2V9PA

Crystal structure of papillomavirus e1 hexameric helicase dna-free form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
279
structure length
272
Chain Sequence
b'TLNESKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDEQPFNITDADWKSFFVRLWGRLDLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REPLICATION PROTEIN E1
publication title Papillomavirus E1 Helicase Assembly Maintains an Asymmetric State in the Absence of DNA and Nucleotide Cofactors.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Hydrolase
total genus 86
structure length 272
sequence length 279
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2v9pA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v9pA02
1DEKA 4TTRA 1CU1A 5EXXA 4Q7JB 3B2EA 4M4SA 5AJXA 3G82C 2VO1A 1G1MA 2V4ZA 4BGDA 1LW7A 3CR8A 4IVQA 1AS2A 3RS2A 4QJ3A 1XEWX 4QM6A 4KLNA 3CWZA 3CRMA 4L9SA 3ZQJA 1HTWA 3VR4A 4TQUS 5TXGA 2OESA 4G5QA 5F3WB 2C95A 1P2UA 4MRSA 1HT1E 1TQ6A 2HYDA 3P4XA 3AKDA 3KKQA 1FX0B 1T5IA 5JI2E 1BOFA 3CLVA 5G41A 3I3SR 4BFSA 4MKHA 1G3MA 3FFBA 3QXCA 4KBGA 4TL7A 4ABYA 1N25A 3A4NA 4Q9KA 3LY5A 3EWAA 4TQ9A 3VNUA 3IO5A 3D6TB 3LO5A 1FW6A 1AJEA 5ELXA 2ZI7A 3K9GA 3OIYA 2GJKA 4B76A 2V55B 1E2EA 3EASA 3V00A 2HLDA 4H1VA 4V03A 3CX7A 1PLJA 3HWSA 2BEKA 2RCNA 1K5DA 4DT1B 2ZQ5A 1KSFX 1XRJA 2GAAA 2ZJ8A 4IKEA 4M2LA 3B60A 3T06B 3SNHA 3X1WA 4OJQA 2Q3MA 1F2UB 1JB1A 1Z5ZA 2Q0HA 2IXFA 1NLZA 4JBWA 2ECKA 1T3HA 3MG9A 2G9NA 1R10A 3T61A 4C0JA 5H8WA 2XXAA 1E79D 1YQTA 2F3RA 3HPQA 2VHCA 3LLMA 3SN6A 3T5GA 2GF0A 2HJVA 1JR3E 4Z51A 4QGGA 1ZNXA 4GT1A 1KSHA 2ZAOA 4LY6A 3U7EB 3GLGE 4RD2A 2PJZA 5BW8A 1J7KA 4PAQA 4OI4A 4DIDA 1OHHA 2F43B 1TF5A 4HUQA 2DWPA 3EIHA 5CK5A 1Z07A 4Q4JA 1HV8A 3THWA 3GJ5A 5E7JA 1TF2A 1XTRA 4QBGB 3AP3A 2YV5A 2ERYA 4LK2A 3UPUA 3QF4B 5FR2A 2CL0X 4NONA 5IDVA 2WSMA 1HQYE 3MJRA 1SKQA 1RPZA 3FGNA 3VNVA 4P33A 3MD0A 3AVXA 1OPXA 2FWRA 2A78A 1G18A 2EFEB 5EQTA 1JQJC 1F6BA 3VAAA 4ZDKA 1P3JA 1E9DA 2OUKA 1YJ5A 2HCBA 1OFIA 5EP2A 3C41J 2MMGA 3DMNA 3GJXC 2ZI6A 1KDRA 1JAHA 1Z63A 1UKVY 1Q21A 1KSJA 3K0AB 5DGXA 3TMKA 2QL6A 1Z6GA 1W36B 4LJ6A 1AN0A 2ZITA 5JLJA 4B35A 3KZ1E 1YZNA 1Z6YA 5FL7A 3EX7C 2RGXA 1M1YE 2ZR7A 4MRNA 3O8CA 5HZHA 1N5IA 1XXHB 1NMXA 4D82A 1W0KD 1G291 3EA0A 4QHTA 2JLWA 2ASEA 1NJFA 1NG9A 5EP3A 3A6PC 4KSCA 3FHCB 1CJMA 1ZIPA 1M7GA 1Z47A 4DIEA 3T34A 2CJWB 3HDTA 4JSTA 5BYJA 3WYGA 3BWDD 3DHWC 3GJ3A 5FOSA 3KTAA 3U6KA 2DFNA 3RYTC 4DLWA 3K0EA 3K09C 4CF7A 2C04A 1G4AE 3KKNA 2BMJA 4GNKA 2NTYC 4XTCS 4C7OA 2QU8A 2Q9AA 1T4GA 3OESA 5D3QA 5AUOB 4DWJA 4M0LA 3X1YA 2JLSA 5FTJA 1Z6TA 1QHHB 3U3JA 3VHXA 2WSSD 2WZQA 5AWFC 421PA 4XWOA 4LJ9A 4IFEA 1L7VC 2PZFA 2VYFA 3CW2A 5JSZB 1H65A 2OBNA 1E2FA 4V02A 5EE0A 2O8DB 1H8EA 1RJ9B 2P2LA 2E9SA 3CNLA 3GJ0A 2BM0A 3QXJA 4B6EA 2IUTA 3WYFA 3T12A 4PC7A 5FTLA 4N0DA 3W90A 1G7TA 4F91B 5DIFA 1S2MA 2QY9A 1Q12A 2BWJA 4NCNA 1CR4A 4XSGA 2W6ID 1U8ZA 4JYCA 1Q44A 1CXZA 1LF0A 2E1RA 3K1JA 3SFVA 1MH1A 3MLEA 1CRQA 1XP8A 2O0JA 3E5HA 3B1ZA 1V43A 1CKEA 3ZD7A 3NDBB 1LF5A 1A2KC 1MT0A 1YZKA 1OKKA 2IYTA 3PQCA 2FE4A 4Q03A 3LW8A 4C0SA 3KXIA 1VPLA 4EQ6B 3NG1A 2PT7A 2X77A 5LD2C 3QXSA 4AWXA 4A82A 1M2OB 2GJ8A 3MGCA 4L4UA 1YR7A 3SJCA 4RD6A 3EZ6A 3PEVA 2HEIA 1KSGA 1WB9A 2O5VA 1X8LA 4RSGA 1AK2A 4Q7KA 4MYHA 1VG1A 3MWJA 2ZRAA 5K8IA 5TMPA 3WNDA 1NY5A 5A0FA 1YR9A 4DXAA 4TZ0A 4QFMA 1S96A 1NVWQ 2Z0MA 1ZNYA 2QBYB 4NU0A 4DEXA 1VIAA 3MCAA 4HDCA 4TMWA 4Q1AA 3TK1A 4DB4A 2UVQA 4XSHA 4CT4B 4DDWA 5J4LA 1GRQA 2RAPA 3LX8A 4II7A 2V7QA 2OSBA 4C4PA 3V4RA 1FQJA 1WDTA 3DKPA 2CCGA 1S0UA 2F1HA 3GLHB 1M6NA 2XNDD 1BKDR 1G7CA 3THOA 3ADCA 5KSOA 1ZC4A 2ZU0C 1WP9A 1U8YA 4OQLA 4C30A 4CVNA 2PZGA 4HYYA 1CJKC 3UXMA 2ZE5A 2J3EA 1M8PA 3NEJA 3I5XA 1Q0UA 3K0FB 2F6RA 3QPUA 1KI6A 3SHWA 2EYUA 2CL6X 3W3AA 1EESA 5FOWA 1G20E 3K0SA 2X2FA 2JJ1D 1Q22A 4MRPA 2Q21A 2BDTA 4RFVA 4D0LB 1BMFD 5FPKA 4CIDA 1KI3A 3ZH9B 3AVPA 1I2DA 1R0WA 5FUVA 4A2WA 1E9AA 2WAXA 4A2QA 2EU8A 2VF8A 3C15C 4YXWD 4JYBA 1GNRA 1HA3A 3Q8XB 4OI2A 4ZO4A 2QTHA 1C1YA 3AKCA 4IJMA 3NHBA 5CLLA 2AL7A 1M7BA 1S3SA 2CHQA 1VCNA 4NE2A 2V54A 4BLSA 2OHFA 2OAP1 1DS6A 1UKZA 4L9WA 4PQRA 2O0KA 3GFPA 2C77A 5KO2A 3H0KA 4OHWA 2EQBA 1MABB 4DLTA 3QKSA 3CIOA 2G77B 3DPUA 3EZ2A 5FUXA 4TTPA 3CNOA 1B0UA 2XB2A 2O52A 2FSGA 2GDJA 2CEAA 4LHYA 4QKQA 3HU2A 1XJQA 1MR3F 1R5OA 4Q9IA 2LCFA 3QOFA 1LS6A 2ZI4A 4D0NA 4AYTA 4CZ2A 3W8RA 3ADKA 3EARA 4ZKEA 5L3SA 4YDSA 1KO4A 2QPTA 2BBTA 2DFTA 2HXYA 3F3YA 3VKWA 1KNXA 4HAXA 2QMOA 1VCMA 2IYQA 3MMPA 4NDZA 3ZS8A 3PENA 5FH9A 3REFA 2VSFA 2CE2X 4RFSA 1XD8A 2IUUA 1B23P 2YINC 4MYTA 1GZSA 4LUCA 2BIFA 3OE7A 3FMFA 4NCHA 3B9PA 2YWEA 5FOXA 1D2NA 1W46A 5JHHB 1US8B 3HJNA 2IWRA 4GP6A 2YYZA 1HY3A 1UAAA 3SQXA 3RRZA 5HKKA 3L82B 4GL2A 3KKOA 1Z6AA 2QENA 4NBSA 4RD4A 2P67A 4E5UA 4C0AC 2R6CA 5FI0B 1OXTA 1VG0B 3RRMA 3RDPA 4TMXA 3U44B 4XVRA 1CR2A 2QQ0A 4C0QC 4GOXA 4S35A 1IN5A 2IXGA 2JDID 3IKJA 3TAUA 4CEHA 2VSOA 2IYSA 3HP1A 1N0VC 4U02A 2PCJA 4YMUA 1MO6A 1W44A 1IN6A 2CDNA 3DDCA 2ZRHA 2IS2A 5H70A 2GEVA 1DADA 4KCGA 3L0PA 1UJ2A 3AF0A 3BJIC 3AGPA 3CF2A 2Z6VA 3KL4A 3UG6A 4G1UC 4XVUA 5SZJA 3IUYA 2CNWA 2B8TA 1E2JA 3RS5A 3R9WA 1J70A 2V9PA 1UBEA 2ORWA 2D62A 1KO5A 1G9XA 4OYHA 2IYUA 3VR1A 1Z06A 5GJWC 3SZRA 3AP2A 2XOKD 3I1FA 4DZZA 2C8VA 4DUGA 4OQNA 2GWHA 5FBRB 3ASZA 1W0JA 2YJTD 4LCBA 4H9GA 4I4LA 3AKYA 2FZLA 2JCSA 3LX5A 3AUXA 5CYPA 2QMHA 1OT3A 1XEXB 2GK7A 1QF9A 1VECA 3W6PA 4JL5A 3P20A 4RCZA 4DKXA 1E1RD 4HB0A 2C9CA 4LC1A 5FTNA 5KSZA 3I4LA 3SQWA 3PVSA 1YR6A 4DCNA 3BAFA 3UMSA 4ACBA 3AM1A 3K70C 3NBYC 4IDNA 2HT1A 2NGRA 3LBHA 5IRCD 3PFIA 2RGAA 4YC7A 3K9LA 4HAVA 5CJ2A 2CMKA 1U81A 4OI1A 4LDJA 4PAOA 2JLUA 2PCLA 3J81k 3ZQ6A 3E2IA 1ZRHA 2ZYTX 4DEYA 1U2RA 4IOKA 4P4UA 5LPNA 1PLLA 1NLYA 4A4DA 4BRUA 1HYQA 1KMQA 1W4AA 2Z43A 4GPTA 4OHVA 4RZUA 1ZM9A 1SGWA 3VR3A 3DMDA 2WKQA 3OIWA 4KVAA 3UWOA 3LA6A 4IHQA 3PUXA 5AUPB 2VSXA 4QHSA 5DI3B 1IN7A 3W3ZB 3VU9A 1YVDA 1ONBA 4WZBE 3PEWA 1E0AA 3GJ7A 3X1ZA 5GJVC 4AK9A 1II9A 5J47A 3PV0A 3CPEA 4MKGA 2QQEA 2ZANA 4MUBA 4JLOA 4Q1CA 4W5JA 1E32A 1GNPA 4V0NA 3VQTA 1DOAA 1XMJA 4CW7A 2BCGY 3UMRA 2BVNA 4KFRA 3BFXA 2NQ2C 1XF9A 5EXSA 1SVOA 4O2RA 1CR1A 4DVGA 2GCOB 3GLIA 3HU1A 4IDOA 3TQCA 5EJEA 2WJVA 1BYUA 1KOFA 4EPTA 4PC2A 2EW1A 3TR5A 1G6OA 4XTRA 3L43A 4TLBA 4JLDA 4L16A 3TUZC 3OZXA 1TEXA 4TT3A 1P4SA 2ZUBA 4A36A 2NO0A 1XNJA 2FDCA 2XGJA 3MSXA 2YNMA 3I5YA 1ZW6A 3AH8A 4M1TA 1IAQA 4W9MC 4UKDA 1E1QA 1OKKD 2A5DA 2JLQA 3B9QA 4Q4AB 3R9IA 1NBMA 2ATVA 2XX3A 3AP1A 1E9EA 4GZLA 2D06A 2YWFA 3AQ4A 1OFUX 3Q7QA 2XAUA 4KFSA 1QHXA 1U0JA 1EG7A 2B8WA 3CZPA 3LVQE 2FEMA 4JIMA 3C8UA 3WMFA 1GILA 2Z4RA 4GDFA 4LV8B 2VP9A 2PH1A 1OSNA 4L15A 4F7WA 3GLGB 1P62B 1XDBA 3VFDA 4RCYA 1CJTC 5HE8A 2W58A 3JVUA 1XWIA 5DNYB 1TF7A 2HF8A 3SS8A 3Q9LA 3QPVA 3QPWA 3QG5A 4NH0A 4HAZA 1N6PA 5BQ5A 2J0UA 5EE5B 2OFOA 1ZUHA 1SKYE 1CTQA 1NKSA 1PVOA 2QP4A 1DAFA 1G5TA 2WJGA 4TSFA 1SVKA 2J45A 1VCIA 3QKRA 1F2TB 5J40A 1NN5A 4U5XA 3FOZA 2QA5A 1FZQA 4NCIA 4ARZB 4HLUC 3F5FA 1EX6A 4P0TA 2BV3A 3LV8A 1T91A 2WPDA 3IDQA 1FL9A 1NJGA 1EFRD 3TJZA 1GVNB 4OHZA 3A4LA 3AB3A 4P31A 1IM2A 2JLVA 3LW7A 1KKMA 2XB4A 4UJ3A 1NP6A 4PHFA 2G1KA 1XD9A 2I4IA 3C4JA 3RWOA 5JHGB 2RKOA 2IEYA 3W9YA 2P0EA 3FHOA 4IFBA 1HUQA 1L4UA 1NN1A 3PXGA 4BFZA 1P9RA 1YZGA 5FBVB 4NTZA 4F4IA 3SJBA 4N3NA 2HCJB 3THXA 3KFXA 1XCGB 4TLEA 1OE0A 2WTUA 2MSEB 2OV2A 1O3YA 3GLIE 2DPXA 2QRNA 2JLXA 1W49A 4CRWB 3RNLA 4RVCA 1KI8A 3SOPA 2AKAB 3QG1A 2J0SA 4IOMA 2WWIA 4YMWA 4BASA 5IT5A 3KJIA 5FTKA 5BWMA 1EWRA 2CLDX 1IXZA 4EPYA 2NO9A 4LBZA 4H1UA 1X8KA 1DAMA 2FEOA 1VYTA 1AA9A 2OAQ1 2QAGA 3AV0B 1DAEA 1XBTA 4LJ5A 3WMGA 1E2DA 1GNQA 4JLPA 2RGNA 2VHQA 3QXHA 4WBSA 4LV6A 3ADBA 3FHTA 1NBME 1X1RA 4Q19A 3Q5EA 1OJLA 1Z08A 4MRVA 3KUCA 2IXEA 2G88A 1GRNA 2EFCB 2W6JD 4Q02A 1NLFA 4ASUA 4AY2A 3I8XA 2GJAA 1DAHA 1D9XA 1KK0A 5SZHB 5F98A 1NSFA 1XMVA 1G8FA 2QMUA 5IK2D 1KZGB 2GJ9A 1SVMA 3Q85A 4Q9LA 3E1SA 5EZ6B 2GETA 2XJ9A 2I1VB 1GFIA 2J7PD 3C7KA 4FMDF 2ZRJA 1GM5A 2YVUA 4YLGA 3A1UA 4HUQB 1JNYA 1X86B 1IN8A 1QRAA 2FF7A 2CHGA 3C16C 4Q4JB 1JXMA 3FKSD 1G8HA 2VH5R 1TADA 2W2XA 4C0KA 3EIEA 1XD2B 1XJ0A 4HLQB 6Q21A 1P61B 1JR6A 2QE7D 1GWNA 3VTKA 3A1VA 4LWZA 4M1MA 1G16A 2FX3A 2H18A 1MRNA 5HKKD 1LVGA 2NZJA 2ZS8A 2AD1A 3RHFA 4ZDIA 4HB3A 2AXNA 4HEJA 5UKDA 2ORVA 1F48A 5B58C 2H5EA 2IS1A 4JMPA 2D74A 2A3RA 2C03A 3KB1A 1EWQA 3SFZA 1UF9A 3IHWA 4F4CA 1E9BA 1R8SA 5DHAA 1FFHA 1VKJA 5AJYA 3WY9A 3B1XA 1CS4C 1E2IA 2BJWA 3OAAA 4M1SA 4A6XA 1FPMA 1WBBA 2H8KA 3I73A 3AVUA 4ZI3A 4ON9A 2CK3D 4C0HA 2JIZA 1JXOA 4CEIA 2A30A 2ZR0A 621PA 2X2EA 1ZU4A 1ELOA 2GBLA 1UADA 5K8UA 1ZUNB 4Z8YA 1GDDA 3IGFA 2XZPA 3OF5A 3EW9A 5KSPA 4B3CA 2J7KA 1TL7C 4M53A 4M9QA 4AG6A 5DISB 1XFAA 4Q1BA 1R0YA 4IVPA 5K8TA 1JQLB 1N3BA 2J1LA 5HR5A 4LYFA 3G0HA 3SYNA 5J4VA 4QM7A 4PPNA 2ZVQX 1O87A 2ZEJA 3SC3A 1S9HA 4AC9A 5CITA 1U9IA 3KX2A 4EPRA 2V6IA 4PTLA 4PQYA 2ZJOA 4GBMA 5FPHA 4HZUB 1PZNA 4I1OA 2ZSEA 4P3YA 3THYA 4B2LA 1TUEA 3ZLJA 3ZGXA 4MRRA 1VHLA 2IA5A 1BS1A 1DBSA 1QVRA 3GQBA 4IDQA 2WKRA 4EFMA 3K70D 4EJSA 1AS0A 2O8FA 2LWIA 3FTQA 3UMFA 4JSYA 1WQ1R 3LBNA 1XTJA 5F2EA 4JLKA 1H8HA 2H92A 4TLCA 5DYGA 3PJRA 2AN9A 3D3QA 3BXZA 3KDSE 2CBZA 1YHNA 4Q1EA 2FPMA 2ZM5A 1FOEB 3CWQA 4UNNA 2QROA 3CF0A 3LLUA 2IK8A 1AKEA 3GMTA 4HLDA 2WMNB 1QHSA 2YC2C 3TR0A 5DE3A 1KI1A 1N6OA 3B13B 1T6NA 1GKYA 1QG2A 4TLDA 4GOKA 5TARA 2BMDA 4D4LA 4O3MA 2OE2A 3B7GA 4DHEA 1E9SA 4D25A 5LD2B 2ZRDA 3A36A 1JECA 2IWHA 4G5SA 4CT5A 4JLNA 1ZJ6A 4DRZA 4W7SA 4C2UA 4AD8A 3QBTA 2GESA 4KVGA 4ITRC 3VR2A 2QG6A 4DLXA 4FXPA 5DYIA 5FR1A 4KI0A 5JFGA 4TT3D 4EPWA 4FCVA 4ZCMA 1DO2A 1ESNA 4M1KA 1LY1A 5FOUA 3TSOA 1DG3A 2DWOA 4K46A 1ZMXA 1IQPA 1P2SA 3ZVRA 1NBMD 2OLJA 2Q3FA 4D6PA 1FNNA 1TMKA 2ZE8A 5TDHA 2WICA 2EWVA 4LHVA 4IXNA 2MSDB 1OIXA 3FE2A 1KIMA 3KKMA 4KV9A 1Z83A 3PUZA 4DB2A 3BIFA 4FW9A 4ACAA 5JJIA 4PXAA 1D6JA 3FYHA 4FMCF 2F1JA 3SBDA 1ZBDA 2V6JA 3UK6A 3BOSA 2WVJA 4D4MA 3KQUA 4RD1A 2JGNA 4A1FA 1ZM4A 3H1TA 1CF4A 1CULC 4CEJB 3QSYA 2BMEA 3SR0A 1HT2E 2PZEA 3W6OA 3R8FA 1CBUA 2G6BA 1GIAA 1U94A 2B21A 2EFHB 4ZKDA 4BEBA 4US2R 5JRJA 4TSFD 3GJ4A 4KBFA 3OFNA 3O47A 4M1YA 2B6HA 2IT1A 2VHTA 1NRJB 2VP2A 2HUPA 5KDLA 2BBSA 4JVLA 5FPTA 2CE7A 1ZP6A 1XCMA 4FN5A 1QG4A 4NP6A 4DDTA 3NKVA 2D3WA 1PJRA 4IEEA 5J5CA 4DT1A 4TYWA 4Q5IA 2CVFA 2RMKA 4TMVA 2WWWA 5LBIA 3U7HB 1F2UA 2QAJA 1II8B 4M1OA 3GEEA 4PR0A 4TTQA 4KXFB 221PA 2GXUA 2CLSA 2O8EB 2VP6A 4PANA 4BLPA 2OCBA 4W5HA 3R7WB 1G6HA 2CCKA 1N2CE 3T1QA 1SVLA 2JA1A 1NNEA 4BQSA 2VEDA 5KPDA 3QF7A 1GAJA 1G7SA 2CL7X 1EFCA 3MWKA 3NWJA 3DVLA 4LV5B 2A5JA 2F43A 3OEED 3QE0A 2IHYA 1ZYUA 4RFSB 1IXRC 1TAGA 2J87A 3PUVA 2QZ4A 4XIGS 1Y3AA 1P75A 2CLCX 2D7CA 3CRVA 5ANRB 3WBKA 3BH6A 4B33A 2YKGA 4Q01A 3TBKA 2ZR9A 2BKUA 3A1TA 4DJTA 2A5GA 1OW3B 4BEJA 1QHYA 2XZOA 3CRRA 5AJZA 4YONB 3T1VA 3TNFA 3RS3A 1COWD 1LTQA 4FWIB 3PIRA 1AM4D 1JEDA 2ZXUA 1OYWA 4MGIR 4BE7B 1GG2A 3HYTA 1CJVC 4C3ZA 2DHRA 2W0SA 2FSFA 3FFAA 4OQXA 5DHFA 4CDGA 4CEHB 1Z0JA 3JVVA 1SXJA 3K0AA 1RRFA 3ZZTA 4K81B 2WMOB 1Z28A 5FL3A 5TV2A 2G83A 1I4TD 4EFNA 1JR3D 8OHMA 4Q1FA 4WZ6A 1JPNA 1VMAA 3ND8A 4A0HA 3IBYA 3QQ5A 4DCUA 4MYUA 2BKEA 4N0EA 5CIQA 4ZPXA 1XXHA 4KFUA 1GRRA 4TL6A 3GLFB 1XPOA 5DN6A 2FSIA 2HJGA 2F7SA 3AUYA 3IPYA 1E2LA 4Z8XA 4R9UC 2VP5A 3IO3A 5GVSA 4TQAA 4XOIA 4DLUA 4X8HA 2IBMA 4LBYA 2EVWX 1LV7A 1DE0A 2ZI9A 4L5BA 2KB0A 4TZ6A 1I4DD 3OEHA 5KU1A 1WE2A 2P6RA 5J4KA 3Q7PA 2JLZA 3BK7A 4NHOA 1VYUA 1L4YA 3KJEA 1QZXA 3ZIAA 3WMEA 3W8NA 1IONA 3DZDA 2QGZA 2R6DA 1G4UR 1P2VA 3TSWA 1E94E 4G3XA 1T8TA 3ICEA 4PAMA 3NXSA 2WIAA 4ZCIA 3CB4A 1QHHA 2NPIA 4WVFA 1M74A 3RC8A 1D9ZA 2QM8A 3CO5A 1TX4B 2H17A 3SHFA 5KNBA 2O8CB 4Q47A 4BFVA 1E2MA 1RE0A 1OH7A 4Q4LA 5EE3A 1R0ZA 3LXRA 4JBYA 1RJ9A 5KTYA 4WZAE 1SKYB 2QNRA 2SHKA 2R44A 3B1YA 4MYCA 4LZZA 4NYIQ 5AUNB 1JI0A 2QP3A 3K70B 2R9VA 3X2SA 5CK4A 2DCUA 5C46F 5L3QB 3LVRE 5F9FA 2E87A 4EFLA 2YOHA 4R71A 1WRBA 1VCOA 1RW4A 2N46A 3EG5A 4Q7MB 3GPLA 3NBXX 3CH5A 2PMKA 3GEIA 2AKYA 1XTQA 3IQXA 1AZTA 4O0MA 4V0LA 1E6CA 4EQ6A 3VU9B 4OBEA 1KNQA 4I81A 4F4JA 2FN4A 2NO6A 4MA4A 1N6IA 2F55A 2OCYC 1GL7A 1VG9B 1X6VA 4US1R 3A1SA 1Q57A 2HLDD 3UG7A 3B1WA 4BLOA 3FVQA 4QGFA 4AURA 1MO5A 2RHMA 1KMHA 3EWSA 1K6MA 4WOPA 1U98A 4KJZA 3U5ZB 3AVVA 2VA8A 3TH5A 3A37A 2H7VA 1FMLA 1FTSA 2XSZA 2WOOA 2GRJA 2OXCA 1CEEA 4URWR 2VP0A 4DLSA 3GLIB 4JLAA 4RY2A 4NYMQ 2QBYA 1UM8A 1IJFA 2ZYWX 2VHJA 1SXJE 4DLYA 4FCWA 1J99A 2XTZA 4R7ZA 1WMSA 2IYRA 1HH4A 3D31A 4PHHA 1ZD1A 4KO8A 2VP4A 4TL9A 4B3XA 5KSYA 1ETUA 4XD7A 2YZ2A 3RRYA 4FINA 1H8HD 4LGMA 4KYIB 1RC8A 3GFOA 3GLHA 1XXHE 3NC0C 3MFYA 4B6FA 1OHHD 3AVQA 4NYIR 3S1AB 3SE0A 2QP9X 3DO6A 3THWB 2ZRMA 4B47A 4F93B 1QHGA 3FWYA 3TLXA 2HV8A 2NG1A 1BIFA 2ONJA 2GZHA 5L3VA 2GEUA 4P4TA 1KY2A 1GUAA 1T3SA 1D2MA 1W7AA 3K0FA 4DLZA 1F3OA 3WRYC 4HB2A 3NH6A 2DYKA 3GD7A 3H4MA 4HI0E 4Y0AA 2BM1A 2QTVB 4U7DA 5J4YA 3M4YA 1T0JB 521PA 1CR0A 4ZIRA 4GFDA 4IW3B 5D3MB 3ETLA 2ZE6A 3X1XA 3AVOA 5AR1A 5JEDA 4EUNA 3RC3A 4AYWA 4C0BA 3AEZA 3MWYW 3UWKA 1GP2A 3KKPA 4LRWA 2A2ZA 4DSTA 4FMDB 3R9XA 5IF9A 2WJHA 3IILA 2W2TA 1OH8A 4OHYA 4HATA 4NYMR 4KAXA 4R2IA 5FL7D 3N70A 1UBCA 1N6LA 3HPRA 2GA8A 3BS4A 3V4FA 2ZYUX 4WXRA 3KQKA 1WBDA 1UKYA 1F5NA 2X8AA 5KDOA 2RGBA 4QHYA 3RVBA 1QHIA 4EDHA 3T1OA 2P5SA 2IUSA 4M9ZA 1XPUA 3C14C 3U4QB 4EPXA 1U90A 5F9HA 1ZCAA 2FGJA 3AF2A 2J9RA 3QNUA 2WOJA 3LNCA 2FNAA 2BBWA 1E2GA 4PX9A 3ZVNA 1TQ2A 3WHLA 3U7FB 3I32A 1M7HA 3D7MA 1Z0DA 1FTNA 3EA5A 4AKIA 1I4LD 2JJ8A 1KAGA 4RD3A 3I8SA 2ZJAA 4G0NA 1EFTA 1KAOA 2BEJA 2AK2A 1E98A 2WJYA 2KI5A 1FMJA 4Q18A 1H8ED 5EUMA 5FPSA 1X3SA 3EPLA 1ZUIA 4PHGA 3OIVA 1RZ3A 3LD9A 5FI1B 4JLJA 4QC2A 1XJCA 1Q3HA 1G5PA 5FBLB 3T1TA 4NZYA 1AGPA 1US8A 3QY0A 4GP7A 1OB5A 2DWQA 1L2TA 1A7JA 2HXSA 1KZ7B 5GADl 1U0HC 2ZSBA 1I2MA 1OV4A 1TQ4A 2IHBA 4BLQA 2WWFA 4PSAA 3U44A 1NIPA 1OYYA 4TLAA 4A8JA 1KGDA 5A5GA 1JALA 1NMYA 1JBKA 1VHTA 5GJBA 1L8QA 3TW8B 4YMSA 3L2OB 4R2HA 3O8RA 4GMXA 5G3ZA 1ESMA 1YRBA 3TW4A 3PUWA 5JEEA 1A1VA 5KNDA 1ZM7A 2OT3B 4Q4HB 4XWKA 1KO7A 4XVQA 1D2EA 4TYNA 2TMKA 2ATXA 5CM8B 4RKEA 3SBEA 3TE6A 4O25A 1NN3A 4BFUA 4CGZA 4UNQA 4RD0A 2BOVA 2GHIA 5HCIA 1HEIA 1T0HB 1GSIA 2VBCA 1E0KA 1R5BA 3QVUA 4UXJA 1CRPA 2ZUDA 4LJ8A 2V7QD 2DR3A 1GKIA 1TEVA 4IRUB 2ODBA 2ZU6A 5FOVA 2KJQA 2ZRCA 4MITA 4UXHA 1OLOA 2ZI5A 5DI9A 1OH6A 1E99A 1KO8A 5CDFA 1UDWA 5GVRA 3ZD6A 4DDVA 3TSZA 2D4HA 2R6FA 2R8RA 1Z0KA 4WXPA 3SDZA 3ZVLA 1SXJD 4JKIA 1TQDA 1KDPA 3B1VA 2H16A 5FPYA 1IBRA 4Q48A 2WWYA 1E2PA 1NVVQ 1IXSB 1BH2A 2GZAA 2OCPA 2ZRPA 2DFKB 2VHUA 5AK0A 2AX4A 4QOSA 4A6PA 2FFAA 1Z2AA 2G3YA 4G01B 4DBLC 2JJ2A 4P4SA 4LYJA 2QPAA 3FKQA 2REBA 4B3FX 1FP6A 3B8HA 1II0A 3FPAA 3P4YA 2G0NA 1NMZA 4IOLA 4LHZA 2W6IA 4GI7A 2C99A 4DCVA 1G7RA 2BC9A 4LYAA 4B74A 2IYZA 4TWZA 3OEHD 4YDHB 3B6EA 2Y8EA 2IYWA 2QAGC 3BRWD 3KJGA 2W83A 1Z22A 4HLUA 2RGNC 1DAGA 1A2BA 1NN0A 3AGQA 3L0IB 5IHPA 5KYKA 3V9PA 2O8BA 5CB8A 4BZQA 1Z2CA 1EGAA 1ZVQA 5B30A 4BPBA 1DARA 4I1UA 4NL4H 1YRAA 4PHTA 2J0QA 3MWLA 3EZFA 2VTKA 3FMIA 2PBRA 2FG5A 3CX6A 4MUAA 3VX4A 1K5GA 2QM7A 4FMCB 1P5ZB 2Z4SA 1KHTA 2RGEA 3BFKA 3AF3A 1XPRA 2AWOA 4Q66C 3R20A 4B34A 2XXAB 2W0MA 3F8TA 3LBIA 1S1CA 4E03A 2B92A 1Z8FA 1IY1A 2FFBA 4EJSB 2O8FB 3K9HA 2QGNA 2KBFA 1NVVR 1KK1A 1XEWY 2YWHA 1GL9B 1NG1A 2ZE7A 4GRAA 4C9BA 4D26A 1KTVA 4BLTA 5L8VA 1ZD9A 3BD9A 3P26A 3KQLA 4BFWA 2RH5A 2NPFA 4HDQB 3OE7D 821PA 1T3LA 5CYOA 5LB4A 5CJPA 1G3QA 2AR7A 4QGHA 4ZV4A 4D80A 1FUKA 1KO1A 2ZIAA 3QIAA 4JT2A 5BXQC 4Q9JA 2WJIA 5JECA 2ANBA 2FMXA 1AZSC 2QT1A 3BC1A 4A0FA 4JVMA 3RRNA 1G8PA 5AUQA 1DAIA 2GZDA 4LI0A 2PJRA 1D5CA 2JJ1A 4EPVA 3GLGA 1MO4A 3U7GA 1OB2A 3ECCA 1UEJA 4JVNA 4IDPA 3SEAA 5BYKA 1MKYA 1BMFA 4B32A 2EYQA 1E96A 2VQSA 1PUJA 3CRQA 2IL1A 4YXWA 5C4GB 5L3RA 2GCNA 2O0HA 4JL6A 1OXUA 2AHOA 2W00A 2AK3A 2GBLC 4RZ2A 2JLYA 4ZCLA 3N2EA 1FNMA 3I92A 4E09A 4Z1MA 1J90A 2CNWD 1RRCA 1WF3A 4ARZA 4Q00A 3RS0A 5EP1A 1HE8B 1S9DA 4ZDJA 1Y63A 4JKYA 5JBQA 3M6AA 2FH5B 4F92B 1K8RA 2KBEA 3K8YA 3P27A 3T5DA 4B3BA 3ONWA 2QUZA 3K0CA 5KOYA 2BMFA 4DUGD 1LS1A 3KTAB 1U9IC 4K8OA 1W0JD 1W4CA 4MKFA 4OHXA 5E7IA 3A58B 4HAUA 5EE1A 4D81A 3B82A 3U60B 3I62A 2CXXA 1HURA 2QI9C 2RHDA 4C7OB 2OILA 1AKYA 4DSOA 2J46A 2ZRNA 3ZS9A 3H2YA 1T9HA 4B48A 1EXMA 2ZRFA 4KYUA 3U3OA 4EJSC 3AVWA 5AJVB 5P21A 1Z0IA 5HE9A 4MH0R 1LFDB 4BFYA 2BHRA 4BWYA 1DELA 1WXQA 5EXTA 3W5IA 4UNSA 1P2TA 2Q6TA 3WP0A 1XMIA 1RRPA 2AXPA 4O2LA 3B85A 2UZ3A 2LKDA 3L8ZA 4AIIA 1A5TA 5FTMA 3RS4A 1E69A 4P32A 3PUYA 4HAYA 4Q9HA 3MUFA 2R62A 1Z29A 1UKEA 2OO7A 4V0MA 1JJVA 5JI3E 5LB2A 1KK2A 3RSLA 1N6HA 1EX7A 1R2QA 4RKFA 3RANA 5E3HA 5C1BA 1UBFA 4UNRA 1E2QA 1N0UA 3IIMA 3ZDQA 4HAWA 1NL3A 2GVDC 4DLVA 1G21E 2JDIA 1JAIA 3BB1A 3UANA 3TKLA 1XCPA 3R8CA 3IEUA 2WM9B 2K5UA 4ERNA 3MJHA 3LDAA 5KNCA 2GXSA 2V1UA 2GXQA 1OXVA 4Q1DA 1UDXA 2BBOA 4HUTA 2LKCA 2PX3A 1KKLA 3SU8A 2IW3A 3EIQA 1E9FA 4LPSA 1GKUB 4XJXA 2GXAA 3HU3A 5HZKA 1SVIA 5M04A 4OK3A 4LBWA 1E9CA 2ZSFA 1N5LA 1XD2A 5HTKA 4JBXA 4XWAA 2OBLA 2XITA 4FWTA 3IQWA 2XOKA 3BGWA 3AF1A 1T8UA 1ZM3A 5E7MA 1NVUQ 1R5NA 1DTSA 3LAWA 1G8GA 3U2QA 4DCTA 3OIUA 3CM0A 3NEYA 3SYLA 2C9OA 3GFTA 4MKIA 1SHKA 3RSOA 4X8MA 1E1QD 1N5JA 1Q1QA 3BB4A 3QUSA 2RGDA 1YZTA 1RRGA 3Q3JB 1E1RA 2REOA 2GF9A 2PEYA 3TVDA 3NTUA 1FQKA 1N6RA 4M8NE 1J8MF 3ZVMA 3QXXA 5FUYA 3ZZ0A 1SXJB 1G3IA 4QJ5A 1NVXQ 4B3DA 1UEIA 1KI6B 1R8QA 2ERXA 4A15A 2DBYA 2FV8A 3DL0A 2PX0A 2ZJBA 1DAKA 2PLRA 2VLIA 1W4BA 3NVAA 4URXR 2ZUCA 2BCJQ 2FZ4A 4TYYA 1U8AA 2RGCA 3LH5A 3CONA 3EC1A 2H57A 1NF3A 4HDOB 2KE5A 1FX0A 1E2NA 1X8JA 2IYYA 4Q21A 3JZMA 2F9LA 1EK0A 4PC1A 4TMKA 4W5WA 3RABA 3W5JA 3EPHA 4AI6A 3P32A 5G3YA 2WJJA 3I72A 1SVWA 5TB5A 1RIFA 1A4RA 3KFVA 2XEXA 5JWRA 1IY2A 1IOZA 4PSKA 4LBVA 1MV5A 5BN3A 4G5OA 1YZLA 4V0ME 1LB1B 3QKSB 2IF2A 2Z5FA 4B43A 2J0VA 2WPDD 3EC2A 121PA 2D2EA 3K09A 4I1VA 1YE8A 3WHKA 2GCPA 5B2ZA 1BO6A 2Q3HA 2W2VA 2V3CC 1P7CA 4HZUA 4NPHA 4JLVA 4LC0A 5FOTA 3BH0A 1XTKA 1E0SA 2QTFA 3BE4A 1T5LA 1WCV1 3BBPA 4N1AA 4OI0A 1OF1A 4KSBA 3Q72A 4QBIA 2JJ2D 3LXXA 4AYXA 2HYIC 5L3SB 3IIJA 1HQCA 4OL0A 1KI4A 2C9YA 3WP1B 1G3RA 1JEEA 2YWGA 3QVVA 2H1LA 4GZMA 5FBWB 4PC3A 1Z6XA 4NCJA 3U3RA 3VHLB 4PSVA 4PO1A 1VYVA 1ZCBA 2A7QA 2IF0A 2OG2A 2YOFA 4ESHA 2D2FA 1PV4A 3QF4A 4BLRA 3PEYA 2FJUA 4MDEA 2F1IA 4QJ4A 4URYR 4BFXA 2FA9A 4S2EA 1KMHB 3LWNA 4MGKR 3GCGA 4RJLA 1ZU5A 2ZREA 2QSZA 1SXJC 2V1XA 3KJHA 4KFTA 1MRSA 1W36C 2NO1A 3HR8A 1CJUC 4LSGA 3KQNA 4M9SA 1S1MA 5C18A 2IS4A 3UIEA 4FD2A 4ASUD 5KPJA 2HF9A 3WBJA 2A5FA 2ZROA 1CLUA 1VIYA 3SI7A 2J5XA 2GTPA 1W4RA 1DPFA 1KI2A 2GNOA 2ZSAA 3DM9B 3UATA 4ZDWA 3BB3A 1G5RA 2RB4A 4B71A 1JPJA 4NMMA 4OK6A 4J0QA 4TMTA 3CPHA 3H86A 4PC6A 1AS3A 3CR7A 4LHWA 4NCKA 1XMSA 2WWHA 2X1VA 2XJ4A 1AGRA 3WYAA 5DH9A 1MO3A 3CH4B 2XTMA 1KI9A 4JVSB 1KJWA 2FPKA 2KWIA 3QKTA 4E07A 1IHUA 2FFHA 1F60A 3BFVA 1XZPA 2ZVPX 1G8YA 3F0TA 2XTNA 3RAPR 1KDTA 2JATA 4GSYA 2I1QA 2PLFA 2QSYA 1P72A 2CJWA 3SJAA 1QHNA 3TRFA 5GJCA 2ZRLA 4URUR 1EFRA 4NKRA 2I3BA 1LNZA 5JWOA 2GEDA 2N42A 2FFQA 4G5RA 3U61B 3HR7A 1SQ5A 1Z3IX 4QGAA 1WA5A 3GP8A 4WAUA 1GITA 4FCTA 4ZIRB 1G3UA 1Q20A 5E4FA 4UJ5A 1QVAA 4B73A 3A8TA 4POAA 4CEJA 1ODFA 3KUDA 4JLBA 3E70C 4A9AA 2ZETA 4I1SA 3VX3A 4YMVA 5JSZA 3QKUA 3CBQA 1N5KA 3X1DA 2QPOA 2O8DA 2Q9CA 3OAAD 2ZRBA 5K8LA 4HB4A 2F9MA 3ICQB 2J59A 1C4OA 4Z1MD 4OQMA 4WA7A 2WHXA 3A1WA 2ZI3A 1N6NA 2QRZA 4B75A 2JIZD 3WRXC 4YMTA 3DEFA 2WBLC 4JLMA 1N6KA 3NDPA 5JRZA 3FMPB 1KI7A 1OXXK 3LQQA 3G5UA 1RKBA 1ZC3A 2X19A 3O8DA 3QEOA 4EAQA 2UKDA 4TYQA 1II8A 1N0WA 4AKGA 2IX3A 1AQUA 2ONKA 2ODNA 2P5TB 4KITB 3GJ6A 3SYKA 2O8EA 3JZAA 2WAYA 2W6JA 2ZSDA 4LJ7A 1VTKA 3R7WA 2NO7A 4I99A 4MQBA 5HPYB 2FPLA 2ZJYA 2QMEA 2C96A 2Q9BA 3CF6R 4JJZA 4PFSA 5IK2A 1XZQA 4IXMA 3IPXA 4OK5A 2WWXA 1ANKA 2J7PA 1HE1C 3NH9A 3TQFA 2XNSA 1KYIA 1GTVA 1Q1ZA 5H1YA 1E2KA 3FDIA 4BRWA 1XX6A 1QBKC 5JCZA 5KDDA 5FFMA 1AIPA 1DVRA 3FKSA 5B64A 2R2AA 2ZRIA 3FMOB 3Q5DA 4KU4A 3PEUA 4PO8A 2UZIR 4AKEA 1OIWA 1YZQA 5CIWA 2KSQA 5EP4A 1YU9A 2QE7A 3ASYA 4URZR 5HCNA 3TUIC 721PA 2A9KA 3W34A 2C2HA 3VR6A 1KK3A 2C78A 4UNPA 2WIBA 3C5HA 3BORA 4BECA 3EPJA 3D8BA 1NIJA 1CP2A 4MGZR 5SZIA 1W47A 5JS7A 1ZNZA 4PPQA 4A8JB 4PZLA 3ZYCA 1XU4A 1RVDA 1IN4A 5CB6A 3VR5A 3GJ8A 1S4QA 3L8YA 3DKVA 2OLKA 4AKHA 2C98A 3TIFA 2IYVA 2NOAA 4LHXA 3B78A 3LFUA 2G1JA 4QBFA 4U00A 3CRW1 2OFXA 4OJKA 3NHAA 3PCRB 1BYIA 2AFHE 2BJVA 4HZIA 5JJLA 5JWHA 3GLFA 1W1WA 2CK3A 3PITA 4BFTA 5BN4A 4NYJQ 1EFHA 1YR8A 4LOAA 3EAQA 1XEFA 4HLCA 4RZ3A 2IEZA 4LJ4A 3TAHA 4LX0A 2J0UB 4DSUA 1C9KA 1M34E 1W5TA 3DZ8A 3NBFA 4C0LA 4BZXA 5E95A 3K53A 3HYRA 3QKRB 1G17A 1Z0FA 1TUIA 3M0EA 1MABA 1FUUA 1G41A 1TU3A 4A0RA 2PT5A 1W2GA 4GOJA 2IYXA 1Z0AA 1UBGA 2QN6A 1R4AA 5BN5A 3WNCA 4LJAA 3GEHA 1SZPA 2GKSA 2FOLA 4C2TA 2O8CA 3TVTA 2DFLA 1GL6A 4X8LA 2EFGA 1P6XA 5EXPA 2IS6A 2GILA 4QL3A 2JLRA 2CHVA 3QBVA 4TMZA 4B3GA 4IOJA 4BZPA 2D7DA 1SULA 1VG8A 1E79A 2PMDA 3VMFA 4D4JA 3W6NA 1W48A 4RZXA 5G40A 3WXMA 2P3SA 2F1RA 4P4SB 2F3TA 5L3QA 1RYHA 1YKSA 3IBGA 1E3MA 4B44A 4FMBB 4DCSA 1Q1BA 1OIVA 3REGA 2WV9A 3THXB 3BERA 1XTSA 2JAQA 2WKPA 4ILEA 1S3GA 5DO9A 2YC4C 5J4HA 3OFND 3DOEA 3L0SA 4NYJR 1CIPA 1ZM2A 2QEQA 2ZS9A 3AKEA 1EFUA 3OHMA 2CCJA 4OQFA 2O8BB 2ZJZA 1OH5A 4A8JC 2ODWA 4UQOA 2ZJ5A 5EUQB 3LQRA 3TUJC 3GLHE 5JZVA 2L0XA 3AVYA 1OXSC 2P6UA 2QAGB 3ND9A 3N5CA 3TGPA 2A5YB 4JT4A 2GK6A 2EFDB 4JZKA 1OFTA 3LRPA 2R65A 2V8OA 5EE9A 4KHZA 2ZRGA 3MRSA 4PZYA 3ADDA 1RFLA 3SJZA 2ZJ2A 3NIBA 3EZ9A 3T35A 2EWWA 2NMVA 4LJYA 1U0LA 3KQHA 5FBQB 2ZAMA 3K9NA 1VDZA 1XB2A 2AWNA 2VF7A 3CZQA 4URVR 2P65A 3S1AA 2VRWA 4QXAA 1TPZA 4LPKA 3GLFE 1U99A 1UFQA 1W0KA 4QNRA 1YZUA 2OXRA 3O8BA 5A4JA 1DG1G 4WW0A 2Z83A 1J2JA 4BUJA 4M9XA 4Z54A 1AQYA 2J41A 4PZZA 4US0R 1J8YF 2FU5C 3B5JA 3IHLA 3P1JA 2C5LA 1G19A 2OCAA 1G64A 1R6BX 2PL3A 1TNDA 4TYPA 1ZNWA 4ZI2A 1KJYA 1XTIA 5C4MA 3EPKA 2B7BA 5C2JB 2ORIA 1E9RA 2ZPTX 4DSNA 3VKGA 4TL8A 1XEXA 4TN1A 1E0JA 4PQFA 1OFHA 1X1SA 2R6GA 5CM9C 5D3MA 1E4YA 4DDUA 1ZD8A 1IJEA 4FIDA 2OBMA 1W5SA 5AJWA 4A92A 2WSSA 5JJKA 2ZYVX 2ZTSA 1NI3A 2RGGA 1P9WA 3U3MA 3KXKA 1W36D 1A82A 2VL7A 2ZS7A 2ODEA 4IEIA 5SZKB 2JEOA 5DSZA 3BH7A 4YQFA 5JCPA 3UKDA 1E4VA 2R6AA 3N2IA 4V0KA 2N1BA 1P9NA 4DLRA 4EKDA 3PG5A 1NY6A 1UPTA 5DN6D 4CEIB 3AVTA 1ZINA 4QG7A 2OZEA 1S8FA 1V5WA 2VPPA 1NSTA 2NZ8A 2WWGA 3RS7A 4Y0VA 4JS0A 4IVRA 2FSHA 2MMCA 3DOFA 5TVKA 3U4QA 1IY0A 3AF4A 2VIIA 5DI3A 4MDFA 4F38A 3CX8A 2ANCA 2OFWA 3ZIAD 2QORA 3U6BA 4A2PA 3DM5A 1PUIA 3IEVA 3VKHA 4D0GA 4D4KA 3I61A 5G53C 2HT6A 3EZ7A 4QRHA 4R98A 2DY1A 5B57C 4E22A 3CKLA 1R0XA 3OEEA 2GCOA 2REXB 3THYB 1JJ7A 4B2IA 1TU4A 1Q3TA 1D8TA 3QENA 3FB4A 4A0GA 2PEZA 5JS8A 4V0OA 4PPFA 5H68A 3RLFA 4QNMA 1P73A 3L0OA 1P60A 5TY0A 3CNNA 5EZ5A 3KB2A 4FI3C 3QJYA 2FGKA 4WIAA 2B7CA 1NKTA 3KXLA 3CPJB 2G0TA 4IDHA 5JMTA 2YOGA 2XNDA 3T15A 5LDDC 1COWA 4HSEA 2MSCB 2AD5A 4Q4AA 4ESVA 2P6NA 1ZAKA 1ZIOA 4JJKA 3ZJYA 5KHOC 4PPGA 1MOZA 5DLQC 4KODA 4QBHA 3EXAA 3IIKA 2AFIE 4M22A 4AG5A 1DO0A 5CLQA 5FUWA 4DC9A 3RWMB 1JR3A 2OM2A 2CVHA 4Q4HA 2DB3A 4UXIA 4D2IA 3M1IA 3MAAC 4Q7LA 4M21A 2ZRKA 4GMDA 3NC1C 4OKSA 5KUTA 2JASA 4G5GA 4JL8A 4L8GA 2XSZD 2GAOA 2IC5A 4X8OA 5CDFE 4MGYR 2OEPA 4M1WA 1E2HA 3C5CA 1FP7A 1TTTA 2QT0A 1GOTA 2NIPA 3QEJA 4XD7D 3A4MA 2IYLD 4B2PA 1SVSA 4PO9A 4KLZA 3WNBA 1PLKA 2GVZC 1KDOA 1F2TA 2GJSA 1W2HA 1R7RA 3CUEF 4CYMA 1Q1EA 3K0CC 1SHZA 4LYHA 3U3KA 3ZZUA 4EIWA 1RYFA 1QDEA 2XZLA 2HDNB 3H84A 3QI2A 3PR1A 3NBZC 1KJZA 1KY3A 4XH9B 2YHSA
chains in the Genus database with same CATH superfamily
2Q07A 4P38A 4NNOA 3OU7A 2ZB4A 2HYDA 2QHXA 3CLVA 1IBMB 3QXCA 1TD9A 2ZJ6A 5CB0A 5E6SA 5SYNA 2Z4TA 8ATCA 2RONA 4B76A 2FZWA 3EASA 2ACEA 1ZRNA 1VE3A 1YB7A 4W1UA 1SXIA 1XRJA 3SNHA 4RS8A 1I94B 3FFTA 3MG9A 5H8WA 1E79D 1YQTA 5FIUA 3N0VA 3FRHA 1V7ZA 3TCKA 1EDBA 2QRPA 3DAHA 3S3TA 3QH4A 1RAHA 2OU2A 3SS7X 1IO2A 3MJRA 2NAPA 1DDNA 2EFEB 5EQTA 4EEXA 3GYHX 5LN1A 3C3BA 1XVTA 3BPVA 5FFFA 4G84A 3K0AB 1KSJA 3ZXXA 1Z6GA 5TF4A 4LJ6A 2ZITA 5JNLA 5FL7A 4MRNA 4JC0A 5KOJB 4GUAA 3RDIA 3DXXA 4DIEA 1R5ID 1Q0RA 4IHTA 3RUAA 2QGFA 1EXNA 4ZYTA 3DHWC 1DFHA 1JZTA 2AGVA 4H3SA 4NLLA 4J7UA 2O8NA 4LNUA 1PU2A 4ZT7A 4ETIA 4QFDA 1NQOA 1N5MA 1V5IA 5TJJA 3P9KA 1L7VC 4P84A 1P4RA 2XADA 2ZB3A 2FMFA 3GJ0A 2VJLA 5AXCA 3T12A 3COYA 4KWIA 4PC7A 2PHZA 4F91B 4AROA 5ILGA 2ZPUA 3BUSA 4PYJA 4H2DA 1Q17A 2C2XA 4DDHA 3IVRA 4LZPA 5LD2C 3ELKA 2R5NA 3LBYA 2H4WA 1OOEA 4P5OA 1AK2A 1V41E 1QRYA 5CD9A 4KNYA 2ZRAA 1F14A 4ONEA 3RREA 4HDCA 1DEXA 1F36A 1VBKA 3LX8A 3PWKA 4HF7A 1PG5A 4CM4B 3X2QH 4RGVA 3VU3A 3JCUC 4CVNA 4P86A 1HRKA 3F1LA 1C0PA 1Z39A 3ER8A 3LSHA 4HTFB 2WU4A 2FPSA 1XTAA 1E60A 3EUKL 1VE6A 1P1CA 3ZMSA 3HUGB 2E6UX 3NGLA 2EQBA 4TKUA 5AFSA 3PXUA 1FBSA 4BE1A 5FUXA 2Q8QA 1B0UA 4QDTA 3ESWB 4I7HA 2PLYA 4EY5A 4CZ2A 2XGOA 2R7AA 5BRNA 1QVTA 4NZOA 4NDZA 1KP9A 1VMKA 2CE2X 3ECOA 4MYTA 2HHHB 2BFWA 1QFXA 1QU3A 1PDNC 4BWFB 4A03A 2V8BA 1D2NA 4JP2A 4GL2A 3GOHA 4B4OA 1E1KA 2AVNA 3DAGA 3GTLJ 2HY7A 3L46A 4YECA 3ETJA 4DQVA 1V11B 3OFJA 3UG6A 2JEZA 3IUYA 3D0SA 3FZGA 2CRGA 2PGNA 4MUYA 3JRWA 2NV0A 3BVPA 1PT7A 2AO9A 4TT8A 4DZZA 1IMJA 1QS0B 3EGXB 4TRNA 4AN0A 1QWSA 3DEIA 1OT3A 4YELA 4YV7A 2HQOA 3JALB 1QF6A 1I0ZA 4ACBA 5T3UA 3LBHA 2WC1A 3HSSA 2B0JA 4NAUA 3L9FA 3K94A 5LPNA 4DTIA 4FGZA 2IHJA 1MDMA 3DMDA 5KQSA 1PZHA 3K2QA 4ND3A 4IJVA 3WLTA 4BL0B 5GWXA 2HLNA 3VU9A 1XSEA 2FETA 5CFMA 2ZANA 2JGAA 1GNPA 2NVQJ 1YMQA 5HZGA 2B4TO 3RJ9A 4AJ9A 2CJYA 4NMXB 4MAAA 4EPTA 1VL2A 1FF9A 3IR5A 1J4AA 3WE7A 3DMGA 2G0AA 3U7JA 1IAQA 4AUXA 1P1HA 4C3VA 1IULA 3R9IA 2JK1A 5CDGA 1L4KA 5KVSA 3ZK9A 4EY3A 1I0LA 3AQ4A 2CMPA 2XAUA 3PQ5A 2B8WA 2BGTA 3WMFA 2AZDA 4ZAZA 3UJ3X 4LV8B 4YCAA 2RHHA 2JIBA 4BAUA 2I3AA 2PUWA 3CUSA 3GG9A 9ABPA 4IINA 4YJKA 1N6PA 2CFOA 3ZX4A 2UZKA 4V1CI 3VR0A 3G5MA 4A1OA 2BEWA 1Q0SA 3HXKA 3A02A 4KH1A 3J7ZI 1ZI6A 1KYTA 1O94C 3WTCA 3TJZA 4HNAA 2XAJA 2WI8A 1PBNA 3Q8LA 2JSCA 3PXGA 3EPZA 5EIFA 3DDWA 3EVCA 4N3NA 1DMSA 1TWAJ 3PUKA 4YV1A 3NV7A 1S2OA 3DVQX 1H6BA 4LE2A 3ZQIA 2V9KA 1POXA 5HS7A 2A92A 4LBZA 4B84A 1VYTA 5LXTF 3E9CA 3G2LA 4RVGA 4JLPA 1APLC 3BKXA 2GLUA 2R5ZB 4FS3A 2D1TA 2QLTA 4ZDOA 5IK2D 1NZFA 4NC9A 1SXHA 4IFIA 2GPAA 4YLGA 4I8IA 1U7PA 3VPGA 4OQQA 3FKSD 1ZWLA 2CLMB 2G40A 1EPUA 1LI5A 2CG4A 4HLQB 4HDNB 5D7NA 1JR6A 3VTKA 3A1VA 4M1MA 5JYCA 1S6YA 3VVLA 2ZS8A 3JZDA 1K83J 4FFRA 1N5DA 2H5EA 1YU6A 3O03A 1P45A 3WQSB 4S1TA 2AN4A 2HQNA 1DFGA 2J5QA 4ENWA 1GGEA 1W52X 2XF7A 3HABA 4M1SA 3TGNA 4NOLA 4A6XA 4C5CA 3QEKA 2H8KA 4A69C 3IT0A 3L8CA 4QLBA 1LD3A 2GM9A 3OX4A 3RHZA 2PH7A 1AV7A 1A50B 1B41A 2J7KA 1TL7C 2VJMB 3A2KA 3ROMA 3LS2A 5K8TA 2BY3A 2Y0DA 3GRVA 1FP4A 3NTOA 1JLHA 1USVA 2FWNA 4S1NA 4FFLA 1PZNA 4ER5A 3ZTYA 4CKCA 2VAMA 2KHMA 3MD9A 1A97A 2AN9A 4MUMA 2EFQA 1OZAA 1FFSA 1FZPB 3GFJA 4XYLA 3B13B 4QUEA 3UK1A 5E17F 2R1TB 2H1WA 3SJ7A 2ZPAA 2IWHA 4CT5A 1MJGM 1JYSA 2QG6A 1BR1A 5JFGA 3CNHA 3JD2A 4M1KA 4XL9A 2FN7A 2O2YA 2R7FA 3D59A 4HEHA 1W88A 1TMKA 3DLIA 2INGX 4C3HJ 4IH4A 3QPLA 2BHTA 4G23A 2QI9F 2JFPA 4OLAA 1WHUA 2DQLA 3U7IA 2JGNA 1ZM4A 2R60A 2O7SA 2BMEA 3SR0A 4FLMA 3W6OA 3IDSA 2X8LA 2W6PA 2I4LA 1Z25A 4M1YA 4GKJB 4PZEA 2C3OA 5FUMA 2HHAA 1QG4A 3ZWPA 2JFUA 5B1IA 1L7RA 2GXUA 2O8EB 3ONDA 2OGSA 4NV0A 3R7WB 2NAZA 3FUCA 3P0IA 2VASA 3GB9A 4FDMA 2X0NA 4DQ0A 2I7CA 1AU9A 2A84A 1JP7A 4C7XA 5DWQA 4A0ZA 1MPXA 2DT5A 4BE7B 4RPCA 1CJVC 4WHMA 5K3EA 1JI8A 1TO1E 2VKDA 3LCCA 1ZD2P 3ZHBA 1V3QE 3IJRA 2QAIA 4F85A 4YRIA 4LY3A 1JA0A 1O8BA 2L2QA 4ZPXA 1XPOA 1FLAA 1Z75A 1E2LA 2UYGA 2RCYA 1JQAA 2MINB 4DY6A 1UELB 5CNMA 1I4EB 3QELA 1P2VA 3TSWA 1T8TA 4Q3DA 2P11A 4ZPJA 1M2EA 3ERMA 4BAGA 3SHFA 1Y4AE 5EE3A 5KTYA 2W93A 4UOQA 3ZCXA 2QP3A 1HKSA 1MENA 5FAXA 2A1UB 4EFLA 1Q84A 2R7NA 2GA2A 2NU9A 3EG5A 1ZW1A 1VQ4I 1Q1HA 2AI1A 3WRXA 1Q74A 2P2DA 2X1DA 3C70A 4YAUA 3B1WA 4JX6A 2VOPA 2VKVA 4F2DA 2NUTB 4WOPA 2ZIZA 1RLIA 3UFXB 3UWSA 3IUPA 4RY2A 4RF3A 3HFJA 4D8VA 1IJFA 2VUHB 1LQ1A 2BEVA 4AP5A 4CM9A 5A0VA 4PHHA 3BR5A 2VQLA 1ETUA 4GXTA 2H65A 1L5SA 1WXXA 4UB6C 3NC0C 3EVFA 2IITA 1RSZA 2LD4A 3S1AB 2X4GA 2QL9A 3M6XA 1NOIA 2C7QA 1IOVA 3ZLUA 2AYYA 3ML6A 3ZHYA 1CUSA 3UJNA 2GOXB 3JTMA 4GYYA 4U7DA 1DAOA 4PHCA 1VC2A 5CVEA 2PXXA 3LGSA 4D1QA 3LJKA 1H3EA 1HG1A 1IZ8A 2XNJA 3PRYA 3O92A 4NYMR 4IRIA 1F51E 3FR7A 1R27A 4M87A 3V4FA 3AY6A 1H2EA 1Y5LA 2RGBA 1JFRA 3MILA 5BRAA 4ISCA 2B0LA 2X1HA 3VVCA 1FUIA 1T6BY 3KPJA 1F0PA 1H2FA 4IIEA 3WHLA 1I4LD 3HKCA 3I8SA 4DIUA 3M9WA 2V26A 3GA5A 2JFFA 2BEJA 2RJ3A 5IKEA 1UMQA 1H8ED 4UPDA 4WLUA 3QU6A 5HFJA 1RZ3A 2MG4A 1PCXA 4K2AA 1HSJA 1XJCA 3L77A 1T95A 4NZYA 2DWQA 4ID9A 3CSDA 2NTEA 1VFNA 1BDHA 3OQ6A 4NBUA 3ZCOA 4DBQA 3OYBA 4G5HA 4A8JA 4HV6A 2AHQA 1JT2A 3EHEA 1JBKA 2GNPA 4TMFA 3CZ4A 3F8CA 5K0ZA 1ZM7A 4HDUA 4RKEA 3HSKA 4O25A 1ORKA 2R5YB 2Y6UA 3TMOA 5DX0A 1WH7A 1J59A 4ZEOA 2AC2A 3EQ6A 5LZ2A 3NUZA 4CM5A 1VPEA 1A95A 1SD6A 3SC6A 1OLOA 3DWEX 3EH2A 2ISQA 3A6FA 1KDPA 3GTOJ 2ZRPA 4L5AA 3FCUB 3PWSA 3LQFA 1GGVA 1BJAA 3KQTA 4MA0A 3SZMA 1TP4A 4QX6A 4YRFA 3A26A 1QB8A 1YSCA 1YRAA 5JMPA 2FBKA 2Q0XA 2W2KB 2FDXA 3DUFA 3LUDA 4YALA 4GR9A 4JXXA 5LMCA 4D26A 2ZGVA 2FJ1A 2CQQA 4LRSB 1TYAE 3JRHA 2Z5LA 3I1YA 3OE7D 5J63A 3RSFA 3HB7A 4S0HB 1C8KA 4D80A 5HVQC 3WYDA 1G8PA 3DO8A 3WJAA 2JJ1A 5FLXK 3GLGA 2R3SA 4YIKA 1X42A 2L7MP 1U0FA 2IPAB 4JI6B 3ZBUA 4WUTA 1LNQA 3QYFA 3DTNA 1I33A 2V58A 3OL4A 5J2TF 1UMDB 3GHHA 1L5HA 1K8RA 2KBEA 3T5DA 1VL8A 1ZCZA 2YX7A 1LS1A 4TX1A 4D81A 1H3NA 4BN4A 4S24A 2QI9C 2QRQA 1E3SA 3R7NA 1Q7RA 4QPZA 2OZKA 3PGA1 1VA4A 3CMYA 2AEFA 2X5NA 5CPRB 4BCBA 4W97A 1WB4A 1P2TA 1ZISA 4X64B 3OPYI 5FEMA 4HLYA 1Z9CA 2DODA 2BP7A 3H42B 1I39A 2GX6A 4K1LA 2OD2A 4HEQA 2HN9A 4AP9A 4PIPA 1W59A 5JI3E 3HJFA 5IHXA 2X4LA 2LY2A 3N0WA 2EDCA 3BXOA 4ZANA 2JDIA 3E82A 3ZV7A 3CLHA 4RACA 4ZZLA 1XOIA 5K3FB 3MJHA 1XEAA 1BXGB 3LDAA 4IR7A 1SC7A 4PVDA 3H36A 2IHVA 4HUTA 3AL2A 4MP6A 1D2AA 5CFOA 2ZXIA 2SKEA 1MW9X 1PR4A 1R5NA 2B36A 1KIFA 2WWRA 3HVJA 4KE8A 1Q1QA 1G3SA 3NTUA 4JJ7A 4ZO8A 1N6RA 3K9TA 4H3VA 2JJQA 3OTQA 1IG0A 3OUUA 3T41A 1Y81A 3QFFA 3EXIA 3CF5F 2YR2A 3NPAA 2VHWA 2ODPA 4KXLA 2RGCA 4BRZA 4HDOB 1KDVA 1X8JA 1HXHA 5IEJA 3QPHA 2LK2A 2PV7A 1FNBA 3P32A 4YRJA 2NUAA 2C4KA 3R2JA 1IOZA 1Z4MA 2IYNA 4PJMA 3I04M 1JWBB 4MPJA 1NTOA 2HWWA 5CB4A 4D9HA 2O1WA 3K09A 3RH0A 2Y1GA 2IYOA 5FOTA 4FBMA 3H5RA 3I9KA 5I4KA 3LLVA 4C76A 1PZEA 2Q4OA 2Z1MA 3DGFC 4XVCA 1WQ4A 3K4BA 5AW6A 3KUUA 1G3RA 5IP7J 5DM6F 1FFEA 3SVZA 2B2XA 4LF6B 2YOFA 1UMCB 3PE4A 3IP7A 1KJ9A 1M10A 4PSWA 1SC4A 1VQ7I 2II6A 3NM5A 5DM4A 3GCGA 3NAUA 1FVHA 1HQDA 3HR8A 2YZKA 3KQNA 1DKLA 3I12A 5IDYA 4LFAB 3GCXA 4XQEA 2AYZA 3NIWA 1F20A 5TLSA 1XMSA 2K9MA 4Z7QB 3RK4A 3RAPR 1Z67A 3CCBA 4KQXA 5F1PA 3LF1A 4JD5A 4O4LB 5AOVA 1XXLA 2Z56A 1T2FA 5HM6A 4FCTA 3BFJA 3ECSA 4CG2A 4X20B 1LSSA 2CFXA 4LTMA 4PQGA 3RVNA 4YMVA 3AB8A 1QHFA 4N4NB 4ZXFA 2OXTA 2Q1XA 3C5WP 4EB6B 1W87A 2I22A 2JHAA 1B8PA 4F3RA 1FSZA 2F48A 3E22A 3G5UA 5IJ9B 3QEOA 3HYIA 2UKDA 1R3DA 5K3AA 4A23A 3ROPA 1KBZA 3WICA 1M1UA 2P5TB 3ZGKA 4LJ7A 3NWPA 2H3HA 2G08A 2OSVA 4JP8A 3TQFA 1GTVA 1X1TA 2XPVA 5C8XA 2Y0SN 1FB5A 2EFOA 4M38A 4L4YA 3FMOB 3A3NA 4PZCA 5CIWA 5JHFA 3GAMA 3VSDA 2GCGA 4AKSA 3BROA 5IAOA 1CP2A 2I8DA 1IN4A 1BHJA 3AY7A 2PO5A 2X23A 2NOAA 3RAEC 1N2ZA 4OJKA 4CN9A 3MELA 4RSMA 1RUOA 1A9ZA 1Q0LA 1WXIA 5TVGA 5FUQA 3DT9A 3RI4A 3E8XA 2G9ZA 4DSUA 3M1YA 4Z2YA 5CDSA 3NBFA 3E4DA 2H8GA 5CMLA 3V8LA 1G17A 2ZTHA 3BMQA 2O2HA 3SXYA 4TVSA 1G41A 1HFJA 4N5NA 1N36B 2IYXA 3ZDXB 2O8CA 4AJNA 3G1TA 1GL6A 3L1JA 4X8LA 5JD5A 2GILA 1FDRA 2PMDA 4UUSA 1MAVA 1T8SA 3ZZMA 1NRIA 4DCSA 1ZIYA 2RQQA 1CUEA 1U2QA 3DOEA 1NDHA 1DQYA 4MHGA 1LTHR 1I6XA 1OH5A 4DLPA 2JRMA 1WABA 3GLHE 1TIBA 2EFJA 5AKEA 1OXSC 3P2KA 1MIHA 1FDWA 5CXUA 3CCLI 5A05A 2VQ6A 5EE9A 3F2IA 1TUGA 3PGLA 5FPQA 3DXFA 3KOOA 4G8JA 2DLLA 1PAUA 3DKKA 4QXAA 3O8BA 4QECA 2CW7A 1TM4E 2UXXA 3WKDA 3UK0A 4K6HA 3O21A 1J1UA 3AONB 2QRJA 4UUBA 3VKGA 4TRMA 1XEXA 2DLNA 4QG3A 1F1JA 5CGZA 4FCYA 3IAUA 2CMGA 3AHEA 1E4YA 4FFNA 2OBMA 1JBQA 1DEOA 5TT0A 2JZCA 1F4KA 1W36D 4RYDA 1T1RA 2VL7A 2XDVA 3NWSA 5AVTA 1IEQA 3L0CA 1BXKA 2N1BA 1YIAA 1IN1A 4RHYA 4EYKA 4GI2A 5E0OA 1X14A 4IVRA 1IB6A 3MZHA 4NNPA 4HGQA 5AHRA 1V4BA 2WAOA 3CX8A 4RCVA 3SHTA 1WD5A 1LPNA 2BFBB 1R0XA 3OEEA 1MG0A 3ZXIA 3FA2A 3EBLA 4A0GA 3AI2A 2Z2KA 3KB2A 1SUPA 4X45A 1DRWA 4O8ZA 3T15A 5KTRA 3EFHA 5YASA 2KIFA 3ST7A 1S7OA 3JQEA 2G28A 5FRDA 3FWEA 2BAGA 3UHJA 2QN2A 1ONVA 3OM9A 4Z0NA 2B98A 4OKSA 2JASA 4L8GA 4MTCA 1BIBA 1WPGA 2GAOA 3SEFA 5IKPA 4X97A 1B2RA 2IYLD 1JJAA 5JVDB 5CA1F 1VKOA 4RYLA 5B1AH 2WMDA 4AJ4A 2H4HA 2H5IA 5A9SA 3QP9A 4YRCA 1FTGA 1JEYA 3O9VA 3HL0A 2WAFA 3FBWA 4HQRA 3CWZA 3PS9A 4L9SA 4ZEMA 1QH9A 4E7JA 3QFSA 2A9QA 4ZRDA 4CUKA 4RLHA 3AKDA 3WWPA 5GQSA 2OKGA 1U3UA 2AJ8A 2QVCA 1R8XA 1N32B 3IO5A 2AF3C 3LO5A 3GRZA 2VRCA 4AECA 1DRUA 1WXGA 3V1MA 2CUKA 4I4TA 3DZKA 3E84A 4PYRA 3X1WA 2CJPA 4JBWA 1DZIA 4A0QA 5KAIC 3GMEA 2VHCA 4L08A 1ZNXA 2O2IA 3VPHA 1EGMB 1SUEA 5BW8A 1OHHA 3RLIA 4LZWA 1QH0A 3G8AA 2E4YA 3PFBA 2EF1A 4RSHA 5JV5A 5GONB 2CL0X 3NHPA 3WGVA 2X1MA 3R5JA 2L7FP 1BFDA 4X1KB 2ZIXB 1E9DA 4HDAA 3WFZA 1XMOB 3LKZA 3K69A 5SYMA 2ZI6A 1Q21A 5CBPB 1W36B 2COEA 1JKOC 1Z6YA 2XVZA 3H3JA 1TTPB 1XXHB 3JSOA 3O7MA 3OWXA 1Z47A 3T34A 4YH1A 4KPUA 2XZDA 1QVUA 3JPWA 3U6KA 1YQQA 2QQ9A 2C7PA 2C04A 2PIDA 2NTYC 4FEYA 1T15A 2WYVA 4NZZA 2Q4BA 3FNFA 5D3QA 3ZCUA 3FPBA 2PVSA 1X7WB 4U7FA 3VHXA 4MW0A 3U1DA 3VNAA 5EE0A 5DBGA 2H08A 4ZD6A 5EJGA 2H1VA 2E1RA 2WE7A 1MH1A 3NDBB 3C18A 3BMCA 2HXOA 4FQ7A 5MGNA 1WJDA 4UTZA 1KIAA 3S1LA 4S1OA 4HRVA 4X41A 3PJDA 2XA2A 4EQ6B 4BU1A 1D09A 1GDHA 1KJNA 3QX3A 4ER6A 2OMEA 1NXOA 4CCOA 1EQ2A 1WB9A 2BSQA 3N58A 3KPYA 3TLKA 1NY5A 2NUBA 2JZYA 1EH8A 2PRKA 1HDPA 4NU0A 4DEXA 4YCNA 3JTEA 4KGZA 4ZGGA 5J4LA 5I9MA 3ADCA 4MMZB 2C0QA 1X80B 1NG7A 2OF7A 1A5AB 3RVRA 3IKVA 4O6VA 2ZE5A 4WGFA 4JI2B 1KC3A 1Q0UA 3SHQA 1M2FA 1NUTA 1UBUS 5JCXA 4BLWA 1AHNA 4IX9A 4O4IA 3ZY5A 4PINA 2Q21A 4MW4A 3ROEA 3ZH9B 1WPRA 3HA3A 4XM2A 3TVYA 2REQB 5HOOA 1IWBB 1Y3IA 5E6UA 2H1HA 4ZARA 2OHFA 4L9WA 3PGVA 3CVVA 3Q3CA 1B4DA 1U3TA 2JFOA 1JHHA 3VOAA 3CNOA 1JA9A 2WA0A 2FSGA 1O7LA 3H2ZA 4J19A 3LPNA 2HU9A 5ISMA 1XJQA 3TTVA 4Q9IA 2ICAA 1JSZA 2ZI4A 4HWOA 1EP1B 3EGOA 4OIFA 4HOBA 4I4CA 1AQJA 4B79A 4IHJB 2IEAA 2BBTA 4XWWA 1TPYA 3IP5A 1IE3A 1TOAA 3D9QX 4RFSA 1PDWA 3M1AA 1X7YB 2H85A 2LREA 1JIXA 3UC9A 2X5KO 1P3DA 4DRXB 1W46A 1RESA 5AM3A 3MWGA 5ALPA 1CS0A 1WJBA 2PRZA 3HP1A 1IN6A 1C4WA 4WLFA 1VM6A 3J80A 1QAMA 5GAGJ 5KAPA 3TDZC 3TCXB 4YPOA 4EG0A 3LUCA 4R1OA 3GRRA 2ZO4A 5EZYA 4TV9F 1VB3A 3VR1A 3ZWNA 1OWNA 4IH9A 2XOKD 3LAPA 1L5QA 1SQ0A 1UFKA 3H1GA 4L8YA 1SFUA 2PMEA 5HRAA 4BEHB 3K70C 2F17A 3GZ4A 3LCVB 4BZZA 3U56A 4YQEA 1LPAB 4CKEB 4P4UA 3C2GA 1HYQA 2WIJA 1SGWA 2Z8ZA 4JMLA 5CX4A 2DUUA 2E5FA 4QE3A 1UIRA 5K0LA 4TTAA 3EN0A 4Z0TA 2CT8A 5BURA 1TT0A 5HQ3A 2Z2IA 1F4PA 3EBPA 5JMWA 3G1LA 2BCGY 3QU2A 4IDOA 1SU8A 4O2BB 5CT6A 3PXEA 4V2FA 4P96A 3O75A 1TZKA 2X9QA 2ODTX 4W9MC 1XFDA 4CL3A 4YT2A 5TMEA 4HDKB 3QZUA 2HU7A 1XRNA 1DU4A 2OY0A 5AW7A 4O5OA 4UEKA 5AQ1A 4ARIA 4BP9A 1P80A 4CLDA 5EJIA 2C20A 4UM7A 4F7WA 2ORYA 4IH1A 3E5MA 4BNJA 1FLNA 4LG3A 1HO3A 4PDKA 4ND2A 1Q92A 1E92A 1VCIA 5JFTA 3FOZA 4MWDA 3FETA 3VHRA 2ZRQA 4N6GA 3H1EA 3LW7A 4CMEA 4Y6OA 5LQNA 3B52X 4XPIB 1K0FA 1YZGA 3HBMA 3THXA 3KFXA 1XCGB 1OE0A 3BG7A 2HWYA 2JFNA 5LYYA 5IYZB 1F9EA 2NSHA 4DXDA 4Q24A 4J3JA 5IYBJ 1IEVA 3IPCA 1OY1A 4G0OA 3WMGA 5I9NA 4OH1A 3WLRA 4R84A 1YE3A 3KUCA 3C5EA 4JITA 4ASUA 3S8YA 3HYSA 2GJAA 1KK0A 1OTYA 4BY1J 1EFVA 5F98A 1XMVA 2YWRA 4BNFA 2YHBA 4FMDF 4XFDA 3TX2A 2HXGA 3C16C 4EI2A 3BWYA 1WL8A 1JT6A 1QC5B 1P61B 2QE7D 1UWCA 4LWZA 1LVGA 4HWPA 3WLAA 4QD3A 2HTEA 3X1KA 2EJTA 4DNFA 3KR2A 3TBHA 2AW3A 1CF2O 1RXSA 1ZJ5A 5DM2A 1ZU4A 4ZAXA 3N5KA 4MAFA 3OF5A 2XZPA 2VT7A 1ND5A 4UEOA 4M53A 5ILSA 1JG6A 5JASA 3VODA 3RFUA 1LJ8A 1B72B 3DFFA 1HEYA 4ZI5A 3FISA 3SLGA 2XUPA 4E5DA 2B8EA 1IVNA 2IA5A 4CLXA 2GIVA 4YP1A 2Q4RA 1NHWA 2GTHA 4JLKA 2VKEA 3PJRA 3DA8A 1UPUA 2GLOA 3TXXA 5FNVA 3HNPA 3TIIA 1KH1A 2FPXA 4K9RA 2FAXA 2CLFB 4EELA 3BHNA 4TLDA 1K8XB 3COVA 3B7GA 2ZRDA 4DRZA 1RBQA 1NDQA 4R1SA 2AH5A 1M6WA 1OLSA 5DHSA 5A3VA 4EPWA 4P1ZA 3A6DA 4NFLA 4FYJA 4AS3A 3C2HA 4IZHA 3ZVRA 4E4HA 3O8OB 2Q3FA 1C9MA 4LAFA 3FE2A 3FKJA 3BIFA 3IXLA 4I6JA 1WDWB 1VI6A 1WJFA 4RKRA 4OATA 1NQWA 3DZCA 1U94A 4BXFA 5IBPA 4EKEA 2PGIA 4I6GA 4LGVA 4HFJA 2I5UA 1PGNA 4QGBA 4FZVA 1NRJB 2GYWA 3AEKA 4MW9A 5JSQA 2OBXA 1XCMA 2ZUFA 5KCZA 1B76A 1USSA 1AUQA 3YASA 221PA 3DAOA 1EK6A 2VVTA 2OCBA 1IVYA 3ZCTA 4GPEA 2HDHA 1A7KA 4L8LA 1I3OA 2DHEA 4H1WA 3C48A 1P75A 2D7CA 2J5BA 3REQA 5MHTA 2QDKA 2EWNA 1QHYA 2HTSA 3C1UA 1JEDA 4NXNB 4EGCB 5KKAA 3O8GA 4K81B 2WMOB 2HA4A 5GM2A 3JAWA 1TNTA 4W9RA 5GTDA 1I9CA 2FQYA 4EJMA 5BWBA 4EGSA 4TL6A 1VFPA 3DFKA 4G09A 1ZONA 2AJTA 4RU1A 3OP1A 4X8HA 3I2GA 3KRTA 4D96A 4WBNA 5ED4A 4QDUA 3CSUA 1TK9A 2A9OA 3H17A 3BK7A 3KVYA 3FDYA 3ZIAA 3DNPA 3WMEA 1ZRFA 2ZIFA 5F21A 1PFYA 3MVEA 4ZCIA 4PS0A 3KDPA 4MQEA 4WDRA 2VT6A 2NYXA 1RE0A 4NJMB 3DU5A 3OQMA 1HE5A 5D85A 5CFRA 5ALXA 4ZFNA 3GCDA 1L3CA 3IQXA 4YUYA 1SBQA 3B48A 1U1EA 2FN4A 4Y0NA 2OCYC 3PVCA 3UG7A 4BCCA 1YW7A 4GF5A 4M54A 5E1ZB 5GADJ 3K4HA 4KJZA 1YUBA 4L0YB 2QMYA 2WOOA 1CEEA 3T9FA 4RAQA 1KFJB 2GXGA 2VHJA 4DNPA 1J99A 2IH2A 2OM6A 3RCOA 1YAHA 3HI6A 4KHPB 3QWHA 3ELUA 4R2LA 3JY6A 5TGDA 2QP9X 4BB9A 2X0FA 4E33A 3O38A 3WL5A 5LLTA 2Q5LA 3QFRA 1WEHA 1PR2A 2VRBA 5I4IA 4I0AA 3MCUA 3O93A 4IWXA 1N57A 2V6EA 3D0RA 1G2PA 4BVGA 3X1XA 5JEDA 3ZYZA 3W7BA 2DZDA 5DYYA 4NCAA 3JRAA 3JYOA 3X1MA 4RAGA 4OHYA 3TW0A 5K5RA 3KQKA 2Q1ZB 2CFCA 2IRFG 5DNCA 3CB2A 1XYGA 3GX4X 3NOQA 4BQQA 3C14C 4MV6A 1VBMA 1BN7A 2BBWA 3ZU3A 5DXAA 3HFSA 2EZ8A 3GCWA 2OO3A 1WUYA 3MMNA 4Q18A 4ZEWA 2Y67A 2ZXFA 3UW3A 1KF0A 1ZUIA 4JODA 5I7RA 1XROA 3GJSA 4I1PA 3VOBA 4JQSA 3KKZA 3ZRGA 2B1QA 4ED9A 2DK8A 4JEMA 4YMSA 1K08A 2V9VA 4BLUA 1HYHA 4D9CA 3O8QB 1Z8HA 4HV4A 4OXYA 3IA2A 3KE2A 3UKOA 3H5IA 1IHPA 2CYBA 1HA8A 3FKIJ 2BOVA 4XIJA 5DHUA 3GQVA 5J8FA 3SVTA 4JROA 3EPRA 2DR3A 2GOYA 1VIDA 1B0AA 4GXNA 4OHKA 4MITA 3S2UA 1VQ8I 3IV5A 1UDWA 1V1JA 3MTIA 4GECA 4WXPA 3B1VA 5D4RA 1Y48E 5AJHA 1U5TC 4IHXA 2O2JA 5AVUA 4FKBA 2Q5QA 3ZJUA 4LHZA 2G0NA 3ZG6A 4GOOD 2Q1SA 3S1RJ 3VH1A 2A4KA 3B6EA 2PR7A 1BHSA 3V9PA 3Q40A 1DP3A 1QGPA 2CMHA 4CQLA 1SKAA 2VTKA 4YQZA 4KNWA 2FG5A 3LDUA 2QM7A 2XPUA 2AZXA 3G0IA 2W6MA 4EJSB 2CUNA 2QGNA 4CQNA 4LNAA 5F0CA 1T2AA 3W6ZA 2R7XA 3A06A 2B69A 3I52A 3VKUA 3FTPA 1JTEA 4G8XA 2RH5A 2Q5HA 2A0KA 4P98A 1ZG1A 5L95A 3RU9A 4TS1A 2ZIAA 4JT2A 4P34A 2OP0A 5HK9A 5A6SA 4KUHA 3ECCA 1CR6A 3ICPA 1AKNA 3HKDB 3K5IA 2WU8A 4WK0B 4KISA 1SFRA 1HLPA 2O2SA 3K6RA 4ZCLA 4UUVA 3JR9A 3RS0A 1T0UA 2Z08A 5EP1A 2PUCA 4FUQA 1Y63A 1NM5C 3BWEA 1P4AA 4KI7A 4IKFA 4HP8A 2Q45A 3HOUJ 3S81A 5E7IA 1V4VA 2CY0A 4XK4A 2H07A 4AY6A 1EXMA 1GCAA 3AVWA 4YJ3B 4QPDA 3ZCQA 1ISMA 1Z0IA 4JY7A 4QVKA 1LFDB 2PUDA 3G1OA 1WNFA 2CQ7A 4H6XA 4NAVA 1PYDA 1CDZA 3OFVA 5B36A 4Q9HA 1MMNA 4JR1A 1JJVA 4IEJA 2VA9A 3H2SA 2ZXJA 5JATA 2X6OA 5DTDA 4IHWA 5KNCA 1TQ8A 1BL0A 2Q2EA 1STOA 1M0SA 4ZI7F 2F2EA 1KARA 3H0GJ 4Z6KA 1YKFA 3EYWA 1HL7A 4BX3A 4FOTA 3EVNA 5C35A 4BGVA 1E20A 1R5GA 3E0QA 3O95A 1AUPA 4TV8B 4EA9A 3HO8A 3IUSA 3SYLA 2WTEA 1ZRCA 2G67A 2L54A 2L82A 3MEXA 2IIQA 2Y68A 1I6LA 5FUYA 3SFIA 5JO9A 1CUFA 2PYDA 1NVXQ 1KI6B 4G2NA 1VXOA 3NVAA 2BCJQ 1BSVA 2HCFA 2BFPA 3K30A 3N3AC 2M6LA 4L7QA 1G3TA 2HDDA 1G20A 2PU5A 3OSFA 3V6LA 2QTBA 4ARVA 1YZLA 2HSWA 5DLEA 2Z5FA 4B43A 1XLVA 1QV7A 4DYDA 4TTJA 2V3CC 1X38A 4JLVA 1UKCA 2E7ZA 3INNA 2WG2A 4GM0A 1KI4A 3GX1A 3K8ZA 3WC4A 5JDCC 2MYTA 2H1LA 2W22A 3A9WA 1IRXA 3U3RA 4PSVA 1QXSA 1A31A 2DTZA 4KQCA 5G0SA 1IRIA 3DJYA 5ALKA 1CV2A 4UHCA 3NDRA 4MGKR 5JZBA 5FWAA 3ASOH 4L9JA 3UKJA 5JNWA 3FUXA 2FOXA 2HBYA 3UATA 3NB0A 4B71A 3HK2A 1I5OA 1YHQI 4QU5A 1CCWA 3SR4A 3UO8B 3BCAA 1YL6A 2JAOA 4OJYA 4TXLA 4E70A 2XTNA 4X44A 2AVDA 1M2HA 4O4HF 4NKRA 3ZWCA 5JTUA 2IIPA 3GRAA 4PV7A 3NALA 1Q20A 4DNCA 4DAEA 4POAA 1SU7A 2M4KA 5ILUA 3KUDA 3S27A 4COOA 3UA4A 3T5PA 1PNQA 3ORQA 3GUCA 3CTMA 3S1SA 2QPOA 4BNDB 3S0JA 2O8DA 1FVOA 2XQKA 3IOBA 4Z1MD 3AOEC 1K7AA 4OSEA 4B75A 1G5FA 2VAPA 2G7HA 2JIZD 3J80Z 3JWIA 2HTFA 4IYRA 1NW5A 1K7EB 4KXYA 3OY7A 3OZDA 1V95A 3C1DA 2W6JA 3PUJA 2C96A 4JJZA 3AJRA 1YD7A 4NC6A 1E2KA 4BRWA 3PGMA 3VBCA 2X0JA 4M46A 3R3SA 5LJIA 1EWTA 1JE0A 2VDKB 4CO8A 1ODJA 2WIBA 2WT9A 4ZVVA 1S7CA 1N8KA 4GX5A 4BNHA 3Q3IA 1MLDA 1O3RA 3B78A 1T4CB 1QQTA 2G06A 4UVGA 4PU0A 3T0YA 1PEYA 4R3WA 4TXJA 1EFHA 3CRZA 2QSHX 2JC3A 3OX1A 5IC5A 4UVAA 1JXAA 2FEPA 3QKRB 1GLNA 5IYCJ 1TU3A 3ENKA 1DC5A 4JHLA 4EZBA 3GEHA 1NURA 5EZSA 1ULZA 3UWDA 4EA7A 3AL3A 4QL3A 2Y6VA 2D7DA 1ECPA 4P4SB 1IUYA 1RYHA 3GNTA 3L6OO 4MZDA 3BERA 2CXQA 1R37A 4OBWA 1GAWA 2PRYA 2WDPA 1NW6A 2EINH 4NENB 3EXHB 5BPDA 4LGYA 2L0XA 1J56A 2QAGB 3MWDA 3KYCA 3V1TC 2A0XA 1RP1A 4JZKA 4TTVA 2EHDA 5EFZA 1JKIA 4PZYA 1U8CB 3NU1A 3SJZA 1WKCA 3RUFA 1DIOB 2P0AA 3T35A 2FQXA 1DCFA 5E6RB 1C3EA 1U5BB 1CZKA 2VF7A 1HDYA 4UM8B 1IPHA 2PN6A 2VRWA 1P29A 1N5OX 3OX3A 3WGYA 1TMGE 3WSTA 5EWMB 1YJCA 2OCAA 1RRVA 4BMDA 1YO6A 2EA4A 1DL5A 4TL8A 4XUCA 5EYPB 1HC7A 3E2PA 5EHQA 5AJWA 4B40A 1D07A 4WA8A 1ODCA 3EEOA 2DN0A 4C2MJ 5FAKA 1HDEA 1A9OA 2NZ8A 3RS7A 3FDJA 5K99A 1Q7EA 2FSHA 1GG5A 2YS9A 1A0OA 1C9EA 2RH8A 4L0CA 4YIFA 1O94A 1JR2A 2XDQA 2ZSIA 3AL0B 2GCOA 2QIPA 2LR0A 4PG4A 1D8TA 1ENHA 1Y8CA 3ZHCA 3H0DA 1OZHA 2IXTA 2FGKA 4WIAA 3G2BA 3FPSA 1FOWA 4Q4AA 1SUBA 1PYOA 2CW0F 4O2AB 2LXNA 3QP5A 4NMWA 4MPDA 4ZJZA 3TP0A 5CJ9A 2CFRA 1NNUA 5JAPA 1FVXA 2NVBA 2BKAA 4C6TB 1GTMA 3BR0A 1QYWA 5HHTA 2PSDA 3DTKA 4PO9A 5F73A 2P78A 5BT8A 4FNAA 4EIWA 1RYFA 3KU1A 2XZLA 3FXJA 4E0BA 1UC5B 4IOCF 4NBWA 4GC9A 2Z5UA 5EXXA 3G82C 3WWDA 2HKOA 4OG2A 4AFNA 3CRMA 2OESA 2YBDA