2DMTA

Solution structure of the homeobox domain of homeobox protein barh-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
GSSGSSGGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein BarH-like 1
publication title Solution structure of the homeobox domain of Homeobox protein BarH-like 1
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmtA00
3PO2J 5K7HA 5J1UA 4IHXA 4A3GJ 2K40A 2LK2A 5IP9J 3M4OJ 3QPLA 2DTZA 2EZKA 3JRBA 2JWTA 5J1YA 4A3LJ 2OF7A 3OSGA 3IH3A 3JREA 4NDLA 3A01A 5FKNA 4D7NA 1WCMJ 1HDPA 2CJJA 1IRZA 2QF7A 1ZGWA 2JA8J 1OJLA 4DW6A 2HXOA 1IDYA 3LSJA 2P81A 4QTRA 1MBGA 2WAQN 3Q3SA 1FEXA 1IJWC 2LKXA 3K2AA 3HM5A 5IP7J 1IC8A 4C3JJ 3GTPJ 1ETKA 2DA1A 4DZPA 3S2HJ 1WH7A 2FD5A 1JGGA 2HOAA 4S0HB 3QPSA 4MO7A 3NAUA 1I3QJ 1TWGJ 3G1OA 4CYCB 2HXIA 2R5YA 4AYBN 1U9OA 4Y7NJ 4L5EA 1TWHJ 1ITYA 1OCPA 3BR6A 4M3BA 4RBOA 2DMPA 2DA6A 3GTOJ 3S14J 2ECBA 2L9RA 1OCTC 3LNQA 5F0HA 2E2JJ 4IHVA 1JT6A 1ORKA 1A6IA 2XGCA 1BW5A 2L7MP 2ZB9A 1WPKA 2DA4A 5F0CA 5F27A 5HODA 3JRFA 1LFUP 1B8IB 2LFBA 3BR2A 5EEAA 3I4NJ 1QVTA 3A02A 5EG0B 1F36A 3S1QJ 2LVSA 2ELKA 1MBHA 3PM1A 3HKZN 2EH3A 1TWFJ 2CQXA 4A93J 5GPCA 1NK2P 3BQYA 4FISA 3S1RJ 1OFCX 3MN2A 3FISA 1JKRC 4FTHA 2MW8A 5J3LA 1IG7A 3B6AA 3MKLA 3ZQLA 5FLMJ 4GFBA 4G12A 2AHQA 3G1LA 2COBA 4X6AJ 3A01B 3IV5A 2O9LA 2MSYA 4MFEA 1FIPA 4I6ZA 4M3FA 4BBSJ 2EZHA 5M5XJ 5F08A 3SDGA 2XPWA 1X58A 2ECCA 3O8HA 2K9SA 3Q0VA 2EBIA 5IOYA 2HDDA 2DMNA 2HI3A 1WI3A 4RDUA 2I10A 1HOMA 1ENHA 1BJZA 3I4MJ 2VKVA 1ETQA 3CCYA 1FTTA 2PMZN 1K83J 2JJ7A 2MG4A 3IH4A 3LSGA 1PUFA 2JA6J 4A3CJ 4A3MJ 5EZGA 2L7ZA 4DZJA 2R5YB 2X6OA 5IPAA 3GBGA 4BY7J 2DA3A 4M6VA 1LFBA 3S2DJ 1RESA 1X2NA 2K9NA 2R0QC 1LE8A 2DA2A 4Y52J 1YRNA 4JX4A 4DYRA 1RETA 2L7FP 2CQQA 2DA7A 4V2FA 5EGOA 4C3IJ 3HOVJ 2JA7J 2VI6A 5E3LA 3JRCA 4MLOA 2CRGA 3H0GJ 3HOWJ 5EF6A 3OSFA 3TP0A 4V2GA 2XPVA 4BXXJ 1QPIA 3CMYA 2M34A 1W0UA 1MSFC 3L1PA 2R92J 2FJ1A 3HEFA 4DYCA 3TP3A 3RZOJ 1GVDA 3E7LA 5M5WJ 1HDDC 3BT9A 1SFOJ 2CUEA 2GLOA 4IHYA 1H89C 1DU6A 1IDZA 2IEKA 4A3BJ 5M5YJ 2DMTA 2X48A 3VPRA 1F43A 2LD5A 3FIWA 1ZTRA 4XK4A 3C2BA 1BW6A 3CQZJ 2H8RA 2YU9J 3JR9A 1JUMA 3GTKJ 4IEJA 2LLKA 3ZOBA 1A5JA 2R93J 1WGXA 3BR5A 5FKMA 2R7ZJ 3F0CA 3RZDJ 4W97A 5J1RA 4BKXA 1PUFB 2HOSA 1VI0A 1U8BA 3FKIJ 1MBKA 1HLVA 3D1NI 2ME0A 3JRGA 4JYKA 2H1KA 3UKGA 2M0CA 3Q0UA 3LSRA 3HB9A 2E19A 2FQ4A 1JJ6C 2ID6A 2X9DA 1LE8B 1GV2A 4LOCA 5C3EJ 3HOYJ 1JUSA 1YRNB 2TCTA 2B63J 2GBYA 5E3OA 3RKQA 2DMQA 1MH4A 9ANTA 4XICA 5EZHA 5IYDJ 2Y9YA 3GTMJ 4IHWA 5EGOB 2E1OA 4JX6A 4MIMA 2JMWA 3JRAA 1P7JA 4DYQA 4XIDA 5M3FJ 3HBLA 3Q0WA 5F1JA 1H8AC 1MBJA 1AHDP 4W1UA 3BG5A 4M3GA 1E3OC 3MVPA 4EEFG 3BR3A 3HOXJ 3ZQFA 1VFCA 4A3JJ 5E3MA 2R5ZA 2Y2ZA 2Y31A 4B3AA 3FK7A 2NVQJ 1O4XA 3S1MJ 5EDNA 2ID3A 3IH2A 3ZQGA 1FTZA 1MNMC 1POGA 2NVYJ 1UHSA 1SANA 5DTDA 4UUSA 4FCYA 2AO9A 5FLVA 2W48A 4CYCA 3WHCA 1T33A 2JA5J 2CU7A 1ETYA 5FKKA 5C4JJ 3ZQHA 1UG2A 1QVUA 3S17J 1TWAJ 2VKEA 1ETOA 1K61A 3PO3J 2Y30A 3BTCA 4MFDA 4B4CA 1GUUA 4C3HJ 1HCRA 3BR0A 4UUTA 4D7MA 2E2IJ 2L0KA 3HGGA 5F0FA 1S7EA 2VUMJ 1MH3A 1B72A 4JX5A 2DA5A 5FKLA 1HF0A 1ZKGA 1RPWA 1JJ8C 5DS9A 4QIWN 2EZIA 4C2MJ 3CDLA 2NVTJ 1RKWA 2G0EA 2O8KA 4D5CA 3BTIA 1Y1WJ 3DCFA 3DEWA 4QSHA 1NK3P 3GTLJ 2VPRA 1IV6A 2QCOA 3K7AJ 2LP0A 1D5YA 3S1NJ 2FX0A 1H88C 3OIOA 1ZK8A 5M3MJ 3WHBA 4I76A 4AUXA 1FJLA 5K7ZA 2DMUA 2XB5A 2LTPA 5FJ8J 1APLC 2DJNA 2N8GA 5EYRA 2YS9A 1JTYA 2K9QA 3GTQJ 3ZQCA 3HOZJ 1ZQ3P 1XG1A 2R5ZB 2NS7A 2M9HA 2NOGA 5GP9A 4FE7A 1BL0A 5E3NA 5K7FA 3HOUJ 3FK6A 4D5FA 3JRIA 3S15J 1MBFA 1AKHA 1ZR2A 2NS8A 2IAIA 2JK3A 2XB0X 1ETXA 2JN6A 5BNGA 5IP6A 4UUSB 5F04A 1RR7A 1VNDA 1UMQA 3BG3A 3JRDA 1JKOC 1IGNA 1I50J 4FE4A 4M3EA 4A3KJ 1P7IA 1GV5A 2WB1N 3S16J 2YUSA 1ETWA 1TWCJ 3HDDA 1XC5A 1IUFA 1JUPA 1T56A 4XRSG 1Q1VA 3SJMA 2CUFA 3OOUA 3NARA 2D5VA 1U78A 2HYJA 4M3DA 1MSEC 5C44J 1ZR4A 2ME6A 2EQRA 2HOTA 3G1MA 1B72B 2WV1A 3BG9A 1DU0A 2E2HJ 1JKPC 2TRTA 5IOZA 3O8GA 4BY1J 1Y1VJ 3BTLA 1X2MA 1Z0XA 1VF9A 1G2HA 4A3DJ 4ABZA 3RQIA 1U9NA 5JLWA 1FIAA 1NTCA 2KT0A 3BR1A 1W0TA 2HQ5A 1XS9A 1AU7A 2XGEA 2Y9ZA 3TEDA 2XPUA 4XRMA 3JRHA 1GT0C 1MBEA 4A3IJ 3LSPA 1JKQC 1BA5A 2M2EA 5FKOA 1Z77A 2OPTA 2LY9A 5JLXA 2LR8A 5IYCJ 1QRYA 2O7OA 3QQAA 1GDTA 2DN0A 2EZLA 4B1RA 2KDZA 3TW6A 4XRSA 2XRLA 2RAEA 3M3YJ 4A3FJ 1JTXA 5IYBJ 4JP0A 4A69C 1I6HJ 3A03A 3BQZA 1AKHB 3W6VA 3BTJA 2GM4A 1WH5A 2MGQA 2NVXJ 3HGYA 3B6CA 4HNVA 4BBRJ 1R9TJ 5C4XJ 1TC3C 4A3EJ 3ZQIA 1B8IA 4X1EA 2XSDC 1RKTA 5EG0A 4AC0A 3GTJJ 3SFIA 1CQTA 2XGDA 3GTGJ 2M8GX 2Y0SN 2IBDA 3H3VK 4J19A 1JT0A 1EF4A 5GPAA 1ETVA 3TW7A 3LOCA
chains in the Genus database with same CATH superfamily
2IPQX 3KX2A 4MEXF 2ZJPF 4YIIA 2WC2A 1XPXA 3L9FA 4NQWB 4KT5C 3KLNA 4OAZA 2C6YA 2IS4A 3FDYA 3CCJI 2DAOA 1TT0A 3KETA 5J1YA 3OSGA 1ZG1A 2M5WA 3K4KA 3JREA 1WQ2A 5FROA 1KQ8A 4HX8A 4NDLA 4RB2C 2VBZA 2AQEA 3DPTA 2WAFA 1WJFA 4Y15A 2X85A 1VQMI 2ESNA 2YU3A 1DPUA 2QF7A 4KA4A 2JA8J 3KZIC 5L3DA 2HXOA 4DW6A 1TW3A 2IA0A 2B0LA 2P81A 2IS2A 2WAQN 2FRHA 2W84A 1BN5A 1IJWC 4CZCA 3LQQA 1G6NA 1IC8A 2P7VB 1S8NA 3IKVA 1KQ9A 2R7QA 4EJWA 4I98B 4KN4X 1TQIA 3BJAA 2FD5A 2QA4I 1JGGA 4ESJA 2JRMA 3JAMK 3NAUA 1I3QJ 3TOBA 1HBXG 4ZJZA 3H0DA 1W36C 3DKYA 3GZ6A 4KMUX 1XGMA 2OQRA 1P4XA 3G71I 3K6GA 5LEKA 1OCRH 1RUOA 1SEUA 4L5EA 4HV6A 2KPMA 4Y4RA 2DQRA 3I55I 1ITYA 4M3BA 4BL0B 4PZJA 2DPUA 3ZN1A 1W7PA 2MC3A 2ZO4A 4PJJA 2UV1A 3HOTA 3JAMZ 3AL0B 5F0HA 1R4MB 5DD8A 1A6IA 3OR2C 1D1AA 3FMQA 2L7MP 1LFUP 2DA4A 5HODA 1Y6IA 3R0JA 3Q9VA 1FP1D 3F21A 2K9MA 2HPIA 3A02A 3CC2I 2XF7A 2J5OA 1RNLA 5L3BA 2MBFA 2PLYA 4KITB 1T98A 1VQ7I 3HKZN 1U8RA 2E7XA 1R1VA 4A93J 4GCVA 3PUFA 1T0FA 2M8EA 2QSGX 2XAGA 2E35A 1QBJA 1OFCX 2OCEA 3FF5A 5BS6A 3FISA 4BUPA 2XVCA 5J3LA 1IG7A 1ULYA 3GZNB 2W1OA 4GFBA 2IA2A 4G12A 3BG7A 2ZCWA 1Z3XA 2COBA 3HUGA 4M72A 5B1BH 2O9LA 4IVNA 1BR2A 2MSYA 4MFEA 3FXRA 1PVEA 3PSIA 4BBSJ 2HYGD 2L01A 3CJQB 3OYFA 1D0YA 2JQ7A 2IGKA 2V1NA 3HRMA 3VOEA 1X58A 2CH0A 2ECCA 2K9SA 3Q0VA 3A4CA 2HDDA 4AU7A 4M6XA 3CO7C 2YX7A 1B4AA 1HOMA 3BWGA 3QYBA 1ETQA 2HPMA 2RREA 2BXZA 5TGTA 3GVAA 3OMYA 2JJ7A 1QO0D 5EZGA 3WU0A 2FE3A 1MNDA 2X1CA 3G73A 4UVBA 5BOXA 1EJ9A 2ADUA 2V9VA 2HFHA 1W7PB 4NBQA 2GA2A 3SXYA 2JZYA 1YRNA 1MIJA 3V7RA 1XMKA 1QHHD 2DA7A 1SD6A 4LITA 4V2FA 3HRTA 1XMAA 2COMA 3WE3A 5E3LA 2XKOA 1K6YA 1ODDA 3HOWJ 2R4GA 4D1QA 3OSFA 2WAQA 4LLGF 2XPVA 3MCZA 2JT1A 1W0UA 2FBKA 4PGHA 2K5CA 2FF4A 4U0VA 3HSFA 2VQGA 2FJ1A 5GAEJ 4G8XA 4MTDA 1Y39A 3SQNA 4S05A 1PUEE 3E7LA 3K4NA 1YYVA 3LL7A 3C7JA 4ZZLA 4BACA 1WI9A 2A3SA 4QWQA 5L3CA 1FNNA 4EM1A 3HUGB 2HEOA 3HTSB 5CPRB 1OLTA 3FIWA 1XSXA 4XK4A 4A2UA 1D0XA 4B48A 3TQNA 1MMGA 2KMUA 1CF7A 3ZOBA 3TBIA 3ZP5A 4XQFA 1WGXA 1OR7C 1JI8A 2CQ7A 4ZTJA 4PFOA 4W97A 1O7FA 3TOAA 5DD4A 1IZ1A 4BKXA 5LGNA 2M7AA 1B9NA 1YITI 2Y75A 3HKZA 1MBKA 2DODA 3D0SA 2NXNB 4XKVA 1X4OA 4C9YA 5K5QA 3PFIA 4E7LA 3BOQA 3LSRA 2FQ4A 1JJ6C 3V7CA 3CD6I 4LOCA 3HOYJ 1BI2A 4HDVA 1YRNB 2TCTA 2LYCA 4L9NA 5GTHC 2LOOA 2DMQA 1MH4A 5E3OA 9ANTA 4M9SA 1QZYA 4BJTA 1T8IA 3BCAA 3O6BB 4A6DA 5CQEA 3K2ZA 4RGXA 1PYVA 3I3LA 2HQAA 3OOPA 4ZYHA 3JTGA 2DI3A 2BV6A 4JX6A 5ILUA 1R49A 2FNPA 4PUSA 3ULQB 4IHTA 1E0EA 2H09A 2XAFA 4DYQA 3IWZA 3W2AA 3Q0WA 1WSUA 3I9V2 2NAZA 3CP8A 1H8AC 3WTSC 1AHDP 3FXLA 2CUJA 4W1UA 4M3GA 1VQOI 4B44A 1YHQI 3F22A 4ANJA 1X3WB 2O5RA 2VASA 2ZFWA 2Y2ZA 3FK7A 3S1MJ 1G8XA 3J7YJ 3DTIA 1LDDA 1LEBA 2W25A 1MNMC 1POGA 2NVYJ 2DOEA 4AWXB 5CQGA 4KDPA 2FMLA 1MGTA 4HOBA 4YRVA 4CYCA 3WHCA 3DBHB 1P9QC 2V1XA 3FBNB 4XOPA 4PJNA 3HZJA 3ZQHA 2BY1A 1QVUA 1UB9A 1ETOA 3ABTA 4FX0A 1CF7B 1Z91A 2OQGA 4MFDA 3ZQ7A 4LGWA 3PUBA 2K9LA 2M7BA 2KQRA 4UB8C 3V7SA 1BBYA 4H4KC 4HRIA 1SMYF 2KISA 3ROUA 5J47A 4XLHA 4BJ5C 1OCCH 1G3WA 3J7ZI 1S7EA 3VYUB 3N97A 2VUMJ 1B72A 4G6TB 4JX5A 1IO2A 5DCMA 5ICFA 5FKLA 1HF0A 2CO5A 6PAXA 4MEYF 4G7OF 2X4HA 1N78A 1NH3A 1LDJA 3I5UA 2NVTJ 2VIXA 4D5CA 1R1TA 1BI0A 3MZHA 3KYCB 4EGYA 1ZRCA 4QSHA 5H20A 3VSLA 2VPRA 4KJZA 1Z05A 2QUFA 2QCOA 4XOTA 2XRNA 3K7AJ 3HRSA 1ONVA 3B73A 2L02A 1L3LA 1H88C 3OIOA 1ZK8A 2P6TA 4LK1F 2VQCA 3KP4A 4I76A 4AUXA 2Q8KA 2DU9A 4M74A 1S7OA 4L9TA 3L2VA 3BPVA 5CVVA 2Z16A 4U88A 2VT2A 3MKYB 1FPQA 2YS9A 2PJPA 3HOZJ 3VYSB 4XSXF 1S3JA 1K4SA 1ZAOA 2CFOA 4F93B 1X1PA 3CP2A 3DFGA 4F7ZA 1MBFA 3S15J 3CC4I 4E7KA 2F4OB 2JK3A 3HOSA 1Z7LA 2JN6A 5F04A 1VNDA 1R5ID 2UXXA 2BYVE 1I50J 1YO5C 3ERMA 4N9HA 4M3EA 1TP4A 2H1LA 4A3KJ 1V54H 4OIOF 1OYYA 3CF5F 3S16J 2IGMA 4C2UA 1YS6A 2MLGA 3OYDA 3HDDA 2DLLA 1XC5A 2K4JA 4I2OA 1OISA 2P5VA 4JK1X 3SFZA 2BY3A 4DJAA 1T56A 3K69A 3DP7A 2CUFA 3NQOA 3NARA 2D1VA 2OD5A 3ISPA 3H5AA 1S72I 4KFCA 5K1YA 1NG6A 3K9TA 2W7NA 3CJTB 2HOTA 3G1MA 1B72B 4DBRA 2WV1A 3F8CA 1SAXA 1DU0A 1JKPC 2TRTA 2KZVA 5DCMB 5E8GA 4BY1J 3BTLA 4CUGA 3CF2A 3HG9A 2LNBA 2KIMA 1FIAA 1X1DA 3A2KA 3KEOA 4LFUA 1OPCA 1AU7A 4B47A 2XGEA 2Y9ZA 2HTJA 2XPUA 1R7JA 1PP7U 3CMAI 1VQ9I 2PG4A 1B59A 2JA2A 1MBEA 1X1CA 2FMYA 5ERIA 1QA6A 2ZNYA 3OIPA 3P7NA 1HW2A 1JKQC 4Y13A 1GXPA 4OIPF 2R3SA 3RPQA 2OPTA 3O2PE 3I4PA 4L5IA 3P9IA 2H8WA 3PQKA 1QRYA 1GDTA 2DN0A 4AIHA 4IPAA 3OS1A 5KHDA 2QSFX 1TW2A 2RAEA 1ZLJA 1XCVA 3QOEA 5DEQA 5BPDA 3M3YJ 4HF2A 2XAQA 3S32A 2P5LC 3ZGKA 3DTKA 1QU3A 4K2EA 1DDNA 3BQZA 4CCNA 3ZMUA 4ZH4F 2GIZA 2W4SA 3MKWB 1G3YA 2GM4A 3B6CA 2GXGA 4BBRJ 2HVSA 5C4XJ 2Z5UA 2CMPA 3CESA 3W2WA 2LC2A 4NHJA 2QGUA 5E17F 2M87A 4V19K 1WHUA 2OJED 5EG0A 1VQNI 3GTJJ 3SFIA 4XNFA 2XGDA 3GTGJ 4YFKF 2D1HA 1XDUA 3HTUA 4ETSA 2MYSA 1EF4A 1KU2A 4QPQA 4HSRA 5JVTA 4X0GA 4HYEA 5K7HA 5LLQA 4IHXA 4A3GJ 1I1SA 3M4OJ 3E3VA 1DP3A 3KPHA 4XKCA 3JRBA 2DCEA 2OF7A 3ABMH 3EUKL 1FWZA 3G3ZA 4D7NA 5E1ZB 1J7KA 4UNOA 1W4MA 4F3QA 3FHZA 4I09A 1ZGWA 3BP8A 3I64A 2LG4A 1IW7F 1XGNA 2M3AA 4IL6C 4QTRA 4XORA 1ON2A 3Q3SA 1O3TA 3HM5A 3ZQQA 2KFDA 2GOXB 1MMAA 1ETKA 2V6EA 2K02A 4DZPA 3S2HJ 4OIQF 1S7AA 3KIOA 1BC8C 2OBPA 3F8FA 4UVAA 4WXHA 2VE9A 2CGPA 4S0HB 3QPSA 4MO7A 1BR4A 5E79C 4EJUA 4MQ9F 3W6JB 4KMFA 3BR6A 2ISYA 1LPQA 3GMEA 3S14J 1TQMA 2BBYA 2L9RA 1OCTC 2CWEA 1IUYA 2Y69H 1TBXA 4IHVA 2ZMEC 3MWMA 5ICGA 1I27A 3CCLI 3H9JA 4XKWA 3WGIA 1RRJA 1VQKI 5F0CA 5F27A 3RTRA 4G7ZF 4OU0A 3OR1C 4ZC3A 3EUHA 2AQFA 2NVUB 1WWXA 2ZSHB 1T95A 5EG0B 2OV7A 2LVSA 2EIMH 3OYHA 3PM1A 2BVLA 2CUZA 1TWFJ 2CQXA 3GYHX 4XM3A 3MMYB 2O8XA 3ECOA 1V5GA 4FISA 2CQKA 4ZYDA 3S1RJ 2A6HF 1KGSA 4CA0A 2IJLA 4FTHA 3OV8A 3H3UA 5J4VA 1YLFA 3ZQLA 3IHUA 4EJOA 2EJRA 2LKPA 1IN8A 1OR7A 2DOAA 2WY7Q 3FXUA 5KNLA 4E4HA 3LWFA 3IV5A 3DKXA 4ASNA 2E60A 4I6ZA 3BDDA 1UCRA 3CCSI 4Q5SF 2EIJH 2EZHA 4L9VA 2GQQA 3QPTA 3SDGA 2XPWA 1D1CA 3VWBA 4LMYA 4GO1A 2DMNA 3R61A 2X6YA 3DF8A 3U21A 1ZGJA 4F92B 3I4MJ 2KHMA 4OAYA 2VKVA 1IXRC 3M8EA 1FTTA 4CXFA 4GYGA 2PMZN 5HLIA 3FXQA 5CVRA 3IH4A 3HXLA 4A3CJ 4P9UA 5JR3A 5D4SA 1MJ9A 5J4YA 4XKBA 2DO7A 3RPUD 3HRUA 2X6OA 3T0YA 1AA7A 2CV0A 5LRRA 3HPGA 1TT5B 3KP5A 4BAYA 1Z3YA 5ILVA 1MMSA 1LFBA 3H1CA 3S2DJ 3CJNA 3FXOA 5D4RA 1DGRM 3KP6A 2DA2A 4JX4A 1H9TA 3WGHA 2RN7A 2GOMA 3BJ6A 2L7FP 3OS2A 1YOVB 2CQQA 3SEZA 1EV7A 5B3SH 2HVRA 3DU5A 2MLKA 1FX7A 5CKTA 4C3IJ 2KJCA 3K1MA 2JA7J 2VI6A 3JRCA 2FOKA 2CRGA 2E1CA 5EF6A 1V5FA 3H5RA 2P7CB 3E6BA 1TZLA 2HVQA 4YELA 2M34A 4NC6A 1FMWA 2R92J 1ERDA 2ESHA 3CJRB 3M8FA 1GVDA 2E1NA 2HOEA 4I01A 1HDDC 1YIOA 3VYTB 1YX3A 2Q0OA 1QGPA 3DLLF 4HLYA 1VQ6I 1DU6A 2KKOA 2DTRA 2Z99A 2DOFA 4XLEA 4A3BJ 4BE0A 2JPCA 3VPRA 1J9IA 2V9KA 3RYRA 3O3KA 3RYPA 2IW5A 1SD5A 1ZTRA 1P2FA 3SZPA 3JR9A 1UHWA 1Z9CA 2VC0A 2EFOA 4BHCA 2BVMA 3K4LA 1YG2A 1J59A 4QLCU 2PI0A 1GVJA 4RGUA 2EIKH 3OWTA 2LLKA 4NB5A 5B5EC 3OYGA 2W85A 3EYYA 1P92A 2V26A 3KE2A 2KDOA 3D5LA 4FQGA 3GZ5A 1BJAA 4L18B 1S29A 2HOSA 3M1EA 1U8BA 2VODA 1FMVA 5FO5A 2QLZA 1O3SA 1XMXA 3HSRA 3UKGA 5AIQA 3U1KA 1SFEA 2G7HA 3ONQA 2VKDA 2E19A 1LFPA 1WFXA 1GV2A 2FUG2 4BEHA 5J6XA 3ZPLA 1Y8QB 2FBHA 1XTAA 3WTTC 4N4OB 5ICCA 4RMNA 1USSA 5IY5H 4FASD 2Q1ZB 4IHWA 3QOPA 4HSTA 3M07A 3F3XA 1BOAA 2E5ZA 3JRAA 1P7JA 4XIDA 2F5DA 5M3FJ 2R7DA 3HBLA 5BMZA 4Y3OA 2HNHA 3SYTA 3H92A 5F1JA 1MBJA 2W00A 3RPUA 3SZGA 3BG5A 2L9VA 3FM3A 3MVPA 5LGTA 1E2XA 2A05A 2LF7A 2LSOA 1T08B 1LUJB 2VN2A 1WKMA 1X1BA 4BJ6C 4BXFA 2Y31A 4B3AA 4HLXA 4J00A 2NVQJ 4XLCA 1I1GA 2PMZA 1LDKB 4A0XA 4BXUA 5HNFA 5IT3A 2XAHA 5JVGF 4JBAA 3ZQGA 2ZJQF 2RQPA 2A5WA 2YR2A 5AONA 5EEHA 1OYIA 4AM3A 4EM2A 3I59A 3J7AY 3GLXA 4E7IA 1SANA 5DCFA 4UUSA 2DT5A 4HX7A 5KVRA 1LEAA 2AO9A 4HBLA 1XSDA 5FLVA 5H6RA 5FGMA 2VJ5A 1UHMA 2BEOA 3OYEA 2JA5J 4E7SA 3TKYA 4QPOA 5LHGA 5HS9A 3S17J 2DJIA 2QYOA 4XL9A 1U0JA 2ZXHA 3K1NA 3F23A 1A35A 3PO3J 2GXAA 5DM6F 4O3MA 4YFXF 2Y30A 2VLAA 2DK8A 2Z2SB 4WF2A 3HL2A 2VXDA 3CCVI 5F1RA 4LD5A 2O6GE 2DDAA 2HZDA 2DDBA 4LLNA 2EV0A 2HWVA 2IGNA 5GAGJ 2L0KA 4BGDA 4WCGA 1LKXA 3HGGA 5F0FA 2BW3A 4D0PA 1XDSA 4A5NA 4OWRB 1S5LC 4OIRF 1EH8A 1ZKGA 1RPWA 4QIWN 3W3CA 3CDLA 4OMZA 3WGGA 1F5TA 4BEHB 4AIKA 1FYLA 1N77A 2KRHA 1Y1WJ 3QU6A 3DEWA 4EMSA 1NK3P 1IV6A 4RAYA 2MA3A 3OYKA 2BE5F 2DFHA 2L2OA 3EUHC 4ITVA 3WTZA 2RNJA 1A04A 1FJLA 2FSWA 1QQIA 2E5NA 2WWYA 2OTJI 3K0LA 4CDGA 5FJ8J 3WU1B 3L00A 3I53A 1IV8A 5D8KB 3SZTA 2FOWA 2JSCA 5JHUA 3NWSA 2CSOA 2MABA 4N0BA 5CVJA 2BOLA 3ZQCA 2XROA 1ZQ3P 2VC1A 4A0ZA 4CZZA 3S93A 4G7HF 2M9HA 1BL0A 4FE7A 4DQ2A 2KIQA 3FK6A 2GAUA 3JRIA 4BDZA 1R71A 2EFNA 3E5QA 2QQAA 2RVCA 4BE1A 5HS7A 1ZHFA 3I59B 3E6CC 4UUSB 4AD9A 2UWMA 1UMQA 3BZCA 1R4NB 1P7IA 1J5YA 2WB1N 2L4MA 3K4BA 2YUSA 3S3NA 2VPLA 2L54A 3QP6A 4FHTA 3PNYA 4XMYA 3LSKA 3QWLA 4G94A 3SJMA 2YPRA 3IRRA 1TNSA 2P4WA 4U87A 1R00A 4RLQA 1I6XA 4IO9F 1TQPA 5IT9K 2STTA 3WTWC 2HU9A 1RUNA 2BW3B 3NRVA 2EQRA 2IP2A 3IP4B 3OYNA 2PMHA 3O8GA 1Y1VJ 4PFPA 5FFXA 2RGVA 1Z0XA 1VF9A 1W1WE 1FOYA 4CCKA 4DOZA 1G2HA 1FOWA 4M9XA 4ABZA 2XSJC 3OYJA 3BR1A 1VQPI 1W0TA 4OMYA 5IT9Z 1P4AA 1R1UA 1A31A 2H6BA 3DWLE 3J80K 4HQMA 3OYAA 3V8JA 3E5UA 4GYIA 2KIFA 4HX4A 3DPLC 1GT0C 1FOKA 4DBQA 2VJ4A 3LSPA 2GIVA 4BQOA 2XDVA 2ZMEA 3FXMA 2UZKA 2QEXI 2QKMB 2LY9A 2LR8A 4IRHA 3J80Z 4A6EA 5IYCJ 2VBWA 2O7OA 4B1RA 2STWA 3P9KA 1MDMA 2X1EA 4XRSA 3M1CA 1J2XA 1FT9A 3TL4X 4LIUA 5E20A 4A3FJ 1JTXA 5HS8A 1RZ4A 4YEJA 1EKEA 1KU9A 2FQ3A 3EQLF 1IN7A 2K4BA 3JW4A 1HC8A 2K7LA 4ESBA 3CCRI 2QM3A 3GFLA 4HNVA 4ZDPA 1R9TJ 3T1BA 3AFHA 1D3YA 2K85A 2Y0SA 4A3EJ 1YFHA 4LLLA 1HXDA 1W5CC 3E97A 1HA8A 2P5KA 2VL8A 4NC7A 1RKTA 1B1BA 4P96A 3PQJA 2F5VA 2M8GX 2IBDA 1JT0A 4EJVA 3IUOA 1K78A 1ETVA 3P5JA 4AVPA 2O61A 3LOCA 3GO5A 2X6WA 3CUOA 2R7SA 1SC7A 3PFYA 3RKWA 2K40A 2LK2A 2UUZA 5IP9J 4I7HA 3M7GA 3CMEI 3IAM2 2DTZA 4UV9A 3LSMA 1ZREA 2JWTA 4A3LJ 1JHFA 2QSHX 5KAIC 4IQJA 4HF0A 3WE2A 1ZYRF 2DK5A 3A01A 5FKNA 4MTEA 1PDNC 1I3AA 4LB5A 1OJLA 1IDYA 3LSJA 5D8LB 1DQUA 1Z6TA 4DIQA 1FEXA 3F6VA 2LKXA 3K2AA 4C3JJ 4XLFA 3IKTA 4ENJA 3IWFA 5D6FA 5LBQA 3KZYA 2WB1A 2VJJA 2ZMEB 2KLOA 4RB1A 2HQRA 1SVMA 3G6EI 1PJRA 1TWGJ 3G1OA 3KYLA 4CYCB 1VZ0A 3AKZA 2HXIA 4AYBN 1U9OA 2R7RA 1TWHJ 4P55A 3VYRB 4RBOA 1YQAA 3U9GA 3BJOA 3GTOJ 1KU7A 2VB6A 5KAFC 4L0ZB 1OCOH 3QU3A 3BC8A 3LNQA 1YE9A 3OL3A 4UXNA 2ISZA 3E6DA 1XSVA 2NOJB 2XASA 2HR3A 2XGCA 3PIPF 2HQNA 3PJRA 4KIGA 3JRFA 1YS7A 2LFBA 3GCMA 4Q4ZF 2ACJA 2NYXA 5EJCA 3BR2A 5E8IA 1IRFA 3I4NJ 4L9JA 1QVTA 4MNUA 3G4SI 1RIOH 1F36A 3S1QJ 2M0MA 4NNJA 1D8JA 3LQRA 3R4KA 1MBHA 3S3MA 1A6QA 2V7FA 3DBLB 1LB2A 2ZBKA 1IAWA 4CCLA 5GPCA 1NK2P 2M4GA 3SEQA 5HLTA 3DKWA 4WK8F 2LH9A 4RA2A 4JQFA 1JKRC 2L3DA 2Y48A 2XF6A 3B6AA 3KYDB 4NC8A 3MKLA 3U1DA 3R0AA 1KYWA 4RB3C 2HZTA 2L7KA 1SFUA 2VONA 4X6AJ 2PBIA 2DFEA 4U0WA 2OCCH 5D5VB 3A01B 1UFMA 2QVOA 4HEA2 5JI6A 4XRFA 1YTYA 4M3FA 3I54A 4I02A 2P0WA 4XLNF 5M5XJ 1ZG3A 1B6AA 2V1UA 4P1WA 4AIJA 4JOMA 2EBIA 2WADA 5IOYA 2LMDA 2D45A 2AXTC 2I10A 3GLLA 1V4RA 1T38A 5TISC 1ENHA 4BHBA 1BJZA 1XGSA 5EEGA 3ZMSA 4N9IA 4WXCA 4KNYA 2IA1A 3CCYA 1TL8A 2E1MB 5E1XA 1SD7A 1FYMA 1K83J 3ESWB 4L5JA 2JA6J 3LSGA 5DUKA 4A3MJ 2L7ZA 4DZJA 1QPMA 5IPAA 4GGGA 2A6EF 3GBGA 2PEXA 3VB2A 4BY7J 4M6VA 1UELB 2R7TA 2L9NA 3KFWX 2PN6A 3JSPA 3FXKA 1R58A 3RKXA 4Y52J 5ICEA 1RETA 3H5NA 2XGXA 2F5FA 3VFZA 3QRFF 3CDHA 3TO6A 3KLOA 1UAAA 3ZR8X 5EGOA 1JE8A 4C2TA 3HOVJ 1F9NA 2KRFA 2MC4A 3OYLA 5E18F 4MLOA 2YSRA 3K4CA 2Z3YA 3H0GJ 3I0TA 2NS0A 3C2HA 2MFZA 4V2GA 1Y56A 4HV5A 3BG6A 3C2GA 4CICA 4BXXJ 2L4AA 3C3WA 3CMYA 2KJBA 1MSFC 3L1PA 4BYYA 5LHHA 3JTHA 2FBIA 1Y8RB 4XR6A 1MKMA 3AG1H 1BC7C 4BQAA 3BZ6A 4RAFA 3KEQA 1D1BA 1IF1A 3PNTA 3BT9A 2OUMA 2JTVA 4S04A 2AS5F 3CC7I 1SFOJ 2CUEA 2WTEA 4GXOA 3ZMZA 5F64A 2WV0A 5CJ9A 4AYBA 1H89C 4IHYA 2IEKA 4WWCA 5M5YJ 3L2RA 1Z21A 2DMTA 3AG3H 4U0YA 2MH2A 1D5VA 2O0YA 3C2BA 3GFIA 1R5HA 2QZ8A 5HVQC 5LEJA 1MMNA 3CDIA 3D5RC 2NNNA 5FRNA 2PQ8A 1IDZA 4DNCA 1A5JA 4ZYGA 2R93J 2ELHA 4BDYA 4J01A 1DUXC 3BR5A 1TLHB 5FKMA 2R7ZJ 2TDXA 3MEXA 3PL8A 1I39A 4A0YA 5J1RA 3E1SA 5F6FA 1K6OA 2IGOA 1VI0A 3KP7A 3FKIJ 2XC7A 2DXIA 4EV0A 3KP2A 2F4MB 3JRGA 4JYKA 1GHCA 1V55H 2F2EA 2ELJA 4M71A 2M30A 3MFKA 3WG7H 2ID6A 1Y0NA 5C3EJ 3K70C 1JUSA 1K4TA 2GBYA 3RKQA 3CCQI 3LSHA 2O03A 4XICA 5EZHA 1HKSA 2VXZA 2XKPA 2Y9YA 3M9AA 4HNUA 5EGOB 2E1OA 4UV8A 4MIMA 3DBRB 3CCUI 3H35A 4KT6A 2JMWA 1U6GA 2BXYA 2CV2A 2VOPA 1USTA 2IVMA 5GTIC 5L3GA 5JFRA 2XF5A 2VT3A 2M45A 3HPHA 3ZRGA 1ZARA 1E3PA 1I5ZA 4UB6C 1M1EB 1E3OC 1IN5A 4HZFA 3JCUC 3P9CA 4EEFG 4A12A 3HOXJ 4O5VA 4A3JJ 1EH7A 1AOYA 1J09A 1ON1A 2IT0A 4G9YA 4UVCA 2LBFA 2R5ZA 1Z7UA 1SD4A 3TO7A 4ZYEA 1MW7A 2EK5A 5EDNA 1CGPA 3LSTA 2ID3A 3IH2A 1YI2I 4XN3A 3N4MA 3U2RA 1UHSA 5DTDA 4HNTA 3AAFA 4FCYA 1STZA 4AVZA 2EA4A 2LY2A 2RQQA 1LQ1A 1T33A 5CVUA 2BHZA 2CU7A 3A0BC 2DW4A 5C4JJ 1UG2A 2O3FA 3CUQC 1BIBA 3KP3A 1R6RA 2ZJ2A 3CMMA 4TV7A 3ML6A 1PP8F 1FYKA 1FLIA 4IJAA 2V1DA 1P6RA 2CW0F 1WJ5A 3BTCA 4C3HJ 1HCRA 4LJZF 2QBYA 4O6JA 2XHKA 4ZYAA 3BR0A 1J0RA 3ABKH 2E2IJ 1FBQA 2E1MC 2DT7B 3K4MA 5BPIA 5HLHA 3DQVC 5CLSA 2MH9A 1G3TA 2M4KA 1FOXA 4U7DA 4GRIA 2UXNA 1UZCA 1LJ9A 4IRGA 3E0JB 4EJTA 4HW0A 2WA0A 4HPQA 4BHPA 1JJ8C 4C2MJ 2G0EA 2I8DA 3EPZA 4HG2A 3DCFA 2IXSA 1LVAA 4MGRA 2LDUA 5L3EA 4MQVA 1IXSB 1WJBA 4Y17A 4F91B 2KIUA 1W5TA 5ILSA 1EA3A 4HDUA 1MJAA 2PMUA 1D5YA 2F48A 2FX0A 3S1NJ 3FXJA 5FRMA 3ASOH 5M3MJ 3ASNH 3KZZA 5K7ZA 3Q5FA 4ZZDA 1P4WA 2A69F 2DMUA 2XB5A 2JVGA 2LTPA 4Q47A 5H6QA 1WJDA 3COAC 1APLC 4ENNA 2DJNA 2A6TA 2FEZA 3H9GA 5EYRA 1L0OC 1ACIA 3T8RA 1MNEA 2E36A 1XG1A 2LBFB 2R5ZB 1KYZA 2NS7A 1FSHA 3L2UA 4F55A 5B66C 2NOGA 4NUBA 5D5XB 3HOUJ 3IC7A 2F4IA 3QAHA 3A0HC 1AKHA 2NS8A 2ZXWH 2R7FA 3V42A 5HOOA 2IAIA 1WJCA 1H0MA 1ETXA 5BNGA 1RR7A 4ON0A 1JKOC 2LF8A 4LK0F 3JRDA 4FE4A 4MHGA 3K1PA 5DUIA 1YW9A 3MZYA 3N05A 1ETWA 2ZNZA 3L09A 3GF2A 3OYIA 3L2CA 2QBYB 1RI7A 4XRSG 1Z1DA 1Q1VA 3OOUA 1KONA 3X2QH 2YX4A 2JRTA 2OTLI 4M3DA 4B43A 2ZSIB 4WX9A 5C44J 2LRDA 3WU2C 1ZR4A 2ME6A 1T39A 1U5TC 4P5OA 3FZVA 1TTYA 3DEUA 1RR8C 4ENMA 3QYEA 3BG9A 2W24A 5TJJA 2E2HJ 3OYMA 1U2WA 3LMMA 1ZRFA 3TDUC 3L2WA 1YJ9I 1O3QA 3VDXA 1UG0A 3WTYC 1IXCA 3FKJA 4A3DJ 3RQIA 1U9NA 1HSTA 2HQ5A 1XS9A 5DDGA 3R6SA 3J7AO 2I5UA 3TEDA 3G2BA 3VODA 3OIQA 4EQQA 3OYCA 5HDNA 4A3IJ 4DGWB 1LVKA 3IRQA 1Z77A 2V4JC 2EFWA 3ELKA 5JLXA 4CGZA 4EGZA 1WZ2A 1QZZA 3LAPA 4CCOA 2XRLA 4L0YB 3FWEA 3SDBA 3GXOA 4LIVA 4BQNA 4IOAF 3F8BA 3H36A 1K79A 2OZ6A 5IYBJ 2WAEA 4A5MA 4HF1A 2X1DA 4JP0A 3M8JA 3MZ8A 4A69C 1I6HJ 3ZMVA 3A03A 2XV4S 1LNWA 1AKHB 3W6VA 3BTJA 1XN7A 1WH5A 2LY1A 2MGQA 4R8HA 2NVXJ 2F5EA 3GFMA 4PSXA 1HW5A 1YJWI 3ZQIA 1B8IA 2EILH 5D6EA 1Y0UA 3TGNA 2GZWA 1JGSA 3ABLH 4PGGA 4FETA 3F6OA 4PDKA 4BS9A 2Y0SN 1HSJA 3H3VK 1T6SA 4J19A 1X4PA 5GPAA 3W2VA 3GEZA 2LREA 3LA7A 3PO2J 2OC6A 5J1UA 3HHGA 2VOOA 4C30A 3K70D 3QPLA 4HA8A 2EZKA 1HQCA 2FA5A 2DYSH 2V79A 3WG9A 3BY6A 2NRAC 4RS8A 4KICA 2R7XA 3FMRA 3IH3A 4GDFA 5LGUA 1FP2A 1JHHA 4CO8A 1WCMJ 4YFNF 4XLAA 1HDPA 2CJJA 4OOIA 2Z9OA 1IRZA 2HKXA 3RSNA 2JVHA 3WTXC 1VQ5I 2X0LA 1FBUA 2R7WA 1MBGA 2KP6A 2EA2A 3BROA 2ETHA 1Z67A 4E70A 2HYFA 2W82A 5IP7J 2A07F 2WY8Q 2L5QA 3GTPJ 3T8TA 1KZHA 2DA1A 1X3UA 5KK1A 1WH7A 3H9QA 3DTEA 2FNAA 2HOAA 4ENKA 2HGCA 4KISA 1ZELA 1WRJA 1N75A 5J8FA 4M6YA 2R5YA 4Y7NJ 4LG3A 4CCJA 4YIFA 3A1YA 1OCPA 2DMPA 1IRXA 2DA6A 3QYFA 1R23A 4EM0B 5LRSA 3GX4X 3QP5A 2G7UA 2ECBA 2HTSA 2KZGA 2E2JJ 1JT6A 1ORKA 3D5SC 3L7WA 5A2QK 2K27A 3GUDA 1BW5A 2X51A 5HDGA 4ESFA 1OKRA 1WPKA 2ZB9A 3R60A 1UJ8A 5HLGA 2H94A 1B8IB 4U7BA 4XSZF 2ICWG 3CO6C 5EEAA 1MJBA 1GXQA 3GFJA 2DT6A 2E34A 1BOBA 5J40A 3AL0C 3RCOA 2ELKA 5A2QZ 5B1AH 4IXAA 2EH3A 4RGRA 4ZDLA 2ZXJA 1H9GA 3BQYA 2V6CA 2JUGA 1XCBA 2VKHA 3TO9A 3LAJA 4E6KG 4FX4A 2LKSA 3MN2A 2EPFA 2MW8A 3S2WA 1D0ZA 1X19A 1E17A 1SFXA 4XONA 1OQYA 3IL2A 5FLMJ 4RM2A 3RDIA 2AHQA 3G1LA 1SFKA 4PK4A 3RI4A 4KIBA 3LFUA 1J75A 2BHYA 3KEYA 1FIPA 3OY9A 2GWRA 4WXDA 3EDPA 2KL4A 1V5EA 3ECHA 3HJEA 5F08A 2A5YB 3O8HA 4N4NB 2ZJRF 4BH9A 2HI3A 4M9ZA 1C0WA 1WI3A 4RDUA 1REPC 1VTNC 2GXBA 3DXJF 2CFXA 2WBMA 1B9MA 1SAUA 3HC7A 1MMDA 2MG4A 1PUFA 1HW1A 4Y33A 3WTUC 3BCBA 1O3RA 4UY8I 5TRDA 2R5YB 2M1BA 4OINF 1ZH5A 2QQ8A 1WVRA 1W36D 2Z33A 2DA3A 1QNTA 1RESA 5K5OA 1X2NA 2Q2EA 2K9NA 2R0QC 1LE8A 4IZZA 2RNGA 2A61A 2R7VA 4DYRA 5FD5A 3QPHA 1E3HA 1FBSA 2RV8A 4CSWA 2F5CA 4XLPF 3RQ4A 3WTVC 5L3FA 2HS5A 1OCZH 2EINH 4RGSA 2EB7A 3C1DA 5FLXK 1WJEA 3REOA 4IQ4A 3ZMTA 1X1AA 2OAZA 2CW7A 3CZ6A 3EETA 3BZKA 3TP0A 4IX7A 3GWZA 3H3ZA 4H0EA 2XAJA 4LG0A 3TMOA 4IRIA 2BGCA 1QPIA 2AXLA 4UUVA 3FMSA 5FLXZ 5DYMA 3CUQA 3HEFA 5AIPA 2QWWA 4DYCA 3TP3A 3RZOJ 5M5WJ 2DQLA 2QQ9A 4KN7X 1G4DA 3NEUA 2GLOA 3I71A 3LSIA 4HAMA 2PFBA 5HNHA 5H2FC 5ED4A 2X48A 1F1ZA 1F43A 2LD5A 3F8MA 3OYBA 2PX9A 1NHAA 1BW6A 3CQZJ 2H8RA 4E7ZA 5CYVA 1JUMA 2YU9J 1T0FC 1W5SA 1MDMB 2MD5A 2PJRA 3GTKJ 3CCMI 1G59A 4IEJA 1ZGAA 2IS6A 2DPDA 4G6QA 3T5XA 2Z1DA 1Z6RA 1ZRDA 4B3XA 2XIGA 3LA3A 3F72A 4PJMA 1WJAA 4BQQA 2IS1A 1RC9A 3F0CA 3RZDJ 1MD0A 1O7LA 3L2QA 2QENA 1PUFB 1KQ0A 3CTAA 1HLVA 4II3A 5K5RA 3D1NI 2ME0A 2W57A 1VQLI 3HIFA 2H1KA 2M0CA 1AWCA 3Q0UA 1YIJI 2K3PA 2D2WA 4B09A 3ZCOA 1YX5A 2Q2EB 3HB9A 2X9DA 2H27A 1LE8B 3PSFA 3ZXSA 4ZDOA 1K78B 2GA1A 1U3EM 2B63J 4RM3A 1MZBA 4B8XA 3VSKA 5IYDJ 2VBXA 3LFKA 3MQ0A 3MAJA 3GTMJ 4BE2A 3KCCA 2EV6A 5D5UB 1YJNI 1XX5A 3QODA 3F8NA 4KYWA 3Q9SA 4RB0A 4UHTA 3AG2H 4XBFA 1VQ4I 4LG0B 3HYIA 1HKTA 3S3OA 4R79A 1V3FA 3BR3A 5KCMA 1XD7A 2VBYA 3ZQFA 1VFCA 2ZFUA 3RIRA 5E3MA 3CUQB 3C18A 5DV5A 2JUCA 1ZG5A 4G6DA 4I0BA 4CH7A 1O4XA 2ZKZA 1YW7A 2FU4A 2R7OA 2BY2A 3NWTA 1FTZA 2RC4A 2VQLA 4P9FA 1YW8A 2BZTA 2HKOA 1EH6A 1IN6A 4IOCF 3RJPA 2W48A 1VQ8I 1KA8A 4BNCA 3I56I 2OA4A 3BLYA 1U5TA 3GW2A 5FKKA 1ETYA 1O57A 4EATA 2PJRB 4Z2YA 2EFQA 1TWAJ 3V4GA 2VKEA 2JSPA 4BU2A 1FZPB 5D5WB 1K61A 2OZUA 1R5GA 4LB6B 1GUUA 4B4CA 3ZN0A 1ZN2A 5E1WA 4UUTA 4IHSA 4D7MA 4E7HA 1R36A 1N25A 3CCEI 3FM5A 1MH3A 4HQEA 2DA5A 1FSEA 3HSEA 2K3FA 4KUMA 3CLQA 2DYRH 4CHUA 4M73A 5DS9A 2EZIA 1RKWA 2B9SA 2O8KA 2VE8A 2ZC2A 3BTIA 3FHNA 3WODF 2CG4A 5HDKA 3I58A 3GTLJ 1Q1HA 3S8PA 2V9PA 4II2A 2LP0A 3DPUA 1DPRA 1XGOA 2CYYA 2K86A 1DGWY 2H6CA 3WHBA 2OU2A 5BQTA 1SMTA 3K4JA 2CS3A 1K7AA 5FB2A 2EWNA 3AG4H 3CLOA 2N8GA 2E7WA 5LHIA 2NNYA 2IRFG 1QHGA 3K10A 1JTYA 2DFIA 2K9QA 4PJLA 4Q48A 3GTQJ 3EUAA 2R7UA 1S9HA 1ZLKA 5JHFA 1BIAA 2QKLB 4I0AA 5GP9A 5E3NA 5K7FA 4CCMA 4D5FA 3E6MA 5FFZA 3RKYA 1ZR2A 3ABUA 4ZTFA 2XUBA 2XB0X 3DEEA 5IP6A 3IAS2 3BG3A 4F52A 1IGNA 3MD2A 1U5TB 3DV8A 4IF4A 1X3ZB 1FC3A 2E71A 5J8CA 1GV5A 1F4KA 2Y0MA 1TWCJ 1G3SA 2KRCA 1IUFA 1XB4A 4D9JA 2A68F 3VEPA 1JUPA 1SVOA 3UR3C 5LD2C 2VQHA 2D5VA 4YG2F 4FT8A 1IRGA 2DFFA 3F9KA 4NQWA 2HYJA 1U78A 1BI3A 2MD0A 1MSEC 4IKFA 4EVIA 1DP7P 2XAUA 3BPXA 2P8TA 4RLFA 4PSWA 3V8LA 2CW8A 2J5PA 3DLAA 2G9WA 1GLNA 2JPBA 5IOZA 3W6KB 1NG7A 1X2MA 2F6CA 3V8KA 2B7EA 2BY0A 1S6LA 3EYIA 4RAGA 2CQNA 5JLWA 1NTCA 2KT0A 3J81K 1TNTA 1OMIA 2EFPA 1OYWA 1W7PD 4RAZA 3LA2A 4CYDA 2CV1A 4PJ0C 4XRMA 3JRHA 1BI1A 1QZEA 2QQBA 3PNVA 3B02A 2HDCA 2VJIA 2RKHA 2HDWA 2DBBA 4YIRX 4AIDA 1BA5A 3J81Z 2FXAA 1KU3A 2M2EA 5FKOA 1D8KA 4KIFA 3QQAA 4Z6YA 2X6XA 2EZLA 2KDZA 2RDPA 1T2KA 3TW6A 3SHFA 4I99C 3PIOF 3FX3A 5LFAA 2EV5A 5GAHJ 3HHHA 1BM9A 3ERED 3E5XA 3MKZA 2P6SA 3OL4A 4XN0A 5FD6A 1R22A 3DU6A 3HGYA 1TC3C 3UNGC 4E7JA 1JXSA 1BR1A 4X1EA 3JSOA 2ZXIA 2XSDC 4R1HA 4PCQA 3OS0A 1IN4A 5DM7F 4AC0A 1CQTA 3ZMDA 1HKQA 2L9SA 1FY7A 1A36A 5GADJ 1SVLA 3TDZC 3FBIB 3TW7A 5CVIA
chains in the Genus database with same CATH topology
3PO2J 5K7HA 5J1UA 4IHXA 4A3GJ 2K40A 2LK2A 5IP9J 3M4OJ 3QPLA 2DTZA 2EZKA 3JRBA 2JWTA 5J1YA 4A3LJ 2OF7A 3OSGA 3IH3A 3JREA 4NDLA 3A01A 5FKNA 4D7NA 1WCMJ 1HDPA 2CJJA 1IRZA 2QF7A 1ZGWA 2JA8J 1OJLA 4DW6A 2HXOA 1IDYA 3LSJA 2P81A 4QTRA 1MBGA 2WAQN 3Q3SA 1FEXA 1IJWC 2LKXA 3K2AA 3HM5A 5IP7J 1IC8A 4C3JJ 3GTPJ 1ETKA 2DA1A 4DZPA 3S2HJ 1WH7A 2FD5A 1JGGA 2HOAA 4S0HB 3QPSA 4MO7A 3NAUA 1I3QJ 1TWGJ 3G1OA 4CYCB 2HXIA 2R5YA 4AYBN 1U9OA 4Y7NJ 4L5EA 1TWHJ 1ITYA 1OCPA 3BR6A 4M3BA 4RBOA 2DMPA 2DA6A 3GTOJ 3S14J 2ECBA 2L9RA 1OCTC 3LNQA 5F0HA 2E2JJ 4IHVA 1JT6A 1ORKA 1A6IA 2XGCA 1BW5A 2L7MP 2ZB9A 1WPKA 2DA4A 5F0CA 5F27A 5HODA 3JRFA 1LFUP 1B8IB 2LFBA 3BR2A 5EEAA 3I4NJ 1QVTA 3A02A 5EG0B 1F36A 3S1QJ 2LVSA 2ELKA 1MBHA 3PM1A 3HKZN 2EH3A 1TWFJ 2CQXA 4A93J 5GPCA 1NK2P 3BQYA 4FISA 3S1RJ 1OFCX 3MN2A 3FISA 1JKRC 4FTHA 2MW8A 5J3LA 1IG7A 3B6AA 3MKLA 3ZQLA 5FLMJ 4GFBA 4G12A 2AHQA 3G1LA 2COBA 4X6AJ 3A01B 3IV5A 2O9LA 2MSYA 4MFEA 1FIPA 4I6ZA 4M3FA 4BBSJ 2EZHA 5M5XJ 5F08A 3SDGA 2XPWA 1X58A 2ECCA 3O8HA 2K9SA 3Q0VA 2EBIA 5IOYA 2HDDA 2DMNA 2HI3A 1WI3A 4RDUA 2I10A 1HOMA 1ENHA 1BJZA 3I4MJ 2VKVA 1ETQA 3CCYA 1FTTA 2PMZN 1K83J 2JJ7A 2MG4A 3IH4A 3LSGA 1PUFA 2JA6J 4A3CJ 4A3MJ 5EZGA 2L7ZA 4DZJA 2R5YB 2X6OA 5IPAA 3GBGA 4BY7J 2DA3A 4M6VA 1LFBA 3S2DJ 1RESA 1X2NA 2K9NA 2R0QC 1LE8A 2DA2A 4Y52J 1YRNA 4JX4A 4DYRA 1RETA 2L7FP 2CQQA 2DA7A 4V2FA 5EGOA 4C3IJ 3HOVJ 2JA7J 2VI6A 5E3LA 3JRCA 4MLOA 2CRGA 3H0GJ 3HOWJ 5EF6A 3OSFA 3TP0A 4V2GA 2XPVA 4BXXJ 1QPIA 3CMYA 2M34A 1W0UA 1MSFC 3L1PA 2R92J 2FJ1A 3HEFA 4DYCA 3TP3A 3RZOJ 1GVDA 3E7LA 5M5WJ 1HDDC 3BT9A 1SFOJ 2CUEA 2GLOA 4IHYA 1H89C 1DU6A 1IDZA 2IEKA 4A3BJ 5M5YJ 2DMTA 2X48A 3VPRA 1F43A 2LD5A 3FIWA 1ZTRA 4XK4A 3C2BA 1BW6A 3CQZJ 2H8RA 2YU9J 3JR9A 1JUMA 3GTKJ 4IEJA 2LLKA 3ZOBA 1A5JA 2R93J 1WGXA 3BR5A 5FKMA 2R7ZJ 3F0CA 3RZDJ 4W97A 5J1RA 4BKXA 1PUFB 2HOSA 1VI0A 1U8BA 3FKIJ 1MBKA 1HLVA 3D1NI 2ME0A 3JRGA 4JYKA 2H1KA 3UKGA 2M0CA 3Q0UA 3LSRA 3HB9A 2E19A 2FQ4A 1JJ6C 2ID6A 2X9DA 1LE8B 1GV2A 4LOCA 5C3EJ 3HOYJ 1JUSA 1YRNB 2TCTA 2B63J 2GBYA 5E3OA 3RKQA 2DMQA 1MH4A 9ANTA 4XICA 5EZHA 5IYDJ 2Y9YA 3GTMJ 4IHWA 5EGOB 2E1OA 4JX6A 4MIMA 2JMWA 3JRAA 1P7JA 4DYQA 4XIDA 5M3FJ 3HBLA 3Q0WA 5F1JA 1H8AC 1MBJA 1AHDP 4W1UA 3BG5A 4M3GA 1E3OC 3MVPA 4EEFG 3BR3A 3HOXJ 3ZQFA 1VFCA 4A3JJ 5E3MA 2R5ZA 2Y2ZA 2Y31A 4B3AA 3FK7A 2NVQJ 1O4XA 3S1MJ 5EDNA 2ID3A 3IH2A 3ZQGA 1FTZA 1MNMC 1POGA 2NVYJ 1UHSA 1SANA 5DTDA 4UUSA 4FCYA 2AO9A 5FLVA 2W48A 4CYCA 3WHCA 1T33A 2JA5J 2CU7A 1ETYA 5FKKA 5C4JJ 3ZQHA 1UG2A 1QVUA 3S17J 1TWAJ 2VKEA 1ETOA 1K61A 3PO3J 2Y30A 3BTCA 4MFDA 4B4CA 1GUUA 4C3HJ 1HCRA 3BR0A 4UUTA 4D7MA 2E2IJ 2L0KA 3HGGA 5F0FA 1S7EA 2VUMJ 1MH3A 1B72A 4JX5A 2DA5A 5FKLA 1HF0A 1ZKGA 1RPWA 1JJ8C 5DS9A 4QIWN 2EZIA 4C2MJ 3CDLA 2NVTJ 1RKWA 2G0EA 2O8KA 4D5CA 3BTIA 1Y1WJ 3DCFA 3DEWA 4QSHA 1NK3P 3GTLJ 2VPRA 1IV6A 2QCOA 3K7AJ 2LP0A 1D5YA 3S1NJ 2FX0A 1H88C 3OIOA 1ZK8A 5M3MJ 3WHBA 4I76A 4AUXA 1FJLA 5K7ZA 2DMUA 2XB5A 2LTPA 5FJ8J 1APLC 2DJNA 2N8GA 5EYRA 2YS9A 1JTYA 2K9QA 3GTQJ 3ZQCA 3HOZJ 1ZQ3P 1XG1A 2R5ZB 2NS7A 2M9HA 2NOGA 5GP9A 4FE7A 1BL0A 5E3NA 5K7FA 3HOUJ 3FK6A 4D5FA 3JRIA 3S15J 1MBFA 1AKHA 1ZR2A 2NS8A 2IAIA 2JK3A 2XB0X 1ETXA 2JN6A 5BNGA 5IP6A 4UUSB 5F04A 1RR7A 1VNDA 1UMQA 3BG3A 3JRDA 1JKOC 1IGNA 1I50J 4FE4A 4M3EA 4A3KJ 1P7IA 1GV5A 2WB1N 3S16J 2YUSA 1ETWA 1TWCJ 3HDDA 1XC5A 1IUFA 1JUPA 1T56A 4XRSG 1Q1VA 3SJMA 2CUFA 3OOUA 3NARA 2D5VA 1U78A 2HYJA 4M3DA 1MSEC 5C44J 1ZR4A 2ME6A 2EQRA 2HOTA 3G1MA 1B72B 2WV1A 3BG9A 1DU0A 2E2HJ 1JKPC 2TRTA 5IOZA 3O8GA 4BY1J 1Y1VJ 3BTLA 1X2MA 1Z0XA 1VF9A 1G2HA 4A3DJ 4ABZA 3RQIA 1U9NA 5JLWA 1FIAA 1NTCA 2KT0A 3BR1A 1W0TA 2HQ5A 1XS9A 1AU7A 2XGEA 2Y9ZA 3TEDA 2XPUA 4XRMA 3JRHA 1GT0C 1MBEA 4A3IJ 3LSPA 1JKQC 1BA5A 2M2EA 5FKOA 1Z77A 2OPTA 2LY9A 5JLXA 2LR8A 5IYCJ 1QRYA 2O7OA 3QQAA 1GDTA 2DN0A 2EZLA 4B1RA 2KDZA 3TW6A 4XRSA 2XRLA 2RAEA 3M3YJ 4A3FJ 1JTXA 5IYBJ 4JP0A 4A69C 1I6HJ 3A03A 3BQZA 1AKHB 3W6VA 3BTJA 2GM4A 1WH5A 2MGQA 2NVXJ 3HGYA 3B6CA 4HNVA 4BBRJ 1R9TJ 5C4XJ 1TC3C 4A3EJ 3ZQIA 1B8IA 4X1EA 2XSDC 1RKTA 5EG0A 4AC0A 3GTJJ 3SFIA 1CQTA 2XGDA 3GTGJ 2M8GX 2Y0SN 2IBDA 3H3VK 4J19A 1JT0A 1EF4A 5GPAA 1ETVA 3TW7A 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 J;  5K7H A;  5J1U A;  4IHX A;  4A3G J;  2K40 A;  2LK2 A;  5IP9 J;  3M4O J;  3QPL A;  2DTZ A;  2EZK A;  3JRB A;  2JWT A;  5J1Y A;  4A3L J;  2OF7 A;  3OSG A;  3IH3 A;  3JRE A;  4NDL A;  3A01 A;  5FKN A;  4D7N A;  1WCM J;  1HDP A;  2CJJ A;  1IRZ A;  2QF7 A;  1ZGW A;  2JA8 J;  1OJL A;  4DW6 A;  2HXO A;  1IDY A;  3LSJ A;  2P81 A;  4QTR A;  1MBG A;  2WAQ N;  3Q3S A;  1FEX A;  1IJW C;  2LKX A;  3K2A A;  3HM5 A;  5IP7 J;  1IC8 A;  4C3J J;  3GTP J;  1ETK A;  2DA1 A;  4DZP A;  3S2H J;  1WH7 A;  2FD5 A;  1JGG A;  2HOA A;  4S0H B;  3QPS A;  4MO7 A;  3NAU A;  1I3Q J;  1TWG J;  3G1O A;  4CYC B;  2HXI A;  2R5Y A;  4AYB N;  1U9O A;  4Y7N J;  4L5E A;  1TWH J;  1ITY A;  1OCP A;  3BR6 A;  4M3B A;  4RBO A;  2DMP A;  2DA6 A;  3GTO J;  3S14 J;  2ECB A;  2L9R A;  1OCT C;  3LNQ A;  5F0H A;  2E2J J;  4IHV A;  1JT6 A;  1ORK A;  1A6I A;  2XGC A;  1BW5 A;  2L7M P;  2ZB9 A;  1WPK A;  2DA4 A;  5F0C A;  5F27 A;  5HOD A;  3JRF A;  1LFU P;  1B8I B;  2LFB A;  3BR2 A;  5EEA A;  3I4N J;  1QVT A;  3A02 A;  5EG0 B;  1F36 A;  3S1Q J;  2LVS A;  2ELK A;  1MBH A;  3PM1 A;  3HKZ N;  2EH3 A;  1TWF J;  2CQX A;  4A93 J;  5GPC A;  1NK2 P;  3BQY A;  4FIS A;  3S1R J;  1OFC X;  3MN2 A;  3FIS A;  1JKR C;  4FTH A;  2MW8 A;  5J3L A;  1IG7 A;  3B6A A;  3MKL A;  3ZQL A;  5FLM J;  4GFB A;  4G12 A;  2AHQ A;  3G1L A;  2COB A;  4X6A J;  3A01 B;  3IV5 A;  2O9L A;  2MSY A;  4MFE A;  1FIP A;  4I6Z A;  4M3F A;  4BBS J;  2EZH A;  5M5X J;  5F08 A;  3SDG A;  2XPW A;  1X58 A;  2ECC A;  3O8H A;  2K9S A;  3Q0V A;  2EBI A;  5IOY A;  2HDD A;  2DMN A;  2HI3 A;  1WI3 A;  4RDU A;  2I10 A;  1HOM A;  1ENH A;  1BJZ A;  3I4M J;  2VKV A;  1ETQ A;  3CCY A;  1FTT A;  2PMZ N;  1K83 J;  2JJ7 A;  2MG4 A;  3IH4 A;  3LSG A;  1PUF A;  2JA6 J;  4A3C J;  4A3M J;  5EZG A;  2L7Z A;  4DZJ A;  2R5Y B;  2X6O A;  5IPA A;  3GBG A;  4BY7 J;  2DA3 A;  4M6V A;  1LFB A;  3S2D J;  1RES A;  1X2N A;  2K9N A;  2R0Q C;  1LE8 A;  2DA2 A;  4Y52 J;  1YRN A;  4JX4 A;  4DYR A;  1RET A;  2L7F P;  2CQQ A;  2DA7 A;  4V2F A;  5EGO A;  4C3I J;  3HOV J;  2JA7 J;  2VI6 A;  5E3L A;  3JRC A;  4MLO A;  2CRG A;  3H0G J;  3HOW J;  5EF6 A;  3OSF A;  3TP0 A;  4V2G A;  2XPV A;  4BXX J;  1QPI A;  3CMY A;  2M34 A;  1W0U A;  1MSF C;  3L1P A;  2R92 J;  2FJ1 A;  3HEF A;  4DYC A;  3TP3 A;  3RZO J;  1GVD A;  3E7L A;  5M5W J;  1HDD C;  3BT9 A;  1SFO J;  2CUE A;  2GLO A;  4IHY A;  1H89 C;  1DU6 A;  1IDZ A;  2IEK A;  4A3B J;  5M5Y J;  2DMT A;  2X48 A;  3VPR A;  1F43 A;  2LD5 A;  3FIW A;  1ZTR A;  4XK4 A;  3C2B A;  1BW6 A;  3CQZ J;  2H8R A;  2YU9 J;  3JR9 A;  1JUM A;  3GTK J;  4IEJ A;  2LLK A;  3ZOB A;  1A5J A;  2R93 J;  1WGX A;  3BR5 A;  5FKM A;  2R7Z J;  3F0C A;  3RZD J;  4W97 A;  5J1R A;  4BKX A;  1PUF B;  2HOS A;  1VI0 A;  1U8B A;  3FKI J;  1MBK A;  1HLV A;  3D1N I;  2ME0 A;  3JRG A;  4JYK A;  2H1K A;  3UKG A;  2M0C A;  3Q0U A;  3LSR A;  3HB9 A;  2E19 A;  2FQ4 A;  1JJ6 C;  2ID6 A;  2X9D A;  1LE8 B;  1GV2 A;  4LOC A;  5C3E J;  3HOY J;  1JUS A;  1YRN B;  2TCT A;  2B63 J;  2GBY A;  5E3O A;  3RKQ A;  2DMQ A;  1MH4 A;  9ANT A;  4XIC A;  5EZH A;  5IYD J;  2Y9Y A;  3GTM J;  4IHW A;  5EGO B;  2E1O A;  4JX6 A;  4MIM A;  2JMW A;  3JRA A;  1P7J A;  4DYQ A;  4XID A;  5M3F J;  3HBL A;  3Q0W A;  5F1J A;  1H8A C;  1MBJ A;  1AHD P;  4W1U A;  3BG5 A;  4M3G A;  1E3O C;  3MVP A;  4EEF G;  3BR3 A;  3HOX J;  3ZQF A;  1VFC A;  4A3J J;  5E3M A;  2R5Z A;  2Y2Z A;  2Y31 A;  4B3A A;  3FK7 A;  2NVQ J;  1O4X A;  3S1M J;  5EDN A;  2ID3 A;  3IH2 A;  3ZQG A;  1FTZ A;  1MNM C;  1POG A;  2NVY J;  1UHS A;  1SAN A;  5DTD A;  4UUS A;  4FCY A;  2AO9 A;  5FLV A;  2W48 A;  4CYC A;  3WHC A;  1T33 A;  2JA5 J;  2CU7 A;  1ETY A;  5FKK A;  5C4J J;  3ZQH A;  1UG2 A;  1QVU A;  3S17 J;  1TWA J;  2VKE A;  1ETO A;  1K61 A;  3PO3 J;  2Y30 A;  3BTC A;  4MFD A;  4B4C A;  1GUU A;  4C3H J;  1HCR A;  3BR0 A;  4UUT A;  4D7M A;  2E2I J;  2L0K A;  3HGG A;  5F0F A;  1S7E A;  2VUM J;  1MH3 A;  1B72 A;  4JX5 A;  2DA5 A;  5FKL A;  1HF0 A;  1ZKG A;  1RPW A;  1JJ8 C;  5DS9 A;  4QIW N;  2EZI A;  4C2M J;  3CDL A;  2NVT J;  1RKW A;  2G0E A;  2O8K A;  4D5C A;  3BTI A;  1Y1W J;  3DCF A;  3DEW A;  4QSH A;  1NK3 P;  3GTL J;  2VPR A;  1IV6 A;  2QCO A;  3K7A J;  2LP0 A;  1D5Y A;  3S1N J;  2FX0 A;  1H88 C;  3OIO A;  1ZK8 A;  5M3M J;  3WHB A;  4I76 A;  4AUX A;  1FJL A;  5K7Z A;  2DMU A;  2XB5 A;  2LTP A;  5FJ8 J;  1APL C;  2DJN A;  2N8G A;  5EYR A;  2YS9 A;  1JTY A;  2K9Q A;  3GTQ J;  3ZQC A;  3HOZ J;  1ZQ3 P;  1XG1 A;  2R5Z B;  2NS7 A;  2M9H A;  2NOG A;  5GP9 A;  4FE7 A;  1BL0 A;  5E3N A;  5K7F A;  3HOU J;  3FK6 A;  4D5F A;  3JRI A;  3S15 J;  1MBF A;  1AKH A;  1ZR2 A;  2NS8 A;  2IAI A;  2JK3 A;  2XB0 X;  1ETX A;  2JN6 A;  5BNG A;  5IP6 A;  4UUS B;  5F04 A;  1RR7 A;  1VND A;  1UMQ A;  3BG3 A;  3JRD A;  1JKO C;  1IGN A;  1I50 J;  4FE4 A;  4M3E A;  4A3K J;  1P7I A;  1GV5 A;  2WB1 N;  3S16 J;  2YUS A;  1ETW A;  1TWC J;  3HDD A;  1XC5 A;  1IUF A;  1JUP A;  1T56 A;  4XRS G;  1Q1V A;  3SJM A;  2CUF A;  3OOU A;  3NAR A;  2D5V A;  1U78 A;  2HYJ A;  4M3D A;  1MSE C;  5C44 J;  1ZR4 A;  2ME6 A;  2EQR A;  2HOT A;  3G1M A;  1B72 B;  2WV1 A;  3BG9 A;  1DU0 A;  2E2H J;  1JKP C;  2TRT A;  5IOZ A;  3O8G A;  4BY1 J;  1Y1V J;  3BTL A;  1X2M A;  1Z0X A;  1VF9 A;  1G2H A;  4A3D J;  4ABZ A;  3RQI A;  1U9N A;  5JLW A;  1FIA A;  1NTC A;  2KT0 A;  3BR1 A;  1W0T A;  2HQ5 A;  1XS9 A;  1AU7 A;  2XGE A;  2Y9Z A;  3TED A;  2XPU A;  4XRM A;  3JRH A;  1GT0 C;  1MBE A;  4A3I J;  3LSP A;  1JKQ C;  1BA5 A;  2M2E A;  5FKO A;  1Z77 A;  2OPT A;  2LY9 A;  5JLX A;  2LR8 A;  5IYC J;  1QRY A;  2O7O A;  3QQA A;  1GDT A;  2DN0 A;  2EZL A;  4B1R A;  2KDZ A;  3TW6 A;  4XRS A;  2XRL A;  2RAE A;  3M3Y J;  4A3F J;  1JTX A;  5IYB J;  4JP0 A;  4A69 C;  1I6H J;  3A03 A;  3BQZ A;  1AKH B;  3W6V A;  3BTJ A;  2GM4 A;  1WH5 A;  2MGQ A;  2NVX J;  3HGY A;  3B6C A;  4HNV A;  4BBR J;  1R9T J;  5C4X J;  1TC3 C;  4A3E J;  3ZQI A;  1B8I A;  4X1E A;  2XSD C;  1RKT A;  5EG0 A;  4AC0 A;  3GTJ J;  3SFI A;  1CQT A;  2XGD A;  3GTG J;  2M8G X;  2Y0S N;  2IBD A;  3H3V K;  4J19 A;  1JT0 A;  1EF4 A;  5GPA A;  1ETV A;  3TW7 A;  3LOC A; 
#chains in the Genus database with same CATH topology
 2IPQ X;  3KX2 A;  4MEX F;  2ZJP F;  4YII A;  2WC2 A;  1XPX A;  3L9F A;  4NQW B;  4KT5 C;  3KLN A;  4OAZ A;  2C6Y A;  2IS4 A;  3FDY A;  3CCJ I;  2DAO A;  1TT0 A;  3KET A;  5J1Y A;  3OSG A;  1ZG1 A;  2M5W A;  3K4K A;  3JRE A;  1WQ2 A;  5FRO A;  1KQ8 A;  4HX8 A;  4NDL A;  4RB2 C;  2VBZ A;  2AQE A;  3DPT A;  2WAF A;  1WJF A;  4Y15 A;  2X85 A;  1VQM I;  2ESN A;  2YU3 A;  1DPU A;  2QF7 A;  4KA4 A;  2JA8 J;  3KZI C;  5L3D A;  2HXO A;  4DW6 A;  1TW3 A;  2IA0 A;  2B0L A;  2P81 A;  2IS2 A;  2WAQ N;  2FRH A;  2W84 A;  1BN5 A;  1IJW C;  4CZC A;  3LQQ A;  1G6N A;  1IC8 A;  2P7V B;  1S8N A;  3IKV A;  1KQ9 A;  2R7Q A;  4EJW A;  4I98 B;  4KN4 X;  1TQI A;  3BJA A;  2FD5 A;  2QA4 I;  1JGG A;  4ESJ A;  2JRM A;  3JAM K;  3NAU A;  1I3Q J;  3TOB A;  1HBX G;  4ZJZ A;  3H0D A;  1W36 C;  3DKY A;  3GZ6 A;  4KMU X;  1XGM A;  2OQR A;  1P4X A;  3G71 I;  3K6G A;  5LEK A;  1OCR H;  1RUO A;  1SEU A;  4L5E A;  4HV6 A;  2KPM A;  4Y4R A;  2DQR A;  3I55 I;  1ITY A;  4M3B A;  4BL0 B;  4PZJ A;  2DPU A;  3ZN1 A;  1W7P A;  2MC3 A;  2ZO4 A;  4PJJ A;  2UV1 A;  3HOT A;  3JAM Z;  3AL0 B;  5F0H A;  1R4M B;  5DD8 A;  1A6I A;  3OR2 C;  1D1A A;  3FMQ A;  2L7M P;  1LFU P;  2DA4 A;  5HOD A;  1Y6I A;  3R0J A;  3Q9V A;  1FP1 D;  3F21 A;  2K9M A;  2HPI A;  3A02 A;  3CC2 I;  2XF7 A;  2J5O A;  1RNL A;  5L3B A;  2MBF A;  2PLY A;  4KIT B;  1T98 A;  1VQ7 I;  3HKZ N;  1U8R A;  2E7X A;  1R1V A;  4A93 J;  4GCV A;  3PUF A;  1T0F A;  2M8E A;  2QSG X;  2XAG A;  2E35 A;  1QBJ A;  1OFC X;  2OCE A;  3FF5 A;  5BS6 A;  3FIS A;  4BUP A;  2XVC A;  5J3L A;  1IG7 A;  1ULY A;  3GZN B;  2W1O A;  4GFB A;  2IA2 A;  4G12 A;  3BG7 A;  2ZCW A;  1Z3X A;  2COB A;  3HUG A;  4M72 A;  5B1B H;  2O9L A;  4IVN A;  1BR2 A;  2MSY A;  4MFE A;  3FXR A;  1PVE A;  3PSI A;  4BBS J;  2HYG D;  2L01 A;  3CJQ B;  3OYF A;  1D0Y A;  2JQ7 A;  2IGK A;  2V1N A;  3HRM A;  3VOE A;  1X58 A;  2CH0 A;  2ECC A;  2K9S A;  3Q0V A;  3A4C A;  2HDD A;  4AU7 A;  4M6X A;  3CO7 C;  2YX7 A;  1B4A A;  1HOM A;  3BWG A;  3QYB A;  1ETQ A;  2HPM A;  2RRE A;  2BXZ A;  5TGT A;  3GVA A;  3OMY A;  2JJ7 A;  1QO0 D;  5EZG A;  3WU0 A;  2FE3 A;  1MND A;  2X1C A;  3G73 A;  4UVB A;  5BOX A;  1EJ9 A;  2ADU A;  2V9V A;  2HFH A;  1W7P B;  4NBQ A;  2GA2 A;  3SXY A;  2JZY A;  1YRN A;  1MIJ A;  3V7R A;  1XMK A;  1QHH D;  2DA7 A;  1SD6 A;  4LIT A;  4V2F A;  3HRT A;  1XMA A;  2COM A;  3WE3 A;  5E3L A;  2XKO A;  1K6Y A;  1ODD A;  3HOW J;  2R4G A;  4D1Q A;  3OSF A;  2WAQ A;  4LLG F;  2XPV A;  3MCZ A;  2JT1 A;  1W0U A;  2FBK A;  4PGH A;  2K5C A;  2FF4 A;  4U0V A;  3HSF A;  2VQG A;  2FJ1 A;  5GAE J;  4G8X A;  4MTD A;  1Y39 A;  3SQN A;  4S05 A;  1PUE E;  3E7L A;  3K4N A;  1YYV A;  3LL7 A;  3C7J A;  4ZZL A;  4BAC A;  1WI9 A;  2A3S A;  4QWQ A;  5L3C A;  1FNN A;  4EM1 A;  3HUG B;  2HEO A;  3HTS B;  5CPR B;  1OLT A;  3FIW A;  1XSX A;  4XK4 A;  4A2U A;  1D0X A;  4B48 A;  3TQN A;  1MMG A;  2KMU A;  1CF7 A;  3ZOB A;  3TBI A;  3ZP5 A;  4XQF A;  1WGX A;  1OR7 C;  1JI8 A;  2CQ7 A;  4ZTJ A;  4PFO A;  4W97 A;  1O7F A;  3TOA A;  5DD4 A;  1IZ1 A;  4BKX A;  5LGN A;  2M7A A;  1B9N A;  1YIT I;  2Y75 A;  3HKZ A;  1MBK A;  2DOD A;  3D0S A;  2NXN B;  4XKV A;  1X4O A;  4C9Y A;  5K5Q A;  3PFI A;  4E7L A;  3BOQ A;  3LSR A;  2FQ4 A;  1JJ6 C;  3V7C A;  3CD6 I;  4LOC A;  3HOY J;  1BI2 A;  4HDV A;  1YRN B;  2TCT A;  2LYC A;  4L9N A;  5GTH C;  2LOO A;  2DMQ A;  1MH4 A;  5E3O A;  9ANT A;  4M9S A;  1QZY A;  4BJT A;  1T8I A;  3BCA A;  3O6B B;  4A6D A;  5CQE A;  3K2Z A;  4RGX A;  1PYV A;  3I3L A;  2HQA A;  3OOP A;  4ZYH A;  3JTG A;  2DI3 A;  2BV6 A;  4JX6 A;  5ILU A;  1R49 A;  2FNP A;  4PUS A;  3ULQ B;  4IHT A;  1E0E A;  2H09 A;  2XAF A;  4DYQ A;  3IWZ A;  3W2A A;  3Q0W A;  1WSU A;  3I9V 2;  2NAZ A;  3CP8 A;  1H8A C;  3WTS C;  1AHD P;  3FXL A;  2CUJ A;  4W1U A;  4M3G A;  1VQO I;  4B44 A;  1YHQ I;  3F22 A;  4ANJ A;  1X3W B;  2O5R A;  2VAS A;  2ZFW A;  2Y2Z A;  3FK7 A;  3S1M J;  1G8X A;  3J7Y J;  3DTI A;  1LDD A;  1LEB A;  2W25 A;  1MNM C;  1POG A;  2NVY J;  2DOE A;  4AWX B;  5CQG A;  4KDP A;  2FML A;  1MGT A;  4HOB A;  4YRV A;  4CYC A;  3WHC A;  3DBH B;  1P9Q C;  2V1X A;  3FBN B;  4XOP A;  4PJN A;  3HZJ A;  3ZQH A;  2BY1 A;  1QVU A;  1UB9 A;  1ETO A;  3ABT A;  4FX0 A;  1CF7 B;  1Z91 A;  2OQG A;  4MFD A;  3ZQ7 A;  4LGW A;  3PUB A;  2K9L A;  2M7B A;  2KQR A;  4UB8 C;  3V7S A;  1BBY A;  4H4K C;  4HRI A;  1SMY F;  2KIS A;  3ROU A;  5J47 A;  4XLH A;  4BJ5 C;  1OCC H;  1G3W A;  3J7Z I;  1S7E A;  3VYU B;  3N97 A;  2VUM J;  1B72 A;  4G6T B;  4JX5 A;  1IO2 A;  5DCM A;  5ICF A;  5FKL A;  1HF0 A;  2CO5 A;  6PAX A;  4MEY F;  4G7O F;  2X4H A;  1N78 A;  1NH3 A;  1LDJ A;  3I5U A;  2NVT J;  2VIX A;  4D5C A;  1R1T A;  1BI0 A;  3MZH A;  3KYC B;  4EGY A;  1ZRC A;  4QSH A;  5H20 A;  3VSL A;  2VPR A;  4KJZ A;  1Z05 A;  2QUF A;  2QCO A;  4XOT A;  2XRN A;  3K7A J;  3HRS A;  1ONV A;  3B73 A;  2L02 A;  1L3L A;  1H88 C;  3OIO A;  1ZK8 A;  2P6T A;  4LK1 F;  2VQC A;  3KP4 A;  4I76 A;  4AUX A;  2Q8K A;  2DU9 A;  4M74 A;  1S7O A;  4L9T A;  3L2V A;  3BPV A;  5CVV A;  2Z16 A;  4U88 A;  2VT2 A;  3MKY B;  1FPQ A;  2YS9 A;  2PJP A;  3HOZ J;  3VYS B;  4XSX F;  1S3J A;  1K4S A;  1ZAO A;  2CFO A;  4F93 B;  1X1P A;  3CP2 A;  3DFG A;  4F7Z A;  1MBF A;  3S15 J;  3CC4 I;  4E7K A;  2F4O B;  2JK3 A;  3HOS A;  1Z7L A;  2JN6 A;  5F04 A;  1VND A;  1R5I D;  2UXX A;  2BYV E;  1I50 J;  1YO5 C;  3ERM A;  4N9H A;  4M3E A;  1TP4 A;  2H1L A;  4A3K J;  1V54 H;  4OIO F;  1OYY A;  3CF5 F;  3S16 J;  2IGM A;  4C2U A;  1YS6 A;  2MLG A;  3OYD A;  3HDD A;  2DLL A;  1XC5 A;  2K4J A;  4I2O A;  1OIS A;  2P5V A;  4JK1 X;  3SFZ A;  2BY3 A;  4DJA A;  1T56 A;  3K69 A;  3DP7 A;  2CUF A;  3NQO A;  3NAR A;  2D1V A;  2OD5 A;  3ISP A;  3H5A A;  1S72 I;  4KFC A;  5K1Y A;  1NG6 A;  3K9T A;  2W7N A;  3CJT B;  2HOT A;  3G1M A;  1B72 B;  4DBR A;  2WV1 A;  3F8C A;  1SAX A;  1DU0 A;  1JKP C;  2TRT A;  2KZV A;  5DCM B;  5E8G A;  4BY1 J;  3BTL A;  4CUG A;  3CF2 A;  3HG9 A;  2LNB A;  2KIM A;  1FIA A;  1X1D A;  3A2K A;  3KEO A;  4LFU A;  1OPC A;  1AU7 A;  4B47 A;  2XGE A;  2Y9Z A;  2HTJ A;  2XPU A;  1R7J A;  1PP7 U;  3CMA I;  1VQ9 I;  2PG4 A;  1B59 A;  2JA2 A;  1MBE A;  1X1C A;  2FMY A;  5ERI A;  1QA6 A;  2ZNY A;  3OIP A;  3P7N A;  1HW2 A;  1JKQ C;  4Y13 A;  1GXP A;  4OIP F;  2R3S A;  3RPQ A;  2OPT A;  3O2P E;  3I4P A;  4L5I A;  3P9I A;  2H8W A;  3PQK A;  1QRY A;  1GDT A;  2DN0 A;  4AIH A;  4IPA A;  3OS1 A;  5KHD A;  2QSF X;  1TW2 A;  2RAE A;  1ZLJ A;  1XCV A;  3QOE A;  5DEQ A;  5BPD A;  3M3Y J;  4HF2 A;  2XAQ A;  3S32 A;  2P5L C;  3ZGK A;  3DTK A;  1QU3 A;  4K2E A;  1DDN A;  3BQZ A;  4CCN A;  3ZMU A;  4ZH4 F;  2GIZ A;  2W4S A;  3MKW B;  1G3Y A;  2GM4 A;  3B6C A;  2GXG A;  4BBR J;  2HVS A;  5C4X J;  2Z5U A;  2CMP A;  3CES A;  3W2W A;  2LC2 A;  4NHJ A;  2QGU A;  5E17 F;  2M87 A;  4V19 K;  1WHU A;  2OJE D;  5EG0 A;  1VQN I;  3GTJ J;  3SFI A;  4XNF A;  2XGD A;  3GTG J;  4YFK F;  2D1H A;  1XDU A;  3HTU A;  4ETS A;  2MYS A;  1EF4 A;  1KU2 A;  4QPQ A;  4HSR A;  5JVT A;  4X0G A;  4HYE A;  5K7H A;  5LLQ A;  4IHX A;  4A3G J;  1I1S A;  3M4O J;  3E3V A;  1DP3 A;  3KPH A;  4XKC A;  3JRB A;  2DCE A;  2OF7 A;  3ABM H;  3EUK L;  1FWZ A;  3G3Z A;  4D7N A;  5E1Z B;  1J7K A;  4UNO A;  1W4M A;  4F3Q A;  3FHZ A;  4I09 A;  1ZGW A;  3BP8 A;  3I64 A;  2LG4 A;  1IW7 F;  1XGN A;  2M3A A;  4IL6 C;  4QTR A;  4XOR A;  1ON2 A;  3Q3S A;  1O3T A;  3HM5 A;  3ZQQ A;  2KFD A;  2GOX B;  1MMA A;  1ETK A;  2V6E A;  2K02 A;  4DZP A;  3S2H J;  4OIQ F;  1S7A A;  3KIO A;  1BC8 C;  2OBP A;  3F8F A;  4UVA A;  4WXH A;  2VE9 A;  2CGP A;  4S0H B;  3QPS A;  4MO7 A;  1BR4 A;  5E79 C;  4EJU A;  4MQ9 F;  3W6J B;  4KMF A;  3BR6 A;  2ISY A;  1LPQ A;  3GME A;  3S14 J;  1TQM A;  2BBY A;  2L9R A;  1OCT C;  2CWE A;  1IUY A;  2Y69 H;  1TBX A;  4IHV A;  2ZME C;  3MWM A;  5ICG A;  1I27 A;  3CCL I;  3H9J A;  4XKW A;  3WGI A;  1RRJ A;  1VQK I;  5F0C A;  5F27 A;  3RTR A;  4G7Z F;  4OU0 A;  3OR1 C;  4ZC3 A;  3EUH A;  2AQF A;  2NVU B;  1WWX A;  2ZSH B;  1T95 A;  5EG0 B;  2OV7 A;  2LVS A;  2EIM H;  3OYH A;  3PM1 A;  2BVL A;  2CUZ A;  1TWF J;  2CQX A;  3GYH X;  4XM3 A;  3MMY B;  2O8X A;  3ECO A;  1V5G A;  4FIS A;  2CQK A;  4ZYD A;  3S1R J;  2A6H F;  1KGS A;  4CA0 A;  2IJL A;  4FTH A;  3OV8 A;  3H3U A;  5J4V A;  1YLF A;  3ZQL A;  3IHU A;  4EJO A;  2EJR A;  2LKP A;  1IN8 A;  1OR7 A;  2DOA A;  2WY7 Q;  3FXU A;  5KNL A;  4E4H A;  3LWF A;  3IV5 A;  3DKX A;  4ASN A;  2E60 A;  4I6Z A;  3BDD A;  1UCR A;  3CCS I;  4Q5S F;  2EIJ H;  2EZH A;  4L9V A;  2GQQ A;  3QPT A;  3SDG A;  2XPW A;  1D1C A;  3VWB A;  4LMY A;  4GO1 A;  2DMN A;  3R61 A;  2X6Y A;  3DF8 A;  3U21 A;  1ZGJ A;  4F92 B;  3I4M J;  2KHM A;  4OAY A;  2VKV A;  1IXR C;  3M8E A;  1FTT A;  4CXF A;  4GYG A;  2PMZ N;  5HLI A;  3FXQ A;  5CVR A;  3IH4 A;  3HXL A;  4A3C J;  4P9U A;  5JR3 A;  5D4S A;  1MJ9 A;  5J4Y A;  4XKB A;  2DO7 A;  3RPU D;  3HRU A;  2X6O A;  3T0Y A;  1AA7 A;  2CV0 A;  5LRR A;  3HPG A;  1TT5 B;  3KP5 A;  4BAY A;  1Z3Y A;  5ILV A;  1MMS A;  1LFB A;  3H1C A;  3S2D J;  3CJN A;  3FXO A;  5D4R A;  1DGR M;  3KP6 A;  2DA2 A;  4JX4 A;  1H9T A;  3WGH A;  2RN7 A;  2GOM A;  3BJ6 A;  2L7F P;  3OS2 A;  1YOV B;  2CQQ A;  3SEZ A;  1EV7 A;  5B3S H;  2HVR A;  3DU5 A;  2MLK A;  1FX7 A;  5CKT A;  4C3I J;  2KJC A;  3K1M A;  2JA7 J;  2VI6 A;  3JRC A;  2FOK A;  2CRG A;  2E1C A;  5EF6 A;  1V5F A;  3H5R A;  2P7C B;  3E6B A;  1TZL A;  2HVQ A;  4YEL A;  2M34 A;  4NC6 A;  1FMW A;  2R92 J;  1ERD A;  2ESH A;  3CJR B;  3M8F A;  1GVD A;  2E1N A;  2HOE A;  4I01 A;  1HDD C;  1YIO A;  3VYT B;  1YX3 A;  2Q0O A;  1QGP A;  3DLL F;  4HLY A;  1VQ6 I;  1DU6 A;  2KKO A;  2DTR A;  2Z99 A;  2DOF A;  4XLE A;  4A3B J;  4BE0 A;  2JPC A;  3VPR A;  1J9I A;  2V9K A;  3RYR A;  3O3K A;  3RYP A;  2IW5 A;  1SD5 A;  1ZTR A;  1P2F A;  3SZP A;  3JR9 A;  1UHW A;  1Z9C A;  2VC0 A;  2EFO A;  4BHC A;  2BVM A;  3K4L A;  1YG2 A;  1J59 A;  4QLC U;  2PI0 A;  1GVJ A;  4RGU A;  2EIK H;  3OWT A;  2LLK A;  4NB5 A;  5B5E C;  3OYG A;  2W85 A;  3EYY A;  1P92 A;  2V26 A;  3KE2 A;  2KDO A;  3D5L A;  4FQG A;  3GZ5 A;  1BJA A;  4L18 B;  1S29 A;  2HOS A;  3M1E A;  1U8B A;  2VOD A;  1FMV A;  5FO5 A;  2QLZ A;  1O3S A;  1XMX A;  3HSR A;  3UKG A;  5AIQ A;  3U1K A;  1SFE A;  2G7H A;  3ONQ A;  2VKD A;  2E19 A;  1LFP A;  1WFX A;  1GV2 A;  2FUG 2;  4BEH A;  5J6X A;  3ZPL A;  1Y8Q B;  2FBH A;  1XTA A;  3WTT C;  4N4O B;  5ICC A;  4RMN A;  1USS A;  5IY5 H;  4FAS D;  2Q1Z B;  4IHW A;  3QOP A;  4HST A;  3M07 A;  3F3X A;  1BOA A;  2E5Z A;  3JRA A;  1P7J A;  4XID A;  2F5D A;  5M3F J;  2R7D A;  3HBL A;  5BMZ A;  4Y3O A;  2HNH A;  3SYT A;  3H92 A;  5F1J A;  1MBJ A;  2W00 A;  3RPU A;  3SZG A;  3BG5 A;  2L9V A;  3FM3 A;  3MVP A;  5LGT A;  1E2X A;  2A05 A;  2LF7 A;  2LSO A;  1T08 B;  1LUJ B;  2VN2 A;  1WKM A;  1X1B A;  4BJ6 C;  4BXF A;  2Y31 A;  4B3A A;  4HLX A;  4J00 A;  2NVQ J;  4XLC A;  1I1G A;  2PMZ A;  1LDK B;  4A0X A;  4BXU A;  5HNF A;  5IT3 A;  2XAH A;  5JVG F;  4JBA A;  3ZQG A;  2ZJQ F;  2RQP A;  2A5W A;  2YR2 A;  5AON A;  5EEH A;  1OYI A;  4AM3 A;  4EM2 A;  3I59 A;  3J7A Y;  3GLX A;  4E7I A;  1SAN A;  5DCF A;  4UUS A;  2DT5 A;  4HX7 A;  5KVR A;  1LEA A;  2AO9 A;  4HBL A;  1XSD A;  5FLV A;  5H6R A;  5FGM A;  2VJ5 A;  1UHM A;  2BEO A;  3OYE A;  2JA5 J;  4E7S A;  3TKY A;  4QPO A;  5LHG A;  5HS9 A;  3S17 J;  2DJI A;  2QYO A;  4XL9 A;  1U0J A;  2ZXH A;  3K1N A;  3F23 A;  1A35 A;  3PO3 J;  2GXA A;  5DM6 F;  4O3M A;  4YFX F;  2Y30 A;  2VLA A;  2DK8 A;  2Z2S B;  4WF2 A;  3HL2 A;  2VXD A;  3CCV I;  5F1R A;  4LD5 A;  2O6G E;  2DDA A;  2HZD A;  2DDB A;  4LLN A;  2EV0 A;  2HWV A;  2IGN A;  5GAG J;  2L0K A;  4BGD A;  4WCG A;  1LKX A;  3HGG A;  5F0F A;  2BW3 A;  4D0P A;  1XDS A;  4A5N A;  4OWR B;  1S5L C;  4OIR F;  1EH8 A;  1ZKG A;  1RPW A;  4QIW N;  3W3C A;  3CDL A;  4OMZ A;  3WGG A;  1F5T A;  4BEH B;  4AIK A;  1FYL A;  1N77 A;  2KRH A;  1Y1W J;  3QU6 A;  3DEW A;  4EMS A;  1NK3 P;  1IV6 A;  4RAY A;  2MA3 A;  3OYK A;  2BE5 F;  2DFH A;  2L2O A;  3EUH C;  4ITV A;  3WTZ A;  2RNJ A;  1A04 A;  1FJL A;  2FSW A;  1QQI A;  2E5N A;  2WWY A;  2OTJ I;  3K0L A;  4CDG A;  5FJ8 J;  3WU1 B;  3L00 A;  3I53 A;  1IV8 A;  5D8K B;  3SZT A;  2FOW A;  2JSC A;  5JHU A;  3NWS A;  2CSO A;  2MAB A;  4N0B A;  5CVJ A;  2BOL A;  3ZQC A;  2XRO A;  1ZQ3 P;  2VC1 A;  4A0Z A;  4CZZ A;  3S93 A;  4G7H F;  2M9H A;  1BL0 A;  4FE7 A;  4DQ2 A;  2KIQ A;  3FK6 A;  2GAU A;  3JRI A;  4BDZ A;  1R71 A;  2EFN A;  3E5Q A;  2QQA A;  2RVC A;  4BE1 A;  5HS7 A;  1ZHF A;  3I59 B;  3E6C C;  4UUS B;  4AD9 A;  2UWM A;  1UMQ A;  3BZC A;  1R4N B;  1P7I A;  1J5Y A;  2WB1 N;  2L4M A;  3K4B A;  2YUS A;  3S3N A;  2VPL A;  2L54 A;  3QP6 A;  4FHT A;  3PNY A;  4XMY A;  3LSK A;  3QWL A;  4G94 A;  3SJM A;  2YPR A;  3IRR A;  1TNS A;  2P4W A;  4U87 A;  1R00 A;  4RLQ A;  1I6X A;  4IO9 F;  1TQP A;  5IT9 K;  2STT A;  3WTW C;  2HU9 A;  1RUN A;  2BW3 B;  3NRV A;  2EQR A;  2IP2 A;  3IP4 B;  3OYN A;  2PMH A;  3O8G A;  1Y1V J;  4PFP A;  5FFX A;  2RGV A;  1Z0X A;  1VF9 A;  1W1W E;  1FOY A;  4CCK A;  4DOZ A;  1G2H A;  1FOW A;  4M9X A;  4ABZ A;  2XSJ C;  3OYJ A;  3BR1 A;  1VQP I;  1W0T A;  4OMY A;  5IT9 Z;  1P4A A;  1R1U A;  1A31 A;  2H6B A;  3DWL E;  3J80 K;  4HQM A;  3OYA A;  3V8J A;  3E5U A;  4GYI A;  2KIF A;  4HX4 A;  3DPL C;  1GT0 C;  1FOK A;  4DBQ A;  2VJ4 A;  3LSP A;  2GIV A;  4BQO A;  2XDV A;  2ZME A;  3FXM A;  2UZK A;  2QEX I;  2QKM B;  2LY9 A;  2LR8 A;  4IRH A;  3J80 Z;  4A6E A;  5IYC J;  2VBW A;  2O7O A;  4B1R A;  2STW A;  3P9K A;  1MDM A;  2X1E A;  4XRS A;  3M1C A;  1J2X A;  1FT9 A;  3TL4 X;  4LIU A;  5E20 A;  4A3F J;  1JTX A;  5HS8 A;  1RZ4 A;  4YEJ A;  1EKE A;  1KU9 A;  2FQ3 A;  3EQL F;  1IN7 A;  2K4B A;  3JW4 A;  1HC8 A;  2K7L A;  4ESB A;  3CCR I;  2QM3 A;  3GFL A;  4HNV A;  4ZDP A;  1R9T J;  3T1B A;  3AFH A;  1D3Y A;  2K85 A;  2Y0S A;  4A3E J;  1YFH A;  4LLL A;  1HXD A;  1W5C C;  3E97 A;  1HA8 A;  2P5K A;  2VL8 A;  4NC7 A;  1RKT A;  1B1B A;  4P96 A;  3PQJ A;  2F5V A;  2M8G X;  2IBD A;  1JT0 A;  4EJV A;  3IUO A;  1K78 A;  1ETV A;  3P5J A;  4AVP A;  2O61 A;  3LOC A;  3GO5 A;  2X6W A;  3CUO A;  2R7S A;  1SC7 A;  3PFY A;  3RKW A;  2K40 A;  2LK2 A;  2UUZ A;  5IP9 J;  4I7H A;  3M7G A;  3CME I;  3IAM 2;  2DTZ A;  4UV9 A;  3LSM A;  1ZRE A;  2JWT A;  4A3L J;  1JHF A;  2QSH X;  5KAI C;  4IQJ A;  4HF0 A;  3WE2 A;  1ZYR F;  2DK5 A;  3A01 A;  5FKN A;  4MTE A;  1PDN C;  1I3A A;  4LB5 A;  1OJL A;  1IDY A;  3LSJ A;  5D8L B;  1DQU A;  1Z6T A;  4DIQ A;  1FEX A;  3F6V A;  2LKX A;  3K2A A;  4C3J J;  4XLF A;  3IKT A;  4ENJ A;  3IWF A;  5D6F A;  5LBQ A;  3KZY A;  2WB1 A;  2VJJ A;  2ZME B;  2KLO A;  4RB1 A;  2HQR A;  1SVM A;  3G6E I;  1PJR A;  1TWG J;  3G1O A;  3KYL A;  4CYC B;  1VZ0 A;  3AKZ A;  2HXI A;  4AYB N;  1U9O A;  2R7R A;  1TWH J;  4P55 A;  3VYR B;  4RBO A;  1YQA A;  3U9G A;  3BJO A;  3GTO J;  1KU7 A;  2VB6 A;  5KAF C;  4L0Z B;  1OCO H;  3QU3 A;  3BC8 A;  3LNQ A;  1YE9 A;  3OL3 A;  4UXN A;  2ISZ A;  3E6D A;  1XSV A;  2NOJ B;  2XAS A;  2HR3 A;  2XGC A;  3PIP F;  2HQN A;  3PJR A;  4KIG A;  3JRF A;  1YS7 A;  2LFB A;  3GCM A;  4Q4Z F;  2ACJ A;  2NYX A;  5EJC A;  3BR2 A;  5E8I A;  1IRF A;  3I4N J;  4L9J A;  1QVT A;  4MNU A;  3G4S I;  1RIO H;  1F36 A;  3S1Q J;  2M0M A;  4NNJ A;  1D8J A;  3LQR A;  3R4K A;  1MBH A;  3S3M A;  1A6Q A;  2V7F A;  3DBL B;  1LB2 A;  2ZBK A;  1IAW A;  4CCL A;  5GPC A;  1NK2 P;  2M4G A;  3SEQ A;  5HLT A;  3DKW A;  4WK8 F;  2LH9 A;  4RA2 A;  4JQF A;  1JKR C;  2L3D A;  2Y48 A;  2XF6 A;  3B6A A;  3KYD B;  4NC8 A;  3MKL A;  3U1D A;  3R0A A;  1KYW A;  4RB3 C;  2HZT A;  2L7K A;  1SFU A;  2VON A;  4X6A J;  2PBI A;  2DFE A;  4U0W A;  2OCC H;  5D5V B;  3A01 B;  1UFM A;  2QVO A;  4HEA 2;  5JI6 A;  4XRF A;  1YTY A;  4M3F A;  3I54 A;  4I02 A;  2P0W A;  4XLN F;  5M5X J;  1ZG3 A;  1B6A A;  2V1U A;  4P1W A;  4AIJ A;  4JOM A;  2EBI A;  2WAD A;  5IOY A;  2LMD A;  2D45 A;  2AXT C;  2I10 A;  3GLL A;  1V4R A;  1T38 A;  5TIS C;  1ENH A;  4BHB A;  1BJZ A;  1XGS A;  5EEG A;  3ZMS A;  4N9I A;  4WXC A;  4KNY A;  2IA1 A;  3CCY A;  1TL8 A;  2E1M B;  5E1X A;  1SD7 A;  1FYM A;  1K83 J;  3ESW B;  4L5J A;  2JA6 J;  3LSG A;  5DUK A;  4A3M J;  2L7Z A;  4DZJ A;  1QPM A;  5IPA A;  4GGG A;  2A6E F;  3GBG A;  2PEX A;  3VB2 A;  4BY7 J;  4M6V A;  1UEL B;  2R7T A;  2L9N A;  3KFW X;  2PN6 A;  3JSP A;  3FXK A;  1R58 A;  3RKX A;  4Y52 J;  5ICE A;  1RET A;  3H5N A;  2XGX A;  2F5F A;  3VFZ A;  3QRF F;  3CDH A;  3TO6 A;  3KLO A;  1UAA A;  3ZR8 X;  5EGO A;  1JE8 A;  4C2T A;  3HOV J;  1F9N A;  2KRF A;  2MC4 A;  3OYL A;  5E18 F;  4MLO A;  2YSR A;  3K4C A;  2Z3Y A;  3H0G J;  3I0T A;  2NS0 A;  3C2H A;  2MFZ A;  4V2G A;  1Y56 A;  4HV5 A;  3BG6 A;  3C2G A;  4CIC A;  4BXX J;  2L4A A;  3C3W A;  3CMY A;  2KJB A;  1MSF C;  3L1P A;  4BYY A;  5LHH A;  3JTH A;  2FBI A;  1Y8R B;  4XR6 A;  1MKM A;  3AG1 H;  1BC7 C;  4BQA A;  3BZ6 A;  4RAF A;  3KEQ A;  1D1B A;  1IF1 A;  3PNT A;  3BT9 A;  2OUM A;  2JTV A;  4S04 A;  2AS5 F;  3CC7 I;  1SFO J;  2CUE A;  2WTE A;  4GXO A;  3ZMZ A;  5F64 A;  2WV0 A;  5CJ9 A;  4AYB A;  1H89 C;  4IHY A;  2IEK A;  4WWC A;  5M5Y J;  3L2R A;  1Z21 A;  2DMT A;  3AG3 H;  4U0Y A;  2MH2 A;  1D5V A;  2O0Y A;  3C2B A;  3GFI A;  1R5H A;  2QZ8 A;  5HVQ C;  5LEJ A;  1MMN A;  3CDI A;  3D5R C;  2NNN A;  5FRN A;  2PQ8 A;  1IDZ A;  4DNC A;  1A5J A;  4ZYG A;  2R93 J;  2ELH A;  4BDY A;  4J01 A;  1DUX C;  3BR5 A;  1TLH B;  5FKM A;  2R7Z J;  2TDX A;  3MEX A;  3PL8 A;  1I39 A;  4A0Y A;  5J1R A;  3E1S A;  5F6F A;  1K6O A;  2IGO A;  1VI0 A;  3KP7 A;  3FKI J;  2XC7 A;  2DXI A;  4EV0 A;  3KP2 A;  2F4M B;  3JRG A;  4JYK A;  1GHC A;  1V55 H;  2F2E A;  2ELJ A;  4M71 A;  2M30 A;  3MFK A;  3WG7 H;  2ID6 A;  1Y0N A;  5C3E J;  3K70 C;  1JUS A;  1K4T A;  2GBY A;  3RKQ A;  3CCQ I;  3LSH A;  2O03 A;  4XIC A;  5EZH A;  1HKS A;  2VXZ A;  2XKP A;  2Y9Y A;  3M9A A;  4HNU A;  5EGO B;  2E1O A;  4UV8 A;  4MIM A;  3DBR B;  3CCU I;  3H35 A;  4KT6 A;  2JMW A;  1U6G A;  2BXY A;  2CV2 A;  2VOP A;  1UST A;  2IVM A;  5GTI C;  5L3G A;  5JFR A;  2XF5 A;  2VT3 A;  2M45 A;  3HPH A;  3ZRG A;  1ZAR A;  1E3P A;  1I5Z A;  4UB6 C;  1M1E B;  1E3O C;  1IN5 A;  4HZF A;  3JCU C;  3P9C A;  4EEF G;  4A12 A;  3HOX J;  4O5V A;  4A3J J;  1EH7 A;  1AOY A;  1J09 A;  1ON1 A;  2IT0 A;  4G9Y A;  4UVC A;  2LBF A;  2R5Z A;  1Z7U A;  1SD4 A;  3TO7 A;  4ZYE A;  1MW7 A;  2EK5 A;  5EDN A;  1CGP A;  3LST A;  2ID3 A;  3IH2 A;  1YI2 I;  4XN3 A;  3N4M A;  3U2R A;  1UHS A;  5DTD A;  4HNT A;  3AAF A;  4FCY A;  1STZ A;  4AVZ A;  2EA4 A;  2LY2 A;  2RQQ A;  1LQ1 A;  1T33 A;  5CVU A;  2BHZ A;  2CU7 A;  3A0B C;  2DW4 A;  5C4J J;  1UG2 A;  2O3F A;  3CUQ C;  1BIB A;  3KP3 A;  1R6R A;  2ZJ2 A;  3CMM A;  4TV7 A;  3ML6 A;  1PP8 F;  1FYK A;  1FLI A;  4IJA A;  2V1D A;  1P6R A;  2CW0 F;  1WJ5 A;  3BTC A;  4C3H J;  1HCR A;  4LJZ F;  2QBY A;  4O6J A;  2XHK A;  4ZYA A;  3BR0 A;  1J0R A;  3ABK H;  2E2I J;  1FBQ A;  2E1M C;  2DT7 B;  3K4M A;  5BPI A;  5HLH A;  3DQV C;  5CLS A;  2MH9 A;  1G3T A;  2M4K A;  1FOX A;  4U7D A;  4GRI A;  2UXN A;  1UZC A;  1LJ9 A;  4IRG A;  3E0J B;  4EJT A;  4HW0 A;  2WA0 A;  4HPQ A;  4BHP A;  1JJ8 C;  4C2M J;  2G0E A;  2I8D A;  3EPZ A;  4HG2 A;  3DCF A;  2IXS A;  1LVA A;  4MGR A;  2LDU A;  5L3E A;  4MQV A;  1IXS B;  1WJB A;  4Y17 A;  4F91 B;  2KIU A;  1W5T A;  5ILS A;  1EA3 A;  4HDU A;  1MJA A;  2PMU A;  1D5Y A;  2F48 A;  2FX0 A;  3S1N J;  3FXJ A;  5FRM A;  3ASO H;  5M3M J;  3ASN H;  3KZZ A;  5K7Z A;  3Q5F A;  4ZZD A;  1P4W A;  2A69 F;  2DMU A;  2XB5 A;  2JVG A;  2LTP A;  4Q47 A;  5H6Q A;  1WJD A;  3COA C;  1APL C;  4ENN A;  2DJN A;  2A6T A;  2FEZ A;  3H9G A;  5EYR A;  1L0O C;  1ACI A;  3T8R A;  1MNE A;  2E36 A;  1XG1 A;  2LBF B;  2R5Z B;  1KYZ A;  2NS7 A;  1FSH A;  3L2U A;  4F55 A;  5B66 C;  2NOG A;  4NUB A;  5D5X B;  3HOU J;  3IC7 A;  2F4I A;  3QAH A;  3A0H C;  1AKH A;  2NS8 A;  2ZXW H;  2R7F A;  3V42 A;  5HOO A;  2IAI A;  1WJC A;  1H0M A;  1ETX A;  5BNG A;  1RR7 A;  4ON0 A;  1JKO C;  2LF8 A;  4LK0 F;  3JRD A;  4FE4 A;  4MHG A;  3K1P A;  5DUI A;  1YW9 A;  3MZY A;  3N05 A;  1ETW A;  2ZNZ A;  3L09 A;  3GF2 A;  3OYI A;  3L2C A;  2QBY B;  1RI7 A;  4XRS G;  1Z1D A;  1Q1V A;  3OOU A;  1KON A;  3X2Q H;  2YX4 A;  2JRT A;  2OTL I;  4M3D A;  4B43 A;  2ZSI B;  4WX9 A;  5C44 J;  2LRD A;  3WU2 C;  1ZR4 A;  2ME6 A;  1T39 A;  1U5T C;  4P5O A;  3FZV A;  1TTY A;  3DEU A;  1RR8 C;  4ENM A;  3QYE A;  3BG9 A;  2W24 A;  5TJJ A;  2E2H J;  3OYM A;  1U2W A;  3LMM A;  1ZRF A;  3TDU C;  3L2W A;  1YJ9 I;  1O3Q A;  3VDX A;  1UG0 A;  3WTY C;  1IXC A;  3FKJ A;  4A3D J;  3RQI A;  1U9N A;  1HST A;  2HQ5 A;  1XS9 A;  5DDG A;  3R6S A;  3J7A O;  2I5U A;  3TED A;  3G2B A;  3VOD A;  3OIQ A;  4EQQ A;  3OYC A;  5HDN A;  4A3I J;  4DGW B;  1LVK A;  3IRQ A;  1Z77 A;  2V4J C;  2EFW A;  3ELK A;  5JLX A;  4CGZ A;  4EGZ A;  1WZ2 A;  1QZZ A;  3LAP A;  4CCO A;  2XRL A;  4L0Y B;  3FWE A;  3SDB A;  3GXO A;  4LIV A;  4BQN A;  4IOA F;  3F8B A;  3H36 A;  1K79 A;  2OZ6 A;  5IYB J;  2WAE A;  4A5M A;  4HF1 A;  2X1D A;  4JP0 A;  3M8J A;  3MZ8 A;  4A69 C;  1I6H J;  3ZMV A;  3A03 A;  2XV4 S;  1LNW A;  1AKH B;  3W6V A;  3BTJ A;  1XN7 A;  1WH5 A;  2LY1 A;  2MGQ A;  4R8H A;  2NVX J;  2F5E A;  3GFM A;  4PSX A;  1HW5 A;  1YJW I;  3ZQI A;  1B8I A;  2EIL H;  5D6E A;  1Y0U A;  3TGN A;  2GZW A;  1JGS A;  3ABL H;  4PGG A;  4FET A;  3F6O A;  4PDK A;  4BS9 A;  2Y0S N;  1HSJ A;  3H3V K;  1T6S A;  4J19 A;  1X4P A;  5GPA A;  3W2V A;  3GEZ A;  2LRE A;  3LA7 A;  3PO2 J;  2OC6 A;  5J1U A;  3HHG A;  2VOO A;  4C30 A;  3K70 D;  3QPL A;  4HA8 A;  2EZK A;  1HQC A;  2FA5 A;  2DYS H;  2V79 A;  3WG9 A;  3BY6 A;  2NRA C;  4RS8 A;  4KIC A;  2R7X A;  3FMR A;  3IH3 A;  4GDF A;  5LGU A;  1FP2 A;  1JHH A;  4CO8 A;  1WCM J;  4YFN F;  4XLA A;  1HDP A;  2CJJ A;  4OOI A;  2Z9O A;  1IRZ A;  2HKX A;  3RSN A;  2JVH A;  3WTX C;  1VQ5 I;  2X0L A;  1FBU A;  2R7W A;  1MBG A;  2KP6 A;  2EA2 A;  3BRO A;  2ETH A;  1Z67 A;  4E70 A;  2HYF A;  2W82 A;  5IP7 J;  2A07 F;  2WY8 Q;  2L5Q A;  3GTP J;  3T8T A;  1KZH A;  2DA1 A;  1X3U A;  5KK1 A;  1WH7 A;  3H9Q A;  3DTE A;  2FNA A;  2HOA A;  4ENK A;  2HGC A;  4KIS A;  1ZEL A;  1WRJ A;  1N75 A;  5J8F A;  4M6Y A;  2R5Y A;  4Y7N J;  4LG3 A;  4CCJ A;  4YIF A;  3A1Y A;  1OCP A;  2DMP A;  1IRX A;  2DA6 A;  3QYF A;  1R23 A;  4EM0 B;  5LRS A;  3GX4 X;  3QP5 A;  2G7U A;  2ECB A;  2HTS A;  2KZG A;  2E2J J;  1JT6 A;  1ORK A;  3D5S C;  3L7W A;  5A2Q K;  2K27 A;  3GUD A;  1BW5 A;  2X51 A;  5HDG A;  4ESF A;  1OKR A;  1WPK A;  2ZB9 A;  3R60 A;  1UJ8 A;  5HLG A;  2H94 A;  1B8I B;  4U7B A;  4XSZ F;  2ICW G;  3CO6 C;  5EEA A;  1MJB A;  1GXQ A;  3GFJ A;  2DT6 A;  2E34 A;  1BOB A;  5J40 A;  3AL0 C;  3RCO A;  2ELK A;  5A2Q Z;  5B1A H;  4IXA A;  2EH3 A;  4RGR A;  4ZDL A;  2ZXJ A;  1H9G A;  3BQY A;  2V6C A;  2JUG A;  1XCB A;  2VKH A;  3TO9 A;  3LAJ A;  4E6K G;  4FX4 A;  2LKS A;  3MN2 A;  2EPF A;  2MW8 A;  3S2W A;  1D0Z A;  1X19 A;  1E17 A;  1SFX A;  4XON A;  1OQY A;  3IL2 A;  5FLM J;  4RM2 A;  3RDI A;  2AHQ A;  3G1L A;  1SFK A;  4PK4 A;  3RI4 A;  4KIB A;  3LFU A;  1J75 A;  2BHY A;  3KEY A;  1FIP A;  3OY9 A;  2GWR A;  4WXD A;  3EDP A;  2KL4 A;  1V5E A;  3ECH A;  3HJE A;  5F08 A;  2A5Y B;  3O8H A;  4N4N B;  2ZJR F;  4BH9 A;  2HI3 A;  4M9Z A;  1C0W A;  1WI3 A;  4RDU A;  1REP C;  1VTN C;  2GXB A;  3DXJ F;  2CFX A;  2WBM A;  1B9M A;  1SAU A;  3HC7 A;  1MMD A;  2MG4 A;  1PUF A;  1HW1 A;  4Y33 A;  3WTU C;  3BCB A;  1O3R A;  4UY8 I;  5TRD A;  2R5Y B;  2M1B A;  4OIN F;  1ZH5 A;  2QQ8 A;  1WVR A;  1W36 D;  2Z33 A;  2DA3 A;  1QNT A;  1RES A;  5K5O A;  1X2N A;  2Q2E A;  2K9N A;  2R0Q C;  1LE8 A;  4IZZ A;  2RNG A;  2A61 A;  2R7V A;  4DYR A;  5FD5 A;  3QPH A;  1E3H A;  1FBS A;  2RV8 A;  4CSW A;  2F5C A;  4XLP F;  3RQ4 A;  3WTV C;  5L3F A;  2HS5 A;  1OCZ H;  2EIN H;  4RGS A;  2EB7 A;  3C1D A;  5FLX K;  1WJE A;  3REO A;  4IQ4 A;  3ZMT A;  1X1A A;  2OAZ A;  2CW7 A;  3CZ6 A;  3EET A;  3BZK A;  3TP0 A;  4IX7 A;  3GWZ A;  3H3Z A;  4H0E A;  2XAJ A;  4LG0 A;  3TMO A;  4IRI A;  2BGC A;  1QPI A;  2AXL A;  4UUV A;  3FMS A;  5FLX Z;  5DYM A;  3CUQ A;  3HEF A;  5AIP A;  2QWW A;  4DYC A;  3TP3 A;  3RZO J;  5M5W J;  2DQL A;  2QQ9 A;  4KN7 X;  1G4D A;  3NEU A;  2GLO A;  3I71 A;  3LSI A;  4HAM A;  2PFB A;  5HNH A;  5H2F C;  5ED4 A;  2X48 A;  1F1Z A;  1F43 A;  2LD5 A;  3F8M A;  3OYB A;  2PX9 A;  1NHA A;  1BW6 A;  3CQZ J;  2H8R A;  4E7Z A;  5CYV A;  1JUM A;  2YU9 J;  1T0F C;  1W5S A;  1MDM B;  2MD5 A;  2PJR A;  3GTK J;  3CCM I;  1G59 A;  4IEJ A;  1ZGA A;  2IS6 A;  2DPD A;  4G6Q A;  3T5X A;  2Z1D A;  1Z6R A;  1ZRD A;  4B3X A;  2XIG A;  3LA3 A;  3F72 A;  4PJM A;  1WJA A;  4BQQ A;  2IS1 A;  1RC9 A;  3F0C A;  3RZD J;  1MD0 A;  1O7L A;  3L2Q A;  2QEN A;  1PUF B;  1KQ0 A;  3CTA A;  1HLV A;  4II3 A;  5K5R A;  3D1N I;  2ME0 A;  2W57 A;  1VQL I;  3HIF A;  2H1K A;  2M0C A;  1AWC A;  3Q0U A;  1YIJ I;  2K3P A;  2D2W A;  4B09 A;  3ZCO A;  1YX5 A;  2Q2E B;  3HB9 A;  2X9D A;  2H27 A;  1LE8 B;  3PSF A;  3ZXS A;  4ZDO A;  1K78 B;  2GA1 A;  1U3E M;  2B63 J;  4RM3 A;  1MZB A;  4B8X A;  3VSK A;  5IYD J;  2VBX A;  3LFK A;  3MQ0 A;  3MAJ A;  3GTM J;  4BE2 A;  3KCC A;  2EV6 A;  5D5U B;  1YJN I;  1XX5 A;  3QOD A;  3F8N A;  4KYW A;  3Q9S A;  4RB0 A;  4UHT A;  3AG2 H;  4XBF A;  1VQ4 I;  4LG0 B;  3HYI A;  1HKT A;  3S3O A;  4R79 A;  1V3F A;  3BR3 A;  5KCM A;  1XD7 A;  2VBY A;  3ZQF A;  1VFC A;  2ZFU A;  3RIR A;  5E3M A;  3CUQ B;  3C18 A;  5DV5 A;  2JUC A;  1ZG5 A;  4G6D A;  4I0B A;  4CH7 A;  1O4X A;  2ZKZ A;  1YW7 A;  2FU4 A;  2R7O A;  2BY2 A;  3NWT A;  1FTZ A;  2RC4 A;  2VQL A;  4P9F A;  1YW8 A;  2BZT A;  2HKO A;  1EH6 A;  1IN6 A;  4IOC F;  3RJP A;  2W48 A;  1VQ8 I;  1KA8 A;  4BNC A;  3I56 I;  2OA4 A;  3BLY A;  1U5T A;  3GW2 A;  5FKK A;  1ETY A;  1O57 A;  4EAT A;  2PJR B;  4Z2Y A;  2EFQ A;  1TWA J;  3V4G A;  2VKE A;  2JSP A;  4BU2 A;  1FZP B;  5D5W B;  1K61 A;  2OZU A;  1R5G A;  4LB6 B;  1GUU A;  4B4C A;  3ZN0 A;  1ZN2 A;  5E1W A;  4UUT A;  4IHS A;  4D7M A;  4E7H A;  1R36 A;  1N25 A;  3CCE I;  3FM5 A;  1MH3 A;  4HQE A;  2DA5 A;  1FSE A;  3HSE A;  2K3F A;  4KUM A;  3CLQ A;  2DYR H;  4CHU A;  4M73 A;  5DS9 A;  2EZI A;  1RKW A;  2B9S A;  2O8K A;  2VE8 A;  2ZC2 A;  3BTI A;  3FHN A;  3WOD F;  2CG4 A;  5HDK A;  3I58 A;  3GTL J;  1Q1H A;  3S8P A;  2V9P A;  4II2 A;  2LP0 A;  3DPU A;  1DPR A;  1XGO A;  2CYY A;  2K86 A;  1DGW Y;  2H6C A;  3WHB A;  2OU2 A;  5BQT A;  1SMT A;  3K4J A;  2CS3 A;  1K7A A;  5FB2 A;  2EWN A;  3AG4 H;  3CLO A;  2N8G A;  2E7W A;  5LHI A;  2NNY A;  2IRF G;  1QHG A;  3K10 A;  1JTY A;  2DFI A;  2K9Q A;  4PJL A;  4Q48 A;  3GTQ J;  3EUA A;  2R7U A;  1S9H A;  1ZLK A;  5JHF A;  1BIA A;  2QKL B;  4I0A A;  5GP9 A;  5E3N A;  5K7F A;  4CCM A;  4D5F A;  3E6M A;  5FFZ A;  3RKY A;  1ZR2 A;  3ABU A;  4ZTF A;  2XUB A;  2XB0 X;  3DEE A;  5IP6 A;  3IAS 2;  3BG3 A;  4F52 A;  1IGN A;  3MD2 A;  1U5T B;  3DV8 A;  4IF4 A;  1X3Z B;  1FC3 A;  2E71 A;  5J8C A;  1GV5 A;  1F4K A;  2Y0M A;  1TWC J;  1G3S A;  2KRC A;  1IUF A;  1XB4 A;  4D9J A;  2A68 F;  3VEP A;  1JUP A;  1SVO A;  3UR3 C;  5LD2 C;  2VQH A;  2D5V A;  4YG2 F;  4FT8 A;  1IRG A;  2DFF A;  3F9K A;  4NQW A;  2HYJ A;  1U78 A;  1BI3 A;  2MD0 A;  1MSE C;  4IKF A;  4EVI A;  1DP7 P;  2XAU A;  3BPX A;  2P8T A;  4RLF A;  4PSW A;  3V8L A;  2CW8 A;  2J5P A;  3DLA A;  2G9W A;  1GLN A;  2JPB A;  5IOZ A;  3W6K B;  1NG7 A;  1X2M A;  2F6C A;  3V8K A;  2B7E A;  2BY0 A;  1S6L A;  3EYI A;  4RAG A;  2CQN A;  5JLW A;  1NTC A;  2KT0 A;  3J81 K;  1TNT A;  1OMI A;  2EFP A;  1OYW A;  1W7P D;  4RAZ A;  3LA2 A;  4CYD A;  2CV1 A;  4PJ0 C;  4XRM A;  3JRH A;  1BI1 A;  1QZE A;  2QQB A;  3PNV A;  3B02 A;  2HDC A;  2VJI A;  2RKH A;  2HDW A;  2DBB A;  4YIR X;  4AID A;  1BA5 A;  3J81 Z;  2FXA A;  1KU3 A;  2M2E A;  5FKO A;  1D8K A;  4KIF A;  3QQA A;  4Z6Y A;  2X6X A;  2EZL A;  2KDZ A;  2RDP A;  1T2K A;  3TW6 A;  3SHF A;  4I99 C;  3PIO F;  3FX3 A;  5LFA A;  2EV5 A;  5GAH J;  3HHH A;  1BM9 A;  3ERE D;  3E5X A;  3MKZ A;  2P6S A;  3OL4 A;  4XN0 A;  5FD6 A;  1R22 A;  3DU6 A;  3HGY A;  1TC3 C;  3UNG C;  4E7J A;  1JXS A;  1BR1 A;  4X1E A;  3JSO A;  2ZXI A;  2XSD C;  4R1H A;  4PCQ A;  3OS0 A;  1IN4 A;  5DM7 F;  4AC0 A;  1CQT A;  3ZMD A;  1HKQ A;  2L9S A;  1FY7 A;  1A36 A;  5GAD J;  1SVL A;  3TDZ C;  3FBI B;  3TW7 A;  5CVI A; 
#chains in the Genus database with same CATH homology
 3PO2 J;  5K7H A;  5J1U A;  4IHX A;  4A3G J;  2K40 A;  2LK2 A;  5IP9 J;  3M4O J;  3QPL A;  2DTZ A;  2EZK A;  3JRB A;  2JWT A;  5J1Y A;  4A3L J;  2OF7 A;  3OSG A;  3IH3 A;  3JRE A;  4NDL A;  3A01 A;  5FKN A;  4D7N A;  1WCM J;  1HDP A;  2CJJ A;  1IRZ A;  2QF7 A;  1ZGW A;  2JA8 J;  1OJL A;  4DW6 A;  2HXO A;  1IDY A;  3LSJ A;  2P81 A;  4QTR A;  1MBG A;  2WAQ N;  3Q3S A;  1FEX A;  1IJW C;  2LKX A;  3K2A A;  3HM5 A;  5IP7 J;  1IC8 A;  4C3J J;  3GTP J;  1ETK A;  2DA1 A;  4DZP A;  3S2H J;  1WH7 A;  2FD5 A;  1JGG A;  2HOA A;  4S0H B;  3QPS A;  4MO7 A;  3NAU A;  1I3Q J;  1TWG J;  3G1O A;  4CYC B;  2HXI A;  2R5Y A;  4AYB N;  1U9O A;  4Y7N J;  4L5E A;  1TWH J;  1ITY A;  1OCP A;  3BR6 A;  4M3B A;  4RBO A;  2DMP A;  2DA6 A;  3GTO J;  3S14 J;  2ECB A;  2L9R A;  1OCT C;  3LNQ A;  5F0H A;  2E2J J;  4IHV A;  1JT6 A;  1ORK A;  1A6I A;  2XGC A;  1BW5 A;  2L7M P;  2ZB9 A;  1WPK A;  2DA4 A;  5F0C A;  5F27 A;  5HOD A;  3JRF A;  1LFU P;  1B8I B;  2LFB A;  3BR2 A;  5EEA A;  3I4N J;  1QVT A;  3A02 A;  5EG0 B;  1F36 A;  3S1Q J;  2LVS A;  2ELK A;  1MBH A;  3PM1 A;  3HKZ N;  2EH3 A;  1TWF J;  2CQX A;  4A93 J;  5GPC A;  1NK2 P;  3BQY A;  4FIS A;  3S1R J;  1OFC X;  3MN2 A;  3FIS A;  1JKR C;  4FTH A;  2MW8 A;  5J3L A;  1IG7 A;  3B6A A;  3MKL A;  3ZQL A;  5FLM J;  4GFB A;  4G12 A;  2AHQ A;  3G1L A;  2COB A;  4X6A J;  3A01 B;  3IV5 A;  2O9L A;  2MSY A;  4MFE A;  1FIP A;  4I6Z A;  4M3F A;  4BBS J;  2EZH A;  5M5X J;  5F08 A;  3SDG A;  2XPW A;  1X58 A;  2ECC A;  3O8H A;  2K9S A;  3Q0V A;  2EBI A;  5IOY A;  2HDD A;  2DMN A;  2HI3 A;  1WI3 A;  4RDU A;  2I10 A;  1HOM A;  1ENH A;  1BJZ A;  3I4M J;  2VKV A;  1ETQ A;  3CCY A;  1FTT A;  2PMZ N;  1K83 J;  2JJ7 A;  2MG4 A;  3IH4 A;  3LSG A;  1PUF A;  2JA6 J;  4A3C J;  4A3M J;  5EZG A;  2L7Z A;  4DZJ A;  2R5Y B;  2X6O A;  5IPA A;  3GBG A;  4BY7 J;  2DA3 A;  4M6V A;  1LFB A;  3S2D J;  1RES A;  1X2N A;  2K9N A;  2R0Q C;  1LE8 A;  2DA2 A;  4Y52 J;  1YRN A;  4JX4 A;  4DYR A;  1RET A;  2L7F P;  2CQQ A;  2DA7 A;  4V2F A;  5EGO A;  4C3I J;  3HOV J;  2JA7 J;  2VI6 A;  5E3L A;  3JRC A;  4MLO A;  2CRG A;  3H0G J;  3HOW J;  5EF6 A;  3OSF A;  3TP0 A;  4V2G A;  2XPV A;  4BXX J;  1QPI A;  3CMY A;  2M34 A;  1W0U A;  1MSF C;  3L1P A;  2R92 J;  2FJ1 A;  3HEF A;  4DYC A;  3TP3 A;  3RZO J;  1GVD A;  3E7L A;  5M5W J;  1HDD C;  3BT9 A;  1SFO J;  2CUE A;  2GLO A;  4IHY A;  1H89 C;  1DU6 A;  1IDZ A;  2IEK A;  4A3B J;  5M5Y J;  2DMT A;  2X48 A;  3VPR A;  1F43 A;  2LD5 A;  3FIW A;  1ZTR A;  4XK4 A;  3C2B A;  1BW6 A;  3CQZ J;  2H8R A;  2YU9 J;  3JR9 A;  1JUM A;  3GTK J;  4IEJ A;  2LLK A;  3ZOB A;  1A5J A;  2R93 J;  1WGX A;  3BR5 A;  5FKM A;  2R7Z J;  3F0C A;  3RZD J;  4W97 A;  5J1R A;  4BKX A;  1PUF B;  2HOS A;  1VI0 A;  1U8B A;  3FKI J;  1MBK A;  1HLV A;  3D1N I;  2ME0 A;  3JRG A;  4JYK A;  2H1K A;  3UKG A;  2M0C A;  3Q0U A;  3LSR A;  3HB9 A;  2E19 A;  2FQ4 A;  1JJ6 C;  2ID6 A;  2X9D A;  1LE8 B;  1GV2 A;  4LOC A;  5C3E J;  3HOY J;  1JUS A;  1YRN B;  2TCT A;  2B63 J;  2GBY A;  5E3O A;  3RKQ A;  2DMQ A;  1MH4 A;  9ANT A;  4XIC A;  5EZH A;  5IYD J;  2Y9Y A;  3GTM J;  4IHW A;  5EGO B;  2E1O A;  4JX6 A;  4MIM A;  2JMW A;  3JRA A;  1P7J A;  4DYQ A;  4XID A;  5M3F J;  3HBL A;  3Q0W A;  5F1J A;  1H8A C;  1MBJ A;  1AHD P;  4W1U A;  3BG5 A;  4M3G A;  1E3O C;  3MVP A;  4EEF G;  3BR3 A;  3HOX J;  3ZQF A;  1VFC A;  4A3J J;  5E3M A;  2R5Z A;  2Y2Z A;  2Y31 A;  4B3A A;  3FK7 A;  2NVQ J;  1O4X A;  3S1M J;  5EDN A;  2ID3 A;  3IH2 A;  3ZQG A;  1FTZ A;  1MNM C;  1POG A;  2NVY J;  1UHS A;  1SAN A;  5DTD A;  4UUS A;  4FCY A;  2AO9 A;  5FLV A;  2W48 A;  4CYC A;  3WHC A;  1T33 A;  2JA5 J;  2CU7 A;  1ETY A;  5FKK A;  5C4J J;  3ZQH A;  1UG2 A;  1QVU A;  3S17 J;  1TWA J;  2VKE A;  1ETO A;  1K61 A;  3PO3 J;  2Y30 A;  3BTC A;  4MFD A;  4B4C A;  1GUU A;  4C3H J;  1HCR A;  3BR0 A;  4UUT A;  4D7M A;  2E2I J;  2L0K A;  3HGG A;  5F0F A;  1S7E A;  2VUM J;  1MH3 A;  1B72 A;  4JX5 A;  2DA5 A;  5FKL A;  1HF0 A;  1ZKG A;  1RPW A;  1JJ8 C;  5DS9 A;  4QIW N;  2EZI A;  4C2M J;  3CDL A;  2NVT J;  1RKW A;  2G0E A;  2O8K A;  4D5C A;  3BTI A;  1Y1W J;  3DCF A;  3DEW A;  4QSH A;  1NK3 P;  3GTL J;  2VPR A;  1IV6 A;  2QCO A;  3K7A J;  2LP0 A;  1D5Y A;  3S1N J;  2FX0 A;  1H88 C;  3OIO A;  1ZK8 A;  5M3M J;  3WHB A;  4I76 A;  4AUX A;  1FJL A;  5K7Z A;  2DMU A;  2XB5 A;  2LTP A;  5FJ8 J;  1APL C;  2DJN A;  2N8G A;  5EYR A;  2YS9 A;  1JTY A;  2K9Q A;  3GTQ J;  3ZQC A;  3HOZ J;  1ZQ3 P;  1XG1 A;  2R5Z B;  2NS7 A;  2M9H A;  2NOG A;  5GP9 A;  4FE7 A;  1BL0 A;  5E3N A;  5K7F A;  3HOU J;  3FK6 A;  4D5F A;  3JRI A;  3S15 J;  1MBF A;  1AKH A;  1ZR2 A;  2NS8 A;  2IAI A;  2JK3 A;  2XB0 X;  1ETX A;  2JN6 A;  5BNG A;  5IP6 A;  4UUS B;  5F04 A;  1RR7 A;  1VND A;  1UMQ A;  3BG3 A;  3JRD A;  1JKO C;  1IGN A;  1I50 J;  4FE4 A;  4M3E A;  4A3K J;  1P7I A;  1GV5 A;  2WB1 N;  3S16 J;  2YUS A;  1ETW A;  1TWC J;  3HDD A;  1XC5 A;  1IUF A;  1JUP A;  1T56 A;  4XRS G;  1Q1V A;  3SJM A;  2CUF A;  3OOU A;  3NAR A;  2D5V A;  1U78 A;  2HYJ A;  4M3D A;  1MSE C;  5C44 J;  1ZR4 A;  2ME6 A;  2EQR A;  2HOT A;  3G1M A;  1B72 B;  2WV1 A;  3BG9 A;  1DU0 A;  2E2H J;  1JKP C;  2TRT A;  5IOZ A;  3O8G A;  4BY1 J;  1Y1V J;  3BTL A;  1X2M A;  1Z0X A;  1VF9 A;  1G2H A;  4A3D J;  4ABZ A;  3RQI A;  1U9N A;  5JLW A;  1FIA A;  1NTC A;  2KT0 A;  3BR1 A;  1W0T A;  2HQ5 A;  1XS9 A;  1AU7 A;  2XGE A;  2Y9Z A;  3TED A;  2XPU A;  4XRM A;  3JRH A;  1GT0 C;  1MBE A;  4A3I J;  3LSP A;  1JKQ C;  1BA5 A;  2M2E A;  5FKO A;  1Z77 A;  2OPT A;  2LY9 A;  5JLX A;  2LR8 A;  5IYC J;  1QRY A;  2O7O A;  3QQA A;  1GDT A;  2DN0 A;  2EZL A;  4B1R A;  2KDZ A;  3TW6 A;  4XRS A;  2XRL A;  2RAE A;  3M3Y J;  4A3F J;  1JTX A;  5IYB J;  4JP0 A;  4A69 C;  1I6H J;  3A03 A;  3BQZ A;  1AKH B;  3W6V A;  3BTJ A;  2GM4 A;  1WH5 A;  2MGQ A;  2NVX J;  3HGY A;  3B6C A;  4HNV A;  4BBR J;  1R9T J;  5C4X J;  1TC3 C;  4A3E J;  3ZQI A;  1B8I A;  4X1E A;  2XSD C;  1RKT A;  5EG0 A;  4AC0 A;  3GTJ J;  3SFI A;  1CQT A;  2XGD A;  3GTG J;  2M8G X;  2Y0S N;  2IBD A;  3H3V K;  4J19 A;  1JT0 A;  1EF4 A;  5GPA A;  1ETV A;  3TW7 A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...