1R22A

Crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
93
Chain Sequence
LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRHVYYQLQDHHIVALYQNALDHLQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transcription repressor
molecule keywords Transcriptional repressor smtB
total genus 28
structure length 93
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r22A00
1A04A 1UCRA 1HSTA 5E18F 3I71A 1PDNC 2M30A 3WGGA 4A0XA 4UXNA 4LK0F 3VOEA 1FYKA 1K7AA 1USSA 4CYDA 2HFHA 3M7GA 1OPCA 2FNAA 1WI9A 2V1DA 5DCMB 3P9KA 1B6AA 2GA1A 5AONA 1SMYF 3FZVA 3BPVA 3K2ZA 4WXDA 2OZUA 1ODDA 3HTUA 4KA4A 1BI3A 2VBZA 1W4MA 4L5IA 2EFPA 4I01A 1MJAA 3WE2A 3BWGA 4LG0B 1F5TA 5D8KB 4MTEA 3DP7A 2DPDA 1EH7A 4LG0A 1OYYA 3BROA 5ILVA 4RGRA 2DO7A 2ZXJA 5LGTA 2DPUA 2ZBKA 2FA5A 2RN7A 3EETA 1EH8A 2TDXA 3FXUA 1HW5A 4EV0A 1W7PA 4B09A 4HBLA 4YG2F 1MKMA 2NYXA 1NHAA 4L9VA 3GO5A 2CG4A 4O6JA 3V7RA 1IF1A 4GO1A 5J8CA 2YSRA 2W24A 2VODA 1J2XA 2MH2A 3IL2A 5JVTA 2JT1A 1XD7A 3V8JA 3HIFA 1TTYA 4A5MA 5BPDA 2K4JA 3D0SA 4ZYEA 1AOYA 1O57A 4GCVA 4G94A 2HKXA 4HDVA 3BP8A 2FBKA 4M6YA 3DFGA 5ICCA 3JTHA 5IT3A 2WC2A 2Q0OA 5FLXK 2PG4A 5K5RA 4KYWA 1J5YA 3HHHA 5F1RA 2YX4A 1TQPA 1IXSB 2ZMEA 3JTGA 4KMFA 5L3BA 1S29A 4WCGA 4M73A 2PI0A 1FT9A 4EGYA 1HBXG 3K0LA 4H0EA 1G6NA 4ESBA 1TLHB 2IA1A 1FPQA 2YR2A 1XCBA 2DT5A 3ELKA 2VONA 4ENJA 3GF2A 3COAC 2GQQA 2H6CA 3U9GA 5BPIA 4KN7X 2ISYA 1MZBA 2OQRA 1U3EM 2JPBA 1U6GA 3KZZA 3E3VA 3IRQA 2KIFA 1R5GA 4XRFA 4ENMA 2A07F 3CUQB 5LHIA 2W84A 2B0LA 3L2CA 4UVBA 2Z9OA 1V4RA 2P6TA 1UB9A 4AIJA 4KN4X 3H3UA 3SZPA 4LMYA 1ZRCA 4HZFA 3ZMTA 3E5UA 2EA4A 1Z1DA 4HF2A 3BY6A 1D8KA 3MAJA 2VBYA 2V1XA 4WWCA 3E97A 1WKMA 3SFZA 2MA3A 2P7VB 1PUEE 2RC4A 3E6CC 4ON0A 5FLXZ 1P6RA 2IP2A 4YFKF 2F5EA 4GXOA 3SHFA 3JAMK 4EGZA 4ESFA 5H20A 2HEOA 2LF7A 2ESNA 5K5OA 3DEUA 4LD5A 3SZTA 4Y13A 3LQRA 3TQNA 3O3KA 5AIQA 5L3GA 3F6VA 2O3FA 3MFKA 1FNNA 3WU0A 1XDSA 2KIMA 5JFRA 5BMZA 1IRFA 2BEOA 1SD6A 2Y0MA 3G3ZA 1R58A 2KRFA 5EEGA 1I27A 2C6YA 4BHCA 2VE8A 2GIVA 3P9IA 1K78B 5L3DA 3TO7A 1H9GA 2ACJA 2FXAA 4P9FA 2XV4S 5ED4A 2PBIA 1PP8F 3HYIA 1R00A 1IUYA 4KFCA 3CTAA 2CYYA 4EJOA 3FHZA 2HTSA 5LRSA 1FBQA 1BOAA 3D5LA 1DPRA 3MEXA 3QPHA 2P7CB 3B73A 2R3SA 2A5YB 3CO6C 3ML6A 3EQLF 1PP7U 4ZZDA 1O3RA 2HOEA 3KZYA 4OINF 1S7OA 2XAFA 2XAHA 3GZ5A 2CSOA 2OAZA 4HX4A 3MCZA 5K1YA 4I98B 2GXGA 3GXOA 3RTRA 2A6HF 3WTYC 2ETHA 2EV5A 4HX8A 2D2WA 5TJJA 4A5NA 3DKWA 5ILSA 1H0MA 4N9IA 1QZZA 4WXHA 1ZGJA 2DK8A 3EDPA 4WF2A 2CWEA 2EK5A 4M9ZA 4DNCA 2W25A 4EM1A 3ABUA 2JPCA 1IXCA 5L3CA 3KP6A 3TOBA 1T98A 3V7CA 2IPQX 4GYIA 1YYVA 5DDGA 4RS8A 1W7PB 3AAFA 1Q1HA 3GW2A 1BI2A 1MJ9A 2CO5A 1HW2A 2F5FA 4ZH4F 5ILUA 3WTVC 1FBSA 3OOPA 4BNCA 1XGNA 3RYPA 3WG9A 4UV9A 4OIPF 2VOOA 4I0BA 2QQAA 1JXSA 1JGSA 1YIOA 3J7AO 2XKPA 3REOA 4A6DA 3ECHA 4FX0A 1LEBA 1C0WA 3BDDA 2OQGA 4G6QA 2E1CA 2QVOA 3FX3A 5K5QA 1O7FA 3WTSC 4OMYA 2KIUA 3ZN0A 4EJWA 3M1EA 2ZMEB 4HLXA 4WXCA 2ELHA 1IN7A 2L4AA 5ICFA 2HDCA 5HOOA 2IA2A 2RVCA 2VT2A 1ZARA 1L3LA 2EB7A 2L3DA 2QWWA 2VC0A 3L7WA 3KLNA 4HAMA 1E17A 3TKYA 1Z05A 2G9WA 1DPUA 2MLGA 5LBQA 3F6OA 4KDPA 2GAUA 5CVVA 1U78A 3IKVA 3K1MA 1R36A 1KQ0A 1HW1A 3GWZA 1ZRFA 1XN7A 1J59A 1FX7A 1I1SA 3ZMZA 3GFMA 1O3TA 1ON1A 3IWFA 1QQIA 3I58A 2FMLA 5LLQA 1LVAA 1FYMA 3RKYA 3T0YA 2XVCA 5CVJA 3R0AA 1LDKB 1ON2A 1CF7B 4P55A 2K27A 4ETSA 2G7UA 1B1BA 3P9CA 4CICA 2FSWA 2PEXA 3HSEA 4PZJA 3O2PE 4FHTA 5DUKA 3F8CA 5KVRA 4RAZA 2DBBA 4AIKA 4EM2A 1XCVA 4Q48A 3C3WA 4HQMA 3C7JA 3DPTA 1GXQA 3C1DA 1G3YA 5CLSA 3ZP5A 3F8NA 4UUVA 3HRSA 1ONVA 4FX4A 2WWYA 3P7NA 2MLKA 4N0BA 2M5WA 2H09A 1P4WA 2NAZA 4NB5A 1V3FA 1YW9A 2IJLA 1JE8A 3NQOA 2NNYA 3QPTA 2O03A 1IN6A 2DTRA 4JBAA 4R79A 1IRGA 3V8LA 2X0LA 5D5UB 2BGCA 1QNTA 1Z6TA 3IRRA 5DD4A 1KU2A 1O3SA 4GYGA 1MDMB 1YW8A 1LEAA 2FOKA 3C18A 3E5QA 2KKOA 1XGSA 3KP5A 2XRNA 2EWNA 2VN2A 2QM3A 3W6KB 3MZHA 5BQTA 4TV7A 1REPC 1D3YA 4ENNA 3WTZA 2PFBA 3CUQA 1KYWA 2HWVA 2ZNZA 1SMTA 3NRVA 2G7HA 5A2QZ 2PJPA 5BS6A 1ZREA 3I59A 3KFWX 4HOBA 1WWXA 1IN4A 4AVPA 1QZYA 3MQ0A 1MGTA 2MH9A 1UHMA 4KIFA 3HOTA 1UFMA 2IVMA 3J80K 4JK1X 2O0YA 3B02A 1ULYA 3ECOA 1TQMA 3GZ6A 1Z91A 3FMRA 2M1BA 2FBIA 3DV8A 2XAJA 4HW0A 4RB1A 5BOXA 4G7HF 2ZNYA 1W5TA 2BBYA 2Y48A 2GZWA 4D0PA 5FGMA 2HKOA 1F4KA 2OBPA 1KQ9A 2ZCWA 1MD0A 1K6OA 4BHBA 3GX4X 4KICA 4U88A 2QQBA 1SFUA 4LLNA 1B59A 4HF1A 2MD5A 2E1NA 3I4PA 4JQFA 5DCFA 3QAHA 1ZGAA 1P2FA 4Y15A 3LAPA 2XAGA 2COMA 4CHUA 2Q2EA 4P96A 4LFUA 4XBFA 4N9HA 2PN6A 2A68F 2L01A 1B4AA 2L4MA 3RPQA 4L0YB 2NRAC 3ERED 2HZTA 2RQPA 5L3EA 1Z9CA 2LNBA 3VB2A 3IHUA 1J9IA 2F5CA 5DUIA 4CXFA 1TQIA 3BJ6A 3HTSB 3F72A 3O6BB 2P4WA 4MTDA 2BYVE 3J81Z 2F2EA 4G8XA 2L54A 4LLLA 5LEKA 2RNJA 3KEQA 4OU0A 4L5JA 1T39A 3PQKA 3LQQA 2JSCA 3BOQA 4EJUA 2NNNA 4UHTA 1BIAA 4G9YA 1S7AA 4K2EA 4DQ2A 4LGWA 1LJ9A 1RIOH 5D5XB 2A6EF 5JHUA 1RI7A 3CUOA 2YU3A 1XGOA 1E2XA 3TO6A 3GYHX 2V1UA 5D5VB 2J5OA 3M8FA 2Z3YA 3CO7C 1ZRDA 3KE2A 4GGGA 5ICEA 1T38A 2FQ3A 4BAYA 3F3XA 3JW4A 3PFIA 3DPLC 2YPRA 2P8TA 3IKTA 4L9JA 2DFIA 1D8JA 2EV6A 4RB0A 1T6SA 1OYWA 2RGVA 3WODF 1U5TA 1S8NA 2K7LA 1TBXA 4MNUA 1Y0UA 1K79A 1LDJA 4ESJA 3FM5A 5H6QA 2EJRA 3PQJA 1J0RA 2IA0A 3DQVC 4I7HA 3EYYA 4EM0B 1QBJA 1S6LA 3V7SA 2E7XA 5AIPA 3CLOA 3TDUC 3L00A 1B9MA 3ZMUA 5KK1A 1SFEA 2ISZA 4RAYA 3R61A 2P6SA 3CJNA 3ROUA 2A61A 4XLNF 4KIBA 1ZG5A 3HRMA 3MZYA 5E8IA 1XDUA 4G7ZF 2QBYB 4HV5A 2WV0A 5LHHA 2DLLA 3WE3A 4R1HA 4RGUA 2CGPA 4U0WA 1ZYRF 2QQ9A 3TOAA 3BJOA 4IF4A 1G4DA 2K86A 5CVIA 3L9FA 5FB2A 3F21A 5D4RA 4UNOA 5HVQC 4UVAA 4M9XA 1H9TA 2CQKA 3S2WA 3ZQ7A 2R7FA 3LA3A 1B9NA 2DQLA 4QWQA 2MBFA 2IT0A 3BJAA 3RKXA 4OIQF 4CDGA 4IRHA 1BC8C 5H6RA 2FRHA 4M74A 4IJAA 2VBWA 4YFNF 4Q5SF 2QUFA 3FMQA 1RZ4A 3KP4A 2IW5A 1YO5C 1FSHA 1SD5A 4S04A 1QGPA 2STWA 4MQVA 1R7JA 3K69A 2FMYA 4PGGA 1U8RA 4ZZLA 5E1ZB 2XAQA 1YQAA 2HQRA 2EFQA 2DU9A 5F64A 2UXXA 1I1GA 2OA4A 1YFHA 1RUNA 3U2RA 2XUBA 2E7WA 4LLGF 1JHFA 3GEZA 5F6FA 2OZ6A 3HHGA 4L9TA 5DV5A 3KLOA 2HGCA 2HR3A 5HLIA 2DQRA 1XMKA 1I5ZA 2F5DA 3LA7A 2Q8KA 1FZPB 2EA2A 3DXJF 3R6SA 4A0ZA 4MEYF 2K4BA 2EV0A 1CF7A 2ESHA 4IXAA 3KETA 3SXYA 2K02A 4EJVA 4YIFA 4Q4ZF 3WTTC 3CUQC 1HQCA 4KT5C 2HYGD 5DEQA 1QO0D 2FEZA 2JZYA 2NS0A 2FBHA 1RUOA 3NEUA 3J81K 1KGSA 2D1HA 2Z33A 2LF8A 4NQWA 2PMUA 4CO8A 3F22A 1FSEA 1DUXC 5J8FA 4KNYA 3K9TA 1L0OC 1ZN2A 1RNLA 4RGXA 4IVNA 2QLZA 3F23A 4PCQA 4A0YA 1BM9A 3BZ6A 1P4AA 3TO9A 4YIIA 4RB2C 3HSRA 1XB4A 3ISPA 3OV8A 4M6XA 2ADUA 1KU9A 4IRGA 1BBYA 5DYMA 4UV8A 1J75A 2D1VA 1LB2A 4HYEA 5E17F 1BI1A 4O3MA 3FXQA 3MWMA 1XSVA 1KQ8A 2XKOA 5CVRA 2JRTA 1GVJA 1OMIA 3RJPA 4A6EA 2M87A 2VC1A 4RGSA 4LB6B 4IHSA 5CYVA 3FMSA 3N4MA 5L3FA 2MC3A 3E6DA 4IHTA 1WSUA 3U1DA 3RDIA 5D8LB 2M8EA 1HKTA 1ZLJA 4ZYDA 2A3SA 2V79A 3RYRA 3R60A 3H92A 5E20A 2M45A 4CZZA 2UWMA 5D4SA 3M8EA 4OMZA 3R4KA 3V8KA 3L09A 3HOSA 2PLYA 4G7OF 2ZFWA 3T8TA 1ZH5A 2ZJ2A 2O6GE 2Z5UA 4O5VA 3ABTA 1U5TB 3T8RA 4EVIA 1KU7A 3Q9VA 3WTXC 4U0YA 3QP6A 4L0ZB 2GXBA 2LSOA 4MHGA 1KYZA 2DI3A 2VBXA 1SD7A 4I0AA 1YS6A 5E1XA 1BJAA 5D6EA 5ICGA 1FOKA 3TGNA 3JSPA 5IT9Z 2H94A 1SD4A 3GFJA 4P9UA 1R1UA 1W7PD 1XGMA 4OOIA 1S3JA 4PDKA 3I53A 3K1NA 3QU6A 2BE5F 2EFOA 4I2OA 4S05A 2HS5A 2UZKA 1ZHFA 4WK8F 1G3WA 2X4HA 4CGZA 3GFLA 3KCCA 3T1BA 1FP2A 5JR3A 1EH6A 2JTVA 5LGUA 2CFXA 2STTA 5LHGA 2DK5A 5LGNA 5FFZA 1KA8A 1R1VA 3F8MA 2Y75A 1EV7A 1U2WA 2ZO4A 1YTYA 4Z2YA 1HKSA 3HSFA 2KJBA 1FY7A 2H6BA 3HRUA 1R5HA 5FO5A 1OKRA 2QENA 1GHCA 3I54A 2AS5F 2PMHA 5HS8A 2GWRA 2H27A 5FD5A 2A69F 4I02A 4WX9A 1TW3A 1CGPA 3RKWA 4LJZF 4MEXF 2DW4A 3RPUA 3LSTA 4U0VA 4BYYA 4R8HA 2VOPA 1R1TA 1LDDA 4YFXF 4IPAA 3KP2A 4FT8A 3BPXA 3LAJA 5DD8A 3I0TA 4BQAA 1G3TA 3EUHA 4PGHA 3M9AA 1IZ1A 4M71A 4Q47A 4QLCU 5E1WA 4OIRF 5D6FA 1STZA 3GLXA 3KEOA 2W57A 1P4XA 1AWCA 1IW7F 4L9NA 3ZMVA 2EFNA 4ASNA 1LQ1A 3E6MA 4P5OA 4XLPF 1FP1D 1W5SA 5CJ9A 4L18B 5DCMA 4F7ZA 2WTEA 3IC7A 3Q9SA 5HDGA 3VEPA 2XROA 3WU1B 1QPMA 2UXNA 3KP7A 1O3QA 5JI6A 2RDPA 2EFWA 4BXUA 1SAXA 5HDNA 3GUDA 2QZ8A 1TNTA 4BHPA 1YS7A 1FYLA 3EYIA 3I64A 4EQQA 4NHJA 2QBYA 4HV6A 5HS9A 1GXPA 5EEHA 4U7BA 1R22A 2ZKZA 5E8GA 4M9SA 5ERIA 3JSOA 3K1PA 1OYIA 3I5UA 3FWEA 1ZG1A 4OIOF 1I6XA 4G6DA 5LRRA 1USTA 3WGIA 5A2QK 1YLFA 4E70A 3WTUC 1R23A 2LDUA 4B8XA 1HSJA 2P5LC 1VTNC 4HF0A 5HDKA 2PQ8A 4HLYA 3ULQB 1MDMA 4KUMA 1ZLKA 2O61A 2R7DA 2HQNA 1HKQA 3GVAA 4AWXB 1IN8A 3VODA 2AXLA 4I09A 5FD6A 3KP3A 3QP5A 1D5VA 2FNPA 2GA2A 2VXZA 4ZYGA 4HDUA 1MJBA 2RKHA 2W85A 2XHKA 3IWZA 3RI4A 4BH9A 2CW0F 3HRTA 2OU2A 3ZPLA 3R0JA 2P5VA 2HTJA 4UVCA 1BC7C 1DDNA 5CVUA 3FXRA 1ZAOA 1LNWA 1U5TC 2V6CA 3JAMZ 4U7DA 1SFXA 1WRJA 1YW7A 3E6BA 3I59B 2OD5A 4XSXF 2P5KA 1T2KA 3QRFF 3HUGA 5HLHA 2RV8A 4EMSA 4A12A 1Z6RA 1IXRC 2LKPA 4M72A 2KJCA 3LFKA 4HQEA 2O8XA 1T0FA 1FBUA 2VT3A 3ZN1A 1F9NA 2QYOA 1DP7P 2YX7A 4IRIA 2VE9A 4LK1F 3F8FA 1FC3A 3ZMDA 1IN5A 4HA8A 4HX7A 3ZMSA 3TDZC 2L02A 1X3UA 2BV6A 3Q5FA 2D45A 1HXDA 3CDHA 3WGHA 3VFZA 1XSDA 4ENKA 2IRFG 3N97A 3F8BA 4LB5A 2FF4A 4A2UA 1BI0A 1O7LA 3H3ZA 3DF8A 4AIHA 4MGRA 4Y17A 5D5WB 2J5PA 3RIRA 4KIGA 3T5XA 5HS7A 1WQ2A 4MQ9F 2FU4A 4ZYHA 1UHWA 3SQNA 2HYFA 4EJTA 2DAOA 1ZG3A 3FF5A 1OR7A 1JHHA 1KU3A 5FFXA 3E5XA 1BIBA 3WTWC 1TNSA 1XSXA 1BN5A 3J80Z 2XIGA 5J6XA 3V4GA 2XGXA 3W6JB 1FLIA 3G73A 1P92A 1FWZA 3GFIA 2Z99A 1F1ZA 1J7KA 3QU3A 4AD9A 2XASA 5HLGA 2V9VA 4RB3C 5TRDA 1XMAA 3LWFA 5IT9K 1YG2A 3FM3A 1Z7UA 5LEJA 6PAXA 1IAWA 3QOPA 2FE3A 1G3SA 1TW2A 1K78A 3LA2A 4XSZF 4KMUX
chains in the Genus database with same CATH superfamily
4FCYA 1A04A 1UCRA 2G0EA 1HSTA 4OAZA 5E18F 3CC4I 2VJJA 3I71A 2MFZA 1PDNC 2M30A 3WGGA 3K70C 4A0XA 2QCOA 3IH3A 4UXNA 4LK0F 3VOEA 3HZJA 1FIPA 4CCKA 1K7AA 1USSA 4CYDA 1FYKA 3QQAA 2HFHA 3M7GA 3ZQQA 1OPCA 4BXXJ 2FNAA 5GPAA 1WI9A 5CPRB 1GV5A 2V1DA 4OAYA 3SEQA 5DCMB 3P9KA 1B6AA 2GA1A 2IAIA 5AONA 1SMYF 3FZVA 1UELB 1RPWA 1Y8RB 3BPVA 3K2ZA 4WXDA 2JRMA 2OZUA 1IV8A 1S7EA 1ODDA 2CJJA 2XF5A 1FOYA 3HTUA 5IP9J 4KA4A 1BI3A 4BKXA 3SDGA 2VBZA 1W4MA 4PJ0C 4L5IA 2VKVA 4CUGA 2DMTA 2EFPA 2LH9A 4I01A 3OY9A 1MJAA 3WE2A 3BWGA 5HLTA 4LG0B 1FOWA 3DU5A 1F5TA 5D8KB 4BJTA 2JWTA 4MTEA 2DA5A 1PUFB 2K9NA 2JA5J 3OR1C 1RR7A 3DP7A 2DPDA 2L5QA 5EG0A 1Y8QB 3GTJJ 1FTZA 1EH7A 4LG0A 1OYYA 4XKCA 4PJLA 3L1PA 1WH5A 3BROA 5ILVA 1IO2A 2A05A 4RGRA 2DYRH 4HG2A 3OIPA 4UUSB 2DO7A 1BR1A 3EUHC 4A93J 2ZXJA 5LGTA 4HNUA 3EPZA 2DPUA 2ZBKA 2FA5A 2RN7A 3EETA 2ZXIA 1EH8A 2TDXA 3FXUA 1HW5A 4C3HJ 3HOUJ 4XL9A 1Z3YA 2XB5A 4EV0A 1VQMI 1PYVA 1MBEA 4PJMA 1W7PA 4B09A 4HBLA 2W7NA 4YG2F 1MKMA 2RQQA 2NYXA 3S15J 2NOGA 1NHAA 4L9VA 3GO5A 1ETYA 2ECBA 2IS6A 2CG4A 4O6JA 5J1UA 4JX6A 3V7RA 2WAFA 1IDYA 3TL4X 1IF1A 3OYCA 4GO1A 2JVHA 1KZHA 5J8CA 1F36A 2YSRA 1YRNB 2W24A 4ZDLA 3OOUA 2XSDC 2VODA 4BY1J 4F91B 1J2XA 4BE2A 2MH2A 2QF7A 3A03A 3IL2A 5JVTA 3G1MA 2MD0A 2JT1A 1XD7A 2LY9A 1VQOI 3V8JA 3HIFA 3W2WA 1TTYA 5CQGA 1ETXA 2M9HA 4A5MA 5BPDA 3BG6A 2K4JA 3ABLH 3D0SA 4ZYEA 1AOYA 1R9TJ 2R7VA 1O57A 4GCVA 4G94A 2HKXA 3DTIA 4HDVA 3BP8A 2FBKA 4C3IJ 4ZTFA 4M6YA 3DFGA 5ICCA 3QWLA 2XGEA 1NK2P 1VQLI 3QODA 3JTHA 5IT3A 2WC2A 3LSMA 3DKYA 2Q0OA 5FLXK 2PG4A 1WCMJ 5K5RA 1JJ8C 1B72B 3JRCA 4IOCF 4KYWA 1J5YA 5F08A 4UB8C 3HHHA 1YIJI 5F1RA 2YX4A 3CD6I 1TQPA 1IXSB 2ZMEA 5EZHA 1B72A 3JTGA 4KMFA 5L3BA 1S29A 4WCGA 4M73A 3S3OA 1MW7A 1LKXA 2PI0A 3CCRI 2W82A 4A3GJ 1FT9A 4EGYA 2ELKA 3I9V2 3HBLA 2EIMH 1HBXG 4F55A 2CUJA 3K0LA 3KEYA 4H0EA 4Y7NJ 2FUG2 1G6NA 2KQRA 4ESBA 3JRDA 3WHBA 4FQGA 1TLHB 2R5ZA 4BE1A 1W36D 3MKLA 2IA1A 1FPQA 2DDBA 2YR2A 2M7AA 2E2IJ 2JUCA 4CH7A 2ID6A 1XCBA 2DT5A 3ELKA 2H8WA 4ENJA 2VONA 3GF2A 3COAC 3HDDA 2GQQA 2H6CA 3U9GA 5BPIA 4KN7X 2ISYA 1MZBA 2OQRA 5GAGJ 2JPBA 1U3EM 1IRZA 1U6GA 3VYTB 3KZZA 3E3VA 5J40A 3S16J 1KONA 4QPQA 3IRQA 3CP8A 2KIFA 1R5GA 4XRFA 2V6EA 4ENMA 2A07F 3CUQB 4A3KJ 2TCTA 3PO2J 1MSFC 5LHIA 2W84A 3A1YA 9ANTA 3MKWB 2B0LA 3L2CA 4UVBA 2Z9OA 3CCSI 1V4RA 2R0QC 4XNFA 2JQ7A 4F93B 2P6TA 3S2DJ 1UB9A 4AIJA 4KN4X 3H3UA 4CZCA 3CCMI 4LIUA 3SZPA 4LMYA 1ZRCA 5TGTA 4HZFA 3ZMTA 4JOMA 2EZLA 3BR3A 3E5UA 2O8KA 2EA4A 2B7EA 2FJ1A 1Z1DA 4HF2A 3BY6A 3K4KA 3ZCOA 2V9KA 3W2VA 4BDYA 1D8KA 2ZXWH 3MAJA 2VBYA 3S3NA 3DCFA 2V1XA 4WWCA 3E97A 1MH4A 3EUKL 1WKMA 1VQNI 3SFZA 5E3OA 2MA3A 2P7VB 1PUEE 2X51A 2LG4A 4IL6C 5F1JA 2RC4A 3E6CC 1WVRA 4ON0A 4BY7J 4FASD 4DBQA 2DTZA 5FLXZ 1P6RA 2IP2A 5M5WJ 1BJZA 4YFKF 2F5EA 4GXOA 3SHFA 4DJAA 3JAMK 4YRVA 4EGZA 3UR3C 1T8IA 2EINH 5EF6A 3BQZA 4ITVA 4ESFA 2R7TA 5H20A 2HEOA 2PMZN 1GT0C 1WPKA 2LF7A 3TW6A 2ESNA 5K5OA 3DEUA 4LD5A 3SZTA 4Y13A 3LQRA 3OIQA 1WH7A 1ZELA 3TQNA 3O3KA 3GZNB 1TL8A 5AIQA 3DEEA 2LMDA 2AQEA 1MNMC 5L3GA 3F6VA 2O3FA 4IZZA 3MFKA 1MSEC 1FNNA 3WU0A 1XDSA 2KIMA 2KRHA 3BCBA 1JUPA 5JFRA 4MO7A 2HVQA 5BMZA 4B1RA 3HKZA 2CUEA 2GOXB 3DTKA 1IRFA 2BEOA 1SD6A 2Y0MA 4ZYAA 3J7ZI 5E3NA 5B1AH 1TT5B 1X4OA 1R58A 3G3ZA 5KNLA 3M8JA 2KRFA 2DMNA 2L7KA 1I27A 5EEGA 1XC5A 2C6YA 4BHCA 1POGA 2X9DA 2VE8A 2GIVA 3P9IA 3ABKH 2DA2A 1G8XA 1K78B 5L3DA 1NG7A 1YJ9I 2ME6A 1R4MB 3TO7A 1B8IB 1H9GA 2VI6A 2ACJA 2FXAA 1N77A 4P9FA 3W3CA 2XV4S 5ED4A 2PBIA 1D0ZA 2DOFA 1PP8F 5IYDJ 4RAFA 2KZGA 3HYIA 1R00A 1IUYA 2QSHX 4ANJA 3A0HC 2R4GA 4KFCA 4NC8A 3CTAA 3NAUA 5JLWA 4EEFG 2CYYA 4EJOA 3FHZA 4X6AJ 2HTSA 1LE8A 5LRSA 1FBQA 4BQOA 3ZGKA 1QVTA 3FIWA 1BOAA 5HNHA 3M1CA 3D5LA 1DPRA 4EATA 3DBLB 3JRIA 5C44J 2O5RA 3MEXA 2UV1A 3QPHA 4QPOA 2P7CB 2DN0A 3B73A 2R3SA 3CJQB 4XKWA 2A5YB 4RBOA 3CO6C 4E7HA 2XB0X 1D0YA 3ML6A 3CCQI 3EQLF 3RZDJ 2ZFUA 3L2RA 1PP7U 4ZZDA 4HNTA 1O3RA 2HOEA 3KZYA 3B6CA 3KX2A 4OINF 1S7OA 2XAFA 1CQTA 2NVQJ 2XAHA 2EIJH 2Y9ZA 3GZ5A 2XAUA 2CSOA 2OAZA 1WI3A 4HX4A 4XRSA 4AUXA 2XGDA 3MCZA 4DIQA 5K1YA 3O8HA 2X6OA 4I98B 2GXGA 3GXOA 3RTRA 2A6HF 2M34A 3L2QA 3WTYC 4XLHA 3HGGA 1Z77A 2ETHA 2PJRA 3PIPF 2EV5A 1UMQA 2D2WA 4HX8A 4E7LA 5TJJA 3VSLA 4A5NA 2HYJA 3DKWA 5ILSA 1H0MA 4N9IA 1QZZA 5J3LA 1WJAA 2LFBA 4II3A 4AYBN 4WXHA 1ZGJA 2I8DA 5IOYA 2D5VA 4CCMA 2DK8A 3EDPA 4WF2A 1MMAA 2MW8A 2JSPA 2E36A 2CWEA 2EK5A 4M9ZA 4DNCA 5F0CA 2W25A 4EM1A 3ABUA 1UJ8A 5B66C 4V19K 2BY3A 2CRGA 3PUFA 2JPCA 4E7ZA 3E0JB 2MC4A 2LOOA 1IXCA 5L3CA 3WHCA 3VDXA 4IQ4A 2GOMA 2BW3A 2P81A 2ZSHB 2VPLA 1E3OC 3KP6A 3TOBA 4ABZA 2MABA 1ZR2A 1T98A 2M0CA 2IPQX 2KHMA 2E1OA 2L2OA 4GYIA 3V7CA 4KJZA 1YYVA 2LKSA 3ERMA 5DDGA 2Y31A 2VKEA 4RS8A 2Q2EB 2HOAA 3PNYA 3PSIA 1W7PB 4NNJA 1Q1HA 3AAFA 1OLTA 3GW2A 5FJ8J 1BI2A 1MJ9A 2CO5A 2F6CA 4BACA 1XMXA 2B63J 3Q0WA 1HW2A 2F5FA 2R7XA 2V7FA 4NQWB 3HXLA 1R49A 4KITB 4N4OB 4ZH4F 5ILUA 3CQZJ 3WTVC 1FBSA 3OOPA 4BNCA 1XGNA 3RYPA 3WG9A 1WJ5A 4UV9A 3DTEA 4OIPF 1LVKA 3JRBA 2WA0A 2VOOA 5FRMA 3C2BA 1EJ9A 4NUBA 4I0BA 2QQAA 2NVUB 1JXSA 1JGSA 1YIOA 3J7AO 2XKPA 3REOA 5GAEJ 4A6DA 3ECHA 3OYAA 4A3CJ 3GTMJ 2DA4A 4FX0A 1GDTA 1LEBA 1C0WA 3BDDA 2OQGA 4G6QA 2E1CA 2QVOA 5B1BH 5E3LA 1P7JA 3FX3A 5K5QA 1O7FA 4E4HA 3WTSC 3K4MA 1SEUA 4OMYA 4M3EA 2KIUA 3BLYA 3ZN0A 4EJWA 3M1EA 2ZMEB 2Y30A 2VQGA 4XN3A 3HL2A 1SAUA 3LOCA 4BUPA 4HLXA 3CC7I 4WXCA 3S1MJ 2ELHA 1IN7A 4FTHA 3F9KA 2HQ5A 2L4AA 1IDZA 5ICFA 2LREA 2HDCA 3G4SI 3BR5A 5HOOA 2IA2A 2RVCA 5J4YA 2VT2A 5DTDA 2IS1A 1ZARA 1L3LA 2EB7A 2L3DA 2QWWA 2LK2A 2VC0A 3L7WA 3A2KA 3OL3A 3KLNA 3HC7A 4HAMA 1E17A 3TKYA 3PJRA 1Z05A 2G9WA 3RCOA 1DPUA 2MLGA 4BBSJ 2EH3A 2JA8J 2VJ4A 5LBQA 3CJTB 1GV2A 3F6OA 4L5EA 4KDPA 2JMWA 2GAUA 3CDLA 2ICWG 5CVVA 2NOJB 1U78A 3IKVA 3K1MA 1QHHD 4DOZA 1RETA 1R36A 4KT6A 4AYBA 2W48A 2XPWA 3IH2A 4II2A 1KQ0A 2WY7Q 1HW1A 1HOMA 1T33A 4FISA 3GWZA 1ZRFA 1XN7A 1J59A 1FX7A 1S9HA 2DT7B 1I1SA 3ZQGA 3ZMZA 3GFMA 1O3TA 1Y1WJ 3FXMA 5K7ZA 1ON1A 5FLVA 3IWFA 1QQIA 2HVRA 1FMWA 3I58A 2FMLA 2DYSH 3DWLE 5LLQA 1LVAA 3ZQCA 1FYMA 1Z67A 3RKYA 1FJLA 1SANA 1X58A 1WHUA 3T0YA 2WV1A 2XVCA 2M8GX 4XN0A 5CVJA 3OYGA 2KPMA 3R0AA 3I55I 1LDKB 4J01A 2UUZA 1ON2A 1CF7B 3HGYA 3F0CA 4CYCB 4ZTJA 1HC8A 4P55A 2K27A 3K10A 4ETSA 2G7UA 2GLOA 1B1BA 2HXIA 3P9CA 1OJLA 3A02A 1OFCX 3ESWB 4CICA 4UUTA 2FSWA 2PEXA 3HSEA 4PZJA 3O2PE 4FHTA 4CCJA 2HQAA 5DUKA 4IEJA 2HVSA 1R6RA 3F8CA 5KVRA 3NWSA 2JVGA 1NH3A 4RAZA 2DBBA 4JX4A 5EGOB 4UUSA 4AIKA 4EM2A 1XCVA 2DMQA 3CF2A 4Q48A 2IXSA 3C3WA 3RPUD 2VASA 4HQMA 4ZC3A 2M7BA 4BJ5C 3C7JA 3DPTA 3HOYJ 1GXQA 3RSNA 3C1DA 1G3YA 4E7JA 5CLSA 3ZP5A 3F8NA 2IGNA 1WFXA 4UUVA 4DYCA 3HRSA 2LRDA 5K7FA 1ONVA 4FX4A 2LTPA 4IHYA 4BEHA 2WWYA 2QA4I 3P7NA 1K83J 3IH4A 1V54H 1BA5A 2MLKA 1UAAA 2F48A 4N0BA 2M5WA 2H09A 2DODA 1P4WA 3BTLA 1A6IA 2NAZA 2X1EA 4NB5A 1V3FA 1LPQA 1YW9A 4UB6C 3CCLI 2IJLA 1JE8A 4AVZA 3NQOA 2NNYA 3QPTA 1A6QA 4B43A 1K4SA 3FBNB 5DM7F 1AA7A 2O03A 1HF0A 1SFKA 4KISA 1IN6A 2DTRA 4JBAA 4R79A 3G6EI 4B48A 3H3VK 1IRGA 3V8LA 2X0LA 1D5YA 5D5UB 1YI2I 2BGCA 1QNTA 1Z6TA 3K4CA 3IRRA 5DD4A 1KU2A 2R5ZB 1O3SA 4GYGA 3WG7H 1MDMB 1HLVA 1UZCA 1YW8A 1W0TA 3CP2A 2KLOA 2E34A 1TT0A 2CS3A 1LEAA 2FOKA 3C18A 3O8GA 1W36C 1JGGA 3E5QA 3CLQA 4XRMA 3JRHA 1QA6A 2KKOA 1XGSA 3KP5A 4QIWN 2XRNA 2Y2ZA 4A3LJ 2EWNA 2M4GA 2RNGA 2VN2A 2BXZA 2BVMA 2QM3A 3PUBA 2WAQN 3LMMA 1R5ID 3Q0VA 2VJIA 3W6KB 3CESA 3MZHA 5BQTA 3L2WA 4M3BA 4TV7A 1REPC 1A36A 5DM6F 1D3YA 4ENNA 4A3MJ 3WTZA 2QEXI 2PFBA 1BW5A 3CUQA 1KYWA 2HWVA 2ZNZA 4UY8I 1YJNI 1Y6IA 2E35A 1SMTA 4A3EJ 3NRVA 2G7HA 4RM2A 2HPIA 5A2QZ 2PJPA 5BS6A 1ZREA 3I59A 3KFWX 4I99C 2JK3A 3S93A 3PL8A 4HOBA 2COBA 1WWXA 1IN4A 4YIRX 4AVPA 1QZYA 3L2UA 3BZCA 3MQ0A 1RRJA 2VJ5A 1MGTA 1ZK8A 1UHMA 2MH9A 4KIFA 3HOTA 1UFMA 5JLXA 3G71I 1FMVA 2IVMA 3J80K 4JK1X 2O0YA 3B02A 3FK6A 5F27A 1ULYA 1JUSA 4BQQA 3CCJI 3ECOA 1TQMA 2OV7A 4YELA 3GZ6A 2PJRB 1Z91A 3FMRA 2M1BA 2FBIA 5GTHC 3DV8A 2XAJA 4HW0A 1JI8A 3A0BC 4RB1A 5BOXA 4PSXA 1RESA 4G7HF 3FKIJ 2ZNYA 1W5TA 2BBYA 2Y48A 3FDYA 2GZWA 4D0PA 5FGMA 2HKOA 1F4KA 3VYRB 2OBPA 1KQ9A 1MMSA 1DQUA 2ZCWA 3ZXSA 1MD0A 2AO9A 2Z16A 4CCLA 5EZGA 5HNFA 3OYJA 1K6OA 4BHBA 3GTPJ 3GX4X 3D5RC 4KICA 1GLNA 3GTKJ 2LY2A 4U88A 2QQBA 1SFUA 4LLNA 3M07A 1ZTRA 2WAQA 3I4NJ 1B59A 4HF1A 2R7ZJ 1MH3A 4W1UA 3S8PA 1R71A 2MD5A 2E1NA 1OISA 4NC6A 1YRNA 3I4PA 2IS2A 4JQFA 1JJ6C 5DCFA 2K9MA 2RREA 3QAHA 2HDWA 2K9SA 2W1OA 1ZGAA 1P2FA 4Y15A 3LAPA 5C4XJ 2XAGA 2COMA 2XGCA 4CHUA 4A3JJ 1BW6A 2Q2EA 4P96A 4LFUA 5KAIC 4XBFA 5IP6A 2E1MB 3MKZA 4N9HA 2PN6A 4DZJA 3PO3J 2A68F 2L01A 2L7MP 1B4AA 1MNEA 2L4MA 3IAS2 1O4XA 3IUOA 3H9QA 3RPQA 1Z21A 1QRYA 2GBYA 4MIMA 2WAEA 2R7SA 1HCRA 3ONQA 4L0YB 2ZMEC 2NRAC 3ERED 2DMUA 2E1MC 2HZTA 4IHVA 2P0WA 3VWBA 2RQPA 3FXLA 5L3EA 1Z9CA 2I10A 2LNBA 2E5NA 3VB2A 1F43A 5EDNA 1HDDC 1ITYA 1XTAA 3IHUA 1XS9A 1J9IA 4XLCA 3PSFA 2F5CA 3FXKA 5DUIA 4CXFA 2YS9A 1TQIA 3BJ6A 2W00A 3TP3A 4BQNA 3HTSB 3F72A 3O6BB 2LVSA 4DW6A 2P4WA 4MTDA 2BYVE 1ERDA 3ZOBA 3TW7A 3JREA 3J81Z 2F2EA 1P7IA 3OS2A 5GAHJ 3H0DA 4G8XA 2L54A 4LLLA 2CW8A 5LEKA 2RNJA 3KEQA 4OU0A 4L5JA 4C9YA 3PQKA 1T39A 3LQQA 2JSCA 3BOQA 4EJUA 3K4NA 2XDVA 2NNNA 4UHTA 3CCVI 3BR6A 2BXYA 1K61A 1BIAA 4G9YA 1S7AA 4K2EA 4DQ2A 4LGWA 4B44A 1LJ9A 1RIOH 5D5XB 2XPVA 1MBGA 2A6EF 2VB6A 5JHUA 4G12A 1RI7A 3MD2A 3CUOA 2YU3A 4D9JA 1VF9A 4IKFA 2K9LA 4BXFA 1XGOA 4JP0A 3G1LA 2LR8A 1E2XA 3TO6A 3GYHX 1OCTC 2V1UA 1JTYA 5D5VB 3JCUC 2J5OA 3M8FA 2Z3YA 3CO7C 1ZRDA 3KE2A 4GGGA 3CMEI 5ICEA 1T38A 3I3LA 5B3SH 5M3FJ 2FQ3A 3K4LA 3VSKA 3L2VA 4BAYA 3UKGA 2HZDA 2L7ZA 2NS8A 3OIOA 3F3XA 4W97A 5M5XJ 3JW4A 3BG9A 3PFIA 3U21A 3DPLC 2YPRA 3CC2I 2P8TA 3IKTA 3A01B 4L9JA 1X1PA 2DFIA 1D8JA 4D5CA 2EV6A 3DPUA 3OR2C 3SFIA 4RB0A 1T6SA 2JJ7A 1VQ6I 3EUAA 1OYWA 2RGVA 3WODF 5EEAA 5EG0B 1U5TA 1S8NA 2K7LA 1TBXA 3QYBA 4G6TB 3HOZJ 2ZC2A 4MNUA 1BL0A 3CDIA 1YX3A 1Y0UA 1K79A 2DFEA 1VQ5I 1X2NA 1LDJA 4NBQA 1SVOA 4Y4RA 3BZKA 4ESJA 1G2HA 3HKZN 3FM5A 5H6QA 2EJRA 3PQJA 1J0RA 2IA0A 3DQVC 4I7HA 3KYDB 1FIAA 3EYYA 3H5RA 4EM0B 2KZVA 1QBJA 1S6LA 2VKDA 3HOXJ 2RAEA 3V7SA 2EPFA 2V4JC 2E7XA 5HODA 5AIPA 3CLOA 3TDUC 4DYRA 3KYLA 3L00A 1MMNA 4N4NB 1LUJB 1X1DA 1B9MA 1Q1VA 3ZMUA 5KK1A 1SFEA 2F4IA 2X48A 3AL0C 2ISZA 4RAYA 3R61A 3LSPA 1N25A 2JUGA 2P6SA 3CJNA 3ROUA 2A61A 2O7OA 1OCRH 3K2AA 3AG3H 2I5UA 4XLNF 4RAGA 4KIBA 2VQLA 4A3FJ 3HRMA 3MZYA 5E8IA 1ZG5A 3GTLJ 1WGXA 4D7MA 1XDUA 1D0XA 4F92B 4G7ZF 2QBYB 5EGOA 2VL8A 2KP6A 1I39A 4HSTA 4FETA 4HV5A 4X0GA 2DOAA 2WV0A 5LHHA 2DLLA 4XM3A 3WE3A 4R1HA 2HI3A 4RGUA 2CGPA 1Y56A 1UG0A 4U0WA 2WBMA 1PVEA 1ZYRF 2QQ9A 3TOAA 3BJOA 4IF4A 2VPRA 1G4DA 2K86A 3G2BA 5CVIA 3L9FA 2BY2A 5FB2A 3F21A 2JA7J 2QGUA 4PJNA 1GUUA 5D4RA 4UNOA 5HVQC 4UVAA 2CU7A 1IUFA 2BHYA 4HPQA 3QPLA 4M9XA 1H9TA 2FD5A 1K4TA 4E7KA 2CQKA 4XKBA 3S2WA 4NC7A 1ACIA 3PM1A 3ZQ7A 5M3MJ 2XSJC 2R7FA 3LA3A 2R93J 1B9NA 4XIDA 1JUMA 2DQLA 2R5YA 1QVUA 4QWQA 4BU2A 2MBFA 2QQ8A 2IT0A 2KIQA 3BJAA 4J19A 1I50J 1OCCH 5BNGA 3E7LA 2CV0A 3RKXA 4OIQF 3MMYB 1TWAJ 4CDGA 3QOEA 3JRGA 2R5YB 4IRHA 1BC8C 5H6RA 2FRHA 4M74A 1H88C 1JTXA 4IJAA 2VBWA 4YFNF 4U87A 4Q5SF 2TRTA 5GTIC 5DS9A 2QUFA 2OF7A 3ZQHA 3FMQA 1V55H 2L9RA 3G1OA 1RZ4A 4DGWB 5GADJ 3KP4A 2IW5A 1SVLA 3PNTA 4PK4A 1YO5C 4A3DJ 1VNDA 1VQPI 2CQ7A 5C3EJ 4LITA 1FSHA 1SD5A 1TWGJ 4S04A 1QGPA 1JKQC 2STWA 4MQVA 2IS4A 1WZ2A 3QYFA 2BVLA 3ZRGA 4Y52J 1R7JA 3AFHA 3K69A 2FMYA 3HM5A 3GTOJ 4PGGA 1ZQ3P 1U8RA 4LIVA 5E1ZB 2XAQA 4ZZLA 1YQAA 2HQRA 2ZJQF 1ZKGA 2EFQA 2R7OA 3PIOF 2L0KA 2DU9A 1X1CA 5F64A 2UXXA 1I1GA 3J7YJ 3ABMH 2OA4A 2CW7A 1YFHA 1RUNA 2X6YA 3U2RA 1EA3A 1ETQA 3BC8A 3HG9A 3LSJA 2XUBA 1Z7LA 2E7WA 4LLGF 1JHFA 3GEZA 4IQJA 5F6FA 2OZ6A 3DKXA 2XC7A 4DYQA 2E71A 3HHGA 4L9TA 3BTJA 5DV5A 3KLOA 2OCCH 2HGCA 2HR3A 4BE0A 5HLIA 2DQRA 4IOAF 1TWFJ 1T08B 1XMKA 1I5ZA 2F5DA 1AKHB 2MSYA 3LA7A 3OYNA 2Q8KA 1FZPB 2EA2A 5IP7J 1Y0NA 4I6ZA 3DXJF 3R6SA 4A0ZA 4BS9A 4BGDA 2ZSIB 4MEYF 5KCMA 2K4BA 1MIJA 5IPAA 2EV0A 3ASNH 4X1EA 1CF7A 2ESHA 4IXAA 3KETA 1Y39A 2BW3B 3SXYA 2K02A 2K85A 3DBHB 3OMYA 4EJVA 3AKZA 1VQ4I 1TWHJ 4YIFA 2DJNA 4Q4ZF 4Y3OA 3WTTC 4RLQA 3CUQC 1HQCA 1NG6A 4KT5C 2HYGD 2JA2A 3H1CA 2PMZA 2WB1A 5DEQA 2OC6A 3CMMA 1QO0D 2FEZA 2NS0A 2JZYA 3FBIB 1A31A 3H9GA 4MLOA 3S32A 2FBHA 2JN6A 3NEUA 3J81K 1KGSA 2D1HA 1RUOA 2Z33A 2LF8A 1TC3C 1VQKI 3GTQJ 4NQWA 3S1NJ 2Y9YA 2PMUA 2V26A 4CO8A 3F22A 2M2EA 1VQ7I 1FSEA 1DUXC 5J8FA 3X2QH 2O9LA 1PJRA 3P5JA 1OCZH 4KNYA 3K4BA 2F5VA 3LSGA 3K9TA 4RLFA 2KDZA 1L0OC 1ZN2A 2LLKA 3AL0B 1IRXA 2EQRA 2E2JJ 3PNVA 1RNLA 2PX9A 3FK7A 1A35A 2EIKH 1WJCA 3S2HJ 4IO9F 1X1BA 4RGXA 4IVNA 2QLZA 5M5YJ 3F23A 1DU0A 4Z6YA 3AG4H 4PCQA 4A0YA 1BM9A 3BZ6A 3D5SC 2LBFA 1P4AA 2KFDA 5F0FA 2ID3A 1S72I 3H36A 1E3PA 3TO9A 3NARA 4YIIA 1K6YA 1B8IA 4RB2C 3HSRA 4I76A 1TP4A 1XB4A 3ISPA 3OV8A 4M6XA 1YJWI 2ADUA 2XF7A 1KU9A 3V42A 2H1KA 2LC2A 2HDDA 4E7SA 4IRGA 3RQIA 3OYMA 1BBYA 2KT0A 2VKHA 5DYMA 3VYUB 2MG4A 4UV8A 1J75A 2AQFA 1V5FA 2D1VA 3Q3SA 1LB2A 1JKOC 2E19A 2MYSA 2MGQA 3BR2A 3HPGA 4HYEA 4RA2A 5E17F 1BI1A 4O3MA 2AXTC 1D1BA 2H1LA 3FXQA 3MWMA 3OYIA 1XSVA 1KQ8A 5FKKA 1X4PA 2XKOA 3UNGC 3TBIA 5CVRA 2BZTA 3OYBA 2JRTA 1GVJA 1OMIA 3RJPA 2ZJRF 4A6EA 1I3AA 2M87A 4IX7A 3QPSA 4MFEA 2VC1A 4RGSA 3ZQLA 2NS7A 3KYCB 4HEA2 1H8AC 4LB6B 1IG7A 2Z1DA 4IHSA 4XONA 2X6XA 5CYVA 3FMSA 3N4MA 5L3FA 2MC3A 1T56A 3U1KA 3E6DA 4IHTA 4PUSA 3OS1A 2WADA 1WSUA 3U1DA 1PUFA 3RDIA 5D8LB 2M8EA 1HKTA 1ZLJA 4ZYDA 2A3SA 1NK3P 2DXIA 4C2TA 3HOVJ 2V79A 3RYRA 3LSRA 3S1RJ 2KRCA 3R60A 3HJEA 1BOBA 3H92A 4LG3A 3H9JA 5E20A 1JT6A 1XPXA 2M45A 3CCUI 3SJMA 3AG2H 4CZZA 2UWMA 5D4SA 3M8EA 2HOTA 4OMZA 3R4KA 1QHGA 3V8KA 2CUZA 3L09A 4NDLA 3HOSA 2PLYA 4G7OF 2ZFWA 3T8TA 1J09A 2QKMB 2ZJ2A 1ZH5A 4CA0A 4F52A 1VFCA 2O6GE 2DDAA 2Z5UA 3ZQIA 4O5VA 4BL0B 2FQ4A 1E3HA 3ABTA 2X1CA 2X85A 1U5TB 1D1CA 2JA6J 3T8RA 1X3WB 4EVIA 1KU7A 4FE7A 3Q9VA 1MMDA 4CYCA 4U0YA 3QP6A 3WTXC 1AKHA 3K6GA 4XMYA 4L0ZB 2GXBA 1M1EB 4QSHA 4A69C 2CMPA 1WJDA 4BJ6C 2KL4A 2LSOA 4MHGA 5KHDA 2AHQA 1KYZA 2DI3A 2E5ZA 2VBXA 1SD7A 3W2AA 3K4JA 5C4JJ 1BR2A 4I0AA 4BDZA 1I6HJ 1MBJA 2L9NA 1YS6A 5E1XA 1A5JA 1BJAA 2L9SA 1U0JA 5D6EA 3BR1A 5ICGA 1FOKA 1SVMA 3TGNA 3JSPA 5IT9Z 4FE4A 2H94A 1SD4A 2K3FA 4ZJZA 3LSKA 4M3GA 3GFJA 5JHFA 3K7AJ 4P9UA 3BG3A 2IBDA 4RMNA 1R1UA 1W7PD 1XGMA 2VXDA 2F4OB 4OOIA 1WJEA 4CCOA 1S3JA 2XRLA 4PDKA 3I53A 3K1NA 1YE9A 2HXOA 3QU6A 1X2MA 2BE5F 2EFOA 3OS0A 5IYCJ 4E7IA 4S05A 2HS5A 4I2OA 2UZKA 1ZHFA 4WK8F 1G3WA 2VQCA 5J1RA 2X4HA 4CGZA 3GFLA 1QZEA 2BY0A 2VLAA 3KCCA 3T1BA 1FP2A 5JR3A 2CQXA 3A4CA 1EH6A 4XLEA 3BR0A 4AM3A 2JTVA 2IGMA 1YHQI 3QYEA 5FKOA 1BR4A 5LGUA 2CFXA 2STTA 5LHGA 3LSIA 2DK5A 1Z0XA 3Q0UA 4M6VA 1YX5A 3SDBA 5LGNA 2GIZA 5FFZA 2BHZA 3CMAI 1KA8A 1R1VA 3F8MA 2Y75A 4A3IJ 1QU3A 1EV7A 1U2WA 3OYHA 2ZO4A 4XK4A 1YTYA 4Z2YA 4CSWA 1HKSA 2L9VA 2K40A 3HSFA 4H4KC 2KJBA 2WY8Q 1FY7A 2H6BA 3HRUA 1RKWA 1R5HA 4PFOA 5FO5A 1OKRA 2QENA 1GHCA 3I54A 1XX5A 2PMHA 2AS5F 1ORKA 2LD5A 2IGKA 5HS8A 2GWRA 2OUMA 2H27A 4XORA 3H5NA 5FD5A 2A69F 4M3FA 2DT6A 3CF5F 4I02A 2Q1ZB 4WX9A 1TW3A 1CGPA 3RKWA 4LJZF 2M0MA 4MEXF 1ZGWA 4OWRB 1G59A 2DW4A 1OCOH 2EBIA 1D1AA 3RPUA 3LSTA 1RR8C 4U0VA 4BYYA 2R92J 4R8HA 2DJIA 2VOPA 1GVDA 1R1TA 1LDDA 2B9SA 3MVPA 2BOLA 3LL7A 3ZR8X 1Y1VJ 4YFXF 5E79C 4IPAA 5EJCA 1X1AA 3KP2A 1APLC 3K70D 4FT8A 4GFBA 1LFBA 2NVYJ 3BPXA 4DBRA 1X19A 5LFAA 2HOSA 3LAJA 2N8GA 4JYKA 5DD8A 2NXNB 3I0TA 4BQAA 1G3TA 2DFFA 1FOXA 3EUHA 4PGHA 3M9AA 1IZ1A 1P9QC 3LNQA 4M71A 4Q47A 1MBHA 1N75A 1DP3A 1TWCJ 3KIOA 4QLCU 2CV1A 3H0GJ 2VUMJ 2ZXHA 2EZKA 3HOWJ 5E1WA 2BY1A 3VPRA 1JT0A 4OIRF 2A5WA 3BCAA 5D6FA 1STZA 3GLXA 2Y0SN 3KEOA 3CCYA 2W57A 4MFDA 1P4XA 5FKMA 1AWCA 1IW7F 4L9NA 5GPCA 3ZMVA 2GM4A 2EFNA 4ASNA 4ZDOA 1DU6A 1H89C 1LQ1A 3E6MA 4JX5A 2FOWA 4P5OA 4XLPF 3M3YJ 5KAFC 3S17J 3FKJA 1ETWA 4Y33A 1FP1D 3TMOA 1W5SA 5CJ9A 3BG5A 2LY1A 4L18B 5DCMA 4F7ZA 1JKPC 3DBRB 3SYTA 3MKYB 2WTEA 3BTCA 3IC7A 4F3QA 3Q9SA 1U9OA 5HDGA 3VEPA 3C2GA 2FX0A 1W0UA 2QKLB 3WU1B 2XROA 1DGWY 1QPMA 2UXNA 3KP7A 5F0HA 3KZIC 1O3QA 5JI6A 3W6VA 5EYRA 2RDPA 3OYFA 4HRIA 4D5FA 4C2UA 3ZQFA 2EFWA 2K9QA 4BXUA 1LFUP 4AU7A 1SAXA 5HDNA 5FLMJ 2QSFX 2Z2SB 1NTCA 3LFUA 2DA1A 1LFPA 2QZ8A 2A6TA 3GUDA 1MBFA 1TNTA 2LKXA 1AU7A 3OYKA 3N05A 1XG1A 4BHPA 1YS7A 2CQQA 3ASOH 3TP0A 2XF6A 2KISA 3BG7A 1FYLA 3EYIA 4ZDPA 1OQYA 3I64A 4EQQA 5H2FC 4J00A 4NHJA 2ELJA 2OJED 3DLLF 3JR9A 2QBYA 2CFOA 4HV6A 5HS9A 1GXPA 2GXAA 2CH0A 5EEHA 4C3JJ 4U7BA 1R22A 4CCNA 2ZKZA 2YU9J 5E8GA 4M9SA 5ERIA 3JSOA 3FXJA 2ZJPF 3BQYA 3K1PA 3FXOA 1R4NB 2DFHA 1OYIA 3DLAA 3I5UA 1OCPA 3GBGA 4V2GA 2X1DA 3MZ8A 1VQ9I 3FWEA 2V1NA 1ZG1A 4OIOF 1WJBA 1I6XA 4G6DA 5LRRA 4B47A 3RQ4A 2DMPA 1ETKA 1USTA 3WGIA 5A2QK 1YITI 1YLFA 4HNVA 1ETVA 2DA7A 2IEKA 4E70A 2CV2A 1IV6A 3WTUC 3RZOJ 3FISA 3S3MA 1DGRM 3H35A 1R23A 2LDUA 1YOVB 3D1NI 3HPHA 1JKRC 3JRAA 3CZ6A 4B8XA 2DA6A 1HSJA 2P5LC 1UG2A 1VTNC 4AIDA 4HF0A 5HDKA 1S5LC 4B3AA 2PQ8A 4V2FA 3I56I 5F04A 4HLYA 5K7HA 1AHDP 3ULQB 1V5GA 1SFOJ 1MDMA 4KUMA 5TISC 3SEZA 1ZLKA 2X6WA 2NVXJ 2O61A 2R7DA 2HQNA 2LP0A 3LSHA 2E2HJ 1FTTA 1HKQA 3GVAA 2VQHA 1MMGA 3RKQA 4AWXB 1IC8A 1IN8A 3VODA 2AXLA 4I09A 5FD6A 3CCEI 3KP3A 3OSFA 3QP5A 3S1QJ 3GCMA 1D5VA 2FNPA 2GA2A 2VXZA 2EZIA 4ZYGA 2R7WA 4HDUA 1MJBA 2RKHA 2W85A 2XHKA 4XRSG 3IWZA 1IJWC 3RI4A 4BH9A 2HPMA 2CW0F 2LYCA 3HRTA 2L7FP 2OU2A 3ZPLA 3CMYA 3R0JA 2P5VA 2WB1N 1VQ8I 4M3DA 2HTJA 4UVCA 1BC7C 4IHWA 4QTRA 3MN2A 1DDNA 1U9NA 5CVUA 3FXRA 1ZAOA 1FEXA 1LNWA 1U5TC 2V6CA 3OSGA 3HUGB 3C2HA 3JAMZ 3GLLA 4U7DA 1ENHA 4XKVA 1SFXA 1WRJA 1YW7A 2OPTA 3E6BA 2OD5A 3I59B 3A01A 4XSXF 2P5KA 1T2KA 1HA8A 2ME0A 3QRFF 3HUGA 3IP4B 5HLHA 2HU9A 2RV8A 2CUFA 3CJRB 4XLAA 4EMSA 4A12A 3IV5A 1Z6RA 1IXRC 2LKPA 4XOPA 3AG1H 4M72A 4PSWA 3HEFA 2KJCA 3LFKA 4IHXA 2YUSA 4XICA 4HQEA 5IY5H 2O8XA 1T0FA 1FBUA 4XR6A 2VT3A 1ETOA 5JVGF 3ZN1A 3TEDA 1F9NA 2QYOA 1DP7P 2YX7A 4IRIA 5CQEA 2ECCA 1T0FC 4LK1F 4D1QA 3F8FA 2VE9A 3I4MJ 1FC3A 3VYSB 3ZMDA 1TZLA 2K3PA 2QSGX 1QPIA 1IN5A 4PFPA 4HA8A 4HX7A 5E3MA 2Y69H 1EF4A 1EKEA 3ZMSA 3TDZC 5FRNA 2EZHA 2EILH 2R7QA 5IYBJ 2L02A 1X3UA 1E0EA 2DCEA 2BV6A 1RC9A 5FKNA 3Q5FA 2F4MB 1W5CC 2D45A 4DZPA 1MBKA 1HXDA 1I3QJ 3B6AA 4PJJA 3CDHA 3J7AY 3WGHA 3GMEA 3VFZA 1XSDA 2R7UA 5J4VA 3GTGJ 2OTJI 1VZ0A 4ENKA 2IRFG 3N97A 3F8BA 4D7NA 5FKLA 4E6KG 3IAM2 2FF4A 4LB5A 1HDPA 4A2UA 1BI0A 1O7LA 3H3ZA 3DF8A 1RKTA 4AIHA 3S14J 4MGRA 3OL4A 3PFYA 5J47A 2W4SA 4Y17A 5D5WB 3JRFA 2J5PA 3KPHA 3SZGA 1U8BA 4XOTA 4RM3A 3RIRA 4KIGA 2M3AA 3T5XA 5HS7A 1WQ2A 4MQ9F 4BBRJ 1SC7A 2FU4A 4ZYHA 1UHWA 1V5EA 4XQFA 3SQNA 5FROA 1Z3XA 2HYFA 1W1WE 2HNHA 2KMUA 2VIXA 2M4KA 3WU2C 4EJTA 2E60A 4GRIA 4B3XA 2DAOA 2H8RA 1ZG3A 1VI0A 3FF5A 4RDUA 1OR7A 4LOCA 3M4OJ 1JHHA 2XPUA 1T95A 1KU3A 5FFXA 3E5XA 1OR7C 1BIBA 3WTWC 4B4CA 1TNSA 1XSXA 1BN5A 4HSRA 4P1WA 3J80Z 2XIGA 5J6XA 4BEHB 4C30A 3V4GA 1N78A 5B5EC 2ZB9A 2OTLI 1X3ZB 2XGXA 4YEJA 3W6JB 3OYEA 1FLIA 5J1YA 3G73A 1P92A 1FWZA 3GFIA 3OYLA 2Z99A 4C2MJ 2DOEA 3NWTA 1F1ZA 1J7KA 3DU6A 1WJFA 2DA3A 3QU3A 5LD2C 4AD9A 2XASA 5HLGA 2V9VA 3HB9A 4RB3C 3OYDA 1MNDA 5TRDA 1XMAA 4GDFA 4A3BJ 3LWFA 1IGNA 5IT9K 3BT9A 2OCEA 2CQNA 1YG2A 2KDOA 3FM3A 3FHNA 1Z7UA 2V9PA 3H5AA 5LEJA 2IGOA 1ZR4A 6PAXA 5IOZA 2LBFB 3OWTA 1LE8B 3DEWA 2NVTJ 2K5CA 1IAWA 3QOPA 1UHSA 2FE3A 3E1SA 5GP9A 1G3SA 1TW2A 4AC0A 2R7RA 3BTIA 4XLFA 1K78A 2Y0SA 4S0HB 3LA2A 4XSZF 5CKTA 4KMUX
chains in the Genus database with same CATH topology
1A04A 1UCRA 1HSTA 5E18F 3I71A 1PDNC 2M30A 3WGGA 4A0XA 4UXNA 4LK0F 3VOEA 1FYKA 1K7AA 1USSA 4CYDA 2HFHA 3M7GA 1OPCA 2FNAA 1WI9A 2V1DA 5DCMB 3P9KA 1B6AA 2GA1A 5AONA 1SMYF 3FZVA 3BPVA 3K2ZA 4WXDA 2OZUA 1ODDA 3HTUA 4KA4A 1BI3A 2VBZA 1W4MA 4L5IA 2EFPA 4I01A 1MJAA 3WE2A 3BWGA 4LG0B 1F5TA 5D8KB 4MTEA 3DP7A 2DPDA 1EH7A 4LG0A 1OYYA 3BROA 5ILVA 4RGRA 2DO7A 2ZXJA 5LGTA 2DPUA 2ZBKA 2FA5A 2RN7A 3EETA 1EH8A 2TDXA 3FXUA 1HW5A 4EV0A 1W7PA 4B09A 4HBLA 4YG2F 1MKMA 2NYXA 1NHAA 4L9VA 3GO5A 2CG4A 4O6JA 3V7RA 1IF1A 4GO1A 5J8CA 2YSRA 2W24A 2VODA 1J2XA 2MH2A 3IL2A 5JVTA 2JT1A 1XD7A 3V8JA 3HIFA 1TTYA 4A5MA 5BPDA 2K4JA 3D0SA 4ZYEA 1AOYA 1O57A 4GCVA 4G94A 2HKXA 4HDVA 3BP8A 2FBKA 4M6YA 3DFGA 5ICCA 3JTHA 5IT3A 2WC2A 2Q0OA 5FLXK 2PG4A 5K5RA 4KYWA 1J5YA 3HHHA 5F1RA 2YX4A 1TQPA 1IXSB 2ZMEA 3JTGA 4KMFA 5L3BA 1S29A 4WCGA 4M73A 2PI0A 1FT9A 4EGYA 1HBXG 3K0LA 4H0EA 1G6NA 4ESBA 1TLHB 2IA1A 1FPQA 2YR2A 1XCBA 2DT5A 3ELKA 2VONA 4ENJA 3GF2A 3COAC 2GQQA 2H6CA 3U9GA 5BPIA 4KN7X 2ISYA 1MZBA 2OQRA 1U3EM 2JPBA 1U6GA 3KZZA 3E3VA 3IRQA 2KIFA 1R5GA 4XRFA 4ENMA 2A07F 3CUQB 5LHIA 2W84A 2B0LA 3L2CA 4UVBA 2Z9OA 1V4RA 2P6TA 1UB9A 4AIJA 4KN4X 3H3UA 3SZPA 4LMYA 1ZRCA 4HZFA 3ZMTA 3E5UA 2EA4A 1Z1DA 4HF2A 3BY6A 1D8KA 3MAJA 2VBYA 2V1XA 4WWCA 3E97A 1WKMA 3SFZA 2MA3A 2P7VB 1PUEE 2RC4A 3E6CC 4ON0A 5FLXZ 1P6RA 2IP2A 4YFKF 2F5EA 4GXOA 3SHFA 3JAMK 4EGZA 4ESFA 5H20A 2HEOA 2LF7A 2ESNA 5K5OA 3DEUA 4LD5A 3SZTA 4Y13A 3LQRA 3TQNA 3O3KA 5AIQA 5L3GA 3F6VA 2O3FA 3MFKA 1FNNA 3WU0A 1XDSA 2KIMA 5JFRA 5BMZA 1IRFA 2BEOA 1SD6A 2Y0MA 3G3ZA 1R58A 2KRFA 5EEGA 1I27A 2C6YA 4BHCA 2VE8A 2GIVA 3P9IA 1K78B 5L3DA 3TO7A 1H9GA 2ACJA 2FXAA 4P9FA 2XV4S 5ED4A 2PBIA 1PP8F 3HYIA 1R00A 1IUYA 4KFCA 3CTAA 2CYYA 4EJOA 3FHZA 2HTSA 5LRSA 1FBQA 1BOAA 3D5LA 1DPRA 3MEXA 3QPHA 2P7CB 3B73A 2R3SA 2A5YB 3CO6C 3ML6A 3EQLF 1PP7U 4ZZDA 1O3RA 2HOEA 3KZYA 4OINF 1S7OA 2XAFA 2XAHA 3GZ5A 2CSOA 2OAZA 4HX4A 3MCZA 5K1YA 4I98B 2GXGA 3GXOA 3RTRA 2A6HF 3WTYC 2ETHA 2EV5A 4HX8A 2D2WA 5TJJA 4A5NA 3DKWA 5ILSA 1H0MA 4N9IA 1QZZA 4WXHA 1ZGJA 2DK8A 3EDPA 4WF2A 2CWEA 2EK5A 4M9ZA 4DNCA 2W25A 4EM1A 3ABUA 2JPCA 1IXCA 5L3CA 3KP6A 3TOBA 1T98A 3V7CA 2IPQX 4GYIA 1YYVA 5DDGA 4RS8A 1W7PB 3AAFA 1Q1HA 3GW2A 1BI2A 1MJ9A 2CO5A 1HW2A 2F5FA 4ZH4F 5ILUA 3WTVC 1FBSA 3OOPA 4BNCA 1XGNA 3RYPA 3WG9A 4UV9A 4OIPF 2VOOA 4I0BA 2QQAA 1JXSA 1JGSA 1YIOA 3J7AO 2XKPA 3REOA 4A6DA 3ECHA 4FX0A 1LEBA 1C0WA 3BDDA 2OQGA 4G6QA 2E1CA 2QVOA 3FX3A 5K5QA 1O7FA 3WTSC 4OMYA 2KIUA 3ZN0A 4EJWA 3M1EA 2ZMEB 4HLXA 4WXCA 2ELHA 1IN7A 2L4AA 5ICFA 2HDCA 5HOOA 2IA2A 2RVCA 2VT2A 1ZARA 1L3LA 2EB7A 2L3DA 2QWWA 2VC0A 3L7WA 3KLNA 4HAMA 1E17A 3TKYA 1Z05A 2G9WA 1DPUA 2MLGA 5LBQA 3F6OA 4KDPA 2GAUA 5CVVA 1U78A 3IKVA 3K1MA 1R36A 1KQ0A 1HW1A 3GWZA 1ZRFA 1XN7A 1J59A 1FX7A 1I1SA 3ZMZA 3GFMA 1O3TA 1ON1A 3IWFA 1QQIA 3I58A 2FMLA 5LLQA 1LVAA 1FYMA 3RKYA 3T0YA 2XVCA 5CVJA 3R0AA 1LDKB 1ON2A 1CF7B 4P55A 2K27A 4ETSA 2G7UA 1B1BA 3P9CA 4CICA 2FSWA 2PEXA 3HSEA 4PZJA 3O2PE 4FHTA 5DUKA 3F8CA 5KVRA 4RAZA 2DBBA 4AIKA 4EM2A 1XCVA 4Q48A 3C3WA 4HQMA 3C7JA 3DPTA 1GXQA 3C1DA 1G3YA 5CLSA 3ZP5A 3F8NA 4UUVA 3HRSA 1ONVA 4FX4A 2WWYA 3P7NA 2MLKA 4N0BA 2M5WA 2H09A 1P4WA 2NAZA 4NB5A 1V3FA 1YW9A 2IJLA 1JE8A 3NQOA 2NNYA 3QPTA 2O03A 1IN6A 2DTRA 4JBAA 4R79A 1IRGA 3V8LA 2X0LA 5D5UB 2BGCA 1QNTA 1Z6TA 3IRRA 5DD4A 1KU2A 1O3SA 4GYGA 1MDMB 1YW8A 1LEAA 2FOKA 3C18A 3E5QA 2KKOA 1XGSA 3KP5A 2XRNA 2EWNA 2VN2A 2QM3A 3W6KB 3MZHA 5BQTA 4TV7A 1REPC 1D3YA 4ENNA 3WTZA 2PFBA 3CUQA 1KYWA 2HWVA 2ZNZA 1SMTA 3NRVA 2G7HA 5A2QZ 2PJPA 5BS6A 1ZREA 3I59A 3KFWX 4HOBA 1WWXA 1IN4A 4AVPA 1QZYA 3MQ0A 1MGTA 2MH9A 1UHMA 4KIFA 3HOTA 1UFMA 2IVMA 3J80K 4JK1X 2O0YA 3B02A 1ULYA 3ECOA 1TQMA 3GZ6A 1Z91A 3FMRA 2M1BA 2FBIA 3DV8A 2XAJA 4HW0A 4RB1A 5BOXA 4G7HF 2ZNYA 1W5TA 2BBYA 2Y48A 2GZWA 4D0PA 5FGMA 2HKOA 1F4KA 2OBPA 1KQ9A 2ZCWA 1MD0A 1K6OA 4BHBA 3GX4X 4KICA 4U88A 2QQBA 1SFUA 4LLNA 1B59A 4HF1A 2MD5A 2E1NA 3I4PA 4JQFA 5DCFA 3QAHA 1ZGAA 1P2FA 4Y15A 3LAPA 2XAGA 2COMA 4CHUA 2Q2EA 4P96A 4LFUA 4XBFA 4N9HA 2PN6A 2A68F 2L01A 1B4AA 2L4MA 3RPQA 4L0YB 2NRAC 3ERED 2HZTA 2RQPA 5L3EA 1Z9CA 2LNBA 3VB2A 3IHUA 1J9IA 2F5CA 5DUIA 4CXFA 1TQIA 3BJ6A 3HTSB 3F72A 3O6BB 2P4WA 4MTDA 2BYVE 3J81Z 2F2EA 4G8XA 2L54A 4LLLA 5LEKA 2RNJA 3KEQA 4OU0A 4L5JA 1T39A 3PQKA 3LQQA 2JSCA 3BOQA 4EJUA 2NNNA 4UHTA 1BIAA 4G9YA 1S7AA 4K2EA 4DQ2A 4LGWA 1LJ9A 1RIOH 5D5XB 2A6EF 5JHUA 1RI7A 3CUOA 2YU3A 1XGOA 1E2XA 3TO6A 3GYHX 2V1UA 5D5VB 2J5OA 3M8FA 2Z3YA 3CO7C 1ZRDA 3KE2A 4GGGA 5ICEA 1T38A 2FQ3A 4BAYA 3F3XA 3JW4A 3PFIA 3DPLC 2YPRA 2P8TA 3IKTA 4L9JA 2DFIA 1D8JA 2EV6A 4RB0A 1T6SA 1OYWA 2RGVA 3WODF 1U5TA 1S8NA 2K7LA 1TBXA 4MNUA 1Y0UA 1K79A 1LDJA 4ESJA 3FM5A 5H6QA 2EJRA 3PQJA 1J0RA 2IA0A 3DQVC 4I7HA 3EYYA 4EM0B 1QBJA 1S6LA 3V7SA 2E7XA 5AIPA 3CLOA 3TDUC 3L00A 1B9MA 3ZMUA 5KK1A 1SFEA 2ISZA 4RAYA 3R61A 2P6SA 3CJNA 3ROUA 2A61A 4XLNF 4KIBA 1ZG5A 3HRMA 3MZYA 5E8IA 1XDUA 4G7ZF 2QBYB 4HV5A 2WV0A 5LHHA 2DLLA 3WE3A 4R1HA 4RGUA 2CGPA 4U0WA 1ZYRF 2QQ9A 3TOAA 3BJOA 4IF4A 1G4DA 2K86A 5CVIA 3L9FA 5FB2A 3F21A 5D4RA 4UNOA 5HVQC 4UVAA 4M9XA 1H9TA 2CQKA 3S2WA 3ZQ7A 2R7FA 3LA3A 1B9NA 2DQLA 4QWQA 2MBFA 2IT0A 3BJAA 3RKXA 4OIQF 4CDGA 4IRHA 1BC8C 5H6RA 2FRHA 4M74A 4IJAA 2VBWA 4YFNF 4Q5SF 2QUFA 3FMQA 1RZ4A 3KP4A 2IW5A 1YO5C 1FSHA 1SD5A 4S04A 1QGPA 2STWA 4MQVA 1R7JA 3K69A 2FMYA 4PGGA 1U8RA 4ZZLA 5E1ZB 2XAQA 1YQAA 2HQRA 2EFQA 2DU9A 5F64A 2UXXA 1I1GA 2OA4A 1YFHA 1RUNA 3U2RA 2XUBA 2E7WA 4LLGF 1JHFA 3GEZA 5F6FA 2OZ6A 3HHGA 4L9TA 5DV5A 3KLOA 2HGCA 2HR3A 5HLIA 2DQRA 1XMKA 1I5ZA 2F5DA 3LA7A 2Q8KA 1FZPB 2EA2A 3DXJF 3R6SA 4A0ZA 4MEYF 2K4BA 2EV0A 1CF7A 2ESHA 4IXAA 3KETA 3SXYA 2K02A 4EJVA 4YIFA 4Q4ZF 3WTTC 3CUQC 1HQCA 4KT5C 2HYGD 5DEQA 1QO0D 2FEZA 2JZYA 2NS0A 2FBHA 1RUOA 3NEUA 3J81K 1KGSA 2D1HA 2Z33A 2LF8A 4NQWA 2PMUA 4CO8A 3F22A 1FSEA 1DUXC 5J8FA 4KNYA 3K9TA 1L0OC 1ZN2A 1RNLA 4RGXA 4IVNA 2QLZA 3F23A 4PCQA 4A0YA 1BM9A 3BZ6A 1P4AA 3TO9A 4YIIA 4RB2C 3HSRA 1XB4A 3ISPA 3OV8A 4M6XA 2ADUA 1KU9A 4IRGA 1BBYA 5DYMA 4UV8A 1J75A 2D1VA 1LB2A 4HYEA 5E17F 1BI1A 4O3MA 3FXQA 3MWMA 1XSVA 1KQ8A 2XKOA 5CVRA 2JRTA 1GVJA 1OMIA 3RJPA 4A6EA 2M87A 2VC1A 4RGSA 4LB6B 4IHSA 5CYVA 3FMSA 3N4MA 5L3FA 2MC3A 3E6DA 4IHTA 1WSUA 3U1DA 3RDIA 5D8LB 2M8EA 1HKTA 1ZLJA 4ZYDA 2A3SA 2V79A 3RYRA 3R60A 3H92A 5E20A 2M45A 4CZZA 2UWMA 5D4SA 3M8EA 4OMZA 3R4KA 3V8KA 3L09A 3HOSA 2PLYA 4G7OF 2ZFWA 3T8TA 1ZH5A 2ZJ2A 2O6GE 2Z5UA 4O5VA 3ABTA 1U5TB 3T8RA 4EVIA 1KU7A 3Q9VA 3WTXC 4U0YA 3QP6A 4L0ZB 2GXBA 2LSOA 4MHGA 1KYZA 2DI3A 2VBXA 1SD7A 4I0AA 1YS6A 5E1XA 1BJAA 5D6EA 5ICGA 1FOKA 3TGNA 3JSPA 5IT9Z 2H94A 1SD4A 3GFJA 4P9UA 1R1UA 1W7PD 1XGMA 4OOIA 1S3JA 4PDKA 3I53A 3K1NA 3QU6A 2BE5F 2EFOA 4I2OA 4S05A 2HS5A 2UZKA 1ZHFA 4WK8F 1G3WA 2X4HA 4CGZA 3GFLA 3KCCA 3T1BA 1FP2A 5JR3A 1EH6A 2JTVA 5LGUA 2CFXA 2STTA 5LHGA 2DK5A 5LGNA 5FFZA 1KA8A 1R1VA 3F8MA 2Y75A 1EV7A 1U2WA 2ZO4A 1YTYA 4Z2YA 1HKSA 3HSFA 2KJBA 1FY7A 2H6BA 3HRUA 1R5HA 5FO5A 1OKRA 2QENA 1GHCA 3I54A 2AS5F 2PMHA 5HS8A 2GWRA 2H27A 5FD5A 2A69F 4I02A 4WX9A 1TW3A 1CGPA 3RKWA 4LJZF 4MEXF 2DW4A 3RPUA 3LSTA 4U0VA 4BYYA 4R8HA 2VOPA 1R1TA 1LDDA 4YFXF 4IPAA 3KP2A 4FT8A 3BPXA 3LAJA 5DD8A 3I0TA 4BQAA 1G3TA 3EUHA 4PGHA 3M9AA 1IZ1A 4M71A 4Q47A 4QLCU 5E1WA 4OIRF 5D6FA 1STZA 3GLXA 3KEOA 2W57A 1P4XA 1AWCA 1IW7F 4L9NA 3ZMVA 2EFNA 4ASNA 1LQ1A 3E6MA 4P5OA 4XLPF 1FP1D 1W5SA 5CJ9A 4L18B 5DCMA 4F7ZA 2WTEA 3IC7A 3Q9SA 5HDGA 3VEPA 2XROA 3WU1B 1QPMA 2UXNA 3KP7A 1O3QA 5JI6A 2RDPA 2EFWA 4BXUA 1SAXA 5HDNA 3GUDA 2QZ8A 1TNTA 4BHPA 1YS7A 1FYLA 3EYIA 3I64A 4EQQA 4NHJA 2QBYA 4HV6A 5HS9A 1GXPA 5EEHA 4U7BA 1R22A 2ZKZA 5E8GA 4M9SA 5ERIA 3JSOA 3K1PA 1OYIA 3I5UA 3FWEA 1ZG1A 4OIOF 1I6XA 4G6DA 5LRRA 1USTA 3WGIA 5A2QK 1YLFA 4E70A 3WTUC 1R23A 2LDUA 4B8XA 1HSJA 2P5LC 1VTNC 4HF0A 5HDKA 2PQ8A 4HLYA 3ULQB 1MDMA 4KUMA 1ZLKA 2O61A 2R7DA 2HQNA 1HKQA 3GVAA 4AWXB 1IN8A 3VODA 2AXLA 4I09A 5FD6A 3KP3A 3QP5A 1D5VA 2FNPA 2GA2A 2VXZA 4ZYGA 4HDUA 1MJBA 2RKHA 2W85A 2XHKA 3IWZA 3RI4A 4BH9A 2CW0F 3HRTA 2OU2A 3ZPLA 3R0JA 2P5VA 2HTJA 4UVCA 1BC7C 1DDNA 5CVUA 3FXRA 1ZAOA 1LNWA 1U5TC 2V6CA 3JAMZ 4U7DA 1SFXA 1WRJA 1YW7A 3E6BA 3I59B 2OD5A 4XSXF 2P5KA 1T2KA 3QRFF 3HUGA 5HLHA 2RV8A 4EMSA 4A12A 1Z6RA 1IXRC 2LKPA 4M72A 2KJCA 3LFKA 4HQEA 2O8XA 1T0FA 1FBUA 2VT3A 3ZN1A 1F9NA 2QYOA 1DP7P 2YX7A 4IRIA 2VE9A 4LK1F 3F8FA 1FC3A 3ZMDA 1IN5A 4HA8A 4HX7A 3ZMSA 3TDZC 2L02A 1X3UA 2BV6A 3Q5FA 2D45A 1HXDA 3CDHA 3WGHA 3VFZA 1XSDA 4ENKA 2IRFG 3N97A 3F8BA 4LB5A 2FF4A 4A2UA 1BI0A 1O7LA 3H3ZA 3DF8A 4AIHA 4MGRA 4Y17A 5D5WB 2J5PA 3RIRA 4KIGA 3T5XA 5HS7A 1WQ2A 4MQ9F 2FU4A 4ZYHA 1UHWA 3SQNA 2HYFA 4EJTA 2DAOA 1ZG3A 3FF5A 1OR7A 1JHHA 1KU3A 5FFXA 3E5XA 1BIBA 3WTWC 1TNSA 1XSXA 1BN5A 3J80Z 2XIGA 5J6XA 3V4GA 2XGXA 3W6JB 1FLIA 3G73A 1P92A 1FWZA 3GFIA 2Z99A 1F1ZA 1J7KA 3QU3A 4AD9A 2XASA 5HLGA 2V9VA 4RB3C 5TRDA 1XMAA 3LWFA 5IT9K 1YG2A 3FM3A 1Z7UA 5LEJA 6PAXA 1IAWA 3QOPA 2FE3A 1G3SA 1TW2A 1K78A 3LA2A 4XSZF 4KMUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A04 A;  1UCR A;  1HST A;  5E18 F;  3I71 A;  1PDN C;  2M30 A;  3WGG A;  4A0X A;  4UXN A;  4LK0 F;  3VOE A;  1FYK A;  1K7A A;  1USS A;  4CYD A;  2HFH A;  3M7G A;  1OPC A;  2FNA A;  1WI9 A;  2V1D A;  5DCM B;  3P9K A;  1B6A A;  2GA1 A;  5AON A;  1SMY F;  3FZV A;  3BPV A;  3K2Z A;  4WXD A;  2OZU A;  1ODD A;  3HTU A;  4KA4 A;  1BI3 A;  2VBZ A;  1W4M A;  4L5I A;  2EFP A;  4I01 A;  1MJA A;  3WE2 A;  3BWG A;  4LG0 B;  1F5T A;  5D8K B;  4MTE A;  3DP7 A;  2DPD A;  1EH7 A;  4LG0 A;  1OYY A;  3BRO A;  5ILV A;  4RGR A;  2DO7 A;  2ZXJ A;  5LGT A;  2DPU A;  2ZBK A;  2FA5 A;  2RN7 A;  3EET A;  1EH8 A;  2TDX A;  3FXU A;  1HW5 A;  4EV0 A;  1W7P A;  4B09 A;  4HBL A;  4YG2 F;  1MKM A;  2NYX A;  1NHA A;  4L9V A;  3GO5 A;  2CG4 A;  4O6J A;  3V7R A;  1IF1 A;  4GO1 A;  5J8C A;  2YSR A;  2W24 A;  2VOD A;  1J2X A;  2MH2 A;  3IL2 A;  5JVT A;  2JT1 A;  1XD7 A;  3V8J A;  3HIF A;  1TTY A;  4A5M A;  5BPD A;  2K4J A;  3D0S A;  4ZYE A;  1AOY A;  1O57 A;  4GCV A;  4G94 A;  2HKX A;  4HDV A;  3BP8 A;  2FBK A;  4M6Y A;  3DFG A;  5ICC A;  3JTH A;  5IT3 A;  2WC2 A;  2Q0O A;  5FLX K;  2PG4 A;  5K5R A;  4KYW A;  1J5Y A;  3HHH A;  5F1R A;  2YX4 A;  1TQP A;  1IXS B;  2ZME A;  3JTG A;  4KMF A;  5L3B A;  1S29 A;  4WCG A;  4M73 A;  2PI0 A;  1FT9 A;  4EGY A;  1HBX G;  3K0L A;  4H0E A;  1G6N A;  4ESB A;  1TLH B;  2IA1 A;  1FPQ A;  2YR2 A;  1XCB A;  2DT5 A;  3ELK A;  2VON A;  4ENJ A;  3GF2 A;  3COA C;  2GQQ A;  2H6C A;  3U9G A;  5BPI A;  4KN7 X;  2ISY A;  1MZB A;  2OQR A;  1U3E M;  2JPB A;  1U6G A;  3KZZ A;  3E3V A;  3IRQ A;  2KIF A;  1R5G A;  4XRF A;  4ENM A;  2A07 F;  3CUQ B;  5LHI A;  2W84 A;  2B0L A;  3L2C A;  4UVB A;  2Z9O A;  1V4R A;  2P6T A;  1UB9 A;  4AIJ A;  4KN4 X;  3H3U A;  3SZP A;  4LMY A;  1ZRC A;  4HZF A;  3ZMT A;  3E5U A;  2EA4 A;  1Z1D A;  4HF2 A;  3BY6 A;  1D8K A;  3MAJ A;  2VBY A;  2V1X A;  4WWC A;  3E97 A;  1WKM A;  3SFZ A;  2MA3 A;  2P7V B;  1PUE E;  2RC4 A;  3E6C C;  4ON0 A;  5FLX Z;  1P6R A;  2IP2 A;  4YFK F;  2F5E A;  4GXO A;  3SHF A;  3JAM K;  4EGZ A;  4ESF A;  5H20 A;  2HEO A;  2LF7 A;  2ESN A;  5K5O A;  3DEU A;  4LD5 A;  3SZT A;  4Y13 A;  3LQR A;  3TQN A;  3O3K A;  5AIQ A;  5L3G A;  3F6V A;  2O3F A;  3MFK A;  1FNN A;  3WU0 A;  1XDS A;  2KIM A;  5JFR A;  5BMZ A;  1IRF A;  2BEO A;  1SD6 A;  2Y0M A;  3G3Z A;  1R58 A;  2KRF A;  5EEG A;  1I27 A;  2C6Y A;  4BHC A;  2VE8 A;  2GIV A;  3P9I A;  1K78 B;  5L3D A;  3TO7 A;  1H9G A;  2ACJ A;  2FXA A;  4P9F A;  2XV4 S;  5ED4 A;  2PBI A;  1PP8 F;  3HYI A;  1R00 A;  1IUY A;  4KFC A;  3CTA A;  2CYY A;  4EJO A;  3FHZ A;  2HTS A;  5LRS A;  1FBQ A;  1BOA A;  3D5L A;  1DPR A;  3MEX A;  3QPH A;  2P7C B;  3B73 A;  2R3S A;  2A5Y B;  3CO6 C;  3ML6 A;  3EQL F;  1PP7 U;  4ZZD A;  1O3R A;  2HOE A;  3KZY A;  4OIN F;  1S7O A;  2XAF A;  2XAH A;  3GZ5 A;  2CSO A;  2OAZ A;  4HX4 A;  3MCZ A;  5K1Y A;  4I98 B;  2GXG A;  3GXO A;  3RTR A;  2A6H F;  3WTY C;  2ETH A;  2EV5 A;  4HX8 A;  2D2W A;  5TJJ A;  4A5N A;  3DKW A;  5ILS A;  1H0M A;  4N9I A;  1QZZ A;  4WXH A;  1ZGJ A;  2DK8 A;  3EDP A;  4WF2 A;  2CWE A;  2EK5 A;  4M9Z A;  4DNC A;  2W25 A;  4EM1 A;  3ABU A;  2JPC A;  1IXC A;  5L3C A;  3KP6 A;  3TOB A;  1T98 A;  3V7C A;  2IPQ X;  4GYI A;  1YYV A;  5DDG A;  4RS8 A;  1W7P B;  3AAF A;  1Q1H A;  3GW2 A;  1BI2 A;  1MJ9 A;  2CO5 A;  1HW2 A;  2F5F A;  4ZH4 F;  5ILU A;  3WTV C;  1FBS A;  3OOP A;  4BNC A;  1XGN A;  3RYP A;  3WG9 A;  4UV9 A;  4OIP F;  2VOO A;  4I0B A;  2QQA A;  1JXS A;  1JGS A;  1YIO A;  3J7A O;  2XKP A;  3REO A;  4A6D A;  3ECH A;  4FX0 A;  1LEB A;  1C0W A;  3BDD A;  2OQG A;  4G6Q A;  2E1C A;  2QVO A;  3FX3 A;  5K5Q A;  1O7F A;  3WTS C;  4OMY A;  2KIU A;  3ZN0 A;  4EJW A;  3M1E A;  2ZME B;  4HLX A;  4WXC A;  2ELH A;  1IN7 A;  2L4A A;  5ICF A;  2HDC A;  5HOO A;  2IA2 A;  2RVC A;  2VT2 A;  1ZAR A;  1L3L A;  2EB7 A;  2L3D A;  2QWW A;  2VC0 A;  3L7W A;  3KLN A;  4HAM A;  1E17 A;  3TKY A;  1Z05 A;  2G9W A;  1DPU A;  2MLG A;  5LBQ A;  3F6O A;  4KDP A;  2GAU A;  5CVV A;  1U78 A;  3IKV A;  3K1M A;  1R36 A;  1KQ0 A;  1HW1 A;  3GWZ A;  1ZRF A;  1XN7 A;  1J59 A;  1FX7 A;  1I1S A;  3ZMZ A;  3GFM A;  1O3T A;  1ON1 A;  3IWF A;  1QQI A;  3I58 A;  2FML A;  5LLQ A;  1LVA A;  1FYM A;  3RKY A;  3T0Y A;  2XVC A;  5CVJ A;  3R0A A;  1LDK B;  1ON2 A;  1CF7 B;  4P55 A;  2K27 A;  4ETS A;  2G7U A;  1B1B A;  3P9C A;  4CIC A;  2FSW A;  2PEX A;  3HSE A;  4PZJ A;  3O2P E;  4FHT A;  5DUK A;  3F8C A;  5KVR A;  4RAZ A;  2DBB A;  4AIK A;  4EM2 A;  1XCV A;  4Q48 A;  3C3W A;  4HQM A;  3C7J A;  3DPT A;  1GXQ A;  3C1D A;  1G3Y A;  5CLS A;  3ZP5 A;  3F8N A;  4UUV A;  3HRS A;  1ONV A;  4FX4 A;  2WWY A;  3P7N A;  2MLK A;  4N0B A;  2M5W A;  2H09 A;  1P4W A;  2NAZ A;  4NB5 A;  1V3F A;  1YW9 A;  2IJL A;  1JE8 A;  3NQO A;  2NNY A;  3QPT A;  2O03 A;  1IN6 A;  2DTR A;  4JBA A;  4R79 A;  1IRG A;  3V8L A;  2X0L A;  5D5U B;  2BGC A;  1QNT A;  1Z6T A;  3IRR A;  5DD4 A;  1KU2 A;  1O3S A;  4GYG A;  1MDM B;  1YW8 A;  1LEA A;  2FOK A;  3C18 A;  3E5Q A;  2KKO A;  1XGS A;  3KP5 A;  2XRN A;  2EWN A;  2VN2 A;  2QM3 A;  3W6K B;  3MZH A;  5BQT A;  4TV7 A;  1REP C;  1D3Y A;  4ENN A;  3WTZ A;  2PFB A;  3CUQ A;  1KYW A;  2HWV A;  2ZNZ A;  1SMT A;  3NRV A;  2G7H A;  5A2Q Z;  2PJP A;  5BS6 A;  1ZRE A;  3I59 A;  3KFW X;  4HOB A;  1WWX A;  1IN4 A;  4AVP A;  1QZY A;  3MQ0 A;  1MGT A;  2MH9 A;  1UHM A;  4KIF A;  3HOT A;  1UFM A;  2IVM A;  3J80 K;  4JK1 X;  2O0Y A;  3B02 A;  1ULY A;  3ECO A;  1TQM A;  3GZ6 A;  1Z91 A;  3FMR A;  2M1B A;  2FBI A;  3DV8 A;  2XAJ A;  4HW0 A;  4RB1 A;  5BOX A;  4G7H F;  2ZNY A;  1W5T A;  2BBY A;  2Y48 A;  2GZW A;  4D0P A;  5FGM A;  2HKO A;  1F4K A;  2OBP A;  1KQ9 A;  2ZCW A;  1MD0 A;  1K6O A;  4BHB A;  3GX4 X;  4KIC A;  4U88 A;  2QQB A;  1SFU A;  4LLN A;  1B59 A;  4HF1 A;  2MD5 A;  2E1N A;  3I4P A;  4JQF A;  5DCF A;  3QAH A;  1ZGA A;  1P2F A;  4Y15 A;  3LAP A;  2XAG A;  2COM A;  4CHU A;  2Q2E A;  4P96 A;  4LFU A;  4XBF A;  4N9H A;  2PN6 A;  2A68 F;  2L01 A;  1B4A A;  2L4M A;  3RPQ A;  4L0Y B;  2NRA C;  3ERE D;  2HZT A;  2RQP A;  5L3E A;  1Z9C A;  2LNB A;  3VB2 A;  3IHU A;  1J9I A;  2F5C A;  5DUI A;  4CXF A;  1TQI A;  3BJ6 A;  3HTS B;  3F72 A;  3O6B B;  2P4W A;  4MTD A;  2BYV E;  3J81 Z;  2F2E A;  4G8X A;  2L54 A;  4LLL A;  5LEK A;  2RNJ A;  3KEQ A;  4OU0 A;  4L5J A;  1T39 A;  3PQK A;  3LQQ A;  2JSC A;  3BOQ A;  4EJU A;  2NNN A;  4UHT A;  1BIA A;  4G9Y A;  1S7A A;  4K2E A;  4DQ2 A;  4LGW A;  1LJ9 A;  1RIO H;  5D5X B;  2A6E F;  5JHU A;  1RI7 A;  3CUO A;  2YU3 A;  1XGO A;  1E2X A;  3TO6 A;  3GYH X;  2V1U A;  5D5V B;  2J5O A;  3M8F A;  2Z3Y A;  3CO7 C;  1ZRD A;  3KE2 A;  4GGG A;  5ICE A;  1T38 A;  2FQ3 A;  4BAY A;  3F3X A;  3JW4 A;  3PFI A;  3DPL C;  2YPR A;  2P8T A;  3IKT A;  4L9J A;  2DFI A;  1D8J A;  2EV6 A;  4RB0 A;  1T6S A;  1OYW A;  2RGV A;  3WOD F;  1U5T A;  1S8N A;  2K7L A;  1TBX A;  4MNU A;  1Y0U A;  1K79 A;  1LDJ A;  4ESJ A;  3FM5 A;  5H6Q A;  2EJR A;  3PQJ A;  1J0R A;  2IA0 A;  3DQV C;  4I7H A;  3EYY A;  4EM0 B;  1QBJ A;  1S6L A;  3V7S A;  2E7X A;  5AIP A;  3CLO A;  3TDU C;  3L00 A;  1B9M A;  3ZMU A;  5KK1 A;  1SFE A;  2ISZ A;  4RAY A;  3R61 A;  2P6S A;  3CJN A;  3ROU A;  2A61 A;  4XLN F;  4KIB A;  1ZG5 A;  3HRM A;  3MZY A;  5E8I A;  1XDU A;  4G7Z F;  2QBY B;  4HV5 A;  2WV0 A;  5LHH A;  2DLL A;  3WE3 A;  4R1H A;  4RGU A;  2CGP A;  4U0W A;  1ZYR F;  2QQ9 A;  3TOA A;  3BJO A;  4IF4 A;  1G4D A;  2K86 A;  5CVI A;  3L9F A;  5FB2 A;  3F21 A;  5D4R A;  4UNO A;  5HVQ C;  4UVA A;  4M9X A;  1H9T A;  2CQK A;  3S2W A;  3ZQ7 A;  2R7F A;  3LA3 A;  1B9N A;  2DQL A;  4QWQ A;  2MBF A;  2IT0 A;  3BJA A;  3RKX A;  4OIQ F;  4CDG A;  4IRH A;  1BC8 C;  5H6R A;  2FRH A;  4M74 A;  4IJA A;  2VBW A;  4YFN F;  4Q5S F;  2QUF A;  3FMQ A;  1RZ4 A;  3KP4 A;  2IW5 A;  1YO5 C;  1FSH A;  1SD5 A;  4S04 A;  1QGP A;  2STW A;  4MQV A;  1R7J A;  3K69 A;  2FMY A;  4PGG A;  1U8R A;  4ZZL A;  5E1Z B;  2XAQ A;  1YQA A;  2HQR A;  2EFQ A;  2DU9 A;  5F64 A;  2UXX A;  1I1G A;  2OA4 A;  1YFH A;  1RUN A;  3U2R A;  2XUB A;  2E7W A;  4LLG F;  1JHF A;  3GEZ A;  5F6F A;  2OZ6 A;  3HHG A;  4L9T A;  5DV5 A;  3KLO A;  2HGC A;  2HR3 A;  5HLI A;  2DQR A;  1XMK A;  1I5Z A;  2F5D A;  3LA7 A;  2Q8K A;  1FZP B;  2EA2 A;  3DXJ F;  3R6S A;  4A0Z A;  4MEY F;  2K4B A;  2EV0 A;  1CF7 A;  2ESH A;  4IXA A;  3KET A;  3SXY A;  2K02 A;  4EJV A;  4YIF A;  4Q4Z F;  3WTT C;  3CUQ C;  1HQC A;  4KT5 C;  2HYG D;  5DEQ A;  1QO0 D;  2FEZ A;  2JZY A;  2NS0 A;  2FBH A;  1RUO A;  3NEU A;  3J81 K;  1KGS A;  2D1H A;  2Z33 A;  2LF8 A;  4NQW A;  2PMU A;  4CO8 A;  3F22 A;  1FSE A;  1DUX C;  5J8F A;  4KNY A;  3K9T A;  1L0O C;  1ZN2 A;  1RNL A;  4RGX A;  4IVN A;  2QLZ A;  3F23 A;  4PCQ A;  4A0Y A;  1BM9 A;  3BZ6 A;  1P4A A;  3TO9 A;  4YII A;  4RB2 C;  3HSR A;  1XB4 A;  3ISP A;  3OV8 A;  4M6X A;  2ADU A;  1KU9 A;  4IRG A;  1BBY A;  5DYM A;  4UV8 A;  1J75 A;  2D1V A;  1LB2 A;  4HYE A;  5E17 F;  1BI1 A;  4O3M A;  3FXQ A;  3MWM A;  1XSV A;  1KQ8 A;  2XKO A;  5CVR A;  2JRT A;  1GVJ A;  1OMI A;  3RJP A;  4A6E A;  2M87 A;  2VC1 A;  4RGS A;  4LB6 B;  4IHS A;  5CYV A;  3FMS A;  3N4M A;  5L3F A;  2MC3 A;  3E6D A;  4IHT A;  1WSU A;  3U1D A;  3RDI A;  5D8L B;  2M8E A;  1HKT A;  1ZLJ A;  4ZYD A;  2A3S A;  2V79 A;  3RYR A;  3R60 A;  3H92 A;  5E20 A;  2M45 A;  4CZZ A;  2UWM A;  5D4S A;  3M8E A;  4OMZ A;  3R4K A;  3V8K A;  3L09 A;  3HOS A;  2PLY A;  4G7O F;  2ZFW A;  3T8T A;  1ZH5 A;  2ZJ2 A;  2O6G E;  2Z5U A;  4O5V A;  3ABT A;  1U5T B;  3T8R A;  4EVI A;  1KU7 A;  3Q9V A;  3WTX C;  4U0Y A;  3QP6 A;  4L0Z B;  2GXB A;  2LSO A;  4MHG A;  1KYZ A;  2DI3 A;  2VBX A;  1SD7 A;  4I0A A;  1YS6 A;  5E1X A;  1BJA A;  5D6E A;  5ICG A;  1FOK A;  3TGN A;  3JSP A;  5IT9 Z;  2H94 A;  1SD4 A;  3GFJ A;  4P9U A;  1R1U A;  1W7P D;  1XGM A;  4OOI A;  1S3J A;  4PDK A;  3I53 A;  3K1N A;  3QU6 A;  2BE5 F;  2EFO A;  4I2O A;  4S05 A;  2HS5 A;  2UZK A;  1ZHF A;  4WK8 F;  1G3W A;  2X4H A;  4CGZ A;  3GFL A;  3KCC A;  3T1B A;  1FP2 A;  5JR3 A;  1EH6 A;  2JTV A;  5LGU A;  2CFX A;  2STT A;  5LHG A;  2DK5 A;  5LGN A;  5FFZ A;  1KA8 A;  1R1V A;  3F8M A;  2Y75 A;  1EV7 A;  1U2W A;  2ZO4 A;  1YTY A;  4Z2Y A;  1HKS A;  3HSF A;  2KJB A;  1FY7 A;  2H6B A;  3HRU A;  1R5H A;  5FO5 A;  1OKR A;  2QEN A;  1GHC A;  3I54 A;  2AS5 F;  2PMH A;  5HS8 A;  2GWR A;  2H27 A;  5FD5 A;  2A69 F;  4I02 A;  4WX9 A;  1TW3 A;  1CGP A;  3RKW A;  4LJZ F;  4MEX F;  2DW4 A;  3RPU A;  3LST A;  4U0V A;  4BYY A;  4R8H A;  2VOP A;  1R1T A;  1LDD A;  4YFX F;  4IPA A;  3KP2 A;  4FT8 A;  3BPX A;  3LAJ A;  5DD8 A;  3I0T A;  4BQA A;  1G3T A;  3EUH A;  4PGH A;  3M9A A;  1IZ1 A;  4M71 A;  4Q47 A;  4QLC U;  5E1W A;  4OIR F;  5D6F A;  1STZ A;  3GLX A;  3KEO A;  2W57 A;  1P4X A;  1AWC A;  1IW7 F;  4L9N A;  3ZMV A;  2EFN A;  4ASN A;  1LQ1 A;  3E6M A;  4P5O A;  4XLP F;  1FP1 D;  1W5S A;  5CJ9 A;  4L18 B;  5DCM A;  4F7Z A;  2WTE A;  3IC7 A;  3Q9S A;  5HDG A;  3VEP A;  2XRO A;  3WU1 B;  1QPM A;  2UXN A;  3KP7 A;  1O3Q A;  5JI6 A;  2RDP A;  2EFW A;  4BXU A;  1SAX A;  5HDN A;  3GUD A;  2QZ8 A;  1TNT A;  4BHP A;  1YS7 A;  1FYL A;  3EYI A;  3I64 A;  4EQQ A;  4NHJ A;  2QBY A;  4HV6 A;  5HS9 A;  1GXP A;  5EEH A;  4U7B A;  1R22 A;  2ZKZ A;  5E8G A;  4M9S A;  5ERI A;  3JSO A;  3K1P A;  1OYI A;  3I5U A;  3FWE A;  1ZG1 A;  4OIO F;  1I6X A;  4G6D A;  5LRR A;  1UST A;  3WGI A;  5A2Q K;  1YLF A;  4E70 A;  3WTU C;  1R23 A;  2LDU A;  4B8X A;  1HSJ A;  2P5L C;  1VTN C;  4HF0 A;  5HDK A;  2PQ8 A;  4HLY A;  3ULQ B;  1MDM A;  4KUM A;  1ZLK A;  2O61 A;  2R7D A;  2HQN A;  1HKQ A;  3GVA A;  4AWX B;  1IN8 A;  3VOD A;  2AXL A;  4I09 A;  5FD6 A;  3KP3 A;  3QP5 A;  1D5V A;  2FNP A;  2GA2 A;  2VXZ A;  4ZYG A;  4HDU A;  1MJB A;  2RKH A;  2W85 A;  2XHK A;  3IWZ A;  3RI4 A;  4BH9 A;  2CW0 F;  3HRT A;  2OU2 A;  3ZPL A;  3R0J A;  2P5V A;  2HTJ A;  4UVC A;  1BC7 C;  1DDN A;  5CVU A;  3FXR A;  1ZAO A;  1LNW A;  1U5T C;  2V6C A;  3JAM Z;  4U7D A;  1SFX A;  1WRJ A;  1YW7 A;  3E6B A;  3I59 B;  2OD5 A;  4XSX F;  2P5K A;  1T2K A;  3QRF F;  3HUG A;  5HLH A;  2RV8 A;  4EMS A;  4A12 A;  1Z6R A;  1IXR C;  2LKP A;  4M72 A;  2KJC A;  3LFK A;  4HQE A;  2O8X A;  1T0F A;  1FBU A;  2VT3 A;  3ZN1 A;  1F9N A;  2QYO A;  1DP7 P;  2YX7 A;  4IRI A;  2VE9 A;  4LK1 F;  3F8F A;  1FC3 A;  3ZMD A;  1IN5 A;  4HA8 A;  4HX7 A;  3ZMS A;  3TDZ C;  2L02 A;  1X3U A;  2BV6 A;  3Q5F A;  2D45 A;  1HXD A;  3CDH A;  3WGH A;  3VFZ A;  1XSD A;  4ENK A;  2IRF G;  3N97 A;  3F8B A;  4LB5 A;  2FF4 A;  4A2U A;  1BI0 A;  1O7L A;  3H3Z A;  3DF8 A;  4AIH A;  4MGR A;  4Y17 A;  5D5W B;  2J5P A;  3RIR A;  4KIG A;  3T5X A;  5HS7 A;  1WQ2 A;  4MQ9 F;  2FU4 A;  4ZYH A;  1UHW A;  3SQN A;  2HYF A;  4EJT A;  2DAO A;  1ZG3 A;  3FF5 A;  1OR7 A;  1JHH A;  1KU3 A;  5FFX A;  3E5X A;  1BIB A;  3WTW C;  1TNS A;  1XSX A;  1BN5 A;  3J80 Z;  2XIG A;  5J6X A;  3V4G A;  2XGX A;  3W6J B;  1FLI A;  3G73 A;  1P92 A;  1FWZ A;  3GFI A;  2Z99 A;  1F1Z A;  1J7K A;  3QU3 A;  4AD9 A;  2XAS A;  5HLG A;  2V9V A;  4RB3 C;  5TRD A;  1XMA A;  3LWF A;  5IT9 K;  1YG2 A;  3FM3 A;  1Z7U A;  5LEJ A;  6PAX A;  1IAW A;  3QOP A;  2FE3 A;  1G3S A;  1TW2 A;  1K78 A;  3LA2 A;  4XSZ F;  4KMU X; 
#chains in the Genus database with same CATH topology
 4FCY A;  1A04 A;  1UCR A;  2G0E A;  1HST A;  4OAZ A;  5E18 F;  3CC4 I;  2VJJ A;  3I71 A;  2MFZ A;  1PDN C;  2M30 A;  3WGG A;  3K70 C;  4A0X A;  2QCO A;  3IH3 A;  4UXN A;  4LK0 F;  3VOE A;  3HZJ A;  1FIP A;  4CCK A;  1K7A A;  1USS A;  4CYD A;  1FYK A;  3QQA A;  2HFH A;  3M7G A;  3ZQQ A;  1OPC A;  4BXX J;  2FNA A;  5GPA A;  1WI9 A;  5CPR B;  1GV5 A;  2V1D A;  4OAY A;  3SEQ A;  5DCM B;  3P9K A;  1B6A A;  2GA1 A;  2IAI A;  5AON A;  1SMY F;  3FZV A;  1UEL B;  1RPW A;  1Y8R B;  3BPV A;  3K2Z A;  4WXD A;  2JRM A;  2OZU A;  1IV8 A;  1S7E A;  1ODD A;  2CJJ A;  2XF5 A;  1FOY A;  3HTU A;  5IP9 J;  4KA4 A;  1BI3 A;  4BKX A;  3SDG A;  2VBZ A;  1W4M A;  4PJ0 C;  4L5I A;  2VKV A;  4CUG A;  2DMT A;  2EFP A;  2LH9 A;  4I01 A;  3OY9 A;  1MJA A;  3WE2 A;  3BWG A;  5HLT A;  4LG0 B;  1FOW A;  3DU5 A;  1F5T A;  5D8K B;  4BJT A;  2JWT A;  4MTE A;  2DA5 A;  1PUF B;  2K9N A;  2JA5 J;  3OR1 C;  1RR7 A;  3DP7 A;  2DPD A;  2L5Q A;  5EG0 A;  1Y8Q B;  3GTJ J;  1FTZ A;  1EH7 A;  4LG0 A;  1OYY A;  4XKC A;  4PJL A;  3L1P A;  1WH5 A;  3BRO A;  5ILV A;  1IO2 A;  2A05 A;  4RGR A;  2DYR H;  4HG2 A;  3OIP A;  4UUS B;  2DO7 A;  1BR1 A;  3EUH C;  4A93 J;  2ZXJ A;  5LGT A;  4HNU A;  3EPZ A;  2DPU A;  2ZBK A;  2FA5 A;  2RN7 A;  3EET A;  2ZXI A;  1EH8 A;  2TDX A;  3FXU A;  1HW5 A;  4C3H J;  3HOU J;  4XL9 A;  1Z3Y A;  2XB5 A;  4EV0 A;  1VQM I;  1PYV A;  1MBE A;  4PJM A;  1W7P A;  4B09 A;  4HBL A;  2W7N A;  4YG2 F;  1MKM A;  2RQQ A;  2NYX A;  3S15 J;  2NOG A;  1NHA A;  4L9V A;  3GO5 A;  1ETY A;  2ECB A;  2IS6 A;  2CG4 A;  4O6J A;  5J1U A;  4JX6 A;  3V7R A;  2WAF A;  1IDY A;  3TL4 X;  1IF1 A;  3OYC A;  4GO1 A;  2JVH A;  1KZH A;  5J8C A;  1F36 A;  2YSR A;  1YRN B;  2W24 A;  4ZDL A;  3OOU A;  2XSD C;  2VOD A;  4BY1 J;  4F91 B;  1J2X A;  4BE2 A;  2MH2 A;  2QF7 A;  3A03 A;  3IL2 A;  5JVT A;  3G1M A;  2MD0 A;  2JT1 A;  1XD7 A;  2LY9 A;  1VQO I;  3V8J A;  3HIF A;  3W2W A;  1TTY A;  5CQG A;  1ETX A;  2M9H A;  4A5M A;  5BPD A;  3BG6 A;  2K4J A;  3ABL H;  3D0S A;  4ZYE A;  1AOY A;  1R9T J;  2R7V A;  1O57 A;  4GCV A;  4G94 A;  2HKX A;  3DTI A;  4HDV A;  3BP8 A;  2FBK A;  4C3I J;  4ZTF A;  4M6Y A;  3DFG A;  5ICC A;  3QWL A;  2XGE A;  1NK2 P;  1VQL I;  3QOD A;  3JTH A;  5IT3 A;  2WC2 A;  3LSM A;  3DKY A;  2Q0O A;  5FLX K;  2PG4 A;  1WCM J;  5K5R A;  1JJ8 C;  1B72 B;  3JRC A;  4IOC F;  4KYW A;  1J5Y A;  5F08 A;  4UB8 C;  3HHH A;  1YIJ I;  5F1R A;  2YX4 A;  3CD6 I;  1TQP A;  1IXS B;  2ZME A;  5EZH A;  1B72 A;  3JTG A;  4KMF A;  5L3B A;  1S29 A;  4WCG A;  4M73 A;  3S3O A;  1MW7 A;  1LKX A;  2PI0 A;  3CCR I;  2W82 A;  4A3G J;  1FT9 A;  4EGY A;  2ELK A;  3I9V 2;  3HBL A;  2EIM H;  1HBX G;  4F55 A;  2CUJ A;  3K0L A;  3KEY A;  4H0E A;  4Y7N J;  2FUG 2;  1G6N A;  2KQR A;  4ESB A;  3JRD A;  3WHB A;  4FQG A;  1TLH B;  2R5Z A;  4BE1 A;  1W36 D;  3MKL A;  2IA1 A;  1FPQ A;  2DDB A;  2YR2 A;  2M7A A;  2E2I J;  2JUC A;  4CH7 A;  2ID6 A;  1XCB A;  2DT5 A;  3ELK A;  2H8W A;  4ENJ A;  2VON A;  3GF2 A;  3COA C;  3HDD A;  2GQQ A;  2H6C A;  3U9G A;  5BPI A;  4KN7 X;  2ISY A;  1MZB A;  2OQR A;  5GAG J;  2JPB A;  1U3E M;  1IRZ A;  1U6G A;  3VYT B;  3KZZ A;  3E3V A;  5J40 A;  3S16 J;  1KON A;  4QPQ A;  3IRQ A;  3CP8 A;  2KIF A;  1R5G A;  4XRF A;  2V6E A;  4ENM A;  2A07 F;  3CUQ B;  4A3K J;  2TCT A;  3PO2 J;  1MSF C;  5LHI A;  2W84 A;  3A1Y A;  9ANT A;  3MKW B;  2B0L A;  3L2C A;  4UVB A;  2Z9O A;  3CCS I;  1V4R A;  2R0Q C;  4XNF A;  2JQ7 A;  4F93 B;  2P6T A;  3S2D J;  1UB9 A;  4AIJ A;  4KN4 X;  3H3U A;  4CZC A;  3CCM I;  4LIU A;  3SZP A;  4LMY A;  1ZRC A;  5TGT A;  4HZF A;  3ZMT A;  4JOM A;  2EZL A;  3BR3 A;  3E5U A;  2O8K A;  2EA4 A;  2B7E A;  2FJ1 A;  1Z1D A;  4HF2 A;  3BY6 A;  3K4K A;  3ZCO A;  2V9K A;  3W2V A;  4BDY A;  1D8K A;  2ZXW H;  3MAJ A;  2VBY A;  3S3N A;  3DCF A;  2V1X A;  4WWC A;  3E97 A;  1MH4 A;  3EUK L;  1WKM A;  1VQN I;  3SFZ A;  5E3O A;  2MA3 A;  2P7V B;  1PUE E;  2X51 A;  2LG4 A;  4IL6 C;  5F1J A;  2RC4 A;  3E6C C;  1WVR A;  4ON0 A;  4BY7 J;  4FAS D;  4DBQ A;  2DTZ A;  5FLX Z;  1P6R A;  2IP2 A;  5M5W J;  1BJZ A;  4YFK F;  2F5E A;  4GXO A;  3SHF A;  4DJA A;  3JAM K;  4YRV A;  4EGZ A;  3UR3 C;  1T8I A;  2EIN H;  5EF6 A;  3BQZ A;  4ITV A;  4ESF A;  2R7T A;  5H20 A;  2HEO A;  2PMZ N;  1GT0 C;  1WPK A;  2LF7 A;  3TW6 A;  2ESN A;  5K5O A;  3DEU A;  4LD5 A;  3SZT A;  4Y13 A;  3LQR A;  3OIQ A;  1WH7 A;  1ZEL A;  3TQN A;  3O3K A;  3GZN B;  1TL8 A;  5AIQ A;  3DEE A;  2LMD A;  2AQE A;  1MNM C;  5L3G A;  3F6V A;  2O3F A;  4IZZ A;  3MFK A;  1MSE C;  1FNN A;  3WU0 A;  1XDS A;  2KIM A;  2KRH A;  3BCB A;  1JUP A;  5JFR A;  4MO7 A;  2HVQ A;  5BMZ A;  4B1R A;  3HKZ A;  2CUE A;  2GOX B;  3DTK A;  1IRF A;  2BEO A;  1SD6 A;  2Y0M A;  4ZYA A;  3J7Z I;  5E3N A;  5B1A H;  1TT5 B;  1X4O A;  1R58 A;  3G3Z A;  5KNL A;  3M8J A;  2KRF A;  2DMN A;  2L7K A;  1I27 A;  5EEG A;  1XC5 A;  2C6Y A;  4BHC A;  1POG A;  2X9D A;  2VE8 A;  2GIV A;  3P9I A;  3ABK H;  2DA2 A;  1G8X A;  1K78 B;  5L3D A;  1NG7 A;  1YJ9 I;  2ME6 A;  1R4M B;  3TO7 A;  1B8I B;  1H9G A;  2VI6 A;  2ACJ A;  2FXA A;  1N77 A;  4P9F A;  3W3C A;  2XV4 S;  5ED4 A;  2PBI A;  1D0Z A;  2DOF A;  1PP8 F;  5IYD J;  4RAF A;  2KZG A;  3HYI A;  1R00 A;  1IUY A;  2QSH X;  4ANJ A;  3A0H C;  2R4G A;  4KFC A;  4NC8 A;  3CTA A;  3NAU A;  5JLW A;  4EEF G;  2CYY A;  4EJO A;  3FHZ A;  4X6A J;  2HTS A;  1LE8 A;  5LRS A;  1FBQ A;  4BQO A;  3ZGK A;  1QVT A;  3FIW A;  1BOA A;  5HNH A;  3M1C A;  3D5L A;  1DPR A;  4EAT A;  3DBL B;  3JRI A;  5C44 J;  2O5R A;  3MEX A;  2UV1 A;  3QPH A;  4QPO A;  2P7C B;  2DN0 A;  3B73 A;  2R3S A;  3CJQ B;  4XKW A;  2A5Y B;  4RBO A;  3CO6 C;  4E7H A;  2XB0 X;  1D0Y A;  3ML6 A;  3CCQ I;  3EQL F;  3RZD J;  2ZFU A;  3L2R A;  1PP7 U;  4ZZD A;  4HNT A;  1O3R A;  2HOE A;  3KZY A;  3B6C A;  3KX2 A;  4OIN F;  1S7O A;  2XAF A;  1CQT A;  2NVQ J;  2XAH A;  2EIJ H;  2Y9Z A;  3GZ5 A;  2XAU A;  2CSO A;  2OAZ A;  1WI3 A;  4HX4 A;  4XRS A;  4AUX A;  2XGD A;  3MCZ A;  4DIQ A;  5K1Y A;  3O8H A;  2X6O A;  4I98 B;  2GXG A;  3GXO A;  3RTR A;  2A6H F;  2M34 A;  3L2Q A;  3WTY C;  4XLH A;  3HGG A;  1Z77 A;  2ETH A;  2PJR A;  3PIP F;  2EV5 A;  1UMQ A;  2D2W A;  4HX8 A;  4E7L A;  5TJJ A;  3VSL A;  4A5N A;  2HYJ A;  3DKW A;  5ILS A;  1H0M A;  4N9I A;  1QZZ A;  5J3L A;  1WJA A;  2LFB A;  4II3 A;  4AYB N;  4WXH A;  1ZGJ A;  2I8D A;  5IOY A;  2D5V A;  4CCM A;  2DK8 A;  3EDP A;  4WF2 A;  1MMA A;  2MW8 A;  2JSP A;  2E36 A;  2CWE A;  2EK5 A;  4M9Z A;  4DNC A;  5F0C A;  2W25 A;  4EM1 A;  3ABU A;  1UJ8 A;  5B66 C;  4V19 K;  2BY3 A;  2CRG A;  3PUF A;  2JPC A;  4E7Z A;  3E0J B;  2MC4 A;  2LOO A;  1IXC A;  5L3C A;  3WHC A;  3VDX A;  4IQ4 A;  2GOM A;  2BW3 A;  2P81 A;  2ZSH B;  2VPL A;  1E3O C;  3KP6 A;  3TOB A;  4ABZ A;  2MAB A;  1ZR2 A;  1T98 A;  2M0C A;  2IPQ X;  2KHM A;  2E1O A;  2L2O A;  4GYI A;  3V7C A;  4KJZ A;  1YYV A;  2LKS A;  3ERM A;  5DDG A;  2Y31 A;  2VKE A;  4RS8 A;  2Q2E B;  2HOA A;  3PNY A;  3PSI A;  1W7P B;  4NNJ A;  1Q1H A;  3AAF A;  1OLT A;  3GW2 A;  5FJ8 J;  1BI2 A;  1MJ9 A;  2CO5 A;  2F6C A;  4BAC A;  1XMX A;  2B63 J;  3Q0W A;  1HW2 A;  2F5F A;  2R7X A;  2V7F A;  4NQW B;  3HXL A;  1R49 A;  4KIT B;  4N4O B;  4ZH4 F;  5ILU A;  3CQZ J;  3WTV C;  1FBS A;  3OOP A;  4BNC A;  1XGN A;  3RYP A;  3WG9 A;  1WJ5 A;  4UV9 A;  3DTE A;  4OIP F;  1LVK A;  3JRB A;  2WA0 A;  2VOO A;  5FRM A;  3C2B A;  1EJ9 A;  4NUB A;  4I0B A;  2QQA A;  2NVU B;  1JXS A;  1JGS A;  1YIO A;  3J7A O;  2XKP A;  3REO A;  5GAE J;  4A6D A;  3ECH A;  3OYA A;  4A3C J;  3GTM J;  2DA4 A;  4FX0 A;  1GDT A;  1LEB A;  1C0W A;  3BDD A;  2OQG A;  4G6Q A;  2E1C A;  2QVO A;  5B1B H;  5E3L A;  1P7J A;  3FX3 A;  5K5Q A;  1O7F A;  4E4H A;  3WTS C;  3K4M A;  1SEU A;  4OMY A;  4M3E A;  2KIU A;  3BLY A;  3ZN0 A;  4EJW A;  3M1E A;  2ZME B;  2Y30 A;  2VQG A;  4XN3 A;  3HL2 A;  1SAU A;  3LOC A;  4BUP A;  4HLX A;  3CC7 I;  4WXC A;  3S1M J;  2ELH A;  1IN7 A;  4FTH A;  3F9K A;  2HQ5 A;  2L4A A;  1IDZ A;  5ICF A;  2LRE A;  2HDC A;  3G4S I;  3BR5 A;  5HOO A;  2IA2 A;  2RVC A;  5J4Y A;  2VT2 A;  5DTD A;  2IS1 A;  1ZAR A;  1L3L A;  2EB7 A;  2L3D A;  2QWW A;  2LK2 A;  2VC0 A;  3L7W A;  3A2K A;  3OL3 A;  3KLN A;  3HC7 A;  4HAM A;  1E17 A;  3TKY A;  3PJR A;  1Z05 A;  2G9W A;  3RCO A;  1DPU A;  2MLG A;  4BBS J;  2EH3 A;  2JA8 J;  2VJ4 A;  5LBQ A;  3CJT B;  1GV2 A;  3F6O A;  4L5E A;  4KDP A;  2JMW A;  2GAU A;  3CDL A;  2ICW G;  5CVV A;  2NOJ B;  1U78 A;  3IKV A;  3K1M A;  1QHH D;  4DOZ A;  1RET A;  1R36 A;  4KT6 A;  4AYB A;  2W48 A;  2XPW A;  3IH2 A;  4II2 A;  1KQ0 A;  2WY7 Q;  1HW1 A;  1HOM A;  1T33 A;  4FIS A;  3GWZ A;  1ZRF A;  1XN7 A;  1J59 A;  1FX7 A;  1S9H A;  2DT7 B;  1I1S A;  3ZQG A;  3ZMZ A;  3GFM A;  1O3T A;  1Y1W J;  3FXM A;  5K7Z A;  1ON1 A;  5FLV A;  3IWF A;  1QQI A;  2HVR A;  1FMW A;  3I58 A;  2FML A;  2DYS H;  3DWL E;  5LLQ A;  1LVA A;  3ZQC A;  1FYM A;  1Z67 A;  3RKY A;  1FJL A;  1SAN A;  1X58 A;  1WHU A;  3T0Y A;  2WV1 A;  2XVC A;  2M8G X;  4XN0 A;  5CVJ A;  3OYG A;  2KPM A;  3R0A A;  3I55 I;  1LDK B;  4J01 A;  2UUZ A;  1ON2 A;  1CF7 B;  3HGY A;  3F0C A;  4CYC B;  4ZTJ A;  1HC8 A;  4P55 A;  2K27 A;  3K10 A;  4ETS A;  2G7U A;  2GLO A;  1B1B A;  2HXI A;  3P9C A;  1OJL A;  3A02 A;  1OFC X;  3ESW B;  4CIC A;  4UUT A;  2FSW A;  2PEX A;  3HSE A;  4PZJ A;  3O2P E;  4FHT A;  4CCJ A;  2HQA A;  5DUK A;  4IEJ A;  2HVS A;  1R6R A;  3F8C A;  5KVR A;  3NWS A;  2JVG A;  1NH3 A;  4RAZ A;  2DBB A;  4JX4 A;  5EGO B;  4UUS A;  4AIK A;  4EM2 A;  1XCV A;  2DMQ A;  3CF2 A;  4Q48 A;  2IXS A;  3C3W A;  3RPU D;  2VAS A;  4HQM A;  4ZC3 A;  2M7B A;  4BJ5 C;  3C7J A;  3DPT A;  3HOY J;  1GXQ A;  3RSN A;  3C1D A;  1G3Y A;  4E7J A;  5CLS A;  3ZP5 A;  3F8N A;  2IGN A;  1WFX A;  4UUV A;  4DYC A;  3HRS A;  2LRD A;  5K7F A;  1ONV A;  4FX4 A;  2LTP A;  4IHY A;  4BEH A;  2WWY A;  2QA4 I;  3P7N A;  1K83 J;  3IH4 A;  1V54 H;  1BA5 A;  2MLK A;  1UAA A;  2F48 A;  4N0B A;  2M5W A;  2H09 A;  2DOD A;  1P4W A;  3BTL A;  1A6I A;  2NAZ A;  2X1E A;  4NB5 A;  1V3F A;  1LPQ A;  1YW9 A;  4UB6 C;  3CCL I;  2IJL A;  1JE8 A;  4AVZ A;  3NQO A;  2NNY A;  3QPT A;  1A6Q A;  4B43 A;  1K4S A;  3FBN B;  5DM7 F;  1AA7 A;  2O03 A;  1HF0 A;  1SFK A;  4KIS A;  1IN6 A;  2DTR A;  4JBA A;  4R79 A;  3G6E I;  4B48 A;  3H3V K;  1IRG A;  3V8L A;  2X0L A;  1D5Y A;  5D5U B;  1YI2 I;  2BGC A;  1QNT A;  1Z6T A;  3K4C A;  3IRR A;  5DD4 A;  1KU2 A;  2R5Z B;  1O3S A;  4GYG A;  3WG7 H;  1MDM B;  1HLV A;  1UZC A;  1YW8 A;  1W0T A;  3CP2 A;  2KLO A;  2E34 A;  1TT0 A;  2CS3 A;  1LEA A;  2FOK A;  3C18 A;  3O8G A;  1W36 C;  1JGG A;  3E5Q A;  3CLQ A;  4XRM A;  3JRH A;  1QA6 A;  2KKO A;  1XGS A;  3KP5 A;  4QIW N;  2XRN A;  2Y2Z A;  4A3L J;  2EWN A;  2M4G A;  2RNG A;  2VN2 A;  2BXZ A;  2BVM A;  2QM3 A;  3PUB A;  2WAQ N;  3LMM A;  1R5I D;  3Q0V A;  2VJI A;  3W6K B;  3CES A;  3MZH A;  5BQT A;  3L2W A;  4M3B A;  4TV7 A;  1REP C;  1A36 A;  5DM6 F;  1D3Y A;  4ENN A;  4A3M J;  3WTZ A;  2QEX I;  2PFB A;  1BW5 A;  3CUQ A;  1KYW A;  2HWV A;  2ZNZ A;  4UY8 I;  1YJN I;  1Y6I A;  2E35 A;  1SMT A;  4A3E J;  3NRV A;  2G7H A;  4RM2 A;  2HPI A;  5A2Q Z;  2PJP A;  5BS6 A;  1ZRE A;  3I59 A;  3KFW X;  4I99 C;  2JK3 A;  3S93 A;  3PL8 A;  4HOB A;  2COB A;  1WWX A;  1IN4 A;  4YIR X;  4AVP A;  1QZY A;  3L2U A;  3BZC A;  3MQ0 A;  1RRJ A;  2VJ5 A;  1MGT A;  1ZK8 A;  1UHM A;  2MH9 A;  4KIF A;  3HOT A;  1UFM A;  5JLX A;  3G71 I;  1FMV A;  2IVM A;  3J80 K;  4JK1 X;  2O0Y A;  3B02 A;  3FK6 A;  5F27 A;  1ULY A;  1JUS A;  4BQQ A;  3CCJ I;  3ECO A;  1TQM A;  2OV7 A;  4YEL A;  3GZ6 A;  2PJR B;  1Z91 A;  3FMR A;  2M1B A;  2FBI A;  5GTH C;  3DV8 A;  2XAJ A;  4HW0 A;  1JI8 A;  3A0B C;  4RB1 A;  5BOX A;  4PSX A;  1RES A;  4G7H F;  3FKI J;  2ZNY A;  1W5T A;  2BBY A;  2Y48 A;  3FDY A;  2GZW A;  4D0P A;  5FGM A;  2HKO A;  1F4K A;  3VYR B;  2OBP A;  1KQ9 A;  1MMS A;  1DQU A;  2ZCW A;  3ZXS A;  1MD0 A;  2AO9 A;  2Z16 A;  4CCL A;  5EZG A;  5HNF A;  3OYJ A;  1K6O A;  4BHB A;  3GTP J;  3GX4 X;  3D5R C;  4KIC A;  1GLN A;  3GTK J;  2LY2 A;  4U88 A;  2QQB A;  1SFU A;  4LLN A;  3M07 A;  1ZTR A;  2WAQ A;  3I4N J;  1B59 A;  4HF1 A;  2R7Z J;  1MH3 A;  4W1U A;  3S8P A;  1R71 A;  2MD5 A;  2E1N A;  1OIS A;  4NC6 A;  1YRN A;  3I4P A;  2IS2 A;  4JQF A;  1JJ6 C;  5DCF A;  2K9M A;  2RRE A;  3QAH A;  2HDW A;  2K9S A;  2W1O A;  1ZGA A;  1P2F A;  4Y15 A;  3LAP A;  5C4X J;  2XAG A;  2COM A;  2XGC A;  4CHU A;  4A3J J;  1BW6 A;  2Q2E A;  4P96 A;  4LFU A;  5KAI C;  4XBF A;  5IP6 A;  2E1M B;  3MKZ A;  4N9H A;  2PN6 A;  4DZJ A;  3PO3 J;  2A68 F;  2L01 A;  2L7M P;  1B4A A;  1MNE A;  2L4M A;  3IAS 2;  1O4X A;  3IUO A;  3H9Q A;  3RPQ A;  1Z21 A;  1QRY A;  2GBY A;  4MIM A;  2WAE A;  2R7S A;  1HCR A;  3ONQ A;  4L0Y B;  2ZME C;  2NRA C;  3ERE D;  2DMU A;  2E1M C;  2HZT A;  4IHV A;  2P0W A;  3VWB A;  2RQP A;  3FXL A;  5L3E A;  1Z9C A;  2I10 A;  2LNB A;  2E5N A;  3VB2 A;  1F43 A;  5EDN A;  1HDD C;  1ITY A;  1XTA A;  3IHU A;  1XS9 A;  1J9I A;  4XLC A;  3PSF A;  2F5C A;  3FXK A;  5DUI A;  4CXF A;  2YS9 A;  1TQI A;  3BJ6 A;  2W00 A;  3TP3 A;  4BQN A;  3HTS B;  3F72 A;  3O6B B;  2LVS A;  4DW6 A;  2P4W A;  4MTD A;  2BYV E;  1ERD A;  3ZOB A;  3TW7 A;  3JRE A;  3J81 Z;  2F2E A;  1P7I A;  3OS2 A;  5GAH J;  3H0D A;  4G8X A;  2L54 A;  4LLL A;  2CW8 A;  5LEK A;  2RNJ A;  3KEQ A;  4OU0 A;  4L5J A;  4C9Y A;  3PQK A;  1T39 A;  3LQQ A;  2JSC A;  3BOQ A;  4EJU A;  3K4N A;  2XDV A;  2NNN A;  4UHT A;  3CCV I;  3BR6 A;  2BXY A;  1K61 A;  1BIA A;  4G9Y A;  1S7A A;  4K2E A;  4DQ2 A;  4LGW A;  4B44 A;  1LJ9 A;  1RIO H;  5D5X B;  2XPV A;  1MBG A;  2A6E F;  2VB6 A;  5JHU A;  4G12 A;  1RI7 A;  3MD2 A;  3CUO A;  2YU3 A;  4D9J A;  1VF9 A;  4IKF A;  2K9L A;  4BXF A;  1XGO A;  4JP0 A;  3G1L A;  2LR8 A;  1E2X A;  3TO6 A;  3GYH X;  1OCT C;  2V1U A;  1JTY A;  5D5V B;  3JCU C;  2J5O A;  3M8F A;  2Z3Y A;  3CO7 C;  1ZRD A;  3KE2 A;  4GGG A;  3CME I;  5ICE A;  1T38 A;  3I3L A;  5B3S H;  5M3F J;  2FQ3 A;  3K4L A;  3VSK A;  3L2V A;  4BAY A;  3UKG A;  2HZD A;  2L7Z A;  2NS8 A;  3OIO A;  3F3X A;  4W97 A;  5M5X J;  3JW4 A;  3BG9 A;  3PFI A;  3U21 A;  3DPL C;  2YPR A;  3CC2 I;  2P8T A;  3IKT A;  3A01 B;  4L9J A;  1X1P A;  2DFI A;  1D8J A;  4D5C A;  2EV6 A;  3DPU A;  3OR2 C;  3SFI A;  4RB0 A;  1T6S A;  2JJ7 A;  1VQ6 I;  3EUA A;  1OYW A;  2RGV A;  3WOD F;  5EEA A;  5EG0 B;  1U5T A;  1S8N A;  2K7L A;  1TBX A;  3QYB A;  4G6T B;  3HOZ J;  2ZC2 A;  4MNU A;  1BL0 A;  3CDI A;  1YX3 A;  1Y0U A;  1K79 A;  2DFE A;  1VQ5 I;  1X2N A;  1LDJ A;  4NBQ A;  1SVO A;  4Y4R A;  3BZK A;  4ESJ A;  1G2H A;  3HKZ N;  3FM5 A;  5H6Q A;  2EJR A;  3PQJ A;  1J0R A;  2IA0 A;  3DQV C;  4I7H A;  3KYD B;  1FIA A;  3EYY A;  3H5R A;  4EM0 B;  2KZV A;  1QBJ A;  1S6L A;  2VKD A;  3HOX J;  2RAE A;  3V7S A;  2EPF A;  2V4J C;  2E7X A;  5HOD A;  5AIP A;  3CLO A;  3TDU C;  4DYR A;  3KYL A;  3L00 A;  1MMN A;  4N4N B;  1LUJ B;  1X1D A;  1B9M A;  1Q1V A;  3ZMU A;  5KK1 A;  1SFE A;  2F4I A;  2X48 A;  3AL0 C;  2ISZ A;  4RAY A;  3R61 A;  3LSP A;  1N25 A;  2JUG A;  2P6S A;  3CJN A;  3ROU A;  2A61 A;  2O7O A;  1OCR H;  3K2A A;  3AG3 H;  2I5U A;  4XLN F;  4RAG A;  4KIB A;  2VQL A;  4A3F J;  3HRM A;  3MZY A;  5E8I A;  1ZG5 A;  3GTL J;  1WGX A;  4D7M A;  1XDU A;  1D0X A;  4F92 B;  4G7Z F;  2QBY B;  5EGO A;  2VL8 A;  2KP6 A;  1I39 A;  4HST A;  4FET A;  4HV5 A;  4X0G A;  2DOA A;  2WV0 A;  5LHH A;  2DLL A;  4XM3 A;  3WE3 A;  4R1H A;  2HI3 A;  4RGU A;  2CGP A;  1Y56 A;  1UG0 A;  4U0W A;  2WBM A;  1PVE A;  1ZYR F;  2QQ9 A;  3TOA A;  3BJO A;  4IF4 A;  2VPR A;  1G4D A;  2K86 A;  3G2B A;  5CVI A;  3L9F A;  2BY2 A;  5FB2 A;  3F21 A;  2JA7 J;  2QGU A;  4PJN A;  1GUU A;  5D4R A;  4UNO A;  5HVQ C;  4UVA A;  2CU7 A;  1IUF A;  2BHY A;  4HPQ A;  3QPL A;  4M9X A;  1H9T A;  2FD5 A;  1K4T A;  4E7K A;  2CQK A;  4XKB A;  3S2W A;  4NC7 A;  1ACI A;  3PM1 A;  3ZQ7 A;  5M3M J;  2XSJ C;  2R7F A;  3LA3 A;  2R93 J;  1B9N A;  4XID A;  1JUM A;  2DQL A;  2R5Y A;  1QVU A;  4QWQ A;  4BU2 A;  2MBF A;  2QQ8 A;  2IT0 A;  2KIQ A;  3BJA A;  4J19 A;  1I50 J;  1OCC H;  5BNG A;  3E7L A;  2CV0 A;  3RKX A;  4OIQ F;  3MMY B;  1TWA J;  4CDG A;  3QOE A;  3JRG A;  2R5Y B;  4IRH A;  1BC8 C;  5H6R A;  2FRH A;  4M74 A;  1H88 C;  1JTX A;  4IJA A;  2VBW A;  4YFN F;  4U87 A;  4Q5S F;  2TRT A;  5GTI C;  5DS9 A;  2QUF A;  2OF7 A;  3ZQH A;  3FMQ A;  1V55 H;  2L9R A;  3G1O A;  1RZ4 A;  4DGW B;  5GAD J;  3KP4 A;  2IW5 A;  1SVL A;  3PNT A;  4PK4 A;  1YO5 C;  4A3D J;  1VND A;  1VQP I;  2CQ7 A;  5C3E J;  4LIT A;  1FSH A;  1SD5 A;  1TWG J;  4S04 A;  1QGP A;  1JKQ C;  2STW A;  4MQV A;  2IS4 A;  1WZ2 A;  3QYF A;  2BVL A;  3ZRG A;  4Y52 J;  1R7J A;  3AFH A;  3K69 A;  2FMY A;  3HM5 A;  3GTO J;  4PGG A;  1ZQ3 P;  1U8R A;  4LIV A;  5E1Z B;  2XAQ A;  4ZZL A;  1YQA A;  2HQR A;  2ZJQ F;  1ZKG A;  2EFQ A;  2R7O A;  3PIO F;  2L0K A;  2DU9 A;  1X1C A;  5F64 A;  2UXX A;  1I1G A;  3J7Y J;  3ABM H;  2OA4 A;  2CW7 A;  1YFH A;  1RUN A;  2X6Y A;  3U2R A;  1EA3 A;  1ETQ A;  3BC8 A;  3HG9 A;  3LSJ A;  2XUB A;  1Z7L A;  2E7W A;  4LLG F;  1JHF A;  3GEZ A;  4IQJ A;  5F6F A;  2OZ6 A;  3DKX A;  2XC7 A;  4DYQ A;  2E71 A;  3HHG A;  4L9T A;  3BTJ A;  5DV5 A;  3KLO A;  2OCC H;  2HGC A;  2HR3 A;  4BE0 A;  5HLI A;  2DQR A;  4IOA F;  1TWF J;  1T08 B;  1XMK A;  1I5Z A;  2F5D A;  1AKH B;  2MSY A;  3LA7 A;  3OYN A;  2Q8K A;  1FZP B;  2EA2 A;  5IP7 J;  1Y0N A;  4I6Z A;  3DXJ F;  3R6S A;  4A0Z A;  4BS9 A;  4BGD A;  2ZSI B;  4MEY F;  5KCM A;  2K4B A;  1MIJ A;  5IPA A;  2EV0 A;  3ASN H;  4X1E A;  1CF7 A;  2ESH A;  4IXA A;  3KET A;  1Y39 A;  2BW3 B;  3SXY A;  2K02 A;  2K85 A;  3DBH B;  3OMY A;  4EJV A;  3AKZ A;  1VQ4 I;  1TWH J;  4YIF A;  2DJN A;  4Q4Z F;  4Y3O A;  3WTT C;  4RLQ A;  3CUQ C;  1HQC A;  1NG6 A;  4KT5 C;  2HYG D;  2JA2 A;  3H1C A;  2PMZ A;  2WB1 A;  5DEQ A;  2OC6 A;  3CMM A;  1QO0 D;  2FEZ A;  2NS0 A;  2JZY A;  3FBI B;  1A31 A;  3H9G A;  4MLO A;  3S32 A;  2FBH A;  2JN6 A;  3NEU A;  3J81 K;  1KGS A;  2D1H A;  1RUO A;  2Z33 A;  2LF8 A;  1TC3 C;  1VQK I;  3GTQ J;  4NQW A;  3S1N J;  2Y9Y A;  2PMU A;  2V26 A;  4CO8 A;  3F22 A;  2M2E A;  1VQ7 I;  1FSE A;  1DUX C;  5J8F A;  3X2Q H;  2O9L A;  1PJR A;  3P5J A;  1OCZ H;  4KNY A;  3K4B A;  2F5V A;  3LSG A;  3K9T A;  4RLF A;  2KDZ A;  1L0O C;  1ZN2 A;  2LLK A;  3AL0 B;  1IRX A;  2EQR A;  2E2J J;  3PNV A;  1RNL A;  2PX9 A;  3FK7 A;  1A35 A;  2EIK H;  1WJC A;  3S2H J;  4IO9 F;  1X1B A;  4RGX A;  4IVN A;  2QLZ A;  5M5Y J;  3F23 A;  1DU0 A;  4Z6Y A;  3AG4 H;  4PCQ A;  4A0Y A;  1BM9 A;  3BZ6 A;  3D5S C;  2LBF A;  1P4A A;  2KFD A;  5F0F A;  2ID3 A;  1S72 I;  3H36 A;  1E3P A;  3TO9 A;  3NAR A;  4YII A;  1K6Y A;  1B8I A;  4RB2 C;  3HSR A;  4I76 A;  1TP4 A;  1XB4 A;  3ISP A;  3OV8 A;  4M6X A;  1YJW I;  2ADU A;  2XF7 A;  1KU9 A;  3V42 A;  2H1K A;  2LC2 A;  2HDD A;  4E7S A;  4IRG A;  3RQI A;  3OYM A;  1BBY A;  2KT0 A;  2VKH A;  5DYM A;  3VYU B;  2MG4 A;  4UV8 A;  1J75 A;  2AQF A;  1V5F A;  2D1V A;  3Q3S A;  1LB2 A;  1JKO C;  2E19 A;  2MYS A;  2MGQ A;  3BR2 A;  3HPG A;  4HYE A;  4RA2 A;  5E17 F;  1BI1 A;  4O3M A;  2AXT C;  1D1B A;  2H1L A;  3FXQ A;  3MWM A;  3OYI A;  1XSV A;  1KQ8 A;  5FKK A;  1X4P A;  2XKO A;  3UNG C;  3TBI A;  5CVR A;  2BZT A;  3OYB A;  2JRT A;  1GVJ A;  1OMI A;  3RJP A;  2ZJR F;  4A6E A;  1I3A A;  2M87 A;  4IX7 A;  3QPS A;  4MFE A;  2VC1 A;  4RGS A;  3ZQL A;  2NS7 A;  3KYC B;  4HEA 2;  1H8A C;  4LB6 B;  1IG7 A;  2Z1D A;  4IHS A;  4XON A;  2X6X A;  5CYV A;  3FMS A;  3N4M A;  5L3F A;  2MC3 A;  1T56 A;  3U1K A;  3E6D A;  4IHT A;  4PUS A;  3OS1 A;  2WAD A;  1WSU A;  3U1D A;  1PUF A;  3RDI A;  5D8L B;  2M8E A;  1HKT A;  1ZLJ A;  4ZYD A;  2A3S A;  1NK3 P;  2DXI A;  4C2T A;  3HOV J;  2V79 A;  3RYR A;  3LSR A;  3S1R J;  2KRC A;  3R60 A;  3HJE A;  1BOB A;  3H92 A;  4LG3 A;  3H9J A;  5E20 A;  1JT6 A;  1XPX A;  2M45 A;  3CCU I;  3SJM A;  3AG2 H;  4CZZ A;  2UWM A;  5D4S A;  3M8E A;  2HOT A;  4OMZ A;  3R4K A;  1QHG A;  3V8K A;  2CUZ A;  3L09 A;  4NDL A;  3HOS A;  2PLY A;  4G7O F;  2ZFW A;  3T8T A;  1J09 A;  2QKM B;  2ZJ2 A;  1ZH5 A;  4CA0 A;  4F52 A;  1VFC A;  2O6G E;  2DDA A;  2Z5U A;  3ZQI A;  4O5V A;  4BL0 B;  2FQ4 A;  1E3H A;  3ABT A;  2X1C A;  2X85 A;  1U5T B;  1D1C A;  2JA6 J;  3T8R A;  1X3W B;  4EVI A;  1KU7 A;  4FE7 A;  3Q9V A;  1MMD A;  4CYC A;  4U0Y A;  3QP6 A;  3WTX C;  1AKH A;  3K6G A;  4XMY A;  4L0Z B;  2GXB A;  1M1E B;  4QSH A;  4A69 C;  2CMP A;  1WJD A;  4BJ6 C;  2KL4 A;  2LSO A;  4MHG A;  5KHD A;  2AHQ A;  1KYZ A;  2DI3 A;  2E5Z A;  2VBX A;  1SD7 A;  3W2A A;  3K4J A;  5C4J J;  1BR2 A;  4I0A A;  4BDZ A;  1I6H J;  1MBJ A;  2L9N A;  1YS6 A;  5E1X A;  1A5J A;  1BJA A;  2L9S A;  1U0J A;  5D6E A;  3BR1 A;  5ICG A;  1FOK A;  1SVM A;  3TGN A;  3JSP A;  5IT9 Z;  4FE4 A;  2H94 A;  1SD4 A;  2K3F A;  4ZJZ A;  3LSK A;  4M3G A;  3GFJ A;  5JHF A;  3K7A J;  4P9U A;  3BG3 A;  2IBD A;  4RMN A;  1R1U A;  1W7P D;  1XGM A;  2VXD A;  2F4O B;  4OOI A;  1WJE A;  4CCO A;  1S3J A;  2XRL A;  4PDK A;  3I53 A;  3K1N A;  1YE9 A;  2HXO A;  3QU6 A;  1X2M A;  2BE5 F;  2EFO A;  3OS0 A;  5IYC J;  4E7I A;  4S05 A;  2HS5 A;  4I2O A;  2UZK A;  1ZHF A;  4WK8 F;  1G3W A;  2VQC A;  5J1R A;  2X4H A;  4CGZ A;  3GFL A;  1QZE A;  2BY0 A;  2VLA A;  3KCC A;  3T1B A;  1FP2 A;  5JR3 A;  2CQX A;  3A4C A;  1EH6 A;  4XLE A;  3BR0 A;  4AM3 A;  2JTV A;  2IGM A;  1YHQ I;  3QYE A;  5FKO A;  1BR4 A;  5LGU A;  2CFX A;  2STT A;  5LHG A;  3LSI A;  2DK5 A;  1Z0X A;  3Q0U A;  4M6V A;  1YX5 A;  3SDB A;  5LGN A;  2GIZ A;  5FFZ A;  2BHZ A;  3CMA I;  1KA8 A;  1R1V A;  3F8M A;  2Y75 A;  4A3I J;  1QU3 A;  1EV7 A;  1U2W A;  3OYH A;  2ZO4 A;  4XK4 A;  1YTY A;  4Z2Y A;  4CSW A;  1HKS A;  2L9V A;  2K40 A;  3HSF A;  4H4K C;  2KJB A;  2WY8 Q;  1FY7 A;  2H6B A;  3HRU A;  1RKW A;  1R5H A;  4PFO A;  5FO5 A;  1OKR A;  2QEN A;  1GHC A;  3I54 A;  1XX5 A;  2PMH A;  2AS5 F;  1ORK A;  2LD5 A;  2IGK A;  5HS8 A;  2GWR A;  2OUM A;  2H27 A;  4XOR A;  3H5N A;  5FD5 A;  2A69 F;  4M3F A;  2DT6 A;  3CF5 F;  4I02 A;  2Q1Z B;  4WX9 A;  1TW3 A;  1CGP A;  3RKW A;  4LJZ F;  2M0M A;  4MEX F;  1ZGW A;  4OWR B;  1G59 A;  2DW4 A;  1OCO H;  2EBI A;  1D1A A;  3RPU A;  3LST A;  1RR8 C;  4U0V A;  4BYY A;  2R92 J;  4R8H A;  2DJI A;  2VOP A;  1GVD A;  1R1T A;  1LDD A;  2B9S A;  3MVP A;  2BOL A;  3LL7 A;  3ZR8 X;  1Y1V J;  4YFX F;  5E79 C;  4IPA A;  5EJC A;  1X1A A;  3KP2 A;  1APL C;  3K70 D;  4FT8 A;  4GFB A;  1LFB A;  2NVY J;  3BPX A;  4DBR A;  1X19 A;  5LFA A;  2HOS A;  3LAJ A;  2N8G A;  4JYK A;  5DD8 A;  2NXN B;  3I0T A;  4BQA A;  1G3T A;  2DFF A;  1FOX A;  3EUH A;  4PGH A;  3M9A A;  1IZ1 A;  1P9Q C;  3LNQ A;  4M71 A;  4Q47 A;  1MBH A;  1N75 A;  1DP3 A;  1TWC J;  3KIO A;  4QLC U;  2CV1 A;  3H0G J;  2VUM J;  2ZXH A;  2EZK A;  3HOW J;  5E1W A;  2BY1 A;  3VPR A;  1JT0 A;  4OIR F;  2A5W A;  3BCA A;  5D6F A;  1STZ A;  3GLX A;  2Y0S N;  3KEO A;  3CCY A;  2W57 A;  4MFD A;  1P4X A;  5FKM A;  1AWC A;  1IW7 F;  4L9N A;  5GPC A;  3ZMV A;  2GM4 A;  2EFN A;  4ASN A;  4ZDO A;  1DU6 A;  1H89 C;  1LQ1 A;  3E6M A;  4JX5 A;  2FOW A;  4P5O A;  4XLP F;  3M3Y J;  5KAF C;  3S17 J;  3FKJ A;  1ETW A;  4Y33 A;  1FP1 D;  3TMO A;  1W5S A;  5CJ9 A;  3BG5 A;  2LY1 A;  4L18 B;  5DCM A;  4F7Z A;  1JKP C;  3DBR B;  3SYT A;  3MKY B;  2WTE A;  3BTC A;  3IC7 A;  4F3Q A;  3Q9S A;  1U9O A;  5HDG A;  3VEP A;  3C2G A;  2FX0 A;  1W0U A;  2QKL B;  3WU1 B;  2XRO A;  1DGW Y;  1QPM A;  2UXN A;  3KP7 A;  5F0H A;  3KZI C;  1O3Q A;  5JI6 A;  3W6V A;  5EYR A;  2RDP A;  3OYF A;  4HRI A;  4D5F A;  4C2U A;  3ZQF A;  2EFW A;  2K9Q A;  4BXU A;  1LFU P;  4AU7 A;  1SAX A;  5HDN A;  5FLM J;  2QSF X;  2Z2S B;  1NTC A;  3LFU A;  2DA1 A;  1LFP A;  2QZ8 A;  2A6T A;  3GUD A;  1MBF A;  1TNT A;  2LKX A;  1AU7 A;  3OYK A;  3N05 A;  1XG1 A;  4BHP A;  1YS7 A;  2CQQ A;  3ASO H;  3TP0 A;  2XF6 A;  2KIS A;  3BG7 A;  1FYL A;  3EYI A;  4ZDP A;  1OQY A;  3I64 A;  4EQQ A;  5H2F C;  4J00 A;  4NHJ A;  2ELJ A;  2OJE D;  3DLL F;  3JR9 A;  2QBY A;  2CFO A;  4HV6 A;  5HS9 A;  1GXP A;  2GXA A;  2CH0 A;  5EEH A;  4C3J J;  4U7B A;  1R22 A;  4CCN A;  2ZKZ A;  2YU9 J;  5E8G A;  4M9S A;  5ERI A;  3JSO A;  3FXJ A;  2ZJP F;  3BQY A;  3K1P A;  3FXO A;  1R4N B;  2DFH A;  1OYI A;  3DLA A;  3I5U A;  1OCP A;  3GBG A;  4V2G A;  2X1D A;  3MZ8 A;  1VQ9 I;  3FWE A;  2V1N A;  1ZG1 A;  4OIO F;  1WJB A;  1I6X A;  4G6D A;  5LRR A;  4B47 A;  3RQ4 A;  2DMP A;  1ETK A;  1UST A;  3WGI A;  5A2Q K;  1YIT I;  1YLF A;  4HNV A;  1ETV A;  2DA7 A;  2IEK A;  4E70 A;  2CV2 A;  1IV6 A;  3WTU C;  3RZO J;  3FIS A;  3S3M A;  1DGR M;  3H35 A;  1R23 A;  2LDU A;  1YOV B;  3D1N I;  3HPH A;  1JKR C;  3JRA A;  3CZ6 A;  4B8X A;  2DA6 A;  1HSJ A;  2P5L C;  1UG2 A;  1VTN C;  4AID A;  4HF0 A;  5HDK A;  1S5L C;  4B3A A;  2PQ8 A;  4V2F A;  3I56 I;  5F04 A;  4HLY A;  5K7H A;  1AHD P;  3ULQ B;  1V5G A;  1SFO J;  1MDM A;  4KUM A;  5TIS C;  3SEZ A;  1ZLK A;  2X6W A;  2NVX J;  2O61 A;  2R7D A;  2HQN A;  2LP0 A;  3LSH A;  2E2H J;  1FTT A;  1HKQ A;  3GVA A;  2VQH A;  1MMG A;  3RKQ A;  4AWX B;  1IC8 A;  1IN8 A;  3VOD A;  2AXL A;  4I09 A;  5FD6 A;  3CCE I;  3KP3 A;  3OSF A;  3QP5 A;  3S1Q J;  3GCM A;  1D5V A;  2FNP A;  2GA2 A;  2VXZ A;  2EZI A;  4ZYG A;  2R7W A;  4HDU A;  1MJB A;  2RKH A;  2W85 A;  2XHK A;  4XRS G;  3IWZ A;  1IJW C;  3RI4 A;  4BH9 A;  2HPM A;  2CW0 F;  2LYC A;  3HRT A;  2L7F P;  2OU2 A;  3ZPL A;  3CMY A;  3R0J A;  2P5V A;  2WB1 N;  1VQ8 I;  4M3D A;  2HTJ A;  4UVC A;  1BC7 C;  4IHW A;  4QTR A;  3MN2 A;  1DDN A;  1U9N A;  5CVU A;  3FXR A;  1ZAO A;  1FEX A;  1LNW A;  1U5T C;  2V6C A;  3OSG A;  3HUG B;  3C2H A;  3JAM Z;  3GLL A;  4U7D A;  1ENH A;  4XKV A;  1SFX A;  1WRJ A;  1YW7 A;  2OPT A;  3E6B A;  2OD5 A;  3I59 B;  3A01 A;  4XSX F;  2P5K A;  1T2K A;  1HA8 A;  2ME0 A;  3QRF F;  3HUG A;  3IP4 B;  5HLH A;  2HU9 A;  2RV8 A;  2CUF A;  3CJR B;  4XLA A;  4EMS A;  4A12 A;  3IV5 A;  1Z6R A;  1IXR C;  2LKP A;  4XOP A;  3AG1 H;  4M72 A;  4PSW A;  3HEF A;  2KJC A;  3LFK A;  4IHX A;  2YUS A;  4XIC A;  4HQE A;  5IY5 H;  2O8X A;  1T0F A;  1FBU A;  4XR6 A;  2VT3 A;  1ETO A;  5JVG F;  3ZN1 A;  3TED A;  1F9N A;  2QYO A;  1DP7 P;  2YX7 A;  4IRI A;  5CQE A;  2ECC A;  1T0F C;  4LK1 F;  4D1Q A;  3F8F A;  2VE9 A;  3I4M J;  1FC3 A;  3VYS B;  3ZMD A;  1TZL A;  2K3P A;  2QSG X;  1QPI A;  1IN5 A;  4PFP A;  4HA8 A;  4HX7 A;  5E3M A;  2Y69 H;  1EF4 A;  1EKE A;  3ZMS A;  3TDZ C;  5FRN A;  2EZH A;  2EIL H;  2R7Q A;  5IYB J;  2L02 A;  1X3U A;  1E0E A;  2DCE A;  2BV6 A;  1RC9 A;  5FKN A;  3Q5F A;  2F4M B;  1W5C C;  2D45 A;  4DZP A;  1MBK A;  1HXD A;  1I3Q J;  3B6A A;  4PJJ A;  3CDH A;  3J7A Y;  3WGH A;  3GME A;  3VFZ A;  1XSD A;  2R7U A;  5J4V A;  3GTG J;  2OTJ I;  1VZ0 A;  4ENK A;  2IRF G;  3N97 A;  3F8B A;  4D7N A;  5FKL A;  4E6K G;  3IAM 2;  2FF4 A;  4LB5 A;  1HDP A;  4A2U A;  1BI0 A;  1O7L A;  3H3Z A;  3DF8 A;  1RKT A;  4AIH A;  3S14 J;  4MGR A;  3OL4 A;  3PFY A;  5J47 A;  2W4S A;  4Y17 A;  5D5W B;  3JRF A;  2J5P A;  3KPH A;  3SZG A;  1U8B A;  4XOT A;  4RM3 A;  3RIR A;  4KIG A;  2M3A A;  3T5X A;  5HS7 A;  1WQ2 A;  4MQ9 F;  4BBR J;  1SC7 A;  2FU4 A;  4ZYH A;  1UHW A;  1V5E A;  4XQF A;  3SQN A;  5FRO A;  1Z3X A;  2HYF A;  1W1W E;  2HNH A;  2KMU A;  2VIX A;  2M4K A;  3WU2 C;  4EJT A;  2E60 A;  4GRI A;  4B3X A;  2DAO A;  2H8R A;  1ZG3 A;  1VI0 A;  3FF5 A;  4RDU A;  1OR7 A;  4LOC A;  3M4O J;  1JHH A;  2XPU A;  1T95 A;  1KU3 A;  5FFX A;  3E5X A;  1OR7 C;  1BIB A;  3WTW C;  4B4C A;  1TNS A;  1XSX A;  1BN5 A;  4HSR A;  4P1W A;  3J80 Z;  2XIG A;  5J6X A;  4BEH B;  4C30 A;  3V4G A;  1N78 A;  5B5E C;  2ZB9 A;  2OTL I;  1X3Z B;  2XGX A;  4YEJ A;  3W6J B;  3OYE A;  1FLI A;  5J1Y A;  3G73 A;  1P92 A;  1FWZ A;  3GFI A;  3OYL A;  2Z99 A;  4C2M J;  2DOE A;  3NWT A;  1F1Z A;  1J7K A;  3DU6 A;  1WJF A;  2DA3 A;  3QU3 A;  5LD2 C;  4AD9 A;  2XAS A;  5HLG A;  2V9V A;  3HB9 A;  4RB3 C;  3OYD A;  1MND A;  5TRD A;  1XMA A;  4GDF A;  4A3B J;  3LWF A;  1IGN A;  5IT9 K;  3BT9 A;  2OCE A;  2CQN A;  1YG2 A;  2KDO A;  3FM3 A;  3FHN A;  1Z7U A;  2V9P A;  3H5A A;  5LEJ A;  2IGO A;  1ZR4 A;  6PAX A;  5IOZ A;  2LBF B;  3OWT A;  1LE8 B;  3DEW A;  2NVT J;  2K5C A;  1IAW A;  3QOP A;  1UHS A;  2FE3 A;  3E1S A;  5GP9 A;  1G3S A;  1TW2 A;  4AC0 A;  2R7R A;  3BTI A;  4XLF A;  1K78 A;  2Y0S A;  4S0H B;  3LA2 A;  4XSZ F;  5CKT A;  4KMU X; 
#chains in the Genus database with same CATH homology
 1A04 A;  1UCR A;  1HST A;  5E18 F;  3I71 A;  1PDN C;  2M30 A;  3WGG A;  4A0X A;  4UXN A;  4LK0 F;  3VOE A;  1FYK A;  1K7A A;  1USS A;  4CYD A;  2HFH A;  3M7G A;  1OPC A;  2FNA A;  1WI9 A;  2V1D A;  5DCM B;  3P9K A;  1B6A A;  2GA1 A;  5AON A;  1SMY F;  3FZV A;  3BPV A;  3K2Z A;  4WXD A;  2OZU A;  1ODD A;  3HTU A;  4KA4 A;  1BI3 A;  2VBZ A;  1W4M A;  4L5I A;  2EFP A;  4I01 A;  1MJA A;  3WE2 A;  3BWG A;  4LG0 B;  1F5T A;  5D8K B;  4MTE A;  3DP7 A;  2DPD A;  1EH7 A;  4LG0 A;  1OYY A;  3BRO A;  5ILV A;  4RGR A;  2DO7 A;  2ZXJ A;  5LGT A;  2DPU A;  2ZBK A;  2FA5 A;  2RN7 A;  3EET A;  1EH8 A;  2TDX A;  3FXU A;  1HW5 A;  4EV0 A;  1W7P A;  4B09 A;  4HBL A;  4YG2 F;  1MKM A;  2NYX A;  1NHA A;  4L9V A;  3GO5 A;  2CG4 A;  4O6J A;  3V7R A;  1IF1 A;  4GO1 A;  5J8C A;  2YSR A;  2W24 A;  2VOD A;  1J2X A;  2MH2 A;  3IL2 A;  5JVT A;  2JT1 A;  1XD7 A;  3V8J A;  3HIF A;  1TTY A;  4A5M A;  5BPD A;  2K4J A;  3D0S A;  4ZYE A;  1AOY A;  1O57 A;  4GCV A;  4G94 A;  2HKX A;  4HDV A;  3BP8 A;  2FBK A;  4M6Y A;  3DFG A;  5ICC A;  3JTH A;  5IT3 A;  2WC2 A;  2Q0O A;  5FLX K;  2PG4 A;  5K5R A;  4KYW A;  1J5Y A;  3HHH A;  5F1R A;  2YX4 A;  1TQP A;  1IXS B;  2ZME A;  3JTG A;  4KMF A;  5L3B A;  1S29 A;  4WCG A;  4M73 A;  2PI0 A;  1FT9 A;  4EGY A;  1HBX G;  3K0L A;  4H0E A;  1G6N A;  4ESB A;  1TLH B;  2IA1 A;  1FPQ A;  2YR2 A;  1XCB A;  2DT5 A;  3ELK A;  2VON A;  4ENJ A;  3GF2 A;  3COA C;  2GQQ A;  2H6C A;  3U9G A;  5BPI A;  4KN7 X;  2ISY A;  1MZB A;  2OQR A;  1U3E M;  2JPB A;  1U6G A;  3KZZ A;  3E3V A;  3IRQ A;  2KIF A;  1R5G A;  4XRF A;  4ENM A;  2A07 F;  3CUQ B;  5LHI A;  2W84 A;  2B0L A;  3L2C A;  4UVB A;  2Z9O A;  1V4R A;  2P6T A;  1UB9 A;  4AIJ A;  4KN4 X;  3H3U A;  3SZP A;  4LMY A;  1ZRC A;  4HZF A;  3ZMT A;  3E5U A;  2EA4 A;  1Z1D A;  4HF2 A;  3BY6 A;  1D8K A;  3MAJ A;  2VBY A;  2V1X A;  4WWC A;  3E97 A;  1WKM A;  3SFZ A;  2MA3 A;  2P7V B;  1PUE E;  2RC4 A;  3E6C C;  4ON0 A;  5FLX Z;  1P6R A;  2IP2 A;  4YFK F;  2F5E A;  4GXO A;  3SHF A;  3JAM K;  4EGZ A;  4ESF A;  5H20 A;  2HEO A;  2LF7 A;  2ESN A;  5K5O A;  3DEU A;  4LD5 A;  3SZT A;  4Y13 A;  3LQR A;  3TQN A;  3O3K A;  5AIQ A;  5L3G A;  3F6V A;  2O3F A;  3MFK A;  1FNN A;  3WU0 A;  1XDS A;  2KIM A;  5JFR A;  5BMZ A;  1IRF A;  2BEO A;  1SD6 A;  2Y0M A;  3G3Z A;  1R58 A;  2KRF A;  5EEG A;  1I27 A;  2C6Y A;  4BHC A;  2VE8 A;  2GIV A;  3P9I A;  1K78 B;  5L3D A;  3TO7 A;  1H9G A;  2ACJ A;  2FXA A;  4P9F A;  2XV4 S;  5ED4 A;  2PBI A;  1PP8 F;  3HYI A;  1R00 A;  1IUY A;  4KFC A;  3CTA A;  2CYY A;  4EJO A;  3FHZ A;  2HTS A;  5LRS A;  1FBQ A;  1BOA A;  3D5L A;  1DPR A;  3MEX A;  3QPH A;  2P7C B;  3B73 A;  2R3S A;  2A5Y B;  3CO6 C;  3ML6 A;  3EQL F;  1PP7 U;  4ZZD A;  1O3R A;  2HOE A;  3KZY A;  4OIN F;  1S7O A;  2XAF A;  2XAH A;  3GZ5 A;  2CSO A;  2OAZ A;  4HX4 A;  3MCZ A;  5K1Y A;  4I98 B;  2GXG A;  3GXO A;  3RTR A;  2A6H F;  3WTY C;  2ETH A;  2EV5 A;  4HX8 A;  2D2W A;  5TJJ A;  4A5N A;  3DKW A;  5ILS A;  1H0M A;  4N9I A;  1QZZ A;  4WXH A;  1ZGJ A;  2DK8 A;  3EDP A;  4WF2 A;  2CWE A;  2EK5 A;  4M9Z A;  4DNC A;  2W25 A;  4EM1 A;  3ABU A;  2JPC A;  1IXC A;  5L3C A;  3KP6 A;  3TOB A;  1T98 A;  3V7C A;  2IPQ X;  4GYI A;  1YYV A;  5DDG A;  4RS8 A;  1W7P B;  3AAF A;  1Q1H A;  3GW2 A;  1BI2 A;  1MJ9 A;  2CO5 A;  1HW2 A;  2F5F A;  4ZH4 F;  5ILU A;  3WTV C;  1FBS A;  3OOP A;  4BNC A;  1XGN A;  3RYP A;  3WG9 A;  4UV9 A;  4OIP F;  2VOO A;  4I0B A;  2QQA A;  1JXS A;  1JGS A;  1YIO A;  3J7A O;  2XKP A;  3REO A;  4A6D A;  3ECH A;  4FX0 A;  1LEB A;  1C0W A;  3BDD A;  2OQG A;  4G6Q A;  2E1C A;  2QVO A;  3FX3 A;  5K5Q A;  1O7F A;  3WTS C;  4OMY A;  2KIU A;  3ZN0 A;  4EJW A;  3M1E A;  2ZME B;  4HLX A;  4WXC A;  2ELH A;  1IN7 A;  2L4A A;  5ICF A;  2HDC A;  5HOO A;  2IA2 A;  2RVC A;  2VT2 A;  1ZAR A;  1L3L A;  2EB7 A;  2L3D A;  2QWW A;  2VC0 A;  3L7W A;  3KLN A;  4HAM A;  1E17 A;  3TKY A;  1Z05 A;  2G9W A;  1DPU A;  2MLG A;  5LBQ A;  3F6O A;  4KDP A;  2GAU A;  5CVV A;  1U78 A;  3IKV A;  3K1M A;  1R36 A;  1KQ0 A;  1HW1 A;  3GWZ A;  1ZRF A;  1XN7 A;  1J59 A;  1FX7 A;  1I1S A;  3ZMZ A;  3GFM A;  1O3T A;  1ON1 A;  3IWF A;  1QQI A;  3I58 A;  2FML A;  5LLQ A;  1LVA A;  1FYM A;  3RKY A;  3T0Y A;  2XVC A;  5CVJ A;  3R0A A;  1LDK B;  1ON2 A;  1CF7 B;  4P55 A;  2K27 A;  4ETS A;  2G7U A;  1B1B A;  3P9C A;  4CIC A;  2FSW A;  2PEX A;  3HSE A;  4PZJ A;  3O2P E;  4FHT A;  5DUK A;  3F8C A;  5KVR A;  4RAZ A;  2DBB A;  4AIK A;  4EM2 A;  1XCV A;  4Q48 A;  3C3W A;  4HQM A;  3C7J A;  3DPT A;  1GXQ A;  3C1D A;  1G3Y A;  5CLS A;  3ZP5 A;  3F8N A;  4UUV A;  3HRS A;  1ONV A;  4FX4 A;  2WWY A;  3P7N A;  2MLK A;  4N0B A;  2M5W A;  2H09 A;  1P4W A;  2NAZ A;  4NB5 A;  1V3F A;  1YW9 A;  2IJL A;  1JE8 A;  3NQO A;  2NNY A;  3QPT A;  2O03 A;  1IN6 A;  2DTR A;  4JBA A;  4R79 A;  1IRG A;  3V8L A;  2X0L A;  5D5U B;  2BGC A;  1QNT A;  1Z6T A;  3IRR A;  5DD4 A;  1KU2 A;  1O3S A;  4GYG A;  1MDM B;  1YW8 A;  1LEA A;  2FOK A;  3C18 A;  3E5Q A;  2KKO A;  1XGS A;  3KP5 A;  2XRN A;  2EWN A;  2VN2 A;  2QM3 A;  3W6K B;  3MZH A;  5BQT A;  4TV7 A;  1REP C;  1D3Y A;  4ENN A;  3WTZ A;  2PFB A;  3CUQ A;  1KYW A;  2HWV A;  2ZNZ A;  1SMT A;  3NRV A;  2G7H A;  5A2Q Z;  2PJP A;  5BS6 A;  1ZRE A;  3I59 A;  3KFW X;  4HOB A;  1WWX A;  1IN4 A;  4AVP A;  1QZY A;  3MQ0 A;  1MGT A;  2MH9 A;  1UHM A;  4KIF A;  3HOT A;  1UFM A;  2IVM A;  3J80 K;  4JK1 X;  2O0Y A;  3B02 A;  1ULY A;  3ECO A;  1TQM A;  3GZ6 A;  1Z91 A;  3FMR A;  2M1B A;  2FBI A;  3DV8 A;  2XAJ A;  4HW0 A;  4RB1 A;  5BOX A;  4G7H F;  2ZNY A;  1W5T A;  2BBY A;  2Y48 A;  2GZW A;  4D0P A;  5FGM A;  2HKO A;  1F4K A;  2OBP A;  1KQ9 A;  2ZCW A;  1MD0 A;  1K6O A;  4BHB A;  3GX4 X;  4KIC A;  4U88 A;  2QQB A;  1SFU A;  4LLN A;  1B59 A;  4HF1 A;  2MD5 A;  2E1N A;  3I4P A;  4JQF A;  5DCF A;  3QAH A;  1ZGA A;  1P2F A;  4Y15 A;  3LAP A;  2XAG A;  2COM A;  4CHU A;  2Q2E A;  4P96 A;  4LFU A;  4XBF A;  4N9H A;  2PN6 A;  2A68 F;  2L01 A;  1B4A A;  2L4M A;  3RPQ A;  4L0Y B;  2NRA C;  3ERE D;  2HZT A;  2RQP A;  5L3E A;  1Z9C A;  2LNB A;  3VB2 A;  3IHU A;  1J9I A;  2F5C A;  5DUI A;  4CXF A;  1TQI A;  3BJ6 A;  3HTS B;  3F72 A;  3O6B B;  2P4W A;  4MTD A;  2BYV E;  3J81 Z;  2F2E A;  4G8X A;  2L54 A;  4LLL A;  5LEK A;  2RNJ A;  3KEQ A;  4OU0 A;  4L5J A;  1T39 A;  3PQK A;  3LQQ A;  2JSC A;  3BOQ A;  4EJU A;  2NNN A;  4UHT A;  1BIA A;  4G9Y A;  1S7A A;  4K2E A;  4DQ2 A;  4LGW A;  1LJ9 A;  1RIO H;  5D5X B;  2A6E F;  5JHU A;  1RI7 A;  3CUO A;  2YU3 A;  1XGO A;  1E2X A;  3TO6 A;  3GYH X;  2V1U A;  5D5V B;  2J5O A;  3M8F A;  2Z3Y A;  3CO7 C;  1ZRD A;  3KE2 A;  4GGG A;  5ICE A;  1T38 A;  2FQ3 A;  4BAY A;  3F3X A;  3JW4 A;  3PFI A;  3DPL C;  2YPR A;  2P8T A;  3IKT A;  4L9J A;  2DFI A;  1D8J A;  2EV6 A;  4RB0 A;  1T6S A;  1OYW A;  2RGV A;  3WOD F;  1U5T A;  1S8N A;  2K7L A;  1TBX A;  4MNU A;  1Y0U A;  1K79 A;  1LDJ A;  4ESJ A;  3FM5 A;  5H6Q A;  2EJR A;  3PQJ A;  1J0R A;  2IA0 A;  3DQV C;  4I7H A;  3EYY A;  4EM0 B;  1QBJ A;  1S6L A;  3V7S A;  2E7X A;  5AIP A;  3CLO A;  3TDU C;  3L00 A;  1B9M A;  3ZMU A;  5KK1 A;  1SFE A;  2ISZ A;  4RAY A;  3R61 A;  2P6S A;  3CJN A;  3ROU A;  2A61 A;  4XLN F;  4KIB A;  1ZG5 A;  3HRM A;  3MZY A;  5E8I A;  1XDU A;  4G7Z F;  2QBY B;  4HV5 A;  2WV0 A;  5LHH A;  2DLL A;  3WE3 A;  4R1H A;  4RGU A;  2CGP A;  4U0W A;  1ZYR F;  2QQ9 A;  3TOA A;  3BJO A;  4IF4 A;  1G4D A;  2K86 A;  5CVI A;  3L9F A;  5FB2 A;  3F21 A;  5D4R A;  4UNO A;  5HVQ C;  4UVA A;  4M9X A;  1H9T A;  2CQK A;  3S2W A;  3ZQ7 A;  2R7F A;  3LA3 A;  1B9N A;  2DQL A;  4QWQ A;  2MBF A;  2IT0 A;  3BJA A;  3RKX A;  4OIQ F;  4CDG A;  4IRH A;  1BC8 C;  5H6R A;  2FRH A;  4M74 A;  4IJA A;  2VBW A;  4YFN F;  4Q5S F;  2QUF A;  3FMQ A;  1RZ4 A;  3KP4 A;  2IW5 A;  1YO5 C;  1FSH A;  1SD5 A;  4S04 A;  1QGP A;  2STW A;  4MQV A;  1R7J A;  3K69 A;  2FMY A;  4PGG A;  1U8R A;  4ZZL A;  5E1Z B;  2XAQ A;  1YQA A;  2HQR A;  2EFQ A;  2DU9 A;  5F64 A;  2UXX A;  1I1G A;  2OA4 A;  1YFH A;  1RUN A;  3U2R A;  2XUB A;  2E7W A;  4LLG F;  1JHF A;  3GEZ A;  5F6F A;  2OZ6 A;  3HHG A;  4L9T A;  5DV5 A;  3KLO A;  2HGC A;  2HR3 A;  5HLI A;  2DQR A;  1XMK A;  1I5Z A;  2F5D A;  3LA7 A;  2Q8K A;  1FZP B;  2EA2 A;  3DXJ F;  3R6S A;  4A0Z A;  4MEY F;  2K4B A;  2EV0 A;  1CF7 A;  2ESH A;  4IXA A;  3KET A;  3SXY A;  2K02 A;  4EJV A;  4YIF A;  4Q4Z F;  3WTT C;  3CUQ C;  1HQC A;  4KT5 C;  2HYG D;  5DEQ A;  1QO0 D;  2FEZ A;  2JZY A;  2NS0 A;  2FBH A;  1RUO A;  3NEU A;  3J81 K;  1KGS A;  2D1H A;  2Z33 A;  2LF8 A;  4NQW A;  2PMU A;  4CO8 A;  3F22 A;  1FSE A;  1DUX C;  5J8F A;  4KNY A;  3K9T A;  1L0O C;  1ZN2 A;  1RNL A;  4RGX A;  4IVN A;  2QLZ A;  3F23 A;  4PCQ A;  4A0Y A;  1BM9 A;  3BZ6 A;  1P4A A;  3TO9 A;  4YII A;  4RB2 C;  3HSR A;  1XB4 A;  3ISP A;  3OV8 A;  4M6X A;  2ADU A;  1KU9 A;  4IRG A;  1BBY A;  5DYM A;  4UV8 A;  1J75 A;  2D1V A;  1LB2 A;  4HYE A;  5E17 F;  1BI1 A;  4O3M A;  3FXQ A;  3MWM A;  1XSV A;  1KQ8 A;  2XKO A;  5CVR A;  2JRT A;  1GVJ A;  1OMI A;  3RJP A;  4A6E A;  2M87 A;  2VC1 A;  4RGS A;  4LB6 B;  4IHS A;  5CYV A;  3FMS A;  3N4M A;  5L3F A;  2MC3 A;  3E6D A;  4IHT A;  1WSU A;  3U1D A;  3RDI A;  5D8L B;  2M8E A;  1HKT A;  1ZLJ A;  4ZYD A;  2A3S A;  2V79 A;  3RYR A;  3R60 A;  3H92 A;  5E20 A;  2M45 A;  4CZZ A;  2UWM A;  5D4S A;  3M8E A;  4OMZ A;  3R4K A;  3V8K A;  3L09 A;  3HOS A;  2PLY A;  4G7O F;  2ZFW A;  3T8T A;  1ZH5 A;  2ZJ2 A;  2O6G E;  2Z5U A;  4O5V A;  3ABT A;  1U5T B;  3T8R A;  4EVI A;  1KU7 A;  3Q9V A;  3WTX C;  4U0Y A;  3QP6 A;  4L0Z B;  2GXB A;  2LSO A;  4MHG A;  1KYZ A;  2DI3 A;  2VBX A;  1SD7 A;  4I0A A;  1YS6 A;  5E1X A;  1BJA A;  5D6E A;  5ICG A;  1FOK A;  3TGN A;  3JSP A;  5IT9 Z;  2H94 A;  1SD4 A;  3GFJ A;  4P9U A;  1R1U A;  1W7P D;  1XGM A;  4OOI A;  1S3J A;  4PDK A;  3I53 A;  3K1N A;  3QU6 A;  2BE5 F;  2EFO A;  4I2O A;  4S05 A;  2HS5 A;  2UZK A;  1ZHF A;  4WK8 F;  1G3W A;  2X4H A;  4CGZ A;  3GFL A;  3KCC A;  3T1B A;  1FP2 A;  5JR3 A;  1EH6 A;  2JTV A;  5LGU A;  2CFX A;  2STT A;  5LHG A;  2DK5 A;  5LGN A;  5FFZ A;  1KA8 A;  1R1V A;  3F8M A;  2Y75 A;  1EV7 A;  1U2W A;  2ZO4 A;  1YTY A;  4Z2Y A;  1HKS A;  3HSF A;  2KJB A;  1FY7 A;  2H6B A;  3HRU A;  1R5H A;  5FO5 A;  1OKR A;  2QEN A;  1GHC A;  3I54 A;  2AS5 F;  2PMH A;  5HS8 A;  2GWR A;  2H27 A;  5FD5 A;  2A69 F;  4I02 A;  4WX9 A;  1TW3 A;  1CGP A;  3RKW A;  4LJZ F;  4MEX F;  2DW4 A;  3RPU A;  3LST A;  4U0V A;  4BYY A;  4R8H A;  2VOP A;  1R1T A;  1LDD A;  4YFX F;  4IPA A;  3KP2 A;  4FT8 A;  3BPX A;  3LAJ A;  5DD8 A;  3I0T A;  4BQA A;  1G3T A;  3EUH A;  4PGH A;  3M9A A;  1IZ1 A;  4M71 A;  4Q47 A;  4QLC U;  5E1W A;  4OIR F;  5D6F A;  1STZ A;  3GLX A;  3KEO A;  2W57 A;  1P4X A;  1AWC A;  1IW7 F;  4L9N A;  3ZMV A;  2EFN A;  4ASN A;  1LQ1 A;  3E6M A;  4P5O A;  4XLP F;  1FP1 D;  1W5S A;  5CJ9 A;  4L18 B;  5DCM A;  4F7Z A;  2WTE A;  3IC7 A;  3Q9S A;  5HDG A;  3VEP A;  2XRO A;  3WU1 B;  1QPM A;  2UXN A;  3KP7 A;  1O3Q A;  5JI6 A;  2RDP A;  2EFW A;  4BXU A;  1SAX A;  5HDN A;  3GUD A;  2QZ8 A;  1TNT A;  4BHP A;  1YS7 A;  1FYL A;  3EYI A;  3I64 A;  4EQQ A;  4NHJ A;  2QBY A;  4HV6 A;  5HS9 A;  1GXP A;  5EEH A;  4U7B A;  1R22 A;  2ZKZ A;  5E8G A;  4M9S A;  5ERI A;  3JSO A;  3K1P A;  1OYI A;  3I5U A;  3FWE A;  1ZG1 A;  4OIO F;  1I6X A;  4G6D A;  5LRR A;  1UST A;  3WGI A;  5A2Q K;  1YLF A;  4E70 A;  3WTU C;  1R23 A;  2LDU A;  4B8X A;  1HSJ A;  2P5L C;  1VTN C;  4HF0 A;  5HDK A;  2PQ8 A;  4HLY A;  3ULQ B;  1MDM A;  4KUM A;  1ZLK A;  2O61 A;  2R7D A;  2HQN A;  1HKQ A;  3GVA A;  4AWX B;  1IN8 A;  3VOD A;  2AXL A;  4I09 A;  5FD6 A;  3KP3 A;  3QP5 A;  1D5V A;  2FNP A;  2GA2 A;  2VXZ A;  4ZYG A;  4HDU A;  1MJB A;  2RKH A;  2W85 A;  2XHK A;  3IWZ A;  3RI4 A;  4BH9 A;  2CW0 F;  3HRT A;  2OU2 A;  3ZPL A;  3R0J A;  2P5V A;  2HTJ A;  4UVC A;  1BC7 C;  1DDN A;  5CVU A;  3FXR A;  1ZAO A;  1LNW A;  1U5T C;  2V6C A;  3JAM Z;  4U7D A;  1SFX A;  1WRJ A;  1YW7 A;  3E6B A;  3I59 B;  2OD5 A;  4XSX F;  2P5K A;  1T2K A;  3QRF F;  3HUG A;  5HLH A;  2RV8 A;  4EMS A;  4A12 A;  1Z6R A;  1IXR C;  2LKP A;  4M72 A;  2KJC A;  3LFK A;  4HQE A;  2O8X A;  1T0F A;  1FBU A;  2VT3 A;  3ZN1 A;  1F9N A;  2QYO A;  1DP7 P;  2YX7 A;  4IRI A;  2VE9 A;  4LK1 F;  3F8F A;  1FC3 A;  3ZMD A;  1IN5 A;  4HA8 A;  4HX7 A;  3ZMS A;  3TDZ C;  2L02 A;  1X3U A;  2BV6 A;  3Q5F A;  2D45 A;  1HXD A;  3CDH A;  3WGH A;  3VFZ A;  1XSD A;  4ENK A;  2IRF G;  3N97 A;  3F8B A;  4LB5 A;  2FF4 A;  4A2U A;  1BI0 A;  1O7L A;  3H3Z A;  3DF8 A;  4AIH A;  4MGR A;  4Y17 A;  5D5W B;  2J5P A;  3RIR A;  4KIG A;  3T5X A;  5HS7 A;  1WQ2 A;  4MQ9 F;  2FU4 A;  4ZYH A;  1UHW A;  3SQN A;  2HYF A;  4EJT A;  2DAO A;  1ZG3 A;  3FF5 A;  1OR7 A;  1JHH A;  1KU3 A;  5FFX A;  3E5X A;  1BIB A;  3WTW C;  1TNS A;  1XSX A;  1BN5 A;  3J80 Z;  2XIG A;  5J6X A;  3V4G A;  2XGX A;  3W6J B;  1FLI A;  3G73 A;  1P92 A;  1FWZ A;  3GFI A;  2Z99 A;  1F1Z A;  1J7K A;  3QU3 A;  4AD9 A;  2XAS A;  5HLG A;  2V9V A;  4RB3 C;  5TRD A;  1XMA A;  3LWF A;  5IT9 K;  1YG2 A;  3FM3 A;  1Z7U A;  5LEJ A;  6PAX A;  1IAW A;  3QOP A;  2FE3 A;  1G3S A;  1TW2 A;  1K78 A;  3LA2 A;  4XSZ F;  4KMU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...