2V9PA

Crystal structure of papillomavirus e1 hexameric helicase dna-free form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
279
structure length
272
Chain Sequence
TLNESKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDEQPFNITDADWKSFFVRLWGRLDLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REPLICATION PROTEIN E1
publication title Papillomavirus E1 Helicase Assembly Maintains an Asymmetric State in the Absence of DNA and Nucleotide Cofactors.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Hydrolase
total genus 86
structure length 272
sequence length 279
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2v9pA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v9pA02
1E9SA 5AR1A 2QP4A 1JEDA 3RS0A 4M1MA 2GK7A 4G1UC 1G5RA 4QBIA 2WVJA 2KJQA 2W00A 1GKIA 1NLYA 5FR2A 1F2TA 4UJ5A 5EE9A 1N5KA 4F4JA 3EA0A 4LJAA 3KZ1E 4MDEA 1NI3A 5SZIA 1OHHD 3QIAA 2VHTA 1AKYA 3A1VA 5JSZA 2HT6A 4IJMA 2V1UA 1U0LA 4Q03A 2ZSDA 4KITB 3MJRA 4FIDA 4JVSB 1Q1ZA 3RABA 2P5TB 1QBKC 2P5SA 3BH0A 4JVMA 3U3OA 5IHPA 3IO5A 3MWLA 4DIDA 2QBYA 3TJZA 4A0GA 3PV0A 1N6NA 1W5SA 4M1OA 2OE2A 3RYTC 3BFVA 4BLSA 2VQSA 1GWNA 4JL5A 2ATVA 3C4JA 4RZ2A 1U8ZA 2F9MA 2GBLC 5FPSA 1T8TA 2CE2X 2B92A 4DKXA 1IQPA 1DVRA 1QHHA 2SHKA 2F55A 3LFUA 3NBFA 1YZLA 2GEDA 3LDAA 3H4MA 3QXSA 3LVRE 3X1YA 3TSZA 2Q9CA 4DVGA 1D2EA 4NH0A 4OK5A 4RFSB 1KI2A 1CR2A 1JI0A 2FSHA 4MA4A 1I2DA 2OBLA 1NVUQ 1I4TD 1ZU4A 1N0WA 1ZM9A 4FINA 2CLSA 4LHYA 4Q1BA 5A0FA 3EZ2A 2OUKA 3AF4A 3ADKA 2JLSA 4OK3A 3QOFA 1AJEA 2Z43A 4WA7A 4EQ6A 1MABA 3QI2A 2ZRLA 2VHQA 2QGNA 1Z0AA 1LY1A 3K9GA 4EPRA 4YC7A 2AXPA 3QPWA 4NZYA 3MSXA 4EPTA 1GVNB 1G64A 4JT2A 1WB9A 2CDNA 3TUJC 1Q3TA 2BMFA 3HPRA 3BFKA 1VG9B 3ZZTA 3GLIB 2EFDB 1OIWA 1JAIA 4II7A 4DXAA 1G8HA 3W5IA 4BLQA 4HYYA 1VHTA 2GVZC 4KYUA 3I3SR 1F6BA 3W9YA 4JKYA 4LSGA 1G20E 3FMFA 3ND8A 4RD6A 4P4UA 3UWKA 5HPYB 3U3MA 4MGYR 2IW3A 2FOLA 1Z0DA 4N0DA 1GSIA 4UNSA 1G7SA 5CK4A 1KSFX 2B7BA 2R2AA 1F5NA 2WMOB 1JR3A 3F3YA 4DC9A 2CK3A 4MGIR 1TPZA 3GLFE 3NC0C 1XD9A 4KFRA 3VX3A 4JLBA 3PEYA 3BJIC 4B76A 1E4VA 4C0HA 4DDVA 2QSZA 4XSGA 4US2R 4R71A 1CS4C 1KI8A 4DLVA 3IO3A 3WMFA 2GCPA 3PUZA 3UMSA 1X86B 5DI3A 3RS2A 3EPLA 2ZSEA 1R10A 4JLOA 3T5GA 1Z5ZA 3WHLA 4OI4A 3VR3A 3AVQA 2WWHA 4JKIA 4QGAA 3F5FA 1JJ7A 5IK2D 2O5VA 1X1RA 3CKLA 1SXJB 2ZROA 3DDCA 4LX0A 2I1VB 4MUAA 2V6IA 2A78A 4MUBA 4HLDA 4AK9A 3UIEA 3TQFA 4NDZA 4M9SA 5F2EA 1NLFA 4XVRA 1XTJA 5L3SB 3LH5A 3EG5A 2VSOA 4LPKA 5EE3A 3C41J 1WE2A 5A4JA 4QNMA 1SHKA 4NMMA 2VEDA 5FTKA 2JEOA 3CF2A 2ZUDA 1DAMA 2PEYA 3IBYA 2Q3HA 4Q7KA 1NVVR 2C98A 2RHDA 4AWXA 4C0KA 3NKVA 2DBYA 5JMTA 2OG2A 4OQLA 3BK7A 1RKBA 4DSUA 2ZI6A 1BH2A 1UKYA 1VCIA 4IVRA 4R2IA 3AP3A 3B60A 1TX4B 1ZCAA 2YVUA 5BN4A 3THYB 1CF4A 2W2XA 2GCOA 2F9LA 2PCLA 2ZR9A 3EC1A 3QJYA 3VTKA 2PEZA 3K0FB 2IYLD 3LD9A 2FWRA 5AJZA 4LJ7A 4ILEA 1OJLA 4BLRA 4D0LB 1OFTA 2YJTD 4MRRA 4TZ0A 4UXHA 2C03A 4HZIA 2IWHA 3WMEA 2AL7A 4Q9IA 5LPNA 4U7DA 1I4DD 3KQHA 4MKHA 1OPXA 2KI5A 4HZUB 4CZ2A 1G5PA 3NH6A 1ZUHA 4D80A 4R7ZA 2GF9A 4HLQB 1TMKA 2XTNA 5SZKB 3V4RA 5JS8A 2J1LA 1SXJC 3EAQA 1E2QA 1D9XA 1Z8FA 4XOIA 2GNOA 3GLHE 3GMTA 2GEUA 1XEXA 4BFSA 2IF0A 4Z8YA 4MYHA 2GBLA 5C4GB 4N0EA 2YWGA 1LS1A 1KO7A 2J3EA 1ZM7A 2QAGC 4KLZA 4OQNA 4OQMA 1OSNA 2IYZA 4WOPA 4H1VA 3E5HA 5FOTA 1F3OA 4XTRA 2JJ1D 4LY6A 5DYIA 5IDVA 1K6MA 1XJCA 1OB5A 2XSZA 1VTKA 4JLNA 3SHFA 3EASA 4R2HA 3R8CA 3V9PA 4EPWA 3NG1A 2WJYA 3GJXC 1S3GA 3UKDA 1HA3A 3X1ZA 3X1XA 3CNLA 2GETA 3SYNA 3IQWA 2JJ2D 3QE0A 1OXTA 1G4UR 2R62A 3T5DA 4QJ3A 4MRSA 2QY9A 2J7KA 2RGCA 3WNBA 4D82A 1CEEA 4FCVA 2RGEA 4PR0A 1OFIA 2P2LA 1DAIA 1Z2AA 2O0HA 4GMDA 4RVCA 4QC2A 4DSNA 1WDTA 3GEEA 1Z28A 4KXFB 1OFUX 5CJ2A 5KDOA 3TKLA 2A9KA 1M7BA 2DWOA 4DJTA 1W0JD 5L3VA 3BC1A 2XZLA 4A15A 4A2QA 1M8PA 3X1WA 3UPUA 3B1ZA 2DB3A 3QBVA 3VHXA 3NWJA 4AYXA 1OKKA 1EFRA 1KY2A 3K0AB 4LBWA 5FUXA 1D6JA 1KI6B 4Q9JA 2BEKA 4QRHA 3NBXX 1G1MA 2BBWA 5TXGA 2WJHA 4KYIB 5EXPA 1E2DA 1QHXA 5EXTA 2ZYUX 3WBJA 1AS3A 2DFTA 2IL1A 2PH1A 4HB0A 4OL0A 4EUNA 4ZDWA 5KSOA 2GZHA 3AVXA 3IIMA 4OBEA 5IF9A 1AKEA 2ZJ5A 2GILA 4URZR 1W2HA 4LJYA 4DLYA 4RFSA 4Q4JB 1M74A 1ZBDA 3OFNA 5JWOA 2ZS7A 5A5GA 1FMLA 1G7RA 3TUIC 4A6PA 1U2RA 2E87A 2VP0A 2YV5A 3ZVMA 4NYJR 3WRYC 1L7VC 3HR7A 2WWWA 2E9SA 5H68A 6Q21A 2ZRHA 4FWIB 4BPBA 4YDHB 2G3YA 2PMDA 2Z4RA 1Q20A 4NYMR 5EP2A 2XNDA 5AK0A 3M0EA 1E32A 1SZPA 1R8QA 2IUUA 1Z6YA 4JLJA 2ZAMA 4A36A 3K9NA 1VG8A 4YMVA 4JBWA 4E07A 2ZE8A 4XH9B 3GP8A 2ZRKA 3TR5A 2UVQA 3QVUA 2V54A 1GM5A 5DLQC 4ERNA 4IDHA 1ZC3A 1FQJA 2WSMA 3HJNA 1UM8A 5CK5A 1SVMA 1JPNA 1ZRHA 2B21A 2G1JA 4Q1AA 4MRVA 1MT0A 2X19A 5KU1A 1YQTA 3I62A 1ZD1A 2RMKA 3RSOA 1VG0B 1I2MA 1ZUIA 3TSWA 3N70A 4CIDA 1P75A 1KSHA 3EWSA 2BMEA 4DEXA 5B30A 4Z1MD 4OI2A 4W5HA 1KNQA 5FBRB 5FUVA 3W8NA 1KI1A 5HKKA 3L0OA 2W58A 1OH8A 3UWOA 5TB5A 2EWWA 2CHVA 4C7OB 1EGAA 2DPXA 4BZXA 4XTCS 2IYVA 4TT3D 2PL3A 1E2PA 2AKYA 2HLDA 3K70B 1QRAA 3CBQA 2IXGA 2V6JA 3VR1A 1YR9A 4F93B 3EPKA 1W7AA 1YR7A 2RHMA 1E2LA 2X2FA 2J0UA 2CJWB 1G6HA 1DAKA 4JJKA 1XZPA 4RCZA 3ICEA 1UAAA 2VRWA 4MGZR 2UZIR 4P31A 1XWIA 4LDJA 5FBLB 3ZYCA 1S4QA 3ZS8A 1SXJA 1GRNA 2KBEA 2VLIA 5L8VA 1P2VA 3SU8A 2NIPA 2ZI5A 2GAAA 4UJ3A 2VL7A 2VP4A 2QAGA 2FN4A 1P2SA 2KB0A 5L3SA 3AVOA 8OHMA 2C2HA 1XZQA 1NBMD 2WWGA 2QGZA 3FMPB 1RYHA 4PHGA 4RZUA 4TLDA 4IDPA 1YZTA 4I1OA 4WW0A 4ACAA 3AF3A 1S1MA 2NZ8A 3A36A 3PUVA 4RD4A 3BB4A 4R9UC 4LHVA 2ZRBA 1UBEA 521PA 3VKGA 4ZO4A 1F2TB 5SZJA 2WIBA 4C2TA 1JALA 3KB2A 3OE7A 4PTLA 4B71A 4IEIA 1QHNA 1UDXA 2HUPA 4WBSA 3AKYA 5EXSA 4Q48A 4A8JA 2P6RA 2GEVA 2JLQA 2Z83A 4FD2A 1P3JA 1HEIA 2BCGY 1P9RA 3QKSB 5JWHA 4C0QC 4OJQA 3RC8A 3N2EA 1W4RA 4TYYA 1N6PA 1U8AA 2WJJA 1NSTA 1W4BA 2WWFA 4ZDJA 5JECA 2V8OA 3AKDA 2TMKA 3EZFA 2LKDA 3B5JA 5TVKA 3AVTA 2BJWA 1SVIA 3T1QA 1KZGB 5GJBA 4W5JA 4CYMA 2WWIA 1BKDR 1QHHB 5EZ6B 2LCFA 1IAQA 3A4LA 3I72A 4PC2A 1A4RA 1E0JA 4BE7B 2ZRAA 1ZNXA 1TF5A 3R9XA 1ESNA 2QQ0A 4D0NA 4B2IA 1ANKA 1KNXA 4M9XA 2YKGA 4CEIA 5DISB 2EFCB 4HLUA 5EJEA 1DG1G 2ZUBA 2ODEA 3B8HA 3CX6A 2H8KA 4EQ6B 2R9VA 1MABB 1XU4A 4RKFA 4TMKA 4G3XA 2ZJBA 3C5HA 3R20A 2UZ3A 3U60B 1W0KA 1FMJA 1E9EA 1IJEA 4OI1A 3Q85A 1Z0FA 4GI7A 4PXAA 1G8PA 2B7CA 4HATA 2V3CC 2GESA 5EQTA 4A0RA 1GFIA 3LXXA 3KKNA 5KSZA 2NO1A 3AEZA 4W9MC 2D7DA 4ZDKA 4IDNA 4UNQA 2WMNB 5FBVB 3FDIA 3VR4A 4KBGA 3ASZA 2FSGA 3K09C 4A0HA 3BIFA 3NDBB 3MWYW 3H2YA 3FKSD 4Q7LA 4AIIA 2G0TA 1T0JB 1ZP6A 3PG5A 4B48A 1LF0A 5GJWC 1LTQA 2HJGA 4YMSA 4YDSA 1KI3A 3QUSA 3LXRA 3L82B 1NRJB 1N5JA 3EA5A 1B23P 1J90A 2WJGA 4EFLA 2C9YA 2OXCA 4AG5A 1ZD8A 2C9OA 3FWYA 4M1KA 2ORIA 1QZXA 4ARZB 4BLPA 4LHZA 3WHKA 4F4IA 4N1AA 4LPSA 4PQRA 4LJ5A 1BYUA 2LKCA 4HAYA 3A1TA 4WXRA 1F2UA 4RCYA 3IUYA 4XVQA 1VCMA 3PENA 5DI3B 4HDQB 5LD2B 1MH1A 1KAOA 3OEHA 3UG7A 1F60A 2ZETA 3P1JA 1A2KC 4XWOA 4KJZA 2QMOA 2IK8A 3I4LA 2J7PD 3LW8A 3KQKA 2WWYA 3THXB 4TL7A 1BS1A 2W6IA 2A5DA 2Q3MA 2WOJA 1G8GA 2AHOA 3QY0A 1W36B 2O8CA 1E2KA 1RRPA 3TH5A 3BB3A 2BM1A 1H8EA 4O2RA 3EZ7A 4GZMA 2J59A 1ELOA 1RVDA 1YHNA 2CNWD 4O3MA 2DCUA 3T34A 1PUJA 4AYWA 4WVFA 4KAXA 1OH7A 2OESA 3QXHA 5JEDA 2QQEA 3VKHA 1VYTA 5J4HA 2AD5A 2WOOA 3DOEA 4FMDB 4ZIRA 1H8HD 4EPYA 1TNDA 1ONBA 3G82C 2C77A 1IXRC 1E1QA 4JLMA 4K46A 2BOVA 3GLFA 1OYYA 2GZAA 2OT3B 5JRZA 4QGGA 2W0MA 4AI6A 2WBLC 1DG3A 1XDBA 4IKEA 2B8TA 2C8VA 1YRAA 5FUWA 3OIUA 3K53A 1R5BA 3LQRA 5CIQA 3SR0A 2CVFA 4R98A 3QVVA 4HSEA 4IW3B 4QBHA 2VYFA 4TYNA 2ZSAA 3H0KA 4IOLA 5E7JA 4GBMA 2GCOB 3TAHA 4TMTA 5DH9A 3VMFA 1SULA 4ESHA 4EPXA 3P27A 1E9AA 2F3RA 3LBNA 4LYFA 4K8OA 5CYOA 1KMQA 3P32A 1UBGA 2A5GA 2IC5A 5DN6D 3SC3A 3RRNA 2GZDA 4B3FX 3O8RA 2AWNA 1Z06A 1G41A 1XD8A 1G18A 2C5LA 4PPGA 2VO1A 3BAFA 4DB2A 3T06B 1P5ZB 4BGDA 3T61A 2R65A 1ZNYA 1DAEA 5KSYA 2H17A 3E2IA 4TSFD 3L0IB 5EE1A 4YONB 4C7OA 2ZANA 3FKQA 1Z83A 1QHSA 3QXJA 1KI9A 3ETLA 2OLKA 4AY2A 1DAGA 4I4LA 3L8ZA 4F7WA 2GF0A 3CRVA 4A9AA 3OE7D 5KPJA 1W36C 3AF2A 2DWPA 3P4XA 2C95A 1KO1A 1BMFD 4MQBA 1T5IA 4NL4H 2GDJA 1AN0A 3ZH9B 2JLRA 4A4DA 3ZQJA 1OYWA 5IRCD 4LGMA 1TAGA 3QF4B 1VCNA 3HYRA 1M34E 2CL6X 2EFGA 1KKMA 4TMZA 1OXVA 4RD1A 1Z47A 1NY5A 2ZTSA 1FW6A 2W6JA 1NNEA 2NO6A 2OAQ1 3CH4B 4JLVA 4JVLA 1Z6AA 2QMEA 3ZZ0A 1E2FA 3HDTA 4IVQA 4LJ4A 1WBBA 2F6RA 2XOKD 3M1IA 3AUYA 3LLUA 1Q21A 3X1DA 2REXB 2Z4SA 3SJZA 1FTSA 1HUQA 1E9FA 4KSCA 1W4AA 2OFWA 1XTQA 1G16A 1YZQA 4NPHA 4OHVA 4AKEA 4DCTA 3U5ZB 4IXMA 5DHAA 3LO5A 3MAAC 4KFUA 4TQUS 5EUMA 2J0VA 4URUR 4Q47A 3GJ3A 1Z6GA 1DARA 2H18A 4B47A 4IRUB 3AM1A 4Q4AA 3B1XA 2DY1A 1JNYA 3QKSA 3K09A 3SQWA 3AGQA 5AJXA 2J87A 1U81A 4FCWA 1G21E 3A58B 3SEAA 3GJ0A 1OW3B 2EYUA 2J0QA 5JEEA 1VYVA 1KDOA 1E2JA 1P73A 3KDSE 2W0SA 2R6GA 2WPDA 1OIVA 3N5CA 3HYTA 2QRNA 3KXLA 3U7FB 1QF9A 1S3SA 3QXXA 4NYIQ 5FOWA 1XXHE 2IYYA 4H1UA 2IWRA 3TW4A 4B3DA 1JQJC 4DIEA 1YR8A 3W3ZB 1K8RA 4C2UA 5FR1A 1IJFA 1XPRA 3CX7A 1T5LA 2F3TA 2FFHA 2FEOA 4UNNA 1E1RD 2YC4C 1S9DA 3RNLA 1G3RA 1WP9A 4M1TA 3VKWA 3U44A 4UNRA 2NO0A 2NO7A 3RLFA 3ADCA 1VCOA 4HB2A 3VR6A 2XZPA 1T3HA 1YR6A 2HCBA 4LBYA 5FBWB 1ZIOA 3WP1B 4AKIA 3SQXA 3RDPA 5GVSA 1J99A 1T4GA 5FOSA 4POAA 721PA 1G4AE 1U0HC 4JIMA 2IHYA 1FUUA 1Q22A 3PEWA 1XD2A 5JHHB 1OFHA 3ZVNA 3B6EA 1AS0A 2CEAA 4K81B 3RHFA 3ZGXA 1DADA 1R0ZA 1DELA 2KE5A 3Q3JB 1QHIA 1IN8A 4PSKA 4B3CA 4N3NA 3CZPA 1KYIA 3SHWA 4HLCA 3FFBA 2P0EA 3P26A 3SFZA 3W6NA 4LV5B 4OJKA 3IIJA 5C18A 2OXRA 4TMVA 2P65A 2YWHA 1X8JA 4FWTA 2CLCX 4PZZA 2O8EA 2QG6A 1PVOA 4JYCA 3MFYA 1D2NA 4B73A 2EFEB 2JLXA 1C9KA 3FHCB 4KODA 4G5RA 2QP3A 2ZR7A 2IS2A 4ARZA 1V43A 2N46A 5KYKA 4X8LA 4PPQA 5GJVC 3T15A 4Q01A 4EPVA 3ZVLA 1XCPA 2O0JA 4NCHA 3QG5A 2A5FA 1A7JA 1VKJA 4UQOA 3PITA 4D6PA 4AC9A 3IPYA 1XEFA 1Z0JA 3K9LA 1KY3A 1G7CA 1OE0A 4PSVA 5B2ZA 4C30A 2J0UB 5CIWA 4E03A 1OF1A 4TMXA 2KWIA 3THXA 4YMUA 1TUIA 2CE7A 5TMPA 2PMKA 1ZU5A 2R44A 4QGFA 3W5JA 2IF2A 1N25A 4GL2A 2ZR0A 2GWHA 4KFSA 1KZ7B 4BLOA 2FG5A 2ZITA 2HCJB 2QAGB 3MCAA 2JDIA 4WZ6A 2X2EA 4O25A 1G17A 4DWJA 4FCTA 1CRQA 3B13B 1E9CA 1NIPA 3EWAA 2JLVA 2ECKA 1PUIA 2IYSA 3AUXA 4D4JA 2XZOA 3K70D 1NL3A 5C4MA 4DUGA 3GFPA 2QAJA 4XD7D 4AG6A 2GAOA 5J4YA 2ZREA 3DZ8A 4FMDF 1US8A 3OAAA 5D3QA 2NMVA 1MOZA 4KSBA 4C0SA 4I1VA 5JJLA 1LW7A 2JIZA 5D3MA 4A8JB 3OZXA 3DZDA 3GJ5A 1NVWQ 4NU0A 2RGDA 4OQXA 1F48A 3Q8XB 4CGZA 3U3RA 3HU2A 2VTKA 1GTVA 1L4UA 2CL0X 1COWD 2ZAOA 3BERA 3NHBA 2ZSBA 4V0KA 1UBCA 4CEJB 2QSYA 1PJRA 4GOJA 1HURA 5CB8A 4QM6A 2QL6A 2IYXA 4KHZA 3GJ7A 4C9BA 4DEYA 3LX5A 5CM9C 2HJVA 3KXIA 4E5UA 2EFHB 4QG7A 3TQCA 4A82A 4DB4A 4M9QA 5LB2A 1FNMA 2ZRNA 2YNMA 4CRWB 1N6HA 3QF4A 2RKOA 1RPZA 1XTIA 2D4HA 4P4SA 2IYWA 4B3XA 4CEIB 1W2GA 3CX8A 1DBSA 1W4CA 1P7CA 2XITA 3GCGA 4PPNA 4V0OA 3SFVA 3TW8B 4B75A 2D74A 1CJMA 4TWZA 1WA5A 5DYGA 2FSFA 5H8WA 2GRJA 4ZKEA 3CR8A 4TQAA 4DCVA 1E2IA 1R8SA 2RGBA 5AUPB 1GNRA 2AN9A 3CWZA 2VF8A 1Q44A 3FPAA 4DSOA 4DBLC 1E79A 5BXQC 2ZYTX 2WJVA 2YWFA 3VHLB 1NJGA 3AQ4A 3EX7C 1IN5A 1U0JA 1VECA 5JLJA 4A8JC 1CLUA 1I4LD 2BKUA 4TN1A 2HT1A 1CKEA 4Q19A 4JBYA 1ESMA 3PUXA 4JMPA 1QVRA 3CM0A 1EFHA 3I73A 1XCMA 1II8A 1Y63A 3NTUA 4QJ4A 2WTUA 2FSIA 3CUEF 1SVOA 1Z0KA 5FI1B 2FPKA 3MG9A 3U4QA 2V7QA 4Q1CA 1G9XA 1JEEA 1P9WA 2ZE7A 2ZRCA 2CCJA 3D6TB 4Q7MB 3KUCA 4IFBA 1UKVY 2GJ8A 2AFIE 2NQ2C 1GILA 3ONWA 4IOMA 2QMHA 2G9NA 4E09A 2ZEJA 1MV5A 1K5GA 1KMHA 3LBHA 1UADA 3PVSA 1HQYE 1WMSA 3EZ9A 1T8UA 1F2UB 3GJ4A 4TQ9A 3NEYA 5CLQA 3RRMA 3SE0A 5E4FA 1R4AA 3KJEA 3NDPA 621PA 1CJVC 4URVR 4HLUC 4IOKA 1PZNA 2WKPA 4TYPA 3VX4A 4D26A 2QI9C 2WZQA 3SBEA 3GLGE 3KUDA 4PC6A 3TUZC 2BV3A 2ZRPA 5FH9A 2YOGA 1MO4A 5BQ5A 4QBFA 1R5NA 2A5JA 2O8CB 1GUAA 3OEEA 5P21A 2Q21A 3AKEA 5AUQA 5GVRA 1HE8B 2HF9A 2ZJ8A 1OT3A 1JR3D 2CK3D 3Q5DA 3C16C 4AURA 2V9PA 2OFOA 4GT1A 4Y0VA 2X8AA 5EE5B 2IUTA 2QM8A 4ZIRB 3LBIA 1TADA 1Z08A 5KTYA 3EW9A 3GLFB 1SKYE 4PO1A 2FV8A 4Q4HB 4V0NA 1FUKA 3W3AA 5AWFC 2G88A 3IKJA 2VA8A 4A1FA 5JZVA 2QM7A 4GP6A 3V4FA 2QPTA 2IX3A 4D81A 4OHYA 1KJWA 4Q9HA 5G3ZA 1NKTA 1NVXQ 3CPJB 4Q5IA 1FOEB 3K0EA 1Z0IA 2V55B 4HUQA 4KI0A 5DNYB 1EG7A 3BFXA 3D8BA 1OH5A 2VHJA 1W36D 3ZD7A 1BOFA 2AX4A 2NO9A 1S8FA 1E99A 1FZQA 3CF0A 2F1JA 3E1SA 3NBYC 4PANA 3B9QA 1GAJA 3OIVA 4M0LA 4URWR 2FNAA 4LYAA 4BZPA 3AP2A 2WV9A 2L0XA 3RC3A 1N2CE 3W34A 3FYHA 5E7IA 4MYCA 2EU8A 4M53A 2X1VA 1VYUA 4JLAA 4WZBE 3KJIA 1D2MA 3TNFA 2J46A 3MJHA 1S0UA 3W90A 3UXMA 2ODNA 2O8DB 3QQ5A 3SYLA 1EX7A 2ONKA 5HZHA 1JPJA 2PT5A 4YLGA 5LBIA 5DI9A 2BHRA 4YXWA 4DT1A 1Q1BA 2ZRIA 1PLKA 1CJUC 2CLDX 2JGNA 3K1JA 4MH0R 1QG4A 1KO8A 1S96A 5BW8A 4JS0A 2ZI4A 4LCBA 1SVLA 2IYQA 4O2LA 1BO6A 3CNNA 2IYUA 2BBSA 4ASUA 5FBQB 2I1QA 1J2JA 1ZNWA 4I1SA 1XNJA 3FMIA 4QNRA 2PLFA 2OLJA 3DVLA 3EXAA 3IILA 4FXPA 4E22A 4PHTA 4WXPA 1DAFA 2RH5A 1UJ2A 3I1FA 5JFGA 2G77B 3RRZA 2J45A 1P61B 2F1HA 1J8MF 3L43A 4L15A 2AFHE 4HEJA 4L9SA 1LB1B 1W5TA 1HH4A 2J41A 5J47A 4NONA 1Y3AA 1Z2CA 2GXAA 1HT1E 5TDHA 1E9RA 2WSSA 4KFTA 1UEJA 5B58C 5EUQB 4MRPA 3PXGA 1NBME 3GLHB 1GIAA 2D3WA 3QPVA 1AZSC 4D25A 4M21A 2AK2A 3FHTA 4Q4AB 1KDRA 2QPAA 3QKTA 1ZNZA 2R6AA 1Z07A 1XPOA 4NP6A 1V5WA 2RGGA 2ZJOA 1U9IA 4RZ3A 4DLWA 2XSZD 3ZIAA 2GKSA 1T3LA 4IHQA 1T91A 2WWXA 3EPJA 1XP8A 4KO8A 3TSOA 3REGA 1G3IA 1L2TA 2XAUA 1G3UA 4DDUA 1IN7A 3FVQA 3Q7QA 4CEJA 4XVUA 2OHFA 4PO9A 3EC2A 3AVUA 1GG2A 5KHOC 1D5CA 3KQLA 2R6CA 1KJYA 1GRRA 2P6UA 3KXKA 1KKLA 3SYKA 2QE7A 3WXMA 421PA 3K0SA 1RRCA 3TGPA 3PFIA 1E94E 2ZJYA 1IY1A 4LZZA 4V02A 2BMJA 5EZ5A 4JLPA 1JB1A 3QKRA 4QL3A 1NG1A 1K5DA 3OHMA 2ANCA 2QENA 4QOSA 4WZAE 4DRZA 2YC2C 4BRWA 2VBCA 1KAGA 1YRBA 2P6NA 4HAUA 3QENA 2IYRA 3B1WA 4Q9KA 1M2OB 1UPTA 2OBNA 2ZXUA 3U44B 3MWKA 1ZYUA 3KKMA 4OKSA 4HUTA 4Q4LA 5JS7A 2EYQA 4CT5A 2IXFA 2G1KA 3JZAA 1OKKD 1EFRD 3PEVA 4OYHA 4DSTA 5K8IA 3B1YA 2ZJAA 1G7TA 3EZ6A 4C0AC 4Y0AA 3VNUA 5TY0A 5F98A 3PEUA 1N6RA 4JJZA 2JLZA 1D9ZA 1CRPA 4LI0A 3DKVA 3KJGA 2QTVB 1OHHA 3OIWA 1ZM4A 2CMKA 4BRUA 1XD2B 3KTAA 5EE0A 2VHUA 1KGDA 1MO6A 2PJZA 4OI0A 3K0CA 3OFND 1XXHA 1Q1EA 5TARA 2YOHA 3O8BA 3MRSA 4PAQA 5E7MA 1J7KA 3WY9A 5B64A 4NYIR 1CR1A 3I5XA 2WJIA 2V1XA 1RC8A 2YZ2A 3BS4A 1D8TA 2GJAA 4JLDA 4B3GA 1FP7A 2ASEA 5FOUA 4ABYA 1GP2A 1UKEA 1GNPA 1HQCA 1DE0A 2XNDD 1UF9A 2O8EB 4XIGS 1XMSA 2GJ9A 1QDEA 3LNCA 1RZ3A 1N6OA 2F43A 2HXSA 1TF7A 2REOA 4JSYA 3SN6A 3WYFA 5KNDA 4P33A 1S2MA 1TUEA 1ZCBA 1FQKA 4ZI3A 2B8WA 4G01B 2CCKA 2AKAB 4OK6A 3IHWA 2CVHA 1RE0A 3ASYA 3FB4A 2ANBA 2MMGA 3H1TA 3L0SA 3DOFA 1MRSA 3GPLA 3QXCA 5HCIA 3RANA 4DCSA 2QU8A 3CRRA 4TMWA 2FPMA 1W1WA 3B1VA 1G5TA 2ZIAA 3U6KA 3C5CA 2Q9BA 3WYGA 3GLIE 4ITRC 4JLKA 1U94A 4ZCIA 5KOYA 4Q00A 5FTJA 2GJSA 4RJLA 3AVWA 5HKKD 2P67A 3PQCA 1MO3A 1VIAA 1NY6A 4RD2A 2ERYA 2QTFA 2ODBA 2Z6VA 4L4UA 4Q4HA 4BFYA 2VF7A 1EFUA 4V0ME 1EFCA 5DIFA 2Q3FA 2HLDD 1G8FA 3LX8A 3PCRB 4O0MA 2FJUA 3DM9B 3WP0A 3ZS9A 1NG9A 1R0XA 3WRXC 4BEBA 4HDOB 3RAPR 1BYIA 3CRMA 3NH9A 3QEOA 1US8B 2JLWA 2GHIA 1NMYA 1T9HA 1SXJD 4A2WA 5HE8A 4OHWA 1FNNA 2AXNA 1P2UA 1U99A 2QROA 1N6LA 4BFXA 5D3MB 5FTLA 1MKYA 1UFQA 1KDPA 2MSCB 3R8FA 3I61A 3BH7A 4CEHA 1R7RA 2OCAA 3HU3A 1W47A 3FTQA 4DLZA 1XTRA 4PQYA 1A2BA 5KNBA 2CL7X 1NMXA 4PC1A 4RSGA 5HR5A 2C04A 3B7GA 3NEJA 2EWVA 3NVAA 4S2EA 2YHSA 3BH6A 1P9NA 3A6PC 1PLJA 3AP1A 1P6XA 1X1SA 2ZS8A 1T0HB 1L4YA 1YZNA 2RAPA 2HYIC 4D0GA 1SXJE 1C1YA 3LAWA 3FFAA 1GKUB 3U2QA 2VH5R 4US0R 2FA9A 2RGAA 2O8DA 2HF8A 2ZRGA 4LBVA 3CH5A 5IK2A 4PZLA 5J5CA 3IIKA 4ESVA 2D06A 2ZRFA 1SQ5A 4LOAA 4ZKDA 4B6FA 4US1R 3ZDQA 1KDTA 1CR4A 1TEXA 2I4IA 1TTTA 5FI0B 3A8TA 1CJTC 2CXXA 3DO6A 2JA1A 4DHEA 1TQ2A 2OFXA 3RS4A 2OCPA 4MKIA 3IBGA 3WNDA 4P4SB 2JATA 3KJHA 1HE1C 1N0UA 4FMBB 5AJVB 1E9DA 1KO4A 3UANA 1SVSA 3QF7A 4TTRA 4UNPA 3IDQA 2QZ4A 3VU9A 1JQLB 1LV7A 1N6KA 1T6NA 2A7QA 3A4MA 1UDWA 1NN3A 5AJWA 3TMKA 3LRPA 3TVTA 1A5TA 3LWNA 1TEVA 3SI7A 5FOXA 3GEHA 3NXSA 1TQDA 2BVNA 1AQYA 2ORVA 4CW7A 5FL7A 5CDFE 5FUYA 3TR0A 3G0HA 1WQ1R 4FMCB 1KO5A 1U8YA 2PX0A 1FTNA 3M4YA 1RW4A 3BGWA 2ONJA 2DHRA 4RFVA 1GZSA 1WCV1 3ZVRA 4P0TA 3GLHA 4Q18A 2ZS9A 2XTMA 5FOVA 5IT5A 2A2ZA 1II8B 1IY0A 2W83A 3BRWD 1M6NA 4Q02A 3IEVA 1G8YA 4LJ8A 3U4QB 2IYTA 4LV6A 5KSPA 4AD8A 4PZYA 3CWQA 4ZV4A 2AD1A 2GJKA 3V00A 3BE4A 1R0WA 2RGXA 1W0KD 5DE3A 3JVUA 4JL6A 1IBRA 4B2LA 2AR7A 3CRQA 1YVDA 1NN5A 4Q1DA 1KMHB 1XMJA 2ORWA 2Q0HA 3RWMB 2XJ9A 2VPPA 3GFTA 3KL4A 4RD3A 2JCSA 5ANRB 4P4TA 4Q7JB 4ZDIA 4GFDA 2JJ1A 1SVWA 3EIQA 2V4ZA 3W8RA 5JJKA 1OXXK 2WICA 4DDWA 4TL9A 3MMPA 1MO5A 2YINC 2HV8A 1CR0A 4MRNA 1XMVA 3SDZA 1FX0A 1U98A 4LV8B 1RFLA 4ZI2A 2PZEA 5FPTA 1TF2A 2H5EA 4YMTA 2GTPA 4Q21A 2R8RA 3RSLA 1O87A 1DO2A 4BECA 1YZUA 2IBMA 2JJ2A 4B6EA 2DFNA 2FGKA 1UKZA 4G0NA 1AGRA 4L9WA 1NIJA 3CB4A 4OHZA 2GK6A 3SZRA 2CBZA 3U7HB 3GJ6A 1U90A 3RWOA 5F9HA 4NCNA 2PZFA 4GMXA 1IN6A 1S1CA 4B74A 1GNQA 2HDNB 3OEHD 1DS6A 4FI3C 3VQTA 4XWKA 4ZCMA 3IPXA 2IUSA 3MUFA 1W0JA 4U5XA 5K8TA 4BUJA 4HUQB 3DPUA 5LDDC 2W6ID 4KCGA 1E2MA 4LK2A 1IM2A 3DM5A 4IOJA 2OO7A 1H8ED 3GLGA 3KKPA 1G6OA 2N1BA 1AA9A 4KU4A 5BN3A 3R9WA 2I3BA 1R6BX 2BCJQ 3BBPA 2F1IA 5BYKA 1KK2A 3K8YA 3QKUA 4YMWA 5FTNA 3N2IA 3NC1C 4C0LA 1CJKC 4LHWA 3I32A 2J5XA 5HE9A 5JBQA 2FFBA 1E1QD 2J0SA 3ND9A 2O0KA 4ZCLA 3LVQE 2WM9B 5JCZA 1FPMA 3RRYA 4DLSA 3R7WA 2XNSA 2PLRA 4D2IA 5KDLA 1CU1A 2QA5A 1JXOA 4EIWA 1E3MA 4M22A 5E95A 1J70A 1II9A 4P3YA 5JI3E 1Z22A 2ZJZA 1ZJ6A 4ACBA 4L16A 4DT1B 4G5QA 5CITA 2JLUA 2QEQA 2EVWX 2XXAA 1N6IA 1HV8A 1WRBA 1XBTA 1P4SA 3Q7PA 1PLLA 1ZMXA 1XFAA 2ZJ2A 5EP1A 5GJCA 4D4KA 3GFOA 3SS8A 2WKQA 2Z5FA 4JZKA 2GXQA 3U3KA 2ZYVX 2BIFA 4JSTA 1EFTA 4EAQA 1WXQA 1N3BA 4TLBA 3EPHA 3DKPA 1OIXA 2IS6A 2AWOA 2PBRA 3H84A 1Q1QA 4IFEA 1NN1A 1TU3A 3IQXA 2ZE5A 1XPUA 3GJ8A 1JR6A 1P60A 3S1AB 3ADBA 4F92B 5H70A 1W46A 2XX3A 4BFZA 4MYUA 5KDDA 1H65A 1FP6A 3DL0A 4HAWA 4V03A 3ADDA 2GXUA 3JVVA 3LY5A 2NPFA 3TE6A 4DCUA 3KB1A 3C15C 3K9HA 4TL8A 1DPFA 5CLLA 3FMOB 1M1YE 1R2QA 2F1RA 2Q6TA 3JZMA 3HP1A 3W6OA 4D4LA 1GITA 1Z3IX 4XWAA 2W6JD 4Z1MA 4EJSB 1TQ4A 2QT1A 1YKSA 4LC0A 1A1VA 3HR8A 3I92A 4PC3A 3OF5A 1SKQA 1X8LA 2OAP1 4L8GA 3QBTA 2P3SA 4DLTA 1CP2A 2NG1A 1KK3A 2FPLA 2YWEA 4EFMA 3DMDA 4UKDA 1AK2A 2BBOA 2QT0A 4CDGA 1Q3HA 3AH8A 4G5OA 3E70C 4TT3A 3KQNA 2O8FA 1N0VC 4B33A 1SGWA 3KFVA 5FL7D 3ZJYA 5FPYA 3UATA 2JJ8A 1S9HA 4PC7A 3AVVA 4MYTA 4PX9A 1VIYA 2VHCA 821PA 4GNKA 2EQBA 3T1VA 2FZLA 5F9FA 2NOAA 2C96A 1GDDA 2O8BA 3QKRB 1DTSA 1IOZA 3THWA 1E2EA 1UBFA 1E4YA 2WHXA 3I8SA 3DMNA 1QHYA 4M1SA 1ZIPA 3W6PA 1NBMA 3REFA 2IS1A 2KBFA 4TLAA 5J4KA 5K8LA 1G3MA 4KVGA 3RS7A 3D31A 3O8DA 4LHXA 4LJ9A 5L3QA 5BYJA 1L8QA 4OQFA 2XB2A 4CVNA 2ZU0C 1LF5A 4PSAA 4BFWA 1XEWY 3CRW1 2WPDD 4Z8XA 3U7EB 1GL6A 4ON9A 3B82A 3CO5A 4WAUA 4B2PA 5C1BA 3T35A 4EKDA 4G5GA 1NP6A 1RYFA 2UKDA 1WF3A 1E96A 3EIEA 5FTMA 4D4MA 5JHGB 1ZAKA 3KTAB 3LLMA 5CJPA 1RJ9A 5AUOB 3B9PA 4EJSC 4KBFA 1GOTA 5L3RA 5HZKA 1XXHB 4F4CA 1MR3F 5HTKA 3CNOA 1ZW6A 4LYHA 1X3SA 1HT2E 1U9IC 2MMCA 2FEMA 1JXMA 4KLNA 1KOFA 3WYAA 1E2HA 5AUNB 2A30A 4HB3A 4F38A 4JL8A 1IXSB 2A5YB 2QMUA 4FMCF 3Q72A 4PAMA 1RIFA 2ODWA 4CF7A 3HWSA 1ZVQA 1E0AA 2WAYA 1NN0A 4TYQA 4URXR 1ETUA 1EXMA 2O52A 3CLVA 4WIAA 4MITA 1KSJA 1IHUA 3U7GA 2F43B 5C46F 4GOKA 2Q9AA 2FGJA 2DYKA 2G6BA 4TLEA 1VDZA 1LFDB 1GL7A 3B78A 2NPIA 1KI7A 5BN5A 2ZRDA 3ZD6A 3AGPA 4IEEA 5K8UA 2JAQA 4B44A 1AS2A 3J81k 1VG1A 2R6FA 1GRQA 1HYQA 2IXEA 2JASA 4IVPA 3NIBA 4X8MA 1X6VA 5J4VA 2VIIA 4Q1FA 1G291 3VNVA 3A37A 1ZUNB 1TQ6A 3R9IA 3BORA 4B43A 3CONA 1FFHA 4NCJA 4TLCA 4MKGA 1E69A 2ZI9A 3LQQA 4EFNA 2ZVQX 2HYDA 3Q5EA 4HB4A 4JBXA 4FN5A 1YJ5A 4MKFA 4XSHA 3WNCA 3VAAA 4TYWA 1AGPA 1TL7C 3ECCA 3UK6A 1W49A 3BOSA 1XX6A 3K0CC 5SZHB 1VMAA 2H16A 1M7HA 2ZI3A 4Q1EA 5M04A 3D7MA 3MD0A 2BDTA 4I81A 1XCGB 4DLRA 2G83A 1CTQA 3A4NA 4M8NE 1C4OA 3FKSA 4Z54A 2YYZA 1ZINA 2FU5C 3T12A 4BZQA 5CB6A 3PUWA 1E9BA 4QJ5A 4A2PA 1JECA 1Z6XA 3PJRA 1DEKA 4I1UA 1QHGA 1JR3E 2BM0A 2PZGA 5GADl 3UG6A 4U02A 3CZQA 2HEIA 2D7CA 4X8HA 3GEIA 4QHTA 3KQUA 4MGKR 1YZKA 2CHQA 4KVAA 4LRWA 2OILA 3RS3A 3ZZUA 4PHHA 5AJYA 2G0NA 3KX2A 1FL9A 4FW9A 1A82A 4CEHB 1KI4A 4H9GA 2QRZA 2QPOA 1MRNA 1ZD9A 3I8XA 2JDID 3KFXA 3H86A 3GLIA 4RY2A 1J8YF 1Z6TA 2QUZA 2MSEB 2W2VA 5ELXA 1AZTA 4GP7A 4B34A 1O3YA 2CHGA 4LYJA 2BJVA 1KK1A 1AM4D 3BD9A 1XJ0A 4IDQA 2ZI7A 2ZUCA 4DUGD 5BWMA 2BWJA 2HXYA 2BEJA 2J7PA 1P72A 1E2GA 2OZEA 2QORA 3EIHA 4V0MA 4EDHA 3FOZA 5UKDA 5E3HA 3OAAD 4YQFA 3L8YA 2QNRA 2VSFA 2DFLA 2J9RA 2GA8A 2ZQ5A 3SNHA 2BBTA 3U61B 3AVYA 1JJVA 2JIZD 2CNWA 3TAUA 3TLXA 2GCNA 3LW7A 2IHBA 4DCNA 1NVVQ 5CYPA 1RRGA 5DHFA 4B32A 4TZ6A 3QSYA 3DEFA 1H8HA 1IY2A 2CCGA 2ZPTX 1ZM3A 4RD0A 4V0LA 1UEIA 1XTKA 2RGNC 3AF1A 3VU9B 4P32A 2B6HA 1Z63A 2K5UA 3FGNA 1YU9A 1E6CA 3D3QA 4HAXA 1N5LA 5TV2A 3F0TA 3S1AA 2IS4A 3BXZA 4DDTA 3GQBA 2QN6A 3ZQ6A 4S35A 1JAHA 5HCNA 5DN6A 1Z29A 3AF0A 2ZSFA 1QVAA 1OXSC 3RVBA 4GSYA 2IEZA 4PHFA 1W48A 5G41A 1XTSA 2DR3A 4Q66C 2C9CA 5EP4A 3AVPA 3UMFA 4QFMA 2D2FA 4EJSA 5DO9A 221PA 4G5SA 2H92A 1P2TA 4AYTA 3UMRA 4QHSA 4W7SA 1ZM2A 2ERXA 2XTZA 4TSFA 4ZPXA 4DZZA 2E1RA 3PR1A 3THYA 1E79D 2DFKB 4BLTA 1XJQA 1BMFA 5JCPA 1OLOA 2OSBA 2ZRJA 4GDFA 5JSZB 3K0FA 1M7GA 5CDFA 4NE2A 3F8TA 2BMDA 2AK3A 1XRJA 4M4SA 3A1WA 2VP6A 3FE2A 5B57C 1YZGA 2QBYB 3O8CA 1KSGA 2REBA 3IHLA 4BFVA 4AKHA 3K70C 4HZUA 2XOKA 1FX0B 4GOXA 5KO2A 2QTHA 1T3SA 2V7QD 4PFSA 1IN4A 2JLYA 1SHZA 2D62A 3FHOA 2FX3A 2ZU6A 1DOAA 2NTYC 2FFQA 1WBDA 4QKQA 2D2EA 4IXNA 3X2SA 3MGCA 4UXJA 2IT1A 4TTQA 4QGHA 4BASA 1II0A 1XEWX 5JWRA 4NKRA 1KIMA 3B2EA 4HAZA 2ZE6A 4C4PA 2FFAA 2ZRMA 4DLUA 4JVNA 3T1TA 2GXSA 3BB1A 2IEYA 4BEJA 1R5OA 5EXXA 1EK0A 5KNCA 3VR2A 2R6DA 1OH6A 1EWRA 1LVGA 5LB4A 3WMGA 1B0UA 2BKEA 1OV4A 1G3QA 3HPQA 4GZLA 3TVDA 3OEED 3RS5A 4J0QA 1G19A 3GLGB 3SJCA 4Q9LA 4BWYA 3QNUA 2IA5A 4QHYA 4NBSA 3CR7A 2H57A 3SJBA 2PCJA 4QBGB 3C14C 2N42A 2H7VA 3TK1A 3C8UA 4M1YA 3M6AA 2MSDB 4PPFA 2ZYWX 2WIAA 3MWJA 4LBZA 4NYJQ 1W44A 1KHTA 1GKYA 3GD7A 3PUYA 2OEPA 3R7WB 3TRFA 3EARA 1CIPA 4LWZA 1SKYB 4NYMQ 3IEUA 4OHXA 2VSXA 5FFMA 2VP2A 5KPDA 1E1RA 3O47A 1EX6A 3G5UA 4PQFA 1KTVA 1R0YA 4I99A 4X8OA 4GPTA 3SOPA 5G40A 1E0SA 4IDOA 2ZM5A 1DO0A 1NKSA 2XB4A 3AV0B 3I5YA 2C78A 5G3YA 4RKEA 1HTWA 3K0AA 5DGXA 2XXAB 1KI6A 4BFTA 4C0BA 1PV4A 4AKGA 5JRJA 5EP3A 2NGRA 1AQUA 4Z51A 4XJXA 3U3JA 1XF9A 1N5IA 1IXZA 3VFDA 2OM2A 3OESA 3KKQA 4B35A 5DSZA 1LNZA 1TU4A 2EW1A 3VR5A 2RCNA 1NJFA 3ZLJA 1RRFA 4Q4JA 2ZVPX 3HU1A 4M9ZA 1Q0UA 2BC9A 2RGNA 3B85A 3TBKA 3SJAA 2F7SA 4GRAA 2KSQA 2Y8EA 4BFUA 2XGJA 4YXWD 1YE8A 3SBDA 3QEJA 4LC1A 4HI0E 1KK0A 2C99A 4LJ6A 3LA6A 4CT4B 4HDCA 4UXIA 2FF7A 4M2LA 3LV8A 3CF6R 1IONA 5J40A 5KUTA 4DLXA 4KV9A 5FPKA 4ASUD 4B3BA 3L0PA 5C2JB 4C3ZA 4PAOA 4JYBA 5JJIA 3NHAA 1X8KA 2WKRA 1CXZA 1P62B 4PO8A 4NCIA 2OV2A 4TL6A 2VP5A 4A6XA 1NLZA 1AIPA 4QM7A 5FL3A 3A1SA 3QPUA 2O8FB 3DHWC 3CPHA 2RB4A 3OIYA 3CW2A 3CPEA 3PIRA 5F3WB 3IGFA 4C0JA 1LS6A 4MDFA 1GL9B 3NBZC 3BWDD 3Q9LA 4URYR 5CM8B 2QP9X 5JI2E 3C7KA 5H1YA 3TIFA 1OXUA 3QG1A 1ZC4A 2OCYC 1DAHA 4QXAA 1XB2A 2WSSD 3L2OB 4F91B 2ATXA 5FPHA 1NF3A 3P4YA 4A0FA 2FDCA 2FZ4A 2O8BB 4NHOA 3WBKA 2W2TA 2NZJA 1EWQA 3THWB 1SVKA 2WAXA 4NTZA 3U6BA 2PT7A 3P20A 1CBUA 4HAVA 1NMZA 1CULC 5J4LA 1JBKA 3ICQB 5LD2C 1E2NA 4JT4A 4BQSA 2FE4A 1HY3A 2OBMA 2FMXA 3MLEA 3ZIAD 2XJ4A 4W5WA 1KJZA 2FH5B 5L3QB 2OCBA 2LWIA 1EESA 4M1WA 1NSFA 3AKCA 2X77A 2YOFA 2A3RA 1OB2A 2PX3A 4XD7A 2CJWA 2QE7D 1XEXB 2H1LA 4TTPA 4L5BA 1VHLA 5G53C 3CIOA 1Q12A 4U00A 1E98A 1Q57A 3KKOA 1RJ9B 4RZXA 2DWQA 3A1UA 4NCKA 2PJRA 3THOA 121PA 2GVDC 2VP9A 3AB3A 4LUCA 3T1OA 1ODFA 1QG2A 2XEXA 1VPLA 1E0KA 4A92A 2Z0MA 1XMIA 1COWA 1BIFA
chains in the Genus database with same CATH superfamily
3Q7SA 4JQFA 2IKQA 3RKUA 1H4SA 2LUOA 3SIPA 4RQTA 3MILA 1YVPA 4NPCA 3WTZA 1U6KA 4HNQA 3I0TA 3INTA 2QBYA 4PYLA 3PV0A 1W5SA 1K6IA 4XVHA 2JRLA 2PQ8A 3J7AO 4NQWB 4O5OA 1U8ZA 1OCRH 3PEEA 2C8JA 4LFUA 1FLNA 1E62A 3MHTA 1HCRA 1M1UA 3TG2A 2PUGA 1ZM9A 2E48A 1PR1A 3HS3A 2WWVD 2D1RA 4Q1BA 2OUKA 4CQLB 3WLLA 5DTEA 3HOYJ 3VM6A 5HEKA 3NB0A 1TWHJ 4RU1A 3JALA 4EPTA 2PVCA 3I1YA 1WB9A 2DU9A 1YRQA 2JFXA 1U2PA 3U4MA 3B2NA 1ORVA 3DLIA 1P31A 1ILEA 4KN7X 3SEZA 1DFHA 3UUWA 5GP9A 2XF5A 2YVKA 3DA8A 3PL5A 4MP6A 1DEOA 1F5NA 4QOHA 3OPYI 2BFFA 3M3PA 3BJIC 2GFQA 4XSGA 2W25A 1V4VA 3N7AA 1T2NA 1PZXA 2CNNA 5ELMA 2LP0A 2XASA 1PYVA 4OI4A 4RB2C 4OU0A 2JCBA 1SXJB 2C1ZA 4MUAA 5LOVF 3EQ9A 5FROA 4NDZA 4QQRA 2E4ZA 3HYCA 3IDSA 3EG5A 2VSOA 1VQPI 2ZDHA 1IK4A 4C3HJ 4JI8B 2M87A 2VTDA 4UOEA 2ZI6A 1TJ4A 5JXJA 5A3RA 2ZT6A 2FSVC 1ENZA 1NTCA 4Q9DA 4QO7A 3TFQA 4W97A 1QFXA 2QOEA 3DHYA 3H0DA 2C03A 4CLOB 3ES9A 1G5PA 2PQMA 1UBHS 1TMKA 4IPAA 3BTCA 1E2UA 4FR5A 2XKBA 3JD1A 2NSJA 1M1NB 4OLAA 2W2PA 1D1CA 3KZCA 4BFSA 4JGGA 3LP5A 4CHGA 1UJ6A 3CT4A 2VWQA 4QREA 3R5KA 4QLOA 3SQDA 2M3AA 3CNLA 3MXOA 1G4UR 3KP3A 2J7KA 3F3MA 3NKFA 1E5LA 2BF7A 3ZPXA 2TSYB 4KXFB 1OFUX 4GE0A 5KDOA 1UELB 4TV9A 3BA6A 2EC5A 1WVGA 1GGEA 4BMVA 2B1GA 2KZGA 4H4CA 2BEKA 3DOJA 4H4DA 1DKPA 4IILA 2RREA 1H93A 3MTGA 1G1MA 3WTBA 2Q3DA 1P7VA 2ACKA 1WB4A 3I04A 3JR7A 2HQ5A 4BDSA 3LDUA 1HDCA 4GLBA 3T3MB 4IDEA 2LXNA 3P2KA 5C7LO 2E87A 3T0FA 2YV5A 5FV4A 6Q21A 4FWIB 4LJLA 4G67A 1Q20A 3I28A 5AK0A 3KSUA 4L9AA 3H1EA 1VG8A 3FGOA 3K4KA 4Z1OA 1ZO8A 4H0NA 3TTUA 3RNOA 4ZAXA 1K7SN 1IV6A 4FK8A 2VK4A 4Q1AA 3RYHB 4KXQA 5KU1A 1AU7A 3KTFA 2DT7B 1D6SA 1FDWA 3HFJA 4CIDA 4G81A 4JOMA 4RH0A 2MR5A 4YJDA 2IEDA 3WGZA 5ALQA 1Y4DE 4YRJA 4BAGA 2FQ3A 5IUJC 4HP8A 1ZD2P 4YAUA 4HRIA 2GOMA 2AKYA 1Y0NA 2FPGB 2HXOA 5CEEA 1LEBA 1PZGA 3R7SA 1G6KA 4L9VA 2DPYA 2X1LA 2GAAA 2QAGA 2VKQA 5B1YA 3NOVA 3DMTC 4BP3A 1SD4A 1PJ2A 4MHOA 5B58T 1SELA 3F47A 1XELA 4OBWA 5BVGB 2KRCA 3RLIA 3OE7A 1GPNA 1V16A 4WBSA 4OMCA 2GKGA 3GTPJ 3OU7A 1HEIA 2GB4A 5JWHA 1LW6E 1W4RA 2LG4A 2JJ7A 2CDRA 4HVTA 4JUBA 2CD7A 3ONDA 2P35A 5GJBA 1YVUA 1XT6A 5AFSA 2Q5IA 4PC2A 3UT5A 2R96A 1TF5A 2QTAA 2BGIA 4D0NA 1SCIA 3BR2A 2Y1DA 2EFCB 1DUVG 1VQKI 1ZYRF 2ODEA 2XGEA 5IKXA 2EX0A 3MF4A 5KJCA 3Q9SA 1MFZA 4KWTA 3E84A 2B7CA 5LL6P 1GFIA 3Q5FA 2DJ5A 3VR4A 3MJEA 4A0HA 4EUFA 1PTJA 2XUIA 4PNHA 2WRZA 2C7GA 1KQ3A 4BE4A 4O2AA 4DY6A 1J90A 4HX5A 4PJLA 4M1KA 3H9CA 1X14A 3U1DA 5LSAA 1J1ZA 2DF8A 4WXRA 1IYZA 4GNRA 2DX7A 5DI3B 2GFHA 3OEHA 1A2KC 2IK8A 2Q3MA 1SVNA 4CL3A 3KSBC 2VZLA 4GZMA 3T4EA 2OYCA 1PUJA 4AYWA 3T5MA 2G5GX 3ISTA 1VL1A 4DBZA 2CXPA 4AZ3A 3HKCB 5AKKA 2G6TA 3D7NA 1PBTA 1UBSB 2H1VA 3LRTA 3VMFA 2R7RA 5F51A 3BAZA 2X0LA 4J16C 4U8HA 5KINB 3TLJA 4E7IA 1Z06A 2VO1A 2RHRA 4RA9A 5KTNA 1QCZA 3AM4A 3SXUB 4IUYA 1NA5A 1QHSA 5LIPA 2HKOA 3L8HA 2XADA 2C5HA 2DWPA 1T5IA 3OE5A 2OCXA 5ALXA 2R66A 3WWYA 1RCUA 1M34E 5DN9A 3V9AA 1OXVA 1JR2A 2Q6LA 3AG3H 4J7XA 1SFOJ 3G8AA 1TRKA 3QVKA 2HU9A 3JCZA 2REQA 3PWTA 3UAGA 2F6RA 3HNRA 3LLUA 3BE6A 3ZHQA 4L4SA 3IDFA 1E9FA 3VSLA 3H2SA 2B8JA 5DYNA 2J0VA 3UT6A 1V4NA 4NU8X 1ATZA 1Z6GA 4DZPA 2Y2VA 1UJBA 4KQIA 4YT4A 3QGMA 4DMHA 3RSZA 2GM5A 4KX5A 1OWMA 1AU9A 1ZSNA 1ECBA 1NNI1 3S5UA 3QXXA 4NYIQ 3VRHA 4TKUB 3AZPA 2EFWA 1XSVA 2YS6A 1YFLA 2CVQA 4C2UA 4MFDA 2AGVA 5SY9A 4YUWA 3VKWA 5EHXA 2QG9A 3P5BA 4YPFA 2DMTA 4BN5A 1TKAA 1C50A 2EKPA 1U8FO 4MUGA 4J01A 2XKAA 2ZT8A 3PEWA 1HOTA 1OFHA 3D7SA 2WB1A 4ZOEA 1TWAJ 4OQQA 2JN6A 1YCGA 4I6ZA 2H54A 3LCJA 2W71A 2IS2A 4IJKA 3CY6A 1DLJA 2A5FA 4PSVA 4YPOA 3CUOA 1ODDA 4XCVA 4W6QA 2K02A 5I7HA 2HYJA 3L6DA 1YI2I 3D6JA 4FYPA 4KQCA 1E20A 5T6BA 5KC9A 1NKVA 1FMFA 4LSWA 3EWAA 3G0GA 5K0EA 4ZVTA 5IAAA 3AERB 1FBSA 4MEJA 5F1RA 2WNHA 4FMDF 3RSCA 2DMPA 1XK7A 5D3QA 5JJLA 2QUFA 2O7NA 1DX6A 3U3RA 1O0SA 4FFBB 3TNLA 3P45A 2ZSBA 2XUAA 4F3YA 2CNBA 3JTHA 4MCJA 3GJ7A 1BS2A 1QJCA 4CM4B 1UDRA 5I4CA 4BDTA 4X1KB 1GA6A 1FNMA 2WQ7A 4ZQBA 1U3FA 4Z53A 3TW8B 2WE8A 4R1OA 5M5XJ 3VV2A 4G0XA 1VQOI 1QYDA 6YASA 1GSHA 4P5PA 2VF8A 1YCHA 3K4LA 2YWFA 2V7FA 1CLUA 1Q0ZA 1Z74A 1XR3A 3VO1A 3PUXA 5F0HA 1XCMA 3VJLA 1ZH4A 4EGFA 5K05A 1PHRA 1DXQA 4BEHA 4D0PA 2V6BA 3O4RA 3QFSA 1RLIA 4QYIA 2ECFA 3KP6A 3H2ZA 3TL3A 4PS0A 4ZTBA 4IFBA 5K4HA 1T8UA 4TQ9A 4HTFB 1QH1A 3EUKL 3MBIA 4WLOA 2QI9C 1H9TA 1B8UA 1Z0ZA 2BZGA 3HDYA 3G3EA 5EZGA 3OEEA 4W1UA 5EG5A 4PE5B 1G20B 2KRFA 3T52A 2J9ZB 3LBIA 2XBUA 4L5EA 4DNOA 2FV8A 1L8XA 1QQTA 5JZVA 3OQNA 1Z0IA 3LHDA 5DNYB 1C81A 2Y1OA 3NBYC 3J81A 2FNAA 3S2EA 3AP2A 2WUGA 3EXHC 1WVIA 1U4SA 1QO0A 2X1VA 1VYUA 2DQRA 4QVGA 2Z5UA 2J46A 4LRUA 2NZVG 2VPYA 4G0YA 4E2WA 1YKGA 2FEZA 2GZRA 1ID8A 4IH9A 2CY0A 4ALJA 1YASA 4CI9A 1FP4A 1KVTA 2IYQA 1QLJA 1BMDA 4ZT5A 1Z4OA 3WKDA 2WUEA 4E22A 5JXHA 3Q3IA 1MMDA 1CF7A 1P61B 4L9SA 4P9UA 2ZCVA 2Q5QA 3DFZA 1DU4A 2F9FA 4MRPA 1KMNA 4HNAA 1GVHA 4M21A 3BD6A 2QPAA 1BGVA 2AEJA 5EXEA 4CMIB 1LNSA 3TSOA 1CG6A 1G3IA 3DNMA 4QTYA 3Q7QA 5A9SB 3EC2A 1K9SA 3FMQA 3KQLA 5KNLA 3WXMA 2XCRB 3N76A 1QB8A 2QENA 4WZAE 2FOXA 1JFTA 5EKSA 3ASUA 2L3DA 2JJQA 4YG2F 5B1BH 1I3MA 3M3HA 2CFSA 3GNTA 2PKCA 4QOGA 3FDZA 3ZI4A 4BN4A 2WTBA 5ALOA 2YJGA 1UFMA 3K0CA 3OV8A 5IZCC 1CR1A 2ZJ6A 1P4RA 2W48A 4Y6LA 4CM3A 1D8TA 1FP7A 1MX3A 1U9OA 3NARA 2HJ9A 3ET4A 4Y0NA 1X9GA 3JAMZ 3LNCA 3IJ5A 1S2MA 2MMGA 1Y89A 1WRJA 1VKZA 3QELB 1GN9A 1Y3IA 5EA2A 2L54A 5LQJA 2I65A 1C3OB 3GZTB 9LDBA 3BQNB 4X24A 3KHUA 2WTEA 2EFPA 4KUGA 2K87A 1FFSA 4OKIA 5CXXA 1P0CA 4Q24A 3LX8A 1Z7UA 4P2GA 1OAAA 4XWGA 3CRMA 3QEOA 1US8B 4MOWA 1FNNA 4BFXA 2NSHA 3FTQA 3AW8A 4RSGA 2YYSA 4QTUB 5TGTA 3E6AA 1SXJE 3LAWA 5EKXA 4LBVA 1VBMA 3IIKA 1NXTA 3BA1A 2QLNA 4R5HA 5IASA 2FUEA 3OYBA 1HKHA 4C7XA 1L1QA 1PR5A 3HWX1 1RI4A 1Z38A 3QF7A 4OFBA 3COYA 2QMYA 2BKVA 1JQLB 3CCCA 1SUBA 2JBAB 3D6AA 1RYMA 1E5XA 3V4PB 4RMNA 2ORVA 4CHUA 1CEYA 2M1XA 3HVKA 4E51A 2M45A 4PG8A 3ZVRA 3TNYA 3DLLF 3D2AA 1DEHA 1ND6A 4DOMA 2SKCA 2GEJA 4OG2A 5G0UA 2BI8A 1Z3CA 5E79C 4Q1DA 2VDUE 2HA4A 2HJRA 4E0BA 1E7SA 3ILXA 5KJ6A 4FASD 2Q99A 2BI7A 5HJ2A 3IRRA 2QX6A 3G9QA 1OYVA 5D7BA 2PU5A 2PZEA 5FPTA 2E6UX 2PUEA 4WNCA 3MTQA 4QUJA 3RSLA 1SB8A 1J56A 1WXHA 2V96A 2WU1A 2NVTJ 4GUAA 3NTOA 2LP4Y 2B8EA 4BUJA 4CCWA 1P4XA 3ER9A 2YMMA 2ARKA 3OLYA 1SD5A 1OC4A 5BYKA 3K8YA 4EYOA 2P4HX 2DECA 3A9SA 1C9MA 3LVQE 1KBOA 5DXFA 5JCZA 3P9ZA 3Q8LA 4D9CA 1CU1A 3GJZA 1JXOA 5GONB 1PDVA 1II9A 4DMUB 4P98A 4ACBA 2DWUA 1HV8A 1WRBA 2VF4X 1Y82A 3WHPA 4OMUA 2NU9A 1Y42X 1AGYA 1F0NA 1WXQA 2HN9A 4F11A 2B4QA 1ZZEA 4OJMX 4KGXA 4W5NA 2PUTA 1IRFA 3KB1A 2HQNA 5KYNA 4M3EA 3OPVA 1SMYF 3HP1A 1GITA 3RTGA 2GOYA 4KPEC 3QVSA 3FG9A 1A1VA 4PC3A 5KMGA 2G71A 4UKDA 2G4VA 1AK2A 5CPBA 1POWA 1YACA 5FL7D 4EBFA 1JL3A 4PLTA 1KETA 2NLOA 1FBNA 1JVBA 1VIYA 821PA 2EQBA 5AVXA 4XPIA 2VRCD 4TXHA 1JHAA 3TLAA 3QMMA 5CA0F 1I50J 2P9CA 1KQPA 2WHXA 1O6GA 3VBEA 1GUUA 2JBWA 3DF8A 4HQLA 4LHXA 4E15A 2XB2A 1LB2A 3GNLA 4B4KA 3CRW1 1ECPA 4UU0A 2WPDD 4Z8XA 4LF5B 1U7WA 5ALNA 2Z3WA 3GFQA 2HFHA 1X3SA 2JIPA 2FEMA 2LR0A 4D8XA 4CCSA 4FDAA 1ETVA 5D8DA 3Q72A 1WJGA 3F6OA 5LXTF 1KSJA 3IMKA 5HK8A 5I9NA 2C9BA 1I14A 2G6BA 1GL7A 1R8JA 2VSQA 3AGPA 1AKNA 3I9JA 1NH3A 1V1JA 1C8LA 3DOIA 3AHCA 3GNSA 1FFHA 3OQIA 1PVDA 1Y48E 1LU9A 2ZVQX 1N5DA 1TL7C 3CD6I 4ZZ1A 4O1HA 2ZI3A 4Q1EA 1W0CA 2VJYA 5B6PA 3S29A 5F2NA 4BYGA 1JEYA 1QQIA 3H2BA 4OM8A 1QDUA 3OYGA 1LPSA 4EHKA 4IH4A 1R3UA 4JX8A 2GPAA 1VE7A 3PF8A 2WYHA 1PT6A 4UHTA 1WUJS 4GDMA 1M1EB 4YP1A 5ARCA 2BEJA 4YEDA 1C1DA 4URFA 3K4CA 2YFYA 3HXTA 1YCDA 1ODTC 1P2DA 3JQAD 1NR7A 2CNOA 5EVJA 2WIGA 5FLYA 3BZ6A 1UG2A 1FX7A 4I5GA 5FD6A 3DAYA 3AG5A 1L7QA 1HQDA 5L6LB 5TV2A 1P0FA 2E5ZA 3BXZA 4DDTA 5JSYA 1V1MB 3ML1A 2OV7A 3KQMA 4F9GA 1M2GA 3SM9A 4IQ8A 4L9JA 4UAUA 1ULHA 5BWNA 3LBAA 2V7BA 3PXUA 3LSMA 4Z2AA 5KS2A 4L0YB 5LZ7A 4QYTA 3F4LA 2D0OB 4EG0A 4BNHA 5BV8A 3ZWOA 3ZUGA 3VVLA 5I7EA 4DV0B 3TINA 1MX1A 3NRCA 2D2EA 1G21A 2MINA 2H9IA 3EAFA 1QFYA 3HRTA 1IOVA 1R5OA 3QLEA 2QVXX 4R7TA 3MELA 3EODA 1G19A 3FTDA 4M0KA 4ZMRA 5BN3B 1UP4A 2JCGA 2E4XA 2C2BA 6ADHA 3ADPA 3A6ZA 1MF7A 1X1EA 3EDOA 2VNSA 2GBYA 3CURA 1U5BA 1V45E 1CUAA 4ZVVA 1CIPA 4OHXA 1VBFA 2DFEA 5G40A 3FW1A 5JZBA 1QJ4A 1L7AA 3GH3A 5F1KA 2BGGA 3MD2A 5JRJA 1JUSA 5JH7B 4KYTA 4I4TF 2L7KA 3FXOA 2EW1A 5J2TA 3TOZA 2RGNA 3S28A 1QQAA 2JA7J 1GYQA 3MGKA 2M7AA 4Q7QA 2C99A 3OZGA 4UXIA 4WY8A 1HNZB 3OE1A 3PSHA 1HRDA 4JYBA 1OGIA 5AK5A 3RM3A 1J42A 4ITVA 4ZDOA 4MQLA 2LY2A 4W9RA 3CPEA 4C0JA 2WHPA 5LC1A 2EILH 2NSLA 1ZK8A 3T7KA 3C7KA 1TYEB 4CV2A 2WSSD 4HQEA 3ZVKA 1OYIA 4Z4GA 1I4EB 1OISA 1SVKA 2R00C 1CBUA 1CUJA 5BS6A 4I6GA 1TM5E 1E2NA 3GV0A 1XRLA 2V59A 2FMXA 3P9QA 2XJ4A 3EUEA 4N5MA 1KYQA 4MQ5A 1YL5A 5JQGB 4AJNA 4TTPA 3EQLF 1J6UA 4RHXA 2VHVA 2JGDB 1JI3A 3GVIA 3RHSA 1B6AA 1GTSA 3D81A 3WAKA 1DKNA 3IAS2 1E9SA 3SYMA 1TIBA 3GRRA 1WOMA 3PO2J 1KZYC 4A27A 4ASNA 2CF5A 4V0RA 4CLRA 4JA0A 4KLAA 4UJ5A 1RUNA 3OIPA 1N5KA 4R2XA 5DBGA 5EE9A 5CG1A 3IBCA 1GPDG 4AZVA 4RVOA 3H99A 3OPYB 3W04A 1ZLYA 3I2KA 4TPKA 3JD4A 1HXHA 4H6VA 4HDUA 4R8HA 1SQSA 2TRSB 2QKLB 5IHPA 4KFCA 4IJUA 5HFNA 1T9AA 2JPBA 2IYOA 3C1AA 1O97D 4P93A 1I2CA 2F55A 5DYTA 3AHDA 3OS0A 1QGED 4JCCA 3DU5A 2EA4A 1ZRCA 3INYA 3QU2A 1YRLA 1I2DA 1U4OA 3IMCA 3MQ2A 3OT5A 3OS1A 4YJ3A 4P36A 4MLDA 2XPWA 1MABA 4Z4IA 1RHKA 4ZWNA 2Z08A 4CPDA 3LCMA 4UVGA 1FJHA 3OD1A 2EFDB 1OTXA 3G2IA 4P96A 3PFGA 2HRDA 1JIIA 2WF6A 2NTJA 1FSEA 4GPIB 4G12A 1G20E 4RD6A 4P4UA 1L9KA 1AHPA 4U87A 1DTEA 1JU9A 1AUPA 4OP3A 5JAPA 1E92A 2UVDA 2GCPA 1EJ0A 3TI9A 2WJWA 1X7XA 4JLOA 4NY1A 4PVDA 3CCJI 2WWHA 1W96A 3CLKA 4B6GA 1ST3A 1TEZA 2PFSA 1NQVA 4BVFA 3D9QX 3VH4A 1DWQA 4LPKA 5EE3A 1UOEA 2PZLA 5FTKA 1MZPA 1IF1A 2LE0A 4BVKA 2G1AA 4PNZA 4UTRA 4U2EA 3H5VA 1U1CA 1X1TA 4YX9A 4A3LJ 1JRLA 3MKZA 3SJ7A 2LREA 2IV2X 1RKUA 2GCOA 3JVIA 4G09A 4EI8A 2PRJA 3VTKA 2PEZA 4MRRA 2YJTD 2D45A 5GAHJ 2FUG2 5IAKA 1P1RA 3IJPA 4Z7OB 3OWXA 1SXGA 3VVBA 5EWJB 3E9EA 1D9XA 2DQZA 3O8NA 4M0CA 4OYLA 4B4OA 3ZHVA 3RFXA 3SXYA 1YTUA 5FOTA 2NU6A 5FYQA 1GZ7A 4X00A 4MV5A 5BWCA 2NXEA 1K2WA 4MGRA 1S3GA 2LCIA 4K7JA 4UAGA 4E5YA 1AXRA 1MU0A 3WFJA 4HQNA 4CCAA 1O54A 3KAQA 4QDKA 3TKLA 1IZYA 1IHOA 2LKPA 2BR5A 1BR2A 2ZJ0A 5CU7A 2L02A 1KEKA 2CS3A 2OENG 1PJ8A 1GSAA 3Q40A 1WWKA 2OCCH 2E7ZA 4DLYA 3R7FA 4AY5A 3OYMA 4MYDA 3C5VA 4MQMA 5H68A 4AZWA 4D8YA 3BD7A 4YDHB 3CUQB 1XA4A 3DW1X 2YN4A 3FCXA 3U4AA 4FGSA 3TR5A 1T36B 2GLTA 1GM5A 3MMYB 4L6CA 4N49A 2YY6A 4E6PA 1HKTA 4QFCA 4DTCA 1LBEA 3CIFA 4NOJA 5A5DA 3NHZA 1XGMA 1ZONA 2IV3A 2EG5A 4EECA 2TMDA 3A6FA 3P97A 1ULZA 3IAHA 4GU5A 4C88A 4YJFA 2P3OA 2NYVA 3J7TA 4Z1MD 1U2SA 2I8LA 3HZHA 2G1UA 4RTRA 1SHUX 4C7OB 3T7IA 4E70A 4XTCS 4RK4A 3IA2A 4AMVA 5AJUA 4AF6A 2YRFA 3ZS8A 3WK5A 2QYSA 1E3DA 2SBTA 4C3IJ 3R7DA 4J9VA 4R16A 5CFOA 1STOA 1OQYA 2Z6AA 5KQSA 4BL0B 5I9MA 3SLGA 5LJIA 4OTZA 2ZRBA 4NAHA 4LZOA 2Q2EA 5KAIC 1WPGA 3D4PA 3U31A 2EHDA 1U80A 4Q3KA 1S7CA 2ICAA 5IF3A 4UHCA 5K3BA 3QKSB 1AF7A 3Q8WA 1Y1LA 4TYYA 5I47A 2WJJA 5D5PA 1PYGA 2NYUA 3NJRA 1PT5A 5U9CA 1R49A 1ZJJA 5EJ9A 4U7BA 1PJ4A 5TVKA 5F73A 2GA1A 1YC5A 1NE7A 3DNFA 1AKTA 3VYUB 4TVOA 1A4RA 5FADA 4GPBA 2XGXA 3GA0A 3R9XA 1Z26A 3LUDA 1QCYA 2SKEA 4K3VA 3C5HA 1Q77A 2L42A 3DXZA 3HEAA 1WSDA 4JC8A 4E6KG 3ME5A 5KSZA 2B1JA 4UNQA 1UZNA 1XKQA 2FSPA 5K4GA 1P9LA 2WD7B 1KI3A 2BRUA 2EP5A 1N5JA 2HK6A 1YJXA 1B23P 4LMBA 4AG5A 4PYMA 4LHZA 2NRAC 3OYCA 2WADA 3PFYA 1W8DA 5K0JA 2QVZX 1YDFA 4KJZA 1K3UB 4JJ4A 1RI3A 3ZCXA 1U11A 3TH5A 5DDGA 2XYHA 1A9PA 5ADUS 3EE6A 1G2HA 4S1PA 5JEDA 1NPYA 4CM8A 1XZEA 3E3NA 2FN8A 4IS2A 1KYVA 2OD9A 2B8TA 4AJKA 5IVDA 4P7KA 5CYFA 3QVVA 1X2EA 4HF1A 1SULA 2E1CA 4CKZA 3HA5A 3TSCA 3A2KA 4LXQA 2C5LA 1P1BA 3G8CA 1ESZA 4TWRA 5F3DA 1R00A 1TM7E 2GMWA 5D5HA 4YMGA 4YONB 4EMTA 3WTTC 4BO4A 3B6KA 4XGIA 5EG0B 3KOZA 4LGMA 4V24A 2NU8A 2XXJA 3SC6A 3N9IA 5BV0A 1O5TA 3GX1A 2LTAA 2ZIXA 2XQJA 2FEKA 4XORA 5IZ4A 4RFLA 4DV2B 4ROSA 1JSXA 1IIBA 1BU5A 1QH8A 3L7OA 2H9AA 5HS8A 4FCCA 1OTYA 3JQRA 4B47A 4F9EA 1U5CA 3B1XA 3P0RA 1R9MA 1XAIA 2ZWAA 4UEKA 3SEAA 3KSZO 1KERA 4X97A 1OROA 1P73A 3P9PA 4CR7A 4H1UA 3RUCA 4CMHA 4B3DA 5LLDA 4DIEA 3MUOA 1T5LA 3JD3A 2QQ8A 4UNNA 2DCMA 2QRLA 1SHTX 3SSAA 2XWPA 5MHTA 3ZCOA 3CJNA 4PYOA 3EPZA 1QPBA 1AS0A 2CEAA 1IM8A 1IUPA 4C6SA 1QHIA 2HQOA 4PSKA 3RC1A 4Y52J 1NRIA 3CZPA 1YXMA 4XB6B 4YHHB 4IIJA 5C18A 2DPMA 5B55A 2X6OA 1G8AA 2H63A 4OXYA 5JV5A 4FQGA 4ARZA 1BX0A 5CKTA 1EA3A 1U28C 4B3JA 3B12A 2UUZA 1M0WA 4R1HA 1QG6A 2XH8A 5DULA 1ZOLA 4YMUA 1QP8A 1U31A 1ZU5A 4BKUA 1YJ9I 4YAEA 1SUCA 2ZR0A 2OA4A 2ZITA 1K1EA 2Z09A 3OF3A 4KPGA 5HF9A 1ZJYA 4U0WA 2G09A 1UXGA 2JFBA 4P84A 2XA9A 3C6ZA 1O5OA 3EVZA 1JTFA 2C84A 2PYIA 2OUMA 2ZJRF 5HHTA 5DCWA 5IN5A 5AP9A 3WWCA 4MWCA 2PN1A 2R7WA 1L4MA 2VTKA 5DD4A 2CL0X 2RC4A 1TJ3A 5F5XA 5CA0A 3RS9A 3NHBA 2B83A 4INZA 3EF1A 2AMYA 3VPRA 2KLBA 4K40A 3A6GA 1NR1A 3ABKH 3M4ZA 4Y1RB 4QFDA 3KOMA 3G5MA 3R2JA 4OLJA 3GCGA 4Y2XA 3BWMA 3MS7A 4LXIA 3CMMA 2XYPA 2X0KA 3CWZA 3MGGA 4XLHA 5JROA 3KKKA 1VJGA 1IN5A 1U0JA 2NUAB 2J32A 3KOOA 3S8YA 4D41A 3P9SA 5LXTA 4G1CA 5IVPA 3PQ2A 2VJPA 4OHBA 4QJ4A 3I76A 3U4QA 3W3CA 3G1UA 1NQUA 2HMSA 1T24A 4E7ZA 3LLVA 3DSRA 2QMHA 2ZEJA 4KE9A 3ZWNA 4GG1A 4DYDA 3K9FC 3BZUA 2AOUA 2VE9A 2QLZA 1SCNE 1G8MA 3EVDA 3OCYA 1D09A 2Z2ZA 4GGMX 4RJKA 3RRJA 1QRYA 2AYYA 2YHIB 1K06A 4P55A 3F6YA 3QEBZ 2EV0A 2I7TA 2WU0A 1SWWA 2QKYA 4CN9A 5ILSA 5KTRA 2FW8A 4ERXA 2CQXA 1E7WA 4OLHA 3S55A 2ZBFA 3VR3D 3DDZX 1LPAB 3GL9A 1W36D 3ZD7A 1S8FA 3E1SA 3KTDA 4H0CA 1MDMB 4M0LA 1YQAA 5C5IA 2EU8A 1XXLA 4YP9A 4IZOA 4MB6A 4HDAA 4IRGA 2WFMA 4TMFA 1A5SB 5C1DA 2YBEA 1R27A 3D7RA 3EGDB 2CLDX 4WERA 3I56I 3K1JA 1QG4A 4PG5A 3TZEA 3UWDA 3BEOA 1AUXA 1CUCA 5JS6A 4KC0A 2M2IA 3S5JA 1O0CA 2IXTA 3EH2A 4FS3A 1HE3A 3S0JA 1T8PA 1E7QA 5EUQB 4YJ2B 1DAOA 4EY7A 2ZJOA 3NX4A 2IE0A 3ID6C 2G8LA 1QX4A 5DNCA 3QU4A 5AI5A 6GPBA 2QEXI 3SYKA 1E1MA 3HA2A 1TC1A 4RKRA 5HKOA 5IUKC 3AUFA 3CW8X 2HKIA 4DRZA 4HWOA 1HX7A 4AICA 3SZTA 3H13A 4N7MA 4HUTA 5B7QA 1T8IA 4DSTA 4C0AC 2AC2A 1MLDA 3BXGA 4AECA 4LI0A 1EUDA 4UEOA 4JJAA 4CMGA 2CMKA 4BRUA 1XD2B 3KTAA 3W5DA 2XDYA 2CB9A 4OI0A 3BL5A 3DTVB 1XXHA 4UDXX 1J7KA 5B64A 3DT9A 4K6GA 1K8ZB 2YZ2A 2V6FA 5DEQA 1YTLA 2XNDD 2B94A 2GJ9A 1TF7A 4M71A 2HZTA 1BQ3A 1HYEA 1CZHA 4DG5A 1H0HA 4EA7A 4LQLA 1ECLA 1Q0SA 1Z0SA 1NUUA 4I4TA 1TXGA 5HCIA 2QU8A 2II6A 3UAZA 5KTKA 3ZWPA 3S8EA 1OD6A 2X0DA 4CM7A 2Q9BA 4ZCIA 2FWIA 4BJ5C 2VL8A 1K2VN 1QE0A 3AAFA 1X94A 3IUJA 2DA4A 1SUDA 4ZEVA 2ZJQF 1VHDA 3FWZA 3M8FA 2Z9DA 4UTPA 3NANA 1V8FA 1XQ1A 4D46A 1NMYA 3JYOA 5FTLA 5D3MB 1M2JA 4M89A 1HYHA 3F78A 5A06A 2QMZA 2BEVA 1YJCA 3NEJA 1SA0B 1KVSA 5IT9K 3VMMA 1UJ8A 1POGA 3HOXJ 4Q16A 3GVCA 2BEUA 2O8DA 3WG9A 1G2QA 4K9RA 4GOMD 3VHQA 2CXXA 3WNDA 4AB1A 4ZVOA 3BXEA 5IEJA 1BNCA 2W98A 4C6TB 4CW7A 3G0HA 3E22A 3M4YA 3FWKA 5INTA 2ONJA 3G85A 2QUKA 3FIJA 4PCAA 5K2MA 4RDCA 2R8PA 3VYSB 4V19K 5IC6A 3FPKA 5A3JA 2LYCA 2R25B 4AD8A 4XJSA 2W6OA 2NV6A 3WGQA 4Y33A 5CDGA 2BKLA 1IBRA 4YR7A 5C8DA 4UTNA 1NVTA 3L0BA 4PFKA 2VPPA 2IJGX 2ZTVA 3V6LA 2WICA 3ZLBA 1ZVMA 2IPMA 4AS1A 1IB0A 4LYYA 1U98A 4TRNA 3JD0A 4JNKA 4XSVA 2Q7XA 5CLHA 2R1ZA 2D0DA 4NF2A 3IPXA 1JMKC 3PNVA 2YCLA 5K5QA 1YW8A 4ALKA 1E2MA 5CM2Z 4CYCA 2HD4A 2ZAYA 2F1IA 3UGJA 3IOEA 5FTNA 3W1WA 3NC1C 5F0CA 2NV0A 3BJOA 2J5XA 2VIXA 3FTPA 1VE1A 3FXMA 1Q0LA 1NBHA 3AM3A 3R6DA 1NLMA 3HY6A 1QP7A 1D0IA 3DAGA 4DT1B 1MCZA 3LOQA 1GDHA 1PUFB 4CMCA 4HO1X 3ILVA 2XE6A 4WOJA 5FWDA 4BKPA 1NN1A 1S5LC 3ADBA 5H70A 2WKSA 4QPJC 3ADDA 2CJYA 4O6VA 2PXAA 2Q6TA 4XKBA 2CG4A 3ELYA 1L5HA 3HPHA 5IDYA 1SKQA 1C9JA 3BSSA 4G5OA 5FPYA 3ORFA 1Y9AA 1ZKDA 4DG9A 5K0GA 1RVV1 1FE8A 2C96A 3ZDCA 2ZCWA 1DTSA 1BW6A 2P77A 1E2EA 2RC5A 5K8LA 4KVGA 1TC3C 5A9TA 4OQFA 1R18A 2LW7A 2ZSKA 2ME0A 5C1BA 1RYFA 4UHJA 3LLMA 5AUOB 4Y67A 4N5IX 3CNOA 3CVYA 1E2HA 2Q4BA 4F38A 5DEOA 2IZ5A 3ZXXA 3I0NA 5A4AA 4MITA 4JCOA 4CTMA 5BMVA 1JXAA 1PS0A 1T6XA 3RIXA 4XXHA 2WK1A 4AVPA 1U2TA 1SAYA 3DL4A 1QVUA 3AU9A 4JH0A 2F17A 3IT0A 2GZMA 4UE3S 4RDUA 2D8AA 5M04A 1R9JA 3SVZA 3T8TA 2V1DA 2H5IA 3PNKA 1E0EA 4MAAA 3TXXA 1JECA 2KM1A 3GEMA 5EJ7A 2D7CA 2EJCA 3KQUA 3L1VA 3DZCA 1JGSA 2ID4A 3BFJA 3KG2A 2V8BA 3I8XA 4UM8B 2RQQA 4PN3A 2ZXWH 5IM5A 4RAZA 3L2WA 2BJVA 3WGGA 4IHJB 4P82A 4IDQA 3NHWA 5GIPE 3HOZJ 1SKBA 1QAQA 3I2FA 2QNRA 5CVJA 3U61B 4B6JA 3JQBC 1JJVA 2JD0A 4E21A 1VRWA 4UZFA 1JKOC 5GAJA 1PT7A 4MCIA 4LNHA 2I4RA 4Z2YA 1NSYA 1E6CA 2WE7A 4DKJA 1KAHA 3V3KA 5E9AA 5I7WA 3FTFA 3L8EA 1O6BA 1Z3XA 3ECSA 2X0FA 4G5SA 5C7YA 3NZEA 4BHTA 3PIDA 4JV5B 3NIWA 1CYEA 3HM9A 1E79D 3K2QA 4IMIB 4DMLA 2BMDA 1XRJA 5JYDA 4M4SA 1XLWA 4XFDA 2ODPA 1YZGA 1HMYA 1XKXA 1VM6A 2VDWA 3MRVA 3D0OA 4ENTA 2Z6QA 3COZA 4LXUA 4PFSA 2WHRA 5AH0A 4ND4A 2B20A 3FHOA 1KPGA 3R5FA 2BLLA 4I3FA 4INAA 4QGHA 1A31A 3S17J 4G4SO 2P3QA 5EXXA 3PYXA 5L51A 4BH9A 3WLTA 2X9NA 5G0SA 1OV4A 5HUQA 1E1CB 3CR7A 4JQOA 1MNAA 1JZTA 1NQWA 1EXNA 4E7HA 4LE1A 4U0YA 1OVGA 1A9TA 1CY6A 3CBGA 5CT6A 4NBKA 1KHTA 2A3SA 2O7OA 1YX3A 5K3CA 3JQCA 3IEUA 1EX6A 1K78A 5DGTA 4OMZA 2XB4A 1E6UA 1FZTA 1HTWA 4UU1A 3V46A 4AO6A 4C78A 3H0CA 2IYEA 3KKQA 2AG8A 2RCNA 1GXSA 2RHBA 5C5CA 2CW5A 4E4YA 3QI7A 3EC7A 1K7CA 5CFPA 4AZ0B 4M2LA 2J9XB 1W4ZA 1IONA 5J2TF 1FTTA 3KP2A 3O3NB 2RFLA 3OFSA 1P62B 2I34A 1QTRA 2JBHA 3FJYA 1L5SA 2QRMA 4ODIA 4R1SA 4LMPA 3DHWC 5ALDA 4N82A 1XZNA 1J2TA 3TIFA 1DAHA 5J8CA 3MD9A 1CUHA 2CL5A 3THWB 4L5CA 3V2GA 4D8TA 1EX1A 1W6UA 1MHPA 2FH5B 5L3QB 4ZO7A 1G2OA 1MZBA 3AKCA 2P75A 1S01A 3NHLA 2Z4TA 2LDBA 4CR6A 2RNJA 4OHUA 4JX6A 3RCBA 2VJQA 3JRNA 2I6TA 1I6HJ 1Z0XA 4BE9A 4QPCA 3QYFA 1FSHA 3ZCPA 1G7SA 2PGOA 3H4TA 2WJ3A 1C29B 1RZRD 1AHHA 1FFDA 3LY7A 1GKIA 1F2TA 2XRFA 1SBNE 4H2DA 3T38A 5SZIA 3K3PA 2JGRA 2OK8A 4P80A 5BVHA 3EBOA 4FFMA 2VKVA 5C53B 3MJRA 4FOSA 3T54A 3RABA 5E1OA 3IO5A 1SAXA 1FK8A 2OHJA 2O7QA 2HDWA 3V3TA 1GWNA 4JL5A 3IAEA 2OWEA 1O4XA 3A6JA 1MH4A 3UMJA 2UDPA 3PX7A 3M7GA 5M5WJ 1FB5A 4GMGA 4XLZA 1E6KA 3CVWA 3PU6A 4FNOA 2QGNA 2Q3BA 5KC8A 2MABA 2HQBA 1RWMA 1RAAA 3UJ6A 3W2WA 4UTOA 4JP3A 4MVYA 3ZZTA 4YJ3F 1RP7A 5FCDA 1IGNA 4UFNA 4BPRA 3DTKA 4E31A 4CM9D 3TD2A 2PGXA 3F0CA 2MBFA 2FOLA 1XSXA 3OY9A 5B3JA 3D8NA 1XMQB 3T9CA 4K6KA 1TZ2A 3BRCA 1BC5A 5D5VB 4EG3A 5K8CA 4ZK2A 3JQ8B 3QPSA