3Q9VA

Crystal structure of rra c-terminal domain(123-221) from deinococcus radiodurans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding response regulator
publication title Crystal structure of rra c-terminal domain(123-221) from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q9vA00
4IPAA 5HLHA 4A12A 3T8TA 2KKOA 1ZRDA 3GFMA 2M1BA 3KFWX 1XGOA 2LKPA 5F1RA 5AIPA 5LRSA 1ZGAA 2D2WA 2K4JA 2JSCA 1IF1A 3C7JA 4BAYA 4BYYA 4O3MA 4CICA 4OINF 3DKWA 5D6EA 4GCVA 1XMKA 1Q1HA 4RGRA 2QVOA 2XGXA 1LEBA 1G6NA 3BPXA 2EV6A 3IRQA 2XRNA 3F6VA 1HXDA 4HX8A 4M9ZA 2NS0A 3DXJF 2MC3A 3JTHA 4I01A 5ERIA 3HUGA 3MCZA 4YIFA 2W25A 2EFOA 2ZBKA 4F7ZA 4WX9A 1MKMA 1TNTA 4LJZF 2HDCA 5FFXA 4H0EA 1RIOH 2FMLA 2V9VA 2EWNA 2W24A 2HYGD 3WU1B 4ENMA 1R22A 1S6LA 4A6EA 2HOEA 3TGNA 1DUXC 1IW7F 1IXCA 3DPTA 2KIMA 3RJPA 1ZAOA 3F6OA 3I71A 2XUBA 1E2XA 3KP3A 3HSFA 2XKOA 2EB7A 4MQVA 5FD5A 3JAMZ 4KIFA 4IVNA 1ZYRF 2MLGA 4WCGA 4P96A 3FMSA 3I4PA 5D8KB 2K7LA 1QQIA 3RYRA 3KZZA 2PBIA 1P4WA 5E1WA 2K4BA 1FYMA 2QBYB 3WTXC 1OYYA 4U7BA 4L0ZB 3O2PE 1LDDA 6PAXA 3WTWC 4RB3C 1Z1DA 4GGGA 3OOPA 4ZH4F 4GXOA 4PGHA 3E5UA 4AVPA 2G7HA 3MFKA 2LF8A 4CZZA 2O8XA 2GXGA 1JHHA 3RIRA 5E20A 2XVCA 4FHTA 5D6FA 4WK8F 3JW4A 4Y13A 1FBUA 4G94A 4WXCA 1S8NA 2FF4A 4ZYGA 2KJBA 1FP2A 3GF2A 1D8JA 3TDUC 1ZGJA 5HOOA 2J5PA 4AIHA 1MDMA 2OZ6A 4P55A 2GQQA 5DV5A 4MGRA 4M73A 2XAQA 2HEOA 3QPTA 1EV7A 3L09A 2DTRA 2D45A 2XAGA 3V4GA 5LHHA 3ELKA 1BIAA 2CO5A 5L3DA 1ZG3A 3E6CC 5LHGA 1SD7A 1U6GA 2EFQA 3ZPLA 1G4DA 5K5QA 1K78B 2GWRA 4FT8A 3TQNA 4UHTA 1T0FA 4Q48A 3D5LA 2QYOA 5TJJA 5F6FA 1KU2A 4L9NA 1GXQA 1T39A 4EJVA 4UNOA 4A2UA 3LFKA 2OZUA 1B4AA 1ZH5A 3E6BA 2O6GE 2IVMA 2VC1A 1ZARA 3P9CA 1W5TA 4RS8A 3JSOA 2AXLA 4P9UA 1T6SA 3T1BA 4MHGA 3I58A 4RB1A 2ELHA 1XB4A 2ZNYA 2DU9A 4HOBA 4HF1A 3NQOA 2FNPA 3CUQB 2A5YB 3I53A 3RKYA 4IF4A 4MTEA 3K0LA 5DUKA 1STZA 1D5VA 3DEUA 1W7PB 5LBQA 2EV5A 2HQRA 3E6DA 4R79A 4R8HA 2ESHA 3BJOA 5HDKA 4IRIA 3GFJA 1K7AA 1BOAA 1R58A 4M71A 1ON1A 2RC4A 3SQNA 1QBJA 2VOPA 2EFWA 4XLPF 2ZNZA 4I0AA 2YX7A 1YG2A 3IL2A 2EK5A 3CUQA 5LHIA 4UVCA 3RPUA 2FOKA 2W84A 4HYEA 3K2ZA 5E1XA 4L18B 2MH2A 3ECOA 1HKTA 3AAFA 2E1CA 1HSJA 1U5TC 2VOOA 4LK1F 2YU3A 5JHUA 3KP4A 5JFRA 1XSXA 5FO5A 2P6TA 2IA0A 2VT2A 3FXRA 1LDKB 2ZO4A 3WTTC 4EQQA 5LGTA 2BV6A 3HOTA 1BI0A 1U3EM 4G7ZF 1USSA 4WXDA 3WGHA 4IXAA 2V1DA 3HRMA 3V7CA 2VT3A 4EJTA 1QZYA 2FQ3A 1SD6A 4ENNA 2DO7A 5EEGA 3ABUA 1SMYF 3IKTA 2ZCWA 3PQKA 3FXQA 2VONA 3ZMTA 2IT0A 3JTGA 1FBQA 2Z3YA 3TO9A 2PJPA 2VODA 3TKYA 3LA2A 2ZKZA 1P2FA 3VFZA 1BI2A 2JPCA 4AIKA 2HKOA 3SZTA 1RUNA 3DV8A 3KCCA 2VXZA 1T2KA 3F23A 4N0BA 1E17A 4JBAA 5E8IA 4L9VA 2A6HF 3SFZA 3GWZA 4JQFA 2A69F 3R0AA 2JZYA 3TOAA 2XROA 3F22A 3GFLA 2MH9A 3HRUA 1OPCA 2EFPA 5KVRA 2R7DA 1UHWA 4LGWA 1FYLA 4BHCA 2WWYA 4U88A 5K5OA 1SFXA 2AS5F 4LFUA 4ENKA 1WRJA 2QUFA 4IHTA 1NHAA 2HQNA 2H94A 3CUOA 3K69A 4M6YA 1K79A 4L0YB 2C6YA 2G7UA 1DPRA 3FM5A 5J8CA 2VBXA 1BBYA 4EM2A 3N97A 2JPBA 1ZLKA 1GVJA 2OA4A 4S05A 3HOSA 4IJAA 3BJ6A 3R4KA 1CF7B 2IP2A 1W7PD 1G3SA 1FNNA 2K86A 1P92A 2DPDA 1PUEE 2HTJA 2A3SA 1J0RA 1RZ4A 1L3LA 1DDNA 5H6QA 3NRVA 2CW0F 3CDHA 1SD5A 1U2WA 4YFNF 2V1UA 2HWVA 2VN2A 2P7CB 2JT1A 4OIRF 4JK1X 3COAC 4MEYF 2FBHA 1XGMA 1UB9A 4GO1A 2MBFA 2OQRA 1YS7A 4K2EA 3BWGA 1HSTA 4RGXA 1XDUA 1QPMA 1DPUA 1CF7A 1ZRCA 3CJNA 5DEQA 2STTA 5HVQC 2MA3A 2F5CA 3H92A 1FSHA 1WWXA 3M9AA 3G3ZA 2M30A 2OD5A 3QP6A 1YIOA 3J81Z 3VOEA 3KE2A 1R5GA 5ILVA 3CUQC 2G9WA 4G6QA 3LQRA 4I98B 3TO7A 4EJWA 3TO6A 2D1VA 2O0YA 3RYPA 3HHHA 2M5WA 1QZZA 3VEPA 3ZMSA 3F8MA 3IWZA 2YSRA 5LGUA 4ZYEA 1YTYA 3MQ0A 1XCBA 3WGGA 2DLLA 2GXBA 5F64A 5HLGA 3EYYA 1KYZA 4LLLA 3LQQA 3B73A 3E6MA 3E3VA 1BI3A 3FHZA 3ERED 5L3EA 4KDPA 2X0LA 3QU6A 5DYMA 1W5SA 3ML6A 2FA5A 2Y75A 1I6XA 2Y0MA 3RI4A 1JXSA 1TW2A 1G3TA 2E7WA 4EM1A 4G7HF 1W4MA 5CVVA 4WXHA 3ZMVA 1ZLJA 3GZ5A 3WE3A 1KU3A 4OIPF 1OR7A 3DP7A 5ED4A 1XSDA 4KN4X 3F21A 5HS7A 3I59B 3J80Z 4EJUA 3TOBA 1TNSA 3MWMA 4M9SA 4OIQF 4R1HA 1U8RA 1UCRA 5D5UB 2KIFA 3HSEA 2RQPA 4A5MA 1XMAA 3V8JA 3R0JA 4LMYA 3DF8A 3KLOA 2R7FA 3FZVA 1XGSA 1IUYA 4OOIA 5HDNA 2Q0OA 4GYIA 4HA8A 3S2WA 1FOKA 4MEXF 2QM3A 4OMYA 4YG2F 3SZPA 4CHUA 5BPIA 3LWFA 5JR3A 1J5YA 1MJBA 3FX3A 1BI1A 2QBYA 2V6CA 3ABTA 3MEXA 1IN5A 3U2RA 4HAMA 4M9XA 3HRTA 1BIBA 4G8XA 2NYXA 3KEOA 2KIUA 1DP7P 3ZMZA 5DD8A 3FMRA 4N9IA 2OBPA 4G9YA 1B59A 4LB6B 2UZKA 2F5DA 3MAJA 3P9IA 2E7XA 2LF7A 1C0WA 1HKSA 3K1MA 2GZWA 3BY6A 1O7LA 5E8GA 1B9MA 1R5HA 1IRFA 3P7NA 3FM3A 5LLQA 4KMFA 2L4MA 1I27A 5CVIA 4I2OA 2K27A 4MQ9F 4RGSA 2H6BA 5FD6A 2P6SA 1D8KA 2ZMEB 4XSXF 5D5WB 1S7AA 1USTA 4RAZA 3HTSB 3VODA 1KQ9A 1XSVA 5D4SA 5HDGA 1G3YA 5DDGA 2H6CA 1H9GA 1K78A 4UVAA 1LEAA 2DK5A 3CTAA 5JVTA 1PDNC 3BP8A 2HTSA 2MLKA 4BQAA 2ADUA 2M87A 4FX4A 2YPRA 3ZN0A 3V7RA 4KUMA 1YQAA 2EA2A 2UXXA 1QNTA 4KICA 2M45A 1Z91A 1PP7U 2WTEA 2XKPA 1HQCA 1ZHFA 3M8EA 2NNNA 4D0PA 4HLYA 4CGZA 5J6XA 2L3DA 5LEKA 3M1EA 2FMYA 2L54A 1J7KA 5TRDA 1KU9A 3H3ZA 1W7PA 4DQ2A 4A0YA 1B1BA 3GVAA 4I7HA 5E17F 2R3SA 4BHPA 2IW5A 3VB2A 2HR3A 2EA4A 3WTVC 2E1NA 4ESBA 1JGSA 4UUVA 2X4HA 2XV4S 2H27A 4IHSA 4E70A 4HF0A 3EQLF 3ZN1A 4B8XA 2XAJA 4HW0A 1FX7A 5H20A 4HQMA 2ISYA 5AONA 2O03A 3K9TA 3F8BA 2F5FA 5BQTA 5DD4A 1IN4A 1LQ1A 2XASA 1LDJA 4RAYA 2VBWA 5IT9Z 2FBIA 3RKWA 4EV0A 1LJ9A 2KRFA 1GHCA 3TDZC 2YR2A 4PDKA 2Q8KA 2YX4A 3IRRA 4KNYA 3C1DA 3Q9VA 4XRFA 3O6BB 3W6KB 3LA7A 4KA4A 1O3TA 3HTUA 5LEJA 4WF2A 5D5XB 4HBLA 3HSRA 3CO6C 1YW8A 2HYFA 1SD4A 2A61A 1U78A 1FC3A 2PMHA 2NRAC 4P5OA 5ILSA 2F2EA 5ICGA 4Q4ZF 2RN7A 4G7OF 1EH7A 2PMUA 1JE8A 1GXPA 3LSTA 5JI6A 5FLXZ 1O3RA 3ISPA 1FPQA 3E97A 2BE5F 2ZFWA 1P4XA 3ROUA 4CDGA 1H9TA 2PG4A 5ICCA 4KYWA 2L01A 4HDVA 3T8RA 3KP7A 4L5JA 2PLYA 2BEOA 4KFCA 3RKXA 5A2QZ 3I5UA 1QGPA 3MZYA 5CYVA 3WE2A 1LNWA 1IAWA 4M72A 1Z6TA 5HLIA 2DQLA 4O6JA 2EFNA 1BM9A 3ZMDA 1WSUA 3T5XA 5HS9A 2RDPA 2CG4A 3WTZA 4BXUA 3GXOA 2GA1A 3H3UA 1O57A 2OU2A 4LG0B 3L7WA 4LLNA 2W85A 5HS8A 2FSWA 2LDUA 5CVUA 4XSZF 1OKRA 5BPDA 1J59A 2QQBA 4HX4A 2WC2A 3C18A 1FT9A 3WGIA 3LA3A 4YFKF 3CO7C 2RVCA 2TDXA 1KGSA 1UFMA 3D0SA 1F4KA 4UXNA 1BN5A 3EUHA 2W57A 5ILUA 3FXUA 2DQRA 4HLXA 1R1VA 2P5VA 1IN8A 2V1XA 2L02A 5D8LB 1J9IA 3GLXA 4L9JA 4IRHA 4LG0A 2FBKA 4ON0A 3FWEA 4ENJA 3ZQ7A 1FZPB 3QAHA 5IT3A 2QZ8A 2NAZA 2L4AA 3L9FA 3QRFF 3QOPA 1V3FA 1A04A 2QWWA 4NQWA 4S04A 5CJ9A 3KZYA 2CFXA 2ESNA 1OYWA 1H0MA 3ECHA 3U9GA 2VC0A 2A68F 2FEZA 2EJRA 4A0ZA 2Z33A 1ULYA 2OQGA 2PN6A 4WWCA 1F5TA 2FE3A 1MD0A 4G6DA 3CLOA 1R1TA 3J81K 2IRFG 5BOXA 2P8TA 3DQVC 4KT5C 5L3FA 1FBSA 1WKMA 1WI9A 2FXAA 1TLHB 3GX4X 3GFIA 2JTVA 4Y15A 1TQIA 1ON2A 1U5TB 3OV8A 2V79A 4U0YA 2B0LA 2CWEA 3GZ6A 3P9KA 4Y17A 5FB2A 1YYVA 2MD5A 4M74A 2VBZA 1HW1A 1MZBA 1Z05A 2F5EA 4LK0F 2A6EF 3V7SA 4LB5A 2LSOA 5DCFA 1Z9CA 4RGUA 3WTUC 3LAPA 3I54A 4GYGA 2BGCA 2HFHA 4I09A 5KK1A 5CLSA 1AWCA 2XAHA 2ACJA 1U5TA 3HHGA 1BC8C 4B09A 1XD7A 2OAZA 1HKQA 4EJOA 1OYIA 1WQ2A 3F8CA 2P5LC 1B9NA 3R6SA 3O3KA 2BYVE 1BC7C 2IPQX 1YW7A 5LGNA 2EV0A 3PFIA 4MNUA 1ZG1A 3JAMK 4ZZDA 1FYKA 4U7DA 3J80K 1TQMA 5L3CA 3L2CA 1HBXG 3DPLC 2WV0A 1FY7A 4XLNF 2GA2A 2XIGA 1J75A 4UV8A 1KA8A 1IN7A 3I59A 4OMZA 1IXRC 3J7AO 3QP5A 1XCVA 5K1YA 3BOQA 2Z9OA 2CSOA 1P4AA 3N4MA 3DFGA 5EEHA 3MZHA 2J5OA 3KP5A 1O7FA 4Q5SF 1MDMB 4L5IA 5FFZA 5CVRA 1TBXA 5E18F 4QWQA 4U0WA 1XDSA 3L00A 3E5XA 3RPQA 4ASNA 4U0VA 1ZRFA 5FGMA 2FRHA 3V8LA 1IN6A 3IWFA 1YFHA 3EYIA 4ESFA 3WODF 3BJAA 5CVJA 2HGCA 1REPC 3F8NA 2ZXJA 2DI3A 2P5KA 3HRSA 3WG9A 1SAXA 1FWZA 3KETA 5L3GA 3KEQA 2RV8A 2DW4A 4ETSA 4MTDA 1ZG5A 1SMTA 1F1ZA 2DBBA 4HZFA 4I0BA 4OU0A 4HX7A 2DPUA 4KIGA 4DNCA 1I1GA 4N9HA 1T38A 2HZTA 1RNLA 1R36A 4YIIA 3F8FA 1Z6RA 2H09A 5L3BA 2IA1A 5E1ZB 4IRGA 1V4RA 2FNAA 4BH9A 1R7JA 1MJAA 3HIFA 3GYHX 1ODDA 4KIBA 4PZJA 1UHMA 4EM0B 3BPVA 1TTYA 2VE8A 2Z99A 1YO5C 1OMIA 1BJAA 1TW3A 4TV7A 3GUDA 4O5VA 1FSEA 1HW2A 1CGPA 4A0XA 4HF2A 1RI7A 3IKVA 5ICFA 5J8FA 4PGGA 4HV5A 5H6RA 4EGZA 1XN7A 1R00A 1B6AA 2ZMEA 3I64A 3NEUA 1ONVA 2BBYA 3BDDA 3REOA 2K02A 2STWA 2HS5A 3ZP5A 4UV9A 2CQKA 4ESJA 3IC7A 4OIOF 2QENA 3RTRA 4HDUA 3R60A 1KU7A 2DK8A 4EVIA 4RB2C 1P6RA 2DFIA 3G73A 5BMZA 2ETHA 3U1DA 1FP1D 1LVAA 1IRGA 3W6JB 2PI0A 3B02A 2O61A 4EGYA 3EETA 3FMQA 5DCMB 3T0YA 1I1SA 3EDPA 2QLZA 1KQ8A 3SHFA 3GO5A 2P7VB 5LRRA 2XAFA 2FU4A 1D3YA 1JHFA 2Z5UA 1TQPA 2LNBA 1S3JA 2Y48A 4Q47A 2ZJ2A 4LD5A 1RUOA 3LAJA 2IJLA 4AD9A 5D5VB 1R23A 4CO8A 1MGTA 4HQEA 2RNJA 3ZMUA 2CYYA 4RB0A 5IT9K 1IZ1A 4KMUX 5DCMA 5DUIA 4P9FA 3FF5A 2VE9A 3WTSC 4A5NA 1F9NA 4KN7X 2PQ8A 2RGVA 3BROA 4QLCU 1EH8A 1SFEA 1EH6A 2COMA 5AIQA 4A6DA 4L9TA 2PEXA 2ISZA 1IXSB 3KLNA 4ZYDA 1K6OA 3Q9SA 4I02A 1ZN2A 1FLIA 3JSPA 2D1HA 4NB5A 5D4RA 3C3WA 3PQJA 3QPHA 3R61A 1SFUA 4XBFA 4FX0A 4CYDA 4Z2YA 3F72A 2HKXA 1I5ZA 2CGPA 1MJ9A 4HV6A 3E5QA 2PFBA 3HYIA 2A07F 1X3UA 2VBYA 1VTNC 5FLXK 3M7GA 2GAUA 4EMSA 3I0TA 1J2XA 2IA2A 1O3SA 5K5RA 1YLFA 1S29A 3WU0A 1AOYA 2P4WA 4ZZLA 5A2QK 2GIVA 1KQ0A 3V8KA 4NHJA 4PCQA 3F3XA 1ZREA 1Y0UA 2XHKA 3WTYC 1QO0D 1XGNA 1T98A 2DAOA 4BNCA 4YFXF 3K1PA 2M8EA 3K1NA 2O3FA 2QQ9A 3Q5FA 2KJCA 2QQAA 4CXFA 3SXYA 4M6XA 5BS6A 1R1UA 2NNYA 1YS6A 2JRTA 4BHBA 2RKHA 3KP6A 1KYWA 4AWXB 3BZ6A 3GEZA 4LLGF 3IHUA 1Z7UA 4UVBA 3KP2A 1O3QA 1L0OC 4ZYHA 4AIJA 1PP8F 1LB2A 3QU3A 3M8FA 2Q2EA 2UXNA 2DT5A 1G3WA 3ULQB 2UWMA 3RDIA 3GW2A 1HW5A 1YW9A 5ICEA 1S7OA
chains in the Genus database with same CATH superfamily
4IPAA 5HLHA 2R7WA 4A12A 3T8TA 5B3SH 2KKOA 1ZRDA 5IYBJ 2ZXHA 3GFMA 4BQOA 2M1BA 1NK2P 3KFWX 1GDTA 1XGOA 2LKPA 3BT9A 3K70C 2M0CA 4AC0A 4FTHA 3IAS2 4IX7A 4XLEA 5F1RA 3OL4A 5AIPA 3ZOBA 5LRSA 1WJAA 5F0FA 1ZGAA 2D2WA 2K4JA 3GTJJ 5J47A 2JSCA 2X6WA 5C3EJ 2XAUA 1IF1A 3C7JA 2LBFA 4BKXA 4BAYA 2V1NA 3TP3A 1Y8RB 4BYYA 4OINF 3DKWA 5D6EA 4CICA 4O3MA 4GCVA 1XMKA 2DT7B 4N4OB 1Q1HA 2F5VA 2QVOA 2XGXA 3KYDB 4RGRA 1K4SA 1LEBA 4MIMA 1G6NA 3BPXA 4CZCA 2EV6A 3IRQA 3BZKA 2EZHA 2XRNA 3F6VA 3BC8A 3MKYB 1HXDA 4HX8A 1SVLA 1WHUA 4CYCA 4M9ZA 3A0BC 3CDLA 5EF6A 2NS0A 3DXJF 3SZGA 2MC3A 1RC9A 3GBGA 3FBIB 3QYBA 1YI2I 1NG7A 4XLFA 3JTHA 3NWTA 2WAEA 2LYCA 4I01A 2AXTC 5ERIA 1YE9A 3EUAA 3CCEI 1PVEA 3HUGA 3MCZA 3CF2A 2RQQA 4YIFA 2W25A 4U87A 2EFOA 2ZBKA 4F7ZA 2R7SA 4WX9A 1MKMA 1TNTA 4LJZF 2HDCA 3QYFA 5FFXA 2PX9A 4H0EA 1RIOH 2PMZN 3S2HJ 4BQQA 2FMLA 2V9VA 2EWNA 2LD5A 2W24A 2B9SA 2DODA 2HYGD 3RCOA 3U21A 2BHZA 3WU1B 4ENMA 1R22A 1S6LA 4A6EA 2HOEA 2QQ8A 3TGNA 1DUXC 2E35A 1IW7F 3OYMA 1IXCA 3DPTA 5FRMA 4N4NB 2IGOA 2JJ7A 2KIMA 3RJPA 1ZAOA 3IH2A 3F6OA 5B5EC 3I71A 3A4CA 3K2AA 2XUBA 1R4NB 2BY2A 1E2XA 3KP3A 3HSFA 2E36A 2DFEA 2XKOA 3F0CA 2EB7A 2XPUA 1K83J 4MQVA 2A6TA 1S72I 4IEJA 5FD5A 3JAMZ 2M4GA 4KIFA 4A3KJ 1GV2A 4IVNA 1ZYRF 4XKCA 1IUFA 1ACIA 2MLGA 4WCGA 4P96A 3FMSA 3K4JA 2CQ7A 3I4PA 5D8KB 2K7LA 1QQIA 1TC3C 3RYRA 1IRXA 2VUMJ 3KZZA 2PBIA 2WBMA 1P4WA 1NTCA 5DM6F 5C4XJ 5E1WA 2K4BA 1FYMA 4XOTA 2QBYB 1WZ2A 4PUSA 3GMEA 2KPMA 1X4OA 3WTXC 4IHYA 1OYYA 4U7BA 1V54H 2COBA 4L0ZB 3O2PE 2DA5A 4M3GA 1LDDA 1XTAA 4PK4A 6PAXA 3WTWC 3KIOA 2P81A 2BXYA 3WHBA 4C2TA 4RB3C 1Z1DA 4GGGA 2LY9A 3ASOH 1Y39A 3SJMA 2JVHA 2R5ZA 2KDOA 3OOPA 4ZH4F 4GXOA 4PGHA 3E5UA 4AVPA 2G7HA 3MFKA 2LF8A 1JJ8C 4QTRA 2BW3A 3RZOJ 4CZZA 1VQKI 2O8XA 2LC2A 2GXGA 4HSTA 3BLYA 1JHHA 3RIRA 2IGMA 2MG4A 5E20A 3OYJA 2GLOA 2XVCA 1MMSA 3HOXJ 4FHTA 4LG3A 2EIJH 3OYLA 1K6YA 1WJEA 3L2UA 1R4MB 2EINH 5D6FA 4WK8F 3JW4A 4Y13A 2PJRB 1FBUA 3Q0UA 4G94A 4JOMA 4WXCA 4J19A 3K4LA 4YELA 3X2QH 5J1YA 1S8NA 1G59A 2FF4A 4ZYGA 2KJBA 4I99C 1ZQ3P 1FP2A 1T56A 1WJDA 3GF2A 1D8JA 3TDUC 1SFKA 1ZGJA 5FKMA 3JCUC 5HOOA 4A3MJ 2J5PA 4AIHA 4D9JA 1VQOI 2OZ6A 4P55A 1MDMA 2W7NA 2GQQA 3OIPA 4NC8A 5DV5A 2I5UA 3S17J 1QVTA 4MGRA 4M73A 4XLCA 2XAQA 3BTLA 2HEOA 1YJNI 2GIZA 3QPTA 1EV7A 2BY0A 1S9HA 3L09A 2DTRA 2EBIA 2D45A 3H0GJ 3N05A 2XAGA 3V4GA 5LHHA 2NXNB 2H8WA 3ELKA 1EA3A 2LVSA 1X1AA 1I3AA 1BIAA 2CO5A 2EZIA 5L3DA 1ZG3A 2YS9A 2R7QA 1HDDC 2PJRA 3E6CC 5LHGA 1Z77A 1SD7A 1U6GA 2EFQA 4KITB 4D1QA 5F0HA 4BL0B 3D1NI 3ZPLA 2O7OA 1G4DA 4MLOA 5K5QA 2IS6A 1D1BA 1K78B 2ZXWH 3S1MJ 2O5RA 2GWRA 4C30A 2CH0A 4FT8A 3L2WA 1SEUA 2VPRA 4Z6YA 4RLFA 3TQNA 4UHTA 1T0FA 4Q48A 3D5LA 1RPWA 2QYOA 3TW7A 4E7JA 1Q1VA 4BBSJ 5TJJA 5F6FA 2L0KA 1KU2A 3MVPA 1PUFA 4L9NA 1GXQA 2VKDA 1OLTA 1MNMC 1T39A 4EJVA 4GRIA 2L2OA 4UNOA 4A2UA 3W3CA 3LFKA 2OZUA 1B4AA 2EQRA 4LITA 1ZH5A 3VWBA 2CW8A 2OC6A 3E6BA 3UNGC 2O6GE 4XLAA 2IVMA 2VC1A 1ZARA 3BR1A 3P9CA 1W5TA 4RS8A 4E4HA 3JSOA 2AXLA 4P9UA 1T6SA 3T1BA 4MHGA 5EGOB 3E0JB 2O9LA 3I58A 3H3VK 4RB1A 3C2GA 4X1EA 2ELHA 1XB4A 2ZNYA 2DU9A 3PUBA 4HOBA 3NQOA 2KDZA 4HF1A 2AHQA 2QF7A 2FNPA 1IDYA 2ME0A 3CUQB 3LFUA 2A5YB 3I53A 3RKYA 2VL8A 4IF4A 3BQYA 4MTEA 2LK2A 3K0LA 5DUKA 3DCFA 1STZA 1D5VA 4YRVA 3DEUA 1W7PB 1LPQA 5LBQA 2HOTA 2EV5A 2HQRA 3G1OA 2LKSA 1DQUA 3S1RJ 3E6DA 4R79A 4JX6A 4R8HA 2ESHA 3BJOA 5HDKA 4IRIA 3GFJA 1VQMI 4QPQA 3HDDA 3ABMH 1K7AA 4CCOA 1BOAA 1R58A 4M71A 1SC7A 3BG7A 1ON1A 4UUSA 5IP7J 2E5NA 5HLTA 2RC4A 3ZCOA 3SQNA 1QBJA 2VOPA 4XORA 2EFWA 5EGOA 2IXSA 3AKZA 3G6EI 4XLPF 1LE8B 2ZNZA 4P1WA 5IYDJ 4I0AA 2YX7A 3FXKA 2HOAA 3CCSI 1YG2A 2QCOA 3IL2A 2EK5A 1D1CA 2Y30A 5FLMJ 3CUQA 1UJ8A 5LHIA 3PM1A 4UVCA 1GLNA 2FOKA 2DMNA 3RPUA 2W84A 4HYEA 1RR7A 3K2ZA 5E1XA 1EJ9A 4L18B 1Z3YA 2MH2A 3ECOA 3LOCA 2DA6A 1AA7A 1FIPA 2K9LA 5GPCA 1HKTA 3AAFA 5EDNA 2E1CA 1HSJA 1U5TC 4G6TB 2VOOA 4LK1F 1E0EA 2YU3A 5JHUA 1BOBA 3KP4A 2QEXI 3W2VA 5JFRA 1XSXA 1LVKA 3OR1C 5FO5A 3V42A 3JRIA 2P6TA 2DN0A 2K3PA 5M5XJ 2IA0A 2JA5J 2VT2A 3IP4B 4GFBA 2WA0A 3JREA 2ME6A 3FXRA 1LDKB 5EEAA 2ZO4A 3WTTC 4EQQA 5LGTA 2KT0A 2BV6A 1EF4A 3HOTA 3FXOA 1BI0A 4IZZA 1U3EM 4G7ZF 1USSA 2VASA 4WXDA 2NS8A 1B8IB 2M4KA 4BE1A 1H8AC 3BG5A 3WGHA 1MBKA 3DTEA 1WJFA 2V1DA 4IXAA 4XL9A 3HRMA 2LY2A 3RSNA 3V7CA 2E5ZA 3TW6A 2VT3A 2HXOA 4EJTA 2DOFA 1WH7A 1QZYA 2FQ3A 2WB1A 1SD6A 4ENNA 1YX3A 3RQ4A 2DO7A 5EEGA 2RREA 2E34A 3ABUA 3E7LA 4L5EA 1SMYF 3IKTA 1SAUA 2ZCWA 3FISA 3FXQA 2F4MB 2ZFUA 3PQKA 4PFPA 4Y7NJ 4IHXA 1LFUP 2VONA 3DBHB 1FTZA 4Y4RA 3ZMTA 2H1KA 3JTGA 2IT0A 1FBQA 2EZKA 2Z3YA 3TO9A 2PJPA 2VODA 3M4OJ 9ANTA 3JRCA 3TKYA 3LA2A 3LSHA 2ZKZA 1MNDA 4OAZA 1P2FA 3VFZA 1BI2A 2JPCA 4AIKA 3CQZJ 1G2HA 2HKOA 1UELB 1B72B 3HPGA 3SZTA 3TMOA 3DV8A 3HGYA 2M0MA 2OPTA 1RUNA 3KCCA 4AUXA 1I3QJ 2VXZA 1T2KA 3F23A 1GV5A 4JP0A 1X1CA 4N0BA 3K4KA 3UR3C 1E17A 4JBAA 4XONA 4S0HB 5E8IA 4L9VA 2A6HF 4MO7A 3AL0C 5M5YJ 2NOGA 2HDWA 3K4MA 3SFZA 3GWZA 3W2WA 2Y31A 3AG1H 4KISA 4JQFA 4ZDOA 2A69F 1UAAA 3R0AA 3BTJA 2JZYA 3TOAA 2XROA 4FQGA 3F22A 3PO2J 3GFLA 2EZLA 2MH9A 1CQTA 3HOUJ 1D0YA 5H2FC 3HRUA 3C2BA 1BR2A 2A5WA 1OPCA 4PJNA 5JLXA 2XGCA 5EG0B 5TISC 2EFPA 5KVRA 2R7DA 1UHWA 1VF9A 1VFCA 3S14J 2MSYA 3IH3A 4LGWA 1FYLA 4BHCA 2WWYA 1B72A 1YOVB 4C2MJ 3G2BA 1A35A 4BJ5C 1WFXA 3S3NA 2DMPA 4U88A 1OCZH 1XS9A 5K5OA 1SFXA 2AS5F 5TGTA 2WAFA 5FRNA 4LFUA 3FBNB 3A01B 1WRJA 3HM5A 4XKVA 4ENKA 3QYEA 2QUFA 4PFOA 3ZR8X 1YITI 5F08A 1W1WE 2H1LA 4PJLA 4IHTA 1NHAA 2HQNA 2H94A 4RAFA 2BOLA 4E7SA 3CUOA 3K69A 4M6YA 3G4SI 1K79A 4L0YB 5K7FA 2HYJA 2C6YA 5JLWA 2G7UA 3Q0VA 2CUEA 3GCMA 3A0HC 1DPRA 3FM5A 4Y33A 5J8CA 2VBXA 3OYKA 1Y0NA 1R5ID 3S2DJ 1BBYA 4EM2A 4E7HA 3PIOF 1MBEA 1E3OC 3N97A 2JPBA 5CQGA 4BQNA 1BL0A 1ZLKA 3H5RA 2QGUA 3ZRGA 1K61A 1GVJA 1T0FC 2OA4A 4S05A 3HOSA 3GTLJ 4IJAA 3BJ6A 3R4KA 1CF7B 3CP2A 4AVZA 2IP2A 1W7PD 1G3SA 2NVYJ 3WU2C 4NQWB 2E71A 1FNNA 4A3CJ 2K86A 1P92A 2NVQJ 2DPDA 1PUEE 4A3BJ 2HTJA 1QHGA 2A3SA 1J0RA 1RZ4A 1L3LA 3CCVI 1DDNA 5H6QA 1W36C 3FK7A 1AKHB 3NRVA 3BR3A 2VKHA 2CW0F 3CDHA 1SD5A 1U2WA 4YFNF 5HNFA 2V1UA 2HWVA 2VN2A 2P7CB 2CFOA 2JT1A 2Y2ZA 3P5JA 4JK1X 4OIRF 3COAC 4MEYF 2FBHA 1XGMA 1UB9A 2OJED 1S5LC 4GO1A 1JKPC 2MBFA 2OQRA 5J3LA 1YS7A 2KIQA 1T95A 4K2EA 2HPIA 2GXAA 3K7AJ 3BWGA 1HSTA 3PUFA 3HL2A 2M34A 4RGXA 1XDUA 1P7JA 3GLLA 3CP8A 2KLOA 1QPMA 1DPUA 4ZC3A 2ZJQF 1CF7A 1FMWA 2L5QA 2CUFA 1ZRCA 3CJNA 5FKNA 5DEQA 2DFFA 2STTA 3F9KA 5HVQC 1IG7A 2MA3A 2F5CA 2LY1A 4W97A 3H92A 2IS2A 5M3MJ 1FSHA 1WWXA 3M3YJ 3M9AA 3G3ZA 2M30A 4HSRA 1MBHA 2HZDA 2OD5A 3QP6A 1YIOA 4I6ZA 3J81Z 1U9NA 1X1DA 2FUG2 3VOEA 1T33A 3KE2A 1R5GA 5ILVA 2G0EA 5BNGA 2X48A 1ZGWA 3DBRB 3CUQC 2G9WA 1YRNB 4G6QA 4BUPA 3LQRA 3HOYJ 2DA7A 4I98B 1GVDA 3TO7A 4EJWA 3TO6A 2EIKH 2KFDA 5KCMA 3MKZA 3A03A 4RBOA 2D1VA 2L7ZA 2O0YA 1IGNA 3RYPA 3HHHA 2QSGX 2M5WA 3QPSA 3D5SC 1QZZA 2DXIA 3VEPA 3ZMSA 3F8MA 3IWZA 2YSRA 5LGUA 4ZYEA 3JRAA 1YTYA 3CESA 3VYRB 1MMNA 4BBRJ 2OF7A 2X51A 3MQ0A 1MBFA 1XCBA 3WGGA 2DLLA 3GTPJ 4FE7A 1OQYA 2GXBA 5F64A 5HLGA 3EYYA 1VQ4I 2ICWG 1KYZA 4LLLA 2HQAA 3LQQA 3B73A 1U0JA 3E6MA 3I4NJ 3E3VA 1ENHA 1BI3A 4E7LA 2XF7A 1U9OA 5EZGA 3FHZA 3ERED 5L3EA 4KDPA 2X0LA 3QU6A 5DYMA 1W5SA 2DOAA 3OYHA 3CZ6A 3DU5A 3ML6A 2FA5A 1ZELA 5KHDA 2Y75A 1QU3A 1I6XA 2Y0MA 1DGRM 3RI4A 1JXSA 2R92J 1TW2A 1VZ0A 5FJ8J 1G3TA 3PL8A 2E7WA 2DA1A 1BJZA 4EM1A 4G7HF 5EJCA 2R7VA 5KNLA 1W4MA 2XRLA 2QKLB 4WXHA 5CVVA 3ZMVA 4ZTJA 1ZLJA 3GZ5A 5CQEA 4G12A 3WE3A 5GPAA 1H89C 1KU3A 5CPRB 2K40A 4OIPF 3LSMA 4HRIA 3KYLA 1OR7A 3DP7A 5ED4A 2L9RA 4ITVA 1XSDA 3ZQQA 4KN4X 3KPHA 3F21A 2VJ4A 1U8BA 5HS7A 3I59B 3OYAA 3J80Z 3DU6A 4KT6A 4EJUA 5DS9A 4JYKA 2E1MC 3CCLI 3TOBA 1MSFC 1TNSA 3MWMA 4M9SA 3HBLA 4OIQF 4R1HA 3HG9A 1U8RA 1UCRA 5D5UB 2KIFA 3HSEA 4YEJA 3JRHA 2RQPA 4A3LJ 4OAYA 2F4OB 1XMAA 4A5MA 3OYCA 1TWHJ 3HKZA 4IHVA 2VPLA 5F27A 5IOYA 3V8JA 3DF8A 3R0JA 3PNTA 4LMYA 1N75A 3KLOA 5IP6A 4BE0A 2GOXB 1RRJA 4CCMA 2R7FA 3FK6A 3FZVA 1XGSA 1IUYA 4OOIA 5C4JJ 5HDNA 2Q0OA 4AIDA 1X2NA 4GYIA 3I9V2 3BR0A 4HA8A 3S2WA 1FOKA 4MEXF 2QM3A 1MW7A 2X6OA 4OMYA 1V55H 4YG2F 3SZPA 5C44J 4CHUA 1SVOA 4XK4A 5BPIA 3LWFA 1Y56A 4KJZA 3DPUA 1J5YA 5JR3A 3L1PA 1UG0A 3VYUB 1MJBA 3FX3A 1BI1A 2QBYA 2L7MP 3B6CA 3CCRI 5J1UA 4JX4A 2KRCA 5K7ZA 2RAEA 2V6CA 1OCCH 3ABTA 3MEXA 1IN5A 3U2RA 3I4MJ 4HAMA 4ZDPA 2M3AA 4M9XA 3HRTA 2R0QC 1BIBA 1UG2A 2VQLA 4G8XA 4BACA 3HOZJ 2NYXA 3KEOA 3W2AA 4MFEA 2CU7A 2KIUA 1DP7P 2DDAA 4DBRA 3ZMZA 1VQNI 5DD8A 2EILH 5DM7F 2VKVA 3FMRA 4N9IA 4I76A 1KZHA 2M2EA 2OBPA 3K6GA 4G9YA 3BCBA 1B59A 4LB6B 2XPWA 2JA2A 1WJBA 2UZKA 1HCRA 3CD6I 3C2HA 1T8IA 1VQPI 3K4CA 1Z3XA 2F5DA 4B44A 2BVMA 3MAJA 3P9IA 4PJMA 1BW5A 2E7XA 2LF7A 4M3EA 1ETYA 2ZSHB 1YIJI 1C0WA 1WH5A 3OS1A 1HKSA 3K1MA 2GZWA 3BY6A 1VQ7I 2E60A 3LL7A 3PIPF 2KISA 5FLVA 5E79C 2MGQA 1O7LA 4BDYA 5E8GA 1F36A 1B9MA 1R5HA 4NBQA 5JVGF 1IRFA 3P7NA 3FM3A 5LLQA 2DYSH 4KMFA 2L4MA 1OCRH 1I27A 1KONA 5CVIA 5EYRA 1MMAA 4I2OA 2K27A 4MQ9F 4RGSA 3Q0WA 2H6BA 5FD6A 1TWAJ 3OOUA 2P6SA 3BTCA 1D8KA 3CC7I 2ZMEB 4C2UA 2IBDA 1P9QC 4XSXF 2LR8A 4ANJA 5D5WB 1S7AA 1USTA 2JN6A 4RAZA 3HTSB 3QQAA 2KZGA 2CQQA 3VODA 2AO9A 1OJLA 1KQ9A 1XSVA 2DTZA 5D4SA 1A6IA 5HDGA 3G1MA 2DA3A 3SFIA 1G3YA 3G1LA 5DDGA 3D5RC 2CV0A 2H6CA 2CQXA 1H9GA 1R49A 1IDZA 1O4XA 1K78A 4UVAA 2E2IJ 1LEAA 5CKTA 2DK5A 3CTAA 5JVTA 1PDNC 5IY5H 3BP8A 2HTSA 2MLKA 4IHWA 2LMDA 4FETA 3LSPA 2VJJA 4BQAA 2ADUA 2M87A 4FX4A 1W5CC 2YPRA 3A2KA 3ZN0A 2Y69H 3V7RA 4KUMA 2LH9A 2IGKA 1IC8A 1YQAA 2ZSIB 1X58A 5FKLA 2EA2A 2DFHA 2UXXA 4NDLA 2ZB9A 1QNTA 2V9PA 4KICA 2M45A 2BY3A 2VKEA 2HVQA 3H0DA 1Z91A 1PP7U 2WTEA 3H9GA 3GZNB 4BXXJ 2XKPA 1HQCA 1ZHFA 3M8EA 4XICA 1BW6A 5FKOA 2NNNA 3HC7A 4D0PA 2W4SA 1SANA 2LREA 4HLYA 2PMZA 4CGZA 5J6XA 2L3DA 3G71I 1PYVA 3BG3A 5LEKA 2VXDA 3M1EA 2FMYA 1JUSA 1RR8C 2L54A 3SDGA 1RETA 1J7KA 5TRDA 1KU9A 3CLQA 4AYBN 1POGA 1W7PA 3H3ZA 4DQ2A 1A31A 1HF0A 4A0YA 4B43A 3TBIA 2KRHA 2XDVA 1YHQI 1B1BA 2K5CA 3GVAA 4I7HA 2DJNA 4IOCF 3ABKH 3MMYB 4V2GA 4BGDA 5E17F 2R3SA 4XMYA 2IW5A 1VI0A 4BHPA 2DDBA 3VB2A 2HR3A 2XF6A 3BTIA 3L2QA 2EA4A 2KQRA 3WTVC 1TT0A 1D0ZA 1IV8A 2E1NA 1QHHD 2YUSA 2FX0A 4ESBA 3LSKA 1JGSA 1AU7A 2X4HA 2XV4S 4QPOA 4UUVA 1RKWA 2H27A 2XSDC 4IHSA 4QSHA 1OR7C 4E70A 4HF0A 3EQLF 3ZN1A 4B8XA 2XAJA 2VQGA 4HW0A 1FX7A 5H20A 1SVMA 4HQMA 2ISYA 3K10A 1LE8A 1APLC 3IV5A 1XPXA 5AONA 1OCTC 2O03A 3K9TA 3F8BA 3CDIA 4B48A 2F5FA 5BQTA 2JA8J 5DD4A 2OTLI 1IN4A 4PJJA 1LQ1A 2XASA 1QPIA 1LDJA 4RAYA 2VBWA 5IT9Z 1MH4A 2FBIA 4OWRB 3RKWA 2AQFA 4EV0A 1LJ9A 4X0GA 2KRFA 4E7ZA 1GHCA 5LFAA 3BG6A 1HDPA 3TDZC 2YR2A 4PDKA 3OSGA 5GAGJ 2Q8KA 1HA8A 3BR6A 2YX4A 2L7KA 3IRRA 3LNQA 4KNYA 4C3IJ 3C1DA 4BJTA 3H9JA 3Q9VA 3GTOJ 4XRFA 2NVUB 1UZCA 5KAIC 3O6BB 3W6KB 2E1OA 4DW6A 2XC7A 3A02A 3LA7A 4NC6A 1XMXA 4KA4A 1B8IA 1O3TA 3HTUA 3SDBA 5LEJA 1MBGA 3W6VA 4IQJA 3H1CA 4WF2A 5D5XB 2JK3A 4HBLA 3HSRA 3CO6C 1YW8A 2HYFA 2M7BA 3H35A 4YIRX 4A3IJ 4D7NA 3PNYA 2M8GX 4XNFA 3TP0A 1ETOA 1SD4A 2A61A 4A3GJ 1U78A 3TL4X 2HI3A 1OCOH 1FC3A 2R5YB 2PMHA 2NRAC 3M07A 3JRGA 4P5OA 3FKJA 2JSPA 2F2EA 5ILSA 3ZQFA 2IS1A 2VJ5A 4A69C 5ICGA 4Q4ZF 3OYGA 1MSEC 2RN7A 2R7TA 1YX5A 2WV1A 4G7OF 1EH7A 2PMUA 2ID3A 4A3FJ 2KP6A 1JE8A 2DMQA 5KAFC 5J40A 1GXPA 1M1EB 3LSTA 4DYRA 5J4YA 5JI6A 3M8JA 5FLXZ 1O3RA 3ISPA 1FPQA 2JQ7A 1ITYA 4ZYAA 3E97A 2BE5F 1JUPA 2ZFWA 3CCYA 5B66C 1P4XA 4FASD 3ROUA 4CDGA 5DTDA 1H9TA 2PG4A 2F4IA 4LIVA 4IOAF 2KMUA 5ICCA 4KYWA 2K9MA 2L01A 4XRSG 4HDVA 5E3NA 4JX5A 3T8RA 3KP7A 4L5JA 2PLYA 2BEOA 4KFCA 4XM3A 3RKXA 5A2QZ 3I5UA 3PJRA 1QGPA 3MZYA 5CYVA 3WE2A 1LNWA 1LFPA 3HKZN 1IAWA 4M72A 2K9QA 3BQZA 1Z6TA 2CV2A 3CJRB 2Q1ZB 1YJWI 2BHYA 5F0CA 5HLIA 1FTTA 2DQLA 4O6JA 2R7OA 2EFNA 1BM9A 3ZMDA 1WSUA 1W0TA 2Y9YA 3T5XA 5HS9A 2JUCA 3CCQI 2EH3A 3OS2A 2RDPA 2CV1A 2CG4A 3WTZA 4BXUA 3GXOA 2GA1A 2DOEA 3H3UA 4II3A 3ZXSA 1Y1VJ 1O57A 2OU2A 4B3XA 4LG0B 5K7HA 3L7WA 3S3MA 4LLNA 4CCNA 2W85A 2X85A 1ETVA 2XGDA 5HS8A 5EG0A 2FSWA 4H4KC 1X4PA 2LDUA 5CVUA 4XSZF 1OKRA 2DMTA 5BPDA 1J59A 3ZQGA 2QQBA 2IAIA 4HX4A 2ELJA 1JTYA 1ETQA 2WC2A 3C18A 3S1NJ 1FT9A 3WGIA 1QVUA 1ETXA 3HEFA 1BA5A 2Z16A 4M6VA 3LA3A 3K70D 4YFKF 3CO7C 1YJ9I 2RVCA 3DTKA 2TDXA 1KGSA 1VQ5I 1UFMA 3D0SA 1F4KA 2QSHX 4UXNA 3GTKJ 2LKXA 1BN5A 3A01A 3EUHA 2W57A 5ILUA 2Z2SB 4HNVA 1JTXA 3FXUA 2DQRA 1FIAA 4HLXA 1R1VA 2P5VA 4CSWA 4B3AA 1Z0XA 1IN8A 3FKIJ 3OYBA 2F48A 1D0XA 1MH3A 2V1XA 2L02A 5IYCJ 4A3EJ 5D8LB 3BG9A 1IV6A 1J9IA 3GLXA 4L9JA 3MN2A 4IRHA 4FISA 2XPVA 4LG0A 2JA7J 2FBKA 4ON0A 1JI8A 3JRBA 3FWEA 4ENJA 1QRYA 1VQ9I 4BXFA 3ZQ7A 1FZPB 2K3FA 3QAHA 3S16J 5IT3A 2QZ8A 2NAZA 2L4AA 4F52A 4J01A 3L9FA 3S8PA 5GTHC 3QRFF 1I39A 2WADA 1ZTRA 1V3FA 3QOPA 1A04A 4UB8C 1AHDP 2QWWA 2KZVA 4NQWA 4S04A 3CMAI 4ZTFA 5CJ9A 3KZYA 4RA2A 4XR6A 3QWLA 2FOWA 2CFXA 2ESNA 1OYWA 1TWFJ 1H0MA 3ECHA 4II2A 3U9GA 2VC0A 2A68F 2HVRA 2FEZA 2VLAA 2EJRA 1AKHA 4A0ZA 2R93J 4CUGA 2V7FA 2Z33A 1ULYA 1E3PA 2OQGA 1TT5B 5E3LA 2PN6A 4WWCA 1XX5A 2MC4A 3L2RA 4CYCB 3EPZA 1F5TA 3CJTB 3QPLA 3HJEA 1DP3A 2FE3A 1FOYA 2H8RA 2HDDA 1LKXA 1X1BA 4XKWA 1MD0A 4G6DA 4XKBA 3CLOA 2JVGA 1TZLA 4DOZA 1OISA 1R1TA 3J81K 5GAHJ 4EEFG 3HUGB 2IRFG 4V2FA 5BOXA 1HC8A 2P8TA 3DQVC 4KT5C 3DLLF 2GM4A 5L3FA 1FBSA 4AU7A 1XG1A 3GTGJ 1WKMA 3DEEA 1WI9A 2HU9A 3OMYA 1JJ6C 3HOVJ 2CUJA 2FXAA 1TLHB 3DBLB 2VIXA 1ZR2A 2DJIA 4HPQA 3GX4X 3TEDA 3CC2I 4NNJA 3ZQCA 3VPRA 3GFIA 2XGEA 2JTVA 2Y0SA 4Y15A 2M7AA 1TQIA 1ON2A 1U5TB 1TL8A 3OV8A 2V79A 2K85A 2TCTA 3OYFA 4U0YA 2B0LA 5EZHA 2QSFX 1HLVA 2CWEA 3GZ6A 2B7EA 3P9KA 3PNVA 3QOEA 4Y17A 5IP9J 4DZPA 3VSKA 5FB2A 1Z67A 2R7RA 2WAQA 5B1AH 1YYVA 2NVXJ 3CC4I 1YRNA 2MD5A 3OR2C 4M74A 1Z7LA 2VBZA 4CCKA 4RLQA 3LSRA 1HW1A 3I56I 1MZBA 1Z05A 2W48A 2F5EA 4LK0F 1NG6A 2A6EF 1A5JA 4M3FA 3V7SA 2UUZA 4LB5A 2LSOA 5J4VA 5IPAA 2W00A 3H5AA 5DCFA 2CRGA 1Z9CA 4C9YA 4RGUA 3WTUC 3LAPA 2QKMB 2X1EA 3I54A 4GYGA 4ZDLA 4QIWN 3S3OA 2CQNA 2BGCA 3IH4A 2HFHA 4I09A 5KK1A 2BY1A 5CLSA 1FMVA 1ZK8A 1AWCA 2XAHA 2ACJA 3CCUI 1G8XA 1U5TA 1VQ6I 2MABA 1WJ5A 1FOWA 2W82A 3NAUA 3HHGA 1BC8C 4B09A 1XD7A 2OAZA 3PO3J 1HKQA 2LFBA 2WY8Q 3J7AY 4EJOA 4LOCA 1OFCX 1OYIA 2XF5A 1WQ2A 3F8CA 2P5LC 2WY7Q 2XSJC 1B9NA 3R6SA 3O3KA 4A3DJ 2BYVE 1Y8QB 1BC7C 2CJJA 2IPQX 5HODA 3FXJA 1YW7A 1WJCA 3IUOA 5LGNA 2EV0A 2CMPA 1N25A 4DYCA 4BJ6C 3PFIA 2N8GA 4MNUA 1ZG1A 3JAMK 4ZZDA 1FYKA 2E19A 4U7DA 3J80K 4BEHB 1TQMA 5L3CA 3L2CA 2R5ZB 3FXLA 4BS9A 1MMGA 3O8GA 4PSWA 1HBXG 5B1BH 3KEYA 3ABLH 2BW3B 4XRSA 4F92B 5IOZA 3DPLC 2WV0A 1FY7A 3AL0B 4DJAA 3ASNH 4XLNF 2GA2A 3NWSA 3K4BA 2XIGA 1J75A 3HB9A 1GT0C 1H88C 3K4NA 1KA8A 2WB1N 1IN7A 4UV8A 5GP9A 3I59A 3AG4H 4OMZA 3KX2A 1IXRC 3J7AO 3QP5A 3OSFA 1Y1WJ 1XCVA 5K1YA 3BOQA 2Z9OA 3E1SA 2CSOA 3CF5F 4IO9F 1P4AA 1X3ZB 3N4MA 2KHMA 3DFGA 5EEHA 4F3QA 3MZHA 1R9TJ 4PJ0C 2J5OA 3KP5A 1O7FA 4XOPA 1JT6A 5LD2C 2R4GA 3OL3A 2HOSA 1MDMB 4Q5SF 3CJQB 1FEXA 1I50J 2LOOA 4L5IA 5FFZA 1SFOJ 4BEHA 4IL6C 3ZQHA 5CVRA 1TBXA 1NH3A 5E18F 4QWQA 4U0WA 1XDSA 3L00A 3E5XA 4CA0A 2Y9ZA 3RPQA 4ASNA 3JRDA 4U0VA 1ZRFA 1X1PA 3BR2A 5FGMA 2FRHA 3V8LA 1IN6A 1I6HJ 5E3OA 1ZKGA 3IWFA 1YFHA 3EYIA 4ESFA 3Q3SA 3WODF 2CW7A 4A93J 3BJAA 5CVJA 2MW8A 1VNDA 1QZEA 2HGCA 3KYCB 1REPC 3F8NA 2ZXJA 1F43A 2DI3A 2IS4A 2P5KA 3HRSA 3WG9A 1SAXA 2L9SA 3FDYA 1FWZA 3H9QA 3WG7H 3KETA 5L3GA 3KEQA 3EUHC 3RKQA 3HXLA 2ZC2A 3GTQJ 2RV8A 2V4JC 2K9SA 1UMQA 2DW4A 4ETSA 4MTDA 1ZG5A 5J1RA 4DBQA 1BR1A 1SMTA 1F1ZA 4D7MA 4HNUA 3LMMA 2DBBA 1R6RA 4HZFA 4I0BA 4OU0A 4HX7A 2DPUA 4KIGA 3WHCA 1PUFB 4DNCA 3S15J 1TWCJ 4GDFA 1I1GA 3OWTA 4N9HA 3FIWA 2R7ZJ 3I55I 1T38A 3CMMA 3VDXA 2HZTA 1RNLA 1R36A 4D5FA 4FE4A 4YIIA 4RM3A 3F8FA 1Z6RA 2H09A 5L3BA 2IA1A 5E1ZB 1WI3A 4IRGA 1V4RA 2FNAA 4B47A 4BH9A 2F6CA 3FHNA 3A1YA 1R7JA 3H36A 1MJAA 3HIFA 4PSXA 1GUUA 2EPFA 2ELKA 2IGNA 3GYHX 1ODDA 4B1RA 3JR9A 4KIBA 4PZJA 2NOJB 2MD0A 3DWLE 1JKOC 2OCCH 1UHMA 1JUMA 1X19A 4EM0B 3BPVA 1TTYA 2VE8A 2VI6A 2Z99A 1YO5C 1OMIA 1BJAA 1TW3A 3OIQA 4TV7A 3PFYA 1N78A 4IKFA 3GUDA 4O5VA 1FSEA 1HW2A 2OTJI 4UUSB 3LSIA 1CGPA 4A0XA 4HF2A 1RI7A 4LIUA 3IKVA 5E3MA 1PJRA 1K4TA 3MZ8A 5ICFA 4J00A 1E3HA 1TWGJ 2L9NA 5J8FA 3AG2H 4XN3A 3LSJA 4PGGA 4UY8I 4MFDA 3MKLA 4HV5A 1W0UA 4NUBA 3ZQLA 5H6RA 4EGZA 3J7ZI 2AQEA 1XN7A 2QA4I 4DZJA 4A3JJ 1R00A 1B6AA 4Y52J 4RM2A 2ZMEA 3I64A 3NEUA 4HG2A 2ECBA 1ONVA 2BBYA 3BDDA 3REOA 3AG3H 3M1CA 1MBJA 2K02A 2STWA 3IAM2 2HS5A 3ZP5A 1Z21A 4UV9A 2X1CA 5HNHA 3CCMI 2CQKA 4ESJA 3IC7A 1JT0A 4OIOF 2NVTJ 3DEWA 2QENA 2ZXIA 2ZJPF 1ERDA 3RTRA 4HDUA 3HPHA 1ZR4A 4F55A 3R60A 1KU7A 1RKTA 3CCJI 1TP4A 2DK8A 4BY7J 3QODA 4EVIA 4RB2C 2DA4A 3SEQA 1V5GA 1P6RA 3H5NA 2DFIA 4BU2A 3G73A 4F91B 5BMZA 3DKXA 2ETHA 3U1DA 1FP1D 4HNTA 1LVAA 3ESWB 1IRGA 1JKQC 3W6JB 2PI0A 3B02A 4E6KG 2O61A 3OYNA 2ZJRF 1T08B 4EGYA 4D5CA 3EETA 3FMQA 5DCMB 3T0YA 1I1SA 2L7FP 2JMWA 3FXMA 1JGGA 1QA6A 3EDPA 2QLZA 2M9HA 3ONQA 4EATA 1KQ8A 3SHFA 3GO5A 2TRTA 4NC7A 2P7VB 5LRRA 3BR5A 2XAFA 2V9KA 5GAEJ 2DMUA 2FU4A 2HXIA 1D3YA 1JHFA 2Z5UA 1TQPA 1RESA 2LNBA 4IQ4A 3J7YJ 1S3JA 2Y48A 2OCEA 3LSGA 4Q47A 2ZJ2A 4LD5A 4DYQA 2OUMA 1J09A 2FJ1A 4DIQA 1RUOA 2Y0SN 1UHSA 3LAJA 2IJLA 4AD9A 2E1MB 4CCLA 5D5VB 1R23A 4CO8A 1MGTA 4AM3A 4F93B 4HQEA 2RNJA 3ZMUA 3EUKL 2CYYA 2HNHA 3B6AA 4RB0A 5IT9K 1IZ1A 4KMUX 5DCMA 5DUIA 2WAQN 4P9FA 2O8KA 3RZDJ 3FF5A 1HOMA 2DA2A 2VE9A 1OCPA 3WTSC 4A5NA 3UKGA 1F9NA 3BZCA 2LP0A 2VJIA 2KL4A 3ERMA 4KN7X 1WCMJ 3DTIA 1S7EA 2X6YA 2PQ8A 2RGVA 3BROA 4QLCU 1EH8A 1SFEA 1EH6A 2COMA 5AIQA 4A6DA 3KZIC 4L9TA 2PEXA 2IEKA 1N77A 2ISZA 1A6QA 1IXSB 3KLNA 3OYIA 4W1UA 4ZYDA 5FROA 1D1AA 2RNGA 1K6OA 2YU9J 3HZJA 1LUJB 2X1DA 1Y6IA 3Q9SA 2ECCA 4I02A 3S93A 4UB6C 1ZN2A 1FLIA 3L2VA 1ORKA 3JSPA 4C3JJ 5F1JA 2D1HA 4XIDA 1R71A 4NB5A 5D4RA 3C3WA 5GADJ 2L9VA 3PQJA 3VYTB 4C3HJ 3QPHA 4BY1J 3OYDA 3R61A 5JHFA 1MNEA 4V19K 1MMDA 1SFUA 4XBFA 4FX0A 4CYDA 4XRMA 4Z2YA 5F04A 3U1KA 3BCAA 1WPKA 3F72A 2K9NA 2LRDA 3OS0A 3CMEI 4X6AJ 2HKXA 1I5ZA 3OIOA 4FCYA 2A05A 2MFZA 2CGPA 1MJ9A 4HV6A 3E5QA 4DGWB 2PFBA 3HYIA 2A07F 1X3UA 2VBYA 2XB0X 1VTNC 2Z1DA 1W36D 5FLXK 3M7GA 2GAUA 4CH7A 2R7UA 1DU6A 4EMSA 3I0TA 2BVLA 2JUGA 3JRFA 1J2XA 2GOMA 2VQHA 2IA2A 2LG4A 3MKWB 3I3LA 2UV1A 2R5YA 1EKEA 1O3SA 1X3WB 5K5RA 4BDZA 1YLFA 1S29A 2MYSA 3HGGA 3WU0A 4UUTA 1AOYA 2XB5A 2P4WA 2V6EA 1ETWA 4ZZLA 5A2QK 2GIVA 2OV7A 1KQ0A 2HPMA 3DLAA 3VYSB 1V5FA 4M3DA 4Y3OA 4M3BA 2LTPA 3V8KA 2X9DA 4NHJA 2LLKA 4PCQA 1X2MA 5GTIC 2FD5A 3F3XA 1ZREA 2B63J 2E2JJ 1Y0UA 2XHKA 2DCEA 2I8DA 3WTYC 3NARA 3ZQIA 1QO0D 1XGNA 1ETKA 4CCJA 4ZJZA 1T98A 1WGXA 1V5EA 1VQ8I 3OY9A 2DAOA 2JRMA 4BNCA 4YFXF 3S32A 3K1PA 3CMYA 1IRZA 1WVRA 2M8EA 3K1NA 1BR4A 2CS3A 2O3FA 2QQ9A 2Q2EB 3Q5FA 2KJCA 2QQAA 3RPUD 4CXFA 2NS7A 3HOWJ 4E7KA 2EIMH 2E2HJ 3SXYA 4M6XA 1FOXA 5BS6A 2ID6A 2VB6A 1R1UA 2NNYA 1XC5A 1LFBA 2I10A 4XQFA 3S1QJ 1YS6A 4HEA2 1MIJA 2JRTA 4B4CA 2DT6A 4BHBA 4RAGA 2RKHA 2BXZA 1DU0A 1VQLI 1DGWY 3GTMJ 3KP6A 1KYWA 5FKKA 2VQCA 1FJLA 4AWXB 5M5WJ 3BZ6A 3GEZA 2JA6J 4LLGF 2X6XA 2P0WA 3IHUA 2HQ5A 4RMNA 3DKYA 1Z7UA 3OYEA 2HVSA 4XN0A 1NK3P 1P7IA 4UVBA 4RDUA 3O8HA 3SYTA 2V26A 3KP2A 1O3QA 2JWTA 1L0OC 3RQIA 4ZYHA 4AIJA 1PP8F 2LBFB 1JKRC 2FQ4A 1A36A 2BZTA 4ABZA 1LB2A 3QU3A 3AFHA 3M8FA 2CUZA 3PSIA 2DYRH 2Q2EA 2ZMEC 2UXNA 2DT5A 1G3WA 2D5VA 3ULQB 2UWMA 1IO2A 3MD2A 1IJWC 4XLHA 2GBYA 2R7XA 2W1OA 4E7IA 3SEZA 3RDIA 3GW2A 1HW5A 1YW9A 3PSFA 1D5YA 3VSLA 4AYBA 5ICEA 5M3FJ 3ZGKA 4BE2A 1S7OA
chains in the Genus database with same CATH topology
4IPAA 5HLHA 4A12A 3T8TA 2KKOA 1ZRDA 3GFMA 2M1BA 3KFWX 1XGOA 2LKPA 5F1RA 5AIPA 5LRSA 1ZGAA 2D2WA 2K4JA 2JSCA 1IF1A 3C7JA 4BAYA 4BYYA 4O3MA 4CICA 4OINF 3DKWA 5D6EA 4GCVA 1XMKA 1Q1HA 4RGRA 2QVOA 2XGXA 1LEBA 1G6NA 3BPXA 2EV6A 3IRQA 2XRNA 3F6VA 1HXDA 4HX8A 4M9ZA 2NS0A 3DXJF 2MC3A 3JTHA 4I01A 5ERIA 3HUGA 3MCZA 4YIFA 2W25A 2EFOA 2ZBKA 4F7ZA 4WX9A 1MKMA 1TNTA 4LJZF 2HDCA 5FFXA 4H0EA 1RIOH 2FMLA 2V9VA 2EWNA 2W24A 2HYGD 3WU1B 4ENMA 1R22A 1S6LA 4A6EA 2HOEA 3TGNA 1DUXC 1IW7F 1IXCA 3DPTA 2KIMA 3RJPA 1ZAOA 3F6OA 3I71A 2XUBA 1E2XA 3KP3A 3HSFA 2XKOA 2EB7A 4MQVA 5FD5A 3JAMZ 4KIFA 4IVNA 1ZYRF 2MLGA 4WCGA 4P96A 3FMSA 3I4PA 5D8KB 2K7LA 1QQIA 3RYRA 3KZZA 2PBIA 1P4WA 5E1WA 2K4BA 1FYMA 2QBYB 3WTXC 1OYYA 4U7BA 4L0ZB 3O2PE 1LDDA 6PAXA 3WTWC 4RB3C 1Z1DA 4GGGA 3OOPA 4ZH4F 4GXOA 4PGHA 3E5UA 4AVPA 2G7HA 3MFKA 2LF8A 4CZZA 2O8XA 2GXGA 1JHHA 3RIRA 5E20A 2XVCA 4FHTA 5D6FA 4WK8F 3JW4A 4Y13A 1FBUA 4G94A 4WXCA 1S8NA 2FF4A 4ZYGA 2KJBA 1FP2A 3GF2A 1D8JA 3TDUC 1ZGJA 5HOOA 2J5PA 4AIHA 1MDMA 2OZ6A 4P55A 2GQQA 5DV5A 4MGRA 4M73A 2XAQA 2HEOA 3QPTA 1EV7A 3L09A 2DTRA 2D45A 2XAGA 3V4GA 5LHHA 3ELKA 1BIAA 2CO5A 5L3DA 1ZG3A 3E6CC 5LHGA 1SD7A 1U6GA 2EFQA 3ZPLA 1G4DA 5K5QA 1K78B 2GWRA 4FT8A 3TQNA 4UHTA 1T0FA 4Q48A 3D5LA 2QYOA 5TJJA 5F6FA 1KU2A 4L9NA 1GXQA 1T39A 4EJVA 4UNOA 4A2UA 3LFKA 2OZUA 1B4AA 1ZH5A 3E6BA 2O6GE 2IVMA 2VC1A 1ZARA 3P9CA 1W5TA 4RS8A 3JSOA 2AXLA 4P9UA 1T6SA 3T1BA 4MHGA 3I58A 4RB1A 2ELHA 1XB4A 2ZNYA 2DU9A 4HOBA 4HF1A 3NQOA 2FNPA 3CUQB 2A5YB 3I53A 3RKYA 4IF4A 4MTEA 3K0LA 5DUKA 1STZA 1D5VA 3DEUA 1W7PB 5LBQA 2EV5A 2HQRA 3E6DA 4R79A 4R8HA 2ESHA 3BJOA 5HDKA 4IRIA 3GFJA 1K7AA 1BOAA 1R58A 4M71A 1ON1A 2RC4A 3SQNA 1QBJA 2VOPA 2EFWA 4XLPF 2ZNZA 4I0AA 2YX7A 1YG2A 3IL2A 2EK5A 3CUQA 5LHIA 4UVCA 3RPUA 2FOKA 2W84A 4HYEA 3K2ZA 5E1XA 4L18B 2MH2A 3ECOA 1HKTA 3AAFA 2E1CA 1HSJA 1U5TC 2VOOA 4LK1F 2YU3A 5JHUA 3KP4A 5JFRA 1XSXA 5FO5A 2P6TA 2IA0A 2VT2A 3FXRA 1LDKB 2ZO4A 3WTTC 4EQQA 5LGTA 2BV6A 3HOTA 1BI0A 1U3EM 4G7ZF 1USSA 4WXDA 3WGHA 4IXAA 2V1DA 3HRMA 3V7CA 2VT3A 4EJTA 1QZYA 2FQ3A 1SD6A 4ENNA 2DO7A 5EEGA 3ABUA 1SMYF 3IKTA 2ZCWA 3PQKA 3FXQA 2VONA 3ZMTA 2IT0A 3JTGA 1FBQA 2Z3YA 3TO9A 2PJPA 2VODA 3TKYA 3LA2A 2ZKZA 1P2FA 3VFZA 1BI2A 2JPCA 4AIKA 2HKOA 3SZTA 1RUNA 3DV8A 3KCCA 2VXZA 1T2KA 3F23A 4N0BA 1E17A 4JBAA 5E8IA 4L9VA 2A6HF 3SFZA 3GWZA 4JQFA 2A69F 3R0AA 2JZYA 3TOAA 2XROA 3F22A 3GFLA 2MH9A 3HRUA 1OPCA 2EFPA 5KVRA 2R7DA 1UHWA 4LGWA 1FYLA 4BHCA 2WWYA 4U88A 5K5OA 1SFXA 2AS5F 4LFUA 4ENKA 1WRJA 2QUFA 4IHTA 1NHAA 2HQNA 2H94A 3CUOA 3K69A 4M6YA 1K79A 4L0YB 2C6YA 2G7UA 1DPRA 3FM5A 5J8CA 2VBXA 1BBYA 4EM2A 3N97A 2JPBA 1ZLKA 1GVJA 2OA4A 4S05A 3HOSA 4IJAA 3BJ6A 3R4KA 1CF7B 2IP2A 1W7PD 1G3SA 1FNNA 2K86A 1P92A 2DPDA 1PUEE 2HTJA 2A3SA 1J0RA 1RZ4A 1L3LA 1DDNA 5H6QA 3NRVA 2CW0F 3CDHA 1SD5A 1U2WA 4YFNF 2V1UA 2HWVA 2VN2A 2P7CB 2JT1A 4OIRF 4JK1X 3COAC 4MEYF 2FBHA 1XGMA 1UB9A 4GO1A 2MBFA 2OQRA 1YS7A 4K2EA 3BWGA 1HSTA 4RGXA 1XDUA 1QPMA 1DPUA 1CF7A 1ZRCA 3CJNA 5DEQA 2STTA 5HVQC 2MA3A 2F5CA 3H92A 1FSHA 1WWXA 3M9AA 3G3ZA 2M30A 2OD5A 3QP6A 1YIOA 3J81Z 3VOEA 3KE2A 1R5GA 5ILVA 3CUQC 2G9WA 4G6QA 3LQRA 4I98B 3TO7A 4EJWA 3TO6A 2D1VA 2O0YA 3RYPA 3HHHA 2M5WA 1QZZA 3VEPA 3ZMSA 3F8MA 3IWZA 2YSRA 5LGUA 4ZYEA 1YTYA 3MQ0A 1XCBA 3WGGA 2DLLA 2GXBA 5F64A 5HLGA 3EYYA 1KYZA 4LLLA 3LQQA 3B73A 3E6MA 3E3VA 1BI3A 3FHZA 3ERED 5L3EA 4KDPA 2X0LA 3QU6A 5DYMA 1W5SA 3ML6A 2FA5A 2Y75A 1I6XA 2Y0MA 3RI4A 1JXSA 1TW2A 1G3TA 2E7WA 4EM1A 4G7HF 1W4MA 5CVVA 4WXHA 3ZMVA 1ZLJA 3GZ5A 3WE3A 1KU3A 4OIPF 1OR7A 3DP7A 5ED4A 1XSDA 4KN4X 3F21A 5HS7A 3I59B 3J80Z 4EJUA 3TOBA 1TNSA 3MWMA 4M9SA 4OIQF 4R1HA 1U8RA 1UCRA 5D5UB 2KIFA 3HSEA 2RQPA 4A5MA 1XMAA 3V8JA 3R0JA 4LMYA 3DF8A 3KLOA 2R7FA 3FZVA 1XGSA 1IUYA 4OOIA 5HDNA 2Q0OA 4GYIA 4HA8A 3S2WA 1FOKA 4MEXF 2QM3A 4OMYA 4YG2F 3SZPA 4CHUA 5BPIA 3LWFA 5JR3A 1J5YA 1MJBA 3FX3A 1BI1A 2QBYA 2V6CA 3ABTA 3MEXA 1IN5A 3U2RA 4HAMA 4M9XA 3HRTA 1BIBA 4G8XA 2NYXA 3KEOA 2KIUA 1DP7P 3ZMZA 5DD8A 3FMRA 4N9IA 2OBPA 4G9YA 1B59A 4LB6B 2UZKA 2F5DA 3MAJA 3P9IA 2E7XA 2LF7A 1C0WA 1HKSA 3K1MA 2GZWA 3BY6A 1O7LA 5E8GA 1B9MA 1R5HA 1IRFA 3P7NA 3FM3A 5LLQA 4KMFA 2L4MA 1I27A 5CVIA 4I2OA 2K27A 4MQ9F 4RGSA 2H6BA 5FD6A 2P6SA 1D8KA 2ZMEB 4XSXF 5D5WB 1S7AA 1USTA 4RAZA 3HTSB 3VODA 1KQ9A 1XSVA 5D4SA 5HDGA 1G3YA 5DDGA 2H6CA 1H9GA 1K78A 4UVAA 1LEAA 2DK5A 3CTAA 5JVTA 1PDNC 3BP8A 2HTSA 2MLKA 4BQAA 2ADUA 2M87A 4FX4A 2YPRA 3ZN0A 3V7RA 4KUMA 1YQAA 2EA2A 2UXXA 1QNTA 4KICA 2M45A 1Z91A 1PP7U 2WTEA 2XKPA 1HQCA 1ZHFA 3M8EA 2NNNA 4D0PA 4HLYA 4CGZA 5J6XA 2L3DA 5LEKA 3M1EA 2FMYA 2L54A 1J7KA 5TRDA 1KU9A 3H3ZA 1W7PA 4DQ2A 4A0YA 1B1BA 3GVAA 4I7HA 5E17F 2R3SA 4BHPA 2IW5A 3VB2A 2HR3A 2EA4A 3WTVC 2E1NA 4ESBA 1JGSA 4UUVA 2X4HA 2XV4S 2H27A 4IHSA 4E70A 4HF0A 3EQLF 3ZN1A 4B8XA 2XAJA 4HW0A 1FX7A 5H20A 4HQMA 2ISYA 5AONA 2O03A 3K9TA 3F8BA 2F5FA 5BQTA 5DD4A 1IN4A 1LQ1A 2XASA 1LDJA 4RAYA 2VBWA 5IT9Z 2FBIA 3RKWA 4EV0A 1LJ9A 2KRFA 1GHCA 3TDZC 2YR2A 4PDKA 2Q8KA 2YX4A 3IRRA 4KNYA 3C1DA 3Q9VA 4XRFA 3O6BB 3W6KB 3LA7A 4KA4A 1O3TA 3HTUA 5LEJA 4WF2A 5D5XB 4HBLA 3HSRA 3CO6C 1YW8A 2HYFA 1SD4A 2A61A 1U78A 1FC3A 2PMHA 2NRAC 4P5OA 5ILSA 2F2EA 5ICGA 4Q4ZF 2RN7A 4G7OF 1EH7A 2PMUA 1JE8A 1GXPA 3LSTA 5JI6A 5FLXZ 1O3RA 3ISPA 1FPQA 3E97A 2BE5F 2ZFWA 1P4XA 3ROUA 4CDGA 1H9TA 2PG4A 5ICCA 4KYWA 2L01A 4HDVA 3T8RA 3KP7A 4L5JA 2PLYA 2BEOA 4KFCA 3RKXA 5A2QZ 3I5UA 1QGPA 3MZYA 5CYVA 3WE2A 1LNWA 1IAWA 4M72A 1Z6TA 5HLIA 2DQLA 4O6JA 2EFNA 1BM9A 3ZMDA 1WSUA 3T5XA 5HS9A 2RDPA 2CG4A 3WTZA 4BXUA 3GXOA 2GA1A 3H3UA 1O57A 2OU2A 4LG0B 3L7WA 4LLNA 2W85A 5HS8A 2FSWA 2LDUA 5CVUA 4XSZF 1OKRA 5BPDA 1J59A 2QQBA 4HX4A 2WC2A 3C18A 1FT9A 3WGIA 3LA3A 4YFKF 3CO7C 2RVCA 2TDXA 1KGSA 1UFMA 3D0SA 1F4KA 4UXNA 1BN5A 3EUHA 2W57A 5ILUA 3FXUA 2DQRA 4HLXA 1R1VA 2P5VA 1IN8A 2V1XA 2L02A 5D8LB 1J9IA 3GLXA 4L9JA 4IRHA 4LG0A 2FBKA 4ON0A 3FWEA 4ENJA 3ZQ7A 1FZPB 3QAHA 5IT3A 2QZ8A 2NAZA 2L4AA 3L9FA 3QRFF 3QOPA 1V3FA 1A04A 2QWWA 4NQWA 4S04A 5CJ9A 3KZYA 2CFXA 2ESNA 1OYWA 1H0MA 3ECHA 3U9GA 2VC0A 2A68F 2FEZA 2EJRA 4A0ZA 2Z33A 1ULYA 2OQGA 2PN6A 4WWCA 1F5TA 2FE3A 1MD0A 4G6DA 3CLOA 1R1TA 3J81K 2IRFG 5BOXA 2P8TA 3DQVC 4KT5C 5L3FA 1FBSA 1WKMA 1WI9A 2FXAA 1TLHB 3GX4X 3GFIA 2JTVA 4Y15A 1TQIA 1ON2A 1U5TB 3OV8A 2V79A 4U0YA 2B0LA 2CWEA 3GZ6A 3P9KA 4Y17A 5FB2A 1YYVA 2MD5A 4M74A 2VBZA 1HW1A 1MZBA 1Z05A 2F5EA 4LK0F 2A6EF 3V7SA 4LB5A 2LSOA 5DCFA 1Z9CA 4RGUA 3WTUC 3LAPA 3I54A 4GYGA 2BGCA 2HFHA 4I09A 5KK1A 5CLSA 1AWCA 2XAHA 2ACJA 1U5TA 3HHGA 1BC8C 4B09A 1XD7A 2OAZA 1HKQA 4EJOA 1OYIA 1WQ2A 3F8CA 2P5LC 1B9NA 3R6SA 3O3KA 2BYVE 1BC7C 2IPQX 1YW7A 5LGNA 2EV0A 3PFIA 4MNUA 1ZG1A 3JAMK 4ZZDA 1FYKA 4U7DA 3J80K 1TQMA 5L3CA 3L2CA 1HBXG 3DPLC 2WV0A 1FY7A 4XLNF 2GA2A 2XIGA 1J75A 4UV8A 1KA8A 1IN7A 3I59A 4OMZA 1IXRC 3J7AO 3QP5A 1XCVA 5K1YA 3BOQA 2Z9OA 2CSOA 1P4AA 3N4MA 3DFGA 5EEHA 3MZHA 2J5OA 3KP5A 1O7FA 4Q5SF 1MDMB 4L5IA 5FFZA 5CVRA 1TBXA 5E18F 4QWQA 4U0WA 1XDSA 3L00A 3E5XA 3RPQA 4ASNA 4U0VA 1ZRFA 5FGMA 2FRHA 3V8LA 1IN6A 3IWFA 1YFHA 3EYIA 4ESFA 3WODF 3BJAA 5CVJA 2HGCA 1REPC 3F8NA 2ZXJA 2DI3A 2P5KA 3HRSA 3WG9A 1SAXA 1FWZA 3KETA 5L3GA 3KEQA 2RV8A 2DW4A 4ETSA 4MTDA 1ZG5A 1SMTA 1F1ZA 2DBBA 4HZFA 4I0BA 4OU0A 4HX7A 2DPUA 4KIGA 4DNCA 1I1GA 4N9HA 1T38A 2HZTA 1RNLA 1R36A 4YIIA 3F8FA 1Z6RA 2H09A 5L3BA 2IA1A 5E1ZB 4IRGA 1V4RA 2FNAA 4BH9A 1R7JA 1MJAA 3HIFA 3GYHX 1ODDA 4KIBA 4PZJA 1UHMA 4EM0B 3BPVA 1TTYA 2VE8A 2Z99A 1YO5C 1OMIA 1BJAA 1TW3A 4TV7A 3GUDA 4O5VA 1FSEA 1HW2A 1CGPA 4A0XA 4HF2A 1RI7A 3IKVA 5ICFA 5J8FA 4PGGA 4HV5A 5H6RA 4EGZA 1XN7A 1R00A 1B6AA 2ZMEA 3I64A 3NEUA 1ONVA 2BBYA 3BDDA 3REOA 2K02A 2STWA 2HS5A 3ZP5A 4UV9A 2CQKA 4ESJA 3IC7A 4OIOF 2QENA 3RTRA 4HDUA 3R60A 1KU7A 2DK8A 4EVIA 4RB2C 1P6RA 2DFIA 3G73A 5BMZA 2ETHA 3U1DA 1FP1D 1LVAA 1IRGA 3W6JB 2PI0A 3B02A 2O61A 4EGYA 3EETA 3FMQA 5DCMB 3T0YA 1I1SA 3EDPA 2QLZA 1KQ8A 3SHFA 3GO5A 2P7VB 5LRRA 2XAFA 2FU4A 1D3YA 1JHFA 2Z5UA 1TQPA 2LNBA 1S3JA 2Y48A 4Q47A 2ZJ2A 4LD5A 1RUOA 3LAJA 2IJLA 4AD9A 5D5VB 1R23A 4CO8A 1MGTA 4HQEA 2RNJA 3ZMUA 2CYYA 4RB0A 5IT9K 1IZ1A 4KMUX 5DCMA 5DUIA 4P9FA 3FF5A 2VE9A 3WTSC 4A5NA 1F9NA 4KN7X 2PQ8A 2RGVA 3BROA 4QLCU 1EH8A 1SFEA 1EH6A 2COMA 5AIQA 4A6DA 4L9TA 2PEXA 2ISZA 1IXSB 3KLNA 4ZYDA 1K6OA 3Q9SA 4I02A 1ZN2A 1FLIA 3JSPA 2D1HA 4NB5A 5D4RA 3C3WA 3PQJA 3QPHA 3R61A 1SFUA 4XBFA 4FX0A 4CYDA 4Z2YA 3F72A 2HKXA 1I5ZA 2CGPA 1MJ9A 4HV6A 3E5QA 2PFBA 3HYIA 2A07F 1X3UA 2VBYA 1VTNC 5FLXK 3M7GA 2GAUA 4EMSA 3I0TA 1J2XA 2IA2A 1O3SA 5K5RA 1YLFA 1S29A 3WU0A 1AOYA 2P4WA 4ZZLA 5A2QK 2GIVA 1KQ0A 3V8KA 4NHJA 4PCQA 3F3XA 1ZREA 1Y0UA 2XHKA 3WTYC 1QO0D 1XGNA 1T98A 2DAOA 4BNCA 4YFXF 3K1PA 2M8EA 3K1NA 2O3FA 2QQ9A 3Q5FA 2KJCA 2QQAA 4CXFA 3SXYA 4M6XA 5BS6A 1R1UA 2NNYA 1YS6A 2JRTA 4BHBA 2RKHA 3KP6A 1KYWA 4AWXB 3BZ6A 3GEZA 4LLGF 3IHUA 1Z7UA 4UVBA 3KP2A 1O3QA 1L0OC 4ZYHA 4AIJA 1PP8F 1LB2A 3QU3A 3M8FA 2Q2EA 2UXNA 2DT5A 1G3WA 3ULQB 2UWMA 3RDIA 3GW2A 1HW5A 1YW9A 5ICEA 1S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  5HLH A;  4A12 A;  3T8T A;  2KKO A;  1ZRD A;  3GFM A;  2M1B A;  3KFW X;  1XGO A;  2LKP A;  5F1R A;  5AIP A;  5LRS A;  1ZGA A;  2D2W A;  2K4J A;  2JSC A;  1IF1 A;  3C7J A;  4BAY A;  4BYY A;  4O3M A;  4CIC A;  4OIN F;  3DKW A;  5D6E A;  4GCV A;  1XMK A;  1Q1H A;  4RGR A;  2QVO A;  2XGX A;  1LEB A;  1G6N A;  3BPX A;  2EV6 A;  3IRQ A;  2XRN A;  3F6V A;  1HXD A;  4HX8 A;  4M9Z A;  2NS0 A;  3DXJ F;  2MC3 A;  3JTH A;  4I01 A;  5ERI A;  3HUG A;  3MCZ A;  4YIF A;  2W25 A;  2EFO A;  2ZBK A;  4F7Z A;  4WX9 A;  1MKM A;  1TNT A;  4LJZ F;  2HDC A;  5FFX A;  4H0E A;  1RIO H;  2FML A;  2V9V A;  2EWN A;  2W24 A;  2HYG D;  3WU1 B;  4ENM A;  1R22 A;  1S6L A;  4A6E A;  2HOE A;  3TGN A;  1DUX C;  1IW7 F;  1IXC A;  3DPT A;  2KIM A;  3RJP A;  1ZAO A;  3F6O A;  3I71 A;  2XUB A;  1E2X A;  3KP3 A;  3HSF A;  2XKO A;  2EB7 A;  4MQV A;  5FD5 A;  3JAM Z;  4KIF A;  4IVN A;  1ZYR F;  2MLG A;  4WCG A;  4P96 A;  3FMS A;  3I4P A;  5D8K B;  2K7L A;  1QQI A;  3RYR A;  3KZZ A;  2PBI A;  1P4W A;  5E1W A;  2K4B A;  1FYM A;  2QBY B;  3WTX C;  1OYY A;  4U7B A;  4L0Z B;  3O2P E;  1LDD A;  6PAX A;  3WTW C;  4RB3 C;  1Z1D A;  4GGG A;  3OOP A;  4ZH4 F;  4GXO A;  4PGH A;  3E5U A;  4AVP A;  2G7H A;  3MFK A;  2LF8 A;  4CZZ A;  2O8X A;  2GXG A;  1JHH A;  3RIR A;  5E20 A;  2XVC A;  4FHT A;  5D6F A;  4WK8 F;  3JW4 A;  4Y13 A;  1FBU A;  4G94 A;  4WXC A;  1S8N A;  2FF4 A;  4ZYG A;  2KJB A;  1FP2 A;  3GF2 A;  1D8J A;  3TDU C;  1ZGJ A;  5HOO A;  2J5P A;  4AIH A;  1MDM A;  2OZ6 A;  4P55 A;  2GQQ A;  5DV5 A;  4MGR A;  4M73 A;  2XAQ A;  2HEO A;  3QPT A;  1EV7 A;  3L09 A;  2DTR A;  2D45 A;  2XAG A;  3V4G A;  5LHH A;  3ELK A;  1BIA A;  2CO5 A;  5L3D A;  1ZG3 A;  3E6C C;  5LHG A;  1SD7 A;  1U6G A;  2EFQ A;  3ZPL A;  1G4D A;  5K5Q A;  1K78 B;  2GWR A;  4FT8 A;  3TQN A;  4UHT A;  1T0F A;  4Q48 A;  3D5L A;  2QYO A;  5TJJ A;  5F6F A;  1KU2 A;  4L9N A;  1GXQ A;  1T39 A;  4EJV A;  4UNO A;  4A2U A;  3LFK A;  2OZU A;  1B4A A;  1ZH5 A;  3E6B A;  2O6G E;  2IVM A;  2VC1 A;  1ZAR A;  3P9C A;  1W5T A;  4RS8 A;  3JSO A;  2AXL A;  4P9U A;  1T6S A;  3T1B A;  4MHG A;  3I58 A;  4RB1 A;  2ELH A;  1XB4 A;  2ZNY A;  2DU9 A;  4HOB A;  4HF1 A;  3NQO A;  2FNP A;  3CUQ B;  2A5Y B;  3I53 A;  3RKY A;  4IF4 A;  4MTE A;  3K0L A;  5DUK A;  1STZ A;  1D5V A;  3DEU A;  1W7P B;  5LBQ A;  2EV5 A;  2HQR A;  3E6D A;  4R79 A;  4R8H A;  2ESH A;  3BJO A;  5HDK A;  4IRI A;  3GFJ A;  1K7A A;  1BOA A;  1R58 A;  4M71 A;  1ON1 A;  2RC4 A;  3SQN A;  1QBJ A;  2VOP A;  2EFW A;  4XLP F;  2ZNZ A;  4I0A A;  2YX7 A;  1YG2 A;  3IL2 A;  2EK5 A;  3CUQ A;  5LHI A;  4UVC A;  3RPU A;  2FOK A;  2W84 A;  4HYE A;  3K2Z A;  5E1X A;  4L18 B;  2MH2 A;  3ECO A;  1HKT A;  3AAF A;  2E1C A;  1HSJ A;  1U5T C;  2VOO A;  4LK1 F;  2YU3 A;  5JHU A;  3KP4 A;  5JFR A;  1XSX A;  5FO5 A;  2P6T A;  2IA0 A;  2VT2 A;  3FXR A;  1LDK B;  2ZO4 A;  3WTT C;  4EQQ A;  5LGT A;  2BV6 A;  3HOT A;  1BI0 A;  1U3E M;  4G7Z F;  1USS A;  4WXD A;  3WGH A;  4IXA A;  2V1D A;  3HRM A;  3V7C A;  2VT3 A;  4EJT A;  1QZY A;  2FQ3 A;  1SD6 A;  4ENN A;  2DO7 A;  5EEG A;  3ABU A;  1SMY F;  3IKT A;  2ZCW A;  3PQK A;  3FXQ A;  2VON A;  3ZMT A;  2IT0 A;  3JTG A;  1FBQ A;  2Z3Y A;  3TO9 A;  2PJP A;  2VOD A;  3TKY A;  3LA2 A;  2ZKZ A;  1P2F A;  3VFZ A;  1BI2 A;  2JPC A;  4AIK A;  2HKO A;  3SZT A;  1RUN A;  3DV8 A;  3KCC A;  2VXZ A;  1T2K A;  3F23 A;  4N0B A;  1E17 A;  4JBA A;  5E8I A;  4L9V A;  2A6H F;  3SFZ A;  3GWZ A;  4JQF A;  2A69 F;  3R0A A;  2JZY A;  3TOA A;  2XRO A;  3F22 A;  3GFL A;  2MH9 A;  3HRU A;  1OPC A;  2EFP A;  5KVR A;  2R7D A;  1UHW A;  4LGW A;  1FYL A;  4BHC A;  2WWY A;  4U88 A;  5K5O A;  1SFX A;  2AS5 F;  4LFU A;  4ENK A;  1WRJ A;  2QUF A;  4IHT A;  1NHA A;  2HQN A;  2H94 A;  3CUO A;  3K69 A;  4M6Y A;  1K79 A;  4L0Y B;  2C6Y A;  2G7U A;  1DPR A;  3FM5 A;  5J8C A;  2VBX A;  1BBY A;  4EM2 A;  3N97 A;  2JPB A;  1ZLK A;  1GVJ A;  2OA4 A;  4S05 A;  3HOS A;  4IJA A;  3BJ6 A;  3R4K A;  1CF7 B;  2IP2 A;  1W7P D;  1G3S A;  1FNN A;  2K86 A;  1P92 A;  2DPD A;  1PUE E;  2HTJ A;  2A3S A;  1J0R A;  1RZ4 A;  1L3L A;  1DDN A;  5H6Q A;  3NRV A;  2CW0 F;  3CDH A;  1SD5 A;  1U2W A;  4YFN F;  2V1U A;  2HWV A;  2VN2 A;  2P7C B;  2JT1 A;  4OIR F;  4JK1 X;  3COA C;  4MEY F;  2FBH A;  1XGM A;  1UB9 A;  4GO1 A;  2MBF A;  2OQR A;  1YS7 A;  4K2E A;  3BWG A;  1HST A;  4RGX A;  1XDU A;  1QPM A;  1DPU A;  1CF7 A;  1ZRC A;  3CJN A;  5DEQ A;  2STT A;  5HVQ C;  2MA3 A;  2F5C A;  3H92 A;  1FSH A;  1WWX A;  3M9A A;  3G3Z A;  2M30 A;  2OD5 A;  3QP6 A;  1YIO A;  3J81 Z;  3VOE A;  3KE2 A;  1R5G A;  5ILV A;  3CUQ C;  2G9W A;  4G6Q A;  3LQR A;  4I98 B;  3TO7 A;  4EJW A;  3TO6 A;  2D1V A;  2O0Y A;  3RYP A;  3HHH A;  2M5W A;  1QZZ A;  3VEP A;  3ZMS A;  3F8M A;  3IWZ A;  2YSR A;  5LGU A;  4ZYE A;  1YTY A;  3MQ0 A;  1XCB A;  3WGG A;  2DLL A;  2GXB A;  5F64 A;  5HLG A;  3EYY A;  1KYZ A;  4LLL A;  3LQQ A;  3B73 A;  3E6M A;  3E3V A;  1BI3 A;  3FHZ A;  3ERE D;  5L3E A;  4KDP A;  2X0L A;  3QU6 A;  5DYM A;  1W5S A;  3ML6 A;  2FA5 A;  2Y75 A;  1I6X A;  2Y0M A;  3RI4 A;  1JXS A;  1TW2 A;  1G3T A;  2E7W A;  4EM1 A;  4G7H F;  1W4M A;  5CVV A;  4WXH A;  3ZMV A;  1ZLJ A;  3GZ5 A;  3WE3 A;  1KU3 A;  4OIP F;  1OR7 A;  3DP7 A;  5ED4 A;  1XSD A;  4KN4 X;  3F21 A;  5HS7 A;  3I59 B;  3J80 Z;  4EJU A;  3TOB A;  1TNS A;  3MWM A;  4M9S A;  4OIQ F;  4R1H A;  1U8R A;  1UCR A;  5D5U B;  2KIF A;  3HSE A;  2RQP A;  4A5M A;  1XMA A;  3V8J A;  3R0J A;  4LMY A;  3DF8 A;  3KLO A;  2R7F A;  3FZV A;  1XGS A;  1IUY A;  4OOI A;  5HDN A;  2Q0O A;  4GYI A;  4HA8 A;  3S2W A;  1FOK A;  4MEX F;  2QM3 A;  4OMY A;  4YG2 F;  3SZP A;  4CHU A;  5BPI A;  3LWF A;  5JR3 A;  1J5Y A;  1MJB A;  3FX3 A;  1BI1 A;  2QBY A;  2V6C A;  3ABT A;  3MEX A;  1IN5 A;  3U2R A;  4HAM A;  4M9X A;  3HRT A;  1BIB A;  4G8X A;  2NYX A;  3KEO A;  2KIU A;  1DP7 P;  3ZMZ A;  5DD8 A;  3FMR A;  4N9I A;  2OBP A;  4G9Y A;  1B59 A;  4LB6 B;  2UZK A;  2F5D A;  3MAJ A;  3P9I A;  2E7X A;  2LF7 A;  1C0W A;  1HKS A;  3K1M A;  2GZW A;  3BY6 A;  1O7L A;  5E8G A;  1B9M A;  1R5H A;  1IRF A;  3P7N A;  3FM3 A;  5LLQ A;  4KMF A;  2L4M A;  1I27 A;  5CVI A;  4I2O A;  2K27 A;  4MQ9 F;  4RGS A;  2H6B A;  5FD6 A;  2P6S A;  1D8K A;  2ZME B;  4XSX F;  5D5W B;  1S7A A;  1UST A;  4RAZ A;  3HTS B;  3VOD A;  1KQ9 A;  1XSV A;  5D4S A;  5HDG A;  1G3Y A;  5DDG A;  2H6C A;  1H9G A;  1K78 A;  4UVA A;  1LEA A;  2DK5 A;  3CTA A;  5JVT A;  1PDN C;  3BP8 A;  2HTS A;  2MLK A;  4BQA A;  2ADU A;  2M87 A;  4FX4 A;  2YPR A;  3ZN0 A;  3V7R A;  4KUM A;  1YQA A;  2EA2 A;  2UXX A;  1QNT A;  4KIC A;  2M45 A;  1Z91 A;  1PP7 U;  2WTE A;  2XKP A;  1HQC A;  1ZHF A;  3M8E A;  2NNN A;  4D0P A;  4HLY A;  4CGZ A;  5J6X A;  2L3D A;  5LEK A;  3M1E A;  2FMY A;  2L54 A;  1J7K A;  5TRD A;  1KU9 A;  3H3Z A;  1W7P A;  4DQ2 A;  4A0Y A;  1B1B A;  3GVA A;  4I7H A;  5E17 F;  2R3S A;  4BHP A;  2IW5 A;  3VB2 A;  2HR3 A;  2EA4 A;  3WTV C;  2E1N A;  4ESB A;  1JGS A;  4UUV A;  2X4H A;  2XV4 S;  2H27 A;  4IHS A;  4E70 A;  4HF0 A;  3EQL F;  3ZN1 A;  4B8X A;  2XAJ A;  4HW0 A;  1FX7 A;  5H20 A;  4HQM A;  2ISY A;  5AON A;  2O03 A;  3K9T A;  3F8B A;  2F5F A;  5BQT A;  5DD4 A;  1IN4 A;  1LQ1 A;  2XAS A;  1LDJ A;  4RAY A;  2VBW A;  5IT9 Z;  2FBI A;  3RKW A;  4EV0 A;  1LJ9 A;  2KRF A;  1GHC A;  3TDZ C;  2YR2 A;  4PDK A;  2Q8K A;  2YX4 A;  3IRR A;  4KNY A;  3C1D A;  3Q9V A;  4XRF A;  3O6B B;  3W6K B;  3LA7 A;  4KA4 A;  1O3T A;  3HTU A;  5LEJ A;  4WF2 A;  5D5X B;  4HBL A;  3HSR A;  3CO6 C;  1YW8 A;  2HYF A;  1SD4 A;  2A61 A;  1U78 A;  1FC3 A;  2PMH A;  2NRA C;  4P5O A;  5ILS A;  2F2E A;  5ICG A;  4Q4Z F;  2RN7 A;  4G7O F;  1EH7 A;  2PMU A;  1JE8 A;  1GXP A;  3LST A;  5JI6 A;  5FLX Z;  1O3R A;  3ISP A;  1FPQ A;  3E97 A;  2BE5 F;  2ZFW A;  1P4X A;  3ROU A;  4CDG A;  1H9T A;  2PG4 A;  5ICC A;  4KYW A;  2L01 A;  4HDV A;  3T8R A;  3KP7 A;  4L5J A;  2PLY A;  2BEO A;  4KFC A;  3RKX A;  5A2Q Z;  3I5U A;  1QGP A;  3MZY A;  5CYV A;  3WE2 A;  1LNW A;  1IAW A;  4M72 A;  1Z6T A;  5HLI A;  2DQL A;  4O6J A;  2EFN A;  1BM9 A;  3ZMD A;  1WSU A;  3T5X A;  5HS9 A;  2RDP A;  2CG4 A;  3WTZ A;  4BXU A;  3GXO A;  2GA1 A;  3H3U A;  1O57 A;  2OU2 A;  4LG0 B;  3L7W A;  4LLN A;  2W85 A;  5HS8 A;  2FSW A;  2LDU A;  5CVU A;  4XSZ F;  1OKR A;  5BPD A;  1J59 A;  2QQB A;  4HX4 A;  2WC2 A;  3C18 A;  1FT9 A;  3WGI A;  3LA3 A;  4YFK F;  3CO7 C;  2RVC A;  2TDX A;  1KGS A;  1UFM A;  3D0S A;  1F4K A;  4UXN A;  1BN5 A;  3EUH A;  2W57 A;  5ILU A;  3FXU A;  2DQR A;  4HLX A;  1R1V A;  2P5V A;  1IN8 A;  2V1X A;  2L02 A;  5D8L B;  1J9I A;  3GLX A;  4L9J A;  4IRH A;  4LG0 A;  2FBK A;  4ON0 A;  3FWE A;  4ENJ A;  3ZQ7 A;  1FZP B;  3QAH A;  5IT3 A;  2QZ8 A;  2NAZ A;  2L4A A;  3L9F A;  3QRF F;  3QOP A;  1V3F A;  1A04 A;  2QWW A;  4NQW A;  4S04 A;  5CJ9 A;  3KZY A;  2CFX A;  2ESN A;  1OYW A;  1H0M A;  3ECH A;  3U9G A;  2VC0 A;  2A68 F;  2FEZ A;  2EJR A;  4A0Z A;  2Z33 A;  1ULY A;  2OQG A;  2PN6 A;  4WWC A;  1F5T A;  2FE3 A;  1MD0 A;  4G6D A;  3CLO A;  1R1T A;  3J81 K;  2IRF G;  5BOX A;  2P8T A;  3DQV C;  4KT5 C;  5L3F A;  1FBS A;  1WKM A;  1WI9 A;  2FXA A;  1TLH B;  3GX4 X;  3GFI A;  2JTV A;  4Y15 A;  1TQI A;  1ON2 A;  1U5T B;  3OV8 A;  2V79 A;  4U0Y A;  2B0L A;  2CWE A;  3GZ6 A;  3P9K A;  4Y17 A;  5FB2 A;  1YYV A;  2MD5 A;  4M74 A;  2VBZ A;  1HW1 A;  1MZB A;  1Z05 A;  2F5E A;  4LK0 F;  2A6E F;  3V7S A;  4LB5 A;  2LSO A;  5DCF A;  1Z9C A;  4RGU A;  3WTU C;  3LAP A;  3I54 A;  4GYG A;  2BGC A;  2HFH A;  4I09 A;  5KK1 A;  5CLS A;  1AWC A;  2XAH A;  2ACJ A;  1U5T A;  3HHG A;  1BC8 C;  4B09 A;  1XD7 A;  2OAZ A;  1HKQ A;  4EJO A;  1OYI A;  1WQ2 A;  3F8C A;  2P5L C;  1B9N A;  3R6S A;  3O3K A;  2BYV E;  1BC7 C;  2IPQ X;  1YW7 A;  5LGN A;  2EV0 A;  3PFI A;  4MNU A;  1ZG1 A;  3JAM K;  4ZZD A;  1FYK A;  4U7D A;  3J80 K;  1TQM A;  5L3C A;  3L2C A;  1HBX G;  3DPL C;  2WV0 A;  1FY7 A;  4XLN F;  2GA2 A;  2XIG A;  1J75 A;  4UV8 A;  1KA8 A;  1IN7 A;  3I59 A;  4OMZ A;  1IXR C;  3J7A O;  3QP5 A;  1XCV A;  5K1Y A;  3BOQ A;  2Z9O A;  2CSO A;  1P4A A;  3N4M A;  3DFG A;  5EEH A;  3MZH A;  2J5O A;  3KP5 A;  1O7F A;  4Q5S F;  1MDM B;  4L5I A;  5FFZ A;  5CVR A;  1TBX A;  5E18 F;  4QWQ A;  4U0W A;  1XDS A;  3L00 A;  3E5X A;  3RPQ A;  4ASN A;  4U0V A;  1ZRF A;  5FGM A;  2FRH A;  3V8L A;  1IN6 A;  3IWF A;  1YFH A;  3EYI A;  4ESF A;  3WOD F;  3BJA A;  5CVJ A;  2HGC A;  1REP C;  3F8N A;  2ZXJ A;  2DI3 A;  2P5K A;  3HRS A;  3WG9 A;  1SAX A;  1FWZ A;  3KET A;  5L3G A;  3KEQ A;  2RV8 A;  2DW4 A;  4ETS A;  4MTD A;  1ZG5 A;  1SMT A;  1F1Z A;  2DBB A;  4HZF A;  4I0B A;  4OU0 A;  4HX7 A;  2DPU A;  4KIG A;  4DNC A;  1I1G A;  4N9H A;  1T38 A;  2HZT A;  1RNL A;  1R36 A;  4YII A;  3F8F A;  1Z6R A;  2H09 A;  5L3B A;  2IA1 A;  5E1Z B;  4IRG A;  1V4R A;  2FNA A;  4BH9 A;  1R7J A;  1MJA A;  3HIF A;  3GYH X;  1ODD A;  4KIB A;  4PZJ A;  1UHM A;  4EM0 B;  3BPV A;  1TTY A;  2VE8 A;  2Z99 A;  1YO5 C;  1OMI A;  1BJA A;  1TW3 A;  4TV7 A;  3GUD A;  4O5V A;  1FSE A;  1HW2 A;  1CGP A;  4A0X A;  4HF2 A;  1RI7 A;  3IKV A;  5ICF A;  5J8F A;  4PGG A;  4HV5 A;  5H6R A;  4EGZ A;  1XN7 A;  1R00 A;  1B6A A;  2ZME A;  3I64 A;  3NEU A;  1ONV A;  2BBY A;  3BDD A;  3REO A;  2K02 A;  2STW A;  2HS5 A;  3ZP5 A;  4UV9 A;  2CQK A;  4ESJ A;  3IC7 A;  4OIO F;  2QEN A;  3RTR A;  4HDU A;  3R60 A;  1KU7 A;  2DK8 A;  4EVI A;  4RB2 C;  1P6R A;  2DFI A;  3G73 A;  5BMZ A;  2ETH A;  3U1D A;  1FP1 D;  1LVA A;  1IRG A;  3W6J B;  2PI0 A;  3B02 A;  2O61 A;  4EGY A;  3EET A;  3FMQ A;  5DCM B;  3T0Y A;  1I1S A;  3EDP A;  2QLZ A;  1KQ8 A;  3SHF A;  3GO5 A;  2P7V B;  5LRR A;  2XAF A;  2FU4 A;  1D3Y A;  1JHF A;  2Z5U A;  1TQP A;  2LNB A;  1S3J A;  2Y48 A;  4Q47 A;  2ZJ2 A;  4LD5 A;  1RUO A;  3LAJ A;  2IJL A;  4AD9 A;  5D5V B;  1R23 A;  4CO8 A;  1MGT A;  4HQE A;  2RNJ A;  3ZMU A;  2CYY A;  4RB0 A;  5IT9 K;  1IZ1 A;  4KMU X;  5DCM A;  5DUI A;  4P9F A;  3FF5 A;  2VE9 A;  3WTS C;  4A5N A;  1F9N A;  4KN7 X;  2PQ8 A;  2RGV A;  3BRO A;  4QLC U;  1EH8 A;  1SFE A;  1EH6 A;  2COM A;  5AIQ A;  4A6D A;  4L9T A;  2PEX A;  2ISZ A;  1IXS B;  3KLN A;  4ZYD A;  1K6O A;  3Q9S A;  4I02 A;  1ZN2 A;  1FLI A;  3JSP A;  2D1H A;  4NB5 A;  5D4R A;  3C3W A;  3PQJ A;  3QPH A;  3R61 A;  1SFU A;  4XBF A;  4FX0 A;  4CYD A;  4Z2Y A;  3F72 A;  2HKX A;  1I5Z A;  2CGP A;  1MJ9 A;  4HV6 A;  3E5Q A;  2PFB A;  3HYI A;  2A07 F;  1X3U A;  2VBY A;  1VTN C;  5FLX K;  3M7G A;  2GAU A;  4EMS A;  3I0T A;  1J2X A;  2IA2 A;  1O3S A;  5K5R A;  1YLF A;  1S29 A;  3WU0 A;  1AOY A;  2P4W A;  4ZZL A;  5A2Q K;  2GIV A;  1KQ0 A;  3V8K A;  4NHJ A;  4PCQ A;  3F3X A;  1ZRE A;  1Y0U A;  2XHK A;  3WTY C;  1QO0 D;  1XGN A;  1T98 A;  2DAO A;  4BNC A;  4YFX F;  3K1P A;  2M8E A;  3K1N A;  2O3F A;  2QQ9 A;  3Q5F A;  2KJC A;  2QQA A;  4CXF A;  3SXY A;  4M6X A;  5BS6 A;  1R1U A;  2NNY A;  1YS6 A;  2JRT A;  4BHB A;  2RKH A;  3KP6 A;  1KYW A;  4AWX B;  3BZ6 A;  3GEZ A;  4LLG F;  3IHU A;  1Z7U A;  4UVB A;  3KP2 A;  1O3Q A;  1L0O C;  4ZYH A;  4AIJ A;  1PP8 F;  1LB2 A;  3QU3 A;  3M8F A;  2Q2E A;  2UXN A;  2DT5 A;  1G3W A;  3ULQ B;  2UWM A;  3RDI A;  3GW2 A;  1HW5 A;  1YW9 A;  5ICE A;  1S7O A; 
#chains in the Genus database with same CATH topology
 4IPA A;  5HLH A;  2R7W A;  4A12 A;  3T8T A;  5B3S H;  2KKO A;  1ZRD A;  5IYB J;  2ZXH A;  3GFM A;  4BQO A;  2M1B A;  1NK2 P;  3KFW X;  1GDT A;  1XGO A;  2LKP A;  3BT9 A;  3K70 C;  2M0C A;  4AC0 A;  4FTH A;  3IAS 2;  4IX7 A;  4XLE A;  5F1R A;  3OL4 A;  5AIP A;  3ZOB A;  5LRS A;  1WJA A;  5F0F A;  1ZGA A;  2D2W A;  2K4J A;  3GTJ J;  5J47 A;  2JSC A;  2X6W A;  5C3E J;  2XAU A;  1IF1 A;  3C7J A;  2LBF A;  4BKX A;  4BAY A;  2V1N A;  3TP3 A;  1Y8R B;  4BYY A;  4OIN F;  3DKW A;  5D6E A;  4CIC A;  4O3M A;  4GCV A;  1XMK A;  2DT7 B;  4N4O B;  1Q1H A;  2F5V A;  2QVO A;  2XGX A;  3KYD B;  4RGR A;  1K4S A;  1LEB A;  4MIM A;  1G6N A;  3BPX A;  4CZC A;  2EV6 A;  3IRQ A;  3BZK A;  2EZH A;  2XRN A;  3F6V A;  3BC8 A;  3MKY B;  1HXD A;  4HX8 A;  1SVL A;  1WHU A;  4CYC A;  4M9Z A;  3A0B C;  3CDL A;  5EF6 A;  2NS0 A;  3DXJ F;  3SZG A;  2MC3 A;  1RC9 A;  3GBG A;  3FBI B;  3QYB A;  1YI2 I;  1NG7 A;  4XLF A;  3JTH A;  3NWT A;  2WAE A;  2LYC A;  4I01 A;  2AXT C;  5ERI A;  1YE9 A;  3EUA A;  3CCE I;  1PVE A;  3HUG A;  3MCZ A;  3CF2 A;  2RQQ A;  4YIF A;  2W25 A;  4U87 A;  2EFO A;  2ZBK A;  4F7Z A;  2R7S A;  4WX9 A;  1MKM A;  1TNT A;  4LJZ F;  2HDC A;  3QYF A;  5FFX A;  2PX9 A;  4H0E A;  1RIO H;  2PMZ N;  3S2H J;  4BQQ A;  2FML A;  2V9V A;  2EWN A;  2LD5 A;  2W24 A;  2B9S A;  2DOD A;  2HYG D;  3RCO A;  3U21 A;  2BHZ A;  3WU1 B;  4ENM A;  1R22 A;  1S6L A;  4A6E A;  2HOE A;  2QQ8 A;  3TGN A;  1DUX C;  2E35 A;  1IW7 F;  3OYM A;  1IXC A;  3DPT A;  5FRM A;  4N4N B;  2IGO A;  2JJ7 A;  2KIM A;  3RJP A;  1ZAO A;  3IH2 A;  3F6O A;  5B5E C;  3I71 A;  3A4C A;  3K2A A;  2XUB A;  1R4N B;  2BY2 A;  1E2X A;  3KP3 A;  3HSF A;  2E36 A;  2DFE A;  2XKO A;  3F0C A;  2EB7 A;  2XPU A;  1K83 J;  4MQV A;  2A6T A;  1S72 I;  4IEJ A;  5FD5 A;  3JAM Z;  2M4G A;  4KIF A;  4A3K J;  1GV2 A;  4IVN A;  1ZYR F;  4XKC A;  1IUF A;  1ACI A;  2MLG A;  4WCG A;  4P96 A;  3FMS A;  3K4J A;  2CQ7 A;  3I4P A;  5D8K B;  2K7L A;  1QQI A;  1TC3 C;  3RYR A;  1IRX A;  2VUM J;  3KZZ A;  2PBI A;  2WBM A;  1P4W A;  1NTC A;  5DM6 F;  5C4X J;  5E1W A;  2K4B A;  1FYM A;  4XOT A;  2QBY B;  1WZ2 A;  4PUS A;  3GME A;  2KPM A;  1X4O A;  3WTX C;  4IHY A;  1OYY A;  4U7B A;  1V54 H;  2COB A;  4L0Z B;  3O2P E;  2DA5 A;  4M3G A;  1LDD A;  1XTA A;  4PK4 A;  6PAX A;  3WTW C;  3KIO A;  2P81 A;  2BXY A;  3WHB A;  4C2T A;  4RB3 C;  1Z1D A;  4GGG A;  2LY9 A;  3ASO H;  1Y39 A;  3SJM A;  2JVH A;  2R5Z A;  2KDO A;  3OOP A;  4ZH4 F;  4GXO A;  4PGH A;  3E5U A;  4AVP A;  2G7H A;  3MFK A;  2LF8 A;  1JJ8 C;  4QTR A;  2BW3 A;  3RZO J;  4CZZ A;  1VQK I;  2O8X A;  2LC2 A;  2GXG A;  4HST A;  3BLY A;  1JHH A;  3RIR A;  2IGM A;  2MG4 A;  5E20 A;  3OYJ A;  2GLO A;  2XVC A;  1MMS A;  3HOX J;  4FHT A;  4LG3 A;  2EIJ H;  3OYL A;  1K6Y A;  1WJE A;  3L2U A;  1R4M B;  2EIN H;  5D6F A;  4WK8 F;  3JW4 A;  4Y13 A;  2PJR B;  1FBU A;  3Q0U A;  4G94 A;  4JOM A;  4WXC A;  4J19 A;  3K4L A;  4YEL A;  3X2Q H;  5J1Y A;  1S8N A;  1G59 A;  2FF4 A;  4ZYG A;  2KJB A;  4I99 C;  1ZQ3 P;  1FP2 A;  1T56 A;  1WJD A;  3GF2 A;  1D8J A;  3TDU C;  1SFK A;  1ZGJ A;  5FKM A;  3JCU C;  5HOO A;  4A3M J;  2J5P A;  4AIH A;  4D9J A;  1VQO I;  2OZ6 A;  4P55 A;  1MDM A;  2W7N A;  2GQQ A;  3OIP A;  4NC8 A;  5DV5 A;  2I5U A;  3S17 J;  1QVT A;  4MGR A;  4M73 A;  4XLC A;  2XAQ A;  3BTL A;  2HEO A;  1YJN I;  2GIZ A;  3QPT A;  1EV7 A;  2BY0 A;  1S9H A;  3L09 A;  2DTR A;  2EBI A;  2D45 A;  3H0G J;  3N05 A;  2XAG A;  3V4G A;  5LHH A;  2NXN B;  2H8W A;  3ELK A;  1EA3 A;  2LVS A;  1X1A A;  1I3A A;  1BIA A;  2CO5 A;  2EZI A;  5L3D A;  1ZG3 A;  2YS9 A;  2R7Q A;  1HDD C;  2PJR A;  3E6C C;  5LHG A;  1Z77 A;  1SD7 A;  1U6G A;  2EFQ A;  4KIT B;  4D1Q A;  5F0H A;  4BL0 B;  3D1N I;  3ZPL A;  2O7O A;  1G4D A;  4MLO A;  5K5Q A;  2IS6 A;  1D1B A;  1K78 B;  2ZXW H;  3S1M J;  2O5R A;  2GWR A;  4C30 A;  2CH0 A;  4FT8 A;  3L2W A;  1SEU A;  2VPR A;  4Z6Y A;  4RLF A;  3TQN A;  4UHT A;  1T0F A;  4Q48 A;  3D5L A;  1RPW A;  2QYO A;  3TW7 A;  4E7J A;  1Q1V A;  4BBS J;  5TJJ A;  5F6F A;  2L0K A;  1KU2 A;  3MVP A;  1PUF A;  4L9N A;  1GXQ A;  2VKD A;  1OLT A;  1MNM C;  1T39 A;  4EJV A;  4GRI A;  2L2O A;  4UNO A;  4A2U A;  3W3C A;  3LFK A;  2OZU A;  1B4A A;  2EQR A;  4LIT A;  1ZH5 A;  3VWB A;  2CW8 A;  2OC6 A;  3E6B A;  3UNG C;  2O6G E;  4XLA A;  2IVM A;  2VC1 A;  1ZAR A;  3BR1 A;  3P9C A;  1W5T A;  4RS8 A;  4E4H A;  3JSO A;  2AXL A;  4P9U A;  1T6S A;  3T1B A;  4MHG A;  5EGO B;  3E0J B;  2O9L A;  3I58 A;  3H3V K;  4RB1 A;  3C2G A;  4X1E A;  2ELH A;  1XB4 A;  2ZNY A;  2DU9 A;  3PUB A;  4HOB A;  3NQO A;  2KDZ A;  4HF1 A;  2AHQ A;  2QF7 A;  2FNP A;  1IDY A;  2ME0 A;  3CUQ B;  3LFU A;  2A5Y B;  3I53 A;  3RKY A;  2VL8 A;  4IF4 A;  3BQY A;  4MTE A;  2LK2 A;  3K0L A;  5DUK A;  3DCF A;  1STZ A;  1D5V A;  4YRV A;  3DEU A;  1W7P B;  1LPQ A;  5LBQ A;  2HOT A;  2EV5 A;  2HQR A;  3G1O A;  2LKS A;  1DQU A;  3S1R J;  3E6D A;  4R79 A;  4JX6 A;  4R8H A;  2ESH A;  3BJO A;  5HDK A;  4IRI A;  3GFJ A;  1VQM I;  4QPQ A;  3HDD A;  3ABM H;  1K7A A;  4CCO A;  1BOA A;  1R58 A;  4M71 A;  1SC7 A;  3BG7 A;  1ON1 A;  4UUS A;  5IP7 J;  2E5N A;  5HLT A;  2RC4 A;  3ZCO A;  3SQN A;  1QBJ A;  2VOP A;  4XOR A;  2EFW A;  5EGO A;  2IXS A;  3AKZ A;  3G6E I;  4XLP F;  1LE8 B;  2ZNZ A;  4P1W A;  5IYD J;  4I0A A;  2YX7 A;  3FXK A;  2HOA A;  3CCS I;  1YG2 A;  2QCO A;  3IL2 A;  2EK5 A;  1D1C A;  2Y30 A;  5FLM J;  3CUQ A;  1UJ8 A;  5LHI A;  3PM1 A;  4UVC A;  1GLN A;  2FOK A;  2DMN A;  3RPU A;  2W84 A;  4HYE A;  1RR7 A;  3K2Z A;  5E1X A;  1EJ9 A;  4L18 B;  1Z3Y A;  2MH2 A;  3ECO A;  3LOC A;  2DA6 A;  1AA7 A;  1FIP A;  2K9L A;  5GPC A;  1HKT A;  3AAF A;  5EDN A;  2E1C A;  1HSJ A;  1U5T C;  4G6T B;  2VOO A;  4LK1 F;  1E0E A;  2YU3 A;  5JHU A;  1BOB A;  3KP4 A;  2QEX I;  3W2V A;  5JFR A;  1XSX A;  1LVK A;  3OR1 C;  5FO5 A;  3V42 A;  3JRI A;  2P6T A;  2DN0 A;  2K3P A;  5M5X J;  2IA0 A;  2JA5 J;  2VT2 A;  3IP4 B;  4GFB A;  2WA0 A;  3JRE A;  2ME6 A;  3FXR A;  1LDK B;  5EEA A;  2ZO4 A;  3WTT C;  4EQQ A;  5LGT A;  2KT0 A;  2BV6 A;  1EF4 A;  3HOT A;  3FXO A;  1BI0 A;  4IZZ A;  1U3E M;  4G7Z F;  1USS A;  2VAS A;  4WXD A;  2NS8 A;  1B8I B;  2M4K A;  4BE1 A;  1H8A C;  3BG5 A;  3WGH A;  1MBK A;  3DTE A;  1WJF A;  2V1D A;  4IXA A;  4XL9 A;  3HRM A;  2LY2 A;  3RSN A;  3V7C A;  2E5Z A;  3TW6 A;  2VT3 A;  2HXO A;  4EJT A;  2DOF A;  1WH7 A;  1QZY A;  2FQ3 A;  2WB1 A;  1SD6 A;  4ENN A;  1YX3 A;  3RQ4 A;  2DO7 A;  5EEG A;  2RRE A;  2E34 A;  3ABU A;  3E7L A;  4L5E A;  1SMY F;  3IKT A;  1SAU A;  2ZCW A;  3FIS A;  3FXQ A;  2F4M B;  2ZFU A;  3PQK A;  4PFP A;  4Y7N J;  4IHX A;  1LFU P;  2VON A;  3DBH B;  1FTZ A;  4Y4R A;  3ZMT A;  2H1K A;  3JTG A;  2IT0 A;  1FBQ A;  2EZK A;  2Z3Y A;  3TO9 A;  2PJP A;  2VOD A;  3M4O J;  9ANT A;  3JRC A;  3TKY A;  3LA2 A;  3LSH A;  2ZKZ A;  1MND A;  4OAZ A;  1P2F A;  3VFZ A;  1BI2 A;  2JPC A;  4AIK A;  3CQZ J;  1G2H A;  2HKO A;  1UEL B;  1B72 B;  3HPG A;  3SZT A;  3TMO A;  3DV8 A;  3HGY A;  2M0M A;  2OPT A;  1RUN A;  3KCC A;  4AUX A;  1I3Q J;  2VXZ A;  1T2K A;  3F23 A;  1GV5 A;  4JP0 A;  1X1C A;  4N0B A;  3K4K A;  3UR3 C;  1E17 A;  4JBA A;  4XON A;  4S0H B;  5E8I A;  4L9V A;  2A6H F;  4MO7 A;  3AL0 C;  5M5Y J;  2NOG A;  2HDW A;  3K4M A;  3SFZ A;  3GWZ A;  3W2W A;  2Y31 A;  3AG1 H;  4KIS A;  4JQF A;  4ZDO A;  2A69 F;  1UAA A;  3R0A A;  3BTJ A;  2JZY A;  3TOA A;  2XRO A;  4FQG A;  3F22 A;  3PO2 J;  3GFL A;  2EZL A;  2MH9 A;  1CQT A;  3HOU J;  1D0Y A;  5H2F C;  3HRU A;  3C2B A;  1BR2 A;  2A5W A;  1OPC A;  4PJN A;  5JLX A;  2XGC A;  5EG0 B;  5TIS C;  2EFP A;  5KVR A;  2R7D A;  1UHW A;  1VF9 A;  1VFC A;  3S14 J;  2MSY A;  3IH3 A;  4LGW A;  1FYL A;  4BHC A;  2WWY A;  1B72 A;  1YOV B;  4C2M J;  3G2B A;  1A35 A;  4BJ5 C;  1WFX A;  3S3N A;  2DMP A;  4U88 A;  1OCZ H;  1XS9 A;  5K5O A;  1SFX A;  2AS5 F;  5TGT A;  2WAF A;  5FRN A;  4LFU A;  3FBN B;  3A01 B;  1WRJ A;  3HM5 A;  4XKV A;  4ENK A;  3QYE A;  2QUF A;  4PFO A;  3ZR8 X;  1YIT I;  5F08 A;  1W1W E;  2H1L A;  4PJL A;  4IHT A;  1NHA A;  2HQN A;  2H94 A;  4RAF A;  2BOL A;  4E7S A;  3CUO A;  3K69 A;  4M6Y A;  3G4S I;  1K79 A;  4L0Y B;  5K7F A;  2HYJ A;  2C6Y A;  5JLW A;  2G7U A;  3Q0V A;  2CUE A;  3GCM A;  3A0H C;  1DPR A;  3FM5 A;  4Y33 A;  5J8C A;  2VBX A;  3OYK A;  1Y0N A;  1R5I D;  3S2D J;  1BBY A;  4EM2 A;  4E7H A;  3PIO F;  1MBE A;  1E3O C;  3N97 A;  2JPB A;  5CQG A;  4BQN A;  1BL0 A;  1ZLK A;  3H5R A;  2QGU A;  3ZRG A;  1K61 A;  1GVJ A;  1T0F C;  2OA4 A;  4S05 A;  3HOS A;  3GTL J;  4IJA A;  3BJ6 A;  3R4K A;  1CF7 B;  3CP2 A;  4AVZ A;  2IP2 A;  1W7P D;  1G3S A;  2NVY J;  3WU2 C;  4NQW B;  2E71 A;  1FNN A;  4A3C J;  2K86 A;  1P92 A;  2NVQ J;  2DPD A;  1PUE E;  4A3B J;  2HTJ A;  1QHG A;  2A3S A;  1J0R A;  1RZ4 A;  1L3L A;  3CCV I;  1DDN A;  5H6Q A;  1W36 C;  3FK7 A;  1AKH B;  3NRV A;  3BR3 A;  2VKH A;  2CW0 F;  3CDH A;  1SD5 A;  1U2W A;  4YFN F;  5HNF A;  2V1U A;  2HWV A;  2VN2 A;  2P7C B;  2CFO A;  2JT1 A;  2Y2Z A;  3P5J A;  4JK1 X;  4OIR F;  3COA C;  4MEY F;  2FBH A;  1XGM A;  1UB9 A;  2OJE D;  1S5L C;  4GO1 A;  1JKP C;  2MBF A;  2OQR A;  5J3L A;  1YS7 A;  2KIQ A;  1T95 A;  4K2E A;  2HPI A;  2GXA A;  3K7A J;  3BWG A;  1HST A;  3PUF A;  3HL2 A;  2M34 A;  4RGX A;  1XDU A;  1P7J A;  3GLL A;  3CP8 A;  2KLO A;  1QPM A;  1DPU A;  4ZC3 A;  2ZJQ F;  1CF7 A;  1FMW A;  2L5Q A;  2CUF A;  1ZRC A;  3CJN A;  5FKN A;  5DEQ A;  2DFF A;  2STT A;  3F9K A;  5HVQ C;  1IG7 A;  2MA3 A;  2F5C A;  2LY1 A;  4W97 A;  3H92 A;  2IS2 A;  5M3M J;  1FSH A;  1WWX A;  3M3Y J;  3M9A A;  3G3Z A;  2M30 A;  4HSR A;  1MBH A;  2HZD A;  2OD5 A;  3QP6 A;  1YIO A;  4I6Z A;  3J81 Z;  1U9N A;  1X1D A;  2FUG 2;  3VOE A;  1T33 A;  3KE2 A;  1R5G A;  5ILV A;  2G0E A;  5BNG A;  2X48 A;  1ZGW A;  3DBR B;  3CUQ C;  2G9W A;  1YRN B;  4G6Q A;  4BUP A;  3LQR A;  3HOY J;  2DA7 A;  4I98 B;  1GVD A;  3TO7 A;  4EJW A;  3TO6 A;  2EIK H;  2KFD A;  5KCM A;  3MKZ A;  3A03 A;  4RBO A;  2D1V A;  2L7Z A;  2O0Y A;  1IGN A;  3RYP A;  3HHH A;  2QSG X;  2M5W A;  3QPS A;  3D5S C;  1QZZ A;  2DXI A;  3VEP A;  3ZMS A;  3F8M A;  3IWZ A;  2YSR A;  5LGU A;  4ZYE A;  3JRA A;  1YTY A;  3CES A;  3VYR B;  1MMN A;  4BBR J;  2OF7 A;  2X51 A;  3MQ0 A;  1MBF A;  1XCB A;  3WGG A;  2DLL A;  3GTP J;  4FE7 A;  1OQY A;  2GXB A;  5F64 A;  5HLG A;  3EYY A;  1VQ4 I;  2ICW G;  1KYZ A;  4LLL A;  2HQA A;  3LQQ A;  3B73 A;  1U0J A;  3E6M A;  3I4N J;  3E3V A;  1ENH A;  1BI3 A;  4E7L A;  2XF7 A;  1U9O A;  5EZG A;  3FHZ A;  3ERE D;  5L3E A;  4KDP A;  2X0L A;  3QU6 A;  5DYM A;  1W5S A;  2DOA A;  3OYH A;  3CZ6 A;  3DU5 A;  3ML6 A;  2FA5 A;  1ZEL A;  5KHD A;  2Y75 A;  1QU3 A;  1I6X A;  2Y0M A;  1DGR M;  3RI4 A;  1JXS A;  2R92 J;  1TW2 A;  1VZ0 A;  5FJ8 J;  1G3T A;  3PL8 A;  2E7W A;  2DA1 A;  1BJZ A;  4EM1 A;  4G7H F;  5EJC A;  2R7V A;  5KNL A;  1W4M A;  2XRL A;  2QKL B;  4WXH A;  5CVV A;  3ZMV A;  4ZTJ A;  1ZLJ A;  3GZ5 A;  5CQE A;  4G12 A;  3WE3 A;  5GPA A;  1H89 C;  1KU3 A;  5CPR B;  2K40 A;  4OIP F;  3LSM A;  4HRI A;  3KYL A;  1OR7 A;  3DP7 A;  5ED4 A;  2L9R A;  4ITV A;  1XSD A;  3ZQQ A;  4KN4 X;  3KPH A;  3F21 A;  2VJ4 A;  1U8B A;  5HS7 A;  3I59 B;  3OYA A;  3J80 Z;  3DU6 A;  4KT6 A;  4EJU A;  5DS9 A;  4JYK A;  2E1M C;  3CCL I;  3TOB A;  1MSF C;  1TNS A;  3MWM A;  4M9S A;  3HBL A;  4OIQ F;  4R1H A;  3HG9 A;  1U8R A;  1UCR A;  5D5U B;  2KIF A;  3HSE A;  4YEJ A;  3JRH A;  2RQP A;  4A3L J;  4OAY A;  2F4O B;  1XMA A;  4A5M A;  3OYC A;  1TWH J;  3HKZ A;  4IHV A;  2VPL A;  5F27 A;  5IOY A;  3V8J A;  3DF8 A;  3R0J A;  3PNT A;  4LMY A;  1N75 A;  3KLO A;  5IP6 A;  4BE0 A;  2GOX B;  1RRJ A;  4CCM A;  2R7F A;  3FK6 A;  3FZV A;  1XGS A;  1IUY A;  4OOI A;  5C4J J;  5HDN A;  2Q0O A;  4AID A;  1X2N A;  4GYI A;  3I9V 2;  3BR0 A;  4HA8 A;  3S2W A;  1FOK A;  4MEX F;  2QM3 A;  1MW7 A;  2X6O A;  4OMY A;  1V55 H;  4YG2 F;  3SZP A;  5C44 J;  4CHU A;  1SVO A;  4XK4 A;  5BPI A;  3LWF A;  1Y56 A;  4KJZ A;  3DPU A;  1J5Y A;  5JR3 A;  3L1P A;  1UG0 A;  3VYU B;  1MJB A;  3FX3 A;  1BI1 A;  2QBY A;  2L7M P;  3B6C A;  3CCR I;  5J1U A;  4JX4 A;  2KRC A;  5K7Z A;  2RAE A;  2V6C A;  1OCC H;  3ABT A;  3MEX A;  1IN5 A;  3U2R A;  3I4M J;  4HAM A;  4ZDP A;  2M3A A;  4M9X A;  3HRT A;  2R0Q C;  1BIB A;  1UG2 A;  2VQL A;  4G8X A;  4BAC A;  3HOZ J;  2NYX A;  3KEO A;  3W2A A;  4MFE A;  2CU7 A;  2KIU A;  1DP7 P;  2DDA A;  4DBR A;  3ZMZ A;  1VQN I;  5DD8 A;  2EIL H;  5DM7 F;  2VKV A;  3FMR A;  4N9I A;  4I76 A;  1KZH A;  2M2E A;  2OBP A;  3K6G A;  4G9Y A;  3BCB A;  1B59 A;  4LB6 B;  2XPW A;  2JA2 A;  1WJB A;  2UZK A;  1HCR A;  3CD6 I;  3C2H A;  1T8I A;  1VQP I;  3K4C A;  1Z3X A;  2F5D A;  4B44 A;  2BVM A;  3MAJ A;  3P9I A;  4PJM A;  1BW5 A;  2E7X A;  2LF7 A;  4M3E A;  1ETY A;  2ZSH B;  1YIJ I;  1C0W A;  1WH5 A;  3OS1 A;  1HKS A;  3K1M A;  2GZW A;  3BY6 A;  1VQ7 I;  2E60 A;  3LL7 A;  3PIP F;  2KIS A;  5FLV A;  5E79 C;  2MGQ A;  1O7L A;  4BDY A;  5E8G A;  1F36 A;  1B9M A;  1R5H A;  4NBQ A;  5JVG F;  1IRF A;  3P7N A;  3FM3 A;  5LLQ A;  2DYS H;  4KMF A;  2L4M A;  1OCR H;  1I27 A;  1KON A;  5CVI A;  5EYR A;  1MMA A;  4I2O A;  2K27 A;  4MQ9 F;  4RGS A;  3Q0W A;  2H6B A;  5FD6 A;  1TWA J;  3OOU A;  2P6S A;  3BTC A;  1D8K A;  3CC7 I;  2ZME B;  4C2U A;  2IBD A;  1P9Q C;  4XSX F;  2LR8 A;  4ANJ A;  5D5W B;  1S7A A;  1UST A;  2JN6 A;  4RAZ A;  3HTS B;  3QQA A;  2KZG A;  2CQQ A;  3VOD A;  2AO9 A;  1OJL A;  1KQ9 A;  1XSV A;  2DTZ A;  5D4S A;  1A6I A;  5HDG A;  3G1M A;  2DA3 A;  3SFI A;  1G3Y A;  3G1L A;  5DDG A;  3D5R C;  2CV0 A;  2H6C A;  2CQX A;  1H9G A;  1R49 A;  1IDZ A;  1O4X A;  1K78 A;  4UVA A;  2E2I J;  1LEA A;  5CKT A;  2DK5 A;  3CTA A;  5JVT A;  1PDN C;  5IY5 H;  3BP8 A;  2HTS A;  2MLK A;  4IHW A;  2LMD A;  4FET A;  3LSP A;  2VJJ A;  4BQA A;  2ADU A;  2M87 A;  4FX4 A;  1W5C C;  2YPR A;  3A2K A;  3ZN0 A;  2Y69 H;  3V7R A;  4KUM A;  2LH9 A;  2IGK A;  1IC8 A;  1YQA A;  2ZSI B;  1X58 A;  5FKL A;  2EA2 A;  2DFH A;  2UXX A;  4NDL A;  2ZB9 A;  1QNT A;  2V9P A;  4KIC A;  2M45 A;  2BY3 A;  2VKE A;  2HVQ A;  3H0D A;  1Z91 A;  1PP7 U;  2WTE A;  3H9G A;  3GZN B;  4BXX J;  2XKP A;  1HQC A;  1ZHF A;  3M8E A;  4XIC A;  1BW6 A;  5FKO A;  2NNN A;  3HC7 A;  4D0P A;  2W4S A;  1SAN A;  2LRE A;  4HLY A;  2PMZ A;  4CGZ A;  5J6X A;  2L3D A;  3G71 I;  1PYV A;  3BG3 A;  5LEK A;  2VXD A;  3M1E A;  2FMY A;  1JUS A;  1RR8 C;  2L54 A;  3SDG A;  1RET A;  1J7K A;  5TRD A;  1KU9 A;  3CLQ A;  4AYB N;  1POG A;  1W7P A;  3H3Z A;  4DQ2 A;  1A31 A;  1HF0 A;  4A0Y A;  4B43 A;  3TBI A;  2KRH A;  2XDV A;  1YHQ I;  1B1B A;  2K5C A;  3GVA A;  4I7H A;  2DJN A;  4IOC F;  3ABK H;  3MMY B;  4V2G A;  4BGD A;  5E17 F;  2R3S A;  4XMY A;  2IW5 A;  1VI0 A;  4BHP A;  2DDB A;  3VB2 A;  2HR3 A;  2XF6 A;  3BTI A;  3L2Q A;  2EA4 A;  2KQR A;  3WTV C;  1TT0 A;  1D0Z A;  1IV8 A;  2E1N A;  1QHH D;  2YUS A;  2FX0 A;  4ESB A;  3LSK A;  1JGS A;  1AU7 A;  2X4H A;  2XV4 S;  4QPO A;  4UUV A;  1RKW A;  2H27 A;  2XSD C;  4IHS A;  4QSH A;  1OR7 C;  4E70 A;  4HF0 A;  3EQL F;  3ZN1 A;  4B8X A;  2XAJ A;  2VQG A;  4HW0 A;  1FX7 A;  5H20 A;  1SVM A;  4HQM A;  2ISY A;  3K10 A;  1LE8 A;  1APL C;  3IV5 A;  1XPX A;  5AON A;  1OCT C;  2O03 A;  3K9T A;  3F8B A;  3CDI A;  4B48 A;  2F5F A;  5BQT A;  2JA8 J;  5DD4 A;  2OTL I;  1IN4 A;  4PJJ A;  1LQ1 A;  2XAS A;  1QPI A;  1LDJ A;  4RAY A;  2VBW A;  5IT9 Z;  1MH4 A;  2FBI A;  4OWR B;  3RKW A;  2AQF A;  4EV0 A;  1LJ9 A;  4X0G A;  2KRF A;  4E7Z A;  1GHC A;  5LFA A;  3BG6 A;  1HDP A;  3TDZ C;  2YR2 A;  4PDK A;  3OSG A;  5GAG J;  2Q8K A;  1HA8 A;  3BR6 A;  2YX4 A;  2L7K A;  3IRR A;  3LNQ A;  4KNY A;  4C3I J;  3C1D A;  4BJT A;  3H9J A;  3Q9V A;  3GTO J;  4XRF A;  2NVU B;  1UZC A;  5KAI C;  3O6B B;  3W6K B;  2E1O A;  4DW6 A;  2XC7 A;  3A02 A;  3LA7 A;  4NC6 A;  1XMX A;  4KA4 A;  1B8I A;  1O3T A;  3HTU A;  3SDB A;  5LEJ A;  1MBG A;  3W6V A;  4IQJ A;  3H1C A;  4WF2 A;  5D5X B;  2JK3 A;  4HBL A;  3HSR A;  3CO6 C;  1YW8 A;  2HYF A;  2M7B A;  3H35 A;  4YIR X;  4A3I J;  4D7N A;  3PNY A;  2M8G X;  4XNF A;  3TP0 A;  1ETO A;  1SD4 A;  2A61 A;  4A3G J;  1U78 A;  3TL4 X;  2HI3 A;  1OCO H;  1FC3 A;  2R5Y B;  2PMH A;  2NRA C;  3M07 A;  3JRG A;  4P5O A;  3FKJ A;  2JSP A;  2F2E A;  5ILS A;  3ZQF A;  2IS1 A;  2VJ5 A;  4A69 C;  5ICG A;  4Q4Z F;  3OYG A;  1MSE C;  2RN7 A;  2R7T A;  1YX5 A;  2WV1 A;  4G7O F;  1EH7 A;  2PMU A;  2ID3 A;  4A3F J;  2KP6 A;  1JE8 A;  2DMQ A;  5KAF C;  5J40 A;  1GXP A;  1M1E B;  3LST A;  4DYR A;  5J4Y A;  5JI6 A;  3M8J A;  5FLX Z;  1O3R A;  3ISP A;  1FPQ A;  2JQ7 A;  1ITY A;  4ZYA A;  3E97 A;  2BE5 F;  1JUP A;  2ZFW A;  3CCY A;  5B66 C;  1P4X A;  4FAS D;  3ROU A;  4CDG A;  5DTD A;  1H9T A;  2PG4 A;  2F4I A;  4LIV A;  4IOA F;  2KMU A;  5ICC A;  4KYW A;  2K9M A;  2L01 A;  4XRS G;  4HDV A;  5E3N A;  4JX5 A;  3T8R A;  3KP7 A;  4L5J A;  2PLY A;  2BEO A;  4KFC A;  4XM3 A;  3RKX A;  5A2Q Z;  3I5U A;  3PJR A;  1QGP A;  3MZY A;  5CYV A;  3WE2 A;  1LNW A;  1LFP A;  3HKZ N;  1IAW A;  4M72 A;  2K9Q A;  3BQZ A;  1Z6T A;  2CV2 A;  3CJR B;  2Q1Z B;  1YJW I;  2BHY A;  5F0C A;  5HLI A;  1FTT A;  2DQL A;  4O6J A;  2R7O A;  2EFN A;  1BM9 A;  3ZMD A;  1WSU A;  1W0T A;  2Y9Y A;  3T5X A;  5HS9 A;  2JUC A;  3CCQ I;  2EH3 A;  3OS2 A;  2RDP A;  2CV1 A;  2CG4 A;  3WTZ A;  4BXU A;  3GXO A;  2GA1 A;  2DOE A;  3H3U A;  4II3 A;  3ZXS A;  1Y1V J;  1O57 A;  2OU2 A;  4B3X A;  4LG0 B;  5K7H A;  3L7W A;  3S3M A;  4LLN A;  4CCN A;  2W85 A;  2X85 A;  1ETV A;  2XGD A;  5HS8 A;  5EG0 A;  2FSW A;  4H4K C;  1X4P A;  2LDU A;  5CVU A;  4XSZ F;  1OKR A;  2DMT A;  5BPD A;  1J59 A;  3ZQG A;  2QQB A;  2IAI A;  4HX4 A;  2ELJ A;  1JTY A;  1ETQ A;  2WC2 A;  3C18 A;  3S1N J;  1FT9 A;  3WGI A;  1QVU A;  1ETX A;  3HEF A;  1BA5 A;  2Z16 A;  4M6V A;  3LA3 A;  3K70 D;  4YFK F;  3CO7 C;  1YJ9 I;  2RVC A;  3DTK A;  2TDX A;  1KGS A;  1VQ5 I;  1UFM A;  3D0S A;  1F4K A;  2QSH X;  4UXN A;  3GTK J;  2LKX A;  1BN5 A;  3A01 A;  3EUH A;  2W57 A;  5ILU A;  2Z2S B;  4HNV A;  1JTX A;  3FXU A;  2DQR A;  1FIA A;  4HLX A;  1R1V A;  2P5V A;  4CSW A;  4B3A A;  1Z0X A;  1IN8 A;  3FKI J;  3OYB A;  2F48 A;  1D0X A;  1MH3 A;  2V1X A;  2L02 A;  5IYC J;  4A3E J;  5D8L B;  3BG9 A;  1IV6 A;  1J9I A;  3GLX A;  4L9J A;  3MN2 A;  4IRH A;  4FIS A;  2XPV A;  4LG0 A;  2JA7 J;  2FBK A;  4ON0 A;  1JI8 A;  3JRB A;  3FWE A;  4ENJ A;  1QRY A;  1VQ9 I;  4BXF A;  3ZQ7 A;  1FZP B;  2K3F A;  3QAH A;  3S16 J;  5IT3 A;  2QZ8 A;  2NAZ A;  2L4A A;  4F52 A;  4J01 A;  3L9F A;  3S8P A;  5GTH C;  3QRF F;  1I39 A;  2WAD A;  1ZTR A;  1V3F A;  3QOP A;  1A04 A;  4UB8 C;  1AHD P;  2QWW A;  2KZV A;  4NQW A;  4S04 A;  3CMA I;  4ZTF A;  5CJ9 A;  3KZY A;  4RA2 A;  4XR6 A;  3QWL A;  2FOW A;  2CFX A;  2ESN A;  1OYW A;  1TWF J;  1H0M A;  3ECH A;  4II2 A;  3U9G A;  2VC0 A;  2A68 F;  2HVR A;  2FEZ A;  2VLA A;  2EJR A;  1AKH A;  4A0Z A;  2R93 J;  4CUG A;  2V7F A;  2Z33 A;  1ULY A;  1E3P A;  2OQG A;  1TT5 B;  5E3L A;  2PN6 A;  4WWC A;  1XX5 A;  2MC4 A;  3L2R A;  4CYC B;  3EPZ A;  1F5T A;  3CJT B;  3QPL A;  3HJE A;  1DP3 A;  2FE3 A;  1FOY A;  2H8R A;  2HDD A;  1LKX A;  1X1B A;  4XKW A;  1MD0 A;  4G6D A;  4XKB A;  3CLO A;  2JVG A;  1TZL A;  4DOZ A;  1OIS A;  1R1T A;  3J81 K;  5GAH J;  4EEF G;  3HUG B;  2IRF G;  4V2F A;  5BOX A;  1HC8 A;  2P8T A;  3DQV C;  4KT5 C;  3DLL F;  2GM4 A;  5L3F A;  1FBS A;  4AU7 A;  1XG1 A;  3GTG J;  1WKM A;  3DEE A;  1WI9 A;  2HU9 A;  3OMY A;  1JJ6 C;  3HOV J;  2CUJ A;  2FXA A;  1TLH B;  3DBL B;  2VIX A;  1ZR2 A;  2DJI A;  4HPQ A;  3GX4 X;  3TED A;  3CC2 I;  4NNJ A;  3ZQC A;  3VPR A;  3GFI A;  2XGE A;  2JTV A;  2Y0S A;  4Y15 A;  2M7A A;  1TQI A;  1ON2 A;  1U5T B;  1TL8 A;  3OV8 A;  2V79 A;  2K85 A;  2TCT A;  3OYF A;  4U0Y A;  2B0L A;  5EZH A;  2QSF X;  1HLV A;  2CWE A;  3GZ6 A;  2B7E A;  3P9K A;  3PNV A;  3QOE A;  4Y17 A;  5IP9 J;  4DZP A;  3VSK A;  5FB2 A;  1Z67 A;  2R7R A;  2WAQ A;  5B1A H;  1YYV A;  2NVX J;  3CC4 I;  1YRN A;  2MD5 A;  3OR2 C;  4M74 A;  1Z7L A;  2VBZ A;  4CCK A;  4RLQ A;  3LSR A;  1HW1 A;  3I56 I;  1MZB A;  1Z05 A;  2W48 A;  2F5E A;  4LK0 F;  1NG6 A;  2A6E F;  1A5J A;  4M3F A;  3V7S A;  2UUZ A;  4LB5 A;  2LSO A;  5J4V A;  5IPA A;  2W00 A;  3H5A A;  5DCF A;  2CRG A;  1Z9C A;  4C9Y A;  4RGU A;  3WTU C;  3LAP A;  2QKM B;  2X1E A;  3I54 A;  4GYG A;  4ZDL A;  4QIW N;  3S3O A;  2CQN A;  2BGC A;  3IH4 A;  2HFH A;  4I09 A;  5KK1 A;  2BY1 A;  5CLS A;  1FMV A;  1ZK8 A;  1AWC A;  2XAH A;  2ACJ A;  3CCU I;  1G8X A;  1U5T A;  1VQ6 I;  2MAB A;  1WJ5 A;  1FOW A;  2W82 A;  3NAU A;  3HHG A;  1BC8 C;  4B09 A;  1XD7 A;  2OAZ A;  3PO3 J;  1HKQ A;  2LFB A;  2WY8 Q;  3J7A Y;  4EJO A;  4LOC A;  1OFC X;  1OYI A;  2XF5 A;  1WQ2 A;  3F8C A;  2P5L C;  2WY7 Q;  2XSJ C;  1B9N A;  3R6S A;  3O3K A;  4A3D J;  2BYV E;  1Y8Q B;  1BC7 C;  2CJJ A;  2IPQ X;  5HOD A;  3FXJ A;  1YW7 A;  1WJC A;  3IUO A;  5LGN A;  2EV0 A;  2CMP A;  1N25 A;  4DYC A;  4BJ6 C;  3PFI A;  2N8G A;  4MNU A;  1ZG1 A;  3JAM K;  4ZZD A;  1FYK A;  2E19 A;  4U7D A;  3J80 K;  4BEH B;  1TQM A;  5L3C A;  3L2C A;  2R5Z B;  3FXL A;  4BS9 A;  1MMG A;  3O8G A;  4PSW A;  1HBX G;  5B1B H;  3KEY A;  3ABL H;  2BW3 B;  4XRS A;  4F92 B;  5IOZ A;  3DPL C;  2WV0 A;  1FY7 A;  3AL0 B;  4DJA A;  3ASN H;  4XLN F;  2GA2 A;  3NWS A;  3K4B A;  2XIG A;  1J75 A;  3HB9 A;  1GT0 C;  1H88 C;  3K4N A;  1KA8 A;  2WB1 N;  1IN7 A;  4UV8 A;  5GP9 A;  3I59 A;  3AG4 H;  4OMZ A;  3KX2 A;  1IXR C;  3J7A O;  3QP5 A;  3OSF A;  1Y1W J;  1XCV A;  5K1Y A;  3BOQ A;  2Z9O A;  3E1S A;  2CSO A;  3CF5 F;  4IO9 F;  1P4A A;  1X3Z B;  3N4M A;  2KHM A;  3DFG A;  5EEH A;  4F3Q A;  3MZH A;  1R9T J;  4PJ0 C;  2J5O A;  3KP5 A;  1O7F A;  4XOP A;  1JT6 A;  5LD2 C;  2R4G A;  3OL3 A;  2HOS A;  1MDM B;  4Q5S F;  3CJQ B;  1FEX A;  1I50 J;  2LOO A;  4L5I A;  5FFZ A;  1SFO J;  4BEH A;  4IL6 C;  3ZQH A;  5CVR A;  1TBX A;  1NH3 A;  5E18 F;  4QWQ A;  4U0W A;  1XDS A;  3L00 A;  3E5X A;  4CA0 A;  2Y9Z A;  3RPQ A;  4ASN A;  3JRD A;  4U0V A;  1ZRF A;  1X1P A;  3BR2 A;  5FGM A;  2FRH A;  3V8L A;  1IN6 A;  1I6H J;  5E3O A;  1ZKG A;  3IWF A;  1YFH A;  3EYI A;  4ESF A;  3Q3S A;  3WOD F;  2CW7 A;  4A93 J;  3BJA A;  5CVJ A;  2MW8 A;  1VND A;  1QZE A;  2HGC A;  3KYC B;  1REP C;  3F8N A;  2ZXJ A;  1F43 A;  2DI3 A;  2IS4 A;  2P5K A;  3HRS A;  3WG9 A;  1SAX A;  2L9S A;  3FDY A;  1FWZ A;  3H9Q A;  3WG7 H;  3KET A;  5L3G A;  3KEQ A;  3EUH C;  3RKQ A;  3HXL A;  2ZC2 A;  3GTQ J;  2RV8 A;  2V4J C;  2K9S A;  1UMQ A;  2DW4 A;  4ETS A;  4MTD A;  1ZG5 A;  5J1R A;  4DBQ A;  1BR1 A;  1SMT A;  1F1Z A;  4D7M A;  4HNU A;  3LMM A;  2DBB A;  1R6R A;  4HZF A;  4I0B A;  4OU0 A;  4HX7 A;  2DPU A;  4KIG A;  3WHC A;  1PUF B;  4DNC A;  3S15 J;  1TWC J;  4GDF A;  1I1G A;  3OWT A;  4N9H A;  3FIW A;  2R7Z J;  3I55 I;  1T38 A;  3CMM A;  3VDX A;  2HZT A;  1RNL A;  1R36 A;  4D5F A;  4FE4 A;  4YII A;  4RM3 A;  3F8F A;  1Z6R A;  2H09 A;  5L3B A;  2IA1 A;  5E1Z B;  1WI3 A;  4IRG A;  1V4R A;  2FNA A;  4B47 A;  4BH9 A;  2F6C A;  3FHN A;  3A1Y A;  1R7J A;  3H36 A;  1MJA A;  3HIF A;  4PSX A;  1GUU A;  2EPF A;  2ELK A;  2IGN A;  3GYH X;  1ODD A;  4B1R A;  3JR9 A;  4KIB A;  4PZJ A;  2NOJ B;  2MD0 A;  3DWL E;  1JKO C;  2OCC H;  1UHM A;  1JUM A;  1X19 A;  4EM0 B;  3BPV A;  1TTY A;  2VE8 A;  2VI6 A;  2Z99 A;  1YO5 C;  1OMI A;  1BJA A;  1TW3 A;  3OIQ A;  4TV7 A;  3PFY A;  1N78 A;  4IKF A;  3GUD A;  4O5V A;  1FSE A;  1HW2 A;  2OTJ I;  4UUS B;  3LSI A;  1CGP A;  4A0X A;  4HF2 A;  1RI7 A;  4LIU A;  3IKV A;  5E3M A;  1PJR A;  1K4T A;  3MZ8 A;  5ICF A;  4J00 A;  1E3H A;  1TWG J;  2L9N A;  5J8F A;  3AG2 H;  4XN3 A;  3LSJ A;  4PGG A;  4UY8 I;  4MFD A;  3MKL A;  4HV5 A;  1W0U A;  4NUB A;  3ZQL A;  5H6R A;  4EGZ A;  3J7Z I;  2AQE A;  1XN7 A;  2QA4 I;  4DZJ A;  4A3J J;  1R00 A;  1B6A A;  4Y52 J;  4RM2 A;  2ZME A;  3I64 A;  3NEU A;  4HG2 A;  2ECB A;  1ONV A;  2BBY A;  3BDD A;  3REO A;  3AG3 H;  3M1C A;  1MBJ A;  2K02 A;  2STW A;  3IAM 2;  2HS5 A;  3ZP5 A;  1Z21 A;  4UV9 A;  2X1C A;  5HNH A;  3CCM I;  2CQK A;  4ESJ A;  3IC7 A;  1JT0 A;  4OIO F;  2NVT J;  3DEW A;  2QEN A;  2ZXI A;  2ZJP F;  1ERD A;  3RTR A;  4HDU A;  3HPH A;  1ZR4 A;  4F55 A;  3R60 A;  1KU7 A;  1RKT A;  3CCJ I;  1TP4 A;  2DK8 A;  4BY7 J;  3QOD A;  4EVI A;  4RB2 C;  2DA4 A;  3SEQ A;  1V5G A;  1P6R A;  3H5N A;  2DFI A;  4BU2 A;  3G73 A;  4F91 B;  5BMZ A;  3DKX A;  2ETH A;  3U1D A;  1FP1 D;  4HNT A;  1LVA A;  3ESW B;  1IRG A;  1JKQ C;  3W6J B;  2PI0 A;  3B02 A;  4E6K G;  2O61 A;  3OYN A;  2ZJR F;  1T08 B;  4EGY A;  4D5C A;  3EET A;  3FMQ A;  5DCM B;  3T0Y A;  1I1S A;  2L7F P;  2JMW A;  3FXM A;  1JGG A;  1QA6 A;  3EDP A;  2QLZ A;  2M9H A;  3ONQ A;  4EAT A;  1KQ8 A;  3SHF A;  3GO5 A;  2TRT A;  4NC7 A;  2P7V B;  5LRR A;  3BR5 A;  2XAF A;  2V9K A;  5GAE J;  2DMU A;  2FU4 A;  2HXI A;  1D3Y A;  1JHF A;  2Z5U A;  1TQP A;  1RES A;  2LNB A;  4IQ4 A;  3J7Y J;  1S3J A;  2Y48 A;  2OCE A;  3LSG A;  4Q47 A;  2ZJ2 A;  4LD5 A;  4DYQ A;  2OUM A;  1J09 A;  2FJ1 A;  4DIQ A;  1RUO A;  2Y0S N;  1UHS A;  3LAJ A;  2IJL A;  4AD9 A;  2E1M B;  4CCL A;  5D5V B;  1R23 A;  4CO8 A;  1MGT A;  4AM3 A;  4F93 B;  4HQE A;  2RNJ A;  3ZMU A;  3EUK L;  2CYY A;  2HNH A;  3B6A A;  4RB0 A;  5IT9 K;  1IZ1 A;  4KMU X;  5DCM A;  5DUI A;  2WAQ N;  4P9F A;  2O8K A;  3RZD J;  3FF5 A;  1HOM A;  2DA2 A;  2VE9 A;  1OCP A;  3WTS C;  4A5N A;  3UKG A;  1F9N A;  3BZC A;  2LP0 A;  2VJI A;  2KL4 A;  3ERM A;  4KN7 X;  1WCM J;  3DTI A;  1S7E A;  2X6Y A;  2PQ8 A;  2RGV A;  3BRO A;  4QLC U;  1EH8 A;  1SFE A;  1EH6 A;  2COM A;  5AIQ A;  4A6D A;  3KZI C;  4L9T A;  2PEX A;  2IEK A;  1N77 A;  2ISZ A;  1A6Q A;  1IXS B;  3KLN A;  3OYI A;  4W1U A;  4ZYD A;  5FRO A;  1D1A A;  2RNG A;  1K6O A;  2YU9 J;  3HZJ A;  1LUJ B;  2X1D A;  1Y6I A;  3Q9S A;  2ECC A;  4I02 A;  3S93 A;  4UB6 C;  1ZN2 A;  1FLI A;  3L2V A;  1ORK A;  3JSP A;  4C3J J;  5F1J A;  2D1H A;  4XID A;  1R71 A;  4NB5 A;  5D4R A;  3C3W A;  5GAD J;  2L9V A;  3PQJ A;  3VYT B;  4C3H J;  3QPH A;  4BY1 J;  3OYD A;  3R61 A;  5JHF A;  1MNE A;  4V19 K;  1MMD A;  1SFU A;  4XBF A;  4FX0 A;  4CYD A;  4XRM A;  4Z2Y A;  5F04 A;  3U1K A;  3BCA A;  1WPK A;  3F72 A;  2K9N A;  2LRD A;  3OS0 A;  3CME I;  4X6A J;  2HKX A;  1I5Z A;  3OIO A;  4FCY A;  2A05 A;  2MFZ A;  2CGP A;  1MJ9 A;  4HV6 A;  3E5Q A;  4DGW B;  2PFB A;  3HYI A;  2A07 F;  1X3U A;  2VBY A;  2XB0 X;  1VTN C;  2Z1D A;  1W36 D;  5FLX K;  3M7G A;  2GAU A;  4CH7 A;  2R7U A;  1DU6 A;  4EMS A;  3I0T A;  2BVL A;  2JUG A;  3JRF A;  1J2X A;  2GOM A;  2VQH A;  2IA2 A;  2LG4 A;  3MKW B;  3I3L A;  2UV1 A;  2R5Y A;  1EKE A;  1O3S A;  1X3W B;  5K5R A;  4BDZ A;  1YLF A;  1S29 A;  2MYS A;  3HGG A;  3WU0 A;  4UUT A;  1AOY A;  2XB5 A;  2P4W A;  2V6E A;  1ETW A;  4ZZL A;  5A2Q K;  2GIV A;  2OV7 A;  1KQ0 A;  2HPM A;  3DLA A;  3VYS B;  1V5F A;  4M3D A;  4Y3O A;  4M3B A;  2LTP A;  3V8K A;  2X9D A;  4NHJ A;  2LLK A;  4PCQ A;  1X2M A;  5GTI C;  2FD5 A;  3F3X A;  1ZRE A;  2B63 J;  2E2J J;  1Y0U A;  2XHK A;  2DCE A;  2I8D A;  3WTY C;  3NAR A;  3ZQI A;  1QO0 D;  1XGN A;  1ETK A;  4CCJ A;  4ZJZ A;  1T98 A;  1WGX A;  1V5E A;  1VQ8 I;  3OY9 A;  2DAO A;  2JRM A;  4BNC A;  4YFX F;  3S32 A;  3K1P A;  3CMY A;  1IRZ A;  1WVR A;  2M8E A;  3K1N A;  1BR4 A;  2CS3 A;  2O3F A;  2QQ9 A;  2Q2E B;  3Q5F A;  2KJC A;  2QQA A;  3RPU D;  4CXF A;  2NS7 A;  3HOW J;  4E7K A;  2EIM H;  2E2H J;  3SXY A;  4M6X A;  1FOX A;  5BS6 A;  2ID6 A;  2VB6 A;  1R1U A;  2NNY A;  1XC5 A;  1LFB A;  2I10 A;  4XQF A;  3S1Q J;  1YS6 A;  4HEA 2;  1MIJ A;  2JRT A;  4B4C A;  2DT6 A;  4BHB A;  4RAG A;  2RKH A;  2BXZ A;  1DU0 A;  1VQL I;  1DGW Y;  3GTM J;  3KP6 A;  1KYW A;  5FKK A;  2VQC A;  1FJL A;  4AWX B;  5M5W J;  3BZ6 A;  3GEZ A;  2JA6 J;  4LLG F;  2X6X A;  2P0W A;  3IHU A;  2HQ5 A;  4RMN A;  3DKY A;  1Z7U A;  3OYE A;  2HVS A;  4XN0 A;  1NK3 P;  1P7I A;  4UVB A;  4RDU A;  3O8H A;  3SYT A;  2V26 A;  3KP2 A;  1O3Q A;  2JWT A;  1L0O C;  3RQI A;  4ZYH A;  4AIJ A;  1PP8 F;  2LBF B;  1JKR C;  2FQ4 A;  1A36 A;  2BZT A;  4ABZ A;  1LB2 A;  3QU3 A;  3AFH A;  3M8F A;  2CUZ A;  3PSI A;  2DYR H;  2Q2E A;  2ZME C;  2UXN A;  2DT5 A;  1G3W A;  2D5V A;  3ULQ B;  2UWM A;  1IO2 A;  3MD2 A;  1IJW C;  4XLH A;  2GBY A;  2R7X A;  2W1O A;  4E7I A;  3SEZ A;  3RDI A;  3GW2 A;  1HW5 A;  1YW9 A;  3PSF A;  1D5Y A;  3VSL A;  4AYB A;  5ICE A;  5M3F J;  3ZGK A;  4BE2 A;  1S7O A; 
#chains in the Genus database with same CATH homology
 4IPA A;  5HLH A;  4A12 A;  3T8T A;  2KKO A;  1ZRD A;  3GFM A;  2M1B A;  3KFW X;  1XGO A;  2LKP A;  5F1R A;  5AIP A;  5LRS A;  1ZGA A;  2D2W A;  2K4J A;  2JSC A;  1IF1 A;  3C7J A;  4BAY A;  4BYY A;  4O3M A;  4CIC A;  4OIN F;  3DKW A;  5D6E A;  4GCV A;  1XMK A;  1Q1H A;  4RGR A;  2QVO A;  2XGX A;  1LEB A;  1G6N A;  3BPX A;  2EV6 A;  3IRQ A;  2XRN A;  3F6V A;  1HXD A;  4HX8 A;  4M9Z A;  2NS0 A;  3DXJ F;  2MC3 A;  3JTH A;  4I01 A;  5ERI A;  3HUG A;  3MCZ A;  4YIF A;  2W25 A;  2EFO A;  2ZBK A;  4F7Z A;  4WX9 A;  1MKM A;  1TNT A;  4LJZ F;  2HDC A;  5FFX A;  4H0E A;  1RIO H;  2FML A;  2V9V A;  2EWN A;  2W24 A;  2HYG D;  3WU1 B;  4ENM A;  1R22 A;  1S6L A;  4A6E A;  2HOE A;  3TGN A;  1DUX C;  1IW7 F;  1IXC A;  3DPT A;  2KIM A;  3RJP A;  1ZAO A;  3F6O A;  3I71 A;  2XUB A;  1E2X A;  3KP3 A;  3HSF A;  2XKO A;  2EB7 A;  4MQV A;  5FD5 A;  3JAM Z;  4KIF A;  4IVN A;  1ZYR F;  2MLG A;  4WCG A;  4P96 A;  3FMS A;  3I4P A;  5D8K B;  2K7L A;  1QQI A;  3RYR A;  3KZZ A;  2PBI A;  1P4W A;  5E1W A;  2K4B A;  1FYM A;  2QBY B;  3WTX C;  1OYY A;  4U7B A;  4L0Z B;  3O2P E;  1LDD A;  6PAX A;  3WTW C;  4RB3 C;  1Z1D A;  4GGG A;  3OOP A;  4ZH4 F;  4GXO A;  4PGH A;  3E5U A;  4AVP A;  2G7H A;  3MFK A;  2LF8 A;  4CZZ A;  2O8X A;  2GXG A;  1JHH A;  3RIR A;  5E20 A;  2XVC A;  4FHT A;  5D6F A;  4WK8 F;  3JW4 A;  4Y13 A;  1FBU A;  4G94 A;  4WXC A;  1S8N A;  2FF4 A;  4ZYG A;  2KJB A;  1FP2 A;  3GF2 A;  1D8J A;  3TDU C;  1ZGJ A;  5HOO A;  2J5P A;  4AIH A;  1MDM A;  2OZ6 A;  4P55 A;  2GQQ A;  5DV5 A;  4MGR A;  4M73 A;  2XAQ A;  2HEO A;  3QPT A;  1EV7 A;  3L09 A;  2DTR A;  2D45 A;  2XAG A;  3V4G A;  5LHH A;  3ELK A;  1BIA A;  2CO5 A;  5L3D A;  1ZG3 A;  3E6C C;  5LHG A;  1SD7 A;  1U6G A;  2EFQ A;  3ZPL A;  1G4D A;  5K5Q A;  1K78 B;  2GWR A;  4FT8 A;  3TQN A;  4UHT A;  1T0F A;  4Q48 A;  3D5L A;  2QYO A;  5TJJ A;  5F6F A;  1KU2 A;  4L9N A;  1GXQ A;  1T39 A;  4EJV A;  4UNO A;  4A2U A;  3LFK A;  2OZU A;  1B4A A;  1ZH5 A;  3E6B A;  2O6G E;  2IVM A;  2VC1 A;  1ZAR A;  3P9C A;  1W5T A;  4RS8 A;  3JSO A;  2AXL A;  4P9U A;  1T6S A;  3T1B A;  4MHG A;  3I58 A;  4RB1 A;  2ELH A;  1XB4 A;  2ZNY A;  2DU9 A;  4HOB A;  4HF1 A;  3NQO A;  2FNP A;  3CUQ B;  2A5Y B;  3I53 A;  3RKY A;  4IF4 A;  4MTE A;  3K0L A;  5DUK A;  1STZ A;  1D5V A;  3DEU A;  1W7P B;  5LBQ A;  2EV5 A;  2HQR A;  3E6D A;  4R79 A;  4R8H A;  2ESH A;  3BJO A;  5HDK A;  4IRI A;  3GFJ A;  1K7A A;  1BOA A;  1R58 A;  4M71 A;  1ON1 A;  2RC4 A;  3SQN A;  1QBJ A;  2VOP A;  2EFW A;  4XLP F;  2ZNZ A;  4I0A A;  2YX7 A;  1YG2 A;  3IL2 A;  2EK5 A;  3CUQ A;  5LHI A;  4UVC A;  3RPU A;  2FOK A;  2W84 A;  4HYE A;  3K2Z A;  5E1X A;  4L18 B;  2MH2 A;  3ECO A;  1HKT A;  3AAF A;  2E1C A;  1HSJ A;  1U5T C;  2VOO A;  4LK1 F;  2YU3 A;  5JHU A;  3KP4 A;  5JFR A;  1XSX A;  5FO5 A;  2P6T A;  2IA0 A;  2VT2 A;  3FXR A;  1LDK B;  2ZO4 A;  3WTT C;  4EQQ A;  5LGT A;  2BV6 A;  3HOT A;  1BI0 A;  1U3E M;  4G7Z F;  1USS A;  4WXD A;  3WGH A;  4IXA A;  2V1D A;  3HRM A;  3V7C A;  2VT3 A;  4EJT A;  1QZY A;  2FQ3 A;  1SD6 A;  4ENN A;  2DO7 A;  5EEG A;  3ABU A;  1SMY F;  3IKT A;  2ZCW A;  3PQK A;  3FXQ A;  2VON A;  3ZMT A;  2IT0 A;  3JTG A;  1FBQ A;  2Z3Y A;  3TO9 A;  2PJP A;  2VOD A;  3TKY A;  3LA2 A;  2ZKZ A;  1P2F A;  3VFZ A;  1BI2 A;  2JPC A;  4AIK A;  2HKO A;  3SZT A;  1RUN A;  3DV8 A;  3KCC A;  2VXZ A;  1T2K A;  3F23 A;  4N0B A;  1E17 A;  4JBA A;  5E8I A;  4L9V A;  2A6H F;  3SFZ A;  3GWZ A;  4JQF A;  2A69 F;  3R0A A;  2JZY A;  3TOA A;  2XRO A;  3F22 A;  3GFL A;  2MH9 A;  3HRU A;  1OPC A;  2EFP A;  5KVR A;  2R7D A;  1UHW A;  4LGW A;  1FYL A;  4BHC A;  2WWY A;  4U88 A;  5K5O A;  1SFX A;  2AS5 F;  4LFU A;  4ENK A;  1WRJ A;  2QUF A;  4IHT A;  1NHA A;  2HQN A;  2H94 A;  3CUO A;  3K69 A;  4M6Y A;  1K79 A;  4L0Y B;  2C6Y A;  2G7U A;  1DPR A;  3FM5 A;  5J8C A;  2VBX A;  1BBY A;  4EM2 A;  3N97 A;  2JPB A;  1ZLK A;  1GVJ A;  2OA4 A;  4S05 A;  3HOS A;  4IJA A;  3BJ6 A;  3R4K A;  1CF7 B;  2IP2 A;  1W7P D;  1G3S A;  1FNN A;  2K86 A;  1P92 A;  2DPD A;  1PUE E;  2HTJ A;  2A3S A;  1J0R A;  1RZ4 A;  1L3L A;  1DDN A;  5H6Q A;  3NRV A;  2CW0 F;  3CDH A;  1SD5 A;  1U2W A;  4YFN F;  2V1U A;  2HWV A;  2VN2 A;  2P7C B;  2JT1 A;  4OIR F;  4JK1 X;  3COA C;  4MEY F;  2FBH A;  1XGM A;  1UB9 A;  4GO1 A;  2MBF A;  2OQR A;  1YS7 A;  4K2E A;  3BWG A;  1HST A;  4RGX A;  1XDU A;  1QPM A;  1DPU A;  1CF7 A;  1ZRC A;  3CJN A;  5DEQ A;  2STT A;  5HVQ C;  2MA3 A;  2F5C A;  3H92 A;  1FSH A;  1WWX A;  3M9A A;  3G3Z A;  2M30 A;  2OD5 A;  3QP6 A;  1YIO A;  3J81 Z;  3VOE A;  3KE2 A;  1R5G A;  5ILV A;  3CUQ C;  2G9W A;  4G6Q A;  3LQR A;  4I98 B;  3TO7 A;  4EJW A;  3TO6 A;  2D1V A;  2O0Y A;  3RYP A;  3HHH A;  2M5W A;  1QZZ A;  3VEP A;  3ZMS A;  3F8M A;  3IWZ A;  2YSR A;  5LGU A;  4ZYE A;  1YTY A;  3MQ0 A;  1XCB A;  3WGG A;  2DLL A;  2GXB A;  5F64 A;  5HLG A;  3EYY A;  1KYZ A;  4LLL A;  3LQQ A;  3B73 A;  3E6M A;  3E3V A;  1BI3 A;  3FHZ A;  3ERE D;  5L3E A;  4KDP A;  2X0L A;  3QU6 A;  5DYM A;  1W5S A;  3ML6 A;  2FA5 A;  2Y75 A;  1I6X A;  2Y0M A;  3RI4 A;  1JXS A;  1TW2 A;  1G3T A;  2E7W A;  4EM1 A;  4G7H F;  1W4M A;  5CVV A;  4WXH A;  3ZMV A;  1ZLJ A;  3GZ5 A;  3WE3 A;  1KU3 A;  4OIP F;  1OR7 A;  3DP7 A;  5ED4 A;  1XSD A;  4KN4 X;  3F21 A;  5HS7 A;  3I59 B;  3J80 Z;  4EJU A;  3TOB A;  1TNS A;  3MWM A;  4M9S A;  4OIQ F;  4R1H A;  1U8R A;  1UCR A;  5D5U B;  2KIF A;  3HSE A;  2RQP A;  4A5M A;  1XMA A;  3V8J A;  3R0J A;  4LMY A;  3DF8 A;  3KLO A;  2R7F A;  3FZV A;  1XGS A;  1IUY A;  4OOI A;  5HDN A;  2Q0O A;  4GYI A;  4HA8 A;  3S2W A;  1FOK A;  4MEX F;  2QM3 A;  4OMY A;  4YG2 F;  3SZP A;  4CHU A;  5BPI A;  3LWF A;  5JR3 A;  1J5Y A;  1MJB A;  3FX3 A;  1BI1 A;  2QBY A;  2V6C A;  3ABT A;  3MEX A;  1IN5 A;  3U2R A;  4HAM A;  4M9X A;  3HRT A;  1BIB A;  4G8X A;  2NYX A;  3KEO A;  2KIU A;  1DP7 P;  3ZMZ A;  5DD8 A;  3FMR A;  4N9I A;  2OBP A;  4G9Y A;  1B59 A;  4LB6 B;  2UZK A;  2F5D A;  3MAJ A;  3P9I A;  2E7X A;  2LF7 A;  1C0W A;  1HKS A;  3K1M A;  2GZW A;  3BY6 A;  1O7L A;  5E8G A;  1B9M A;  1R5H A;  1IRF A;  3P7N A;  3FM3 A;  5LLQ A;  4KMF A;  2L4M A;  1I27 A;  5CVI A;  4I2O A;  2K27 A;  4MQ9 F;  4RGS A;  2H6B A;  5FD6 A;  2P6S A;  1D8K A;  2ZME B;  4XSX F;  5D5W B;  1S7A A;  1UST A;  4RAZ A;  3HTS B;  3VOD A;  1KQ9 A;  1XSV A;  5D4S A;  5HDG A;  1G3Y A;  5DDG A;  2H6C A;  1H9G A;  1K78 A;  4UVA A;  1LEA A;  2DK5 A;  3CTA A;  5JVT A;  1PDN C;  3BP8 A;  2HTS A;  2MLK A;  4BQA A;  2ADU A;  2M87 A;  4FX4 A;  2YPR A;  3ZN0 A;  3V7R A;  4KUM A;  1YQA A;  2EA2 A;  2UXX A;  1QNT A;  4KIC A;  2M45 A;  1Z91 A;  1PP7 U;  2WTE A;  2XKP A;  1HQC A;  1ZHF A;  3M8E A;  2NNN A;  4D0P A;  4HLY A;  4CGZ A;  5J6X A;  2L3D A;  5LEK A;  3M1E A;  2FMY A;  2L54 A;  1J7K A;  5TRD A;  1KU9 A;  3H3Z A;  1W7P A;  4DQ2 A;  4A0Y A;  1B1B A;  3GVA A;  4I7H A;  5E17 F;  2R3S A;  4BHP A;  2IW5 A;  3VB2 A;  2HR3 A;  2EA4 A;  3WTV C;  2E1N A;  4ESB A;  1JGS A;  4UUV A;  2X4H A;  2XV4 S;  2H27 A;  4IHS A;  4E70 A;  4HF0 A;  3EQL F;  3ZN1 A;  4B8X A;  2XAJ A;  4HW0 A;  1FX7 A;  5H20 A;  4HQM A;  2ISY A;  5AON A;  2O03 A;  3K9T A;  3F8B A;  2F5F A;  5BQT A;  5DD4 A;  1IN4 A;  1LQ1 A;  2XAS A;  1LDJ A;  4RAY A;  2VBW A;  5IT9 Z;  2FBI A;  3RKW A;  4EV0 A;  1LJ9 A;  2KRF A;  1GHC A;  3TDZ C;  2YR2 A;  4PDK A;  2Q8K A;  2YX4 A;  3IRR A;  4KNY A;  3C1D A;  3Q9V A;  4XRF A;  3O6B B;  3W6K B;  3LA7 A;  4KA4 A;  1O3T A;  3HTU A;  5LEJ A;  4WF2 A;  5D5X B;  4HBL A;  3HSR A;  3CO6 C;  1YW8 A;  2HYF A;  1SD4 A;  2A61 A;  1U78 A;  1FC3 A;  2PMH A;  2NRA C;  4P5O A;  5ILS A;  2F2E A;  5ICG A;  4Q4Z F;  2RN7 A;  4G7O F;  1EH7 A;  2PMU A;  1JE8 A;  1GXP A;  3LST A;  5JI6 A;  5FLX Z;  1O3R A;  3ISP A;  1FPQ A;  3E97 A;  2BE5 F;  2ZFW A;  1P4X A;  3ROU A;  4CDG A;  1H9T A;  2PG4 A;  5ICC A;  4KYW A;  2L01 A;  4HDV A;  3T8R A;  3KP7 A;  4L5J A;  2PLY A;  2BEO A;  4KFC A;  3RKX A;  5A2Q Z;  3I5U A;  1QGP A;  3MZY A;  5CYV A;  3WE2 A;  1LNW A;  1IAW A;  4M72 A;  1Z6T A;  5HLI A;  2DQL A;  4O6J A;  2EFN A;  1BM9 A;  3ZMD A;  1WSU A;  3T5X A;  5HS9 A;  2RDP A;  2CG4 A;  3WTZ A;  4BXU A;  3GXO A;  2GA1 A;  3H3U A;  1O57 A;  2OU2 A;  4LG0 B;  3L7W A;  4LLN A;  2W85 A;  5HS8 A;  2FSW A;  2LDU A;  5CVU A;  4XSZ F;  1OKR A;  5BPD A;  1J59 A;  2QQB A;  4HX4 A;  2WC2 A;  3C18 A;  1FT9 A;  3WGI A;  3LA3 A;  4YFK F;  3CO7 C;  2RVC A;  2TDX A;  1KGS A;  1UFM A;  3D0S A;  1F4K A;  4UXN A;  1BN5 A;  3EUH A;  2W57 A;  5ILU A;  3FXU A;  2DQR A;  4HLX A;  1R1V A;  2P5V A;  1IN8 A;  2V1X A;  2L02 A;  5D8L B;  1J9I A;  3GLX A;  4L9J A;  4IRH A;  4LG0 A;  2FBK A;  4ON0 A;  3FWE A;  4ENJ A;  3ZQ7 A;  1FZP B;  3QAH A;  5IT3 A;  2QZ8 A;  2NAZ A;  2L4A A;  3L9F A;  3QRF F;  3QOP A;  1V3F A;  1A04 A;  2QWW A;  4NQW A;  4S04 A;  5CJ9 A;  3KZY A;  2CFX A;  2ESN A;  1OYW A;  1H0M A;  3ECH A;  3U9G A;  2VC0 A;  2A68 F;  2FEZ A;  2EJR A;  4A0Z A;  2Z33 A;  1ULY A;  2OQG A;  2PN6 A;  4WWC A;  1F5T A;  2FE3 A;  1MD0 A;  4G6D A;  3CLO A;  1R1T A;  3J81 K;  2IRF G;  5BOX A;  2P8T A;  3DQV C;  4KT5 C;  5L3F A;  1FBS A;  1WKM A;  1WI9 A;  2FXA A;  1TLH B;  3GX4 X;  3GFI A;  2JTV A;  4Y15 A;  1TQI A;  1ON2 A;  1U5T B;  3OV8 A;  2V79 A;  4U0Y A;  2B0L A;  2CWE A;  3GZ6 A;  3P9K A;  4Y17 A;  5FB2 A;  1YYV A;  2MD5 A;  4M74 A;  2VBZ A;  1HW1 A;  1MZB A;  1Z05 A;  2F5E A;  4LK0 F;  2A6E F;  3V7S A;  4LB5 A;  2LSO A;  5DCF A;  1Z9C A;  4RGU A;  3WTU C;  3LAP A;  3I54 A;  4GYG A;  2BGC A;  2HFH A;  4I09 A;  5KK1 A;  5CLS A;  1AWC A;  2XAH A;  2ACJ A;  1U5T A;  3HHG A;  1BC8 C;  4B09 A;  1XD7 A;  2OAZ A;  1HKQ A;  4EJO A;  1OYI A;  1WQ2 A;  3F8C A;  2P5L C;  1B9N A;  3R6S A;  3O3K A;  2BYV E;  1BC7 C;  2IPQ X;  1YW7 A;  5LGN A;  2EV0 A;  3PFI A;  4MNU A;  1ZG1 A;  3JAM K;  4ZZD A;  1FYK A;  4U7D A;  3J80 K;  1TQM A;  5L3C A;  3L2C A;  1HBX G;  3DPL C;  2WV0 A;  1FY7 A;  4XLN F;  2GA2 A;  2XIG A;  1J75 A;  4UV8 A;  1KA8 A;  1IN7 A;  3I59 A;  4OMZ A;  1IXR C;  3J7A O;  3QP5 A;  1XCV A;  5K1Y A;  3BOQ A;  2Z9O A;  2CSO A;  1P4A A;  3N4M A;  3DFG A;  5EEH A;  3MZH A;  2J5O A;  3KP5 A;  1O7F A;  4Q5S F;  1MDM B;  4L5I A;  5FFZ A;  5CVR A;  1TBX A;  5E18 F;  4QWQ A;  4U0W A;  1XDS A;  3L00 A;  3E5X A;  3RPQ A;  4ASN A;  4U0V A;  1ZRF A;  5FGM A;  2FRH A;  3V8L A;  1IN6 A;  3IWF A;  1YFH A;  3EYI A;  4ESF A;  3WOD F;  3BJA A;  5CVJ A;  2HGC A;  1REP C;  3F8N A;  2ZXJ A;  2DI3 A;  2P5K A;  3HRS A;  3WG9 A;  1SAX A;  1FWZ A;  3KET A;  5L3G A;  3KEQ A;  2RV8 A;  2DW4 A;  4ETS A;  4MTD A;  1ZG5 A;  1SMT A;  1F1Z A;  2DBB A;  4HZF A;  4I0B A;  4OU0 A;  4HX7 A;  2DPU A;  4KIG A;  4DNC A;  1I1G A;  4N9H A;  1T38 A;  2HZT A;  1RNL A;  1R36 A;  4YII A;  3F8F A;  1Z6R A;  2H09 A;  5L3B A;  2IA1 A;  5E1Z B;  4IRG A;  1V4R A;  2FNA A;  4BH9 A;  1R7J A;  1MJA A;  3HIF A;  3GYH X;  1ODD A;  4KIB A;  4PZJ A;  1UHM A;  4EM0 B;  3BPV A;  1TTY A;  2VE8 A;  2Z99 A;  1YO5 C;  1OMI A;  1BJA A;  1TW3 A;  4TV7 A;  3GUD A;  4O5V A;  1FSE A;  1HW2 A;  1CGP A;  4A0X A;  4HF2 A;  1RI7 A;  3IKV A;  5ICF A;  5J8F A;  4PGG A;  4HV5 A;  5H6R A;  4EGZ A;  1XN7 A;  1R00 A;  1B6A A;  2ZME A;  3I64 A;  3NEU A;  1ONV A;  2BBY A;  3BDD A;  3REO A;  2K02 A;  2STW A;  2HS5 A;  3ZP5 A;  4UV9 A;  2CQK A;  4ESJ A;  3IC7 A;  4OIO F;  2QEN A;  3RTR A;  4HDU A;  3R60 A;  1KU7 A;  2DK8 A;  4EVI A;  4RB2 C;  1P6R A;  2DFI A;  3G73 A;  5BMZ A;  2ETH A;  3U1D A;  1FP1 D;  1LVA A;  1IRG A;  3W6J B;  2PI0 A;  3B02 A;  2O61 A;  4EGY A;  3EET A;  3FMQ A;  5DCM B;  3T0Y A;  1I1S A;  3EDP A;  2QLZ A;  1KQ8 A;  3SHF A;  3GO5 A;  2P7V B;  5LRR A;  2XAF A;  2FU4 A;  1D3Y A;  1JHF A;  2Z5U A;  1TQP A;  2LNB A;  1S3J A;  2Y48 A;  4Q47 A;  2ZJ2 A;  4LD5 A;  1RUO A;  3LAJ A;  2IJL A;  4AD9 A;  5D5V B;  1R23 A;  4CO8 A;  1MGT A;  4HQE A;  2RNJ A;  3ZMU A;  2CYY A;  4RB0 A;  5IT9 K;  1IZ1 A;  4KMU X;  5DCM A;  5DUI A;  4P9F A;  3FF5 A;  2VE9 A;  3WTS C;  4A5N A;  1F9N A;  4KN7 X;  2PQ8 A;  2RGV A;  3BRO A;  4QLC U;  1EH8 A;  1SFE A;  1EH6 A;  2COM A;  5AIQ A;  4A6D A;  4L9T A;  2PEX A;  2ISZ A;  1IXS B;  3KLN A;  4ZYD A;  1K6O A;  3Q9S A;  4I02 A;  1ZN2 A;  1FLI A;  3JSP A;  2D1H A;  4NB5 A;  5D4R A;  3C3W A;  3PQJ A;  3QPH A;  3R61 A;  1SFU A;  4XBF A;  4FX0 A;  4CYD A;  4Z2Y A;  3F72 A;  2HKX A;  1I5Z A;  2CGP A;  1MJ9 A;  4HV6 A;  3E5Q A;  2PFB A;  3HYI A;  2A07 F;  1X3U A;  2VBY A;  1VTN C;  5FLX K;  3M7G A;  2GAU A;  4EMS A;  3I0T A;  1J2X A;  2IA2 A;  1O3S A;  5K5R A;  1YLF A;  1S29 A;  3WU0 A;  1AOY A;  2P4W A;  4ZZL A;  5A2Q K;  2GIV A;  1KQ0 A;  3V8K A;  4NHJ A;  4PCQ A;  3F3X A;  1ZRE A;  1Y0U A;  2XHK A;  3WTY C;  1QO0 D;  1XGN A;  1T98 A;  2DAO A;  4BNC A;  4YFX F;  3K1P A;  2M8E A;  3K1N A;  2O3F A;  2QQ9 A;  3Q5F A;  2KJC A;  2QQA A;  4CXF A;  3SXY A;  4M6X A;  5BS6 A;  1R1U A;  2NNY A;  1YS6 A;  2JRT A;  4BHB A;  2RKH A;  3KP6 A;  1KYW A;  4AWX B;  3BZ6 A;  3GEZ A;  4LLG F;  3IHU A;  1Z7U A;  4UVB A;  3KP2 A;  1O3Q A;  1L0O C;  4ZYH A;  4AIJ A;  1PP8 F;  1LB2 A;  3QU3 A;  3M8F A;  2Q2E A;  2UXN A;  2DT5 A;  1G3W A;  3ULQ B;  2UWM A;  3RDI A;  3GW2 A;  1HW5 A;  1YW9 A;  5ICE A;  1S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...