3Q9VA

Crystal structure of rra c-terminal domain(123-221) from deinococcus radiodurans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding response regulator
publication title Crystal structure of rra c-terminal domain(123-221) from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q9vA00
4L0YB 1FX7A 1R1VA 5FO5A 2OAZA 5D8LB 4LJZF 3RDIA 3SFZA 2YX7A 4LB5A 2COMA 2A69F 3SZPA 1EV7A 2GXGA 3KFWX 2QLZA 1XDSA 2EA2A 3HRTA 3KLNA 5DCMB 1K7AA 4A12A 2D1HA 3FF5A 1TQPA 1K78B 4YG2F 2J5PA 3E5QA 4HX7A 3TQNA 5AIQA 4UV9A 2PFBA 5DCFA 1RIOH 4R8HA 3T1BA 4KYWA 4I0AA 5TRDA 1F1ZA 3SXYA 4G7ZF 5CVJA 4NQWA 5DUIA 1TNSA 1QZYA 3KLOA 4MGRA 5LRRA 4LB6B 3U2RA 1E2XA 2LKPA 1GXQA 2EFQA 2QQ9A 4CICA 2F2EA 1WWXA 1HBXG 3HRMA 3LAJA 2D2WA 1K79A 2Y48A 3HIFA 3C1DA 4RGUA 2QYOA 2P7CB 1XMAA 2B0LA 3WTXC 2L4AA 2VE8A 2DAOA 3K2ZA 3GWZA 1H0MA 4HAMA 1QPMA 3K0LA 5IT9K 2BV6A 4IHTA 2QVOA 3MZYA 1V4RA 2QENA 3E6MA 1LB2A 1BN5A 2FEZA 3J80Z 3C7JA 1IXSB 2NS0A 5LGTA 1V3FA 5LHGA 4LG0B 1EH7A 5LEKA 3T8RA 1T6SA 2K02A 2P6TA 2W25A 2RVCA 4OIPF 1P6RA 1R1TA 1XSXA 3EYIA 1SMTA 5HDKA 2CG4A 3LAPA 2YSRA 2QM3A 5K5QA 1ZYRF 2PMUA 2IP2A 3P7NA 5E8IA 3F8MA 1EH8A 1S7AA 2FBIA 3MQ0A 3RYRA 5ILUA 2O3FA 3JAMK 5CVUA 3CUQC 2IW5A 2FRHA 1XGMA 3W6JB 2HKXA 3I58A 3MFKA 1YQAA 3FMRA 1D8KA 3TGNA 1LQ1A 1DPUA 3R61A 1O3RA 3K69A 3HSFA 2XROA 2O6GE 3BZ6A 2ESNA 3I5UA 1BIBA 3B02A 1Z91A 4ETSA 5LHIA 3M8EA 2Q0OA 3G73A 4NHJA 2VBWA 3I71A 4XSXF 3V4GA 4EMSA 3ZMZA 3BY6A 4Y17A 1ZREA 2V1UA 4M9XA 4AD9A 4ESJA 1IUYA 1XSDA 4G6QA 4CO8A 2E7WA 4S05A 4EGYA 3OOPA 1SFXA 4KMFA 5JR3A 2IT0A 2Y0MA 4GYIA 4U88A 3VFZA 1IN7A 3I4PA 3WTVC 2GQQA 1TW2A 2P5LC 3LWFA 3LA3A 4HDUA 1J7KA 4G7HF 1DUXC 3LSTA 2HTSA 4WK8F 5E1ZB 3LQRA 3M9AA 4HLYA 1YG2A 1O3TA 2W85A 3ZMDA 1R58A 4LD5A 3D5LA 3QOPA 1KQ0A 5ICFA 3QPHA 5HDGA 5E20A 2KKOA 1LEAA 2A6EF 5D4RA 2PJPA 1F4KA 2QUFA 1OKRA 1Z9CA 5HS7A 2MH9A 3O2PE 5H6RA 3DXJF 4BXUA 1OYIA 1YW8A 4IRGA 5BPDA 4M6YA 4ZYGA 3AAFA 1P4WA 1XGOA 3HUGA 3WTYC 1BC7C 4ZYHA 3CLOA 4RGXA 1IAWA 4U7BA 1TW3A 2ZFWA 2F5EA 5CYVA 3DQVC 3FXQA 2ISZA 3IRQA 4HBLA 1FZPB 3WTTC 1YS7A 4GO1A 1TNTA 3RIRA 4UVAA 5IT3A 3C18A 1USSA 1YFHA 2FA5A 1MDMB 2DK5A 4KIBA 1MZBA 2VT3A 4A0ZA 3RPUA 2Q2EA 3F3XA 1ZARA 3FZVA 1Z6RA 2IA0A 3E97A 3EETA 3QU3A 2MC3A 2JZYA 1RZ4A 1SD6A 2XASA 1LEBA 4HW0A 3VODA 3KEQA 4EJUA 5J6XA 1H9GA 3ECOA 1FYLA 4AIKA 4ZH4F 3BWGA 5D6FA 2H27A 4RAYA 4OINF 3ISPA 2R7FA 1IXRC 3E6BA 2P4WA 4XBFA 4HF1A 3J81K 2FQ3A 4JBAA 1B1BA 3DF8A 4Q4ZF 1ZLKA 3M7GA 1Z7UA 4M73A 5E18F 3JW4A 3DV8A 1OMIA 1Q1HA 1W5SA 1KYZA 2K4BA 2NAZA 5FB2A 4HOBA 1MGTA 2STWA 3KP7A 1FLIA 4ENKA 4FX0A 1CGPA 3F8NA 3FWEA 3S2WA 1HW5A 1YYVA 3REOA 4GCVA 4UVCA 3L9FA 3EUHA 4KN7X 1BI1A 2HYGD 1P92A 2EFNA 1YTYA 1SMYF 5BQTA 1U78A 4P9UA 4GXOA 4FHTA 3IWFA 4EJOA 3LQQA 2YX4A 1FYKA 1R23A 3IKTA 2UXNA 2R7DA 4LFUA 1LDKB 1BC8C 1R7JA 3ULQB 1W7PA 3CUQA 4H0EA 5E17F 2MLGA 1KQ8A 1LVAA 2ISYA 2JTVA 2A07F 4L9TA 3HTUA 3RI4A 2VBZA 5E1WA 2IRFG 1QNTA 4IVNA 2Q8KA 3CTAA 3WTWC 1U5TA 3RPQA 3TO9A 1B9MA 2MD5A 1BJAA 4KIGA 3BJOA 2ZJ2A 3HRSA 1KU9A 4DNCA 1XN7A 4AVPA 2ZCWA 1ON2A 3WU0A 3KP3A 3VOEA 3BOQA 1IF1A 3CJNA 2P5KA 4NB5A 1ZN2A 4A0XA 5BOXA 4OIOF 4IJAA 4S04A 1FYMA 5KK1A 4HF2A 2KIMA 2M45A 3M8FA 2BYVE 4EJTA 4HF0A 3F8CA 3GFJA 3CUOA 2XKOA 2ZKZA 4CYDA 4UHTA 5K1YA 4OU0A 3Q9SA 2EV0A 3R60A 1ZGAA 2PQ8A 4YFNF 1WKMA 4HQEA 2W84A 2LSOA 3ZMUA 2PN6A 2IVMA 2XGXA 4G7OF 5ILVA 2PMHA 1FY7A 4MQVA 5J8CA 3F72A 3KZZA 2EFPA 1PP8F 4L9NA 1R5HA 4XLNF 1S8NA 5A2QK 3BPXA 3WODF 4M71A 3RKWA 1I5ZA 1ZAOA 3U9GA 2D1VA 1KA8A 4LLLA 2Z9OA 4L0ZB 2GA1A 3L00A 1O3QA 1DDNA 1IW7F 2WWYA 2HQRA 2FMLA 3E3VA 3P9CA 4N9IA 4BHPA 3B73A 1UCRA 1KGSA 5LRSA 3RYPA 2KJBA 1XSVA 3I0TA 2EFWA 4MNUA 4PZJA 4EM1A 4RAZA 1KQ9A 4IXAA 5K5OA 3V7CA 2HR3A 3F6VA 5DEQA 2EA4A 1OYWA 3F21A 3IRRA 3WTUC 5CVIA 4KIFA 3GF2A 2Y75A 3KP4A 2D45A 3MWMA 3JTGA 3EQLF 2ZMEB 5FLXK 3GZ5A 1ZG5A 1RUOA 2STTA 3FXUA 4TV7A 1F9NA 1Y0UA 1AWCA 2RDPA 3QAHA 4AWXB 1U2WA 3ECHA 3GFLA 5D6EA 4PGHA 1A04A 1BBYA 3COAC 3NEUA 4OMYA 4UV8A 2VBXA 2L4MA 4WX9A 1FP2A 2HOEA 1YW7A 4MQ9F 2JPBA 1BI3A 1MJ9A 1IZ1A 2DPUA 4BAYA 4A6DA 4U0WA 4N0BA 2IPQX 4IF4A 4RGRA 3KZYA 1JHFA 2L54A 1U8RA 4YFKF 2XRNA 4ENJA 4KT5C 1FT9A 4Q48A 2CO5A 5CLSA 3TOAA 3HOTA 5CJ9A 1JXSA 1BIAA 1UFMA 2F5FA 4JK1X 1WQ2A 3MEXA 3TOBA 2M5WA 3JSPA 4EVIA 1ZHFA 2FE3A 3I53A 4G8XA 1YIOA 3SHFA 2QBYB 1SFEA 1WI9A 1U5TC 3U1DA 1XCBA 5HDNA 2TDXA 2DBBA 3GW2A 3V8JA 4UNOA 2VOOA 2L3DA 2FBHA 4IPAA 5EEHA 3GXOA 2DT5A 2FSWA 2GA2A 5E8GA 4EQQA 1UHWA 4N9HA 2IA2A 3DPLC 3L09A 4QWQA 1ZGJA 1J75A 4A5MA 2HWVA 2LF8A 3TDUC 2CWEA 2EFOA 1I6XA 2MBFA 3KP6A 1I27A 3TDZC 3H3UA 2QZ8A 1WRJA 1JE8A 1USTA 1B6AA 4WXDA 2ZNYA 4A2UA 2KIFA 3H3ZA 2CGPA 5D5VB 1REPC 1O3SA 2FNAA 3RJPA 1HW2A 3BJAA 3I59B 2VC1A 3K1MA 2MA3A 1IN6A 1ZG3A 3FHZA 3QRFF 2E1CA 3DKWA 1FOKA 5L3FA 5BS6A 4QLCU 1MJAA 2FU4A 2YPRA 3GLXA 1CF7B 2NRAC 4D0PA 3R0AA 4HV6A 5HS8A 4L18B 5F6FA 4WF2A 2K4JA 2ZXJA 3N97A 4F7ZA 1R36A 3J80K 4WXCA 3R6SA 2FF4A 4LMYA 5KVRA 4CDGA 1L3LA 4I09A 1E17A 3W6KB 2PG4A 1HQCA 2H6BA 2PI0A 5DUKA 1GVJA 2LDUA 4P5OA 1LDJA 1KU2A 3IC7A 4CZZA 5JFRA 2E7XA 3ERED 1GHCA 2DPDA 3CDHA 5DCMA 4M9SA 3QU6A 1K78A 1R22A 1HKTA 1FNNA 3HSEA 2DK8A 3V8LA 3KETA 4G6DA 2HTJA 1IN8A 4K2EA 4EM0B 2OBPA 1D3YA 2XAHA 3GUDA 1W5TA 2HEOA 3T5XA 5H20A 4M9ZA 2ELHA 4ZZLA 2WTEA 1DPRA 2GIVA 1RNLA 2Z5UA 2XAJA 3BPVA 1T0FA 1PDNC 1UHMA 4O6JA 1ZRDA 1TLHB 1TBXA 3F23A 1ONVA 6PAXA 5ERIA 5LGNA 2YR2A 4BH9A 2WC2A 1P4XA 1U3EM 4G94A 1YLFA 3PQKA 4KDPA 4PGGA 2HFHA 2KJCA 3KP5A 4ZZDA 5ICCA 3LA2A 2RNJA 2X0LA 4U7DA 1U6GA 2AXLA 2P6SA 3G3ZA 4P55A 3T8TA 3NRVA 3T0YA 2Z3YA 2BGCA 3P9IA 2E1NA 4B8XA 1ZG1A 1FSEA 1L0OC 2K7LA 2Z99A 2A61A 2ZO4A 1YO5C 2XAFA 2BEOA 4LG0A 2ESHA 4M6XA 3I54A 4UVBA 4BNCA 5D5UB 5AIPA 1ODDA 3R4KA 4MTEA 4HZFA 1WSUA 2VODA 3LA7A 1T38A 2VE9A 4IRIA 1T98A 1ZH5A 4G9YA 1XGSA 2RV8A 2V9VA 2DLLA 1D5VA 3RKYA 4GGGA 5BPIA 3V7SA 3IWZA 4Y15A 2P8TA 5HS9A 2H09A 2HYFA 2OA4A 1I1SA 4HX8A 2HZTA 5DDGA 3SZTA 1JHHA 4L9JA 5LLQA 1ON1A 4XSZF 4RB0A 1QQIA 2KRFA 4KICA 1HXDA 2XVCA 3SQNA 3H92A 3FX3A 3TO6A 2R3SA 4I0BA 3WE3A 1IN4A 2VN2A 4ESBA 1TQIA 5IT9Z 1QZZA 2JT1A 1P2FA 4KMUX 2NNYA 4IHSA 3ML6A 4HDVA 3F22A 3JTHA 2BBYA 2HKOA 2VC0A 3ZQ7A 1JGSA 1P4AA 1G3YA 5F1RA 3BDDA 3L2CA 4EGZA 2KIUA 3BJ6A 5LGUA 4WXHA 5L3EA 3E5UA 4I01A 3ZN0A 1J9IA 5LHHA 1W4MA 5LEJA 1HSTA 1S6LA 1ZRFA 3O6BB 3K1PA 2OZUA 1XGNA 4ZYEA 2G7HA 5L3BA 5HVQC 3GFIA 2FBKA 4A5NA 4CGZA 1YW9A 3VB2A 2VT2A 3CO7C 2ACJA 4UUVA 3DFGA 2BE5F 3BROA 1FC3A 2M1BA 3ELKA 4RB3C 3C3WA 3VEPA 1MD0A 2RQPA 2V6CA 4MEYF 5H6QA 4I98B 3HYIA 4Z2YA 1LNWA 1J59A 3QPTA 4FX4A 4HQMA 3PQJA 2DTRA 2F5DA 1S3JA 1O7LA 2ETHA 2LF7A 2UXXA 2ADUA 5HOOA 5L3DA 5FD6A 5FFXA 1ULYA 1R1UA 5J8FA 4EJWA 2FMYA 1HW1A 1STZA 3FM5A 1MDMA 3ZMSA 1XMKA 5DD8A 4CXFA 5ICEA 1PP7U 2NYXA 2O03A 3N4MA 3F6OA 1MKMA 2EJRA 3GVAA 4AIJA 4XLPF 3FXRA 2AS5F 3DPTA 2FXAA 1FWZA 3MCZA 3RKXA 3GEZA 2RKHA 1H9TA 2DO7A 1R5GA 2G7UA 5LBQA 2K86A 1IRGA 2MH2A 2XHKA 4Q5SF 4KA4A 1XCVA 2VBYA 2XAGA 4RGSA 5DV5A 1T39A 3O3KA 4LK1F 3F8BA 1BM9A 3ZN1A 2JRTA 1F5TA 1W7PD 4KN4X 5FGMA 1I1GA 3K1NA 2CYYA 4IRHA 3GFMA 5D8KB 4EV0A 1QBJA 1RI7A 3KP2A 4PCQA 3TKYA 2IJLA 2X4HA 3DEUA 1C0WA 4HA8A 5L3CA 2V1XA 3WGIA 2V79A 4BQAA 1HSJA 4M72A 3ABUA 5JVTA 3PFIA 2XIGA 1KU3A 1J5YA 1W7PB 3CUQB 2O8XA 4YFXF 2L01A 1LJ9A 1TTYA 5CVRA 1XD7A 1G3SA 2HS5A 1EH6A 4JQFA 4O3MA 2QQBA 4FT8A 2WV0A 1OR7A 2VXZA 1FBSA 1U5TB 3KCCA 1S29A 3ZMTA 5BMZA 4ON0A 3ABTA 4A6EA 3EDPA 4HX4A 1ZRCA 1T2KA 3WGGA 2JPCA 2HDCA 2HGCA 1FBUA 4PDKA 4R79A 2A3SA 5ED4A 3WGHA 1D8JA 3J81Z 5HLGA 4ENMA 2M8EA 3WG9A 4MTDA 4ENNA 3RTRA 1HKQA 3IKVA 1G4DA 1VTNC 5HLIA 1J0RA 3ZPLA 3QP6A 4OMZA 4LK0F 4ASNA 1NHAA 4A0YA 5CVVA 5HLHA 2G9WA 4HLXA 3FM3A 4I02A 3LFKA 4LGWA 2GWRA 1OYYA 2DQLA 2M87A 1SD4A 4Y13A 4XRFA 3CO6C 5AONA 2H6CA 1BOAA 1PUEE 2EB7A 2EK5A 4KFCA 4ESFA 5D5XB 2CW0F 2XKPA 3Q5FA 2GXBA 5JI6A 3I64A 3J7AO 3P9KA 1UB9A 3V8KA 2GAUA 3IL2A 3WTSC 2XV4S 2PEXA 1O57A 2EWNA 2DW4A 1IN5A 2OZ6A 1Z1DA 2Z33A 4OIRF 4U0VA 3KEOA 1LDDA 5FD5A 2O61A 3HHHA 1SFUA 4MHGA 4AIHA 2XUBA 1KYWA 1QO0D 1RUNA 3KE2A 5EEGA 3OV8A 3Q9VA 1FP1D 2C6YA 2RC4A 3M1EA 2PLYA 2F5CA 4BHCA 4UXNA 4BYYA 2P5VA 5TJJA 1OPCA 1IXCA 2QQAA 1X3UA 4OIQF 2DU9A 3DP7A 4LLNA 3NQOA 3IHUA 2ZNZA 3GZ6A 4YIIA 1Z6TA 2L02A 2PBIA 3E5XA 2ZMEA 2H94A 2W57A 1HKSA 2RGVA 2QWWA 4WCGA 2EV5A 2RN7A 2FOKA 2M30A 5E1XA 4WWCA 4LLGF 3F8FA 1O7FA 4KNYA 3WU1B 4P9FA 1QGPA 4E70A 2MLKA 2XAQA 5A2QZ 1YS6A 3ZP5A 2JSCA 2OD5A 1XB4A 1B9NA 1Z05A 1GXPA 2OQRA 2VOPA 4GYGA 4M74A 2FNPA 5K5RA 4KUMA 3ZMVA 4RB1A 4OOIA 3HRUA 4U0YA 2O0YA 1K6OA 2DI3A 1S7OA 2W24A 1R00A 3BP8A 2VONA 4B09A 4MEXF 1TQMA 4YIFA 4HYEA 2OU2A 2GZWA 3MAJA 2CQKA 5ICGA 1G3WA 2DFIA 2QBYA 5ILSA 5D5WB 2J5OA 5F64A 2DQRA 4I7HA 5L3GA 4I2OA 5FLXZ 2UZKA 2A68F 4P96A 2V1DA 3HOSA 4EJVA 1SD5A 4R1HA 3D0SA 3MZHA 4EM2A 3L7WA 3V7RA 4DQ2A 3WE2A 2ZBKA 2A5YB 4L9VA 2LNBA 3HTSB 3GYHX 1G3TA 5JHUA 3R0JA 2CSOA 1FSHA 3FMSA 2K27A 4L5IA 4CHUA 4BHBA 1G6NA 3E6DA 1KU7A 5DD4A 1SAXA 1XDUA 5FFZA 1FPQA 2YU3A 1IRFA 1AOYA 3GO5A 5D4SA 3ROUA 2HQNA 3FMQA 4RS8A 1MJBA 4Q47A 3GX4X 1BI0A 2UWMA 3HHGA 3K9TA 1B59A 3TO7A 2EV6A 4RB2C 4L5JA 3E6CC 3I59A 5DYMA 3JAMZ 3WTZA 1ZLJA 3EYYA 1BI2A 2NNNA 2CFXA 1J2XA 2A6HF 3JSOA 1FBQA 1SD7A 4O5VA 2P7VB 1CF7A 4ZYDA 1B4AA 3HSRA 2OQGA 1DP7P 3QP5A 4HV5A 2IA1A
chains in the Genus database with same CATH superfamily
2K9SA 3BCBA 4M6VA 3CC7I 5EGOB 2Y0SA 3SEQA 4L0YB 4BJ6C 2E71A 1FX7A 2HOTA 1R1VA 2HOAA 5FO5A 2OAZA 5D8LB 4BE1A 2BZTA 4LJZF 3RDIA 3SFZA 2YX7A 3HDDA 2COMA 2LRDA 2A69F 3SZPA 4LB5A 1A5JA 1EV7A 2GXGA 3KFWX 2QLZA 1XDSA 5J1UA 2EA2A 3HRTA 4HG2A 3KLNA 5DCMB 1K7AA 1E3HA 2K9LA 2WADA 2D1HA 3GBGA 4A12A 3FF5A 5DS9A 3HGYA 1TQPA 1K78B 2CV0A 1SVOA 2PJRA 4YG2F 1D0XA 2EZKA 2LKXA 2J5PA 2MGQA 3E5QA 4HX7A 4FTHA 3TQNA 5AIQA 4UV9A 3GTGJ 4XRSG 2PFBA 5DCFA 2E1OA 1RIOH 4R8HA 1TZLA 1UG2A 4UB8C 3T1BA 2AQEA 4CYCB 2EILH 4KYWA 4I0AA 5TRDA 3Q0VA 1F1ZA 4C30A 1MBEA 3SXYA 2HU9A 3D1NI 1ETOA 4G7ZF 1N77A 3VYSB 2X6XA 5EEAA 2W1OA 5CVJA 4NQWA 4UUSA 5DUIA 2R7TA 4RM2A 1TNSA 1QZYA 3KLOA 2UUZA 4MGRA 5LRRA 2ZMEC 4LB6B 3U2RA 1E2XA 2LKPA 1GXQA 2EFQA 5GTHC 4MO7A 2QQ9A 1XS9A 3G1MA 4DBQA 5M5WJ 4CICA 2F2EA 1BA5A 4A3EJ 4C3JJ 1WWXA 1ORKA 1HBXG 3HRMA 1WPKA 1FOYA 4XL9A 4IX7A 3GCMA 4A3CJ 4II3A 5HNFA 3LAJA 1VQ6I 4UY8I 2D2WA 2XF6A 1K79A 2Y48A 3HIFA 2Q1ZB 3H9GA 3C1DA 4RGUA 2QYOA 2P7CB 1XMAA 3S14J 2B0LA 2V9KA 2L4AA 3WTXC 1KONA 2VE8A 3M1CA 2DAOA 3IAS2 3K2ZA 3OS0A 1ERDA 3GWZA 5BNGA 3DPUA 1H0MA 4HAMA 2NOGA 2XC7A 2ZSIB 1QPMA 3K0LA 3MMYB 5IT9K 2BV6A 2Y9YA 2QVOA 4P1WA 2ECBA 4IHTA 5M5XJ 3MZYA 4BJ5C 1V4RA 3DCFA 3OYCA 2KPMA 2WAQN 2NVQJ 2QENA 1GLNA 1QVUA 3OR2C 4IL6C 3ZQQA 2K9QA 1Y56A 3E6MA 1LB2A 1YRNA 1BN5A 3UR3C 3H5AA 2F4OB 2FEZA 1D0ZA 3J80Z 3C7JA 1IXSB 2NS0A 5LGTA 3RCOA 1V3FA 5LHGA 4LG0B 4B1RA 1EH7A 1O4XA 1E3PA 3T8RA 5LEKA 1T6SA 3EUHC 1W36D 3CF5F 2K02A 1JKPC 2P6TA 1MW7A 1ETXA 3CJQB 1MNDA 2W25A 4DYRA 2RVCA 4OIPF 1P6RA 2HXIA 2FX0A 1R1TA 1WJAA 1XSXA 1OCCH 5M3FJ 3I9V2 3JRIA 3HC7A 3EYIA 1SMTA 1ZELA 4XRSA 5HDKA 1QRYA 2CG4A 2F4IA 4BUPA 2X6OA 2R7RA 3LAPA 2YSRA 2OJED 1IRXA 3BT9A 4LOCA 1IJWC 2QM3A 5K5QA 4E7HA 4BY1J 1ZYRF 2PMUA 2IP2A 3P7NA 1W0UA 5E8IA 1RETA 3F8MA 1TC3C 1YJ9I 1EH8A 1S7AA 2FBIA 2LP0A 3MQ0A 5F1JA 3RYRA 2XPVA 5ILUA 2O3FA 3JAMK 2MYSA 5CVUA 3CUQC 2A05A 1I39A 2PX9A 1QVTA 3DTIA 1WVRA 4E6KG 2IW5A 2FRHA 1XGMA 5EG0A 2AQFA 4JX6A 3H1CA 3W6JB 2HKXA 2VPLA 3I58A 4XKWA 1V55H 2CS3A 1EKEA 4GRIA 1UELB 1UAAA 4PUSA 3MFKA 2LY2A 1E3OC 1YQAA 3FMRA 1D8KA 3TGNA 4I76A 3CESA 1LQ1A 1DPUA 3R61A 1O3RA 3K69A 4B4CA 3CCLI 3HSFA 1XG1A 1PYVA 2XROA 3LL7A 2O6GE 1WJFA 4EEFG 3BZ6A 2ESNA 3I5UA 1BIBA 4E7KA 1BW6A 2DXIA 2KZVA 3B02A 1Z91A 4ETSA 1WJ5A 2X6WA 5LHIA 5M3MJ 3M8EA 2Q0OA 3G73A 1LE8A 4NHJA 3MVPA 2VBWA 4M3EA 2IS4A 3I71A 4XSXF 3V4GA 4EMSA 1ENHA 1DU0A 2JN6A 3ZMZA 1Z3YA 3BY6A 3S1RJ 4Y17A 1ZREA 2V1UA 4M9XA 4AD9A 4DYQA 4ESJA 2XGEA 3ASOH 3J7YJ 1XSDA 1IUYA 4G6QA 4CO8A 3BZCA 4B3XA 2E7WA 4S05A 3OOPA 4EGYA 1SFXA 4KMFA 5JR3A 4I6ZA 2IT0A 3Q0UA 2DFEA 2Y69H 2KIQA 3CD6I 4Y4RA 1X4OA 2Y0MA 4PFOA 2R7WA 4GYIA 5F0CA 4U88A 3VFZA 3AL0B 1X2NA 1IN7A 3I4PA 3WTVC 2GQQA 1TW2A 1H8AC 1FOXA 2P5LC 3LWFA 1IG7A 4JP0A 2HDDA 3H35A 3LA3A 4LIVA 4HDUA 1J7KA 3A4CA 4G7HF 1JGGA 1DUXC 3H3VK 3LSTA 2HTSA 4WK8F 5E1ZB 3LQRA 3K4NA 2JVHA 3M9AA 4HLYA 5KHDA 1TT5B 2ZXWH 1YG2A 1O3TA 5GAHJ 2W85A 3ZMDA 1R58A 4LD5A 3D5LA 3QOPA 1KQ0A 2ZJRF 5ICFA 3QPHA 3D5RC 1QA6A 3PFYA 5HDGA 5E20A 2KKOA 4D7NA 1LEAA 2A6EF 5D4RA 5HNHA 2QSFX 3OL4A 2PJPA 3BG7A 3GZNB 1F4KA 2QUFA 2HXOA 2E2IJ 1OKRA 1Z9CA 5FKMA 2JA7J 5HS7A 2MH9A 3LSJA 2JQ7A 2XPWA 1AKHA 3O2PE 3M07A 4XLHA 3BCAA 2LBFB 5H6RA 3DXJF 4BXUA 1B72A 1OYIA 1YW8A 4IRGA 5BPDA 3CMEI 4M6YA 1T95A 3DTEA 4ZYGA 3AAFA 2F6CA 1P4WA 1XGOA 1ZK8A 3HUGA 3TMOA 2E2HJ 1Z21A 2IGOA 3WTYC 1BC7C 4ZYHA 3IH3A 4BY7J 3JRCA 3B6CA 3CLOA 4RGXA 2X1DA 1IAWA 4U7BA 3BG5A 1TW3A 2ZFWA 2F5EA 3S2DJ 5CYVA 3DQVC 3FXQA 4W97A 2ISZA 3IRQA 3L2RA 4HBLA 1FZPB 2JA2A 3HM5A 2JWTA 1SFOJ 3WTTC 2VQLA 3PJRA 1YS7A 4GO1A 1TNTA 5KAIC 3RIRA 3A03A 1R6RA 4UVAA 2BW3A 5IT3A 3C18A 3M4OJ 2KRHA 4MFDA 1USSA 1YFHA 2FA5A 1FIAA 1MDMB 3A1YA 2DK5A 3K7AJ 2VKHA 4A3BJ 4KIBA 1MZBA 2VT3A 3BG3A 4A0ZA 3RPUA 3LSIA 3S3NA 2Q2EA 3F3XA 1ZARA 3FZVA 1Z6RA 2IA0A 3E97A 3EETA 1NTCA 3QU3A 2MC3A 4BBSJ 2XPUA 4CCOA 2JZYA 4XKVA 1HLVA 3GTPJ 3HL2A 1RZ4A 1SD6A 2XASA 1LEBA 2VJ4A 4HW0A 3KEQA 3VODA 1PJRA 3LSHA 4EJUA 2P81A 5J6XA 2KRCA 1F36A 2Z1DA 5JLXA 1H9GA 3ECOA 5EYRA 3OYLA 1Y1VJ 1D1AA 1FYLA 3ZQHA 4AIKA 4ZH4F 2DA7A 4W1UA 3BWGA 5D6FA 4PK4A 3WHBA 3ZQIA 3S32A 5IP7J 2FOWA 2H27A 4RAYA 3ABMH 4OINF 2CQ7A 3MD2A 3ISPA 5LFAA 3CCMI 3GLLA 3S93A 2R7FA 4BQNA 2E19A 3HOZJ 1IXRC 1N78A 1VQOI 3E6BA 5K7HA 2P4WA 4XBFA 4XOPA 3TP3A 4HF1A 4A93J 3J81K 1UZCA 2FQ3A 1OQYA 4JBAA 5E3MA 1B1BA 2LYCA 2O7OA 3DF8A 4XN3A 4N4NB 4Q4ZF 1GT0C 1ZLKA 3M7GA 1Z7UA 2H8WA 5EJCA 1IDYA 1ZR2A 4M73A 3PL8A 5F0FA 5E18F 4LG3A 2QF7A 3JW4A 3IP4B 2GIZA 2MSYA 3DV8A 1OMIA 4IZZA 1Q1HA 1W5SA 1VF9A 4XLEA 5H2FC 1R71A 1KYZA 2EZLA 2K4BA 2NAZA 5FB2A 4HOBA 2LREA 1MGTA 1RR7A 2K3PA 5EF6A 2M9HA 2GBYA 1A6IA 3KP7A 2STWA 1FLIA 5B5EC 5B66C 4ENKA 2KT0A 3ZQGA 4FX0A 1CGPA 3F8NA 3FWEA 3S2WA 3OYAA 3O8HA 3W3CA 1HW5A 1YYVA 3REOA 1D0YA 2VL8A 3I3LA 4GCVA 4UVCA 3L9FA 3EUHA 4KN7X 1BI1A 3A0HC 5F04A 2HYGD 2EFNA 1P92A 1YTYA 2E5ZA 1SMYF 5BQTA 1U78A 1MBGA 4P9UA 3A02A 3HPGA 3K70D 4GXOA 1K83J 3CQZJ 2DT6A 4BE0A 1X1AA 1JT0A 4FHTA 2XF5A 3IWFA 4EJOA 3LQQA 4G6TB 2DT7B 2YX4A 3OS2A 1FYKA 2H1LA 1R23A 3IKTA 4M3FA 4J01A 2QSGX 2UXNA 1W5CC 2R7DA 2RAEA 3SFIA 1DU6A 4LFUA 1LDKB 3ERMA 2ID6A 2HDWA 2WY8Q 2DMQA 4D1QA 3H5RA 1S72I 4OAZA 1BC8C 2HPIA 1R7JA 2CH0A 3FIWA 3ULQB 1Y8QB 1W7PA 2B9SA 3CUQA 4H0EA 3MZ8A 5E17F 2MLGA 5JVGF 3SZGA 1KQ8A 1LVAA 1S7EA 2ISYA 2JTVA 2A07F 1DGWY 1QPIA 5JHFA 3HJEA 4L9TA 3HTUA 3RI4A 1ZTRA 2VBZA 5E1WA 2FJ1A 2IRFG 1QNTA 2DTZA 5FJ8J 1JJ8C 3PNYA 4IVNA 2V1NA 2Q8KA 3VSKA 3K70C 3CTAA 3WTWC 4DIQA 1U5TA 3FXLA 3GTKJ 3RPQA 3TO9A 2DMTA 1B9MA 2GM4A 4B47A 1MBKA 1WI3A 1OCZH 2MD5A 1BJAA 4KIGA 2DJNA 3BJOA 2ZJ2A 3HKZN 3HRSA 2GOXB 1KU9A 4DNCA 3HOVJ 4B3AA 1XN7A 4AVPA 3BQZA 2ZCWA 1ON2A 3QYFA 3WU0A 2JUGA 2KDOA 4RDUA 3KP3A 4I99C 2M7AA 3VOEA 3A2KA 1FTTA 3BOQA 2QA4I 1IF1A 3WU2C 3CJNA 2FD5A 3ZXSA 2QCOA 1FMVA 2XF7A 3DU6A 2P5KA 4NB5A 1ZN2A 3QWLA 4A0XA 1BR1A 5BOXA 4C3IJ 2VQGA 4OIOF 4UUTA 4IJAA 2ZC2A 4S04A 1FYMA 2NVXJ 3OMYA 5KK1A 3MKLA 3FK7A 4HF2A 2KIMA 2M45A 3BR2A 3CDIA 3M8FA 2BYVE 4EJTA 2PMZN 4PJLA 4HF0A 3F8CA 2XGCA 3GFJA 3CUOA 2QKMB 2XKOA 1H89C 2CW7A 2ZKZA 4CYDA 3JRGA 4UHTA 5K1YA 3HOUJ 4BQOA 4OU0A 4F91B 3Q9SA 5F0HA 2EV0A 3R60A 3A0BC 1ZGAA 2PQ8A 3G1LA 1WKMA 4YFNF 3OYIA 4HQEA 2Y31A 2W84A 2LY9A 3PNTA 3LSGA 2LSOA 3ZMUA 2PN6A 2IVMA 2XGXA 3K4BA 1E0EA 2L5QA 4G7OF 5ILVA 2PMHA 2HVRA 1HDDC 1FY7A 4MQVA 1BL0A 2L7FP 5J8CA 3F72A 3KZZA 2EFPA 2XRLA 1PP8F 3RQ4A 4L9NA 1R5HA 4XLNF 4A3GJ 1S8NA 5A2QK 2M0MA 3BPXA 3WODF 4M71A 4ZYAA 1GDTA 1TWGJ 3RKWA 1I5ZA 1ZAOA 3U9GA 3BG9A 3DWLE 2DA6A 3LMMA 5IYCJ 3N05A 2XAUA 1VQKI 2D1VA 3CCQI 4NUBA 1KA8A 1X4PA 4LLLA 2Z9OA 4JOMA 3GTJJ 4A3IJ 3OYHA 3K4LA 1BR2A 2B7EA 4L0ZB 2GA1A 3L00A 1O3QA 1DDNA 2R7VA 2IGNA 2L7ZA 2M4KA 2K9NA 3AFHA 1IW7F 4BACA 2WWYA 2HQRA 5J3LA 3TL4X 3S2HJ 2FMLA 3E3VA 5J1RA 3A01B 3FISA 3P9CA 4N9IA 2TCTA 4BHPA 1UJ8A 3B73A 2X48A 1UCRA 1KGSA 5LRSA 3RYPA 2OPTA 2KJBA 1XSVA 3I0TA 2COBA 2EFWA 4MNUA 4PZJA 3CP8A 4EM1A 4RAZA 1KQ9A 4IXAA 4CCNA 5K5OA 3V7CA 1IRZA 1B8IB 4DYCA 2HR3A 3F6VA 5DEQA 2EA4A 1GUUA 1OYWA 3VDXA 2IGKA 1R4MB 3F21A 3OYKA 1T0FC 3CCYA 1R9TJ 1IV8A 1ZKGA 3WTUC 3IRRA 3CMYA 1R4NB 5CVIA 3QPLA 4KIFA 5E79C 3GF2A 2Y75A 3KP4A 2D45A 1X1CA 3MWMA 3JTGA 3OYNA 2CFOA 1JT6A 3G4SI 3EQLF 4G12A 2ZMEB 5FLXK 9ANTA 2R0QC 3OL3A 3GZ5A 4MIMA 1ZG5A 1RUOA 2STTA 3FXUA 1J09A 3S1NJ 4TV7A 1Y1WJ 1F9NA 2O9LA 4C9YA 1Y0UA 1AWCA 4HRIA 2RDPA 3S17J 2KISA 3L1PA 3QAHA 4AWXB 4E7SA 1U2WA 3ECHA 3GFLA 5D6EA 4PGHA 1A04A 1BBYA 3COAC 3NEUA 4OMYA 4CCLA 1SFKA 5C4XJ 4UV8A 3H5NA 2VBXA 5GADJ 3BG6A 4E4HA 2L4MA 4WX9A 4A3DJ 3K10A 3RZDJ 1FP2A 3E0JB 2HOEA 2HQAA 1YW7A 3S16J 1R5ID 4KJZA 1IO2A 4MQ9F 1A36A 2JPBA 3OSGA 5GTIC 1Y8RB 3KEYA 4FQGA 2IXSA 1BI3A 3UKGA 2VUMJ 2IS6A 3X2QH 2CUJA 3I4NJ 1MJ9A 1IZ1A 2DPUA 4BAYA 3L2WA 4A6DA 4U0WA 1DGRM 3PSIA 4N0BA 3VSLA 5GAEJ 2IPQX 4IF4A 1YX5A 4RGRA 3KZYA 1JHFA 2L54A 1OCPA 1VNDA 1U8RA 1LFPA 4RAGA 4YFKF 2XRNA 4ENJA 1OCRH 2I8DA 4KT5C 1FT9A 4Q48A 2CO5A 5CLSA 3GTOJ 2F4MB 1Z3XA 5DM6F 3TOAA 3HOTA 5CJ9A 3HKZA 4XLCA 1JXSA 2EQRA 1HC8A 2R7SA 4JYKA 4GDFA 2R5ZB 1BIAA 3CJRB 4C2MJ 3LSKA 2R4GA 3TBIA 4KISA 1PUFB 4H4KC 5DTDA 2W7NA 2OTLI 1UFMA 2F5FA 2DOAA 2W4SA 4JK1X 1WQ2A 1IC8A 2DDAA 3MEXA 1JTXA 4ITVA 1T33A 3TOBA 2M5WA 3JSPA 2KFDA 4ZDLA 3K6GA 4AM3A 4EVIA 1HOMA 2L9NA 1ZHFA 4DOZA 2R7QA 4BEHA 2FE3A 3I53A 1GV5A 4G8XA 1YIOA 3CMMA 1W36C 3SHFA 2QBYB 1FIPA 1SFEA 2PMZA 2WY7Q 2Y30A 1WI9A 3KZIC 1U5TC 3U1DA 1P7JA 2X85A 1XCBA 1ETWA 4YELA 3CF2A 5M5YJ 3W2AA 4OAYA 4HEA2 5HDNA 3ZR8X 2RQQA 2VLAA 5J4VA 2TDXA 3VYTB 1RPWA 2DBBA 3GW2A 2FUG2 3V8JA 4CCMA 1RRJA 4UNOA 5K7ZA 1ITYA 2VOOA 2L3DA 2FBHA 4IPAA 3NARA 1MH3A 5EEHA 3GXOA 3F0CA 1MBJA 2DT5A 4QIWN 2FSWA 2GA2A 4CA0A 2L7KA 5E8GA 4EQQA 2NXNB 1UHWA 4N9HA 1ZQ3P 2IA2A 3DPLC 2DFHA 3L09A 3JRBA 4QWQA 3NWSA 1CQTA 4QPQA 4AYBA 1ZGJA 1XMXA 1J75A 3M3YJ 4A5MA 3FKJA 2HWVA 2LF8A 3MKYB 3TDUC 5C4JJ 4XLFA 1Z0XA 2QEXI 2CWEA 2VXDA 4F93B 2EFOA 2HZDA 1I6XA 2MBFA 3KP6A 1I27A 3TDZC 4NC8A 3H3UA 3BR1A 3IH2A 2BOLA 2QZ8A 3W2VA 1WRJA 3AL0C 1EF4A 4BKXA 1UG0A 2CQNA 1USTA 1JE8A 1B6AA 1T08B 4WXDA 3BR6A 2BY2A 1TWHJ 4FASD 2K3FA 2ZNYA 4DZJA 4A2UA 2KIFA 3H3ZA 2BY0A 4V2FA 2CGPA 5D5VB 1REPC 2ZJQF 2FNAA 1O3SA 3RJPA 4F52A 2EPFA 1HW2A 2K5CA 3MKWB 1VQNI 1ACIA 3BJAA 3JRAA 1YOVB 3BTJA 3I59B 2VC1A 3K1MA 2MA3A 1IN6A 1ZG3A 3FHZA 3Q3SA 3QRFF 2E1CA 2MD0A 3K2AA 3DKWA 1APLC 1VI0A 2QQ8A 1FOKA 4BS9A 4KT6A 4F3QA 5L3FA 3AG3H 5BS6A 3G1OA 4QLCU 1MJAA 2FU4A 1PVEA 2YPRA 3GLXA 5FKOA 3CC2I 1CF7B 2NRAC 1OCTC 2W00A 4D0PA 3R0AA 2V6EA 4HV6A 5HS8A 1V5EA 2LFBA 4N4OB 2WA0A 4L18B 5F6FA 4WF2A 4HNVA 2A5WA 2K4JA 3D5SC 2ZXJA 5J4YA 4HPQA 2DMPA 3N97A 3ONQA 2P0WA 5C44J 4F7ZA 1R36A 2LG4A 3J80K 4WXCA 3R6SA 4F55A 1RKWA 2FF4A 2ME0A 1Y39A 3HG9A 2XB5A 2DODA 1X2MA 4LMYA 5KVRA 4CDGA 1L3LA 4ZJZA 1QZEA 1VQMI 3QYBA 4YIRX 4I09A 2A6TA 2CQQA 2PJRB 1E17A 3W6KB 2PG4A 3S15J 1HQCA 4ZTFA 2H6BA 2PI0A 3KYLA 1IDZA 2E35A 5DUKA 3OSFA 3V42A 2O5RA 5EGOA 3IUOA 1T8IA 1GVJA 2LDUA 4P5OA 1LDJA 3C2GA 1KU2A 2OTJI 3IC7A 5KNLA 2DOFA 4CZZA 3J7AY 5EZHA 4NQWB 5JFRA 4UUSB 2E7XA 3ERED 1GHCA 2DPDA 2WV1A 3CDHA 2BXZA 1NK3P 2EIJH 5DCMA 4M9SA 3QQAA 3QU6A 2ZJPF 1K78A 1R22A 1HKTA 1FNNA 3NWTA 3HSEA 2DK8A 4XMYA 3V8LA 4M3GA 3KETA 4G6DA 2HTJA 1IN8A 3VPRA 4K2EA 4EM0B 3BTCA 2OBPA 1D3YA 5KAFC 2JRMA 2XAHA 1UMQA 2ZXIA 4CYCA 3GUDA 4IHYA 1W5TA 2IAIA 2HEOA 5J1YA 3H9QA 3T5XA 2VI6A 5H20A 1G2HA 3HBLA 4M9ZA 2ELHA 3K4CA 4ZZLA 2HOSA 2WTEA 1DPRA 2GIVA 2BY1A 1RNLA 2R7ZJ 2Z5UA 2XAJA 3BPVA 4IHVA 3PO2J 1T0FA 1PDNC 1I6HJ 2E1MB 1UHMA 4O6JA 1ZRDA 1TLHB 2ZB9A 1TBXA 1YRNB 3FBIB 5FKKA 3F23A 4E7JA 1ONVA 1WJDA 3L2UA 2VPRA 6PAXA 1AHDP 5ERIA 3CC4I 4BL0B 5LGNA 2YR2A 3CCJI 4BH9A 2WC2A 1P4XA 1U3EM 4G94A 1DQUA 3BTIA 1YLFA 2GLOA 3OIPA 3PQKA 5K7FA 4XNFA 3DBHB 3CCRI 2LMDA 1BOBA 4PGGA 2HFHA 5GAGJ 4KDPA 2KJCA 3KP5A 4ZZDA 1V5FA 3FHNA 1Z67A 1WH7A 5ICCA 3GMEA 3LA2A 4LITA 2RNJA 2X0LA 3PUFA 1SAUA 2KP6A 4U7DA 1U6GA 2AXLA 2Y2ZA 2P6SA 1MMDA 3G3ZA 4P55A 3U1KA 3ZQCA 3T8TA 3NRVA 3T0YA 4AIDA 2Z3YA 2BGCA 3P9IA 2E1NA 4B8XA 1ZG1A 4AU7A 3ZOBA 1TL8A 4UB6C 1FSEA 2IBDA 1L0OC 2K7LA 3F9KA 2Z99A 3HGGA 2A61A 2KLOA 2ZO4A 1YO5C 3KIOA 2XAFA 3DBLB 1MMNA 2X51A 1TT0A 2BEOA 2V4JC 1IUFA 2ESHA 4M6XA 2VJ5A 4LG0A 1FMWA 2DMNA 1QHHD 4JX4A 4ABZA 1TP4A 2HVQA 2XSJC 1RKTA 3I54A 4UVBA 4BNCA 5D5UB 1D5YA 5AIPA 4B43A 1ODDA 3R4KA 1YJWI 4MTEA 4HZFA 1ZGWA 1WSUA 3LA7A 1ZR4A 2VODA 3OIQA 2Z2SB 1T38A 2E2JJ 2VE9A 3FK6A 4NBQA 4AVZA 4MFEA 1WHUA 3OY9A 5EG0B 4IRIA 1T98A 1OCOH 3QODA 1OLTA 3VYRB 4FE7A 4G9YA 1ZH5A 1K61A 1XGSA 1HDPA 2RV8A 2V9VA 3CZ6A 4RAFA 2DLLA 3TW6A 1D5VA 4HNUA 5F08A 3RKYA 3OYJA 2BHYA 4GGGA 1QHGA 3EUAA 5KCMA 1OR7C 5E3NA 2LVSA 3K4MA 4HNTA 5BPIA 3V7SA 3IAM2 2LY1A 3IWZA 4Y15A 4D7MA 4CH7A 2AHQA 4V19K 3K4JA 2M8GX 2P8TA 5HS9A 2H09A 2HYFA 2BY3A 2OA4A 1I1SA 2N8GA 1QU3A 4HX8A 2HZTA 1G59A 5FLVA 2KDZA 2R7XA 5DDGA 2VQCA 3SZTA 2VIXA 5C3EJ 1LE8B 4E7LA 2F48A 1JHHA 3IH4A 2LKSA 2TRTA 4Y7NJ 2RREA 3OWTA 4L9JA 5LLQA 3LSPA 1ON1A 2WAFA 4XSZF 4DJAA 3GTQJ 2R92J 4NC7A 1QQIA 4RB0A 2V7FA 2KRFA 4KICA 4XR6A 3SEZA 4J00A 1YE9A 2YUSA 1HXDA 2XVCA 4YEJA 3I4MJ 3SQNA 4DGWB 3H92A 3TEDA 3Q0WA 1MMAA 3FX3A 3U21A 1YITI 2NVYJ 3TO6A 2R3SA 4I0BA 3WE3A 2NVTJ 1IN4A 2VN2A 2H8RA 4IOAF 4XKBA 2DN0A 3S3OA 4ESBA 1TQIA 5IT9Z 1QZZA 2JT1A 1P2FA 1X3ZB 4KMUX 2OC6A 2NNYA 2IGMA 4IEJA 4CCJA 1JUMA 4BE2A 1SEUA 4IHSA 3ML6A 4HDVA 3S8PA 3F22A 3FXOA 4DZPA 3JTHA 1Y0NA 4XQFA 2BBYA 3DLLF 2HKOA 2M0CA 5FROA 2VC0A 2DYSH 2GXAA 3ZQ7A 1VQ9I 1JGSA 1S9HA 1P4AA 1G3YA 5B1AH 2O8KA 1U9NA 1WGXA 5F1RA 3HOWJ 3BDDA 4U87A 3L2CA 4EGZA 4X6AJ 2KIUA 4LIUA 3BJ6A 5LGUA 4Y33A 2X1CA 4WXHA 5L3EA 4ZC3A 3E5UA 4I01A 3C2BA 4PJNA 3ZN0A 5LHHA 1J9IA 2DFFA 3MN2A 1W4MA 5LEJA 1HSTA 1S6LA 1AKHB 3RPUD 4D9JA 1ZRFA 3O6BB 2EH3A 3K1PA 4V2GA 2OZUA 3OYDA 4IQJA 1XGNA 4ZYEA 2HI3A 2G7HA 2ELJA 1B72B 5L3BA 5HVQC 4BBRJ 2VJIA 1D1BA 4YRVA 5J40A 3CCUI 1MMGA 1BW5A 4XLAA 2KQRA 2X9DA 4AYBN 3GFIA 3HUGB 2XGDA 1SVLA 2FBKA 3HOXJ 4A5NA 4CGZA 1YW9A 3VB2A 2VT2A 3CO7C 2ACJA 4UUVA 1XC5A 3OIOA 4BXFA 3DFGA 2BE5F 3BROA 3WG7H 1FC3A 2WBMA 2M1BA 3ELKA 4RA2A 4RMNA 4RB3C 3C3WA 4QPOA 4CCKA 3VEPA 2BXYA 2IEKA 2JVGA 2LC2A 4HSRA 1HCRA 2QKLB 4XN0A 5F27A 2LBFA 1MD0A 2BW3B 5J47A 1U8BA 3H36A 3HEFA 4XM3A 2RQPA 4BQQA 2V6CA 4MEYF 1WH5A 5H6QA 4QTRA 4I98B 3TP0A 1LFBA 4E7IA 3HYIA 4Z2YA 1LNWA 1J59A 2Q2EB 3QPTA 3ZCOA 2BVMA 4FX4A 4HQMA 2AXTC 3OS1A 3PQJA 2JSPA 2DTRA 2R7UA 2F5DA 4Y3OA 2E60A 1S3JA 1O7LA 2ETHA 2LF7A 2UXXA 3BR5A 5GPCA 1FJLA 1XPXA 1MIJA 2ADUA 3OYBA 1JKRC 5HOOA 5L3DA 5FD6A 2VKDA 5FFXA 3L2QA 4BDYA 1MNEA 2M34A 1ULYA 4XOTA 1R1UA 3E7LA 2JJ7A 2LTPA 5J8FA 4EJWA 1NK2P 2ID3A 2ZXHA 3NAUA 2NVUB 1YJNI 2FMYA 3H9JA 1HW1A 1STZA 2VKVA 4IOCF 2CU7A 2VASA 3FM5A 2MW8A 1MDMA 3ZMSA 3PSFA 2IS2A 2LOOA 1XMKA 5DD8A 2LH9A 4IHXA 4CXFA 2CMPA 5ICEA 4C3HJ 3ZGKA 3OOUA 2MABA 4M3BA 1K6YA 2DDBA 1PP7U 2NYXA 2O03A 3N4MA 3F6OA 2ECCA 5IOYA 1MKMA 2R7OA 3CCEI 2EJRA 1POGA 3BZKA 3GVAA 4AIJA 3E1SA 3RZOJ 2DA1A 2K9MA 4XLPF 3FXRA 2WB1A 1R49A 2HPMA 2AS5F 3DPTA 2B63J 1GV2A 3BTLA 4XRMA 3MKZA 2XSDC 2FXAA 1FWZA 3MCZA 3RKXA 3GEZA 2RKHA 1H9TA 2DO7A 5E3OA 4XONA 4IHWA 5GP9A 5FKLA 3FKIJ 2DCEA 1R5GA 2G7UA 5LBQA 2I5UA 1YX3A 2K86A 1IRGA 4RLFA 2QSHX 1V5GA 2MH2A 2XHKA 4Q5SF 4KA4A 1LKXA 1XCVA 2VBYA 2XAGA 3CDLA 2DYRH 3AG4H 3H0GJ 1VQLI 1W0TA 3ESWB 4BXXJ 1LPQA 4RGSA 5DV5A 4AC0A 1T39A 1N25A 3O3KA 4LK1F 3F8BA 4PFPA 1BM9A 3ZN1A 2EBIA 5CQGA 2JRTA 1F5TA 1W7PD 3HZJA 4KN4X 4M3DA 1HA8A 5FGMA 2MG4A 1I1GA 2X1EA 4BDZA 3K1NA 3HB9A 2CYYA 1MNMC 1Z7LA 1FEXA 4FCYA 4L5EA 4IRHA 3GFMA 5D8KB 3DKXA 4XK4A 4EV0A 1QBJA 1RI7A 3KP2A 4ANJA 4PCQA 3TKYA 3LNQA 2IJLA 2E36A 2X4HA 4DBRA 2W82A 3DEUA 1C0WA 4HA8A 5L3CA 1TWFJ 2V1XA 3DU5A 2EIMH 3WGIA 2V79A 4BQAA 1HSJA 4M72A 1ETYA 3K4KA 3ABUA 1D1CA 5JVTA 3PFIA 2HYJA 4XICA 5FRMA 2XIGA 1KU3A 2YU9J 1J5YA 1W7PB 2KHMA 2NS8A 3CUQB 2O8XA 4S0HB 4YFXF 2L01A 2L9SA 3FBNB 1LJ9A 1TTYA 5EDNA 3B6AA 5CVRA 2EZIA 1WFXA 1XD7A 1G3SA 1JKQC 1YHQI 2HS5A 3G71I 1ETVA 4FISA 3LSMA 5FLMJ 1EH6A 2X6YA 4JQFA 1N75A 3FXKA 2ME6A 2ZSHB 4O3MA 2QQBA 3OYMA 1UHSA 3P5JA 4FT8A 3EUKL 2WV0A 1OR7A 1X1PA 2VXZA 1FBSA 1P7IA 3LFUA 1U5TB 3KCCA 1A35A 4QSHA 1S29A 3ZMTA 4B44A 5BMZA 1S5LC 3C2HA 1VFCA 2DOEA 4ON0A 3CJTB 4PJ0C 3ABTA 1A31A 4A6EA 3EDPA 4HX4A 1ZRCA 1T2KA 3CP2A 3WGGA 3DBRB 2JPCA 2HDCA 2HGCA 4A69C 1FBUA 2GOMA 2L2OA 2L7MP 3SDGA 2RNGA 3SDBA 2DJIA 4PDKA 4R79A 2DA2A 5IY5H 1MMSA 2A3SA 5E3LA 3OYEA 1JUPA 3FXMA 3WGHA 5ED4A 1OISA 1I3AA 1VQ8I 1D8JA 3J81Z 5HLGA 4II2A 4ENMA 2HNHA 2M8EA 3WG9A 4MTDA 4ZTJA 4ENNA 1WJEA 4FETA 3RTRA 1HKQA 3ZRGA 4Y52J 2LR8A 3IKVA 3I55I 3L2VA 1JJ6C 1G4DA 3HXLA 1I3QJ 3ABKH 3KYDB 1VTNC 5HLIA 3G2BA 4A3FJ 4RBOA 1WCMJ 1J0RA 3ZPLA 2JMWA 3QP6A 4OMZA 4A3LJ 2R5YB 3CLQA 4LK0F 2DMUA 2ICWG 1RESA 2CW8A 4ASNA 1U0JA 1NHAA 1OJLA 4A0YA 4PJJA 5CVVA 5DM7F 5HLHA 3DLAA 3SJMA 2G9WA 4HLXA 1VQ7I 2ELKA 4MLOA 3FM3A 5IPAA 1P9QC 4I02A 3LFKA 1ETKA 1JTYA 2VB6A 4LGWA 2GWRA 1OYYA 3PM1A 2E34A 1Y6IA 4HSTA 3S1QJ 2CJJA 2DQLA 2KL4A 2M87A 3RKQA 1SD4A 5CPRB 1X19A 2W48A 4Y13A 4XRFA 2I10A 3CO6C 5AONA 5GPAA 1RC9A 3UNGC 4NDLA 2H6CA 1BOAA 1PUEE 1SC7A 3I56I 2JA6J 1VZ0A 2VQHA 2M2EA 3GTLJ 4IQ4A 2EB7A 2EK5A 4KFCA 4ESFA 2M3AA 5D5XB 2CW0F 4PSXA 2XKPA 2V26A 1AA7A 1MBHA 3Q5FA 2GXBA 1X1BA 5JI6A 4XIDA 1TWAJ 4ZDOA 3I64A 1MH4A 3WHCA 3J7AO 2OV7A 3QPSA 3P9KA 2WAEA 2JA5J 1UB9A 2YS9A 3V8KA 2OCCH 2GAUA 2NOJB 5HLTA 3WTSC 3IL2A 1MSFC 1NG7A 2XV4S 4OWRB 2PEXA 1K4SA 1O57A 1F43A 2E5NA 2EWNA 1WJBA 2DW4A 1XTAA 2DA5A 2OCEA 1IN5A 2OZ6A 3EPZA 3FDYA 1X3WB 1Z1DA 2HQ5A 3PNVA 3JRHA 2Z33A 2EINH 3ZQLA 4A3JJ 4OIRF 4U0VA 3VYUB 3JRFA 3KEOA 5TGTA 2WAQA 2KZGA 3M8JA 1LDDA 5FD5A 4CZCA 1SANA 1LFUP 2O61A 3HHHA 5FRNA 1SFUA 4MHGA 4AIHA 2XUBA 2IS1A 1X58A 1KYWA 3PIOF 1QO0D 3G6EI 2K85A 3PO3J 2NS7A 1U9OA 3JREA 1RUNA 3KE2A 3CCVI 2H1KA 5EEGA 2KMUA 1NH3A 3OV8A 3Q9VA 2MC4A 1FP1D 2C6YA 2RC4A 3M1EA 3A01A 2PLYA 4BU2A 1LVKA 3LSRA 3DKYA 2F5CA 3GTMJ 4BHCA 1XX5A 4UXNA 3RQIA 5IP9J 1VQ5I 4BYYA 3LOCA 4XKCA 1KZHA 2P5VA 1Q1VA 3W2WA 4GFBA 1B8IA 2EIKH 1OPCA 5TJJA 3ASNH 5B1BH 3TW7A 2JUCA 1IXCA 2DA3A 2V9PA 2LK2A 4C2UA 2QQAA 1X3UA 4OIQF 3JR9A 1BR4A 2VKEA 2E1MC 2DU9A 3BC8A 1IV6A 4PJMA 3DP7A 4LLNA 5IYDJ 3NQOA 3IHUA 2ZNZA 3GZ6A 4D5FA 2ZFUA 4YIIA 2Y9ZA 4Z6YA 2VJJA 1EA3A 1YI2I 1Z6TA 1MSEC 2Y0SN 2L02A 3BR0A 2PBIA 3E5XA 2ZMEA 1T56A 2H94A 2W57A 1HF0A 1HKSA 2L0KA 1W1WE 4BJTA 1JKOC 2RGVA 2QWWA 4WCGA 2EV5A 2RN7A 1ETQA 4AUXA 4C2TA 2FOKA 2M30A 5E1XA 1IGNA 4WWCA 4LLGF 3F8FA 1A6QA 4EATA 4CSWA 1O7FA 4KNYA 3IV5A 3WU1B 1I50J 4P9FA 1QGPA 3OR1C 2QGUA 3VWBA 4E70A 5CKTA 1OFCX 2MLKA 2XAQA 3S3MA 5A2QZ 2CUEA 3AKZA 1YS6A 4F92B 3ZP5A 2JSCA 2OD5A 1XB4A 4J19A 1B9NA 1Z05A 3CCSI 2OF7A 2OQRA 4JX5A 1GXPA 2M7BA 4GYGA 2K40A 4M74A 2CV2A 2VOPA 1JI8A 2FNPA 3JCUC 4PSWA 5K5RA 4CUGA 2XDVA 4KUMA 5IOZA 3H0DA 2JA8J 3ABLH 3ZMVA 4RB1A 4OOIA 4D5CA 5IYBJ 2Z16A 4E7ZA 3HRUA 4BEHB 4BGDA 4U0YA 2O0YA 2WB1N 1G8XA 3CMAI 1K6OA 1RR8C 2DI3A 4IO9F 1S7OA 5LD2C 4DW6A 1WZ2A 4X0GA 2W24A 3SYTA 5JLWA 1R00A 2MFZA 3BP8A 5IP6A 2VONA 1DP3A 4FE4A 2R5ZA 4B09A 4MEXF 1PUFA 3RSNA 3QOEA 3AG1H 1TQMA 4YIFA 4HYEA 1SVMA 2OU2A 4RLQA 1BJZA 2GZWA 2CUZA 3MAJA 5CQEA 2HVSA 1MBFA 4X1EA 3S1MJ 2CQKA 5ICGA 3BQYA 1G3WA 2DFIA 4A3KJ 1EJ9A 2QBYA 5ILSA 5D5WB 2XB0X 4RM3A 2J5OA 3QYEA 5F64A 1Z77A 2DQRA 3FXJA 4I7HA 5L3GA 4I2OA 2AO9A 5FLXZ 2UZKA 5FKNA 1VQ4I 2DA4A 2A68F 4P96A 2V1DA 2BVLA 2L9RA 1SD5A 2EZHA 4R1HA 1JUSA 4EJVA 3HOSA 4A3MJ 1AU7A 1GVDA 3D0SA 3MZHA 4EM2A 1TWCJ 3L7WA 3V7RA 3J7ZI 2R93J 4DQ2A 1FOWA 1VQPI 3HPHA 4XORA 3WE2A 2FQ4A 2ZBKA 2A5YB 3ZQFA 4KITB 4L9VA 2LNBA 3HTSB 2D5VA 3GYHX 1G3TA 2L9VA 5JHUA 3R0JA 2CSOA 2OUMA 1FSHA 2CUFA 3W6VA 2G0EA 3BR3A 4IKFA 3FMSA 3DTKA 3OYGA 2K27A 2F5VA 4L5IA 4CHUA 4NC6A 4BHBA 1G6NA 3E6DA 1KU7A 3DEWA 5DD4A 1SAXA 2CV1A 5HODA 1XDUA 5FFZA 1FPQA 2YU3A 1IRFA 2BHZA 2LD5A 1AOYA 3KX2A 3JRDA 1X1DA 3GO5A 1YIJI 3OYFA 5D4SA 4NNJA 3ROUA 1K4TA 2HQNA 3FMQA 4RS8A 1H88C 1MJBA 2CRGA 3KYCB 4Q47A 3GX4X 1BI0A 2UWMA 3HHGA 3K9TA 1M1EB 2CQXA 1B59A 3TO7A 2EV6A 4RB2C 2R5YA 2UV1A 3KPHA 4L5JA 1LUJB 4B48A 3PUBA 3E6CC 3I59A 3HOYJ 5DYMA 5EZGA 3WTZA 3JAMZ 5B3SH 3PIPF 1ZLJA 1WJCA 5TISC 3EYYA 1BI2A 2NNNA 2CFXA 1J2XA 2A6HF 2LLKA 2M4GA 3JSOA 1FTZA 1FBQA 1SD7A 4O5VA 3O8GA 2P7VB 1CF7A 4ZYDA 1B4AA 3HSRA 2OQGA 4ZDPA 1DP7P 3AG2H 3QP5A 3BLYA 3DEEA 4HV5A 2IA1A 1NG6A 1V54H 2JK3A
chains in the Genus database with same CATH topology
4L0YB 1FX7A 1R1VA 5FO5A 2OAZA 5D8LB 4LJZF 3RDIA 3SFZA 2YX7A 4LB5A 2COMA 2A69F 3SZPA 1EV7A 2GXGA 3KFWX 2QLZA 1XDSA 2EA2A 3HRTA 3KLNA 5DCMB 1K7AA 4A12A 2D1HA 3FF5A 1TQPA 1K78B 4YG2F 2J5PA 3E5QA 4HX7A 3TQNA 5AIQA 4UV9A 2PFBA 5DCFA 1RIOH 4R8HA 3T1BA 4KYWA 4I0AA 5TRDA 1F1ZA 3SXYA 4G7ZF 5CVJA 4NQWA 5DUIA 1TNSA 1QZYA 3KLOA 4MGRA 5LRRA 4LB6B 3U2RA 1E2XA 2LKPA 1GXQA 2EFQA 2QQ9A 4CICA 2F2EA 1WWXA 1HBXG 3HRMA 3LAJA 2D2WA 1K79A 2Y48A 3HIFA 3C1DA 4RGUA 2QYOA 2P7CB 1XMAA 2B0LA 3WTXC 2L4AA 2VE8A 2DAOA 3K2ZA 3GWZA 1H0MA 4HAMA 1QPMA 3K0LA 5IT9K 2BV6A 4IHTA 2QVOA 3MZYA 1V4RA 2QENA 3E6MA 1LB2A 1BN5A 2FEZA 3J80Z 3C7JA 1IXSB 2NS0A 5LGTA 1V3FA 5LHGA 4LG0B 1EH7A 5LEKA 3T8RA 1T6SA 2K02A 2P6TA 2W25A 2RVCA 4OIPF 1P6RA 1R1TA 1XSXA 3EYIA 1SMTA 5HDKA 2CG4A 3LAPA 2YSRA 2QM3A 5K5QA 1ZYRF 2PMUA 2IP2A 3P7NA 5E8IA 3F8MA 1EH8A 1S7AA 2FBIA 3MQ0A 3RYRA 5ILUA 2O3FA 3JAMK 5CVUA 3CUQC 2IW5A 2FRHA 1XGMA 3W6JB 2HKXA 3I58A 3MFKA 1YQAA 3FMRA 1D8KA 3TGNA 1LQ1A 1DPUA 3R61A 1O3RA 3K69A 3HSFA 2XROA 2O6GE 3BZ6A 2ESNA 3I5UA 1BIBA 3B02A 1Z91A 4ETSA 5LHIA 3M8EA 2Q0OA 3G73A 4NHJA 2VBWA 3I71A 4XSXF 3V4GA 4EMSA 3ZMZA 3BY6A 4Y17A 1ZREA 2V1UA 4M9XA 4AD9A 4ESJA 1IUYA 1XSDA 4G6QA 4CO8A 2E7WA 4S05A 4EGYA 3OOPA 1SFXA 4KMFA 5JR3A 2IT0A 2Y0MA 4GYIA 4U88A 3VFZA 1IN7A 3I4PA 3WTVC 2GQQA 1TW2A 2P5LC 3LWFA 3LA3A 4HDUA 1J7KA 4G7HF 1DUXC 3LSTA 2HTSA 4WK8F 5E1ZB 3LQRA 3M9AA 4HLYA 1YG2A 1O3TA 2W85A 3ZMDA 1R58A 4LD5A 3D5LA 3QOPA 1KQ0A 5ICFA 3QPHA 5HDGA 5E20A 2KKOA 1LEAA 2A6EF 5D4RA 2PJPA 1F4KA 2QUFA 1OKRA 1Z9CA 5HS7A 2MH9A 3O2PE 5H6RA 3DXJF 4BXUA 1OYIA 1YW8A 4IRGA 5BPDA 4M6YA 4ZYGA 3AAFA 1P4WA 1XGOA 3HUGA 3WTYC 1BC7C 4ZYHA 3CLOA 4RGXA 1IAWA 4U7BA 1TW3A 2ZFWA 2F5EA 5CYVA 3DQVC 3FXQA 2ISZA 3IRQA 4HBLA 1FZPB 3WTTC 1YS7A 4GO1A 1TNTA 3RIRA 4UVAA 5IT3A 3C18A 1USSA 1YFHA 2FA5A 1MDMB 2DK5A 4KIBA 1MZBA 2VT3A 4A0ZA 3RPUA 2Q2EA 3F3XA 1ZARA 3FZVA 1Z6RA 2IA0A 3E97A 3EETA 3QU3A 2MC3A 2JZYA 1RZ4A 1SD6A 2XASA 1LEBA 4HW0A 3VODA 3KEQA 4EJUA 5J6XA 1H9GA 3ECOA 1FYLA 4AIKA 4ZH4F 3BWGA 5D6FA 2H27A 4RAYA 4OINF 3ISPA 2R7FA 1IXRC 3E6BA 2P4WA 4XBFA 4HF1A 3J81K 2FQ3A 4JBAA 1B1BA 3DF8A 4Q4ZF 1ZLKA 3M7GA 1Z7UA 4M73A 5E18F 3JW4A 3DV8A 1OMIA 1Q1HA 1W5SA 1KYZA 2K4BA 2NAZA 5FB2A 4HOBA 1MGTA 2STWA 3KP7A 1FLIA 4ENKA 4FX0A 1CGPA 3F8NA 3FWEA 3S2WA 1HW5A 1YYVA 3REOA 4GCVA 4UVCA 3L9FA 3EUHA 4KN7X 1BI1A 2HYGD 1P92A 2EFNA 1YTYA 1SMYF 5BQTA 1U78A 4P9UA 4GXOA 4FHTA 3IWFA 4EJOA 3LQQA 2YX4A 1FYKA 1R23A 3IKTA 2UXNA 2R7DA 4LFUA 1LDKB 1BC8C 1R7JA 3ULQB 1W7PA 3CUQA 4H0EA 5E17F 2MLGA 1KQ8A 1LVAA 2ISYA 2JTVA 2A07F 4L9TA 3HTUA 3RI4A 2VBZA 5E1WA 2IRFG 1QNTA 4IVNA 2Q8KA 3CTAA 3WTWC 1U5TA 3RPQA 3TO9A 1B9MA 2MD5A 1BJAA 4KIGA 3BJOA 2ZJ2A 3HRSA 1KU9A 4DNCA 1XN7A 4AVPA 2ZCWA 1ON2A 3WU0A 3KP3A 3VOEA 3BOQA 1IF1A 3CJNA 2P5KA 4NB5A 1ZN2A 4A0XA 5BOXA 4OIOF 4IJAA 4S04A 1FYMA 5KK1A 4HF2A 2KIMA 2M45A 3M8FA 2BYVE 4EJTA 4HF0A 3F8CA 3GFJA 3CUOA 2XKOA 2ZKZA 4CYDA 4UHTA 5K1YA 4OU0A 3Q9SA 2EV0A 3R60A 1ZGAA 2PQ8A 4YFNF 1WKMA 4HQEA 2W84A 2LSOA 3ZMUA 2PN6A 2IVMA 2XGXA 4G7OF 5ILVA 2PMHA 1FY7A 4MQVA 5J8CA 3F72A 3KZZA 2EFPA 1PP8F 4L9NA 1R5HA 4XLNF 1S8NA 5A2QK 3BPXA 3WODF 4M71A 3RKWA 1I5ZA 1ZAOA 3U9GA 2D1VA 1KA8A 4LLLA 2Z9OA 4L0ZB 2GA1A 3L00A 1O3QA 1DDNA 1IW7F 2WWYA 2HQRA 2FMLA 3E3VA 3P9CA 4N9IA 4BHPA 3B73A 1UCRA 1KGSA 5LRSA 3RYPA 2KJBA 1XSVA 3I0TA 2EFWA 4MNUA 4PZJA 4EM1A 4RAZA 1KQ9A 4IXAA 5K5OA 3V7CA 2HR3A 3F6VA 5DEQA 2EA4A 1OYWA 3F21A 3IRRA 3WTUC 5CVIA 4KIFA 3GF2A 2Y75A 3KP4A 2D45A 3MWMA 3JTGA 3EQLF 2ZMEB 5FLXK 3GZ5A 1ZG5A 1RUOA 2STTA 3FXUA 4TV7A 1F9NA 1Y0UA 1AWCA 2RDPA 3QAHA 4AWXB 1U2WA 3ECHA 3GFLA 5D6EA 4PGHA 1A04A 1BBYA 3COAC 3NEUA 4OMYA 4UV8A 2VBXA 2L4MA 4WX9A 1FP2A 2HOEA 1YW7A 4MQ9F 2JPBA 1BI3A 1MJ9A 1IZ1A 2DPUA 4BAYA 4A6DA 4U0WA 4N0BA 2IPQX 4IF4A 4RGRA 3KZYA 1JHFA 2L54A 1U8RA 4YFKF 2XRNA 4ENJA 4KT5C 1FT9A 4Q48A 2CO5A 5CLSA 3TOAA 3HOTA 5CJ9A 1JXSA 1BIAA 1UFMA 2F5FA 4JK1X 1WQ2A 3MEXA 3TOBA 2M5WA 3JSPA 4EVIA 1ZHFA 2FE3A 3I53A 4G8XA 1YIOA 3SHFA 2QBYB 1SFEA 1WI9A 1U5TC 3U1DA 1XCBA 5HDNA 2TDXA 2DBBA 3GW2A 3V8JA 4UNOA 2VOOA 2L3DA 2FBHA 4IPAA 5EEHA 3GXOA 2DT5A 2FSWA 2GA2A 5E8GA 4EQQA 1UHWA 4N9HA 2IA2A 3DPLC 3L09A 4QWQA 1ZGJA 1J75A 4A5MA 2HWVA 2LF8A 3TDUC 2CWEA 2EFOA 1I6XA 2MBFA 3KP6A 1I27A 3TDZC 3H3UA 2QZ8A 1WRJA 1JE8A 1USTA 1B6AA 4WXDA 2ZNYA 4A2UA 2KIFA 3H3ZA 2CGPA 5D5VB 1REPC 1O3SA 2FNAA 3RJPA 1HW2A 3BJAA 3I59B 2VC1A 3K1MA 2MA3A 1IN6A 1ZG3A 3FHZA 3QRFF 2E1CA 3DKWA 1FOKA 5L3FA 5BS6A 4QLCU 1MJAA 2FU4A 2YPRA 3GLXA 1CF7B 2NRAC 4D0PA 3R0AA 4HV6A 5HS8A 4L18B 5F6FA 4WF2A 2K4JA 2ZXJA 3N97A 4F7ZA 1R36A 3J80K 4WXCA 3R6SA 2FF4A 4LMYA 5KVRA 4CDGA 1L3LA 4I09A 1E17A 3W6KB 2PG4A 1HQCA 2H6BA 2PI0A 5DUKA 1GVJA 2LDUA 4P5OA 1LDJA 1KU2A 3IC7A 4CZZA 5JFRA 2E7XA 3ERED 1GHCA 2DPDA 3CDHA 5DCMA 4M9SA 3QU6A 1K78A 1R22A 1HKTA 1FNNA 3HSEA 2DK8A 3V8LA 3KETA 4G6DA 2HTJA 1IN8A 4K2EA 4EM0B 2OBPA 1D3YA 2XAHA 3GUDA 1W5TA 2HEOA 3T5XA 5H20A 4M9ZA 2ELHA 4ZZLA 2WTEA 1DPRA 2GIVA 1RNLA 2Z5UA 2XAJA 3BPVA 1T0FA 1PDNC 1UHMA 4O6JA 1ZRDA 1TLHB 1TBXA 3F23A 1ONVA 6PAXA 5ERIA 5LGNA 2YR2A 4BH9A 2WC2A 1P4XA 1U3EM 4G94A 1YLFA 3PQKA 4KDPA 4PGGA 2HFHA 2KJCA 3KP5A 4ZZDA 5ICCA 3LA2A 2RNJA 2X0LA 4U7DA 1U6GA 2AXLA 2P6SA 3G3ZA 4P55A 3T8TA 3NRVA 3T0YA 2Z3YA 2BGCA 3P9IA 2E1NA 4B8XA 1ZG1A 1FSEA 1L0OC 2K7LA 2Z99A 2A61A 2ZO4A 1YO5C 2XAFA 2BEOA 4LG0A 2ESHA 4M6XA 3I54A 4UVBA 4BNCA 5D5UB 5AIPA 1ODDA 3R4KA 4MTEA 4HZFA 1WSUA 2VODA 3LA7A 1T38A 2VE9A 4IRIA 1T98A 1ZH5A 4G9YA 1XGSA 2RV8A 2V9VA 2DLLA 1D5VA 3RKYA 4GGGA 5BPIA 3V7SA 3IWZA 4Y15A 2P8TA 5HS9A 2H09A 2HYFA 2OA4A 1I1SA 4HX8A 2HZTA 5DDGA 3SZTA 1JHHA 4L9JA 5LLQA 1ON1A 4XSZF 4RB0A 1QQIA 2KRFA 4KICA 1HXDA 2XVCA 3SQNA 3H92A 3FX3A 3TO6A 2R3SA 4I0BA 3WE3A 1IN4A 2VN2A 4ESBA 1TQIA 5IT9Z 1QZZA 2JT1A 1P2FA 4KMUX 2NNYA 4IHSA 3ML6A 4HDVA 3F22A 3JTHA 2BBYA 2HKOA 2VC0A 3ZQ7A 1JGSA 1P4AA 1G3YA 5F1RA 3BDDA 3L2CA 4EGZA 2KIUA 3BJ6A 5LGUA 4WXHA 5L3EA 3E5UA 4I01A 3ZN0A 1J9IA 5LHHA 1W4MA 5LEJA 1HSTA 1S6LA 1ZRFA 3O6BB 3K1PA 2OZUA 1XGNA 4ZYEA 2G7HA 5L3BA 5HVQC 3GFIA 2FBKA 4A5NA 4CGZA 1YW9A 3VB2A 2VT2A 3CO7C 2ACJA 4UUVA 3DFGA 2BE5F 3BROA 1FC3A 2M1BA 3ELKA 4RB3C 3C3WA 3VEPA 1MD0A 2RQPA 2V6CA 4MEYF 5H6QA 4I98B 3HYIA 4Z2YA 1LNWA 1J59A 3QPTA 4FX4A 4HQMA 3PQJA 2DTRA 2F5DA 1S3JA 1O7LA 2ETHA 2LF7A 2UXXA 2ADUA 5HOOA 5L3DA 5FD6A 5FFXA 1ULYA 1R1UA 5J8FA 4EJWA 2FMYA 1HW1A 1STZA 3FM5A 1MDMA 3ZMSA 1XMKA 5DD8A 4CXFA 5ICEA 1PP7U 2NYXA 2O03A 3N4MA 3F6OA 1MKMA 2EJRA 3GVAA 4AIJA 4XLPF 3FXRA 2AS5F 3DPTA 2FXAA 1FWZA 3MCZA 3RKXA 3GEZA 2RKHA 1H9TA 2DO7A 1R5GA 2G7UA 5LBQA 2K86A 1IRGA 2MH2A 2XHKA 4Q5SF 4KA4A 1XCVA 2VBYA 2XAGA 4RGSA 5DV5A 1T39A 3O3KA 4LK1F 3F8BA 1BM9A 3ZN1A 2JRTA 1F5TA 1W7PD 4KN4X 5FGMA 1I1GA 3K1NA 2CYYA 4IRHA 3GFMA 5D8KB 4EV0A 1QBJA 1RI7A 3KP2A 4PCQA 3TKYA 2IJLA 2X4HA 3DEUA 1C0WA 4HA8A 5L3CA 2V1XA 3WGIA 2V79A 4BQAA 1HSJA 4M72A 3ABUA 5JVTA 3PFIA 2XIGA 1KU3A 1J5YA 1W7PB 3CUQB 2O8XA 4YFXF 2L01A 1LJ9A 1TTYA 5CVRA 1XD7A 1G3SA 2HS5A 1EH6A 4JQFA 4O3MA 2QQBA 4FT8A 2WV0A 1OR7A 2VXZA 1FBSA 1U5TB 3KCCA 1S29A 3ZMTA 5BMZA 4ON0A 3ABTA 4A6EA 3EDPA 4HX4A 1ZRCA 1T2KA 3WGGA 2JPCA 2HDCA 2HGCA 1FBUA 4PDKA 4R79A 2A3SA 5ED4A 3WGHA 1D8JA 3J81Z 5HLGA 4ENMA 2M8EA 3WG9A 4MTDA 4ENNA 3RTRA 1HKQA 3IKVA 1G4DA 1VTNC 5HLIA 1J0RA 3ZPLA 3QP6A 4OMZA 4LK0F 4ASNA 1NHAA 4A0YA 5CVVA 5HLHA 2G9WA 4HLXA 3FM3A 4I02A 3LFKA 4LGWA 2GWRA 1OYYA 2DQLA 2M87A 1SD4A 4Y13A 4XRFA 3CO6C 5AONA 2H6CA 1BOAA 1PUEE 2EB7A 2EK5A 4KFCA 4ESFA 5D5XB 2CW0F 2XKPA 3Q5FA 2GXBA 5JI6A 3I64A 3J7AO 3P9KA 1UB9A 3V8KA 2GAUA 3IL2A 3WTSC 2XV4S 2PEXA 1O57A 2EWNA 2DW4A 1IN5A 2OZ6A 1Z1DA 2Z33A 4OIRF 4U0VA 3KEOA 1LDDA 5FD5A 2O61A 3HHHA 1SFUA 4MHGA 4AIHA 2XUBA 1KYWA 1QO0D 1RUNA 3KE2A 5EEGA 3OV8A 3Q9VA 1FP1D 2C6YA 2RC4A 3M1EA 2PLYA 2F5CA 4BHCA 4UXNA 4BYYA 2P5VA 5TJJA 1OPCA 1IXCA 2QQAA 1X3UA 4OIQF 2DU9A 3DP7A 4LLNA 3NQOA 3IHUA 2ZNZA 3GZ6A 4YIIA 1Z6TA 2L02A 2PBIA 3E5XA 2ZMEA 2H94A 2W57A 1HKSA 2RGVA 2QWWA 4WCGA 2EV5A 2RN7A 2FOKA 2M30A 5E1XA 4WWCA 4LLGF 3F8FA 1O7FA 4KNYA 3WU1B 4P9FA 1QGPA 4E70A 2MLKA 2XAQA 5A2QZ 1YS6A 3ZP5A 2JSCA 2OD5A 1XB4A 1B9NA 1Z05A 1GXPA 2OQRA 2VOPA 4GYGA 4M74A 2FNPA 5K5RA 4KUMA 3ZMVA 4RB1A 4OOIA 3HRUA 4U0YA 2O0YA 1K6OA 2DI3A 1S7OA 2W24A 1R00A 3BP8A 2VONA 4B09A 4MEXF 1TQMA 4YIFA 4HYEA 2OU2A 2GZWA 3MAJA 2CQKA 5ICGA 1G3WA 2DFIA 2QBYA 5ILSA 5D5WB 2J5OA 5F64A 2DQRA 4I7HA 5L3GA 4I2OA 5FLXZ 2UZKA 2A68F 4P96A 2V1DA 3HOSA 4EJVA 1SD5A 4R1HA 3D0SA 3MZHA 4EM2A 3L7WA 3V7RA 4DQ2A 3WE2A 2ZBKA 2A5YB 4L9VA 2LNBA 3HTSB 3GYHX 1G3TA 5JHUA 3R0JA 2CSOA 1FSHA 3FMSA 2K27A 4L5IA 4CHUA 4BHBA 1G6NA 3E6DA 1KU7A 5DD4A 1SAXA 1XDUA 5FFZA 1FPQA 2YU3A 1IRFA 1AOYA 3GO5A 5D4SA 3ROUA 2HQNA 3FMQA 4RS8A 1MJBA 4Q47A 3GX4X 1BI0A 2UWMA 3HHGA 3K9TA 1B59A 3TO7A 2EV6A 4RB2C 4L5JA 3E6CC 3I59A 5DYMA 3JAMZ 3WTZA 1ZLJA 3EYYA 1BI2A 2NNNA 2CFXA 1J2XA 2A6HF 3JSOA 1FBQA 1SD7A 4O5VA 2P7VB 1CF7A 4ZYDA 1B4AA 3HSRA 2OQGA 1DP7P 3QP5A 4HV5A 2IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L0Y B;  1FX7 A;  1R1V A;  5FO5 A;  2OAZ A;  5D8L B;  4LJZ F;  3RDI A;  3SFZ A;  2YX7 A;  4LB5 A;  2COM A;  2A69 F;  3SZP A;  1EV7 A;  2GXG A;  3KFW X;  2QLZ A;  1XDS A;  2EA2 A;  3HRT A;  3KLN A;  5DCM B;  1K7A A;  4A12 A;  2D1H A;  3FF5 A;  1TQP A;  1K78 B;  4YG2 F;  2J5P A;  3E5Q A;  4HX7 A;  3TQN A;  5AIQ A;  4UV9 A;  2PFB A;  5DCF A;  1RIO H;  4R8H A;  3T1B A;  4KYW A;  4I0A A;  5TRD A;  1F1Z A;  3SXY A;  4G7Z F;  5CVJ A;  4NQW A;  5DUI A;  1TNS A;  1QZY A;  3KLO A;  4MGR A;  5LRR A;  4LB6 B;  3U2R A;  1E2X A;  2LKP A;  1GXQ A;  2EFQ A;  2QQ9 A;  4CIC A;  2F2E A;  1WWX A;  1HBX G;  3HRM A;  3LAJ A;  2D2W A;  1K79 A;  2Y48 A;  3HIF A;  3C1D A;  4RGU A;  2QYO A;  2P7C B;  1XMA A;  2B0L A;  3WTX C;  2L4A A;  2VE8 A;  2DAO A;  3K2Z A;  3GWZ A;  1H0M A;  4HAM A;  1QPM A;  3K0L A;  5IT9 K;  2BV6 A;  4IHT A;  2QVO A;  3MZY A;  1V4R A;  2QEN A;  3E6M A;  1LB2 A;  1BN5 A;  2FEZ A;  3J80 Z;  3C7J A;  1IXS B;  2NS0 A;  5LGT A;  1V3F A;  5LHG A;  4LG0 B;  1EH7 A;  5LEK A;  3T8R A;  1T6S A;  2K02 A;  2P6T A;  2W25 A;  2RVC A;  4OIP F;  1P6R A;  1R1T A;  1XSX A;  3EYI A;  1SMT A;  5HDK A;  2CG4 A;  3LAP A;  2YSR A;  2QM3 A;  5K5Q A;  1ZYR F;  2PMU A;  2IP2 A;  3P7N A;  5E8I A;  3F8M A;  1EH8 A;  1S7A A;  2FBI A;  3MQ0 A;  3RYR A;  5ILU A;  2O3F A;  3JAM K;  5CVU A;  3CUQ C;  2IW5 A;  2FRH A;  1XGM A;  3W6J B;  2HKX A;  3I58 A;  3MFK A;  1YQA A;  3FMR A;  1D8K A;  3TGN A;  1LQ1 A;  1DPU A;  3R61 A;  1O3R A;  3K69 A;  3HSF A;  2XRO A;  2O6G E;  3BZ6 A;  2ESN A;  3I5U A;  1BIB A;  3B02 A;  1Z91 A;  4ETS A;  5LHI A;  3M8E A;  2Q0O A;  3G73 A;  4NHJ A;  2VBW A;  3I71 A;  4XSX F;  3V4G A;  4EMS A;  3ZMZ A;  3BY6 A;  4Y17 A;  1ZRE A;  2V1U A;  4M9X A;  4AD9 A;  4ESJ A;  1IUY A;  1XSD A;  4G6Q A;  4CO8 A;  2E7W A;  4S05 A;  4EGY A;  3OOP A;  1SFX A;  4KMF A;  5JR3 A;  2IT0 A;  2Y0M A;  4GYI A;  4U88 A;  3VFZ A;  1IN7 A;  3I4P A;  3WTV C;  2GQQ A;  1TW2 A;  2P5L C;  3LWF A;  3LA3 A;  4HDU A;  1J7K A;  4G7H F;  1DUX C;  3LST A;  2HTS A;  4WK8 F;  5E1Z B;  3LQR A;  3M9A A;  4HLY A;  1YG2 A;  1O3T A;  2W85 A;  3ZMD A;  1R58 A;  4LD5 A;  3D5L A;  3QOP A;  1KQ0 A;  5ICF A;  3QPH A;  5HDG A;  5E20 A;  2KKO A;  1LEA A;  2A6E F;  5D4R A;  2PJP A;  1F4K A;  2QUF A;  1OKR A;  1Z9C A;  5HS7 A;  2MH9 A;  3O2P E;  5H6R A;  3DXJ F;  4BXU A;  1OYI A;  1YW8 A;  4IRG A;  5BPD A;  4M6Y A;  4ZYG A;  3AAF A;  1P4W A;  1XGO A;  3HUG A;  3WTY C;  1BC7 C;  4ZYH A;  3CLO A;  4RGX A;  1IAW A;  4U7B A;  1TW3 A;  2ZFW A;  2F5E A;  5CYV A;  3DQV C;  3FXQ A;  2ISZ A;  3IRQ A;  4HBL A;  1FZP B;  3WTT C;  1YS7 A;  4GO1 A;  1TNT A;  3RIR A;  4UVA A;  5IT3 A;  3C18 A;  1USS A;  1YFH A;  2FA5 A;  1MDM B;  2DK5 A;  4KIB A;  1MZB A;  2VT3 A;  4A0Z A;  3RPU A;  2Q2E A;  3F3X A;  1ZAR A;  3FZV A;  1Z6R A;  2IA0 A;  3E97 A;  3EET A;  3QU3 A;  2MC3 A;  2JZY A;  1RZ4 A;  1SD6 A;  2XAS A;  1LEB A;  4HW0 A;  3VOD A;  3KEQ A;  4EJU A;  5J6X A;  1H9G A;  3ECO A;  1FYL A;  4AIK A;  4ZH4 F;  3BWG A;  5D6F A;  2H27 A;  4RAY A;  4OIN F;  3ISP A;  2R7F A;  1IXR C;  3E6B A;  2P4W A;  4XBF A;  4HF1 A;  3J81 K;  2FQ3 A;  4JBA A;  1B1B A;  3DF8 A;  4Q4Z F;  1ZLK A;  3M7G A;  1Z7U A;  4M73 A;  5E18 F;  3JW4 A;  3DV8 A;  1OMI A;  1Q1H A;  1W5S A;  1KYZ A;  2K4B A;  2NAZ A;  5FB2 A;  4HOB A;  1MGT A;  2STW A;  3KP7 A;  1FLI A;  4ENK A;  4FX0 A;  1CGP A;  3F8N A;  3FWE A;  3S2W A;  1HW5 A;  1YYV A;  3REO A;  4GCV A;  4UVC A;  3L9F A;  3EUH A;  4KN7 X;  1BI1 A;  2HYG D;  1P92 A;  2EFN A;  1YTY A;  1SMY F;  5BQT A;  1U78 A;  4P9U A;  4GXO A;  4FHT A;  3IWF A;  4EJO A;  3LQQ A;  2YX4 A;  1FYK A;  1R23 A;  3IKT A;  2UXN A;  2R7D A;  4LFU A;  1LDK B;  1BC8 C;  1R7J A;  3ULQ B;  1W7P A;  3CUQ A;  4H0E A;  5E17 F;  2MLG A;  1KQ8 A;  1LVA A;  2ISY A;  2JTV A;  2A07 F;  4L9T A;  3HTU A;  3RI4 A;  2VBZ A;  5E1W A;  2IRF G;  1QNT A;  4IVN A;  2Q8K A;  3CTA A;  3WTW C;  1U5T A;  3RPQ A;  3TO9 A;  1B9M A;  2MD5 A;  1BJA A;  4KIG A;  3BJO A;  2ZJ2 A;  3HRS A;  1KU9 A;  4DNC A;  1XN7 A;  4AVP A;  2ZCW A;  1ON2 A;  3WU0 A;  3KP3 A;  3VOE A;  3BOQ A;  1IF1 A;  3CJN A;  2P5K A;  4NB5 A;  1ZN2 A;  4A0X A;  5BOX A;  4OIO F;  4IJA A;  4S04 A;  1FYM A;  5KK1 A;  4HF2 A;  2KIM A;  2M45 A;  3M8F A;  2BYV E;  4EJT A;  4HF0 A;  3F8C A;  3GFJ A;  3CUO A;  2XKO A;  2ZKZ A;  4CYD A;  4UHT A;  5K1Y A;  4OU0 A;  3Q9S A;  2EV0 A;  3R60 A;  1ZGA A;  2PQ8 A;  4YFN F;  1WKM A;  4HQE A;  2W84 A;  2LSO A;  3ZMU A;  2PN6 A;  2IVM A;  2XGX A;  4G7O F;  5ILV A;  2PMH A;  1FY7 A;  4MQV A;  5J8C A;  3F72 A;  3KZZ A;  2EFP A;  1PP8 F;  4L9N A;  1R5H A;  4XLN F;  1S8N A;  5A2Q K;  3BPX A;  3WOD F;  4M71 A;  3RKW A;  1I5Z A;  1ZAO A;  3U9G A;  2D1V A;  1KA8 A;  4LLL A;  2Z9O A;  4L0Z B;  2GA1 A;  3L00 A;  1O3Q A;  1DDN A;  1IW7 F;  2WWY A;  2HQR A;  2FML A;  3E3V A;  3P9C A;  4N9I A;  4BHP A;  3B73 A;  1UCR A;  1KGS A;  5LRS A;  3RYP A;  2KJB A;  1XSV A;  3I0T A;  2EFW A;  4MNU A;  4PZJ A;  4EM1 A;  4RAZ A;  1KQ9 A;  4IXA A;  5K5O A;  3V7C A;  2HR3 A;  3F6V A;  5DEQ A;  2EA4 A;  1OYW A;  3F21 A;  3IRR A;  3WTU C;  5CVI A;  4KIF A;  3GF2 A;  2Y75 A;  3KP4 A;  2D45 A;  3MWM A;  3JTG A;  3EQL F;  2ZME B;  5FLX K;  3GZ5 A;  1ZG5 A;  1RUO A;  2STT A;  3FXU A;  4TV7 A;  1F9N A;  1Y0U A;  1AWC A;  2RDP A;  3QAH A;  4AWX B;  1U2W A;  3ECH A;  3GFL A;  5D6E A;  4PGH A;  1A04 A;  1BBY A;  3COA C;  3NEU A;  4OMY A;  4UV8 A;  2VBX A;  2L4M A;  4WX9 A;  1FP2 A;  2HOE A;  1YW7 A;  4MQ9 F;  2JPB A;  1BI3 A;  1MJ9 A;  1IZ1 A;  2DPU A;  4BAY A;  4A6D A;  4U0W A;  4N0B A;  2IPQ X;  4IF4 A;  4RGR A;  3KZY A;  1JHF A;  2L54 A;  1U8R A;  4YFK F;  2XRN A;  4ENJ A;  4KT5 C;  1FT9 A;  4Q48 A;  2CO5 A;  5CLS A;  3TOA A;  3HOT A;  5CJ9 A;  1JXS A;  1BIA A;  1UFM A;  2F5F A;  4JK1 X;  1WQ2 A;  3MEX A;  3TOB A;  2M5W A;  3JSP A;  4EVI A;  1ZHF A;  2FE3 A;  3I53 A;  4G8X A;  1YIO A;  3SHF A;  2QBY B;  1SFE A;  1WI9 A;  1U5T C;  3U1D A;  1XCB A;  5HDN A;  2TDX A;  2DBB A;  3GW2 A;  3V8J A;  4UNO A;  2VOO A;  2L3D A;  2FBH A;  4IPA A;  5EEH A;  3GXO A;  2DT5 A;  2FSW A;  2GA2 A;  5E8G A;  4EQQ A;  1UHW A;  4N9H A;  2IA2 A;  3DPL C;  3L09 A;  4QWQ A;  1ZGJ A;  1J75 A;  4A5M A;  2HWV A;  2LF8 A;  3TDU C;  2CWE A;  2EFO A;  1I6X A;  2MBF A;  3KP6 A;  1I27 A;  3TDZ C;  3H3U A;  2QZ8 A;  1WRJ A;  1JE8 A;  1UST A;  1B6A A;  4WXD A;  2ZNY A;  4A2U A;  2KIF A;  3H3Z A;  2CGP A;  5D5V B;  1REP C;  1O3S A;  2FNA A;  3RJP A;  1HW2 A;  3BJA A;  3I59 B;  2VC1 A;  3K1M A;  2MA3 A;  1IN6 A;  1ZG3 A;  3FHZ A;  3QRF F;  2E1C A;  3DKW A;  1FOK A;  5L3F A;  5BS6 A;  4QLC U;  1MJA A;  2FU4 A;  2YPR A;  3GLX A;  1CF7 B;  2NRA C;  4D0P A;  3R0A A;  4HV6 A;  5HS8 A;  4L18 B;  5F6F A;  4WF2 A;  2K4J A;  2ZXJ A;  3N97 A;  4F7Z A;  1R36 A;  3J80 K;  4WXC A;  3R6S A;  2FF4 A;  4LMY A;  5KVR A;  4CDG A;  1L3L A;  4I09 A;  1E17 A;  3W6K B;  2PG4 A;  1HQC A;  2H6B A;  2PI0 A;  5DUK A;  1GVJ A;  2LDU A;  4P5O A;  1LDJ A;  1KU2 A;  3IC7 A;  4CZZ A;  5JFR A;  2E7X A;  3ERE D;  1GHC A;  2DPD A;  3CDH A;  5DCM A;  4M9S A;  3QU6 A;  1K78 A;  1R22 A;  1HKT A;  1FNN A;  3HSE A;  2DK8 A;  3V8L A;  3KET A;  4G6D A;  2HTJ A;  1IN8 A;  4K2E A;  4EM0 B;  2OBP A;  1D3Y A;  2XAH A;  3GUD A;  1W5T A;  2HEO A;  3T5X A;  5H20 A;  4M9Z A;  2ELH A;  4ZZL A;  2WTE A;  1DPR A;  2GIV A;  1RNL A;  2Z5U A;  2XAJ A;  3BPV A;  1T0F A;  1PDN C;  1UHM A;  4O6J A;  1ZRD A;  1TLH B;  1TBX A;  3F23 A;  1ONV A;  6PAX A;  5ERI A;  5LGN A;  2YR2 A;  4BH9 A;  2WC2 A;  1P4X A;  1U3E M;  4G94 A;  1YLF A;  3PQK A;  4KDP A;  4PGG A;  2HFH A;  2KJC A;  3KP5 A;  4ZZD A;  5ICC A;  3LA2 A;  2RNJ A;  2X0L A;  4U7D A;  1U6G A;  2AXL A;  2P6S A;  3G3Z A;  4P55 A;  3T8T A;  3NRV A;  3T0Y A;  2Z3Y A;  2BGC A;  3P9I A;  2E1N A;  4B8X A;  1ZG1 A;  1FSE A;  1L0O C;  2K7L A;  2Z99 A;  2A61 A;  2ZO4 A;  1YO5 C;  2XAF A;  2BEO A;  4LG0 A;  2ESH A;  4M6X A;  3I54 A;  4UVB A;  4BNC A;  5D5U B;  5AIP A;  1ODD A;  3R4K A;  4MTE A;  4HZF A;  1WSU A;  2VOD A;  3LA7 A;  1T38 A;  2VE9 A;  4IRI A;  1T98 A;  1ZH5 A;  4G9Y A;  1XGS A;  2RV8 A;  2V9V A;  2DLL A;  1D5V A;  3RKY A;  4GGG A;  5BPI A;  3V7S A;  3IWZ A;  4Y15 A;  2P8T A;  5HS9 A;  2H09 A;  2HYF A;  2OA4 A;  1I1S A;  4HX8 A;  2HZT A;  5DDG A;  3SZT A;  1JHH A;  4L9J A;  5LLQ A;  1ON1 A;  4XSZ F;  4RB0 A;  1QQI A;  2KRF A;  4KIC A;  1HXD A;  2XVC A;  3SQN A;  3H92 A;  3FX3 A;  3TO6 A;  2R3S A;  4I0B A;  3WE3 A;  1IN4 A;  2VN2 A;  4ESB A;  1TQI A;  5IT9 Z;  1QZZ A;  2JT1 A;  1P2F A;  4KMU X;  2NNY A;  4IHS A;  3ML6 A;  4HDV A;  3F22 A;  3JTH A;  2BBY A;  2HKO A;  2VC0 A;  3ZQ7 A;  1JGS A;  1P4A A;  1G3Y A;  5F1R A;  3BDD A;  3L2C A;  4EGZ A;  2KIU A;  3BJ6 A;  5LGU A;  4WXH A;  5L3E A;  3E5U A;  4I01 A;  3ZN0 A;  1J9I A;  5LHH A;  1W4M A;  5LEJ A;  1HST A;  1S6L A;  1ZRF A;  3O6B B;  3K1P A;  2OZU A;  1XGN A;  4ZYE A;  2G7H A;  5L3B A;  5HVQ C;  3GFI A;  2FBK A;  4A5N A;  4CGZ A;  1YW9 A;  3VB2 A;  2VT2 A;  3CO7 C;  2ACJ A;  4UUV A;  3DFG A;  2BE5 F;  3BRO A;  1FC3 A;  2M1B A;  3ELK A;  4RB3 C;  3C3W A;  3VEP A;  1MD0 A;  2RQP A;  2V6C A;  4MEY F;  5H6Q A;  4I98 B;  3HYI A;  4Z2Y A;  1LNW A;  1J59 A;  3QPT A;  4FX4 A;  4HQM A;  3PQJ A;  2DTR A;  2F5D A;  1S3J A;  1O7L A;  2ETH A;  2LF7 A;  2UXX A;  2ADU A;  5HOO A;  5L3D A;  5FD6 A;  5FFX A;  1ULY A;  1R1U A;  5J8F A;  4EJW A;  2FMY A;  1HW1 A;  1STZ A;  3FM5 A;  1MDM A;  3ZMS A;  1XMK A;  5DD8 A;  4CXF A;  5ICE A;  1PP7 U;  2NYX A;  2O03 A;  3N4M A;  3F6O A;  1MKM A;  2EJR A;  3GVA A;  4AIJ A;  4XLP F;  3FXR A;  2AS5 F;  3DPT A;  2FXA A;  1FWZ A;  3MCZ A;  3RKX A;  3GEZ A;  2RKH A;  1H9T A;  2DO7 A;  1R5G A;  2G7U A;  5LBQ A;  2K86 A;  1IRG A;  2MH2 A;  2XHK A;  4Q5S F;  4KA4 A;  1XCV A;  2VBY A;  2XAG A;  4RGS A;  5DV5 A;  1T39 A;  3O3K A;  4LK1 F;  3F8B A;  1BM9 A;  3ZN1 A;  2JRT A;  1F5T A;  1W7P D;  4KN4 X;  5FGM A;  1I1G A;  3K1N A;  2CYY A;  4IRH A;  3GFM A;  5D8K B;  4EV0 A;  1QBJ A;  1RI7 A;  3KP2 A;  4PCQ A;  3TKY A;  2IJL A;  2X4H A;  3DEU A;  1C0W A;  4HA8 A;  5L3C A;  2V1X A;  3WGI A;  2V79 A;  4BQA A;  1HSJ A;  4M72 A;  3ABU A;  5JVT A;  3PFI A;  2XIG A;  1KU3 A;  1J5Y A;  1W7P B;  3CUQ B;  2O8X A;  4YFX F;  2L01 A;  1LJ9 A;  1TTY A;  5CVR A;  1XD7 A;  1G3S A;  2HS5 A;  1EH6 A;  4JQF A;  4O3M A;  2QQB A;  4FT8 A;  2WV0 A;  1OR7 A;  2VXZ A;  1FBS A;  1U5T B;  3KCC A;  1S29 A;  3ZMT A;  5BMZ A;  4ON0 A;  3ABT A;  4A6E A;  3EDP A;  4HX4 A;  1ZRC A;  1T2K A;  3WGG A;  2JPC A;  2HDC A;  2HGC A;  1FBU A;  4PDK A;  4R79 A;  2A3S A;  5ED4 A;  3WGH A;  1D8J A;  3J81 Z;  5HLG A;  4ENM A;  2M8E A;  3WG9 A;  4MTD A;  4ENN A;  3RTR A;  1HKQ A;  3IKV A;  1G4D A;  1VTN C;  5HLI A;  1J0R A;  3ZPL A;  3QP6 A;  4OMZ A;  4LK0 F;  4ASN A;  1NHA A;  4A0Y A;  5CVV A;  5HLH A;  2G9W A;  4HLX A;  3FM3 A;  4I02 A;  3LFK A;  4LGW A;  2GWR A;  1OYY A;  2DQL A;  2M87 A;  1SD4 A;  4Y13 A;  4XRF A;  3CO6 C;  5AON A;  2H6C A;  1BOA A;  1PUE E;  2EB7 A;  2EK5 A;  4KFC A;  4ESF A;  5D5X B;  2CW0 F;  2XKP A;  3Q5F A;  2GXB A;  5JI6 A;  3I64 A;  3J7A O;  3P9K A;  1UB9 A;  3V8K A;  2GAU A;  3IL2 A;  3WTS C;  2XV4 S;  2PEX A;  1O57 A;  2EWN A;  2DW4 A;  1IN5 A;  2OZ6 A;  1Z1D A;  2Z33 A;  4OIR F;  4U0V A;  3KEO A;  1LDD A;  5FD5 A;  2O61 A;  3HHH A;  1SFU A;  4MHG A;  4AIH A;  2XUB A;  1KYW A;  1QO0 D;  1RUN A;  3KE2 A;  5EEG A;  3OV8 A;  3Q9V A;  1FP1 D;  2C6Y A;  2RC4 A;  3M1E A;  2PLY A;  2F5C A;  4BHC A;  4UXN A;  4BYY A;  2P5V A;  5TJJ A;  1OPC A;  1IXC A;  2QQA A;  1X3U A;  4OIQ F;  2DU9 A;  3DP7 A;  4LLN A;  3NQO A;  3IHU A;  2ZNZ A;  3GZ6 A;  4YII A;  1Z6T A;  2L02 A;  2PBI A;  3E5X A;  2ZME A;  2H94 A;  2W57 A;  1HKS A;  2RGV A;  2QWW A;  4WCG A;  2EV5 A;  2RN7 A;  2FOK A;  2M30 A;  5E1X A;  4WWC A;  4LLG F;  3F8F A;  1O7F A;  4KNY A;  3WU1 B;  4P9F A;  1QGP A;  4E70 A;  2MLK A;  2XAQ A;  5A2Q Z;  1YS6 A;  3ZP5 A;  2JSC A;  2OD5 A;  1XB4 A;  1B9N A;  1Z05 A;  1GXP A;  2OQR A;  2VOP A;  4GYG A;  4M74 A;  2FNP A;  5K5R A;  4KUM A;  3ZMV A;  4RB1 A;  4OOI A;  3HRU A;  4U0Y A;  2O0Y A;  1K6O A;  2DI3 A;  1S7O A;  2W24 A;  1R00 A;  3BP8 A;  2VON A;  4B09 A;  4MEX F;  1TQM A;  4YIF A;  4HYE A;  2OU2 A;  2GZW A;  3MAJ A;  2CQK A;  5ICG A;  1G3W A;  2DFI A;  2QBY A;  5ILS A;  5D5W B;  2J5O A;  5F64 A;  2DQR A;  4I7H A;  5L3G A;  4I2O A;  5FLX Z;  2UZK A;  2A68 F;  4P96 A;  2V1D A;  3HOS A;  4EJV A;  1SD5 A;  4R1H A;  3D0S A;  3MZH A;  4EM2 A;  3L7W A;  3V7R A;  4DQ2 A;  3WE2 A;  2ZBK A;  2A5Y B;  4L9V A;  2LNB A;  3HTS B;  3GYH X;  1G3T A;  5JHU A;  3R0J A;  2CSO A;  1FSH A;  3FMS A;  2K27 A;  4L5I A;  4CHU A;  4BHB A;  1G6N A;  3E6D A;  1KU7 A;  5DD4 A;  1SAX A;  1XDU A;  5FFZ A;  1FPQ A;  2YU3 A;  1IRF A;  1AOY A;  3GO5 A;  5D4S A;  3ROU A;  2HQN A;  3FMQ A;  4RS8 A;  1MJB A;  4Q47 A;  3GX4 X;  1BI0 A;  2UWM A;  3HHG A;  3K9T A;  1B59 A;  3TO7 A;  2EV6 A;  4RB2 C;  4L5J A;  3E6C C;  3I59 A;  5DYM A;  3JAM Z;  3WTZ A;  1ZLJ A;  3EYY A;  1BI2 A;  2NNN A;  2CFX A;  1J2X A;  2A6H F;  3JSO A;  1FBQ A;  1SD7 A;  4O5V A;  2P7V B;  1CF7 A;  4ZYD A;  1B4A A;  3HSR A;  2OQG A;  1DP7 P;  3QP5 A;  4HV5 A;  2IA1 A; 
#chains in the Genus database with same CATH topology
 2K9S A;  3BCB A;  4M6V A;  3CC7 I;  5EGO B;  2Y0S A;  3SEQ A;  4L0Y B;  4BJ6 C;  2E71 A;  1FX7 A;  2HOT A;  1R1V A;  2HOA A;  5FO5 A;  2OAZ A;  5D8L B;  4BE1 A;  2BZT A;  4LJZ F;  3RDI A;  3SFZ A;  2YX7 A;  3HDD A;  2COM A;  2LRD A;  2A69 F;  3SZP A;  4LB5 A;  1A5J A;  1EV7 A;  2GXG A;  3KFW X;  2QLZ A;  1XDS A;  5J1U A;  2EA2 A;  3HRT A;  4HG2 A;  3KLN A;  5DCM B;  1K7A A;  1E3H A;  2K9L A;  2WAD A;  2D1H A;  3GBG A;  4A12 A;  3FF5 A;  5DS9 A;  3HGY A;  1TQP A;  1K78 B;  2CV0 A;  1SVO A;  2PJR A;  4YG2 F;  1D0X A;  2EZK A;  2LKX A;  2J5P A;  2MGQ A;  3E5Q A;  4HX7 A;  4FTH A;  3TQN A;  5AIQ A;  4UV9 A;  3GTG J;  4XRS G;  2PFB A;  5DCF A;  2E1O A;  1RIO H;  4R8H A;  1TZL A;  1UG2 A;  4UB8 C;  3T1B A;  2AQE A;  4CYC B;  2EIL H;  4KYW A;  4I0A A;  5TRD A;  3Q0V A;  1F1Z A;  4C30 A;  1MBE A;  3SXY A;  2HU9 A;  3D1N I;  1ETO A;  4G7Z F;  1N77 A;  3VYS B;  2X6X A;  5EEA A;  2W1O A;  5CVJ A;  4NQW A;  4UUS A;  5DUI A;  2R7T A;  4RM2 A;  1TNS A;  1QZY A;  3KLO A;  2UUZ A;  4MGR A;  5LRR A;  2ZME C;  4LB6 B;  3U2R A;  1E2X A;  2LKP A;  1GXQ A;  2EFQ A;  5GTH C;  4MO7 A;  2QQ9 A;  1XS9 A;  3G1M A;  4DBQ A;  5M5W J;  4CIC A;  2F2E A;  1BA5 A;  4A3E J;  4C3J J;  1WWX A;  1ORK A;  1HBX G;  3HRM A;  1WPK A;  1FOY A;  4XL9 A;  4IX7 A;  3GCM A;  4A3C J;  4II3 A;  5HNF A;  3LAJ A;  1VQ6 I;  4UY8 I;  2D2W A;  2XF6 A;  1K79 A;  2Y48 A;  3HIF A;  2Q1Z B;  3H9G A;  3C1D A;  4RGU A;  2QYO A;  2P7C B;  1XMA A;  3S14 J;  2B0L A;  2V9K A;  2L4A A;  3WTX C;  1KON A;  2VE8 A;  3M1C A;  2DAO A;  3IAS 2;  3K2Z A;  3OS0 A;  1ERD A;  3GWZ A;  5BNG A;  3DPU A;  1H0M A;  4HAM A;  2NOG A;  2XC7 A;  2ZSI B;  1QPM A;  3K0L A;  3MMY B;  5IT9 K;  2BV6 A;  2Y9Y A;  2QVO A;  4P1W A;  2ECB A;  4IHT A;  5M5X J;  3MZY A;  4BJ5 C;  1V4R A;  3DCF A;  3OYC A;  2KPM A;  2WAQ N;  2NVQ J;  2QEN A;  1GLN A;  1QVU A;  3OR2 C;  4IL6 C;  3ZQQ A;  2K9Q A;  1Y56 A;  3E6M A;  1LB2 A;  1YRN A;  1BN5 A;  3UR3 C;  3H5A A;  2F4O B;  2FEZ A;  1D0Z A;  3J80 Z;  3C7J A;  1IXS B;  2NS0 A;  5LGT A;  3RCO A;  1V3F A;  5LHG A;  4LG0 B;  4B1R A;  1EH7 A;  1O4X A;  1E3P A;  3T8R A;  5LEK A;  1T6S A;  3EUH C;  1W36 D;  3CF5 F;  2K02 A;  1JKP C;  2P6T A;  1MW7 A;  1ETX A;  3CJQ B;  1MND A;  2W25 A;  4DYR A;  2RVC A;  4OIP F;  1P6R A;  2HXI A;  2FX0 A;  1R1T A;  1WJA A;  1XSX A;  1OCC H;  5M3F J;  3I9V 2;  3JRI A;  3HC7 A;  3EYI A;  1SMT A;  1ZEL A;  4XRS A;  5HDK A;  1QRY A;  2CG4 A;  2F4I A;  4BUP A;  2X6O A;  2R7R A;  3LAP A;  2YSR A;  2OJE D;  1IRX A;  3BT9 A;  4LOC A;  1IJW C;  2QM3 A;  5K5Q A;  4E7H A;  4BY1 J;  1ZYR F;  2PMU A;  2IP2 A;  3P7N A;  1W0U A;  5E8I A;  1RET A;  3F8M A;  1TC3 C;  1YJ9 I;  1EH8 A;  1S7A A;  2FBI A;  2LP0 A;  3MQ0 A;  5F1J A;  3RYR A;  2XPV A;  5ILU A;  2O3F A;  3JAM K;  2MYS A;  5CVU A;  3CUQ C;  2A05 A;  1I39 A;  2PX9 A;  1QVT A;  3DTI A;  1WVR A;  4E6K G;  2IW5 A;  2FRH A;  1XGM A;  5EG0 A;  2AQF A;  4JX6 A;  3H1C A;  3W6J B;  2HKX A;  2VPL A;  3I58 A;  4XKW A;  1V55 H;  2CS3 A;  1EKE A;  4GRI A;  1UEL B;  1UAA A;  4PUS A;  3MFK A;  2LY2 A;  1E3O C;  1YQA A;  3FMR A;  1D8K A;  3TGN A;  4I76 A;  3CES A;  1LQ1 A;  1DPU A;  3R61 A;  1O3R A;  3K69 A;  4B4C A;  3CCL I;  3HSF A;  1XG1 A;  1PYV A;  2XRO A;  3LL7 A;  2O6G E;  1WJF A;  4EEF G;  3BZ6 A;  2ESN A;  3I5U A;  1BIB A;  4E7K A;  1BW6 A;  2DXI A;  2KZV A;  3B02 A;  1Z91 A;  4ETS A;  1WJ5 A;  2X6W A;  5LHI A;  5M3M J;  3M8E A;  2Q0O A;  3G73 A;  1LE8 A;  4NHJ A;  3MVP A;  2VBW A;  4M3E A;  2IS4 A;  3I71 A;  4XSX F;  3V4G A;  4EMS A;  1ENH A;  1DU0 A;  2JN6 A;  3ZMZ A;  1Z3Y A;  3BY6 A;  3S1R J;  4Y17 A;  1ZRE A;  2V1U A;  4M9X A;  4AD9 A;  4DYQ A;  4ESJ A;  2XGE A;  3ASO H;  3J7Y J;  1XSD A;  1IUY A;  4G6Q A;  4CO8 A;  3BZC A;  4B3X A;  2E7W A;  4S05 A;  3OOP A;  4EGY A;  1SFX A;  4KMF A;  5JR3 A;  4I6Z A;  2IT0 A;  3Q0U A;  2DFE A;  2Y69 H;  2KIQ A;  3CD6 I;  4Y4R A;  1X4O A;  2Y0M A;  4PFO A;  2R7W A;  4GYI A;  5F0C A;  4U88 A;  3VFZ A;  3AL0 B;  1X2N A;  1IN7 A;  3I4P A;  3WTV C;  2GQQ A;  1TW2 A;  1H8A C;  1FOX A;  2P5L C;  3LWF A;  1IG7 A;  4JP0 A;  2HDD A;  3H35 A;  3LA3 A;  4LIV A;  4HDU A;  1J7K A;  3A4C A;  4G7H F;  1JGG A;  1DUX C;  3H3V K;  3LST A;  2HTS A;  4WK8 F;  5E1Z B;  3LQR A;  3K4N A;  2JVH A;  3M9A A;  4HLY A;  5KHD A;  1TT5 B;  2ZXW H;  1YG2 A;  1O3T A;  5GAH J;  2W85 A;  3ZMD A;  1R58 A;  4LD5 A;  3D5L A;  3QOP A;  1KQ0 A;  2ZJR F;  5ICF A;  3QPH A;  3D5R C;  1QA6 A;  3PFY A;  5HDG A;  5E20 A;  2KKO A;  4D7N A;  1LEA A;  2A6E F;  5D4R A;  5HNH A;  2QSF X;  3OL4 A;  2PJP A;  3BG7 A;  3GZN B;  1F4K A;  2QUF A;  2HXO A;  2E2I J;  1OKR A;  1Z9C A;  5FKM A;  2JA7 J;  5HS7 A;  2MH9 A;  3LSJ A;  2JQ7 A;  2XPW A;  1AKH A;  3O2P E;  3M07 A;  4XLH A;  3BCA A;  2LBF B;  5H6R A;  3DXJ F;  4BXU A;  1B72 A;  1OYI A;  1YW8 A;  4IRG A;  5BPD A;  3CME I;  4M6Y A;  1T95 A;  3DTE A;  4ZYG A;  3AAF A;  2F6C A;  1P4W A;  1XGO A;  1ZK8 A;  3HUG A;  3TMO A;  2E2H J;  1Z21 A;  2IGO A;  3WTY C;  1BC7 C;  4ZYH A;  3IH3 A;  4BY7 J;  3JRC A;  3B6C A;  3CLO A;  4RGX A;  2X1D A;  1IAW A;  4U7B A;  3BG5 A;  1TW3 A;  2ZFW A;  2F5E A;  3S2D J;  5CYV A;  3DQV C;  3FXQ A;  4W97 A;  2ISZ A;  3IRQ A;  3L2R A;  4HBL A;  1FZP B;  2JA2 A;  3HM5 A;  2JWT A;  1SFO J;  3WTT C;  2VQL A;  3PJR A;  1YS7 A;  4GO1 A;  1TNT A;  5KAI C;  3RIR A;  3A03 A;  1R6R A;  4UVA A;  2BW3 A;  5IT3 A;  3C18 A;  3M4O J;  2KRH A;  4MFD A;  1USS A;  1YFH A;  2FA5 A;  1FIA A;  1MDM B;  3A1Y A;  2DK5 A;  3K7A J;  2VKH A;  4A3B J;  4KIB A;  1MZB A;  2VT3 A;  3BG3 A;  4A0Z A;  3RPU A;  3LSI A;  3S3N A;  2Q2E A;  3F3X A;  1ZAR A;  3FZV A;  1Z6R A;  2IA0 A;  3E97 A;  3EET A;  1NTC A;  3QU3 A;  2MC3 A;  4BBS J;  2XPU A;  4CCO A;  2JZY A;  4XKV A;  1HLV A;  3GTP J;  3HL2 A;  1RZ4 A;  1SD6 A;  2XAS A;  1LEB A;  2VJ4 A;  4HW0 A;  3KEQ A;  3VOD A;  1PJR A;  3LSH A;  4EJU A;  2P81 A;  5J6X A;  2KRC A;  1F36 A;  2Z1D A;  5JLX A;  1H9G A;  3ECO A;  5EYR A;  3OYL A;  1Y1V J;  1D1A A;  1FYL A;  3ZQH A;  4AIK A;  4ZH4 F;  2DA7 A;  4W1U A;  3BWG A;  5D6F A;  4PK4 A;  3WHB A;  3ZQI A;  3S32 A;  5IP7 J;  2FOW A;  2H27 A;  4RAY A;  3ABM H;  4OIN F;  2CQ7 A;  3MD2 A;  3ISP A;  5LFA A;  3CCM I;  3GLL A;  3S93 A;  2R7F A;  4BQN A;  2E19 A;  3HOZ J;  1IXR C;  1N78 A;  1VQO I;  3E6B A;  5K7H A;  2P4W A;  4XBF A;  4XOP A;  3TP3 A;  4HF1 A;  4A93 J;  3J81 K;  1UZC A;  2FQ3 A;  1OQY A;  4JBA A;  5E3M A;  1B1B A;  2LYC A;  2O7O A;  3DF8 A;  4XN3 A;  4N4N B;  4Q4Z F;  1GT0 C;  1ZLK A;  3M7G A;  1Z7U A;  2H8W A;  5EJC A;  1IDY A;  1ZR2 A;  4M73 A;  3PL8 A;  5F0F A;  5E18 F;  4LG3 A;  2QF7 A;  3JW4 A;  3IP4 B;  2GIZ A;  2MSY A;  3DV8 A;  1OMI A;  4IZZ A;  1Q1H A;  1W5S A;  1VF9 A;  4XLE A;  5H2F C;  1R71 A;  1KYZ A;  2EZL A;  2K4B A;  2NAZ A;  5FB2 A;  4HOB A;  2LRE A;  1MGT A;  1RR7 A;  2K3P A;  5EF6 A;  2M9H A;  2GBY A;  1A6I A;  3KP7 A;  2STW A;  1FLI A;  5B5E C;  5B66 C;  4ENK A;  2KT0 A;  3ZQG A;  4FX0 A;  1CGP A;  3F8N A;  3FWE A;  3S2W A;  3OYA A;  3O8H A;  3W3C A;  1HW5 A;  1YYV A;  3REO A;  1D0Y A;  2VL8 A;  3I3L A;  4GCV A;  4UVC A;  3L9F A;  3EUH A;  4KN7 X;  1BI1 A;  3A0H C;  5F04 A;  2HYG D;  2EFN A;  1P92 A;  1YTY A;  2E5Z A;  1SMY F;  5BQT A;  1U78 A;  1MBG A;  4P9U A;  3A02 A;  3HPG A;  3K70 D;  4GXO A;  1K83 J;  3CQZ J;  2DT6 A;  4BE0 A;  1X1A A;  1JT0 A;  4FHT A;  2XF5 A;  3IWF A;  4EJO A;  3LQQ A;  4G6T B;  2DT7 B;  2YX4 A;  3OS2 A;  1FYK A;  2H1L A;  1R23 A;  3IKT A;  4M3F A;  4J01 A;  2QSG X;  2UXN A;  1W5C C;  2R7D A;  2RAE A;  3SFI A;  1DU6 A;  4LFU A;  1LDK B;  3ERM A;  2ID6 A;  2HDW A;  2WY8 Q;  2DMQ A;  4D1Q A;  3H5R A;  1S72 I;  4OAZ A;  1BC8 C;  2HPI A;  1R7J A;  2CH0 A;  3FIW A;  3ULQ B;  1Y8Q B;  1W7P A;  2B9S A;  3CUQ A;  4H0E A;  3MZ8 A;  5E17 F;  2MLG A;  5JVG F;  3SZG A;  1KQ8 A;  1LVA A;  1S7E A;  2ISY A;  2JTV A;  2A07 F;  1DGW Y;  1QPI A;  5JHF A;  3HJE A;  4L9T A;  3HTU A;  3RI4 A;  1ZTR A;  2VBZ A;  5E1W A;  2FJ1 A;  2IRF G;  1QNT A;  2DTZ A;  5FJ8 J;  1JJ8 C;  3PNY A;  4IVN A;  2V1N A;  2Q8K A;  3VSK A;  3K70 C;  3CTA A;  3WTW C;  4DIQ A;  1U5T A;  3FXL A;  3GTK J;  3RPQ A;  3TO9 A;  2DMT A;  1B9M A;  2GM4 A;  4B47 A;  1MBK A;  1WI3 A;  1OCZ H;  2MD5 A;  1BJA A;  4KIG A;  2DJN A;  3BJO A;  2ZJ2 A;  3HKZ N;  3HRS A;  2GOX B;  1KU9 A;  4DNC A;  3HOV J;  4B3A A;  1XN7 A;  4AVP A;  3BQZ A;  2ZCW A;  1ON2 A;  3QYF A;  3WU0 A;  2JUG A;  2KDO A;  4RDU A;  3KP3 A;  4I99 C;  2M7A A;  3VOE A;  3A2K A;  1FTT A;  3BOQ A;  2QA4 I;  1IF1 A;  3WU2 C;  3CJN A;  2FD5 A;  3ZXS A;  2QCO A;  1FMV A;  2XF7 A;  3DU6 A;  2P5K A;  4NB5 A;  1ZN2 A;  3QWL A;  4A0X A;  1BR1 A;  5BOX A;  4C3I J;  2VQG A;  4OIO F;  4UUT A;  4IJA A;  2ZC2 A;  4S04 A;  1FYM A;  2NVX J;  3OMY A;  5KK1 A;  3MKL A;  3FK7 A;  4HF2 A;  2KIM A;  2M45 A;  3BR2 A;  3CDI A;  3M8F A;  2BYV E;  4EJT A;  2PMZ N;  4PJL A;  4HF0 A;  3F8C A;  2XGC A;  3GFJ A;  3CUO A;  2QKM B;  2XKO A;  1H89 C;  2CW7 A;  2ZKZ A;  4CYD A;  3JRG A;  4UHT A;  5K1Y A;  3HOU J;  4BQO A;  4OU0 A;  4F91 B;  3Q9S A;  5F0H A;  2EV0 A;  3R60 A;  3A0B C;  1ZGA A;  2PQ8 A;  3G1L A;  1WKM A;  4YFN F;  3OYI A;  4HQE A;  2Y31 A;  2W84 A;  2LY9 A;  3PNT A;  3LSG A;  2LSO A;  3ZMU A;  2PN6 A;  2IVM A;  2XGX A;  3K4B A;  1E0E A;  2L5Q A;  4G7O F;  5ILV A;  2PMH A;  2HVR A;  1HDD C;  1FY7 A;  4MQV A;  1BL0 A;  2L7F P;  5J8C A;  3F72 A;  3KZZ A;  2EFP A;  2XRL A;  1PP8 F;  3RQ4 A;  4L9N A;  1R5H A;  4XLN F;  4A3G J;  1S8N A;  5A2Q K;  2M0M A;  3BPX A;  3WOD F;  4M71 A;  4ZYA A;  1GDT A;  1TWG J;  3RKW A;  1I5Z A;  1ZAO A;  3U9G A;  3BG9 A;  3DWL E;  2DA6 A;  3LMM A;  5IYC J;  3N05 A;  2XAU A;  1VQK I;  2D1V A;  3CCQ I;  4NUB A;  1KA8 A;  1X4P A;  4LLL A;  2Z9O A;  4JOM A;  3GTJ J;  4A3I J;  3OYH A;  3K4L A;  1BR2 A;  2B7E A;  4L0Z B;  2GA1 A;  3L00 A;  1O3Q A;  1DDN A;  2R7V A;  2IGN A;  2L7Z A;  2M4K A;  2K9N A;  3AFH A;  1IW7 F;  4BAC A;  2WWY A;  2HQR A;  5J3L A;  3TL4 X;  3S2H J;  2FML A;  3E3V A;  5J1R A;  3A01 B;  3FIS A;  3P9C A;  4N9I A;  2TCT A;  4BHP A;  1UJ8 A;  3B73 A;  2X48 A;  1UCR A;  1KGS A;  5LRS A;  3RYP A;  2OPT A;  2KJB A;  1XSV A;  3I0T A;  2COB A;  2EFW A;  4MNU A;  4PZJ A;  3CP8 A;  4EM1 A;  4RAZ A;  1KQ9 A;  4IXA A;  4CCN A;  5K5O A;  3V7C A;  1IRZ A;  1B8I B;  4DYC A;  2HR3 A;  3F6V A;  5DEQ A;  2EA4 A;  1GUU A;  1OYW A;  3VDX A;  2IGK A;  1R4M B;  3F21 A;  3OYK A;  1T0F C;  3CCY A;  1R9T J;  1IV8 A;  1ZKG A;  3WTU C;  3IRR A;  3CMY A;  1R4N B;  5CVI A;  3QPL A;  4KIF A;  5E79 C;  3GF2 A;  2Y75 A;  3KP4 A;  2D45 A;  1X1C A;  3MWM A;  3JTG A;  3OYN A;  2CFO A;  1JT6 A;  3G4S I;  3EQL F;  4G12 A;  2ZME B;  5FLX K;  9ANT A;  2R0Q C;  3OL3 A;  3GZ5 A;  4MIM A;  1ZG5 A;  1RUO A;  2STT A;  3FXU A;  1J09 A;  3S1N J;  4TV7 A;  1Y1W J;  1F9N A;  2O9L A;  4C9Y A;  1Y0U A;  1AWC A;  4HRI A;  2RDP A;  3S17 J;  2KIS A;  3L1P A;  3QAH A;  4AWX B;  4E7S A;  1U2W A;  3ECH A;  3GFL A;  5D6E A;  4PGH A;  1A04 A;  1BBY A;  3COA C;  3NEU A;  4OMY A;  4CCL A;  1SFK A;  5C4X J;  4UV8 A;  3H5N A;  2VBX A;  5GAD J;  3BG6 A;  4E4H A;  2L4M A;  4WX9 A;  4A3D J;  3K10 A;  3RZD J;  1FP2 A;  3E0J B;  2HOE A;  2HQA A;  1YW7 A;  3S16 J;  1R5I D;  4KJZ A;  1IO2 A;  4MQ9 F;  1A36 A;  2JPB A;  3OSG A;  5GTI C;  1Y8R B;  3KEY A;  4FQG A;  2IXS A;  1BI3 A;  3UKG A;  2VUM J;  2IS6 A;  3X2Q H;  2CUJ A;  3I4N J;  1MJ9 A;  1IZ1 A;  2DPU A;  4BAY A;  3L2W A;  4A6D A;  4U0W A;  1DGR M;  3PSI A;  4N0B A;  3VSL A;  5GAE J;  2IPQ X;  4IF4 A;  1YX5 A;  4RGR A;  3KZY A;  1JHF A;  2L54 A;  1OCP A;  1VND A;  1U8R A;  1LFP A;  4RAG A;  4YFK F;  2XRN A;  4ENJ A;  1OCR H;  2I8D A;  4KT5 C;  1FT9 A;  4Q48 A;  2CO5 A;  5CLS A;  3GTO J;  2F4M B;  1Z3X A;  5DM6 F;  3TOA A;  3HOT A;  5CJ9 A;  3HKZ A;  4XLC A;  1JXS A;  2EQR A;  1HC8 A;  2R7S A;  4JYK A;  4GDF A;  2R5Z B;  1BIA A;  3CJR B;  4C2M J;  3LSK A;  2R4G A;  3TBI A;  4KIS A;  1PUF B;  4H4K C;  5DTD A;  2W7N A;  2OTL I;  1UFM A;  2F5F A;  2DOA A;  2W4S A;  4JK1 X;  1WQ2 A;  1IC8 A;  2DDA A;  3MEX A;  1JTX A;  4ITV A;  1T33 A;  3TOB A;  2M5W A;  3JSP A;  2KFD A;  4ZDL A;  3K6G A;  4AM3 A;  4EVI A;  1HOM A;  2L9N A;  1ZHF A;  4DOZ A;  2R7Q A;  4BEH A;  2FE3 A;  3I53 A;  1GV5 A;  4G8X A;  1YIO A;  3CMM A;  1W36 C;  3SHF A;  2QBY B;  1FIP A;  1SFE A;  2PMZ A;  2WY7 Q;  2Y30 A;  1WI9 A;  3KZI C;  1U5T C;  3U1D A;  1P7J A;  2X85 A;  1XCB A;  1ETW A;  4YEL A;  3CF2 A;  5M5Y J;  3W2A A;  4OAY A;  4HEA 2;  5HDN A;  3ZR8 X;  2RQQ A;  2VLA A;  5J4V A;  2TDX A;  3VYT B;  1RPW A;  2DBB A;  3GW2 A;  2FUG 2;  3V8J A;  4CCM A;  1RRJ A;  4UNO A;  5K7Z A;  1ITY A;  2VOO A;  2L3D A;  2FBH A;  4IPA A;  3NAR A;  1MH3 A;  5EEH A;  3GXO A;  3F0C A;  1MBJ A;  2DT5 A;  4QIW N;  2FSW A;  2GA2 A;  4CA0 A;  2L7K A;  5E8G A;  4EQQ A;  2NXN B;  1UHW A;  4N9H A;  1ZQ3 P;  2IA2 A;  3DPL C;  2DFH A;  3L09 A;  3JRB A;  4QWQ A;  3NWS A;  1CQT A;  4QPQ A;  4AYB A;  1ZGJ A;  1XMX A;  1J75 A;  3M3Y J;  4A5M A;  3FKJ A;  2HWV A;  2LF8 A;  3MKY B;  3TDU C;  5C4J J;  4XLF A;  1Z0X A;  2QEX I;  2CWE A;  2VXD A;  4F93 B;  2EFO A;  2HZD A;  1I6X A;  2MBF A;  3KP6 A;  1I27 A;  3TDZ C;  4NC8 A;  3H3U A;  3BR1 A;  3IH2 A;  2BOL A;  2QZ8 A;  3W2V A;  1WRJ A;  3AL0 C;  1EF4 A;  4BKX A;  1UG0 A;  2CQN A;  1UST A;  1JE8 A;  1B6A A;  1T08 B;  4WXD A;  3BR6 A;  2BY2 A;  1TWH J;  4FAS D;  2K3F A;  2ZNY A;  4DZJ A;  4A2U A;  2KIF A;  3H3Z A;  2BY0 A;  4V2F A;  2CGP A;  5D5V B;  1REP C;  2ZJQ F;  2FNA A;  1O3S A;  3RJP A;  4F52 A;  2EPF A;  1HW2 A;  2K5C A;  3MKW B;  1VQN I;  1ACI A;  3BJA A;  3JRA A;  1YOV B;  3BTJ A;  3I59 B;  2VC1 A;  3K1M A;  2MA3 A;  1IN6 A;  1ZG3 A;  3FHZ A;  3Q3S A;  3QRF F;  2E1C A;  2MD0 A;  3K2A A;  3DKW A;  1APL C;  1VI0 A;  2QQ8 A;  1FOK A;  4BS9 A;  4KT6 A;  4F3Q A;  5L3F A;  3AG3 H;  5BS6 A;  3G1O A;  4QLC U;  1MJA A;  2FU4 A;  1PVE A;  2YPR A;  3GLX A;  5FKO A;  3CC2 I;  1CF7 B;  2NRA C;  1OCT C;  2W00 A;  4D0P A;  3R0A A;  2V6E A;  4HV6 A;  5HS8 A;  1V5E A;  2LFB A;  4N4O B;  2WA0 A;  4L18 B;  5F6F A;  4WF2 A;  4HNV A;  2A5W A;  2K4J A;  3D5S C;  2ZXJ A;  5J4Y A;  4HPQ A;  2DMP A;  3N97 A;  3ONQ A;  2P0W A;  5C44 J;  4F7Z A;  1R36 A;  2LG4 A;  3J80 K;  4WXC A;  3R6S A;  4F55 A;  1RKW A;  2FF4 A;  2ME0 A;  1Y39 A;  3HG9 A;  2XB5 A;  2DOD A;  1X2M A;  4LMY A;  5KVR A;  4CDG A;  1L3L A;  4ZJZ A;  1QZE A;  1VQM I;  3QYB A;  4YIR X;  4I09 A;  2A6T A;  2CQQ A;  2PJR B;  1E17 A;  3W6K B;  2PG4 A;  3S15 J;  1HQC A;  4ZTF A;  2H6B A;  2PI0 A;  3KYL A;  1IDZ A;  2E35 A;  5DUK A;  3OSF A;  3V42 A;  2O5R A;  5EGO A;  3IUO A;  1T8I A;  1GVJ A;  2LDU A;  4P5O A;  1LDJ A;  3C2G A;  1KU2 A;  2OTJ I;  3IC7 A;  5KNL A;  2DOF A;  4CZZ A;  3J7A Y;  5EZH A;  4NQW B;  5JFR A;  4UUS B;  2E7X A;  3ERE D;  1GHC A;  2DPD A;  2WV1 A;  3CDH A;  2BXZ A;  1NK3 P;  2EIJ H;  5DCM A;  4M9S A;  3QQA A;  3QU6 A;  2ZJP F;  1K78 A;  1R22 A;  1HKT A;  1FNN A;  3NWT A;  3HSE A;  2DK8 A;  4XMY A;  3V8L A;  4M3G A;  3KET A;  4G6D A;  2HTJ A;  1IN8 A;  3VPR A;  4K2E A;  4EM0 B;  3BTC A;  2OBP A;  1D3Y A;  5KAF C;  2JRM A;  2XAH A;  1UMQ A;  2ZXI A;  4CYC A;  3GUD A;  4IHY A;  1W5T A;  2IAI A;  2HEO A;  5J1Y A;  3H9Q A;  3T5X A;  2VI6 A;  5H20 A;  1G2H A;  3HBL A;  4M9Z A;  2ELH A;  3K4C A;  4ZZL A;  2HOS A;  2WTE A;  1DPR A;  2GIV A;  2BY1 A;  1RNL A;  2R7Z J;  2Z5U A;  2XAJ A;  3BPV A;  4IHV A;  3PO2 J;  1T0F A;  1PDN C;  1I6H J;  2E1M B;  1UHM A;  4O6J A;  1ZRD A;  1TLH B;  2ZB9 A;  1TBX A;  1YRN B;  3FBI B;  5FKK A;  3F23 A;  4E7J A;  1ONV A;  1WJD A;  3L2U A;  2VPR A;  6PAX A;  1AHD P;  5ERI A;  3CC4 I;  4BL0 B;  5LGN A;  2YR2 A;  3CCJ I;  4BH9 A;  2WC2 A;  1P4X A;  1U3E M;  4G94 A;  1DQU A;  3BTI A;  1YLF A;  2GLO A;  3OIP A;  3PQK A;  5K7F A;  4XNF A;  3DBH B;  3CCR I;  2LMD A;  1BOB A;  4PGG A;  2HFH A;  5GAG J;  4KDP A;  2KJC A;  3KP5 A;  4ZZD A;  1V5F A;  3FHN A;  1Z67 A;  1WH7 A;  5ICC A;  3GME A;  3LA2 A;  4LIT A;  2RNJ A;  2X0L A;  3PUF A;  1SAU A;  2KP6 A;  4U7D A;  1U6G A;  2AXL A;  2Y2Z A;  2P6S A;  1MMD A;  3G3Z A;  4P55 A;  3U1K A;  3ZQC A;  3T8T A;  3NRV A;  3T0Y A;  4AID A;  2Z3Y A;  2BGC A;  3P9I A;  2E1N A;  4B8X A;  1ZG1 A;  4AU7 A;  3ZOB A;  1TL8 A;  4UB6 C;  1FSE A;  2IBD A;  1L0O C;  2K7L A;  3F9K A;  2Z99 A;  3HGG A;  2A61 A;  2KLO A;  2ZO4 A;  1YO5 C;  3KIO A;  2XAF A;  3DBL B;  1MMN A;  2X51 A;  1TT0 A;  2BEO A;  2V4J C;  1IUF A;  2ESH A;  4M6X A;  2VJ5 A;  4LG0 A;  1FMW A;  2DMN A;  1QHH D;  4JX4 A;  4ABZ A;  1TP4 A;  2HVQ A;  2XSJ C;  1RKT A;  3I54 A;  4UVB A;  4BNC A;  5D5U B;  1D5Y A;  5AIP A;  4B43 A;  1ODD A;  3R4K A;  1YJW I;  4MTE A;  4HZF A;  1ZGW A;  1WSU A;  3LA7 A;  1ZR4 A;  2VOD A;  3OIQ A;  2Z2S B;  1T38 A;  2E2J J;  2VE9 A;  3FK6 A;  4NBQ A;  4AVZ A;  4MFE A;  1WHU A;  3OY9 A;  5EG0 B;  4IRI A;  1T98 A;  1OCO H;  3QOD A;  1OLT A;  3VYR B;  4FE7 A;  4G9Y A;  1ZH5 A;  1K61 A;  1XGS A;  1HDP A;  2RV8 A;  2V9V A;  3CZ6 A;  4RAF A;  2DLL A;  3TW6 A;  1D5V A;  4HNU A;  5F08 A;  3RKY A;  3OYJ A;  2BHY A;  4GGG A;  1QHG A;  3EUA A;  5KCM A;  1OR7 C;  5E3N A;  2LVS A;  3K4M A;  4HNT A;  5BPI A;  3V7S A;  3IAM 2;  2LY1 A;  3IWZ A;  4Y15 A;  4D7M A;  4CH7 A;  2AHQ A;  4V19 K;  3K4J A;  2M8G X;  2P8T A;  5HS9 A;  2H09 A;  2HYF A;  2BY3 A;  2OA4 A;  1I1S A;  2N8G A;  1QU3 A;  4HX8 A;  2HZT A;  1G59 A;  5FLV A;  2KDZ A;  2R7X A;  5DDG A;  2VQC A;  3SZT A;  2VIX A;  5C3E J;  1LE8 B;  4E7L A;  2F48 A;  1JHH A;  3IH4 A;  2LKS A;  2TRT A;  4Y7N J;  2RRE A;  3OWT A;  4L9J A;  5LLQ A;  3LSP A;  1ON1 A;  2WAF A;  4XSZ F;  4DJA A;  3GTQ J;  2R92 J;  4NC7 A;  1QQI A;  4RB0 A;  2V7F A;  2KRF A;  4KIC A;  4XR6 A;  3SEZ A;  4J00 A;  1YE9 A;  2YUS A;  1HXD A;  2XVC A;  4YEJ A;  3I4M J;  3SQN A;  4DGW B;  3H92 A;  3TED A;  3Q0W A;  1MMA A;  3FX3 A;  3U21 A;  1YIT I;  2NVY J;  3TO6 A;  2R3S A;  4I0B A;  3WE3 A;  2NVT J;  1IN4 A;  2VN2 A;  2H8R A;  4IOA F;  4XKB A;  2DN0 A;  3S3O A;  4ESB A;  1TQI A;  5IT9 Z;  1QZZ A;  2JT1 A;  1P2F A;  1X3Z B;  4KMU X;  2OC6 A;  2NNY A;  2IGM A;  4IEJ A;  4CCJ A;  1JUM A;  4BE2 A;  1SEU A;  4IHS A;  3ML6 A;  4HDV A;  3S8P A;  3F22 A;  3FXO A;  4DZP A;  3JTH A;  1Y0N A;  4XQF A;  2BBY A;  3DLL F;  2HKO A;  2M0C A;  5FRO A;  2VC0 A;  2DYS H;  2GXA A;  3ZQ7 A;  1VQ9 I;  1JGS A;  1S9H A;  1P4A A;  1G3Y A;  5B1A H;  2O8K A;  1U9N A;  1WGX A;  5F1R A;  3HOW J;  3BDD A;  4U87 A;  3L2C A;  4EGZ A;  4X6A J;  2KIU A;  4LIU A;  3BJ6 A;  5LGU A;  4Y33 A;  2X1C A;  4WXH A;  5L3E A;  4ZC3 A;  3E5U A;  4I01 A;  3C2B A;  4PJN A;  3ZN0 A;  5LHH A;  1J9I A;  2DFF A;  3MN2 A;  1W4M A;  5LEJ A;  1HST A;  1S6L A;  1AKH B;  3RPU D;  4D9J A;  1ZRF A;  3O6B B;  2EH3 A;  3K1P A;  4V2G A;  2OZU A;  3OYD A;  4IQJ A;  1XGN A;  4ZYE A;  2HI3 A;  2G7H A;  2ELJ A;  1B72 B;  5L3B A;  5HVQ C;  4BBR J;  2VJI A;  1D1B A;  4YRV A;  5J40 A;  3CCU I;  1MMG A;  1BW5 A;  4XLA A;  2KQR A;  2X9D A;  4AYB N;  3GFI A;  3HUG B;  2XGD A;  1SVL A;  2FBK A;  3HOX J;  4A5N A;  4CGZ A;  1YW9 A;  3VB2 A;  2VT2 A;  3CO7 C;  2ACJ A;  4UUV A;  1XC5 A;  3OIO A;  4BXF A;  3DFG A;  2BE5 F;  3BRO A;  3WG7 H;  1FC3 A;  2WBM A;  2M1B A;  3ELK A;  4RA2 A;  4RMN A;  4RB3 C;  3C3W A;  4QPO A;  4CCK A;  3VEP A;  2BXY A;  2IEK A;  2JVG A;  2LC2 A;  4HSR A;  1HCR A;  2QKL B;  4XN0 A;  5F27 A;  2LBF A;  1MD0 A;  2BW3 B;  5J47 A;  1U8B A;  3H36 A;  3HEF A;  4XM3 A;  2RQP A;  4BQQ A;  2V6C A;  4MEY F;  1WH5 A;  5H6Q A;  4QTR A;  4I98 B;  3TP0 A;  1LFB A;  4E7I A;  3HYI A;  4Z2Y A;  1LNW A;  1J59 A;  2Q2E B;  3QPT A;  3ZCO A;  2BVM A;  4FX4 A;  4HQM A;  2AXT C;  3OS1 A;  3PQJ A;  2JSP A;  2DTR A;  2R7U A;  2F5D A;  4Y3O A;  2E60 A;  1S3J A;  1O7L A;  2ETH A;  2LF7 A;  2UXX A;  3BR5 A;  5GPC A;  1FJL A;  1XPX A;  1MIJ A;  2ADU A;  3OYB A;  1JKR C;  5HOO A;  5L3D A;  5FD6 A;  2VKD A;  5FFX A;  3L2Q A;  4BDY A;  1MNE A;  2M34 A;  1ULY A;  4XOT A;  1R1U A;  3E7L A;  2JJ7 A;  2LTP A;  5J8F A;  4EJW A;  1NK2 P;  2ID3 A;  2ZXH A;  3NAU A;  2NVU B;  1YJN I;  2FMY A;  3H9J A;  1HW1 A;  1STZ A;  2VKV A;  4IOC F;  2CU7 A;  2VAS A;  3FM5 A;  2MW8 A;  1MDM A;  3ZMS A;  3PSF A;  2IS2 A;  2LOO A;  1XMK A;  5DD8 A;  2LH9 A;  4IHX A;  4CXF A;  2CMP A;  5ICE A;  4C3H J;  3ZGK A;  3OOU A;  2MAB A;  4M3B A;  1K6Y A;  2DDB A;  1PP7 U;  2NYX A;  2O03 A;  3N4M A;  3F6O A;  2ECC A;  5IOY A;  1MKM A;  2R7O A;  3CCE I;  2EJR A;  1POG A;  3BZK A;  3GVA A;  4AIJ A;  3E1S A;  3RZO J;  2DA1 A;  2K9M A;  4XLP F;  3FXR A;  2WB1 A;  1R49 A;  2HPM A;  2AS5 F;  3DPT A;  2B63 J;  1GV2 A;  3BTL A;  4XRM A;  3MKZ A;  2XSD C;  2FXA A;  1FWZ A;  3MCZ A;  3RKX A;  3GEZ A;  2RKH A;  1H9T A;  2DO7 A;  5E3O A;  4XON A;  4IHW A;  5GP9 A;  5FKL A;  3FKI J;  2DCE A;  1R5G A;  2G7U A;  5LBQ A;  2I5U A;  1YX3 A;  2K86 A;  1IRG A;  4RLF A;  2QSH X;  1V5G A;  2MH2 A;  2XHK A;  4Q5S F;  4KA4 A;  1LKX A;  1XCV A;  2VBY A;  2XAG A;  3CDL A;  2DYR H;  3AG4 H;  3H0G J;  1VQL I;  1W0T A;  3ESW B;  4BXX J;  1LPQ A;  4RGS A;  5DV5 A;  4AC0 A;  1T39 A;  1N25 A;  3O3K A;  4LK1 F;  3F8B A;  4PFP A;  1BM9 A;  3ZN1 A;  2EBI A;  5CQG A;  2JRT A;  1F5T A;  1W7P D;  3HZJ A;  4KN4 X;  4M3D A;  1HA8 A;  5FGM A;  2MG4 A;  1I1G A;  2X1E A;  4BDZ A;  3K1N A;  3HB9 A;  2CYY A;  1MNM C;  1Z7L A;  1FEX A;  4FCY A;  4L5E A;  4IRH A;  3GFM A;  5D8K B;  3DKX A;  4XK4 A;  4EV0 A;  1QBJ A;  1RI7 A;  3KP2 A;  4ANJ A;  4PCQ A;  3TKY A;  3LNQ A;  2IJL A;  2E36 A;  2X4H A;  4DBR A;  2W82 A;  3DEU A;  1C0W A;  4HA8 A;  5L3C A;  1TWF J;  2V1X A;  3DU5 A;  2EIM H;  3WGI A;  2V79 A;  4BQA A;  1HSJ A;  4M72 A;  1ETY A;  3K4K A;  3ABU A;  1D1C A;  5JVT A;  3PFI A;  2HYJ A;  4XIC A;  5FRM A;  2XIG A;  1KU3 A;  2YU9 J;  1J5Y A;  1W7P B;  2KHM A;  2NS8 A;  3CUQ B;  2O8X A;  4S0H B;  4YFX F;  2L01 A;  2L9S A;  3FBN B;  1LJ9 A;  1TTY A;  5EDN A;  3B6A A;  5CVR A;  2EZI A;  1WFX A;  1XD7 A;  1G3S A;  1JKQ C;  1YHQ I;  2HS5 A;  3G71 I;  1ETV A;  4FIS A;  3LSM A;  5FLM J;  1EH6 A;  2X6Y A;  4JQF A;  1N75 A;  3FXK A;  2ME6 A;  2ZSH B;  4O3M A;  2QQB A;  3OYM A;  1UHS A;  3P5J A;  4FT8 A;  3EUK L;  2WV0 A;  1OR7 A;  1X1P A;  2VXZ A;  1FBS A;  1P7I A;  3LFU A;  1U5T B;  3KCC A;  1A35 A;  4QSH A;  1S29 A;  3ZMT A;  4B44 A;  5BMZ A;  1S5L C;  3C2H A;  1VFC A;  2DOE A;  4ON0 A;  3CJT B;  4PJ0 C;  3ABT A;  1A31 A;  4A6E A;  3EDP A;  4HX4 A;  1ZRC A;  1T2K A;  3CP2 A;  3WGG A;  3DBR B;  2JPC A;  2HDC A;  2HGC A;  4A69 C;  1FBU A;  2GOM A;  2L2O A;  2L7M P;  3SDG A;  2RNG A;  3SDB A;  2DJI A;  4PDK A;  4R79 A;  2DA2 A;  5IY5 H;  1MMS A;  2A3S A;  5E3L A;  3OYE A;  1JUP A;  3FXM A;  3WGH A;  5ED4 A;  1OIS A;  1I3A A;  1VQ8 I;  1D8J A;  3J81 Z;  5HLG A;  4II2 A;  4ENM A;  2HNH A;  2M8E A;  3WG9 A;  4MTD A;  4ZTJ A;  4ENN A;  1WJE A;  4FET A;  3RTR A;  1HKQ A;  3ZRG A;  4Y52 J;  2LR8 A;  3IKV A;  3I55 I;  3L2V A;  1JJ6 C;  1G4D A;  3HXL A;  1I3Q J;  3ABK H;  3KYD B;  1VTN C;  5HLI A;  3G2B A;  4A3F J;  4RBO A;  1WCM J;  1J0R A;  3ZPL A;  2JMW A;  3QP6 A;  4OMZ A;  4A3L J;  2R5Y B;  3CLQ A;  4LK0 F;  2DMU A;  2ICW G;  1RES A;  2CW8 A;  4ASN A;  1U0J A;  1NHA A;  1OJL A;  4A0Y A;  4PJJ A;  5CVV A;  5DM7 F;  5HLH A;  3DLA A;  3SJM A;  2G9W A;  4HLX A;  1VQ7 I;  2ELK A;  4MLO A;  3FM3 A;  5IPA A;  1P9Q C;  4I02 A;  3LFK A;  1ETK A;  1JTY A;  2VB6 A;  4LGW A;  2GWR A;  1OYY A;  3PM1 A;  2E34 A;  1Y6I A;  4HST A;  3S1Q J;  2CJJ A;  2DQL A;  2KL4 A;  2M87 A;  3RKQ A;  1SD4 A;  5CPR B;  1X19 A;  2W48 A;  4Y13 A;  4XRF A;  2I10 A;  3CO6 C;  5AON A;  5GPA A;  1RC9 A;  3UNG C;  4NDL A;  2H6C A;  1BOA A;  1PUE E;  1SC7 A;  3I56 I;  2JA6 J;  1VZ0 A;  2VQH A;  2M2E A;  3GTL J;  4IQ4 A;  2EB7 A;  2EK5 A;  4KFC A;  4ESF A;  2M3A A;  5D5X B;  2CW0 F;  4PSX A;  2XKP A;  2V26 A;  1AA7 A;  1MBH A;  3Q5F A;  2GXB A;  1X1B A;  5JI6 A;  4XID A;  1TWA J;  4ZDO A;  3I64 A;  1MH4 A;  3WHC A;  3J7A O;  2OV7 A;  3QPS A;  3P9K A;  2WAE A;  2JA5 J;  1UB9 A;  2YS9 A;  3V8K A;  2OCC H;  2GAU A;  2NOJ B;  5HLT A;  3WTS C;  3IL2 A;  1MSF C;  1NG7 A;  2XV4 S;  4OWR B;  2PEX A;  1K4S A;  1O57 A;  1F43 A;  2E5N A;  2EWN A;  1WJB A;  2DW4 A;  1XTA A;  2DA5 A;  2OCE A;  1IN5 A;  2OZ6 A;  3EPZ A;  3FDY A;  1X3W B;  1Z1D A;  2HQ5 A;  3PNV A;  3JRH A;  2Z33 A;  2EIN H;  3ZQL A;  4A3J J;  4OIR F;  4U0V A;  3VYU B;  3JRF A;  3KEO A;  5TGT A;  2WAQ A;  2KZG A;  3M8J A;  1LDD A;  5FD5 A;  4CZC A;  1SAN A;  1LFU P;  2O61 A;  3HHH A;  5FRN A;  1SFU A;  4MHG A;  4AIH A;  2XUB A;  2IS1 A;  1X58 A;  1KYW A;  3PIO F;  1QO0 D;  3G6E I;  2K85 A;  3PO3 J;  2NS7 A;  1U9O A;  3JRE A;  1RUN A;  3KE2 A;  3CCV I;  2H1K A;  5EEG A;  2KMU A;  1NH3 A;  3OV8 A;  3Q9V A;  2MC4 A;  1FP1 D;  2C6Y A;  2RC4 A;  3M1E A;  3A01 A;  2PLY A;  4BU2 A;  1LVK A;  3LSR A;  3DKY A;  2F5C A;  3GTM J;  4BHC A;  1XX5 A;  4UXN A;  3RQI A;  5IP9 J;  1VQ5 I;  4BYY A;  3LOC A;  4XKC A;  1KZH A;  2P5V A;  1Q1V A;  3W2W A;  4GFB A;  1B8I A;  2EIK H;  1OPC A;  5TJJ A;  3ASN H;  5B1B H;  3TW7 A;  2JUC A;  1IXC A;  2DA3 A;  2V9P A;  2LK2 A;  4C2U A;  2QQA A;  1X3U A;  4OIQ F;  3JR9 A;  1BR4 A;  2VKE A;  2E1M C;  2DU9 A;  3BC8 A;  1IV6 A;  4PJM A;  3DP7 A;  4LLN A;  5IYD J;  3NQO A;  3IHU A;  2ZNZ A;  3GZ6 A;  4D5F A;  2ZFU A;  4YII A;  2Y9Z A;  4Z6Y A;  2VJJ A;  1EA3 A;  1YI2 I;  1Z6T A;  1MSE C;  2Y0S N;  2L02 A;  3BR0 A;  2PBI A;  3E5X A;  2ZME A;  1T56 A;  2H94 A;  2W57 A;  1HF0 A;  1HKS A;  2L0K A;  1W1W E;  4BJT A;  1JKO C;  2RGV A;  2QWW A;  4WCG A;  2EV5 A;  2RN7 A;  1ETQ A;  4AUX A;  4C2T A;  2FOK A;  2M30 A;  5E1X A;  1IGN A;  4WWC A;  4LLG F;  3F8F A;  1A6Q A;  4EAT A;  4CSW A;  1O7F A;  4KNY A;  3IV5 A;  3WU1 B;  1I50 J;  4P9F A;  1QGP A;  3OR1 C;  2QGU A;  3VWB A;  4E70 A;  5CKT A;  1OFC X;  2MLK A;  2XAQ A;  3S3M A;  5A2Q Z;  2CUE A;  3AKZ A;  1YS6 A;  4F92 B;  3ZP5 A;  2JSC A;  2OD5 A;  1XB4 A;  4J19 A;  1B9N A;  1Z05 A;  3CCS I;  2OF7 A;  2OQR A;  4JX5 A;  1GXP A;  2M7B A;  4GYG A;  2K40 A;  4M74 A;  2CV2 A;  2VOP A;  1JI8 A;  2FNP A;  3JCU C;  4PSW A;  5K5R A;  4CUG A;  2XDV A;  4KUM A;  5IOZ A;  3H0D A;  2JA8 J;  3ABL H;  3ZMV A;  4RB1 A;  4OOI A;  4D5C A;  5IYB J;  2Z16 A;  4E7Z A;  3HRU A;  4BEH B;  4BGD A;  4U0Y A;  2O0Y A;  2WB1 N;  1G8X A;  3CMA I;  1K6O A;  1RR8 C;  2DI3 A;  4IO9 F;  1S7O A;  5LD2 C;  4DW6 A;  1WZ2 A;  4X0G A;  2W24 A;  3SYT A;  5JLW A;  1R00 A;  2MFZ A;  3BP8 A;  5IP6 A;  2VON A;  1DP3 A;  4FE4 A;  2R5Z A;  4B09 A;  4MEX F;  1PUF A;  3RSN A;  3QOE A;  3AG1 H;  1TQM A;  4YIF A;  4HYE A;  1SVM A;  2OU2 A;  4RLQ A;  1BJZ A;  2GZW A;  2CUZ A;  3MAJ A;  5CQE A;  2HVS A;  1MBF A;  4X1E A;  3S1M J;  2CQK A;  5ICG A;  3BQY A;  1G3W A;  2DFI A;  4A3K J;  1EJ9 A;  2QBY A;  5ILS A;  5D5W B;  2XB0 X;  4RM3 A;  2J5O A;  3QYE A;  5F64 A;  1Z77 A;  2DQR A;  3FXJ A;  4I7H A;  5L3G A;  4I2O A;  2AO9 A;  5FLX Z;  2UZK A;  5FKN A;  1VQ4 I;  2DA4 A;  2A68 F;  4P96 A;  2V1D A;  2BVL A;  2L9R A;  1SD5 A;  2EZH A;  4R1H A;  1JUS A;  4EJV A;  3HOS A;  4A3M J;  1AU7 A;  1GVD A;  3D0S A;  3MZH A;  4EM2 A;  1TWC J;  3L7W A;  3V7R A;  3J7Z I;  2R93 J;  4DQ2 A;  1FOW A;  1VQP I;  3HPH A;  4XOR A;  3WE2 A;  2FQ4 A;  2ZBK A;  2A5Y B;  3ZQF A;  4KIT B;  4L9V A;  2LNB A;  3HTS B;  2D5V A;  3GYH X;  1G3T A;  2L9V A;  5JHU A;  3R0J A;  2CSO A;  2OUM A;  1FSH A;  2CUF A;  3W6V A;  2G0E A;  3BR3 A;  4IKF A;  3FMS A;  3DTK A;  3OYG A;  2K27 A;  2F5V A;  4L5I A;  4CHU A;  4NC6 A;  4BHB A;  1G6N A;  3E6D A;  1KU7 A;  3DEW A;  5DD4 A;  1SAX A;  2CV1 A;  5HOD A;  1XDU A;  5FFZ A;  1FPQ A;  2YU3 A;  1IRF A;  2BHZ A;  2LD5 A;  1AOY A;  3KX2 A;  3JRD A;  1X1D A;  3GO5 A;  1YIJ I;  3OYF A;  5D4S A;  4NNJ A;  3ROU A;  1K4T A;  2HQN A;  3FMQ A;  4RS8 A;  1H88 C;  1MJB A;  2CRG A;  3KYC B;  4Q47 A;  3GX4 X;  1BI0 A;  2UWM A;  3HHG A;  3K9T A;  1M1E B;  2CQX A;  1B59 A;  3TO7 A;  2EV6 A;  4RB2 C;  2R5Y A;  2UV1 A;  3KPH A;  4L5J A;  1LUJ B;  4B48 A;  3PUB A;  3E6C C;  3I59 A;  3HOY J;  5DYM A;  5EZG A;  3WTZ A;  3JAM Z;  5B3S H;  3PIP F;  1ZLJ A;  1WJC A;  5TIS C;  3EYY A;  1BI2 A;  2NNN A;  2CFX A;  1J2X A;  2A6H F;  2LLK A;  2M4G A;  3JSO A;  1FTZ A;  1FBQ A;  1SD7 A;  4O5V A;  3O8G A;  2P7V B;  1CF7 A;  4ZYD A;  1B4A A;  3HSR A;  2OQG A;  4ZDP A;  1DP7 P;  3AG2 H;  3QP5 A;  3BLY A;  3DEE A;  4HV5 A;  2IA1 A;  1NG6 A;  1V54 H;  2JK3 A; 
#chains in the Genus database with same CATH homology
 4L0Y B;  1FX7 A;  1R1V A;  5FO5 A;  2OAZ A;  5D8L B;  4LJZ F;  3RDI A;  3SFZ A;  2YX7 A;  4LB5 A;  2COM A;  2A69 F;  3SZP A;  1EV7 A;  2GXG A;  3KFW X;  2QLZ A;  1XDS A;  2EA2 A;  3HRT A;  3KLN A;  5DCM B;  1K7A A;  4A12 A;  2D1H A;  3FF5 A;  1TQP A;  1K78 B;  4YG2 F;  2J5P A;  3E5Q A;  4HX7 A;  3TQN A;  5AIQ A;  4UV9 A;  2PFB A;  5DCF A;  1RIO H;  4R8H A;  3T1B A;  4KYW A;  4I0A A;  5TRD A;  1F1Z A;  3SXY A;  4G7Z F;  5CVJ A;  4NQW A;  5DUI A;  1TNS A;  1QZY A;  3KLO A;  4MGR A;  5LRR A;  4LB6 B;  3U2R A;  1E2X A;  2LKP A;  1GXQ A;  2EFQ A;  2QQ9 A;  4CIC A;  2F2E A;  1WWX A;  1HBX G;  3HRM A;  3LAJ A;  2D2W A;  1K79 A;  2Y48 A;  3HIF A;  3C1D A;  4RGU A;  2QYO A;  2P7C B;  1XMA A;  2B0L A;  3WTX C;  2L4A A;  2VE8 A;  2DAO A;  3K2Z A;  3GWZ A;  1H0M A;  4HAM A;  1QPM A;  3K0L A;  5IT9 K;  2BV6 A;  4IHT A;  2QVO A;  3MZY A;  1V4R A;  2QEN A;  3E6M A;  1LB2 A;  1BN5 A;  2FEZ A;  3J80 Z;  3C7J A;  1IXS B;  2NS0 A;  5LGT A;  1V3F A;  5LHG A;  4LG0 B;  1EH7 A;  5LEK A;  3T8R A;  1T6S A;  2K02 A;  2P6T A;  2W25 A;  2RVC A;  4OIP F;  1P6R A;  1R1T A;  1XSX A;  3EYI A;  1SMT A;  5HDK A;  2CG4 A;  3LAP A;  2YSR A;  2QM3 A;  5K5Q A;  1ZYR F;  2PMU A;  2IP2 A;  3P7N A;  5E8I A;  3F8M A;  1EH8 A;  1S7A A;  2FBI A;  3MQ0 A;  3RYR A;  5ILU A;  2O3F A;  3JAM K;  5CVU A;  3CUQ C;  2IW5 A;  2FRH A;  1XGM A;  3W6J B;  2HKX A;  3I58 A;  3MFK A;  1YQA A;  3FMR A;  1D8K A;  3TGN A;  1LQ1 A;  1DPU A;  3R61 A;  1O3R A;  3K69 A;  3HSF A;  2XRO A;  2O6G E;  3BZ6 A;  2ESN A;  3I5U A;  1BIB A;  3B02 A;  1Z91 A;  4ETS A;  5LHI A;  3M8E A;  2Q0O A;  3G73 A;  4NHJ A;  2VBW A;  3I71 A;  4XSX F;  3V4G A;  4EMS A;  3ZMZ A;  3BY6 A;  4Y17 A;  1ZRE A;  2V1U A;  4M9X A;  4AD9 A;  4ESJ A;  1IUY A;  1XSD A;  4G6Q A;  4CO8 A;  2E7W A;  4S05 A;  4EGY A;  3OOP A;  1SFX A;  4KMF A;  5JR3 A;  2IT0 A;  2Y0M A;  4GYI A;  4U88 A;  3VFZ A;  1IN7 A;  3I4P A;  3WTV C;  2GQQ A;  1TW2 A;  2P5L C;  3LWF A;  3LA3 A;  4HDU A;  1J7K A;  4G7H F;  1DUX C;  3LST A;  2HTS A;  4WK8 F;  5E1Z B;  3LQR A;  3M9A A;  4HLY A;  1YG2 A;  1O3T A;  2W85 A;  3ZMD A;  1R58 A;  4LD5 A;  3D5L A;  3QOP A;  1KQ0 A;  5ICF A;  3QPH A;  5HDG A;  5E20 A;  2KKO A;  1LEA A;  2A6E F;  5D4R A;  2PJP A;  1F4K A;  2QUF A;  1OKR A;  1Z9C A;  5HS7 A;  2MH9 A;  3O2P E;  5H6R A;  3DXJ F;  4BXU A;  1OYI A;  1YW8 A;  4IRG A;  5BPD A;  4M6Y A;  4ZYG A;  3AAF A;  1P4W A;  1XGO A;  3HUG A;  3WTY C;  1BC7 C;  4ZYH A;  3CLO A;  4RGX A;  1IAW A;  4U7B A;  1TW3 A;  2ZFW A;  2F5E A;  5CYV A;  3DQV C;  3FXQ A;  2ISZ A;  3IRQ A;  4HBL A;  1FZP B;  3WTT C;  1YS7 A;  4GO1 A;  1TNT A;  3RIR A;  4UVA A;  5IT3 A;  3C18 A;  1USS A;  1YFH A;  2FA5 A;  1MDM B;  2DK5 A;  4KIB A;  1MZB A;  2VT3 A;  4A0Z A;  3RPU A;  2Q2E A;  3F3X A;  1ZAR A;  3FZV A;  1Z6R A;  2IA0 A;  3E97 A;  3EET A;  3QU3 A;  2MC3 A;  2JZY A;  1RZ4 A;  1SD6 A;  2XAS A;  1LEB A;  4HW0 A;  3VOD A;  3KEQ A;  4EJU A;  5J6X A;  1H9G A;  3ECO A;  1FYL A;  4AIK A;  4ZH4 F;  3BWG A;  5D6F A;  2H27 A;  4RAY A;  4OIN F;  3ISP A;  2R7F A;  1IXR C;  3E6B A;  2P4W A;  4XBF A;  4HF1 A;  3J81 K;  2FQ3 A;  4JBA A;  1B1B A;  3DF8 A;  4Q4Z F;  1ZLK A;  3M7G A;  1Z7U A;  4M73 A;  5E18 F;  3JW4 A;  3DV8 A;  1OMI A;  1Q1H A;  1W5S A;  1KYZ A;  2K4B A;  2NAZ A;  5FB2 A;  4HOB A;  1MGT A;  2STW A;  3KP7 A;  1FLI A;  4ENK A;  4FX0 A;  1CGP A;  3F8N A;  3FWE A;  3S2W A;  1HW5 A;  1YYV A;  3REO A;  4GCV A;  4UVC A;  3L9F A;  3EUH A;  4KN7 X;  1BI1 A;  2HYG D;  1P92 A;  2EFN A;  1YTY A;  1SMY F;  5BQT A;  1U78 A;  4P9U A;  4GXO A;  4FHT A;  3IWF A;  4EJO A;  3LQQ A;  2YX4 A;  1FYK A;  1R23 A;  3IKT A;  2UXN A;  2R7D A;  4LFU A;  1LDK B;  1BC8 C;  1R7J A;  3ULQ B;  1W7P A;  3CUQ A;  4H0E A;  5E17 F;  2MLG A;  1KQ8 A;  1LVA A;  2ISY A;  2JTV A;  2A07 F;  4L9T A;  3HTU A;  3RI4 A;  2VBZ A;  5E1W A;  2IRF G;  1QNT A;  4IVN A;  2Q8K A;  3CTA A;  3WTW C;  1U5T A;  3RPQ A;  3TO9 A;  1B9M A;  2MD5 A;  1BJA A;  4KIG A;  3BJO A;  2ZJ2 A;  3HRS A;  1KU9 A;  4DNC A;  1XN7 A;  4AVP A;  2ZCW A;  1ON2 A;  3WU0 A;  3KP3 A;  3VOE A;  3BOQ A;  1IF1 A;  3CJN A;  2P5K A;  4NB5 A;  1ZN2 A;  4A0X A;  5BOX A;  4OIO F;  4IJA A;  4S04 A;  1FYM A;  5KK1 A;  4HF2 A;  2KIM A;  2M45 A;  3M8F A;  2BYV E;  4EJT A;  4HF0 A;  3F8C A;  3GFJ A;  3CUO A;  2XKO A;  2ZKZ A;  4CYD A;  4UHT A;  5K1Y A;  4OU0 A;  3Q9S A;  2EV0 A;  3R60 A;  1ZGA A;  2PQ8 A;  4YFN F;  1WKM A;  4HQE A;  2W84 A;  2LSO A;  3ZMU A;  2PN6 A;  2IVM A;  2XGX A;  4G7O F;  5ILV A;  2PMH A;  1FY7 A;  4MQV A;  5J8C A;  3F72 A;  3KZZ A;  2EFP A;  1PP8 F;  4L9N A;  1R5H A;  4XLN F;  1S8N A;  5A2Q K;  3BPX A;  3WOD F;  4M71 A;  3RKW A;  1I5Z A;  1ZAO A;  3U9G A;  2D1V A;  1KA8 A;  4LLL A;  2Z9O A;  4L0Z B;  2GA1 A;  3L00 A;  1O3Q A;  1DDN A;  1IW7 F;  2WWY A;  2HQR A;  2FML A;  3E3V A;  3P9C A;  4N9I A;  4BHP A;  3B73 A;  1UCR A;  1KGS A;  5LRS A;  3RYP A;  2KJB A;  1XSV A;  3I0T A;  2EFW A;  4MNU A;  4PZJ A;  4EM1 A;  4RAZ A;  1KQ9 A;  4IXA A;  5K5O A;  3V7C A;  2HR3 A;  3F6V A;  5DEQ A;  2EA4 A;  1OYW A;  3F21 A;  3IRR A;  3WTU C;  5CVI A;  4KIF A;  3GF2 A;  2Y75 A;  3KP4 A;  2D45 A;  3MWM A;  3JTG A;  3EQL F;  2ZME B;  5FLX K;  3GZ5 A;  1ZG5 A;  1RUO A;  2STT A;  3FXU A;  4TV7 A;  1F9N A;  1Y0U A;  1AWC A;  2RDP A;  3QAH A;  4AWX B;  1U2W A;  3ECH A;  3GFL A;  5D6E A;  4PGH A;  1A04 A;  1BBY A;  3COA C;  3NEU A;  4OMY A;  4UV8 A;  2VBX A;  2L4M A;  4WX9 A;  1FP2 A;  2HOE A;  1YW7 A;  4MQ9 F;  2JPB A;  1BI3 A;  1MJ9 A;  1IZ1 A;  2DPU A;  4BAY A;  4A6D A;  4U0W A;  4N0B A;  2IPQ X;  4IF4 A;  4RGR A;  3KZY A;  1JHF A;  2L54 A;  1U8R A;  4YFK F;  2XRN A;  4ENJ A;  4KT5 C;  1FT9 A;  4Q48 A;  2CO5 A;  5CLS A;  3TOA A;  3HOT A;  5CJ9 A;  1JXS A;  1BIA A;  1UFM A;  2F5F A;  4JK1 X;  1WQ2 A;  3MEX A;  3TOB A;  2M5W A;  3JSP A;  4EVI A;  1ZHF A;  2FE3 A;  3I53 A;  4G8X A;  1YIO A;  3SHF A;  2QBY B;  1SFE A;  1WI9 A;  1U5T C;  3U1D A;  1XCB A;  5HDN A;  2TDX A;  2DBB A;  3GW2 A;  3V8J A;  4UNO A;  2VOO A;  2L3D A;  2FBH A;  4IPA A;  5EEH A;  3GXO A;  2DT5 A;  2FSW A;  2GA2 A;  5E8G A;  4EQQ A;  1UHW A;  4N9H A;  2IA2 A;  3DPL C;  3L09 A;  4QWQ A;  1ZGJ A;  1J75 A;  4A5M A;  2HWV A;  2LF8 A;  3TDU C;  2CWE A;  2EFO A;  1I6X A;  2MBF A;  3KP6 A;  1I27 A;  3TDZ C;  3H3U A;  2QZ8 A;  1WRJ A;  1JE8 A;  1UST A;  1B6A A;  4WXD A;  2ZNY A;  4A2U A;  2KIF A;  3H3Z A;  2CGP A;  5D5V B;  1REP C;  1O3S A;  2FNA A;  3RJP A;  1HW2 A;  3BJA A;  3I59 B;  2VC1 A;  3K1M A;  2MA3 A;  1IN6 A;  1ZG3 A;  3FHZ A;  3QRF F;  2E1C A;  3DKW A;  1FOK A;  5L3F A;  5BS6 A;  4QLC U;  1MJA A;  2FU4 A;  2YPR A;  3GLX A;  1CF7 B;  2NRA C;  4D0P A;  3R0A A;  4HV6 A;  5HS8 A;  4L18 B;  5F6F A;  4WF2 A;  2K4J A;  2ZXJ A;  3N97 A;  4F7Z A;  1R36 A;  3J80 K;  4WXC A;  3R6S A;  2FF4 A;  4LMY A;  5KVR A;  4CDG A;  1L3L A;  4I09 A;  1E17 A;  3W6K B;  2PG4 A;  1HQC A;  2H6B A;  2PI0 A;  5DUK A;  1GVJ A;  2LDU A;  4P5O A;  1LDJ A;  1KU2 A;  3IC7 A;  4CZZ A;  5JFR A;  2E7X A;  3ERE D;  1GHC A;  2DPD A;  3CDH A;  5DCM A;  4M9S A;  3QU6 A;  1K78 A;  1R22 A;  1HKT A;  1FNN A;  3HSE A;  2DK8 A;  3V8L A;  3KET A;  4G6D A;  2HTJ A;  1IN8 A;  4K2E A;  4EM0 B;  2OBP A;  1D3Y A;  2XAH A;  3GUD A;  1W5T A;  2HEO A;  3T5X A;  5H20 A;  4M9Z A;  2ELH A;  4ZZL A;  2WTE A;  1DPR A;  2GIV A;  1RNL A;  2Z5U A;  2XAJ A;  3BPV A;  1T0F A;  1PDN C;  1UHM A;  4O6J A;  1ZRD A;  1TLH B;  1TBX A;  3F23 A;  1ONV A;  6PAX A;  5ERI A;  5LGN A;  2YR2 A;  4BH9 A;  2WC2 A;  1P4X A;  1U3E M;  4G94 A;  1YLF A;  3PQK A;  4KDP A;  4PGG A;  2HFH A;  2KJC A;  3KP5 A;  4ZZD A;  5ICC A;  3LA2 A;  2RNJ A;  2X0L A;  4U7D A;  1U6G A;  2AXL A;  2P6S A;  3G3Z A;  4P55 A;  3T8T A;  3NRV A;  3T0Y A;  2Z3Y A;  2BGC A;  3P9I A;  2E1N A;  4B8X A;  1ZG1 A;  1FSE A;  1L0O C;  2K7L A;  2Z99 A;  2A61 A;  2ZO4 A;  1YO5 C;  2XAF A;  2BEO A;  4LG0 A;  2ESH A;  4M6X A;  3I54 A;  4UVB A;  4BNC A;  5D5U B;  5AIP A;  1ODD A;  3R4K A;  4MTE A;  4HZF A;  1WSU A;  2VOD A;  3LA7 A;  1T38 A;  2VE9 A;  4IRI A;  1T98 A;  1ZH5 A;  4G9Y A;  1XGS A;  2RV8 A;  2V9V A;  2DLL A;  1D5V A;  3RKY A;  4GGG A;  5BPI A;  3V7S A;  3IWZ A;  4Y15 A;  2P8T A;  5HS9 A;  2H09 A;  2HYF A;  2OA4 A;  1I1S A;  4HX8 A;  2HZT A;  5DDG A;  3SZT A;  1JHH A;  4L9J A;  5LLQ A;  1ON1 A;  4XSZ F;  4RB0 A;  1QQI A;  2KRF A;  4KIC A;  1HXD A;  2XVC A;  3SQN A;  3H92 A;  3FX3 A;  3TO6 A;  2R3S A;  4I0B A;  3WE3 A;  1IN4 A;  2VN2 A;  4ESB A;  1TQI A;  5IT9 Z;  1QZZ A;  2JT1 A;  1P2F A;  4KMU X;  2NNY A;  4IHS A;  3ML6 A;  4HDV A;  3F22 A;  3JTH A;  2BBY A;  2HKO A;  2VC0 A;  3ZQ7 A;  1JGS A;  1P4A A;  1G3Y A;  5F1R A;  3BDD A;  3L2C A;  4EGZ A;  2KIU A;  3BJ6 A;  5LGU A;  4WXH A;  5L3E A;  3E5U A;  4I01 A;  3ZN0 A;  1J9I A;  5LHH A;  1W4M A;  5LEJ A;  1HST A;  1S6L A;  1ZRF A;  3O6B B;  3K1P A;  2OZU A;  1XGN A;  4ZYE A;  2G7H A;  5L3B A;  5HVQ C;  3GFI A;  2FBK A;  4A5N A;  4CGZ A;  1YW9 A;  3VB2 A;  2VT2 A;  3CO7 C;  2ACJ A;  4UUV A;  3DFG A;  2BE5 F;  3BRO A;  1FC3 A;  2M1B A;  3ELK A;  4RB3 C;  3C3W A;  3VEP A;  1MD0 A;  2RQP A;  2V6C A;  4MEY F;  5H6Q A;  4I98 B;  3HYI A;  4Z2Y A;  1LNW A;  1J59 A;  3QPT A;  4FX4 A;  4HQM A;  3PQJ A;  2DTR A;  2F5D A;  1S3J A;  1O7L A;  2ETH A;  2LF7 A;  2UXX A;  2ADU A;  5HOO A;  5L3D A;  5FD6 A;  5FFX A;  1ULY A;  1R1U A;  5J8F A;  4EJW A;  2FMY A;  1HW1 A;  1STZ A;  3FM5 A;  1MDM A;  3ZMS A;  1XMK A;  5DD8 A;  4CXF A;  5ICE A;  1PP7 U;  2NYX A;  2O03 A;  3N4M A;  3F6O A;  1MKM A;  2EJR A;  3GVA A;  4AIJ A;  4XLP F;  3FXR A;  2AS5 F;  3DPT A;  2FXA A;  1FWZ A;  3MCZ A;  3RKX A;  3GEZ A;  2RKH A;  1H9T A;  2DO7 A;  1R5G A;  2G7U A;  5LBQ A;  2K86 A;  1IRG A;  2MH2 A;  2XHK A;  4Q5S F;  4KA4 A;  1XCV A;  2VBY A;  2XAG A;  4RGS A;  5DV5 A;  1T39 A;  3O3K A;  4LK1 F;  3F8B A;  1BM9 A;  3ZN1 A;  2JRT A;  1F5T A;  1W7P D;  4KN4 X;  5FGM A;  1I1G A;  3K1N A;  2CYY A;  4IRH A;  3GFM A;  5D8K B;  4EV0 A;  1QBJ A;  1RI7 A;  3KP2 A;  4PCQ A;  3TKY A;  2IJL A;  2X4H A;  3DEU A;  1C0W A;  4HA8 A;  5L3C A;  2V1X A;  3WGI A;  2V79 A;  4BQA A;  1HSJ A;  4M72 A;  3ABU A;  5JVT A;  3PFI A;  2XIG A;  1KU3 A;  1J5Y A;  1W7P B;  3CUQ B;  2O8X A;  4YFX F;  2L01 A;  1LJ9 A;  1TTY A;  5CVR A;  1XD7 A;  1G3S A;  2HS5 A;  1EH6 A;  4JQF A;  4O3M A;  2QQB A;  4FT8 A;  2WV0 A;  1OR7 A;  2VXZ A;  1FBS A;  1U5T B;  3KCC A;  1S29 A;  3ZMT A;  5BMZ A;  4ON0 A;  3ABT A;  4A6E A;  3EDP A;  4HX4 A;  1ZRC A;  1T2K A;  3WGG A;  2JPC A;  2HDC A;  2HGC A;  1FBU A;  4PDK A;  4R79 A;  2A3S A;  5ED4 A;  3WGH A;  1D8J A;  3J81 Z;  5HLG A;  4ENM A;  2M8E A;  3WG9 A;  4MTD A;  4ENN A;  3RTR A;  1HKQ A;  3IKV A;  1G4D A;  1VTN C;  5HLI A;  1J0R A;  3ZPL A;  3QP6 A;  4OMZ A;  4LK0 F;  4ASN A;  1NHA A;  4A0Y A;  5CVV A;  5HLH A;  2G9W A;  4HLX A;  3FM3 A;  4I02 A;  3LFK A;  4LGW A;  2GWR A;  1OYY A;  2DQL A;  2M87 A;  1SD4 A;  4Y13 A;  4XRF A;  3CO6 C;  5AON A;  2H6C A;  1BOA A;  1PUE E;  2EB7 A;  2EK5 A;  4KFC A;  4ESF A;  5D5X B;  2CW0 F;  2XKP A;  3Q5F A;  2GXB A;  5JI6 A;  3I64 A;  3J7A O;  3P9K A;  1UB9 A;  3V8K A;  2GAU A;  3IL2 A;  3WTS C;  2XV4 S;  2PEX A;  1O57 A;  2EWN A;  2DW4 A;  1IN5 A;  2OZ6 A;  1Z1D A;  2Z33 A;  4OIR F;  4U0V A;  3KEO A;  1LDD A;  5FD5 A;  2O61 A;  3HHH A;  1SFU A;  4MHG A;  4AIH A;  2XUB A;  1KYW A;  1QO0 D;  1RUN A;  3KE2 A;  5EEG A;  3OV8 A;  3Q9V A;  1FP1 D;  2C6Y A;  2RC4 A;  3M1E A;  2PLY A;  2F5C A;  4BHC A;  4UXN A;  4BYY A;  2P5V A;  5TJJ A;  1OPC A;  1IXC A;  2QQA A;  1X3U A;  4OIQ F;  2DU9 A;  3DP7 A;  4LLN A;  3NQO A;  3IHU A;  2ZNZ A;  3GZ6 A;  4YII A;  1Z6T A;  2L02 A;  2PBI A;  3E5X A;  2ZME A;  2H94 A;  2W57 A;  1HKS A;  2RGV A;  2QWW A;  4WCG A;  2EV5 A;  2RN7 A;  2FOK A;  2M30 A;  5E1X A;  4WWC A;  4LLG F;  3F8F A;  1O7F A;  4KNY A;  3WU1 B;  4P9F A;  1QGP A;  4E70 A;  2MLK A;  2XAQ A;  5A2Q Z;  1YS6 A;  3ZP5 A;  2JSC A;  2OD5 A;  1XB4 A;  1B9N A;  1Z05 A;  1GXP A;  2OQR A;  2VOP A;  4GYG A;  4M74 A;  2FNP A;  5K5R A;  4KUM A;  3ZMV A;  4RB1 A;  4OOI A;  3HRU A;  4U0Y A;  2O0Y A;  1K6O A;  2DI3 A;  1S7O A;  2W24 A;  1R00 A;  3BP8 A;  2VON A;  4B09 A;  4MEX F;  1TQM A;  4YIF A;  4HYE A;  2OU2 A;  2GZW A;  3MAJ A;  2CQK A;  5ICG A;  1G3W A;  2DFI A;  2QBY A;  5ILS A;  5D5W B;  2J5O A;  5F64 A;  2DQR A;  4I7H A;  5L3G A;  4I2O A;  5FLX Z;  2UZK A;  2A68 F;  4P96 A;  2V1D A;  3HOS A;  4EJV A;  1SD5 A;  4R1H A;  3D0S A;  3MZH A;  4EM2 A;  3L7W A;  3V7R A;  4DQ2 A;  3WE2 A;  2ZBK A;  2A5Y B;  4L9V A;  2LNB A;  3HTS B;  3GYH X;  1G3T A;  5JHU A;  3R0J A;  2CSO A;  1FSH A;  3FMS A;  2K27 A;  4L5I A;  4CHU A;  4BHB A;  1G6N A;  3E6D A;  1KU7 A;  5DD4 A;  1SAX A;  1XDU A;  5FFZ A;  1FPQ A;  2YU3 A;  1IRF A;  1AOY A;  3GO5 A;  5D4S A;  3ROU A;  2HQN A;  3FMQ A;  4RS8 A;  1MJB A;  4Q47 A;  3GX4 X;  1BI0 A;  2UWM A;  3HHG A;  3K9T A;  1B59 A;  3TO7 A;  2EV6 A;  4RB2 C;  4L5J A;  3E6C C;  3I59 A;  5DYM A;  3JAM Z;  3WTZ A;  1ZLJ A;  3EYY A;  1BI2 A;  2NNN A;  2CFX A;  1J2X A;  2A6H F;  3JSO A;  1FBQ A;  1SD7 A;  4O5V A;  2P7V B;  1CF7 A;  4ZYD A;  1B4A A;  3HSR A;  2OQG A;  1DP7 P;  3QP5 A;  4HV5 A;  2IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...