1MBJA

Mouse c-myb dna-binding domain repeat 3
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
total genus 16
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbjA00
2CUFA 4A3KJ 3JRFA 5JLWA 2R92J 4V2FA 2MG4A 1T33A 2E2JJ 2LFBA 4A69C 5K7ZA 1FTTA 4A3LJ 4FISA 1EF4A 3C2BA 4G12A 2TRTA 2DJNA 5DTDA 3TW6A 4DW6A 2VKEA 1A5JA 1B72B 1ZGWA 5C44J 4A3FJ 3OIOA 1JKOC 4W1UA 4IHXA 2Y9ZA 2R5YB 2JA5J 1H8AC 5EGOB 1RPWA 3BG3A 2M8GX 2M0CA 1WPKA 2L7FP 1FTZA 1ETXA 3CDLA 4AYBN 1JKRC 2HOAA 3JRCA 3E7LA 1RETA 3A03A 3JRHA 4A3MJ 4BKXA 5E3MA 3S1QJ 2R0QC 1D5YA 5IPAA 2D5VA 5J1RA 4EEFG 2DMUA 1ETVA 4BY7J 4DYQA 2NVXJ 2M2EA 1GV2A 3A01B 4I6ZA 1GV5A 2M9HA 3DCFA 3O8GA 4M6VA 5M5XJ 2R5ZA 3PO3J 3MKLA 1JJ8C 3K7AJ 5C4XJ 4MO7A 4NDLA 2CQXA 3DEWA 4IHWA 4M3DA 1ETYA 2DTZA 2OPTA 1IG7A 2VUMJ 3IH2A 5FKKA 4M3FA 3ZQFA 1JKQC 3NAUA 3G1MA 4CYCA 3HKZN 2P81A 4MIMA 3G1OA 5IOYA 2E2HJ 3RZDJ 5F04A 3ZQHA 2TCTA 1F36A 1H88C 4AUXA 2WV1A 2FQ4A 1IDZA 3GTMJ 1RR7A 4L5EA 3GTQJ 5GP9A 5EG0A 3RKQA 2FD5A 2XGCA 3GTPJ 2JJ7A 2HOTA 5FLMJ 1O4XA 1YRNA 2VI6A 2L7MP 3BR3A 1Q1VA 2GLOA 1P7JA 1W0TA 5M5WJ 4JX4A 4C2MJ 4BXXJ 5DS9A 3S1MJ 2W48A 1X2MA 3TP0A 5F08A 4UUSA 4Y7NJ 5FJ8J 3CMYA 1BW6A 2CJJA 1AHDP 3Q0VA 4Y52J 3RQIA 1T56A 2ZB9A 5GPAA 5F1JA 4DZPA 1MBGA 3JRDA 4XIDA 2N8GA 3VPRA 2K9NA 2DMQA 5FKOA 5JLXA 2EZKA 2L7ZA 1F43A 4A3GJ 5EDNA 3H3VK 2LLKA 3S15J 3QPSA 4A3EJ 5E3NA 5FLVA 1RKTA 2ECBA 3QPLA 5EF6A 4JX6A 3H0GJ 1ITYA 3GBGA 4A3DJ 4MFEA 5M3FJ 1CQTA 1MNMC 3Q0WA 3IV5A 4BBSJ 2EH3A 2R5ZB 1HLVA 4JX5A 3JRAA 1JUPA 5F0FA 9ANTA 2LVSA 2EZIA 4HNVA 2XPWA 4FCYA 2DA6A 2X6OA 4V2GA 3BTCA 4C3JJ 4M3GA 4LOCA 1HCRA 1MBHA 2XGEA 1IDYA 1LFBA 1TWFJ 2DA1A 4RBOA 3HB9A 2MSYA 2JA7J 1VF9A 2AO9A 2RAEA 2L0KA 1FJLA 3JRBA 1I3QJ 2XRLA 3S17J 2XSDC 2O8KA 3I4NJ 4XRMA 5EEAA 5J1YA 5EYRA 3MVPA 1X58A 2E19A 1IJWC 2NVQJ 2X48A 1POGA 5EG0B 3FISA 3S16J 1MH3A 5IP6A 1YRNB 5J3LA 2KT0A 3PM1A 4DYCA 2DMPA 2PMZN 1WH5A 2COBA 1A6IA 3L1PA 2ME0A 1TWHJ 3A02A 3B6AA 3BR1A 5HODA 4XRSA 4JP0A 2FJ1A 5FKLA 4D5CA 1ZQ3P 4IHVA 1JT0A 3FK7A 2L9RA 4UUSB 3HOWJ 2JMWA 1MBFA 2XPVA 1JUSA 2CQQA 4ABZA 4D7NA 2LK2A 4RDUA 2NOGA 2X9DA 2HQ5A 2AHQA 2WAQN 1B8IA 2ID6A 1I6HJ 2IEKA 1XC5A 1XS9A 1W0UA 1JKPC 2FX0A 1UMQA 3TW7A 2HYJA 2LKXA 2CU7A 4QSHA 1OFCX 2NS8A 1S7EA 2WB1N 4QTRA 1WCMJ 1Z0XA 4S0HB 2CUEA 3OSFA 3BTIA 2MW8A 2EBIA 2VKVA 1IV6A 3OOUA 1MBKA 1B72A 3BTJA 3ZQLA 1MSFC 2HXIA 1ETOA 2QF7A 1JTYA 2ECCA 5K7HA 3HOVJ 5J1UA 2E2IJ 4J19A 2ID3A 3LSJA 4QIWN 2R93J 2HDDA 2M34A 1TWCJ 4MFDA 1WGXA 1TWGJ 3SDGA 3CCYA 3Q3SA 4MLOA 2JA8J 2LD5A 1FEXA 1AU7A 3PO2J 1HOMA 4X1EA 2LTPA 3LSPA 2HXOA 1ZR2A 1SANA 3HM5A 2DMNA 1HDDC 2KDZA 1JJ6C 2XPUA 3ZQGA 4GFBA 3F0CA 1IC8A 1GVDA 2HOSA 5IYDJ 4FTHA 2K9SA 1QVTA 4I76A 3Q0UA 2JK3A 1WI3A 1ENHA 3JRIA 5IP7J 3ZQCA 3HDDA 3SFIA 3GTOJ 1BW5A 2ME6A 1VI0A 4FE4A 1XG1A 1ZTRA 2EQRA 3O8HA 1P7IA 3IH4A 2LR8A 5M5YJ 1ZK8A 2HI3A 3JR9A 5C3EJ 1NK3P 3RZOJ 2EZHA 1PUFA 5IYCJ 2YU9J 1IGNA 1RKWA 3HGYA 1B8IB 1QPIA 1FIPA 3S2DJ 1MSEC 2DA7A 2GM4A 4CYCB 4XRSG 4B4CA 1HDPA 4B3AA 2EZLA 3OSGA 3IH3A 5EZHA 1DU6A 3I4MJ 2LY9A 4IHYA 3B6CA 2DA2A 1OJLA 1QVUA 2CRGA 3WHBA 4M3EA 3HOUJ 5E3LA 3BR5A 1ETQA 1IRZA 1MBEA 5C4JJ 3S14J 1OCTC 3SJMA 1U78A 5GPCA 3FK6A 2Y9YA 1FIAA 2XB0X 1BL0A 1TC3C 3BTLA 5K7FA 3BG9A 1GUUA 4BBRJ 3NARA 5IP9J 1IUFA 3LSRA 5F0HA 1G2HA 5FKMA 3W6VA 3HOYJ 1WH7A 4A3IJ 1AKHA 4D5FA 1BA5A 4DZJA 1LE8A 3HGGA 1R9TJ 1BJZA 4A93J 3BG5A 1ETWA 3K2AA 3TP3A 2NVYJ 4A3BJ 2DA3A 3CQZJ 5IOZA 3M4OJ 3LNQA 5EZGA 5FKNA 1GDTA 3UKGA 1SFOJ 1H89C 2Y30A 3JRGA 1APLC 1JT6A 2DMTA 3ZQIA 3M3YJ 2NVTJ 4X6AJ 1QRYA 1K83J 1LFUP 3TEDA 2JWTA 1I50J 2Y31A 4XK4A 2E1OA 1VFCA 2VPRA 4C3IJ 4C3HJ 1X2NA 2O7OA 2XGDA 1OCPA 1ZKGA 4A3JJ 2OF7A 1UG2A 2R5YA 2I10A 3BR0A 3BR2A 1GT0C 5EGOA 3S1NJ 2IAIA 2XB5A 2G0EA 2YUSA 1Y1WJ 1U8BA 3GTGJ 4A3CJ 2O9LA 4JYKA 4AC0A 3S2HJ 3ZOBA 1VNDA 3FKIJ 3S1RJ 1PUFB 2DA5A 2DA4A 1ORKA 5F0CA 1NTCA 1Y1VJ 2K9QA 3HOXJ 1ZR4A 4IEJA 3WHCA 4UUTA 5E3OA 5IYBJ 2DN0A 1JTXA 5BNGA 1E3OC 1MBJA 2JA6J 4BY1J 1UHSA 3BQYA 2NS7A 3A01A 5F27A 2H8RA 2JN6A 3JREA 3D1NI 2IBDA 4FE7A 4W97A 1ETKA 1U9OA 3BQZA 1NK2P 1JUMA 3LOCA 3GTKJ 3BR6A 3FIWA 1Z77A 1U9NA 1JGGA 2Y0SN 1MH4A 2K40A 3HOZJ 3GTJJ 2Y2ZA 3LSGA 3MN2A 3GTLJ 4XICA 2H1KA 2MGQA 4D7MA 2ELKA 4B1RA 5M3MJ 1DU0A 2QCOA 1RESA 3BT9A 3HBLA 3QQAA 2YS9A 2R7ZJ 1AKHB 3HEFA 2B63J 4M3BA 1TWAJ 2GBYA 1LE8B 4DYRA 3G1LA 1HF0A 1K61A 2LP0A
chains in the Genus database with same CATH superfamily
4IX7A 5JLWA 1P2FA 2CQKA 3WTWC 4XORA 1R5GA 1OR7C 1T33A 1R49A 2LSOA 4IOAF 3CDIA 5F6FA 1FTTA 2GZWA 1EJ9A 3M8EA 4MEXF 2P8TA 1ZLJA 5L3GA 1MMAA 5L3EA 2VJJA 1Y6IA 4IRIA 3C2BA 4G12A 2PFBA 2EV5A 4RLFA 5CQEA 4I0BA 1K4TA 3S2WA 3QPTA 2VKEA 3K4BA 4NBQA 5KNLA 3M9AA 3OIOA 4RGRA 1JKOC 2XF6A 3CTAA 2FE3A 2HVRA 3LA7A 4IVNA 3I64A 2R7DA 2E1MB 2L7FP 2CMPA 3E5QA 4M73A 2ESHA 4YFKF 4I0AA 2CW7A 3JRCA 2HDCA 1USTA 3HOSA 3JRHA 2DW4A 3VODA 5ILSA 4NC8A 2AS5F 5DDGA 1K7AA 1F4KA 3BG7A 1X1BA 2ZJPF 4C2UA 2IGOA 2AXTC 1FMWA 2Z33A 2ZSHB 2ZJ2A 2JUGA 4M6VA 1MW7A 5LEJA 3DQVC 3Q5FA 1JJ8C 1MJAA 5LGTA 5C4XJ 1IUYA 2GXAA 4DJAA 4MO7A 1EA3A 2L2OA 4JBAA 4U0WA 4PJLA 2HTJA 3DEWA 4IHWA 4EGZA 1XD7A 3EUAA 2OPTA 2DTZA 2LBFA 5J4YA 2OU2A 2QWWA 4M3FA 1JKQC 1YS6A 2ELHA 4HYEA 4EJVA 4CYCA 3HKZN 2FUG2 3F3XA 1V5FA 4D9JA 2Z3YA 4M9ZA 4XR6A 1YHQI 1CF7A 1IZ1A 1P4WA 3ONQA 2YPRA 5FD5A 1F36A 3O3KA 2LREA 5KHDA 2WV1A 2PEXA 2DFEA 1IDZA 2VB6A 3GTMJ 4L5EA 1HW5A 3BLYA 3JW4A 3MZYA 2IS6A 2JVGA 2XGCA 3M7GA 5ICEA 4GCVA 4XQFA 4WX9A 4I02A 1ON2A 2KISA 2W7NA 3FHZA 4HLYA 3W6KB 2D1VA 1V54H 1R4MB 4C2MJ 4BXFA 1SVMA 2RKHA 1XB4A 2W48A 3QOEA 1X2MA 3QOPA 3TP0A 2VBZA 5F08A 4UUSA 3RIRA 2QLZA 1HSTA 1BW6A 1XSXA 3RQIA 3CMEI 4Y52J 2ZB9A 4XOPA 1YX5A 5GPAA 1UELB 1MKMA 4XIDA 4PJNA 2ESNA 3LSIA 4GDFA 3VPRA 2K9NA 3SEQA 3TOAA 3I55I 1VQ6I 2LRDA 1SAUA 3A0HC 5D5WB 3RJPA 4A3EJ 5GAHJ 4F93B 4FETA 3K2ZA 3QPLA 2HZTA 5H2FC 1VQ8I 3AG1H 2KRCA 3H0GJ 1ITYA 3GBGA 5E20A 3OY9A 5M3FJ 4WXDA 4ENNA 3K0LA 3AAFA 1E2XA 3O6BB 4BBSJ 2IGKA 5ILVA 3O2PE 3FX3A 1I3AA 3KX2A 1JUPA 1HLVA 2RGVA 5F0FA 3OYAA 2OJED 2OZUA 1U3EM 1W5TA 4ETSA 4FCYA 4CCLA 4UB8C 1SAXA 2HQNA 4HG2A 5D5VB 1WJAA 3BTCA 4BACA 1MMNA 3CP8A 4LOCA 3G73A 5LHGA 1IDYA 1LDJA 2JA7J 2HKXA 1XTAA 3EYYA 2L0KA 5TGTA 3JRBA 1CF7B 2VXZA 4O5VA 3W2WA 3L2CA 5EYRA 2NVQJ 3ASNH 4UVAA 1B6AA 4RGUA 2P5KA 3S3NA 1S72I 1XDSA 1SEUA 2WB1A 1MH3A 3FXKA 1LFPA 1WWXA 2ZXWH 4FT8A 2KT0A 4YIFA 5TISC 3PM1A 2YU3A 2PMZN 1QZYA 2ME0A 1TWHJ 3BR1A 4BHPA 1ZGAA 1ZH5A 5JFRA 5FKLA 1YW8A 2W24A 5HDKA 1W4MA 4U7DA 1SD4A 5FFXA 4IHVA 3V7CA 2IP2A 4UUSB 3TOBA 4PJ0C 2IVMA 2XPVA 1JUSA 4ABZA 2LK2A 3PNYA 1NG7A 4RDUA 1ZGJA 2RDPA 1A35A 2PI0A 1OPCA 3CESA 3CCSI 4MQVA 4PJMA 3SHFA 1ZELA 3AG4H 1R5HA 1FOKA 1KQ0A 1JKPC 4LG3A 4ZYAA 2LKXA 4ZYGA 3GVAA 2CW0F 5BPDA 2VPLA 5F64A 3IWZA 1LDDA 3ZP5A 1YE9A 1Z0XA 1BN5A 2HKOA 3OL4A 2VONA 2JA2A 3BZ6A 3W2VA 1YI2I 2EBIA 4A6EA 5JVTA 1IV6A 4OAYA 1H0MA 2PX9A 1VTNC 2RNJA 1B72A 2W85A 5E8IA 1ERDA 2V1DA 1MSFC 3KP5A 3HOVJ 5K7HA 2DAOA 2BY0A 2OD5A 2E1NA 3SXYA 4AIJA 2E2IJ 3IAM2 4OIOF 2ID3A 2EA2A 2M0MA 2HDDA 2D1HA 1J59A 4E7ZA 1MMSA 3L09A 1Y0NA 4MFDA 2BVLA 4YIRX 2WC2A 2KDOA 2Q1ZB 3F21A 3OYBA 3HM5A 3KIOA 2X85A 2LKPA 2KDZA 4Z2YA 2XPUA 2F4OB 1IC8A 3EYIA 1QBJA 4EGYA 3ELKA 1D1CA 2K9SA 3MWMA 1QVTA 3QYEA 3KYDB 4ON0A 3DP7A 3WTZA 2FOKA 1ENHA 4WCGA 2OA4A 2R4GA 3HJEA 3FM3A 1HC8A 3JSPA 3CCVI 3TQNA 4HLXA 4FE4A 2UXXA 1R22A 1B1BA 1P7IA 3U2RA 3L2RA 1YW7A 1ZRCA 4KYWA 2EFOA 2LR8A 4GRIA 1FBQA 1TT0A 3D5LA 5EEGA 1J09A 4LITA 5IYCJ 3OIQA 4BHCA 2YU9J 1IGNA 3HGYA 4XNFA 1FIPA 1DGRM 2DA7A 2GM4A 4XRSG 1CGPA 3HXLA 1OYWA 4RAYA 3HPGA 2NS0A 3G2BA 3UNGC 3L2WA 3I54A 5EZHA 4CCJA 1IW7F 3GZ6A 3NRVA 4KT6A 4NUBA 2ZSIB 1MGTA 2CRGA 1OCZH 4BYYA 1S29A 2EFNA 4EM0B 2A5WA 3HOUJ 5E3LA 3PNTA 4Y4RA 4QWQA 5DYMA 5HOOA 5C4JJ 1USSA 3S14J 1IRZA 1AOYA 2NRAC 2H6BA 2HGCA 3FK6A 1FIAA 1WJ5A 2IJLA 4WK8F 3BTLA 5K7FA 5GAGJ 2V7FA 1K6YA 3OYLA 1YFHA 1FP2A 1Z3YA 1IUFA 4B09A 1VQ7I 2R7OA 1WH7A 5KAIC 3ULQB 1FBSA 3K10A 2FBKA 2WA0A 4PK4A 2EA4A 5K5OA 3HTSB 1IRGA 1MNEA 1I1SA 4EQQA 5DCMA 2QEXI 1LE8A 1BI1A 2LYCA 1DPRA 5HNFA 1PVEA 4BQOA 2ZFWA 5D6FA 1G3WA 3R0AA 4A3BJ 3GWZA 3LQRA 3LAPA 4UVBA 2I5UA 1BIBA 3WTUC 3LNQA 5FKNA 3UKGA 1H89C 4GGGA 2Y30A 3JRGA 1JT6A 2K7LA 1LJ9A 5LRRA 4RS8A 1Z7UA 3H36A 3WE2A 2NVTJ 1LKXA 1J5YA 2RVCA 4IKFA 4Y17A 3OYEA 3H3ZA 3L9FA 1S9HA 1IAWA 1BC7C 5FLXK 2DT6A 4UY8I 1KU2A 1OCPA 2UWMA 1U5TB 4O6JA 4XN3A 2V6CA 3KZIC 2FEZA 3BR2A 1GT0C 2XROA 1DUXC 2IAIA 2DCEA 2EPFA 2H6CA 3E5UA 2R7TA 3F8CA 5E8GA 1GXPA 3S2HJ 1VZ0A 2ZMEC 2FF4A 3FZVA 3S1RJ 2KFDA 1JI8A 2OAZA 2CGPA 5F0CA 4OMYA 3DFGA 3OIPA 2H8WA 1ZLKA 1ZR4A 4BEHB 1J9IA 3WHCA 4UUTA 4HNTA 4L5IA 1E3OC 2JA6J 2L3DA 1G59A 2QKMB 2BE5F 5F27A 2H8RA 1SD7A 2GIZA 4LLGF 4RMNA 5K5RA 3D1NI 3CO7C 4FE7A 4LD5A 1BIAA 2K3FA 3DTEA 4QPOA 4I99C 4M74A 1JUMA 4Q48A 4BE0A 3CUOA 2EV0A 1OCCH 2A3SA 1R00A 3FIWA 2VKHA 1HQCA 1U9NA 3FDYA 2Y0SN 1MH4A 1LVAA 5E1XA 3GTJJ 3EQLF 4R79A 1BC8C 3GTLJ 3KFWX 4XICA 3OS1A 1FOXA 2MGQA 4N0BA 1HKQA 4BE1A 4D7MA 4U87A 2MC4A 4XKBA 1MJ9A 3PSFA 4TV7A 2M87A 1YTYA 2VQGA 3HBLA 3JSOA 2L9NA 2B63J 1UJ8A 4WXHA 2EFPA 5D4RA 3T5XA 2KZGA 4RB2C 1LE8B 4K2EA 2XVCA 3E97A 5AONA 1HF0A 4AYBA 2AQFA 3N4MA 3QAHA 2CUFA 3ABMH 1MDMA 3OYIA 1HW1A 4V2FA 2MG4A 3TL4X 1YS7A 2E2JJ 3KZZA 5CVRA 5JI6A 4PZJA 5HDGA 4A69C 4PDKA 5LGUA 1VQ5I 4HX4A 3QPHA 4FISA 1G6NA 4OU0A 5E1ZB 1LEAA 1V5GA 3CUQB 1X1AA 2TRTA 2W25A 3HRTA 3TW6A 3C2GA 2ISYA 5HLHA 3A1YA 3WE3A 3RSNA 4DBQA 4XBFA 3H0DA 3CC7I 5CYVA 4LLLA 2HWVA 4IHXA 2PJRA 1TQIA 4HDVA 1RPWA 1TW2A 1WPKA 2E35A 2YX7A 5J6XA 1E17A 1FTZA 4BE2A 3OV8A 4Y15A 4H4KC 5D5UB 5FLXZ 2QUFA 2K9MA 2Q8KA 4ZYDA 2QQBA 4A3MJ 4BKXA 4CGZA 5K1YA 2WBMA 2MC3A 4U0YA 3W6JB 1X1DA 4EEFG 2RC4A 3CJQB 3CZ6A 2M2EA 1DPUA 1GV2A 5ED4A 4L18B 2ACJA 3ABUA 3OMYA 4XSZF 1WRJA 3A4CA 4G6QA 4KJZA 4ZC3A 3RPUD 1P4XA 2QENA 3MKLA 4RA2A 1RZ4A 1XGNA 2BXZA 3K9TA 2F5EA 3CMMA 3UR3C 1BJAA 1HXDA 2YSRA 1FWZA 3SZTA 3IWFA 4ENMA 1Z6RA 1PUEE 5J4VA 3M8JA 1RRJA 4KN4X 4II2A 3V4GA 2BBYA 3AG2H 2DFHA 2VUMJ 3IH2A 3ZQFA 2NOJB 3NAUA 2P81A 2IGMA 4E70A 2L9VA 1OQYA 4M71A 2E2HJ 4DOZA 3RZDJ 1FT9A 3H5AA 4D0PA 5TJJA 2VJ4A 3LSTA 3NWSA 4AUXA 4BJTA 1H88C 1QNTA 1ON1A 1RR7A 1WJDA 2RNGA 2WADA 3REOA 2BEOA 3RPQA 1OR7A 4A12A 1VQNI 4LIUA 1MDMB 2XKPA 3GTPJ 2JJ7A 1ZG3A 4BJ5C 2IPQX 1O4XA 3ZPLA 2L7MP 2HPIA 1XSDA 5M5WJ 2VOPA 1YYVA 2F2EA 3OYFA 5B1AH 4XLHA 3CCMI 4Y7NJ 2AXLA 4XSXF 1OCOH 2L01A 3HG9A 2PJRB 3PFYA 1MBGA 3GXOA 3M8FA 4M6YA 2P5VA 3CP2A 2NNNA 2RQQA 3KP4A 2V9PA 5FKOA 4M9SA 1M1EB 4RB1A 2L7ZA 1F43A 4A3GJ 3KETA 4BHBA 3H9GA 1QPMA 1F9NA 3QPSA 2RV8A 2R7XA 4PFPA 1IXSB 4ZTFA 4ASNA 5FLVA 1UB9A 2K86A 1IXRC 4OOIA 2DYRH 2MBFA 2H94A 4A3DJ 4CCOA 3NEUA 3CMAI 5JHFA 3IV5A 3COAC 4AD9A 2EH3A 2VN2A 3QP5A 3JRAA 1XPXA 3C7JA 4KA4A 4FX4A 9ANTA 3ABLH 2P0WA 1O3QA 2Z5UA 2EZIA 3V42A 2A68F 2XPWA 4HNVA 3RCOA 4ZDPA 5FD6A 2E5ZA 2R7UA 1VQ9I 2CUJA 4DNCA 5DCFA 2QYOA 1K78A 3WGIA 2E1MC 4P9UA 5ILUA 1LUJB 4M3GA 3J7ZI 1HCRA 5IY5H 1MBHA 1WVRA 2XGEA 3B02A 1FP1D 2DA1A 3HB9A 2MSYA 4PFOA 2G7UA 3QYBA 2RAEA 1I6XA 2WAQA 4CSWA 1FJLA 1I3QJ 2XRLA 1IN7A 2PG4A 3OYHA 2R7SA 3I4NJ 4XRMA 5EEAA 3JCUC 3ML6A 1ONVA 1X58A 3MVPA 3X2QH 1WZ2A 2K5CA 2X48A 3IAS2 1POGA 3MCZA 4WXCA 4XLCA 3S16J 5IP6A 2RQPA 2A61A 2XF7A 3ZMSA 4HW0A 5J3LA 3HRMA 1FSEA 3BZKA 2X1EA 2B0LA 1WH5A 5ICCA 4BUPA 4UB6C 2GOMA 2FJ1A 4BDZA 2GXGA 1UCRA 3C3WA 4IPAA 3H92A 3HOWJ 2CSOA 4YEJA 3J80K 1MBFA 1YO5C 3JTGA 5AIQA 4L0ZB 3ZMVA 4MGRA 4YG2F 1T6SA 3MZHA 4II3A 1WJCA 2CV0A 2X9DA 3OR2C 2V79A 4UHTA 1IN5A 4EJUA 1WSUA 3E6DA 2ID6A 4AWXB 2KPMA 1IN8A 2FU4A 4CDGA 5B5EC 3VYRB 1G3TA 1OFCX 2NS8A 3C2HA 1S7EA 2WB1N 3E6BA 3E6CC 3OS2A 4CXFA 3CCJI 4NC6A 1STZA 3OSFA 4G9YA 3BTIA 3E6MA 2HFHA 2NAZA 4KIBA 4R1HA 4L9TA 3FXUA 4XONA 4RM3A 1LVKA 2DO7A 3HSRA 4E7KA 1ETOA 2KQRA 5H20A 3MAJA 3VSKA 5J1UA 1YIOA 3K69A 1L3LA 4LK0F 3OYGA 4IOCF 2O3FA 4J19A 2VL8A 2BZTA 4PGHA 2DI3A 4QIWN 4BXUA 4XM3A 1XSVA 1DGWY 1TWCJ 2DFFA 2L54A 5FGMA 3SDGA 3CCYA 5CLSA 3EETA 2A6EF 4MLOA 1BM9A 2LKSA 4KIFA 2LD5A 1W7PA 4NQWA 1HOMA 3QRFF 4OWRB 4XMYA 1SANA 5JVGF 3KYLA 3FXQA 2XC7A 3BCBA 4BH9A 3ZQGA 2HOSA 5IYDJ 2IT0A 4FTHA 2MD0A 2IRFG 5LBQA 1TNTA 2KRFA 2X6XA 2DODA 1WI3A 1T2KA 4FQGA 4IO9F 2LF8A 3RQ4A 3ZQCA 3HDDA 5A2QK 3CCUI 3GTOJ 1BW5A 2ME6A 3H35A 3BY6A 1O3SA 2ZNYA 1ZTRA 3WTYC 2EQRA 4HEA2 2QSGX 4XLPF 2W1OA 1HSJA 3IH4A 3MMYB 1V5EA 3R6SA 5FFZA 2FOWA 2VE9A 5C3EJ 3VDXA 3RZOJ 3NQOA 4HA8A 1PUFA 1FYMA 2LF7A 3MFKA 4AIDA 1ACIA 2MLGA 3RKXA 1PDNC 1A04A 2LBFB 1QPIA 3S2DJ 1SFUA 4CYCB 4ENJA 2WY7Q 4C9YA 4B3AA 3K4NA 1WFXA 2EZLA 1R71A 3IH3A 3CO6C 3WU2C 3J80Z 4WWCA 3EUHA 4CUGA 4BU2A 1IXCA 2WTEA 3K4LA 3I4MJ 4IHYA 3B6CA 3TO9A 2DA2A 3OWTA 2W4SA 2O5RA 2K4JA 2DQLA 2QBYA 1YQAA 3KE2A 2E60A 1MBEA 3E3VA 3SJMA 2OTLI 4IL6C 4ZDLA 1SFEA 1YLFA 4XLFA 2O03A 3K1MA 1LEBA 1G2HA 2X51A 3ESWB 2QA4I 2M7AA 3F22A 1R58A 5DD4A 1HKSA 1WHUA 2JPBA 1XN7A 1X19A 4HV6A 4D5FA 2UUZA 2R7VA 4J00A 1XGOA 2EINH 3F9KA 2KIMA 3HGGA 1R9TJ 3K6GA 2TDXA 4NQWB 2XAUA 2CW8A 2NVYJ 4S05A 1X1PA 1RI7A 2VBXA 2CUZA 3WTXC 2VXDA 4JK1X 1SFOJ 1GLNA 3M1EA 1APLC 4KMUX 2FBHA 2J5OA 4AIHA 3HRUA 1FYKA 3M3YJ 4P1WA 1KU7A 1SD5A 2KL4A 5KCMA 1QRYA 4NB5A 2BW3A 3DKYA 2O61A 3TKYA 2Y31A 3GF2A 4HQMA 4IRGA 4MTDA 4A0YA 1XMKA 4B8XA 4C3HJ 4S04A 2O7OA 2Q0OA 2COMA 2VLAA 2LC2A 3DLLF 4A3JJ 1UG2A 2B9SA 1FMVA 1K6OA 2M45A 1OMIA 4CCNA 2DTRA 1YJWI 2MFZA 3ABTA 1VNDA 2JTVA 5HS9A 1PUFB 4P55A 5LEKA 2DA4A 1OYIA 1KA8A 5A2QZ 2BY3A 2K9QA 1D0XA 3HOXJ 2R7QA 1D5VA 5E3OA 2VQHA 3L7WA 5B3SH 3TBIA 1MBJA 4RM2A 5E1WA 2VOOA 2IW5A 3A01A 3GZNB 2LNBA 4ZTJA 4LB5A 2IBDA 4GXOA 1Z7LA 3BQZA 1W5SA 4W97A 1TNSA 2Q2EA 2IA2A 2K27A 5GTIC 1NK2P 2QBYB 2K4BA 1G8XA 2OCEA 4HV5A 3GTKJ 2OTJI 1Z77A 2L9SA 2XRNA 4LMYA 2K40A 3HYIA 1WJBA 1U6GA 3KZYA 3MN2A 4IQ4A 4Y33A 2CH0A 4PCQA 4NNJA 3BJ6A 4HF2A 2ZNZA 2QQ8A 1BR4A 4UVCA 3F23A 4C30A 2BYVE 2IA1A 1DU0A 1OLTA 4IJAA 2RREA 3BT9A 2D45A 3PFIA 3ZN1A 2YS9A 1B9MA 3FXLA 3HEFA 1E3PA 1FNNA 1Q1HA 2VT3A 4DYRA 4GO1A 5ICFA 2CS3A 1JE8A 4PJJA 4Y3OA 4RAFA 3RYPA 1IO2A 2L4MA 4XKVA 4HBLA 3T8RA 1S6LA 4L9JA 2F5DA 2FNPA 1UAAA 2BY1A 3CF5F 2JRMA 3E0JB 1QU3A 1EF4A 2ZO4A 2L4AA 4KN7X 1QA6A 4DW6A 2QZ8A 3BWGA 1B72B 1RUNA 4A3FJ 2D2WA 1RR8C 1OKRA 2Y9ZA 2JA5J 1MZBA 1MIJA 1Z21A 1UFMA 3BOQA 1H8AC 4NC7A 2ZMEA 3GFIA 3CCLI 2DYSH 1TL8A 3BG3A 2M8GX 3ZCOA 2M0CA 2BXYA 3FWEA 4HQEA 1ETXA 3P9CA 3U9GA 3HRSA 4AYBN 1JKRC 4M72A 1QZEA 1RETA 3E7LA 3S1QJ 3I53A 4E7LA 2R0QC 3AL0B 2QVOA 1REPC 5FO5A 4HOBA 4XLAA 2DMUA 1ETVA 3J7AO 1OYYA 1D0YA 3RKWA 3A01B 2M8EA 1UHWA 2KIQA 1JXSA 2M9HA 3DCFA 2R5ZA 2ELJA 3AFHA 3FMSA 1B4AA 3ABKH 4OIRF 5GADJ 2Q2EB 1ZYRF 3BJAA 3P9IA 3I5UA 1U2WA 1U5TC 4MHGA 3K7AJ 3FBNB 5ICGA 1V55H 3W3CA 4NDLA 4G7ZF 3QWLA 1LB2A 2CQXA 4CHUA 3V7SA 4CA0A 2JQ7A 2E7WA 1D8JA 4XKCA 5GAEJ 4LGWA 1FZPB 3FKJA 3TGNA 5H6QA 3G1MA 3H9JA 3I58A 3WU1B 3CLOA 1QO0D 3FXRA 3BPXA 3DPTA 3R4KA 4MIMA 4YFXF 5CJ9A 5IOYA 3GX4X 1KQ9A 1VQMI 5F04A 1I27A 5CVVA 3H5NA 4KDPA 1I1GA 4EMSA 2STTA 1H9GA 2DK5A 2VC0A 2VQCA 3AG3H 3BROA 4RB0A 3FMQA 5GP9A 4HRIA 5FB2A 5EG0A 3RKQA 1ZG1A 3H5RA 2XUBA 2HOTA 1T0FA 2IGNA 3BR3A 1Q1VA 2Z1DA 2GLOA 1P7JA 1TW3A 4JOMA 1W0TA 4JX4A 2HS5A 2ZXIA 4BXXJ 2P6SA 2VJIA 5DS9A 1TTYA 3KCCA 1PP8F 2CG4A 5FJ8J 3CMYA 2JUCA 1S3JA 1T56A 1FLIA 1NHAA 2W57A 4DZPA 2KMUA 1FX7A 1X4OA 2N8GA 3MZ8A 1YX3A 3N97A 1VQOI 3PL8A 3U1KA 2A6HF 3RTRA 2F6CA 2ZXJA 4OAZA 4KNYA 5EJCA 4C2TA 3S15J 3V8KA 2E1CA 1D1BA 3A2KA 2DU9A 2MABA 2VBYA 5E3NA 2VQLA 5HLIA 2M30A 3MQ0A 3LSKA 3OYCA 4AIKA 5IT9K 3LMMA 5DCMB 5EF6A 2XASA 4JX6A 2CFOA 3KP3A 3CCRI 3OYNA 4I98B 3LFUA 1YJ9I 2HDWA 4MFEA 3G6EI 1BI3A 1CQTA 1MNMC 3CUQC 3Q0WA 1ODDA 2XSJC 2Y48A 2KHMA 1ZG5A 2R5ZB 2Y75A 3NWTA 4ZJZA 1Z91A 2UV1A 2GXBA 3WG9A 2LVSA 3L00A 2CO5A 2X6OA 2EFWA 4MNUA 1EH8A 4V2GA 2FBIA 3VSLA 3K1NA 2OBPA 1Z05A 1L0OC 1XMAA 1VQKI 4MQ9F 2XIGA 1KU9A 2K02A 4U7BA 4A2UA 2CV1A 1IN6A 4AVPA 1TBXA 4N9HA 2XSDC 3P7NA 3KLNA 3LA3A 3K4CA 5J1YA 3HHGA 3MKWB 2E19A 1IJWC 4XLNF 3VYUB 5EG0B 3BJOA 1MMGA 4A0XA 2CWEA 1N77A 3LSMA 3SDBA 2QQ9A 2OQRA 3HPHA 4BGDA 1R36A 2ZC2A 3I3LA 2XAQA 4DYCA 2CQNA 1SC7A 2LG4A 2ZJQF 2COBA 1A6IA 3L1PA 3B6AA 2DOFA 3A02A 4HX8A 4JP0A 4N4OB 5J8CA 1MMDA 1HBXG 1UHMA 3K4JA 4D7NA 2HZDA 4L5JA 2V1UA 2DFIA 4KICA 2R3SA 4QLCU 1TLHB 2HQ5A 4OINF 2AHQA 2WAQN 1T95A 2A05A 3IUOA 3I4PA 2PMHA 2HR3A 3FMRA 2G7HA 2V1NA 2IEKA 4V19K 1P6RA 3T8TA 1XS9A 2FX0A 1BI0A 1JHHA 1K79A 1GXQA 2HYJA 4QSHA 4KMFA 1YJNI 3FF5A 4J01A 1WCMJ 2KJCA 4S0HB 4G6TB 2CUEA 1BR2A 2M4GA 2V9KA 2JSPA 4ZH4F 3EPZA 3OOUA 3IRRA 2LH9A 3RDIA 3BC8A 5CPRB 3IKTA 1N78A 1E0EA 1MBKA 2BHZA 3BTJA 2F4MB 3ZQLA 4EVIA 2HXIA 4EM1A 4ESBA 3VWBA 2ECCA 1SVLA 2F5CA 2K85A 5IT9Z 1KQ8A 4Z6YA 1K4SA 1Z67A 3LSJA 1SFKA 2C6YA 2R93J 1EV7A 4B3XA 4YIIA 1I5ZA 2IA0A 2Z2SB 2VODA 1WGXA 3CJTB 1TWGJ 3VYSB 1IN4A 4CO8A 3KYCB 3MKZA 2EIJH 3ZQQA 3ZXSA 1FEXA 3DBLB 1A36A 2GOXB 2LTPA 1ZR2A 3N05A 2W00A 4G6DA 4E6KG 4KUMA 4GFBA 1GVDA 4Q4ZF 2DPDA 3HL2A 3R60A 1BOAA 3D5RC 2JK3A 3KLOA 2M4KA 1X3UA 4ITVA 2IXSA 3HTUA 4ESFA 2BV6A 2XKOA 3I59A 2VKDA 3F6OA 1RUOA 5KK1A 2JZYA 3DEEA 3QU6A 2QM3A 2BHYA 4HNUA 4PUSA 4DQ2A 2DOAA 3SZPA 1XG1A 2PMUA 3BPVA 1Y8RB 2X4HA 4CCKA 2ZKZA 1W36C 2HI3A 3JR9A 2XF5A 1SFXA 4DIQA 1TQPA 3LA2A 5L3BA 4HSRA 2G9WA 2Y69H 3P9KA 1T39A 4XL9A 5LHHA 5CVJA 4B4CA 3HOTA 1U8RA 4KITB 1D0ZA 4F3QA 2R7RA 1DU6A 2YX4A 2LY9A 2XAJA 5JR3A 1XCVA 4Q47A 1QVUA 3PUBA 4F91B 1VQLI 4M6XA 4M3EA 3FXOA 3S93A 2X6YA 1ETQA 1OCRH 5LFAA 3K70D 1OCTC 1BI2A 1H9TA 1U78A 4RGSA 4YFNF 1QGPA 1X3ZB 3KEYA 3QP6A 4ZYEA 5J47A 2JVHA 1BL0A 3CJRB 4HAMA 1YW9A 3GCMA 1GUUA 3NARA 4XLEA 5IP9J 4P96A 1ZRDA 3ZRGA 3CCQI 4PSWA 2H27A 3HOYJ 3I9V2 3ERMA 1AKHA 3OYMA 2JPCA 3BDDA 4LFUA 2B7EA 2QQAA 2R7WA 4IZZA 3CD6I 1BA5A 5B66C 4DZJA 1XGSA 1QHGA 1BJZA 3DBHB 1R1TA 5GTHC 4E7JA 4A93J 1ETWA 3K2AA 3C18A 1VQ4I 3CC4I 5FROA 3CQZJ 3A0BC 2ADUA 2VIXA 5IOZA 5EZGA 3M4OJ 5D5XB 2H1LA 2PLYA 3FXJA 1Z9CA 2KIUA 3ZQIA 1FOYA 4HX7A 1P9QC 2O8XA 1K83J 4HZFA 1LFUP 2BVMA 3TEDA 1SMYF 3J7AY 4UXNA 3PUFA 2X0LA 1RC9A 2HTSA 5LRSA 2O6GE 3M1CA 4GYGA 4M9XA 4NHJA 3L2UA 3I59B 2X1CA 3LSHA 2XGDA 4DGWB 4Q5SF 3SFZA 4HF0A 2R5YA 3BR0A 4IF4A 4D1QA 3IP4B 1T8IA 2NYXA 5EGOA 3S3OA 2QSFX 2PJPA 2DOEA 3S1NJ 3QYFA 2G0EA 1B59A 2FRHA 3T1BA 1U8BA 4A3CJ 4JYKA 4AC0A 2DT7B 3FKIJ 1ZREA 2PBIA 1K78B 2A07F 4CCMA 3CLQA 3HIFA 1NTCA 1Y1VJ 2WV0A 1Y56A 4IXAA 2ZJRF 1U0JA 3HSEA 4FX0A 2EFQA 3BCAA 1JTXA 5BNGA 2UZKA 3BQYA 1X1CA 3W2AA 3WU0A 4CZZA 2JN6A 1XCBA 3LAJA 2BY2A 1ETKA 4BQNA 1TQMA 1WQ2A 2BOLA 3LOCA 5HS8A 1FOWA 3GLLA 3MEXA 2XDVA 1P92A 3LSGA 3B73A 5HLGA 3AKZA 2H1KA 1VQPI 1D3YA 2OV7A 3ECHA 3IKVA 4ZYHA 2L02A 4I7HA 2DPUA 1GHCA 2ELKA 4B1RA 2RN7A 5M3MJ 2QCOA 4OIQF 1RESA 4A5NA 4P9FA 4UV8A 2DDBA 3QQAA 1FPQA 3QODA 3JTHA 4RAZA 1AKHB 2GWRA 2HVSA 2OZ6A 1TWAJ 3V7RA 2KLOA 5DUKA 3TO7A 3JAMK 4E7IA 2FXAA 1S5LC 2V6EA 4HDUA 2K3PA 2LP0A 3IL2A 2IS2A 4EV0A 4A3KJ 3JRFA 1RNLA 2LY2A 3ERED 3F8NA 2E34A 2R92J 4CZCA 4MEYF 3FM5A 4ENKA 1MJBA 4G7OF 2LFBA 3LQQA 5K7ZA 3GFMA 4A3LJ 2UXNA 4KISA 2DJNA 2DT5A 5DTDA 1PYVA 2EB7A 1A5JA 3I0TA 2A5YB 1ZGWA 4EATA 5C44J 3HUGA 4W1UA 4IHTA 1W36D 1F1ZA 2R5YB 4YELA 1BBYA 4RAGA 5J40A 1KONA 4R8HA 4HSTA 5EGOB 3GFJA 2Z99A 2K9LA 1KGSA 4IHSA 4UNOA 3TMOA 3PIOF 1QHHD 2HPMA 5J8FA 3CDLA 3HKZA 3IRQA 4N4NB 2M5WA 2HOAA 4DBRA 1S8NA 5H6RA 2VC1A 3BG6A 3A03A 5DUIA 2WWYA 3Q9VA 4L9NA 5E3MA 4Y13A 2DXIA 4P5OA 2KP6A 1W7PB 2Z16A 1D5YA 5IPAA 2X6WA 2D5VA 5J1RA 2DBBA 3TO6A 4BY7J 4DYQA 2NVXJ 5D8KB 4E7SA 4I6ZA 1GV5A 4LIVA 3K4MA 1X4PA 3O8GA 5DV5A 2E7XA 3C1DA 5M5XJ 3PO3J 1DDNA 4H0EA 4BAYA 3G4SI 5BOXA 2GQQA 3DF8A 1WJFA 2P4WA 2M3AA 2P7CB 4KT5C 4BL0B 4M3DA 1EH7A 4F55A 1C0WA 1ETYA 2DQRA 1IG7A 5FKKA 2VBWA 2A6TA 5D8LB 4I09A 3DTKA 3G1OA 5F1RA 1ZAOA 3ZQHA 2TCTA 5EEHA 3TDUC 4JQFA 2FQ4A 5D4SA 1G3SA 3EUKL 3GTQJ 1R5ID 3EUHC 3ZMUA 4ANJA 5E17F 3F72A 4A0ZA 2E5NA 3GLXA 5JHUA 2FD5A 1BOBA 2LDUA 4XOTA 5CVIA 5FLMJ 1W1WE 1YRNA 2VI6A 4G8XA 1W5CC 1JGSA 2MLKA 4A5MA 4CH7A 2I8DA 1V3FA 2ZFUA 1AA7A 3JAMZ 5IT3A 3S1MJ 3RPUA 3KP2A 4XN0A 1JHFA 1OISA 1EH6A 3OL3A 2CJJA 1AHDP 3Q0VA 4MTEA 1LNWA 2F5FA 2GAUA 3HUGB 5F1JA 1KZHA 1XMXA 4BNCA 1WI9A 5LGNA 5FRMA 3JRDA 1Z1DA 1RIOH 4F52A 2GA1A 5HS7A 1O3RA 1SVOA 1WKMA 3DBRB 4XRFA 2HNHA 2DMQA 5JLXA 4E4HA 2EZKA 3ZGKA 3PQKA 3ZMTA 4FHTA 5CVUA 1X3WB 5EDNA 3H3VK 2LLKA 4ESJA 3WTSC 4PSXA 1Y0UA 4AM3A 3CF2A 5L3DA 2P6TA 4LB6B 3U21A 5E18F 2CYYA 4EJOA 1RKTA 3LL7A 2ECBA 2FNAA 2DK8A 2L5QA 4HPQA 2KZVA 3VOEA 3R61A 1J2XA 2PQ8A 3OS0A 5BS6A 2XAHA 3G71I 2VASA 1Y39A 1U5TA 3GW2A 4JX5A 3F8BA 3DWLE 3WGGA 2CFXA 5LHIA 2P5LC 3RI4A 2JRTA 1O57A 3PNVA 5BMZA 5HNHA 2PMZA 2BW3B 2DA6A 1R1VA 2V26A 4I01A 1DQUA 1T08B 2EWNA 2V9VA 1LQ1A 3CJNA 4C3JJ 2J5PA 3FXMA 2HVQA 3F8FA 3KEQA 1TWFJ 1LFBA 2M7BA 3ZN0A 4RBOA 1DP7P 1FYLA 2LMDA 4BEHA 1S7OA 2L7KA 1VF9A 2AO9A 2OQGA 1MD0A 2GIVA 2EK5A 3PQJA 3AL0C 1BR1A 4B47A 2GA2A 3S17J 2F5VA 2O8KA 1LPQA 4LJZF 3LWFA 3SQNA 4BS9A 3VFZA 2R7FA 4RB3C 1T98A 4RGXA 2O0YA 2W84A 5HVQC 1XGMA 3FISA 3OR1C 2PN6A 1QZZA 2VJ5A 3CCEI 3I71A 1YRNB 2H09A 3I56I 1FSHA 5BPIA 2KIFA 2DMPA 1IRXA 4UV9A 3RKYA 5HODA 4XRSA 2ZBKA 2ZXHA 5CKTA 3PJRA 2HYFA 2OUMA 4D5CA 1IF1A 2ISZA 3S8PA 1ZQ3P 3OYDA 1JT0A 3FK7A 4OIPF 3ISPA 2L9RA 1R23A 1ULYA 2JMWA 2MH9A 2CQQA 3K1PA 2OC6A 3DEUA 2EILH 3D0SA 3RYRA 2FA5A 3QU3A 1W7PD 2NOGA 5DM6F 2ETHA 3L2VA 1B8IA 1I6HJ 1FBUA 2DDAA 1HKTA 1XC5A 1W0UA 1UMQA 3ZMZA 3TW7A 2CU7A 2M1BA 5FRNA 4QTRA 4HF1A 3CUQA 3J81K 2MW8A 2XGXA 4G94A 2VKVA 1ZRFA 5DD8A 3GFLA 4BQAA 2KJBA 2W82A 3GYHX 1EKEA 2LY1A 5LLQA 3EDPA 1F5TA 2HQAA 1T38A 1XDUA 2P7VB 2QF7A 3GZ5A 1JTYA 2MYSA 4L0YB 1IV8A 2YR2A 1YIJI 5AIPA 3DU6A 2NXNB 1YOVB 2V1XA 2QGUA 1SMTA 3CDHA 2IS1A 2M34A 3HHHA 1SD6A 3KPHA 4B48A 1HW2A 3Q3SA 5B1BH 2JA8J 3VB2A 1G3YA 2MA3A 6PAXA 3KEOA 1AU7A 3PO2J 4ZDOA 2ZMEB 4X1EA 1D8KA 1A6QA 2HXOA 3LSPA 3DV8A 2DMNA 1HDDC 1JJ6C 4AU7A 1LDKB 3F0CA 2HYGD 3J7YJ 1O7FA 1Y8QB 4I76A 3Q0UA 3FBIB 2WY8Q 4GYIA 3VEPA 3JRIA 2ICWG 4N9IA 5IP7J 2HU9A 4B43A 3SZGA 3SFIA 5LD2C 1J0RA 2ZCWA 2BGCA 1VI0A 4PGGA 1J7KA 2VT2A 3O8HA 3HZJA 4RLQA 3KP6A 5KVRA 4LG0A 5L3FA 4WF2A 3WTVC 3K70C 4BDYA 1J75A 5M5YJ 3DLAA 3OOPA 1ZK8A 4KFCA 2MD5A 1PP7U 4IRHA 2F48A 1NK3P 2EZHA 4FASD 1E3HA 2JSCA 1RKWA 1B8IB 4OMZA 1MSEC 3SYTA 3GMEA 2CV2A 1QQIA 3F6VA 1YITI 1HDPA 3LFKA 3DKXA 3S3MA 3MKYB 3OSGA 1G4DA 1T0FC 4X0GA 2F4IA 2EIKH 2HOEA 3E5XA 3CC2I 4EJWA 1TP4A 1B9NA 2LOOA 1OJLA 2STWA 2DJIA 3H9QA 3WHBA 4BJ6C 3H1CA 3TDZC 4F7ZA 4U0VA 3BR5A 5KAFC 1O7LA 4BQQA 3H3UA 3OYKA 5GPCA 2Y9YA 2NVUB 2XB0X 3WTTC 3V8JA 1TC3C 4IQJA 3BG9A 4L9VA 3R0JA 3D5SC 4BBRJ 3LSRA 4O3MA 5F0HA 5FKMA 1R1UA 4UUVA 3J81Z 3W6VA 1KYWA 3SEZA 5HDNA 2FSWA 5K5QA 4A3IJ 2DLLA 4F92B 3DKWA 5L3CA 3ASOH 3E1SA 1YG2A 3HSFA 1ZHFA 3ECOA 2XV4S 3BG5A 5HLTA 3TP3A 1PJRA 2EIMH 1HA8A 3VYTB 2DA3A 1KU3A 1R7JA 2WAEA 1TT5B 2WAFA 3BP8A 1GDTA 4B44A 1A31A 2DMTA 2XHKA 2FQ3A 2V4JC 4U88A 4I2OA 4X6AJ 3ZMDA 2JWTA 4AVZA 1S7AA 2XAGA 3MD2A 3F8MA 1I50J 1N75A 2VE8A 4XK4A 1N25A 5D6EA 2E1OA 2X1DA 2VPRA 3WG7H 4C3IJ 4ZZDA 1VFCA 3P5JA 2MH2A 1X2NA 1P4AA 4LLNA 3ROUA 1ZKGA 1IRFA 2IS4A 2OF7A 2I10A 2NNYA 2Y0SA 2AQEA 4CICA 3ZR8X 1I39A 3IHUA 2EV6A 2E71A 3DPUA 3M07A 1WJEA 5DEQA 1AWCA 4EJTA 4LG0B 2XB5A 1UG0A 2YUSA 1Y1WJ 2KRHA 3GTGJ 2O9LA 1Z6TA 3ZOBA 1MNDA 1KYZA 4QPQA 2DA5A 1ORKA 1R6RA 1O3TA 2OCCH 1FC3A 3DXJF 5BQTA 4IEJA 1NH3A 1TZLA 1D1AA 3DPLC 1Z3XA 2DN0A 2KKOA 3PSIA 5IYBJ 2CQ7A 3V8LA 3ZQ7A 3OYJA 4BY1J 1UHSA 1R4NB 3L2QA 2NS7A 2FMYA 4YRVA 1ZARA 3FHNA 3S32A 2FMLA 1FY7A 2HQRA 3JREA 2JT1A 3BZCA 3HC7A 3K4KA 1U9OA 3Q9SA 3T0YA 3WODF 3IC7A 1NG6A 1XX5A 4XKWA 3BR6A 2A69F 2Y0MA 4ZZLA 3DU5A 1JGGA 3HOZJ 3DTIA 5ERIA 5TRDA 2Y2ZA 2QSHX 2EJRA 2Z9OA 4CYDA 5DM7F 3PIPF 5CQGA 3GEZA 4E7HA 1DP3A 3KP7A 1UZCA 1ZN2A 2R7ZJ 5E79C 3GUDA 2QKLB 4EM2A 4KIGA 4M3BA 1GVJA 3U1DA 2GBYA 2HEOA 2E36A 3G3ZA 4A6DA 4LK1F 3G1LA 1K61A 4G7HF 2XAFA 1V4RA 3GO5A 3WGHA
chains in the Genus database with same CATH topology
2CUFA 4A3KJ 3JRFA 5JLWA 2R92J 4V2FA 2MG4A 1T33A 2E2JJ 2LFBA 4A69C 5K7ZA 1FTTA 4A3LJ 4FISA 1EF4A 3C2BA 4G12A 2TRTA 2DJNA 5DTDA 3TW6A 4DW6A 2VKEA 1A5JA 1B72B 1ZGWA 5C44J 4A3FJ 3OIOA 1JKOC 4W1UA 4IHXA 2Y9ZA 2R5YB 2JA5J 1H8AC 5EGOB 1RPWA 3BG3A 2M8GX 2M0CA 1WPKA 2L7FP 1FTZA 1ETXA 3CDLA 4AYBN 1JKRC 2HOAA 3JRCA 3E7LA 1RETA 3A03A 3JRHA 4A3MJ 4BKXA 5E3MA 3S1QJ 2R0QC 1D5YA 5IPAA 2D5VA 5J1RA 4EEFG 2DMUA 1ETVA 4BY7J 4DYQA 2NVXJ 2M2EA 1GV2A 3A01B 4I6ZA 1GV5A 2M9HA 3DCFA 3O8GA 4M6VA 5M5XJ 2R5ZA 3PO3J 3MKLA 1JJ8C 3K7AJ 5C4XJ 4MO7A 4NDLA 2CQXA 3DEWA 4IHWA 4M3DA 1ETYA 2DTZA 2OPTA 1IG7A 2VUMJ 3IH2A 5FKKA 4M3FA 3ZQFA 1JKQC 3NAUA 3G1MA 4CYCA 3HKZN 2P81A 4MIMA 3G1OA 5IOYA 2E2HJ 3RZDJ 5F04A 3ZQHA 2TCTA 1F36A 1H88C 4AUXA 2WV1A 2FQ4A 1IDZA 3GTMJ 1RR7A 4L5EA 3GTQJ 5GP9A 5EG0A 3RKQA 2FD5A 2XGCA 3GTPJ 2JJ7A 2HOTA 5FLMJ 1O4XA 1YRNA 2VI6A 2L7MP 3BR3A 1Q1VA 2GLOA 1P7JA 1W0TA 5M5WJ 4JX4A 4C2MJ 4BXXJ 5DS9A 3S1MJ 2W48A 1X2MA 3TP0A 5F08A 4UUSA 4Y7NJ 5FJ8J 3CMYA 1BW6A 2CJJA 1AHDP 3Q0VA 4Y52J 3RQIA 1T56A 2ZB9A 5GPAA 5F1JA 4DZPA 1MBGA 3JRDA 4XIDA 2N8GA 3VPRA 2K9NA 2DMQA 5FKOA 5JLXA 2EZKA 2L7ZA 1F43A 4A3GJ 5EDNA 3H3VK 2LLKA 3S15J 3QPSA 4A3EJ 5E3NA 5FLVA 1RKTA 2ECBA 3QPLA 5EF6A 4JX6A 3H0GJ 1ITYA 3GBGA 4A3DJ 4MFEA 5M3FJ 1CQTA 1MNMC 3Q0WA 3IV5A 4BBSJ 2EH3A 2R5ZB 1HLVA 4JX5A 3JRAA 1JUPA 5F0FA 9ANTA 2LVSA 2EZIA 4HNVA 2XPWA 4FCYA 2DA6A 2X6OA 4V2GA 3BTCA 4C3JJ 4M3GA 4LOCA 1HCRA 1MBHA 2XGEA 1IDYA 1LFBA 1TWFJ 2DA1A 4RBOA 3HB9A 2MSYA 2JA7J 1VF9A 2AO9A 2RAEA 2L0KA 1FJLA 3JRBA 1I3QJ 2XRLA 3S17J 2XSDC 2O8KA 3I4NJ 4XRMA 5EEAA 5J1YA 5EYRA 3MVPA 1X58A 2E19A 1IJWC 2NVQJ 2X48A 1POGA 5EG0B 3FISA 3S16J 1MH3A 5IP6A 1YRNB 5J3LA 2KT0A 3PM1A 4DYCA 2DMPA 2PMZN 1WH5A 2COBA 1A6IA 3L1PA 2ME0A 1TWHJ 3A02A 3B6AA 3BR1A 5HODA 4XRSA 4JP0A 2FJ1A 5FKLA 4D5CA 1ZQ3P 4IHVA 1JT0A 3FK7A 2L9RA 4UUSB 3HOWJ 2JMWA 1MBFA 2XPVA 1JUSA 2CQQA 4ABZA 4D7NA 2LK2A 4RDUA 2NOGA 2X9DA 2HQ5A 2AHQA 2WAQN 1B8IA 2ID6A 1I6HJ 2IEKA 1XC5A 1XS9A 1W0UA 1JKPC 2FX0A 1UMQA 3TW7A 2HYJA 2LKXA 2CU7A 4QSHA 1OFCX 2NS8A 1S7EA 2WB1N 4QTRA 1WCMJ 1Z0XA 4S0HB 2CUEA 3OSFA 3BTIA 2MW8A 2EBIA 2VKVA 1IV6A 3OOUA 1MBKA 1B72A 3BTJA 3ZQLA 1MSFC 2HXIA 1ETOA 2QF7A 1JTYA 2ECCA 5K7HA 3HOVJ 5J1UA 2E2IJ 4J19A 2ID3A 3LSJA 4QIWN 2R93J 2HDDA 2M34A 1TWCJ 4MFDA 1WGXA 1TWGJ 3SDGA 3CCYA 3Q3SA 4MLOA 2JA8J 2LD5A 1FEXA 1AU7A 3PO2J 1HOMA 4X1EA 2LTPA 3LSPA 2HXOA 1ZR2A 1SANA 3HM5A 2DMNA 1HDDC 2KDZA 1JJ6C 2XPUA 3ZQGA 4GFBA 3F0CA 1IC8A 1GVDA 2HOSA 5IYDJ 4FTHA 2K9SA 1QVTA 4I76A 3Q0UA 2JK3A 1WI3A 1ENHA 3JRIA 5IP7J 3ZQCA 3HDDA 3SFIA 3GTOJ 1BW5A 2ME6A 1VI0A 4FE4A 1XG1A 1ZTRA 2EQRA 3O8HA 1P7IA 3IH4A 2LR8A 5M5YJ 1ZK8A 2HI3A 3JR9A 5C3EJ 1NK3P 3RZOJ 2EZHA 1PUFA 5IYCJ 2YU9J 1IGNA 1RKWA 3HGYA 1B8IB 1QPIA 1FIPA 3S2DJ 1MSEC 2DA7A 2GM4A 4CYCB 4XRSG 4B4CA 1HDPA 4B3AA 2EZLA 3OSGA 3IH3A 5EZHA 1DU6A 3I4MJ 2LY9A 4IHYA 3B6CA 2DA2A 1OJLA 1QVUA 2CRGA 3WHBA 4M3EA 3HOUJ 5E3LA 3BR5A 1ETQA 1IRZA 1MBEA 5C4JJ 3S14J 1OCTC 3SJMA 1U78A 5GPCA 3FK6A 2Y9YA 1FIAA 2XB0X 1BL0A 1TC3C 3BTLA 5K7FA 3BG9A 1GUUA 4BBRJ 3NARA 5IP9J 1IUFA 3LSRA 5F0HA 1G2HA 5FKMA 3W6VA 3HOYJ 1WH7A 4A3IJ 1AKHA 4D5FA 1BA5A 4DZJA 1LE8A 3HGGA 1R9TJ 1BJZA 4A93J 3BG5A 1ETWA 3K2AA 3TP3A 2NVYJ 4A3BJ 2DA3A 3CQZJ 5IOZA 3M4OJ 3LNQA 5EZGA 5FKNA 1GDTA 3UKGA 1SFOJ 1H89C 2Y30A 3JRGA 1APLC 1JT6A 2DMTA 3ZQIA 3M3YJ 2NVTJ 4X6AJ 1QRYA 1K83J 1LFUP 3TEDA 2JWTA 1I50J 2Y31A 4XK4A 2E1OA 1VFCA 2VPRA 4C3IJ 4C3HJ 1X2NA 2O7OA 2XGDA 1OCPA 1ZKGA 4A3JJ 2OF7A 1UG2A 2R5YA 2I10A 3BR0A 3BR2A 1GT0C 5EGOA 3S1NJ 2IAIA 2XB5A 2G0EA 2YUSA 1Y1WJ 1U8BA 3GTGJ 4A3CJ 2O9LA 4JYKA 4AC0A 3S2HJ 3ZOBA 1VNDA 3FKIJ 3S1RJ 1PUFB 2DA5A 2DA4A 1ORKA 5F0CA 1NTCA 1Y1VJ 2K9QA 3HOXJ 1ZR4A 4IEJA 3WHCA 4UUTA 5E3OA 5IYBJ 2DN0A 1JTXA 5BNGA 1E3OC 1MBJA 2JA6J 4BY1J 1UHSA 3BQYA 2NS7A 3A01A 5F27A 2H8RA 2JN6A 3JREA 3D1NI 2IBDA 4FE7A 4W97A 1ETKA 1U9OA 3BQZA 1NK2P 1JUMA 3LOCA 3GTKJ 3BR6A 3FIWA 1Z77A 1U9NA 1JGGA 2Y0SN 1MH4A 2K40A 3HOZJ 3GTJJ 2Y2ZA 3LSGA 3MN2A 3GTLJ 4XICA 2H1KA 2MGQA 4D7MA 2ELKA 4B1RA 5M3MJ 1DU0A 2QCOA 1RESA 3BT9A 3HBLA 3QQAA 2YS9A 2R7ZJ 1AKHB 3HEFA 2B63J 4M3BA 1TWAJ 2GBYA 1LE8B 4DYRA 3G1LA 1HF0A 1K61A 2LP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUF A;  4A3K J;  3JRF A;  5JLW A;  2R92 J;  4V2F A;  2MG4 A;  1T33 A;  2E2J J;  2LFB A;  4A69 C;  5K7Z A;  1FTT A;  4A3L J;  4FIS A;  1EF4 A;  3C2B A;  4G12 A;  2TRT A;  2DJN A;  5DTD A;  3TW6 A;  4DW6 A;  2VKE A;  1A5J A;  1B72 B;  1ZGW A;  5C44 J;  4A3F J;  3OIO A;  1JKO C;  4W1U A;  4IHX A;  2Y9Z A;  2R5Y B;  2JA5 J;  1H8A C;  5EGO B;  1RPW A;  3BG3 A;  2M8G X;  2M0C A;  1WPK A;  2L7F P;  1FTZ A;  1ETX A;  3CDL A;  4AYB N;  1JKR C;  2HOA A;  3JRC A;  3E7L A;  1RET A;  3A03 A;  3JRH A;  4A3M J;  4BKX A;  5E3M A;  3S1Q J;  2R0Q C;  1D5Y A;  5IPA A;  2D5V A;  5J1R A;  4EEF G;  2DMU A;  1ETV A;  4BY7 J;  4DYQ A;  2NVX J;  2M2E A;  1GV2 A;  3A01 B;  4I6Z A;  1GV5 A;  2M9H A;  3DCF A;  3O8G A;  4M6V A;  5M5X J;  2R5Z A;  3PO3 J;  3MKL A;  1JJ8 C;  3K7A J;  5C4X J;  4MO7 A;  4NDL A;  2CQX A;  3DEW A;  4IHW A;  4M3D A;  1ETY A;  2DTZ A;  2OPT A;  1IG7 A;  2VUM J;  3IH2 A;  5FKK A;  4M3F A;  3ZQF A;  1JKQ C;  3NAU A;  3G1M A;  4CYC A;  3HKZ N;  2P81 A;  4MIM A;  3G1O A;  5IOY A;  2E2H J;  3RZD J;  5F04 A;  3ZQH A;  2TCT A;  1F36 A;  1H88 C;  4AUX A;  2WV1 A;  2FQ4 A;  1IDZ A;  3GTM J;  1RR7 A;  4L5E A;  3GTQ J;  5GP9 A;  5EG0 A;  3RKQ A;  2FD5 A;  2XGC A;  3GTP J;  2JJ7 A;  2HOT A;  5FLM J;  1O4X A;  1YRN A;  2VI6 A;  2L7M P;  3BR3 A;  1Q1V A;  2GLO A;  1P7J A;  1W0T A;  5M5W J;  4JX4 A;  4C2M J;  4BXX J;  5DS9 A;  3S1M J;  2W48 A;  1X2M A;  3TP0 A;  5F08 A;  4UUS A;  4Y7N J;  5FJ8 J;  3CMY A;  1BW6 A;  2CJJ A;  1AHD P;  3Q0V A;  4Y52 J;  3RQI A;  1T56 A;  2ZB9 A;  5GPA A;  5F1J A;  4DZP A;  1MBG A;  3JRD A;  4XID A;  2N8G A;  3VPR A;  2K9N A;  2DMQ A;  5FKO A;  5JLX A;  2EZK A;  2L7Z A;  1F43 A;  4A3G J;  5EDN A;  3H3V K;  2LLK A;  3S15 J;  3QPS A;  4A3E J;  5E3N A;  5FLV A;  1RKT A;  2ECB A;  3QPL A;  5EF6 A;  4JX6 A;  3H0G J;  1ITY A;  3GBG A;  4A3D J;  4MFE A;  5M3F J;  1CQT A;  1MNM C;  3Q0W A;  3IV5 A;  4BBS J;  2EH3 A;  2R5Z B;  1HLV A;  4JX5 A;  3JRA A;  1JUP A;  5F0F A;  9ANT A;  2LVS A;  2EZI A;  4HNV A;  2XPW A;  4FCY A;  2DA6 A;  2X6O A;  4V2G A;  3BTC A;  4C3J J;  4M3G A;  4LOC A;  1HCR A;  1MBH A;  2XGE A;  1IDY A;  1LFB A;  1TWF J;  2DA1 A;  4RBO A;  3HB9 A;  2MSY A;  2JA7 J;  1VF9 A;  2AO9 A;  2RAE A;  2L0K A;  1FJL A;  3JRB A;  1I3Q J;  2XRL A;  3S17 J;  2XSD C;  2O8K A;  3I4N J;  4XRM A;  5EEA A;  5J1Y A;  5EYR A;  3MVP A;  1X58 A;  2E19 A;  1IJW C;  2NVQ J;  2X48 A;  1POG A;  5EG0 B;  3FIS A;  3S16 J;  1MH3 A;  5IP6 A;  1YRN B;  5J3L A;  2KT0 A;  3PM1 A;  4DYC A;  2DMP A;  2PMZ N;  1WH5 A;  2COB A;  1A6I A;  3L1P A;  2ME0 A;  1TWH J;  3A02 A;  3B6A A;  3BR1 A;  5HOD A;  4XRS A;  4JP0 A;  2FJ1 A;  5FKL A;  4D5C A;  1ZQ3 P;  4IHV A;  1JT0 A;  3FK7 A;  2L9R A;  4UUS B;  3HOW J;  2JMW A;  1MBF A;  2XPV A;  1JUS A;  2CQQ A;  4ABZ A;  4D7N A;  2LK2 A;  4RDU A;  2NOG A;  2X9D A;  2HQ5 A;  2AHQ A;  2WAQ N;  1B8I A;  2ID6 A;  1I6H J;  2IEK A;  1XC5 A;  1XS9 A;  1W0U A;  1JKP C;  2FX0 A;  1UMQ A;  3TW7 A;  2HYJ A;  2LKX A;  2CU7 A;  4QSH A;  1OFC X;  2NS8 A;  1S7E A;  2WB1 N;  4QTR A;  1WCM J;  1Z0X A;  4S0H B;  2CUE A;  3OSF A;  3BTI A;  2MW8 A;  2EBI A;  2VKV A;  1IV6 A;  3OOU A;  1MBK A;  1B72 A;  3BTJ A;  3ZQL A;  1MSF C;  2HXI A;  1ETO A;  2QF7 A;  1JTY A;  2ECC A;  5K7H A;  3HOV J;  5J1U A;  2E2I J;  4J19 A;  2ID3 A;  3LSJ A;  4QIW N;  2R93 J;  2HDD A;  2M34 A;  1TWC J;  4MFD A;  1WGX A;  1TWG J;  3SDG A;  3CCY A;  3Q3S A;  4MLO A;  2JA8 J;  2LD5 A;  1FEX A;  1AU7 A;  3PO2 J;  1HOM A;  4X1E A;  2LTP A;  3LSP A;  2HXO A;  1ZR2 A;  1SAN A;  3HM5 A;  2DMN A;  1HDD C;  2KDZ A;  1JJ6 C;  2XPU A;  3ZQG A;  4GFB A;  3F0C A;  1IC8 A;  1GVD A;  2HOS A;  5IYD J;  4FTH A;  2K9S A;  1QVT A;  4I76 A;  3Q0U A;  2JK3 A;  1WI3 A;  1ENH A;  3JRI A;  5IP7 J;  3ZQC A;  3HDD A;  3SFI A;  3GTO J;  1BW5 A;  2ME6 A;  1VI0 A;  4FE4 A;  1XG1 A;  1ZTR A;  2EQR A;  3O8H A;  1P7I A;  3IH4 A;  2LR8 A;  5M5Y J;  1ZK8 A;  2HI3 A;  3JR9 A;  5C3E J;  1NK3 P;  3RZO J;  2EZH A;  1PUF A;  5IYC J;  2YU9 J;  1IGN A;  1RKW A;  3HGY A;  1B8I B;  1QPI A;  1FIP A;  3S2D J;  1MSE C;  2DA7 A;  2GM4 A;  4CYC B;  4XRS G;  4B4C A;  1HDP A;  4B3A A;  2EZL A;  3OSG A;  3IH3 A;  5EZH A;  1DU6 A;  3I4M J;  2LY9 A;  4IHY A;  3B6C A;  2DA2 A;  1OJL A;  1QVU A;  2CRG A;  3WHB A;  4M3E A;  3HOU J;  5E3L A;  3BR5 A;  1ETQ A;  1IRZ A;  1MBE A;  5C4J J;  3S14 J;  1OCT C;  3SJM A;  1U78 A;  5GPC A;  3FK6 A;  2Y9Y A;  1FIA A;  2XB0 X;  1BL0 A;  1TC3 C;  3BTL A;  5K7F A;  3BG9 A;  1GUU A;  4BBR J;  3NAR A;  5IP9 J;  1IUF A;  3LSR A;  5F0H A;  1G2H A;  5FKM A;  3W6V A;  3HOY J;  1WH7 A;  4A3I J;  1AKH A;  4D5F A;  1BA5 A;  4DZJ A;  1LE8 A;  3HGG A;  1R9T J;  1BJZ A;  4A93 J;  3BG5 A;  1ETW A;  3K2A A;  3TP3 A;  2NVY J;  4A3B J;  2DA3 A;  3CQZ J;  5IOZ A;  3M4O J;  3LNQ A;  5EZG A;  5FKN A;  1GDT A;  3UKG A;  1SFO J;  1H89 C;  2Y30 A;  3JRG A;  1APL C;  1JT6 A;  2DMT A;  3ZQI A;  3M3Y J;  2NVT J;  4X6A J;  1QRY A;  1K83 J;  1LFU P;  3TED A;  2JWT A;  1I50 J;  2Y31 A;  4XK4 A;  2E1O A;  1VFC A;  2VPR A;  4C3I J;  4C3H J;  1X2N A;  2O7O A;  2XGD A;  1OCP A;  1ZKG A;  4A3J J;  2OF7 A;  1UG2 A;  2R5Y A;  2I10 A;  3BR0 A;  3BR2 A;  1GT0 C;  5EGO A;  3S1N J;  2IAI A;  2XB5 A;  2G0E A;  2YUS A;  1Y1W J;  1U8B A;  3GTG J;  4A3C J;  2O9L A;  4JYK A;  4AC0 A;  3S2H J;  3ZOB A;  1VND A;  3FKI J;  3S1R J;  1PUF B;  2DA5 A;  2DA4 A;  1ORK A;  5F0C A;  1NTC A;  1Y1V J;  2K9Q A;  3HOX J;  1ZR4 A;  4IEJ A;  3WHC A;  4UUT A;  5E3O A;  5IYB J;  2DN0 A;  1JTX A;  5BNG A;  1E3O C;  1MBJ A;  2JA6 J;  4BY1 J;  1UHS A;  3BQY A;  2NS7 A;  3A01 A;  5F27 A;  2H8R A;  2JN6 A;  3JRE A;  3D1N I;  2IBD A;  4FE7 A;  4W97 A;  1ETK A;  1U9O A;  3BQZ A;  1NK2 P;  1JUM A;  3LOC A;  3GTK J;  3BR6 A;  3FIW A;  1Z77 A;  1U9N A;  1JGG A;  2Y0S N;  1MH4 A;  2K40 A;  3HOZ J;  3GTJ J;  2Y2Z A;  3LSG A;  3MN2 A;  3GTL J;  4XIC A;  2H1K A;  2MGQ A;  4D7M A;  2ELK A;  4B1R A;  5M3M J;  1DU0 A;  2QCO A;  1RES A;  3BT9 A;  3HBL A;  3QQA A;  2YS9 A;  2R7Z J;  1AKH B;  3HEF A;  2B63 J;  4M3B A;  1TWA J;  2GBY A;  1LE8 B;  4DYR A;  3G1L A;  1HF0 A;  1K61 A;  2LP0 A; 
#chains in the Genus database with same CATH topology
 4IX7 A;  5JLW A;  1P2F A;  2CQK A;  3WTW C;  4XOR A;  1R5G A;  1OR7 C;  1T33 A;  1R49 A;  2LSO A;  4IOA F;  3CDI A;  5F6F A;  1FTT A;  2GZW A;  1EJ9 A;  3M8E A;  4MEX F;  2P8T A;  1ZLJ A;  5L3G A;  1MMA A;  5L3E A;  2VJJ A;  1Y6I A;  4IRI A;  3C2B A;  4G12 A;  2PFB A;  2EV5 A;  4RLF A;  5CQE A;  4I0B A;  1K4T A;  3S2W A;  3QPT A;  2VKE A;  3K4B A;  4NBQ A;  5KNL A;  3M9A A;  3OIO A;  4RGR A;  1JKO C;  2XF6 A;  3CTA A;  2FE3 A;  2HVR A;  3LA7 A;  4IVN A;  3I64 A;  2R7D A;  2E1M B;  2L7F P;  2CMP A;  3E5Q A;  4M73 A;  2ESH A;  4YFK F;  4I0A A;  2CW7 A;  3JRC A;  2HDC A;  1UST A;  3HOS A;  3JRH A;  2DW4 A;  3VOD A;  5ILS A;  4NC8 A;  2AS5 F;  5DDG A;  1K7A A;  1F4K A;  3BG7 A;  1X1B A;  2ZJP F;  4C2U A;  2IGO A;  2AXT C;  1FMW A;  2Z33 A;  2ZSH B;  2ZJ2 A;  2JUG A;  4M6V A;  1MW7 A;  5LEJ A;  3DQV C;  3Q5F A;  1JJ8 C;  1MJA A;  5LGT A;  5C4X J;  1IUY A;  2GXA A;  4DJA A;  4MO7 A;  1EA3 A;  2L2O A;  4JBA A;  4U0W A;  4PJL A;  2HTJ A;  3DEW A;  4IHW A;  4EGZ A;  1XD7 A;  3EUA A;  2OPT A;  2DTZ A;  2LBF A;  5J4Y A;  2OU2 A;  2QWW A;  4M3F A;  1JKQ C;  1YS6 A;  2ELH A;  4HYE A;  4EJV A;  4CYC A;  3HKZ N;  2FUG 2;  3F3X A;  1V5F A;  4D9J A;  2Z3Y A;  4M9Z A;  4XR6 A;  1YHQ I;  1CF7 A;  1IZ1 A;  1P4W A;  3ONQ A;  2YPR A;  5FD5 A;  1F36 A;  3O3K A;  2LRE A;  5KHD A;  2WV1 A;  2PEX A;  2DFE A;  1IDZ A;  2VB6 A;  3GTM J;  4L5E A;  1HW5 A;  3BLY A;  3JW4 A;  3MZY A;  2IS6 A;  2JVG A;  2XGC A;  3M7G A;  5ICE A;  4GCV A;  4XQF A;  4WX9 A;  4I02 A;  1ON2 A;  2KIS A;  2W7N A;  3FHZ A;  4HLY A;  3W6K B;  2D1V A;  1V54 H;  1R4M B;  4C2M J;  4BXF A;  1SVM A;  2RKH A;  1XB4 A;  2W48 A;  3QOE A;  1X2M A;  3QOP A;  3TP0 A;  2VBZ A;  5F08 A;  4UUS A;  3RIR A;  2QLZ A;  1HST A;  1BW6 A;  1XSX A;  3RQI A;  3CME I;  4Y52 J;  2ZB9 A;  4XOP A;  1YX5 A;  5GPA A;  1UEL B;  1MKM A;  4XID A;  4PJN A;  2ESN A;  3LSI A;  4GDF A;  3VPR A;  2K9N A;  3SEQ A;  3TOA A;  3I55 I;  1VQ6 I;  2LRD A;  1SAU A;  3A0H C;  5D5W B;  3RJP A;  4A3E J;  5GAH J;  4F93 B;  4FET A;  3K2Z A;  3QPL A;  2HZT A;  5H2F C;  1VQ8 I;  3AG1 H;  2KRC A;  3H0G J;  1ITY A;  3GBG A;  5E20 A;  3OY9 A;  5M3F J;  4WXD A;  4ENN A;  3K0L A;  3AAF A;  1E2X A;  3O6B B;  4BBS J;  2IGK A;  5ILV A;  3O2P E;  3FX3 A;  1I3A A;  3KX2 A;  1JUP A;  1HLV A;  2RGV A;  5F0F A;  3OYA A;  2OJE D;  2OZU A;  1U3E M;  1W5T A;  4ETS A;  4FCY A;  4CCL A;  4UB8 C;  1SAX A;  2HQN A;  4HG2 A;  5D5V B;  1WJA A;  3BTC A;  4BAC A;  1MMN A;  3CP8 A;  4LOC A;  3G73 A;  5LHG A;  1IDY A;  1LDJ A;  2JA7 J;  2HKX A;  1XTA A;  3EYY A;  2L0K A;  5TGT A;  3JRB A;  1CF7 B;  2VXZ A;  4O5V A;  3W2W A;  3L2C A;  5EYR A;  2NVQ J;  3ASN H;  4UVA A;  1B6A A;  4RGU A;  2P5K A;  3S3N A;  1S72 I;  1XDS A;  1SEU A;  2WB1 A;  1MH3 A;  3FXK A;  1LFP A;  1WWX A;  2ZXW H;  4FT8 A;  2KT0 A;  4YIF A;  5TIS C;  3PM1 A;  2YU3 A;  2PMZ N;  1QZY A;  2ME0 A;  1TWH J;  3BR1 A;  4BHP A;  1ZGA A;  1ZH5 A;  5JFR A;  5FKL A;  1YW8 A;  2W24 A;  5HDK A;  1W4M A;  4U7D A;  1SD4 A;  5FFX A;  4IHV A;  3V7C A;  2IP2 A;  4UUS B;  3TOB A;  4PJ0 C;  2IVM A;  2XPV A;  1JUS A;  4ABZ A;  2LK2 A;  3PNY A;  1NG7 A;  4RDU A;  1ZGJ A;  2RDP A;  1A35 A;  2PI0 A;  1OPC A;  3CES A;  3CCS I;  4MQV A;  4PJM A;  3SHF A;  1ZEL A;  3AG4 H;  1R5H A;  1FOK A;  1KQ0 A;  1JKP C;  4LG3 A;  4ZYA A;  2LKX A;  4ZYG A;  3GVA A;  2CW0 F;  5BPD A;  2VPL A;  5F64 A;  3IWZ A;  1LDD A;  3ZP5 A;  1YE9 A;  1Z0X A;  1BN5 A;  2HKO A;  3OL4 A;  2VON A;  2JA2 A;  3BZ6 A;  3W2V A;  1YI2 I;  2EBI A;  4A6E A;  5JVT A;  1IV6 A;  4OAY A;  1H0M A;  2PX9 A;  1VTN C;  2RNJ A;  1B72 A;  2W85 A;  5E8I A;  1ERD A;  2V1D A;  1MSF C;  3KP5 A;  3HOV J;  5K7H A;  2DAO A;  2BY0 A;  2OD5 A;  2E1N A;  3SXY A;  4AIJ A;  2E2I J;  3IAM 2;  4OIO F;  2ID3 A;  2EA2 A;  2M0M A;  2HDD A;  2D1H A;  1J59 A;  4E7Z A;  1MMS A;  3L09 A;  1Y0N A;  4MFD A;  2BVL A;  4YIR X;  2WC2 A;  2KDO A;  2Q1Z B;  3F21 A;  3OYB A;  3HM5 A;  3KIO A;  2X85 A;  2LKP A;  2KDZ A;  4Z2Y A;  2XPU A;  2F4O B;  1IC8 A;  3EYI A;  1QBJ A;  4EGY A;  3ELK A;  1D1C A;  2K9S A;  3MWM A;  1QVT A;  3QYE A;  3KYD B;  4ON0 A;  3DP7 A;  3WTZ A;  2FOK A;  1ENH A;  4WCG A;  2OA4 A;  2R4G A;  3HJE A;  3FM3 A;  1HC8 A;  3JSP A;  3CCV I;  3TQN A;  4HLX A;  4FE4 A;  2UXX A;  1R22 A;  1B1B A;  1P7I A;  3U2R A;  3L2R A;  1YW7 A;  1ZRC A;  4KYW A;  2EFO A;  2LR8 A;  4GRI A;  1FBQ A;  1TT0 A;  3D5L A;  5EEG A;  1J09 A;  4LIT A;  5IYC J;  3OIQ A;  4BHC A;  2YU9 J;  1IGN A;  3HGY A;  4XNF A;  1FIP A;  1DGR M;  2DA7 A;  2GM4 A;  4XRS G;  1CGP A;  3HXL A;  1OYW A;  4RAY A;  3HPG A;  2NS0 A;  3G2B A;  3UNG C;  3L2W A;  3I54 A;  5EZH A;  4CCJ A;  1IW7 F;  3GZ6 A;  3NRV A;  4KT6 A;  4NUB A;  2ZSI B;  1MGT A;  2CRG A;  1OCZ H;  4BYY A;  1S29 A;  2EFN A;  4EM0 B;  2A5W A;  3HOU J;  5E3L A;  3PNT A;  4Y4R A;  4QWQ A;  5DYM A;  5HOO A;  5C4J J;  1USS A;  3S14 J;  1IRZ A;  1AOY A;  2NRA C;  2H6B A;  2HGC A;  3FK6 A;  1FIA A;  1WJ5 A;  2IJL A;  4WK8 F;  3BTL A;  5K7F A;  5GAG J;  2V7F A;  1K6Y A;  3OYL A;  1YFH A;  1FP2 A;  1Z3Y A;  1IUF A;  4B09 A;  1VQ7 I;  2R7O A;  1WH7 A;  5KAI C;  3ULQ B;  1FBS A;  3K10 A;  2FBK A;  2WA0 A;  4PK4 A;  2EA4 A;  5K5O A;  3HTS B;  1IRG A;  1MNE A;  1I1S A;  4EQQ A;  5DCM A;  2QEX I;  1LE8 A;  1BI1 A;  2LYC A;  1DPR A;  5HNF A;  1PVE A;  4BQO A;  2ZFW A;  5D6F A;  1G3W A;  3R0A A;  4A3B J;  3GWZ A;  3LQR A;  3LAP A;  4UVB A;  2I5U A;  1BIB A;  3WTU C;  3LNQ A;  5FKN A;  3UKG A;  1H89 C;  4GGG A;  2Y30 A;  3JRG A;  1JT6 A;  2K7L A;  1LJ9 A;  5LRR A;  4RS8 A;  1Z7U A;  3H36 A;  3WE2 A;  2NVT J;  1LKX A;  1J5Y A;  2RVC A;  4IKF A;  4Y17 A;  3OYE A;  3H3Z A;  3L9F A;  1S9H A;  1IAW A;  1BC7 C;  5FLX K;  2DT6 A;  4UY8 I;  1KU2 A;  1OCP A;  2UWM A;  1U5T B;  4O6J A;  4XN3 A;  2V6C A;  3KZI C;  2FEZ A;  3BR2 A;  1GT0 C;  2XRO A;  1DUX C;  2IAI A;  2DCE A;  2EPF A;  2H6C A;  3E5U A;  2R7T A;  3F8C A;  5E8G A;  1GXP A;  3S2H J;  1VZ0 A;  2ZME C;  2FF4 A;  3FZV A;  3S1R J;  2KFD A;  1JI8 A;  2OAZ A;  2CGP A;  5F0C A;  4OMY A;  3DFG A;  3OIP A;  2H8W A;  1ZLK A;  1ZR4 A;  4BEH B;  1J9I A;  3WHC A;  4UUT A;  4HNT A;  4L5I A;  1E3O C;  2JA6 J;  2L3D A;  1G59 A;  2QKM B;  2BE5 F;  5F27 A;  2H8R A;  1SD7 A;  2GIZ A;  4LLG F;  4RMN A;  5K5R A;  3D1N I;  3CO7 C;  4FE7 A;  4LD5 A;  1BIA A;  2K3F A;  3DTE A;  4QPO A;  4I99 C;  4M74 A;  1JUM A;  4Q48 A;  4BE0 A;  3CUO A;  2EV0 A;  1OCC H;  2A3S A;  1R00 A;  3FIW A;  2VKH A;  1HQC A;  1U9N A;  3FDY A;  2Y0S N;  1MH4 A;  1LVA A;  5E1X A;  3GTJ J;  3EQL F;  4R79 A;  1BC8 C;  3GTL J;  3KFW X;  4XIC A;  3OS1 A;  1FOX A;  2MGQ A;  4N0B A;  1HKQ A;  4BE1 A;  4D7M A;  4U87 A;  2MC4 A;  4XKB A;  1MJ9 A;  3PSF A;  4TV7 A;  2M87 A;  1YTY A;  2VQG A;  3HBL A;  3JSO A;  2L9N A;  2B63 J;  1UJ8 A;  4WXH A;  2EFP A;  5D4R A;  3T5X A;  2KZG A;  4RB2 C;  1LE8 B;  4K2E A;  2XVC A;  3E97 A;  5AON A;  1HF0 A;  4AYB A;  2AQF A;  3N4M A;  3QAH A;  2CUF A;  3ABM H;  1MDM A;  3OYI A;  1HW1 A;  4V2F A;  2MG4 A;  3TL4 X;  1YS7 A;  2E2J J;  3KZZ A;  5CVR A;  5JI6 A;  4PZJ A;  5HDG A;  4A69 C;  4PDK A;  5LGU A;  1VQ5 I;  4HX4 A;  3QPH A;  4FIS A;  1G6N A;  4OU0 A;  5E1Z B;  1LEA A;  1V5G A;  3CUQ B;  1X1A A;  2TRT A;  2W25 A;  3HRT A;  3TW6 A;  3C2G A;  2ISY A;  5HLH A;  3A1Y A;  3WE3 A;  3RSN A;  4DBQ A;  4XBF A;  3H0D A;  3CC7 I;  5CYV A;  4LLL A;  2HWV A;  4IHX A;  2PJR A;  1TQI A;  4HDV A;  1RPW A;  1TW2 A;  1WPK A;  2E35 A;  2YX7 A;  5J6X A;  1E17 A;  1FTZ A;  4BE2 A;  3OV8 A;  4Y15 A;  4H4K C;  5D5U B;  5FLX Z;  2QUF A;  2K9M A;  2Q8K A;  4ZYD A;  2QQB A;  4A3M J;  4BKX A;  4CGZ A;  5K1Y A;  2WBM A;  2MC3 A;  4U0Y A;  3W6J B;  1X1D A;  4EEF G;  2RC4 A;  3CJQ B;  3CZ6 A;  2M2E A;  1DPU A;  1GV2 A;  5ED4 A;  4L18 B;  2ACJ A;  3ABU A;  3OMY A;  4XSZ F;  1WRJ A;  3A4C A;  4G6Q A;  4KJZ A;  4ZC3 A;  3RPU D;  1P4X A;  2QEN A;  3MKL A;  4RA2 A;  1RZ4 A;  1XGN A;  2BXZ A;  3K9T A;  2F5E A;  3CMM A;  3UR3 C;  1BJA A;  1HXD A;  2YSR A;  1FWZ A;  3SZT A;  3IWF A;  4ENM A;  1Z6R A;  1PUE E;  5J4V A;  3M8J A;  1RRJ A;  4KN4 X;  4II2 A;  3V4G A;  2BBY A;  3AG2 H;  2DFH A;  2VUM J;  3IH2 A;  3ZQF A;  2NOJ B;  3NAU A;  2P81 A;  2IGM A;  4E70 A;  2L9V A;  1OQY A;  4M71 A;  2E2H J;  4DOZ A;  3RZD J;  1FT9 A;  3H5A A;  4D0P A;  5TJJ A;  2VJ4 A;  3LST A;  3NWS A;  4AUX A;  4BJT A;  1H88 C;  1QNT A;  1ON1 A;  1RR7 A;  1WJD A;  2RNG A;  2WAD A;  3REO A;  2BEO A;  3RPQ A;  1OR7 A;  4A12 A;  1VQN I;  4LIU A;  1MDM B;  2XKP A;  3GTP J;  2JJ7 A;  1ZG3 A;  4BJ5 C;  2IPQ X;  1O4X A;  3ZPL A;  2L7M P;  2HPI A;  1XSD A;  5M5W J;  2VOP A;  1YYV A;  2F2E A;  3OYF A;  5B1A H;  4XLH A;  3CCM I;  4Y7N J;  2AXL A;  4XSX F;  1OCO H;  2L01 A;  3HG9 A;  2PJR B;  3PFY A;  1MBG A;  3GXO A;  3M8F A;  4M6Y A;  2P5V A;  3CP2 A;  2NNN A;  2RQQ A;  3KP4 A;  2V9P A;  5FKO A;  4M9S A;  1M1E B;  4RB1 A;  2L7Z A;  1F43 A;  4A3G J;  3KET A;  4BHB A;  3H9G A;  1QPM A;  1F9N A;  3QPS A;  2RV8 A;  2R7X A;  4PFP A;  1IXS B;  4ZTF A;  4ASN A;  5FLV A;  1UB9 A;  2K86 A;  1IXR C;  4OOI A;  2DYR H;  2MBF A;  2H94 A;  4A3D J;  4CCO A;  3NEU A;  3CMA I;  5JHF A;  3IV5 A;  3COA C;  4AD9 A;  2EH3 A;  2VN2 A;  3QP5 A;  3JRA A;  1XPX A;  3C7J A;  4KA4 A;  4FX4 A;  9ANT A;  3ABL H;  2P0W A;  1O3Q A;  2Z5U A;  2EZI A;  3V42 A;  2A68 F;  2XPW A;  4HNV A;  3RCO A;  4ZDP A;  5FD6 A;  2E5Z A;  2R7U A;  1VQ9 I;  2CUJ A;  4DNC A;  5DCF A;  2QYO A;  1K78 A;  3WGI A;  2E1M C;  4P9U A;  5ILU A;  1LUJ B;  4M3G A;  3J7Z I;  1HCR A;  5IY5 H;  1MBH A;  1WVR A;  2XGE A;  3B02 A;  1FP1 D;  2DA1 A;  3HB9 A;  2MSY A;  4PFO A;  2G7U A;  3QYB A;  2RAE A;  1I6X A;  2WAQ A;  4CSW A;  1FJL A;  1I3Q J;  2XRL A;  1IN7 A;  2PG4 A;  3OYH A;  2R7S A;  3I4N J;  4XRM A;  5EEA A;  3JCU C;  3ML6 A;  1ONV A;  1X58 A;  3MVP A;  3X2Q H;  1WZ2 A;  2K5C A;  2X48 A;  3IAS 2;  1POG A;  3MCZ A;  4WXC A;  4XLC A;  3S16 J;  5IP6 A;  2RQP A;  2A61 A;  2XF7 A;  3ZMS A;  4HW0 A;  5J3L A;  3HRM A;  1FSE A;  3BZK A;  2X1E A;  2B0L A;  1WH5 A;  5ICC A;  4BUP A;  4UB6 C;  2GOM A;  2FJ1 A;  4BDZ A;  2GXG A;  1UCR A;  3C3W A;  4IPA A;  3H92 A;  3HOW J;  2CSO A;  4YEJ A;  3J80 K;  1MBF A;  1YO5 C;  3JTG A;  5AIQ A;  4L0Z B;  3ZMV A;  4MGR A;  4YG2 F;  1T6S A;  3MZH A;  4II3 A;  1WJC A;  2CV0 A;  2X9D A;  3OR2 C;  2V79 A;  4UHT A;  1IN5 A;  4EJU A;  1WSU A;  3E6D A;  2ID6 A;  4AWX B;  2KPM A;  1IN8 A;  2FU4 A;  4CDG A;  5B5E C;  3VYR B;  1G3T A;  1OFC X;  2NS8 A;  3C2H A;  1S7E A;  2WB1 N;  3E6B A;  3E6C C;  3OS2 A;  4CXF A;  3CCJ I;  4NC6 A;  1STZ A;  3OSF A;  4G9Y A;  3BTI A;  3E6M A;  2HFH A;  2NAZ A;  4KIB A;  4R1H A;  4L9T A;  3FXU A;  4XON A;  4RM3 A;  1LVK A;  2DO7 A;  3HSR A;  4E7K A;  1ETO A;  2KQR A;  5H20 A;  3MAJ A;  3VSK A;  5J1U A;  1YIO A;  3K69 A;  1L3L A;  4LK0 F;  3OYG A;  4IOC F;  2O3F A;  4J19 A;  2VL8 A;  2BZT A;  4PGH A;  2DI3 A;  4QIW N;  4BXU A;  4XM3 A;  1XSV A;  1DGW Y;  1TWC J;  2DFF A;  2L54 A;  5FGM A;  3SDG A;  3CCY A;  5CLS A;  3EET A;  2A6E F;  4MLO A;  1BM9 A;  2LKS A;  4KIF A;  2LD5 A;  1W7P A;  4NQW A;  1HOM A;  3QRF F;  4OWR B;  4XMY A;  1SAN A;  5JVG F;  3KYL A;  3FXQ A;  2XC7 A;  3BCB A;  4BH9 A;  3ZQG A;  2HOS A;  5IYD J;  2IT0 A;  4FTH A;  2MD0 A;  2IRF G;  5LBQ A;  1TNT A;  2KRF A;  2X6X A;  2DOD A;  1WI3 A;  1T2K A;  4FQG A;  4IO9 F;  2LF8 A;  3RQ4 A;  3ZQC A;  3HDD A;  5A2Q K;  3CCU I;  3GTO J;  1BW5 A;  2ME6 A;  3H35 A;  3BY6 A;  1O3S A;  2ZNY A;  1ZTR A;  3WTY C;  2EQR A;  4HEA 2;  2QSG X;  4XLP F;  2W1O A;  1HSJ A;  3IH4 A;  3MMY B;  1V5E A;  3R6S A;  5FFZ A;  2FOW A;  2VE9 A;  5C3E J;  3VDX A;  3RZO J;  3NQO A;  4HA8 A;  1PUF A;  1FYM A;  2LF7 A;  3MFK A;  4AID A;  1ACI A;  2MLG A;  3RKX A;  1PDN C;  1A04 A;  2LBF B;  1QPI A;  3S2D J;  1SFU A;  4CYC B;  4ENJ A;  2WY7 Q;  4C9Y A;  4B3A A;  3K4N A;  1WFX A;  2EZL A;  1R71 A;  3IH3 A;  3CO6 C;  3WU2 C;  3J80 Z;  4WWC A;  3EUH A;  4CUG A;  4BU2 A;  1IXC A;  2WTE A;  3K4L A;  3I4M J;  4IHY A;  3B6C A;  3TO9 A;  2DA2 A;  3OWT A;  2W4S A;  2O5R A;  2K4J A;  2DQL A;  2QBY A;  1YQA A;  3KE2 A;  2E60 A;  1MBE A;  3E3V A;  3SJM A;  2OTL I;  4IL6 C;  4ZDL A;  1SFE A;  1YLF A;  4XLF A;  2O03 A;  3K1M A;  1LEB A;  1G2H A;  2X51 A;  3ESW B;  2QA4 I;  2M7A A;  3F22 A;  1R58 A;  5DD4 A;  1HKS A;  1WHU A;  2JPB A;  1XN7 A;  1X19 A;  4HV6 A;  4D5F A;  2UUZ A;  2R7V A;  4J00 A;  1XGO A;  2EIN H;  3F9K A;  2KIM A;  3HGG A;  1R9T J;  3K6G A;  2TDX A;  4NQW B;  2XAU A;  2CW8 A;  2NVY J;  4S05 A;  1X1P A;  1RI7 A;  2VBX A;  2CUZ A;  3WTX C;  2VXD A;  4JK1 X;  1SFO J;  1GLN A;  3M1E A;  1APL C;  4KMU X;  2FBH A;  2J5O A;  4AIH A;  3HRU A;  1FYK A;  3M3Y J;  4P1W A;  1KU7 A;  1SD5 A;  2KL4 A;  5KCM A;  1QRY A;  4NB5 A;  2BW3 A;  3DKY A;  2O61 A;  3TKY A;  2Y31 A;  3GF2 A;  4HQM A;  4IRG A;  4MTD A;  4A0Y A;  1XMK A;  4B8X A;  4C3H J;  4S04 A;  2O7O A;  2Q0O A;  2COM A;  2VLA A;  2LC2 A;  3DLL F;  4A3J J;  1UG2 A;  2B9S A;  1FMV A;  1K6O A;  2M45 A;  1OMI A;  4CCN A;  2DTR A;  1YJW I;  2MFZ A;  3ABT A;  1VND A;  2JTV A;  5HS9 A;  1PUF B;  4P55 A;  5LEK A;  2DA4 A;  1OYI A;  1KA8 A;  5A2Q Z;  2BY3 A;  2K9Q A;  1D0X A;  3HOX J;  2R7Q A;  1D5V A;  5E3O A;  2VQH A;  3L7W A;  5B3S H;  3TBI A;  1MBJ A;  4RM2 A;  5E1W A;  2VOO A;  2IW5 A;  3A01 A;  3GZN B;  2LNB A;  4ZTJ A;  4LB5 A;  2IBD A;  4GXO A;  1Z7L A;  3BQZ A;  1W5S A;  4W97 A;  1TNS A;  2Q2E A;  2IA2 A;  2K27 A;  5GTI C;  1NK2 P;  2QBY B;  2K4B A;  1G8X A;  2OCE A;  4HV5 A;  3GTK J;  2OTJ I;  1Z77 A;  2L9S A;  2XRN A;  4LMY A;  2K40 A;  3HYI A;  1WJB A;  1U6G A;  3KZY A;  3MN2 A;  4IQ4 A;  4Y33 A;  2CH0 A;  4PCQ A;  4NNJ A;  3BJ6 A;  4HF2 A;  2ZNZ A;  2QQ8 A;  1BR4 A;  4UVC A;  3F23 A;  4C30 A;  2BYV E;  2IA1 A;  1DU0 A;  1OLT A;  4IJA A;  2RRE A;  3BT9 A;  2D45 A;  3PFI A;  3ZN1 A;  2YS9 A;  1B9M A;  3FXL A;  3HEF A;  1E3P A;  1FNN A;  1Q1H A;  2VT3 A;  4DYR A;  4GO1 A;  5ICF A;  2CS3 A;  1JE8 A;  4PJJ A;  4Y3O A;  4RAF A;  3RYP A;  1IO2 A;  2L4M A;  4XKV A;  4HBL A;  3T8R A;  1S6L A;  4L9J A;  2F5D A;  2FNP A;  1UAA A;  2BY1 A;  3CF5 F;  2JRM A;  3E0J B;  1QU3 A;  1EF4 A;  2ZO4 A;  2L4A A;  4KN7 X;  1QA6 A;  4DW6 A;  2QZ8 A;  3BWG A;  1B72 B;  1RUN A;  4A3F J;  2D2W A;  1RR8 C;  1OKR A;  2Y9Z A;  2JA5 J;  1MZB A;  1MIJ A;  1Z21 A;  1UFM A;  3BOQ A;  1H8A C;  4NC7 A;  2ZME A;  3GFI A;  3CCL I;  2DYS H;  1TL8 A;  3BG3 A;  2M8G X;  3ZCO A;  2M0C A;  2BXY A;  3FWE A;  4HQE A;  1ETX A;  3P9C A;  3U9G A;  3HRS A;  4AYB N;  1JKR C;  4M72 A;  1QZE A;  1RET A;  3E7L A;  3S1Q J;  3I53 A;  4E7L A;  2R0Q C;  3AL0 B;  2QVO A;  1REP C;  5FO5 A;  4HOB A;  4XLA A;  2DMU A;  1ETV A;  3J7A O;  1OYY A;  1D0Y A;  3RKW A;  3A01 B;  2M8E A;  1UHW A;  2KIQ A;  1JXS A;  2M9H A;  3DCF A;  2R5Z A;  2ELJ A;  3AFH A;  3FMS A;  1B4A A;  3ABK H;  4OIR F;  5GAD J;  2Q2E B;  1ZYR F;  3BJA A;  3P9I A;  3I5U A;  1U2W A;  1U5T C;  4MHG A;  3K7A J;  3FBN B;  5ICG A;  1V55 H;  3W3C A;  4NDL A;  4G7Z F;  3QWL A;  1LB2 A;  2CQX A;  4CHU A;  3V7S A;  4CA0 A;  2JQ7 A;  2E7W A;  1D8J A;  4XKC A;  5GAE J;  4LGW A;  1FZP B;  3FKJ A;  3TGN A;  5H6Q A;  3G1M A;  3H9J A;  3I58 A;  3WU1 B;  3CLO A;  1QO0 D;  3FXR A;  3BPX A;  3DPT A;  3R4K A;  4MIM A;  4YFX F;  5CJ9 A;  5IOY A;  3GX4 X;  1KQ9 A;  1VQM I;  5F04 A;  1I27 A;  5CVV A;  3H5N A;  4KDP A;  1I1G A;  4EMS A;  2STT A;  1H9G A;  2DK5 A;  2VC0 A;  2VQC A;  3AG3 H;  3BRO A;  4RB0 A;  3FMQ A;  5GP9 A;  4HRI A;  5FB2 A;  5EG0 A;  3RKQ A;  1ZG1 A;  3H5R A;  2XUB A;  2HOT A;  1T0F A;  2IGN A;  3BR3 A;  1Q1V A;  2Z1D A;  2GLO A;  1P7J A;  1TW3 A;  4JOM A;  1W0T A;  4JX4 A;  2HS5 A;  2ZXI A;  4BXX J;  2P6S A;  2VJI A;  5DS9 A;  1TTY A;  3KCC A;  1PP8 F;  2CG4 A;  5FJ8 J;  3CMY A;  2JUC A;  1S3J A;  1T56 A;  1FLI A;  1NHA A;  2W57 A;  4DZP A;  2KMU A;  1FX7 A;  1X4O A;  2N8G A;  3MZ8 A;  1YX3 A;  3N97 A;  1VQO I;  3PL8 A;  3U1K A;  2A6H F;  3RTR A;  2F6C A;  2ZXJ A;  4OAZ A;  4KNY A;  5EJC A;  4C2T A;  3S15 J;  3V8K A;  2E1C A;  1D1B A;  3A2K A;  2DU9 A;  2MAB A;  2VBY A;  5E3N A;  2VQL A;  5HLI A;  2M30 A;  3MQ0 A;  3LSK A;  3OYC A;  4AIK A;  5IT9 K;  3LMM A;  5DCM B;  5EF6 A;  2XAS A;  4JX6 A;  2CFO A;  3KP3 A;  3CCR I;  3OYN A;  4I98 B;  3LFU A;  1YJ9 I;  2HDW A;  4MFE A;  3G6E I;  1BI3 A;  1CQT A;  1MNM C;  3CUQ C;  3Q0W A;  1ODD A;  2XSJ C;  2Y48 A;  2KHM A;  1ZG5 A;  2R5Z B;  2Y75 A;  3NWT A;  4ZJZ A;  1Z91 A;  2UV1 A;  2GXB A;  3WG9 A;  2LVS A;  3L00 A;  2CO5 A;  2X6O A;  2EFW A;  4MNU A;  1EH8 A;  4V2G A;  2FBI A;  3VSL A;  3K1N A;  2OBP A;  1Z05 A;  1L0O C;  1XMA A;  1VQK I;  4MQ9 F;  2XIG A;  1KU9 A;  2K02 A;  4U7B A;  4A2U A;  2CV1 A;  1IN6 A;  4AVP A;  1TBX A;  4N9H A;  2XSD C;  3P7N A;  3KLN A;  3LA3 A;  3K4C A;  5J1Y A;  3HHG A;  3MKW B;  2E19 A;  1IJW C;  4XLN F;  3VYU B;  5EG0 B;  3BJO A;  1MMG A;  4A0X A;  2CWE A;  1N77 A;  3LSM A;  3SDB A;  2QQ9 A;  2OQR A;  3HPH A;  4BGD A;  1R36 A;  2ZC2 A;  3I3L A;  2XAQ A;  4DYC A;  2CQN A;  1SC7 A;  2LG4 A;  2ZJQ F;  2COB A;  1A6I A;  3L1P A;  3B6A A;  2DOF A;  3A02 A;  4HX8 A;  4JP0 A;  4N4O B;  5J8C A;  1MMD A;  1HBX G;  1UHM A;  3K4J A;  4D7N A;  2HZD A;  4L5J A;  2V1U A;  2DFI A;  4KIC A;  2R3S A;  4QLC U;  1TLH B;  2HQ5 A;  4OIN F;  2AHQ A;  2WAQ N;  1T95 A;  2A05 A;  3IUO A;  3I4P A;  2PMH A;  2HR3 A;  3FMR A;  2G7H A;  2V1N A;  2IEK A;  4V19 K;  1P6R A;  3T8T A;  1XS9 A;  2FX0 A;  1BI0 A;  1JHH A;  1K79 A;  1GXQ A;  2HYJ A;  4QSH A;  4KMF A;  1YJN I;  3FF5 A;  4J01 A;  1WCM J;  2KJC A;  4S0H B;  4G6T B;  2CUE A;  1BR2 A;  2M4G A;  2V9K A;  2JSP A;  4ZH4 F;  3EPZ A;  3OOU A;  3IRR A;  2LH9 A;  3RDI A;  3BC8 A;  5CPR B;  3IKT A;  1N78 A;  1E0E A;  1MBK A;  2BHZ A;  3BTJ A;  2F4M B;  3ZQL A;  4EVI A;  2HXI A;  4EM1 A;  4ESB A;  3VWB A;  2ECC A;  1SVL A;  2F5C A;  2K85 A;  5IT9 Z;  1KQ8 A;  4Z6Y A;  1K4S A;  1Z67 A;  3LSJ A;  1SFK A;  2C6Y A;  2R93 J;  1EV7 A;  4B3X A;  4YII A;  1I5Z A;  2IA0 A;  2Z2S B;  2VOD A;  1WGX A;  3CJT B;  1TWG J;  3VYS B;  1IN4 A;  4CO8 A;  3KYC B;  3MKZ A;  2EIJ H;  3ZQQ A;  3ZXS A;  1FEX A;  3DBL B;  1A36 A;  2GOX B;  2LTP A;  1ZR2 A;  3N05 A;  2W00 A;  4G6D A;  4E6K G;  4KUM A;  4GFB A;  1GVD A;  4Q4Z F;  2DPD A;  3HL2 A;  3R60 A;  1BOA A;  3D5R C;  2JK3 A;  3KLO A;  2M4K A;  1X3U A;  4ITV A;  2IXS A;  3HTU A;  4ESF A;  2BV6 A;  2XKO A;  3I59 A;  2VKD A;  3F6O A;  1RUO A;  5KK1 A;  2JZY A;  3DEE A;  3QU6 A;  2QM3 A;  2BHY A;  4HNU A;  4PUS A;  4DQ2 A;  2DOA A;  3SZP A;  1XG1 A;  2PMU A;  3BPV A;  1Y8R B;  2X4H A;  4CCK A;  2ZKZ A;  1W36 C;  2HI3 A;  3JR9 A;  2XF5 A;  1SFX A;  4DIQ A;  1TQP A;  3LA2 A;  5L3B A;  4HSR A;  2G9W A;  2Y69 H;  3P9K A;  1T39 A;  4XL9 A;  5LHH A;  5CVJ A;  4B4C A;  3HOT A;  1U8R A;  4KIT B;  1D0Z A;  4F3Q A;  2R7R A;  1DU6 A;  2YX4 A;  2LY9 A;  2XAJ A;  5JR3 A;  1XCV A;  4Q47 A;  1QVU A;  3PUB A;  4F91 B;  1VQL I;  4M6X A;  4M3E A;  3FXO A;  3S93 A;  2X6Y A;  1ETQ A;  1OCR H;  5LFA A;  3K70 D;  1OCT C;  1BI2 A;  1H9T A;  1U78 A;  4RGS A;  4YFN F;  1QGP A;  1X3Z B;  3KEY A;  3QP6 A;  4ZYE A;  5J47 A;  2JVH A;  1BL0 A;  3CJR B;  4HAM A;  1YW9 A;  3GCM A;  1GUU A;  3NAR A;  4XLE A;  5IP9 J;  4P96 A;  1ZRD A;  3ZRG A;  3CCQ I;  4PSW A;  2H27 A;  3HOY J;  3I9V 2;  3ERM A;  1AKH A;  3OYM A;  2JPC A;  3BDD A;  4LFU A;  2B7E A;  2QQA A;  2R7W A;  4IZZ A;  3CD6 I;  1BA5 A;  5B66 C;  4DZJ A;  1XGS A;  1QHG A;  1BJZ A;  3DBH B;  1R1T A;  5GTH C;  4E7J A;  4A93 J;  1ETW A;  3K2A A;  3C18 A;  1VQ4 I;  3CC4 I;  5FRO A;  3CQZ J;  3A0B C;  2ADU A;  2VIX A;  5IOZ A;  5EZG A;  3M4O J;  5D5X B;  2H1L A;  2PLY A;  3FXJ A;  1Z9C A;  2KIU A;  3ZQI A;  1FOY A;  4HX7 A;  1P9Q C;  2O8X A;  1K83 J;  4HZF A;  1LFU P;  2BVM A;  3TED A;  1SMY F;  3J7A Y;  4UXN A;  3PUF A;  2X0L A;  1RC9 A;  2HTS A;  5LRS A;  2O6G E;  3M1C A;  4GYG A;  4M9X A;  4NHJ A;  3L2U A;  3I59 B;  2X1C A;  3LSH A;  2XGD A;  4DGW B;  4Q5S F;  3SFZ A;  4HF0 A;  2R5Y A;  3BR0 A;  4IF4 A;  4D1Q A;  3IP4 B;  1T8I A;  2NYX A;  5EGO A;  3S3O A;  2QSF X;  2PJP A;  2DOE A;  3S1N J;  3QYF A;  2G0E A;  1B59 A;  2FRH A;  3T1B A;  1U8B A;  4A3C J;  4JYK A;  4AC0 A;  2DT7 B;  3FKI J;  1ZRE A;  2PBI A;  1K78 B;  2A07 F;  4CCM A;  3CLQ A;  3HIF A;  1NTC A;  1Y1V J;  2WV0 A;  1Y56 A;  4IXA A;  2ZJR F;  1U0J A;  3HSE A;  4FX0 A;  2EFQ A;  3BCA A;  1JTX A;  5BNG A;  2UZK A;  3BQY A;  1X1C A;  3W2A A;  3WU0 A;  4CZZ A;  2JN6 A;  1XCB A;  3LAJ A;  2BY2 A;  1ETK A;  4BQN A;  1TQM A;  1WQ2 A;  2BOL A;  3LOC A;  5HS8 A;  1FOW A;  3GLL A;  3MEX A;  2XDV A;  1P92 A;  3LSG A;  3B73 A;  5HLG A;  3AKZ A;  2H1K A;  1VQP I;  1D3Y A;  2OV7 A;  3ECH A;  3IKV A;  4ZYH A;  2L02 A;  4I7H A;  2DPU A;  1GHC A;  2ELK A;  4B1R A;  2RN7 A;  5M3M J;  2QCO A;  4OIQ F;  1RES A;  4A5N A;  4P9F A;  4UV8 A;  2DDB A;  3QQA A;  1FPQ A;  3QOD A;  3JTH A;  4RAZ A;  1AKH B;  2GWR A;  2HVS A;  2OZ6 A;  1TWA J;  3V7R A;  2KLO A;  5DUK A;  3TO7 A;  3JAM K;  4E7I A;  2FXA A;  1S5L C;  2V6E A;  4HDU A;  2K3P A;  2LP0 A;  3IL2 A;  2IS2 A;  4EV0 A;  4A3K J;  3JRF A;  1RNL A;  2LY2 A;  3ERE D;  3F8N A;  2E34 A;  2R92 J;  4CZC A;  4MEY F;  3FM5 A;  4ENK A;  1MJB A;  4G7O F;  2LFB A;  3LQQ A;  5K7Z A;  3GFM A;  4A3L J;  2UXN A;  4KIS A;  2DJN A;  2DT5 A;  5DTD A;  1PYV A;  2EB7 A;  1A5J A;  3I0T A;  2A5Y B;  1ZGW A;  4EAT A;  5C44 J;  3HUG A;  4W1U A;  4IHT A;  1W36 D;  1F1Z A;  2R5Y B;  4YEL A;  1BBY A;  4RAG A;  5J40 A;  1KON A;  4R8H A;  4HST A;  5EGO B;  3GFJ A;  2Z99 A;  2K9L A;  1KGS A;  4IHS A;  4UNO A;  3TMO A;  3PIO F;  1QHH D;  2HPM A;  5J8F A;  3CDL A;  3HKZ A;  3IRQ A;  4N4N B;  2M5W A;  2HOA A;  4DBR A;  1S8N A;  5H6R A;  2VC1 A;  3BG6 A;  3A03 A;  5DUI A;  2WWY A;  3Q9V A;  4L9N A;  5E3M A;  4Y13 A;  2DXI A;  4P5O A;  2KP6 A;  1W7P B;  2Z16 A;  1D5Y A;  5IPA A;  2X6W A;  2D5V A;  5J1R A;  2DBB A;  3TO6 A;  4BY7 J;  4DYQ A;  2NVX J;  5D8K B;  4E7S A;  4I6Z A;  1GV5 A;  4LIV A;  3K4M A;  1X4P A;  3O8G A;  5DV5 A;  2E7X A;  3C1D A;  5M5X J;  3PO3 J;  1DDN A;  4H0E A;  4BAY A;  3G4S I;  5BOX A;  2GQQ A;  3DF8 A;  1WJF A;  2P4W A;  2M3A A;  2P7C B;  4KT5 C;  4BL0 B;  4M3D A;  1EH7 A;  4F55 A;  1C0W A;  1ETY A;  2DQR A;  1IG7 A;  5FKK A;  2VBW A;  2A6T A;  5D8L B;  4I09 A;  3DTK A;  3G1O A;  5F1R A;  1ZAO A;  3ZQH A;  2TCT A;  5EEH A;  3TDU C;  4JQF A;  2FQ4 A;  5D4S A;  1G3S A;  3EUK L;  3GTQ J;  1R5I D;  3EUH C;  3ZMU A;  4ANJ A;  5E17 F;  3F72 A;  4A0Z A;  2E5N A;  3GLX A;  5JHU A;  2FD5 A;  1BOB A;  2LDU A;  4XOT A;  5CVI A;  5FLM J;  1W1W E;  1YRN A;  2VI6 A;  4G8X A;  1W5C C;  1JGS A;  2MLK A;  4A5M A;  4CH7 A;  2I8D A;  1V3F A;  2ZFU A;  1AA7 A;  3JAM Z;  5IT3 A;  3S1M J;  3RPU A;  3KP2 A;  4XN0 A;  1JHF A;  1OIS A;  1EH6 A;  3OL3 A;  2CJJ A;  1AHD P;  3Q0V A;  4MTE A;  1LNW A;  2F5F A;  2GAU A;  3HUG B;  5F1J A;  1KZH A;  1XMX A;  4BNC A;  1WI9 A;  5LGN A;  5FRM A;  3JRD A;  1Z1D A;  1RIO H;  4F52 A;  2GA1 A;  5HS7 A;  1O3R A;  1SVO A;  1WKM A;  3DBR B;  4XRF A;  2HNH A;  2DMQ A;  5JLX A;  4E4H A;  2EZK A;  3ZGK A;  3PQK A;  3ZMT A;  4FHT A;  5CVU A;  1X3W B;  5EDN A;  3H3V K;  2LLK A;  4ESJ A;  3WTS C;  4PSX A;  1Y0U A;  4AM3 A;  3CF2 A;  5L3D A;  2P6T A;  4LB6 B;  3U21 A;  5E18 F;  2CYY A;  4EJO A;  1RKT A;  3LL7 A;  2ECB A;  2FNA A;  2DK8 A;  2L5Q A;  4HPQ A;  2KZV A;  3VOE A;  3R61 A;  1J2X A;  2PQ8 A;  3OS0 A;  5BS6 A;  2XAH A;  3G71 I;  2VAS A;  1Y39 A;  1U5T A;  3GW2 A;  4JX5 A;  3F8B A;  3DWL E;  3WGG A;  2CFX A;  5LHI A;  2P5L C;  3RI4 A;  2JRT A;  1O57 A;  3PNV A;  5BMZ A;  5HNH A;  2PMZ A;  2BW3 B;  2DA6 A;  1R1V A;  2V26 A;  4I01 A;  1DQU A;  1T08 B;  2EWN A;  2V9V A;  1LQ1 A;  3CJN A;  4C3J J;  2J5P A;  3FXM A;  2HVQ A;  3F8F A;  3KEQ A;  1TWF J;  1LFB A;  2M7B A;  3ZN0 A;  4RBO A;  1DP7 P;  1FYL A;  2LMD A;  4BEH A;  1S7O A;  2L7K A;  1VF9 A;  2AO9 A;  2OQG A;  1MD0 A;  2GIV A;  2EK5 A;  3PQJ A;  3AL0 C;  1BR1 A;  4B47 A;  2GA2 A;  3S17 J;  2F5V A;  2O8K A;  1LPQ A;  4LJZ F;  3LWF A;  3SQN A;  4BS9 A;  3VFZ A;  2R7F A;  4RB3 C;  1T98 A;  4RGX A;  2O0Y A;  2W84 A;  5HVQ C;  1XGM A;  3FIS A;  3OR1 C;  2PN6 A;  1QZZ A;  2VJ5 A;  3CCE I;  3I71 A;  1YRN B;  2H09 A;  3I56 I;  1FSH A;  5BPI A;  2KIF A;  2DMP A;  1IRX A;  4UV9 A;  3RKY A;  5HOD A;  4XRS A;  2ZBK A;  2ZXH A;  5CKT A;  3PJR A;  2HYF A;  2OUM A;  4D5C A;  1IF1 A;  2ISZ A;  3S8P A;  1ZQ3 P;  3OYD A;  1JT0 A;  3FK7 A;  4OIP F;  3ISP A;  2L9R A;  1R23 A;  1ULY A;  2JMW A;  2MH9 A;  2CQQ A;  3K1P A;  2OC6 A;  3DEU A;  2EIL H;  3D0S A;  3RYR A;  2FA5 A;  3QU3 A;  1W7P D;  2NOG A;  5DM6 F;  2ETH A;  3L2V A;  1B8I A;  1I6H J;  1FBU A;  2DDA A;  1HKT A;  1XC5 A;  1W0U A;  1UMQ A;  3ZMZ A;  3TW7 A;  2CU7 A;  2M1B A;  5FRN A;  4QTR A;  4HF1 A;  3CUQ A;  3J81 K;  2MW8 A;  2XGX A;  4G94 A;  2VKV A;  1ZRF A;  5DD8 A;  3GFL A;  4BQA A;  2KJB A;  2W82 A;  3GYH X;  1EKE A;  2LY1 A;  5LLQ A;  3EDP A;  1F5T A;  2HQA A;  1T38 A;  1XDU A;  2P7V B;  2QF7 A;  3GZ5 A;  1JTY A;  2MYS A;  4L0Y B;  1IV8 A;  2YR2 A;  1YIJ I;  5AIP A;  3DU6 A;  2NXN B;  1YOV B;  2V1X A;  2QGU A;  1SMT A;  3CDH A;  2IS1 A;  2M34 A;  3HHH A;  1SD6 A;  3KPH A;  4B48 A;  1HW2 A;  3Q3S A;  5B1B H;  2JA8 J;  3VB2 A;  1G3Y A;  2MA3 A;  6PAX A;  3KEO A;  1AU7 A;  3PO2 J;  4ZDO A;  2ZME B;  4X1E A;  1D8K A;  1A6Q A;  2HXO A;  3LSP A;  3DV8 A;  2DMN A;  1HDD C;  1JJ6 C;  4AU7 A;  1LDK B;  3F0C A;  2HYG D;  3J7Y J;  1O7F A;  1Y8Q B;  4I76 A;  3Q0U A;  3FBI B;  2WY8 Q;  4GYI A;  3VEP A;  3JRI A;  2ICW G;  4N9I A;  5IP7 J;  2HU9 A;  4B43 A;  3SZG A;  3SFI A;  5LD2 C;  1J0R A;  2ZCW A;  2BGC A;  1VI0 A;  4PGG A;  1J7K A;  2VT2 A;  3O8H A;  3HZJ A;  4RLQ A;  3KP6 A;  5KVR A;  4LG0 A;  5L3F A;  4WF2 A;  3WTV C;  3K70 C;  4BDY A;  1J75 A;  5M5Y J;  3DLA A;  3OOP A;  1ZK8 A;  4KFC A;  2MD5 A;  1PP7 U;  4IRH A;  2F48 A;  1NK3 P;  2EZH A;  4FAS D;  1E3H A;  2JSC A;  1RKW A;  1B8I B;  4OMZ A;  1MSE C;  3SYT A;  3GME A;  2CV2 A;  1QQI A;  3F6V A;  1YIT I;  1HDP A;  3LFK A;  3DKX A;  3S3M A;  3MKY B;  3OSG A;  1G4D A;  1T0F C;  4X0G A;  2F4I A;  2EIK H;  2HOE A;  3E5X A;  3CC2 I;  4EJW A;  1TP4 A;  1B9N A;  2LOO A;  1OJL A;  2STW A;  2DJI A;  3H9Q A;  3WHB A;  4BJ6 C;  3H1C A;  3TDZ C;  4F7Z A;  4U0V A;  3BR5 A;  5KAF C;  1O7L A;  4BQQ A;  3H3U A;  3OYK A;  5GPC A;  2Y9Y A;  2NVU B;  2XB0 X;  3WTT C;  3V8J A;  1TC3 C;  4IQJ A;  3BG9 A;  4L9V A;  3R0J A;  3D5S C;  4BBR J;  3LSR A;  4O3M A;  5F0H A;  5FKM A;  1R1U A;  4UUV A;  3J81 Z;  3W6V A;  1KYW A;  3SEZ A;  5HDN A;  2FSW A;  5K5Q A;  4A3I J;  2DLL A;  4F92 B;  3DKW A;  5L3C A;  3ASO H;  3E1S A;  1YG2 A;  3HSF A;  1ZHF A;  3ECO A;  2XV4 S;  3BG5 A;  5HLT A;  3TP3 A;  1PJR A;  2EIM H;  1HA8 A;  3VYT B;  2DA3 A;  1KU3 A;  1R7J A;  2WAE A;  1TT5 B;  2WAF A;  3BP8 A;  1GDT A;  4B44 A;  1A31 A;  2DMT A;  2XHK A;  2FQ3 A;  2V4J C;  4U88 A;  4I2O A;  4X6A J;  3ZMD A;  2JWT A;  4AVZ A;  1S7A A;  2XAG A;  3MD2 A;  3F8M A;  1I50 J;  1N75 A;  2VE8 A;  4XK4 A;  1N25 A;  5D6E A;  2E1O A;  2X1D A;  2VPR A;  3WG7 H;  4C3I J;  4ZZD A;  1VFC A;  3P5J A;  2MH2 A;  1X2N A;  1P4A A;  4LLN A;  3ROU A;  1ZKG A;  1IRF A;  2IS4 A;  2OF7 A;  2I10 A;  2NNY A;  2Y0S A;  2AQE A;  4CIC A;  3ZR8 X;  1I39 A;  3IHU A;  2EV6 A;  2E71 A;  3DPU A;  3M07 A;  1WJE A;  5DEQ A;  1AWC A;  4EJT A;  4LG0 B;  2XB5 A;  1UG0 A;  2YUS A;  1Y1W J;  2KRH A;  3GTG J;  2O9L A;  1Z6T A;  3ZOB A;  1MND A;  1KYZ A;  4QPQ A;  2DA5 A;  1ORK A;  1R6R A;  1O3T A;  2OCC H;  1FC3 A;  3DXJ F;  5BQT A;  4IEJ A;  1NH3 A;  1TZL A;  1D1A A;  3DPL C;  1Z3X A;  2DN0 A;  2KKO A;  3PSI A;  5IYB J;  2CQ7 A;  3V8L A;  3ZQ7 A;  3OYJ A;  4BY1 J;  1UHS A;  1R4N B;  3L2Q A;  2NS7 A;  2FMY A;  4YRV A;  1ZAR A;  3FHN A;  3S32 A;  2FML A;  1FY7 A;  2HQR A;  3JRE A;  2JT1 A;  3BZC A;  3HC7 A;  3K4K A;  1U9O A;  3Q9S A;  3T0Y A;  3WOD F;  3IC7 A;  1NG6 A;  1XX5 A;  4XKW A;  3BR6 A;  2A69 F;  2Y0M A;  4ZZL A;  3DU5 A;  1JGG A;  3HOZ J;  3DTI A;  5ERI A;  5TRD A;  2Y2Z A;  2QSH X;  2EJR A;  2Z9O A;  4CYD A;  5DM7 F;  3PIP F;  5CQG A;  3GEZ A;  4E7H A;  1DP3 A;  3KP7 A;  1UZC A;  1ZN2 A;  2R7Z J;  5E79 C;  3GUD A;  2QKL B;  4EM2 A;  4KIG A;  4M3B A;  1GVJ A;  3U1D A;  2GBY A;  2HEO A;  2E36 A;  3G3Z A;  4A6D A;  4LK1 F;  3G1L A;  1K61 A;  4G7H F;  2XAF A;  1V4R A;  3GO5 A;  3WGH A; 
#chains in the Genus database with same CATH homology
 2CUF A;  4A3K J;  3JRF A;  5JLW A;  2R92 J;  4V2F A;  2MG4 A;  1T33 A;  2E2J J;  2LFB A;  4A69 C;  5K7Z A;  1FTT A;  4A3L J;  4FIS A;  1EF4 A;  3C2B A;  4G12 A;  2TRT A;  2DJN A;  5DTD A;  3TW6 A;  4DW6 A;  2VKE A;  1A5J A;  1B72 B;  1ZGW A;  5C44 J;  4A3F J;  3OIO A;  1JKO C;  4W1U A;  4IHX A;  2Y9Z A;  2R5Y B;  2JA5 J;  1H8A C;  5EGO B;  1RPW A;  3BG3 A;  2M8G X;  2M0C A;  1WPK A;  2L7F P;  1FTZ A;  1ETX A;  3CDL A;  4AYB N;  1JKR C;  2HOA A;  3JRC A;  3E7L A;  1RET A;  3A03 A;  3JRH A;  4A3M J;  4BKX A;  5E3M A;  3S1Q J;  2R0Q C;  1D5Y A;  5IPA A;  2D5V A;  5J1R A;  4EEF G;  2DMU A;  1ETV A;  4BY7 J;  4DYQ A;  2NVX J;  2M2E A;  1GV2 A;  3A01 B;  4I6Z A;  1GV5 A;  2M9H A;  3DCF A;  3O8G A;  4M6V A;  5M5X J;  2R5Z A;  3PO3 J;  3MKL A;  1JJ8 C;  3K7A J;  5C4X J;  4MO7 A;  4NDL A;  2CQX A;  3DEW A;  4IHW A;  4M3D A;  1ETY A;  2DTZ A;  2OPT A;  1IG7 A;  2VUM J;  3IH2 A;  5FKK A;  4M3F A;  3ZQF A;  1JKQ C;  3NAU A;  3G1M A;  4CYC A;  3HKZ N;  2P81 A;  4MIM A;  3G1O A;  5IOY A;  2E2H J;  3RZD J;  5F04 A;  3ZQH A;  2TCT A;  1F36 A;  1H88 C;  4AUX A;  2WV1 A;  2FQ4 A;  1IDZ A;  3GTM J;  1RR7 A;  4L5E A;  3GTQ J;  5GP9 A;  5EG0 A;  3RKQ A;  2FD5 A;  2XGC A;  3GTP J;  2JJ7 A;  2HOT A;  5FLM J;  1O4X A;  1YRN A;  2VI6 A;  2L7M P;  3BR3 A;  1Q1V A;  2GLO A;  1P7J A;  1W0T A;  5M5W J;  4JX4 A;  4C2M J;  4BXX J;  5DS9 A;  3S1M J;  2W48 A;  1X2M A;  3TP0 A;  5F08 A;  4UUS A;  4Y7N J;  5FJ8 J;  3CMY A;  1BW6 A;  2CJJ A;  1AHD P;  3Q0V A;  4Y52 J;  3RQI A;  1T56 A;  2ZB9 A;  5GPA A;  5F1J A;  4DZP A;  1MBG A;  3JRD A;  4XID A;  2N8G A;  3VPR A;  2K9N A;  2DMQ A;  5FKO A;  5JLX A;  2EZK A;  2L7Z A;  1F43 A;  4A3G J;  5EDN A;  3H3V K;  2LLK A;  3S15 J;  3QPS A;  4A3E J;  5E3N A;  5FLV A;  1RKT A;  2ECB A;  3QPL A;  5EF6 A;  4JX6 A;  3H0G J;  1ITY A;  3GBG A;  4A3D J;  4MFE A;  5M3F J;  1CQT A;  1MNM C;  3Q0W A;  3IV5 A;  4BBS J;  2EH3 A;  2R5Z B;  1HLV A;  4JX5 A;  3JRA A;  1JUP A;  5F0F A;  9ANT A;  2LVS A;  2EZI A;  4HNV A;  2XPW A;  4FCY A;  2DA6 A;  2X6O A;  4V2G A;  3BTC A;  4C3J J;  4M3G A;  4LOC A;  1HCR A;  1MBH A;  2XGE A;  1IDY A;  1LFB A;  1TWF J;  2DA1 A;  4RBO A;  3HB9 A;  2MSY A;  2JA7 J;  1VF9 A;  2AO9 A;  2RAE A;  2L0K A;  1FJL A;  3JRB A;  1I3Q J;  2XRL A;  3S17 J;  2XSD C;  2O8K A;  3I4N J;  4XRM A;  5EEA A;  5J1Y A;  5EYR A;  3MVP A;  1X58 A;  2E19 A;  1IJW C;  2NVQ J;  2X48 A;  1POG A;  5EG0 B;  3FIS A;  3S16 J;  1MH3 A;  5IP6 A;  1YRN B;  5J3L A;  2KT0 A;  3PM1 A;  4DYC A;  2DMP A;  2PMZ N;  1WH5 A;  2COB A;  1A6I A;  3L1P A;  2ME0 A;  1TWH J;  3A02 A;  3B6A A;  3BR1 A;  5HOD A;  4XRS A;  4JP0 A;  2FJ1 A;  5FKL A;  4D5C A;  1ZQ3 P;  4IHV A;  1JT0 A;  3FK7 A;  2L9R A;  4UUS B;  3HOW J;  2JMW A;  1MBF A;  2XPV A;  1JUS A;  2CQQ A;  4ABZ A;  4D7N A;  2LK2 A;  4RDU A;  2NOG A;  2X9D A;  2HQ5 A;  2AHQ A;  2WAQ N;  1B8I A;  2ID6 A;  1I6H J;  2IEK A;  1XC5 A;  1XS9 A;  1W0U A;  1JKP C;  2FX0 A;  1UMQ A;  3TW7 A;  2HYJ A;  2LKX A;  2CU7 A;  4QSH A;  1OFC X;  2NS8 A;  1S7E A;  2WB1 N;  4QTR A;  1WCM J;  1Z0X A;  4S0H B;  2CUE A;  3OSF A;  3BTI A;  2MW8 A;  2EBI A;  2VKV A;  1IV6 A;  3OOU A;  1MBK A;  1B72 A;  3BTJ A;  3ZQL A;  1MSF C;  2HXI A;  1ETO A;  2QF7 A;  1JTY A;  2ECC A;  5K7H A;  3HOV J;  5J1U A;  2E2I J;  4J19 A;  2ID3 A;  3LSJ A;  4QIW N;  2R93 J;  2HDD A;  2M34 A;  1TWC J;  4MFD A;  1WGX A;  1TWG J;  3SDG A;  3CCY A;  3Q3S A;  4MLO A;  2JA8 J;  2LD5 A;  1FEX A;  1AU7 A;  3PO2 J;  1HOM A;  4X1E A;  2LTP A;  3LSP A;  2HXO A;  1ZR2 A;  1SAN A;  3HM5 A;  2DMN A;  1HDD C;  2KDZ A;  1JJ6 C;  2XPU A;  3ZQG A;  4GFB A;  3F0C A;  1IC8 A;  1GVD A;  2HOS A;  5IYD J;  4FTH A;  2K9S A;  1QVT A;  4I76 A;  3Q0U A;  2JK3 A;  1WI3 A;  1ENH A;  3JRI A;  5IP7 J;  3ZQC A;  3HDD A;  3SFI A;  3GTO J;  1BW5 A;  2ME6 A;  1VI0 A;  4FE4 A;  1XG1 A;  1ZTR A;  2EQR A;  3O8H A;  1P7I A;  3IH4 A;  2LR8 A;  5M5Y J;  1ZK8 A;  2HI3 A;  3JR9 A;  5C3E J;  1NK3 P;  3RZO J;  2EZH A;  1PUF A;  5IYC J;  2YU9 J;  1IGN A;  1RKW A;  3HGY A;  1B8I B;  1QPI A;  1FIP A;  3S2D J;  1MSE C;  2DA7 A;  2GM4 A;  4CYC B;  4XRS G;  4B4C A;  1HDP A;  4B3A A;  2EZL A;  3OSG A;  3IH3 A;  5EZH A;  1DU6 A;  3I4M J;  2LY9 A;  4IHY A;  3B6C A;  2DA2 A;  1OJL A;  1QVU A;  2CRG A;  3WHB A;  4M3E A;  3HOU J;  5E3L A;  3BR5 A;  1ETQ A;  1IRZ A;  1MBE A;  5C4J J;  3S14 J;  1OCT C;  3SJM A;  1U78 A;  5GPC A;  3FK6 A;  2Y9Y A;  1FIA A;  2XB0 X;  1BL0 A;  1TC3 C;  3BTL A;  5K7F A;  3BG9 A;  1GUU A;  4BBR J;  3NAR A;  5IP9 J;  1IUF A;  3LSR A;  5F0H A;  1G2H A;  5FKM A;  3W6V A;  3HOY J;  1WH7 A;  4A3I J;  1AKH A;  4D5F A;  1BA5 A;  4DZJ A;  1LE8 A;  3HGG A;  1R9T J;  1BJZ A;  4A93 J;  3BG5 A;  1ETW A;  3K2A A;  3TP3 A;  2NVY J;  4A3B J;  2DA3 A;  3CQZ J;  5IOZ A;  3M4O J;  3LNQ A;  5EZG A;  5FKN A;  1GDT A;  3UKG A;  1SFO J;  1H89 C;  2Y30 A;  3JRG A;  1APL C;  1JT6 A;  2DMT A;  3ZQI A;  3M3Y J;  2NVT J;  4X6A J;  1QRY A;  1K83 J;  1LFU P;  3TED A;  2JWT A;  1I50 J;  2Y31 A;  4XK4 A;  2E1O A;  1VFC A;  2VPR A;  4C3I J;  4C3H J;  1X2N A;  2O7O A;  2XGD A;  1OCP A;  1ZKG A;  4A3J J;  2OF7 A;  1UG2 A;  2R5Y A;  2I10 A;  3BR0 A;  3BR2 A;  1GT0 C;  5EGO A;  3S1N J;  2IAI A;  2XB5 A;  2G0E A;  2YUS A;  1Y1W J;  1U8B A;  3GTG J;  4A3C J;  2O9L A;  4JYK A;  4AC0 A;  3S2H J;  3ZOB A;  1VND A;  3FKI J;  3S1R J;  1PUF B;  2DA5 A;  2DA4 A;  1ORK A;  5F0C A;  1NTC A;  1Y1V J;  2K9Q A;  3HOX J;  1ZR4 A;  4IEJ A;  3WHC A;  4UUT A;  5E3O A;  5IYB J;  2DN0 A;  1JTX A;  5BNG A;  1E3O C;  1MBJ A;  2JA6 J;  4BY1 J;  1UHS A;  3BQY A;  2NS7 A;  3A01 A;  5F27 A;  2H8R A;  2JN6 A;  3JRE A;  3D1N I;  2IBD A;  4FE7 A;  4W97 A;  1ETK A;  1U9O A;  3BQZ A;  1NK2 P;  1JUM A;  3LOC A;  3GTK J;  3BR6 A;  3FIW A;  1Z77 A;  1U9N A;  1JGG A;  2Y0S N;  1MH4 A;  2K40 A;  3HOZ J;  3GTJ J;  2Y2Z A;  3LSG A;  3MN2 A;  3GTL J;  4XIC A;  2H1K A;  2MGQ A;  4D7M A;  2ELK A;  4B1R A;  5M3M J;  1DU0 A;  2QCO A;  1RES A;  3BT9 A;  3HBL A;  3QQA A;  2YS9 A;  2R7Z J;  1AKH B;  3HEF A;  2B63 J;  4M3B A;  1TWA J;  2GBY A;  1LE8 B;  4DYR A;  3G1L A;  1HF0 A;  1K61 A;  2LP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...