2JT1A

Solution nmr structure of pefi (plasmid-encoded fimbriae regulatory) protein from salmonella typhimurium. northeast structural genomics target str82
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
71
Chain Sequence
MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PefI protein
publication title Solution NMR structure of the plasmid-encoded fimbriae regulatory protein PefI from Salmonella enterica serovar Typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
total genus 20
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04703 FaeA FaeA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jt1A00
2FBIA 4P96A 4LLGF 5D8KB 4ZYEA 2CO5A 4KICA 3TO7A 3RI4A 1KQ0A 1J5YA 3E97A 3BJOA 2DPUA 4L5JA 2RKHA 1XDSA 1R1TA 2BEOA 3T1BA 3BPXA 2PMUA 3CTAA 2VC1A 4UHTA 4L0ZB 2FBHA 2O3FA 1IRGA 4M73A 3Q9SA 4M6XA 4KMUX 3RPUA 5E1XA 4KUMA 1S6LA 2FRHA 3H3UA 5IT3A 4YIIA 2J5PA 4A6DA 1QNTA 1K78A 4LG0A 1FNNA 4M9XA 1ZLJA 1ZRCA 5BPIA 1TQIA 1QQIA 1O3QA 2DLLA 2WTEA 1T39A 1QPMA 1FYKA 3D5LA 2K86A 2L4MA 2NNYA 3E6MA 1Q1HA 3N4MA 3RPQA 2H94A 3LAPA 2D1HA 5LGNA 1PP8F 3KFWX 5ICCA 2BYVE 3PFIA 2EJRA 1XD7A 1JHFA 1BC8C 3QP6A 4AIKA 5CVJA 2IA2A 1UHMA 1FWZA 2ZNYA 4HDUA 4FX4A 3FX3A 3GW2A 1CGPA 4P9UA 2XVCA 4OOIA 4I02A 2OD5A 1IN5A 3V7RA 5FFXA 1ZRDA 4DNCA 3DPTA 4ZYHA 4OIRF 3BWGA 2YX7A 1SFUA 3T0YA 3IWFA 2EFOA 5ED4A 4HYEA 3M7GA 2CWEA 4RAYA 3E3VA 2TDXA 3P9KA 4ENJA 4ESJA 2PBIA 1MJ9A 1IZ1A 1DPUA 2DI3A 3F23A 4U0WA 2JPBA 1Z6TA 3QRFF 2M30A 4O5VA 3F8NA 1R36A 2X4HA 1IXRC 3F3XA 5D6FA 3EYYA 2JZYA 3ZN0A 4BXUA 4A0YA 3WGIA 1SD7A 4L9JA 5AONA 2J5OA 2DK8A 5DEQA 3HRSA 1Z6RA 4RGXA 2EFWA 4YFKF 4G7HF 3ZN1A 3OOPA 1J59A 3GFIA 3SZTA 2NNNA 3GF2A 2FBKA 1XCVA 4ZZLA 3RKWA 1ZG3A 1FPQA 2F5EA 1HW2A 1IN7A 2ESNA 4MHGA 1BC7C 2LDUA 2V6CA 1KGSA 2UXXA 4DQ2A 4CXFA 2EFNA 4O6JA 2M45A 3FXRA 4KFCA 3KEQA 1IXSB 4RGRA 4LMYA 3LQRA 4GO1A 1ZH5A 4G7ZF 3HYIA 3SFZA 2HEOA 3WU0A 4WK8F 1F9NA 1U8RA 4P55A 3BDDA 2DT5A 2RDPA 2RN7A 4Y17A 1S29A 5HLIA 3ERED 1MJAA 1I1SA 1AWCA 3TO6A 3WTWC 4KMFA 1TW2A 2KRFA 1X3UA 3T8RA 3V8KA 1HW5A 5CVRA 2ZBKA 1YW7A 4YFNF 5L3DA 3ROUA 4P9FA 3FMQA 2YSRA 1TNSA 5CLSA 2STWA 4LK0F 5TJJA 4LLNA 4OMYA 2P7CB 1ZGJA 4A6EA 1KU3A 2C6YA 2ETHA 4HAMA 5CVIA 2R7FA 1XMKA 2L4AA 3QPTA 1CF7A 5L3FA 4HV6A 5JR3A 2W84A 2W24A 2P6TA 3GYHX 2DQLA 2ZCWA 2A5YB 2XGXA 2VBYA 1SMYF 3RTRA 1B59A 4BQAA 1MD0A 2PI0A 1Z1DA 3E5XA 2DAOA 1IF1A 2VBWA 4PCQA 1ZG1A 4QWQA 3ZMDA 2LF8A 4MTEA 3IC7A 1P4XA 5EEHA 2V9VA 1YLFA 4WXHA 4LD5A 2EV0A 2XKOA 2YX4A 1FOKA 2D1VA 2MD5A 1QO0D 2L54A 3U1DA 1IUYA 3I64A 3DP7A 3GFLA 5E18F 2XAFA 2STTA 3B02A 4HZFA 4IHSA 1R5HA 1WRJA 2ZJ2A 2DFIA 1BM9A 1U2WA 3HSEA 1JGSA 2CYYA 3WGHA 4IF4A 5HOOA 3HHGA 1U5TA 1LDJA 1OPCA 4BNCA 1O7FA 4UVBA 3HSFA 2MLGA 2PQ8A 1GHCA 2QLZA 2ISZA 5JVTA 4RGUA 1IN8A 3G73A 2BGCA 1WWXA 2RQPA 2M5WA 1FX7A 4WWCA 2X0LA 5H6QA 1FT9A 4HF0A 1DP7P 4WF2A 2H09A 1OMIA 3KETA 3MEXA 1YW9A 3F8MA 2KJBA 1TW3A 4IXAA 2EB7A 3NRVA 1H9TA 1EH7A 3IKVA 5ILUA 5ICEA 2M1BA 2EFPA 3R6SA 1KQ9A 3CUQC 1LDKB 1U3EM 4RB2C 2MBFA 1SAXA 3BPVA 1W7PA 1I1GA 2VODA 4HF1A 2QZ8A 3K1PA 4EJUA 3IL2A 4BHCA 2P8TA 1WSUA 2OA4A 4WXCA 5D6EA 4O3MA 1BI2A 3OV8A 4ZYDA 3SXYA 1G6NA 4ENKA 4ENNA 3F6VA 3BOQA 2PMHA 3MWMA 4HX7A 2D2WA 1T98A 4HBLA 3E5QA 3QAHA 2MLKA 3BJ6A 3QU3A 2GQQA 2EFQA 3IRRA 1S7AA 4Q4ZF 2CSOA 2VONA 3KP7A 3FZVA 1MKMA 5BOXA 4NHJA 1HKSA 5AIQA 1HSJA 2VOPA 1FP2A 1GXQA 4YIFA 3GEZA 2RNJA 4R8HA 4YFXF 1PDNC 4RB3C 1FYMA 2L01A 4IHTA 4JK1X 5LEKA 4L9NA 3I54A 3WTSC 1XSXA 3CO7C 3BY6A 1XSDA 5D4SA 2COMA 4CDGA 4OU0A 1P92A 4JBAA 1TBXA 2FSWA 5HDGA 2JSCA 2R3SA 3RYRA 2K4BA 4HLXA 2KJCA 1LQ1A 3LQQA 3V4GA 2FE3A 4RGSA 4GYIA 1GVJA 4ASNA 4I01A 3O6BB 5FO5A 3F6OA 2KIUA 4ZZDA 3F8CA 1EH6A 3QU6A 5F1RA 1D8KA 1LDDA 3KP2A 4OIPF 3BJAA 1HW1A 4Y15A 2EV5A 5E1WA 2PN6A 4G6DA 3D0SA 3Q9VA 1P4AA 4HQEA 3SQNA 2Z9OA 2QUFA 3WU1B 4Q48A 2BE5F 3WE2A 1O3RA 1ZREA 1UCRA 5BPDA 5LGTA 3ZMUA 4LB5A 3TQNA 1JE8A 2IVMA 5HDNA 1OYIA 3FXUA 1FLIA 1KYZA 1Z05A 4JQFA 1ZAOA 3K1NA 2GXBA 3M1EA 3J81K 4KT5C 1JXSA 3FM5A 1DUXC 4HLYA 1K78B 1YS7A 3J81Z 2A07F 4I0BA 2E1CA 2WC2A 1VTNC 4UXNA 1JHHA 2E1NA 3JTGA 3WGGA 4U7BA 2HZTA 2MA3A 3ECOA 3DV8A 1XN7A 3VFZA 2XV4S 2EA4A 1ONVA 3RKXA 2Q2EA 2A69F 2FXAA 3KLNA 4EGYA 2EA2A 1DDNA 5ILSA 4BHPA 3EQLF 2VE8A 2FF4A 2VOOA 1G3WA 4XRFA 3L2CA 2VBZA 1A04A 1S7OA 1XGSA 4MGRA 2QYOA 2XUBA 1IN4A 5K1YA 2P5LC 5CVUA 4NQWA 5ICFA 1R58A 5J8CA 3SHFA 2DO7A 3KP4A 4EM1A 1U78A 2FOKA 4UV8A 3RDIA 2P5KA 1XGNA 4IRIA 5HLHA 3TKYA 2PFBA 2MH2A 1XB4A 3REOA 2V1DA 3MQ0A 1BJAA 1O3TA 2HGCA 1F1ZA 2P6SA 4FT8A 3VEPA 3TOBA 3HRMA 2XHKA 2CG4A 3E6BA 4F7ZA 4BAYA 2HKOA 4Y13A 4GCVA 2FMLA 2W57A 3J80K 3K0LA 4N0BA 2HFHA 3BZ6A 4A5MA 1KU2A 3HTSB 2M87A 4MQVA 3J80Z 3LA7A 2OU2A 5HDKA 3M8EA 4LGWA 3EUHA 3ZP5A 2GZWA 2PG4A 4U0VA 2FNAA 4LLLA 1R1UA 5BQTA 2L02A 4I2OA 1B9NA 4HX8A 2V1XA 3G3ZA 6PAXA 3S2WA 2ZMEA 2H6BA 1S3JA 2DQRA 4B09A 5FGMA 1K7AA 3R60A 4CGZA 5F64A 1O3SA 5E1ZB 2KIFA 2GA2A 2MH9A 3R61A 3O2PE 3DEUA 2Z99A 2ACJA 4N9IA 4AIJA 1R5GA 1W5SA 1T0FA 1YQAA 5KK1A 3KLOA 3MCZA 2A61A 1RZ4A 5E20A 2D45A 1ZARA 4G7OF 3JTHA 2JTVA 2VXZA 2IA0A 2PJPA 3K9TA 1YS6A 5D5UB 2Q8KA 2EWNA 2O0YA 1T2KA 1U6GA 3DPLC 2HWVA 2JT1A 4PDKA 2DTRA 4EM2A 4BYYA 1QZZA 5TRDA 3CDHA 2A6EF 3BP8A 2NS0A 3P7NA 4U7DA 1R1VA 2Q0OA 4CHUA 1XSVA 5DDGA 2QBYA 4MNUA 2P5VA 2FU4A 4EVIA 2OBPA 2VT2A 1Z91A 2V79A 2Z3YA 3GZ5A 1YFHA 2ELHA 2ADUA 1FBUA 1K6OA 2ZNZA 5FLXK 3I4PA 1YO5C 1I27A 3PQKA 4EJVA 3K1MA 4KNYA 3F8FA 2CQKA 3C3WA 1F5TA 4OIQF 5FLXZ 3VOEA 2XASA 4EQQA 4A5NA 3NQOA 2LNBA 4K2EA 3QOPA 3L9FA 2Z5UA 3DFGA 3CUQB 3ML6A 1J9IA 1REPC 5LEJA 1IAWA 5DCMA 1EV7A 5FD6A 1SD4A 1LJ9A 3HTUA 1FBQA 5DUIA 4MEYF 2WV0A 4RB1A 3FF5A 1J2XA 3BROA 1HSTA 1ON2A 2HTJA 5DD8A 3RKYA 5IT9K 2NAZA 1ZG5A 2QWWA 3HRUA 4HV5A 2NRAC 2VN2A 3DQVC 3M8FA 1ZLKA 2FEZA 3CUOA 3F72A 2OZ6A 4NB5A 1WI9A 5IT9Z 2VT3A 5DCFA 5ILVA 3RYPA 3KZYA 1OYWA 4KYWA 2G9WA 4HOBA 1IXCA 3KP5A 1FSHA 5FFZA 4N9HA 5DV5A 1HQCA 2R7DA 1W4MA 5J8FA 3TO9A 4S04A 1MDMA 4XSXF 1G3TA 3K2ZA 2BBYA 3F21A 1KU9A 2PEXA 3TOAA 3I59B 1R7JA 4UNOA 2K02A 4A12A 2HYGD 3U9GA 3FM3A 1QGPA 2FQ3A 4IPAA 3TGNA 1BOAA 5LHGA 4EGZA 1RI7A 4L9VA 2ZO4A 4OINF 4RS8A 2FA5A 1FP1D 3JW4A 2OQRA 5BMZA 2O03A 1USSA 4LB6B 1BBYA 5LLQA 1W7PB 4HQMA 2GXGA 2WWYA 1SFXA 4IJAA 1FZPB 2XKPA 3JAMK 1HKQA 5JFRA 5FD5A 5ICGA 4KN4X 4KA4A 3F8BA 4CO8A 2XAGA 1U5TC 3JAMZ 2QQ9A 5H20A 1RUOA 3E6DA 1IRFA 1FC3A 3WTTC 2ISYA 2XIGA 2CFXA 4MQ9F 1D5VA 1MJBA 4G9YA 1TTYA 2OAZA 4XBFA 3I5UA 3L7WA 1BI3A 3WTVC 4R79A 2F5FA 3HOTA 5KVRA 3U2RA 5CYVA 4EJWA 2EK5A 5ERIA 1EH8A 2F5CA 3GWZA 4PGHA 2RVCA 5HS7A 5D5XB 5LHIA 3CJNA 4AD9A 1W5TA 2VBXA 3VB2A 3P9IA 4FX0A 2H6CA 4B8XA 1ON1A 3TDZC 2HQNA 3KP6A 2RGVA 3COAC 1KYWA 1SD6A 5LRSA 1HXDA 5AIPA 1V4RA 1I5ZA 2GWRA 3I71A 2XRNA 4MTDA 2RC4A 3RJPA 3H92A 3DXJF 2JRTA 3KE2A 2LF7A 1Z9CA 4KIBA 3EETA 2XAHA 4KN7X 1AOYA 2VC0A 1IW7F 3DF8A 5HS9A 2W25A 3FMRA 2O61A 3C1DA 1TQPA 3WE3A 1D3YA 5HLGA 5CJ9A 1Z7UA 3EDPA 1O7LA 3M9AA 4M71A 4UVAA 1R23A 4FHTA 4I98B 4OIOF 1OR7A 4WX9A 3LFKA 3H3ZA 4XLNF 4LG0B 3AAFA 4A2UA 4MEXF 3HUGA 3FHZA 2HOEA 3I0TA 3IHUA 2BV6A 1L3LA 4KDPA 3P9CA 3CLOA 1WQ2A 4HDVA 2F5DA 3MAJA 3GUDA 2UXNA 3SZPA 5HS8A 4L9TA 4IRHA 3W6JB 5E17F 3KZZA 1B1BA 2Z33A 3T5XA 1LEAA 1B9MA 2XAJA 1UB9A 4R1HA 2IW5A 4YG2F 4G6QA 1B6AA 3ZMZA 1S8NA 2YU3A 3KEOA 3IWZA 4M9SA 3W6KB 4M74A 5LHHA 2YR2A 3V8JA 5BS6A 1T38A 4WXDA 3MZYA 2ESHA 4UVCA 1HKTA 3HSRA 4HA8A 4KIGA 3FXQA 3PQJA 3R4KA 4ETSA 4UUVA 2QENA 4P5OA 2IP2A 4L5IA 3E5UA 3HOSA 1J75A 1WKMA 4AWXB 1SD5A 5CVVA 1BIAA 2XROA 2JPCA 5LRRA 1MGTA 2O8XA 3N97A 2B0LA 4CZZA 3K69A 3WTXC 3JSPA 5JHUA 2XAQA 3WTZA 1G4DA 4RB0A 2HKXA 4LJZF 2P7VB 4I0AA 3B73A 3ZMSA 1W7PD 1V3FA 1YG2A 4G94A 3T8TA 4GYGA 1F4KA 2MC3A 1T6SA 3LA2A 4M9ZA 4QLCU 2DBBA 1BI0A 3J7AO 5DD4A 1B4AA 1BN5A 2Y75A 3E6CC 1ZGAA 4CICA 1YYVA 4EM0B 5K5OA 4GXOA 3IKTA 1KU7A 4D0PA 2E7XA 1XGOA 2GAUA 3C7JA 2HTSA 1Y0UA 2UWMA 4IVNA 3ULQB 5JI6A 1I6XA 1ZHFA 1XCBA 5A2QK 1STZA 3ECHA 3Q5FA 3FMSA 1OYYA 1PP7U 3JSOA 3EYIA 2AXLA 2A3SA 1G3YA 1SMTA 2HYFA 1TLHB 1MZBA 1FBSA 4M6YA 1LNWA 4LK1F 5A2QZ 2VE9A 2LSOA 1XGMA 2ZMEB 3I58A 3L09A 1SFEA 4I09A 1KQ8A 1ZRFA 3RIRA 2HS5A 1L0OC 4Z2YA 5K5QA 4ENMA 4KIFA 2GA1A 3V7CA 5D5WB 2OQGA 1QZYA 1LVAA 5FB2A 1LB2A 3ZQ7A 5L3EA 5L3GA 4EV0A 1UFMA 4UV9A 1C0WA 4XLPF 3ZMTA 3VODA 3ABTA 1RIOH 4LFUA 2H27A 1FY7A 1USTA 3ISPA 4RAZA 2LKPA 1CF7B 4ZYGA 1YTYA 2IJLA 1G3SA 4IRGA 1RNLA 4M72A 2NYXA 3ABUA 3ZMVA 3GZ6A 3ELKA 1TQMA 4ESFA 5E8GA 4AVPA 3R0JA 3NEUA 2QBYB 1O57A 2PLYA 4XSZF 2HR3A 4EJOA 3QPHA 3CUQA 3HHHA 2DU9A 4L18B 2K27A 4H0EA 4ZH4F 5H6RA 2V1UA 2E7WA 1OKRA 3GFMA 3HRTA 2GIVA 1FSEA 2QQBA 2CW0F 2ZKZA 1BI1A 2F2EA 4HX4A 3CO6C 3KP3A 3F22A 3MFKA 5L3BA 1E2XA 5HVQC 3O3KA 2P4WA 4S05A 3QP5A 5DCMB 4EJTA 2QVOA 3WODF 3MZHA 3LWFA 5LGUA 2EV6A 2RV8A 1U5TB 2YPRA 1H0MA 5F6FA 5L3CA 2Y48A 5EEGA 4BH9A 4ESBA 4ON0A 4Q47A 3V7SA 2K4JA 1P4WA 3I53A 4EMSA 1ZYRF 2KKOA 3WTYC 1E17A 3GO5A 3I59A 1R22A 2QM3A 2IRFG 4CYDA 3IRQA 2IPQX 3GXOA 5LBQA 2QQAA 2OZUA 5DUKA 2A68F 4Q5SF 4AIHA 2UZKA 2DW4A 2DK5A 3R0AA 3KCCA 2K7LA 1FYLA 2FMYA 1H9GA 1R00A 1TNTA 3V8LA 1XMAA 1MDMB 1YIOA 2W85A 4GGGA 1ZN2A 1GXPA 4A0ZA 1XDUA 1ODDA 1ULYA 4A0XA 1LEBA 2G7HA 2HDCA 2ZFWA 5D4RA 2FNPA 1P6RA 3GX4X 1QBJA 4U88A 1J0RA 3WG9A 1RUNA 5E8IA 1P2FA 1YW8A 4OMZA 3TDUC 4BHBA 3GVAA 2Y0MA 3HIFA 1K79A 4HF2A 1KA8A 3L00A 1HBXG 3ZPLA 2AS5F 2DPDA 4WCGA 3C18A 2KIMA 4HW0A 4PGGA 3DKWA 3LSTA 1J7KA 2IA1A 4G8XA 4E70A 2M8EA 3LA3A 5DYMA 3GFJA 2IT0A 1NHAA 1UHWA 1PUEE 2HQRA 4L0YB 2L3DA 4TV7A 5D5VB 3FWEA 4I7HA 5D8LB 3WTUC 4PZJA 2ZXJA 3GLXA 1IN6A 1D8JA 2O6GE 2G7UA 5J6XA 2CGPA 2A6HF 1BIBA 1DPRA 4U0YA 3LAJA 5K5RA
chains in the Genus database with same CATH superfamily
2FBIA 1EKEA 4P96A 2CQQA 2CW8A 4LLGF 5D8KB 1X1PA 4F92B 4ZYEA 3RSNA 2CO5A 2M0MA 2FQ4A 5FKLA 3EPZA 4KICA 3TO7A 3RI4A 4AVZA 1KQ0A 2MW8A 2IS1A 3CC4I 1J5YA 1NTCA 1DU6A 1S72I 3E97A 4F91B 1AKHA 3BJOA 4PK4A 2DPUA 1Z7LA 2CQ7A 4L5JA 2RKHA 2FJ1A 3KIOA 1XDSA 3C2HA 3QYEA 1R1TA 2BEOA 3VPRA 3T1BA 3BPXA 2PMUA 3CTAA 2VC1A 3FK7A 4UHTA 4ZTJA 4L0ZB 5J47A 1F36A 2FOWA 4GFBA 2FBHA 2O3FA 1IRGA 2OTJI 4M73A 3VSKA 3Q9SA 4F3QA 4M6XA 4KMUX 3RPUA 5E1XA 2N8GA 4KUMA 5EJCA 1YJNI 1LFPA 3I55I 1S6LA 1HDPA 2FRHA 3H3UA 5IT3A 4NNJA 4YIIA 2J5PA 4DZPA 4V19K 3VYSB 2E1OA 1QNTA 4A6DA 4LG0A 4KITB 1K78A 2B63J 1FNNA 1SVOA 1VI0A 2LD5A 1WJEA 4M9XA 4LG3A 1AHDP 1ZLJA 3BQYA 3OYIA 1NK2P 1ZRCA 3FXJA 3M8JA 5BPIA 2LREA 1TQIA 1QQIA 1O3QA 2DLLA 2HQ5A 4IQJA 2WTEA 1T39A 1QPMA 5M3FJ 1FYKA 2Q1ZB 3D5LA 2HVSA 2K86A 2L4MA 1XC5A 3ESWB 2OTLI 2VQHA 2NNYA 3E6MA 1Q1HA 3HGYA 3N4MA 3RPQA 2H94A 3LAPA 2D1HA 5J40A 2BHYA 5LGNA 1PP8F 3KFWX 1RETA 2DN0A 1ETXA 2NVQJ 3H36A 4C2MJ 5ICCA 4JOMA 2BYVE 2QKLB 4XLEA 3PFIA 1XMXA 2EJRA 1XD7A 2QSHX 1JHFA 3VYUB 1BC8C 3QP6A 2IS6A 4AIKA 5CVJA 2JRMA 2KLOA 3W2WA 3PSFA 2W00A 1ZELA 2IA2A 1UHMA 4XLHA 4XM3A 4BKXA 1B72A 2X6OA 1FWZA 2ZNYA 1MNMC 1X1DA 2HNHA 2VB6A 4HDUA 3S1RJ 4FX4A 3OYJA 3FX3A 3G6EI 4BY1J 4A3JJ 3GW2A 1CGPA 4P9UA 2RQQA 2XVCA 3U1KA 4E7ZA 2ZJPF 4OOIA 4I02A 3L2WA 2OD5A 1IN5A 3V7RA 5TISC 5FFXA 1ZRDA 4DNCA 3DPTA 4C2UA 1PVEA 4BJTA 1K83J 4F55A 4ZYHA 4OIRF 3BWGA 4ABZA 5HLTA 4ZTFA 4A3FJ 2IBDA 2YX7A 3OS1A 1D1CA 4DJAA 1SFUA 5F27A 3T0YA 3IWFA 2L0KA 2EFOA 5ED4A 1R71A 4V2GA 3NAUA 4HYEA 2MD0A 3M7GA 2AQFA 2L2OA 4D5CA 2CWEA 4RAYA 2FUG2 2K9MA 3E3VA 2TDXA 2GM4A 3CCQI 3G4SI 1TWFJ 1GVDA 2ECBA 3P9KA 4ENJA 4ESJA 2PBIA 1MJ9A 1IZ1A 3QPSA 3GTGJ 1DPUA 1GV2A 4XK4A 2DI3A 3F23A 4U0WA 1Z3YA 2JPBA 4NQWB 1MH4A 1P9QC 3I3LA 1JTXA 1S9HA 1H88C 4LITA 3OYAA 3MKYB 1JKOC 3ONQA 4DBRA 2W48A 1Z6TA 3QRFF 4QPQA 1OR7C 2M30A 4BXFA 4O5VA 3QOEA 3F8NA 1MH3A 1R36A 2VKHA 1Y6IA 2X4HA 3CCVI 1IXRC 3BTIA 3F3XA 3EYYA 2DA2A 3C2GA 2JZYA 5D6FA 3ZN0A 3HL2A 4BXUA 4A0YA 3WGIA 1SD7A 4L9JA 5AONA 2V7FA 3PFYA 2HDWA 2EH3A 2J5OA 3OY9A 3Q0VA 1LPQA 2LY2A 2DK8A 4XR6A 5DEQA 2R93J 3K6GA 3JRAA 2KHMA 2HOAA 3HRSA 1Z6RA 4RGXA 2EFWA 3ABKH 4YFKF 3K4BA 4G7HF 3ZN1A 2DT6A 3OOPA 1J59A 1JI8A 1QA6A 4C9YA 3SZTA 3GFIA 2NNNA 3GF2A 2FBKA 1XCVA 4ZZLA 2QSGX 1WZ2A 1IV8A 2IEKA 3PUFA 3RKWA 1ZG3A 5B3SH 1B8IA 1FPQA 3QODA 1E3OC 2F5EA 1HCRA 3A03A 1HW2A 5LD2C 4JP0A 1IN7A 2ESNA 4MHGA 1BC7C 2R7UA 2LDUA 5M5XJ 2V6CA 1KGSA 4BEHA 2L9VA 2XGCA 1ENHA 2TRTA 2UXXA 1HA8A 3FHNA 4DQ2A 4CXFA 1WJ5A 3S1QJ 2EFNA 4O6JA 4BDZA 2M45A 3FXRA 4KFCA 3E0JB 1BR4A 3OSFA 3KEQA 1IXSB 2BHZA 4NC7A 4LMYA 4RGRA 3LQRA 3NARA 4BJ6C 4GO1A 3V42A 1ZH5A 1S5LC 2VKDA 1U8BA 4G7ZF 3ZQFA 4YEJA 3HYIA 2E71A 3H5RA 2M8GX 3DTEA 3SFZA 2HEOA 3HBLA 3WU0A 4WK8F 1F9NA 4HNUA 2A5WA 1U8RA 4P55A 3BDDA 2DT5A 2RDPA 2RN7A 4Y17A 1S29A 5HLIA 1FJLA 3DTIA 3ERED 1MJAA 2KQRA 1I1SA 1JGGA 5EEAA 1AWCA 4CSWA 3HOYJ 2IGMA 1IRXA 4FETA 2Y9YA 3TO6A 3WTWC 2MSYA 4KMFA 1TW2A 3JRFA 1SEUA 2OF7A 5F08A 2KRFA 3H0GJ 2QA4I 1X3UA 3T8RA 3V8KA 1HW5A 5CVRA 2L7FP 2NS8A 2ZBKA 1VQ8I 4RDUA 1YW7A 1YE9A 4YFNF 5L3DA 3ROUA 1TWGJ 4P9FA 1N75A 3FMQA 2YSRA 1TNSA 5CLSA 2STWA 3DU5A 3LSHA 4LK0F 5TJJA 3BR1A 3BG7A 2KL4A 2E2HJ 1JT6A 3S3MA 2B7EA 4LLNA 2P7CB 4OMYA 3F9KA 1ZGJA 4A6EA 1KU3A 2C6YA 3MN2A 2ETHA 2O7OA 4PJJA 4HAMA 5CVIA 1Y56A 2OC6A 2R7FA 1XMKA 2L4AA 3QPTA 1CF7A 3PO2J 5L3FA 4HV6A 2XPUA 5JR3A 1POGA 2W84A 5H2FC 2W24A 2P6TA 3FDYA 3I4NJ 3GYHX 2DQLA 2A05A 2ZCWA 4FCYA 2QKMB 2A5YB 1DQUA 3TBIA 1D0XA 2XGXA 3BR3A 2VBYA 4UUSB 1SMYF 1MSFC 2R7VA 3RTRA 5IOZA 4HPQA 2K9LA 3CCJI 1B59A 3ZQLA 3ASNH 1RPWA 4X1EA 4I6ZA 1MD0A 2PI0A 4BQAA 1Z1DA 2LG4A 3E5XA 4XKBA 2DAOA 1OQYA 1ZKGA 1IF1A 2VBWA 4PCQA 4CCLA 1ZG1A 2NOJB 4QWQA 4IEJA 3ZMDA 4CCKA 1ETQA 3RQIA 2P81A 2LF8A 4MTEA 3IC7A 2GOMA 2VASA 2WB1A 1P4XA 3K10A 1KZHA 3RCOA 1W1WE 4IZZA 5EEHA 2V9VA 4HEA2 1X3WB 1YLFA 4WXHA 4LD5A 5FKMA 2EV0A 2XKOA 4RBOA 2XC7A 1TP4A 2XSDC 2YX4A 1FOKA 2V6EA 4XIDA 2D1VA 1X1AA 2MD5A 2E1MC 1QO0D 2XRLA 1HOMA 2L54A 3VYTB 3U1DA 1WVRA 1IUYA 4XOPA 3I64A 3DP7A 3GFLA 5E18F 2XAFA 2DMPA 1VNDA 3B02A 2STTA 4HZFA 4IHSA 3UR3C 1R5HA 1WRJA 2ZJ2A 1TC3C 3PL8A 4IKFA 2DFIA 1PUFB 1BM9A 3H3VK 4BQOA 2F5VA 2RREA 3S3NA 3CCMI 1U2WA 3HSEA 1YRNA 1JGSA 4MFDA 3HDDA 5F1JA 5LFAA 2CYYA 3WGHA 3PSIA 2E2JJ 4CCOA 4IF4A 1V5EA 5HOOA 1JKRC 3HHGA 2CQNA 3OIQA 1PJRA 1D1BA 1LDJA 1U5TA 1OPCA 4BNCA 3H9QA 1O7FA 2WY7Q 1G8XA 2MLGA 3HSFA 2EINH 2PQ8A 2ZSIB 4UVBA 3OYLA 2H1KA 3GTOJ 2QLZA 2VKEA 3OYKA 2ISZA 5FKOA 1GHCA 4FE7A 5JVTA 2LTPA 4RGUA 3ERMA 1JUPA 1MBKA 1IN8A 3G73A 2BGCA 4E6KG 1WWXA 2RQPA 3H5AA 4BS9A 2DOEA 4OAZA 2M5WA 1XX5A 1SAUA 3AG1H 2JA2A 1FX7A 4B3XA 4WWCA 3GTPJ 3KX2A 2X0LA 5FKKA 5H6QA 1FOWA 1FT9A 4HF0A 1WI3A 1DP7P 4WF2A 2H09A 1OMIA 3PUBA 3KETA 3MEXA 2MGQA 2KIQA 5KAIC 4C3JJ 1YW9A 3F8MA 2IS4A 2KJBA 2V1NA 1R4MB 1TW3A 4IXAA 2EB7A 3OL3A 1EA3A 3NRVA 3LSIA 2X1CA 1H9TA 1EH7A 3IKVA 5ILUA 5ICEA 2M1BA 3DBRB 4M3GA 3TP0A 1FOYA 4RAGA 1X4PA 2EFPA 3R6SA 1KQ9A 4C2TA 3ASOH 5JLXA 3CUQC 4E7HA 2ME0A 1LDKB 3PNTA 4AUXA 1U3EM 4RB2C 2OUMA 2MBFA 1SAXA 3BPVA 1W7PA 4A3BJ 1I1GA 2VODA 4HF1A 3S17J 1FIAA 2QZ8A 3MKZA 3K1PA 4EJUA 3IL2A 4BHCA 2P8TA 1WSUA 3BG6A 1LFUP 2OA4A 3AL0B 2LBFA 4M3DA 1T33A 4WXCA 5D6EA 4AU7A 2ZSHB 1ETKA 1DP3A 4O3MA 1BI2A 3OV8A 4ZYDA 3SXYA 2L9SA 1G6NA 4ENKA 3FK6A 4ZYAA 4ENNA 5M5YJ 2ZB9A 3F6VA 3CQZJ 4EATA 1LVKA 3BOQA 1FMWA 2PMHA 3HXLA 3CCLI 5J1RA 1WJAA 3MWMA 1IO2A 4HX7A 3A4CA 4G12A 2D2WA 2LC2A 1RESA 3VYRB 1T98A 4HBLA 3E5QA 3QAHA 2MLKA 2KISA 3CDIA 3BJ6A 3QU3A 2GQQA 2EFQA 3PJRA 2CU7A 4NC8A 3G71I 3IRRA 1S7AA 4Q4ZF 1VQPI 2CSOA 4H4KC 2VONA 3KP7A 3FZVA 3TL4X 1MKMA 2K5CA 4FE4A 3FIWA 5BOXA 1XS9A 1N78A 5E79C 4NHJA 1HKSA 1MBGA 3JRCA 5AIQA 1HSJA 1A35A 2VOPA 2EZIA 1FP2A 1GXQA 2LKSA 3CDLA 4YIFA 2E34A 3GEZA 1FEXA 2RNJA 3UNGC 4R8HA 4YFXF 1PDNC 4RB3C 1FYMA 5EF6A 2L01A 4IHTA 3OYFA 4HSRA 4JK1X 1D5YA 5LEKA 1K61A 4L9NA 3I54A 2EBIA 2R7OA 3OMYA 3WTSC 1XSXA 2B9SA 3CO7C 3FXKA 2L7KA 3BY6A 5KNLA 1OFCX 1W0TA 1XSDA 5IP7J 2L5QA 5D4SA 2COMA 4M6VA 4CDGA 3M07A 4OU0A 5IY5H 1P92A 4JBAA 2JVHA 1MBFA 1TBXA 5F0HA 2DFHA 2FSWA 2JSCA 5HDGA 2DMQA 1VQOI 4Y7NJ 1MNEA 1TT5B 3LNQA 2GIZA 4EEFG 4IO9F 2R3SA 3MKWB 3GLLA 3H35A 3RYRA 2K4BA 4CYCB 4HLXA 2KJCA 1LQ1A 1APLC 1H89C 1M1EB 3LQQA 3V4GA 2DA3A 2FE3A 4RGSA 4GYIA 1GVJA 4ASNA 1LFBA 4I01A 3O6BB 5FO5A 3X2QH 3W6VA 3F6OA 2KIUA 4ZZDA 3F8CA 1EH6A 3O8GA 1Y0NA 3QU6A 5F1RA 1ITYA 1WCMJ 3A0BC 1D8KA 1X2MA 1LDDA 3DEWA 5K7ZA 1ERDA 3KP2A 4OIPF 4W1UA 4PSWA 1JKQC 3BJAA 2PX9A 5GAGJ 3I56I 1HW1A 4Y15A 3GCMA 2I8DA 2EV5A 4UUTA 5E1WA 3K70C 4M3EA 3Q0UA 3WU2C 4LIUA 4N4NB 2PN6A 4G6DA 2Y69H 3D0SA 3HOWJ 4XQFA 3Q9VA 1P4AA 4HQEA 2VPLA 2AHQA 3BR5A 4J01A 1A36A 3OYEA 4L5EA 3VDXA 1IDYA 3LSKA 3SQNA 1S7EA 2Z9OA 2QUFA 2AQEA 1Y8RB 3WU1B 4Q48A 1YI2I 4Y3OA 4D5FA 2BE5F 4QIWN 1U9NA 2F6CA 1QPIA 3WE2A 2VUMJ 1O3RA 4A69C 1GUUA 2QF7A 1ZREA 3TW6A 1UCRA 4PJ0C 5CKTA 5BPDA 1SC7A 3CMMA 5LGTA 3ZMUA 1AKHB 3BZKA 5CPRB 3AG3H 3B6AA 2LLKA 2R7WA 4LB5A 2XSJC 2L9RA 2E36A 3TQNA 3M4OJ 2DYRH 1JE8A 3TEDA 2LOOA 2IVMA 3EUKL 5HDNA 3OYHA 1D0YA 1EJ9A 4XICA 1OYIA 3FXUA 1FLIA 4IHVA 3G1MA 1A6QA 1KYZA 1Z05A 1X3ZB 2M7BA 2DODA 4JQFA 2LRDA 1ZAOA 3L2RA 3K1NA 2GXBA 3M1EA 3J81K 3CP8A 4KT5C 4PJNA 4II3A 1JXSA 3JRGA 3FM5A 1DUXC 4HLYA 4AYBA 1K78B 1YS7A 2WAFA 3J81Z 1QU3A 2HVQA 2A07F 4I0BA 2E1CA 4QSHA 4J00A 2WC2A 1NK3P 3BG5A 4QTRA 4D1QA 1VTNC 4UXNA 1JHHA 3SEQA 2E1NA 3HUGB 3JTGA 4ZDOA 2FD5A 2EIMH 3WGGA 4U7BA 2HZTA 2MA3A 3ECOA 4C3HJ 3DV8A 2DJIA 1XN7A 1G59A 4D7MA 2QSFX 3VFZA 1JT0A 3CF5F 2XV4S 4IOCF 3BC8A 1R5ID 2DYSH 4CCNA 4AC0A 2EA4A 3W2VA 1FTTA 4ZC3A 1LE8A 1EF4A 4E7IA 3KYDB 1ONVA 3K4CA 3RKXA 2Q2EA 2VJJA 2A69F 4IHYA 2FXAA 5DM7F 1FTZA 3KPHA 4NUBA 3KLNA 2H8RA 3OYGA 4EGYA 1LUJB 2EA2A 2VQCA 1DDNA 3S32A 5ILSA 4BHPA 3EQLF 2VE8A 2FF4A 2VOOA 1N25A 2DMTA 1X4OA 2Y9ZA 1G3WA 3QPLA 3IUOA 2O5RA 3CCEI 4XRFA 3L2CA 2VBZA 1VF9A 1SFOJ 1B72B 1A04A 2DCEA 1S7OA 2LH9A 1XGSA 1ZR4A 4A93J 4MGRA 2QYOA 1V5GA 2XUBA 1IN4A 5K1YA 2P5LC 5CVUA 1FMVA 4NQWA 1E3HA 3GZNB 3OR2C 2IS2A 2DA6A 3ZQCA 1MW7A 3SYTA 4F93B 5ICFA 4FASD 1R58A 2R7SA 5J8CA 1U0JA 3SHFA 2DO7A 2ZXIA 3E7LA 5HNHA 3KP4A 1YITI 4EM1A 1U78A 2FOKA 4UV8A 3RDIA 2P5KA 1XGNA 4IRIA 4N4OB 5HLHA 4X6AJ 3TKYA 2BVMA 2PFBA 2MH2A 3BG3A 1XB4A 3REOA 2WBMA 2BVLA 2V1DA 5GPCA 3MQ0A 1TL8A 2LY9A 1BJAA 1WPKA 5EGOA 1O3TA 2HGCA 1F1ZA 1WFXA 2JUCA 2P6SA 2F4OB 4FT8A 3TW7A 5FJ8J 2R7TA 4XOTA 3VEPA 4RLFA 3TOBA 2BY3A 3SDGA 3D5RC 1V55H 3OR1C 2ZXHA 2XHKA 3HRMA 2CG4A 3E6BA 4F7ZA 4UB6C 4BAYA 4YIRX 2HKOA 9ANTA 4Y13A 4GCVA 2X85A 3HC7A 2FMLA 2F4IA 2W57A 4D9JA 4HNTA 3K0LA 3J80K 3A2KA 4N0BA 4DIQA 2HFHA 1TT0A 4BE0A 3BZ6A 4A5MA 1KU2A 3HB9A 3HTSB 3GBGA 2M87A 4MQVA 3J80Z 1OISA 3LA7A 3KYCB 3JRBA 3SFIA 4OWRB 2OU2A 3M8EA 5HDKA 4LGWA 3EUHA 3S8PA 3ZP5A 2GZWA 2PG4A 4U0VA 2FNAA 4LLLA 1BL0A 1G2HA 1UAAA 2Z1DA 1ZTRA 1R1UA 5BQTA 3BTLA 1FOXA 2L02A 2R5ZB 4I2OA 1B9NA 3AG4H 4HX8A 2PMZA 2V1XA 3G3ZA 3OIPA 3Q3SA 4MLOA 6PAXA 2W82A 1WH7A 3S2WA 2M34A 2VJ5A 2A6TA 2R7QA 2ZMEA 2H6BA 2RNGA 2WAQA 2JA6J 3GTLJ 2BZTA 1S3JA 2DQRA 3SEZA 2LMDA 4DW6A 2BY1A 1B8IB 5GTHC 2K3PA 4B09A 5FGMA 1K7AA 3R60A 5DS9A 4AIDA 3A01B 4CGZA 3RKQA 3FXMA 5F64A 2HVRA 1O3SA 1E0EA 5E1ZB 2KIFA 2MABA 4JX5A 2GA2A 2MH9A 1GV5A 3R61A 3O2PE 3DEUA 3DLLF 2Z99A 2CV2A 5JVGF 2ACJA 2NOGA 2CUZA 2EIJH 4N9IA 2O8KA 3A1YA 2Y0SA 1GLNA 4AIJA 1R5GA 1W5SA 1T0FA 4M3BA 1AA7A 1YQAA 5KK1A 4E7KA 3KLOA 3MCZA 4A3CJ 2A61A 3P5JA 2CS3A 1RZ4A 5E20A 5EDNA 3HGGA 2K85A 2BW3A 3N05A 2WA0A 3OYBA 2E1MB 2D45A 1ZARA 4G7OF 3JTHA 2JTVA 1MMAA 2AXTC 2VXZA 3PNVA 3OWTA 2IA0A 2VJIA 4AM3A 2E2IJ 2PJPA 3K9TA 3GTQJ 1YS6A 3OYNA 5D5UB 4DBQA 2Q8KA 2EWNA 3IP4B 2O0YA 1T2KA 2XB5A 3HPHA 1U6GA 2HPIA 4CA0A 2M4KA 1VQNI 3DPLC 5EZHA 2HWVA 2JT1A 4PDKA 2DTRA 4EM2A 2KZVA 1VFCA 1MMNA 4BYYA 5M3MJ 2DMNA 1QZZA 5TRDA 3CDHA 1Y1VJ 5GADJ 2A6EF 2Z16A 3ZR8X 3BP8A 2NS0A 3P7NA 2H8WA 5F0CA 4U7DA 1R1VA 2Q0OA 2X6WA 4CHUA 1YJ9I 1XSVA 5DDGA 2QBYA 2XDVA 4MNUA 3S15J 4LIVA 2P5VA 2FU4A 1SVMA 2TCTA 3W2AA 4GRIA 2PJRB 4EVIA 2KDOA 2GBYA 2OBPA 4XRSA 2VT2A 3LL7A 1Z91A 2V79A 2Z3YA 3GZ5A 1YFHA 4DGWB 3K4KA 2ELHA 4KT6A 2ADUA 2XF7A 1FBUA 2IGOA 1K6OA 1X19A 4B3AA 2LYCA 1IJWC 1BW6A 4PJLA 2LK2A 3LMMA 2ZNZA 3SZGA 3I4PA 1YO5C 4A3IJ 5FLXK 2HI3A 1I27A 3OS2A 3PQKA 3H0DA 5E3LA 1W36C 4EJVA 3RQ4A 3K1MA 4KNYA 3F8FA 3BR2A 2CQKA 3C3WA 1F5TA 1GDTA 2LVSA 5JLWA 4OIQF 5FLXZ 3VOEA 2XASA 3H9GA 4EQQA 5E3NA 1X2NA 2MG4A 4A5NA 3NQOA 2LNBA 4K2EA 3QOPA 2R0QC 1Z21A 3H1CA 1VQ6I 3L9FA 2Z5UA 3DFGA 2MFZA 2DTZA 3CUQB 3ML6A 3HOZJ 1J9IA 2G0EA 1REPC 5IPAA 4BE1A 5LEJA 1ETOA 2R5YB 1IAWA 5C3EJ 4I76A 1R4NB 5DCMA 5GPAA 4XLAA 4MO7A 4OAYA 1ETVA 1EV7A 2F4MB 5FD6A 2HYJA 1SD4A 3KZIC 1LJ9A 2XGEA 2K9SA 2QCOA 2WY8Q 2Z2SB 3HTUA 1MBEA 3ZOBA 3FBIB 1FBQA 3BLYA 3JCUC 2KDZA 3OSGA 2UUZA 4S0HB 1CQTA 2LKXA 2M9HA 5DUIA 2W4SA 4MEYF 2JA5J 2X6YA 2WV0A 4JX4A 2M3AA 4RB1A 1OCZH 3FF5A 1J2XA 1T08B 1WGXA 1BW5A 3IH4A 3BROA 1RR8C 3D5SC 4PJMA 3UKGA 3CD6I 3CC2I 1HSTA 1ON2A 2DT7B 2HTJA 5DD8A 3RKYA 3ZQGA 5IT9K 2NAZA 2XAUA 2NXNB 1ZG5A 2QWWA 1YRNB 3PIPF 3HRUA 4HV5A 2NRAC 2HOSA 2VN2A 3DQVC 3EUAA 3M8FA 4E7SA 1ZLKA 4FQGA 2FEZA 3CUOA 3OIOA 3F72A 2OZ6A 4NB5A 2QQ8A 1WI9A 5IT9Z 1BR2A 2VT3A 5DCFA 5ILVA 1RKTA 3RYPA 2M4GA 4BGDA 3KZYA 2Y31A 4IHWA 4C30A 1BR1A 1OYWA 2O9LA 4KYWA 2K40A 1DGWY 2G9WA 4HOBA 1IXCA 1Z0XA 3D1NI 4XKVA 1I6HJ 3KP5A 4NDLA 3LSPA 4P1WA 1ZR2A 1FSHA 1T8IA 5FFZA 2X48A 4N9HA 5DV5A 1HQCA 1XTAA 3MVPA 1A5JA 3SJMA 3JRIA 1Z3XA 4ZJZA 2R7DA 1IDZA 1W4MA 4PFOA 4W97A 1A31A 5J8FA 3TO9A 3CCSI 4D7NA 4S04A 1MDMA 4DYCA 4XSXF 1VQKI 1G3TA 3K2ZA 2BBYA 4XN3A 3F21A 2CV0A 1KU9A 2PEXA 2NVTJ 3TOAA 3I59B 1R7JA 4XORA 4UNOA 5EG0A 2K02A 4A12A 4II2A 2HYGD 3U9GA 1XPXA 3FM3A 1QGPA 3DLAA 2FQ3A 1BJZA 4IPAA 3TGNA 3HPGA 3Q0WA 1BOAA 5LHGA 4EGZA 1RI7A 1MIJA 3B6CA 4L9VA 3BT9A 2L7MP 2P0WA 2PMZN 2ZO4A 4OINF 5C4XJ 3BZCA 4RS8A 5IOYA 2FA5A 1FP1D 3JW4A 3AKZA 1MNDA 1LKXA 2OQRA 4XLFA 3K4LA 2KRHA 5BMZA 2O03A 1USSA 4LB6B 4BE2A 1BBYA 5LLQA 5FLVA 4PUSA 1W7PB 4HQMA 2GXGA 2WWYA 1SFXA 4B44A 4IJAA 1FZPB 3K4MA 3S2HJ 1NH3A 1X1CA 4BY7J 4A3KJ 2XKPA 5GAEJ 1HKQA 3JAMK 5JFRA 1TZLA 5BNGA 5FD5A 5ICGA 1D0ZA 2HQAA 4KN4X 4KA4A 3F8BA 4CO8A 1JUSA 3OYDA 1YOVB 2XAGA 3MMYB 1U5TC 3HM5A 4B4CA 3CJRB 3JAMZ 2QQ9A 5H20A 1RUOA 4B1RA 3E6DA 1YHQI 3K7AJ 4A3EJ 1IRFA 1FC3A 3WTTC 1I3AA 2ID6A 2ISYA 2XIGA 2CFXA 2K9QA 3AG2H 4MQ9F 1ETYA 4NC6A 4DOZA 1D5VA 1MJBA 1R9TJ 4G9YA 1TTYA 2OAZA 4XBFA 2E5ZA 3I5UA 5HNFA 3CF2A 1X58A 3L7WA 1BI3A 1WHUA 3WTVC 4R79A 1UHSA 2F5FA 5TGTA 4UB8C 3HOTA 5KVRA 1J09A 3U2RA 3I4MJ 3FXOA 5CYVA 4CYCA 4HG2A 4EJWA 2EK5A 4IQ4A 5ERIA 3QYBA 1EH8A 2F5CA 3GWZA 4PGHA 1WJFA 2RVCA 4Z6YA 1HDDC 5HS7A 2I5UA 3OS0A 3S1NJ 5D5XB 2DA5A 5LHIA 3CJNA 2JJ7A 4F52A 3A02A 4AD9A 4FTHA 1I50J 1W5TA 1T95A 2VBXA 3VB2A 3P9IA 4FX0A 2F48A 2H6CA 5KHDA 2XPWA 2YUSA 4B8XA 4V2FA 1OCOH 3HOUJ 1ON1A 3FKIJ 3TDZC 2HQNA 3KP6A 5C44J 2JVGA 1UG0A 2RGVA 5FRMA 2X1EA 3COAC 1KYWA 5J4VA 1SD6A 1HF0A 2XF5A 5LRSA 1HXDA 5AIPA 1V4RA 2CFOA 3DU6A 1I5ZA 3NWSA 2MYSA 4XRMA 1P7IA 4X0GA 1MBJA 3S1MJ 3K2AA 3BTJA 2VPRA 5IYBJ 1BA5A 2ELJA 2LP0A 2GWRA 3I71A 2XRNA 4LOCA 4MTDA 4XRSG 2RC4A 4BDYA 2WB1N 3RJPA 3DCFA 2XPVA 3H92A 3DXJF 3L1PA 4ITVA 2JRTA 4XLCA 3KE2A 3S14J 3DPUA 2LF7A 1VQ5I 3E1SA 1Z9CA 2R4GA 3EETA 4KIBA 2XAHA 4B47A 4FISA 4KN7X 3ZCOA 1AOYA 3L2QA 1WH5A 4PFPA 2VC0A 1IW7F 4CZCA 2EZLA 1QVUA 2ZC2A 3DF8A 4E7JA 5HS9A 2W25A 2V9KA 3BR6A 3FMRA 2O61A 4HRIA 3C1DA 1TQPA 3WE3A 2ICWG 4QPOA 4IX7A 1D3YA 2DA1A 5HLGA 3A0HC 5J1UA 5CJ9A 1Z7UA 3ZGKA 3EDPA 3ZQHA 1O7LA 2ZFUA 4A3LJ 3M9AA 4M71A 2CMPA 3WHBA 4UVAA 4JYKA 2MC4A 3SDBA 1UJ8A 1V5FA 1R23A 2FX0A 4FHTA 4I98B 4OIOF 3J7ZI 1IC8A 1QHHD 2L7ZA 1OR7A 2XB0X 4WX9A 3LFKA 1OCCH 3H3ZA 4XLNF 4LG0B 2IXSA 4BQNA 4A2UA 3AAFA 4MEXF 3MKLA 3HUGA 1VQ4I 3FHZA 1SVLA 2HOEA 2K9NA 2WAEA 3I0TA 4MIMA 3IHUA 2BV6A 1ZQ3P 1L3LA 1ACIA 4KDPA 3P9CA 5GP9A 3BR0A 3CLOA 1WQ2A 4DYRA 4HDVA 1VQMI 1IRZA 2F5DA 3L2UA 3MAJA 3QWLA 1Y1WJ 3GUDA 2JUGA 2UXNA 3SZPA 5HS8A 4BU2A 4L9TA 4IRHA 3W6JB 5E17F 3KZZA 1V54H 4XNFA 1B1BA 5KCMA 5IP6A 1WJDA 2Z33A 3T5XA 1LEAA 1B9MA 2XAJA 1UB9A 3G1LA 3K4JA 4R1HA 2IW5A 4A3DJ 4YG2F 5FLMJ 1JTYA 4G6QA 1B6AA 3ABLH 3ZMZA 4JX6A 1S8NA 2YU3A 3KEOA 3IWZA 4M9SA 1D1AA 3RZDJ 1QHGA 3W6KB 5E3MA 4M74A 5LHHA 1Q1VA 2YR2A 2KT0A 3V8JA 4KISA 1H8AC 2CRGA 5BS6A 1UELB 2H1LA 2ZXWH 2EZHA 1T38A 1FIPA 4WXDA 3MZYA 2ESHA 3PM1A 2M7AA 1QRYA 4UVCA 1HKTA 1LE8B 3HSRA 4HA8A 4KIGA 3FXQA 3PQJA 3R4KA 4ETSA 4UUVA 2QENA 2R7XA 4P5OA 2Q2EB 2KPMA 2IP2A 4L5IA 1U9OA 1SANA 2DXIA 3E5UA 4U87A 4B48A 3HOSA 1J75A 2WV1A 1WKMA 4AWXB 2LR8A 2QGUA 2DMUA 2L9NA 4CUGA 1O4XA 1SD5A 5CVVA 1MSEC 2JK3A 2OPTA 1BIAA 2COBA 2KP6A 2CUJA 2XROA 2UV1A 2JPCA 3LSMA 3QYFA 2VIXA 5LRRA 2DDBA 4XMYA 2R7ZJ 1MGTA 2O8XA 2CQXA 4YELA 3N97A 2B0LA 4E7LA 1KONA 2DA4A 4A3GJ 1OCRH 4CZZA 3K69A 3WTXC 5CQEA 5JHUA 3JSPA 1IG7A 5IYDJ 2XAQA 3WTZA 1G4DA 4RB0A 3GTKJ 4ANJA 2HKXA 2Y2ZA 4LJZF 1R49A 2P7VB 4I0AA 3W3CA 4RM2A 2VKVA 3B73A 3ZMSA 1W7PD 1V3FA 1VZ0A 2LFBA 1YG2A 4G94A 1IV6A 3T8TA 2E35A 2VXDA 1ORKA 3G1OA 2WADA 4DYQA 4GYGA 4NBQA 1F4KA 5IP9J 4RM3A 4CH7A 1OLTA 4ZDPA 2MC3A 1T6SA 3K70D 3LA2A 2LY1A 3JRHA 4XKWA 4M9ZA 2HXOA 4QLCU 5EGOB 2JA7J 2DBBA 4XONA 2JA8J 5FRNA 4YRVA 5KAFC 2M2EA 1HLVA 1BI0A 3HKZA 3C2BA 5DD4A 3J7AO 2R5ZA 1B4AA 1BN5A 2JWTA 1TWCJ 3CMYA 1VQ9I 2Y75A 3E6CC 2X6XA 1ZGAA 4CICA 2X9DA 1YYVA 4EM0B 2OJED 5K5OA 4IHXA 2CJJA 4GXOA 5M5WJ 4IOAF 2D5VA 3IKTA 1KU7A 4D0PA 2E7XA 1XGOA 1T56A 2GAUA 3C7JA 4CCJA 3J7YJ 2HTSA 1Y0UA 1QVTA 4PSXA 3A01A 4IVNA 2UWMA 3ULQB 1R6RA 5JI6A 1I6XA 3KYLA 1ZHFA 3HEFA 1XCBA 1P7JA 5A2QK 1STZA 2CH0A 3FKJA 3ECHA 4IL6C 3Q5FA 3FMSA 1AU7A 1OYYA 1PP7U 4BEHB 3LOCA 3JSOA 3EYIA 2HOTA 3IV5A 2AXLA 3OOUA 2A3SA 1G3YA 2KRCA 3PNYA 1SMTA 2HYFA 1TLHB 1MZBA 2IGKA 5B5EC 1FBSA 3S3OA 4M6YA 1LNWA 4LK1F 5A2QZ 2VE9A 2LSOA 1XGMA 2ZMEB 3ZXSA 2GOXB 3I58A 3L09A 3CLQA 5EZGA 3FXLA 3IAM2 4RA2A 1SFEA 2EZKA 4I09A 1NG6A 1KQ8A 1ZRFA 3RIRA 2HS5A 1L0OC 4Z2YA 1BOBA 5K5QA 4ENMA 1PYVA 4KIFA 2GA1A 3V7CA 4BL0B 2W1OA 5D5WB 1OCPA 3FBNB 2OQGA 2YS9A 1NG7A 1E3PA 1QZYA 1LVAA 4Y33A 5FB2A 1YX5A 1LB2A 1IGNA 3ZQ7A 4RAFA 3JREA 3G2BA 5L3EA 3DKXA 2OCCH 5L3GA 3BG9A 4EV0A 1Y8QB 1UFMA 1Z77A 4UV9A 1C0WA 3CMAI 4XLPF 2CUEA 3ZMTA 1I39A 3CESA 2DA7A 3HG9A 4UUSA 3VODA 1UG2A 2CUFA 1K4TA 2BW3B 3IAS2 3ABTA 1RIOH 3BTCA 4LFUA 2H27A 3AFHA 2PJRA 1WJCA 1FY7A 5J3LA 1USTA 1QZEA 3RZOJ 1X1BA 3EUHC 3ISPA 4RAZA 2V9PA 2LKPA 1ZGWA 4ZYGA 1CF7B 4AYBN 1YTYA 2NVYJ 4G6TB 4I99C 2IJLA 1G3SA 4IRGA 1RNLA 1RR7A 4M72A 2KMUA 1RKWA 2NYXA 3ABUA 3IH3A 3RPUD 3CCUI 2VLAA 3ZMVA 5IYCJ 3GZ6A 3M1CA 3ELKA 1TQMA 4ESFA 2V26A 2ZMEC 4J19A 1F43A 3HZJA 5E8GA 1W5CC 2GLOA 4AVPA 4BBRJ 3R0JA 5HODA 2E60A 1OCTC 3NEUA 2QBYB 1YX3A 4B43A 1O57A 3CMEI 5K7FA 1MMDA 2EIKH 2PLYA 4BXXJ 4XSZF 3K4NA 5CQGA 2HR3A 4EJOA 3QPHA 3CUQA 3CCYA 3HHHA 3M3YJ 3LFUA 1IUFA 2DU9A 4L18B 3O8HA 1PUFA 2K27A 2R5YA 2ZJRF 4ZH4F 5H6RA 4H0EA 1MBHA 1JJ6C 2V1UA 2E7WA 1ETWA 4BBSJ 1OKRA 3GFMA 5FKNA 3HRTA 2GIVA 3JRDA 3S93A 1FSEA 3CP2A 2E5NA 2QQBA 2K3FA 1T0FC 3F0CA 3OL4A 3GTMJ 2AO9A 3JR9A 5J1YA 2CW0F 2ZKZA 4BJ5C 2DFFA 1I3QJ 1BI1A 2I10A 2F2EA 5E3OA 4E4HA 3PIOF 4KJZA 3IH2A 4HX4A 3U21A 3L2VA 3CO6C 4ZDLA 4A3MJ 3KP3A 1K6YA 2XGDA 3GMEA 3KEYA 2DOAA 1UMQA 2JSPA 3F22A 3MFKA 3TMOA 5L3BA 1E2XA 5HVQC 2HZDA 3O3KA 2P4WA 3MZ8A 4S05A 1JKPC 3WG7H 1VQ7I 2ID3A 3QP5A 1YIJI 5DCMB 1Z67A 1OJLA 2ECCA 3WHCA 5DM6F 4EJTA 2QVOA 3WODF 3MZHA 2M0CA 3LWFA 2IAIA 5LGUA 3FISA 2KFDA 1DGRM 2EV6A 2IGNA 2NVUB 2VQGA 2DFEA 3LSGA 2RV8A 1U5TB 2YPRA 2VJ4A 2ZJQF 1H0MA 2CW7A 5F6FA 5L3CA 2Y48A 1YJWI 5EEGA 4BH9A 4ESBA 2DJNA 5GTIC 2E19A 2VL8A 4ON0A 3H5NA 4Q47A 5FROA 3V7SA 2K4JA 1P4WA 3I9V2 2W7NA 4UY8I 3I53A 4EMSA 3DKYA 1ZYRF 1SFKA 2KKOA 3CZ6A 3WTYC 4BQQA 1E17A 4BACA 3GO5A 3I59A 1R22A 2ME6A 2QM3A 4HSTA 2IRFG 4CYDA 3DTKA 2V4JC 3IRQA 2BOLA 2IPQX 3NWTA 3GXOA 3HKZN 5LBQA 2QQAA 2OZUA 4XL9A 5DUKA 2A68F 4BUPA 3J7AY 2BXZA 4Q5SF 4AIHA 2JN6A 4M3FA 2UZKA 2DW4A 3ZQIA 2DK5A 3R0AA 3KCCA 2K7LA 3DBLB 1RRJA 1FYLA 3HJEA 2FMYA 1H9GA 2X51A 2R7RA 5B1BH 3LSJA 1R00A 2RAEA 1TNTA 5F04A 3V8LA 2NS7A 3S16J 1XMAA 1MDMB 1YIOA 2WAQN 1ZK8A 3ABMH 2EQRA 2W85A 4GGGA 1VQLI 1ZN2A 1GXPA 2VQLA 3TP3A 4A0ZA 1XDUA 1W0UA 2YU9J 1ODDA 1HC8A 5EG0B 5B66C 1MMSA 1ULYA 5EYRA 3ZRGA 4RMNA 3ZQQA 2GXAA 2LBFB 4A0XA 4HNVA 3PO3J 1LEBA 3VSLA 2EPFA 2G7HA 2HDCA 2ZFWA 5D4RA 2HU9A 3DBHB 2FNPA 3H9JA 1MMGA 1P6RA 1TWAJ 3MD2A 2NVXJ 2ELKA 3GX4X 4CCMA 4U88A 1J0RA 1QBJA 3WG9A 2KZGA 1RUNA 1UZCA 5B1AH 4Y52J 2DDAA 5DTDA 5K7HA 5E8IA 5C4JJ 2Y0SN 1P2FA 1YW8A 4OMZA 3TDUC 3OYCA 4BHBA 1Y39A 4XKCA 2OV7A 3DWLE 1GT0C 3GVAA 2BY2A 2Y0MA 5J4YA 3GTJJ 3HIFA 2R92J 2DOFA 3HOVJ 1K79A 4HF2A 1KA8A 3BCBA 2Y30A 3L00A 1HBXG 4Y4RA 3ZPLA 4RLQA 2AS5F 5JHFA 2DPDA 1DU0A 4GDFA 2OCEA 2JQ7A 3QQAA 4WCGA 3C18A 4DZJA 2KIMA 1W36D 2QEXI 4HW0A 1RC9A 4PGGA 2EILH 3DKWA 1K4SA 3LSTA 2HPMA 1J7KA 3LSRA 4MFEA 1N77A 2HXIA 4C3IJ 2IA1A 2BXYA 4G8XA 2JMWA 3CJQB 4E70A 2M8EA 3S2DJ 3LA3A 5DYMA 2XF6A 3BQZA 1JJ8C 3HOXJ 3GFJA 3DEEA 5GAHJ 2CV1A 3CJTB 2IT0A 5F0FA 1NHAA 1A6IA 1UHWA 2HQRA 1PUEE 3VWBA 4L0YB 2L3DA 4TV7A 5D5VB 3FWEA 4I7HA 5D8LB 3WTUC 1XG1A 3AL0C 1WJBA 1JUMA 4PZJA 3CCRI 2ZXJA 3GLXA 1IN6A 1D8JA 2O6GE 2G7UA 5J6XA 2CGPA 2X1DA 2A6HF 2VI6A 2BY0A 4XN0A 1BIBA 1DPRA 4U0YA 2HDDA 3OYMA 1TWHJ 3LAJA 3BCAA 5K5RA 3CC7I
chains in the Genus database with same CATH topology
2FBIA 4P96A 4LLGF 5D8KB 4ZYEA 2CO5A 4KICA 3TO7A 3RI4A 1KQ0A 1J5YA 3E97A 3BJOA 2DPUA 4L5JA 2RKHA 1XDSA 1R1TA 2BEOA 3T1BA 3BPXA 2PMUA 3CTAA 2VC1A 4UHTA 4L0ZB 2FBHA 2O3FA 1IRGA 4M73A 3Q9SA 4M6XA 4KMUX 3RPUA 5E1XA 4KUMA 1S6LA 2FRHA 3H3UA 5IT3A 4YIIA 2J5PA 4A6DA 1QNTA 1K78A 4LG0A 1FNNA 4M9XA 1ZLJA 1ZRCA 5BPIA 1TQIA 1QQIA 1O3QA 2DLLA 2WTEA 1T39A 1QPMA 1FYKA 3D5LA 2K86A 2L4MA 2NNYA 3E6MA 1Q1HA 3N4MA 3RPQA 2H94A 3LAPA 2D1HA 5LGNA 1PP8F 3KFWX 5ICCA 2BYVE 3PFIA 2EJRA 1XD7A 1JHFA 1BC8C 3QP6A 4AIKA 5CVJA 2IA2A 1UHMA 1FWZA 2ZNYA 4HDUA 4FX4A 3FX3A 3GW2A 1CGPA 4P9UA 2XVCA 4OOIA 4I02A 2OD5A 1IN5A 3V7RA 5FFXA 1ZRDA 4DNCA 3DPTA 4ZYHA 4OIRF 3BWGA 2YX7A 1SFUA 3T0YA 3IWFA 2EFOA 5ED4A 4HYEA 3M7GA 2CWEA 4RAYA 3E3VA 2TDXA 3P9KA 4ENJA 4ESJA 2PBIA 1MJ9A 1IZ1A 1DPUA 2DI3A 3F23A 4U0WA 2JPBA 1Z6TA 3QRFF 2M30A 4O5VA 3F8NA 1R36A 2X4HA 1IXRC 3F3XA 5D6FA 3EYYA 2JZYA 3ZN0A 4BXUA 4A0YA 3WGIA 1SD7A 4L9JA 5AONA 2J5OA 2DK8A 5DEQA 3HRSA 1Z6RA 4RGXA 2EFWA 4YFKF 4G7HF 3ZN1A 3OOPA 1J59A 3GFIA 3SZTA 2NNNA 3GF2A 2FBKA 1XCVA 4ZZLA 3RKWA 1ZG3A 1FPQA 2F5EA 1HW2A 1IN7A 2ESNA 4MHGA 1BC7C 2LDUA 2V6CA 1KGSA 2UXXA 4DQ2A 4CXFA 2EFNA 4O6JA 2M45A 3FXRA 4KFCA 3KEQA 1IXSB 4RGRA 4LMYA 3LQRA 4GO1A 1ZH5A 4G7ZF 3HYIA 3SFZA 2HEOA 3WU0A 4WK8F 1F9NA 1U8RA 4P55A 3BDDA 2DT5A 2RDPA 2RN7A 4Y17A 1S29A 5HLIA 3ERED 1MJAA 1I1SA 1AWCA 3TO6A 3WTWC 4KMFA 1TW2A 2KRFA 1X3UA 3T8RA 3V8KA 1HW5A 5CVRA 2ZBKA 1YW7A 4YFNF 5L3DA 3ROUA 4P9FA 3FMQA 2YSRA 1TNSA 5CLSA 2STWA 4LK0F 5TJJA 4LLNA 4OMYA 2P7CB 1ZGJA 4A6EA 1KU3A 2C6YA 2ETHA 4HAMA 5CVIA 2R7FA 1XMKA 2L4AA 3QPTA 1CF7A 5L3FA 4HV6A 5JR3A 2W84A 2W24A 2P6TA 3GYHX 2DQLA 2ZCWA 2A5YB 2XGXA 2VBYA 1SMYF 3RTRA 1B59A 4BQAA 1MD0A 2PI0A 1Z1DA 3E5XA 2DAOA 1IF1A 2VBWA 4PCQA 1ZG1A 4QWQA 3ZMDA 2LF8A 4MTEA 3IC7A 1P4XA 5EEHA 2V9VA 1YLFA 4WXHA 4LD5A 2EV0A 2XKOA 2YX4A 1FOKA 2D1VA 2MD5A 1QO0D 2L54A 3U1DA 1IUYA 3I64A 3DP7A 3GFLA 5E18F 2XAFA 2STTA 3B02A 4HZFA 4IHSA 1R5HA 1WRJA 2ZJ2A 2DFIA 1BM9A 1U2WA 3HSEA 1JGSA 2CYYA 3WGHA 4IF4A 5HOOA 3HHGA 1U5TA 1LDJA 1OPCA 4BNCA 1O7FA 4UVBA 3HSFA 2MLGA 2PQ8A 1GHCA 2QLZA 2ISZA 5JVTA 4RGUA 1IN8A 3G73A 2BGCA 1WWXA 2RQPA 2M5WA 1FX7A 4WWCA 2X0LA 5H6QA 1FT9A 4HF0A 1DP7P 4WF2A 2H09A 1OMIA 3KETA 3MEXA 1YW9A 3F8MA 2KJBA 1TW3A 4IXAA 2EB7A 3NRVA 1H9TA 1EH7A 3IKVA 5ILUA 5ICEA 2M1BA 2EFPA 3R6SA 1KQ9A 3CUQC 1LDKB 1U3EM 4RB2C 2MBFA 1SAXA 3BPVA 1W7PA 1I1GA 2VODA 4HF1A 2QZ8A 3K1PA 4EJUA 3IL2A 4BHCA 2P8TA 1WSUA 2OA4A 4WXCA 5D6EA 4O3MA 1BI2A 3OV8A 4ZYDA 3SXYA 1G6NA 4ENKA 4ENNA 3F6VA 3BOQA 2PMHA 3MWMA 4HX7A 2D2WA 1T98A 4HBLA 3E5QA 3QAHA 2MLKA 3BJ6A 3QU3A 2GQQA 2EFQA 3IRRA 1S7AA 4Q4ZF 2CSOA 2VONA 3KP7A 3FZVA 1MKMA 5BOXA 4NHJA 1HKSA 5AIQA 1HSJA 2VOPA 1FP2A 1GXQA 4YIFA 3GEZA 2RNJA 4R8HA 4YFXF 1PDNC 4RB3C 1FYMA 2L01A 4IHTA 4JK1X 5LEKA 4L9NA 3I54A 3WTSC 1XSXA 3CO7C 3BY6A 1XSDA 5D4SA 2COMA 4CDGA 4OU0A 1P92A 4JBAA 1TBXA 2FSWA 5HDGA 2JSCA 2R3SA 3RYRA 2K4BA 4HLXA 2KJCA 1LQ1A 3LQQA 3V4GA 2FE3A 4RGSA 4GYIA 1GVJA 4ASNA 4I01A 3O6BB 5FO5A 3F6OA 2KIUA 4ZZDA 3F8CA 1EH6A 3QU6A 5F1RA 1D8KA 1LDDA 3KP2A 4OIPF 3BJAA 1HW1A 4Y15A 2EV5A 5E1WA 2PN6A 4G6DA 3D0SA 3Q9VA 1P4AA 4HQEA 3SQNA 2Z9OA 2QUFA 3WU1B 4Q48A 2BE5F 3WE2A 1O3RA 1ZREA 1UCRA 5BPDA 5LGTA 3ZMUA 4LB5A 3TQNA 1JE8A 2IVMA 5HDNA 1OYIA 3FXUA 1FLIA 1KYZA 1Z05A 4JQFA 1ZAOA 3K1NA 2GXBA 3M1EA 3J81K 4KT5C 1JXSA 3FM5A 1DUXC 4HLYA 1K78B 1YS7A 3J81Z 2A07F 4I0BA 2E1CA 2WC2A 1VTNC 4UXNA 1JHHA 2E1NA 3JTGA 3WGGA 4U7BA 2HZTA 2MA3A 3ECOA 3DV8A 1XN7A 3VFZA 2XV4S 2EA4A 1ONVA 3RKXA 2Q2EA 2A69F 2FXAA 3KLNA 4EGYA 2EA2A 1DDNA 5ILSA 4BHPA 3EQLF 2VE8A 2FF4A 2VOOA 1G3WA 4XRFA 3L2CA 2VBZA 1A04A 1S7OA 1XGSA 4MGRA 2QYOA 2XUBA 1IN4A 5K1YA 2P5LC 5CVUA 4NQWA 5ICFA 1R58A 5J8CA 3SHFA 2DO7A 3KP4A 4EM1A 1U78A 2FOKA 4UV8A 3RDIA 2P5KA 1XGNA 4IRIA 5HLHA 3TKYA 2PFBA 2MH2A 1XB4A 3REOA 2V1DA 3MQ0A 1BJAA 1O3TA 2HGCA 1F1ZA 2P6SA 4FT8A 3VEPA 3TOBA 3HRMA 2XHKA 2CG4A 3E6BA 4F7ZA 4BAYA 2HKOA 4Y13A 4GCVA 2FMLA 2W57A 3J80K 3K0LA 4N0BA 2HFHA 3BZ6A 4A5MA 1KU2A 3HTSB 2M87A 4MQVA 3J80Z 3LA7A 2OU2A 5HDKA 3M8EA 4LGWA 3EUHA 3ZP5A 2GZWA 2PG4A 4U0VA 2FNAA 4LLLA 1R1UA 5BQTA 2L02A 4I2OA 1B9NA 4HX8A 2V1XA 3G3ZA 6PAXA 3S2WA 2ZMEA 2H6BA 1S3JA 2DQRA 4B09A 5FGMA 1K7AA 3R60A 4CGZA 5F64A 1O3SA 5E1ZB 2KIFA 2GA2A 2MH9A 3R61A 3O2PE 3DEUA 2Z99A 2ACJA 4N9IA 4AIJA 1R5GA 1W5SA 1T0FA 1YQAA 5KK1A 3KLOA 3MCZA 2A61A 1RZ4A 5E20A 2D45A 1ZARA 4G7OF 3JTHA 2JTVA 2VXZA 2IA0A 2PJPA 3K9TA 1YS6A 5D5UB 2Q8KA 2EWNA 2O0YA 1T2KA 1U6GA 3DPLC 2HWVA 2JT1A 4PDKA 2DTRA 4EM2A 4BYYA 1QZZA 5TRDA 3CDHA 2A6EF 3BP8A 2NS0A 3P7NA 4U7DA 1R1VA 2Q0OA 4CHUA 1XSVA 5DDGA 2QBYA 4MNUA 2P5VA 2FU4A 4EVIA 2OBPA 2VT2A 1Z91A 2V79A 2Z3YA 3GZ5A 1YFHA 2ELHA 2ADUA 1FBUA 1K6OA 2ZNZA 5FLXK 3I4PA 1YO5C 1I27A 3PQKA 4EJVA 3K1MA 4KNYA 3F8FA 2CQKA 3C3WA 1F5TA 4OIQF 5FLXZ 3VOEA 2XASA 4EQQA 4A5NA 3NQOA 2LNBA 4K2EA 3QOPA 3L9FA 2Z5UA 3DFGA 3CUQB 3ML6A 1J9IA 1REPC 5LEJA 1IAWA 5DCMA 1EV7A 5FD6A 1SD4A 1LJ9A 3HTUA 1FBQA 5DUIA 4MEYF 2WV0A 4RB1A 3FF5A 1J2XA 3BROA 1HSTA 1ON2A 2HTJA 5DD8A 3RKYA 5IT9K 2NAZA 1ZG5A 2QWWA 3HRUA 4HV5A 2NRAC 2VN2A 3DQVC 3M8FA 1ZLKA 2FEZA 3CUOA 3F72A 2OZ6A 4NB5A 1WI9A 5IT9Z 2VT3A 5DCFA 5ILVA 3RYPA 3KZYA 1OYWA 4KYWA 2G9WA 4HOBA 1IXCA 3KP5A 1FSHA 5FFZA 4N9HA 5DV5A 1HQCA 2R7DA 1W4MA 5J8FA 3TO9A 4S04A 1MDMA 4XSXF 1G3TA 3K2ZA 2BBYA 3F21A 1KU9A 2PEXA 3TOAA 3I59B 1R7JA 4UNOA 2K02A 4A12A 2HYGD 3U9GA 3FM3A 1QGPA 2FQ3A 4IPAA 3TGNA 1BOAA 5LHGA 4EGZA 1RI7A 4L9VA 2ZO4A 4OINF 4RS8A 2FA5A 1FP1D 3JW4A 2OQRA 5BMZA 2O03A 1USSA 4LB6B 1BBYA 5LLQA 1W7PB 4HQMA 2GXGA 2WWYA 1SFXA 4IJAA 1FZPB 2XKPA 3JAMK 1HKQA 5JFRA 5FD5A 5ICGA 4KN4X 4KA4A 3F8BA 4CO8A 2XAGA 1U5TC 3JAMZ 2QQ9A 5H20A 1RUOA 3E6DA 1IRFA 1FC3A 3WTTC 2ISYA 2XIGA 2CFXA 4MQ9F 1D5VA 1MJBA 4G9YA 1TTYA 2OAZA 4XBFA 3I5UA 3L7WA 1BI3A 3WTVC 4R79A 2F5FA 3HOTA 5KVRA 3U2RA 5CYVA 4EJWA 2EK5A 5ERIA 1EH8A 2F5CA 3GWZA 4PGHA 2RVCA 5HS7A 5D5XB 5LHIA 3CJNA 4AD9A 1W5TA 2VBXA 3VB2A 3P9IA 4FX0A 2H6CA 4B8XA 1ON1A 3TDZC 2HQNA 3KP6A 2RGVA 3COAC 1KYWA 1SD6A 5LRSA 1HXDA 5AIPA 1V4RA 1I5ZA 2GWRA 3I71A 2XRNA 4MTDA 2RC4A 3RJPA 3H92A 3DXJF 2JRTA 3KE2A 2LF7A 1Z9CA 4KIBA 3EETA 2XAHA 4KN7X 1AOYA 2VC0A 1IW7F 3DF8A 5HS9A 2W25A 3FMRA 2O61A 3C1DA 1TQPA 3WE3A 1D3YA 5HLGA 5CJ9A 1Z7UA 3EDPA 1O7LA 3M9AA 4M71A 4UVAA 1R23A 4FHTA 4I98B 4OIOF 1OR7A 4WX9A 3LFKA 3H3ZA 4XLNF 4LG0B 3AAFA 4A2UA 4MEXF 3HUGA 3FHZA 2HOEA 3I0TA 3IHUA 2BV6A 1L3LA 4KDPA 3P9CA 3CLOA 1WQ2A 4HDVA 2F5DA 3MAJA 3GUDA 2UXNA 3SZPA 5HS8A 4L9TA 4IRHA 3W6JB 5E17F 3KZZA 1B1BA 2Z33A 3T5XA 1LEAA 1B9MA 2XAJA 1UB9A 4R1HA 2IW5A 4YG2F 4G6QA 1B6AA 3ZMZA 1S8NA 2YU3A 3KEOA 3IWZA 4M9SA 3W6KB 4M74A 5LHHA 2YR2A 3V8JA 5BS6A 1T38A 4WXDA 3MZYA 2ESHA 4UVCA 1HKTA 3HSRA 4HA8A 4KIGA 3FXQA 3PQJA 3R4KA 4ETSA 4UUVA 2QENA 4P5OA 2IP2A 4L5IA 3E5UA 3HOSA 1J75A 1WKMA 4AWXB 1SD5A 5CVVA 1BIAA 2XROA 2JPCA 5LRRA 1MGTA 2O8XA 3N97A 2B0LA 4CZZA 3K69A 3WTXC 3JSPA 5JHUA 2XAQA 3WTZA 1G4DA 4RB0A 2HKXA 4LJZF 2P7VB 4I0AA 3B73A 3ZMSA 1W7PD 1V3FA 1YG2A 4G94A 3T8TA 4GYGA 1F4KA 2MC3A 1T6SA 3LA2A 4M9ZA 4QLCU 2DBBA 1BI0A 3J7AO 5DD4A 1B4AA 1BN5A 2Y75A 3E6CC 1ZGAA 4CICA 1YYVA 4EM0B 5K5OA 4GXOA 3IKTA 1KU7A 4D0PA 2E7XA 1XGOA 2GAUA 3C7JA 2HTSA 1Y0UA 2UWMA 4IVNA 3ULQB 5JI6A 1I6XA 1ZHFA 1XCBA 5A2QK 1STZA 3ECHA 3Q5FA 3FMSA 1OYYA 1PP7U 3JSOA 3EYIA 2AXLA 2A3SA 1G3YA 1SMTA 2HYFA 1TLHB 1MZBA 1FBSA 4M6YA 1LNWA 4LK1F 5A2QZ 2VE9A 2LSOA 1XGMA 2ZMEB 3I58A 3L09A 1SFEA 4I09A 1KQ8A 1ZRFA 3RIRA 2HS5A 1L0OC 4Z2YA 5K5QA 4ENMA 4KIFA 2GA1A 3V7CA 5D5WB 2OQGA 1QZYA 1LVAA 5FB2A 1LB2A 3ZQ7A 5L3EA 5L3GA 4EV0A 1UFMA 4UV9A 1C0WA 4XLPF 3ZMTA 3VODA 3ABTA 1RIOH 4LFUA 2H27A 1FY7A 1USTA 3ISPA 4RAZA 2LKPA 1CF7B 4ZYGA 1YTYA 2IJLA 1G3SA 4IRGA 1RNLA 4M72A 2NYXA 3ABUA 3ZMVA 3GZ6A 3ELKA 1TQMA 4ESFA 5E8GA 4AVPA 3R0JA 3NEUA 2QBYB 1O57A 2PLYA 4XSZF 2HR3A 4EJOA 3QPHA 3CUQA 3HHHA 2DU9A 4L18B 2K27A 4H0EA 4ZH4F 5H6RA 2V1UA 2E7WA 1OKRA 3GFMA 3HRTA 2GIVA 1FSEA 2QQBA 2CW0F 2ZKZA 1BI1A 2F2EA 4HX4A 3CO6C 3KP3A 3F22A 3MFKA 5L3BA 1E2XA 5HVQC 3O3KA 2P4WA 4S05A 3QP5A 5DCMB 4EJTA 2QVOA 3WODF 3MZHA 3LWFA 5LGUA 2EV6A 2RV8A 1U5TB 2YPRA 1H0MA 5F6FA 5L3CA 2Y48A 5EEGA 4BH9A 4ESBA 4ON0A 4Q47A 3V7SA 2K4JA 1P4WA 3I53A 4EMSA 1ZYRF 2KKOA 3WTYC 1E17A 3GO5A 3I59A 1R22A 2QM3A 2IRFG 4CYDA 3IRQA 2IPQX 3GXOA 5LBQA 2QQAA 2OZUA 5DUKA 2A68F 4Q5SF 4AIHA 2UZKA 2DW4A 2DK5A 3R0AA 3KCCA 2K7LA 1FYLA 2FMYA 1H9GA 1R00A 1TNTA 3V8LA 1XMAA 1MDMB 1YIOA 2W85A 4GGGA 1ZN2A 1GXPA 4A0ZA 1XDUA 1ODDA 1ULYA 4A0XA 1LEBA 2G7HA 2HDCA 2ZFWA 5D4RA 2FNPA 1P6RA 3GX4X 1QBJA 4U88A 1J0RA 3WG9A 1RUNA 5E8IA 1P2FA 1YW8A 4OMZA 3TDUC 4BHBA 3GVAA 2Y0MA 3HIFA 1K79A 4HF2A 1KA8A 3L00A 1HBXG 3ZPLA 2AS5F 2DPDA 4WCGA 3C18A 2KIMA 4HW0A 4PGGA 3DKWA 3LSTA 1J7KA 2IA1A 4G8XA 4E70A 2M8EA 3LA3A 5DYMA 3GFJA 2IT0A 1NHAA 1UHWA 1PUEE 2HQRA 4L0YB 2L3DA 4TV7A 5D5VB 3FWEA 4I7HA 5D8LB 3WTUC 4PZJA 2ZXJA 3GLXA 1IN6A 1D8JA 2O6GE 2G7UA 5J6XA 2CGPA 2A6HF 1BIBA 1DPRA 4U0YA 3LAJA 5K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBI A;  4P96 A;  4LLG F;  5D8K B;  4ZYE A;  2CO5 A;  4KIC A;  3TO7 A;  3RI4 A;  1KQ0 A;  1J5Y A;  3E97 A;  3BJO A;  2DPU A;  4L5J A;  2RKH A;  1XDS A;  1R1T A;  2BEO A;  3T1B A;  3BPX A;  2PMU A;  3CTA A;  2VC1 A;  4UHT A;  4L0Z B;  2FBH A;  2O3F A;  1IRG A;  4M73 A;  3Q9S A;  4M6X A;  4KMU X;  3RPU A;  5E1X A;  4KUM A;  1S6L A;  2FRH A;  3H3U A;  5IT3 A;  4YII A;  2J5P A;  4A6D A;  1QNT A;  1K78 A;  4LG0 A;  1FNN A;  4M9X A;  1ZLJ A;  1ZRC A;  5BPI A;  1TQI A;  1QQI A;  1O3Q A;  2DLL A;  2WTE A;  1T39 A;  1QPM A;  1FYK A;  3D5L A;  2K86 A;  2L4M A;  2NNY A;  3E6M A;  1Q1H A;  3N4M A;  3RPQ A;  2H94 A;  3LAP A;  2D1H A;  5LGN A;  1PP8 F;  3KFW X;  5ICC A;  2BYV E;  3PFI A;  2EJR A;  1XD7 A;  1JHF A;  1BC8 C;  3QP6 A;  4AIK A;  5CVJ A;  2IA2 A;  1UHM A;  1FWZ A;  2ZNY A;  4HDU A;  4FX4 A;  3FX3 A;  3GW2 A;  1CGP A;  4P9U A;  2XVC A;  4OOI A;  4I02 A;  2OD5 A;  1IN5 A;  3V7R A;  5FFX A;  1ZRD A;  4DNC A;  3DPT A;  4ZYH A;  4OIR F;  3BWG A;  2YX7 A;  1SFU A;  3T0Y A;  3IWF A;  2EFO A;  5ED4 A;  4HYE A;  3M7G A;  2CWE A;  4RAY A;  3E3V A;  2TDX A;  3P9K A;  4ENJ A;  4ESJ A;  2PBI A;  1MJ9 A;  1IZ1 A;  1DPU A;  2DI3 A;  3F23 A;  4U0W A;  2JPB A;  1Z6T A;  3QRF F;  2M30 A;  4O5V A;  3F8N A;  1R36 A;  2X4H A;  1IXR C;  3F3X A;  5D6F A;  3EYY A;  2JZY A;  3ZN0 A;  4BXU A;  4A0Y A;  3WGI A;  1SD7 A;  4L9J A;  5AON A;  2J5O A;  2DK8 A;  5DEQ A;  3HRS A;  1Z6R A;  4RGX A;  2EFW A;  4YFK F;  4G7H F;  3ZN1 A;  3OOP A;  1J59 A;  3GFI A;  3SZT A;  2NNN A;  3GF2 A;  2FBK A;  1XCV A;  4ZZL A;  3RKW A;  1ZG3 A;  1FPQ A;  2F5E A;  1HW2 A;  1IN7 A;  2ESN A;  4MHG A;  1BC7 C;  2LDU A;  2V6C A;  1KGS A;  2UXX A;  4DQ2 A;  4CXF A;  2EFN A;  4O6J A;  2M45 A;  3FXR A;  4KFC A;  3KEQ A;  1IXS B;  4RGR A;  4LMY A;  3LQR A;  4GO1 A;  1ZH5 A;  4G7Z F;  3HYI A;  3SFZ A;  2HEO A;  3WU0 A;  4WK8 F;  1F9N A;  1U8R A;  4P55 A;  3BDD A;  2DT5 A;  2RDP A;  2RN7 A;  4Y17 A;  1S29 A;  5HLI A;  3ERE D;  1MJA A;  1I1S A;  1AWC A;  3TO6 A;  3WTW C;  4KMF A;  1TW2 A;  2KRF A;  1X3U A;  3T8R A;  3V8K A;  1HW5 A;  5CVR A;  2ZBK A;  1YW7 A;  4YFN F;  5L3D A;  3ROU A;  4P9F A;  3FMQ A;  2YSR A;  1TNS A;  5CLS A;  2STW A;  4LK0 F;  5TJJ A;  4LLN A;  4OMY A;  2P7C B;  1ZGJ A;  4A6E A;  1KU3 A;  2C6Y A;  2ETH A;  4HAM A;  5CVI A;  2R7F A;  1XMK A;  2L4A A;  3QPT A;  1CF7 A;  5L3F A;  4HV6 A;  5JR3 A;  2W84 A;  2W24 A;  2P6T A;  3GYH X;  2DQL A;  2ZCW A;  2A5Y B;  2XGX A;  2VBY A;  1SMY F;  3RTR A;  1B59 A;  4BQA A;  1MD0 A;  2PI0 A;  1Z1D A;  3E5X A;  2DAO A;  1IF1 A;  2VBW A;  4PCQ A;  1ZG1 A;  4QWQ A;  3ZMD A;  2LF8 A;  4MTE A;  3IC7 A;  1P4X A;  5EEH A;  2V9V A;  1YLF A;  4WXH A;  4LD5 A;  2EV0 A;  2XKO A;  2YX4 A;  1FOK A;  2D1V A;  2MD5 A;  1QO0 D;  2L54 A;  3U1D A;  1IUY A;  3I64 A;  3DP7 A;  3GFL A;  5E18 F;  2XAF A;  2STT A;  3B02 A;  4HZF A;  4IHS A;  1R5H A;  1WRJ A;  2ZJ2 A;  2DFI A;  1BM9 A;  1U2W A;  3HSE A;  1JGS A;  2CYY A;  3WGH A;  4IF4 A;  5HOO A;  3HHG A;  1U5T A;  1LDJ A;  1OPC A;  4BNC A;  1O7F A;  4UVB A;  3HSF A;  2MLG A;  2PQ8 A;  1GHC A;  2QLZ A;  2ISZ A;  5JVT A;  4RGU A;  1IN8 A;  3G73 A;  2BGC A;  1WWX A;  2RQP A;  2M5W A;  1FX7 A;  4WWC A;  2X0L A;  5H6Q A;  1FT9 A;  4HF0 A;  1DP7 P;  4WF2 A;  2H09 A;  1OMI A;  3KET A;  3MEX A;  1YW9 A;  3F8M A;  2KJB A;  1TW3 A;  4IXA A;  2EB7 A;  3NRV A;  1H9T A;  1EH7 A;  3IKV A;  5ILU A;  5ICE A;  2M1B A;  2EFP A;  3R6S A;  1KQ9 A;  3CUQ C;  1LDK B;  1U3E M;  4RB2 C;  2MBF A;  1SAX A;  3BPV A;  1W7P A;  1I1G A;  2VOD A;  4HF1 A;  2QZ8 A;  3K1P A;  4EJU A;  3IL2 A;  4BHC A;  2P8T A;  1WSU A;  2OA4 A;  4WXC A;  5D6E A;  4O3M A;  1BI2 A;  3OV8 A;  4ZYD A;  3SXY A;  1G6N A;  4ENK A;  4ENN A;  3F6V A;  3BOQ A;  2PMH A;  3MWM A;  4HX7 A;  2D2W A;  1T98 A;  4HBL A;  3E5Q A;  3QAH A;  2MLK A;  3BJ6 A;  3QU3 A;  2GQQ A;  2EFQ A;  3IRR A;  1S7A A;  4Q4Z F;  2CSO A;  2VON A;  3KP7 A;  3FZV A;  1MKM A;  5BOX A;  4NHJ A;  1HKS A;  5AIQ A;  1HSJ A;  2VOP A;  1FP2 A;  1GXQ A;  4YIF A;  3GEZ A;  2RNJ A;  4R8H A;  4YFX F;  1PDN C;  4RB3 C;  1FYM A;  2L01 A;  4IHT A;  4JK1 X;  5LEK A;  4L9N A;  3I54 A;  3WTS C;  1XSX A;  3CO7 C;  3BY6 A;  1XSD A;  5D4S A;  2COM A;  4CDG A;  4OU0 A;  1P92 A;  4JBA A;  1TBX A;  2FSW A;  5HDG A;  2JSC A;  2R3S A;  3RYR A;  2K4B A;  4HLX A;  2KJC A;  1LQ1 A;  3LQQ A;  3V4G A;  2FE3 A;  4RGS A;  4GYI A;  1GVJ A;  4ASN A;  4I01 A;  3O6B B;  5FO5 A;  3F6O A;  2KIU A;  4ZZD A;  3F8C A;  1EH6 A;  3QU6 A;  5F1R A;  1D8K A;  1LDD A;  3KP2 A;  4OIP F;  3BJA A;  1HW1 A;  4Y15 A;  2EV5 A;  5E1W A;  2PN6 A;  4G6D A;  3D0S A;  3Q9V A;  1P4A A;  4HQE A;  3SQN A;  2Z9O A;  2QUF A;  3WU1 B;  4Q48 A;  2BE5 F;  3WE2 A;  1O3R A;  1ZRE A;  1UCR A;  5BPD A;  5LGT A;  3ZMU A;  4LB5 A;  3TQN A;  1JE8 A;  2IVM A;  5HDN A;  1OYI A;  3FXU A;  1FLI A;  1KYZ A;  1Z05 A;  4JQF A;  1ZAO A;  3K1N A;  2GXB A;  3M1E A;  3J81 K;  4KT5 C;  1JXS A;  3FM5 A;  1DUX C;  4HLY A;  1K78 B;  1YS7 A;  3J81 Z;  2A07 F;  4I0B A;  2E1C A;  2WC2 A;  1VTN C;  4UXN A;  1JHH A;  2E1N A;  3JTG A;  3WGG A;  4U7B A;  2HZT A;  2MA3 A;  3ECO A;  3DV8 A;  1XN7 A;  3VFZ A;  2XV4 S;  2EA4 A;  1ONV A;  3RKX A;  2Q2E A;  2A69 F;  2FXA A;  3KLN A;  4EGY A;  2EA2 A;  1DDN A;  5ILS A;  4BHP A;  3EQL F;  2VE8 A;  2FF4 A;  2VOO A;  1G3W A;  4XRF A;  3L2C A;  2VBZ A;  1A04 A;  1S7O A;  1XGS A;  4MGR A;  2QYO A;  2XUB A;  1IN4 A;  5K1Y A;  2P5L C;  5CVU A;  4NQW A;  5ICF A;  1R58 A;  5J8C A;  3SHF A;  2DO7 A;  3KP4 A;  4EM1 A;  1U78 A;  2FOK A;  4UV8 A;  3RDI A;  2P5K A;  1XGN A;  4IRI A;  5HLH A;  3TKY A;  2PFB A;  2MH2 A;  1XB4 A;  3REO A;  2V1D A;  3MQ0 A;  1BJA A;  1O3T A;  2HGC A;  1F1Z A;  2P6S A;  4FT8 A;  3VEP A;  3TOB A;  3HRM A;  2XHK A;  2CG4 A;  3E6B A;  4F7Z A;  4BAY A;  2HKO A;  4Y13 A;  4GCV A;  2FML A;  2W57 A;  3J80 K;  3K0L A;  4N0B A;  2HFH A;  3BZ6 A;  4A5M A;  1KU2 A;  3HTS B;  2M87 A;  4MQV A;  3J80 Z;  3LA7 A;  2OU2 A;  5HDK A;  3M8E A;  4LGW A;  3EUH A;  3ZP5 A;  2GZW A;  2PG4 A;  4U0V A;  2FNA A;  4LLL A;  1R1U A;  5BQT A;  2L02 A;  4I2O A;  1B9N A;  4HX8 A;  2V1X A;  3G3Z A;  6PAX A;  3S2W A;  2ZME A;  2H6B A;  1S3J A;  2DQR A;  4B09 A;  5FGM A;  1K7A A;  3R60 A;  4CGZ A;  5F64 A;  1O3S A;  5E1Z B;  2KIF A;  2GA2 A;  2MH9 A;  3R61 A;  3O2P E;  3DEU A;  2Z99 A;  2ACJ A;  4N9I A;  4AIJ A;  1R5G A;  1W5S A;  1T0F A;  1YQA A;  5KK1 A;  3KLO A;  3MCZ A;  2A61 A;  1RZ4 A;  5E20 A;  2D45 A;  1ZAR A;  4G7O F;  3JTH A;  2JTV A;  2VXZ A;  2IA0 A;  2PJP A;  3K9T A;  1YS6 A;  5D5U B;  2Q8K A;  2EWN A;  2O0Y A;  1T2K A;  1U6G A;  3DPL C;  2HWV A;  2JT1 A;  4PDK A;  2DTR A;  4EM2 A;  4BYY A;  1QZZ A;  5TRD A;  3CDH A;  2A6E F;  3BP8 A;  2NS0 A;  3P7N A;  4U7D A;  1R1V A;  2Q0O A;  4CHU A;  1XSV A;  5DDG A;  2QBY A;  4MNU A;  2P5V A;  2FU4 A;  4EVI A;  2OBP A;  2VT2 A;  1Z91 A;  2V79 A;  2Z3Y A;  3GZ5 A;  1YFH A;  2ELH A;  2ADU A;  1FBU A;  1K6O A;  2ZNZ A;  5FLX K;  3I4P A;  1YO5 C;  1I27 A;  3PQK A;  4EJV A;  3K1M A;  4KNY A;  3F8F A;  2CQK A;  3C3W A;  1F5T A;  4OIQ F;  5FLX Z;  3VOE A;  2XAS A;  4EQQ A;  4A5N A;  3NQO A;  2LNB A;  4K2E A;  3QOP A;  3L9F A;  2Z5U A;  3DFG A;  3CUQ B;  3ML6 A;  1J9I A;  1REP C;  5LEJ A;  1IAW A;  5DCM A;  1EV7 A;  5FD6 A;  1SD4 A;  1LJ9 A;  3HTU A;  1FBQ A;  5DUI A;  4MEY F;  2WV0 A;  4RB1 A;  3FF5 A;  1J2X A;  3BRO A;  1HST A;  1ON2 A;  2HTJ A;  5DD8 A;  3RKY A;  5IT9 K;  2NAZ A;  1ZG5 A;  2QWW A;  3HRU A;  4HV5 A;  2NRA C;  2VN2 A;  3DQV C;  3M8F A;  1ZLK A;  2FEZ A;  3CUO A;  3F72 A;  2OZ6 A;  4NB5 A;  1WI9 A;  5IT9 Z;  2VT3 A;  5DCF A;  5ILV A;  3RYP A;  3KZY A;  1OYW A;  4KYW A;  2G9W A;  4HOB A;  1IXC A;  3KP5 A;  1FSH A;  5FFZ A;  4N9H A;  5DV5 A;  1HQC A;  2R7D A;  1W4M A;  5J8F A;  3TO9 A;  4S04 A;  1MDM A;  4XSX F;  1G3T A;  3K2Z A;  2BBY A;  3F21 A;  1KU9 A;  2PEX A;  3TOA A;  3I59 B;  1R7J A;  4UNO A;  2K02 A;  4A12 A;  2HYG D;  3U9G A;  3FM3 A;  1QGP A;  2FQ3 A;  4IPA A;  3TGN A;  1BOA A;  5LHG A;  4EGZ A;  1RI7 A;  4L9V A;  2ZO4 A;  4OIN F;  4RS8 A;  2FA5 A;  1FP1 D;  3JW4 A;  2OQR A;  5BMZ A;  2O03 A;  1USS A;  4LB6 B;  1BBY A;  5LLQ A;  1W7P B;  4HQM A;  2GXG A;  2WWY A;  1SFX A;  4IJA A;  1FZP B;  2XKP A;  3JAM K;  1HKQ A;  5JFR A;  5FD5 A;  5ICG A;  4KN4 X;  4KA4 A;  3F8B A;  4CO8 A;  2XAG A;  1U5T C;  3JAM Z;  2QQ9 A;  5H20 A;  1RUO A;  3E6D A;  1IRF A;  1FC3 A;  3WTT C;  2ISY A;  2XIG A;  2CFX A;  4MQ9 F;  1D5V A;  1MJB A;  4G9Y A;  1TTY A;  2OAZ A;  4XBF A;  3I5U A;  3L7W A;  1BI3 A;  3WTV C;  4R79 A;  2F5F A;  3HOT A;  5KVR A;  3U2R A;  5CYV A;  4EJW A;  2EK5 A;  5ERI A;  1EH8 A;  2F5C A;  3GWZ A;  4PGH A;  2RVC A;  5HS7 A;  5D5X B;  5LHI A;  3CJN A;  4AD9 A;  1W5T A;  2VBX A;  3VB2 A;  3P9I A;  4FX0 A;  2H6C A;  4B8X A;  1ON1 A;  3TDZ C;  2HQN A;  3KP6 A;  2RGV A;  3COA C;  1KYW A;  1SD6 A;  5LRS A;  1HXD A;  5AIP A;  1V4R A;  1I5Z A;  2GWR A;  3I71 A;  2XRN A;  4MTD A;  2RC4 A;  3RJP A;  3H92 A;  3DXJ F;  2JRT A;  3KE2 A;  2LF7 A;  1Z9C A;  4KIB A;  3EET A;  2XAH A;  4KN7 X;  1AOY A;  2VC0 A;  1IW7 F;  3DF8 A;  5HS9 A;  2W25 A;  3FMR A;  2O61 A;  3C1D A;  1TQP A;  3WE3 A;  1D3Y A;  5HLG A;  5CJ9 A;  1Z7U A;  3EDP A;  1O7L A;  3M9A A;  4M71 A;  4UVA A;  1R23 A;  4FHT A;  4I98 B;  4OIO F;  1OR7 A;  4WX9 A;  3LFK A;  3H3Z A;  4XLN F;  4LG0 B;  3AAF A;  4A2U A;  4MEX F;  3HUG A;  3FHZ A;  2HOE A;  3I0T A;  3IHU A;  2BV6 A;  1L3L A;  4KDP A;  3P9C A;  3CLO A;  1WQ2 A;  4HDV A;  2F5D A;  3MAJ A;  3GUD A;  2UXN A;  3SZP A;  5HS8 A;  4L9T A;  4IRH A;  3W6J B;  5E17 F;  3KZZ A;  1B1B A;  2Z33 A;  3T5X A;  1LEA A;  1B9M A;  2XAJ A;  1UB9 A;  4R1H A;  2IW5 A;  4YG2 F;  4G6Q A;  1B6A A;  3ZMZ A;  1S8N A;  2YU3 A;  3KEO A;  3IWZ A;  4M9S A;  3W6K B;  4M74 A;  5LHH A;  2YR2 A;  3V8J A;  5BS6 A;  1T38 A;  4WXD A;  3MZY A;  2ESH A;  4UVC A;  1HKT A;  3HSR A;  4HA8 A;  4KIG A;  3FXQ A;  3PQJ A;  3R4K A;  4ETS A;  4UUV A;  2QEN A;  4P5O A;  2IP2 A;  4L5I A;  3E5U A;  3HOS A;  1J75 A;  1WKM A;  4AWX B;  1SD5 A;  5CVV A;  1BIA A;  2XRO A;  2JPC A;  5LRR A;  1MGT A;  2O8X A;  3N97 A;  2B0L A;  4CZZ A;  3K69 A;  3WTX C;  3JSP A;  5JHU A;  2XAQ A;  3WTZ A;  1G4D A;  4RB0 A;  2HKX A;  4LJZ F;  2P7V B;  4I0A A;  3B73 A;  3ZMS A;  1W7P D;  1V3F A;  1YG2 A;  4G94 A;  3T8T A;  4GYG A;  1F4K A;  2MC3 A;  1T6S A;  3LA2 A;  4M9Z A;  4QLC U;  2DBB A;  1BI0 A;  3J7A O;  5DD4 A;  1B4A A;  1BN5 A;  2Y75 A;  3E6C C;  1ZGA A;  4CIC A;  1YYV A;  4EM0 B;  5K5O A;  4GXO A;  3IKT A;  1KU7 A;  4D0P A;  2E7X A;  1XGO A;  2GAU A;  3C7J A;  2HTS A;  1Y0U A;  2UWM A;  4IVN A;  3ULQ B;  5JI6 A;  1I6X A;  1ZHF A;  1XCB A;  5A2Q K;  1STZ A;  3ECH A;  3Q5F A;  3FMS A;  1OYY A;  1PP7 U;  3JSO A;  3EYI A;  2AXL A;  2A3S A;  1G3Y A;  1SMT A;  2HYF A;  1TLH B;  1MZB A;  1FBS A;  4M6Y A;  1LNW A;  4LK1 F;  5A2Q Z;  2VE9 A;  2LSO A;  1XGM A;  2ZME B;  3I58 A;  3L09 A;  1SFE A;  4I09 A;  1KQ8 A;  1ZRF A;  3RIR A;  2HS5 A;  1L0O C;  4Z2Y A;  5K5Q A;  4ENM A;  4KIF A;  2GA1 A;  3V7C A;  5D5W B;  2OQG A;  1QZY A;  1LVA A;  5FB2 A;  1LB2 A;  3ZQ7 A;  5L3E A;  5L3G A;  4EV0 A;  1UFM A;  4UV9 A;  1C0W A;  4XLP F;  3ZMT A;  3VOD A;  3ABT A;  1RIO H;  4LFU A;  2H27 A;  1FY7 A;  1UST A;  3ISP A;  4RAZ A;  2LKP A;  1CF7 B;  4ZYG A;  1YTY A;  2IJL A;  1G3S A;  4IRG A;  1RNL A;  4M72 A;  2NYX A;  3ABU A;  3ZMV A;  3GZ6 A;  3ELK A;  1TQM A;  4ESF A;  5E8G A;  4AVP A;  3R0J A;  3NEU A;  2QBY B;  1O57 A;  2PLY A;  4XSZ F;  2HR3 A;  4EJO A;  3QPH A;  3CUQ A;  3HHH A;  2DU9 A;  4L18 B;  2K27 A;  4H0E A;  4ZH4 F;  5H6R A;  2V1U A;  2E7W A;  1OKR A;  3GFM A;  3HRT A;  2GIV A;  1FSE A;  2QQB A;  2CW0 F;  2ZKZ A;  1BI1 A;  2F2E A;  4HX4 A;  3CO6 C;  3KP3 A;  3F22 A;  3MFK A;  5L3B A;  1E2X A;  5HVQ C;  3O3K A;  2P4W A;  4S05 A;  3QP5 A;  5DCM B;  4EJT A;  2QVO A;  3WOD F;  3MZH A;  3LWF A;  5LGU A;  2EV6 A;  2RV8 A;  1U5T B;  2YPR A;  1H0M A;  5F6F A;  5L3C A;  2Y48 A;  5EEG A;  4BH9 A;  4ESB A;  4ON0 A;  4Q47 A;  3V7S A;  2K4J A;  1P4W A;  3I53 A;  4EMS A;  1ZYR F;  2KKO A;  3WTY C;  1E17 A;  3GO5 A;  3I59 A;  1R22 A;  2QM3 A;  2IRF G;  4CYD A;  3IRQ A;  2IPQ X;  3GXO A;  5LBQ A;  2QQA A;  2OZU A;  5DUK A;  2A68 F;  4Q5S F;  4AIH A;  2UZK A;  2DW4 A;  2DK5 A;  3R0A A;  3KCC A;  2K7L A;  1FYL A;  2FMY A;  1H9G A;  1R00 A;  1TNT A;  3V8L A;  1XMA A;  1MDM B;  1YIO A;  2W85 A;  4GGG A;  1ZN2 A;  1GXP A;  4A0Z A;  1XDU A;  1ODD A;  1ULY A;  4A0X A;  1LEB A;  2G7H A;  2HDC A;  2ZFW A;  5D4R A;  2FNP A;  1P6R A;  3GX4 X;  1QBJ A;  4U88 A;  1J0R A;  3WG9 A;  1RUN A;  5E8I A;  1P2F A;  1YW8 A;  4OMZ A;  3TDU C;  4BHB A;  3GVA A;  2Y0M A;  3HIF A;  1K79 A;  4HF2 A;  1KA8 A;  3L00 A;  1HBX G;  3ZPL A;  2AS5 F;  2DPD A;  4WCG A;  3C18 A;  2KIM A;  4HW0 A;  4PGG A;  3DKW A;  3LST A;  1J7K A;  2IA1 A;  4G8X A;  4E70 A;  2M8E A;  3LA3 A;  5DYM A;  3GFJ A;  2IT0 A;  1NHA A;  1UHW A;  1PUE E;  2HQR A;  4L0Y B;  2L3D A;  4TV7 A;  5D5V B;  3FWE A;  4I7H A;  5D8L B;  3WTU C;  4PZJ A;  2ZXJ A;  3GLX A;  1IN6 A;  1D8J A;  2O6G E;  2G7U A;  5J6X A;  2CGP A;  2A6H F;  1BIB A;  1DPR A;  4U0Y A;  3LAJ A;  5K5R A; 
#chains in the Genus database with same CATH topology
 2FBI A;  1EKE A;  4P96 A;  2CQQ A;  2CW8 A;  4LLG F;  5D8K B;  1X1P A;  4F92 B;  4ZYE A;  3RSN A;  2CO5 A;  2M0M A;  2FQ4 A;  5FKL A;  3EPZ A;  4KIC A;  3TO7 A;  3RI4 A;  4AVZ A;  1KQ0 A;  2MW8 A;  2IS1 A;  3CC4 I;  1J5Y A;  1NTC A;  1DU6 A;  1S72 I;  3E97 A;  4F91 B;  1AKH A;  3BJO A;  4PK4 A;  2DPU A;  1Z7L A;  2CQ7 A;  4L5J A;  2RKH A;  2FJ1 A;  3KIO A;  1XDS A;  3C2H A;  3QYE A;  1R1T A;  2BEO A;  3VPR A;  3T1B A;  3BPX A;  2PMU A;  3CTA A;  2VC1 A;  3FK7 A;  4UHT A;  4ZTJ A;  4L0Z B;  5J47 A;  1F36 A;  2FOW A;  4GFB A;  2FBH A;  2O3F A;  1IRG A;  2OTJ I;  4M73 A;  3VSK A;  3Q9S A;  4F3Q A;  4M6X A;  4KMU X;  3RPU A;  5E1X A;  2N8G A;  4KUM A;  5EJC A;  1YJN I;  1LFP A;  3I55 I;  1S6L A;  1HDP A;  2FRH A;  3H3U A;  5IT3 A;  4NNJ A;  4YII A;  2J5P A;  4DZP A;  4V19 K;  3VYS B;  2E1O A;  1QNT A;  4A6D A;  4LG0 A;  4KIT B;  1K78 A;  2B63 J;  1FNN A;  1SVO A;  1VI0 A;  2LD5 A;  1WJE A;  4M9X A;  4LG3 A;  1AHD P;  1ZLJ A;  3BQY A;  3OYI A;  1NK2 P;  1ZRC A;  3FXJ A;  3M8J A;  5BPI A;  2LRE A;  1TQI A;  1QQI A;  1O3Q A;  2DLL A;  2HQ5 A;  4IQJ A;  2WTE A;  1T39 A;  1QPM A;  5M3F J;  1FYK A;  2Q1Z B;  3D5L A;  2HVS A;  2K86 A;  2L4M A;  1XC5 A;  3ESW B;  2OTL I;  2VQH A;  2NNY A;  3E6M A;  1Q1H A;  3HGY A;  3N4M A;  3RPQ A;  2H94 A;  3LAP A;  2D1H A;  5J40 A;  2BHY A;  5LGN A;  1PP8 F;  3KFW X;  1RET A;  2DN0 A;  1ETX A;  2NVQ J;  3H36 A;  4C2M J;  5ICC A;  4JOM A;  2BYV E;  2QKL B;  4XLE A;  3PFI A;  1XMX A;  2EJR A;  1XD7 A;  2QSH X;  1JHF A;  3VYU B;  1BC8 C;  3QP6 A;  2IS6 A;  4AIK A;  5CVJ A;  2JRM A;  2KLO A;  3W2W A;  3PSF A;  2W00 A;  1ZEL A;  2IA2 A;  1UHM A;  4XLH A;  4XM3 A;  4BKX A;  1B72 A;  2X6O A;  1FWZ A;  2ZNY A;  1MNM C;  1X1D A;  2HNH A;  2VB6 A;  4HDU A;  3S1R J;  4FX4 A;  3OYJ A;  3FX3 A;  3G6E I;  4BY1 J;  4A3J J;  3GW2 A;  1CGP A;  4P9U A;  2RQQ A;  2XVC A;  3U1K A;  4E7Z A;  2ZJP F;  4OOI A;  4I02 A;  3L2W A;  2OD5 A;  1IN5 A;  3V7R A;  5TIS C;  5FFX A;  1ZRD A;  4DNC A;  3DPT A;  4C2U A;  1PVE A;  4BJT A;  1K83 J;  4F55 A;  4ZYH A;  4OIR F;  3BWG A;  4ABZ A;  5HLT A;  4ZTF A;  4A3F J;  2IBD A;  2YX7 A;  3OS1 A;  1D1C A;  4DJA A;  1SFU A;  5F27 A;  3T0Y A;  3IWF A;  2L0K A;  2EFO A;  5ED4 A;  1R71 A;  4V2G A;  3NAU A;  4HYE A;  2MD0 A;  3M7G A;  2AQF A;  2L2O A;  4D5C A;  2CWE A;  4RAY A;  2FUG 2;  2K9M A;  3E3V A;  2TDX A;  2GM4 A;  3CCQ I;  3G4S I;  1TWF J;  1GVD A;  2ECB A;  3P9K A;  4ENJ A;  4ESJ A;  2PBI A;  1MJ9 A;  1IZ1 A;  3QPS A;  3GTG J;  1DPU A;  1GV2 A;  4XK4 A;  2DI3 A;  3F23 A;  4U0W A;  1Z3Y A;  2JPB A;  4NQW B;  1MH4 A;  1P9Q C;  3I3L A;  1JTX A;  1S9H A;  1H88 C;  4LIT A;  3OYA A;  3MKY B;  1JKO C;  3ONQ A;  4DBR A;  2W48 A;  1Z6T A;  3QRF F;  4QPQ A;  1OR7 C;  2M30 A;  4BXF A;  4O5V A;  3QOE A;  3F8N A;  1MH3 A;  1R36 A;  2VKH A;  1Y6I A;  2X4H A;  3CCV I;  1IXR C;  3BTI A;  3F3X A;  3EYY A;  2DA2 A;  3C2G A;  2JZY A;  5D6F A;  3ZN0 A;  3HL2 A;  4BXU A;  4A0Y A;  3WGI A;  1SD7 A;  4L9J A;  5AON A;  2V7F A;  3PFY A;  2HDW A;  2EH3 A;  2J5O A;  3OY9 A;  3Q0V A;  1LPQ A;  2LY2 A;  2DK8 A;  4XR6 A;  5DEQ A;  2R93 J;  3K6G A;  3JRA A;  2KHM A;  2HOA A;  3HRS A;  1Z6R A;  4RGX A;  2EFW A;  3ABK H;  4YFK F;  3K4B A;  4G7H F;  3ZN1 A;  2DT6 A;  3OOP A;  1J59 A;  1JI8 A;  1QA6 A;  4C9Y A;  3SZT A;  3GFI A;  2NNN A;  3GF2 A;  2FBK A;  1XCV A;  4ZZL A;  2QSG X;  1WZ2 A;  1IV8 A;  2IEK A;  3PUF A;  3RKW A;  1ZG3 A;  5B3S H;  1B8I A;  1FPQ A;  3QOD A;  1E3O C;  2F5E A;  1HCR A;  3A03 A;  1HW2 A;  5LD2 C;  4JP0 A;  1IN7 A;  2ESN A;  4MHG A;  1BC7 C;  2R7U A;  2LDU A;  5M5X J;  2V6C A;  1KGS A;  4BEH A;  2L9V A;  2XGC A;  1ENH A;  2TRT A;  2UXX A;  1HA8 A;  3FHN A;  4DQ2 A;  4CXF A;  1WJ5 A;  3S1Q J;  2EFN A;  4O6J A;  4BDZ A;  2M45 A;  3FXR A;  4KFC A;  3E0J B;  1BR4 A;  3OSF A;  3KEQ A;  1IXS B;  2BHZ A;  4NC7 A;  4LMY A;  4RGR A;  3LQR A;  3NAR A;  4BJ6 C;  4GO1 A;  3V42 A;  1ZH5 A;  1S5L C;  2VKD A;  1U8B A;  4G7Z F;  3ZQF A;  4YEJ A;  3HYI A;  2E71 A;  3H5R A;  2M8G X;  3DTE A;  3SFZ A;  2HEO A;  3HBL A;  3WU0 A;  4WK8 F;  1F9N A;  4HNU A;  2A5W A;  1U8R A;  4P55 A;  3BDD A;  2DT5 A;  2RDP A;  2RN7 A;  4Y17 A;  1S29 A;  5HLI A;  1FJL A;  3DTI A;  3ERE D;  1MJA A;  2KQR A;  1I1S A;  1JGG A;  5EEA A;  1AWC A;  4CSW A;  3HOY J;  2IGM A;  1IRX A;  4FET A;  2Y9Y A;  3TO6 A;  3WTW C;  2MSY A;  4KMF A;  1TW2 A;  3JRF A;  1SEU A;  2OF7 A;  5F08 A;  2KRF A;  3H0G J;  2QA4 I;  1X3U A;  3T8R A;  3V8K A;  1HW5 A;  5CVR A;  2L7F P;  2NS8 A;  2ZBK A;  1VQ8 I;  4RDU A;  1YW7 A;  1YE9 A;  4YFN F;  5L3D A;  3ROU A;  1TWG J;  4P9F A;  1N75 A;  3FMQ A;  2YSR A;  1TNS A;  5CLS A;  2STW A;  3DU5 A;  3LSH A;  4LK0 F;  5TJJ A;  3BR1 A;  3BG7 A;  2KL4 A;  2E2H J;  1JT6 A;  3S3M A;  2B7E A;  4LLN A;  2P7C B;  4OMY A;  3F9K A;  1ZGJ A;  4A6E A;  1KU3 A;  2C6Y A;  3MN2 A;  2ETH A;  2O7O A;  4PJJ A;  4HAM A;  5CVI A;  1Y56 A;  2OC6 A;  2R7F A;  1XMK A;  2L4A A;  3QPT A;  1CF7 A;  3PO2 J;  5L3F A;  4HV6 A;  2XPU A;  5JR3 A;  1POG A;  2W84 A;  5H2F C;  2W24 A;  2P6T A;  3FDY A;  3I4N J;  3GYH X;  2DQL A;  2A05 A;  2ZCW A;  4FCY A;  2QKM B;  2A5Y B;  1DQU A;  3TBI A;  1D0X A;  2XGX A;  3BR3 A;  2VBY A;  4UUS B;  1SMY F;  1MSF C;  2R7V A;  3RTR A;  5IOZ A;  4HPQ A;  2K9L A;  3CCJ I;  1B59 A;  3ZQL A;  3ASN H;  1RPW A;  4X1E A;  4I6Z A;  1MD0 A;  2PI0 A;  4BQA A;  1Z1D A;  2LG4 A;  3E5X A;  4XKB A;  2DAO A;  1OQY A;  1ZKG A;  1IF1 A;  2VBW A;  4PCQ A;  4CCL A;  1ZG1 A;  2NOJ B;  4QWQ A;  4IEJ A;  3ZMD A;  4CCK A;  1ETQ A;  3RQI A;  2P81 A;  2LF8 A;  4MTE A;  3IC7 A;  2GOM A;  2VAS A;  2WB1 A;  1P4X A;  3K10 A;  1KZH A;  3RCO A;  1W1W E;  4IZZ A;  5EEH A;  2V9V A;  4HEA 2;  1X3W B;  1YLF A;  4WXH A;  4LD5 A;  5FKM A;  2EV0 A;  2XKO A;  4RBO A;  2XC7 A;  1TP4 A;  2XSD C;  2YX4 A;  1FOK A;  2V6E A;  4XID A;  2D1V A;  1X1A A;  2MD5 A;  2E1M C;  1QO0 D;  2XRL A;  1HOM A;  2L54 A;  3VYT B;  3U1D A;  1WVR A;  1IUY A;  4XOP A;  3I64 A;  3DP7 A;  3GFL A;  5E18 F;  2XAF A;  2DMP A;  1VND A;  3B02 A;  2STT A;  4HZF A;  4IHS A;  3UR3 C;  1R5H A;  1WRJ A;  2ZJ2 A;  1TC3 C;  3PL8 A;  4IKF A;  2DFI A;  1PUF B;  1BM9 A;  3H3V K;  4BQO A;  2F5V A;  2RRE A;  3S3N A;  3CCM I;  1U2W A;  3HSE A;  1YRN A;  1JGS A;  4MFD A;  3HDD A;  5F1J A;  5LFA A;  2CYY A;  3WGH A;  3PSI A;  2E2J J;  4CCO A;  4IF4 A;  1V5E A;  5HOO A;  1JKR C;  3HHG A;  2CQN A;  3OIQ A;  1PJR A;  1D1B A;  1LDJ A;  1U5T A;  1OPC A;  4BNC A;  3H9Q A;  1O7F A;  2WY7 Q;  1G8X A;  2MLG A;  3HSF A;  2EIN H;  2PQ8 A;  2ZSI B;  4UVB A;  3OYL A;  2H1K A;  3GTO J;  2QLZ A;  2VKE A;  3OYK A;  2ISZ A;  5FKO A;  1GHC A;  4FE7 A;  5JVT A;  2LTP A;  4RGU A;  3ERM A;  1JUP A;  1MBK A;  1IN8 A;  3G73 A;  2BGC A;  4E6K G;  1WWX A;  2RQP A;  3H5A A;  4BS9 A;  2DOE A;  4OAZ A;  2M5W A;  1XX5 A;  1SAU A;  3AG1 H;  2JA2 A;  1FX7 A;  4B3X A;  4WWC A;  3GTP J;  3KX2 A;  2X0L A;  5FKK A;  5H6Q A;  1FOW A;  1FT9 A;  4HF0 A;  1WI3 A;  1DP7 P;  4WF2 A;  2H09 A;  1OMI A;  3PUB A;  3KET A;  3MEX A;  2MGQ A;  2KIQ A;  5KAI C;  4C3J J;  1YW9 A;  3F8M A;  2IS4 A;  2KJB A;  2V1N A;  1R4M B;  1TW3 A;  4IXA A;  2EB7 A;  3OL3 A;  1EA3 A;  3NRV A;  3LSI A;  2X1C A;  1H9T A;  1EH7 A;  3IKV A;  5ILU A;  5ICE A;  2M1B A;  3DBR B;  4M3G A;  3TP0 A;  1FOY A;  4RAG A;  1X4P A;  2EFP A;  3R6S A;  1KQ9 A;  4C2T A;  3ASO H;  5JLX A;  3CUQ C;  4E7H A;  2ME0 A;  1LDK B;  3PNT A;  4AUX A;  1U3E M;  4RB2 C;  2OUM A;  2MBF A;  1SAX A;  3BPV A;  1W7P A;  4A3B J;  1I1G A;  2VOD A;  4HF1 A;  3S17 J;  1FIA A;  2QZ8 A;  3MKZ A;  3K1P A;  4EJU A;  3IL2 A;  4BHC A;  2P8T A;  1WSU A;  3BG6 A;  1LFU P;  2OA4 A;  3AL0 B;  2LBF A;  4M3D A;  1T33 A;  4WXC A;  5D6E A;  4AU7 A;  2ZSH B;  1ETK A;  1DP3 A;  4O3M A;  1BI2 A;  3OV8 A;  4ZYD A;  3SXY A;  2L9S A;  1G6N A;  4ENK A;  3FK6 A;  4ZYA A;  4ENN A;  5M5Y J;  2ZB9 A;  3F6V A;  3CQZ J;  4EAT A;  1LVK A;  3BOQ A;  1FMW A;  2PMH A;  3HXL A;  3CCL I;  5J1R A;  1WJA A;  3MWM A;  1IO2 A;  4HX7 A;  3A4C A;  4G12 A;  2D2W A;  2LC2 A;  1RES A;  3VYR B;  1T98 A;  4HBL A;  3E5Q A;  3QAH A;  2MLK A;  2KIS A;  3CDI A;  3BJ6 A;  3QU3 A;  2GQQ A;  2EFQ A;  3PJR A;  2CU7 A;  4NC8 A;  3G71 I;  3IRR A;  1S7A A;  4Q4Z F;  1VQP I;  2CSO A;  4H4K C;  2VON A;  3KP7 A;  3FZV A;  3TL4 X;  1MKM A;  2K5C A;  4FE4 A;  3FIW A;  5BOX A;  1XS9 A;  1N78 A;  5E79 C;  4NHJ A;  1HKS A;  1MBG A;  3JRC A;  5AIQ A;  1HSJ A;  1A35 A;  2VOP A;  2EZI A;  1FP2 A;  1GXQ A;  2LKS A;  3CDL A;  4YIF A;  2E34 A;  3GEZ A;  1FEX A;  2RNJ A;  3UNG C;  4R8H A;  4YFX F;  1PDN C;  4RB3 C;  1FYM A;  5EF6 A;  2L01 A;  4IHT A;  3OYF A;  4HSR A;  4JK1 X;  1D5Y A;  5LEK A;  1K61 A;  4L9N A;  3I54 A;  2EBI A;  2R7O A;  3OMY A;  3WTS C;  1XSX A;  2B9S A;  3CO7 C;  3FXK A;  2L7K A;  3BY6 A;  5KNL A;  1OFC X;  1W0T A;  1XSD A;  5IP7 J;  2L5Q A;  5D4S A;  2COM A;  4M6V A;  4CDG A;  3M07 A;  4OU0 A;  5IY5 H;  1P92 A;  4JBA A;  2JVH A;  1MBF A;  1TBX A;  5F0H A;  2DFH A;  2FSW A;  2JSC A;  5HDG A;  2DMQ A;  1VQO I;  4Y7N J;  1MNE A;  1TT5 B;  3LNQ A;  2GIZ A;  4EEF G;  4IO9 F;  2R3S A;  3MKW B;  3GLL A;  3H35 A;  3RYR A;  2K4B A;  4CYC B;  4HLX A;  2KJC A;  1LQ1 A;  1APL C;  1H89 C;  1M1E B;  3LQQ A;  3V4G A;  2DA3 A;  2FE3 A;  4RGS A;  4GYI A;  1GVJ A;  4ASN A;  1LFB A;  4I01 A;  3O6B B;  5FO5 A;  3X2Q H;  3W6V A;  3F6O A;  2KIU A;  4ZZD A;  3F8C A;  1EH6 A;  3O8G A;  1Y0N A;  3QU6 A;  5F1R A;  1ITY A;  1WCM J;  3A0B C;  1D8K A;  1X2M A;  1LDD A;  3DEW A;  5K7Z A;  1ERD A;  3KP2 A;  4OIP F;  4W1U A;  4PSW A;  1JKQ C;  3BJA A;  2PX9 A;  5GAG J;  3I56 I;  1HW1 A;  4Y15 A;  3GCM A;  2I8D A;  2EV5 A;  4UUT A;  5E1W A;  3K70 C;  4M3E A;  3Q0U A;  3WU2 C;  4LIU A;  4N4N B;  2PN6 A;  4G6D A;  2Y69 H;  3D0S A;  3HOW J;  4XQF A;  3Q9V A;  1P4A A;  4HQE A;  2VPL A;  2AHQ A;  3BR5 A;  4J01 A;  1A36 A;  3OYE A;  4L5E A;  3VDX A;  1IDY A;  3LSK A;  3SQN A;  1S7E A;  2Z9O A;  2QUF A;  2AQE A;  1Y8R B;  3WU1 B;  4Q48 A;  1YI2 I;  4Y3O A;  4D5F A;  2BE5 F;  4QIW N;  1U9N A;  2F6C A;  1QPI A;  3WE2 A;  2VUM J;  1O3R A;  4A69 C;  1GUU A;  2QF7 A;  1ZRE A;  3TW6 A;  1UCR A;  4PJ0 C;  5CKT A;  5BPD A;  1SC7 A;  3CMM A;  5LGT A;  3ZMU A;  1AKH B;  3BZK A;  5CPR B;  3AG3 H;  3B6A A;  2LLK A;  2R7W A;  4LB5 A;  2XSJ C;  2L9R A;  2E36 A;  3TQN A;  3M4O J;  2DYR H;  1JE8 A;  3TED A;  2LOO A;  2IVM A;  3EUK L;  5HDN A;  3OYH A;  1D0Y A;  1EJ9 A;  4XIC A;  1OYI A;  3FXU A;  1FLI A;  4IHV A;  3G1M A;  1A6Q A;  1KYZ A;  1Z05 A;  1X3Z B;  2M7B A;  2DOD A;  4JQF A;  2LRD A;  1ZAO A;  3L2R A;  3K1N A;  2GXB A;  3M1E A;  3J81 K;  3CP8 A;  4KT5 C;  4PJN A;  4II3 A;  1JXS A;  3JRG A;  3FM5 A;  1DUX C;  4HLY A;  4AYB A;  1K78 B;  1YS7 A;  2WAF A;  3J81 Z;  1QU3 A;  2HVQ A;  2A07 F;  4I0B A;  2E1C A;  4QSH A;  4J00 A;  2WC2 A;  1NK3 P;  3BG5 A;  4QTR A;  4D1Q A;  1VTN C;  4UXN A;  1JHH A;  3SEQ A;  2E1N A;  3HUG B;  3JTG A;  4ZDO A;  2FD5 A;  2EIM H;  3WGG A;  4U7B A;  2HZT A;  2MA3 A;  3ECO A;  4C3H J;  3DV8 A;  2DJI A;  1XN7 A;  1G59 A;  4D7M A;  2QSF X;  3VFZ A;  1JT0 A;  3CF5 F;  2XV4 S;  4IOC F;  3BC8 A;  1R5I D;  2DYS H;  4CCN A;  4AC0 A;  2EA4 A;  3W2V A;  1FTT A;  4ZC3 A;  1LE8 A;  1EF4 A;  4E7I A;  3KYD B;  1ONV A;  3K4C A;  3RKX A;  2Q2E A;  2VJJ A;  2A69 F;  4IHY A;  2FXA A;  5DM7 F;  1FTZ A;  3KPH A;  4NUB A;  3KLN A;  2H8R A;  3OYG A;  4EGY A;  1LUJ B;  2EA2 A;  2VQC A;  1DDN A;  3S32 A;  5ILS A;  4BHP A;  3EQL F;  2VE8 A;  2FF4 A;  2VOO A;  1N25 A;  2DMT A;  1X4O A;  2Y9Z A;  1G3W A;  3QPL A;  3IUO A;  2O5R A;  3CCE I;  4XRF A;  3L2C A;  2VBZ A;  1VF9 A;  1SFO J;  1B72 B;  1A04 A;  2DCE A;  1S7O A;  2LH9 A;  1XGS A;  1ZR4 A;  4A93 J;  4MGR A;  2QYO A;  1V5G A;  2XUB A;  1IN4 A;  5K1Y A;  2P5L C;  5CVU A;  1FMV A;  4NQW A;  1E3H A;  3GZN B;  3OR2 C;  2IS2 A;  2DA6 A;  3ZQC A;  1MW7 A;  3SYT A;  4F93 B;  5ICF A;  4FAS D;  1R58 A;  2R7S A;  5J8C A;  1U0J A;  3SHF A;  2DO7 A;  2ZXI A;  3E7L A;  5HNH A;  3KP4 A;  1YIT I;  4EM1 A;  1U78 A;  2FOK A;  4UV8 A;  3RDI A;  2P5K A;  1XGN A;  4IRI A;  4N4O B;  5HLH A;  4X6A J;  3TKY A;  2BVM A;  2PFB A;  2MH2 A;  3BG3 A;  1XB4 A;  3REO A;  2WBM A;  2BVL A;  2V1D A;  5GPC A;  3MQ0 A;  1TL8 A;  2LY9 A;  1BJA A;  1WPK A;  5EGO A;  1O3T A;  2HGC A;  1F1Z A;  1WFX A;  2JUC A;  2P6S A;  2F4O B;  4FT8 A;  3TW7 A;  5FJ8 J;  2R7T A;  4XOT A;  3VEP A;  4RLF A;  3TOB A;  2BY3 A;  3SDG A;  3D5R C;  1V55 H;  3OR1 C;  2ZXH A;  2XHK A;  3HRM A;  2CG4 A;  3E6B A;  4F7Z A;  4UB6 C;  4BAY A;  4YIR X;  2HKO A;  9ANT A;  4Y13 A;  4GCV A;  2X85 A;  3HC7 A;  2FML A;  2F4I A;  2W57 A;  4D9J A;  4HNT A;  3K0L A;  3J80 K;  3A2K A;  4N0B A;  4DIQ A;  2HFH A;  1TT0 A;  4BE0 A;  3BZ6 A;  4A5M A;  1KU2 A;  3HB9 A;  3HTS B;  3GBG A;  2M87 A;  4MQV A;  3J80 Z;  1OIS A;  3LA7 A;  3KYC B;  3JRB A;  3SFI A;  4OWR B;  2OU2 A;  3M8E A;  5HDK A;  4LGW A;  3EUH A;  3S8P A;  3ZP5 A;  2GZW A;  2PG4 A;  4U0V A;  2FNA A;  4LLL A;  1BL0 A;  1G2H A;  1UAA A;  2Z1D A;  1ZTR A;  1R1U A;  5BQT A;  3BTL A;  1FOX A;  2L02 A;  2R5Z B;  4I2O A;  1B9N A;  3AG4 H;  4HX8 A;  2PMZ A;  2V1X A;  3G3Z A;  3OIP A;  3Q3S A;  4MLO A;  6PAX A;  2W82 A;  1WH7 A;  3S2W A;  2M34 A;  2VJ5 A;  2A6T A;  2R7Q A;  2ZME A;  2H6B A;  2RNG A;  2WAQ A;  2JA6 J;  3GTL J;  2BZT A;  1S3J A;  2DQR A;  3SEZ A;  2LMD A;  4DW6 A;  2BY1 A;  1B8I B;  5GTH C;  2K3P A;  4B09 A;  5FGM A;  1K7A A;  3R60 A;  5DS9 A;  4AID A;  3A01 B;  4CGZ A;  3RKQ A;  3FXM A;  5F64 A;  2HVR A;  1O3S A;  1E0E A;  5E1Z B;  2KIF A;  2MAB A;  4JX5 A;  2GA2 A;  2MH9 A;  1GV5 A;  3R61 A;  3O2P E;  3DEU A;  3DLL F;  2Z99 A;  2CV2 A;  5JVG F;  2ACJ A;  2NOG A;  2CUZ A;  2EIJ H;  4N9I A;  2O8K A;  3A1Y A;  2Y0S A;  1GLN A;  4AIJ A;  1R5G A;  1W5S A;  1T0F A;  4M3B A;  1AA7 A;  1YQA A;  5KK1 A;  4E7K A;  3KLO A;  3MCZ A;  4A3C J;  2A61 A;  3P5J A;  2CS3 A;  1RZ4 A;  5E20 A;  5EDN A;  3HGG A;  2K85 A;  2BW3 A;  3N05 A;  2WA0 A;  3OYB A;  2E1M B;  2D45 A;  1ZAR A;  4G7O F;  3JTH A;  2JTV A;  1MMA A;  2AXT C;  2VXZ A;  3PNV A;  3OWT A;  2IA0 A;  2VJI A;  4AM3 A;  2E2I J;  2PJP A;  3K9T A;  3GTQ J;  1YS6 A;  3OYN A;  5D5U B;  4DBQ A;  2Q8K A;  2EWN A;  3IP4 B;  2O0Y A;  1T2K A;  2XB5 A;  3HPH A;  1U6G A;  2HPI A;  4CA0 A;  2M4K A;  1VQN I;  3DPL C;  5EZH A;  2HWV A;  2JT1 A;  4PDK A;  2DTR A;  4EM2 A;  2KZV A;  1VFC A;  1MMN A;  4BYY A;  5M3M J;  2DMN A;  1QZZ A;  5TRD A;  3CDH A;  1Y1V J;  5GAD J;  2A6E F;  2Z16 A;  3ZR8 X;  3BP8 A;  2NS0 A;  3P7N A;  2H8W A;  5F0C A;  4U7D A;  1R1V A;  2Q0O A;  2X6W A;  4CHU A;  1YJ9 I;  1XSV A;  5DDG A;  2QBY A;  2XDV A;  4MNU A;  3S15 J;  4LIV A;  2P5V A;  2FU4 A;  1SVM A;  2TCT A;  3W2A A;  4GRI A;  2PJR B;  4EVI A;  2KDO A;  2GBY A;  2OBP A;  4XRS A;  2VT2 A;  3LL7 A;  1Z91 A;  2V79 A;  2Z3Y A;  3GZ5 A;  1YFH A;  4DGW B;  3K4K A;  2ELH A;  4KT6 A;  2ADU A;  2XF7 A;  1FBU A;  2IGO A;  1K6O A;  1X19 A;  4B3A A;  2LYC A;  1IJW C;  1BW6 A;  4PJL A;  2LK2 A;  3LMM A;  2ZNZ A;  3SZG A;  3I4P A;  1YO5 C;  4A3I J;  5FLX K;  2HI3 A;  1I27 A;  3OS2 A;  3PQK A;  3H0D A;  5E3L A;  1W36 C;  4EJV A;  3RQ4 A;  3K1M A;  4KNY A;  3F8F A;  3BR2 A;  2CQK A;  3C3W A;  1F5T A;  1GDT A;  2LVS A;  5JLW A;  4OIQ F;  5FLX Z;  3VOE A;  2XAS A;  3H9G A;  4EQQ A;  5E3N A;  1X2N A;  2MG4 A;  4A5N A;  3NQO A;  2LNB A;  4K2E A;  3QOP A;  2R0Q C;  1Z21 A;  3H1C A;  1VQ6 I;  3L9F A;  2Z5U A;  3DFG A;  2MFZ A;  2DTZ A;  3CUQ B;  3ML6 A;  3HOZ J;  1J9I A;  2G0E A;  1REP C;  5IPA A;  4BE1 A;  5LEJ A;  1ETO A;  2R5Y B;  1IAW A;  5C3E J;  4I76 A;  1R4N B;  5DCM A;  5GPA A;  4XLA A;  4MO7 A;  4OAY A;  1ETV A;  1EV7 A;  2F4M B;  5FD6 A;  2HYJ A;  1SD4 A;  3KZI C;  1LJ9 A;  2XGE A;  2K9S A;  2QCO A;  2WY8 Q;  2Z2S B;  3HTU A;  1MBE A;  3ZOB A;  3FBI B;  1FBQ A;  3BLY A;  3JCU C;  2KDZ A;  3OSG A;  2UUZ A;  4S0H B;  1CQT A;  2LKX A;  2M9H A;  5DUI A;  2W4S A;  4MEY F;  2JA5 J;  2X6Y A;  2WV0 A;  4JX4 A;  2M3A A;  4RB1 A;  1OCZ H;  3FF5 A;  1J2X A;  1T08 B;  1WGX A;  1BW5 A;  3IH4 A;  3BRO A;  1RR8 C;  3D5S C;  4PJM A;  3UKG A;  3CD6 I;  3CC2 I;  1HST A;  1ON2 A;  2DT7 B;  2HTJ A;  5DD8 A;  3RKY A;  3ZQG A;  5IT9 K;  2NAZ A;  2XAU A;  2NXN B;  1ZG5 A;  2QWW A;  1YRN B;  3PIP F;  3HRU A;  4HV5 A;  2NRA C;  2HOS A;  2VN2 A;  3DQV C;  3EUA A;  3M8F A;  4E7S A;  1ZLK A;  4FQG A;  2FEZ A;  3CUO A;  3OIO A;  3F72 A;  2OZ6 A;  4NB5 A;  2QQ8 A;  1WI9 A;  5IT9 Z;  1BR2 A;  2VT3 A;  5DCF A;  5ILV A;  1RKT A;  3RYP A;  2M4G A;  4BGD A;  3KZY A;  2Y31 A;  4IHW A;  4C30 A;  1BR1 A;  1OYW A;  2O9L A;  4KYW A;  2K40 A;  1DGW Y;  2G9W A;  4HOB A;  1IXC A;  1Z0X A;  3D1N I;  4XKV A;  1I6H J;  3KP5 A;  4NDL A;  3LSP A;  4P1W A;  1ZR2 A;  1FSH A;  1T8I A;  5FFZ A;  2X48 A;  4N9H A;  5DV5 A;  1HQC A;  1XTA A;  3MVP A;  1A5J A;  3SJM A;  3JRI A;  1Z3X A;  4ZJZ A;  2R7D A;  1IDZ A;  1W4M A;  4PFO A;  4W97 A;  1A31 A;  5J8F A;  3TO9 A;  3CCS I;  4D7N A;  4S04 A;  1MDM A;  4DYC A;  4XSX F;  1VQK I;  1G3T A;  3K2Z A;  2BBY A;  4XN3 A;  3F21 A;  2CV0 A;  1KU9 A;  2PEX A;  2NVT J;  3TOA A;  3I59 B;  1R7J A;  4XOR A;  4UNO A;  5EG0 A;  2K02 A;  4A12 A;  4II2 A;  2HYG D;  3U9G A;  1XPX A;  3FM3 A;  1QGP A;  3DLA A;  2FQ3 A;  1BJZ A;  4IPA A;  3TGN A;  3HPG A;  3Q0W A;  1BOA A;  5LHG A;  4EGZ A;  1RI7 A;  1MIJ A;  3B6C A;  4L9V A;  3BT9 A;  2L7M P;  2P0W A;  2PMZ N;  2ZO4 A;  4OIN F;  5C4X J;  3BZC A;  4RS8 A;  5IOY A;  2FA5 A;  1FP1 D;  3JW4 A;  3AKZ A;  1MND A;  1LKX A;  2OQR A;  4XLF A;  3K4L A;  2KRH A;  5BMZ A;  2O03 A;  1USS A;  4LB6 B;  4BE2 A;  1BBY A;  5LLQ A;  5FLV A;  4PUS A;  1W7P B;  4HQM A;  2GXG A;  2WWY A;  1SFX A;  4B44 A;  4IJA A;  1FZP B;  3K4M A;  3S2H J;  1NH3 A;  1X1C A;  4BY7 J;  4A3K J;  2XKP A;  5GAE J;  1HKQ A;  3JAM K;  5JFR A;  1TZL A;  5BNG A;  5FD5 A;  5ICG A;  1D0Z A;  2HQA A;  4KN4 X;  4KA4 A;  3F8B A;  4CO8 A;  1JUS A;  3OYD A;  1YOV B;  2XAG A;  3MMY B;  1U5T C;  3HM5 A;  4B4C A;  3CJR B;  3JAM Z;  2QQ9 A;  5H20 A;  1RUO A;  4B1R A;  3E6D A;  1YHQ I;  3K7A J;  4A3E J;  1IRF A;  1FC3 A;  3WTT C;  1I3A A;  2ID6 A;  2ISY A;  2XIG A;  2CFX A;  2K9Q A;  3AG2 H;  4MQ9 F;  1ETY A;  4NC6 A;  4DOZ A;  1D5V A;  1MJB A;  1R9T J;  4G9Y A;  1TTY A;  2OAZ A;  4XBF A;  2E5Z A;  3I5U A;  5HNF A;  3CF2 A;  1X58 A;  3L7W A;  1BI3 A;  1WHU A;  3WTV C;  4R79 A;  1UHS A;  2F5F A;  5TGT A;  4UB8 C;  3HOT A;  5KVR A;  1J09 A;  3U2R A;  3I4M J;  3FXO A;  5CYV A;  4CYC A;  4HG2 A;  4EJW A;  2EK5 A;  4IQ4 A;  5ERI A;  3QYB A;  1EH8 A;  2F5C A;  3GWZ A;  4PGH A;  1WJF A;  2RVC A;  4Z6Y A;  1HDD C;  5HS7 A;  2I5U A;  3OS0 A;  3S1N J;  5D5X B;  2DA5 A;  5LHI A;  3CJN A;  2JJ7 A;  4F52 A;  3A02 A;  4AD9 A;  4FTH A;  1I50 J;  1W5T A;  1T95 A;  2VBX A;  3VB2 A;  3P9I A;  4FX0 A;  2F48 A;  2H6C A;  5KHD A;  2XPW A;  2YUS A;  4B8X A;  4V2F A;  1OCO H;  3HOU J;  1ON1 A;  3FKI J;  3TDZ C;  2HQN A;  3KP6 A;  5C44 J;  2JVG A;  1UG0 A;  2RGV A;  5FRM A;  2X1E A;  3COA C;  1KYW A;  5J4V A;  1SD6 A;  1HF0 A;  2XF5 A;  5LRS A;  1HXD A;  5AIP A;  1V4R A;  2CFO A;  3DU6 A;  1I5Z A;  3NWS A;  2MYS A;  4XRM A;  1P7I A;  4X0G A;  1MBJ A;  3S1M J;  3K2A A;  3BTJ A;  2VPR A;  5IYB J;  1BA5 A;  2ELJ A;  2LP0 A;  2GWR A;  3I71 A;  2XRN A;  4LOC A;  4MTD A;  4XRS G;  2RC4 A;  4BDY A;  2WB1 N;  3RJP A;  3DCF A;  2XPV A;  3H92 A;  3DXJ F;  3L1P A;  4ITV A;  2JRT A;  4XLC A;  3KE2 A;  3S14 J;  3DPU A;  2LF7 A;  1VQ5 I;  3E1S A;  1Z9C A;  2R4G A;  3EET A;  4KIB A;  2XAH A;  4B47 A;  4FIS A;  4KN7 X;  3ZCO A;  1AOY A;  3L2Q A;  1WH5 A;  4PFP A;  2VC0 A;  1IW7 F;  4CZC A;  2EZL A;  1QVU A;  2ZC2 A;  3DF8 A;  4E7J A;  5HS9 A;  2W25 A;  2V9K A;  3BR6 A;  3FMR A;  2O61 A;  4HRI A;  3C1D A;  1TQP A;  3WE3 A;  2ICW G;  4QPO A;  4IX7 A;  1D3Y A;  2DA1 A;  5HLG A;  3A0H C;  5J1U A;  5CJ9 A;  1Z7U A;  3ZGK A;  3EDP A;  3ZQH A;  1O7L A;  2ZFU A;  4A3L J;  3M9A A;  4M71 A;  2CMP A;  3WHB A;  4UVA A;  4JYK A;  2MC4 A;  3SDB A;  1UJ8 A;  1V5F A;  1R23 A;  2FX0 A;  4FHT A;  4I98 B;  4OIO F;  3J7Z I;  1IC8 A;  1QHH D;  2L7Z A;  1OR7 A;  2XB0 X;  4WX9 A;  3LFK A;  1OCC H;  3H3Z A;  4XLN F;  4LG0 B;  2IXS A;  4BQN A;  4A2U A;  3AAF A;  4MEX F;  3MKL A;  3HUG A;  1VQ4 I;  3FHZ A;  1SVL A;  2HOE A;  2K9N A;  2WAE A;  3I0T A;  4MIM A;  3IHU A;  2BV6 A;  1ZQ3 P;  1L3L A;  1ACI A;  4KDP A;  3P9C A;  5GP9 A;  3BR0 A;  3CLO A;  1WQ2 A;  4DYR A;  4HDV A;  1VQM I;  1IRZ A;  2F5D A;  3L2U A;  3MAJ A;  3QWL A;  1Y1W J;  3GUD A;  2JUG A;  2UXN A;  3SZP A;  5HS8 A;  4BU2 A;  4L9T A;  4IRH A;  3W6J B;  5E17 F;  3KZZ A;  1V54 H;  4XNF A;  1B1B A;  5KCM A;  5IP6 A;  1WJD A;  2Z33 A;  3T5X A;  1LEA A;  1B9M A;  2XAJ A;  1UB9 A;  3G1L A;  3K4J A;  4R1H A;  2IW5 A;  4A3D J;  4YG2 F;  5FLM J;  1JTY A;  4G6Q A;  1B6A A;  3ABL H;  3ZMZ A;  4JX6 A;  1S8N A;  2YU3 A;  3KEO A;  3IWZ A;  4M9S A;  1D1A A;  3RZD J;  1QHG A;  3W6K B;  5E3M A;  4M74 A;  5LHH A;  1Q1V A;  2YR2 A;  2KT0 A;  3V8J A;  4KIS A;  1H8A C;  2CRG A;  5BS6 A;  1UEL B;  2H1L A;  2ZXW H;  2EZH A;  1T38 A;  1FIP A;  4WXD A;  3MZY A;  2ESH A;  3PM1 A;  2M7A A;  1QRY A;  4UVC A;  1HKT A;  1LE8 B;  3HSR A;  4HA8 A;  4KIG A;  3FXQ A;  3PQJ A;  3R4K A;  4ETS A;  4UUV A;  2QEN A;  2R7X A;  4P5O A;  2Q2E B;  2KPM A;  2IP2 A;  4L5I A;  1U9O A;  1SAN A;  2DXI A;  3E5U A;  4U87 A;  4B48 A;  3HOS A;  1J75 A;  2WV1 A;  1WKM A;  4AWX B;  2LR8 A;  2QGU A;  2DMU A;  2L9N A;  4CUG A;  1O4X A;  1SD5 A;  5CVV A;  1MSE C;  2JK3 A;  2OPT A;  1BIA A;  2COB A;  2KP6 A;  2CUJ A;  2XRO A;  2UV1 A;  2JPC A;  3LSM A;  3QYF A;  2VIX A;  5LRR A;  2DDB A;  4XMY A;  2R7Z J;  1MGT A;  2O8X A;  2CQX A;  4YEL A;  3N97 A;  2B0L A;  4E7L A;  1KON A;  2DA4 A;  4A3G J;  1OCR H;  4CZZ A;  3K69 A;  3WTX C;  5CQE A;  5JHU A;  3JSP A;  1IG7 A;  5IYD J;  2XAQ A;  3WTZ A;  1G4D A;  4RB0 A;  3GTK J;  4ANJ A;  2HKX A;  2Y2Z A;  4LJZ F;  1R49 A;  2P7V B;  4I0A A;  3W3C A;  4RM2 A;  2VKV A;  3B73 A;  3ZMS A;  1W7P D;  1V3F A;  1VZ0 A;  2LFB A;  1YG2 A;  4G94 A;  1IV6 A;  3T8T A;  2E35 A;  2VXD A;  1ORK A;  3G1O A;  2WAD A;  4DYQ A;  4GYG A;  4NBQ A;  1F4K A;  5IP9 J;  4RM3 A;  4CH7 A;  1OLT A;  4ZDP A;  2MC3 A;  1T6S A;  3K70 D;  3LA2 A;  2LY1 A;  3JRH A;  4XKW A;  4M9Z A;  2HXO A;  4QLC U;  5EGO B;  2JA7 J;  2DBB A;  4XON A;  2JA8 J;  5FRN A;  4YRV A;  5KAF C;  2M2E A;  1HLV A;  1BI0 A;  3HKZ A;  3C2B A;  5DD4 A;  3J7A O;  2R5Z A;  1B4A A;  1BN5 A;  2JWT A;  1TWC J;  3CMY A;  1VQ9 I;  2Y75 A;  3E6C C;  2X6X A;  1ZGA A;  4CIC A;  2X9D A;  1YYV A;  4EM0 B;  2OJE D;  5K5O A;  4IHX A;  2CJJ A;  4GXO A;  5M5W J;  4IOA F;  2D5V A;  3IKT A;  1KU7 A;  4D0P A;  2E7X A;  1XGO A;  1T56 A;  2GAU A;  3C7J A;  4CCJ A;  3J7Y J;  2HTS A;  1Y0U A;  1QVT A;  4PSX A;  3A01 A;  4IVN A;  2UWM A;  3ULQ B;  1R6R A;  5JI6 A;  1I6X A;  3KYL A;  1ZHF A;  3HEF A;  1XCB A;  1P7J A;  5A2Q K;  1STZ A;  2CH0 A;  3FKJ A;  3ECH A;  4IL6 C;  3Q5F A;  3FMS A;  1AU7 A;  1OYY A;  1PP7 U;  4BEH B;  3LOC A;  3JSO A;  3EYI A;  2HOT A;  3IV5 A;  2AXL A;  3OOU A;  2A3S A;  1G3Y A;  2KRC A;  3PNY A;  1SMT A;  2HYF A;  1TLH B;  1MZB A;  2IGK A;  5B5E C;  1FBS A;  3S3O A;  4M6Y A;  1LNW A;  4LK1 F;  5A2Q Z;  2VE9 A;  2LSO A;  1XGM A;  2ZME B;  3ZXS A;  2GOX B;  3I58 A;  3L09 A;  3CLQ A;  5EZG A;  3FXL A;  3IAM 2;  4RA2 A;  1SFE A;  2EZK A;  4I09 A;  1NG6 A;  1KQ8 A;  1ZRF A;  3RIR A;  2HS5 A;  1L0O C;  4Z2Y A;  1BOB A;  5K5Q A;  4ENM A;  1PYV A;  4KIF A;  2GA1 A;  3V7C A;  4BL0 B;  2W1O A;  5D5W B;  1OCP A;  3FBN B;  2OQG A;  2YS9 A;  1NG7 A;  1E3P A;  1QZY A;  1LVA A;  4Y33 A;  5FB2 A;  1YX5 A;  1LB2 A;  1IGN A;  3ZQ7 A;  4RAF A;  3JRE A;  3G2B A;  5L3E A;  3DKX A;  2OCC H;  5L3G A;  3BG9 A;  4EV0 A;  1Y8Q B;  1UFM A;  1Z77 A;  4UV9 A;  1C0W A;  3CMA I;  4XLP F;  2CUE A;  3ZMT A;  1I39 A;  3CES A;  2DA7 A;  3HG9 A;  4UUS A;  3VOD A;  1UG2 A;  2CUF A;  1K4T A;  2BW3 B;  3IAS 2;  3ABT A;  1RIO H;  3BTC A;  4LFU A;  2H27 A;  3AFH A;  2PJR A;  1WJC A;  1FY7 A;  5J3L A;  1UST A;  1QZE A;  3RZO J;  1X1B A;  3EUH C;  3ISP A;  4RAZ A;  2V9P A;  2LKP A;  1ZGW A;  4ZYG A;  1CF7 B;  4AYB N;  1YTY A;  2NVY J;  4G6T B;  4I99 C;  2IJL A;  1G3S A;  4IRG A;  1RNL A;  1RR7 A;  4M72 A;  2KMU A;  1RKW A;  2NYX A;  3ABU A;  3IH3 A;  3RPU D;  3CCU I;  2VLA A;  3ZMV A;  5IYC J;  3GZ6 A;  3M1C A;  3ELK A;  1TQM A;  4ESF A;  2V26 A;  2ZME C;  4J19 A;  1F43 A;  3HZJ A;  5E8G A;  1W5C C;  2GLO A;  4AVP A;  4BBR J;  3R0J A;  5HOD A;  2E60 A;  1OCT C;  3NEU A;  2QBY B;  1YX3 A;  4B43 A;  1O57 A;  3CME I;  5K7F A;  1MMD A;  2EIK H;  2PLY A;  4BXX J;  4XSZ F;  3K4N A;  5CQG A;  2HR3 A;  4EJO A;  3QPH A;  3CUQ A;  3CCY A;  3HHH A;  3M3Y J;  3LFU A;  1IUF A;  2DU9 A;  4L18 B;  3O8H A;  1PUF A;  2K27 A;  2R5Y A;  2ZJR F;  4ZH4 F;  5H6R A;  4H0E A;  1MBH A;  1JJ6 C;  2V1U A;  2E7W A;  1ETW A;  4BBS J;  1OKR A;  3GFM A;  5FKN A;  3HRT A;  2GIV A;  3JRD A;  3S93 A;  1FSE A;  3CP2 A;  2E5N A;  2QQB A;  2K3F A;  1T0F C;  3F0C A;  3OL4 A;  3GTM J;  2AO9 A;  3JR9 A;  5J1Y A;  2CW0 F;  2ZKZ A;  4BJ5 C;  2DFF A;  1I3Q J;  1BI1 A;  2I10 A;  2F2E A;  5E3O A;  4E4H A;  3PIO F;  4KJZ A;  3IH2 A;  4HX4 A;  3U21 A;  3L2V A;  3CO6 C;  4ZDL A;  4A3M J;  3KP3 A;  1K6Y A;  2XGD A;  3GME A;  3KEY A;  2DOA A;  1UMQ A;  2JSP A;  3F22 A;  3MFK A;  3TMO A;  5L3B A;  1E2X A;  5HVQ C;  2HZD A;  3O3K A;  2P4W A;  3MZ8 A;  4S05 A;  1JKP C;  3WG7 H;  1VQ7 I;  2ID3 A;  3QP5 A;  1YIJ I;  5DCM B;  1Z67 A;  1OJL A;  2ECC A;  3WHC A;  5DM6 F;  4EJT A;  2QVO A;  3WOD F;  3MZH A;  2M0C A;  3LWF A;  2IAI A;  5LGU A;  3FIS A;  2KFD A;  1DGR M;  2EV6 A;  2IGN A;  2NVU B;  2VQG A;  2DFE A;  3LSG A;  2RV8 A;  1U5T B;  2YPR A;  2VJ4 A;  2ZJQ F;  1H0M A;  2CW7 A;  5F6F A;  5L3C A;  2Y48 A;  1YJW I;  5EEG A;  4BH9 A;  4ESB A;  2DJN A;  5GTI C;  2E19 A;  2VL8 A;  4ON0 A;  3H5N A;  4Q47 A;  5FRO A;  3V7S A;  2K4J A;  1P4W A;  3I9V 2;  2W7N A;  4UY8 I;  3I53 A;  4EMS A;  3DKY A;  1ZYR F;  1SFK A;  2KKO A;  3CZ6 A;  3WTY C;  4BQQ A;  1E17 A;  4BAC A;  3GO5 A;  3I59 A;  1R22 A;  2ME6 A;  2QM3 A;  4HST A;  2IRF G;  4CYD A;  3DTK A;  2V4J C;  3IRQ A;  2BOL A;  2IPQ X;  3NWT A;  3GXO A;  3HKZ N;  5LBQ A;  2QQA A;  2OZU A;  4XL9 A;  5DUK A;  2A68 F;  4BUP A;  3J7A Y;  2BXZ A;  4Q5S F;  4AIH A;  2JN6 A;  4M3F A;  2UZK A;  2DW4 A;  3ZQI A;  2DK5 A;  3R0A A;  3KCC A;  2K7L A;  3DBL B;  1RRJ A;  1FYL A;  3HJE A;  2FMY A;  1H9G A;  2X51 A;  2R7R A;  5B1B H;  3LSJ A;  1R00 A;  2RAE A;  1TNT A;  5F04 A;  3V8L A;  2NS7 A;  3S16 J;  1XMA A;  1MDM B;  1YIO A;  2WAQ N;  1ZK8 A;  3ABM H;  2EQR A;  2W85 A;  4GGG A;  1VQL I;  1ZN2 A;  1GXP A;  2VQL A;  3TP3 A;  4A0Z A;  1XDU A;  1W0U A;  2YU9 J;  1ODD A;  1HC8 A;  5EG0 B;  5B66 C;  1MMS A;  1ULY A;  5EYR A;  3ZRG A;  4RMN A;  3ZQQ A;  2GXA A;  2LBF B;  4A0X A;  4HNV A;  3PO3 J;  1LEB A;  3VSL A;  2EPF A;  2G7H A;  2HDC A;  2ZFW A;  5D4R A;  2HU9 A;  3DBH B;  2FNP A;  3H9J A;  1MMG A;  1P6R A;  1TWA J;  3MD2 A;  2NVX J;  2ELK A;  3GX4 X;  4CCM A;  4U88 A;  1J0R A;  1QBJ A;  3WG9 A;  2KZG A;  1RUN A;  1UZC A;  5B1A H;  4Y52 J;  2DDA A;  5DTD A;  5K7H A;  5E8I A;  5C4J J;  2Y0S N;  1P2F A;  1YW8 A;  4OMZ A;  3TDU C;  3OYC A;  4BHB A;  1Y39 A;  4XKC A;  2OV7 A;  3DWL E;  1GT0 C;  3GVA A;  2BY2 A;  2Y0M A;  5J4Y A;  3GTJ J;  3HIF A;  2R92 J;  2DOF A;  3HOV J;  1K79 A;  4HF2 A;  1KA8 A;  3BCB A;  2Y30 A;  3L00 A;  1HBX G;  4Y4R A;  3ZPL A;  4RLQ A;  2AS5 F;  5JHF A;  2DPD A;  1DU0 A;  4GDF A;  2OCE A;  2JQ7 A;  3QQA A;  4WCG A;  3C18 A;  4DZJ A;  2KIM A;  1W36 D;  2QEX I;  4HW0 A;  1RC9 A;  4PGG A;  2EIL H;  3DKW A;  1K4S A;  3LST A;  2HPM A;  1J7K A;  3LSR A;  4MFE A;  1N77 A;  2HXI A;  4C3I J;  2IA1 A;  2BXY A;  4G8X A;  2JMW A;  3CJQ B;  4E70 A;  2M8E A;  3S2D J;  3LA3 A;  5DYM A;  2XF6 A;  3BQZ A;  1JJ8 C;  3HOX J;  3GFJ A;  3DEE A;  5GAH J;  2CV1 A;  3CJT B;  2IT0 A;  5F0F A;  1NHA A;  1A6I A;  1UHW A;  2HQR A;  1PUE E;  3VWB A;  4L0Y B;  2L3D A;  4TV7 A;  5D5V B;  3FWE A;  4I7H A;  5D8L B;  3WTU C;  1XG1 A;  3AL0 C;  1WJB A;  1JUM A;  4PZJ A;  3CCR I;  2ZXJ A;  3GLX A;  1IN6 A;  1D8J A;  2O6G E;  2G7U A;  5J6X A;  2CGP A;  2X1D A;  2A6H F;  2VI6 A;  2BY0 A;  4XN0 A;  1BIB A;  1DPR A;  4U0Y A;  2HDD A;  3OYM A;  1TWH J;  3LAJ A;  3BCA A;  5K5R A;  3CC7 I; 
#chains in the Genus database with same CATH homology
 2FBI A;  4P96 A;  4LLG F;  5D8K B;  4ZYE A;  2CO5 A;  4KIC A;  3TO7 A;  3RI4 A;  1KQ0 A;  1J5Y A;  3E97 A;  3BJO A;  2DPU A;  4L5J A;  2RKH A;  1XDS A;  1R1T A;  2BEO A;  3T1B A;  3BPX A;  2PMU A;  3CTA A;  2VC1 A;  4UHT A;  4L0Z B;  2FBH A;  2O3F A;  1IRG A;  4M73 A;  3Q9S A;  4M6X A;  4KMU X;  3RPU A;  5E1X A;  4KUM A;  1S6L A;  2FRH A;  3H3U A;  5IT3 A;  4YII A;  2J5P A;  4A6D A;  1QNT A;  1K78 A;  4LG0 A;  1FNN A;  4M9X A;  1ZLJ A;  1ZRC A;  5BPI A;  1TQI A;  1QQI A;  1O3Q A;  2DLL A;  2WTE A;  1T39 A;  1QPM A;  1FYK A;  3D5L A;  2K86 A;  2L4M A;  2NNY A;  3E6M A;  1Q1H A;  3N4M A;  3RPQ A;  2H94 A;  3LAP A;  2D1H A;  5LGN A;  1PP8 F;  3KFW X;  5ICC A;  2BYV E;  3PFI A;  2EJR A;  1XD7 A;  1JHF A;  1BC8 C;  3QP6 A;  4AIK A;  5CVJ A;  2IA2 A;  1UHM A;  1FWZ A;  2ZNY A;  4HDU A;  4FX4 A;  3FX3 A;  3GW2 A;  1CGP A;  4P9U A;  2XVC A;  4OOI A;  4I02 A;  2OD5 A;  1IN5 A;  3V7R A;  5FFX A;  1ZRD A;  4DNC A;  3DPT A;  4ZYH A;  4OIR F;  3BWG A;  2YX7 A;  1SFU A;  3T0Y A;  3IWF A;  2EFO A;  5ED4 A;  4HYE A;  3M7G A;  2CWE A;  4RAY A;  3E3V A;  2TDX A;  3P9K A;  4ENJ A;  4ESJ A;  2PBI A;  1MJ9 A;  1IZ1 A;  1DPU A;  2DI3 A;  3F23 A;  4U0W A;  2JPB A;  1Z6T A;  3QRF F;  2M30 A;  4O5V A;  3F8N A;  1R36 A;  2X4H A;  1IXR C;  3F3X A;  5D6F A;  3EYY A;  2JZY A;  3ZN0 A;  4BXU A;  4A0Y A;  3WGI A;  1SD7 A;  4L9J A;  5AON A;  2J5O A;  2DK8 A;  5DEQ A;  3HRS A;  1Z6R A;  4RGX A;  2EFW A;  4YFK F;  4G7H F;  3ZN1 A;  3OOP A;  1J59 A;  3GFI A;  3SZT A;  2NNN A;  3GF2 A;  2FBK A;  1XCV A;  4ZZL A;  3RKW A;  1ZG3 A;  1FPQ A;  2F5E A;  1HW2 A;  1IN7 A;  2ESN A;  4MHG A;  1BC7 C;  2LDU A;  2V6C A;  1KGS A;  2UXX A;  4DQ2 A;  4CXF A;  2EFN A;  4O6J A;  2M45 A;  3FXR A;  4KFC A;  3KEQ A;  1IXS B;  4RGR A;  4LMY A;  3LQR A;  4GO1 A;  1ZH5 A;  4G7Z F;  3HYI A;  3SFZ A;  2HEO A;  3WU0 A;  4WK8 F;  1F9N A;  1U8R A;  4P55 A;  3BDD A;  2DT5 A;  2RDP A;  2RN7 A;  4Y17 A;  1S29 A;  5HLI A;  3ERE D;  1MJA A;  1I1S A;  1AWC A;  3TO6 A;  3WTW C;  4KMF A;  1TW2 A;  2KRF A;  1X3U A;  3T8R A;  3V8K A;  1HW5 A;  5CVR A;  2ZBK A;  1YW7 A;  4YFN F;  5L3D A;  3ROU A;  4P9F A;  3FMQ A;  2YSR A;  1TNS A;  5CLS A;  2STW A;  4LK0 F;  5TJJ A;  4LLN A;  4OMY A;  2P7C B;  1ZGJ A;  4A6E A;  1KU3 A;  2C6Y A;  2ETH A;  4HAM A;  5CVI A;  2R7F A;  1XMK A;  2L4A A;  3QPT A;  1CF7 A;  5L3F A;  4HV6 A;  5JR3 A;  2W84 A;  2W24 A;  2P6T A;  3GYH X;  2DQL A;  2ZCW A;  2A5Y B;  2XGX A;  2VBY A;  1SMY F;  3RTR A;  1B59 A;  4BQA A;  1MD0 A;  2PI0 A;  1Z1D A;  3E5X A;  2DAO A;  1IF1 A;  2VBW A;  4PCQ A;  1ZG1 A;  4QWQ A;  3ZMD A;  2LF8 A;  4MTE A;  3IC7 A;  1P4X A;  5EEH A;  2V9V A;  1YLF A;  4WXH A;  4LD5 A;  2EV0 A;  2XKO A;  2YX4 A;  1FOK A;  2D1V A;  2MD5 A;  1QO0 D;  2L54 A;  3U1D A;  1IUY A;  3I64 A;  3DP7 A;  3GFL A;  5E18 F;  2XAF A;  2STT A;  3B02 A;  4HZF A;  4IHS A;  1R5H A;  1WRJ A;  2ZJ2 A;  2DFI A;  1BM9 A;  1U2W A;  3HSE A;  1JGS A;  2CYY A;  3WGH A;  4IF4 A;  5HOO A;  3HHG A;  1U5T A;  1LDJ A;  1OPC A;  4BNC A;  1O7F A;  4UVB A;  3HSF A;  2MLG A;  2PQ8 A;  1GHC A;  2QLZ A;  2ISZ A;  5JVT A;  4RGU A;  1IN8 A;  3G73 A;  2BGC A;  1WWX A;  2RQP A;  2M5W A;  1FX7 A;  4WWC A;  2X0L A;  5H6Q A;  1FT9 A;  4HF0 A;  1DP7 P;  4WF2 A;  2H09 A;  1OMI A;  3KET A;  3MEX A;  1YW9 A;  3F8M A;  2KJB A;  1TW3 A;  4IXA A;  2EB7 A;  3NRV A;  1H9T A;  1EH7 A;  3IKV A;  5ILU A;  5ICE A;  2M1B A;  2EFP A;  3R6S A;  1KQ9 A;  3CUQ C;  1LDK B;  1U3E M;  4RB2 C;  2MBF A;  1SAX A;  3BPV A;  1W7P A;  1I1G A;  2VOD A;  4HF1 A;  2QZ8 A;  3K1P A;  4EJU A;  3IL2 A;  4BHC A;  2P8T A;  1WSU A;  2OA4 A;  4WXC A;  5D6E A;  4O3M A;  1BI2 A;  3OV8 A;  4ZYD A;  3SXY A;  1G6N A;  4ENK A;  4ENN A;  3F6V A;  3BOQ A;  2PMH A;  3MWM A;  4HX7 A;  2D2W A;  1T98 A;  4HBL A;  3E5Q A;  3QAH A;  2MLK A;  3BJ6 A;  3QU3 A;  2GQQ A;  2EFQ A;  3IRR A;  1S7A A;  4Q4Z F;  2CSO A;  2VON A;  3KP7 A;  3FZV A;  1MKM A;  5BOX A;  4NHJ A;  1HKS A;  5AIQ A;  1HSJ A;  2VOP A;  1FP2 A;  1GXQ A;  4YIF A;  3GEZ A;  2RNJ A;  4R8H A;  4YFX F;  1PDN C;  4RB3 C;  1FYM A;  2L01 A;  4IHT A;  4JK1 X;  5LEK A;  4L9N A;  3I54 A;  3WTS C;  1XSX A;  3CO7 C;  3BY6 A;  1XSD A;  5D4S A;  2COM A;  4CDG A;  4OU0 A;  1P92 A;  4JBA A;  1TBX A;  2FSW A;  5HDG A;  2JSC A;  2R3S A;  3RYR A;  2K4B A;  4HLX A;  2KJC A;  1LQ1 A;  3LQQ A;  3V4G A;  2FE3 A;  4RGS A;  4GYI A;  1GVJ A;  4ASN A;  4I01 A;  3O6B B;  5FO5 A;  3F6O A;  2KIU A;  4ZZD A;  3F8C A;  1EH6 A;  3QU6 A;  5F1R A;  1D8K A;  1LDD A;  3KP2 A;  4OIP F;  3BJA A;  1HW1 A;  4Y15 A;  2EV5 A;  5E1W A;  2PN6 A;  4G6D A;  3D0S A;  3Q9V A;  1P4A A;  4HQE A;  3SQN A;  2Z9O A;  2QUF A;  3WU1 B;  4Q48 A;  2BE5 F;  3WE2 A;  1O3R A;  1ZRE A;  1UCR A;  5BPD A;  5LGT A;  3ZMU A;  4LB5 A;  3TQN A;  1JE8 A;  2IVM A;  5HDN A;  1OYI A;  3FXU A;  1FLI A;  1KYZ A;  1Z05 A;  4JQF A;  1ZAO A;  3K1N A;  2GXB A;  3M1E A;  3J81 K;  4KT5 C;  1JXS A;  3FM5 A;  1DUX C;  4HLY A;  1K78 B;  1YS7 A;  3J81 Z;  2A07 F;  4I0B A;  2E1C A;  2WC2 A;  1VTN C;  4UXN A;  1JHH A;  2E1N A;  3JTG A;  3WGG A;  4U7B A;  2HZT A;  2MA3 A;  3ECO A;  3DV8 A;  1XN7 A;  3VFZ A;  2XV4 S;  2EA4 A;  1ONV A;  3RKX A;  2Q2E A;  2A69 F;  2FXA A;  3KLN A;  4EGY A;  2EA2 A;  1DDN A;  5ILS A;  4BHP A;  3EQL F;  2VE8 A;  2FF4 A;  2VOO A;  1G3W A;  4XRF A;  3L2C A;  2VBZ A;  1A04 A;  1S7O A;  1XGS A;  4MGR A;  2QYO A;  2XUB A;  1IN4 A;  5K1Y A;  2P5L C;  5CVU A;  4NQW A;  5ICF A;  1R58 A;  5J8C A;  3SHF A;  2DO7 A;  3KP4 A;  4EM1 A;  1U78 A;  2FOK A;  4UV8 A;  3RDI A;  2P5K A;  1XGN A;  4IRI A;  5HLH A;  3TKY A;  2PFB A;  2MH2 A;  1XB4 A;  3REO A;  2V1D A;  3MQ0 A;  1BJA A;  1O3T A;  2HGC A;  1F1Z A;  2P6S A;  4FT8 A;  3VEP A;  3TOB A;  3HRM A;  2XHK A;  2CG4 A;  3E6B A;  4F7Z A;  4BAY A;  2HKO A;  4Y13 A;  4GCV A;  2FML A;  2W57 A;  3J80 K;  3K0L A;  4N0B A;  2HFH A;  3BZ6 A;  4A5M A;  1KU2 A;  3HTS B;  2M87 A;  4MQV A;  3J80 Z;  3LA7 A;  2OU2 A;  5HDK A;  3M8E A;  4LGW A;  3EUH A;  3ZP5 A;  2GZW A;  2PG4 A;  4U0V A;  2FNA A;  4LLL A;  1R1U A;  5BQT A;  2L02 A;  4I2O A;  1B9N A;  4HX8 A;  2V1X A;  3G3Z A;  6PAX A;  3S2W A;  2ZME A;  2H6B A;  1S3J A;  2DQR A;  4B09 A;  5FGM A;  1K7A A;  3R60 A;  4CGZ A;  5F64 A;  1O3S A;  5E1Z B;  2KIF A;  2GA2 A;  2MH9 A;  3R61 A;  3O2P E;  3DEU A;  2Z99 A;  2ACJ A;  4N9I A;  4AIJ A;  1R5G A;  1W5S A;  1T0F A;  1YQA A;  5KK1 A;  3KLO A;  3MCZ A;  2A61 A;  1RZ4 A;  5E20 A;  2D45 A;  1ZAR A;  4G7O F;  3JTH A;  2JTV A;  2VXZ A;  2IA0 A;  2PJP A;  3K9T A;  1YS6 A;  5D5U B;  2Q8K A;  2EWN A;  2O0Y A;  1T2K A;  1U6G A;  3DPL C;  2HWV A;  2JT1 A;  4PDK A;  2DTR A;  4EM2 A;  4BYY A;  1QZZ A;  5TRD A;  3CDH A;  2A6E F;  3BP8 A;  2NS0 A;  3P7N A;  4U7D A;  1R1V A;  2Q0O A;  4CHU A;  1XSV A;  5DDG A;  2QBY A;  4MNU A;  2P5V A;  2FU4 A;  4EVI A;  2OBP A;  2VT2 A;  1Z91 A;  2V79 A;  2Z3Y A;  3GZ5 A;  1YFH A;  2ELH A;  2ADU A;  1FBU A;  1K6O A;  2ZNZ A;  5FLX K;  3I4P A;  1YO5 C;  1I27 A;  3PQK A;  4EJV A;  3K1M A;  4KNY A;  3F8F A;  2CQK A;  3C3W A;  1F5T A;  4OIQ F;  5FLX Z;  3VOE A;  2XAS A;  4EQQ A;  4A5N A;  3NQO A;  2LNB A;  4K2E A;  3QOP A;  3L9F A;  2Z5U A;  3DFG A;  3CUQ B;  3ML6 A;  1J9I A;  1REP C;  5LEJ A;  1IAW A;  5DCM A;  1EV7 A;  5FD6 A;  1SD4 A;  1LJ9 A;  3HTU A;  1FBQ A;  5DUI A;  4MEY F;  2WV0 A;  4RB1 A;  3FF5 A;  1J2X A;  3BRO A;  1HST A;  1ON2 A;  2HTJ A;  5DD8 A;  3RKY A;  5IT9 K;  2NAZ A;  1ZG5 A;  2QWW A;  3HRU A;  4HV5 A;  2NRA C;  2VN2 A;  3DQV C;  3M8F A;  1ZLK A;  2FEZ A;  3CUO A;  3F72 A;  2OZ6 A;  4NB5 A;  1WI9 A;  5IT9 Z;  2VT3 A;  5DCF A;  5ILV A;  3RYP A;  3KZY A;  1OYW A;  4KYW A;  2G9W A;  4HOB A;  1IXC A;  3KP5 A;  1FSH A;  5FFZ A;  4N9H A;  5DV5 A;  1HQC A;  2R7D A;  1W4M A;  5J8F A;  3TO9 A;  4S04 A;  1MDM A;  4XSX F;  1G3T A;  3K2Z A;  2BBY A;  3F21 A;  1KU9 A;  2PEX A;  3TOA A;  3I59 B;  1R7J A;  4UNO A;  2K02 A;  4A12 A;  2HYG D;  3U9G A;  3FM3 A;  1QGP A;  2FQ3 A;  4IPA A;  3TGN A;  1BOA A;  5LHG A;  4EGZ A;  1RI7 A;  4L9V A;  2ZO4 A;  4OIN F;  4RS8 A;  2FA5 A;  1FP1 D;  3JW4 A;  2OQR A;  5BMZ A;  2O03 A;  1USS A;  4LB6 B;  1BBY A;  5LLQ A;  1W7P B;  4HQM A;  2GXG A;  2WWY A;  1SFX A;  4IJA A;  1FZP B;  2XKP A;  3JAM K;  1HKQ A;  5JFR A;  5FD5 A;  5ICG A;  4KN4 X;  4KA4 A;  3F8B A;  4CO8 A;  2XAG A;  1U5T C;  3JAM Z;  2QQ9 A;  5H20 A;  1RUO A;  3E6D A;  1IRF A;  1FC3 A;  3WTT C;  2ISY A;  2XIG A;  2CFX A;  4MQ9 F;  1D5V A;  1MJB A;  4G9Y A;  1TTY A;  2OAZ A;  4XBF A;  3I5U A;  3L7W A;  1BI3 A;  3WTV C;  4R79 A;  2F5F A;  3HOT A;  5KVR A;  3U2R A;  5CYV A;  4EJW A;  2EK5 A;  5ERI A;  1EH8 A;  2F5C A;  3GWZ A;  4PGH A;  2RVC A;  5HS7 A;  5D5X B;  5LHI A;  3CJN A;  4AD9 A;  1W5T A;  2VBX A;  3VB2 A;  3P9I A;  4FX0 A;  2H6C A;  4B8X A;  1ON1 A;  3TDZ C;  2HQN A;  3KP6 A;  2RGV A;  3COA C;  1KYW A;  1SD6 A;  5LRS A;  1HXD A;  5AIP A;  1V4R A;  1I5Z A;  2GWR A;  3I71 A;  2XRN A;  4MTD A;  2RC4 A;  3RJP A;  3H92 A;  3DXJ F;  2JRT A;  3KE2 A;  2LF7 A;  1Z9C A;  4KIB A;  3EET A;  2XAH A;  4KN7 X;  1AOY A;  2VC0 A;  1IW7 F;  3DF8 A;  5HS9 A;  2W25 A;  3FMR A;  2O61 A;  3C1D A;  1TQP A;  3WE3 A;  1D3Y A;  5HLG A;  5CJ9 A;  1Z7U A;  3EDP A;  1O7L A;  3M9A A;  4M71 A;  4UVA A;  1R23 A;  4FHT A;  4I98 B;  4OIO F;  1OR7 A;  4WX9 A;  3LFK A;  3H3Z A;  4XLN F;  4LG0 B;  3AAF A;  4A2U A;  4MEX F;  3HUG A;  3FHZ A;  2HOE A;  3I0T A;  3IHU A;  2BV6 A;  1L3L A;  4KDP A;  3P9C A;  3CLO A;  1WQ2 A;  4HDV A;  2F5D A;  3MAJ A;  3GUD A;  2UXN A;  3SZP A;  5HS8 A;  4L9T A;  4IRH A;  3W6J B;  5E17 F;  3KZZ A;  1B1B A;  2Z33 A;  3T5X A;  1LEA A;  1B9M A;  2XAJ A;  1UB9 A;  4R1H A;  2IW5 A;  4YG2 F;  4G6Q A;  1B6A A;  3ZMZ A;  1S8N A;  2YU3 A;  3KEO A;  3IWZ A;  4M9S A;  3W6K B;  4M74 A;  5LHH A;  2YR2 A;  3V8J A;  5BS6 A;  1T38 A;  4WXD A;  3MZY A;  2ESH A;  4UVC A;  1HKT A;  3HSR A;  4HA8 A;  4KIG A;  3FXQ A;  3PQJ A;  3R4K A;  4ETS A;  4UUV A;  2QEN A;  4P5O A;  2IP2 A;  4L5I A;  3E5U A;  3HOS A;  1J75 A;  1WKM A;  4AWX B;  1SD5 A;  5CVV A;  1BIA A;  2XRO A;  2JPC A;  5LRR A;  1MGT A;  2O8X A;  3N97 A;  2B0L A;  4CZZ A;  3K69 A;  3WTX C;  3JSP A;  5JHU A;  2XAQ A;  3WTZ A;  1G4D A;  4RB0 A;  2HKX A;  4LJZ F;  2P7V B;  4I0A A;  3B73 A;  3ZMS A;  1W7P D;  1V3F A;  1YG2 A;  4G94 A;  3T8T A;  4GYG A;  1F4K A;  2MC3 A;  1T6S A;  3LA2 A;  4M9Z A;  4QLC U;  2DBB A;  1BI0 A;  3J7A O;  5DD4 A;  1B4A A;  1BN5 A;  2Y75 A;  3E6C C;  1ZGA A;  4CIC A;  1YYV A;  4EM0 B;  5K5O A;  4GXO A;  3IKT A;  1KU7 A;  4D0P A;  2E7X A;  1XGO A;  2GAU A;  3C7J A;  2HTS A;  1Y0U A;  2UWM A;  4IVN A;  3ULQ B;  5JI6 A;  1I6X A;  1ZHF A;  1XCB A;  5A2Q K;  1STZ A;  3ECH A;  3Q5F A;  3FMS A;  1OYY A;  1PP7 U;  3JSO A;  3EYI A;  2AXL A;  2A3S A;  1G3Y A;  1SMT A;  2HYF A;  1TLH B;  1MZB A;  1FBS A;  4M6Y A;  1LNW A;  4LK1 F;  5A2Q Z;  2VE9 A;  2LSO A;  1XGM A;  2ZME B;  3I58 A;  3L09 A;  1SFE A;  4I09 A;  1KQ8 A;  1ZRF A;  3RIR A;  2HS5 A;  1L0O C;  4Z2Y A;  5K5Q A;  4ENM A;  4KIF A;  2GA1 A;  3V7C A;  5D5W B;  2OQG A;  1QZY A;  1LVA A;  5FB2 A;  1LB2 A;  3ZQ7 A;  5L3E A;  5L3G A;  4EV0 A;  1UFM A;  4UV9 A;  1C0W A;  4XLP F;  3ZMT A;  3VOD A;  3ABT A;  1RIO H;  4LFU A;  2H27 A;  1FY7 A;  1UST A;  3ISP A;  4RAZ A;  2LKP A;  1CF7 B;  4ZYG A;  1YTY A;  2IJL A;  1G3S A;  4IRG A;  1RNL A;  4M72 A;  2NYX A;  3ABU A;  3ZMV A;  3GZ6 A;  3ELK A;  1TQM A;  4ESF A;  5E8G A;  4AVP A;  3R0J A;  3NEU A;  2QBY B;  1O57 A;  2PLY A;  4XSZ F;  2HR3 A;  4EJO A;  3QPH A;  3CUQ A;  3HHH A;  2DU9 A;  4L18 B;  2K27 A;  4H0E A;  4ZH4 F;  5H6R A;  2V1U A;  2E7W A;  1OKR A;  3GFM A;  3HRT A;  2GIV A;  1FSE A;  2QQB A;  2CW0 F;  2ZKZ A;  1BI1 A;  2F2E A;  4HX4 A;  3CO6 C;  3KP3 A;  3F22 A;  3MFK A;  5L3B A;  1E2X A;  5HVQ C;  3O3K A;  2P4W A;  4S05 A;  3QP5 A;  5DCM B;  4EJT A;  2QVO A;  3WOD F;  3MZH A;  3LWF A;  5LGU A;  2EV6 A;  2RV8 A;  1U5T B;  2YPR A;  1H0M A;  5F6F A;  5L3C A;  2Y48 A;  5EEG A;  4BH9 A;  4ESB A;  4ON0 A;  4Q47 A;  3V7S A;  2K4J A;  1P4W A;  3I53 A;  4EMS A;  1ZYR F;  2KKO A;  3WTY C;  1E17 A;  3GO5 A;  3I59 A;  1R22 A;  2QM3 A;  2IRF G;  4CYD A;  3IRQ A;  2IPQ X;  3GXO A;  5LBQ A;  2QQA A;  2OZU A;  5DUK A;  2A68 F;  4Q5S F;  4AIH A;  2UZK A;  2DW4 A;  2DK5 A;  3R0A A;  3KCC A;  2K7L A;  1FYL A;  2FMY A;  1H9G A;  1R00 A;  1TNT A;  3V8L A;  1XMA A;  1MDM B;  1YIO A;  2W85 A;  4GGG A;  1ZN2 A;  1GXP A;  4A0Z A;  1XDU A;  1ODD A;  1ULY A;  4A0X A;  1LEB A;  2G7H A;  2HDC A;  2ZFW A;  5D4R A;  2FNP A;  1P6R A;  3GX4 X;  1QBJ A;  4U88 A;  1J0R A;  3WG9 A;  1RUN A;  5E8I A;  1P2F A;  1YW8 A;  4OMZ A;  3TDU C;  4BHB A;  3GVA A;  2Y0M A;  3HIF A;  1K79 A;  4HF2 A;  1KA8 A;  3L00 A;  1HBX G;  3ZPL A;  2AS5 F;  2DPD A;  4WCG A;  3C18 A;  2KIM A;  4HW0 A;  4PGG A;  3DKW A;  3LST A;  1J7K A;  2IA1 A;  4G8X A;  4E70 A;  2M8E A;  3LA3 A;  5DYM A;  3GFJ A;  2IT0 A;  1NHA A;  1UHW A;  1PUE E;  2HQR A;  4L0Y B;  2L3D A;  4TV7 A;  5D5V B;  3FWE A;  4I7H A;  5D8L B;  3WTU C;  4PZJ A;  2ZXJ A;  3GLX A;  1IN6 A;  1D8J A;  2O6G E;  2G7U A;  5J6X A;  2CGP A;  2A6H F;  1BIB A;  1DPR A;  4U0Y A;  3LAJ A;  5K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...