2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
2FNAA 1YG2A 3VKVA 1HSZA 1VL0A 4E21A 1QGPA 2A69F 4I9NA 3VC7A 2J3JA 3ZWXA 4BNYA 3GFGA 4EUFA 1E7RA 4IBOA 1O6ZA 3DHEA 2JSCA 4S04A 4PCQA 5HLGA 4UUVA 2I65A 3GDGA 4IM7A 2IP2A 3RBZA 2VOPA 3ZCXA 2X23A 4YB8A 3K2EA 3L4BA 1I3MA 4K2EA 4IRIA 3V8BA 4BGEA 1BW9B 2IDZA 2NNNA 2HLPA 2OORA 2X9VA 3F46A 4D79A 1L7EA 4J9VA 4CMBA 2YSRA 4WNCA 2D59A 5LLQA 3H8VA 3U62A 1DPGA 1E3SA 2O3UA 3HSKA 5C7IO 5L4SA 2BH9A 3IL2A 4BO4A 3MFKA 2GSDA 4CMEA 2Q2WA 2PGJA 5C37A 2XOXA 2GZ1A 1E3LA 2M87A 2C6YA 2X4HA 4PVCA 1R22A 1U3EM 1ENZA 4J2HA 4UUNA 1TLHB 3UUWA 5L3FA 5L45A 3FM5A 2X0IA 3OH8A 5DCYA 1GYQA 1O9BA 3FI9A 3GYHX 4YJHB 2FE3A 5CP8A 4CV0A 4CMHA 1S8NA 3HHHA 5DCMB 3RTRA 5HVQC 1DSSG 3UCFA 2Q3EA 5HWSA 1M6HA 1SD6A 2XAQA 1FOKA 3ZN0A 3DP7A 5TNXA 4AICA 2VYVA 2ZTUA 4A6EA 3MOGA 4NJOA 3VPXA 2L01A 1KU7A 3U4IA 1TW3A 4XYLA 1J4AA 4Q47A 2RV8A 4OL9A 3E5UA 1EE9A 1BVRA 1M67A 3CO7C 4DIFA 1HYEA 2VYND 2EK5A 1F14A 3O26A 3VPFA 2RIRA 1Q0LA 3H9JA 5JCJA 1OC4A 4M89A 1VM6A 2G9WA 4CICA 1L3LA 2FR8A 1E6WA 4R54A 3IKTA 4XD2A 3QRFF 5JS6A 4BHTA 1MUUA 3PDJA 4IJWA 2I9PA 5KVQA 4AVPA 2V6MA 1RIOH 2VWPA 1DHTA 3GRPA 2IYPA 1F17A 1XGOA 2G1UA 4IJVA 3BJAA 3EQLF 2UAGA 5DP1A 1H6CA 1LRKA 2PA3A 4BQPA 1Z05A 1LRJA 4GAEA 3M7GA 2VOEA 2KKOA 3OV8A 4Q4ZF 1H6BA 1DBVO 3FPCA 4FFPA 3N97A 1QZYA 5CDUA 5DULA 5LEKA 1IXRC 1LVAA 5LGUA 1I36A 1KVSA 1LA2A 2OZ6A 3V4GA 3RC1A 3DQVC 1PL6A 4BIIA 1ZCJA 1HETA 2R00C 3COAC 2IPQX 4YDRA 4I9UA 1EQUA 4HA8A 1I2BA 3O4RA 4OOFA 3TOAA 1R23A 5IDYA 1I32A 2JCYA 4PG8A 3PQFA 3CIFA 4GMGA 4A5OA 4YT2A 2EWNA 2P5KA 3EHEA 2HU2A 1ZK0A 3EC7A 3NGLA 4YWJA 1D3AA 1TT7A 1WPQA 3ZH2A 3DL2A 5BR7A 4LMYA 3UFXA 2GPTA 2X0JA 3DEYX 3JD1A 3P2YA 2CSOA 3CJNA 3ZV6A 2BD0A 1W7PD 3EVTA 3K96A 1M2WA 3K1PA 3JD2A 3DAGA 5TS3A 3IMFA 4FFLA 3N58A 4OKNA 4HOBA 1HLPA 3FNHA 3GK3A 3Q3CA 2BI8A 2XKOA 3WBBA 2PNFA 1HSJA 2WTBA 3HN7A 3ABTA 5JO9A 1CJCA 2XAGA 1U3UA 4ALNA 5DN9A 2R00A 3D4NA 3ZI0A 1O0SA 1H0KA 3Q9VA 2MD5A 3WMXA 5T57A 4UAGA 4KUHA 1WZEA 2BGLA 2DBZA 2VRBA 2ZQYA 2EFOA 3BHMA 1FYMA 4HV6A 5D8LB 1Q1NA 3RWBA 2VRCD 1VLLA 3HIFA 1N7GA 1IF1A 2H6BA 4ALJA 1PGNA 2NU6A 3PWSA 4F46A 1YB5A 3NGXA 4ON0A 4RAYA 1J59A 2EW2A 4M1QA 4NU6A 3IDSA 3JQ7B 4XQGA 1L1FA 4N9HA 4KICA 1X15A 4O59O 3KCCA 1RYDA 5B37A 2FOIA 4NHEA 5DV5A 4R16A 2COMA 4QO7A 4QT0A 2W90A 2VBZA 4ASNA 1G4DA 2VONA 1VL6A 4U0YA 2DO7A 1XSXA 3G3EA 4UXNA 1X13A 1BC8C 3J80Z 1H6DA 2P9CA 1Z6RA 3OIFA 4J90A 2DQ4A 5COAA 3GVXA 3CXRA 1G6KA 4Y6PA 5E20A 1MC5A 1XD7A 3QWBA 2Y1EA 2H6CA 2HZTA 4KN4X 3GFBA 1WSUA 2NWQA 5CPBA 5THKA 2B4TO 3DZJA 1HWYA 3PZRA 3WYCA 2E7XA 4J16A 1YJ8A 4LG0A 3KP4A 3V7RA 3FHZA 5L4LA 3ELKA 1B59A 2Z95A 3NTRA 4N5MA 3IC7A 2EGGA 3HRMA 4JN6B 4WCFB 4WLFA 5T5QA 2GN4A 5CDYA 1YO5C 2OA4A 4G9YA 4O5VA 1H93A 2HMSA 3ZV3A 4AFNA 4D3DA 3OA0A 4PGHA 2HQNA 3H3JA 4J6FA 2BGMA 2OBNA 2F5CA 3P7NA 1K6JA 1STZA 3A28A 2YDYA 2QRLA 4A03A 2OP0A 4B7CA 2XAFA 5MDHA 1XDSA 1E3WA 2CDAA 1GHCA 4E5YA 4UEKA 4PG7A 3ZMUA 3G79A 3I9MA 5F1PA 4XYMA 2W25A 5E8GA 2BGKA 3GPDG 5DCUA 3VH2A 2HKXA 4EGZA 1H9TA 1E7QA 2P4QA 3DFGA 3H5NA 4YJFA 2DBVO 3R4KA 2JKVA 3BTSA 1O3TA 2EG9A 1EV7A 1B3RA 4TZTA 2YV2A 4RV9A 3I59A 3L09A 1UZMA 1VRWA 1DIBA 3LFKA 1B9MA 1IW7F 2QQ5A 1ZN2A 1ONVA 2NU9A 3DPTA 1TT5B 4ZICA 3OOPA 4QEDA 3OJLA 2EKLA 1WQ2A 1S7CA 2O48X 4TKMA 1I24A 2PN6A 4IRHA 2NAZA 1NX6A 4IINA 4K1LA 4CV2A 5HS4A 1ENYA 4YACA 3RKWA 4P9UA 3KZYA 3TPCA 1D8AA 4KWHA 2GR9A 4PLYA 4XYGA 5HM8A 1JWAB 2JD2A 4CV1A 1PGOA 1U2GA 2HAEA 2DU9A 5D4RA 4J1TA 3HDQA 1C0LA 3H65A 4CQMB 3KO8A 3M8EA 3LT2A 4QECA 3FHLA 4FQ8A 3S2FA 4CMIB 2YV3A 2I67A 3LT0A 4RGUA 1Z82A 1JW9B 2AHRA 1BJAA 3OHSX 4NPCA 2OQRA 2QWWA 3HRUA 2LDUA 1TQMA 1YB1A 2ZK7A 4ZRNA 1FSHA 1GVJA 4U88A 4CO8A 4M87A 3O6BB 3BY6A 3RPUA 3PP8A 2HUNA 2ZTVA 4YFKF 1B16A 3SXPA 4GSKA 3MJ4A 2STWA 3U49A 5JMWA 5EPOA 3IRQA 4BQRA 1PIWA 4QFDA 2QM3A 2H6EA 1GPJA 3CZRA 1J5PA 5TRTA 5H81A 1VSVA 2H27A 1QKIA 3GMDA 3W4KA 2K27A 1H94A 2W57A 3LQRA 2EXXA 4IIVA 5C7LO 2OD5A 4N0BA 2L54A 2ZTMA 5G0UA 5FF9A 3N7UA 1S29A 3WU1B 2FR0A 3R6DA 4DVJA 3MZHA 2IA0A 3DBRA 3D1LA 1R5GA 2X9NA 2G82A 3BMCB 3EZYA 2I5PO 2Y0DA 4KUMA 1DOHA 5ICCA 4U7WA 4Y6SA 4A26A 2XROA 1R00A 3B1FA 5BT9A 4E33A 4WWCA 4WCFC 4RB3C 3T0YA 3RFTA 1JDJA 3FWZA 5JFRA 3GHHA 3HSFA 3UVEA 5CVJA 2HQ1A 1E3IA 2FRDA 3MCVA 4HBGA 4WLOA 4PZJA 2O3FA 1EMDA 5IFLA 1V8BA 3T5XA 4DPLA 1QXSA 4S05A 3OIGA 3Q0EA 2DBBA 4AD9A 3I9OA 2C29D 2PMUA 3QWIA 4EV0A 1IHYA 4NQZA 3ICCA 2VHZA 4IS2A 1CQJA 1DAOA 1OAAA 3L0DA 2YX7A 2Q45A 4JQCA 1MC4A 1E7YA 1MD0A 3RDIA 1P74A 4E3ZA 1L7DA 3TN7A 2FNPA 4CMJA 1Y9EA 4I8XA 1ZG1A 2B5VA 2BFMA 1IULA 1PTJA 3HB4X 1RWBA 5ENDA 2RH4A 2B69A 1NAIA 4FJ2A 5E1XA 3K1NA 3TOXA 3KLOA 1ADBA 2YU3A 4NK4A 3RVDA 2DFVA 4G7OF 2DTDA 2FZEA 4OH1A 1OYYA 4O5OA 2M30A 2PLAA 4P9FA 2EFPA 2RQPA 3OETA 2WD7A 3ULKA 2FPIA 1PQUA 1I3KA 5A9SB 5TRDA 5L3EA 3D3WA 1G3WA 3WTBA 2OQGA 1SNYA 4GKBA 5FLXZ 9LDBA 2XAHA 3LAJA 1R12A 1U9JA 3OJFA 3EYYA 4RDHA 4DXHA 3CEAA 3SJUA 4D0SA 1UXHA 1PQPA 3QV1A 3RKUA 1LSSA 2YR2A 1U8RA 3NRCA 4O63O 2VWHA 4ENKA 4L0YB 2IE0A 2O3RA 3GGOA 3M2TA 3PVZA 4MQVA 2B4RO 4DWVA 1QO0D 2ZQZA 3AUSA 3JYOA 5AVOA 4YYZA 4MJLA 3TDUC 5CG1A 1HE2A 5IJZA 4F6LA 2J8ZA 1VJTA 4J0EA 2O2SA 1PGJA 2YHIB 2JT1A 3TO7A 1GYRA 5CEJA 1TVEA 2CO5A 3ZNOA 3DKWA 2WYVA 3KEQA 3C7AA 3PIDA 5TT1A 3GEDA 2QBYA 3PDUA 1J49A 4IDDA 3WWZA 2Y0MA 2O61A 1W5SA 2VBYA 4EJVA 3E9NA 1EDOA 1EVJA 4XQCA 2IODA 3QVOA 1LDBA 4KZPA 5JSFA 5DEQA 3GZ6A 3WU0A 3DONA 2Q2VA 3O8QA 4OYRA 4TVBA 3VDRA 1U7TA 1FDWA 3FMSA 4LMPA 4AJJA 2EV5A 5KWEA 4M73A 5IZCA 1TQPA 4Y98A 3I1JA 3H9UA 1TNTA 4CM8B 5LEJA 3RBXA 5EL0A 4WCGA 4XLNF 1PWZA 4FBGA 1HKUA 1LDDA 4PGGA 3GZ5A 2BF7A 3ADPA 3JQGB 4YG2F 5IAAA 1MG0A 4YAEA 4IDEA 2M8EA 4GX0A 1XGKA 2DPDA 1UDCA 2AMFA 3JTGA 3WSVA 1PL8A 4DYDA 1UFMA 5DCFA 4G94A 3SHFA 4NFHA 4EJOA 3HE3A 4NHJA 1PJLA 2K02A 2BRUA 2EFQA 2QYOA 4RAZA 1DB3A 5ILOA 3I9LA 4RVSA 4BOYA 4PGFA 5LGNA 4CMKA 3R0JA 3JQFA 2Y0EA 3QW2A 3CKYA 4FN4A 3DF8A 5DDGA 4CMCA 3B73A 3CPSA 4WCDA 1JWBB 3V1YA 3E6MA 1E1LA 3JQBA 1XLTA 3OJOA 1YS6A 4O6JA 1O3QA 1DJQA 2YFQA 4BO2A 4Z6KA 3ITDA 4KIGA 3BMQB 1PGPA 3ZWNA 4D43A 1F9NA 1NFFA 1T2FA 4CUZA 3KSZO 3VZPA 2Y05A 4ZH4F 2Y68A 2ET6A 1BGVA 2HKOA 4LLLA 4P8RA 4E2WA 3BTOA 2H9IA 3FF4A 4RB2C 3BJOA 4LK0F 1ZFNA 2F5DA 3KBOA 3RPQA 1FDVA 2UDPA 4KT5C 4K28A 1XU7A 2O2YA 2NACA 3U5TA 3VB2A 2JPCA 3I4FA 4I5EA 2ZMEA 1E7SA 4DQXA 1RM5A 1LI4A 1CDOA 3EAGA 3DB2A 4FFNA 2EV9A 5FFFA 3L6EA 5IT9K 1CIVA 2IXAA 3RFVA 4GX2A 2A6EF 3E8XA 1TB4A 3C8MA 4LVCA 4HLXA 3D5TA 4BO3A 4BNKA 2D45A 1RKXA 1I3NA 1UP4A 4CJXA 1X7DA 3I4CA 3K69A 1I01A 3FD8A 3ON5A 3H92A 3C85A 4CQMA 5B12A 4Z9YA 3T1BA 3EDPA 4P38A 2NS0A 2STTA 3FXQA 1I27A 2OBPA 4ND1A 2J5PA 1MZBA 3AW9A 5FGMA 3TNLA 1YFHA 3KP2A 5K6AC 3EVNA 4UUPA 3R0AA 3DBLB 1YS4A 4WEQA 1NBOA 3AJRA 1J9IA 3FXUA 5GZ6A 4I9HA 2FZWA 4BGVA 4WLVA 4EI2A 4YT8A 2I3GA 3HUDA 3OJ0A 3PWKA 2ZNYA 4Q3EA 1NVTA 4WEOA 4MP3A 1ZARA 4FSHA 1FPQA 2E49A 2X5KO 3S2EA 3T7EA 1LDYA 3TZKA 3IS3A 2NSDA 5G2OA 1T26A 5AXDA 5IT9Z 5JAZA 3NAQA 4WK8F 4WE3A 3E5XA 1B14A 4NBWA 1K2WA 1YL7A 3KLNA 3F6VA 4YRAA 1I10A 3EYWA 3DPLC 2KIUA 4OIOF 3G3ZA 2IW5A 4OXNA 4GI2A 2ZB4A 1SOWA 2JL1A 3F4LA 2KJBA 2PBIA 1A72A 4HF1A 1WZIA 3WSWA 3UCXA 4EGYA 2RHRA 2IYOA 3MTJA 4PVDA 5JXWA 1GFSA 5TJHA 2WD8A 4CLDA 4NBRA 1GZ3A 3HUGA 2WJPA 4B8WA 2EA2A 1Q1HA 1FMCA 4AIJA 1O95A 3ASVA 3GZ4A 1YIOA 3JSPA 3VAZA 4RLSA 1FP2A 1BXGA 1HW1A 4D3FA 3WXBA 4BO1A 1LC3A 2LF8A 2L3DA 4A0XA 1WI9A 1XWFA 4D45A 3L4SO 4WXHA 2OMEA 1SFXA 6PAXA 1Q0QA 2JD0A 4J0FA 1FP1D 1A7KA 3DOJA 1GADO 4QTZA 5L4NA 4GYIA 2DW4A 4HFNA 4JLWA 2WWYA 2ZFWA 1FXSA 4KQWA 4BH9A 2OZUA 5B1YA 5MGBA 1EVYA 4L9TA 4OIPF 3E9QA 3GFIA 1Y5RA 2ILTA 3QPHA 1T2EA 2Y99A 3QHAA 4MVJF 3NQOA 4XJTA 1BHSA 3GAZA 4XSXF 3L9XA 5U1PA 3RBVA 4LB5A 4CR8A 3DZGA 5FFZA 2CVZA 3KRTA 3R3SA 2FR1A 4Q9NA 2UXNA 1FLIA 3FZVA 2FEZA 1WMBA 4J3FA 2EKPA 1O94A 4QSMA 1X0VA 1I8TA 2HR3A 4Q5SF 3PHHA 1O7FA 3OA2A 4M49A 3TJRA 1IAWA 3GY0A 3TF5A 4LLNA 3I71A 4O1MA 2WEKA 4DBVO 5DD8A 4WOKA 1IN5A 1WDMA 2ZO4A 4B4WA 3HSEA 1X0XA 3P5SA 1F8FA 4FPXA 3H3UA 1UHMA 2W8ZA 3ZP5A 1PL7A 2HMWA 4RVDA 4XDYA 5F5LA 3WIEA 5IDQA 5EN4A 3TFQA 4I09A 4L8VA 3BIOA 2D1YA 4RORA 1GL3A 1XCVA 4HY3A 4M74A 2CF5A 3QWHA 1JHFA 2CD9A 2MLKA 3HOTA 3I83A 4CM6A 4CODB 1G1AA 2WM3A 4RF2A 3ML6A 4M9ZA 4G6DA 5L3GA 1IE3A 1N7HA 2BFAA 3GPIA 3JYNA 2B37A 3RUEA 4AJ2A 3RKXA 1IYZA 2WYUA 5EQFA 4DQ2A 4KA4A 5A2QZ 3FWNA 2IJLA 2FSSA 4JXKA 4UUOA 4EJ0A 4JK3A 5H83A 1IHXA 4NBTA 1P0CA 3KSDO 3QWFA 4ILKA 1F5TA 3GXOA 3GFMA 2HMVA 2TDXA 1PDNC 3GLQA 4OO3A 4ZYEA 4BO9A 2PZLA 1EE2A 4RPLA 3AY3A 4U0KA 3KYCA 5LRRA 4QUKA 1BIAA 4RGRA 5FB2A 2BYVE 4L4SA 1SC6A 3MWDB 2FQ3A 2RDPA 1OBFO 1BXZA 1G3YA 1E7MA 1UAGA 4LGWA 4MVJI 3DR3A 4EUHA 4R9RA 4GBJA 2VNSA 5JAQA 2XV4S 3VVCA 1OC2A 1FZPB 2C2XA 3AI3A 4FFRA 4BHPA 1JA9A 2RKHA 1XDWA 1Z1DA 4E4YA 2JRTA 3GQVA 1Z73A 2JFFA 2J5RA 2FBHA 2DQLA 2MBFA 4HYEA 2CZCA 2PH5A 4RGXA 1I3LA 5U4QA 5DDIP 3RROA 3ZU3A 3KP6A 4BXUA 2VT2A 2QYSA 3WQSB 2ZJ2A 3GGGA 1FBUA 4CM3A 4JBIA 3AU9A 4BKRA 1TXGA 4CM1A 5BNIA 4A12A 4XJSA 4AG3A 2AS5F 4LCJA 3K0LA 4O6VA 5JHUA 2YZ7A 2D2IA 2ZIZA 4RZHA 1HRDA 2ZJ1A 5AONA 1ZRDA 2DKNA 4B3HA 1QNTA 4KDFA 4EJTA 1P1KA 5D5XB 2X9GA 1IZ0A 1LLDA 2GZWA 3OMLA 5EMHA 2G7HA 3IKVA 4GSLA 3VH4A 5B4UA 2GN6A 1A4IA 1CYDA 3Q9NA 2A94A 1R6DA 4FFOA 3V2UA 1V6AA 4U0VA 4EM1A 1R1TA 1PP7U 3WTXC 1RUNA 1EK5A 4MGRA 3NKLA 3DBHA 1B8PA 4TRJA 4BO8A 1P31A 1KC3A 2FOKA 4JP2A 1F1ZA 5JY6A 4WLNA 4GPD1 2A6HF 2O8XA 1HE5A 3DHYA 4YAJA 4R01A 1FY7A 1A27A 5K5OA 5JDIC 1ZH8A 3T4EA 4IF4A 1ZXLA 1PEDA 2VXZA 2Y0CA 4RPJA 1X7HA 5IN5A 5THQA 2P5YA 4YA6A 2NM0A 3JQCA 4Z9FA 2R7FA 3F5QA 1HXDA 5I7SA 1CQIA 3ZWMA 2F5EA 1YRLA 3BMCA 1K78B 1HT0A 3JYQA 4GX5A 4MIEA 3I3OA 1TA4A 3QJ5A 4YRDA 3A9WA 1WKMA 1ZW1A 4A7PA 4MVJE 1MFZA 3B1KA 1I2CA 3KM0A 2JFGA 4E6PA 4RS8A 1E92A 1VJ0A 3UHAA 1DAPA 1OFGA 2B35A 2Y66A 1YYVA 3F23A 3CZMA 3LK7A 5EJ2A 2Y67A 4IQ8A 4UREA 1DUXC 1FWZA 2O7QA 1E3WB 2X8LA 3AUTA 1KU3A 2Y75A 2V1XA 1BXGB 3DZKA 1UP7A 2Q49A 4J9UE 1O5IA 3WR5A 4PLCA 3GDFA 2O3JA 2P68A 2PKQO 4BNZA 1U6GA 2JCVA 2P6TA 4BGUA 4L5JA 3I58A 5DNAA 5EERA 5KKAA 3GEZA 4D7AA 2PMHA 4XRFA 5DBIA 3LZ6A 4YFXF 2ZYDA 2GCGA 2DAOA 2OU2A 4BKOA 4J4HA 2X4GA 3C7DB 1MJBA 4FJ1A 3MEQA 3JTHA 5HA5A 4HUJA 3CH6A 4B4UA 5I7EA 1ORRA 3WG9A 5JYEA 2A92A 1IY8A 2DAPA 2DPGA 3WTZA 5EIOA 3L77A 4PLZA 5IF3A 3G49A 1AUPA 1W7PB 1J6UA 4UVHA 4HZFA 3V7CA 3DOCA 1KC1A 3NDJA 1QP8A 4W6ZA 5L53A 4NJMB 2FP4A 3DMYA 4N5NA 1ULSA 1Z91A 1T24A 1ZK1A 2Q99A 5A9RA 1DC5A 5COBA 1LQTA 1M75A 2NTJA 4FGSA 3PTZA 2X86A 2VHWA 2X22A 1SB9A 5D6FA 2V65A 5CDSA 2VTEA 5I7FA 1LNWA 2JAPA 4XQEA 4M54A 1DFGA 3DQPA 3MTGA 3K92A 2WE7A 4ZVVA 2HTJA 4R8HA 1SBYA 4JROA 8ADHA 1T2CA 1KVRA 1UH5A 3NTQA 3T8TA 3ETDA 3ZNQA 1EFLA 4OM8A 3BDDA 5I7VA 2E37A 2M5WA 3MWMA 3OP4A 1KERA 2YW9A 3PHLA 5A4DA 3UW3A 1ON2A 4I02A 2ISYA 3E5MA 4JBHA 1YB4A 1QR6A 1A9YA 1AXGA 3QWAA 1V3VA 3G73A 4RPKA 1QYVA 3RCBA 1ULUA 2JD1A 4BNUA 1Y5MA 1P4AA 4CUJA 1HSOA 1ZK2A 2Z99A 4ENJA 4L0ZB 5A9TA 3P9IA 1JKIA 1GZ6A 4XYBA 4L9VA 3W6KB 5F1RA 2UUPA 3PQEA 3HTSB 4B09A 3W6UA 5CDGA 5DYMA 3ZW8A 1XB4A 4RQUA 1Y8QA 1LJ9A 4UVAA 4Y9DA 2IT0A 1WWKA 5K5RA 1TLTA 1EBUA 4ZYHA 3IHUA 2GDZA 5HBRA 5IXYA 2DBRA 2VT3A 5E1ZB 1E5LA 4IDBA 4WLEA 4XX0A 4DPMA 4WECA 4NH4A 1EZ4A 3FNGA 1QLHA 3ZV4A 1C1DB 4HLYA 4KDPA 1DRUA 3UCEA 3AU8A 3LWFA 1YXMA 3LF1A 4W9NA 1GUZA 1G0NA 4P22A 3RJPA 3WGZA 1V3UA 1HE3A 4PG6A 3I64A 1JXSA 2GF2A 3D5LA 1IXSB 1BW9A 1CWUA 4RGBA 2XAJA 2YFHA 3BMNA 3K30A 4CM7A 3L9FA 1BRMA 3BA1A 4RDIA 4E13A 2BI7A 1SMKA 4EW6A 1OR7A 4GO1A 1QV6A 1B8VA 2NNLD 2WTEA 4ZHSA 4DMLA 1NVMB 4AJLA 3K5PA 1BWSA 1F06A 2PZKA 4W4TA 4MNUA 4DPKA 3KSUA 1R36A 1ADFA 1FNNA 3OECA 1Y1PA 4EM0B 2WSBA 4OMYA 3G1UA 4JBAA 4RQTA 3W4JA 3CE6A 2DC1A 2FN7A 4BO0A 9LDTA 5ADHA 4WNIA 4EVIA 4L75A 2NU8A 2PH3A 3PIIA 3RJ9A 1TNSA 2VC0A 4MEYF 5LGTA 4Q3DA 3GFLA 3LT4A 4E70A 4URFA 4LJZF 1H2BA 4WJZA 4J1SA 2BKAA 3O03A 4MVJH 2ZCVA 1T98A 2OAZA 2H1SA 1BIBA 1NASA 1NWCA 2JAHA 2Z9OA 2EW8A 2PKQP 2W2KA 3K8ZA 4NIMA 4YIFA 4E32A 1KU9A 4W7IA 1NM5A 4BAYA 1ZSNA 1XQ6A 1GEGA 2A35A 2J6IA 3ZDFA 4AJPA 1I1SA 1CERA 3JQ7A 4M9XA 5A3JA 2H5LA 4TSKA 3ABUA 2EIHA 4U7BA 4R5MA 4JIGA 3HWRA 3HNPA 3F8BA 4GGGA 2P4HX 2HEOA 2XAAA 1H5QA 3PYMA 2UXXA 3ZWYA 4CM5A 4E2ZA 5ICSA 1VJ1A 2LDXA 5JE8A 4IHTA 4R1NA 5LHIA 3FNFA 1EH7A 3WWYA 3DAPA 1RM0A 3TZQA 1SEPA 1PZGA 2VOJA 1FX7A 3KP5A 3M1AA 4HNGA 5G0SA 2QYTA 3ZN1A 3HOSA 3QLJA 4EJMA 3QE3A 2VZ0A 2J3HA 4OQYA 1KY5A 3E9MA 1C3VA 3BXXA 3ZHZA 3RASA 2NTNA 4GKVA 4NMHA 4A0ZA 4B3IA 3WS7A 4D44A 5JNLA 3Q2KA 3SEFA 4J2OA 1KQ9A 1D5VA 1NR1A 3HDHA 3D0OA 3GVPA 4YAIA 5A02A 5IDXA 4AL4A 4I1IA 3RFXA 4CL8A 3GHYA 4HADA 3LLVA 3ULQB 1T2KA 5JAIA 2GD1O 2PD3A 1AXEA 3I9KA 3DHNA 3PPIA 5DZSA 3Q9SA 2WE8A 1A04A 4MTEA 4P4NA 8LDHA 3PHGA 2FA5A 1YTYA 4L4XA 4LD5A 2LDBA 3JQ9C 5AXBA 4PRLA 1LDGA 4MTDA 2P2SA 1UXKA 1PSDA 1BBYA 3I9JA 2PQ8A 3MEXA 5KTKA 4IXTA 1RPNA 1ZREA 3RJ5A 4UVBA 1RM4A 3PZBA 5JR3A 3M9AA 3D3EA 3GMSA 4CM9A 4FT8A 3GW2A 4AWXB 2J5KA 3BMQA 3DWFA 1PS0A 4CHUA 1Z9CA 3RQSA 1USSA 5ITWA 4OGWA 5E8IA 1BI0A 1ISFA 3JSAA 4GH5A 2PG4A 3WYBA 3C24A 5ILGA 3X2EA 4CV3A 3Q5FA 1U3TA 1RJWA 3V2GA 1ZG5A 3RC9A 4UV9A 3VOSA 5K9ZA 1T25A 2R7DA 3GT0A 1E17A 5AIQA 4FW8A 3KHUA 2HJRA 4PDKA 2HSDA 2FMYA 5CVVA 4ENMA 4FJ0A 1HXHA 3AK4A 1W7PA 1HSTA 1U5TA 1YS7A 1ISMA 4C7JA 1K6OA 4KYWA 1SPXA 1DRWA 2UV8A 2AG8A 4BMNA 3M6IA 4UULA 4OIQF 4Z0TA 3LU1A 1PJ3A 3EMKA 2KIFA 1CF7A 1P4XA 3HB5X 4LSMA 2V79A 4QWQA 4XA8A 4BQAA 3M1EA 4I7HA 3DXFA 3GWZA 5KCZA 1UDBA 5J6XA 3K9TA 3C1TA 1ON1A 2DK5A 1B0AA 2MC3A 1I6XA 1ZRFA 4A5NA 1W5TA 2AE1A 5KVVA 4WXCA 4EDFA 2WDZA 4CM4B 2MA3A 4YT4A 5BPIA 1Y8RA 3LVFO 1IOLA 2AW5A 4IQGA 4E5MA 1NVGA 3MJTA 3RKRA 4WX9A 2AEFA 1LDEA 3DFZA 4GVXA 3CMCO 1E2XA 1I0ZA 1WMAA 4FC7A 4UVDA 1BI3A 4YQZA 4IJAA 1PU2A 2Q2QA 3IWFA 3KTDA 3MAJA 3JQDA 5FI5A 3WNQA 3FM3A 5ICGA 5AQ1A 1HZZA 2FBKA 1MX3A 1Q0HA 1LRLA 1I1GA 4MIOA 2JHFA 4PG5A 4YJFB 5JMPA 2CSUA 1A7AA 5KJFA 1EH6A 4RPHA 1ZBQA 4ZRMA 1R1UA 1RI7A 1BXKA 4I98B 1YDWA 2ZYGA 1J5YA 2C0CA 4EJ6A 4EQQA 2V6CA 2AEMA 3VPHA 2JPBA 4HW0A 3F8MA 1DLIA 1U2DA 3GNQA 1C1DA 3E5RA 4M9SA 4LB6B 1BDMA 2POQX 3HG7A 3OF2A 4J7XA 3VPSA 3CUQC 3ZHBA 4UVCA 3ICPA 3DMTA 4BNXA 3GFJA 1PGQA 4PRKA 2KJCA 6LDHA 3UAGA 3WJ7A 4P4GA 2HO5A 1Q7GA 2O7SA 5EEGA 4BO5A 4CQLB 3OIDA 1J0XO 3AOEC 4IPTA 4YEDA 4A27A 3LSYA 1P1JA 2W2KB 3BYZA 1BG6A 3FSRA 4Z9XA 1ZJYA 4CLEA 4Y17A 3RI4A 4IRGA 2WV0A 4QX6A 2QIOA 1SCUA 1LUAA 5A5EA 4UNOA 1R4MA 3LF2A 2VC1A 1O7LA 1VKOA 1SMTA 2E82A 3NX4A 2B36A 4OXKA 4BB6A 2XIGA 5CLSA 4KIFA 1N9GA 3WICA 2GQQA 2RN7A 5DCMA 2FSWA 5KOIA 1HKSA 2DTXA 1T1RA 4IDFA 4L74A 1SD5A 1XSVA 2HJSA 1HTBA 1MJAA 5D5WB 1ARZA 3ROUA 3GDOA 1HDOA 3R0IA 4WK6A 2DVMA 3JCZA 3AFNA 1IL0A 1PQWA 5G4LA 3NT2A 2JHGA 3AUAA 3QY9A 4MKZA 5I9MA 4TWRA 3DOOA 3I0TA 4MVJM 2JFHA 2DBQA 2NTVA 3VTFA 3D7LA 4RJTA 5TIIA 1O57A 1MXFA 4PLHA 4AJEA 4BNLA 2UWMA 3CINA 4H3VA 3SLGA 5FD5A 1EUDA 3VPGA 2A5YB 1DPUA 1O3RA 1P9LA 1R0KA 3DAFA 1AN9A 2F5FA 1GU7A 3IUSA 5JY1A 1PJ2A 1BMDA 5HLIA 1Y9AA 4YJGB 5I9NA 3CUOA 4II3A 2BHLA 1S6YA 1CETA 4CLOB 3K1MA 3ZMDA 1U3VA 4Q3BA 5C7OO 3INRA 1NXQA 2O4UX 1RZ4A 1Y8RB 3TQHA 4A2UA 4B4OA 4CDGA 1D8KA 4AVYA 3A14A 3TZHA 3REOA 1Q7BA 3LQFA 3WB9A 3I6IA 3WTVC 3U4DA 2Q0OA 1LDJA 1XDUA 4Z2YA 1Z75A 4J7UA 4EEXA 2X7HA 2ADUA 4GLLA 2HYFA 3U0BA 3MJSA 4IJKA 2C7VA 3WGTA 3MWEB 1FYLA 3GF2A 4W99A 5CEFA 4R41A 3JQAA 4CM8A 1D1SA 5D4SA 1FT9A 1KYQA 3PJEA 1LDMA 1I2ZA 1QV7A 5HDGA 3E03A 3BMOB 1XG5A 1GYPA 2O6GE 1YLFA 3D0SA 1W6UA 2O3SA 4ITUA 3UF0A 1DLJA 4E31A 2XF8A 5CHEA 4XR4A 1QSGA 5ENVA 2GA1A 3HJAA 2NRAC 2L4MA 2B83A 2IRWA 1MFPA 4ID9A 3EW7A 5ER6A 1UXGA 3L4BC 3MJCA 5DBFA 1NPDA 4A5MA 2VBXA 4PG4A 3W6JB 3FR7A 2VOOA 2J3IA 1Z7UA 1QG6A 3WGYA 5IG2A 1LBEA 3B70A 3U2RA 3C3XA 4YBZA 3HHGA 4ZQBA 3VH1A 1IPEA 4IGFA 2WC2A 4R5HA 5ES3A 4WLUA 1JKJA 1KQ0A 2BEOA 4HDUA 2FMLA 1B15A 2AQKA 2PZMA 4MINA 1LC0A 2NVUA 1TQIA 4C4OA 3G1TA 4DIBA 2PV7A 1HDGO 4OKIA 4XR9A 1HW2A 4PZDA 3WLFA 1QPMA 2ZJ0A 2A61A 2V1UA 5A1TA 4I0AA 3H9EO 3GEGA 4J43A 4HX5A 4CR6A 3KLPX 5CFZA 1R0SA 1B7GO 2K86A 1HKTA 5JVTA 3KYBA 1P1IA 2FPPA 3SC4A 1ZMOA 4BNGA 2D5AA 4BHBA 4EM2A 4ZQEA 5TJJA 2AEJA 1ZK3A 4R68A 2P6SA 3RUCA 4GVLA 5LC1A 2YPRA 3R1IA 1XA0A 3VZQA 3KZVA 2YUTA 1YKFA 3G0OA 2GASA 4CLRB 1H6AA 4F45A 4K9DA 4RL6A 5A9SA 3R61A 2EKQA 4PLVA 3PQJA 2Y1FA 2CMDA 2BFOA 1K7AA 4R1TA 4U8GA 1U5TB 1XMKA 3V8LA 2OO5A 3SZPA 1GZ4A 4INAA 1WRJA 4TRMA 2CVQA 4H15A 4IQ0A 2EP5A 1U8XX 3GR6A 4Q3AA 1GTMA 1U28A 1X3UA 2NU7A 1NQOA 1DRVA 1GCOA 2FBIA 5ICFA 1ONNA 3BTVA 1M6WA 3EK2A 1T4DA 3F5SA 3PJDA 4FX0A 1LB2A 1CF7B 1IZ9A 1JKFA 4DTIA 3IIEA 4EUEA 3H5AA 1R16A 1ZUD1 2NYXA 1Z74A 4XBFA 2J3KA 3PXXA 4KTVE 4RVHA 3WGOA 4AJNA 4ZYGA 5B4TA 2KIMA 3DBLA 3IC5A 4EZBA 3ZPLA 1BVUA 3KB6A 4KMUX 3GH3A 3TQNA 1R7JA 3OQBA 2DPHA 1DDOA 4DMMA 3BOQA 5F1OA 2I99A 3TDKA 5KVCA 3H6KA 3GZNB 3PYLA 5J8FA 3F72A 3LSTA 2ZXJA 1GY8A 5HTOA 2HMTA 4L4RA 1G6NA 3VHRA 2QZ8A 1I5RA 1P0FA 1QYWA 3DTTA 4HNHA 3KV3O 2NQ8A 3NEUA 1S3JA 1EQ2A 3GNTA 3B20A 4HX8A 4UVGA 5AOVA 1P33A 1K3TA 4BKUA 4IS3A 5DOZA 5L7TA 1NFRA 3JQAB 2VUTA 2OHXA 3RU9A 1LLQA 3MZYA 1UZNA 2D0IA 2I76A 2OP1A 3GVAA 1M66A 2GYYA 4MP8A 1KYWA 3DDNA 3KLMX 5CG2A 3DXJF 3BMOA 2UYYA 3WTTC 3S2IA 2DI3A 4TRNA 1SD4A 4ND3A 1YL6A 4IPAA 2VHYA 3BTUA 1TT5A 2HYGD 2DUUA 4CLHA 4E0BA 5IZCC 2G0TA 2P91A 2X58A 3ZNNA 3JD0A 2G7UA 4XRRA 2E7WA 4EJWA 4TVOA 4KTTE 2X1HA 3NT4A 3WGGA 5LBQA 4XEHA 3SLKA 3PQDA 3CMMA 3WIDA 1IB6A 3B6ZA 2Z33A 5F1KA 3I53A 4JJFA 1IUKA 3I54A 1KVUA 3GUYA 1MGOA 4X54A 4D46A 5FO5A 1B6AA 2HFHA 5LHHA 1PUEE 3FPLA 2CGPA 4MIYA 2QQ9A 5JLAA 1J7KA 5KJ6A 2EEZA 2BELA 3PK0A 4Q39A 3PFIA 1RUOA 3WFIA 4CMIA 4RVGA 3QOPA 4EEZA 3FWEA 4ENNA 4KDEA 1T38A 2I3AA 3JV7A 3ANLA 1DXYA 4MKXA 1ZLKA 1BI1A 4L76A 5TQVA 4CLXA 2P8TA 2FPGA 3C3WA 2VZ9A 5K5QA 3CSDA 4OINF 4FCCA 3LA3A 1AOYA 3BPVA 4GMFA 3CO6C 2EFWA 2PD6A 5D8KB 3BAZA 3P2OA 4BNWA 5T64A 1SMYF 5KVRA 4EMSA 5HS6A 3LQQA 4KIBA 1P77A 3K73O 1FBSA 1H2HA 1DP7P 1DC6A 4RLHA 4WOJA 5TLSA 4AJIA 1OKRA 2OGUA 3PFWO 3LLSA 4CMAA 3F8CA 1V0JA 2D3TA 3PHJA 3HQ4O 1XN7A 4H16A 1U78A 3A1NA 4N54A 3TO6A 5BSFA 3HRSA 3F8NA 3W8FA 1K89A 5JDCC 4B4VA 1R4NA 3TSCA 3F47A 4UVIA 1Y8QB 5KVSA 2FHSA 4GLOA 3S2GA 1YQXA 3RC2A 1CF2O 3E48A 1OMIA 1QQIA 1EK6A 3BJ6A 4I5DA 3I23A 2HK8A 4WPGA 1N8KA 1X14A 1D3YA 3ONFA 5DUIA 4QO8A 4ALLA 2EGHA 3O3KA 3ISPA 1BTOA 2ZCUA 4YJGA 2K4JA 1VE9A 4E2XA 1ADGA 2K7LA 2O23A 2CVOA 1MKMA 1U4OA 3CUQB 1ISHA 4IVNA 1N92A 2HMUA 2OFPA 1ZO8A 1AE1A 2DU8A 4BMVA 5L51A 3RUFA 4H0EA 4OQZA 3QVWA 1TEHA 3TOBA 4BO7A 3DV8A 1NHGA 4ND4A 3VVBA 3BMNB 1XKQA 5G4KB 2Q1UA 3JQ6A 4DUPA 1QZZA 1R1VA 4HX4A 1YBMA 4NZ9A 3CLOA 4GCVA 3PI7A 4IDCA 1U8FO 2NVUB 3UKOA 2R3SA 3F22A 2NLOA 2DM6A 2BLLA 2GN8A 2GXGA 1RM3A 3BHIA 4BNVA 4GWGA 1XR3A 3ADOA 1KU2A 1BSVA 1JN0A 1P92A 1C0WA 4HF2A 4J7CA 1J75A 3WE2A 4ZZDA 3JAMK 1HEUA 2FMUA 1O8CA 1UJMA 2P9EA 2W4QA 1ZVMA 3ENKA 3GVIA 3ZU5A 4RO0A 4DYVA 2BV6A 2C54A 1T4BA 5G0VA 1LNQA 4XKJA 2F2EA 4L5IA 3H9QA 1XMAA 3RUHA 4ZA2A 2CY0A 3V1UA 4KFCA 5IT3A 4I2OA 3BZ6A 1IUYA 1MG5A 4IUYA 5CAEA 3Q6IA 4CLRA 5JDCA 1LSOA 2VYNA 3HDJA 3V5NA 4HV4A 2IA2A 1D7OA 5HOOA 3P7MA 4LRTB 3KE2A 3JSOA 5COQA 5IDWA 1O3SA 1N2SA 4NBVA 1H0MA 3BPXA 3H2SA 3HFSA 2KRFA 1ZIDA 3AY7A 4JJIA 2BBYA 1NNUA 1MLDA 2Y1GA 2E4AA 1MXHA 1HDZA 2DLDA 3WTCA 5FEUA 3QAHA 1NYTA 1T2DA 1V9LA 2O4CA 2O0YA 4CZZA 3UICA 3EZLA 4I01A 1NTOA 2Y48A 4HX7A 4BHCA 4EGFA 4GYGA 1PX0A 4R1SA 3RKYA 4BNMA 5GZ3A 1A9ZA 3ZV5A 4G6QA 4AJ1A 3JAMZ 5F21A 4U0WA 3E1KA 1MDMB 1EBFA 2JCXA 1I5ZA 2YHIA 3QQPA 4TV7A 1GDHA 2PZJA 4Y13A 1ZMTA 3UN1A 4IXAA 1F8GA 1ZEMA 3DBHB 3AI2A 5TSDA 2VCYA 5CVIA 1K0UA 1RYEA 4G8XA 2PK3A 2QRKA 3W8EA 2DTEA 2IXBA 1JTVA 4G65A 2GAUA 2HDCA 2Q1WA 4IIUA 3KZZA 2X6TA 3NYWA 3E6CC 1E3JA 5G0WA 5TJ9A 4H7PA 2YX4A 4KNYA 2OL4A 4ALKA 2H94A 4BV9A 5JYDA 4NFYA 2EV0A 2RNJA 1PJQA 4KMSA 1R37A 1ZJZA 2VE8A 3C7JA 3D5QA 3FBGA 4O0LA 4OJNA 3ZWPA 2ETHA 4E5NA 4E5KA 1DC3A 4I5FA 3IOYA 2CYYA 3Q11A 4GGPA 5EINA 1ZNQO 2QHXA 1CGPA 1L0OC 1SZJG 1R4NB 2BFPA 2HRBA 3K9QO 3KYCB 4JJGA 1XEAA 4ESFA 2DUWA 3GRKA 4A73A 2QRJA 2CWEA 4DL9A 1GXQA 2E48A 2QG4A 5L9AA 2A3SA 2IEDA 2X0RA 4Z0PA 4BL5A 3DBRB 3SFZA 1H9AA 1R15A 3GOHA 3IWZA 5JW6A 3AAFA 1Q2XA 1U4SA 3WLEA 1JGSA 2HWVA 4ZGWA 2P7CB 3I9NA 3K6JA 1E0DA 2VTDA 1MA0A 3QRWA 2DQRA 3CTMA 3JQEA 1HDRA 4LGVA 4KOAA 3QP6A 3S8MA 2W85A 1DIGA 3UGKA 5TX7A 4BV8A 1IN4A 3VKUA 2HK9A 3WMWA 5KJ1A 1AHIA 4RF5A 2HTSA 1UB9A 4IXWA 1LQ1A 4PCVA 1I33A 4FR5A 4BNHA 4MKRA 1PJSA 5L95A 1C0PA 4CYDA 4BMSA 3RI3A 4KN7X 3DBVO 2IZ1A 3KYDB 3JW4A 2GLXA 2ESHA 3RU7A 1EFKA 1KEWA 2UVDA 2HCTA 4OSPA 3ZNPA 4JQFA 3GGPA 5KK1A 2PEXA 1E77A 1GAEO 3ITKA 3OQ6A 1NP3A 1P4WA 5J8CA 2PJPA 3QP5A 4QXMA 4HF0A 2Y1CA 2VHXA 4LK3A 4M8SA 3TZCA 3V8JA 2GRAA 3V7SA 3IAHA 4Y8VA 5ILVA 2QQAA 4RVUA 3V8KA 2CNBA 1JU9A 5JPIA 4IY1A 2ZBKA 3NT5A 1T0FA 3QP9A 4L0QA 4Y6RA 2CDCA 3VODA 4FDAA 5FFXA 1P2FA 4NNJA 3F4BA 5BMZA 3P9KA 3R6SA 1P1RA 2PWZA 4ND2A 4HFJA 1TBXA 3RIHA 1JHHA 2EB7A 3DMTC 2VWQA 5BS6A 2W84A 1GQ2A 3GNSA 5DBGA 5CPFA 5GZ1A 2AE2A 4MVJA 2V6GA 4ZD6A 3B1JA 3IRRA 3DEUA 3FN4A 3L6DA 3KP3A 1KYZA 2PGLA 2SCUA 2GUGA 3PLRA 4UVEA 5DCWA 1OYWA 1Q7CA 3FTPA 4R3NA 4FX4A 4G81A 3RUIA 1UDAA 4YAGA 1YVEI 4L18B 1LQUA 4OU0A 5ILUA 4LN1A 4GL4A 2B5WA 3CUKA 4LVUA 1ONPA 4NG5A 3H7AA 1IZ1A 3EUHA 2GZ3A 6ADHA 4MQ9F 2GIVA 1KEVA 3EUWA 4JCOA 1JAXA 4L9NA 1WP4A 5CVUA 4IMRA 2HDHA 3H9GA 1R58A 2JZYA 3ZU2A 2ELHA 5JCXA 4M72A 4NB5A 4TMFA 4TZKA 1XIVA 3KVOA 2V6FA 4R9SA 2WYWA 1SOVA 3RD5A 4RF4A 1VKNA 3ECHA 1GEEA 5CYVA 1UUFA 1YO6A 2GGSA 3R60A 1UCRA 1YQDA 4XLPF 3ZWOA 3O8QB 2EP7A 4L9RA 4DREA 4F6CA 3RC7A 1A4UA 3ONEA 1EUZA 1Z45A 3SZTA 4B7UA 1YQGA 1H9GA 1IRGA 4F7ZA 3GUCA 4I0BA 2E1CA 1XYGA 2IA1A 4W7HA 1PP8F 3PJFA 4UV8A 1NFQA 3CTAA 1KVTA 2B0JA 2C7GA 3JQBC 3JQGA 1ZZEA 5LDGA 5JI6A 1LX6A 3F1KA 1YH3A 1IN7A 3ENNA 3DO5A 3RSHA 4DQVA 5E17F 4HKTA 4YT5A 3FF5A 1NWHA 2RHCA 3U1DA 3LT1A 3ZHYA 4FOOA 3WQRA 2P4WA 2IEBA 3ECOA 2NVWA 3FTNA 2J5QA 3AM3A 3AY6A 3NTOA 3QVXA 3FBTA 4S3MA 4B7XA 3X2FA 3NDIA 1DIRA 2EF1A 5CDTA 4PLTA 2Z5UA 4NBUA 3ZMZA 1FK8A 2EJVA 1P1HA 1PZFA 3ROQA 4WF2A 3WNVA 3H2ZA 1MGTA 2R2GA 2D4AA 3U9LA 4CQLA 2Q8KA 5C5IA 1QLJA 1HQCA 5KNLA 4NU5A 3NJ4A 4LLGF 4PLWA 5TT0A 4YRBA 2XKPA 2JJYA 5KJEA 4XB2A 4A10A 4A6DA 4MO2A 1XELA 2E6UX 3S1LA 3T7CA 3ZWCA 1JAYA 4JX8A 2NQTA 4S1VA 1OZAA 3K2BA 4KUEA 1K6IA 2A4KA 1R4MB 2PFBA 3GVCA 4WASA 4XGKA 3EDMA 2P5UA 2DT5A 4NR0A 2AXLA 4ZN6A 2DFDA 5FYDA 4FFMA 3ZN2A 2VWGA 1K79A 1OI7A 3D4PA 3EGOA 2XRNA 1YQAA 5ICEA 1DC4A 1N9GB 2VE9A 3AWDA 3E82A 4Y15A 1H9BA 3VZRA 4YPOA 1IRFA 1OYIA 4YXFA 5KKCA 2ESNA 2Y1DA 3JQAD 3TL2A 5DP2A 4CGZA 2P5LC 3LAPA 1YE3A 5HS8A 3U4HA 3BWGA 3C7CB 1HDCA 1DO8A 4M6XA 1YL5A 2GNAA 3E97A 5F6FA 4R3WA 4P96A 4B3JA 2NUAA 4FC6A 5CEEA 3S55A 3UXYA 3C1OA 3DFUA 3ETEA 1U7HA 7ADHA 3SXYA 4L73A 2Q4EA 3V2HA 4K6FA 3ZWBA 1X1TA 5ITVA 3GAFA 3RUAA 1G0OA 3OSUA 2GERA 2QQBA 1LXCA 1KEPA 2FRHA 1MJ9A 1P3DA 1N5DA 4EBFA 1ISGA 2EWMA 4U6QA 1GUYA 4RPGA 3OFSA 2ZKLA 3PWZA 4P55A 1S7OA 3J7AO 5TGDA 5A04A 2C5AA 1B2LA 3GG9A 3E3VA 1QYXA 1UAYA 3KEOA 2HGCA 3KXDA 2A07F 1WWXA 2C5EA 2EJWA 2B0LA 5JO0A 2WWRA 3EYIA 4YCAA 2Z1MA 1T2AA 4UEOA 4YQYA 3HDYA 2C20A 1ZGAA 1NQ5A 2PKRA 5G0TA 3ANMA 4AJOA 2XGXA 5FLXK 2EHDA 2EA4A 3ZWVA 1F4KA 2XUBA 3WTWC 1QYDA 4RVFA 3L00A 3ABIA 3SVTA 1FBQA 1LLCA 1YDEA 1ZEJA 3QA9A 5BSGA 3VOEA 3F8FA 3KYDA 5A06A 3R3JA 1DFHA 4U0JA 4ZU3A 4WUVA 1K6XA 3F21A 3NUGA 2R6JA 3LA2A 2D5CA 3OBBA 1KOLA 5EESA 2AG5A 3ROPA 3KUXA 3UH1A 4DC1A 2DFIA 5HLHA 1DDNA 4HFRA 2HS5A 1PS8A 2VN2A 4HBLA 3I59B 4YTEA 2YV1A 4F3YA 1EH8A 4P5OA 3WGIA 1N1EA 4EYEA 4CMGA 2Y93A 2LKPA 2W24A 4FGWA 4KP7A 4BGIA 2DTRA 4DBZA 3GF4A 4ND5A 4N7RA 3IP1A 4AJ4A 1U3WA 2IZZA 1J0RA 2Q50A 4CR7A 1HDXA 4GXOA 1F12A 2X0NA 1S6LA 2C07A 3W6ZA 4J4BA 5GMOA 2MH9A 1SO8A 4DNCA 1Z6TA 2NVBA 1FDTA 2K4BA 5HS9A 1DJNA 1UHWA 1V3TA 2OBYA 2PGDA 1WW8A 1KY4A 2X5OA 5H20A 3NJ8A 5A05A 4LSWA 4FHTA 1O89A 4JK1X 2IZ0A 2OZPA 5FI3A 1ZLJA 3GO5A 5FD6A 4GGOA 5EQDA 2DK8A 3WTUC 1VTNC 3O9ZA 4BKPA 1W4MA 1KVQA 2L02A 1ZXBA 1B4AA 1KIFA 2W2LD 1D4FA 2PFGA 3DC2A 2ZNZA 3CDHA 3ZGYA 1ZRCA 1ZAOA 1HBXG 1FDSA 4BYYA 1P44A 1NR7A 2WD7B 3GN2A 3M1LA 4MVJD 1ODDA 1C14A 1JQBA 2O03A 2QLZA 2FSVA 4OIMA 3D3WB 3J80K 2UZKA 1G3TA 1CRWG 1R66A 2EV6A 5AXCA 3NRVA 5T67A 4A0SA 1DHRA 3DTYA 5JDIA 3PYXA 4N9IA 1U5CA 4QLCU 1W0CA 4Q48A 3AM5A 5HRUA 3WGHA 4RZIA 5A3VA 2QZZA 2LF7A 2PTGA 4XZ3A 1SFEA 4G7HF 2V9VA 2PI0A 3E6AA 3OEYA 1UP6A 2I6TA 4HFMA 5BNFA 1LEAA 3HTUA 2VODA 2CW0F 1KQ8A 4YAKA 1GR0A 2TMGA 3IQDB 4I08A 3L07A 5CJ9A 3FNEA 1GUFA 3TO9A 1JVSA 3JQFC 3OICA 3RIRA 1AHHA 3STHA 2BMAA 4XIJA 1XSDA 5D5UB 3PGJA 1KA8A 1LJ8A 5L3ZA 3ZHXA 3GLXA 3I5MA 3WDSA 4ZQHA 5L3CA 2VRCA 4BNIA 1TTYA 1V4RA 4RB0A 1U1IA 2I66A 3ZMSA 1E1MA 5C3MA 3AUUA 2Z5LA 1BM9A 2M1BA 4OOEA 2A68F 5ED4A 1EEHA 3N74A 3GX4X 1DIAA 2Q2EA 2CDBA 2XXJA 3VZSA 4YFNF 4XGIA 2FY8A 3LDHA 3LC7O 2A9FA 4JBGA 4XDZA 1F0YA 1DEHA 3AFMA 1D8JA 4BNTA 2FWMX 3F6OA 1ZK4A 3WYEA 5KJCA 3P19A 1OPCA 4BKQA 3IUPA 5IXSA 3PJGA 5E18F 1YOVA 4CUKA 1E5QA 4MPDA 3HFGA 3JQ8A 4A0YA 2E1NA 1T39A 4ZQFA 1DFIA 3JYPA 1Y81A 3C1DA 3WODF 3HHPA 3FX3A 4TKLA 2VZ8A 4NJMA 3WBFA 4LFUA 5HS7A 3ZZNA 3BP8A 3FR8A 3TDZC 4I5GA 2YHUA 1HE4A 1LU9A 4TROA 1HYHA 4Q3NA 2VN8A 3FMQA 2IRFG 1OMOA 1XU9A 1QBJA 1ZGJA 1Z6ZA 1YBVA 2O50A 4DC0A 1BDBA 1ISIA 1HYGA 2HRZA 1WVGA 3C1AA 1W8DA 3LA7A 2AQ8A 4M6YA 4OOIA 1P45A 5T8KC 1RNLA 1C1XA 3PFFA 1ZHFA 7MDHA 1EDZA 2RAFA 2PY6A 1BI2A 2PR2A 5K0ZA 3JD4A 2GWRA 1MDMA 1GCUA 3BHJA 1E6EA 1GPDG 5LHGA 2QVOA 3OQ1A 4R69A 4CXFA 4YJHA 4AJKA 1VC2A 2FU4A 1Z7EA 4D0PA 3KETA 1SAYA 1JVBA 2RC4A 2X5JO 1IN6A 2ZKZA 4J1NA 3MZ0A 4XWYA 1NHWA 1XCBA 1YGYA 4OAQA 2OUIA 4RCVA 4ZJUA 3UOGA 2G5CA 4ESOA 1HZJA 3INGA 2V1DA 3O2PE 3TRIA 4E2YA 1USTA 2NADA 2OXIA 4DLAA 4HP8A 1PR9A 3OJEA 2XVCA 1NHAA 3E6BA 1VPDA 1XQ1A 3A4VA 3AI1A 4NDNE 3GN1A 5ER9A 3PHIA 4J49A 4MVJP 4NI5A 1UXJA 3QIVA 4WCFA 3TGNA 1K78A 3KP7A 3MJEA 4DQUA 2L4AA 2AA3A 4AIKA 4ESJA 4G7ZF 1E7WA 1YJQA 3HYIA 2ZCWA 1KS9A 1LEHA 5I8WA 4JGBA 4EJUA 1FC3A 4D41A 4BUCA 2C82A 3O38A 1MV8A 3PRJA 3BROA 1T1SA 3ZWWA 5ILSA 4QFCA 1EUCA 1EVIA 5T8KA 4DA9A 2ACJA 3FCOA 4B8XA 4OMUA 3RUDA 2AQHA 4R1HA 5BNTA 4B79A 5G4KA 1VI2A 5JC8A 5HDKA 4IDAA 3H3ZA 4XRGA 1SB8A 2B4QA 5BQFA 3TKYA 3N4MA 1NQTA 2PLYA 3I6QA 3ZW9A 5K6AA 3M8FA 1PZHA 2X0LA 5U9CA 2CUKA 2F00A 1K5HA 3SBOA 5ICMA 4BNNA 5A03A 5CVRA 1U2WA 1ZSYA 3GA0A 3M2PA 1XGNA 3QVSA 3W4IA 5IN4A 1UXIA 4GQAA 2CFCA 4HAMA 2ZB7A 4Y67A 2HK7A 3JYLA 2RGVA 3ROKA 1D1TA 5ERIA 1QORA 1W73A 4CL3A 4DGSA 3W1VA 5FWNA 1VL8A 2EERA 4PFJA 2AXQA 3INTA 2ZMEB 4WKGA 3VTZA 3WFJA 4DIOA 1QRRA 4MOWA 3E6DA 3U9GA 2HQRA 1EVZA 2DPUA 4PIVA 4XQ9A 1E6UA 3ROMA 1A5ZA 4CMEC 4XGNA 2J5OA 5A2QK 5F5NA 5HDNA 3K31A 4ALIA 3I5UA 4EITA 1REPC 4KMFA 3MJVA 1NQAO 2Q4BA 2FXAA 1ZG3A 4BNCA 1U5AA 3JQ9A 4II2A 1ZYRF 2EFNA 3D64A 4U5QA 5IZ4A 1J2XA 1VSUA 2G76A 1IXCA 2QX7A 3NDRA 3PEFA 1Y6JA 2FF4A 5BSEA 3QSGA 2P9GA 1QMGA 1TW2A 3RYPA 1YWGO 3WTYC 5F3RA 4XB1A 5TC4A 1SD7A 3ONDA 5JC1A 3L9WA 1YBAA 3H4VA 3ASUA 4NK5A 3J81K 1PJCA 1PR3A 2HKIA 4R1UA 1FYKA 3A06A 4HWKA 2Z3YA 3AOEA 1BN5A 1N1GA 5DF1A 3MQ0A 1ID1A 1Y7TA 2UUOA 2C2YA 3COSA 3GEMA 1LDKB 2WMDA 5K1YA 4ZQGA 1BOAA 1HKQA 5I8ZA 4C7KA 1M76A 1P1FA 2BGCA 2VUSA 4RGSA 2Q1SA 1B1BA 5L7WA 3QU6A 3HADA 3NEPX 3HN2A 1JLLA 2IVMA 3NV9A 5AIPA 4LG0B 1FDUA 3OEWA 4OXYA 4KQXA 5LDHA 1B3BA 4E12A 1KBZA 3U3XA 3HSRA 1UR5A 4M86A 1YOVB 4BNFA 4DRYA 4CQMD 1KETA 1B9NA 4M71A 4R51A 3S2WA 1LLUA 4J1QA 2YYYA 4R79A 3WE3A 2MLGA 1ZSVA 2CG4A 4ROSA 3PLNA 2QENA 1GV0A 4GX1A 4Z0HO 4FIZA 2RH8A 3F3SA 3L7WA 4JP3A 3GG2A 5L3BA 4FS3A 3D4OA 3TOZA 3WOHA 4PN3A 1SFUA 4CM9D 2VHVA 1JE8A 1HL3A 3ORFA 3LYLA 3RAJA 1GD1O 1Y0UA 5D6EA 2QW8A 4MP6A 1XGMA 1WXDA 2F1KA 1HLDA 2O3TA 3DZBA 3V1TC 4IMPA 4DLBA 3K2ZA 4TRRA 1I30A 3SJ7A 4R4JA 1C0KA 3W8DA 1HDYA 3JD3A 3Q9UA 1E3EA 2D8AA 3KFWX 3ERED 2RBEA 4K6CA 3Q2IA 4UEJA 1FSEA 2LSOA 5LCXA 4PZEA 2VUUA 2D1VA 2D2WA 3WTSC 1A71A 1LSJA 3TWOA 1IPFA 1B8UA 2ZATA 4AJHA 3FMRA 2ZB8A 2BE5F 3IJPA 3JQ8B 2XPCA 3SC6A 1GV1A 3I4PA 2JTVA 2P5VA 1YW9A 4ZZLA 1LSUA 1YONA 2G17A 3IP3A 1TI7A 3WQQA 3B02A 1U5TC 1QYCA 3MCZA 1V3FA 4A2CA 1LTHR 5GY7A 4BO6A 1XGSA 3HZZA 1PS9A 3TFOA 3ETGA 4K26A 4G5HA 5JAMA 5H6QA 4XYEA 2GO1A 2VYVD 3BZUA 3T8RA 2M45A 2RCYA 1NAHA 4RF3A 1NPTO 2NV6A 2ZTLA 3Q1LA 1C1XB 1XHLA 4OSOA 4W9NC 2Z1NA 2QUFA 4FD3A 4LRSB 4TQGA 5BPDA 4KUGA 4E5PA 3E5QA 1BC7C 1PJBA 2OOSA 1MB4A 4HQMA 1CEQA 1G3SA 3ZQ7A 1PJTA 1PZEA 3KOUA 4HXYA 4CM4A 2QBYB 3DZIA 3GZNA 2V6BA 1P6RA 4J4TA 4LW8A 4WGGA 3FXRA 3TZ6A 3U09A 1ONOA 5B4VA 2YQ4A 1PJ4A 2DLLA 5J23A 1E1NA 4PLPA 2EJRA 1GXPA 1SAXA 2ZYAA 4LMRA 4YR9A 5DUKA 5H82A 2NNYA 1YW7A 1T6SA 3VFZA 4XSZF 1ZH5A 4HQEA 2CF6A 4P4LA 3QPTA 4ESBA 1WNTA 3EY4A 3C18A 1ISJA 1WDLA 4XCVA 3DZFA 4NQWA 1W4ZA 4U6SA 4Q3CA 4OMZA 4D0RA 4PZCA 2PD4A 4IJUA 4WXDA 3JTMA 2ISZA 5TF4A 2GZ2A 3GC6A 5JBIA 2XHKA 1X7GA 2W98A 3AOGA 1C0IA 3G17A 5T6BA 1FJHA 3MOIA 3VEPA 3QVTA 2VNAA 1HW5A 4BS9A 3PQKA 1Z7BA 4AIHA 2VQ3A 1GQQA 5JCJD 4HDVA 3CUQA 3ZMTA 3T4XA 2CFXA 3H5RA 3EETA 2XXBA 5A5FA 1ZKMA 4MHGA 2O3QA 5JFOA 3P9CA 1ULYA 2D1HA 4PLFA 3HRTA 4N5LA 4UUMA 3SX2A 4FOSA 2RVCA 5D5VB 4W82A 3L2CA 2MH2A 3ZU4A 1DPRA 5H6RA 4IHSA 1X1EA 2YQ5A 1WLYA 3ANNA 3F1LA 5BSHA 4L9JA 4N18A 4M55A 3QU3A 1HF3A 5DD4A 4D3SA 5KIAA 2QZ9A 1AGNA 4DLLA 2P7VB 2VBWA 2HOEA 5E1WA 4O3MA 4NFSA 4U7DA 1S7AA 4MDHA 1R5HA 4IDGA 5L3DA 3TL3A 5AYVA 2TMDA 2C59A 3WX0A 4PLGA 4YVFA 1SEVA 4GWKA 4JNKA 4MEXF 1GQYA 4BB5A 1E1KA 4IGEA 4Z3KA 3GUDA 2V7PA 1DIHA 4MVJG 4HV5A 4QQRA 5DT9A 4D42A 3FRJA 4ONEA 5L40A 5L7YA 1IN8A 1B26A 4UHTA 2YY7A 3AM4A 3SQNA 2H63A 1ENPA 1KGSA 2XASA 1ML3A 5F64A 1AWCA 2AQIA 5DOVA 3ST7A 3RYRA 4LK1F 1FF9A 4YIIA 5BQTA 2CQKA 4ALMA 4YJDA 1LEBA 2YJZA 1XSEA 3F9IA 3F6YA 1MP0A 4OIRF 2Q1TA 2Y1OA 1PWXA 3LC2O 3OM9A 4BVAA 1ENOA 1V35A 2GN9A 4FB5A 3J81Z 1NPYA 3IJRA 4XIYA 1LDNA 4Z3DA 1UZLA 3VH3A 4CPDA 5I9LA 3PGXA 1OOEA 4B8ZA 5BOXA 4KWIA 1WAMA 4RB1A 4CLOA 4ZYDA 4ETSA 3I52A 4LISA 5AXAA 1KEUA 5EEHA 4OHUA 1R0LA 1ADCA 3H3FA 3ZMVA 3ZWAA 3U4CA 5LRSA 2ZB3A 2H09A 2YDXA 4BNJA 2GA2A 1YW8A 3L6OO 4E30A 3LC1O 2Q46A 4IZHA 1WDKA 2W2LA 3DZHA 3GVHA 2LNBA 4LCEA 2GXBA 4IZIA 3VDQA 3WGQA 3E18A 4G2NA 3WJAA 4J91A 3F3XA
chains in the Genus database with same CATH superfamily
2C1EA 1PSZA 2RI6A 3ZHOA 1BH2A 2CC2A 3VKVA 1TVMA 4O4IA 1VL0A 4CKXA 4E21A 1MTOA 4EGJA 2ONZA 4CEJB 1NG9A 2R4UA 1G8FA 2F62A 3DDCA 3AKDA 3I42A 4EFMA 1HMPA 2FEOA 3H05A 5LQNA 1QAQA 3M34A 4F6RA 3LW8A 4BV9A 2AR0A 3T4UA 1AA7A 1A7JA 3CC4I 3ZD9A 1QF6A 1M3SA 4MS3A 2Q3BA 4MUAA 1NOIA 4O4HA 1E94E 3K2EA 3ZW7A 5J59A 3DDZX 4C3UA 5B3LA 3M6MD 4IRIA 1XQWA 1Y6QA 2CLKB 4H7KA 1OBVA 2O0MA 3I8SA 4HYTA 3CCVI 2IDZA 2HLPA 5D3QA 4D79A 4DA0A 4NSNA 5K03A 5HNFA 1H4SA 3ZVNA 2V96A 1SQFA 1CHDA 1FJLA 1N25A 3O95A 4S1PA 5AQEA 3RNLA 1DCMA 1D7AA 3IAXA 3JVDA 3A1EA 4TV9F 3CZCA 2ONJA 5BURA 3RZDJ 4DSTA 3AM1A 4RULA 5EP2A 3CX8A 4LSZA 2JDID 1E3LA 1VHWA 2X41A 3GEBA 4EHAA 3ELBA 1RI2A 5ELMA 1OV4A 3WYBA 4KT6A 1TLHB 4UDOA 3Q6NA 1B8OA 4FE4A 3UUWA 5L45A 3FM5A 1XX5A 1M74A 2X0IA 1IUOA 2DWUA 2D2VA 1GYQA 1KJWA 1O9BA 3VA7A 1RRCA 2YINC 2FE3A 3AGPA 5IPFA 2AJDA 3B1YA 2PPVA 5GVSA 3HHHA 1DSSG 3RTRA 3UATA 2J41A 4UM8B 5HILA 3C2HA 2A7XA 1FOKA 5TNXA 4ZIRB 5FUMA 1DT5A 5FKLA 3MOGA 4A6EA 1GTZA 3VPXA 1TC3C 2L01A 3U4IA 2BUBA 4IIXA 5FPYA 1AZWA 2FEAA 2OO7A 3ZXSA 3WJ2A 2BR4A 4FDVA 1BVRA 1M67A 1QH9A 2L42A 3CUVA 4Q9HA 4DLYA 3D6NB 2NP7A 1HYEA 2VYND 2EK5A 4WY2A 4WI1A 4IJMA 4OHBA 5JCJA 5JHHB 1SQ6A 5GIPE 4U7GA 5KYVA 4HQ0A 2HA0A 3IKTA 1Z16A 2I6FA 3II6X 1TWAJ 3ORRA 4I7EA 4NDLA 4KH0A 1IK4A 1Q0TA 5J3LA 3K4PA 5CURA 4IJWA 2I9PA 3GLHE 4M60A 4AVPA 2VWPA 1RIOH 1JIXA 2V8OA 3GRPA 4M0PA 4B9AA 2IYPA 4DKXA 4E51A 3UQYS 1ORTA 1X70A 2G1UA 3E8SA 3IQXA 3BJAA 1A50B 3EQLF 4MHTA 2HOSA 5DP1A 1WY7A 1H6CA 2A5DA 4TMVA 3G0HA 2DT7B 1NJ5A 1T29A 1Z05A 3AILA 3FI0A 1LRJA 1M34B 2PZGA 2VP2A 2VNJA 3P71T 1MC1A 4GAEA 5JUWA 1MRNA 1H6BA 3G7NA 3SQDA 4PZ0A 1MB2A 3FPCA 5JSYA 1R0WA 5DULA 4P3PA 1YDFA 3I2JA 3IE0A 2FPXA 1L6RA 2Q3FA 5LGUA 1ZUIA 3RC1A 4MWBA 1PL6A 1V9CA 3EQ9A 4BIIA 1HETA 3SYRA 2BFFA 3H0EA 1VQ4I 2Y4OA 3OWOA 3PR1A 3ENZA 4YDRA 4ZP1A 4O4IB 1CEYA 2JCYA 1FYDA 4PG8A 1MW8X 3L93A 4OXQA 4YT2A 4O2RA 1O6GA 1V8PA 2HU2A 3QTLA 2XUAA 1D3AA 2AUMA 2FB9A 3CHYA 2JUCA 4ZC8A 2RGNC 2A9KA 1LS6A 4K9RA 3RQIA 5FLVA 3RNOA 4YMWA 2CSOA 3ZV6A 4DM4A 1W7PD 4RSRA 4B5LA 3DAGA 1P7WA 5KUTA 4DB4A 1MJFA 1YCHA 3K0BA 1FTNA 1JDVA 2BZ0A 3GK3A 3L4EA 5EC8A 4ZVOA 4XCVA 1UQRA 4LBYA 2HK6A 2CLEB 3HN7A 3ABTA 3B60A 2R5NA 4JGGA 2QTVB 4IIYA 1CJCA 4KFUA 4ND8A 5AHWA 1BKSB 4UM9D 5DN9A 3AINA 4DZJA 1DZ3A 3EQ2A 1FNSA 1SBNE 2X6XA 1J24A 3MLBA 2MD5A 2G09A 1KWKA 2GWHA 3KPWA 4G23A 3QXSA 5FOWA 2F4MB 2OV6A 2DFNA 1LVHA 2Y71A 2ZQYA 3BHMA 3LPDA 4HV6A 3BMXA 3E4DA 3FYDA 2VRCD 4HNAA 4WZAE 2C88A 4RD6A 4WOBA 1W0KD 3UA4A 1J59A 3ESQA 3AC0A 3IDSA 3OOJA 2ZZKA 2VPLA 3QX9A 4IVPA 3LHKA 4O59O 4AXXA 3UANA 4AKGA 2L7FP 4KXNA 1J5EB 4UFNA 5I4BA 3ZEIA 1FEXA 3PR3A 4YS6A 1VL6A 1M6YA 1SUCA 1T36B 3BWEA 2DO7A 5E38A 3PE6A 5SYAA 2PRJA 4DOZA 1WUKS 2P9CA 1BC8C 1VBNA 3FCCA 4J90A 5BQPA 5DNYB 2WG1A 2D3WA 5E20A 4NYMR 3RODA 1UINA 3QMPA 1K83J 2Y1EA 4DXDA 5TQ0A 4KN4X 2Q6KA 1K3UB 1SXJC 1BXRA 4LZPA 4AIIA 2B4TO 1XU4A 1KMCA 3PZRA 3ABSB 1LZKA 1LGYA 2ORIA 5L4LA 3KP4A 4KODA 4K9NA 5BNZA 4N5MA 3DR5A 3P94A 3IC7A 1UFQA 2EGGA 3HRMA 2VJIA 1TZMA 2H8KA 4WLFA 5T5QA 3DO8A 2ZYWX 4UM9B 1B1AA 4IIEA 5LOVB 4G9YA 4O5VA 2E4ZA 3I39X 4DTCA 2TYSB 4DM3A 4KHZA 2YN0A 3OA0A 5A3QA 2HQNA 5KYWB 1BH6A 2OBNA 3RKQA 3P7NA 4P3YA 1K6JA 4IG4A 4J03A 3DVAA 5CGZA 1CUSA 4B7CA 5MDHA 1T43A 1XDSA 2D54A 1JIKA 4GM4A 4HLDA 3H8WA 3M6AA 4UEKA 4PG7A 1TTTA 3FYCA 4IAOA 3E7DA 5JD5A 1UPFA 4ALNA 1TM3E 1CJUC 5F1PA 1N8NA 1RVV1 1WETA 4XKBA 5E8GA 3AL2A 3NOXA 1VRVA 4X6UA 3ZIAD 1LPOA 2WJJA 2CNDA 4MLPA 2HKXA 4ZDOA 1II9A 1ZUNA 2DBVO 3R4KA 2A1UB 4OBWA 1O3TA 2GPBA 1PVEA 2ZS7A 2FG7C 5CGQB 4DDTA 2PT5A 1HK7A 5DHSA 2NAFA 4N01A 1VRWA 5B1DA 1T9BA 1ONVA 3DPTA 4L3WA 4GRAA 4ZICA 2CZQA 2ZJZA 1THZA 1WQ4A 1L7VC 1E3HA 1M1ZA 3IIKA 4L78A 2QB5A 2JA7J 4BBJA 4C76A 3BWVA 4XIIA 1K4TA 3G1LA 1NX6A 4G0MA 4JOQA 3TX2A 4K1LA 1ENYA 3E9CA 2FDXA 5IARA 4P9UA 4Z9BA 3KZYA 3TPCA 4ZGBA 5HM8A 5HKAA 5CCDA 2IHYA 2CNNA 1E2HA 3GJYA 5ITZA 3OJWA 1P19A 2JD2A 4A0RA 1XUOA 2PWBA 4WAUA 4CV1A 2NO0A 2PUVA 2HAEA 4TWIA 1S2IA 4I50A 3H65A 4CQMB 5F04A 3KO8A 3Q3JB 1NW9B 2X8WA 2XMPA 4RQAA 4AKEA 2YV3A 2RJNA 5BYKA 2DHEA 1PYGA 2JGDA 1TMOA 3KZKA 2VTBA 5FUYA 1JW9B 2AI1A 1M1YA 4NPCA 1DINA 2QWWA 5I51A 3RSZA 2IXSA 1QHIA 1TQMA 2J30A 2F2TA 1DBIA 3BBLA 2BT4A 2VXOA 3C0KA 2EX4A 3O6BB 3RPUA 3L7BA 1GNRA 2ZTVA 3RTAA 4YFKF 3DAYA 4GSKA 4UTXA 3ND8A 3LKVA 4XLZA 1V26A 2VKVA 5EPOA 4YMTA 5GINE 5D3MB 1PIWA 2CUTA 3BN3A 4DHEA 4DJAA 1UBNA 4J0HA 1Z06A 3CZRA 4IHJB 1E0SA 1J5PA 3I32A 3HI6A 5CHYA 3E1GA 1TZ2A 5TRTA 4D6PA 2IDKA 3JWGA 1H94A 3THXA 2EXXA 4IIVA 3EXIB 1SN7A 4N0BA 1HOXA 2L54A 3KCQA 4I19A 5TPWA 1CUUA 4LGCA 2PV0A 4L22A 2X48A 1Q22A 3MJHA 2ZXIA 1PHRA 2O1SA 2QPTA 3LGXA 3SDSA 2HNKA 2YV4A 4QC2A 1H3FA 3EW9A 1XXHE 2IEGA 3NXSA 4S12A 5AKJA 4CI0B 1TM1E 2WB1A 4C0AC 2IHZA 1NX9A 1R00A 5BT9A 1WE2A 2JKZA 4B82A 3JVUA 4MR8A 1U0RA 4WWCA 1S2MA 4BEJA 1JDJA 4G1CA 3GHHA 1Y98A 2C2WA 2QLBA 3DVQX 5FX2A 1DAFA 2GK6A 2M6LA 4HBGA 1KBQA 4WLOA 1EMDA 4I99A 3QH4A 4S05A 3OIGA 4KZKA 4AD9A 3I9OA 3E9RA 2PMUA 1JSCA 1CQJA 1DAOA 1OAAA 2Q45A 1MC4A 1Q3KA 1E7YA 1MD0A 3RDIA 1P74A 3MWEA 5EZQA 1VGVA 3T5BA 3K9CA 1VLZA 3TN7A 2WIJA 3Q3IA 1Y9EA 4DJEC 1JZQA 1OB2A 3COJA 1OWPA 2WF8A 4AYBN 3LSIA 1SCUB 3L8YA 4G0ZA 4I8XA 5GIOE 2GNPA 1I39A 1RWBA 4R1OA 1FIAA 1QWSA 1G5QA 4XB6B 4RLQA 3L1UA 4NK4A 3RVLA 1Z4OA 3U5TA 2F17A 1YTUA 3CLRD 2ZWMA 4F9EA 4XCXA 1U8CB 1UMBA 2M30A 1C9YA 2P0YA 1XTVA 1CZKA 2XVZA 3F2IA 3OETA 2PA0A 3IR7A 4HI0E 3ULKA 1PQUA 3UJ8A 3MERA 2V8BA 5TRDA 4QXPA 3R44A 4U02A 3VHXB 1MTZA 1RLTA 4GKBA 1KDYA 4LVOA 3URKA 3SOPA 1YUNA 1V39A 2OAP1 5E9JA 3LAJA 1Q12A 1JGGA 5ITZB 3STUA 3KHSA 4BE4A 3I0NA 1SPBS 2CXSA 1Z0AA 2HWXA 2IFTA 1LSSA 2YXDA 3FLBA 3E4CA 3QHPA 1GZDA 1R9NA 1KI4A 1MO2A 1Y42X 4ENKA 4L0YB 4GPAA 2O3RA 4LRUA 3V4FA 4W5QA 2KPOA 1G21E 2ZQZA 3MQFA 1TM5E 3G0IA 1LBHA 4ISBA 4YYZA 3CX3A 2FFQA 4DLZA 2W1OA 4AI6A 3A7DA 4F6LA 2OG1A 1YZVA 3WK9A 4QRDA 3C8DA 3L01A 4UTVA 4I4TF 3F7TA 1UFOA 1YQUA 2JT1A 3TO7A 2KHMA 1NVAA 1KPIA 2D1RA 1JIIA 5ARBA 3C7AA 5CEJA 1PYVA 2YJ4A 3OIOA 1DAHA 1JDUA 2VHTA 5A0VA 2HEGA 2LZ0A 1ZQ1A 2HDOA 2QN3A 3E9NA 4TPKA 1D09A 1I5OA 5ESDA 3GZ6A 1YZLA 2C9YA 2GEUA 2YASA 3B78A 4LJ4A 4UUBA 1OXUA 1U7TA 1FS6A 3FMSA 1OF1A 1SXGA 3DM5A 3TR5A 3SQXA 1BX0A 3RFUA 4RFVA 2Z0MA 3T95A 4G5YA 5TMPA 3ZHVA 2OV8A 1I4LD 4Y2XA 4F2GA 1PWZA 4Q24A 3R7AA 5IAAA 2V58A 2FFBA 3GZ5A 3HS3A 4TV8B 1OXSC 2I54A 1GZUA 2JFPA 2CJJA 4GX0A 4L5CA 2I7DA 4YREA 1UDCA 1A0OA 1U3GA 2R1TA 3G85A 3UAOA 4UNNA 1FTWA 1M1NB 5SZKB 3AVXA 4NFHA 2P3OA 3BIFA 4OATA 3F6PA 1A6QA 4ZDLA 2PBZA 2DODA 1ST2A 5E4JA 1RQNA 4LNAA 1C2YA 3UT5A 2PGIA 4YO7A 3TLGA 2AOWA 2BCJQ 1FSZA 3RC3A 5DLPA 4HRXA 4FN4A 5EHIA 3DF8A 1JQ3A 3KKMA 1N0WA 4CMCA 2DYSH 3B73A 1P2GA 3CPSA 3ISTA 1TT0A 3IURA 2DA1A 4K9MA 1ZGWA 3FKIJ 1E1LA 3JQBA 2WHEA 3RWMB 3AR7A 3OJOA 4IR7A 1DJQA 5D8DA 1ILEA 4NYJR 1BOFA 3ZWNA 1PGPA 4YIRX 1K7FB 1F9NA 2XUOA 2BY3A 3NWEA 5DXJA 5HYVA 2J46A 3KSZO 2C42A 3X1KA 1EZZA 4A3JJ 3CR8A 2OAGA 3W05A 3DSRA 3ZY6A 1BMTA 2Y68A 3KKKA 2HKOA 2PS3A 3LFHA 1E3MA 1QIDA 3LZDA 4RB2C 3BF7A 1K61A 4IIJF 3BJOA 1XO1A 4WY8A 5K3EA 1FDVA 2KPMA 2I4OA 1W87A 4I55A 3CZ4A 4K28A 1XU7A 2FAXA 3F5MA 3P97A 3BRWA 5EWJB 3E3MA 2OM6A 3P9YA 4R2JA 5KNCH 4DQXA 2ZMEA 1GWNA 2GD6A 3ASZA 1H23A 1N6LA 2FOXA 3SXUB 5FFFA 1S2LA 4A6XA 3L6EA 5M2QA 1JGTA 1YK1A 2YFYA 4EI8A 3MWJA 4LYEA 3AG2H 3W06A 2OD9A 5TMEA 4DR6B 2D45A 2G1PA 1I3NA 2A86A 3N6XA 4FOLA 4ID3A 2X7XA 5CM2Z 1XI2A 1Y1RA 2Y1LA 3C85A 1M1UA 4JJKA 1SXJB 4P38A 1IJBA 4PIMA 4HXFB 1C8KA 4X6YA 3R09A 3H3XA 4CHTA 3OPYB 4XD7D 1Z37A 3K4JA 2PJDA 5CT6A 3AHHA 4LQCA 3DBLB 1MIOA 1YS4A 1FTYA 4LJ9A 1NBOA 1XB2A 4YV7A 2WOOA 4V24A 1G5HA 3DHWC 5BOSB 4I9HA 4PPGA 4EI2A 5U9CA 2EYQA 3HUDA 3OJ0A 2K3PA 2ZNYA 3TPZA 4FD2A 3MKZA 2OBXA 5L4SA 2YOGA 1FPQA 1M2JA 3D0QA 3H2IA 3A1FA 4QJ4A 5CW2A 4QTTB 4BNTA 4BU1A 4YMGA 2C83A 5IVKA 3A1CA 5AM3A 3W78A 2RARA 5G2OA 2PX5A 3IXMA 3PC8C 4N3GA 4WK8F 4RSHA 3E5XA 2ZSBA 5I48A 3R4VA 4ZU6X 4CF6A 2W82A 3F6VA 1I10A 2P1ZA 3TKLA 2XYQA 3TRJA 4EGQA 5FAKA 4TMTA 1HE1C 2VDPB 2KIUA 2KBEA 4JKYA 1JG2A 2B8TA 4OIOF 4ZFNA 2HOTA 1UKYA 3TIXB 3EFOA 5JAOA 1T95A 1SOWA 2JL1A 2I8DA 1QCZA 2ZDHA 4NENB 3CQZJ 2PBIA 1DAMA 1G6OA 4B73A 4NCAA 1OZ0A 1FRNA 1W85B 5K0TA 2FMIA 3V8EA 4PVDA 4HX9A 4RY0A 4AF8A 2QMYA 1WXXA 2SHKA 3UTDA 1D9ZA 2E34A 2WD8A 3G9UA 3IVMA 3M1YA 4KYIB 3HUGA 3KWJA 4XMYA 3P1JA 1TE2A 1ZN8A 4TWJA 3SS9X 2W70A 2LR0A 4DCPA 4EKDA 4AIJA 1O95A 5M34A 2EH3A 1YIOA 3JSPA 1HQKA 1HFJA 1BXGA 1CZHA 4V0RA 4C4XA 3QUTA 4D3FA 1ODIA 2PLRA 4BE1A 4KO4S 3ZQFA 2ZI5A 1EKXA 1T3SA 1WI9A 5CVCA 4Z4HA 3L4SO 3SICE 4YJ2A 1BR4A 4XLAA 1UMDB 2G67A 3A9VA 1GADO 5BYAA 1HNNA 3BR6A 1M33A 2W6ID 4M1EA 3JRFA 2E2WA 3O73A 3DKYA 3WAJA 4BH9A 2IYAA 5B1YA 4H3SA 2W43A 1VHTA 3R7SA 3GFIA 2ILTA 3I45A 3QPHA 1CX9B 1T2EA 2PZEA 3CG4A 3NQOA 3IV7A 3NRBA 5U1PA 4XSXF 3RBVA 4YMUA 4CR8A 4ECAA 6ABPA 4CIDA 5EWJA 3AJDA 4F3RA 4WERA 5HQJA 2OCIA 4AIRA 2DMTA 5FIUA 3ICOA 3QPVA 4GZMA 1OI3A 1X0VA 3OFJA 2I22A 1VKZA 1YMQA 1JQAA 5AM0A 4Z0NA 4YP1A 4U87A 4W8HA 5KU1A 3TJRA 3GZJA 1CY8A 3I71A 1GZ5A 2WEKA 2NUAB 4GI1A 4PYNA 2ZUWA 4A0QA 2WWWA 2Y9ZA 3S1MJ 2WWFA 3G2MA 1A5TA 1WDMA 4H0FA 1JLHA 2YC4C 2RHOA 2HA7A 2VJQA 3NLLA 3OU6A 5ALGA 1UHMA 3DVRX 1PL7A 3IDAA 5C3UA 3HYCA 4GZLA 3Q0IA 5FYQA 2RG7A 3TFQA 4I09A 1VLMA 1TIBA 4K3VA 1RRPA 2IHTA 4PU0A 4Q7JB 3RSCA 2PYZA 4NS1A 3EUKL 4MFEA 3QWHA 2ZIWB 1U0OC 2H9AA 5FQNA 3B12A 5FWAA 2VPYA 5BOSA 2JFZA 1WSBA 3GPIA 3JYNA 1IE3A 2O5EA 4GEKA 3HGYA 3LI2A 2B37A 1C7EA 1M34A 4O4JA 4AUNA 1W88A 5BT8A 4JC8A 3MMYB 5E3LA 5JROA 2WYUA 3BCSA 3FWNA 5A2QZ 3OCZA 2FSSA 3BBPA 1LPPA 4EJ0A 3UHPA 5HJ7A 3RAPR 4Z54A 3F2VA 3U60B 2JLRA 3RV4A 1S2DA 4OO3A 3NASA 5K6RA 5FA6A 2IH4A 1BW5A 2GM5A 3FM9A 2QCOA 2XB8A 4JLKA 4BE9A 4U0KA 2PL9A 4LZAA 2A1IA 2CJWA 5FB2A 4ZT5A 4GPTA 2BYVE 1WLSA 3CCLI 2HA2A 1XL0A 3U7EB 5AVXA 1OREA 1MORA 5EE0A 1G3YA 4LGYA 4OI4A 3GJ6A 2XECA 3GWGA 3MKLA 1WCIA 1YDHA 3OURA 3VVCA 3WKDA 2H7XA 4BC0A 1YRNB 1P3Y1 2I8LA 1YR6A 3TG2A 1AKHA 1G7RA 5IEBA 2HGSA 4H7EA 1CRPA 3MG9A 5HXAA 1VPEA 1JHRA 1S8FA 2JFFA 4M1KA 5LYJA 2FBHA 4HYEA 1G1MA 4JQOA 1P9OA 2Z4SA 2Q28A 5DDIP 3KP6A 4BXUA 2QN9A 1NXSA 4J3NA 4C6HA 4CM3A 1GQOA 3KEFA 1QRAA 4RW0A 4PBSA 1JKJB 4X0GA 1VDZA 1TJPB 3DTVB 5E0OA 4ZAXA 3W2AA 4CM1A 4AG3A 1XMOB 4AG6A 4YPFA 2GKSA 2H48A 4X8HA 1M5RA 3GV0A 1C9JA 3SLRA 4GICA 5FTJA 1XD2B 2D2IA 2J3EA 2DQKA 2V4ZA 4X44A 2OFFA 4RC9A 3ZY4A 4KQKA 1IZ0A 1KZ6A 1LLDA 4PNEA 3GBVA 4WKNA 3IKVA 1YHQI 4EHBA 1O5OA 2PSSA 1A36A 5EJFA 1T0UA 2YHBA 1V6AA 2QLJA 4WL0A 3SX0A 1UMCB 3K4CA 3UWKA 3S1NJ 3G1WA 3R75A 1QVUA 3PJDA 4BUZA 1O5TA 1F1ZA 3JRIA