2V9PA

Crystal structure of papillomavirus e1 hexameric helicase dna-free form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
279
structure length
272
Chain Sequence
TLNESKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDEQPFNITDADWKSFFVRLWGRLDLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REPLICATION PROTEIN E1
publication title Papillomavirus E1 Helicase Assembly Maintains an Asymmetric State in the Absence of DNA and Nucleotide Cofactors.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
molecule tags Hydrolase
total genus 86
structure length 272
sequence length 279
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2v9pA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v9pA02
1R5NA 2J0QA 5DISB 1P4SA 2CLDX 1OKKD 2ECKA 3RS3A 3PG5A 2Z4SA 4DLTA 3OFND 1D2EA 4JT4A 1LW7A 1OKKA 5A0FA 3AVTA 1YZTA 3KQLA 3OFNA 3UKDA 2WVJA 1Q57A 1RYFA 5EZ6B 1KK1A 5KNBA 1CR1A 2HCBA 2V4ZA 1Q1ZA 3NBXX 2OLJA 5FI0B 2OE2A 5B58C 4MQBA 1KZGB 1IXZA 3KXLA 3RSOA 1NNEA 4EFLA 2RAPA 1DVRA 4FMDF 3BORA 2OV2A 5AJXA 5EXSA 3X2SA 2YWEA 2CK3D 3PV0A 3W8RA 4C0LA 4CEIB 2XITA 2CK3A 1NI3A 2JEOA 4RD6A 3BD9A 3QOFA 2AX4A 4FW9A 4OJKA 4WOPA 3GEEA 1GP2A 4LJ8A 1N6PA 2RH5A 2R6GA 1OFUX 1XEWX 2P6UA 4Q66C 2QTFA 1P9RA 4GDFA 1KY2A 1N6LA 1OHHD 5JFGA 1VPLA 3FKSD 2QRNA 4M9ZA 1DBSA 2PZFA 1OHHA 2AWOA 5JLJA 3GLFA 3CH4B 4URZR 3FKSA 2REBA 3K0EA 2JJ8A 3LO5A 1WA5A 3QKUA 3W3AA 4PO1A 2WJVA 3ZVLA 2P0EA 3O8BA 4Q1AA 1G5RA 1CKEA 2HT1A 3AP1A 1DTSA 2Q3FA 1GFIA 4B73A 2N42A 3FTQA 3SQXA 2DWQA 3VR3A 1FP7A 4OI0A 2GBLA 1CXZA 4B74A 3AVYA 1R0WA 4UQOA 2X1VA 4TYPA 3DHWC 4CRWB 3P4XA 4AG6A 3AKCA 2R6CA 1FNMA 1OH7A 1NVVR 1AM4D 1P9WA 4WBSA 1JQLB 1CRQA 3GLHA 1UKVY 5CK4A 3A6PC 4U5XA 2CDNA 4OHVA 1NMXA 2QSZA 3MGCA 4BFVA 3AH8A 1VHLA 2PCLA 3DOFA 5DH9A 1OH6A 5H1YA 3VR1A 4O0MA 1R0YA 1N2CE 2RGXA 2GK7A 1DAGA 1FNNA 2F1IA 1MRNA 3GLGA 4PHGA 1E69A 1NLZA 5FBWB 1VG0B 3IEUA 3QXJA 3SE0A 3WHKA 2RGNC 3GLFB 4QHTA 2YZ2A 4F92B 3ZJYA 3AKDA 1L7VC 2IT1A 4UNSA 4V0NA 3ZLJA 1N5IA 2J87A 2D4HA 2GZAA 2QI9C 2GESA 3DM5A 3GPLA 2PZEA 3PEYA 1GKYA 2QRZA 4NYJQ 1EFHA 3WY9A 3QEOA 4LJ6A 1QBKC 1KMQA 1W47A 1U94A 4IDOA 2IWHA 1OJLA 2GF0A 3NBFA 2H1LA 1KDRA 2DBYA 4UNQA 2V6IA 4JJKA 3GP8A 2VSFA 2PEZA 3MJRA 1XCGB 3GLHB 3ADKA 2QPOA 4GBMA 2QPAA 2UZ3A 2ZPTX 1NKSA 2VHCA 3CZQA 4L4UA 2QAGA 2IS2A 3CO5A 4ZO4A 1AZTA 2A5DA 2PZGA 1GNRA 1QVAA 4OYHA 4C2UA 4Q02A 3OEEA 2O8FA 4M1OA 2JJ1D 3GJ7A 3ECCA 2XNDD 2ZRPA 4BLQA 2QP4A 4MGIR 2JJ1A 3ZVMA 1X3SA 3LNCA 3TE6A 2EFEB 1KNQA 2FGKA 2Z6VA 3ZS9A 2AXPA 3L0OA 4W5WA 3EA5A 1KI3A 1TEVA 1WMSA 2GEUA 3CNLA 4Q18A 3RYTC 4BRUA 4D4JA 1BOFA 1ODFA 4PC7A 3KKMA 4HZUA 1KAOA 2D62A 1WDTA 2QGNA 1ZM7A 1KKLA 3OZXA 4PPNA 1QHSA 2QTHA 3CZPA 1G3QA 4AIIA 4DDTA 1NSTA 1F5NA 1Z6YA 3LXXA 1G3IA 1R5BA 4QKQA 5JWRA 2VEDA 2VP6A 4KJZA 2IYUA 1YZLA 3VR5A 2QAGB 1MOZA 4Q01A 3FKQA 4IOMA 5KDOA 4NONA 2HF9A 3U7GA 3SNHA 5KYKA 3R8CA 2JA1A 2YC2C 4RCZA 2O8FB 3HP1A 5GVSA 1S9DA 1E32A 4P4SB 1Z0FA 1Z22A 1NJFA 1KO7A 3WP1B 3G5UA 3U3JA 1YRAA 1KI8A 3WNBA 4M2LA 1FOEB 1FMLA 3CNOA 2YV5A 3L43A 4YQFA 3QVVA 4JVMA 3VU9B 2FE4A 3EC1A 2W2XA 2AN9A 1ZVQA 3B1VA 4HZUB 1C4OA 3M0EA 4HLUC 1X8KA 3AUYA 1UKYA 3EZFA 1XB2A 1GWNA 421PA 5A4JA 4XVRA 4LRWA 1JB1A 2HXSA 2KBFA 1KO5A 4C0KA 3DOEA 3ZH9B 3KJHA 3ZZ0A 2ASEA 2JIZD 2OBNA 4I1OA 5LPNA 4B3XA 2C9CA 1R0ZA 1N3BA 1TQ6A 2ERYA 4QXAA 5A5GA 2JIZA 1NVXQ 4I99A 3LY5A 4Q48A 2BCGY 3AGQA 1JXMA 3BH6A 4C0QC 2ANBA 3CBQA 2HF8A 5DNYB 3ND8A 3HPRA 3R9WA 1XTSA 1XTIA 3EAQA 2IS1A 2QP3A 2OO7A 3ONWA 4XSHA 1T6NA 4PQYA 4F91B 5J5CA 1MO4A 3SZRA 4CYMA 2QMUA 2I3BA 4JYBA 5C4GB 2ZYTX 2GAOA 2C96A 4HI0E 4KFSA 5KOYA 1EFCA 1HT1E 3BB4A 2NIPA 4OK5A 1KK2A 4E07A 2VHTA 1DELA 2ATVA 5SZKB 1C9KA 5H70A 1R8SA 1ZUHA 1NBME 4B3GA 2ATXA 3QENA 3VR2A 4NYMR 4Q4LA 5G40A 1EFRD 1U9IA 2FSHA 1ZC3A 2IYLD 1KYIA 2J1LA 2ZI9A 1EFRA 3QF4A 1EWQA 2ZEJA 3QEJA 2GJAA 3TH5A 2MSDB 2GCPA 1PV4A 3P32A 1E9DA 1PUIA 2WWXA 1VIAA 1QHNA 2C04A 4LCBA 4UNRA 3D7MA 2ZAOA 4XSGA 3M1IA 2J0UB 1GSIA 1NLFA 2GBLC 2OCAA 3I3SR 2IYYA 4YXWA 4B47A 1XD2B 3GFOA 3TAUA 1OYWA 1W4RA 3EIEA 1A1VA 3TNFA 1S3GA 2J0VA 2EWWA 3JZMA 1KSHA 4TMXA 4WZAE 1NL3A 3RWMB 1NVWQ 3FHCB 1VKJA 2GZHA 4WXRA 1UF9A 1XD8A 1ZUNB 4QG7A 3QVUA 5BN5A 1N6KA 1FQJA 3BFVA 3MLEA 4YMWA 3WP0A 4RD1A 4Y0AA 3JVVA 4S35A 1AGPA 3ADCA 1UBCA 4DC9A 4GP7A 3LH5A 4JLPA 5FL7D 1FW6A 3VNUA 1J2JA 2YOHA 3EPKA 3GJ0A 1OT3A 5FL7A 3FFAA 5JJKA 4PSVA 2P6NA 3C41J 4Q47A 3QF4B 2AR7A 4F7WA 4BFXA 1KI6A 4D4LA 2ODNA 4B3CA 4IVRA 1D8TA 5KO2A 1G8HA 2R8RA 2F1RA 3B6EA 2FOLA 5DI9A 5EE5B 4OL0A 1P3JA 3UMSA 1KGDA 2OAQ1 2QP9X 3R9IA 5KHOC 3FMIA 2AK2A 4NP6A 3A1WA 1T3HA 1SVKA 3FOZA 1J99A 1X86B 1Z6AA 2BIFA 1XTQA 1X8JA 2YWFA 1RIFA 4YMVA 1ZNZA 4DLUA 5BYKA 3ICQB 3AB3A 3VX4A 4XVQA 2QAGC 2B92A 1GG2A 1AS3A 2VRWA 3VKWA 5JBQA 5F3WB 4MYUA 2ZR0A 2ZQ5A 2QT1A 1AA9A 1Q12A 3U2QA 5SZJA 4C30A 4JZKA 2IBMA 1KSGA 2C99A 2ZS8A 4BFZA 1E2GA 3IQXA 3O8DA 2ZJ2A 2RGEA 5CYOA 4C7OB 3QUSA 1OIXA 2ZJOA 1TUIA 4GMXA 4JYCA 2KSQA 4QBFA 1IXSB 3DMDA 4B44A 4OHZA 4CT4B 5DI3A 2CJWA 4LHWA 4Q7LA 4LWZA 4AKEA 1NBMD 5L3VA 1MKYA 4TYWA 5BWMA 1GUAA 2Z43A 4Z8XA 5KSYA 1H65A 3CRW1 1GRQA 1NBMA 3SJCA 1QZXA 2XX3A 3GEIA 2ZRHA 1N5LA 2XZOA 3MFYA 4ZPXA 4BFTA 1A5TA 3T5GA 3U5ZB 3DKPA 2R9VA 2C03A 4GMDA 1TF5A 4MGKR 4G1UC 1SXJE 1U8YA 4AY2A 3VNVA 2DPXA 3VTKA 3DKVA 1G8FA 1G3MA 4QC2A 1G17A 2OBMA 4A2PA 3AVPA 1QG4A 3J81k 1E96A 2IYQA 4IXMA 2H8KA 2AFIE 4R98A 3SEAA 1FPMA 5FUYA 2EWVA 2G77B 2WKPA 3AVUA 3W6PA 3BIFA 2Z4RA 4M1TA 3QG5A 4FCWA 4JS0A 3C7KA 4G01B 4UXIA 4BLRA 2CJWB 4TMTA 2ORVA 1D5CA 4GPTA 3TR0A 3ZQJA 4DDWA 5UKDA 1AS0A 3B9PA 5JS7A 1W46A 3SN6A 5AJYA 2FA9A 2ZSBA 3HYTA 5FR2A 4AKIA 3AF3A 4I1UA 2OFXA 3CX6A 3X1WA 3PJRA 3FVQA 3TR5A 1ESNA 5HPYB 1ZNYA 2ZE7A 3UATA 4C9BA 2ZI5A 3AF4A 3EZ7A 3THXA 1X1SA 3U44A 3HPQA 2FSGA 4RD0A 3TUJC 2VP0A 2Q3HA 1S96A 4RD4A 2AWNA 2BDTA 3ICEA 1VMAA 4PQFA 3IIJA 2QNRA 3ZVNA 1GRRA 2W6JD 5BW8A 4URXR 1E9SA 2LKDA 4M9QA 1CJTC 1G8PA 1QHYA 3LVRE 1B0UA 4UNNA 3R7WA 3UMRA 2BM1A 3WYGA 2W6JA 1E2EA 4QGHA 2PX3A 3X1ZA 3O47A 3KQKA 1US8A 2VF8A 2ORIA 2WV9A 4TL7A 1II8A 2NO1A 1Z6TA 3CF6R 3WMFA 2Z0MA 4IDPA 1QHHA 1DAHA 1VG8A 3DZ8A 5KPJA 3DZDA 2WM9B 2Y8EA 3CKLA 5KNCA 2FPKA 4OI4A 1OXVA 2OAP1 1H8HD 1IONA 1U9IC 5HE8A 5JI2E 2AXNA 3WXMA 3W3ZB 1H8HA 1KK0A 3H1TA 4FXPA 5IDVA 1U90A 3THXB 4A6PA 1IY0A 2B7CA 2ODEA 4FD2A 4RZ3A 3RRYA 1UADA 2CVHA 4NH0A 1W0JD 2TMKA 1NG9A 4URUR 5DE3A 1W0JA 2F1HA 1WE2A 1T4GA 3EWAA 4QOSA 4V0KA 3U7EB 2OUKA 3IPYA 5JHGB 2G9NA 2V9PA 1XMIA 3AVOA 1US8B 4MUAA 1TAGA 4OQMA 1CIPA 4YMSA 1Q44A 1M2OB 2GEVA 1FMJA 1II8B 3CW2A 3OHMA 1SXJD 2A2ZA 1S3SA 2C8VA 1LF0A 1QHHB 4OQFA 621PA 1SXJA 4EDHA 2J9RA 5KTYA 2RGDA 1KI7A 1IOZA 2FV8A 3KB2A 1GILA 4IRUB 4POAA 1DAEA 4C0HA 2RGGA 2FFBA 1BIFA 4OQLA 1MV5A 3K0SA 1BO6A 3VKGA 1OH8A 2WOJA 3B7GA 2IYVA 4NCNA 1LS6A 2FJUA 3Q5DA 4XTCS 5FPYA 1RZ3A 3Q72A 4ZIRA 2PCJA 3KB1A 5FOWA 4D26A 3OIYA 4A0HA 1RYHA 1P2VA 1Z0IA 3FHOA 2ZR7A 2BEJA 4HAUA 2ZRKA 2VA8A 3FB4A 2ZUDA 3NEYA 4R9UC 1DAMA 3C8UA 2WWWA 5KDLA 1IXRC 3GQBA 2ZITA 1GTVA 4IDNA 2OM2A 2WWIA 3RRNA 3BXZA 2FMXA 4EFNA 721PA 3QJYA 4QBGB 3SQWA 1GVNB 3PEWA 2BBOA 3LDAA 4WIAA 2R6FA 4YDHB 3ZIAD 1KSFX 2AKYA 4XJXA 1CRPA 1SXJB 1QF9A 2ZTSA 2P6RA 1VCNA 1E9BA 3ZIAA 5J4HA 1YRBA 2DHRA 2PX0A 5J4VA 4Q03A 5KPDA 5G41A 3T34A 1AQYA 3QF7A 1TPZA 2GJKA 3CX7A 3EZ6A 4UXJA 1RE0A 1ZUIA 4LPKA 2C78A 2P2LA 2XTNA 2HJVA 3AQ4A 4A2WA 4R2IA 3IQWA 2ZRCA 3RWOA 3EIQA 2PMDA 1KNXA 4OBEA 2CL0X 2IYTA 3TKLA 3NKVA 1XWIA 4KYUA 4TTPA 3F0TA 4MDFA 4HDQB 3A4LA 4M1YA 4B3DA 3Q7PA 2F7SA 4UJ3A 3GJ3A 4Q21A 1PUJA 2CCJA 1N25A 4GZLA 2I1VB 4HB2A 2WBLC 2XNSA 2AD1A 4PC2A 4RFSB 3U6KA 1KO8A 1J70A 1OV4A 2BOVA 1F2UA 3CR7A 5JWHA 3BOSA 4GP6A 2A3RA 1QRAA 5EUQB 5B2ZA 1GNQA 2OT3B 3CNNA 2ZU0C 1BS1A 1LS1A 1YKSA 5SZIA 2QBYA 3UPUA 1JNYA 1TQ2A 4LDJA 4RCYA 1UBFA 2J59A 2XJ4A 1F48A 2G1JA 5CM8B 3Q85A 3G82C 2EYUA 4BGDA 3V4RA 4G5SA 2RGCA 1G8YA 2GXUA 2PBRA 2Q9AA 2ZI7A 3SR0A 3WYAA 2BBWA 1GL9B 2GXSA 4LY6A 5JI3E 4ZDIA 1CS4C 1X6VA 4WVFA 2HUPA 3NBYC 1NG1A 3B5JA 2YJTD 4IKEA 4V0LA 2KBEA 5KDDA 1JBKA 4B2PA 1COWA 221PA 3B1YA 3PUZA 2MSCB 2WAYA 3CF2A 4D81A 1D2MA 2O8EA 2D7CA 4MRPA 1KDPA 1F2UB 2IEZA 1W4BA 1X1RA 3U3KA 3RS4A 3CPHA 4BLOA 2JLVA 2NQ2C 1T5LA 3TUZC 1Z28A 1BH2A 2QBYB 5FH9A 4QHYA 3C15C 3P26A 1EFTA 1NJGA 4A36A 1PLJA 4BLSA 1DADA 1L2TA 2CBZA 2QTVB 3N2EA 3PENA 3ADBA 4L5BA 3TGPA 3QPVA 4FN5A 4KVAA 3HJNA 4N0EA 4NTZA 5L3QB 1CEEA 1TQDA 3QPWA 2ZE6A 2CCGA 5EE9A 4A6XA 1XJ0A 2VH5R 1ESMA 4HAZA 4Q4HA 2LCFA 1GOTA 1WB9A 4TZ0A 1IY1A 2V1UA 4BZXA 2ZVPX 1XFAA 2FSIA 3F3YA 3JZAA 4JBYA 4FMDB 1J8YF 1MO5A 2IUTA 4JL5A 1WCV1 2REOA 2JLZA 1NMYA 1TF2A 1SVSA 2FPMA 4ESHA 1N6NA 2VTKA 4PTLA 4DDUA 2ANCA 1LV7A 2OLKA 6Q21A 4CF7A 1Z8FA 3GLIE 1Z63A 1G7RA 2NO0A 4DIEA 3GJ5A 3OESA 3Q8XB 3ND9A 2ZJYA 4PZLA 4BLPA 3HDTA 1JPJA 4DXAA 4GNKA 5LBIA 1JJVA 1XCPA 1M1YE 1YJ5A 3IO5A 4PZZA 5C46F 2IF2A 1FP6A 4F38A 3W6OA 3PUYA 4FMCF 4EIWA 3RABA 1SVWA 4CW7A 3U60B 2VHQA 1XEXA 2GKSA 2DCUA 3I8SA 2QPTA 3LWNA 4QNRA 2IEYA 2YNMA 1II0A 2I4IA 5ELXA 1HT2E 4B35A 3EPJA 3GCGA 5CITA 2ZU6A 4C3ZA 5AUOB 3RRZA 4GOXA 1HQYE 3CONA 3H84A 3PIRA 5JHHB 4F4CA 2R44A 1HE1C 4EKDA 1VYTA 2RKOA 2A5YB 4X8LA 5EP2A 4QGFA 5GJBA 4CEHA 4I4LA 5KU1A 1ZU5A 1E9CA 2A30A 5GADl 5FTLA 1SXJC 5DSZA 3A4NA 1FQKA 2CLSA 4EPYA 2PLRA 4P31A 2X2FA 1T8UA 4DB2A 1SZPA 1Z2CA 3A1UA 4LYFA 1HY3A 2LKCA 4EJSA 1PJRA 4P4TA 3EASA 3CWQA 3OE7A 1DAFA 4JLBA 4Z51A 3D31A 5FTMA 2NTYC 2R2AA 2ZI6A 1DS6A 3C4JA 2WOOA 4NCHA 1ZNXA 4TLDA 2HYIC 4PAQA 2XGJA 2ZJBA 4Q00A 4F4IA 4LYHA 4P0TA 1NY5A 4V0OA 2ZXUA 1C1YA 2HXYA 3NHBA 4N3NA 1V5WA 4A0RA 1GZSA 4QJ5A 4RKFA 1Q1EA 2VF7A 4QGAA 2H16A 2AHOA 2QORA 1U98A 2QL6A 2IUSA 2WZQA 3B1WA 1W5SA 2YWHA 4DLYA 1WQ1R 2J7PD 2X19A 5G3YA 3AVQA 2QM7A 3OEED 4CEHB 1S0UA 4A1FA 4URYR 3D3QA 2J7PA 1HQCA 2QROA 5HZKA 1KJZA 2JASA 3D8BA 4URWR 1UKEA 2REXB 3GLGB 5LD2B 4B34A 1XNJA 3P4YA 4L8GA 1GL6A 4ZDJA 3I72A 1P73A 1TU4A 4FCTA 2WMNB 3LFUA 4PPFA 5DYIA 4EJSB 1BMFD 3I4LA 3KQUA 2ZRLA 4MYHA 5E4FA 4DT1A 3RSLA 4WZ6A 1PVOA 1BMFA 3QKSA 2L0XA 2XXAA 4MDEA 4D0NA 2Q9CA 5EE3A 3TQFA 4LX0A 2A5FA 1E94E 1VG9B 2EFGA 1Z07A 3TK1A 2ZRAA 2WWFA 4QM6A 5L3SA 4DBLC 4QFMA 2QE7D 4JVSB 3CRRA 1P7CA 4PR0A 4QJ4A 4YONB 2QE7A 2E87A 1JPNA 1VCOA 3GLIA 4KITB 4P3YA 3K9HA 2XOKD 1NVVQ 4R71A 4A9AA 5DIFA 2XOKA 5EQTA 2HCJB 1IHUA 2EVWX 2PH1A 4DSNA 4NDZA 4TYYA 3EPLA 1S1MA 2VIIA 2H57A 2IYSA 3T35A 4HZIA 3GMTA 4AYWA 2QT0A 4Q4AA 1OW3B 2LWIA 3T5DA 2ZJAA 4DEXA 4BWYA 5AJVB 4DT1B 2EFDB 4KU4A 5HCIA 1FFHA 1DOAA 1E0JA 1G3RA 1KY3A 2QMEA 2ZSDA 5E7IA 4PO9A 5FPKA 2WJYA 4TL6A 4HUQA 5FOSA 1MRSA 4DSOA 3A1VA 1VYVA 2ZJZA 5C1BA 4DCNA 2GWHA 3W34A 2NO7A 5L3SB 5CYPA 4HYYA 5E7MA 3SJZA 1LVGA 2MSEB 2XB4A 5HTKA 4LJ5A 1AN0A 2XTMA 1Z0DA 2WAXA 2QGZA 4IHQA 4KLNA 3WMEA 2X77A 3GLIB 1KI1A 1ZP6A 2FWRA 2BKUA 4FINA 4C0SA 1E4VA 5B57C 1LTQA 3TLXA 4II7A 2ZSAA 4JLDA 2OCPA 2YYZA 2ZVQX 4IOKA 5FBQB 4EFMA 4HLDA 3LXRA 4Q9HA 3TW4A 1DAIA 2NZJA 3PQCA 1D2NA 3LW8A 3MWYW 3IO3A 2CE2X 2QZ4A 4Q4AB 5DLQC 3QKTA 2BV3A 1FUKA 3P27A 1M7BA 3AUXA 5LB2A 2B7BA 4LJ9A 3SI7A 1PLKA 2ZS7A 1E2LA 2EW1A 1RVDA 1SKYE 3ETLA 1R2QA 3K0AA 1OIVA 3ZVRA 5TARA 3AGPA 4BQSA 2IXFA 4HUQB 4LHXA 4KAXA 4PQRA 1LY1A 3EPHA 4JL8A 4P33A 4JLVA 3H4MA 1SHZA 2V6JA 3B9QA 1TTTA 4OK6A 5KSOA 2GVDC 3TMKA 4A8JA 3O8CA 1T8TA 4XWOA 4RZUA 1CBUA 1R4AA 3B82A 3BH0A 1HUQA 3NG1A 4G3XA 2GAAA 2BC9A 2ZI4A 1J8MF 2MMGA 1YR9A 1TL7C 2ODBA 3U7FB 1EWRA 4G5OA 1NIJA 1M7GA 3UIEA 4DSTA 4UKDA 1XXHA 3FMPB 1U0JA 3K0FA 1G18A 1ZCAA 4NE2A 1DEKA 1WXQA 3JVUA 3KXIA 3K70D 2QG6A 5G3ZA 4YXWD 4K46A 5J40A 2DFKB 1K5GA 3K0AB 3AVWA 4DCVA 3K53A 2ZM5A 4PC3A 1H8ED 1I4DD 1XTKA 4LYJA 1S4QA 1UJ2A 1H8EA 2JATA 3RDPA 4CEJA 4JKIA 2H5EA 2GXAA 2QSYA 2IUUA 3KQNA 4US0R 4D25A 1UEJA 3M4YA 1XZQA 4KODA 3K1JA 1BYIA 4A8JB 4DLWA 2GXQA 5AJWA 3SFVA 3L8YA 3B8HA 3A37A 4N1AA 4AD8A 2CHVA 4JLAA 5E3HA 3PUWA 3A1SA 2IF0A 4HB0A 5LD2C 1X8LA 4PFSA 1YZKA 2ZSFA 2WSMA 3BFXA 3DMNA 1E9EA 3FMOB 3NC1C 2GZDA 2IK8A 2ZRGA 2GILA 5AR1A 4A2QA 4Q9JA 2ZYVX 4MRVA 2SHKA 4EJSC 5CJ2A 3CF0A 2W83A 1AS2A 1BYUA 4BLTA 1P75A 1JALA 2CVFA 5E95A 4DB4A 2BMFA 3K09A 3TBKA 2F3TA 1E4YA 4Q1EA 1Y3AA 1XTRA 2ODWA 3I1FA 3OEHA 2QAJA 2DWPA 5EXTA 3CIOA 3RANA 1G4UR 1KSJA 4EPVA 3K70B 4FWTA 3BK7A 2ZRBA 1LB1B 4G0NA 3BJIC 4PXAA 2GF9A 2BM0A 5FBRB 4IXNA 5JEEA 4JVLA 3CLVA 2IXGA 2UKDA 2EU8A 2HYDA 4CEJB 3NIBA 4GOJA 4EPWA 3I5XA 2FZLA 1I2MA 5SZHB 1ZINA 4ACBA 3BRWD 2QMOA 1D9XA 4TL8A 1M6NA 1P5ZB 2BMEA 4JBXA 1W49A 2O8DA 5DHFA 3U3OA 4AYXA 5JZVA 4M22A 4MKGA 1OFIA 4NYMQ 3MWJA 1W4AA 1R7RA 1KI6B 2QA5A 3PUVA 1HYQA 1JR3E 1W44A 2V54A 4M53A 4MRSA 1A82A 1QVRA 3CPEA 3A1TA 1M34E 4B3FX 3UG7A 3TAHA 1FTSA 4XVUA 4Q7MB 3SYNA 4BRWA 4HAWA 5FPTA 5B30A 4NYIR 2ONJA 2ZRMA 4TQ9A 3KTAA 4D82A 4IFEA 4PHTA 3AVXA 4QGGA 1WP9A 2WWHA 5K8UA 4U7DA 5CIWA 3B1ZA 5L3RA 3VAAA 1U81A 3OAAD 5FPSA 3BE4A 1A2BA 4IEEA 4RVCA 3ZDQA 3OAAA 3R9XA 2FF7A 1GRNA 1E2JA 2CNWD 5EP1A 3TIFA 1ZW6A 2CNWA 4KXFB 3SFZA 4DEYA 2JGNA 3LA6A 1SKYB 1MR3F 1TU3A 2OCYC 1N6OA 4PHFA 4YMTA 4NHOA 4PAOA 1Z6GA 5TXGA 1W0KD 1I4TD 3TVDA 5IHPA 2VSXA 1NP6A 3RC8A 1W0KA 1NN3A 4PC6A 2AD5A 2KWIA 4US1R 4HUTA 4M0LA 4F93B 1Z83A 2GCOA 3QBVA 5DI3B 5F98A 4LV5B 3S1AA 1F60A 4LYAA 3AM1A 4AKHA 2JLRA 521PA 3LD9A 1GKUB 2F43A 2VYFA 4TSFD 1LNZA 2Z5FA 4OI2A 4D80A 3LQQA 4TSFA 5IT5A 1ZYUA 4ZI3A 3EZ9A 4XWKA 5FBVB 2A9KA 4OK3A 4RFVA 1OXTA 4HAVA 2WJHA 3QQ5A 4PPGA 1OF1A 3KKQA 2CHQA 1R6BX 2WPDD 2XZPA 5C2JB 2IYWA 5IRCD 3LV8A 1NVUQ 1NIPA 2WPDA 4KI0A 2IA5A 1F2TA 3FE2A 1NF3A 1RRCA 4PANA 2N46A 2W0MA 1ANKA 1XMSA 4TLEA 4ABYA 2WTUA 3R8FA 1WBBA 4PSAA 2WJGA 4IFBA 3NDPA 3HU3A 4WXPA 2O8CA 2GJ9A 2R65A 1XTJA 4QNMA 1VCIA 1RKBA 1G16A 2F43B 3K9NA 4Q9KA 4IOJA 4K81B 3UWOA 3FPAA 4JLKA 4A8JC 1E2MA 4MYCA 4IVQA 1I4LD 1F6BA 4LHYA 3SYKA 4I81A 3TJZA 1HE8B 4LJ4A 2ZYUX 3L0PA 1E1QD 4H1UA 4LZZA 4GL2A 1XZPA 2EYQA 1JR3D 1E1QA 4IW3B 1TUEA 3U61B 1JJ7A 1OFHA 4JLMA 3LRPA 2GDJA 4B71A 2PJRA 2GNOA 2A5GA 1JR3A 3T15A 3U44B 3T12A 5IK2D 3NEJA 3L2OB 4J0QA 4LBYA 3WNDA 1T0JB 3FDIA 4BFSA 2OG2A 3QPUA 5IK2A 1N5KA 5CB6A 1E1RD 3O8RA 3R7WB 3K70C 3B85A 4GRAA 1N0VC 1E1RA 1YHNA 4GI7A 3L0SA 5AUQA 2WJIA 4JLNA 3VFDA 3NC0C 1JECA 3Q5EA 4TQAA 3GFTA 4B76A 5K8TA 5JJLA 2O8CB 2QQEA 3I62A 3L0IB 1W48A 4BEBA 2O52A 2QM8A 1Q1BA 2C98A 4JT2A 3K9LA 3EZ2A 3U6BA 4WA7A 3GFPA 2PJZA 2R6DA 1G9XA 3TUIC 3U7HB 1D9ZA 1ZM4A 1PZNA 4XH9B 1G8GA 1G41A 5FUWA 4RD2A 2HEIA 4X8HA 4CGZA 3G0HA 1K6MA 5LDDC 5KNDA 3EARA 3T1VA 2BEKA 3X1YA 4DDVA 1LFDB 2ZRNA 1UDWA 3QI2A 2HJGA 4M9XA 5F2EA 5C18A 3K09C 1RPZA 2OBLA 4KFTA 4V0ME 1NN0A 4QL3A 1TX4B 3I92A 4BFYA 1E9FA 3RHFA 2VSOA 1G1MA 4TMVA 3LW7A 1XRJA 2OSBA 1M7HA 3PITA 4L9WA 4RSGA 1U8AA 1VIYA 2RGNA 4B2LA 5DN6D 1XPOA 4D2IA 3QY0A 5DN6A 5TVKA 1YQTA 3PXGA 3SHWA 2EFHB 4AC9A 3EW9A 1Z0KA 1JQJC 4KSCA 5J4KA 1SVOA 3W8NA 2BBSA 2GEDA 3LBNA 3A8TA 4L15A 4KVGA 1S9HA 5GVRA 1KI4A 4HAXA 5F9FA 1NN1A 1NRJB 4D4MA 3V9PA 1G4AE 5DO9A 1KJWA 4JBWA 2D3WA 2O0KA 4BZPA 4A15A 2FZ4A 4W9MC 3VMFA 2BMJA 2OHFA 3ZYCA 4X8OA 1GIAA 3N5CA 2IHYA 5FTNA 1CJMA 3VKHA 4ZIRB 1YR7A 1XJCA 2E9SA 3PR1A 4A92A 1FX0A 1AKEA 5JSZA 3U3RA 2BJWA 5JRZA 2C9YA 2IHBA 4LI0A 4LBWA 4LJ7A 2G6BA 3V4FA 1ZU4A 1CF4A 1JR6A 4AWXA 3SU8A 2WIBA 5H68A 2AL7A 4G5QA 4TLAA 3I73A 4GOKA 3AKYA 4HLQB 4AG5A 1G6OA 4RY2A 5CM9C 4JJZA 5D3QA 4HB3A 2YOGA 1UFQA 1UDXA 1CJVC 2DFTA 4ON9A 1MH1A 1KDTA 1SQ5A 1XD9A 2HT6A 1Z0JA 2WKRA 3IHLA 1ZCBA 1COWD 1KZ7B 3KKNA 1ZM2A 2VHUA 1QHIA 2VLIA 2F6RA 2UZIR 3CH5A 4TMKA 1JEEA 5TY0A 3X1XA 2JLYA 4ZDWA 5FOVA 1ZAKA 1JI0A 1E2NA 2B6HA 2K5UA 1S8FA 1FX0B 3MCAA 4HATA 5JSZB 1VTKA 4N0DA 2IYRA 2QMHA 5FR1A 2OCBA 1NKTA 1FTNA 3GJ6A 3NVAA 4LBVA 2WSSD 3HU1A 1OIWA 3IEVA 1EK0A 1SGWA 2NMVA 4D0GA 2WSSA 4MA4A 2BJVA 3WYFA 1CLUA 2F9MA 4V03A 5HE9A 2FSFA 1UBGA 2QENA 5EXXA 4HLUA 2QN6A 2ZREA 4HSEA 5FBLB 3Q3JB 3REFA 1JAHA 4M1SA 4V0MA 1U2RA 5IF9A 1ZM9A 3GD7A 3LX5A 3CB4A 2ZSEA 1YU9A 2XB2A 4PO8A 1RC8A 3E5HA 4TMWA 3GJXC 4DUGD 4W5HA 1Q3HA 4KBFA 1Q20A 3KJGA 5JCZA 1W36D 4DUGA 1G7TA 5BN3A 2F55A 4PPQA 3MRSA 3BB3A 3QXSA 3NDBB 4JVNA 4DLZA 1T91A 4MRRA 1HV8A 3IGFA 3VR6A 4Y0VA 2O8EB 2H92A 1HTWA 4TWZA 4NYJR 3RC3A 3B2EA 4MKIA 2GRJA 1RRGA 5DYGA 1AQUA 1QDEA 1T9HA 2B8TA 2IS6A 3KXKA 1P60A 2IYZA 4M4SA 3ZGXA 1XU4A 3C14C 4S2EA 1GKIA 1Z06A 2OEPA 1KAGA 1V43A 2FH5B 4PZYA 3UMFA 4RZ2A 1XX6A 3ZZUA 4QBIA 1ZNWA 1WRBA 4WAUA 3KQHA 1ZM3A 5GJVC 4L9SA 3MD0A 3THWA 1N0WA 4JLOA 1NLYA 4NKRA 2WHXA 3X1DA 1Z29A 2J7KA 2PL3A 3REGA 3RS2A 3TVTA 2NO6A 5CDFE 2P67A 1AKYA 1MO3A 2WIAA 1Z3IX 2D74A 3A58B 3BS4A 4FI3C 4P4UA 5JWOA 2FDCA 3THYA 2IXEA 4BFUA 4MH0R 4GFDA 3UG6A 4FMCB 5EP4A 4Q4HB 1J90A 4K8OA 3BGWA 2RGBA 4NZYA 5FOTA 2QEQA 1E6CA 1RJ9A 3B60A 1W36B 1K5DA 1G7SA 2BCJQ 2KB0A 4LGMA 1IAQA 2RCNA 1J7KA 4X8MA 3KFVA 2XSZD 2NZ8A 4A82A 3PUXA 4DIDA 4RJLA 2XSZA 1IJFA 4M21A 4LOAA 1CR2A 1TF7A 1E0AA 3K8YA 1N6RA 4UXHA 3LVQE 1I2DA 1OB5A 4NBSA 5BYJA 5C4MA 3IBGA 4US2R 1AIPA 2PT5A 3B1XA 3OE7D 2CLCX 3SYLA 3CM0A 1T3LA 5KSPA 2ZUCA 1E2HA 4BECA 3QIAA 3THWB 3SC3A 2J0SA 2UVQA 2Q9BA 3EWSA 2V8OA 3THYB 3WRYC 1XEXB 5FFMA 4FCVA 5GJCA 1IN4A 1SVMA 2GETA 1TQ4A 4CIDA 2PLFA 4HDOB 4KFRA 1DO2A 5J47A 2YOFA 1RJ9B 1NY6A 1XEWY 1S2MA 2J3EA 3BH7A 4Q4JA 5JECA 4I1SA 5LB4A 4G5GA 5TMPA 4HLCA 3SHFA 2ERXA 4IJMA 2BHRA 3TSZA 3LQRA 4F4JA 3I8XA 1UAAA 1IN5A 3IIKA 4LHZA 1KK3A 1XPUA 3U3MA 2GJSA 3CRMA 2D2FA 4TQUS 2NPFA 2FFAA 2NO9A 5FOXA 2IW3A 3KJEA 2WJJA 3KX2A 3PFIA 3IUYA 5AJZA 4A4DA 3BFKA 1OPXA 4OQXA 1XXHE 5BN4A 3PCRB 4HAYA 4NL4H 3I32A 1CTQA 1TNDA 4DKXA 4BPBA 3FFBA 3V00A 4DWJA 2JCSA 3ASYA 1KDOA 2VP4A 4DCTA 1E0SA 5K8IA 4GT1A 2CMKA 2ZRDA 4P4SA 1EGAA 1OXSC 4DLXA 2XNDA 2GVZC 5L8VA 3CRVA 4Q4JB 1ONBA 2CEAA 4YDSA 2VO1A 1CR4A 3VU9A 1E9RA 3K0CA 2FU5C 1PLLA 2CL6X 1YR8A 2Q3MA 5EE1A 4D0LB 3DL0A 4E03A 4EAQA 1IM2A 3H0KA 4Q7JB 1Z5ZA 3KZ1E 5CDFA 1M8PA 4Z1MD 4HEJA 3T1TA 3MUFA 3N2IA 2C77A 4Q1CA 3U4QA 2P3SA 4JLJA 4Z1MA 3UWKA 5BXQC 4P32A 2WWYA 4RKEA 3QE0A 2YINC 3BERA 3SBDA 3QKSB 5EP3A 4Q9IA 2W0SA 4WW0A 5CLLA 5AUNB 2XXAB 3OIVA 4DZZA 2AK3A 2P65A 1P72A 3CWZA 4OJQA 1E2DA 3RAPR 4B75A 1XDBA 4BUJA 2ZE8A 1G21E 3HR8A 2HV8A 4Z8YA 5K8LA 4H1VA 1QHGA 1MO6A 4AI6A 4ZI2A 2FFQA 1SVIA 5GJWC 3EC2A 2WICA 3ASZA 4EPTA 4BASA 1VYUA 3QG1A 3BC1A 4ZCIA 3OF5A 2RHDA 3AP3A 2DFLA 1RRPA 2NG1A 2W6ID 4B33A 3MAAC 3MG9A 2GK6A 2W6IA 3W9YA 2ZJ5A 1DG1G 4Z54A 3U4QB 1VECA 4JIMA 4DHEA 2EQBA 3EG5A 1XMJA 4RD3A 3LLUA 1AK2A 3VX3A 1G3UA 4AYTA 3FWYA 1CR0A 1NMZA 4TTQA 2CL7X 4O25A 2I1QA 3NBZC 1RRFA 3P20A 2VP9A 1N6HA 2FEMA 1OE0A 3WRXC 1T3SA 4ZCLA 5FL3A 4ZDKA 3EX7C 2ZANA 5H8WA 3DVLA 3AF0A 1W36C 2A5JA 1CJUC 1HH4A 2YHSA 3TRFA 1TADA 1ZRHA 2H7VA 2JLQA 1KTVA 2Q0HA 2JLWA 1XMVA 1ZC4A 4XTRA 2QQ0A 5J4YA 2ZROA 2J0UA 3K9GA 3CX8A 2NGRA 3ZD7A 4BE7B 1RW4A 3SOPA 3NWJA 2V1XA 2KE5A 1XD2A 3RVBA 1E0KA 3IBYA 3ADDA 3RS0A 1SULA 4IDHA 3VQTA 1SVLA 2OESA 4KO8A 1KI2A 2JAQA 1D6JA 3UANA 4GZMA 2IX3A 1P2TA 1EX7A 1OFTA 1VDZA 1ZD8A 2CHGA 4LSGA 4LPSA 5G53C 1DARA 4PC1A 5HCNA 1JEDA 4B43A 1F3OA 3LBIA 4Q1FA 4C0JA 3F5FA 4R2HA 2D7DA 1M74A 3MWKA 4LK2A 2FGJA 2RGAA 1ELOA 4NCIA 2IYXA 2PT7A 4ZKDA 4XIGS 1IN6A 3OIUA 4CDGA 2O8BA 1IBRA 1Q3TA 3MJHA 1U0LA 1GM5A 2YKGA 1ZJ6A 1MT0A 4KSBA 1R8QA 2EFCB 2J46A 4LHVA 1CP2A 1IN7A 2VP5A 3FYHA 1G291 1E98A 2MMCA 1EFUA 1VG1A 3QXCA 4KLZA 1E2IA 2G0NA 1OYYA 3HU2A 1FZQA 1E9AA 1XXHB 3K0FB 1KHTA 2OFWA 1ZD9A 2CXXA 2JDID 2VQSA 3M6AA 1KO4A 4D4KA 3OEHD 4ARZA 2JDIA 2AKAB 2VBCA 2BMDA 2GHIA 2IL1A 4XOIA 4E5UA 4PSKA 4D6PA 1KJYA 3KJIA 4QM7A 2O0JA 1W5TA 3AF1A 3L8ZA 4Q5IA 2OXCA 1E2FA 4L16A 2CCKA 4H9GA 4M1KA 2H18A 2J5XA 4DLVA 2O8BB 3HWSA 5JS8A 2PEYA 1AGRA 1AJEA 1YZQA 3DDCA 2HDNB 3LLMA 4C7OA 4ASUD 3QXHA 1YZNA 3QSYA 5HR5A 3T1QA 1R0XA 1Z08A 4ASUA 2ZR9A 5FI1B 1DPFA 1YR6A 3C5CA 4B3BA 3A4MA 2J45A 4B2IA 1NSFA 1OXXK 4O2RA 4R7ZA 4B6FA 1WBDA 1GITA 2DY1A 4OHXA 4UJ5A 4B48A 5HKKD 2BKEA 2N1BA 4KBGA 4U00A 1FL9A 3LBHA 5M04A 3GJ8A 5HKKA 4GSYA 2DWOA 2OZEA 1Y63A 2O0HA 1UEIA 4MITA 3RLFA 1HURA 4ITRC 3THOA 4C2TA 1JAIA 1MABA 4ARZB 4FIDA 5TB5A 4LC0A 3E70C 2Q21A 2CE7A 4M1MA 2YWGA 2ZIAA 2ZS9A 4LV6A 2G88A 1Q22A 4DLRA 5FPHA 2G83A 1ZIOA 3EA0A 3PVSA 2J41A 3SJAA 1G6HA 4B6EA 3RS5A 1UPTA 2OFOA 3GEHA 3K0CC 2G1KA 3Q9LA 4EPRA 3CPJB 3IHWA 3RRMA 2O8DB 1B23P 1ETUA 1IY2A 1Z47A 4U02A 2W58A 4TT3D 1LF5A 5FTJA 3MMPA 4NPHA 4TT3A 4DCSA 4A0GA 1N5JA 2F9LA 1CJKC 4W7SA 3BBPA 4OHWA 3WMGA 3IPXA 2BBTA 2VP2A 3BB1A 1OH5A 1U99A 3N70A 2ZAMA 3H2YA 4TMZA 2RB4A 2JLUA 1MABB 2ZRIA 4UNPA 3DPUA 1P2SA 2ZRFA 2C9OA 3FHTA 4EQ6A 4TTRA 1SHKA 4LJAA 3W5IA 1EG7A 2XZLA 3KUDA 4WZBE 2D06A 1TMKA 1DO0A 2C95A 1KKMA 2FEOA 3T06B 2C5LA 1Q0UA 1Z0AA 4QJ3A 3KTAB 4E09A 1FUUA 1DG3A 2R6AA 1U0HC 3QXXA 2XAUA 5EXPA 3DEFA 5JRJA 3C16C 2NPIA 2HLDD 3RS7A 1A7JA 2FPLA 2G3YA 4KFUA 2JJ2D 3W6NA 2HLDA 5JEDA 2JJ2A 4DRZA 1N0UA 1HA3A 1P2UA 4B32A 3ZS8A 3R20A 4C0AC 3MWLA 2VPPA 4FMBB 1R10A 3TSWA 4ERNA 1YVDA 3SS8A 1G5TA 3T61A 3NHAA 4AURA 1WF3A 5DGXA 3AP2A 3QKRA 4TYQA 3CRQA 2IS4A 3VHXA 3UK6A 1XP8A 4XWAA 3PEUA 4O3MA 4MUBA 1OLOA 2F1JA 3AVVA 1L8QA 3SBEA 1YZUA 1KMHA 4EQ6B 2QU8A 4TN1A 2GCOB 1UM8A 2BVNA 1KOFA 2XEXA 4MGYR 3S1AB 3VR4A 2W2VA 4M9SA 5D3MA 3AV0B 4DSUA 2JLXA 2FFHA 3B13B 4LBZA 3PEVA 3AKEA 3W5JA 4CT5A 1ZIPA 4NYIQ 2ONKA 1KI9A 4TLBA 3F8TA 3BAFA 1AZSC 1E2PA 4I1VA 2XTZA 2ZUBA 4PAMA 4BZQA 1CULC 4AK9A 4JL6A 4QBHA 4MKHA 2ZE5A 4OHYA 4URVR 4PX9A 3C5HA 2RMKA 1P9NA 2VL7A 1F2TB 2ZYWX 3EXAA 4TL9A 4DVGA 4IVPA 1Q21A 3BWDD 2W2TA 2W00A 1GDDA 3NXSA 1G5PA 3QKRB 3A36A 3NH6A 2DFNA 1O3YA 1P61B 4DLSA 3SDZA 4DJTA 3W90A 1W2GA 3I61A 1DAKA 2P5TB 2WKQA 1GAJA 1KMHB 3Q7QA 1L4YA 1P6XA 1QHXA 2IC5A 1G64A 1O87A 2FN4A 4AKGA 121PA 4Q9LA 5CLQA 5D3MB 4ACAA 4M1WA 5DHAA 4LC1A 4O2LA 1W1WA 5CK5A 4A0FA 1W2HA 4NU0A 5EE0A 2G0TA 3QNUA 1OB2A 1QG2A 3TQCA 5ANRB 2ZETA 3WBJA 2A7QA 1XF9A 2PMKA 4IOLA 1E99A 1K8RA 4Q7KA 2O5VA 5KUTA 3ZQ6A 5B64A 1E2KA 1T0HB 2ZI3A 2VHJA 3DM9B 2GJ8A 1G19A 4MGZR 5JJIA 5EUMA 1RFLA 1A4RA 4Q1BA 4KV9A 1G20E 4OQNA 4M8NE 3VHLB 4OKSA 2FX3A 5TDHA 4C4PA 4EUNA 3I5YA 4HB4A 3KUCA 4IDQA 1XEFA 4KHZA 2QY9A 3KDSE 1L4UA 4CZ2A 1G7CA 1E3MA 5FOUA 4BFWA 4YLGA 4Q19A 5AUPB 2X8AA 1HEIA 1UKZA 2ORWA 4E22A 2NOAA 1Z6XA 5FUVA 5EJEA 5J4LA 2XJ9A 4JKYA 2DR3A 4MRNA 1Z2AA 3UXMA 1YZGA 3AEZA 2ZRJA 3L82B 2AFHE 4LUCA 4RFSA 1UBEA 2C2HA 5FUXA 3FMFA 2R62A 3IKJA 1R5OA 3NTUA 2DYKA 2Z83A 4IEIA 2IWRA 5JMTA 2DB3A 3HR7A 3WHLA 3NH9A 3D6TB 1IJEA 1IQPA 3HYRA 2YC4C 4NMMA 1U8ZA 4FWIB 5EZ5A 2FNAA 5FTKA 1GNPA 3ZZTA 4XD7D 2QUZA 4CVNA 1N6IA 1BKDR 1ZD1A 821PA 1VCMA 3EIHA 2YVUA 4XD7A 2WMOB 3TSOA 1S1CA 2ZJ8A 3P1JA 2GCNA 4JSYA 3GLFE 1E79D 2BWJA 4TYNA 1IN8A 5E7JA 2P5SA 4DCUA 3E1SA 1E79A 1VHTA 3B78A 1EXMA 2JLSA 3IDQA 3LX8A 4PHHA 4EPXA 3ZD6A 1A2KC 4TZ6A 1JXOA 4MKFA 4ZV4A 4QRHA 4G5RA 3SJBA 4KYIB 5JCPA 3LAWA 4W5JA 4TLCA 4Q1DA 3KKPA 3FGNA 3RNLA 2H17A 4BEJA 1GL7A 3IILA 2GTPA 1II9A 3KKOA 3OIWA 4C0BA 3E2IA 2V7QD 2D2EA 1EESA 4ZCMA 1EX6A 4YMUA 2E1RA 5AK0A 2V7QA 2B8WA 5KSZA 1KIMA 3H86A 5AWFC 2V55B 3GLHE 1SKQA 3CUEF 5F9HA 3KFXA 4KCGA 3QBTA 4LJYA 4ZKEA 4ESVA 3WNCA 2RHMA 2B21A 4LV8B 3GJ4A 4JSTA 1XCMA 2WWGA 4MYTA 4HDCA 2FG5A 3KL4A 4V02A 3GLGE 5CIQA 1XPRA 4OI1A 1W4CA 1CU1A 1W7AA 1E2QA 5L3QA 1NN5A 5P21A 4JMPA 2GA8A 2F3RA 3AF2A 1T5IA 4QHSA 2V3CC 4NCJA 2OILA 4NCKA 5TV2A 2Q6TA 8OHMA 1DE0A 5CB8A 3DO6A 3IIMA 1P62B 4RZXA 1XJQA 1ZBDA 2KI5A 2X2EA 1XBTA 1TEXA 4CEIA 4ILEA 5CJPA 1Q1QA 3TW8B 1ZMXA 5HZHA 1OSNA 2KJQA 3WBKA 1KO1A 3T1OA 3CR8A 1YE8A 5BQ5A 2OXRA 3MSXA 2A78A 1OXUA 4YC7A
chains in the Genus database with same CATH superfamily
4IF4A 3LVBA 5LP6C 3OFND 3DDOA 2JA6J 3HB1A 1FFSA 5G4KB 1CR1A 1I7SB 3HCWA 4E5NA 3EGDB 4GYYA 1W4LA 3FUTA 5JZ9A 3BORA 5EXSA 2MBFA 1FJ2A 1LDGA 1J1ZA 3DEEA 1SURA 3A4TA 2IJGX 2ISCA 4K05A 4IHSA 4KYWA 3SICE 1MNAA 1PNQA 3K0EA 2HMVA 3DC2A 1XOIA 1BW9A 3WMWA 2V7GA 2PA0A 1J75A 1RCTE 3NHZA 1J8FA 3W2EA 5KJFA 2X1VA 4TYPA 5GAJA 4TV9F 3P0RA 4BFVA 4GZ5A 4O0MA 2XF5A 5EMLA 4HTFA 1DAGA 4V0QA 3CRNA 2JA2A 3GEBA 2XW6A 3G0OA 1P4JA 1TKCA 3CVUA 4I02A 4UNSA 3JQGB 5CG2A 1TQMA 3NHKA 1WCWA 3QEKA 1H5NA 4KOAA 1CB0A 2LY1A 4YX9A 1UBRS 4EJTA 1L5RA 2VHCA 1ID8A 3ZCRA 1LPPA 1GNRA 4OYHA 2JSPA 3WV5A 3IQGX 4RIIA 4EA7A 4BL0B 5TEWA 4RMNA 3SF8B 1CPYA 2H59A 5DIZA 2ISYA 1EWKA 2GBGA 1KAOA 2D62A 2F5DA 1U2DC 2QGNA 3HXTA 5K7FA 3WYNA 4MGRA 4MP8A 4OGFA 4O4HA 2QN3A 4RF2A 5P8WA 2BCEA 1OLUA 3INRA 3LXXA 3VR5D 2IYUA 3QE4A 1MOZA 2KHMA 1XX5A 2D0PB 4JJEA 4RCZA 3L1PA 1XDDA 1E32A 4P4SB 3E9QA 3SKVA 1WTAA 3KDPA 2DAOA 3TSYA 4DUYB 4FXOA 3CNOA 3RIMA 2KMLA 2NOGA 3ONEA 5F5XA 4QU0A 2EA2A 4DCGA 4O4JB 5CLIA 5YASA 3OI7A 2NAZA 3ZH9B 2WBMA 4QXAA 1NVXQ 3WLRA 1JHQA 2A9RA 2XV1A 3HKCB 4XUDA 4B3IA 1HI9A 3RYHA 3URKA 4L27A 1BDHA 4PYNA 1PL0A 4EGAA 4L07A 3UV6A 4DA4A 3HB7A 3SZRA 1VCHA 2PXXA 5DB4A 2GT1A 5I7WA 2CRGA 1YITI 1HT1E 5CVDA 3D59A 1P17A 3TW6A 3FH0A 4B2YA 3MOIA 1ZC3A 1ZMRA 5K6AA 3UMVA 1J5EB 4CMIA 1FVOA 2O61A 3JQBA 4GMFA 4JLSA 3GFOA 2I2XB 4WEOA 2QUKA 3Q88A 1E7WA 3E58A 4GI5A 4LN1A 1WUHS 1LJLA 3L0DA 4ARAA 5FT9A 5FL7D 1B76A 2ZSHB 2YOHA 3C41J 5J5AA 3KJFA 1JFTA 5DM70 4B3CA 2HA6A 1I7LA 2R8RA 1ILWA 4PG4A 4MQEB 3HA3A 2JHAA 4C9YA 1RR6A 3IC7A 1HLPA 4EVRA 1RIFA 2IYFA 4EABA 3AHCA 4XSXF 4QUBA 3OM8A 4WESA 1P1KA 3SQMA 1WCIB 4OJMX 1G21B 3EVCA 2UUAB 3X1MA 2PH7A 3O8DA 2OQRA 2ZJOA 3I6MA 1HYHA 5D1NA 1RZVA 4X6XA 4AKEA 3QLVC 1IH8A 4BJ6C 4N54A 5CX1A 5FEMA 2BXZA 1O9HA 2OXFA 2V6GA 2BKAA 4DMFA 3AL2A 5E9QA 4HNQA 1AV6A 5CB4B 3I59B 2HZ7A 1SOMA 4IHYA 3PXXA 3WI7A 3G59A 3W6PA 2Z4RA 4L8LA 1A7AA 16PKA 1X15A 3IYLW 4M37A 1K79A 1F51E 1XLUA 4JLWA 1Q7EA 1U0RA 5A4AA 2VJBA 1PR5A 2V0GA 1XRSB 2BGCA 5DNUA 2W6CX 4URXR 3EXG1 1SUEA 3ZDCA 2DOFA 1B0UA 3OQPA 2BM1A 3R75A 3O47A 4JHXA 2VF8A 1WSWA 4QPZA 1QVWA 4HV4A 5F3RA 1NVBA 3RAFC 1N4DA 1VG8A 4F4FA 5BW4A 4LJKA 3RTDA 4J03A 1H8HD 1U3UA 2RQQA 2DUMA 1LBTA 2NZWA 3ZQ4A 2Y0SN 1ZA1A 3LG2A 1X87A 5HF5A 4R8MA 4G8BA 3E4CA 4DKJA 4D0RA 4IX7A 5JHGB 2CUNA 4PAGA 4S1TA 1M75A 9GPBA 5TPZA 1HC7A 2IY8A 1S3SA 2C83A 3PQKA 1SG9A 3GLQA 1VRVA 4EDHA 2N8GA 2CBXA 2D1YA 4FSHA 2RGGA 3K0SA 1JL3A 2IYVA 1L7QA 4E88A 2RJ3A 2VQLA 3Q72A 5FOWA 2BXYA 4ZARA 1V2HE 1VPWA 4JX4A 4ZOLA 5AI0A 1VRWA 5LDHA 1YE9A 5CPBA 1O95A 4K86A 4X9XA 2I99A 4CUGA 1J9ZA 1YK1A 3IPRA 2CVZA 1QF9A 4JYKA 4ZFNA 1JDBB 4IBOA 3QF7A 4NC9A 4UXJA 3I58A 4PJLA 3OKPA 2P2LA 3M6UA 3RWOA 1KNXA 1UMBB 4MDFA 4OQ4A 2CYCA 1XZ8A 3AT1A 3CF4G 4HB2A 2EIXA 3GPBA 3RSFA 1U8UA 3E9NA 5SZIA 2VBZA 2UZ1B 3AFHA 5ADHA 1XZJA 2XMPA 2JF0A 4YECA 3GFMA 3KOUA 4L51A 5D6NA 4IUDS 3TL2A 5GZ3A 3B7PA 1BKYA 2PLWA 4QU8A 4FHEA 1JBKA 1UPBA 1P3Y1 3ILVA 2ADUA 1FLDA 3OVMA 1E6EA 5CNMA 2P0YA 2IUFA 3FGZA 1KC3A 4U5QA 1PLJA 2A1UB 3ZBUA 4ZJPA 3WGTA 1ZH4A 4KVAA 3JAMA 1W87A 3U1VA 3PNKA 1TQDA 3HDGA 1WB4A 2VXYA 1ON1A 3R7NA 1NV8A 3N0VA 1XFAA 3TVYA 4MR9B 4TOIA 5BNTA 5B3AA 4R68A 1TF2A 2ZJ6A 4MPJA 4DDUA 2YFKA 3Q7EA 4DIEA 1HE2A 2D5CA 4DVJA 2NUPA 3AUTA 1ORTA 4A10A 2OVBA 5I5EA 3UHPA 4JAVC 3MBOA 2YNMD 5ILVA 3RF6A 3GNTA 2DMNA 2DA1A 1DINA 4GOXA 4LLGF 3FWNA 4TMYA 1VYTA 4UB6C 4ABTA 1FS6A 5IP6A 3IUMA 1JDBC 1JN0A 4P31A 1T8UA 1TWFJ 3BTSA 2VASA 5AHWA 2CLLB 1Z05A 3OE7A 1X7GA 4MWDA 4Z51A 4GRDA 2VDLB 4LHSA 2V9ZA 1DS6A 2XVMA 1T9GR 1NY5A 5T6BA 4V0OA 2YFQA 3HFSA 2WIKA 3MUNA 4BHTA 2YWHA 3SXUB 2GWRA 2P9JA 2OUMA 3HMKA 1MIOB 3P4YA 5DYIA 2VZ8A 3A6FA 4BJ5A 2L4MA 3EQZA 4D99A 1VQLI 5EKXA 5F12A 2RAFA 5LA6B 4D0NA 2BHZA 1O0BA 2RHCA 3QEMA 4BJ1A 2QE7A 4X41A 3SHVA 3DJFA 2OD2A 5DIFA 1IHUA 1DCMA 4MV5A 2VIIA 4DFDA 2IYSA 5A7FA 2PPVA 2II6A 1T5DX 5FP0A 4MJ7A 5LL6P 3KZIC 4WL0A 3W9BA 3COJA 4QGBA 1PFVA 1R7JA 2WAXA 3WIOA 4M0MA 1U02A 1KI1A 1K61A 3DWGA 3IR5A 4HLDA 4MW7A 3HY6A 1OVGA 1M7BA 5T5QA 5BMVA 1JFFB 3ZG6A 5FEUA 2QIPA 4P92A 3AR2A 1OIVA 4U3JA 1VFCA 1EFVA 4YT2A 4HSRA 3CJTA 5IFKA 2O3JA 3OYKA 2PMBA 3GGPA 3F7TA 5F51A 3ZE9A 3GTOJ 3K1MA 2E48A 4PG5A 2C5SA 4OB8A 4F45A 3P0FA 5KTSA 3FFTA 4G3XA 4J1TA 2GAAA 2VRCA 2GXGA 1L5HA 1BJKA 1RPNA 1MT3A 4RGQA 2DULA 4IP0A 1NOIA 2X2PA 1Y81A 1YX3A 1MKMA 2BY1A 3U3DA 2PQ8A 4LYJA 4PGHA 1P33A 4CEJA 2ZOSA 4W8OA 1RJFA 2HF7A 4KODA 5DTQA 2GXQA 5AJWA 1K63A 3MRVA 2V4MA 2Q3LA 2CJJA 5EMHA 2WSMA 4IKPA 3FBIB 3IE0A 3FLEA 1UC5B 1DWUA 4CQLA 2WP0A 1VKHA 3NGXA 4PXAA 2BM0A 1PTKA 2BF4A 2GAIA 1ZINA 4JENA 1WMAA 4BO6A 4EG6A 3ZQ7A 1PNVA 4GIBA 1EI9A 1PWZA 3CEJA 4MKGA 2XUPA 4MR8A 3RFCA 1NHGA 3AFOA 4ND1A 3HZHA 1M34E 3IVXA 1P2BA 1FTSA 1AKHA 2L02A 1WW8A 5LYJB 3MT7A 2C6YA 1Z3XA 2RG1A 4P4NA 3BSSA 3DE2X 3CUOA 5IAGA 4NULA 3R3UA 1FC0A 5WRFA 4EFKA 1E2JA 2Q3DA 3M81A 3FBNB 3H1AA 4JELA 2IBDA 2ODPA 3ORSA 2WWTA 2C9ZA 2WTEA 4AKHA 2HTSA 1F60A 3K1NA 5D4SA 4LYAA 5KAIC 1JSZA 2IT0A 4ZI3A 3I39X 4YQZA 2HZDA 1HQKA 1Z5GA 4CG3A 1U7DA 2FZCA 1G5QA 4ZZLA 1Y3FE 1QE0A 2HSJA 5KMGB 1UKAA 1RRCA 1UWKA 2OYRA 5IHXA 4FDAA 1XMSA 4TLEA 4WV3A 5C5DA 4DR2B 1VCIA 1BW6A 4BAGA 1MW7A 2TYSB 3TEJA 2C3PA 1E2MA 2LYCA 1ZESA 3R8XA 1BCSB 2PWPA 2ENWA 4Z4CA 3U61B 3KP6A 5KTKA 2VT7A 1EZZA 2P9FA 4FOTA 1LLDA 4PU0A 2W57A 1KFCB 3DCJA 2DH5A 2M98A 1R15A 4HWPA 1I6LA 4JT2A 3K5HA 3EZ2A 2PJZA 2R6DA 3TUIC 2F3UA 1D9ZA 2HEIA 1CRLA 4Y98A 5DOZA 3EARA 3EGEA 1DIOB 5AVXA 3DLTA 3DDUA 2OBLA 1VL6A 5AVQA 2OBXA 1JEAA 3F8BA 1E7SA 1QPZA 5TVKA 1YQTA 3RFFA 3CCLI 3KCNA 4W5QA 3OOUA 4D4MA 4YRSA 3AZOA 1KJWA 4ARCA 4JBWA 3DEYX 4W9MC 2BMJA 3F5MA 2G25A 2C00A 2IKSA 3WWOA 1SB9A 1KA8A 3Q0TA 1PZGA 5JRZA 2I2WA 4X20B 1JR6A 2AEJA 3I09A 2J5PA 4TLAA 3OYDA 2BV6A 2VDUE 1MBFA 2FN7A 1FEXA 4RC9A 4J7XA 3OZWA 3KKNA 3PPWA 1QHIA 2O9JA 5THKA 5K0EA 4ZDWA 4NPCA 2DQ4A 5E6UA 2FP4B 2DG2A 3D7NA 3VZRA 2LNDA 4KIWA 5EXXA 4PRKA 4HDKB 3F2IA 5FD8A 4M88A 1YU9A 3DMTC 2I8CA 3WJ1A 3QRWA 4CLEA 2HDHA 5BN3A 5LIRA 4FCCA 3EE6A 1IMOA 3AHEA 1FYWA 4MKIA 3LHIA 4UV9A 3CUQA 1F5SA 2B8TA 2IS6A 1GKLA 3AHFA 1P5FA 4PZYA 4WBXC 1C1XB 1JZQA 2H1WA 2D1SA 5EZYF 2J4FA 1GN8A 4JLOA 4NKRA 5CDFE 3KYCB 4LIVA 2R86A 3RS2A 4YRGA 5FOTA 1U4SA 2VXDA 4E5YA 1YDWA 3ZXSA 3PUXA 4TS1A 2LTPA 1TF7A 3Q9VA 1NKVA 4BP8A 3IBGA 3CM0A 1RQ7A 2HFKA 4KVFA 1NP7A 1NYRA 4R8VA 4YO7A 5C8VA 4LS3A 2YS6A 2P78A 2V8OA 3STUA 1ZD5A 5FUBA 1XZCA 4CCJA 1KS2A 4UPVA 1TW3A 4DXDA 2NACA 1E1CB 3AAFA 3DF7A 1XEWY 2J3EA 4N0PA 3NRCA 3UAWA 1OMIA 2Q2OA 1AKWA 3T38A 3IAM1 3U3MA 1PN3A 1SMKA 1KVQA 1IG0A 4XQ9A 1XS9A 3MERA 3DBHA 3HI6A 5BN4A 1PE0A 3AIIA 3PCRB 3FFBA 2G0AA 4GX0A 2CMKA 2KDZA 5TGDA 4AS2A 2GJ4A 5K5RA 3CRVA 4YDSA 1V1RB 4DV0B 1G4DA 2LBPA 3ESRA 1T1SA 1QQIA 5FF9A 3OPVA 3SBDA 4DZZA 3R0AA 1RXEA 4II2A 1F1JA 4Q9AA 4TN5A 4BUJA 3T1YB 3QE3A 4WKOA 4FEAA 2P6OA 3F6VA 4UUAA 4FQ5A 1BVUA 3T5CA 4B33A 1AOXA 1UOEA 4YAIA 4K6OA 5SYAA 1HBXG 5J8FA 2B2XA 3W5HA 1CVLA 3ZW8A 4UC0A 2REQA 4ZDKA 1WI9A 2HIMA 4GOMD 2FPPB 4RSHA 2PGNA 3DAOA 2JLWA 5GPBA 2L54A 1XMVA 1ZC4A 3OOSA 2XKAA 4NDNE 2EHJA 3JQ6A 2V1XA 3IBYA 3VBEA 1SULA 2QW0X 3WK8A 2JGDA 5DCUA 3K4JA 1K9SA 1VDZA 3NHJA 1JH9A 2H2HA 2X0JA 3MWKA 1AUOA 5BNIA 3S40A 1IBRA 5JQGB 2AUMA 3L8MA 4L76A 2QZZA 9LDTA 1E6WA 2BDEA 4W6QA 1CDEA 5C7YA 1E2IA 2G0NA 4QDJA 2D2XA 2Q1XA 4R5HA 2OWEA 5GPCA 3LRTA 3EN0A 1LSOA 2ECBA 2JDIA 4UEWA 2AKAB 3Q7SA 3W6VA 3KJIA 3MQ0A 3PU6A 2H18A 2JFBA 2JGRA 3ODGA 2ON6A 3M5CA 1YZNA 2WJ4A 4PIMA 4EBBA 4ZT3A 2J8ZA 4MVJI 1DEXA 5AK3A 4B6FA 1SUCA 3HJRA 3OLWA 3GDOA 3LBHA 2IXDA 4FYXA 4CDRA 2DQKA 4CG1A 1J25A 1TFUA 3KAQA 1NNUA 2WAOA 4LC0A 4KQ1A 1K4KA 3NPAA 2VUUA 2UUZA 1H1LA 1Q22A 4YFVA 2JZCA 3ZXIA 3M9LA 2X0LA 4DN6A 2J41A 1UPTA 3GEHA 2OBBA 3QJ5A 5EPEA 2M2EA 3CPJB 3RRMA 3FMSA 3VC3A 1Z47A 3E81A 3MFKA 3M4NA 4XKCA 3AOGA 1E59A 3QEBZ 3KNZA 2V6BA 2ZRFA 3N7UA 3E6BA 2XCLA 4MJLA 1DO0A 5TQ2A 1FUUA 1LWOA 1U0HC 5REQA 1THTA 5JRJA 1NVMB 4CM8B 2A8YA 2HLDA 1GPLA 5CT5A 4LEIA 3OOPA 3OTWA 1U8EA 3M6LA 2C2KA 4C0AC 3GGSA 1Y39A 3VSBA 1YSCA 5G02A 1SZCA 1EU1A 4YAGA 2Y30A 1UJMA 1UM8A 1KOFA 2WYIA 3UAYA 3SFIA 1BVHA 5D3MA 5JS2A 3B13B 4C78A 3NHRA 4QUEA 4P9UA 3RYPA 3F8TA 5IBCA 4MW4A 4OXYA 4AK9A 1F9AA 4JL6A 1GEEA 3CNBA 3PE4A 2C0CA 1X2EA 2FZKA 2LTAA 4IIEA 3NXSA 1T4CA 3OP1A 1KOJA 3VHXB 1WI3A 1USGA 4F72A 1MU0A 1L4YA 4NABA 3I9FA 2AS5F 3H5TA 4EBFA 2QM0A 1IUPA 4JJFA 3ZDEA 1AKRA 5EGNA 2PTHA 3OG9A 2V0CA 1T0HB 2Y4OA 1ZRFA 2VBGA 3HA2A 4GOOD 4D7NA 1FCJA 1WQ3A 4HB4A 3UT6A 1F4LA 1I33A 4EELA 1KWKA 4FP9A 1XEFA 3FIJA 1IPFA 2PZBA 4DJEC 1OFGA 4DLPA 4MRNA 1XGSA 2ZRJA 2DRIA 4D9EA 1J97A 4YRZA 2IW5A 4KQWA 4MV0A 1IQPA 1ZY2A 3OMLA 4PN3A 2P7VB 5KOJB 4RZQA 2WF7A 2QT9A 4YY3B 1YZYA 2O1EA 3AIOA 3C3CA 2UVPA 2GCNA 4JSYA 3KTOA 2CSXA 1IN8A 2Q1ZB 1NBIA 4OMCA 3AYZB 4W1UA 1LDMA 4MV4A 3N7AA 4MB6A 3KKPA 4HW0A 1SN7A 3PSIA 4IJVA 5AW7A 2DX7A 5IDYA 2RH4A 3TOAA 2K4MA 2PSSA 3SDSA 4RABA 1Q1GA 2B21A 4LV8B 3VISA 5F7XA 4KGVA 4XX1A 3ZPXA 4QDOA 4J1NA 3W4IA 2KFDA 5ADUS 3CC8A 2F3RA 2UZKA 2C4HA 8OHMA 2X2EA 3C6XA 1P8AA 1R6VA 7YASA 1Y3BE 3T9DA 1KVRA 1WO8A 5FROA 2LIVA 1O2DA 1R71A 1V9LA 4A3GJ 2P6MA 1DEOA 1R1VA 2OKCA 2KZVA 2VBWA 2GBPA 3X2SA 1IZZA 4PCAA 1XQ1A 2PY6A 4C0LA 4UUSA 1KH3A 3FNRA 1PT6A 3UH1A 1FQOA 1X38A 2QRUA 1QGOA 4R3UC 2JFOA 2O8KA 3ONVA 1BROA 3L7YA 5JFGA 3T4PA 4KQ6A 4YGYA 1DBSA 3A26A 2E60A 3HOSA 4WCFB 4UHFA 2PX2A 4UM9B 2Q3FA 2ZXJA 3OQNA 4ZYDA 3VR3A 1QMPA 2E7XA 4B74A 3AVYA 5HILA 4PYLA 1JQLB 3J7AY 3JQDA 1GEGA 5DH9A 3EGXB 1V11B 2A05A 4DPKA 4BN0A 2JGFA 4ETNA 2P1RA 2P5YA 2I71A 2GZAA 5DK4A 1WHTA 1B8IA 4JASB 1MBGA 3OZ7A 2IDJA 5HKOA 1TO6A 3SBXA 5EF6A 2FW9A 2QTGA 1G8KA 3QM1A 2GK3A 1ULZA 2B1RA 1PNTA 4BLQA 1HA8A 4MGIR 1IUKA 3WWEA 2LCIA 2F2TA 1BGWA 1VL2A 3TINA 4HZUA 1AU7A 2XZTA 4KICA 4PPNA 2GFHA 3LT4A 4FNAA 3P9ZA 1WSUA 4M3BA 2HRRA 4MR7B 1T2FA 5KVAA 1NONA 4JQFA 2V8BA 3QYPA 3C6ZA 3WP1B 1JUDA 2VWQA 3CUKA 4JVMA 4P5EA 3VI3B 5C7IO 3EC1A 5FRNA 1QH9A 421PA 1X9HA 4F85A 5E4JA 5HDQA 1L8XA 1RYZA 3LT1A 4I46A 3QP5A 1N2CA 2LREA 5LPNA 3IBCA 3E1GA 4WCFC 4KYTA 2ANBA 1QH8A 1WABA 3NIWA 2DHCA 3UNXA 3L18A 1E2UA 2G67A 3QWBA 4TKZA 2B98A 3ZZ1A 1DT5A 1KK2A 4GD3Q 2Q5FA 1I5RA 4RTJA 4BC0A 5HF6A 3RRJA 5SY6A 2J1LA 4DPMA 3P32A 1PUIA 1DEHA 3DTEA 5BRNA 4XYLA 3I3SR 4LXQA 1C80A 2IYYA 2WADA 4HAOA 4WZAE 3NV9A 1FQJA 1V3QE 4E21A 4JBNA 3M3HA 3EYWA 4S0HB 5I7EA 3I2JA 3FOAA 2RHRA 3JTHA 4I1PA 1K08A 5EG5A 1GLNA 4BKPA 1T3HA 4BWVA 3ZR8X 1SZJG 2YWFA 4BO2A 1ZQ3P 2RJOA 1AS3A 2AXTC 3KYDB 3TDZC 3G0BA 1AA9A 2IBMA 1NNSA 4MW6A 1C9YA 4W1SA 2HKXA 4EG4A 3NJRA 4P81A 4B44A 1KU2A 3WTXC 3I9KA 2PJDA 1H23A 4KE6A 4DARA 3MLBA 2XZOA 3SZLA 2KDOA 5LP1A 2O1WA 1FSGA 1R5GA 4L7QA 3VNVA 2HHLA 3G1OA 3L04A 4E12A 1HFWA 1SXQA 4CQMB 3QPCA 3DR5A 3BTUA 3BIFA 2QQ8A 1JT6A 1C1DA 4HGYA 3PF8A 3C7KA 4G01B 2PSFA 5JVTA 1AHDP 1AS0A 5JS7A 3MTEA 1ZAOA 2P7CB 3FSGD 2DFVA 4IKFA 3V8VA 4BDSA 1ADFA 1KONA 2XT6A 4IDEA 2FSGA 4RD4A 4PQFA 4HWTA 1WMEA 2NAFA 4Y1GA 3FG9A 4R81A 5ALYA 1QBGA 4WZAB 3CGWA 3IVAA 5EJ7A 3ILSA 5KNCD 2QTZA 5GTIC 2OAP1 1EX9A 4QVKA 4H31A 5JI2E 2QRHA 2F3PA 1CB7A 1V8PA 3FDZB 4LSMA 3ZCVA 1EP9A 3IPYA 1RKUA 1E5TA 1LDDA 3C97A 4QWMA 1HFEL 2CNNA 3VU1A 4QUAA 5TMDA 3UYKA 3DOCA 2QUJA 1MUUA 1GUYA 1ECLA 1VKZA 3COVA 4NCNA 5L3DA 1BDBA 1GPJA 4JV5B 1IEQA 2FB9A 3KB1A 1CX9B 2HB6A 3ICPA 4R9UC 3E6DA 1R5ID 1RWQA 3K20A 3RRNA 3A11A 3NV7A 2GPAA 2OBYA 3NWBA 2X22A 5HLTA 1JLSA 2VUSA 1EUDB 3MMSA 1V8BA 3GVHA 3OE4A 1TXGA 4ZTBA 1D8AA 5DK6A 4LZPA 4YAUA 3GJ3A 3LU1A 1JHAA 3L7IA 4KK3A 4E1AA 4H4EA 1WPXA 4RBNA 1X3ZB 3BWGA 2IIVA 3TZ6A 5F5LA 4OAYA 2BBWA 3HYCA 5DTEA 4CZCA 3IQZA 1Y8CA 4D9KA 4LITA 4ODIA 4YJGA 1QIDA 3W5AA 4NX2A 1JJBA 2O8EA 2WINI 1Q91A 4C7BA 1PG0A 1W4BA 3F8MA 2LVSA 3O5AA 2P41A 4KUGA 3ZJ4A 2G4LA 5HUHA 1L2TA 1RJEA 4HQOA 3HN7A 3KLBA 1DT3A 3ZLVA 5HWSA 2MD0A 3HJNA 2Q2EB 1FQWA 1DJNA 3WB2A 2BGWA 4XIYA 1U8CB 3G7UA 2Z4TA 3BD6A 1YRQA 4PF1A 2FVYA 2ZJYA 4DL9A 5AKJA 1JA0A 2R7XA 4CR7A 5AQEA 4II3A 3TW7A 2RIPA 4P08A 3DTYA 2JKZA 5SY9A 4IUBS 3X2FA 1PP7U 3ZLTA 3ZGLA 1BWPA 1HE1C 2MHCA 5DSZA 2ZZMA 2CLSA 2DQYA 4WY8A 2R7OA 2CNOA 3EXG2 3WKBA 3S2HJ 5JROA 4MVJP 2WYWA 4B3SB 4F4IA 5CFRA 2P8SA 3FWEA 1N75A 1JJAA 1V5WA 1E8NA 1SXIA 1OC2A 1P80A 1GQOA 3G2LA 3AVQA 5HZKA 1KJZA 1PV1A 3OYHA 1ZYRF 3RUIA 4KA4A 3NM5A 4EJSB 3JSPA 1RZRD 2BMAA 4IH1A 1E94E 3KOWA 1Z07A 4FYHA 1BU5A 5FWXA 1MMGA 1KEUA 2WU0A 2RBEA 4A9AA 3DFKA 4DCMA 2P69A 4TYYA 1EUYA 3HOUJ 3R3JA 1ORIA 4NBWA 4HZIA 1TT0A 1ND5A 2LWIA 2WSYB 2C4TA 4DEXA 5JAOA 4M6VA 3AETB 3I01A 3R6DA 3PYLA 1CE8B 2QLZA 1VL5A 5FOSA 3V8LA 2ZJZA 3JYHA 3R5TA 3PHCA 4G5XA 4RH1A 1ZP6A 1AURA 1KHHA 4EFMA 1A7KA 1RI3A 1KYXA 1DMRA 3SQNA 1PGOA 3C4QA 1K7AA 3QKTA 2BV3A 3FTCA 2EZHA 3BE6A 2FUG6 3SI7A 1E2LA 1R2QA 1SOUA 1FBQA 1JLLA 2Y9PB 2AX3A 4OK6A 4QXOA 4LY0A 3GRRA 3KP3A 2OMEA 4GVXA 3BMNA 2NS8A 5K4AA 5LRSA 1AO0A 3W8EA 1JBEA 3BH0A 5EWLA 3S8YA 1NASA 2R93J 4JP0A 1DJQA 1XXHA 1B1BA 1QQAA 2R25B 2CMDA 5EZGA 2WM3A 1ND6A 3E8XA 2QG6A 5B1EA 4ZGBA 3H11B 1N2XA 3PO3J 3ZBPA 4Q1VA 4LNUA 1AQLA 1UJ2A 2NTNA 1H8EA 3RS9A 1A5ZA 2G06A 2PX4A 4PW0A 3IJ5A 2PWBA 4DJ5X 2Y1CA 3KP4A 4YEDA 3ZV6A 5DNDA 3R6SA 4LECA 4EJSC 3OIPA 1JKMA 1V7QA 4Q1EA 3HLTA 3OEHA 3AZQA 1F2VA 3GFFA 1A69A 2VJKA 3EXHB 4RO0A 3CLVA 2IXGA 1YC2A 2HYDA 4GOJA 3WLAA 3JCUC 5CDYA 2FBIA 1D9XA 3H65A 1W49A 1A88A 3LDFA 4IO9F 2MYNA 1CHNA 3S4YA 4HMPA 1ORHA 4MKRA 2OZUA 4UUQA 1RXCA 3AM5A 4P4GA 4Q7MB 1U0BB 4ZI7A 4JI0B 3STHA 4DA9A 3C3BA 5K8UA 5EA2A 5TRDA 2CSUA 1VHWA 1U81A 2OUIA 1BI3A 1ZMTA 3RJ9A 2G5TA 4I1RA 3TIFA 4R4JA 1SU4A 3ZN2A 1UG0A 3MSCA 4IDCA 3P52A 4INOA 5CT4A 1ABEA 4DMKA 4OP2A 5DI3B 3KCQA 1Z15A 2G08A 3WS7A 3AM1A 521PA 2W1OA 4KR7A 3S2SA 4AJ2A 3F8CA 3VB2A 3BVPA 1D1TA 1OXTA 1OF1A 4LX8A 1XJWA 3QNMA 1NIPA 4WBNB 3MVPA 1W25A 3V48A 2WV0A 4PSAA 4IFBA 2RK4A 2ZTMA 3ZHVA 4QNMA 4R9VA 2VJMA 1X3WB 1IY9A 2QM3A 3LPDA 1OR7A 5JAHA 3Q6MA 3EODA 1I4LD 3SYKA 4RK5A 3VXKA 4IRHA 1OLSA 2X7XA 1Y3HA 4QD3A 1AY0A 1T0JB 4ZEWA 2OG2A 3L2RA 3K2IA 2RNGA 1WOMA 1ZJ4A 3O83A 3EXHC 4JLNA 4FFMA 2VN8A 3EYAA 3U6BA 5FNVF 1G9XA 4GYGA 5KYXA 1Q84A 5KNDA 3LP6A 3S2WA 5JFOA 2BEKA 5CDTA 4RJIA 2EIHA 3BT9A 1C0EA 2JZNA 3PJGA 3HRUA 2FWAA 1JEYB 3E5NA 5AOAA 4QXQA 4DV1B 3PSAA 1YD7A 1PS9A 1XVIA 2FZVA 1NN1A 5IVPA 1F8YA 5BSTA 2O0KA 2YVQA 2FZ4A 1GUBA 2Z2SB 4KR3A 4AO7A 4ZIRB 1DQZA 3T1NA 4WVLA 3LT5A 4NC8A 4FNMA 5EJMA 4FONA 5AM4A 2DA3A 5JVDF 3FDXA 3GK3A 4L75A 4AG5A 3BGDA 2NZUG 3TTXA 4V19K 4ON9A 1MH1A 2YUIA 4XCXA 3ETGA 2F6RA 3E82A 4JBLA 3X1XA 2JLYA 3KK0A 4J8PA 1FX0B 1SD2A 3MCAA 3EDOA 4E5PA 4PZ0A 3FSJX 1PHRA 1SGWA 1LK0A 3WYFA 5HE9A 3EXIA 5A62A 4J9UE 1I30A 5AI9A 2HQRA 5M5WJ 2SECE 1FYXA 4MVJA 2CXRA 1MCZA 1TVKB 4W5OA 3TCNA 1XTBA 2FKNA 3M8KA 2OXTA 1VL0A 2DQSA 4KWHA 2W9XA 1QDEA 1YC5A 3RTCA 1D4FA 1IN1A 1Z06A 3O2JA 3TQIA 3FVTA 1OT5A 4OIFA 2A0WA 1UT8A 1AKYA 4GFDA 2RGBA 4EF6A 1WMFA 4LGMA 2KB0A 2Z6QA 4LOAA 5E9JA 1N6RA 2YY6A 4L22A 2CLCX 1RE1A 4CG2A 5IVHA 4EZBA 2X8JA 2QTMA 3DE6X 3WB1A 4MLDA 3EEFA 5GJCA 3BR5A 3NFYA 1FRQA 4F9GA 3S93A 4G4GA 1J1IA 2EKZA 3IFSA 4I1SA 1ZOOA 5JNVA 4CBVA 3H3UA 4AAYA 1JE1A 3EBOA 1ZSNA 4DTCA 2EV0A 4MHSA 4ENSA 4OQXA 3GVXA 2WD7B 1EJ0A 3N2NA 3ASYA 1T29A 3NTVA 3PEEA 2A9QA 2ZRDA 4AICA 1RQRA 3ZU6A 3L6BA 4JR1A 1GZVA 3N2KA 3WOVA 3EEYA 1GTSA 3K0CA 2CL6X 2Q3MA 5EE1A 4E03A 2WSIA 3GCWA 3H9UA 2QUFA 4ZVPA 4R54A 3BMCA 4B5KA 2W0SA 4JP8A 2E5ZA 1DKNA 4ZT5A 4PLCA 1G21E 3NT4A 5K8LA 3MMYB 1MO6A 2PKQO 1BG6A 3NJ8A 2XADA 4CSWA 4O4JF 4IHKA 2NVOA 4N8EA 2EXXA 4CE6A 1U1IA 1R74A 4Z54A 1VECA 3HY4A 1S2GA 5LZ5A 5K05A 5FULA 2IBSA 3P20A 1OE0A 5EJ2A 1NVDA 3AF0A 1J9GA 3HCDA 4L0ZB 1CJUC 2IGTA 4JROA 2Q0HA 1UHWA 3HACA 4K88A 1DKUA 3IUOA 4PJ0C 3EC7A 4R40A 1I7DA 3K8ZA 3CH6A 3NHFA 2XDWA 4RB0A 4DJJA 2CHGA 3LBIA 2IIQA 2Q07A 1UXIA 3KLOA 3ZJVA 1ELOA 2HZBA 3FXLA 2VLAA 1WCYA 2PMWB 4MVJM 3AONB 1OWPA 3G4SI 1O7JA 1T3TA 4LHVA 4Y15A 1XLWA 2GD0A 2QRMA 3DHNA 5JLAA 1G291 3GUHA 2R5NA 1EFUA 3QE2A 3QELA 4HVLA 9ABPA 2AIRA 4QWWA 1XGMA 1QYCA 3M6AA 2OFWA 4HVTA 2BMDA 5BQOA 1I0IA 3KZMA 1KJYA 4J16A 3IPLA 5LCXA 1AHPA 3ENWA 2EATA 2YS9A 1Z6RA 4I55A 3NEAA 4TRNA 4K9MA 3A4MA 1HDXA 4BHCA 4B48A 4AP6A 3K9FC 2UUBB 3OTGA 1A8UA 4B4UA 3W04A 1E9VA 3RLFA 2HMAA 5HP4A 4D4HA 1AXRA 4IICA 3JASB 3CCJI 1ODSA 5EWMB 5ALHA 4MV1A 1R9JA 2O3UA 1UBKS 2BPOA 4FFLA 2H0AA 3EXEA 1EXVA 3M1LA 1BW5A 3NDIA 3OA0A 2OQIA 3UGKA 3UA4A 2FPGA 4W7SA 3BBPA 4XAQA 1XGNA 4PQGA 4XYGA 5CB4F 3VAZA 4XFDA 3VVCA 3AI3A 4EQ6A 3LCCA 1ZH5A 3KKZA 3P9YA 1I1NA 3A0BC 4ZAZA 2GNAA 4FNGA 4EP1A 1PO7A 4W1QA 3CZ6A 3IAM2 2WP8J 4TUYB 4N7MA 4IZZA 3PFWO 3KJZA 1N0UA 2R7KA 2I3GA 1K3TA 1YVDA 4IHXA 3T61A 4ZRMA 3CRQA 1L8QA 2YRXA 5CAEB 2D1VA 4Q6WA 4AXBA 2QU8A 3L01A 2GCOB 2HHHB 5JYCA 3AV0B 1ZUWA 4EHAA 2CLFB 4AJJA 5K4HA 4XB6B 4G1BA 3BAFA 2ZYIA 1LZKA 1SFRA 5SY4A 4OIQF 4QBHA 3TIVA 3V7SA 4PX9A 2E19A 4YJ2B 2ZYWX 1F2TB 5B37A 4YQYA 4DOMA 4A8TA 5FKOA 1VL8A 1C4KA 3OSZA 4EEKA 4UPEA 4BZZA 1Z7WA 1W8IA 3G3EA 1BOAA 2Q0OA 3SG0A 1NW4A 2XE6A 5A05A 3F7OA 3O6VA 4UU8A 4PNEA 2ZW9A 2Q6IA 2JAXA 1E99A 2OTLI 3KSRA 4D5GA 4OL9A 4Q1BA 1GGJA 4OKSA 2FX3A 4E46A 4CZ2A 1E3MA 4AX8A 4TXLA 4RX1A 3K6JA 2AT1A 3FCUB 1E5DA 3MINA 1RXYA 1SC9A 4A1OA 4RFSA 1VSVA 5F4BA 2YIDA 3NTUA 1MMFB 2DYKA 3T3DA 2O19A 4I5IA 2YC4C 3IIEA 1U8ZA 4BQQA 1BKDR 3GT3A 4XIIA 4GL4A 2R8XA 2WMOB 2IUEA 2NUAA 1FRZA 3T7SA 2QUAA 4PG6A 2A3NA 3ZD6A 2P90A 3NI2A 4DLAA 4C3JJ 4F46A 4KMOA 3ZE2B 3VYWA 4ZCMA 1RRJA 4KWCA 1KARA 4K9OA 2PJUA 3GLHE 5CVCA 4FB5A 1RAGA 5F7ZA 1QQ6A 3C5EA 4IQ4A 1QZUA 4JA0A 1NV9A 4KPUB 4MDYA 5HBGA 2AS0A 3T7IA 2WTBA 3FCSB 4B4OA 1SWWA 1WDLA 3TW8B 1NHWA 4PO3X 1A9TA 3S0JA 2JKVA 1M10A 3PPVA 3COWA 1P4SA 5BUZA 3PG5A 5CBKA 1YL5A 3CFYA 4MTLA 2P9TA 1J0XO 2XQIA 3OFNA 4XQCA 3UKDA 4ARSA 5EZ6B 3DNMA 2YXNA 5B58C 2RAVA 4EGCB 2AFHA 3OM1A 3AEQB 3RARA 2DVMA 1P1JA 3D54D 1ATZA 3HRHA 4E94A 2VHZA 4JEIA 2FRHA 2ZWVA 2P6UA 4KMUX 1P9RA 5JV5A 1WUKS 2VAPA 1JFLA 3BEOA 4HRYA 1WXHA 3QKUA 4PO1A 4QEDA 4CTMA 2V9KA 1REQA 2VK2A 1IHYA 4BV8A 2VK8A 3KWFA 3BYZA 4AG6A 1Z91A 3IWFA 1UKVY 5LQUA 1I6XA 2EILH 2PCLA 3CDIA 1Z7BA 1OKRA 1XDGA 4DPLA 1FNNA 1OR8A 2CMFA 1B6AA 2ZJPF 2DXIA 4GI1A 1MC8A 3AQIA 2GESA 3N58A 3HHEA 3DB1A 3WY9A 5A5EA