2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
2HKOA 5DP2A 2OQGA 4BNHA 1AHHA 4GX2A 4OIPF 5L7WA 3JAMZ 4S05A 3TOBA 4RQTA 3QHAA 4AD9A 5L7YA 1XQ6A 1WNTA 1X1EA 1YBVA 1ADCA 1CF2O 4IJKA 2BYVE 4G7ZF 4ESBA 3WTVC 1P1IA 1BIAA 3VH3A 3ZWYA 4KFCA 3OEYA 5EERA 3WYEA 2MA3A 1LNWA 2QVOA 1H6AA 1SD6A 4H0EA 2HEOA 1P4XA 1FSEA 2QM3A 3UH1A 3V1TC 4Y8VA 3PQDA 4HLYA 1ISIA 3VEPA 4ZGWA 1IN5A 2HMSA 4AIKA 4EJ6A 1U8FO 1UXKA 5CG2A 1P4WA 2C5EA 1K6JA 4R1UA 4ROSA 3OF2A 1YW9A 2WD8A 3P9CA 4BMSA 1S8NA 3SHFA 5BSEA 2EFNA 3I64A 1G6KA 5G4KA 1Z1DA 1YVEI 3I58A 4MDHA 4BVAA 3GFLA 1QKIA 3JQAD 3PIDA 5ILGA 3PLNA 3REOA 3RFXA 3ZN1A 3QA9A 5L4LA 1QZYA 4I0AA 1HXDA 2R7DA 2P5VA 3JAMK 2HU2A 3NEPX 3T7EA 1TVEA 5JCJA 1BRMA 1LSOA 2FRDA 4J6FA 1PS9A 2V6FA 3RC1A 2UXNA 1XMKA 2CW0F 3WU1B 3JD1A 4Q48A 1LB2A 1MA0A 5G0UA 4IS2A 4DC1A 4F46A 4N9HA 1H93A 1FDTA 5HS9A 1YL7A 2YV2A 4UVIA 2VXZA 4G5HA 4HX4A 4XGKA 1XDSA 2J3IA 1PJCA 3C18A 2X0LA 3ZMVA 1IB6A 3E97A 3DXJF 1AXGA 3HUDA 2ZCVA 2O2YA 4H15A 1MJ9A 1EDOA 1IE3A 2GN6A 3L4BC 1DB3A 1KYZA 5CYVA 4ND2A 2X5JO 1EUDA 4PRKA 1GTMA 2PKRA 3GT0A 3HADA 4UNOA 4W82A 1U1IA 3ZWVA 4IDAA 1FNNA 2QUFA 1E17A 2L4MA 3WGIA 4QFDA 1A4IA 2X58A 2CD9A 3DBRB 3WXBA 3HOSA 1U5TC 1K7AA 4BO0A 2V79A 2W25A 1QLHA 4YCAA 5A02A 1I36A 3ZGYA 3OICA 3DEYX 5HS8A 1I2ZA 1OBFO 4FGSA 1EMDA 4EUHA 5CDUA 3DBHA 4BKQA 3JQ8A 4LFUA 5JHUA 3J81Z 2LF8A 1D5VA 3JSAA 2P9GA 4Q9NA 4HBGA 1G3YA 2DI3A 2Z99A 1HKUA 3FNGA 1IF1A 3RFTA 4LG0B 1KIFA 1M6WA 4PLCA 4Z3KA 5LGUA 1IUKA 2JT1A 4YJHA 1KU7A 4Y6PA 1LQ1A 4Z0TA 3SX2A 4U5QA 1JXSA 4TMFA 1BN5A 4A0YA 1HE5A 1ZG3A 1I24A 4L18B 1B59A 2CWEA 4G8XA 2C6YA 5TC4A 1UXIA 2YUTA 3BTOA 3CO7C 1E1LA 4FC6A 3NT5A 5F1KA 1CDOA 1N1EA 2ZCWA 4RAZA 2UWMA 1T1RA 3AY3A 4HNHA 5K6AC 3H5NA 1KOLA 4DPKA 4HW0A 4TZTA 3WGTA 2VNSA 4NH4A 3Q1LA 4XYMA 5L3BA 4HV4A 4ZH4F 2FMUA 3ZWPA 2Q45A 1FK8A 2ZB4A 1LX6A 2NQTA 1IN6A 4N9IA 4F45A 1Z7BA 2DVMA 5EESA 4TRMA 3L7WA 4IINA 4RF3A 4G9YA 3PVZA 1RM4A 1E1MA 2P9CA 1IL0A 2NACA 4NFYA 4N18A 2VE9A 4KTTE 3J81K 3MOGA 3WOHA 4XBFA 4DA9A 5C7LO 1R1UA 2CO5A 5F64A 1BXGB 1C0LA 1S7CA 4LD5A 2BRUA 5IT3A 1E92A 2AE1A 1EK5A 2ZO4A 1IAWA 4J1QA 5LGTA 3V7RA 1BG6A 2FF4A 1YOVB 5DOZA 1FDWA 2ISZA 1B8PA 2JHGA 2WYUA 2M45A 2PG4A 4A5MA 2QQ9A 4U0VA 4YIFA 5GZ6A 2O23A 1B6AA 3QLJA 3K73O 4UEJA 2I5PO 4B7UA 1GYRA 4EJ0A 5AQ1A 1QV7A 2DTEA 3GEZA 3DAPA 3QWAA 3MJSA 3WTYC 4D44A 2MBFA 3E9MA 4D3SA 3WU0A 4BHBA 1ENYA 3DEUA 2TMGA 2V65A 3KO8A 3PQFA 1ON1A 4LISA 3RBXA 4CXFA 1HW5A 2P7CB 5K5RA 4IHSA 3WSVA 1I0ZA 4XGNA 4BNFA 1OR7A 2GNAA 3LZ6A 4FDAA 1U5AA 4CM5A 1H6BA 3OJLA 2DBRA 1WXDA 2ZQYA 3FF4A 4RPJA 5JMPA 3ZU3A 4FBGA 4YDRA 1HBXG 1NP3A 4AJHA 4IHTA 3D4NA 3DONA 3E6AA 4AWXB 4KMUX 1YGYA 3TOAA 1UHWA 4UEKA 5FLXZ 4N54A 5IG2A 1U28A 2A6HF 1S3JA 2BE5F 3R61A 3K6JA 4QO7A 5KK1A 4P9UA 1K89A 1DPUA 4LB6B 2L3DA 5IFLA 3JYQA 4XR4A 4L4XA 3AUAA 1QP8A 4NHEA 1S6YA 4TROA 4WECA 3PWKA 5JMWA 1WKMA 2VRCD 2D2WA 1EVZA 2GQQA 1AWCA 3I5MA 1SBYA 4UXNA 3ZZNA 5I9NA 2WTBA 1ENPA 5EIOA 4EZBA 3MJVA 1H9TA 2GSDA 2GZ1A 1KYWA 1ISJA 1E3IA 4P4GA 4J90A 4LVUA 1X1TA 3A28A 4CM8B 4O5OA 2LNBA 2EV0A 4BB6A 1BI0A 3RD5A 1ZLKA 1GCOA 1GPDG 4ZA2A 5KIAA 2YHIB 4IJVA 3M1EA 4AFNA 3K69A 2LDXA 3BOQA 1X7GA 3TRIA 5J8FA 2JRTA 3AJRA 1E7WA 2ZFWA 3WYBA 4EI2A 3WMWA 4G81A 5LEKA 3HQ4O 2PMHA 1M2WA 1EVYA 3HZZA 2VT3A 3CDHA 3JQ9A 4GWGA 4L9RA 3ULKA 1ZXLA 4B8ZA 2X0IA 2XAGA 4IVNA 1RUOA 2EKPA 4N7RA 2D2IA 1HZJA 3L6EA 2HMVA 2RQPA 5I8ZA 1DRWA 5AIQA 1ISFA 5KWEA 4BQPA 3QOPA 1Z82A 1VPDA 4CM7A 3CTMA 2ZNZA 1MG5A 2EKLA 2ZJ1A 4GKVA 4KNYA 3TL3A 4QX6A 1KGSA 3VDRA 4J9UE 3O26A 2BGCA 4U7DA 4J4HA 3OA0A 2L4AA 3V7SA 3PWSA 4JXKA 3DFGA 4J0EA 5CPFA 4CMAA 4JJFA 3I4FA 1KY5A 3BYZA 3ONDA 4OXYA 3ZMUA 4D0PA 5JO0A 4OMZA 1F14A 3DZJA 4LSMA 3P9IA 2P4HX 5LGNA 3GFJA 1FX7A 2I9PA 5G2OA 2GPTA 4C4OA 3I9MA 3O8QB 2TDXA 4CLRB 4A6DA 2RIRA 1HEUA 3TO9A 3LVFO 3JQAA 1ZHFA 3JW4A 1HE3A 5ERIA 4GMFA 2JJYA 3HN7A 4WE3A 2IXBA 3MEXA 4BIIA 1IN8A 1B26A 4TV7A 4MVJE 3O03A 3P9KA 4RPHA 1U4SA 4D79A 1DHTA 3QJ5A 2K86A 5IXYA 2NLOA 4WF2A 1Z75A 4OGWA 1GXQA 1F8FA 2W2LD 1FC3A 1N1GA 5A9RA 2W84A 4GGGA 2JZYA 2DPDA 2CZCA 4K1LA 3VH2A 4AJOA 3PHIA 3CUQB 3E8XA 2B4RO 2NVUB 5CVIA 4ZZLA 4XQGA 3VZPA 4QT0A 4LLLA 4FOOA 1ZN2A 2ESNA 1E7QA 2FR8A 3OJOA 4ZRMA 3SJUA 5A4DA 3C8MA 4IQ8A 1JN0A 2A07F 1LQUA 1YRLA 4NJMA 4NK5A 7MDHA 2O7QA 2XIGA 3RDIA 3DPLC 2FE3A 1JKFA 2ZYAA 3L4SO 2DBZA 3NGLA 2D1YA 3E1KA 3QV1A 1V3TA 3DDNA 4I9HA 4XQCA 5G0VA 4N5NA 2E82A 3ZV5A 4PG5A 4RQUA 2RVCA 1LSUA 4BB5A 3LFKA 3WTZA 4AIHA 1ENOA 1PR3A 1V9LA 2JFFA 3IIEA 4E4YA 2HRZA 2HJSA 3WQSB 4Y67A 3F6YA 3BPXA 4ALLA 4AJEA 1U8RA 3L6DA 4CLHA 3LYLA 2X23A 4ZICA 3PZBA 1XQ1A 5CEEA 4FCCA 1D8KA 4G94A 1PQWA 3GMDA 2KIUA 4XSXF 4ZQEA 4EJMA 1K6XA 2HS5A 1T2AA 3L4BA 4GX5A 3EGOA 3EYYA 4MINA 2O03A 1Y5RA 3E5XA 4FOSA 4RPGA 3ZWXA 4YB8A 3IS3A 4P8RA 3QAHA 1MLDA 4A2UA 3D1LA 1MFPA 4AJJA 1HT0A 2BBYA 2IP2A 3IKTA 1YONA 1R1TA 3ABTA 3EW7A 5FI5A 5BNIA 3HDHA 4L5JA 1QV6A 2F00A 4M6XA 3BXXA 3C24A 4UREA 3HFSA 5COAA 5JFRA 3WTTC 3BHMA 1ZEJA 1U5TA 3FN4A 3AY6A 1T2KA 2R2GA 4PLWA 2Y1DA 3K31A 5E8IA 1NX6A 4HWKA 4R5HA 2FN7A 2MH9A 4PVCA 2AG5A 1ML3A 3WLFA 3BDDA 1UDCA 3O9ZA 2BELA 5D4RA 5A04A 4BXUA 2RCYA 2E1NA 4U7WA 5ILSA 1BXZA 1BWSA 3COSA 2VYND 1MD0A 4GAEA 1IN4A 4URFA 2IPQX 3L6OO 1UB9A 4ND4A 1NNUA 1Y8QB 4BNYA 1R6DA 3D0SA 1JKJA 2BV6A 2Y05A 1BIBA 3H3UA 1XYGA 4EJVA 4WKGA 2IA1A 1GL3A 3T1BA 1Q0HA 4BO1A 1YIOA 5H20A 2B83A 3GHHA 5JAQA 1NM5A 3WNVA 2F2EA 4CPDA 2WWRA 4OM8A 3WDSA 3F4BA 3JYPA 2HDCA 3M2TA 1AHIA 1D1TA 2IODA 1R23A 2VE8A 1QBJA 4IJUA 1X15A 5T6BA 3B1JA 2DC1A 2WJPA 2Y93A 1U78A 1PJ3A 4W7IA 3D0OA 1OMIA 3ROQA 1X7DA 2CUKA 3KLPX 2Y1EA 1GHCA 1EFLA 3QVSA 4KWHA 2GCGA 4J1NA 4XJTA 2OBPA 2O4UX 5EQFA 4CO8A 3FWZA 4DMMA 1Z7EA 2RAFA 3H7AA 4BS9A 1PU2A 2XV4S 3EVTA 4R1NA 3ZNNA 1IHYA 4B4OA 1GU7A 3RJ5A 4I5GA 2X9NA 1AUPA 1WMAA 2JAHA 4PG4A 3RUDA 2VBZA 3PLRA 4UAGA 3S1LA 2OD5A 1Q7BA 4BGUA 4LGWA 2X9VA 3DKWA 3P7NA 4ZYHA 1GUYA 1PQUA 2VRBA 2YJZA 4IQ0A 4J2OA 4XRGA 2R00C 1MDMA 2PWZA 4GI2A 5GMOA 2FMYA 3UCXA 4PLTA 2XAFA 5D5VB 2HK7A 1MB4A 3FNEA 3V2UA 2W98A 3JQGB 5B4TA 4LMYA 2BH9A 5E20A 3GOHA 1BSVA 2EHDA 3L9WA 2PGJA 2WMDA 2BEOA 2DBBA 1VKOA 2P68A 1PTJA 5A5EA 5JAMA 4CLOB 5L4NA 5KJFA 1YW8A 5ADHA 5BS6A 1U2GA 4R8HA 4MKZA 3U09A 5JDCC 2HMWA 1AGNA 2FSWA 1NVTA 1H94A 1REPC 1PWZA 1WMBA 4YQZA 5BNFA 3F6OA 4ALJA 2HUNA 4M55A 3GEDA 3HFGA 3X2FA 4ALIA 1SEVA 4E33A 4PLGA 2OZUA 2Q1WA 3K9TA 5L3FA 4I01A 2UZKA 4BGVA 4QSMA 3BMCA 2I3AA 1RZ4A 1YQAA 2VT2A 3MQ0A 4ND5A 1QYWA 3EETA 1WP4A 2QENA 3I6QA 4BNIA 4EITA 1BGVA 2XXJA 3SLGA 5A3VA 4KDEA 2EW2A 5E1XA 5KVRA 3FX3A 3QQPA 4EV0A 5T8KC 4R68A 3RQSA 4UVCA 2X7HA 4RVHA 4YBZA 4J7UA 5J6XA 3KSDO 4M72A 1T26A 4A26A 4YYZA 4HOBA 5LEJA 1RIOH 1O7FA 3F8CA 3H9UA 3WICA 2FBKA 4I02A 3TDUC 4YT5A 3LAJA 3FBGA 4E30A 1B9NA 2G7HA 3HSRA 3AUUA 5HWSA 3CMCO 3OBBA 2NUAA 1C0WA 2PTGA 3JTHA 4P55A 1NAIA 4HUJA 3DZIA 1S7AA 3R60A 4R51A 1WPQA 3LAPA 2VNAA 3SBOA 2NVWA 1I3MA 3JSOA 2L01A 1FBUA 2Q1TA 4L0ZB 3GEGA 3VZQA 3JTGA 4RORA 4DTIA 3KE2A 1CWUA 2W2KB 2C20A 2EP7A 4ALNA 1LDYA 3ASVA 1GYPA 2BGMA 2PZMA 1T2EA 3MTJA 2G9WA 1YL5A 1PJ4A 4ASNA 3NT2A 1RYEA 3RFVA 3WSWA 3H5RA 5KJCA 4IF4A 3P7MA 3KHUA 2R3SA 4EBFA 4UUMA 3LK7A 4DLLA 1HQCA 1WRJA 2VBYA 3M8FA 2WD7A 2AS5F 4UV8A 2I67A 3RAJA 2EWNA 4AJ4A 5C7OO 4J7XA 1HDGO 3TOZA 5C5IA 5JCJD 2W2LA 2CNBA 1ARZA 2WEKA 3BMNA 1YXMA 1WDMA 4B3HA 2EKQA 2D45A 1T39A 1SFUA 3BY6A 5ICCA 1ZH8A 2RBEA 1DJNA 1SCUA 4ZQFA 3DOOA 1GYQA 2H6EA 2PR2A 4GPD1 1G0OA 1CIVA 2AA3A 1CRWG 4RS8A 4JK3A 4YRAA 1MKMA 3GZNA 3OJEA 4D43A 3DTTA 1HXHA 1U2WA 5D6EA 3HG7A 1KEUA 1HYEA 1ONNA 2CVQA 3D3WA 5EMHA 4C7JA 1V0JA 3HSFA 2NAZA 2Y1GA 4PG8A 4M6YA 1PGJA 3GFGA 1UUFA 4ITUA 4B7CA 3WLEA 3PHJA 1FBQA 2A4KA 2OA4A 1XU9A 1BW9A 2C2XA 4BNXA 5IXSA 5KVVA 4EJWA 2B0JA 2HOEA 4E70A 4CMIA 3D4OA 3MWEB 4JP3A 1E1KA 1NQOA 3BHJA 1NWCA 2XHKA 5L4SA 4G7OF 4BNVA 3ZP5A 3FPCA 4NR0A 1B8UA 1KBZA 1SZJG 3UICA 3ZV3A 2C7GA 2Q0OA 3SFZA 1GFSA 1JWBB 1YL6A 2O4CA 2QHXA 3HRMA 3I59A 1MP0A 2WSBA 3J80Z 1CGPA 4IJAA 2JD0A 5IT9Z 3KXDA 3MOIA 5ICSA 2AXLA 4ENJA 1WWKA 4M9SA 2NADA 3B70A 3GY0A 4B3IA 2X4GA 4CM4A 3VKVA 1SPXA 2IDZA 3ABUA 4A7PA 4Z6KA 5DP1A 5IZ4A 1OOEA 5DULA 4A5NA 3H5AA 1HSJA 3VAZA 4CMCA 1PJQA 3ANMA 4P5OA 2JTVA 4ZVVA 3VH4A 4WCFB 2J5QA 1J49A 2FPGA 3I52A 1XSVA 3JQ7B 2LDUA 1YS7A 1NFFA 2G1UA 2X5KO 2OMEA 5DCMA 5HBRA 3DC2A 2DAPA 4Q3EA 1I1SA 2QBYB 3GDGA 3K30A 4UVHA 4CV1A 1LDKB 3KZYA 1NHWA 2C5AA 1OFGA 2Y0CA 3L00A 4L75A 4CQLB 5MDHA 4O5VA 1YDWA 2PLAA 5JI6A 2DTRA 4GBJA 2IXAA 1UP7A 3PFWO 4IPAA 2VYNA 3I1JA 1YLFA 1R22A 1O7LA 2FPPA 3OETA 3RYRA 2HMTA 4I08A 2XAHA 3UCEA 3AU9A 3M8EA 3R3JA 4OYRA 4RZIA 3RSHA 3J80K 3GNSA 4HF2A 5IT9K 2ADUA 1HKSA 2RNJA 1YJQA 3R6DA 3SC6A 3GDFA 5BQFA 3NRVA 2VZ9A 4DWVA 3W6UA 5B4UA 1U2DA 4DYVA 1QNTA 2B36A 3GN1A 1IPFA 1P4AA 3HHHA 3DL2A 4S3MA 2PI0A 1ZG1A 4WCGA 1N7GA 3IMFA 1C14A 4N5MA 1BXKA 1R4MA 1OC2A 2VOOA 3LT1A 4YTEA 1MC5A 2R7FA 1D8JA 1Z9CA 2H63A 3JYLA 1QZZA 2MLGA 5ICGA 4FJ1A 4Z0PA 3RASA 1GCUA 1GPJA 1E1NA 3MCZA 3E18A 4A5OA 2G76A 2DK8A 3INRA 2FSSA 1EBUA 3GZ4A 3QSGA 6ADHA 5HVQC 4PGHA 1IW7F 5JDIC 2XKOA 4OKIA 2C59A 4HXYA 1DIAA 3ASUA 1E6UA 1KETA 1YS6A 5IDXA 1FPQA 3RBVA 4O6JA 3WFJA 4QO8A 3A1NA 1XU7A 3BMOB 4CM9D 1BJAA 4BNMA 3CSDA 4OOFA 2Q50A 5EJ2A 2ZMEB 4IJWA 1ZFNA 3MJTA 3UHAA 5D4SA 2OORA 1U9JA 3D5QA 3AFMA 2EW8A 3HHPA 3MEQA 4BNUA 1V3UA 1XSDA 1S6LA 3BMQA 3AY7A 1FDVA 4YJFA 1W5SA 2MC3A 5DD4A 1XA0A 2BI7A 3HSKA 3T4EA 5DDIP 3TFQA 4GYIA 3WGOA 2O7SA 1OZAA 1J5YA 3TWOA 3MZ0A 2VBXA 3ZNPA 4XYLA 4NU6A 3GNTA 3GUDA 3HSEA 5LHHA 2QX7A 2WYWA 2DTDA 4YJGB 5CAEA 3Q9NA 3U4DA 2XUBA 3KP2A 4XJSA 4CV2A 4RF4A 4E0BA 4HDUA 1NPYA 2PFBA 1DPGA 1T25A 1ADBA 4EMSA 1YS4A 4RVFA 5BR7A 3KYDA 2HK9A 3PDJA 1GZ3A 2OZ6A 3GGGA 4MP8A 4NK4A 1WDKA 1ZO8A 2EIHA 1ZG5A 3AUTA 4WOJA 1PJTA 3CEAA 4AJ2A 1P33A 4CQMB 3BJ6A 2WWYA 3V8LA 2R00A 2RN7A 4MIOA 1STZA 4M9ZA 2QZ9A 3ABIA 4AJ1A 1MXFA 5BPIA 5HDNA 3AI1A 1W7PD 4P4NA 1EVIA 4CYDA 2JSCA 1DDNA 4B4VA 1H2BA 3W8EA 1E3LA 4AICA 1UR5A 5IDQA 1YG2A 1ZYRF 3C7JA 4QQRA 3U1DA 1OPCA 2A5YB 3QE3A 5KOIA 1SAXA 1WSUA 4UUPA 5BNTA 2EV6A 2P7VB 4NHJA 3U4IA 1B14A 5JDCA 4EEXA 3T5XA 3ZMZA 3ZN2A 3E6MA 4W6ZA 4ND3A 4XLPF 3IC7A 2A6EF 2GR9A 4MTDA 3VTZA 2ZKLA 4LRTB 4YR9A 2W57A 1HDRA 1W4MA 4DRYA 3H9EO 4M86A 4BH9A 3LT2A 4JJIA 5I7EA 1O5IA 2FHSA 2OL4A 3GEMA 4TZKA 3L2CA 2DPUA 2EJVA 3HNPA 3U9GA 1DIBA 5HA5A 3KUXA 1BI3A 3ZMSA 3DO5A 4PLHA 4F7ZA 4YXFA 4E21A 5T8KA 1P6RA 3VFZA 4BYYA 1CF7A 2GUGA 2PV7A 4XWYA 4IRIA 3IAHA 4OHUA 1J2XA 1VL8A 4E5NA 3FR8A 1DC6A 4G65A 3V8KA 3WGZA 4IRHA 5DBIA 3IL2A 2M87A 1J4AA 1C1XB 1YB4A 1Z6TA 2UV8A 3JQCA 4FT8A 4AVPA 3TZQA 3WB9A 4PVDA 4K28A 2EXXA 4Y6SA 1E5LA 4HQMA 3BJAA 4NBVA 1Z6RA 3CLOA 2XPCA 4U6SA 4Y6RA 3PJFA 1J7KA 4MVJD 3Q9SA 1ON2A 1LU9A 2YFQA 4K2EA 3GRKA 4R4JA 3L9XA 2DQRA 1ZH5A 1U7TA 1F06A 4WASA 1LDMA 1H9AA 4TRJA 5E17F 5TNXA 2CYYA 4OIRF 4CMBA 2IW5A 3FM3A 5B12A 4UV9A 1QR6A 3R0AA 4OU0A 2YSRA 5CVVA 4U0YA 3LF1A 4R54A 5KVQA 5TSDA 3VZRA 4BGIA 4F3YA 1UZNA 3L9FA 1D4FA 1VSUA 4WLFA 3CTAA 3DHEA 3WTXC 1NPTO 1RKXA 1RNLA 2VQ3A 2X5OA 1P1RA 3GVCA 3E6BA 1BVUA 1ZSYA 1KYQA 4RV9A 1EK6A 4PIVA 1Q7CA 1BC7C 1Q7GA 3I4PA 1M75A 2X6TA 1P3DA 3H4VA 1ORRA 1AE1A 1DHRA 3KEOA 2FMLA 2NYXA 1E3WA 3VPGA 3R6SA 4GGPA 1VKNA 2D1VA 4BO8A 5TJHA 2G5CA 4ENMA 1R0KA 4ZN6A 2QQAA 3INTA 4FC7A 4XRFA 2Q2VA 1GUZA 1XSXA 1GQQA 2D8AA 2ACJA 3P2YA 3E03A 5JPIA 4WXCA 4JK1X 3GZ5A 1YB1A 5DCYA 2CSOA 3NQOA 3BWGA 3PHLA 4L0QA 1CJCA 1P92A 4O59O 3STHA 4BMVA 2VUUA 4WXDA 1DIGA 5TGDA 1I33A 1LA2A 1OMOA 2HQ1A 3QPHA 3N7UA 4HADA 1HLPA 1C1DA 1WVGA 3ANLA 3PQEA 4D41A 3PGJA 5K9ZA 4NQWA 4L0YB 4L4SA 5CPBA 2RH8A 1IRGA 4NDNE 3E6DA 2ZXJA 1TW2A 1LLUA 1O9BA 3FR7A 3I0TA 3KFWX 3CUOA 4J1TA 5IZCA 3LQFA 4R01A 5L45A 1BDMA 4K6CA 4TKLA 3EYIA 1MUUA 3NV9A 5H6QA 2BLLA 3OIFA 5ICFA 2JD2A 3PK0A 2P5UA 4BV8A 2EB7A 2I66A 5DOVA 3RU7A 3IKVA 3LT4A 1LDJA 3K96A 2ZJ0A 5LBQA 5U1PA 3SXPA 3AWDA 4QXMA 4YT4A 4RB3C 2J5OA 4ZZDA 1ZRFA 1FXSA 5G4LA 2NTVA 2I6TA 2X0JA 2AQHA 3IRQA 3U4HA 3LDHA 4KIGA 3RTRA 5HOOA 3MAJA 2PJPA 1EBFA 4NFHA 4CMGA 2HKIA 4D0RA 4L9NA 1L7EA 2F5DA 1I1GA 2VTEA 3OECA 2H94A 4HFRA 4KUEA 4EEZA 1EDZA 1K78A 1MGTA 5FWNA 3TQHA 3OA2A 3WIEA 3DBHB 1NR7A 2E7WA 3JQ8B 2JFGA 3ZHXA 3GGPA 3N4MA 4BO9A 3I71A 1JAXA 1YKFA 3CZMA 5HDGA 2DQLA 3W6JB 1ENZA 1FDSA 5E18F 4HFJA 1A7AA 3N97A 4YJHB 1F12A 4YT8A 1VRWA 5H83A 2CF6A 5LRRA 1SD7A 4EUFA 4PRLA 5ILOA 4EJUA 1FYMA 4U6QA 1LVAA 5CLSA 3G79A 2ETHA 5G0TA 5KJEA 1XDUA 5TJ9A 3WGQA 2YZ7A 4CM9A 2RKHA 4KWIA 3WFIA 2O3TA 4Q3NA 4QUKA 2EF1A 3IOYA 3ETGA 1LEBA 3SEFA 1I5ZA 2FNPA 1PX0A 3EVNA 4RAYA 3E6CC 3JQBA 1QYDA 2QIOA 3PIIA 4ID9A 4G6DA 3ONEA 3G3ZA 3OMLA 3KBOA 4PZJA 1XGOA 2GLXA 2MD5A 2E49A 4YIIA 2CMDA 3TZCA 1IYZA 5D8KB 2A68F 3WIDA 3QVXA 1NHGA 1VL0A 2Z1NA 4RO0A 5ITWA 3GXOA 3MJCA 3KB6A 3WBFA 2HLPA 2HFHA 4Y13A 5EQDA 3CO6C 2FR0A 4QECA 4WPGA 4XYEA 3TZKA 1PZHA 5KVSA 1D7OA 1MJAA 4EJOA 1K6OA 2HRBA 3E5QA 3EUHA 3DAGA 1Y81A 4GQAA 5JDIA 5IDWA 4KTVE 2O6GE 3EYWA 4WLOA 4NBWA 4E3ZA 4IRGA 5TLSA 3ZWWA 4OQZA 7ADHA 3K2BA 1TI7A 1U7HA 2IVMA 2O3RA 2AQIA 3OH8A 5J23A 1ZK3A 3PYLA 2G82A 2ZB7A 3KLOA 3JD4A 4II3A 1X14A 4PGFA 4Q3AA 5AXCA 4L9JA 4FFRA 2C29D 3ZW8A 5D5UB 3AM4A 4R16A 4TKMA 4UULA 5HS4A 4BKPA 2AQKA 4WLEA 5FFZA 3WMXA 1J0XO 3CPSA 4ZYEA 5I9LA 1HWYA 3BP8A 4RGBA 4KIFA 1ZK1A 2IZ1A 4WNCA 4Y98A 3NDIA 2PGDA 3VODA 4B8XA 2FRHA 3VB2A 3QVOA 1H9BA 1LJ9A 5DV5A 3O38A 4FIZA 1LDGA 1LXCA 2E6UX 2XKPA 1LDDA 2C54A 2TMDA 4YRDA 3NUGA 1HF3A 3U49A 1W7PA 2HQRA 4E5MA 5A3JA 5FLXK 4RGUA 2DU9A 5A2QZ 3GA0A 1Z91A 4FX4A 1PJBA 5A9SA 2QYTA 1P1HA 1JWAB 1TBXA 1XGKA 3KSUA 4FSHA 1JLLA 1SEPA 3F47A 4U0WA 4I1IA 3I23A 4PZEA 4RLHA 1CQIA 5G0SA 1DFIA 4Y15A 2DUWA 5CJ9A 1NYTA 5T64A 5FGMA 4NU5A 1I2BA 3PFIA 3GLQA 4B4UA 1EQ2A 4OIQF 5FEUA 1FDUA 1X7HA 4WWCA 3OP4A 1B4AA 3EUWA 3QWBA 2ZB3A 2P4QA 3MZHA 3RKWA 1LLQA 4U88A 4A2CA 2F1KA 2YQ4A 4RDHA 1R0SA 4L9TA 3WG9A 3UUWA 4K9DA 3LT0A 1KU9A 4GYGA 1O8CA 3INGA 5LDGA 1H6DA 4WCFC 2AEFA 3TDZC 2UYYA 3RU9A 4KZPA 5F21A 3Q0EA 1L0OC 5A2QK 4EQQA 1ZNQO 1Z05A 4TSKA 1B15A 5BPDA 2V1UA 3JD2A 5H82A 4E13A 2ZTVA 4MVJA 4FPXA 4Z9FA 1PGNA 2PEXA 3GVHA 5B4VA 3A4VA 3ML6A 3NGXA 1XGSA 2CVZA 1U5CA 1O3TA 4WJZA 3MWDB 2C07A 2RH4A 1XWFA 3LC7O 5ER9A 4BAYA 1ONOA 3IUSA 3AI2A 4KMSA 3BROA 3RUCA 5DCFA 2GWRA 1PSDA 4ND1A 4D45A 3HHGA 3GVAA 1EH7A 5EEHA 2NTJA 2PFGA 3RBZA 3ZWNA 4CR6A 3S2WA 3L09A 3KZZA 4Q47A 1R16A 4DIOA 5CDSA 3FHZA 2VN2A 3I9OA 3ITKA 5EN4A 2Y1OA 4IGFA 3ZV4A 5K1YA 3E48A 3ITDA 3PDUA 1E3EA 1K0UA 3GAFA 2V1XA 3TNLA 1BM9A 3QP6A 1XG5A 3A9WA 4ZYGA 3DMTC 2CDBA 1GZ4A 3H65A 2Z33A 3KOUA 3QP5A 2HWVA 2O50A 4RL6A 3FSRA 3AOEC 3GHYA 1HE2A 4E12A 1DRVA 1JW9B 4AIJA 4I98B 2Y99A 3LF2A 4JROA 4XKJA 3IDSA 1HW2A 3KLMX 4DBZA 4U8GA 4R1SA 4BNCA 2OAZA 3ZH2A 4CM1A 2DPHA 4U0JA 3S2EA 1O95A 1M67A 1QGPA 3JQAB 4P22A 3RKYA 1FZPB 1P1FA 2IYPA 1KQ8A 5CHEA 2Y0MA 3RWBA 4GMGA 1NASA 5IJZA 4CR8A 3DZFA 4PGGA 3E9QA 2ET6A 1FOKA 2IRFG 4HKTA 4EM1A 3GZ6A 1ONVA 1EVJA 4ZD6A 5EL0A 4DMLA 4PG6A 4YFXF 1PGPA 1T2FA 3F72A 1H5QA 4KP7A 3CXRA 4GO1A 2C0CA 3G0OA 1DEHA 3OJFA 3PRJA 4TVBA 4YAGA 4L73A 3T8TA 1C0IA 1XIVA 2EA4A 4NJMB 3F6VA 1G3SA 2QRLA 1K79A 4HQEA 2A69F 4XLNF 4J7CA 5K6AA 1J75A 1HSTA 4ZQGA 2RV8A 1VTNC 1DUXC 3QIVA 4M74A 2QZZA 4DPLA 4MEXF 2NWQA 3A14A 3W4IA 4YQYA 2AXQA 2MH2A 4KUMA 4RCVA 1ZGAA 3WGGA 2P5LC 2I99A 4YVFA 4EJTA 4HYEA 3C7AA 2K27A 4IDCA 3UW3A 4HA8A 3UN1A 4DQXA 2DT5A 3U5TA 4QLCU 5LCXA 4WK8F 1R4NA 1XLTA 2J5RA 2UUPA 1YQGA 2X8LA 4DVJA 4XR9A 3PJEA 3IQDB 1Y8RA 2O3SA 4IS3A 3S8MA 4XYGA 2BI8A 3M9AA 2XF8A 2QRKA 5K5OA 3VPFA 2WV0A 1ADFA 1BVRA 1V3FA 2DFVA 3G3EA 1EE9A 3J7AO 4XD2A 1QXSA 2G17A 3ZMDA 3BIOA 1GEGA 1B3BA 1WZEA 2ZYGA 3Q11A 4FS3A 1E7RA 2PZJA 1R5HA 1E6WA 3ZNQA 3RJPA 4IDEA 4QWQA 5I7FA 1ZK2A 3KCCA 3B1FA 2G0TA 3GK3A 5BMZA 5B37A 2P6SA 3F8BA 3O4RA 4MVJI 1QSGA 1DFHA 2ZCUA 3H9JA 3IP3A 3GUYA 5BSGA 1HSZA 3Q9VA 2DLDA 3GVPA 1U5TB 4GL4A 3MZYA 4H7PA 4PZDA 2O3QA 5B1YA 1I30A 1D3AA 3DP7A 3F4LA 4FR5A 1TNTA 3OHSX 1E3JA 3PP8A 2OOSA 3VPHA 2H5LA 4YA6A 3KRTA 3GH3A 3MTGA 4CUKA 1P77A 5EINA 3I54A 5I8WA 3OOPA 3COAC 3PGXA 3R0IA 2H6CA 3ORFA 1XGNA 4Q39A 4CV3A 2D1HA 2BGLA 1ZJZA 4JN6B 4L4RA 4KQXA 1H6CA 3DFUA 4II2A 4E5YA 4D0SA 1NWHA 3GPIA 1Q1NA 2ZBKA 1AXEA 3CINA 3PWZA 1ULYA 4I5FA 2BD0A 4NNJA 2FU4A 2YW9A 4F6CA 2EWMA 1LI4A 3ZMTA 4CMKA 5CVRA 1EV7A 3PYMA 4MKXA 2PN6A 3KP6A 1A4UA 2JHFA 2YV1A 1NVMB 5JC1A 5ICEA 4I5DA 2NRAC 3DBLA 2V9VA 3NTQA 2VHWA 3GPDG 5AOVA 1CEQA 1X3UA 1G0NA 2B5VA 1YDEA 3HRSA 3B20A 1MJBA 2VBWA 3LA3A 2Y1FA 2JKVA 4BO6A 4DREA 1SB9A 4DGSA 4PCVA 4A03A 4DQ2A 2B4QA 4X54A 1U3TA 4L8VA 4W4TA 5F5LA 3EQLF 4FHTA 3BTSA 4NBTA 4P4LA 2PK3A 3ZI0A 2E37A 3WQQA 2YX7A 4YFNF 1GUFA 2A35A 1Z6ZA 3V4GA 4ZYDA 3ON5A 3NEUA 4OOIA 1NFQA 1VI2A 2VWGA 3KP7A 5A1TA 4BO5A 3T8RA 1ZRDA 1Y9AA 1RM3A 3JQFC 4OJNA 1ZZEA 3LC2O 4ZQHA 1ISMA 4GCVA 5KKCA 3IP1A 4BNZA 1T38A 3T4XA 4KQWA 4XDYA 5DN9A 3FTNA 4LB5A 1KA8A 3JCZA 4J0FA 4LN1A 4YEDA 4ZQBA 5L9AA 2GN8A 1YH3A 1Q0QA 2YX4A 3PEFA 2ZTMA 1MDMB 3ZWCA 4ALKA 3I9LA 2M30A 1KVUA 4R1HA 2EGHA 2P9EA 1AN9A 3OV8A 3RIHA 4TRRA 5FFFA 3N58A 4MIYA 3PYXA 4MVJG 3WE2A 3UFXA 3DMYA 5HM8A 2FY8A 1SMYF 4I9NA 4NB5A 2AHRA 2B37A 2H1SA 3UKOA 5CG1A 2QG4A 1N9GA 5I7VA 2EJWA 4WEOA 3WGHA 2LDBA 2NU7A 3VVBA 5ED4A 4UHTA 4KA4A 2PKQP 1W0CA 1DSSG 2VZ0A 2V7PA 2XRNA 3FM5A 2FBIA 4UVGA 3UCFA 4M1QA 1YO5C 1KQ0A 1PL7A 1IZ1A 3GF2A 2JL1A 2NU8A 1YWGO 2ZTLA 3ROKA 3S2IA 5U9CA 3BMCB 3PFFA 4HFNA 3GG2A 3MJ4A 5THQA 2PA3A 2FEZA 4CDGA 4M49A 4YPOA 2PY6A 3GF4A 4UVEA 1N8KA 5JAIA 1OYIA 1U8XX 1G3TA 3LA2A 1FSHA 3DF8A 5A05A 3GW2A 2EFQA 3ZWOA 4RVDA 3GRPA 4RVSA 2FZEA 4HX7A 1HE4A 2GO1A 1U3EM 3C85A 2W85A 1LRLA 2VONA 2BMAA 2UUOA 3W4JA 3LA7A 4OIMA 3ZWMA 3JQ6A 5FO5A 4BO3A 3M1AA 1RPNA 1BBYA 1R15A 4M87A 2V6MA 1XSEA 2Z95A 3V1UA 2DU8A 1LJ8A 5IDYA 1KC1A 1XHLA 5DUKA 4PN3A 2POQX 2VC1A 3NTRA 1TT5A 5L95A 3RPUA 5FD6A 1VJ1A 4J16A 1UZLA 1V6AA 1DBVO 5H81A 5A9TA 1NR1A 4JIGA 1U3UA 2Z1MA 2I65A 2IZ0A 4GX0A 4M8SA 2WM3A 2XVCA 3MWMA 2NU6A 3C7CB 4BV9A 4GH5A 3CKYA 5HS7A 4W9NC 3E3VA 2QWWA 3WTSC 2FSVA 4IIUA 2J6IA 2K4BA 4R1TA 4BHTA 5JY6A 2A9FA 2Z5LA 2A94A 2GZWA 1IZ0A 2W8ZA 1JAYA 4FQ8A 5ER6A 4AG3A 1M76A 4PZCA 3ELKA 5E1ZB 4U0KA 3S2GA 4DBVO 2P6TA 3H3ZA 2PH3A 4MVJH 3TSCA 2X9GA 3BJOA 4CJXA 2MLKA 3SJ7A 4GLLA 4DNCA 2WD7B 2DW4A 2GA2A 4CICA 3H9QA 5HLHA 1EUZA 1SOWA 5LRSA 2FR1A 3RC9A 3TPCA 2G7UA 2PD6A 3BMNB 3WWYA 1DRUA 2FZWA 4BKUA 1WDLA 1BI1A 1UDAA 2BFOA 4IPTA 2NV6A 1VJ0A 1H0MA 2DQ4A 2VHXA 2VYVA 1Q1HA 1EQUA 2I3GA 1IXRC 2VUTA 3BHIA 3DMTA 4PLPA 1TXGA 4C7KA 1P2FA 4KUGA 2FP4A 1XR3A 2SCUA 4CMHA 1G3WA 1O94A 3AOEA 1DJQA 3GZNB 3HDYA 3GFMA 2WYVA 4Z9YA 3I83A 2YYYA 3ZQ7A 4WLNA 3SC4A 4M9XA 5A5FA 1QYVA 5AYVA 1KS9A 4XEHA 3BZ6A 5LHIA 1UXJA 3D3WB 5AXDA 4JQCA 3V5NA 3HIFA 1QRRA 2YDXA 5DF1A 1XEAA 2ILTA 4BO4A 4PLZA 4GWKA 1BW9B 1UJMA 2EFPA 1BMDA 1R36A 1N5DA 4GVXA 5CEJA 1ISGA 1HRDA 1LTHR 3RKRA 1F1ZA 4CMIB 4O1MA 4CZZA 3R0JA 1GV1A 5L7TA 3GO5A 3NYWA 2FXAA 3EDPA 3MCVA 4EVIA 1IHXA 3GAZA 1P44A 5COBA 8ADHA 3C3WA 2YHUA 5KCZA 3I59B 2PH5A 2WDZA 2VCYA 1S29A 2O0YA 3HN2A 3LQQA 3DQVC 3F9IA 3CZRA 4GLOA 1PDNC 1ZGJA 4CM4B 2GN9A 4K26A 1GQYA 3D3EA 4XDZA 3VZSA 2OO5A 3AFNA 1VC2A 1P1JA 4RZHA 4EM0B 2IA0A 3RI4A 1Y9EA 3EY4A 4YG2F 4XQEA 3WBBA 5JS6A 3DHNA 1T4DA 2OHXA 3P19A 2W90A 4I09A 2CDAA 1WLYA 5DCMB 1ZKMA 1W6UA 3DHYA 2B4TO 3OIDA 4LVCA 2Q99A 3C7DB 3FWNA 4KN7X 1GV0A 4K6FA 2GYYA 4XB2A 4JQFA 2LSOA 3F1LA 2KJCA 1GDHA 2IZZA 3K92A 1PWXA 4W99A 1P0FA 4CL8A 4EGFA 2NS0A 1FP1D 1B16A 1XB4A 4ON0A 1IZ9A 3QU6A 5G4KB 3ZHYA 5JC8A 4UUOA 3RKUA 3IUPA 4E2YA 4D3FA 5JLAA 2IEDA 4LLGF 4R3NA 4RF2A 3JD0A 3RUFA 2EG9A 3DWFA 5MGBA 1YTYA 2JCXA 3JD3A 1ZEMA 4F6LA 3KP4A 4NQZA 5IAAA 2L02A 1ZMTA 3CUQC 5BQTA 3U4CA 3PQKA 4DUPA 1R4MB 2QYOA 1Y7TA 3IWZA 4NMHA 4HBLA 2Q1UA 2NVBA 3KM0A 1FLIA 4OINF 2Q3EA 3W4KA 3HUGA 2HGCA 2STWA 1BTOA 4NJOA 5FYDA 5HRUA 1E0DA 2NU9A 3EZLA 3CMMA 1K2WA 1Y5MA 5L3CA 3JYNA 4IDDA 4U7BA 1P9LA 1D1SA 2YDYA 3JYOA 2O2SA 3K1NA 2RDPA 4HF0A 2RHRA 4PLVA 4Z3DA 5GY7A 4BNJA 1ZMOA 4H16A 1OAAA 2CGPA 1JQBA 2C82A 1YW7A 4CR7A 3FI9A 5T67A 1XGMA 3WNQA 1RI7A 1LDNA 4MKRA 1YJ8A 4ZHSA 5F1OA 2WTEA 3ISPA 3UVEA 1HW1A 3BPVA 2M5WA 1A72A 1I3LA 3BMQB 3GUCA 3I6IA 3ST7A 4YJFB 5H6RA 3L07A 4AL4A 2RHCA 3ROMA 3FTPA 4J91A 3SXYA 4BQAA 3NDJA 4J4TA 1I3KA 2PBIA 3AAFA 1HKQA 1UXHA 3DZKA 3VVCA 1DO8A 1HYGA 1PS8A 2BHLA 4N5LA 3NTOA 5THKA 2ELHA 4HV6A 3LLVA 1V4RA 4JJGA 1I2CA 4JNKA 4WNIA 4YAEA 1TW3A 4XA8A 1GVJA 1HDXA 2F5EA 1PUEE 4P38A 4GXOA 3FRJA 3IRRA 1LRKA 4MP3A 4RB0A 2Z5UA 3DBRA 3DOJA 3K8ZA 3OJ0A 1YB5A 3JQFA 1ZJYA 3CUKA 1LNQA 5COQA 1KU2A 4BHPA 2GIVA 1DIHA 1MXHA 1SAYA 2CY0A 2EEZA 1QPMA 3KYDB 1ZSNA 3Q2IA 1A9YA 4INAA 4J1SA 2JD1A 2O8XA 3D4PA 3FXUA 1ODDA 2JPBA 3TJRA 4DLAA 3HDJA 1UFMA 2A61A 4UUVA 1OC4A 4LG0A 2FOKA 1T1SA 4L5IA 1QORA 1TLTA 4TRNA 2EK5A 5L3EA 2NNNA 2STTA 4RVGA 1YFHA 1KERA 3WJAA 2P4WA 1GAEO 4P96A 3JTMA 3DOCA 2B35A 4KYWA 3HYIA 2AW5A 2IRWA 2VODA 1T6SA 5DYMA 1W5TA 3AOGA 4GVLA 4AJPA 1ZK4A 4H3VA 3V1YA 4ETSA 1IPEA 4IZIA 4OQYA 3RI3A 4A27A 4D42A 1J6UA 5L53A 1LDBA 3IWFA 2E4AA 2DBQA 4IXAA 1FJHA 1KVTA 2EP5A 2VWHA 3M1LA 5TQVA 1LSJA 4E5PA 1YQXA 1KVRA 5BT9A 3RC2A 3WTCA 3KLNA 2AEJA 4NI5A 3DQPA 4QEDA 1PP8F 5DDGA 3PJGA 6LDHA 5GZ1A 1HSOA 4WXHA 3I9NA 1YO6A 2JPCA 4A0ZA 1UXGA 2EERA 2JCYA 5LC1A 3EZYA 4FFPA 3HWRA 1T24A 1EE2A 4MVJM 2BFPA 4AJNA 2IA2A 2VOPA 3VHRA 1O89A 5DBGA 1R58A 3DR3A 4OXNA 1IXCA 1CF7B 2ZB8A 1ZW1A 1BXGA 1DAPA 5F6FA 2CF5A 2IE0A 5C3MA 3EDMA 1P31A 3ICCA 4I2OA 1USTA 2BGKA 3BA1A 1JVSA 1X13A 2GF2A 4MVJF 3EHEA 3W8DA 3WTBA 4J3FA 3ZU5A 1YOVA 3ROUA 2EFOA 1YQDA 3S55A 2EA2A 3D64A 3WE3A 3KP3A 1OYYA 4RJTA 3TO7A 1EZ4A 3AW9A 3NKLA 3TZHA 3QU3A 2HMUA 1LUAA 3F21A 4Z9XA 2H6BA 4AJIA 1DLIA 4WLVA 4JCOA 1MGOA 3E5MA 4BHCA 4W9NA 1B7GO 1BC8C 2GASA 4R79A 2HJRA 3FPLA 3KV3O 4A6EA 4NBUA 5AIPA 5I9MA 5HLIA 1NAHA 3I3OA 5FI3A 1J0RA 3GR6A 4GGOA 4BNKA 4B3JA 1IULA 4E2XA 3X2EA 3GDOA 2YV3A 4G7HF 5BSFA 3JV7A 3DPTA 3NJ4A 4LSWA 3UAGA 1WQ2A 2FOIA 3RROA 3QVWA 5DCWA 1WAMA 4ESFA 1EEHA 2Y66A 4ESJA 1JTVA 1KEWA 5LLQA 2YQ5A 4PG7A 4B79A 1ZSVA 1T0FA 4FX0A 2J3HA 2GXBA 3GVXA 3CJNA 3E5UA 1E3WB 3O6BB 1GR0A 4CHUA 1QO0D 4XSZF 2PLYA 2GZ2A 5KKAA 1Q0LA 4A73A 2PMUA 4BNGA 1SNYA 5GZ3A 5TT1A 4OL9A 3VOSA 1QYCA 3EC7A 4LLNA 4CLEA 3I9KA 3N74A 5JY1A 1LEHA 1ULUA 2ZIZA 4IDFA 5DCUA 4B09A 1TQIA 2CFXA 1O6ZA 5D5XB 1B9MA 3OIGA 4DIBA 4WGGA 1EH6A 5CDYA 3QPTA 3C1TA 3VKUA 1XCVA 2HKXA 1F0YA 4R9RA 2Y1CA 3G49A 4PLYA 4LCEA 3TZ6A 1IOLA 1R12A 1MC4A 4BUCA 3KEQA 3SLKA 1VE9A 3I4CA 3VC7A 5CDGA 4OXKA 3U3XA 1E2XA 1PIWA 1VSVA 1C1DB 1KVQA 4CM8A 3H92A 2Q49A 4AVYA 5L40A 1RJWA 4KOAA 4CMJA 1X0XA 2OFPA 1E7YA 1C0PA 2Y67A 4RGSA 1H0KA 2YHIA 3M2PA 3ADPA 3WJ7A 3FNHA 2HYFA 1SMTA 1I5RA 4RDIA 4YJDA 3DBVO 1B3RA 1YE3A 5FB2A 3JSPA 3D5LA 2ZKZA 1XD7A 1C3VA 1NQTA 1PP7U 3GVIA 2FA5A 3LSTA 4W7HA 1S7OA 3GGOA 4RB1A 4RGRA 1N7HA 3PTZA 2A92A 2Q2WA 3VTFA 1MG0A 3FCOA 2HYGD 2HCTA 4HP8A 1B0AA 2AE2A 3UGKA 4E31A 3T7CA 2BF7A 3ENNA 2I76A 3K9QO 1K78B 1NFRA 1HETA 1RYDA 4GX1A 4Q3DA 3F8NA 4JLWA 4B4WA 3C1DA 1IY8A 3G1TA 1JHFA 1GQ2A 3GFBA 4S04A 5JXWA 3O3KA 1HZZA 3F1KA 3KETA 3H2SA 3IJRA 2Q4EA 1W4ZA 4I9UA 4MPDA 4RPLA 1V35A 2Y0DA 5DD8A 3W6KB 3DAFA 3ZWAA 1VJTA 3KVOA 2PD4A 3SZPA 2NSDA 3SVTA 1HDZA 4XCVA 5KJ1A 1LEAA 3ECHA 3T0YA 1QMGA 2JCVA 3GYHX 3O8QA 4LW8A 4CLRA 1DAOA 1B1BA 2Y48A 1T4BA 2B5WA 2D3TA 1NXQA 4XYBA 4YAJA 3LC1O 2ZK7A 3GWZA 1NTOA 2LF7A 4HX5A 2A3SA 4HZFA 4KN4X 5F1RA 3M6IA 1O3SA 3RUAA 1JHHA 4HDVA 1ZK0A 4CL3A 1AOYA 2BFMA 2OBYA 4LMPA 3U0BA 4R69A 1FWZA 4IXTA 3CUQA 3TOXA 5D5WB 2NVUA 1O57A 3B02A 5TRDA 1O3QA 5G0WA 4YAKA 4KMFA 2YU3A 1HYHA 4KDPA 4NBRA 4KIBA 5KJ6A 3Q9UA 3BTVA 1A04A 4A0XA 2PZLA 5JYEA 1RM5A 1VM6A 1XCBA 1JE8A 3DV8A 4FB5A 2HK8A 2Y68A 3WR5A 1LRJA 5FD5A 1JA9A 5JAZA 3K2ZA 2WE8A 3FMQA 4OMYA 3O2PE 2GDZA 1KQ9A 3HE3A 3FXQA 4L9VA 1DC5A 3FMSA 4PDKA 2KIFA 1B2LA 3H3FA 5JW6A 1PJSA 2XASA 1VLLA 4BNWA 4FGWA 2UDPA 5A03A 3W8FA 8LDHA 1IXSB 1SFXA 1A71A 1O0SA 5JR3A 3GC6A 4HF1A 4NG5A 5CP8A 5IN4A 3V2HA 4PFJA 2NQ8A 3KYCA 4XIYA 5ILVA 2DAOA 5ES3A 5F1PA 1Z73A 4CUZA 2VHYA 3LU1A 1Y0UA 2IEBA 3FWEA 4MQVA 4JGBA 3RJ9A 4RB2C 4OIOF 2J3KA 4ZRNA 3RUIA 9LDTA 4LK1F 2ZJ2A 3F22A 1A27A 3F3SA 2CFCA 5AVOA 1DFGA 4MTEA 3MFKA 1W7PB 4RLSA 4IBOA 5C7IO 1F17A 3BZUA 2W4QA 3QWFA 2Z9OA 2CQKA 4JBAA 1PZEA 3DTYA 5A9SB 3LWFA 2HO5A 1ZREA 2XOXA 1TT7A 1EFKA 3JQEA 2J5PA 2ISYA 4MHGA 5JYDA 4IDBA 1WI9A 2HZTA 3KTDA 4EYEA 5JNLA 2GGSA 2YY7A 2K4JA 2Q1SA 2FNAA 1TTYA 3QP9A 2OQRA 2QLZA 3FNFA 4S1VA 4R5MA 3DZHA 4BNLA 5ITVA 4HAMA 1PJLA 4JX8A 5E1WA 3U62A 1YYVA 3QWIA 4XZ3A 3PHGA 3SZTA 4HNGA 5CVJA 3GN2A 4FW8A 4M89A 3IC5A 2ESHA 1F4KA 6PAXA 2M1BA 3ROPA 1ZBQA 2GD1O 4BQRA 1Y8QA 1BHSA 4M54A 3ZNOA 1I27A 2B0LA 2IT0A 3GNQA 1LC0A 3W1VA 4D3DA 3PQJA 3OQBA 3OFSA 3E5RA 4CMEC 3CE6A 3VPXA 4J4BA 3ZPLA 2Q46A 4DIFA 3I5UA 2P91A 2VN8A 4QFCA 3ZDFA 1D8AA 1PEDA 4J43A 2CSUA 2M8EA 2JFHA 2O3UA 3BAZA 1Z74A 2GN4A 1LQTA 1XKQA 3KYCB 4R9SA 4CM3A 5TIIA 2ZATA 4EGYA 1LC3A 1SD4A 3V8JA 1RUNA 1MX3A 1O3RA 1GZ6A 2UAGA 2VYVD 4Q3BA 2UVDA 3EK2A 4Y9DA 1WZIA 5DNAA 3QRFF 3V2GA 4E2WA 3VPSA 1GXPA 2DTXA 2VHVA 3GX4X 1CETA 1EUCA 5HDKA 1Z7UA 2NNLD 4Y17A 2ZQZA 5TS3A 4LCJA 5TT0A 2Y0EA 2FQ3A 2YR2A 3D5TA 3PXXA 1KVSA 4IGEA 4IZHA 3ZW9A 3OQ1A 2PGLA 3K0LA 4Q5SF 1XELA 3Q2KA 1ISHA 4CM6A 2Q2QA 4A0SA 4YWJA 2K7LA 4G6QA 2HTSA 1EH8A 3PJDA 4E32A 2EFWA 1H9GA 2VZ8A 1TQMA 4HLXA 1I8TA 5JSFA 2DK5A 4MNUA 2JAPA 5FF9A 4OKNA 4OSOA 5EEGA 4E5KA 3TQNA 5AXAA 3EAGA 2EJRA 1R1VA 1DC3A 4FD3A 1G4DA 1UAGA 4HFMA 3PI7A 3HRTA 3OM9A 3JQGA 1K6IA 1KEPA 1LSSA 1V3VA 1T2DA 4ZJUA 2Y75A 5K0ZA 3HDQA 1PJ2A 4D46A 2GAUA 3V7CA 2H27A 1E6EA 2WC2A 3P2OA 3VH1A 1GY8A 4CUJA 4CLOA 4JBGA 1PZFA 2CG4A 3VOEA 5T57A 2Q2EA 1I01A 4Z2YA 1ZARA 4HX8A 1R37A 1U3WA 4PCQA 3ZU2A 3H9GA 4BO7A 1A9ZA 3NJ8A 3LQRA 3L77A 4DQVA 4I0BA 4M71A 1C0KA 1H2HA 5AXBA 1R0LA 3QW2A 4LRSB 1HTBA 3HTSB 2C7VA 3R1IA 4CQMD 3WS7A 4FFNA 4WCDA 1SFEA 1PGOA 3WTUC 4YACA 3ZCXA 5ENDA 1K5HA 3HOTA 4LGVA 5LDHA 3RYPA 1J5PA 3H3JA 3IJPA 2LKPA 1I32A 1SOVA 4TVOA 1UZMA 4ENKA 1QYXA 3F5QA 4IY1A 3RVDA 4I5EA 4CV0A 1F8GA 1A7KA 1E7SA 4ESOA 3U2RA 1FF9A 3W6ZA 4BMNA 4ALMA 9LDBA 4LJZF 1UP6A 3AM5A 2DFDA 2XXBA 2EV9A 3H6KA 1KU3A 2FPIA 4IDGA 1BOAA 2PQ8A 2VOJA 2X22A 1DOHA 1TA4A 4ILKA 4J9VA 1DDOA 3AK4A 1BI2A 1OI7A 2CDCA 3ECOA 2GXGA 5BOXA 1ID1A 1P45A 1R4NB 1NPDA 1QG6A 4BKOA 2DKNA 1Y8RB 3NT4A 4WLUA 1BDBA 2DBVO 5CDTA 5D6FA 5JVTA 1LDEA 2DPGA 2W2KA 3ZN0A 2HAEA 2NM0A 5I7SA 1M66A 2NTNA 3ZU4A 4DL9A 1A5ZA 2VRCA 1LBEA 4FJ0A 2GZ3A 1DC4A 3DXFA 4IMPA 2D4AA 5L3GA 1RM0A 5A06A 1LLDA 1SC6A 2PKQO 3Q6IA 3OSUA 1J59A 4GSLA 2PNFA 4HY3A 4YAIA 5JCXA 1DLJA 5KNLA 3OQ6A 3U9LA 1G1AA 3K1PA 1SO8A 4O3MA 3DFZA 3ULQB 1DP7P 4DPMA 1P1KA 1PR9A 2GERA 1UP4A 3AUSA 4UUNA 4DYDA 3FMRA 3B1KA 4ONEA 3RC7A 3KZVA 4O63O 4Q4ZF 4OSPA 4LK0F 3FXRA 1E3SA 4KDFA 4ZU3A 4TQGA 2QQBA 1U3VA 1U6GA 1ZLJA 1FYKA 1L7DA 2C2YA 2RGVA 2P5YA 2O48X 1WWXA 1M6HA 2XROA 1FYLA 3H8VA 1B8VA 4JBIA 4XX0A 4I8XA 4NFSA 4OAQA 1D3YA 3F8FA 1R7JA 4AJKA 4CLDA 5BSHA 4FFMA 4IUYA 1ZXBA 1UAYA 4CLXA 2VWPA 2OUIA 1V8BA 1W73A 3H2ZA 2AEMA 3RCBA 3B73A 2OP1A 4PLFA 2VTDA 2OP0A 1KC3A 3WTWC 4MVJP 2NNYA 1JU9A 1SD5A 5L51A 1WW8A 3C1OA 4WK6A 5IN5A 1R5GA 1CQJA 1T98A 1W8DA 3KSZO 1IRFA 4IM7A 5DUIA 3F3XA 1GD1O 2V1DA 1JKIA 1K3TA 5AONA 1I6XA 2KRFA 1CERA 3DBLB 4XGIA 1TQPA 4UVDA 2OBNA 4CODB 4XIJA 3QY9A 2D0IA 1UCRA 2QZ8A 3TO6A 5F3RA 2VWQA 3S2FA 2XAQA 3I53A 1MFZA 3C1AA 5ENVA 5IF3A 4YT2A 1XMAA 3WX0A 4BKRA 5L3DA 1MV8A 1F9NA 4LK3A 2VOEA 1QLJA 2W24A 3G73A 5LHGA 2FWMX 3D7LA 3R3SA 3DZGA 5TX7A 3R4KA 3QRWA 2O3FA 4UVBA 1NQ5A 4EUEA 3GQVA 3TFOA 2V6CA 2X86A 3FD8A 4FJ2A 4WCFA 4E6PA 3I9JA 1ZCJA 3RPQA 3JQ7A 4GSKA 5E8GA 5TRTA 5HS6A 2X4HA 1IN7A 2QBYA 3F8MA 2OGUA 3QWHA 4O0LA 3UXYA 5KTKA 3MJEA 4CQLA 1DPRA 3ZHZA 4A10A 4E2ZA 1Y6JA 2Z3YA 2D5CA 5CVUA 1PZGA 3TKYA 4XB1A 1JGSA 3Q3CA 3B6ZA 5FFXA 2XGXA 4IIVA 1FMCA 2J5KA 4RF5A 1E5QA 2AMFA 1SMKA 4FN4A 2COMA 3RUHA 1N92A 2P2SA 4MO2A 3ENKA 3PHHA 4EDFA 4KT5C 1N9GB 2P5KA 1HL3A 1KY4A 1KEVA 4YFKF 5DZSA 4HV5A 2Q8KA 2PZKA 1ZRCA 1NQAO 3ICPA 4B7XA 4FFOA 3FBTA 3GMSA 3ERED 1HLDA 2Q4BA 3DB2A 3L0DA 4R3WA 4OOEA 1ULSA 5JO9A 4AJLA 2J8ZA 4MGRA 2R6JA 5CEFA 2X1HA 2E1CA 5IZCC 1MZBA 4WOKA 2IJLA 3HTUA 3RUEA 1ONPA 2BKAA 3TN7A 3LSYA 4YRBA 4NZ9A 3FF5A 2YFHA 2F5CA 2ZTUA 3KYBA 3RKXA 2ZNYA 1FP2A 4FFLA 2V6BA 1XDWA 1J9IA 4BO2A 3VDQA 1OKRA 2J3JA 3JQDA 1IUYA 4WEQA 2DLLA 1R00A 1F5TA 1FY7A 1USSA 3GLXA 3EMKA 4LMRA 2O61A 4Z0HO 2P8TA 4RPKA 1VL6A 1PS0A 1LLCA 3F46A 4OMUA 3WYCA 5JFOA 1P0CA 4OH1A 4N0BA 3BMOA 3HJAA 4BGEA 3PZRA 1X0VA 1ZVMA 3Q5FA 3NAQA 3GFIA 1E7MA 3NX4A 2ZMEA 3C3XA 4NPCA 3K1MA 4EW6A 2L54A 4BOYA 4CMEA 4ENNA 2KKOA 4B8WA 1TT5B 1FT9A 4A12A 5HTOA 4P9FA 1U4OA 2YPRA 1HDCA 4QTZA 4DXHA 1ZUD1 4OO3A 3TDKA 3M7GA 5K5QA 3QVTA 2E7XA 1UHMA 4R41A 3F5SA 4IMRA 5EPOA 3G1UA 4IQGA 4Q3CA 4XQ9A 3SQNA 4BL5A 2GRAA 5L3ZA 1ADGA 1Y1PA 1G6NA 3IHUA 3GG9A 5KVCA 3DZBA 3ZHBA 4JP2A 1XN7A 1UH5A 2O3JA 4MOWA 3TGNA 1JVBA 2EGGA 4UEOA 2RC4A 3AI3A 4KICA 4MJLA 4YJGA 4RGXA 1DXYA 5F5NA 2AQ8A 4GKBA 1T2CA 1NVGA 3JQBC 4BNNA 4TWRA 3NDRA 3P5SA 3ANNA 4J49A 1PQPA 2VC0A 3RIRA 3K2EA 1DIRA 2HR3A 3ZWBA 3G17A 2OU2A 1CYDA 5CFZA 4MP6A 5ICMA 3UOGA 2F5FA 1E77A 2QYSA 3FZVA 3ETDA 1TB4A 3WWZA 1Q2XA 4DC0A 4CQMA 1I10A 4D7AA 4UVAA 1P74A 4CGZA 4NIMA 5C37A 5TF4A 2OZPA 2UXXA 2KJBA 1UDBA 1YBMA 4KUHA 4WUVA 2DFIA 2FBHA 1GEEA 4DQUA 3TF5A 4J2HA 1PL6A 1I3NA 5JBIA 2DUUA 3AM3A 1Z45A 2AG8A 3NRCA 1R66A 2IYOA 3E9NA 3F23A 1PGQA 3BTUA 4EM2A 4M73A 1HKTA 5DEQA 2BFAA 5DBFA 2VHZA 2HTJA 5HLGA 2D59A 1JDJA 1ZIDA 3KP5A 2X0RA 3AU8A 1PL8A 3LLSA 5T5QA 2QRJA 5TJJA 2DM6A 4I7HA 4DLBA 2WE7A 5D8LB 1TNSA 1ZAOA 4O6VA 2KIMA 5JE8A 4G2NA 4WX9A 1N2SA 5DT9A 3TL2A 5J8CA 2OXIA 2V6GA 4RVUA 3PPIA 4MQ9F 1NBOA 3E82A 3K5PA 1TLHB 4MIEA 5U4QA 3HB5X 1HDYA 4XRRA 2DO7A 4EGZA 2X0NA 3CIFA 3JQ9C 2XAJA 4L74A 3FHLA 1YBAA 2QW8A 2XAAA 1TEHA 3V8BA 3WQRA 1OYWA 3ZV6A 1QQIA 4JBHA 3WGYA 2D5AA 4MEYF 3ADOA 3ETEA 3HRUA 3OEWA 3WODF 2HSDA 2VUSA 1C1XA 4L76A 2E48A 2HQNA 2B69A 3UF0A 1NHAA 2PD3A 2K02A 1HDOA 1L3LA 1FBSA 1RWBA 2QQ5A 3A06A 3ONFA 4IXWA 2H09A 2H9IA 1GADO 5ILUA 2ZYDA 2CVOA 3HB4X 3CH6A 2EV5A 1SB8A 4BNTA 1L1FA 2HDHA 2GA1A
chains in the Genus database with same CATH superfamily
4KPFC 1BE1A 3TNFA 3TOBA 4JLOA 1J8FA 1NJ6A 5INTA 4HQ6A 1GNLA 2CLFB 4XGQA 2HMSA 1T08B 5EIAA 1O6CA 4ROSA 3D2AA 2GESA 4A3DJ 1ORDA 1C81A 3M5WA 5HUHA 5G4KA 2Q5IA 3GFLA 3PIDA 1IG7A 1E9BA 1W88B 4DRXA 3M1CA 4HX4A 2R1TA 2C04A 2I4LA 1DB3A 2Z6VA 1S89A 4TQ9A 2IOYA 3A4TA 4N6OA 2L4MA 2CD9A 4RE5A 1I4LD 4HPXB 3ZGYA 1Y48E 2HSJA 1EMDA 4FGSA 1SFKA 2OJED 4BKQA 1TK3A 1Z5WA 2P9GA 4GOXA 2DI3A 3KALA 5MFZA 4LG0B 2DEUA 4A3IJ 3VR1A 3OYLA 3VRHA 4FINA 2FX5A 1UXIA 2X2OA 1Z56C 3R0ZA 3VKWA 4RU1A 1X80A 2WB1N 3DKXA 2K2WA 2P3LA 3QNWA 2EBHX 5BV0A 3SR3A 2PG4A 2V7GA 4B7UA 4LCBA 5A5GA 3E9MA 3ZHTA 1JL3A 5I9BA 3VU0A 1I0ZA 5JCOA 3LZ6A 1F5SA 1U5AA 1QG2A 2BR4A 5I7UA 2K9NA 1NMYA 1ZD2P 1DPUA 5D7BA 2J9GA 2JA7J 1E1QA 1H9TA 2HA7A 1P3JA 1Q2UA 3HKEB 5JVGF 2QAGB 1IV6A 2JAUA 4JFRA 1NQVA 4L4YA 1YVUA 2E1PA 2JRTA 3ACBA 2DZDA 2Z5GA 3IBSA 4KSBA 3KR9A 1M2WA 2AVDA 5EJFA 2ATXA 4N7RA 5KC9A 4EI8A 3UJ6A 1VPDA 3OYGA 4BVEA 4W1UA 2CQXA 3VDRA 4B9EA 4WVFA 3CZ9A 3I4FA 2VXYA 2IEYA 2YNMD 4LSMA 1L4BA 4A6PA 4A6DA 2JJYA 1KWGA 4D9CA 1FJ2A 1FC3A 2MYTA 2XNDD 4GGGA 4H6XA 1M8PA 2PSHA 4FOOA 1ZONA 2R7TA 1U0HC 1XJ0A 3F67A 5G0VA 5ARCA 5CCBA 1KR5A 2J6HA 4ZALA 4JCCA 5EVJA 4YI5A 4ZWNA 3ROFA 3DV9A 1G7CA 2O2XA 2O03A 2X9DA 3IKTA 3PU6A 1WVRA 3E7WA 5BYJA 1MNMC 3C24A 1VFCA 3I0NA 2QJRA 4YRTA 4R5HA 2IIBA 1ULZA 3ESYA 3KSMA 2VYND 2BUAA 3HVRA 1JKJA 1ZYUA 4JI5B 2IA1A 3T1BA 3ZQLA 3T3MB 4L78A 1KE2A 2DCMA 3FFTA 2IGOA 5D3KA 2CYCA 1QH1A 2OYSA 2NUPB 2J5XA 1ZESA 4DSAA 2KB0A 1DTWA 2B7BA 5H7XA 5H68A 3OOHA 4OK5A 1JKQC 1XFDA 4RK1A 4XDGA 4IHQA 4DLTA 1I5EA 4HWTA 1SBQA 3THRA 3LOQA 4US2R 9MHTA 2Z1DA 1E96A 3W04A 2BEOA 3L8YA 2P68A 5DIZA 2FETA 3IALA 4MVWA 1A5JA 2HEGA 3QKWA 3IQFA 4FASD 1CVIA 3T52A 3ELYA 1YA6A 2X1EA 1YJWI 2AN1A 3EXG1 4LZPA 2XECA 2OCAA 3DMPA 4Q6WA 1PR2A 3LNTA 3UMYA 1Z88A 2J9FA 1V5EA 1T8WA 1MC1A 2C4NA 2NUAA 5BN4A 3QMMA 3DTKA 1QQTA 4YALA 2XOEA 3AHEA 4HNAB 1KU6A 3SC3A 2OBXA 4RORA 1ETOA 1ZD4A 3RYIB 2O14A 1WEKA 3H1AA 4UBLA 2A0WA 1T2EA 5LP6C 3AVQA 1TUGA 4E22A 1JPNA 4MQEA 2XVZA 2TYSB 2AS5F 2I67A 2FPKA 4XX0B 1CIVA 1AVTA 1HYEA 4G26A 5GWXA 4K2HA 4PSXA 3WLEA 3L8EA 1Z4NA 3L0OA 2QLLA 4YELA 2HW8A 1MP0A 3ZW9A 3OZXA 1M9NA 4DRYA 4M9SA 4CM4A 1KMNA 4XARA 3AEUA 3VH4A 3I52A 4AQ7A 1ECLA 5DCMA 3CW2A 4IJ6A 2QLFA 4NAVA 4TSFA 1EHCA 1ZM4A 3EA5A 3G02A 2IBMA 2XAHA 3AU9A 4D6YA 1Z5GA 4LJ8A 2XLBA 1ZA1A 1CJSA 2B36A 2IYQA 1P4AA 1OILA 4GEGA 1C14A 2VZEA 3MCZA 4G0ZA 3HCRA 5EE5B 4O6JA 3WFJA 3A1NA 3BMOB 3DE1X 1U9JA 3KPHA 3BMQA 3F90A 5AIAA 4FHZA 3RSNA 5CXXA 2EH3A 1RW4A 1WJBA 4D3XA 2B9VA 4DAEA 5AJHA 3MZ0A 3DDSA 1HNXB 1IVNA 4OHBA 1T8PA 2J3MA 3UC5A 3TCKA 1QZEA 2H07A 4P7GA 2QOEA 4G0QA 3FYDA 1I3CA 5FPQA 1ADBA 4LEIA 5BR7A 3KYDA 2QDKA 2XUFA 4AB1A 3QG5A 4AJ2A 4CQMB 2RN7A 4MQ4A 3RV4A 3N87A 2GNPA 1W7PD 3VZBA 4IHWA 2RGYA 2R0QC 1YG2A 1E0SA 2RGAA 1OPCA 3RE1A 2Q2NA 5JDCA 5JSYA 4RC9A 4WXEA 2ZJ4A 2MFZA 4NLLA 5I7EA 5JXGA 1R0CA 3OMWA 3RTBA 1P6RA 1THZA 1J9GA 1DC6A 4QEKA 3KVRA 1WDWB 4JR1A 4L5YA 4PVDA 4N4NB 5TF0A 4NZYA 1R3DA 3LAWA 3DTNA 1LPPA 3S44A 2QRVB 4L3VA 1AKQA 2HI0A 1W1UA 2EZLA 3BLYA 4RH0A 3R6SA 2FW9A 3RYFB 3Q7IA 2QNRA 1ULTA 4ZDJA 1Z7WA 4B6PA 2LIPA 2VPXA 2ZITA 1E79D 4MARA 2AKYA 3HTXA 3W5HA 1OFUX 2XZPA 4NQWA 3B3JA 1XLTC 3A1SA 1N6OA 3E6DA 3OYAA 4J19A 1XT6A 2DPYA 5CVEA 4K6CA 3NV9A 3MFQA 1MENA 1UFRA 1X7WB 3BH7A 4RD1A 1TYEB 1EUDB 1K2VN 1FXSA 5JALA 2W00A 2I6TA 2PRSA 1PHRA 5KWSA 4B8YA 4UMDA 1L7EA 2YN4A 4C89A 2Y31A 6YASA 4H1HA 5E18F 4YJHB 3DUFA 2EZUA 4PRLA 1FYMA 1SANA 1IRXA 3VJMA 3G79A 1A98A 5G0TA 1VGRA 3MD0A 2QD4A 2D5VA 3OL4A 2CMDA 4RYDA 5D8KB 2I33A 3F3YA 3UKDA 3CO6C 4F7DA 5JDIA 4HZGA 5E9WA 3O8RA 2FZ4A 3MUFA 1WI3A 2BFDB 1RRVA 3OC6A 3N6VA 2AQKA 3JZFA 4R0NA 4RIHA 3PWTA 3CUUA 1LJ9A 1LCIA 1LZKA 1LDDA 3KUDA 4YRDA 3SSAA 5B30A 4IV8A 2RFLA 3GFFA 3CP2A 3CF2A 4I1IA 2Y8EA 1WP9A 1DFIA 4DGWB 3ZDDA 3E0XA 1X7ZB 1EQ2A 1WB4A 5CVTA 5CXSA 2XCRB 2P77A 2J0QA 4GYGA 1ZGHA 4CIBA 3KQKA 3GVHA 4EG5A 2Z8XA 1XWFA 4QNRA 5IUKC 4AK9A 4H7KA 2NTJA 1CUUA 4OQEA 2DFPA 4JAVC 3V4PB 4Q47A 4IGFA 5CLIA 1USVA 2V1XA 3TNLA 3THXA 1MSFC 4EG7A 1GZ4A 4EABA 4WIAA 3DC7A 4ENUA 1R88A 3HK2A 4R8RA 2KS6A 4XKJA 3C4VA 3FDFA 3ZH2A 4BP8A 1SC1A 2OV4A 2WWIA 2JFYA 4NRDA 3W05A 1PGPA 1T4MA 5IBRA 4GO1A 2P2LA 4CGYA 2IV7A 1G3SA 2QRLA 4HQEA 4E46A 1BIFA 2XYHA 2D6FA 3WGGA 4F5DA 1SRQA 1GSAA 4M1YA 2HDNB 1QO0A 2IH2A 4XWAA 2FOLA 2FSFA 4G0UA 3R77A 3VPFA 1YIAA 3G3EA 1QXSA 3BIOA 2ZJ6A 5B37A 1X38A 3Q9VA 1XB2A 1JV2B 1KTIA 3GLGE 5JATA 2ECPA 2ZYWX 3J80A 1P77A 2QV0A 5AI6A 1KSHA 3CQZJ 4JUIA 1L5HB 1NC1A 3C48A 1GRRA 4EM6A 2BD0A 4HAYA 5CVRA 4CMKA 2PN6A 5JC1A 4Y52J 2HJGA 1XZ8A 5CDFE 4RZ2A 1CEQA 2IH4A 2AW3A 3NAMA 5I7HA 5BO5A 2IYTA 4FHTA 4HDOB 2M3AA 4XRSG 2YX7A 1LH0A 5LXTF 4NYJQ 1Z6ZA 4TV9B 3DVSX 5CA0F 3LV8A 4ZJPA 5TE9A 4K0RA 5TISC 5L9AA 4ALKA 2GO7A 3I9LA 2Q5HA 3JQQA 4JENA 1CP3A 3OV8A 1X3SA 1VIVA 4IMJB 3ERMA 4MIYA 4OREX 1KIMA 5EMJA 1R3UA 1TZ2A 5IYZF 2AHRA 2B37A 4JMLA 1G18A 1DINA 1M74A 1LBTA 2CXOA 1Y9DA 3BWBA 4C88A 3U3MA 4I9GA 1EB9A 1BS2A 1XZCA 4C78A 3QA3E 2DERA 3U4GA 4BL5A 4J16A 1V6AA 5ITZA 5IMSA 2PQMA 2QLMA 4ZAXA 4W9NC 3KSAC 4GKKB 1NW4A 5JTUA 1JQLB 4QUAA 2DX7A 4EARA 4NFLA 3EVAA 1DS6A 5FV4A 3UKGA 2WJIA 3BDIA 3PR3A 2YWFA 3SYTA 2HB6A 3PRHA 3LM8A 3D3WB 4E7IA 5CBPA 2HV8A 1BXRA 1H2YA 4HQOA 1COWD 2XDQB 1UKYA 1MIOA 3M4XA 3GO5A 2C4KA 3GAZA 1A9XB 1MAWA 4IRMA 3SHOA 1B23P 4CBVA 2I29A 4H7HA 2P40A 2UYHA 1R0WA 3SCZA 3I92A 3QX3A 2PBFA 4Q3KA 4B4DA 5ALGA 3FSJX 1RKBA 1T29A 1XZHA 2B92A 1UJCA 2GVNA 5JC8A 4EHHA 2C97A 2GTHA 1L7AA 3AF3A 2DFFA 2FRXA 1MHTA 3DZDA 1WXEA 1J39A 5F9FA 1YZTA 4RZSA 4HBLA 3EVFA 5FBZA 2NVBA 3R3XA 5HRUA 1B72B 3A3KA 2Z4TA 2YDYA 2Y4NA 3DVRX 4H16A 2IS2A 1T6XA 5K3CA 2G9NA 4YCDA 5IK2A 4PFQA 4HWRA 4TT8A 2ZVJA 1ODFA 1JFVA 1K4TA 5THKA 2OC9A 2WD9A 1AZWA 1TW3A 2QUIA 4BJ6A 3DBRA 1M5UA 5BOSB 4XMYA 3JQFA 3Q2IA 2V5AA 4GU5A 4J1SA 3D4PA 1TYZA 1NMZA 3A9SA 4B3TB 4PPQA 2FOKA 1T1SA 2CEKA 2IHKA 4K6KA 3BQYA 2HDDA 1QHGA 1M7BA 2ZBVA 3JTMA 2VODA 5DYMA 4FWIB 2A9OA 3BEDA 1LSJA 4CKWB 1XRJA 4P3KA 5DDGA 1VA4A 2J45A 1CFZA 5LC1A 5C18A 3NYQA 4M0LA 2VSQA 4OXNA 2JVKA 3JWEA 5C3MA 4I2OA 2BOLA 5E79C 3V8NA 5BNGA 2DT7B 3FUCA 3CCEI 2F17A 1KO4A 1CNEA 3RCOA 4IDHA 2VXCA 3EVGA 3F8TA 5KTNA 2FOIA 2OESA 5JV5A 1T0FA 2GXBA 2MCFA 1RI3A 9ATCA 1QO0D 4A73A 4YAUA 2QTTA 3PITA 1LFBA 4B09A 1UMBB 1U7DA 4L8FA 1YS2X 1W94A 4R8SA 4PYOA 1KVQA 3VGPA 1SUSA 2QR3A 4HT3B 4RDIA 3R5XA 3GXBA 1NG9A 1NGSA 2I7VA 5FKLA 5J4HA 5B5EC 1N7HA 4F5ZA 5ES4B 1FSGA 4RYLA 3T6KA 3LKZA 2Z8ZA 4GX1A 3U40A 1DVRA 1QGUA 2V1NA 2O2IA 3OFKA 2YTZA 3IJRA 1JBQA 1W4ZA 2IZ6A 3W6KB 3KP1A 1NRXA 4G25A 2LCFA 4YAJA 1ZNWA 4C6TB 2ZBRA 2QRHA 4CCAA 4C08A 3U0BA 5D5WB 1TF2A 3C3KA 2XAUA 4B6JA 5KJ6A 3A36A 3BTVA 4WESB 4B6FA 1K68A 4JB8A 3GLUA 2RREA 3AVVA 1N9ZA 2HSGA 1V37A 3W8FA 3NEAA 4KH1A 4HF1A 1J1ZA 3V2HA 5TPWA 4WL0A 1SIWA 1A27A 3KFVA 4NC7A 4A8JB 1PZEA 4IF6A 1NDQA 3USZA 2JFOA 1TAGA 1JLLB 4GP6A 1CQIB 3OCJA 1P2SA 3QP9A 3QBTA 4TS1A 3GN2A 1VKJA 4NMXB 1GM5A 3PC8C 4M54A 3UEOA 4FR0A 2GLOA 2A59A 2G36A 5C9ZA 3ZDFA 3PNMA 4D4HA 1ODJA 2GXUA 3ZKWA 3KYCB 2PWAA 3GD5A 1D0SA 1PR4A 4Y9DA 4D1QA 4CEJA 4H6PA 3A05A 1BEEA 3K0LA 1EH8A 3FETA 4KO8A 4WFKA 2IY7A 4WN9B 1KRWA 1G4AE 1U7PA 2W48A 5AXAA 4DMHA 2BC9A 3G9UA 3RGWS 3OYIA 1XRSB 1VBKA 3CLSD 3VKGA 1Y56A 4PCQA 1Q15A 3ZXYA 4M71A 1H2HA 1SG0A 1YE5A 2CGEA 2JAXA 3L7AA 2O8DA 3BRWD 2OEPA 1AK9A 1XZFA 4MROA 1DBWA 1J5PA 1SOVA 4TVOA 4I5EA 3KBBA 5KI6A 5CVCA 2OGZA 3LX4A 3PSAA 3QXCA 1TA4A 2F3SA 2IUSA 1R4NB 1R8XA 1KJ9A 4BKOA 2DBVO 3INYA 1ISPA 2A0UA 4ARSA 2I2AA 4C7OA 2D4AA 1OGYA 4LOCA 1AQ6A 2Q6VA 3OU2A 1AN0A 3DFZA 1CZRA 1PR9A 2VK8A 3FMRA 4RS4A 4B17A 1E3SA 1V5IA 4RSMA 2AMLA 2QQBA 4MV5A 4OAQA 4AJKA 5BSHA 1D04A 1P73A 2BKVA 2WZCA 5JG7A 2OUIA 1V8BA 3T3IA 4GM0A 1Q1ZA 1CQJA 1T98A 4XPIA 4HEA2 3ESAA 4DA8A 3IAEA 2OBNA 3ZEAA 3QY9A 3BS4A 2GK6A 1GN9A 4I99C 4C9YA 1QWOA 1KQGA 2Z5FA 5BW5A 3EG9A 3B3GA 3PSFA 1VXRA 4CKXA 2FEMA 1DCKA 3NTVA 2A3NA 2ODTX 1IN7A 3CH7A 2QBYA 3W2IA 4CYCA 5BYKA 2Z3YA 2OTJI 4LF6B 2FLKA 3K0CA 5LMUB 2P2SA 5JVDF 4JXXA 3QEAZ 3GJSA 3SJBA 1HLDA 1Z5VA 3OJWA 1Z28A 3D3JA 5CXUA 4XAQA 1SFOJ 2LG4A 2ZB9A 3G0HA 2XPUA 3DO6A 1F5TA 3C0KA 1ESCA 2Z2JA 3D8NA 2W6JA 2RCNA 1ODSA 1BH2A 3A4CA 3OIOA 4IQJA 1MJGM 2PQ2A 3W1EA 5IVPA 2E7XA 2CVHA 4YO7A 2GRAA 1RHKA 2F3PA 2XIJA 3GG9A 2ZAMA 3H18A 3JR7A 3CH4B 2OAQ1 3MNFA 2FFQA 5AESA 4D8XA 3P5SA 1PQPA 3ZWBA 3O1JC 3G17A 4DKXA 3P0IA 4ZK2A 2H2AA 3KTOA 4DV7B 1JJ8C 2QMHA 3IR7A 2XF5A 4BQEA 2X0RA 1MDFA 4WCVA 4IVRA 1TNSA 4O6VA 4G2NA 5EGOA 4GMHA 5TR9A 4M0CA 2X0NA 2W37A 4QYWA 2YH2A 1CZLA 3EUEA 1L5RA 3HRUA 5DNUA 1P7CA 4BX9A 4YP1A 1NVUQ 3K5HA 3ODPA 3HB4X 4WZBB 4BMXA 4HGZA 2OQGA 1G6Q1 3SLRA 1HF0A 4ARZB 2HXYA 1S72I 2R5NA 4R98A 1X1EA 1YBVA 1SKQA 2HVSA 1H6AA 2DFLA 4AUMA 1SD6A 4PHCA 5K20A 2QM3A 5HXAA 4S1OA 1RMTA 5B3AA 1RXSA 4D8TA 1K66A 2WD8A 3IPAA 1S8NA 4BLRA 4EF4A 1RHRA 5ILGA 3RFXA 4FYWA 1EGMB 4EG1A 1MEEA 2OHFA 5CEEA 5G1OA 5ELMA 3AG6A 1PJCA 3ZMVA 2M9HA 4PZPA 4Q21A 4HEA1 3C14C 3GT0A 4IKFA 1ZCZA 1FNNA 2ID7A 2JZCA 2X58A 1YJBA 4BFXA 4BLQA 5EWJA 1C3OB 2VPPA 3DBHA 2O2HA 4CN8A 5ALZA 2LF8A 1WUKS 3EZ7A 1G3YA 2Z99A 1KMHA 3IBYA 1RXWA 4RABA 3W5BA 1MX9A 1Z0KA 4IEFB 4D02A 1D0XA 1Z6GA 2ESRA 1NM5C 4HNHA 3H5NA 2CHVA 5TMBA 1GLGA 2WAYA 1W46A 4F45A 1OY1A 1EPUA 2C8KA 5A2GA 4NFYA 3FDZB 1CE8A 3MOGA 3WOHA 4DA9A 1BXGB 1BX3A 2FWPA 4LD5A 3L2RA 1O54A 3C5CA 2FF4A 2DH6A 4UHEA 3ZHQA 3HO1A 2BHZA 1E58A 4W5NA 2JI9A 3WYGA 2JA1A 5BVGB 3G6EI 1PDVA 1ON1A 1TO2E 4CXFA 2GNAA 1NTCA 4RPJA 4IIHA 5AH0A 4FBGA 4UHFA 3ZJUA 1R6BX 2ZXWH 4HDKA 3BQNB 1PLKA 2AC4A 4XR4A 3K0FB 1BS1A 4WECA 3PWKA 3LG2A 2GQQA 3LSPA 1SM4A 2F2TA 3AF5A 1ISJA 3A28A 1JFFA 4DM3A 2E1OA 3F3KA 3PTAA 1MJHA 4IJVA 3BOQA 4AMBA 1K7CA 3UQYS 1N7JA 1LKZA 1ETXA 3QVGA 4DM4A 4C0HA 3NDBB 4XLAA 1RUOA 2X0IA 2XUQA 3L6EA 3ZQJA 2XNSA 3SX4A 2LRHA 5ESRA 4KNYA 1KGSA 1XD9A 2P65A 2WJJA 1TYBE 1SVSA 4LRWA 1KY3A 3FX2A 4GOKA 2FZLA 3P9IA 3SBDA 2GWHA 3QPSA 3E0QA 1ZHFA 4TMWA 2NZXA 3V4ZA 1B26A 4D79A 2K86A 4AURA 4C3UA 2K40A 3HGGA 2JZYA 2ECCA 1WEHA 3OQIA 2FG5A 2ZS9A 1QFMA 2HQ5A 2Q6OA 5ED0A 1PD1A 5CT8A 3VHXA 4BCDA 7MDHA 3L4SO 2ZZNA 2SKDA 3DH0A 1W4RA 4AWBA 5B1EA 4RQUA 4B2PA 1JQKA 1TC3C 1WQ1R 2PJUA 1U0LA 3B53X 4FCCA 4QGBA 3H36A 1CKEA 1EU1A 1RXVA 4ZT5A 3VO8A 5HKKA 3I2FA 3ABTA 1GHTA 2F00A 4HTFA 2NPIA 2HU7A 2W5UA 1NX6A 3IEXA 4KQIA 2BSQA 2MH9A 2HOTA 2AG5A 3MILA 2RCYA 5ALXA 1LD3A 1IN4A 3OAAA 1QX4A 2WJAA 2P4EA 4XICA 3HCOA 5F7JA 4I1VA 3QBDA 4WKGA 2CCKA 2OORC 1N0IA 2ZAGA 3JYPA 1WSBA 2FG6C 4A2WA 3KYJB 2DC1A 4E7LA 2Y1EA 1I3OA 3WQHA 4EA6A 5AVYA 4J1NA 5H4GA 1WMDA 4ZOLF 4I5GA 5ALYA 2VBZA