3Q9VA

Crystal structure of rra c-terminal domain(123-221) from deinococcus radiodurans
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of rra c-terminal domain(123-221) from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein
molecule keywords DNA-binding response regulator
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3q9vA00
1KYWA 5ICCA 2YX4A 1R5GA 3BP8A 3ZN0A 3MCZA 1RI7A 4BNCA 4ZZLA 1IN5A 5E18F 1ZGJA 3QP5A 2VT2A 3GYHX 3BPVA 1ODDA 2FXAA 3FZVA 1BI1A 1ONVA 1U5TB 1ZG5A 5A2QK 1BBYA 3M9AA 4A2UA 4OIOF 3ZMDA 2XASA 3C3WA 5ILSA 1PDNC 3ABUA 2EV0A 3CUQB 3DEUA 5CJ9A 3ZMSA 3MWMA 3E97A 3ZN1A 4MEXF 4YIFA 4OINF 3M8FA 2DPUA 4HLXA 4CZZA 1YS7A 1MDMB 5F64A 2UWMA 2P5VA 1HKSA 4ENKA 4KICA 2QVOA 5LEKA 2E7WA 5FFZA 4UNOA 1UFMA 2NRAC 2M1BA 5IT9K 2Z3YA 3M7GA 3VEPA 3IHUA 3LFKA 3HSFA 4M72A 4EM2A 1BOAA 1PP8F 3WGIA 4ZYHA 4UVCA 1CGPA 1MJBA 2IT0A 4O6JA 1H0MA 4YFKF 1G3TA 1KU9A 3HRUA 3FHZA 1T6SA 4IHTA 4ON0A 2Y0MA 4P5OA 3GFLA 3ECOA 2P6TA 4BQAA 1I1SA 1QZZA 4A0XA 1XB4A 3E3VA 3O3KA 4EVIA 4U7DA 2H6CA 1G6NA 1MJAA 4Q48A 4MNUA 3E6BA 2PI0A 2XGXA 5D5UB 2TDXA 4UUVA 3CUOA 2FRHA 2O3FA 4U0WA 1O7FA 4I02A 2EFPA 4AIKA 3ZMTA 4M9ZA 1SD7A 4DNCA 2Z9OA 2HTJA 3REOA 4HAMA 4PZJA 3GW2A 2VE9A 5KK1A 1ULYA 3MEXA 2CO5A 1G3YA 2HEOA 2A5YB 1HW2A 1SMYF 3WG9A 2Q8KA 1J75A 4FT8A 3RJPA 5L3FA 1LEBA 1J59A 2DI3A 3J81Z 2QQ9A 4HV5A 2FNAA 1Z7UA 5CVJA 4IJAA 3CTAA 2XAQA 2K27A 2PLYA 1PP7U 2W84A 2IJLA 3PFIA 3QPHA 4L0ZB 1XCBA 2D2WA 1QO0D 3RKYA 3KCCA 5AONA 4JBAA 2UZKA 1QBJA 4HYEA 2OQGA 4R8HA 4L5IA 1LDJA 4CO8A 3ZMVA 2P6SA 2ZKZA 3L09A 4RB3C 2PMHA 2F5DA 2PN6A 2F2EA 2L4AA 3J81K 3C1DA 3IL2A 4MEYF 2GIVA 1U3EM 4IHSA 2XAJA 1ZLJA 2V9VA 3ECHA 4CGZA 1R1VA 3CO7C 2EV6A 5LGTA 1O57A 3BJ6A 3HRMA 1J2XA 5JVTA 1Z05A 2QUFA 4I0AA 2XVCA 1I27A 3T8TA 4M6YA 3D5LA 4LK0F 5E1XA 2NYXA 3FM3A 1LJ9A 1Q1HA 2XAGA 1YIOA 5DCMA 3HSEA 5DDGA 2EV5A 1L3LA 2VBXA 3MAJA 2HKXA 3DV8A 2WV0A 1ZRCA 4YIIA 1R58A 1OYWA 4QWQA 2VBWA 3HRSA 2ZBKA 4IRIA 1REPC 4MHGA 1XSDA 3QU3A 1WWXA 3RYPA 2V1XA 2ISYA 1GHCA 5F6FA 4YFNF 2IA2A 4EJUA 3P9CA 3OV8A 5LBQA 1UCRA 2EFOA 4ZZDA 2O8XA 1D8KA 2JTVA 2CFXA 4I0BA 5DCFA 4JQFA 1FSHA 3R0AA 1XN7A 2GZWA 1HBXG 2G7UA 4GYIA 1H9GA 1LB2A 2FBIA 3R4KA 5FO5A 1P92A 4RAZA 1P4WA 3O2PE 4RB2C 3FF5A 1YLFA 3GEZA 3BZ6A 2KJCA 2RDPA 1E17A 5HDNA 2R7FA 2F5CA 1XD7A 2M8EA 2L4MA 4EJVA 1B9NA 4HX4A 1KYZA 4UXNA 4Q4ZF 5FD5A 1TNSA 4UHTA 3BJAA 3I58A 4G6DA 5D6EA 1LEAA 5EEHA 4MTDA 2L02A 4I09A 3O6BB 3KP3A 3U2RA 3F22A 2DW4A 4LJZF 2HYFA 5E20A 2AS5F 2HKOA 4RB1A 2CW0F 3KP2A 2IP2A 5ILVA 2FQ3A 2MA3A 3LQQA 2LDUA 1JE8A 4S05A 4LG0B 1XGSA 3B73A 3LA2A 3EYYA 1W5TA 4GGGA 1U6GA 4NQWA 3V4GA 4IPAA 1T98A 2JT1A 1ZN2A 4MQ9F 1PUEE 3TDZC 5HVQC 5JI6A 4IXAA 3FXRA 2QYOA 4MTEA 4G8XA 3E5QA 2C6YA 5AIQA 2V1DA 3QP6A 4LG0A 2ISZA 2HDCA 3EUHA 3WU1B 3GF2A 1XCVA 5L3CA 4H0EA 1P4XA 1T38A 2FSWA 1JGSA 1O3QA 2MD5A 1AOYA 2FBKA 5H20A 4XBFA 3SHFA 2M30A 3GZ6A 4FX0A 4KA4A 2DK5A 5E1ZB 2OQRA 4QLCU 4A6DA 3BWGA 5D5WB 3RPQA 2OZ6A 4XLPF 1TQIA 4K2EA 4LD5A 5TRDA 5KVRA 5D6FA 4L9JA 3U9GA 1IF1A 5LRRA 5CVIA 1ZREA 2OU2A 4BHPA 2PQ8A 1R7JA 2DTRA 3KETA 2HQRA 2HTSA 1Z1DA 4PGGA 2MH9A 3F8FA 5ICGA 2RV8A 5BQTA 5FGMA 1FSEA 2NS0A 3PQKA 2ZO4A 2FNPA 1I6XA 1IN6A 3KP4A 2CG4A 1J7KA 3EQLF 2VXZA 1RNLA 3EDPA 4GXOA 1FT9A 2K4BA 2AXLA 2DT5A 2BV6A 4IVNA 1Z6RA 3RPUA 1TBXA 1IAWA 2ZXJA 2H6BA 3ABTA 2A3SA 4L0YB 1RZ4A 4U0YA 3DQVC 3V7RA 3TKYA 2W85A 1RUNA 1I5ZA 2RN7A 1FBQA 4GYGA 2STWA 3I59B 3RI4A 2R3SA 1BIBA 3WTZA 2HQNA 4A5MA 4KMFA 2J5OA 4LB6B 2YSRA 2F5FA 1FP1D 2X4HA 2QZ8A 1XDUA 3T8RA 1SD4A 2R7DA 5DYMA 1F4KA 5ED4A 4L9VA 4HF0A 1NHAA 3H3UA 1TW2A 1XGNA 1P6RA 2OA4A 2YPRA 4IF4A 2O61A 3KEOA 2IA1A 2EFNA 4M6XA 2K4JA 3WU0A 1B4AA 4N0BA 3TO7A 3OOPA 1YW9A 3ZQ7A 2K7LA 2CWEA 4HBLA 4L9TA 5JFRA 5F1RA 2FMYA 1XMAA 4M73A 1S7AA 1U2WA 3WTTC 4Y13A 2EA4A 5D5VB 2H09A 1S8NA 3R61A 1B1BA 2XROA 2BBYA 1RUOA 4R79A 2P7CB 4HDVA 3WGHA 3MFKA 5D4RA 2EJRA 2O03A 4AVPA 2VC1A 5K5RA 4WXDA 1B9MA 3NRVA 1QGPA 4KN4X 5HLGA 4JK1X 2PEXA 3HTSB 2B0LA 1S7OA 2XAFA 3H92A 1EH8A 5CLSA 4M74A 3CDHA 4HQMA 2FE3A 2EWNA 1TQMA 3RYRA 1QZYA 4S04A 3H3ZA 1CF7B 4ZYDA 3MZYA 3GFIA 3QOPA 1X3UA 1USSA 2HR3A 5DUKA 1HKQA 2ACJA 2IA0A 4BYYA 2Y75A 2QM3A 2JZYA 4M9XA 1ON1A 1FPQA 4EM0B 4RB0A 5FLXK 5D5XB 2RNJA 2FBHA 2XKPA 2KIMA 2Z99A 4LLNA 3JSPA 1BI0A 5EEGA 4CICA 1QQIA 1SD5A 2E7XA 2KKOA 3Q9VA 4KIBA 1FOKA 4A0ZA 1Z6TA 1O3RA 3WTWC 2H27A 3J80K 3RTRA 1WSUA 3I54A 3JTGA 2KIFA 4OIRF 1SFEA 4RGXA 1G3WA 3G73A 3GFMA 1YG2A 3J7AO 1OYIA 3WGGA 4U88A 1DPRA 4AD9A 4CXFA 4OMZA 2QLZA 3TGNA 4F7ZA 5K5OA 4N9IA 4EMSA 4BAYA 1XGOA 3VB2A 1QPMA 1KGSA 4WWCA 2HYGD 1D8JA 3KP7A 1FC3A 2W25A 1W7PD 1YO5C 4M71A 2LF8A 3HOSA 2EFWA 3LA3A 4EGYA 2FU4A 3R60A 2ETHA 3F8BA 5ILUA 2L01A 3GVAA 4B8XA 3M8EA 3I5UA 3FMSA 4WXHA 1YW8A 1FWZA 4OMYA 3FXQA 1IXRC 1UHWA 5DCMB 4AIJA 2KIUA 2MLKA 1JXSA 2DFIA 5LEJA 5IT9Z 5L3DA 3HHHA 1FY7A 4ESFA 2E1NA 3FMQA 1T2KA 1EH7A 3Q5FA 2EA2A 4P9UA 1WI9A 2V6CA 1OYYA 3EETA 1K78B 3NEUA 5E17F 1BIAA 2DO7A 1HSJA 2GAUA 5CVVA 3DXJF 2J5PA 5HDGA 5L3EA 4Q5SF 2LKPA 5L3BA 3F8CA 3E6CC 4ESBA 2GQQA 2CQKA 3KLOA 1P2FA 4OOIA 4CYDA 1LDDA 3HRTA 1GXQA 5TJJA 1YFHA 3ELKA 4G7HF 4PCQA 4XSXF 2RQPA 1CF7A 4ZYGA 2OD5A 5BPDA 3GXOA 1DP7P 1MZBA 1DDNA 2HZTA 4I7HA 3PQJA 4Y17A 5H6RA 3SZPA 4RGSA 4EQQA 2XHKA 1W4MA 1IW7F 1BN5A 3RDIA 1XSXA 4OIPF 2QBYA 1FLIA 1U8RA 3BROA 2G7HA 1IRFA 2DBBA 2W24A 4R1HA 1B59A 5DUIA 5ICEA 1EV7A 4P96A 2Z33A 4HA8A 3C7JA 2F5EA 2LSOA 3K69A 2EFQA 2Q2EA 1U5TC 1T0FA 3GWZA 2A68F 2MH2A 3K9TA 5DV5A 2PJPA 2M87A 5JR3A 3T0YA 4EJOA 4GCVA 3L00A 6PAXA 5BS6A 4Q47A 2BEOA 1HKTA 2ZNZA 3GUDA 4D0PA 4B09A 1BI3A 3LQRA 1K79A 1YW7A 2D1HA 2KRFA 4E70A 3COAC 4EGZA 4KMUX 1A04A 4ZYEA 5HDKA 1OPCA 3V8JA 4LLLA 3P7NA 3KFWX 2ZJ2A 3F8MA 3GFJA 2DK8A 2ZMEA 3T1BA 1XDSA 2ZCWA 3LAPA 3JSOA 3IKVA 3VFZA 4YFXF 1IZ1A 3I64A 3EYIA 3F23A 1S3JA 3SXYA 3MZHA 1TNTA 1DPUA 2FA5A 2CSOA 1D5VA 3E5XA 1KQ8A 3HSRA 3V7CA 2XUBA 5J8CA 2P5KA 5FD6A 1ZHFA 2VC0A 4WK8F 5DD8A 4KDPA 3WTYC 1KQ0A 3RIRA 2G9WA 2JPBA 2QENA 2H94A 4RS8A 3W6JB 1W5SA 1O7LA 3HIFA 1IXSB 2A61A 4KT5C 1MD0A 3GZ5A 2JRTA 4G94A 5E1WA 1S29A 4G7ZF 2VE8A 5K5QA 5LGUA 5HS9A 1LDKB 4LGWA 2CYYA 4XSZF 3QPTA 4P55A 1R00A 1HXDA 1BC8C 4XLNF 4U7BA 3BJOA 3JAMZ 1UB9A 3W6KB 5J6XA 2D45A 1SMTA 4G6QA 1RIOH 4RGUA 5D8LB 5BMZA 4HF2A 4Y15A 2FEZA 1MGTA 5LLQA 3FX3A 4BHBA 4Z2YA 1USTA 1R1UA 3DPLC 1Z91A 4KN7X 2OBPA 5DEQA 2A6EF 4CDGA 3Q9SA 1ZRDA 1TLHB 2ESHA 1YS6A 3L2CA 1FZPB 4WCGA 4BH9A 3WTVC 1R1TA 2DQRA 1Z9CA 4ENJA 4EV0A 3N4MA 3ML6A 1TQPA 5K1YA 3V8KA 4O5VA 2RC4A 5E8GA 4TV7A 2FF4A 2UXXA 2LF7A 2O0YA 3FMRA 4ENMA 4L18B 1I1GA 3CUQA 1V3FA 2VBYA 3ROUA 1H9TA 3K2ZA 2PG4A 1R23A 3J80Z 2DPDA 2HWVA 2V1UA 2ZMEB 2VOPA 2WC2A 1U5TA 2ZFWA 2RKHA 4I01A 4HQEA 1YTYA 3IWZA 1R36A 4ESJA 2PMUA 2RVCA 4EJTA 2VODA 1FP2A 3ZMUA 1SD6A 3ZP5A 1IN8A 5CYVA 3E5UA 4HZFA 5HS8A 3KE2A 4G9YA 4BXUA 3F6OA 1B6AA 2BGCA 3KZYA 1OR7A 2L54A 4I2OA 1ON2A 4HV6A 3VODA 1ZARA 1F5TA 3BPXA 3BOQA 1MKMA 5HLHA 2W57A 5E8IA 3BY6A 5LHIA 2VONA 1SFUA 3CJNA 4OIQF 4ETSA 5FLXZ 4HF1A 4MGRA 1GXPA 1IXCA 4L5JA 5J8FA 1KA8A 3DF8A 3TOAA 3DP7A 2VBZA 2MLGA 3WE3A 5AIPA 1R22A 2XIGA 1JHHA 3ULQB 2GA1A 2OZUA 1JHFA 2PFBA 1FBSA 3GX4X 2COMA 2GA2A 5FB2A 1K6OA 2FOKA 4A5NA 1IUYA 1FYLA 1BM9A 3R6SA 3IKTA 4UVAA 2K02A 3RKWA 4YG2F 5CVUA 4KFCA 3KP6A 3F8NA 1G3SA 2NNYA 2IW5A 1W7PB 2ZNYA 3SFZA 3V7SA 1WKMA 2E1CA 5DD4A 1R5HA 2HS5A 1TTYA 3VOEA 3CUQC 3FWEA 4HLYA 3HYIA 4MQVA 3CLOA 4WF2A 2YR2A 2MC3A 3K1NA 3L7WA 4DQ2A 3KZZA 3DKWA 3FXUA 5CVRA 1J5YA 1FX7A 5D8KB 5L3GA 1STZA 2L3DA 4HOBA 4IRGA 2QQAA 4WX9A 2PBIA 1S6LA 3K1PA 3JW4A 3MQ0A 2XV4S 3C18A 4HX7A 1ZRFA 3G3ZA 4A0YA 1FNNA 3LA7A 2RGVA 2P5LC 4A6EA 1ZGAA 2BE5F 1J0RA 3GLXA 1P4AA 1K78A 3SZTA 2GXGA 4AWXB 3WTUC 2QBYB 3RKXA 1IRGA 2VT3A 2GWRA 5H6QA 3BDDA 3P9IA 3ZMZA 5LGNA 3TO9A 4HDUA 4I98B 3I71A 2DLLA 2P7VB 2NNNA 1J9IA 3KP5A 3E6DA 3I59A 3U1DA 2Y48A 5LHHA 5IT3A 3AAFA 5FFXA 1WRJA 4NB5A 2VOOA 1TW3A 4RAYA 3QAHA 2WTEA 3F72A 3V8LA 5LHGA 3HUGA 1MJ9A 3R0JA 3TO6A 4ENNA 3WE2A 1SAXA 1KU2A 3KEQA 3TQNA 3DFGA 1D3YA 1IN4A 1O3SA 4UV9A 5LRSA 3F3XA 4OU0A 1EH6A 4IRHA 2Z5UA 3JAMK 3WTSC 3E6MA 2KJBA 5ICFA 2HFHA 1WQ2A 1E2XA 4FX4A 3IRRA 1MDMA 2DAOA 5BOXA 4WXCA 2XKOA 1DUXC 4M9SA 2QQBA 1HQCA 1T39A 3ZPLA 1OKRA 2GXBA 3K0LA 1KU3A 4LB5A 4UV8A 3ERED 5ERIA 2QWWA 3JTHA 4KNYA 2CGPA 1YQAA 1AWCA 4EJWA 3QRFF 1VTNC 2OAZA 3K1MA 3M1EA 1W7PA 5HLIA 3HOTA 2A69F 3TDUC 3D0SA 3WODF 5BPIA 1U78A 1OMIA 2K86A 1LQ1A 4NHJA 2FMLA 1QNTA 4GO1A 2BYVE 3IC7A 2JSCA 2EB7A 1Y0UA 1V4RA 2STTA 2HGCA 5HOOA 1F9NA 1ZYRF 2O6GE 4RGRA 1HW1A 2ELHA 2LNBA 2YX7A 4UVBA 2X0LA 4AIHA 3SQNA 1ZG1A 3NQOA 1LVAA 3IRQA 3FM5A 3IWFA 1FYKA 2M5WA 2XRNA 4O3MA 2WWYA 2P4WA 3HHGA 3S2WA 3TOBA 2IRFG 1SFXA 2DU9A 1F1ZA 2UXNA 1ZLKA 3P9KA 4LFUA 4EM1A 3CO6C 3QU6A 2MBFA 5HS7A 1LNWA 3F6VA 1L0OC 4BHCA 1BI2A 4N9HA 3I53A 4G7OF 2P8TA 3F21A 2JPCA 3I0TA 1O3TA 2V79A 4XRFA 2M45A 1XMKA 3L9FA 1HSTA 3B02A 4KIFA 4CHUA 1ZAOA 2NAZA 4KIGA 1KQ9A 1K7AA 2ESNA 1XSVA 1YYVA 3HTUA 2HOEA 2IVMA 2A07F 3I4PA 4U0VA 1KU7A 1XGMA 3ISPA 4ZH4F 2A6HF 4A12A 3LWFA 4FHTA 2DQLA 3LAJA 1G4DA 3T5XA 4HX8A 1UHMA 2EK5A 2XAHA 1IN7A 1GVJA 4HW0A 4LK1F 1C0WA 3KLNA 2VN2A 4PDKA 1BJAA 2IPQX 5A2QZ 3LSTA 2YU3A 4KYWA 3N97A 2ADUA 1FBUA 2Q0OA 3GO5A 4ASNA 4PGHA 3WTXC 1ZG3A 3DPTA 2D1VA 5D4SA 4L9NA 4LMYA 4KUMA 4LLGF 1ZH5A 1HW5A 1BC7C 1FYMA 4P9FA 5JHUA
chains in the Genus database with same CATH superfamily
1KYWA 3OYMA 4BGDA 5ICCA 2YX4A 3ONQA 1R5GA 2Y69H 3BP8A 3ZN0A 3MCZA 1RI7A 4BNCA 3VPRA 4ZZLA 2E35A 1IN5A 2BVMA 4OWRB 4UY8I 3G2BA 1SEUA 1A6IA 2CV1A 1WFXA 5E18F 1ZGJA 3ZQLA 3QP5A 2VT2A 4DZPA 3GYHX 3BPVA 1MBKA 1ODDA 2FXAA 2Y2ZA 3EUHC 2DA2A 1WVRA 3FZVA 3HOVJ 1BI1A 3BZCA 1ONVA 4DYQA 1Y1WJ 1U5TB 1ZG5A 4Y3OA 4N4NB 5A2QK 1BBYA 3HJEA 3M9AA 5GAGJ 4A2UA 4OIOF 1FOYA 4IEJA 3CD6I 3ZMDA 1ETKA 4BKXA 1XS9A 2XASA 1NK2P 3C3WA 5ILSA 1GV2A 4IOAF 1PDNC 3ABUA 2EV0A 2BY0A 3CUQB 3DEUA 3K4NA 1TWFJ 4BJ6C 3Q3SA 4BE1A 4RAGA 5CJ9A 3ZMSA 2A5WA 3IV5A 3AG4H 3MWMA 3E97A 2LC2A 3GTQJ 1POGA 3ZN1A 5FJ8J 4MEXF 2EZKA 4L5EA 2CMPA 3B6AA 4YIFA 4OINF 3K6GA 2ECCA 3M8FA 2DPUA 4HLXA 1FTTA 3CP8A 1V5EA 2V4JC 5C4XJ 1OR7C 1ZKGA 4CZZA 1YS7A 1MDMB 5F64A 1BW5A 2UWMA 2P5VA 3SFIA 2ZB9A 2LR8A 3A4CA 1HKSA 4ENKA 1XX5A 4KICA 2QVOA 1VQ8I 3PSFA 2E7WA 5LEKA 2F5VA 2MABA 2VKDA 5FFZA 5EJCA 1X1AA 2VASA 1D1AA 2QA4I 4UNOA 1UFMA 2NRAC 3TP3A 1VQLI 3W2AA 4BS9A 2NS8A 2M1BA 5IT9K 2Z3YA 3M7GA 3VEPA 4HRIA 3IHUA 3LFKA 5IOZA 3HSFA 4M72A 4EM2A 3AG2H 3DEEA 2E1MC 1MNMC 1BOAA 1PP8F 4D1QA 3WGIA 2XF5A 4ZYHA 4UVCA 2ECBA 2VB6A 1YHQI 1CGPA 1MJBA 2IT0A 2CW7A 4O6JA 1IO2A 1H0MA 4PJLA 4YFKF 1G3TA 1P7JA 1UG2A 1D5YA 2MC4A 3RZOJ 2X1CA 1KU9A 1GLNA 3HRUA 3FHZA 1T6SA 4IHTA 2WV1A 4ON0A 2Y0MA 4P5OA 1T0FC 3GFLA 2EIMH 2LKSA 2EILH 3ECOA 4CUGA 3CDIA 1BW6A 3HEFA 4IQ4A 4M3DA 2P6TA 4BQAA 1I1SA 1DP3A 2LBFB 3I9V2 4KT6A 2CV2A 4AU7A 1QZZA 2QKLB 4FETA 4A0XA 2QEXI 1XB4A 3E3VA 3O3KA 4EVIA 4U7DA 2W4SA 5F27A 4RM3A 1ETVA 2H6CA 1G6NA 1OJLA 1MJAA 4Q48A 4MNUA 3E6BA 2PI0A 2XGXA 2WAEA 5D5UB 2Z16A 2TDXA 4UUVA 3CUOA 2FRHA 2AQFA 2O3FA 3ABLH 3ZCOA 1V5GA 4U0WA 3CMAI 1XTAA 2WY8Q 3DLLF 2IGNA 5M5WJ 1O7FA 2L7ZA 4I02A 2EFPA 4JX5A 4AIKA 5BNGA 3ZMTA 4M9ZA 1SD7A 4DNCA 2Z9OA 2HTJA 4UUTA 3H9GA 3REOA 4HAMA 3KIOA 4A3GJ 4PZJA 4F3QA 3GW2A 2VE9A 5KK1A 1ULYA 1ZK8A 3MEXA 3FIWA 4JX6A 2CO5A 1G3YA 2KHMA 2HEOA 2A5YB 1SMYF 2QGUA 3KEYA 1HW2A 3WG9A 2Q8KA 1J75A 4FT8A 3RJPA 2VQHA 2K40A 5L3FA 4A3DJ 1LEBA 1J59A 2DI3A 3J81Z 1HLVA 2OTLI 2QQ9A 2W7NA 3CMYA 4HV5A 4M3FA 1YJ9I 2R92J 3S1QJ 2FNAA 3LSJA 1PUFB 1Z7UA 5CVJA 4IJAA 3CTAA 4RDUA 3ASNH 4F91B 2XAQA 3IAM2 2CV0A 2K27A 2PLYA 1PP7U 4CYCA 3OIQA 2W84A 2IJLA 3PFIA 3QPHA 3H9QA 4L0ZB 5KCMA 1XCBA 2D2WA 2EINH 2IAIA 1QO0D 3L2WA 2GLOA 3RKYA 1R5ID 3KCCA 1EA3A 5AONA 5FRMA 4JBAA 4AC0A 2UZKA 2LRDA 1QBJA 4HYEA 2OQGA 4R8HA 4L5IA 2X6XA 1LDJA 3U1KA 3K10A 4CO8A 3ZMVA 1HDPA 2P6SA 2ZKZA 3W3CA 3L09A 4RB3C 2PMHA 5EYRA 2F5DA 2PN6A 1D0XA 2F2EA 2Z1DA 3BTCA 4BQOA 1JGGA 2L4AA 3J81K 1DU0A 3C1DA 3IL2A 3DTKA 4MO7A 4MEYF 4E7SA 1CQTA 2GIVA 1U3EM 4IHSA 2XAJA 1ZLJA 3FKIJ 2V9VA 3ECHA 4CGZA 1R1VA 1FJLA 1MBGA 3HDDA 3CO7C 2EV6A 5LGTA 2KRCA 3MZ8A 3FXJA 1O57A 2GBYA 1WI3A 4IQJA 2AXTC 3BJ6A 3HRMA 1J2XA 2WA0A 5DTDA 5JVTA 2M34A 3BTLA 1Z05A 4Y33A 2QUFA 2V9KA 3OYFA 4I0AA 2XVCA 1I27A 3T8TA 4M6YA 5FLVA 1X19A 1R49A 3D5LA 1JT6A 2Q2EB 3IH2A 4LK0F 3I55I 3M3YJ 1Z7LA 2FX0A 2ID3A 4AYBA 5E1XA 2NYXA 4ZYAA 2RAEA 3W2VA 3C2HA 3AL0B 3BR1A 3FM3A 3G6EI 1LJ9A 1Q1HA 2XAGA 1YIOA 5DCMA 3HSEA 5DDGA 2EV5A 5IP7J 1L3LA 2E2JJ 2VBXA 3SZGA 3MAJA 2HKXA 2W82A 4QPQA 1U8BA 3ZRGA 3DV8A 1ETYA 4YRVA 2WV0A 1ZRCA 4YIIA 3G4SI 1R58A 1OYWA 4QWQA 4FQGA 2VBWA 1WJBA 3HRSA 4ZDPA 2JMWA 3OMYA 5C4JJ 4ANJA 2ZBKA 4BY1J 4IRIA 1REPC 4MHGA 1TWHJ 1XSDA 2KLOA 3V42A 2Y9ZA 3H5NA 3QU3A 2LY9A 1WWXA 3RYPA 2V1XA 1IUFA 2ISYA 1GHCA 5F6FA 4YFNF 2X9DA 2IA2A 3HKZN 4EJUA 2E5NA 3S32A 5KNLA 2XB0X 3P9CA 3VSLA 4XLFA 4XKBA 2DJNA 2L9RA 3OV8A 5LBQA 1UCRA 2EFOA 4FCYA 4ZZDA 3QYEA 4E7LA 3S3OA 2O8XA 3HXLA 3SEZA 1NK3P 1D8KA 2JTVA 2LOOA 1IDZA 2CFXA 3PNVA 4I0BA 5DCFA 4F92B 1HOMA 2JJ7A 4JQFA 1FSHA 3R0AA 1XN7A 2DA5A 3S15J 2XF7A 2GZWA 4I6ZA 4E7KA 1HBXG 1X1PA 2G7UA 1UG0A 4RA2A 4GYIA 5E3MA 1H9GA 5M3FJ 1PYVA 1ZTRA 3FXOA 1RETA 1LB2A 3KYDB 3K7AJ 1I39A 2FBIA 3R4KA 5M3MJ 1K4SA 3O8GA 3CCYA 5FO5A 2VKHA 1P92A 2LFBA 2NVUB 4RAZA 1P4WA 3DCFA 3O2PE 3CP2A 1GT0C 4RB2C 3FF5A 1YLFA 4BJTA 2V1NA 3GEZA 4BJ5C 5M5YJ 3BZ6A 2KJCA 2RDPA 4UUSB 1ITYA 1E17A 2XGCA 3OYKA 1EJ9A 1APLC 5HDNA 4BEHA 1EKEA 2CH0A 2R7FA 4C30A 1JI8A 4CCKA 2F5CA 3FKJA 2YU9J 1XD7A 2E1OA 2M8EA 3J7ZI 2L4MA 4EJVA 1B9NA 4HX4A 1KYZA 4UXNA 3RPUD 4Q4ZF 4HPQA 4IL6C 1BJZA 3OSGA 5FD5A 1TNSA 4UHTA 3BJAA 3FXKA 3I58A 4G6DA 3BTIA 5D6EA 3JR9A 1VQKI 3UR3C 4PJMA 1LEAA 3OOUA 5EEHA 3VYUB 4MTDA 2L02A 4I09A 3O6BB 3KP3A 3U2RA 1LVKA 3F22A 2L0KA 3CJRB 2DW4A 1D1BA 4LJZF 2HYFA 3CESA 5E20A 2AS5F 2XDVA 3E0JB 2HKOA 4RB1A 1JKRC 3CF5F 2CW0F 3KP2A 4PUSA 3D5RC 2HPMA 4A3BJ 3S14J 4II2A 2IP2A 4FE7A 5ILVA 2FQ3A 2OTJI 2MA3A 2QF7A 4CH7A 3LQQA 2LDUA 4XRSA 2XB5A 2F6CA 1JE8A 1ACIA 4S05A 4LG0B 3DTEA 1XGSA 2MSYA 3BTJA 1WGXA 1GVDA 3B73A 3LA2A 3EYYA 1W5TA 4GGGA 1U6GA 1X2NA 4NQWA 2DFEA 3V4GA 4IPAA 1T98A 2NOJB 2JT1A 5KHDA 5C44J 1ZN2A 2OCEA 4MQ9F 4F55A 2WAQN 1PUEE 1W0UA 3TDZC 4IZZA 2ME0A 5FROA 5HVQC 5JI6A 4IXAA 5FRNA 3FXRA 1FIPA 2QYOA 2PX9A 1VQMI 2NVXJ 4MTEA 3PJRA 4G8XA 3E5QA 2C6YA 5AIQA 2V1DA 3QP6A 4LG0A 2ISZA 5JVGF 5DM7F 2IXSA 2EIJH 2HDCA 3EUHA 2HXOA 2JA6J 3PIOF 1FOXA 3C2GA 3WU1B 5GAEJ 3LSMA 3DTIA 1VF9A 3GF2A 2BOLA 3QQAA 4BQQA 1XCVA 5L3CA 5EG0A 4H0EA 4LOCA 1DGWY 1P4XA 2DTZA 1T38A 1VQPI 1GV5A 3HOZJ 3ZQFA 2FSWA 2E19A 1Y1VJ 1JGSA 5FKKA 2KP6A 3LL7A 4XQFA 4Y4RA 4FTHA 4A3IJ 2MD5A 4XM3A 1O3QA 1AOYA 5B3SH 2MD0A 4CZCA 2CQQA 2FBKA 5H20A 4LIVA 2K9SA 4XBFA 4A3KJ 2FQ4A 3SHFA 2M30A 2DMPA 3GZ6A 1VI0A 1WPKA 4FX0A 1BA5A 4KA4A 5JLXA 2DK5A 5E1ZB 2OQRA 4QLCU 5EZGA 1WZ2A 2H8WA 4A6DA 4DYCA 5DS9A 1V54H 3BWGA 5D5WB 3RPQA 4XIDA 2OZ6A 3EUKL 4XLPF 1TQIA 1AKHA 4K2EA 1YI2I 2KRHA 1JKPC 2V9PA 3BR2A 4LD5A 2XPVA 4XLAA 2XPWA 5TRDA 5KVRA 1WJDA 1I3QJ 4HSTA 2DDAA 3LMMA 4L9JA 5D6FA 3U9GA 1IF1A 5LRRA 5CVIA 1ZREA 2WB1A 3CC2I 2OU2A 2CFOA 4NC8A 4BHPA 2PQ8A 1HA8A 3ABKH 4E7HA 1R7JA 4DBRA 4M3GA 2DTRA 3KETA 2JQ7A 2BXYA 2HTSA 2HQRA 3P5JA 1Z1DA 4PGGA 2MH9A 1ETQA 3F8FA 2VIXA 5ICGA 3A01A 1IJWC 2RV8A 2TCTA 5BQTA 2KQRA 5FGMA 1FSEA 2NS0A 3PQKA 3L2RA 2ZO4A 2FNPA 1I6XA 1IN6A 4ZTJA 3KP4A 3S1RJ 2CG4A 3A2KA 1J7KA 2VPRA 1W5CC 3IUOA 3BR6A 3EQLF 5JLWA 2R4GA 2VXZA 1RNLA 3EDPA 3BG7A 4GXOA 1V55H 2DN0A 1FT9A 5J1YA 4AYBN 2K4BA 2AXLA 1VQ7I 2O5RA 2KMUA 3S2DJ 2DT5A 2BV6A 5GP9A 5CPRB 4IVNA 3OIOA 1Z6RA 2DYSH 4ITVA 3RPUA 1TBXA 1IAWA 2ZXJA 2H6BA 3JRDA 3ABTA 2A3SA 3QPLA 4L0YB 3K4CA 3JRAA 3RZDJ 1RZ4A 4U0YA 1UZCA 3DQVC 3V7RA 4NUBA 3TKYA 2K9MA 3HZJA 4RLFA 2W85A 2M3AA 1RUNA 1I5ZA 3JREA 2LK2A 2RN7A 5HNFA 4HG2A 1FBQA 3BZKA 1JJ6C 1MSEC 4GYGA 4JOMA 2STWA 2K3FA 2E34A 1JKOC 3I59B 3RI4A 1G59A 5J3LA 2R3SA 1BIBA 3WTZA 5B1AH 2Q1ZB 2HQNA 4NNJA 4A5MA 2K9LA 3PUFA 4KMFA 2J5OA 4LB6B 1IRZA 5C3EJ 2YSRA 2F5FA 1FP1D 3N05A 2DT6A 3TP0A 2X4HA 2QZ8A 3HKZA 1XDUA 2COBA 4P1WA 3T8RA 1MSFC 1SD4A 3MN2A 2R7DA 3Q0WA 5DYMA 1F4KA 5ED4A 4L9VA 4HF0A 2JWTA 4A3CJ 1NHAA 2JA5J 3S16J 2L9SA 4KITB 3H3UA 1TW2A 3QWLA 1XGNA 3LOCA 1P6RA 2OA4A 2YPRA 4IF4A 1I3AA 2O61A 4CCMA 2GOMA 3LSKA 1OCTC 4E4HA 3J7AY 3KEOA 1W36D 2NVYJ 3NWTA 4MFEA 3FBIB 3PUBA 2KDZA 2IA1A 3JRGA 3F0CA 2CS3A 1R6RA 2EFNA 4M6XA 1TP4A 1WJEA 2K4JA 3WU0A 1B4AA 4N0BA 1TT0A 3TO7A 2D5VA 3OOPA 1YW9A 1K61A 3ZQ7A 5IOYA 2K7LA 2L7FP 1MMGA 2KT0A 2CWEA 4HBLA 4L9TA 2DA6A 5JFRA 5F1RA 4NBQA 2FMYA 3A0BC 1YIJI 2H1KA 1XMAA 1QPIA 1FOWA 4X1EA 2P81A 4M73A 1S7AA 1U2WA 3WTTC 4Y13A 2EA4A 3MKLA 5D5VB 4RM2A 2HQ5A 2H09A 2Y0SA 3I56I 1S8NA 3J7YJ 4BEHB 1OISA 4PJNA 3Q0UA 3R61A 4ZDOA 1B1BA 3A03A 4BQNA 2BBYA 2XROA 1RUOA 4R79A 2P7CB 1HCRA 4HDVA 3WGHA 4CSWA 5GADJ 3MFKA 4G6TB 5D4RA 3ZGKA 2EJRA 3TBIA 2O03A 1OCCH 4AVPA 4II3A 2VC1A 5K5RA 4WXDA 2JVGA 1B9MA 3NRVA 2W00A 5EGOA 1QGPA 3VDXA 4KN4X 5HLGA 1MBJA 4JK1X 2PEXA 3HTSB 3M8JA 2B0LA 3A0HC 1S7OA 1TL8A 4JYKA 2XAFA 3H92A 4HNTA 1B72A 2NVQJ 3JRBA 1Y39A 1EH8A 5CLSA 1Y0NA 4M74A 1QU3A 3JRIA 3QYBA 3CCRI 4AUXA 3CDHA 4HQMA 4PK4A 2FE3A 5GPCA 2EWNA 1TQMA 5K7HA 3RYRA 2OCCH 1QZYA 4DBQA 1ETOA 3HG9A 4S04A 2R7VA 5J4VA 3H3ZA 1CF7B 1U0JA 1MH3A 3ZXSA 4ZYDA 3MZYA 2DA7A 3GFIA 3QOPA 2HU9A 1X3UA 1USSA 5F1JA 4CCOA 2HR3A 5DUKA 1HKQA 1U9NA 3CCJI 2ACJA 3RSNA 2IA0A 4BYYA 2Y75A 2QM3A 2DCEA 2QSFX 4NQWB 5TGTA 2JZYA 4M9XA 1LE8B 4XN0A 1ON1A 5FKLA 4C2MJ 1FPQA 4EM0B 4BDYA 2CRGA 3EPZA 2VUMJ 4LIUA 4I99C 2V26A 4RB0A 3ZOBA 4BL0B 5FLXK 5D5XB 2RNJA 3L2QA 9ANTA 3H5RA 2BXZA 2VQCA 3FXLA 4BE0A 2FBHA 3CCQI 2XKPA 2KIMA 2Z99A 4LLNA 2UV1A 1WH5A 4E7JA 1OCRH 3JSPA 1BI0A 5EEGA 4CICA 5IYDJ 2E36A 1QQIA 1SD5A 2E7XA 2DT7B 1ZQ3P 2KIQA 2KKOA 3M07A 3Q9VA 4KIBA 3CC7I 4EATA 1FOKA 4N4OB 4PFOA 1UJ8A 4A0ZA 1S7EA 4I76A 1Z6TA 2WY7Q 1O3RA 1YRNB 1AU7A 1YE9A 2X85A 3G71I 2IS2A 3WTWC 2KL4A 2H27A 3J80K 3RTRA 1WSUA 2CQNA 3JRFA 4IHXA 4RAFA 3GBGA 3I54A 3ZQHA 1N25A 3JTGA 2KIFA 5IP9J 1Q1VA 1T95A 2MG4A 4OIRF 1S9HA 1SFEA 1Y8QB 4RGXA 3A1YA 4PSWA 1K4TA 1LUJB 1G3WA 4F93B 3G73A 2XGDA 3GFMA 4BXFA 1MBFA 1YG2A 3CCLI 2VJ5A 1R71A 1UHSA 1OYIA 3CC4I 3J7AO 3WGGA 1G2HA 4U88A 3BT9A 5EG0B 1SVMA 1DPRA 2OV7A 2RREA 1W36C 4FISA 4AD9A 1R9TJ 3CCMI 2VQGA 4CXFA 3GTJJ 4OMZA 2QLZA 3TGNA 3CCVI 4F7ZA 4KISA 5K5OA 4N9IA 4EMSA 4BAYA 1XGOA 4CCLA 3VB2A 1QPMA 1KGSA 2QSGX 4WWCA 2HYGD 4G12A 1D8JA 3KP7A 2LREA 3IH3A 4YEJA 1FC3A 2PMZN 2W25A 1W7PD 2NS7A 1Z0XA 3FXMA 2QKMB 1YO5C 1LFBA 4M71A 2LF8A 3BCAA 4V2FA 1JTYA 4LITA 3HOSA 2EFWA 3LA3A 4EGYA 2FU4A 3G1MA 3S1NJ 2R7TA 3R60A 2ETHA 4C3JJ 4BXXJ 3F8BA 5ILUA 1Y56A 2L01A 3GVAA 2PJRA 4B8XA 3HGYA 3M8EA 3I5UA 1UMQA 3FMSA 1YW8A 4WXHA 4C2UA 3DU5A 2FOWA 3G1OA 1FWZA 1YITI 4OMYA 3FXQA 1IXRC 1UHWA 3K70D 5DCMB 5EGOB 4AIJA 4V19K 2KIUA 2MLKA 1JXSA 2DFIA 1OCOH 1TWAJ 5LEJA 5L3DA 5K7FA 3HHHA 1FY7A 5IT9Z 3S3NA 3D1NI 1MMNA 4V2GA 4XRSG 4ESFA 2E1NA 3FMQA 4C9YA 1T2KA 1EH7A 3Q5FA 2EA2A 4B43A 2B7EA 4P9UA 1WI9A 5J1UA 3OYCA 2V6CA 1OYYA 2WAFA 3EETA 2HZDA 1K78B 3NEUA 2O9LA 5E17F 1BIAA 2DO7A 3GCMA 1HSJA 2GAUA 1YJWI 2X1EA 1GUUA 4UB6C 3GTOJ 5CVVA 2NOGA 2QSHX 2JSPA 3DXJF 1IG7A 2J5PA 5HDGA 4A3LJ 4MLOA 5L3EA 4CCNA 4PSXA 4Q5SF 2LKPA 5L3BA 3OYNA 4OAYA 3U21A 3F8CA 3E6CC 1QA6A 4B3XA 4ESBA 2HOSA 2KZGA 2R5ZB 2GQQA 2CQKA 5DM6F 1JT0A 3KLOA 4A3JJ 1P2FA 3MKZA 4OOIA 3GTLJ 3MKWB 1IRXA 3HB9A 3TMOA 1ZGWA 4CYDA 1LDDA 3HRTA 1GXQA 5TJJA 5GTIC 1YFHA 2W48A 3ELKA 4G7HF 2AO9A 4PCQA 4XSXF 1JJ8C 4LG3A 1P7IA 1RR7A 2RQPA 1CF7A 4ZYGA 2OD5A 5BPDA 3GXOA 2XF6A 2JUCA 3KYLA 1A6QA 2DA1A 3CDLA 1DP7P 4M3EA 1MZBA 1DDNA 2VI6A 3CCUI 2HZTA 3BG5A 3PQJA 1Y6IA 4I7HA 4Y17A 5EZHA 1FMWA 3F9KA 4RGSA 5H6RA 3SZPA 4EQQA 3HOYJ 3LNQA 2XHKA 3NWSA 3H0GJ 1W4MA 5HNHA 1IW7F 1BN5A 3RDIA 4PJ0C 1XSXA 2WADA 2IGOA 2F48A 4OIPF 2QBYA 1FLIA 1U8RA 3CF2A 2HPIA 1VQ4I 2CUZA 3BROA 2G7HA 1FMVA 2EH3A 1IRFA 2DBBA 5TISC 4MFDA 1WJAA 2BHZA 4E7IA 1PUFA 2W24A 3NAUA 4FE4A 1N77A 1B59A 2ZJQF 5DUIA 4CA0A 1HC8A 3KX2A 3CJTB 3H3VK 3C2BA 3OS1A 5ICEA 3CMEI 1EV7A 2DYRH 1MBHA 4P96A 1KZHA 2Z33A 2RQQA 3A01B 4HA8A 3HPHA 3C7JA 2F5EA 4XONA 2LSOA 4DGWB 3K69A 2EFQA 2M0MA 4BY7J 2Q2EA 1LFPA 1U5TC 1MMDA 1T0FA 4XKWA 4U87A 5J47A 3GWZA 2A68F 2MH2A 3K9TA 5DV5A 1LPQA 1TC3C 2VXDA 2PJPA 3BG9A 3FK6A 2M87A 2O7OA 5JR3A 1HDDC 4XMYA 4QIWN 3T0YA 2JA7J 1AHDP 1SFOJ 5CQGA 3GMEA 4EJOA 4GCVA 2BHYA 3L00A 4CYCB 2WB1N 4XLHA 1ETWA 6PAXA 4BBRJ 3OS2A 1JUMA 5FKMA 5BS6A 2KDOA 2L9NA 4Q47A 2BEOA 1HKTA 2R7UA 2CQXA 2M2EA 2ZNZA 3GUDA 3ZR8X 4D0PA 3L2UA 4B09A 3UKGA 1BI3A 4BACA 3LQRA 3OYJA 2FUG2 1K79A 1YW7A 3HPGA 2F4MB 4S0HB 1VQ6I 2D1HA 4BBSJ 2KRFA 4D9JA 2M7BA 2CW8A 4E70A 3COAC 4EGZA 1ZR4A 4KMUX 3RKQA 1A04A 2QCOA 4ZYEA 4CCJA 5HDKA 1OPCA 3V8JA 4LLLA 1DGRM 2E60A 3P7NA 3KFWX 3LSRA 2ZJ2A 1FIAA 2M8GX 3F8MA 4NC7A 1HF0A 3GFJA 2K5CA 2DK8A 2LKXA 2ZMEA 3T1BA 1E3PA 4NDLA 5KAFC 1XDSA 2ZCWA 3LAPA 2LVSA 1AA7A 3HOXJ 4DIQA 3JSOA 1QVUA 1T08B 3IKVA 3VFZA 4YFXF 1IZ1A 3I64A 3EYIA 4A3EJ 3K4LA 3F23A 1RESA 5B1BH 1S3JA 3SXYA 3MZHA 1TNTA 4HSRA 4FASD 4J00A 4XN3A 3IH4A 1DPUA 2FA5A 2CSOA 2HVSA 1D5VA 1BL0A 1WJ5A 5KAIC 3E5XA 4C3IJ 1KQ8A 2PMZA 3CQZJ 3HSRA 3MKYB 3V7CA 2DXIA 1X3ZB 2R93J 2XUBA 4D7MA 3D5SC 5J8CA 2P5KA 5FD6A 2EIKH 1M1EB 1ZHFA 3QODA 2VC0A 4WK8F 2O8KA 3OL3A 5DD8A 2M9HA 3MD2A 4KDPA 1ZELA 2HYJA 3WTYC 2M0CA 1JKQC 3O8HA 1KQ0A 3RIRA 2G9WA 2HXIA 2JPBA 2H94A 2QENA 3K4JA 4RS8A 4XNFA 3W6JB 2CQ7A 2Y30A 3GZNB 1W5SA 1O7LA 2IGKA 3FHNA 3HIFA 4PJJA 1IXSB 2A61A 3DBRB 4A3FJ 1QRYA 4KT5C 3AL0C 1MD0A 3GZ5A 3W2WA 2JRTA 2P0WA 4G94A 5E1WA 1S29A 3OY9A 4G7ZF 2VE8A 2OJED 5K5QA 2ZJRF 1IDYA 5LGUA 4B47A 5HS9A 4BUPA 5EEAA 1VQNI 1LDKB 1VQOI 4LGWA 2CYYA 4AIDA 2E71A 4XSZF 2BW3B 3QPTA 4P55A 4ABZA 3LSPA 2ICWG 3WU2C 3PO2J 2L9VA 1R00A 2DMQA 1HXDA 1X2MA 2YUSA 1BC8C 2YS9A 4XLNF 4U7BA 3BJOA 3X2QH 2WBMA 4HNUA 3JAMZ 1N75A 1UB9A 3PSIA 2LMDA 1BOBA 1TWCJ 3W6KB 5J6XA 2D45A 1RC9A 1BR2A 1WJCA 1SMTA 1TT5B 2ZMEC 4G6QA 4EEFG 2DMNA 2N8GA 2JVHA 1I50J 2VPLA 1RIOH 3QYFA 1ETXA 1VFCA 1RRJA 4RGUA 2X6WA 1SFKA 5D8LB 3S1MJ 3E1SA 5BMZA 4HF2A 4Y15A 2FEZA 1MGTA 3FBNB 5LLQA 2XAUA 4J19A 2L2OA 2HOTA 3FX3A 2OC6A 4BHBA 3PNTA 1G8XA 1K83J 4Z2YA 3OYDA 3ASOH 1USTA 1R1UA 3VWBA 4J01A 2UUZA 4Y7NJ 3HBLA 2E1MB 2ZC2A 2VKEA 3DPLC 1Z91A 4KN7X 4UUSA 2OBPA 5DEQA 2A6EF 4CDGA 3Q9SA 1AKHB 1ZRDA 1TLHB 3L2VA 2ESHA 1YS6A 5IYBJ 3L2CA 1FZPB 4WCGA 3DKXA 3OYIA 4BH9A 3WTVC 1R1TA 3OYEA 2DQRA 1Z9CA 4ENJA 4EV0A 2GXAA 4NC6A 3HGGA 3JRHA 3N4MA 3ML6A 1TQPA 2R7OA 5K1YA 2X6YA 3V8KA 2RNGA 4O5VA 1OCZH 2JA8J 2RC4A 4TV7A 2FF4A 2UXXA 5E8GA 5F0FA 3CCEI 2LF7A 3AFHA 2I10A 4C3HJ 2O0YA 3WG7H 3FMRA 4ENMA 3AG3H 2ID6A 4L18B 1I1GA 2F4IA 2XSJC 4DYRA 3VYSB 3CUQA 2CU7A 1V3FA 2DDBA 2VBYA 3ROUA 1H9TA 1PVEA 3K2ZA 3OIPA 3S2HJ 2PG4A 2R7WA 3HOUJ 2BY2A 1R23A 3J80Z 2AHQA 2DPDA 2HWVA 3HL2A 2JUGA 2V1UA 2ZMEB 4ZJZA 2WC2A 2VOPA 2CUJA 1A36A 4UB8C 2TRTA 1U5TA 2ZFWA 2RKHA 5GPAA 4I01A 4HQEA 1YTYA 1YX5A 3IWZA 3BR5A 3M4OJ 1H88C 1R36A 4ESJA 1WCMJ 2PMUA 2RVCA 3CZ6A 2JA2A 5IY5H 4EJTA 2LP0A 2LD5A 2VODA 2LH9A 1FP2A 3ZMUA 5E3LA 1SD6A 3BC8A 3ZP5A 1IN8A 3GLLA 5CYVA 4JP0A 1NTCA 3E5UA 1D0YA 1X1DA 4HZFA 5HS8A 3KE2A 4G9YA 3HC7A 4BXUA 3F6OA 1B6AA 3A02A 2DOFA 1S5LC 4BDZA 2EZHA 3WHBA 2BGCA 3KZYA 3OYAA 1OR7A 2ME6A 2L54A 3MMYB 3TW7A 2GOXB 2DA3A 4I2OA 1D0ZA 1ON2A 4HV6A 4X0GA 3VODA 3S17J 3OR1C 1VZ0A 3K70C 1ZARA 3HOWJ 3LFUA 1F5TA 3BG3A 3BPXA 5H2FC 3BOQA 2LY1A 1MKMA 2DFHA 2HVQA 5HLHA 1PJRA 2R7ZJ 2W57A 5E8IA 3BY6A 5LHIA 2VONA 4D5CA 1SFUA 3CJNA 4OIQF 3KYCB 2ELKA 2XGEA 1JTXA 3SYTA 3S8PA 2VJIA 2XPUA 2VL8A 4ETSA 5FLXZ 2R0QC 5M5XJ 4HF1A 5IP6A 4MGRA 5HLTA 1GXPA 2OF7A 4QTRA 1IXCA 4L5JA 5CQEA 1OCPA 2DMTA 5J8FA 1W1WE 2L5QA 1KA8A 3DF8A 3TOAA 3DP7A 2VBZA 1R4NB 4XRMA 2ZSIB 2MLGA 3WE3A 1N78A 2BY1A 3PL8A 5AIPA 1B8IB 3RQIA 1R22A 2XIGA 2M7AA 1JHHA 4B44A 3ULQB 2GA1A 2IBDA 4W97A 2OZUA 1T56A 3ZQCA 1JHFA 1F36A 2PFBA 1FBSA 2LY2A 3GX4X 2COMA 1LFUP 2GA2A 5FB2A 4BU2A 5B66C 3S3MA 4C2TA 3M1CA 2ZJPF 1K6OA 2FOKA 4IHWA 1I6HJ 4A5NA 1K6YA 1IUYA 2L7MP 1FYLA 1BM9A 3R6SA 3IKTA 1J09A 3KZIC 3ZQQA 2B63J 4XR6A 2CJJA 1EF4A 4UVAA 2K02A 3RKWA 2R7SA 4YG2F 1VNDA 2L7KA 2K3PA 1E0EA 3GTPJ 2HVRA 5CVUA 4E7ZA 2K9NA 3FDYA 4BE2A 3BQZA 4KFCA 3KP6A 1ERDA 3F8NA 1MIJA 5IPAA 1G3SA 2NNYA 1TWGJ 2IW5A 1W7PB 2ZXHA 3MVPA 2K85A 2ZNYA 3DWLE 3SFZA 3V7SA 1WKMA 3LSIA 2E1CA 4H4KC 5DD4A 3FISA 3ESWB 1R5HA 2HS5A 2DODA 4IO9F 1TTYA 3VOEA 3CUQC 3FWEA 2HDDA 4HLYA 3HYIA 4MQVA 3CLOA 2E2IJ 4WF2A 2YR2A 2Z2SB 2JK3A 2MC3A 3K1NA 1MBEA 3L7WA 5GAHJ 4DQ2A 4GFBA 1A5JA 2B9SA 4DZJA 2ZXIA 3KZZA 3SDGA 5J1RA 3FXUA 3DKWA 2GIZA 5CVRA 1J5YA 1FX7A 3WHCA 5D8KB 4Z6YA 5L3GA 3I3LA 3Q0VA 1STZA 2L3DA 4HOBA 4IRGA 2QQAA 4WX9A 2BZTA 1RR8C 1SAUA 2PBIA 4AM3A 1JUPA 1S6LA 3OR2C 1SC7A 3K1PA 1B8IA 3JW4A 4QPOA 3MQ0A 2XV4S 3C18A 3DPUA 3L1PA 5FLMJ 5F0HA 4HX7A 1ZRFA 3G3ZA 3CLQA 4A0YA 2VJJA 4B3AA 5LD2C 1FNNA 3BR3A 1MNEA 3OYLA 3LA7A 2R7XA 2RGVA 1D1CA 1T8IA 2R5YA 3AKZA 2P5LC 3G1LA 3H35A 4A6EA 5B5EC 3RCOA 3BLYA 1NG7A 1ZGAA 3CCSI 2BE5F 2MW8A 2WAQA 3OSFA 2IS6A 1J0RA 1RPWA 3GLXA 2F4OB 1P4AA 2GM4A 1RKWA 2NVTJ 1K78A 2LYCA 4IKFA 2H1LA 4ZC3A 3SZTA 2GXGA 4AWXB 3VYRB 3WTUC 3RKXA 2QBYB 1IRGA 2VT3A 5EF6A 4XL9A 2GWRA 4JX4A 1P9QC 2CUEA 1OFCX 5J4YA 4D5FA 2V6EA 5H6QA 3QOEA 4QSHA 2R5YB 3BDDA 3P9IA 4XORA 2R7QA 3ZMZA 5LGNA 1WJFA 3TO9A 4HDUA 1ZR2A 1GDTA 1X1BA 4I98B 5F04A 2MYSA 3I71A 2DLLA 2HNHA 2P7VB 2XSDC 2NNNA 4W1UA 1J9IA 3KP5A 3E6DA 4KJZA 3I59A 3S93A 3U1DA 4RLQA 3RQ4A 1UAAA 2LBFA 2Y48A 2MFZA 2LTPA 2G0EA 5IT3A 5LHHA 4YELA 3AAFA 1IV6A 5FFXA 1WRJA 4OAZA 3VYTB 4MIMA 4NB5A 2VOOA 2EBIA 1TW3A 1YRNA 2R5ZA 5JHUA 4RAYA 3QAHA 2WTEA 3F72A 1H8AC 2E5ZA 3V8LA 5LHGA 2HI3A 2ZXWH 5FKNA 1Z67A 4Y52J 4XKVA 3HUGA 2ZSHB 1MJ9A 3R0JA 3TO6A 1Z3XA 4ENNA 2EZIA 1E3HA 3WE2A 1YJNI 2HDWA 1SAXA 3OS0A 1MMSA 1SANA 3OYBA 3CJQB 1KU2A 3KEQA 1U9OA 3TQNA 2OUMA 3ZQGA 2I8DA 3DFGA 3BQYA 1S72I 2DMUA 1D3YA 1IN4A 3OYHA 2DJIA 1WHUA 1O3SA 4UV9A 3H1CA 5LRSA 3F3XA 4OU0A 1VQ5I 1EH6A 4IRHA 1X4OA 2Z5UA 2NXNB 4YIRX 5FKOA 3JAMK 2VQLA 1JUSA 4XICA 5EDNA 4X6AJ 4RMNA 3EUAA 3WTSC 3E6MA 2KJBA 5ICFA 2HFHA 1WQ2A 1E2XA 3W6VA 4FX4A 3IRRA 1NH3A 3PIPF 3PO3J 1MDMA 2DAOA 5BOXA 4WXCA 5J40A 2XKOA 1DUXC 4AVZA 4M9SA 2QQBA 3B6CA 2KPMA 2X48A 1NG6A 3LSHA 1HQCA 5CKTA 1T39A 1VQ9I 2A05A 1Z77A 3VSKA 3ZPLA 2LLKA 2BVLA 1OKRA 2GXBA 3K0LA 1KU3A 4LB5A 4UV8A 5ERIA 3OL4A 3ERED 4IHVA 2DOEA 2X6OA 3TW6A 2QWWA 3JTHA 1B72B 4KNYA 1E3OC 2KFDA 3IP4B 5E3NA 1A31A 2CGPA 1YQAA 1XPXA 1AWCA 4EJWA 3QRFF 3BR0A 1VTNC 5E79C 1X4PA 2OAZA 3K1MA 2OPTA 2IS4A 3M1EA 2IEKA 1QVTA 1W7PA 4XOPA 3E7LA 3ZQIA 1XG1A 3IAS2 5HLIA 3HOTA 2A69F 3TDUC 2KISA 3BCBA 3D0SA 3WODF 4GRIA 1LE8A 5GTHC 5BPIA 1U78A 1OMIA 4A93J 3GTMJ 3CMMA 2K86A 1LQ1A 1TZLA 2A6TA 5IYCJ 2FMLA 1O4XA 4NHJA 2VJ4A 2I5UA 1QNTA 5F0CA 4GO1A 2BYVE 3IC7A 2JSCA 2EB7A 2JRMA 3PNYA 1Y0UA 1V4RA 1W0TA 3ERMA 1IC8A 4DJAA 1H89C 2X51A 2XC7A 3HUGB 2STTA 2HGCA 3LSGA 1FEXA 3FK7A 1RKTA 3BG6A 1MW7A 4ZTFA 5HOOA 1F9NA 1ZYRF 2EZLA 2O6GE 4XKCA 4XOTA 2LG4A 4RGRA 1HW1A 2ELHA 2LNBA 2EPFA 2YX7A 1SVLA 4D7NA 4UVBA 2X0LA 4AIHA 4IX7A 3I4MJ 4XLEA 5F08A 1X3WB 2FJ1A 1FTZA 1IV8A 4GDFA 3SQNA 1ZG1A 3SDBA 2VKVA 1Z21A 3NQOA 3SEQA 4M6VA 1LVAA 3IRQA 1A35A 3FM5A 3PM1A 3H0DA 3IWFA 3I4NJ 1DQUA 2M4KA 1FYKA 2M5WA 4B1RA 1ORKA 3DBHB 2XRNA 2HOAA 4O3MA 1OLTA 3TL4X 2WWYA 2P4WA 1BC7C 2XRLA 4A69C 3UNGC 2IS1A 2M4GA 2ZFUA 3HHGA 1IGNA 3K4MA 4DW6A 2H8RA 3DKYA 3S2WA 2VLAA 4DOZA 1F43A 2FD5A 3TOBA 2IRFG 2MGQA 1SFXA 1Z3YA 2X1DA 3JCUC 2DU9A 1DU6A 1F1ZA 2UXNA 4B48A 1ZLKA 1V5FA 3P9KA 1XMXA 4LFUA 1X1CA 2Y9YA 4EM1A 2K9QA 3CO6C 3QU6A 2MBFA 3K2AA 5JHFA 3QPSA 4HNVA 3H5AA 3SJMA 5HS7A 1LNWA 3F6VA 1L0OC 1YOVB 2DFFA 4BHCA 3DU6A 1BI2A 3GTKJ 1MH4A 3I53A 4N9HA 1SVOA 1QHHD 4G7OF 2P8TA 1KONA 3H36A 3F21A 3DLAA 2JPCA 3I0TA 1O3TA 1T33A 3DBLB 2ELJA 2V79A 4XRFA 4IOCF 1UELB 3HM5A 2M45A 1XMKA 2W1OA 3L9FA 4B4CA 1HSTA 3B02A 4KIFA 4F52A 5LFAA 4CHUA 3K4BA 1Y8RB 1ZAOA 2NAZA 3DEWA 2PJRB 4KIGA 1KQ9A 1K7AA 2R7RA 2ESNA 1XSVA 1YYVA 2Y0SN 1OQYA 3HTUA 2HOEA 2E2HJ 2IVMA 2A07F 3I4PA 4U0VA 1KU7A 1XGMA 3ISPA 4ZH4F 3OYGA 2A6HF 4A12A 3LWFA 3NARA 2IGMA 2BY3A 1QZEA 4FHTA 1BR1A 3OWTA 2KZVA 2DQLA 2CUFA 4HEA2 3LAJA 1G4DA 1YX3A 4M3BA 3T5XA 3KPHA 4HX8A 4PFPA 1UHMA 2Y31A 2EK5A 2HQAA 1MMAA 3AG1H 1R4MB 3PFYA 2XAHA 5E3OA 1IN7A 4XLCA 2BW3A 1GVJA 4HW0A 1QHGA 4LK1F 1C0WA 3ABMH 3KLNA 1XC5A 2VN2A 4PDKA 1BJAA 2IPQX 5A2QZ 1ENHA 3LSTA 1X58A 2YU3A 5K7ZA 4RBOA 2V7FA 3GTGJ 4KYWA 4ZDLA 2ADUA 3N97A 1FBUA 2Q0OA 3GO5A 4ASNA 2JN6A 4PGHA 2DA4A 1WH7A 2AQEA 5HODA 3WTXC 1BR4A 1ZG3A 4IHYA 3DPTA 2DOAA 2D1VA 5D4SA 3TEDA 2EQRA 3K4KA 2QQ8A 4A3MJ 1MNDA 4L9NA 4LMYA 4KUMA 4LLGF 4XK4A 1HW5A 4E6KG 1ZH5A 3H9JA 4R1HA 1FYMA 4P9FA 3JRCA 1LKXA
chains in the Genus database with same CATH topology
1KYWA 5ICCA 2YX4A 1R5GA 3BP8A 3ZN0A 3MCZA 1RI7A 4BNCA 4ZZLA 1IN5A 5E18F 1ZGJA 3QP5A 2VT2A 3GYHX 3BPVA 1ODDA 2FXAA 3FZVA 1BI1A 1ONVA 1U5TB 1ZG5A 5A2QK 1BBYA 3M9AA 4A2UA 4OIOF 3ZMDA 2XASA 3C3WA 5ILSA 1PDNC 3ABUA 2EV0A 3CUQB 3DEUA 5CJ9A 3ZMSA 3MWMA 3E97A 3ZN1A 4MEXF 4YIFA 4OINF 3M8FA 2DPUA 4HLXA 4CZZA 1YS7A 1MDMB 5F64A 2UWMA 2P5VA 1HKSA 4ENKA 4KICA 2QVOA 5LEKA 2E7WA 5FFZA 4UNOA 1UFMA 2NRAC 2M1BA 5IT9K 2Z3YA 3M7GA 3VEPA 3IHUA 3LFKA 3HSFA 4M72A 4EM2A 1BOAA 1PP8F 3WGIA 4ZYHA 4UVCA 1CGPA 1MJBA 2IT0A 4O6JA 1H0MA 4YFKF 1G3TA 1KU9A 3HRUA 3FHZA 1T6SA 4IHTA 4ON0A 2Y0MA 4P5OA 3GFLA 3ECOA 2P6TA 4BQAA 1I1SA 1QZZA 4A0XA 1XB4A 3E3VA 3O3KA 4EVIA 4U7DA 2H6CA 1G6NA 1MJAA 4Q48A 4MNUA 3E6BA 2PI0A 2XGXA 5D5UB 2TDXA 4UUVA 3CUOA 2FRHA 2O3FA 4U0WA 1O7FA 4I02A 2EFPA 4AIKA 3ZMTA 4M9ZA 1SD7A 4DNCA 2Z9OA 2HTJA 3REOA 4HAMA 4PZJA 3GW2A 2VE9A 5KK1A 1ULYA 3MEXA 2CO5A 1G3YA 2HEOA 2A5YB 1HW2A 1SMYF 3WG9A 2Q8KA 1J75A 4FT8A 3RJPA 5L3FA 1LEBA 1J59A 2DI3A 3J81Z 2QQ9A 4HV5A 2FNAA 1Z7UA 5CVJA 4IJAA 3CTAA 2XAQA 2K27A 2PLYA 1PP7U 2W84A 2IJLA 3PFIA 3QPHA 4L0ZB 1XCBA 2D2WA 1QO0D 3RKYA 3KCCA 5AONA 4JBAA 2UZKA 1QBJA 4HYEA 2OQGA 4R8HA 4L5IA 1LDJA 4CO8A 3ZMVA 2P6SA 2ZKZA 3L09A 4RB3C 2PMHA 2F5DA 2PN6A 2F2EA 2L4AA 3J81K 3C1DA 3IL2A 4MEYF 2GIVA 1U3EM 4IHSA 2XAJA 1ZLJA 2V9VA 3ECHA 4CGZA 1R1VA 3CO7C 2EV6A 5LGTA 1O57A 3BJ6A 3HRMA 1J2XA 5JVTA 1Z05A 2QUFA 4I0AA 2XVCA 1I27A 3T8TA 4M6YA 3D5LA 4LK0F 5E1XA 2NYXA 3FM3A 1LJ9A 1Q1HA 2XAGA 1YIOA 5DCMA 3HSEA 5DDGA 2EV5A 1L3LA 2VBXA 3MAJA 2HKXA 3DV8A 2WV0A 1ZRCA 4YIIA 1R58A 1OYWA 4QWQA 2VBWA 3HRSA 2ZBKA 4IRIA 1REPC 4MHGA 1XSDA 3QU3A 1WWXA 3RYPA 2V1XA 2ISYA 1GHCA 5F6FA 4YFNF 2IA2A 4EJUA 3P9CA 3OV8A 5LBQA 1UCRA 2EFOA 4ZZDA 2O8XA 1D8KA 2JTVA 2CFXA 4I0BA 5DCFA 4JQFA 1FSHA 3R0AA 1XN7A 2GZWA 1HBXG 2G7UA 4GYIA 1H9GA 1LB2A 2FBIA 3R4KA 5FO5A 1P92A 4RAZA 1P4WA 3O2PE 4RB2C 3FF5A 1YLFA 3GEZA 3BZ6A 2KJCA 2RDPA 1E17A 5HDNA 2R7FA 2F5CA 1XD7A 2M8EA 2L4MA 4EJVA 1B9NA 4HX4A 1KYZA 4UXNA 4Q4ZF 5FD5A 1TNSA 4UHTA 3BJAA 3I58A 4G6DA 5D6EA 1LEAA 5EEHA 4MTDA 2L02A 4I09A 3O6BB 3KP3A 3U2RA 3F22A 2DW4A 4LJZF 2HYFA 5E20A 2AS5F 2HKOA 4RB1A 2CW0F 3KP2A 2IP2A 5ILVA 2FQ3A 2MA3A 3LQQA 2LDUA 1JE8A 4S05A 4LG0B 1XGSA 3B73A 3LA2A 3EYYA 1W5TA 4GGGA 1U6GA 4NQWA 3V4GA 4IPAA 1T98A 2JT1A 1ZN2A 4MQ9F 1PUEE 3TDZC 5HVQC 5JI6A 4IXAA 3FXRA 2QYOA 4MTEA 4G8XA 3E5QA 2C6YA 5AIQA 2V1DA 3QP6A 4LG0A 2ISZA 2HDCA 3EUHA 3WU1B 3GF2A 1XCVA 5L3CA 4H0EA 1P4XA 1T38A 2FSWA 1JGSA 1O3QA 2MD5A 1AOYA 2FBKA 5H20A 4XBFA 3SHFA 2M30A 3GZ6A 4FX0A 4KA4A 2DK5A 5E1ZB 2OQRA 4QLCU 4A6DA 3BWGA 5D5WB 3RPQA 2OZ6A 4XLPF 1TQIA 4K2EA 4LD5A 5TRDA 5KVRA 5D6FA 4L9JA 3U9GA 1IF1A 5LRRA 5CVIA 1ZREA 2OU2A 4BHPA 2PQ8A 1R7JA 2DTRA 3KETA 2HQRA 2HTSA 1Z1DA 4PGGA 2MH9A 3F8FA 5ICGA 2RV8A 5BQTA 5FGMA 1FSEA 2NS0A 3PQKA 2ZO4A 2FNPA 1I6XA 1IN6A 3KP4A 2CG4A 1J7KA 3EQLF 2VXZA 1RNLA 3EDPA 4GXOA 1FT9A 2K4BA 2AXLA 2DT5A 2BV6A 4IVNA 1Z6RA 3RPUA 1TBXA 1IAWA 2ZXJA 2H6BA 3ABTA 2A3SA 4L0YB 1RZ4A 4U0YA 3DQVC 3V7RA 3TKYA 2W85A 1RUNA 1I5ZA 2RN7A 1FBQA 4GYGA 2STWA 3I59B 3RI4A 2R3SA 1BIBA 3WTZA 2HQNA 4A5MA 4KMFA 2J5OA 4LB6B 2YSRA 2F5FA 1FP1D 2X4HA 2QZ8A 1XDUA 3T8RA 1SD4A 2R7DA 5DYMA 1F4KA 5ED4A 4L9VA 4HF0A 1NHAA 3H3UA 1TW2A 1XGNA 1P6RA 2OA4A 2YPRA 4IF4A 2O61A 3KEOA 2IA1A 2EFNA 4M6XA 2K4JA 3WU0A 1B4AA 4N0BA 3TO7A 3OOPA 1YW9A 3ZQ7A 2K7LA 2CWEA 4HBLA 4L9TA 5JFRA 5F1RA 2FMYA 1XMAA 4M73A 1S7AA 1U2WA 3WTTC 4Y13A 2EA4A 5D5VB 2H09A 1S8NA 3R61A 1B1BA 2XROA 2BBYA 1RUOA 4R79A 2P7CB 4HDVA 3WGHA 3MFKA 5D4RA 2EJRA 2O03A 4AVPA 2VC1A 5K5RA 4WXDA 1B9MA 3NRVA 1QGPA 4KN4X 5HLGA 4JK1X 2PEXA 3HTSB 2B0LA 1S7OA 2XAFA 3H92A 1EH8A 5CLSA 4M74A 3CDHA 4HQMA 2FE3A 2EWNA 1TQMA 3RYRA 1QZYA 4S04A 3H3ZA 1CF7B 4ZYDA 3MZYA 3GFIA 3QOPA 1X3UA 1USSA 2HR3A 5DUKA 1HKQA 2ACJA 2IA0A 4BYYA 2Y75A 2QM3A 2JZYA 4M9XA 1ON1A 1FPQA 4EM0B 4RB0A 5FLXK 5D5XB 2RNJA 2FBHA 2XKPA 2KIMA 2Z99A 4LLNA 3JSPA 1BI0A 5EEGA 4CICA 1QQIA 1SD5A 2E7XA 2KKOA 3Q9VA 4KIBA 1FOKA 4A0ZA 1Z6TA 1O3RA 3WTWC 2H27A 3J80K 3RTRA 1WSUA 3I54A 3JTGA 2KIFA 4OIRF 1SFEA 4RGXA 1G3WA 3G73A 3GFMA 1YG2A 3J7AO 1OYIA 3WGGA 4U88A 1DPRA 4AD9A 4CXFA 4OMZA 2QLZA 3TGNA 4F7ZA 5K5OA 4N9IA 4EMSA 4BAYA 1XGOA 3VB2A 1QPMA 1KGSA 4WWCA 2HYGD 1D8JA 3KP7A 1FC3A 2W25A 1W7PD 1YO5C 4M71A 2LF8A 3HOSA 2EFWA 3LA3A 4EGYA 2FU4A 3R60A 2ETHA 3F8BA 5ILUA 2L01A 3GVAA 4B8XA 3M8EA 3I5UA 3FMSA 4WXHA 1YW8A 1FWZA 4OMYA 3FXQA 1IXRC 1UHWA 5DCMB 4AIJA 2KIUA 2MLKA 1JXSA 2DFIA 5LEJA 5IT9Z 5L3DA 3HHHA 1FY7A 4ESFA 2E1NA 3FMQA 1T2KA 1EH7A 3Q5FA 2EA2A 4P9UA 1WI9A 2V6CA 1OYYA 3EETA 1K78B 3NEUA 5E17F 1BIAA 2DO7A 1HSJA 2GAUA 5CVVA 3DXJF 2J5PA 5HDGA 5L3EA 4Q5SF 2LKPA 5L3BA 3F8CA 3E6CC 4ESBA 2GQQA 2CQKA 3KLOA 1P2FA 4OOIA 4CYDA 1LDDA 3HRTA 1GXQA 5TJJA 1YFHA 3ELKA 4G7HF 4PCQA 4XSXF 2RQPA 1CF7A 4ZYGA 2OD5A 5BPDA 3GXOA 1DP7P 1MZBA 1DDNA 2HZTA 4I7HA 3PQJA 4Y17A 5H6RA 3SZPA 4RGSA 4EQQA 2XHKA 1W4MA 1IW7F 1BN5A 3RDIA 1XSXA 4OIPF 2QBYA 1FLIA 1U8RA 3BROA 2G7HA 1IRFA 2DBBA 2W24A 4R1HA 1B59A 5DUIA 5ICEA 1EV7A 4P96A 2Z33A 4HA8A 3C7JA 2F5EA 2LSOA 3K69A 2EFQA 2Q2EA 1U5TC 1T0FA 3GWZA 2A68F 2MH2A 3K9TA 5DV5A 2PJPA 2M87A 5JR3A 3T0YA 4EJOA 4GCVA 3L00A 6PAXA 5BS6A 4Q47A 2BEOA 1HKTA 2ZNZA 3GUDA 4D0PA 4B09A 1BI3A 3LQRA 1K79A 1YW7A 2D1HA 2KRFA 4E70A 3COAC 4EGZA 4KMUX 1A04A 4ZYEA 5HDKA 1OPCA 3V8JA 4LLLA 3P7NA 3KFWX 2ZJ2A 3F8MA 3GFJA 2DK8A 2ZMEA 3T1BA 1XDSA 2ZCWA 3LAPA 3JSOA 3IKVA 3VFZA 4YFXF 1IZ1A 3I64A 3EYIA 3F23A 1S3JA 3SXYA 3MZHA 1TNTA 1DPUA 2FA5A 2CSOA 1D5VA 3E5XA 1KQ8A 3HSRA 3V7CA 2XUBA 5J8CA 2P5KA 5FD6A 1ZHFA 2VC0A 4WK8F 5DD8A 4KDPA 3WTYC 1KQ0A 3RIRA 2G9WA 2JPBA 2QENA 2H94A 4RS8A 3W6JB 1W5SA 1O7LA 3HIFA 1IXSB 2A61A 4KT5C 1MD0A 3GZ5A 2JRTA 4G94A 5E1WA 1S29A 4G7ZF 2VE8A 5K5QA 5LGUA 5HS9A 1LDKB 4LGWA 2CYYA 4XSZF 3QPTA 4P55A 1R00A 1HXDA 1BC8C 4XLNF 4U7BA 3BJOA 3JAMZ 1UB9A 3W6KB 5J6XA 2D45A 1SMTA 4G6QA 1RIOH 4RGUA 5D8LB 5BMZA 4HF2A 4Y15A 2FEZA 1MGTA 5LLQA 3FX3A 4BHBA 4Z2YA 1USTA 1R1UA 3DPLC 1Z91A 4KN7X 2OBPA 5DEQA 2A6EF 4CDGA 3Q9SA 1ZRDA 1TLHB 2ESHA 1YS6A 3L2CA 1FZPB 4WCGA 4BH9A 3WTVC 1R1TA 2DQRA 1Z9CA 4ENJA 4EV0A 3N4MA 3ML6A 1TQPA 5K1YA 3V8KA 4O5VA 2RC4A 5E8GA 4TV7A 2FF4A 2UXXA 2LF7A 2O0YA 3FMRA 4ENMA 4L18B 1I1GA 3CUQA 1V3FA 2VBYA 3ROUA 1H9TA 3K2ZA 2PG4A 1R23A 3J80Z 2DPDA 2HWVA 2V1UA 2ZMEB 2VOPA 2WC2A 1U5TA 2ZFWA 2RKHA 4I01A 4HQEA 1YTYA 3IWZA 1R36A 4ESJA 2PMUA 2RVCA 4EJTA 2VODA 1FP2A 3ZMUA 1SD6A 3ZP5A 1IN8A 5CYVA 3E5UA 4HZFA 5HS8A 3KE2A 4G9YA 4BXUA 3F6OA 1B6AA 2BGCA 3KZYA 1OR7A 2L54A 4I2OA 1ON2A 4HV6A 3VODA 1ZARA 1F5TA 3BPXA 3BOQA 1MKMA 5HLHA 2W57A 5E8IA 3BY6A 5LHIA 2VONA 1SFUA 3CJNA 4OIQF 4ETSA 5FLXZ 4HF1A 4MGRA 1GXPA 1IXCA 4L5JA 5J8FA 1KA8A 3DF8A 3TOAA 3DP7A 2VBZA 2MLGA 3WE3A 5AIPA 1R22A 2XIGA 1JHHA 3ULQB 2GA1A 2OZUA 1JHFA 2PFBA 1FBSA 3GX4X 2COMA 2GA2A 5FB2A 1K6OA 2FOKA 4A5NA 1IUYA 1FYLA 1BM9A 3R6SA 3IKTA 4UVAA 2K02A 3RKWA 4YG2F 5CVUA 4KFCA 3KP6A 3F8NA 1G3SA 2NNYA 2IW5A 1W7PB 2ZNYA 3SFZA 3V7SA 1WKMA 2E1CA 5DD4A 1R5HA 2HS5A 1TTYA 3VOEA 3CUQC 3FWEA 4HLYA 3HYIA 4MQVA 3CLOA 4WF2A 2YR2A 2MC3A 3K1NA 3L7WA 4DQ2A 3KZZA 3DKWA 3FXUA 5CVRA 1J5YA 1FX7A 5D8KB 5L3GA 1STZA 2L3DA 4HOBA 4IRGA 2QQAA 4WX9A 2PBIA 1S6LA 3K1PA 3JW4A 3MQ0A 2XV4S 3C18A 4HX7A 1ZRFA 3G3ZA 4A0YA 1FNNA 3LA7A 2RGVA 2P5LC 4A6EA 1ZGAA 2BE5F 1J0RA 3GLXA 1P4AA 1K78A 3SZTA 2GXGA 4AWXB 3WTUC 2QBYB 3RKXA 1IRGA 2VT3A 2GWRA 5H6QA 3BDDA 3P9IA 3ZMZA 5LGNA 3TO9A 4HDUA 4I98B 3I71A 2DLLA 2P7VB 2NNNA 1J9IA 3KP5A 3E6DA 3I59A 3U1DA 2Y48A 5LHHA 5IT3A 3AAFA 5FFXA 1WRJA 4NB5A 2VOOA 1TW3A 4RAYA 3QAHA 2WTEA 3F72A 3V8LA 5LHGA 3HUGA 1MJ9A 3R0JA 3TO6A 4ENNA 3WE2A 1SAXA 1KU2A 3KEQA 3TQNA 3DFGA 1D3YA 1IN4A 1O3SA 4UV9A 5LRSA 3F3XA 4OU0A 1EH6A 4IRHA 2Z5UA 3JAMK 3WTSC 3E6MA 2KJBA 5ICFA 2HFHA 1WQ2A 1E2XA 4FX4A 3IRRA 1MDMA 2DAOA 5BOXA 4WXCA 2XKOA 1DUXC 4M9SA 2QQBA 1HQCA 1T39A 3ZPLA 1OKRA 2GXBA 3K0LA 1KU3A 4LB5A 4UV8A 3ERED 5ERIA 2QWWA 3JTHA 4KNYA 2CGPA 1YQAA 1AWCA 4EJWA 3QRFF 1VTNC 2OAZA 3K1MA 3M1EA 1W7PA 5HLIA 3HOTA 2A69F 3TDUC 3D0SA 3WODF 5BPIA 1U78A 1OMIA 2K86A 1LQ1A 4NHJA 2FMLA 1QNTA 4GO1A 2BYVE 3IC7A 2JSCA 2EB7A 1Y0UA 1V4RA 2STTA 2HGCA 5HOOA 1F9NA 1ZYRF 2O6GE 4RGRA 1HW1A 2ELHA 2LNBA 2YX7A 4UVBA 2X0LA 4AIHA 3SQNA 1ZG1A 3NQOA 1LVAA 3IRQA 3FM5A 3IWFA 1FYKA 2M5WA 2XRNA 4O3MA 2WWYA 2P4WA 3HHGA 3S2WA 3TOBA 2IRFG 1SFXA 2DU9A 1F1ZA 2UXNA 1ZLKA 3P9KA 4LFUA 4EM1A 3CO6C 3QU6A 2MBFA 5HS7A 1LNWA 3F6VA 1L0OC 4BHCA 1BI2A 4N9HA 3I53A 4G7OF 2P8TA 3F21A 2JPCA 3I0TA 1O3TA 2V79A 4XRFA 2M45A 1XMKA 3L9FA 1HSTA 3B02A 4KIFA 4CHUA 1ZAOA 2NAZA 4KIGA 1KQ9A 1K7AA 2ESNA 1XSVA 1YYVA 3HTUA 2HOEA 2IVMA 2A07F 3I4PA 4U0VA 1KU7A 1XGMA 3ISPA 4ZH4F 2A6HF 4A12A 3LWFA 4FHTA 2DQLA 3LAJA 1G4DA 3T5XA 4HX8A 1UHMA 2EK5A 2XAHA 1IN7A 1GVJA 4HW0A 4LK1F 1C0WA 3KLNA 2VN2A 4PDKA 1BJAA 2IPQX 5A2QZ 3LSTA 2YU3A 4KYWA 3N97A 2ADUA 1FBUA 2Q0OA 3GO5A 4ASNA 4PGHA 3WTXC 1ZG3A 3DPTA 2D1VA 5D4SA 4L9NA 4LMYA 4KUMA 4LLGF 1ZH5A 1HW5A 1BC7C 1FYMA 4P9FA 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYW A;  5ICC A;  2YX4 A;  1R5G A;  3BP8 A;  3ZN0 A;  3MCZ A;  1RI7 A;  4BNC A;  4ZZL A;  1IN5 A;  5E18 F;  1ZGJ A;  3QP5 A;  2VT2 A;  3GYH X;  3BPV A;  1ODD A;  2FXA A;  3FZV A;  1BI1 A;  1ONV A;  1U5T B;  1ZG5 A;  5A2Q K;  1BBY A;  3M9A A;  4A2U A;  4OIO F;  3ZMD A;  2XAS A;  3C3W A;  5ILS A;  1PDN C;  3ABU A;  2EV0 A;  3CUQ B;  3DEU A;  5CJ9 A;  3ZMS A;  3MWM A;  3E97 A;  3ZN1 A;  4MEX F;  4YIF A;  4OIN F;  3M8F A;  2DPU A;  4HLX A;  4CZZ A;  1YS7 A;  1MDM B;  5F64 A;  2UWM A;  2P5V A;  1HKS A;  4ENK A;  4KIC A;  2QVO A;  5LEK A;  2E7W A;  5FFZ A;  4UNO A;  1UFM A;  2NRA C;  2M1B A;  5IT9 K;  2Z3Y A;  3M7G A;  3VEP A;  3IHU A;  3LFK A;  3HSF A;  4M72 A;  4EM2 A;  1BOA A;  1PP8 F;  3WGI A;  4ZYH A;  4UVC A;  1CGP A;  1MJB A;  2IT0 A;  4O6J A;  1H0M A;  4YFK F;  1G3T A;  1KU9 A;  3HRU A;  3FHZ A;  1T6S A;  4IHT A;  4ON0 A;  2Y0M A;  4P5O A;  3GFL A;  3ECO A;  2P6T A;  4BQA A;  1I1S A;  1QZZ A;  4A0X A;  1XB4 A;  3E3V A;  3O3K A;  4EVI A;  4U7D A;  2H6C A;  1G6N A;  1MJA A;  4Q48 A;  4MNU A;  3E6B A;  2PI0 A;  2XGX A;  5D5U B;  2TDX A;  4UUV A;  3CUO A;  2FRH A;  2O3F A;  4U0W A;  1O7F A;  4I02 A;  2EFP A;  4AIK A;  3ZMT A;  4M9Z A;  1SD7 A;  4DNC A;  2Z9O A;  2HTJ A;  3REO A;  4HAM A;  4PZJ A;  3GW2 A;  2VE9 A;  5KK1 A;  1ULY A;  3MEX A;  2CO5 A;  1G3Y A;  2HEO A;  2A5Y B;  1HW2 A;  1SMY F;  3WG9 A;  2Q8K A;  1J75 A;  4FT8 A;  3RJP A;  5L3F A;  1LEB A;  1J59 A;  2DI3 A;  3J81 Z;  2QQ9 A;  4HV5 A;  2FNA A;  1Z7U A;  5CVJ A;  4IJA A;  3CTA A;  2XAQ A;  2K27 A;  2PLY A;  1PP7 U;  2W84 A;  2IJL A;  3PFI A;  3QPH A;  4L0Z B;  1XCB A;  2D2W A;  1QO0 D;  3RKY A;  3KCC A;  5AON A;  4JBA A;  2UZK A;  1QBJ A;  4HYE A;  2OQG A;  4R8H A;  4L5I A;  1LDJ A;  4CO8 A;  3ZMV A;  2P6S A;  2ZKZ A;  3L09 A;  4RB3 C;  2PMH A;  2F5D A;  2PN6 A;  2F2E A;  2L4A A;  3J81 K;  3C1D A;  3IL2 A;  4MEY F;  2GIV A;  1U3E M;  4IHS A;  2XAJ A;  1ZLJ A;  2V9V A;  3ECH A;  4CGZ A;  1R1V A;  3CO7 C;  2EV6 A;  5LGT A;  1O57 A;  3BJ6 A;  3HRM A;  1J2X A;  5JVT A;  1Z05 A;  2QUF A;  4I0A A;  2XVC A;  1I27 A;  3T8T A;  4M6Y A;  3D5L A;  4LK0 F;  5E1X A;  2NYX A;  3FM3 A;  1LJ9 A;  1Q1H A;  2XAG A;  1YIO A;  5DCM A;  3HSE A;  5DDG A;  2EV5 A;  1L3L A;  2VBX A;  3MAJ A;  2HKX A;  3DV8 A;  2WV0 A;  1ZRC A;  4YII A;  1R58 A;  1OYW A;  4QWQ A;  2VBW A;  3HRS A;  2ZBK A;  4IRI A;  1REP C;  4MHG A;  1XSD A;  3QU3 A;  1WWX A;  3RYP A;  2V1X A;  2ISY A;  1GHC A;  5F6F A;  4YFN F;  2IA2 A;  4EJU A;  3P9C A;  3OV8 A;  5LBQ A;  1UCR A;  2EFO A;  4ZZD A;  2O8X A;  1D8K A;  2JTV A;  2CFX A;  4I0B A;  5DCF A;  4JQF A;  1FSH A;  3R0A A;  1XN7 A;  2GZW A;  1HBX G;  2G7U A;  4GYI A;  1H9G A;  1LB2 A;  2FBI A;  3R4K A;  5FO5 A;  1P92 A;  4RAZ A;  1P4W A;  3O2P E;  4RB2 C;  3FF5 A;  1YLF A;  3GEZ A;  3BZ6 A;  2KJC A;  2RDP A;  1E17 A;  5HDN A;  2R7F A;  2F5C A;  1XD7 A;  2M8E A;  2L4M A;  4EJV A;  1B9N A;  4HX4 A;  1KYZ A;  4UXN A;  4Q4Z F;  5FD5 A;  1TNS A;  4UHT A;  3BJA A;  3I58 A;  4G6D A;  5D6E A;  1LEA A;  5EEH A;  4MTD A;  2L02 A;  4I09 A;  3O6B B;  3KP3 A;  3U2R A;  3F22 A;  2DW4 A;  4LJZ F;  2HYF A;  5E20 A;  2AS5 F;  2HKO A;  4RB1 A;  2CW0 F;  3KP2 A;  2IP2 A;  5ILV A;  2FQ3 A;  2MA3 A;  3LQQ A;  2LDU A;  1JE8 A;  4S05 A;  4LG0 B;  1XGS A;  3B73 A;  3LA2 A;  3EYY A;  1W5T A;  4GGG A;  1U6G A;  4NQW A;  3V4G A;  4IPA A;  1T98 A;  2JT1 A;  1ZN2 A;  4MQ9 F;  1PUE E;  3TDZ C;  5HVQ C;  5JI6 A;  4IXA A;  3FXR A;  2QYO A;  4MTE A;  4G8X A;  3E5Q A;  2C6Y A;  5AIQ A;  2V1D A;  3QP6 A;  4LG0 A;  2ISZ A;  2HDC A;  3EUH A;  3WU1 B;  3GF2 A;  1XCV A;  5L3C A;  4H0E A;  1P4X A;  1T38 A;  2FSW A;  1JGS A;  1O3Q A;  2MD5 A;  1AOY A;  2FBK A;  5H20 A;  4XBF A;  3SHF A;  2M30 A;  3GZ6 A;  4FX0 A;  4KA4 A;  2DK5 A;  5E1Z B;  2OQR A;  4QLC U;  4A6D A;  3BWG A;  5D5W B;  3RPQ A;  2OZ6 A;  4XLP F;  1TQI A;  4K2E A;  4LD5 A;  5TRD A;  5KVR A;  5D6F A;  4L9J A;  3U9G A;  1IF1 A;  5LRR A;  5CVI A;  1ZRE A;  2OU2 A;  4BHP A;  2PQ8 A;  1R7J A;  2DTR A;  3KET A;  2HQR A;  2HTS A;  1Z1D A;  4PGG A;  2MH9 A;  3F8F A;  5ICG A;  2RV8 A;  5BQT A;  5FGM A;  1FSE A;  2NS0 A;  3PQK A;  2ZO4 A;  2FNP A;  1I6X A;  1IN6 A;  3KP4 A;  2CG4 A;  1J7K A;  3EQL F;  2VXZ A;  1RNL A;  3EDP A;  4GXO A;  1FT9 A;  2K4B A;  2AXL A;  2DT5 A;  2BV6 A;  4IVN A;  1Z6R A;  3RPU A;  1TBX A;  1IAW A;  2ZXJ A;  2H6B A;  3ABT A;  2A3S A;  4L0Y B;  1RZ4 A;  4U0Y A;  3DQV C;  3V7R A;  3TKY A;  2W85 A;  1RUN A;  1I5Z A;  2RN7 A;  1FBQ A;  4GYG A;  2STW A;  3I59 B;  3RI4 A;  2R3S A;  1BIB A;  3WTZ A;  2HQN A;  4A5M A;  4KMF A;  2J5O A;  4LB6 B;  2YSR A;  2F5F A;  1FP1 D;  2X4H A;  2QZ8 A;  1XDU A;  3T8R A;  1SD4 A;  2R7D A;  5DYM A;  1F4K A;  5ED4 A;  4L9V A;  4HF0 A;  1NHA A;  3H3U A;  1TW2 A;  1XGN A;  1P6R A;  2OA4 A;  2YPR A;  4IF4 A;  2O61 A;  3KEO A;  2IA1 A;  2EFN A;  4M6X A;  2K4J A;  3WU0 A;  1B4A A;  4N0B A;  3TO7 A;  3OOP A;  1YW9 A;  3ZQ7 A;  2K7L A;  2CWE A;  4HBL A;  4L9T A;  5JFR A;  5F1R A;  2FMY A;  1XMA A;  4M73 A;  1S7A A;  1U2W A;  3WTT C;  4Y13 A;  2EA4 A;  5D5V B;  2H09 A;  1S8N A;  3R61 A;  1B1B A;  2XRO A;  2BBY A;  1RUO A;  4R79 A;  2P7C B;  4HDV A;  3WGH A;  3MFK A;  5D4R A;  2EJR A;  2O03 A;  4AVP A;  2VC1 A;  5K5R A;  4WXD A;  1B9M A;  3NRV A;  1QGP A;  4KN4 X;  5HLG A;  4JK1 X;  2PEX A;  3HTS B;  2B0L A;  1S7O A;  2XAF A;  3H92 A;  1EH8 A;  5CLS A;  4M74 A;  3CDH A;  4HQM A;  2FE3 A;  2EWN A;  1TQM A;  3RYR A;  1QZY A;  4S04 A;  3H3Z A;  1CF7 B;  4ZYD A;  3MZY A;  3GFI A;  3QOP A;  1X3U A;  1USS A;  2HR3 A;  5DUK A;  1HKQ A;  2ACJ A;  2IA0 A;  4BYY A;  2Y75 A;  2QM3 A;  2JZY A;  4M9X A;  1ON1 A;  1FPQ A;  4EM0 B;  4RB0 A;  5FLX K;  5D5X B;  2RNJ A;  2FBH A;  2XKP A;  2KIM A;  2Z99 A;  4LLN A;  3JSP A;  1BI0 A;  5EEG A;  4CIC A;  1QQI A;  1SD5 A;  2E7X A;  2KKO A;  3Q9V A;  4KIB A;  1FOK A;  4A0Z A;  1Z6T A;  1O3R A;  3WTW C;  2H27 A;  3J80 K;  3RTR A;  1WSU A;  3I54 A;  3JTG A;  2KIF A;  4OIR F;  1SFE A;  4RGX A;  1G3W A;  3G73 A;  3GFM A;  1YG2 A;  3J7A O;  1OYI A;  3WGG A;  4U88 A;  1DPR A;  4AD9 A;  4CXF A;  4OMZ A;  2QLZ A;  3TGN A;  4F7Z A;  5K5O A;  4N9I A;  4EMS A;  4BAY A;  1XGO A;  3VB2 A;  1QPM A;  1KGS A;  4WWC A;  2HYG D;  1D8J A;  3KP7 A;  1FC3 A;  2W25 A;  1W7P D;  1YO5 C;  4M71 A;  2LF8 A;  3HOS A;  2EFW A;  3LA3 A;  4EGY A;  2FU4 A;  3R60 A;  2ETH A;  3F8B A;  5ILU A;  2L01 A;  3GVA A;  4B8X A;  3M8E A;  3I5U A;  3FMS A;  4WXH A;  1YW8 A;  1FWZ A;  4OMY A;  3FXQ A;  1IXR C;  1UHW A;  5DCM B;  4AIJ A;  2KIU A;  2MLK A;  1JXS A;  2DFI A;  5LEJ A;  5IT9 Z;  5L3D A;  3HHH A;  1FY7 A;  4ESF A;  2E1N A;  3FMQ A;  1T2K A;  1EH7 A;  3Q5F A;  2EA2 A;  4P9U A;  1WI9 A;  2V6C A;  1OYY A;  3EET A;  1K78 B;  3NEU A;  5E17 F;  1BIA A;  2DO7 A;  1HSJ A;  2GAU A;  5CVV A;  3DXJ F;  2J5P A;  5HDG A;  5L3E A;  4Q5S F;  2LKP A;  5L3B A;  3F8C A;  3E6C C;  4ESB A;  2GQQ A;  2CQK A;  3KLO A;  1P2F A;  4OOI A;  4CYD A;  1LDD A;  3HRT A;  1GXQ A;  5TJJ A;  1YFH A;  3ELK A;  4G7H F;  4PCQ A;  4XSX F;  2RQP A;  1CF7 A;  4ZYG A;  2OD5 A;  5BPD A;  3GXO A;  1DP7 P;  1MZB A;  1DDN A;  2HZT A;  4I7H A;  3PQJ A;  4Y17 A;  5H6R A;  3SZP A;  4RGS A;  4EQQ A;  2XHK A;  1W4M A;  1IW7 F;  1BN5 A;  3RDI A;  1XSX A;  4OIP F;  2QBY A;  1FLI A;  1U8R A;  3BRO A;  2G7H A;  1IRF A;  2DBB A;  2W24 A;  4R1H A;  1B59 A;  5DUI A;  5ICE A;  1EV7 A;  4P96 A;  2Z33 A;  4HA8 A;  3C7J A;  2F5E A;  2LSO A;  3K69 A;  2EFQ A;  2Q2E A;  1U5T C;  1T0F A;  3GWZ A;  2A68 F;  2MH2 A;  3K9T A;  5DV5 A;  2PJP A;  2M87 A;  5JR3 A;  3T0Y A;  4EJO A;  4GCV A;  3L00 A;  6PAX A;  5BS6 A;  4Q47 A;  2BEO A;  1HKT A;  2ZNZ A;  3GUD A;  4D0P A;  4B09 A;  1BI3 A;  3LQR A;  1K79 A;  1YW7 A;  2D1H A;  2KRF A;  4E70 A;  3COA C;  4EGZ A;  4KMU X;  1A04 A;  4ZYE A;  5HDK A;  1OPC A;  3V8J A;  4LLL A;  3P7N A;  3KFW X;  2ZJ2 A;  3F8M A;  3GFJ A;  2DK8 A;  2ZME A;  3T1B A;  1XDS A;  2ZCW A;  3LAP A;  3JSO A;  3IKV A;  3VFZ A;  4YFX F;  1IZ1 A;  3I64 A;  3EYI A;  3F23 A;  1S3J A;  3SXY A;  3MZH A;  1TNT A;  1DPU A;  2FA5 A;  2CSO A;  1D5V A;  3E5X A;  1KQ8 A;  3HSR A;  3V7C A;  2XUB A;  5J8C A;  2P5K A;  5FD6 A;  1ZHF A;  2VC0 A;  4WK8 F;  5DD8 A;  4KDP A;  3WTY C;  1KQ0 A;  3RIR A;  2G9W A;  2JPB A;  2QEN A;  2H94 A;  4RS8 A;  3W6J B;  1W5S A;  1O7L A;  3HIF A;  1IXS B;  2A61 A;  4KT5 C;  1MD0 A;  3GZ5 A;  2JRT A;  4G94 A;  5E1W A;  1S29 A;  4G7Z F;  2VE8 A;  5K5Q A;  5LGU A;  5HS9 A;  1LDK B;  4LGW A;  2CYY A;  4XSZ F;  3QPT A;  4P55 A;  1R00 A;  1HXD A;  1BC8 C;  4XLN F;  4U7B A;  3BJO A;  3JAM Z;  1UB9 A;  3W6K B;  5J6X A;  2D45 A;  1SMT A;  4G6Q A;  1RIO H;  4RGU A;  5D8L B;  5BMZ A;  4HF2 A;  4Y15 A;  2FEZ A;  1MGT A;  5LLQ A;  3FX3 A;  4BHB A;  4Z2Y A;  1UST A;  1R1U A;  3DPL C;  1Z91 A;  4KN7 X;  2OBP A;  5DEQ A;  2A6E F;  4CDG A;  3Q9S A;  1ZRD A;  1TLH B;  2ESH A;  1YS6 A;  3L2C A;  1FZP B;  4WCG A;  4BH9 A;  3WTV C;  1R1T A;  2DQR A;  1Z9C A;  4ENJ A;  4EV0 A;  3N4M A;  3ML6 A;  1TQP A;  5K1Y A;  3V8K A;  4O5V A;  2RC4 A;  5E8G A;  4TV7 A;  2FF4 A;  2UXX A;  2LF7 A;  2O0Y A;  3FMR A;  4ENM A;  4L18 B;  1I1G A;  3CUQ A;  1V3F A;  2VBY A;  3ROU A;  1H9T A;  3K2Z A;  2PG4 A;  1R23 A;  3J80 Z;  2DPD A;  2HWV A;  2V1U A;  2ZME B;  2VOP A;  2WC2 A;  1U5T A;  2ZFW A;  2RKH A;  4I01 A;  4HQE A;  1YTY A;  3IWZ A;  1R36 A;  4ESJ A;  2PMU A;  2RVC A;  4EJT A;  2VOD A;  1FP2 A;  3ZMU A;  1SD6 A;  3ZP5 A;  1IN8 A;  5CYV A;  3E5U A;  4HZF A;  5HS8 A;  3KE2 A;  4G9Y A;  4BXU A;  3F6O A;  1B6A A;  2BGC A;  3KZY A;  1OR7 A;  2L54 A;  4I2O A;  1ON2 A;  4HV6 A;  3VOD A;  1ZAR A;  1F5T A;  3BPX A;  3BOQ A;  1MKM A;  5HLH A;  2W57 A;  5E8I A;  3BY6 A;  5LHI A;  2VON A;  1SFU A;  3CJN A;  4OIQ F;  4ETS A;  5FLX Z;  4HF1 A;  4MGR A;  1GXP A;  1IXC A;  4L5J A;  5J8F A;  1KA8 A;  3DF8 A;  3TOA A;  3DP7 A;  2VBZ A;  2MLG A;  3WE3 A;  5AIP A;  1R22 A;  2XIG A;  1JHH A;  3ULQ B;  2GA1 A;  2OZU A;  1JHF A;  2PFB A;  1FBS A;  3GX4 X;  2COM A;  2GA2 A;  5FB2 A;  1K6O A;  2FOK A;  4A5N A;  1IUY A;  1FYL A;  1BM9 A;  3R6S A;  3IKT A;  4UVA A;  2K02 A;  3RKW A;  4YG2 F;  5CVU A;  4KFC A;  3KP6 A;  3F8N A;  1G3S A;  2NNY A;  2IW5 A;  1W7P B;  2ZNY A;  3SFZ A;  3V7S A;  1WKM A;  2E1C A;  5DD4 A;  1R5H A;  2HS5 A;  1TTY A;  3VOE A;  3CUQ C;  3FWE A;  4HLY A;  3HYI A;  4MQV A;  3CLO A;  4WF2 A;  2YR2 A;  2MC3 A;  3K1N A;  3L7W A;  4DQ2 A;  3KZZ A;  3DKW A;  3FXU A;  5CVR A;  1J5Y A;  1FX7 A;  5D8K B;  5L3G A;  1STZ A;  2L3D A;  4HOB A;  4IRG A;  2QQA A;  4WX9 A;  2PBI A;  1S6L A;  3K1P A;  3JW4 A;  3MQ0 A;  2XV4 S;  3C18 A;  4HX7 A;  1ZRF A;  3G3Z A;  4A0Y A;  1FNN A;  3LA7 A;  2RGV A;  2P5L C;  4A6E A;  1ZGA A;  2BE5 F;  1J0R A;  3GLX A;  1P4A A;  1K78 A;  3SZT A;  2GXG A;  4AWX B;  3WTU C;  2QBY B;  3RKX A;  1IRG A;  2VT3 A;  2GWR A;  5H6Q A;  3BDD A;  3P9I A;  3ZMZ A;  5LGN A;  3TO9 A;  4HDU A;  4I98 B;  3I71 A;  2DLL A;  2P7V B;  2NNN A;  1J9I A;  3KP5 A;  3E6D A;  3I59 A;  3U1D A;  2Y48 A;  5LHH A;  5IT3 A;  3AAF A;  5FFX A;  1WRJ A;  4NB5 A;  2VOO A;  1TW3 A;  4RAY A;  3QAH A;  2WTE A;  3F72 A;  3V8L A;  5LHG A;  3HUG A;  1MJ9 A;  3R0J A;  3TO6 A;  4ENN A;  3WE2 A;  1SAX A;  1KU2 A;  3KEQ A;  3TQN A;  3DFG A;  1D3Y A;  1IN4 A;  1O3S A;  4UV9 A;  5LRS A;  3F3X A;  4OU0 A;  1EH6 A;  4IRH A;  2Z5U A;  3JAM K;  3WTS C;  3E6M A;  2KJB A;  5ICF A;  2HFH A;  1WQ2 A;  1E2X A;  4FX4 A;  3IRR A;  1MDM A;  2DAO A;  5BOX A;  4WXC A;  2XKO A;  1DUX C;  4M9S A;  2QQB A;  1HQC A;  1T39 A;  3ZPL A;  1OKR A;  2GXB A;  3K0L A;  1KU3 A;  4LB5 A;  4UV8 A;  3ERE D;  5ERI A;  2QWW A;  3JTH A;  4KNY A;  2CGP A;  1YQA A;  1AWC A;  4EJW A;  3QRF F;  1VTN C;  2OAZ A;  3K1M A;  3M1E A;  1W7P A;  5HLI A;  3HOT A;  2A69 F;  3TDU C;  3D0S A;  3WOD F;  5BPI A;  1U78 A;  1OMI A;  2K86 A;  1LQ1 A;  4NHJ A;  2FML A;  1QNT A;  4GO1 A;  2BYV E;  3IC7 A;  2JSC A;  2EB7 A;  1Y0U A;  1V4R A;  2STT A;  2HGC A;  5HOO A;  1F9N A;  1ZYR F;  2O6G E;  4RGR A;  1HW1 A;  2ELH A;  2LNB A;  2YX7 A;  4UVB A;  2X0L A;  4AIH A;  3SQN A;  1ZG1 A;  3NQO A;  1LVA A;  3IRQ A;  3FM5 A;  3IWF A;  1FYK A;  2M5W A;  2XRN A;  4O3M A;  2WWY A;  2P4W A;  3HHG A;  3S2W A;  3TOB A;  2IRF G;  1SFX A;  2DU9 A;  1F1Z A;  2UXN A;  1ZLK A;  3P9K A;  4LFU A;  4EM1 A;  3CO6 C;  3QU6 A;  2MBF A;  5HS7 A;  1LNW A;  3F6V A;  1L0O C;  4BHC A;  1BI2 A;  4N9H A;  3I53 A;  4G7O F;  2P8T A;  3F21 A;  2JPC A;  3I0T A;  1O3T A;  2V79 A;  4XRF A;  2M45 A;  1XMK A;  3L9F A;  1HST A;  3B02 A;  4KIF A;  4CHU A;  1ZAO A;  2NAZ A;  4KIG A;  1KQ9 A;  1K7A A;  2ESN A;  1XSV A;  1YYV A;  3HTU A;  2HOE A;  2IVM A;  2A07 F;  3I4P A;  4U0V A;  1KU7 A;  1XGM A;  3ISP A;  4ZH4 F;  2A6H F;  4A12 A;  3LWF A;  4FHT A;  2DQL A;  3LAJ A;  1G4D A;  3T5X A;  4HX8 A;  1UHM A;  2EK5 A;  2XAH A;  1IN7 A;  1GVJ A;  4HW0 A;  4LK1 F;  1C0W A;  3KLN A;  2VN2 A;  4PDK A;  1BJA A;  2IPQ X;  5A2Q Z;  3LST A;  2YU3 A;  4KYW A;  3N97 A;  2ADU A;  1FBU A;  2Q0O A;  3GO5 A;  4ASN A;  4PGH A;  3WTX C;  1ZG3 A;  3DPT A;  2D1V A;  5D4S A;  4L9N A;  4LMY A;  4KUM A;  4LLG F;  1ZH5 A;  1HW5 A;  1BC7 C;  1FYM A;  4P9F A;  5JHU A; 
#chains in the Genus database with same CATH topology
 1KYW A;  3OYM A;  4BGD A;  5ICC A;  2YX4 A;  3ONQ A;  1R5G A;  2Y69 H;  3BP8 A;  3ZN0 A;  3MCZ A;  1RI7 A;  4BNC A;  3VPR A;  4ZZL A;  2E35 A;  1IN5 A;  2BVM A;  4OWR B;  4UY8 I;  3G2B A;  1SEU A;  1A6I A;  2CV1 A;  1WFX A;  5E18 F;  1ZGJ A;  3ZQL A;  3QP5 A;  2VT2 A;  4DZP A;  3GYH X;  3BPV A;  1MBK A;  1ODD A;  2FXA A;  2Y2Z A;  3EUH C;  2DA2 A;  1WVR A;  3FZV A;  3HOV J;  1BI1 A;  3BZC A;  1ONV A;  4DYQ A;  1Y1W J;  1U5T B;  1ZG5 A;  4Y3O A;  4N4N B;  5A2Q K;  1BBY A;  3HJE A;  3M9A A;  5GAG J;  4A2U A;  4OIO F;  1FOY A;  4IEJ A;  3CD6 I;  3ZMD A;  1ETK A;  4BKX A;  1XS9 A;  2XAS A;  1NK2 P;  3C3W A;  5ILS A;  1GV2 A;  4IOA F;  1PDN C;  3ABU A;  2EV0 A;  2BY0 A;  3CUQ B;  3DEU A;  3K4N A;  1TWF J;  4BJ6 C;  3Q3S A;  4BE1 A;  4RAG A;  5CJ9 A;  3ZMS A;  2A5W A;  3IV5 A;  3AG4 H;  3MWM A;  3E97 A;  2LC2 A;  3GTQ J;  1POG A;  3ZN1 A;  5FJ8 J;  4MEX F;  2EZK A;  4L5E A;  2CMP A;  3B6A A;  4YIF A;  4OIN F;  3K6G A;  2ECC A;  3M8F A;  2DPU A;  4HLX A;  1FTT A;  3CP8 A;  1V5E A;  2V4J C;  5C4X J;  1OR7 C;  1ZKG A;  4CZZ A;  1YS7 A;  1MDM B;  5F64 A;  1BW5 A;  2UWM A;  2P5V A;  3SFI A;  2ZB9 A;  2LR8 A;  3A4C A;  1HKS A;  4ENK A;  1XX5 A;  4KIC A;  2QVO A;  1VQ8 I;  3PSF A;  2E7W A;  5LEK A;  2F5V A;  2MAB A;  2VKD A;  5FFZ A;  5EJC A;  1X1A A;  2VAS A;  1D1A A;  2QA4 I;  4UNO A;  1UFM A;  2NRA C;  3TP3 A;  1VQL I;  3W2A A;  4BS9 A;  2NS8 A;  2M1B A;  5IT9 K;  2Z3Y A;  3M7G A;  3VEP A;  4HRI A;  3IHU A;  3LFK A;  5IOZ A;  3HSF A;  4M72 A;  4EM2 A;  3AG2 H;  3DEE A;  2E1M C;  1MNM C;  1BOA A;  1PP8 F;  4D1Q A;  3WGI A;  2XF5 A;  4ZYH A;  4UVC A;  2ECB A;  2VB6 A;  1YHQ I;  1CGP A;  1MJB A;  2IT0 A;  2CW7 A;  4O6J A;  1IO2 A;  1H0M A;  4PJL A;  4YFK F;  1G3T A;  1P7J A;  1UG2 A;  1D5Y A;  2MC4 A;  3RZO J;  2X1C A;  1KU9 A;  1GLN A;  3HRU A;  3FHZ A;  1T6S A;  4IHT A;  2WV1 A;  4ON0 A;  2Y0M A;  4P5O A;  1T0F C;  3GFL A;  2EIM H;  2LKS A;  2EIL H;  3ECO A;  4CUG A;  3CDI A;  1BW6 A;  3HEF A;  4IQ4 A;  4M3D A;  2P6T A;  4BQA A;  1I1S A;  1DP3 A;  2LBF B;  3I9V 2;  4KT6 A;  2CV2 A;  4AU7 A;  1QZZ A;  2QKL B;  4FET A;  4A0X A;  2QEX I;  1XB4 A;  3E3V A;  3O3K A;  4EVI A;  4U7D A;  2W4S A;  5F27 A;  4RM3 A;  1ETV A;  2H6C A;  1G6N A;  1OJL A;  1MJA A;  4Q48 A;  4MNU A;  3E6B A;  2PI0 A;  2XGX A;  2WAE A;  5D5U B;  2Z16 A;  2TDX A;  4UUV A;  3CUO A;  2FRH A;  2AQF A;  2O3F A;  3ABL H;  3ZCO A;  1V5G A;  4U0W A;  3CMA I;  1XTA A;  2WY8 Q;  3DLL F;  2IGN A;  5M5W J;  1O7F A;  2L7Z A;  4I02 A;  2EFP A;  4JX5 A;  4AIK A;  5BNG A;  3ZMT A;  4M9Z A;  1SD7 A;  4DNC A;  2Z9O A;  2HTJ A;  4UUT A;  3H9G A;  3REO A;  4HAM A;  3KIO A;  4A3G J;  4PZJ A;  4F3Q A;  3GW2 A;  2VE9 A;  5KK1 A;  1ULY A;  1ZK8 A;  3MEX A;  3FIW A;  4JX6 A;  2CO5 A;  1G3Y A;  2KHM A;  2HEO A;  2A5Y B;  1SMY F;  2QGU A;  3KEY A;  1HW2 A;  3WG9 A;  2Q8K A;  1J75 A;  4FT8 A;  3RJP A;  2VQH A;  2K40 A;  5L3F A;  4A3D J;  1LEB A;  1J59 A;  2DI3 A;  3J81 Z;  1HLV A;  2OTL I;  2QQ9 A;  2W7N A;  3CMY A;  4HV5 A;  4M3F A;  1YJ9 I;  2R92 J;  3S1Q J;  2FNA A;  3LSJ A;  1PUF B;  1Z7U A;  5CVJ A;  4IJA A;  3CTA A;  4RDU A;  3ASN H;  4F91 B;  2XAQ A;  3IAM 2;  2CV0 A;  2K27 A;  2PLY A;  1PP7 U;  4CYC A;  3OIQ A;  2W84 A;  2IJL A;  3PFI A;  3QPH A;  3H9Q A;  4L0Z B;  5KCM A;  1XCB A;  2D2W A;  2EIN H;  2IAI A;  1QO0 D;  3L2W A;  2GLO A;  3RKY A;  1R5I D;  3KCC A;  1EA3 A;  5AON A;  5FRM A;  4JBA A;  4AC0 A;  2UZK A;  2LRD A;  1QBJ A;  4HYE A;  2OQG A;  4R8H A;  4L5I A;  2X6X A;  1LDJ A;  3U1K A;  3K10 A;  4CO8 A;  3ZMV A;  1HDP A;  2P6S A;  2ZKZ A;  3W3C A;  3L09 A;  4RB3 C;  2PMH A;  5EYR A;  2F5D A;  2PN6 A;  1D0X A;  2F2E A;  2Z1D A;  3BTC A;  4BQO A;  1JGG A;  2L4A A;  3J81 K;  1DU0 A;  3C1D A;  3IL2 A;  3DTK A;  4MO7 A;  4MEY F;  4E7S A;  1CQT A;  2GIV A;  1U3E M;  4IHS A;  2XAJ A;  1ZLJ A;  3FKI J;  2V9V A;  3ECH A;  4CGZ A;  1R1V A;  1FJL A;  1MBG A;  3HDD A;  3CO7 C;  2EV6 A;  5LGT A;  2KRC A;  3MZ8 A;  3FXJ A;  1O57 A;  2GBY A;  1WI3 A;  4IQJ A;  2AXT C;  3BJ6 A;  3HRM A;  1J2X A;  2WA0 A;  5DTD A;  5JVT A;  2M34 A;  3BTL A;  1Z05 A;  4Y33 A;  2QUF A;  2V9K A;  3OYF A;  4I0A A;  2XVC A;  1I27 A;  3T8T A;  4M6Y A;  5FLV A;  1X19 A;  1R49 A;  3D5L A;  1JT6 A;  2Q2E B;  3IH2 A;  4LK0 F;  3I55 I;  3M3Y J;  1Z7L A;  2FX0 A;  2ID3 A;  4AYB A;  5E1X A;  2NYX A;  4ZYA A;  2RAE A;  3W2V A;  3C2H A;  3AL0 B;  3BR1 A;  3FM3 A;  3G6E I;  1LJ9 A;  1Q1H A;  2XAG A;  1YIO A;  5DCM A;  3HSE A;  5DDG A;  2EV5 A;  5IP7 J;  1L3L A;  2E2J J;  2VBX A;  3SZG A;  3MAJ A;  2HKX A;  2W82 A;  4QPQ A;  1U8B A;  3ZRG A;  3DV8 A;  1ETY A;  4YRV A;  2WV0 A;  1ZRC A;  4YII A;  3G4S I;  1R58 A;  1OYW A;  4QWQ A;  4FQG A;  2VBW A;  1WJB A;  3HRS A;  4ZDP A;  2JMW A;  3OMY A;  5C4J J;  4ANJ A;  2ZBK A;  4BY1 J;  4IRI A;  1REP C;  4MHG A;  1TWH J;  1XSD A;  2KLO A;  3V42 A;  2Y9Z A;  3H5N A;  3QU3 A;  2LY9 A;  1WWX A;  3RYP A;  2V1X A;  1IUF A;  2ISY A;  1GHC A;  5F6F A;  4YFN F;  2X9D A;  2IA2 A;  3HKZ N;  4EJU A;  2E5N A;  3S32 A;  5KNL A;  2XB0 X;  3P9C A;  3VSL A;  4XLF A;  4XKB A;  2DJN A;  2L9R A;  3OV8 A;  5LBQ A;  1UCR A;  2EFO A;  4FCY A;  4ZZD A;  3QYE A;  4E7L A;  3S3O A;  2O8X A;  3HXL A;  3SEZ A;  1NK3 P;  1D8K A;  2JTV A;  2LOO A;  1IDZ A;  2CFX A;  3PNV A;  4I0B A;  5DCF A;  4F92 B;  1HOM A;  2JJ7 A;  4JQF A;  1FSH A;  3R0A A;  1XN7 A;  2DA5 A;  3S15 J;  2XF7 A;  2GZW A;  4I6Z A;  4E7K A;  1HBX G;  1X1P A;  2G7U A;  1UG0 A;  4RA2 A;  4GYI A;  5E3M A;  1H9G A;  5M3F J;  1PYV A;  1ZTR A;  3FXO A;  1RET A;  1LB2 A;  3KYD B;  3K7A J;  1I39 A;  2FBI A;  3R4K A;  5M3M J;  1K4S A;  3O8G A;  3CCY A;  5FO5 A;  2VKH A;  1P92 A;  2LFB A;  2NVU B;  4RAZ A;  1P4W A;  3DCF A;  3O2P E;  3CP2 A;  1GT0 C;  4RB2 C;  3FF5 A;  1YLF A;  4BJT A;  2V1N A;  3GEZ A;  4BJ5 C;  5M5Y J;  3BZ6 A;  2KJC A;  2RDP A;  4UUS B;  1ITY A;  1E17 A;  2XGC A;  3OYK A;  1EJ9 A;  1APL C;  5HDN A;  4BEH A;  1EKE A;  2CH0 A;  2R7F A;  4C30 A;  1JI8 A;  4CCK A;  2F5C A;  3FKJ A;  2YU9 J;  1XD7 A;  2E1O A;  2M8E A;  3J7Z I;  2L4M A;  4EJV A;  1B9N A;  4HX4 A;  1KYZ A;  4UXN A;  3RPU D;  4Q4Z F;  4HPQ A;  4IL6 C;  1BJZ A;  3OSG A;  5FD5 A;  1TNS A;  4UHT A;  3BJA A;  3FXK A;  3I58 A;  4G6D A;  3BTI A;  5D6E A;  3JR9 A;  1VQK I;  3UR3 C;  4PJM A;  1LEA A;  3OOU A;  5EEH A;  3VYU B;  4MTD A;  2L02 A;  4I09 A;  3O6B B;  3KP3 A;  3U2R A;  1LVK A;  3F22 A;  2L0K A;  3CJR B;  2DW4 A;  1D1B A;  4LJZ F;  2HYF A;  3CES A;  5E20 A;  2AS5 F;  2XDV A;  3E0J B;  2HKO A;  4RB1 A;  1JKR C;  3CF5 F;  2CW0 F;  3KP2 A;  4PUS A;  3D5R C;  2HPM A;  4A3B J;  3S14 J;  4II2 A;  2IP2 A;  4FE7 A;  5ILV A;  2FQ3 A;  2OTJ I;  2MA3 A;  2QF7 A;  4CH7 A;  3LQQ A;  2LDU A;  4XRS A;  2XB5 A;  2F6C A;  1JE8 A;  1ACI A;  4S05 A;  4LG0 B;  3DTE A;  1XGS A;  2MSY A;  3BTJ A;  1WGX A;  1GVD A;  3B73 A;  3LA2 A;  3EYY A;  1W5T A;  4GGG A;  1U6G A;  1X2N A;  4NQW A;  2DFE A;  3V4G A;  4IPA A;  1T98 A;  2NOJ B;  2JT1 A;  5KHD A;  5C44 J;  1ZN2 A;  2OCE A;  4MQ9 F;  4F55 A;  2WAQ N;  1PUE E;  1W0U A;  3TDZ C;  4IZZ A;  2ME0 A;  5FRO A;  5HVQ C;  5JI6 A;  4IXA A;  5FRN A;  3FXR A;  1FIP A;  2QYO A;  2PX9 A;  1VQM I;  2NVX J;  4MTE A;  3PJR A;  4G8X A;  3E5Q A;  2C6Y A;  5AIQ A;  2V1D A;  3QP6 A;  4LG0 A;  2ISZ A;  5JVG F;  5DM7 F;  2IXS A;  2EIJ H;  2HDC A;  3EUH A;  2HXO A;  2JA6 J;  3PIO F;  1FOX A;  3C2G A;  3WU1 B;  5GAE J;  3LSM A;  3DTI A;  1VF9 A;  3GF2 A;  2BOL A;  3QQA A;  4BQQ A;  1XCV A;  5L3C A;  5EG0 A;  4H0E A;  4LOC A;  1DGW Y;  1P4X A;  2DTZ A;  1T38 A;  1VQP I;  1GV5 A;  3HOZ J;  3ZQF A;  2FSW A;  2E19 A;  1Y1V J;  1JGS A;  5FKK A;  2KP6 A;  3LL7 A;  4XQF A;  4Y4R A;  4FTH A;  4A3I J;  2MD5 A;  4XM3 A;  1O3Q A;  1AOY A;  5B3S H;  2MD0 A;  4CZC A;  2CQQ A;  2FBK A;  5H20 A;  4LIV A;  2K9S A;  4XBF A;  4A3K J;  2FQ4 A;  3SHF A;  2M30 A;  2DMP A;  3GZ6 A;  1VI0 A;  1WPK A;  4FX0 A;  1BA5 A;  4KA4 A;  5JLX A;  2DK5 A;  5E1Z B;  2OQR A;  4QLC U;  5EZG A;  1WZ2 A;  2H8W A;  4A6D A;  4DYC A;  5DS9 A;  1V54 H;  3BWG A;  5D5W B;  3RPQ A;  4XID A;  2OZ6 A;  3EUK L;  4XLP F;  1TQI A;  1AKH A;  4K2E A;  1YI2 I;  2KRH A;  1JKP C;  2V9P A;  3BR2 A;  4LD5 A;  2XPV A;  4XLA A;  2XPW A;  5TRD A;  5KVR A;  1WJD A;  1I3Q J;  4HST A;  2DDA A;  3LMM A;  4L9J A;  5D6F A;  3U9G A;  1IF1 A;  5LRR A;  5CVI A;  1ZRE A;  2WB1 A;  3CC2 I;  2OU2 A;  2CFO A;  4NC8 A;  4BHP A;  2PQ8 A;  1HA8 A;  3ABK H;  4E7H A;  1R7J A;  4DBR A;  4M3G A;  2DTR A;  3KET A;  2JQ7 A;  2BXY A;  2HTS A;  2HQR A;  3P5J A;  1Z1D A;  4PGG A;  2MH9 A;  1ETQ A;  3F8F A;  2VIX A;  5ICG A;  3A01 A;  1IJW C;  2RV8 A;  2TCT A;  5BQT A;  2KQR A;  5FGM A;  1FSE A;  2NS0 A;  3PQK A;  3L2R A;  2ZO4 A;  2FNP A;  1I6X A;  1IN6 A;  4ZTJ A;  3KP4 A;  3S1R J;  2CG4 A;  3A2K A;  1J7K A;  2VPR A;  1W5C C;  3IUO A;  3BR6 A;  3EQL F;  5JLW A;  2R4G A;  2VXZ A;  1RNL A;  3EDP A;  3BG7 A;  4GXO A;  1V55 H;  2DN0 A;  1FT9 A;  5J1Y A;  4AYB N;  2K4B A;  2AXL A;  1VQ7 I;  2O5R A;  2KMU A;  3S2D J;  2DT5 A;  2BV6 A;  5GP9 A;  5CPR B;  4IVN A;  3OIO A;  1Z6R A;  2DYS H;  4ITV A;  3RPU A;  1TBX A;  1IAW A;  2ZXJ A;  2H6B A;  3JRD A;  3ABT A;  2A3S A;  3QPL A;  4L0Y B;  3K4C A;  3JRA A;  3RZD J;  1RZ4 A;  4U0Y A;  1UZC A;  3DQV C;  3V7R A;  4NUB A;  3TKY A;  2K9M A;  3HZJ A;  4RLF A;  2W85 A;  2M3A A;  1RUN A;  1I5Z A;  3JRE A;  2LK2 A;  2RN7 A;  5HNF A;  4HG2 A;  1FBQ A;  3BZK A;  1JJ6 C;  1MSE C;  4GYG A;  4JOM A;  2STW A;  2K3F A;  2E34 A;  1JKO C;  3I59 B;  3RI4 A;  1G59 A;  5J3L A;  2R3S A;  1BIB A;  3WTZ A;  5B1A H;  2Q1Z B;  2HQN A;  4NNJ A;  4A5M A;  2K9L A;  3PUF A;  4KMF A;  2J5O A;  4LB6 B;  1IRZ A;  5C3E J;  2YSR A;  2F5F A;  1FP1 D;  3N05 A;  2DT6 A;  3TP0 A;  2X4H A;  2QZ8 A;  3HKZ A;  1XDU A;  2COB A;  4P1W A;  3T8R A;  1MSF C;  1SD4 A;  3MN2 A;  2R7D A;  3Q0W A;  5DYM A;  1F4K A;  5ED4 A;  4L9V A;  4HF0 A;  2JWT A;  4A3C J;  1NHA A;  2JA5 J;  3S16 J;  2L9S A;  4KIT B;  3H3U A;  1TW2 A;  3QWL A;  1XGN A;  3LOC A;  1P6R A;  2OA4 A;  2YPR A;  4IF4 A;  1I3A A;  2O61 A;  4CCM A;  2GOM A;  3LSK A;  1OCT C;  4E4H A;  3J7A Y;  3KEO A;  1W36 D;  2NVY J;  3NWT A;  4MFE A;  3FBI B;  3PUB A;  2KDZ A;  2IA1 A;  3JRG A;  3F0C A;  2CS3 A;  1R6R A;  2EFN A;  4M6X A;  1TP4 A;  1WJE A;  2K4J A;  3WU0 A;  1B4A A;  4N0B A;  1TT0 A;  3TO7 A;  2D5V A;  3OOP A;  1YW9 A;  1K61 A;  3ZQ7 A;  5IOY A;  2K7L A;  2L7F P;  1MMG A;  2KT0 A;  2CWE A;  4HBL A;  4L9T A;  2DA6 A;  5JFR A;  5F1R A;  4NBQ A;  2FMY A;  3A0B C;  1YIJ I;  2H1K A;  1XMA A;  1QPI A;  1FOW A;  4X1E A;  2P81 A;  4M73 A;  1S7A A;  1U2W A;  3WTT C;  4Y13 A;  2EA4 A;  3MKL A;  5D5V B;  4RM2 A;  2HQ5 A;  2H09 A;  2Y0S A;  3I56 I;  1S8N A;  3J7Y J;  4BEH B;  1OIS A;  4PJN A;  3Q0U A;  3R61 A;  4ZDO A;  1B1B A;  3A03 A;  4BQN A;  2BBY A;  2XRO A;  1RUO A;  4R79 A;  2P7C B;  1HCR A;  4HDV A;  3WGH A;  4CSW A;  5GAD J;  3MFK A;  4G6T B;  5D4R A;  3ZGK A;  2EJR A;  3TBI A;  2O03 A;  1OCC H;  4AVP A;  4II3 A;  2VC1 A;  5K5R A;  4WXD A;  2JVG A;  1B9M A;  3NRV A;  2W00 A;  5EGO A;  1QGP A;  3VDX A;  4KN4 X;  5HLG A;  1MBJ A;  4JK1 X;  2PEX A;  3HTS B;  3M8J A;  2B0L A;  3A0H C;  1S7O A;  1TL8 A;  4JYK A;  2XAF A;  3H92 A;  4HNT A;  1B72 A;  2NVQ J;  3JRB A;  1Y39 A;  1EH8 A;  5CLS A;  1Y0N A;  4M74 A;  1QU3 A;  3JRI A;  3QYB A;  3CCR I;  4AUX A;  3CDH A;  4HQM A;  4PK4 A;  2FE3 A;  5GPC A;  2EWN A;  1TQM A;  5K7H A;  3RYR A;  2OCC H;  1QZY A;  4DBQ A;  1ETO A;  3HG9 A;  4S04 A;  2R7V A;  5J4V A;  3H3Z A;  1CF7 B;  1U0J A;  1MH3 A;  3ZXS A;  4ZYD A;  3MZY A;  2DA7 A;  3GFI A;  3QOP A;  2HU9 A;  1X3U A;  1USS A;  5F1J A;  4CCO A;  2HR3 A;  5DUK A;  1HKQ A;  1U9N A;  3CCJ I;  2ACJ A;  3RSN A;  2IA0 A;  4BYY A;  2Y75 A;  2QM3 A;  2DCE A;  2QSF X;  4NQW B;  5TGT A;  2JZY A;  4M9X A;  1LE8 B;  4XN0 A;  1ON1 A;  5FKL A;  4C2M J;  1FPQ A;  4EM0 B;  4BDY A;  2CRG A;  3EPZ A;  2VUM J;  4LIU A;  4I99 C;  2V26 A;  4RB0 A;  3ZOB A;  4BL0 B;  5FLX K;  5D5X B;  2RNJ A;  3L2Q A;  9ANT A;  3H5R A;  2BXZ A;  2VQC A;  3FXL A;  4BE0 A;  2FBH A;  3CCQ I;  2XKP A;  2KIM A;  2Z99 A;  4LLN A;  2UV1 A;  1WH5 A;  4E7J A;  1OCR H;  3JSP A;  1BI0 A;  5EEG A;  4CIC A;  5IYD J;  2E36 A;  1QQI A;  1SD5 A;  2E7X A;  2DT7 B;  1ZQ3 P;  2KIQ A;  2KKO A;  3M07 A;  3Q9V A;  4KIB A;  3CC7 I;  4EAT A;  1FOK A;  4N4O B;  4PFO A;  1UJ8 A;  4A0Z A;  1S7E A;  4I76 A;  1Z6T A;  2WY7 Q;  1O3R A;  1YRN B;  1AU7 A;  1YE9 A;  2X85 A;  3G71 I;  2IS2 A;  3WTW C;  2KL4 A;  2H27 A;  3J80 K;  3RTR A;  1WSU A;  2CQN A;  3JRF A;  4IHX A;  4RAF A;  3GBG A;  3I54 A;  3ZQH A;  1N25 A;  3JTG A;  2KIF A;  5IP9 J;  1Q1V A;  1T95 A;  2MG4 A;  4OIR F;  1S9H A;  1SFE A;  1Y8Q B;  4RGX A;  3A1Y A;  4PSW A;  1K4T A;  1LUJ B;  1G3W A;  4F93 B;  3G73 A;  2XGD A;  3GFM A;  4BXF A;  1MBF A;  1YG2 A;  3CCL I;  2VJ5 A;  1R71 A;  1UHS A;  1OYI A;  3CC4 I;  3J7A O;  3WGG A;  1G2H A;  4U88 A;  3BT9 A;  5EG0 B;  1SVM A;  1DPR A;  2OV7 A;  2RRE A;  1W36 C;  4FIS A;  4AD9 A;  1R9T J;  3CCM I;  2VQG A;  4CXF A;  3GTJ J;  4OMZ A;  2QLZ A;  3TGN A;  3CCV I;  4F7Z A;  4KIS A;  5K5O A;  4N9I A;  4EMS A;  4BAY A;  1XGO A;  4CCL A;  3VB2 A;  1QPM A;  1KGS A;  2QSG X;  4WWC A;  2HYG D;  4G12 A;  1D8J A;  3KP7 A;  2LRE A;  3IH3 A;  4YEJ A;  1FC3 A;  2PMZ N;  2W25 A;  1W7P D;  2NS7 A;  1Z0X A;  3FXM A;  2QKM B;  1YO5 C;  1LFB A;  4M71 A;  2LF8 A;  3BCA A;  4V2F A;  1JTY A;  4LIT A;  3HOS A;  2EFW A;  3LA3 A;  4EGY A;  2FU4 A;  3G1M A;  3S1N J;  2R7T A;  3R60 A;  2ETH A;  4C3J J;  4BXX J;  3F8B A;  5ILU A;  1Y56 A;  2L01 A;  3GVA A;  2PJR A;  4B8X A;  3HGY A;  3M8E A;  3I5U A;  1UMQ A;  3FMS A;  1YW8 A;  4WXH A;  4C2U A;  3DU5 A;  2FOW A;  3G1O A;  1FWZ A;  1YIT I;  4OMY A;  3FXQ A;  1IXR C;  1UHW A;  3K70 D;  5DCM B;  5EGO B;  4AIJ A;  4V19 K;  2KIU A;  2MLK A;  1JXS A;  2DFI A;  1OCO H;  1TWA J;  5LEJ A;  5L3D A;  5K7F A;  3HHH A;  1FY7 A;  5IT9 Z;  3S3N A;  3D1N I;  1MMN A;  4V2G A;  4XRS G;  4ESF A;  2E1N A;  3FMQ A;  4C9Y A;  1T2K A;  1EH7 A;  3Q5F A;  2EA2 A;  4B43 A;  2B7E A;  4P9U A;  1WI9 A;  5J1U A;  3OYC A;  2V6C A;  1OYY A;  2WAF A;  3EET A;  2HZD A;  1K78 B;  3NEU A;  2O9L A;  5E17 F;  1BIA A;  2DO7 A;  3GCM A;  1HSJ A;  2GAU A;  1YJW I;  2X1E A;  1GUU A;  4UB6 C;  3GTO J;  5CVV A;  2NOG A;  2QSH X;  2JSP A;  3DXJ F;  1IG7 A;  2J5P A;  5HDG A;  4A3L J;  4MLO A;  5L3E A;  4CCN A;  4PSX A;  4Q5S F;  2LKP A;  5L3B A;  3OYN A;  4OAY A;  3U21 A;  3F8C A;  3E6C C;  1QA6 A;  4B3X A;  4ESB A;  2HOS A;  2KZG A;  2R5Z B;  2GQQ A;  2CQK A;  5DM6 F;  1JT0 A;  3KLO A;  4A3J J;  1P2F A;  3MKZ A;  4OOI A;  3GTL J;  3MKW B;  1IRX A;  3HB9 A;  3TMO A;  1ZGW A;  4CYD A;  1LDD A;  3HRT A;  1GXQ A;  5TJJ A;  5GTI C;  1YFH A;  2W48 A;  3ELK A;  4G7H F;  2AO9 A;  4PCQ A;  4XSX F;  1JJ8 C;  4LG3 A;  1P7I A;  1RR7 A;  2RQP A;  1CF7 A;  4ZYG A;  2OD5 A;  5BPD A;  3GXO A;  2XF6 A;  2JUC A;  3KYL A;  1A6Q A;  2DA1 A;  3CDL A;  1DP7 P;  4M3E A;  1MZB A;  1DDN A;  2VI6 A;  3CCU I;  2HZT A;  3BG5 A;  3PQJ A;  1Y6I A;  4I7H A;  4Y17 A;  5EZH A;  1FMW A;  3F9K A;  4RGS A;  5H6R A;  3SZP A;  4EQQ A;  3HOY J;  3LNQ A;  2XHK A;  3NWS A;  3H0G J;  1W4M A;  5HNH A;  1IW7 F;  1BN5 A;  3RDI A;  4PJ0 C;  1XSX A;  2WAD A;  2IGO A;  2F48 A;  4OIP F;  2QBY A;  1FLI A;  1U8R A;  3CF2 A;  2HPI A;  1VQ4 I;  2CUZ A;  3BRO A;  2G7H A;  1FMV A;  2EH3 A;  1IRF A;  2DBB A;  5TIS C;  4MFD A;  1WJA A;  2BHZ A;  4E7I A;  1PUF A;  2W24 A;  3NAU A;  4FE4 A;  1N77 A;  1B59 A;  2ZJQ F;  5DUI A;  4CA0 A;  1HC8 A;  3KX2 A;  3CJT B;  3H3V K;  3C2B A;  3OS1 A;  5ICE A;  3CME I;  1EV7 A;  2DYR H;  1MBH A;  4P96 A;  1KZH A;  2Z33 A;  2RQQ A;  3A01 B;  4HA8 A;  3HPH A;  3C7J A;  2F5E A;  4XON A;  2LSO A;  4DGW B;  3K69 A;  2EFQ A;  2M0M A;  4BY7 J;  2Q2E A;  1LFP A;  1U5T C;  1MMD A;  1T0F A;  4XKW A;  4U87 A;  5J47 A;  3GWZ A;  2A68 F;  2MH2 A;  3K9T A;  5DV5 A;  1LPQ A;  1TC3 C;  2VXD A;  2PJP A;  3BG9 A;  3FK6 A;  2M87 A;  2O7O A;  5JR3 A;  1HDD C;  4XMY A;  4QIW N;  3T0Y A;  2JA7 J;  1AHD P;  1SFO J;  5CQG A;  3GME A;  4EJO A;  4GCV A;  2BHY A;  3L00 A;  4CYC B;  2WB1 N;  4XLH A;  1ETW A;  6PAX A;  4BBR J;  3OS2 A;  1JUM A;  5FKM A;  5BS6 A;  2KDO A;  2L9N A;  4Q47 A;  2BEO A;  1HKT A;  2R7U A;  2CQX A;  2M2E A;  2ZNZ A;  3GUD A;  3ZR8 X;  4D0P A;  3L2U A;  4B09 A;  3UKG A;  1BI3 A;  4BAC A;  3LQR A;  3OYJ A;  2FUG 2;  1K79 A;  1YW7 A;  3HPG A;  2F4M B;  4S0H B;  1VQ6 I;  2D1H A;  4BBS J;  2KRF A;  4D9J A;  2M7B A;  2CW8 A;  4E70 A;  3COA C;  4EGZ A;  1ZR4 A;  4KMU X;  3RKQ A;  1A04 A;  2QCO A;  4ZYE A;  4CCJ A;  5HDK A;  1OPC A;  3V8J A;  4LLL A;  1DGR M;  2E60 A;  3P7N A;  3KFW X;  3LSR A;  2ZJ2 A;  1FIA A;  2M8G X;  3F8M A;  4NC7 A;  1HF0 A;  3GFJ A;  2K5C A;  2DK8 A;  2LKX A;  2ZME A;  3T1B A;  1E3P A;  4NDL A;  5KAF C;  1XDS A;  2ZCW A;  3LAP A;  2LVS A;  1AA7 A;  3HOX J;  4DIQ A;  3JSO A;  1QVU A;  1T08 B;  3IKV A;  3VFZ A;  4YFX F;  1IZ1 A;  3I64 A;  3EYI A;  4A3E J;  3K4L A;  3F23 A;  1RES A;  5B1B H;  1S3J A;  3SXY A;  3MZH A;  1TNT A;  4HSR A;  4FAS D;  4J00 A;  4XN3 A;  3IH4 A;  1DPU A;  2FA5 A;  2CSO A;  2HVS A;  1D5V A;  1BL0 A;  1WJ5 A;  5KAI C;  3E5X A;  4C3I J;  1KQ8 A;  2PMZ A;  3CQZ J;  3HSR A;  3MKY B;  3V7C A;  2DXI A;  1X3Z B;  2R93 J;  2XUB A;  4D7M A;  3D5S C;  5J8C A;  2P5K A;  5FD6 A;  2EIK H;  1M1E B;  1ZHF A;  3QOD A;  2VC0 A;  4WK8 F;  2O8K A;  3OL3 A;  5DD8 A;  2M9H A;  3MD2 A;  4KDP A;  1ZEL A;  2HYJ A;  3WTY C;  2M0C A;  1JKQ C;  3O8H A;  1KQ0 A;  3RIR A;  2G9W A;  2HXI A;  2JPB A;  2H94 A;  2QEN A;  3K4J A;  4RS8 A;  4XNF A;  3W6J B;  2CQ7 A;  2Y30 A;  3GZN B;  1W5S A;  1O7L A;  2IGK A;  3FHN A;  3HIF A;  4PJJ A;  1IXS B;  2A61 A;  3DBR B;  4A3F J;  1QRY A;  4KT5 C;  3AL0 C;  1MD0 A;  3GZ5 A;  3W2W A;  2JRT A;  2P0W A;  4G94 A;  5E1W A;  1S29 A;  3OY9 A;  4G7Z F;  2VE8 A;  2OJE D;  5K5Q A;  2ZJR F;  1IDY A;  5LGU A;  4B47 A;  5HS9 A;  4BUP A;  5EEA A;  1VQN I;  1LDK B;  1VQO I;  4LGW A;  2CYY A;  4AID A;  2E71 A;  4XSZ F;  2BW3 B;  3QPT A;  4P55 A;  4ABZ A;  3LSP A;  2ICW G;  3WU2 C;  3PO2 J;  2L9V A;  1R00 A;  2DMQ A;  1HXD A;  1X2M A;  2YUS A;  1BC8 C;  2YS9 A;  4XLN F;  4U7B A;  3BJO A;  3X2Q H;  2WBM A;  4HNU A;  3JAM Z;  1N75 A;  1UB9 A;  3PSI A;  2LMD A;  1BOB A;  1TWC J;  3W6K B;  5J6X A;  2D45 A;  1RC9 A;  1BR2 A;  1WJC A;  1SMT A;  1TT5 B;  2ZME C;  4G6Q A;  4EEF G;  2DMN A;  2N8G A;  2JVH A;  1I50 J;  2VPL A;  1RIO H;  3QYF A;  1ETX A;  1VFC A;  1RRJ A;  4RGU A;  2X6W A;  1SFK A;  5D8L B;  3S1M J;  3E1S A;  5BMZ A;  4HF2 A;  4Y15 A;  2FEZ A;  1MGT A;  3FBN B;  5LLQ A;  2XAU A;  4J19 A;  2L2O A;  2HOT A;  3FX3 A;  2OC6 A;  4BHB A;  3PNT A;  1G8X A;  1K83 J;  4Z2Y A;  3OYD A;  3ASO H;  1UST A;  1R1U A;  3VWB A;  4J01 A;  2UUZ A;  4Y7N J;  3HBL A;  2E1M B;  2ZC2 A;  2VKE A;  3DPL C;  1Z91 A;  4KN7 X;  4UUS A;  2OBP A;  5DEQ A;  2A6E F;  4CDG A;  3Q9S A;  1AKH B;  1ZRD A;  1TLH B;  3L2V A;  2ESH A;  1YS6 A;  5IYB J;  3L2C A;  1FZP B;  4WCG A;  3DKX A;  3OYI A;  4BH9 A;  3WTV C;  1R1T A;  3OYE A;  2DQR A;  1Z9C A;  4ENJ A;  4EV0 A;  2GXA A;  4NC6 A;  3HGG A;  3JRH A;  3N4M A;  3ML6 A;  1TQP A;  2R7O A;  5K1Y A;  2X6Y A;  3V8K A;  2RNG A;  4O5V A;  1OCZ H;  2JA8 J;  2RC4 A;  4TV7 A;  2FF4 A;  2UXX A;  5E8G A;  5F0F A;  3CCE I;  2LF7 A;  3AFH A;  2I10 A;  4C3H J;  2O0Y A;  3WG7 H;  3FMR A;  4ENM A;  3AG3 H;  2ID6 A;  4L18 B;  1I1G A;  2F4I A;  2XSJ C;  4DYR A;  3VYS B;  3CUQ A;  2CU7 A;  1V3F A;  2DDB A;  2VBY A;  3ROU A;  1H9T A;  1PVE A;  3K2Z A;  3OIP A;  3S2H J;  2PG4 A;  2R7W A;  3HOU J;  2BY2 A;  1R23 A;  3J80 Z;  2AHQ A;  2DPD A;  2HWV A;  3HL2 A;  2JUG A;  2V1U A;  2ZME B;  4ZJZ A;  2WC2 A;  2VOP A;  2CUJ A;  1A36 A;  4UB8 C;  2TRT A;  1U5T A;  2ZFW A;  2RKH A;  5GPA A;  4I01 A;  4HQE A;  1YTY A;  1YX5 A;  3IWZ A;  3BR5 A;  3M4O J;  1H88 C;  1R36 A;  4ESJ A;  1WCM J;  2PMU A;  2RVC A;  3CZ6 A;  2JA2 A;  5IY5 H;  4EJT A;  2LP0 A;  2LD5 A;  2VOD A;  2LH9 A;  1FP2 A;  3ZMU A;  5E3L A;  1SD6 A;  3BC8 A;  3ZP5 A;  1IN8 A;  3GLL A;  5CYV A;  4JP0 A;  1NTC A;  3E5U A;  1D0Y A;  1X1D A;  4HZF A;  5HS8 A;  3KE2 A;  4G9Y A;  3HC7 A;  4BXU A;  3F6O A;  1B6A A;  3A02 A;  2DOF A;  1S5L C;  4BDZ A;  2EZH A;  3WHB A;  2BGC A;  3KZY A;  3OYA A;  1OR7 A;  2ME6 A;  2L54 A;  3MMY B;  3TW7 A;  2GOX B;  2DA3 A;  4I2O A;  1D0Z A;  1ON2 A;  4HV6 A;  4X0G A;  3VOD A;  3S17 J;  3OR1 C;  1VZ0 A;  3K70 C;  1ZAR A;  3HOW J;  3LFU A;  1F5T A;  3BG3 A;  3BPX A;  5H2F C;  3BOQ A;  2LY1 A;  1MKM A;  2DFH A;  2HVQ A;  5HLH A;  1PJR A;  2R7Z J;  2W57 A;  5E8I A;  3BY6 A;  5LHI A;  2VON A;  4D5C A;  1SFU A;  3CJN A;  4OIQ F;  3KYC B;  2ELK A;  2XGE A;  1JTX A;  3SYT A;  3S8P A;  2VJI A;  2XPU A;  2VL8 A;  4ETS A;  5FLX Z;  2R0Q C;  5M5X J;  4HF1 A;  5IP6 A;  4MGR A;  5HLT A;  1GXP A;  2OF7 A;  4QTR A;  1IXC A;  4L5J A;  5CQE A;  1OCP A;  2DMT A;  5J8F A;  1W1W E;  2L5Q A;  1KA8 A;  3DF8 A;  3TOA A;  3DP7 A;  2VBZ A;  1R4N B;  4XRM A;  2ZSI B;  2MLG A;  3WE3 A;  1N78 A;  2BY1 A;  3PL8 A;  5AIP A;  1B8I B;  3RQI A;  1R22 A;  2XIG A;  2M7A A;  1JHH A;  4B44 A;  3ULQ B;  2GA1 A;  2IBD A;  4W97 A;  2OZU A;  1T56 A;  3ZQC A;  1JHF A;  1F36 A;  2PFB A;  1FBS A;  2LY2 A;  3GX4 X;  2COM A;  1LFU P;  2GA2 A;  5FB2 A;  4BU2 A;  5B66 C;  3S3M A;  4C2T A;  3M1C A;  2ZJP F;  1K6O A;  2FOK A;  4IHW A;  1I6H J;  4A5N A;  1K6Y A;  1IUY A;  2L7M P;  1FYL A;  1BM9 A;  3R6S A;  3IKT A;  1J09 A;  3KZI C;  3ZQQ A;  2B63 J;  4XR6 A;  2CJJ A;  1EF4 A;  4UVA A;  2K02 A;  3RKW A;  2R7S A;  4YG2 F;  1VND A;  2L7K A;  2K3P A;  1E0E A;  3GTP J;  2HVR A;  5CVU A;  4E7Z A;  2K9N A;  3FDY A;  4BE2 A;  3BQZ A;  4KFC A;  3KP6 A;  1ERD A;  3F8N A;  1MIJ A;  5IPA A;  1G3S A;  2NNY A;  1TWG J;  2IW5 A;  1W7P B;  2ZXH A;  3MVP A;  2K85 A;  2ZNY A;  3DWL E;  3SFZ A;  3V7S A;  1WKM A;  3LSI A;  2E1C A;  4H4K C;  5DD4 A;  3FIS A;  3ESW B;  1R5H A;  2HS5 A;  2DOD A;  4IO9 F;  1TTY A;  3VOE A;  3CUQ C;  3FWE A;  2HDD A;  4HLY A;  3HYI A;  4MQV A;  3CLO A;  2E2I J;  4WF2 A;  2YR2 A;  2Z2S B;  2JK3 A;  2MC3 A;  3K1N A;  1MBE A;  3L7W A;  5GAH J;  4DQ2 A;  4GFB A;  1A5J A;  2B9S A;  4DZJ A;  2ZXI A;  3KZZ A;  3SDG A;  5J1R A;  3FXU A;  3DKW A;  2GIZ A;  5CVR A;  1J5Y A;  1FX7 A;  3WHC A;  5D8K B;  4Z6Y A;  5L3G A;  3I3L A;  3Q0V A;  1STZ A;  2L3D A;  4HOB A;  4IRG A;  2QQA A;  4WX9 A;  2BZT A;  1RR8 C;  1SAU A;  2PBI A;  4AM3 A;  1JUP A;  1S6L A;  3OR2 C;  1SC7 A;  3K1P A;  1B8I A;  3JW4 A;  4QPO A;  3MQ0 A;  2XV4 S;  3C18 A;  3DPU A;  3L1P A;  5FLM J;  5F0H A;  4HX7 A;  1ZRF A;  3G3Z A;  3CLQ A;  4A0Y A;  2VJJ A;  4B3A A;  5LD2 C;  1FNN A;  3BR3 A;  1MNE A;  3OYL A;  3LA7 A;  2R7X A;  2RGV A;  1D1C A;  1T8I A;  2R5Y A;  3AKZ A;  2P5L C;  3G1L A;  3H35 A;  4A6E A;  5B5E C;  3RCO A;  3BLY A;  1NG7 A;  1ZGA A;  3CCS I;  2BE5 F;  2MW8 A;  2WAQ A;  3OSF A;  2IS6 A;  1J0R A;  1RPW A;  3GLX A;  2F4O B;  1P4A A;  2GM4 A;  1RKW A;  2NVT J;  1K78 A;  2LYC A;  4IKF A;  2H1L A;  4ZC3 A;  3SZT A;  2GXG A;  4AWX B;  3VYR B;  3WTU C;  3RKX A;  2QBY B;  1IRG A;  2VT3 A;  5EF6 A;  4XL9 A;  2GWR A;  4JX4 A;  1P9Q C;  2CUE A;  1OFC X;  5J4Y A;  4D5F A;  2V6E A;  5H6Q A;  3QOE A;  4QSH A;  2R5Y B;  3BDD A;  3P9I A;  4XOR A;  2R7Q A;  3ZMZ A;  5LGN A;  1WJF A;  3TO9 A;  4HDU A;  1ZR2 A;  1GDT A;  1X1B A;  4I98 B;  5F04 A;  2MYS A;  3I71 A;  2DLL A;  2HNH A;  2P7V B;  2XSD C;  2NNN A;  4W1U A;  1J9I A;  3KP5 A;  3E6D A;  4KJZ A;  3I59 A;  3S93 A;  3U1D A;  4RLQ A;  3RQ4 A;  1UAA A;  2LBF A;  2Y48 A;  2MFZ A;  2LTP A;  2G0E A;  5IT3 A;  5LHH A;  4YEL A;  3AAF A;  1IV6 A;  5FFX A;  1WRJ A;  4OAZ A;  3VYT B;  4MIM A;  4NB5 A;  2VOO A;  2EBI A;  1TW3 A;  1YRN A;  2R5Z A;  5JHU A;  4RAY A;  3QAH A;  2WTE A;  3F72 A;  1H8A C;  2E5Z A;  3V8L A;  5LHG A;  2HI3 A;  2ZXW H;  5FKN A;  1Z67 A;  4Y52 J;  4XKV A;  3HUG A;  2ZSH B;  1MJ9 A;  3R0J A;  3TO6 A;  1Z3X A;  4ENN A;  2EZI A;  1E3H A;  3WE2 A;  1YJN I;  2HDW A;  1SAX A;  3OS0 A;  1MMS A;  1SAN A;  3OYB A;  3CJQ B;  1KU2 A;  3KEQ A;  1U9O A;  3TQN A;  2OUM A;  3ZQG A;  2I8D A;  3DFG A;  3BQY A;  1S72 I;  2DMU A;  1D3Y A;  1IN4 A;  3OYH A;  2DJI A;  1WHU A;  1O3S A;  4UV9 A;  3H1C A;  5LRS A;  3F3X A;  4OU0 A;  1VQ5 I;  1EH6 A;  4IRH A;  1X4O A;  2Z5U A;  2NXN B;  4YIR X;  5FKO A;  3JAM K;  2VQL A;  1JUS A;  4XIC A;  5EDN A;  4X6A J;  4RMN A;  3EUA A;  3WTS C;  3E6M A;  2KJB A;  5ICF A;  2HFH A;  1WQ2 A;  1E2X A;  3W6V A;  4FX4 A;  3IRR A;  1NH3 A;  3PIP F;  3PO3 J;  1MDM A;  2DAO A;  5BOX A;  4WXC A;  5J40 A;  2XKO A;  1DUX C;  4AVZ A;  4M9S A;  2QQB A;  3B6C A;  2KPM A;  2X48 A;  1NG6 A;  3LSH A;  1HQC A;  5CKT A;  1T39 A;  1VQ9 I;  2A05 A;  1Z77 A;  3VSK A;  3ZPL A;  2LLK A;  2BVL A;  1OKR A;  2GXB A;  3K0L A;  1KU3 A;  4LB5 A;  4UV8 A;  5ERI A;  3OL4 A;  3ERE D;  4IHV A;  2DOE A;  2X6O A;  3TW6 A;  2QWW A;  3JTH A;  1B72 B;  4KNY A;  1E3O C;  2KFD A;  3IP4 B;  5E3N A;  1A31 A;  2CGP A;  1YQA A;  1XPX A;  1AWC A;  4EJW A;  3QRF F;  3BR0 A;  1VTN C;  5E79 C;  1X4P A;  2OAZ A;  3K1M A;  2OPT A;  2IS4 A;  3M1E A;  2IEK A;  1QVT A;  1W7P A;  4XOP A;  3E7L A;  3ZQI A;  1XG1 A;  3IAS 2;  5HLI A;  3HOT A;  2A69 F;  3TDU C;  2KIS A;  3BCB A;  3D0S A;  3WOD F;  4GRI A;  1LE8 A;  5GTH C;  5BPI A;  1U78 A;  1OMI A;  4A93 J;  3GTM J;  3CMM A;  2K86 A;  1LQ1 A;  1TZL A;  2A6T A;  5IYC J;  2FML A;  1O4X A;  4NHJ A;  2VJ4 A;  2I5U A;  1QNT A;  5F0C A;  4GO1 A;  2BYV E;  3IC7 A;  2JSC A;  2EB7 A;  2JRM A;  3PNY A;  1Y0U A;  1V4R A;  1W0T A;  3ERM A;  1IC8 A;  4DJA A;  1H89 C;  2X51 A;  2XC7 A;  3HUG B;  2STT A;  2HGC A;  3LSG A;  1FEX A;  3FK7 A;  1RKT A;  3BG6 A;  1MW7 A;  4ZTF A;  5HOO A;  1F9N A;  1ZYR F;  2EZL A;  2O6G E;  4XKC A;  4XOT A;  2LG4 A;  4RGR A;  1HW1 A;  2ELH A;  2LNB A;  2EPF A;  2YX7 A;  1SVL A;  4D7N A;  4UVB A;  2X0L A;  4AIH A;  4IX7 A;  3I4M J;  4XLE A;  5F08 A;  1X3W B;  2FJ1 A;  1FTZ A;  1IV8 A;  4GDF A;  3SQN A;  1ZG1 A;  3SDB A;  2VKV A;  1Z21 A;  3NQO A;  3SEQ A;  4M6V A;  1LVA A;  3IRQ A;  1A35 A;  3FM5 A;  3PM1 A;  3H0D A;  3IWF A;  3I4N J;  1DQU A;  2M4K A;  1FYK A;  2M5W A;  4B1R A;  1ORK A;  3DBH B;  2XRN A;  2HOA A;  4O3M A;  1OLT A;  3TL4 X;  2WWY A;  2P4W A;  1BC7 C;  2XRL A;  4A69 C;  3UNG C;  2IS1 A;  2M4G A;  2ZFU A;  3HHG A;  1IGN A;  3K4M A;  4DW6 A;  2H8R A;  3DKY A;  3S2W A;  2VLA A;  4DOZ A;  1F43 A;  2FD5 A;  3TOB A;  2IRF G;  2MGQ A;  1SFX A;  1Z3Y A;  2X1D A;  3JCU C;  2DU9 A;  1DU6 A;  1F1Z A;  2UXN A;  4B48 A;  1ZLK A;  1V5F A;  3P9K A;  1XMX A;  4LFU A;  1X1C A;  2Y9Y A;  4EM1 A;  2K9Q A;  3CO6 C;  3QU6 A;  2MBF A;  3K2A A;  5JHF A;  3QPS A;  4HNV A;  3H5A A;  3SJM A;  5HS7 A;  1LNW A;  3F6V A;  1L0O C;  1YOV B;  2DFF A;  4BHC A;  3DU6 A;  1BI2 A;  3GTK J;  1MH4 A;  3I53 A;  4N9H A;  1SVO A;  1QHH D;  4G7O F;  2P8T A;  1KON A;  3H36 A;  3F21 A;  3DLA A;  2JPC A;  3I0T A;  1O3T A;  1T33 A;  3DBL B;  2ELJ A;  2V79 A;  4XRF A;  4IOC F;  1UEL B;  3HM5 A;  2M45 A;  1XMK A;  2W1O A;  3L9F A;  4B4C A;  1HST A;  3B02 A;  4KIF A;  4F52 A;  5LFA A;  4CHU A;  3K4B A;  1Y8R B;  1ZAO A;  2NAZ A;  3DEW A;  2PJR B;  4KIG A;  1KQ9 A;  1K7A A;  2R7R A;  2ESN A;  1XSV A;  1YYV A;  2Y0S N;  1OQY A;  3HTU A;  2HOE A;  2E2H J;  2IVM A;  2A07 F;  3I4P A;  4U0V A;  1KU7 A;  1XGM A;  3ISP A;  4ZH4 F;  3OYG A;  2A6H F;  4A12 A;  3LWF A;  3NAR A;  2IGM A;  2BY3 A;  1QZE A;  4FHT A;  1BR1 A;  3OWT A;  2KZV A;  2DQL A;  2CUF A;  4HEA 2;  3LAJ A;  1G4D A;  1YX3 A;  4M3B A;  3T5X A;  3KPH A;  4HX8 A;  4PFP A;  1UHM A;  2Y31 A;  2EK5 A;  2HQA A;  1MMA A;  3AG1 H;  1R4M B;  3PFY A;  2XAH A;  5E3O A;  1IN7 A;  4XLC A;  2BW3 A;  1GVJ A;  4HW0 A;  1QHG A;  4LK1 F;  1C0W A;  3ABM H;  3KLN A;  1XC5 A;  2VN2 A;  4PDK A;  1BJA A;  2IPQ X;  5A2Q Z;  1ENH A;  3LST A;  1X58 A;  2YU3 A;  5K7Z A;  4RBO A;  2V7F A;  3GTG J;  4KYW A;  4ZDL A;  2ADU A;  3N97 A;  1FBU A;  2Q0O A;  3GO5 A;  4ASN A;  2JN6 A;  4PGH A;  2DA4 A;  1WH7 A;  2AQE A;  5HOD A;  3WTX C;  1BR4 A;  1ZG3 A;  4IHY A;  3DPT A;  2DOA A;  2D1V A;  5D4S A;  3TED A;  2EQR A;  3K4K A;  2QQ8 A;  4A3M J;  1MND A;  4L9N A;  4LMY A;  4KUM A;  4LLG F;  4XK4 A;  1HW5 A;  4E6K G;  1ZH5 A;  3H9J A;  4R1H A;  1FYM A;  4P9F A;  3JRC A;  1LKX A; 
#chains in the Genus database with same CATH homology
 1KYW A;  5ICC A;  2YX4 A;  1R5G A;  3BP8 A;  3ZN0 A;  3MCZ A;  1RI7 A;  4BNC A;  4ZZL A;  1IN5 A;  5E18 F;  1ZGJ A;  3QP5 A;  2VT2 A;  3GYH X;  3BPV A;  1ODD A;  2FXA A;  3FZV A;  1BI1 A;  1ONV A;  1U5T B;  1ZG5 A;  5A2Q K;  1BBY A;  3M9A A;  4A2U A;  4OIO F;  3ZMD A;  2XAS A;  3C3W A;  5ILS A;  1PDN C;  3ABU A;  2EV0 A;  3CUQ B;  3DEU A;  5CJ9 A;  3ZMS A;  3MWM A;  3E97 A;  3ZN1 A;  4MEX F;  4YIF A;  4OIN F;  3M8F A;  2DPU A;  4HLX A;  4CZZ A;  1YS7 A;  1MDM B;  5F64 A;  2UWM A;  2P5V A;  1HKS A;  4ENK A;  4KIC A;  2QVO A;  5LEK A;  2E7W A;  5FFZ A;  4UNO A;  1UFM A;  2NRA C;  2M1B A;  5IT9 K;  2Z3Y A;  3M7G A;  3VEP A;  3IHU A;  3LFK A;  3HSF A;  4M72 A;  4EM2 A;  1BOA A;  1PP8 F;  3WGI A;  4ZYH A;  4UVC A;  1CGP A;  1MJB A;  2IT0 A;  4O6J A;  1H0M A;  4YFK F;  1G3T A;  1KU9 A;  3HRU A;  3FHZ A;  1T6S A;  4IHT A;  4ON0 A;  2Y0M A;  4P5O A;  3GFL A;  3ECO A;  2P6T A;  4BQA A;  1I1S A;  1QZZ A;  4A0X A;  1XB4 A;  3E3V A;  3O3K A;  4EVI A;  4U7D A;  2H6C A;  1G6N A;  1MJA A;  4Q48 A;  4MNU A;  3E6B A;  2PI0 A;  2XGX A;  5D5U B;  2TDX A;  4UUV A;  3CUO A;  2FRH A;  2O3F A;  4U0W A;  1O7F A;  4I02 A;  2EFP A;  4AIK A;  3ZMT A;  4M9Z A;  1SD7 A;  4DNC A;  2Z9O A;  2HTJ A;  3REO A;  4HAM A;  4PZJ A;  3GW2 A;  2VE9 A;  5KK1 A;  1ULY A;  3MEX A;  2CO5 A;  1G3Y A;  2HEO A;  2A5Y B;  1HW2 A;  1SMY F;  3WG9 A;  2Q8K A;  1J75 A;  4FT8 A;  3RJP A;  5L3F A;  1LEB A;  1J59 A;  2DI3 A;  3J81 Z;  2QQ9 A;  4HV5 A;  2FNA A;  1Z7U A;  5CVJ A;  4IJA A;  3CTA A;  2XAQ A;  2K27 A;  2PLY A;  1PP7 U;  2W84 A;  2IJL A;  3PFI A;  3QPH A;  4L0Z B;  1XCB A;  2D2W A;  1QO0 D;  3RKY A;  3KCC A;  5AON A;  4JBA A;  2UZK A;  1QBJ A;  4HYE A;  2OQG A;  4R8H A;  4L5I A;  1LDJ A;  4CO8 A;  3ZMV A;  2P6S A;  2ZKZ A;  3L09 A;  4RB3 C;  2PMH A;  2F5D A;  2PN6 A;  2F2E A;  2L4A A;  3J81 K;  3C1D A;  3IL2 A;  4MEY F;  2GIV A;  1U3E M;  4IHS A;  2XAJ A;  1ZLJ A;  2V9V A;  3ECH A;  4CGZ A;  1R1V A;  3CO7 C;  2EV6 A;  5LGT A;  1O57 A;  3BJ6 A;  3HRM A;  1J2X A;  5JVT A;  1Z05 A;  2QUF A;  4I0A A;  2XVC A;  1I27 A;  3T8T A;  4M6Y A;  3D5L A;  4LK0 F;  5E1X A;  2NYX A;  3FM3 A;  1LJ9 A;  1Q1H A;  2XAG A;  1YIO A;  5DCM A;  3HSE A;  5DDG A;  2EV5 A;  1L3L A;  2VBX A;  3MAJ A;  2HKX A;  3DV8 A;  2WV0 A;  1ZRC A;  4YII A;  1R58 A;  1OYW A;  4QWQ A;  2VBW A;  3HRS A;  2ZBK A;  4IRI A;  1REP C;  4MHG A;  1XSD A;  3QU3 A;  1WWX A;  3RYP A;  2V1X A;  2ISY A;  1GHC A;  5F6F A;  4YFN F;  2IA2 A;  4EJU A;  3P9C A;  3OV8 A;  5LBQ A;  1UCR A;  2EFO A;  4ZZD A;  2O8X A;  1D8K A;  2JTV A;  2CFX A;  4I0B A;  5DCF A;  4JQF A;  1FSH A;  3R0A A;  1XN7 A;  2GZW A;  1HBX G;  2G7U A;  4GYI A;  1H9G A;  1LB2 A;  2FBI A;  3R4K A;  5FO5 A;  1P92 A;  4RAZ A;  1P4W A;  3O2P E;  4RB2 C;  3FF5 A;  1YLF A;  3GEZ A;  3BZ6 A;  2KJC A;  2RDP A;  1E17 A;  5HDN A;  2R7F A;  2F5C A;  1XD7 A;  2M8E A;  2L4M A;  4EJV A;  1B9N A;  4HX4 A;  1KYZ A;  4UXN A;  4Q4Z F;  5FD5 A;  1TNS A;  4UHT A;  3BJA A;  3I58 A;  4G6D A;  5D6E A;  1LEA A;  5EEH A;  4MTD A;  2L02 A;  4I09 A;  3O6B B;  3KP3 A;  3U2R A;  3F22 A;  2DW4 A;  4LJZ F;  2HYF A;  5E20 A;  2AS5 F;  2HKO A;  4RB1 A;  2CW0 F;  3KP2 A;  2IP2 A;  5ILV A;  2FQ3 A;  2MA3 A;  3LQQ A;  2LDU A;  1JE8 A;  4S05 A;  4LG0 B;  1XGS A;  3B73 A;  3LA2 A;  3EYY A;  1W5T A;  4GGG A;  1U6G A;  4NQW A;  3V4G A;  4IPA A;  1T98 A;  2JT1 A;  1ZN2 A;  4MQ9 F;  1PUE E;  3TDZ C;  5HVQ C;  5JI6 A;  4IXA A;  3FXR A;  2QYO A;  4MTE A;  4G8X A;  3E5Q A;  2C6Y A;  5AIQ A;  2V1D A;  3QP6 A;  4LG0 A;  2ISZ A;  2HDC A;  3EUH A;  3WU1 B;  3GF2 A;  1XCV A;  5L3C A;  4H0E A;  1P4X A;  1T38 A;  2FSW A;  1JGS A;  1O3Q A;  2MD5 A;  1AOY A;  2FBK A;  5H20 A;  4XBF A;  3SHF A;  2M30 A;  3GZ6 A;  4FX0 A;  4KA4 A;  2DK5 A;  5E1Z B;  2OQR A;  4QLC U;  4A6D A;  3BWG A;  5D5W B;  3RPQ A;  2OZ6 A;  4XLP F;  1TQI A;  4K2E A;  4LD5 A;  5TRD A;  5KVR A;  5D6F A;  4L9J A;  3U9G A;  1IF1 A;  5LRR A;  5CVI A;  1ZRE A;  2OU2 A;  4BHP A;  2PQ8 A;  1R7J A;  2DTR A;  3KET A;  2HQR A;  2HTS A;  1Z1D A;  4PGG A;  2MH9 A;  3F8F A;  5ICG A;  2RV8 A;  5BQT A;  5FGM A;  1FSE A;  2NS0 A;  3PQK A;  2ZO4 A;  2FNP A;  1I6X A;  1IN6 A;  3KP4 A;  2CG4 A;  1J7K A;  3EQL F;  2VXZ A;  1RNL A;  3EDP A;  4GXO A;  1FT9 A;  2K4B A;  2AXL A;  2DT5 A;  2BV6 A;  4IVN A;  1Z6R A;  3RPU A;  1TBX A;  1IAW A;  2ZXJ A;  2H6B A;  3ABT A;  2A3S A;  4L0Y B;  1RZ4 A;  4U0Y A;  3DQV C;  3V7R A;  3TKY A;  2W85 A;  1RUN A;  1I5Z A;  2RN7 A;  1FBQ A;  4GYG A;  2STW A;  3I59 B;  3RI4 A;  2R3S A;  1BIB A;  3WTZ A;  2HQN A;  4A5M A;  4KMF A;  2J5O A;  4LB6 B;  2YSR A;  2F5F A;  1FP1 D;  2X4H A;  2QZ8 A;  1XDU A;  3T8R A;  1SD4 A;  2R7D A;  5DYM A;  1F4K A;  5ED4 A;  4L9V A;  4HF0 A;  1NHA A;  3H3U A;  1TW2 A;  1XGN A;  1P6R A;  2OA4 A;  2YPR A;  4IF4 A;  2O61 A;  3KEO A;  2IA1 A;  2EFN A;  4M6X A;  2K4J A;  3WU0 A;  1B4A A;  4N0B A;  3TO7 A;  3OOP A;  1YW9 A;  3ZQ7 A;  2K7L A;  2CWE A;  4HBL A;  4L9T A;  5JFR A;  5F1R A;  2FMY A;  1XMA A;  4M73 A;  1S7A A;  1U2W A;  3WTT C;  4Y13 A;  2EA4 A;  5D5V B;  2H09 A;  1S8N A;  3R61 A;  1B1B A;  2XRO A;  2BBY A;  1RUO A;  4R79 A;  2P7C B;  4HDV A;  3WGH A;  3MFK A;  5D4R A;  2EJR A;  2O03 A;  4AVP A;  2VC1 A;  5K5R A;  4WXD A;  1B9M A;  3NRV A;  1QGP A;  4KN4 X;  5HLG A;  4JK1 X;  2PEX A;  3HTS B;  2B0L A;  1S7O A;  2XAF A;  3H92 A;  1EH8 A;  5CLS A;  4M74 A;  3CDH A;  4HQM A;  2FE3 A;  2EWN A;  1TQM A;  3RYR A;  1QZY A;  4S04 A;  3H3Z A;  1CF7 B;  4ZYD A;  3MZY A;  3GFI A;  3QOP A;  1X3U A;  1USS A;  2HR3 A;  5DUK A;  1HKQ A;  2ACJ A;  2IA0 A;  4BYY A;  2Y75 A;  2QM3 A;  2JZY A;  4M9X A;  1ON1 A;  1FPQ A;  4EM0 B;  4RB0 A;  5FLX K;  5D5X B;  2RNJ A;  2FBH A;  2XKP A;  2KIM A;  2Z99 A;  4LLN A;  3JSP A;  1BI0 A;  5EEG A;  4CIC A;  1QQI A;  1SD5 A;  2E7X A;  2KKO A;  3Q9V A;  4KIB A;  1FOK A;  4A0Z A;  1Z6T A;  1O3R A;  3WTW C;  2H27 A;  3J80 K;  3RTR A;  1WSU A;  3I54 A;  3JTG A;  2KIF A;  4OIR F;  1SFE A;  4RGX A;  1G3W A;  3G73 A;  3GFM A;  1YG2 A;  3J7A O;  1OYI A;  3WGG A;  4U88 A;  1DPR A;  4AD9 A;  4CXF A;  4OMZ A;  2QLZ A;  3TGN A;  4F7Z A;  5K5O A;  4N9I A;  4EMS A;  4BAY A;  1XGO A;  3VB2 A;  1QPM A;  1KGS A;  4WWC A;  2HYG D;  1D8J A;  3KP7 A;  1FC3 A;  2W25 A;  1W7P D;  1YO5 C;  4M71 A;  2LF8 A;  3HOS A;  2EFW A;  3LA3 A;  4EGY A;  2FU4 A;  3R60 A;  2ETH A;  3F8B A;  5ILU A;  2L01 A;  3GVA A;  4B8X A;  3M8E A;  3I5U A;  3FMS A;  4WXH A;  1YW8 A;  1FWZ A;  4OMY A;  3FXQ A;  1IXR C;  1UHW A;  5DCM B;  4AIJ A;  2KIU A;  2MLK A;  1JXS A;  2DFI A;  5LEJ A;  5IT9 Z;  5L3D A;  3HHH A;  1FY7 A;  4ESF A;  2E1N A;  3FMQ A;  1T2K A;  1EH7 A;  3Q5F A;  2EA2 A;  4P9U A;  1WI9 A;  2V6C A;  1OYY A;  3EET A;  1K78 B;  3NEU A;  5E17 F;  1BIA A;  2DO7 A;  1HSJ A;  2GAU A;  5CVV A;  3DXJ F;  2J5P A;  5HDG A;  5L3E A;  4Q5S F;  2LKP A;  5L3B A;  3F8C A;  3E6C C;  4ESB A;  2GQQ A;  2CQK A;  3KLO A;  1P2F A;  4OOI A;  4CYD A;  1LDD A;  3HRT A;  1GXQ A;  5TJJ A;  1YFH A;  3ELK A;  4G7H F;  4PCQ A;  4XSX F;  2RQP A;  1CF7 A;  4ZYG A;  2OD5 A;  5BPD A;  3GXO A;  1DP7 P;  1MZB A;  1DDN A;  2HZT A;  4I7H A;  3PQJ A;  4Y17 A;  5H6R A;  3SZP A;  4RGS A;  4EQQ A;  2XHK A;  1W4M A;  1IW7 F;  1BN5 A;  3RDI A;  1XSX A;  4OIP F;  2QBY A;  1FLI A;  1U8R A;  3BRO A;  2G7H A;  1IRF A;  2DBB A;  2W24 A;  4R1H A;  1B59 A;  5DUI A;  5ICE A;  1EV7 A;  4P96 A;  2Z33 A;  4HA8 A;  3C7J A;  2F5E A;  2LSO A;  3K69 A;  2EFQ A;  2Q2E A;  1U5T C;  1T0F A;  3GWZ A;  2A68 F;  2MH2 A;  3K9T A;  5DV5 A;  2PJP A;  2M87 A;  5JR3 A;  3T0Y A;  4EJO A;  4GCV A;  3L00 A;  6PAX A;  5BS6 A;  4Q47 A;  2BEO A;  1HKT A;  2ZNZ A;  3GUD A;  4D0P A;  4B09 A;  1BI3 A;  3LQR A;  1K79 A;  1YW7 A;  2D1H A;  2KRF A;  4E70 A;  3COA C;  4EGZ A;  4KMU X;  1A04 A;  4ZYE A;  5HDK A;  1OPC A;  3V8J A;  4LLL A;  3P7N A;  3KFW X;  2ZJ2 A;  3F8M A;  3GFJ A;  2DK8 A;  2ZME A;  3T1B A;  1XDS A;  2ZCW A;  3LAP A;  3JSO A;  3IKV A;  3VFZ A;  4YFX F;  1IZ1 A;  3I64 A;  3EYI A;  3F23 A;  1S3J A;  3SXY A;  3MZH A;  1TNT A;  1DPU A;  2FA5 A;  2CSO A;  1D5V A;  3E5X A;  1KQ8 A;  3HSR A;  3V7C A;  2XUB A;  5J8C A;  2P5K A;  5FD6 A;  1ZHF A;  2VC0 A;  4WK8 F;  5DD8 A;  4KDP A;  3WTY C;  1KQ0 A;  3RIR A;  2G9W A;  2JPB A;  2QEN A;  2H94 A;  4RS8 A;  3W6J B;  1W5S A;  1O7L A;  3HIF A;  1IXS B;  2A61 A;  4KT5 C;  1MD0 A;  3GZ5 A;  2JRT A;  4G94 A;  5E1W A;  1S29 A;  4G7Z F;  2VE8 A;  5K5Q A;  5LGU A;  5HS9 A;  1LDK B;  4LGW A;  2CYY A;  4XSZ F;  3QPT A;  4P55 A;  1R00 A;  1HXD A;  1BC8 C;  4XLN F;  4U7B A;  3BJO A;  3JAM Z;  1UB9 A;  3W6K B;  5J6X A;  2D45 A;  1SMT A;  4G6Q A;  1RIO H;  4RGU A;  5D8L B;  5BMZ A;  4HF2 A;  4Y15 A;  2FEZ A;  1MGT A;  5LLQ A;  3FX3 A;  4BHB A;  4Z2Y A;  1UST A;  1R1U A;  3DPL C;  1Z91 A;  4KN7 X;  2OBP A;  5DEQ A;  2A6E F;  4CDG A;  3Q9S A;  1ZRD A;  1TLH B;  2ESH A;  1YS6 A;  3L2C A;  1FZP B;  4WCG A;  4BH9 A;  3WTV C;  1R1T A;  2DQR A;  1Z9C A;  4ENJ A;  4EV0 A;  3N4M A;  3ML6 A;  1TQP A;  5K1Y A;  3V8K A;  4O5V A;  2RC4 A;  5E8G A;  4TV7 A;  2FF4 A;  2UXX A;  2LF7 A;  2O0Y A;  3FMR A;  4ENM A;  4L18 B;  1I1G A;  3CUQ A;  1V3F A;  2VBY A;  3ROU A;  1H9T A;  3K2Z A;  2PG4 A;  1R23 A;  3J80 Z;  2DPD A;  2HWV A;  2V1U A;  2ZME B;  2VOP A;  2WC2 A;  1U5T A;  2ZFW A;  2RKH A;  4I01 A;  4HQE A;  1YTY A;  3IWZ A;  1R36 A;  4ESJ A;  2PMU A;  2RVC A;  4EJT A;  2VOD A;  1FP2 A;  3ZMU A;  1SD6 A;  3ZP5 A;  1IN8 A;  5CYV A;  3E5U A;  4HZF A;  5HS8 A;  3KE2 A;  4G9Y A;  4BXU A;  3F6O A;  1B6A A;  2BGC A;  3KZY A;  1OR7 A;  2L54 A;  4I2O A;  1ON2 A;  4HV6 A;  3VOD A;  1ZAR A;  1F5T A;  3BPX A;  3BOQ A;  1MKM A;  5HLH A;  2W57 A;  5E8I A;  3BY6 A;  5LHI A;  2VON A;  1SFU A;  3CJN A;  4OIQ F;  4ETS A;  5FLX Z;  4HF1 A;  4MGR A;  1GXP A;  1IXC A;  4L5J A;  5J8F A;  1KA8 A;  3DF8 A;  3TOA A;  3DP7 A;  2VBZ A;  2MLG A;  3WE3 A;  5AIP A;  1R22 A;  2XIG A;  1JHH A;  3ULQ B;  2GA1 A;  2OZU A;  1JHF A;  2PFB A;  1FBS A;  3GX4 X;  2COM A;  2GA2 A;  5FB2 A;  1K6O A;  2FOK A;  4A5N A;  1IUY A;  1FYL A;  1BM9 A;  3R6S A;  3IKT A;  4UVA A;  2K02 A;  3RKW A;  4YG2 F;  5CVU A;  4KFC A;  3KP6 A;  3F8N A;  1G3S A;  2NNY A;  2IW5 A;  1W7P B;  2ZNY A;  3SFZ A;  3V7S A;  1WKM A;  2E1C A;  5DD4 A;  1R5H A;  2HS5 A;  1TTY A;  3VOE A;  3CUQ C;  3FWE A;  4HLY A;  3HYI A;  4MQV A;  3CLO A;  4WF2 A;  2YR2 A;  2MC3 A;  3K1N A;  3L7W A;  4DQ2 A;  3KZZ A;  3DKW A;  3FXU A;  5CVR A;  1J5Y A;  1FX7 A;  5D8K B;  5L3G A;  1STZ A;  2L3D A;  4HOB A;  4IRG A;  2QQA A;  4WX9 A;  2PBI A;  1S6L A;  3K1P A;  3JW4 A;  3MQ0 A;  2XV4 S;  3C18 A;  4HX7 A;  1ZRF A;  3G3Z A;  4A0Y A;  1FNN A;  3LA7 A;  2RGV A;  2P5L C;  4A6E A;  1ZGA A;  2BE5 F;  1J0R A;  3GLX A;  1P4A A;  1K78 A;  3SZT A;  2GXG A;  4AWX B;  3WTU C;  2QBY B;  3RKX A;  1IRG A;  2VT3 A;  2GWR A;  5H6Q A;  3BDD A;  3P9I A;  3ZMZ A;  5LGN A;  3TO9 A;  4HDU A;  4I98 B;  3I71 A;  2DLL A;  2P7V B;  2NNN A;  1J9I A;  3KP5 A;  3E6D A;  3I59 A;  3U1D A;  2Y48 A;  5LHH A;  5IT3 A;  3AAF A;  5FFX A;  1WRJ A;  4NB5 A;  2VOO A;  1TW3 A;  4RAY A;  3QAH A;  2WTE A;  3F72 A;  3V8L A;  5LHG A;  3HUG A;  1MJ9 A;  3R0J A;  3TO6 A;  4ENN A;  3WE2 A;  1SAX A;  1KU2 A;  3KEQ A;  3TQN A;  3DFG A;  1D3Y A;  1IN4 A;  1O3S A;  4UV9 A;  5LRS A;  3F3X A;  4OU0 A;  1EH6 A;  4IRH A;  2Z5U A;  3JAM K;  3WTS C;  3E6M A;  2KJB A;  5ICF A;  2HFH A;  1WQ2 A;  1E2X A;  4FX4 A;  3IRR A;  1MDM A;  2DAO A;  5BOX A;  4WXC A;  2XKO A;  1DUX C;  4M9S A;  2QQB A;  1HQC A;  1T39 A;  3ZPL A;  1OKR A;  2GXB A;  3K0L A;  1KU3 A;  4LB5 A;  4UV8 A;  3ERE D;  5ERI A;  2QWW A;  3JTH A;  4KNY A;  2CGP A;  1YQA A;  1AWC A;  4EJW A;  3QRF F;  1VTN C;  2OAZ A;  3K1M A;  3M1E A;  1W7P A;  5HLI A;  3HOT A;  2A69 F;  3TDU C;  3D0S A;  3WOD F;  5BPI A;  1U78 A;  1OMI A;  2K86 A;  1LQ1 A;  4NHJ A;  2FML A;  1QNT A;  4GO1 A;  2BYV E;  3IC7 A;  2JSC A;  2EB7 A;  1Y0U A;  1V4R A;  2STT A;  2HGC A;  5HOO A;  1F9N A;  1ZYR F;  2O6G E;  4RGR A;  1HW1 A;  2ELH A;  2LNB A;  2YX7 A;  4UVB A;  2X0L A;  4AIH A;  3SQN A;  1ZG1 A;  3NQO A;  1LVA A;  3IRQ A;  3FM5 A;  3IWF A;  1FYK A;  2M5W A;  2XRN A;  4O3M A;  2WWY A;  2P4W A;  3HHG A;  3S2W A;  3TOB A;  2IRF G;  1SFX A;  2DU9 A;  1F1Z A;  2UXN A;  1ZLK A;  3P9K A;  4LFU A;  4EM1 A;  3CO6 C;  3QU6 A;  2MBF A;  5HS7 A;  1LNW A;  3F6V A;  1L0O C;  4BHC A;  1BI2 A;  4N9H A;  3I53 A;  4G7O F;  2P8T A;  3F21 A;  2JPC A;  3I0T A;  1O3T A;  2V79 A;  4XRF A;  2M45 A;  1XMK A;  3L9F A;  1HST A;  3B02 A;  4KIF A;  4CHU A;  1ZAO A;  2NAZ A;  4KIG A;  1KQ9 A;  1K7A A;  2ESN A;  1XSV A;  1YYV A;  3HTU A;  2HOE A;  2IVM A;  2A07 F;  3I4P A;  4U0V A;  1KU7 A;  1XGM A;  3ISP A;  4ZH4 F;  2A6H F;  4A12 A;  3LWF A;  4FHT A;  2DQL A;  3LAJ A;  1G4D A;  3T5X A;  4HX8 A;  1UHM A;  2EK5 A;  2XAH A;  1IN7 A;  1GVJ A;  4HW0 A;  4LK1 F;  1C0W A;  3KLN A;  2VN2 A;  4PDK A;  1BJA A;  2IPQ X;  5A2Q Z;  3LST A;  2YU3 A;  4KYW A;  3N97 A;  2ADU A;  1FBU A;  2Q0O A;  3GO5 A;  4ASN A;  4PGH A;  3WTX C;  1ZG3 A;  3DPT A;  2D1V A;  5D4S A;  4L9N A;  4LMY A;  4KUM A;  4LLG F;  1ZH5 A;  1HW5 A;  1BC7 C;  1FYM A;  4P9F A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...