2V9PA

Crystal structure of papillomavirus e1 hexameric helicase dna-free form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
279
structure length
272
Chain Sequence
TLNESKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDEQPFNITDADWKSFFVRLWGRLDLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Papillomavirus E1 Helicase Assembly Maintains an Asymmetric State in the Absence of DNA and Nucleotide Cofactors.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Hydrolase
molecule keywords REPLICATION PROTEIN E1
total genus 86
structure length 272
sequence length 279
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2v9pA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v9pA02
2VP6A 1XEXA 3ZIAD 2O0KA 4LJ7A 3TSWA 1P2UA 5JECA 4FI3C 1Y3AA 2WPDA 4MRRA 2ZR0A 3TQFA 2RAPA 4PR0A 2BVNA 2QL6A 4LDJA 4Q18A 1CF4A 4PHTA 3VQTA 4D6PA 4DLRA 5KNCA 2D4HA 3VHLB 2ZRMA 3EC2A 1E94E 1X8LA 4L8GA 1VHLA 5AUQA 2BJWA 3MWKA 4RKFA 1DADA 4POAA 1WDTA 1Z6YA 3CWZA 5CLLA 4TLDA 3B60A 1E0KA 1GRNA 4MUAA 3THWA 5FPHA 1BH2A 3JZAA 1DO0A 1KYIA 1NL3A 1XX6A 2A5JA 4M1WA 1M7HA 1JR6A 1HA3A 2OO7A 4A15A 3I72A 2UKDA 4LBYA 3EIQA 2JJ2A 1XTSA 1NN1A 4XJXA 1E2LA 3PUZA 5H70A 3THXB 1E79D 3SE0A 2O8BB 2OAQ1 3QOFA 1G9XA 2V6IA 4NDZA 1N6PA 2OXRA 4GOJA 1NLYA 4OJQA 1TNDA 4LJ8A 4XSGA 2JATA 1XXHE 2VRWA 5M04A 1HT2E 2ZJAA 1DVRA 1ZMXA 4Z51A 3KTAB 1BS1A 1XNJA 1S3SA 3M4YA 3K9HA 4FMCF 4L4UA 2BCJQ 2WSSD 4L15A 3W90A 1QDEA 3AVYA 1DAMA 4YMWA 1FP6A 5CLQA 2A5FA 3RS0A 2J0UA 4Q21A 3GJ6A 4IDPA 5FOSA 1NKTA 2WV9A 3GPLA 4MUBA 2YWFA 2Z83A 4JT2A 4PAMA 4MYUA 2GA8A 4FCTA 2XSZA 1VDZA 4S35A 2PL3A 1K5GA 3MWJA 3SU8A 4AURA 5L3VA 1XU4A 2BBTA 3GJ4A 3QPWA 2JJ1A 1SXJE 4V0MA 3T15A 5BWMA 2QQ0A 1G16A 2BWJA 2IL1A 3HU2A 5HE8A 1T3HA 4TYWA 4Q7JB 2D06A 2UZ3A 2OT3B 4J0QA 1Y63A 4DRZA 4KYUA 5KNBA 1JEDA 1SHZA 1TU3A 1ZVQA 2NZ8A 3QVVA 4HDCA 4JJZA 3V00A 2J0SA 4U5XA 1KK0A 1ZIPA 2EWVA 2QM8A 2RGEA 4M1OA 4X8MA 3P20A 2IYYA 5HKKD 4A2WA 3A1SA 4HLQB 4LYFA 2ZI3A 2OFXA 1W5TA 3ADBA 3AF0A 3BWDD 2FFAA 3G0HA 1W2GA 4DLTA 4JSYA 1AA9A 1KZGB 1M74A 1F2UB 4GOXA 4Q9LA 5DI9A 4B3XA 1FMLA 1G7CA 2I1QA 1II8B 4O0MA 4CEJA 2ONKA 3LLUA 2OBNA 4KJZA 4I1OA 2VH5R 3BH7A 4MGKR 2J9RA 1N6NA 4C9BA 2BMJA 5HCIA 1II0A 2CLSA 3QG1A 4QJ5A 5JWHA 1H8EA 3QEOA 1WF3A 5FPTA 4RSGA 4WBSA 1F3OA 1VECA 4II7A 3N5CA 2K5UA 1YZTA 1OLOA 3B9PA 4MYTA 3N2IA 4OI4A 1W4BA 1XFAA 4ZDJA 4I4LA 1DAGA 3Q7PA 1GL9B 2N1BA 3I73A 3W6OA 1PUJA 1MO4A 3KKNA 1KGDA 2XB2A 1XD2B 3IQWA 4JLVA 4QOSA 3GLGA 4Q9IA 4QBFA 4DSNA 3U3OA 2PZEA 4EPRA 4C2UA 1KZ7B 3CF2A 3RLFA 4D4JA 2QT1A 2P67A 2VYFA 4JLPA 5JHHB 2FSGA 4Z8XA 3AQ4A 2OFWA 4LI0A 1Q1EA 4DLUA 4JLBA 1ZU5A 2O8DA 5DI3A 1Z0FA 4KU4A 2WWIA 1QHXA 1GM5A 1R0ZA 4ZI2A 4B3BA 1Z2CA 2J7PD 1HTWA 2QTVB 5FR1A 1Z83A 2WJIA 3UWOA 2LKDA 2ZRFA 2ZE5A 2XXAA 3CH4B 4M1TA 3L82B 3ZZ0A 2ZXUA 2CNWD 1E2JA 3OIVA 1N5KA 4P3YA 4Q01A 3FHOA 3TSZA 4Q4JB 1Q1ZA 2MMCA 5ANRB 1A1VA 1JXOA 1TL7C 2W2TA 4QKQA 1U8YA 1KSHA 4X8OA 3A8TA 1OYWA 2DPXA 1VIAA 4TMTA 5TDHA 1MT0A 5L3RA 5JJLA 2X1VA 4NTZA 4X8LA 1KI6B 4FMDF 1US8B 1MRNA 1YJ5A 4JLKA 2B8TA 3CPHA 4Q00A 5CIQA 2LKCA 1W0KD 2RKOA 1R0WA 2IF2A 1AK2A 3MJHA 4NBSA 1J70A 4TYNA 4AKGA 2R9VA 2W0MA 3VMFA 3SJZA 5H8WA 2RCNA 3KFVA 1A7JA 1CIPA 3AH8A 4W5JA 3EPKA 3QPUA 1KDPA 2NO7A 3U4QB 1EFCA 1OFIA 3BRWD 3HYTA 3IUYA 4RCYA 3L0SA 3KB1A 3VX4A 5IF9A 3U6BA 2BKEA 5EE1A 3R7WB 4HUTA 3NHBA 3TGPA 3U7GA 2ODWA 4NCHA 1S2MA 1FUUA 4JZKA 2QMEA 1C4OA 2MMGA 4Z8YA 4MA4A 3K0CC 4Q1EA 5JLJA 3GQBA 1FX0A 3SYLA 1T8TA 1P72A 1WP9A 1D5CA 5D3MB 4ESVA 3NXSA 3LX8A 4MRNA 1FOEB 4HLUC 1D6JA 3WNBA 1LW7A 1NVUQ 4JT4A 1JPJA 2B7CA 4MDFA 2ATXA 4AIIA 4B3FX 3KKPA 2ANBA 3X1XA 4DB2A 2REXB 4TWZA 5KPDA 1LF0A 1NMYA 3KXIA 4YQFA 2MSCB 4LPKA 1NVXQ 2WAXA 1E9FA 3SN6A 4PO8A 4YXWA 4Q4AB 3R8CA 2IS6A 3DHWC 4GMXA 3DPUA 3ZGXA 3PV0A 3DMDA 5TY0A 2FE4A 4DCVA 4P4SA 4IOMA 4U7DA 1WBBA 2WKRA 3J81k 1XB2A 4TQ9A 1DAKA 1S9HA 3EARA 2JLRA 2SHKA 2G3YA 4UNSA 1I2MA 3OIUA 2BDTA 2PH1A 3M6AA 2GEUA 1IY1A 3E70C 1J90A 4HAYA 4BZPA 4DJTA 4US2R 1CEEA 2F7SA 1P9RA 1CRPA 3FKSA 2C96A 2R2AA 3LLMA 1N6OA 4MKIA 2YC4C 1FP7A 3BORA 3I4LA 1OV4A 5CYPA 1NJFA 5H68A 1X1SA 3B8HA 1E69A 4RFVA 4ZI3A 3W9YA 1RRGA 1VYUA 1AKYA 4PHGA 3RWOA 5FUVA 4URZR 2VP2A 3QG5A 4M9SA 4E03A 1RRPA 2NGRA 3IDQA 1E99A 2RHDA 1PLKA 1CXZA 1T6NA 2PT7A 4UXIA 3VR6A 3GJ3A 2AWOA 1P7CA 3B82A 3A1UA 3QKRB 2O8CA 2KBFA 5GJVC 3L8ZA 1GKUB 1L4UA 3WRXC 4KODA 1CJKC 2J87A 1YZNA 1ZAKA 5JWOA 2EWWA 3DM9B 1NBME 3QKSB 2QAGC 3GLIB 3IBGA 4WA7A 1EFRA 5FOUA 4GI7A 2FN4A 2QROA 1KDRA 421PA 3QXXA 3LWNA 5E3HA 2L0XA 3TVDA 3B85A 4D4MA 3GMTA 1CJUC 2BBWA 3KTAA 2PMDA 4TLEA 1X6VA 5J4KA 3CF0A 4CEIB 4CRWB 1SXJB 1IJEA 3LW7A 4XTCS 2J5XA 3CF6R 4Q4HA 3EPJA 4TMZA 3AKEA 2BBSA 3TVTA 3RC8A 3HWSA 4BASA 1OIXA 1XTJA 4E09A 5IRCD 5FI1B 1BMFA 2ZU6A 2Q0HA 3FGNA 3N70A 3TUJC 4CVNA 1HQYE 4M22A 2F9MA 3Q85A 3SNHA 3T12A 2YHSA 5FFMA 5FTLA 2GJ9A 3IPXA 2R65A 3FFBA 4AG6A 1IN7A 3KJGA 2G1KA 1G291 3ZD6A 2FPLA 1FFHA 1G21E 1OKKA 3F8TA 1YVDA 3QXHA 4TL8A 1TF2A 5DN6D 4G5SA 4EJSA 1XCGB 4LWZA 3UMRA 1NI3A 3W6PA 5CM9C 2O8FA 1YU9A 1SVLA 4F38A 5L3QB 4Q02A 4EFLA 1J8MF 4B3GA 4GPTA 3IGFA 2R62A 1RZ3A 1UDXA 3WYFA 2WWFA 3SZRA 1N5LA 4MRSA 3U3MA 4CIDA 4HYYA 3ZVMA 3EG5A 4NPHA 5JS7A 2XZLA 1XRJA 2CCGA 3CUEF 4DXAA 2Z6VA 5IHPA 3U2QA 1TQ4A 2JIZD 2V3CC 3MWLA 2ZI6A 3CNOA 3LXRA 2G88A 3FVQA 5DYGA 3PEYA 1ZP6A 3I3SR 2AFIE 5BQ5A 4EPVA 5JJIA 2EYUA 3GP8A 1G7RA 3TE6A 3K9LA 4BEJA 1G4AE 2I1VB 2C99A 1CJVC 4R98A 2Z4RA 2QY9A 5G41A 4GDFA 5DE3A 1W48A 3U60B 2JLUA 3BK7A 1RYFA 1B0UA 3NEYA 2P5TB 4A6PA 1G7SA 3T5DA 4E22A 1Q44A 1NLZA 2ZRJA 4YDSA 5TXGA 4BGDA 1NY6A 1XEFA 1VG1A 2R44A 1XMSA 1HEIA 1FTSA 4A8JA 1OW3B 4C0JA 1Q3HA 1R7RA 2VHUA 4Z1MD 3AKYA 4BZQA 1HV8A 2A30A 2IW3A 3KQNA 1AJEA 5A5GA 3HDTA 4PHHA 1P5ZB 1XXHA 3CW2A 1TQ2A 3MAAC 2FFBA 4XD7A 1HYQA 1IXZA 3L0IB 5FBQB 3AVWA 2ZEJA 1JR3D 2BV3A 4PTLA 3KZ1E 3PXGA 3EC1A 2Y8EA 2HLDA 4KLZA 3NG1A 4HUQB 1PZNA 4QM6A 4I1VA 3M1IA 1OHHA 4AI6A 2R6AA 4AYWA 4D4KA 3KQUA 1UADA 3S1AB 1RJ9A 3FE2A 4G5RA 4FINA 4PQYA 1G8PA 4M4SA 3B1ZA 2QI9C 1FMJA 2A5GA 2CHGA 3NTUA 1RW4A 5C1BA 3UMSA 5F3WB 1G17A 4DDTA 2IYWA 4QHTA 2FFHA 4OL0A 4BWYA 1EXMA 4JVNA 1RE0A 4KLNA 3ZS9A 2DB3A 1VTKA 3HU3A 3WMFA 4ZV4A 2IYTA 3CRQA 3K0CA 4OQFA 3VR4A 1JBKA 3WP1B 3ZYCA 3AVVA 3W34A 3I5YA 2YWHA 2ZR7A 3I8SA 3WMEA 4ARZA 4JLMA 1MO3A 2Q3HA 4Y0VA 3NBFA 2IYRA 1S4QA 4JLDA 4OK6A 1X8JA 2RB4A 1OSNA 1QHIA 2ORWA 3AUYA 1KJWA 4F4IA 2CXXA 1J8YF 3LBNA 2D7CA 2VHQA 5FPYA 4K8OA 1G5RA 2WJHA 2WWXA 1XWIA 2V1XA 4G5OA 3QKTA 1T0HB 5CJ2A 1E2EA 4TMWA 3X2SA 5C4MA 4MGZR 1EK0A 1XMJA 5HPYB 1BYIA 4ON9A 1JPNA 1GL6A 5EXXA 5AWFC 4G5GA 2CBZA 2PCLA 3QENA 2WHXA 1SXJC 2B6HA 1E9SA 1VYVA 1K6MA 4HAUA 2YYZA 1MABA 5EQTA 1GG2A 2IXGA 2QUZA 3AUXA 3WP0A 1COWA 4NONA 1KK2A 1H8HA 4H9GA 5TV2A 4HB2A 5JFGA 2J0UB 3MCAA 3D31A 4RCZA 4EFMA 2NPFA 4DB4A 1VCIA 1UFQA 2HCJB 3U61B 5AJVB 1TF5A 2KB0A 2VP9A 3GD7A 3B1VA 3IHWA 4C0AC 2GJKA 3CNLA 1IXSB 2ZE8A 3MJRA 4Q03A 3C5CA 3TW4A 4FD2A 1K8RA 2EW1A 4GZLA 2P6RA 1KK3A 2QAJA 3LRPA 2PEZA 5AUNB 6Q21A 2GJSA 8OHMA 5EXTA 4EUNA 1ZW6A 4PAOA 1E96A 3R9XA 5HCNA 1TUIA 3E5HA 2QQEA 1T8UA 1ZD8A 3VAAA 1WBDA 4G0NA 4IEEA 1WRBA 4URVR 1KIMA 4RD0A 2XTNA 1F48A 1FPMA 1G64A 2F3RA 2WPDD 3WXMA 1OT3A 2ZSEA 4B3DA 2CJWA 2GCPA 3I8XA 1SHKA 5FOTA 4X8HA 1Q3TA 1Z6XA 1H8HD 4QJ3A 3D7MA 5D3QA 1NSTA 1W2HA 2OAP1 3AF3A 2OE2A 4JL5A 1DEKA 2JLYA 1YZUA 1S1CA 3A1VA 4RZUA 3NC0C 1KMHA 2C78A 4XWAA 1ZC3A 3OIYA 2PMKA 2X2EA 1QBKC 3PITA 1KDOA 3SFVA 2FG5A 3BFVA 3E1SA 2JEOA 2XAUA 2QE7A 2F1HA 2DWPA 2FX3A 4KXFB 5FH9A 1KHTA 1KSJA 4KVAA 5DHFA 3ZJYA 2FZLA 4DLZA 3U3KA 5KU1A 4DCSA 4MYCA 4LJAA 4XVRA 1KO8A 1OF1A 2FOLA 3EWSA 1R2QA 3QSYA 4TSFD 2BCGY 3HPQA 4OI2A 3SEAA 2Q3FA 3DVLA 1CP2A 2QPOA 3RC3A 1HQCA 2FSHA 4MKFA 3OEHD 5B57C 3QNUA 1E9RA 1W4CA 4B44A 4DUGA 4ZCLA 1XP8A 2O0JA 3SOPA 4DDWA 1GNPA 4QC2A 3NH6A 5JSZB 2PX0A 4C0SA 5GVSA 3K53A 4BUJA 3SR0A 2ZRLA 1CJMA 2H17A 2ZQ5A 1UBGA 1JQLB 1E2DA 1QHNA 3QI2A 3EX7C 3K0EA 1KTVA 2XNDA 3RSLA 4CEIA 2CVHA 3EPLA 3C5HA 1EX6A 4P4UA 4TT3A 2IS4A 3OEHA 4DLXA 2ZJ8A 4IFEA 2DHRA 1AQYA 5HZKA 5KNDA 1HE8B 3FKQA 1MO5A 1NMXA 2CMKA 4TSFA 1P2TA 3WNCA 3GLIE 2MSEB 3ZH9B 5BN4A 5F2EA 5A4JA 2ZI9A 3PCRB 1XD8A 1E9EA 2REBA 4MKHA 2EQBA 1QZXA 2ERYA 2ZANA 4LJYA 4Q66C 3CO5A 5DO9A 3LH5A 4EJSB 2CHVA 3K70D 4KITB 1G1MA 5JWRA 4IW3B 1W4AA 4B73A 3I5XA 3ADDA 2O8FB 1UAAA 1OFUX 3UWKA 4MQBA 1K5DA 4LUCA 4CZ2A 4AWXA 3A1WA 2CL7X 3KJEA 4TMXA 2ZE7A 3HPRA 2ZM5A 1OH8A 1FNNA 1J2JA 1RFLA 2B7BA 4LOAA 2NZJA 4Q4LA 3LA6A 1ZU4A 3W3ZB 3AVXA 5EE5B 4OI0A 3W3AA 3B7GA 2OCYC 1ZINA 2ZR9A 1UBCA 3SFZA 4KFRA 1LFDB 1XMVA 4DLSA 2JGNA 3OF5A 3RDPA 4M1SA 1IN4A 3R9WA 2GF0A 1ZC4A 2QGNA 3BERA 2JDIA 4JYBA 2YOFA 1DBSA 1M6NA 1I4TD 2HCBA 3EPHA 1UEJA 1NN5A 1SGWA 1HURA 2IXFA 1LNZA 1TQ6A 4BFYA 2FEMA 2J7PA 3HP1A 1GWNA 1L2TA 3IKJA 2O8EB 1QHGA 4AY2A 5JCZA 5FPKA 3IO5A 5DHAA 5AR1A 3RNLA 1G6OA 2CLDX 1FQKA 4QBHA 2ZSDA 1ELOA 3MFYA 3UG6A 4D81A 1E1RA 4JKYA 1EFHA 3UKDA 2J0VA 2ORIA 4R7ZA 4UJ3A 3GEHA 4C7OA 2H92A 1NN3A 1KK1A 1ZBDA 1S8FA 1VG8A 3AP2A 3T61A 4QNRA 3VU9B 1SVOA 1XCPA 4ASUD 5E7JA 2H7VA 2QZ4A 1DS6A 1R0XA 1R8QA 1OXTA 2I4IA 5EP4A 3THYB 4JSTA 5HR5A 1XPUA 5KSOA 5EP2A 2QPAA 1N5JA 3QKUA 2C2HA 2O0HA 4G1UC 4B35A 2ZYTX 2ZROA 1OKKD 2QP3A 1UEIA 2YV5A 4QBGB 4M53A 1YZLA 4EPYA 3IQXA 3QE0A 3OAAD 5AJXA 2IUSA 4DHEA 4RVCA 2WIBA 121PA 2AK2A 1I4LD 4PQRA 1UKYA 4HLDA 3K0FB 2QU8A 3DKPA 2QBYB 4LCBA 4Y0AA 4BLSA 1CR1A 4OHVA 3GEIA 4L16A 3MG9A 2PX3A 2QAGA 2F55A 1G8GA 2CL0X 4EPTA 5FUXA 2GETA 3VKWA 5KPJA 2CK3D 1SVMA 1D8TA 4DDUA 1Z0IA 3RRYA 4KHZA 3X1ZA 1D2EA 4Q4JA 1AZTA 1TEXA 5LD2B 1KI7A 2GZHA 2ZJ5A 4XVUA 5SZJA 1ESMA 4HLCA 3WYGA 2XJ4A 1D2MA 1Z6AA 1Q1BA 4BFWA 1U0LA 1QG2A 3PEUA 4WAUA 4UJ5A 1N0WA 1E79A 4R71A 2EFCB 2GBLC 5FL7D 4BPBA 3VKGA 3NKVA 3P4XA 1G3MA 2BKUA 3OE7A 4B47A 3ZQ6A 2IYSA 4QM7A 2CCJA 1Z8FA 2WJYA 2ZYVX 2GXUA 2HUPA 2W6JA 2IEYA 2JJ1D 3CRMA 4NYJQ 4XOIA 2Z5FA 3I1FA 3Q3JB 3RRZA 4P33A 3VX3A 5H1YA 4O2RA 4QNMA 1KI2A 2QENA 2QRZA 3T35A 3AM1A 5IK2A 3BAFA 5AUPB 2BMFA 2NO0A 4DVGA 2NO6A 5DYIA 3CRRA 5KSZA 3NHAA 3CX8A 4HZIA 4LSGA 1RC8A 3ADKA 3I92A 1LF5A 4C30A 1P61B 4JYCA 3ZVLA 2D3WA 1SVWA 2PLFA 3NVAA 3RS7A 5KSPA 2F43A 3A4MA 2ODBA 5FL3A 4DLVA 4A0HA 1WMSA 1GFIA 1YR9A 1KO7A 1T4GA 4Q47A 2EVWX 4YMUA 3DOEA 3WMGA 3NDPA 2BEJA 5G3ZA 1GSIA 2EFEB 1N6HA 1KKMA 1VG9B 1DO2A 4N1AA 4PPQA 1IBRA 1Q1QA 4C0QC 1TAGA 1ZNXA 2ZRGA 2CVFA 4JKIA 4H1UA 3IEVA 1IY2A 4EFNA 2QNRA 4TLCA 2VSXA 1IN8A 1L4YA 2XTMA 4IRUB 1W0JD 3ZQJA 4HEJA 4W5HA 5JS8A 2ZS7A 3RYTC 2GK7A 2HLDD 4A9AA 1DAFA 2N46A 2WSMA 4QHYA 1HH4A 2ZI4A 3KQHA 1JR3A 3HYRA 1GKIA 5BXQC 2Z4SA 1OB5A 3ZZTA 1SQ5A 4EDHA 2XTZA 4NH0A 1E2GA 3BC1A 2VEDA 4PZLA 4A4DA 1DOAA 1Z6TA 1PLLA 1MO6A 1UF9A 2G6BA 2ZUDA 5DISB 4A0FA 1NVVQ 1Q22A 2G1JA 3KXLA 3P1JA 2QORA 2GZAA 2X19A 4BFVA 1DPFA 4A1FA 1XJQA 2PZFA 1OH5A 1S3GA 4DEXA 1HUQA 1DELA 2ZS8A 1E2HA 2V6JA 1ZUIA 2ZU0C 3H4MA 1GRRA 1E9BA 4GNKA 4NCNA 5FR2A 4FMBB 1BOFA 2P65A 2QA5A 2VHTA 1Q12A 1XBTA 2P6NA 4GP7A 1SKYB 1W4RA 2PCJA 2WWGA 4KBFA 1UJ2A 4BRUA 1E2IA 4N0EA 5AK0A 4NYMR 2F9LA 4WOPA 2WBLC 3IEUA 3AEZA 1UPTA 2X8AA 4DDVA 3U7EB 2Z43A 3RSOA 3BS4A 3A37A 1WE2A 3QBVA 5E95A 3OE7D 5FTKA 3TK1A 3KJHA 3GLFB 3FHCB 3MSXA 3NEJA 3MGCA 3MMPA 4JLAA 2Q9CA 2YZ2A 4TZ0A 2LCFA 4OKSA 1XD2A 3AGQA 1AKEA 2R8RA 1I2DA 3U44B 1T3SA 1V5WA 1Z3IX 1N3BA 1P75A 1W49A 2IT1A 3DZDA 4XWKA 3GFOA 4DBLC 3ECCA 2PJZA 5EE3A 3BFKA 1ZUNB 2ANCA 3K9GA 3SC3A 1JEEA 3JVVA 1Z0DA 3IIJA 3WNDA 2Z0MA 4NU0A 1U81A 3LQRA 3UG7A 3VTKA 1G20E 2JLZA 1RYHA 821PA 2O8DB 1EFRD 1KNQA 1A5TA 3ND8A 2GNOA 2ZPTX 3OEED 3HR7A 2BIFA 2ZRBA 3REGA 1U0JA 4PC2A 4PHFA 3B1XA 4Q1AA 2IX3A 1KI8A 4DSOA 1EWQA 5A0FA 4OJKA 5CB8A 4JVLA 5BYJA 1AS0A 3H86A 2A5YB 1WQ1R 4M2LA 2ORVA 3CX6A 4JVSB 4I1UA 4UNPA 1GNQA 4F7WA 2Q9BA 2WJGA 2QT0A 2CCKA 4DT1A 1R8SA 1KMQA 1N6LA 4BFSA 3AVUA 4PPNA 3A4LA 1YKSA 3QIAA 4HZUB 1OIWA 3LBIA 1F6BA 4DCTA 5K8LA 4Q1FA 4B3CA 1ZUHA 3WBJA 3PUWA 3QUSA 5FL7A 3KX2A 1US8A 1P6XA 5KDDA 2QSYA 4PZYA 4LBWA 3QF7A 3QXSA 2VTKA 2J3EA 2UVQA 1KI9A 5GJCA 4B32A 4E5UA 2NQ2C 3Q9LA 1XEWY 3QF4A 1G3IA 4P32A 1CR4A 4EQ6B 2F6RA 4A92A 2AR7A 1ZM3A 1U9IA 4QG7A 1GNRA 2BM1A 4M1MA 1E4YA 4NMMA 1U8ZA 3EASA 3ICEA 1J99A 1W5SA 2AKYA 2IXEA 2ZUCA 3OESA 3QXCA 4RD4A 5EZ6B 1S96A 3W8NA 3LQQA 2H1LA 2C04A 4NYJR 1U98A 1G8HA 3GJ0A 2G77B 2YKGA 1NG1A 4UKDA 2WMNB 2JASA 3K09A 1E4VA 3GJ5A 4YXWD 5EP3A 3TR0A 4HLUA 3B5JA 4LJ5A 5CB6A 2FPKA 2DBYA 1BIFA 3ZS8A 2JLWA 3TQCA 2FGKA 2EFDB 2RGGA 4G5QA 3LAWA 3QEJA 5FOVA 3TR5A 5B64A 2IEZA 2W6ID 2ONJA 1OIVA 5L8VA 1JR3E 4JJKA 4WZ6A 4TYQA 3L8YA 4B2PA 3QBTA 1Z6GA 3SS8A 3KFXA 4Z1MA 4FCVA 3NH9A 4LHWA 1NVWQ 2VF7A 4GFDA 3QVUA 2G9NA 2ZUBA 5L3SB 3O8DA 4ITRC 4UXHA 3GLHB 3LBHA 1KI3A 4HB0A 2BMEA 2GJAA 4Q1CA 1MH1A 4B43A 1MKYA 5J4VA 1QHYA 3AF1A 3IHLA 2OCAA 3PIRA 4A0RA 3WRYC 2GXSA 4BLQA 2B92A 2YC2C 4LJ9A 3KKOA 4ZDKA 4BEBA 4YMSA 5EE0A 2V54A 1WCV1 4LYJA 2NO1A 721PA 3RS2A 2QBYA 2VP5A 3S1AA 3KB2A 4XVQA 1P62B 2W2VA 3EZ2A 3R20A 5SZHB 2A7QA 2QAGB 3U7FB 2YVUA 3U6KA 1PLJA 1T9HA 2F1RA 3CM0A 3FDIA 2AD5A 2XEXA 5GADl 4C4PA 2BHRA 2FEOA 2D7DA 2RH5A 3DO6A 2XNDD 5LB4A 2AHOA 3MUFA 3X1WA 1XTQA 3GJXC 3TW8B 1AS3A 1CS4C 2OFOA 2QMOA 2VBCA 4AYXA 3TUZC 1SKYE 1Z08A 1R6BX 3EWAA 4MKGA 4PC1A 2VQSA 4B48A 1E0AA 4C0KA 1A2KC 4KFUA 3MD0A 3QXJA 4NZYA 1N2CE 3K70B 1TF7A 4BFUA 1KOFA 5KUTA 1G6HA 1GILA 2HF8A 4Q9KA 4NHOA 1G3RA 1R5NA 2IF0A 2J0QA 4TMVA 1E9DA 1R5OA 2AX4A 2FV8A 1P2VA 4US0R 5DIFA 2DWQA 4BQSA 5GJBA 2W2XA 1E0JA 3BJIC 1S9DA 2ZI7A 3B1YA 2ZRKA 2P0EA 4AK9A 4M1KA 3OEEA 4R2IA 2H5EA 2C9YA 2ZRPA 1Z0JA 3KUCA 1E2MA 1E2KA 4PANA 5JSZA 2W00A 1E2QA 1KNXA 2OUKA 1FW6A 2J41A 3PEWA 2OV2A 1AM4D 1IAQA 221PA 4NYMQ 1L8QA 4URXR 4RZ2A 3BIFA 4TLBA 4DKXA 2OG2A 2PT5A 1IQPA 5JMTA 1MABB 1OXSC 2VHCA 2XNSA 3K0AB 5EE9A 2IUUA 4HB4A 1ZD9A 5HZHA 1NIPA 3C4JA 1G5TA 1R0YA 1G3QA 2CE2X 3H2YA 3L0PA 4CYMA 3ONWA 5FUWA 2R6FA 1DAEA 4V0OA 2KBEA 4CT4B 3NIBA 1VIYA 2CNWA 2J46A 3G82C 2QP4A 4BFZA 4A8JC 5DLQC 1VCMA 2OBLA 2GRJA 4LHYA 5KTYA 1DTSA 1QVRA 5B2ZA 3VFDA 3BD9A 2CHQA 3FB4A 5FBRB 4IDHA 4PC3A 2RGBA 1TPZA 3PUYA 2WJJA 2GESA 3PUXA 5TVKA 2RGDA 4KBGA 3WY9A 1E32A 2OCPA 5LPNA 2CDNA 1PV4A 1GDDA 2XB4A 4U02A 2VLIA 3RWMB 3VNVA 2FSIA 2C03A 2XX3A 2GCOA 4QHSA 1PJRA 1JECA 3BE4A 3GCGA 3AF2A 4F92B 5ELXA 2RGCA 1FL9A 1YRBA 1X1RA 2QE7D 4TL6A 4CEHB 3FWYA 1N0UA 4C0HA 2IYQA 1VCOA 2IWHA 2QMHA 1YHNA 3K8YA 1R4AA 2KJQA 4C0LA 4O25A 4ZIRA 2OESA 3AGPA 2WJVA 1LY1A 3C14C 5LBIA 4FIDA 1M8PA 2PLRA 3OFND 2W58A 2W6IA 4N3NA 3CZQA 2GVDC 2XITA 1XJ0A 1G7TA 2ZRNA 4F4JA 1RRFA 1YR6A 2DFKB 4IJMA 2IUTA 3EIHA 3ICQB 1SZPA 3PEVA 5CYOA 1YZQA 4UNNA 1QG4A 3BOSA 4BLOA 1KO1A 4JS0A 2YINC 1IN6A 1TX4B 2PZGA 4ILEA 3H84A 5C18A 1ZJ6A 4GRAA 2DR3A 5TMPA 2P2LA 4LRWA 2F1IA 3ASYA 4C7OB 1NSFA 1CRQA 5TARA 2ZJYA 2JIZA 2MSDB 5JJKA 1L7VC 2GXAA 3CPJB 1P4SA 5CIWA 3THXA 4IEIA 1HE1C 1NNEA 3SHWA 2WSSA 1W47A 3ZZUA 4AKHA 1GZSA 1UKEA 2EYQA 3FFAA 4URUR 1VG0B 4CT5A 1JQJC 4OHWA 3BB3A 2ZJZA 4RY2A 2IA5A 1TTTA 4DSUA 1EX7A 4IFBA 4AKEA 1FNMA 3RRNA 4HUQA 3V4FA 3K1JA 1YR8A 2CE7A 2KI5A 4IVPA 1UBFA 2RGNC 3TSOA 4DCNA 5IK2D 1YR7A 3K0FA 4V0NA 3JZMA 4JL8A 3PJRA 4DSTA 2IC5A 3U3RA 1QRAA 1RJ9B 5E7MA 2QG6A 4JLJA 3UANA 2DYKA 1ZM9A 4ABYA 3ASZA 4P0TA 1RVDA 5KHOC 3C8UA 2AK3A 2GEDA 1E1QA 2IYLD 4WZAE 3TAHA 1OHHD 2WICA 5LDDC 1KDTA 4QGGA 1ONBA 3QQ5A 1X3SA 1EGAA 4PO1A 1M7BA 1SVIA 4HSEA 4IKEA 4JL6A 3R8FA 2WOOA 4HAVA 1OYYA 4TYPA 3LW8A 3V4RA 4DEYA 2IK8A 1WB9A 3KQKA 3C41J 1AN0A 1YRAA 3ZLJA 3D3QA 1QHHA 2QM7A 5HTKA 5EUMA 3QY0A 3O8RA 2OLKA 5JI2E 2NG1A 4YONB 4M0LA 2C8VA 2IS1A 3CWQA 3LFUA 4ASUA 4KYIB 1G41A 1XMIA 2CL6X 5EUQB 1E3MA 3KDSE 5FOWA 2F1JA 2JJ2D 4EQ6A 1XF9A 1G4UR 4IDOA 2WWYA 4FW9A 1YQTA 3DEFA 1GOTA 2KWIA 4HI0E 4JLNA 4ZCIA 3SYKA 5DGXA 4URYR 4RD2A 1E1RD 2OXCA 3TMKA 1XTKA 4M1YA 1G8FA 3EA5A 1G8YA 2DY1A 3A4NA 1RRCA 2WVJA 2OLJA 2X2FA 5SZIA 1HT1E 1XCMA 1YZGA 3DM5A 5C4GB 1RPZA 3AB3A 4BLPA 2WZQA 3AF4A 3W8RA 2O8EA 2V7QA 3IILA 1DG3A 5FTMA 4ZDWA 4URWR 4V0LA 3TJZA 2BBOA 1U9IC 2C5LA 3FOZA 2A3RA 3ZIAA 2JLXA 1LS6A 4E07A 2ZAMA 5JHGB 1D9XA 3CX7A 4IOLA 3OFNA 3VNUA 4HATA 3W6NA 3OIWA 3A36A 1DARA 3VU9A 1SULA 1TADA 1OE0A 1IONA 1X8KA 1ZRHA 4EPWA 1LTQA 1OFTA 1TU4A 2A5DA 4RKEA 2GVZC 1KY2A 1O3YA 2OM2A 1KO5A 3CKLA 4NE2A 3AVOA 1ZYUA 2N42A 1LVGA 3NBXX 4IOKA 5TB5A 5K8UA 4F91B 1Z5ZA 4GP6A 1NMZA 4GZMA 2QTFA 3I61A 4OQLA 1UBEA 3GLHE 4ZO4A 2WWWA 2QN6A 4A2QA 1M1YE 2H57A 4FN5A 4YDHB 4A2PA 4D0GA 2J7KA 4ZCMA 1IM2A 2ZRHA 2AL7A 2WOJA 4TTRA 2FF7A 1P9NA 4ZPXA 1T5LA 1XEWX 2CEAA 3LDAA 4PC6A 2RGXA 1II9A 3GJ7A 5JRZA 2W0SA 5K8TA 3UPUA 2ZITA 1P9WA 2GK6A 1LS1A 4DC9A 1IY0A 4PQFA 3EW9A 2XOKD 1F5NA 2OHFA 3P27A 1E98A 4CDGA 3K0SA 1E9CA 2IYXA 1FQJA 2GHIA 1ZM7A 1ETUA 4U00A 4MGYR 5E4FA 2WKQA 4UNQA 4DUGD 3BBPA 4ACAA 2GAOA 4FXPA 3THWB 4TL7A 5F9HA 4B6FA 5DN6A 3P4YA 4L5BA 4LZZA 3H0KA 1Z0AA 2EFGA 1QVAA 3REFA 2HJGA 3A1TA 3GLFA 2XJ9A 4TT3D 1D2NA 4Q7MB 1W36B 4MGIR 3R9IA 3TLXA 3AVPA 1IOZA 3NDBB 2F3TA 1XJCA 1GUAA 5CM8B 2FA9A 2C98A 4O3MA 1AZSC 1I4DD 2GF9A 3R7WA 4I99A 4OQXA 2XOKA 1N6RA 3CB4A 5B30A 3TBKA 4Q19A 1XPOA 1CTQA 3VR1A 5F98A 1CLUA 5GJWC 2AXNA 2BC9A 3LVRE 2BJVA 4YC7A 4B75A 4DWJA 4ZDIA 2ZREA 3NC1C 3RABA 1B23P 2F43B 2ATVA 2CLCX 4LK2A 2H8KA 5IDVA 2AFHE 3V9PA 1KSFX 4YMTA 3PFIA 2ZYUX 1NLFA 3D6TB 4JIMA 2OILA 1OXUA 4B2IA 4UXJA 1ZM4A 3GJ8A 1S1MA 2D2EA 1NBMA 2DWOA 3IO3A 1OXXK 3RS4A 5BYKA 3ADCA 3C7KA 3WHKA 1QHSA 5CJPA 2AN9A 4QGHA 4AG5A 5JEEA 4ZKDA 1MV5A 3TUIC 1Z29A 3I62A 3ETLA 5DSZA 4D80A 1T3LA 1S0UA 3LY5A 4KFSA 4ERNA 2GCOB 3CPEA 2E1RA 3W5IA 4PSKA 5J47A 5J4YA 2FGJA 1TQDA 2HEIA 1OH6A 3W5JA 3BFXA 4PX9A 5LD2C 1XD9A 3KUDA 4QGFA 4EJSC 4CEHA 2ZRDA 1F2TB 3FMOB 3RRMA 1W46A 4PSVA 3U3JA 4WVFA 4DLYA 3CRVA 4HAXA 4IHQA 5DNYB 2W83A 2HJVA 2HYIC 4B76A 1JJ7A 2JCSA 2RGAA 3E2IA 4YMVA 3HJNA 3TKLA 1LB1B 3GLFE 3RS5A 3RANA 1T91A 4KO8A 1E2PA 2H16A 3KKQA 5J5CA 4C3ZA 1W7AA 2RGNA 4TYYA 1XEXB 3LNCA 1V43A 1IXRC 2FNAA 1A4RA 1CR2A 4GBMA 1X86B 4GOKA 4XSHA 3L0OA 4B34A 4LV8B 3AKDA 1Z47A 3Q5EA 3DL0A 3GFPA 1U94A 5AJWA 4BLRA 1W0JA 2P3SA 4DIEA 1DAHA 4MYHA 2E87A 1WA5A 2D2FA 3D8BA 2XZPA 5B58C 2HXSA 3T1TA 5BW8A 4ACBA 5C2JB 1NN0A 1XZPA 2IWRA 3EZFA 3DMNA 3OHMA 1C1YA 5F9FA 4LHZA 1UKZA 2OSBA 3GLHA 1NY5A 3FYHA 2GWHA 4V02A 2QRNA 3U44A 2ZRIA 1UDWA 2A2ZA 4CW7A 3CONA 4NL4H 3HU1A 5J4LA 5AUOB 4W7SA 3T5GA 3X1YA 3PUVA 1AIPA 4S2EA 1AGRA 2ZI5A 2RHMA 1TEVA 1T0JB 2JAQA 1Q20A 3K09C 3BH6A 4JMPA 2V7QD 4XWOA 2FFQA 1G19A 3CZPA 3FHTA 3C15C 3ZDQA 5EZ5A 4D82A 4MITA 4F93B 2ZRAA 3VR2A 1AS2A 1EESA 2FPMA 4KFTA 3JVUA 5KOYA 4FCWA 2XGJA 1M34E 5EXSA 4EPXA 3PQCA 3EA0A 4YLGA 4F4CA 4DZZA 2J1LA 1T5IA 3DZ8A 4ZKEA 1N25A 3L2OB 4B74A 4EIWA 2W6JD 2ZJ2A 1EFUA 1U90A 3SBEA 1IN5A 4KSBA 4KV9A 1Q57A 4US1R 1E9AA 2VIIA 1Z0KA 4OQMA 1Z07A 3BGWA 3THOA 1BO6A 4WZBE 1XPRA 2ZJBA 4HZUA 2HV8A 4QJ4A 1W0KA 1QHHB 1ZCAA 2ZSBA 2ZSAA 1JAIA 4O2LA 4W5WA 2IS2A 3CR7A 3BB1A 3CNNA 1RKBA 3ND9A 4EKDA 2HYDA 3U5ZB 4OHXA 5SZKB 4Z54A 1P73A 2DCUA 5G3YA 2CK3A 4PAQA 4LJ4A 4DLWA 4MDEA 1JI0A 2GEVA 4IDNA 3QF4B 5G53C 1W36D 4LGMA 2QMUA 1P60A 2GTPA 4BLTA 1ZCBA 2NTYC 3B13B 3RVBA 3I32A 4QXAA 1KO4A 1DAIA 3U4QA 3T06B 1NKSA 2EU8A 2RMKA 2WIAA 2VP0A 2R6DA 1JNYA 2QEQA 1F2UA 3UATA 1NP6A 1YE8A 5JBQA 3FMFA 1II8A 4IXNA 4CEJB 2GXQA 4RFSB 5FBWB 4AC9A 3CIOA 4Q1BA 1R5BA 1M7GA 2IHYA 2I3BA 2OEPA 3K0AA 4OK3A 4XD7D 2ZE6A 2ZAOA 4B33A 3EZ6A 3MLEA 2GJ8A 2JLVA 5D3MA 4FMDB 4CGZA 1IJFA 4TL9A 5KYKA 2FU5C 3IIMA 4PPGA 4LJ6A 621PA 4KCGA 3MRSA 1NJGA 2GAAA 4PPFA 3EZ9A 5LB2A 4TZ6A 5FUYA 2FWRA 1Z63A 1JAHA 4L9SA 4LC0A 3EAQA 4V03A 2JJ8A 1EWRA 1SKQA 3PVSA 3BH0A 4BRWA 1P2SA 2ZETA 3TRFA 2VA8A 4M9XA 5L3SA 2IHBA 3SJCA 2ZIAA 3Q7QA 1NF3A 3TAUA 4OI1A 2NPIA 5FTNA 2PEYA 1CJTC 2AD1A 4RZ3A 3F3YA 3EIEA 2BM0A 4NYIR 4HDOB 1GP2A 1QF9A 3L43A 4P4SB 1CULC 4RZXA 2VL7A 5K8IA 2HT6A 4LY6A 1NBMD 3HR8A 5DI3B 3LVQE 3FMPB 4BE7B 1GKYA 5IT5A 4A0GA 1J7KA 1P3JA 2UZIR 1OH7A 4Q7KA 1KY3A 2WMOB 4M8NE 3P32A 1FTNA 2FH5B 4NP6A 4TTQA 4MRPA 1AGPA 1IHUA 3SBDA 1VCNA 2FJUA 2XXAB 4C2TA 4WXRA 1ZM2A 2O5VA 2V1UA 2FSFA 1KSGA 3AKCA 1ZNWA 1COWD 2IYUA 3WBKA 1U0HC 2GBLA 3SQWA 2ZVQX 4ARZB 2WTUA 2HXYA 5BN5A 4TMKA 5P21A 4WIAA 3O8CA 2DFLA 2AWNA 2REOA 2VP4A 2YWEA 3GEEA 1VKJA 2YOHA 4PSAA 2ASEA 1Z2AA 2P6UA 1G3UA 4NCJA 1N5IA 3KL4A 2YJTD 1OJLA 1BMFD 3LD9A 2ODNA 1E1QD 1O87A 3F5FA 4QGAA 4UQOA 4QL3A 4LBVA 4BZXA 4D4LA 3ZVNA 1G5PA 2XSZD 4M9ZA 5KO2A 4XIGS 5FBVB 3CH5A 1BYUA 1CKEA 2VHJA 4JVMA 4D0NA 4N0DA 3QKSA 3X1DA 3GLIA 2V8OA 2O8BA 3CRW1 1U2RA 4H1VA 4K46A 4LX0A 2JA1A 4L9WA 3TH5A 2O52A 3QPVA 2IYZA 3O47A 2Q3MA 3GFTA 2XZOA 1SXJD 4AD8A 4JLOA 3Q72A 4FWIB 2X77A 3A58B 5J40A 1E0SA 3RAPR 4Q7LA 4B2LA 1ESNA 1SXJA 1W44A 3FKSD 1Z06A 4V0ME 4C0BA 5JEDA 2G0NA 3KJIA 2ZRCA 4Q4HB 3RHFA 1KAGA 2VSOA 4K81B 4A36A 4KSCA 3DKVA 4PZZA 2IBMA 1VMAA 3ZVRA 4DCUA 3T1OA 3EXAA 1CU1A 2E9SA 4R9UC 1GRQA 1GAJA 2ZYWX 2DFTA 3B2EA 2VPPA 1PUIA 4B71A 1TMKA 4NCKA 2D62A 2ZTSA 4RJLA 4V0KA 3O8BA 4DT1B 3B9QA 3LO5A 1M2OB 3G5UA 4MRVA 3SDZA 2NO9A 3GLGE 4RD3A 2Q21A 2QTHA 5EP1A 1W36C 4D26A 3BXZA 4Q4AA 4QFMA 4PFSA 3RS3A 2V4ZA 4P31A 1TUEA 3LV8A 1F2TA 3PR1A 4D0LB 1G18A 3AV0B 1ZNZA 4LYHA 4IVQA 5EXPA 4PO9A 2KE5A 1R10A 1KJYA 2OBMA 2BEKA 2CJWB 4HAZA 4GSYA 3TNFA 4DIDA 3A6PC 3SQXA 3ZD7A 2GCNA 1PVOA 2B8WA 1F60A 2NIPA 3UXMA 4KVGA 3UMFA 2QSZA 5UKDA 4BFXA 2VF8A 4W9MC 1XZQA 1KMHB 5JZVA 4GL2A 1YZKA 4UNRA 2G83A 4NCIA 3LXXA 4R2HA 3FTQA 3VKHA 5CDFE 2JLSA 3T1QA 5J4HA 2HT1A 1LV7A 3OAAA 3UIEA 2GDJA 1MR3F 1OB2A 4IDQA 4ESHA 2HDNB 1MOZA 4KAXA 2FZ4A 3VR5A 4D25A 2B21A 2TMKA 1OFHA 1VHTA 2GKSA 5DH9A 1SVSA 2ZSFA 2QGZA 3CLVA 4G01B 2P5SA 3OZXA 3PENA 4TTPA 5C46F 5CITA 1N0VC 5CK5A 4A8JB 5FI0B 3QJYA 4RD6A 2WKPA 3KKMA 4Q9JA 1FZQA 5GVRA 3QKRA 4OBEA 3SYNA 2O8CB 2WM9B 1EFTA 1CBUA 1VPLA 5FBLB 1XDBA 3GLGB 2OCBA 1RIFA 2Q6TA 3TIFA 1KJZA 4IVRA 5JI3E 4M9QA 4WXPA 2ZS9A 3MWYW 1MRSA 3IIKA 1KI1A 2AXPA 2WWHA 4A82A 1D9ZA 3VHXA 4OHYA 1A82A 5AJYA 3NWJA 4TLAA 2V9PA 2FDCA 2FMXA 4LV6A 1NRJB 4LHVA 1JXMA 4P4TA 4NKRA 4G3XA 2PJRA 4BECA 3F0TA 4RD1A 521PA 4JBYA 4Q9HA 1H65A 3EZ7A 4JBWA 1ODFA 2JDID 4OHZA 5EJEA 1GITA 3B6EA 4NYIQ 4A6XA 5JRJA 2OZEA 2NMVA 3C16C 2ZVPX 3SJAA 3SJBA 3PG5A 1Q21A 3NBYC 1DE0A 4QBIA 3FPAA 3DOFA 3N2EA 1GVNB 4I81A 1C9KA 2YOGA 3KQLA 1KAOA 3T1VA 5KSYA 2H18A 4B6EA 3T34A 5G40A 3SI7A 4AKIA 1KI6A 5CDFA 3M0EA 3U7HB 3VR3A 4D2IA 4GMDA 5E7IA 4FWTA 2AKAB 4Q5IA 5FPSA 1NG9A 5L3QA 4XH9B 3IBYA 3K9NA 2PBRA 1XTRA 1ANKA 3CR8A 5FTJA 4MH0R 5BN3A 2C9CA 2JLQA 4JBXA 2EFHB 1NVVR 4EAQA 3B78A 1Z22A 2C77A 2HF9A 2DFNA 1OXVA 2A78A 1ZIOA 1E6CA 2C9OA 3LX5A 1ZNYA 3Q8XB 2Q9AA 4PC7A 5KDOA 3WYAA 4AYTA 4QRHA 1JB1A 1ZD1A 4RFSA 1UKVY 4TQUS 3Q5DA 4PXAA 2VO1A 1KKLA 2BMDA 2R6CA 1GIAA 3P26A 4IOJA 4KI0A 3KXKA 1N6KA 3WHLA 1GTVA 1NIJA 3AVQA 4OQNA 4XTRA 3UK6A 2ODEA 4OK5A 2V55B 3AP1A 5CK4A 1EG7A 1FX0B 2ZJOA 5AJZA 4M21A 4CF7A 1VYTA 1AQUA 2R6GA 4Q48A 2VSFA 1BKDR 1U99A 3BB4A 1DG1G 2YNMA 5HKKA 3AVTA 2ECKA 3NBZC 4LHXA 5JCPA 4BFTA 4HAWA 4TN1A 2ERXA 2D74A 4LBZA 1WXQA 2NOAA 1E2NA 3AP3A 5FOXA 2GZDA 1OPXA 2WAYA 1FUKA 3H1TA 3THYA 2G0TA 1GL7A 1U8AA 1H8ED 1N6IA 1XXHB 1CR0A 4OYHA 2C95A 4IXMA 4HB3A 4LYAA 2A9KA 2J59A 4Q1DA 2BOVA 4LC1A 3CBQA 3SHFA 2J45A 4FMCB 4LPSA 5KDLA 1Z28A 1E2FA 2GILA 4LV5B 2IYVA 3K70C 4HDQB 4WW0A 3FMIA 1SVKA 2QPTA 1XTIA 2KSQA 3DDCA 1UM8A 4TQAA 2QP9X 5HE9A 1A2BA 3B1WA 4GT1A 1KI4A 1W1WA 2YWGA 1Q0UA 1JJVA 3IPYA 4ZIRB 4I1SA 2LWIA 1JALA 1HY3A
chains in the Genus database with same CATH superfamily
4P5EA 4X90A 4MNUA 1TZ2A 1XEXA 3I9NA 3ZIAD 4WIAA 1SIWA 2O0KA 4LJ7A 3SSAA 1JP7A 1BOOA 2IPOA 3GRKA 2GF2A 5HTOA 1P2UA 4KMMA 2JA8J 1KS2A 3BJEA 2Z2XA 3KVOA 5JECA 4JB2A 2ZR0A 2D5AA 2IP1A 2I4MA 2RAPA 4RIIA 4ZXFA 3QJGA 3MKZA 2XVXA 1UPUA 3IXQA 2HQBA 4CN8A 2JFQA 5A4KA 4O02B 4B3MB 1CF4A 2R4TA 1GZ4A 2A6HF 3VQTA 3VODA 4C29A 4DLRA 1GPWB 2E1MC 1BWRA 2CFSA 2XE8A 4KPYA 2QX8A 1REQA 2HA7A 4G36A 4CH7A 2A86A 4L8GA 3TNYA 4XM0A 3QOYA 4JXZA 3C5EA 4HNUA 1WDTA 4QDKA 1C1XB 2E5NA 1EDBA 2I2WA 1M10A 2XEDA 5CLLA 4TLDA 2Z3YA 3AOEC 1V16B 3FYUB 5D5WB 2KQRA 2BFAA 2C2ZA 3E53A 1BH2A 3JZAA 4IZHA 1KYIA 3UV3A 1XX6A 1NOIA 1M8KA 3G13A 5CXQA 1DP7P 1ODSA 2CLHB 2OO7A 3U19A 3VWBA 3I72A 1Y7LA 2JJ2A 1XTSA 3OPMA 2IBSA 1E2LA 2IQIA 3PUZA 4MLCA 4PM4A 3SE0A 2LZ0A 2O3UA 3N87A 3OURA 4NG4A 3QOFA 2YWXA 1X1AA 1WUJS 3EQ6A 3KQOA 4ZVTA 4YHBA 2V6IA 3I9MA 4GUAA 2X2OA 3QYPA 1VI6A 3TSAA 2HMWA 1LNWA 2X5XA 3A2MA 3CVYA 2KYRA 1PK9A 1NLYA 1FSSA 3K5PA 2HK7A 2IZ1A 2JAWA 3K4PA 4PNPA 2GAFA 4LFCB 5M04A 1XXHE 4M54A 1UPCA 1MPTA 3I01A 4DDMA 4LGWA 1DVRA 1ZMXA 5ALGA 3KTAB 4NBWA 1S3SA 4QT4A 5BQ3A 4DHWA 4QFDA 4L4UA 2F3SA 2WSSD 3CZCA 3W90A 1QDEA 2BFOA 5ALMA 3CH6A 3S28A 4J0GA 4O8ZA 2A5FA 2DT7B 4P7BA 1GZHB 2YIDA 4J3NA 4KL8S 1PV2A 3EWIA 2RBEA 1SWWA 4EJTA 1NVDA 1NKTA 3GJ6A 3K7EA 3M3DA 2IOFK 4K03A 4YRZA 3S1MJ 1SCNE 4M3NA 3SM3A 2C7GA 2YWFA 4BFCA 1RLIA 3HFGA 1TXGA 4FYIA 2R0QC 1SQSA 2OGSA 1ZK4A 4YAUA 4D3ZA 5H02A 3RE1A 3URMA 1XE3A 5BR1A 1JHHA 2XTAA 4UHHA 2PL3A 1EF4A 2XUIA 4R41A 2BFFB 4HQLA 1PR9A 2BBTA 4D5CA 4LNUB 2R5WA 2JJ1A 3AYXB 5E3OA 3S3MA 5F7OA 2QQ0A 4YAOA 1FFAA 2JHAA 4LZNA 1MC4A 3G1TA 1KVUA 3IV9A 2B30A 1SD6A 3FK6A 5E1WA 1L5FA 4BZWA 1U3VA 1ZVQA 4UZFA 2M4KA 1THZA 2NZ8A 4G25A 3ABZA 4HDCA 2I03A 4AO7A 2V26A 2R6ZA 4ETIA 4TWRA 2I2BA 1AQJA 3BAZA 1XALA 1BVRA 3GK3A 3KQSA 4XLPF 1HA8A 1Z91A 4Q16A 3GF4A 4DA4A 4LWQA 1SFUA 1BBYA 2L54A 3M4ZA 4YRJA 4FTHA 1U0BB 3PK0A 4BEHA 1D1BA 3RHTA 2VJ4A 4EEFG 4C5BA 4F4FA 5FV7A 3K2AA 1N3IA 2OFXA 3CUKA 3IQGX 1YDWA 4EG7A 5KREA 4KISA 3ADBA 2MSYA 1V7PC 5HVQC 3AF0A 3NANA 5LQAA 3G0HA 1W2GA 3KJZA 1AA9A 1M74A 2CFXA 3OHSX 4GOXA 4Q9LA 4B3XA 1KAMA 3I2FA 3IT0A 5DI9A 4IWNA 3W06A 1YR2A 2ONKA 1DT3A 4CEJA 1JTFA 5I5GA 3EG9A 2QRVA 1U2ZA 5HS7A 1WFXA 3VU8A 1JRLA 2BMJA 3MBIA 1MX5A 4PN3A 2LBFB 2Z30A 4LFBB 4DCNA 3SZGA 2YMQA 1WF3A 2OK7A 2GQ0A 3JARB 4JWKA 3U9GA 4PGFA 1YDHA 4V2IA 3N5CA 3ZIDA 1YZTA 1L1FA 4D9JA 1EE1A 1IZ1A 2GAIA 4MYTA 5J2UF 1R5HA 3QVLA 4E32A 5KJ6A 1IU9A 4ZDJA 5JCOC 4X93A 4I4LA 3EVBA 1G5HA 2C7OA 4R6WA 4WNIA 5G1NA 5L3FA 2K9SA 2CQKA 1IN1A 1DAGA 4M3BA 1QIGA 4A3EJ 1GL9B 2N1BA 4I6GA 5D51S 4PSDA 3KKNA 2IDZA 4NY1A 1KGDA 3KU4A 3NT5A 4GO1A 1UXKA 1XD2B 3IQWA 4URHA 3VBEA 4X3CA 3ZCVA 5ICSA 4DUYB 1LX6A 2CFTA 2PZEA 4C2UA 3TS1A 3C2BA 1AHIA 2DP4E 3IT1A 4WXCA 2QW8A 3VZDA 1D04A 3C6QA 2R86A 1EYZA 3IDFA 4GR9A 3AFNA 5I8PA 5JFRA 2P67A 3KQMA 3KR0A 3WMRA 3HTUA 2AOVA 1I94B 3AQ4A 2I10A 4JP3A 3LFKA 3ZCOA 3D1LA 1JDUA 4JXKA 1Q1EA 4LI0A 5CR9A 1USVA 2GK4A 1NG6A 5TQJA 3OECA 1DEXA 1IDOA 1Z0FA 4FNAA 3NEUA 4HTAA 4KLNA 4FOPA 3RK1A 3V2HA 3H04A 3K2QA 5WRFA 3UBMA 2WWIA 5JPIA 1GM5A 5K8VA 3JVDA 1XN7A 1LSJA 1MD9A 3ANLA 4JNCA 4B3BA 4CM8A 4YFNF 5G4KA 4DY4A 2HQSA 5B1AH 1U4OA 1VE6A 2B7EA 4U8HA 2Z3ZA 1HDGO 3SHOA 4KN7X 2WAAA 2XXAA 4YQYA 4DYCA 1UBNA 1H6AA 1RE1A 2CNWD 1S89A 2EEPA 1N5KA 1VJ5A 4P3YA 3IRVA 5BV2P 2QZ8A 3HGTA 4NS1A 5DNUA 3VH1A 5F3RA 3DE6X 2GHQA 2HJHA 5BWOA 1EA5A 4CHTA 1U8YA 3CYFA 2VE9A 2HKIA 2XVMA 5TEVA 3VUFA 1SHUX 4RF2A 1ID8A 1VIAA 2QQ9A 1JYFA 1LJ9A 3IAFA 4K9LA 4TMTA 3WGUA 3ZTWA 2J3JA 5L3RA 2A6PA 2X1VA 3L8CA 1LGYA 1R36A 2YWDA 3FUCA 1QYRA 4X8LA 4DJFC 3OIDA 1JQ5A 3ELBA 4JLKA 5H3LA 1T9GR 3V2GA 3B36A 3DEIA 4D46A 2P2ZA 3GUUA 4OCZA 1V47A 1W0KD 1W581 2LKCA 2RKOA 2ZW9A 5FD6A 1ECPA 1OX6A 3IHKA 2IF2A 2FD5A 2NO5A 4Q66C 3W7AA 3ET4A 3MJHA 4NBSA 4XKCA 5EF6A 1QPBA 2UYGA 5DXAA 1C50A 1KMIY 2VPIA 4PXYA 2KZVA 1UL1X 2JI4A 3F97A 3C18A 1A7JA 1IY8A 1CIPA 4W6QA 3RRJA 1QH8B 3FUWA 2AC2A 3PQ7A 4UARA 2ZUFA 4DQUA 1Q74A 2QQFA 3MJCA 1SD7A 2PMFA 4GH5A 3M34A 5KAFC 1PUFB 1VTNC 3BRWD 3L2QA 2XNHA 4GEKA 4IIJA 1TM3E 3KB1A 1IJWC 1JDBC 2G0AA 2BKEA 5IF9A 4HUTA 1XDSA 2HFHA 1BI0A 1YQUA 4HMQA 1TW2A 2ODWA 3SSNA 4QU0A 1GNTA 2P30A 4EYEA 1FUUA 3F98A 4M9UA 3AO0B 3NXKA 1MGOA 1XDWA 2MMGA 5FX2A 1FU8A 1M76A 4P5PA 1I33A 1L3CA 4HVCA 3DBOB 3DKRA 1P4WA 3K0CC 4MA4A 2AI3A 3F9IA 1O8CA 2EZ9A 4Q1EA 5JLJA 3OJLA 4QUGA 2HSJA 4RBOA 2FLVA 4YRTA 3WK9A 3ZRGA 2II6A 3DCYA 1DCKA 1XHFA 4UHTA 1JAYA 2YXLA 4G97A 1CS0A 2PZMA 4HLUC 3OYKA 1WPQA 2X8LA 4YALA 4HS9A 2AOTA 4JT4A 4EKNB 4YRMA 2D6FA 2VC0A 1YRNA 4HFNA 4KB5A 4EABA 3P0JA 1DUXC 3ED1A 4MDFA 3V8PA 2NP6A 3KKPA 4Y7NJ 2ANBA 2Z58A 1NXPA 1VQLI 2REXB 3NARA 1ZA1A 3QKWA 2R751 1QWSA 1NMYA 4U2BA 4WEOA 3X1MA 2IIVA 3E84A 4PJNA 4LPKA 5LUAA 2Y2VA 1NVXQ 3HXMA 1BXRA 1T1JA 4NULA 4XR6A 4RH3A 4PO8A 3SN6A 4V19K 1SG0A 3R8CA 2BJHA 1SB8A 1VIDA 2WUWE 3BKWA 4HF2A 3QITA 4MUIA 1YS4A 4ZO6A 4MVWA 5TE9A 3ABTA 1RMQA 3DMDA 5IJ0B 4ZD6A 3D43A 1AO0A 4DCVA 1AJEA 3JSAA 5A7HA 2XPUA 4U7DA 3NYRA 3DVAA 2HZBA 1WBBA 3IRRA 1YZYA 1XB2A 5AP9A 4NBVA 4OBBA 1DAKA 4TQ9A 5ALXA 3RK0A 1DGRM 4BJHB 2Q1XA 5HYVA 2JLRA 1Y5RA 1GG9A 3WLIA 1FTWA 2NNNA 2BKXA 2QN2A 1I2MA 1ZRNA 1DPUA 2VJQA 4HAOA 1FSEA 4U87A 2PH1A 2LIPA 1I7NA 2GEUA 1OLXA 2WYWA 3LWZA 4I19A 5GMOA 4B4VA 2ME6A 2H7YA 2PPLA 4B2YA 4JI7B 3G73A 2OC9A 4IOAF 3WTSC 1GAQA 4FVTA 4JHLA 3ZW9A 3AL0B 5JAPA 3KE8A 1NW3A 2WRZA 2F4VB 4O8CA 3GBGA 4X9XA 4S0ZA 5E1DA 4G6ZA 4L27A 2CHFA 2AGVA 4YDQA 1HMPA 1N6OA 4XLEA 1VPVA 3GLXA 4YIIA 3COWA 3T94A 4QUEA 1IM8A 3HEAA 4NBTA 4R5MA 2OECA 4UCQA 3B3GA 4WN9B 5H68A 3B8HA 2NQ8A 4RFVA 5AK3A 3VBCA 4TMFA 2D54A 1HQDA 3W9YA 5KTPA 2OCKA 4L2IA 1H1LA 4R1SA 2VVTA 1FC0A 4WASA 3RWOA 3OJEA 3AUTA 1ZOPA 4J4BA 3IDQA 3V2UA 4XORA 2VJJA 2NVUB 4DAOA 1MIHA 2PT7A 5KNDD 3BL5A 3CZAA 5HIIA 4Y9RA 1E1LA 4CCWA 4Q0MA 9LDBA 4N5DA 4M3DA 5DM2A 1V4VA 3B82A 1SQFA 3QKRB 1QRDA 2O8CA 3L8ZA 4AF7A 1GKUB 1PP7U 3HDYA 4PLWA 2E82A 4JP8A 3VSLA 1CJKC 4U88A 5ICEA 2AX3A 2C83A 2I22A 4IUCS 4KACA 1GEEA 2HEGA 2HOTA 1NBME 2YRXA 3HY3A 3BZBA 3IBGA 5CDYA 5J43A 3OYJA 1EFRA 5B1IA 2R7KA 5JD4A 1FMVA 4MCJA 3MJFA 5LMNB 1JU9A 3PSFA 1ZH5A 3ITKA 1KYWA 5E3HA 4FX2A 1ONOA 5PGMA 4OAYA 2O7NA 1A9RA 1GQFA 2O9JA 2ZTHA 4WUTA 3TVDA 1FLDA 3O5AA 5DCWA 4CYCA 4D4MA 5LMUB 1S8AA 1SCKA 4TTJA 2BBWA 3TIIA 3KTAA 4I50A 5KNBH 3PQ3A 4DC1A 2IU0A 1VXOA 3X3HA 5J4KA 5J23A 3FOFC 1V5EA 1SXJB 2X4LA 4XXHA 3A02A 1P0PA 5JLAA 4Q4HA 4DM4A 4TMZA 3EPJA 3RC8A 2Z1NA 2CVZA 1GGVA 2QVOA 3G6WA 3KHTA 5A2QA 4J0JA 1M2JA 4E09A 1JU3A 4F46A 2QMZA 1ENOA 1BMFA 2ZU6A 2Q0HA 4H4CA 1SEUA 4KQCA 1USIA 1HQYE 1P3Y1 3IDZA 5HF5A 2PY6A 4CVNA 2A0UA 3SNHA 4YRKA 1V8ZA 2C42A 1U8TA 5I7HA 2JH3A 4DMCA 3LZ6A 1RYDA 5CJJA 5IAGA 1KQ0A 3V2IA 2Y0BA 1NUQA 1PVEA 2AC4A 2NV2B 1I7PA 4PRYA 1IN7A 4E11A 4B1RA 2G1KA 3FNIA 3SIRA 2XOXA 1GR0A 1E7WA 1G21E 4XX1A 3ZZNA 2YIMA 4D43A 4U7BA 3HG7A 3AR6A 1PQ4A 3H3ZA 1T08B 3HJFA 3SYRA 3HYNA 4OY3A 1NI3A 2B2NA 3KKKA 3LZDA 1L7XA 4MQ6A 3W6PA 4CM9A 1VKOA 3KQWA 2O8FA 1ULZA 2X7HA 5GGYA 4RTMA 3P0FA 4Q02A 3OJ0A 4EFLA 3U1BA 4AX8A 2XE4A 4RTRA 3IKMB 4GPTA 1O4VA 2WAOA 3WYFA 1RZ3A 3DYIA 2WWFA 2VDUE 3DW3X 5CX4A 5CFRA 1TUBA 1XPJA 1YMVA 3JQFA 3U3MA 1ZRMA 4BMDA 5CT6A 3DE0X 3PHBE 2FSUA 1RR8C 1RUOA 2EHDA 3EEFA 2CCGA 4JIGA 1NK2P 3CUEF 1GG8A 4X41A 2WB2A 1GGNA 3IQDB 4UM9B 3U2QA 3TO7A 4BC0A 1TO1E 5ITZB 4OQPA 3ZDZB 2BKLA 1YA8A 3D7LA 3IUEA 2G88A 3GZ4A 4WCDA 3GI1A 4S3MA 1QGZA 1YS1X 1Q19A 2EYUA 4CV3A 3B6AA 1U8RA 2WDZA 1RMYA 1YNOA 2BHTA 1IUPA 1I2CA 4LZJA 3GP8A 3ESYA 1WMFA 1LI5A 5C7LO 3S8MA 3PVCA 1EM6A 1K61A 2HM7A 4R98A 2IXTA 4LVUA 2W2QA 4YLEA 2F4OB 3D4BA 5JY1A 1Q1GA 1N5OX 3S2DJ 1J33A 3NBKA 4RVFA 5DE3A 3TDKA 2HL6A 3M7IA 2E5WA 4C14A 2JLUA 3I83A 3QVOA 4A6PA 3T5DA 1ETOA 4JK1X 2ZRJA 4AXBA 4XGRA 7YASA 4YT4A 1NY6A 3HOUJ 1PYOA 4P3XA 1DEAA 1N5DA 1Z7LA 1MJFA 1QR6A 1FTSA 2LUOA 3PJEA 3VVLA 3WWOA 5IFKA 1R7RA 2VHUA 4Z1MD 1HLGA 3L6EA 4N0QA 3R5KA 4UC0A 4B7UA 1HV8A 2DUJA 2IW3A 1QS0A 1UPXA 2QV0A 1SIOA 4JENA 1T1RA 5LM3A 3KQNA 4M36A 1ZG5A 5KYYA 4D4GA 4Y98A 3H6HA 2XKOA 1TQ2A 5FBQB 5KYXA 3AVWA 1IXZA 1JLMA 2QR5A 4FUQA 1ZGCA 1MBKA 1JR3D 1WHSB 4LS3A 4PTLA 3OMLA 4GPBA 1DIRA 5DNEA 1MC8A 3BMNB 4M46A 1ZWLA 4KSYA 3LSTA 4PS1A 1B9MA 1PZNA 3JSPA 3SZPA 1HLDA 1R5JA 3ORSA 4O4IF 2GFQA 3OO1A 1K68A 1Z12A 2IHKA 2R6AA 3IPRA 3C3KA 4XCQA 1K5HA 4KR3A 2ZJ1A 2HQAA 1YK0A 3KOOA 3O4HA 5JSYA 4FINA 1F51E 1G8PA 4M4SA 3UJ9A 4XDHA 5DCUA 4AIRA 3EBLA 4CUGA 1GU7A 1P4GA 4KQMA 3USZA 4ARSA 1LPOA 1REPC 2XMCA 4H3KB 4EI7A 4H77A 1GPKA 3C43A 5F3WB 3FXUA 1G17A 1MOPA 1NBEA 2VK8A 2D1FA 3V8QA 5B2EA 1EXMA 3E9EA 3IAM6 1QGOA 4L22A 4PTYA 1QMPA 5CX1B 3ZXYA 2W71A 5JY6A 2X6RA 1WV1A 3ZU3A 4CKEB 2PQ2A 1VBKA 2ZYRA 1XHLA 3LGXA 3K0CA 4PZJA 1DKNA 3PXUA 3AJ9A 3AVVA 3QPBA 1CWUA 2PS3A 3I5YA 2YVKA 3WMEA 2RC4A 4GM4A 3KLMX 4JLMA 4UVIA 4KA4A 1LEAA 2JBWA 3GNTA 5TRDA 2WD7B 1GNVA 4JLDA 2QGUA 2K86A 1KPHA 3PTLA 4MR8B 4KPFC 2ORWA 4AY5A 3H2SA 1C1XA 2XOEA 2CXXA 3CCRI 1WSDA 4MP6A 2Q5FA 3IE0A 4QOHA 1J8YF 3X43A 5H9WA 1V16A 3FYUA 1UMDB 5EFZA 1VBNA 4K8OA 1BW9A 1DCFA 1G5RA 3ZDFA 3CC8A 5FKKA 1L7NA 3P2MA 2WJHA 4DVJA 4F85A 5JFOA 1QNLA 1E5TA 1M2VA 1A5SB 1U0GA 4AS2A 1T0HB 1Z6QA 1FMCA 3DMPA 3S2HJ 2XDAA 5CJ2A 1WMEA 2EZ4A 2DBZA 1Y1WJ 1Q17A 4RXTA 3ZVKA 2B63J 3CUSA 2KZGA 5DX8A 5C4MA 4XIYA 4H4KC 2P6SA 2NVTJ 1QYVA 1V6SA 2ET6A 3GUVA 3H99A 4JBLA 4KWTA 1WQ4A 4ON9A 1BXZA 1IWPB 1CUHA 2PMBA 5EXXA 2G5GX 3OSZA 1QV9A 4MI9A 3WHIA 2CBZA 2DPDA 5F1RA 2AR0A 3ON5A 4QODA 4BNDB 5D5VB 5D84A 8ABPA 4HAUA 2YYZA 1RWXA 3MAJA 4YHHB 1LLQA 2OBPA 1YMUA 5DTQA 4E5VA 5B4TA 3TM4A 1GQQA 4L7VA 5HQ3A 4DV0B 1TIBA 3BTOA 3OZFA 4E7OA 4W5QA 3B9BA 4BVJA 1D0IA 1IGNA 1FU7A 1QPGA 3ULQB 3D6FA 1C80A 1COWA 4FFNA 4MKZA 4P7JA 5JBIA 1KK2A 3FDYA 4JGBA 5CP8A 2HA0A 3G2KA 3WV5A 4HB2A 3QA9A 2VPQA 5BNTA 4QQNA 5B1DA 3ZZMA 3D31A 1QP8A 1K08A 4FR2A 4PINA 4EFMA 1VCIA 2HCJB 1BS2A 4RTQA 5BUCA 4DB4A 4RK5A 5BYAA 2HCRA 1AUXA 1QJ4A 1TF5A 5DWVA 4X64B 5LGNA 1KEEA 1Q7EA 1EEXB 1IJBA 2JRLA 3CNLA 3VDQA 2DX7A 1EINA 3M49A 3OTQA 1Z7YA 3TW4A 2VJMA 2ZPAA 4CTMA 1X2BA 2EW1A 1RLUA 1MH3A 1O2DA 5CT5A 3OZRA 3LRPA 2V65A 6Q21A 4FZRA 5A62A 1V1MB 5EXTA 2OGZA 5TGZA 4EUNA 2G1UA 1RZVA 4OQ4A 5KKNB 4JX8A 3TAXA 4LITA 3FSRA 4MQLA 1FFBA 5HCNA 4Z4QA 4RHTA 5FADA 3LF2A 3REOA 4P84A 5U1PA 1ZD8A 2R6HA 1A6IA 3LDUA 3A28A 4AJJA 1WBDA 4HPQA 3D1NI 2XUHA 1YS2X 4MWOA 3GVXA 4NBQA 2DHCA 4NABA 4TUYA 4A0SA 4BV9A 4C22A 1Q7CA 4URVR 4EG3A 4UM9D 1KIMA 5CLIA 3T7KA 3V55A 4YCDA 2XTNA 1FPMA 4FDVA 2F3RA 1MXFA 2CJWA 4BO6A 5LZ2A 3ZQGA 2GCPA 3BRCA 1E17A 3A4YA 3WB0A 4DMHA 1IWOA 2ZNZA 1JQ3A 2VJDA 1H8HD 2NUTB 3MRVA 3OS1A 1W2HA 2AFIB 1B59A 2R60A 2VSYA 1S2IA 2W5UA 1YZUA 3C3PA 1TO6A 4JL5A 1XKLA 2A84A 4BNCA 2H7XA 4PLVA 5D5UB 1IOLA 3WLOA 3Q9UA 1NTRA 3C87A 1A9XA 4CM3A 3OIYA 3TTUA 2PMKA 4K9NA 2O4CA 1X15A 4OU4A 4RY9A 3LI2A 1KDOA 2YHAA 3SFVA 4DCOA 3U21A 2FG5A 2ME0A 3TIGA 3GL9A 3AR7A 4LSWA 3ZMTA 2F1HA 1UBJS 1M5RA 4PX2A 2OZUA 1X1DA 4J0EA 1KSJA 3NYIA 3VDRA 1FRVA 5DHFA 3ZJYA 4B46A 3L2RA 2OQIA 4J2OA 2OKGA 4JEMA 4LYGA 3L01A 3U3KA 4AVYA 2ID6A 4ENQA 2FOLA 1HYBA 2WMYA 2X1MA 4CCLA 1MNMC 1R1TA 1CJSA 1R2QA 1LXCA 3CN7A 3H7AA 1RMTA 2YDXA 5GGXA 3EZGA 1CG6A 3DVLA 1YRQA 4EEKA 3PUIA 1RZRA 4YCCA 2CZCA 1S8OA 4CNQA 1V37A 2FSHA 4FIZA 3SMQA 3OEHD 1MVNA 2G70A 4OHKA 1XC7A 2DOKA 3BEOA 4JR2A 1EVIA 1ZI8A 2GD6A 4NQWA 1XP8A 3HKEB 4XWWA 4EB8A 5JCXA 1O6GA 1Y6FA 1G2IA 4MVJM 5AHKA 3F2VA 3OV8A 3NH6A 3IP6A 1VJ0A 3KSUA 4TV9F 2BFBA 1CJMA 2ZRLA 1TCVA 1YQGA 1W8DA 2ZQ5A 1UBGA 5LCXA 2V9CA 5T4HA 4C0WA 5BW6B 1JEAA 4CIAA 1QHNA 2OUIA 3EX7C 1SKBA 3K0EA 2OWDA 4XQEA 3C3BA 3U1VA 4BO9A 1C1DA 4R5HA 1KTVA 3VHXB 3TOBA 5E1XA 3QODA 4D9CA 4FI3F 1F9NA 1I9GA 3KKEA 3LCMA 4POOA 2UUAB 3KUUA 3MBOA 4R69A 4UBIA 1EPUA 4NAVA 3EOBI 4P4UA 4TXLA 2YQ5A 2HVRA 2OAGA 5K03A 2HCTA 1UK8A 3H9GA 4FZ3A 2BGIA 3OKCA 4YUWA 4GXRA 4ZOBA 5A4MS 3DTVD 3ABMH 5J1RA 4UTVA 2Q3DA 3VMMA 3OFSA 1RLMA 2CF6A 4L6IA 3ZX5A 1Q0RA 3WA6A 5AKIA 5HZKA 3D7KA 1JVBA 1MO5A 4GPIB 5IAEA 5DDGA 2CMKA 2D5IA 3QBDA 3WNCA 1HSJA 1HO3A 1N5MA 2MSEB 2QD4A 3E8XA 2BFCA 3ZH9B 3WKAA 2ZI9A 4ES6A 2DJNA 1YE5A 2YVQA 3K73O 3PCRB 4X00A 3CLUD 5IAOA 1B41A 1CDEA 4OF4A 2ID3A 2DG2A 3N8HA 3LH5A 1C2YA 2HAEA 3NHJA 3PYLA 3GRRA 4Z2YA 3VOAA 5LQUA 3P8ZA 3K70D 5A03A 1FSGA 2OY0A 2VUTA 1ZRSA 5B7QA 5JWRA 2E6KA 7MDHA 2XPCA 3ADDA 4B73A 3I5XA 4KR2A 4RPIA 1WWXA 1SOUA 1PFQA 2W2OA 3LRXA 5IUNC 3MRTA 1JE8A 4LUCA 3R3SA 4G8DA 2JK3A 1KH2A 3CZMA 3KDAA 4AWXA 4C4AA 4YI3A 1OH8A 1FNNA 1X4PA 2NZJA 1YQEA 5E20A 2YV2A 1MC5A 4Q4LA 3Q2KA 1TA9A 5DP1A 2VEOA 3AVXA 4R4JA 5DBHX 1ZINA 1Q3KA 5KQPA 3DOHA 3RYIA 3ABRB 5K1ZA 2ZYDA 4X6YA 3LWDA 2JGNA 2HPIA 4K0RA 3AIOA 1OASA 1MU0A 3P52A 4MDHA 1SOVA 1SMTA 3RDPA 2MR6A 4F21A 2GF0A 1PL0A 5KCZA 3B6CA 2VKTA 4K8RB 4UMFA 1LFUP 2O05A 5F1KA 1OAOA 1T6YA 2HCBA 5EZYB 4DSZA 4Z4FA 2WP8J 3N76A 1KA8A 4JP0A 3L1PA 1G2HA 1HURA 2IXFA 3OS0A 2X23A 3FNRA 1TQ6A 3AL2A 2QQBA 3HP1A 3L18A 1GWNA 1EX9A 2BW0A 2F5DA 3JWIA 4HTFB 1EJ9A 1V55H 2DQKA 1QHGA 3HJUA 3MJSA 4YP5A 5GIPE 4AY2A 5EI5A 1XG5A 5AXCA 4JC5A 1AVTA 1TEZA 1ETYA 1YR3A 4FFBB 3J80A 3A3PA 2W42A 1TQMA 1U0SY 5LQNA 2FK7A 3QX8A 1CX9B 1DRWA 4NMXB 3VSDA 3N8GA 2G1AA 3KQPA 4XDYA 3UKDA 2J0VA 4I1YA 4R7ZA 4NC8A 2ILVA 3GEHA 3NDJA 3OQ6A 1WX1A 4Y2GA 4JXXA 1NN3A 2IOQA 1GQ2A 2IIBA 1ZBDA 4BTEA 1CT9A 3VU9B 2CH0A 3R74A 3P9CA 3E5NA 2ELJA 1VKRA 1RBYA 2J9YB 4ASUD 1U28C 4GMFA 2COKA 2RBKA 3F96A 1P39A 2QSFX 5EP4A 1U5BA 3OYAA 2ROQA 4RTNA 4N6NA 3L7AA 3X44A 4QDZA 3C2HA 1FJGB 5FKMA 1CEXA 4GL2A 1NPYA 1YONA 4B45A 2C7QA 1MUUA 1OKKD 1VIVA 4Y18A 1ZN2A 4B6OA 3LSJA 2ABWA 3PU6A 1RM4A 5IYZF 1E3LA 4BPRA 3A10A 4QBGB 4EO4A 3RV4A 5EJ9A 3F8CA 4EPYA 3IQXA 3VA7A 2IUSA 2BE9A 2JFFA 1Q6YA 3PHLA 4RVCA 5BP7A 2JPBA 5JD3A 2AK2A 2BUBA 5HDNA 3ZE9A 1GTSA 2QBYB 4Y0AA 2I4OA 4A91A 4ZJPA 4QYSA 1YRLA 4NUBA 1U65A 2ZT6A 1UJCA 3GGGA 3QH4A 3WGVA 1VHJA 5C5CA 2B20A 4HNTA 1WSWA 2CL0X 5ALTA 1PR6A 2RHLA 1ZK3A 3KBOA 1AKHB 4DV6B 5KPJA 4TV7A 2COUA 3ZV4A 4E6EA 4TKUB 3X1ZA 4MW5A 3R6TA 1QC5B 2B3DA 5DV9A 3M6FA 1AZTA 2CWWA 1OCPA 3FPJA 3HJRA 4FFMA 4DTIA 4AY6A 1RAIA 1QGED 3U1TA 3CU5A 1EKEA 3ANYB 2OPTA 4N8SA 1BVHA 1Q1BA 2V6CA 4BFWA 2C29D 2R11A 2H1SA 3WJ7A 3V7RA 1QG2A 4MYDA 3RYHB 5FB2A 1N0WA 1GTL1 3T5XA 1XL1A 2EFCB 1BOBA 2X6QA 2IBDA 1H5UA 1Z4QA 5FL7D 1IEVA 1DTEA 4LDPA 1R18A 2Y30A 1G3MA 4E46A 2HR1A 3VKGA 2BKUA 2FDXA 4WLEA 2IYSA 4QM7A 2CCJA 3RTDA 3GT4A 3CDHA 2OD5A 3V5NA 1Y3FE 5B55A 4KXMA 3SVTA 1M9NA 3CBGA 1O3SA 2Z5FA 3PQKA 4P4NA 5DNVA 1YWGO 2Y4OA 1JIUA 2YY7A 3W1VA 4ZZ1A 4QNMA 5ESDA 1A4XA 2M6RA 3LE8A 2JLBA 4DIBA 4J01A 1L5RA 5TGDA 4RB0A 1JG4A 3HFSA 2AOWA 2BMFA 3GAFA 1KYQA 1NBOA 1MNEA 2L7ZA 2IQ5A 3L7YA 4LXUA 1ORVA 3OR2C 1UJNA 4J16C 4P81A 5DYIA 4K1LA 3UMCA 1ZO8A 1H9BA 5TJHA 3WYEA 4HVTA 1XCOA 5DYWA 1VKNA 3DYBA 3SZOA 1Z3CA 2ZIFA 3EXG1 3H8VA 3P0IA 5ELLA 5FYQA 3ADKA 1XGMA 3HMKA 2LTAA 3S16J 4C30A 2JGAA 3CE6A 3I92A 2M1ZA 4GGOA 3BN3A 4E4TA 5CBKA 2D3WA 1WCIB 2BBYA 3HB0A 3LO8A 5L53A 5BVGA 5KSPA 1NBWB 2VS1A 1RYEA 5B3SH 1DAPA 1E4EA 2VOPA 5FL3A 2XVYA 2WJZB 3NNSA 3ZGOA 4CQMA 5EQFA 1KO7A 5EZGA 1T4GA 4B9AA 4LDAA 2G36A 4Q47A 1ETXA 2ZXHA 2AO9A 2B99A 1L6RA 3LKVA 3PFNA 3DOEA 4LHEA 1XZAA 5GONA 1RQNA 4EKEA 1FW8A 2GYYA 4ZZ0A 3J81Z 2WIJA 3Q7IA 1I6KA 2EFEB 3RJ5A 4BXOB 3LVFO 1BN5A 1BVYF 5FQOA 1IBRA 1TAGA 1ZNXA 2B0LA 2CVFA 4JKIA 1U0RA 3RTEA 4DS3A 5BO5A 4HNGA 1W4ZA 2ACEA 4TLCA 2VSXA 1GT91 1G3SA 2XGMA 3DXXA 3IXLA 1V4RA 1EGHA 3IYLW 2DA4A 1B74A 1BXRB 5JS8A 4W5HA 4AVZA 1D5WA 1TJ5A 3RYTC 5JSUA 4R16A 4A9AA 1OFUA 2WNSA 4M49A 1KZ4A 5HIMA 2WFZA 1CY6A 4A0QA 1JR3A 4O0LA 1GKIA 5IJ0A 3KQHA 3QRWA 3WTXC 4TUYB 5GONF 1M2FA 1RKVA 2E1MB 2XTZA 1TM7E 1J9EA 1BSVA 4WESB 1J0RA 5ITWA 3ECHA 2VEDA 2RK4A 3BC1A 3IIIA 3ZLVA 5JH7B 1XZCA 4AUEA 5KOHB 2VPYA 5BW4A 1HE4A 2VOOA 1AKUA 3QVTA 3PJGA 1BE1A 2G6BA 2DTDA 1UF9A 3KYJB 4UEOA 2XF5A 2WA2A 1IPFA 1BJZA 5DISB 2YYSA 3KXLA 3OWHA 2NYVA 5IVIA 1TT7A 2GZAA 2X19A 2MYSA 4HJRA 4LOHA 1PX0A 3D8NA 1YBVA 4ZKEA 4G65A 4GI1A 3UNXA 1XJQA 2WJPA 4HDKA 2PZFA 1MGPA 3MQ0A 1PKEA 4JLSA 1KU9A 3BOQA 2TS1A 3NKLA 1JS1X 5JAIA 1WJCA 5EQJB 5IARA 4LK3A 2JZOA 5IM5A 3HSFA 3WG9A 1O0BA 2ZU0C 3BE6A 3O1HB 5E7QA 4BYMA 4RLHA 4FM9A 1NXWA 2W6QA 1DUSA 3DHYA 3CO6C 4UW9A 3KZCA 2JRTA 2QZ9A 1BOFA 4A12A 1FLVA 1OLUA 2P65A 2VHTA 3RPEA 3DKIA 5NLLA 5LYYA 3TLGA 1Y0BA 1U3DA 2I66A 1U31A 1UJ2A 4BN5A 4EENA 5EKSA 2JFXA 1GNLA 1T2AA 4MJ7A 2HBQA 3H36A 3T9FA 1Q7BA 5T3YA 5JTTA 2HU9A 5E9JA 1SCBA 3AEZA 1UPTA 3U7EB 4IBOA 2G9QA 3W5SA 4Z6KA 3A37A 1L5HB 2WABA 2GZ3A 3OE7D 3H8SA 1VA5A 3IOMA 3MSXA 4BLVA 1RQXA 3FWZA 4JLAA 4PAGA 1ZREA 2Q9CA 2YZ2A 2LCFA 3EOZA 3VOBA 3ZWVA 1AKEA 1O54A 4Y1FA 1L5OA 4DYDA 1T3SA 1DSSG 1KP3A 4NFHA 1HE3A 2ZDQA 3QX7A 4WNAA 2Q6VA 2JFWA 3ZWPA 1NMEA 1QZTA 4MZDA 1JG6A 2MSNA 4MNTA 3JS5A 3WAKA 4QUIA 2J5RA 2EZUA 3BR5A 1I7LA 2Q5OA 2YICA 3AEQB 3BFKA 4HDUA 2ANCA 2M3AA 3IBCA 3K9GA 3JVVA 5F5NA 3HACA 3SY8A 3WNDA 1LFBA 1ORWA 4BEVA 2BGWA 1U81A 1JDBB 2DZDA 2PSDA 1G20E 1XQYA 3EIXA 3ISTA 2ONCA 3HHEA 3UG7A 1BMDA 3LJKA 4BO2A 1EFRD 1QLJA 2PXHA 3M7GA 3GGSA 3SKYA 1EVKA 1GZ6A 2GZ2A 5HRAA 5K0LA 3LU1A 2HWKA 2YZNA 2ZSJA 2ID9A 1YVUA 3D5QA 3G4SI 5B66C 3NWBA 4B3SB 4DJEC 2BIFA 3MSCA 4RW0A 4KREA 4PC2A 3R4KA 1VZ0A 4TKVB 2AKEA 4DSOA 3D3WA 2VTBB 1IBKB 3D9QX 1FSFA 4WCFA 3FBTA 4JVLA 5BYJA 3WBBA 3H86A 4IHSA 3OBBA 4BUCA 2W6NA 1GNQA 1TFUA 2QT0A 4Y2PA 2Z6AA 3QM1A 3JRCA 4R01A 5DMXA 4EG5A 3TMYA 2GEKA 1Q0HA 1TBXA 1BWQA 3KKLA 4PPNA 3A4LA 1DJNA 1I5EA 4HZUB 4ME6A 4MRMA 5A5EA 2K9LA 4KH1A 1RI3A 2CGEA 3T7AA 3ESZA 3H3UA 4JI2B 3TQSA 4IG9A 4B3CA 3WR5A 1RRMA 1OUMA 4EY5A 5FLXK 4B3AA 1JVNA 3EUAA 1Q7GA 5T41A 3RVDA 4F52A 1UODA 2ODTX 3HHPA 3R24A 1US8A 1QYCA 2PSJA 2QAIA 3JD2A 5CNJA 1QKKA 2QSYA 1HOXA 4PIMA 4CG1A 1U78A 3FOWA 3IJPA 4RSRA 4AF8A 4XVCA 3IHTA 3IP3A 3QF7A 4B32A 5LU8A 4MJXA 2EH3A 4HUJA 4F4UA 5JQGA 3T5PA 4ZZLA 3QF4A 1G3IA 1ODTC 4P32A 1CR4A 2C9ZA 2HNKA 2YZGA 2E34A 3NM4A 1TCBA 3I6YA 3GZJA 4QG7A 4L95C 1NM5A 4M1MA 2VBIA 1U8ZA 1I10A 2P3OA 1KH1A 1N8TA 3EASA 4PLFA 4OGKA 4DA0A 2P5KA 4K7JA 2WIDA 5AQ1A 2ZMEA 3D8UA 5EZ6B 4FR0A 1S96A 3JQBC 1Y1KE 4IINA 2V4JC 1DU4A 1YC2A 5A4FS 3LQQA 3Q0VA 4M7WA 2R8EA 2L7MP 4W7HA