;  2BHZ A;  5DD4 A;  4A3C J;  1XGM A;  3SZP A;  1H0M A;  4D7M A;  4KYW A;  3JR9 A;  1YRN A;  2HS5 A;  1HOM A;  2HYG D;  4B48 A;  3OYG A;  3W3C A;  2HXI A;  3QPS A;  3V7S A;  2HVQ A;  2NVT J;  2PN6 A;  3FDY A;  4A3F J;  3OYA A;  2WV1 A;  3EUK L;  3PNV A;  3MN2 A;  4B3X A;  2DTR A;  1FEX A;  4B3A A;  2FML A;  4KT6 A;  3VDX A;  2BXY A;  2XRO A;  3OSF A;  1D8J A;  1JXS A;  5LEK A;  3FK6 A;  5CYV A;  3L09 A;  4B1R A;  4A69 C;  1IN6 A;  3ZMZ A;  1IAW A;  5K7Z A;  2QEX I;  3PL8 A;  4NC7 A;  4F93 B;  3M9A A;  3ZN1 A;  3CCL I;  3KYD B;  2DMT A;  4E7I A;  1IXR C;  2OV7 A;  5E1W A;  3WGI A;  1YW9 A;  2XAF A;  3ZMD A;  1NH3 A;  5LRR A;  5FLX Z;  4I76 A;  1I1S A;  3RPQ A;  1FP2 A;  2EIL H;  1J7K A;  3IKV A;  1IO2 A;  4KIF A;  5J6X A;  4RB2 C;  4IO9 F;  5H6R A;  2D1H A;  4A6D A;  1P4W A;  3FM3 A;  3CMY A;  1JKO C;  3VOD A;  4IPA A;  2VJ5 A;  1R4N B;  2BY0 A;  3U1K A;  2Y30 A;  1RKT A;  2CW0 F;  2HOA A;  1XMX A;  3I54 A;  1JJ6 C;  4PJJ A;  3V7C A;  2K9Q A;  3TP3 A;  2M0C A;  2WTE A;  5FKM A;  1MMN A;  2O5R A;  3CD6 I;  1Y39 A;  2L02 A;  2G0E A;  3GLX A;  3VSK A;  2JPB A;  2IS1 A;  4IRI A;  5LHH A;  4UNO A;  3BG6 A;  3LL7 A;  2VE9 A;  2DT7 B;  1QZY A;  1SAN A;  3D5S C;  3T5X A;  4IHS A;  2NVU B;  1EJ9 A;  1G3Y A;  3OSG A;  2F5V A;  1ETV A;  3S2W A;  3M1E A;  5BMZ A;  3KPH A;  3CCR I;  2BXZ A;  2F4I A;  3HYI A;  2FBK A;  2CO5 A;  1MNE A;  2UZK A;  4UHT A;  1STZ A;  1UAA A;  4CUG A;  3OYB A;  2EFP A;  5CPR B;  1Z9C A;  2C6Y A;  2WV0 A;  3I0T A;  4E7H A;  1W5T A;  5M3F J;  4D0P A;  3OR1 C;  1XDU A;  2M1B A;  3TL4 X;  1XSX A;  2M0M A;  4DW6 A;  4KIS A;  3KP4 A;  1Z21 A;  2X48 A;  1HW1 A;  2R5Z A;  4XON A;  1SAX A;  1UG0 A;  1VQ5 I;  1IN7 A;  1RUO A;  1ZQ3 P;  2MH2 A;  4IVN A;  5E8G A;  3LST A;  4QWQ A;  2VUM J;  1I3A A;  1Z77 A;  4NC8 A;  4QPQ A;  4BJ6 C;  3PSF A;  1MDM A;  1FSE A;  4PJL A;  1IN5 A;  3G4S I;  2H1K A;  3L2U A;  3JCU C;  3HIF A;  3S17 J;  2DI3 A;  2A05 A;  3A02 A;  4XOP A;  1M1E B;  3ISP A;  5EF6 A;  1U6G A;  3ABM H;  2FX0 A;  3QP5 A;  4ZYD A;  2VE8 A;  2FRH A;  2NXN B;  4IJA A;  4XLE A;  4II3 A;  2BW3 B;  2AQF A;  3ZMU A;  3GYH X;  1U5T C;  3D5L A;  4FQG A;  4HBL A;  3R60 A;  1LKX A;  4Y4R A;  1U0J A;  1ZEL A;  2VQG A;  4GXO A;  4F52 A;  1U9N A;  1UZC A;  2X51 A;  3BQY A;  3FZV A;  3X2Q H;  2VN2 A;  5J1R A;  2R7D A;  3JRC A;  3R4K A;  3WHB A;  2IBD A;  5J3L A;  4EJV A;  5D4R A;  4R1H A;  4GGG A;  2ZSH B;  2J5O A;  2EV5 A;  1D0X A;  3WTY C;  5CVR A;  3F8N A;  2EK5 A;  2HTJ A;  2ID3 A;  3GZ6 A;  1V55 H;  3VB2 A;  2RV8 A;  3FKJ A;  4HZF A;  4HNT A;  1IJW C;  3K2Z A;  1VQN I;  2JA8 J;  1S9H A;  5J8C A;  1QA6 A;  1ON2 A;  3R6S A;  4XOT A;  2K9N A;  3HSE A;  4YG2 F;  2IS4 A;  4UVB A;  3WTX C;  5LFA A;  3KZI C;  1TLH B;  1Z3X A;  2QVO A;  4LB5 A;  2L4A A;  3LQR A;  5D6F A;  2FBI A;  1G8X A;  2PFB A;  1PUF B;  2F48 A;  2Z9O A;  2X85 A;  4JYK A;  1JKQ C;  2V6E A;  1ZHF A;  3CCE I;  1JKP C;  2MAB A;  3BCB A;  1U8R A;  2JMW A;  1BI3 A;  1MIJ A;  3CDI A;  4G7Z F;  5F27 A;  1R23 A;  4C3J J;  3JRA A;  2HDC A;  5IYB J;  2VKD A;  3DLL F;  1X19 A;  2R92 J;  3S8P A;  1R6R A;  2ELJ A;  1MGT A;  1U5T A;  5DTD A;  2LG4 A;  2BYV E;  4M72 A;  1R7J A;  2W82 A;  3J81 K;  3HOS A;  4FET A;  1OPC A;  4NQW A;  2V1D A;  3MZ8 A;  2CGP A;  4E4H A;  2LH9 A;  1JUP A;  1V5F A;  3LA3 A;  3IV5 A;  1YTY A;  2N8G A;  2O03 A;  2HVR A;  3A0B C;  2DMN A;  3DF8 A;  4LIV A;  3ULQ B;  1R9T J;  1LFB A;  2QA4 I;  4A5N A;  3AG4 H;  4HG2 A;  3D0S A;  4Q4Z F;  1VQO I;  2DA7 A;  2CG4 A;  3ASN H;  1HSJ A;  4EMS A;  3KET A;  4K2E A;  1OCT C;  1BW5 A;  3QWL A;  2M30 A;  4HX8 A;  1C0W A;  2FEZ A;  1ON1 A;  3HBL A;  4JX6 A;  3ZOB A;  2E5N A;  3L2Q A;  1CF7 B;  4ZZL A;  1P4X A;  3S14 J;  2QQA A;  2LRD A;  5C44 J;  5EJC A;  1RRJ A;  1N78 A;  1ETY A;  2FD5 A;  2NVX J;  2CMP A;  1VQP I;  4EJU A;  3ZQQ A;  1YW8 A;  3ASO H;  1QNT A;  3LSH A;  3ZQH A;  2CV2 A;  2ZC2 A;  1VQM I;  2DA5 A;  3LFU A;  3B02 A;  4LFU A;  2CRG A;  1TNS A;  2GXG A;  2YR2 A;  3S3O A;  4M3E A;  3QQA A;  3LA7 A;  3GTQ J;  4HW0 A;  2E2H J;  3RPU A;  1ORK A;  1MMG A;  3G73 A;  2MW8 A;  1OQY A;  1MBH A;  2YSR A;  4XRS G;  2HKO A;  2X1E A;  3IWF A;  2V79 A;  2XPU A;  3A01 A;  4IQJ A;  1IRF A;  3AG3 H;  2KRF A;  2DBB A;  4KMF A;  2MH9 A;  4KNY A;  2VAS A;  2DK5 A;  2CV1 A;  3AG2 H;  3AL0 B;  4P1W A;  1A04 A;  3KP2 A;  4M6V A;  2BY2 A;  2O7O A;  3I64 A;  2KIS A;  2VC0 A;  5B1B H;  5F1J A;  2Z3Y A;  3WG7 H;  4ESJ A;  2VKV A;  1MJB A;  3L00 A;  1Z7U A;  3F23 A;  2K7L A;  2OQR A;  1T33 A;  4U87 A;  2HFH A;  3ZP5 A;  2K40 A;  1RR8 C;  2V9V A;  1YOV B;  3FXJ A;  1FBS A;  4I01 A;  5GAG J;  2DTZ A;  5HS8 A;  5FLM J;  1ZYR F;  2HZT A;  4Q48 A;  1NG7 A;  2R7T A;  2Z99 A;  4BH9 A;  2V7F A;  1HW2 A;  4GO1 A;  1N77 A;  2FQ3 A;  4CZC A;  4MIM A;  2K27 A;  2PQ8 A;  4MEY F;  4IHX A;  3FX3 A;  1TZL A;  1TTY A;  1TL8 A;  1USS A;  4EV0 A;  4KN7 X;  2K9L A;  2O8X A;  1F1Z A;  4JX5 A;  3V4G A;  3H5N A;  3J7Y J;  4BQA A;  3Q0U A;  1QU3 A;  3H92 A;  2HDW A;  3QOD A;  4UVC A;  4WCG A;  5GAD J;  1AWC A;  2JQ7 A;  5K5O A;  3P5J A;  2WY7 Q;  5JLW A;  1MZB A;  1Z1D A;  5K5Q A;  1V4R A;  4JQF A;  3E5U A;  5LEJ A;  4CXF A;  2DN0 A;  3SZT A;  2XAH A;  1TWH J;  3IRR A;  2Y75 A;  4AYB A;  3M7G A;  2H09 A;  5HNH A;  1SD4 A;  4P55 A;  3GEZ A;  5BNG A;  2Y9Z A;  4LOC A;  4Q47 A;  1FTT A;  5C3E J;  3HPG A;  3AFH A;  4AWX B;  2IA1 A;  5E1Z B;  3L2W A;  1ZRD A;  2E2I J;  1JTX A;  1UB9 A;  2ZXI A;  2NVY J;  5DM7 F;  1NHA A;  5ILU A;  3I71 A;  1MBG A;  2AQE A;  3FHZ A;  1D1A A;  4A0X A;  1CQT A;  1DP7 P;  3HC7 A;  4HV5 A;  3VSL A;  1JUM A;  4V2F A;  2K85 A;  4EAT A;  3K1M A;  3QPH A;  1ERD A;  1LEA A;  2STW A;  2L7F P;  1KQ8 A;  3FF5 A;  2VJ4 A;  5BPD A;  4CDG A;  4BXU A;  4KUM A;  3S32 A;  2OCC H;  4ESF A;  1UFM A;  3ZQI A;  4CGZ A;  3LA2 A;  5BQT A;  2J5P A;  2LVS A;  4E70 A;  2QSH X;  2GWR A;  3G71 I;  5E3N A;  1R1V A;  4A12 A;  1PVE A;  3ZQ7 A;  4CCK A;  4NB5 A;  3IH4 A;  4P9U A;  1OCZ H;  3A03 A;  4DBR A;  3W6V A;  2KJC A;  2R5Y A;  1X1B A;  1T08 B;  1IN4 A;  2LF8 A;  4IHT A;  1EH6 A;  5GAE J;  1IDY A;  3E6B A;  1NG6 A;  2PBI A;  3ZR8 X;  5A2Q Z;  1TWA J;  2Y9Y A;  1VQK I;  2L01 A;  2DFF A;  3E5X A;  1FIP A;  4N0B A;  2R93 J;  2MLK A;  2H94 A;  2VXD A;  1W5S A;  3K4J A;  3JRG A;  3OS0 A;  2XF6 A;  2DMP A;  1DU6 A;  2DT5 A;  5FD5 A;  2OBP A;  3DWL E;  2R7Q A;  2RN7 A;  3DEE A;  3FMQ A;  3DPU A;  2GA1 A;  3V7R A;  3F0C A;  1Z6T A;  2ADU A;  2M3A A;  1RUN A;  4PJM A;  1G2H A;  4ZDO A;  1ZRF A;  4XRF A;  1FOK A;  3ZGK A;  4LG3 A;  2F4M B;  1IRG A;  3I59 B;  3W6J B;  2VBX A;  2LF7 A;  3DBH B;  3G1O A;  3I5U A;  1B59 A;  5EZH A;  4BHP A;  1QHH D;  2RNJ A;  3C2G A;  4M73 A;  3GZ5 A;  5FRM A;  1X1D A;  4IRG A;  3J80 Z;  2M2E A;  5JVG F;  4ENJ A;  5GTH C;  2ZFU A;  1D0Z A;  3GX4 X;  3K69 A;  5ERI A;  3IAM 2;  4BAY A;  3BLY A;  5LRS A;  1QZZ A;  2KZV A;  2X4H A;  4G12 A;  1HKT A;  1ZLK A;  4I2O A;  3HUG B;  5D5X B;  5J4V A;  1YX3 A;  1BA5 A;  2OZU A;  4LG0 B;  4EQQ A;  4UY8 I;  3O2P E;  1FC3 A;  4M71 A;  1S7A A;  2B9S A;  2COM A;  4CCJ A;  1POG A;  2HPM A;  1VTN C;  1QVT A;  1U78 A;  2IVM A;  4BEH A;  2JA2 A;  1BI2 A;  3RIR A;  3RYP A;  2IAI A;  4M9Z A;  5DEQ A;  1X1A A;  4IHV A;  3CF2 A;  4QSH A;  5F1R A;  3G6E I;  3CJQ B;  1YJ9 I;  2E1O A;  1P4A A;  3TO7 A;  1JJ8 C;  2CQK A;  2MBF A;  4FT8 A;  4CA0 A;  5BS6 A;  3LFK A;  5KCM A;  2K9S A;  4NDL A;  5FFX A;  2VOP A;  3CDH A;  3I56 I;  1PP7 U;  2F4O B;  4C3H J;  3KEQ A;  4ZYE A;  4CO8 A;  4RB3 C;  4HF2 A;  4EGZ A;  2F5F A;  4FX4 A;  1YO5 C;  1K61 A;  4S0H B;  5B5E C;  3NWT A;  3K6G A;  3WHC A;  2NVQ J;  3A0H C;  3ECH A;  4Y7N J;  4RB1 A;  3ELK A;  4WXC A;  2KDZ A;  3G3Z A;  3IC7 A;  5DCM A;  2RQP A;  5GP9 A;  4XBF A;  3ZPL A;  3BDD A;  3GO5 A;  2KZG A;  2WB1 N;  2OPT A;  3CES A;  1OCC H;  3QPL A;  2QBY A;  1BI1 A;  1MSE C;  1HST A;  1WQ2 A;  2W4S A;  3QYF A;  2H1L A;  3SJM A;  1T38 A;  3E6D A;  3DQV C;  4XLN F;  2MLG A;  3PUF A;  1WJD A;  3TKY A;  4C2T A;  3PFY A;  2GAU A;  2LKP A;  1P7J A;  3Q0W A;  5FRO A;  3WTT C;  3GTJ J;  2W24 A;  4CYD A;  3JRB A;  1ONV A;  1WGX A;  4HX7 A;  4B4C A;  1WJ5 A;  3DKX A;  3SZG A;  4BQQ A;  4BS9 A;  3CUQ B;  2I8D A;  2CWE A;  4YIR X;  2K9M A;  1V54 H;  4UXN A;  2CUJ A;  4DQ2 A;  4OIO F;  2VT2 A;  4EJW A;  1HA8 A;  3ZQL A;  2DQL A;  2UV1 A;  3GW2 A;  5BOX A;  1Y8R B;  2ESH A;  5TJJ A;  2IEK A;  2ECB A;  3BQZ A;  5FKN A;  1LE8 B;  5ICF A;  1OKR A;  2L4M A;  3HB9 A;  2O8K A;  2STT A;  4GYI A;  4QPO A;  3FIS A;  3KX2 A;  2CV0 A;  5LD2 C;  1CGP A;  4RB0 A;  3W6K B;  1B6A A;  3IAS 2;  2VPL A;  4IZZ A;  4ENM A;  2R7S A;  2VL8 A;  4G8X A;  2WA0 A;  2CS3 A;  2NAZ A;  4MGR A;  2DT6 A;  1TC3 C;  3EUH C;  3VEP A;  1R22 A;  4MEX F;  1RES A;  3DXJ F;  4W97 A;  4CCL A;  2CQ7 A;  3BTI A;  3SHF A;  5EEA A;  1XC5 A;  4HF1 A;  3I4N J;  1UMQ A;  2Y0S N;  5CKT A;  2ZNZ A;  2AHQ A;  3F8F A;  5HDG A;  3Q3S A;  1DDN A;  3DV8 A;  1W0U A;  1GT0 C;  1EV7 A;  3TDU C;  3JRE A;  2D45 A;  2E1N A;  1BJZ A;  1HKQ A;  2F2E A;  1WFX A;  2R7U A;  1DPU A;  1W7P B;  2TDX A;  1MBJ A;  3H36 A;  3K70 C;  4J01 A;  2FE3 A;  1U2W A;  1NTC A;  2BVL A;  1WCM J;  5HNF A;  5GPC A;  4II2 A;  2V9P A;  1FT9 A;  3MQ0 A;  3S2H J;  5GAH J;  3IUO A;  4CH7 A;  4J00 A;  2A61 A;  3CCJ I;  2XSD C;  4N9H A;  1MH4 A;  3CMM A;  4Y3O A;  2ICW G;  1XCV A;  2KKO A;  1AKH B;  1IUY A;  2XGE A;  5LHI A;  4MNU A;  3O6B B;  3BZC A;  3HRU A;  1XB4 A;  2E7W A;  1S6L A;  2BY3 A;  3P9K A;  1XGN A;  4WXH A;  1AHD P;  4I99 C;  3BR5 A;  3CCU I;  5FRN A;  2JA7 J;  3SQN A;  3HOW J;  1I27 A;  3EUH A;  4EM0 B;  3OV8 A;  1PP8 F;  3CC4 I;  3BJ6 A;  4KIT B;  3SYT A;  2MG4 A;  4IEJ A;  3OS1 A;  4BE0 A;  3REO A;  1NK2 P;  3LSK A;  1O3S A;  4UV8 A;  2PJR A;  2LFB A;  1WVR A;  2ZJQ F;  3ZMV A;  2XRL A;  5HLI A;  3KFW X;  2LSO A;  2X6X A;  2GXA A;  2FXA A;  2RC4 A;  5JR3 A;  4XKW A;  1ETW A;  2HNH A;  2DA6 A;  1WI9 A;  2JTV A;  4PSX A;  1YS6 A;  3H9Q A;  4E7S A;  2FUG 2;  4RGU A;  2L7K A;  1AOY A;  4ON0 A;  5EGO B;  3BPV A;  2HQ5 A;  2OU2 A;  1S72 I;  1FLI A;  3CP2 A;  3H3Z A;  4AM3 A;  2XSJ C;  3M8F A;  1OMI A;  4UV9 A;  2CW7 A;  1K4S A;  2LY1 A;  3J7A Y;  2E71 A;  3TW6 A;  1XGS A;  3KP3 A;  3MD2 A;  4OIP F;  3S1M J;  1IN8 A;  5KVR A;  1I50 J;  1Q1H A;  2FSW A;  4L9J A;  2W25 A;  2LMD A;  3K4N A;  1FJL A;  1ZG1 A;  2A6E F;  3FXU A;  2QCO A;  2K4B A;  2W48 A;  1S8N A;  1UST A;  4DZP A;  2R7X A;  2KHM A;  4IOA F;  3CCQ I;  4EGY A;  2LTP A;  2WAQ A;  3CZ6 A;  4M9S A;  1O7L A;  2FQ4 A;  3L2V A;  2GBY A;  2L0K A;  4HX4 A;  1YG2 A;  1BC8 C;  1YJN I;  2YPR A;  4MLO A;  2HOS A;  1RPW A;  1Z67 A;  4OAZ A;  1XSV A;  3MKZ A;  4HST A;  4AUX A;  1OCR H;  1WHU A;  2VB6 A;  4GRI A;  4AIK A;  5DCF A;  1ZRC A;  3LSG A;  4MO7 A;  4ZC3 A;  5ICE A;  1R5H A;  5TGT A;  5IYD J;  4AID A;  2DFH A;  4OIR F;  4HRI A;  1X1P A;  3RQ4 A;  1LUJ B;  3QRF F;  1IZ1 A;  2BEO A;  2K02 A;  3HOX J;  1D3Y A;  4LLN A;  2ZB9 A;  1TQP A;  4M3G A;  3K1P A;  3F72 A;  1GV5 A;  5CJ9 A;  5E79 C;  3IWZ A;  1D5Y A;  1IF1 A;  3OOP A;  4H4K C;  1DQU A;  4JOM A;  4ZDP A;  2FA5 A;  2GIV A;  2QSF X;  3D5R C;  3K7A J;  4DIQ A;  4S05 A;  1T56 A;  1VQ6 I;  2R7F A;  5LHG A;  4UUT A;  3OL4 A;  4MTE A;  3K4C A;  3C7J A;  1HCR A;  2HOT A;  3BR2 A;  1O57 A;  1R1U A;  2YU9 J;  4L5E A;  1IRZ A;  4D5F A;  3NWS A;  2NS7 A;  3FXQ A;  2IGO A;  4Z2Y A;  3A4C A;  3RPU D;  3FWE A;  1TWG J;  3FHN A;  4BKX A;  3ZQC A;  1AA7 A;  2KRH A;  2XAU A;  5HDN A;  2ZNY A;  2MYS A;  2ISZ A;  2WBM A;  2Z16 A;  3KP6 A;  2Y0M A;  5LGU A;  3FXK A;  3H1C A;  3CJR B;  1ZR2 A;  3ECO A;  3LSJ A;  1XDS A;  4OMY A;  2FOW A;  2MGQ A;  2VJI A;  2X1D A;  2HQA A;  1MMS A;  2VI6 A;  1GVD A;  4JBA A;  2HGC A;  3LQQ A;  3J7A O;  1QPM A;  2Q8K A;  4N4O B;  4YII A;  3HTU A;  2OF7 A;  1BN5 A;  2JA6 J;  3PSI A;  1WWX A;  2XDV A;  3FKI J;  5EG0 B;  1FYM A;  1BC7 C;  2KP6 A;  2KIU A;  4PK4 A;  4EJO A;  1TNT A;  3OMY A;  4UUS A;  2ID6 A;  1X3W B;  2RAE A;  4CYC A;  5CVU A;  1A31 A;  3BR3 A;  2DYS H;  1PDN C;  2IGN A;  3E0J B;  3NAU A;  2EZI A;  3N97 A;  2A6T A;  2WAD A;  1WJA A;  1HXD A;  3DLA A;  2O61 A;  2XGD A;  2A5Y B;  2NNY A;  2O3F A;  2XC7 A;  2O0Y A;  4PZJ A;  1XTA A;  4V19 K;  4XN0 A;  4BQN A;  5JVT A;  2JN6 A;  1FMV A;  4YEJ A;  3DPT A;  4A3E J;  3S3M A;  4BNC A;  4XLC A;  1D1B A;  1QRY A;  1G3T A;  3UR3 C;  3JRI A;  2LYC A;  3S2D J;  1B9N A;  4CZZ A;  1ACI A;  3E7L A;  2XAJ A;  4MHG A;  1QGP A;  5C4X J;  2ZME C;  2DOD A;  1IW7 F;  5ICG A;  3PNY A;  4Y15 A;  1JTY A;  1X58 A;  2BV6 A;  3DU6 A;  2AO9 A;  3V8K A;  3OYF A;  3ZMS A;  2DQR A;  2XB0 X;  4BJT A;  5DUI A;  5BPI A;  3OYM A;  2P5L C;  2E1C A;  5FLX K;  1K78 A;  2H8W A;  1S29 A;  4BU2 A;  5IY5 H;  4X0G A;  3BR0 A;  5B3S H;  4OWR B;  4ZYA A;  3IRQ A;  3Q5F A;  3PO3 J;  2Q2E B;  2WC2 A;  4I7H A;  3CO6 C;  1I39 A;  3JTG A;  2B63 J;  5CQE A;  2G9W A;  1KON A;  1B8I B;  1ZRE A;  4FHT A;  3W2A A;  1IV8 A;  2VPR A;  3V42 A;  2EQR A;  4IF4 A;  3TMO A;  4Y17 A;  2BVM A;  2E1M C;  3BZ6 A;  3C3W A;  3GFI A;  1O7F A;  3I58 A;  4E7Z A;  3ZN0 A;  4IX7 A;  4BDY A;  2L5Q A;  1VZ0 A;  3O8H A;  2P81 A;  4HNV A;  3SDG A;  4DGW B;  4A3L J;  1EH7 A;  2EWN A;  4CCO A;  4PSW A;  2DK8 A;  1B72 A;  3S16 J;  4E7L A;  2D2W A;  1MJA A;  3BC8 A;  1FOX A;  1JE8 A;  4A3J J;  3CC7 I;  2EIM H;  2E19 A;  3R0A A;  4BE1 A;  2E36 A;  1ULY A;  2ZME A;  4G7H F;  1LPQ A;  1TWC J;  2K3F A;  5EZG A;  4B44 A;  4PJN A;  1Y0U A;  5F0C A;  1JGS A;  4UUV A;  1O3R A;  3HM5 A;  1W36 D;  3DTE A;  1TWF J;  5L3D A;  3CMA I;  2CUZ A;  1YRN B;  5K5R A;  1K6Y A;  2XPW A;  2VBW A;  1IXS B;  1YX5 A;  3RZD J;  2L7Z A;  2EB7 A;  1WH7 A;  3HSF A;  2ACJ A;  4AVZ A;  2JSP A;  5FB2 A;  3RTR A;  1OYY A;  3U21 A;  3T0Y A;  4RLF A;  3GTG J;  2E2J J;  3U2R A;  2HWV A;  1FYL A;  4ZDL A;  2GIZ A;  4Z6Y A;  3F8M A;  2L9V A;  1OLT A;  2EA4 A;  2F6C A;  2PLY A;  2EJR A;  1H89 C;  1OYW A;  2HYJ A;  3DEU A;  5DD8 A;  1GXQ A;  4F7Z A;  3WTV C;  3C2B A;  1HDP A;  1KU2 A;  1REP C;  1OR7 C;  3I3L A;  3GF2 A;  1T0F A;  1QO0 D;  2PMU A;  3DTI A;  4M6Y A;  3TBI A;  1SD6 A;  1SVL A;  3G1L A;  5E3L A;  1SFK A;  2DDA A;  3WTZ A;  4N4N B;  4I6Z A;  3MVP A;  1TQI A;  5KAF C;  4G6Q A;  2DLL A;  3N05 A;  1LDK B;  1LFU P;  1QQI A;  4V2G A;  4L0Z B;  1BOB A;  1GUU A;  2Z33 A;  1R36 A;  4HLY A;  2KJB A;  4NUB A;  4XK4 A;  3WGH A;  1K6O A;  3PNT A;  2QEN A;  3MFK A;  3RI4 A;  1IXC A;  1RZ4 A;  1JUS A;  4XIC A;  1MND A;  1XGO A;  2GZW A;  2AXT C;  2W7N A;  5F0F A;  2VIX A;  2LBF A;  4M3B A;  2W00 A;  2IS6 A;  2VQC A;  3H0G J;  1E2X A;  5ICC A;  1D8K A;  1BOA A;  2H27 A;  2EZH A;  1G6N A;  2YX4 A;  5IP6 A;  4X6A J;  3KP5 A;  1J2X A;  4MFD A;  4L5J A;  2EV6 A;  4RAY A;  2MFZ A;  2HR3 A;  3CUO A;  2Z5U A;  2XIG A;  1YQA A;  2DW4 A;  3WU0 A;  4C2U A;  2EFN A;  1OR7 A;  5D6E A;  4AC0 A;  4HA8 A;  2BGC A;  1SEU A;  1W36 C;  3OYL A;  4A3K J;  3BTJ A;  1DUX C;  4DYQ A;  2GQQ A;  2O9L A;  4G6D A;  1MJ9 A;  4M3F A;  1E3P A;  4XQF A;  2R7Z J;  1ZGW A;  2COB A;  4U0W A;  3I55 I;  2IT0 A;  5H6Q A;  2CFO A;  2R5Z B;  2K4J A;  3HRS A;  2ZBK A;  4U7D A;  1W5C C;  2M45 A;  1H9G A;  2EIJ H;  4FX0 A;  2W1O A;  1OIS A;  3S1R J;  2FF4 A;  2MC4 A;  2Z2S B;  1MDM B;  4J19 A;  4WF2 A;  2X6O A;  3RKX A;  1WJF A;  2V26 A;  1MSF C;  1YS7 A;  3HPH A;  3RSN A;  4AYB N;  3B6C A;  2KFD A;  2PJP A;  1KQ0 A;  3RKY A;  2VT3 A;  1SVM A;  2KL4 A;  4RM3 A;  3F9K A;  3H3V K;  4YFK F;  2A3S A;  1IUF A;  1HW5 A;  1SMY F;  5CVJ A;  4P96 A;  2LY2 A;  5IT9 K;  3OIQ A;  3ZQG A;  4M6X A;  2XGC A;  1D0Y A;  4A3D J;  2XRN A;  5F0H A;  3C18 A;  4GCV A;  5E17 F;  2QQB A;  2HKX A;  1ENH A;  3JAM Z;  1X3Z B;  1MNM C;  2X6Y A;  4QLC U;  2GLO A;  2E5Z A;  4CIC A;  2PMZ A;  1BR4 A;  3HSR A;  3MKL A;  4B09 A;  1ITY A;  1GHC A;  4EJT A;  1I1G A;  3VFZ A;  2DA2 A;  4D9J A;  1U3E M;  1X1C A;  4MQV A;  4XN3 A;  4YEL A;  2B0L A;  1J0R A;  3GUD A;  3RDI A;  5J1Y A;  1RKW A;  2ZXJ A;  5IOZ A;  1RET A;  2NOG A;  1R71 A;  3CTA A;  2RKH A;  2BY1 A;  3CJN A;  1WKM A;  2KT0 A;  2A07 F;  4A0Y A;  3PO2 J;  5J40 A;  3TOA A;  2QLZ A;  3ZMT A;  2CQN A;  2LKS A;  2V4J C;  1FWZ A;  2KIQ A;  3S93 A;  5JHF A;  2QZ8 A;  3FMR A;  2HPI A;  2QQ9 A;  2JZY A;  3HKZ A;  4HQE A;  4ENN A;  4ZTJ A;  1K78 B;  1F4K A;  4BXX J;  1KGS A;  4HSR A;  3TOB A;  2CUF A;  3I53 A;  1QHG A;  3EQL F;  1U5T B;  1JGG A;  4DZJ A;  2DCE A;  4C3I J;  3DFG A;  2CFX A;  5DYM A;  1O3Q A;  2FMY A;  3RCO A;  2DU9 A;  3OYN A;  2XKP A;  4NQW B;  3CCV I;  2NS8 A;  4KDP A;  1R4M B;  3TO6 A;  2Y2Z A;  4IRH A;  1MD0 A;  1RR7 A;  5DUK A;  5HLT A;  3OYH A;  1YIO A;  4JX4 A;  3M3Y J;  2KDO A;  1SAU A;  3ROU A;  4IHW A;  4QTR A;  3G2B A;  5LLQ A;  4XRS A;  4XID A;  2XF7 A;  2XKO A;  1OYI A;  5HS9 A;  5JFR A;  1VQ4 I;  1B72 B;  2R7R A;  3P9C A;  1X2N A;  4HF0 A;  3F3X A;  1WRJ A;  2HYF A;  5JI6 A;  3K0L A;  3L2C A;  3IH3 A;  3VYU B;  2P0W A;  1I5Z A;  1S7O A;  1XMK A;  2JT1 A;  4LLG F;  1KU3 A;  3FIW A;  3F21 A;  4Q5S F;  2OUM A;  3FXM A;  1Q1V A;  3K70 D;  1HDD C;  4A2U A;  1BBY A;  2UXX A;  2L9S A;  3E1S A;  5IYC J;  1DGW Y;  1ZN2 A;  1G4D A;  1R49 A;  3J7Z I;  3WG9 A;  2VON A;  1FYK A;  4M74 A;  1WZ2 A;  1HLV A;  1FOY A;  2CYY A;  1GV2 A;  3L7W A;  5EEG A;  3H35 A;  2NOJ B;  3Q9V A;  3BPX A;  2W57 A;  2OZ6 A;  4M3D A;  4NC6 A;  4B8X A;  4IQ4 A;  3A01 B;  1A35 A;  4NNJ A;  1RIO H;  2E1M B;  1ETX A;  4WX9 A;  1KZH A;  2EZL A;  3CLQ A;  1F5T A;  5D4S A;  1A36 A;  4GDF A;  1GLN A;  2QUF A;  2VQH A;  1T98 A;  1JHF A;  2DFI A;  5DV5 A;  1WI3 A;  1E3O C;  2LDU A;  4BDZ A;  3RZO J;  3S3N A;  2XHK A;  5J4Y A;  1ZGJ A;  4O5V A;  1DGR M;  1ETQ A;  2BW3 A;  2HEO A;  3QP6 A;  4JK1 X;  5DM6 F;  2OCE A;  1FSH A;  5A2Q K;  1HBX G;  2HDD A;  2RQQ A;  1X2M A;  9ANT A;  1P7I A;  1RI7 A;  1FOW A;  1ZH5 A;  1ZTR A;  2ELH A;  3WE3 A;  1IGN A;  1VND A;  3WE2 A;  3HZJ A;  4ASN A;  3WTS C;  4E7K A;  3CDL A;  1FTZ A;  1K4T A;  2JRT A;  2E34 A;  2M87 A;  4AIH A;  3GFM A;  1JT6 A;  5IP7 J;  1VQL I;  2MD0 A;  3H5R A;  3M4O J;  1D1C A;  2NNN A;  2GXB A;  2XAQ A;  1P6R A;  1TBX A;  2XV4 S;  4HYE A;  5M5X J;  3LAP A;  4ESB A;  1ZGA A;  3D1N I;  4A3M J;  4PGH A;  4KN4 X;  4BE2 A;  1K83 J;  2DJN A;  1ODD A;  3EET A;  4HNU A;  1J9I A;  1PUF A;  3IHU A;  3DCF A;  1YFH A;  1BI0 A;  3TP0 A;  1F36 A;  3J80 K;  1PUE E;  3BG3 A;  1I6X A;  4RGR A;  4CSW A;  2YS9 A;  1UEL B;  2X0L A;  2YU3 A;  4BGD A;  3T1B A;  5TIS C;  4I09 A;  1E3H A;  3L1P A;  2IGM A;  2F5E A;  3CCY A;  5F04 A;  1G59 A;  5D5U B;  1Y56 A;  2GOX B;  2P5K A;  4I02 A;  2ME0 A;  4AVP A;  4LIU A;  3RQI A;  2JA5 J;  1MBK A;  4HDV A;  1IG7 A;  3VYT B;  3HDD A;  2W85 A;  3KEO A;  4PUS A;  2IS2 A;  1SFO J;  1BR1 A;  3PQJ A;  5KHD A;  2VOO A;  1WJB A;  2E35 A;  2LNB A;  4AD9 A;  4H0E A;  4LJZ F;  3E6C C;  1L0O C;  1XCB A;  4OIN F;  2ZKZ A;  2VJJ A;  4WXD A;  1VQ7 I;  2ESN A;  2JVH A;  1LVA A;  1FP1 D;  4Y13 A;  4IOC F;  3HHH A;  3I4P A;  1FBU A;  1HKS A;  2DPD A;  2I10 A;  1G3S A;  1RNL A;  4LK0 F;  1D5V A;  2EH3 A;  2KIF A;  2R5Y B;  1CF7 A;  2IRF G;  2XPV A;  3E6M A;  1JT0 A;  3DEW A;  2DA1 A;  4ETS A;  3OYC A;  1VQ9 I;  4ZZD A;  1YHQ I;  4YRV A;  2EBI A;  4I0A A;  1MKM A;  1RC9 A;  4KA4 A;  1A6I A;  1IRX A;  4HPQ A;  4A5M A;  4Y52 J;  1ZLJ A;  2JVG A;  3GCM A;  2XAG A;  2K86 A;  4BHC A;  2LY9 A;  1S5L C;  3HHG A;  5CLS A;  2M4K A;  5L3G A;  3GTP J;  4LLL A;  1PYV A;  2JSC A;  4ITV A;  3B73 A;  1SFX A;  1F43 A;  1BM9 A;  5EEH A;  3MZH A;  1BR2 A;  1HF0 A;  3C2H A;  4OOI A;  1UHS A;  1Z3Y A;  2EA2 A;  3RJP A;  3OY9 A;  2OTJ I;  3S1Q J;  3DKW A;  5K1Y A;  3GTL J;  2MA3 A;  2MC3 A;  4B43 A;  2ECC A;  1BL0 A;  4RBO A;  2IA0 A;  2R4G A;  4HEA 2;  2DAO A;  4FAS D;  3OR2 C;  2HVS A;  4CCN A;  3BWG A;  3WTW C;  3Q0V A;  5D8K B;  2LLK A;  3F6O A;  1R00 A;  2ZFW A;  3KYC B;  3KEY A;  2AXL A;  2IXS A;  5LGN A;  5EGO A;  3C1D A;  3IP4 B;  4G94 A;  2GM4 A;  2YUS A;  3CQZ J;  4BY1 J;  1MBE A;  2JRM A;  3M8J A;  3J81 Z;  2HOE A;  2WAQ N;  4BEH B;  3SEZ A;  3V8J A;  2XGX A;  1SFU A;  4R8H A;  3OS2 A;  2M9H A;  2NS0 A;  2KPM A;  2LRE A;  4RAF A;  3HJE A;  3LSI A;  5F08 A;  4M9X A;  1FX7 A;  5FKK A;  1UJ8 A;  4LMY A;  3FXR A;  2Y31 A;  2QQ8 A;  5DDG A;  1EH8 A;  3KLN A;  2JJ7 A;  3BR6 A;  2OA4 A;  1X4P A;  2CU7 A;  2HXO A;  1Y6I A;  2FOK A;  1B4A A;  2ELK A;  1O4X A;  3ABT A;  3EUA A;  1Z7L A;  3TQN A;  2MD5 A;  2ZO4 A;  4KMU X;  3SEQ A;  3LAJ A;  2JWT A;  4C2M J;  4A3G J;  4PJ0 C;  1Y1V J;  5K7F A;  3CC2 I;  2OD5 A;  3FXO A;  5DCM B;  2A6H F;  4QIW N;  3JRH A;  2P4W A;  3F22 A;  1LB2 A;  3JRF A;  1Y0N A;  2V1N A;  4D5C A;  2XVC A;  3GBG A;  5B66 C;  1H8A C;  2EPF A;  2QGU A;  5D5V B;  3AAF A;  1WSU A;  2QBY B;  3ERM A;  2LD5 A;  2UXN A;  1X4O A;  1TT5 B;  3P9I A;  2UWM A;  4FCY A;  3KLO A;  3K4B A;  1HQC A;  2VKH A;  4FIS A;  2L2O A;  1YI2 I;  2UUZ A;  5HLG A;  1Y8Q B;  2VLA A;  4RDU A;  3NEU A;  4XKV A;  2LK2 A;  2KIM A;  3K4L A;  1LEB A;  3VYS B;  1SMT A;  2X1C A;  3HRT A;  3WOD F;  5FLV A;  2X6W A;  3K1N A;  4L5I A;  2V1U A;  1WJC A;  3T8T A;  1AU7 A;  4A0Z A;  4RAZ A;  4P9F A;  4TV7 A;  4ZH4 F;  2QSG X;  4XMY A;  3S1N J;  4D1Q A;  5LGT A;  3E3V A;  4MQ9 F;  2VBZ A;  2G7H A;  5E18 F;  3QAH A;  5GPA A;  1I3Q J;  2M7A A;  1WH5 A;  1UHW A;  2DDB A;  4BXF A;  2P6T A;  3GFL A;  4HV6 A;  1KYZ A;  4DYC A;  1S7E A;  3HOT A;  1Z05 A;  2A5W A;  2BZT A;  2DJI A;  3QU3 A;  5FKL A;  5AIP A;  5M5Y J;  2HQN A;  2K3P A;  3BTL A;  4FE4 A;  2PI0 A;  4A3B J;  4XL9 A;  2M5W A;  3BZK A;  3MMY B;  4BQO A;  2FNP A;  5TRD A;  3QU6 A;  3ZCO A;  4U88 A;  1MBF A;  1P92 A;  2VXZ A;  2P8T A;  3I59 A;  2KLO A;  1XSD A;  5K7H A;  1TP4 A;  1W7P D;  2H6C A;  1YYV A;  3R61 A;  1K79 A;  3LSR A;  1DU0 A;  1VFC A;  4F3Q A;  1XMA A;  4I98 B;  1OJL A;  1YW7 A;  4DNC A;  5IPA A;  3OOU A;  4OMZ A;  3RKQ A;  1T0F C;  3PJR A;  4ZYH A;  3CME I;  1BIB A;  2X9D A;  2DA4 A;  1VQ8 I;  2KMU A;  3HUG A;  5EDN A;  3HXL A;  5L3B A;  2IJL A;  3GME A;  4LG0 A;  5KK1 A;  1NK3 P;  3BG9 A;  3FK7 A;  3K4M A;  2HTS A;  3HL2 A;  4O6J A;  2QKM B;  3LNQ A;  1APL C;  3BCA A;  2ZJ2 A;  3U9G A;  4MTD A;  3SFI A;  3GZN B;  5HDK A;  3JW4 A;  5B1A H;  5IT3 A;  3B6A A;  3FBI B;  3HTS B;  1LDJ A;  3H3U A;  4GFB A;  2VOD A;  3FXL A;  5E3M A;  3FBN B;  2JPC A;  5HS7 A;  2BOL A;  3QYB A;  5IP9 J;  4HOB A;  2Y48 A;  1EKE A;  3CUQ C;  1S3J A;  3KYL A;  3WU1 B;  3NQO A;  1T6S A;  1F9N A;  3MEX A;  2PJR B;  2KQR A;  3OWT A;  1R1T A;  1Z6R A;  4BAC A;  2ETH A;  5DS9 A;  3ABK H;  3DTK A;  3QOE A;  5E1X A;  1Z91 A;  4BJ5 C;  1VI0 A;  1ZG5 A;  4ANJ A;  5IT9 Z;  2EV0 A;  3HGY A;  3H9J A;  5CVI A;  4IHY A;  1R5G A;  2DYR H;  3TDZ C;  5HOD A;  4RAG A;  1DPR A;  2CH0 A;  2ZXH A;  3KIO A;  1LNW A;  3JSO A;  4L18 B;  1MW7 A;  4OU0 A;  5IOY A;  1P9Q C;  3QPT A;  4AIJ A; 
#chains in the Genus database with same CATH homology
 5CKT A;  4F55 A;  3OR1 C;  2R7W A;  3TL4 X;  2M0M A;  4RM2 A;  3A1Y A;  4KIS A;  1Z21 A;  2M7B A;  3OL3 A;  4LIT A;  2V4J C;  4XON A;  1UG0 A;  3S93 A;  5JHF A;  1WFX A;  2R7U A;  2HPI A;  4J01 A;  3HKZ A;  3K70 C;  2QKL B;  4NC8 A;  2BVL A;  4ZTJ A;  3DKY A;  5HNF A;  4II2 A;  4HSR A;  4QPQ A;  1E0E A;  4XNF A;  4BJ6 C;  3PSF A;  1QHG A;  4PJL A;  4P5O A;  3L2U A;  3IUO A;  4CH7 A;  2DCE A;  4J00 A;  3RCO A;  3OYN A;  4XOP A;  4XLH A;  4NQW B;  3CMM A;  1MMD A;  4Y3O A;  5HLT A;  4XLE A;  3OYH A;  1DP3 A;  4II3 A;  2BW3 B;  2KDO A;  1SAU A;  2AQF A;  3D5L A;  4DOZ A;  3G2B A;  1LKX A;  4Y4R A;  2XF7 A;  1U0J A;  1ZEL A;  2VQG A;  4F52 A;  3QYE A;  4E7J A;  2X51 A;  5FRN A;  2R7R A;  3A2K A;  2Z1D A;  3SYT A;  4KIT B;  3OS1 A;  2ZSH B;  4BE0 A;  3LSK A;  2PJR A;  1D0X A;  4ZJZ A;  3VYU B;  2P0W A;  2X6X A;  3FKJ A;  4HNT A;  1LFP A;  1S9H A;  4XKW A;  2VQL A;  2HNH A;  2OUM A;  4PSX A;  3VWB A;  3K70 D;  3H9Q A;  3VYR B;  4E7S A;  2FUG 2;  1V5E A;  4XOT A;  2IS4 A;  2L9S A;  3E1S A;  2L7K A;  5LFA A;  1DGW Y;  4R79 A;  1Z3X A;  3CP2 A;  3K10 A;  2XSJ C;  1G8X A;  4OAY A;  2CW7 A;  2X85 A;  2V6E A;  4G6T B;  2LY1 A;  4C9Y A;  3J7A Y;  2MAB A;  3BCB A;  2NOJ B;  3H35 A;  3MD2 A;  1LVK A;  3SDB A;  1PJR A;  1EA3 A;  3BG7 A;  2HU9 A;  4IQ4 A;  4RMN A;  2VKD A;  1X19 A;  3S8P A;  3K4N A;  1R6R A;  2E1M B;  4NNJ A;  2RRE A;  2ELJ A;  3OYE A;  2R7X A;  2KHM A;  2LG4 A;  3LMM A;  1GLN A;  2WAQ A;  2W82 A;  3CZ6 A;  2VQH A;  3HOS A;  4FET A;  3OIP A;  3L2V A;  4B47 A;  3W2V A;  4MLO A;  4BDZ A;  5CQG A;  4E4H A;  3CP8 A;  4OAZ A;  3MKZ A;  2LH9 A;  3S3N A;  4HST A;  1V5F A;  2VB6 A;  1DGR M;  2BW3 A;  4GRI A;  2HVR A;  4XR6 A;  3LSG A;  4LIV A;  4ZC3 A;  2KRC A;  5TGT A;  4HG2 A;  2RQQ A;  2WY8 Q;  4HRI A;  2ZSI B;  2HZD A;  4C30 A;  2WAE A;  3RQ4 A;  4E7K A;  4XKC A;  2E5N A;  3L2Q A;  2LRD A;  4ZDP A;  4H4K C;  1DQU A;  4JOM A;  4AU7 A;  4DIQ A;  3D5R C;  1N78 A;  2MD0 A;  3H5R A;  2RNG A;  1D1C A;  2CMP A;  3OL4 A;  3K4C A;  3ZQQ A;  3LSH A;  2CV2 A;  3AKZ A;  4BL0 B;  3DU5 A;  3LFU A;  2M4G A;  3NWS A;  2IGO A;  3A4C A;  4BE2 A;  3RPU D;  4HNU A;  2LC2 A;  3S3O A;  3FHN A;  1AA7 A;  2KRH A;  2XAU A;  1MMG A;  2MYS A;  3UNG C;  2WBM A;  2Z16 A;  3M1C A;  4CSW A;  1UEL B;  3MKW B;  4BGD A;  4BUP A;  3CJR B;  2X1E A;  4IQJ A;  2IGM A;  1G59 A;  3H0D A;  2VAS A;  2VJI A;  3H9G A;  2X1D A;  2CV1 A;  3AL0 B;  2HQA A;  4Y33 A;  1Y56 A;  4P1W A;  2GOX B;  4RLQ A;  4LIU A;  4N4O B;  2LOO A;  3VYT B;  2K5C A;  4PUS A;  3PSI A;  2XDV A;  3ZRG A;  2IS2 A;  2KP6 A;  4PK4 A;  2IGK A;  1BR1 A;  3OMY A;  5KHD A;  1WJB A;  4U87 A;  2Q1Z B;  1YE9 A;  2IGN A;  3E0J B;  2JUG A;  2VJJ A;  3DLA A;  2A6T A;  1WJA A;  2JVH A;  2WAD A;  4XLA A;  2DOA A;  2XC7 A;  1NG7 A;  2R7T A;  1WJE A;  3K4K A;  2V7F A;  4XN0 A;  1N77 A;  4DJA A;  3ZXS A;  4CZC A;  4BQN A;  1FMV A;  4YEJ A;  3DPT A;  3S3M A;  1TZL A;  4XLC A;  2K9L A;  4IKF A;  1D1B A;  3OYC A;  3EPZ A;  4XLF A;  3H5N A;  4YRV A;  1QU3 A;  3L2R A;  3UR3 C;  2LYC A;  1IRX A;  2HDW A;  3QOD A;  3LSM A;  4HPQ A;  2JVG A;  4E6K G;  2WB1 A;  2XF5 A;  2R7V A;  4KJZ A;  2WY7 Q;  4ZTF A;  2L9N A;  2M4K A;  3PNY A;  1PYV A;  4JQF A;  4ITV A;  3DU6 A;  4F91 B;  2V9K A;  1BR2 A;  3OYD A;  3OYF A;  4BJT A;  1N75 A;  3C2H A;  3OYM A;  4AYB A;  5HNH A;  2R7O A;  1Z3Y A;  3OY9 A;  4BU2 A;  4X0G A;  4OWR B;  4ZYA A;  3HPG A;  2Q2E B;  1TT0 A;  1V5G A;  3AFH A;  3L2W A;  2ZXI A;  4B43 A;  4DBQ A;  5CQE A;  3OYI A;  1KON A;  3W2A A;  2AQE A;  4XOR A;  3OYJ A;  1D1A A;  2R4G A;  4HEA 2;  3V42 A;  3TMO A;  4FAS D;  3OR2 C;  2BVM A;  2HVS A;  2E1M C;  3HC7 A;  4XKB A;  3VSL A;  4CCN A;  4EAT A;  4E7Z A;  4IX7 A;  4BDY A;  1ERD A;  2L5Q A;  1VZ0 A;  2VJ4 A;  4DGW B;  3S32 A;  4CCO A;  3KEY A;  4PSW A;  3OYK A;  2IXS A;  4E7L A;  3IP4 B;  2CW8 A;  3M8J A;  3BC8 A;  4CCK A;  4BEH B;  2LBF B;  3SEZ A;  4CCM A;  4DBR A;  4BE1 A;  3OS2 A;  1X1B A;  2KPM A;  2LRE A;  4PFP A;  2E60 A;  3LSI A;  4PFO A;  4B44 A;  4PJN A;  2GOM A;  2Y0S A;  1NG6 A;  3ZR8 X;  4XM3 A;  1W36 D;  3DTE A;  2CUZ A;  1X4P A;  1K6Y A;  1YX5 A;  1Y6I A;  5HVQ C;  4AVZ A;  2JSP A;  2VXD A;  3RTR A;  3U21 A;  3K4J A;  1FMW A;  3OS0 A;  2XF6 A;  3EUA A;  4RLF A;  1Z7L A;  3I9V 2;  4ZDL A;  3SEQ A;  3DWL E;  1OLT A;  2R7Q A;  2F6C A;  3DEE A;  3DPU A;  2WAF A;  5HOO A;  2M3A A;  4PJM A;  4ZDO A;  2V1N A;  3GBG A;  3HG9 A;  4LG3 A;  3ZGK A;  1OR7 C;  3I3L A;  3TBI A;  3DTI A;  3PUB A;  1X4O A;  2UWM A;  3W2W A;  1JI8 A;  1SFK A;  1J09 A;  4N4N B;  1QHH D;  3C2G A;  5FRM A;  2DXI A;  1X1D A;  3K4B A;  2VKH A;  2ZFU A;  1D0Z A;  2L2O A;  3DPL C;  3IAM 2;  3BLY A;  3N05 A;  2KZV A;  2UUZ A;  3AL0 C;  1LDK B;  2VLA A;  3H5A A;  4U7B A;  3HUG B;  4XKV A;  1YX3 A;  1BOB A;  4F92 B;  3K4L A;  3VYS B;  2X1C A;  1MMA A;  3MKY B;  4NUB A;  2X6W A;  3PNT A;  1WJC A;  3ONQ A;  5KNL A;  1MND A;  4CCJ A;  2HPM A;  1T95 A;  2W7N A;  2OC6 A;  2LBF A;  2JA2 A;  2VIX A;  4BEH A;  2W00 A;  1X1A A;  2IS6 A;  2VQC A;  3CF2 A;  4XMY A;  4D1Q A;  3CJQ B;  4CA0 A;  5KCM A;  2M7A A;  4BXF A;  2MFZ A;  4B48 A;  3OYG A;  3W3C A;  3HOT A;  2HVQ A;  4C2U A;  2A5W A;  2DJI A;  3FDY A;  3OYA A;  3NWT A;  3K6G A;  3EUK L;  3PNV A;  3OYL A;  1W36 C;  2K3P A;  4B3X A;  4KT6 A;  4XL9 A;  3VDX A;  4XQF A;  3MMY B;  4BQO A;  3ZCO A;  2CFO A;  3CES A;  2VXZ A;  2KLO A;  3PL8 A;  4NC7 A;  4F93 B;  2W1O A;  3QYF A;  2W4S A;  4F3Q A;  2MC4 A;  2Z2S B;  4E7I A;  2OV7 A;  3DQV C;  1WJD A;  4C2T A;  3PFY A;  3OOU A;  1WJF A;  2V26 A;  1T0F C;  5FRO A;  3HPH A;  3RSN A;  3PJR A;  2KMU A;  2KL4 A;  4RM3 A;  3HXL A;  3F9K A;  1WJ5 A;  3DKX A;  3SZG A;  4BQQ A;  4BS9 A;  2I8D A;  3K4M A;  2VJ5 A;  2K9M A;  3HL2 A;  2QKM B;  2CUJ A;  2LY2 A;  3BCA A;  3OIQ A;  4PJJ A;  1HA8 A;  2UV1 A;  1D0Y A;  3FBI B;  1MMN A;  2O5R A;  3VSK A;  3FBN B;  2IS1 A;  2BOL A;  3QYB A;  3KYL A;  3BG6 A;  3LL7 A;  2DT7 B;  2X6Y A;  3D5S C;  2PJR B;  2KQR A;  3OWT A;  4QPO A;  2CV0 A;  2E5Z A;  3KX2 A;  2F5V A;  2PMZ A;  1BR4 A;  4BAC A;  5LD2 C;  3IAS 2;  2VPL A;  3DTK A;  4IZZ A;  3QOE A;  2R7S A;  2VL8 A;  4D9J A;  1X1C A;  4BJ5 C;  4XN3 A;  4YEL A;  2WA0 A;  2CS3 A;  2F4I A;  4ANJ A;  3H9J A;  1MNE A;  2DT6 A;  3EUH C;  4CUG A;  1UAA A;  3OYB A;  4CCL A;  2CH0 A;  2ZXH A;  5CPR B;  1MW7 A;  1P9Q C;  4E7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...