2V9PA

Crystal structure of papillomavirus e1 hexameric helicase dna-free form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
279
structure length
272
Chain Sequence
TLNESKFDFGTMVQWAYDHKYAEESKIAYEYALAAGSDSNARAFLATNSQAKHVKDCATMVRHYLRAETQALSMPAYIKARCKLATGEGSWKSILTFFNYQNIELITFINALKLWLKGIPKKNCLAFIGPPNTGKSMLCNSLIHFLGGSVLSFANHKSHFWLASLADTRAALVDDATHACWRYFDTYLRNALDGYPVSIDRKHKAAVQIKAPPLLVTSNIDVQAEDRYLYLHSRVQTFRFEQPCTDEQPFNITDADWKSFFVRLWGRLDLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords REPLICATION PROTEIN E1
publication title Papillomavirus E1 Helicase Assembly Maintains an Asymmetric State in the Absence of DNA and Nucleotide Cofactors.
pubmed doi rcsb
source organism Bovine papillomavirus type 1
total genus 86
structure length 272
sequence length 279
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Zinc finger, large T-antigen D1 domain 2v9pA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v9pA02
1W44A 3X1XA 4Q02A 3IGFA 4D81A 2DB3A 4G3XA 2GESA 4QC2A 5AUNB 1XF9A 2ZETA 3K09C 2DFLA 4RD6A 4YONB 4AI6A 2FSIA 1PVOA 1AGPA 4D4KA 5AUOB 1GUAA 4ABYA 2IA5A 4M1YA 2EYQA 2IYLD 5EXTA 3LQRA 2ZRDA 1E3MA 3SFZA 2ZI9A 1CJVC 1YZGA 3M6AA 2WWYA 5IHPA 5C2JB 1G8FA 3CPHA 4YQFA 2BBTA 4D82A 1AZSC 4F38A 2QN6A 2ZJZA 2JLZA 2NO6A 3KUDA 4DCNA 1ZUNB 1CTQA 1JXOA 3TE6A 1E2KA 2ZRBA 5DH9A 3AKDA 4EPYA 1M2OB 3BXZA 1G8GA 4DRZA 3KKMA 2Z6VA 3T61A 1RRCA 4GOJA 4TLDA 3NBZC 3IIMA 1KO4A 1W4BA 1BMFD 1CR1A 3VU9A 4C4PA 4DEYA 3PUYA 2ZI3A 2WKQA 3K09A 1Z8FA 3N70A 1EXMA 5E7MA 3PV0A 4PSAA 2OAP1 2ODEA 1SHZA 2H17A 5G41A 2VP9A 4HLUC 2F1RA 1LVGA 3LWNA 4CRWB 3SC3A 4BLPA 4A1FA 1Z08A 3TW4A 2PX3A 3KQHA 4QM7A 3H0KA 4Q1DA 3ZJYA 4E09A 1NRJB 4TL7A 5KSOA 1ZD9A 1IONA 5DHFA 1JR6A 3QKRA 5JLJA 3FFBA 3AVTA 4XTRA 4RD3A 3VFDA 4A4DA 3LAWA 1II8A 2GXUA 1D2EA 1B0UA 4CDGA 1OSNA 1SQ5A 1SGWA 1A1VA 1NF3A 4I4LA 4J0QA 2IF0A 4IFEA 4Q19A 2GAOA 2CVHA 2P3SA 1VG9B 4B3FX 1KMHB 1AKEA 4WOPA 3QXHA 2JGNA 3IBGA 4MRSA 5AJYA 3K9HA 4O2RA 4Q9HA 5EP4A 3VKWA 2GEUA 1RZ3A 4KFRA 4IVPA 3IKJA 1FMLA 3T35A 3ZZUA 1EESA 8OHMA 3K9NA 1WDTA 1Y3AA 2KJQA 3BD9A 1KSHA 1YJ5A 4HLUA 1ZD8A 2MMGA 4I1VA 4QKQA 2Z4SA 1R8SA 4PHFA 4E07A 2XZPA 2QT1A 2IL1A 2NQ2C 3QIAA 4L15A 1E9FA 5SZJA 1HH4A 3ZVRA 2JEOA 2WSSA 4FWIB 2WIAA 1OFIA 4RSGA 3TIFA 2DPXA 1OW3B 3DOEA 3E5HA 3B9QA 4QFMA 4BZQA 2IYSA 521PA 3VR4A 2VP6A 2JLUA 3SYLA 4HLCA 2V1XA 1HE1C 2NO1A 2G1JA 3CBQA 1E4YA 3VAAA 2GWHA 2VHTA 4V0NA 3I8SA 4IDQA 4QG7A 2D06A 4DUGA 1HURA 4DLSA 1WF3A 4U02A 4V0LA 1LF5A 4TT3A 2HLDD 3AF1A 1CR0A 1N6LA 4B33A 3CWZA 3SYKA 1SVSA 4Q1FA 3QNUA 2CL7X 1GNQA 1E79A 4UNQA 1GZSA 4UNNA 1DARA 1FP6A 4M53A 1KI6B 4JIMA 4RVCA 2KBEA 4ZDIA 1FX0A 2B7BA 3GJ6A 3SR0A 2XB2A 5EUQB 2ZRCA 2P5SA 4NHOA 2EYUA 1TEVA 1JAIA 3OIYA 1C9KA 1Y63A 1FPMA 4LPKA 3PR1A 2NPFA 4LJ5A 1TUEA 2J45A 4BFVA 2YC2C 4QBGB 2ZTSA 2OLKA 2WOOA 2RGGA 3CW2A 4X8MA 3ZH9B 2EFCB 2A5YB 3QG1A 2WSMA 1OV4A 1M6NA 2ZJ5A 4OJQA 4KV9A 2P6NA 3LW8A 2DWPA 5B58C 2ZI7A 4JLBA 4KXFB 4PC7A 3WNCA 3ND8A 3UXMA 2KB0A 1W4RA 2DY1A 5CB6A 1SHKA 3KQKA 3DZDA 1ONBA 4GZLA 2Q3FA 2X2FA 3F5FA 4JKIA 1CRQA 1CJTC 3DZ8A 3LBIA 1VIYA 1E79D 2B7CA 4C30A 3RRNA 3TR5A 4B47A 1Z5ZA 3PIRA 1DO2A 5AJZA 2OE2A 1JPNA 4XD7D 4JLAA 2C2HA 1N6OA 2EU8A 4IRUB 4IDHA 1VG1A 2EFDB 1RRGA 5FOVA 2D62A 3QBTA 3HPQA 4XVQA 1CP2A 5D3MB 1NY5A 2BBWA 4B3DA 5JS8A 1ZM4A 1C4OA 4RFVA 1R0XA 4LJAA 1N5IA 2Z43A 1JR3D 1GVNB 5EE0A 2QG6A 1Z47A 3IILA 3Q8XB 5DHAA 5JCPA 5H8WA 2HCBA 3ZQ6A 2ZRFA 4XVRA 4Q7JB 3ICEA 1ZIPA 2V7QA 1Q22A 3TSWA 2BIFA 3UK6A 5ELXA 3NDBB 4JT4A 2AL7A 2F3RA 4P4TA 3UANA 1XD2B 4C0QC 4CEJB 2IUSA 5FOWA 4RJLA 5TB5A 1S0UA 4HUTA 1BKDR 2ECKA 2PBRA 5FBQB 4F4IA 2MSCB 1L4YA 2FA9A 5FI0B 2IUTA 4FIDA 4ARZB 2GJSA 1J70A 3UWKA 3G5UA 2VYFA 2WWHA 1NMZA 3OEED 4WVFA 3WNDA 3GFTA 3AGQA 2DFNA 1P2UA 4E03A 2XAUA 1P9NA 3VKGA 3WP1B 3X1YA 4M1WA 2JAQA 4NYMR 2N1BA 3A6PC 3SQXA 3KDSE 1GRRA 2VHCA 3LA6A 2XTNA 4B3BA 1GRNA 1T5IA 3UG7A 1X1RA 1VPLA 3WY9A 1ZW6A 4P4SA 5D3MA 3THOA 1J99A 1F2UA 2ZR0A 3AUXA 2QTVB 3I61A 1Q20A 2GBLC 3EA5A 1KI1A 2ATXA 5AUQA 5UKDA 1U2RA 1SXJC 1NMYA 2DWQA 4LPSA 3FDIA 4HEJA 2AD5A 3B1VA 4UJ3A 1T8TA 2IXGA 4RFSB 1P5ZB 2IEZA 4LHXA 4XTCS 4URUR 2GK6A 4B34A 3BH6A 3KB1A 5L3SA 4QGGA 1OXVA 2ZVQX 4KI0A 1S96A 1G19A 3MGCA 3MCAA 1F48A 1JJ7A 1NKSA 2OHFA 2VHQA 3NDPA 2HXSA 3FE2A 4X8HA 2ZM5A 2XGJA 1XPRA 2CNWD 4FMCB 3RS4A 2FV8A 3DM9B 1LTQA 1TQ6A 1DVRA 1NL3A 2IW3A 4Q4HB 1QG4A 2WJGA 4BZXA 5IF9A 3DKVA 2CCKA 1DAHA 1XX6A 3PQCA 2O8CB 3SOPA 4F93B 1Z28A 4TSFD 3GJXC 1QHNA 3CRRA 2GBLA 5CDFE 5EE3A 1SXJA 1P6XA 1J8YF 2A30A 2A3RA 3OZXA 3I72A 4I1OA 4H1VA 1E0KA 3DPUA 3SS8A 4XJXA 4Q7KA 4ZIRB 1KTVA 4H1UA 2QP9X 1X8JA 4RFSA 3ZYCA 4LJ9A 3DMNA 1R0YA 3JVVA 3B82A 3ADCA 2GCOB 1E1QD 2HJGA 3PVSA 1NIPA 2BVNA 5CLLA 1ZAKA 2GVZC 2R6DA 1F60A 3OIWA 221PA 2ZSDA 1T91A 5FPSA 3V4RA 3KFVA 1Z07A 2CLDX 1Z6YA 4M9QA 3NHAA 4N0DA 2OCYC 2J7PA 2ZJ2A 3FHOA 2OBNA 3EASA 4FINA 1G17A 2QSZA 3RS7A 1L4UA 1XXHE 2OM2A 5KPDA 1WP9A 4IW3B 1Q1ZA 1GKIA 2EW1A 3RRMA 2IUUA 2QM7A 2Y8EA 2FZ4A 4JSTA 3EX7C 5EXPA 2R2AA 1ZM2A 4PSKA 3GJ5A 1YE8A 3ZLJA 1DAMA 1ZUHA 2QBYA 1GRQA 1M74A 3NBFA 3TMKA 5FH9A 3IEVA 2BJWA 1ZNYA 3EPHA 1NBME 3LQQA 1L8QA 4P3YA 1E6CA 5AK0A 4D4LA 3CRQA 4B74A 1W7AA 1TEXA 3SFVA 3F3YA 1G1MA 1YZKA 1IOZA 2QT0A 4YDHB 2OV2A 3WMGA 1TQDA 3AVXA 4RZ3A 2EFGA 2F7SA 3VNVA 4Q7LA 3EPKA 1UAAA 2YHSA 4YDSA 3EIQA 4UQOA 3BH7A 1OIVA 1JB1A 2CL6X 4Q9LA 2J3EA 2CE7A 1X8KA 4D4MA 1NN0A 4NONA 4PQRA 1P2VA 1XMSA 3D31A 3T1OA 3U7HB 3WBKA 1GG2A 2J7PD 4PPGA 5HKKD 3C8UA 3Q5DA 2ZRLA 4OK3A 3OF5A 2E9SA 3NH9A 5JZVA 4A2PA 1Z6GA 2HT1A 1XMJA 4QXAA 1G3RA 1I4LD 4V03A 3ETLA 4IDOA 2F43B 5JCZA 3TGPA 3CF0A 1I2MA 3U6BA 3CNOA 2JLRA 5FFMA 1OFHA 1WCV1 2GTPA 4HAWA 4U7DA 4LJ7A 1KO8A 4UJ5A 3K70D 1ZIOA 3NBYC 4PAQA 4BPBA 2OLJA 3EA0A 2BM0A 2O52A 4G5QA 3MD0A 3VHXA 4DB4A 5AWFC 1UKYA 4E5UA 1KY3A 4ZDKA 2LKDA 3BB4A 3IO3A 2FDCA 1VDZA 1R2QA 1OHHD 1A7JA 3PUWA 3ZGXA 1XCPA 3THYA 2IXFA 1SVOA 4BEJA 2ZU0C 2REOA 1E9CA 3P27A 4MKGA 3BB1A 1IN5A 4CF7A 3CZQA 4OQLA 1N6KA 5FOSA 1CRPA 3CNNA 1QHHB 4HZIA 2WMNB 1YU9A 3TKLA 4IXNA 3K0SA 1U8YA 1ZINA 2J9RA 1NP6A 4TQAA 2D3WA 1VCOA 3OAAD 2ZJBA 3DO6A 4Y0VA 2J41A 4DSOA 4B32A 4EJSC 5F98A 1OKKD 2EVWX 1PUJA 2N46A 3CUEF 2GXSA 3GLHE 3L8YA 2H8KA 4XH9B 5CLQA 1VYUA 2CJWA 3U3JA 3LFUA 2AFHE 1S1MA 2VQSA 1YR8A 2R6AA 2ZRAA 4KO8A 4BFTA 1Z3IX 1Q0UA 2NGRA 4PR0A 5HCIA 5B2ZA 1KGDA 2VLIA 3U3RA 4BFYA 1KI7A 5JJKA 2ZJAA 4M8NE 2ZUBA 1ZC3A 4L9SA 5FPTA 1KOFA 3HU2A 4MQBA 1H8EA 1XRJA 5KDLA 1KYIA 3ASYA 1JQLB 1E9EA 4PQFA 2J46A 1KY2A 3ZIAD 2BEJA 1R5OA 4W5JA 4BRWA 1KO1A 1J7KA 2DBYA 2H16A 3NWJA 2ZS7A 3CNLA 5JWRA 4EJSA 1S2MA 5FL7A 4E22A 4JLPA 4MUBA 2NMVA 1ZM7A 3RSOA 4AKEA 4A0RA 3MFYA 4KFUA 1OJLA 1W0KD 3DMDA 1T3HA 1KJYA 4HZUA 4AIIA 2P6RA 2NO7A 1W47A 4BLRA 3QKSB 4JYCA 2DWOA 1E9DA 121PA 1YZNA 2FZLA 5FOUA 1M7HA 3LRPA 2W83A 1HV8A 2WPDA 5CJPA 1NVVR 2NG1A 2CBZA 2XNDD 3ZS8A 2QP4A 4N0EA 3TJZA 4CT4B 1W2HA 4C0SA 2DYKA 1G4AE 4GZMA 3GLFA 1W5TA 3AGPA 4KCGA 2PT5A 2WWFA 1OYYA 5IDVA 1WQ1R 2FFQA 2OSBA 5L3RA 1DEKA 1GSIA 4OHYA 4NE2A 3ADDA 3U6KA 2Z5FA 2G0TA 1ANKA 2O0JA 4V0ME 3R7WB 1M8PA 2YOHA 5TDHA 3EG5A 4AKHA 3LO5A 4NYIQ 4PHGA 1MO6A 2RMKA 4MRNA 3EPJA 1LS6A 1O3YA 1U90A 1PZNA 1XD9A 4KU4A 3T06B 4B48A 4QHSA 2OG2A 2VEDA 4KHZA 3AF3A 1COWD 1LFDB 3AVOA 3BFKA 4R71A 3TUZC 1U8ZA 1UM8A 2ZIAA 1KO5A 4YXWA 4CEIB 4FI3C 3ZS9A 2ZROA 2FPKA 3IO5A 3SNHA 4HAUA 3FHTA 5CIQA 3AP1A 2ZYWX 4AG6A 4CZ2A 2OEPA 4DSNA 1EX7A 4US0R 2WWGA 1OFUX 1NSFA 3THWA 3KB2A 4HAZA 4QGAA 1XJCA 1YZQA 2HF9A 4LV5B 3EZ6A 3BC1A 1CJUC 1GNPA 1K8RA 4LV6A 4DLRA 5DI3B 1G9XA 1R5NA 1ZD1A 3A36A 3AQ4A 3VR2A 2YWFA 3RS5A 2W00A 3EZ9A 4PO9A 4DXAA 4GDFA 3QEJA 1L2TA 1E96A 2JJ2A 3H84A 3NTUA 1ZUIA 3P32A 2C04A 5K8LA 2JDID 1K5GA 1RJ9A 2IYUA 2H57A 3NEYA 4M2LA 4Q9IA 3TNFA 3VR1A 3WRYC 4ESVA 4NPHA 3SBDA 4TWZA 1GKYA 1F6BA 4KVGA 3MUFA 4K81B 1NLYA 2WJYA 1EGAA 1W5SA 1BIFA 1DS6A 2AXPA 2VSFA 2WZQA 1N5KA 2OILA 3CF2A 2D7DA 2O8FA 3GLIB 4OL0A 3WP0A 4BLSA 2G9NA 1IXZA 3PENA 1KK0A 4PQYA 5JRJA 5JS7A 4IEEA 1N25A 2PZEA 5KUTA 3A1UA 2YV5A 1UBFA 2V6JA 2V8OA 2NZJA 4NL4H 1TUIA 1W36D 1UEJA 3C7KA 5AUPB 2J7KA 1E0JA 3L2OB 3IIJA 2FFHA 4KVAA 3SHFA 2K5UA 2AN9A 3NIBA 2KSQA 1D9XA 4ITRC 2ZUCA 3SJAA 3A8TA 2I3BA 4OI4A 3BFXA 4TN1A 5BYJA 3I8XA 2VP0A 1E9RA 1Q3HA 1CIPA 1VG0B 1ZJ6A 1MH1A 2C98A 2X19A 3SJBA 3AP3A 3AVUA 2W0SA 2YINC 4WXPA 4AWXA 3BE4A 3TSZA 2OCBA 2NOAA 3MWJA 4LJYA 4Z8XA 1NBMD 4V0KA 1JEEA 3PEWA 3TUIC 3RWMB 1ZBDA 2A5DA 3L0PA 5LD2C 2WWXA 4LI0A 1GP2A 4AURA 3GLIA 2ANBA 1ZNZA 4BEBA 4GPTA 1XFAA 1UEIA 2JLWA 1XJ0A 3FOZA 2DHRA 2IS1A 1EFRD 4GMXA 2GXAA 4P0TA 1JNYA 3VNUA 2P65A 3VKHA 1D8TA 3QKRB 1AS3A 4D25A 2NZ8A 3BFVA 1SULA 1R10A 2ZQ5A 1NG1A 2O0HA 5E95A 1II8B 2QY9A 2ORVA 1UF9A 4XSGA 1N6HA 3CPJB 4NZYA 2GJAA 5CK5A 2IS4A 4B3CA 4LGMA 1RRFA 3O47A 4C0LA 3GPLA 1Q1QA 1OIXA 3Q7PA 4ASUD 2OXRA 4KBGA 2F55A 2GXQA 2OESA 3IPYA 1WMSA 4NCJA 2AFIE 5C46F 5L8VA 4Q9KA 1WA5A 3AB3A 3QY0A 4Q1BA 4QL3A 4MRVA 4UNSA 1DBSA 2TMKA 4CYMA 4Q48A 4TL6A 4D0LB 4DLUA 1FQKA 2O8EA 3AF2A 1U9IC 4R7ZA 5FUVA 3T1QA 4Q4LA 1E2JA 3KKPA 4BECA 1DO0A 1FNNA 3SN6A 3CX8A 3KXKA 3KKOA 1NNEA 1M1YE 1DAKA 3EC1A 5CB8A 3K9LA 2JJ8A 4N3NA 4DC9A 4LJ8A 2FEOA 1ZCBA 4TLBA 5IT5A 5SZIA 3HR7A 2F9LA 3U61B 5FOTA 1BYIA 4KSCA 1IQPA 1SKYB 1G64A 2A5JA 2Q0HA 3A4NA 4NDZA 5BYKA 3W6PA 3GD7A 4DB2A 2HLDA 2XSZA 5FTKA 1G8YA 2IWHA 1E9AA 4Q00A 4TMKA 1N5JA 3C41J 4JBWA 4MGYR 1SZPA 3QVUA 1MR3F 1GWNA 1SVMA 4H9GA 2JIZA 2HYIC 1U9IA 2IHYA 1XEXA 3LX5A 2A5GA 1S1CA 4M22A 4AG5A 3U44A 1VYTA 4P4UA 2QMHA 1W1WA 3SJZA 1P3JA 1JXMA 3PFIA 3FMIA 1Z29A 3IIKA 4IOKA 4HLQB 4C0AC 1Z0FA 1VMAA 4DJTA 2F6RA 2FF7A 1FX0B 2NO0A 3W5IA 1P73A 5J4VA 2X77A 2ZRGA 3MSXA 2PLRA 5KU1A 3AF0A 3EW9A 1Z22A 2CCJA 4II7A 3TRFA 1BYUA 1OH7A 2WM9B 3KTAA 2RAPA 4MYCA 4HDOB 5EXXA 3ZZTA 2C99A 2D2EA 4TL9A 1K6MA 1NJGA 3I32A 2EFHB 2RB4A 4NCHA 3QI2A 4BUJA 1KI2A 1II0A 4URXR 3K9GA 2O8BA 4Q4JA 1PLLA 1CULC 4ZI3A 2H5EA 3IHWA 1KHTA 2XSZD 4TL8A 4DT1A 4PX9A 5KHOC 4OK5A 3X1DA 5BN5A 5J4LA 5D3QA 2WWWA 1QHXA 2BJVA 4LBVA 5KTYA 3KZ1E 2WJIA 2ZE5A 2QTFA 2G88A 2ZJ8A 4Q4AB 2JIZD 2ZJOA 4XD7A 2Z83A 1Q44A 4M4SA 5DISB 5A0FA 1PLJA 1GITA 1FZQA 2LKCA 1HE8B 2PCLA 5TVKA 4EPTA 4RD0A 3ECCA 1CR2A 3QPWA 2EWWA 2G83A 4R2HA 3I92A 4BLQA 1M34E 4QGHA 1UDXA 5FBVB 1JR3A 1HT1E 2JASA 3REGA 3NKVA 1E2HA 2RKOA 4LWZA 4ACAA 1E0AA 2IF2A 1B23P 2ZR7A 4TMTA 4HAVA 1E2PA 3ADKA 1H65A 4Z54A 5P21A 3U60B 2ZITA 4C0JA 2FSFA 4AYTA 1KSFX 4XWOA 1TX4B 4UKDA 3LH5A 1IBRA 2OFWA 3Q5EA 5FTLA 1FP7A 1QRAA 3GEIA 2BKUA 4QBIA 3OEEA 4BASA 4EPVA 1UKVY 3RRZA 4Z1MD 4IFBA 2OAQ1 2F1IA 1HY3A 3KJHA 4Q4AA 2GZDA 4GOXA 2GCPA 1EK0A 4PO1A 1AS0A 2B92A 3LXXA 1G5PA 3W9YA 2P67A 1RKBA 3QXSA 2W2VA 2W6JD 2FSGA 4Z51A 3CB4A 4EFMA 4DDUA 2CL0X 2NO9A 4OI0A 2FWRA 2XOKD 4QNMA 4POAA 4JYBA 1DTSA 3PEYA 3FFAA 5CJ2A 2IBMA 4NCNA 5B64A 4TLAA 3UMRA 4P4SB 3RYTC 1QBKC 1Q12A 1F2UB 1LF0A 3C15C 1AA9A 2DCUA 3K8YA 4BRUA 5A5GA 5L3QA 1TTTA 2WMOB 1XTQA 4CGZA 5AJVB 3IQWA 5FL3A 3DEFA 1XZPA 1IJFA 4W7SA 4OHZA 2QE7D 2GDJA 4A82A 5KOYA 1WE2A 4GL2A 2HDNB 1EWQA 2CNWA 2IC5A 3RWOA 1CJKC 1CKEA 5L3SB 1W4CA 3E1SA 4EDHA 1UPTA 2FPMA 3EXAA 3KL4A 3N5CA 5SZKB 1OPXA 2ZYUX 3CIOA 1AK2A 1L7VC 4EPWA 4TSFA 1DG3A 2WJVA 5KDOA 1WB9A 4CEHA 4RD1A 2GF0A 1OFTA 4JBYA 3BOSA 1JI0A 4OQMA 4R9UC 5BN3A 5JRZA 2PZGA 2CMKA 3F0TA 2RGDA 5C4GB 5HCNA 4KYIB 1UFQA 1SXJB 1XDBA 3UATA 1W4AA 5EP2A 1DE0A 3EZ2A 1KSGA 1DAIA 1KDRA 5JECA 1V43A 3I73A 3U7FB 1E1QA 3KFXA 4EQ6A 5JWHA 3QF4A 1E4VA 2ORIA 2ZXUA 2ONJA 3R9XA 1T0HB 3A1TA 2QNRA 3GFPA 2RGNC 3GFOA 1VCNA 2F1JA 5F9HA 1KI9A 2F9MA 1MT0A 2ZI6A 3LV8A 1RYFA 5G53C 1YR9A 4LHVA 5GJWC 3H4MA 1A2KC 5C18A 1G4UR 3H1TA 4D6PA 3LD9A 2AWNA 3BIFA 2JJ1D 5BN4A 4KSBA 5B57C 4IOLA 4TTQA 2R62A 2ORWA 1G16A 4QHYA 1DELA 2XNSA 3FMFA 3CRVA 3R20A 1QHIA 5AR1A 3T1VA 3U2QA 4PPNA 3T34A 1KAOA 3QSYA 2IYWA 1HQCA 4ZCLA 1ZU4A 2QBYB 4HYYA 4EFNA 1XCGB 3R9WA 4MGZR 1TF2A 4G0NA 3EAQA 3U4QA 2IYZA 4WZBE 3B1YA 5H70A 2RGNA 2NTYC 4Q01A 4QRHA 3GEEA 1D2MA 4ZV4A 3IHLA 4WW0A 3OFND 3PUZA 3K70C 3B1ZA 1EFTA 1YR6A 4P33A 4DBLC 3P4YA 4KITB 2P0EA 1DPFA 4OQFA 2GCNA 1G3UA 2IS6A 2A7QA 1XNJA 2J0UA 4L9WA 1S4QA 1Z6TA 4PTLA 5K8IA 5HKKA 4FMDF 4QBHA 4OQXA 5EE9A 3HP1A 4DWJA 4IDPA 4Q1EA 4FW9A 1IN7A 1FFHA 1OF1A 1G3IA 3JZMA 5JWOA 4M1SA 3B13B 2VTKA 2QQ0A 4TLEA 5J4HA 1OB5A 3WYGA 4WA7A 4OJKA 4TYYA 4NTZA 4L5BA 2GJKA 3QOFA 3R8CA 1EFUA 1NVXQ 2QMOA 4JVLA 3W3AA 1QG2A 1KNQA 1GAJA 5FPYA 3TUJC 3SHWA 1U8AA 1WXQA 2XTMA 3EPLA 3LBNA 4GI7A 1OIWA 3D3QA 2AHOA 1KKLA 5IK2D 3KXLA 3SBEA 3ZVLA 1SVWA 1AN0A 1ZU5A 1X86B 1ZCAA 2ZE6A 3K0CC 4L8GA 1KJWA 2ZREA 4LYJA 4MRPA 3Q85A 5FOXA 2PZFA 5EXSA 1OHHA 2IHBA 4JT2A 1XJQA 2PMDA 4S35A 2XJ9A 1A82A 3S1AA 5FBLB 3THYB 1XPOA 1W2GA 3QKUA 2UZ3A 2XB4A 4YMUA 2OBLA 3HDTA 4KLNA 5CYPA 3KQLA 3OAAA 1D6JA 3ZQJA 1LV7A 4PO8A 3QEOA 4NP6A 2OT3B 3RS2A 2LCFA 1XP8A 4M1MA 4A0FA 4ESHA 1OKKA 2D2FA 4MKIA 4UXHA 4PC6A 1KMQA 3AH8A 2QSYA 3B1WA 5J47A 1IN4A 1I4TD 5HZHA 3FVQA 4DCVA 4TQ9A 5CYOA 3K0CA 2LWIA 3C4JA 4YMSA 3GP8A 4B76A 3FKSD 1FOEB 4NYJQ 4DKXA 1EFHA 1MABB 3E2IA 1VHTA 5E3HA 4XOIA 4O2LA 3W90A 621PA 1E0SA 2CJWB 4PAMA 1T5LA 2WTUA 2QMUA 4M9ZA 4BFSA 3PEVA 3VMFA 2ATVA 2QRZA 1KNXA 3IUYA 4NMMA 3QXXA 3VX3A 1BS1A 3ZIAA 4P31A 4A0GA 4DHEA 2RGBA 1N2CE 3B6EA 1UADA 1G7TA 2XITA 3B1XA 2C78A 5HE8A 2BMFA 4NYIR 1A5TA 4Q9JA 4MRRA 2WKRA 4PC2A 1J2JA 2HF8A 1W0KA 1JECA 1F2TA 1ZNXA 3KX2A 5LB4A 2ZAOA 4O3MA 4EJSB 1X3SA 4HATA 3IDQA 1RE0A 1H8HD 3B85A 3GJ0A 3K0FA 4DLYA 4JLOA 3O8RA 1WBBA 5F3WB 4HZUB 4UXJA 4BQSA 2XNDA 1AM4D 1IN6A 2R9VA 3GLIE 3I62A 2QENA 1UKEA 1A2BA 2ZS9A 4EUNA 4JVSB 2OCPA 4V0OA 1MABA 4FCWA 4TYPA 3B2EA 1N0WA 1X8LA 5LBIA 4LC0A 3CH5A 3DDCA 5BW8A 3C5HA 4HLDA 1W46A 3QBVA 1GKUB 3QQ5A 1MOZA 4ACBA 4BZPA 1VKJA 5K8TA 3GLFB 4HB2A 2FEMA 5GVSA 3KQUA 4DDVA 2HV8A 1BH2A 1GL9B 4MITA 3QUSA 4TMZA 4QOSA 1VTKA 4MUAA 1G6OA 1GILA 3AVWA 3I1FA 3ZD7A 2C9CA 2KBFA 3HYTA 3CH4B 3NBXX 4DSUA 1NI3A 2XX3A 3LNCA 4U00A 1COWA 3MG9A 2J1LA 3WYFA 2GETA 1YRBA 1YZTA 4B43A 3AVVA 5EP1A 1ZYUA 3K0AA 1OXXK 1SVIA 1HEIA 4BLOA 3CRW1 2G1KA 2YWHA 2GF9A 5HZKA 2L0XA 2QP3A 2ZSBA 2IEYA 2QORA 1C1YA 2VHUA 4RCZA 2BBOA 2ZYVX 4DLTA 2R6FA 3A1VA 2YOGA 3CONA 3CRMA 2W2XA 1KK3A 2CK3D 3PUXA 4UNPA 3ZDQA 2EQBA 3W3ZB 4GP7A 3LLMA 1YR7A 2D4HA 1II9A 4PFSA 2J0QA 2X8AA 4HB0A 2GKSA 4XSHA 4L16A 1AS2A 1W36C 1Z0JA 1Z0IA 1Z2CA 3AF4A 3TAHA 4A8JC 2ZE8A 4AKGA 3B8HA 1YRAA 3IQXA 5LB2A 3HWSA 2OZEA 3THWB 3N2EA 4IKEA 3O8DA 1V5WA 3A1WA 1G41A 3RS3A 4ZDJA 1T9HA 2FJUA 5DYIA 5KYKA 5CDFA 2QAGC 2AXNA 1ETUA 1KDPA 4GRAA 5J4KA 2JDIA 2AR7A 4PZLA 4MDFA 4JKYA 4ZO4A 3GLGB 3A4MA 4KODA 5BWMA 4JJKA 4Q7MB 3HPRA 4EPRA 2DFKB 4NCKA 3L0SA 3U5ZB 2OO7A 3TBKA 1WBDA 4W5WA 1RJ9B 4A2QA 3RC3A 2AX4A 1E69A 2HJVA 2QA5A 3FYHA 4JL8A 4Q1CA 4M9XA 2WICA 3DHWC 1VG8A 4YMWA 4IVQA 2VO1A 1QDEA 3T5GA 5EJEA 2GZAA 4B44A 2RHMA 1NN3A 1YQTA 1QZXA 1CJMA 4O25A 2O8FB 3Q7QA 4RCYA 1LY1A 1G7RA 3SJCA 2YJTD 3EC2A 1MV5A 5CITA 4FMBB 4QM6A 4JMPA 4M1TA 1J90A 821PA 1XXHA 2BMJA 5AJWA 1XCMA 2AKYA 2QAGA 4M21A 5HR5A 4LJ6A 4OYHA 3H86A 4MGIR 1TQ2A 1SKYE 2P5TB 3U3OA 2IS2A 4B75A 5DIFA 2Q9CA 4X8LA 3CLVA 4LYAA 1E9BA 1NKTA 5TV2A 4F4CA 2PCJA 3QPUA 5JSZA 3GLGA 5J40A 2BWJA 3OEHD 5IRCD 5C4MA 1AJEA 3O8BA 4W5HA 3FKQA 4JSYA 4YLGA 1NBMA 4C0BA 3SEAA 1I4DD 3BERA 5L3VA 4JLDA 4URYR 1IAQA 3W6OA 4KLZA 3GJ8A 5FBWB 1X1SA 2AK2A 2ZE7A 1OH5A 3B5JA 3RC8A 1CLUA 4B3XA 1T0JB 4I81A 5DO9A 3AKYA 1EFRA 4WXRA 2Q21A 4A6PA 3THXA 3QG5A 2H7VA 2UKDA 1AZTA 4FCVA 2NPIA 3I4LA 4TTRA 4XWAA 4G5SA 4XIGS 1G5RA 5F9FA 5FTNA 2Q9AA 2GA8A 2CVFA 4R98A 3VR5A 4NBSA 3EZFA 4B2LA 1HA3A 5KNCA 4O0MA 2FN4A 2VP4A 1IN8A 1E2MA 1P4SA 2E87A 1KI4A 1A4RA 3PUVA 4TMWA 4OHWA 4WZ6A 5E7IA 3MJHA 3TW8B 4ASUA 5JMTA 3ONWA 3DM5A 3UPUA 3RDPA 2OFOA 4LUCA 2ODBA 2FGJA 2J59A 4ILEA 421PA 5KO2A 4A15A 3C14C 5BQ5A 1NMXA 1Q21A 2BHRA 2VL7A 5DE3A 1XEWX 1IXSB 3A1SA 1AGRA 1E2LA 4G01B 5LD2B 4US2R 4GSYA 2C77A 2YWGA 5KPJA 4OK6A 2O8EB 1XMIA 4EAQA 4LC1A 4CIDA 2D74A 1R7RA 4YMVA 2BM1A 4W9MC 1E2DA 5DYGA 1AQYA 3HJNA 5FPHA 1RIFA 3NG1A 2J87A 4OQNA 3AVYA 2H92A 4KBFA 4LHZA 3EIEA 2X2EA 2BOVA 3WHLA 2Z0MA 3T5DA 4U5XA 1TMKA 4HUQA 1DG1G 1N6IA 3ADBA 4EIWA 2ZAMA 1GM5A 2QTHA 4A0HA 3MJRA 5SZHB 1R0ZA 4K46A 4MYTA 1G6HA 1UBCA 3U7EB 4LDJA 2O5VA 4AC9A 2VF8A 721PA 2D7CA 1TU4A 2BV3A 4UXIA 1OLOA 5G3ZA 3GLHA 4QJ5A 5KDDA 2YWEA 2RGCA 3FGNA 4PPFA 2JLVA 1FUUA 5CM8B 2ZRIA 2QAJA 4C0KA 2JATA 5BXQC 2V9PA 5KNBA 1OXSC 2C95A 2V54A 5EE1A 1XEXB 1ZRHA 4DLWA 2HUPA 4LV8B 1O87A 1KI3A 2ZRMA 3U44B 1T3LA 2PX0A 1FNMA 3F8TA 1LS1A 4Q66C 5KNDA 2BEKA 3EWSA 4MYUA 4F7WA 1BO6A 1E98A 1RVDA 3ND9A 4DLXA 3AEZA 1XB2A 4GOKA 1N6NA 1NN5A 5GJVC 5F2EA 1T3SA 2RH5A 4RZ2A 5CIWA 4ZDWA 1T8UA 4LBYA 2IYXA 2PT7A 4MYHA 3HU1A 4D80A 2CHQA 1W0JD 1US8A 4IJMA 2DFTA 3K1JA 3KTAB 2ZEJA 5FTJA 1E1RD 1NVUQ 2YVUA 3BJIC 2JLXA 2UZIR 4CT5A 1EWRA 4DCTA 2VP2A 2O8BB 4Q18A 4Q4JB 2Q6TA 3WHKA 3P4XA 2GVDC 1IJEA 4DT1B 2FNAA 3RANA 1Z83A 1Z2AA 2Q3MA 1VCIA 4OKSA 4P32A 1P61B 3N2IA 3IBYA 2G3YA 1KDOA 3AKEA 3EWAA 4US1R 2V6IA 1TU3A 2XEXA 2C03A 3MAAC 1RC8A 3CWQA 4ZCIA 4TMXA 4HSEA 1JQJC 3A37A 4QJ3A 4V0MA 3UIEA 2MSEB 4M0LA 3PJRA 2V55B 2FGKA 2WJJA 3TVDA 1YHNA 4C7OB 2IYYA 4JBXA 1SXJE 4MH0R 1G18A 3ZVNA 4OBEA 1UBEA 1RRPA 2ZI5A 4ZCMA 2YOFA 3BK7A 2QPAA 4TMVA 4FMCF 3OE7A 2JA1A 2O0KA 3BORA 3PG5A 4A36A 4X8OA 1NN1A 2YKGA 3DKPA 1KAGA 4Z1MA 3T1TA 3SDZA 2WKPA 2KWIA 1ZVQA 1CU1A 1RPZA 1NJFA 4NCIA 3FMOB 1QVAA 1TQ4A 2FH5B 2W6JA 4B35A 3J81k 2BC9A 2WOJA 2H18A 3LVQE 3M1IA 4JLVA 2VRWA 4Q21A 5ANRB 4A9AA 2XOKA 2WVJA 4BGDA 1KMHA 2QL6A 1XBTA 2V1UA 1MO4A 4ON9A 1CS4C 2BCGY 3RAPR 5DSZA 2IYQA 2NIPA 2JLSA 4C7OA 4IXMA 4KAXA 1IY0A 4LHWA 1P9RA 2JLYA 1FMJA 3CZPA 1OXUA 2SHKA 2OCAA 5J4YA 2ZR9A 3LY5A 4TLCA 2XZLA 2QE7A 3WBJA 2IK8A 4IHQA 4MGKR 1P72A 2CHGA 2ODNA 3CX7A 1HT2E 3SE0A 5L3QB 5GADl 2ZI4A 4BWYA 3RLFA 4JVNA 2F1HA 2ONKA 2YZ2A 3OIUA 5EUMA 1N5LA 1KK2A 3ZD6A 3W5JA 4DDTA 1DAGA 3OE7D 4JLMA 1P60A 3RHFA 2R6CA 3R9IA 5FI1B 5JEDA 4R2IA 3SI7A 3G82C 1QHGA 2WSSD 1F3OA 1QVRA 1GDDA 2ANCA 4AYWA 4DLZA 1GNRA 2GJ8A 2ZVPX 3GJ7A 1TAGA 4B2IA 3ICQB 4DIDA 4JLJA 1M7GA 5FUWA 2A5FA 2IT1A 1NY6A 4PHTA 6Q21A 4CEHB 3HU3A 4BFUA 1QHSA 1E2FA 2C9OA 4Y0AA 1ELOA 2FFAA 1S8FA 2RGAA 1OH6A 4DUGD 2PMKA 2JLQA 2ZANA 1XMVA 3UWOA 1Z63A 2R65A 1Q57A 3Q9LA 4TT3D 1SKQA 2REXB 4OI2A 3HR8A 1KI6A 2ZRPA 3MRSA 4Q5IA 1UJ2A 4DCUA 4ERNA 2MMCA 2ZS8A 3B9PA 4JLKA 2VP5A 4WZAE 1TF7A 1ZP6A 1E2NA 1XTIA 4EQ6B 3BGWA 3QF4B 4I1SA 1MO5A 2VA8A 2WV9A 4IOMA 2VHJA 2P6UA 2QEQA 3SU8A 1DADA 3PEUA 1R0WA 2YNMA 4LSGA 2C8VA 4BFWA 5TMPA 2ZRHA 1I2DA 5FUXA 5J5CA 2BDTA 3UMFA 4M9SA 2J0SA 3UG6A 2W0MA 2JJ1A 4MKHA 1P2SA 4TYWA 3T15A 1JPJA 1YKSA 3B78A 4GMDA 2QQEA 4C0HA 4DLVA 3D7MA 3EZ7A 2F3TA 2A2ZA 4B73A 2PJZA 4CVNA 1P62B 1S3SA 4PAOA 4XWKA 1NLZA 2C5LA 3MWKA 5H68A 1NVWQ 1XTRA 1PLKA 3RNLA 2KE5A 2VF7A 4C3ZA 3CR7A 4TZ0A 2W2TA 3V00A 3OFNA 1XD8A 4KJZA 3FHCB 2CXXA 3EARA 3KKQA 2REBA 4LZZA 1XPUA 2GAAA 3U4QB 4PSVA 1OXTA 2RCNA 1U0JA 5JFGA 4RKEA 2GEVA 2IXEA 1YZLA 3MMPA 2CHVA 4JLNA 1LW7A 3Q72A 4DCSA 4HB4A 1F5NA 1KSJA 5JI3E 3VR3A 3D8BA 4G5OA 5LDDC 1KI8A 3NXSA 3QF7A 1ZM9A 2J0UB 3TAUA 1N0VC 4LY6A 3SYNA 4V02A 1NSTA 1HQYE 2PEYA 5DGXA 2QI9C 3QE0A 1DOAA 2IYRA 4GT1A 3QPVA 5DN6A 2IYTA 2CEAA 2RGEA 5HTKA 1FTNA 1RYHA 3RVBA 4L4UA 4YMTA 5TXGA 1N3BA 2CE2X 1SVLA 5IK2A 4A6XA 2BMDA 4NYJR 1CBUA 2WAXA 1XD2A 4CEJA 2GILA 4B3GA 4IDNA 1IY1A 4KFTA 4D2IA 2V7QD 3SQWA 3I3SR 4K8OA 4ARZA 3QKTA 1AIPA 3K70B 3GJ4A 2VSOA 4XVUA 2OFXA 3NC1C 3GLFE 2N42A 4RKFA 3WNBA 4AK9A 4MDEA 2EFEB 4JVMA 1VHLA 1LNZA 3OESA 2RHDA 4F4JA 1KKMA 4DEXA 3B7GA 5KSZA 1FL9A 1S9DA 4QBFA 3TQCA 3CO5A 4GBMA 4HI0E 5GVRA 1P75A 3S1AB 5E7JA 1IY2A 2BKEA 1FUKA 3LX8A 4QJ4A 5JEEA 1TF5A 4DDWA 1E2EA 1OB2A 3LW7A 1R8QA 1CXZA 1ZNWA 5FTMA 5H1YA 4F92B 1AQUA 2QMEA 3NVAA 5GJCA 2FG5A 3AUYA 3WMFA 4A92A 3SZRA 2OBMA 2FSHA 1E2GA 4M1KA 4EPXA 1T6NA 4RY2A 3FKSA 4LHYA 3CM0A 4D26A 5DN6D 1Z0DA 2H1LA 4PHHA 2A9KA 4CW7A 3X1WA 5KSPA 2ASEA 5A4JA 2G0NA 1VIAA 2ZPTX 2PEZA 3M0EA 4A2WA 1OE0A 4M1OA 2IWRA 3L0OA 4Q4HA 5TY0A 2QUZA 1ODFA 3TK1A 3IPXA 1KK1A 1ESMA 3G0HA 4ZI2A 3C16C 3AKCA 1JALA 2WAYA 2O8CA 4LBWA 3MLEA 1G7CA 5LPNA 3C5CA 1VYVA 4C2TA 3P1JA 2X1VA 3B60A 4F91B 4NYMQ 1PJRA 3GLGE 5HPYB 4KFSA 2IYVA 1KZ7B 4RD2A 1MO3A 1SVKA 2PLFA 3WMEA 2BCJQ 3AVQA 1W49A 2E1RA 5FR2A 1H8HA 2GZHA 1D9ZA 3DVLA 2ODWA 3AVPA 1SXJD 4ZIRA 1GTVA 2W6IA 1F2TB 2DR3A 3M4YA 2EWVA 4FN5A 2VH5R 2P2LA 2MSDB 2Q3HA 4TYQA 5JJIA 2GCOA 3K0FB 5G40A 1NG9A 1N0UA 3OIVA 4WAUA 3L0IB 2QU8A 3W6NA 2QRNA 4Q47A 4QNRA 3L82B 3BRWD 2CDNA 1BOFA 3CX6A 4PPQA 2J0VA 3K0EA 1TPZA 1S3GA 3JVUA 4NU0A 3TLXA 5JHGB 4FD2A 3KXIA 2C96A 3LXRA 1GOTA 3REFA 3LLUA 1TADA 3CR8A 1UKZA 3BAFA 1PUIA 2ZU6A 2ZSFA 4TTPA 3AM1A 4IEIA 3TSOA 3NEJA 4HDCA 1E2IA 2QPOA 3LBHA 1P9WA 5GJBA 4B2PA 3LDAA 4C2UA 3NH6A 1XTJA 3RRYA 4JJZA 2Q9BA 1Z0KA 2CLCX 4TZ6A 1LB1B 3KUCA 1KO7A 1UBGA 3FMPB 3L8ZA 5FR1A 4DZZA 1KIMA 1OYWA 3QVVA 5DI9A 2AKAB 1TNDA 1KJZA 1RFLA 3HYRA 5EP3A 4RD4A 1R6BX 5JHHB 3CPEA 2CK3A 3K0AB 1S9HA 4WBSA 2GHIA 1G8PA 4BFXA 1U0HC 4TQUS 3VX4A 2G77B 2W6ID 3KKNA 4B6EA 5M04A 1AKYA 1VECA 3V4FA 1WRBA 1PV4A 2FE4A 3T12A 1FTSA 3P26A 1XEFA 3FTQA 2W58A 3PITA 4LJ4A 5FBRB 3RS0A 4FWTA 3AV0B 4WIAA 1T4GA 2YYZA 4EFLA 1Q1BA 2FOLA 4DSTA 2B6HA 1CF4A 2AK3A 2GK7A 4D0NA 3DOFA 2I1QA 4Q03A 4EKDA 4LYFA 4PANA 2OXCA 2O8DB 4AKIA 2F43A 4YC7A 2R44A 3VHLB 2BBSA 4B6FA 1XWIA 3MWYW 3W8RA 3I5XA 3R8FA 3WRXC 1JAHA 3U3KA 5E4FA 3FWYA 2QGZA 1NIJA 3CF6R 3TR0A 3BWDD 1G5TA 1HUQA 3UKDA 2V4ZA 4AD8A 1GIAA 1XU4A 4KYUA 2FFBA 2GNOA 2HCJB 4TYNA 4JL5A 2AD1A 2XZOA 3KJEA 5FUYA 5HE9A 1G21E 2GJ9A 2HEIA 2ZUDA 2VSXA 1W36B 4GP6A 3U7GA 3AP2A 4GFDA 3RABA 4A8JB 4PC1A 1X6VA 1G3QA 4NKRA 1UDWA 3LVRE 1JBKA 1QHHA 4HAYA 3I5YA 1G7SA 5EZ5A 1DAFA 2CLSA 3NHBA 4AYXA 4LBZA 4LOAA 4NH0A 3E70C 2PL3A 1Z06A 1XXHB 3W8NA 2Z4RA 2QAGB 4N1AA 1FW6A 2ERXA 2HT6A 3BH0A 3CKLA 1E9SA 4JL6A 2QROA 3ZZ0A 3OEHA 3RSLA 3D6TB 3GCGA 1MRNA 1QHYA 3MWLA 4URWR 5JI2E 2YC4C 2O8DA 2BMEA 2ZRNA 4URZR 4FMDB 3GJ3A 1G3MA 5JSZB 3L43A 3ZVMA 1TL7C 3VQTA 3JZAA 2ZSAA 3P20A 5CK4A 4B71A 1CEEA 3OHMA 4LX0A 1EFCA 1YVDA 2VIIA 4RZUA 1U81A 4DIEA 2ZRKA 3VR6A 4G5RA 2FU5C 2JCSA 5B30A 1IHUA 1J8MF 4BE7B 3GEHA 5K8UA 1CR4A 2ZSEA 3A4LA 1Z6AA 1RW4A 5TARA 4HDQB 5EE5B 2ZRJA 1W48A 1DAEA 3BBPA 4A8JA 1E2QA 1D2NA 3QENA 1HTWA 2PH1A 1ZM3A 1ESNA 3THXB 3A58B 2B8TA 2GRJA 4LRWA 1M7BA 4JS0A 1H8ED 2GEDA 2WWIA 4QHTA 2XXAB 2QGNA 3W34A 3TVTA 4BLTA 1HYQA 3FPAA 4C9BA 1IM2A 2ZYTX 4MKFA 5FPKA 5FL7D 3KJIA 3QKSA 5JBQA 1ZMXA 4ZKDA 3K53A 1NLFA 5EZ6B 1P2TA 3QXCA 5G3YA 5CM9C 1P7CA 4URVR 4ZPXA 1XZQA 1ZC4A 1E94E 1FQJA 1G8HA 3TQFA 2QZ4A 2WPDD 3X2SA 2KI5A 2B8WA 3WYAA 3Q3JB 3KQNA 2A78A 3U3MA 2AWOA 1OT3A 2XJ4A 5EQTA 2V3CC 1R5BA 4LK2A 1K5DA 3R7WA 1EG7A 3V9PA 3UMSA 3NC0C 2J5XA 3QXJA 2R8RA 1R4AA 3FB4A 1KZGB 5KSYA 4FXPA 1JR3E 1XTKA 2I1VB 4MA4A 4HUQB 3EIHA 2FMXA 3PCRB 2XXAA 4HB3A 3BS4A 2XTZA 5C1BA 5DNYB 2B21A 2ERYA 4G1UC 4OHXA 1G20E 2FX3A 4D4JA 3KJGA 1Q1EA 3ASZA 4PZYA 2IX3A 4FCTA 4CEIA 1Q3TA 2C9YA 4ZKEA 4D0GA 1XEWY 3IEUA 3GLHB 2VPPA 2I4IA 1VCMA 4Z8YA 2G6BA 4Q1AA 4YXWD 4IVRA 4BFZA 1Z0AA 4OHVA 1N6RA 2RGXA 2QM8A 2VBCA 1NVVQ 2QPTA 1Z6XA 4JZKA 4LCBA 2HXYA 2WBLC 3H2YA 4G5GA 5DLQC 4UNRA 1MRSA 3O8CA 1OH8A 3QJYA 1GL7A 3GQBA 4LYHA 4AY2A 2FPLA 4HAXA 5DI3A 4IOJA 1MKYA 1U99A 1XTSA 4I99A 4S2EA 3GMTA 1YZUA 1N6PA 2R6GA 4QGFA 3VTKA 1E32A 1KDTA 4OI1A 4RZXA 1QF9A 1EX6A 2OUKA 1JEDA 1W0JA 3X1ZA 4PXAA 1BMFA 1U94A 2CCGA 4GNKA 5AJXA 1E1RA 3BB3A 4DVGA 1IXRC 3PXGA 2HYDA 2WIBA 1GL6A 2ZJYA 1D5CA 1U0LA 2JJ2D 1GFIA 1US8B 2WJHA 4PZZA 3VU9B 1G291 3DL0A 2WHXA 4I1UA 1U98A 3WXMA 2PJRA 2UVQA 5JJLA 4PC3A 3TH5A 1JJVA 1E99A
chains in the Genus database with same CATH superfamily
4X7PA 3A26A 4IXAA 3AR2A 4EY5A 1O96A 1NOJA 1AGPA 4D4KA 2KL4A 4TV9F 2I80A 5TJHA 5EXTA 5A5DA 4BL0B 2UU9B 1VLJA 5IHPA 4KR0A 2C07A 2QN6A 5ALEA 3IE0A 4ADSG 3IEKA 4FOSA 5JY6A 1G8GA 2G9WA 3IE1A 4BVLA 2R5WA 4DEYA 3QX3A 5EGOA 3K09A 2Z1DA 3W3AH 4GGMX 1JEQA 4UEQA 3W2EA 5ALJA 3SC3A 1ESDA 2JCGA 1NRJB 5CPRB 3I6QA 4WLFA 5DHFA 2YXDA 4KX3A 1A9YA 3N5KA 1V8BA 3CUQA 1OI4A 1A1VA 1W9HA 4PIVA 3GGSA 5AJYA 4UEWA 1YBVA 1G0OA 4OY3A 2HPMA 5D6NA 1QZTA 4MVJH 4TWIA 3ULKA 2CLEB 3IDZA 1Z7UA 4Y2HA 4P93A 2BDUA 4E7IA 4LHEA 2ESNA 4DF3A 3A4CA 5BORA 3SC6A 3UV3A 3EXHA 5LNK6 2NYRA 1ZQ9A 3RV3A 3IUPA 4LKOA 4KUEA 3SYLA 3AMVA 2V1XA 1HE1C 3ZHSA 3UAXA 3VAAA 4Q5SF 4ND3A 2JCXA 3ODGA 3OE1A 1O5IA 2ZBEA 4FBLA 2CL7X 1GZSA 5EG5A 1PSZA 1KI6B 1KBQA 1MPTA 4NHOA 4H27A 2J3LA 1DJOA 3OIYA 4RIGA 1JTEA 2LD5A 2CKDA 4AVPA 3ZZNA 4HVCA 2J45A 2OLKA 4NAHA 4DYVA 3C87A 5B5EC 2I87A 2HHCA 4KSYA 4N5MA 2RHTA 4KACA 5FLXZ 2Q3FA 3DZ8A 3LBIA 4B47A 4MNTA 1CEXA 3JATB 2KLHA 1JDSA 3OZ7A 3R0VA 1Z56C 2W43A 4RFVA 5BSTA 4CTNA 4JEUA 3Q8XB 4NXNB 2NVWA 3U4AA 3OI7A 4P3OA 3TSWA 4QT0A 2BT4A 1YQAA 2AL7A 2JGFA 1S0UA 4PE5B 5FBQB 4B4WA 2HTFA 1JR2A 4EHFA 3VKGA 2H63A 3KP1A 3TMYA 4ECEA 3KDSE 5BSWA 3I64A 4WFJA 2CLKB 5IBPA 1MC8A 4ZVTA 3ZDYB 4I5DA 2HU8A 4TS4A 1C7JA 1RAHA 1DBPA 4AM8A 4X7RA 3QODA 3A01B 4URUR 4KE7A 1IV6A 4LNHA 2Y1XA 5BV0A 1J42A 2VHQA 3FE2A 3RS4A 3OJ0A 1YK1A 3Q10A 2RNGA 4P9UA 4TSFD 1B8OA 1LPMA 2V96A 4S04A 1GJRA 2FSVA 1P1CA 2PUDA 2Y1DA 4H1UA 3VZCA 4CCJA 3TQRA 3PJDA 1MH3A 2L19A 3B53X 4OLJA 5HRCA 1G17A 4EGFA 1AGXA 3P96A 3GVHA 2NVBA 2Y8EA 5K05A 2QVOA 1YE8A 2H1OA 2LP0A 3ZLBA 1ZUHA 3DEUA 3VZPA 2KIFA 3LQQA 1L8QA 2RDMA 4DBVO 3SWWA 2E5FA 4B74A 4JP1A 3FSGA 4MQFB 1G1MA 3N86A 4O8ZA 2EFGA 3S7ZA 3PNTA 3HZRA 1R4MA 1ZGHA 5CCBA 1JB1A 2OORC 4IF6A 5ES4B 2ET6A 4EX6A 4BO5A 5HKKD 4OA5A 4BTVA 2PIDA 4WXDA 4RV4A 1MIJA 4IM7A 1O8BA 1LJ9A 1HDZA 3CF0A 2PWPA 1Q7CA 2JLRA 2AUNA 1Z2OX 1DU6A 5HF8A 2XCLA 2V79A 4OTZA 1LI5A 1PYOA 4C1NA 2E1NA 2NXEA 3BB4A 2MYNA 2FPXA 3QWBA 3WTWC 3OQBA 3X1JA 4CM7A 2ODTX 1FFCA 1C3XA 1PI3A 4DIBA 1K86A 1SFEA 4TQAA 1B9NA 2V0NA 3NM4A 2TMYA 4CQNA 3IL2A 4MKRA 2GXSA 4N9IA 3PDIB 3HXQA 4BX9A 3L06A 1JDTA 1BX3A 3L6UA 3LTNC 2J07A 3DAFA 3DYIA 2HA2A 4KW7A 2FUCA 2HWVA 2QL9A 3O8HA 1MU0A 1YDHA 2J46A 2WAQA 3ZNOA 1KO1A 2DBYA 4CTJA 2H9YA 4BNCA 5TRTA 2A86A 2G9RA 1I30A 4G6ZA 2NO7A 3GIWA 2VDMB 5IP7J 3JRDA 3EDYA 5IHXA 4FILA 3GPCA 1PFKA 2YZ7A 4CT4B 3QX8A 4C6SA 5F04A 4KV7A 4DRXA 3UMMA 2OSBA 3ZGVA 3ISTA 4E3ZA 2PMWB 4F5EA 5A7GA 1F2DA 3WLMA 3HQ4O 1U5BA 3RJPA 4QE3A 5CTAA 2XKPA 3WGMA 3GZTB 1IH8A 4L5IA 5IUNC 1KVQA 4R71A 3WR5A 3TJMA 2BKVA 1BW9B 3GLLA 2HPAA 4PLZA 1FJGB 4KIFA 3P9CA 4US0R 3THWA 3KB2A 2DQRA 2D1SA 3ZK8A 3HHHA 1V9SA 5F7ZA 1H2XA 4E33A 5DMXA 4OSEA 1N2CB 1H23A 2JJ2A 4IRGA 1I6XA 3WRYC 1I7NA 4BDZA 4CM3A 4PG8A 5J8CA 3SX2A 5J2TF 3Q7TA 1M73E 4IQ4A 5JNVA 4OGGA 3EY4A 4RA9A 4NL4H 2XPWA 3QK7A 1IXKA 5AUPB 4KVAA 2AN9A 1EK6A 3ZJTA 2MD0A 1CZNA 2XDVA 5LRSA 3HJHA 4YLEA 1ZJ6A 3PFKA 2M0CA 5KTNA 3RWMB 4OINF 1AA7A 1Q7BA 4XRRA 1U7XA 3ZWCA 5LZ8A 2QQBA 4K0RA 3H18A 3QKRB 3ZE9A 3QYAA 2DUUA 1LWOA 5AVYA 2AE1A 2GJAA 4WX9A 2VDOB 5EQJB 3L7LA 2OXRA 1MGTA 5AH0A 3NOQA 1MMNA 5EJ5A 1EE1A 2Z9CA 2VLBA 1U9IC 1DC3A 3AG1H 4AMBA 2VF5X 3LA7A 3VAYA 1BOOA 4DC9A 4IEJA 3U61B 4MHGA 1WD7A 1XB4A 5A9SA 5K0EA 4CO8A 4MGYR 1SZPA 4JDUA 1MR3F 3U9GA 1Q50A 1YO6A 2E2WA 1U6GA 2IHYA 1TT0A 3LX5A 1ID1A 4GU5A 1ZH5A 2QMHA 5F2KA 1W1WA 1Z38A 2ELJA 3ZV4A 4U0WA 1NV8A 3PL1A 1VMAA 4X1YB 1AXRA 1P73A 4DVJA 4OEHA 3AF0A 1Z22A 5JASA 3V1KA 1K6MA 1LV8A 2EFHB 4B6QA 4URXR 3DPSA 1ISFA 3WA7A 1KC1A 3NVDA 4KWHA 2ICWG 3WICA 4ALIA 5JDCA 1WV0A 2ZJOA 1KQ0A 4ENWA 3UXEA 4WCFC 1CR2A 3C2BA 3MB8A 3PFHA 4Q7EA 3GZNB 4O29A 1DXQA 3QWHA 4XONA 3OR2C 4ACAA 2ZR7A 3GP3A 5J6XA 4UNOA 1RRKA 3DFIA 1X74A 1F6DA 1TX4B 2OFWA 3CLTC 1XZMA 5M5WJ 4JJFA 1AS0A 2B92A 3FHNA 4LSMA 1PYGA 1H3NA 2PQMA 1N2EA 5F1RA 2HPIA 3UMRA 1Q12A 5A5GA 2CNKA 3SIRA 3SVTA 3MCZA 10MHA 4IX7A 3WB9A 5HNKA 1R64A 5LJLA 3DQVC 1OWOA 3U1VA 1AUQA 1YB6A 4LGWA 2GF0A 4UU8A 3CYFA 4PLPA 4OLFA 4B9AA 1SXJB 2TSYB 2PUVA 2KFDA 3OJLA 5BR8B 4DLKA 3KFXA 2D1YA 2VQGA 1IEVA 1N8KA 1T0UA 3C6QA 3PQ6A 3B6IA 1T0HB 3ZQQA 3X2EA 1MX9A 2G7MC 2OU2A 2H5LA 3NGMA 4F72A 4OX9Y 3HSFA 3C39A 3A9WA 2H6BA 4FMPA 3MNFA 4Z1OA 1Q1GA 1RP7A 1ZDMA 2D3TA 5TC4A 1G16A 5E6UB 4OHCA 1XZGA 2KQRA 3BE5A 3FNGA 1HQCA 2IGMA 4UHHA 1XQWA 4YAWA 2W84A 4YTEA 2IYZA 4X85A 3CKYA 2JARA 1G8XA 3KQTA 2PT9A 4A8TA 4BE2A 3P4YA 2WKWA 5FKMA 1N8TA 1GPWB 4V2GA 1GUBA 1FYXA 3VR3D 4JYZA 4QDOA 1BEZA 3ELUA 3FNEA 4INAA 2GJKA 4ZHSA 4TXJA 2FR0A 3WQRA 3TLMA 3L0BA 3SBEA 4OU0A 3DFMA 2AI2A 3TEDA 2IZZA 2FRVA 1IPFA 1VBNA 4A3IJ 1A82A 1YZVA 1TYBE 2L01A 4C3HJ 4CM4B 1LLDA 3RS2A 5FD8A 1KMQA 5J23A 2FPGB 2XGGA 1DJLA 3RVLA 1FTQA 3BRSA 1T5LA 2BCEA 2J48A 1NU8A 1C8LA 3GMDA 4NYIR 1J21A 3HKZN 1T5SA 4LITA 3C7AA 3Q11A 3O8RA 3B85A 3BTUA 3V7SA 3RYHA 1D2AA 1F9NA 4Q3KA 2XCUA 2W2PA 4Y2SA 2AJDA 3FMSA 1QF6A 5IW8A 2I4RA 3FXAA 3BPSA 3ME5A 1SCNE 4ZXPA 2IJLA 3QQ5A 2V58A 3LCCA 4ACBA 3F6PA 4X0EA 2HZDA 1D8JA 2BFBA 4LJLA 2HV8A 3SZLA 5JS2A 3GARA 4BLUA 1TJ3A 2G36A 2D5AA 2XRLA 1OAOC 1PFUA 2ZUWA 2AQKA 3HYTA 3FXLA 5E18F 1VQ9I 3EH2A 4E7KA 1HG1A 3LZCA 3IEMA 3K0AA 1SVIA 1HEIA 2Y77A 5E8RA 2G7UA 2NSJA 5KJ1A 2Y6VA 4P7GA 3JAWA 3W3ZB 2D4HA 1II9A 2ZULA 4PM4A 3VKFA 3N2EA 1V5WA 3U40A 1ZXXA 3UK1A 1NW5A 1U7PA 3BGVA 4EMUA 4LYEA 1YZHA 2WJ3A 2HKIA 2DFKB 2ZCWA 2HHAA 4QRDA 3AINA 5IYCJ 1WKBA 1PQWA 4FS3A 2VXCA 1T08B 3DHWC 2WHQA 5FLMJ 4RPJA 1H9GA 2O54A 4O25A 5FNZA 1G7RA 3SJCA 2E34A 5FPQA 2NU9A 3MF4A 1FK8A 2BGTA 2EBHX 3U3OA 5K3EA 2I3GA 2Q49A 2REQB 3GFLA 3EFHA 1YZ3A 1WXFA 5IRCD 2R48A 5LU9A 2OAZA 5JLAA 3SEAA 2HGZA 4L07A 3STXA 1SUWA 3HJEA 3NETA 1FEXA 4K86A 1V26A 3VPFA 1T0JB 4EG7A 1KP9A 2UKDA 1JEAA 1JW9B 1ZRFA 3AC0A 3HRHA 2O3FA 2CUTA 3RIRA 2IPQX 4XL9A 4IUYA 2H7XA 4DG8A 5JMTA 2XKBA 4DXHA 4NC9A 3RDPA 421PA 1F1JA 1ZD2P 4DV2B 1NULA 2XECA 1PGPA 1TQ8A 2NVQJ 1LPNA 2TDXA 4TT8A 3T3GA 1FJ2A 1PJLA 4KGVA 3AVYA 1G9SA 1KZ4A 1YQQA 3HJTA 3WHLA 4RFLA 2Z0MA 3CMCO 4A93J 4K6CA 3ILXA 2ZAMA 3HSSA 2XT9A 2KQUA 1LWNA 3J81A 4KO1S 1KAEA 3I9V1 1AXEA 1KI3A 3FDXA 2FN9A 2PX0A 2CMFA 1EA7A 2GCEA 1P9LA 3NHMA 3WLPA 1AU7A 1QNTA 1NG6A 5LU8A 4WSOA 2BELA 5F2EA 3T9CA 2P90A 1T8UA 4E46A 4AB1A 4E15A 4MYHA 1ZBQA 2DFTA 4B82A 1DRUA 4P3KA 1EMDA 4IQFA 4CM1A 2GVDC 4DJAA 2QW8A 4P4LA 2A6PA 4OKSA 4N5HX 3UQYS 2V6IA 3D5EA 2PXHA 2QVLA 2F17A 2FRDC 3G88A 1T95A 3FUCA 4A12A 3PPIA 1FNDA 2QPAA 5CVVA 2HJSA 3M6LA 1RPZA 1UBNA 5GWXA 4UVBA 2BC9A 1J7JA 3OUTA 3EGOA 5KX5F 3OKCA 3CZ9A 2R5FA 2GYYA 2XZLA 4MWZA 1BU5A 2IK8A 4MJLA 1UQTA 1RXYA 3SE0A 4JBLA 3NHKA 4IMIB 4X62B 1PR5A 2F1HA 2X13A 4EMSA 4AP6A 3A6JA 3DOCA 3Q5GA 1L3CA 4YCLA 4UTZA 5HW0A 1S72I 1GQ2A 1I7LA 3RIEA 4M3GA 5TIIA 2ID8A 4K88A 2EEZA 1IWBB 3R5TA 4BNYA 3BHMA 3D6NB 4DUZB 3V7RA 3MLBA 5D2CA 1IEXA 4MP8A 1ORTA 2JLQA 2R65A 3VBCA 1YDWA 2ZS8A 4JLKA 4CHUA 1IZ9A 2QN9A 1OAKA 2VA8A 2HRCA 3QLTA 3SU8A 3BYZA 4POOA 2BDTA 1Z5WA 3F6RA 1EPUA 4MMXB 2QQEA 5L45A 5JXGA 4HDKA 1S3SA 1LTKA 4XVCA 1NLZA 3I37X 1PLKA 4M6VA 4RVDA 2ZT6A 1T3ZA 1QO9A 3DV9A 1LPOA 4X20A 3RGGA 4MCAA 2KM1A 4BB0A 2HSWA 3ZU6A 4DR1B 4DCSA 5E1MA 3CJTB 3BR3A 4M8SA 4G5YA 3KLOA 2YICA 5HF5A 5J1UA 1N0VC 4FZ5A 3PWSA 2Y75A 2MWMA 4WPGA 5EJMA 1WNTA 1MXHA 2RHRA 3QPVA 4C20A 1U0EA 1TYDE 2XKJE 1SVLA 5AXDA 1JFSA 2RHJA 2GXBA 3WGZA 1UC8A 5GP1A 1I33A 5DW0A 1CUAA 4NMWA 2OFXA 3ZIDA 4RKFA 3WNBA 1F8YA 2BE7A 4LG1A 1AQNA 3E1GA 3OESA 3U4GA 4RHXA 5E7JA 4C6HA 2C83A 4DDWA 5FADA 1UP6A 1Y6QA 3NVAA 3SZRA 3MZYA 1U1GA 5DT2A 1YRQA 1PJAA 2Q4EA 1HW1A 2PGAA 1EH7A 3C3KA 3TK1A 1ODFA 1UBHS 4ZI2A 4B6RA 5CYFA 3BG9A 3IHUA 3BJ6A 3FJ1A 3BL6A 4FI3F 1DC8A 5HPYB 2Q27A 1H2BA 2BCJQ 1E2UA 4CJXA 2W6IA 1F2TB 1U2EA 3SZOA 5IAKA 4FGLA 5LLQA 1B16A 3HXPA 2YRWA 3ZCRA 2OAEA 1BOFA 4DYDA 2YU9J 3FUTA 2Q0QA 4ENQA 2HNBA 1JMKC 5EZGA 2ZU6A 4D9HA 1D03A 2CLCX 2K3FA 1N9KA 2A05A 2ZBKA 4C3IJ 1E5LA 1Y56A 2FKAA 4RD4A 1Z45A 3KKNA 1CB0A 5KVVA 2OP1A 4FD3A 3EVEA 3UJ8A 4Z9FA 1E6WA 3WGQA 1P31A 4I2OA 3D8UA 1XD7A 5K45A 5CPBA 4D0NA 3QPLA 3PNOA 4RGVA 1JT2A 2VBIA 2NP6A 1ES9A 1TVCA 3TM5A 3EG9B 1EG2A 1YCGA 4AD8A 1GIAA 4DDMA 2G80A 2ZLBA 2RK6A 3RABA 2QHXA 3H5VA 1Z2NX 4C14A 4JFAA 5FKKA 2ZB4A 4HAYA 1T35A 3GUZA 1X1AA 1SHLA 2FD5A 3MTGA 5LJIA 1QB8A 3GAMA 5JT1A 4KWTA 3JZAA 2ZSAA 1E5VA 1YVDA 4A0XA 3UOWA 3BWVA 4LB5A 2XE7A 1N36B 1IHUA 5ICCA 3CXUA 1FVHA 1AE1A 2ZSEA 1QYDA 4AIDA 4QFCA 3VZDA 2ZRJA 3BBPA 5E79C 1D2NA 3QENA 1CHDA 5IKPA 4P0PB 3DLLF 3ZXUB 3B8EA 3LO8A 1HDPA 4I02A 4BGVA 1HZJA 1G5QA 4GKJB 2BKAA 5FPKA 5JCXA 3QEAZ 1WG8A 2C3UA 1OVGA 1ZMXA 2H3EA 2XUPA 3ROPA 3JQ6A 4UD6A 4RQTA 3TQHA 3F4BA 2LY1A 4P55A 1ORHA 5HKAA 4NX2A 1IQRA 2G8LA 1N9GB 1G8SA 1FXWF 1IPHA 3R7WA 4BMNA 1EZZA 5JC1A 3DLCA 3NC0C 3ZV5A 1M0SA 1RZRA 4RB0A 5E6SA 2BFCA 3WE7A 4HB3A 3V97A 2FX3A 3LSMA 4A7PA 4ZKEA 1BWSA 5IT0A 4WOCA 2A5LA 4L5YA 1E1LA 1OWNA 2O1SA 3GLHB 4A6EA 3S8EA 2CGEA 1ZS9A 5A3QA 4PLTA 4JZKA 2PX8A 1WW2A 2PGLA 3QJYA 4LYHA 2WHPB 2P9CA 4XKVA 5IZCC 1AQLA 1I6HJ 3PU6A 4M3FA 1UBKS 3BSFA 2MSYA 2ZSHB 3HA7A 3DSRA 3DNFA 5I9NA 2C20A 4UC0A 2BAGA 1PNVA 4XWWA 2OMEA 3WV4A 3GRCA 2H4HA 1UCRA 4LECA 2DB3A 4YONB 1R15A 1YE3A 2FSIA 4M0PA 4CKZA 4XQCA 5K0FA 3NORA 4RUKA 3TSAA 2GTIA 4KTVE 3OR1C 3KEYA 2UV1A 3L02A 3N07A 2MSKA 1MSFC 3EZNA 1BR4A 4ZVSA 1DKLA 4BLPA 4Q1DA 4ZEXA 1QIDA 4C4OA 2Q3DA 2QTWB 3DO8A 2VKDA 3SE7A 4RA6A 2CFIA 3FCEA 2IU0A 1PZFA 1KYXA 4G8DA 3E9MA 2Z6QA 1GNTA 1RWKA 2KJQA 3HGQA 1KSHA 3RO7A 2OOKA 4IXTA 1SFRA 4LFBB 2JFVA 3UB4A 3K4CA 2OZ6A 3BQNB 3FDYA 2DPXA 1OW3B 1CF9A 3IV9A 3B9QA 4B79A 2H2DA 4O4HF 1QGPA 5FD5A 1X80A 3ZHQA 1E3WB 1LF5A 4R1LA 2V7GA 4UOEA 2XE8A 1W2WB 2H8WA 2I54A 3M5PA 4UHFA 1K0UA 3OFVA 3L9FA 4YFYA 1WPGA 3OUZA 2P9ZA 2RGGA 3DJFA 3IKVA 1BOAA 4HEA6 1VFCA 1ZA2A 1VB5A 4PC7A 3SY8A 1HEUA 4KVFA 3DZDA 4GZLA 2BZGA 3IDFA 1VIYA 3WU2C 1I1GA 3F73A 4DR5B 4UBJA 1WDLA 1YJAA 4EG0A 5JARA 3OX4A 1GHTA 1JR3D 2B37A 3R6LA 2QG6A 2WFMA 1CYEA 3VVLA 2EZUA 2I67A 2GLXA 1I3QJ 1Y8ZA 3GAFA 3KUXA 1ZIPA 3EGWA 3BQYA 1BKDR 4FYVA 3UWKA 2VYFA 3D2LA 2VA9A 1P9NA 2JAQA 4M7PA 1Z4JA 3GLSA 3AZPA 1T24A 3L7JA 3AUXA 3PVCA 4A5MA 1CVIA 4BQIA 2RBKA 4HEJA 2IEZA 4BHTA 2B4TO 4KI0A 4MV4A 4XPIB 4FOLA 4FMCB 3T0GA 5C44J 4KN7X 5IF9A 3GF2A 3AU8A 1M1NB 1SVNA 3JWPA 1E7WA 4F9GA 3R8XA 2FK8A 4CKBA 2JFWA 2YBEA 3I72A 2HFJA 4K3UA 3WGVA 4WN9B 5ENVA 3S2EA 3IAM2 2GVZC 2ZSDA 1BJAA 2SCUB 2IIQA 3HYLA 5DOVA 1ZX1A 4IW3B 2ZXWH 1EFVB 1IJWC 4HDMA 2XD4A 1R3UA 2HV9A 1FMWA 4UE3S 4UOZA 2XIGA 4BNJA 3FFTA 4RMGA 1X2MA 3MMZA 2Z98A 1E6CA 1PR1A 3W5SA 2C5GA 4NNJA 5EJ2A 2TYSB 3VNVA 3F6OA 4RSHA 5K0JA 1QU2A 3EIQA 2CL6X 4XYEA 1UG0A 2OC4A 1X7DA 3WBKA 3OFSA 2CDAA 4MVJA 1KJJA 5E8GA 3NEPX 5ALMA 1BVHA 3KOYA 4IDOA 4YMIA 3Q7SA 2WIDA 2LG4A 1YHQI 3CV3A 2IEGA 4QAQA 4YP1A 4PAQA 4DB4A 4M71A 1L1QA 1O94D 3FPSA 8LDHA 1J8DA 3BJAA 3P27A 4BVJA 1GCAA 3K6SB 5KQGA 1Y4ZA 1IHOA 4B84A 1TQPA 2B94A 3H11B 3LFUA 2R6AA 2ZRAA 4X6AJ 1Z3IX 4W1UA 3JWGA 4FYYA 4EY6A 4LZJA 3HU2A 5B3LA 4YP5A 3IOEA 5I7FA 2B9VA 3M34A 2Q99A 1R5OA 4W5JA 3LDGA 3BD8A 4BKQA 2NN3C 4R9SA 1D04A 4OKIA 3MFYA 4WCVA 5HSGA 1IBKB 3WRXA 5FOUA 3HE3A 2PAAA 3WNZA 2QRGA 1F06A 2XVCA 4RKYA 4BO7A 4EB0A 4OREX 4U7WA 3Q9VA 2V6MA 3OQPA 2QUFA 1DT3A 2JGDB 2Z5GA 3LKDA 3BE8A 1NW9B 4BNDA 7ABPA 3T06B 4YAKA 4Z2YA 3OZRA 1U8ZA 1YLFA 1MZBA 4FQ7A 4GXTA 3OYIA 2O8KA 3SNHA 2A6HF 3VUEA 1BRMA 4I7HA 2OEPA 5EHGA 1ORKA 1P77A 1XVUA 3UOAB 4MV5A 1OBHA 5GV8A 1F8XA 1AF4A 5CG1A 4WFKA 3LDFA 4CYCA 5CFMA 4O33A 3U3ZA 3RS5A 1XAIA 2B1RA 2ATIA 2EP7A 1YDMA 2P9HA 3B9BA 3EXFB 3BZUA 5FBZA 3WP0A 1D4OA 1MENA 1O96B 3V7UA 3ZGNA 3QYEA 4HDNA 1Y5LA 4BS9A 4PZ9A 4PLYA 4DV4B 1IUYA 1NP3A 1G5FA 1SELA 3BHNA 4D7AA 2AUTA 3WWCA 2OPTA 2XB0X 5EGOB 1VHQA 1P0CA 4RABA 1CDEA 5I9SA 1JEQB 1BX1A 4CMAA 2A9FA 2Z8YM 4HV6A 1HW2A 4GMXA 3VKHA 3HDHA 1WY7A 1SULA 1GLGA 3ZOBA 1IAWA 3CUQB 3LT5A 2VBZA 5TSDA 4XSGA 4BACA 4QREA 3UTDA 3GW8A 3O47A 4JODA 1E1DA 3V7FA 3L8MA 4AJ9A 4KPUA 1WA5A 4J19A 2V1DA 3I2YX 2I7VA 4UCXA 2FOKA 3RBXA 3EXHB 2WDPA 5JALA 4Q1VA 3RK4A 1MC5A 4X1OA 3UW1A 4OMUA 1VQ1A 1E9AA 1T9GS 1N5JA 3LTEA 3VZRA 4HT3B 1J5XA 4M22A 1TWHJ 1DMRA 5TT1A 2X9VA 2HZ7A 4QG3A 1GTSA 4JC0A 1C4KA 1T1JA 2XCQA 3ZDCA 4LY9A 3W5IA 4E2FA 3BKXA 4LS3A 2CZGA 2CCJA 3TRFA 4ENSA 3GXOA 3ZZTA 2C99A 2QN2A 2HCTA 1KI2A 3CVUA 4J7AA 1R23A 1HOMA 4IPTA 3X1DA 5IC4A 4LBVA 5DNEA 1B3RA 2QTFA 4XR6A 1YO5C 3UWDA 1ZO8A 1Q44A 3HCCA 1O2DA 1ZMTA 5EHNA 1CP3A 2EWWA 4F5YA 1E2BA 4OLAA 1RHRA 1E0AA 4ARSA 3Q15C 2ZDQA 4C0JA 2YRXA 2G71A 1FRNA 1QIFA 1BR1A 4NBQA 1UKVY 4FPXA 1NHAA 3VRHA 4YJ3B 3WLAA 1I36A 3ND6A 1EUZA 5GAEJ 2P40A 2MINA 2VUMJ 2FQXA 2IBMA 4XM1A 3PBKA 2WT9A 3WG9A 1Y7HA 3DDHA 2NNLD 1XTQA 2NUTA 3TB4A 4NOJA 3WTCA 1T2FA 3WIVA 1QYCA 4JIGA 1U9CA 4A8HA 2OCIA 4TSFA 4OYRA 2QUIA 1Q83A 1QWOA 3NAUA 3I58A 3V4PB 1Q1HA 3TW6A 2PZGA 2CMKA 5DWDA 3BMNA 2FR1A 2DEUA 5CG2A 3QX9A 1RR7A 3QE4A 1V43A 1U5CA 5JWHA 3IVAA 3PF9A 2HD4A 1ONSA 4YVFA 4MPRA 5HOQA 3GGGA 5BW4A 4GBGA 2MSWA 4MQ5A 3CMMA 3NRBA 2DFEA 1WDMA 5KTSA 4XUGB 4AS3A 4A5OA 2I66A 1V9CA 1V1RB 2GK4A 1CUUA 1YF3A 4R5HA 3OQMA 1K7SN 1RHUA 1D2MA 3IHLA 4WFIA 2Z6AA 5E20A 1T2VA 4MZDA 4KITB 1RM4A 3FUUA 4LWQA 5K8IA 3MWGA 5HKKA 4OQXA 2JD1A 2WTBA 1E66A 4TLEA 3RADC 1XGSA 4TYYA 2BR3A 3OIFA 3R8CA 2O2EA 4QTXA 5BUCA 5CKTA 3ELKA 2W2OA 2CQQA 2ZB3A 1QM5A 2R6JA 5I9IA 2A9OA 1V25A 3JQQA 3OMYA 5CYPA 4MVJI 2PNJA 4CLXA 2O2SA 4XK4A 3G2QA 4ZGWA 3WKEA 3L6EA 2ETXA 4EEKA 4HH1A 4UEJA 1AKTA 2PQ2A 2LWIA 1MMFB 3RW9A 4U4AA 4FQ5A 4WDRA 2FW9A 5E3HA 1A9RA 4XLTA 4WJZA 5LC1A 3IUYA 5C9ZA 4YX9A 4CIAA 1P3Y1 3C5VA 5HKLA 4OIQF 3Q7RA 2ZUTA 2VXYA 3SSOA 4I01A 1Z4PX 3PI7A 1F0YA 3LHDA 5ALTA 1SZCA 3RI3A 2O5RA 3KX2A 5K6AC 1EJ6A 4ZU6X 1CNFA 2ZMEC 4IZIA 4AYBN 2W2NA 1AM4D 2GM4A 1WP4A 4C03A 2ZS9A 4MCJA 2D7JA 5DXFA 4ETWA 2QUAA 3FTPA 4ME6A 4ZEMA 1SXGA 3JSOA 4M9CA 1F1ZA 3SZ3A 3RYPA 2VAXA 1ADYA 3NBXX 3FM3A 2Z9OA 4EHJA 1YJWI 1U5BB 1WCIB 2B3TA 4NY1A 1Q2XA 1VE3A 3BN3A 2ZSBA 3DV2A 4J29A 1JG1A 3COWA 4FXOA 3SM9A 2R97A 2QUBA 4EECA 1XQYA 3U17A 1J1ZA 3THWB 1Y5MA 1M9NA 4KMOA 5EYPA 3CLKA 4NV3A 1IG7A 4JJKA 5IASA 5CLSA 1KWKA 3K6JA 2OZPA 1IRIA 2XRFA 4TS1A 1Z7EA 4H17A 4N7RA 3RPQA 4AJOA 2DFVA 1T8IA 4RA9B 5KTKA 3LUKA 3WHBA 5AHKA 3QMMA 2Y9PB 1OPCA 2W8ZA 5TV2A 3QPUA 3JAMZ 4YLGA 2HSGA 2WHRA 4GXOA 1P91A 1B15A 5BWCA 1VPEA 2HSZA 4URYR 1B42A 5K0NA 1L5SA 1IUKA 1FIPA 5FTNA 1UMBB 1X1CA 2X0NA 3QFSA 1VSVA 4H7IA 4O0MA 4RL4A 1P4SA 4C88A 4BNNA 1R6TA 3CSUA 2CF5A 3G23A 3R61A 2O1EA 3QITA 4ZCQA 4ZT3A 3H8WA 2Q3LA 3K15A 3M9LA 2XDWA 2CG4A 2DTZA 2O7RA 5D8KB 4AO7A 1ULBA 1DNPA 1KMNA 1X3UA 3EQ8A 3UJDA 2FJ0A 2DRIA 4B80A 5IPAA 4WUTA 2VPWA 5IT9A 2H48A 1SBCA 3O38A 4AZ3A 5A9SB 3K2EA 3D81A 2C95A 4MUGA 4R7TA 4YIRX 2HUPA 4FR5A 3F8TA 1VB3A 4GOKA 5T6BA 2PHZA 1KJ8A 4RPLA 1P1FA 2O8VA 1B00A 3LC7O 3BJIC 2VUUA 4JI0B 1MT3A 4ZO9A 1XMKA 2DFFA 5I4BA 5AW9A 1UK8A 2VJJA 1M2EA 3UHJA 3TDUC 2ID4A 2PX9A 4G1BA 3PXAA 1QGAA 5ALPA 1UJ5A 2PWYA 2C7OA 3O95A 4AJPA 3AUUA 2YXNA 1LVAA 2WYIA 3H0EA 3HRMA 2WAEA 3BP8A 5KC9A 1KU9A 1VSTA 3G17A 5ABPA 4X8OA 5CEFA 1HOTA 3KZIC 2NU7A 3KP7A 4I0WB 2Y1EA 3EK2A 3W78A 1EU1A 3GPIA 3N87A 1SCIA 1G5HA 2WE8A 2I5PO 2EGHA 1PJ2A 4C7OA 2M5WA 4HX7A 3WTXC 2EBWA 4KIWA 1OXUA 2WQ7A 2PQ0A 1RJFA 5F4BA 3BCHA 1P72A 3U1DA 3KR9A 1F1BA 4UUQA 3PC3A 1VGVA 3CZRA 4LG0A 3UA3A 4ZRNA 4K87A 4KTTE 3KBBA 2C3OA 2WSSD 2JIQA 4JBAA 2V7XA 2ZVPX 1E3HA 2YYYA 1VQMI 1U0OC 3KO8A 4WLEA 1M7GA 1K6XA 5HDNA 2A5FA 3O8OB 2HQNA 3HU3A 3J7AY 4UEOA 1E2FA 4WBNA 5JZSA 2RGAA 3A3YA 1Z63A 5JCOC 1YUNA 2FPIB 3DEZA 1USUA 4OG2A 4H4EA 2PMCA 3Q3IA 2QZPA 1L5VA 1NF9A 4EKEA 2MLGA 2YX1A 1FS6A 4HNRA 4MKHA 5KQRA 3B78A 4PX3A 1KOJA 1I2ZA 5D86A 3FPFA 1DBVO 2JQ7A 3ZI0A 4K5QA 4JJEA 2BGCA 3MW8A 4G6QA 4ZI7B 1S29A 4XWTA 3L41A 1M2HA 2GEVA 1MEEA 4KX5A 4X84A 5HJ2A 3VR3A 1NNLA 2EAUA 2DT5A 4HVLA 4ROSA 2LIPA 4NZOA 4J0FA 3X1KA 2Y67A 1N3BA 2FWAA 2VHWA 1YQ9A 1UR5A 1Z7WA 3I3SR 1Q0ZA 2JGJA 4ZJUA 4AK9A 1ZI8A 2AR0A 4G86A 1VHLA 1FL9A 4QBFA 1J2TA 1DBQA 1JE0A 4M98A 2C4TA 5JEEA 3HMQA 3BWXA 2JZCA 5KTTA 1JZSA 2EX4A 4GIBA 2QMEA 2O5CA 5ECWA 4P7BA 3SS9X 2J5RA 2Q2QA 5A4JA 5E0OA 1PFGA 3EMVA 2B3DA 3TCXB 4HX9A 1U1FA 4JX9A 4BN5A 1QGDA 4FYKA 2RNJA 4U9UA 3N8HA 1XRNA 5LDGA 5C8YF 1ODDA 3C3CA 1XN7A 2E1RA 3AVPA 4LZNA 5A0TA 2L17A 1NVTA 3C3XA 1FSEA 3H16A 5DM0A 4BV3A 3RYHB 3GFFA 2H54A 2L7FP 3LDHA 3HTSB 1EDZA 3L2QA 3HOWJ 1RM3A 2J30A 3IP9A 3GTMJ 3LLUA 4JP2A 2EQ5A 4DC0A 1NPTO 1YTLA 3BAFA 3LBYA 4HDCA 2BFBB 3GGJA 4MV7A 4FHTA 3VC1A 2Q9BA 4HKTA 3NB0A 4TZ6A 3DKKA 4XOTA 4ENVA 2CLIB 2C2BA 4OLHA 1KIMA 5FKNA 1DDIA 3GJZA 3K0AB 5KQPA 4GPIB 5IH3A 5IX8A 1S2IA 2GM3A 2VAVA 4E5KA 1CY4A 2NXNA 3JWJA 4KQ9A 1GN8A 4EFLA 4DV0B 3RFUA 4ZCTA 3IAS1 4Q03A 3LGAA 2VK1A 4YC7A 3DYBA 5DGHA 3QVTA 1QVTA 2Q29A 3P0JA 3LJKA 2XWQA 1K3FA 2K87A 1WSUA 3EZGA 3BPVA 5HE9A 2XHKA 4PYOA 1FNCA 4GP6A 4A8JB 2CS3A 2BHZA 4IOAF 1O0CA 5AM0A 2NU9B 3HYNA 4NH0A 3R5JA 3E70C 2PL3A 3W8NA 2YFHA 3BWCA 3G5AA 4N1AA 5F3DA 1QHYA 3A0RB 3VQTA 4HK4A 2C2YA 5HK8A 4M0CA 2DQSA 2XQKA 1ZNQO 4BE7B 1J8MF 3OY9A 4QYSA 5EE5B 5LMNB 2A61A 1FOWA 1K7FB 3DMTA 3T9FA 2XE4A 2G6TA 5LGUA 3CVYA 2H1RA 2GEDA 2UDPA 4JP8A 4OBWA 4DNPA 1U8TA 3DXYA 4UV8A 2HW8A 4BLTA 2JI9A 1V11A 1I80A 2ZSIB 2X6XA 3HFGA 3K53A 2HQOA 1S5PA 2ZIXA 1V2HE 1E94E 1AURA 3TQFA 5B36A 2V0GA 3M3PA 3ZPLA 3UFBA 2ISQA 2WVHA 4LK2A 1K5DA 4OYLA 3HTXA 3HUTA 1SWWA 3LHKA 3UMSA 2QYHA 5C1BA 2D5IA 2DPDA 1WHTA 2FP4A 2O9JA 2GCGA 2G6BA 4YXWD 3LQFA 1X92A 2RGXA 2H1WA 2VUSA 1YS2X 1VQNI 1T25A 2AJ8A 3OHSX 4RHTA 1GCOA 2G0AA 3L7YA 2AG5A 1SBHA 4JQFA 2YJNA 3KPYA 3LSYA 3I01A 3O03A 3BB3A 2ZXJA 3M6XA 4N12A 2VCYA 1JEOA 5DBIA 4KYTA 1W44A 4M87A 1HRDA 4G3XA 4Q82A 2GESA 3WL6A 1JTXA 2YASA 5J5VA 2DFLA 1NOKA 3P97A 5DUKA 2QRUA 1Z3YA 5CTJA 3NNSA 2WWYA 1V6AA 4Q05A 4ARVA 2G7ZA 5C2JB 1ZJZA 4I50F 3KUDA 5CB4A 1E2KA 3KKMA 1QBJA 2AC2A 3IAFA 2RGVA 4ZN6A 4CNQA 3PUYA 5A1TA 1Z8FA 3PV0A 1SHZA 1U7DA 3PLRA 4XI9A 4J3FA 3L8EA 3LK7A 2DOKA 5DPMA 2WZCA 3IT0A 4E6PA 1QP7A 1WSAA 4ZEVA 1Z5NA 5G0UA 3JTHA 2WU8A 1W5FA 3FNBA 1NF3A 5JI6A 5A1JA 4MCHA 2FQWA 3HY4A 2NTEA 2HRQA 3DVAA 3IKJA 4ZH4F 2LTAA 4ZWNA 1Z17A 4L0DA 2J3JA 4R8RA 5ALNA 4PHFA 2D5BA 5K3OA 4QTZA 2IYSA 4ZRMA 3K1TA