3Q9VA

Crystal structure of rra c-terminal domain(123-221) from deinococcus radiodurans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA-binding response regulator
publication title Crystal structure of rra c-terminal domain(123-221) from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q9vA00
2JZYA 1Z6TA 5L3GA 3O3KA 1FY7A 4AWXB 2TDXA 3M7GA 4F7ZA 1W7PB 1V3FA 3F22A 2XAGA 1FLIA 2YSRA 1BC8C 4G7HF 2PBIA 2BGCA 4CYDA 1GVJA 3WTSC 3GFLA 3VODA 3HRTA 1OYYA 2ETHA 3HTUA 1I1SA 3CDHA 2HYGD 4BHCA 1G4DA 5K1YA 2O6GE 2EFWA 2UZKA 1OYWA 1SMYF 2JPCA 1EH8A 3DKWA 3LQQA 3TO6A 1JGSA 4RGSA 4G9YA 2OQRA 3KP5A 3IWFA 4QLCU 4OMYA 1H9TA 3FF5A 3MFKA 3HOSA 3PQJA 2DQRA 3K0LA 2HQNA 4OIQF 2E1NA 2CW0F 4LMYA 4KT5C 3LFKA 5CVVA 2EK5A 1FNNA 2VBWA 2WTEA 4U7DA 4EGYA 4BNCA 5DCFA 2P5LC 1U6GA 2D1VA 3CUQC 3WGGA 1YIOA 5JFRA 3ZMDA 4KYWA 2WWYA 4R79A 2VT3A 2RDPA 1TW2A 2MH2A 2KIUA 4G6DA 1I27A 1S7AA 3CJNA 1GHCA 4LG0A 1W5TA 4CHUA 1IN4A 2GWRA 4RGRA 3P7NA 4EJWA 4IVNA 4AIJA 3O6BB 1AWCA 4IHTA 1GXPA 2R7FA 3WTWC 1R23A 5FD5A 2KKOA 2M87A 3HSEA 3BJ6A 2QBYA 5FLXK 5L3FA 1S6LA 4I0BA 2LDUA 2P6TA 1P92A 1IN5A 3GYHX 2FRHA 1TNSA 3KP6A 3J80K 4LG0B 3K2ZA 3BDDA 5D4RA 2RV8A 2OD5A 4MQVA 2ZKZA 1ZYRF 1WKMA 1XGOA 3SZPA 1USSA 2R7DA 3CO6C 3E5QA 1SFUA 2RQPA 1BOAA 2W85A 2RC4A 1O57A 2KJBA 1TLHB 1E2XA 2QBYB 2O03A 1D8JA 1Z7UA 3GLXA 4A0XA 5D5VB 3BJAA 2ZFWA 1I5ZA 3BY6A 4A0ZA 1T98A 4OU0A 4P55A 2XASA 3DV8A 2Y48A 5J8CA 1XCBA 3ULQB 3V8JA 4L18B 3R4KA 1ZRCA 3COAC 4UUVA 3HUGA 1B1BA 4CO8A 4YFKF 3IKTA 3E3VA 4ZYHA 1LJ9A 3IRQA 3SXYA 1G3SA 1YTYA 2V1XA 2HEOA 1FBSA 1TTYA 2RN7A 3QPTA 3FMQA 2ISZA 1STZA 2LF8A 1G3WA 2STWA 3REOA 2Q0OA 2H09A 3F21A 1HW2A 1O3SA 5K5OA 3E6MA 3FM3A 2OQGA 3LAPA 4M9XA 1MJBA 4YFNF 1V4RA 3TGNA 2PFBA 4G94A 3FMRA 1K7AA 2DPUA 3R60A 4KIFA 3OOPA 1R5GA 4KDPA 5FD6A 4L5IA 2M30A 1O7FA 3R61A 4CZZA 3QP6A 3MZHA 3EYIA 1XD7A 1U2WA 2EFOA 1CGPA 2YX4A 1IXCA 3KEQA 3LWFA 5L3EA 1K78A 2MBFA 4WX9A 2ZNZA 1FYLA 3I53A 2MLKA 1KYZA 4NQWA 3WTYC 4WXDA 2P6SA 2F5DA 3GX4X 2J5PA 6PAXA 2Z5UA 1ZG5A 1HW1A 5ILVA 2FNPA 2ADUA 4Q47A 3KP7A 4M9ZA 2DT5A 5JR3A 2QUFA 4ASNA 4P96A 3HHHA 1QPMA 2L01A 5E20A 1D3YA 2M8EA 4EJOA 4A2UA 1IXSB 3RYRA 3RDIA 3TDZC 3JTGA 3FWEA 1NHAA 2V79A 1XGMA 2ESNA 2FQ3A 4MQ9F 2HTJA 2A3SA 2K86A 3WTTC 1W4MA 1IRFA 3GF2A 1BIAA 3GVAA 3QAHA 4M9SA 2V9VA 3E5XA 1MJAA 2MD5A 2IPQX 3QP5A 3GW2A 2DTRA 2ZO4A 1MD0A 2UXNA 1O3TA 4R1HA 5ILUA 1KA8A 2W84A 3DP7A 5H20A 3ELKA 3CUOA 4ZYGA 3V8LA 3L2CA 2PN6A 4YFXF 1XB4A 2L3DA 3WGHA 1HKTA 4ESJA 1XSXA 3NEUA 4HX4A 4PDKA 3B73A 3ECHA 3CUQA 1FX7A 2IRFG 3M1EA 1KU7A 1BM9A 2M45A 5ERIA 2F5FA 1Q1HA 4Y13A 1O3RA 2VE9A 3E6BA 3J81Z 1R1TA 4RAYA 2ZBKA 3M9AA 2QWWA 3SFZA 5JVTA 2XROA 5KVRA 4I01A 5HS8A 3G3ZA 4QWQA 2EJRA 3F6VA 1UB9A 1J75A 2IA1A 2RNJA 1KU9A 4ZH4F 3CUQB 2QYOA 4CDGA 4HX8A 3KCCA 3U1DA 4EQQA 2P7CB 2VN2A 1Z9CA 3KETA 4P5OA 4JQFA 2YU3A 3RIRA 2EB7A 1F1ZA 3KP2A 4MTEA 2VOOA 4XBFA 1K6OA 2G7UA 4LD5A 4A6DA 2QQAA 4WF2A 5HLIA 1KU2A 1J2XA 1FYMA 4U7BA 3F8CA 3K1PA 1C0WA 3MAJA 3C7JA 3TDUC 4L9NA 4OOIA 3HTSB 4MEXF 3PQKA 3NQOA 2HWVA 2C6YA 4MEYF 2LSOA 4IXAA 3KLOA 4RB2C 1P2FA 3ZN0A 4EJTA 3ZMTA 2IA2A 1XSVA 1WWXA 3RPQA 1MJ9A 3HOTA 2E1CA 3WU0A 3F6OA 5F1RA 4HBLA 2HDCA 3IKVA 4U0VA 2BEOA 2V6CA 2FU4A 4LGWA 2DU9A 4KN7X 2Y75A 4ENMA 3K69A 2DO7A 2DK8A 3BOQA 1XSDA 4S05A 5LBQA 2G9WA 4A5MA 3JAMK 3FM5A 4LFUA 4Y15A 1DPRA 2PLYA 2GZWA 4L5JA 1TQIA 1J7KA 1U5TC 4FX4A 2K27A 4TV7A 1O3QA 4WXCA 3C1DA 2EWNA 2D1HA 5H6RA 1J0RA 2YR2A 1J5YA 2RVCA 2VE8A 2JPBA 4RS8A 5FLXZ 4WCGA 1P4AA 2OBPA 2RGVA 4FT8A 4B09A 2OZ6A 4LJZF 1KQ0A 3WTZA 5CLSA 4G8XA 3P9KA 5LGUA 4BH9A 1X3UA 2EA4A 3U9GA 3GFMA 4M74A 2XAQA 1JE8A 2HOEA 1QNTA 3RKYA 1T2KA 5HLGA 3BZ6A 1FSHA 3LA2A 4ENJA 3V8KA 1FWZA 3GZ5A 1YS6A 3ZPLA 1T0FA 4M72A 4N9HA 4H0EA 1WRJA 4KA4A 2V1DA 2P4WA 2ZJ2A 1G6NA 5DD8A 1HQCA 1SMTA 3DQVC 2X4HA 2PG4A 2CFXA 2GA1A 2YPRA 1IF1A 2ZMEA 2P5KA 5D6EA 1ZLKA 2PI0A 5LEKA 1XGNA 3GO5A 3U2RA 4AIKA 1R1UA 1F5TA 4A6EA 1KGSA 3KZZA 1TBXA 5A2QK 4O6JA 4ZYEA 2PMUA 1BN5A 1FPQA 2CG4A 1AOYA 1PP8F 5LHIA 4LLNA 1LEAA 3K1MA 3Q9SA 5ICFA 5CVRA 1YG2A 3HYIA 4ZYDA 1MGTA 4IPAA 2VONA 3FX3A 4YIIA 4RGXA 1LNWA 5TRDA 5DEQA 2MLGA 2ZMEB 3EQLF 3FXUA 4N9IA 4XSZF 1W5SA 4DNCA 5E1XA 3LAJA 2DK5A 3BROA 4HYEA 1I1GA 4BHPA 4ZZDA 1BC7C 3KEOA 4CGZA 2XAFA 4N0BA 2P5VA 5EEGA 1ZGJA 1RZ4A 2L4MA 4ESBA 2FSWA 2O61A 5CYVA 3KZYA 2HTSA 2XRNA 2GA2A 4IF4A 2NS0A 1K79A 4DQ2A 2A6HF 3ISPA 2L02A 3ZMSA 3K9TA 2DLLA 4K2EA 2O0YA 1U3EM 2FMLA 1KYWA 2BV6A 1S3JA 3ERED 3ZMUA 3JW4A 2M5WA 3TKYA 1QZZA 2XGXA 4OIPF 1IRGA 1R7JA 1F4KA 2L4AA 4KFCA 4UXNA 5FGMA 3EETA 4Q4ZF 2DFIA 5BMZA 4KMFA 4MTDA 4Q48A 4I09A 4LK1F 4KICA 2BE5F 5F6FA 3L09A 3ZMVA 4G7OF 3F8BA 5LGTA 3ZP5A 1O7LA 1Z6RA 3RPUA 4LB5A 3HRMA 1BI0A 2A5YB 2JRTA 5HDGA 3C18A 3TOBA 2FE3A 2JT1A 1Z91A 5CVUA 3KP3A 3F8MA 4OINF 3FXQA 4AVPA 4BHBA 3IC7A 4KMUX 3F8FA 3TO7A 1YS7A 3BJOA 2K4JA 4WWCA 4WK8F 4JK1X 4EJUA 2QLZA 1ZGAA 2PEXA 4MGRA 1XN7A 1U5TA 4I7HA 4GGGA 3G73A 2NNYA 2LF7A 3MWMA 5DYMA 2D45A 2OZUA 1B59A 1IN7A 1DPUA 5HLHA 4L0YB 1EV7A 5E8GA 1L3LA 2FBKA 1K78B 1RUOA 1IXRC 3ECOA 2O8XA 2UXXA 1T38A 4S04A 3D5LA 3I5UA 4GXOA 5FO5A 4KN4X 2EA2A 1KQ9A 2A68F 1JHHA 1P4XA 4ON0A 1U5TB 5J8FA 3JTHA 2R3SA 4HV5A 1A04A 1ZN2A 2A61A 1LB2A 3KE2A 1DP7P 1S8NA 2AXLA 3S2WA 3EUHA 4AIHA 2CSOA 4BQAA 3RYPA 3ZN1A 5HS7A 4CXFA 1S7OA 4RB0A 2IVMA 4HX7A 3T0YA 1HSTA 4HLXA 3BPVA 3J7AO 4Y17A 1Z05A 3RKXA 3JSPA 4EGZA 5J6XA 3BPXA 3L7WA 2EFQA 5IT9Z 1FSEA 3F8NA 4B8XA 3L9FA 3VEPA 1R58A 1H0MA 3T1BA 1YW7A 4IHSA 3R0AA 2ZNYA 5H6QA 1SD7A 1PDNC 1R00A 3WU1B 4M71A 5F64A 3WTXC 3AAFA 3HIFA 1FYKA 5FB2A 4LB6B 1IZ1A 4OMZA 3QOPA 4WXHA 3WE2A 3RTRA 4O3MA 2NNNA 4ETSA 1YFHA 4LK0F 2RKHA 5HDNA 4P9UA 3JAMZ 4XRFA 3GFIA 1RUNA 1ZHFA 3QU3A 5LHHA 1ZRFA 5ILSA 1LQ1A 3LSTA 5DUIA 1R5HA 1J9IA 3HSRA 3TQNA 1QO0D 2Z33A 1I6XA 2NAZA 4R8HA 3I71A 4A5NA 5AONA 4LLLA 2XKOA 4EV0A 3SQNA 3I59A 4RB3C 3H3UA 3HHGA 2XV4S 4RGUA 3E5UA 1T39A 1SFXA 1REPC 2VBYA 1IN8A 5KK1A 4HW0A 3BWGA 3GWZA 3WGIA 4PGGA 3VB2A 1EH7A 2GQQA 4G7ZF 5JI6A 2A6EF 2W57A 3LA7A 1D5VA 3TO9A 2K02A 1D8KA 1P4WA 1BIBA 4U0YA 3M8FA 4XSXF 3IWZA 3I59B 2FOKA 4D0PA 2HGCA 1DDNA 1OMIA 2F5CA 3D0SA 1PP7U 1KU3A 2Z9OA 1L0OC 1B6AA 2FNAA 3P9CA 4HLYA 3J81K 4PZJA 4KIBA 1ON2A 3ML6A 3I58A 4PCQA 5BPDA 5JHUA 1J59A 1BI1A 1BBYA 2ISYA 2NYXA 2A69F 5E8IA 3HRUA 2KJCA 4L9TA 1UFMA 4A0YA 4I0AA 1B9MA 2HKOA 2QQ9A 3WODF 1T6SA 5A2QZ 3K1NA 1WI9A 5D4SA 2B0LA 2XVCA 3QPHA 2VC0A 2JTVA 1U78A 1FT9A 4I98B 4U88A 5ICEA 1WSUA 4UHTA 3GXOA 3Q9VA 1YYVA 2DQLA 2OAZA 5LHGA 2IA0A 4GO1A 1IW7F 1XCVA 2VC1A 3I4PA 2KIMA 4Z2YA 3PFIA 2IW5A 3I54A 1FOKA 2QM3A 3J80Z 2PJPA 2QENA 4ENKA 4XLPF 2GXGA 4L9VA 1ZREA 2HZTA 5BPIA 3GZ6A 1XMAA 2ELHA 3R6SA 2P7VB 1YLFA 3LQRA 1E17A 1IAWA 3QU6A 3SZTA 4HZFA 4HF2A 4OIRF 2VT2A 3O2PE 5AIPA 1SD6A 3WE3A 4GCVA 2H6CA 3DPTA 1LDKB 3ABUA 5ICCA 4HF0A 2CWEA 2E7WA 4JBAA 4BAYA 4L9JA 2DBBA 4M6XA 2K4BA 1DUXC 2HKXA 3GEZA 3V7CA 1XMKA 3DXJF 1YQAA 2XIGA 1SAXA 1HKSA 1FBQA 2VOPA 1F9NA 5D5XB 2X0LA 1YW8A 2EV5A 2XKPA 3FMSA 4AD9A 3F23A 1ZRDA 2F5EA 1OR7A 2LKPA 2L54A 1SD5A 2PQ8A 2Z99A 1VTNC 4RAZA 5D5WB 3CO7C 4I2OA 2V1UA 2ACJA 1BI2A 1HW5A 2DAOA 1ZH5A 1BI3A 2F2EA 2Z3YA 2COMA 1IUYA 2ESHA 2MH9A 4PGHA 5CVIA 1HXDA 3LA3A 1ON1A 3GFJA 5AIQA 1QGPA 1ZARA 1S29A 2Y0MA 3I64A 4YG2F 2CGPA 3DPLC 2JSCA 3CTAA 1LEBA 4IJAA 3GUDA 2FF4A 5L3CA 4ZZLA 4FHTA 4UV8A 3E97A 1TW3A 3CLOA 2MA3A 3N4MA 4U0WA 2OU2A 4HDUA 4EJVA 5LLQA 2EFPA 2FEZA 3MZYA 1LDDA 4FX0A 2ZCWA 1H9GA 4HQMA 4NB5A 5D5UB 2AS5F 1ZG3A 3W6KB 3V4GA 4HOBA 2FBIA 4I02A 1LDJA 1TNTA 3WTVC 1OYIA 2H94A 2FA5A 3V7SA 2DI3A 1TQMA 2XAHA 2XHKA 2H27A 2QZ8A 3HSFA 2HFHA 2NRAC 1OPCA 1CF7A 1XDSA 3H3ZA 1ZAOA 3R0JA 3OV8A 3Q5FA 3H92A 1WQ2A 1R1VA 4CICA 3RI4A 2GAUA 4IRHA 5CVJA 2Q2EA 5DCMA 2M1BA 4GYGA 5E1ZB 1TQPA 4XLNF 3VOEA 2QVOA 1B9NA 1IN6A 3WTUC 4OIOF 2YX7A 4EMSA 3JSOA 4O5VA 2H6BA 3WG9A 1FP1D 1CF7B 5K5RA 1YO5C 3F3XA 4UV9A 3QRFF 4KNYA 5LEJA 2FBHA 4HA8A 2XAJA 2J5OA 4NHJA 1QZYA 1ZLJA 5DCMB 2HYFA 3T8RA 1HSJA 5DV5A 1G3YA 5CJ9A 2G7HA 2KRFA 1HKQA 4EM0B 5DDGA 3ZQ7A 2VBZA 5ED4A 4A12A 1PUEE 1SFEA 4KUMA 2MC3A 5TJJA 3ABTA 5D8LB 1ZG1A 3SHFA 5BOXA 4GYIA 2O3FA 1R22A 1XDUA 5D6FA 4HV6A 5LRRA 3RJPA 1FC3A 2XUBA 2GXBA 3C3WA 3BP8A 3W6JB 2W24A 5L3DA 3E6CC 1P6RA 1Y0UA 3MEXA 5IT3A 4KIGA 3M8EA 4LLGF 2P8TA 3KP4A 3EDPA 1Z1DA 2IT0A 3NRVA 4UVBA 1U8RA 1YW9A 1EH6A 2ZXJA 5L3BA 4L0ZB 2PMHA 1FP2A 1GXQA 2KIFA 2EV0A 4MHGA 2W25A 5EEHA 3F72A 1MDMA 2UWMA 1FBUA 3FXRA 1ODDA 1OKRA 1LVAA 3IRRA 3P9IA 4UVCA 2E7XA 3I0TA 4IRIA 5LGNA 3IL2A 3MCZA 5E17F 5LRSA 1QQIA 4BYYA 4YIFA 1SD4A 3FHZA 1HBXG 5FFXA 3DFGA 4G6QA 4EM2A 1MDMB 3KFWX 4P9FA 2EV6A 5HVQC 3TOAA 4MNUA 2CQKA 3ZMZA 4M73A 4Q5SF 2OA4A 2DPDA 4BXUA 2GIVA 2DW4A 1UCRA 3DEUA 5E1WA 3IHUA 3L00A 2BBYA 4IRGA 5HS9A 1R36A 3T5XA 4HAMA 3VFZA 4EM1A 2QQBA 2Q8KA 4RB1A 4E70A 1USTA 4HDVA 5DUKA 1UHWA 4HF1A 1B4AA 4UNOA 4M6YA 3KLNA 1UHMA 1W7PD 4ESFA 5K5QA 4ENNA 2CO5A 5IT9K 2WC2A 3B02A 1RNLA 4UVAA 2STTA 2LNBA 1BJAA 2VODA 3FZVA 3DF8A 2IP2A 2VXZA 3EYYA 1JXSA 2CYYA 2WV0A 2IJLA 3RKWA 5HDKA 3MQ0A 4HQEA 2FXAA 5DD4A 5HOOA 2HR3A 2BYVE 4EVIA 3N97A 1ULYA 1W7PA 3ROUA 1QBJA 2HQRA 1MZBA 1RI7A 5BS6A 1JHFA 3HRSA 3V7RA 5BQTA 1G3TA 2HS5A 1ONVA 1FZPB 2D2WA 5FFZA 2EFNA 3E6DA 1KQ8A 2FMYA 1RIOH 5E18F 1XGSA 1MKMA 5D8KB 2K7LA 5ICGA 2A07F 3T8TA 2VBXA
chains in the Genus database with same CATH superfamily
2JZYA 1HA8A 4OAYA 1Z6TA 5KNLA 2K3FA 5L3GA 3O3KA 1FY7A 4AWXB 4MFEA 4XR6A 2TDXA 3M7GA 4F7ZA 3PIOF 5GAGJ 1W7PB 1V3FA 3F22A 2XAGA 1FLIA 2NOGA 1MH3A 2IGKA 1P7IA 2YSRA 2JWTA 3CCRI 1BC8C 1MNDA 4G7HF 3ZQGA 1EJ9A 2PBIA 2BGCA 4XN3A 2DA5A 1MBGA 1R9TJ 3CP2A 4CYDA 2VQLA 1GVJA 3WTSC 2YS9A 2VJ4A 3GFLA 2ZSHB 3VODA 3TP0A 5J1YA 3HRTA 1OYYA 1S5LC 4UY8I 2ETHA 2BXYA 2VJ5A 3HTUA 1I1SA 3JR9A 3CDHA 3Q0WA 3LSPA 3LL7A 1Z21A 2LR8A 4CCNA 3OYGA 2HYGD 4BHCA 1BR4A 3ZQIA 3A01A 1G4DA 2E2JJ 5K1YA 2O6GE 2W4SA 2EFWA 2VKHA 1JI8A 4DW6A 1A6QA 2UZKA 3S1QJ 1OYWA 1YHQI 1SMYF 2JPCA 3FXKA 1X1CA 3SEQA 1EH8A 3DKWA 3LQQA 3TO6A 3CC2I 1JGSA 2EINH 4RGSA 5E3MA 4G9YA 3J7ZI 2OQRA 2Y30A 1D1AA 4DYRA 3VWBA 4F93B 3KP5A 3S14J 3IWFA 4QLCU 4CSWA 4OMYA 1H9TA 3FF5A 3MFKA 5B66C 3HOSA 3G1OA 3PQJA 4ANJA 2E36A 2DQRA 3K0LA 2HQNA 2HOTA 4BBSJ 3AFHA 4BY1J 1QPIA 2E1NA 4C2MJ 4UB8C 2VQCA 4OIQF 2CW0F 4V2GA 4LMYA 1XS9A 3S3NA 4X0GA 4KT5C 2MW8A 3LFKA 5CVVA 3HOZJ 2EK5A 1JT6A 4A3DJ 3A01B 3M3YJ 1DP3A 1FNNA 2VBWA 2LG4A 2AQFA 2CJJA 2CW7A 2M2EA 2LLKA 2WTEA 4U7DA 3OYEA 4EGYA 4BNCA 1W5CC 5DCFA 2P5LC 1U6GA 3CQZJ 2D1VA 3CUQC 3WGGA 1YIOA 1U0JA 1B72A 2L7KA 1SC7A 1ZQ3P 1Z7LA 5JFRA 4PJNA 4C30A 3ZMDA 4KYWA 2DJNA 2JVGA 4R79A 2WWYA 3OSGA 1W36C 2XPUA 2VT3A 2RDPA 5JLWA 1JJ8C 1TW2A 2MH2A 2KIUA 4G6DA 2R5ZA 3HDDA 1M1EB 1I27A 1S7AA 3CJNA 1GHCA 2DJIA 4LG0A 5J1UA 1MNMC 1W5TA 4CHUA 2K9SA 1E3PA 1IN4A 2GWRA 4RGRA 4E7JA 2VKEA 3P7NA 4EJWA 1ETQA 2ZXIA 2M4GA 1VQ8I 4IEJA 4IVNA 4AIJA 3O6BB 1AWCA 2TCTA 4IHTA 1GXPA 1D0XA 2R7FA 3WTWC 1R23A 1JJ6C 5FKKA 5FD5A 2KKOA 2LKSA 2M87A 3G1MA 2IXSA 3HSEA 3BJ6A 2QBYA 1YX5A 3GTOJ 5FLXK 2PMZA 4QTRA 5L3FA 2HDDA 2KDZA 2QKMB 1S6LA 3CF5F 4I0BA 3ZQHA 1B72B 2LDUA 2P6TA 2JMWA 3CP8A 1P92A 1IN5A 2L2OA 3DKXA 3MZ8A 3GYHX 3KIOA 2VQHA 2FRHA 1TNSA 3KP6A 2R5ZB 3J80K 2KHMA 4LG0B 3K2ZA 3BDDA 5D4RA 2RV8A 2OD5A 1GUUA 3AL0C 2WA0A 1ETVA 4MQVA 2ZKZA 1ZYRF 1QHGA 1ZELA 1WKMA 1RR7A 1XGOA 3SZPA 2NVYJ 3DEWA 1NH3A 1USSA 1T95A 3KYCB 2R7DA 2BVLA 2VJIA 2QQ8A 3RSNA 3CO6C 3E5QA 1SFUA 2EQRA 4XMYA 2RQPA 1BOAA 2W85A 2RC4A 3PUBA 2ID3A 2X6XA 3GLLA 5GAEJ 1O57A 3HGGA 3IP4B 2KJBA 1TLHB 1POGA 1E2XA 2UUZA 4F3QA 2O03A 2QBYB 1D8JA 1Z7UA 3GLXA 4A0XA 5D5VB 4Y4RA 2IGMA 3BJAA 2ZFWA 1I5ZA 1Y6IA 3OYBA 3BY6A 4A0ZA 1T98A 2X6WA 1YITI 4OU0A 4P55A 1SVLA 3PJRA 2XASA 3DV8A 2Y48A 1ETOA 5J8CA 1XCBA 4BDZA 3TBIA 5B1BH 1HDDC 3ULQB 3V8JA 4FCYA 4L18B 2ICWG 3R4KA 1ZRCA 3COAC 4UUVA 3HUGA 2ECBA 1B1BA 4CO8A 4YFKF 3IKTA 5EZHA 3E3VA 2WY8Q 3K2AA 2RREA 5EGOA 4ZYHA 4BL0B 1LJ9A 1SANA 2OC6A 3IRQA 3SXYA 1VQ7I 3SEZA 1G3SA 1OCCH 4A3EJ 1YTYA 2X6YA 3DU5A 3FXJA 3SFIA 3O8HA 2V1XA 2HEOA 1FBSA 1P7JA 1TTYA 2RN7A 3QPTA 3FMQA 3LSKA 2ISZA 1STZA 1N78A 2LF8A 1G3WA 2F4MB 4B48A 5E79C 2R7QA 5FROA 2STWA 3BTJA 2VUMJ 3REOA 4LITA 2Q0OA 3NARA 5B1AH 2H09A 3F21A 2R92J 1HW2A 1O3SA 5K5OA 1IDZA 3E6MA 3FM3A 2OQGA 3LAPA 1RRJA 4M9XA 2M3AA 3S16J 2VASA 1MJBA 3H0DA 4YFNF 1V4RA 3TGNA 2PFBA 3H9GA 1DGWY 2KMUA 3DBRB 1EF4A 4G94A 2V9KA 3FMRA 1K7AA 5DS9A 3HUGB 2DPUA 2X48A 2VKVA 3Q3SA 3CLQA 1K4SA 2HXOA 3R60A 4KIFA 2WAQA 3OOPA 3A2KA 1WJFA 5EGOB 1W36D 2JA8J 3OYIA 1R5GA 4KDPA 1ETXA 4IHXA 5FD6A 3HPGA 4L5IA 2IS2A 1BOBA 3H9QA 3CJQB 2M30A 1G59A 1O7FA 3R61A 2HVRA 3CJTB 4CZZA 2K5CA 2CUZA 3DBLB 3JCUC 2OV7A 3QP6A 4CCJA 2CV0A 3MZHA 3EYIA 1XD7A 1U2WA 4XKBA 2EFOA 1CGPA 2YX4A 1IXCA 3KEQA 3LWFA 5L3EA 1K78A 1TWGJ 2MBFA 2ELKA 1MBHA 2EZKA 4WX9A 2ZNZA 5KAFC 1MNEA 1FYLA 2Y0SN 4NC6A 1XX5A 3WHCA 3I53A 2MLKA 1KYZA 4NQWA 3WTYC 4WXDA 4E7KA 2P6SA 2F5DA 3GX4X 2J5PA 1FJLA 6PAXA 2Z5UA 5F1JA 1H88C 1ZG5A 1HW1A 5ILVA 2GLOA 3BTLA 2FNPA 2ADUA 5CQGA 5F0HA 3QYBA 1IO2A 1K61A 4Q47A 2Q1ZB 4B1RA 1ITYA 3S2DJ 2OPTA 4XOPA 3QQAA 2EILH 3KP7A 1TWHJ 3S15J 2XPVA 4M9ZA 2K85A 2DT5A 5JR3A 2QUFA 4ASNA 4IHWA 4P96A 2IGOA 3HHHA 1QPMA 3M4OJ 1A6IA 2L01A 3G4SI 5E20A 1MBEA 1D3YA 2M8EA 4EJOA 4BQQA 2QSFX 3CCLI 4A2UA 1XMXA 3I56I 2KFDA 1IXSB 3RYRA 4AYBN 1GV2A 1Q1VA 3RDIA 3TDZC 3MVPA 3FWEA 3JTGA 1NHAA 2V79A 1XGMA 5C4JJ 2AXTC 4DBQA 5C3EJ 2R0QC 2DT6A 2ESNA 4NQWB 2E19A 2FQ3A 1T0FC 4MQ9F 2HTJA 3HM5A 2R7TA 4FETA 2DTZA 2A3SA 2K86A 3WTTC 4YELA 4QPQA 1W4MA 3FBIB 2NVTJ 2W7NA 1IRFA 2LH9A 1XTAA 3GF2A 1BIAA 3GVAA 3CCUI 3QAHA 2W00A 2K9MA 4M9SA 1HF0A 2ZMEC 1TC3C 4Y33A 3PO3J 2V9VA 3E5XA 3CCQI 1MJAA 1IJWC 2MD5A 2IPQX 3QP5A 3GW2A 1LPQA 4W97A 5F0FA 2P81A 5IYDJ 2DTRA 2ZO4A 1MD0A 1D1BA 2DA3A 2UXNA 4R1HA 1O3TA 3PNTA 1MMAA 1HCRA 1QU3A 5ILUA 1KA8A 2W84A 4II2A 4H4KC 3S3MA 3DP7A 5H20A 3ELKA 3VPRA 1TT5B 2R7UA 5FJ8J 3CUOA 4ZYGA 3V8LA 3L2CA 4BE1A 1R5ID 2PN6A 4YFXF 3BCBA 4F91B 2K3PA 4I99C 1XB4A 2L3DA 3WGHA 4PFOA 3FK6A 1HKTA 4ESJA 2K9LA 1XSXA 3NEUA 4HX4A 4PDKA 2IS4A 3B73A 3ECHA 2LMDA 3CUQA 4XRMA 1FX7A 1YE9A 4KJZA 2IRFG 3BR5A 3M1EA 1KU7A 3TP3A 1BM9A 2DN0A 2M45A 3CMEI 5ERIA 1OR7C 2F5FA 1Q1HA 2BZTA 4Y13A 2K40A 1O3RA 2VE9A 3E6BA 3J81Z 1R1TA 4RAYA 1U8BA 2ZBKA 2DFEA 3M9AA 2KQRA 2LVSA 2QWWA 3SFZA 5JVTA 3HG9A 2XROA 4YRVA 5KVRA 4I01A 2LFBA 2DT7B 4KISA 2XRLA 5HS8A 2N8GA 5KCMA 1R49A 1Y1WJ 3H5RA 1E0EA 1X58A 3G3ZA 4QWQA 3FXLA 5TISC 5BNGA 3S8PA 4IO9F 3CC7I 3A0HC 2EJRA 3F6VA 4BQNA 2X1DA 1UB9A 1J75A 1QHHD 2MGQA 5DTDA 2BY2A 2IA1A 2RNJA 2HU9A 2X6OA 2NS8A 1ACIA 5HNFA 1KU9A 1FOYA 2JJ7A 2M7BA 2V6EA 3NWTA 3S1RJ 4XORA 3CUQB 4ZH4F 2QYOA 4CDGA 1N25A 3H3VK 4HX8A 5M5YJ 3KCCA 3U1DA 4EQQA 3MKZA 2P7CB 2CRGA 2VN2A 3BG7A 4DYQA 5IOZA 1Z9CA 3KETA 4P5OA 4DGWB 2GIZA 4CCOA 4JQFA 2YU3A 4M3FA 3RIRA 1UJ8A 2EB7A 4IKFA 1RESA 2M7AA 3OSFA 1HC8A 4M3DA 1F1ZA 3KP2A 4Y7NJ 4MTEA 1FIPA 2KIQA 3FBNB 2VOOA 4XBFA 1LKXA 3E7LA 1K6OA 2G7UA 4LD5A 4A6DA 4GFBA 2M0CA 2QQAA 1DU0A 4WF2A 3DEEA 5HLIA 1KU2A 1J2XA 2LBFA 1LFUP 4A3FJ 1FYMA 1RKTA 4RM2A 4U7BA 3F8CA 5FKNA 3K1PA 1C0WA 3MAJA 3H0GJ 3H5AA 3C7JA 3TDUC 3OYHA 4HSTA 2R7OA 1UG2A 3OYAA 4L9NA 2QCOA 4OOIA 2OUMA 1WPKA 3HTSB 1O4XA 4MEXF 2EBIA 3PQKA 2H8WA 1X3WB 3NQOA 3FDYA 3ABKH 2HWVA 2C6YA 4MEYF 2LSOA 4IXAA 3OYMA 3KLOA 4XKWA 1P2FA 3ZN0A 4RB2C 4EJTA 1VQNI 3ZMTA 2IA2A 1XSVA 5EYRA 1WWXA 3RPQA 4IX7A 3SYTA 3M8JA 1MJ9A 1XC5A 3HOTA 5J47A 5EG0A 3IV5A 1WJBA 3UKGA 3WU0A 2E1CA 2DA7A 3F6OA 1IG7A 2H8RA 5F1RA 1WJDA 4HBLA 1APLC 2HDCA 4BGDA 3IKVA 4U0VA 4B47A 2BEOA 2V6CA 2FU4A 4LGWA 2ZC2A 2DU9A 2L9VA 3BG5A 4U87A 4BE2A 1BW6A 3P5JA 4KN7X 2Y75A 4ENMA 2A6TA 2DO7A 3K69A 2DK8A 3BOQA 2EH3A 1XSDA 4S05A 2DYSH 2Y9YA 5CKTA 4LG3A 5GADJ 5LBQA 3OL3A 1A36A 1LFBA 2G9WA 4A5MA 3JAMK 3FM5A 2DMTA 4LFUA 4P1WA 4DOZA 3BTIA 4Y15A 1DPRA 5EJCA 2VJJA 2PLYA 4M3EA 2E1MC 2GZWA 4L5JA 1TQIA 1K6YA 4QIWN 4IHYA 2YUSA 1J7KA 5EG0B 1U5TC 2JA2A 4FX4A 1QVTA 2K27A 3HOXJ 3S1MJ 1OCZH 4Z6YA 2E71A 4NNJA 5C4XJ 4TV7A 3BR3A 2CFOA 1O3QA 1JUPA 2FX0A 3GZNB 4WXCA 3U1KA 2BOLA 3C1DA 2EWNA 4B3XA 2D1HA 5H6RA 1J0RA 2WY7Q 2YR2A 2L9NA 3NWSA 1J5YA 2UV1A 2RVCA 4PFPA 5J1RA 3KPHA 3G71I 2VE8A 2JPBA 5F08A 4RS8A 3IH2A 1OFCX 3RQ4A 5FLXZ 3ASOH 4CCKA 4WCGA 2GBYA 1FMVA 4JYKA 2CQNA 2L7FP 3Q0UA 1P4AA 2ZJPF 2OBPA 2RGVA 3HC7A 1B8IA 4FT8A 3FK7A 3AG2H 2OZ6A 4B09A 4LJZF 1KQ0A 4XICA 1W0UA 1VQ4I 3WTZA 5CLSA 4G8XA 3P9KA 4W1UA 5F27A 2DA2A 4BUPA 5LGUA 4BH9A 3CMYA 5TGTA 1X3UA 2EA4A 3U9GA 3ABMH 3GFMA 4M74A 1ENHA 2XAQA 3ZQCA 3DPUA 2ECCA 5B5EC 1JE8A 2HOEA 1QNTA 4XIDA 3RKYA 1X1PA 5GTIC 1T2KA 3EUHC 5HLGA 2Z2SB 3MD2A 3BZ6A 2QGUA 1FSHA 3LA2A 4E7SA 2NVQJ 4E4HA 2KPMA 3BR0A 4ENJA 3C2GA 3V8KA 1FWZA 3GZ5A 5H2FC 1YS6A 3ZPLA 2XF5A 5GP9A 1T0FA 4M72A 4N9HA 4H0EA 1BW5A 1WRJA 4KA4A 1TL8A 2V1DA 2P4WA 1JKOC 2ZJ2A 1G6NA 2HVQA 5DD8A 1HQCA 5EZGA 3ZRGA 4F92B 1SMTA 2K9QA 1RETA 4E7LA 3DQVC 4CCLA 4C3JJ 2E60A 2X4HA 3PL8A 2JUGA 2PG4A 2CFXA 2GA1A 4LOCA 1B8IB 2YPRA 1VFCA 2XB0X 2CUEA 3BZKA 2R7ZJ 1IF1A 1RR8C 2ZMEA 2NXNB 5IYBJ 3EPZA 2P5KA 1ZKGA 2R93J 3I4MJ 5D6EA 4II3A 1TWFJ 2NS7A 1ZLKA 2PI0A 5LEKA 2R5YA 1XGNA 4C2TA 3K4NA 3GO5A 3U2RA 4AIKA 1R1UA 1JKRC 1JTYA 1YJWI 5IP9J 1F5TA 4A6EA 2JRMA 1MW7A 1KGSA 3KZZA 1OCTC 1TBXA 3SDBA 4O6JA 4ZYEA 5A2QK 3OMYA 2E2HJ 2PMUA 1V55H 2Z16A 4C3IJ 1MH4A 1K83J 1BN5A 1FPQA 2CG4A 1AOYA 5K7ZA 1PP8F 2DXIA 5LHIA 2VQGA 4LLNA 4D5FA 1LEAA 3K1MA 3Q9SA 5ICFA 4IOCF 2DMPA 4PJLA 1FMWA 5CVRA 1YG2A 3HYIA 4ZYDA 4J01A 1MGTA 2DMNA 4IPAA 2VONA 3FX3A 2ZXWH 4YIIA 4RGXA 1LNWA 3E1SA 5TRDA 3VYSB 5DEQA 4E7HA 2MLGA 2ZMEB 1NG7A 3EQLF 3M07A 5EF6A 3FXUA 4N9IA 1OCPA 3FIWA 2JA7J 4XSZF 2PMZN 1W5SA 2LY9A 4DNCA 2OTLI 1N75A 4FISA 2F4IA 2Z1DA 5E1XA 1Z67A 1WJAA 2R5YB 3LAJA 2DK5A 5IPAA 3BROA 3S1NJ 3Q0VA 1I1GA 4HYEA 4BHPA 3KZIC 4ZZDA 1BC7C 2FOWA 1T8IA 2QA4I 1VQOI 2KZVA 3KEOA 1VQ6I 4A3GJ 4A3CJ 1K4TA 1SVMA 2O8KA 4CGZA 2XAFA 3RQIA 4N0BA 2P5VA 3JRGA 4NDLA 1Z3YA 2EIMH 2LYCA 5EEGA 1ZGJA 3ERMA 3I3LA 1RZ4A 1UG0A 2L4MA 4B4CA 1IRZA 4ESBA 3W2WA 3QODA 2IGNA 3PO2J 2FSWA 3NAUA 1R4MB 2O61A 5CYVA 2COBA 1AKHA 3KZYA 4N4OB 2HTSA 2XRNA 4EEFG 3JRCA 2GA2A 2V4JC 4RBOA 4IF4A 4A3MJ 4E7IA 3PFYA 3K70C 2NS0A 2VPRA 1K79A 5GAHJ 2A5WA 4DQ2A 4BXFA 3OYNA 2A6HF 3ISPA 2L02A 2X1EA 3ZMSA 4RA2A 3K9TA 5JVGF 2DLLA 4K2EA 2O0YA 1U3EM 1VQ9I 4BJ5C 4RMNA 2JVHA 3JRAA 2FMLA 2VI6A 1KYWA 3RPUD 2BV6A 3BT9A 3K6GA 4FASD 1S3JA 2CQQA 3ERED 3ZMUA 1WZ2A 3OYCA 2M0MA 3JW4A 2M5WA 1UHSA 1Z0XA 4ZDOA 2GOXB 1SEUA 3TKYA 1QZZA 5F04A 2XGXA 4OIPF 1IRGA 5JLXA 3OS2A 1DGRM 1R7JA 2FJ1A 2DOEA 1AKHB 1F4KA 2OCEA 1FIAA 3FHNA 2L4AA 4KFCA 3PM1A 4UXNA 5FGMA 4IHVA 1Y0NA 3EETA 4Q4ZF 1UMQA 2DFIA 5BMZA 5IOYA 4KMFA 3QPLA 4MTDA 2R7XA 4BDYA 4Q48A 2IEKA 3X2QH 1EKEA 4I09A 4LK1F 2ZJRF 4KICA 2BE5F 5F6FA 3L09A 4A3JJ 1OCRH 3OS1A 4LIUA 3ZMVA 4G7OF 3F8BA 5LGTA 2ZXHA 3ZP5A 1O7LA 5KAIC 4AC0A 1Z6RA 3RPUA 2WAQN 4LB5A 4X1EA 4AIDA 1ZK8A 3BG6A 1VF9A 4BE0A 3HRMA 4IZZA 1BI0A 2A5YB 3MKYB 5FLVA 2JRTA 3MMYB 5HDGA 3JRIA 4A3KJ 1IC8A 3C18A 3TOBA 3ZGKA 2FE3A 2PJRA 3OYDA 3K4CA 3UNGC 2JT1A 1Z91A 5CVUA 3KP3A 3F8MA 2CW8A 4ZYAA 4OINF 4S0HB 3FXQA 1R4NB 4AVPA 3G2BA 4BHBA 1ZGWA 1F36A 3IC7A 1SFKA 1X1DA 4KMUX 3F8FA 4QPOA 3CCSI 4HRIA 3TO7A 1YS7A 3BJOA 3RCOA 2K4JA 4AUXA 4WWCA 4WK8F 4JK1X 3ZQFA 1GV5A 2QLZA 4EJUA 1ZGAA 2PEXA 4MGRA 1UELB 1XN7A 2Y0SA 1JGGA 1U5TA 4I7HA 4GGGA 3G73A 2PX9A 1PUFA 1JKPC 2OF7A 5GTHC 2CUFA 2NNYA 4ZDPA 1CQTA 2ME6A 4PSXA 2LF7A 3MWMA 3QWLA 3D1NI 1E3OC 5DYMA 1Z77A 5HNHA 5KHDA 2D45A 2OZUA 3BC8A 1B59A 3LSRA 1IN7A 1DPUA 5HLHA 4L0YB 1EV7A 5E8GA 2L9RA 1MSFC 1L3LA 5FRNA 3H9JA 2FBKA 1K78B 1RUOA 1IXRC 3ECOA 2O8XA 1WJEA 3OIOA 2UXXA 3ONQA 1T38A 2MG4A 2H1KA 2QF7A 5CPRB 4S04A 3D5LA 2HPIA 3I5UA 4GXOA 4BKXA 1I3AA 1X2MA 2IBDA 3OYFA 4DIQA 2E1MB 3I55I 5FO5A 4KN4X 2EZLA 5IP6A 2EA2A 4AYBA 1KQ9A 2A68F 3N05A 2VB6A 1JHHA 1P4XA 4ON0A 4RLQA 1U5TB 4BJTA 5J8FA 5LFAA 4D9JA 3KEYA 3JTHA 2R3SA 1PUFB 4XNFA 4HV5A 4BACA 1A04A 1ZN2A 2A61A 2XPWA 2M34A 3KE2A 2VL8A 5M3FJ 1LB2A 4E6KG 3H5NA 4XLAA 1DP7P 1TWCJ 3VSLA 3WU2C 1S8NA 2AXLA 2OTJI 5CQEA 3S2WA 1BL0A 9ANTA 2NVXJ 3EUHA 4AIHA 2CSOA 2HXIA 3RYPA 4BQAA 3ZN1A 5HS7A 1R6RA 4CXFA 1LVKA 1S7OA 4RB0A 2IVMA 4HX7A 3I4NJ 1UZCA 3T0YA 1HSTA 4HLXA 4D7NA 3BPVA 5F0CA 3J7AO 4A3LJ 3S3OA 3JREA 4Y17A 3GTKJ 1Z05A 3RKXA 3JSPA 3L1PA 4EGZA 5J6XA 3BPXA 3L7WA 2EFQA 4XL9A 5IT9Z 1FSEA 3F8NA 4B8XA 4F52A 1S72I 1X1AA 3L9FA 3VEPA 1R58A 2VIXA 1H0MA 3FXMA 1NG6A 5EEAA 4AM3A 3T1BA 3B6AA 1YW7A 4I6ZA 3TW7A 5DM7F 2LY2A 2EPFA 2DFHA 3R0AA 4IHSA 5IP7J 2ZNYA 5H6QA 1SD7A 3DTEA 1PDNC 2DODA 1R00A 4ABZA 2JSPA 1WFXA 2V26A 3WU1B 5E3LA 1S9HA 4M71A 2HOSA 4UB6C 5F64A 3WTXC 3AAFA 3HIFA 1FYKA 5EDNA 3B6CA 3W3CA 1OISA 5FB2A 4LB6B 2L7ZA 1IZ1A 4XK4A 4OMZA 3QOPA 2ELJA 1WGXA 1BR2A 2LP0A 4WXHA 3WE2A 3LMMA 3RTRA 4KITB 1VQKI 4O3MA 3A03A 3AG4H 1T56A 2NNNA 4ETSA 1YFHA 4LK0F 2XB5A 1D0ZA 2RKHA 5HDNA 1D5YA 4HNTA 4P9UA 3JRBA 2A05A 3JAMZ 4XRFA 3GFIA 1RUNA 1ZHFA 2L0KA 2AHQA 3QU3A 2L7MP 3K70D 5LHHA 1ZRFA 5ILSA 2JA6J 1LQ1A 2RNGA 3LSTA 5DUIA 1R5HA 4CYCA 1J9IA 2XGDA 3HSRA 1MMSA 2P0WA 2OJED 3JRDA 3OYKA 4XQFA 3L2UA 3TQNA 2GOMA 1QO0D 2Z33A 1I6XA 2NAZA 2WAFA 4R8HA 3I71A 4A5NA 3JRFA 5AONA 4LLLA 3GTLJ 1YOVB 1X19A 2XKOA 3GMEA 4EV0A 2XC7A 2OCCH 4NC7A 3I59A 3SQNA 4RB3C 1Y39A 3H3UA 1V5GA 4XLEA 3HHGA 2XV4S 4ZTJA 2DFFA 4RGUA 1AA7A 3DLAA 5IY5H 3E5UA 3HBLA 1JUMA 4PK4A 3BCAA 1T39A 3ZCOA 1SFXA 2X85A 1REPC 3OIPA 4F55A 4XLHA 2VBYA 1IN8A 5KK1A 3PUFA 4HW0A 3I9V2 1D0YA 3BWGA 4BXXJ 3GWZA 3WGIA 4PGGA 3CDIA 3VB2A 2WAEA 1EH7A 1WH5A 2GQQA 5JI6A 4G7ZF 2R7SA 2A6EF 2W57A 3LA7A 1D5VA 3TO9A 4NC8A 2K02A 1D8KA 2Y31A 1P4WA 3BQZA 3AL0B 1BIBA 1RKWA 1GLNA 1WJCA 4U0YA 3G1LA 3M8FA 3OIQA 5JHFA 2HQAA 4JP0A 4XSXF 1N77A 3IWZA 2KLOA 3I59B 2FOKA 2BY3A 2WB1N 4D0PA 2HGCA 3DKYA 2XF7A 2LBFB 5FKLA 1T33A 3GCMA 1DDNA 3KX2A 1OMIA 2F5CA 3D0SA 1PP7U 1KU3A 1FTZA 2Z9OA 1L0OC 1B6AA 2FNAA 3GTMJ 2DOAA 3P9CA 3BZCA 4X6AJ 4HLYA 1HDPA 1ZTRA 2I5UA 3J81K 4PZJA 2R7VA 4C2UA 4KIBA 1ON2A 3ML6A 1SVOA 3HEFA 4Y52J 2KRCA 3I58A 1VQMI 4PJMA 2X51A 4PCQA 5BPDA 3VYUB 5JHUA 1J59A 1BI1A 4B3AA 2E2IJ 2X9DA 2JA5J 1BBYA 3SJMA 3BR2A 1JT0A 1G2HA 2ISYA 2NYXA 2A69F 5E8IA 1ETYA 2EIJH 3C2HA 3HRUA 2KJCA 3HKZN 3PNYA 2BHYA 4L9TA 3ZQQA 4D7MA 1OJLA 1UFMA 4A0YA 4I0AA 1B9MA 4CH7A 5HODA 2HKOA 4XN0A 2QQ9A 3WODF 1T6SA 5A2QZ 3K1NA 1WI9A 3HPHA 2B0LA 2LOOA 2XVCA 3K4JA 5D4SA 2MYSA 3VDXA 3G6EI 2M9HA 3QPHA 3MN2A 2VC0A 2BXZA 2DMUA 2HYJA 2JTVA 4BBRJ 4QSHA 1U78A 3A02A 2JUCA 3TMOA 1P9QC 3GTQJ 4YEJA 1FT9A 4I98B 4U88A 5ICEA 1ORKA 3QYFA 4XM3A 2EZHA 1WSUA 3CC4I 1SAUA 2XF6A 3DBHB 4UHTA 4E7ZA 2R7WA 3GXOA 4HNUA 1MBKA 3Q9VA 3BQYA 3L2WA 3BLYA 2ZB9A 1YYVA 2DQLA 2OAZA 3D5RC 5LHGA 2IA0A 3ESWB 4GO1A 3IH3A 5FKMA 1W0TA 5FRMA 3LSIA 1IW7F 1XCVA 2VC1A 3I4PA 1Y1VJ 2KIMA 4Z2YA 3PFIA 3KYDB 3FISA 2IW5A 3CDLA 3I54A 2HDWA 2QM3A 1FOKA 3J80Z 2PJPA 2IAIA 2QENA 2RQQA 4UUSA 3L2RA 4ENKA 4XLPF 2QSGX 4IQJA 4YIRX 2GXGA 5B3SH 4L9VA 1ZREA 4CA0A 1XG1A 2HZTA 3OWTA 3LSJA 3FKIJ 2V9PA 3HXLA 4RDUA 4OAZA 1W1WE 2BVMA 5FLMJ 3LFUA 5BPIA 3GZ6A 1XMAA 3JRHA 2AQEA 2ELHA 3R6SA 4PJJA 1VI0A 2HI3A 2P7VB 1YLFA 2W48A 1NK3P 3LQRA 1E17A 3OY9A 1D1CA 1IAWA 3QU6A 3SZTA 4HZFA 4C9YA 3CCEI 1NK2P 4HF2A 4OIRF 2VT2A 1EA3A 3O2PE 5AIPA 1IRXA 5M5XJ 1SD6A 3OS0A 3WE3A 3J7AY 2LC2A 4GCVA 2H6CA 3DPTA 2DA6A 1VNDA 3OL4A 4IQ4A 1A31A 1GDTA 2H1LA 3FKJA 1OQYA 2FD5A 4UUSB 1LDKB 3ABUA 1IV6A 5ICCA 4HF0A 4J00A 1LUJB 2CWEA 2F6CA 2LY1A 2KZGA 2E7WA 3LSGA 4JBAA 2O7OA 3HJEA 2LTPA 4BAYA 2CS3A 1GT0C 4L9JA 2DBBA 4M6XA 2K4BA 3BR6A 1DUXC 2HKXA 3GEZA 2DMQA 3V7CA 1XMKA 3DXJF 3UR3C 1YQAA 1HLVA 2XIGA 2LK2A 1SAXA 2DOFA 1QA6A 1HKSA 1FBQA 2VOPA 1FEXA 5J4YA 1F9NA 3HL2A 5D5XB 2X0LA 3BR1A 1YW8A 2KL4A 2ID6A 2EV5A 3DU6A 1SFOJ 2XKPA 2HZDA 3FMSA 4C3HJ 4AD9A 2DA4A 4AU7A 4XRSG 3SZGA 3W6VA 3F23A 1ZRDA 2F5EA 2NVUB 3F9KA 1OR7A 2LKPA 2L54A 1SD5A 2MD0A 2PQ8A 2Z99A 2WBMA 1VTNC 4RAZA 5D5WB 1J09A 3CO7C 3LSHA 2XDVA 4I2OA 2MFZA 3K4BA 2V1UA 3VYRB 2ACJA 1ERDA 1X2NA 3E0JB 4DZJA 1BI2A 2KISA 2O5RA 1HW5A 3GTGJ 3W2AA 2DAOA 5M3MJ 1ZH5A 1BI3A 2F2EA 3OOUA 4JX5A 4CUGA 2Z3YA 1KONA 2F4OB 2G0EA 2COMA 1IUYA 2F48A 4A3BJ 2ESHA 3O8GA 2MH9A 3H35A 4ZDLA 4PGHA 5CVIA 1HXDA 3LA3A 1ON1A 3GFJA 5AIQA 1QGPA 1ZARA 5E3OA 1S29A 1WI3A 2Y0MA 3I64A 1JKQC 3DCFA 4YG2F 1BR1A 2QSHX 1I39A 2CGPA 2DYRH 3DPLC 3AG1H 4V19K 2JSCA 3CTAA 1LEBA 4IJAA 3GUDA 2Y2ZA 1IGNA 4FE7A 3PNVA 2CV2A 2FF4A 5L3CA 2V1NA 2CV1A 3DTKA 2I8DA 4FE4A 3ZXSA 2CUJA 4ZZLA 4ZTFA 1TT0A 4I76A 3W2VA 4FHTA 3CMMA 3E97A 4UV8A 4XONA 4PSWA 1TW3A 1KZHA 2CMPA 3K4MA 3MKWB 2GXAA 4JOMA 2GM4A 3CLOA 2MA3A 4M3BA 1FTTA 3LOCA 4U0WA 3N4MA 1A35A 2OU2A 4HDUA 5GPAA 4EJVA 2VKDA 2Y69H 1YX3A 4V2FA 5LLQA 1MMGA 2EFPA 2FEZA 3MZYA 1LDDA 1WH7A 2D5VA 2O9LA 2MSYA 3CCMI 4FX0A 3V42A 4FQGA 4G6TB 2ZCWA 1H9GA 3DWLE 4ZC3A 1FOWA 2B7EA 4HQMA 4NB5A 5D5UB 2AS5F 1ZG3A 3W6KB 3V4GA 4HOBA 3QYEA 2FBIA 4I02A 1LDJA 1TNTA 3ZR8X 3WTVC 3OR1C 1OYIA 2H94A 4BY7J 1YI2I 2FA5A 2X1CA 4UUTA 2LKXA 3V7SA 2B63J 2DI3A 1VQLI 5K7HA 1TQMA 2XAHA 2XHKA 3ASNH 4MO7A 5GPCA 2H27A 1HOMA 2QZ8A 3HSFA 3HGYA 2HFHA 4PUSA 2WV1A 3K4KA 1V5FA 1OPCA 2NRAC 4GDFA 1CF7A 1JUSA 1XDSA 3TEDA 3H3ZA 1ZAOA 3R0JA 3OV8A 1Y8RB 3Q5FA 1Y8QB 3H92A 4XRSA 1WQ2A 2BY0A 1R1VA 2JK3A 4PJ0C 4CICA 3RI4A 2LD5A 2GAUA 4IRHA 5CVJA 4A3IJ 2Q2EA 5J4VA 4AVZA 3MKLA 4IL6C 2F5VA 1GVDA 1IUFA 2M1BA 5DCMA 4ZJZA 2L9SA 4MIMA 3PIPF 4GYGA 5E1ZB 1I50J 1TQPA 3EUKL 4XLNF 1YRNA 3VOEA 2QVOA 1B9NA 2E5NA 1VQPI 1ETKA 3RZOJ 3BTCA 2HQ5A 1IN6A 1E3HA 3S93A 3WTUC 4OIOF 3CZ6A 2YX7A 4EMSA 2KP6A 3CESA 5E3NA 1MMDA 3JSOA 2HNHA 4O5VA 2H6BA 4RAFA 1V5EA 5LD2C 1PYVA 1RC9A 3S17J 1G8XA 1OCOH 3HB9A 2LRDA 3WG9A 4XLCA 3DTIA 4D1QA 1FP1D 1DU6A 1JTXA 3S32A 1CF7B 1BA5A 2BHZA 5HLTA 5K5RA 2DA1A 1YO5C 1X3ZB 3F3XA 3VSKA 1QRYA 4UV9A 4BJ6C 3QRFF 4KNYA 2CU7A 4FTHA 5LEJA 2FBHA 4HA8A 2YU9J 2XAJA 1MSEC 4B43A 3CJRB 2Q2EB 2J5OA 2AO9A 3L2QA 4NHJA 1QZYA 1OLTA 1AHDP 2PJRB 1ZLJA 2NOJB 5DCMB 2HYFA 3T8RA 1HSJA 5DV5A 1G3YA 5CJ9A 2BY1A 4XKCA 4BS9A 2EIKH 4JX4A 1YRNB 3HOWJ 2G7HA 2KRFA 1HKQA 3SDGA 4B44A 1WHUA 1BJZA 3HOUJ 3QOEA 5IYCJ 3HOYJ 2E35A 4EM0B 5DDGA 1X1BA 3ZQ7A 2VBZA 1F43A 1ZR4A 2DDAA 3OYLA 3K10A 2R7RA 1H89C 3CF2A 5ED4A 4A12A 1PUEE 1X4PA 3OYJA 1SFEA 4KUMA 2E1OA 2MC3A 5TJJA 3ABTA 2XGCA 5D8LB 1RPWA 2V7FA 5DM6F 1ZG1A 2IS6A 1PVEA 3WHBA 1AU7A 3SHFA 5BOXA 4GYIA 2O3FA 1R22A 1XDUA 5D6FA 2DDBA 4HV6A 5LRRA 1U9NA 3RJPA 1FC3A 2XUBA 4XLFA 2GXBA 2BW3A 3C3WA 2XGEA 3BP8A 3BG3A 2W24A 4NUBA 4OWRB 5L3DA 1P6RA 1Y0UA 3A4CA 3W6JB 5C44J 3MEXA 3PSIA 3E6CC 5IT3A 3F0CA 1UAAA 3K4LA 2LREA 2L5QA 4KIGA 3M8EA 4LLGF 2RAEA 2P8TA 3KP4A 3EDPA 1Z1DA 2IT0A 3NRVA 2WADA 4UVBA 1U8RA 4RLFA 3H1CA 3EUAA 1YW9A 1EH6A 2ZXJA 5L3BA 2XSDC 1FOXA 3CD6I 3IAM2 4L0ZB 3J7YJ 3A1YA 4NBQA 4MFDA 3ZOBA 2PMHA 1FP2A 2JN6A 4EATA 1GXQA 2KIFA 4D5CA 4RAGA 2EV0A 4HEA2 3FXOA 2CQ7A 1U9OA 3OR2C 4MHGA 1WCMJ 2BW3B 2W25A 2CH0A 5EEHA 3TL4X 3F72A 1MDMA 2UWMA 1FBUA 1IDYA 1X4OA 3IAS2 4ITVA 3FXRA 4JX6A 2HVSA 1ODDA 3ABLH 1OKRA 1LVAA 2KRHA 3IRRA 3P9IA 4XKVA 4UVCA 3U21A 2E7XA 3I0TA 1YJ9I 4IRIA 5LGNA 1MIJA 1I6HJ 3WG7H 2K9NA 3VYTB 3IL2A 1YJNI 1DQUA 2ZJQF 2ZSIB 3MCZA 1ZR2A 1NTCA 5E17F 3CMAI 2KT0A 4M3GA 5LRSA 1QQIA 4BYYA 4YIFA 1SD4A 2QKLB 3FHZA 2EZIA 2E34A 1HBXG 5FFXA 3QPSA 5J40A 1I3QJ 3C2BA 2I10A 3DFGA 3IUOA 4RM3A 4G6QA 1A5JA 1WVRA 4CCMA 3H36A 4HSRA 4EM2A 1T08B 1TZLA 2MC4A 3KFWX 1MDMB 1LE8A 4P9FA 1TWAJ 2EV6A 3AG3H 5HVQC 1PJRA 2E5ZA 4DJAA 4KT6A 3IH4A 3TOAA 4MNUA 2CQKA 1XPXA 3ZMZA 1V54H 4M73A 2XSJC 4Q5SF 2Y9ZA 3D5SC 2OA4A 1VQ5I 2DPDA 4BXUA 1R71A 2ZFUA 1MMNA 2GIVA 2DW4A 4HG2A 1UCRA 2KDOA 3DEUA 5E1WA 3IHUA 3L00A 2BBYA 4IRGA 1ETWA 1R36A 5HS9A 3T5XA 1S7EA 3GTPJ 3DLLF 4HPQA 4HAMA 3VFZA 4EM1A 2QQBA 2Q8KA 1QZEA 1MBJA 4RB1A 4E70A 1USTA 4L5EA 5DUKA 1UHWA 4HDVA 1WJ5A 2TRTA 4HF1A 3A0BC 4CYCB 2JQ7A 1B4AA 4BU2A 2VLAA 4UNOA 4M6YA 3KLNA 1UHMA 1YIJI 1W7PD 4ESFA 5K5QA 4DYCA 1LE8B 4IOAF 4ENNA 3S2HJ 2CO5A 2MABA 4HNVA 3LSMA 1LFPA 5IT9K 4LIVA 2WC2A 3M1CA 4MLOA 3B02A 2W1OA 4BEHA 3CCJI 1RNLA 1IV8A 4UVAA 2STTA 2LNBA 2ME0A 1BJAA 2VODA 5M5WJ 3RKQA 3FZVA 5J3LA 1MBFA 4Y3OA 2M8GX 3CCYA 2WB1A 3L2VA 3DF8A 3GTJJ 2IP2A 2VXZA 3EYYA 3BG9A 1JXSA 3HZJA 3GBGA 3CCVI 4BQOA 2CYYA 2HOAA 2WV0A 2IJLA 3RKWA 3MQ0A 5HDKA 2QEXI 4HQEA 2FXAA 4GRIA 3K7AJ 5DD4A 5K7FA 3AKZA 1H8AC 2R4GA 1Z3XA 4XOTA 5HOOA 2HR3A 2W82A 2BYVE 4EVIA 3LNQA 3N97A 1ULYA 2FUG2 3RZDJ 1W7PA 4DBRA 3ROUA 1QBJA 2HQRA 4N4NB 4J19A 1VZ0A 4A69C 1MZBA 4A93J 4G12A 3ZQLA 1RI7A 5BS6A 1JHFA 4DZPA 3HRSA 3V7RA 2M4KA 4BEHB 4M6VA 1QVUA 2XAUA 5BQTA 1G3TA 2HS5A 2CQXA 3HOVJ 1ONVA 1FZPB 2D2WA 5FFZA 2IS1A 2VXDA 2EFNA 3E6DA 1TP4A 3HKZA 2FMYA 1KQ8A 1RIOH 2FQ4A 3KYLA 2HPMA 4CZCA 5E18F 1XGSA 1MKMA 5FKOA 5D8KB 2K7LA 1Y56A 5ICGA 2A07F 3PSFA 3TW6A 2B9SA 2VPLA 3T8TA 2VBXA 2DCEA
chains in the Genus database with same CATH topology
2JZYA 1Z6TA 5L3GA 3O3KA 1FY7A 4AWXB 2TDXA 3M7GA 4F7ZA 1W7PB 1V3FA 3F22A 2XAGA 1FLIA 2YSRA 1BC8C 4G7HF 2PBIA 2BGCA 4CYDA 1GVJA 3WTSC 3GFLA 3VODA 3HRTA 1OYYA 2ETHA 3HTUA 1I1SA 3CDHA 2HYGD 4BHCA 1G4DA 5K1YA 2O6GE 2EFWA 2UZKA 1OYWA 1SMYF 2JPCA 1EH8A 3DKWA 3LQQA 3TO6A 1JGSA 4RGSA 4G9YA 2OQRA 3KP5A 3IWFA 4QLCU 4OMYA 1H9TA 3FF5A 3MFKA 3HOSA 3PQJA 2DQRA 3K0LA 2HQNA 4OIQF 2E1NA 2CW0F 4LMYA 4KT5C 3LFKA 5CVVA 2EK5A 1FNNA 2VBWA 2WTEA 4U7DA 4EGYA 4BNCA 5DCFA 2P5LC 1U6GA 2D1VA 3CUQC 3WGGA 1YIOA 5JFRA 3ZMDA 4KYWA 2WWYA 4R79A 2VT3A 2RDPA 1TW2A 2MH2A 2KIUA 4G6DA 1I27A 1S7AA 3CJNA 1GHCA 4LG0A 1W5TA 4CHUA 1IN4A 2GWRA 4RGRA 3P7NA 4EJWA 4IVNA 4AIJA 3O6BB 1AWCA 4IHTA 1GXPA 2R7FA 3WTWC 1R23A 5FD5A 2KKOA 2M87A 3HSEA 3BJ6A 2QBYA 5FLXK 5L3FA 1S6LA 4I0BA 2LDUA 2P6TA 1P92A 1IN5A 3GYHX 2FRHA 1TNSA 3KP6A 3J80K 4LG0B 3K2ZA 3BDDA 5D4RA 2RV8A 2OD5A 4MQVA 2ZKZA 1ZYRF 1WKMA 1XGOA 3SZPA 1USSA 2R7DA 3CO6C 3E5QA 1SFUA 2RQPA 1BOAA 2W85A 2RC4A 1O57A 2KJBA 1TLHB 1E2XA 2QBYB 2O03A 1D8JA 1Z7UA 3GLXA 4A0XA 5D5VB 3BJAA 2ZFWA 1I5ZA 3BY6A 4A0ZA 1T98A 4OU0A 4P55A 2XASA 3DV8A 2Y48A 5J8CA 1XCBA 3ULQB 3V8JA 4L18B 3R4KA 1ZRCA 3COAC 4UUVA 3HUGA 1B1BA 4CO8A 4YFKF 3IKTA 3E3VA 4ZYHA 1LJ9A 3IRQA 3SXYA 1G3SA 1YTYA 2V1XA 2HEOA 1FBSA 1TTYA 2RN7A 3QPTA 3FMQA 2ISZA 1STZA 2LF8A 1G3WA 2STWA 3REOA 2Q0OA 2H09A 3F21A 1HW2A 1O3SA 5K5OA 3E6MA 3FM3A 2OQGA 3LAPA 4M9XA 1MJBA 4YFNF 1V4RA 3TGNA 2PFBA 4G94A 3FMRA 1K7AA 2DPUA 3R60A 4KIFA 3OOPA 1R5GA 4KDPA 5FD6A 4L5IA 2M30A 1O7FA 3R61A 4CZZA 3QP6A 3MZHA 3EYIA 1XD7A 1U2WA 2EFOA 1CGPA 2YX4A 1IXCA 3KEQA 3LWFA 5L3EA 1K78A 2MBFA 4WX9A 2ZNZA 1FYLA 3I53A 2MLKA 1KYZA 4NQWA 3WTYC 4WXDA 2P6SA 2F5DA 3GX4X 2J5PA 6PAXA 2Z5UA 1ZG5A 1HW1A 5ILVA 2FNPA 2ADUA 4Q47A 3KP7A 4M9ZA 2DT5A 5JR3A 2QUFA 4ASNA 4P96A 3HHHA 1QPMA 2L01A 5E20A 1D3YA 2M8EA 4EJOA 4A2UA 1IXSB 3RYRA 3RDIA 3TDZC 3JTGA 3FWEA 1NHAA 2V79A 1XGMA 2ESNA 2FQ3A 4MQ9F 2HTJA 2A3SA 2K86A 3WTTC 1W4MA 1IRFA 3GF2A 1BIAA 3GVAA 3QAHA 4M9SA 2V9VA 3E5XA 1MJAA 2MD5A 2IPQX 3QP5A 3GW2A 2DTRA 2ZO4A 1MD0A 2UXNA 1O3TA 4R1HA 5ILUA 1KA8A 2W84A 3DP7A 5H20A 3ELKA 3CUOA 4ZYGA 3V8LA 3L2CA 2PN6A 4YFXF 1XB4A 2L3DA 3WGHA 1HKTA 4ESJA 1XSXA 3NEUA 4HX4A 4PDKA 3B73A 3ECHA 3CUQA 1FX7A 2IRFG 3M1EA 1KU7A 1BM9A 2M45A 5ERIA 2F5FA 1Q1HA 4Y13A 1O3RA 2VE9A 3E6BA 3J81Z 1R1TA 4RAYA 2ZBKA 3M9AA 2QWWA 3SFZA 5JVTA 2XROA 5KVRA 4I01A 5HS8A 3G3ZA 4QWQA 2EJRA 3F6VA 1UB9A 1J75A 2IA1A 2RNJA 1KU9A 4ZH4F 3CUQB 2QYOA 4CDGA 4HX8A 3KCCA 3U1DA 4EQQA 2P7CB 2VN2A 1Z9CA 3KETA 4P5OA 4JQFA 2YU3A 3RIRA 2EB7A 1F1ZA 3KP2A 4MTEA 2VOOA 4XBFA 1K6OA 2G7UA 4LD5A 4A6DA 2QQAA 4WF2A 5HLIA 1KU2A 1J2XA 1FYMA 4U7BA 3F8CA 3K1PA 1C0WA 3MAJA 3C7JA 3TDUC 4L9NA 4OOIA 3HTSB 4MEXF 3PQKA 3NQOA 2HWVA 2C6YA 4MEYF 2LSOA 4IXAA 3KLOA 4RB2C 1P2FA 3ZN0A 4EJTA 3ZMTA 2IA2A 1XSVA 1WWXA 3RPQA 1MJ9A 3HOTA 2E1CA 3WU0A 3F6OA 5F1RA 4HBLA 2HDCA 3IKVA 4U0VA 2BEOA 2V6CA 2FU4A 4LGWA 2DU9A 4KN7X 2Y75A 4ENMA 3K69A 2DO7A 2DK8A 3BOQA 1XSDA 4S05A 5LBQA 2G9WA 4A5MA 3JAMK 3FM5A 4LFUA 4Y15A 1DPRA 2PLYA 2GZWA 4L5JA 1TQIA 1J7KA 1U5TC 4FX4A 2K27A 4TV7A 1O3QA 4WXCA 3C1DA 2EWNA 2D1HA 5H6RA 1J0RA 2YR2A 1J5YA 2RVCA 2VE8A 2JPBA 4RS8A 5FLXZ 4WCGA 1P4AA 2OBPA 2RGVA 4FT8A 4B09A 2OZ6A 4LJZF 1KQ0A 3WTZA 5CLSA 4G8XA 3P9KA 5LGUA 4BH9A 1X3UA 2EA4A 3U9GA 3GFMA 4M74A 2XAQA 1JE8A 2HOEA 1QNTA 3RKYA 1T2KA 5HLGA 3BZ6A 1FSHA 3LA2A 4ENJA 3V8KA 1FWZA 3GZ5A 1YS6A 3ZPLA 1T0FA 4M72A 4N9HA 4H0EA 1WRJA 4KA4A 2V1DA 2P4WA 2ZJ2A 1G6NA 5DD8A 1HQCA 1SMTA 3DQVC 2X4HA 2PG4A 2CFXA 2GA1A 2YPRA 1IF1A 2ZMEA 2P5KA 5D6EA 1ZLKA 2PI0A 5LEKA 1XGNA 3GO5A 3U2RA 4AIKA 1R1UA 1F5TA 4A6EA 1KGSA 3KZZA 1TBXA 5A2QK 4O6JA 4ZYEA 2PMUA 1BN5A 1FPQA 2CG4A 1AOYA 1PP8F 5LHIA 4LLNA 1LEAA 3K1MA 3Q9SA 5ICFA 5CVRA 1YG2A 3HYIA 4ZYDA 1MGTA 4IPAA 2VONA 3FX3A 4YIIA 4RGXA 1LNWA 5TRDA 5DEQA 2MLGA 2ZMEB 3EQLF 3FXUA 4N9IA 4XSZF 1W5SA 4DNCA 5E1XA 3LAJA 2DK5A 3BROA 4HYEA 1I1GA 4BHPA 4ZZDA 1BC7C 3KEOA 4CGZA 2XAFA 4N0BA 2P5VA 5EEGA 1ZGJA 1RZ4A 2L4MA 4ESBA 2FSWA 2O61A 5CYVA 3KZYA 2HTSA 2XRNA 2GA2A 4IF4A 2NS0A 1K79A 4DQ2A 2A6HF 3ISPA 2L02A 3ZMSA 3K9TA 2DLLA 4K2EA 2O0YA 1U3EM 2FMLA 1KYWA 2BV6A 1S3JA 3ERED 3ZMUA 3JW4A 2M5WA 3TKYA 1QZZA 2XGXA 4OIPF 1IRGA 1R7JA 1F4KA 2L4AA 4KFCA 4UXNA 5FGMA 3EETA 4Q4ZF 2DFIA 5BMZA 4KMFA 4MTDA 4Q48A 4I09A 4LK1F 4KICA 2BE5F 5F6FA 3L09A 3ZMVA 4G7OF 3F8BA 5LGTA 3ZP5A 1O7LA 1Z6RA 3RPUA 4LB5A 3HRMA 1BI0A 2A5YB 2JRTA 5HDGA 3C18A 3TOBA 2FE3A 2JT1A 1Z91A 5CVUA 3KP3A 3F8MA 4OINF 3FXQA 4AVPA 4BHBA 3IC7A 4KMUX 3F8FA 3TO7A 1YS7A 3BJOA 2K4JA 4WWCA 4WK8F 4JK1X 4EJUA 2QLZA 1ZGAA 2PEXA 4MGRA 1XN7A 1U5TA 4I7HA 4GGGA 3G73A 2NNYA 2LF7A 3MWMA 5DYMA 2D45A 2OZUA 1B59A 1IN7A 1DPUA 5HLHA 4L0YB 1EV7A 5E8GA 1L3LA 2FBKA 1K78B 1RUOA 1IXRC 3ECOA 2O8XA 2UXXA 1T38A 4S04A 3D5LA 3I5UA 4GXOA 5FO5A 4KN4X 2EA2A 1KQ9A 2A68F 1JHHA 1P4XA 4ON0A 1U5TB 5J8FA 3JTHA 2R3SA 4HV5A 1A04A 1ZN2A 2A61A 1LB2A 3KE2A 1DP7P 1S8NA 2AXLA 3S2WA 3EUHA 4AIHA 2CSOA 4BQAA 3RYPA 3ZN1A 5HS7A 4CXFA 1S7OA 4RB0A 2IVMA 4HX7A 3T0YA 1HSTA 4HLXA 3BPVA 3J7AO 4Y17A 1Z05A 3RKXA 3JSPA 4EGZA 5J6XA 3BPXA 3L7WA 2EFQA 5IT9Z 1FSEA 3F8NA 4B8XA 3L9FA 3VEPA 1R58A 1H0MA 3T1BA 1YW7A 4IHSA 3R0AA 2ZNYA 5H6QA 1SD7A 1PDNC 1R00A 3WU1B 4M71A 5F64A 3WTXC 3AAFA 3HIFA 1FYKA 5FB2A 4LB6B 1IZ1A 4OMZA 3QOPA 4WXHA 3WE2A 3RTRA 4O3MA 2NNNA 4ETSA 1YFHA 4LK0F 2RKHA 5HDNA 4P9UA 3JAMZ 4XRFA 3GFIA 1RUNA 1ZHFA 3QU3A 5LHHA 1ZRFA 5ILSA 1LQ1A 3LSTA 5DUIA 1R5HA 1J9IA 3HSRA 3TQNA 1QO0D 2Z33A 1I6XA 2NAZA 4R8HA 3I71A 4A5NA 5AONA 4LLLA 2XKOA 4EV0A 3SQNA 3I59A 4RB3C 3H3UA 3HHGA 2XV4S 4RGUA 3E5UA 1T39A 1SFXA 1REPC 2VBYA 1IN8A 5KK1A 4HW0A 3BWGA 3GWZA 3WGIA 4PGGA 3VB2A 1EH7A 2GQQA 4G7ZF 5JI6A 2A6EF 2W57A 3LA7A 1D5VA 3TO9A 2K02A 1D8KA 1P4WA 1BIBA 4U0YA 3M8FA 4XSXF 3IWZA 3I59B 2FOKA 4D0PA 2HGCA 1DDNA 1OMIA 2F5CA 3D0SA 1PP7U 1KU3A 2Z9OA 1L0OC 1B6AA 2FNAA 3P9CA 4HLYA 3J81K 4PZJA 4KIBA 1ON2A 3ML6A 3I58A 4PCQA 5BPDA 5JHUA 1J59A 1BI1A 1BBYA 2ISYA 2NYXA 2A69F 5E8IA 3HRUA 2KJCA 4L9TA 1UFMA 4A0YA 4I0AA 1B9MA 2HKOA 2QQ9A 3WODF 1T6SA 5A2QZ 3K1NA 1WI9A 5D4SA 2B0LA 2XVCA 3QPHA 2VC0A 2JTVA 1U78A 1FT9A 4I98B 4U88A 5ICEA 1WSUA 4UHTA 3GXOA 3Q9VA 1YYVA 2DQLA 2OAZA 5LHGA 2IA0A 4GO1A 1IW7F 1XCVA 2VC1A 3I4PA 2KIMA 4Z2YA 3PFIA 2IW5A 3I54A 1FOKA 2QM3A 3J80Z 2PJPA 2QENA 4ENKA 4XLPF 2GXGA 4L9VA 1ZREA 2HZTA 5BPIA 3GZ6A 1XMAA 2ELHA 3R6SA 2P7VB 1YLFA 3LQRA 1E17A 1IAWA 3QU6A 3SZTA 4HZFA 4HF2A 4OIRF 2VT2A 3O2PE 5AIPA 1SD6A 3WE3A 4GCVA 2H6CA 3DPTA 1LDKB 3ABUA 5ICCA 4HF0A 2CWEA 2E7WA 4JBAA 4BAYA 4L9JA 2DBBA 4M6XA 2K4BA 1DUXC 2HKXA 3GEZA 3V7CA 1XMKA 3DXJF 1YQAA 2XIGA 1SAXA 1HKSA 1FBQA 2VOPA 1F9NA 5D5XB 2X0LA 1YW8A 2EV5A 2XKPA 3FMSA 4AD9A 3F23A 1ZRDA 2F5EA 1OR7A 2LKPA 2L54A 1SD5A 2PQ8A 2Z99A 1VTNC 4RAZA 5D5WB 3CO7C 4I2OA 2V1UA 2ACJA 1BI2A 1HW5A 2DAOA 1ZH5A 1BI3A 2F2EA 2Z3YA 2COMA 1IUYA 2ESHA 2MH9A 4PGHA 5CVIA 1HXDA 3LA3A 1ON1A 3GFJA 5AIQA 1QGPA 1ZARA 1S29A 2Y0MA 3I64A 4YG2F 2CGPA 3DPLC 2JSCA 3CTAA 1LEBA 4IJAA 3GUDA 2FF4A 5L3CA 4ZZLA 4FHTA 4UV8A 3E97A 1TW3A 3CLOA 2MA3A 3N4MA 4U0WA 2OU2A 4HDUA 4EJVA 5LLQA 2EFPA 2FEZA 3MZYA 1LDDA 4FX0A 2ZCWA 1H9GA 4HQMA 4NB5A 5D5UB 2AS5F 1ZG3A 3W6KB 3V4GA 4HOBA 2FBIA 4I02A 1LDJA 1TNTA 3WTVC 1OYIA 2H94A 2FA5A 3V7SA 2DI3A 1TQMA 2XAHA 2XHKA 2H27A 2QZ8A 3HSFA 2HFHA 2NRAC 1OPCA 1CF7A 1XDSA 3H3ZA 1ZAOA 3R0JA 3OV8A 3Q5FA 3H92A 1WQ2A 1R1VA 4CICA 3RI4A 2GAUA 4IRHA 5CVJA 2Q2EA 5DCMA 2M1BA 4GYGA 5E1ZB 1TQPA 4XLNF 3VOEA 2QVOA 1B9NA 1IN6A 3WTUC 4OIOF 2YX7A 4EMSA 3JSOA 4O5VA 2H6BA 3WG9A 1FP1D 1CF7B 5K5RA 1YO5C 3F3XA 4UV9A 3QRFF 4KNYA 5LEJA 2FBHA 4HA8A 2XAJA 2J5OA 4NHJA 1QZYA 1ZLJA 5DCMB 2HYFA 3T8RA 1HSJA 5DV5A 1G3YA 5CJ9A 2G7HA 2KRFA 1HKQA 4EM0B 5DDGA 3ZQ7A 2VBZA 5ED4A 4A12A 1PUEE 1SFEA 4KUMA 2MC3A 5TJJA 3ABTA 5D8LB 1ZG1A 3SHFA 5BOXA 4GYIA 2O3FA 1R22A 1XDUA 5D6FA 4HV6A 5LRRA 3RJPA 1FC3A 2XUBA 2GXBA 3C3WA 3BP8A 3W6JB 2W24A 5L3DA 3E6CC 1P6RA 1Y0UA 3MEXA 5IT3A 4KIGA 3M8EA 4LLGF 2P8TA 3KP4A 3EDPA 1Z1DA 2IT0A 3NRVA 4UVBA 1U8RA 1YW9A 1EH6A 2ZXJA 5L3BA 4L0ZB 2PMHA 1FP2A 1GXQA 2KIFA 2EV0A 4MHGA 2W25A 5EEHA 3F72A 1MDMA 2UWMA 1FBUA 3FXRA 1ODDA 1OKRA 1LVAA 3IRRA 3P9IA 4UVCA 2E7XA 3I0TA 4IRIA 5LGNA 3IL2A 3MCZA 5E17F 5LRSA 1QQIA 4BYYA 4YIFA 1SD4A 3FHZA 1HBXG 5FFXA 3DFGA 4G6QA 4EM2A 1MDMB 3KFWX 4P9FA 2EV6A 5HVQC 3TOAA 4MNUA 2CQKA 3ZMZA 4M73A 4Q5SF 2OA4A 2DPDA 4BXUA 2GIVA 2DW4A 1UCRA 3DEUA 5E1WA 3IHUA 3L00A 2BBYA 4IRGA 5HS9A 1R36A 3T5XA 4HAMA 3VFZA 4EM1A 2QQBA 2Q8KA 4RB1A 4E70A 1USTA 4HDVA 5DUKA 1UHWA 4HF1A 1B4AA 4UNOA 4M6YA 3KLNA 1UHMA 1W7PD 4ESFA 5K5QA 4ENNA 2CO5A 5IT9K 2WC2A 3B02A 1RNLA 4UVAA 2STTA 2LNBA 1BJAA 2VODA 3FZVA 3DF8A 2IP2A 2VXZA 3EYYA 1JXSA 2CYYA 2WV0A 2IJLA 3RKWA 5HDKA 3MQ0A 4HQEA 2FXAA 5DD4A 5HOOA 2HR3A 2BYVE 4EVIA 3N97A 1ULYA 1W7PA 3ROUA 1QBJA 2HQRA 1MZBA 1RI7A 5BS6A 1JHFA 3HRSA 3V7RA 5BQTA 1G3TA 2HS5A 1ONVA 1FZPB 2D2WA 5FFZA 2EFNA 3E6DA 1KQ8A 2FMYA 1RIOH 5E18F 1XGSA 1MKMA 5D8KB 2K7LA 5ICGA 2A07F 3T8TA 2VBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZY A;  1Z6T A;  5L3G A;  3O3K A;  1FY7 A;  4AWX B;  2TDX A;  3M7G A;  4F7Z A;  1W7P B;  1V3F A;  3F22 A;  2XAG A;  1FLI A;  2YSR A;  1BC8 C;  4G7H F;  2PBI A;  2BGC A;  4CYD A;  1GVJ A;  3WTS C;  3GFL A;  3VOD A;  3HRT A;  1OYY A;  2ETH A;  3HTU A;  1I1S A;  3CDH A;  2HYG D;  4BHC A;  1G4D A;  5K1Y A;  2O6G E;  2EFW A;  2UZK A;  1OYW A;  1SMY F;  2JPC A;  1EH8 A;  3DKW A;  3LQQ A;  3TO6 A;  1JGS A;  4RGS A;  4G9Y A;  2OQR A;  3KP5 A;  3IWF A;  4QLC U;  4OMY A;  1H9T A;  3FF5 A;  3MFK A;  3HOS A;  3PQJ A;  2DQR A;  3K0L A;  2HQN A;  4OIQ F;  2E1N A;  2CW0 F;  4LMY A;  4KT5 C;  3LFK A;  5CVV A;  2EK5 A;  1FNN A;  2VBW A;  2WTE A;  4U7D A;  4EGY A;  4BNC A;  5DCF A;  2P5L C;  1U6G A;  2D1V A;  3CUQ C;  3WGG A;  1YIO A;  5JFR A;  3ZMD A;  4KYW A;  2WWY A;  4R79 A;  2VT3 A;  2RDP A;  1TW2 A;  2MH2 A;  2KIU A;  4G6D A;  1I27 A;  1S7A A;  3CJN A;  1GHC A;  4LG0 A;  1W5T A;  4CHU A;  1IN4 A;  2GWR A;  4RGR A;  3P7N A;  4EJW A;  4IVN A;  4AIJ A;  3O6B B;  1AWC A;  4IHT A;  1GXP A;  2R7F A;  3WTW C;  1R23 A;  5FD5 A;  2KKO A;  2M87 A;  3HSE A;  3BJ6 A;  2QBY A;  5FLX K;  5L3F A;  1S6L A;  4I0B A;  2LDU A;  2P6T A;  1P92 A;  1IN5 A;  3GYH X;  2FRH A;  1TNS A;  3KP6 A;  3J80 K;  4LG0 B;  3K2Z A;  3BDD A;  5D4R A;  2RV8 A;  2OD5 A;  4MQV A;  2ZKZ A;  1ZYR F;  1WKM A;  1XGO A;  3SZP A;  1USS A;  2R7D A;  3CO6 C;  3E5Q A;  1SFU A;  2RQP A;  1BOA A;  2W85 A;  2RC4 A;  1O57 A;  2KJB A;  1TLH B;  1E2X A;  2QBY B;  2O03 A;  1D8J A;  1Z7U A;  3GLX A;  4A0X A;  5D5V B;  3BJA A;  2ZFW A;  1I5Z A;  3BY6 A;  4A0Z A;  1T98 A;  4OU0 A;  4P55 A;  2XAS A;  3DV8 A;  2Y48 A;  5J8C A;  1XCB A;  3ULQ B;  3V8J A;  4L18 B;  3R4K A;  1ZRC A;  3COA C;  4UUV A;  3HUG A;  1B1B A;  4CO8 A;  4YFK F;  3IKT A;  3E3V A;  4ZYH A;  1LJ9 A;  3IRQ A;  3SXY A;  1G3S A;  1YTY A;  2V1X A;  2HEO A;  1FBS A;  1TTY A;  2RN7 A;  3QPT A;  3FMQ A;  2ISZ A;  1STZ A;  2LF8 A;  1G3W A;  2STW A;  3REO A;  2Q0O A;  2H09 A;  3F21 A;  1HW2 A;  1O3S A;  5K5O A;  3E6M A;  3FM3 A;  2OQG A;  3LAP A;  4M9X A;  1MJB A;  4YFN F;  1V4R A;  3TGN A;  2PFB A;  4G94 A;  3FMR A;  1K7A A;  2DPU A;  3R60 A;  4KIF A;  3OOP A;  1R5G A;  4KDP A;  5FD6 A;  4L5I A;  2M30 A;  1O7F A;  3R61 A;  4CZZ A;  3QP6 A;  3MZH A;  3EYI A;  1XD7 A;  1U2W A;  2EFO A;  1CGP A;  2YX4 A;  1IXC A;  3KEQ A;  3LWF A;  5L3E A;  1K78 A;  2MBF A;  4WX9 A;  2ZNZ A;  1FYL A;  3I53 A;  2MLK A;  1KYZ A;  4NQW A;  3WTY C;  4WXD A;  2P6S A;  2F5D A;  3GX4 X;  2J5P A;  6PAX A;  2Z5U A;  1ZG5 A;  1HW1 A;  5ILV A;  2FNP A;  2ADU A;  4Q47 A;  3KP7 A;  4M9Z A;  2DT5 A;  5JR3 A;  2QUF A;  4ASN A;  4P96 A;  3HHH A;  1QPM A;  2L01 A;  5E20 A;  1D3Y A;  2M8E A;  4EJO A;  4A2U A;  1IXS B;  3RYR A;  3RDI A;  3TDZ C;  3JTG A;  3FWE A;  1NHA A;  2V79 A;  1XGM A;  2ESN A;  2FQ3 A;  4MQ9 F;  2HTJ A;  2A3S A;  2K86 A;  3WTT C;  1W4M A;  1IRF A;  3GF2 A;  1BIA A;  3GVA A;  3QAH A;  4M9S A;  2V9V A;  3E5X A;  1MJA A;  2MD5 A;  2IPQ X;  3QP5 A;  3GW2 A;  2DTR A;  2ZO4 A;  1MD0 A;  2UXN A;  1O3T A;  4R1H A;  5ILU A;  1KA8 A;  2W84 A;  3DP7 A;  5H20 A;  3ELK A;  3CUO A;  4ZYG A;  3V8L A;  3L2C A;  2PN6 A;  4YFX F;  1XB4 A;  2L3D A;  3WGH A;  1HKT A;  4ESJ A;  1XSX A;  3NEU A;  4HX4 A;  4PDK A;  3B73 A;  3ECH A;  3CUQ A;  1FX7 A;  2IRF G;  3M1E A;  1KU7 A;  1BM9 A;  2M45 A;  5ERI A;  2F5F A;  1Q1H A;  4Y13 A;  1O3R A;  2VE9 A;  3E6B A;  3J81 Z;  1R1T A;  4RAY A;  2ZBK A;  3M9A A;  2QWW A;  3SFZ A;  5JVT A;  2XRO A;  5KVR A;  4I01 A;  5HS8 A;  3G3Z A;  4QWQ A;  2EJR A;  3F6V A;  1UB9 A;  1J75 A;  2IA1 A;  2RNJ A;  1KU9 A;  4ZH4 F;  3CUQ B;  2QYO A;  4CDG A;  4HX8 A;  3KCC A;  3U1D A;  4EQQ A;  2P7C B;  2VN2 A;  1Z9C A;  3KET A;  4P5O A;  4JQF A;  2YU3 A;  3RIR A;  2EB7 A;  1F1Z A;  3KP2 A;  4MTE A;  2VOO A;  4XBF A;  1K6O A;  2G7U A;  4LD5 A;  4A6D A;  2QQA A;  4WF2 A;  5HLI A;  1KU2 A;  1J2X A;  1FYM A;  4U7B A;  3F8C A;  3K1P A;  1C0W A;  3MAJ A;  3C7J A;  3TDU C;  4L9N A;  4OOI A;  3HTS B;  4MEX F;  3PQK A;  3NQO A;  2HWV A;  2C6Y A;  4MEY F;  2LSO A;  4IXA A;  3KLO A;  4RB2 C;  1P2F A;  3ZN0 A;  4EJT A;  3ZMT A;  2IA2 A;  1XSV A;  1WWX A;  3RPQ A;  1MJ9 A;  3HOT A;  2E1C A;  3WU0 A;  3F6O A;  5F1R A;  4HBL A;  2HDC A;  3IKV A;  4U0V A;  2BEO A;  2V6C A;  2FU4 A;  4LGW A;  2DU9 A;  4KN7 X;  2Y75 A;  4ENM A;  3K69 A;  2DO7 A;  2DK8 A;  3BOQ A;  1XSD A;  4S05 A;  5LBQ A;  2G9W A;  4A5M A;  3JAM K;  3FM5 A;  4LFU A;  4Y15 A;  1DPR A;  2PLY A;  2GZW A;  4L5J A;  1TQI A;  1J7K A;  1U5T C;  4FX4 A;  2K27 A;  4TV7 A;  1O3Q A;  4WXC A;  3C1D A;  2EWN A;  2D1H A;  5H6R A;  1J0R A;  2YR2 A;  1J5Y A;  2RVC A;  2VE8 A;  2JPB A;  4RS8 A;  5FLX Z;  4WCG A;  1P4A A;  2OBP A;  2RGV A;  4FT8 A;  4B09 A;  2OZ6 A;  4LJZ F;  1KQ0 A;  3WTZ A;  5CLS A;  4G8X A;  3P9K A;  5LGU A;  4BH9 A;  1X3U A;  2EA4 A;  3U9G A;  3GFM A;  4M74 A;  2XAQ A;  1JE8 A;  2HOE A;  1QNT A;  3RKY A;  1T2K A;  5HLG A;  3BZ6 A;  1FSH A;  3LA2 A;  4ENJ A;  3V8K A;  1FWZ A;  3GZ5 A;  1YS6 A;  3ZPL A;  1T0F A;  4M72 A;  4N9H A;  4H0E A;  1WRJ A;  4KA4 A;  2V1D A;  2P4W A;  2ZJ2 A;  1G6N A;  5DD8 A;  1HQC A;  1SMT A;  3DQV C;  2X4H A;  2PG4 A;  2CFX A;  2GA1 A;  2YPR A;  1IF1 A;  2ZME A;  2P5K A;  5D6E A;  1ZLK A;  2PI0 A;  5LEK A;  1XGN A;  3GO5 A;  3U2R A;  4AIK A;  1R1U A;  1F5T A;  4A6E A;  1KGS A;  3KZZ A;  1TBX A;  5A2Q K;  4O6J A;  4ZYE A;  2PMU A;  1BN5 A;  1FPQ A;  2CG4 A;  1AOY A;  1PP8 F;  5LHI A;  4LLN A;  1LEA A;  3K1M A;  3Q9S A;  5ICF A;  5CVR A;  1YG2 A;  3HYI A;  4ZYD A;  1MGT A;  4IPA A;  2VON A;  3FX3 A;  4YII A;  4RGX A;  1LNW A;  5TRD A;  5DEQ A;  2MLG A;  2ZME B;  3EQL F;  3FXU A;  4N9I A;  4XSZ F;  1W5S A;  4DNC A;  5E1X A;  3LAJ A;  2DK5 A;  3BRO A;  4HYE A;  1I1G A;  4BHP A;  4ZZD A;  1BC7 C;  3KEO A;  4CGZ A;  2XAF A;  4N0B A;  2P5V A;  5EEG A;  1ZGJ A;  1RZ4 A;  2L4M A;  4ESB A;  2FSW A;  2O61 A;  5CYV A;  3KZY A;  2HTS A;  2XRN A;  2GA2 A;  4IF4 A;  2NS0 A;  1K79 A;  4DQ2 A;  2A6H F;  3ISP A;  2L02 A;  3ZMS A;  3K9T A;  2DLL A;  4K2E A;  2O0Y A;  1U3E M;  2FML A;  1KYW A;  2BV6 A;  1S3J A;  3ERE D;  3ZMU A;  3JW4 A;  2M5W A;  3TKY A;  1QZZ A;  2XGX A;  4OIP F;  1IRG A;  1R7J A;  1F4K A;  2L4A A;  4KFC A;  4UXN A;  5FGM A;  3EET A;  4Q4Z F;  2DFI A;  5BMZ A;  4KMF A;  4MTD A;  4Q48 A;  4I09 A;  4LK1 F;  4KIC A;  2BE5 F;  5F6F A;  3L09 A;  3ZMV A;  4G7O F;  3F8B A;  5LGT A;  3ZP5 A;  1O7L A;  1Z6R A;  3RPU A;  4LB5 A;  3HRM A;  1BI0 A;  2A5Y B;  2JRT A;  5HDG A;  3C18 A;  3TOB A;  2FE3 A;  2JT1 A;  1Z91 A;  5CVU A;  3KP3 A;  3F8M A;  4OIN F;  3FXQ A;  4AVP A;  4BHB A;  3IC7 A;  4KMU X;  3F8F A;  3TO7 A;  1YS7 A;  3BJO A;  2K4J A;  4WWC A;  4WK8 F;  4JK1 X;  4EJU A;  2QLZ A;  1ZGA A;  2PEX A;  4MGR A;  1XN7 A;  1U5T A;  4I7H A;  4GGG A;  3G73 A;  2NNY A;  2LF7 A;  3MWM A;  5DYM A;  2D45 A;  2OZU A;  1B59 A;  1IN7 A;  1DPU A;  5HLH A;  4L0Y B;  1EV7 A;  5E8G A;  1L3L A;  2FBK A;  1K78 B;  1RUO A;  1IXR C;  3ECO A;  2O8X A;  2UXX A;  1T38 A;  4S04 A;  3D5L A;  3I5U A;  4GXO A;  5FO5 A;  4KN4 X;  2EA2 A;  1KQ9 A;  2A68 F;  1JHH A;  1P4X A;  4ON0 A;  1U5T B;  5J8F A;  3JTH A;  2R3S A;  4HV5 A;  1A04 A;  1ZN2 A;  2A61 A;  1LB2 A;  3KE2 A;  1DP7 P;  1S8N A;  2AXL A;  3S2W A;  3EUH A;  4AIH A;  2CSO A;  4BQA A;  3RYP A;  3ZN1 A;  5HS7 A;  4CXF A;  1S7O A;  4RB0 A;  2IVM A;  4HX7 A;  3T0Y A;  1HST A;  4HLX A;  3BPV A;  3J7A O;  4Y17 A;  1Z05 A;  3RKX A;  3JSP A;  4EGZ A;  5J6X A;  3BPX A;  3L7W A;  2EFQ A;  5IT9 Z;  1FSE A;  3F8N A;  4B8X A;  3L9F A;  3VEP A;  1R58 A;  1H0M A;  3T1B A;  1YW7 A;  4IHS A;  3R0A A;  2ZNY A;  5H6Q A;  1SD7 A;  1PDN C;  1R00 A;  3WU1 B;  4M71 A;  5F64 A;  3WTX C;  3AAF A;  3HIF A;  1FYK A;  5FB2 A;  4LB6 B;  1IZ1 A;  4OMZ A;  3QOP A;  4WXH A;  3WE2 A;  3RTR A;  4O3M A;  2NNN A;  4ETS A;  1YFH A;  4LK0 F;  2RKH A;  5HDN A;  4P9U A;  3JAM Z;  4XRF A;  3GFI A;  1RUN A;  1ZHF A;  3QU3 A;  5LHH A;  1ZRF A;  5ILS A;  1LQ1 A;  3LST A;  5DUI A;  1R5H A;  1J9I A;  3HSR A;  3TQN A;  1QO0 D;  2Z33 A;  1I6X A;  2NAZ A;  4R8H A;  3I71 A;  4A5N A;  5AON A;  4LLL A;  2XKO A;  4EV0 A;  3SQN A;  3I59 A;  4RB3 C;  3H3U A;  3HHG A;  2XV4 S;  4RGU A;  3E5U A;  1T39 A;  1SFX A;  1REP C;  2VBY A;  1IN8 A;  5KK1 A;  4HW0 A;  3BWG A;  3GWZ A;  3WGI A;  4PGG A;  3VB2 A;  1EH7 A;  2GQQ A;  4G7Z F;  5JI6 A;  2A6E F;  2W57 A;  3LA7 A;  1D5V A;  3TO9 A;  2K02 A;  1D8K A;  1P4W A;  1BIB A;  4U0Y A;  3M8F A;  4XSX F;  3IWZ A;  3I59 B;  2FOK A;  4D0P A;  2HGC A;  1DDN A;  1OMI A;  2F5C A;  3D0S A;  1PP7 U;  1KU3 A;  2Z9O A;  1L0O C;  1B6A A;  2FNA A;  3P9C A;  4HLY A;  3J81 K;  4PZJ A;  4KIB A;  1ON2 A;  3ML6 A;  3I58 A;  4PCQ A;  5BPD A;  5JHU A;  1J59 A;  1BI1 A;  1BBY A;  2ISY A;  2NYX A;  2A69 F;  5E8I A;  3HRU A;  2KJC A;  4L9T A;  1UFM A;  4A0Y A;  4I0A A;  1B9M A;  2HKO A;  2QQ9 A;  3WOD F;  1T6S A;  5A2Q Z;  3K1N A;  1WI9 A;  5D4S A;  2B0L A;  2XVC A;  3QPH A;  2VC0 A;  2JTV A;  1U78 A;  1FT9 A;  4I98 B;  4U88 A;  5ICE A;  1WSU A;  4UHT A;  3GXO A;  3Q9V A;  1YYV A;  2DQL A;  2OAZ A;  5LHG A;  2IA0 A;  4GO1 A;  1IW7 F;  1XCV A;  2VC1 A;  3I4P A;  2KIM A;  4Z2Y A;  3PFI A;  2IW5 A;  3I54 A;  1FOK A;  2QM3 A;  3J80 Z;  2PJP A;  2QEN A;  4ENK A;  4XLP F;  2GXG A;  4L9V A;  1ZRE A;  2HZT A;  5BPI A;  3GZ6 A;  1XMA A;  2ELH A;  3R6S A;  2P7V B;  1YLF A;  3LQR A;  1E17 A;  1IAW A;  3QU6 A;  3SZT A;  4HZF A;  4HF2 A;  4OIR F;  2VT2 A;  3O2P E;  5AIP A;  1SD6 A;  3WE3 A;  4GCV A;  2H6C A;  3DPT A;  1LDK B;  3ABU A;  5ICC A;  4HF0 A;  2CWE A;  2E7W A;  4JBA A;  4BAY A;  4L9J A;  2DBB A;  4M6X A;  2K4B A;  1DUX C;  2HKX A;  3GEZ A;  3V7C A;  1XMK A;  3DXJ F;  1YQA A;  2XIG A;  1SAX A;  1HKS A;  1FBQ A;  2VOP A;  1F9N A;  5D5X B;  2X0L A;  1YW8 A;  2EV5 A;  2XKP A;  3FMS A;  4AD9 A;  3F23 A;  1ZRD A;  2F5E A;  1OR7 A;  2LKP A;  2L54 A;  1SD5 A;  2PQ8 A;  2Z99 A;  1VTN C;  4RAZ A;  5D5W B;  3CO7 C;  4I2O A;  2V1U A;  2ACJ A;  1BI2 A;  1HW5 A;  2DAO A;  1ZH5 A;  1BI3 A;  2F2E A;  2Z3Y A;  2COM A;  1IUY A;  2ESH A;  2MH9 A;  4PGH A;  5CVI A;  1HXD A;  3LA3 A;  1ON1 A;  3GFJ A;  5AIQ A;  1QGP A;  1ZAR A;  1S29 A;  2Y0M A;  3I64 A;  4YG2 F;  2CGP A;  3DPL C;  2JSC A;  3CTA A;  1LEB A;  4IJA A;  3GUD A;  2FF4 A;  5L3C A;  4ZZL A;  4FHT A;  4UV8 A;  3E97 A;  1TW3 A;  3CLO A;  2MA3 A;  3N4M A;  4U0W A;  2OU2 A;  4HDU A;  4EJV A;  5LLQ A;  2EFP A;  2FEZ A;  3MZY A;  1LDD A;  4FX0 A;  2ZCW A;  1H9G A;  4HQM A;  4NB5 A;  5D5U B;  2AS5 F;  1ZG3 A;  3W6K B;  3V4G A;  4HOB A;  2FBI A;  4I02 A;  1LDJ A;  1TNT A;  3WTV C;  1OYI A;  2H94 A;  2FA5 A;  3V7S A;  2DI3 A;  1TQM A;  2XAH A;  2XHK A;  2H27 A;  2QZ8 A;  3HSF A;  2HFH A;  2NRA C;  1OPC A;  1CF7 A;  1XDS A;  3H3Z A;  1ZAO A;  3R0J A;  3OV8 A;  3Q5F A;  3H92 A;  1WQ2 A;  1R1V A;  4CIC A;  3RI4 A;  2GAU A;  4IRH A;  5CVJ A;  2Q2E A;  5DCM A;  2M1B A;  4GYG A;  5E1Z B;  1TQP A;  4XLN F;  3VOE A;  2QVO A;  1B9N A;  1IN6 A;  3WTU C;  4OIO F;  2YX7 A;  4EMS A;  3JSO A;  4O5V A;  2H6B A;  3WG9 A;  1FP1 D;  1CF7 B;  5K5R A;  1YO5 C;  3F3X A;  4UV9 A;  3QRF F;  4KNY A;  5LEJ A;  2FBH A;  4HA8 A;  2XAJ A;  2J5O A;  4NHJ A;  1QZY A;  1ZLJ A;  5DCM B;  2HYF A;  3T8R A;  1HSJ A;  5DV5 A;  1G3Y A;  5CJ9 A;  2G7H A;  2KRF A;  1HKQ A;  4EM0 B;  5DDG A;  3ZQ7 A;  2VBZ A;  5ED4 A;  4A12 A;  1PUE E;  1SFE A;  4KUM A;  2MC3 A;  5TJJ A;  3ABT A;  5D8L B;  1ZG1 A;  3SHF A;  5BOX A;  4GYI A;  2O3F A;  1R22 A;  1XDU A;  5D6F A;  4HV6 A;  5LRR A;  3RJP A;  1FC3 A;  2XUB A;  2GXB A;  3C3W A;  3BP8 A;  3W6J B;  2W24 A;  5L3D A;  3E6C C;  1P6R A;  1Y0U A;  3MEX A;  5IT3 A;  4KIG A;  3M8E A;  4LLG F;  2P8T A;  3KP4 A;  3EDP A;  1Z1D A;  2IT0 A;  3NRV A;  4UVB A;  1U8R A;  1YW9 A;  1EH6 A;  2ZXJ A;  5L3B A;  4L0Z B;  2PMH A;  1FP2 A;  1GXQ A;  2KIF A;  2EV0 A;  4MHG A;  2W25 A;  5EEH A;  3F72 A;  1MDM A;  2UWM A;  1FBU A;  3FXR A;  1ODD A;  1OKR A;  1LVA A;  3IRR A;  3P9I A;  4UVC A;  2E7X A;  3I0T A;  4IRI A;  5LGN A;  3IL2 A;  3MCZ A;  5E17 F;  5LRS A;  1QQI A;  4BYY A;  4YIF A;  1SD4 A;  3FHZ A;  1HBX G;  5FFX A;  3DFG A;  4G6Q A;  4EM2 A;  1MDM B;  3KFW X;  4P9F A;  2EV6 A;  5HVQ C;  3TOA A;  4MNU A;  2CQK A;  3ZMZ A;  4M73 A;  4Q5S F;  2OA4 A;  2DPD A;  4BXU A;  2GIV A;  2DW4 A;  1UCR A;  3DEU A;  5E1W A;  3IHU A;  3L00 A;  2BBY A;  4IRG A;  5HS9 A;  1R36 A;  3T5X A;  4HAM A;  3VFZ A;  4EM1 A;  2QQB A;  2Q8K A;  4RB1 A;  4E70 A;  1UST A;  4HDV A;  5DUK A;  1UHW A;  4HF1 A;  1B4A A;  4UNO A;  4M6Y A;  3KLN A;  1UHM A;  1W7P D;  4ESF A;  5K5Q A;  4ENN A;  2CO5 A;  5IT9 K;  2WC2 A;  3B02 A;  1RNL A;  4UVA A;  2STT A;  2LNB A;  1BJA A;  2VOD A;  3FZV A;  3DF8 A;  2IP2 A;  2VXZ A;  3EYY A;  1JXS A;  2CYY A;  2WV0 A;  2IJL A;  3RKW A;  5HDK A;  3MQ0 A;  4HQE A;  2FXA A;  5DD4 A;  5HOO A;  2HR3 A;  2BYV E;  4EVI A;  3N97 A;  1ULY A;  1W7P A;  3ROU A;  1QBJ A;  2HQR A;  1MZB A;  1RI7 A;  5BS6 A;  1JHF A;  3HRS A;  3V7R A;  5BQT A;  1G3T A;  2HS5 A;  1ONV A;  1FZP B;  2D2W A;  5FFZ A;  2EFN A;  3E6D A;  1KQ8 A;  2FMY A;  1RIO H;  5E18 F;  1XGS A;  1MKM A;  5D8K B;  2K7L A;  5ICG A;  2A07 F;  3T8T A;  2VBX A; 
#chains in the Genus database with same CATH topology
 2JZY A;  1HA8 A;  4OAY A;  1Z6T A;  5KNL A;  2K3F A;  5L3G A;  3O3K A;  1FY7 A;  4AWX B;  4MFE A;  4XR6 A;  2TDX A;  3M7G A;  4F7Z A;  3PIO F;  5GAG J;  1W7P B;  1V3F A;  3F22 A;  2XAG A;  1FLI A;  2NOG A;  1MH3 A;  2IGK A;  1P7I A;  2YSR A;  2JWT A;  3CCR I;  1BC8 C;  1MND A;  4G7H F;  3ZQG A;  1EJ9 A;  2PBI A;  2BGC A;  4XN3 A;  2DA5 A;  1MBG A;  1R9T J;  3CP2 A;  4CYD A;  2VQL A;  1GVJ A;  3WTS C;  2YS9 A;  2VJ4 A;  3GFL A;  2ZSH B;  3VOD A;  3TP0 A;  5J1Y A;  3HRT A;  1OYY A;  1S5L C;  4UY8 I;  2ETH A;  2BXY A;  2VJ5 A;  3HTU A;  1I1S A;  3JR9 A;  3CDH A;  3Q0W A;  3LSP A;  3LL7 A;  1Z21 A;  2LR8 A;  4CCN A;  3OYG A;  2HYG D;  4BHC A;  1BR4 A;  3ZQI A;  3A01 A;  1G4D A;  2E2J J;  5K1Y A;  2O6G E;  2W4S A;  2EFW A;  2VKH A;  1JI8 A;  4DW6 A;  1A6Q A;  2UZK A;  3S1Q J;  1OYW A;  1YHQ I;  1SMY F;  2JPC A;  3FXK A;  1X1C A;  3SEQ A;  1EH8 A;  3DKW A;  3LQQ A;  3TO6 A;  3CC2 I;  1JGS A;  2EIN H;  4RGS A;  5E3M A;  4G9Y A;  3J7Z I;  2OQR A;  2Y30 A;  1D1A A;  4DYR A;  3VWB A;  4F93 B;  3KP5 A;  3S14 J;  3IWF A;  4QLC U;  4CSW A;  4OMY A;  1H9T A;  3FF5 A;  3MFK A;  5B66 C;  3HOS A;  3G1O A;  3PQJ A;  4ANJ A;  2E36 A;  2DQR A;  3K0L A;  2HQN A;  2HOT A;  4BBS J;  3AFH A;  4BY1 J;  1QPI A;  2E1N A;  4C2M J;  4UB8 C;  2VQC A;  4OIQ F;  2CW0 F;  4V2G A;  4LMY A;  1XS9 A;  3S3N A;  4X0G A;  4KT5 C;  2MW8 A;  3LFK A;  5CVV A;  3HOZ J;  2EK5 A;  1JT6 A;  4A3D J;  3A01 B;  3M3Y J;  1DP3 A;  1FNN A;  2VBW A;  2LG4 A;  2AQF A;  2CJJ A;  2CW7 A;  2M2E A;  2LLK A;  2WTE A;  4U7D A;  3OYE A;  4EGY A;  4BNC A;  1W5C C;  5DCF A;  2P5L C;  1U6G A;  3CQZ J;  2D1V A;  3CUQ C;  3WGG A;  1YIO A;  1U0J A;  1B72 A;  2L7K A;  1SC7 A;  1ZQ3 P;  1Z7L A;  5JFR A;  4PJN A;  4C30 A;  3ZMD A;  4KYW A;  2DJN A;  2JVG A;  4R79 A;  2WWY A;  3OSG A;  1W36 C;  2XPU A;  2VT3 A;  2RDP A;  5JLW A;  1JJ8 C;  1TW2 A;  2MH2 A;  2KIU A;  4G6D A;  2R5Z A;  3HDD A;  1M1E B;  1I27 A;  1S7A A;  3CJN A;  1GHC A;  2DJI A;  4LG0 A;  5J1U A;  1MNM C;  1W5T A;  4CHU A;  2K9S A;  1E3P A;  1IN4 A;  2GWR A;  4RGR A;  4E7J A;  2VKE A;  3P7N A;  4EJW A;  1ETQ A;  2ZXI A;  2M4G A;  1VQ8 I;  4IEJ A;  4IVN A;  4AIJ A;  3O6B B;  1AWC A;  2TCT A;  4IHT A;  1GXP A;  1D0X A;  2R7F A;  3WTW C;  1R23 A;  1JJ6 C;  5FKK A;  5FD5 A;  2KKO A;  2LKS A;  2M87 A;  3G1M A;  2IXS A;  3HSE A;  3BJ6 A;  2QBY A;  1YX5 A;  3GTO J;  5FLX K;  2PMZ A;  4QTR A;  5L3F A;  2HDD A;  2KDZ A;  2QKM B;  1S6L A;  3CF5 F;  4I0B A;  3ZQH A;  1B72 B;  2LDU A;  2P6T A;  2JMW A;  3CP8 A;  1P92 A;  1IN5 A;  2L2O A;  3DKX A;  3MZ8 A;  3GYH X;  3KIO A;  2VQH A;  2FRH A;  1TNS A;  3KP6 A;  2R5Z B;  3J80 K;  2KHM A;  4LG0 B;  3K2Z A;  3BDD A;  5D4R A;  2RV8 A;  2OD5 A;  1GUU A;  3AL0 C;  2WA0 A;  1ETV A;  4MQV A;  2ZKZ A;  1ZYR F;  1QHG A;  1ZEL A;  1WKM A;  1RR7 A;  1XGO A;  3SZP A;  2NVY J;  3DEW A;  1NH3 A;  1USS A;  1T95 A;  3KYC B;  2R7D A;  2BVL A;  2VJI A;  2QQ8 A;  3RSN A;  3CO6 C;  3E5Q A;  1SFU A;  2EQR A;  4XMY A;  2RQP A;  1BOA A;  2W85 A;  2RC4 A;  3PUB A;  2ID3 A;  2X6X A;  3GLL A;  5GAE J;  1O57 A;  3HGG A;  3IP4 B;  2KJB A;  1TLH B;  1POG A;  1E2X A;  2UUZ A;  4F3Q A;  2O03 A;  2QBY B;  1D8J A;  1Z7U A;  3GLX A;  4A0X A;  5D5V B;  4Y4R A;  2IGM A;  3BJA A;  2ZFW A;  1I5Z A;  1Y6I A;  3OYB A;  3BY6 A;  4A0Z A;  1T98 A;  2X6W A;  1YIT I;  4OU0 A;  4P55 A;  1SVL A;  3PJR A;  2XAS A;  3DV8 A;  2Y48 A;  1ETO A;  5J8C A;  1XCB A;  4BDZ A;  3TBI A;  5B1B H;  1HDD C;  3ULQ B;  3V8J A;  4FCY A;  4L18 B;  2ICW G;  3R4K A;  1ZRC A;  3COA C;  4UUV A;  3HUG A;  2ECB A;  1B1B A;  4CO8 A;  4YFK F;  3IKT A;  5EZH A;  3E3V A;  2WY8 Q;  3K2A A;  2RRE A;  5EGO A;  4ZYH A;  4BL0 B;  1LJ9 A;  1SAN A;  2OC6 A;  3IRQ A;  3SXY A;  1VQ7 I;  3SEZ A;  1G3S A;  1OCC H;  4A3E J;  1YTY A;  2X6Y A;  3DU5 A;  3FXJ A;  3SFI A;  3O8H A;  2V1X A;  2HEO A;  1FBS A;  1P7J A;  1TTY A;  2RN7 A;  3QPT A;  3FMQ A;  3LSK A;  2ISZ A;  1STZ A;  1N78 A;  2LF8 A;  1G3W A;  2F4M B;  4B48 A;  5E79 C;  2R7Q A;  5FRO A;  2STW A;  3BTJ A;  2VUM J;  3REO A;  4LIT A;  2Q0O A;  3NAR A;  5B1A H;  2H09 A;  3F21 A;  2R92 J;  1HW2 A;  1O3S A;  5K5O A;  1IDZ A;  3E6M A;  3FM3 A;  2OQG A;  3LAP A;  1RRJ A;  4M9X A;  2M3A A;  3S16 J;  2VAS A;  1MJB A;  3H0D A;  4YFN F;  1V4R A;  3TGN A;  2PFB A;  3H9G A;  1DGW Y;  2KMU A;  3DBR B;  1EF4 A;  4G94 A;  2V9K A;  3FMR A;  1K7A A;  5DS9 A;  3HUG B;  2DPU A;  2X48 A;  2VKV A;  3Q3S A;  3CLQ A;  1K4S A;  2HXO A;  3R60 A;  4KIF A;  2WAQ A;  3OOP A;  3A2K A;  1WJF A;  5EGO B;  1W36 D;  2JA8 J;  3OYI A;  1R5G A;  4KDP A;  1ETX A;  4IHX A;  5FD6 A;  3HPG A;  4L5I A;  2IS2 A;  1BOB A;  3H9Q A;  3CJQ B;  2M30 A;  1G59 A;  1O7F A;  3R61 A;  2HVR A;  3CJT B;  4CZZ A;  2K5C A;  2CUZ A;  3DBL B;  3JCU C;  2OV7 A;  3QP6 A;  4CCJ A;  2CV0 A;  3MZH A;  3EYI A;  1XD7 A;  1U2W A;  4XKB A;  2EFO A;  1CGP A;  2YX4 A;  1IXC A;  3KEQ A;  3LWF A;  5L3E A;  1K78 A;  1TWG J;  2MBF A;  2ELK A;  1MBH A;  2EZK A;  4WX9 A;  2ZNZ A;  5KAF C;  1MNE A;  1FYL A;  2Y0S N;  4NC6 A;  1XX5 A;  3WHC A;  3I53 A;  2MLK A;  1KYZ A;  4NQW A;  3WTY C;  4WXD A;  4E7K A;  2P6S A;  2F5D A;  3GX4 X;  2J5P A;  1FJL A;  6PAX A;  2Z5U A;  5F1J A;  1H88 C;  1ZG5 A;  1HW1 A;  5ILV A;  2GLO A;  3BTL A;  2FNP A;  2ADU A;  5CQG A;  5F0H A;  3QYB A;  1IO2 A;  1K61 A;  4Q47 A;  2Q1Z B;  4B1R A;  1ITY A;  3S2D J;  2OPT A;  4XOP A;  3QQA A;  2EIL H;  3KP7 A;  1TWH J;  3S15 J;  2XPV A;  4M9Z A;  2K85 A;  2DT5 A;  5JR3 A;  2QUF A;  4ASN A;  4IHW A;  4P96 A;  2IGO A;  3HHH A;  1QPM A;  3M4O J;  1A6I A;  2L01 A;  3G4S I;  5E20 A;  1MBE A;  1D3Y A;  2M8E A;  4EJO A;  4BQQ A;  2QSF X;  3CCL I;  4A2U A;  1XMX A;  3I56 I;  2KFD A;  1IXS B;  3RYR A;  4AYB N;  1GV2 A;  1Q1V A;  3RDI A;  3TDZ C;  3MVP A;  3FWE A;  3JTG A;  1NHA A;  2V79 A;  1XGM A;  5C4J J;  2AXT C;  4DBQ A;  5C3E J;  2R0Q C;  2DT6 A;  2ESN A;  4NQW B;  2E19 A;  2FQ3 A;  1T0F C;  4MQ9 F;  2HTJ A;  3HM5 A;  2R7T A;  4FET A;  2DTZ A;  2A3S A;  2K86 A;  3WTT C;  4YEL A;  4QPQ A;  1W4M A;  3FBI B;  2NVT J;  2W7N A;  1IRF A;  2LH9 A;  1XTA A;  3GF2 A;  1BIA A;  3GVA A;  3CCU I;  3QAH A;  2W00 A;  2K9M A;  4M9S A;  1HF0 A;  2ZME C;  1TC3 C;  4Y33 A;  3PO3 J;  2V9V A;  3E5X A;  3CCQ I;  1MJA A;  1IJW C;  2MD5 A;  2IPQ X;  3QP5 A;  3GW2 A;  1LPQ A;  4W97 A;  5F0F A;  2P81 A;  5IYD J;  2DTR A;  2ZO4 A;  1MD0 A;  1D1B A;  2DA3 A;  2UXN A;  4R1H A;  1O3T A;  3PNT A;  1MMA A;  1HCR A;  1QU3 A;  5ILU A;  1KA8 A;  2W84 A;  4II2 A;  4H4K C;  3S3M A;  3DP7 A;  5H20 A;  3ELK A;  3VPR A;  1TT5 B;  2R7U A;  5FJ8 J;  3CUO A;  4ZYG A;  3V8L A;  3L2C A;  4BE1 A;  1R5I D;  2PN6 A;  4YFX F;  3BCB A;  4F91 B;  2K3P A;  4I99 C;  1XB4 A;  2L3D A;  3WGH A;  4PFO A;  3FK6 A;  1HKT A;  4ESJ A;  2K9L A;  1XSX A;  3NEU A;  4HX4 A;  4PDK A;  2IS4 A;  3B73 A;  3ECH A;  2LMD A;  3CUQ A;  4XRM A;  1FX7 A;  1YE9 A;  4KJZ A;  2IRF G;  3BR5 A;  3M1E A;  1KU7 A;  3TP3 A;  1BM9 A;  2DN0 A;  2M45 A;  3CME I;  5ERI A;  1OR7 C;  2F5F A;  1Q1H A;  2BZT A;  4Y13 A;  2K40 A;  1O3R A;  2VE9 A;  3E6B A;  3J81 Z;  1R1T A;  4RAY A;  1U8B A;  2ZBK A;  2DFE A;  3M9A A;  2KQR A;  2LVS A;  2QWW A;  3SFZ A;  5JVT A;  3HG9 A;  2XRO A;  4YRV A;  5KVR A;  4I01 A;  2LFB A;  2DT7 B;  4KIS A;  2XRL A;  5HS8 A;  2N8G A;  5KCM A;  1R49 A;  1Y1W J;  3H5R A;  1E0E A;  1X58 A;  3G3Z A;  4QWQ A;  3FXL A;  5TIS C;  5BNG A;  3S8P A;  4IO9 F;  3CC7 I;  3A0H C;  2EJR A;  3F6V A;  4BQN A;  2X1D A;  1UB9 A;  1J75 A;  1QHH D;  2MGQ A;  5DTD A;  2BY2 A;  2IA1 A;  2RNJ A;  2HU9 A;  2X6O A;  2NS8 A;  1ACI A;  5HNF A;  1KU9 A;  1FOY A;  2JJ7 A;  2M7B A;  2V6E A;  3NWT A;  3S1R J;  4XOR A;  3CUQ B;  4ZH4 F;  2QYO A;  4CDG A;  1N25 A;  3H3V K;  4HX8 A;  5M5Y J;  3KCC A;  3U1D A;  4EQQ A;  3MKZ A;  2P7C B;  2CRG A;  2VN2 A;  3BG7 A;  4DYQ A;  5IOZ A;  1Z9C A;  3KET A;  4P5O A;  4DGW B;  2GIZ A;  4CCO A;  4JQF A;  2YU3 A;  4M3F A;  3RIR A;  1UJ8 A;  2EB7 A;  4IKF A;  1RES A;  2M7A A;  3OSF A;  1HC8 A;  4M3D A;  1F1Z A;  3KP2 A;  4Y7N J;  4MTE A;  1FIP A;  2KIQ A;  3FBN B;  2VOO A;  4XBF A;  1LKX A;  3E7L A;  1K6O A;  2G7U A;  4LD5 A;  4A6D A;  4GFB A;  2M0C A;  2QQA A;  1DU0 A;  4WF2 A;  3DEE A;  5HLI A;  1KU2 A;  1J2X A;  2LBF A;  1LFU P;  4A3F J;  1FYM A;  1RKT A;  4RM2 A;  4U7B A;  3F8C A;  5FKN A;  3K1P A;  1C0W A;  3MAJ A;  3H0G J;  3H5A A;  3C7J A;  3TDU C;  3OYH A;  4HST A;  2R7O A;  1UG2 A;  3OYA A;  4L9N A;  2QCO A;  4OOI A;  2OUM A;  1WPK A;  3HTS B;  1O4X A;  4MEX F;  2EBI A;  3PQK A;  2H8W A;  1X3W B;  3NQO A;  3FDY A;  3ABK H;  2HWV A;  2C6Y A;  4MEY F;  2LSO A;  4IXA A;  3OYM A;  3KLO A;  4XKW A;  1P2F A;  3ZN0 A;  4RB2 C;  4EJT A;  1VQN I;  3ZMT A;  2IA2 A;  1XSV A;  5EYR A;  1WWX A;  3RPQ A;  4IX7 A;  3SYT A;  3M8J A;  1MJ9 A;  1XC5 A;  3HOT A;  5J47 A;  5EG0 A;  3IV5 A;  1WJB A;  3UKG A;  3WU0 A;  2E1C A;  2DA7 A;  3F6O A;  1IG7 A;  2H8R A;  5F1R A;  1WJD A;  4HBL A;  1APL C;  2HDC A;  4BGD A;  3IKV A;  4U0V A;  4B47 A;  2BEO A;  2V6C A;  2FU4 A;  4LGW A;  2ZC2 A;  2DU9 A;  2L9V A;  3BG5 A;  4U87 A;  4BE2 A;  1BW6 A;  3P5J A;  4KN7 X;  2Y75 A;  4ENM A;  2A6T A;  2DO7 A;  3K69 A;  2DK8 A;  3BOQ A;  2EH3 A;  1XSD A;  4S05 A;  2DYS H;  2Y9Y A;  5CKT A;  4LG3 A;  5GAD J;  5LBQ A;  3OL3 A;  1A36 A;  1LFB A;  2G9W A;  4A5M A;  3JAM K;  3FM5 A;  2DMT A;  4LFU A;  4P1W A;  4DOZ A;  3BTI A;  4Y15 A;  1DPR A;  5EJC A;  2VJJ A;  2PLY A;  4M3E A;  2E1M C;  2GZW A;  4L5J A;  1TQI A;  1K6Y A;  4QIW N;  4IHY A;  2YUS A;  1J7K A;  5EG0 B;  1U5T C;  2JA2 A;  4FX4 A;  1QVT A;  2K27 A;  3HOX J;  3S1M J;  1OCZ H;  4Z6Y A;  2E71 A;  4NNJ A;  5C4X J;  4TV7 A;  3BR3 A;  2CFO A;  1O3Q A;  1JUP A;  2FX0 A;  3GZN B;  4WXC A;  3U1K A;  2BOL A;  3C1D A;  2EWN A;  4B3X A;  2D1H A;  5H6R A;  1J0R A;  2WY7 Q;  2YR2 A;  2L9N A;  3NWS A;  1J5Y A;  2UV1 A;  2RVC A;  4PFP A;  5J1R A;  3KPH A;  3G71 I;  2VE8 A;  2JPB A;  5F08 A;  4RS8 A;  3IH2 A;  1OFC X;  3RQ4 A;  5FLX Z;  3ASO H;  4CCK A;  4WCG A;  2GBY A;  1FMV A;  4JYK A;  2CQN A;  2L7F P;  3Q0U A;  1P4A A;  2ZJP F;  2OBP A;  2RGV A;  3HC7 A;  1B8I A;  4FT8 A;  3FK7 A;  3AG2 H;  2OZ6 A;  4B09 A;  4LJZ F;  1KQ0 A;  4XIC A;  1W0U A;  1VQ4 I;  3WTZ A;  5CLS A;  4G8X A;  3P9K A;  4W1U A;  5F27 A;  2DA2 A;  4BUP A;  5LGU A;  4BH9 A;  3CMY A;  5TGT A;  1X3U A;  2EA4 A;  3U9G A;  3ABM H;  3GFM A;  4M74 A;  1ENH A;  2XAQ A;  3ZQC A;  3DPU A;  2ECC A;  5B5E C;  1JE8 A;  2HOE A;  1QNT A;  4XID A;  3RKY A;  1X1P A;  5GTI C;  1T2K A;  3EUH C;  5HLG A;  2Z2S B;  3MD2 A;  3BZ6 A;  2QGU A;  1FSH A;  3LA2 A;  4E7S A;  2NVQ J;  4E4H A;  2KPM A;  3BR0 A;  4ENJ A;  3C2G A;  3V8K A;  1FWZ A;  3GZ5 A;  5H2F C;  1YS6 A;  3ZPL A;  2XF5 A;  5GP9 A;  1T0F A;  4M72 A;  4N9H A;  4H0E A;  1BW5 A;  1WRJ A;  4KA4 A;  1TL8 A;  2V1D A;  2P4W A;  1JKO C;  2ZJ2 A;  1G6N A;  2HVQ A;  5DD8 A;  1HQC A;  5EZG A;  3ZRG A;  4F92 B;  1SMT A;  2K9Q A;  1RET A;  4E7L A;  3DQV C;  4CCL A;  4C3J J;  2E60 A;  2X4H A;  3PL8 A;  2JUG A;  2PG4 A;  2CFX A;  2GA1 A;  4LOC A;  1B8I B;  2YPR A;  1VFC A;  2XB0 X;  2CUE A;  3BZK A;  2R7Z J;  1IF1 A;  1RR8 C;  2ZME A;  2NXN B;  5IYB J;  3EPZ A;  2P5K A;  1ZKG A;  2R93 J;  3I4M J;  5D6E A;  4II3 A;  1TWF J;  2NS7 A;  1ZLK A;  2PI0 A;  5LEK A;  2R5Y A;  1XGN A;  4C2T A;  3K4N A;  3GO5 A;  3U2R A;  4AIK A;  1R1U A;  1JKR C;  1JTY A;  1YJW I;  5IP9 J;  1F5T A;  4A6E A;  2JRM A;  1MW7 A;  1KGS A;  3KZZ A;  1OCT C;  1TBX A;  3SDB A;  4O6J A;  4ZYE A;  5A2Q K;  3OMY A;  2E2H J;  2PMU A;  1V55 H;  2Z16 A;  4C3I J;  1MH4 A;  1K83 J;  1BN5 A;  1FPQ A;  2CG4 A;  1AOY A;  5K7Z A;  1PP8 F;  2DXI A;  5LHI A;  2VQG A;  4LLN A;  4D5F A;  1LEA A;  3K1M A;  3Q9S A;  5ICF A;  4IOC F;  2DMP A;  4PJL A;  1FMW A;  5CVR A;  1YG2 A;  3HYI A;  4ZYD A;  4J01 A;  1MGT A;  2DMN A;  4IPA A;  2VON A;  3FX3 A;  2ZXW H;  4YII A;  4RGX A;  1LNW A;  3E1S A;  5TRD A;  3VYS B;  5DEQ A;  4E7H A;  2MLG A;  2ZME B;  1NG7 A;  3EQL F;  3M07 A;  5EF6 A;  3FXU A;  4N9I A;  1OCP A;  3FIW A;  2JA7 J;  4XSZ F;  2PMZ N;  1W5S A;  2LY9 A;  4DNC A;  2OTL I;  1N75 A;  4FIS A;  2F4I A;  2Z1D A;  5E1X A;  1Z67 A;  1WJA A;  2R5Y B;  3LAJ A;  2DK5 A;  5IPA A;  3BRO A;  3S1N J;  3Q0V A;  1I1G A;  4HYE A;  4BHP A;  3KZI C;  4ZZD A;  1BC7 C;  2FOW A;  1T8I A;  2QA4 I;  1VQO I;  2KZV A;  3KEO A;  1VQ6 I;  4A3G J;  4A3C J;  1K4T A;  1SVM A;  2O8K A;  4CGZ A;  2XAF A;  3RQI A;  4N0B A;  2P5V A;  3JRG A;  4NDL A;  1Z3Y A;  2EIM H;  2LYC A;  5EEG A;  1ZGJ A;  3ERM A;  3I3L A;  1RZ4 A;  1UG0 A;  2L4M A;  4B4C A;  1IRZ A;  4ESB A;  3W2W A;  3QOD A;  2IGN A;  3PO2 J;  2FSW A;  3NAU A;  1R4M B;  2O61 A;  5CYV A;  2COB A;  1AKH A;  3KZY A;  4N4O B;  2HTS A;  2XRN A;  4EEF G;  3JRC A;  2GA2 A;  2V4J C;  4RBO A;  4IF4 A;  4A3M J;  4E7I A;  3PFY A;  3K70 C;  2NS0 A;  2VPR A;  1K79 A;  5GAH J;  2A5W A;  4DQ2 A;  4BXF A;  3OYN A;  2A6H F;  3ISP A;  2L02 A;  2X1E A;  3ZMS A;  4RA2 A;  3K9T A;  5JVG F;  2DLL A;  4K2E A;  2O0Y A;  1U3E M;  1VQ9 I;  4BJ5 C;  4RMN A;  2JVH A;  3JRA A;  2FML A;  2VI6 A;  1KYW A;  3RPU D;  2BV6 A;  3BT9 A;  3K6G A;  4FAS D;  1S3J A;  2CQQ A;  3ERE D;  3ZMU A;  1WZ2 A;  3OYC A;  2M0M A;  3JW4 A;  2M5W A;  1UHS A;  1Z0X A;  4ZDO A;  2GOX B;  1SEU A;  3TKY A;  1QZZ A;  5F04 A;  2XGX A;  4OIP F;  1IRG A;  5JLX A;  3OS2 A;  1DGR M;  1R7J A;  2FJ1 A;  2DOE A;  1AKH B;  1F4K A;  2OCE A;  1FIA A;  3FHN A;  2L4A A;  4KFC A;  3PM1 A;  4UXN A;  5FGM A;  4IHV A;  1Y0N A;  3EET A;  4Q4Z F;  1UMQ A;  2DFI A;  5BMZ A;  5IOY A;  4KMF A;  3QPL A;  4MTD A;  2R7X A;  4BDY A;  4Q48 A;  2IEK A;  3X2Q H;  1EKE A;  4I09 A;  4LK1 F;  2ZJR F;  4KIC A;  2BE5 F;  5F6F A;  3L09 A;  4A3J J;  1OCR H;  3OS1 A;  4LIU A;  3ZMV A;  4G7O F;  3F8B A;  5LGT A;  2ZXH A;  3ZP5 A;  1O7L A;  5KAI C;  4AC0 A;  1Z6R A;  3RPU A;  2WAQ N;  4LB5 A;  4X1E A;  4AID A;  1ZK8 A;  3BG6 A;  1VF9 A;  4BE0 A;  3HRM A;  4IZZ A;  1BI0 A;  2A5Y B;  3MKY B;  5FLV A;  2JRT A;  3MMY B;  5HDG A;  3JRI A;  4A3K J;  1IC8 A;  3C18 A;  3TOB A;  3ZGK A;  2FE3 A;  2PJR A;  3OYD A;  3K4C A;  3UNG C;  2JT1 A;  1Z91 A;  5CVU A;  3KP3 A;  3F8M A;  2CW8 A;  4ZYA A;  4OIN F;  4S0H B;  3FXQ A;  1R4N B;  4AVP A;  3G2B A;  4BHB A;  1ZGW A;  1F36 A;  3IC7 A;  1SFK A;  1X1D A;  4KMU X;  3F8F A;  4QPO A;  3CCS I;  4HRI A;  3TO7 A;  1YS7 A;  3BJO A;  3RCO A;  2K4J A;  4AUX A;  4WWC A;  4WK8 F;  4JK1 X;  3ZQF A;  1GV5 A;  2QLZ A;  4EJU A;  1ZGA A;  2PEX A;  4MGR A;  1UEL B;  1XN7 A;  2Y0S A;  1JGG A;  1U5T A;  4I7H A;  4GGG A;  3G73 A;  2PX9 A;  1PUF A;  1JKP C;  2OF7 A;  5GTH C;  2CUF A;  2NNY A;  4ZDP A;  1CQT A;  2ME6 A;  4PSX A;  2LF7 A;  3MWM A;  3QWL A;  3D1N I;  1E3O C;  5DYM A;  1Z77 A;  5HNH A;  5KHD A;  2D45 A;  2OZU A;  3BC8 A;  1B59 A;  3LSR A;  1IN7 A;  1DPU A;  5HLH A;  4L0Y B;  1EV7 A;  5E8G A;  2L9R A;  1MSF C;  1L3L A;  5FRN A;  3H9J A;  2FBK A;  1K78 B;  1RUO A;  1IXR C;  3ECO A;  2O8X A;  1WJE A;  3OIO A;  2UXX A;  3ONQ A;  1T38 A;  2MG4 A;  2H1K A;  2QF7 A;  5CPR B;  4S04 A;  3D5L A;  2HPI A;  3I5U A;  4GXO A;  4BKX A;  1I3A A;  1X2M A;  2IBD A;  3OYF A;  4DIQ A;  2E1M B;  3I55 I;  5FO5 A;  4KN4 X;  2EZL A;  5IP6 A;  2EA2 A;  4AYB A;  1KQ9 A;  2A68 F;  3N05 A;  2VB6 A;  1JHH A;  1P4X A;  4ON0 A;  4RLQ A;  1U5T B;  4BJT A;  5J8F A;  5LFA A;  4D9J A;  3KEY A;  3JTH A;  2R3S A;  1PUF B;  4XNF A;  4HV5 A;  4BAC A;  1A04 A;  1ZN2 A;  2A61 A;  2XPW A;  2M34 A;  3KE2 A;  2VL8 A;  5M3F J;  1LB2 A;  4E6K G;  3H5N A;  4XLA A;  1DP7 P;  1TWC J;  3VSL A;  3WU2 C;  1S8N A;  2AXL A;  2OTJ I;  5CQE A;  3S2W A;  1BL0 A;  9ANT A;  2NVX J;  3EUH A;  4AIH A;  2CSO A;  2HXI A;  3RYP A;  4BQA A;  3ZN1 A;  5HS7 A;  1R6R A;  4CXF A;  1LVK A;  1S7O A;  4RB0 A;  2IVM A;  4HX7 A;  3I4N J;  1UZC A;  3T0Y A;  1HST A;  4HLX A;  4D7N A;  3BPV A;  5F0C A;  3J7A O;  4A3L J;  3S3O A;  3JRE A;  4Y17 A;  3GTK J;  1Z05 A;  3RKX A;  3JSP A;  3L1P A;  4EGZ A;  5J6X A;  3BPX A;  3L7W A;  2EFQ A;  4XL9 A;  5IT9 Z;  1FSE A;  3F8N A;  4B8X A;  4F52 A;  1S72 I;  1X1A A;  3L9F A;  3VEP A;  1R58 A;  2VIX A;  1H0M A;  3FXM A;  1NG6 A;  5EEA A;  4AM3 A;  3T1B A;  3B6A A;  1YW7 A;  4I6Z A;  3TW7 A;  5DM7 F;  2LY2 A;  2EPF A;  2DFH A;  3R0A A;  4IHS A;  5IP7 J;  2ZNY A;  5H6Q A;  1SD7 A;  3DTE A;  1PDN C;  2DOD A;  1R00 A;  4ABZ A;  2JSP A;  1WFX A;  2V26 A;  3WU1 B;  5E3L A;  1S9H A;  4M71 A;  2HOS A;  4UB6 C;  5F64 A;  3WTX C;  3AAF A;  3HIF A;  1FYK A;  5EDN A;  3B6C A;  3W3C A;  1OIS A;  5FB2 A;  4LB6 B;  2L7Z A;  1IZ1 A;  4XK4 A;  4OMZ A;  3QOP A;  2ELJ A;  1WGX A;  1BR2 A;  2LP0 A;  4WXH A;  3WE2 A;  3LMM A;  3RTR A;  4KIT B;  1VQK I;  4O3M A;  3A03 A;  3AG4 H;  1T56 A;  2NNN A;  4ETS A;  1YFH A;  4LK0 F;  2XB5 A;  1D0Z A;  2RKH A;  5HDN A;  1D5Y A;  4HNT A;  4P9U A;  3JRB A;  2A05 A;  3JAM Z;  4XRF A;  3GFI A;  1RUN A;  1ZHF A;  2L0K A;  2AHQ A;  3QU3 A;  2L7M P;  3K70 D;  5LHH A;  1ZRF A;  5ILS A;  2JA6 J;  1LQ1 A;  2RNG A;  3LST A;  5DUI A;  1R5H A;  4CYC A;  1J9I A;  2XGD A;  3HSR A;  1MMS A;  2P0W A;  2OJE D;  3JRD A;  3OYK A;  4XQF A;  3L2U A;  3TQN A;  2GOM A;  1QO0 D;  2Z33 A;  1I6X A;  2NAZ A;  2WAF A;  4R8H A;  3I71 A;  4A5N A;  3JRF A;  5AON A;  4LLL A;  3GTL J;  1YOV B;  1X19 A;  2XKO A;  3GME A;  4EV0 A;  2XC7 A;  2OCC H;  4NC7 A;  3I59 A;  3SQN A;  4RB3 C;  1Y39 A;  3H3U A;  1V5G A;  4XLE A;  3HHG A;  2XV4 S;  4ZTJ A;  2DFF A;  4RGU A;  1AA7 A;  3DLA A;  5IY5 H;  3E5U A;  3HBL A;  1JUM A;  4PK4 A;  3BCA A;  1T39 A;  3ZCO A;  1SFX A;  2X85 A;  1REP C;  3OIP A;  4F55 A;  4XLH A;  2VBY A;  1IN8 A;  5KK1 A;  3PUF A;  4HW0 A;  3I9V 2;  1D0Y A;  3BWG A;  4BXX J;  3GWZ A;  3WGI A;  4PGG A;  3CDI A;  3VB2 A;  2WAE A;  1EH7 A;  1WH5 A;  2GQQ A;  5JI6 A;  4G7Z F;  2R7S A;  2A6E F;  2W57 A;  3LA7 A;  1D5V A;  3TO9 A;  4NC8 A;  2K02 A;  1D8K A;  2Y31 A;  1P4W A;  3BQZ A;  3AL0 B;  1BIB A;  1RKW A;  1GLN A;  1WJC A;  4U0Y A;  3G1L A;  3M8F A;  3OIQ A;  5JHF A;  2HQA A;  4JP0 A;  4XSX F;  1N77 A;  3IWZ A;  2KLO A;  3I59 B;  2FOK A;  2BY3 A;  2WB1 N;  4D0P A;  2HGC A;  3DKY A;  2XF7 A;  2LBF B;  5FKL A;  1T33 A;  3GCM A;  1DDN A;  3KX2 A;  1OMI A;  2F5C A;  3D0S A;  1PP7 U;  1KU3 A;  1FTZ A;  2Z9O A;  1L0O C;  1B6A A;  2FNA A;  3GTM J;  2DOA A;  3P9C A;  3BZC A;  4X6A J;  4HLY A;  1HDP A;  1ZTR A;  2I5U A;  3J81 K;  4PZJ A;  2R7V A;  4C2U A;  4KIB A;  1ON2 A;  3ML6 A;  1SVO A;  3HEF A;  4Y52 J;  2KRC A;  3I58 A;  1VQM I;  4PJM A;  2X51 A;  4PCQ A;  5BPD A;  3VYU B;  5JHU A;  1J59 A;  1BI1 A;  4B3A A;  2E2I J;  2X9D A;  2JA5 J;  1BBY A;  3SJM A;  3BR2 A;  1JT0 A;  1G2H A;  2ISY A;  2NYX A;  2A69 F;  5E8I A;  1ETY A;  2EIJ H;  3C2H A;  3HRU A;  2KJC A;  3HKZ N;  3PNY A;  2BHY A;  4L9T A;  3ZQQ A;  4D7M A;  1OJL A;  1UFM A;  4A0Y A;  4I0A A;  1B9M A;  4CH7 A;  5HOD A;  2HKO A;  4XN0 A;  2QQ9 A;  3WOD F;  1T6S A;  5A2Q Z;  3K1N A;  1WI9 A;  3HPH A;  2B0L A;  2LOO A;  2XVC A;  3K4J A;  5D4S A;  2MYS A;  3VDX A;  3G6E I;  2M9H A;  3QPH A;  3MN2 A;  2VC0 A;  2BXZ A;  2DMU A;  2HYJ A;  2JTV A;  4BBR J;  4QSH A;  1U78 A;  3A02 A;  2JUC A;  3TMO A;  1P9Q C;  3GTQ J;  4YEJ A;  1FT9 A;  4I98 B;  4U88 A;  5ICE A;  1ORK A;  3QYF A;  4XM3 A;  2EZH A;  1WSU A;  3CC4 I;  1SAU A;  2XF6 A;  3DBH B;  4UHT A;  4E7Z A;  2R7W A;  3GXO A;  4HNU A;  1MBK A;  3Q9V A;  3BQY A;  3L2W A;  3BLY A;  2ZB9 A;  1YYV A;  2DQL A;  2OAZ A;  3D5R C;  5LHG A;  2IA0 A;  3ESW B;  4GO1 A;  3IH3 A;  5FKM A;  1W0T A;  5FRM A;  3LSI A;  1IW7 F;  1XCV A;  2VC1 A;  3I4P A;  1Y1V J;  2KIM A;  4Z2Y A;  3PFI A;  3KYD B;  3FIS A;  2IW5 A;  3CDL A;  3I54 A;  2HDW A;  2QM3 A;  1FOK A;  3J80 Z;  2PJP A;  2IAI A;  2QEN A;  2RQQ A;  4UUS A;  3L2R A;  4ENK A;  4XLP F;  2QSG X;  4IQJ A;  4YIR X;  2GXG A;  5B3S H;  4L9V A;  1ZRE A;  4CA0 A;  1XG1 A;  2HZT A;  3OWT A;  3LSJ A;  3FKI J;  2V9P A;  3HXL A;  4RDU A;  4OAZ A;  1W1W E;  2BVM A;  5FLM J;  3LFU A;  5BPI A;  3GZ6 A;  1XMA A;  3JRH A;  2AQE A;  2ELH A;  3R6S A;  4PJJ A;  1VI0 A;  2HI3 A;  2P7V B;  1YLF A;  2W48 A;  1NK3 P;  3LQR A;  1E17 A;  3OY9 A;  1D1C A;  1IAW A;  3QU6 A;  3SZT A;  4HZF A;  4C9Y A;  3CCE I;  1NK2 P;  4HF2 A;  4OIR F;  2VT2 A;  1EA3 A;  3O2P E;  5AIP A;  1IRX A;  5M5X J;  1SD6 A;  3OS0 A;  3WE3 A;  3J7A Y;  2LC2 A;  4GCV A;  2H6C A;  3DPT A;  2DA6 A;  1VND A;  3OL4 A;  4IQ4 A;  1A31 A;  1GDT A;  2H1L A;  3FKJ A;  1OQY A;  2FD5 A;  4UUS B;  1LDK B;  3ABU A;  1IV6 A;  5ICC A;  4HF0 A;  4J00 A;  1LUJ B;  2CWE A;  2F6C A;  2LY1 A;  2KZG A;  2E7W A;  3LSG A;  4JBA A;  2O7O A;  3HJE A;  2LTP A;  4BAY A;  2CS3 A;  1GT0 C;  4L9J A;  2DBB A;  4M6X A;  2K4B A;  3BR6 A;  1DUX C;  2HKX A;  3GEZ A;  2DMQ A;  3V7C A;  1XMK A;  3DXJ F;  3UR3 C;  1YQA A;  1HLV A;  2XIG A;  2LK2 A;  1SAX A;  2DOF A;  1QA6 A;  1HKS A;  1FBQ A;  2VOP A;  1FEX A;  5J4Y A;  1F9N A;  3HL2 A;  5D5X B;  2X0L A;  3BR1 A;  1YW8 A;  2KL4 A;  2ID6 A;  2EV5 A;  3DU6 A;  1SFO J;  2XKP A;  2HZD A;  3FMS A;  4C3H J;  4AD9 A;  2DA4 A;  4AU7 A;  4XRS G;  3SZG A;  3W6V A;  3F23 A;  1ZRD A;  2F5E A;  2NVU B;  3F9K A;  1OR7 A;  2LKP A;  2L54 A;  1SD5 A;  2MD0 A;  2PQ8 A;  2Z99 A;  2WBM A;  1VTN C;  4RAZ A;  5D5W B;  1J09 A;  3CO7 C;  3LSH A;  2XDV A;  4I2O A;  2MFZ A;  3K4B A;  2V1U A;  3VYR B;  2ACJ A;  1ERD A;  1X2N A;  3E0J B;  4DZJ A;  1BI2 A;  2KIS A;  2O5R A;  1HW5 A;  3GTG J;  3W2A A;  2DAO A;  5M3M J;  1ZH5 A;  1BI3 A;  2F2E A;  3OOU A;  4JX5 A;  4CUG A;  2Z3Y A;  1KON A;  2F4O B;  2G0E A;  2COM A;  1IUY A;  2F48 A;  4A3B J;  2ESH A;  3O8G A;  2MH9 A;  3H35 A;  4ZDL A;  4PGH A;  5CVI A;  1HXD A;  3LA3 A;  1ON1 A;  3GFJ A;  5AIQ A;  1QGP A;  1ZAR A;  5E3O A;  1S29 A;  1WI3 A;  2Y0M A;  3I64 A;  1JKQ C;  3DCF A;  4YG2 F;  1BR1 A;  2QSH X;  1I39 A;  2CGP A;  2DYR H;  3DPL C;  3AG1 H;  4V19 K;  2JSC A;  3CTA A;  1LEB A;  4IJA A;  3GUD A;  2Y2Z A;  1IGN A;  4FE7 A;  3PNV A;  2CV2 A;  2FF4 A;  5L3C A;  2V1N A;  2CV1 A;  3DTK A;  2I8D A;  4FE4 A;  3ZXS A;  2CUJ A;  4ZZL A;  4ZTF A;  1TT0 A;  4I76 A;  3W2V A;  4FHT A;  3CMM A;  3E97 A;  4UV8 A;  4XON A;  4PSW A;  1TW3 A;  1KZH A;  2CMP A;  3K4M A;  3MKW B;  2GXA A;  4JOM A;  2GM4 A;  3CLO A;  2MA3 A;  4M3B A;  1FTT A;  3LOC A;  4U0W A;  3N4M A;  1A35 A;  2OU2 A;  4HDU A;  5GPA A;  4EJV A;  2VKD A;  2Y69 H;  1YX3 A;  4V2F A;  5LLQ A;  1MMG A;  2EFP A;  2FEZ A;  3MZY A;  1LDD A;  1WH7 A;  2D5V A;  2O9L A;  2MSY A;  3CCM I;  4FX0 A;  3V42 A;  4FQG A;  4G6T B;  2ZCW A;  1H9G A;  3DWL E;  4ZC3 A;  1FOW A;  2B7E A;  4HQM A;  4NB5 A;  5D5U B;  2AS5 F;  1ZG3 A;  3W6K B;  3V4G A;  4HOB A;  3QYE A;  2FBI A;  4I02 A;  1LDJ A;  1TNT A;  3ZR8 X;  3WTV C;  3OR1 C;  1OYI A;  2H94 A;  4BY7 J;  1YI2 I;  2FA5 A;  2X1C A;  4UUT A;  2LKX A;  3V7S A;  2B63 J;  2DI3 A;  1VQL I;  5K7H A;  1TQM A;  2XAH A;  2XHK A;  3ASN H;  4MO7 A;  5GPC A;  2H27 A;  1HOM A;  2QZ8 A;  3HSF A;  3HGY A;  2HFH A;  4PUS A;  2WV1 A;  3K4K A;  1V5F A;  1OPC A;  2NRA C;  4GDF A;  1CF7 A;  1JUS A;  1XDS A;  3TED A;  3H3Z A;  1ZAO A;  3R0J A;  3OV8 A;  1Y8R B;  3Q5F A;  1Y8Q B;  3H92 A;  4XRS A;  1WQ2 A;  2BY0 A;  1R1V A;  2JK3 A;  4PJ0 C;  4CIC A;  3RI4 A;  2LD5 A;  2GAU A;  4IRH A;  5CVJ A;  4A3I J;  2Q2E A;  5J4V A;  4AVZ A;  3MKL A;  4IL6 C;  2F5V A;  1GVD A;  1IUF A;  2M1B A;  5DCM A;  4ZJZ A;  2L9S A;  4MIM A;  3PIP F;  4GYG A;  5E1Z B;  1I50 J;  1TQP A;  3EUK L;  4XLN F;  1YRN A;  3VOE A;  2QVO A;  1B9N A;  2E5N A;  1VQP I;  1ETK A;  3RZO J;  3BTC A;  2HQ5 A;  1IN6 A;  1E3H A;  3S93 A;  3WTU C;  4OIO F;  3CZ6 A;  2YX7 A;  4EMS A;  2KP6 A;  3CES A;  5E3N A;  1MMD A;  3JSO A;  2HNH A;  4O5V A;  2H6B A;  4RAF A;  1V5E A;  5LD2 C;  1PYV A;  1RC9 A;  3S17 J;  1G8X A;  1OCO H;  3HB9 A;  2LRD A;  3WG9 A;  4XLC A;  3DTI A;  4D1Q A;  1FP1 D;  1DU6 A;  1JTX A;  3S32 A;  1CF7 B;  1BA5 A;  2BHZ A;  5HLT A;  5K5R A;  2DA1 A;  1YO5 C;  1X3Z B;  3F3X A;  3VSK A;  1QRY A;  4UV9 A;  4BJ6 C;  3QRF F;  4KNY A;  2CU7 A;  4FTH A;  5LEJ A;  2FBH A;  4HA8 A;  2YU9 J;  2XAJ A;  1MSE C;  4B43 A;  3CJR B;  2Q2E B;  2J5O A;  2AO9 A;  3L2Q A;  4NHJ A;  1QZY A;  1OLT A;  1AHD P;  2PJR B;  1ZLJ A;  2NOJ B;  5DCM B;  2HYF A;  3T8R A;  1HSJ A;  5DV5 A;  1G3Y A;  5CJ9 A;  2BY1 A;  4XKC A;  4BS9 A;  2EIK H;  4JX4 A;  1YRN B;  3HOW J;  2G7H A;  2KRF A;  1HKQ A;  3SDG A;  4B44 A;  1WHU A;  1BJZ A;  3HOU J;  3QOE A;  5IYC J;  3HOY J;  2E35 A;  4EM0 B;  5DDG A;  1X1B A;  3ZQ7 A;  2VBZ A;  1F43 A;  1ZR4 A;  2DDA A;  3OYL A;  3K10 A;  2R7R A;  1H89 C;  3CF2 A;  5ED4 A;  4A12 A;  1PUE E;  1X4P A;  3OYJ A;  1SFE A;  4KUM A;  2E1O A;  2MC3 A;  5TJJ A;  3ABT A;  2XGC A;  5D8L B;  1RPW A;  2V7F A;  5DM6 F;  1ZG1 A;  2IS6 A;  1PVE A;  3WHB A;  1AU7 A;  3SHF A;  5BOX A;  4GYI A;  2O3F A;  1R22 A;  1XDU A;  5D6F A;  2DDB A;  4HV6 A;  5LRR A;  1U9N A;  3RJP A;  1FC3 A;  2XUB A;  4XLF A;  2GXB A;  2BW3 A;  3C3W A;  2XGE A;  3BP8 A;  3BG3 A;  2W24 A;  4NUB A;  4OWR B;  5L3D A;  1P6R A;  1Y0U A;  3A4C A;  3W6J B;  5C44 J;  3MEX A;  3PSI A;  3E6C C;  5IT3 A;  3F0C A;  1UAA A;  3K4L A;  2LRE A;  2L5Q A;  4KIG A;  3M8E A;  4LLG F;  2RAE A;  2P8T A;  3KP4 A;  3EDP A;  1Z1D A;  2IT0 A;  3NRV A;  2WAD A;  4UVB A;  1U8R A;  4RLF A;  3H1C A;  3EUA A;  1YW9 A;  1EH6 A;  2ZXJ A;  5L3B A;  2XSD C;  1FOX A;  3CD6 I;  3IAM 2;  4L0Z B;  3J7Y J;  3A1Y A;  4NBQ A;  4MFD A;  3ZOB A;  2PMH A;  1FP2 A;  2JN6 A;  4EAT A;  1GXQ A;  2KIF A;  4D5C A;  4RAG A;  2EV0 A;  4HEA 2;  3FXO A;  2CQ7 A;  1U9O A;  3OR2 C;  4MHG A;  1WCM J;  2BW3 B;  2W25 A;  2CH0 A;  5EEH A;  3TL4 X;  3F72 A;  1MDM A;  2UWM A;  1FBU A;  1IDY A;  1X4O A;  3IAS 2;  4ITV A;  3FXR A;  4JX6 A;  2HVS A;  1ODD A;  3ABL H;  1OKR A;  1LVA A;  2KRH A;  3IRR A;  3P9I A;  4XKV A;  4UVC A;  3U21 A;  2E7X A;  3I0T A;  1YJ9 I;  4IRI A;  5LGN A;  1MIJ A;  1I6H J;  3WG7 H;  2K9N A;  3VYT B;  3IL2 A;  1YJN I;  1DQU A;  2ZJQ F;  2ZSI B;  3MCZ A;  1ZR2 A;  1NTC A;  5E17 F;  3CMA I;  2KT0 A;  4M3G A;  5LRS A;  1QQI A;  4BYY A;  4YIF A;  1SD4 A;  2QKL B;  3FHZ A;  2EZI A;  2E34 A;  1HBX G;  5FFX A;  3QPS A;  5J40 A;  1I3Q J;  3C2B A;  2I10 A;  3DFG A;  3IUO A;  4RM3 A;  4G6Q A;  1A5J A;  1WVR A;  4CCM A;  3H36 A;  4HSR A;  4EM2 A;  1T08 B;  1TZL A;  2MC4 A;  3KFW X;  1MDM B;  1LE8 A;  4P9F A;  1TWA J;  2EV6 A;  3AG3 H;  5HVQ C;  1PJR A;  2E5Z A;  4DJA A;  4KT6 A;  3IH4 A;  3TOA A;  4MNU A;  2CQK A;  1XPX A;  3ZMZ A;  1V54 H;  4M73 A;  2XSJ C;  4Q5S F;  2Y9Z A;  3D5S C;  2OA4 A;  1VQ5 I;  2DPD A;  4BXU A;  1R71 A;  2ZFU A;  1MMN A;  2GIV A;  2DW4 A;  4HG2 A;  1UCR A;  2KDO A;  3DEU A;  5E1W A;  3IHU A;  3L00 A;  2BBY A;  4IRG A;  1ETW A;  1R36 A;  5HS9 A;  3T5X A;  1S7E A;  3GTP J;  3DLL F;  4HPQ A;  4HAM A;  3VFZ A;  4EM1 A;  2QQB A;  2Q8K A;  1QZE A;  1MBJ A;  4RB1 A;  4E70 A;  1UST A;  4L5E A;  5DUK A;  1UHW A;  4HDV A;  1WJ5 A;  2TRT A;  4HF1 A;  3A0B C;  4CYC B;  2JQ7 A;  1B4A A;  4BU2 A;  2VLA A;  4UNO A;  4M6Y A;  3KLN A;  1UHM A;  1YIJ I;  1W7P D;  4ESF A;  5K5Q A;  4DYC A;  1LE8 B;  4IOA F;  4ENN A;  3S2H J;  2CO5 A;  2MAB A;  4HNV A;  3LSM A;  1LFP A;  5IT9 K;  4LIV A;  2WC2 A;  3M1C A;  4MLO A;  3B02 A;  2W1O A;  4BEH A;  3CCJ I;  1RNL A;  1IV8 A;  4UVA A;  2STT A;  2LNB A;  2ME0 A;  1BJA A;  2VOD A;  5M5W J;  3RKQ A;  3FZV A;  5J3L A;  1MBF A;  4Y3O A;  2M8G X;  3CCY A;  2WB1 A;  3L2V A;  3DF8 A;  3GTJ J;  2IP2 A;  2VXZ A;  3EYY A;  3BG9 A;  1JXS A;  3HZJ A;  3GBG A;  3CCV I;  4BQO A;  2CYY A;  2HOA A;  2WV0 A;  2IJL A;  3RKW A;  3MQ0 A;  5HDK A;  2QEX I;  4HQE A;  2FXA A;  4GRI A;  3K7A J;  5DD4 A;  5K7F A;  3AKZ A;  1H8A C;  2R4G A;  1Z3X A;  4XOT A;  5HOO A;  2HR3 A;  2W82 A;  2BYV E;  4EVI A;  3LNQ A;  3N97 A;  1ULY A;  2FUG 2;  3RZD J;  1W7P A;  4DBR A;  3ROU A;  1QBJ A;  2HQR A;  4N4N B;  4J19 A;  1VZ0 A;  4A69 C;  1MZB A;  4A93 J;  4G12 A;  3ZQL A;  1RI7 A;  5BS6 A;  1JHF A;  4DZP A;  3HRS A;  3V7R A;  2M4K A;  4BEH B;  4M6V A;  1QVU A;  2XAU A;  5BQT A;  1G3T A;  2HS5 A;  2CQX A;  3HOV J;  1ONV A;  1FZP B;  2D2W A;  5FFZ A;  2IS1 A;  2VXD A;  2EFN A;  3E6D A;  1TP4 A;  3HKZ A;  2FMY A;  1KQ8 A;  1RIO H;  2FQ4 A;  3KYL A;  2HPM A;  4CZC A;  5E18 F;  1XGS A;  1MKM A;  5FKO A;  5D8K B;  2K7L A;  1Y56 A;  5ICG A;  2A07 F;  3PSF A;  3TW6 A;  2B9S A;  2VPL A;  3T8T A;  2VBX A;  2DCE A; 
#chains in the Genus database with same CATH homology
 2JZY A;  1Z6T A;  5L3G A;  3O3K A;  1FY7 A;  4AWX B;  2TDX A;  3M7G A;  4F7Z A;  1W7P B;  1V3F A;  3F22 A;  2XAG A;  1FLI A;  2YSR A;  1BC8 C;  4G7H F;  2PBI A;  2BGC A;  4CYD A;  1GVJ A;  3WTS C;  3GFL A;  3VOD A;  3HRT A;  1OYY A;  2ETH A;  3HTU A;  1I1S A;  3CDH A;  2HYG D;  4BHC A;  1G4D A;  5K1Y A;  2O6G E;  2EFW A;  2UZK A;  1OYW A;  1SMY F;  2JPC A;  1EH8 A;  3DKW A;  3LQQ A;  3TO6 A;  1JGS A;  4RGS A;  4G9Y A;  2OQR A;  3KP5 A;  3IWF A;  4QLC U;  4OMY A;  1H9T A;  3FF5 A;  3MFK A;  3HOS A;  3PQJ A;  2DQR A;  3K0L A;  2HQN A;  4OIQ F;  2E1N A;  2CW0 F;  4LMY A;  4KT5 C;  3LFK A;  5CVV A;  2EK5 A;  1FNN A;  2VBW A;  2WTE A;  4U7D A;  4EGY A;  4BNC A;  5DCF A;  2P5L C;  1U6G A;  2D1V A;  3CUQ C;  3WGG A;  1YIO A;  5JFR A;  3ZMD A;  4KYW A;  2WWY A;  4R79 A;  2VT3 A;  2RDP A;  1TW2 A;  2MH2 A;  2KIU A;  4G6D A;  1I27 A;  1S7A A;  3CJN A;  1GHC A;  4LG0 A;  1W5T A;  4CHU A;  1IN4 A;  2GWR A;  4RGR A;  3P7N A;  4EJW A;  4IVN A;  4AIJ A;  3O6B B;  1AWC A;  4IHT A;  1GXP A;  2R7F A;  3WTW C;  1R23 A;  5FD5 A;  2KKO A;  2M87 A;  3HSE A;  3BJ6 A;  2QBY A;  5FLX K;  5L3F A;  1S6L A;  4I0B A;  2LDU A;  2P6T A;  1P92 A;  1IN5 A;  3GYH X;  2FRH A;  1TNS A;  3KP6 A;  3J80 K;  4LG0 B;  3K2Z A;  3BDD A;  5D4R A;  2RV8 A;  2OD5 A;  4MQV A;  2ZKZ A;  1ZYR F;  1WKM A;  1XGO A;  3SZP A;  1USS A;  2R7D A;  3CO6 C;  3E5Q A;  1SFU A;  2RQP A;  1BOA A;  2W85 A;  2RC4 A;  1O57 A;  2KJB A;  1TLH B;  1E2X A;  2QBY B;  2O03 A;  1D8J A;  1Z7U A;  3GLX A;  4A0X A;  5D5V B;  3BJA A;  2ZFW A;  1I5Z A;  3BY6 A;  4A0Z A;  1T98 A;  4OU0 A;  4P55 A;  2XAS A;  3DV8 A;  2Y48 A;  5J8C A;  1XCB A;  3ULQ B;  3V8J A;  4L18 B;  3R4K A;  1ZRC A;  3COA C;  4UUV A;  3HUG A;  1B1B A;  4CO8 A;  4YFK F;  3IKT A;  3E3V A;  4ZYH A;  1LJ9 A;  3IRQ A;  3SXY A;  1G3S A;  1YTY A;  2V1X A;  2HEO A;  1FBS A;  1TTY A;  2RN7 A;  3QPT A;  3FMQ A;  2ISZ A;  1STZ A;  2LF8 A;  1G3W A;  2STW A;  3REO A;  2Q0O A;  2H09 A;  3F21 A;  1HW2 A;  1O3S A;  5K5O A;  3E6M A;  3FM3 A;  2OQG A;  3LAP A;  4M9X A;  1MJB A;  4YFN F;  1V4R A;  3TGN A;  2PFB A;  4G94 A;  3FMR A;  1K7A A;  2DPU A;  3R60 A;  4KIF A;  3OOP A;  1R5G A;  4KDP A;  5FD6 A;  4L5I A;  2M30 A;  1O7F A;  3R61 A;  4CZZ A;  3QP6 A;  3MZH A;  3EYI A;  1XD7 A;  1U2W A;  2EFO A;  1CGP A;  2YX4 A;  1IXC A;  3KEQ A;  3LWF A;  5L3E A;  1K78 A;  2MBF A;  4WX9 A;  2ZNZ A;  1FYL A;  3I53 A;  2MLK A;  1KYZ A;  4NQW A;  3WTY C;  4WXD A;  2P6S A;  2F5D A;  3GX4 X;  2J5P A;  6PAX A;  2Z5U A;  1ZG5 A;  1HW1 A;  5ILV A;  2FNP A;  2ADU A;  4Q47 A;  3KP7 A;  4M9Z A;  2DT5 A;  5JR3 A;  2QUF A;  4ASN A;  4P96 A;  3HHH A;  1QPM A;  2L01 A;  5E20 A;  1D3Y A;  2M8E A;  4EJO A;  4A2U A;  1IXS B;  3RYR A;  3RDI A;  3TDZ C;  3JTG A;  3FWE A;  1NHA A;  2V79 A;  1XGM A;  2ESN A;  2FQ3 A;  4MQ9 F;  2HTJ A;  2A3S A;  2K86 A;  3WTT C;  1W4M A;  1IRF A;  3GF2 A;  1BIA A;  3GVA A;  3QAH A;  4M9S A;  2V9V A;  3E5X A;  1MJA A;  2MD5 A;  2IPQ X;  3QP5 A;  3GW2 A;  2DTR A;  2ZO4 A;  1MD0 A;  2UXN A;  1O3T A;  4R1H A;  5ILU A;  1KA8 A;  2W84 A;  3DP7 A;  5H20 A;  3ELK A;  3CUO A;  4ZYG A;  3V8L A;  3L2C A;  2PN6 A;  4YFX F;  1XB4 A;  2L3D A;  3WGH A;  1HKT A;  4ESJ A;  1XSX A;  3NEU A;  4HX4 A;  4PDK A;  3B73 A;  3ECH A;  3CUQ A;  1FX7 A;  2IRF G;  3M1E A;  1KU7 A;  1BM9 A;  2M45 A;  5ERI A;  2F5F A;  1Q1H A;  4Y13 A;  1O3R A;  2VE9 A;  3E6B A;  3J81 Z;  1R1T A;  4RAY A;  2ZBK A;  3M9A A;  2QWW A;  3SFZ A;  5JVT A;  2XRO A;  5KVR A;  4I01 A;  5HS8 A;  3G3Z A;  4QWQ A;  2EJR A;  3F6V A;  1UB9 A;  1J75 A;  2IA1 A;  2RNJ A;  1KU9 A;  4ZH4 F;  3CUQ B;  2QYO A;  4CDG A;  4HX8 A;  3KCC A;  3U1D A;  4EQQ A;  2P7C B;  2VN2 A;  1Z9C A;  3KET A;  4P5O A;  4JQF A;  2YU3 A;  3RIR A;  2EB7 A;  1F1Z A;  3KP2 A;  4MTE A;  2VOO A;  4XBF A;  1K6O A;  2G7U A;  4LD5 A;  4A6D A;  2QQA A;  4WF2 A;  5HLI A;  1KU2 A;  1J2X A;  1FYM A;  4U7B A;  3F8C A;  3K1P A;  1C0W A;  3MAJ A;  3C7J A;  3TDU C;  4L9N A;  4OOI A;  3HTS B;  4MEX F;  3PQK A;  3NQO A;  2HWV A;  2C6Y A;  4MEY F;  2LSO A;  4IXA A;  3KLO A;  4RB2 C;  1P2F A;  3ZN0 A;  4EJT A;  3ZMT A;  2IA2 A;  1XSV A;  1WWX A;  3RPQ A;  1MJ9 A;  3HOT A;  2E1C A;  3WU0 A;  3F6O A;  5F1R A;  4HBL A;  2HDC A;  3IKV A;  4U0V A;  2BEO A;  2V6C A;  2FU4 A;  4LGW A;  2DU9 A;  4KN7 X;  2Y75 A;  4ENM A;  3K69 A;  2DO7 A;  2DK8 A;  3BOQ A;  1XSD A;  4S05 A;  5LBQ A;  2G9W A;  4A5M A;  3JAM K;  3FM5 A;  4LFU A;  4Y15 A;  1DPR A;  2PLY A;  2GZW A;  4L5J A;  1TQI A;  1J7K A;  1U5T C;  4FX4 A;  2K27 A;  4TV7 A;  1O3Q A;  4WXC A;  3C1D A;  2EWN A;  2D1H A;  5H6R A;  1J0R A;  2YR2 A;  1J5Y A;  2RVC A;  2VE8 A;  2JPB A;  4RS8 A;  5FLX Z;  4WCG A;  1P4A A;  2OBP A;  2RGV A;  4FT8 A;  4B09 A;  2OZ6 A;  4LJZ F;  1KQ0 A;  3WTZ A;  5CLS A;  4G8X A;  3P9K A;  5LGU A;  4BH9 A;  1X3U A;  2EA4 A;  3U9G A;  3GFM A;  4M74 A;  2XAQ A;  1JE8 A;  2HOE A;  1QNT A;  3RKY A;  1T2K A;  5HLG A;  3BZ6 A;  1FSH A;  3LA2 A;  4ENJ A;  3V8K A;  1FWZ A;  3GZ5 A;  1YS6 A;  3ZPL A;  1T0F A;  4M72 A;  4N9H A;  4H0E A;  1WRJ A;  4KA4 A;  2V1D A;  2P4W A;  2ZJ2 A;  1G6N A;  5DD8 A;  1HQC A;  1SMT A;  3DQV C;  2X4H A;  2PG4 A;  2CFX A;  2GA1 A;  2YPR A;  1IF1 A;  2ZME A;  2P5K A;  5D6E A;  1ZLK A;  2PI0 A;  5LEK A;  1XGN A;  3GO5 A;  3U2R A;  4AIK A;  1R1U A;  1F5T A;  4A6E A;  1KGS A;  3KZZ A;  1TBX A;  5A2Q K;  4O6J A;  4ZYE A;  2PMU A;  1BN5 A;  1FPQ A;  2CG4 A;  1AOY A;  1PP8 F;  5LHI A;  4LLN A;  1LEA A;  3K1M A;  3Q9S A;  5ICF A;  5CVR A;  1YG2 A;  3HYI A;  4ZYD A;  1MGT A;  4IPA A;  2VON A;  3FX3 A;  4YII A;  4RGX A;  1LNW A;  5TRD A;  5DEQ A;  2MLG A;  2ZME B;  3EQL F;  3FXU A;  4N9I A;  4XSZ F;  1W5S A;  4DNC A;  5E1X A;  3LAJ A;  2DK5 A;  3BRO A;  4HYE A;  1I1G A;  4BHP A;  4ZZD A;  1BC7 C;  3KEO A;  4CGZ A;  2XAF A;  4N0B A;  2P5V A;  5EEG A;  1ZGJ A;  1RZ4 A;  2L4M A;  4ESB A;  2FSW A;  2O61 A;  5CYV A;  3KZY A;  2HTS A;  2XRN A;  2GA2 A;  4IF4 A;  2NS0 A;  1K79 A;  4DQ2 A;  2A6H F;  3ISP A;  2L02 A;  3ZMS A;  3K9T A;  2DLL A;  4K2E A;  2O0Y A;  1U3E M;  2FML A;  1KYW A;  2BV6 A;  1S3J A;  3ERE D;  3ZMU A;  3JW4 A;  2M5W A;  3TKY A;  1QZZ A;  2XGX A;  4OIP F;  1IRG A;  1R7J A;  1F4K A;  2L4A A;  4KFC A;  4UXN A;  5FGM A;  3EET A;  4Q4Z F;  2DFI A;  5BMZ A;  4KMF A;  4MTD A;  4Q48 A;  4I09 A;  4LK1 F;  4KIC A;  2BE5 F;  5F6F A;  3L09 A;  3ZMV A;  4G7O F;  3F8B A;  5LGT A;  3ZP5 A;  1O7L A;  1Z6R A;  3RPU A;  4LB5 A;  3HRM A;  1BI0 A;  2A5Y B;  2JRT A;  5HDG A;  3C18 A;  3TOB A;  2FE3 A;  2JT1 A;  1Z91 A;  5CVU A;  3KP3 A;  3F8M A;  4OIN F;  3FXQ A;  4AVP A;  4BHB A;  3IC7 A;  4KMU X;  3F8F A;  3TO7 A;  1YS7 A;  3BJO A;  2K4J A;  4WWC A;  4WK8 F;  4JK1 X;  4EJU A;  2QLZ A;  1ZGA A;  2PEX A;  4MGR A;  1XN7 A;  1U5T A;  4I7H A;  4GGG A;  3G73 A;  2NNY A;  2LF7 A;  3MWM A;  5DYM A;  2D45 A;  2OZU A;  1B59 A;  1IN7 A;  1DPU A;  5HLH A;  4L0Y B;  1EV7 A;  5E8G A;  1L3L A;  2FBK A;  1K78 B;  1RUO A;  1IXR C;  3ECO A;  2O8X A;  2UXX A;  1T38 A;  4S04 A;  3D5L A;  3I5U A;  4GXO A;  5FO5 A;  4KN4 X;  2EA2 A;  1KQ9 A;  2A68 F;  1JHH A;  1P4X A;  4ON0 A;  1U5T B;  5J8F A;  3JTH A;  2R3S A;  4HV5 A;  1A04 A;  1ZN2 A;  2A61 A;  1LB2 A;  3KE2 A;  1DP7 P;  1S8N A;  2AXL A;  3S2W A;  3EUH A;  4AIH A;  2CSO A;  4BQA A;  3RYP A;  3ZN1 A;  5HS7 A;  4CXF A;  1S7O A;  4RB0 A;  2IVM A;  4HX7 A;  3T0Y A;  1HST A;  4HLX A;  3BPV A;  3J7A O;  4Y17 A;  1Z05 A;  3RKX A;  3JSP A;  4EGZ A;  5J6X A;  3BPX A;  3L7W A;  2EFQ A;  5IT9 Z;  1FSE A;  3F8N A;  4B8X A;  3L9F A;  3VEP A;  1R58 A;  1H0M A;  3T1B A;  1YW7 A;  4IHS A;  3R0A A;  2ZNY A;  5H6Q A;  1SD7 A;  1PDN C;  1R00 A;  3WU1 B;  4M71 A;  5F64 A;  3WTX C;  3AAF A;  3HIF A;  1FYK A;  5FB2 A;  4LB6 B;  1IZ1 A;  4OMZ A;  3QOP A;  4WXH A;  3WE2 A;  3RTR A;  4O3M A;  2NNN A;  4ETS A;  1YFH A;  4LK0 F;  2RKH A;  5HDN A;  4P9U A;  3JAM Z;  4XRF A;  3GFI A;  1RUN A;  1ZHF A;  3QU3 A;  5LHH A;  1ZRF A;  5ILS A;  1LQ1 A;  3LST A;  5DUI A;  1R5H A;  1J9I A;  3HSR A;  3TQN A;  1QO0 D;  2Z33 A;  1I6X A;  2NAZ A;  4R8H A;  3I71 A;  4A5N A;  5AON A;  4LLL A;  2XKO A;  4EV0 A;  3SQN A;  3I59 A;  4RB3 C;  3H3U A;  3HHG A;  2XV4 S;  4RGU A;  3E5U A;  1T39 A;  1SFX A;  1REP C;  2VBY A;  1IN8 A;  5KK1 A;  4HW0 A;  3BWG A;  3GWZ A;  3WGI A;  4PGG A;  3VB2 A;  1EH7 A;  2GQQ A;  4G7Z F;  5JI6 A;  2A6E F;  2W57 A;  3LA7 A;  1D5V A;  3TO9 A;  2K02 A;  1D8K A;  1P4W A;  1BIB A;  4U0Y A;  3M8F A;  4XSX F;  3IWZ A;  3I59 B;  2FOK A;  4D0P A;  2HGC A;  1DDN A;  1OMI A;  2F5C A;  3D0S A;  1PP7 U;  1KU3 A;  2Z9O A;  1L0O C;  1B6A A;  2FNA A;  3P9C A;  4HLY A;  3J81 K;  4PZJ A;  4KIB A;  1ON2 A;  3ML6 A;  3I58 A;  4PCQ A;  5BPD A;  5JHU A;  1J59 A;  1BI1 A;  1BBY A;  2ISY A;  2NYX A;  2A69 F;  5E8I A;  3HRU A;  2KJC A;  4L9T A;  1UFM A;  4A0Y A;  4I0A A;  1B9M A;  2HKO A;  2QQ9 A;  3WOD F;  1T6S A;  5A2Q Z;  3K1N A;  1WI9 A;  5D4S A;  2B0L A;  2XVC A;  3QPH A;  2VC0 A;  2JTV A;  1U78 A;  1FT9 A;  4I98 B;  4U88 A;  5ICE A;  1WSU A;  4UHT A;  3GXO A;  3Q9V A;  1YYV A;  2DQL A;  2OAZ A;  5LHG A;  2IA0 A;  4GO1 A;  1IW7 F;  1XCV A;  2VC1 A;  3I4P A;  2KIM A;  4Z2Y A;  3PFI A;  2IW5 A;  3I54 A;  1FOK A;  2QM3 A;  3J80 Z;  2PJP A;  2QEN A;  4ENK A;  4XLP F;  2GXG A;  4L9V A;  1ZRE A;  2HZT A;  5BPI A;  3GZ6 A;  1XMA A;  2ELH A;  3R6S A;  2P7V B;  1YLF A;  3LQR A;  1E17 A;  1IAW A;  3QU6 A;  3SZT A;  4HZF A;  4HF2 A;  4OIR F;  2VT2 A;  3O2P E;  5AIP A;  1SD6 A;  3WE3 A;  4GCV A;  2H6C A;  3DPT A;  1LDK B;  3ABU A;  5ICC A;  4HF0 A;  2CWE A;  2E7W A;  4JBA A;  4BAY A;  4L9J A;  2DBB A;  4M6X A;  2K4B A;  1DUX C;  2HKX A;  3GEZ A;  3V7C A;  1XMK A;  3DXJ F;  1YQA A;  2XIG A;  1SAX A;  1HKS A;  1FBQ A;  2VOP A;  1F9N A;  5D5X B;  2X0L A;  1YW8 A;  2EV5 A;  2XKP A;  3FMS A;  4AD9 A;  3F23 A;  1ZRD A;  2F5E A;  1OR7 A;  2LKP A;  2L54 A;  1SD5 A;  2PQ8 A;  2Z99 A;  1VTN C;  4RAZ A;  5D5W B;  3CO7 C;  4I2O A;  2V1U A;  2ACJ A;  1BI2 A;  1HW5 A;  2DAO A;  1ZH5 A;  1BI3 A;  2F2E A;  2Z3Y A;  2COM A;  1IUY A;  2ESH A;  2MH9 A;  4PGH A;  5CVI A;  1HXD A;  3LA3 A;  1ON1 A;  3GFJ A;  5AIQ A;  1QGP A;  1ZAR A;  1S29 A;  2Y0M A;  3I64 A;  4YG2 F;  2CGP A;  3DPL C;  2JSC A;  3CTA A;  1LEB A;  4IJA A;  3GUD A;  2FF4 A;  5L3C A;  4ZZL A;  4FHT A;  4UV8 A;  3E97 A;  1TW3 A;  3CLO A;  2MA3 A;  3N4M A;  4U0W A;  2OU2 A;  4HDU A;  4EJV A;  5LLQ A;  2EFP A;  2FEZ A;  3MZY A;  1LDD A;  4FX0 A;  2ZCW A;  1H9G A;  4HQM A;  4NB5 A;  5D5U B;  2AS5 F;  1ZG3 A;  3W6K B;  3V4G A;  4HOB A;  2FBI A;  4I02 A;  1LDJ A;  1TNT A;  3WTV C;  1OYI A;  2H94 A;  2FA5 A;  3V7S A;  2DI3 A;  1TQM A;  2XAH A;  2XHK A;  2H27 A;  2QZ8 A;  3HSF A;  2HFH A;  2NRA C;  1OPC A;  1CF7 A;  1XDS A;  3H3Z A;  1ZAO A;  3R0J A;  3OV8 A;  3Q5F A;  3H92 A;  1WQ2 A;  1R1V A;  4CIC A;  3RI4 A;  2GAU A;  4IRH A;  5CVJ A;  2Q2E A;  5DCM A;  2M1B A;  4GYG A;  5E1Z B;  1TQP A;  4XLN F;  3VOE A;  2QVO A;  1B9N A;  1IN6 A;  3WTU C;  4OIO F;  2YX7 A;  4EMS A;  3JSO A;  4O5V A;  2H6B A;  3WG9 A;  1FP1 D;  1CF7 B;  5K5R A;  1YO5 C;  3F3X A;  4UV9 A;  3QRF F;  4KNY A;  5LEJ A;  2FBH A;  4HA8 A;  2XAJ A;  2J5O A;  4NHJ A;  1QZY A;  1ZLJ A;  5DCM B;  2HYF A;  3T8R A;  1HSJ A;  5DV5 A;  1G3Y A;  5CJ9 A;  2G7H A;  2KRF A;  1HKQ A;  4EM0 B;  5DDG A;  3ZQ7 A;  2VBZ A;  5ED4 A;  4A12 A;  1PUE E;  1SFE A;  4KUM A;  2MC3 A;  5TJJ A;  3ABT A;  5D8L B;  1ZG1 A;  3SHF A;  5BOX A;  4GYI A;  2O3F A;  1R22 A;  1XDU A;  5D6F A;  4HV6 A;  5LRR A;  3RJP A;  1FC3 A;  2XUB A;  2GXB A;  3C3W A;  3BP8 A;  3W6J B;  2W24 A;  5L3D A;  3E6C C;  1P6R A;  1Y0U A;  3MEX A;  5IT3 A;  4KIG A;  3M8E A;  4LLG F;  2P8T A;  3KP4 A;  3EDP A;  1Z1D A;  2IT0 A;  3NRV A;  4UVB A;  1U8R A;  1YW9 A;  1EH6 A;  2ZXJ A;  5L3B A;  4L0Z B;  2PMH A;  1FP2 A;  1GXQ A;  2KIF A;  2EV0 A;  4MHG A;  2W25 A;  5EEH A;  3F72 A;  1MDM A;  2UWM A;  1FBU A;  3FXR A;  1ODD A;  1OKR A;  1LVA A;  3IRR A;  3P9I A;  4UVC A;  2E7X A;  3I0T A;  4IRI A;  5LGN A;  3IL2 A;  3MCZ A;  5E17 F;  5LRS A;  1QQI A;  4BYY A;  4YIF A;  1SD4 A;  3FHZ A;  1HBX G;  5FFX A;  3DFG A;  4G6Q A;  4EM2 A;  1MDM B;  3KFW X;  4P9F A;  2EV6 A;  5HVQ C;  3TOA A;  4MNU A;  2CQK A;  3ZMZ A;  4M73 A;  4Q5S F;  2OA4 A;  2DPD A;  4BXU A;  2GIV A;  2DW4 A;  1UCR A;  3DEU A;  5E1W A;  3IHU A;  3L00 A;  2BBY A;  4IRG A;  5HS9 A;  1R36 A;  3T5X A;  4HAM A;  3VFZ A;  4EM1 A;  2QQB A;  2Q8K A;  4RB1 A;  4E70 A;  1UST A;  4HDV A;  5DUK A;  1UHW A;  4HF1 A;  1B4A A;  4UNO A;  4M6Y A;  3KLN A;  1UHM A;  1W7P D;  4ESF A;  5K5Q A;  4ENN A;  2CO5 A;  5IT9 K;  2WC2 A;  3B02 A;  1RNL A;  4UVA A;  2STT A;  2LNB A;  1BJA A;  2VOD A;  3FZV A;  3DF8 A;  2IP2 A;  2VXZ A;  3EYY A;  1JXS A;  2CYY A;  2WV0 A;  2IJL A;  3RKW A;  5HDK A;  3MQ0 A;  4HQE A;  2FXA A;  5DD4 A;  5HOO A;  2HR3 A;  2BYV E;  4EVI A;  3N97 A;  1ULY A;  1W7P A;  3ROU A;  1QBJ A;  2HQR A;  1MZB A;  1RI7 A;  5BS6 A;  1JHF A;  3HRS A;  3V7R A;  5BQT A;  1G3T A;  2HS5 A;  1ONV A;  1FZP B;  2D2W A;  5FFZ A;  2EFN A;  3E6D A;  1KQ8 A;  2FMY A;  1RIO H;  5E18 F;  1XGS A;  1MKM A;  5D8K B;  2K7L A;  5ICG A;  2A07 F;  3T8T A;  2VBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...