4AYBN

Rnap at 3.2ang
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 14
structure length 65
sequence length 65
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4aybN00
2DMTA 4XK4A 3QPLA 4AYBN 2HI3A 3TW7A 1QVTA 1ETWA 2PMZN 1ZGWA 4M3EA 1S7EA 2DA3A 4D5FA 2FX0A 2LKXA 2XB0X 1ZR2A 2CU7A 4LOCA 1TC3C 4C3HJ 2NVQJ 4JX6A 4A3BJ 2HQ5A 4FE7A 2COBA 2AHQA 4DW6A 2LTPA 3RZDJ 1JT0A 3FKIJ 5GP9A 5IYBJ 3BR5A 1WPKA 2DMQA 3HGGA 5EG0A 4FISA 4W1UA 1FTZA 4A3FJ 4A3LJ 1ITYA 2CJJA 4A3MJ 1GDTA 1UMQA 2LR8A 5IP9J 1IGNA 1ZK8A 4B1RA 3PM1A 1BW5A 5M3FJ 4CYCB 1F36A 2JJ7A 2E2HJ 5C4XJ 4X1EA 2DA5A 1A5JA 3S14J 1HLVA 3ZQFA 3B6CA 4MLOA 2EH3A 5EDNA 4A3JJ 1CQTA 3HOVJ 4IHVA 5FKNA 2YUSA 2MW8A 2E2IJ 1Z77A 2CRGA 1RKTA 3QQAA 4A93J 3BR0A 1H88C 3M3YJ 1JTYA 1JUMA 3FISA 4XRMA 4A3EJ 3DCFA 1LFUP 2ME0A 3MN2A 4A3CJ 1QPIA 1WH5A 2XGDA 4XICA 3HDDA 4DZPA 3TP0A 3ZQGA 1MSEC 4IEJA 2Y30A 2NS8A 1IUFA 2ECBA 5IP7J 1Y1VJ 2KT0A 1K61A 4A3GJ 2YS9A 3HKZN 1VFCA 1JKPC 3BTJA 4D7MA 2X9DA 3TP3A 4MO7A 1RETA 2HXIA 2KDZA 2M0CA 1JJ8C 1LE8A 1LE8B 2JK3A 5IYDJ 2XGEA 1VNDA 3JRDA 4Y52J 2L7FP 2VI6A 3S2HJ 1XC5A 1AKHA 2R0QC 3I4NJ 4Y7NJ 2VPRA 2HOAA 3CDLA 5K7ZA 1OCPA 3O8GA 4BY1J 3TEDA 4B4CA 3BTIA 3CCYA 1MBGA 2WB1N 5IP6A 1GUUA 1IRZA 5E3LA 4L5EA 2LK2A 5IPAA 4FTHA 4XRSA 4M3BA 2WV1A 4JYKA 1X2NA 1PUFA 3BTLA 3BG5A 2P81A 3S1QJ 3S2DJ 2H1KA 4I6ZA 3S1RJ 1GT0C 3M4OJ 3F0CA 3TW6A 2TCTA 5IYCJ 1WCMJ 3OSGA 4A3DJ 1U9OA 1G2HA 1P7IA 1SFOJ 5JLWA 3S1NJ 4M3FA 3HOYJ 2JA7J 2JWTA 3DEWA 5C4JJ 4XRSG 5BNGA 5J1YA 1TWAJ 4G12A 5J1UA 1OCTC 3NARA 4DYRA 3OOUA 3L1PA 2ECCA 5E3OA 1MH3A 4UUTA 2M34A 2XGCA 1WI3A 3MVPA 2EQRA 1QRYA 2DMNA 1XS9A 2QCOA 1JUSA 2E1OA 1GV5A 3B6AA 1ETOA 3JRBA 2R92J 2FJ1A 1MH4A 3JREA 5M3MJ 4D5CA 2EZKA 4FCYA 2IBDA 2LVSA 2FQ4A 1FTTA 1MNMC 3JRAA 2VKEA 1ENHA 4A3IJ 2LD5A 1ZTRA 2W48A 3BR1A 3HOZJ 2EZLA 3LSJA 1FIAA 2XSDC 3LOCA 1BJZA 3MKLA 1Y1WJ 3FK7A 3LSRA 3S1MJ 4M3DA 3BR6A 2DA2A 5M5WJ 2L7MP 3IH3A 3QPSA 1T56A 2CUFA 5FLMJ 3Q0UA 3Q0WA 2HOSA 2ID3A 1JGGA 3BR2A 1JKRC 2HDDA 1IDYA 5F0FA 2R5ZB 2K9QA 2DA7A 2JA5J 2X6OA 2XPUA 1IG7A 2L7ZA 2M2EA 2N8GA 4UUSA 2MG4A 5DTDA 2YU9J 3RZOJ 2JN6A 5GPCA 1BL0A 4BY7J 2HXOA 3SFIA 1WGXA 4IHWA 3S15J 3PO2J 3ZQLA 3GTOJ 3OIOA 1QVUA 4V2FA 1JJ6C 2NVTJ 1K83J 2CQXA 2K9SA 1W0UA 5IOYA 5EGOA 1GVDA 4EEFG 3E7LA 2CQQA 1TWCJ 1ZR4A 5J3LA 2LFBA 3BG9A 2Y31A 3K7AJ 4BBRJ 2Y0SN 5F0HA 2E2JJ 3S17J 2X48A 4QSHA 1DU0A 1RR7A 2EBIA 1LFBA 1B72B 1EF4A 3IH4A 3HGYA 2DA1A 2H8RA 4B3AA 1X58A 4MIMA 3SDGA 4I76A 5FKMA 3CMYA 1GV2A 3ZQIA 2O9LA 1ETXA 5FKKA 3GTJJ 1Q1VA 2M8GX 1HDDC 3GTKJ 1O4XA 2DA4A 1NK3P 4RBOA 2K40A 2G0EA 5C44J 2XPVA 2LLKA 2R7ZJ 3SJMA 3G1OA 3H0GJ 2HYJA 1RPWA 4HNVA 2R5ZA 2QF7A 2AO9A 1JTXA 4MFDA 2EZHA 3LSGA 4IHXA 2O7OA 1UHSA 2DJNA 4S0HB 4MFEA 2GBYA 1IV6A 4J19A 3CQZJ 3I4MJ 2R5YB 5FLVA 4D7NA 4QTRA 3IH2A 1TWFJ 1IDZA 3GBGA 4GFBA 1MBJA 2DN0A 4ABZA 1DU6A 3HOXJ 2E19A 1HCRA 5JLXA 2GLOA 4X6AJ 5EZHA 1FJLA 3HEFA 4A3KJ 1MBEA 3OSFA 1IC8A 4JX5A 3H3VK 5FKLA 3NAUA 3GTMJ 1TWHJ 3C2BA 5DS9A 3JR9A 5HODA 5F0CA 3HM5A 4V2GA 2VKVA 3BT9A 1HOMA 1I50J 5EGOB 1APLC 3GTPJ 2Y9ZA 2LY9A 2OF7A 1MBFA 1JT6A 5F1JA 4BXXJ 2TRTA 5EEAA 1D5YA 3BR3A 2ZB9A 1F43A 3A01A 1U78A 2WAQN 2B63J 4UUSB 4C2MJ 2DA6A 2NVYJ 1WH7A 2L9RA 3WHCA 4QIWN 1AKHB 3LNQA 4AUXA 3HOUJ 5EZGA 1YRNB 1AHDP 1HF0A 1YRNA 3WHBA 4IHYA 2NS7A 3Q0VA 3RKQA 2XPWA 1ZKGA 1SANA 3VPRA 3GTQJ 3HBLA 1AU7A 5E3NA 1T33A 3JRCA 3FIWA 5EF6A 2D5VA 1OJLA 2NVXJ 4DZJA 1XG1A 1A6IA 3JRIA 2R5YA 1I6HJ 4NDLA 2FD5A 3IV5A 2VUMJ 2LP0A 2M9HA 5FJ8J 3BTCA 3JRGA 1B8IA 3W6VA 2OPTA 3K2AA 2DTZA 1MBHA 2O8KA 5K7HA 2XRLA 4DYCA 5F08A 1MBKA 2ELKA 1JUPA 2IEKA 4AC0A 1IJWC 2ME6A 5EYRA 1U9NA 3HB9A 2CUEA 2K9NA 5C3EJ 1OFCX 3G1LA 4DYQA 4C3IJ 4JP0A 3LSPA 1FIPA 3BQZA 1UG2A 2L0KA 3BG3A 1JKOC 1B8IB 1RKWA 4CYCA 2R93J 3PO3J 2RAEA 3GTLJ 2DMPA 2I10A 1BW6A 3ZOBA 1ETKA 1H89C 1VI0A 3BQYA 5FKOA 1R9TJ 3FK6A 1B72A 3JRHA 3ZQCA 4A69C 3A02A 2MGQA 1VF9A 3HOWJ 5EG0B 1HDPA 2XB5A 2GM4A 1RESA 4M6VA 1Z0XA 3O8HA 1JKQC 2Y9YA 1X2MA 1ETVA 4W97A 3D1NI 4BBSJ 1ZQ3P 5K7FA 2IAIA 3JRFA 1PUFB 2JA6J 2JA8J 3A03A 4JX4A 1ETQA 2EZIA 1E3OC 5F04A 2ID6A 3GTGJ 3S16J 4BKXA 9ANTA 2HOTA 2DMUA 5J1RA 5F27A 1ORKA 1ETYA 4C3JJ 5E3MA 1I3QJ 1BA5A 4RDUA 2Y2ZA 5M5YJ 1NK2P 2MSYA 1H8AC 4FE4A 1POGA 3G1MA 1TWGJ 3UKGA 4XIDA 1U8BA 3ZQHA 2NOGA 1NTCA 2JMWA 1MSFC 5M5XJ 4M3GA 1FEXA 3Q3SA 3RQIA 1P7JA 3A01B 5GPAA 1W0TA 5IOZA
chains in the Genus database with same CATH superfamily
1R49A 5LEKA 3CO6C 1R5GA 2HI3A 4MTEA 1S72I 3CDHA 4BDYA 5BS6A 3E6BA 4M3EA 2V1UA 1WVRA 4D5FA 2O6GE 1ZR2A 1L0OC 4UB8C 2GIVA 2COBA 5AONA 2B7EA 4LG3A 2AHQA 2ZFUA 1YW7A 2ZMEC 5A2QZ 2GOXB 1VQ8I 2R7XA 3FKIJ 3E6CC 1FZPB 1JI8A 2X85A 1FOYA 1D3YA 3I64A 4N4NB 2K02A 5E20A 3CD6I 3BR5A 3OYGA 1I6XA 3HGGA 4BJ5C 4HSTA 1FTZA 1ITYA 2L9VA 3IL2A 2CJJA 5H6RA 4TV7A 1FBSA 3VODA 1UMQA 1FBQA 1QZZA 4ENMA 5E8IA 2E1CA 1IN7A 3C3WA 1ZK8A 4B1RA 1VQKI 3LFUA 5M3FJ 5LFAA 2JJ7A 3U1DA 2V4JC 1BI0A 4L9TA 4ZZLA 3B6CA 4MLOA 1XCBA 4A3JJ 1CQTA 2J5PA 3HOVJ 5LEJA 4R8HA 2ZO4A 4WXCA 1Z77A 3E3VA 5L3CA 2E2IJ 2CRGA 3A0HC 3KLOA 3QQAA 5HLGA 4I01A 1YQAA 4BHPA 1JTYA 2K3FA 2Q1ZB 3FISA 4JK1X 3MN2A 2EJRA 4AD9A 4XLPF 3A2KA 2JT1A 4DZPA 3OS0A 4IEJA 2Y30A 3TKYA 2LY1A 2UV1A 2R3SA 4IO9F 2KMUA 1K61A 2DT5A 1SVLA 3S3NA 1RIOH 3HKZN 3ESWB 1LDDA 3J81Z 2IT0A 3KYLA 3WODF 3KP4A 2X9DA 1VQ7I 4EV0A 2L9SA 2KDZA 3V7CA 5ICFA 2DJIA 4AIKA 3V7RA 2OV7A 2JK3A 4P1WA 4XOTA 4WXHA 2GZWA 4PGHA 2VJ4A 1IZ1A 3FXJA 2L7FP 1T38A 3H92A 3S2HJ 1XC5A 1S8NA 1B9MA 4YFNF 2VPRA 5E18F 4KICA 4E7JA 3GFIA 2W24A 2Q2EA 2RDPA 3O8GA 3GW2A 4BY1J 2FRHA 4ZYDA 2DAOA 3U1KA 3BDDA 3LMMA 2B0LA 3BTIA 4KFCA 2PMUA 3LA7A 4MEYF 1MBGA 3GEZA 3KP5A 2D45A 3T8TA 1QGPA 3HRMA 5KCMA 4HV6A 4FTHA 1C0WA 4XRSA 2OQGA 1ULYA 4M3BA 2WV1A 4IVNA 1X2NA 1K78B 3S1QJ 2H1KA 4I6ZA 2R7VA 3PNTA 1GT0C 2X4HA 1A36A 3F0CA 5IYCJ 3GUDA 1K6OA 2YPRA 3IKVA 4A3DJ 1G2HA 1IN8A 1SFOJ 5B66C 3J7AO 3DEWA 5C4JJ 2DDAA 1BI2A 2EFOA 4M6YA 4HBLA 5J1YA 4G12A 3OYJA 5E17F 3OYBA 1W7PD 4MEXF 3Q9VA 2RN7A 4A2UA 2HVSA 4UUTA 2XGCA 3MVPA 4KT5C 3J80K 2ISYA 4HG2A 1MMSA 2QQAA 1QRYA 2V1NA 4CCJA 3EQLF 1JUSA 3RTRA 2YX7A 3W6KB 3RPUD 3H5AA 2E1OA 5CJ9A 3HJEA 3D5LA 2ISZA 1IRFA 4KISA 1GVJA 2A05A 3JRBA 5FFZA 2FJ1A 3JTHA 3JREA 5M3MJ 4D5CA 2X51A 2IBDA 3NWTA 4YIRX 4HV5A 1BI1A 2FQ4A 2GIZA 3O2PE 4XLHA 1RUNA 1ON2A 4LIUA 4BE1A 4PJLA 3LSJA 1FIAA 2PMZA 3I56I 2VT2A 3I53A 3S1MJ 3N97A 1XGNA 4FX4A 3ECOA 2ZJPF 2QKMB 2EK5A 3W2WA 4U7DA 4ZH4F 1YG2A 4XBFA 1UAAA 2DQRA 3KZZA 5H2FC 1QU3A 1LFPA 2ID3A 1I3AA 3BR2A 2HDDA 1IDYA 3I9V2 2R5ZB 2K9QA 3L00A 3E0JB 2L9NA 1HKTA 2X6OA 1KQ8A 3DV8A 2L7ZA 3LAJA 2M2EA 2MG4A 3F8CA 1YW9A 5GPCA 2ZMEA 5D8LB 3QAHA 3RKWA 5IY5H 1PJRA 3HZJA 3OYIA 3ZQLA 2HZTA 4O5VA 1SFUA 1QVUA 4IRIA 2RNJA 1B6AA 2K9SA 2D2WA 2KP6A 2LRDA 4AVPA 1RI7A 5IOYA 3V8LA 3OIPA 1HSJA 3I59B 1TWCJ 4NC6A 5J3LA 4BBRJ 2E2JJ 2E60A 3FHNA 3CC4I 3VB2A 2IRFG 2X48A 2HGCA 1P9QC 3VDXA 2XRNA 2B9SA 2H6BA 2KZVA 1LFBA 2XC7A 2W84A 3F3XA 3OOPA 6PAXA 3IH4A 2HYGD 2XV4S 3C7JA 3HGYA 2XAHA 2H8RA 1D1CA 2QBYA 1X58A 4MGRA 4I76A 2NVUB 3ZQIA 2ZXHA 1BR2A 2F48A 4U0VA 3BJAA 4ZZDA 2H27A 3GZ6A 2AXLA 1IN4A 1ZYRF 4G94A 4LB5A 2ZMEB 3P9KA 1WQ2A 2GXGA 4RAZA 2VJJA 5FFXA 1YI2I 1O4XA 2DA4A 1SEUA 1NK3P 2NAZA 1Z1DA 2G0EA 5C44J 1S5LC 1S3JA 3HYIA 1USTA 3VYTB 3SJMA 3ZPLA 2CH0A 2HYJA 4HNVA 1Y8QB 1FX7A 5L3EA 4A0YA 3MKWB 1OR7C 3M8FA 4L9VA 2A61A 3CUQA 1X3UA 4MFDA 4RB2C 2L54A 2LBFA 1XD7A 5K5RA 2BGCA 3T8RA 2KZGA 2DJNA 3HHGA 5ED4A 1ZRCA 3WTYC 1DQUA 1NG6A 3VYUB 3HIFA 4ZDOA 2JUGA 1TWFJ 1Z91A 2QBYB 1MBJA 4ABZA 4ENKA 3SEZA 5JLXA 1U6GA 1J09A 3TO7A 1FYMA 4HAMA 1SAXA 1R1TA 4EATA 4HYEA 3H3VK 5EEHA 3ZCOA 4M9XA 3FXQA 3NAUA 2FXAA 1FYKA 1TWHJ 2WAFA 2JRTA 5HODA 2NNYA 1PUEE 2L01A 3IKTA 3HM5A 2EIMH 4V2GA 3OYLA 5CVJA 2VKVA 1HOMA 5EGOB 3MFKA 2YU3A 3BC8A 3CCQI 1DDNA 1G3YA 2ZNYA 2JQ7A 5ILSA 4BAYA 1FPQA 4LITA 2OQRA 4BXXJ 1V55H 3BR3A 2FUG2 3QU3A 1KYZA 1U8RA 5FLXZ 1F9NA 2WAQN 4CCLA 2D1VA 4CCKA 2ZSHB 1XSXA 3TQNA 2VIXA 4G7OF 2Y69H 5BPDA 3GCMA 4C2MJ 2PN6A 2NVYJ 1SFKA 1WH7A 4HNUA 4C2UA 4IKFA 3IRRA 4AUXA 5A2QK 2CUZA 3EUKL 1AHDP 2MC4A 3WHBA 3P7NA 5KHDA 2XPWA 1MMGA 1ZRDA 2PJRB 2LH9A 3HBLA 3GTQJ 4KMFA 4G7ZF 3RSNA 3BG6A 3PSIA 3DBHB 2BW3A 2Y0SA 1K78A 2V1DA 5CVVA 1D1AA 2JVGA 3G73A 4OIPF 3RDIA 2D5VA 3QYFA 2L5QA 1I5ZA 4WK8F 3JRIA 2HVRA 4NDLA 3H36A 4IF4A 2FD5A 4M71A 3IV5A 5B1BH 4P55A 2M9HA 5FJ8J 3BTCA 2DU9A 2Z1DA 4GGGA 4Q47A 4Q48A 3CP2A 4RGXA 3L7WA 4NB5A 2VBYA 4ESFA 2XKOA 5DEQA 5K7HA 3P9IA 1WJBA 3VEPA 4DYCA 3OR1C 2ELKA 5F08A 1JUPA 2XF5A 3A0BC 1YW8A 5EYRA 1ZHFA 1IXRC 3H0DA 2LF8A 4PSWA 2P8TA 2CUEA 2K9NA 3CJRB 4LLNA 4C3IJ 3LSPA 4LK1F 1N78A 1J0RA 3S2WA 3TMOA 4P96A 1Z3YA 2I10A 1XSVA 2DT6A 1ETKA 4HX4A 5TRDA 1D8JA 3ABTA 4G6DA 2VQLA 4OWRB 2MGQA 2FOWA 4OU0A 3FXLA 1TNTA 3H9JA 4BEHB 3DLAA 5HDKA 3CESA 2A6TA 3O6BB 3FKJA 4ZYGA 2X0LA 4W97A 1ZGJA 2MBFA 3CJTB 1BI3A 1W7PB 1SAUA 3KEYA 3SFZA 2MLGA 1XSDA 3KP3A 2F5DA 2IAIA 3V8KA 1LVAA 2F4MB 3FMQA 3KLNA 2VT3A 3JRFA 2X1EA 3A03A 4JX4A 2KIMA 1E3OC 2X1CA 2FMLA 4BQQA 2R7UA 3F8NA 3KZYA 3GTGJ 9ANTA 2W57A 5LGTA 3WTTC 4B8XA 4ON0A 2QQBA 2K27A 1FYLA 4C3JJ 3CMEI 5E3MA 2O0YA 2PJRA 1I3QJ 3MKZA 5M5YJ 4II3A 4II2A 3VSLA 4CA0A 5KAFC 4FE4A 1H9GA 5D5XB 3J7ZI 3V4GA 1HXDA 2M4KA 2EV0A 5K1YA 2OJED 4BJ6C 1A35A 2ELJA 3QODA 2HR3A 1ONVA 3PFIA 1FT9A 1BC7C 2V26A 1P7JA 3A01B 4HLYA 3ML6A 1ZGWA 1S6LA 2JZYA 2P0WA 3TOBA 2JPBA 2DA3A 2GOMA 2IXSA 1SD5A 2LKXA 4XLCA 1OCOH 1MIJA 2CU7A 4LOCA 2NVQJ 4C3HJ 4A3BJ 2DQLA 5GTHC 4K2EA 2R7QA 4HQMA 4DW6A 2NXNB 3BJ6A 3RZDJ 4LLLA 1A31A 1QHHD 4IQJA 1JT0A 5GP9A 2VJ5A 1KU9A 4UV8A 2VJIA 1YS6A 2DK8A 3F8BA 5EG0A 1MJ9A 5D8KB 4W1UA 1GXQA 5JR3A 4L5JA 3H5RA 1JGSA 1XMXA 3R61A 3MKYB 4A3LJ 2IW5A 3AG4H 1GDTA 2CSOA 3DBLB 3P5JA 4ZYHA 1BW5A 3QU6A 4XORA 4CYCB 2R7SA 1Z7LA 5JI6A 4L9NA 2DA5A 2W00A 3SZTA 4RGSA 4XR6A 1A5JA 3HRSA 1T95A 2EA2A 3ZQFA 4RGRA 4RM3A 4UV9A 4EQQA 1J59A 2UXXA 5FKNA 4YG2F 3WE2A 1R4NB 2ZXIA 2FQ3A 3W2AA 1RKTA 4HSRA 1WZ2A 4A93J 1H88C 5HDGA 2XAUA 4CCNA 1LDKB 2E36A 1QPMA 1KQ0A 3M8JA 4WX9A 5BPIA 2CV0A 3IWFA 1E2XA 3DCFA 1LFUP 4FQGA 3SYTA 1QPIA 4XICA 3HDDA 5ICGA 1STZA 3F8MA 3ZQGA 3BROA 3E97A 2NS8A 1IUFA 3G71I 2KT0A 3M7GA 1VFCA 1YIOA 3GVAA 3VFZA 2CV2A 2J5OA 1IAWA 3K4LA 1DP7P 2RC4A 2VN2A 4A6DA 2M0CA 1S9HA 4BACA 1LE8A 3M07A 4H4KC 5CKTA 1ZG5A 1VNDA 4I09A 2VASA 4I99C 3CC7I 4DNCA 2IA0A 1K7AA 4GO1A 1TLHB 2K3PA 3RKXA 3K9TA 2R0QC 3I4NJ 2LREA 3F6OA 3K0LA 1FC3A 2EV5A 1G3WA 4M73A 5K7ZA 1OCPA 1EV7A 3TEDA 3I71A 2QEXI 3KETA 2CQ7A 2QLZA 1RZ4A 1WJFA 3CCYA 5IP6A 1IRZA 1GUUA 2WB1A 4L5EA 2LK2A 3BZCA 5DCFA 4OIQF 2LNBA 3K4KA 4YFXF 4JYKA 3K1MA 2VXZA 1PUFA 1ON1A 3S2DJ 1BR4A 1W7PA 3M4OJ 2E7WA 3KP2A 2W1OA 4AIDA 2QM3A 3OSGA 1UG0A 3MQ0A 1U9OA 2IGKA 3TBIA 4KIGA 1P7IA 2CV1A 3HUGB 4Q4ZF 3OV8A 2HS5A 2VQHA 2ESHA 1R00A 1TBXA 1P4XA 5CQGA 2JA7J 1I27A 2A69F 2XKPA 2OAZA 4XRSG 4U0WA 3TO9A 3DF8A 4E7KA 1HKQA 3Q5FA 3NARA 3F22A 4I0BA 3L2VA 4QLCU 3OY9A 2A5YB 2ZFWA 2FE3A 2M34A 2H6CA 1WI3A 1O3SA 3RIRA 2LC2A 2GQQA 2KL4A 4ESJA 1VQMI 3FBIB 5FRMA 3LQRA 1F4KA 3PL8A 2P6SA 1Y39A 3CJQB 4RGUA 3G2BA 2EZKA 1WSUA 2LVSA 4OAYA 1GXPA 2BY2A 1S7AA 1H0MA 3OL3A 2RV8A 3JCUC 1MNMC 3DPLC 3JRAA 4MNUA 3LSKA 4J00A 4CGZA 1EJ9A 1ZTRA 2DFEA 2V7FA 3H35A 3GO5A 2O5RA 1P2FA 1TZLA 2HZDA 2EZLA 5F6FA 1XN7A 5E1ZB 4EJOA 3VOEA 4JOMA 4ZYEA 3LSRA 2P4WA 3HTSB 4M3DA 4OIRF 4IOCF 4E7IA 2DA2A 4EJVA 5M5WJ 2JTVA 1YJ9I 4XRFA 3K69A 2BW3B 3QPSA 4ENJA 2NRAC 4EGZA 2XASA 2KRCA 3F72A 5F64A 2ACJA 1JGGA 3CLQA 5F0FA 4L0YB 3DFGA 5EEGA 2IS6A 4BL0B 2V9PA 3QYBA 3C1DA 1Y0UA 1MNDA 5E1WA 3GWZA 5JHFA 2NNNA 4HF0A 4HNTA 2JA5J 1RRJA 2UWMA 2M0MA 2XPUA 3R6SA 5TGTA 1R7JA 1IRXA 2N8GA 2E1NA 4UUSA 3FXUA 2YU9J 3DTEA 3IC7A 1X1BA 1MJBA 2JN6A 1TW3A 1BL0A 4BY7J 4LG0A 3OYNA 2O8XA 2HDWA 2HXOA 2GXAA 4L18B 2QSHX 3S15J 1XX5A 3PO2J 5J47A 3AKZA 5GAEJ 4UUVA 4F52A 4Y33A 4YFKF 5AIPA 2KISA 5FB2A 1W0UA 1VQ5I 2KLOA 5J8FA 4EJTA 2KQRA 3HRUA 2CQQA 4EM0B 2JSCA 1MDMA 3RKYA 4MQ9F 2M45A 4RS8A 4D1QA 1RR7A 5HOOA 1IN5A 2XGXA 4ZYAA 2W4SA 1WJAA 1XGSA 2TDXA 4HOBA 3GYHX 1EF4A 2WAQA 1IF1A 2E1MC 2CS3A 4PDKA 1V3FA 4BYYA 4DIQA 3ULQB 1OKRA 2W85A 3CMYA 2GA2A 4XN3A 2WY8Q 2LOOA 2MD0A 4FASD 4RAYA 3GTJJ 5D4RA 2QSGX 3ZP5A 3GTKJ 5HVQC 2JRMA 3FBNB 4RBOA 3J7AY 1W5CC 2K40A 2E35A 2XPVA 3GXOA 3I3LA 3H1CA 2VXDA 4KIBA 2BV6A 3VYSB 2ZJRF 2OUMA 2MH9A 1LNWA 1JTXA 2BVLA 2EZHA 2Z5UA 4XMYA 4S05A 3I54A 2O7OA 3CP8A 4IPAA 1W4MA 4S0HB 3MZYA 1REPC 4MFEA 1IV6A 1U5TA 3CMAI 4CSWA 1KYWA 2WTEA 1DPUA 4DQ2A 4HLXA 3I4MJ 2M7AA 3FMSA 3GZNB 3ZQ7A 5FLVA 3DQVC 4XNFA 4D7NA 3IH2A 5DV5A 1E3HA 3LQQA 3ZMSA 2MD5A 2DN0A 2XHKA 1DU6A 2GA1A 5HS9A 2YR2A 1HCRA 4BDZA 2GLOA 2BXZA 4X6AJ 5EZHA 3HEFA 4L0ZB 1MBEA 4RB1A 2AS5F 4ZDPA 3GTMJ 3JR9A 4N4OB 1X3WB 2Q0OA 2EWNA 2H09A 5E1XA 5F0CA 1G8XA 1I50J 2FBHA 3R0JA 4M6XA 4Y4RA 3CCUI 4F93B 4BH9A 2Y9ZA 2TRTA 4CCMA 2ZB9A 1FWZA 4RMNA 1DPRA 2QWWA 2YSRA 1JHFA 3NQOA 3UNGC 4U7BA 2P7CB 3PJRA 4DJAA 1K79A 2DFFA 3BZ6A 4Y17A 1G4DA 2KJBA 1TQIA 1U5TC 5LGNA 3OYHA 4MTDA 2P7VB 3WHCA 3CUQB 4HX7A 3HOUJ 1Y6IA 1YRNB 5KNLA 4IHYA 2CQKA 4A6EA 1FMWA 1SANA 1BN5A 3LL7A 1T33A 3QPTA 5B5EC 3LA2A 1MMNA 2MYSA 3GF2A 4PFPA 5LBQA 4B43A 4X0GA 2STWA 1AOYA 4IXAA 3WE3A 1MMDA 1TNSA 3VWBA 4N9HA 3CCRI 2V9KA 5DUKA 3L2CA 1XG1A 1A6IA 3B02A 2OTLI 5B1AH 5HNFA 1OMIA 5IT9K 3BJOA 2A3SA 3S3OA 2KRHA 3QOEA 4A5NA 1MZBA 2KKOA 1ZLKA 4CO8A 3ZMDA 1O3TA 1L3LA 3K2AA 4XKCA 1O3RA 2XRLA 3W3CA 1TL8A 1MBKA 2W82A 4E70A 2A5WA 2DOAA 2DCEA 2HWVA 3LAPA 3CCVI 1ZARA 4G9YA 2BY1A 1Z05A 1R5ID 1T39A 2DOEA 4DYQA 3DEEA 1UZCA 3TOAA 4QPQA 2UXNA 2L7KA 1FIPA 2L0KA 5HDNA 3ABUA 4M9ZA 3PO3J 2K4JA 3RPUA 1WKMA 3HPGA 4PZJA 4BGDA 2H8WA 2ADUA 2PBIA 3MZ8A 1BOBA 3JRHA 4IX7A 2EIKH 4EM2A 4IZZA 1VF9A 1HDPA 2DODA 2F5FA 2QVOA 5BQTA 1NH3A 3JAMZ 2IGOA 1HW5A 3O8HA 1JKQC 1PDNC 4ZDLA 3OS1A 3L2QA 3M1CA 1X2MA 3WGHA 5FROA 1SFXA 3K10A 5HLHA 1FP2A 1EH7A 1QQIA 1DGRM 1UJ8A 1N25A 3J7YJ 2Z33A 4OMZA 2BY0A 4E7HA 3BPXA 1LQ1A 2JA6J 5JVTA 1B9NA 1V5EA 3PUBA 2JA8J 3ZMVA 2EZIA 1K4SA 3IWZA 4CZZA 2EFNA 3HOTA 3ABLH 2JA2A 2CGPA 2DO7A 1OLTA 1ORKA 1R5HA 5L3GA 5FRNA 4QWQA 1SMYF 1ZREA 2XIGA 2Y2ZA 2MSYA 2XAFA 4AWXB 5JVGF 5DM6F 1TQMA 2EILH 3ZN0A 3E1SA 3CCJI 2LSOA 1D1BA 1H8AC 1POGA 1XCVA 4BE0A 1U8BA 3ZQHA 5ILVA 2L4MA 2O03A 3ELKA 2Y48A 1ZELA 1V4RA 4ENNA 1YFHA 3Q3SA 2R7TA 3QPHA 1FP1D 1A04A 4H0EA 2QUFA 1A6QA 3HXLA 1W0TA 4UVBA 2DMTA 4KA4A 3FHZA 3QPLA 1X19A 4LG0B 1ETWA 2PMZN 4Q5SF 1OCRH 3WTZA 4YELA 1S7EA 3AG1H 5D6EA 1V54H 2E5ZA 2FX0A 2XB0X 2OTJI 4XOPA 2EIJH 4JQFA 4JX6A 4FE7A 5GAHJ 4BQNA 4ANJA 1X1DA 4A5MA 1IW7F 2LTPA 3BOQA 3IAM2 2LYCA 1HQCA 3BP8A 5FGMA 1LUJB 4OINF 2CW7A 4YRVA 4HQEA 2PI0A 2JPCA 5FD5A 2K9LA 1FOXA 1WPKA 2HKXA 5J40A 4G6QA 1R71A 3KZIC 4FISA 4CDGA 3PUFA 4AM3A 1I39A 2VONA 2DYRH 4HW0A 2DFIA 2F5CA 2L3DA 3FM3A 2LR8A 5IP9J 3HSFA 1IGNA 5TJJA 3ZMTA 3PM1A 2OZ6A 2WA0A 1VTNC 2P5VA 4UVCA 4LFUA 4QPOA 2E2HJ 5C4XJ 1M1EB 3PQJA 3QWLA 3S14J 2E7XA 2DXIA 3CLOA 3QYEA 1T08B 2PLYA 2YUSA 1V5GA 5IOZA 4XQFA 3V7SA 3BR0A 2GXBA 3M3YJ 4WF2A 1QZEA 4U88A 1JUMA 1AA7A 3RYRA 3OL4A 4A3EJ 3M9AA 3RPQA 1IXSB 2VBZA 2QYOA 3BCBA 1BM9A 5HS7A 2ME0A 3OYFA 4A3CJ 2ZKZA 1WH5A 1OPCA 2XGDA 4RAGA 5HLTA 4Z6YA 3J81K 3K6GA 3TP0A 1MSEC 2VE9A 1I1SA 2RGVA 2HPMA 4BHCA 5JHUA 5IP7J 3K1NA 2VC1A 2FF4A 1J2XA 1J5YA 2IA1A 4PFOA 4F3QA 2YS9A 2Y0MA 3HKZA 1JKPC 3BTJA 3E6MA 4D7MA 3ZXSA 3F23A 3TP3A 3W6JB 2V79A 3BY6A 1RETA 2HXIA 4LJZF 1JJ8C 1CGPA 3PNYA 1LE8B 1FY7A 2XGEA 2P5LC 3JRDA 3DU6A 3OYCA 1JHHA 1YX3A 2HNHA 1KONA 4Y7NJ 3COAC 2MLKA 4UVAA 2VKHA 3IHUA 5L3FA 2CMPA 3K4NA 1WWXA 2MA3A 2HTSA 3FXOA 1YYVA 3R4KA 5E3LA 5IPAA 2FMYA 4YEJA 1QO0D 2PEXA 1LJ9A 4HDUA 3BTLA 3BG5A 1R1VA 3ERMA 2P81A 2X6WA 4IRHA 2GWRA 1PVEA 3S1RJ 2TCTA 3WGGA 2QZ8A 1SFEA 2DPUA 2EA4A 1Z9CA 3L9FA 3S1NJ 4M3FA 1R4MB 2MC3A 4BEHA 2QGUA 1YJNI 1K6YA 3HOYJ 3DKWA 2JWTA 1XMKA 4XL9A 3SZPA 3RI4A 3GLLA 5BNGA 2JSPA 1TWAJ 4KNYA 4IOAF 1JXSA 2IGMA 3U21A 4HA8A 3OOUA 4CICA 2HYFA 3L1PA 2ECCA 1MH3A 2KIUA 1Y8RB 2EQRA 3K2ZA 2VL8A 3G4SI 2DMNA 1XS9A 2OZUA 1J75A 4PJMA 2BZTA 2G7HA 2WBMA 4KN4X 1GV5A 3B6AA 1IN6A 1HSTA 1MH4A 3O3KA 4UHTA 4A12A 2NYXA 2DK5A 1YOVB 3MD2A 2Z2SB 4LGWA 2VKEA 1ENHA 3HTUA 3GFJA 1YLFA 2LD5A 1VQ9I 4D0PA 3REOA 4BNCA 5DCMA 3LOCA 1BJZA 3MKLA 1Y1WJ 5LHIA 2BHYA 2DW4A 3FK7A 1YX5A 1E17A 5CLSA 3L2RA 3ERED 2PJPA 4I0AA 1SD6A 3F9KA 2HEOA 4I02A 4KDPA 1MD0A 4PCQA 3K4JA 2FSWA 3LSHA 5DUIA 2L7MP 3GLXA 1T56A 2M1BA 2CUFA 5KK1A 3Q0WA 2ZXJA 2HOSA 2PG4A 3GX4X 2EV6A 3D5RC 1FLIA 4ZTFA 3WTVC 4N0BA 3T1BA 2DA7A 4AVZA 3K4BA 2PMHA 4EMSA 1YS7A 2L2OA 1K4TA 4XONA 4IRGA 3FWEA 3KP7A 1BIBA 4CZCA 1WFXA 1BOAA 3PIPF 2PQ8A 4PJ0C 3DU5A 2LKSA 2F5VA 5BMZA 2MH2A 2PFBA 3W2VA 3ZRGA 2EPFA 2EFWA 2VB6A 3SFIA 1WGXA 3ZGKA 2BEOA 4S04A 3GTOJ 3SHFA 3LFKA 2NVTJ 4UNOA 5ICEA 1GVDA 3LSMA 2Y75A 4XLNF 5LLQA 1ZR4A 5F0HA 3BG9A 2Y31A 2C6YA 4O3MA 2DYSH 2Y0SN 4XLFA 5K5QA 1MDMB 3JSOA 4QSHA 2A6EF 1VQ4I 2EBIA 1NG7A 5FO5A 2QKLB 2XUBA 4KT6A 5E79C 3I59A 2FEZA 3AG3H 5CVUA 5FLXK 5DD4A 1WJDA 1V5FA 2X6XA 3HSEA 2DA1A 4B3AA 1PP7U 4GDFA 1FMVA 2OCCH 1GV2A 3KCCA 4IL6C 5L3BA 3F6VA 3CF5F 3K70D 2DDBA 4EJWA 2QQ8A 1Q1VA 1HDDC 3DP7A 1ACIA 4M9SA 3OYDA 3T5XA 1VQNI 4RLQA 2R7ZJ 3NRVA 3G1OA 1RPWA 2ZCWA 4XSXF 4BUPA 5HS8A 3N05A 3OYEA 3KYDB 2AO9A 1DUXC 2LF7A 4IHXA 1B59A 3Q9SA 3SQNA 1WI9A 4PJNA 4BQOA 3D5SC 1OCZH 4BXFA 4IHTA 2VE8A 4C2TA 2GBYA 1YIJI 3JW4A 4J19A 3CQZJ 4B09A 4QTRA 4Z2YA 3L2UA 5TISC 1QZYA 3WTUC 1IDZA 2GAUA 1QNTA 3GBGA 3OWTA 1G6NA 5LRRA 1SVOA 4GFBA 2E5NA 3HOXJ 3RQ4A 4IHSA 3WU0A 3ZMZA 4A3KJ 5ERIA 3OIQA 4G7HF 2R7RA 3RCOA 2IS2A 5FKLA 2LY2A 1N75A 1O3QA 3G3ZA 4RA2A 3BT9A 1P6RA 2AQFA 1W36D 2HQNA 2FNAA 5DDGA 3GTPJ 2F5EA 2LY9A 4Y15A 1MBFA 1JT6A 5F1JA 4WWCA 1SVMA 5EEAA 2V9VA 2P5KA 3J80Z 1MMAA 1BIAA 3DTIA 5F1RA 4F7ZA 3OYKA 3WTXC 4RB0A 4GCVA 5L3DA 4M74A 1TTYA 2FA5A 3SEQA 4UUSB 2B63J 3KIOA 2A6HF 4QIWN 3KE2A 3LNQA 1EA3A 5GADJ 1HF0A 1YRNA 3FF5A 3Q0VA 1ZKGA 4C9YA 1AU7A 3BWGA 3I0TA 5D4SA 4O6JA 2OC6A 5K5OA 3FZVA 4E7SA 2UUZA 1F5TA 1X1PA 4BQAA 3FMRA 2DTRA 4LD5A 5EF6A 2HPIA 3TDZC 3DEUA 4NC7A 1OJLA 3WG7H 2NVXJ 1BC8C 5IT9Z 2R5YA 3GZ5A 2Q8KA 4DBQA 5CQEA 1HW2A 3ABKH 1E3PA 2D1HA 3PFYA 1F1ZA 1ZH5A 3ABMH 3H9GA 5DCMB 2IS4A 3S3MA 1B8IA 4PGGA 2OPTA 3ECHA 1W5SA 2XAGA 1MBHA 1VQLI 1OISA 1XGMA 1N77A 2E34A 5D6FA 1S29A 5HNHA 1LB2A 4DGWB 2IEKA 4AC0A 1SD4A 1U9NA 3HB9A 3WTSC 2DI3A 2CUJA 2EB7A 4XLEA 3WTWC 4HF2A 2I8DA 3KP6A 1OFCX 2K86A 1MJAA 2AQEA 4JP0A 4GYIA 1UG2A 3BQZA 3BG3A 3LSIA 3TO6A 1RKWA 2F4OB 4CYCA 4NUBA 2R93J 4CYDA 3GTLJ 2DMPA 2G9WA 3ZOBA 1UCRA 3BCAA 3QP5A 2FBIA 2CYYA 2DBBA 3BQYA 5FKOA 1OCCH 1R9TJ 3FK6A 4MQVA 1B72A 1R36A 4L9JA 4A69C 3DKYA 2STTA 2M4GA 2WY7Q 1MGTA 2XVCA 2ESNA 1RESA 4GXOA 4KN7X 4M6VA 2BHZA 4XLAA 1U3EM 2EFPA 2Y9YA 5AIQA 3OYMA 2G7UA 3WGIA 1ETVA 2WADA 4EVIA 3I58A 1ZQ3P 2WC2A 2H94A 5K7FA 3R0AA 2IA2A 1BBYA 3H5NA 1TQPA 5D5UB 2BE5F 3C18A 2MFZA 3FXRA 1Y0NA 5F04A 2HDCA 4BKXA 3G6EI 2HOTA 4XM3A 5F27A 3JSPA 3FM5A 1BA5A 4RDUA 1YHQI 5JFRA 1NK2P 1HA8A 3EDPA 1DGWY 2OCEA 3VYRB 3EPZA 4ETSA 3DPTA 3V8JA 3S32A 2YX4A 5LD2C 4KUMA 4AIHA 1HBXG 5ILUA 1VQ6I 2XAJA 2VOPA 3R60A 1G59A 2VBWA 3A1YA 3MEXA 4E4HA 1HW1A 5M5XJ 2BXYA 1FEXA 4XN0A 5J4YA 1LDJA 1X3ZB 2ZXWH 1Z6TA 2CFXA 4XK4A 4AYBN 4OAZA 3K70C 4EGYA 3TW7A 2R4GA 1QVTA 3CUQC 4ZTJA 1TT5B 1S7OA 2CFOA 4NC8A 4R1HA 3LA3A 2CQNA 1EH6A 2XF6A 4E7LA 1VQOI 1LVKA 4I2OA 1TC3C 1P92A 2K7LA 2HQ5A 4KJZA 2Z9OA 1RUOA 2RREA 2M30A 4PSXA 3CTAA 4KITB 1KA8A 4OIOF 2IVMA 5IYBJ 1U0JA 2MABA 4NQWB 1QA6A 4AIJA 2DMQA 2K4BA 5J8CA 1ERDA 4A3FJ 2ZBKA 2IGNA 1W5TA 3BPVA 4A3MJ 3N4MA 3SZGA 1Z67A 3NWSA 1D0YA 4CHUA 1F36A 5ICCA 1SC7A 4X1EA 3RJPA 1IO2A 5H20A 1HLVA 1FSEA 1WJEA 1T0FC 3U2RA 3L2WA 3GFMA 2QA4I 2EH3A 5EDNA 3H3UA 5CPRB 5IT3A 5BOXA 3IAS2 4IHVA 1XDSA 1TP4A 2MW8A 3MAJA 3AL0C 3PQKA 1LEBA 3CZ6A 4I98B 5FD6A 2V1XA 1H9TA 4XRMA 3CCLI 4HRIA 3E5UA 1WJ5A 4P9FA 2XROA 2R7DA 2VC0A 3CMMA 3ROUA 3ZMUA 2VBXA 4JBAA 4J01A 2ECBA 2RQPA 1T2KA 1Y1VJ 2QSFX 2HQRA 5J4VA 4A3GJ 4G8XA 2HQAA 3IRQA 3S93A 3CO7C 4ITVA 2H1LA 5J6XA 1RC9A 1U2WA 3KEOA 5HLIA 3FDYA 2LMDA 4AYBA 1MNEA 3HUGA 4MO7A 4CUGA 1D0XA 5IYDJ 3CC2I 4Y52J 1UB9A 4ZC3A 2VI6A 2ZJ2A 1AKHA 3QP6A 1QBJA 2HOAA 1XB4A 2EFQA 1T0FA 3CDLA 3HRTA 3TL4X 2KIFA 2KIQA 1XTAA 4B4CA 4U0YA 1CF7B 1KGSA 2CWEA 2IPQX 2WB1N 1QHGA 2BVMA 3AG2H 3HOSA 1OR7A 2V6EA 3X2QH 3WU1B 1WJCA 2Z99A 3EYYA 2KDOA 1TT0A 2KJCA 2RKHA 2F6CA 2VPLA 4HZFA 4C30A 3I55I 4OOIA 3FXMA 3SDBA 3TW6A 3S8PA 1WCMJ 2X6YA 3ZQQA 3KX2A 2VLAA 3OR2C 2XF7A 1E0EA 5JLWA 3HG9A 4RM2A 1BR1A 1YITI 1J7KA 2OA4A 1Q1HA 1R23A 1SMTA 5J1UA 3C2GA 3JTGA 3DWLE 1OCTC 1FBUA 2Z3YA 3GFLA 4DYRA 3WG9A 3ASNH 5E3OA 3CDIA 2FNPA 4P9UA 1UFMA 4BE2A 2RVCA 3HPHA 1WRJA 2QCOA 3ONQA 4GYGA 4F91B 4RAFA 2P6TA 3P9CA 4UY8I 1ETOA 2R92J 4BS9A 3U9GA 3EYIA 2IJLA 2ZNZA 4HPQA 3CCEI 4XKVA 4A0XA 2LKPA 2HU9A 4HF1A 2E1MB 1FTTA 1YE9A 2XDVA 2K9MA 1RNLA 4A3IJ 2W48A 3BR1A 3PSFA 3AL0B 3HOZJ 3DKXA 2XSDC 3BLYA 5LHHA 5CYVA 4E6KG 2QQ9A 2LDUA 5EJCA 2R7OA 3BR6A 3HSRA 1XMAA 3IH3A 1IUYA 5FLMJ 4NHJA 2ZC2A 3Q0UA 2LBFB 4PUSA 3UR3C 4CCOA 2EINH 3EUHA 3RYPA 3OYAA 1JKRC 3IUOA 4FHTA 3CJNA 3EETA 1IV8A 4RB3C 3KYCB 1LKXA 2L02A 1B1BA 3PIOF 2HVQA 1VQPI 1IG7A 1G3SA 5DTDA 1R22A 2HFHA 4G6TB 1YJWI 3RZOJ 2M8EA 1FNNA 3H9QA 1HC8A 2M5WA 2KPMA 2M7BA 4Y3OA 3F8FA 3MWMA 1IRGA 2OD5A 1KU3A 4IHWA 3OIOA 3CCMI 4I7HA 4V2FA 3BZKA 4B44A 3LSTA 1JJ6C 1NHAA 1K83J 2CQXA 2E71A 1EH8A 4HDVA 3LWFA 1W1WE 1ZGAA 5EGOA 3CF2A 1X1CA 4WCGA 2NS0A 4EEFG 4V19K 2M87A 3E7LA 2LFBA 3K7AJ 4EM1A 1ZG1A 3S17J 1ZN2A 4BHBA 1DU0A 3MCZA 3HHHA 1Y56A 2O61A 1WHUA 4NBQA 5D5VB 2VOOA 1B72B 1OYIA 3OMYA 2KHMA 2DT7B 2CW8A 4AU7A 4MIMA 3SDGA 5FKMA 4HX8A 4RLFA 2Z16A 2OBPA 2O9LA 1ETXA 3FXKA 5FKKA 4NNJA 2W25A 3SXYA 2M8GX 1GLNA 1J9IA 3CUOA 1JE8A 2X1DA 1OYWA 1PYVA 3C2HA 2K5CA 2DLLA 1UHMA 2LLKA 4FX0A 4N9IA 4E7ZA 1Z6RA 3PNVA 4A0ZA 3H0GJ 4NQWA 2IP2A 2R5ZA 2BOLA 3E5QA 2HKOA 1B4AA 3VSKA 2QF7A 4HEA2 4P5OA 2QENA 3IP4B 3KFWX 3EUAA 3LSGA 4B48A 1OYYA 4PK4A 1UHSA 2CW0F 2CG4A 4KIFA 2WV0A 2HTJA 1PP8F 1O7LA 2HOEA 5B3SH 2R5YB 3L09A 1SD7A 4L5IA 1KU7A 2O3FA 3I4PA 1U5TB 4EJUA 2CO5A 1R6RA 2ETHA 1AWCA 1G3TA 3DLLF 2E19A 2BBYA 4KMUX 4XKBA 2NOJB 2KRFA 2R7WA 1BJAA 1FJLA 3OSFA 1IC8A 3BG7A 4JX5A 1XDUA 5DM7F 2JVHA 3C2BA 4PJJA 5DS9A 5CVIA 5D5WB 3HC7A 4XSZF 5GAGJ 1HKSA 3B73A 1UELB 2A68F 3K4MA 1APLC 1UHWA 2OF7A 4GRIA 4U87A 4F92B 1OQYA 1D5YA 1DP3A 3E6DA 4BXUA 4LB6B 3K4CA 3CCSI 1F43A 5CVRA 2WWYA 3A01A 4LLGF 1U78A 2OU2A 2V6CA 5E8GA 2ICWG 5DD8A 4UB6C 2RQQA 4KYWA 2PX9A 4B47A 2DA6A 2XSJC 2L9RA 1D8KA 1AKHB 1X1AA 1T8IA 5EZGA 4ZJZA 1Z3XA 1Z7UA 4ESBA 4LIVA 4LK0F 1D5VA 2NS7A 1KU2A 4IQ4A 3RKQA 5LGUA 3VPRA 4CXFA 1P4AA 2ZJQF 1W36C 4B3XA 1MW7A 5E3NA 3F21A 3JRCA 2IS1A 3QOPA 2FBKA 3KPHA 3ISPA 4IJAA 1USSA 3FIWA 1IXCA 4DBRA 1KZHA 4MHGA 4OMYA 4DZJA 2W7NA 1YTYA 1I6HJ 1GHCA 1CF7A 5GTIC 2VUMJ 2LP0A 2Q2EB 3DPUA 1FOWA 2DOFA 2RNGA 4XKWA 3JRGA 3W6VA 2L4AA 2VKDA 5LHGA 3MMYB 3JAMK 4F55A 2DTZA 4DOZA 2O8KA 1XPXA 3H3ZA 2ELHA 3GMEA 2DFHA 3HL2A 1P4WA 2VQCA 1IJWC 1KQ9A 5KVRA 2ME6A 1D0ZA 2KFDA 3A4CA 4FT8A 1Z21A 5C3EJ 3G1LA 1LEAA 1T6SA 1VZ0A 1B8IB 3TDUC 1JKOC 2F2EA 3OS2A 2RAEA 1BW6A 4UXNA 2XAQA 1TW2A 1H89C 1X4PA 5H6QA 3KEQA 5GPAA 4YIFA 1VI0A 3T0YA 4YIIA 3ZQCA 1T98A 4M72A 3A02A 1FSHA 1R58A 3HOWJ 3ZR8X 5EG0B 1ZG3A 2K85A 2XB5A 2BY3A 1RR8C 2GM4A 1FOKA 3E5XA 1YO5C 1Z0XA 1X4OA 2M3AA 4R79A 2FU4A 3DTKA 4D9JA 1R1UA 2AXTC 1LPQA 2VODA 3ZN1A 2DPDA 3D1NI 4BBSJ 3V42A 2FOKA 3I5UA 1O57A 3DXJF 3NEUA 1EKEA 1PUFB 2JUCA 3TGNA 2COMA 1ZRFA 4BJTA 4CH7A 2I5UA 3EUHC 1ETQA 4BU2A 2ID6A 3S16J 5KAIC 2LG4A 2DMUA 5J1RA 3MZHA 1XGOA 5LRSA 1ETYA 3D0SA 5DYMA 4FETA 2UZKA 3FX3A 1ZAOA 1ZLJA 3M1EA 1ODDA 4Y13A 2A07F 3K1PA 3G1MA 1TWGJ 3QRFF 3UKGA 1MKMA 2WAEA 4LMYA 4WXDA 1O7FA 4XIDA 4ASNA 2NOGA 1NTCA 2JMWA 3ASOH 1MSFC 2BYVE 3AFHA 3DBRB 3AAFA 1I1GA 2VQGA 3RQIA 3WU2C 3M8EA 4FCYA 2R7FA 4M3GA 2ZSIB 2F4IA
chains in the Genus database with same CATH topology
2DMTA 4XK4A 3QPLA 4AYBN 2HI3A 3TW7A 1QVTA 1ETWA 2PMZN 1ZGWA 4M3EA 1S7EA 2DA3A 4D5FA 2FX0A 2LKXA 2XB0X 1ZR2A 2CU7A 4LOCA 1TC3C 4C3HJ 2NVQJ 4JX6A 4A3BJ 2HQ5A 4FE7A 2COBA 2AHQA 4DW6A 2LTPA 3RZDJ 1JT0A 3FKIJ 5GP9A 5IYBJ 3BR5A 1WPKA 2DMQA 3HGGA 5EG0A 4FISA 4W1UA 1FTZA 4A3FJ 4A3LJ 1ITYA 2CJJA 4A3MJ 1GDTA 1UMQA 2LR8A 5IP9J 1IGNA 1ZK8A 4B1RA 3PM1A 1BW5A 5M3FJ 4CYCB 1F36A 2JJ7A 2E2HJ 5C4XJ 4X1EA 2DA5A 1A5JA 3S14J 1HLVA 3ZQFA 3B6CA 4MLOA 2EH3A 5EDNA 4A3JJ 1CQTA 3HOVJ 4IHVA 5FKNA 2YUSA 2MW8A 2E2IJ 1Z77A 2CRGA 1RKTA 3QQAA 4A93J 3BR0A 1H88C 3M3YJ 1JTYA 1JUMA 3FISA 4XRMA 4A3EJ 3DCFA 1LFUP 2ME0A 3MN2A 4A3CJ 1QPIA 1WH5A 2XGDA 4XICA 3HDDA 4DZPA 3TP0A 3ZQGA 1MSEC 4IEJA 2Y30A 2NS8A 1IUFA 2ECBA 5IP7J 1Y1VJ 2KT0A 1K61A 4A3GJ 2YS9A 3HKZN 1VFCA 1JKPC 3BTJA 4D7MA 2X9DA 3TP3A 4MO7A 1RETA 2HXIA 2KDZA 2M0CA 1JJ8C 1LE8A 1LE8B 2JK3A 5IYDJ 2XGEA 1VNDA 3JRDA 4Y52J 2L7FP 2VI6A 3S2HJ 1XC5A 1AKHA 2R0QC 3I4NJ 4Y7NJ 2VPRA 2HOAA 3CDLA 5K7ZA 1OCPA 3O8GA 4BY1J 3TEDA 4B4CA 3BTIA 3CCYA 1MBGA 2WB1N 5IP6A 1GUUA 1IRZA 5E3LA 4L5EA 2LK2A 5IPAA 4FTHA 4XRSA 4M3BA 2WV1A 4JYKA 1X2NA 1PUFA 3BTLA 3BG5A 2P81A 3S1QJ 3S2DJ 2H1KA 4I6ZA 3S1RJ 1GT0C 3M4OJ 3F0CA 3TW6A 2TCTA 5IYCJ 1WCMJ 3OSGA 4A3DJ 1U9OA 1G2HA 1P7IA 1SFOJ 5JLWA 3S1NJ 4M3FA 3HOYJ 2JA7J 2JWTA 3DEWA 5C4JJ 4XRSG 5BNGA 5J1YA 1TWAJ 4G12A 5J1UA 1OCTC 3NARA 4DYRA 3OOUA 3L1PA 2ECCA 5E3OA 1MH3A 4UUTA 2M34A 2XGCA 1WI3A 3MVPA 2EQRA 1QRYA 2DMNA 1XS9A 2QCOA 1JUSA 2E1OA 1GV5A 3B6AA 1ETOA 3JRBA 2R92J 2FJ1A 1MH4A 3JREA 5M3MJ 4D5CA 2EZKA 4FCYA 2IBDA 2LVSA 2FQ4A 1FTTA 1MNMC 3JRAA 2VKEA 1ENHA 4A3IJ 2LD5A 1ZTRA 2W48A 3BR1A 3HOZJ 2EZLA 3LSJA 1FIAA 2XSDC 3LOCA 1BJZA 3MKLA 1Y1WJ 3FK7A 3LSRA 3S1MJ 4M3DA 3BR6A 2DA2A 5M5WJ 2L7MP 3IH3A 3QPSA 1T56A 2CUFA 5FLMJ 3Q0UA 3Q0WA 2HOSA 2ID3A 1JGGA 3BR2A 1JKRC 2HDDA 1IDYA 5F0FA 2R5ZB 2K9QA 2DA7A 2JA5J 2X6OA 2XPUA 1IG7A 2L7ZA 2M2EA 2N8GA 4UUSA 2MG4A 5DTDA 2YU9J 3RZOJ 2JN6A 5GPCA 1BL0A 4BY7J 2HXOA 3SFIA 1WGXA 4IHWA 3S15J 3PO2J 3ZQLA 3GTOJ 3OIOA 1QVUA 4V2FA 1JJ6C 2NVTJ 1K83J 2CQXA 2K9SA 1W0UA 5IOYA 5EGOA 1GVDA 4EEFG 3E7LA 2CQQA 1TWCJ 1ZR4A 5J3LA 2LFBA 3BG9A 2Y31A 3K7AJ 4BBRJ 2Y0SN 5F0HA 2E2JJ 3S17J 2X48A 4QSHA 1DU0A 1RR7A 2EBIA 1LFBA 1B72B 1EF4A 3IH4A 3HGYA 2DA1A 2H8RA 4B3AA 1X58A 4MIMA 3SDGA 4I76A 5FKMA 3CMYA 1GV2A 3ZQIA 2O9LA 1ETXA 5FKKA 3GTJJ 1Q1VA 2M8GX 1HDDC 3GTKJ 1O4XA 2DA4A 1NK3P 4RBOA 2K40A 2G0EA 5C44J 2XPVA 2LLKA 2R7ZJ 3SJMA 3G1OA 3H0GJ 2HYJA 1RPWA 4HNVA 2R5ZA 2QF7A 2AO9A 1JTXA 4MFDA 2EZHA 3LSGA 4IHXA 2O7OA 1UHSA 2DJNA 4S0HB 4MFEA 2GBYA 1IV6A 4J19A 3CQZJ 3I4MJ 2R5YB 5FLVA 4D7NA 4QTRA 3IH2A 1TWFJ 1IDZA 3GBGA 4GFBA 1MBJA 2DN0A 4ABZA 1DU6A 3HOXJ 2E19A 1HCRA 5JLXA 2GLOA 4X6AJ 5EZHA 1FJLA 3HEFA 4A3KJ 1MBEA 3OSFA 1IC8A 4JX5A 3H3VK 5FKLA 3NAUA 3GTMJ 1TWHJ 3C2BA 5DS9A 3JR9A 5HODA 5F0CA 3HM5A 4V2GA 2VKVA 3BT9A 1HOMA 1I50J 5EGOB 1APLC 3GTPJ 2Y9ZA 2LY9A 2OF7A 1MBFA 1JT6A 5F1JA 4BXXJ 2TRTA 5EEAA 1D5YA 3BR3A 2ZB9A 1F43A 3A01A 1U78A 2WAQN 2B63J 4UUSB 4C2MJ 2DA6A 2NVYJ 1WH7A 2L9RA 3WHCA 4QIWN 1AKHB 3LNQA 4AUXA 3HOUJ 5EZGA 1YRNB 1AHDP 1HF0A 1YRNA 3WHBA 4IHYA 2NS7A 3Q0VA 3RKQA 2XPWA 1ZKGA 1SANA 3VPRA 3GTQJ 3HBLA 1AU7A 5E3NA 1T33A 3JRCA 3FIWA 5EF6A 2D5VA 1OJLA 2NVXJ 4DZJA 1XG1A 1A6IA 3JRIA 2R5YA 1I6HJ 4NDLA 2FD5A 3IV5A 2VUMJ 2LP0A 2M9HA 5FJ8J 3BTCA 3JRGA 1B8IA 3W6VA 2OPTA 3K2AA 2DTZA 1MBHA 2O8KA 5K7HA 2XRLA 4DYCA 5F08A 1MBKA 2ELKA 1JUPA 2IEKA 4AC0A 1IJWC 2ME6A 5EYRA 1U9NA 3HB9A 2CUEA 2K9NA 5C3EJ 1OFCX 3G1LA 4DYQA 4C3IJ 4JP0A 3LSPA 1FIPA 3BQZA 1UG2A 2L0KA 3BG3A 1JKOC 1B8IB 1RKWA 4CYCA 2R93J 3PO3J 2RAEA 3GTLJ 2DMPA 2I10A 1BW6A 3ZOBA 1ETKA 1H89C 1VI0A 3BQYA 5FKOA 1R9TJ 3FK6A 1B72A 3JRHA 3ZQCA 4A69C 3A02A 2MGQA 1VF9A 3HOWJ 5EG0B 1HDPA 2XB5A 2GM4A 1RESA 4M6VA 1Z0XA 3O8HA 1JKQC 2Y9YA 1X2MA 1ETVA 4W97A 3D1NI 4BBSJ 1ZQ3P 5K7FA 2IAIA 3JRFA 1PUFB 2JA6J 2JA8J 3A03A 4JX4A 1ETQA 2EZIA 1E3OC 5F04A 2ID6A 3GTGJ 3S16J 4BKXA 9ANTA 2HOTA 2DMUA 5J1RA 5F27A 1ORKA 1ETYA 4C3JJ 5E3MA 1I3QJ 1BA5A 4RDUA 2Y2ZA 5M5YJ 1NK2P 2MSYA 1H8AC 4FE4A 1POGA 3G1MA 1TWGJ 3UKGA 4XIDA 1U8BA 3ZQHA 2NOGA 1NTCA 2JMWA 1MSFC 5M5XJ 4M3GA 1FEXA 3Q3SA 3RQIA 1P7JA 3A01B 5GPAA 1W0TA 5IOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMT A;  4XK4 A;  3QPL A;  4AYB N;  2HI3 A;  3TW7 A;  1QVT A;  1ETW A;  2PMZ N;  1ZGW A;  4M3E A;  1S7E A;  2DA3 A;  4D5F A;  2FX0 A;  2LKX A;  2XB0 X;  1ZR2 A;  2CU7 A;  4LOC A;  1TC3 C;  4C3H J;  2NVQ J;  4JX6 A;  4A3B J;  2HQ5 A;  4FE7 A;  2COB A;  2AHQ A;  4DW6 A;  2LTP A;  3RZD J;  1JT0 A;  3FKI J;  5GP9 A;  5IYB J;  3BR5 A;  1WPK A;  2DMQ A;  3HGG A;  5EG0 A;  4FIS A;  4W1U A;  1FTZ A;  4A3F J;  4A3L J;  1ITY A;  2CJJ A;  4A3M J;  1GDT A;  1UMQ A;  2LR8 A;  5IP9 J;  1IGN A;  1ZK8 A;  4B1R A;  3PM1 A;  1BW5 A;  5M3F J;  4CYC B;  1F36 A;  2JJ7 A;  2E2H J;  5C4X J;  4X1E A;  2DA5 A;  1A5J A;  3S14 J;  1HLV A;  3ZQF A;  3B6C A;  4MLO A;  2EH3 A;  5EDN A;  4A3J J;  1CQT A;  3HOV J;  4IHV A;  5FKN A;  2YUS A;  2MW8 A;  2E2I J;  1Z77 A;  2CRG A;  1RKT A;  3QQA A;  4A93 J;  3BR0 A;  1H88 C;  3M3Y J;  1JTY A;  1JUM A;  3FIS A;  4XRM A;  4A3E J;  3DCF A;  1LFU P;  2ME0 A;  3MN2 A;  4A3C J;  1QPI A;  1WH5 A;  2XGD A;  4XIC A;  3HDD A;  4DZP A;  3TP0 A;  3ZQG A;  1MSE C;  4IEJ A;  2Y30 A;  2NS8 A;  1IUF A;  2ECB A;  5IP7 J;  1Y1V J;  2KT0 A;  1K61 A;  4A3G J;  2YS9 A;  3HKZ N;  1VFC A;  1JKP C;  3BTJ A;  4D7M A;  2X9D A;  3TP3 A;  4MO7 A;  1RET A;  2HXI A;  2KDZ A;  2M0C A;  1JJ8 C;  1LE8 A;  1LE8 B;  2JK3 A;  5IYD J;  2XGE A;  1VND A;  3JRD A;  4Y52 J;  2L7F P;  2VI6 A;  3S2H J;  1XC5 A;  1AKH A;  2R0Q C;  3I4N J;  4Y7N J;  2VPR A;  2HOA A;  3CDL A;  5K7Z A;  1OCP A;  3O8G A;  4BY1 J;  3TED A;  4B4C A;  3BTI A;  3CCY A;  1MBG A;  2WB1 N;  5IP6 A;  1GUU A;  1IRZ A;  5E3L A;  4L5E A;  2LK2 A;  5IPA A;  4FTH A;  4XRS A;  4M3B A;  2WV1 A;  4JYK A;  1X2N A;  1PUF A;  3BTL A;  3BG5 A;  2P81 A;  3S1Q J;  3S2D J;  2H1K A;  4I6Z A;  3S1R J;  1GT0 C;  3M4O J;  3F0C A;  3TW6 A;  2TCT A;  5IYC J;  1WCM J;  3OSG A;  4A3D J;  1U9O A;  1G2H A;  1P7I A;  1SFO J;  5JLW A;  3S1N J;  4M3F A;  3HOY J;  2JA7 J;  2JWT A;  3DEW A;  5C4J J;  4XRS G;  5BNG A;  5J1Y A;  1TWA J;  4G12 A;  5J1U A;  1OCT C;  3NAR A;  4DYR A;  3OOU A;  3L1P A;  2ECC A;  5E3O A;  1MH3 A;  4UUT A;  2M34 A;  2XGC A;  1WI3 A;  3MVP A;  2EQR A;  1QRY A;  2DMN A;  1XS9 A;  2QCO A;  1JUS A;  2E1O A;  1GV5 A;  3B6A A;  1ETO A;  3JRB A;  2R92 J;  2FJ1 A;  1MH4 A;  3JRE A;  5M3M J;  4D5C A;  2EZK A;  4FCY A;  2IBD A;  2LVS A;  2FQ4 A;  1FTT A;  1MNM C;  3JRA A;  2VKE A;  1ENH A;  4A3I J;  2LD5 A;  1ZTR A;  2W48 A;  3BR1 A;  3HOZ J;  2EZL A;  3LSJ A;  1FIA A;  2XSD C;  3LOC A;  1BJZ A;  3MKL A;  1Y1W J;  3FK7 A;  3LSR A;  3S1M J;  4M3D A;  3BR6 A;  2DA2 A;  5M5W J;  2L7M P;  3IH3 A;  3QPS A;  1T56 A;  2CUF A;  5FLM J;  3Q0U A;  3Q0W A;  2HOS A;  2ID3 A;  1JGG A;  3BR2 A;  1JKR C;  2HDD A;  1IDY A;  5F0F A;  2R5Z B;  2K9Q A;  2DA7 A;  2JA5 J;  2X6O A;  2XPU A;  1IG7 A;  2L7Z A;  2M2E A;  2N8G A;  4UUS A;  2MG4 A;  5DTD A;  2YU9 J;  3RZO J;  2JN6 A;  5GPC A;  1BL0 A;  4BY7 J;  2HXO A;  3SFI A;  1WGX A;  4IHW A;  3S15 J;  3PO2 J;  3ZQL A;  3GTO J;  3OIO A;  1QVU A;  4V2F A;  1JJ6 C;  2NVT J;  1K83 J;  2CQX A;  2K9S A;  1W0U A;  5IOY A;  5EGO A;  1GVD A;  4EEF G;  3E7L A;  2CQQ A;  1TWC J;  1ZR4 A;  5J3L A;  2LFB A;  3BG9 A;  2Y31 A;  3K7A J;  4BBR J;  2Y0S N;  5F0H A;  2E2J J;  3S17 J;  2X48 A;  4QSH A;  1DU0 A;  1RR7 A;  2EBI A;  1LFB A;  1B72 B;  1EF4 A;  3IH4 A;  3HGY A;  2DA1 A;  2H8R A;  4B3A A;  1X58 A;  4MIM A;  3SDG A;  4I76 A;  5FKM A;  3CMY A;  1GV2 A;  3ZQI A;  2O9L A;  1ETX A;  5FKK A;  3GTJ J;  1Q1V A;  2M8G X;  1HDD C;  3GTK J;  1O4X A;  2DA4 A;  1NK3 P;  4RBO A;  2K40 A;  2G0E A;  5C44 J;  2XPV A;  2LLK A;  2R7Z J;  3SJM A;  3G1O A;  3H0G J;  2HYJ A;  1RPW A;  4HNV A;  2R5Z A;  2QF7 A;  2AO9 A;  1JTX A;  4MFD A;  2EZH A;  3LSG A;  4IHX A;  2O7O A;  1UHS A;  2DJN A;  4S0H B;  4MFE A;  2GBY A;  1IV6 A;  4J19 A;  3CQZ J;  3I4M J;  2R5Y B;  5FLV A;  4D7N A;  4QTR A;  3IH2 A;  1TWF J;  1IDZ A;  3GBG A;  4GFB A;  1MBJ A;  2DN0 A;  4ABZ A;  1DU6 A;  3HOX J;  2E19 A;  1HCR A;  5JLX A;  2GLO A;  4X6A J;  5EZH A;  1FJL A;  3HEF A;  4A3K J;  1MBE A;  3OSF A;  1IC8 A;  4JX5 A;  3H3V K;  5FKL A;  3NAU A;  3GTM J;  1TWH J;  3C2B A;  5DS9 A;  3JR9 A;  5HOD A;  5F0C A;  3HM5 A;  4V2G A;  2VKV A;  3BT9 A;  1HOM A;  1I50 J;  5EGO B;  1APL C;  3GTP J;  2Y9Z A;  2LY9 A;  2OF7 A;  1MBF A;  1JT6 A;  5F1J A;  4BXX J;  2TRT A;  5EEA A;  1D5Y A;  3BR3 A;  2ZB9 A;  1F43 A;  3A01 A;  1U78 A;  2WAQ N;  2B63 J;  4UUS B;  4C2M J;  2DA6 A;  2NVY J;  1WH7 A;  2L9R A;  3WHC A;  4QIW N;  1AKH B;  3LNQ A;  4AUX A;  3HOU J;  5EZG A;  1YRN B;  1AHD P;  1HF0 A;  1YRN A;  3WHB A;  4IHY A;  2NS7 A;  3Q0V A;  3RKQ A;  2XPW A;  1ZKG A;  1SAN A;  3VPR A;  3GTQ J;  3HBL A;  1AU7 A;  5E3N A;  1T33 A;  3JRC A;  3FIW A;  5EF6 A;  2D5V A;  1OJL A;  2NVX J;  4DZJ A;  1XG1 A;  1A6I A;  3JRI A;  2R5Y A;  1I6H J;  4NDL A;  2FD5 A;  3IV5 A;  2VUM J;  2LP0 A;  2M9H A;  5FJ8 J;  3BTC A;  3JRG A;  1B8I A;  3W6V A;  2OPT A;  3K2A A;  2DTZ A;  1MBH A;  2O8K A;  5K7H A;  2XRL A;  4DYC A;  5F08 A;  1MBK A;  2ELK A;  1JUP A;  2IEK A;  4AC0 A;  1IJW C;  2ME6 A;  5EYR A;  1U9N A;  3HB9 A;  2CUE A;  2K9N A;  5C3E J;  1OFC X;  3G1L A;  4DYQ A;  4C3I J;  4JP0 A;  3LSP A;  1FIP A;  3BQZ A;  1UG2 A;  2L0K A;  3BG3 A;  1JKO C;  1B8I B;  1RKW A;  4CYC A;  2R93 J;  3PO3 J;  2RAE A;  3GTL J;  2DMP A;  2I10 A;  1BW6 A;  3ZOB A;  1ETK A;  1H89 C;  1VI0 A;  3BQY A;  5FKO A;  1R9T J;  3FK6 A;  1B72 A;  3JRH A;  3ZQC A;  4A69 C;  3A02 A;  2MGQ A;  1VF9 A;  3HOW J;  5EG0 B;  1HDP A;  2XB5 A;  2GM4 A;  1RES A;  4M6V A;  1Z0X A;  3O8H A;  1JKQ C;  2Y9Y A;  1X2M A;  1ETV A;  4W97 A;  3D1N I;  4BBS J;  1ZQ3 P;  5K7F A;  2IAI A;  3JRF A;  1PUF B;  2JA6 J;  2JA8 J;  3A03 A;  4JX4 A;  1ETQ A;  2EZI A;  1E3O C;  5F04 A;  2ID6 A;  3GTG J;  3S16 J;  4BKX A;  9ANT A;  2HOT A;  2DMU A;  5J1R A;  5F27 A;  1ORK A;  1ETY A;  4C3J J;  5E3M A;  1I3Q J;  1BA5 A;  4RDU A;  2Y2Z A;  5M5Y J;  1NK2 P;  2MSY A;  1H8A C;  4FE4 A;  1POG A;  3G1M A;  1TWG J;  3UKG A;  4XID A;  1U8B A;  3ZQH A;  2NOG A;  1NTC A;  2JMW A;  1MSF C;  5M5X J;  4M3G A;  1FEX A;  3Q3S A;  3RQI A;  1P7J A;  3A01 B;  5GPA A;  1W0T A;  5IOZ A; 
#chains in the Genus database with same CATH topology
 1R49 A;  5LEK A;  3CO6 C;  1R5G A;  2HI3 A;  4MTE A;  1S72 I;  3CDH A;  4BDY A;  5BS6 A;  3E6B A;  4M3E A;  2V1U A;  1WVR A;  4D5F A;  2O6G E;  1ZR2 A;  1L0O C;  4UB8 C;  2GIV A;  2COB A;  5AON A;  2B7E A;  4LG3 A;  2AHQ A;  2ZFU A;  1YW7 A;  2ZME C;  5A2Q Z;  2GOX B;  1VQ8 I;  2R7X A;  3FKI J;  3E6C C;  1FZP B;  1JI8 A;  2X85 A;  1FOY A;  1D3Y A;  3I64 A;  4N4N B;  2K02 A;  5E20 A;  3CD6 I;  3BR5 A;  3OYG A;  1I6X A;  3HGG A;  4BJ5 C;  4HST A;  1FTZ A;  1ITY A;  2L9V A;  3IL2 A;  2CJJ A;  5H6R A;  4TV7 A;  1FBS A;  3VOD A;  1UMQ A;  1FBQ A;  1QZZ A;  4ENM A;  5E8I A;  2E1C A;  1IN7 A;  3C3W A;  1ZK8 A;  4B1R A;  1VQK I;  3LFU A;  5M3F J;  5LFA A;  2JJ7 A;  3U1D A;  2V4J C;  1BI0 A;  4L9T A;  4ZZL A;  3B6C A;  4MLO A;  1XCB A;  4A3J J;  1CQT A;  2J5P A;  3HOV J;  5LEJ A;  4R8H A;  2ZO4 A;  4WXC A;  1Z77 A;  3E3V A;  5L3C A;  2E2I J;  2CRG A;  3A0H C;  3KLO A;  3QQA A;  5HLG A;  4I01 A;  1YQA A;  4BHP A;  1JTY A;  2K3F A;  2Q1Z B;  3FIS A;  4JK1 X;  3MN2 A;  2EJR A;  4AD9 A;  4XLP F;  3A2K A;  2JT1 A;  4DZP A;  3OS0 A;  4IEJ A;  2Y30 A;  3TKY A;  2LY1 A;  2UV1 A;  2R3S A;  4IO9 F;  2KMU A;  1K61 A;  2DT5 A;  1SVL A;  3S3N A;  1RIO H;  3HKZ N;  3ESW B;  1LDD A;  3J81 Z;  2IT0 A;  3KYL A;  3WOD F;  3KP4 A;  2X9D A;  1VQ7 I;  4EV0 A;  2L9S A;  2KDZ A;  3V7C A;  5ICF A;  2DJI A;  4AIK A;  3V7R A;  2OV7 A;  2JK3 A;  4P1W A;  4XOT A;  4WXH A;  2GZW A;  4PGH A;  2VJ4 A;  1IZ1 A;  3FXJ A;  2L7F P;  1T38 A;  3H92 A;  3S2H J;  1XC5 A;  1S8N A;  1B9M A;  4YFN F;  2VPR A;  5E18 F;  4KIC A;  4E7J A;  3GFI A;  2W24 A;  2Q2E A;  2RDP A;  3O8G A;  3GW2 A;  4BY1 J;  2FRH A;  4ZYD A;  2DAO A;  3U1K A;  3BDD A;  3LMM A;  2B0L A;  3BTI A;  4KFC A;  2PMU A;  3LA7 A;  4MEY F;  1MBG A;  3GEZ A;  3KP5 A;  2D45 A;  3T8T A;  1QGP A;  3HRM A;  5KCM A;  4HV6 A;  4FTH A;  1C0W A;  4XRS A;  2OQG A;  1ULY A;  4M3B A;  2WV1 A;  4IVN A;  1X2N A;  1K78 B;  3S1Q J;  2H1K A;  4I6Z A;  2R7V A;  3PNT A;  1GT0 C;  2X4H A;  1A36 A;  3F0C A;  5IYC J;  3GUD A;  1K6O A;  2YPR A;  3IKV A;  4A3D J;  1G2H A;  1IN8 A;  1SFO J;  5B66 C;  3J7A O;  3DEW A;  5C4J J;  2DDA A;  1BI2 A;  2EFO A;  4M6Y A;  4HBL A;  5J1Y A;  4G12 A;  3OYJ A;  5E17 F;  3OYB A;  1W7P D;  4MEX F;  3Q9V A;  2RN7 A;  4A2U A;  2HVS A;  4UUT A;  2XGC A;  3MVP A;  4KT5 C;  3J80 K;  2ISY A;  4HG2 A;  1MMS A;  2QQA A;  1QRY A;  2V1N A;  4CCJ A;  3EQL F;  1JUS A;  3RTR A;  2YX7 A;  3W6K B;  3RPU D;  3H5A A;  2E1O A;  5CJ9 A;  3HJE A;  3D5L A;  2ISZ A;  1IRF A;  4KIS A;  1GVJ A;  2A05 A;  3JRB A;  5FFZ A;  2FJ1 A;  3JTH A;  3JRE A;  5M3M J;  4D5C A;  2X51 A;  2IBD A;  3NWT A;  4YIR X;  4HV5 A;  1BI1 A;  2FQ4 A;  2GIZ A;  3O2P E;  4XLH A;  1RUN A;  1ON2 A;  4LIU A;  4BE1 A;  4PJL A;  3LSJ A;  1FIA A;  2PMZ A;  3I56 I;  2VT2 A;  3I53 A;  3S1M J;  3N97 A;  1XGN A;  4FX4 A;  3ECO A;  2ZJP F;  2QKM B;  2EK5 A;  3W2W A;  4U7D A;  4ZH4 F;  1YG2 A;  4XBF A;  1UAA A;  2DQR A;  3KZZ A;  5H2F C;  1QU3 A;  1LFP A;  2ID3 A;  1I3A A;  3BR2 A;  2HDD A;  1IDY A;  3I9V 2;  2R5Z B;  2K9Q A;  3L00 A;  3E0J B;  2L9N A;  1HKT A;  2X6O A;  1KQ8 A;  3DV8 A;  2L7Z A;  3LAJ A;  2M2E A;  2MG4 A;  3F8C A;  1YW9 A;  5GPC A;  2ZME A;  5D8L B;  3QAH A;  3RKW A;  5IY5 H;  1PJR A;  3HZJ A;  3OYI A;  3ZQL A;  2HZT A;  4O5V A;  1SFU A;  1QVU A;  4IRI A;  2RNJ A;  1B6A A;  2K9S A;  2D2W A;  2KP6 A;  2LRD A;  4AVP A;  1RI7 A;  5IOY A;  3V8L A;  3OIP A;  1HSJ A;  3I59 B;  1TWC J;  4NC6 A;  5J3L A;  4BBR J;  2E2J J;  2E60 A;  3FHN A;  3CC4 I;  3VB2 A;  2IRF G;  2X48 A;  2HGC A;  1P9Q C;  3VDX A;  2XRN A;  2B9S A;  2H6B A;  2KZV A;  1LFB A;  2XC7 A;  2W84 A;  3F3X A;  3OOP A;  6PAX A;  3IH4 A;  2HYG D;  2XV4 S;  3C7J A;  3HGY A;  2XAH A;  2H8R A;  1D1C A;  2QBY A;  1X58 A;  4MGR A;  4I76 A;  2NVU B;  3ZQI A;  2ZXH A;  1BR2 A;  2F48 A;  4U0V A;  3BJA A;  4ZZD A;  2H27 A;  3GZ6 A;  2AXL A;  1IN4 A;  1ZYR F;  4G94 A;  4LB5 A;  2ZME B;  3P9K A;  1WQ2 A;  2GXG A;  4RAZ A;  2VJJ A;  5FFX A;  1YI2 I;  1O4X A;  2DA4 A;  1SEU A;  1NK3 P;  2NAZ A;  1Z1D A;  2G0E A;  5C44 J;  1S5L C;  1S3J A;  3HYI A;  1UST A;  3VYT B;  3SJM A;  3ZPL A;  2CH0 A;  2HYJ A;  4HNV A;  1Y8Q B;  1FX7 A;  5L3E A;  4A0Y A;  3MKW B;  1OR7 C;  3M8F A;  4L9V A;  2A61 A;  3CUQ A;  1X3U A;  4MFD A;  4RB2 C;  2L54 A;  2LBF A;  1XD7 A;  5K5R A;  2BGC A;  3T8R A;  2KZG A;  2DJN A;  3HHG A;  5ED4 A;  1ZRC A;  3WTY C;  1DQU A;  1NG6 A;  3VYU B;  3HIF A;  4ZDO A;  2JUG A;  1TWF J;  1Z91 A;  2QBY B;  1MBJ A;  4ABZ A;  4ENK A;  3SEZ A;  5JLX A;  1U6G A;  1J09 A;  3TO7 A;  1FYM A;  4HAM A;  1SAX A;  1R1T A;  4EAT A;  4HYE A;  3H3V K;  5EEH A;  3ZCO A;  4M9X A;  3FXQ A;  3NAU A;  2FXA A;  1FYK A;  1TWH J;  2WAF A;  2JRT A;  5HOD A;  2NNY A;  1PUE E;  2L01 A;  3IKT A;  3HM5 A;  2EIM H;  4V2G A;  3OYL A;  5CVJ A;  2VKV A;  1HOM A;  5EGO B;  3MFK A;  2YU3 A;  3BC8 A;  3CCQ I;  1DDN A;  1G3Y A;  2ZNY A;  2JQ7 A;  5ILS A;  4BAY A;  1FPQ A;  4LIT A;  2OQR A;  4BXX J;  1V55 H;  3BR3 A;  2FUG 2;  3QU3 A;  1KYZ A;  1U8R A;  5FLX Z;  1F9N A;  2WAQ N;  4CCL A;  2D1V A;  4CCK A;  2ZSH B;  1XSX A;  3TQN A;  2VIX A;  4G7O F;  2Y69 H;  5BPD A;  3GCM A;  4C2M J;  2PN6 A;  2NVY J;  1SFK A;  1WH7 A;  4HNU A;  4C2U A;  4IKF A;  3IRR A;  4AUX A;  5A2Q K;  2CUZ A;  3EUK L;  1AHD P;  2MC4 A;  3WHB A;  3P7N A;  5KHD A;  2XPW A;  1MMG A;  1ZRD A;  2PJR B;  2LH9 A;  3HBL A;  3GTQ J;  4KMF A;  4G7Z F;  3RSN A;  3BG6 A;  3PSI A;  3DBH B;  2BW3 A;  2Y0S A;  1K78 A;  2V1D A;  5CVV A;  1D1A A;  2JVG A;  3G73 A;  4OIP F;  3RDI A;  2D5V A;  3QYF A;  2L5Q A;  1I5Z A;  4WK8 F;  3JRI A;  2HVR A;  4NDL A;  3H36 A;  4IF4 A;  2FD5 A;  4M71 A;  3IV5 A;  5B1B H;  4P55 A;  2M9H A;  5FJ8 J;  3BTC A;  2DU9 A;  2Z1D A;  4GGG A;  4Q47 A;  4Q48 A;  3CP2 A;  4RGX A;  3L7W A;  4NB5 A;  2VBY A;  4ESF A;  2XKO A;  5DEQ A;  5K7H A;  3P9I A;  1WJB A;  3VEP A;  4DYC A;  3OR1 C;  2ELK A;  5F08 A;  1JUP A;  2XF5 A;  3A0B C;  1YW8 A;  5EYR A;  1ZHF A;  1IXR C;  3H0D A;  2LF8 A;  4PSW A;  2P8T A;  2CUE A;  2K9N A;  3CJR B;  4LLN A;  4C3I J;  3LSP A;  4LK1 F;  1N78 A;  1J0R A;  3S2W A;  3TMO A;  4P96 A;  1Z3Y A;  2I10 A;  1XSV A;  2DT6 A;  1ETK A;  4HX4 A;  5TRD A;  1D8J A;  3ABT A;  4G6D A;  2VQL A;  4OWR B;  2MGQ A;  2FOW A;  4OU0 A;  3FXL A;  1TNT A;  3H9J A;  4BEH B;  3DLA A;  5HDK A;  3CES A;  2A6T A;  3O6B B;  3FKJ A;  4ZYG A;  2X0L A;  4W97 A;  1ZGJ A;  2MBF A;  3CJT B;  1BI3 A;  1W7P B;  1SAU A;  3KEY A;  3SFZ A;  2MLG A;  1XSD A;  3KP3 A;  2F5D A;  2IAI A;  3V8K A;  1LVA A;  2F4M B;  3FMQ A;  3KLN A;  2VT3 A;  3JRF A;  2X1E A;  3A03 A;  4JX4 A;  2KIM A;  1E3O C;  2X1C A;  2FML A;  4BQQ A;  2R7U A;  3F8N A;  3KZY A;  3GTG J;  9ANT A;  2W57 A;  5LGT A;  3WTT C;  4B8X A;  4ON0 A;  2QQB A;  2K27 A;  1FYL A;  4C3J J;  3CME I;  5E3M A;  2O0Y A;  2PJR A;  1I3Q J;  3MKZ A;  5M5Y J;  4II3 A;  4II2 A;  3VSL A;  4CA0 A;  5KAF C;  4FE4 A;  1H9G A;  5D5X B;  3J7Z I;  3V4G A;  1HXD A;  2M4K A;  2EV0 A;  5K1Y A;  2OJE D;  4BJ6 C;  1A35 A;  2ELJ A;  3QOD A;  2HR3 A;  1ONV A;  3PFI A;  1FT9 A;  1BC7 C;  2V26 A;  1P7J A;  3A01 B;  4HLY A;  3ML6 A;  1ZGW A;  1S6L A;  2JZY A;  2P0W A;  3TOB A;  2JPB A;  2DA3 A;  2GOM A;  2IXS A;  1SD5 A;  2LKX A;  4XLC A;  1OCO H;  1MIJ A;  2CU7 A;  4LOC A;  2NVQ J;  4C3H J;  4A3B J;  2DQL A;  5GTH C;  4K2E A;  2R7Q A;  4HQM A;  4DW6 A;  2NXN B;  3BJ6 A;  3RZD J;  4LLL A;  1A31 A;  1QHH D;  4IQJ A;  1JT0 A;  5GP9 A;  2VJ5 A;  1KU9 A;  4UV8 A;  2VJI A;  1YS6 A;  2DK8 A;  3F8B A;  5EG0 A;  1MJ9 A;  5D8K B;  4W1U A;  1GXQ A;  5JR3 A;  4L5J A;  3H5R A;  1JGS A;  1XMX A;  3R61 A;  3MKY B;  4A3L J;  2IW5 A;  3AG4 H;  1GDT A;  2CSO A;  3DBL B;  3P5J A;  4ZYH A;  1BW5 A;  3QU6 A;  4XOR A;  4CYC B;  2R7S A;  1Z7L A;  5JI6 A;  4L9N A;  2DA5 A;  2W00 A;  3SZT A;  4RGS A;  4XR6 A;  1A5J A;  3HRS A;  1T95 A;  2EA2 A;  3ZQF A;  4RGR A;  4RM3 A;  4UV9 A;  4EQQ A;  1J59 A;  2UXX A;  5FKN A;  4YG2 F;  3WE2 A;  1R4N B;  2ZXI A;  2FQ3 A;  3W2A A;  1RKT A;  4HSR A;  1WZ2 A;  4A93 J;  1H88 C;  5HDG A;  2XAU A;  4CCN A;  1LDK B;  2E36 A;  1QPM A;  1KQ0 A;  3M8J A;  4WX9 A;  5BPI A;  2CV0 A;  3IWF A;  1E2X A;  3DCF A;  1LFU P;  4FQG A;  3SYT A;  1QPI A;  4XIC A;  3HDD A;  5ICG A;  1STZ A;  3F8M A;  3ZQG A;  3BRO A;  3E97 A;  2NS8 A;  1IUF A;  3G71 I;  2KT0 A;  3M7G A;  1VFC A;  1YIO A;  3GVA A;  3VFZ A;  2CV2 A;  2J5O A;  1IAW A;  3K4L A;  1DP7 P;  2RC4 A;  2VN2 A;  4A6D A;  2M0C A;  1S9H A;  4BAC A;  1LE8 A;  3M07 A;  4H4K C;  5CKT A;  1ZG5 A;  1VND A;  4I09 A;  2VAS A;  4I99 C;  3CC7 I;  4DNC A;  2IA0 A;  1K7A A;  4GO1 A;  1TLH B;  2K3P A;  3RKX A;  3K9T A;  2R0Q C;  3I4N J;  2LRE A;  3F6O A;  3K0L A;  1FC3 A;  2EV5 A;  1G3W A;  4M73 A;  5K7Z A;  1OCP A;  1EV7 A;  3TED A;  3I71 A;  2QEX I;  3KET A;  2CQ7 A;  2QLZ A;  1RZ4 A;  1WJF A;  3CCY A;  5IP6 A;  1IRZ A;  1GUU A;  2WB1 A;  4L5E A;  2LK2 A;  3BZC A;  5DCF A;  4OIQ F;  2LNB A;  3K4K A;  4YFX F;  4JYK A;  3K1M A;  2VXZ A;  1PUF A;  1ON1 A;  3S2D J;  1BR4 A;  1W7P A;  3M4O J;  2E7W A;  3KP2 A;  2W1O A;  4AID A;  2QM3 A;  3OSG A;  1UG0 A;  3MQ0 A;  1U9O A;  2IGK A;  3TBI A;  4KIG A;  1P7I A;  2CV1 A;  3HUG B;  4Q4Z F;  3OV8 A;  2HS5 A;  2VQH A;  2ESH A;  1R00 A;  1TBX A;  1P4X A;  5CQG A;  2JA7 J;  1I27 A;  2A69 F;  2XKP A;  2OAZ A;  4XRS G;  4U0W A;  3TO9 A;  3DF8 A;  4E7K A;  1HKQ A;  3Q5F A;  3NAR A;  3F22 A;  4I0B A;  3L2V A;  4QLC U;  3OY9 A;  2A5Y B;  2ZFW A;  2FE3 A;  2M34 A;  2H6C A;  1WI3 A;  1O3S A;  3RIR A;  2LC2 A;  2GQQ A;  2KL4 A;  4ESJ A;  1VQM I;  3FBI B;  5FRM A;  3LQR A;  1F4K A;  3PL8 A;  2P6S A;  1Y39 A;  3CJQ B;  4RGU A;  3G2B A;  2EZK A;  1WSU A;  2LVS A;  4OAY A;  1GXP A;  2BY2 A;  1S7A A;  1H0M A;  3OL3 A;  2RV8 A;  3JCU C;  1MNM C;  3DPL C;  3JRA A;  4MNU A;  3LSK A;  4J00 A;  4CGZ A;  1EJ9 A;  1ZTR A;  2DFE A;  2V7F A;  3H35 A;  3GO5 A;  2O5R A;  1P2F A;  1TZL A;  2HZD A;  2EZL A;  5F6F A;  1XN7 A;  5E1Z B;  4EJO A;  3VOE A;  4JOM A;  4ZYE A;  3LSR A;  2P4W A;  3HTS B;  4M3D A;  4OIR F;  4IOC F;  4E7I A;  2DA2 A;  4EJV A;  5M5W J;  2JTV A;  1YJ9 I;  4XRF A;  3K69 A;  2BW3 B;  3QPS A;  4ENJ A;  2NRA C;  4EGZ A;  2XAS A;  2KRC A;  3F72 A;  5F64 A;  2ACJ A;  1JGG A;  3CLQ A;  5F0F A;  4L0Y B;  3DFG A;  5EEG A;  2IS6 A;  4BL0 B;  2V9P A;  3QYB A;  3C1D A;  1Y0U A;  1MND A;  5E1W A;  3GWZ A;  5JHF A;  2NNN A;  4HF0 A;  4HNT A;  2JA5 J;  1RRJ A;  2UWM A;  2M0M A;  2XPU A;  3R6S A;  5TGT A;  1R7J A;  1IRX A;  2N8G A;  2E1N A;  4UUS A;  3FXU A;  2YU9 J;  3DTE A;  3IC7 A;  1X1B A;  1MJB A;  2JN6 A;  1TW3 A;  1BL0 A;  4BY7 J;  4LG0 A;  3OYN A;  2O8X A;  2HDW A;  2HXO A;  2GXA A;  4L18 B;  2QSH X;  3S15 J;  1XX5 A;  3PO2 J;  5J47 A;  3AKZ A;  5GAE J;  4UUV A;  4F52 A;  4Y33 A;  4YFK F;  5AIP A;  2KIS A;  5FB2 A;  1W0U A;  1VQ5 I;  2KLO A;  5J8F A;  4EJT A;  2KQR A;  3HRU A;  2CQQ A;  4EM0 B;  2JSC A;  1MDM A;  3RKY A;  4MQ9 F;  2M45 A;  4RS8 A;  4D1Q A;  1RR7 A;  5HOO A;  1IN5 A;  2XGX A;  4ZYA A;  2W4S A;  1WJA A;  1XGS A;  2TDX A;  4HOB A;  3GYH X;  1EF4 A;  2WAQ A;  1IF1 A;  2E1M C;  2CS3 A;  4PDK A;  1V3F A;  4BYY A;  4DIQ A;  3ULQ B;  1OKR A;  2W85 A;  3CMY A;  2GA2 A;  4XN3 A;  2WY8 Q;  2LOO A;  2MD0 A;  4FAS D;  4RAY A;  3GTJ J;  5D4R A;  2QSG X;  3ZP5 A;  3GTK J;  5HVQ C;  2JRM A;  3FBN B;  4RBO A;  3J7A Y;  1W5C C;  2K40 A;  2E35 A;  2XPV A;  3GXO A;  3I3L A;  3H1C A;  2VXD A;  4KIB A;  2BV6 A;  3VYS B;  2ZJR F;  2OUM A;  2MH9 A;  1LNW A;  1JTX A;  2BVL A;  2EZH A;  2Z5U A;  4XMY A;  4S05 A;  3I54 A;  2O7O A;  3CP8 A;  4IPA A;  1W4M A;  4S0H B;  3MZY A;  1REP C;  4MFE A;  1IV6 A;  1U5T A;  3CMA I;  4CSW A;  1KYW A;  2WTE A;  1DPU A;  4DQ2 A;  4HLX A;  3I4M J;  2M7A A;  3FMS A;  3GZN B;  3ZQ7 A;  5FLV A;  3DQV C;  4XNF A;  4D7N A;  3IH2 A;  5DV5 A;  1E3H A;  3LQQ A;  3ZMS A;  2MD5 A;  2DN0 A;  2XHK A;  1DU6 A;  2GA1 A;  5HS9 A;  2YR2 A;  1HCR A;  4BDZ A;  2GLO A;  2BXZ A;  4X6A J;  5EZH A;  3HEF A;  4L0Z B;  1MBE A;  4RB1 A;  2AS5 F;  4ZDP A;  3GTM J;  3JR9 A;  4N4O B;  1X3W B;  2Q0O A;  2EWN A;  2H09 A;  5E1X A;  5F0C A;  1G8X A;  1I50 J;  2FBH A;  3R0J A;  4M6X A;  4Y4R A;  3CCU I;  4F93 B;  4BH9 A;  2Y9Z A;  2TRT A;  4CCM A;  2ZB9 A;  1FWZ A;  4RMN A;  1DPR A;  2QWW A;  2YSR A;  1JHF A;  3NQO A;  3UNG C;  4U7B A;  2P7C B;  3PJR A;  4DJA A;  1K79 A;  2DFF A;  3BZ6 A;  4Y17 A;  1G4D A;  2KJB A;  1TQI A;  1U5T C;  5LGN A;  3OYH A;  4MTD A;  2P7V B;  3WHC A;  3CUQ B;  4HX7 A;  3HOU J;  1Y6I A;  1YRN B;  5KNL A;  4IHY A;  2CQK A;  4A6E A;  1FMW A;  1SAN A;  1BN5 A;  3LL7 A;  1T33 A;  3QPT A;  5B5E C;  3LA2 A;  1MMN A;  2MYS A;  3GF2 A;  4PFP A;  5LBQ A;  4B43 A;  4X0G A;  2STW A;  1AOY A;  4IXA A;  3WE3 A;  1MMD A;  1TNS A;  3VWB A;  4N9H A;  3CCR I;  2V9K A;  5DUK A;  3L2C A;  1XG1 A;  1A6I A;  3B02 A;  2OTL I;  5B1A H;  5HNF A;  1OMI A;  5IT9 K;  3BJO A;  2A3S A;  3S3O A;  2KRH A;  3QOE A;  4A5N A;  1MZB A;  2KKO A;  1ZLK A;  4CO8 A;  3ZMD A;  1O3T A;  1L3L A;  3K2A A;  4XKC A;  1O3R A;  2XRL A;  3W3C A;  1TL8 A;  1MBK A;  2W82 A;  4E70 A;  2A5W A;  2DOA A;  2DCE A;  2HWV A;  3LAP A;  3CCV I;  1ZAR A;  4G9Y A;  2BY1 A;  1Z05 A;  1R5I D;  1T39 A;  2DOE A;  4DYQ A;  3DEE A;  1UZC A;  3TOA A;  4QPQ A;  2UXN A;  2L7K A;  1FIP A;  2L0K A;  5HDN A;  3ABU A;  4M9Z A;  3PO3 J;  2K4J A;  3RPU A;  1WKM A;  3HPG A;  4PZJ A;  4BGD A;  2H8W A;  2ADU A;  2PBI A;  3MZ8 A;  1BOB A;  3JRH A;  4IX7 A;  2EIK H;  4EM2 A;  4IZZ A;  1VF9 A;  1HDP A;  2DOD A;  2F5F A;  2QVO A;  5BQT A;  1NH3 A;  3JAM Z;  2IGO A;  1HW5 A;  3O8H A;  1JKQ C;  1PDN C;  4ZDL A;  3OS1 A;  3L2Q A;  3M1C A;  1X2M A;  3WGH A;  5FRO A;  1SFX A;  3K10 A;  5HLH A;  1FP2 A;  1EH7 A;  1QQI A;  1DGR M;  1UJ8 A;  1N25 A;  3J7Y J;  2Z33 A;  4OMZ A;  2BY0 A;  4E7H A;  3BPX A;  1LQ1 A;  2JA6 J;  5JVT A;  1B9N A;  1V5E A;  3PUB A;  2JA8 J;  3ZMV A;  2EZI A;  1K4S A;  3IWZ A;  4CZZ A;  2EFN A;  3HOT A;  3ABL H;  2JA2 A;  2CGP A;  2DO7 A;  1OLT A;  1ORK A;  1R5H A;  5L3G A;  5FRN A;  4QWQ A;  1SMY F;  1ZRE A;  2XIG A;  2Y2Z A;  2MSY A;  2XAF A;  4AWX B;  5JVG F;  5DM6 F;  1TQM A;  2EIL H;  3ZN0 A;  3E1S A;  3CCJ I;  2LSO A;  1D1B A;  1H8A C;  1POG A;  1XCV A;  4BE0 A;  1U8B A;  3ZQH A;  5ILV A;  2L4M A;  2O03 A;  3ELK A;  2Y48 A;  1ZEL A;  1V4R A;  4ENN A;  1YFH A;  3Q3S A;  2R7T A;  3QPH A;  1FP1 D;  1A04 A;  4H0E A;  2QUF A;  1A6Q A;  3HXL A;  1W0T A;  4UVB A;  2DMT A;  4KA4 A;  3FHZ A;  3QPL A;  1X19 A;  4LG0 B;  1ETW A;  2PMZ N;  4Q5S F;  1OCR H;  3WTZ A;  4YEL A;  1S7E A;  3AG1 H;  5D6E A;  1V54 H;  2E5Z A;  2FX0 A;  2XB0 X;  2OTJ I;  4XOP A;  2EIJ H;  4JQF A;  4JX6 A;  4FE7 A;  5GAH J;  4BQN A;  4ANJ A;  1X1D A;  4A5M A;  1IW7 F;  2LTP A;  3BOQ A;  3IAM 2;  2LYC A;  1HQC A;  3BP8 A;  5FGM A;  1LUJ B;  4OIN F;  2CW7 A;  4YRV A;  4HQE A;  2PI0 A;  2JPC A;  5FD5 A;  2K9L A;  1FOX A;  1WPK A;  2HKX A;  5J40 A;  4G6Q A;  1R71 A;  3KZI C;  4FIS A;  4CDG A;  3PUF A;  4AM3 A;  1I39 A;  2VON A;  2DYR H;  4HW0 A;  2DFI A;  2F5C A;  2L3D A;  3FM3 A;  2LR8 A;  5IP9 J;  3HSF A;  1IGN A;  5TJJ A;  3ZMT A;  3PM1 A;  2OZ6 A;  2WA0 A;  1VTN C;  2P5V A;  4UVC A;  4LFU A;  4QPO A;  2E2H J;  5C4X J;  1M1E B;  3PQJ A;  3QWL A;  3S14 J;  2E7X A;  2DXI A;  3CLO A;  3QYE A;  1T08 B;  2PLY A;  2YUS A;  1V5G A;  5IOZ A;  4XQF A;  3V7S A;  3BR0 A;  2GXB A;  3M3Y J;  4WF2 A;  1QZE A;  4U88 A;  1JUM A;  1AA7 A;  3RYR A;  3OL4 A;  4A3E J;  3M9A A;  3RPQ A;  1IXS B;  2VBZ A;  2QYO A;  3BCB A;  1BM9 A;  5HS7 A;  2ME0 A;  3OYF A;  4A3C J;  2ZKZ A;  1WH5 A;  1OPC A;  2XGD A;  4RAG A;  5HLT A;  4Z6Y A;  3J81 K;  3K6G A;  3TP0 A;  1MSE C;  2VE9 A;  1I1S A;  2RGV A;  2HPM A;  4BHC A;  5JHU A;  5IP7 J;  3K1N A;  2VC1 A;  2FF4 A;  1J2X A;  1J5Y A;  2IA1 A;  4PFO A;  4F3Q A;  2YS9 A;  2Y0M A;  3HKZ A;  1JKP C;  3BTJ A;  3E6M A;  4D7M A;  3ZXS A;  3F23 A;  3TP3 A;  3W6J B;  2V79 A;  3BY6 A;  1RET A;  2HXI A;  4LJZ F;  1JJ8 C;  1CGP A;  3PNY A;  1LE8 B;  1FY7 A;  2XGE A;  2P5L C;  3JRD A;  3DU6 A;  3OYC A;  1JHH A;  1YX3 A;  2HNH A;  1KON A;  4Y7N J;  3COA C;  2MLK A;  4UVA A;  2VKH A;  3IHU A;  5L3F A;  2CMP A;  3K4N A;  1WWX A;  2MA3 A;  2HTS A;  3FXO A;  1YYV A;  3R4K A;  5E3L A;  5IPA A;  2FMY A;  4YEJ A;  1QO0 D;  2PEX A;  1LJ9 A;  4HDU A;  3BTL A;  3BG5 A;  1R1V A;  3ERM A;  2P81 A;  2X6W A;  4IRH A;  2GWR A;  1PVE A;  3S1R J;  2TCT A;  3WGG A;  2QZ8 A;  1SFE A;  2DPU A;  2EA4 A;  1Z9C A;  3L9F A;  3S1N J;  4M3F A;  1R4M B;  2MC3 A;  4BEH A;  2QGU A;  1YJN I;  1K6Y A;  3HOY J;  3DKW A;  2JWT A;  1XMK A;  4XL9 A;  3SZP A;  3RI4 A;  3GLL A;  5BNG A;  2JSP A;  1TWA J;  4KNY A;  4IOA F;  1JXS A;  2IGM A;  3U21 A;  4HA8 A;  3OOU A;  4CIC A;  2HYF A;  3L1P A;  2ECC A;  1MH3 A;  2KIU A;  1Y8R B;  2EQR A;  3K2Z A;  2VL8 A;  3G4S I;  2DMN A;  1XS9 A;  2OZU A;  1J75 A;  4PJM A;  2BZT A;  2G7H A;  2WBM A;  4KN4 X;  1GV5 A;  3B6A A;  1IN6 A;  1HST A;  1MH4 A;  3O3K A;  4UHT A;  4A12 A;  2NYX A;  2DK5 A;  1YOV B;  3MD2 A;  2Z2S B;  4LGW A;  2VKE A;  1ENH A;  3HTU A;  3GFJ A;  1YLF A;  2LD5 A;  1VQ9 I;  4D0P A;  3REO A;  4BNC A;  5DCM A;  3LOC A;  1BJZ A;  3MKL A;  1Y1W J;  5LHI A;  2BHY A;  2DW4 A;  3FK7 A;  1YX5 A;  1E17 A;  5CLS A;  3L2R A;  3ERE D;  2PJP A;  4I0A A;  1SD6 A;  3F9K A;  2HEO A;  4I02 A;  4KDP A;  1MD0 A;  4PCQ A;  3K4J A;  2FSW A;  3LSH A;  5DUI A;  2L7M P;  3GLX A;  1T56 A;  2M1B A;  2CUF A;  5KK1 A;  3Q0W A;  2ZXJ A;  2HOS A;  2PG4 A;  3GX4 X;  2EV6 A;  3D5R C;  1FLI A;  4ZTF A;  3WTV C;  4N0B A;  3T1B A;  2DA7 A;  4AVZ A;  3K4B A;  2PMH A;  4EMS A;  1YS7 A;  2L2O A;  1K4T A;  4XON A;  4IRG A;  3FWE A;  3KP7 A;  1BIB A;  4CZC A;  1WFX A;  1BOA A;  3PIP F;  2PQ8 A;  4PJ0 C;  3DU5 A;  2LKS A;  2F5V A;  5BMZ A;  2MH2 A;  2PFB A;  3W2V A;  3ZRG A;  2EPF A;  2EFW A;  2VB6 A;  3SFI A;  1WGX A;  3ZGK A;  2BEO A;  4S04 A;  3GTO J;  3SHF A;  3LFK A;  2NVT J;  4UNO A;  5ICE A;  1GVD A;  3LSM A;  2Y75 A;  4XLN F;  5LLQ A;  1ZR4 A;  5F0H A;  3BG9 A;  2Y31 A;  2C6Y A;  4O3M A;  2DYS H;  2Y0S N;  4XLF A;  5K5Q A;  1MDM B;  3JSO A;  4QSH A;  2A6E F;  1VQ4 I;  2EBI A;  1NG7 A;  5FO5 A;  2QKL B;  2XUB A;  4KT6 A;  5E79 C;  3I59 A;  2FEZ A;  3AG3 H;  5CVU A;  5FLX K;  5DD4 A;  1WJD A;  1V5F A;  2X6X A;  3HSE A;  2DA1 A;  4B3A A;  1PP7 U;  4GDF A;  1FMV A;  2OCC H;  1GV2 A;  3KCC A;  4IL6 C;  5L3B A;  3F6V A;  3CF5 F;  3K70 D;  2DDB A;  4EJW A;  2QQ8 A;  1Q1V A;  1HDD C;  3DP7 A;  1ACI A;  4M9S A;  3OYD A;  3T5X A;  1VQN I;  4RLQ A;  2R7Z J;  3NRV A;  3G1O A;  1RPW A;  2ZCW A;  4XSX F;  4BUP A;  5HS8 A;  3N05 A;  3OYE A;  3KYD B;  2AO9 A;  1DUX C;  2LF7 A;  4IHX A;  1B59 A;  3Q9S A;  3SQN A;  1WI9 A;  4PJN A;  4BQO A;  3D5S C;  1OCZ H;  4BXF A;  4IHT A;  2VE8 A;  4C2T A;  2GBY A;  1YIJ I;  3JW4 A;  4J19 A;  3CQZ J;  4B09 A;  4QTR A;  4Z2Y A;  3L2U A;  5TIS C;  1QZY A;  3WTU C;  1IDZ A;  2GAU A;  1QNT A;  3GBG A;  3OWT A;  1G6N A;  5LRR A;  1SVO A;  4GFB A;  2E5N A;  3HOX J;  3RQ4 A;  4IHS A;  3WU0 A;  3ZMZ A;  4A3K J;  5ERI A;  3OIQ A;  4G7H F;  2R7R A;  3RCO A;  2IS2 A;  5FKL A;  2LY2 A;  1N75 A;  1O3Q A;  3G3Z A;  4RA2 A;  3BT9 A;  1P6R A;  2AQF A;  1W36 D;  2HQN A;  2FNA A;  5DDG A;  3GTP J;  2F5E A;  2LY9 A;  4Y15 A;  1MBF A;  1JT6 A;  5F1J A;  4WWC A;  1SVM A;  5EEA A;  2V9V A;  2P5K A;  3J80 Z;  1MMA A;  1BIA A;  3DTI A;  5F1R A;  4F7Z A;  3OYK A;  3WTX C;  4RB0 A;  4GCV A;  5L3D A;  4M74 A;  1TTY A;  2FA5 A;  3SEQ A;  4UUS B;  2B63 J;  3KIO A;  2A6H F;  4QIW N;  3KE2 A;  3LNQ A;  1EA3 A;  5GAD J;  1HF0 A;  1YRN A;  3FF5 A;  3Q0V A;  1ZKG A;  4C9Y A;  1AU7 A;  3BWG A;  3I0T A;  5D4S A;  4O6J A;  2OC6 A;  5K5O A;  3FZV A;  4E7S A;  2UUZ A;  1F5T A;  1X1P A;  4BQA A;  3FMR A;  2DTR A;  4LD5 A;  5EF6 A;  2HPI A;  3TDZ C;  3DEU A;  4NC7 A;  1OJL A;  3WG7 H;  2NVX J;  1BC8 C;  5IT9 Z;  2R5Y A;  3GZ5 A;  2Q8K A;  4DBQ A;  5CQE A;  1HW2 A;  3ABK H;  1E3P A;  2D1H A;  3PFY A;  1F1Z A;  1ZH5 A;  3ABM H;  3H9G A;  5DCM B;  2IS4 A;  3S3M A;  1B8I A;  4PGG A;  2OPT A;  3ECH A;  1W5S A;  2XAG A;  1MBH A;  1VQL I;  1OIS A;  1XGM A;  1N77 A;  2E34 A;  5D6F A;  1S29 A;  5HNH A;  1LB2 A;  4DGW B;  2IEK A;  4AC0 A;  1SD4 A;  1U9N A;  3HB9 A;  3WTS C;  2DI3 A;  2CUJ A;  2EB7 A;  4XLE A;  3WTW C;  4HF2 A;  2I8D A;  3KP6 A;  1OFC X;  2K86 A;  1MJA A;  2AQE A;  4JP0 A;  4GYI A;  1UG2 A;  3BQZ A;  3BG3 A;  3LSI A;  3TO6 A;  1RKW A;  2F4O B;  4CYC A;  4NUB A;  2R93 J;  4CYD A;  3GTL J;  2DMP A;  2G9W A;  3ZOB A;  1UCR A;  3BCA A;  3QP5 A;  2FBI A;  2CYY A;  2DBB A;  3BQY A;  5FKO A;  1OCC H;  1R9T J;  3FK6 A;  4MQV A;  1B72 A;  1R36 A;  4L9J A;  4A69 C;  3DKY A;  2STT A;  2M4G A;  2WY7 Q;  1MGT A;  2XVC A;  2ESN A;  1RES A;  4GXO A;  4KN7 X;  4M6V A;  2BHZ A;  4XLA A;  1U3E M;  2EFP A;  2Y9Y A;  5AIQ A;  3OYM A;  2G7U A;  3WGI A;  1ETV A;  2WAD A;  4EVI A;  3I58 A;  1ZQ3 P;  2WC2 A;  2H94 A;  5K7F A;  3R0A A;  2IA2 A;  1BBY A;  3H5N A;  1TQP A;  5D5U B;  2BE5 F;  3C18 A;  2MFZ A;  3FXR A;  1Y0N A;  5F04 A;  2HDC A;  4BKX A;  3G6E I;  2HOT A;  4XM3 A;  5F27 A;  3JSP A;  3FM5 A;  1BA5 A;  4RDU A;  1YHQ I;  5JFR A;  1NK2 P;  1HA8 A;  3EDP A;  1DGW Y;  2OCE A;  3VYR B;  3EPZ A;  4ETS A;  3DPT A;  3V8J A;  3S32 A;  2YX4 A;  5LD2 C;  4KUM A;  4AIH A;  1HBX G;  5ILU A;  1VQ6 I;  2XAJ A;  2VOP A;  3R60 A;  1G59 A;  2VBW A;  3A1Y A;  3MEX A;  4E4H A;  1HW1 A;  5M5X J;  2BXY A;  1FEX A;  4XN0 A;  5J4Y A;  1LDJ A;  1X3Z B;  2ZXW H;  1Z6T A;  2CFX A;  4XK4 A;  4AYB N;  4OAZ A;  3K70 C;  4EGY A;  3TW7 A;  2R4G A;  1QVT A;  3CUQ C;  4ZTJ A;  1TT5 B;  1S7O A;  2CFO A;  4NC8 A;  4R1H A;  3LA3 A;  2CQN A;  1EH6 A;  2XF6 A;  4E7L A;  1VQO I;  1LVK A;  4I2O A;  1TC3 C;  1P92 A;  2K7L A;  2HQ5 A;  4KJZ A;  2Z9O A;  1RUO A;  2RRE A;  2M30 A;  4PSX A;  3CTA A;  4KIT B;  1KA8 A;  4OIO F;  2IVM A;  5IYB J;  1U0J A;  2MAB A;  4NQW B;  1QA6 A;  4AIJ A;  2DMQ A;  2K4B A;  5J8C A;  1ERD A;  4A3F J;  2ZBK A;  2IGN A;  1W5T A;  3BPV A;  4A3M J;  3N4M A;  3SZG A;  1Z67 A;  3NWS A;  1D0Y A;  4CHU A;  1F36 A;  5ICC A;  1SC7 A;  4X1E A;  3RJP A;  1IO2 A;  5H20 A;  1HLV A;  1FSE A;  1WJE A;  1T0F C;  3U2R A;  3L2W A;  3GFM A;  2QA4 I;  2EH3 A;  5EDN A;  3H3U A;  5CPR B;  5IT3 A;  5BOX A;  3IAS 2;  4IHV A;  1XDS A;  1TP4 A;  2MW8 A;  3MAJ A;  3AL0 C;  3PQK A;  1LEB A;  3CZ6 A;  4I98 B;  5FD6 A;  2V1X A;  1H9T A;  4XRM A;  3CCL I;  4HRI A;  3E5U A;  1WJ5 A;  4P9F A;  2XRO A;  2R7D A;  2VC0 A;  3CMM A;  3ROU A;  3ZMU A;  2VBX A;  4JBA A;  4J01 A;  2ECB A;  2RQP A;  1T2K A;  1Y1V J;  2QSF X;  2HQR A;  5J4V A;  4A3G J;  4G8X A;  2HQA A;  3IRQ A;  3S93 A;  3CO7 C;  4ITV A;  2H1L A;  5J6X A;  1RC9 A;  1U2W A;  3KEO A;  5HLI A;  3FDY A;  2LMD A;  4AYB A;  1MNE A;  3HUG A;  4MO7 A;  4CUG A;  1D0X A;  5IYD J;  3CC2 I;  4Y52 J;  1UB9 A;  4ZC3 A;  2VI6 A;  2ZJ2 A;  1AKH A;  3QP6 A;  1QBJ A;  2HOA A;  1XB4 A;  2EFQ A;  1T0F A;  3CDL A;  3HRT A;  3TL4 X;  2KIF A;  2KIQ A;  1XTA A;  4B4C A;  4U0Y A;  1CF7 B;  1KGS A;  2CWE A;  2IPQ X;  2WB1 N;  1QHG A;  2BVM A;  3AG2 H;  3HOS A;  1OR7 A;  2V6E A;  3X2Q H;  3WU1 B;  1WJC A;  2Z99 A;  3EYY A;  2KDO A;  1TT0 A;  2KJC A;  2RKH A;  2F6C A;  2VPL A;  4HZF A;  4C30 A;  3I55 I;  4OOI A;  3FXM A;  3SDB A;  3TW6 A;  3S8P A;  1WCM J;  2X6Y A;  3ZQQ A;  3KX2 A;  2VLA A;  3OR2 C;  2XF7 A;  1E0E A;  5JLW A;  3HG9 A;  4RM2 A;  1BR1 A;  1YIT I;  1J7K A;  2OA4 A;  1Q1H A;  1R23 A;  1SMT A;  5J1U A;  3C2G A;  3JTG A;  3DWL E;  1OCT C;  1FBU A;  2Z3Y A;  3GFL A;  4DYR A;  3WG9 A;  3ASN H;  5E3O A;  3CDI A;  2FNP A;  4P9U A;  1UFM A;  4BE2 A;  2RVC A;  3HPH A;  1WRJ A;  2QCO A;  3ONQ A;  4GYG A;  4F91 B;  4RAF A;  2P6T A;  3P9C A;  4UY8 I;  1ETO A;  2R92 J;  4BS9 A;  3U9G A;  3EYI A;  2IJL A;  2ZNZ A;  4HPQ A;  3CCE I;  4XKV A;  4A0X A;  2LKP A;  2HU9 A;  4HF1 A;  2E1M B;  1FTT A;  1YE9 A;  2XDV A;  2K9M A;  1RNL A;  4A3I J;  2W48 A;  3BR1 A;  3PSF A;  3AL0 B;  3HOZ J;  3DKX A;  2XSD C;  3BLY A;  5LHH A;  5CYV A;  4E6K G;  2QQ9 A;  2LDU A;  5EJC A;  2R7O A;  3BR6 A;  3HSR A;  1XMA A;  3IH3 A;  1IUY A;  5FLM J;  4NHJ A;  2ZC2 A;  3Q0U A;  2LBF B;  4PUS A;  3UR3 C;  4CCO A;  2EIN H;  3EUH A;  3RYP A;  3OYA A;  1JKR C;  3IUO A;  4FHT A;  3CJN A;  3EET A;  1IV8 A;  4RB3 C;  3KYC B;  1LKX A;  2L02 A;  1B1B A;  3PIO F;  2HVQ A;  1VQP I;  1IG7 A;  1G3S A;  5DTD A;  1R22 A;  2HFH A;  4G6T B;  1YJW I;  3RZO J;  2M8E A;  1FNN A;  3H9Q A;  1HC8 A;  2M5W A;  2KPM A;  2M7B A;  4Y3O A;  3F8F A;  3MWM A;  1IRG A;  2OD5 A;  1KU3 A;  4IHW A;  3OIO A;  3CCM I;  4I7H A;  4V2F A;  3BZK A;  4B44 A;  3LST A;  1JJ6 C;  1NHA A;  1K83 J;  2CQX A;  2E71 A;  1EH8 A;  4HDV A;  3LWF A;  1W1W E;  1ZGA A;  5EGO A;  3CF2 A;  1X1C A;  4WCG A;  2NS0 A;  4EEF G;  4V19 K;  2M87 A;  3E7L A;  2LFB A;  3K7A J;  4EM1 A;  1ZG1 A;  3S17 J;  1ZN2 A;  4BHB A;  1DU0 A;  3MCZ A;  3HHH A;  1Y56 A;  2O61 A;  1WHU A;  4NBQ A;  5D5V B;  2VOO A;  1B72 B;  1OYI A;  3OMY A;  2KHM A;  2DT7 B;  2CW8 A;  4AU7 A;  4MIM A;  3SDG A;  5FKM A;  4HX8 A;  4RLF A;  2Z16 A;  2OBP A;  2O9L A;  1ETX A;  3FXK A;  5FKK A;  4NNJ A;  2W25 A;  3SXY A;  2M8G X;  1GLN A;  1J9I A;  3CUO A;  1JE8 A;  2X1D A;  1OYW A;  1PYV A;  3C2H A;  2K5C A;  2DLL A;  1UHM A;  2LLK A;  4FX0 A;  4N9I A;  4E7Z A;  1Z6R A;  3PNV A;  4A0Z A;  3H0G J;  4NQW A;  2IP2 A;  2R5Z A;  2BOL A;  3E5Q A;  2HKO A;  1B4A A;  3VSK A;  2QF7 A;  4HEA 2;  4P5O A;  2QEN A;  3IP4 B;  3KFW X;  3EUA A;  3LSG A;  4B48 A;  1OYY A;  4PK4 A;  1UHS A;  2CW0 F;  2CG4 A;  4KIF A;  2WV0 A;  2HTJ A;  1PP8 F;  1O7L A;  2HOE A;  5B3S H;  2R5Y B;  3L09 A;  1SD7 A;  4L5I A;  1KU7 A;  2O3F A;  3I4P A;  1U5T B;  4EJU A;  2CO5 A;  1R6R A;  2ETH A;  1AWC A;  1G3T A;  3DLL F;  2E19 A;  2BBY A;  4KMU X;  4XKB A;  2NOJ B;  2KRF A;  2R7W A;  1BJA A;  1FJL A;  3OSF A;  1IC8 A;  3BG7 A;  4JX5 A;  1XDU A;  5DM7 F;  2JVH A;  3C2B A;  4PJJ A;  5DS9 A;  5CVI A;  5D5W B;  3HC7 A;  4XSZ F;  5GAG J;  1HKS A;  3B73 A;  1UEL B;  2A68 F;  3K4M A;  1APL C;  1UHW A;  2OF7 A;  4GRI A;  4U87 A;  4F92 B;  1OQY A;  1D5Y A;  1DP3 A;  3E6D A;  4BXU A;  4LB6 B;  3K4C A;  3CCS I;  1F43 A;  5CVR A;  2WWY A;  3A01 A;  4LLG F;  1U78 A;  2OU2 A;  2V6C A;  5E8G A;  2ICW G;  5DD8 A;  4UB6 C;  2RQQ A;  4KYW A;  2PX9 A;  4B47 A;  2DA6 A;  2XSJ C;  2L9R A;  1D8K A;  1AKH B;  1X1A A;  1T8I A;  5EZG A;  4ZJZ A;  1Z3X A;  1Z7U A;  4ESB A;  4LIV A;  4LK0 F;  1D5V A;  2NS7 A;  1KU2 A;  4IQ4 A;  3RKQ A;  5LGU A;  3VPR A;  4CXF A;  1P4A A;  2ZJQ F;  1W36 C;  4B3X A;  1MW7 A;  5E3N A;  3F21 A;  3JRC A;  2IS1 A;  3QOP A;  2FBK A;  3KPH A;  3ISP A;  4IJA A;  1USS A;  3FIW A;  1IXC A;  4DBR A;  1KZH A;  4MHG A;  4OMY A;  4DZJ A;  2W7N A;  1YTY A;  1I6H J;  1GHC A;  1CF7 A;  5GTI C;  2VUM J;  2LP0 A;  2Q2E B;  3DPU A;  1FOW A;  2DOF A;  2RNG A;  4XKW A;  3JRG A;  3W6V A;  2L4A A;  2VKD A;  5LHG A;  3MMY B;  3JAM K;  4F55 A;  2DTZ A;  4DOZ A;  2O8K A;  1XPX A;  3H3Z A;  2ELH A;  3GME A;  2DFH A;  3HL2 A;  1P4W A;  2VQC A;  1IJW C;  1KQ9 A;  5KVR A;  2ME6 A;  1D0Z A;  2KFD A;  3A4C A;  4FT8 A;  1Z21 A;  5C3E J;  3G1L A;  1LEA A;  1T6S A;  1VZ0 A;  1B8I B;  3TDU C;  1JKO C;  2F2E A;  3OS2 A;  2RAE A;  1BW6 A;  4UXN A;  2XAQ A;  1TW2 A;  1H89 C;  1X4P A;  5H6Q A;  3KEQ A;  5GPA A;  4YIF A;  1VI0 A;  3T0Y A;  4YII A;  3ZQC A;  1T98 A;  4M72 A;  3A02 A;  1FSH A;  1R58 A;  3HOW J;  3ZR8 X;  5EG0 B;  1ZG3 A;  2K85 A;  2XB5 A;  2BY3 A;  1RR8 C;  2GM4 A;  1FOK A;  3E5X A;  1YO5 C;  1Z0X A;  1X4O A;  2M3A A;  4R79 A;  2FU4 A;  3DTK A;  4D9J A;  1R1U A;  2AXT C;  1LPQ A;  2VOD A;  3ZN1 A;  2DPD A;  3D1N I;  4BBS J;  3V42 A;  2FOK A;  3I5U A;  1O57 A;  3DXJ F;  3NEU A;  1EKE A;  1PUF B;  2JUC A;  3TGN A;  2COM A;  1ZRF A;  4BJT A;  4CH7 A;  2I5U A;  3EUH C;  1ETQ A;  4BU2 A;  2ID6 A;  3S16 J;  5KAI C;  2LG4 A;  2DMU A;  5J1R A;  3MZH A;  1XGO A;  5LRS A;  1ETY A;  3D0S A;  5DYM A;  4FET A;  2UZK A;  3FX3 A;  1ZAO A;  1ZLJ A;  3M1E A;  1ODD A;  4Y13 A;  2A07 F;  3K1P A;  3G1M A;  1TWG J;  3QRF F;  3UKG A;  1MKM A;  2WAE A;  4LMY A;  4WXD A;  1O7F A;  4XID A;  4ASN A;  2NOG A;  1NTC A;  2JMW A;  3ASO H;  1MSF C;  2BYV E;  3AFH A;  3DBR B;  3AAF A;  1I1G A;  2VQG A;  3RQI A;  3WU2 C;  3M8E A;  4FCY A;  2R7F A;  4M3G A;  2ZSI B;  2F4I A; 
#chains in the Genus database with same CATH homology
 2DMT A;  4XK4 A;  3QPL A;  4AYB N;  2HI3 A;  3TW7 A;  1QVT A;  1ETW A;  2PMZ N;  1ZGW A;  4M3E A;  1S7E A;  2DA3 A;  4D5F A;  2FX0 A;  2LKX A;  2XB0 X;  1ZR2 A;  2CU7 A;  4LOC A;  1TC3 C;  4C3H J;  2NVQ J;  4JX6 A;  4A3B J;  2HQ5 A;  4FE7 A;  2COB A;  2AHQ A;  4DW6 A;  2LTP A;  3RZD J;  1JT0 A;  3FKI J;  5GP9 A;  5IYB J;  3BR5 A;  1WPK A;  2DMQ A;  3HGG A;  5EG0 A;  4FIS A;  4W1U A;  1FTZ A;  4A3F J;  4A3L J;  1ITY A;  2CJJ A;  4A3M J;  1GDT A;  1UMQ A;  2LR8 A;  5IP9 J;  1IGN A;  1ZK8 A;  4B1R A;  3PM1 A;  1BW5 A;  5M3F J;  4CYC B;  1F36 A;  2JJ7 A;  2E2H J;  5C4X J;  4X1E A;  2DA5 A;  1A5J A;  3S14 J;  1HLV A;  3ZQF A;  3B6C A;  4MLO A;  2EH3 A;  5EDN A;  4A3J J;  1CQT A;  3HOV J;  4IHV A;  5FKN A;  2YUS A;  2MW8 A;  2E2I J;  1Z77 A;  2CRG A;  1RKT A;  3QQA A;  4A93 J;  3BR0 A;  1H88 C;  3M3Y J;  1JTY A;  1JUM A;  3FIS A;  4XRM A;  4A3E J;  3DCF A;  1LFU P;  2ME0 A;  3MN2 A;  4A3C J;  1QPI A;  1WH5 A;  2XGD A;  4XIC A;  3HDD A;  4DZP A;  3TP0 A;  3ZQG A;  1MSE C;  4IEJ A;  2Y30 A;  2NS8 A;  1IUF A;  2ECB A;  5IP7 J;  1Y1V J;  2KT0 A;  1K61 A;  4A3G J;  2YS9 A;  3HKZ N;  1VFC A;  1JKP C;  3BTJ A;  4D7M A;  2X9D A;  3TP3 A;  4MO7 A;  1RET A;  2HXI A;  2KDZ A;  2M0C A;  1JJ8 C;  1LE8 A;  1LE8 B;  2JK3 A;  5IYD J;  2XGE A;  1VND A;  3JRD A;  4Y52 J;  2L7F P;  2VI6 A;  3S2H J;  1XC5 A;  1AKH A;  2R0Q C;  3I4N J;  4Y7N J;  2VPR A;  2HOA A;  3CDL A;  5K7Z A;  1OCP A;  3O8G A;  4BY1 J;  3TED A;  4B4C A;  3BTI A;  3CCY A;  1MBG A;  2WB1 N;  5IP6 A;  1GUU A;  1IRZ A;  5E3L A;  4L5E A;  2LK2 A;  5IPA A;  4FTH A;  4XRS A;  4M3B A;  2WV1 A;  4JYK A;  1X2N A;  1PUF A;  3BTL A;  3BG5 A;  2P81 A;  3S1Q J;  3S2D J;  2H1K A;  4I6Z A;  3S1R J;  1GT0 C;  3M4O J;  3F0C A;  3TW6 A;  2TCT A;  5IYC J;  1WCM J;  3OSG A;  4A3D J;  1U9O A;  1G2H A;  1P7I A;  1SFO J;  5JLW A;  3S1N J;  4M3F A;  3HOY J;  2JA7 J;  2JWT A;  3DEW A;  5C4J J;  4XRS G;  5BNG A;  5J1Y A;  1TWA J;  4G12 A;  5J1U A;  1OCT C;  3NAR A;  4DYR A;  3OOU A;  3L1P A;  2ECC A;  5E3O A;  1MH3 A;  4UUT A;  2M34 A;  2XGC A;  1WI3 A;  3MVP A;  2EQR A;  1QRY A;  2DMN A;  1XS9 A;  2QCO A;  1JUS A;  2E1O A;  1GV5 A;  3B6A A;  1ETO A;  3JRB A;  2R92 J;  2FJ1 A;  1MH4 A;  3JRE A;  5M3M J;  4D5C A;  2EZK A;  4FCY A;  2IBD A;  2LVS A;  2FQ4 A;  1FTT A;  1MNM C;  3JRA A;  2VKE A;  1ENH A;  4A3I J;  2LD5 A;  1ZTR A;  2W48 A;  3BR1 A;  3HOZ J;  2EZL A;  3LSJ A;  1FIA A;  2XSD C;  3LOC A;  1BJZ A;  3MKL A;  1Y1W J;  3FK7 A;  3LSR A;  3S1M J;  4M3D A;  3BR6 A;  2DA2 A;  5M5W J;  2L7M P;  3IH3 A;  3QPS A;  1T56 A;  2CUF A;  5FLM J;  3Q0U A;  3Q0W A;  2HOS A;  2ID3 A;  1JGG A;  3BR2 A;  1JKR C;  2HDD A;  1IDY A;  5F0F A;  2R5Z B;  2K9Q A;  2DA7 A;  2JA5 J;  2X6O A;  2XPU A;  1IG7 A;  2L7Z A;  2M2E A;  2N8G A;  4UUS A;  2MG4 A;  5DTD A;  2YU9 J;  3RZO J;  2JN6 A;  5GPC A;  1BL0 A;  4BY7 J;  2HXO A;  3SFI A;  1WGX A;  4IHW A;  3S15 J;  3PO2 J;  3ZQL A;  3GTO J;  3OIO A;  1QVU A;  4V2F A;  1JJ6 C;  2NVT J;  1K83 J;  2CQX A;  2K9S A;  1W0U A;  5IOY A;  5EGO A;  1GVD A;  4EEF G;  3E7L A;  2CQQ A;  1TWC J;  1ZR4 A;  5J3L A;  2LFB A;  3BG9 A;  2Y31 A;  3K7A J;  4BBR J;  2Y0S N;  5F0H A;  2E2J J;  3S17 J;  2X48 A;  4QSH A;  1DU0 A;  1RR7 A;  2EBI A;  1LFB A;  1B72 B;  1EF4 A;  3IH4 A;  3HGY A;  2DA1 A;  2H8R A;  4B3A A;  1X58 A;  4MIM A;  3SDG A;  4I76 A;  5FKM A;  3CMY A;  1GV2 A;  3ZQI A;  2O9L A;  1ETX A;  5FKK A;  3GTJ J;  1Q1V A;  2M8G X;  1HDD C;  3GTK J;  1O4X A;  2DA4 A;  1NK3 P;  4RBO A;  2K40 A;  2G0E A;  5C44 J;  2XPV A;  2LLK A;  2R7Z J;  3SJM A;  3G1O A;  3H0G J;  2HYJ A;  1RPW A;  4HNV A;  2R5Z A;  2QF7 A;  2AO9 A;  1JTX A;  4MFD A;  2EZH A;  3LSG A;  4IHX A;  2O7O A;  1UHS A;  2DJN A;  4S0H B;  4MFE A;  2GBY A;  1IV6 A;  4J19 A;  3CQZ J;  3I4M J;  2R5Y B;  5FLV A;  4D7N A;  4QTR A;  3IH2 A;  1TWF J;  1IDZ A;  3GBG A;  4GFB A;  1MBJ A;  2DN0 A;  4ABZ A;  1DU6 A;  3HOX J;  2E19 A;  1HCR A;  5JLX A;  2GLO A;  4X6A J;  5EZH A;  1FJL A;  3HEF A;  4A3K J;  1MBE A;  3OSF A;  1IC8 A;  4JX5 A;  3H3V K;  5FKL A;  3NAU A;  3GTM J;  1TWH J;  3C2B A;  5DS9 A;  3JR9 A;  5HOD A;  5F0C A;  3HM5 A;  4V2G A;  2VKV A;  3BT9 A;  1HOM A;  1I50 J;  5EGO B;  1APL C;  3GTP J;  2Y9Z A;  2LY9 A;  2OF7 A;  1MBF A;  1JT6 A;  5F1J A;  4BXX J;  2TRT A;  5EEA A;  1D5Y A;  3BR3 A;  2ZB9 A;  1F43 A;  3A01 A;  1U78 A;  2WAQ N;  2B63 J;  4UUS B;  4C2M J;  2DA6 A;  2NVY J;  1WH7 A;  2L9R A;  3WHC A;  4QIW N;  1AKH B;  3LNQ A;  4AUX A;  3HOU J;  5EZG A;  1YRN B;  1AHD P;  1HF0 A;  1YRN A;  3WHB A;  4IHY A;  2NS7 A;  3Q0V A;  3RKQ A;  2XPW A;  1ZKG A;  1SAN A;  3VPR A;  3GTQ J;  3HBL A;  1AU7 A;  5E3N A;  1T33 A;  3JRC A;  3FIW A;  5EF6 A;  2D5V A;  1OJL A;  2NVX J;  4DZJ A;  1XG1 A;  1A6I A;  3JRI A;  2R5Y A;  1I6H J;  4NDL A;  2FD5 A;  3IV5 A;  2VUM J;  2LP0 A;  2M9H A;  5FJ8 J;  3BTC A;  3JRG A;  1B8I A;  3W6V A;  2OPT A;  3K2A A;  2DTZ A;  1MBH A;  2O8K A;  5K7H A;  2XRL A;  4DYC A;  5F08 A;  1MBK A;  2ELK A;  1JUP A;  2IEK A;  4AC0 A;  1IJW C;  2ME6 A;  5EYR A;  1U9N A;  3HB9 A;  2CUE A;  2K9N A;  5C3E J;  1OFC X;  3G1L A;  4DYQ A;  4C3I J;  4JP0 A;  3LSP A;  1FIP A;  3BQZ A;  1UG2 A;  2L0K A;  3BG3 A;  1JKO C;  1B8I B;  1RKW A;  4CYC A;  2R93 J;  3PO3 J;  2RAE A;  3GTL J;  2DMP A;  2I10 A;  1BW6 A;  3ZOB A;  1ETK A;  1H89 C;  1VI0 A;  3BQY A;  5FKO A;  1R9T J;  3FK6 A;  1B72 A;  3JRH A;  3ZQC A;  4A69 C;  3A02 A;  2MGQ A;  1VF9 A;  3HOW J;  5EG0 B;  1HDP A;  2XB5 A;  2GM4 A;  1RES A;  4M6V A;  1Z0X A;  3O8H A;  1JKQ C;  2Y9Y A;  1X2M A;  1ETV A;  4W97 A;  3D1N I;  4BBS J;  1ZQ3 P;  5K7F A;  2IAI A;  3JRF A;  1PUF B;  2JA6 J;  2JA8 J;  3A03 A;  4JX4 A;  1ETQ A;  2EZI A;  1E3O C;  5F04 A;  2ID6 A;  3GTG J;  3S16 J;  4BKX A;  9ANT A;  2HOT A;  2DMU A;  5J1R A;  5F27 A;  1ORK A;  1ETY A;  4C3J J;  5E3M A;  1I3Q J;  1BA5 A;  4RDU A;  2Y2Z A;  5M5Y J;  1NK2 P;  2MSY A;  1H8A C;  4FE4 A;  1POG A;  3G1M A;  1TWG J;  3UKG A;  4XID A;  1U8B A;  3ZQH A;  2NOG A;  1NTC A;  2JMW A;  1MSF C;  5M5X J;  4M3G A;  1FEX A;  3Q3S A;  3RQI A;  1P7J A;  3A01 B;  5GPA A;  1W0T A;  5IOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...