4AYBN

Rnap at 3.2ang
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4aybN00
1AKHB 2JK3A 4D7MA 4A3FJ 3S16J 3JREA 3Q0WA 9ANTA 4CYCA 3PO3J 1WPKA 3WHBA 1VI0A 2DA4A 2L7ZA 4ABZA 1JTXA 3S1MJ 2YS9A 1X2NA 2CU7A 2WV1A 2YUSA 2DMTA 4A3MJ 3OOUA 5EDNA 3G1OA 3S15J 3HGGA 1LE8A 1JKPC 5GP9A 2VKVA 4MFEA 1MSFC 2DA1A 1ETVA 1H88C 4A3LJ 2MG4A 5M3FJ 2KT0A 2X9DA 1POGA 3B6CA 2FQ4A 1VF9A 2LFBA 1WCMJ 3FKIJ 2ME6A 1OCTC 2LLKA 3O8HA 5FLMJ 1HF0A 2Y9ZA 2LR8A 3BR2A 3JRIA 1JKOC 3BQYA 1SFOJ 3PO2J 4A3JJ 1UG2A 1ZR2A 1ITYA 4MIMA 4JX4A 2NVXJ 2IAIA 4IEJA 2R0QC 5IYDJ 1LFBA 2DMUA 3G1LA 2VI6A 5C4XJ 1UHSA 2TRTA 2CQQA 4BXXJ 4JYKA 3GTMJ 3MVPA 4D5CA 1S7EA 1IDZA 2DN0A 2GM4A 1Y1VJ 1JKRC 1EF4A 1QVTA 4JP0A 1JUPA 4LOCA 1B72B 2HI3A 3OSGA 3O8GA 1PUFA 3M4OJ 4A3GJ 3ZQIA 3BTIA 3RKQA 3ZQFA 2DMNA 2E2HJ 4B4CA 3K2AA 2AO9A 1MSEC 4A93J 5C44J 1OFCX 1MBKA 3HOWJ 5EYRA 2NVTJ 1BA5A 2Y0SN 4JX5A 1DU0A 1T56A 1ETOA 1F36A 3HOYJ 3D1NI 4M3GA 1DU6A 2EZKA 2JMWA 4XRSG 2H1KA 5M5YJ 3JRAA 4CYCB 1NTCA 2XGDA 2VUMJ 1BW5A 4DYCA 2XSDC 2M34A 2EBIA 5F0FA 1GUUA 5J1RA 1APLC 2LD5A 4M6VA 3QQAA 3S17J 2LY9A 2K9SA 2DA2A 1RETA 4FE4A 3JR9A 3MKLA 1I6HJ 2EZLA 1FIAA 1OCPA 1WI3A 4AYBN 4B3AA 5IOYA 4MO7A 2GBYA 4C2MJ 3GTLJ 3CQZJ 1GV2A 1MH3A 1RR7A 1LE8B 3LSJA 1Z77A 4D7NA 2X48A 1WH5A 1XS9A 2N8GA 4GFBA 2E2JJ 2EQRA 1MBFA 1FTTA 5F0HA 4UUSA 1UMQA 3TP3A 1RPWA 2Y31A 3ZQCA 1I50J 2R7ZJ 2DMQA 1PUFB 1XG1A 1JT6A 1JJ8C 3CDLA 1HOMA 2ECBA 2MW8A 5E3NA 4M3EA 5FKLA 2FX0A 3FK7A 5DTDA 1GT0C 2H8RA 4Y7NJ 4W1UA 3CMYA 1BW6A 5IYCJ 1TWGJ 3SJMA 5EG0A 1TC3C 4XIDA 1U8BA 1ZKGA 1FJLA 3F0CA 2XB0X 4A3IJ 3JRGA 1X58A 1IGNA 5M5XJ 5F0CA 1MBJA 2ELKA 3QPSA 4EEFG 3TW7A 3A01B 3W6VA 3SDGA 3L1PA 5C3EJ 2QF7A 5FKOA 2P81A 5FKNA 1JT0A 2NVQJ 2JA8J 4HNVA 2O9LA 3MN2A 1MNMC 3BR6A 2EZHA 4I76A 2E19A 1IUFA 5M5WJ 2X6OA 1W0UA 1AKHA 1HCRA 3VPRA 1QPIA 3HOUJ 4Y52J 2ZB9A 3BG5A 5FKMA 2E2IJ 3I4MJ 2JA7J 4X1EA 2DMPA 3BG3A 3LSRA 1AHDP 1ZK8A 2HOAA 2PMZN 2ME0A 2R5ZA 4QTRA 2EZIA 3JRFA 4DYQA 2JN6A 2HOTA 4RBOA 5F08A 1WH7A 4MFDA 3E7LA 2HXIA 4L5EA 2NVYJ 3BTCA 5M3MJ 2W48A 2M9HA 2K9QA 2NOGA 3NARA 4A69C 3H3VK 3S1NJ 1U9OA 2R5YB 1K61A 5FJ8J 2I10A 1BL0A 3A02A 4C3HJ 2ID6A 1XC5A 4DYRA 3FK6A 2R93J 3FIWA 2D5VA 4A3KJ 1H8AC 4I6ZA 1O4XA 1JUMA 2QCOA 4DZPA 3G1MA 3IH4A 5F04A 3BTLA 2XB5A 3ZQGA 3ZQLA 5DS9A 2HOSA 3M3YJ 2Y30A 4IHXA 4A3EJ 2CUEA 1P7JA 1TWFJ 2DA3A 3S2DJ 3JRDA 1Q1VA 1RESA 1I3QJ 2L0KA 5EZGA 5F27A 5EGOB 4RDUA 3JRCA 5IP6A 5J1YA 4B1RA 1VNDA 3Q0UA 2CUFA 3BR3A 1U9NA 3ZQHA 3DEWA 1ENHA 2XPVA 2DTZA 1B8IB 3IH2A 5K7HA 5EF6A 3GTPJ 4XRMA 4BY7J 4NDLA 1ETXA 3HEFA 3BR0A 1GVDA 1U78A 3S1RJ 1NK3P 2KDZA 3LSGA 3I4NJ 2M0CA 3A03A 1RKWA 2EH3A 3HOZJ 1F43A 2Y9YA 3HOXJ 1ETQA 4JX6A 4MLOA 3GTGJ 2LTPA 1MH4A 1Z0XA 4FE7A 3IV5A 2LKXA 2YU9J 1H89C 1GDTA 5IP7J 1MBEA 2K40A 1ZGWA 3GTKJ 3RZOJ 1AU7A 1K83J 2XGEA 2CJJA 2NS8A 1ORKA 2VPRA 1RKTA 3B6AA 1GV5A 4AC0A 1YRNB 1Y1WJ 2RAEA 1E3OC 2FJ1A 3Q0VA 2L7FP 4BBRJ 5J3LA 3HB9A 4M3DA 1FTZA 4FISA 4X6AJ 1IDYA 5EZHA 1X2MA 5IPAA 3TEDA 1MBGA 4XRSA 2WAQN 2CRGA 2XGCA 3C2BA 3S2HJ 5GPCA 3S1QJ 2M2EA 3DCFA 4A3CJ 2HQ5A 1MBHA 4V2GA 4QSHA 4A3BJ 2ID3A 1IJWC 2DA6A 4S0HB 1ETKA 2JA5J 1CQTA 5BNGA 2AHQA 1HLVA 1B72A 1QRYA 3BG9A 1JUSA 1ZQ3P 3QPLA 4IHWA 4D5FA 2L7MP 1A6IA 2B63J 4DZJA 2XRLA 2LP0A 2JJ7A 5HODA 1A5JA 3LOCA 3GTQJ 1G2HA 2HDDA 5EGOA 1WGXA 5IP9J 2O8KA 1TWHJ 1FEXA 2JWTA 3JRBA 1NK2P 1IV6A 3RQIA 2R92J 3A01A 3BQZA 2NS7A 3CCYA 2OF7A 5FLVA 3S14J 2E1OA 3UKGA 2HXOA 2LK2A 2VKEA 1IC8A 4QIWN 1SANA 1YRNA 1JGGA 2DJNA 4IHYA 3TP0A 4M3BA 4C3IJ 1FIPA 2XPWA 1JTYA 5IOZA 2IEKA 3BR5A 3FISA 2COBA 4BKXA 4J19A 4AUXA 1VFCA 2LVSA 1ETYA 4C3JJ 2L9RA 2ECCA 3HBLA 5E3OA 3BTJA 3IH3A 3Q3SA 5E3LA 2DA5A 4BBSJ 4UUSB 1JKQC 2GLOA 4IHVA 3TW6A 2MSYA 4BY1J 2O7OA 1ZTRA 3HDDA 3PM1A 3BR1A 4V2FA 4DW6A 2Y2ZA 1B8IA 4M3FA 1W0TA 2FD5A 2MGQA 3NAUA 1T33A 4FTHA 3LSPA 2K9NA 4XICA 4FCYA 3BT9A 1D5YA 4A3DJ 2R5ZB 3WHCA 5IYBJ 2OPTA 3HOVJ 1P7IA 5EG0B 5E3MA 2HYJA 3K7AJ 5J1UA 3ZOBA 4W97A 2R5YA 2DA7A 5F1JA 4XK4A 2M8GX 5GPAA 3LNQA 1TWAJ 1IRZA 1ZR4A 3HM5A 1R9TJ 1ETWA 2G0EA 3HKZN 3GBGA 5K7ZA 1TWCJ 3OIOA 3JRHA 5EEAA 1HDDC 1QVUA 2IBDA 4G12A 3RZDJ 3OSFA 3H0GJ 2XPUA 5JLXA 5C4JJ 1HDPA 3GTOJ 3SFIA 3HGYA 4UUTA 1OJLA 2CQXA 2WB1N 2TCTA 5JLWA 1LFUP 1JJ6C 1BJZA 5FKKA 3GTJJ 2JA6J 1IG7A 5K7FA
chains in the Genus database with same CATH superfamily
3R4KA 1QPMA 2JK3A 3IAM2 4XOTA 3ZQQA 2V9KA 3Q0WA 3E6MA 2QBYB 4ZTFA 1R1VA 4CYCA 1SC7A 1BIBA 1WPKA 4XKCA 2R3SA 3WHBA 3GLXA 2L7ZA 2J5PA 4HV5A 2KIFA 4MQVA 3L2UA 4OIPF 3IP4B 2VKDA 4KMUX 3TOAA 2L5QA 2YS9A 4KITB 2CU7A 2VOPA 2W1OA 4M72A 5TJJA 1V3FA 1Y39A 2AQEA 4A3MJ 1A6QA 1MZBA 3OOUA 4ZZDA 3G73A 3VDXA 5EDNA 2DT7B 2OCEA 5FLXK 2LRDA 3CF2A 1ETVA 4A3LJ 2LBFA 3CZ6A 3K1PA 3I53A 1VF9A 2BXYA 3GFJA 3FKIJ 3O8HA 5HDGA 1REPC 3BR2A 2XGXA 2KPMA 1SFOJ 2NS0A 1WVRA 3PO2J 4J00A 1XMKA 5D5UB 4IF4A 2XHKA 3CUQA 1ZR2A 1ITYA 5LHGA 3IL2A 1LQ1A 2NYXA 2DMUA 3ZRGA 1ERDA 2O61A 1JE8A 5C4XJ 1SVMA 2RQPA 2TRTA 4XSXF 4F3QA 4BS9A 4PJJA 3GTMJ 4IVNA 3CUOA 2YU3A 2GM4A 1XN7A 3I3LA 1PUFA 3M4OJ 4P96A 1X4OA 4RB0A 2DK8A 3A0HC 2OQGA 2KLOA 3P9CA 4RM2A 2OTLI 3I64A 3RKQA 3WE3A 4BACA 1H9GA 3BZ6A 4I01A 2X6XA 2DFFA 4KT6A 2EPFA 2HS5A 2XIGA 1DP7P 2E5ZA 4OIQF 4JX5A 1XPXA 1T56A 1T0FA 3WG9A 4XNFA 1F36A 4LGWA 2R7WA 1VQOI 5H6QA 3G4SI 3N4MA 4OU0A 1DU6A 3DBHB 3A1YA 1LNWA 2H1KA 4I09A 2BW3A 1TL8A 2M34A 5E1XA 5F0FA 2XRNA 1GUUA 3H1CA 2DXIA 3J7AY 4YFNF 1N78A 3S17J 1RR8C 2LY9A 2K4JA 3K9TA 1RETA 1MNEA 2A6TA 2ZO4A 3VOEA 1FIAA 4ESBA 4AYBN 2HZTA 4C2MJ 2ADUA 4ON0A 4H4KC 5DYMA 1N77A 4XKWA 3X2QH 1KU7A 3FXQA 3V7CA 4BGDA 2STWA 1Z77A 2X48A 2AXTC 1XS9A 1OCCH 1G3WA 4BNCA 4N9HA 5LGUA 1YE9A 4BDZA 1HKSA 4II2A 2E2JJ 4KIGA 3TL4X 2EA2A 4MNUA 3TDZC 3JAMZ 5LEJA 3RIRA 1G3TA 2MLGA 2DMQA 1XG1A 4MEYF 2HYFA 4BE2A 2MW8A 2E35A 2VKHA 3EUKL 5CVJA 3D5LA 1UFMA 3FK7A 2H8RA 1GT0C 5F6FA 5IT3A 2MABA 4EJUA 2K86A 3COAC 2OZUA 1YLFA 5AIQA 1KU9A 1ZKGA 4E7ZA 3CESA 3GO5A 5D6EA 1IGNA 2LOOA 2BY0A 1MBJA 4ZDPA 2QQBA 3JTGA 1IN5A 2LY1A 3HUGA 3SDGA 3F21A 4IQJA 1LDJA 2H8WA 4RAZA 2L02A 4I99C 4PFPA 3VYUB 2BXZA 4ZYEA 3ROUA 4HNVA 3OV8A 3ZN0A 3U21A 3BR6A 2XAFA 3QOEA 2VJ5A 3TGNA 2EZHA 5J4VA 1IUFA 1D1BA 2KDOA 2WA0A 3HOUJ 2KIUA 2XF6A 3R61A 3G2BA 1IN6A 1MJAA 4UVBA 5FKMA 3CCSI 2ESHA 2ZBKA 4B3XA 5JHFA 1RRJA 1EJ9A 1BI2A 2KRHA 4F91B 1K6OA 2PMZN 4GXOA 2FNAA 2QLZA 4HG2A 3S3NA 2CYYA 1OMIA 5F1RA 2A61A 2IA0A 2JN6A 3KFWX 3OYBA 2X1DA 3JW4A 3H92A 2GOMA 3K70C 3GVAA 4P55A 4HNUA 2NVYJ 5M3MJ 2DBBA 4EM0B 2WAEA 2W48A 2QZ8A 3NARA 4AD9A 4IOAF 5KVRA 3S1NJ 2QA4I 3EUHA 1X3ZB 3I55I 3CCQI 4NC6A 2FA5A 1BL0A 3A02A 5IT9Z 2F5DA 3SZPA 2ID6A 2YX4A 4A0XA 5GTHC 1ZH5A 4L9TA 4AVPA 3FK6A 2G7UA 1YIOA 2D5VA 5JVGF 1H8AC 1O4XA 1QHGA 1V5EA 3BP8A 4DZPA 2GXAA 3HOTA 2CWEA 3RKYA 5E18F 3BTLA 2HOSA 5DS9A 3K2ZA 3L00A 3H9QA 2LBFB 3FM5A 1OLTA 4IHXA 3Q9VA 1Y56A 4A3EJ 1K4TA 2DA3A 4FX4A 3S2DJ 1QNTA 4ZJZA 1Q1VA 3LAPA 1IN4A 4KN4X 3IWFA 5EZGA 4AIDA 1EA3A 2FE3A 2UWMA 2IGOA 2FU4A 2R7FA 3LL7A 4O5VA 2HQAA 4GO1A 3BR3A 2E60A 3HRTA 4BE1A 3KP5A 2XPVA 1G3YA 2QGUA 3M1CA 4MGRA 3CCJI 2K3PA 2OAZA 4LG0A 4NDLA 3MQ0A 3HEFA 3LSIA 1EV7A 3HG9A 2P4WA 3DBLB 3KX2A 3LSGA 3A03A 3HOZJ 3DP7A 1F43A 2KRCA 1Q1HA 4MLOA 1J75A 1BI3A 2YU9J 2BYVE 1STZA 4XQFA 2HPMA 3DKYA 2WAFA 2BV6A 4NHJA 5J47A 1MBEA 1RI7A 1EKEA 5FFXA 3RZOJ 2IT0A 2A5YB 5CLSA 2PLYA 2VPRA 2EJRA 2WY7Q 3B6AA 3T0YA 1BOAA 1BC7C 1VQ9I 1BC8C 3NRVA 3Q0VA 4BBRJ 2OV7A 2JA2A 4M3DA 4XONA 1YYVA 2ZSIB 2VE8A 2PMUA 1X4PA 3AG4H 1X1PA 1YX5A 1S9HA 1K78B 4KMFA 1TW2A 4XRSA 1PYVA 3LSTA 3GMEA 2UZKA 1T0FC 5GPCA 4LITA 4BYYA 2M2EA 4RAYA 4A3CJ 5HLTA 3BPVA 1W36C 4LG3A 2KKOA 4HF0A 3KEOA 3T1BA 4R79A 3ERED 4E7LA 1MMSA 1CQTA 4ITVA 3GUDA 3M9AA 2HQRA 1USSA 1BOBA 3ZMDA 4IRGA 4UV8A 3QPLA 4G9YA 1ZAOA 1P4WA 2KFDA 3H9JA 1LFPA 4FETA 2XRLA 2LP0A 1A5JA 2KIMA 3SXYA 3F8FA 1IN8A 5FGMA 1WGXA 4FQGA 1B9MA 3DEEA 2FXAA 3JRBA 4EM1A 1XGSA 5JI6A 4HX8A 4IRIA 2XDVA 4PJLA 1KQ0A 4UHTA 3A01A 1FZPB 5GAHJ 1BJAA 3FZVA 1OQYA 3AG3H 2EFNA 5DM6F 2D45A 1NH3A 1JGGA 1W36D 4IHYA 3RI4A 3I9V2 2FSWA 3HPHA 4M3BA 5D8KB 4P9FA 3O2PE 1IF1A 1VQMI 1OYIA 2K3FA 2GAUA 2MC3A 4XM3A 4BQAA 4IKFA 4IHTA 4BKXA 5HNHA 4AUXA 3DTEA 4F7ZA 1IRFA 5E3OA 3TQNA 3BTJA 1E3PA 3IH3A 2M87A 2M1BA 5B1BH 5ILSA 4YFKF 4UUSB 1U3EM 1JKQC 4A0ZA 3KIOA 5EJCA 5F64A 3HHHA 4XLHA 4HF2A 1ZTRA 4A0YA 2DW4A 3PM1A 2VE9A 5LHIA 3BR1A 1ZLKA 2Y2ZA 2IS4A 3F8BA 3SQNA 4ASNA 4M6XA 1F4KA 5L3CA 4QWQA 4HNTA 2MGQA 2OCCH 3OMYA 4HF1A 1D0XA 5L3FA 3O3KA 2JUCA 5TGTA 1A04A 1OR7A 3RPUD 2GXBA 1WHUA 2XKOA 1AOYA 5LRSA 2Q2EB 3FMRA 4CCMA 1ON2A 2VIXA 2PJRA 1VZ0A 3KP4A 3A4CA 5F1JA 4F55A 2Y69H 2M8GX 2A05A 5JR3A 3BG7A 3MKZA 4HSTA 3W6JB 4DBRA 2KIQA 3WTVC 1ZR4A 4XLPF 1Z05A 3GBGA 3HSRA 3OR2C 5K7ZA 1WJBA 3ZMTA 1R6RA 1SMYF 5LGTA 4CCOA 3OIOA 1P6RA 3RJPA 4XR6A 2F4OB 5ERIA 1X1CA 3EETA 2FMYA 2OBPA 1EH6A 2OUMA 1ZRFA 2XPUA 4KJZA 3L2VA 5JLXA 1G4DA 1SFUA 3GTOJ 5D4SA 1V5GA 3BJ6A 3HGYA 5FLXZ 3WTSC 4LG0B 2CQKA 2YPRA 3TO7A 2WB1N 3PIOF 1RUNA 1T08B 2HDWA 2P6SA 5CQGA 1PP7U 3DQVC 1XB4A 5FKKA 2XAGA 4DIQA 4HPQA 1O3RA 3S8PA 4OAZA 1AKHB 2VT2A 2RN7A 3JCUC 3KP2A 3S16J 3O6BB 9ANTA 1IXCA 2PFBA 2MA3A 3U1KA 4EMSA 3ECHA 4QLCU 3DTIA 1JXSA 1VQ4I 3E6CC 2DA4A 1GXQA 1XGMA 1YJNI 2O8XA 2LMDA 1SD5A 3CC2I 4GRIA 2KMUA 2YSRA 3K10A 4PSXA 1Z7LA 3V4GA 2YUSA 1HKQA 4FT8A 1XMXA 2JQ7A 2M0MA 1BR1A 1D5VA 3OYCA 1ZGAA 4MFEA 2NXNB 2F5FA 3H0DA 2KT0A 3EYYA 2KJBA 2VXDA 4YFXF 4PZJA 3HTUA 2B7EA 2IA1A 3OY9A 2EB7A 2IS1A 3TO6A 3U9GA 2FQ4A 2IJLA 2LFBA 1R23A 4CXFA 2LLKA 2Y9ZA 2DI3A 2LKPA 1JKOC 2A6EF 2IP2A 2P5LC 4DNCA 4NQWA 5L3EA 2DOAA 2CFXA 1UG2A 2D1VA 4A3JJ 1IO2A 3WTXC 4MIMA 5J40A 2X4HA 3CMMA 4LK0F 3MKWB 2NVXJ 2IAIA 5IYDJ 2WB1A 3DPUA 4L9JA 2X51A 1IW7F 1IUYA 2WV0A 4ZH4F 3M8EA 4HW0A 2JPCA 2DN0A 1S7AA 4GGGA 1Y1VJ 2FNPA 2ACJA 3DPTA 2UUZA 2H6CA 3EUAA 4BJTA 3N97A 3O8GA 5AIPA 5BMZA 1N25A 3BTIA 2O3FA 3TDUC 4LLNA 3DBRB 2PMHA 3ZQFA 5HNFA 2DCEA 2AO9A 4A93J 5C44J 1UELB 1MBKA 1P92A 4CSWA 2NVTJ 1RC9A 1BA5A 3IHUA 4HLYA 2L9NA 3CMEI 3CDIA 1YS7A 1L3LA 3OOPA 3I54A 1ONVA 3V8KA 1MNDA 2DT5A 4AIHA 1Z91A 5CPRB 4BE0A 4RAGA 3W3CA 1YJWI 2JMWA 2B0LA 3EPZA 4RB3C 4KNYA 2PEXA 2EILH 3JRAA 4CYCB 3S93A 1NTCA 2XGDA 4Q48A 5HOOA 1J0RA 2MYSA 2QKLB 3R6SA 1V4RA 3HKZA 4AIKA 2JSPA 2LNBA 2V26A 3DTKA 4I0BA 1APLC 1ZRDA 4OOIA 4M6VA 3QQAA 3GZNB 2DA2A 2UV1A 1OCRH 2ZJRF 2VXZA 3JR9A 3MKLA 4LMYA 4MO7A 3GTLJ 1KQ9A 2GWRA 4GCVA 2VLAA 2VQHA 5DCFA 2O0YA 1RR7A 1LE8B 4KIFA 4ESFA 3MMYB 1BBYA 2VN2A 4ENKA 2XUBA 3FXOA 4EV0A 3PJRA 1Z3YA 1YOVB 2N8GA 4GFBA 1MBFA 2F5VA 1O3TA 4UUSA 3HYIA 1UMQA 2CV0A 3MD2A 3K4MA 3QRFF 2R7ZJ 1JT6A 1MKMA 4N4OB 5ILVA 2QBYA 2E1NA 2KP6A 3RDIA 1OR7C 2QQ8A 4U7BA 2ZJ2A 5HS7A 4CCNA 4EJWA 5FKLA 4U0YA 3BG6A 5FD6A 2DQLA 1O3QA 4LJZF 1TP4A 2WBMA 3PSIA 2JUGA 3OL4A 3SEZA 3GZ6A 1BW6A 1TWGJ 2M4GA 3E5UA 2HVQA 3FXUA 4BXUA 1VTNC 2R7OA 3F0CA 3QPTA 2HVRA 2XB0X 1K78A 1ZGJA 1HQCA 1X58A 3JRGA 1ODDA 4HQMA 4KDPA 5F0CA 3BWGA 4CZCA 1SAXA 3W6VA 3L9FA 2W00A 2QF7A 5FKNA 3ZR8X 1SD6A 3LSMA 1LVAA 1JT0A 4FHTA 4A5MA 2NVQJ 1OISA 1X1BA 4UV9A 1MNMC 2VL8A 2ZKZA 4EJTA 1UCRA 3I56I 3CJNA 3K4LA 1W0UA 1WI9A 1AKHA 4QPOA 3F6VA 3ZXSA 3RYPA 2ZB9A 2DO7A 1UG0A 2M45A 1UJ8A 1KYWA 1IV8A 4X1EA 2DMPA 3LSRA 4IOCF 3SYTA 3F3XA 2ZCWA 2R5ZA 1O57A 4QTRA 3AFHA 2EZIA 3JRFA 4R1HA 3KP3A 2HOTA 2H94A 3V7RA 3JTHA 4RBOA 1T98A 1U5TA 1WH7A 2EIJH 2W85A 5F08A 4MFDA 3G71I 4CGZA 1FX7A 1TBXA 2PX9A 3M8JA 2DT6A 4WK8F 4NUBA 1ACIA 2K9QA 4LB6B 2ELJA 1R49A 3H3VK 3HTSB 2R7SA 3CLOA 5DCMB 4CCLA 3IRRA 3ABMH 5FRNA 1WRJA 2BY1A 4LD5A 1ULYA 2P7VB 4BDYA 5ICFA 1H0MA 3LQQA 4DYRA 4AWXB 2WWYA 2ZJQF 1QU3A 1I3AA 3LAJA 3G6EI 3DLAA 2EK5A 4I6ZA 2FRHA 3I5UA 1LEBA 1JUMA 5D8LB 3G1MA 3IH4A 2XB5A 4X0GA 2M3AA 2RC4A 1CGPA 2KL4A 2Y30A 3VYSB 1TWFJ 3BC8A 3AL0C 1Z67A 1RESA 4E7JA 2L0KA 3S3MA 3E97A 4HDVA 5D5XB 4ENMA 3VFZA 4IZZA 3WU0A 1G3SA 2ISYA 3DEWA 3CCMI 1R7JA 5DUIA 1ENHA 4L9NA 1TNTA 3WTUC 1T8IA 1MJ9A 2DTZA 5BPDA 5AONA 4YG2F 2XSJC 1B4AA 2Z9OA 4E4HA 1J9IA 4YRVA 3FXRA 3I4PA 4BY7J 1UAAA 3BR0A 2VONA 4KIBA 3L2RA 1QZEA 2CSOA 3F8CA 4UB6C 1NK3P 4RGUA 2KDZA 2QUFA 2EH3A 1B6AA 2RQQA 1A35A 2Y9YA 2BBYA 4V19K 2DFEA 4M6YA 1MH4A 3WG7H 4B48A 4K2EA 3IV5A 2LKXA 3FDYA 1GDTA 3L09A 3ONQA 3JSOA 3ISPA 2KZVA 3K4NA 2E36A 4YELA 4ZZLA 5IP7J 1S29A 1G59A 4A6DA 5CVVA 2K40A 1ZGWA 4U88A 1T39A 4FASD 2XGEA 1AU7A 2R7UA 2DYRH 1ORKA 3K4CA 2JPBA 5FD5A 3W6KB 1GV5A 3S2WA 4AC0A 1YRNB 5JHUA 2RAEA 2L4MA 1E3OC 3ZMSA 3H3UA 2FJ1A 4I02A 4RGSA 5DUKA 1O3SA 1E3HA 2LF7A 2GA1A 4FISA 1SAUA 4IPAA 2E7XA 3Q9SA 3TEDA 2BEOA 2CMPA 1YG2A 2WAQN 1R58A 2CV2A 2MBFA 5IT9K 5J4YA 2HQ5A 2X6WA 3H9GA 3S3OA 4CZZA 4EGYA 1MBHA 5CVUA 4HAMA 1BN5A 2CUJA 2E1CA 1IJWC 3PSFA 2RKHA 2VODA 2V1DA 5BNGA 1I39A 2AHQA 2R7TA 4Y33A 1DP3A 5BS6A 1QRYA 3WTWC 4IO9F 1Y0NA 4XMYA 1L0OC 1PJRA 5B3SH 4D5FA 5HODA 1P4AA 3GTQJ 3SDBA 1I1SA 1DGWY 3OS0A 4RLFA 5IP9J 1FT9A 1U5TB 4L9VA 4DGWB 2O8KA 3IUOA 2V1NA 1Y8QB 3DF8A 4GYGA 2IPQX 5DCMA 2NS7A 3HHGA 2OF7A 4OAYA 2JRMA 4BXFA 2HXOA 3QWLA 4EATA 1WJEA 1NG7A 1FIPA 2Z5UA 5IOZA 1I27A 4I0AA 1J5YA 1T6SA 1J09A 3I58A 4J19A 3D5SC 1VFCA 4C3JJ 3HSFA 2L9RA 4C2UA 3HBLA 5ICGA 3RCOA 3E1SA 1CF7A 2FBIA 5KK1A 1R5ID 4HRIA 1LUJB 3CCRI 1HXDA 2L9SA 3DFGA 5LRRA 3EQLF 2BHZA 4Z2YA 3CCEI 1OKRA 3QAHA 2A6HF 3H3ZA 2Z16A 1WJFA 3HDDA 3BZKA 2GQQA 1B8IA 3BJOA 1YFHA 5K1YA 5LD2C 4AM3A 2CV1A 1T33A 3RQ4A 2WADA 3BT9A 2KQRA 4XLAA 3T8RA 4KICA 1Y6IA 2GXGA 3WHCA 1IAWA 5IYBJ 4KFCA 4YEJA 3HOVJ 3LFKA 3P7NA 3EUHC 2HYJA 2LREA 2V79A 3KP7A 4PDKA 5E79C 2HDCA 4Y3OA 2DOEA 2ELHA 1PDNC 3KYLA 2DA7A 2R5YA 2P5KA 1XGOA 4GDFA 3F72A 3OYIA 4MTEA 4H0EA 1X1DA 4ZTJA 3ZMVA 3HM5A 1A31A 2QEXI 1Y0UA 3C18A 4G7ZF 2JZYA 3OYAA 3C2GA 4XN3A 4AYBA 1HDDC 1N75A 1YS6A 3V8LA 5H2FC 5KAFC 1P9QC 2Q2EA 1S3JA 1HDPA 5C4JJ 3VYTB 3GXOA 4XLEA 2QM3A 4XORA 3REOA 3SFIA 3ZMZA 4S04A 2X1CA 3UR3C 3EDPA 4KUMA 1OJLA 1I5ZA 4HBLA 4UUTA 5DM7F 2IRFG 1XMAA 2Z3YA 3LMMA 2W82A 4HQEA 1J59A 2OQRA 1FBQA 1IG7A 2UXXA 2NNYA 4D7MA 3HSEA 5D5VB 3AKZA 4A3FJ 3JREA 3H5AA 2EWNA 2LC2A 2W84A 1FLIA 3VSKA 1HC8A 4M9XA 3CLQA 3K0LA 1ZRCA 1VI0A 1SFKA 4HOBA 4ABZA 1ZN2A 2FUG2 2VPLA 2P6TA 3KLNA 4EJOA 4XLNF 1MDMA 1G8XA 1W4MA 5LFAA 3K69A 2L2OA 1J2XA 2IW5A 3G1OA 1MW7A 2FOWA 3S15J 4A6EA 3HGGA 2IS2A 2F4IA 1QA6A 2VKVA 1BM9A 2DA1A 1FOKA 1H88C 1IZ1A 5KAIC 2DODA 1EH8A 4E70A 3J81Z 1YTYA 3B6CA 1O7FA 5HDKA 1WCMJ 1D1AA 2ME6A 5FLMJ 1HF0A 4NNJA 3LSHA 2CQ7A 3JRIA 3ASOH 5TISC 4QPQA 4JK1X 2VQLA 4A5NA 2ZSHB 4JX4A 1GXPA 4MTDA 2MLKA 4PJMA 5CYVA 2VBYA 3VODA 1EH7A 2IXSA 3AL0B 3CO6C 4NC8A 4BXXJ 1MIJA 2GIZA 4BU2A 4D5CA 3TO9A 3MAJA 4C30A 4RGXA 2LDUA 1W1WE 3NEUA 1KGSA 4JP0A 5GAEJ 4LOCA 4WX9A 2HI3A 1B72B 2ETHA 4IJAA 4I7HA 4A3GJ 1QGPA 3MKYB 2V6CA 3DWLE 1KA8A 2V9VA 3AG1H 3ZQIA 1S8NA 1W5CC 1Z7UA 2K9LA 5DV5A 2VC0A 2P0WA 3DU5A 1RIOH 2CW0F 2DMNA 4B4CA 2GA2A 2ZXHA 2ZC2A 3K2AA 2CS3A 1YQAA 2E1MC 1F9NA 5EYRA 4F92B 3KETA 3R0JA 1DU0A 4XRFA 3TBIA 4EQQA 3P9KA 3H36A 3W2AA 3HOYJ 1OYYA 3OIQA 1VQNI 2BVLA 1YITI 1W5SA 2PQ8A 2RVCA 2XAQA 3OS1A 4RB2C 3VWBA 5M5YJ 2V4JC 4E7HA 4G6QA 4DYCA 3BY6A 4TV7A 4BHPA 3A0BC 4O6JA 5J1RA 3V8JA 2LD5A 4IHSA 1W7PD 3GF2A 2K02A 1Z3XA 5HVQC 3DLLF 2K9SA 4NBQA 3IC7A 4FE4A 2RV8A 1X3UA 2FBKA 1DQUA 1MD0A 2M5WA 5IOYA 4B3AA 3LWFA 2R7RA 2GBYA 2RNGA 3CUQC 3MCZA 5GADJ 1GV2A 2W25A 1MH3A 1QBJA 1R5GA 3C2HA 3JSPA 1UB9A 4M71A 1HW1A 2XC7A 4BHBA 5DD8A 1FBUA 4EM2A 5F0HA 2OTJI 4CCJA 5A2QZ 1LKXA 2Y31A 4HDUA 4IL6C 1MJBA 1PUFB 1JJ8C 3PNVA 3DPLC 1TT5B 2HYGD 1HOMA 2ECBA 4G94A 4RAFA 4CCKA 3LSKA 1UHMA 1FWZA 1YO5C 5B66C 3BOQA 4ZC3A 5DTDA 1FOWA 2FF4A 5LBQA 2R7VA 5LHHA 1KONA 3BDDA 2FOKA 3SJMA 4ZYAA 4XIDA 3HJEA 1U8BA 2OJED 2ZXWH 4Q5SF 5M5XJ 1MMNA 1YHQI 2DLLA 3BROA 3E5XA 5K5RA 1JGSA 3TW7A 1XDSA 3A01B 1HW2A 3L1PA 2E1MB 5FKOA 2P81A 4PK4A 3HPGA 2BZTA 5CKTA 2A07F 1W5TA 2O9LA 2QYOA 3MN2A 3OYHA 3WGIA 4UVCA 1H9TA 3DKWA 1DPUA 4I76A 2E19A 3C1DA 3RPUA 2X6OA 3VPRA 2W7NA 1QPIA 3IKTA 2BVMA 2HPIA 1P2FA 3FBIB 3BG5A 2OZ6A 3CF5F 3IRQA 5DD4A 3RSNA 1BR4A 3QOPA 1SFXA 3KZZA 2G9WA 3K70D 3BG3A 1AHDP 1ZK8A 2QSFX 3QU3A 5KNLA 1T38A 3FBNB 2ME0A 2MH2A 2LKSA 2GOXB 4DYQA 2JVHA 2NVUB 5ICCA 4L18B 3MWMA 3R0AA 3E7LA 3BTCA 2F2EA 2XAHA 2YX7A 4L5IA 2M9HA 2O6GE 1FOXA 2NOGA 2QWWA 4PUSA 5FO5A 2Y0MA 4AIJA 2M8EA 1QQIA 4C3HJ 3ZCOA 1XC5A 5TRDA 2E34A 1D0YA 3FIWA 3KYDB 1YIJI 1HKTA 5CVIA 3U2RA 3T8TA 4OMYA 2IGMA 3ZQGA 4Q4ZF 2M4KA 4B47A 4L0ZB 2K27A 2ZFWA 2KJCA 3E6DA 4BQOA 2XAUA 2HEOA 1TQMA 1U2WA 5ILUA 2CUEA 1LEAA 3JRDA 5F27A 2BHYA 4M9ZA 2CW7A 2RREA 3JRCA 1YW7A 3I71A 4MEXF 4B1RA 1D8KA 2W57A 2I8DA 2EFOA 3D0SA 1U0JA 3UNGC 2DAOA 3J7YJ 5EF6A 2P5VA 4XRMA 1ETXA 2HFHA 1TNSA 1GVDA 1TTYA 3K4KA 1X19A 4HYEA 2PMZA 1WFXA 3S1RJ 2M0CA 1RKWA 5E1WA 1TQPA 3KCCA 3ULQB 3HOXJ 5D6FA 4LLLA 5HLHA 4ESJA 2V6EA 4E7IA 5HLGA 4HX4A 4ZYHA 5A2QK 2LTPA 1R71A 1V54H 4FE7A 2PJRB 1H89C 3TKYA 2QQ9A 4HSRA 2IA2A 2C6YA 2EV6A 2W4SA 1QZYA 4DBQA 4CA0A 3GTKJ 2ZXJA 5ED4A 2NS8A 3IAS2 5DDGA 1TW3A 2Y75A 4MQ9F 1LPQA 5J3LA 4ENJA 5DEQA 4F93B 1FTZA 4CH7A 1QZZA 5LGNA 4X6AJ 3ZPLA 1IDYA 5EZHA 3GCMA 1MBGA 2KRFA 2F4MB 1KZHA 4II3A 1JHHA 4XLCA 4PGGA 5L3DA 5LEKA 3FKJA 4IRHA 3C2BA 3S2HJ 5HDNA 4CO8A 2K5CA 3HRMA 5H20A 3SHFA 5E8GA 3S1QJ 4E7KA 1USTA 5D4RA 2QQAA 3ECOA 3R60A 4KN7X 2QSHX 2EV5A 4V2GA 5J8FA 2X0LA 2ID3A 2DA6A 4Y15A 1ETKA 2DPDA 4UNOA 2DOFA 2JA5J 2HGCA 3M07A 5L3GA 1HLVA 1B72A 2OA4A 3EYIA 5HLIA 4LIUA 2ICWG 2DK5A 2VC1A 1Z9CA 1ZQ3P 3VB2A 5E8IA 1B59A 2M7AA 1KYZA 2ZMEA 3DKXA 4EGZA 2CFOA 4IHWA 1O7LA 3DV8A 3FXMA 2B63J 3F9KA 2VQCA 3LOCA 2HNHA 2DJIA 1TZLA 2ZMEC 1TLHB 2FBHA 2TDXA 1W7PA 5EGOA 4JBAA 1HW5A 2MC4A 3FHZA 2L54A 1NHAA 4F52A 4MHGA 3ERMA 3M8FA 4U87A 3RTRA 4AU7A 2R92J 3RYRA 4BL0B 3OYKA 3CCYA 3OIPA 3PNTA 2E1OA 4UVAA 2ZJPF 4PJNA 3UKGA 2LK2A 2VKEA 1IC8A 2DJNA 2EINH 3PUBA 2P8TA 3OR1C 5FROA 3SFZA 2Z33A 4C3IJ 1JTYA 3OYMA 2D2WA 2XASA 5KCMA 3BR5A 2KISA 3GX4X 1WWXA 1ETYA 3WGHA 3H35A 1B9NA 4C2TA 3Q3SA 2DA5A 1S6LA 2X85A 4BBSJ 3MEXA 3OS2A 2GLOA 3L7WA 3LFUA 3TW6A 4IXAA 3U1DA 1C0WA 2MSYA 5BQTA 4BY1J 4CICA 4L0YB 3LA2A 1E2XA 1XTAA 3CDHA 1FMVA 4M3FA 3A2KA 2FD5A 4B09A 2OD5A 4WXDA 1JHFA 1ZELA 5BPIA 3V7SA 1ZREA 3F23A 4DOZA 2H09A 2ZNYA 4FTHA 3H5RA 4XSZF 2DDAA 3LSPA 1U8RA 2K9NA 1D5YA 4FCYA 2E5NA 2VJIA 2WTEA 2ZNZA 2FEZA 4PSWA 1SFEA 3M1EA 2R5ZB 1P7IA 4L5JA 2A69F 4XBFA 4J01A 5E3MA 4ZYGA 3K7AJ 3MZHA 5J1UA 1BR2A 4XLFA 3ZOBA 2MD0A 1WJAA 4B8XA 2DU9A 4W97A 2IGNA 3CO7C 2DPUA 4XK4A 4WXHA 4P1WA 1TWAJ 2VT3A 4ZDLA 2E7WA 3TMOA 1IRZA 3QYBA 1ETWA 1X1AA 3DU6A 3HKZN 1SVOA 3QODA 1E17A 1R1UA 4KT5C 4G6DA 3BLYA 1Y8RB 2XF7A 4G12A 4S05A 3RZDJ 3SZTA 1W7PB 2H1LA 2QKMB 2AXLA 2IGKA 2I5UA 1BI0A 1UZCA 1FSHA 1OCZH 1A36A 1TQIA 3J80K 4WXCA 1WJ5A 2CQXA 3K4JA 4Y17A 4D1QA 2TCTA 3CP8A 1AWCA 2Z99A 3AG2H 5K5OA 2QVOA 2V7FA 3LQRA 4U0WA 5JLWA 1LFUP 1JJ6C 1BJZA 3GTJJ 1S7OA 1FMWA 1G6NA 3F6OA 3BCAA 5J8CA 2XVCA 1OPCA 4JQFA 1F1ZA 1S5LC 5K5QA 1DUXC 4M9SA 3PO3J 4N4NB 5ICEA 2PN6A 1FOYA 2CO5A 2PI0A 3BPXA 1JTXA 2VBWA 5KHDA 2VOOA 3S1MJ 1XGNA 2DYSH 2QSGX 1X2NA 3F22A 4OIOF 2NOJB 2WV1A 3FX3A 2Y0SA 2DMTA 1DPRA 1WZ2A 5LLQA 4LB5A 1OCOH 2F48A 2PBIA 1LE8A 1JKPC 5GP9A 2CH0A 5GAGJ 1HA8A 1MSFC 4Q47A 5FRMA 2MG4A 5M3FJ 1VQ8I 1XX5A 4PCQA 2X9DA 1HSTA 1POGA 2HQNA 3OYNA 1FC3A 6PAXA 1OCTC 3C3WA 4KA4A 2LR8A 3BQYA 1RNLA 3CCVI 1FYMA 2K7LA 2PG4A 3MFKA 1VQKI 1RZ4A 1FPQA 3NQOA 4OIRF 4IEJA 2R0QC 2XROA 1LB2A 1LFBA 2O03A 3G1LA 1XCVA 5B5EC 2VI6A 4N9IA 1UHSA 3CTAA 3AAFA 2CQQA 3PFYA 3KEQA 1K79A 2P7CB 4JYKA 2MH9A 3MVPA 1S7EA 5JVTA 3WTTC 1IDZA 4Z6YA 2Z2SB 5FFZA 3RPQA 2WC2A 4NB5A 4B44A 4ZDOA 1JKRC 1EF4A 1QVTA 2EFWA 3ZN1A 1JUPA 3HZJA 4KISA 4XOPA 3OSGA 3PQJA 3FF5A 2LSOA 4E6KG 2M30A 4BH9A 2HU9A 3B73A 2AS5F 2E71A 5CQEA 3F8NA 2HKXA 3N05A 2W24A 2E2HJ 4YIFA 4HV6A 1MSEC 4U7DA 1XCBA 1SVLA 1WSUA 3NWSA 2FQ3A 1OFCX 1KQ8A 3CCUI 1ZG1A 1MGTA 3HOWJ 3IKVA 3QP5A 2Y0SN 2XF5A 1XDUA 3KZIC 1QHHD 1ETOA 2ZFUA 3ABKH 4G6TB 4Y4RA 2K4BA 1WJDA 3D1NI 4HZFA 2KZGA 1T95A 4M3GA 5J6XA 2HZDA 2EZKA 3KE2A 4XRSG 4YIRX 2M7BA 3GW2A 3F8MA 2BE5F 3IWZA 3LA7A 2VUMJ 1MMAA 1BW5A 2B9SA 2XSDC 1IRGA 2EBIA 2O5RA 4BEHA 1PVEA 1TT0A 2VBXA 3GEZA 3KEYA 4RB1A 3ZGKA 3CJRB 3D5RC 1VQPI 1R4NB 4CYDA 1R36A 2EZLA 1OCPA 2A5WA 1WI3A 1I6HJ 3GFMA 3FM3A 2V9PA 1NG6A 3CQZJ 2LY2A 3E5QA 4G8XA 2HOEA 3LSJA 5CVRA 3GWZA 3HRSA 2Q0OA 4D7NA 3J81K 5E17F 2PJPA 1WH5A 3SEQA 1FSEA 2VBZA 2UXNA 2WY8Q 3E6BA 2Q8KA 2XAJA 2EQRA 3WTZA 3L2CA 1FTTA 3P9IA 1YW9A 2ISZA 2A68F 3TP3A 1RPWA 2H6BA 2JTVA 2OU2A 3B02A 3VYRB 3ZQCA 5E20A 1I50J 4BJ5C 4OWRB 3CDLA 5FB2A 3I59B 3GYHX 1LDKB 3KP6A 5E3NA 4M3EA 1YW8A 1XSXA 4JOMA 3WU1B 3CC7I 2HTJA 2CGPA 2IS6A 2FX0A 2GZWA 4HEA2 2BY3A 2CQNA 2ESNA 4Y7NJ 4W1UA 3CJQB 3CMYA 5IYCJ 1D8JA 5EG0A 1TC3C 4CHUA 1FJLA 1LVKA 4A3IJ 1MMDA 4N0BA 2K85A 2STTA 3QU6A 2ELKA 3QPSA 3W2VA 4EEFG 4P9UA 2BOLA 3DXJF 2F5EA 5JFRA 5C3EJ 1K4SA 1ZYRF 2GIVA 1FYLA 3HXLA 4G7OF 3PIPF 2JA8J 2HWVA 4ANJA 4OMZA 3FWEA 2EIKH 3I0TA 2CG4A 4PFOA 2AQFA 3WU2C 4WCGA 5M5WJ 4XKVA 1HCRA 1X3WB 3ASNH 4Y52J 5EEGA 2E2IJ 2L9VA 3I4MJ 2ZMEB 5E1ZB 2JA7J 1RUOA 2LF8A 4XN0A 1IRXA 4CUGA 3PUFA 1U5TC 4A12A 2HOAA 5EEHA 1YX3A 3OWTA 1K7AA 3KZYA 2H27A 4RA2A 1GHCA 3ABLH 2HXIA 4L5EA 1F5TA 1FP2A 3OYGA 2CW8A 4LK1F 1DDNA 4A69C 4HX7A 3I59A 1U9OA 4E7SA 3HOSA 2L7KA 2R5YB 3CP2A 1K61A 5FJ8J 2I10A 3HC7A 3WTYC 4U0VA 3ESWB 1MMGA 3W2WA 2R93J 4A3KJ 3OYDA 2A3SA 2DQRA 2JRTA 2MD5A 4KYWA 2QCOA 1ZLJA 3V42A 5F04A 1DGRM 1V5FA 3LA3A 3ZQLA 2HVSA 1VQ6I 3M3YJ 1FYKA 2ZXIA 2V1XA 2RNJA 2L4AA 4PGHA 3GLLA 1P7JA 4ETSA 3SZGA 3ABTA 1B1BA 1BIAA 1I3QJ 5EGOB 4D9JA 4RDUA 2Y48A 3OYLA 4BEHB 5IP6A 4ZYDA 5J1YA 4UY8I 1VNDA 3Q0UA 2CUFA 3J7ZI 1U9NA 3ZQHA 2DFIA 4HA8A 2EV0A 3L2QA 1B8IB 3IH2A 1FBSA 2X1EA 5K7HA 3GTPJ 1Z6RA 4XKBA 2OC6A 1U78A 4Y13A 1XSDA 1LJ9A 3ZMUA 3ZP5A 1GLNA 3I4NJ 2D1HA 3WODF 1ETQA 4JX6A 1VQLI 1VQ5I 2EA4A 3KPHA 3GTGJ 1Z0XA 2RDPA 4LFUA 3FMQA 3Q5FA 3TOBA 3CD6I 1SD7A 2LYCA 2MFZA 4UXNA 4RLQA 1YI2I 4ENNA 3K4BA 3PNYA 3J80Z 1K83J 1J7KA 2CJJA 3PL8A 2KHMA 4CDGA 1RKTA 4DQ2A 4LIVA 3ABUA 1Y1WJ 5BOXA 2DFHA 2L7FP 3KLOA 1KU2A 3J7AO 3HB9A 1Z1DA 3QYEA 1FY7A 1HSJA 3QP6A 3GFIA 4M73A 5IPAA 1X2MA 2EIMH 2FMLA 2G7HA 1ON1A 1SD4A 2CRGA 3CJTB 3QYFA 2XGCA 1WQ2A 2BW3B 1D1CA 2IVMA 1CF7B 1FNNA 3BJAA 3DCFA 3FHNA 2NRAC 2EFQA 4QSHA 1ZG3A 4A3BJ 1ZHFA 4BAYA 4S0HB 2DTRA 2F6CA 3K1MA 1WJCA 4RM3A 3P5JA 3NWTA 3BZCA 3WGGA 3FXKA 3CC4I 4C9YA 2NNNA 1JUSA 3BG9A 1R00A 3OYFA 2YR2A 1U6GA 1Z6TA 2NAZA 2HTSA 4HLXA 3GFLA 5HS9A 1VQ7I 2BY2A 2V1UA 2L7MP 1A6IA 2LG4A 4DZJA 4WWCA 1IXRC 2JJ7A 5L3BA 1G2HA 4WF2A 2HDDA 4YIIA 3OYJA 3CMAI 1TWHJ 3G3ZA 2JWTA 1FEXA 3E0JB 4BUPA 1K6YA 3M7GA 1D0ZA 1IV6A 2R7DA 2X6YA 3FXLA 1NK2P 3RQIA 3PFIA 4BQNA 4UUVA 3FXJA 5B1AH 1IXSB 3S32A 3BQZA 4IQ4A 3VEPA 4EVIA 1R4MB 4M74A 4OINF 1AA7A 1ZG5A 1SEUA 3RKXA 4DJAA 3C7JA 5FLVA 3S14J 2XKPA 1I6XA 3FMSA 4A2UA 4QIWN 1SANA 4G7HF 1YRNA 2DDBA 3HRUA 3TP0A 5GTIC 2XPWA 5H6RA 4R8HA 2IEKA 3FISA 4RMNA 2COBA 2R7XA 1IN7A 1R5HA 2Z1DA 4LLGF 2LVSA 3ZQ7A 2ECCA 1XSVA 3WE2A 2LH9A 1R1TA 3OYEA 3GZ5A 2F5CA 4NC7A 2QENA 1R22A 4XL9A 5E3LA 1YJ9I 1PP8F 1OYWA 3HUGB 4B43A 3DEUA 2COMA 5IY5H 4RGRA 3MZ8A 4PJ0C 4IHVA 1D3YA 4D0PA 3HIFA 3BCBA 2L3DA 2CUZA 2VASA 2O7OA 3QPHA 1ZARA 4I98B 3RKWA 4V2FA 4DW6A 1W0TA 3MZYA 3CCLI 3H5NA 3NAUA 1I1GA 2VQGA 3T5XA 4IX7A 4XICA 1UHWA 1WKMA 2R7QA 4AVZA 1V55H 2VJJA 4A3DJ 4BHCA 3VSLA 2XV4S 2OPTA 2VB6A 3CUQB 2K9MA 5EG0B 2BGCA 2Q1ZB 3K6GA 2HR3A 2JVGA 1T2KA 1LDDA 4BQQA 1JI8A 1S72I 1Z21A 2VJ4A 2JSCA 5GPAA 3LNQA 1FP1D 4FX0A 1R9TJ 1SMTA 2G0EA 1TWCJ 2R4GA 3E3VA 3PQKA 5HS8A 3OL3A 5EEAA 3JRHA 1HBXG 1QVUA 1M1EB 1QO0D 2IBDA 4NQWB 1P4XA 3OSFA 3H0GJ 5CJ9A 2RGVA 1KU3A 2WAQA 4UB8C 1PUEE 1E0EA 4RS8A 3HL2A 4O3MA 1GVJA 3L2WA 3KYCB 1BI1A 4EJVA 4P5OA 2HKOA 1MDMB 4I2OA 2EFPA 1XD7A 2J5OA 4BJ6C 2JT1A 4GYIA 5D5WB 3ML6A 2JA6J 5K7FA 2L01A 3ELKA 3K1NA 3JAMK
chains in the Genus database with same CATH topology
1AKHB 2JK3A 4D7MA 4A3FJ 3S16J 3JREA 3Q0WA 9ANTA 4CYCA 3PO3J 1WPKA 3WHBA 1VI0A 2DA4A 2L7ZA 4ABZA 1JTXA 3S1MJ 2YS9A 1X2NA 2CU7A 2WV1A 2YUSA 2DMTA 4A3MJ 3OOUA 5EDNA 3G1OA 3S15J 3HGGA 1LE8A 1JKPC 5GP9A 2VKVA 4MFEA 1MSFC 2DA1A 1ETVA 1H88C 4A3LJ 2MG4A 5M3FJ 2KT0A 2X9DA 1POGA 3B6CA 2FQ4A 1VF9A 2LFBA 1WCMJ 3FKIJ 2ME6A 1OCTC 2LLKA 3O8HA 5FLMJ 1HF0A 2Y9ZA 2LR8A 3BR2A 3JRIA 1JKOC 3BQYA 1SFOJ 3PO2J 4A3JJ 1UG2A 1ZR2A 1ITYA 4MIMA 4JX4A 2NVXJ 2IAIA 4IEJA 2R0QC 5IYDJ 1LFBA 2DMUA 3G1LA 2VI6A 5C4XJ 1UHSA 2TRTA 2CQQA 4BXXJ 4JYKA 3GTMJ 3MVPA 4D5CA 1S7EA 1IDZA 2DN0A 2GM4A 1Y1VJ 1JKRC 1EF4A 1QVTA 4JP0A 1JUPA 4LOCA 1B72B 2HI3A 3OSGA 3O8GA 1PUFA 3M4OJ 4A3GJ 3ZQIA 3BTIA 3RKQA 3ZQFA 2DMNA 2E2HJ 4B4CA 3K2AA 2AO9A 1MSEC 4A93J 5C44J 1OFCX 1MBKA 3HOWJ 5EYRA 2NVTJ 1BA5A 2Y0SN 4JX5A 1DU0A 1T56A 1ETOA 1F36A 3HOYJ 3D1NI 4M3GA 1DU6A 2EZKA 2JMWA 4XRSG 2H1KA 5M5YJ 3JRAA 4CYCB 1NTCA 2XGDA 2VUMJ 1BW5A 4DYCA 2XSDC 2M34A 2EBIA 5F0FA 1GUUA 5J1RA 1APLC 2LD5A 4M6VA 3QQAA 3S17J 2LY9A 2K9SA 2DA2A 1RETA 4FE4A 3JR9A 3MKLA 1I6HJ 2EZLA 1FIAA 1OCPA 1WI3A 4AYBN 4B3AA 5IOYA 4MO7A 2GBYA 4C2MJ 3GTLJ 3CQZJ 1GV2A 1MH3A 1RR7A 1LE8B 3LSJA 1Z77A 4D7NA 2X48A 1WH5A 1XS9A 2N8GA 4GFBA 2E2JJ 2EQRA 1MBFA 1FTTA 5F0HA 4UUSA 1UMQA 3TP3A 1RPWA 2Y31A 3ZQCA 1I50J 2R7ZJ 2DMQA 1PUFB 1XG1A 1JT6A 1JJ8C 3CDLA 1HOMA 2ECBA 2MW8A 5E3NA 4M3EA 5FKLA 2FX0A 3FK7A 5DTDA 1GT0C 2H8RA 4Y7NJ 4W1UA 3CMYA 1BW6A 5IYCJ 1TWGJ 3SJMA 5EG0A 1TC3C 4XIDA 1U8BA 1ZKGA 1FJLA 3F0CA 2XB0X 4A3IJ 3JRGA 1X58A 1IGNA 5M5XJ 5F0CA 1MBJA 2ELKA 3QPSA 4EEFG 3TW7A 3A01B 3W6VA 3SDGA 3L1PA 5C3EJ 2QF7A 5FKOA 2P81A 5FKNA 1JT0A 2NVQJ 2JA8J 4HNVA 2O9LA 3MN2A 1MNMC 3BR6A 2EZHA 4I76A 2E19A 1IUFA 5M5WJ 2X6OA 1W0UA 1AKHA 1HCRA 3VPRA 1QPIA 3HOUJ 4Y52J 2ZB9A 3BG5A 5FKMA 2E2IJ 3I4MJ 2JA7J 4X1EA 2DMPA 3BG3A 3LSRA 1AHDP 1ZK8A 2HOAA 2PMZN 2ME0A 2R5ZA 4QTRA 2EZIA 3JRFA 4DYQA 2JN6A 2HOTA 4RBOA 5F08A 1WH7A 4MFDA 3E7LA 2HXIA 4L5EA 2NVYJ 3BTCA 5M3MJ 2W48A 2M9HA 2K9QA 2NOGA 3NARA 4A69C 3H3VK 3S1NJ 1U9OA 2R5YB 1K61A 5FJ8J 2I10A 1BL0A 3A02A 4C3HJ 2ID6A 1XC5A 4DYRA 3FK6A 2R93J 3FIWA 2D5VA 4A3KJ 1H8AC 4I6ZA 1O4XA 1JUMA 2QCOA 4DZPA 3G1MA 3IH4A 5F04A 3BTLA 2XB5A 3ZQGA 3ZQLA 5DS9A 2HOSA 3M3YJ 2Y30A 4IHXA 4A3EJ 2CUEA 1P7JA 1TWFJ 2DA3A 3S2DJ 3JRDA 1Q1VA 1RESA 1I3QJ 2L0KA 5EZGA 5F27A 5EGOB 4RDUA 3JRCA 5IP6A 5J1YA 4B1RA 1VNDA 3Q0UA 2CUFA 3BR3A 1U9NA 3ZQHA 3DEWA 1ENHA 2XPVA 2DTZA 1B8IB 3IH2A 5K7HA 5EF6A 3GTPJ 4XRMA 4BY7J 4NDLA 1ETXA 3HEFA 3BR0A 1GVDA 1U78A 3S1RJ 1NK3P 2KDZA 3LSGA 3I4NJ 2M0CA 3A03A 1RKWA 2EH3A 3HOZJ 1F43A 2Y9YA 3HOXJ 1ETQA 4JX6A 4MLOA 3GTGJ 2LTPA 1MH4A 1Z0XA 4FE7A 3IV5A 2LKXA 2YU9J 1H89C 1GDTA 5IP7J 1MBEA 2K40A 1ZGWA 3GTKJ 3RZOJ 1AU7A 1K83J 2XGEA 2CJJA 2NS8A 1ORKA 2VPRA 1RKTA 3B6AA 1GV5A 4AC0A 1YRNB 1Y1WJ 2RAEA 1E3OC 2FJ1A 3Q0VA 2L7FP 4BBRJ 5J3LA 3HB9A 4M3DA 1FTZA 4FISA 4X6AJ 1IDYA 5EZHA 1X2MA 5IPAA 3TEDA 1MBGA 4XRSA 2WAQN 2CRGA 2XGCA 3C2BA 3S2HJ 5GPCA 3S1QJ 2M2EA 3DCFA 4A3CJ 2HQ5A 1MBHA 4V2GA 4QSHA 4A3BJ 2ID3A 1IJWC 2DA6A 4S0HB 1ETKA 2JA5J 1CQTA 5BNGA 2AHQA 1HLVA 1B72A 1QRYA 3BG9A 1JUSA 1ZQ3P 3QPLA 4IHWA 4D5FA 2L7MP 1A6IA 2B63J 4DZJA 2XRLA 2LP0A 2JJ7A 5HODA 1A5JA 3LOCA 3GTQJ 1G2HA 2HDDA 5EGOA 1WGXA 5IP9J 2O8KA 1TWHJ 1FEXA 2JWTA 3JRBA 1NK2P 1IV6A 3RQIA 2R92J 3A01A 3BQZA 2NS7A 3CCYA 2OF7A 5FLVA 3S14J 2E1OA 3UKGA 2HXOA 2LK2A 2VKEA 1IC8A 4QIWN 1SANA 1YRNA 1JGGA 2DJNA 4IHYA 3TP0A 4M3BA 4C3IJ 1FIPA 2XPWA 1JTYA 5IOZA 2IEKA 3BR5A 3FISA 2COBA 4BKXA 4J19A 4AUXA 1VFCA 2LVSA 1ETYA 4C3JJ 2L9RA 2ECCA 3HBLA 5E3OA 3BTJA 3IH3A 3Q3SA 5E3LA 2DA5A 4BBSJ 4UUSB 1JKQC 2GLOA 4IHVA 3TW6A 2MSYA 4BY1J 2O7OA 1ZTRA 3HDDA 3PM1A 3BR1A 4V2FA 4DW6A 2Y2ZA 1B8IA 4M3FA 1W0TA 2FD5A 2MGQA 3NAUA 1T33A 4FTHA 3LSPA 2K9NA 4XICA 4FCYA 3BT9A 1D5YA 4A3DJ 2R5ZB 3WHCA 5IYBJ 2OPTA 3HOVJ 1P7IA 5EG0B 5E3MA 2HYJA 3K7AJ 5J1UA 3ZOBA 4W97A 2R5YA 2DA7A 5F1JA 4XK4A 2M8GX 5GPAA 3LNQA 1TWAJ 1IRZA 1ZR4A 3HM5A 1R9TJ 1ETWA 2G0EA 3HKZN 3GBGA 5K7ZA 1TWCJ 3OIOA 3JRHA 5EEAA 1HDDC 1QVUA 2IBDA 4G12A 3RZDJ 3OSFA 3H0GJ 2XPUA 5JLXA 5C4JJ 1HDPA 3GTOJ 3SFIA 3HGYA 4UUTA 1OJLA 2CQXA 2WB1N 2TCTA 5JLWA 1LFUP 1JJ6C 1BJZA 5FKKA 3GTJJ 2JA6J 1IG7A 5K7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKH B;  2JK3 A;  4D7M A;  4A3F J;  3S16 J;  3JRE A;  3Q0W A;  9ANT A;  4CYC A;  3PO3 J;  1WPK A;  3WHB A;  1VI0 A;  2DA4 A;  2L7Z A;  4ABZ A;  1JTX A;  3S1M J;  2YS9 A;  1X2N A;  2CU7 A;  2WV1 A;  2YUS A;  2DMT A;  4A3M J;  3OOU A;  5EDN A;  3G1O A;  3S15 J;  3HGG A;  1LE8 A;  1JKP C;  5GP9 A;  2VKV A;  4MFE A;  1MSF C;  2DA1 A;  1ETV A;  1H88 C;  4A3L J;  2MG4 A;  5M3F J;  2KT0 A;  2X9D A;  1POG A;  3B6C A;  2FQ4 A;  1VF9 A;  2LFB A;  1WCM J;  3FKI J;  2ME6 A;  1OCT C;  2LLK A;  3O8H A;  5FLM J;  1HF0 A;  2Y9Z A;  2LR8 A;  3BR2 A;  3JRI A;  1JKO C;  3BQY A;  1SFO J;  3PO2 J;  4A3J J;  1UG2 A;  1ZR2 A;  1ITY A;  4MIM A;  4JX4 A;  2NVX J;  2IAI A;  4IEJ A;  2R0Q C;  5IYD J;  1LFB A;  2DMU A;  3G1L A;  2VI6 A;  5C4X J;  1UHS A;  2TRT A;  2CQQ A;  4BXX J;  4JYK A;  3GTM J;  3MVP A;  4D5C A;  1S7E A;  1IDZ A;  2DN0 A;  2GM4 A;  1Y1V J;  1JKR C;  1EF4 A;  1QVT A;  4JP0 A;  1JUP A;  4LOC A;  1B72 B;  2HI3 A;  3OSG A;  3O8G A;  1PUF A;  3M4O J;  4A3G J;  3ZQI A;  3BTI A;  3RKQ A;  3ZQF A;  2DMN A;  2E2H J;  4B4C A;  3K2A A;  2AO9 A;  1MSE C;  4A93 J;  5C44 J;  1OFC X;  1MBK A;  3HOW J;  5EYR A;  2NVT J;  1BA5 A;  2Y0S N;  4JX5 A;  1DU0 A;  1T56 A;  1ETO A;  1F36 A;  3HOY J;  3D1N I;  4M3G A;  1DU6 A;  2EZK A;  2JMW A;  4XRS G;  2H1K A;  5M5Y J;  3JRA A;  4CYC B;  1NTC A;  2XGD A;  2VUM J;  1BW5 A;  4DYC A;  2XSD C;  2M34 A;  2EBI A;  5F0F A;  1GUU A;  5J1R A;  1APL C;  2LD5 A;  4M6V A;  3QQA A;  3S17 J;  2LY9 A;  2K9S A;  2DA2 A;  1RET A;  4FE4 A;  3JR9 A;  3MKL A;  1I6H J;  2EZL A;  1FIA A;  1OCP A;  1WI3 A;  4AYB N;  4B3A A;  5IOY A;  4MO7 A;  2GBY A;  4C2M J;  3GTL J;  3CQZ J;  1GV2 A;  1MH3 A;  1RR7 A;  1LE8 B;  3LSJ A;  1Z77 A;  4D7N A;  2X48 A;  1WH5 A;  1XS9 A;  2N8G A;  4GFB A;  2E2J J;  2EQR A;  1MBF A;  1FTT A;  5F0H A;  4UUS A;  1UMQ A;  3TP3 A;  1RPW A;  2Y31 A;  3ZQC A;  1I50 J;  2R7Z J;  2DMQ A;  1PUF B;  1XG1 A;  1JT6 A;  1JJ8 C;  3CDL A;  1HOM A;  2ECB A;  2MW8 A;  5E3N A;  4M3E A;  5FKL A;  2FX0 A;  3FK7 A;  5DTD A;  1GT0 C;  2H8R A;  4Y7N J;  4W1U A;  3CMY A;  1BW6 A;  5IYC J;  1TWG J;  3SJM A;  5EG0 A;  1TC3 C;  4XID A;  1U8B A;  1ZKG A;  1FJL A;  3F0C A;  2XB0 X;  4A3I J;  3JRG A;  1X58 A;  1IGN A;  5M5X J;  5F0C A;  1MBJ A;  2ELK A;  3QPS A;  4EEF G;  3TW7 A;  3A01 B;  3W6V A;  3SDG A;  3L1P A;  5C3E J;  2QF7 A;  5FKO A;  2P81 A;  5FKN A;  1JT0 A;  2NVQ J;  2JA8 J;  4HNV A;  2O9L A;  3MN2 A;  1MNM C;  3BR6 A;  2EZH A;  4I76 A;  2E19 A;  1IUF A;  5M5W J;  2X6O A;  1W0U A;  1AKH A;  1HCR A;  3VPR A;  1QPI A;  3HOU J;  4Y52 J;  2ZB9 A;  3BG5 A;  5FKM A;  2E2I J;  3I4M J;  2JA7 J;  4X1E A;  2DMP A;  3BG3 A;  3LSR A;  1AHD P;  1ZK8 A;  2HOA A;  2PMZ N;  2ME0 A;  2R5Z A;  4QTR A;  2EZI A;  3JRF A;  4DYQ A;  2JN6 A;  2HOT A;  4RBO A;  5F08 A;  1WH7 A;  4MFD A;  3E7L A;  2HXI A;  4L5E A;  2NVY J;  3BTC A;  5M3M J;  2W48 A;  2M9H A;  2K9Q A;  2NOG A;  3NAR A;  4A69 C;  3H3V K;  3S1N J;  1U9O A;  2R5Y B;  1K61 A;  5FJ8 J;  2I10 A;  1BL0 A;  3A02 A;  4C3H J;  2ID6 A;  1XC5 A;  4DYR A;  3FK6 A;  2R93 J;  3FIW A;  2D5V A;  4A3K J;  1H8A C;  4I6Z A;  1O4X A;  1JUM A;  2QCO A;  4DZP A;  3G1M A;  3IH4 A;  5F04 A;  3BTL A;  2XB5 A;  3ZQG A;  3ZQL A;  5DS9 A;  2HOS A;  3M3Y J;  2Y30 A;  4IHX A;  4A3E J;  2CUE A;  1P7J A;  1TWF J;  2DA3 A;  3S2D J;  3JRD A;  1Q1V A;  1RES A;  1I3Q J;  2L0K A;  5EZG A;  5F27 A;  5EGO B;  4RDU A;  3JRC A;  5IP6 A;  5J1Y A;  4B1R A;  1VND A;  3Q0U A;  2CUF A;  3BR3 A;  1U9N A;  3ZQH A;  3DEW A;  1ENH A;  2XPV A;  2DTZ A;  1B8I B;  3IH2 A;  5K7H A;  5EF6 A;  3GTP J;  4XRM A;  4BY7 J;  4NDL A;  1ETX A;  3HEF A;  3BR0 A;  1GVD A;  1U78 A;  3S1R J;  1NK3 P;  2KDZ A;  3LSG A;  3I4N J;  2M0C A;  3A03 A;  1RKW A;  2EH3 A;  3HOZ J;  1F43 A;  2Y9Y A;  3HOX J;  1ETQ A;  4JX6 A;  4MLO A;  3GTG J;  2LTP A;  1MH4 A;  1Z0X A;  4FE7 A;  3IV5 A;  2LKX A;  2YU9 J;  1H89 C;  1GDT A;  5IP7 J;  1MBE A;  2K40 A;  1ZGW A;  3GTK J;  3RZO J;  1AU7 A;  1K83 J;  2XGE A;  2CJJ A;  2NS8 A;  1ORK A;  2VPR A;  1RKT A;  3B6A A;  1GV5 A;  4AC0 A;  1YRN B;  1Y1W J;  2RAE A;  1E3O C;  2FJ1 A;  3Q0V A;  2L7F P;  4BBR J;  5J3L A;  3HB9 A;  4M3D A;  1FTZ A;  4FIS A;  4X6A J;  1IDY A;  5EZH A;  1X2M A;  5IPA A;  3TED A;  1MBG A;  4XRS A;  2WAQ N;  2CRG A;  2XGC A;  3C2B A;  3S2H J;  5GPC A;  3S1Q J;  2M2E A;  3DCF A;  4A3C J;  2HQ5 A;  1MBH A;  4V2G A;  4QSH A;  4A3B J;  2ID3 A;  1IJW C;  2DA6 A;  4S0H B;  1ETK A;  2JA5 J;  1CQT A;  5BNG A;  2AHQ A;  1HLV A;  1B72 A;  1QRY A;  3BG9 A;  1JUS A;  1ZQ3 P;  3QPL A;  4IHW A;  4D5F A;  2L7M P;  1A6I A;  2B63 J;  4DZJ A;  2XRL A;  2LP0 A;  2JJ7 A;  5HOD A;  1A5J A;  3LOC A;  3GTQ J;  1G2H A;  2HDD A;  5EGO A;  1WGX A;  5IP9 J;  2O8K A;  1TWH J;  1FEX A;  2JWT A;  3JRB A;  1NK2 P;  1IV6 A;  3RQI A;  2R92 J;  3A01 A;  3BQZ A;  2NS7 A;  3CCY A;  2OF7 A;  5FLV A;  3S14 J;  2E1O A;  3UKG A;  2HXO A;  2LK2 A;  2VKE A;  1IC8 A;  4QIW N;  1SAN A;  1YRN A;  1JGG A;  2DJN A;  4IHY A;  3TP0 A;  4M3B A;  4C3I J;  1FIP A;  2XPW A;  1JTY A;  5IOZ A;  2IEK A;  3BR5 A;  3FIS A;  2COB A;  4BKX A;  4J19 A;  4AUX A;  1VFC A;  2LVS A;  1ETY A;  4C3J J;  2L9R A;  2ECC A;  3HBL A;  5E3O A;  3BTJ A;  3IH3 A;  3Q3S A;  5E3L A;  2DA5 A;  4BBS J;  4UUS B;  1JKQ C;  2GLO A;  4IHV A;  3TW6 A;  2MSY A;  4BY1 J;  2O7O A;  1ZTR A;  3HDD A;  3PM1 A;  3BR1 A;  4V2F A;  4DW6 A;  2Y2Z A;  1B8I A;  4M3F A;  1W0T A;  2FD5 A;  2MGQ A;  3NAU A;  1T33 A;  4FTH A;  3LSP A;  2K9N A;  4XIC A;  4FCY A;  3BT9 A;  1D5Y A;  4A3D J;  2R5Z B;  3WHC A;  5IYB J;  2OPT A;  3HOV J;  1P7I A;  5EG0 B;  5E3M A;  2HYJ A;  3K7A J;  5J1U A;  3ZOB A;  4W97 A;  2R5Y A;  2DA7 A;  5F1J A;  4XK4 A;  2M8G X;  5GPA A;  3LNQ A;  1TWA J;  1IRZ A;  1ZR4 A;  3HM5 A;  1R9T J;  1ETW A;  2G0E A;  3HKZ N;  3GBG A;  5K7Z A;  1TWC J;  3OIO A;  3JRH A;  5EEA A;  1HDD C;  1QVU A;  2IBD A;  4G12 A;  3RZD J;  3OSF A;  3H0G J;  2XPU A;  5JLX A;  5C4J J;  1HDP A;  3GTO J;  3SFI A;  3HGY A;  4UUT A;  1OJL A;  2CQX A;  2WB1 N;  2TCT A;  5JLW A;  1LFU P;  1JJ6 C;  1BJZ A;  5FKK A;  3GTJ J;  2JA6 J;  1IG7 A;  5K7F A; 
#chains in the Genus database with same CATH topology
 3R4K A;  1QPM A;  2JK3 A;  3IAM 2;  4XOT A;  3ZQQ A;  2V9K A;  3Q0W A;  3E6M A;  2QBY B;  4ZTF A;  1R1V A;  4CYC A;  1SC7 A;  1BIB A;  1WPK A;  4XKC A;  2R3S A;  3WHB A;  3GLX A;  2L7Z A;  2J5P A;  4HV5 A;  2KIF A;  4MQV A;  3L2U A;  4OIP F;  3IP4 B;  2VKD A;  4KMU X;  3TOA A;  2L5Q A;  2YS9 A;  4KIT B;  2CU7 A;  2VOP A;  2W1O A;  4M72 A;  5TJJ A;  1V3F A;  1Y39 A;  2AQE A;  4A3M J;  1A6Q A;  1MZB A;  3OOU A;  4ZZD A;  3G73 A;  3VDX A;  5EDN A;  2DT7 B;  2OCE A;  5FLX K;  2LRD A;  3CF2 A;  1ETV A;  4A3L J;  2LBF A;  3CZ6 A;  3K1P A;  3I53 A;  1VF9 A;  2BXY A;  3GFJ A;  3FKI J;  3O8H A;  5HDG A;  1REP C;  3BR2 A;  2XGX A;  2KPM A;  1SFO J;  2NS0 A;  1WVR A;  3PO2 J;  4J00 A;  1XMK A;  5D5U B;  4IF4 A;  2XHK A;  3CUQ A;  1ZR2 A;  1ITY A;  5LHG A;  3IL2 A;  1LQ1 A;  2NYX A;  2DMU A;  3ZRG A;  1ERD A;  2O61 A;  1JE8 A;  5C4X J;  1SVM A;  2RQP A;  2TRT A;  4XSX F;  4F3Q A;  4BS9 A;  4PJJ A;  3GTM J;  4IVN A;  3CUO A;  2YU3 A;  2GM4 A;  1XN7 A;  3I3L A;  1PUF A;  3M4O J;  4P96 A;  1X4O A;  4RB0 A;  2DK8 A;  3A0H C;  2OQG A;  2KLO A;  3P9C A;  4RM2 A;  2OTL I;  3I64 A;  3RKQ A;  3WE3 A;  4BAC A;  1H9G A;  3BZ6 A;  4I01 A;  2X6X A;  2DFF A;  4KT6 A;  2EPF A;  2HS5 A;  2XIG A;  1DP7 P;  2E5Z A;  4OIQ F;  4JX5 A;  1XPX A;  1T56 A;  1T0F A;  3WG9 A;  4XNF A;  1F36 A;  4LGW A;  2R7W A;  1VQO I;  5H6Q A;  3G4S I;  3N4M A;  4OU0 A;  1DU6 A;  3DBH B;  3A1Y A;  1LNW A;  2H1K A;  4I09 A;  2BW3 A;  1TL8 A;  2M34 A;  5E1X A;  5F0F A;  2XRN A;  1GUU A;  3H1C A;  2DXI A;  3J7A Y;  4YFN F;  1N78 A;  3S17 J;  1RR8 C;  2LY9 A;  2K4J A;  3K9T A;  1RET A;  1MNE A;  2A6T A;  2ZO4 A;  3VOE A;  1FIA A;  4ESB A;  4AYB N;  2HZT A;  4C2M J;  2ADU A;  4ON0 A;  4H4K C;  5DYM A;  1N77 A;  4XKW A;  3X2Q H;  1KU7 A;  3FXQ A;  3V7C A;  4BGD A;  2STW A;  1Z77 A;  2X48 A;  2AXT C;  1XS9 A;  1OCC H;  1G3W A;  4BNC A;  4N9H A;  5LGU A;  1YE9 A;  4BDZ A;  1HKS A;  4II2 A;  2E2J J;  4KIG A;  3TL4 X;  2EA2 A;  4MNU A;  3TDZ C;  3JAM Z;  5LEJ A;  3RIR A;  1G3T A;  2MLG A;  2DMQ A;  1XG1 A;  4MEY F;  2HYF A;  4BE2 A;  2MW8 A;  2E35 A;  2VKH A;  3EUK L;  5CVJ A;  3D5L A;  1UFM A;  3FK7 A;  2H8R A;  1GT0 C;  5F6F A;  5IT3 A;  2MAB A;  4EJU A;  2K86 A;  3COA C;  2OZU A;  1YLF A;  5AIQ A;  1KU9 A;  1ZKG A;  4E7Z A;  3CES A;  3GO5 A;  5D6E A;  1IGN A;  2LOO A;  2BY0 A;  1MBJ A;  4ZDP A;  2QQB A;  3JTG A;  1IN5 A;  2LY1 A;  3HUG A;  3SDG A;  3F21 A;  4IQJ A;  1LDJ A;  2H8W A;  4RAZ A;  2L02 A;  4I99 C;  4PFP A;  3VYU B;  2BXZ A;  4ZYE A;  3ROU A;  4HNV A;  3OV8 A;  3ZN0 A;  3U21 A;  3BR6 A;  2XAF A;  3QOE A;  2VJ5 A;  3TGN A;  2EZH A;  5J4V A;  1IUF A;  1D1B A;  2KDO A;  2WA0 A;  3HOU J;  2KIU A;  2XF6 A;  3R61 A;  3G2B A;  1IN6 A;  1MJA A;  4UVB A;  5FKM A;  3CCS I;  2ESH A;  2ZBK A;  4B3X A;  5JHF A;  1RRJ A;  1EJ9 A;  1BI2 A;  2KRH A;  4F91 B;  1K6O A;  2PMZ N;  4GXO A;  2FNA A;  2QLZ A;  4HG2 A;  3S3N A;  2CYY A;  1OMI A;  5F1R A;  2A61 A;  2IA0 A;  2JN6 A;  3KFW X;  3OYB A;  2X1D A;  3JW4 A;  3H92 A;  2GOM A;  3K70 C;  3GVA A;  4P55 A;  4HNU A;  2NVY J;  5M3M J;  2DBB A;  4EM0 B;  2WAE A;  2W48 A;  2QZ8 A;  3NAR A;  4AD9 A;  4IOA F;  5KVR A;  3S1N J;  2QA4 I;  3EUH A;  1X3Z B;  3I55 I;  3CCQ I;  4NC6 A;  2FA5 A;  1BL0 A;  3A02 A;  5IT9 Z;  2F5D A;  3SZP A;  2ID6 A;  2YX4 A;  4A0X A;  5GTH C;  1ZH5 A;  4L9T A;  4AVP A;  3FK6 A;  2G7U A;  1YIO A;  2D5V A;  5JVG F;  1H8A C;  1O4X A;  1QHG A;  1V5E A;  3BP8 A;  4DZP A;  2GXA A;  3HOT A;  2CWE A;  3RKY A;  5E18 F;  3BTL A;  2HOS A;  5DS9 A;  3K2Z A;  3L00 A;  3H9Q A;  2LBF B;  3FM5 A;  1OLT A;  4IHX A;  3Q9V A;  1Y56 A;  4A3E J;  1K4T A;  2DA3 A;  4FX4 A;  3S2D J;  1QNT A;  4ZJZ A;  1Q1V A;  3LAP A;  1IN4 A;  4KN4 X;  3IWF A;  5EZG A;  4AID A;  1EA3 A;  2FE3 A;  2UWM A;  2IGO A;  2FU4 A;  2R7F A;  3LL7 A;  4O5V A;  2HQA A;  4GO1 A;  3BR3 A;  2E60 A;  3HRT A;  4BE1 A;  3KP5 A;  2XPV A;  1G3Y A;  2QGU A;  3M1C A;  4MGR A;  3CCJ I;  2K3P A;  2OAZ A;  4LG0 A;  4NDL A;  3MQ0 A;  3HEF A;  3LSI A;  1EV7 A;  3HG9 A;  2P4W A;  3DBL B;  3KX2 A;  3LSG A;  3A03 A;  3HOZ J;  3DP7 A;  1F43 A;  2KRC A;  1Q1H A;  4MLO A;  1J75 A;  1BI3 A;  2YU9 J;  2BYV E;  1STZ A;  4XQF A;  2HPM A;  3DKY A;  2WAF A;  2BV6 A;  4NHJ A;  5J47 A;  1MBE A;  1RI7 A;  1EKE A;  5FFX A;  3RZO J;  2IT0 A;  2A5Y B;  5CLS A;  2PLY A;  2VPR A;  2EJR A;  2WY7 Q;  3B6A A;  3T0Y A;  1BOA A;  1BC7 C;  1VQ9 I;  1BC8 C;  3NRV A;  3Q0V A;  4BBR J;  2OV7 A;  2JA2 A;  4M3D A;  4XON A;  1YYV A;  2ZSI B;  2VE8 A;  2PMU A;  1X4P A;  3AG4 H;  1X1P A;  1YX5 A;  1S9H A;  1K78 B;  4KMF A;  1TW2 A;  4XRS A;  1PYV A;  3LST A;  3GME A;  2UZK A;  1T0F C;  5GPC A;  4LIT A;  4BYY A;  2M2E A;  4RAY A;  4A3C J;  5HLT A;  3BPV A;  1W36 C;  4LG3 A;  2KKO A;  4HF0 A;  3KEO A;  3T1B A;  4R79 A;  3ERE D;  4E7L A;  1MMS A;  1CQT A;  4ITV A;  3GUD A;  3M9A A;  2HQR A;  1USS A;  1BOB A;  3ZMD A;  4IRG A;  4UV8 A;  3QPL A;  4G9Y A;  1ZAO A;  1P4W A;  2KFD A;  3H9J A;  1LFP A;  4FET A;  2XRL A;  2LP0 A;  1A5J A;  2KIM A;  3SXY A;  3F8F A;  1IN8 A;  5FGM A;  1WGX A;  4FQG A;  1B9M A;  3DEE A;  2FXA A;  3JRB A;  4EM1 A;  1XGS A;  5JI6 A;  4HX8 A;  4IRI A;  2XDV A;  4PJL A;  1KQ0 A;  4UHT A;  3A01 A;  1FZP B;  5GAH J;  1BJA A;  3FZV A;  1OQY A;  3AG3 H;  2EFN A;  5DM6 F;  2D45 A;  1NH3 A;  1JGG A;  1W36 D;  4IHY A;  3RI4 A;  3I9V 2;  2FSW A;  3HPH A;  4M3B A;  5D8K B;  4P9F A;  3O2P E;  1IF1 A;  1VQM I;  1OYI A;  2K3F A;  2GAU A;  2MC3 A;  4XM3 A;  4BQA A;  4IKF A;  4IHT A;  4BKX A;  5HNH A;  4AUX A;  3DTE A;  4F7Z A;  1IRF A;  5E3O A;  3TQN A;  3BTJ A;  1E3P A;  3IH3 A;  2M87 A;  2M1B A;  5B1B H;  5ILS A;  4YFK F;  4UUS B;  1U3E M;  1JKQ C;  4A0Z A;  3KIO A;  5EJC A;  5F64 A;  3HHH A;  4XLH A;  4HF2 A;  1ZTR A;  4A0Y A;  2DW4 A;  3PM1 A;  2VE9 A;  5LHI A;  3BR1 A;  1ZLK A;  2Y2Z A;  2IS4 A;  3F8B A;  3SQN A;  4ASN A;  4M6X A;  1F4K A;  5L3C A;  4QWQ A;  4HNT A;  2MGQ A;  2OCC H;  3OMY A;  4HF1 A;  1D0X A;  5L3F A;  3O3K A;  2JUC A;  5TGT A;  1A04 A;  1OR7 A;  3RPU D;  2GXB A;  1WHU A;  2XKO A;  1AOY A;  5LRS A;  2Q2E B;  3FMR A;  4CCM A;  1ON2 A;  2VIX A;  2PJR A;  1VZ0 A;  3KP4 A;  3A4C A;  5F1J A;  4F55 A;  2Y69 H;  2M8G X;  2A05 A;  5JR3 A;  3BG7 A;  3MKZ A;  4HST A;  3W6J B;  4DBR A;  2KIQ A;  3WTV C;  1ZR4 A;  4XLP F;  1Z05 A;  3GBG A;  3HSR A;  3OR2 C;  5K7Z A;  1WJB A;  3ZMT A;  1R6R A;  1SMY F;  5LGT A;  4CCO A;  3OIO A;  1P6R A;  3RJP A;  4XR6 A;  2F4O B;  5ERI A;  1X1C A;  3EET A;  2FMY A;  2OBP A;  1EH6 A;  2OUM A;  1ZRF A;  2XPU A;  4KJZ A;  3L2V A;  5JLX A;  1G4D A;  1SFU A;  3GTO J;  5D4S A;  1V5G A;  3BJ6 A;  3HGY A;  5FLX Z;  3WTS C;  4LG0 B;  2CQK A;  2YPR A;  3TO7 A;  2WB1 N;  3PIO F;  1RUN A;  1T08 B;  2HDW A;  2P6S A;  5CQG A;  1PP7 U;  3DQV C;  1XB4 A;  5FKK A;  2XAG A;  4DIQ A;  4HPQ A;  1O3R A;  3S8P A;  4OAZ A;  1AKH B;  2VT2 A;  2RN7 A;  3JCU C;  3KP2 A;  3S16 J;  3O6B B;  9ANT A;  1IXC A;  2PFB A;  2MA3 A;  3U1K A;  4EMS A;  3ECH A;  4QLC U;  3DTI A;  1JXS A;  1VQ4 I;  3E6C C;  2DA4 A;  1GXQ A;  1XGM A;  1YJN I;  2O8X A;  2LMD A;  1SD5 A;  3CC2 I;  4GRI A;  2KMU A;  2YSR A;  3K10 A;  4PSX A;  1Z7L A;  3V4G A;  2YUS A;  1HKQ A;  4FT8 A;  1XMX A;  2JQ7 A;  2M0M A;  1BR1 A;  1D5V A;  3OYC A;  1ZGA A;  4MFE A;  2NXN B;  2F5F A;  3H0D A;  2KT0 A;  3EYY A;  2KJB A;  2VXD A;  4YFX F;  4PZJ A;  3HTU A;  2B7E A;  2IA1 A;  3OY9 A;  2EB7 A;  2IS1 A;  3TO6 A;  3U9G A;  2FQ4 A;  2IJL A;  2LFB A;  1R23 A;  4CXF A;  2LLK A;  2Y9Z A;  2DI3 A;  2LKP A;  1JKO C;  2A6E F;  2IP2 A;  2P5L C;  4DNC A;  4NQW A;  5L3E A;  2DOA A;  2CFX A;  1UG2 A;  2D1V A;  4A3J J;  1IO2 A;  3WTX C;  4MIM A;  5J40 A;  2X4H A;  3CMM A;  4LK0 F;  3MKW B;  2NVX J;  2IAI A;  5IYD J;  2WB1 A;  3DPU A;  4L9J A;  2X51 A;  1IW7 F;  1IUY A;  2WV0 A;  4ZH4 F;  3M8E A;  4HW0 A;  2JPC A;  2DN0 A;  1S7A A;  4GGG A;  1Y1V J;  2FNP A;  2ACJ A;  3DPT A;  2UUZ A;  2H6C A;  3EUA A;  4BJT A;  3N97 A;  3O8G A;  5AIP A;  5BMZ A;  1N25 A;  3BTI A;  2O3F A;  3TDU C;  4LLN A;  3DBR B;  2PMH A;  3ZQF A;  5HNF A;  2DCE A;  2AO9 A;  4A93 J;  5C44 J;  1UEL B;  1MBK A;  1P92 A;  4CSW A;  2NVT J;  1RC9 A;  1BA5 A;  3IHU A;  4HLY A;  2L9N A;  3CME I;  3CDI A;  1YS7 A;  1L3L A;  3OOP A;  3I54 A;  1ONV A;  3V8K A;  1MND A;  2DT5 A;  4AIH A;  1Z91 A;  5CPR B;  4BE0 A;  4RAG A;  3W3C A;  1YJW I;  2JMW A;  2B0L A;  3EPZ A;  4RB3 C;  4KNY A;  2PEX A;  2EIL H;  3JRA A;  4CYC B;  3S93 A;  1NTC A;  2XGD A;  4Q48 A;  5HOO A;  1J0R A;  2MYS A;  2QKL B;  3R6S A;  1V4R A;  3HKZ A;  4AIK A;  2JSP A;  2LNB A;  2V26 A;  3DTK A;  4I0B A;  1APL C;  1ZRD A;  4OOI A;  4M6V A;  3QQA A;  3GZN B;  2DA2 A;  2UV1 A;  1OCR H;  2ZJR F;  2VXZ A;  3JR9 A;  3MKL A;  4LMY A;  4MO7 A;  3GTL J;  1KQ9 A;  2GWR A;  4GCV A;  2VLA A;  2VQH A;  5DCF A;  2O0Y A;  1RR7 A;  1LE8 B;  4KIF A;  4ESF A;  3MMY B;  1BBY A;  2VN2 A;  4ENK A;  2XUB A;  3FXO A;  4EV0 A;  3PJR A;  1Z3Y A;  1YOV B;  2N8G A;  4GFB A;  1MBF A;  2F5V A;  1O3T A;  4UUS A;  3HYI A;  1UMQ A;  2CV0 A;  3MD2 A;  3K4M A;  3QRF F;  2R7Z J;  1JT6 A;  1MKM A;  4N4O B;  5ILV A;  2QBY A;  2E1N A;  2KP6 A;  3RDI A;  1OR7 C;  2QQ8 A;  4U7B A;  2ZJ2 A;  5HS7 A;  4CCN A;  4EJW A;  5FKL A;  4U0Y A;  3BG6 A;  5FD6 A;  2DQL A;  1O3Q A;  4LJZ F;  1TP4 A;  2WBM A;  3PSI A;  2JUG A;  3OL4 A;  3SEZ A;  3GZ6 A;  1BW6 A;  1TWG J;  2M4G A;  3E5U A;  2HVQ A;  3FXU A;  4BXU A;  1VTN C;  2R7O A;  3F0C A;  3QPT A;  2HVR A;  2XB0 X;  1K78 A;  1ZGJ A;  1HQC A;  1X58 A;  3JRG A;  1ODD A;  4HQM A;  4KDP A;  5F0C A;  3BWG A;  4CZC A;  1SAX A;  3W6V A;  3L9F A;  2W00 A;  2QF7 A;  5FKN A;  3ZR8 X;  1SD6 A;  3LSM A;  1LVA A;  1JT0 A;  4FHT A;  4A5M A;  2NVQ J;  1OIS A;  1X1B A;  4UV9 A;  1MNM C;  2VL8 A;  2ZKZ A;  4EJT A;  1UCR A;  3I56 I;  3CJN A;  3K4L A;  1W0U A;  1WI9 A;  1AKH A;  4QPO A;  3F6V A;  3ZXS A;  3RYP A;  2ZB9 A;  2DO7 A;  1UG0 A;  2M45 A;  1UJ8 A;  1KYW A;  1IV8 A;  4X1E A;  2DMP A;  3LSR A;  4IOC F;  3SYT A;  3F3X A;  2ZCW A;  2R5Z A;  1O57 A;  4QTR A;  3AFH A;  2EZI A;  3JRF A;  4R1H A;  3KP3 A;  2HOT A;  2H94 A;  3V7R A;  3JTH A;  4RBO A;  1T98 A;  1U5T A;  1WH7 A;  2EIJ H;  2W85 A;  5F08 A;  4MFD A;  3G71 I;  4CGZ A;  1FX7 A;  1TBX A;  2PX9 A;  3M8J A;  2DT6 A;  4WK8 F;  4NUB A;  1ACI A;  2K9Q A;  4LB6 B;  2ELJ A;  1R49 A;  3H3V K;  3HTS B;  2R7S A;  3CLO A;  5DCM B;  4CCL A;  3IRR A;  3ABM H;  5FRN A;  1WRJ A;  2BY1 A;  4LD5 A;  1ULY A;  2P7V B;  4BDY A;  5ICF A;  1H0M A;  3LQQ A;  4DYR A;  4AWX B;  2WWY A;  2ZJQ F;  1QU3 A;  1I3A A;  3LAJ A;  3G6E I;  3DLA A;  2EK5 A;  4I6Z A;  2FRH A;  3I5U A;  1LEB A;  1JUM A;  5D8L B;  3G1M A;  3IH4 A;  2XB5 A;  4X0G A;  2M3A A;  2RC4 A;  1CGP A;  2KL4 A;  2Y30 A;  3VYS B;  1TWF J;  3BC8 A;  3AL0 C;  1Z67 A;  1RES A;  4E7J A;  2L0K A;  3S3M A;  3E97 A;  4HDV A;  5D5X B;  4ENM A;  3VFZ A;  4IZZ A;  3WU0 A;  1G3S A;  2ISY A;  3DEW A;  3CCM I;  1R7J A;  5DUI A;  1ENH A;  4L9N A;  1TNT A;  3WTU C;  1T8I A;  1MJ9 A;  2DTZ A;  5BPD A;  5AON A;  4YG2 F;  2XSJ C;  1B4A A;  2Z9O A;  4E4H A;  1J9I A;  4YRV A;  3FXR A;  3I4P A;  4BY7 J;  1UAA A;  3BR0 A;  2VON A;  4KIB A;  3L2R A;  1QZE A;  2CSO A;  3F8C A;  4UB6 C;  1NK3 P;  4RGU A;  2KDZ A;  2QUF A;  2EH3 A;  1B6A A;  2RQQ A;  1A35 A;  2Y9Y A;  2BBY A;  4V19 K;  2DFE A;  4M6Y A;  1MH4 A;  3WG7 H;  4B48 A;  4K2E A;  3IV5 A;  2LKX A;  3FDY A;  1GDT A;  3L09 A;  3ONQ A;  3JSO A;  3ISP A;  2KZV A;  3K4N A;  2E36 A;  4YEL A;  4ZZL A;  5IP7 J;  1S29 A;  1G59 A;  4A6D A;  5CVV A;  2K40 A;  1ZGW A;  4U88 A;  1T39 A;  4FAS D;  2XGE A;  1AU7 A;  2R7U A;  2DYR H;  1ORK A;  3K4C A;  2JPB A;  5FD5 A;  3W6K B;  1GV5 A;  3S2W A;  4AC0 A;  1YRN B;  5JHU A;  2RAE A;  2L4M A;  1E3O C;  3ZMS A;  3H3U A;  2FJ1 A;  4I02 A;  4RGS A;  5DUK A;  1O3S A;  1E3H A;  2LF7 A;  2GA1 A;  4FIS A;  1SAU A;  4IPA A;  2E7X A;  3Q9S A;  3TED A;  2BEO A;  2CMP A;  1YG2 A;  2WAQ N;  1R58 A;  2CV2 A;  2MBF A;  5IT9 K;  5J4Y A;  2HQ5 A;  2X6W A;  3H9G A;  3S3O A;  4CZZ A;  4EGY A;  1MBH A;  5CVU A;  4HAM A;  1BN5 A;  2CUJ A;  2E1C A;  1IJW C;  3PSF A;  2RKH A;  2VOD A;  2V1D A;  5BNG A;  1I39 A;  2AHQ A;  2R7T A;  4Y33 A;  1DP3 A;  5BS6 A;  1QRY A;  3WTW C;  4IO9 F;  1Y0N A;  4XMY A;  1L0O C;  1PJR A;  5B3S H;  4D5F A;  5HOD A;  1P4A A;  3GTQ J;  3SDB A;  1I1S A;  1DGW Y;  3OS0 A;  4RLF A;  5IP9 J;  1FT9 A;  1U5T B;  4L9V A;  4DGW B;  2O8K A;  3IUO A;  2V1N A;  1Y8Q B;  3DF8 A;  4GYG A;  2IPQ X;  5DCM A;  2NS7 A;  3HHG A;  2OF7 A;  4OAY A;  2JRM A;  4BXF A;  2HXO A;  3QWL A;  4EAT A;  1WJE A;  1NG7 A;  1FIP A;  2Z5U A;  5IOZ A;  1I27 A;  4I0A A;  1J5Y A;  1T6S A;  1J09 A;  3I58 A;  4J19 A;  3D5S C;  1VFC A;  4C3J J;  3HSF A;  2L9R A;  4C2U A;  3HBL A;  5ICG A;  3RCO A;  3E1S A;  1CF7 A;  2FBI A;  5KK1 A;  1R5I D;  4HRI A;  1LUJ B;  3CCR I;  1HXD A;  2L9S A;  3DFG A;  5LRR A;  3EQL F;  2BHZ A;  4Z2Y A;  3CCE I;  1OKR A;  3QAH A;  2A6H F;  3H3Z A;  2Z16 A;  1WJF A;  3HDD A;  3BZK A;  2GQQ A;  1B8I A;  3BJO A;  1YFH A;  5K1Y A;  5LD2 C;  4AM3 A;  2CV1 A;  1T33 A;  3RQ4 A;  2WAD A;  3BT9 A;  2KQR A;  4XLA A;  3T8R A;  4KIC A;  1Y6I A;  2GXG A;  3WHC A;  1IAW A;  5IYB J;  4KFC A;  4YEJ A;  3HOV J;  3LFK A;  3P7N A;  3EUH C;  2HYJ A;  2LRE A;  2V79 A;  3KP7 A;  4PDK A;  5E79 C;  2HDC A;  4Y3O A;  2DOE A;  2ELH A;  1PDN C;  3KYL A;  2DA7 A;  2R5Y A;  2P5K A;  1XGO A;  4GDF A;  3F72 A;  3OYI A;  4MTE A;  4H0E A;  1X1D A;  4ZTJ A;  3ZMV A;  3HM5 A;  1A31 A;  2QEX I;  1Y0U A;  3C18 A;  4G7Z F;  2JZY A;  3OYA A;  3C2G A;  4XN3 A;  4AYB A;  1HDD C;  1N75 A;  1YS6 A;  3V8L A;  5H2F C;  5KAF C;  1P9Q C;  2Q2E A;  1S3J A;  1HDP A;  5C4J J;  3VYT B;  3GXO A;  4XLE A;  2QM3 A;  4XOR A;  3REO A;  3SFI A;  3ZMZ A;  4S04 A;  2X1C A;  3UR3 C;  3EDP A;  4KUM A;  1OJL A;  1I5Z A;  4HBL A;  4UUT A;  5DM7 F;  2IRF G;  1XMA A;  2Z3Y A;  3LMM A;  2W82 A;  4HQE A;  1J59 A;  2OQR A;  1FBQ A;  1IG7 A;  2UXX A;  2NNY A;  4D7M A;  3HSE A;  5D5V B;  3AKZ A;  4A3F J;  3JRE A;  3H5A A;  2EWN A;  2LC2 A;  2W84 A;  1FLI A;  3VSK A;  1HC8 A;  4M9X A;  3CLQ A;  3K0L A;  1ZRC A;  1VI0 A;  1SFK A;  4HOB A;  4ABZ A;  1ZN2 A;  2FUG 2;  2VPL A;  2P6T A;  3KLN A;  4EJO A;  4XLN F;  1MDM A;  1G8X A;  1W4M A;  5LFA A;  3K69 A;  2L2O A;  1J2X A;  2IW5 A;  3G1O A;  1MW7 A;  2FOW A;  3S15 J;  4A6E A;  3HGG A;  2IS2 A;  2F4I A;  1QA6 A;  2VKV A;  1BM9 A;  2DA1 A;  1FOK A;  1H88 C;  1IZ1 A;  5KAI C;  2DOD A;  1EH8 A;  4E70 A;  3J81 Z;  1YTY A;  3B6C A;  1O7F A;  5HDK A;  1WCM J;  1D1A A;  2ME6 A;  5FLM J;  1HF0 A;  4NNJ A;  3LSH A;  2CQ7 A;  3JRI A;  3ASO H;  5TIS C;  4QPQ A;  4JK1 X;  2VQL A;  4A5N A;  2ZSH B;  4JX4 A;  1GXP A;  4MTD A;  2MLK A;  4PJM A;  5CYV A;  2VBY A;  3VOD A;  1EH7 A;  2IXS A;  3AL0 B;  3CO6 C;  4NC8 A;  4BXX J;  1MIJ A;  2GIZ A;  4BU2 A;  4D5C A;  3TO9 A;  3MAJ A;  4C30 A;  4RGX A;  2LDU A;  1W1W E;  3NEU A;  1KGS A;  4JP0 A;  5GAE J;  4LOC A;  4WX9 A;  2HI3 A;  1B72 B;  2ETH A;  4IJA A;  4I7H A;  4A3G J;  1QGP A;  3MKY B;  2V6C A;  3DWL E;  1KA8 A;  2V9V A;  3AG1 H;  3ZQI A;  1S8N A;  1W5C C;  1Z7U A;  2K9L A;  5DV5 A;  2VC0 A;  2P0W A;  3DU5 A;  1RIO H;  2CW0 F;  2DMN A;  4B4C A;  2GA2 A;  2ZXH A;  2ZC2 A;  3K2A A;  2CS3 A;  1YQA A;  2E1M C;  1F9N A;  5EYR A;  4F92 B;  3KET A;  3R0J A;  1DU0 A;  4XRF A;  3TBI A;  4EQQ A;  3P9K A;  3H36 A;  3W2A A;  3HOY J;  1OYY A;  3OIQ A;  1VQN I;  2BVL A;  1YIT I;  1W5S A;  2PQ8 A;  2RVC A;  2XAQ A;  3OS1 A;  4RB2 C;  3VWB A;  5M5Y J;  2V4J C;  4E7H A;  4G6Q A;  4DYC A;  3BY6 A;  4TV7 A;  4BHP A;  3A0B C;  4O6J A;  5J1R A;  3V8J A;  2LD5 A;  4IHS A;  1W7P D;  3GF2 A;  2K02 A;  1Z3X A;  5HVQ C;  3DLL F;  2K9S A;  4NBQ A;  3IC7 A;  4FE4 A;  2RV8 A;  1X3U A;  2FBK A;  1DQU A;  1MD0 A;  2M5W A;  5IOY A;  4B3A A;  3LWF A;  2R7R A;  2GBY A;  2RNG A;  3CUQ C;  3MCZ A;  5GAD J;  1GV2 A;  2W25 A;  1MH3 A;  1QBJ A;  1R5G A;  3C2H A;  3JSP A;  1UB9 A;  4M71 A;  1HW1 A;  2XC7 A;  4BHB A;  5DD8 A;  1FBU A;  4EM2 A;  5F0H A;  2OTJ I;  4CCJ A;  5A2Q Z;  1LKX A;  2Y31 A;  4HDU A;  4IL6 C;  1MJB A;  1PUF B;  1JJ8 C;  3PNV A;  3DPL C;  1TT5 B;  2HYG D;  1HOM A;  2ECB A;  4G94 A;  4RAF A;  4CCK A;  3LSK A;  1UHM A;  1FWZ A;  1YO5 C;  5B66 C;  3BOQ A;  4ZC3 A;  5DTD A;  1FOW A;  2FF4 A;  5LBQ A;  2R7V A;  5LHH A;  1KON A;  3BDD A;  2FOK A;  3SJM A;  4ZYA A;  4XID A;  3HJE A;  1U8B A;  2OJE D;  2ZXW H;  4Q5S F;  5M5X J;  1MMN A;  1YHQ I;  2DLL A;  3BRO A;  3E5X A;  5K5R A;  1JGS A;  3TW7 A;  1XDS A;  3A01 B;  1HW2 A;  3L1P A;  2E1M B;  5FKO A;  2P81 A;  4PK4 A;  3HPG A;  2BZT A;  5CKT A;  2A07 F;  1W5T A;  2O9L A;  2QYO A;  3MN2 A;  3OYH A;  3WGI A;  4UVC A;  1H9T A;  3DKW A;  1DPU A;  4I76 A;  2E19 A;  3C1D A;  3RPU A;  2X6O A;  3VPR A;  2W7N A;  1QPI A;  3IKT A;  2BVM A;  2HPI A;  1P2F A;  3FBI B;  3BG5 A;  2OZ6 A;  3CF5 F;  3IRQ A;  5DD4 A;  3RSN A;  1BR4 A;  3QOP A;  1SFX A;  3KZZ A;  2G9W A;  3K70 D;  3BG3 A;  1AHD P;  1ZK8 A;  2QSF X;  3QU3 A;  5KNL A;  1T38 A;  3FBN B;  2ME0 A;  2MH2 A;  2LKS A;  2GOX B;  4DYQ A;  2JVH A;  2NVU B;  5ICC A;  4L18 B;  3MWM A;  3R0A A;  3E7L A;  3BTC A;  2F2E A;  2XAH A;  2YX7 A;  4L5I A;  2M9H A;  2O6G E;  1FOX A;  2NOG A;  2QWW A;  4PUS A;  5FO5 A;  2Y0M A;  4AIJ A;  2M8E A;  1QQI A;  4C3H J;  3ZCO A;  1XC5 A;  5TRD A;  2E34 A;  1D0Y A;  3FIW A;  3KYD B;  1YIJ I;  1HKT A;  5CVI A;  3U2R A;  3T8T A;  4OMY A;  2IGM A;  3ZQG A;  4Q4Z F;  2M4K A;  4B47 A;  4L0Z B;  2K27 A;  2ZFW A;  2KJC A;  3E6D A;  4BQO A;  2XAU A;  2HEO A;  1TQM A;  1U2W A;  5ILU A;  2CUE A;  1LEA A;  3JRD A;  5F27 A;  2BHY A;  4M9Z A;  2CW7 A;  2RRE A;  3JRC A;  1YW7 A;  3I71 A;  4MEX F;  4B1R A;  1D8K A;  2W57 A;  2I8D A;  2EFO A;  3D0S A;  1U0J A;  3UNG C;  2DAO A;  3J7Y J;  5EF6 A;  2P5V A;  4XRM A;  1ETX A;  2HFH A;  1TNS A;  1GVD A;  1TTY A;  3K4K A;  1X19 A;  4HYE A;  2PMZ A;  1WFX A;  3S1R J;  2M0C A;  1RKW A;  5E1W A;  1TQP A;  3KCC A;  3ULQ B;  3HOX J;  5D6F A;  4LLL A;  5HLH A;  4ESJ A;  2V6E A;  4E7I A;  5HLG A;  4HX4 A;  4ZYH A;  5A2Q K;  2LTP A;  1R71 A;  1V54 H;  4FE7 A;  2PJR B;  1H89 C;  3TKY A;  2QQ9 A;  4HSR A;  2IA2 A;  2C6Y A;  2EV6 A;  2W4S A;  1QZY A;  4DBQ A;  4CA0 A;  3GTK J;  2ZXJ A;  5ED4 A;  2NS8 A;  3IAS 2;  5DDG A;  1TW3 A;  2Y75 A;  4MQ9 F;  1LPQ A;  5J3L A;  4ENJ A;  5DEQ A;  4F93 B;  1FTZ A;  4CH7 A;  1QZZ A;  5LGN A;  4X6A J;  3ZPL A;  1IDY A;  5EZH A;  3GCM A;  1MBG A;  2KRF A;  2F4M B;  1KZH A;  4II3 A;  1JHH A;  4XLC A;  4PGG A;  5L3D A;  5LEK A;  3FKJ A;  4IRH A;  3C2B A;  3S2H J;  5HDN A;  4CO8 A;  2K5C A;  3HRM A;  5H20 A;  3SHF A;  5E8G A;  3S1Q J;  4E7K A;  1UST A;  5D4R A;  2QQA A;  3ECO A;  3R60 A;  4KN7 X;  2QSH X;  2EV5 A;  4V2G A;  5J8F A;  2X0L A;  2ID3 A;  2DA6 A;  4Y15 A;  1ETK A;  2DPD A;  4UNO A;  2DOF A;  2JA5 J;  2HGC A;  3M07 A;  5L3G A;  1HLV A;  1B72 A;  2OA4 A;  3EYI A;  5HLI A;  4LIU A;  2ICW G;  2DK5 A;  2VC1 A;  1Z9C A;  1ZQ3 P;  3VB2 A;  5E8I A;  1B59 A;  2M7A A;  1KYZ A;  2ZME A;  3DKX A;  4EGZ A;  2CFO A;  4IHW A;  1O7L A;  3DV8 A;  3FXM A;  2B63 J;  3F9K A;  2VQC A;  3LOC A;  2HNH A;  2DJI A;  1TZL A;  2ZME C;  1TLH B;  2FBH A;  2TDX A;  1W7P A;  5EGO A;  4JBA A;  1HW5 A;  2MC4 A;  3FHZ A;  2L54 A;  1NHA A;  4F52 A;  4MHG A;  3ERM A;  3M8F A;  4U87 A;  3RTR A;  4AU7 A;  2R92 J;  3RYR A;  4BL0 B;  3OYK A;  3CCY A;  3OIP A;  3PNT A;  2E1O A;  4UVA A;  2ZJP F;  4PJN A;  3UKG A;  2LK2 A;  2VKE A;  1IC8 A;  2DJN A;  2EIN H;  3PUB A;  2P8T A;  3OR1 C;  5FRO A;  3SFZ A;  2Z33 A;  4C3I J;  1JTY A;  3OYM A;  2D2W A;  2XAS A;  5KCM A;  3BR5 A;  2KIS A;  3GX4 X;  1WWX A;  1ETY A;  3WGH A;  3H35 A;  1B9N A;  4C2T A;  3Q3S A;  2DA5 A;  1S6L A;  2X85 A;  4BBS J;  3MEX A;  3OS2 A;  2GLO A;  3L7W A;  3LFU A;  3TW6 A;  4IXA A;  3U1D A;  1C0W A;  2MSY A;  5BQT A;  4BY1 J;  4CIC A;  4L0Y B;  3LA2 A;  1E2X A;  1XTA A;  3CDH A;  1FMV A;  4M3F A;  3A2K A;  2FD5 A;  4B09 A;  2OD5 A;  4WXD A;  1JHF A;  1ZEL A;  5BPI A;  3V7S A;  1ZRE A;  3F23 A;  4DOZ A;  2H09 A;  2ZNY A;  4FTH A;  3H5R A;  4XSZ F;  2DDA A;  3LSP A;  1U8R A;  2K9N A;  1D5Y A;  4FCY A;  2E5N A;  2VJI A;  2WTE A;  2ZNZ A;  2FEZ A;  4PSW A;  1SFE A;  3M1E A;  2R5Z B;  1P7I A;  4L5J A;  2A69 F;  4XBF A;  4J01 A;  5E3M A;  4ZYG A;  3K7A J;  3MZH A;  5J1U A;  1BR2 A;  4XLF A;  3ZOB A;  2MD0 A;  1WJA A;  4B8X A;  2DU9 A;  4W97 A;  2IGN A;  3CO7 C;  2DPU A;  4XK4 A;  4WXH A;  4P1W A;  1TWA J;  2VT3 A;  4ZDL A;  2E7W A;  3TMO A;  1IRZ A;  3QYB A;  1ETW A;  1X1A A;  3DU6 A;  3HKZ N;  1SVO A;  3QOD A;  1E17 A;  1R1U A;  4KT5 C;  4G6D A;  3BLY A;  1Y8R B;  2XF7 A;  4G12 A;  4S05 A;  3RZD J;  3SZT A;  1W7P B;  2H1L A;  2QKM B;  2AXL A;  2IGK A;  2I5U A;  1BI0 A;  1UZC A;  1FSH A;  1OCZ H;  1A36 A;  1TQI A;  3J80 K;  4WXC A;  1WJ5 A;  2CQX A;  3K4J A;  4Y17 A;  4D1Q A;  2TCT A;  3CP8 A;  1AWC A;  2Z99 A;  3AG2 H;  5K5O A;  2QVO A;  2V7F A;  3LQR A;  4U0W A;  5JLW A;  1LFU P;  1JJ6 C;  1BJZ A;  3GTJ J;  1S7O A;  1FMW A;  1G6N A;  3F6O A;  3BCA A;  5J8C A;  2XVC A;  1OPC A;  4JQF A;  1F1Z A;  1S5L C;  5K5Q A;  1DUX C;  4M9S A;  3PO3 J;  4N4N B;  5ICE A;  2PN6 A;  1FOY A;  2CO5 A;  2PI0 A;  3BPX A;  1JTX A;  2VBW A;  5KHD A;  2VOO A;  3S1M J;  1XGN A;  2DYS H;  2QSG X;  1X2N A;  3F22 A;  4OIO F;  2NOJ B;  2WV1 A;  3FX3 A;  2Y0S A;  2DMT A;  1DPR A;  1WZ2 A;  5LLQ A;  4LB5 A;  1OCO H;  2F48 A;  2PBI A;  1LE8 A;  1JKP C;  5GP9 A;  2CH0 A;  5GAG J;  1HA8 A;  1MSF C;  4Q47 A;  5FRM A;  2MG4 A;  5M3F J;  1VQ8 I;  1XX5 A;  4PCQ A;  2X9D A;  1HST A;  1POG A;  2HQN A;  3OYN A;  1FC3 A;  6PAX A;  1OCT C;  3C3W A;  4KA4 A;  2LR8 A;  3BQY A;  1RNL A;  3CCV I;  1FYM A;  2K7L A;  2PG4 A;  3MFK A;  1VQK I;  1RZ4 A;  1FPQ A;  3NQO A;  4OIR F;  4IEJ A;  2R0Q C;  2XRO A;  1LB2 A;  1LFB A;  2O03 A;  3G1L A;  1XCV A;  5B5E C;  2VI6 A;  4N9I A;  1UHS A;  3CTA A;  3AAF A;  2CQQ A;  3PFY A;  3KEQ A;  1K79 A;  2P7C B;  4JYK A;  2MH9 A;  3MVP A;  1S7E A;  5JVT A;  3WTT C;  1IDZ A;  4Z6Y A;  2Z2S B;  5FFZ A;  3RPQ A;  2WC2 A;  4NB5 A;  4B44 A;  4ZDO A;  1JKR C;  1EF4 A;  1QVT A;  2EFW A;  3ZN1 A;  1JUP A;  3HZJ A;  4KIS A;  4XOP A;  3OSG A;  3PQJ A;  3FF5 A;  2LSO A;  4E6K G;  2M30 A;  4BH9 A;  2HU9 A;  3B73 A;  2AS5 F;  2E71 A;  5CQE A;  3F8N A;  2HKX A;  3N05 A;  2W24 A;  2E2H J;  4YIF A;  4HV6 A;  1MSE C;  4U7D A;  1XCB A;  1SVL A;  1WSU A;  3NWS A;  2FQ3 A;  1OFC X;  1KQ8 A;  3CCU I;  1ZG1 A;  1MGT A;  3HOW J;  3IKV A;  3QP5 A;  2Y0S N;  2XF5 A;  1XDU A;  3KZI C;  1QHH D;  1ETO A;  2ZFU A;  3ABK H;  4G6T B;  4Y4R A;  2K4B A;  1WJD A;  3D1N I;  4HZF A;  2KZG A;  1T95 A;  4M3G A;  5J6X A;  2HZD A;  2EZK A;  3KE2 A;  4XRS G;  4YIR X;  2M7B A;  3GW2 A;  3F8M A;  2BE5 F;  3IWZ A;  3LA7 A;  2VUM J;  1MMA A;  1BW5 A;  2B9S A;  2XSD C;  1IRG A;  2EBI A;  2O5R A;  4BEH A;  1PVE A;  1TT0 A;  2VBX A;  3GEZ A;  3KEY A;  4RB1 A;  3ZGK A;  3CJR B;  3D5R C;  1VQP I;  1R4N B;  4CYD A;  1R36 A;  2EZL A;  1OCP A;  2A5W A;  1WI3 A;  1I6H J;  3GFM A;  3FM3 A;  2V9P A;  1NG6 A;  3CQZ J;  2LY2 A;  3E5Q A;  4G8X A;  2HOE A;  3LSJ A;  5CVR A;  3GWZ A;  3HRS A;  2Q0O A;  4D7N A;  3J81 K;  5E17 F;  2PJP A;  1WH5 A;  3SEQ A;  1FSE A;  2VBZ A;  2UXN A;  2WY8 Q;  3E6B A;  2Q8K A;  2XAJ A;  2EQR A;  3WTZ A;  3L2C A;  1FTT A;  3P9I A;  1YW9 A;  2ISZ A;  2A68 F;  3TP3 A;  1RPW A;  2H6B A;  2JTV A;  2OU2 A;  3B02 A;  3VYR B;  3ZQC A;  5E20 A;  1I50 J;  4BJ5 C;  4OWR B;  3CDL A;  5FB2 A;  3I59 B;  3GYH X;  1LDK B;  3KP6 A;  5E3N A;  4M3E A;  1YW8 A;  1XSX A;  4JOM A;  3WU1 B;  3CC7 I;  2HTJ A;  2CGP A;  2IS6 A;  2FX0 A;  2GZW A;  4HEA 2;  2BY3 A;  2CQN A;  2ESN A;  4Y7N J;  4W1U A;  3CJQ B;  3CMY A;  5IYC J;  1D8J A;  5EG0 A;  1TC3 C;  4CHU A;  1FJL A;  1LVK A;  4A3I J;  1MMD A;  4N0B A;  2K85 A;  2STT A;  3QU6 A;  2ELK A;  3QPS A;  3W2V A;  4EEF G;  4P9U A;  2BOL A;  3DXJ F;  2F5E A;  5JFR A;  5C3E J;  1K4S A;  1ZYR F;  2GIV A;  1FYL A;  3HXL A;  4G7O F;  3PIP F;  2JA8 J;  2HWV A;  4ANJ A;  4OMZ A;  3FWE A;  2EIK H;  3I0T A;  2CG4 A;  4PFO A;  2AQF A;  3WU2 C;  4WCG A;  5M5W J;  4XKV A;  1HCR A;  1X3W B;  3ASN H;  4Y52 J;  5EEG A;  2E2I J;  2L9V A;  3I4M J;  2ZME B;  5E1Z B;  2JA7 J;  1RUO A;  2LF8 A;  4XN0 A;  1IRX A;  4CUG A;  3PUF A;  1U5T C;  4A12 A;  2HOA A;  5EEH A;  1YX3 A;  3OWT A;  1K7A A;  3KZY A;  2H27 A;  4RA2 A;  1GHC A;  3ABL H;  2HXI A;  4L5E A;  1F5T A;  1FP2 A;  3OYG A;  2CW8 A;  4LK1 F;  1DDN A;  4A69 C;  4HX7 A;  3I59 A;  1U9O A;  4E7S A;  3HOS A;  2L7K A;  2R5Y B;  3CP2 A;  1K61 A;  5FJ8 J;  2I10 A;  3HC7 A;  3WTY C;  4U0V A;  3ESW B;  1MMG A;  3W2W A;  2R93 J;  4A3K J;  3OYD A;  2A3S A;  2DQR A;  2JRT A;  2MD5 A;  4KYW A;  2QCO A;  1ZLJ A;  3V42 A;  5F04 A;  1DGR M;  1V5F A;  3LA3 A;  3ZQL A;  2HVS A;  1VQ6 I;  3M3Y J;  1FYK A;  2ZXI A;  2V1X A;  2RNJ A;  2L4A A;  4PGH A;  3GLL A;  1P7J A;  4ETS A;  3SZG A;  3ABT A;  1B1B A;  1BIA A;  1I3Q J;  5EGO B;  4D9J A;  4RDU A;  2Y48 A;  3OYL A;  4BEH B;  5IP6 A;  4ZYD A;  5J1Y A;  4UY8 I;  1VND A;  3Q0U A;  2CUF A;  3J7Z I;  1U9N A;  3ZQH A;  2DFI A;  4HA8 A;  2EV0 A;  3L2Q A;  1B8I B;  3IH2 A;  1FBS A;  2X1E A;  5K7H A;  3GTP J;  1Z6R A;  4XKB A;  2OC6 A;  1U78 A;  4Y13 A;  1XSD A;  1LJ9 A;  3ZMU A;  3ZP5 A;  1GLN A;  3I4N J;  2D1H A;  3WOD F;  1ETQ A;  4JX6 A;  1VQL I;  1VQ5 I;  2EA4 A;  3KPH A;  3GTG J;  1Z0X A;  2RDP A;  4LFU A;  3FMQ A;  3Q5F A;  3TOB A;  3CD6 I;  1SD7 A;  2LYC A;  2MFZ A;  4UXN A;  4RLQ A;  1YI2 I;  4ENN A;  3K4B A;  3PNY A;  3J80 Z;  1K83 J;  1J7K A;  2CJJ A;  3PL8 A;  2KHM A;  4CDG A;  1RKT A;  4DQ2 A;  4LIV A;  3ABU A;  1Y1W J;  5BOX A;  2DFH A;  2L7F P;  3KLO A;  1KU2 A;  3J7A O;  3HB9 A;  1Z1D A;  3QYE A;  1FY7 A;  1HSJ A;  3QP6 A;  3GFI A;  4M73 A;  5IPA A;  1X2M A;  2EIM H;  2FML A;  2G7H A;  1ON1 A;  1SD4 A;  2CRG A;  3CJT B;  3QYF A;  2XGC A;  1WQ2 A;  2BW3 B;  1D1C A;  2IVM A;  1CF7 B;  1FNN A;  3BJA A;  3DCF A;  3FHN A;  2NRA C;  2EFQ A;  4QSH A;  1ZG3 A;  4A3B J;  1ZHF A;  4BAY A;  4S0H B;  2DTR A;  2F6C A;  3K1M A;  1WJC A;  4RM3 A;  3P5J A;  3NWT A;  3BZC A;  3WGG A;  3FXK A;  3CC4 I;  4C9Y A;  2NNN A;  1JUS A;  3BG9 A;  1R00 A;  3OYF A;  2YR2 A;  1U6G A;  1Z6T A;  2NAZ A;  2HTS A;  4HLX A;  3GFL A;  5HS9 A;  1VQ7 I;  2BY2 A;  2V1U A;  2L7M P;  1A6I A;  2LG4 A;  4DZJ A;  4WWC A;  1IXR C;  2JJ7 A;  5L3B A;  1G2H A;  4WF2 A;  2HDD A;  4YII A;  3OYJ A;  3CMA I;  1TWH J;  3G3Z A;  2JWT A;  1FEX A;  3E0J B;  4BUP A;  1K6Y A;  3M7G A;  1D0Z A;  1IV6 A;  2R7D A;  2X6Y A;  3FXL A;  1NK2 P;  3RQI A;  3PFI A;  4BQN A;  4UUV A;  3FXJ A;  5B1A H;  1IXS B;  3S32 A;  3BQZ A;  4IQ4 A;  3VEP A;  4EVI A;  1R4M B;  4M74 A;  4OIN F;  1AA7 A;  1ZG5 A;  1SEU A;  3RKX A;  4DJA A;  3C7J A;  5FLV A;  3S14 J;  2XKP A;  1I6X A;  3FMS A;  4A2U A;  4QIW N;  1SAN A;  4G7H F;  1YRN A;  2DDB A;  3HRU A;  3TP0 A;  5GTI C;  2XPW A;  5H6R A;  4R8H A;  2IEK A;  3FIS A;  4RMN A;  2COB A;  2R7X A;  1IN7 A;  1R5H A;  2Z1D A;  4LLG F;  2LVS A;  3ZQ7 A;  2ECC A;  1XSV A;  3WE2 A;  2LH9 A;  1R1T A;  3OYE A;  3GZ5 A;  2F5C A;  4NC7 A;  2QEN A;  1R22 A;  4XL9 A;  5E3L A;  1YJ9 I;  1PP8 F;  1OYW A;  3HUG B;  4B43 A;  3DEU A;  2COM A;  5IY5 H;  4RGR A;  3MZ8 A;  4PJ0 C;  4IHV A;  1D3Y A;  4D0P A;  3HIF A;  3BCB A;  2L3D A;  2CUZ A;  2VAS A;  2O7O A;  3QPH A;  1ZAR A;  4I98 B;  3RKW A;  4V2F A;  4DW6 A;  1W0T A;  3MZY A;  3CCL I;  3H5N A;  3NAU A;  1I1G A;  2VQG A;  3T5X A;  4IX7 A;  4XIC A;  1UHW A;  1WKM A;  2R7Q A;  4AVZ A;  1V55 H;  2VJJ A;  4A3D J;  4BHC A;  3VSL A;  2XV4 S;  2OPT A;  2VB6 A;  3CUQ B;  2K9M A;  5EG0 B;  2BGC A;  2Q1Z B;  3K6G A;  2HR3 A;  2JVG A;  1T2K A;  1LDD A;  4BQQ A;  1JI8 A;  1S72 I;  1Z21 A;  2VJ4 A;  2JSC A;  5GPA A;  3LNQ A;  1FP1 D;  4FX0 A;  1R9T J;  1SMT A;  2G0E A;  1TWC J;  2R4G A;  3E3V A;  3PQK A;  5HS8 A;  3OL3 A;  5EEA A;  3JRH A;  1HBX G;  1QVU A;  1M1E B;  1QO0 D;  2IBD A;  4NQW B;  1P4X A;  3OSF A;  3H0G J;  5CJ9 A;  2RGV A;  1KU3 A;  2WAQ A;  4UB8 C;  1PUE E;  1E0E A;  4RS8 A;  3HL2 A;  4O3M A;  1GVJ A;  3L2W A;  3KYC B;  1BI1 A;  4EJV A;  4P5O A;  2HKO A;  1MDM B;  4I2O A;  2EFP A;  1XD7 A;  2J5O A;  4BJ6 C;  2JT1 A;  4GYI A;  5D5W B;  3ML6 A;  2JA6 J;  5K7F A;  2L01 A;  3ELK A;  3K1N A;  3JAM K; 
#chains in the Genus database with same CATH homology
 1AKH B;  2JK3 A;  4D7M A;  4A3F J;  3S16 J;  3JRE A;  3Q0W A;  9ANT A;  4CYC A;  3PO3 J;  1WPK A;  3WHB A;  1VI0 A;  2DA4 A;  2L7Z A;  4ABZ A;  1JTX A;  3S1M J;  2YS9 A;  1X2N A;  2CU7 A;  2WV1 A;  2YUS A;  2DMT A;  4A3M J;  3OOU A;  5EDN A;  3G1O A;  3S15 J;  3HGG A;  1LE8 A;  1JKP C;  5GP9 A;  2VKV A;  4MFE A;  1MSF C;  2DA1 A;  1ETV A;  1H88 C;  4A3L J;  2MG4 A;  5M3F J;  2KT0 A;  2X9D A;  1POG A;  3B6C A;  2FQ4 A;  1VF9 A;  2LFB A;  1WCM J;  3FKI J;  2ME6 A;  1OCT C;  2LLK A;  3O8H A;  5FLM J;  1HF0 A;  2Y9Z A;  2LR8 A;  3BR2 A;  3JRI A;  1JKO C;  3BQY A;  1SFO J;  3PO2 J;  4A3J J;  1UG2 A;  1ZR2 A;  1ITY A;  4MIM A;  4JX4 A;  2NVX J;  2IAI A;  4IEJ A;  2R0Q C;  5IYD J;  1LFB A;  2DMU A;  3G1L A;  2VI6 A;  5C4X J;  1UHS A;  2TRT A;  2CQQ A;  4BXX J;  4JYK A;  3GTM J;  3MVP A;  4D5C A;  1S7E A;  1IDZ A;  2DN0 A;  2GM4 A;  1Y1V J;  1JKR C;  1EF4 A;  1QVT A;  4JP0 A;  1JUP A;  4LOC A;  1B72 B;  2HI3 A;  3OSG A;  3O8G A;  1PUF A;  3M4O J;  4A3G J;  3ZQI A;  3BTI A;  3RKQ A;  3ZQF A;  2DMN A;  2E2H J;  4B4C A;  3K2A A;  2AO9 A;  1MSE C;  4A93 J;  5C44 J;  1OFC X;  1MBK A;  3HOW J;  5EYR A;  2NVT J;  1BA5 A;  2Y0S N;  4JX5 A;  1DU0 A;  1T56 A;  1ETO A;  1F36 A;  3HOY J;  3D1N I;  4M3G A;  1DU6 A;  2EZK A;  2JMW A;  4XRS G;  2H1K A;  5M5Y J;  3JRA A;  4CYC B;  1NTC A;  2XGD A;  2VUM J;  1BW5 A;  4DYC A;  2XSD C;  2M34 A;  2EBI A;  5F0F A;  1GUU A;  5J1R A;  1APL C;  2LD5 A;  4M6V A;  3QQA A;  3S17 J;  2LY9 A;  2K9S A;  2DA2 A;  1RET A;  4FE4 A;  3JR9 A;  3MKL A;  1I6H J;  2EZL A;  1FIA A;  1OCP A;  1WI3 A;  4AYB N;  4B3A A;  5IOY A;  4MO7 A;  2GBY A;  4C2M J;  3GTL J;  3CQZ J;  1GV2 A;  1MH3 A;  1RR7 A;  1LE8 B;  3LSJ A;  1Z77 A;  4D7N A;  2X48 A;  1WH5 A;  1XS9 A;  2N8G A;  4GFB A;  2E2J J;  2EQR A;  1MBF A;  1FTT A;  5F0H A;  4UUS A;  1UMQ A;  3TP3 A;  1RPW A;  2Y31 A;  3ZQC A;  1I50 J;  2R7Z J;  2DMQ A;  1PUF B;  1XG1 A;  1JT6 A;  1JJ8 C;  3CDL A;  1HOM A;  2ECB A;  2MW8 A;  5E3N A;  4M3E A;  5FKL A;  2FX0 A;  3FK7 A;  5DTD A;  1GT0 C;  2H8R A;  4Y7N J;  4W1U A;  3CMY A;  1BW6 A;  5IYC J;  1TWG J;  3SJM A;  5EG0 A;  1TC3 C;  4XID A;  1U8B A;  1ZKG A;  1FJL A;  3F0C A;  2XB0 X;  4A3I J;  3JRG A;  1X58 A;  1IGN A;  5M5X J;  5F0C A;  1MBJ A;  2ELK A;  3QPS A;  4EEF G;  3TW7 A;  3A01 B;  3W6V A;  3SDG A;  3L1P A;  5C3E J;  2QF7 A;  5FKO A;  2P81 A;  5FKN A;  1JT0 A;  2NVQ J;  2JA8 J;  4HNV A;  2O9L A;  3MN2 A;  1MNM C;  3BR6 A;  2EZH A;  4I76 A;  2E19 A;  1IUF A;  5M5W J;  2X6O A;  1W0U A;  1AKH A;  1HCR A;  3VPR A;  1QPI A;  3HOU J;  4Y52 J;  2ZB9 A;  3BG5 A;  5FKM A;  2E2I J;  3I4M J;  2JA7 J;  4X1E A;  2DMP A;  3BG3 A;  3LSR A;  1AHD P;  1ZK8 A;  2HOA A;  2PMZ N;  2ME0 A;  2R5Z A;  4QTR A;  2EZI A;  3JRF A;  4DYQ A;  2JN6 A;  2HOT A;  4RBO A;  5F08 A;  1WH7 A;  4MFD A;  3E7L A;  2HXI A;  4L5E A;  2NVY J;  3BTC A;  5M3M J;  2W48 A;  2M9H A;  2K9Q A;  2NOG A;  3NAR A;  4A69 C;  3H3V K;  3S1N J;  1U9O A;  2R5Y B;  1K61 A;  5FJ8 J;  2I10 A;  1BL0 A;  3A02 A;  4C3H J;  2ID6 A;  1XC5 A;  4DYR A;  3FK6 A;  2R93 J;  3FIW A;  2D5V A;  4A3K J;  1H8A C;  4I6Z A;  1O4X A;  1JUM A;  2QCO A;  4DZP A;  3G1M A;  3IH4 A;  5F04 A;  3BTL A;  2XB5 A;  3ZQG A;  3ZQL A;  5DS9 A;  2HOS A;  3M3Y J;  2Y30 A;  4IHX A;  4A3E J;  2CUE A;  1P7J A;  1TWF J;  2DA3 A;  3S2D J;  3JRD A;  1Q1V A;  1RES A;  1I3Q J;  2L0K A;  5EZG A;  5F27 A;  5EGO B;  4RDU A;  3JRC A;  5IP6 A;  5J1Y A;  4B1R A;  1VND A;  3Q0U A;  2CUF A;  3BR3 A;  1U9N A;  3ZQH A;  3DEW A;  1ENH A;  2XPV A;  2DTZ A;  1B8I B;  3IH2 A;  5K7H A;  5EF6 A;  3GTP J;  4XRM A;  4BY7 J;  4NDL A;  1ETX A;  3HEF A;  3BR0 A;  1GVD A;  1U78 A;  3S1R J;  1NK3 P;  2KDZ A;  3LSG A;  3I4N J;  2M0C A;  3A03 A;  1RKW A;  2EH3 A;  3HOZ J;  1F43 A;  2Y9Y A;  3HOX J;  1ETQ A;  4JX6 A;  4MLO A;  3GTG J;  2LTP A;  1MH4 A;  1Z0X A;  4FE7 A;  3IV5 A;  2LKX A;  2YU9 J;  1H89 C;  1GDT A;  5IP7 J;  1MBE A;  2K40 A;  1ZGW A;  3GTK J;  3RZO J;  1AU7 A;  1K83 J;  2XGE A;  2CJJ A;  2NS8 A;  1ORK A;  2VPR A;  1RKT A;  3B6A A;  1GV5 A;  4AC0 A;  1YRN B;  1Y1W J;  2RAE A;  1E3O C;  2FJ1 A;  3Q0V A;  2L7F P;  4BBR J;  5J3L A;  3HB9 A;  4M3D A;  1FTZ A;  4FIS A;  4X6A J;  1IDY A;  5EZH A;  1X2M A;  5IPA A;  3TED A;  1MBG A;  4XRS A;  2WAQ N;  2CRG A;  2XGC A;  3C2B A;  3S2H J;  5GPC A;  3S1Q J;  2M2E A;  3DCF A;  4A3C J;  2HQ5 A;  1MBH A;  4V2G A;  4QSH A;  4A3B J;  2ID3 A;  1IJW C;  2DA6 A;  4S0H B;  1ETK A;  2JA5 J;  1CQT A;  5BNG A;  2AHQ A;  1HLV A;  1B72 A;  1QRY A;  3BG9 A;  1JUS A;  1ZQ3 P;  3QPL A;  4IHW A;  4D5F A;  2L7M P;  1A6I A;  2B63 J;  4DZJ A;  2XRL A;  2LP0 A;  2JJ7 A;  5HOD A;  1A5J A;  3LOC A;  3GTQ J;  1G2H A;  2HDD A;  5EGO A;  1WGX A;  5IP9 J;  2O8K A;  1TWH J;  1FEX A;  2JWT A;  3JRB A;  1NK2 P;  1IV6 A;  3RQI A;  2R92 J;  3A01 A;  3BQZ A;  2NS7 A;  3CCY A;  2OF7 A;  5FLV A;  3S14 J;  2E1O A;  3UKG A;  2HXO A;  2LK2 A;  2VKE A;  1IC8 A;  4QIW N;  1SAN A;  1YRN A;  1JGG A;  2DJN A;  4IHY A;  3TP0 A;  4M3B A;  4C3I J;  1FIP A;  2XPW A;  1JTY A;  5IOZ A;  2IEK A;  3BR5 A;  3FIS A;  2COB A;  4BKX A;  4J19 A;  4AUX A;  1VFC A;  2LVS A;  1ETY A;  4C3J J;  2L9R A;  2ECC A;  3HBL A;  5E3O A;  3BTJ A;  3IH3 A;  3Q3S A;  5E3L A;  2DA5 A;  4BBS J;  4UUS B;  1JKQ C;  2GLO A;  4IHV A;  3TW6 A;  2MSY A;  4BY1 J;  2O7O A;  1ZTR A;  3HDD A;  3PM1 A;  3BR1 A;  4V2F A;  4DW6 A;  2Y2Z A;  1B8I A;  4M3F A;  1W0T A;  2FD5 A;  2MGQ A;  3NAU A;  1T33 A;  4FTH A;  3LSP A;  2K9N A;  4XIC A;  4FCY A;  3BT9 A;  1D5Y A;  4A3D J;  2R5Z B;  3WHC A;  5IYB J;  2OPT A;  3HOV J;  1P7I A;  5EG0 B;  5E3M A;  2HYJ A;  3K7A J;  5J1U A;  3ZOB A;  4W97 A;  2R5Y A;  2DA7 A;  5F1J A;  4XK4 A;  2M8G X;  5GPA A;  3LNQ A;  1TWA J;  1IRZ A;  1ZR4 A;  3HM5 A;  1R9T J;  1ETW A;  2G0E A;  3HKZ N;  3GBG A;  5K7Z A;  1TWC J;  3OIO A;  3JRH A;  5EEA A;  1HDD C;  1QVU A;  2IBD A;  4G12 A;  3RZD J;  3OSF A;  3H0G J;  2XPU A;  5JLX A;  5C4J J;  1HDP A;  3GTO J;  3SFI A;  3HGY A;  4UUT A;  1OJL A;  2CQX A;  2WB1 N;  2TCT A;  5JLW A;  1LFU P;  1JJ6 C;  1BJZ A;  5FKK A;  3GTJ J;  2JA6 J;  1IG7 A;  5K7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...