2JT1A

Solution nmr structure of pefi (plasmid-encoded fimbriae regulatory) protein from salmonella typhimurium. northeast structural genomics target str82
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
71
Chain Sequence
b'MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PefI protein
publication title Solution NMR structure of the plasmid-encoded fimbriae regulatory protein PefI from Salmonella enterica serovar Typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transcription
total genus 20
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04703 FaeA FaeA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jt1A00
4BH9A 2HTJA 3WG9A 5JHUA 2IPQX 5HDKA 4A2UA 3IKVA 2JPCA 5DUIA 1YW8A 1OPCA 2VONA 4RB2C 2JPBA 1BM9A 3G73A 4IRIA 1U5TA 2HTSA 2VBXA 1MKMA 3BJAA 2FXAA 4BXUA 4BNCA 5HDNA 4HDUA 5FLXK 1QPMA 3GEZA 1KQ9A 1K7AA 1B6AA 4LD5A 1UB9A 2MLKA 4UUVA 5H20A 2A07F 1D5VA 1LB2A 1J9IA 5LHGA 1FPQA 1SMYF 3RKXA 2VBYA 3KEQA 3CUOA 4WXDA 3Q5FA 1STZA 3I59B 3VODA 2A6EF 4LG0B 4UVAA 5D8LB 2ZFWA 4M9XA 1RNLA 4OMYA 1JXSA 2O6GE 2GIVA 4EM1A 2STWA 3BJOA 4L9NA 3KLNA 4E70A 4I02A 4GYGA 1W7PB 2X4HA 4M74A 2V6CA 4EMSA 3P9KA 5HDGA 4KDPA 2DQRA 3V8LA 1R00A 3CUQA 3FMRA 2GA2A 5DD4A 4P9FA 1TLHB 5HS9A 2GAUA 4ZYEA 4L5JA 2P5VA 5L3BA 1B4AA 3IWFA 1PUEE 3KETA 4R8HA 2RQPA 1MGTA 2VXZA 2PG4A 3DEUA 2CW0F 5JR3A 3WU0A 5A2QZ 1W5SA 5JVTA 3Q9VA 3H3UA 1P4WA 2Y75A 2DBBA 3QPTA 4UVBA 2ZMEA 1ZG1A 1J0RA 1UHMA 4ZH4F 3BOQA 2EV6A 4JK1X 3TO6A 3QPHA 1FC3A 2HGCA 4A0YA 1YIOA 4GGGA 2NS0A 1R7JA 2HS5A 1AOYA 3K1MA 4L0ZB 1SD5A 3ZQ7A 1L0OC 5BQTA 3KP3A 1ZN2A 3J80K 1BI1A 3K1NA 3VFZA 4EJOA 5KVRA 4L9JA 2DFIA 4LMYA 3CO7C 1ZAOA 5DEQA 5BOXA 2Q8KA 5ILSA 3B73A 4HLYA 1B9MA 2IVMA 1LVAA 2RKHA 1CF7B 2MBFA 2EV5A 3PFIA 2H94A 3F8BA 3K1PA 4ZYDA 1DDNA 4KYWA 2DO7A 2ZCWA 3R6SA 3M8EA 3F3XA 2W85A 2QUFA 4BHBA 1ZG3A 2ESNA 1KGSA 1QQIA 2ESHA 3EETA 2L02A 4ASNA 4LLLA 1RUNA 1O7FA 4OIRF 2K27A 3WTSC 2PQ8A 3ZN0A 2QZ8A 2GXGA 3RKWA 3C18A 4U7BA 1KYWA 1R1VA 4XRFA 5LLQA 1R5HA 4WF2A 5LGNA 3FXRA 4A5MA 2HR3A 2YSRA 3R0JA 3PQKA 4HX8A 2TDXA 2DAOA 4PDKA 3CDHA 3W6KB 4OMZA 2UXNA 2DW4A 2MH2A 2O61A 1D3YA 5CLSA 5CJ9A 2BV6A 2IT0A 1H9GA 4IJAA 1HW5A 3JTGA 1OYYA 2V79A 2NYXA 3F8NA 2GA1A 1XSVA 3TO7A 3T8TA 1USTA 5L3FA 3FWEA 1YFHA 2EFPA 3DXJF 3GO5A 4G8XA 4CXFA 3JSPA 2C6YA 5FGMA 4LLGF 4LK0F 4MTDA 5E20A 3NEUA 4YFNF 5CYVA 2F5DA 2ADUA 4HV6A 4NQWA 3GZ5A 1EH6A 2RV8A 4LG0A 3RYRA 3SZTA 5FD5A 5CVRA 2G9WA 5E8IA 4KUMA 1F5TA 4XSXF 1HSJA 3QAHA 3D5LA 1P2FA 2JSCA 5J6XA 1W7PA 1NHAA 1Y0UA 3MWMA 3AAFA 5IT9Z 3T0YA 2COMA 2OA4A 3RDIA 3KP5A 3L09A 3KP2A 1OKRA 1XGMA 2IP2A 2P6TA 5BPDA 1ON1A 2KIFA 3KE2A 4U88A 3J80Z 1DPRA 4LLNA 1U78A 2A69F 1T2KA 1RUOA 5CVJA 1FBQA 4RGRA 4Q47A 4RGSA 3J7AO 2RVCA 3QRFF 3MZHA 2JRTA 5LEJA 4G7HF 1KQ8A 3N4MA 4KN4X 3GWZA 4YIFA 2ZKZA 2OAZA 3ZMVA 2JZYA 3M7GA 3SHFA 2F2EA 5E18F 2XAJA 4KA4A 1BOAA 3R60A 1BI3A 1IW7F 2BYVE 1IUYA 3QU3A 3JSOA 2M30A 4KMFA 1J2XA 4I0BA 2XUBA 5K5RA 2AS5F 5LBQA 4ENJA 2HYFA 1YG2A 1FSHA 3HOTA 4XLPF 4KMUX 4G6DA 3LA2A 4Q5SF 3E5XA 2VC1A 5BPIA 3V7RA 4YFKF 5F6FA 3GXOA 4WWCA 1I6XA 3FXQA 4L9VA 2QWWA 1Z6TA 3I71A 2EFNA 2KKOA 2MD5A 1U3EM 3HOSA 2KIMA 2CSOA 4RAZA 4PGGA 1TTYA 4F7ZA 2HFHA 4P9UA 4UXNA 3GFIA 3E6CC 2VOPA 1QZYA 1F4KA 3IRRA 2BEOA 2QLZA 1WQ2A 1RIOH 3T5XA 2FSWA 1MDMA 3BP8A 2HKXA 4Y15A 5LGUA 4KIGA 3L7WA 5HOOA 4FT8A 5JI6A 3IHUA 2R3SA 5L3GA 1HW2A 1O57A 4N9IA 1IF1A 2XIGA 3O6BB 1G4DA 2HZTA 2LNBA 3RPQA 3HTUA 1J75A 3WTUC 2B0LA 4Q48A 2Y48A 3REOA 1U6GA 5FB2A 4GCVA 3KP6A 1S8NA 1X3UA 3TOBA 3WE2A 4AIKA 2Z33A 2E7WA 2DT5A 5HS7A 1BI2A 2H09A 2RC4A 2P5KA 3MCZA 1XN7A 1JE8A 1W7PD 2CQKA 1SMTA 2DK8A 4O3MA 4CDGA 5D5VB 3L9FA 4LFUA 1OMIA 5FFZA 2OQRA 2W24A 3HSEA 1MZBA 4LK1F 4RAYA 4RGXA 1W5TA 1IXSB 4WXHA 2YX4A 2H6BA 3M1EA 1LDDA 2FQ3A 2Z5UA 3GFMA 3D0SA 4YFXF 2HYGD 1WRJA 1IN4A 2W25A 4HF2A 1HKTA 4ZYGA 2Z3YA 3SFZA 1Z9CA 1G3WA 1LQ1A 1K79A 3F72A 4M73A 1C0WA 2Q0OA 1U8RA 3T1BA 4OU0A 3TQNA 3E5QA 2YX7A 3WTXC 4FHTA 4OIOF 4H0EA 3B02A 3LA7A 4EQQA 2LSOA 1B1BA 4IVNA 2ISZA 4I98B 3ABTA 2OBPA 2QENA 3ZP5A 2O3FA 2IA2A 3LQRA 4ETSA 2O0YA 4HOBA 1SFUA 4RB0A 4A6EA 4UHTA 1G3SA 3KZYA 2L54A 4U7DA 3P7NA 1XGOA 4R1HA 1IXRC 5ICGA 2NNYA 4PGHA 2FBHA 4JBAA 4UV8A 1YS7A 3HRMA 1FX7A 3ELKA 1ONVA 1S6LA 3F23A 4IRGA 5ICFA 4HQEA 3KLOA 1B59A 2LDUA 1JGSA 4EM0B 2IA0A 5D5XB 4R79A 4WX9A 2VBWA 4Y17A 5E8GA 4B8XA 3WTTC 2HDCA 4A5NA 4WK8F 2EB7A 4RS8A 2XRNA 2OQGA 3TOAA 4Q4ZF 1KA8A 2P8TA 3O3KA 5DDGA 2VODA 2QVOA 1OYIA 4PCQA 4XSZF 1FOKA 3GYHX 1JHFA 2XVCA 4PZJA 3FM5A 3ML6A 4I0AA 1F9NA 1ULYA 1IN7A 4MNUA 1BC7C 3J81K 1H9TA 5DUKA 4KN7X 1AWCA 4G9YA 2PLYA 5LEKA 4IHTA 3QP6A 1TQPA 3LAJA 1ZGJA 4M9SA 3WTYC 4ZYHA 2PEXA 3S2WA 1S3JA 1QGPA 3H3ZA 5D6EA 4MQ9F 3FMSA 5L3DA 3WGHA 2VBZA 1RI7A 1U5TC 5K1YA 1KU7A 2MH9A 3H92A 1IN6A 4N9HA 3MZYA 2EV0A 2IA1A 1CGPA 1SD4A 3JAMK 1O3RA 5E1XA 1T98A 4HA8A 2DI3A 1LJ9A 3CLOA 4ENNA 1K78A 2D1HA 1D8JA 1RZ4A 1ZLJA 2A5YB 2A61A 1J59A 1LNWA 5FFXA 2K4JA 2M1BA 5IT3A 4IPAA 1XGSA 3RJPA 5FLXZ 2FF4A 4DNCA 4BQAA 3E5UA 3ERED 3IKTA 2QQAA 1Z05A 1KYZA 1LEBA 1HBXG 4EJWA 2QQ9A 2H27A 4BHPA 3IC7A 3ECOA 4YG2F 2HEOA 3IRQA 1XMKA 2LKPA 1BC8C 2FE3A 2XKOA 3E6BA 4M72A 3FXUA 1KU3A 5L3EA 2W84A 3KP4A 4EJTA 2UWMA 1FBSA 4CHUA 5DV5A 2K4BA 4QWQA 2G7HA 3HRTA 2FBKA 2UXXA 3F22A 1YQAA 3TO9A 2PJPA 3EYIA 3BY6A 3NQOA 5J8CA 3I59A 2QQBA 1FP1D 4KIFA 2F5FA 2WWYA 3U9GA 2KIUA 3GVAA 1I1SA 5ICCA 1WWXA 1R1TA 3VOEA 3WTVC 2ZXJA 1T39A 5FO5A 2RNJA 4RGUA 5LRSA 5E1ZB 2J5PA 1OYWA 2DTRA 5HVQC 3F8CA 2QBYB 4NHJA 4HBLA 4IXAA 3R4KA 5ILVA 2BE5F 3N97A 4LGWA 3W6JB 3J81Z 1SAXA 2HKOA 3VEPA 1XSXA 3GF2A 2MLGA 3EQLF 3ZMSA 1DPUA 1WI9A 4U0WA 1BI0A 1K6OA 5E1WA 5ILUA 2HWVA 2ISYA 2EFQA 4HV5A 2E1NA 2KJBA 2PFBA 1I27A 4S05A 1LDKB 2KJCA 2YPRA 5K5QA 1GXPA 4S04A 2XAHA 5H6RA 3MQ0A 2CGPA 1U5TB 3E6MA 4AWXB 1O7LA 1V4RA 2EFOA 2LF7A 4I7HA 2PN6A 4HAMA 2ELHA 3BROA 4WXCA 3GX4X 2LF8A 4LB5A 2IW5A 2OU2A 1EV7A 4HX4A 1WKMA 3HRSA 3V8JA 2UZKA 1XCVA 5HLHA 4I2OA 2EA2A 2H6CA 3O2PE 1G3TA 1CF7A 3PQJA 2KRFA 4GXOA 2BBYA 5D5UB 1SD7A 3KFWX 1J7KA 1ZREA 2R7FA 4HZFA 4B09A 4G7ZF 1SD6A 1HSTA 3KEOA 1Z7UA 3QOPA 3FM3A 3WTZA 4FX0A 1ZGAA 5HLGA 2P5LC 2VC0A 1ZYRF 4P5OA 4IF4A 2K02A 3DPLC 1D8KA 5EEGA 2WV0A 4TV7A 5D8KB 4BAYA 5HLIA 1YW9A 4EV0A 4MGRA 2EFWA 3V8KA 3I4PA 1P92A 2V1XA 1J5YA 3V7CA 3ABUA 1I1GA 2XROA 4I09A 2DLLA 1ON2A 1FWZA 3TGNA 3F8MA 2XGXA 3EDPA 1G6NA 1XB4A 3RPUA 4JQFA 1UFMA 2VT3A 5CVUA 2VE9A 2ZMEB 3HSFA 2L3DA 2OD5A 4DQ2A 1BIBA 1VTNC 1QO0D 3I0TA 1REPC 3WGIA 2ACJA 2M45A 4HQMA 4P55A 1FSEA 1R36A 3DV8A 1G3YA 3ZMTA 1R5GA 3ROUA 1PP7U 2VN2A 2STTA 3CTAA 2XASA 3EUHA 3BWGA 4LJZF 1E17A 4ESJA 1YO5C 1FP2A 1Q1HA 1T0FA 4N0BA 4AVPA 1XGNA 2P4WA 1XMAA 3F8FA 2D45A 3JTHA 4EVIA 4L9TA 4ENMA 1EH7A 1GVJA 1W4MA 4P96A 1QNTA 3LQQA 3P9IA 1KQ0A 3G3ZA 3HUGA 2JT1A 1S7AA 4AIJA 3C1DA 4FX4A 1FYLA 3R61A 2P7CB 1GHCA 2V1UA 5ED4A 3M9AA 1IZ1A 5KK1A 2WC2A 4A12A 1IAWA 3FF5A 5K5OA 3CO6C 2RDPA 2A3SA 3ECHA 1ZLKA 1GXQA 2W57A 3I58A 4IRHA 2ETHA 4XLNF 4O6JA 1U2WA 4Y13A 2D1VA 1H0MA 1XDSA 2FU4A 3BDDA 2ZNZA 2Q2EA 3HYIA 1P4XA 3L00A 3ZMDA 4ZZDA 5BMZA 2HQRA 1LDJA 3RTRA 2O03A 1TW3A 3I53A 5AIQA 4WCGA 1P4AA 2OZ6A 1XDUA 1ODDA 4ENKA 2Y0MA 1ZRCA 1FY7A 2FBIA 1ZARA 3Q9SA 4ZZLA 2J5OA 2PMHA 2K86A 3F6VA 2IRFG 4K2EA 1USSA 3K2ZA 3KZZA 3WODF 4ON0A 3COAC 2VT2A 2CO5A 1A04A 5JFRA 5D4SA 3VB2A 4CICA 4HX7A 1JHHA 2ZBKA 2NAZA 2GZWA 4OINF 1BJAA 1YTYA 4UNOA 2DQLA 1XCBA 4D0PA 1TNSA 5F64A 2K7LA 3CJNA 2CWEA 3L2CA 3HTSB 4UVCA 2L4AA 2CFXA 1BN5A 1YLFA 2Z9OA 4RB1A 3MFKA 4KNYA 1KU9A 2F5EA 4OIPF 1IN5A 5J8FA 2IJLA 2JTVA 2V9VA 4CZZA 3T8RA 3OV8A 5IT9K 4G6QA 2V1DA 2XAFA 2P6SA 5BS6A 4ESFA 4KT5C 3DKWA 3DP7A 3WTWC 1PP8F 1FT9A 3BJ6A 3C7JA 2FEZA 1HQCA 3GLXA 3SXYA 2M87A 5EEHA 2FOKA 4XBFA 3HHHA 5F1RA 4CGZA 3TKYA 1YW7A 1FYKA 1O3SA 3RIRA 3LA3A 2FA5A 3QP5A 1P6RA 3K9TA 4BYYA 2RGVA 3KCCA 5E17F 4QLCU 1FBUA 2VOOA 3V4GA 2OZUA 1Z91A 1IRGA 4KICA 5DYMA 1XSDA 2XKPA 1F1ZA 2WTEA 3ZN1A 1WSUA 2O8XA 3RI4A 2BGCA 3GFLA 5CVIA 3ISPA 2X0LA 3GZ6A 2GQQA 2M5WA 1LEAA 2P7VB 2A6HF 3F21A 4AIHA 5HS8A 5D4RA 1DUXC 5H6QA 3IL2A 3C3WA 3F6OA 2VE8A 2MA3A 2EWNA 2YR2A 3MEXA 5ERIA 3CUQC 2NNNA 2GWRA 5AONA 2MC3A 3M8FA 3K0LA 3HHGA 4MTEA 3BZ6A 3JW4A 1TW2A 1R22A 3FHZA 1MDMB 3WU1B 2DPUA 3HSRA 1ZRDA 4HF1A 2ZNYA 3DPTA 5L3CA 3DF8A 1MJ9A 4BHCA 3OOPA 1YS6A 4HYEA 3IWZA 1L3LA 4CYDA 1ZHFA 4EGZA 1O3TA 2EA4A 2YU3A 1YYVA 3DFGA 1QZZA 1T6SA 4MQVA 2M8EA 2XAQA 1TBXA 2EJRA 2FMYA 3U1DA 2DPDA 1E2XA 3E6DA 1I5ZA 1HKQA 3I54A 2FMLA 4OIQF 1FLIA 2CG4A 4AD9A 5DCMB 4RB3C 1BBYA 2F5CA 3ZMZA 4EJVA 4IHSA 2HQNA 1O3QA 2FNAA 2A68F 1UHWA 3HIFA 4HW0A 3V7SA 4O5VA 4I01A 4M9ZA 2PBIA 2XAGA 4A0ZA 2NRAC 1SFEA 3I64A 2XV4S 4L0YB 1S29A 3SZPA 1MJBA 3E3VA 4CO8A 5DCFA 3EYYA 5FD6A 1QBJA 3WGGA 4G7OF 2QYOA 3TDZC 3FZVA 4KFCA 3JAMZ 4HDVA 1ZH5A 1R1UA 2AXLA 3ZMUA 5LGTA 2E7XA 3E97A 5DD8A 4GYIA 1FZPB 3ULQB 3DQVC 3BPVA 3SQNA 1XD7A 4EM2A 5LHHA 4EGYA 2FNPA 1IN8A 1TQMA 2ZO4A 2EK5A 2ZJ2A 4EJUA 4MEYF 4G94A 3GFJA 1BIAA 4HLXA 5D5WB 4L18B 4MEXF 2QM3A 2HOEA 2RN7A 1R23A 3FX3A 4M6XA 4YIIA 2G7UA 4M6YA 3P9CA 5ICEA 3LFKA 3MAJA 1Z6RA 3CUQB 3LSTA 3ZPLA 3BPXA 1T38A 5LRRA 1ZG5A 3RKYA 5D6FA 1OR7A 3KP7A 1SFXA 5AIPA 3NRVA 1UCRA 4A6DA 2PI0A 2GXBA 3GUDA 1ZRFA 2XHKA 3HRUA 2FRHA 5TJJA 1FYMA 4LB6B 4UV9A 5LHIA 1V3FA 3FMQA 1TNTA 1PDNC 1KU2A 4MHGA 1R58A 3R0AA 4U0VA 1MJAA 4A0XA 3WE3A 2D2WA 3I5UA 3QU6A 5TRDA 5A2QK 1TQIA 1HKSA 2DK5A 1IXCA 2L4MA 4GO1A 3GW2A 3K69A 4NB5A 4ESBA 3LAPA 4L5IA 1B9NA 4Z2YA 1MD0A 2DU9A 4HF0A 3TDUC 3U2RA 1EH8A 4M71A 3RYPA 4KIBA 2R7DA 2CYYA 2QBYA 4U0YA 6PAXA 4OOIA 2Z99A 1K78B 1IRFA 1DP7P 1FNNA 1HW1A 5DCMA 1S7OA 2PMUA 3LWFA 2L01A 1HXDA 1Z1DA 2E1CA 5CVVA
chains in the Genus database with same CATH superfamily
4BH9A 2HTJA 3WG9A 4D1QA 1D0ZA 5JHUA 2IPQX 3ZQIA 5HDKA 4A2UA 3IKVA 3PM1A 2JPCA 5DUIA 5B5EC 2Y0SN 1YW8A 4RAGA 3LSGA 1OPCA 2DDAA 5EJCA 2VONA 4A3DJ 4RB2C 4IL6C 2JPBA 2XGCA 1BM9A 1BR4A 2OJED 3JRBA 2Z1DA 3ESWB 3G73A 4IRIA 1U5TA 2HTSA 3ASOH 3OYGA 3OOUA 3A01A 4B47A 2VBXA 5FLVA 1MKMA 3HXLA 3BJAA 2FXAA 4BXUA 3DTKA 4BNCA 5HDNA 1TP4A 1WJFA 2NOGA 3BTCA 4HDUA 5FLXK 1U0JA 3QWLA 1QPMA 5B1AH 3DTEA 3GEZA 1KQ9A 1UZCA 1K7AA 1B6AA 2AHQA 1TC3C 2R7RA 1FOYA 4LD5A 1UB9A 2MLKA 4UUVA 5C3EJ 5H20A 4E7KA 4BY7J 1UAAA 2L9NA 4NDLA 2A07F 2OTLI 3GTPJ 1D5VA 3VYSB 2JQ7A 1Y1VJ 1LB2A 1J9IA 1POGA 5LHGA 1BA5A 1FPQA 2F5VA 3OYEA 1P7JA 1SANA 1SMYF 3RKXA 2VBYA 4XORA 1UG0A 3KEQA 4NQWB 3CUOA 4WXDA 3Q5FA 2EPFA 2M9HA 1S72I 3OYCA 1A36A 3QYBA 1STZA 3I59B 3VODA 3FISA 1BW6A 2A6EF 4ABZA 1ORKA 3TP0A 4LG0B 4UVAA 2KIQA 5D8LB 1X3ZB 1JKQC 2ZFWA 4M9XA 2XPVA 3CMMA 1S9HA 1RNLA 4OMYA 1WPKA 1JXSA 2O6GE 2GIVA 1RKTA 4EM1A 2STWA 3BJOA 3DWLE 1N77A 4L9NA 3M3YJ 3KLNA 4E70A 4JOMA 4I02A 4GYGA 1W7PB 2X4HA 4M74A 2V6CA 2ICWG 2R7SA 4EMSA 3AL0B 3P9KA 5HDGA 4KDPA 3J7AY 3V8LA 1R00A 2LREA 2MGQA 3UNGC 3CUQA 3FMRA 1NTCA 2GA2A 5DD4A 1W36D 4P9FA 1TLHB 1APLC 4MFEA 4ZJZA 1F43A 5HS9A 1T0FC 2GAUA 2KDZA 4ZYEA 3S1RJ 1K4TA 4L5JA 2P5VA 4FASD 5L3BA 1B72A 2RQQA 5FROA 1B4AA 1MBGA 2DN0A 3HG9A 3ZRGA 3IWFA 1JI8A 1PUEE 3KETA 2ZJQF 4R8HA 3RPUD 2NS7A 3S1QJ 2RQPA 1MGTA 2VXZA 2PG4A 3DEUA 2CW0F 5JR3A 3FBNB 1X1BA 3JRDA 5EG0A 4FE7A 2CW8A 4XMYA 3WU0A 4PSXA 5A2QZ 1W5SA 5JVTA 2Z16A 2Y2ZA 3IH3A 3Q9VA 3H3UA 3TW6A 1GUUA 2R5ZA 2I8DA 1P4WA 4RLQA 2MYSA 3W2AA 2Y75A 2DBBA 2A6TA 4IOAF 3QPTA 4UVBA 1XG1A 2ZMEA 1ZG1A 1J0RA 1UHMA 3KZIC 4ZH4F 2E2HJ 4AC0A 3BOQA 2EV6A 3PL8A 4JK1X 3TO6A 3EUKL 2NXNB 3QPHA 1FC3A 2CUJA 2O8KA 2HGCA 4A0YA 1YIOA 4DBQA 4GGGA 2NS0A 5H2FC 3B6CA 4IQ4A 1R7JA 2JVHA 5JLXA 2HS5A 4GDFA 1AOYA 3K1MA 4L0ZB 1B8IA 1SD5A 3AG3H 3ZQ7A 1L0OC 5BQTA 3KP3A 3I3LA 4C2MJ 1ZN2A 3J80K 2GLOA 2VI6A 3RZOJ 1BI1A 3K1NA 3VFZA 4EJOA 5KVRA 1E3PA 4L9JA 2DFIA 4LMYA 3CO7C 4AYBN 1TT5B 2O7OA 1ZAOA 5DEQA 2DOAA 5BOXA 1MBHA 3K4BA 5EYRA 3AG1H 3ZOBA 4M3EA 4NC6A 2Q8KA 5ILSA 1I6HJ 3HC7A 3B73A 4HLYA 1B9MA 2EINH 3CP2A 2IVMA 2M34A 3OL3A 5KAFC 1LVAA 2RKHA 2QA4I 2AQEA 4F55A 3JREA 4XLAA 4ZTJA 1T8IA 1CF7B 2KZVA 2MBFA 3PUBA 3IP4B 5CPRB 2EV5A 4DZJA 3PFIA 3U21A 2H94A 2HVRA 3F8BA 3K1PA 4ZYDA 2V1NA 3J7YJ 1DDNA 2K9NA 3E7LA 2BXZA 4KYWA 4FE4A 2DO7A 2ZCWA 3R6SA 3M8EA 3F3XA 2CH0A 2W85A 3BTIA 2QUFA 4XRMA 4BHBA 1ZG3A 2ESNA 1KGSA 3IH4A 1QQIA 2LY2A 2ZXHA 3RCOA 2ESHA 3EETA 3DKYA 2L02A 4ASNA 4LLLA 5HNHA 1RUNA 1O7FA 1KZHA 4OIRF 2K27A 4HSTA 4M6VA 1ETWA 1V5GA 3WTSC 1JJ8C 1KONA 1BL0A 1HA8A 2ECCA 4IEJA 2PQ8A 3ZN0A 2QZ8A 4PFPA 5B66C 1RPWA 2GXGA 3RKWA 5K7FA 3C18A 4U7BA 2PX9A 1KYWA 1R1VA 3HOXJ 4I6ZA 3JRAA 1FIPA 2LC2A 1UELB 4XRFA 1MMDA 5LLQA 1R5HA 1WHUA 2XB5A 4WF2A 5LGNA 1HLVA 2QCOA 3FXRA 3CCSI 3WG7H 1CQTA 4A5MA 5K7HA 2HR3A 2YSRA 3R0JA 3HOZJ 3PQKA 3ZQGA 1A6QA 4HX8A 2TDXA 2DAOA 3A02A 2X1CA 4PDKA 2ME0A 2W4SA 3CDHA 3W6KB 5IOZA 1S5LC 1SFOJ 4C3HJ 4DYQA 5GPCA 4OMZA 1FOXA 3D5SC 2UXNA 2DW4A 5EZGA 1Z7LA 2MH2A 3K4MA 2XSDC 2O61A 1D3YA 5CLSA 3U1KA 4A3MJ 3H35A 5CJ9A 2BV6A 4A69C 2IT0A 1H9GA 4IJAA 2K9SA 1ETVA 3ERMA 3S93A 5K7ZA 1HW5A 4E7LA 3HOYJ 3X2QH 3JTGA 1OYYA 2V79A 2NYXA 3F8NA 4OAYA 3TBIA 1IC8A 3GCMA 2GA1A 1XSVA 2XAUA 2WAQN 3TO7A 3T8TA 1USTA 5L3FA 3FWEA 1YFHA 2EFPA 3DXJF 2KT0A 3GO5A 4G8XA 2R93J 2YS9A 4CXFA 3JSPA 2C6YA 2VIXA 5FGMA 4LLGF 4LK0F 4MTDA 3K10A 2JA2A 5E20A 3NEUA 2JA8J 4YFNF 5CYVA 2F5DA 2ADUA 4HV6A 4NQWA 3GZ5A 1EH6A 4A3CJ 4Z6YA 1JUSA 1IO2A 2DA4A 2RV8A 4W1UA 2XDVA 4LG0A 2LBFB 3RYRA 3OS0A 1NG7A 2DT6A 4M3GA 3SZTA 2E2JJ 5FD5A 2CUZA 4XLHA 5CVRA 2G9WA 5E8IA 9ANTA 4I76A 3HEFA 4KUMA 1F5TA 3KYCB 1DQUA 4XSXF 1HSJA 3QAHA 3D5LA 4DOZA 1P2FA 1JUMA 5E3NA 2JSCA 5J6XA 4BDZA 1W7PA 4RM2A 1NHAA 3K2AA 3WHBA 1VZ0A 3CMYA 1Y0UA 3MWMA 3AAFA 2M0MA 5IT9Z 3T0YA 2JA6J 2COMA 2OA4A 3RDIA 2X6WA 2HXOA 4W97A 3KP5A 3L09A 3KP2A 1MNMC 1MMAA 1W5CC 2WADA 3H9QA 1ERDA 1JT6A 3E0JB 1OKRA 5J1UA 3CP8A 1MH4A 2L7KA 1MW7A 3S16J 5IP9J 3MD2A 1XGMA 2ME6A 4S0HB 3LSJA 2IP2A 2NVQJ 2P6TA 3C2BA 4NUBA 5BPDA 1ON1A 3OYMA 3VYUB 5E3LA 2KIFA 3KE2A 3G2BA 4U88A 3J80Z 1DPRA 1TWHJ 4LLNA 3LSIA 3FK7A 3I4MJ 1U78A 2A69F 1T2KA 1RUOA 5CVJA 2VLAA 3OMYA 1FBQA 3H9JA 4RGRA 4Q47A 4B44A 4BS9A 1W0TA 4RGSA 3J7AO 2RVCA 3N05A 3QRFF 1BOBA 2BVLA 4N4OB 3M1CA 2M0CA 3MZHA 2MABA 3VSLA 2JRTA 4NC8A 5LEJA 4G7HF 1KQ8A 3MMYB 3CF5F 5M5XJ 3N4MA 3CCUI 4KN4X 2OUMA 4PJ0C 4CYCB 3OL4A 4UB6C 3GWZA 2IAIA 5FLMJ 4YIFA 1FTZA 2ZKZA 2OAZA 3ZMVA 2EBIA 2JZYA 3M7GA 3SHFA 2F2EA 1IDYA 3JRIA 2BW3A 4BJ5C 5E18F 2XAJA 3Q0UA 1W1WE 4KA4A 1BOAA 1XX5A 2PMZN 3CMEI 3R60A 3KYDB 1BI3A 1IW7F 1D1CA 2BYVE 1WCMJ 3BT9A 1LPQA 2KP6A 1IUYA 4DBRA 5J47A 3QU3A 4XOPA 3JSOA 2M30A 4KMFA 2EIMH 4XICA 1J2XA 4MFDA 4E7IA 4I0BA 1DGWY 4C2TA 2AQFA 2XUBA 2DMNA 3MVPA 5K5RA 2AS5F 3JRHA 1W0UA 1DU0A 2BOLA 5LBQA 4ENJA 4F93B 3VYTB 2HYFA 2NOJB 1G59A 5IYDJ 1YG2A 1FSHA 2LG4A 2NS8A 3HOTA 4XLPF 3KX2A 4KMUX 4G6DA 1N75A 2N8GA 3LA2A 4A3KJ 1MBKA 4Q5SF 1VQ8I 3E5XA 2IBDA 2VC1A 5BPIA 4LITA 2V26A 4D7NA 4QPOA 3CZ6A 3V7RA 1R71A 4IOCF 4YFKF 5F6FA 4B3AA 1FTTA 1Y56A 3GXOA 2X6XA 4WWCA 3CC2I 4V19K 2L9RA 1I6XA 3FXQA 4L9VA 2M7BA 2QWWA 2DFEA 1Z6TA 3W2VA 3BZCA 3I71A 2EFNA 2KKOA 2MD5A 4PUSA 2GM4A 1U3EM 2VQCA 3HOSA 2KIMA 3JRCA 2CSOA 3S15J 2OTJI 3S3NA 4HEA2 1TWCJ 4RAZA 3BR0A 2WB1A 3FKIJ 3QYFA 4PGGA 1LUJB 5F08A 2GOXB 1TTYA 4F7ZA 3S8PA 3HM5A 5LD2C 2HFHA 4OWRB 4XOTA 1A31A 4P9UA 3F0CA 4A3BJ 4UXNA 5CVVA 3HPHA 3GFIA 3E6CC 4B48A 2VOPA 1QZYA 1F4KA 2E1OA 1X1AA 1ETQA 2BEOA 2BXYA 1WQ2A 1SVOA 2QLZA 3IRRA 1PUFA 4RA2A 3CCJI 1RIOH 3T5XA 2FSWA 1MDMA 3BP8A 4C2UA 3HOVJ 4AU7A 2HKXA 4Y15A 5LGUA 1WJDA 2V6EA 4KIGA 4P1WA 5TGTA 1VQPI 4IHXA 1YX3A 1YE9A 2L0KA 3L7WA 5HOOA 3H1CA 3HKZA 3I55I 2LY9A 4F52A 1VQ5I 4FT8A 5JI6A 3IHUA 2OF7A 5IP7J 3ONQA 2R3SA 5L3GA 1HW2A 1O57A 2BY2A 4N9IA 1IF1A 3AKZA 2LH9A 3PUFA 3DEWA 5E3MA 5FKMA 1XPXA 1Y8RB 2XIGA 3O6BB 1G4DA 2HZTA 2LNBA 4YEJA 2EIJH 3RPQA 3HTUA 3RQIA 1Y8QB 3PJRA 2DJNA 1PYVA 1J75A 3Q3SA 3WTUC 2B0LA 4Q48A 4AIDA 4BJ6C 2TRTA 2Y48A 5M3MJ 3REOA 2F4OB 1U6GA 3CJQB 5FB2A 4GCVA 3M8JA 3LSKA 3E1SA 1R4MB 3HL2A 3KP6A 1X4OA 1S8NA 3JRFA 4CZCA 3PSFA 1AKHB 5GADJ 1X3UA 4XL9A 1V5EA 3TOBA 3WE2A 5J40A 4ZDLA 2HOTA 1IUFA 4M3DA 3DU6A 3CCQI 4AIKA 2Z33A 3H9GA 2E7WA 2M4GA 2DT5A 5HS7A 1BI2A 2DOFA 2H09A 2RC4A 1OLTA 2P5KA 4XIDA 1SEUA 3MCZA 1XN7A 2EZLA 2WAFA 4N4NB 1JE8A 2VPLA 4PFOA 1W7PD 4XK4A 2VKHA 2CQKA 1SMTA 2DK8A 4CCMA 3CCYA 5LFAA 4O3MA 1OJLA 5KNLA 1TT0A 3L2WA 4CDGA 5D5VB 1UHSA 2HOAA 1HDDC 3L9FA 4LFUA 1OMIA 5FFZA 2OQRA 2W24A 1WJAA 3HSEA 1MZBA 4LK1F 4RAYA 4RGXA 3OYKA 1W5TA 1IXSB 4WXHA 3H36A 2VJIA 2YX4A 2H6BA 3G1LA 3M4OJ 4HNVA 2JVGA 3M1EA 4BE0A 1LDDA 2FQ3A 2Z5UA 1ETYA 1IDZA 2I5UA 3GFMA 1VQ6I 3D0SA 4YFXF 2HYGD 1VI0A 1QU3A 1WRJA 3TEDA 1IN4A 2XSJC 1WJBA 2W25A 4HF2A 1FEXA 5J1RA 1HKTA 2DMPA 1MBEA 5J4VA 1OCZH 4C3IJ 4AUXA 2L7MP 2Z3YA 4ZYGA 3SFZA 1Z9CA 2CV1A 1G3WA 1LQ1A 1K79A 3F72A 4M73A 1ZKGA 1C0WA 2AXTC 1N78A 1FIAA 2Q0OA 2LKXA 3JR9A 1X4PA 3DBHB 1U8RA 3T1BA 5C4XJ 4FQGA 4OU0A 5F0FA 4BEHA 2VASA 5EGOA 3L1PA 3TQNA 3E5QA 2QKLB 2YX7A 1W36C 3K4JA 3WTXC 4FHTA 5F0CA 4OIOF 2EQRA 1OR7C 2NVUB 4H0EA 2HPMA 3B02A 2CJJA 2DYSH 2LKSA 3LA7A 1UMQA 2IXSA 2Q1ZB 4EQQA 1AU7A 3LSHA 2LSOA 4E4HA 2BY0A 1B1BA 4BACA 1Z21A 4IVNA 3PSIA 1Y6IA 2ISZA 5KAIC 4I98B 3ABTA 4F92B 2OBPA 4LIVA 2QENA 4MO7A 3ZP5A 2O3FA 2WV1A 4ANJA 2IA2A 3LQRA 4ETSA 2O0YA 4HOBA 2WY7Q 4RB0A 4QTRA 1SFUA 4A6EA 3M07A 4UHTA 1HCRA 2V9PA 5JVGF 1G3SA 2H1LA 3KZYA 4DIQA 2L54A 4XN0A 3GTJJ 3TL4X 4U7DA 3P7NA 1XGOA 3HB9A 2E36A 4R1HA 1IXRC 5ICGA 2NNYA 4PGHA 2FBHA 3S3MA 4JBAA 1AA7A 4UV8A 3ZQCA 2ZC2A 1YS7A 5EF6A 3QPLA 1Z67A 3HRMA 5GAGJ 1HOMA 1FX7A 4RBOA 2Y30A 3ELKA 1YRNA 1ONVA 1S6LA 4NC7A 3F23A 4IRGA 5ICFA 3FHNA 4HQEA 3EUHC 3KLOA 2E5ZA 3RSNA 1I39A 3VDXA 1B59A 2LDUA 2FD5A 4MLOA 3MKZA 2FUG2 1WJ5A 1JGSA 5CKTA 4EM0B 3L2QA 2V4JC 2IA0A 5D5XB 4R79A 4WX9A 2VBWA 3MKLA 4BKXA 3PNTA 4Y17A 2JA7J 5E8GA 1IJWC 2R7VA 3HOUJ 1LFBA 4B8XA 3WTTC 3LNQA 2HDCA 1R9TJ 4A5NA 4WK8F 2EB7A 4RS8A 2XRNA 2OQGA 3TOAA 3OIQA 1OISA 4Q4ZF 1KA8A 2P8TA 2JMWA 1MNDA 3O3KA 2Y69H 5DDGA 2VODA 2QVOA 4IHVA 1YITI 3SZGA 1FMWA 1OYIA 3MKWB 1QRYA 4PCQA 2E34A 4XSZF 1FOKA 3GYHX 3BR1A 4BXFA 1JHFA 5HODA 4FTHA 1RKWA 4UUTA 2XVCA 4PZJA 2R5YA 3FM5A 3ML6A 4I0AA 1F9NA 1ULYA 4CH7A 4HG2A 1IN7A 4BDYA 2QEXI 4MNUA 3OYIA 1BC7C 5FRNA 3OY9A 2HDWA 2B9SA 4IHYA 2TCTA 3J81K 1H9TA 3H5NA 2Y9YA 5DUKA 4KN7X 1AWCA 4G9YA 3GTMJ 2PLYA 5LEKA 4IHTA 2DA1A 3QP6A 4B43A 3FXKA 1TQPA 2XRLA 3ZQHA 1ZGJA 3LAJA 2HVSA 3OIPA 4BE2A 1LFUP 4M9SA 5FKKA 5J3LA 4A3LJ 2GXAA 3WTYC 4ZYHA 3G6EI 2PEXA 3S2WA 1S3JA 1QGPA 3H3ZA 5D6EA 4MQ9F 3FMSA 4C9YA 5L3DA 5EDNA 3BG5A 1QHHD 1IRZA 3BCAA 1ZELA 4D9JA 1VNDA 1BW5A 2BHYA 3MZ8A 3WGHA 2DA5A 1JUPA 1XS9A 2HPIA 3HOWJ 2VBZA 4FCYA 2KDOA 1RI7A 1U5TC 5K1YA 1KU7A 1FMVA 2MH9A 3K70D 3H92A 2UV1A 3HPGA 3DLAA 3GMEA 1IN6A 2R7TA 4JX5A 1MMSA 4N9HA 4D5FA 2W48A 2P81A 4KT6A 2W00A 3MZYA 1VQOI 2EV0A 2IA1A 1AKHA 1CGPA 1SD4A 1VQLI 3JAMK 4XNFA 5GAHJ 2MSYA 2E1MC 3AG2H 3CDIA 3KEYA 5E1XA 1O3RA 1SFKA 1T98A 4QIWN 2EH3A 3I56I 4HA8A 4PSWA 1SVLA 2FX0A 2DI3A 1LJ9A 2KL4A 3CLOA 4ENNA 1K78A 2QSGX 2D1HA 3MKYB 2DJIA 1D8JA 1RZ4A 3SDBA 4XKVA 5E79C 2IS4A 1DP3A 1J09A 1ZLJA 4NBQA 2A5YB 2A61A 3G71I 1J59A 2ELJA 3K6GA 4XKWA 1LNWA 1NK3P 1WH5A 5FFXA 2K4JA 2M1BA 5IT3A 3RZDJ 4IPAA 1XGSA 3RJPA 2E5NA 3NAUA 5FLXZ 2FF4A 1X3WB 2F4IA 4Y4RA 3Q0WA 1JTYA 2JWTA 4DNCA 4BQAA 3QYEA 3E5UA 4G12A 2IGMA 2R4GA 2DXIA 3SDGA 2ZFUA 3ZQFA 3ERED 2MW8A 3IKTA 5FKNA 2QQAA 1Z05A 2DODA 3NWSA 1I3QJ 4BY1J 1KYZA 1LEBA 2DCEA 2CQQA 1NH3A 4CUGA 1H8AC 4E7ZA 2LTPA 1HBXG 4EJWA 2QQ9A 4A3EJ 1H88C 2H27A 3BG7A 1AHDP 4CSWA 3P5JA 4BHPA 3FXLA 3IC7A 3VYRB 3ECOA 4YG2F 3SJMA 2HEOA 2F4MB 4UY8I 3IRQA 1XMKA 2LKPA 2HQAA 1BC8C 2FE3A 2JN6A 1X19A 1R5ID 2XKOA 3E6BA 4M72A 1T08B 3FXUA 3ZQLA 1KU3A 3TP3A 5L3EA 2W7NA 1ZTRA 2W84A 5F0HA 3KP4A 4EJTA 2UWMA 1FBSA 4CHUA 4KITB 5DV5A 2K4BA 1WZ2A 1QPIA 4QWQA 2G7HA 5J1YA 3HRTA 5KCMA 2FBKA 4EEFG 2UXXA 3F22A 1YQAA 3TO9A 2VJ5A 2PJPA 3EYIA 3BY6A 3NQOA 1E3HA 1RR8C 2M3AA 3I59A 5J8CA 4AYBA 2QQBA 2ZMEC 1FP1D 2IGNA 3OYDA 2JUCA 4KIFA 2K5CA 2F5FA 2H1KA 2WWYA 3U9GA 1Z3XA 2KIUA 3SEZA 3GVAA 2E19A 2ECBA 1I1SA 1QHGA 5ICCA 1WWXA 1R1TA 3VOEA 4XLEA 3WTVC 3WU2C 2ZXJA 2BHZA 1T39A 3DKXA 5FO5A 2RNJA 4RGUA 4V2FA 5FKLA 5LRSA 1MBFA 1Y1WJ 5E1ZB 5FJ8J 2J5PA 1OYWA 1V55H 3Q0VA 2DTRA 3SEQA 3OYNA 2M4KA 4Y7NJ 5HVQC 3F8CA 2IGKA 1U9NA 2KRCA 3FXOA 4ZYAA 3GTLJ 3HUGB 2KFDA 2QBYB 1VQ7I 1ZR4A 3OWTA 4IKFA 4G6TB 3CCRI 2LMDA 5IYCJ 4HBLA 4NHJA 4IHWA 4IXAA 3R4KA 5ILVA 2BE5F 3N97A 3PO3J 2X1DA 4LGWA 3W6JB 1FOWA 2XGEA 3J81Z 1SAXA 2HKOA 3VEPA 1XSXA 3GF2A 2MLGA 3EQLF 3ZMSA 3A2KA 2LR8A 4AM3A 4BXXJ 1RR7A 4C30A 3G1OA 1DPUA 1WI9A 3KIOA 2VQHA 4U0WA 5IOYA 1BI0A 3I4NJ 1K6OA 3PIOF 5E1WA 4BE1A 2Y9ZA 5ILUA 1R4NB 1BR1A 4F91B 2HWVA 2ISYA 3B6AA 3UKGA 2EFQA 4HV5A 4BU2A 1JKPC 3LSRA 2DT7B 2E1NA 2KJBA 1EF4A 2CV0A 2PFBA 1I27A 2AO9A 3BR6A 3BTJA 4S05A 1LDKB 5FRMA 1Y0NA 2KJCA 2YPRA 5K5QA 1SC7A 1GXPA 4S04A 4A3FJ 4XRSG 2XAHA 3DBLB 5H6RA 3RQ4A 3MQ0A 2CGPA 1U5TB 1BJZA 3A01B 3E6MA 5F1JA 1MBJA 4AWXB 1O7LA 1V4RA 2EFOA 2Q2EB 4PJNA 2LF7A 2KISA 3HKZN 2PN6A 4I7HA 3OYFA 2PJRB 1UG2A 1RC9A 4HAMA 2V7FA 3IAS2 2ELHA 1VQ9I 3OR1C 3BROA 4WXCA 3GX4X 2HYJA 1JJ6C 2E1MB 1YJ9I 2VQGA 2EZHA 2LF8A 2DMTA 4LB5A 2IW5A 2OU2A 1EV7A 5DM7F 4HX4A 1P9QC 1WKMA 3HRSA 2DFFA 3V8JA 2UZKA 1XCVA 3A0HC 5HLHA 4I2OA 1K4SA 2EA2A 2H6CA 3O2PE 3S32A 3A03A 3F9KA 1T95A 4UUSB 3S14J 2R0QC 1G3TA 2L9SA 1TWFJ 2QSFX 1CF7A 3OYLA 2M8GX 3PQJA 2KRFA 2L9VA 3CDLA 4JYKA 4GXOA 2BBYA 5D5UB 1DGRM 1SD7A 2A5WA 3KFWX 1J7KA 3BLYA 2EILH 1ZREA 2R7FA 1P7IA 3FDYA 4LG3A 1EJ9A 4HZFA 4B09A 3VPRA 4XLFA 5E3OA 2R7ZJ 4G7ZF 1SD6A 2XC7A 1HSTA 3KEOA 5C44J 1Z7UA 2M7AA 3FM3A 3QOPA 4LOCA 3WTZA 4FX0A 1ZR2A 2NVTJ 1ZGAA 2A05A 2QKMB 5HLGA 3H0GJ 2P5LC 2VC0A 1ZYRF 4P5OA 2CQNA 3LFUA 4IF4A 2K02A 3DPLC 1D8KA 5EEGA 2WV0A 3OSFA 1FJLA 4TV7A 3H5RA 5D8KB 5HLIA 4BAYA 1LVKA 1YW9A 4EV0A 1N25A 4YELA 4MGRA 1XTAA 2EFWA 4BBSJ 3V8KA 2MG4A 4CCJA 2CQ7A 3I4PA 1P92A 2V1XA 2X85A 5M5YJ 5F27A 1J5YA 3V7CA 3ABUA 4PJJA 1IRXA 2FJ1A 1I1GA 2JK3A 2XROA 4I09A 2DLLA 1ON2A 4XQFA 1FWZA 4PJLA 3TGNA 4DYCA 1X2MA 3F8MA 2XGXA 3EDPA 1G6NA 5EG0B 1XB4A 3SYTA 3EUAA 3RPUA 4JQFA 1UFMA 3S2DJ 2VT3A 5BNGA 5CVUA 1GDTA 2VE9A 2ZMEB 3HSFA 2L3DA 2OD5A 3OIOA 5GP9A 1Q1VA 4DQ2A 1BIBA 3LSMA 2OCCH 4B3XA 1VTNC 2VQLA 1QO0D 3BR3A 4GRIA 4V2GA 3I0TA 3IH2A 1REPC 3WGIA 2ACJA 3BZKA 2M45A 4HQMA 4P55A 4Y33A 4XR6A 5EEAA 1FSEA 1R36A 3DV8A 4CCOA 1G3YA 3ZMTA 1R5GA 1B8IB 3ASNH 3ROUA 1PP7U 2VN2A 2STTA 3HZJA 3IAM2 3CTAA 2XASA 2BY1A 3EUHA 3BWGA 4LJZF 2YU9J 4ESJA 1YO5C 1E17A 4X0GA 1LE8B 2NVXJ 1Q1HA 1FP2A 1LFPA 1T0FA 4N0BA 2PMZA 4AVPA 1XGNA 2P4WA 2LBFA 2H8RA 3S3OA 2W1OA 3DEEA 1XMAA 4BGDA 2JUGA 3F8FA 2D45A 3JTHA 1F36A 2R92J 2RAEA 4EVIA 4L9TA 4ENMA 3W6VA 3QOEA 1EH7A 1GVJA 4DGWB 1W4MA 4P96A 1QNTA 3LQQA 3NARA 5HLTA 1X1CA 3DTIA 3P9IA 1KQ0A 1ETXA 3G3ZA 3HUGA 2JT1A 4IZZA 1GVDA 2LOOA 4FISA 4Y52J 1S7AA 4QSHA 3CLQA 5KHDA 3J7ZI 4AIJA 4H4KC 3C1DA 2VPRA 3IV5A 3QPSA 4ZTFA 4FX4A 4E6KG 2K9LA 1IGNA 1FYLA 3R61A 2P7CB 3SFIA 2CQXA 1GHCA 2V1UA 5ED4A 3M9AA 4D5CA 1IZ1A 5KK1A 2RNGA 3K4NA 2WC2A 3KPHA 1QVTA 4A12A 1IAWA 2VJ4A 3FF5A 4EATA 5K5OA 3CO6C 2RDPA 2A3SA 3ZQQA 3ECHA 1ZLKA 1GXQA 2W57A 1EA3A 3I58A 4IRHA 2ETHA 2KRHA 4XLNF 2R7OA 4MIMA 4O6JA 3GTOJ 4XN3A 3C2HA 1U2WA 4Y13A 2D1VA 2RREA 1H0MA 2UUZA 1GV2A 1XDSA 3BDDA 2FU4A 1X1PA 3D5RC 2ZNZA 2ZB9A 2HQ5A 2Q2EA 1NK2P 3HYIA 3A4CA 1P4XA 3L00A 4CYCA 1YI2I 2PJRA 3PNYA 3ZMDA 3O8GA 4ZZDA 3CCMI 3K4KA 2CU7A 1WFXA 5BMZA 2HQRA 1LDJA 2R7QA 3JRGA 3RTRA 1HF0A 2O03A 4RMNA 1TW3A 2YUSA 4BQQA 2FQ4A 3DCFA 3I53A 3DU5A 1RESA 2LP0A 5AIQA 4ZDPA 4WCGA 2H8WA 4F3QA 1P4AA 4E7JA 4BUPA 2OZ6A 2ZSHB 3FXJA 1XDUA 3TMOA 4XKBA 4UUSA 1ODDA 4ENKA 2Y0MA 2EZIA 1JGGA 1FY7A 1ZRCA 2BZTA 2FBIA 1ZARA 3LMMA 1ACIA 2CV2A 3Q9SA 4ZZLA 3ZXSA 4L5EA 3GLLA 2J5OA 2X6OA 3LSPA 2PMHA 4RLFA 4IX7A 2K86A 1TWGJ 3F6VA 5CQEA 1ETOA 2IRFG 2EIKH 4ZDOA 2VB6A 4K2EA 1USSA 1ZQ3P 2CRGA 3K2ZA 3KZZA 2QGUA 3WODF 3S17J 1QA6A 2K40A 4ON0A 1WI3A 3COAC 2DA6A 2F48A 5B3SH 5M3FJ 2VT2A 2CO5A 1A04A 1OCOH 4DYRA 5JFRA 5IY5H 2LVSA 2JA5J 5D4SA 3VB2A 2MD0A 3AG4H 4OAZA 4CICA 2E2IJ 2X9DA 3GBGA 2JSPA 4HX7A 3S2HJ 1OFCX 1JHHA 2ZBKA 3HBLA 2NAZA 3V42A 2GZWA 4OINF 1BJAA 1YTYA 4XM3A 3CCEI 4UNOA 2DQLA 1XCBA 4D0PA 1TNSA 5F64A 2K7LA 5IP6A 2HDDA 3CJNA 2LLKA 2CWEA 5J4YA 4E7SA 3L2CA 2LRDA 2E60A 2BY3A 3OR2C 3HTSB 4B1RA 2KMUA 1A6IA 1BR2A 2B7EA 2L4AA 4UVCA 3K70C 1V54H 2CFXA 2ZJRF 4FETA 3K4LA 1BN5A 1YLFA 1WVRA 3A1YA 2Z9OA 2VL8A 1SVMA 5B1BH 4RB1A 3MFKA 4KNYA 1KU9A 3CQZJ 2O5RA 2P0WA 2F5EA 2Y0SA 4OIPF 1VQKI 1IN5A 5J8FA 2IJLA 2JTVA 3HDDA 4BBRJ 4UB8C 2E35A 4HPQA 2V9VA 2E71A 4CZZA 5GTIC 4PK4A 3T8RA 1YOVB 2OPTA 3OV8A 5IT9K 2LD5A 1R49A 4HNTA 4G6QA 2V1DA 3DPUA 2R7UA 2XAFA 2ZJPF 2DMQA 2P6SA 5BS6A 4ESFA 1JKOC 1ENHA 4KT5C 2WA0A 3DKWA 3DP7A 3WTWC 1PP8F 1MMNA 3OYHA 2V9KA 1JTXA 1FT9A 1QVUA 3BJ6A 1HC8A 3C7JA 3BR5A 2FEZA 3S1NJ 1E0EA 1MNEA 1WGXA 1HQCA 3GLXA 1YIJI 3SXYA 2DA7A 2M87A 2ZSIB 5EEHA 1GV5A 2FOKA 1T33A 4XBFA 1DU6A 4DZPA 5IPAA 3HHHA 5F1RA 2MFZA 4CGZA 2M2EA 3TKYA 4I99C 1D1BA 1OCTC 1YW7A 1FYKA 4IQJA 2BW3B 1O3SA 1X58A 3G4SI 3CF2A 3FKJA 4A93J 2MC4A 1LE8A 3RIRA 3CCVI 2CMPA 3LA3A 2FA5A 3VWBA 3QP5A 1P6RA 3K9TA 4BYYA 4JP0A 3H3VK 3MN2A 2RGVA 3KCCA 5E17F 5JLWA 4A3JJ 2KLOA 4QLCU 3CC4I 2CFOA 2IS2A 1FBUA 2K9MA 2W82A 2VOOA 1A5JA 3V4GA 2OZUA 1Z91A 1IRGA 4KICA 4X1EA 3BC8A 1XC5A 5DYMA 1XSDA 2XKPA 1F1ZA 2O9LA 3HGYA 1MSEC 2WTEA 3CCLI 2IS1A 3BQYA 2ZXIA 2XPWA 2DOEA 5GPAA 3W3CA 3ZN1A 1WSUA 1PVEA 2O8XA 3RI4A 1ZGWA 2BGCA 1UJ8A 2K3PA 2GBYA 4QPQA 1RETA 3GFLA 1EKEA 1IV8A 3I9V2 1X2NA 2JRMA 3ISPA 5CVIA 5TISC 3KYLA 5DTDA 4BQNA 2X0LA 3GZ6A 1X1DA 2GQQA 2KPMA 3ZGKA 1G2HA 2M5WA 2D5VA 1GT0C 3CJRB 1LEAA 3GTGJ 2P7VB 2A6HF 3EPZA 3ABLH 3F21A 4AIHA 5HS8A 5D4RA 1DUXC 5H6QA 3IL2A 4RAFA 5M5WJ 3C3WA 3F6OA 3HGGA 1TL8A 3TW7A 1OCPA 2JJ7A 2VE8A 4XLCA 1K61A 2MA3A 2EWNA 1OQYA 3FBIB 4NNJA 1I50J 2YR2A 5IYBJ 3MEXA 5ERIA 3CUQC 2NNNA 2GWRA 5AONA 1ITYA 4II3A 2K3FA 1T56A 1K6YA 2MC3A 2XGDA 1M1EB 3M8FA 3K0LA 2Y31A 2G0EA 2IGOA 3HHGA 3W2WA 1GLNA 2K9QA 1PUFB 4MTEA 3BZ6A 1Z0XA 3OSGA 3OYJA 3JW4A 1TW2A 5DS9A 1VQNI 2DA2A 1R22A 3FHZA 1MDMB 5C4JJ 3WU1B 4XRSA 4CCLA 3IUOA 2DPUA 3HSRA 1ZRDA 2DA3A 1O4XA 4HF1A 2ZNYA 1YJNI 3DPTA 5L3CA 2I10A 4KISA 3DF8A 1HDPA 1VF9A 1MJ9A 2DDBA 3BTLA 2QSHX 4BHCA 3OOPA 3OYBA 4IO9F 1YS6A 2CUFA 4HYEA 3IWZA 2K85A 3K7AJ 1NG6A 4CYDA 1L3LA 1ZHFA 4EGZA 1H89C 2HI3A 1O3TA 2EA4A 4J00A 2YU3A 3BG9A 1YHQI 1YYVA 3FXMA 2HXIA 3DFGA 2OC6A 1VQMI 2NVYJ 1JKRC 1QZZA 2VKEA 2BVMA 1T6SA 2X48A 4MQVA 2M8EA 2LFBA 1WJEA 2XAQA 3GTQJ 4II2A 3H0DA 2HVQA 3NWTA 2R7XA 2LYCA 3PFYA 1TBXA 2EJRA 3HJEA 3O8HA 4XONA 2FMYA 1VQ4I 3OS1A 1YX5A 3U1DA 2DPDA 1E2XA 3E6DA 1I5ZA 1HKQA 3I54A 2FMLA 4OIQF 4X6AJ 1FLIA 4ZC3A 2CG4A 1MSFC 2ID6A 2L5QA 4AD9A 2WAEA 5DCMB 4RB3C 1BBYA 3CESA 2KZGA 2F5CA 3UR3C 1Z77A 3ZMZA 4EJVA 2R7WA 4IHSA 2HQNA 3A0BC 1JT0A 1O3QA 3DLLF 2FNAA 2A68F 1IV6A 1UHWA 1R6RA 3HIFA 4HW0A 3V7SA 2ZXWH 3BR2A 4BJTA 4O5VA 4I01A 2XF5A 2XB0X 2OCEA 2WB1N 3PO2J 3QQAA 4M9ZA 2QQ8A 2PBIA 2XPUA 4J19A 2XAGA 4A0ZA 2NRAC 1SFEA 3I64A 1S7EA 2XV4S 5DM6F 4L0YB 2XF6A 1S29A 3SZPA 1MJBA 3E3VA 1U8BA 4CO8A 5DCFA 4RDUA 2FOWA 3VSKA 3EYYA 4CA0A 5FD6A 1QBJA 3WGGA 4G7OF 2QYOA 3BG6A 3TDZC 3FZVA 4Y3OA 2DMUA 3FIWA 4KFCA 2CS3A 4B4CA 3JAMZ 4YRVA 4HDVA 1R1UA 1ZH5A 3LOCA 2AXLA 3ZMUA 4BEHB 5EGOB 5LGTA 2E7XA 3AFHA 3E97A 2B63J 3ABMH 5DD8A 4GYIA 4CCNA 1D5YA 1MH3A 2WAQA 4DJAA 3GZNB 3PIPF 3K4CA 1FZPB 1PJRA 2EZKA 2X1EA 1E3OC 3ULQB 3DQVC 3BPVA 4BQOA 3SQNA 1LKXA 5HNFA 3GTKJ 1XD7A 4EM2A 5LHHA 4EGYA 2FNPA 1IN8A 1TQMA 2OV7A 2ZO4A 4JX4A 1TWAJ 2EK5A 2ZJ2A 4EJUA 4MEYF 4G94A 2WBMA 3GFJA 3ABKH 1BIAA 4E7HA 4HRIA 4GFBA 1QZEA 4KJZA 2IS6A 4HLXA 5D5WB 4L18B 1G8XA 3RKQA 2LY1A 4MEXF 1D1AA 2WY8Q 2QM3A 3DBRB 2CUEA 3L2RA 4A3IJ 2HOEA 1YRNB 2RN7A 2X51A 1R23A 3FX3A 4M6XA 4YIIA 2G7UA 4M6YA 3P9CA 3WHCA 4J01A 5ICEA 3LFKA 3MAJA 1Z6RA 3CUQB 1V5FA 3LSTA 4PJMA 3ZPLA 3BPXA 1OCRH 1T38A 1B72B 5LRRA 1ZG5A 2Z2SB 3RKYA 5D6FA 2VUMJ 4CCKA 1MIJA 2X6YA 3BCBA 4ITVA 2COBA 1K83J 1OR7A 3KP7A 1SFXA 3L2UA 5AIPA 3NRVA 2HOSA 4AVZA 2DFHA 1UCRA 4A6DA 1RRJA 2PI0A 2GXBA 3BG3A 3GUDA 3PNVA 1ZRFA 1Y39A 2XHKA 3HRUA 2FRHA 4JX6A 5TJJA 2L7ZA 3H5AA 4LB6B 1FYMA 2VKDA 5JHFA 4UV9A 5EZHA 5LHIA 3AL0C 1V3FA 2DYRH 3BQZA 2VKVA 2R5ZB 3FMQA 1OCCH 1TNTA 4HSRA 2XF7A 2HU9A 1PDNC 4XKCA 2CW7A 1KU2A 1YJWI 4MHGA 1D0YA 2KHMA 2R5YB 1R58A 3R0AA 4U0VA 1MJAA 4A0XA 5CQGA 2ELKA 1SAUA 1XMXA 3ZCOA 2DTZA 3WE3A 4HNUA 1VFCA 2D2WA 2L7FP 1Z3YA 3I5UA 3QU6A 2VJJA 1WH7A 4M3BA 5TRDA 3CJTB 5A2QK 2QF7A 1TQIA 1HKSA 2L2OA 2HNHA 2DK5A 1WJCA 1IXCA 2L4MA 3OS2A 3S1MJ 1ETKA 5GTHC 1MMGA 4BL0B 4GO1A 3G1MA 4RM3A 2ID3A 3GW2A 3L2VA 1IG7A 3K69A 3QODA 4NB5A 5F04A 2F6CA 4ESBA 4D7MA 1U9OA 4DW6A 1TZLA 4M3FA 3CD6I 2IEKA 4LIUA 2HZDA 1I3AA 3LAPA 4L5IA 2GIZA 1B9NA 2LK2A 4Z2YA 1MD0A 2DU9A 4HF0A 2GOMA 3TDUC 3ZR8X 3U2RA 1EH8A 3CC7I 3FK6A 4YIRX 3OYAA 4M71A 4U87A 3RYPA 3D1NI 4KIBA 4C3JJ 2R7DA 5FKOA 2CYYA 1ZK8A 5GAEJ 4A3GJ 1A35A 2QBYA 4U0YA 3CMAI 6PAXA 4OOIA 3C2GA 2Z99A 1K78B 1IRFA 1DP7P 1FNNA 1HW1A 2VXDA 5DCMA 3JCUC 1S7OA 2PMUA 3LWFA 2L01A 1HXDA 1Z1DA 2E1CA 3LL7A 1D0XA 2DQRA 2KQRA
chains in the Genus database with same CATH topology
4BH9A 2HTJA 3WG9A 5JHUA 2IPQX 5HDKA 4A2UA 3IKVA 2JPCA 5DUIA 1YW8A 1OPCA 2VONA 4RB2C 2JPBA 1BM9A 3G73A 4IRIA 1U5TA 2HTSA 2VBXA 1MKMA 3BJAA 2FXAA 4BXUA 4BNCA 5HDNA 4HDUA 5FLXK 1QPMA 3GEZA 1KQ9A 1K7AA 1B6AA 4LD5A 1UB9A 2MLKA 4UUVA 5H20A 2A07F 1D5VA 1LB2A 1J9IA 5LHGA 1FPQA 1SMYF 3RKXA 2VBYA 3KEQA 3CUOA 4WXDA 3Q5FA 1STZA 3I59B 3VODA 2A6EF 4LG0B 4UVAA 5D8LB 2ZFWA 4M9XA 1RNLA 4OMYA 1JXSA 2O6GE 2GIVA 4EM1A 2STWA 3BJOA 4L9NA 3KLNA 4E70A 4I02A 4GYGA 1W7PB 2X4HA 4M74A 2V6CA 4EMSA 3P9KA 5HDGA 4KDPA 2DQRA 3V8LA 1R00A 3CUQA 3FMRA 2GA2A 5DD4A 4P9FA 1TLHB 5HS9A 2GAUA 4ZYEA 4L5JA 2P5VA 5L3BA 1B4AA 3IWFA 1PUEE 3KETA 4R8HA 2RQPA 1MGTA 2VXZA 2PG4A 3DEUA 2CW0F 5JR3A 3WU0A 5A2QZ 1W5SA 5JVTA 3Q9VA 3H3UA 1P4WA 2Y75A 2DBBA 3QPTA 4UVBA 2ZMEA 1ZG1A 1J0RA 1UHMA 4ZH4F 3BOQA 2EV6A 4JK1X 3TO6A 3QPHA 1FC3A 2HGCA 4A0YA 1YIOA 4GGGA 2NS0A 1R7JA 2HS5A 1AOYA 3K1MA 4L0ZB 1SD5A 3ZQ7A 1L0OC 5BQTA 3KP3A 1ZN2A 3J80K 1BI1A 3K1NA 3VFZA 4EJOA 5KVRA 4L9JA 2DFIA 4LMYA 3CO7C 1ZAOA 5DEQA 5BOXA 2Q8KA 5ILSA 3B73A 4HLYA 1B9MA 2IVMA 1LVAA 2RKHA 1CF7B 2MBFA 2EV5A 3PFIA 2H94A 3F8BA 3K1PA 4ZYDA 1DDNA 4KYWA 2DO7A 2ZCWA 3R6SA 3M8EA 3F3XA 2W85A 2QUFA 4BHBA 1ZG3A 2ESNA 1KGSA 1QQIA 2ESHA 3EETA 2L02A 4ASNA 4LLLA 1RUNA 1O7FA 4OIRF 2K27A 3WTSC 2PQ8A 3ZN0A 2QZ8A 2GXGA 3RKWA 3C18A 4U7BA 1KYWA 1R1VA 4XRFA 5LLQA 1R5HA 4WF2A 5LGNA 3FXRA 4A5MA 2HR3A 2YSRA 3R0JA 3PQKA 4HX8A 2TDXA 2DAOA 4PDKA 3CDHA 3W6KB 4OMZA 2UXNA 2DW4A 2MH2A 2O61A 1D3YA 5CLSA 5CJ9A 2BV6A 2IT0A 1H9GA 4IJAA 1HW5A 3JTGA 1OYYA 2V79A 2NYXA 3F8NA 2GA1A 1XSVA 3TO7A 3T8TA 1USTA 5L3FA 3FWEA 1YFHA 2EFPA 3DXJF 3GO5A 4G8XA 4CXFA 3JSPA 2C6YA 5FGMA 4LLGF 4LK0F 4MTDA 5E20A 3NEUA 4YFNF 5CYVA 2F5DA 2ADUA 4HV6A 4NQWA 3GZ5A 1EH6A 2RV8A 4LG0A 3RYRA 3SZTA 5FD5A 5CVRA 2G9WA 5E8IA 4KUMA 1F5TA 4XSXF 1HSJA 3QAHA 3D5LA 1P2FA 2JSCA 5J6XA 1W7PA 1NHAA 1Y0UA 3MWMA 3AAFA 5IT9Z 3T0YA 2COMA 2OA4A 3RDIA 3KP5A 3L09A 3KP2A 1OKRA 1XGMA 2IP2A 2P6TA 5BPDA 1ON1A 2KIFA 3KE2A 4U88A 3J80Z 1DPRA 4LLNA 1U78A 2A69F 1T2KA 1RUOA 5CVJA 1FBQA 4RGRA 4Q47A 4RGSA 3J7AO 2RVCA 3QRFF 3MZHA 2JRTA 5LEJA 4G7HF 1KQ8A 3N4MA 4KN4X 3GWZA 4YIFA 2ZKZA 2OAZA 3ZMVA 2JZYA 3M7GA 3SHFA 2F2EA 5E18F 2XAJA 4KA4A 1BOAA 3R60A 1BI3A 1IW7F 2BYVE 1IUYA 3QU3A 3JSOA 2M30A 4KMFA 1J2XA 4I0BA 2XUBA 5K5RA 2AS5F 5LBQA 4ENJA 2HYFA 1YG2A 1FSHA 3HOTA 4XLPF 4KMUX 4G6DA 3LA2A 4Q5SF 3E5XA 2VC1A 5BPIA 3V7RA 4YFKF 5F6FA 3GXOA 4WWCA 1I6XA 3FXQA 4L9VA 2QWWA 1Z6TA 3I71A 2EFNA 2KKOA 2MD5A 1U3EM 3HOSA 2KIMA 2CSOA 4RAZA 4PGGA 1TTYA 4F7ZA 2HFHA 4P9UA 4UXNA 3GFIA 3E6CC 2VOPA 1QZYA 1F4KA 3IRRA 2BEOA 2QLZA 1WQ2A 1RIOH 3T5XA 2FSWA 1MDMA 3BP8A 2HKXA 4Y15A 5LGUA 4KIGA 3L7WA 5HOOA 4FT8A 5JI6A 3IHUA 2R3SA 5L3GA 1HW2A 1O57A 4N9IA 1IF1A 2XIGA 3O6BB 1G4DA 2HZTA 2LNBA 3RPQA 3HTUA 1J75A 3WTUC 2B0LA 4Q48A 2Y48A 3REOA 1U6GA 5FB2A 4GCVA 3KP6A 1S8NA 1X3UA 3TOBA 3WE2A 4AIKA 2Z33A 2E7WA 2DT5A 5HS7A 1BI2A 2H09A 2RC4A 2P5KA 3MCZA 1XN7A 1JE8A 1W7PD 2CQKA 1SMTA 2DK8A 4O3MA 4CDGA 5D5VB 3L9FA 4LFUA 1OMIA 5FFZA 2OQRA 2W24A 3HSEA 1MZBA 4LK1F 4RAYA 4RGXA 1W5TA 1IXSB 4WXHA 2YX4A 2H6BA 3M1EA 1LDDA 2FQ3A 2Z5UA 3GFMA 3D0SA 4YFXF 2HYGD 1WRJA 1IN4A 2W25A 4HF2A 1HKTA 4ZYGA 2Z3YA 3SFZA 1Z9CA 1G3WA 1LQ1A 1K79A 3F72A 4M73A 1C0WA 2Q0OA 1U8RA 3T1BA 4OU0A 3TQNA 3E5QA 2YX7A 3WTXC 4FHTA 4OIOF 4H0EA 3B02A 3LA7A 4EQQA 2LSOA 1B1BA 4IVNA 2ISZA 4I98B 3ABTA 2OBPA 2QENA 3ZP5A 2O3FA 2IA2A 3LQRA 4ETSA 2O0YA 4HOBA 1SFUA 4RB0A 4A6EA 4UHTA 1G3SA 3KZYA 2L54A 4U7DA 3P7NA 1XGOA 4R1HA 1IXRC 5ICGA 2NNYA 4PGHA 2FBHA 4JBAA 4UV8A 1YS7A 3HRMA 1FX7A 3ELKA 1ONVA 1S6LA 3F23A 4IRGA 5ICFA 4HQEA 3KLOA 1B59A 2LDUA 1JGSA 4EM0B 2IA0A 5D5XB 4R79A 4WX9A 2VBWA 4Y17A 5E8GA 4B8XA 3WTTC 2HDCA 4A5NA 4WK8F 2EB7A 4RS8A 2XRNA 2OQGA 3TOAA 4Q4ZF 1KA8A 2P8TA 3O3KA 5DDGA 2VODA 2QVOA 1OYIA 4PCQA 4XSZF 1FOKA 3GYHX 1JHFA 2XVCA 4PZJA 3FM5A 3ML6A 4I0AA 1F9NA 1ULYA 1IN7A 4MNUA 1BC7C 3J81K 1H9TA 5DUKA 4KN7X 1AWCA 4G9YA 2PLYA 5LEKA 4IHTA 3QP6A 1TQPA 3LAJA 1ZGJA 4M9SA 3WTYC 4ZYHA 2PEXA 3S2WA 1S3JA 1QGPA 3H3ZA 5D6EA 4MQ9F 3FMSA 5L3DA 3WGHA 2VBZA 1RI7A 1U5TC 5K1YA 1KU7A 2MH9A 3H92A 1IN6A 4N9HA 3MZYA 2EV0A 2IA1A 1CGPA 1SD4A 3JAMK 1O3RA 5E1XA 1T98A 4HA8A 2DI3A 1LJ9A 3CLOA 4ENNA 1K78A 2D1HA 1D8JA 1RZ4A 1ZLJA 2A5YB 2A61A 1J59A 1LNWA 5FFXA 2K4JA 2M1BA 5IT3A 4IPAA 1XGSA 3RJPA 5FLXZ 2FF4A 4DNCA 4BQAA 3E5UA 3ERED 3IKTA 2QQAA 1Z05A 1KYZA 1LEBA 1HBXG 4EJWA 2QQ9A 2H27A 4BHPA 3IC7A 3ECOA 4YG2F 2HEOA 3IRQA 1XMKA 2LKPA 1BC8C 2FE3A 2XKOA 3E6BA 4M72A 3FXUA 1KU3A 5L3EA 2W84A 3KP4A 4EJTA 2UWMA 1FBSA 4CHUA 5DV5A 2K4BA 4QWQA 2G7HA 3HRTA 2FBKA 2UXXA 3F22A 1YQAA 3TO9A 2PJPA 3EYIA 3BY6A 3NQOA 5J8CA 3I59A 2QQBA 1FP1D 4KIFA 2F5FA 2WWYA 3U9GA 2KIUA 3GVAA 1I1SA 5ICCA 1WWXA 1R1TA 3VOEA 3WTVC 2ZXJA 1T39A 5FO5A 2RNJA 4RGUA 5LRSA 5E1ZB 2J5PA 1OYWA 2DTRA 5HVQC 3F8CA 2QBYB 4NHJA 4HBLA 4IXAA 3R4KA 5ILVA 2BE5F 3N97A 4LGWA 3W6JB 3J81Z 1SAXA 2HKOA 3VEPA 1XSXA 3GF2A 2MLGA 3EQLF 3ZMSA 1DPUA 1WI9A 4U0WA 1BI0A 1K6OA 5E1WA 5ILUA 2HWVA 2ISYA 2EFQA 4HV5A 2E1NA 2KJBA 2PFBA 1I27A 4S05A 1LDKB 2KJCA 2YPRA 5K5QA 1GXPA 4S04A 2XAHA 5H6RA 3MQ0A 2CGPA 1U5TB 3E6MA 4AWXB 1O7LA 1V4RA 2EFOA 2LF7A 4I7HA 2PN6A 4HAMA 2ELHA 3BROA 4WXCA 3GX4X 2LF8A 4LB5A 2IW5A 2OU2A 1EV7A 4HX4A 1WKMA 3HRSA 3V8JA 2UZKA 1XCVA 5HLHA 4I2OA 2EA2A 2H6CA 3O2PE 1G3TA 1CF7A 3PQJA 2KRFA 4GXOA 2BBYA 5D5UB 1SD7A 3KFWX 1J7KA 1ZREA 2R7FA 4HZFA 4B09A 4G7ZF 1SD6A 1HSTA 3KEOA 1Z7UA 3QOPA 3FM3A 3WTZA 4FX0A 1ZGAA 5HLGA 2P5LC 2VC0A 1ZYRF 4P5OA 4IF4A 2K02A 3DPLC 1D8KA 5EEGA 2WV0A 4TV7A 5D8KB 4BAYA 5HLIA 1YW9A 4EV0A 4MGRA 2EFWA 3V8KA 3I4PA 1P92A 2V1XA 1J5YA 3V7CA 3ABUA 1I1GA 2XROA 4I09A 2DLLA 1ON2A 1FWZA 3TGNA 3F8MA 2XGXA 3EDPA 1G6NA 1XB4A 3RPUA 4JQFA 1UFMA 2VT3A 5CVUA 2VE9A 2ZMEB 3HSFA 2L3DA 2OD5A 4DQ2A 1BIBA 1VTNC 1QO0D 3I0TA 1REPC 3WGIA 2ACJA 2M45A 4HQMA 4P55A 1FSEA 1R36A 3DV8A 1G3YA 3ZMTA 1R5GA 3ROUA 1PP7U 2VN2A 2STTA 3CTAA 2XASA 3EUHA 3BWGA 4LJZF 1E17A 4ESJA 1YO5C 1FP2A 1Q1HA 1T0FA 4N0BA 4AVPA 1XGNA 2P4WA 1XMAA 3F8FA 2D45A 3JTHA 4EVIA 4L9TA 4ENMA 1EH7A 1GVJA 1W4MA 4P96A 1QNTA 3LQQA 3P9IA 1KQ0A 3G3ZA 3HUGA 2JT1A 1S7AA 4AIJA 3C1DA 4FX4A 1FYLA 3R61A 2P7CB 1GHCA 2V1UA 5ED4A 3M9AA 1IZ1A 5KK1A 2WC2A 4A12A 1IAWA 3FF5A 5K5OA 3CO6C 2RDPA 2A3SA 3ECHA 1ZLKA 1GXQA 2W57A 3I58A 4IRHA 2ETHA 4XLNF 4O6JA 1U2WA 4Y13A 2D1VA 1H0MA 1XDSA 2FU4A 3BDDA 2ZNZA 2Q2EA 3HYIA 1P4XA 3L00A 3ZMDA 4ZZDA 5BMZA 2HQRA 1LDJA 3RTRA 2O03A 1TW3A 3I53A 5AIQA 4WCGA 1P4AA 2OZ6A 1XDUA 1ODDA 4ENKA 2Y0MA 1ZRCA 1FY7A 2FBIA 1ZARA 3Q9SA 4ZZLA 2J5OA 2PMHA 2K86A 3F6VA 2IRFG 4K2EA 1USSA 3K2ZA 3KZZA 3WODF 4ON0A 3COAC 2VT2A 2CO5A 1A04A 5JFRA 5D4SA 3VB2A 4CICA 4HX7A 1JHHA 2ZBKA 2NAZA 2GZWA 4OINF 1BJAA 1YTYA 4UNOA 2DQLA 1XCBA 4D0PA 1TNSA 5F64A 2K7LA 3CJNA 2CWEA 3L2CA 3HTSB 4UVCA 2L4AA 2CFXA 1BN5A 1YLFA 2Z9OA 4RB1A 3MFKA 4KNYA 1KU9A 2F5EA 4OIPF 1IN5A 5J8FA 2IJLA 2JTVA 2V9VA 4CZZA 3T8RA 3OV8A 5IT9K 4G6QA 2V1DA 2XAFA 2P6SA 5BS6A 4ESFA 4KT5C 3DKWA 3DP7A 3WTWC 1PP8F 1FT9A 3BJ6A 3C7JA 2FEZA 1HQCA 3GLXA 3SXYA 2M87A 5EEHA 2FOKA 4XBFA 3HHHA 5F1RA 4CGZA 3TKYA 1YW7A 1FYKA 1O3SA 3RIRA 3LA3A 2FA5A 3QP5A 1P6RA 3K9TA 4BYYA 2RGVA 3KCCA 5E17F 4QLCU 1FBUA 2VOOA 3V4GA 2OZUA 1Z91A 1IRGA 4KICA 5DYMA 1XSDA 2XKPA 1F1ZA 2WTEA 3ZN1A 1WSUA 2O8XA 3RI4A 2BGCA 3GFLA 5CVIA 3ISPA 2X0LA 3GZ6A 2GQQA 2M5WA 1LEAA 2P7VB 2A6HF 3F21A 4AIHA 5HS8A 5D4RA 1DUXC 5H6QA 3IL2A 3C3WA 3F6OA 2VE8A 2MA3A 2EWNA 2YR2A 3MEXA 5ERIA 3CUQC 2NNNA 2GWRA 5AONA 2MC3A 3M8FA 3K0LA 3HHGA 4MTEA 3BZ6A 3JW4A 1TW2A 1R22A 3FHZA 1MDMB 3WU1B 2DPUA 3HSRA 1ZRDA 4HF1A 2ZNYA 3DPTA 5L3CA 3DF8A 1MJ9A 4BHCA 3OOPA 1YS6A 4HYEA 3IWZA 1L3LA 4CYDA 1ZHFA 4EGZA 1O3TA 2EA4A 2YU3A 1YYVA 3DFGA 1QZZA 1T6SA 4MQVA 2M8EA 2XAQA 1TBXA 2EJRA 2FMYA 3U1DA 2DPDA 1E2XA 3E6DA 1I5ZA 1HKQA 3I54A 2FMLA 4OIQF 1FLIA 2CG4A 4AD9A 5DCMB 4RB3C 1BBYA 2F5CA 3ZMZA 4EJVA 4IHSA 2HQNA 1O3QA 2FNAA 2A68F 1UHWA 3HIFA 4HW0A 3V7SA 4O5VA 4I01A 4M9ZA 2PBIA 2XAGA 4A0ZA 2NRAC 1SFEA 3I64A 2XV4S 4L0YB 1S29A 3SZPA 1MJBA 3E3VA 4CO8A 5DCFA 3EYYA 5FD6A 1QBJA 3WGGA 4G7OF 2QYOA 3TDZC 3FZVA 4KFCA 3JAMZ 4HDVA 1ZH5A 1R1UA 2AXLA 3ZMUA 5LGTA 2E7XA 3E97A 5DD8A 4GYIA 1FZPB 3ULQB 3DQVC 3BPVA 3SQNA 1XD7A 4EM2A 5LHHA 4EGYA 2FNPA 1IN8A 1TQMA 2ZO4A 2EK5A 2ZJ2A 4EJUA 4MEYF 4G94A 3GFJA 1BIAA 4HLXA 5D5WB 4L18B 4MEXF 2QM3A 2HOEA 2RN7A 1R23A 3FX3A 4M6XA 4YIIA 2G7UA 4M6YA 3P9CA 5ICEA 3LFKA 3MAJA 1Z6RA 3CUQB 3LSTA 3ZPLA 3BPXA 1T38A 5LRRA 1ZG5A 3RKYA 5D6FA 1OR7A 3KP7A 1SFXA 5AIPA 3NRVA 1UCRA 4A6DA 2PI0A 2GXBA 3GUDA 1ZRFA 2XHKA 3HRUA 2FRHA 5TJJA 1FYMA 4LB6B 4UV9A 5LHIA 1V3FA 3FMQA 1TNTA 1PDNC 1KU2A 4MHGA 1R58A 3R0AA 4U0VA 1MJAA 4A0XA 3WE3A 2D2WA 3I5UA 3QU6A 5TRDA 5A2QK 1TQIA 1HKSA 2DK5A 1IXCA 2L4MA 4GO1A 3GW2A 3K69A 4NB5A 4ESBA 3LAPA 4L5IA 1B9NA 4Z2YA 1MD0A 2DU9A 4HF0A 3TDUC 3U2RA 1EH8A 4M71A 3RYPA 4KIBA 2R7DA 2CYYA 2QBYA 4U0YA 6PAXA 4OOIA 2Z99A 1K78B 1IRFA 1DP7P 1FNNA 1HW1A 5DCMA 1S7OA 2PMUA 3LWFA 2L01A 1HXDA 1Z1DA 2E1CA 5CVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BH9 A;  2HTJ A;  3WG9 A;  5JHU A;  2IPQ X;  5HDK A;  4A2U A;  3IKV A;  2JPC A;  5DUI A;  1YW8 A;  1OPC A;  2VON A;  4RB2 C;  2JPB A;  1BM9 A;  3G73 A;  4IRI A;  1U5T A;  2HTS A;  2VBX A;  1MKM A;  3BJA A;  2FXA A;  4BXU A;  4BNC A;  5HDN A;  4HDU A;  5FLX K;  1QPM A;  3GEZ A;  1KQ9 A;  1K7A A;  1B6A A;  4LD5 A;  1UB9 A;  2MLK A;  4UUV A;  5H20 A;  2A07 F;  1D5V A;  1LB2 A;  1J9I A;  5LHG A;  1FPQ A;  1SMY F;  3RKX A;  2VBY A;  3KEQ A;  3CUO A;  4WXD A;  3Q5F A;  1STZ A;  3I59 B;  3VOD A;  2A6E F;  4LG0 B;  4UVA A;  5D8L B;  2ZFW A;  4M9X A;  1RNL A;  4OMY A;  1JXS A;  2O6G E;  2GIV A;  4EM1 A;  2STW A;  3BJO A;  4L9N A;  3KLN A;  4E70 A;  4I02 A;  4GYG A;  1W7P B;  2X4H A;  4M74 A;  2V6C A;  4EMS A;  3P9K A;  5HDG A;  4KDP A;  2DQR A;  3V8L A;  1R00 A;  3CUQ A;  3FMR A;  2GA2 A;  5DD4 A;  4P9F A;  1TLH B;  5HS9 A;  2GAU A;  4ZYE A;  4L5J A;  2P5V A;  5L3B A;  1B4A A;  3IWF A;  1PUE E;  3KET A;  4R8H A;  2RQP A;  1MGT A;  2VXZ A;  2PG4 A;  3DEU A;  2CW0 F;  5JR3 A;  3WU0 A;  5A2Q Z;  1W5S A;  5JVT A;  3Q9V A;  3H3U A;  1P4W A;  2Y75 A;  2DBB A;  3QPT A;  4UVB A;  2ZME A;  1ZG1 A;  1J0R A;  1UHM A;  4ZH4 F;  3BOQ A;  2EV6 A;  4JK1 X;  3TO6 A;  3QPH A;  1FC3 A;  2HGC A;  4A0Y A;  1YIO A;  4GGG A;  2NS0 A;  1R7J A;  2HS5 A;  1AOY A;  3K1M A;  4L0Z B;  1SD5 A;  3ZQ7 A;  1L0O C;  5BQT A;  3KP3 A;  1ZN2 A;  3J80 K;  1BI1 A;  3K1N A;  3VFZ A;  4EJO A;  5KVR A;  4L9J A;  2DFI A;  4LMY A;  3CO7 C;  1ZAO A;  5DEQ A;  5BOX A;  2Q8K A;  5ILS A;  3B73 A;  4HLY A;  1B9M A;  2IVM A;  1LVA A;  2RKH A;  1CF7 B;  2MBF A;  2EV5 A;  3PFI A;  2H94 A;  3F8B A;  3K1P A;  4ZYD A;  1DDN A;  4KYW A;  2DO7 A;  2ZCW A;  3R6S A;  3M8E A;  3F3X A;  2W85 A;  2QUF A;  4BHB A;  1ZG3 A;  2ESN A;  1KGS A;  1QQI A;  2ESH A;  3EET A;  2L02 A;  4ASN A;  4LLL A;  1RUN A;  1O7F A;  4OIR F;  2K27 A;  3WTS C;  2PQ8 A;  3ZN0 A;  2QZ8 A;  2GXG A;  3RKW A;  3C18 A;  4U7B A;  1KYW A;  1R1V A;  4XRF A;  5LLQ A;  1R5H A;  4WF2 A;  5LGN A;  3FXR A;  4A5M A;  2HR3 A;  2YSR A;  3R0J A;  3PQK A;  4HX8 A;  2TDX A;  2DAO A;  4PDK A;  3CDH A;  3W6K B;  4OMZ A;  2UXN A;  2DW4 A;  2MH2 A;  2O61 A;  1D3Y A;  5CLS A;  5CJ9 A;  2BV6 A;  2IT0 A;  1H9G A;  4IJA A;  1HW5 A;  3JTG A;  1OYY A;  2V79 A;  2NYX A;  3F8N A;  2GA1 A;  1XSV A;  3TO7 A;  3T8T A;  1UST A;  5L3F A;  3FWE A;  1YFH A;  2EFP A;  3DXJ F;  3GO5 A;  4G8X A;  4CXF A;  3JSP A;  2C6Y A;  5FGM A;  4LLG F;  4LK0 F;  4MTD A;  5E20 A;  3NEU A;  4YFN F;  5CYV A;  2F5D A;  2ADU A;  4HV6 A;  4NQW A;  3GZ5 A;  1EH6 A;  2RV8 A;  4LG0 A;  3RYR A;  3SZT A;  5FD5 A;  5CVR A;  2G9W A;  5E8I A;  4KUM A;  1F5T A;  4XSX F;  1HSJ A;  3QAH A;  3D5L A;  1P2F A;  2JSC A;  5J6X A;  1W7P A;  1NHA A;  1Y0U A;  3MWM A;  3AAF A;  5IT9 Z;  3T0Y A;  2COM A;  2OA4 A;  3RDI A;  3KP5 A;  3L09 A;  3KP2 A;  1OKR A;  1XGM A;  2IP2 A;  2P6T A;  5BPD A;  1ON1 A;  2KIF A;  3KE2 A;  4U88 A;  3J80 Z;  1DPR A;  4LLN A;  1U78 A;  2A69 F;  1T2K A;  1RUO A;  5CVJ A;  1FBQ A;  4RGR A;  4Q47 A;  4RGS A;  3J7A O;  2RVC A;  3QRF F;  3MZH A;  2JRT A;  5LEJ A;  4G7H F;  1KQ8 A;  3N4M A;  4KN4 X;  3GWZ A;  4YIF A;  2ZKZ A;  2OAZ A;  3ZMV A;  2JZY A;  3M7G A;  3SHF A;  2F2E A;  5E18 F;  2XAJ A;  4KA4 A;  1BOA A;  3R60 A;  1BI3 A;  1IW7 F;  2BYV E;  1IUY A;  3QU3 A;  3JSO A;  2M30 A;  4KMF A;  1J2X A;  4I0B A;  2XUB A;  5K5R A;  2AS5 F;  5LBQ A;  4ENJ A;  2HYF A;  1YG2 A;  1FSH A;  3HOT A;  4XLP F;  4KMU X;  4G6D A;  3LA2 A;  4Q5S F;  3E5X A;  2VC1 A;  5BPI A;  3V7R A;  4YFK F;  5F6F A;  3GXO A;  4WWC A;  1I6X A;  3FXQ A;  4L9V A;  2QWW A;  1Z6T A;  3I71 A;  2EFN A;  2KKO A;  2MD5 A;  1U3E M;  3HOS A;  2KIM A;  2CSO A;  4RAZ A;  4PGG A;  1TTY A;  4F7Z A;  2HFH A;  4P9U A;  4UXN A;  3GFI A;  3E6C C;  2VOP A;  1QZY A;  1F4K A;  3IRR A;  2BEO A;  2QLZ A;  1WQ2 A;  1RIO H;  3T5X A;  2FSW A;  1MDM A;  3BP8 A;  2HKX A;  4Y15 A;  5LGU A;  4KIG A;  3L7W A;  5HOO A;  4FT8 A;  5JI6 A;  3IHU A;  2R3S A;  5L3G A;  1HW2 A;  1O57 A;  4N9I A;  1IF1 A;  2XIG A;  3O6B B;  1G4D A;  2HZT A;  2LNB A;  3RPQ A;  3HTU A;  1J75 A;  3WTU C;  2B0L A;  4Q48 A;  2Y48 A;  3REO A;  1U6G A;  5FB2 A;  4GCV A;  3KP6 A;  1S8N A;  1X3U A;  3TOB A;  3WE2 A;  4AIK A;  2Z33 A;  2E7W A;  2DT5 A;  5HS7 A;  1BI2 A;  2H09 A;  2RC4 A;  2P5K A;  3MCZ A;  1XN7 A;  1JE8 A;  1W7P D;  2CQK A;  1SMT A;  2DK8 A;  4O3M A;  4CDG A;  5D5V B;  3L9F A;  4LFU A;  1OMI A;  5FFZ A;  2OQR A;  2W24 A;  3HSE A;  1MZB A;  4LK1 F;  4RAY A;  4RGX A;  1W5T A;  1IXS B;  4WXH A;  2YX4 A;  2H6B A;  3M1E A;  1LDD A;  2FQ3 A;  2Z5U A;  3GFM A;  3D0S A;  4YFX F;  2HYG D;  1WRJ A;  1IN4 A;  2W25 A;  4HF2 A;  1HKT A;  4ZYG A;  2Z3Y A;  3SFZ A;  1Z9C A;  1G3W A;  1LQ1 A;  1K79 A;  3F72 A;  4M73 A;  1C0W A;  2Q0O A;  1U8R A;  3T1B A;  4OU0 A;  3TQN A;  3E5Q A;  2YX7 A;  3WTX C;  4FHT A;  4OIO F;  4H0E A;  3B02 A;  3LA7 A;  4EQQ A;  2LSO A;  1B1B A;  4IVN A;  2ISZ A;  4I98 B;  3ABT A;  2OBP A;  2QEN A;  3ZP5 A;  2O3F A;  2IA2 A;  3LQR A;  4ETS A;  2O0Y A;  4HOB A;  1SFU A;  4RB0 A;  4A6E A;  4UHT A;  1G3S A;  3KZY A;  2L54 A;  4U7D A;  3P7N A;  1XGO A;  4R1H A;  1IXR C;  5ICG A;  2NNY A;  4PGH A;  2FBH A;  4JBA A;  4UV8 A;  1YS7 A;  3HRM A;  1FX7 A;  3ELK A;  1ONV A;  1S6L A;  3F23 A;  4IRG A;  5ICF A;  4HQE A;  3KLO A;  1B59 A;  2LDU A;  1JGS A;  4EM0 B;  2IA0 A;  5D5X B;  4R79 A;  4WX9 A;  2VBW A;  4Y17 A;  5E8G A;  4B8X A;  3WTT C;  2HDC A;  4A5N A;  4WK8 F;  2EB7 A;  4RS8 A;  2XRN A;  2OQG A;  3TOA A;  4Q4Z F;  1KA8 A;  2P8T A;  3O3K A;  5DDG A;  2VOD A;  2QVO A;  1OYI A;  4PCQ A;  4XSZ F;  1FOK A;  3GYH X;  1JHF A;  2XVC A;  4PZJ A;  3FM5 A;  3ML6 A;  4I0A A;  1F9N A;  1ULY A;  1IN7 A;  4MNU A;  1BC7 C;  3J81 K;  1H9T A;  5DUK A;  4KN7 X;  1AWC A;  4G9Y A;  2PLY A;  5LEK A;  4IHT A;  3QP6 A;  1TQP A;  3LAJ A;  1ZGJ A;  4M9S A;  3WTY C;  4ZYH A;  2PEX A;  3S2W A;  1S3J A;  1QGP A;  3H3Z A;  5D6E A;  4MQ9 F;  3FMS A;  5L3D A;  3WGH A;  2VBZ A;  1RI7 A;  1U5T C;  5K1Y A;  1KU7 A;  2MH9 A;  3H92 A;  1IN6 A;  4N9H A;  3MZY A;  2EV0 A;  2IA1 A;  1CGP A;  1SD4 A;  3JAM K;  1O3R A;  5E1X A;  1T98 A;  4HA8 A;  2DI3 A;  1LJ9 A;  3CLO A;  4ENN A;  1K78 A;  2D1H A;  1D8J A;  1RZ4 A;  1ZLJ A;  2A5Y B;  2A61 A;  1J59 A;  1LNW A;  5FFX A;  2K4J A;  2M1B A;  5IT3 A;  4IPA A;  1XGS A;  3RJP A;  5FLX Z;  2FF4 A;  4DNC A;  4BQA A;  3E5U A;  3ERE D;  3IKT A;  2QQA A;  1Z05 A;  1KYZ A;  1LEB A;  1HBX G;  4EJW A;  2QQ9 A;  2H27 A;  4BHP A;  3IC7 A;  3ECO A;  4YG2 F;  2HEO A;  3IRQ A;  1XMK A;  2LKP A;  1BC8 C;  2FE3 A;  2XKO A;  3E6B A;  4M72 A;  3FXU A;  1KU3 A;  5L3E A;  2W84 A;  3KP4 A;  4EJT A;  2UWM A;  1FBS A;  4CHU A;  5DV5 A;  2K4B A;  4QWQ A;  2G7H A;  3HRT A;  2FBK A;  2UXX A;  3F22 A;  1YQA A;  3TO9 A;  2PJP A;  3EYI A;  3BY6 A;  3NQO A;  5J8C A;  3I59 A;  2QQB A;  1FP1 D;  4KIF A;  2F5F A;  2WWY A;  3U9G A;  2KIU A;  3GVA A;  1I1S A;  5ICC A;  1WWX A;  1R1T A;  3VOE A;  3WTV C;  2ZXJ A;  1T39 A;  5FO5 A;  2RNJ A;  4RGU A;  5LRS A;  5E1Z B;  2J5P A;  1OYW A;  2DTR A;  5HVQ C;  3F8C A;  2QBY B;  4NHJ A;  4HBL A;  4IXA A;  3R4K A;  5ILV A;  2BE5 F;  3N97 A;  4LGW A;  3W6J B;  3J81 Z;  1SAX A;  2HKO A;  3VEP A;  1XSX A;  3GF2 A;  2MLG A;  3EQL F;  3ZMS A;  1DPU A;  1WI9 A;  4U0W A;  1BI0 A;  1K6O A;  5E1W A;  5ILU A;  2HWV A;  2ISY A;  2EFQ A;  4HV5 A;  2E1N A;  2KJB A;  2PFB A;  1I27 A;  4S05 A;  1LDK B;  2KJC A;  2YPR A;  5K5Q A;  1GXP A;  4S04 A;  2XAH A;  5H6R A;  3MQ0 A;  2CGP A;  1U5T B;  3E6M A;  4AWX B;  1O7L A;  1V4R A;  2EFO A;  2LF7 A;  4I7H A;  2PN6 A;  4HAM A;  2ELH A;  3BRO A;  4WXC A;  3GX4 X;  2LF8 A;  4LB5 A;  2IW5 A;  2OU2 A;  1EV7 A;  4HX4 A;  1WKM A;  3HRS A;  3V8J A;  2UZK A;  1XCV A;  5HLH A;  4I2O A;  2EA2 A;  2H6C A;  3O2P E;  1G3T A;  1CF7 A;  3PQJ A;  2KRF A;  4GXO A;  2BBY A;  5D5U B;  1SD7 A;  3KFW X;  1J7K A;  1ZRE A;  2R7F A;  4HZF A;  4B09 A;  4G7Z F;  1SD6 A;  1HST A;  3KEO A;  1Z7U A;  3QOP A;  3FM3 A;  3WTZ A;  4FX0 A;  1ZGA A;  5HLG A;  2P5L C;  2VC0 A;  1ZYR F;  4P5O A;  4IF4 A;  2K02 A;  3DPL C;  1D8K A;  5EEG A;  2WV0 A;  4TV7 A;  5D8K B;  4BAY A;  5HLI A;  1YW9 A;  4EV0 A;  4MGR A;  2EFW A;  3V8K A;  3I4P A;  1P92 A;  2V1X A;  1J5Y A;  3V7C A;  3ABU A;  1I1G A;  2XRO A;  4I09 A;  2DLL A;  1ON2 A;  1FWZ A;  3TGN A;  3F8M A;  2XGX A;  3EDP A;  1G6N A;  1XB4 A;  3RPU A;  4JQF A;  1UFM A;  2VT3 A;  5CVU A;  2VE9 A;  2ZME B;  3HSF A;  2L3D A;  2OD5 A;  4DQ2 A;  1BIB A;  1VTN C;  1QO0 D;  3I0T A;  1REP C;  3WGI A;  2ACJ A;  2M45 A;  4HQM A;  4P55 A;  1FSE A;  1R36 A;  3DV8 A;  1G3Y A;  3ZMT A;  1R5G A;  3ROU A;  1PP7 U;  2VN2 A;  2STT A;  3CTA A;  2XAS A;  3EUH A;  3BWG A;  4LJZ F;  1E17 A;  4ESJ A;  1YO5 C;  1FP2 A;  1Q1H A;  1T0F A;  4N0B A;  4AVP A;  1XGN A;  2P4W A;  1XMA A;  3F8F A;  2D45 A;  3JTH A;  4EVI A;  4L9T A;  4ENM A;  1EH7 A;  1GVJ A;  1W4M A;  4P96 A;  1QNT A;  3LQQ A;  3P9I A;  1KQ0 A;  3G3Z A;  3HUG A;  2JT1 A;  1S7A A;  4AIJ A;  3C1D A;  4FX4 A;  1FYL A;  3R61 A;  2P7C B;  1GHC A;  2V1U A;  5ED4 A;  3M9A A;  1IZ1 A;  5KK1 A;  2WC2 A;  4A12 A;  1IAW A;  3FF5 A;  5K5O A;  3CO6 C;  2RDP A;  2A3S A;  3ECH A;  1ZLK A;  1GXQ A;  2W57 A;  3I58 A;  4IRH A;  2ETH A;  4XLN F;  4O6J A;  1U2W A;  4Y13 A;  2D1V A;  1H0M A;  1XDS A;  2FU4 A;  3BDD A;  2ZNZ A;  2Q2E A;  3HYI A;  1P4X A;  3L00 A;  3ZMD A;  4ZZD A;  5BMZ A;  2HQR A;  1LDJ A;  3RTR A;  2O03 A;  1TW3 A;  3I53 A;  5AIQ A;  4WCG A;  1P4A A;  2OZ6 A;  1XDU A;  1ODD A;  4ENK A;  2Y0M A;  1ZRC A;  1FY7 A;  2FBI A;  1ZAR A;  3Q9S A;  4ZZL A;  2J5O A;  2PMH A;  2K86 A;  3F6V A;  2IRF G;  4K2E A;  1USS A;  3K2Z A;  3KZZ A;  3WOD F;  4ON0 A;  3COA C;  2VT2 A;  2CO5 A;  1A04 A;  5JFR A;  5D4S A;  3VB2 A;  4CIC A;  4HX7 A;  1JHH A;  2ZBK A;  2NAZ A;  2GZW A;  4OIN F;  1BJA A;  1YTY A;  4UNO A;  2DQL A;  1XCB A;  4D0P A;  1TNS A;  5F64 A;  2K7L A;  3CJN A;  2CWE A;  3L2C A;  3HTS B;  4UVC A;  2L4A A;  2CFX A;  1BN5 A;  1YLF A;  2Z9O A;  4RB1 A;  3MFK A;  4KNY A;  1KU9 A;  2F5E A;  4OIP F;  1IN5 A;  5J8F A;  2IJL A;  2JTV A;  2V9V A;  4CZZ A;  3T8R A;  3OV8 A;  5IT9 K;  4G6Q A;  2V1D A;  2XAF A;  2P6S A;  5BS6 A;  4ESF A;  4KT5 C;  3DKW A;  3DP7 A;  3WTW C;  1PP8 F;  1FT9 A;  3BJ6 A;  3C7J A;  2FEZ A;  1HQC A;  3GLX A;  3SXY A;  2M87 A;  5EEH A;  2FOK A;  4XBF A;  3HHH A;  5F1R A;  4CGZ A;  3TKY A;  1YW7 A;  1FYK A;  1O3S A;  3RIR A;  3LA3 A;  2FA5 A;  3QP5 A;  1P6R A;  3K9T A;  4BYY A;  2RGV A;  3KCC A;  5E17 F;  4QLC U;  1FBU A;  2VOO A;  3V4G A;  2OZU A;  1Z91 A;  1IRG A;  4KIC A;  5DYM A;  1XSD A;  2XKP A;  1F1Z A;  2WTE A;  3ZN1 A;  1WSU A;  2O8X A;  3RI4 A;  2BGC A;  3GFL A;  5CVI A;  3ISP A;  2X0L A;  3GZ6 A;  2GQQ A;  2M5W A;  1LEA A;  2P7V B;  2A6H F;  3F21 A;  4AIH A;  5HS8 A;  5D4R A;  1DUX C;  5H6Q A;  3IL2 A;  3C3W A;  3F6O A;  2VE8 A;  2MA3 A;  2EWN A;  2YR2 A;  3MEX A;  5ERI A;  3CUQ C;  2NNN A;  2GWR A;  5AON A;  2MC3 A;  3M8F A;  3K0L A;  3HHG A;  4MTE A;  3BZ6 A;  3JW4 A;  1TW2 A;  1R22 A;  3FHZ A;  1MDM B;  3WU1 B;  2DPU A;  3HSR A;  1ZRD A;  4HF1 A;  2ZNY A;  3DPT A;  5L3C A;  3DF8 A;  1MJ9 A;  4BHC A;  3OOP A;  1YS6 A;  4HYE A;  3IWZ A;  1L3L A;  4CYD A;  1ZHF A;  4EGZ A;  1O3T A;  2EA4 A;  2YU3 A;  1YYV A;  3DFG A;  1QZZ A;  1T6S A;  4MQV A;  2M8E A;  2XAQ A;  1TBX A;  2EJR A;  2FMY A;  3U1D A;  2DPD A;  1E2X A;  3E6D A;  1I5Z A;  1HKQ A;  3I54 A;  2FML A;  4OIQ F;  1FLI A;  2CG4 A;  4AD9 A;  5DCM B;  4RB3 C;  1BBY A;  2F5C A;  3ZMZ A;  4EJV A;  4IHS A;  2HQN A;  1O3Q A;  2FNA A;  2A68 F;  1UHW A;  3HIF A;  4HW0 A;  3V7S A;  4O5V A;  4I01 A;  4M9Z A;  2PBI A;  2XAG A;  4A0Z A;  2NRA C;  1SFE A;  3I64 A;  2XV4 S;  4L0Y B;  1S29 A;  3SZP A;  1MJB A;  3E3V A;  4CO8 A;  5DCF A;  3EYY A;  5FD6 A;  1QBJ A;  3WGG A;  4G7O F;  2QYO A;  3TDZ C;  3FZV A;  4KFC A;  3JAM Z;  4HDV A;  1ZH5 A;  1R1U A;  2AXL A;  3ZMU A;  5LGT A;  2E7X A;  3E97 A;  5DD8 A;  4GYI A;  1FZP B;  3ULQ B;  3DQV C;  3BPV A;  3SQN A;  1XD7 A;  4EM2 A;  5LHH A;  4EGY A;  2FNP A;  1IN8 A;  1TQM A;  2ZO4 A;  2EK5 A;  2ZJ2 A;  4EJU A;  4MEY F;  4G94 A;  3GFJ A;  1BIA A;  4HLX A;  5D5W B;  4L18 B;  4MEX F;  2QM3 A;  2HOE A;  2RN7 A;  1R23 A;  3FX3 A;  4M6X A;  4YII A;  2G7U A;  4M6Y A;  3P9C A;  5ICE A;  3LFK A;  3MAJ A;  1Z6R A;  3CUQ B;  3LST A;  3ZPL A;  3BPX A;  1T38 A;  5LRR A;  1ZG5 A;  3RKY A;  5D6F A;  1OR7 A;  3KP7 A;  1SFX A;  5AIP A;  3NRV A;  1UCR A;  4A6D A;  2PI0 A;  2GXB A;  3GUD A;  1ZRF A;  2XHK A;  3HRU A;  2FRH A;  5TJJ A;  1FYM A;  4LB6 B;  4UV9 A;  5LHI A;  1V3F A;  3FMQ A;  1TNT A;  1PDN C;  1KU2 A;  4MHG A;  1R58 A;  3R0A A;  4U0V A;  1MJA A;  4A0X A;  3WE3 A;  2D2W A;  3I5U A;  3QU6 A;  5TRD A;  5A2Q K;  1TQI A;  1HKS A;  2DK5 A;  1IXC A;  2L4M A;  4GO1 A;  3GW2 A;  3K69 A;  4NB5 A;  4ESB A;  3LAP A;  4L5I A;  1B9N A;  4Z2Y A;  1MD0 A;  2DU9 A;  4HF0 A;  3TDU C;  3U2R A;  1EH8 A;  4M71 A;  3RYP A;  4KIB A;  2R7D A;  2CYY A;  2QBY A;  4U0Y A;  6PAX A;  4OOI A;  2Z99 A;  1K78 B;  1IRF A;  1DP7 P;  1FNN A;  1HW1 A;  5DCM A;  1S7O A;  2PMU A;  3LWF A;  2L01 A;  1HXD A;  1Z1D A;  2E1C A;  5CVV A; 
#chains in the Genus database with same CATH topology
 4BH9 A;  2HTJ A;  3WG9 A;  4D1Q A;  1D0Z A;  5JHU A;  2IPQ X;  3ZQI A;  5HDK A;  4A2U A;  3IKV A;  3PM1 A;  2JPC A;  5DUI A;  5B5E C;  2Y0S N;  1YW8 A;  4RAG A;  3LSG A;  1OPC A;  2DDA A;  5EJC A;  2VON A;  4A3D J;  4RB2 C;  4IL6 C;  2JPB A;  2XGC A;  1BM9 A;  1BR4 A;  2OJE D;  3JRB A;  2Z1D A;  3ESW B;  3G73 A;  4IRI A;  1U5T A;  2HTS A;  3ASO H;  3OYG A;  3OOU A;  3A01 A;  4B47 A;  2VBX A;  5FLV A;  1MKM A;  3HXL A;  3BJA A;  2FXA A;  4BXU A;  3DTK A;  4BNC A;  5HDN A;  1TP4 A;  1WJF A;  2NOG A;  3BTC A;  4HDU A;  5FLX K;  1U0J A;  3QWL A;  1QPM A;  5B1A H;  3DTE A;  3GEZ A;  1KQ9 A;  1UZC A;  1K7A A;  1B6A A;  2AHQ A;  1TC3 C;  2R7R A;  1FOY A;  4LD5 A;  1UB9 A;  2MLK A;  4UUV A;  5C3E J;  5H20 A;  4E7K A;  4BY7 J;  1UAA A;  2L9N A;  4NDL A;  2A07 F;  2OTL I;  3GTP J;  1D5V A;  3VYS B;  2JQ7 A;  1Y1V J;  1LB2 A;  1J9I A;  1POG A;  5LHG A;  1BA5 A;  1FPQ A;  2F5V A;  3OYE A;  1P7J A;  1SAN A;  1SMY F;  3RKX A;  2VBY A;  4XOR A;  1UG0 A;  3KEQ A;  4NQW B;  3CUO A;  4WXD A;  3Q5F A;  2EPF A;  2M9H A;  1S72 I;  3OYC A;  1A36 A;  3QYB A;  1STZ A;  3I59 B;  3VOD A;  3FIS A;  1BW6 A;  2A6E F;  4ABZ A;  1ORK A;  3TP0 A;  4LG0 B;  4UVA A;  2KIQ A;  5D8L B;  1X3Z B;  1JKQ C;  2ZFW A;  4M9X A;  2XPV A;  3CMM A;  1S9H A;  1RNL A;  4OMY A;  1WPK A;  1JXS A;  2O6G E;  2GIV A;  1RKT A;  4EM1 A;  2STW A;  3BJO A;  3DWL E;  1N77 A;  4L9N A;  3M3Y J;  3KLN A;  4E70 A;  4JOM A;  4I02 A;  4GYG A;  1W7P B;  2X4H A;  4M74 A;  2V6C A;  2ICW G;  2R7S A;  4EMS A;  3AL0 B;  3P9K A;  5HDG A;  4KDP A;  3J7A Y;  3V8L A;  1R00 A;  2LRE A;  2MGQ A;  3UNG C;  3CUQ A;  3FMR A;  1NTC A;  2GA2 A;  5DD4 A;  1W36 D;  4P9F A;  1TLH B;  1APL C;  4MFE A;  4ZJZ A;  1F43 A;  5HS9 A;  1T0F C;  2GAU A;  2KDZ A;  4ZYE A;  3S1R J;  1K4T A;  4L5J A;  2P5V A;  4FAS D;  5L3B A;  1B72 A;  2RQQ A;  5FRO A;  1B4A A;  1MBG A;  2DN0 A;  3HG9 A;  3ZRG A;  3IWF A;  1JI8 A;  1PUE E;  3KET A;  2ZJQ F;  4R8H A;  3RPU D;  2NS7 A;  3S1Q J;  2RQP A;  1MGT A;  2VXZ A;  2PG4 A;  3DEU A;  2CW0 F;  5JR3 A;  3FBN B;  1X1B A;  3JRD A;  5EG0 A;  4FE7 A;  2CW8 A;  4XMY A;  3WU0 A;  4PSX A;  5A2Q Z;  1W5S A;  5JVT A;  2Z16 A;  2Y2Z A;  3IH3 A;  3Q9V A;  3H3U A;  3TW6 A;  1GUU A;  2R5Z A;  2I8D A;  1P4W A;  4RLQ A;  2MYS A;  3W2A A;  2Y75 A;  2DBB A;  2A6T A;  4IOA F;  3QPT A;  4UVB A;  1XG1 A;  2ZME A;  1ZG1 A;  1J0R A;  1UHM A;  3KZI C;  4ZH4 F;  2E2H J;  4AC0 A;  3BOQ A;  2EV6 A;  3PL8 A;  4JK1 X;  3TO6 A;  3EUK L;  2NXN B;  3QPH A;  1FC3 A;  2CUJ A;  2O8K A;  2HGC A;  4A0Y A;  1YIO A;  4DBQ A;  4GGG A;  2NS0 A;  5H2F C;  3B6C A;  4IQ4 A;  1R7J A;  2JVH A;  5JLX A;  2HS5 A;  4GDF A;  1AOY A;  3K1M A;  4L0Z B;  1B8I A;  1SD5 A;  3AG3 H;  3ZQ7 A;  1L0O C;  5BQT A;  3KP3 A;  3I3L A;  4C2M J;  1ZN2 A;  3J80 K;  2GLO A;  2VI6 A;  3RZO J;  1BI1 A;  3K1N A;  3VFZ A;  4EJO A;  5KVR A;  1E3P A;  4L9J A;  2DFI A;  4LMY A;  3CO7 C;  4AYB N;  1TT5 B;  2O7O A;  1ZAO A;  5DEQ A;  2DOA A;  5BOX A;  1MBH A;  3K4B A;  5EYR A;  3AG1 H;  3ZOB A;  4M3E A;  4NC6 A;  2Q8K A;  5ILS A;  1I6H J;  3HC7 A;  3B73 A;  4HLY A;  1B9M A;  2EIN H;  3CP2 A;  2IVM A;  2M34 A;  3OL3 A;  5KAF C;  1LVA A;  2RKH A;  2QA4 I;  2AQE A;  4F55 A;  3JRE A;  4XLA A;  4ZTJ A;  1T8I A;  1CF7 B;  2KZV A;  2MBF A;  3PUB A;  3IP4 B;  5CPR B;  2EV5 A;  4DZJ A;  3PFI A;  3U21 A;  2H94 A;  2HVR A;  3F8B A;  3K1P A;  4ZYD A;  2V1N A;  3J7Y J;  1DDN A;  2K9N A;  3E7L A;  2BXZ A;  4KYW A;  4FE4 A;  2DO7 A;  2ZCW A;  3R6S A;  3M8E A;  3F3X A;  2CH0 A;  2W85 A;  3BTI A;  2QUF A;  4XRM A;  4BHB A;  1ZG3 A;  2ESN A;  1KGS A;  3IH4 A;  1QQI A;  2LY2 A;  2ZXH A;  3RCO A;  2ESH A;  3EET A;  3DKY A;  2L02 A;  4ASN A;  4LLL A;  5HNH A;  1RUN A;  1O7F A;  1KZH A;  4OIR F;  2K27 A;  4HST A;  4M6V A;  1ETW A;  1V5G A;  3WTS C;  1JJ8 C;  1KON A;  1BL0 A;  1HA8 A;  2ECC A;  4IEJ A;  2PQ8 A;  3ZN0 A;  2QZ8 A;  4PFP A;  5B66 C;  1RPW A;  2GXG A;  3RKW A;  5K7F A;  3C18 A;  4U7B A;  2PX9 A;  1KYW A;  1R1V A;  3HOX J;  4I6Z A;  3JRA A;  1FIP A;  2LC2 A;  1UEL B;  4XRF A;  1MMD A;  5LLQ A;  1R5H A;  1WHU A;  2XB5 A;  4WF2 A;  5LGN A;  1HLV A;  2QCO A;  3FXR A;  3CCS I;  3WG7 H;  1CQT A;  4A5M A;  5K7H A;  2HR3 A;  2YSR A;  3R0J A;  3HOZ J;  3PQK A;  3ZQG A;  1A6Q A;  4HX8 A;  2TDX A;  2DAO A;  3A02 A;  2X1C A;  4PDK A;  2ME0 A;  2W4S A;  3CDH A;  3W6K B;  5IOZ A;  1S5L C;  1SFO J;  4C3H J;  4DYQ A;  5GPC A;  4OMZ A;  1FOX A;  3D5S C;  2UXN A;  2DW4 A;  5EZG A;  1Z7L A;  2MH2 A;  3K4M A;  2XSD C;  2O61 A;  1D3Y A;  5CLS A;  3U1K A;  4A3M J;  3H35 A;  5CJ9 A;  2BV6 A;  4A69 C;  2IT0 A;  1H9G A;  4IJA A;  2K9S A;  1ETV A;  3ERM A;  3S93 A;  5K7Z A;  1HW5 A;  4E7L A;  3HOY J;  3X2Q H;  3JTG A;  1OYY A;  2V79 A;  2NYX A;  3F8N A;  4OAY A;  3TBI A;  1IC8 A;  3GCM A;  2GA1 A;  1XSV A;  2XAU A;  2WAQ N;  3TO7 A;  3T8T A;  1UST A;  5L3F A;  3FWE A;  1YFH A;  2EFP A;  3DXJ F;  2KT0 A;  3GO5 A;  4G8X A;  2R93 J;  2YS9 A;  4CXF A;  3JSP A;  2C6Y A;  2VIX A;  5FGM A;  4LLG F;  4LK0 F;  4MTD A;  3K10 A;  2JA2 A;  5E20 A;  3NEU A;  2JA8 J;  4YFN F;  5CYV A;  2F5D A;  2ADU A;  4HV6 A;  4NQW A;  3GZ5 A;  1EH6 A;  4A3C J;  4Z6Y A;  1JUS A;  1IO2 A;  2DA4 A;  2RV8 A;  4W1U A;  2XDV A;  4LG0 A;  2LBF B;  3RYR A;  3OS0 A;  1NG7 A;  2DT6 A;  4M3G A;  3SZT A;  2E2J J;  5FD5 A;  2CUZ A;  4XLH A;  5CVR A;  2G9W A;  5E8I A;  9ANT A;  4I76 A;  3HEF A;  4KUM A;  1F5T A;  3KYC B;  1DQU A;  4XSX F;  1HSJ A;  3QAH A;  3D5L A;  4DOZ A;  1P2F A;  1JUM A;  5E3N A;  2JSC A;  5J6X A;  4BDZ A;  1W7P A;  4RM2 A;  1NHA A;  3K2A A;  3WHB A;  1VZ0 A;  3CMY A;  1Y0U A;  3MWM A;  3AAF A;  2M0M A;  5IT9 Z;  3T0Y A;  2JA6 J;  2COM A;  2OA4 A;  3RDI A;  2X6W A;  2HXO A;  4W97 A;  3KP5 A;  3L09 A;  3KP2 A;  1MNM C;  1MMA A;  1W5C C;  2WAD A;  3H9Q A;  1ERD A;  1JT6 A;  3E0J B;  1OKR A;  5J1U A;  3CP8 A;  1MH4 A;  2L7K A;  1MW7 A;  3S16 J;  5IP9 J;  3MD2 A;  1XGM A;  2ME6 A;  4S0H B;  3LSJ A;  2IP2 A;  2NVQ J;  2P6T A;  3C2B A;  4NUB A;  5BPD A;  1ON1 A;  3OYM A;  3VYU B;  5E3L A;  2KIF A;  3KE2 A;  3G2B A;  4U88 A;  3J80 Z;  1DPR A;  1TWH J;  4LLN A;  3LSI A;  3FK7 A;  3I4M J;  1U78 A;  2A69 F;  1T2K A;  1RUO A;  5CVJ A;  2VLA A;  3OMY A;  1FBQ A;  3H9J A;  4RGR A;  4Q47 A;  4B44 A;  4BS9 A;  1W0T A;  4RGS A;  3J7A O;  2RVC A;  3N05 A;  3QRF F;  1BOB A;  2BVL A;  4N4O B;  3M1C A;  2M0C A;  3MZH A;  2MAB A;  3VSL A;  2JRT A;  4NC8 A;  5LEJ A;  4G7H F;  1KQ8 A;  3MMY B;  3CF5 F;  5M5X J;  3N4M A;  3CCU I;  4KN4 X;  2OUM A;  4PJ0 C;  4CYC B;  3OL4 A;  4UB6 C;  3GWZ A;  2IAI A;  5FLM J;  4YIF A;  1FTZ A;  2ZKZ A;  2OAZ A;  3ZMV A;  2EBI A;  2JZY A;  3M7G A;  3SHF A;  2F2E A;  1IDY A;  3JRI A;  2BW3 A;  4BJ5 C;  5E18 F;  2XAJ A;  3Q0U A;  1W1W E;  4KA4 A;  1BOA A;  1XX5 A;  2PMZ N;  3CME I;  3R60 A;  3KYD B;  1BI3 A;  1IW7 F;  1D1C A;  2BYV E;  1WCM J;  3BT9 A;  1LPQ A;  2KP6 A;  1IUY A;  4DBR A;  5J47 A;  3QU3 A;  4XOP A;  3JSO A;  2M30 A;  4KMF A;  2EIM H;  4XIC A;  1J2X A;  4MFD A;  4E7I A;  4I0B A;  1DGW Y;  4C2T A;  2AQF A;  2XUB A;  2DMN A;  3MVP A;  5K5R A;  2AS5 F;  3JRH A;  1W0U A;  1DU0 A;  2BOL A;  5LBQ A;  4ENJ A;  4F93 B;  3VYT B;  2HYF A;  2NOJ B;  1G59 A;  5IYD J;  1YG2 A;  1FSH A;  2LG4 A;  2NS8 A;  3HOT A;  4XLP F;  3KX2 A;  4KMU X;  4G6D A;  1N75 A;  2N8G A;  3LA2 A;  4A3K J;  1MBK A;  4Q5S F;  1VQ8 I;  3E5X A;  2IBD A;  2VC1 A;  5BPI A;  4LIT A;  2V26 A;  4D7N A;  4QPO A;  3CZ6 A;  3V7R A;  1R71 A;  4IOC F;  4YFK F;  5F6F A;  4B3A A;  1FTT A;  1Y56 A;  3GXO A;  2X6X A;  4WWC A;  3CC2 I;  4V19 K;  2L9R A;  1I6X A;  3FXQ A;  4L9V A;  2M7B A;  2QWW A;  2DFE A;  1Z6T A;  3W2V A;  3BZC A;  3I71 A;  2EFN A;  2KKO A;  2MD5 A;  4PUS A;  2GM4 A;  1U3E M;  2VQC A;  3HOS A;  2KIM A;  3JRC A;  2CSO A;  3S15 J;  2OTJ I;  3S3N A;  4HEA 2;  1TWC J;  4RAZ A;  3BR0 A;  2WB1 A;  3FKI J;  3QYF A;  4PGG A;  1LUJ B;  5F08 A;  2GOX B;  1TTY A;  4F7Z A;  3S8P A;  3HM5 A;  5LD2 C;  2HFH A;  4OWR B;  4XOT A;  1A31 A;  4P9U A;  3F0C A;  4A3B J;  4UXN A;  5CVV A;  3HPH A;  3GFI A;  3E6C C;  4B48 A;  2VOP A;  1QZY A;  1F4K A;  2E1O A;  1X1A A;  1ETQ A;  2BEO A;  2BXY A;  1WQ2 A;  1SVO A;  2QLZ A;  3IRR A;  1PUF A;  4RA2 A;  3CCJ I;  1RIO H;  3T5X A;  2FSW A;  1MDM A;  3BP8 A;  4C2U A;  3HOV J;  4AU7 A;  2HKX A;  4Y15 A;  5LGU A;  1WJD A;  2V6E A;  4KIG A;  4P1W A;  5TGT A;  1VQP I;  4IHX A;  1YX3 A;  1YE9 A;  2L0K A;  3L7W A;  5HOO A;  3H1C A;  3HKZ A;  3I55 I;  2LY9 A;  4F52 A;  1VQ5 I;  4FT8 A;  5JI6 A;  3IHU A;  2OF7 A;  5IP7 J;  3ONQ A;  2R3S A;  5L3G A;  1HW2 A;  1O57 A;  2BY2 A;  4N9I A;  1IF1 A;  3AKZ A;  2LH9 A;  3PUF A;  3DEW A;  5E3M A;  5FKM A;  1XPX A;  1Y8R B;  2XIG A;  3O6B B;  1G4D A;  2HZT A;  2LNB A;  4YEJ A;  2EIJ H;  3RPQ A;  3HTU A;  3RQI A;  1Y8Q B;  3PJR A;  2DJN A;  1PYV A;  1J75 A;  3Q3S A;  3WTU C;  2B0L A;  4Q48 A;  4AID A;  4BJ6 C;  2TRT A;  2Y48 A;  5M3M J;  3REO A;  2F4O B;  1U6G A;  3CJQ B;  5FB2 A;  4GCV A;  3M8J A;  3LSK A;  3E1S A;  1R4M B;  3HL2 A;  3KP6 A;  1X4O A;  1S8N A;  3JRF A;  4CZC A;  3PSF A;  1AKH B;  5GAD J;  1X3U A;  4XL9 A;  1V5E A;  3TOB A;  3WE2 A;  5J40 A;  4ZDL A;  2HOT A;  1IUF A;  4M3D A;  3DU6 A;  3CCQ I;  4AIK A;  2Z33 A;  3H9G A;  2E7W A;  2M4G A;  2DT5 A;  5HS7 A;  1BI2 A;  2DOF A;  2H09 A;  2RC4 A;  1OLT A;  2P5K A;  4XID A;  1SEU A;  3MCZ A;  1XN7 A;  2EZL A;  2WAF A;  4N4N B;  1JE8 A;  2VPL A;  4PFO A;  1W7P D;  4XK4 A;  2VKH A;  2CQK A;  1SMT A;  2DK8 A;  4CCM A;  3CCY A;  5LFA A;  4O3M A;  1OJL A;  5KNL A;  1TT0 A;  3L2W A;  4CDG A;  5D5V B;  1UHS A;  2HOA A;  1HDD C;  3L9F A;  4LFU A;  1OMI A;  5FFZ A;  2OQR A;  2W24 A;  1WJA A;  3HSE A;  1MZB A;  4LK1 F;  4RAY A;  4RGX A;  3OYK A;  1W5T A;  1IXS B;  4WXH A;  3H36 A;  2VJI A;  2YX4 A;  2H6B A;  3G1L A;  3M4O J;  4HNV A;  2JVG A;  3M1E A;  4BE0 A;  1LDD A;  2FQ3 A;  2Z5U A;  1ETY A;  1IDZ A;  2I5U A;  3GFM A;  1VQ6 I;  3D0S A;  4YFX F;  2HYG D;  1VI0 A;  1QU3 A;  1WRJ A;  3TED A;  1IN4 A;  2XSJ C;  1WJB A;  2W25 A;  4HF2 A;  1FEX A;  5J1R A;  1HKT A;  2DMP A;  1MBE A;  5J4V A;  1OCZ H;  4C3I J;  4AUX A;  2L7M P;  2Z3Y A;  4ZYG A;  3SFZ A;  1Z9C A;  2CV1 A;  1G3W A;  1LQ1 A;  1K79 A;  3F72 A;  4M73 A;  1ZKG A;  1C0W A;  2AXT C;  1N78 A;  1FIA A;  2Q0O A;  2LKX A;  3JR9 A;  1X4P A;  3DBH B;  1U8R A;  3T1B A;  5C4X J;  4FQG A;  4OU0 A;  5F0F A;  4BEH A;  2VAS A;  5EGO A;  3L1P A;  3TQN A;  3E5Q A;  2QKL B;  2YX7 A;  1W36 C;  3K4J A;  3WTX C;  4FHT A;  5F0C A;  4OIO F;  2EQR A;  1OR7 C;  2NVU B;  4H0E A;  2HPM A;  3B02 A;  2CJJ A;  2DYS H;  2LKS A;  3LA7 A;  1UMQ A;  2IXS A;  2Q1Z B;  4EQQ A;  1AU7 A;  3LSH A;  2LSO A;  4E4H A;  2BY0 A;  1B1B A;  4BAC A;  1Z21 A;  4IVN A;  3PSI A;  1Y6I A;  2ISZ A;  5KAI C;  4I98 B;  3ABT A;  4F92 B;  2OBP A;  4LIV A;  2QEN A;  4MO7 A;  3ZP5 A;  2O3F A;  2WV1 A;  4ANJ A;  2IA2 A;  3LQR A;  4ETS A;  2O0Y A;  4HOB A;  2WY7 Q;  4RB0 A;  4QTR A;  1SFU A;  4A6E A;  3M07 A;  4UHT A;  1HCR A;  2V9P A;  5JVG F;  1G3S A;  2H1L A;  3KZY A;  4DIQ A;  2L54 A;  4XN0 A;  3GTJ J;  3TL4 X;  4U7D A;  3P7N A;  1XGO A;  3HB9 A;  2E36 A;  4R1H A;  1IXR C;  5ICG A;  2NNY A;  4PGH A;  2FBH A;  3S3M A;  4JBA A;  1AA7 A;  4UV8 A;  3ZQC A;  2ZC2 A;  1YS7 A;  5EF6 A;  3QPL A;  1Z67 A;  3HRM A;  5GAG J;  1HOM A;  1FX7 A;  4RBO A;  2Y30 A;  3ELK A;  1YRN A;  1ONV A;  1S6L A;  4NC7 A;  3F23 A;  4IRG A;  5ICF A;  3FHN A;  4HQE A;  3EUH C;  3KLO A;  2E5Z A;  3RSN A;  1I39 A;  3VDX A;  1B59 A;  2LDU A;  2FD5 A;  4MLO A;  3MKZ A;  2FUG 2;  1WJ5 A;  1JGS A;  5CKT A;  4EM0 B;  3L2Q A;  2V4J C;  2IA0 A;  5D5X B;  4R79 A;  4WX9 A;  2VBW A;  3MKL A;  4BKX A;  3PNT A;  4Y17 A;  2JA7 J;  5E8G A;  1IJW C;  2R7V A;  3HOU J;  1LFB A;  4B8X A;  3WTT C;  3LNQ A;  2HDC A;  1R9T J;  4A5N A;  4WK8 F;  2EB7 A;  4RS8 A;  2XRN A;  2OQG A;  3TOA A;  3OIQ A;  1OIS A;  4Q4Z F;  1KA8 A;  2P8T A;  2JMW A;  1MND A;  3O3K A;  2Y69 H;  5DDG A;  2VOD A;  2QVO A;  4IHV A;  1YIT I;  3SZG A;  1FMW A;  1OYI A;  3MKW B;  1QRY A;  4PCQ A;  2E34 A;  4XSZ F;  1FOK A;  3GYH X;  3BR1 A;  4BXF A;  1JHF A;  5HOD A;  4FTH A;  1RKW A;  4UUT A;  2XVC A;  4PZJ A;  2R5Y A;  3FM5 A;  3ML6 A;  4I0A A;  1F9N A;  1ULY A;  4CH7 A;  4HG2 A;  1IN7 A;  4BDY A;  2QEX I;  4MNU A;  3OYI A;  1BC7 C;  5FRN A;  3OY9 A;  2HDW A;  2B9S A;  4IHY A;  2TCT A;  3J81 K;  1H9T A;  3H5N A;  2Y9Y A;  5DUK A;  4KN7 X;  1AWC A;  4G9Y A;  3GTM J;  2PLY A;  5LEK A;  4IHT A;  2DA1 A;  3QP6 A;  4B43 A;  3FXK A;  1TQP A;  2XRL A;  3ZQH A;  1ZGJ A;  3LAJ A;  2HVS A;  3OIP A;  4BE2 A;  1LFU P;  4M9S A;  5FKK A;  5J3L A;  4A3L J;  2GXA A;  3WTY C;  4ZYH A;  3G6E I;  2PEX A;  3S2W A;  1S3J A;  1QGP A;  3H3Z A;  5D6E A;  4MQ9 F;  3FMS A;  4C9Y A;  5L3D A;  5EDN A;  3BG5 A;  1QHH D;  1IRZ A;  3BCA A;  1ZEL A;  4D9J A;  1VND A;  1BW5 A;  2BHY A;  3MZ8 A;  3WGH A;  2DA5 A;  1JUP A;  1XS9 A;  2HPI A;  3HOW J;  2VBZ A;  4FCY A;  2KDO A;  1RI7 A;  1U5T C;  5K1Y A;  1KU7 A;  1FMV A;  2MH9 A;  3K70 D;  3H92 A;  2UV1 A;  3HPG A;  3DLA A;  3GME A;  1IN6 A;  2R7T A;  4JX5 A;  1MMS A;  4N9H A;  4D5F A;  2W48 A;  2P81 A;  4KT6 A;  2W00 A;  3MZY A;  1VQO I;  2EV0 A;  2IA1 A;  1AKH A;  1CGP A;  1SD4 A;  1VQL I;  3JAM K;  4XNF A;  5GAH J;  2MSY A;  2E1M C;  3AG2 H;  3CDI A;  3KEY A;  5E1X A;  1O3R A;  1SFK A;  1T98 A;  4QIW N;  2EH3 A;  3I56 I;  4HA8 A;  4PSW A;  1SVL A;  2FX0 A;  2DI3 A;  1LJ9 A;  2KL4 A;  3CLO A;  4ENN A;  1K78 A;  2QSG X;  2D1H A;  3MKY B;  2DJI A;  1D8J A;  1RZ4 A;  3SDB A;  4XKV A;  5E79 C;  2IS4 A;  1DP3 A;  1J09 A;  1ZLJ A;  4NBQ A;  2A5Y B;  2A61 A;  3G71 I;  1J59 A;  2ELJ A;  3K6G A;  4XKW A;  1LNW A;  1NK3 P;  1WH5 A;  5FFX A;  2K4J A;  2M1B A;  5IT3 A;  3RZD J;  4IPA A;  1XGS A;  3RJP A;  2E5N A;  3NAU A;  5FLX Z;  2FF4 A;  1X3W B;  2F4I A;  4Y4R A;  3Q0W A;  1JTY A;  2JWT A;  4DNC A;  4BQA A;  3QYE A;  3E5U A;  4G12 A;  2IGM A;  2R4G A;  2DXI A;  3SDG A;  2ZFU A;  3ZQF A;  3ERE D;  2MW8 A;  3IKT A;  5FKN A;  2QQA A;  1Z05 A;  2DOD A;  3NWS A;  1I3Q J;  4BY1 J;  1KYZ A;  1LEB A;  2DCE A;  2CQQ A;  1NH3 A;  4CUG A;  1H8A C;  4E7Z A;  2LTP A;  1HBX G;  4EJW A;  2QQ9 A;  4A3E J;  1H88 C;  2H27 A;  3BG7 A;  1AHD P;  4CSW A;  3P5J A;  4BHP A;  3FXL A;  3IC7 A;  3VYR B;  3ECO A;  4YG2 F;  3SJM A;  2HEO A;  2F4M B;  4UY8 I;  3IRQ A;  1XMK A;  2LKP A;  2HQA A;  1BC8 C;  2FE3 A;  2JN6 A;  1X19 A;  1R5I D;  2XKO A;  3E6B A;  4M72 A;  1T08 B;  3FXU A;  3ZQL A;  1KU3 A;  3TP3 A;  5L3E A;  2W7N A;  1ZTR A;  2W84 A;  5F0H A;  3KP4 A;  4EJT A;  2UWM A;  1FBS A;  4CHU A;  4KIT B;  5DV5 A;  2K4B A;  1WZ2 A;  1QPI A;  4QWQ A;  2G7H A;  5J1Y A;  3HRT A;  5KCM A;  2FBK A;  4EEF G;  2UXX A;  3F22 A;  1YQA A;  3TO9 A;  2VJ5 A;  2PJP A;  3EYI A;  3BY6 A;  3NQO A;  1E3H A;  1RR8 C;  2M3A A;  3I59 A;  5J8C A;  4AYB A;  2QQB A;  2ZME C;  1FP1 D;  2IGN A;  3OYD A;  2JUC A;  4KIF A;  2K5C A;  2F5F A;  2H1K A;  2WWY A;  3U9G A;  1Z3X A;  2KIU A;  3SEZ A;  3GVA A;  2E19 A;  2ECB A;  1I1S A;  1QHG A;  5ICC A;  1WWX A;  1R1T A;  3VOE A;  4XLE A;  3WTV C;  3WU2 C;  2ZXJ A;  2BHZ A;  1T39 A;  3DKX A;  5FO5 A;  2RNJ A;  4RGU A;  4V2F A;  5FKL A;  5LRS A;  1MBF A;  1Y1W J;  5E1Z B;  5FJ8 J;  2J5P A;  1OYW A;  1V55 H;  3Q0V A;  2DTR A;  3SEQ A;  3OYN A;  2M4K A;  4Y7N J;  5HVQ C;  3F8C A;  2IGK A;  1U9N A;  2KRC A;  3FXO A;  4ZYA A;  3GTL J;  3HUG B;  2KFD A;  2QBY B;  1VQ7 I;  1ZR4 A;  3OWT A;  4IKF A;  4G6T B;  3CCR I;  2LMD A;  5IYC J;  4HBL A;  4NHJ A;  4IHW A;  4IXA A;  3R4K A;  5ILV A;  2BE5 F;  3N97 A;  3PO3 J;  2X1D A;  4LGW A;  3W6J B;  1FOW A;  2XGE A;  3J81 Z;  1SAX A;  2HKO A;  3VEP A;  1XSX A;  3GF2 A;  2MLG A;  3EQL F;  3ZMS A;  3A2K A;  2LR8 A;  4AM3 A;  4BXX J;  1RR7 A;  4C30 A;  3G1O A;  1DPU A;  1WI9 A;  3KIO A;  2VQH A;  4U0W A;  5IOY A;  1BI0 A;  3I4N J;  1K6O A;  3PIO F;  5E1W A;  4BE1 A;  2Y9Z A;  5ILU A;  1R4N B;  1BR1 A;  4F91 B;  2HWV A;  2ISY A;  3B6A A;  3UKG A;  2EFQ A;  4HV5 A;  4BU2 A;  1JKP C;  3LSR A;  2DT7 B;  2E1N A;  2KJB A;  1EF4 A;  2CV0 A;  2PFB A;  1I27 A;  2AO9 A;  3BR6 A;  3BTJ A;  4S05 A;  1LDK B;  5FRM A;  1Y0N A;  2KJC A;  2YPR A;  5K5Q A;  1SC7 A;  1GXP A;  4S04 A;  4A3F J;  4XRS G;  2XAH A;  3DBL B;  5H6R A;  3RQ4 A;  3MQ0 A;  2CGP A;  1U5T B;  1BJZ A;  3A01 B;  3E6M A;  5F1J A;  1MBJ A;  4AWX B;  1O7L A;  1V4R A;  2EFO A;  2Q2E B;  4PJN A;  2LF7 A;  2KIS A;  3HKZ N;  2PN6 A;  4I7H A;  3OYF A;  2PJR B;  1UG2 A;  1RC9 A;  4HAM A;  2V7F A;  3IAS 2;  2ELH A;  1VQ9 I;  3OR1 C;  3BRO A;  4WXC A;  3GX4 X;  2HYJ A;  1JJ6 C;  2E1M B;  1YJ9 I;  2VQG A;  2EZH A;  2LF8 A;  2DMT A;  4LB5 A;  2IW5 A;  2OU2 A;  1EV7 A;  5DM7 F;  4HX4 A;  1P9Q C;  1WKM A;  3HRS A;  2DFF A;  3V8J A;  2UZK A;  1XCV A;  3A0H C;  5HLH A;  4I2O A;  1K4S A;  2EA2 A;  2H6C A;  3O2P E;  3S32 A;  3A03 A;  3F9K A;  1T95 A;  4UUS B;  3S14 J;  2R0Q C;  1G3T A;  2L9S A;  1TWF J;  2QSF X;  1CF7 A;  3OYL A;  2M8G X;  3PQJ A;  2KRF A;  2L9V A;  3CDL A;  4JYK A;  4GXO A;  2BBY A;  5D5U B;  1DGR M;  1SD7 A;  2A5W A;  3KFW X;  1J7K A;  3BLY A;  2EIL H;  1ZRE A;  2R7F A;  1P7I A;  3FDY A;  4LG3 A;  1EJ9 A;  4HZF A;  4B09 A;  3VPR A;  4XLF A;  5E3O A;  2R7Z J;  4G7Z F;  1SD6 A;  2XC7 A;  1HST A;  3KEO A;  5C44 J;  1Z7U A;  2M7A A;  3FM3 A;  3QOP A;  4LOC A;  3WTZ A;  4FX0 A;  1ZR2 A;  2NVT J;  1ZGA A;  2A05 A;  2QKM B;  5HLG A;  3H0G J;  2P5L C;  2VC0 A;  1ZYR F;  4P5O A;  2CQN A;  3LFU A;  4IF4 A;  2K02 A;  3DPL C;  1D8K A;  5EEG A;  2WV0 A;  3OSF A;  1FJL A;  4TV7 A;  3H5R A;  5D8K B;  5HLI A;  4BAY A;  1LVK A;  1YW9 A;  4EV0 A;  1N25 A;  4YEL A;  4MGR A;  1XTA A;  2EFW A;  4BBS J;  3V8K A;  2MG4 A;  4CCJ A;  2CQ7 A;  3I4P A;  1P92 A;  2V1X A;  2X85 A;  5M5Y J;  5F27 A;  1J5Y A;  3V7C A;  3ABU A;  4PJJ A;  1IRX A;  2FJ1 A;  1I1G A;  2JK3 A;  2XRO A;  4I09 A;  2DLL A;  1ON2 A;  4XQF A;  1FWZ A;  4PJL A;  3TGN A;  4DYC A;  1X2M A;  3F8M A;  2XGX A;  3EDP A;  1G6N A;  5EG0 B;  1XB4 A;  3SYT A;  3EUA A;  3RPU A;  4JQF A;  1UFM A;  3S2D J;  2VT3 A;  5BNG A;  5CVU A;  1GDT A;  2VE9 A;  2ZME B;  3HSF A;  2L3D A;  2OD5 A;  3OIO A;  5GP9 A;  1Q1V A;  4DQ2 A;  1BIB A;  3LSM A;  2OCC H;  4B3X A;  1VTN C;  2VQL A;  1QO0 D;  3BR3 A;  4GRI A;  4V2G A;  3I0T A;  3IH2 A;  1REP C;  3WGI A;  2ACJ A;  3BZK A;  2M45 A;  4HQM A;  4P55 A;  4Y33 A;  4XR6 A;  5EEA A;  1FSE A;  1R36 A;  3DV8 A;  4CCO A;  1G3Y A;  3ZMT A;  1R5G A;  1B8I B;  3ASN H;  3ROU A;  1PP7 U;  2VN2 A;  2STT A;  3HZJ A;  3IAM 2;  3CTA A;  2XAS A;  2BY1 A;  3EUH A;  3BWG A;  4LJZ F;  2YU9 J;  4ESJ A;  1YO5 C;  1E17 A;  4X0G A;  1LE8 B;  2NVX J;  1Q1H A;  1FP2 A;  1LFP A;  1T0F A;  4N0B A;  2PMZ A;  4AVP A;  1XGN A;  2P4W A;  2LBF A;  2H8R A;  3S3O A;  2W1O A;  3DEE A;  1XMA A;  4BGD A;  2JUG A;  3F8F A;  2D45 A;  3JTH A;  1F36 A;  2R92 J;  2RAE A;  4EVI A;  4L9T A;  4ENM A;  3W6V A;  3QOE A;  1EH7 A;  1GVJ A;  4DGW B;  1W4M A;  4P96 A;  1QNT A;  3LQQ A;  3NAR A;  5HLT A;  1X1C A;  3DTI A;  3P9I A;  1KQ0 A;  1ETX A;  3G3Z A;  3HUG A;  2JT1 A;  4IZZ A;  1GVD A;  2LOO A;  4FIS A;  4Y52 J;  1S7A A;  4QSH A;  3CLQ A;  5KHD A;  3J7Z I;  4AIJ A;  4H4K C;  3C1D A;  2VPR A;  3IV5 A;  3QPS A;  4ZTF A;  4FX4 A;  4E6K G;  2K9L A;  1IGN A;  1FYL A;  3R61 A;  2P7C B;  3SFI A;  2CQX A;  1GHC A;  2V1U A;  5ED4 A;  3M9A A;  4D5C A;  1IZ1 A;  5KK1 A;  2RNG A;  3K4N A;  2WC2 A;  3KPH A;  1QVT A;  4A12 A;  1IAW A;  2VJ4 A;  3FF5 A;  4EAT A;  5K5O A;  3CO6 C;  2RDP A;  2A3S A;  3ZQQ A;  3ECH A;  1ZLK A;  1GXQ A;  2W57 A;  1EA3 A;  3I58 A;  4IRH A;  2ETH A;  2KRH A;  4XLN F;  2R7O A;  4MIM A;  4O6J A;  3GTO J;  4XN3 A;  3C2H A;  1U2W A;  4Y13 A;  2D1V A;  2RRE A;  1H0M A;  2UUZ A;  1GV2 A;  1XDS A;  3BDD A;  2FU4 A;  1X1P A;  3D5R C;  2ZNZ A;  2ZB9 A;  2HQ5 A;  2Q2E A;  1NK2 P;  3HYI A;  3A4C A;  1P4X A;  3L00 A;  4CYC A;  1YI2 I;  2PJR A;  3PNY A;  3ZMD A;  3O8G A;  4ZZD A;  3CCM I;  3K4K A;  2CU7 A;  1WFX A;  5BMZ A;  2HQR A;  1LDJ A;  2R7Q A;  3JRG A;  3RTR A;  1HF0 A;  2O03 A;  4RMN A;  1TW3 A;  2YUS A;  4BQQ A;  2FQ4 A;  3DCF A;  3I53 A;  3DU5 A;  1RES A;  2LP0 A;  5AIQ A;  4ZDP A;  4WCG A;  2H8W A;  4F3Q A;  1P4A A;  4E7J A;  4BUP A;  2OZ6 A;  2ZSH B;  3FXJ A;  1XDU A;  3TMO A;  4XKB A;  4UUS A;  1ODD A;  4ENK A;  2Y0M A;  2EZI A;  1JGG A;  1FY7 A;  1ZRC A;  2BZT A;  2FBI A;  1ZAR A;  3LMM A;  1ACI A;  2CV2 A;  3Q9S A;  4ZZL A;  3ZXS A;  4L5E A;  3GLL A;  2J5O A;  2X6O A;  3LSP A;  2PMH A;  4RLF A;  4IX7 A;  2K86 A;  1TWG J;  3F6V A;  5CQE A;  1ETO A;  2IRF G;  2EIK H;  4ZDO A;  2VB6 A;  4K2E A;  1USS A;  1ZQ3 P;  2CRG A;  3K2Z A;  3KZZ A;  2QGU A;  3WOD F;  3S17 J;  1QA6 A;  2K40 A;  4ON0 A;  1WI3 A;  3COA C;  2DA6 A;  2F48 A;  5B3S H;  5M3F J;  2VT2 A;  2CO5 A;  1A04 A;  1OCO H;  4DYR A;  5JFR A;  5IY5 H;  2LVS A;  2JA5 J;  5D4S A;  3VB2 A;  2MD0 A;  3AG4 H;  4OAZ A;  4CIC A;  2E2I J;  2X9D A;  3GBG A;  2JSP A;  4HX7 A;  3S2H J;  1OFC X;  1JHH A;  2ZBK A;  3HBL A;  2NAZ A;  3V42 A;  2GZW A;  4OIN F;  1BJA A;  1YTY A;  4XM3 A;  3CCE I;  4UNO A;  2DQL A;  1XCB A;  4D0P A;  1TNS A;  5F64 A;  2K7L A;  5IP6 A;  2HDD A;  3CJN A;  2LLK A;  2CWE A;  5J4Y A;  4E7S A;  3L2C A;  2LRD A;  2E60 A;  2BY3 A;  3OR2 C;  3HTS B;  4B1R A;  2KMU A;  1A6I A;  1BR2 A;  2B7E A;  2L4A A;  4UVC A;  3K70 C;  1V54 H;  2CFX A;  2ZJR F;  4FET A;  3K4L A;  1BN5 A;  1YLF A;  1WVR A;  3A1Y A;  2Z9O A;  2VL8 A;  1SVM A;  5B1B H;  4RB1 A;  3MFK A;  4KNY A;  1KU9 A;  3CQZ J;  2O5R A;  2P0W A;  2F5E A;  2Y0S A;  4OIP F;  1VQK I;  1IN5 A;  5J8F A;  2IJL A;  2JTV A;  3HDD A;  4BBR J;  4UB8 C;  2E35 A;  4HPQ A;  2V9V A;  2E71 A;  4CZZ A;  5GTI C;  4PK4 A;  3T8R A;  1YOV B;  2OPT A;  3OV8 A;  5IT9 K;  2LD5 A;  1R49 A;  4HNT A;  4G6Q A;  2V1D A;  3DPU A;  2R7U A;  2XAF A;  2ZJP F;  2DMQ A;  2P6S A;  5BS6 A;  4ESF A;  1JKO C;  1ENH A;  4KT5 C;  2WA0 A;  3DKW A;  3DP7 A;  3WTW C;  1PP8 F;  1MMN A;  3OYH A;  2V9K A;  1JTX A;  1FT9 A;  1QVU A;  3BJ6 A;  1HC8 A;  3C7J A;  3BR5 A;  2FEZ A;  3S1N J;  1E0E A;  1MNE A;  1WGX A;  1HQC A;  3GLX A;  1YIJ I;  3SXY A;  2DA7 A;  2M87 A;  2ZSI B;  5EEH A;  1GV5 A;  2FOK A;  1T33 A;  4XBF A;  1DU6 A;  4DZP A;  5IPA A;  3HHH A;  5F1R A;  2MFZ A;  4CGZ A;  2M2E A;  3TKY A;  4I99 C;  1D1B A;  1OCT C;  1YW7 A;  1FYK A;  4IQJ A;  2BW3 B;  1O3S A;  1X58 A;  3G4S I;  3CF2 A;  3FKJ A;  4A93 J;  2MC4 A;  1LE8 A;  3RIR A;  3CCV I;  2CMP A;  3LA3 A;  2FA5 A;  3VWB A;  3QP5 A;  1P6R A;  3K9T A;  4BYY A;  4JP0 A;  3H3V K;  3MN2 A;  2RGV A;  3KCC A;  5E17 F;  5JLW A;  4A3J J;  2KLO A;  4QLC U;  3CC4 I;  2CFO A;  2IS2 A;  1FBU A;  2K9M A;  2W82 A;  2VOO A;  1A5J A;  3V4G A;  2OZU A;  1Z91 A;  1IRG A;  4KIC A;  4X1E A;  3BC8 A;  1XC5 A;  5DYM A;  1XSD A;  2XKP A;  1F1Z A;  2O9L A;  3HGY A;  1MSE C;  2WTE A;  3CCL I;  2IS1 A;  3BQY A;  2ZXI A;  2XPW A;  2DOE A;  5GPA A;  3W3C A;  3ZN1 A;  1WSU A;  1PVE A;  2O8X A;  3RI4 A;  1ZGW A;  2BGC A;  1UJ8 A;  2K3P A;  2GBY A;  4QPQ A;  1RET A;  3GFL A;  1EKE A;  1IV8 A;  3I9V 2;  1X2N A;  2JRM A;  3ISP A;  5CVI A;  5TIS C;  3KYL A;  5DTD A;  4BQN A;  2X0L A;  3GZ6 A;  1X1D A;  2GQQ A;  2KPM A;  3ZGK A;  1G2H A;  2M5W A;  2D5V A;  1GT0 C;  3CJR B;  1LEA A;  3GTG J;  2P7V B;  2A6H F;  3EPZ A;  3ABL H;  3F21 A;  4AIH A;  5HS8 A;  5D4R A;  1DUX C;  5H6Q A;  3IL2 A;  4RAF A;  5M5W J;  3C3W A;  3F6O A;  3HGG A;  1TL8 A;  3TW7 A;  1OCP A;  2JJ7 A;  2VE8 A;  4XLC A;  1K61 A;  2MA3 A;  2EWN A;  1OQY A;  3FBI B;  4NNJ A;  1I50 J;  2YR2 A;  5IYB J;  3MEX A;  5ERI A;  3CUQ C;  2NNN A;  2GWR A;  5AON A;  1ITY A;  4II3 A;  2K3F A;  1T56 A;  1K6Y A;  2MC3 A;  2XGD A;  1M1E B;  3M8F A;  3K0L A;  2Y31 A;  2G0E A;  2IGO A;  3HHG A;  3W2W A;  1GLN A;  2K9Q A;  1PUF B;  4MTE A;  3BZ6 A;  1Z0X A;  3OSG A;  3OYJ A;  3JW4 A;  1TW2 A;  5DS9 A;  1VQN I;  2DA2 A;  1R22 A;  3FHZ A;  1MDM B;  5C4J J;  3WU1 B;  4XRS A;  4CCL A;  3IUO A;  2DPU A;  3HSR A;  1ZRD A;  2DA3 A;  1O4X A;  4HF1 A;  2ZNY A;  1YJN I;  3DPT A;  5L3C A;  2I10 A;  4KIS A;  3DF8 A;  1HDP A;  1VF9 A;  1MJ9 A;  2DDB A;  3BTL A;  2QSH X;  4BHC A;  3OOP A;  3OYB A;  4IO9 F;  1YS6 A;  2CUF A;  4HYE A;  3IWZ A;  2K85 A;  3K7A J;  1NG6 A;  4CYD A;  1L3L A;  1ZHF A;  4EGZ A;  1H89 C;  2HI3 A;  1O3T A;  2EA4 A;  4J00 A;  2YU3 A;  3BG9 A;  1YHQ I;  1YYV A;  3FXM A;  2HXI A;  3DFG A;  2OC6 A;  1VQM I;  2NVY J;  1JKR C;  1QZZ A;  2VKE A;  2BVM A;  1T6S A;  2X48 A;  4MQV A;  2M8E A;  2LFB A;  1WJE A;  2XAQ A;  3GTQ J;  4II2 A;  3H0D A;  2HVQ A;  3NWT A;  2R7X A;  2LYC A;  3PFY A;  1TBX A;  2EJR A;  3HJE A;  3O8H A;  4XON A;  2FMY A;  1VQ4 I;  3OS1 A;  1YX5 A;  3U1D A;  2DPD A;  1E2X A;  3E6D A;  1I5Z A;  1HKQ A;  3I54 A;  2FML A;  4OIQ F;  4X6A J;  1FLI A;  4ZC3 A;  2CG4 A;  1MSF C;  2ID6 A;  2L5Q A;  4AD9 A;  2WAE A;  5DCM B;  4RB3 C;  1BBY A;  3CES A;  2KZG A;  2F5C A;  3UR3 C;  1Z77 A;  3ZMZ A;  4EJV A;  2R7W A;  4IHS A;  2HQN A;  3A0B C;  1JT0 A;  1O3Q A;  3DLL F;  2FNA A;  2A68 F;  1IV6 A;  1UHW A;  1R6R A;  3HIF A;  4HW0 A;  3V7S A;  2ZXW H;  3BR2 A;  4BJT A;  4O5V A;  4I01 A;  2XF5 A;  2XB0 X;  2OCE A;  2WB1 N;  3PO2 J;  3QQA A;  4M9Z A;  2QQ8 A;  2PBI A;  2XPU A;  4J19 A;  2XAG A;  4A0Z A;  2NRA C;  1SFE A;  3I64 A;  1S7E A;  2XV4 S;  5DM6 F;  4L0Y B;  2XF6 A;  1S29 A;  3SZP A;  1MJB A;  3E3V A;  1U8B A;  4CO8 A;  5DCF A;  4RDU A;  2FOW A;  3VSK A;  3EYY A;  4CA0 A;  5FD6 A;  1QBJ A;  3WGG A;  4G7O F;  2QYO A;  3BG6 A;  3TDZ C;  3FZV A;  4Y3O A;  2DMU A;  3FIW A;  4KFC A;  2CS3 A;  4B4C A;  3JAM Z;  4YRV A;  4HDV A;  1R1U A;  1ZH5 A;  3LOC A;  2AXL A;  3ZMU A;  4BEH B;  5EGO B;  5LGT A;  2E7X A;  3AFH A;  3E97 A;  2B63 J;  3ABM H;  5DD8 A;  4GYI A;  4CCN A;  1D5Y A;  1MH3 A;  2WAQ A;  4DJA A;  3GZN B;  3PIP F;  3K4C A;  1FZP B;  1PJR A;  2EZK A;  2X1E A;  1E3O C;  3ULQ B;  3DQV C;  3BPV A;  4BQO A;  3SQN A;  1LKX A;  5HNF A;  3GTK J;  1XD7 A;  4EM2 A;  5LHH A;  4EGY A;  2FNP A;  1IN8 A;  1TQM A;  2OV7 A;  2ZO4 A;  4JX4 A;  1TWA J;  2EK5 A;  2ZJ2 A;  4EJU A;  4MEY F;  4G94 A;  2WBM A;  3GFJ A;  3ABK H;  1BIA A;  4E7H A;  4HRI A;  4GFB A;  1QZE A;  4KJZ A;  2IS6 A;  4HLX A;  5D5W B;  4L18 B;  1G8X A;  3RKQ A;  2LY1 A;  4MEX F;  1D1A A;  2WY8 Q;  2QM3 A;  3DBR B;  2CUE A;  3L2R A;  4A3I J;  2HOE A;  1YRN B;  2RN7 A;  2X51 A;  1R23 A;  3FX3 A;  4M6X A;  4YII A;  2G7U A;  4M6Y A;  3P9C A;  3WHC A;  4J01 A;  5ICE A;  3LFK A;  3MAJ A;  1Z6R A;  3CUQ B;  1V5F A;  3LST A;  4PJM A;  3ZPL A;  3BPX A;  1OCR H;  1T38 A;  1B72 B;  5LRR A;  1ZG5 A;  2Z2S B;  3RKY A;  5D6F A;  2VUM J;  4CCK A;  1MIJ A;  2X6Y A;  3BCB A;  4ITV A;  2COB A;  1K83 J;  1OR7 A;  3KP7 A;  1SFX A;  3L2U A;  5AIP A;  3NRV A;  2HOS A;  4AVZ A;  2DFH A;  1UCR A;  4A6D A;  1RRJ A;  2PI0 A;  2GXB A;  3BG3 A;  3GUD A;  3PNV A;  1ZRF A;  1Y39 A;  2XHK A;  3HRU A;  2FRH A;  4JX6 A;  5TJJ A;  2L7Z A;  3H5A A;  4LB6 B;  1FYM A;  2VKD A;  5JHF A;  4UV9 A;  5EZH A;  5LHI A;  3AL0 C;  1V3F A;  2DYR H;  3BQZ A;  2VKV A;  2R5Z B;  3FMQ A;  1OCC H;  1TNT A;  4HSR A;  2XF7 A;  2HU9 A;  1PDN C;  4XKC A;  2CW7 A;  1KU2 A;  1YJW I;  4MHG A;  1D0Y A;  2KHM A;  2R5Y B;  1R58 A;  3R0A A;  4U0V A;  1MJA A;  4A0X A;  5CQG A;  2ELK A;  1SAU A;  1XMX A;  3ZCO A;  2DTZ A;  3WE3 A;  4HNU A;  1VFC A;  2D2W A;  2L7F P;  1Z3Y A;  3I5U A;  3QU6 A;  2VJJ A;  1WH7 A;  4M3B A;  5TRD A;  3CJT B;  5A2Q K;  2QF7 A;  1TQI A;  1HKS A;  2L2O A;  2HNH A;  2DK5 A;  1WJC A;  1IXC A;  2L4M A;  3OS2 A;  3S1M J;  1ETK A;  5GTH C;  1MMG A;  4BL0 B;  4GO1 A;  3G1M A;  4RM3 A;  2ID3 A;  3GW2 A;  3L2V A;  1IG7 A;  3K69 A;  3QOD A;  4NB5 A;  5F04 A;  2F6C A;  4ESB A;  4D7M A;  1U9O A;  4DW6 A;  1TZL A;  4M3F A;  3CD6 I;  2IEK A;  4LIU A;  2HZD A;  1I3A A;  3LAP A;  4L5I A;  2GIZ A;  1B9N A;  2LK2 A;  4Z2Y A;  1MD0 A;  2DU9 A;  4HF0 A;  2GOM A;  3TDU C;  3ZR8 X;  3U2R A;  1EH8 A;  3CC7 I;  3FK6 A;  4YIR X;  3OYA A;  4M71 A;  4U87 A;  3RYP A;  3D1N I;  4KIB A;  4C3J J;  2R7D A;  5FKO A;  2CYY A;  1ZK8 A;  5GAE J;  4A3G J;  1A35 A;  2QBY A;  4U0Y A;  3CMA I;  6PAX A;  4OOI A;  3C2G A;  2Z99 A;  1K78 B;  1IRF A;  1DP7 P;  1FNN A;  1HW1 A;  2VXD A;  5DCM A;  3JCU C;  1S7O A;  2PMU A;  3LWF A;  2L01 A;  1HXD A;  1Z1D A;  2E1C A;  3LL7 A;  1D0X A;  2DQR A;  2KQR A; 
#chains in the Genus database with same CATH homology
 4BH9 A;  2HTJ A;  3WG9 A;  5JHU A;  2IPQ X;  5HDK A;  4A2U A;  3IKV A;  2JPC A;  5DUI A;  1YW8 A;  1OPC A;  2VON A;  4RB2 C;  2JPB A;  1BM9 A;  3G73 A;  4IRI A;  1U5T A;  2HTS A;  2VBX A;  1MKM A;  3BJA A;  2FXA A;  4BXU A;  4BNC A;  5HDN A;  4HDU A;  5FLX K;  1QPM A;  3GEZ A;  1KQ9 A;  1K7A A;  1B6A A;  4LD5 A;  1UB9 A;  2MLK A;  4UUV A;  5H20 A;  2A07 F;  1D5V A;  1LB2 A;  1J9I A;  5LHG A;  1FPQ A;  1SMY F;  3RKX A;  2VBY A;  3KEQ A;  3CUO A;  4WXD A;  3Q5F A;  1STZ A;  3I59 B;  3VOD A;  2A6E F;  4LG0 B;  4UVA A;  5D8L B;  2ZFW A;  4M9X A;  1RNL A;  4OMY A;  1JXS A;  2O6G E;  2GIV A;  4EM1 A;  2STW A;  3BJO A;  4L9N A;  3KLN A;  4E70 A;  4I02 A;  4GYG A;  1W7P B;  2X4H A;  4M74 A;  2V6C A;  4EMS A;  3P9K A;  5HDG A;  4KDP A;  2DQR A;  3V8L A;  1R00 A;  3CUQ A;  3FMR A;  2GA2 A;  5DD4 A;  4P9F A;  1TLH B;  5HS9 A;  2GAU A;  4ZYE A;  4L5J A;  2P5V A;  5L3B A;  1B4A A;  3IWF A;  1PUE E;  3KET A;  4R8H A;  2RQP A;  1MGT A;  2VXZ A;  2PG4 A;  3DEU A;  2CW0 F;  5JR3 A;  3WU0 A;  5A2Q Z;  1W5S A;  5JVT A;  3Q9V A;  3H3U A;  1P4W A;  2Y75 A;  2DBB A;  3QPT A;  4UVB A;  2ZME A;  1ZG1 A;  1J0R A;  1UHM A;  4ZH4 F;  3BOQ A;  2EV6 A;  4JK1 X;  3TO6 A;  3QPH A;  1FC3 A;  2HGC A;  4A0Y A;  1YIO A;  4GGG A;  2NS0 A;  1R7J A;  2HS5 A;  1AOY A;  3K1M A;  4L0Z B;  1SD5 A;  3ZQ7 A;  1L0O C;  5BQT A;  3KP3 A;  1ZN2 A;  3J80 K;  1BI1 A;  3K1N A;  3VFZ A;  4EJO A;  5KVR A;  4L9J A;  2DFI A;  4LMY A;  3CO7 C;  1ZAO A;  5DEQ A;  5BOX A;  2Q8K A;  5ILS A;  3B73 A;  4HLY A;  1B9M A;  2IVM A;  1LVA A;  2RKH A;  1CF7 B;  2MBF A;  2EV5 A;  3PFI A;  2H94 A;  3F8B A;  3K1P A;  4ZYD A;  1DDN A;  4KYW A;  2DO7 A;  2ZCW A;  3R6S A;  3M8E A;  3F3X A;  2W85 A;  2QUF A;  4BHB A;  1ZG3 A;  2ESN A;  1KGS A;  1QQI A;  2ESH A;  3EET A;  2L02 A;  4ASN A;  4LLL A;  1RUN A;  1O7F A;  4OIR F;  2K27 A;  3WTS C;  2PQ8 A;  3ZN0 A;  2QZ8 A;  2GXG A;  3RKW A;  3C18 A;  4U7B A;  1KYW A;  1R1V A;  4XRF A;  5LLQ A;  1R5H A;  4WF2 A;  5LGN A;  3FXR A;  4A5M A;  2HR3 A;  2YSR A;  3R0J A;  3PQK A;  4HX8 A;  2TDX A;  2DAO A;  4PDK A;  3CDH A;  3W6K B;  4OMZ A;  2UXN A;  2DW4 A;  2MH2 A;  2O61 A;  1D3Y A;  5CLS A;  5CJ9 A;  2BV6 A;  2IT0 A;  1H9G A;  4IJA A;  1HW5 A;  3JTG A;  1OYY A;  2V79 A;  2NYX A;  3F8N A;  2GA1 A;  1XSV A;  3TO7 A;  3T8T A;  1UST A;  5L3F A;  3FWE A;  1YFH A;  2EFP A;  3DXJ F;  3GO5 A;  4G8X A;  4CXF A;  3JSP A;  2C6Y A;  5FGM A;  4LLG F;  4LK0 F;  4MTD A;  5E20 A;  3NEU A;  4YFN F;  5CYV A;  2F5D A;  2ADU A;  4HV6 A;  4NQW A;  3GZ5 A;  1EH6 A;  2RV8 A;  4LG0 A;  3RYR A;  3SZT A;  5FD5 A;  5CVR A;  2G9W A;  5E8I A;  4KUM A;  1F5T A;  4XSX F;  1HSJ A;  3QAH A;  3D5L A;  1P2F A;  2JSC A;  5J6X A;  1W7P A;  1NHA A;  1Y0U A;  3MWM A;  3AAF A;  5IT9 Z;  3T0Y A;  2COM A;  2OA4 A;  3RDI A;  3KP5 A;  3L09 A;  3KP2 A;  1OKR A;  1XGM A;  2IP2 A;  2P6T A;  5BPD A;  1ON1 A;  2KIF A;  3KE2 A;  4U88 A;  3J80 Z;  1DPR A;  4LLN A;  1U78 A;  2A69 F;  1T2K A;  1RUO A;  5CVJ A;  1FBQ A;  4RGR A;  4Q47 A;  4RGS A;  3J7A O;  2RVC A;  3QRF F;  3MZH A;  2JRT A;  5LEJ A;  4G7H F;  1KQ8 A;  3N4M A;  4KN4 X;  3GWZ A;  4YIF A;  2ZKZ A;  2OAZ A;  3ZMV A;  2JZY A;  3M7G A;  3SHF A;  2F2E A;  5E18 F;  2XAJ A;  4KA4 A;  1BOA A;  3R60 A;  1BI3 A;  1IW7 F;  2BYV E;  1IUY A;  3QU3 A;  3JSO A;  2M30 A;  4KMF A;  1J2X A;  4I0B A;  2XUB A;  5K5R A;  2AS5 F;  5LBQ A;  4ENJ A;  2HYF A;  1YG2 A;  1FSH A;  3HOT A;  4XLP F;  4KMU X;  4G6D A;  3LA2 A;  4Q5S F;  3E5X A;  2VC1 A;  5BPI A;  3V7R A;  4YFK F;  5F6F A;  3GXO A;  4WWC A;  1I6X A;  3FXQ A;  4L9V A;  2QWW A;  1Z6T A;  3I71 A;  2EFN A;  2KKO A;  2MD5 A;  1U3E M;  3HOS A;  2KIM A;  2CSO A;  4RAZ A;  4PGG A;  1TTY A;  4F7Z A;  2HFH A;  4P9U A;  4UXN A;  3GFI A;  3E6C C;  2VOP A;  1QZY A;  1F4K A;  3IRR A;  2BEO A;  2QLZ A;  1WQ2 A;  1RIO H;  3T5X A;  2FSW A;  1MDM A;  3BP8 A;  2HKX A;  4Y15 A;  5LGU A;  4KIG A;  3L7W A;  5HOO A;  4FT8 A;  5JI6 A;  3IHU A;  2R3S A;  5L3G A;  1HW2 A;  1O57 A;  4N9I A;  1IF1 A;  2XIG A;  3O6B B;  1G4D A;  2HZT A;  2LNB A;  3RPQ A;  3HTU A;  1J75 A;  3WTU C;  2B0L A;  4Q48 A;  2Y48 A;  3REO A;  1U6G A;  5FB2 A;  4GCV A;  3KP6 A;  1S8N A;  1X3U A;  3TOB A;  3WE2 A;  4AIK A;  2Z33 A;  2E7W A;  2DT5 A;  5HS7 A;  1BI2 A;  2H09 A;  2RC4 A;  2P5K A;  3MCZ A;  1XN7 A;  1JE8 A;  1W7P D;  2CQK A;  1SMT A;  2DK8 A;  4O3M A;  4CDG A;  5D5V B;  3L9F A;  4LFU A;  1OMI A;  5FFZ A;  2OQR A;  2W24 A;  3HSE A;  1MZB A;  4LK1 F;  4RAY A;  4RGX A;  1W5T A;  1IXS B;  4WXH A;  2YX4 A;  2H6B A;  3M1E A;  1LDD A;  2FQ3 A;  2Z5U A;  3GFM A;  3D0S A;  4YFX F;  2HYG D;  1WRJ A;  1IN4 A;  2W25 A;  4HF2 A;  1HKT A;  4ZYG A;  2Z3Y A;  3SFZ A;  1Z9C A;  1G3W A;  1LQ1 A;  1K79 A;  3F72 A;  4M73 A;  1C0W A;  2Q0O A;  1U8R A;  3T1B A;  4OU0 A;  3TQN A;  3E5Q A;  2YX7 A;  3WTX C;  4FHT A;  4OIO F;  4H0E A;  3B02 A;  3LA7 A;  4EQQ A;  2LSO A;  1B1B A;  4IVN A;  2ISZ A;  4I98 B;  3ABT A;  2OBP A;  2QEN A;  3ZP5 A;  2O3F A;  2IA2 A;  3LQR A;  4ETS A;  2O0Y A;  4HOB A;  1SFU A;  4RB0 A;  4A6E A;  4UHT A;  1G3S A;  3KZY A;  2L54 A;  4U7D A;  3P7N A;  1XGO A;  4R1H A;  1IXR C;  5ICG A;  2NNY A;  4PGH A;  2FBH A;  4JBA A;  4UV8 A;  1YS7 A;  3HRM A;  1FX7 A;  3ELK A;  1ONV A;  1S6L A;  3F23 A;  4IRG A;  5ICF A;  4HQE A;  3KLO A;  1B59 A;  2LDU A;  1JGS A;  4EM0 B;  2IA0 A;  5D5X B;  4R79 A;  4WX9 A;  2VBW A;  4Y17 A;  5E8G A;  4B8X A;  3WTT C;  2HDC A;  4A5N A;  4WK8 F;  2EB7 A;  4RS8 A;  2XRN A;  2OQG A;  3TOA A;  4Q4Z F;  1KA8 A;  2P8T A;  3O3K A;  5DDG A;  2VOD A;  2QVO A;  1OYI A;  4PCQ A;  4XSZ F;  1FOK A;  3GYH X;  1JHF A;  2XVC A;  4PZJ A;  3FM5 A;  3ML6 A;  4I0A A;  1F9N A;  1ULY A;  1IN7 A;  4MNU A;  1BC7 C;  3J81 K;  1H9T A;  5DUK A;  4KN7 X;  1AWC A;  4G9Y A;  2PLY A;  5LEK A;  4IHT A;  3QP6 A;  1TQP A;  3LAJ A;  1ZGJ A;  4M9S A;  3WTY C;  4ZYH A;  2PEX A;  3S2W A;  1S3J A;  1QGP A;  3H3Z A;  5D6E A;  4MQ9 F;  3FMS A;  5L3D A;  3WGH A;  2VBZ A;  1RI7 A;  1U5T C;  5K1Y A;  1KU7 A;  2MH9 A;  3H92 A;  1IN6 A;  4N9H A;  3MZY A;  2EV0 A;  2IA1 A;  1CGP A;  1SD4 A;  3JAM K;  1O3R A;  5E1X A;  1T98 A;  4HA8 A;  2DI3 A;  1LJ9 A;  3CLO A;  4ENN A;  1K78 A;  2D1H A;  1D8J A;  1RZ4 A;  1ZLJ A;  2A5Y B;  2A61 A;  1J59 A;  1LNW A;  5FFX A;  2K4J A;  2M1B A;  5IT3 A;  4IPA A;  1XGS A;  3RJP A;  5FLX Z;  2FF4 A;  4DNC A;  4BQA A;  3E5U A;  3ERE D;  3IKT A;  2QQA A;  1Z05 A;  1KYZ A;  1LEB A;  1HBX G;  4EJW A;  2QQ9 A;  2H27 A;  4BHP A;  3IC7 A;  3ECO A;  4YG2 F;  2HEO A;  3IRQ A;  1XMK A;  2LKP A;  1BC8 C;  2FE3 A;  2XKO A;  3E6B A;  4M72 A;  3FXU A;  1KU3 A;  5L3E A;  2W84 A;  3KP4 A;  4EJT A;  2UWM A;  1FBS A;  4CHU A;  5DV5 A;  2K4B A;  4QWQ A;  2G7H A;  3HRT A;  2FBK A;  2UXX A;  3F22 A;  1YQA A;  3TO9 A;  2PJP A;  3EYI A;  3BY6 A;  3NQO A;  5J8C A;  3I59 A;  2QQB A;  1FP1 D;  4KIF A;  2F5F A;  2WWY A;  3U9G A;  2KIU A;  3GVA A;  1I1S A;  5ICC A;  1WWX A;  1R1T A;  3VOE A;  3WTV C;  2ZXJ A;  1T39 A;  5FO5 A;  2RNJ A;  4RGU A;  5LRS A;  5E1Z B;  2J5P A;  1OYW A;  2DTR A;  5HVQ C;  3F8C A;  2QBY B;  4NHJ A;  4HBL A;  4IXA A;  3R4K A;  5ILV A;  2BE5 F;  3N97 A;  4LGW A;  3W6J B;  3J81 Z;  1SAX A;  2HKO A;  3VEP A;  1XSX A;  3GF2 A;  2MLG A;  3EQL F;  3ZMS A;  1DPU A;  1WI9 A;  4U0W A;  1BI0 A;  1K6O A;  5E1W A;  5ILU A;  2HWV A;  2ISY A;  2EFQ A;  4HV5 A;  2E1N A;  2KJB A;  2PFB A;  1I27 A;  4S05 A;  1LDK B;  2KJC A;  2YPR A;  5K5Q A;  1GXP A;  4S04 A;  2XAH A;  5H6R A;  3MQ0 A;  2CGP A;  1U5T B;  3E6M A;  4AWX B;  1O7L A;  1V4R A;  2EFO A;  2LF7 A;  4I7H A;  2PN6 A;  4HAM A;  2ELH A;  3BRO A;  4WXC A;  3GX4 X;  2LF8 A;  4LB5 A;  2IW5 A;  2OU2 A;  1EV7 A;  4HX4 A;  1WKM A;  3HRS A;  3V8J A;  2UZK A;  1XCV A;  5HLH A;  4I2O A;  2EA2 A;  2H6C A;  3O2P E;  1G3T A;  1CF7 A;  3PQJ A;  2KRF A;  4GXO A;  2BBY A;  5D5U B;  1SD7 A;  3KFW X;  1J7K A;  1ZRE A;  2R7F A;  4HZF A;  4B09 A;  4G7Z F;  1SD6 A;  1HST A;  3KEO A;  1Z7U A;  3QOP A;  3FM3 A;  3WTZ A;  4FX0 A;  1ZGA A;  5HLG A;  2P5L C;  2VC0 A;  1ZYR F;  4P5O A;  4IF4 A;  2K02 A;  3DPL C;  1D8K A;  5EEG A;  2WV0 A;  4TV7 A;  5D8K B;  4BAY A;  5HLI A;  1YW9 A;  4EV0 A;  4MGR A;  2EFW A;  3V8K A;  3I4P A;  1P92 A;  2V1X A;  1J5Y A;  3V7C A;  3ABU A;  1I1G A;  2XRO A;  4I09 A;  2DLL A;  1ON2 A;  1FWZ A;  3TGN A;  3F8M A;  2XGX A;  3EDP A;  1G6N A;  1XB4 A;  3RPU A;  4JQF A;  1UFM A;  2VT3 A;  5CVU A;  2VE9 A;  2ZME B;  3HSF A;  2L3D A;  2OD5 A;  4DQ2 A;  1BIB A;  1VTN C;  1QO0 D;  3I0T A;  1REP C;  3WGI A;  2ACJ A;  2M45 A;  4HQM A;  4P55 A;  1FSE A;  1R36 A;  3DV8 A;  1G3Y A;  3ZMT A;  1R5G A;  3ROU A;  1PP7 U;  2VN2 A;  2STT A;  3CTA A;  2XAS A;  3EUH A;  3BWG A;  4LJZ F;  1E17 A;  4ESJ A;  1YO5 C;  1FP2 A;  1Q1H A;  1T0F A;  4N0B A;  4AVP A;  1XGN A;  2P4W A;  1XMA A;  3F8F A;  2D45 A;  3JTH A;  4EVI A;  4L9T A;  4ENM A;  1EH7 A;  1GVJ A;  1W4M A;  4P96 A;  1QNT A;  3LQQ A;  3P9I A;  1KQ0 A;  3G3Z A;  3HUG A;  2JT1 A;  1S7A A;  4AIJ A;  3C1D A;  4FX4 A;  1FYL A;  3R61 A;  2P7C B;  1GHC A;  2V1U A;  5ED4 A;  3M9A A;  1IZ1 A;  5KK1 A;  2WC2 A;  4A12 A;  1IAW A;  3FF5 A;  5K5O A;  3CO6 C;  2RDP A;  2A3S A;  3ECH A;  1ZLK A;  1GXQ A;  2W57 A;  3I58 A;  4IRH A;  2ETH A;  4XLN F;  4O6J A;  1U2W A;  4Y13 A;  2D1V A;  1H0M A;  1XDS A;  2FU4 A;  3BDD A;  2ZNZ A;  2Q2E A;  3HYI A;  1P4X A;  3L00 A;  3ZMD A;  4ZZD A;  5BMZ A;  2HQR A;  1LDJ A;  3RTR A;  2O03 A;  1TW3 A;  3I53 A;  5AIQ A;  4WCG A;  1P4A A;  2OZ6 A;  1XDU A;  1ODD A;  4ENK A;  2Y0M A;  1ZRC A;  1FY7 A;  2FBI A;  1ZAR A;  3Q9S A;  4ZZL A;  2J5O A;  2PMH A;  2K86 A;  3F6V A;  2IRF G;  4K2E A;  1USS A;  3K2Z A;  3KZZ A;  3WOD F;  4ON0 A;  3COA C;  2VT2 A;  2CO5 A;  1A04 A;  5JFR A;  5D4S A;  3VB2 A;  4CIC A;  4HX7 A;  1JHH A;  2ZBK A;  2NAZ A;  2GZW A;  4OIN F;  1BJA A;  1YTY A;  4UNO A;  2DQL A;  1XCB A;  4D0P A;  1TNS A;  5F64 A;  2K7L A;  3CJN A;  2CWE A;  3L2C A;  3HTS B;  4UVC A;  2L4A A;  2CFX A;  1BN5 A;  1YLF A;  2Z9O A;  4RB1 A;  3MFK A;  4KNY A;  1KU9 A;  2F5E A;  4OIP F;  1IN5 A;  5J8F A;  2IJL A;  2JTV A;  2V9V A;  4CZZ A;  3T8R A;  3OV8 A;  5IT9 K;  4G6Q A;  2V1D A;  2XAF A;  2P6S A;  5BS6 A;  4ESF A;  4KT5 C;  3DKW A;  3DP7 A;  3WTW C;  1PP8 F;  1FT9 A;  3BJ6 A;  3C7J A;  2FEZ A;  1HQC A;  3GLX A;  3SXY A;  2M87 A;  5EEH A;  2FOK A;  4XBF A;  3HHH A;  5F1R A;  4CGZ A;  3TKY A;  1YW7 A;  1FYK A;  1O3S A;  3RIR A;  3LA3 A;  2FA5 A;  3QP5 A;  1P6R A;  3K9T A;  4BYY A;  2RGV A;  3KCC A;  5E17 F;  4QLC U;  1FBU A;  2VOO A;  3V4G A;  2OZU A;  1Z91 A;  1IRG A;  4KIC A;  5DYM A;  1XSD A;  2XKP A;  1F1Z A;  2WTE A;  3ZN1 A;  1WSU A;  2O8X A;  3RI4 A;  2BGC A;  3GFL A;  5CVI A;  3ISP A;  2X0L A;  3GZ6 A;  2GQQ A;  2M5W A;  1LEA A;  2P7V B;  2A6H F;  3F21 A;  4AIH A;  5HS8 A;  5D4R A;  1DUX C;  5H6Q A;  3IL2 A;  3C3W A;  3F6O A;  2VE8 A;  2MA3 A;  2EWN A;  2YR2 A;  3MEX A;  5ERI A;  3CUQ C;  2NNN A;  2GWR A;  5AON A;  2MC3 A;  3M8F A;  3K0L A;  3HHG A;  4MTE A;  3BZ6 A;  3JW4 A;  1TW2 A;  1R22 A;  3FHZ A;  1MDM B;  3WU1 B;  2DPU A;  3HSR A;  1ZRD A;  4HF1 A;  2ZNY A;  3DPT A;  5L3C A;  3DF8 A;  1MJ9 A;  4BHC A;  3OOP A;  1YS6 A;  4HYE A;  3IWZ A;  1L3L A;  4CYD A;  1ZHF A;  4EGZ A;  1O3T A;  2EA4 A;  2YU3 A;  1YYV A;  3DFG A;  1QZZ A;  1T6S A;  4MQV A;  2M8E A;  2XAQ A;  1TBX A;  2EJR A;  2FMY A;  3U1D A;  2DPD A;  1E2X A;  3E6D A;  1I5Z A;  1HKQ A;  3I54 A;  2FML A;  4OIQ F;  1FLI A;  2CG4 A;  4AD9 A;  5DCM B;  4RB3 C;  1BBY A;  2F5C A;  3ZMZ A;  4EJV A;  4IHS A;  2HQN A;  1O3Q A;  2FNA A;  2A68 F;  1UHW A;  3HIF A;  4HW0 A;  3V7S A;  4O5V A;  4I01 A;  4M9Z A;  2PBI A;  2XAG A;  4A0Z A;  2NRA C;  1SFE A;  3I64 A;  2XV4 S;  4L0Y B;  1S29 A;  3SZP A;  1MJB A;  3E3V A;  4CO8 A;  5DCF A;  3EYY A;  5FD6 A;  1QBJ A;  3WGG A;  4G7O F;  2QYO A;  3TDZ C;  3FZV A;  4KFC A;  3JAM Z;  4HDV A;  1ZH5 A;  1R1U A;  2AXL A;  3ZMU A;  5LGT A;  2E7X A;  3E97 A;  5DD8 A;  4GYI A;  1FZP B;  3ULQ B;  3DQV C;  3BPV A;  3SQN A;  1XD7 A;  4EM2 A;  5LHH A;  4EGY A;  2FNP A;  1IN8 A;  1TQM A;  2ZO4 A;  2EK5 A;  2ZJ2 A;  4EJU A;  4MEY F;  4G94 A;  3GFJ A;  1BIA A;  4HLX A;  5D5W B;  4L18 B;  4MEX F;  2QM3 A;  2HOE A;  2RN7 A;  1R23 A;  3FX3 A;  4M6X A;  4YII A;  2G7U A;  4M6Y A;  3P9C A;  5ICE A;  3LFK A;  3MAJ A;  1Z6R A;  3CUQ B;  3LST A;  3ZPL A;  3BPX A;  1T38 A;  5LRR A;  1ZG5 A;  3RKY A;  5D6F A;  1OR7 A;  3KP7 A;  1SFX A;  5AIP A;  3NRV A;  1UCR A;  4A6D A;  2PI0 A;  2GXB A;  3GUD A;  1ZRF A;  2XHK A;  3HRU A;  2FRH A;  5TJJ A;  1FYM A;  4LB6 B;  4UV9 A;  5LHI A;  1V3F A;  3FMQ A;  1TNT A;  1PDN C;  1KU2 A;  4MHG A;  1R58 A;  3R0A A;  4U0V A;  1MJA A;  4A0X A;  3WE3 A;  2D2W A;  3I5U A;  3QU6 A;  5TRD A;  5A2Q K;  1TQI A;  1HKS A;  2DK5 A;  1IXC A;  2L4M A;  4GO1 A;  3GW2 A;  3K69 A;  4NB5 A;  4ESB A;  3LAP A;  4L5I A;  1B9N A;  4Z2Y A;  1MD0 A;  2DU9 A;  4HF0 A;  3TDU C;  3U2R A;  1EH8 A;  4M71 A;  3RYP A;  4KIB A;  2R7D A;  2CYY A;  2QBY A;  4U0Y A;  6PAX A;  4OOI A;  2Z99 A;  1K78 B;  1IRF A;  1DP7 P;  1FNN A;  1HW1 A;  5DCM A;  1S7O A;  2PMU A;  3LWF A;  2L01 A;  1HXD A;  1Z1D A;  2E1C A;  5CVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...