2JT1A

Solution nmr structure of pefi (plasmid-encoded fimbriae regulatory) protein from salmonella typhimurium. northeast structural genomics target str82
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
71
Chain Sequence
MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PefI protein
publication title Solution NMR structure of the plasmid-encoded fimbriae regulatory protein PefI from Salmonella enterica serovar Typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transcription
total genus 20
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04703 FaeA FaeA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jt1A00
2M45A 3RKXA 4YFKF 5D5XB 3ZMTA 1IXCA 3WTTC 1OKRA 3R60A 2R3SA 1MKMA 4OOIA 1J75A 3W6JB 1ONVA 4BXUA 1XGOA 4AIJA 2ISZA 4LK0F 2LKPA 1XMKA 2JPBA 1J0RA 5D5VB 1BI2A 5CYVA 3E5QA 4CICA 3I59B 1OR7A 4ENMA 1UB9A 2FRHA 4RAZA 2JT1A 2PJPA 3F8BA 2K86A 1XCVA 2PMUA 1I27A 5ICEA 4AIHA 1R7JA 2A69F 4CYDA 4O3MA 3COAC 1FPQA 4QLCU 2A6HF 3RYRA 3REOA 2VBWA 4IVNA 4LD5A 4KIGA 1FX7A 4M6XA 3I64A 4Q47A 2EFOA 2VC1A 2L54A 2RKHA 3S2WA 4RB1A 3ABTA 2VT3A 4L5IA 1R5GA 2O6GE 1MDMA 1MD0A 3KEQA 4ZZDA 2V79A 2CW0F 4MEYF 2V9VA 2G7HA 2ZO4A 1R00A 4BYYA 1EV7A 2ESNA 3B73A 2O0YA 3CO6C 5LRRA 4HDUA 4G6DA 3GFJA 1SFEA 2O61A 3MCZA 4YIFA 1FBQA 3KEOA 1ZAOA 3BP8A 3JSPA 2VONA 2XV4S 2Q0OA 3W6KB 1D3YA 3DPTA 1J59A 3DPLC 2BYVE 3MAJA 1PUEE 3I71A 1WWXA 4LGWA 2IA2A 2GA2A 2OBPA 2OU2A 4ON0A 4U0WA 1HW1A 1XCBA 3SXYA 1L3LA 5HVQC 3VB2A 4OIPF 2FEZA 2H94A 5HLGA 3LSTA 2RQPA 3SZPA 1W7PA 4CGZA 3GYHX 1ZRFA 2MLKA 3TQNA 5HLIA 1MZBA 2EK5A 1TW2A 2GXGA 5LHGA 3F8FA 2NAZA 3KP7A 5BQTA 1FOKA 5E1XA 1B9MA 4I02A 2RC4A 3KFWX 2P5VA 2XAJA 1FYKA 1BBYA 2L02A 3V7CA 3V7RA 4KFCA 2P8TA 3LA7A 4G7ZF 1G6NA 5AIQA 1QQIA 2WC2A 3C3WA 2XAGA 1MJAA 2P7VB 3JAMZ 4KMFA 5JHUA 1J5YA 5LEKA 1KQ8A 1G3WA 2Y0MA 3WU1B 2LNBA 3M1EA 1S8NA 3CDHA 4G9YA 2MBFA 5LGUA 2KJBA 2XKPA 1ZRDA 1T2KA 1GXPA 3LA3A 3ROUA 5ILSA 4LK1F 2NS0A 2TDXA 4CZZA 1F4KA 4ESBA 4EJUA 2DBBA 4HF1A 3HSEA 3I4PA 4EGZA 3R0AA 2MH9A 5F6FA 4NB5A 5F64A 4Q5SF 4OU0A 1SFUA 1I6XA 1TNTA 1JXSA 4FX4A 2D1HA 3WE2A 3J81K 4WXHA 2A07F 2YPRA 1UHMA 3K1PA 1P4XA 3MEXA 4R79A 1U2WA 2K4JA 3F72A 1QNTA 3HRUA 3LWFA 1IN6A 2VOOA 4IPAA 2PN6A 3L7WA 5KK1A 1OYYA 4BH9A 2AXLA 2VT2A 3Q9SA 1K79A 5H20A 3E5UA 4ZYGA 4HQMA 2KIFA 1STZA 1P6RA 1TW3A 3ABUA 4LG0B 1JHHA 2DTRA 2H6CA 4R8HA 4GYGA 1TNSA 5FFZA 1F5TA 2HTSA 4RB3C 3FHZA 1FC3A 2KIUA 3TO6A 1J2XA 3DXJF 4HBLA 3I0TA 2RNJA 1Z1DA 3I59A 3BY6A 2A6EF 3GUDA 2NRAC 1Z91A 4YFNF 1SD7A 2D1VA 4IXAA 2RGVA 3P7NA 4HDVA 4RB2C 5IT9K 3J7AO 2O8XA 3WTYC 1NHAA 1TLHB 3FXUA 2JTVA 2HZTA 2PEXA 1ZLJA 2F5FA 5D6EA 5D8LB 1SMTA 5LHIA 4EJVA 2QLZA 2O03A 1G4DA 3JTHA 4NHJA 1QO0D 1BC8C 1A04A 5JFRA 3WTXC 4L0YB 3GF2A 3P9CA 2HQNA 4UHTA 2XUBA 4UVBA 4F7ZA 1UFMA 4EJOA 2IP2A 3V8KA 3IL2A 1TQMA 2K02A 5LRSA 3QOPA 4LFUA 3ZN1A 1QGPA 2EFQA 2ELHA 3DKWA 1ZHFA 3GEZA 3IRRA 1E2XA 1Y0UA 1WSUA 2DI3A 1ON2A 3LAJA 5HLHA 2P6TA 2F5EA 4N0BA 1S29A 2XAHA 2V6CA 2V1XA 3EETA 1R1UA 3RKWA 4HW0A 4RGSA 4UV9A 2ADUA 3ZPLA 3BWGA 2CFXA 1IRFA 4DNCA 3GXOA 2CO5A 1KU3A 2HQRA 2J5OA 3R61A 5LLQA 1EH7A 3DP7A 1ZRCA 1ULYA 2KIMA 4G7OF 3HUGA 2VBZA 1P92A 5DEQA 4ZZLA 2M1BA 3B02A 3WU0A 3NEUA 5CLSA 5K5QA 3TO9A 2DPDA 3Q5FA 3LFKA 1JE8A 2ESHA 2VN2A 2UWMA 4TV7A 1USTA 4OIQF 4BHBA 2QBYB 1T39A 2PI0A 4G94A 4HLYA 3CJNA 3KP5A 5ILVA 3KLNA 5CVJA 1ZG1A 1CF7A 1U8RA 2MC3A 3BJOA 1FP1D 5CVUA 2STWA 1XDUA 5EEGA 3HRMA 2QQAA 3KCCA 4KIBA 5FO5A 3FMSA 1BI1A 2M8EA 2M30A 1HBXG 5FB2A 4N9HA 3PQJA 2GZWA 1PP8F 4LLGF 1W5SA 1TTYA 3MWMA 3JSOA 2HS5A 3LAPA 5BMZA 3ZMZA 5ICGA 1S3JA 3FMRA 4O6JA 2DO7A 3O6BB 2ETHA 1YO5C 1SD5A 4I7HA 3TDUC 3FX3A 1R23A 1IXSB 1BIAA 2FNPA 3HOTA 2RN7A 1BI3A 2ACJA 2J5PA 4I01A 3HSFA 3R0JA 2Z33A 5DD4A 3R6SA 2GA1A 4LJZF 3J81Z 1PP7U 3T8TA 4LB6B 2QUFA 3IWFA 1Z6TA 2CQKA 3F8NA 1XSXA 3PQKA 3NQOA 4UVCA 1DUXC 2EV0A 4HV6A 3HIFA 3FMQA 4PGHA 4JQFA 4BHCA 2XIGA 3VODA 5E20A 1HSTA 5DV5A 3H3UA 1O3TA 3ZMDA 4ZH4F 4U88A 1D8JA 3F8MA 1OPCA 1W4MA 2K7LA 2QM3A 2ISYA 2VC0A 4LG0A 1OYIA 4U0YA 4Q48A 2HOEA 5HDKA 2W57A 4Y13A 4OMYA 2PQ8A 1IUYA 1S6LA 5D6FA 3KLOA 1IW7F 2WTEA 4Y17A 4GYIA 5EEHA 4D0PA 5IT9Z 4EM0B 3MZYA 3BJ6A 5DUIA 1HQCA 2HWVA 5L3BA 1ON1A 2DQRA 4AVPA 5HS7A 4RGXA 1YTYA 2P5KA 4EM2A 1U3EM 3TOBA 4A0ZA 1FYLA 3FXQA 3KZYA 2IVMA 5DYMA 5LHHA 4L5JA 5E1ZB 2HKOA 2EWNA 2Z5UA 3CTAA 3GFLA 3N97A 4MQ9F 4KN4X 4K2EA 2JRTA 1DDNA 2OZUA 1I5ZA 5J8CA 1QZYA 4L9NA 2VE9A 4UNOA 1O57A 4AIKA 1I1SA 2HEOA 3QPHA 4G7HF 2QWWA 2EA4A 2MLGA 6PAXA 1ODDA 3KP3A 4S05A 3F23A 2QYOA 2CSOA 2DU9A 4EM1A 5JR3A 3VFZA 4HOBA 3ULQB 3L2CA 2QZ8A 4ENNA 3I53A 1FT9A 4ESFA 2R7DA 1G3YA 1IXRC 2IRFG 5ERIA 1O7LA 3KP2A 2HYFA 4ESJA 2UXNA 1LVAA 2IA0A 2YSRA 4I0BA 1QPMA 1SD4A 1O3QA 2Z3YA 3BROA 4EVIA 1TQIA 1UHWA 3GX4X 2HYGD 2PG4A 3F8CA 2IT0A 1YS7A 3C18A 4UV8A 1B1BA 2OA4A 5K1YA 5CJ9A 3V7SA 1SAXA 1FWZA 4FT8A 1RUOA 1G3TA 3FWEA 1REPC 3T5XA 3ECOA 4XBFA 5K5RA 3BZ6A 2QBYA 4EJTA 2ZMEB 2W85A 3V4GA 2NYXA 3WTZA 1XSVA 1ZG5A 1FY7A 5BOXA 5BPDA 3RTRA 1XN7A 3SZTA 2XHKA 2XVCA 3BDDA 3HOSA 4YIIA 2A5YB 5DCMB 3SFZA 3ZQ7A 3GLXA 3RKYA 2KKOA 3HTUA 3TKYA 3MZHA 5JVTA 4GGGA 2EFWA 3QU3A 5LEJA 3M8EA 3OV8A 2JPCA 3WGHA 3DEUA 3CUOA 4CHUA 1K6OA 2XRNA 1R58A 2OAZA 4N9IA 1YW9A 3QP6A 4ASNA 4A5MA 3E6DA 4BNCA 3PFIA 3GZ6A 3L9FA 1YQAA 2VBYA 2FQ3A 2RVCA 3DQVC 1XGMA 2ZCWA 4EMSA 2B0LA 1H0MA 5J8FA 1XSDA 2EV5A 1HW5A 1BN5A 4RAYA 1U5TB 2G9WA 1LDKB 2ZNZA 5HS8A 5F1RA 1TQPA 1U5TC 1YFHA 2FA5A 4KNYA 2F5DA 4P9FA 2HTJA 1E17A 3KETA 3EYIA 4BAYA 2XASA 3EYYA 1IF1A 4IRGA 2CG4A 3IC7A 5J6XA 1B59A 3H92A 2FMYA 5HOOA 1XGSA 1XGNA 1L0OC 3QU6A 2FBKA 1O3RA 3Q9VA 1SD6A 1Q1HA 4MEXF 1Z05A 1T98A 1T0FA 3ZMUA 2COMA 2FOKA 1KQ9A 3IRQA 3JW4A 4P96A 2FMLA 3T1BA 2FXAA 1KU7A 1HXDA 4E70A 1AOYA 2DQLA 4HV5A 4I0AA 2HR3A 4WXDA 5L3DA 2GWRA 4KUMA 1IN7A 2L4MA 1KQ0A 1FBSA 3U9GA 2A68F 5ICCA 4HZFA 2VXZA 3D5LA 4XRFA 4HA8A 1R5HA 4ZYHA 3ML6A 2H27A 4JK1X 2DW4A 5DD8A 5BS6A 2OZ6A 2L3DA 1XDSA 2VODA 4HYEA 1KA8A 3CO7C 2F5CA 3L00A 4AD9A 3SHFA 2E1CA 2F2EA 4P9UA 3K9TA 1VTNC 2X4HA 2BE5F 2AS5F 1OMIA 5E18F 1USSA 4PDKA 3QRFF 2RDPA 4G6QA 4EV0A 5FD5A 2GXBA 4IRIA 1ZG3A 3M8FA 4WX9A 1EH8A 2LSOA 3GVAA 3ERED 4EQQA 2BBYA 5LGNA 1XB4A 1RZ4A 3FM3A 2XROA 1D5VA 1MGTA 4L18B 1OYWA 3M7GA 4S04A 3K1MA 3RYPA 4A6DA 4MHGA 3BOQA 3HTSB 4MNUA 3V8JA 2K4BA 1BM9A 1FBUA 3J80K 2JSCA 2X0LA 5E8GA 3H3ZA 1LB2A 4A5NA 2L01A 3EUHA 4I98B 5DCFA 4L9JA 4IHSA 5ICFA 1ZLKA 2IW5A 5K5OA 1LEBA 1YIOA 3TO7A 5CVRA 2ZMEA 3F3XA 2LF7A 2HDCA 1JHFA 3WTUC 4UUVA 4OINF 3BPVA 2OD5A 4XSZF 3RIRA 2DK8A 1U78A 4ETSA 1ZGAA 1GVJA 2M87A 3ZN0A 5DCMA 3LQQA 2GAUA 3WTWC 2NNNA 5AIPA 4M73A 2Q2EA 5FD6A 3G73A 2XAFA 4IHTA 2MD5A 4HX4A 2ZKZA 2WWYA 3HHHA 2ZNYA 5D8KB 1FZPB 2EA2A 3OOPA 4ZYEA 3QAHA 2GIVA 4LLNA 1ZYRF 1O3SA 1K7AA 4WK8F 3KE2A 1R1VA 1H9GA 3HSRA 5H6RA 1GXQA 3DF8A 4ENJA 2OQRA 3QP5A 5TJJA 2CGPA 1F9NA 4B8XA 3RJPA 5FFXA 2R7FA 1U5TA 1IN8A 4XSXF 2W24A 5TRDA 1W7PD 2QQBA 4JBAA 4OMZA 2ZXJA 3E5XA 4NQWA 4KYWA 3C1DA 3HHGA 3WODF 1RI7A 4LLLA 1U6GA 5IT3A 4KA4A 4P55A 3LQRA 1Z6RA 4WF2A 4DQ2A 3GZ5A 1ZGJA 2UXXA 3AAFA 2KJCA 1WKMA 1IN5A 2DT5A 3TGNA 3QPTA 3G3ZA 4GCVA 4CXFA 4HF2A 4M71A 1KYWA 4KIFA 3HRSA 3CUQB 1HW2A 2P7CB 1HKSA 1P4AA 1YYVA 3CUQC 1TBXA 5E8IA 4G8XA 2PMHA 2XKOA 4KN7X 3WTSC 4IF4A 3VEPA 1RUNA 2BEOA 2Z99A 3RPUA 3WGIA 2DFIA 2K27A 4Z2YA 4ENKA 4WWCA 4U7BA 2YX7A 2L4AA 3FZVA 3WGGA 3ZP5A 3FXRA 1K78B 4L0ZB 1FYMA 4UVAA 2W84A 2NNYA 1X3UA 4P5OA 3KP6A 1YG2A 1F1ZA 1T38A 1Z9CA 4O5VA 4CO8A 2EJRA 4QWQA 4BQAA 1GHCA 5HS9A 5D5UB 3LA2A 4I2OA 3ZMSA 5FLXZ 3TOAA 3DV8A 5A2QK 1LDJA 5L3FA 3D0SA 2VOPA 2DAOA 2HKXA 4U7DA 3RI4A 1HKQA 5D5WB 1RNLA 1V3FA 3K69A 1BI0A 4GO1A 3VOEA 1BC7C 1YLFA 5E17F 2Y48A 2RV8A 4HQEA 4A12A 4EGYA 1FLIA 1CGPA 1P4WA 3P9KA 3E97A 2P5LC 5HDNA 2WV0A 1IZ1A 1EH6A 1KYZA 2MA3A 3E6BA 4ZYDA 4RGRA 2LDUA 4M74A 4YG2F 2QENA 4L9TA 2A3SA 2IPQX 2QQ9A 1G3SA 3FF5A 5CVIA 2CWEA 3J80Z 1WQ2A 1HKTA 4RGUA 4M9ZA 4GXOA 1CF7B 1HSJA 2M5WA 3HRTA 2EB7A 5HDGA 2HFHA 1ZN2A 4HX8A 4A0YA 4Y15A 4CDGA 5ILUA 1DP7P 4MQVA 4I09A 4PGGA 3MQ0A 1KGSA 2DK5A 1FSEA 4LMYA 2H09A 5KVRA 2D2WA 4RS8A 2PBIA 2PFBA 1B6AA 4FX0A 3F22A 1YW7A 4WXCA 2XAQA 1SMYF 2LF8A 3P9IA 3IKVA 3WG9A 1ZH5A 3IWZA 1P2FA 1S7AA 1WI9A 1BJAA 2EFNA 4M9XA 5AONA 3O3KA 2MH2A 5L3GA 2ZBKA 2E1NA 3ELKA 1KU9A 1B9NA 3RPQA 5LBQA 5H6QA 3TDZC 1ZARA 3FM5A 1RIOH 3C7JA 2FNAA 1DPUA 4U0VA 1D8KA 1PDNC 4Q4ZF 2PLYA 3K1NA 1H9TA 4OIOF 4EJWA 4H0EA 3GW2A 2ZJ2A 4XLPF 4RB0A 2Y75A 2FF4A 1V4RA 2Q8KA 3E6MA 2GQQA 1UCRA 3BPXA 1LDDA 3KP4A 4OIRF 3V8LA 3MFKA 4AWXB 4KT5C 1QZZA 2FBIA 3EDPA 3U1DA 3CLOA 4HAMA 2JZYA 4HX7A 2YU3A 2V1DA 3F21A 2FU4A 1R1TA 5ED4A 1SFXA 3GWZA 5LGTA 3GO5A 3CUQA 2G7UA 5JI6A 2CYYA 1JGSA 1LJ9A 2IA1A 4A0XA 2E7XA 4IJAA 1MDMB 1I1GA 4FHTA 2FE3A 3KZZA 1IN4A 2DLLA 3T0YA 4M6YA 1FNNA 1WRJA 2XGXA 1C0WA 1S7OA 2OQGA 4IRHA 3ZMVA 4A6EA 5E1WA 1QBJA 1K78A 2EV6A 1XMAA 4KMUX 1R36A 2VE8A 1ZREA 1FP2A 4LB5A 5FLXK 1MJ9A 5DDGA 1BIBA 3EQLF 3I54A 1B4AA 2FSWA 2BV6A 5A2QZ 3E3VA 3ECHA 4M9SA 3JTGA 2P4WA 1BOAA 2H6BA 2Z9OA 3WE3A 4BHPA 2DPUA 2P6SA 3RDIA 3BJAA 5L3CA 1IRGA 1DPRA 1W7PB 2C6YA 4R1HA 3T8RA 4MTDA 3GFMA 3WTVC 5FGMA 1LEAA 1Z7UA 2QVOA 3ISPA 5DUKA 2V1UA 2YR2A 3I5UA 1XD7A 3IHUA 5BPIA 4PZJA 4HLXA 1FSHA 2VBXA 1KU2A 1LQ1A 4MTEA 1J9IA 4MGRA 4UXNA 1YW8A 3HYIA 3DFGA 2A61A 5D4RA 4B09A 3N4MA 2O3FA 3IKTA 3I58A 3U2RA 1J7KA 3JAMK 2EFPA 2KRFA 3SQNA 2ZFWA 4PCQA 2STTA 4L9VA 4YFXF 1LNWA 2HGCA 3F6VA 4KDPA 5CVVA 5D4SA 1AWCA 3E6CC 1R22A 3F6OA 4A2UA 4KICA 4M72A 2BGCA 4XLNF 3L09A 2D45A 1W5TA 3M9AA 2IJLA 2W25A 3K2ZA 5L3EA 3NRVA 2UZKA 1IAWA 1YS6A 2FBHA 1O7FA 4WCGA 3GFIA 1MJBA 3K0LA 3R4KA 4HF0A 2YX4A 3O2PE 1T6SA 2E7WA
chains in the Genus database with same CATH superfamily
2JVHA 4IOAF 2FD5A 4HNVA 2M45A 3RKXA 3SDGA 4ZTFA 4YFKF 5D5XB 3ZMTA 1IXCA 3WTTC 4XOPA 3PL8A 1OKRA 2WAQA 2FUG2 3R60A 4JYKA 3GTKJ 2R3SA 1MKMA 2LY1A 4OOIA 2K9MA 3W6JB 1J75A 5GP9A 1ETOA 2GLOA 1ONVA 4Y3OA 4BXUA 1XGOA 3H0GJ 5IPAA 4AIJA 2ISZA 4LK0F 1YHQI 4B4CA 2LKPA 2AHQA 4AUXA 4F55A 1XMKA 1X1CA 4BGDA 2L7ZA 2ICWG 3S3OA 2NVQJ 1V5GA 2JPBA 1J0RA 5LFAA 2R0QC 5D5VB 1JGGA 1WVRA 2MGQA 4XIDA 1ITYA 1BI2A 5CYVA 2FX0A 1Z67A 2K3FA 2VIXA 1VQOI 3E5QA 1VQ8I 3M4OJ 4CICA 3I59B 3H9GA 1OR7A 1BJZA 3VPRA 4ENMA 1UB9A 3LNQA 4RAFA 2OCEA 2FRHA 2WA0A 3JRIA 4RAZA 2JT1A 1IUFA 2R5YB 2E34A 2Y2ZA 2PJPA 3F8BA 4XLAA 2K86A 3CP8A 1XCVA 3K2AA 4J00A 2PMUA 3NARA 1I27A 3K4MA 3L2QA 5ICEA 4AIHA 1R7JA 5C4JJ 3NAUA 2A69F 3VYUB 1EJ9A 2V6EA 4CYDA 4O3MA 2R92J 1Y8RB 4E7ZA 4DBRA 3COAC 5J1UA 1FPQA 2KHMA 4QLCU 2A6HF 3RYRA 1VNDA 2L9RA 1GVDA 2DT6A 5F08A 3REOA 2VBWA 2CQ7A 3J7YJ 1P7IA 1DU6A 4IVNA 4V2GA 2EZHA 2M0MA 4LD5A 4KIGA 1FX7A 3OYAA 1E0EA 1JUMA 1NK3P 1FTZA 4M6XA 3I64A 1WFXA 4Q47A 3OYCA 1ETYA 4ZDLA 4HNUA 1JJ6C 1LUJB 1TWFJ 2K40A 2EFOA 1D1CA 5IP7J 3OYDA 2VC1A 2L54A 2RKHA 4BE2A 2QSHX 3S2WA 2H8WA 4RB1A 4L5EA 3ABTA 2VT3A 3K70D 5GAGJ 4M3EA 3CC4I 2HQAA 4L5IA 1R5GA 2O6GE 1MDMA 3H9QA 1MD0A 3H5RA 1V54H 1Y39A 3KEQA 4ZZDA 2V79A 2HDWA 2CW0F 2L9NA 4MEYF 3M3YJ 2V9VA 2G7HA 2ZO4A 3PIOF 1YOVB 1R00A 2HQ5A 4BYYA 2ZSHB 1EV7A 2ESNA 2ZXWH 2O0YA 1T08B 3B73A 2NVYJ 3JRGA 3CO6C 2DXIA 5IYDJ 3HKZA 3EUKL 5LRRA 4HDUA 4G6DA 2ME0A 2VKEA 1SFEA 3GFJA 2O61A 3MCZA 5GPCA 4YIFA 1FBQA 1X2NA 3KEOA 1ZAOA 3BP8A 2JA7J 3BR5A 3JSPA 3K6GA 2R93J 2PJRA 2VONA 5EG0A 2XV4S 2Q0OA 3W6KB 1D3YA 3DPTA 1J59A 3DPLC 2BYVE 3MAJA 1PUEE 1R71A 2M0CA 1K61A 2L7KA 4PSWA 3FXMA 3I71A 2X9DA 1T56A 1WWXA 2DOAA 2F4IA 4LGWA 2DA4A 2IA2A 2GA2A 2EH3A 2OBPA 2OU2A 3CC2I 4ON0A 4U0WA 1JKRC 1HW1A 2DA6A 1XCBA 2CUFA 3SXYA 2BY2A 1YX3A 2DA3A 4C3HJ 1L3LA 2O9LA 4NC7A 5HVQC 3HUGB 1YJNI 3VB2A 4OIPF 1VQ9I 1VQPI 3S1NJ 2FEZA 2H8RA 1A31A 4A3LJ 2H94A 5M3MJ 2VI6A 5HLGA 3LSTA 2RQPA 4N4NB 3SZPA 1W7PA 2ECBA 4IL6C 4CGZA 4N4OB 2QEXI 3GYHX 4E6KG 1ZRFA 1H89C 2MLKA 2DN0A 3TQNA 4RA2A 5HLIA 4D7MA 2R7ZJ 1MZBA 2EK5A 3RCOA 1U8BA 1TW2A 1BR4A 2R4GA 2GXGA 3I4NJ 4B1RA 2QGUA 5LHGA 3F8FA 3FK6A 2NAZA 3KP7A 3CF5F 5BQTA 1FOKA 4XK4A 5E1XA 2JSPA 1B9MA 1XMXA 4I02A 2DYRH 2RC4A 4BEHA 3HBLA 3KFWX 2P5VA 3SEZA 3ZRGA 2XAJA 1FYKA 2LVSA 1BBYA 3F9KA 4UB6C 2L02A 2EIKH 3V7CA 3OIQA 3V7RA 4KFCA 2IGMA 2P8TA 4Y52J 4XRSG 1KZHA 3LA7A 4MFDA 1W36D 2GXAA 3WHBA 1NG6A 1G6NA 1FMVA 5AIQA 1WH5A 1QQIA 1UG0A 4G7ZF 2WC2A 3C3WA 1WJFA 2XAGA 2BY1A 1MJAA 2V9PA 3OR2C 3MKWB 2P7VB 2LFBA 4PJMA 1TWHJ 3JAMZ 5FJ8J 4KMFA 5JHUA 1J5YA 1TT5B 5LEKA 4CCOA 5M5XJ 2W00A 2DOFA 3VYTB 1KQ8A 1DQUA 2KP6A 1G3WA 1VQNI 2K9SA 2Y0MA 3WU1B 2LNBA 3M1EA 1ZR4A 1JKQC 1S8NA 3CDHA 1AHDP 4G9YA 2MBFA 5LGUA 1APLC 3PM1A 2XDVA 2KJBA 2XKPA 3PNYA 1ZRDA 1T2KA 1GXPA 2RREA 3LA3A 3I56I 4J01A 3ROUA 5ILSA 2IS6A 4LK1F 2NS0A 2TDXA 2WAFA 4CZZA 1F4KA 1HC8A 4ESBA 4IQ4A 3QODA 4EJUA 2DBBA 4HF1A 1TT0A 4IEJA 1T33A 3H5NA 3HSEA 3I4PA 3LSIA 2I8DA 4EGZA 3R0AA 2MH9A 5F6FA 2F5VA 4NB5A 1PJRA 3DLAA 5F64A 4Q5SF 4OU0A 1SFUA 1I6XA 1TNTA 1JXSA 3IAS2 4FX4A 2D1HA 3SYTA 1E3OC 3WE2A 1ORKA 3J81K 4PJ0C 1WCMJ 1MBKA 4WXHA 2A07F 2YPRA 4XN3A 1FIAA 3DCFA 1UHMA 5H2FC 4XLCA 3K1PA 4H4KC 1P4XA 3MEXA 3M07A 3IH3A 4XLHA 4R79A 1U2WA 2K4JA 3F72A 3OOUA 1QNTA 3A1YA 4RMNA 3HRUA 3LWFA 2E1OA 2GBYA 1IN6A 2VOOA 5E3LA 4IPAA 1HF0A 3ZQQA 4MLOA 2QSFX 2PN6A 3L7WA 5KK1A 1FMWA 1OYYA 2COBA 4BH9A 3CMAI 2V9KA 2AXLA 2VT2A 3Q9SA 1K79A 1Z0XA 2F6CA 5H20A 1MIJA 2NVXJ 3E5UA 2GOMA 4ZYGA 5JVGF 4HQMA 2KIFA 2OJED 1WGXA 1FEXA 1STZA 1P6RA 1TW3A 3ABUA 4ABZA 2CUJA 2NS7A 4LG0B 1DGRM 3ABLH 3H3VK 3I3LA 3PNTA 1JHHA 2DTRA 2H6CA 4R8HA 4GYGA 3J7ZI 1TNSA 2F4MB 3GCMA 5FFZA 1F5TA 2HTSA 5J4VA 4BJTA 4RB3C 3FHZA 1ZR2A 1FC3A 4DZJA 3BR0A 1NG7A 2Y69H 2KIUA 1X4OA 3TO6A 1J2XA 3DXJF 4HBLA 3I0TA 2RNJA 3J7AY 4XRMA 1Z1DA 3OIPA 3I59A 3BY6A 4CSWA 4DBQA 2A6EF 2X1DA 1OCCH 2KT0A 3GUDA 2R5YA 2DDBA 2WB1A 3ESWB 4F91B 2NRAC 1Z91A 4BY7J 2R7TA 4YFNF 1SD7A 2D1VA 4IXAA 1PYVA 2RGVA 1BW5A 3KYDB 3P7NA 4HDVA 1EKEA 4RB2C 5IT9K 1Z3YA 3PSFA 1YRNB 3J7AO 4XKWA 2O8XA 3WTYC 1NHAA 1TLHB 3FXUA 2JTVA 4FETA 3D1NI 1UAAA 2HZTA 3L2WA 4CCKA 3HDDA 2PEXA 3FKIJ 1ZLJA 2F5FA 3Q0UA 4C30A 5D6EA 2XB0X 3LSKA 5D8LB 1S7EA 2M8GX 1SMTA 1WJDA 4EJVA 2QLZA 5LHIA 1MMGA 2V1NA 2O03A 3OYBA 2BZTA 1G4DA 3JTHA 4NHJA 1QO0D 1BC8C 1A04A 5JFRA 4A3MJ 3WTXC 3S8PA 2CH0A 4L0YB 2WAEA 5M5YJ 3GF2A 1VFCA 3LSMA 3P9CA 4LOCA 2HQNA 4UHTA 1BL0A 2XUBA 1FOWA 4UVBA 2CU7A 4II3A 4F7ZA 2IXSA 1B8IB 1UFMA 4EJOA 4NUBA 1JUPA 2LY9A 1Z3XA 2IP2A 3V8KA 4JX4A 3LFUA 1DU0A 3IL2A 1TQMA 3GLLA 2Y9ZA 3CMEI 1OCZH 2K02A 1WPKA 2DMQA 5LRSA 3QOPA 3OYIA 3TMOA 4LFUA 3ZN1A 1QGPA 2EFQA 3OL4A 1H88C 4UY8I 2ELHA 3DKWA 1ZHFA 3GEZA 3IRRA 1E2XA 1Y0UA 3FHNA 4ZC3A 1WSUA 2DI3A 1ON2A 3LAJA 5HLHA 2P6TA 2F5EA 4N0BA 1S29A 2HVQA 2PX9A 5J3LA 3W2AA 3W6VA 1MNEA 2CJJA 2XAHA 1X1DA 2V6CA 2IAIA 2V1XA 1R1UA 2MFZA 3EETA 3RKWA 4B3XA 5GADJ 3HOXJ 4HW0A 1V5EA 4RGSA 1OQYA 4UV9A 2ADUA 3ZPLA 2K9LA 3BWGA 2CFXA 4HRIA 2XGDA 2VJ4A 3LMMA 3CCEI 1D1BA 1IRFA 4DNCA 1VZ0A 3HXLA 3GXOA 5FKKA 3D5RC 2CO5A 1KU3A 2HQRA 2J5OA 3R61A 1JI8A 4JP0A 1EH7A 5LLQA 3DKXA 1X4PA 3DP7A 4LITA 1ZRCA 2VQCA 1ULYA 1VQ5I 1OISA 2KIMA 4G7OF 4CUGA 4P1WA 3DU6A 3HUGA 2VBZA 3VSLA 4S0HB 1P92A 2MW8A 5DEQA 4ZZLA 2Y0SA 2M1BA 3B02A 3WU0A 4XKBA 3NEUA 2JUGA 1MH3A 1UMQA 5CLSA 1IDYA 3W3CA 3H5AA 5K5QA 5EGOB 3TO9A 2DPDA 2XAUA 2RQQA 5FROA 3Q5FA 3LFKA 1JE8A 2ESHA 2BW3B 2VN2A 3JRDA 2UWMA 1EF4A 4TV7A 1USTA 4OIQF 1FTTA 3OY9A 4XRSA 3N05A 1QRYA 1T95A 3MKYB 4BHBA 3FDYA 2QBYB 3GMEA 3BG3A 1T39A 2PI0A 4G94A 2F4OB 3BC8A 1MBEA 4HLYA 3CJNA 3KP5A 5ILVA 4XKVA 3CCQI 2MABA 3KLNA 5J4YA 1GUUA 1XC5A 5K7FA 2K85A 5CVJA 4XNFA 1ZG1A 1CF7A 1U8RA 2MC3A 2E5NA 2CW8A 3BJOA 1FP1D 3OIOA 5CVUA 2STWA 1XDUA 3HB9A 5EEGA 3HRMA 3RPUD 2QQAA 3KCCA 4KIBA 5FO5A 3DU5A 3G1OA 3FMSA 5M3FJ 3ERMA 1BI1A 2M8EA 3OYGA 5HLTA 2PMZA 2YS9A 2M30A 5F0HA 2AQEA 4BE1A 1I3AA 2LR8A 1YX5A 1HBXG 3K70C 1S5LC 4KJZA 2BVLA 5K7HA 1QZEA 4DYCA 1YIJI 5FB2A 4N9HA 4B43A 3OYEA 3PQJA 2GZWA 1PP8F 4LLGF 2Z16A 1W5SA 1TTYA 3MWMA 3JSOA 3JRHA 2HS5A 4YIRX 1VQ6I 1WH7A 4XLEA 3DBRB 1FIPA 3LAPA 3C2BA 3TP3A 5BMZA 4C2MJ 3LSJA 3ZMZA 5ICGA 1S3JA 2LTPA 3FMRA 3PFYA 4O6JA 2DO7A 3O6BB 3Q0VA 1NK2P 2ETHA 1YO5C 1JUSA 1SD5A 4I7HA 4DW6A 1X3WB 3TDUC 1MH4A 3FX3A 3K4CA 4HPQA 2DMPA 3FXJA 3QYBA 1R23A 2HOTA 1IXSB 4CCNA 4EEFG 4JX5A 2JA5J 3ZR8X 1BIAA 4F3QA 2FNPA 3HOTA 1BOBA 2RN7A 1SC7A 2NVTJ 1BI3A 2ACJA 2J5PA 4I01A 2ID6A 3HSFA 3R0JA 2Z33A 3FBNB 5DD4A 3HC7A 2Y30A 3R6SA 2GA1A 2VKVA 2MG4A 4LJZF 3J81Z 4E7SA 4M3FA 4CA0A 1PP7U 3T8TA 4LB6B 2QUFA 4BS9A 1CQTA 3C2HA 3S1QJ 3IWFA 1IG7A 1Z6TA 2V4JC 5F27A 2CQKA 3F8NA 2HOAA 1XSXA 3ASNH 2X6YA 4GRIA 3ZQHA 1MW7A 1R49A 2CFOA 3PQKA 4J19A 3NQOA 2VB6A 4UVCA 1T8IA 1DUXC 2EV0A 1ZQ3P 4HV6A 2F48A 2JVGA 1Y0NA 3HIFA 2UV1A 3FMQA 4XKCA 1JTYA 1TP4A 4PGHA 4JQFA 4BHCA 2XIGA 3CCJI 3VODA 5E20A 5FLVA 1HSTA 1XS9A 5DV5A 1MMAA 3H3UA 2JK3A 3ZQLA 1O3TA 1SAUA 3ZMDA 2LP0A 4ZH4F 4U88A 1D8JA 3F8MA 2ME6A 1OPCA 1LKXA 1UJ8A 2WV1A 3HGYA 1W4MA 3KZIC 2K7LA 2QM3A 3OYLA 2ISYA 2VC0A 4LG0A 4U87A 1OYIA 2G0EA 3S93A 1T0FC 3OS0A 3RSNA 4U0YA 4Q48A 2GM4A 2HOEA 5HDKA 2VPLA 3DKYA 4PJLA 1E3HA 2W57A 3GTMJ 4Y13A 4OMYA 2PQ8A 1IUYA 2LOOA 1S6LA 4QPQA 5D6FA 4II2A 3KLOA 1W5CC 3BZKA 1IW7F 4MFEA 2WTEA 4Y17A 4GYIA 5EEHA 4MIMA 2ZJPF 4D0PA 3JR9A 3SEQA 3QPSA 5IT9Z 4EM0B 3MZYA 3BJ6A 4A3IJ 1W36C 4UB8C 5DUIA 1HQCA 1DGWY 2HWVA 5L3BA 1LE8A 1RC9A 2XF6A 2P81A 1ON1A 2DQRA 4NBQA 3VWBA 3AKZA 4AVPA 5CPRB 4E7HA 5HS7A 4RGXA 5DTDA 1YTYA 1YRNA 2HU9A 2P5KA 2GIZA 4EM2A 2I10A 1U3EM 3TOBA 4BXXJ 4UUSB 4A0ZA 1FYLA 4A3DJ 3EUAA 5CQEA 2DT7B 4CH7A 2ELKA 3FXQA 3KZYA 2BHYA 2IVMA 1GDTA 5DYMA 5LHHA 3BG9A 4L5JA 1MMSA 4BL0B 5E1ZB 2HKOA 3HEFA 3OMYA 3HL2A 4ITVA 2EWNA 2Z5UA 3CTAA 3GFLA 4MQ9F 3N97A 1Y1VJ 4KN4X 4D1QA 3DEEA 4NC8A 4K2EA 2JRTA 1DDNA 2JA2A 2OZUA 1I5ZA 2KLOA 4ZJZA 3F0CA 5J8CA 2N8GA 3BTLA 2LRDA 4ZDPA 3CCSI 4C2UA 1QZYA 4L9NA 2VE9A 4UNOA 1O57A 5F0CA 3H9JA 2OF7A 4AIKA 2R5ZB 1I1SA 2HEOA 3QPHA 3KX2A 1U9OA 3HZJA 5E79C 4G7HF 1B8IA 2ECCA 2QWWA 2EA4A 2MLGA 6PAXA 1ODDA 3KP3A 1MSEC 4X6AJ 4S05A 3F23A 2QYOA 2CSOA 2DU9A 4EM1A 1IRXA 5JR3A 5C4XJ 2WBMA 3VFZA 4CCLA 4QTRA 4HOBA 3ULQB 3L2CA 2QZ8A 4ENNA 2R7WA 3I53A 1NH3A 1SVLA 1FT9A 2LY2A 3A02A 1X1AA 4ESFA 2R7DA 3BLYA 1G3YA 1IXRC 1SFKA 4IOCF 2IRFG 5ERIA 1O7LA 3KP2A 1KONA 2HYFA 4ESJA 3PJRA 3LSRA 2UXNA 4ZTJA 4W1UA 1LVAA 2IA0A 2DTZA 2YSRA 5KAFC 4I0BA 2LKXA 5HODA 2VLAA 1QPMA 1IV6A 1SD4A 2EBIA 1O3QA 2LLKA 2Z3YA 3BROA 4EVIA 1TQIA 1UHWA 4PK4A 3CCYA 1X2MA 3GTQJ 1K6YA 3BT9A 4XOTA 3GX4X 2HYGD 3G2BA 2PG4A 1H8AC 3F8CA 2IT0A 3BTIA 5FKLA 1YS7A 3C18A 2DA1A 4UV8A 2M4KA 2OCCH 1B1BA 2OA4A 5K1YA 1AA7A 3WHCA 5CJ9A 4BJ6C 1I39A 4IQJA 3V7SA 3S16J 3ZQCA 5FKNA 4PFPA 5TGTA 1SAXA 3LOCA 1FWZA 4FT8A 1RUOA 1A6IA 1YJWI 5EGOA 1G3TA 3FWEA 1D0ZA 2L0KA 1REPC 3EUHC 3U1KA 1SFOJ 3T5XA 4KT6A 3ECOA 4XBFA 4V19K 3G1LA 1JTXA 2BW3A 2EZLA 5K5RA 2VQLA 4B47A 4FE7A 3BZ6A 1Q1VA 4E7KA 2QBYA 1ETVA 4EJTA 2DDAA 1QVTA 2ZMEB 1IDZA 1BW6A 3ASOH 3BG6A 2W85A 2ZMEC 3V4GA 3LSGA 4XR6A 2NYXA 2CUEA 3WTZA 1XSVA 4IHVA 1ZG5A 1FY7A 5BOXA 5BPDA 3RTRA 3UNGC 5C3EJ 2GOXB 1XN7A 1MBFA 3SZTA 2XHKA 4FQGA 3G6EI 1QU3A 3SJMA 2XVCA 1E3PA 3OS2A 2IS2A 3BDDA 3HOSA 4YIIA 2A5YB 5DCMB 3SFZA 3ZQ7A 3GLXA 2E71A 3IH4A 2L5QA 2KKOA 3RKYA 4EATA 5IOYA 3HTUA 1ZTRA 3TKYA 2DMTA 3S1RJ 3MZHA 5JVTA 2R7SA 2Q2EB 4MO7A 4GGGA 3EPZA 2EFWA 3L2VA 5JLXA 3QU3A 1D0YA 5LEJA 4GDFA 3M8EA 3OV8A 2JPCA 1BR2A 3WGHA 3DEUA 3CUOA 4RAGA 4CHUA 2R7VA 4DGWB 4G6TB 1K6OA 2XRNA 4E7IA 1R58A 2OAZA 2QQ8A 4N9IA 3HOUJ 3TBIA 1YW9A 3QP6A 4XQFA 4C3JJ 2QF7A 2XC7A 2M7AA 1XPXA 4ASNA 1ERDA 4A5MA 3E6DA 4BNCA 4AU7A 3PFIA 2EPFA 5TISC 1OCOH 2KFDA 3GZ6A 3L9FA 1YQAA 3GTLJ 1D5YA 4YEJA 2VBYA 2FQ3A 2RVCA 3DQVC 1K4TA 1VQ4I 1XGMA 2ZCWA 1JT6A 4EMSA 2B0LA 1H0MA 2LMDA 5J8FA 1A5JA 4DZPA 2IS4A 5GTIC 1XSDA 2EV5A 1HW5A 3I9V2 2BHZA 2KIQA 2KMUA 1BN5A 4RAYA 2VQGA 1U5TB 3S17J 2G9WA 1LDKB 2ZNZA 2L2OA 3P5JA 5HS8A 2XGEA 2K5CA 1ETQA 2HXOA 3QOEA 5F1RA 1TQPA 1U5TC 4PJJA 2H1KA 1YFHA 2HZDA 3OYJA 2FA5A 5CKTA 5B1BH 4KNYA 2DJIA 2F5DA 4NC6A 4NQWB 4IZZA 2B63J 4P9FA 2HTJA 1E17A 5KHDA 3AG4H 3KETA 4XORA 3L2UA 1D1AA 3EYIA 4BAYA 2XASA 5B5EC 3EYYA 1IF1A 4IRGA 3HPGA 2CG4A 5JHFA 2DYSH 3IC7A 5J6XA 1B59A 3H92A 2FMYA 5GTHC 5HOOA 2UUZA 1XGSA 1XGNA 3WG7H 2DFHA 1L0OC 1M1EB 5EDNA 3QU6A 4RM2A 1R6RA 2ZJQF 1WZ2A 2FBKA 1O3RA 1MBGA 5HNHA 3BTJA 3S2HJ 1X1BA 1SD6A 3Q9VA 4ZDOA 2LC2A 5EEAA 1Q1HA 2JMWA 2DMUA 4MEXF 1Z05A 2BXZA 4DIQA 1T98A 2X85A 1T0FA 3ZMUA 1MMNA 2COMA 1QVUA 1VF9A 2FOKA 5EJCA 1KQ9A 3IRQA 3JW4A 1RR7A 4P96A 2FMLA 3T1BA 2KDOA 2B9SA 2FXAA 1O4XA 1KU7A 4A3GJ 1HXDA 2CQNA 3A03A 3L1PA 3A2KA 4E70A 2XB5A 1AOYA 2DQLA 4RBOA 3BZCA 4HV5A 3CP2A 4I0AA 2HDDA 2HR3A 4LG3A 3AL0B 3IV5A 4WXDA 3IUOA 4AYBN 5L3DA 2GWRA 2KDZA 4KUMA 1IN7A 3ABMH 4NDLA 3GTGJ 3AL0C 2L4MA 1KQ0A 3S32A 1FBSA 3U9GA 1AKHB 3DWLE 2A68F 1UG2A 5ICCA 3VYSB 1Y1WJ 3AG1H 4HZFA 1N75A 2VXZA 3D5LA 4C9YA 3H35A 2HNHA 4XRFA 4M3BA 2OTLI 4HA8A 3S3NA 2M3AA 1R5HA 4ZYHA 5DM7F 3ML6A 1ETWA 4UUSA 2ID3A 2H27A 4JK1X 2DW4A 5DD8A 3VSKA 3OR1C 5BS6A 2IEKA 4IO9F 4D5CA 2ZFUA 2OZ6A 1LFPA 3H36A 2L3DA 2JUCA 2LYCA 1UELB 1XG1A 1XDSA 2VODA 4HYEA 1KA8A 3CO7C 3TEDA 2F5CA 3L00A 3I4MJ 1R4MB 4XM3A 4AD9A 3MD2A 3SHFA 2E1CA 4A3EJ 2EIMH 4BACA 1FOYA 2DFFA 2F2EA 4P9UA 4BE0A 3K9TA 4X0GA 1VTNC 2DMNA 2VPRA 2X4HA 2BE5F 3RZDJ 1Z21A 2R5ZA 4B48A 2LD5A 2AS5F 1OMIA 2A5WA 1GLNA 1WJ5A 3MVPA 1I3QJ 4A69C 5E18F 2XF5A 1A36A 2JA8J 1USSA 2YUSA 2X6WA 4PDKA 4HG2A 4XICA 3ZCOA 3QRFF 2RDPA 4G6QA 4EV0A 2TRTA 5FD5A 5J47A 2GXBA 4AM3A 4IRIA 1ZG3A 4KISA 3M8FA 4WX9A 2M9HA 2P0WA 1EH8A 2LSOA 3GVAA 3ERED 4EQQA 2BBYA 5LGNA 2Z2SB 4BDZA 2VJ5A 2IGNA 9ANTA 1XB4A 1RZ4A 1TC3C 1OCPA 1HOMA 3FM3A 2XROA 5FKMA 1D5VA 2WAQN 4BDYA 1MGTA 4L18B 4A3JJ 3BTCA 1F36A 3E7LA 1R9TJ 1HA8A 1OYWA 3FISA 3RKQA 2RAEA 4AVZA 1UZCA 3TL4X 3M7GA 1Z77A 3BR2A 1RRJA 3S14J 3GBGA 2E19A 4QPOA 3RQIA 2ZXIA 4S04A 3CD6I 3A01B 3K1MA 3RYPA 4A6DA 4MHGA 3BOQA 4ZYAA 3LSHA 2HXIA 2B7EA 2K3PA 3HTSB 4MNUA 3V8JA 2K4BA 1BM9A 1FBUA 3J80K 3ZXSA 2XSDC 2QSGX 2JSCA 2X0LA 5E8GA 3QQAA 2QA4I 2E36A 3H3ZA 4DOZA 5F04A 1LB2A 1WJBA 4A5NA 1GV2A 2L01A 3EUHA 4I98B 5DCFA 1G59A 4L9JA 4IHSA 2M7BA 2E5ZA 2VQHA 5ICFA 2XPVA 1ZLKA 2IW5A 2L9SA 1VQMI 2E1MB 5GPAA 4CYCB 5K5OA 3JRCA 1XX5A 1LEBA 1YIOA 4OWRB 2E1MC 5M5WJ 1LVKA 3TO7A 3K4NA 2ZMEA 3F3XA 5CVRA 3LSPA 2LF7A 2KISA 3HPHA 2Y9YA 2HDCA 1JHFA 3WTUC 4UUVA 4OINF 3BPVA 2OD5A 3RZOJ 4XSZF 1J09A 3RIRA 5FKOA 1FJLA 2DK8A 2DOEA 2W82A 3MKZA 1OCTC 5KAIC 1U78A 2E2HJ 4ETSA 4BY1J 1ZGAA 2ZC2A 1GVJA 2M87A 3ZN0A 5DCMA 3LQQA 2GAUA 4BUPA 5DM6F 3BR6A 1SEUA 3WTWC 2NNNA 1GV5A 2DA7A 2MSYA 4M73A 5AIPA 4DJAA 3S1MJ 2JN6A 3SFIA 3VYRB 2Q2EA 1QA6A 4IHYA 5FD6A 3G73A 2XAFA 5EYRA 4XL9A 3JRAA 3MMYB 4IHTA 1Y6IA 2MD5A 2AXTC 4HX4A 3NWTA 2ZKZA 3PSIA 2WWYA 2HVSA 4A3BJ 2E60A 4DYRA 4LIUA 5K7ZA 3HHHA 1VQLI 2ZNYA 5GAEJ 5D8KB 3HKZN 1FZPB 2R7QA 1TZLA 2EA2A 3OOPA 4ZYEA 3QAHA 3ZQFA 2LG4A 2GIVA 4LLNA 2IS1A 5IOZA 1ZYRF 1O3SA 1K7AA 4WK8F 3KE2A 1R1VA 3CZ6A 1H9GA 2VKDA 3K7AJ 3HSRA 5H6RA 2AQFA 4D5FA 1GXQA 3DF8A 1XTAA 4ENJA 2OQRA 3OYNA 3QP5A 2BXYA 1U9NA 2QKLB 3L2RA 5TJJA 4HNTA 2V7FA 2CGPA 3JRBA 2HVRA 1F9NA 4B8XA 3RJPA 5FFXA 2R7FA 1U5TA 1IN8A 3BG7A 4XSXF 1NTCA 1BA5A 3UKGA 3LL7A 1ZK8A 1HDDC 2W24A 5TRDA 3G4SI 1I6HJ 1W7PD 2QQBA 4JBAA 4OMZA 2ZXJA 2H1LA 3E5XA 1N78A 4NQWA 4KYWA 3C1DA 3HHGA 3FK7A 3WODF 2L7FP 3PO2J 1RR8C 3H1CA 2R7UA 2HOSA 2L9VA 1RI7A 4LLLA 1U6GA 5IT3A 2W7NA 4KA4A 4C2TA 4P55A 3LQRA 1Z6RA 4RLQA 2EIJH 4WF2A 3BR3A 4DQ2A 2CQQA 1IRZA 4BBRJ 1MNDA 4XMYA 3GZ5A 1ZGJA 2UXXA 3AAFA 2KJCA 3OYMA 1WKMA 1IN5A 1RETA 3PO3J 4JOMA 1EA3A 2BY3A 3K4LA 2DT5A 3BG5A 3TGNA 3QPTA 3O8HA 3G3ZA 3HOWJ 2ZJRF 4GCVA 4CXFA 4HF2A 2K9NA 4M71A 5FLMJ 1KYWA 4KIFA 3HRSA 4X1EA 1PUFB 4GFBA 1TWAJ 3CDLA 3CUQB 1HW2A 2P7CB 1YI2I 1HKSA 1ZKGA 3VDXA 1P4AA 5GAHJ 1YYVA 3CUQC 1TBXA 5E8IA 4IX7A 4G8XA 2PMHA 2XKOA 4KN7X 3WTSC 4IF4A 3VEPA 1RUNA 4M3GA 4BKXA 1VQ7I 2XPWA 4BJ5C 2BEOA 2Z99A 3RPUA 3WGIA 2DFIA 2K27A 1WJEA 2BOLA 3CQZJ 4Z2YA 4ENKA 1D0XA 4RM3A 4WWCA 1MBHA 4U7BA 2NXNB 2YX7A 2EQRA 2L4AA 4F92B 1HLVA 3FZVA 5CQGA 3OSGA 3DBHB 1RPWA 3WGGA 3ZP5A 3PIPF 3A0HC 1FOXA 3FXRA 1K78B 4L0ZB 2TCTA 1MBJA 1FYMA 4CZCA 2DFEA 4UVAA 1TL8A 1AKHA 2W84A 3A0BC 5KCMA 2NNYA 3W2VA 1X3UA 1S9HA 2Q1ZB 4P5OA 1Y56A 3KP6A 4Y7NJ 1YG2A 2OUMA 4RDUA 1F1ZA 1T38A 2LBFB 1Z9CA 1S72I 3K4KA 1R4NB 2JWTA 3GTOJ 2R7XA 4O5VA 5B1AH 2XGCA 4CO8A 2EJRA 4QWQA 4BQAA 1GHCA 3QYFA 5DS9A 5HS9A 5D5UB 1MSFC 2FOWA 3OWTA 3KPHA 2VASA 3LA2A 2Z1DA 1ZGWA 4I2OA 3ZMSA 2KPMA 5FLXZ 3TOAA 3DV8A 5A2QK 4E7LA 1YITI 2CV1A 3QYEA 4CCMA 1LDJA 5L3FA 2JA6J 2QCOA 4Y33A 2HYJA 3S2DJ 3D0SA 2VOPA 2DAOA 2LH9A 1WI3A 2HKXA 3CMYA 4ANJA 4U7DA 3RI4A 1HKQA 1N77A 4XONA 5D5WB 4B3AA 3FXLA 1RNLA 3BR1A 2IGOA 1V3FA 2CV0A 3K69A 1BI0A 4GO1A 1Y8QB 3VOEA 5JLWA 2NOJB 5F1JA 1BC7C 1YLFA 5E17F 1DP3A 1OFCX 5EZGA 1QPIA 2Y48A 2RV8A 4HQEA 2LK2A 3IAM2 1LFBA 4A12A 4EGYA 1FLIA 1CGPA 1P4WA 2LREA 3P9KA 1LPQA 2X6OA 4QIWN 4A3KJ 3E97A 2P5LC 1MMDA 2D5VA 5HDNA 2WV0A 2O7OA 1IZ1A 1EH6A 4CCJA 2DA5A 3HGGA 1KYZA 2MA3A 4FTHA 2WY8Q 2CW7A 3E6BA 4ZYDA 3C2GA 4RGRA 2LDUA 2M4GA 5J1YA 4I6ZA 2CRGA 4M74A 4KITB 3E0JB 3HOYJ 3AG3H 2QENA 4YG2F 1R5ID 4L9TA 2A3SA 2IPQX 2QQ9A 1G3SA 3FF5A 5CVIA 3A01A 2CWEA 3J80Z 2DJNA 2KRHA 3IP4B 1WQ2A 2R7RA 4RGUA 1HKTA 4M9ZA 4HSRA 4A3CJ 4GXOA 1CF7B 1HSJA 4V2FA 2M5WA 1HCRA 3HRTA 1A6QA 3ZOBA 5E3MA 1PVEA 3O8GA 2DCEA 2EB7A 1U0JA 3OL3A 5HDGA 2EINH 3HOVJ 1IJWC 2BY0A 2WB1N 3FXKA 2HFHA 4E4HA 1ZN2A 4HX8A 4A0YA 4Y15A 4CDGA 5ILUA 1DP7P 3AFHA 4MQVA 4I09A 4PGGA 3MQ0A 4C3IJ 1KGSA 4Y4RA 3GTPJ 2DK5A 4B44A 1FSEA 4I76A 2H09A 4LMYA 5KVRA 2L7MP 3OSFA 2D2WA 1WJCA 1TWCJ 4RS8A 2PBIA 4CYCA 2HPMA 2PFBA 1B6AA 4FX0A 2EZKA 3F22A 1BR1A 4XN0A 5LD2C 1YW7A 2Y31A 3DTKA 4WXCA 2XAQA 3IH2A 1SMYF 2LF8A 3P9IA 3IKVA 3WG9A 1ZH5A 4M6VA 3IWZA 1P2FA 1S7AA 2WADA 1K4SA 2IBDA 1OCRH 3I55I 2X48A 4D9JA 1WI9A 1VQKI 1BJAA 2FJ1A 5IYBJ 2EFNA 3ZQGA 4M9XA 4NNJA 3UR3C 5AONA 3O3KA 3CCUI 2DODA 3HOZJ 2NS8A 2MYSA 2MH2A 3RQ4A 5BNGA 1B72B 3OYFA 3BCBA 5L3GA 3BQYA 2QKMB 4HSTA 1MNMC 2LKSA 2ZBKA 2E1NA 1ETXA 3ELKA 3CCRI 1KU9A 1B9NA 3RPQA 5LBQA 2KRCA 4LIVA 3W2WA 5H6QA 4A93J 1ACIA 3TDZC 2K9QA 1YE9A 1ZARA 5IY5H 3FM5A 3KIOA 1IV8A 4DYQA 1RIOH 3C7JA 4BQOA 2YU9J 4AC0A 2FNAA 2VJIA 3ONQA 4YRVA 1DPUA 2M2EA 1UHSA 3MN2A 1D8KA 3DEWA 4U0VA 3TP0A 4Q4ZF 1PDNC 5EF6A 2PLYA 3K1NA 1H9TA 4OIOF 2CQXA 2E35A 1Z7LA 2OV7A 1P7JA 4EJWA 3CCLI 4BQNA 4H0EA 3GW2A 2ZJ2A 4XLPF 3CDIA 4RB0A 2A6TA 2Y75A 2FF4A 4FCYA 2DA2A 5B3SH 1V4RA 4G12A 3DTEA 1N25A 3CMMA 2Q8KA 3E6MA 1OR7C 1QHHD 5F0FA 4PUSA 2GQQA 1UCRA 4FASD 3BPXA 3CJRB 3CESA 3Q3SA 3KYLA 1LDDA 2RNGA 2AO9A 3JCUC 3KP4A 3HM5A 3Q0WA 4OIRF 4JX6A 2O8KA 2OC6A 3V8LA 3ZQIA 3MFKA 2Y0SN 1LFUP 4AWXB 2XF7A 4KT5C 1QZZA 1V5FA 1SVOA 5FRMA 2FBIA 3EDPA 3U1DA 3CLOA 4HAMA 3CCMI 1SVMA 4OAZA 2JZYA 4HX7A 2W48A 2ZXHA 2YU3A 4QSHA 4YELA 2X51A 1AU7A 1G8XA 1W1WE 2V1DA 3F21A 3S15J 2FU4A 1R1TA 2FQ4A 5ED4A 1SFXA 1LE8B 3GWZA 3M1CA 2R7OA 4D7NA 3K10A 5HNFA 5LGTA 3GO5A 1PUFA 3CUQA 2VL8A 2G7UA 5JI6A 3G71I 2CYYA 1JGSA 2E2JJ 1LJ9A 2IA1A 5J1RA 4A0XA 2MC4A 2I5UA 2E7XA 4IJAA 1W0UA 1MDMB 3A4CA 1I1GA 1G2HA 4FHTA 1I50J 3DLLF 2FE3A 1POGA 3KZZA 2BVMA 2OTJI 1IN4A 2DLLA 3FIWA 3T0YA 4M6YA 4F52A 2X1CA 1FNNA 1WRJA 2XGXA 1C0WA 1V55H 2PMZN 1S7OA 2OQGA 1ZELA 3FXOA 4IRHA 4RLFA 2XRLA 3ZMVA 2E2IJ 4A6EA 5E1WA 3ZGKA 2KZGA 1ENHA 3BQZA 1QBJA 2EILH 2EZIA 3WU2C 3SDBA 1K78A 2EV6A 3DPUA 1XMAA 2W1OA 4KMUX 4UUTA 3E1SA 1R36A 4A3FJ 2VE8A 1ZREA 1FP2A 3CC7I 4LB5A 2A05A 2PJRB 5EG0B 2VXDA 3NWSA 5FLXK 1MJ9A 3ABKH 4HEA2 3B6CA 2LBFA 5C44J 5DDGA 1BIBA 3EQLF 5KNLA 4Z6YA 1X58A 3I54A 4W97A 4F93B 2MD0A 1B4AA 3BCAA 2FSWA 2X6XA 3V42A 2BV6A 1QHGA 3E3VA 5A2QZ 3ECHA 2KZVA 4M9SA 2V26A 1X3ZB 3JTGA 2P4WA 3CLQA 2ELJA 1BOAA 2H6BA 2OPTA 3DTIA 3WE3A 2Z9OA 1HDPA 4BHPA 2CUZA 2DPUA 3HJEA 1IO2A 1RKWA 2P6SA 3QWLA 1YJ9I 3RDIA 1OLTA 3BJAA 3MZ8A 5L3CA 1IRGA 1DPRA 1W7PB 2C6YA 2WY7Q 3D5SC 4R1HA 3B6AA 3T8RA 1GT0C 1VI0A 3G1MA 1RESA 4IHXA 4MTDA 2ZSIB 3KYCB 3PUBA 3GFMA 3WTVC 5FGMA 1LEAA 1Z7UA 2VJJA 2KL4A 2QVOA 3DBLB 3ISPA 4BBSJ 3CJTB 5DUKA 2V1UA 4IKFA 2ZB9A 3GTJJ 2YR2A 5IP9J 1X1PA 3I5UA 1SANA 1XD7A 4PJNA 3X2QH 3GZNB 4IHWA 4BU2A 3IHUA 4PFOA 3CJQB 5J40A 5BPIA 1W0TA 3OYKA 4PZJA 3K4BA 4HLXA 3JRFA 5E3NA 1FSHA 3PNVA 4BEHB 2JJ7A 4BQQA 2VBXA 1A35A 1TWGJ 2IGKA 1JJ8C 1WHUA 2XPUA 3KEYA 3TW7A 5IP6A 2JRMA 2HPIA 1KU2A 3AG2H 3CCVI 1LQ1A 4MTEA 1J9IA 3QPLA 4MGRA 4UXNA 5EZHA 1YW8A 3HYIA 4AYBA 4XLFA 4PSXA 2W4SA 2VUMJ 3DFGA 2A61A 5D4RA 2NOGA 3OS1A 4B09A 3N4MA 3MKLA 2O3FA 2HI3A 3IKTA 4BXFA 2KQRA 3I58A 4OAYA 1J7KA 2NVUB 3U2RA 2CS3A 2O5RA 2EFPA 2KRFA 2CMPA 3SQNA 3PUFA 3JAMK 1JT0A 2ZFWA 3FKJA 4PCQA 3TW6A 1RKTA 5B66C 4FISA 2STTA 1ETKA 4L9VA 1P9QC 1OJLA 4YFXF 3OYHA 5E3OA 2VKHA 1LNWA 2HGCA 3F6VA 3S3MA 4KDPA 5CVVA 5D4SA 1AWCA 3E6CC 1R22A 3F6OA 4A2UA 4KICA 4M3DA 3JREA 2M34A 4M72A 4FE4A 2BGCA 4XLNF 1JKOC 3SZGA 3L09A 5FRNA 4AIDA 2D45A 1W5TA 3M9AA 2IJLA 2CV2A 2XSJC 2W25A 3K2ZA 5L3EA 1K83J 3NRVA 3CF2A 1JKPC 4I99C 5IYCJ 3HG9A 2UZKA 1IAWA 1YS6A 3FBIB 2FBHA 1F43A 1O7FA 1WJAA 3M8JA 1MJBA 4WCGA 3GFIA 3H0DA 3K0LA 3R4KA 4HF0A 3U21A 3K4JA 2YX4A 1X19A 3O2PE 1IC8A 1IGNA 2X1EA 1T6SA 2JQ7A 2E7WA 1B72A 4E7JA
chains in the Genus database with same CATH topology
2M45A 3RKXA 4YFKF 5D5XB 3ZMTA 1IXCA 3WTTC 1OKRA 3R60A 2R3SA 1MKMA 4OOIA 1J75A 3W6JB 1ONVA 4BXUA 1XGOA 4AIJA 2ISZA 4LK0F 2LKPA 1XMKA 2JPBA 1J0RA 5D5VB 1BI2A 5CYVA 3E5QA 4CICA 3I59B 1OR7A 4ENMA 1UB9A 2FRHA 4RAZA 2JT1A 2PJPA 3F8BA 2K86A 1XCVA 2PMUA 1I27A 5ICEA 4AIHA 1R7JA 2A69F 4CYDA 4O3MA 3COAC 1FPQA 4QLCU 2A6HF 3RYRA 3REOA 2VBWA 4IVNA 4LD5A 4KIGA 1FX7A 4M6XA 3I64A 4Q47A 2EFOA 2VC1A 2L54A 2RKHA 3S2WA 4RB1A 3ABTA 2VT3A 4L5IA 1R5GA 2O6GE 1MDMA 1MD0A 3KEQA 4ZZDA 2V79A 2CW0F 4MEYF 2V9VA 2G7HA 2ZO4A 1R00A 4BYYA 1EV7A 2ESNA 3B73A 2O0YA 3CO6C 5LRRA 4HDUA 4G6DA 3GFJA 1SFEA 2O61A 3MCZA 4YIFA 1FBQA 3KEOA 1ZAOA 3BP8A 3JSPA 2VONA 2XV4S 2Q0OA 3W6KB 1D3YA 3DPTA 1J59A 3DPLC 2BYVE 3MAJA 1PUEE 3I71A 1WWXA 4LGWA 2IA2A 2GA2A 2OBPA 2OU2A 4ON0A 4U0WA 1HW1A 1XCBA 3SXYA 1L3LA 5HVQC 3VB2A 4OIPF 2FEZA 2H94A 5HLGA 3LSTA 2RQPA 3SZPA 1W7PA 4CGZA 3GYHX 1ZRFA 2MLKA 3TQNA 5HLIA 1MZBA 2EK5A 1TW2A 2GXGA 5LHGA 3F8FA 2NAZA 3KP7A 5BQTA 1FOKA 5E1XA 1B9MA 4I02A 2RC4A 3KFWX 2P5VA 2XAJA 1FYKA 1BBYA 2L02A 3V7CA 3V7RA 4KFCA 2P8TA 3LA7A 4G7ZF 1G6NA 5AIQA 1QQIA 2WC2A 3C3WA 2XAGA 1MJAA 2P7VB 3JAMZ 4KMFA 5JHUA 1J5YA 5LEKA 1KQ8A 1G3WA 2Y0MA 3WU1B 2LNBA 3M1EA 1S8NA 3CDHA 4G9YA 2MBFA 5LGUA 2KJBA 2XKPA 1ZRDA 1T2KA 1GXPA 3LA3A 3ROUA 5ILSA 4LK1F 2NS0A 2TDXA 4CZZA 1F4KA 4ESBA 4EJUA 2DBBA 4HF1A 3HSEA 3I4PA 4EGZA 3R0AA 2MH9A 5F6FA 4NB5A 5F64A 4Q5SF 4OU0A 1SFUA 1I6XA 1TNTA 1JXSA 4FX4A 2D1HA 3WE2A 3J81K 4WXHA 2A07F 2YPRA 1UHMA 3K1PA 1P4XA 3MEXA 4R79A 1U2WA 2K4JA 3F72A 1QNTA 3HRUA 3LWFA 1IN6A 2VOOA 4IPAA 2PN6A 3L7WA 5KK1A 1OYYA 4BH9A 2AXLA 2VT2A 3Q9SA 1K79A 5H20A 3E5UA 4ZYGA 4HQMA 2KIFA 1STZA 1P6RA 1TW3A 3ABUA 4LG0B 1JHHA 2DTRA 2H6CA 4R8HA 4GYGA 1TNSA 5FFZA 1F5TA 2HTSA 4RB3C 3FHZA 1FC3A 2KIUA 3TO6A 1J2XA 3DXJF 4HBLA 3I0TA 2RNJA 1Z1DA 3I59A 3BY6A 2A6EF 3GUDA 2NRAC 1Z91A 4YFNF 1SD7A 2D1VA 4IXAA 2RGVA 3P7NA 4HDVA 4RB2C 5IT9K 3J7AO 2O8XA 3WTYC 1NHAA 1TLHB 3FXUA 2JTVA 2HZTA 2PEXA 1ZLJA 2F5FA 5D6EA 5D8LB 1SMTA 5LHIA 4EJVA 2QLZA 2O03A 1G4DA 3JTHA 4NHJA 1QO0D 1BC8C 1A04A 5JFRA 3WTXC 4L0YB 3GF2A 3P9CA 2HQNA 4UHTA 2XUBA 4UVBA 4F7ZA 1UFMA 4EJOA 2IP2A 3V8KA 3IL2A 1TQMA 2K02A 5LRSA 3QOPA 4LFUA 3ZN1A 1QGPA 2EFQA 2ELHA 3DKWA 1ZHFA 3GEZA 3IRRA 1E2XA 1Y0UA 1WSUA 2DI3A 1ON2A 3LAJA 5HLHA 2P6TA 2F5EA 4N0BA 1S29A 2XAHA 2V6CA 2V1XA 3EETA 1R1UA 3RKWA 4HW0A 4RGSA 4UV9A 2ADUA 3ZPLA 3BWGA 2CFXA 1IRFA 4DNCA 3GXOA 2CO5A 1KU3A 2HQRA 2J5OA 3R61A 5LLQA 1EH7A 3DP7A 1ZRCA 1ULYA 2KIMA 4G7OF 3HUGA 2VBZA 1P92A 5DEQA 4ZZLA 2M1BA 3B02A 3WU0A 3NEUA 5CLSA 5K5QA 3TO9A 2DPDA 3Q5FA 3LFKA 1JE8A 2ESHA 2VN2A 2UWMA 4TV7A 1USTA 4OIQF 4BHBA 2QBYB 1T39A 2PI0A 4G94A 4HLYA 3CJNA 3KP5A 5ILVA 3KLNA 5CVJA 1ZG1A 1CF7A 1U8RA 2MC3A 3BJOA 1FP1D 5CVUA 2STWA 1XDUA 5EEGA 3HRMA 2QQAA 3KCCA 4KIBA 5FO5A 3FMSA 1BI1A 2M8EA 2M30A 1HBXG 5FB2A 4N9HA 3PQJA 2GZWA 1PP8F 4LLGF 1W5SA 1TTYA 3MWMA 3JSOA 2HS5A 3LAPA 5BMZA 3ZMZA 5ICGA 1S3JA 3FMRA 4O6JA 2DO7A 3O6BB 2ETHA 1YO5C 1SD5A 4I7HA 3TDUC 3FX3A 1R23A 1IXSB 1BIAA 2FNPA 3HOTA 2RN7A 1BI3A 2ACJA 2J5PA 4I01A 3HSFA 3R0JA 2Z33A 5DD4A 3R6SA 2GA1A 4LJZF 3J81Z 1PP7U 3T8TA 4LB6B 2QUFA 3IWFA 1Z6TA 2CQKA 3F8NA 1XSXA 3PQKA 3NQOA 4UVCA 1DUXC 2EV0A 4HV6A 3HIFA 3FMQA 4PGHA 4JQFA 4BHCA 2XIGA 3VODA 5E20A 1HSTA 5DV5A 3H3UA 1O3TA 3ZMDA 4ZH4F 4U88A 1D8JA 3F8MA 1OPCA 1W4MA 2K7LA 2QM3A 2ISYA 2VC0A 4LG0A 1OYIA 4U0YA 4Q48A 2HOEA 5HDKA 2W57A 4Y13A 4OMYA 2PQ8A 1IUYA 1S6LA 5D6FA 3KLOA 1IW7F 2WTEA 4Y17A 4GYIA 5EEHA 4D0PA 5IT9Z 4EM0B 3MZYA 3BJ6A 5DUIA 1HQCA 2HWVA 5L3BA 1ON1A 2DQRA 4AVPA 5HS7A 4RGXA 1YTYA 2P5KA 4EM2A 1U3EM 3TOBA 4A0ZA 1FYLA 3FXQA 3KZYA 2IVMA 5DYMA 5LHHA 4L5JA 5E1ZB 2HKOA 2EWNA 2Z5UA 3CTAA 3GFLA 3N97A 4MQ9F 4KN4X 4K2EA 2JRTA 1DDNA 2OZUA 1I5ZA 5J8CA 1QZYA 4L9NA 2VE9A 4UNOA 1O57A 4AIKA 1I1SA 2HEOA 3QPHA 4G7HF 2QWWA 2EA4A 2MLGA 6PAXA 1ODDA 3KP3A 4S05A 3F23A 2QYOA 2CSOA 2DU9A 4EM1A 5JR3A 3VFZA 4HOBA 3ULQB 3L2CA 2QZ8A 4ENNA 3I53A 1FT9A 4ESFA 2R7DA 1G3YA 1IXRC 2IRFG 5ERIA 1O7LA 3KP2A 2HYFA 4ESJA 2UXNA 1LVAA 2IA0A 2YSRA 4I0BA 1QPMA 1SD4A 1O3QA 2Z3YA 3BROA 4EVIA 1TQIA 1UHWA 3GX4X 2HYGD 2PG4A 3F8CA 2IT0A 1YS7A 3C18A 4UV8A 1B1BA 2OA4A 5K1YA 5CJ9A 3V7SA 1SAXA 1FWZA 4FT8A 1RUOA 1G3TA 3FWEA 1REPC 3T5XA 3ECOA 4XBFA 5K5RA 3BZ6A 2QBYA 4EJTA 2ZMEB 2W85A 3V4GA 2NYXA 3WTZA 1XSVA 1ZG5A 1FY7A 5BOXA 5BPDA 3RTRA 1XN7A 3SZTA 2XHKA 2XVCA 3BDDA 3HOSA 4YIIA 2A5YB 5DCMB 3SFZA 3ZQ7A 3GLXA 3RKYA 2KKOA 3HTUA 3TKYA 3MZHA 5JVTA 4GGGA 2EFWA 3QU3A 5LEJA 3M8EA 3OV8A 2JPCA 3WGHA 3DEUA 3CUOA 4CHUA 1K6OA 2XRNA 1R58A 2OAZA 4N9IA 1YW9A 3QP6A 4ASNA 4A5MA 3E6DA 4BNCA 3PFIA 3GZ6A 3L9FA 1YQAA 2VBYA 2FQ3A 2RVCA 3DQVC 1XGMA 2ZCWA 4EMSA 2B0LA 1H0MA 5J8FA 1XSDA 2EV5A 1HW5A 1BN5A 4RAYA 1U5TB 2G9WA 1LDKB 2ZNZA 5HS8A 5F1RA 1TQPA 1U5TC 1YFHA 2FA5A 4KNYA 2F5DA 4P9FA 2HTJA 1E17A 3KETA 3EYIA 4BAYA 2XASA 3EYYA 1IF1A 4IRGA 2CG4A 3IC7A 5J6XA 1B59A 3H92A 2FMYA 5HOOA 1XGSA 1XGNA 1L0OC 3QU6A 2FBKA 1O3RA 3Q9VA 1SD6A 1Q1HA 4MEXF 1Z05A 1T98A 1T0FA 3ZMUA 2COMA 2FOKA 1KQ9A 3IRQA 3JW4A 4P96A 2FMLA 3T1BA 2FXAA 1KU7A 1HXDA 4E70A 1AOYA 2DQLA 4HV5A 4I0AA 2HR3A 4WXDA 5L3DA 2GWRA 4KUMA 1IN7A 2L4MA 1KQ0A 1FBSA 3U9GA 2A68F 5ICCA 4HZFA 2VXZA 3D5LA 4XRFA 4HA8A 1R5HA 4ZYHA 3ML6A 2H27A 4JK1X 2DW4A 5DD8A 5BS6A 2OZ6A 2L3DA 1XDSA 2VODA 4HYEA 1KA8A 3CO7C 2F5CA 3L00A 4AD9A 3SHFA 2E1CA 2F2EA 4P9UA 3K9TA 1VTNC 2X4HA 2BE5F 2AS5F 1OMIA 5E18F 1USSA 4PDKA 3QRFF 2RDPA 4G6QA 4EV0A 5FD5A 2GXBA 4IRIA 1ZG3A 3M8FA 4WX9A 1EH8A 2LSOA 3GVAA 3ERED 4EQQA 2BBYA 5LGNA 1XB4A 1RZ4A 3FM3A 2XROA 1D5VA 1MGTA 4L18B 1OYWA 3M7GA 4S04A 3K1MA 3RYPA 4A6DA 4MHGA 3BOQA 3HTSB 4MNUA 3V8JA 2K4BA 1BM9A 1FBUA 3J80K 2JSCA 2X0LA 5E8GA 3H3ZA 1LB2A 4A5NA 2L01A 3EUHA 4I98B 5DCFA 4L9JA 4IHSA 5ICFA 1ZLKA 2IW5A 5K5OA 1LEBA 1YIOA 3TO7A 5CVRA 2ZMEA 3F3XA 2LF7A 2HDCA 1JHFA 3WTUC 4UUVA 4OINF 3BPVA 2OD5A 4XSZF 3RIRA 2DK8A 1U78A 4ETSA 1ZGAA 1GVJA 2M87A 3ZN0A 5DCMA 3LQQA 2GAUA 3WTWC 2NNNA 5AIPA 4M73A 2Q2EA 5FD6A 3G73A 2XAFA 4IHTA 2MD5A 4HX4A 2ZKZA 2WWYA 3HHHA 2ZNYA 5D8KB 1FZPB 2EA2A 3OOPA 4ZYEA 3QAHA 2GIVA 4LLNA 1ZYRF 1O3SA 1K7AA 4WK8F 3KE2A 1R1VA 1H9GA 3HSRA 5H6RA 1GXQA 3DF8A 4ENJA 2OQRA 3QP5A 5TJJA 2CGPA 1F9NA 4B8XA 3RJPA 5FFXA 2R7FA 1U5TA 1IN8A 4XSXF 2W24A 5TRDA 1W7PD 2QQBA 4JBAA 4OMZA 2ZXJA 3E5XA 4NQWA 4KYWA 3C1DA 3HHGA 3WODF 1RI7A 4LLLA 1U6GA 5IT3A 4KA4A 4P55A 3LQRA 1Z6RA 4WF2A 4DQ2A 3GZ5A 1ZGJA 2UXXA 3AAFA 2KJCA 1WKMA 1IN5A 2DT5A 3TGNA 3QPTA 3G3ZA 4GCVA 4CXFA 4HF2A 4M71A 1KYWA 4KIFA 3HRSA 3CUQB 1HW2A 2P7CB 1HKSA 1P4AA 1YYVA 3CUQC 1TBXA 5E8IA 4G8XA 2PMHA 2XKOA 4KN7X 3WTSC 4IF4A 3VEPA 1RUNA 2BEOA 2Z99A 3RPUA 3WGIA 2DFIA 2K27A 4Z2YA 4ENKA 4WWCA 4U7BA 2YX7A 2L4AA 3FZVA 3WGGA 3ZP5A 3FXRA 1K78B 4L0ZB 1FYMA 4UVAA 2W84A 2NNYA 1X3UA 4P5OA 3KP6A 1YG2A 1F1ZA 1T38A 1Z9CA 4O5VA 4CO8A 2EJRA 4QWQA 4BQAA 1GHCA 5HS9A 5D5UB 3LA2A 4I2OA 3ZMSA 5FLXZ 3TOAA 3DV8A 5A2QK 1LDJA 5L3FA 3D0SA 2VOPA 2DAOA 2HKXA 4U7DA 3RI4A 1HKQA 5D5WB 1RNLA 1V3FA 3K69A 1BI0A 4GO1A 3VOEA 1BC7C 1YLFA 5E17F 2Y48A 2RV8A 4HQEA 4A12A 4EGYA 1FLIA 1CGPA 1P4WA 3P9KA 3E97A 2P5LC 5HDNA 2WV0A 1IZ1A 1EH6A 1KYZA 2MA3A 3E6BA 4ZYDA 4RGRA 2LDUA 4M74A 4YG2F 2QENA 4L9TA 2A3SA 2IPQX 2QQ9A 1G3SA 3FF5A 5CVIA 2CWEA 3J80Z 1WQ2A 1HKTA 4RGUA 4M9ZA 4GXOA 1CF7B 1HSJA 2M5WA 3HRTA 2EB7A 5HDGA 2HFHA 1ZN2A 4HX8A 4A0YA 4Y15A 4CDGA 5ILUA 1DP7P 4MQVA 4I09A 4PGGA 3MQ0A 1KGSA 2DK5A 1FSEA 4LMYA 2H09A 5KVRA 2D2WA 4RS8A 2PBIA 2PFBA 1B6AA 4FX0A 3F22A 1YW7A 4WXCA 2XAQA 1SMYF 2LF8A 3P9IA 3IKVA 3WG9A 1ZH5A 3IWZA 1P2FA 1S7AA 1WI9A 1BJAA 2EFNA 4M9XA 5AONA 3O3KA 2MH2A 5L3GA 2ZBKA 2E1NA 3ELKA 1KU9A 1B9NA 3RPQA 5LBQA 5H6QA 3TDZC 1ZARA 3FM5A 1RIOH 3C7JA 2FNAA 1DPUA 4U0VA 1D8KA 1PDNC 4Q4ZF 2PLYA 3K1NA 1H9TA 4OIOF 4EJWA 4H0EA 3GW2A 2ZJ2A 4XLPF 4RB0A 2Y75A 2FF4A 1V4RA 2Q8KA 3E6MA 2GQQA 1UCRA 3BPXA 1LDDA 3KP4A 4OIRF 3V8LA 3MFKA 4AWXB 4KT5C 1QZZA 2FBIA 3EDPA 3U1DA 3CLOA 4HAMA 2JZYA 4HX7A 2YU3A 2V1DA 3F21A 2FU4A 1R1TA 5ED4A 1SFXA 3GWZA 5LGTA 3GO5A 3CUQA 2G7UA 5JI6A 2CYYA 1JGSA 1LJ9A 2IA1A 4A0XA 2E7XA 4IJAA 1MDMB 1I1GA 4FHTA 2FE3A 3KZZA 1IN4A 2DLLA 3T0YA 4M6YA 1FNNA 1WRJA 2XGXA 1C0WA 1S7OA 2OQGA 4IRHA 3ZMVA 4A6EA 5E1WA 1QBJA 1K78A 2EV6A 1XMAA 4KMUX 1R36A 2VE8A 1ZREA 1FP2A 4LB5A 5FLXK 1MJ9A 5DDGA 1BIBA 3EQLF 3I54A 1B4AA 2FSWA 2BV6A 5A2QZ 3E3VA 3ECHA 4M9SA 3JTGA 2P4WA 1BOAA 2H6BA 2Z9OA 3WE3A 4BHPA 2DPUA 2P6SA 3RDIA 3BJAA 5L3CA 1IRGA 1DPRA 1W7PB 2C6YA 4R1HA 3T8RA 4MTDA 3GFMA 3WTVC 5FGMA 1LEAA 1Z7UA 2QVOA 3ISPA 5DUKA 2V1UA 2YR2A 3I5UA 1XD7A 3IHUA 5BPIA 4PZJA 4HLXA 1FSHA 2VBXA 1KU2A 1LQ1A 4MTEA 1J9IA 4MGRA 4UXNA 1YW8A 3HYIA 3DFGA 2A61A 5D4RA 4B09A 3N4MA 2O3FA 3IKTA 3I58A 3U2RA 1J7KA 3JAMK 2EFPA 2KRFA 3SQNA 2ZFWA 4PCQA 2STTA 4L9VA 4YFXF 1LNWA 2HGCA 3F6VA 4KDPA 5CVVA 5D4SA 1AWCA 3E6CC 1R22A 3F6OA 4A2UA 4KICA 4M72A 2BGCA 4XLNF 3L09A 2D45A 1W5TA 3M9AA 2IJLA 2W25A 3K2ZA 5L3EA 3NRVA 2UZKA 1IAWA 1YS6A 2FBHA 1O7FA 4WCGA 3GFIA 1MJBA 3K0LA 3R4KA 4HF0A 2YX4A 3O2PE 1T6SA 2E7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M45 A;  3RKX A;  4YFK F;  5D5X B;  3ZMT A;  1IXC A;  3WTT C;  1OKR A;  3R60 A;  2R3S A;  1MKM A;  4OOI A;  1J75 A;  3W6J B;  1ONV A;  4BXU A;  1XGO A;  4AIJ A;  2ISZ A;  4LK0 F;  2LKP A;  1XMK A;  2JPB A;  1J0R A;  5D5V B;  1BI2 A;  5CYV A;  3E5Q A;  4CIC A;  3I59 B;  1OR7 A;  4ENM A;  1UB9 A;  2FRH A;  4RAZ A;  2JT1 A;  2PJP A;  3F8B A;  2K86 A;  1XCV A;  2PMU A;  1I27 A;  5ICE A;  4AIH A;  1R7J A;  2A69 F;  4CYD A;  4O3M A;  3COA C;  1FPQ A;  4QLC U;  2A6H F;  3RYR A;  3REO A;  2VBW A;  4IVN A;  4LD5 A;  4KIG A;  1FX7 A;  4M6X A;  3I64 A;  4Q47 A;  2EFO A;  2VC1 A;  2L54 A;  2RKH A;  3S2W A;  4RB1 A;  3ABT A;  2VT3 A;  4L5I A;  1R5G A;  2O6G E;  1MDM A;  1MD0 A;  3KEQ A;  4ZZD A;  2V79 A;  2CW0 F;  4MEY F;  2V9V A;  2G7H A;  2ZO4 A;  1R00 A;  4BYY A;  1EV7 A;  2ESN A;  3B73 A;  2O0Y A;  3CO6 C;  5LRR A;  4HDU A;  4G6D A;  3GFJ A;  1SFE A;  2O61 A;  3MCZ A;  4YIF A;  1FBQ A;  3KEO A;  1ZAO A;  3BP8 A;  3JSP A;  2VON A;  2XV4 S;  2Q0O A;  3W6K B;  1D3Y A;  3DPT A;  1J59 A;  3DPL C;  2BYV E;  3MAJ A;  1PUE E;  3I71 A;  1WWX A;  4LGW A;  2IA2 A;  2GA2 A;  2OBP A;  2OU2 A;  4ON0 A;  4U0W A;  1HW1 A;  1XCB A;  3SXY A;  1L3L A;  5HVQ C;  3VB2 A;  4OIP F;  2FEZ A;  2H94 A;  5HLG A;  3LST A;  2RQP A;  3SZP A;  1W7P A;  4CGZ A;  3GYH X;  1ZRF A;  2MLK A;  3TQN A;  5HLI A;  1MZB A;  2EK5 A;  1TW2 A;  2GXG A;  5LHG A;  3F8F A;  2NAZ A;  3KP7 A;  5BQT A;  1FOK A;  5E1X A;  1B9M A;  4I02 A;  2RC4 A;  3KFW X;  2P5V A;  2XAJ A;  1FYK A;  1BBY A;  2L02 A;  3V7C A;  3V7R A;  4KFC A;  2P8T A;  3LA7 A;  4G7Z F;  1G6N A;  5AIQ A;  1QQI A;  2WC2 A;  3C3W A;  2XAG A;  1MJA A;  2P7V B;  3JAM Z;  4KMF A;  5JHU A;  1J5Y A;  5LEK A;  1KQ8 A;  1G3W A;  2Y0M A;  3WU1 B;  2LNB A;  3M1E A;  1S8N A;  3CDH A;  4G9Y A;  2MBF A;  5LGU A;  2KJB A;  2XKP A;  1ZRD A;  1T2K A;  1GXP A;  3LA3 A;  3ROU A;  5ILS A;  4LK1 F;  2NS0 A;  2TDX A;  4CZZ A;  1F4K A;  4ESB A;  4EJU A;  2DBB A;  4HF1 A;  3HSE A;  3I4P A;  4EGZ A;  3R0A A;  2MH9 A;  5F6F A;  4NB5 A;  5F64 A;  4Q5S F;  4OU0 A;  1SFU A;  1I6X A;  1TNT A;  1JXS A;  4FX4 A;  2D1H A;  3WE2 A;  3J81 K;  4WXH A;  2A07 F;  2YPR A;  1UHM A;  3K1P A;  1P4X A;  3MEX A;  4R79 A;  1U2W A;  2K4J A;  3F72 A;  1QNT A;  3HRU A;  3LWF A;  1IN6 A;  2VOO A;  4IPA A;  2PN6 A;  3L7W A;  5KK1 A;  1OYY A;  4BH9 A;  2AXL A;  2VT2 A;  3Q9S A;  1K79 A;  5H20 A;  3E5U A;  4ZYG A;  4HQM A;  2KIF A;  1STZ A;  1P6R A;  1TW3 A;  3ABU A;  4LG0 B;  1JHH A;  2DTR A;  2H6C A;  4R8H A;  4GYG A;  1TNS A;  5FFZ A;  1F5T A;  2HTS A;  4RB3 C;  3FHZ A;  1FC3 A;  2KIU A;  3TO6 A;  1J2X A;  3DXJ F;  4HBL A;  3I0T A;  2RNJ A;  1Z1D A;  3I59 A;  3BY6 A;  2A6E F;  3GUD A;  2NRA C;  1Z91 A;  4YFN F;  1SD7 A;  2D1V A;  4IXA A;  2RGV A;  3P7N A;  4HDV A;  4RB2 C;  5IT9 K;  3J7A O;  2O8X A;  3WTY C;  1NHA A;  1TLH B;  3FXU A;  2JTV A;  2HZT A;  2PEX A;  1ZLJ A;  2F5F A;  5D6E A;  5D8L B;  1SMT A;  5LHI A;  4EJV A;  2QLZ A;  2O03 A;  1G4D A;  3JTH A;  4NHJ A;  1QO0 D;  1BC8 C;  1A04 A;  5JFR A;  3WTX C;  4L0Y B;  3GF2 A;  3P9C A;  2HQN A;  4UHT A;  2XUB A;  4UVB A;  4F7Z A;  1UFM A;  4EJO A;  2IP2 A;  3V8K A;  3IL2 A;  1TQM A;  2K02 A;  5LRS A;  3QOP A;  4LFU A;  3ZN1 A;  1QGP A;  2EFQ A;  2ELH A;  3DKW A;  1ZHF A;  3GEZ A;  3IRR A;  1E2X A;  1Y0U A;  1WSU A;  2DI3 A;  1ON2 A;  3LAJ A;  5HLH A;  2P6T A;  2F5E A;  4N0B A;  1S29 A;  2XAH A;  2V6C A;  2V1X A;  3EET A;  1R1U A;  3RKW A;  4HW0 A;  4RGS A;  4UV9 A;  2ADU A;  3ZPL A;  3BWG A;  2CFX A;  1IRF A;  4DNC A;  3GXO A;  2CO5 A;  1KU3 A;  2HQR A;  2J5O A;  3R61 A;  5LLQ A;  1EH7 A;  3DP7 A;  1ZRC A;  1ULY A;  2KIM A;  4G7O F;  3HUG A;  2VBZ A;  1P92 A;  5DEQ A;  4ZZL A;  2M1B A;  3B02 A;  3WU0 A;  3NEU A;  5CLS A;  5K5Q A;  3TO9 A;  2DPD A;  3Q5F A;  3LFK A;  1JE8 A;  2ESH A;  2VN2 A;  2UWM A;  4TV7 A;  1UST A;  4OIQ F;  4BHB A;  2QBY B;  1T39 A;  2PI0 A;  4G94 A;  4HLY A;  3CJN A;  3KP5 A;  5ILV A;  3KLN A;  5CVJ A;  1ZG1 A;  1CF7 A;  1U8R A;  2MC3 A;  3BJO A;  1FP1 D;  5CVU A;  2STW A;  1XDU A;  5EEG A;  3HRM A;  2QQA A;  3KCC A;  4KIB A;  5FO5 A;  3FMS A;  1BI1 A;  2M8E A;  2M30 A;  1HBX G;  5FB2 A;  4N9H A;  3PQJ A;  2GZW A;  1PP8 F;  4LLG F;  1W5S A;  1TTY A;  3MWM A;  3JSO A;  2HS5 A;  3LAP A;  5BMZ A;  3ZMZ A;  5ICG A;  1S3J A;  3FMR A;  4O6J A;  2DO7 A;  3O6B B;  2ETH A;  1YO5 C;  1SD5 A;  4I7H A;  3TDU C;  3FX3 A;  1R23 A;  1IXS B;  1BIA A;  2FNP A;  3HOT A;  2RN7 A;  1BI3 A;  2ACJ A;  2J5P A;  4I01 A;  3HSF A;  3R0J A;  2Z33 A;  5DD4 A;  3R6S A;  2GA1 A;  4LJZ F;  3J81 Z;  1PP7 U;  3T8T A;  4LB6 B;  2QUF A;  3IWF A;  1Z6T A;  2CQK A;  3F8N A;  1XSX A;  3PQK A;  3NQO A;  4UVC A;  1DUX C;  2EV0 A;  4HV6 A;  3HIF A;  3FMQ A;  4PGH A;  4JQF A;  4BHC A;  2XIG A;  3VOD A;  5E20 A;  1HST A;  5DV5 A;  3H3U A;  1O3T A;  3ZMD A;  4ZH4 F;  4U88 A;  1D8J A;  3F8M A;  1OPC A;  1W4M A;  2K7L A;  2QM3 A;  2ISY A;  2VC0 A;  4LG0 A;  1OYI A;  4U0Y A;  4Q48 A;  2HOE A;  5HDK A;  2W57 A;  4Y13 A;  4OMY A;  2PQ8 A;  1IUY A;  1S6L A;  5D6F A;  3KLO A;  1IW7 F;  2WTE A;  4Y17 A;  4GYI A;  5EEH A;  4D0P A;  5IT9 Z;  4EM0 B;  3MZY A;  3BJ6 A;  5DUI A;  1HQC A;  2HWV A;  5L3B A;  1ON1 A;  2DQR A;  4AVP A;  5HS7 A;  4RGX A;  1YTY A;  2P5K A;  4EM2 A;  1U3E M;  3TOB A;  4A0Z A;  1FYL A;  3FXQ A;  3KZY A;  2IVM A;  5DYM A;  5LHH A;  4L5J A;  5E1Z B;  2HKO A;  2EWN A;  2Z5U A;  3CTA A;  3GFL A;  3N97 A;  4MQ9 F;  4KN4 X;  4K2E A;  2JRT A;  1DDN A;  2OZU A;  1I5Z A;  5J8C A;  1QZY A;  4L9N A;  2VE9 A;  4UNO A;  1O57 A;  4AIK A;  1I1S A;  2HEO A;  3QPH A;  4G7H F;  2QWW A;  2EA4 A;  2MLG A;  6PAX A;  1ODD A;  3KP3 A;  4S05 A;  3F23 A;  2QYO A;  2CSO A;  2DU9 A;  4EM1 A;  5JR3 A;  3VFZ A;  4HOB A;  3ULQ B;  3L2C A;  2QZ8 A;  4ENN A;  3I53 A;  1FT9 A;  4ESF A;  2R7D A;  1G3Y A;  1IXR C;  2IRF G;  5ERI A;  1O7L A;  3KP2 A;  2HYF A;  4ESJ A;  2UXN A;  1LVA A;  2IA0 A;  2YSR A;  4I0B A;  1QPM A;  1SD4 A;  1O3Q A;  2Z3Y A;  3BRO A;  4EVI A;  1TQI A;  1UHW A;  3GX4 X;  2HYG D;  2PG4 A;  3F8C A;  2IT0 A;  1YS7 A;  3C18 A;  4UV8 A;  1B1B A;  2OA4 A;  5K1Y A;  5CJ9 A;  3V7S A;  1SAX A;  1FWZ A;  4FT8 A;  1RUO A;  1G3T A;  3FWE A;  1REP C;  3T5X A;  3ECO A;  4XBF A;  5K5R A;  3BZ6 A;  2QBY A;  4EJT A;  2ZME B;  2W85 A;  3V4G A;  2NYX A;  3WTZ A;  1XSV A;  1ZG5 A;  1FY7 A;  5BOX A;  5BPD A;  3RTR A;  1XN7 A;  3SZT A;  2XHK A;  2XVC A;  3BDD A;  3HOS A;  4YII A;  2A5Y B;  5DCM B;  3SFZ A;  3ZQ7 A;  3GLX A;  3RKY A;  2KKO A;  3HTU A;  3TKY A;  3MZH A;  5JVT A;  4GGG A;  2EFW A;  3QU3 A;  5LEJ A;  3M8E A;  3OV8 A;  2JPC A;  3WGH A;  3DEU A;  3CUO A;  4CHU A;  1K6O A;  2XRN A;  1R58 A;  2OAZ A;  4N9I A;  1YW9 A;  3QP6 A;  4ASN A;  4A5M A;  3E6D A;  4BNC A;  3PFI A;  3GZ6 A;  3L9F A;  1YQA A;  2VBY A;  2FQ3 A;  2RVC A;  3DQV C;  1XGM A;  2ZCW A;  4EMS A;  2B0L A;  1H0M A;  5J8F A;  1XSD A;  2EV5 A;  1HW5 A;  1BN5 A;  4RAY A;  1U5T B;  2G9W A;  1LDK B;  2ZNZ A;  5HS8 A;  5F1R A;  1TQP A;  1U5T C;  1YFH A;  2FA5 A;  4KNY A;  2F5D A;  4P9F A;  2HTJ A;  1E17 A;  3KET A;  3EYI A;  4BAY A;  2XAS A;  3EYY A;  1IF1 A;  4IRG A;  2CG4 A;  3IC7 A;  5J6X A;  1B59 A;  3H92 A;  2FMY A;  5HOO A;  1XGS A;  1XGN A;  1L0O C;  3QU6 A;  2FBK A;  1O3R A;  3Q9V A;  1SD6 A;  1Q1H A;  4MEX F;  1Z05 A;  1T98 A;  1T0F A;  3ZMU A;  2COM A;  2FOK A;  1KQ9 A;  3IRQ A;  3JW4 A;  4P96 A;  2FML A;  3T1B A;  2FXA A;  1KU7 A;  1HXD A;  4E70 A;  1AOY A;  2DQL A;  4HV5 A;  4I0A A;  2HR3 A;  4WXD A;  5L3D A;  2GWR A;  4KUM A;  1IN7 A;  2L4M A;  1KQ0 A;  1FBS A;  3U9G A;  2A68 F;  5ICC A;  4HZF A;  2VXZ A;  3D5L A;  4XRF A;  4HA8 A;  1R5H A;  4ZYH A;  3ML6 A;  2H27 A;  4JK1 X;  2DW4 A;  5DD8 A;  5BS6 A;  2OZ6 A;  2L3D A;  1XDS A;  2VOD A;  4HYE A;  1KA8 A;  3CO7 C;  2F5C A;  3L00 A;  4AD9 A;  3SHF A;  2E1C A;  2F2E A;  4P9U A;  3K9T A;  1VTN C;  2X4H A;  2BE5 F;  2AS5 F;  1OMI A;  5E18 F;  1USS A;  4PDK A;  3QRF F;  2RDP A;  4G6Q A;  4EV0 A;  5FD5 A;  2GXB A;  4IRI A;  1ZG3 A;  3M8F A;  4WX9 A;  1EH8 A;  2LSO A;  3GVA A;  3ERE D;  4EQQ A;  2BBY A;  5LGN A;  1XB4 A;  1RZ4 A;  3FM3 A;  2XRO A;  1D5V A;  1MGT A;  4L18 B;  1OYW A;  3M7G A;  4S04 A;  3K1M A;  3RYP A;  4A6D A;  4MHG A;  3BOQ A;  3HTS B;  4MNU A;  3V8J A;  2K4B A;  1BM9 A;  1FBU A;  3J80 K;  2JSC A;  2X0L A;  5E8G A;  3H3Z A;  1LB2 A;  4A5N A;  2L01 A;  3EUH A;  4I98 B;  5DCF A;  4L9J A;  4IHS A;  5ICF A;  1ZLK A;  2IW5 A;  5K5O A;  1LEB A;  1YIO A;  3TO7 A;  5CVR A;  2ZME A;  3F3X A;  2LF7 A;  2HDC A;  1JHF A;  3WTU C;  4UUV A;  4OIN F;  3BPV A;  2OD5 A;  4XSZ F;  3RIR A;  2DK8 A;  1U78 A;  4ETS A;  1ZGA A;  1GVJ A;  2M87 A;  3ZN0 A;  5DCM A;  3LQQ A;  2GAU A;  3WTW C;  2NNN A;  5AIP A;  4M73 A;  2Q2E A;  5FD6 A;  3G73 A;  2XAF A;  4IHT A;  2MD5 A;  4HX4 A;  2ZKZ A;  2WWY A;  3HHH A;  2ZNY A;  5D8K B;  1FZP B;  2EA2 A;  3OOP A;  4ZYE A;  3QAH A;  2GIV A;  4LLN A;  1ZYR F;  1O3S A;  1K7A A;  4WK8 F;  3KE2 A;  1R1V A;  1H9G A;  3HSR A;  5H6R A;  1GXQ A;  3DF8 A;  4ENJ A;  2OQR A;  3QP5 A;  5TJJ A;  2CGP A;  1F9N A;  4B8X A;  3RJP A;  5FFX A;  2R7F A;  1U5T A;  1IN8 A;  4XSX F;  2W24 A;  5TRD A;  1W7P D;  2QQB A;  4JBA A;  4OMZ A;  2ZXJ A;  3E5X A;  4NQW A;  4KYW A;  3C1D A;  3HHG A;  3WOD F;  1RI7 A;  4LLL A;  1U6G A;  5IT3 A;  4KA4 A;  4P55 A;  3LQR A;  1Z6R A;  4WF2 A;  4DQ2 A;  3GZ5 A;  1ZGJ A;  2UXX A;  3AAF A;  2KJC A;  1WKM A;  1IN5 A;  2DT5 A;  3TGN A;  3QPT A;  3G3Z A;  4GCV A;  4CXF A;  4HF2 A;  4M71 A;  1KYW A;  4KIF A;  3HRS A;  3CUQ B;  1HW2 A;  2P7C B;  1HKS A;  1P4A A;  1YYV A;  3CUQ C;  1TBX A;  5E8I A;  4G8X A;  2PMH A;  2XKO A;  4KN7 X;  3WTS C;  4IF4 A;  3VEP A;  1RUN A;  2BEO A;  2Z99 A;  3RPU A;  3WGI A;  2DFI A;  2K27 A;  4Z2Y A;  4ENK A;  4WWC A;  4U7B A;  2YX7 A;  2L4A A;  3FZV A;  3WGG A;  3ZP5 A;  3FXR A;  1K78 B;  4L0Z B;  1FYM A;  4UVA A;  2W84 A;  2NNY A;  1X3U A;  4P5O A;  3KP6 A;  1YG2 A;  1F1Z A;  1T38 A;  1Z9C A;  4O5V A;  4CO8 A;  2EJR A;  4QWQ A;  4BQA A;  1GHC A;  5HS9 A;  5D5U B;  3LA2 A;  4I2O A;  3ZMS A;  5FLX Z;  3TOA A;  3DV8 A;  5A2Q K;  1LDJ A;  5L3F A;  3D0S A;  2VOP A;  2DAO A;  2HKX A;  4U7D A;  3RI4 A;  1HKQ A;  5D5W B;  1RNL A;  1V3F A;  3K69 A;  1BI0 A;  4GO1 A;  3VOE A;  1BC7 C;  1YLF A;  5E17 F;  2Y48 A;  2RV8 A;  4HQE A;  4A12 A;  4EGY A;  1FLI A;  1CGP A;  1P4W A;  3P9K A;  3E97 A;  2P5L C;  5HDN A;  2WV0 A;  1IZ1 A;  1EH6 A;  1KYZ A;  2MA3 A;  3E6B A;  4ZYD A;  4RGR A;  2LDU A;  4M74 A;  4YG2 F;  2QEN A;  4L9T A;  2A3S A;  2IPQ X;  2QQ9 A;  1G3S A;  3FF5 A;  5CVI A;  2CWE A;  3J80 Z;  1WQ2 A;  1HKT A;  4RGU A;  4M9Z A;  4GXO A;  1CF7 B;  1HSJ A;  2M5W A;  3HRT A;  2EB7 A;  5HDG A;  2HFH A;  1ZN2 A;  4HX8 A;  4A0Y A;  4Y15 A;  4CDG A;  5ILU A;  1DP7 P;  4MQV A;  4I09 A;  4PGG A;  3MQ0 A;  1KGS A;  2DK5 A;  1FSE A;  4LMY A;  2H09 A;  5KVR A;  2D2W A;  4RS8 A;  2PBI A;  2PFB A;  1B6A A;  4FX0 A;  3F22 A;  1YW7 A;  4WXC A;  2XAQ A;  1SMY F;  2LF8 A;  3P9I A;  3IKV A;  3WG9 A;  1ZH5 A;  3IWZ A;  1P2F A;  1S7A A;  1WI9 A;  1BJA A;  2EFN A;  4M9X A;  5AON A;  3O3K A;  2MH2 A;  5L3G A;  2ZBK A;  2E1N A;  3ELK A;  1KU9 A;  1B9N A;  3RPQ A;  5LBQ A;  5H6Q A;  3TDZ C;  1ZAR A;  3FM5 A;  1RIO H;  3C7J A;  2FNA A;  1DPU A;  4U0V A;  1D8K A;  1PDN C;  4Q4Z F;  2PLY A;  3K1N A;  1H9T A;  4OIO F;  4EJW A;  4H0E A;  3GW2 A;  2ZJ2 A;  4XLP F;  4RB0 A;  2Y75 A;  2FF4 A;  1V4R A;  2Q8K A;  3E6M A;  2GQQ A;  1UCR A;  3BPX A;  1LDD A;  3KP4 A;  4OIR F;  3V8L A;  3MFK A;  4AWX B;  4KT5 C;  1QZZ A;  2FBI A;  3EDP A;  3U1D A;  3CLO A;  4HAM A;  2JZY A;  4HX7 A;  2YU3 A;  2V1D A;  3F21 A;  2FU4 A;  1R1T A;  5ED4 A;  1SFX A;  3GWZ A;  5LGT A;  3GO5 A;  3CUQ A;  2G7U A;  5JI6 A;  2CYY A;  1JGS A;  1LJ9 A;  2IA1 A;  4A0X A;  2E7X A;  4IJA A;  1MDM B;  1I1G A;  4FHT A;  2FE3 A;  3KZZ A;  1IN4 A;  2DLL A;  3T0Y A;  4M6Y A;  1FNN A;  1WRJ A;  2XGX A;  1C0W A;  1S7O A;  2OQG A;  4IRH A;  3ZMV A;  4A6E A;  5E1W A;  1QBJ A;  1K78 A;  2EV6 A;  1XMA A;  4KMU X;  1R36 A;  2VE8 A;  1ZRE A;  1FP2 A;  4LB5 A;  5FLX K;  1MJ9 A;  5DDG A;  1BIB A;  3EQL F;  3I54 A;  1B4A A;  2FSW A;  2BV6 A;  5A2Q Z;  3E3V A;  3ECH A;  4M9S A;  3JTG A;  2P4W A;  1BOA A;  2H6B A;  2Z9O A;  3WE3 A;  4BHP A;  2DPU A;  2P6S A;  3RDI A;  3BJA A;  5L3C A;  1IRG A;  1DPR A;  1W7P B;  2C6Y A;  4R1H A;  3T8R A;  4MTD A;  3GFM A;  3WTV C;  5FGM A;  1LEA A;  1Z7U A;  2QVO A;  3ISP A;  5DUK A;  2V1U A;  2YR2 A;  3I5U A;  1XD7 A;  3IHU A;  5BPI A;  4PZJ A;  4HLX A;  1FSH A;  2VBX A;  1KU2 A;  1LQ1 A;  4MTE A;  1J9I A;  4MGR A;  4UXN A;  1YW8 A;  3HYI A;  3DFG A;  2A61 A;  5D4R A;  4B09 A;  3N4M A;  2O3F A;  3IKT A;  3I58 A;  3U2R A;  1J7K A;  3JAM K;  2EFP A;  2KRF A;  3SQN A;  2ZFW A;  4PCQ A;  2STT A;  4L9V A;  4YFX F;  1LNW A;  2HGC A;  3F6V A;  4KDP A;  5CVV A;  5D4S A;  1AWC A;  3E6C C;  1R22 A;  3F6O A;  4A2U A;  4KIC A;  4M72 A;  2BGC A;  4XLN F;  3L09 A;  2D45 A;  1W5T A;  3M9A A;  2IJL A;  2W25 A;  3K2Z A;  5L3E A;  3NRV A;  2UZK A;  1IAW A;  1YS6 A;  2FBH A;  1O7F A;  4WCG A;  3GFI A;  1MJB A;  3K0L A;  3R4K A;  4HF0 A;  2YX4 A;  3O2P E;  1T6S A;  2E7W A; 
#chains in the Genus database with same CATH topology
 2JVH A;  4IOA F;  2FD5 A;  4HNV A;  2M45 A;  3RKX A;  3SDG A;  4ZTF A;  4YFK F;  5D5X B;  3ZMT A;  1IXC A;  3WTT C;  4XOP A;  3PL8 A;  1OKR A;  2WAQ A;  2FUG 2;  3R60 A;  4JYK A;  3GTK J;  2R3S A;  1MKM A;  2LY1 A;  4OOI A;  2K9M A;  3W6J B;  1J75 A;  5GP9 A;  1ETO A;  2GLO A;  1ONV A;  4Y3O A;  4BXU A;  1XGO A;  3H0G J;  5IPA A;  4AIJ A;  2ISZ A;  4LK0 F;  1YHQ I;  4B4C A;  2LKP A;  2AHQ A;  4AUX A;  4F55 A;  1XMK A;  1X1C A;  4BGD A;  2L7Z A;  2ICW G;  3S3O A;  2NVQ J;  1V5G A;  2JPB A;  1J0R A;  5LFA A;  2R0Q C;  5D5V B;  1JGG A;  1WVR A;  2MGQ A;  4XID A;  1ITY A;  1BI2 A;  5CYV A;  2FX0 A;  1Z67 A;  2K3F A;  2VIX A;  1VQO I;  3E5Q A;  1VQ8 I;  3M4O J;  4CIC A;  3I59 B;  3H9G A;  1OR7 A;  1BJZ A;  3VPR A;  4ENM A;  1UB9 A;  3LNQ A;  4RAF A;  2OCE A;  2FRH A;  2WA0 A;  3JRI A;  4RAZ A;  2JT1 A;  1IUF A;  2R5Y B;  2E34 A;  2Y2Z A;  2PJP A;  3F8B A;  4XLA A;  2K86 A;  3CP8 A;  1XCV A;  3K2A A;  4J00 A;  2PMU A;  3NAR A;  1I27 A;  3K4M A;  3L2Q A;  5ICE A;  4AIH A;  1R7J A;  5C4J J;  3NAU A;  2A69 F;  3VYU B;  1EJ9 A;  2V6E A;  4CYD A;  4O3M A;  2R92 J;  1Y8R B;  4E7Z A;  4DBR A;  3COA C;  5J1U A;  1FPQ A;  2KHM A;  4QLC U;  2A6H F;  3RYR A;  1VND A;  2L9R A;  1GVD A;  2DT6 A;  5F08 A;  3REO A;  2VBW A;  2CQ7 A;  3J7Y J;  1P7I A;  1DU6 A;  4IVN A;  4V2G A;  2EZH A;  2M0M A;  4LD5 A;  4KIG A;  1FX7 A;  3OYA A;  1E0E A;  1JUM A;  1NK3 P;  1FTZ A;  4M6X A;  3I64 A;  1WFX A;  4Q47 A;  3OYC A;  1ETY A;  4ZDL A;  4HNU A;  1JJ6 C;  1LUJ B;  1TWF J;  2K40 A;  2EFO A;  1D1C A;  5IP7 J;  3OYD A;  2VC1 A;  2L54 A;  2RKH A;  4BE2 A;  2QSH X;  3S2W A;  2H8W A;  4RB1 A;  4L5E A;  3ABT A;  2VT3 A;  3K70 D;  5GAG J;  4M3E A;  3CC4 I;  2HQA A;  4L5I A;  1R5G A;  2O6G E;  1MDM A;  3H9Q A;  1MD0 A;  3H5R A;  1V54 H;  1Y39 A;  3KEQ A;  4ZZD A;  2V79 A;  2HDW A;  2CW0 F;  2L9N A;  4MEY F;  3M3Y J;  2V9V A;  2G7H A;  2ZO4 A;  3PIO F;  1YOV B;  1R00 A;  2HQ5 A;  4BYY A;  2ZSH B;  1EV7 A;  2ESN A;  2ZXW H;  2O0Y A;  1T08 B;  3B73 A;  2NVY J;  3JRG A;  3CO6 C;  2DXI A;  5IYD J;  3HKZ A;  3EUK L;  5LRR A;  4HDU A;  4G6D A;  2ME0 A;  2VKE A;  1SFE A;  3GFJ A;  2O61 A;  3MCZ A;  5GPC A;  4YIF A;  1FBQ A;  1X2N A;  3KEO A;  1ZAO A;  3BP8 A;  2JA7 J;  3BR5 A;  3JSP A;  3K6G A;  2R93 J;  2PJR A;  2VON A;  5EG0 A;  2XV4 S;  2Q0O A;  3W6K B;  1D3Y A;  3DPT A;  1J59 A;  3DPL C;  2BYV E;  3MAJ A;  1PUE E;  1R71 A;  2M0C A;  1K61 A;  2L7K A;  4PSW A;  3FXM A;  3I71 A;  2X9D A;  1T56 A;  1WWX A;  2DOA A;  2F4I A;  4LGW A;  2DA4 A;  2IA2 A;  2GA2 A;  2EH3 A;  2OBP A;  2OU2 A;  3CC2 I;  4ON0 A;  4U0W A;  1JKR C;  1HW1 A;  2DA6 A;  1XCB A;  2CUF A;  3SXY A;  2BY2 A;  1YX3 A;  2DA3 A;  4C3H J;  1L3L A;  2O9L A;  4NC7 A;  5HVQ C;  3HUG B;  1YJN I;  3VB2 A;  4OIP F;  1VQ9 I;  1VQP I;  3S1N J;  2FEZ A;  2H8R A;  1A31 A;  4A3L J;  2H94 A;  5M3M J;  2VI6 A;  5HLG A;  3LST A;  2RQP A;  4N4N B;  3SZP A;  1W7P A;  2ECB A;  4IL6 C;  4CGZ A;  4N4O B;  2QEX I;  3GYH X;  4E6K G;  1ZRF A;  1H89 C;  2MLK A;  2DN0 A;  3TQN A;  4RA2 A;  5HLI A;  4D7M A;  2R7Z J;  1MZB A;  2EK5 A;  3RCO A;  1U8B A;  1TW2 A;  1BR4 A;  2R4G A;  2GXG A;  3I4N J;  4B1R A;  2QGU A;  5LHG A;  3F8F A;  3FK6 A;  2NAZ A;  3KP7 A;  3CF5 F;  5BQT A;  1FOK A;  4XK4 A;  5E1X A;  2JSP A;  1B9M A;  1XMX A;  4I02 A;  2DYR H;  2RC4 A;  4BEH A;  3HBL A;  3KFW X;  2P5V A;  3SEZ A;  3ZRG A;  2XAJ A;  1FYK A;  2LVS A;  1BBY A;  3F9K A;  4UB6 C;  2L02 A;  2EIK H;  3V7C A;  3OIQ A;  3V7R A;  4KFC A;  2IGM A;  2P8T A;  4Y52 J;  4XRS G;  1KZH A;  3LA7 A;  4MFD A;  1W36 D;  2GXA A;  3WHB A;  1NG6 A;  1G6N A;  1FMV A;  5AIQ A;  1WH5 A;  1QQI A;  1UG0 A;  4G7Z F;  2WC2 A;  3C3W A;  1WJF A;  2XAG A;  2BY1 A;  1MJA A;  2V9P A;  3OR2 C;  3MKW B;  2P7V B;  2LFB A;  4PJM A;  1TWH J;  3JAM Z;  5FJ8 J;  4KMF A;  5JHU A;  1J5Y A;  1TT5 B;  5LEK A;  4CCO A;  5M5X J;  2W00 A;  2DOF A;  3VYT B;  1KQ8 A;  1DQU A;  2KP6 A;  1G3W A;  1VQN I;  2K9S A;  2Y0M A;  3WU1 B;  2LNB A;  3M1E A;  1ZR4 A;  1JKQ C;  1S8N A;  3CDH A;  1AHD P;  4G9Y A;  2MBF A;  5LGU A;  1APL C;  3PM1 A;  2XDV A;  2KJB A;  2XKP A;  3PNY A;  1ZRD A;  1T2K A;  1GXP A;  2RRE A;  3LA3 A;  3I56 I;  4J01 A;  3ROU A;  5ILS A;  2IS6 A;  4LK1 F;  2NS0 A;  2TDX A;  2WAF A;  4CZZ A;  1F4K A;  1HC8 A;  4ESB A;  4IQ4 A;  3QOD A;  4EJU A;  2DBB A;  4HF1 A;  1TT0 A;  4IEJ A;  1T33 A;  3H5N A;  3HSE A;  3I4P A;  3LSI A;  2I8D A;  4EGZ A;  3R0A A;  2MH9 A;  5F6F A;  2F5V A;  4NB5 A;  1PJR A;  3DLA A;  5F64 A;  4Q5S F;  4OU0 A;  1SFU A;  1I6X A;  1TNT A;  1JXS A;  3IAS 2;  4FX4 A;  2D1H A;  3SYT A;  1E3O C;  3WE2 A;  1ORK A;  3J81 K;  4PJ0 C;  1WCM J;  1MBK A;  4WXH A;  2A07 F;  2YPR A;  4XN3 A;  1FIA A;  3DCF A;  1UHM A;  5H2F C;  4XLC A;  3K1P A;  4H4K C;  1P4X A;  3MEX A;  3M07 A;  3IH3 A;  4XLH A;  4R79 A;  1U2W A;  2K4J A;  3F72 A;  3OOU A;  1QNT A;  3A1Y A;  4RMN A;  3HRU A;  3LWF A;  2E1O A;  2GBY A;  1IN6 A;  2VOO A;  5E3L A;  4IPA A;  1HF0 A;  3ZQQ A;  4MLO A;  2QSF X;  2PN6 A;  3L7W A;  5KK1 A;  1FMW A;  1OYY A;  2COB A;  4BH9 A;  3CMA I;  2V9K A;  2AXL A;  2VT2 A;  3Q9S A;  1K79 A;  1Z0X A;  2F6C A;  5H20 A;  1MIJ A;  2NVX J;  3E5U A;  2GOM A;  4ZYG A;  5JVG F;  4HQM A;  2KIF A;  2OJE D;  1WGX A;  1FEX A;  1STZ A;  1P6R A;  1TW3 A;  3ABU A;  4ABZ A;  2CUJ A;  2NS7 A;  4LG0 B;  1DGR M;  3ABL H;  3H3V K;  3I3L A;  3PNT A;  1JHH A;  2DTR A;  2H6C A;  4R8H A;  4GYG A;  3J7Z I;  1TNS A;  2F4M B;  3GCM A;  5FFZ A;  1F5T A;  2HTS A;  5J4V A;  4BJT A;  4RB3 C;  3FHZ A;  1ZR2 A;  1FC3 A;  4DZJ A;  3BR0 A;  1NG7 A;  2Y69 H;  2KIU A;  1X4O A;  3TO6 A;  1J2X A;  3DXJ F;  4HBL A;  3I0T A;  2RNJ A;  3J7A Y;  4XRM A;  1Z1D A;  3OIP A;  3I59 A;  3BY6 A;  4CSW A;  4DBQ A;  2A6E F;  2X1D A;  1OCC H;  2KT0 A;  3GUD A;  2R5Y A;  2DDB A;  2WB1 A;  3ESW B;  4F91 B;  2NRA C;  1Z91 A;  4BY7 J;  2R7T A;  4YFN F;  1SD7 A;  2D1V A;  4IXA A;  1PYV A;  2RGV A;  1BW5 A;  3KYD B;  3P7N A;  4HDV A;  1EKE A;  4RB2 C;  5IT9 K;  1Z3Y A;  3PSF A;  1YRN B;  3J7A O;  4XKW A;  2O8X A;  3WTY C;  1NHA A;  1TLH B;  3FXU A;  2JTV A;  4FET A;  3D1N I;  1UAA A;  2HZT A;  3L2W A;  4CCK A;  3HDD A;  2PEX A;  3FKI J;  1ZLJ A;  2F5F A;  3Q0U A;  4C30 A;  5D6E A;  2XB0 X;  3LSK A;  5D8L B;  1S7E A;  2M8G X;  1SMT A;  1WJD A;  4EJV A;  2QLZ A;  5LHI A;  1MMG A;  2V1N A;  2O03 A;  3OYB A;  2BZT A;  1G4D A;  3JTH A;  4NHJ A;  1QO0 D;  1BC8 C;  1A04 A;  5JFR A;  4A3M J;  3WTX C;  3S8P A;  2CH0 A;  4L0Y B;  2WAE A;  5M5Y J;  3GF2 A;  1VFC A;  3LSM A;  3P9C A;  4LOC A;  2HQN A;  4UHT A;  1BL0 A;  2XUB A;  1FOW A;  4UVB A;  2CU7 A;  4II3 A;  4F7Z A;  2IXS A;  1B8I B;  1UFM A;  4EJO A;  4NUB A;  1JUP A;  2LY9 A;  1Z3X A;  2IP2 A;  3V8K A;  4JX4 A;  3LFU A;  1DU0 A;  3IL2 A;  1TQM A;  3GLL A;  2Y9Z A;  3CME I;  1OCZ H;  2K02 A;  1WPK A;  2DMQ A;  5LRS A;  3QOP A;  3OYI A;  3TMO A;  4LFU A;  3ZN1 A;  1QGP A;  2EFQ A;  3OL4 A;  1H88 C;  4UY8 I;  2ELH A;  3DKW A;  1ZHF A;  3GEZ A;  3IRR A;  1E2X A;  1Y0U A;  3FHN A;  4ZC3 A;  1WSU A;  2DI3 A;  1ON2 A;  3LAJ A;  5HLH A;  2P6T A;  2F5E A;  4N0B A;  1S29 A;  2HVQ A;  2PX9 A;  5J3L A;  3W2A A;  3W6V A;  1MNE A;  2CJJ A;  2XAH A;  1X1D A;  2V6C A;  2IAI A;  2V1X A;  1R1U A;  2MFZ A;  3EET A;  3RKW A;  4B3X A;  5GAD J;  3HOX J;  4HW0 A;  1V5E A;  4RGS A;  1OQY A;  4UV9 A;  2ADU A;  3ZPL A;  2K9L A;  3BWG A;  2CFX A;  4HRI A;  2XGD A;  2VJ4 A;  3LMM A;  3CCE I;  1D1B A;  1IRF A;  4DNC A;  1VZ0 A;  3HXL A;  3GXO A;  5FKK A;  3D5R C;  2CO5 A;  1KU3 A;  2HQR A;  2J5O A;  3R61 A;  1JI8 A;  4JP0 A;  1EH7 A;  5LLQ A;  3DKX A;  1X4P A;  3DP7 A;  4LIT A;  1ZRC A;  2VQC A;  1ULY A;  1VQ5 I;  1OIS A;  2KIM A;  4G7O F;  4CUG A;  4P1W A;  3DU6 A;  3HUG A;  2VBZ A;  3VSL A;  4S0H B;  1P92 A;  2MW8 A;  5DEQ A;  4ZZL A;  2Y0S A;  2M1B A;  3B02 A;  3WU0 A;  4XKB A;  3NEU A;  2JUG A;  1MH3 A;  1UMQ A;  5CLS A;  1IDY A;  3W3C A;  3H5A A;  5K5Q A;  5EGO B;  3TO9 A;  2DPD A;  2XAU A;  2RQQ A;  5FRO A;  3Q5F A;  3LFK A;  1JE8 A;  2ESH A;  2BW3 B;  2VN2 A;  3JRD A;  2UWM A;  1EF4 A;  4TV7 A;  1UST A;  4OIQ F;  1FTT A;  3OY9 A;  4XRS A;  3N05 A;  1QRY A;  1T95 A;  3MKY B;  4BHB A;  3FDY A;  2QBY B;  3GME A;  3BG3 A;  1T39 A;  2PI0 A;  4G94 A;  2F4O B;  3BC8 A;  1MBE A;  4HLY A;  3CJN A;  3KP5 A;  5ILV A;  4XKV A;  3CCQ I;  2MAB A;  3KLN A;  5J4Y A;  1GUU A;  1XC5 A;  5K7F A;  2K85 A;  5CVJ A;  4XNF A;  1ZG1 A;  1CF7 A;  1U8R A;  2MC3 A;  2E5N A;  2CW8 A;  3BJO A;  1FP1 D;  3OIO A;  5CVU A;  2STW A;  1XDU A;  3HB9 A;  5EEG A;  3HRM A;  3RPU D;  2QQA A;  3KCC A;  4KIB A;  5FO5 A;  3DU5 A;  3G1O A;  3FMS A;  5M3F J;  3ERM A;  1BI1 A;  2M8E A;  3OYG A;  5HLT A;  2PMZ A;  2YS9 A;  2M30 A;  5F0H A;  2AQE A;  4BE1 A;  1I3A A;  2LR8 A;  1YX5 A;  1HBX G;  3K70 C;  1S5L C;  4KJZ A;  2BVL A;  5K7H A;  1QZE A;  4DYC A;  1YIJ I;  5FB2 A;  4N9H A;  4B43 A;  3OYE A;  3PQJ A;  2GZW A;  1PP8 F;  4LLG F;  2Z16 A;  1W5S A;  1TTY A;  3MWM A;  3JSO A;  3JRH A;  2HS5 A;  4YIR X;  1VQ6 I;  1WH7 A;  4XLE A;  3DBR B;  1FIP A;  3LAP A;  3C2B A;  3TP3 A;  5BMZ A;  4C2M J;  3LSJ A;  3ZMZ A;  5ICG A;  1S3J A;  2LTP A;  3FMR A;  3PFY A;  4O6J A;  2DO7 A;  3O6B B;  3Q0V A;  1NK2 P;  2ETH A;  1YO5 C;  1JUS A;  1SD5 A;  4I7H A;  4DW6 A;  1X3W B;  3TDU C;  1MH4 A;  3FX3 A;  3K4C A;  4HPQ A;  2DMP A;  3FXJ A;  3QYB A;  1R23 A;  2HOT A;  1IXS B;  4CCN A;  4EEF G;  4JX5 A;  2JA5 J;  3ZR8 X;  1BIA A;  4F3Q A;  2FNP A;  3HOT A;  1BOB A;  2RN7 A;  1SC7 A;  2NVT J;  1BI3 A;  2ACJ A;  2J5P A;  4I01 A;  2ID6 A;  3HSF A;  3R0J A;  2Z33 A;  3FBN B;  5DD4 A;  3HC7 A;  2Y30 A;  3R6S A;  2GA1 A;  2VKV A;  2MG4 A;  4LJZ F;  3J81 Z;  4E7S A;  4M3F A;  4CA0 A;  1PP7 U;  3T8T A;  4LB6 B;  2QUF A;  4BS9 A;  1CQT A;  3C2H A;  3S1Q J;  3IWF A;  1IG7 A;  1Z6T A;  2V4J C;  5F27 A;  2CQK A;  3F8N A;  2HOA A;  1XSX A;  3ASN H;  2X6Y A;  4GRI A;  3ZQH A;  1MW7 A;  1R49 A;  2CFO A;  3PQK A;  4J19 A;  3NQO A;  2VB6 A;  4UVC A;  1T8I A;  1DUX C;  2EV0 A;  1ZQ3 P;  4HV6 A;  2F48 A;  2JVG A;  1Y0N A;  3HIF A;  2UV1 A;  3FMQ A;  4XKC A;  1JTY A;  1TP4 A;  4PGH A;  4JQF A;  4BHC A;  2XIG A;  3CCJ I;  3VOD A;  5E20 A;  5FLV A;  1HST A;  1XS9 A;  5DV5 A;  1MMA A;  3H3U A;  2JK3 A;  3ZQL A;  1O3T A;  1SAU A;  3ZMD A;  2LP0 A;  4ZH4 F;  4U88 A;  1D8J A;  3F8M A;  2ME6 A;  1OPC A;  1LKX A;  1UJ8 A;  2WV1 A;  3HGY A;  1W4M A;  3KZI C;  2K7L A;  2QM3 A;  3OYL A;  2ISY A;  2VC0 A;  4LG0 A;  4U87 A;  1OYI A;  2G0E A;  3S93 A;  1T0F C;  3OS0 A;  3RSN A;  4U0Y A;  4Q48 A;  2GM4 A;  2HOE A;  5HDK A;  2VPL A;  3DKY A;  4PJL A;  1E3H A;  2W57 A;  3GTM J;  4Y13 A;  4OMY A;  2PQ8 A;  1IUY A;  2LOO A;  1S6L A;  4QPQ A;  5D6F A;  4II2 A;  3KLO A;  1W5C C;  3BZK A;  1IW7 F;  4MFE A;  2WTE A;  4Y17 A;  4GYI A;  5EEH A;  4MIM A;  2ZJP F;  4D0P A;  3JR9 A;  3SEQ A;  3QPS A;  5IT9 Z;  4EM0 B;  3MZY A;  3BJ6 A;  4A3I J;  1W36 C;  4UB8 C;  5DUI A;  1HQC A;  1DGW Y;  2HWV A;  5L3B A;  1LE8 A;  1RC9 A;  2XF6 A;  2P81 A;  1ON1 A;  2DQR A;  4NBQ A;  3VWB A;  3AKZ A;  4AVP A;  5CPR B;  4E7H A;  5HS7 A;  4RGX A;  5DTD A;  1YTY A;  1YRN A;  2HU9 A;  2P5K A;  2GIZ A;  4EM2 A;  2I10 A;  1U3E M;  3TOB A;  4BXX J;  4UUS B;  4A0Z A;  1FYL A;  4A3D J;  3EUA A;  5CQE A;  2DT7 B;  4CH7 A;  2ELK A;  3FXQ A;  3KZY A;  2BHY A;  2IVM A;  1GDT A;  5DYM A;  5LHH A;  3BG9 A;  4L5J A;  1MMS A;  4BL0 B;  5E1Z B;  2HKO A;  3HEF A;  3OMY A;  3HL2 A;  4ITV A;  2EWN A;  2Z5U A;  3CTA A;  3GFL A;  4MQ9 F;  3N97 A;  1Y1V J;  4KN4 X;  4D1Q A;  3DEE A;  4NC8 A;  4K2E A;  2JRT A;  1DDN A;  2JA2 A;  2OZU A;  1I5Z A;  2KLO A;  4ZJZ A;  3F0C A;  5J8C A;  2N8G A;  3BTL A;  2LRD A;  4ZDP A;  3CCS I;  4C2U A;  1QZY A;  4L9N A;  2VE9 A;  4UNO A;  1O57 A;  5F0C A;  3H9J A;  2OF7 A;  4AIK A;  2R5Z B;  1I1S A;  2HEO A;  3QPH A;  3KX2 A;  1U9O A;  3HZJ A;  5E79 C;  4G7H F;  1B8I A;  2ECC A;  2QWW A;  2EA4 A;  2MLG A;  6PAX A;  1ODD A;  3KP3 A;  1MSE C;  4X6A J;  4S05 A;  3F23 A;  2QYO A;  2CSO A;  2DU9 A;  4EM1 A;  1IRX A;  5JR3 A;  5C4X J;  2WBM A;  3VFZ A;  4CCL A;  4QTR A;  4HOB A;  3ULQ B;  3L2C A;  2QZ8 A;  4ENN A;  2R7W A;  3I53 A;  1NH3 A;  1SVL A;  1FT9 A;  2LY2 A;  3A02 A;  1X1A A;  4ESF A;  2R7D A;  3BLY A;  1G3Y A;  1IXR C;  1SFK A;  4IOC F;  2IRF G;  5ERI A;  1O7L A;  3KP2 A;  1KON A;  2HYF A;  4ESJ A;  3PJR A;  3LSR A;  2UXN A;  4ZTJ A;  4W1U A;  1LVA A;  2IA0 A;  2DTZ A;  2YSR A;  5KAF C;  4I0B A;  2LKX A;  5HOD A;  2VLA A;  1QPM A;  1IV6 A;  1SD4 A;  2EBI A;  1O3Q A;  2LLK A;  2Z3Y A;  3BRO A;  4EVI A;  1TQI A;  1UHW A;  4PK4 A;  3CCY A;  1X2M A;  3GTQ J;  1K6Y A;  3BT9 A;  4XOT A;  3GX4 X;  2HYG D;  3G2B A;  2PG4 A;  1H8A C;  3F8C A;  2IT0 A;  3BTI A;  5FKL A;  1YS7 A;  3C18 A;  2DA1 A;  4UV8 A;  2M4K A;  2OCC H;  1B1B A;  2OA4 A;  5K1Y A;  1AA7 A;  3WHC A;  5CJ9 A;  4BJ6 C;  1I39 A;  4IQJ A;  3V7S A;  3S16 J;  3ZQC A;  5FKN A;  4PFP A;  5TGT A;  1SAX A;  3LOC A;  1FWZ A;  4FT8 A;  1RUO A;  1A6I A;  1YJW I;  5EGO A;  1G3T A;  3FWE A;  1D0Z A;  2L0K A;  1REP C;  3EUH C;  3U1K A;  1SFO J;  3T5X A;  4KT6 A;  3ECO A;  4XBF A;  4V19 K;  3G1L A;  1JTX A;  2BW3 A;  2EZL A;  5K5R A;  2VQL A;  4B47 A;  4FE7 A;  3BZ6 A;  1Q1V A;  4E7K A;  2QBY A;  1ETV A;  4EJT A;  2DDA A;  1QVT A;  2ZME B;  1IDZ A;  1BW6 A;  3ASO H;  3BG6 A;  2W85 A;  2ZME C;  3V4G A;  3LSG A;  4XR6 A;  2NYX A;  2CUE A;  3WTZ A;  1XSV A;  4IHV A;  1ZG5 A;  1FY7 A;  5BOX A;  5BPD A;  3RTR A;  3UNG C;  5C3E J;  2GOX B;  1XN7 A;  1MBF A;  3SZT A;  2XHK A;  4FQG A;  3G6E I;  1QU3 A;  3SJM A;  2XVC A;  1E3P A;  3OS2 A;  2IS2 A;  3BDD A;  3HOS A;  4YII A;  2A5Y B;  5DCM B;  3SFZ A;  3ZQ7 A;  3GLX A;  2E71 A;  3IH4 A;  2L5Q A;  2KKO A;  3RKY A;  4EAT A;  5IOY A;  3HTU A;  1ZTR A;  3TKY A;  2DMT A;  3S1R J;  3MZH A;  5JVT A;  2R7S A;  2Q2E B;  4MO7 A;  4GGG A;  3EPZ A;  2EFW A;  3L2V A;  5JLX A;  3QU3 A;  1D0Y A;  5LEJ A;  4GDF A;  3M8E A;  3OV8 A;  2JPC A;  1BR2 A;  3WGH A;  3DEU A;  3CUO A;  4RAG A;  4CHU A;  2R7V A;  4DGW B;  4G6T B;  1K6O A;  2XRN A;  4E7I A;  1R58 A;  2OAZ A;  2QQ8 A;  4N9I A;  3HOU J;  3TBI A;  1YW9 A;  3QP6 A;  4XQF A;  4C3J J;  2QF7 A;  2XC7 A;  2M7A A;  1XPX A;  4ASN A;  1ERD A;  4A5M A;  3E6D A;  4BNC A;  4AU7 A;  3PFI A;  2EPF A;  5TIS C;  1OCO H;  2KFD A;  3GZ6 A;  3L9F A;  1YQA A;  3GTL J;  1D5Y A;  4YEJ A;  2VBY A;  2FQ3 A;  2RVC A;  3DQV C;  1K4T A;  1VQ4 I;  1XGM A;  2ZCW A;  1JT6 A;  4EMS A;  2B0L A;  1H0M A;  2LMD A;  5J8F A;  1A5J A;  4DZP A;  2IS4 A;  5GTI C;  1XSD A;  2EV5 A;  1HW5 A;  3I9V 2;  2BHZ A;  2KIQ A;  2KMU A;  1BN5 A;  4RAY A;  2VQG A;  1U5T B;  3S17 J;  2G9W A;  1LDK B;  2ZNZ A;  2L2O A;  3P5J A;  5HS8 A;  2XGE A;  2K5C A;  1ETQ A;  2HXO A;  3QOE A;  5F1R A;  1TQP A;  1U5T C;  4PJJ A;  2H1K A;  1YFH A;  2HZD A;  3OYJ A;  2FA5 A;  5CKT A;  5B1B H;  4KNY A;  2DJI A;  2F5D A;  4NC6 A;  4NQW B;  4IZZ A;  2B63 J;  4P9F A;  2HTJ A;  1E17 A;  5KHD A;  3AG4 H;  3KET A;  4XOR A;  3L2U A;  1D1A A;  3EYI A;  4BAY A;  2XAS A;  5B5E C;  3EYY A;  1IF1 A;  4IRG A;  3HPG A;  2CG4 A;  5JHF A;  2DYS H;  3IC7 A;  5J6X A;  1B59 A;  3H92 A;  2FMY A;  5GTH C;  5HOO A;  2UUZ A;  1XGS A;  1XGN A;  3WG7 H;  2DFH A;  1L0O C;  1M1E B;  5EDN A;  3QU6 A;  4RM2 A;  1R6R A;  2ZJQ F;  1WZ2 A;  2FBK A;  1O3R A;  1MBG A;  5HNH A;  3BTJ A;  3S2H J;  1X1B A;  1SD6 A;  3Q9V A;  4ZDO A;  2LC2 A;  5EEA A;  1Q1H A;  2JMW A;  2DMU A;  4MEX F;  1Z05 A;  2BXZ A;  4DIQ A;  1T98 A;  2X85 A;  1T0F A;  3ZMU A;  1MMN A;  2COM A;  1QVU A;  1VF9 A;  2FOK A;  5EJC A;  1KQ9 A;  3IRQ A;  3JW4 A;  1RR7 A;  4P96 A;  2FML A;  3T1B A;  2KDO A;  2B9S A;  2FXA A;  1O4X A;  1KU7 A;  4A3G J;  1HXD A;  2CQN A;  3A03 A;  3L1P A;  3A2K A;  4E70 A;  2XB5 A;  1AOY A;  2DQL A;  4RBO A;  3BZC A;  4HV5 A;  3CP2 A;  4I0A A;  2HDD A;  2HR3 A;  4LG3 A;  3AL0 B;  3IV5 A;  4WXD A;  3IUO A;  4AYB N;  5L3D A;  2GWR A;  2KDZ A;  4KUM A;  1IN7 A;  3ABM H;  4NDL A;  3GTG J;  3AL0 C;  2L4M A;  1KQ0 A;  3S32 A;  1FBS A;  3U9G A;  1AKH B;  3DWL E;  2A68 F;  1UG2 A;  5ICC A;  3VYS B;  1Y1W J;  3AG1 H;  4HZF A;  1N75 A;  2VXZ A;  3D5L A;  4C9Y A;  3H35 A;  2HNH A;  4XRF A;  4M3B A;  2OTL I;  4HA8 A;  3S3N A;  2M3A A;  1R5H A;  4ZYH A;  5DM7 F;  3ML6 A;  1ETW A;  4UUS A;  2ID3 A;  2H27 A;  4JK1 X;  2DW4 A;  5DD8 A;  3VSK A;  3OR1 C;  5BS6 A;  2IEK A;  4IO9 F;  4D5C A;  2ZFU A;  2OZ6 A;  1LFP A;  3H36 A;  2L3D A;  2JUC A;  2LYC A;  1UEL B;  1XG1 A;  1XDS A;  2VOD A;  4HYE A;  1KA8 A;  3CO7 C;  3TED A;  2F5C A;  3L00 A;  3I4M J;  1R4M B;  4XM3 A;  4AD9 A;  3MD2 A;  3SHF A;  2E1C A;  4A3E J;  2EIM H;  4BAC A;  1FOY A;  2DFF A;  2F2E A;  4P9U A;  4BE0 A;  3K9T A;  4X0G A;  1VTN C;  2DMN A;  2VPR A;  2X4H A;  2BE5 F;  3RZD J;  1Z21 A;  2R5Z A;  4B48 A;  2LD5 A;  2AS5 F;  1OMI A;  2A5W A;  1GLN A;  1WJ5 A;  3MVP A;  1I3Q J;  4A69 C;  5E18 F;  2XF5 A;  1A36 A;  2JA8 J;  1USS A;  2YUS A;  2X6W A;  4PDK A;  4HG2 A;  4XIC A;  3ZCO A;  3QRF F;  2RDP A;  4G6Q A;  4EV0 A;  2TRT A;  5FD5 A;  5J47 A;  2GXB A;  4AM3 A;  4IRI A;  1ZG3 A;  4KIS A;  3M8F A;  4WX9 A;  2M9H A;  2P0W A;  1EH8 A;  2LSO A;  3GVA A;  3ERE D;  4EQQ A;  2BBY A;  5LGN A;  2Z2S B;  4BDZ A;  2VJ5 A;  2IGN A;  9ANT A;  1XB4 A;  1RZ4 A;  1TC3 C;  1OCP A;  1HOM A;  3FM3 A;  2XRO A;  5FKM A;  1D5V A;  2WAQ N;  4BDY A;  1MGT A;  4L18 B;  4A3J J;  3BTC A;  1F36 A;  3E7L A;  1R9T J;  1HA8 A;  1OYW A;  3FIS A;  3RKQ A;  2RAE A;  4AVZ A;  1UZC A;  3TL4 X;  3M7G A;  1Z77 A;  3BR2 A;  1RRJ A;  3S14 J;  3GBG A;  2E19 A;  4QPO A;  3RQI A;  2ZXI A;  4S04 A;  3CD6 I;  3A01 B;  3K1M A;  3RYP A;  4A6D A;  4MHG A;  3BOQ A;  4ZYA A;  3LSH A;  2HXI A;  2B7E A;  2K3P A;  3HTS B;  4MNU A;  3V8J A;  2K4B A;  1BM9 A;  1FBU A;  3J80 K;  3ZXS A;  2XSD C;  2QSG X;  2JSC A;  2X0L A;  5E8G A;  3QQA A;  2QA4 I;  2E36 A;  3H3Z A;  4DOZ A;  5F04 A;  1LB2 A;  1WJB A;  4A5N A;  1GV2 A;  2L01 A;  3EUH A;  4I98 B;  5DCF A;  1G59 A;  4L9J A;  4IHS A;  2M7B A;  2E5Z A;  2VQH A;  5ICF A;  2XPV A;  1ZLK A;  2IW5 A;  2L9S A;  1VQM I;  2E1M B;  5GPA A;  4CYC B;  5K5O A;  3JRC A;  1XX5 A;  1LEB A;  1YIO A;  4OWR B;  2E1M C;  5M5W J;  1LVK A;  3TO7 A;  3K4N A;  2ZME A;  3F3X A;  5CVR A;  3LSP A;  2LF7 A;  2KIS A;  3HPH A;  2Y9Y A;  2HDC A;  1JHF A;  3WTU C;  4UUV A;  4OIN F;  3BPV A;  2OD5 A;  3RZO J;  4XSZ F;  1J09 A;  3RIR A;  5FKO A;  1FJL A;  2DK8 A;  2DOE A;  2W82 A;  3MKZ A;  1OCT C;  5KAI C;  1U78 A;  2E2H J;  4ETS A;  4BY1 J;  1ZGA A;  2ZC2 A;  1GVJ A;  2M87 A;  3ZN0 A;  5DCM A;  3LQQ A;  2GAU A;  4BUP A;  5DM6 F;  3BR6 A;  1SEU A;  3WTW C;  2NNN A;  1GV5 A;  2DA7 A;  2MSY A;  4M73 A;  5AIP A;  4DJA A;  3S1M J;  2JN6 A;  3SFI A;  3VYR B;  2Q2E A;  1QA6 A;  4IHY A;  5FD6 A;  3G73 A;  2XAF A;  5EYR A;  4XL9 A;  3JRA A;  3MMY B;  4IHT A;  1Y6I A;  2MD5 A;  2AXT C;  4HX4 A;  3NWT A;  2ZKZ A;  3PSI A;  2WWY A;  2HVS A;  4A3B J;  2E60 A;  4DYR A;  4LIU A;  5K7Z A;  3HHH A;  1VQL I;  2ZNY A;  5GAE J;  5D8K B;  3HKZ N;  1FZP B;  2R7Q A;  1TZL A;  2EA2 A;  3OOP A;  4ZYE A;  3QAH A;  3ZQF A;  2LG4 A;  2GIV A;  4LLN A;  2IS1 A;  5IOZ A;  1ZYR F;  1O3S A;  1K7A A;  4WK8 F;  3KE2 A;  1R1V A;  3CZ6 A;  1H9G A;  2VKD A;  3K7A J;  3HSR A;  5H6R A;  2AQF A;  4D5F A;  1GXQ A;  3DF8 A;  1XTA A;  4ENJ A;  2OQR A;  3OYN A;  3QP5 A;  2BXY A;  1U9N A;  2QKL B;  3L2R A;  5TJJ A;  4HNT A;  2V7F A;  2CGP A;  3JRB A;  2HVR A;  1F9N A;  4B8X A;  3RJP A;  5FFX A;  2R7F A;  1U5T A;  1IN8 A;  3BG7 A;  4XSX F;  1NTC A;  1BA5 A;  3UKG A;  3LL7 A;  1ZK8 A;  1HDD C;  2W24 A;  5TRD A;  3G4S I;  1I6H J;  1W7P D;  2QQB A;  4JBA A;  4OMZ A;  2ZXJ A;  2H1L A;  3E5X A;  1N78 A;  4NQW A;  4KYW A;  3C1D A;  3HHG A;  3FK7 A;  3WOD F;  2L7F P;  3PO2 J;  1RR8 C;  3H1C A;  2R7U A;  2HOS A;  2L9V A;  1RI7 A;  4LLL A;  1U6G A;  5IT3 A;  2W7N A;  4KA4 A;  4C2T A;  4P55 A;  3LQR A;  1Z6R A;  4RLQ A;  2EIJ H;  4WF2 A;  3BR3 A;  4DQ2 A;  2CQQ A;  1IRZ A;  4BBR J;  1MND A;  4XMY A;  3GZ5 A;  1ZGJ A;  2UXX A;  3AAF A;  2KJC A;  3OYM A;  1WKM A;  1IN5 A;  1RET A;  3PO3 J;  4JOM A;  1EA3 A;  2BY3 A;  3K4L A;  2DT5 A;  3BG5 A;  3TGN A;  3QPT A;  3O8H A;  3G3Z A;  3HOW J;  2ZJR F;  4GCV A;  4CXF A;  4HF2 A;  2K9N A;  4M71 A;  5FLM J;  1KYW A;  4KIF A;  3HRS A;  4X1E A;  1PUF B;  4GFB A;  1TWA J;  3CDL A;  3CUQ B;  1HW2 A;  2P7C B;  1YI2 I;  1HKS A;  1ZKG A;  3VDX A;  1P4A A;  5GAH J;  1YYV A;  3CUQ C;  1TBX A;  5E8I A;  4IX7 A;  4G8X A;  2PMH A;  2XKO A;  4KN7 X;  3WTS C;  4IF4 A;  3VEP A;  1RUN A;  4M3G A;  4BKX A;  1VQ7 I;  2XPW A;  4BJ5 C;  2BEO A;  2Z99 A;  3RPU A;  3WGI A;  2DFI A;  2K27 A;  1WJE A;  2BOL A;  3CQZ J;  4Z2Y A;  4ENK A;  1D0X A;  4RM3 A;  4WWC A;  1MBH A;  4U7B A;  2NXN B;  2YX7 A;  2EQR A;  2L4A A;  4F92 B;  1HLV A;  3FZV A;  5CQG A;  3OSG A;  3DBH B;  1RPW A;  3WGG A;  3ZP5 A;  3PIP F;  3A0H C;  1FOX A;  3FXR A;  1K78 B;  4L0Z B;  2TCT A;  1MBJ A;  1FYM A;  4CZC A;  2DFE A;  4UVA A;  1TL8 A;  1AKH A;  2W84 A;  3A0B C;  5KCM A;  2NNY A;  3W2V A;  1X3U A;  1S9H A;  2Q1Z B;  4P5O A;  1Y56 A;  3KP6 A;  4Y7N J;  1YG2 A;  2OUM A;  4RDU A;  1F1Z A;  1T38 A;  2LBF B;  1Z9C A;  1S72 I;  3K4K A;  1R4N B;  2JWT A;  3GTO J;  2R7X A;  4O5V A;  5B1A H;  2XGC A;  4CO8 A;  2EJR A;  4QWQ A;  4BQA A;  1GHC A;  3QYF A;  5DS9 A;  5HS9 A;  5D5U B;  1MSF C;  2FOW A;  3OWT A;  3KPH A;  2VAS A;  3LA2 A;  2Z1D A;  1ZGW A;  4I2O A;  3ZMS A;  2KPM A;  5FLX Z;  3TOA A;  3DV8 A;  5A2Q K;  4E7L A;  1YIT I;  2CV1 A;  3QYE A;  4CCM A;  1LDJ A;  5L3F A;  2JA6 J;  2QCO A;  4Y33 A;  2HYJ A;  3S2D J;  3D0S A;  2VOP A;  2DAO A;  2LH9 A;  1WI3 A;  2HKX A;  3CMY A;  4ANJ A;  4U7D A;  3RI4 A;  1HKQ A;  1N77 A;  4XON A;  5D5W B;  4B3A A;  3FXL A;  1RNL A;  3BR1 A;  2IGO A;  1V3F A;  2CV0 A;  3K69 A;  1BI0 A;  4GO1 A;  1Y8Q B;  3VOE A;  5JLW A;  2NOJ B;  5F1J A;  1BC7 C;  1YLF A;  5E17 F;  1DP3 A;  1OFC X;  5EZG A;  1QPI A;  2Y48 A;  2RV8 A;  4HQE A;  2LK2 A;  3IAM 2;  1LFB A;  4A12 A;  4EGY A;  1FLI A;  1CGP A;  1P4W A;  2LRE A;  3P9K A;  1LPQ A;  2X6O A;  4QIW N;  4A3K J;  3E97 A;  2P5L C;  1MMD A;  2D5V A;  5HDN A;  2WV0 A;  2O7O A;  1IZ1 A;  1EH6 A;  4CCJ A;  2DA5 A;  3HGG A;  1KYZ A;  2MA3 A;  4FTH A;  2WY8 Q;  2CW7 A;  3E6B A;  4ZYD A;  3C2G A;  4RGR A;  2LDU A;  2M4G A;  5J1Y A;  4I6Z A;  2CRG A;  4M74 A;  4KIT B;  3E0J B;  3HOY J;  3AG3 H;  2QEN A;  4YG2 F;  1R5I D;  4L9T A;  2A3S A;  2IPQ X;  2QQ9 A;  1G3S A;  3FF5 A;  5CVI A;  3A01 A;  2CWE A;  3J80 Z;  2DJN A;  2KRH A;  3IP4 B;  1WQ2 A;  2R7R A;  4RGU A;  1HKT A;  4M9Z A;  4HSR A;  4A3C J;  4GXO A;  1CF7 B;  1HSJ A;  4V2F A;  2M5W A;  1HCR A;  3HRT A;  1A6Q A;  3ZOB A;  5E3M A;  1PVE A;  3O8G A;  2DCE A;  2EB7 A;  1U0J A;  3OL3 A;  5HDG A;  2EIN H;  3HOV J;  1IJW C;  2BY0 A;  2WB1 N;  3FXK A;  2HFH A;  4E4H A;  1ZN2 A;  4HX8 A;  4A0Y A;  4Y15 A;  4CDG A;  5ILU A;  1DP7 P;  3AFH A;  4MQV A;  4I09 A;  4PGG A;  3MQ0 A;  4C3I J;  1KGS A;  4Y4R A;  3GTP J;  2DK5 A;  4B44 A;  1FSE A;  4I76 A;  2H09 A;  4LMY A;  5KVR A;  2L7M P;  3OSF A;  2D2W A;  1WJC A;  1TWC J;  4RS8 A;  2PBI A;  4CYC A;  2HPM A;  2PFB A;  1B6A A;  4FX0 A;  2EZK A;  3F22 A;  1BR1 A;  4XN0 A;  5LD2 C;  1YW7 A;  2Y31 A;  3DTK A;  4WXC A;  2XAQ A;  3IH2 A;  1SMY F;  2LF8 A;  3P9I A;  3IKV A;  3WG9 A;  1ZH5 A;  4M6V A;  3IWZ A;  1P2F A;  1S7A A;  2WAD A;  1K4S A;  2IBD A;  1OCR H;  3I55 I;  2X48 A;  4D9J A;  1WI9 A;  1VQK I;  1BJA A;  2FJ1 A;  5IYB J;  2EFN A;  3ZQG A;  4M9X A;  4NNJ A;  3UR3 C;  5AON A;  3O3K A;  3CCU I;  2DOD A;  3HOZ J;  2NS8 A;  2MYS A;  2MH2 A;  3RQ4 A;  5BNG A;  1B72 B;  3OYF A;  3BCB A;  5L3G A;  3BQY A;  2QKM B;  4HST A;  1MNM C;  2LKS A;  2ZBK A;  2E1N A;  1ETX A;  3ELK A;  3CCR I;  1KU9 A;  1B9N A;  3RPQ A;  5LBQ A;  2KRC A;  4LIV A;  3W2W A;  5H6Q A;  4A93 J;  1ACI A;  3TDZ C;  2K9Q A;  1YE9 A;  1ZAR A;  5IY5 H;  3FM5 A;  3KIO A;  1IV8 A;  4DYQ A;  1RIO H;  3C7J A;  4BQO A;  2YU9 J;  4AC0 A;  2FNA A;  2VJI A;  3ONQ A;  4YRV A;  1DPU A;  2M2E A;  1UHS A;  3MN2 A;  1D8K A;  3DEW A;  4U0V A;  3TP0 A;  4Q4Z F;  1PDN C;  5EF6 A;  2PLY A;  3K1N A;  1H9T A;  4OIO F;  2CQX A;  2E35 A;  1Z7L A;  2OV7 A;  1P7J A;  4EJW A;  3CCL I;  4BQN A;  4H0E A;  3GW2 A;  2ZJ2 A;  4XLP F;  3CDI A;  4RB0 A;  2A6T A;  2Y75 A;  2FF4 A;  4FCY A;  2DA2 A;  5B3S H;  1V4R A;  4G12 A;  3DTE A;  1N25 A;  3CMM A;  2Q8K A;  3E6M A;  1OR7 C;  1QHH D;  5F0F A;  4PUS A;  2GQQ A;  1UCR A;  4FAS D;  3BPX A;  3CJR B;  3CES A;  3Q3S A;  3KYL A;  1LDD A;  2RNG A;  2AO9 A;  3JCU C;  3KP4 A;  3HM5 A;  3Q0W A;  4OIR F;  4JX6 A;  2O8K A;  2OC6 A;  3V8L A;  3ZQI A;  3MFK A;  2Y0S N;  1LFU P;  4AWX B;  2XF7 A;  4KT5 C;  1QZZ A;  1V5F A;  1SVO A;  5FRM A;  2FBI A;  3EDP A;  3U1D A;  3CLO A;  4HAM A;  3CCM I;  1SVM A;  4OAZ A;  2JZY A;  4HX7 A;  2W48 A;  2ZXH A;  2YU3 A;  4QSH A;  4YEL A;  2X51 A;  1AU7 A;  1G8X A;  1W1W E;  2V1D A;  3F21 A;  3S15 J;  2FU4 A;  1R1T A;  2FQ4 A;  5ED4 A;  1SFX A;  1LE8 B;  3GWZ A;  3M1C A;  2R7O A;  4D7N A;  3K10 A;  5HNF A;  5LGT A;  3GO5 A;  1PUF A;  3CUQ A;  2VL8 A;  2G7U A;  5JI6 A;  3G71 I;  2CYY A;  1JGS A;  2E2J J;  1LJ9 A;  2IA1 A;  5J1R A;  4A0X A;  2MC4 A;  2I5U A;  2E7X A;  4IJA A;  1W0U A;  1MDM B;  3A4C A;  1I1G A;  1G2H A;  4FHT A;  1I50 J;  3DLL F;  2FE3 A;  1POG A;  3KZZ A;  2BVM A;  2OTJ I;  1IN4 A;  2DLL A;  3FIW A;  3T0Y A;  4M6Y A;  4F52 A;  2X1C A;  1FNN A;  1WRJ A;  2XGX A;  1C0W A;  1V55 H;  2PMZ N;  1S7O A;  2OQG A;  1ZEL A;  3FXO A;  4IRH A;  4RLF A;  2XRL A;  3ZMV A;  2E2I J;  4A6E A;  5E1W A;  3ZGK A;  2KZG A;  1ENH A;  3BQZ A;  1QBJ A;  2EIL H;  2EZI A;  3WU2 C;  3SDB A;  1K78 A;  2EV6 A;  3DPU A;  1XMA A;  2W1O A;  4KMU X;  4UUT A;  3E1S A;  1R36 A;  4A3F J;  2VE8 A;  1ZRE A;  1FP2 A;  3CC7 I;  4LB5 A;  2A05 A;  2PJR B;  5EG0 B;  2VXD A;  3NWS A;  5FLX K;  1MJ9 A;  3ABK H;  4HEA 2;  3B6C A;  2LBF A;  5C44 J;  5DDG A;  1BIB A;  3EQL F;  5KNL A;  4Z6Y A;  1X58 A;  3I54 A;  4W97 A;  4F93 B;  2MD0 A;  1B4A A;  3BCA A;  2FSW A;  2X6X A;  3V42 A;  2BV6 A;  1QHG A;  3E3V A;  5A2Q Z;  3ECH A;  2KZV A;  4M9S A;  2V26 A;  1X3Z B;  3JTG A;  2P4W A;  3CLQ A;  2ELJ A;  1BOA A;  2H6B A;  2OPT A;  3DTI A;  3WE3 A;  2Z9O A;  1HDP A;  4BHP A;  2CUZ A;  2DPU A;  3HJE A;  1IO2 A;  1RKW A;  2P6S A;  3QWL A;  1YJ9 I;  3RDI A;  1OLT A;  3BJA A;  3MZ8 A;  5L3C A;  1IRG A;  1DPR A;  1W7P B;  2C6Y A;  2WY7 Q;  3D5S C;  4R1H A;  3B6A A;  3T8R A;  1GT0 C;  1VI0 A;  3G1M A;  1RES A;  4IHX A;  4MTD A;  2ZSI B;  3KYC B;  3PUB A;  3GFM A;  3WTV C;  5FGM A;  1LEA A;  1Z7U A;  2VJJ A;  2KL4 A;  2QVO A;  3DBL B;  3ISP A;  4BBS J;  3CJT B;  5DUK A;  2V1U A;  4IKF A;  2ZB9 A;  3GTJ J;  2YR2 A;  5IP9 J;  1X1P A;  3I5U A;  1SAN A;  1XD7 A;  4PJN A;  3X2Q H;  3GZN B;  4IHW A;  4BU2 A;  3IHU A;  4PFO A;  3CJQ B;  5J40 A;  5BPI A;  1W0T A;  3OYK A;  4PZJ A;  3K4B A;  4HLX A;  3JRF A;  5E3N A;  1FSH A;  3PNV A;  4BEH B;  2JJ7 A;  4BQQ A;  2VBX A;  1A35 A;  1TWG J;  2IGK A;  1JJ8 C;  1WHU A;  2XPU A;  3KEY A;  3TW7 A;  5IP6 A;  2JRM A;  2HPI A;  1KU2 A;  3AG2 H;  3CCV I;  1LQ1 A;  4MTE A;  1J9I A;  3QPL A;  4MGR A;  4UXN A;  5EZH A;  1YW8 A;  3HYI A;  4AYB A;  4XLF A;  4PSX A;  2W4S A;  2VUM J;  3DFG A;  2A61 A;  5D4R A;  2NOG A;  3OS1 A;  4B09 A;  3N4M A;  3MKL A;  2O3F A;  2HI3 A;  3IKT A;  4BXF A;  2KQR A;  3I58 A;  4OAY A;  1J7K A;  2NVU B;  3U2R A;  2CS3 A;  2O5R A;  2EFP A;  2KRF A;  2CMP A;  3SQN A;  3PUF A;  3JAM K;  1JT0 A;  2ZFW A;  3FKJ A;  4PCQ A;  3TW6 A;  1RKT A;  5B66 C;  4FIS A;  2STT A;  1ETK A;  4L9V A;  1P9Q C;  1OJL A;  4YFX F;  3OYH A;  5E3O A;  2VKH A;  1LNW A;  2HGC A;  3F6V A;  3S3M A;  4KDP A;  5CVV A;  5D4S A;  1AWC A;  3E6C C;  1R22 A;  3F6O A;  4A2U A;  4KIC A;  4M3D A;  3JRE A;  2M34 A;  4M72 A;  4FE4 A;  2BGC A;  4XLN F;  1JKO C;  3SZG A;  3L09 A;  5FRN A;  4AID A;  2D45 A;  1W5T A;  3M9A A;  2IJL A;  2CV2 A;  2XSJ C;  2W25 A;  3K2Z A;  5L3E A;  1K83 J;  3NRV A;  3CF2 A;  1JKP C;  4I99 C;  5IYC J;  3HG9 A;  2UZK A;  1IAW A;  1YS6 A;  3FBI B;  2FBH A;  1F43 A;  1O7F A;  1WJA A;  3M8J A;  1MJB A;  4WCG A;  3GFI A;  3H0D A;  3K0L A;  3R4K A;  4HF0 A;  3U21 A;  3K4J A;  2YX4 A;  1X19 A;  3O2P E;  1IC8 A;  1IGN A;  2X1E A;  1T6S A;  2JQ7 A;  2E7W A;  1B72 A;  4E7J A; 
#chains in the Genus database with same CATH homology
 2M45 A;  3RKX A;  4YFK F;  5D5X B;  3ZMT A;  1IXC A;  3WTT C;  1OKR A;  3R60 A;  2R3S A;  1MKM A;  4OOI A;  1J75 A;  3W6J B;  1ONV A;  4BXU A;  1XGO A;  4AIJ A;  2ISZ A;  4LK0 F;  2LKP A;  1XMK A;  2JPB A;  1J0R A;  5D5V B;  1BI2 A;  5CYV A;  3E5Q A;  4CIC A;  3I59 B;  1OR7 A;  4ENM A;  1UB9 A;  2FRH A;  4RAZ A;  2JT1 A;  2PJP A;  3F8B A;  2K86 A;  1XCV A;  2PMU A;  1I27 A;  5ICE A;  4AIH A;  1R7J A;  2A69 F;  4CYD A;  4O3M A;  3COA C;  1FPQ A;  4QLC U;  2A6H F;  3RYR A;  3REO A;  2VBW A;  4IVN A;  4LD5 A;  4KIG A;  1FX7 A;  4M6X A;  3I64 A;  4Q47 A;  2EFO A;  2VC1 A;  2L54 A;  2RKH A;  3S2W A;  4RB1 A;  3ABT A;  2VT3 A;  4L5I A;  1R5G A;  2O6G E;  1MDM A;  1MD0 A;  3KEQ A;  4ZZD A;  2V79 A;  2CW0 F;  4MEY F;  2V9V A;  2G7H A;  2ZO4 A;  1R00 A;  4BYY A;  1EV7 A;  2ESN A;  3B73 A;  2O0Y A;  3CO6 C;  5LRR A;  4HDU A;  4G6D A;  3GFJ A;  1SFE A;  2O61 A;  3MCZ A;  4YIF A;  1FBQ A;  3KEO A;  1ZAO A;  3BP8 A;  3JSP A;  2VON A;  2XV4 S;  2Q0O A;  3W6K B;  1D3Y A;  3DPT A;  1J59 A;  3DPL C;  2BYV E;  3MAJ A;  1PUE E;  3I71 A;  1WWX A;  4LGW A;  2IA2 A;  2GA2 A;  2OBP A;  2OU2 A;  4ON0 A;  4U0W A;  1HW1 A;  1XCB A;  3SXY A;  1L3L A;  5HVQ C;  3VB2 A;  4OIP F;  2FEZ A;  2H94 A;  5HLG A;  3LST A;  2RQP A;  3SZP A;  1W7P A;  4CGZ A;  3GYH X;  1ZRF A;  2MLK A;  3TQN A;  5HLI A;  1MZB A;  2EK5 A;  1TW2 A;  2GXG A;  5LHG A;  3F8F A;  2NAZ A;  3KP7 A;  5BQT A;  1FOK A;  5E1X A;  1B9M A;  4I02 A;  2RC4 A;  3KFW X;  2P5V A;  2XAJ A;  1FYK A;  1BBY A;  2L02 A;  3V7C A;  3V7R A;  4KFC A;  2P8T A;  3LA7 A;  4G7Z F;  1G6N A;  5AIQ A;  1QQI A;  2WC2 A;  3C3W A;  2XAG A;  1MJA A;  2P7V B;  3JAM Z;  4KMF A;  5JHU A;  1J5Y A;  5LEK A;  1KQ8 A;  1G3W A;  2Y0M A;  3WU1 B;  2LNB A;  3M1E A;  1S8N A;  3CDH A;  4G9Y A;  2MBF A;  5LGU A;  2KJB A;  2XKP A;  1ZRD A;  1T2K A;  1GXP A;  3LA3 A;  3ROU A;  5ILS A;  4LK1 F;  2NS0 A;  2TDX A;  4CZZ A;  1F4K A;  4ESB A;  4EJU A;  2DBB A;  4HF1 A;  3HSE A;  3I4P A;  4EGZ A;  3R0A A;  2MH9 A;  5F6F A;  4NB5 A;  5F64 A;  4Q5S F;  4OU0 A;  1SFU A;  1I6X A;  1TNT A;  1JXS A;  4FX4 A;  2D1H A;  3WE2 A;  3J81 K;  4WXH A;  2A07 F;  2YPR A;  1UHM A;  3K1P A;  1P4X A;  3MEX A;  4R79 A;  1U2W A;  2K4J A;  3F72 A;  1QNT A;  3HRU A;  3LWF A;  1IN6 A;  2VOO A;  4IPA A;  2PN6 A;  3L7W A;  5KK1 A;  1OYY A;  4BH9 A;  2AXL A;  2VT2 A;  3Q9S A;  1K79 A;  5H20 A;  3E5U A;  4ZYG A;  4HQM A;  2KIF A;  1STZ A;  1P6R A;  1TW3 A;  3ABU A;  4LG0 B;  1JHH A;  2DTR A;  2H6C A;  4R8H A;  4GYG A;  1TNS A;  5FFZ A;  1F5T A;  2HTS A;  4RB3 C;  3FHZ A;  1FC3 A;  2KIU A;  3TO6 A;  1J2X A;  3DXJ F;  4HBL A;  3I0T A;  2RNJ A;  1Z1D A;  3I59 A;  3BY6 A;  2A6E F;  3GUD A;  2NRA C;  1Z91 A;  4YFN F;  1SD7 A;  2D1V A;  4IXA A;  2RGV A;  3P7N A;  4HDV A;  4RB2 C;  5IT9 K;  3J7A O;  2O8X A;  3WTY C;  1NHA A;  1TLH B;  3FXU A;  2JTV A;  2HZT A;  2PEX A;  1ZLJ A;  2F5F A;  5D6E A;  5D8L B;  1SMT A;  5LHI A;  4EJV A;  2QLZ A;  2O03 A;  1G4D A;  3JTH A;  4NHJ A;  1QO0 D;  1BC8 C;  1A04 A;  5JFR A;  3WTX C;  4L0Y B;  3GF2 A;  3P9C A;  2HQN A;  4UHT A;  2XUB A;  4UVB A;  4F7Z A;  1UFM A;  4EJO A;  2IP2 A;  3V8K A;  3IL2 A;  1TQM A;  2K02 A;  5LRS A;  3QOP A;  4LFU A;  3ZN1 A;  1QGP A;  2EFQ A;  2ELH A;  3DKW A;  1ZHF A;  3GEZ A;  3IRR A;  1E2X A;  1Y0U A;  1WSU A;  2DI3 A;  1ON2 A;  3LAJ A;  5HLH A;  2P6T A;  2F5E A;  4N0B A;  1S29 A;  2XAH A;  2V6C A;  2V1X A;  3EET A;  1R1U A;  3RKW A;  4HW0 A;  4RGS A;  4UV9 A;  2ADU A;  3ZPL A;  3BWG A;  2CFX A;  1IRF A;  4DNC A;  3GXO A;  2CO5 A;  1KU3 A;  2HQR A;  2J5O A;  3R61 A;  5LLQ A;  1EH7 A;  3DP7 A;  1ZRC A;  1ULY A;  2KIM A;  4G7O F;  3HUG A;  2VBZ A;  1P92 A;  5DEQ A;  4ZZL A;  2M1B A;  3B02 A;  3WU0 A;  3NEU A;  5CLS A;  5K5Q A;  3TO9 A;  2DPD A;  3Q5F A;  3LFK A;  1JE8 A;  2ESH A;  2VN2 A;  2UWM A;  4TV7 A;  1UST A;  4OIQ F;  4BHB A;  2QBY B;  1T39 A;  2PI0 A;  4G94 A;  4HLY A;  3CJN A;  3KP5 A;  5ILV A;  3KLN A;  5CVJ A;  1ZG1 A;  1CF7 A;  1U8R A;  2MC3 A;  3BJO A;  1FP1 D;  5CVU A;  2STW A;  1XDU A;  5EEG A;  3HRM A;  2QQA A;  3KCC A;  4KIB A;  5FO5 A;  3FMS A;  1BI1 A;  2M8E A;  2M30 A;  1HBX G;  5FB2 A;  4N9H A;  3PQJ A;  2GZW A;  1PP8 F;  4LLG F;  1W5S A;  1TTY A;  3MWM A;  3JSO A;  2HS5 A;  3LAP A;  5BMZ A;  3ZMZ A;  5ICG A;  1S3J A;  3FMR A;  4O6J A;  2DO7 A;  3O6B B;  2ETH A;  1YO5 C;  1SD5 A;  4I7H A;  3TDU C;  3FX3 A;  1R23 A;  1IXS B;  1BIA A;  2FNP A;  3HOT A;  2RN7 A;  1BI3 A;  2ACJ A;  2J5P A;  4I01 A;  3HSF A;  3R0J A;  2Z33 A;  5DD4 A;  3R6S A;  2GA1 A;  4LJZ F;  3J81 Z;  1PP7 U;  3T8T A;  4LB6 B;  2QUF A;  3IWF A;  1Z6T A;  2CQK A;  3F8N A;  1XSX A;  3PQK A;  3NQO A;  4UVC A;  1DUX C;  2EV0 A;  4HV6 A;  3HIF A;  3FMQ A;  4PGH A;  4JQF A;  4BHC A;  2XIG A;  3VOD A;  5E20 A;  1HST A;  5DV5 A;  3H3U A;  1O3T A;  3ZMD A;  4ZH4 F;  4U88 A;  1D8J A;  3F8M A;  1OPC A;  1W4M A;  2K7L A;  2QM3 A;  2ISY A;  2VC0 A;  4LG0 A;  1OYI A;  4U0Y A;  4Q48 A;  2HOE A;  5HDK A;  2W57 A;  4Y13 A;  4OMY A;  2PQ8 A;  1IUY A;  1S6L A;  5D6F A;  3KLO A;  1IW7 F;  2WTE A;  4Y17 A;  4GYI A;  5EEH A;  4D0P A;  5IT9 Z;  4EM0 B;  3MZY A;  3BJ6 A;  5DUI A;  1HQC A;  2HWV A;  5L3B A;  1ON1 A;  2DQR A;  4AVP A;  5HS7 A;  4RGX A;  1YTY A;  2P5K A;  4EM2 A;  1U3E M;  3TOB A;  4A0Z A;  1FYL A;  3FXQ A;  3KZY A;  2IVM A;  5DYM A;  5LHH A;  4L5J A;  5E1Z B;  2HKO A;  2EWN A;  2Z5U A;  3CTA A;  3GFL A;  3N97 A;  4MQ9 F;  4KN4 X;  4K2E A;  2JRT A;  1DDN A;  2OZU A;  1I5Z A;  5J8C A;  1QZY A;  4L9N A;  2VE9 A;  4UNO A;  1O57 A;  4AIK A;  1I1S A;  2HEO A;  3QPH A;  4G7H F;  2QWW A;  2EA4 A;  2MLG A;  6PAX A;  1ODD A;  3KP3 A;  4S05 A;  3F23 A;  2QYO A;  2CSO A;  2DU9 A;  4EM1 A;  5JR3 A;  3VFZ A;  4HOB A;  3ULQ B;  3L2C A;  2QZ8 A;  4ENN A;  3I53 A;  1FT9 A;  4ESF A;  2R7D A;  1G3Y A;  1IXR C;  2IRF G;  5ERI A;  1O7L A;  3KP2 A;  2HYF A;  4ESJ A;  2UXN A;  1LVA A;  2IA0 A;  2YSR A;  4I0B A;  1QPM A;  1SD4 A;  1O3Q A;  2Z3Y A;  3BRO A;  4EVI A;  1TQI A;  1UHW A;  3GX4 X;  2HYG D;  2PG4 A;  3F8C A;  2IT0 A;  1YS7 A;  3C18 A;  4UV8 A;  1B1B A;  2OA4 A;  5K1Y A;  5CJ9 A;  3V7S A;  1SAX A;  1FWZ A;  4FT8 A;  1RUO A;  1G3T A;  3FWE A;  1REP C;  3T5X A;  3ECO A;  4XBF A;  5K5R A;  3BZ6 A;  2QBY A;  4EJT A;  2ZME B;  2W85 A;  3V4G A;  2NYX A;  3WTZ A;  1XSV A;  1ZG5 A;  1FY7 A;  5BOX A;  5BPD A;  3RTR A;  1XN7 A;  3SZT A;  2XHK A;  2XVC A;  3BDD A;  3HOS A;  4YII A;  2A5Y B;  5DCM B;  3SFZ A;  3ZQ7 A;  3GLX A;  3RKY A;  2KKO A;  3HTU A;  3TKY A;  3MZH A;  5JVT A;  4GGG A;  2EFW A;  3QU3 A;  5LEJ A;  3M8E A;  3OV8 A;  2JPC A;  3WGH A;  3DEU A;  3CUO A;  4CHU A;  1K6O A;  2XRN A;  1R58 A;  2OAZ A;  4N9I A;  1YW9 A;  3QP6 A;  4ASN A;  4A5M A;  3E6D A;  4BNC A;  3PFI A;  3GZ6 A;  3L9F A;  1YQA A;  2VBY A;  2FQ3 A;  2RVC A;  3DQV C;  1XGM A;  2ZCW A;  4EMS A;  2B0L A;  1H0M A;  5J8F A;  1XSD A;  2EV5 A;  1HW5 A;  1BN5 A;  4RAY A;  1U5T B;  2G9W A;  1LDK B;  2ZNZ A;  5HS8 A;  5F1R A;  1TQP A;  1U5T C;  1YFH A;  2FA5 A;  4KNY A;  2F5D A;  4P9F A;  2HTJ A;  1E17 A;  3KET A;  3EYI A;  4BAY A;  2XAS A;  3EYY A;  1IF1 A;  4IRG A;  2CG4 A;  3IC7 A;  5J6X A;  1B59 A;  3H92 A;  2FMY A;  5HOO A;  1XGS A;  1XGN A;  1L0O C;  3QU6 A;  2FBK A;  1O3R A;  3Q9V A;  1SD6 A;  1Q1H A;  4MEX F;  1Z05 A;  1T98 A;  1T0F A;  3ZMU A;  2COM A;  2FOK A;  1KQ9 A;  3IRQ A;  3JW4 A;  4P96 A;  2FML A;  3T1B A;  2FXA A;  1KU7 A;  1HXD A;  4E70 A;  1AOY A;  2DQL A;  4HV5 A;  4I0A A;  2HR3 A;  4WXD A;  5L3D A;  2GWR A;  4KUM A;  1IN7 A;  2L4M A;  1KQ0 A;  1FBS A;  3U9G A;  2A68 F;  5ICC A;  4HZF A;  2VXZ A;  3D5L A;  4XRF A;  4HA8 A;  1R5H A;  4ZYH A;  3ML6 A;  2H27 A;  4JK1 X;  2DW4 A;  5DD8 A;  5BS6 A;  2OZ6 A;  2L3D A;  1XDS A;  2VOD A;  4HYE A;  1KA8 A;  3CO7 C;  2F5C A;  3L00 A;  4AD9 A;  3SHF A;  2E1C A;  2F2E A;  4P9U A;  3K9T A;  1VTN C;  2X4H A;  2BE5 F;  2AS5 F;  1OMI A;  5E18 F;  1USS A;  4PDK A;  3QRF F;  2RDP A;  4G6Q A;  4EV0 A;  5FD5 A;  2GXB A;  4IRI A;  1ZG3 A;  3M8F A;  4WX9 A;  1EH8 A;  2LSO A;  3GVA A;  3ERE D;  4EQQ A;  2BBY A;  5LGN A;  1XB4 A;  1RZ4 A;  3FM3 A;  2XRO A;  1D5V A;  1MGT A;  4L18 B;  1OYW A;  3M7G A;  4S04 A;  3K1M A;  3RYP A;  4A6D A;  4MHG A;  3BOQ A;  3HTS B;  4MNU A;  3V8J A;  2K4B A;  1BM9 A;  1FBU A;  3J80 K;  2JSC A;  2X0L A;  5E8G A;  3H3Z A;  1LB2 A;  4A5N A;  2L01 A;  3EUH A;  4I98 B;  5DCF A;  4L9J A;  4IHS A;  5ICF A;  1ZLK A;  2IW5 A;  5K5O A;  1LEB A;  1YIO A;  3TO7 A;  5CVR A;  2ZME A;  3F3X A;  2LF7 A;  2HDC A;  1JHF A;  3WTU C;  4UUV A;  4OIN F;  3BPV A;  2OD5 A;  4XSZ F;  3RIR A;  2DK8 A;  1U78 A;  4ETS A;  1ZGA A;  1GVJ A;  2M87 A;  3ZN0 A;  5DCM A;  3LQQ A;  2GAU A;  3WTW C;  2NNN A;  5AIP A;  4M73 A;  2Q2E A;  5FD6 A;  3G73 A;  2XAF A;  4IHT A;  2MD5 A;  4HX4 A;  2ZKZ A;  2WWY A;  3HHH A;  2ZNY A;  5D8K B;  1FZP B;  2EA2 A;  3OOP A;  4ZYE A;  3QAH A;  2GIV A;  4LLN A;  1ZYR F;  1O3S A;  1K7A A;  4WK8 F;  3KE2 A;  1R1V A;  1H9G A;  3HSR A;  5H6R A;  1GXQ A;  3DF8 A;  4ENJ A;  2OQR A;  3QP5 A;  5TJJ A;  2CGP A;  1F9N A;  4B8X A;  3RJP A;  5FFX A;  2R7F A;  1U5T A;  1IN8 A;  4XSX F;  2W24 A;  5TRD A;  1W7P D;  2QQB A;  4JBA A;  4OMZ A;  2ZXJ A;  3E5X A;  4NQW A;  4KYW A;  3C1D A;  3HHG A;  3WOD F;  1RI7 A;  4LLL A;  1U6G A;  5IT3 A;  4KA4 A;  4P55 A;  3LQR A;  1Z6R A;  4WF2 A;  4DQ2 A;  3GZ5 A;  1ZGJ A;  2UXX A;  3AAF A;  2KJC A;  1WKM A;  1IN5 A;  2DT5 A;  3TGN A;  3QPT A;  3G3Z A;  4GCV A;  4CXF A;  4HF2 A;  4M71 A;  1KYW A;  4KIF A;  3HRS A;  3CUQ B;  1HW2 A;  2P7C B;  1HKS A;  1P4A A;  1YYV A;  3CUQ C;  1TBX A;  5E8I A;  4G8X A;  2PMH A;  2XKO A;  4KN7 X;  3WTS C;  4IF4 A;  3VEP A;  1RUN A;  2BEO A;  2Z99 A;  3RPU A;  3WGI A;  2DFI A;  2K27 A;  4Z2Y A;  4ENK A;  4WWC A;  4U7B A;  2YX7 A;  2L4A A;  3FZV A;  3WGG A;  3ZP5 A;  3FXR A;  1K78 B;  4L0Z B;  1FYM A;  4UVA A;  2W84 A;  2NNY A;  1X3U A;  4P5O A;  3KP6 A;  1YG2 A;  1F1Z A;  1T38 A;  1Z9C A;  4O5V A;  4CO8 A;  2EJR A;  4QWQ A;  4BQA A;  1GHC A;  5HS9 A;  5D5U B;  3LA2 A;  4I2O A;  3ZMS A;  5FLX Z;  3TOA A;  3DV8 A;  5A2Q K;  1LDJ A;  5L3F A;  3D0S A;  2VOP A;  2DAO A;  2HKX A;  4U7D A;  3RI4 A;  1HKQ A;  5D5W B;  1RNL A;  1V3F A;  3K69 A;  1BI0 A;  4GO1 A;  3VOE A;  1BC7 C;  1YLF A;  5E17 F;  2Y48 A;  2RV8 A;  4HQE A;  4A12 A;  4EGY A;  1FLI A;  1CGP A;  1P4W A;  3P9K A;  3E97 A;  2P5L C;  5HDN A;  2WV0 A;  1IZ1 A;  1EH6 A;  1KYZ A;  2MA3 A;  3E6B A;  4ZYD A;  4RGR A;  2LDU A;  4M74 A;  4YG2 F;  2QEN A;  4L9T A;  2A3S A;  2IPQ X;  2QQ9 A;  1G3S A;  3FF5 A;  5CVI A;  2CWE A;  3J80 Z;  1WQ2 A;  1HKT A;  4RGU A;  4M9Z A;  4GXO A;  1CF7 B;  1HSJ A;  2M5W A;  3HRT A;  2EB7 A;  5HDG A;  2HFH A;  1ZN2 A;  4HX8 A;  4A0Y A;  4Y15 A;  4CDG A;  5ILU A;  1DP7 P;  4MQV A;  4I09 A;  4PGG A;  3MQ0 A;  1KGS A;  2DK5 A;  1FSE A;  4LMY A;  2H09 A;  5KVR A;  2D2W A;  4RS8 A;  2PBI A;  2PFB A;  1B6A A;  4FX0 A;  3F22 A;  1YW7 A;  4WXC A;  2XAQ A;  1SMY F;  2LF8 A;  3P9I A;  3IKV A;  3WG9 A;  1ZH5 A;  3IWZ A;  1P2F A;  1S7A A;  1WI9 A;  1BJA A;  2EFN A;  4M9X A;  5AON A;  3O3K A;  2MH2 A;  5L3G A;  2ZBK A;  2E1N A;  3ELK A;  1KU9 A;  1B9N A;  3RPQ A;  5LBQ A;  5H6Q A;  3TDZ C;  1ZAR A;  3FM5 A;  1RIO H;  3C7J A;  2FNA A;  1DPU A;  4U0V A;  1D8K A;  1PDN C;  4Q4Z F;  2PLY A;  3K1N A;  1H9T A;  4OIO F;  4EJW A;  4H0E A;  3GW2 A;  2ZJ2 A;  4XLP F;  4RB0 A;  2Y75 A;  2FF4 A;  1V4R A;  2Q8K A;  3E6M A;  2GQQ A;  1UCR A;  3BPX A;  1LDD A;  3KP4 A;  4OIR F;  3V8L A;  3MFK A;  4AWX B;  4KT5 C;  1QZZ A;  2FBI A;  3EDP A;  3U1D A;  3CLO A;  4HAM A;  2JZY A;  4HX7 A;  2YU3 A;  2V1D A;  3F21 A;  2FU4 A;  1R1T A;  5ED4 A;  1SFX A;  3GWZ A;  5LGT A;  3GO5 A;  3CUQ A;  2G7U A;  5JI6 A;  2CYY A;  1JGS A;  1LJ9 A;  2IA1 A;  4A0X A;  2E7X A;  4IJA A;  1MDM B;  1I1G A;  4FHT A;  2FE3 A;  3KZZ A;  1IN4 A;  2DLL A;  3T0Y A;  4M6Y A;  1FNN A;  1WRJ A;  2XGX A;  1C0W A;  1S7O A;  2OQG A;  4IRH A;  3ZMV A;  4A6E A;  5E1W A;  1QBJ A;  1K78 A;  2EV6 A;  1XMA A;  4KMU X;  1R36 A;  2VE8 A;  1ZRE A;  1FP2 A;  4LB5 A;  5FLX K;  1MJ9 A;  5DDG A;  1BIB A;  3EQL F;  3I54 A;  1B4A A;  2FSW A;  2BV6 A;  5A2Q Z;  3E3V A;  3ECH A;  4M9S A;  3JTG A;  2P4W A;  1BOA A;  2H6B A;  2Z9O A;  3WE3 A;  4BHP A;  2DPU A;  2P6S A;  3RDI A;  3BJA A;  5L3C A;  1IRG A;  1DPR A;  1W7P B;  2C6Y A;  4R1H A;  3T8R A;  4MTD A;  3GFM A;  3WTV C;  5FGM A;  1LEA A;  1Z7U A;  2QVO A;  3ISP A;  5DUK A;  2V1U A;  2YR2 A;  3I5U A;  1XD7 A;  3IHU A;  5BPI A;  4PZJ A;  4HLX A;  1FSH A;  2VBX A;  1KU2 A;  1LQ1 A;  4MTE A;  1J9I A;  4MGR A;  4UXN A;  1YW8 A;  3HYI A;  3DFG A;  2A61 A;  5D4R A;  4B09 A;  3N4M A;  2O3F A;  3IKT A;  3I58 A;  3U2R A;  1J7K A;  3JAM K;  2EFP A;  2KRF A;  3SQN A;  2ZFW A;  4PCQ A;  2STT A;  4L9V A;  4YFX F;  1LNW A;  2HGC A;  3F6V A;  4KDP A;  5CVV A;  5D4S A;  1AWC A;  3E6C C;  1R22 A;  3F6O A;  4A2U A;  4KIC A;  4M72 A;  2BGC A;  4XLN F;  3L09 A;  2D45 A;  1W5T A;  3M9A A;  2IJL A;  2W25 A;  3K2Z A;  5L3E A;  3NRV A;  2UZK A;  1IAW A;  1YS6 A;  2FBH A;  1O7F A;  4WCG A;  3GFI A;  1MJB A;  3K0L A;  3R4K A;  4HF0 A;  2YX4 A;  3O2P E;  1T6S A;  2E7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...