2DMTA

Solution structure of the homeobox domain of homeobox protein barh-like 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
GSSGSSGGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Homeobox protein BarH-like 1
publication title Solution structure of the homeobox domain of Homeobox protein BarH-like 1
rcsb
source organism Homo sapiens
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dmtA00
4XRSA 3S17J 5EYRA 4M3DA 2Y9YA 2DA2A 2L7ZA 3BTLA 5J1RA 1QRYA 5EZGA 3JRGA 2EZLA 3MN2A 3ZQCA 1A5JA 4C3IJ 2HI3A 3HDDA 5K7HA 2JA7J 3HOWJ 1MH4A 4MFEA 2EQRA 3HKZN 1JKOC 1DU6A 1VI0A 3LNQA 4V2GA 1XC5A 2IBDA 3WHBA 1SFOJ 4A93J 3TP0A 5M5YJ 4BXXJ 4A3FJ 1ZTRA 3PO2J 3JREA 5IP7J 3HB9A 3TEDA 2JA5J 1GV2A 4M3BA 3S1QJ 3BG5A 4QTRA 4RBOA 2EZIA 3SJMA 2QF7A 1JUMA 5C4JJ 2DMPA 2ID3A 1ETOA 1TWFJ 1YRNB 3I4NJ 1HLVA 2Y2ZA 4GFBA 3BR5A 4D5CA 2NS7A 4B3AA 2E1OA 5BNGA 4J19A 2JWTA 2DTZA 1RPWA 3CCYA 1FIPA 2DA5A 3IH2A 4DYRA 2Y0SN 1MBEA 5J1UA 1ZQ3P 5J1YA 1HDPA 2CQQA 1MBFA 3LSGA 4JX6A 3GTMJ 4IHYA 1ETXA 1MBJA 1QVUA 2R5YB 1B72B 2HOTA 4UUTA 3H0GJ 1LFUP 1CQTA 1U9NA 2ELKA 4DYQA 5M5WJ 3HBLA 2R0QC 3W6VA 5E3LA 2PMZN 1K83J 1WH5A 2ME0A 2P81A 3O8HA 4W97A 1B8IB 3GTJJ 2E19A 2XPUA 3TP3A 1NK2P 5IP6A 3JRDA 3K7AJ 1YRNA 4QSHA 2LR8A 2JA8J 2COBA 4L5EA 3E7LA 4M3EA 3SFIA 1RKTA 3BQYA 1BW5A 1EF4A 2ECCA 3PO3J 2IAIA 2VUMJ 2JA6J 2L9RA 2DMNA 2XGCA 2NVXJ 2E2IJ 2DA1A 3BR1A 2R5ZA 5EGOA 3GTLJ 1RETA 4JX4A 1ITYA 3M3YJ 3GTKJ 3FK7A 2HXIA 2R5YA 2LKXA 1B72A 3M4OJ 4NDLA 2CUFA 1Y1WJ 3BR3A 4I6ZA 3ZQFA 1BL0A 2OF7A 2M34A 4A3CJ 2L7MP 1SANA 4BY7J 5IPAA 4FTHA 1VFCA 3S16J 3A03A 1JJ6C 3Q3SA 4A3IJ 2VKVA 2NVQJ 1JJ8C 2ZB9A 3MKLA 2XPVA 1IDZA 2DA7A 1JKQC 4IHWA 5FKOA 1FTZA 5F0HA 4M3GA 3ZQLA 4Y7NJ 3A01B 2E2JJ 4IEJA 1K61A 1LFBA 3F0CA 4S0HB 2OPTA 1TWHJ 2VPRA 4B1RA 2LD5A 1X2MA 4D5FA 4DZJA 5JLXA 2YU9J 5F1JA 4XICA 1ETQA 5IYDJ 2O8KA 1UG2A 2CRGA 3IH4A 4UUSA 4A3EJ 2X6OA 4BBRJ 1WGXA 2XSDC 2FJ1A 2WB1N 5EG0B 3GTOJ 1IUFA 1OFCX 4JYKA 5GPCA 4C3JJ 1H88C 1JKPC 3Q0VA 1UMQA 1HDDC 5M3MJ 3LOCA 1RR7A 2YS9A 2XRLA 4D7NA 3TW6A 1ZK8A 4A3MJ 5DTDA 3TW7A 2Y30A 3HOVJ 3A01A 5GP9A 4Y52J 1I50J 3G1OA 5C4XJ 2NOGA 1W0TA 1Z77A 3HOXJ 5E3NA 3GTPJ 1ETKA 3H3VK 2JMWA 5FKLA 1OJLA 2X48A 1IJWC 4A3KJ 1IV6A 1DU0A 4FE4A 3JRAA 1T56A 1P7JA 3S14J 1I3QJ 3OIOA 4JP0A 1XS9A 5JLWA 5FKKA 2H8RA 2XPWA 2R5ZB 2LFBA 3MVPA 5EG0A 3OSFA 5EGOB 3JR9A 2R92J 1JTYA 2ID6A 1AU7A 3QPLA 4XK4A 3G1LA 2GLOA 2HOSA 3A02A 1MBKA 4A3JJ 2DMTA 3L1PA 4MFDA 1D5YA 4X1EA 1WCMJ 4FE7A 3BR6A 1AHDP 3OOUA 1FEXA 4G12A 1Z0XA 4LOCA 1U8BA 2W48A 3HEFA 2K40A 1JT0A 3QPSA 2GM4A 3FISA 3WHCA 2EH3A 5K7ZA 5FKMA 1AKHA 3GTGJ 2LVSA 2FX0A 2XB5A 3HOUJ 2G0EA 4AC0A 1MNMC 3Q0WA 1LE8B 1HF0A 2CU7A 2HQ5A 2H1KA 1GVDA 2AO9A 3GBGA 5IYCJ 2EZHA 4XRMA 4CYCA 1OCPA 3O8GA 1U9OA 5FLMJ 4V2FA 4AYBN 2EBIA 3NAUA 2IEKA 1E3OC 4W1UA 4BBSJ 2DJNA 1BJZA 3HM5A 1MBHA 5E3MA 4A3GJ 4UUSB 4C2MJ 1ZR2A 5C3EJ 2B63J 1NTCA 9ANTA 4D7MA 2TCTA 2VI6A 3ZQIA 2CJJA 1TWCJ 1HOMA 1JUSA 1APLC 3FKIJ 2CUEA 1GDTA 3GTQJ 2D5VA 1X58A 3S15J 2XB0X 3C2BA 3SDGA 3BQZA 1MSFC 1ZKGA 3G1MA 3HGGA 2WAQN 1LE8A 4XIDA 1FJLA 3ZQHA 5E3OA 2R7ZJ 3DCFA 1O4XA 5EDNA 2M8GX 2E2HJ 5F08A 4X6AJ 3BG3A 2EZKA 2HXOA 2DMQA 1XG1A 3JRFA 1NK3P 3NARA 5F0FA 4B4CA 3ZOBA 2MSYA 1Y1VJ 4DYCA 4EEFG 4HNVA 1BW6A 5HODA 1ZGWA 3RZOJ 4A3BJ 1ZR4A 4M6VA 1MSEC 1GV5A 5FLVA 4XRSG 1MBGA 4AUXA 5IP9J 2MGQA 3B6AA 1RKWA 2FD5A 4JX5A 4IHXA 3LSPA 2L0KA 2DA4A 3S1NJ 2M2EA 1TWGJ 1HCRA 2HOAA 2N8GA 2K9SA 3HOZJ 2XGEA 2I10A 4IHVA 3RKQA 5IYBJ 3VPRA 1BA5A 3BTIA 2JJ7A 1U78A 2CQXA 4FISA 1PUFB 5C44J 5K7FA 3IV5A 3S2HJ 3UKGA 1AKHB 4A3LJ 2O7OA 1FTTA 3JRBA 3OSGA 3I4MJ 2LTPA 1Q1VA 3CQZJ 4DW6A 1ORKA 1F43A 4DZPA 2M9HA 2MG4A 4CYCB 2K9NA 2FQ4A 1WH7A 3BTCA 3B6CA 1QPIA 4A3DJ 4MLOA 4MO7A 1MH3A 2VKEA 3D1NI 1ENHA 4QIWN 4C3HJ 1RESA 2HDDA 2NVTJ 3S2DJ 1JKRC 1WI3A 3S1MJ 2WV1A 3RQIA 1F36A 5FJ8J 2RAEA 2AHQA 3BG9A 1S7EA 3BR2A 1VF9A 5M3FJ 4ABZA 1PUFA 2GBYA 5M5XJ 5EF6A 4BKXA 3ZQGA 3HOYJ 2DA3A 1GUUA 4BY1J 2R93J 1ETYA 1H89C 1OCTC 4A69C 5J3LA 2L7FP 3K2AA 1G2HA 1JTXA 5F04A 2X9DA 2ME6A 5EZHA 2DMUA 2DN0A 3PM1A 5IOYA 1TWAJ 3JRCA 3S1RJ 1POGA 2NS8A 2K9QA 1IGNA 2YUSA 4FCYA 5GPAA 2MW8A 1ETWA 1QVTA 1IDYA 5F27A 2O9LA 2KDZA 2HYJA 2LLKA 2JN6A 1WPKA 2XGDA 3BR0A 2NVYJ 1R9TJ 2JK3A 1JT6A 3Q0UA 1I6HJ 2DA6A 1P7IA 1VNDA 1X2NA 5FKNA 2KT0A 2M0CA 3FK6A 1TC3C 3JRHA 3BTJA 2Y9ZA 1IG7A 1ETVA 2Y31A 1IRZA 1FIAA 2LK2A 2LP0A 3DEWA 3LSRA 2LY9A 3QQAA 3JRIA 1JGGA 1JUPA 3LSJA 1GT0C 3BT9A 1W0UA 3CDLA 1A6IA 5F0CA 3CMYA 1H8AC 2TRTA 5DS9A 1T33A 1UHSA 3RZDJ 4I76A 1B8IA 3FIWA 1IC8A 4MIMA 5IOZA 3HGYA 4M3FA 3IH3A 5EEAA 2QCOA 2ECBA 4RDUA
chains in the Genus database with same CATH superfamily
2P5VA 1BI0A 4XKWA 3S17J 3DKXA 2Y9YA 1RUNA 3FXRA 3GEZA 5GAGJ 1FP1D 2DA2A 2EV6A 3CP8A 2L7ZA 3X2QH 2HOEA 3BTLA 1WJAA 5J1RA 1QRYA 2KIUA 1LPQA 2HPIA 4GYGA 4XSZF 5EZGA 4OIRF 3HUGB 3JRGA 4RAZA 4KNYA 3ZQCA 4OOIA 4C3IJ 4CCJA 5KK1A 4OMZA 2HI3A 3TBIA 2JA7J 1MH4A 2ZXWH 5DUKA 3S8PA 2CV1A 4HX4A 3AG2H 2OAZA 1G6NA 3LNQA 3CUQB 4V2GA 5L3BA 1U3EM 3OYMA 2HVQA 3PFIA 1U8RA 5M5YJ 2P6SA 3KP3A 1T6SA 3CJNA 1G59A 4IXAA 2DT7B 2Q2EA 2MYSA 4A3FJ 1ZTRA 4PFOA 2HVRA 1Y0NA 4PDKA 1OPCA 1OYWA 2FMLA 4MNUA 5CVRA 4F91B 3IAS2 3S1QJ 5DCFA 2P8TA 3E0JB 4QTRA 4NHJA 2HZDA 4RGSA 1BIBA 2RNJA 1MMDA 5D6FA 1I1SA 5DM6F 2Z3YA 2ID3A 3CCUI 4ZTFA 2QEXI 1X3ZB 3E5QA 1MJBA 2OZUA 1CGPA 3I4NJ 1FPQA 4XKBA 2ZNZA 1HLVA 3TGNA 3TKYA 1YOVB 2V1UA 3J81Z 5BNGA 3K69A 1DQUA 2NNYA 4HV6A 5D5WB 3BJOA 1FIPA 3MZ8A 2VXZA 2V7FA 3VYUB 1MBEA 1ZQ3P 4XSXF 2CQQA 2HDCA 3VWBA 2R5YB 5LRSA 1CQTA 1LFUP 3CD6I 4LG0B 4HRIA 4AVZA 4YFKF 3M1EA 2K7LA 2FU4A 4L0YB 5E3LA 2HFHA 1K83J 4W97A 2KDOA 3BZ6A 3FDYA 1XCBA 1B8IB 1V3FA 2XRNA 1D0XA 1R58A 2OUMA 3IKVA 1NK2P 1YRNA 1EKEA 1Y56A 2G7HA 3VDXA 2V6EA 2JA8J 2D1HA 4IF4A 3DLAA 5JHFA 3MZHA 2Z16A 3SFIA 4XL9A 2ECCA 2KJBA 2Q8KA 4HYEA 4R1HA 2FRHA 1AOYA 1PYVA 1FY7A 2HYFA 2FEZA 1A36A 1P9QC 3GTLJ 5D8KB 5KVRA 1XSXA 3ASOH 1MW7A 1ITYA 3M3YJ 3ROUA 3FK7A 2MA3A 3M4OJ 3R6SA 2CUFA 2XDVA 1PJRA 3DXJF 4F55A 2KISA 2WBMA 2VC0A 6PAXA 5IPAA 4XMYA 2LKPA 3FXLA 2K4JA 3CESA 3Q3SA 3IL2A 3WGHA 1R22A 1UJ8A 1XMAA 2XAQA 2PMHA 5ICFA 3RIRA 1IDZA 4IHWA 4XLCA 2ICWG 3S3MA 2LYCA 1Z7UA 2STTA 4EATA 1VQ6I 4ZDOA 1E17A 3F0CA 2ZKZA 2OPTA 3K1PA 2W1OA 4V19K 1QZYA 2CUJA 1F1ZA 3KLNA 1X2MA 3ASNH 1BR1A 3OWTA 3QODA 4M6YA 5JLXA 3ZMTA 2YU9J 4HLYA 1GXPA 1O3SA 1UG2A 3W6KB 3G73A 2L3DA 3F8BA 4A3EJ 3EPZA 4GCVA 3VODA 4AD9A 1UG0A 3HXLA 5E1WA 2F48A 2XSDC 3BY6A 2DU9A 4M9SA 5L3DA 2V1XA 1OFCX 3RPQA 3V8KA 1F9NA 4E7IA 1LDDA 2BY2A 2UXNA 3I59A 2HQAA 4YIFA 4C3JJ 1H88C 5LEKA 2AXLA 2VONA 3Q0VA 3ZPLA 2DOEA 2LF8A 5D4SA 1HDDC 4BDZA 5ED4A 4BYYA 2XVCA 2QSHX 2EIJH 2RC4A 3LOCA 4C2TA 2DCEA 1I5ZA 3G71I 4KIFA 2FUG2 2TDXA 2VJ5A 1I50J 3G1OA 2M0MA 1ZN2A 4L0ZB 3N97A 4OINF 1ETKA 1E3HA 4XM3A 3M9AA 2OC6A 5FKLA 5JHUA 4PJNA 4EJUA 2K27A 4EJTA 3S3NA 3BROA 2CYYA 1WSUA 2MH9A 3PQJA 4XLHA 1SD7A 1OYIA 3R61A 5FKKA 2LMDA 4BQOA 4BJ6C 2LFBA 5EG0A 2L9NA 3OSFA 1JTYA 2FMYA 1VZ0A 4BHPA 1ON1A 5FD5A 3E6BA 3OIPA 3G1LA 3SZPA 4N4NB 2HOSA 3HTSB 2DMTA 3L1PA 4M6XA 3DTEA 2CQKA 4GGGA 4ZZLA 2BXYA 2FOWA 3UR3C 3KPHA 2ZNYA 3BR6A 1AHDP 5DYMA 3N05A 4MQ9F 3OYGA 1JT0A 2P4WA 2GM4A 4CHUA 3FISA 1L3LA 2K3FA 2QZ8A 4M72A 2EH3A 4LJZF 3FKJA 2JRMA 1XB4A 2O3FA 2EJRA 5L3CA 3GVAA 3G2BA 2AQFA 2K3PA 3Q0WA 1MNMC 3PIPF 2Y48A 3FMQA 2HPMA 3L9FA 3J7AY 4PSXA 3D5RC 4ENKA 4ITVA 5CVUA 4CYCA 2VBZA 3W2VA 3QPTA 4PK4A 2GQQA 3ZMVA 3FXUA 1TL8A 3NAUA 5LGTA 3OY9A 3RKXA 1E3OC 2B9SA 1YS6A 3K70C 3HRTA 3WTXC 2VKDA 1HW1A 3HM5A 2NS0A 2MBFA 4OU0A 2OCCH 4UUSB 2RQPA 1ZR2A 2B63J 3LSMA 2IA0A 2EFWA 3HSRA 1HOMA 3ZQIA 3EUHA 1JUSA 2R7WA 3FKIJ 4N0BA 1W7PD 1U2WA 2CUEA 1DGWY 3K2ZA 2COMA 4MHGA 3ZP5A 2EV5A 3PNTA 2K02A 2QENA 1BC7C 3HRUA 2W85A 3C2BA 1U5TC 3SDGA 3OR2C 3U21A 2A05A 4ENMA 3T5XA 4IHSA 5DUIA 1X4OA 4ON0A 3G1MA 1S7AA 3HGGA 3IWZA 2R7TA 2PQ8A 4U7BA 1LE8A 4YEJA 4XIDA 1FJLA 3ZQHA 4BDYA 1Z3XA 5EDNA 2XIGA 3M7GA 1W5CC 1YLFA 3BG3A 1XD7A 2P7CB 4LLLA 3E97A 1FNNA 2VE9A 1R1VA 2PX9A 3GW2A 4B4CA 1NK3P 4HDUA 4A3BJ 1PP8F 1ZGWA 3OMYA 2Y0SA 2XGXA 4Q47A 4WF2A 1GV5A 4LB6B 1MSEC 5FLVA 5KAIC 4XRSG 2J5OA 3TOBA 2IS6A 1MBGA 5IP9J 3FXJA 2MGQA 2QKMB 3B6AA 1K79A 1D1CA 1D1BA 2CFOA 4IHXA 3LSPA 5B5EC 2DA4A 4MQVA 3S1NJ 1TWGJ 2WAFA 1ZELA 2N8GA 2IA1A 2QUFA 5E79C 2M1BA 2XSJC 1Z3YA 3VPRA 3HRMA 2VJ4A 4L9JA 3J7ZI 2EFQA 2F6CA 2HQNA 1RC9A 1SD5A 4UB8C 5K5OA 2D1VA 4HF2A 4G6DA 4HNUA 2E7WA 4HAMA 4IO9F 2EA2A 3LSKA 5K7FA 3P7NA 4CICA 4IQJA 3S2HJ 2ZJPF 1AKHB 4A3LJ 1P92A 1W7PB 1Q1VA 2VJJA 3CQZJ 5E8GA 2HZTA 4DZPA 3PL8A 1ZRCA 5HDGA 4P96A 1F5TA 2BHYA 4YIIA 3MKWB 2K9NA 4R8HA 1WH7A 2DXIA 2Z99A 4BHBA 1IRFA 2IS4A 4IL6C 4NQWB 2VKEA 2V1NA 1ENHA 1QGPA 3E5XA 4QIWN 1B1BA 1RESA 3HOSA 1JKRC 4QWQA 5HLGA 1V54H 3S1MJ 2WV1A 4QLCU 2JQ7A 1MNDA 2PBIA 4WXCA 1X1BA 2V6CA 1J5YA 1UHMA 3UNGC 3CO6C 5FFXA 1VF9A 1Y0UA 1E3PA 1ERDA 2GBYA 3HL2A 2Z1DA 4IRHA 2V1DA 2VQLA 2DTRA 2L02A 2L5QA 1GUUA 3M8JA 3ONQA 2PI0A 4BY1J 4HEA2 1P6RA 4XLAA 4J00A 3S3OA 2CW0F 2STWA 4IHTA 3TO6A 1H89C 2KIQA 1OCTC 4UVAA 4P9FA 2VBYA 1IRGA 5F04A 4RA2A 2ME6A 2E7XA 5IOYA 4LFUA 5DD8A 2HWVA 1FYMA 5ILVA 2XF7A 1UAAA 3MKZA 2VLAA 2BXZA 2D2WA 2FSWA 5DDGA 1ZG5A 1ETWA 3K4CA 1IDYA 3ML6A 1DP3A 2O9LA 3DTIA 2KDZA 3KEYA 2MABA 4RAFA 2O6GE 2K85A 4RAYA 2JN6A 2PJRA 2CMPA 2KP6A 1WPKA 5KNLA 1WVRA 3FHZA 4G7OF 2YSRA 2ZFUA 2CG4A 2NVYJ 1R9TJ 5CJ9A 3MKYB 1HKSA 1LKXA 3Q0UA 1G3YA 4IPAA 5H6QA 4LMYA 3JAMK 2E1NA 1O57A 5FKNA 4OMYA 4PSWA 3FK6A 1TC3C 1YX5A 3JRHA 4WK8F 4B43A 2EV0A 2Y9ZA 1IG7A 2KL4A 4UVCA 2CO5A 1FIAA 3U1KA 2LY9A 3QQAA 2VB6A 1JGGA 2A3SA 4ZJZA 2W7NA 1MDMA 4LIUA 1A6IA 4C30A 2EINH 4R79A 2V9KA 1HQCA 4MTEA 3W6JB 1UHSA 3JAMZ 1UCRA 1IC8A 2Q2EB 4MIMA 2NNNA 2MH2A 3RSNA 3HGYA 3L2VA 5HLIA 5DM7F 1V5FA 4XRSA 3AL0B 3ABUA 3I71A 1WFXA 3WU1B 2RN7A 2LSOA 1LFPA 2EA4A 4NNJA 2EZLA 3K4NA 3LA7A 3TO9A 1A5JA 4Y17A 3V4GA 1IW7F 4BQQA 3HDDA 5K7HA 4D1QA 3HOWJ 1P4XA 1R23A 3GWZA 4NBQA 3RPUA 1LEBA 2ACJA 5B3SH 2KIMA 2W84A 2KPMA 3ABTA 1VI0A 3OYCA 4M73A 3GCMA 1SFOJ 4A93J 1HKTA 3D0SA 4XONA 1EH8A 4DNCA 3P9IA 2WA0A 3T8TA 3P9KA 3JREA 1S9HA 4U88A 3I5UA 3SZTA 1YJWI 4BNCA 1X1DA 1GV2A 5HLTA 4M3BA 3BG5A 2IT0A 2HVSA 3KIOA 2LC2A 1JUMA 5D5UB 5C4JJ 2WTEA 5L3EA 2DMPA 1ETOA 3NQOA 2NXNB 4N4OB 2R7SA 1U6GA 2WWYA 1YRNB 1JHHA 3Q9VA 4D5CA 1Z9CA 2NS7A 3TMOA 5KAFC 3RYRA 4MTDA 3CO7C 3LAJA 1T08B 3WE3A 1FOWA 2Y0SN 3WTZA 1HDPA 3WTTC 1IXRC 3O6BB 1OCRH 3OOPA 4HPQA 2F4IA 1MBJA 2CGPA 4TV7A 5LGUA 4IKFA 4L5IA 3RTRA 3CC2I 3KP6A 1LJ9A 4DYQA 3GZ5A 1YHQI 5M5WJ 3HBLA 3H5AA 2R0QC 5GADJ 3W6VA 4I2OA 3KETA 4UXNA 2ME0A 1O7FA 1MJ9A 2ZJ2A 3DKYA 1S29A 5CVJA 3ZCOA 3WG9A 1ZG1A 1W36D 3HZJA 1I27A 1EA3A 2FBHA 4QSHA 4CCOA 3OV8A 3FHNA 2VOPA 3BQYA 1BW5A 2WC2A 2XF5A 2VUMJ 4CDGA 2CUZA 3HHHA 2IP2A 4X0GA 3ERED 3FXMA 2E2IJ 2DA1A 1YJNI 3ZGKA 3BCBA 5EGOA 4BXUA 3LSIA 5LHHA 3KYCB 2IVMA 4XRFA 3TOAA 3CLOA 1KU9A 3BWGA 1B9NA 1ZGJA 4HOBA 3PSFA 1T39A 1RRJA 3HC7A 1Y1WJ 4I6ZA 3ZQFA 4LD5A 3ZMSA 3CMEI 1X3WB 3CCMI 4KYWA 3ZR8X 4WXHA 2OF7A 4A3CJ 2NRAC 4HZFA 4BY7J 3T8RA 3I59B 2JT1A 4FTHA 3A03A 1VFCA 2P7VB 3HJEA 3CCJI 1JJ6C 2O8XA 1FC3A 4A3IJ 2VKVA 3F8MA 1JJ8C 1K4SA 2XPVA 1EV7A 2O5RA 3KCCA 3VB2A 2DPDA 2F5FA 2WY7Q 5DD4A 1I1GA 1T2KA 1LFBA 3MZYA 1OCZH 4S0HB 2VPRA 5LGNA 3ECOA 5F64A 3M8EA 4I0AA 1I6XA 1T38A 1R5GA 1KZHA 4G6QA 1B4AA 1X1AA 2VC1A 4OWRB 5IYDJ 3GMEA 5B1BH 2ZJRF 3NWSA 3GXOA 1JGSA 2DYRH 1TBXA 4RMNA 3K1NA 3HPGA 4NC6A 5EG0B 3E1SA 2OU2A 1JXSA 3FWEA 3GFLA 2H1LA 3H9GA 3J80K 1BR2A 4UVBA 3GF2A 4KN7X 4ESFA 4ZYGA 1UMQA 4ZYEA 2HKXA 2W25A 3P5JA 4P5OA 2FQ3A 3QRFF 2HEOA 1EH7A 1RR7A 2XRLA 2YS9A 4D7NA 4IZZA 2JVGA 3B73A 1VQLI 4A3MJ 5DTDA 1MIJA 4Y15A 2BY3A 2MC4A 3SFZA 2P5LC 3CCRI 2KRHA 2VE8A 5GP9A 1STZA 4DGWB 5CVVA 2LY1A 3LSTA 2NOGA 1G8XA 5C4XJ 3HOXJ 5E3NA 3OYNA 3GTPJ 2XC7A 3J80Z 1OJLA 4KIGA 1MKMA 1O7LA 5IY5H 2A07F 2UZKA 4G6TB 1KQ8A 4DOZA 1I3QJ 3OIOA 4NUBA 4JP0A 3WGIA 5JLWA 1XGNA 2XPWA 4ZYHA 2R5ZB 1QHGA 2R92J 3FMSA 3JR9A 4XK4A 1KU3A 2L9SA 2FNPA 3G4SI 1YIOA 5J4VA 1MBKA 2BE5F 1VQ4I 1V5GA 3CJTB 4DBRA 1D5YA 3ELKA 4X1EA 5ICEA 1WCMJ 2DK5A 4FE7A 3KZZA 4LK1F 4CA0A 1FBSA 4DQ2A 3BLYA 1FEXA 1Z0XA 1WJCA 5FRMA 5E17F 3SEQA 5LBQA 3OS1A 5ERIA 1IV8A 3S32A 5FKMA 3OL4A 2LVSA 3DEUA 3JTHA 3HOUJ 3K4JA 2LREA 4UV8A 3VFZA 2W24A 1LE8B 1XGOA 1TW2A 2VKHA 3IP4B 4KJZA 3QP5A 1HF0A 2ZXHA 2VPLA 1GVDA 2AO9A 2OV7A 2QLZA 3H3ZA 5ILUA 5IYCJ 4HA8A 1Z21A 1OCPA 4P9UA 3HKZA 4V2FA 4W1UA 3KEQA 5F1RA 2H27A 4BBSJ 4Y3OA 2DJNA 5EEGA 1J0RA 3F8CA 1G3SA 1VQ7I 1UHWA 1OYYA 5C3EJ 3L7WA 5JI6A 2ETHA 2BYVE 1OR7C 2TCTA 3AG4H 2VI6A 4ZYAA 4U0WA 1R00A 1APLC 4BEHB 4IRGA 2X6YA 2JZYA 3WODF 4LG3A 4CSWA 3P9CA 1GLNA 1R4NB 2VXDA 2XB0X 1FOKA 2VBWA 1YFHA 2HQRA 3IRQA 1LDKB 2O61A 2KJCA 4HG2A 2MD5A 5BOXA 1IZ1A 1U5TA 1K6YA 2DFEA 3DCFA 1O4XA 2GXGA 3DQVC 4I09A 1YX3A 2E2HJ 3HRSA 4X6AJ 4M71A 2P6TA 1D3YA 2ZMEB 4O6JA 1XPXA 4EJOA 2A61A 1J75A 4RGUA 3CJQB 3I54A 2MSYA 1Y1VJ 3HTUA 1LDJA 4A5MA 4DYCA 4XLPF 3RZOJ 2JRTA 2OQRA 2A6TA 5E1XA 1SMYF 4FX4A 3TDUC 4CO8A 3EYIA 4AWXB 2KFDA 1UFMA 2DDAA 3MWMA 3ZXSA 3KYDB 1ACIA 1HCRA 5IT9K 5KHDA 3F9KA 2XGEA 1R5HA 2I10A 4EJVA 2PMZA 1JE8A 2NVUB 5HOOA 1IO2A 4HSTA 5BPIA 3BTIA 3RI4A 1UELB 2CQXA 2B7EA 3OL3A 3IV5A 3QP6A 5H2FC 1USTA 2BW3A 2O7OA 3FXQA 3OSGA 3WTYC 2A69F 2LTPA 4AM3A 3O3KA 4DW6A 2UXXA 3PQKA 3AL0C 1IUYA 1JHFA 2KRFA 2NYXA 2M8EA 2E5ZA 3LAPA 3JSPA 2E35A 1CF7A 1QPIA 3DWLE 4MLOA 1KYZA 2Q0OA 4FETA 3RPUD 5LFAA 3IKTA 4C3HJ 2M30A 1WI3A 1SC7A 2MD0A 3FM5A 3L2RA 2OTLI 2VT2A 1X3UA 4RM2A 1FSEA 1R6RA 2PJRB 2RAEA 4GRIA 4D9JA 2QBYA 2R7VA 1S7EA 4LLNA 3GFIA 2QQ9A 4KITB 1W4MA 5M3FJ 3BZCA 1DDNA 2O0YA 5M5XJ 1YW9A 4BKXA 3C3WA 1EH6A 2RREA 3RJPA 5BS6A 2ZJQF 2DA3A 1B6AA 2CFXA 4CZZA 1TNTA 4MEYF 4BE1A 4CCNA 2IA2A 2M7BA 1SVLA 1FOXA 1TT0A 2RKHA 3KFWX 4A69C 5J3LA 2LY2A 5H20A 2HYGD 2NOJB 2X9DA 3IC7A 4FT8A 4G9YA 5EZHA 2DMUA 1MDMB 1VQ8I 3MAJA 3JRCA 5FB2A 2MC3A 4HDVA 4UUVA 4BU2A 2X1DA 4EVIA 2LNBA 5D6EA 3ULQB 4O3MA 4RM3A 4FCYA 2MW8A 2IXSA 2LRDA 4FASD 1G4DA 2G9WA 2DI3A 2K9MA 2XASA 2LLKA 1WRJA 2XAHA 4RS8A 2E34A 2XGDA 5E8IA 3R0JA 2JK3A 4F7ZA 1Y6IA 3W2WA 3VOEA 1JT6A 1I6HJ 4OIOF 1FYLA 2H6CA 5HVQC 2LG4A 1VNDA 3KP4A 3WE2A 4II2A 1USSA 2M0CA 2QWWA 2DO7A 2HDWA 1S6LA 1Z6RA 1ETVA 4BE0A 4ETSA 1IRZA 4E7HA 2KRCA 2XKOA 2DOAA 1TTYA 1WZ2A 3DEWA 3LSRA 4LG0A 4L9VA 2XROA 1W0UA 1N75A 3HSEA 4B8XA 2ELJA 1S5LC 3DPTA 3COAC 3D5SC 1S8NA 1B8IA 2IW5A 4NC8A 1XTAA 4EM1A 1V5EA 3CUOA 2HTSA 3F3XA 2FBIA 3V7RA 4LIVA 1WJBA 1YITI 1WWXA 3SEZA 5A2QK 5DEQA 2GOXB 2VQCA 4M3DA 3DBHB 1A04A 2PFBA 3CMAI 1D8KA 3CMMA 4NB5A 3OS2A 4XN0A 4B47A 3A2KA 4DJAA 1QU3A 2LKSA 4N9IA 4B44A 3HKZN 3GX4X 5A2QZ 3DKWA 3E5UA 4EJWA 1DU6A 5DV5A 3ZMDA 2LOOA 3H35A 5FFZA 1LEAA 1XC5A 3ZQ7A 2YR2A 4XBFA 2JA2A 1WJDA 3TP0A 4BXXJ 1TP4A 5B66C 3K0LA 1H0MA 5LD2C 4AYBA 3PO2J 3I64A 4C2UA 4ENNA 2QKLB 3TEDA 2CV0A 2V79A 4NC7A 4KT5C 4XN3A 4RBOA 2EZIA 3SJMA 1BN5A 3Q9SA 1FT9A 1FYKA 1XSDA 4KA4A 2OBPA 2X85A 1TQMA 1WI9A 1GXQA 4HX8A 1TWFJ 5AONA 4E7ZA 1PP7U 4BQAA 2Y2ZA 2QQAA 4YFXF 5BQTA 1XMKA 3BR5A 4E6KG 4B3AA 3CUQC 4F52A 2JWTA 2DTZA 1RPWA 3CCYA 1RR8C 3DF8A 3VEPA 4BGDA 3A0BC 4HX7A 2WAQA 3EETA 3IH2A 1YI2I 4DYRA 3B02A 5J1UA 3I56I 5J1YA 3A4CA 4JX6A 3GTMJ 4QPOA 1Z7LA 3HIFA 4PGGA 1F4KA 2EFOA 1ETXA 4IHYA 2XAJA 1QVUA 3HSFA 3CCLI 3M07A 2QVOA 3H0GJ 2BOLA 1XMXA 1IN4A 5ICCA 2M3AA 1I39A 2V4JC 3SXYA 2QQBA 4EGZA 4JOMA 2PMZN 4XKVA 1KA8A 2P81A 3O8HA 3V42A 4XQFA 1ZRFA 5HDNA 3GTJJ 1DPUA 3L2WA 4C9YA 3TP3A 1EJ9A 2BY1A 4ASNA 3JRDA 3C1DA 4HQEA 2C6YA 1AWCA 2LR8A 3E6MA 2COBA 1KYWA 1BJAA 3E7LA 4M3EA 4KMUX 1EF4A 3OYJA 3PO3J 2IAIA 1MZBA 1MD0A 2L9RA 1X4PA 3DPLC 4Y13A 2DMNA 3L09A 4LGWA 4PFPA 2XGCA 1ZLKA 2H94A 2NVXJ 4L18B 3BR1A 1MGTA 3E6DA 1RETA 1RIOH 4MGRA 4RAGA 5LHIA 3GTKJ 1MMAA 4A6EA 4BL0B 4KMFA 3EUHC 2HXIA 2LKXA 1B72A 1FWZA 4PUSA 3ABKH 2IGMA 3BG7A 3W2AA 3BR3A 1IXSB 1WJ5A 5IT3A 4ZYDA 3VSKA 4IRIA 3V7SA 3DTKA 2M34A 5DCMA 1X19A 2L7MP 1BOBA 2ZO4A 4BXFA 3SQNA 2HNHA 1I3AA 1V4RA 1Y8RB 2NVQJ 1HSTA 1SD6A 1SFKA 3VYRB 4E7KA 1JKQC 2DQLA 5FKOA 3H1CA 1FTZA 2EFPA 1TZLA 5F0HA 3KP5A 4XOPA 4Y7NJ 3ZQLA 2I5UA 1LNWA 1XGSA 1FZPB 2JUCA 1K61A 2DOFA 2Z9OA 1T0FC 3T0YA 3KEOA 5D5VB 1TWHJ 2LD5A 1LUJB 2ADUA 3GFJA 3K70D 4D5FA 4XKCA 2IS1A 1O3QA 4XICA 1ETQA 2IGKA 2CWEA 2H09A 2O8KA 3H3UA 4II3A 1J59A 4UUSA 2ESHA 1YIJI 1M1EB 2ZBKA 1XX5A 4KIBA 5B1AH 2X6OA 4YRVA 1WGXA 1SEUA 1XSVA 1NHAA 4J01A 3I53A 1VQOI 2QA4I 2IGNA 4JYKA 2FXAA 5J8FA 1QA6A 1B9MA 2RVCA 2XKPA 3H9QA 4QPQA 1JKPC 3RKYA 4B48A 2L4MA 4BHCA 5M3MJ 1ZK8A 3FBNB 1MJAA 3TW7A 1VQNI 2UV1A 1V55H 4JBAA 2Y30A 3KLOA 3A01A 3HOVJ 2ZMEC 2R4GA 4LLGF 2AS5F 5HS9A 1HBXG 4U0VA 4Q48A 1Z77A 3H3VK 2X48A 1DU0A 4KISA 2RNGA 2JPBA 3ECHA 3OYIA 1T56A 4I02A 4FX0A 1DP7P 2PJPA 1BOAA 4LK0F 1O3TA 1XS9A 2JSCA 3I55I 3FXKA 5GTIC 4RB1A 4I99C 1WJFA 3A02A 3WTSC 1XCVA 2CV2A 3WU0A 1YE9A 2GA2A 3MCZA 4MFDA 2ZFWA 2F4OB 3BCAA 2PG4A 2IRFG 3OOUA 2GIZA 2X6XA 1VQMI 1S72I 1MMNA 4O5VA 4WX9A 4UY8I 3ESWB 2OZ6A 1Z67A 1X1PA 3QPSA 2CQNA 3E3VA 1OCOH 3OR1C 5K5RA 3JW4A 4GYIA 4Y4RA 1N77A 1AKHA 3GTGJ 1W5SA 1DPRA 2FOKA 1X1CA 5GTHC 1IRXA 3HOTA 2X51A 2G0EA 4D0PA 5TISC 2ELHA 5HNFA 3DU6A 2MFZA 5AIQA 2H1KA 5FRNA 1RI7A 1MMSA 2E36A 1ZLJA 2L4AA 4XRMA 4IX7A 3O8GA 2VASA 1G3WA 2X4HA 1T98A 3F72A 4AYBN 2QSGX 3LQRA 4FQGA 3EDPA 1XGMA 2IEKA 4WXDA 4YG2F 1FLIA 1T95A 3MMYB 1BI1A 1BJZA 2HGCA 5E3MA 4C2MJ 3IWFA 2KHMA 2FNAA 2W4SA 9ANTA 4D7MA 1FSHA 2CQ7A 4IVNA 1LVKA 1TWCJ 2CJJA 4WCGA 5CYVA 2LBFA 1SFUA 3NEUA 2BEOA 3MEXA 3GTQJ 3AG3H 4RB3C 3CC7I 1OR7A 1X58A 3CF2A 3BZKA 5AIPA 3BQZA 1HKQA 4YFNF 1MSFC 4KDPA 1HA8A 2Y0MA 1ZARA 1KGSA 3PJRA 2WAQN 4CYDA 2OQGA 2PN6A 5E3OA 2R7ZJ 3KZYA 1TLHB 2L9VA 5D4RA 4HBLA 5F08A 4ZTJA 2EZKA 5FO5A 4LITA 1YW8A 3JRFA 2BW3B 2DYSH 5F0FA 4EEFG 5E18F 4HNVA 2CW8A 4CXFA 5HODA 5CPRB 1ZR4A 1SFEA 4M6VA 2R7QA 3EUAA 1OISA 1VQPI 3KP7A 4KT6A 1Q1HA 2Z33A 2X0LA 1RKWA 1CF7B 2LH9A 1YQAA 2VN2A 4A5NA 2V26A 2L0KA 4RLFA 3GLXA 1P4AA 2KQRA 2M7AA 3KE2A 3R60A 2HOAA 3C18A 2K9SA 2DPUA 2LF7A 3HOZJ 1VTNC 3QU3A 5HNHA 4KN4X 4IHVA 3H5RA 3F23A 5IYBJ 1ZG3A 2R7DA 2IS2A 3DP7A 1YS7A 2QBYB 2I8DA 1GHCA 3C7JA 2A5YB 3CDIA 3QWLA 2BVLA 1U78A 2DAOA 2CS3A 1YG2A 1C0WA 3EUKL 3F6VA 2MLGA 3BJ6A 4BS9A 1D1AA 5GAEJ 3I9V2 2A68F 1SMTA 4EV0A 3UKGA 4EM0B 2HS5A 2EIKH 2KKOA 3HHGA 3BP8A 3ZQQA 1FTTA 2F2EA 3I4MJ 3KX2A 2LDUA 3J81K 4ZZDA 2GIVA 3W3CA 3ZMZA 1D0YA 2M9HA 3ZN1A 5ILSA 4CYCB 2FQ4A 1R71A 3QYBA 2JVHA 3B6CA 4A3DJ 2AQEA 4JK1X 1MH3A 1W5TA 3LA3A 2HDDA 3TDZC 3QOPA 2R7RA 5HS7A 3K4BA 1F36A 4FHTA 1OCCH 4E7JA 5FJ8J 1YTYA 3MQ0A 5J4YA 3QPHA 1QZEA 3PNYA 3PSIA 4KUMA 2ZC2A 3BR2A 4G8XA 2CSOA 4ABZA 1PUFA 4EGYA 3MFKA 2A6HF 1Z1DA 2EB7A 3GUDA 2GXBA 4PJJA 1ZAOA 1TQIA 1S3JA 2DFFA 1FMVA 2BGCA 1KU7A 1ONVA 1E2XA 1ZYRF 3JSOA 1ZRDA 3K4MA 3ABMH 5J6XA 4A12A 4XOTA 2L7FP 4XLNF 1G2HA 3IHUA 1JTXA 3FXOA 3IRRA 2DN0A 2QQ8A 3QYEA 3EQLF 3S1RJ 1POGA 4BAYA 1K7AA 2NS8A 3NRVA 2YUSA 1H9TA 2WB1A 3FX3A 3IUOA 5F27A 5LHGA 2RQQA 2BV6A 2HYJA 1IAWA 2E71A 3LWFA 4IQ4A 4PJLA 1N78A 3K6GA 2HTJA 2DK8A 2YPRA 3C2GA 4E7SA 3GLLA 3VSLA 1HXDA 2P0WA 1P7IA 1X2NA 1IN5A 3ISPA 2A5WA 2F5CA 4DBQA 1IN7A 4XORA 4BH9A 3D5LA 5TGTA 2LK2A 1WHUA 3CJRB 4M9ZA 4ZDPA 2Y75A 1D0ZA 1QNTA 1JUPA 1R4MB 4RGXA 5LEJA 3LSJA 4HV5A 3BT9A 3BC8A 1BR4A 3CDLA 3LFUA 3PIOF 3K10A 2BVMA 2RV8A 1BI2A 3AKZA 3L00A 3I3LA 4M74A 5F0CA 3CMYA 2QSFX 2BBYA 2YX7A 5DS9A 1T33A 2R7XA 4HF1A 2Z5UA 4I76A 5CLSA 1FX7A 3FIWA 5IOZA 1XN7A 3E6CC 4KICA 2ECBA 3VYSB 2W57A 3O2PE 3V8LA 1K78A 3JCUC 5EYRA 5E20A 2RDPA 2WAEA 3G6EI 1K4TA 3MN2A 1LB2A 5FD6A 3AG1H 4GO1A 2K9LA 1L0OC 4MFEA 2BZTA 3BJAA 4AVPA 2EQRA 1JKOC 2OCEA 2PEXA 4G7HF 3FBIB 2XAGA 2PLYA 2KZGA 3H92A 4B3XA 2IBDA 3WHBA 5IT9Z 1SAUA 2Z2SB 4A0YA 1K6OA 2M5WA 4F3QA 4Q4ZF 1VQ5I 2BY0A 2OA4A 2YU3A 1IXCA 1E0EA 4S05A 5IP7J 3HB9A 4UV9A 3EYYA 1LQ1A 2JA5J 1RNLA 2HR3A 2GZWA 2V9VA 2A6EF 2QF7A 3V8JA 3CCSI 3K4KA 2X1CA 4ENJA 3R4KA 3BPXA 3RDIA 4U7DA 3QU6A 3F8FA 3HUGA 3M8FA 3A0HC 4GFBA 3S2WA 4L5JA 3QYFA 3TL4X 2DFIA 2JUGA 2R7OA 2E1OA 2GOMA 4U87A 4J19A 3CF5F 1REPC 2PMUA 5GAHJ 4M9XA 2DBBA 2E1MB 2VOOA 2DA5A 1T8IA 2KIFA 1WJEA 2XF6A 3CUQA 1D5VA 2H6BA 1MBFA 3LSGA 3F22A 1B72B 3AAFA 4PJMA 1R49A 2W82A 2HOTA 2P5KA 4UUTA 3FMRA 2O03A 2HKOA 1U9NA 3GO5A 2ELKA 2F5VA 5DCMB 1ZGAA 4LB5A 2DT5A 3SYTA 2KMUA 1WH5A 2E19A 3RCOA 2KZVA 2XPUA 3SHFA 2GAUA 4OAZA 2UUZA 5IP6A 3K7AJ 5HLHA 2DT6A 2K86A 5J40A 3F8NA 4F92B 3L2QA 4L5EA 2ISZA 5CQEA 1RKTA 4AIKA 3LMMA 3ABLH 2ISYA 5FGMA 2JA6J 2DLLA 4BE2A 4RB2C 3FM3A 2L54A 2R5ZA 3FF5A 4E70A 1R36A 4JX4A 1B59A 4HF0A 3RKWA 1NG6A 3WTVC 2R5YA 3M1CA 4NDLA 3K4LA 1TW3A 2UWMA 1ULYA 4UB6C 3PUBA 1W1WE 4DIQA 1BL0A 1SANA 5F6FA 4E7LA 2EPFA 2ZSIB 3S16J 4H4KC 5L3FA 4P1WA 3U9GA 5HDKA 1WQ2A 2ZB9A 1NG7A 3MKLA 2DA7A 4I0BA 4BACA 4RGRA 4M3GA 1HC8A 1NH3A 1IN8A 3A01B 3LL7A 4HLXA 2E2JJ 2M87A 3RQ4A 4IEJA 4IJAA 3BPVA 2ESNA 4B09A 2EFNA 2E1CA 4B1RA 5ICGA 1QZZA 5D5XB 2VIXA 3CZ6A 4DZJA 3LQQA 1RUOA 1ON2A 1T0FA 2EK5A 5F1JA 2L7KA 1G3TA 4Z2YA 5CKTA 1XDUA 3F21A 3GFMA 4P55A 1FOYA 2CRGA 3IH4A 3DFGA 2XAUA 4CCKA 1J2XA 3KZIC 1IN6A 3U1DA 4BBRJ 1BC8C 2B0LA 2FJ1A 2WB1N 2OD5A 3GTOJ 3OYLA 1UB9A 3GZ6A 2GA1A 1IUFA 2QYOA 4BEHA 2E5NA 3N4MA 3ZRGA 2DW4A 5JVTA 3OYHA 3CC4I 5GPCA 1FMWA 2K4BA 2WV0A 2OTJI 2F4MB 2FF4A 3OYKA 2Q1ZB 3NWTA 4A2UA 3BOQA 1J09A 2FA5A 3DLLF 1Z6TA 1TQPA 3TW6A 4ZC3A 2M4GA 3G3ZA 1J9IA 2EIMH 1OMIA 1KONA 1J7KA 2ZXIA 2JPCA 1FP2A 3CCVI 4Y52J 4BJ5C 1JI8A 5EJCA 1W0TA 3PNVA 3F6OA 2ZMEA 2JMWA 2CH0A 3WU2C 1IJWC 4A3KJ 1IV6A 1YO5C 5KCMA 4FE4A 1W36C 2R3SA 3JRAA 1PDNC 3CLQA 1P7JA 1Y8QB 3ZN0A 1R1UA 1U0JA 4K2EA 4U0YA 1S7OA 3S14J 1SVMA 5K1YA 1N25A 3L2CA 3HPHA 3R0AA 4L9NA 2BHZA 1OLTA 2H8RA 4ESBA 3MVPA 5K5QA 5EGOB 3CCQI 2ZSHB 2ID6A 1AU7A 3QPLA 1XDSA 1AA7A 4CGZA 2F5EA 2DODA 2GLOA 2J5PA 1HSJA 4A3JJ 3DV8A 5JFRA 3PFYA 1R7JA 2LBFB 1QQIA 4CCLA 2ZXJA 4G12A 4LOCA 3TQNA 4A0XA 1U8BA 2W48A 3HEFA 2K40A 4IOCF 3WTWC 2VQHA 1UZCA 1A31A 3WHCA 1SVOA 5K7ZA 3CCEI 2KLOA 2FX0A 2XB5A 4HQMA 1Z05A 4HW0A 4I98B 3L2UA 2G7UA 3H5NA 4AC0A 1QO0D 5H6RA 4ZH4F 2CU7A 2HQ5A 3HYIA 3GBGA 2EZHA 2X6WA 3V7CA 2WY8Q 1BBYA 1U9OA 5FLMJ 5LLQA 1QPMA 2EBIA 2YX4A 3OYEA 2H8WA 2L01A 5FROA 3OS0A 2OJED 4BJTA 1MBHA 3WTUC 4A3GJ 3H36A 1NTCA 1O3RA 4XLFA 2F5DA 5J47A 2M45A 5JR3A 2MLKA 2DJIA 2XUBA 5JVGF 1R5ID 3JTGA 5EEHA 4AIHA 1GDTA 3DU5A 2D5VA 2VT3A 4E4HA 1TT5B 3S15J 3OIQA 1HW5A 3A1YA 3BDDA 4EM2A 2XV4S 4CZCA 1Z91A 1BM9A 4UHTA 1ZKGA 4MEXF 4RLQA 3LSHA 3OYBA 3DBRB 1PVEA 2E60A 4UNOA 3PUFA 2V9PA 3Q5FA 3I0TA 1P4WA 3CDHA 2M8GX 4PGHA 4I7HA 2HXOA 2DMQA 1GVJA 2JTVA 2NAZA 1XG1A 1YJ9I 3NARA 3ZOBA 4G7ZF 1ODDA 1BW6A 1VQKI 2VBXA 3H0DA 5BPDA 3AFHA 1MNEA 3SZGA 5TJJA 2L2OA 4L9TA 3REOA 2XHKA 4AUXA 4CCMA 2WADA 3CTAA 2FD5A 4JX5A 3MD2A 1A6QA 4WWCA 2M4KA 2M2EA 1BI3A 4HSRA 3T1BA 2GXAA 5TRDA 1A35A 1RZ4A 1YW7A 1PUEE 3RKQA 4Y33A 1BA5A 1OKRA 2JJ7A 3KP2A 5D8LB 2W00A 1PUFB 1KQ9A 2GWRA 4FISA 4RB0A 1ZHFA 4N9HA 4PJ0C 5C44J 3GZNB 1YYVA 3GYHX 5HS8A 2DDBA 3VYTB 3LFKA 4PZJA 5J8CA 3DBLB 3S93A 4OAYA 1DGRM 3HG9A 3JRBA 2AXTC 3CP2A 1FBQA 3SDBA 4AIJA 1ORKA 1F43A 5FLXK 2MG4A 4I01A 3BTCA 2VQGA 3OYFA 2HU9A 2QM3A 2VJIA 4MO7A 4HNTA 3DEEA 2R7UA 2EILH 2DFHA 3D1NI 2QGUA 2NVTJ 3S2DJ 3ZMUA 3J7YJ 4EQQA 2IPQX 3RQIA 3OYDA 4AIDA 1OQYA 3ERMA 1ZH5A 3WG7H 1SD4A 5CQGA 3C2HA 2D45A 1SFXA 2AHQA 3BG9A 4XR6A 1IF1A 5FLXZ 2JSPA 3IAM2 3WGGA 4YELA 1FBUA 2VODA 5EF6A 3ZQGA 3HOYJ 4BUPA 3I58A 1P2FA 3FZVA 5CVIA 1Y39A 4YIRX 4OIPF 2R93J 4XLEA 1ETYA 1W7PA 3OYAA 1U5TB 4JQFA 4ZDLA 4PCQA 5E1ZB 3K2AA 4XNFA 1HW2A 3PM1A 1TWAJ 1QHHD 3H9JA 2VL8A 1BIAA 1VQ9I 1IGNA 2K9QA 4NQWA 2IGOA 5LRRA 4IOAF 5GPAA 1QVTA 1KQ0A 3J7AO 3LA2A 4A6DA 1TNSA 1R1TA 4CH7A 2FBKA 4Z6YA 4KFCA 1K78B 2E1MC 3QOEA 4A0ZA 2RGVA 3TO7A 3BR0A 3K1MA 4GDFA 2R7FA 4F93B 4ESJA 2DA6A 1DUXC 3BG6A 1QBJA 2CW7A 1WKMA 2FE3A 2ZCWA 2KT0A 3KYLA 1MMGA 4GXOA 4OIQF 3BTJA 4BQNA 3K9TA 5L3GA 4EMSA 3QAHA 2Y31A 3I4PA 2IJLA 2LP0A 1D8JA 3JRIA 1LVAA 1GT0C 2X1EA 2EWNA 3DPUA 4ANJA 1SAXA 1ZREA 1H8AC 4CUGA 1KU2A 2TRTA 3U2RA 2K5CA 3RZDJ 4H0EA 2DQRA 4Q5SF 2XAFA 4G94A 4M3FA 3IH3A 3RYPA 4AU7A 5EEAA 2QCOA 4S04A 2Y69H 5BMZA 4RDUA 1H9GA
chains in the Genus database with same CATH topology
4XRSA 3S17J 5EYRA 4M3DA 2Y9YA 2DA2A 2L7ZA 3BTLA 5J1RA 1QRYA 5EZGA 3JRGA 2EZLA 3MN2A 3ZQCA 1A5JA 4C3IJ 2HI3A 3HDDA 5K7HA 2JA7J 3HOWJ 1MH4A 4MFEA 2EQRA 3HKZN 1JKOC 1DU6A 1VI0A 3LNQA 4V2GA 1XC5A 2IBDA 3WHBA 1SFOJ 4A93J 3TP0A 5M5YJ 4BXXJ 4A3FJ 1ZTRA 3PO2J 3JREA 5IP7J 3HB9A 3TEDA 2JA5J 1GV2A 4M3BA 3S1QJ 3BG5A 4QTRA 4RBOA 2EZIA 3SJMA 2QF7A 1JUMA 5C4JJ 2DMPA 2ID3A 1ETOA 1TWFJ 1YRNB 3I4NJ 1HLVA 2Y2ZA 4GFBA 3BR5A 4D5CA 2NS7A 4B3AA 2E1OA 5BNGA 4J19A 2JWTA 2DTZA 1RPWA 3CCYA 1FIPA 2DA5A 3IH2A 4DYRA 2Y0SN 1MBEA 5J1UA 1ZQ3P 5J1YA 1HDPA 2CQQA 1MBFA 3LSGA 4JX6A 3GTMJ 4IHYA 1ETXA 1MBJA 1QVUA 2R5YB 1B72B 2HOTA 4UUTA 3H0GJ 1LFUP 1CQTA 1U9NA 2ELKA 4DYQA 5M5WJ 3HBLA 2R0QC 3W6VA 5E3LA 2PMZN 1K83J 1WH5A 2ME0A 2P81A 3O8HA 4W97A 1B8IB 3GTJJ 2E19A 2XPUA 3TP3A 1NK2P 5IP6A 3JRDA 3K7AJ 1YRNA 4QSHA 2LR8A 2JA8J 2COBA 4L5EA 3E7LA 4M3EA 3SFIA 1RKTA 3BQYA 1BW5A 1EF4A 2ECCA 3PO3J 2IAIA 2VUMJ 2JA6J 2L9RA 2DMNA 2XGCA 2NVXJ 2E2IJ 2DA1A 3BR1A 2R5ZA 5EGOA 3GTLJ 1RETA 4JX4A 1ITYA 3M3YJ 3GTKJ 3FK7A 2HXIA 2R5YA 2LKXA 1B72A 3M4OJ 4NDLA 2CUFA 1Y1WJ 3BR3A 4I6ZA 3ZQFA 1BL0A 2OF7A 2M34A 4A3CJ 2L7MP 1SANA 4BY7J 5IPAA 4FTHA 1VFCA 3S16J 3A03A 1JJ6C 3Q3SA 4A3IJ 2VKVA 2NVQJ 1JJ8C 2ZB9A 3MKLA 2XPVA 1IDZA 2DA7A 1JKQC 4IHWA 5FKOA 1FTZA 5F0HA 4M3GA 3ZQLA 4Y7NJ 3A01B 2E2JJ 4IEJA 1K61A 1LFBA 3F0CA 4S0HB 2OPTA 1TWHJ 2VPRA 4B1RA 2LD5A 1X2MA 4D5FA 4DZJA 5JLXA 2YU9J 5F1JA 4XICA 1ETQA 5IYDJ 2O8KA 1UG2A 2CRGA 3IH4A 4UUSA 4A3EJ 2X6OA 4BBRJ 1WGXA 2XSDC 2FJ1A 2WB1N 5EG0B 3GTOJ 1IUFA 1OFCX 4JYKA 5GPCA 4C3JJ 1H88C 1JKPC 3Q0VA 1UMQA 1HDDC 5M3MJ 3LOCA 1RR7A 2YS9A 2XRLA 4D7NA 3TW6A 1ZK8A 4A3MJ 5DTDA 3TW7A 2Y30A 3HOVJ 3A01A 5GP9A 4Y52J 1I50J 3G1OA 5C4XJ 2NOGA 1W0TA 1Z77A 3HOXJ 5E3NA 3GTPJ 1ETKA 3H3VK 2JMWA 5FKLA 1OJLA 2X48A 1IJWC 4A3KJ 1IV6A 1DU0A 4FE4A 3JRAA 1T56A 1P7JA 3S14J 1I3QJ 3OIOA 4JP0A 1XS9A 5JLWA 5FKKA 2H8RA 2XPWA 2R5ZB 2LFBA 3MVPA 5EG0A 3OSFA 5EGOB 3JR9A 2R92J 1JTYA 2ID6A 1AU7A 3QPLA 4XK4A 3G1LA 2GLOA 2HOSA 3A02A 1MBKA 4A3JJ 2DMTA 3L1PA 4MFDA 1D5YA 4X1EA 1WCMJ 4FE7A 3BR6A 1AHDP 3OOUA 1FEXA 4G12A 1Z0XA 4LOCA 1U8BA 2W48A 3HEFA 2K40A 1JT0A 3QPSA 2GM4A 3FISA 3WHCA 2EH3A 5K7ZA 5FKMA 1AKHA 3GTGJ 2LVSA 2FX0A 2XB5A 3HOUJ 2G0EA 4AC0A 1MNMC 3Q0WA 1LE8B 1HF0A 2CU7A 2HQ5A 2H1KA 1GVDA 2AO9A 3GBGA 5IYCJ 2EZHA 4XRMA 4CYCA 1OCPA 3O8GA 1U9OA 5FLMJ 4V2FA 4AYBN 2EBIA 3NAUA 2IEKA 1E3OC 4W1UA 4BBSJ 2DJNA 1BJZA 3HM5A 1MBHA 5E3MA 4A3GJ 4UUSB 4C2MJ 1ZR2A 5C3EJ 2B63J 1NTCA 9ANTA 4D7MA 2TCTA 2VI6A 3ZQIA 2CJJA 1TWCJ 1HOMA 1JUSA 1APLC 3FKIJ 2CUEA 1GDTA 3GTQJ 2D5VA 1X58A 3S15J 2XB0X 3C2BA 3SDGA 3BQZA 1MSFC 1ZKGA 3G1MA 3HGGA 2WAQN 1LE8A 4XIDA 1FJLA 3ZQHA 5E3OA 2R7ZJ 3DCFA 1O4XA 5EDNA 2M8GX 2E2HJ 5F08A 4X6AJ 3BG3A 2EZKA 2HXOA 2DMQA 1XG1A 3JRFA 1NK3P 3NARA 5F0FA 4B4CA 3ZOBA 2MSYA 1Y1VJ 4DYCA 4EEFG 4HNVA 1BW6A 5HODA 1ZGWA 3RZOJ 4A3BJ 1ZR4A 4M6VA 1MSEC 1GV5A 5FLVA 4XRSG 1MBGA 4AUXA 5IP9J 2MGQA 3B6AA 1RKWA 2FD5A 4JX5A 4IHXA 3LSPA 2L0KA 2DA4A 3S1NJ 2M2EA 1TWGJ 1HCRA 2HOAA 2N8GA 2K9SA 3HOZJ 2XGEA 2I10A 4IHVA 3RKQA 5IYBJ 3VPRA 1BA5A 3BTIA 2JJ7A 1U78A 2CQXA 4FISA 1PUFB 5C44J 5K7FA 3IV5A 3S2HJ 3UKGA 1AKHB 4A3LJ 2O7OA 1FTTA 3JRBA 3OSGA 3I4MJ 2LTPA 1Q1VA 3CQZJ 4DW6A 1ORKA 1F43A 4DZPA 2M9HA 2MG4A 4CYCB 2K9NA 2FQ4A 1WH7A 3BTCA 3B6CA 1QPIA 4A3DJ 4MLOA 4MO7A 1MH3A 2VKEA 3D1NI 1ENHA 4QIWN 4C3HJ 1RESA 2HDDA 2NVTJ 3S2DJ 1JKRC 1WI3A 3S1MJ 2WV1A 3RQIA 1F36A 5FJ8J 2RAEA 2AHQA 3BG9A 1S7EA 3BR2A 1VF9A 5M3FJ 4ABZA 1PUFA 2GBYA 5M5XJ 5EF6A 4BKXA 3ZQGA 3HOYJ 2DA3A 1GUUA 4BY1J 2R93J 1ETYA 1H89C 1OCTC 4A69C 5J3LA 2L7FP 3K2AA 1G2HA 1JTXA 5F04A 2X9DA 2ME6A 5EZHA 2DMUA 2DN0A 3PM1A 5IOYA 1TWAJ 3JRCA 3S1RJ 1POGA 2NS8A 2K9QA 1IGNA 2YUSA 4FCYA 5GPAA 2MW8A 1ETWA 1QVTA 1IDYA 5F27A 2O9LA 2KDZA 2HYJA 2LLKA 2JN6A 1WPKA 2XGDA 3BR0A 2NVYJ 1R9TJ 2JK3A 1JT6A 3Q0UA 1I6HJ 2DA6A 1P7IA 1VNDA 1X2NA 5FKNA 2KT0A 2M0CA 3FK6A 1TC3C 3JRHA 3BTJA 2Y9ZA 1IG7A 1ETVA 2Y31A 1IRZA 1FIAA 2LK2A 2LP0A 3DEWA 3LSRA 2LY9A 3QQAA 3JRIA 1JGGA 1JUPA 3LSJA 1GT0C 3BT9A 1W0UA 3CDLA 1A6IA 5F0CA 3CMYA 1H8AC 2TRTA 5DS9A 1T33A 1UHSA 3RZDJ 4I76A 1B8IA 3FIWA 1IC8A 4MIMA 5IOZA 3HGYA 4M3FA 3IH3A 5EEAA 2QCOA 2ECBA 4RDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS A;  3S17 J;  5EYR A;  4M3D A;  2Y9Y A;  2DA2 A;  2L7Z A;  3BTL A;  5J1R A;  1QRY A;  5EZG A;  3JRG A;  2EZL A;  3MN2 A;  3ZQC A;  1A5J A;  4C3I J;  2HI3 A;  3HDD A;  5K7H A;  2JA7 J;  3HOW J;  1MH4 A;  4MFE A;  2EQR A;  3HKZ N;  1JKO C;  1DU6 A;  1VI0 A;  3LNQ A;  4V2G A;  1XC5 A;  2IBD A;  3WHB A;  1SFO J;  4A93 J;  3TP0 A;  5M5Y J;  4BXX J;  4A3F J;  1ZTR A;  3PO2 J;  3JRE A;  5IP7 J;  3HB9 A;  3TED A;  2JA5 J;  1GV2 A;  4M3B A;  3S1Q J;  3BG5 A;  4QTR A;  4RBO A;  2EZI A;  3SJM A;  2QF7 A;  1JUM A;  5C4J J;  2DMP A;  2ID3 A;  1ETO A;  1TWF J;  1YRN B;  3I4N J;  1HLV A;  2Y2Z A;  4GFB A;  3BR5 A;  4D5C A;  2NS7 A;  4B3A A;  2E1O A;  5BNG A;  4J19 A;  2JWT A;  2DTZ A;  1RPW A;  3CCY A;  1FIP A;  2DA5 A;  3IH2 A;  4DYR A;  2Y0S N;  1MBE A;  5J1U A;  1ZQ3 P;  5J1Y A;  1HDP A;  2CQQ A;  1MBF A;  3LSG A;  4JX6 A;  3GTM J;  4IHY A;  1ETX A;  1MBJ A;  1QVU A;  2R5Y B;  1B72 B;  2HOT A;  4UUT A;  3H0G J;  1LFU P;  1CQT A;  1U9N A;  2ELK A;  4DYQ A;  5M5W J;  3HBL A;  2R0Q C;  3W6V A;  5E3L A;  2PMZ N;  1K83 J;  1WH5 A;  2ME0 A;  2P81 A;  3O8H A;  4W97 A;  1B8I B;  3GTJ J;  2E19 A;  2XPU A;  3TP3 A;  1NK2 P;  5IP6 A;  3JRD A;  3K7A J;  1YRN A;  4QSH A;  2LR8 A;  2JA8 J;  2COB A;  4L5E A;  3E7L A;  4M3E A;  3SFI A;  1RKT A;  3BQY A;  1BW5 A;  1EF4 A;  2ECC A;  3PO3 J;  2IAI A;  2VUM J;  2JA6 J;  2L9R A;  2DMN A;  2XGC A;  2NVX J;  2E2I J;  2DA1 A;  3BR1 A;  2R5Z A;  5EGO A;  3GTL J;  1RET A;  4JX4 A;  1ITY A;  3M3Y J;  3GTK J;  3FK7 A;  2HXI A;  2R5Y A;  2LKX A;  1B72 A;  3M4O J;  4NDL A;  2CUF A;  1Y1W J;  3BR3 A;  4I6Z A;  3ZQF A;  1BL0 A;  2OF7 A;  2M34 A;  4A3C J;  2L7M P;  1SAN A;  4BY7 J;  5IPA A;  4FTH A;  1VFC A;  3S16 J;  3A03 A;  1JJ6 C;  3Q3S A;  4A3I J;  2VKV A;  2NVQ J;  1JJ8 C;  2ZB9 A;  3MKL A;  2XPV A;  1IDZ A;  2DA7 A;  1JKQ C;  4IHW A;  5FKO A;  1FTZ A;  5F0H A;  4M3G A;  3ZQL A;  4Y7N J;  3A01 B;  2E2J J;  4IEJ A;  1K61 A;  1LFB A;  3F0C A;  4S0H B;  2OPT A;  1TWH J;  2VPR A;  4B1R A;  2LD5 A;  1X2M A;  4D5F A;  4DZJ A;  5JLX A;  2YU9 J;  5F1J A;  4XIC A;  1ETQ A;  5IYD J;  2O8K A;  1UG2 A;  2CRG A;  3IH4 A;  4UUS A;  4A3E J;  2X6O A;  4BBR J;  1WGX A;  2XSD C;  2FJ1 A;  2WB1 N;  5EG0 B;  3GTO J;  1IUF A;  1OFC X;  4JYK A;  5GPC A;  4C3J J;  1H88 C;  1JKP C;  3Q0V A;  1UMQ A;  1HDD C;  5M3M J;  3LOC A;  1RR7 A;  2YS9 A;  2XRL A;  4D7N A;  3TW6 A;  1ZK8 A;  4A3M J;  5DTD A;  3TW7 A;  2Y30 A;  3HOV J;  3A01 A;  5GP9 A;  4Y52 J;  1I50 J;  3G1O A;  5C4X J;  2NOG A;  1W0T A;  1Z77 A;  3HOX J;  5E3N A;  3GTP J;  1ETK A;  3H3V K;  2JMW A;  5FKL A;  1OJL A;  2X48 A;  1IJW C;  4A3K J;  1IV6 A;  1DU0 A;  4FE4 A;  3JRA A;  1T56 A;  1P7J A;  3S14 J;  1I3Q J;  3OIO A;  4JP0 A;  1XS9 A;  5JLW A;  5FKK A;  2H8R A;  2XPW A;  2R5Z B;  2LFB A;  3MVP A;  5EG0 A;  3OSF A;  5EGO B;  3JR9 A;  2R92 J;  1JTY A;  2ID6 A;  1AU7 A;  3QPL A;  4XK4 A;  3G1L A;  2GLO A;  2HOS A;  3A02 A;  1MBK A;  4A3J J;  2DMT A;  3L1P A;  4MFD A;  1D5Y A;  4X1E A;  1WCM J;  4FE7 A;  3BR6 A;  1AHD P;  3OOU A;  1FEX A;  4G12 A;  1Z0X A;  4LOC A;  1U8B A;  2W48 A;  3HEF A;  2K40 A;  1JT0 A;  3QPS A;  2GM4 A;  3FIS A;  3WHC A;  2EH3 A;  5K7Z A;  5FKM A;  1AKH A;  3GTG J;  2LVS A;  2FX0 A;  2XB5 A;  3HOU J;  2G0E A;  4AC0 A;  1MNM C;  3Q0W A;  1LE8 B;  1HF0 A;  2CU7 A;  2HQ5 A;  2H1K A;  1GVD A;  2AO9 A;  3GBG A;  5IYC J;  2EZH A;  4XRM A;  4CYC A;  1OCP A;  3O8G A;  1U9O A;  5FLM J;  4V2F A;  4AYB N;  2EBI A;  3NAU A;  2IEK A;  1E3O C;  4W1U A;  4BBS J;  2DJN A;  1BJZ A;  3HM5 A;  1MBH A;  5E3M A;  4A3G J;  4UUS B;  4C2M J;  1ZR2 A;  5C3E J;  2B63 J;  1NTC A;  9ANT A;  4D7M A;  2TCT A;  2VI6 A;  3ZQI A;  2CJJ A;  1TWC J;  1HOM A;  1JUS A;  1APL C;  3FKI J;  2CUE A;  1GDT A;  3GTQ J;  2D5V A;  1X58 A;  3S15 J;  2XB0 X;  3C2B A;  3SDG A;  3BQZ A;  1MSF C;  1ZKG A;  3G1M A;  3HGG A;  2WAQ N;  1LE8 A;  4XID A;  1FJL A;  3ZQH A;  5E3O A;  2R7Z J;  3DCF A;  1O4X A;  5EDN A;  2M8G X;  2E2H J;  5F08 A;  4X6A J;  3BG3 A;  2EZK A;  2HXO A;  2DMQ A;  1XG1 A;  3JRF A;  1NK3 P;  3NAR A;  5F0F A;  4B4C A;  3ZOB A;  2MSY A;  1Y1V J;  4DYC A;  4EEF G;  4HNV A;  1BW6 A;  5HOD A;  1ZGW A;  3RZO J;  4A3B J;  1ZR4 A;  4M6V A;  1MSE C;  1GV5 A;  5FLV A;  4XRS G;  1MBG A;  4AUX A;  5IP9 J;  2MGQ A;  3B6A A;  1RKW A;  2FD5 A;  4JX5 A;  4IHX A;  3LSP A;  2L0K A;  2DA4 A;  3S1N J;  2M2E A;  1TWG J;  1HCR A;  2HOA A;  2N8G A;  2K9S A;  3HOZ J;  2XGE A;  2I10 A;  4IHV A;  3RKQ A;  5IYB J;  3VPR A;  1BA5 A;  3BTI A;  2JJ7 A;  1U78 A;  2CQX A;  4FIS A;  1PUF B;  5C44 J;  5K7F A;  3IV5 A;  3S2H J;  3UKG A;  1AKH B;  4A3L J;  2O7O A;  1FTT A;  3JRB A;  3OSG A;  3I4M J;  2LTP A;  1Q1V A;  3CQZ J;  4DW6 A;  1ORK A;  1F43 A;  4DZP A;  2M9H A;  2MG4 A;  4CYC B;  2K9N A;  2FQ4 A;  1WH7 A;  3BTC A;  3B6C A;  1QPI A;  4A3D J;  4MLO A;  4MO7 A;  1MH3 A;  2VKE A;  3D1N I;  1ENH A;  4QIW N;  4C3H J;  1RES A;  2HDD A;  2NVT J;  3S2D J;  1JKR C;  1WI3 A;  3S1M J;  2WV1 A;  3RQI A;  1F36 A;  5FJ8 J;  2RAE A;  2AHQ A;  3BG9 A;  1S7E A;  3BR2 A;  1VF9 A;  5M3F J;  4ABZ A;  1PUF A;  2GBY A;  5M5X J;  5EF6 A;  4BKX A;  3ZQG A;  3HOY J;  2DA3 A;  1GUU A;  4BY1 J;  2R93 J;  1ETY A;  1H89 C;  1OCT C;  4A69 C;  5J3L A;  2L7F P;  3K2A A;  1G2H A;  1JTX A;  5F04 A;  2X9D A;  2ME6 A;  5EZH A;  2DMU A;  2DN0 A;  3PM1 A;  5IOY A;  1TWA J;  3JRC A;  3S1R J;  1POG A;  2NS8 A;  2K9Q A;  1IGN A;  2YUS A;  4FCY A;  5GPA A;  2MW8 A;  1ETW A;  1QVT A;  1IDY A;  5F27 A;  2O9L A;  2KDZ A;  2HYJ A;  2LLK A;  2JN6 A;  1WPK A;  2XGD A;  3BR0 A;  2NVY J;  1R9T J;  2JK3 A;  1JT6 A;  3Q0U A;  1I6H J;  2DA6 A;  1P7I A;  1VND A;  1X2N A;  5FKN A;  2KT0 A;  2M0C A;  3FK6 A;  1TC3 C;  3JRH A;  3BTJ A;  2Y9Z A;  1IG7 A;  1ETV A;  2Y31 A;  1IRZ A;  1FIA A;  2LK2 A;  2LP0 A;  3DEW A;  3LSR A;  2LY9 A;  3QQA A;  3JRI A;  1JGG A;  1JUP A;  3LSJ A;  1GT0 C;  3BT9 A;  1W0U A;  3CDL A;  1A6I A;  5F0C A;  3CMY A;  1H8A C;  2TRT A;  5DS9 A;  1T33 A;  1UHS A;  3RZD J;  4I76 A;  1B8I A;  3FIW A;  1IC8 A;  4MIM A;  5IOZ A;  3HGY A;  4M3F A;  3IH3 A;  5EEA A;  2QCO A;  2ECB A;  4RDU A; 
#chains in the Genus database with same CATH topology
 2P5V A;  1BI0 A;  4XKW A;  3S17 J;  3DKX A;  2Y9Y A;  1RUN A;  3FXR A;  3GEZ A;  5GAG J;  1FP1 D;  2DA2 A;  2EV6 A;  3CP8 A;  2L7Z A;  3X2Q H;  2HOE A;  3BTL A;  1WJA A;  5J1R A;  1QRY A;  2KIU A;  1LPQ A;  2HPI A;  4GYG A;  4XSZ F;  5EZG A;  4OIR F;  3HUG B;  3JRG A;  4RAZ A;  4KNY A;  3ZQC A;  4OOI A;  4C3I J;  4CCJ A;  5KK1 A;  4OMZ A;  2HI3 A;  3TBI A;  2JA7 J;  1MH4 A;  2ZXW H;  5DUK A;  3S8P A;  2CV1 A;  4HX4 A;  3AG2 H;  2OAZ A;  1G6N A;  3LNQ A;  3CUQ B;  4V2G A;  5L3B A;  1U3E M;  3OYM A;  2HVQ A;  3PFI A;  1U8R A;  5M5Y J;  2P6S A;  3KP3 A;  1T6S A;  3CJN A;  1G59 A;  4IXA A;  2DT7 B;  2Q2E A;  2MYS A;  4A3F J;  1ZTR A;  4PFO A;  2HVR A;  1Y0N A;  4PDK A;  1OPC A;  1OYW A;  2FML A;  4MNU A;  5CVR A;  4F91 B;  3IAS 2;  3S1Q J;  5DCF A;  2P8T A;  3E0J B;  4QTR A;  4NHJ A;  2HZD A;  4RGS A;  1BIB A;  2RNJ A;  1MMD A;  5D6F A;  1I1S A;  5DM6 F;  2Z3Y A;  2ID3 A;  3CCU I;  4ZTF A;  2QEX I;  1X3Z B;  3E5Q A;  1MJB A;  2OZU A;  1CGP A;  3I4N J;  1FPQ A;  4XKB A;  2ZNZ A;  1HLV A;  3TGN A;  3TKY A;  1YOV B;  2V1U A;  3J81 Z;  5BNG A;  3K69 A;  1DQU A;  2NNY A;  4HV6 A;  5D5W B;  3BJO A;  1FIP A;  3MZ8 A;  2VXZ A;  2V7F A;  3VYU B;  1MBE A;  1ZQ3 P;  4XSX F;  2CQQ A;  2HDC A;  3VWB A;  2R5Y B;  5LRS A;  1CQT A;  1LFU P;  3CD6 I;  4LG0 B;  4HRI A;  4AVZ A;  4YFK F;  3M1E A;  2K7L A;  2FU4 A;  4L0Y B;  5E3L A;  2HFH A;  1K83 J;  4W97 A;  2KDO A;  3BZ6 A;  3FDY A;  1XCB A;  1B8I B;  1V3F A;  2XRN A;  1D0X A;  1R58 A;  2OUM A;  3IKV A;  1NK2 P;  1YRN A;  1EKE A;  1Y56 A;  2G7H A;  3VDX A;  2V6E A;  2JA8 J;  2D1H A;  4IF4 A;  3DLA A;  5JHF A;  3MZH A;  2Z16 A;  3SFI A;  4XL9 A;  2ECC A;  2KJB A;  2Q8K A;  4HYE A;  4R1H A;  2FRH A;  1AOY A;  1PYV A;  1FY7 A;  2HYF A;  2FEZ A;  1A36 A;  1P9Q C;  3GTL J;  5D8K B;  5KVR A;  1XSX A;  3ASO H;  1MW7 A;  1ITY A;  3M3Y J;  3ROU A;  3FK7 A;  2MA3 A;  3M4O J;  3R6S A;  2CUF A;  2XDV A;  1PJR A;  3DXJ F;  4F55 A;  2KIS A;  2WBM A;  2VC0 A;  6PAX A;  5IPA A;  4XMY A;  2LKP A;  3FXL A;  2K4J A;  3CES A;  3Q3S A;  3IL2 A;  3WGH A;  1R22 A;  1UJ8 A;  1XMA A;  2XAQ A;  2PMH A;  5ICF A;  3RIR A;  1IDZ A;  4IHW A;  4XLC A;  2ICW G;  3S3M A;  2LYC A;  1Z7U A;  2STT A;  4EAT A;  1VQ6 I;  4ZDO A;  1E17 A;  3F0C A;  2ZKZ A;  2OPT A;  3K1P A;  2W1O A;  4V19 K;  1QZY A;  2CUJ A;  1F1Z A;  3KLN A;  1X2M A;  3ASN H;  1BR1 A;  3OWT A;  3QOD A;  4M6Y A;  5JLX A;  3ZMT A;  2YU9 J;  4HLY A;  1GXP A;  1O3S A;  1UG2 A;  3W6K B;  3G73 A;  2L3D A;  3F8B A;  4A3E J;  3EPZ A;  4GCV A;  3VOD A;  4AD9 A;  1UG0 A;  3HXL A;  5E1W A;  2F48 A;  2XSD C;  3BY6 A;  2DU9 A;  4M9S A;  5L3D A;  2V1X A;  1OFC X;  3RPQ A;  3V8K A;  1F9N A;  4E7I A;  1LDD A;  2BY2 A;  2UXN A;  3I59 A;  2HQA A;  4YIF A;  4C3J J;  1H88 C;  5LEK A;  2AXL A;  2VON A;  3Q0V A;  3ZPL A;  2DOE A;  2LF8 A;  5D4S A;  1HDD C;  4BDZ A;  5ED4 A;  4BYY A;  2XVC A;  2QSH X;  2EIJ H;  2RC4 A;  3LOC A;  4C2T A;  2DCE A;  1I5Z A;  3G71 I;  4KIF A;  2FUG 2;  2TDX A;  2VJ5 A;  1I50 J;  3G1O A;  2M0M A;  1ZN2 A;  4L0Z B;  3N97 A;  4OIN F;  1ETK A;  1E3H A;  4XM3 A;  3M9A A;  2OC6 A;  5FKL A;  5JHU A;  4PJN A;  4EJU A;  2K27 A;  4EJT A;  3S3N A;  3BRO A;  2CYY A;  1WSU A;  2MH9 A;  3PQJ A;  4XLH A;  1SD7 A;  1OYI A;  3R61 A;  5FKK A;  2LMD A;  4BQO A;  4BJ6 C;  2LFB A;  5EG0 A;  2L9N A;  3OSF A;  1JTY A;  2FMY A;  1VZ0 A;  4BHP A;  1ON1 A;  5FD5 A;  3E6B A;  3OIP A;  3G1L A;  3SZP A;  4N4N B;  2HOS A;  3HTS B;  2DMT A;  3L1P A;  4M6X A;  3DTE A;  2CQK A;  4GGG A;  4ZZL A;  2BXY A;  2FOW A;  3UR3 C;  3KPH A;  2ZNY A;  3BR6 A;  1AHD P;  5DYM A;  3N05 A;  4MQ9 F;  3OYG A;  1JT0 A;  2P4W A;  2GM4 A;  4CHU A;  3FIS A;  1L3L A;  2K3F A;  2QZ8 A;  4M72 A;  2EH3 A;  4LJZ F;  3FKJ A;  2JRM A;  1XB4 A;  2O3F A;  2EJR A;  5L3C A;  3GVA A;  3G2B A;  2AQF A;  2K3P A;  3Q0W A;  1MNM C;  3PIP F;  2Y48 A;  3FMQ A;  2HPM A;  3L9F A;  3J7A Y;  4PSX A;  3D5R C;  4ENK A;  4ITV A;  5CVU A;  4CYC A;  2VBZ A;  3W2V A;  3QPT A;  4PK4 A;  2GQQ A;  3ZMV A;  3FXU A;  1TL8 A;  3NAU A;  5LGT A;  3OY9 A;  3RKX A;  1E3O C;  2B9S A;  1YS6 A;  3K70 C;  3HRT A;  3WTX C;  2VKD A;  1HW1 A;  3HM5 A;  2NS0 A;  2MBF A;  4OU0 A;  2OCC H;  4UUS B;  2RQP A;  1ZR2 A;  2B63 J;  3LSM A;  2IA0 A;  2EFW A;  3HSR A;  1HOM A;  3ZQI A;  3EUH A;  1JUS A;  2R7W A;  3FKI J;  4N0B A;  1W7P D;  1U2W A;  2CUE A;  1DGW Y;  3K2Z A;  2COM A;  4MHG A;  3ZP5 A;  2EV5 A;  3PNT A;  2K02 A;  2QEN A;  1BC7 C;  3HRU A;  2W85 A;  3C2B A;  1U5T C;  3SDG A;  3OR2 C;  3U21 A;  2A05 A;  4ENM A;  3T5X A;  4IHS A;  5DUI A;  1X4O A;  4ON0 A;  3G1M A;  1S7A A;  3HGG A;  3IWZ A;  2R7T A;  2PQ8 A;  4U7B A;  1LE8 A;  4YEJ A;  4XID A;  1FJL A;  3ZQH A;  4BDY A;  1Z3X A;  5EDN A;  2XIG A;  3M7G A;  1W5C C;  1YLF A;  3BG3 A;  1XD7 A;  2P7C B;  4LLL A;  3E97 A;  1FNN A;  2VE9 A;  1R1V A;  2PX9 A;  3GW2 A;  4B4C A;  1NK3 P;  4HDU A;  4A3B J;  1PP8 F;  1ZGW A;  3OMY A;  2Y0S A;  2XGX A;  4Q47 A;  4WF2 A;  1GV5 A;  4LB6 B;  1MSE C;  5FLV A;  5KAI C;  4XRS G;  2J5O A;  3TOB A;  2IS6 A;  1MBG A;  5IP9 J;  3FXJ A;  2MGQ A;  2QKM B;  3B6A A;  1K79 A;  1D1C A;  1D1B A;  2CFO A;  4IHX A;  3LSP A;  5B5E C;  2DA4 A;  4MQV A;  3S1N J;  1TWG J;  2WAF A;  1ZEL A;  2N8G A;  2IA1 A;  2QUF A;  5E79 C;  2M1B A;  2XSJ C;  1Z3Y A;  3VPR A;  3HRM A;  2VJ4 A;  4L9J A;  3J7Z I;  2EFQ A;  2F6C A;  2HQN A;  1RC9 A;  1SD5 A;  4UB8 C;  5K5O A;  2D1V A;  4HF2 A;  4G6D A;  4HNU A;  2E7W A;  4HAM A;  4IO9 F;  2EA2 A;  3LSK A;  5K7F A;  3P7N A;  4CIC A;  4IQJ A;  3S2H J;  2ZJP F;  1AKH B;  4A3L J;  1P92 A;  1W7P B;  1Q1V A;  2VJJ A;  3CQZ J;  5E8G A;  2HZT A;  4DZP A;  3PL8 A;  1ZRC A;  5HDG A;  4P96 A;  1F5T A;  2BHY A;  4YII A;  3MKW B;  2K9N A;  4R8H A;  1WH7 A;  2DXI A;  2Z99 A;  4BHB A;  1IRF A;  2IS4 A;  4IL6 C;  4NQW B;  2VKE A;  2V1N A;  1ENH A;  1QGP A;  3E5X A;  4QIW N;  1B1B A;  1RES A;  3HOS A;  1JKR C;  4QWQ A;  5HLG A;  1V54 H;  3S1M J;  2WV1 A;  4QLC U;  2JQ7 A;  1MND A;  2PBI A;  4WXC A;  1X1B A;  2V6C A;  1J5Y A;  1UHM A;  3UNG C;  3CO6 C;  5FFX A;  1VF9 A;  1Y0U A;  1E3P A;  1ERD A;  2GBY A;  3HL2 A;  2Z1D A;  4IRH A;  2V1D A;  2VQL A;  2DTR A;  2L02 A;  2L5Q A;  1GUU A;  3M8J A;  3ONQ A;  2PI0 A;  4BY1 J;  4HEA 2;  1P6R A;  4XLA A;  4J00 A;  3S3O A;  2CW0 F;  2STW A;  4IHT A;  3TO6 A;  1H89 C;  2KIQ A;  1OCT C;  4UVA A;  4P9F A;  2VBY A;  1IRG A;  5F04 A;  4RA2 A;  2ME6 A;  2E7X A;  5IOY A;  4LFU A;  5DD8 A;  2HWV A;  1FYM A;  5ILV A;  2XF7 A;  1UAA A;  3MKZ A;  2VLA A;  2BXZ A;  2D2W A;  2FSW A;  5DDG A;  1ZG5 A;  1ETW A;  3K4C A;  1IDY A;  3ML6 A;  1DP3 A;  2O9L A;  3DTI A;  2KDZ A;  3KEY A;  2MAB A;  4RAF A;  2O6G E;  2K85 A;  4RAY A;  2JN6 A;  2PJR A;  2CMP A;  2KP6 A;  1WPK A;  5KNL A;  1WVR A;  3FHZ A;  4G7O F;  2YSR A;  2ZFU A;  2CG4 A;  2NVY J;  1R9T J;  5CJ9 A;  3MKY B;  1HKS A;  1LKX A;  3Q0U A;  1G3Y A;  4IPA A;  5H6Q A;  4LMY A;  3JAM K;  2E1N A;  1O57 A;  5FKN A;  4OMY A;  4PSW A;  3FK6 A;  1TC3 C;  1YX5 A;  3JRH A;  4WK8 F;  4B43 A;  2EV0 A;  2Y9Z A;  1IG7 A;  2KL4 A;  4UVC A;  2CO5 A;  1FIA A;  3U1K A;  2LY9 A;  3QQA A;  2VB6 A;  1JGG A;  2A3S A;  4ZJZ A;  2W7N A;  1MDM A;  4LIU A;  1A6I A;  4C30 A;  2EIN H;  4R79 A;  2V9K A;  1HQC A;  4MTE A;  3W6J B;  1UHS A;  3JAM Z;  1UCR A;  1IC8 A;  2Q2E B;  4MIM A;  2NNN A;  2MH2 A;  3RSN A;  3HGY A;  3L2V A;  5HLI A;  5DM7 F;  1V5F A;  4XRS A;  3AL0 B;  3ABU A;  3I71 A;  1WFX A;  3WU1 B;  2RN7 A;  2LSO A;  1LFP A;  2EA4 A;  4NNJ A;  2EZL A;  3K4N A;  3LA7 A;  3TO9 A;  1A5J A;  4Y17 A;  3V4G A;  1IW7 F;  4BQQ A;  3HDD A;  5K7H A;  4D1Q A;  3HOW J;  1P4X A;  1R23 A;  3GWZ A;  4NBQ A;  3RPU A;  1LEB A;  2ACJ A;  5B3S H;  2KIM A;  2W84 A;  2KPM A;  3ABT A;  1VI0 A;  3OYC A;  4M73 A;  3GCM A;  1SFO J;  4A93 J;  1HKT A;  3D0S A;  4XON A;  1EH8 A;  4DNC A;  3P9I A;  2WA0 A;  3T8T A;  3P9K A;  3JRE A;  1S9H A;  4U88 A;  3I5U A;  3SZT A;  1YJW I;  4BNC A;  1X1D A;  1GV2 A;  5HLT A;  4M3B A;  3BG5 A;  2IT0 A;  2HVS A;  3KIO A;  2LC2 A;  1JUM A;  5D5U B;  5C4J J;  2WTE A;  5L3E A;  2DMP A;  1ETO A;  3NQO A;  2NXN B;  4N4O B;  2R7S A;  1U6G A;  2WWY A;  1YRN B;  1JHH A;  3Q9V A;  4D5C A;  1Z9C A;  2NS7 A;  3TMO A;  5KAF C;  3RYR A;  4MTD A;  3CO7 C;  3LAJ A;  1T08 B;  3WE3 A;  1FOW A;  2Y0S N;  3WTZ A;  1HDP A;  3WTT C;  1IXR C;  3O6B B;  1OCR H;  3OOP A;  4HPQ A;  2F4I A;  1MBJ A;  2CGP A;  4TV7 A;  5LGU A;  4IKF A;  4L5I A;  3RTR A;  3CC2 I;  3KP6 A;  1LJ9 A;  4DYQ A;  3GZ5 A;  1YHQ I;  5M5W J;  3HBL A;  3H5A A;  2R0Q C;  5GAD J;  3W6V A;  4I2O A;  3KET A;  4UXN A;  2ME0 A;  1O7F A;  1MJ9 A;  2ZJ2 A;  3DKY A;  1S29 A;  5CVJ A;  3ZCO A;  3WG9 A;  1ZG1 A;  1W36 D;  3HZJ A;  1I27 A;  1EA3 A;  2FBH A;  4QSH A;  4CCO A;  3OV8 A;  3FHN A;  2VOP A;  3BQY A;  1BW5 A;  2WC2 A;  2XF5 A;  2VUM J;  4CDG A;  2CUZ A;  3HHH A;  2IP2 A;  4X0G A;  3ERE D;  3FXM A;  2E2I J;  2DA1 A;  1YJN I;  3ZGK A;  3BCB A;  5EGO A;  4BXU A;  3LSI A;  5LHH A;  3KYC B;  2IVM A;  4XRF A;  3TOA A;  3CLO A;  1KU9 A;  3BWG A;  1B9N A;  1ZGJ A;  4HOB A;  3PSF A;  1T39 A;  1RRJ A;  3HC7 A;  1Y1W J;  4I6Z A;  3ZQF A;  4LD5 A;  3ZMS A;  3CME I;  1X3W B;  3CCM I;  4KYW A;  3ZR8 X;  4WXH A;  2OF7 A;  4A3C J;  2NRA C;  4HZF A;  4BY7 J;  3T8R A;  3I59 B;  2JT1 A;  4FTH A;  3A03 A;  1VFC A;  2P7V B;  3HJE A;  3CCJ I;  1JJ6 C;  2O8X A;  1FC3 A;  4A3I J;  2VKV A;  3F8M A;  1JJ8 C;  1K4S A;  2XPV A;  1EV7 A;  2O5R A;  3KCC A;  3VB2 A;  2DPD A;  2F5F A;  2WY7 Q;  5DD4 A;  1I1G A;  1T2K A;  1LFB A;  3MZY A;  1OCZ H;  4S0H B;  2VPR A;  5LGN A;  3ECO A;  5F64 A;  3M8E A;  4I0A A;  1I6X A;  1T38 A;  1R5G A;  1KZH A;  4G6Q A;  1B4A A;  1X1A A;  2VC1 A;  4OWR B;  5IYD J;  3GME A;  5B1B H;  2ZJR F;  3NWS A;  3GXO A;  1JGS A;  2DYR H;  1TBX A;  4RMN A;  3K1N A;  3HPG A;  4NC6 A;  5EG0 B;  3E1S A;  2OU2 A;  1JXS A;  3FWE A;  3GFL A;  2H1L A;  3H9G A;  3J80 K;  1BR2 A;  4UVB A;  3GF2 A;  4KN7 X;  4ESF A;  4ZYG A;  1UMQ A;  4ZYE A;  2HKX A;  2W25 A;  3P5J A;  4P5O A;  2FQ3 A;  3QRF F;  2HEO A;  1EH7 A;  1RR7 A;  2XRL A;  2YS9 A;  4D7N A;  4IZZ A;  2JVG A;  3B73 A;  1VQL I;  4A3M J;  5DTD A;  1MIJ A;  4Y15 A;  2BY3 A;  2MC4 A;  3SFZ A;  2P5L C;  3CCR I;  2KRH A;  2VE8 A;  5GP9 A;  1STZ A;  4DGW B;  5CVV A;  2LY1 A;  3LST A;  2NOG A;  1G8X A;  5C4X J;  3HOX J;  5E3N A;  3OYN A;  3GTP J;  2XC7 A;  3J80 Z;  1OJL A;  4KIG A;  1MKM A;  1O7L A;  5IY5 H;  2A07 F;  2UZK A;  4G6T B;  1KQ8 A;  4DOZ A;  1I3Q J;  3OIO A;  4NUB A;  4JP0 A;  3WGI A;  5JLW A;  1XGN A;  2XPW A;  4ZYH A;  2R5Z B;  1QHG A;  2R92 J;  3FMS A;  3JR9 A;  4XK4 A;  1KU3 A;  2L9S A;  2FNP A;  3G4S I;  1YIO A;  5J4V A;  1MBK A;  2BE5 F;  1VQ4 I;  1V5G A;  3CJT B;  4DBR A;  1D5Y A;  3ELK A;  4X1E A;  5ICE A;  1WCM J;  2DK5 A;  4FE7 A;  3KZZ A;  4LK1 F;  4CA0 A;  1FBS A;  4DQ2 A;  3BLY A;  1FEX A;  1Z0X A;  1WJC A;  5FRM A;  5E17 F;  3SEQ A;  5LBQ A;  3OS1 A;  5ERI A;  1IV8 A;  3S32 A;  5FKM A;  3OL4 A;  2LVS A;  3DEU A;  3JTH A;  3HOU J;  3K4J A;  2LRE A;  4UV8 A;  3VFZ A;  2W24 A;  1LE8 B;  1XGO A;  1TW2 A;  2VKH A;  3IP4 B;  4KJZ A;  3QP5 A;  1HF0 A;  2ZXH A;  2VPL A;  1GVD A;  2AO9 A;  2OV7 A;  2QLZ A;  3H3Z A;  5ILU A;  5IYC J;  4HA8 A;  1Z21 A;  1OCP A;  4P9U A;  3HKZ A;  4V2F A;  4W1U A;  3KEQ A;  5F1R A;  2H27 A;  4BBS J;  4Y3O A;  2DJN A;  5EEG A;  1J0R A;  3F8C A;  1G3S A;  1VQ7 I;  1UHW A;  1OYY A;  5C3E J;  3L7W A;  5JI6 A;  2ETH A;  2BYV E;  1OR7 C;  2TCT A;  3AG4 H;  2VI6 A;  4ZYA A;  4U0W A;  1R00 A;  1APL C;  4BEH B;  4IRG A;  2X6Y A;  2JZY A;  3WOD F;  4LG3 A;  4CSW A;  3P9C A;  1GLN A;  1R4N B;  2VXD A;  2XB0 X;  1FOK A;  2VBW A;  1YFH A;  2HQR A;  3IRQ A;  1LDK B;  2O61 A;  2KJC A;  4HG2 A;  2MD5 A;  5BOX A;  1IZ1 A;  1U5T A;  1K6Y A;  2DFE A;  3DCF A;  1O4X A;  2GXG A;  3DQV C;  4I09 A;  1YX3 A;  2E2H J;  3HRS A;  4X6A J;  4M71 A;  2P6T A;  1D3Y A;  2ZME B;  4O6J A;  1XPX A;  4EJO A;  2A61 A;  1J75 A;  4RGU A;  3CJQ B;  3I54 A;  2MSY A;  1Y1V J;  3HTU A;  1LDJ A;  4A5M A;  4DYC A;  4XLP F;  3RZO J;  2JRT A;  2OQR A;  2A6T A;  5E1X A;  1SMY F;  4FX4 A;  3TDU C;  4CO8 A;  3EYI A;  4AWX B;  2KFD A;  1UFM A;  2DDA A;  3MWM A;  3ZXS A;  3KYD B;  1ACI A;  1HCR A;  5IT9 K;  5KHD A;  3F9K A;  2XGE A;  1R5H A;  2I10 A;  4EJV A;  2PMZ A;  1JE8 A;  2NVU B;  5HOO A;  1IO2 A;  4HST A;  5BPI A;  3BTI A;  3RI4 A;  1UEL B;  2CQX A;  2B7E A;  3OL3 A;  3IV5 A;  3QP6 A;  5H2F C;  1UST A;  2BW3 A;  2O7O A;  3FXQ A;  3OSG A;  3WTY C;  2A69 F;  2LTP A;  4AM3 A;  3O3K A;  4DW6 A;  2UXX A;  3PQK A;  3AL0 C;  1IUY A;  1JHF A;  2KRF A;  2NYX A;  2M8E A;  2E5Z A;  3LAP A;  3JSP A;  2E35 A;  1CF7 A;  1QPI A;  3DWL E;  4MLO A;  1KYZ A;  2Q0O A;  4FET A;  3RPU D;  5LFA A;  3IKT A;  4C3H J;  2M30 A;  1WI3 A;  1SC7 A;  2MD0 A;  3FM5 A;  3L2R A;  2OTL I;  2VT2 A;  1X3U A;  4RM2 A;  1FSE A;  1R6R A;  2PJR B;  2RAE A;  4GRI A;  4D9J A;  2QBY A;  2R7V A;  1S7E A;  4LLN A;  3GFI A;  2QQ9 A;  4KIT B;  1W4M A;  5M3F J;  3BZC A;  1DDN A;  2O0Y A;  5M5X J;  1YW9 A;  4BKX A;  3C3W A;  1EH6 A;  2RRE A;  3RJP A;  5BS6 A;  2ZJQ F;  2DA3 A;  1B6A A;  2CFX A;  4CZZ A;  1TNT A;  4MEY F;  4BE1 A;  4CCN A;  2IA2 A;  2M7B A;  1SVL A;  1FOX A;  1TT0 A;  2RKH A;  3KFW X;  4A69 C;  5J3L A;  2LY2 A;  5H20 A;  2HYG D;  2NOJ B;  2X9D A;  3IC7 A;  4FT8 A;  4G9Y A;  5EZH A;  2DMU A;  1MDM B;  1VQ8 I;  3MAJ A;  3JRC A;  5FB2 A;  2MC3 A;  4HDV A;  4UUV A;  4BU2 A;  2X1D A;  4EVI A;  2LNB A;  5D6E A;  3ULQ B;  4O3M A;  4RM3 A;  4FCY A;  2MW8 A;  2IXS A;  2LRD A;  4FAS D;  1G4D A;  2G9W A;  2DI3 A;  2K9M A;  2XAS A;  2LLK A;  1WRJ A;  2XAH A;  4RS8 A;  2E34 A;  2XGD A;  5E8I A;  3R0J A;  2JK3 A;  4F7Z A;  1Y6I A;  3W2W A;  3VOE A;  1JT6 A;  1I6H J;  4OIO F;  1FYL A;  2H6C A;  5HVQ C;  2LG4 A;  1VND A;  3KP4 A;  3WE2 A;  4II2 A;  1USS A;  2M0C A;  2QWW A;  2DO7 A;  2HDW A;  1S6L A;  1Z6R A;  1ETV A;  4BE0 A;  4ETS A;  1IRZ A;  4E7H A;  2KRC A;  2XKO A;  2DOA A;  1TTY A;  1WZ2 A;  3DEW A;  3LSR A;  4LG0 A;  4L9V A;  2XRO A;  1W0U A;  1N75 A;  3HSE A;  4B8X A;  2ELJ A;  1S5L C;  3DPT A;  3COA C;  3D5S C;  1S8N A;  1B8I A;  2IW5 A;  4NC8 A;  1XTA A;  4EM1 A;  1V5E A;  3CUO A;  2HTS A;  3F3X A;  2FBI A;  3V7R A;  4LIV A;  1WJB A;  1YIT I;  1WWX A;  3SEZ A;  5A2Q K;  5DEQ A;  2GOX B;  2VQC A;  4M3D A;  3DBH B;  1A04 A;  2PFB A;  3CMA I;  1D8K A;  3CMM A;  4NB5 A;  3OS2 A;  4XN0 A;  4B47 A;  3A2K A;  4DJA A;  1QU3 A;  2LKS A;  4N9I A;  4B44 A;  3HKZ N;  3GX4 X;  5A2Q Z;  3DKW A;  3E5U A;  4EJW A;  1DU6 A;  5DV5 A;  3ZMD A;  2LOO A;  3H35 A;  5FFZ A;  1LEA A;  1XC5 A;  3ZQ7 A;  2YR2 A;  4XBF A;  2JA2 A;  1WJD A;  3TP0 A;  4BXX J;  1TP4 A;  5B66 C;  3K0L A;  1H0M A;  5LD2 C;  4AYB A;  3PO2 J;  3I64 A;  4C2U A;  4ENN A;  2QKL B;  3TED A;  2CV0 A;  2V79 A;  4NC7 A;  4KT5 C;  4XN3 A;  4RBO A;  2EZI A;  3SJM A;  1BN5 A;  3Q9S A;  1FT9 A;  1FYK A;  1XSD A;  4KA4 A;  2OBP A;  2X85 A;  1TQM A;  1WI9 A;  1GXQ A;  4HX8 A;  1TWF J;  5AON A;  4E7Z A;  1PP7 U;  4BQA A;  2Y2Z A;  2QQA A;  4YFX F;  5BQT A;  1XMK A;  3BR5 A;  4E6K G;  4B3A A;  3CUQ C;  4F52 A;  2JWT A;  2DTZ A;  1RPW A;  3CCY A;  1RR8 C;  3DF8 A;  3VEP A;  4BGD A;  3A0B C;  4HX7 A;  2WAQ A;  3EET A;  3IH2 A;  1YI2 I;  4DYR A;  3B02 A;  5J1U A;  3I56 I;  5J1Y A;  3A4C A;  4JX6 A;  3GTM J;  4QPO A;  1Z7L A;  3HIF A;  4PGG A;  1F4K A;  2EFO A;  1ETX A;  4IHY A;  2XAJ A;  1QVU A;  3HSF A;  3CCL I;  3M07 A;  2QVO A;  3H0G J;  2BOL A;  1XMX A;  1IN4 A;  5ICC A;  2M3A A;  1I39 A;  2V4J C;  3SXY A;  2QQB A;  4EGZ A;  4JOM A;  2PMZ N;  4XKV A;  1KA8 A;  2P81 A;  3O8H A;  3V42 A;  4XQF A;  1ZRF A;  5HDN A;  3GTJ J;  1DPU A;  3L2W A;  4C9Y A;  3TP3 A;  1EJ9 A;  2BY1 A;  4ASN A;  3JRD A;  3C1D A;  4HQE A;  2C6Y A;  1AWC A;  2LR8 A;  3E6M A;  2COB A;  1KYW A;  1BJA A;  3E7L A;  4M3E A;  4KMU X;  1EF4 A;  3OYJ A;  3PO3 J;  2IAI A;  1MZB A;  1MD0 A;  2L9R A;  1X4P A;  3DPL C;  4Y13 A;  2DMN A;  3L09 A;  4LGW A;  4PFP A;  2XGC A;  1ZLK A;  2H94 A;  2NVX J;  4L18 B;  3BR1 A;  1MGT A;  3E6D A;  1RET A;  1RIO H;  4MGR A;  4RAG A;  5LHI A;  3GTK J;  1MMA A;  4A6E A;  4BL0 B;  4KMF A;  3EUH C;  2HXI A;  2LKX A;  1B72 A;  1FWZ A;  4PUS A;  3ABK H;  2IGM A;  3BG7 A;  3W2A A;  3BR3 A;  1IXS B;  1WJ5 A;  5IT3 A;  4ZYD A;  3VSK A;  4IRI A;  3V7S A;  3DTK A;  2M34 A;  5DCM A;  1X19 A;  2L7M P;  1BOB A;  2ZO4 A;  4BXF A;  3SQN A;  2HNH A;  1I3A A;  1V4R A;  1Y8R B;  2NVQ J;  1HST A;  1SD6 A;  1SFK A;  3VYR B;  4E7K A;  1JKQ C;  2DQL A;  5FKO A;  3H1C A;  1FTZ A;  2EFP A;  1TZL A;  5F0H A;  3KP5 A;  4XOP A;  4Y7N J;  3ZQL A;  2I5U A;  1LNW A;  1XGS A;  1FZP B;  2JUC A;  1K61 A;  2DOF A;  2Z9O A;  1T0F C;  3T0Y A;  3KEO A;  5D5V B;  1TWH J;  2LD5 A;  1LUJ B;  2ADU A;  3GFJ A;  3K70 D;  4D5F A;  4XKC A;  2IS1 A;  1O3Q A;  4XIC A;  1ETQ A;  2IGK A;  2CWE A;  2H09 A;  2O8K A;  3H3U A;  4II3 A;  1J59 A;  4UUS A;  2ESH A;  1YIJ I;  1M1E B;  2ZBK A;  1XX5 A;  4KIB A;  5B1A H;  2X6O A;  4YRV A;  1WGX A;  1SEU A;  1XSV A;  1NHA A;  4J01 A;  3I53 A;  1VQO I;  2QA4 I;  2IGN A;  4JYK A;  2FXA A;  5J8F A;  1QA6 A;  1B9M A;  2RVC A;  2XKP A;  3H9Q A;  4QPQ A;  1JKP C;  3RKY A;  4B48 A;  2L4M A;  4BHC A;  5M3M J;  1ZK8 A;  3FBN B;  1MJA A;  3TW7 A;  1VQN I;  2UV1 A;  1V55 H;  4JBA A;  2Y30 A;  3KLO A;  3A01 A;  3HOV J;  2ZME C;  2R4G A;  4LLG F;  2AS5 F;  5HS9 A;  1HBX G;  4U0V A;  4Q48 A;  1Z77 A;  3H3V K;  2X48 A;  1DU0 A;  4KIS A;  2RNG A;  2JPB A;  3ECH A;  3OYI A;  1T56 A;  4I02 A;  4FX0 A;  1DP7 P;  2PJP A;  1BOA A;  4LK0 F;  1O3T A;  1XS9 A;  2JSC A;  3I55 I;  3FXK A;  5GTI C;  4RB1 A;  4I99 C;  1WJF A;  3A02 A;  3WTS C;  1XCV A;  2CV2 A;  3WU0 A;  1YE9 A;  2GA2 A;  3MCZ A;  4MFD A;  2ZFW A;  2F4O B;  3BCA A;  2PG4 A;  2IRF G;  3OOU A;  2GIZ A;  2X6X A;  1VQM I;  1S72 I;  1MMN A;  4O5V A;  4WX9 A;  4UY8 I;  3ESW B;  2OZ6 A;  1Z67 A;  1X1P A;  3QPS A;  2CQN A;  3E3V A;  1OCO H;  3OR1 C;  5K5R A;  3JW4 A;  4GYI A;  4Y4R A;  1N77 A;  1AKH A;  3GTG J;  1W5S A;  1DPR A;  2FOK A;  1X1C A;  5GTH C;  1IRX A;  3HOT A;  2X51 A;  2G0E A;  4D0P A;  5TIS C;  2ELH A;  5HNF A;  3DU6 A;  2MFZ A;  5AIQ A;  2H1K A;  5FRN A;  1RI7 A;  1MMS A;  2E36 A;  1ZLJ A;  2L4A A;  4XRM A;  4IX7 A;  3O8G A;  2VAS A;  1G3W A;  2X4H A;  1T98 A;  3F72 A;  4AYB N;  2QSG X;  3LQR A;  4FQG A;  3EDP A;  1XGM A;  2IEK A;  4WXD A;  4YG2 F;  1FLI A;  1T95 A;  3MMY B;  1BI1 A;  1BJZ A;  2HGC A;  5E3M A;  4C2M J;  3IWF A;  2KHM A;  2FNA A;  2W4S A;  9ANT A;  4D7M A;  1FSH A;  2CQ7 A;  4IVN A;  1LVK A;  1TWC J;  2CJJ A;  4WCG A;  5CYV A;  2LBF A;  1SFU A;  3NEU A;  2BEO A;  3MEX A;  3GTQ J;  3AG3 H;  4RB3 C;  3CC7 I;  1OR7 A;  1X58 A;  3CF2 A;  3BZK A;  5AIP A;  3BQZ A;  1HKQ A;  4YFN F;  1MSF C;  4KDP A;  1HA8 A;  2Y0M A;  1ZAR A;  1KGS A;  3PJR A;  2WAQ N;  4CYD A;  2OQG A;  2PN6 A;  5E3O A;  2R7Z J;  3KZY A;  1TLH B;  2L9V A;  5D4R A;  4HBL A;  5F08 A;  4ZTJ A;  2EZK A;  5FO5 A;  4LIT A;  1YW8 A;  3JRF A;  2BW3 B;  2DYS H;  5F0F A;  4EEF G;  5E18 F;  4HNV A;  2CW8 A;  4CXF A;  5HOD A;  5CPR B;  1ZR4 A;  1SFE A;  4M6V A;  2R7Q A;  3EUA A;  1OIS A;  1VQP I;  3KP7 A;  4KT6 A;  1Q1H A;  2Z33 A;  2X0L A;  1RKW A;  1CF7 B;  2LH9 A;  1YQA A;  2VN2 A;  4A5N A;  2V26 A;  2L0K A;  4RLF A;  3GLX A;  1P4A A;  2KQR A;  2M7A A;  3KE2 A;  3R60 A;  2HOA A;  3C18 A;  2K9S A;  2DPU A;  2LF7 A;  3HOZ J;  1VTN C;  3QU3 A;  5HNH A;  4KN4 X;  4IHV A;  3H5R A;  3F23 A;  5IYB J;  1ZG3 A;  2R7D A;  2IS2 A;  3DP7 A;  1YS7 A;  2QBY B;  2I8D A;  1GHC A;  3C7J A;  2A5Y B;  3CDI A;  3QWL A;  2BVL A;  1U78 A;  2DAO A;  2CS3 A;  1YG2 A;  1C0W A;  3EUK L;  3F6V A;  2MLG A;  3BJ6 A;  4BS9 A;  1D1A A;  5GAE J;  3I9V 2;  2A68 F;  1SMT A;  4EV0 A;  3UKG A;  4EM0 B;  2HS5 A;  2EIK H;  2KKO A;  3HHG A;  3BP8 A;  3ZQQ A;  1FTT A;  2F2E A;  3I4M J;  3KX2 A;  2LDU A;  3J81 K;  4ZZD A;  2GIV A;  3W3C A;  3ZMZ A;  1D0Y A;  2M9H A;  3ZN1 A;  5ILS A;  4CYC B;  2FQ4 A;  1R71 A;  3QYB A;  2JVH A;  3B6C A;  4A3D J;  2AQE A;  4JK1 X;  1MH3 A;  1W5T A;  3LA3 A;  2HDD A;  3TDZ C;  3QOP A;  2R7R A;  5HS7 A;  3K4B A;  1F36 A;  4FHT A;  1OCC H;  4E7J A;  5FJ8 J;  1YTY A;  3MQ0 A;  5J4Y A;  3QPH A;  1QZE A;  3PNY A;  3PSI A;  4KUM A;  2ZC2 A;  3BR2 A;  4G8X A;  2CSO A;  4ABZ A;  1PUF A;  4EGY A;  3MFK A;  2A6H F;  1Z1D A;  2EB7 A;  3GUD A;  2GXB A;  4PJJ A;  1ZAO A;  1TQI A;  1S3J A;  2DFF A;  1FMV A;  2BGC A;  1KU7 A;  1ONV A;  1E2X A;  1ZYR F;  3JSO A;  1ZRD A;  3K4M A;  3ABM H;  5J6X A;  4A12 A;  4XOT A;  2L7F P;  4XLN F;  1G2H A;  3IHU A;  1JTX A;  3FXO A;  3IRR A;  2DN0 A;  2QQ8 A;  3QYE A;  3EQL F;  3S1R J;  1POG A;  4BAY A;  1K7A A;  2NS8 A;  3NRV A;  2YUS A;  1H9T A;  2WB1 A;  3FX3 A;  3IUO A;  5F27 A;  5LHG A;  2RQQ A;  2BV6 A;  2HYJ A;  1IAW A;  2E71 A;  3LWF A;  4IQ4 A;  4PJL A;  1N78 A;  3K6G A;  2HTJ A;  2DK8 A;  2YPR A;  3C2G A;  4E7S A;  3GLL A;  3VSL A;  1HXD A;  2P0W A;  1P7I A;  1X2N A;  1IN5 A;  3ISP A;  2A5W A;  2F5C A;  4DBQ A;  1IN7 A;  4XOR A;  4BH9 A;  3D5L A;  5TGT A;  2LK2 A;  1WHU A;  3CJR B;  4M9Z A;  4ZDP A;  2Y75 A;  1D0Z A;  1QNT A;  1JUP A;  1R4M B;  4RGX A;  5LEJ A;  3LSJ A;  4HV5 A;  3BT9 A;  3BC8 A;  1BR4 A;  3CDL A;  3LFU A;  3PIO F;  3K10 A;  2BVM A;  2RV8 A;  1BI2 A;  3AKZ A;  3L00 A;  3I3L A;  4M74 A;  5F0C A;  3CMY A;  2QSF X;  2BBY A;  2YX7 A;  5DS9 A;  1T33 A;  2R7X A;  4HF1 A;  2Z5U A;  4I76 A;  5CLS A;  1FX7 A;  3FIW A;  5IOZ A;  1XN7 A;  3E6C C;  4KIC A;  2ECB A;  3VYS B;  2W57 A;  3O2P E;  3V8L A;  1K78 A;  3JCU C;  5EYR A;  5E20 A;  2RDP A;  2WAE A;  3G6E I;  1K4T A;  3MN2 A;  1LB2 A;  5FD6 A;  3AG1 H;  4GO1 A;  2K9L A;  1L0O C;  4MFE A;  2BZT A;  3BJA A;  4AVP A;  2EQR A;  1JKO C;  2OCE A;  2PEX A;  4G7H F;  3FBI B;  2XAG A;  2PLY A;  2KZG A;  3H92 A;  4B3X A;  2IBD A;  3WHB A;  5IT9 Z;  1SAU A;  2Z2S B;  4A0Y A;  1K6O A;  2M5W A;  4F3Q A;  4Q4Z F;  1VQ5 I;  2BY0 A;  2OA4 A;  2YU3 A;  1IXC A;  1E0E A;  4S05 A;  5IP7 J;  3HB9 A;  4UV9 A;  3EYY A;  1LQ1 A;  2JA5 J;  1RNL A;  2HR3 A;  2GZW A;  2V9V A;  2A6E F;  2QF7 A;  3V8J A;  3CCS I;  3K4K A;  2X1C A;  4ENJ A;  3R4K A;  3BPX A;  3RDI A;  4U7D A;  3QU6 A;  3F8F A;  3HUG A;  3M8F A;  3A0H C;  4GFB A;  3S2W A;  4L5J A;  3QYF A;  3TL4 X;  2DFI A;  2JUG A;  2R7O A;  2E1O A;  2GOM A;  4U87 A;  4J19 A;  3CF5 F;  1REP C;  2PMU A;  5GAH J;  4M9X A;  2DBB A;  2E1M B;  2VOO A;  2DA5 A;  1T8I A;  2KIF A;  1WJE A;  2XF6 A;  3CUQ A;  1D5V A;  2H6B A;  1MBF A;  3LSG A;  3F22 A;  1B72 B;  3AAF A;  4PJM A;  1R49 A;  2W82 A;  2HOT A;  2P5K A;  4UUT A;  3FMR A;  2O03 A;  2HKO A;  1U9N A;  3GO5 A;  2ELK A;  2F5V A;  5DCM B;  1ZGA A;  4LB5 A;  2DT5 A;  3SYT A;  2KMU A;  1WH5 A;  2E19 A;  3RCO A;  2KZV A;  2XPU A;  3SHF A;  2GAU A;  4OAZ A;  2UUZ A;  5IP6 A;  3K7A J;  5HLH A;  2DT6 A;  2K86 A;  5J40 A;  3F8N A;  4F92 B;  3L2Q A;  4L5E A;  2ISZ A;  5CQE A;  1RKT A;  4AIK A;  3LMM A;  3ABL H;  2ISY A;  5FGM A;  2JA6 J;  2DLL A;  4BE2 A;  4RB2 C;  3FM3 A;  2L54 A;  2R5Z A;  3FF5 A;  4E70 A;  1R36 A;  4JX4 A;  1B59 A;  4HF0 A;  3RKW A;  1NG6 A;  3WTV C;  2R5Y A;  3M1C A;  4NDL A;  3K4L A;  1TW3 A;  2UWM A;  1ULY A;  4UB6 C;  3PUB A;  1W1W E;  4DIQ A;  1BL0 A;  1SAN A;  5F6F A;  4E7L A;  2EPF A;  2ZSI B;  3S16 J;  4H4K C;  5L3F A;  4P1W A;  3U9G A;  5HDK A;  1WQ2 A;  2ZB9 A;  1NG7 A;  3MKL A;  2DA7 A;  4I0B A;  4BAC A;  4RGR A;  4M3G A;  1HC8 A;  1NH3 A;  1IN8 A;  3A01 B;  3LL7 A;  4HLX A;  2E2J J;  2M87 A;  3RQ4 A;  4IEJ A;  4IJA A;  3BPV A;  2ESN A;  4B09 A;  2EFN A;  2E1C A;  4B1R A;  5ICG A;  1QZZ A;  5D5X B;  2VIX A;  3CZ6 A;  4DZJ A;  3LQQ A;  1RUO A;  1ON2 A;  1T0F A;  2EK5 A;  5F1J A;  2L7K A;  1G3T A;  4Z2Y A;  5CKT A;  1XDU A;  3F21 A;  3GFM A;  4P55 A;  1FOY A;  2CRG A;  3IH4 A;  3DFG A;  2XAU A;  4CCK A;  1J2X A;  3KZI C;  1IN6 A;  3U1D A;  4BBR J;  1BC8 C;  2B0L A;  2FJ1 A;  2WB1 N;  2OD5 A;  3GTO J;  3OYL A;  1UB9 A;  3GZ6 A;  2GA1 A;  1IUF A;  2QYO A;  4BEH A;  2E5N A;  3N4M A;  3ZRG A;  2DW4 A;  5JVT A;  3OYH A;  3CC4 I;  5GPC A;  1FMW A;  2K4B A;  2WV0 A;  2OTJ I;  2F4M B;  2FF4 A;  3OYK A;  2Q1Z B;  3NWT A;  4A2U A;  3BOQ A;  1J09 A;  2FA5 A;  3DLL F;  1Z6T A;  1TQP A;  3TW6 A;  4ZC3 A;  2M4G A;  3G3Z A;  1J9I A;  2EIM H;  1OMI A;  1KON A;  1J7K A;  2ZXI A;  2JPC A;  1FP2 A;  3CCV I;  4Y52 J;  4BJ5 C;  1JI8 A;  5EJC A;  1W0T A;  3PNV A;  3F6O A;  2ZME A;  2JMW A;  2CH0 A;  3WU2 C;  1IJW C;  4A3K J;  1IV6 A;  1YO5 C;  5KCM A;  4FE4 A;  1W36 C;  2R3S A;  3JRA A;  1PDN C;  3CLQ A;  1P7J A;  1Y8Q B;  3ZN0 A;  1R1U A;  1U0J A;  4K2E A;  4U0Y A;  1S7O A;  3S14 J;  1SVM A;  5K1Y A;  1N25 A;  3L2C A;  3HPH A;  3R0A A;  4L9N A;  2BHZ A;  1OLT A;  2H8R A;  4ESB A;  3MVP A;  5K5Q A;  5EGO B;  3CCQ I;  2ZSH B;  2ID6 A;  1AU7 A;  3QPL A;  1XDS A;  1AA7 A;  4CGZ A;  2F5E A;  2DOD A;  2GLO A;  2J5P A;  1HSJ A;  4A3J J;  3DV8 A;  5JFR A;  3PFY A;  1R7J A;  2LBF B;  1QQI A;  4CCL A;  2ZXJ A;  4G12 A;  4LOC A;  3TQN A;  4A0X A;  1U8B A;  2W48 A;  3HEF A;  2K40 A;  4IOC F;  3WTW C;  2VQH A;  1UZC A;  1A31 A;  3WHC A;  1SVO A;  5K7Z A;  3CCE I;  2KLO A;  2FX0 A;  2XB5 A;  4HQM A;  1Z05 A;  4HW0 A;  4I98 B;  3L2U A;  2G7U A;  3H5N A;  4AC0 A;  1QO0 D;  5H6R A;  4ZH4 F;  2CU7 A;  2HQ5 A;  3HYI A;  3GBG A;  2EZH A;  2X6W A;  3V7C A;  2WY8 Q;  1BBY A;  1U9O A;  5FLM J;  5LLQ A;  1QPM A;  2EBI A;  2YX4 A;  3OYE A;  2H8W A;  2L01 A;  5FRO A;  3OS0 A;  2OJE D;  4BJT A;  1MBH A;  3WTU C;  4A3G J;  3H36 A;  1NTC A;  1O3R A;  4XLF A;  2F5D A;  5J47 A;  2M45 A;  5JR3 A;  2MLK A;  2DJI A;  2XUB A;  5JVG F;  1R5I D;  3JTG A;  5EEH A;  4AIH A;  1GDT A;  3DU5 A;  2D5V A;  2VT3 A;  4E4H A;  1TT5 B;  3S15 J;  3OIQ A;  1HW5 A;  3A1Y A;  3BDD A;  4EM2 A;  2XV4 S;  4CZC A;  1Z91 A;  1BM9 A;  4UHT A;  1ZKG A;  4MEX F;  4RLQ A;  3LSH A;  3OYB A;  3DBR B;  1PVE A;  2E60 A;  4UNO A;  3PUF A;  2V9P A;  3Q5F A;  3I0T A;  1P4W A;  3CDH A;  2M8G X;  4PGH A;  4I7H A;  2HXO A;  2DMQ A;  1GVJ A;  2JTV A;  2NAZ A;  1XG1 A;  1YJ9 I;  3NAR A;  3ZOB A;  4G7Z F;  1ODD A;  1BW6 A;  1VQK I;  2VBX A;  3H0D A;  5BPD A;  3AFH A;  1MNE A;  3SZG A;  5TJJ A;  2L2O A;  4L9T A;  3REO A;  2XHK A;  4AUX A;  4CCM A;  2WAD A;  3CTA A;  2FD5 A;  4JX5 A;  3MD2 A;  1A6Q A;  4WWC A;  2M4K A;  2M2E A;  1BI3 A;  4HSR A;  3T1B A;  2GXA A;  5TRD A;  1A35 A;  1RZ4 A;  1YW7 A;  1PUE E;  3RKQ A;  4Y33 A;  1BA5 A;  1OKR A;  2JJ7 A;  3KP2 A;  5D8L B;  2W00 A;  1PUF B;  1KQ9 A;  2GWR A;  4FIS A;  4RB0 A;  1ZHF A;  4N9H A;  4PJ0 C;  5C44 J;  3GZN B;  1YYV A;  3GYH X;  5HS8 A;  2DDB A;  3VYT B;  3LFK A;  4PZJ A;  5J8C A;  3DBL B;  3S93 A;  4OAY A;  1DGR M;  3HG9 A;  3JRB A;  2AXT C;  3CP2 A;  1FBQ A;  3SDB A;  4AIJ A;  1ORK A;  1F43 A;  5FLX K;  2MG4 A;  4I01 A;  3BTC A;  2VQG A;  3OYF A;  2HU9 A;  2QM3 A;  2VJI A;  4MO7 A;  4HNT A;  3DEE A;  2R7U A;  2EIL H;  2DFH A;  3D1N I;  2QGU A;  2NVT J;  3S2D J;  3ZMU A;  3J7Y J;  4EQQ A;  2IPQ X;  3RQI A;  3OYD A;  4AID A;  1OQY A;  3ERM A;  1ZH5 A;  3WG7 H;  1SD4 A;  5CQG A;  3C2H A;  2D45 A;  1SFX A;  2AHQ A;  3BG9 A;  4XR6 A;  1IF1 A;  5FLX Z;  2JSP A;  3IAM 2;  3WGG A;  4YEL A;  1FBU A;  2VOD A;  5EF6 A;  3ZQG A;  3HOY J;  4BUP A;  3I58 A;  1P2F A;  3FZV A;  5CVI A;  1Y39 A;  4YIR X;  4OIP F;  2R93 J;  4XLE A;  1ETY A;  1W7P A;  3OYA A;  1U5T B;  4JQF A;  4ZDL A;  4PCQ A;  5E1Z B;  3K2A A;  4XNF A;  1HW2 A;  3PM1 A;  1TWA J;  1QHH D;  3H9J A;  2VL8 A;  1BIA A;  1VQ9 I;  1IGN A;  2K9Q A;  4NQW A;  2IGO A;  5LRR A;  4IOA F;  5GPA A;  1QVT A;  1KQ0 A;  3J7A O;  3LA2 A;  4A6D A;  1TNS A;  1R1T A;  4CH7 A;  2FBK A;  4Z6Y A;  4KFC A;  1K78 B;  2E1M C;  3QOE A;  4A0Z A;  2RGV A;  3TO7 A;  3BR0 A;  3K1M A;  4GDF A;  2R7F A;  4F93 B;  4ESJ A;  2DA6 A;  1DUX C;  3BG6 A;  1QBJ A;  2CW7 A;  1WKM A;  2FE3 A;  2ZCW A;  2KT0 A;  3KYL A;  1MMG A;  4GXO A;  4OIQ F;  3BTJ A;  4BQN A;  3K9T A;  5L3G A;  4EMS A;  3QAH A;  2Y31 A;  3I4P A;  2IJL A;  2LP0 A;  1D8J A;  3JRI A;  1LVA A;  1GT0 C;  2X1E A;  2EWN A;  3DPU A;  4ANJ A;  1SAX A;  1ZRE A;  1H8A C;  4CUG A;  1KU2 A;  2TRT A;  3U2R A;  2K5C A;  3RZD J;  4H0E A;  2DQR A;  4Q5S F;  2XAF A;  4G94 A;  4M3F A;  3IH3 A;  3RYP A;  4AU7 A;  5EEA A;  2QCO A;  4S04 A;  2Y69 H;  5BMZ A;  4RDU A;  1H9G A; 
#chains in the Genus database with same CATH homology
 4XRS A;  3S17 J;  5EYR A;  4M3D A;  2Y9Y A;  2DA2 A;  2L7Z A;  3BTL A;  5J1R A;  1QRY A;  5EZG A;  3JRG A;  2EZL A;  3MN2 A;  3ZQC A;  1A5J A;  4C3I J;  2HI3 A;  3HDD A;  5K7H A;  2JA7 J;  3HOW J;  1MH4 A;  4MFE A;  2EQR A;  3HKZ N;  1JKO C;  1DU6 A;  1VI0 A;  3LNQ A;  4V2G A;  1XC5 A;  2IBD A;  3WHB A;  1SFO J;  4A93 J;  3TP0 A;  5M5Y J;  4BXX J;  4A3F J;  1ZTR A;  3PO2 J;  3JRE A;  5IP7 J;  3HB9 A;  3TED A;  2JA5 J;  1GV2 A;  4M3B A;  3S1Q J;  3BG5 A;  4QTR A;  4RBO A;  2EZI A;  3SJM A;  2QF7 A;  1JUM A;  5C4J J;  2DMP A;  2ID3 A;  1ETO A;  1TWF J;  1YRN B;  3I4N J;  1HLV A;  2Y2Z A;  4GFB A;  3BR5 A;  4D5C A;  2NS7 A;  4B3A A;  2E1O A;  5BNG A;  4J19 A;  2JWT A;  2DTZ A;  1RPW A;  3CCY A;  1FIP A;  2DA5 A;  3IH2 A;  4DYR A;  2Y0S N;  1MBE A;  5J1U A;  1ZQ3 P;  5J1Y A;  1HDP A;  2CQQ A;  1MBF A;  3LSG A;  4JX6 A;  3GTM J;  4IHY A;  1ETX A;  1MBJ A;  1QVU A;  2R5Y B;  1B72 B;  2HOT A;  4UUT A;  3H0G J;  1LFU P;  1CQT A;  1U9N A;  2ELK A;  4DYQ A;  5M5W J;  3HBL A;  2R0Q C;  3W6V A;  5E3L A;  2PMZ N;  1K83 J;  1WH5 A;  2ME0 A;  2P81 A;  3O8H A;  4W97 A;  1B8I B;  3GTJ J;  2E19 A;  2XPU A;  3TP3 A;  1NK2 P;  5IP6 A;  3JRD A;  3K7A J;  1YRN A;  4QSH A;  2LR8 A;  2JA8 J;  2COB A;  4L5E A;  3E7L A;  4M3E A;  3SFI A;  1RKT A;  3BQY A;  1BW5 A;  1EF4 A;  2ECC A;  3PO3 J;  2IAI A;  2VUM J;  2JA6 J;  2L9R A;  2DMN A;  2XGC A;  2NVX J;  2E2I J;  2DA1 A;  3BR1 A;  2R5Z A;  5EGO A;  3GTL J;  1RET A;  4JX4 A;  1ITY A;  3M3Y J;  3GTK J;  3FK7 A;  2HXI A;  2R5Y A;  2LKX A;  1B72 A;  3M4O J;  4NDL A;  2CUF A;  1Y1W J;  3BR3 A;  4I6Z A;  3ZQF A;  1BL0 A;  2OF7 A;  2M34 A;  4A3C J;  2L7M P;  1SAN A;  4BY7 J;  5IPA A;  4FTH A;  1VFC A;  3S16 J;  3A03 A;  1JJ6 C;  3Q3S A;  4A3I J;  2VKV A;  2NVQ J;  1JJ8 C;  2ZB9 A;  3MKL A;  2XPV A;  1IDZ A;  2DA7 A;  1JKQ C;  4IHW A;  5FKO A;  1FTZ A;  5F0H A;  4M3G A;  3ZQL A;  4Y7N J;  3A01 B;  2E2J J;  4IEJ A;  1K61 A;  1LFB A;  3F0C A;  4S0H B;  2OPT A;  1TWH J;  2VPR A;  4B1R A;  2LD5 A;  1X2M A;  4D5F A;  4DZJ A;  5JLX A;  2YU9 J;  5F1J A;  4XIC A;  1ETQ A;  5IYD J;  2O8K A;  1UG2 A;  2CRG A;  3IH4 A;  4UUS A;  4A3E J;  2X6O A;  4BBR J;  1WGX A;  2XSD C;  2FJ1 A;  2WB1 N;  5EG0 B;  3GTO J;  1IUF A;  1OFC X;  4JYK A;  5GPC A;  4C3J J;  1H88 C;  1JKP C;  3Q0V A;  1UMQ A;  1HDD C;  5M3M J;  3LOC A;  1RR7 A;  2YS9 A;  2XRL A;  4D7N A;  3TW6 A;  1ZK8 A;  4A3M J;  5DTD A;  3TW7 A;  2Y30 A;  3HOV J;  3A01 A;  5GP9 A;  4Y52 J;  1I50 J;  3G1O A;  5C4X J;  2NOG A;  1W0T A;  1Z77 A;  3HOX J;  5E3N A;  3GTP J;  1ETK A;  3H3V K;  2JMW A;  5FKL A;  1OJL A;  2X48 A;  1IJW C;  4A3K J;  1IV6 A;  1DU0 A;  4FE4 A;  3JRA A;  1T56 A;  1P7J A;  3S14 J;  1I3Q J;  3OIO A;  4JP0 A;  1XS9 A;  5JLW A;  5FKK A;  2H8R A;  2XPW A;  2R5Z B;  2LFB A;  3MVP A;  5EG0 A;  3OSF A;  5EGO B;  3JR9 A;  2R92 J;  1JTY A;  2ID6 A;  1AU7 A;  3QPL A;  4XK4 A;  3G1L A;  2GLO A;  2HOS A;  3A02 A;  1MBK A;  4A3J J;  2DMT A;  3L1P A;  4MFD A;  1D5Y A;  4X1E A;  1WCM J;  4FE7 A;  3BR6 A;  1AHD P;  3OOU A;  1FEX A;  4G12 A;  1Z0X A;  4LOC A;  1U8B A;  2W48 A;  3HEF A;  2K40 A;  1JT0 A;  3QPS A;  2GM4 A;  3FIS A;  3WHC A;  2EH3 A;  5K7Z A;  5FKM A;  1AKH A;  3GTG J;  2LVS A;  2FX0 A;  2XB5 A;  3HOU J;  2G0E A;  4AC0 A;  1MNM C;  3Q0W A;  1LE8 B;  1HF0 A;  2CU7 A;  2HQ5 A;  2H1K A;  1GVD A;  2AO9 A;  3GBG A;  5IYC J;  2EZH A;  4XRM A;  4CYC A;  1OCP A;  3O8G A;  1U9O A;  5FLM J;  4V2F A;  4AYB N;  2EBI A;  3NAU A;  2IEK A;  1E3O C;  4W1U A;  4BBS J;  2DJN A;  1BJZ A;  3HM5 A;  1MBH A;  5E3M A;  4A3G J;  4UUS B;  4C2M J;  1ZR2 A;  5C3E J;  2B63 J;  1NTC A;  9ANT A;  4D7M A;  2TCT A;  2VI6 A;  3ZQI A;  2CJJ A;  1TWC J;  1HOM A;  1JUS A;  1APL C;  3FKI J;  2CUE A;  1GDT A;  3GTQ J;  2D5V A;  1X58 A;  3S15 J;  2XB0 X;  3C2B A;  3SDG A;  3BQZ A;  1MSF C;  1ZKG A;  3G1M A;  3HGG A;  2WAQ N;  1LE8 A;  4XID A;  1FJL A;  3ZQH A;  5E3O A;  2R7Z J;  3DCF A;  1O4X A;  5EDN A;  2M8G X;  2E2H J;  5F08 A;  4X6A J;  3BG3 A;  2EZK A;  2HXO A;  2DMQ A;  1XG1 A;  3JRF A;  1NK3 P;  3NAR A;  5F0F A;  4B4C A;  3ZOB A;  2MSY A;  1Y1V J;  4DYC A;  4EEF G;  4HNV A;  1BW6 A;  5HOD A;  1ZGW A;  3RZO J;  4A3B J;  1ZR4 A;  4M6V A;  1MSE C;  1GV5 A;  5FLV A;  4XRS G;  1MBG A;  4AUX A;  5IP9 J;  2MGQ A;  3B6A A;  1RKW A;  2FD5 A;  4JX5 A;  4IHX A;  3LSP A;  2L0K A;  2DA4 A;  3S1N J;  2M2E A;  1TWG J;  1HCR A;  2HOA A;  2N8G A;  2K9S A;  3HOZ J;  2XGE A;  2I10 A;  4IHV A;  3RKQ A;  5IYB J;  3VPR A;  1BA5 A;  3BTI A;  2JJ7 A;  1U78 A;  2CQX A;  4FIS A;  1PUF B;  5C44 J;  5K7F A;  3IV5 A;  3S2H J;  3UKG A;  1AKH B;  4A3L J;  2O7O A;  1FTT A;  3JRB A;  3OSG A;  3I4M J;  2LTP A;  1Q1V A;  3CQZ J;  4DW6 A;  1ORK A;  1F43 A;  4DZP A;  2M9H A;  2MG4 A;  4CYC B;  2K9N A;  2FQ4 A;  1WH7 A;  3BTC A;  3B6C A;  1QPI A;  4A3D J;  4MLO A;  4MO7 A;  1MH3 A;  2VKE A;  3D1N I;  1ENH A;  4QIW N;  4C3H J;  1RES A;  2HDD A;  2NVT J;  3S2D J;  1JKR C;  1WI3 A;  3S1M J;  2WV1 A;  3RQI A;  1F36 A;  5FJ8 J;  2RAE A;  2AHQ A;  3BG9 A;  1S7E A;  3BR2 A;  1VF9 A;  5M3F J;  4ABZ A;  1PUF A;  2GBY A;  5M5X J;  5EF6 A;  4BKX A;  3ZQG A;  3HOY J;  2DA3 A;  1GUU A;  4BY1 J;  2R93 J;  1ETY A;  1H89 C;  1OCT C;  4A69 C;  5J3L A;  2L7F P;  3K2A A;  1G2H A;  1JTX A;  5F04 A;  2X9D A;  2ME6 A;  5EZH A;  2DMU A;  2DN0 A;  3PM1 A;  5IOY A;  1TWA J;  3JRC A;  3S1R J;  1POG A;  2NS8 A;  2K9Q A;  1IGN A;  2YUS A;  4FCY A;  5GPA A;  2MW8 A;  1ETW A;  1QVT A;  1IDY A;  5F27 A;  2O9L A;  2KDZ A;  2HYJ A;  2LLK A;  2JN6 A;  1WPK A;  2XGD A;  3BR0 A;  2NVY J;  1R9T J;  2JK3 A;  1JT6 A;  3Q0U A;  1I6H J;  2DA6 A;  1P7I A;  1VND A;  1X2N A;  5FKN A;  2KT0 A;  2M0C A;  3FK6 A;  1TC3 C;  3JRH A;  3BTJ A;  2Y9Z A;  1IG7 A;  1ETV A;  2Y31 A;  1IRZ A;  1FIA A;  2LK2 A;  2LP0 A;  3DEW A;  3LSR A;  2LY9 A;  3QQA A;  3JRI A;  1JGG A;  1JUP A;  3LSJ A;  1GT0 C;  3BT9 A;  1W0U A;  3CDL A;  1A6I A;  5F0C A;  3CMY A;  1H8A C;  2TRT A;  5DS9 A;  1T33 A;  1UHS A;  3RZD J;  4I76 A;  1B8I A;  3FIW A;  1IC8 A;  4MIM A;  5IOZ A;  3HGY A;  4M3F A;  3IH3 A;  5EEA A;  2QCO A;  2ECB A;  4RDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...