2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
2IJLA 3HJAA 2Z95A 2LF7A 4KDFA 1H6BA 3M8FA 3DHEA 2ZTLA 1T38A 3ITKA 2P6SA 2CVOA 3KOUA 1P1RA 4R1NA 5FWNA 2OFPA 1ADCA 1SZJG 3IMFA 4E21A 5IXYA 3BZ6A 2ZNYA 3I53A 3MAJA 3AJRA 3KXDA 5AXDA 5L3ZA 4J16A 2M8EA 3IC5A 3CO7C 1SO8A 1GDHA 3H2SA 5JCJA 5DOZA 5ES3A 1WSUA 3FF5A 1LEHA 1ZNQO 5DDIP 2GAUA 2Y75A 1FYMA 2Y1CA 5JAZA 1N1GA 2L01A 2BEOA 3VVCA 2X23A 1KQ9A 3K2ZA 1EK6A 4PRLA 3CJNA 2K86A 3DHNA 2BYVE 3ZNQA 4D43A 3HUDA 4BQPA 4EM1A 4FC7A 4WWCA 1UP6A 2MBFA 1F8GA 5DCYA 1J75A 1IOLA 3ABIA 4FOSA 3JQ7A 1JN0A 1OKRA 4I9UA 3WNVA 3ITDA 5E8GA 1QYXA 1PL6A 1GAEO 3DFUA 1YB1A 4XZ3A 5DUIA 3R4KA 1V9LA 2BD0A 1DXYA 2EFPA 4FJ0A 5CEFA 1FBUA 1BJAA 2DBRA 1DIAA 2J6IA 1K78B 4YAEA 1UFMA 3M1EA 3QVOA 4LMPA 5DD8A 4WF2A 1G4DA 1QYCA 4QUKA 3KV3O 4RB3C 1V35A 5IF3A 5KVCA 5IT9Z 1U2GA 5A9SB 5CDGA 5TF4A 3RKRA 3F8MA 4CMBA 4YFXF 2GXGA 3I5MA 5BT9A 4RVUA 3K1MA 4EJVA 3OHSX 5C5IA 4Y6PA 2DPDA 5IT3A 4MIYA 5JMWA 2QZ8A 1YQGA 3E9NA 4M87A 2FWMX 2Q2VA 3GVAA 1PL7A 2JCXA 3HADA 4MVJA 5K0ZA 1GV0A 3ZMDA 3WR5A 1Y1PA 3WGYA 2DU9A 2X4HA 2OP1A 2VHYA 3IUPA 4Q3CA 4CLRB 5A4DA 5BR7A 4FJ1A 1XGKA 3INGA 4K6FA 1ZLJA 2BGKA 1HSTA 3V8BA 2J8ZA 1AXEA 1Z73A 1R00A 3GEZA 3AM5A 1NFRA 5L4LA 1BI3A 2QVOA 2NQTA 1K78A 5JNLA 4N9IA 3R60A 3GFJA 4HDUA 4HYEA 3AW9A 1BN5A 4G7HF 3QP6A 2LDXA 1D8JA 4K6CA 5D5VB 4BB6A 1DBVO 3NT5A 4RB2C 1PWZA 1SOWA 3I0TA 2BI8A 1IF1A 4BIIA 5ICEA 5K5QA 3D4OA 1JKJA 4ND2A 5JE8A 1W4MA 5JDIC 2B4TO 1T2DA 1ZK3A 2QM3A 2HS5A 3GFBA 2QRLA 4FD3A 3WTTC 4L0ZB 2GN4A 4I5EA 1TNSA 1FXSA 1OPCA 3DXJF 3ENNA 1LLCA 3JQ8B 1BDMA 3JTMA 1T4DA 2VTDA 1XQ1A 1WP4A 2TMGA 5I7VA 4J1TA 4AJPA 3LFKA 3PJEA 2X8LA 2YV3A 3H6KA 4QO7A 4IQ8A 4A2CA 2O3RA 4B4OA 4JLWA 4DYDA 2AQ8A 4J49A 1EZ4A 1K0UA 2ET6A 2LDBA 1CYDA 4HW0A 4TQGA 4J2OA 4NK5A 2XROA 1MC4A 1NASA 3TQHA 1Z7UA 3HYIA 1QXSA 2PFGA 1YOVA 3JQAA 5FI3A 2Y0MA 3WE3A 1ZVMA 2W90A 1C0LA 4EM0B 1XGNA 3JQFA 3F47A 5FI5A 1F14A 1R15A 3PHHA 3K92A 4HP8A 3VPGA 2GR9A 2GXBA 1YQXA 4OXNA 3H3ZA 2Y05A 1RZ4A 4IJVA 3TZHA 6ADHA 4RB1A 4GBJA 3RFXA 3QPTA 3O8QB 2CW0F 1BWSA 2J3IA 4WNIA 2V6MA 1EFLA 1PGJA 2HR3A 3RUIA 4K9DA 4CUJA 4KDEA 1L7DA 4FT8A 4NZ9A 4IIVA 2YX7A 2FSVA 3DXFA 2BF7A 1N7HA 2YZ7A 5CJ9A 5C37A 3VZPA 2XGXA 3NX4A 4P9FA 2YYYA 3VKVA 4M71A 1M75A 1TQMA 2O48X 2VN8A 5CVJA 3DR3A 2Q2QA 3AFNA 4ZQHA 4KOAA 3DQVC 2B37A 1GUYA 1DRUA 3OOPA 4L8VA 3ZN2A 4CLEA 4EI2A 1F0YA 2P5YA 3TOAA 4GPD1 2DQ4A 4CM8A 4EEXA 4C7JA 1GXQA 1IULA 1ZJZA 2UAGA 3PYXA 3H5NA 2VHWA 3RKWA 1LSJA 2B83A 3NUGA 3QHAA 3MJEA 4I5DA 4MHGA 3CUQC 5DUKA 1RPNA 4ROSA 1U7TA 3ROQA 4DPMA 4WLUA 3PQKA 3RVDA 1ZHFA 2KIMA 1ZG5A 2FNPA 1EMDA 1H0KA 1LJ9A 4IDEA 3F4BA 4L4XA 1E2XA 4MJLA 3W4IA 5KWEA 1G6NA 5E18F 1Q7CA 5JAQA 3H8VA 1NTOA 1AHHA 2GD1O 2VC0A 4MIOA 4PFJA 3KETA 1KVSA 3GRKA 3DWFA 2DTRA 3AOEC 4N18A 3DBRB 1DPGA 1BM9A 3RIRA 1G1AA 1T2EA 4AL4A 2CSUA 3Q9SA 1RYDA 1U8FO 2DFVA 2XRNA 1Y5RA 1E7QA 1V8BA 3FWZA 4U0JA 2DQRA 4KN7X 3EYIA 2B35A 4YXFA 4ZHSA 1U9JA 5IAAA 1HKQA 1MXFA 1UDAA 3BY6A 3ZU2A 3ORFA 2IZZA 2DI3A 4OL9A 4CMKA 5K6AC 1BI2A 1QRRA 3GHHA 4IXWA 3CXRA 5IZCC 1KVTA 5A5FA 1HYEA 1ZAOA 2E48A 4GWGA 2NU6A 2G5CA 3FNGA 5L7WA 1KA8A 4YT2A 5JYDA 1UZMA 4GGGA 4S04A 1ZIDA 2Y66A 3R3SA 4ND1A 3GZ5A 3WWZA 3ZWBA 4GVXA 2VHXA 3QP5A 1LLQA 3IJRA 2EFWA 3LT1A 4HX5A 4D42A 1MZBA 1YRLA 1KEPA 2FMYA 1YL7A 3KYCB 2L02A 3JD1A 4CR6A 2QBYB 4A0YA 5TIIA 3V8LA 1Y7TA 2WD7A 2WWRA 5CEJA 4BAYA 2FBHA 3FNEA 4IGFA 3RC2A 2V6BA 3GG2A 3E97A 2P9EA 3DB2A 2PTGA 3KLMX 4QSMA 4RPHA 2JAPA 4ILKA 4YIIA 1N7GA 2MC3A 3FR8A 5G0TA 4R01A 3B20A 2OBPA 4CM9D 3U9GA 5JAMA 1IN8A 2P91A 5L40A 2Q1SA 1BIAA 4FW8A 2VYNA 2J3JA 2RDPA 5HLGA 1I8TA 3AU9A 1PL8A 3EAGA 4C4OA 4QFDA 4CICA 2OMEA 3CLOA 4O1MA 2P4QA 2DBBA 1RM4A 1BIBA 3B02A 1P45A 5C7OO 5ILSA 2O2YA 4FHTA 1Y8RB 3C1OA 1S6LA 1K7AA 1I2ZA 3PIDA 3WS7A 3FXQA 3GHYA 2H63A 3JQ8A 2HMVA 3WQQA 1USTA 5L4NA 4N7RA 1I0ZA 3ZW9A 3EK2A 4J9VA 4OSPA 1F9NA 4BO7A 4HUJA 1VPDA 3ETEA 4CR7A 4D41A 2H09A 1PJ3A 5EJ2A 3AUTA 3ONFA 4AG3A 5KJ1A 5EMHA 4R8HA 4XB1A 4G94A 1TTYA 4MVJP 3TRIA 4DLBA 3K1NA 5I7FA 5L3CA 2R00A 1Z6TA 4J90A 1DP7P 3ZV4A 4H16A 1XEAA 3CE6A 4OMUA 3CUQB 4W9NA 1T26A 1ZSVA 1T98A 3C7DB 3TZQA 2D2WA 3ZWOA 4BGUA 2EJRA 3K2BA 5CAEA 3ZWYA 1SMKA 3GZ6A 3ZHZA 1YW7A 2RVCA 1J59A 4R1UA 4BV8A 3B1JA 1XQ6A 1Y8QA 4DUPA 5HM8A 1KU2A 1CWUA 1P1FA 3JQFC 4ZQGA 1YFHA 3MWDB 3I71A 4HQMA 2R7FA 3Q11A 3FNFA 4KQWA 3F23A 4OIPF 3E9QA 5B1YA 1XU7A 2EIHA 4D0RA 3P7MA 3PDUA 2R3SA 1E1NA 4HXYA 5I7SA 3PWSA 4U5QA 5G0VA 4B3JA 3ZWCA 1HDYA 3GK3A 3RUAA 2P2SA 3DBLB 2XV4S 5EEGA 2PMHA 1MGOA 4NU6A 4EMSA 2COMA 2Y1EA 1J5PA 2C54A 3NYWA 4YG2F 3JQCA 5ICFA 3CTMA 3M1AA 5EPOA 1ZMOA 2DU8A 5GMOA 4Q9NA 4AJLA 4DBVO 3DPTA 1TNTA 2J5PA 1IN6A 2C2YA 4NIMA 3ROMA 4DMMA 3QVSA 4JCOA 3FPCA 4KA4A 2V6GA 3PWKA 5TLSA 3L4BC 2XKOA 3FWNA 1P2FA 2ZTMA 3WU1B 1VRWA 3LT2A 1LEAA 1LDMA 1PQPA 4TVBA 1N5DA 1P4XA 4BH9A 2FPPA 4BMNA 3FZVA 1P1HA 5JFRA 2UXNA 2HLPA 1ZO8A 4RORA 5E8IA 3V1TC 1EH6A 2X0LA 4Y15A 4S3MA 5BSHA 1SMYF 1XSXA 3GGOA 4BNXA 1T2CA 1FWZA 4EJMA 1KBZA 1EVZA 1JE8A 4BO3A 1EBUA 2HQNA 2X86A 3TZKA 3H5AA 3VZQA 1MUUA 1WZIA 3E48A 5FYDA 4B09A 5D4SA 5A3JA 3VOSA 4PN3A 4UULA 2O6GE 1DHTA 4J3FA 1YQAA 3K1PA 4DNCA 4LJZF 4F7ZA 3C1TA 3H9EO 2RNJA 2HRBA 3QWHA 4YAKA 2HOEA 3PFIA 4FQ8A 4ONEA 3MTJA 3SC6A 1H9GA 4R1SA 5JPIA 4ESJA 1HW2A 1IZ9A 3TDZC 3M1LA 4MP8A 4XR9A 4BUCA 4L0YB 1YW8A 3DBHA 4BNTA 3FR7A 1IW7F 1W7PA 2LDUA 4IS3A 4GGOA 2IA1A 1PP8F 4ND5A 1FDWA 1MXHA 3INRA 3TDUC 1XMKA 3ANLA 3L9XA 3PYMA 4HWKA 5CEEA 5A04A 4CQLA 1Y9EA 2GQQA 4Z9XA 5J8FA 5EIOA 5EINA 1ORRA 1I32A 3LT0A 3WGGA 5JO0A 4PVDA 2NU9A 1BHSA 1CQJA 2B4QA 1Z1DA 1U2WA 1Z7BA 4OQZA 4W99A 3U3XA 4I9HA 1E5QA 2X9NA 4PLHA 3UKOA 4ALKA 2XAQA 3A06A 4CL3A 4LK1F 3JYOA 4J1QA 1E6WA 3EZYA 1X1TA 3NV9A 1DEHA 2DT5A 3U49A 5D8LB 3V8KA 1A7AA 1FSEA 1BXGA 1N9GA 2P4HX 3BDDA 1NWCA 3K9QO 4L4RA 1SFUA 3PJFA 4PVCA 3SJUA 1X13A 3VPXA 1D1SA 4EEZA 1C0KA 4WLOA 3E6MA 5ILGA 2C7VA 5JLAA 3FTPA 3ZWMA 4FB5A 5IDQA 5H81A 4XRFA 1N1EA 2RHCA 1SEPA 1R4NB 3G3EA 2PG4A 4W7IA 3PK0A 4XQGA 4NU5A 3G17A 1GQYA 3AOGA 3HHHA 5F3RA 5DV5A 4NK4A 3TZCA 5CHEA 2QZZA 3DC2A 5CG2A 1Z91A 1C0IA 2A6HF 2DKNA 1B9NA 1XYGA 4BHBA 1M66A 1PWXA 2WYVA 4DL9A 3ASVA 1R12A 1C14A 1U5CA 2OOSA 2EJWA 2GCGA 3Q2KA 1R1UA 1RUNA 3IUSA 1PZFA 4Q3BA 3BIOA 4J1SA 5TX7A 3DMYA 1OC2A 2NTJA 4XKJA 3WGQA 2QENA 3UXYA 3CUQA 3WE2A 3P2OA 4AJJA 2EK5A 3JV7A 2CDBA 1GZ3A 4JNKA 1GU7A 3IRQA 1EE2A 3T8TA 3ADOA 1DAOA 1QLHA 2D59A 4DRYA 1FY7A 2QQBA 1C1XA 2VRCD 2YV2A 4H3VA 3FHZA 2XKPA 3R1IA 1YKFA 4RZHA 5KJEA 3RC1A 1LTHR 2Z5LA 4WOJA 3F3SA 2O3UA 2F00A 4NDNE 4CDGA 2P7CB 3JQGA 1HZJA 4KMUX 2O4CA 2VWQA 4B3IA 4BNIA 1X3UA 2PGLA 4FDAA 4YFNF 4Q4ZF 1I3NA 3C1AA 1FT9A 3RASA 5IFLA 4HA8A 3GGPA 2OO5A 2OORA 1EQ2A 3HQ4O 3LZ6A 2W2LD 1KETA 3I5UA 1X0VA 2XPCA 1AN9A 1ZREA 3DL2A 2MLGA 1ON1A 4E33A 1I3KA 3QU6A 4M74A 3I6IA 5F21A 1UUFA 2F5EA 2VXZA 1CF7A 4XRGA 2FMLA 1KVUA 4II3A 4CODB 5L45A 4CV1A 2G9WA 3GF2A 1IN4A 5FGMA 1VKOA 4FGWA 1CEQA 4PLGA 5BSFA 4A0SA 2ZJ2A 4L9NA 3FX3A 2AQIA 1I24A 2D2IA 3I64A 1LDEA 2CDAA 4UEOA 4Q3DA 3DZIA 3GEMA 3T7CA 1LDYA 4MO2A 1N2SA 1R1VA 3N7UA 4MKZA 5B37A 2IZ1A 2ZK7A 3I54A 4WLVA 2OZUA 3KB6A 2Q4EA 3WOHA 4CV0A 1OYWA 2Z3YA 4L5IA 2EWNA 1DIGA 3L2CA 5G0SA 4XRRA 3HSKA 3QRFF 4MDHA 5HS6A 3ZMTA 1PZEA 5KVSA 2E7WA 3L0DA 1A9ZA 2YDXA 4OOFA 4MTDA 3A14A 2ZO4A 3JSAA 3OF2A 5ERIA 4MNUA 2ZCVA 4CPDA 3TOBA 4KUMA 4DQXA 3ZWAA 1IUKA 2RKHA 1DFGA 3H3UA 1DAPA 4AVYA 5JDCA 2XVCA 1KYZA 3KFWX 2I3GA 3SJ7A 3PXXA 3L6EA 4BNGA 1CF7B 4B7CA 4WXHA 9LDTA 4ND3A 3WTCA 4RQTA 1LB2A 5D4RA 3HOSA 1M67A 1SOVA 3E5QA 2QQ5A 3GNQA 1CJCA 3TDKA 3ZH2A 3NDRA 3GMDA 5K9ZA 5EERA 1EH7A 2P5KA 2I65A 2BGMA 3BMNA 4PGFA 1M6HA 3FWEA 1W0CA 1M6WA 1PR9A 3PVZA 4LCEA 4FFRA 5G0UA 4P9UA 3QV1A 2MD5A 4UV9A 2V6FA 3BMCA 4XDZA 4CMJA 3SVTA 5LCXA 3RBXA 4JXKA 4I01A 3LAPA 4EGYA 2Y67A 3EVNA 3RC9A 1HYHA 2DAPA 4OKIA 3NGLA 2HMSA 3Q9NA 3CSDA 4YJGA 4ZGWA 5L3DA 4BHTA 1U8RA 2AQKA 8ADHA 2EHDA 1XD7A 5BQTA 4E13A 4MTEA 3RDIA 5B4UA 2CMDA 1ZK1A 4LMRA 1RNLA 2JCVA 1F17A 1F12A 2NVUB 1H9BA 1IYZA 2XASA 3BYZA 4MKXA 1LSSA 5L3EA 2O3QA 2P9GA 2Q49A 2FZEA 3IKVA 1E3WB 3D64A 1EUDA 2RH8A 4D79A 2NYXA 2GZ2A 2JCYA 2B5WA 4D3DA 5E17F 4LSMA 3GR6A 4HV6A 3ROPA 4R79A 4CL8A 1IY8A 2DC1A 3LQFA 1MJ9A 4WGGA 1PGQA 1P0FA 2CO5A 2HK9A 2H5LA 5EQDA 5TRTA 3TL3A 1H9TA 3M7GA 1DPRA 3BAZA 3R6DA 2GDZA 3RI4A 3G1TA 2M30A 1CIVA 1NNUA 1U3UA 1YS4A 4JK3A 2V79A 1LI4A 5U9CA 2VNSA 3NJ8A 4BGEA 2QBYA 4OH1A 4NQZA 3KP3A 2CY0A 4NBWA 2POQX 4IHTA 2E37A 2PGJA 1IB6A 1VSUA 3PQJA 5CVVA 2FP4A 1HT0A 2L4AA 2X9VA 3ANMA 4FFLA 1YLFA 4NI5A 5L7TA 4AJNA 2EV9A 1MKMA 3F6YA 1Y81A 3QVTA 4PLPA 4BNZA 1ZW1A 3NT2A 4OIMA 4ZYHA 4ZZDA 4R16A 2F5FA 4IM7A 1M2WA 5EN4A 4LG0B 1LNQA 4CLOA 2YPRA 2F2EA 1G0NA 3OQ1A 4N54A 4Z9FA 4XYEA 1G3TA 2EFQA 5JCXA 3IWFA 4AJ1A 4BVAA 3DAPA 3BTSA 3K2EA 1SB9A 1GZ6A 3WYBA 3R61A 4JBAA 1IE3A 4U6QA 1NP3A 4TV7A 2V9VA 3GOHA 3QOPA 1KS9A 4PG8A 3WTXC 4S05A 2YUTA 3GVPA 2ILTA 3RJPA 5KTKA 4G7ZF 1LQTA 1DLIA 1HE3A 1UHWA 1ISGA 1DB3A 1Z45A 2CDCA 5JSFA 2JRTA 3NAQA 3CINA 3GAFA 4RGBA 4MP6A 3V7RA 2G7UA 5T8KC 2CQKA 5B12A 1RM0A 3G3ZA 4MOWA 2QWWA 1Q0QA 4RVFA 1GYQA 1DRWA 2G7HA 4WE3A 3KP7A 2FF4A 1I3LA 3V8JA 3AU8A 1BBYA 2DPHA 2RH4A 3OIFA 4ZQFA 2AA3A 1HXHA 1ZK0A 3WMWA 1LDKB 4E5KA 3WG9A 4M6YA 4FC6A 4E5NA 1NYTA 3H92A 2HFHA 4ZICA 4UVDA 1DDNA 1ZUD1 3WSVA 5KJ6A 4IZHA 3I9LA 4K28A 4I08A 4JQFA 4EV0A 2HK7A 4DQ2A 1ZH8A 3O38A 1HE5A 1LDGA 3HOTA 2YDYA 3VHRA 4JIGA 3ZDFA 3J80K 1X7GA 2MH2A 4BGVA 3VH2A 1B14A 2EV6A 1HSOA 4EVIA 3E1KA 1A72A 3LAJA 3O4RA 3GH3A 2X4GA 1Z74A 1B3BA 3R6SA 5LHIA 3TF5A 3SEFA 3KTDA 4GI2A 3RUDA 3C24A 5DD4A 2AS5F 4Y98A 5MGBA 2B5VA 4A0XA 1DDOA 4J0FA 4ZYGA 3GT0A 1R1TA 1OAAA 2DTXA 4TKMA 3GA0A 1YO5C 1NVGA 4CMIB 5G4KA 4XCVA 1VJ0A 1F06A 4WJZA 1YVEI 1ADGA 2J3HA 3HB4X 4Q3NA 1YBVA 2RV8A 2YQ5A 3L7WA 2DPGA 2FHSA 3HSRA 3WSWA 1CRWG 1IUYA 1NHGA 2XAGA 1YQDA 5FLXZ 1E6UA 3GDGA 3GNTA 4LVUA 5JMPA 4DQUA 5I7EA 3GVCA 3OBBA 3WYCA 2FXAA 3COAC 2EEZA 4YJFB 2Z1NA 1V4RA 4KDPA 3VVBA 4G6QA 3J80Z 2RHRA 4L74A 3UH1A 3WBBA 1O9BA 1PJ4A 5IN4A 2E49A 2FSWA 4JQCA 4BMSA 8LDHA 2HQRA 1LVAA 3TKYA 4RPJA 1EH8A 1P0CA 1PIWA 4CLDA 2UV8A 4C7KA 3F9IA 1YONA 4R4JA 4RPGA 1SD7A 4XLPF 2EKQA 2FMUA 2NVWA 4OM8A 5J6XA 4WPGA 3WGIA 1YS7A 1WWKA 2AMFA 3BMOB 3NTOA 1ODDA 5LDGA 4BKPA 2BGCA 1R4MB 3I58A 2P5VA 1VI2A 5DULA 2VOJA 4RCVA 4FSHA 1LJ8A 4TZKA 4XWYA 1MP0A 2Y48A 3INTA 3HRTA 3GDOA 1JU9A 4E31A 4QWQA 4JJFA 2EGHA 4CUZA 4HAMA 3ICCA 4LSWA 4O6VA 3EYYA 1K6JA 3GEGA 1DFHA 2CZCA 1BVUA 4I7HA 2EV5A 3MCVA 2KJCA 1FDVA 1H2HA 3E6CC 3PHIA 4Z0TA 3DBRA 2O03A 1FDTA 1OOEA 1KQ8A 1H5QA 4KT5C 2VNAA 3DF8A 2CVZA 2PNFA 4BKRA 2J5QA 5BQFA 2UVDA 3SLGA 2OP0A 3VKUA 1XSVA 3GUCA 4ZQEA 3M9AA 3KEOA 1T1RA 3F46A 3MEQA 4MPDA 2M45A 1W7PD 2H9IA 3W6UA 1LRJA 4RF2A 2XUBA 3H9UA 3BMOA 4RB0A 3RTRA 4NR0A 4E12A 1NPYA 4YVFA 3ROKA 5BPIA 4GLOA 3EETA 5IZ4A 1P33A 3JD3A 1FBQA 4KMFA 3M6IA 4JROA 6LDHA 5JC1A 2C82A 2XAAA 5B4TA 4YIFA 1A4UA 2WJPA 4YPOA 3I3OA 2XAFA 2BLLA 1MGTA 1ZH5A 1E7MA 4S1VA 2VN2A 4EJUA 4ZU3A 1ZGAA 4QECA 3WTVC 2IVMA 1SAYA 3HFGA 4UVAA 1ZG1A 4Z6KA 4U0KA 3QIVA 3W8FA 3HSFA 1PJBA 3RSHA 1BI1A 4J7CA 2W8ZA 5IXSA 1ISIA 4PCVA 2YY7A 1DIRA 3I1JA 4HFNA 4MVJM 2DBVO 4B7UA 1ZRCA 4ESBA 2K02A 2VBZA 4U0VA 2F5CA 2IYOA 4QT0A 3WQRA 5E20A 4EJWA 2VYVA 1ID1A 3AAFA 1JAYA 1E1KA 1EQUA 2OUIA 3OECA 3OJ0A 4RDIA 4BNUA 4P8RA 4OXYA 4LB6B 1JVSA 1QZZA 4Y17A 2CFCA 2PGDA 3U62A 3R0JA 1S7AA 4EJ0A 1VSVA 2WTEA 2J3KA 3L77A 3Q0EA 1GVJA 4RGUA 2JTVA 4E3ZA 1IRFA 3DMTC 2C5AA 1HXDA 2FR8A 1FC3A 4G2NA 4HV4A 1UAYA 3F72A 2A94A 1R5GA 4LMYA 1H93A 1LLUA 3OIGA 3RROA 1WQ2A 3V1UA 2EW2A 1LC3A 2UUOA 4A73A 2Z5UA 4G9YA 5DCWA 2O61A 2O3JA 4L73A 3G1UA 2EKPA 1XSDA 3PQEA 4PGGA 1EUCA 3DAFA 5U4QA 3OQ6A 1XN7A 2GA1A 3ONEA 4YA6A 1FDUA 1A71A 3DZKA 3I83A 3PTZA 4EZBA 2AHRA 1RUOA 3TL2A 1RJWA 2CD9A 1JW9B 2CFXA 2C5EA 3GYHX 1EUZA 5TT1A 1R23A 3E6BA 5LEKA 4OSOA 4R69A 5BNIA 5GZ6A 5ENDA 4CQMB 3WNQA 1T2AA 1Y8QB 3QRWA 4IJUA 4GKVA 1IN5A 3P7NA 3H9JA 2F1KA 3VB2A 3BTVA 4LB5A 2LNBA 2VBWA 4HF0A 4L9VA 4AVPA 3KVOA 2EW8A 2FEZA 3KZVA 2YV1A 4UREA 1TA4A 2B69A 3WIDA 5TS3A 4EDFA 1LRKA 5JBIA 1NVMB 3QA9A 3QW2A 5HDGA 3ECOA 4MVJD 4D46A 2IEBA 1E3LA 2IRWA 3IP1A 3KZZA 3W4JA 5EESA 4L76A 3UUWA 3NJ4A 2LKPA 3DFZA 2J5OA 2WDZA 2FN7A 2VOOA 4IXTA 1U5TB 1HRDA 4BV9A 3GFGA 5K6AA 3S2WA 1PS8A 4Y9DA 4CQMD 4NBUA 4XIYA 3GFIA 4E4YA 5HS4A 1HKUA 4Y8VA 2DK5A 4J43A 4HZFA 1GYPA 3PP8A 5L3GA 2KIFA 4TRMA 3RU7A 3PHGA 2VWPA 2VWHA 4PG7A 4GYIA 1ISMA 1GY8A 1NQTA 5JVTA 1MG0A 4O63O 3TOXA 2CWEA 2AG5A 4UVBA 2D3TA 3PLNA 5IDYA 5L51A 5ILVA 1U28A 4K2EA 3FBGA 1SFXA 2PBIA 2Q8KA 3OFSA 4J4BA 4RVDA 4BO5A 2GYYA 1LXCA 2HDHA 3E82A 3QAHA 3DOOA 4M8SA 3VAZA 4M86A 4YT5A 1TQIA 3TO6A 1KEUA 5ER9A 1LDNA 1PX0A 2GGSA 4J9UE 1GYRA 1BG6A 2JKVA 3IP3A 3HUGA 5DDGA 1GZ4A 1WDLA 5CDYA 2NVUA 4YRBA 4AICA 1F4KA 2VCYA 4YACA 2IE0A 1GPJA 3WBFA 3RYRA 4BKUA 2YR2A 1VJTA 1P3DA 1E3WA 2C59A 1QGPA 3OJFA 4N5NA 2FBKA 1LDJA 2E1CA 1HQCA 4ZRNA 3DBHB 3HG7A 3ZZNA 4E30A 4E0BA 5F6FA 3COSA 2V65A 3RJ9A 1MD0A 2IA2A 5AYVA 3OP4A 4B4WA 3BJOA 5TQVA 3DOCA 1R36A 1WRJA 3V7SA 1A5ZA 2DLDA 4FFOA 3WLEA 2C6YA 1C3VA 4CQLB 4DPLA 1XCBA 1GEGA 5DZSA 1EV7A 3JYLA 5F1PA 3RIHA 2KKOA 2X1HA 3WQSB 2PA3A 2D4AA 4W7HA 4XYMA 5EL0A 2Y99A 4XYGA 2AEFA 3BP8A 4RF5A 3PGJA 2GF2A 4ZVVA 5TC4A 3FMQA 1HKTA 4XD2A 1CQIA 3I4PA 5BPDA 2PD4A 2EV0A 3KZYA 2GASA 1AE1A 1SPXA 2V7PA 1KYWA 1YL5A 4UEKA 5A2QK 2Z99A 4BO2A 2EWMA 1PSDA 5FFXA 4BOYA 1L7EA 1NQAO 4WCFB 4YB8A 1CETA 3AI2A 3RUHA 2JT1A 2ELHA 1P4AA 3L9FA 4BKQA 3F3XA 2EXXA 4LN1A 1YYVA 2ZIZA 2DW4A 1C1DB 3EZLA 4Q39A 2VYND 4GAEA 4ASNA 4GGPA 1QV7A 4Y67A 2EKLA 4R51A 4OKNA 3KE2A 4J0EA 1HLPA 4F6LA 1UR5A 1I30A 5TRDA 2PKQO 3SZPA 3BA1A 4LRTB 4A7PA 5TSDA 9LDBA 1U5TC 1Q7GA 3NTQA 2W2KB 3JQBC 4NBTA 1SC6A 4ZD6A 2DLLA 4LGWA 1Q7BA 4WLNA 3WTUC 3GPIA 4ID9A 1XDWA 5L95A 4CLXA 1E3IA 1PQUA 1UJMA 3ZWVA 3EHEA 4CM1A 3HSEA 2QYSA 3HRSA 5JHUA 2O4UX 1VC2A 2HJRA 3FTNA 3JTGA 3MJTA 1R16A 4YAGA 1E3EA 3JD2A 1E7RA 4RL6A 4Z2YA 4AWXB 4IDAA 3HTUA 2PN6A 4Q47A 5H6QA 4L18B 2C07A 3AI3A 2PQ8A 1YTYA 3ETDA 3CDHA 3JQBA 4TSKA 1XGOA 4RGXA 5I8ZA 4OIOF 2ADUA 3IQDB 5DBGA 2J5RA 5LHGA 2NTVA 3DZHA 3V2GA 4PRKA 2Z1MA 1EDOA 4B4UA 2UWMA 1FJHA 1H0MA 3HFSA 1E7WA 2PK3A 2R6JA 2CYYA 1I3MA 1NPDA 5ITVA 1HSZA 1O5IA 2Y93A 4IDGA 3AUUA 2NU8A 1KU9A 4DTIA 2VT2A 4L5JA 3V4GA 1SCUA 1XU9A 2DK8A 2P5UA 2W2KA 4FFPA 4I5FA 4F3YA 4E32A 5I9NA 1AUPA 1LBEA 5KIAA 4Y13A 3PPIA 4CUKA 5ADHA 3KP2A 1T6SA 1D1TA 1T25A 3QQPA 2WEKA 5THKA 4EW6A 5EEHA 4FGSA 1K79A 1PDNC 5CVUA 2WYWA 4IIUA 1I1GA 3BPXA 5TT0A 3WLFA 4BO1A 2BE5F 2XAHA 2D5AA 3P19A 3MOIA 4W9NC 3S2GA 5CVRA 5LLQA 4A12A 1U1IA 1U3TA 1NHAA 1ZEMA 5CDUA 1E77A 3ZMZA 2CF5A 5CYVA 1R58A 2PLAA 3PFWO 4CV2A 1IRGA 1DJNA 1LU9A 1W6UA 2W98A 4WCGA 2O7QA 1TVEA 1G3YA 3LF1A 4XR4A 4PCQA 1FPQA 1ULYA 2B4RO 4ALJA 3PZRA 4RVSA 1E1MA 1JKFA 2X5KO 5DBIA 3F8CA 4HKTA 3U4HA 1X14A 3EC7A 1H6AA 1ONOA 3D7LA 4HQEA 3KP5A 4II2A 3RFTA 1I1SA 4ZYEA 1AXGA 5LGNA 4RF4A 3IAHA 4NG5A 3ULKA 5CDSA 4UVEA 1Y0UA 2P4WA 1KY5A 3M8EA 4YAJA 5DN9A 2YU3A 3A28A 1I2CA 1KU3A 3BZUA 4D3FA 2FRHA 1MA0A 3AI1A 1GXPA 3PEFA 3C85A 4IF4A 2NS0A 2QQ9A 1YJ8A 2P9CA 3K0LA 4IJWA 4OJNA 3EDMA 3H2ZA 4QTZA 4CM7A 1O3TA 1JVBA 1UXIA 4XA8A 4JJGA 4BYYA 2GWRA 1USSA 4MGRA 1KC3A 1QSGA 3KP6A 2STTA 2X7HA 3G79A 3VFZA 2NNNA 2OGUA 2P7VB 4FX0A 1QP8A 4OO3A 3DTTA 4O0LA 3VZSA 5TJHA 1NXQA 4FCCA 1T2KA 2NUAA 1IHXA 1QMGA 2VZ9A 4DQVA 2WV0A 3WTWC 1NWHA 1LC0A 2DM6A 2Y68A 1OI7A 3F4LA 3IOYA 4GLLA 3D1LA 3VTZA 3OETA 3HNPA 1PJ2A 1FOKA 1Z75A 4M89A 2PZKA 4UVIA 1S3JA 3L00A 1TQPA 3IDSA 1NQOA 2EERA 4DWVA 3STHA 1JAXA 1E92A 4LLGF 2NADA 1Z7EA 5ITWA 2AW5A 5COAA 2CG4A 2O7SA 4IS2A 4IINA 1LA2A 5HS9A 4NNJA 2Q1UA 4YRDA 1GR0A 4KIBA 4HX4A 5CP8A 3TNLA 3DZFA 3JSOA 5AIQA 5KKAA 4DYVA 2DTDA 1YH3A 3E5MA 4P4NA 1UB9A 1U7HA 3AFMA 4BNHA 2G82A 3C7JA 1XHLA 3Q1LA 4Y6RA 4BNNA 1I2BA 2QW8A 1S29A 4BNCA 1A04A 3T8RA 4OMYA 5HS8A 3SBOA 3KCCA 1KU7A 1V3FA 4GMGA 2GN6A 4UUNA 3U1DA 1ZSNA 4Q3EA 4R1TA 3DAGA 3CZRA 1K6OA 2VZ0A 5L7YA 3HDYA 3MZHA 2X22A 1GPDG 3REOA 4CMEA 3V5NA 4X54A 2L3DA 4U0YA 1IAWA 2D8AA 4PZEA 3OH8A 4WXDA 1MDMB 4IUYA 5FFFA 1ZN2A 4ENNA 2HTSA 3FF4A 3HN2A 1JA9A 1QV6A 3ZW8A 1LSUA 4ZQBA 4KZPA 1HDGO 1LLDA 4ZZLA 3IWZA 2PD6A 2L4MA 3MEXA 3JCZA 1R4NA 3GXOA 2PFBA 2ZMEB 3QWFA 1GFSA 3LQRA 4KUHA 4QFCA 1BMDA 1GD1O 4NHEA 5HVQC 2V6CA 4TRRA 1P9LA 3B70A 4BQRA 5FLXK 2A5YB 5I8WA 5ILOA 1PGPA 1BXGB 4O59O 2ACJA 4JK1X 4OIQF 3F5SA 3WJAA 2E4AA 1UP7A 2PKQP 2WSBA 3RAJA 2A92A 3FMRA 3O26A 1Z6RA 4UUPA 1DC6A 3IC7A 1SB8A 3ERED 2ZBKA 2V1XA 1EDZA 1FF9A 3MJ4A 2IPQX 2A6EF 1ZGJA 3F1KA 4H7PA 4NJMA 1DIBA 2ISZA 4B8WA 5AVOA 1I6XA 1DLJA 4MVJI 1NFFA 4RVHA 5ILUA 5ED4A 2JPBA 4U88A 4IHSA 3O6BB 1P1IA 1XG5A 2E6UX 2NU7A 1CGPA 2DFIA 1M76A 4ND4A 4P4GA 4A5MA 4CZZA 1QORA 3I59A 3F21A 4ENKA 2BMAA 1Q0LA 3K8ZA 2BELA 1O57A 3KYCA 2ZCWA 1DPUA 1SNYA 1ENPA 2WD8A 5F5LA 2I6TA 5F64A 1ISJA 1Z6ZA 4R9RA 1SD4A 3W1VA 4CMGA 5FEUA 4AIKA 3N74A 2NLOA 4HY3A 2QHXA 2EFOA 4E2ZA 1L0OC 4CMEC 4LISA 4EITA 3GVXA 4GMFA 2QX7A 2ZATA 4JX8A 3E9MA 3LA2A 3H5RA 4WXCA 2VONA 4MEYF 3C7AA 3GVHA 2AE1A 3SZTA 1UDBA 2A9FA 4U7WA 4YCAA 4XLNF 3GX4X 1A7KA 1X0XA 5HOOA 3L4BA 5A3VA 5IN5A 4YQZA 4XGNA 2ISYA 2STWA 4WEOA 4YBZA 1FX7A 4LVCA 5DP2A 1Y8RA 1WDKA 4XDYA 2ETHA 5BMZA 2DO7A 2XXBA 4FR5A 1EFKA 2X58A 4Z3KA 5CDTA 2OAZA 4P96A 1CERA 1ZSYA 1UXHA 1E17A 4IGEA 2O8XA 1PP7U 1ML3A 2HYFA 3D5QA 5DCFA 1NAIA 3GLQA 1C0WA 4F6CA 3B1KA 1R5HA 5HDKA 4TROA 2VRBA 2ZQZA 1BGVA 3E5UA 3ONDA 2PJPA 3O2PE 2GERA 2HZTA 1YG2A 3KSDO 3F22A 3KSUA 3W8EA 4BGIA 1QG6A 1WWXA 1ARZA 1HF3A 2PZMA 3MZ0A 3OICA 5TJ9A 5A5EA 3QVXA 4D0PA 2Q1WA 2JAHA 3PI7A 4KNYA 1LUAA 1TW2A 2HKOA 1ZRDA 3AK4A 3QJ5A 2RGVA 2HDCA 2NTNA 3ZN0A 3GAZA 1JHFA 5F1OA 5T67A 1HSJA 3JAMK 3LT4A 5BSEA 3J81K 5KCZA 2FU4A 1IPFA 3KYDA 4NFSA 2W25A 4ZH4F 2B0JA 4R3NA 2OZPA 3FMSA 3GUYA 4TRNA 1P1KA 2R7DA 4Z0HO 4PZCA 2GZ1A 5A9SA 2I9PA 3NT4A 3CUOA 3ZQ7A 1J0XO 1QZYA 2DQLA 1NX6A 4ETSA 4WK6A 3JYNA 1GCUA 3ZWPA 3FM5A 3RPUA 4P5OA 1UCRA 3BMNB 3L07A 3B1FA 1QKIA 1XSEA 3DBLA 4BO8A 1WAMA 2RN7A 2Y0DA 1E3SA 3GRPA 5FFZA 3DO5A 3T1BA 2LF8A 1RIOH 2JFFA 2A07F 4I5GA 1H94A 4GSLA 4IPAA 2FBIA 4CO8A 1O3RA 3C1DA 5D5WB 2ZKLA 3GN1A 4Z9YA 5A06A 2CF6A 4HX7A 4ESFA 2BKAA 2D45A 2Y1FA 2KIUA 2VT3A 1NBOA 2BRUA 2FR0A 3I52A 4HF1A 1YOVB 4NB5A 3JQAB 4PG5A 1HDCA 5ENVA 2VBYA 1YE3A 4RGRA 4WCFA 4DC0A 2MA3A 1U78A 1NHWA 1V3UA 4BNKA 1PGNA 4LFUA 2HU2A 2E82A 2ZXJA 4MQVA 1JDJA 1ADFA 1ZCJA 2IW5A 2HRZA 4A5OA 4YAIA 5LDHA 1JKIA 1U3WA 1MG5A 3C7CB 4AJIA 4KFCA 5IDXA 2G76A 1OC4A 2W4QA 3AOEA 4R41A 1B4AA 3VOEA 4G7OF 1VKNA 3WGHA 3JQ6A 1W7PB 2ZMEA 3O8QA 3QWAA 2OU2A 1UAGA 4EJ6A 5E1XA 2Q2EA 3PZBA 5IT9K 4EUEA 1U4SA 1I33A 1JTVA 2VC1A 5G2OA 4UXNA 1JLLA 1LEBA 1B7GO 1YXMA 2OZ6A 4G81A 3WGTA 4DIBA 2OBYA 4FFMA 2XHKA 4MINA 1XLTA 2BFPA 5KVQA 3SC4A 4B8ZA 5JY1A 4WK8F 3VDQA 2JHGA 1E7SA 1TXGA 4O3MA 4CM5A 1FSHA 4YYZA 1HE2A 2XXJA 4NHJA 4J91A 5HLHA 4M1QA 3UICA 4IY1A 2PZJA 4E2YA 4LK3A 1MLDA 5JCJD 3CKYA 3PJDA 3E6AA 2Q4BA 1PEDA 1P1JA 2D1VA 2BV6A 1BW9A 2NNLD 4E5PA 2VODA 1VM6A 3EW7A 2ZB7A 3IHUA 3H9GA 3OIDA 2YSRA 4AJHA 4DXHA 4BS9A 4NMHA 1E5LA 1WMBA 1U4OA 1V6AA 3KHUA 4R5HA 1PJLA 1XA0A 2WYUA 1KGSA 2Y0EA 1QYDA 1SEVA 1HW5A 4CM9A 4P55A 2PD3A 3A1NA 5COBA 4MIEA 4DA9A 3RKYA 2JL1A 2YHUA 3HB5X 1YDEA 4YQYA 4HF2A 4DVJA 2Q46A 4KYWA 1ZG3A 5JR3A 1Q1NA 2Y1DA 3ZPLA 3ISPA 1Y5MA 4CYDA 3RWBA 3PLRA 2E1NA 1OZAA 4UNOA 5JAIA 5A05A 2GLXA 4UVHA 4I0BA 1B16A 2O50A 3DZGA 3HDJA 4IZIA 1ZEJA 1O0SA 4XB2A 3MJCA 2DAOA 2CGPA 4A5NA 2CVQA 2ZB3A 1WMAA 3D4NA 3LC7O 1FP2A 4TMFA 4EBFA 2JD0A 3N4MA 1R66A 2RCYA 1GQ2A 1MV8A 1W8DA 3HTSB 2WD7B 1Q1HA 4HNGA 4KUEA 5FB2A 4TZTA 2Q0OA 4CXFA 2Q1TA 4B7XA 5I9LA 2GRAA 2BFMA 2HKIA 3X2EA 4XYLA 5AXCA 4DGSA 4AJOA 2PH3A 5AQ1A 2NV6A 1TT5B 1YBAA 2WE8A 3ZU5A 1BW9B 2P6TA 3ST7A 4ZYDA 4HV5A 2ZKZA 1C1XB 4KTVE 4PZDA 1IXSB 4A6DA 1ISFA 3N58A 1VL0A 3JQ7B 1KERA 2YHIB 2ESNA 3SHFA 4WCDA 3UCFA 2DBQA 4GO1A 3HN7A 3D4PA 3LU1A 4IMPA 1VLLA 5HS7A 2ESHA 2B0LA 3ZWXA 4ENMA 4PZJA 3K31A 3CPSA 3RBZA 4HBLA 3U2RA 1IZ1A 1LX6A 1ZKMA 3DKWA 2X0IA 3LSTA 4IDCA 5BNFA 1VJ1A 5H20A 1ADBA 1GEEA 3EDPA 3OEWA 3X2FA 3PRJA 2FR1A 2IZ0A 1WZEA 4WASA 3DP7A 2DBZA 2JD1A 2DVMA 5BSGA 3BTOA 3BJ6A 4WCFC 3PIIA 1J7KA 2C7GA 1FBSA 2IA0A 2HMWA 1J5YA 1G3SA 3GWZA 2AXQA 2OXIA 5CFZA 4KWIA 3IIEA 2W57A 2MH9A 2TDXA 1CDOA 5LRRA 3OSUA 1YW9A 4L4SA 4PLCA 2K7LA 4PLFA 3TSCA 4ESOA 1NR7A 3ML6A 3HHGA 3WIEA 1E6EA 5T6BA 2V1UA 3DQPA 3BROA 4Z0PA 1ZXBA 3QWIA 1B26A 3ROUA 3I4CA 4L0QA 4A6EA 2VUTA 3VPSA 4U6SA 5A02A 2NNYA 4FN4A 3LLSA 4IQGA 1KIFA 1G6KA 3D3EA 3KSZO 1Z9CA 4BNWA 1ZZEA 4YJFA 3QPHA 3H3FA 3QWBA 2BI7A 3TOZA 1E7YA 1O3QA 4W6ZA 4AD9A 3P2YA 3ZMSA 4CMIA 3V2HA 2EA4A 3HRMA 1UXKA 1K89A 4NQWA 1B6AA 3GY0A 4GVLA 4XX0A 3K5PA 1FYLA 3G73A 1X1EA 2HJSA 1S6YA 3HDQA 3S8MA 4ENJA 3K30A 2W2LA 5T5QA 5L3FA 5D6FA 2X5JO 1TI7A 2Y0CA 3ANNA 1D8KA 3A9WA 3T4XA 2WM3A 4Z3DA 5LC1A 4GX2A 2JPCA 3BTUA 1QYWA 3NEPX 4RO0A 5GZ3A 1E0DA 4ZN6A 3QVWA 1R37A 4LK0F 5A2QZ 3CO6C 1WVGA 2EFNA 1ZLKA 3IS3A 3RBVA 4H0EA 1XCVA 5DP1A 3UCEA 4BKOA 3WODF 3BMCB 1R0SA 3GN2A 1L3LA 4U0WA 1HWYA 3MZYA 1PGOA 4N5MA 2GSDA 4W82A 3RU9A 4B4VA 3GF4A 4UVCA 4G8XA 3OM9A 3Q9UA 5CPFA 2QUFA 4M72A 3P9CA 4M6XA 1I5ZA 1RYEA 2GN9A 2HMTA 2QZ9A 4M9XA 3H9QA 3MJVA 3PQDA 4OGWA 4PDKA 1P31A 5I9MA 4HFJA 4BNFA 1BVRA 1AHIA 4D45A 2OQGA 1ENYA 3FN4A 3DPLC 3ZWWA 3Q6IA 1LDBA 3MJSA 5G4LA 1DOHA 1QLJA 1X7DA 3C8MA 3NDIA 5D8KB 2YJZA 2AEMA 4PLYA 3L6OO 3BOQA 4KIGA 4LLLA 4CHUA 2XOXA 3A4VA 5HTOA 1DC3A 4WEQA 1YS6A 3O9ZA 2CNBA 1U6GA 1YIOA 1E1LA 3L09A 3I23A 3WJ7A 3AM4A 3FPLA 4IQ0A 2BH9A 1I01A 4RAYA 1XR3A 2NSDA 5E1ZB 1ONPA 2C20A 3AY3A 4JGBA 4QEDA 1V3TA 1XDUA 4IXAA 1K5HA 3JQ9C 4M55A 4OOEA 4B3HA 5JXWA 4CJXA 3VH1A 1ZBQA 2XAJA 1IXRC 1V3VA 1TEHA 3H3JA 3WXBA 1GHCA 1T2FA 3UAGA 3WWYA 3FD8A 3QY9A 5DEQA 1UP4A 1H2BA 1O6ZA 4U7DA 1KY4A 4WNCA 4Y6SA 3RUEA 3CIFA 4I8XA 1OYIA 2IXAA 4B8XA 3Q5FA 5ICMA 5HWSA 4UV8A 4NJMB 4CM8B 2QYTA 3RUCA 2I5PO 2LSOA 3ZP5A 1GUZA 2QRJA 1TT5A 4KTTE 1ZMTA 2A4KA 2ZYGA 3BHMA 1GL3A 4AFNA 1H6DA 1GQQA 3L4SO 3W6ZA 3PDJA 2AEJA 5TJJA 3SXPA 4TRJA 3I59B 5THQA 3KEQA 2FRDA 3R0IA 1RI7A 4I2OA 1XB4A 5E1WA 1R0LA 3WYEA 3VODA 3ZNOA 2CUKA 2ZJ0A 4K26A 3S1LA 1B15A 1J9IA 3HRUA 3D5TA 3SQNA 2BGLA 2VRCA 2ZCUA 4CM6A 5LBQA 1W4ZA 3LWFA 3NRCA 4EGZA 4NJOA 4ALLA 3JD0A 1K3TA 4F45A 1YL6A 1T1SA 4ZA2A 3ZV3A 3T5XA 3OA2A 4RZIA 4JP2A 4RLSA 1BI0A 4AIHA 1N9GB 4XQCA 2DUUA 1Y9AA 1BRMA 3WTYC 1HYGA 4WX9A 2P68A 3P5SA 4R68A 4KICA 5A1TA 1UXJA 4KUGA 1UDCA 3GGGA 3GQVA 3H7AA 1LSOA 2L54A 1I27A 3FXRA 4BNLA 4DC1A 6PAXA 1D4FA 1EVIA 3JD4A 4JJIA 3LDHA 4M54A 4MQ9F 2H27A 1NVTA 3UVEA 2UDPA 3QLJA 1QO0D 4BHCA 4CM4B 3ZCXA 3GPDG 2IEDA 2IXBA 2UUPA 3IRRA 3HWRA 2WE7A 3F6VA 4CQMA 4J4HA 3KLNA 4YWJA 4LGVA 1B0AA 3WGOA 1HDZA 3ZHXA 2Q3EA 2HWVA 3L9WA 5DT9A 4F46A 3QU3A 3JSPA 4CGZA 5CG1A 3RD5A 4XEHA 3JQ9A 3U0BA 1F5TA 1WLYA 4HLYA 1PQWA 2AG8A 1JGSA 1PS9A 1B1BA 3E3VA 5DOVA 3RQSA 3ZV6A 3UW3A 4P22A 3JTHA 5H6RA 3MQ0A 5KNLA 3PHJA 4AIJA 1IL0A 3H4VA 4J7XA 2VUSA 3MTGA 3T7EA 4J2HA 3W6JB 4BMVA 3W6KB 3VPFA 3ABUA 4XGKA 3VC7A 4RVGA 1K6XA 4DREA 1FZPB 4XQ9A 2ZB8A 1XELA 1RM3A 1TW3A 3MWMA 2PKRA 4BNYA 4E2XA 5L3BA 3ULQB 1NAHA 3TWOA 3RFVA 1X7HA 1B9MA 1RWBA 1S7OA 5KK1A 4EQQA 1OFGA 2FOIA 2TMDA 4L9TA 4M73A 1ISHA 1N8KA 4R5MA 2HMUA 4GX0A 1FYKA 3WTZA 3OV8A 4IVNA 2YX4A 4E2WA 3NKLA 5HRUA 3AY7A 3QE3A 3WMXA 2ZQYA 1WKMA 3R3JA 2VE8A 4MKRA 1KVQA 1ULSA 2OBNA 3S2EA 2EGGA 3LC1O 3BPVA 3FSRA 2IYPA 2X9GA 2QYOA 1GADO 1D7OA 5HA5A 1Z05A 1J0RA 4WLFA 1JQBA 2Q50A 5TGDA 1UH5A 5IG2A 3ZMVA 2JFHA 2OD5A 2A68F 3TGNA 5H82A 1U3EM 4A27A 5DCUA 1BDBA 2RAFA 3BXXA 3MOGA 4CMAA 4M9SA 1KQ0A 2OA4A 1B8UA 1EBFA 4OHUA 1T4BA 4J4TA 1B8VA 1PZHA 1EEHA 1O95A 3CMCO 5KOIA 1O7LA 4JBGA 3J81Z 5AIPA 5GY7A 5MDHA 1NR1A 3DBVO 1R4MA 2JSCA 1B8PA 5C7IO 1XGMA 5FO5A 1DUXC 2BFAA 3ASUA 5KVVA 1ON2A 2DTEA 5T57A 4NPCA 1U8XX 3GZNA 2OHXA 3BWGA 2WWYA 2GA2A 3EQLF 2QRKA 3DZJA 4QLCU 3LK7A 2EF1A 3F1LA 3B6ZA 3LA7A 5BNTA 3EVTA 1ONVA 4E70A 3DFGA 2FOKA 3F8NA 1J6UA 5JO9A 1SD6A 4RS8A 2WMDA 5LGUA 1QR6A 2BHLA 4FOOA 4Q5SF 3CTAA 5AXAA 2I66A 2VOEA 5K5RA 2VHVA 4HNHA 4MVJF 2NWQA 5DCMA 2GZWA 2QG4A 4BO9A 3DTYA 4EJTA 1SBYA 3K96A 3WFJA 4BXUA 3OJOA 3E03A 4XIJA 4P4LA 4G6DA 3HE3A 1HZZA 2FQ3A 4N0BA 3I9OA 1ZK4A 3JYQA 3GNSA 1H9AA 3OEYA 1T0FA 1JHHA 3Q2IA 1W5SA 4K1LA 4BB5A 2PR2A 4PIVA 3VZRA 4Q48A 2BFOA 4R54A 1PS0A 4YJGB 4YJHB 4A10A 4GXOA 1OMOA 3TN7A 4RAZA 3FM3A 1P92A 1BC8C 3KBOA 4GX1A 4CLHA 1W73A 1J49A 1TT7A 2GPTA 3E18A 4RQUA 1ENZA 5F5NA 5JC8A 2RQPA 3Q9VA 2Y1OA 3EY4A 3U4IA 2O23A 2IRFG 4XJTA 2FNAA 3MFKA 4A2UA 2EP7A 3ETGA 2FPGA 4W4TA 2HTJA 3IKTA 2RC4A 3TFQA 2A61A 4UHTA 4LD5A 1ENOA 3EUHA 2DUWA 1PZGA 2P8TA 5CVIA 2PZLA 3DEYX 4PG4A 4DPKA 4CM4A 2SCUA 5AOVA 2VTEA 4B79A 4BO4A 5DCMB 3EUWA 4WKGA 4AJ2A 1HL3A 3NDJA 3NEUA 1FNNA 3TQNA 1FMCA 4XBFA 1PTJA 1YBMA 3BHIA 3EGOA 5TNXA 1BXKA 3GG9A 1TLHB 1JWBB 2KJBA 3UGKA 4BNVA 4YT8A 1JXSA 1EE9A 4A0ZA 4EM2A 1EVJA 4I1IA 4HBGA 4UUVA 3E5RA 4HFMA 3D0SA 2G17A 5LRSA 1HEUA 5C7LO 4PG6A 3WDSA 3VH4A 1OMIA 2PLYA 4GQAA 3KYBA 1O3SA 4GX5A 3C18A 1KC1A 4XGIA 4YDRA 2OQRA 5HLIA 1QQIA 2O3FA 3PWZA 4OIRF 3F5QA 4RDHA 3AWDA 5LHHA 2Q45A 2EJVA 3FBTA 1KYQA 2D0IA 4A03A 4GH5A 1ZXLA 2H6EA 2W24A 5FD6A 2JZYA 5A03A 2X0RA 4DIOA 2A35A 2A3SA 4BQAA 4IBOA 2HQ1A 4JN6B 5JS6A 4U7BA 1IHYA 5D5XB 1J4AA 4ZJUA 3D3WB 2VE9A 4DBZA 4IDDA 4RGSA 2ZTVA 2VHZA 4TVOA 5L9AA 1MC5A 4LW8A 4ALMA 2PV7A 1REPC 3U4CA 5A9TA 4IRHA 2F5DA 3DMTA 4XJSA 3ZV5A 4EGFA 4HOBA 3VEPA 3RJ5A 4TKLA 2W84A 2QQAA 1YJQA 3LSYA 3J7AO 3ZWNA 4D44A 4IPTA 4O6JA 3GFMA 4GL4A 1HDRA 5IZCA 4AJEA 1KOLA 5K5OA 1O8CA 2H6CA 3G49A 3S2IA 3SLKA 5DBFA 2ZTUA 1YB5A 3ZMUA 5HBRA 1D3YA 4M9ZA 1Y6JA 3LVFO 3CUKA 1U2DA 1U5TA 2HCTA 2WTBA 3TO7A 1GUFA 4EUHA 2ZYDA 4UVGA 4D7AA 4D0SA 1BTOA 1JWAB 3T4EA 1HBXG 4UUMA 1AWCA 3JQGB 2M87A 4QO8A 1ZYRF 3PQFA 2B36A 3WTSC 1K6IA 1YGYA 1WI9A 2JD2A 4Q3AA 4UAGA 1P6RA 3JQEA 3PJGA 2IT0A 4I02A 1H6CA 1YDWA 3EYWA 4FFNA 1B3RA 4J6FA 2FA5A 3D3WA 5G4KB 2HO5A 1CF2O 4R1HA 2JFGA 5KJCA 2D1YA 1TB4A 2R2GA 5C3MA 2HYGD 3WICA 1IZ0A 1I10A 5F1KA 2R00C 3LC2O 2HAEA 4L75A 3ABTA 4PGHA 1FK8A 2AE2A 3V7CA 4PLZA 4L9JA 4XSZF 2M5WA 2O0YA 4A26A 3KUXA 1TBXA 3FHLA 2GNAA 5IJZA 2YQ4A 3F8BA 2HUNA 1I5RA 4N9HA 3RPQA 4UEJA 5COQA 3JQAD 1MX3A 2A69F 4GYGA 5KVRA 3N97A 1SFEA 1K2WA 1R0KA 1G3WA 2HSDA 4WLEA 4UUOA 4NFHA 3P9KA 3F6OA 3WU0A 1O89A 4JP3A 1MJAA 3UHAA 3DONA 1LDDA 2BBYA 4J1NA 2FE3A 1D5VA 4YTEA 4IDBA 1KEWA 3U4DA 3C3WA 2NM0A 4FX4A 3GEDA 2OL4A 2K4BA 4R9SA 1FP1D 1DO8A 1HE4A 1Z82A 4R3WA 4YJHA 1XIVA 2RIRA 3GUDA 1FLIA 1D8AA 2EG9A 3CMMA 1KEVA 4PLVA 3ZHYA 2EA2A 3HDHA 4PLTA 4IRIA 3W8DA 2IODA 3LYLA 4HFRA 1HW1A 4YRAA 2FY8A 5K1YA 1BSVA 4E5YA 3ECHA 3GW2A 4ON0A 1DRVA 3ZNPA 1T39A 1LQ1A 4I0AA 2YFHA 3ZU3A 3E5XA 1IPEA 3JW4A 1W5TA 1P4WA 1XKQA 5LEJA 1KVRA 3ADPA 5L4SA 3K9TA 1LRLA 4YFKF 2ZB4A 5J23A 2C2XA 2O2SA 2H1SA 1QPMA 1D3AA 1PJSA 1MB4A 2M1BA 2Z33A 1E3JA 4MP3A 4OXKA 3C3XA 3WFIA 2EB7A 3SXYA 1UHMA 4CMCA 4FBGA 4E5MA 4GCVA 3TO9A 4I09A 3R0AA 5FF9A 1QBJA 2ZJ1A 5JW6A 4DLLA 3ZHBA 2Y1GA 2X0NA 1A27A 3PYLA 3ZNNA 3UF0A 3M2TA 3FCOA 3AUSA 4KQXA 4XQEA 3K6JA 1R6DA 5JYEA 1DFIA 2ZFWA 4DIFA 4JBHA 5GZ1A 2G0TA 2PWZA 5JDIA 1GV1A 4RV9A 1ZJYA 2VYVD 1U3VA 3W4KA 4RLHA 1LNWA 1ONNA 2X0JA 3ZU4A 2PEXA 2GIVA 3ICPA 3TJRA 2JJYA 2C0CA 4QQRA 5DYMA 1J2XA 3FXUA 2NACA 5AONA 3WGZA 3WX0A 3L6DA 2D1HA 1GCOA 3HIFA 3RUFA 1HDOA 2VOPA 3I9JA 1C1DA 1SD5A 1WNTA 2YW9A 3BMQA 4HX8A 1O7FA 4G5HA 5ER6A 2FZWA 4URFA 5DF1A 4BO6A 2UZKA 1F1ZA 3P9IA 1G0OA 3RCBA 2VUUA 3D0OA 1PJCA 2O3TA 2GZ3A 3GDFA 3KO8A 3OJEA 2XIGA 3S55A 3SX2A 3CH6A 2AXLA 1PJQA 1BXZA 1NQ5A 2YHIA 3VPHA 3HZZA 4LG0A 1AOYA 4QXMA 4BNMA 3I9KA 3MWEB 1BOAA 1Q2XA 4J7UA 3GZ4A 1XMAA 3BHJA 1DHRA 3TPCA 2I67A 1P44A 3CZMA 4O5OA 2H6BA 2QIOA 4WUVA 1LQUA 3GMSA 2HK8A 4ZRMA 1VTNC 1F8FA 2C29D 5A9RA 1V0JA 1SMTA 4IJAA 2P5LC 1RKXA 1UZNA 2X6TA 3CEAA 3FRJA 2O3SA 3DOJA 3EMKA 2PH5A 1OYYA 1A9YA 3I4FA 4P38A 4PLWA 1R7JA 4CM3A 4AJ4A 1BC7C 3NGXA 5ICCA 2PI0A 5AXBA 1U5AA 5ICSA 2NVBA 2XF8A 4DMLA 3GFLA 4WOKA 3IJPA 2HGCA 1WPQA 4ITUA 4JBIA 4LCJA 3FNHA 1PUEE 3I6QA 4QX6A 3RKUA 4CLOB 2JHFA 3QP9A 1IN7A 1HETA 1NFQA 1VL6A 2EP5A 1RM5A 4KMSA 3ZGYA 3LQQA 4KN4X 3SFZA 2MLKA 3DDNA 4HADA 1EK5A 3FI9A 3ZN1A 1T24A 4FS3A 2Q99A 2E7XA 1I36A 2G1UA 1UXGA 3KRTA 3VH3A 4LLNA 2I99A 2PY6A 2K4JA 4BNJA 3U9LA 5T8KA 3PHLA 1HTBA 3LF2A 2QLZA 1EVYA 4EJOA 2VWGA 4BL5A 4WECA 1DIHA 1N92A 5BOXA 1VL8A 3AY6A 1HKSA 1C0PA 3UCXA 3UFXA 4KIFA 3E8XA 3GC6A 1ZARA 3H65A 1R22A 4HDVA 1ZRFA 4XYBA 5KKCA 5F1RA 1O94A 4RPKA 4FJ2A 5L53A 5HDNA 2DFDA 1VE9A 5CLSA 1B2LA 1WW8A 2GO1A 3ON5A 1IXCA 5G0WA 3S2FA 5ICGA 3VDRA 4E6PA 2NQ8A 3WB9A 3LA3A 4YJDA 1B59A 2VQ3A 4FIZA 4YT4A 1A4IA 2IDZA 4U8GA 1Q0HA 3AM3A 3E6DA 3DHYA 1AGNA 4OYRA 5JY6A 1DC5A 2HEOA 1MFPA 1X15A 2HKXA 2ZNZA 3GZNB 4MVJH 4CMHA 4RJTA 3O3KA 5B4VA 3NTRA 5T64A 1ZFNA 3I9MA 4MEXF 3JQDA 3KYDB 3I9NA 4NFYA 3TZ6A 3UN1A 2PMUA 1S8NA 3NQOA 2I3AA 3PFFA 4GWKA 3NRVA 1P77A 3V1YA 4CLRA 2GUGA 4NBRA 1UZLA 3UOGA 3MCZA 4YR9A 1HDXA 4ALIA 3K73O 1QYVA 1PJTA 1PU2A 2NAZA 3RC7A 5FD5A 2FSSA 3DEUA 4I98B 1PR3A 2RBEA 2X5OA 3O03A 4EYEA 3G0OA 4BHPA 1MFZA 3ELKA 3D5LA 3T0YA 1DC4A 1FDSA 2YFQA 5LGTA 3KP4A 2CSOA 3DZBA 4CV3A 3Q3CA 1HLDA 5J8CA 4RF3A 4D3SA 1WXDA 2GN8A 4RPLA 1L1FA 2FPIA 4GSKA 1OR7A 3B73A 1XGSA 1P74A 2J5KA 4KWHA 4MVJE 4H15A 1ULUA 2D5CA 4GKBA 4TWRA 5IDWA 5D5UB 2ZYAA 3OMLA 4ALNA 2WC2A 2I76A 4IJKA 1TLTA 3KLPX 4DLAA 3K69A 2W85A 5CPBA 3GLXA 3JAMZ 5BS6A 1NPTO 4OQYA 1OBFO 3TFOA 4FPXA 3GVIA 4M49A 5JDCC 3F8FA 4BO0A 3U09A 3VTFA 4OAQA 1S7CA 3RKXA 7ADHA 1XDSA 2H94A 4O5VA 4EUFA 2VBXA 2VZ8A 3PGXA 4OU0A 5H83A 3KLOA 1NM5A 3LLVA 3OA0A 2AQHA 4NH4A 3RYPA 7MDHA 2V1DA 3BMQB 4AJKA 5D6EA 2Z9OA 1ZK2A 5JI6A 1WDMA 3U5TA 1STZA 3AUAA 4CR8A 3DV8A 2Q2WA 1DJQA 1YB4A 4OINF 4OMZA 4NBVA 4N5LA 3RI3A 1GTMA 3WTBA 3QSGA 3ENKA 5KJFA 2K27A 3GO5A 1MDMA 4OOIA 2DPUA 4IMRA 3BJAA 3M2PA 2UYYA 4KP7A 4L9RA 1YWGO 3ZI0A 1QNTA 3OJLA 4YEDA 2UXXA 4G65A 5JFOA 2NRAC 2IP2A 1YO6A 3V2UA 3KM0A 4HLXA 5U1PA 3IL2A 3HHPA 2KRFA 5DNAA 4IDFA 4XSXF 5EQFA 3OQBA 4IRGA 1SAXA 3JYPA 4I9NA 4INAA 4LRSB 4MVJG 1MJBA 1DSSG 1XWFA
chains in the Genus database with same CATH superfamily
2PJRA 1HT3A 2BSXA 3D4BA 1V8PA 4GL2A 2LF7A 3DHEA 4A9AA 3GV0A 3T0GA 4GZ5A 4H7EA 2OFPA 1ADCA 2HL6A 2GD2A 3EF3A 3WV4A 4E21A 4HGOA 1NLZA 4KAFA 3RO7A 5L3ZA 2M8EA 2O20A 1EGVB 1T0BA 4L95C 2Y0SA 1LGYA 4AX4A 1J2EA 1VDZA 2BEUA 2VXOA 3CX7A 2KHZA 2Y1CA 1FYMA 5DDIP 1MH4A 1N1GA 2DJ5A 2BEOA 3KSRA 3VVCA 1EK6A 3K2ZA 2GI4A 2Q6KA 3CVOA 821PA 2B7BA 2BYVE 1UK9A 1XZMA 1CW2B 1SUIA 3ORRA 1UP6A 3N70A 2MBFA 3T0FA 1IOLA 4R7ZA 4R3UC 4RZQA 4HBZA 1AV6A 5KPDA 4DCTA 2PBLA 2VIIA 4WUTA 3LTNC 2YXDA 1W96A 2BD0A 1I3CA 4EKYA 2DBRA 1BJAA 1JTEA 3N6RA 1G2OA 1NONA 4YQEA 3OSFA 1LZLA 1W2GA 4MAAA 4FN5A 2J6IA 4B3TB 2BM9A 1W88B 1CQXA 4KLRA 4YAEA 3WWPA 3AKDA 1QB8A 5AMXA 2RIPA 4QUKA 3NOXA 1JUSA 2V3VA 1FSPA 2OO5C 1H05A 1FUKA 3EN0A 4K03A 3GLRA 5IF3A 2K3FA 2QVYX 1ACLA 4KQ9A 4LDQA 5CDGA 3W5BA 3E3OA 2CV2A 5HJ2A 3RKRA 2JI8A 3ESCA 4NEQA 4Q9KA 8MHTA 2WR8A 4CMBA 4YFXF 5M5XJ 4HXEB 1C7FA 3RIXA 1E2FA 2XPUA 3SICE 4B32A 2P7HA 4Y6PA 2DPDA 2ZBUA 3PT5A 3UT0A 4KISA 5SY4A 3IUYA 4PYOA 1PUFB 1PZXA 5ERXA 5TPZA 3M34A 2Q2VA 3GVAA 3LKVA 1GNLA 2XEDA 3AKEA 3HADA 3O1JC 3QNMA 3VJLA 1GXSB 4BFWA 4QT4A 5JNSA 4GYKA 3EWNA 2X4HA 3IEXA 4BC1A 1KO5A 2QXUA 3GGCA 4OB6A 3ZTWA 4DM7A 5BR7A 2HR1A 4K6FA 4BDSA 1L5QA 2P4UA 4JLDA 5LZ5A 1FW8A 1NATA 5HCNA 1IBSA 3O3NB 3W06A 3F9RA 3ZCSA 5C8ZA 1R00A 3GEZA 4PPFA 1NFRA 2CUNA 1C8BA 4RK7A 4YMTA 2GNPA 3MAAC 4KFTA 4C4PA 2Y27A 5A6VA 3I5AA 4PAQA 3DEZA 3T3NA 4HYEA 3W6NA 1WJAA 5LYYA 3U37A 4R9UC 5BYJA 1K7EB 2IUFA 3HMKA 1PYDA 2DFLA 3MFYA 3QXSA 5KB3A 1VPWA 1SOWA 4ER7A 1TYZA 4A0FA 1MAHA 5HBRA 1Y8AA 2CVPA 3L0IB 5JHGB 5ICEA 4YRQA 1N0VC 1A6IA 3FGPA 4ND2A 5JDIC 1W4MA 5E3IA 5ITSA 3NRJA 2C95A 2QRLA 3UMJA 1K2VN 3F2IA 1Z5OA 4I5EA 4IVQA 1TNSA 1FXSA 3KEFA 2C94A 1TVKB 3OM1A 1OPCA 3DXJF 2VTDA 3E05A 4HEJA 1O9GA 1V5WA 4IKPA 1R49A 4P81A 4HWGA 1UDWA 4RM3A 4J1TA 3SQLA 4O25A 3DT8A 2I1QA 3GUHA 4QO7A 1ELOA 1KAOA 5EGSA 4DYDA 3A2MA 2VK8A 4OVKA 1CYDA 3EXG1 4YMSA 4GGMX 2TMKA 1NASA 2LE0A 1QXSA 4IW3B 5KYKA 3BS4A 1YOVA 2YXLA 3JQAA 1SY7A 4OV6B 2EKZA 5FI3A 5FWYB 1ZVMA 2WBLC 3A6EA 3ZZ0A 2VH1A 2NUTB 3IO3A 2SICE 4EM0B 3IQFA 5CG2A 1KDYA 5AVKA 2A67A 3WYNA 1BZYA 1F14A 3BSFA 3D43A 3PHHA 4F7WA 3WLIA 3EIUA 1QB7A 1G59A 1J1IA 1G4UR 1YQXA 2V7QA 3H3ZA 6ADHA 1WD5A 1RLUA 1BX3A 4F5EA 4RB1A 3RFXA 5DNVA 3RSNA 2B9EA 1BHQ1 2J3IA 4ZAVA 1ICIA 4IEIA 3CQ9A 3O6VA 2QX4A 5EGOA 1IDZA 4FT8A 2J1LA 1LNZA 5B1HA 3BG9A 3DXFA 1Q1VA 4UOZA 5BNWA 4WLVA 5IKMA 1VFNA 2TS1A 2XF7A 3AF2A 4GVPA 2XDQA 2NO6A 2YYYA 2O5CA 2MW8A 2WTMA 3S8YA 1M75A 1XVLA 1TQMA 5DM6F 2VQHA 5CVJA 2JJ1D 2Q2QA 1R0ZA 3ZDRA 3ZYZA 4EI2A 4OQMA 5D7BA 5L6MB 3MHTA 2OYRA 4R2LA 1WA5A 4GPEA 5JBNA 4GG1A 1QFJA 1S2GA 2DQ4A 3MJRA 3SQOA 3ZHRA 4EEXA 3AJDA 4EYKA 1GXQA 5C4MA 1ZJZA 3WHLA 3H5NA 2BF4A 2B83A 2R1UA 4J16C 4MVWA 4MHGA 3H5OA 1RPNA 5DUKA 2G80A 2V96A 1RPAA 2OZEA 3NS7A 3GTQJ 5GPCA 1L6IA 2KIMA 1EMDA 1XZDA 3O8OA 2OXFA 3F78A 3OKFA 3HPQA 3NHRA 4L4XA 2H4ZA 4D0NA 2YNMC 3W4IA 5KWEA 1M1ZA 4E15A 1Q7CA 2LR0A 3EPPA 1G66A 2GEDA 3FVTA 3KD3A 1P4JA 1AHHA 4GI5A 3HRKA 3KETA 2XCQA 3BB3A 1D9ZA 3DWFA 3MAGA 5EEAA 1JR3A 3R77A 4FHEA 4HR7A 1DPGA 1BM9A 2F3SA 2VDWB 3HEAA 3NCTA 3JRCA 3Q9SA 2CSUA 4QAQA 1U8FO 4MQMA 3BILA 1Y5RA 3Q2OA 1L8AA 3Q6NA 4U0JA 4RAQA 5BN5A 1DJMA 2WIJA 2PX0A 1A9RA 4BJ6C 3SMVA 5IVPA 4B82A 5JRDS 2IZZA 1E3DA 2DUJA 2IPAB 4OL9A 3PDIA 4KU4A 5DXJA 1H3EA 1QRRA 3GHHA 2ZBDA 1KVTA 2NVTJ 4D7MA 1B6SA 2R8XA 3O8NA 3ND7A 3SPXA 2QNRA 4LHYA 2O8CB 4GWGA 2OBFA 2PL9A 3VI3B 2G5CA 3OTGA 3EEYA 3UUGA 5L7WA 4Q1BA 1ENHA 4UPDA 4I1VA 4KW7A 4XEUA 1U0LA 4GGGA 3R3SA 4ND1A 2OR3A 3WWZA 4YT2A 4U2FA 4P0QB 2VHXA 1LLQA 1XQVA 1XTTA 1DI0A 2G8LA 3IJRA 4OM7A 4D42A 1RWMA 3QKSB 1KEPA 2O05A 3S1MJ 1YL7A 5LNK1 5ADVA 3DLAA 4A0YA 2LBPA 3AKYA 5TIIA 3U7GA 1II9A 1JTYA 3IAM6 4BAYA 1BYIA 3OM8A 4FEEA 2X6XA 1JEDA 1Y5NA 5E7IA 3UT5B 3F73A 4WVLA 3RC2A 2A5JA 3GG2A 4RV5A 3L2RA 3ENWA 2YKGA 2AZTA 1RTTA 5G0TA 1SXJA 2MC3A 2QLJA 2P78A 4CM9D 4IHJF 3U9GA 2D1SA 5LB4A 2P91A 3V3KA 1SVUA 5L40A 4IMIB 3C5CA 4FW8A 4M7RA 5CFQA 3QVGB 5CXUA 3EAGA 2RDPA 1OHHD 5EIHA 4J7AA 1PL8A 4JYZA 3ZRGA 1I3AA 4ZTJA 3W2AA 1GNPA 1NT4A 1P3JA 2ARKA 2QUHA 3B8EA 4O1MA 1XX6A 1PJRA 1O1YA 5DGTA 3D31A 9ANTA 2HBYA 1YT5A 2HPZA 3A9TA 2O2YA 3QHQA 3C1OA 1TRHA 2M3AA 1FP6A 3FXQA 2ICAA 3B6AA 2H63A 2AZDA 4MHTA 3HV2A 1USTA 1J25A 5AVZA 1T4GA 1TADA 1D2RA 1NVKA 2MINA 4REMA 4BO7A 2RHGB 2C00A 3DKPA 3H9CA 1VPDA 3ETEA 1JB9A 2ZAOA 2H09A 5EJ2A 4B73A 2HRRA 3KG2A 3KZ1E 3ONFA 5D2CA 5JEEA 5KJ1A 4XB1A 1TTQB 2XUPA 3GLIA 9ATCA 1K1EA 5FOXA 1EUCB 3TRIA 5I7FA 3F2VA 2VF2A 2WQ7A 2HUPA 2NMVA 1G16A 3E9CA 1XEAA 3IRUA 3OF5A 3LUCA 2QRHA 3D8BA 4QQFA 4AECA 3B3QA 3RHZA 3C7DB 2NXWA 4L8WB 3HSYA 2W2OA 3TLMA 1E0EA 4NCXA 4TQAA 3PICA 5CMLA 3WMFA 1YW7A 2RVCA 1H4VB 1Y1RA 3G8AA 1Y8QA 3OTIA 5F35A 1KU2A 2OAGA 2XA1A 1P2BA 3CNHA 4C9YA 3TJMA 5IDVA 3Q11A 2AMVA 3FNFA 4KQWA 3E9QA 1MNAA 5AJZA 5DNDA 1KDPA 5B1YA 2EIHA 5KPJA 1QTIA 1NN3A 2HBRA 2L5QA 2R3SA 5IT9A 5JXHA 4HXYA 1EYZA 3HA3A 3PWSA 5I7SA 4C4TA 2BY3A 1OBCA 2K9QA 3DL4A 1HDYA 3NAMA 3RUAA 1FXUA 2A6TA 2I8DA 4MLOA 4M8LA 2VPRA 4WV3A 3WGMA 3FOBA 5EEGA 1JS1X 1MGOA 4EMSA 2KIQA 2Y1EA 4P82A 4PQRA 3CTMA 5EPOA 2KL4A 2DU8A 3U7FB 5GAEJ 4LNUB 2XVMA 4LC9A 4OMFG 3IOEA 3EG5A 3S1NJ 3JY6A 3F4KA 3E35A 4KA4A 1A5TA 4QQKA 3V33A 3D8HA 5ILQA 2WWWA 2IWRA 1GAQA 2XLCA 3WU1B 2AUNA 2EW1A 2ZTMA 1NT2A 4Q3LA 3CR7A 3JRFA 1LDMA 3HJCA 4HN4B 4RHYA 4V2GA 1NKSA 1SOMA 1LH0A 4TGLA 3G2LA 4CE6A 4BXOB 3LL7A 1P4XA 4BH9A 3DE6X 3QBJA 4WKBA 2GUWA 3FZVA 1AKYA 1KI6B 5JFRA 1P1HA 2HLPA 2Q8NA 4PGMA 5E8IA 4JA0A 2QZJA 1EH6A 2X0LA 4Y15A 1BMTA 3V1TC 4I4NA 1NK3P 3MYRA 1XSXA 1K8ZB 5KAIC 1H2FA 1T2CA 5E2BA 4BNXA 3TX6A 3K71B 3DXYA 1ATIA 1SZPA 5FHQA 3SXUB 4BO3A 2HQNA 1DRJA 1NV8A 2BZSA 3H5AA 1CNEA 1NLUA 2GEVA 2X86A 4PJ0C 3TZKA 2CLCX 3VZQA 5BNZA 4DV7B 5D4SA 1V1RA 2OOKA 3T7AA 3VOSA 3H5VA 4C7VA 3HFJA 1CT9A 5AM4A 4J3FA 4EPWA 3IURA 4I14A 1XVIA 4DNCA 2RG7A 3VOBA 1AMOA 5IVHA 2RNJA 1T15A 3AHIA 3QWHA 4QBKA 3PFIA 1NJSA 2WV9A 4ONEA 1JSXA 5JPIA 4ESJA 4FZRA 3ZGLA 1IZ9A 3M1LA 1X1CA 4MP8A 4BUCA 2HPAA 3FYUB 4MRNA 3FR7A 3UUFA 1UIMA 1ZISA 5AM0A 4DIEA 1TJ4A 3U21A 1IW7F 2RAEA 1GZVA 1FLAA 3CE9A 4D56A 2LDUA 2BZ0A 1XTAA 3BFXA 4IS3A 1JKQC 1QCYA 3JVIA 5DWDA 3L3BA 4HDKB 1GZUA 4ND5A 2BXZA 3OYMA 4PLTA 3TDUC 1XMKA 1IO2A 3NORA 5CUQA 3WXMA 2Y71A 2CXUA 5JH7A 3DTVB 4S1OA 4TS4A 1SCNE 3ROEA 2BMVA 5J8FA 1IMJA 5JO0A 1ORRA 2OY0A 5LBTA 5IMSA 1XPRA 3KDPA 3K2IA 3MGBA 2B4QA 1UFRA 1UZCA 1E5QA 2GBPA 2X9NA 4YCJA 4AZ0B 3K0EA 2QL5A 4OU5A 3UKOA 4ALKA 5DTQA 3BL8A 1QQ7A 1XEWX 2Z6VA 4CL3A 1X1RA 1VIMA 2OLJA 1P0IA 2GS9A 4J1QA 4C4SA 4RZSA 1ZWKA 3PLAE 3PKIA 3C16C 3NV9A 3VI4B 2R85A 4YWJA 2SECE 1BXGA 3L0YA 1FSEA 2CFTA 1Z3YA 2YIMA 3SJUA 1XJCA 3KL2A 5AKEA 5J1RA 3IR5A 4J0QA 3E6MA 4UDOA 5ILGA 4FB5A 3CVJA 3LUJA 1TZBA 3QPBA 5DTJA 2RHCA 1THZA 5F4ZA 1FYXA 1SEPA 3G3EA 2PG4A 3OU6A 4P4TA 4RGQA 4EB6A 3AMVA 5BO5A 2CDNA 4FZ5A 3TZCA 5IHPA 1WNFA 6Q21A 1XYGA 1M66A 2WYVA 2I2XB 1R12A 3F71A 5K0SA 1UOOA 3H5WA 2VK4A 1SRRA 4DCCA 5CXXA 1JJ6C 3EC2A 2CVHA 1R1UA 1ZONA 1RUNA 5FUWA 3W9SA 3BIOA 5TX7A 2PUEA 2POCA 2QENA 2JI6A 3WE2A 4AJJA 4LOKA 2CDBA 1GZ3A 5L3SB 3EEOA 1OQAA 2JIBA 2E1OA 3T8TA 3GTMJ 1E5XA 1T5BA 5DGCA 4BE2A 2PGNA 5IY5H 4RXUA 2D59A 4DRYA 1FY7A 1C1XA 3PJRA 4PZUA 2YV2A 3PUYA 4TLBA 3JZIA 2XKPA 3VSKA 2HJWA 4WL0A 3L7LA 4KR9A 3RC1A 4F6RB 2IW1A 2Z5LA 4C6TB 2G5TA 4BV3A 4URYR 1F5SA 2O0MA 1WUTA 1LPBB 2HDNB 3JQGA 3R6GA 2JFPA 3OOHA 3HDVA 1L7QA 3SYKA 4BNIA 4DM3A 5FTLA 2PGLA 2W22A 2QZSA 4RJJA 4EMBA 4Q4ZF 1S3GA 3KQHA 1T29A 1OFCX 1VJ5A 2C1EA 2QCOA 2ZI5A 2L0XA 2RBGA 3C5EA 3D2BA 4HA8A 2AO9A 1G60A 2KLHA 2OO5A 2XD4A 4LOLA 2QVLA 5B1DA 4YUVA 5KNBD 4XDHA 2W2LD 1ZREA 1B93A 3DL2A 1CVIA 5F2EA 3SM9A 4CVNA 5HKAA 5KJFA 1ZJ5A 3I1IA 3QU6A 2ID9A 1MAVA 3MC1A 3PD1A 2F5EA 2VXZA 2O8BA 3UV3A 3RG8A 5L45A 3IUNA 4II3A 1WRBA 5F2OA 4FGWA 1REQA 2I4OA 2IF0A 3IHLA 2VUIB 4UE3S 1KJYA 1MHPA 4L9NA 4GOOD 3SS7X 1I24A 2GQ0A 2CDAA 1GJRA 3PEWA 2YHBA 3NOOA 1FY2A 1OLSB 2JBAA 2FPPB 3GEMA 4FCWA 4TKVA 4D9GA 1R1VA 3N7UA 1TQ4A 2PLRA 5AVVA 5KCMA 1IONA 3DDCA 2R1TB 1UG2A 2ZK7A 3LO5A 4JT2A 4N40A 3GT4A 3MA0A 5FCDA 4DA8A 5GV8A 4GPAA 4R98A 4RTLA 1RXVA 3HSKA 4QYIB 3N3AC 1UJ8A 1WE2A 1EVKA 3ZMTA 4MDHA 5TMBA 1NI4B 1KDVA 4O4LF 4YY3B 2YDXA 3NWJA 4MTDA 3A14A 3JSAA 4NV1A 2I8CA 3OF2A 3M70A 4CPDA 1RXEA 1P4SA 4WKPA 3G1LA 2W2NA 1BIFA 2F43A 1T9HA 2RKHA 5EYRA 2XIQA 3CLHA 3H8WA 1DFGA 1TZLA 4NJEA 3B2EA 3IT2A 5JDCA 3P27A 2Q9BA 3FVQA 1M3SA 2PIAA 2QDXA 1KYZA 3CD6I 1ZNXA 1EG2A 3GD5A 2JKZA 3OX2A 4WXHA 1F4VA 4HJRA 3VNRA 4ND3A 4TSRA 5JWOA 2QQ5A 1VHQA 1I14A 2CCKA 3IP8A 3ZH2A 3T3HA 4V3CA 1EH7A 3U4AA 5A4FS 5LYJF 3FWEA 1W0CA 4UNQA 1EFRA 2PIDA 5IAGA 4HZUA 2Q9UA 3JPYA 4PO8A 1NIPA 5G0UA 1IZ7A 2MD5A 4XDZA 2R96A 2V6FA 4BASA 1LF0A 3GT7A 3SVTA 5LCXA 2LKXA 3RBXA 4BWYA 5SICE 3U56A 3LAPA 1QHNA 2LKCA 2W8BA 3F6EX 3M3PA 4JXJA 1LPMA 2DAPA 5H80A 3RC9A 4P35A 1OKKA 4MAMA 1U8RA 2AQKA 8ADHA 2ZGVA 4GRDA 4Y7DA 1TJ3A 1W5EA 4EG7A 2OPBA 4ESVA 3R9XB 2TECE 3ELYA 1CV2A 1LJUA 2CMDA 1ZK1A 2Q3LA 1CF4A 2ODNA 3GLLA 1F17A 2QVBA 5DNEA 2XASA 2BSQA 4MCJA 4MKXA 5L3EA 2QR3A 3D0KA 1O03A 2XZTA 3IKVA 3QH4A 1E2HA 4U7TB 4EB0A 5ALLA 1EUDA 3QMVA 1NRWA 4XVUA 5FRMA 5EIEA 4JP8A 3KPVA 4PC3A 5EWMA 3TCXB 3EH2A 4DG5A 5JJ5A 3BFVA 4QOHA 3ROPA 3G0CA 1L4KA 1EXVA 4IQJA 4KFUA 1IY8A 3P2EA 4WGGA 1PGQA 1ZJJA 4FP9A 4MR9B 5TRTA 5IXJA 3KPUA 4IX7A 4F11A 1DPRA 5CQGA 4XMYA 2GDZA 3RI4A 3G1TA 1U3UA 1YS4A 1LI4A 3IEVA 1YVUA 3E2IA 4GP7A 5TNXA 2FZGA 3CLQA 2IX9A 1U80A 1GGJA 2CY0A 2XGMA 4IHTA 2IQIA 2XB6A 2VTVA 1IB6A 5LJIA 3PGKA 4DLSA 2V55B 2M9HA 4DV3B 3SYNA 1IEXA 4FGKA 2HYIC 3UXMA 2EV9A 1WMFA 2BFFA 3DEIA 3MRXA 3GJ6A 1E2QA 5JNVA 1I6MA 1E5TA 5SY6A 2A57A 3IPRA 5A4KA 1SM4A 4ZYHA 2AI3A 4H0NA 2BJHA 1KR5A 1YX3A 3OYJA 2II6A 2SNIE 2VSFA 4M1OA 1IVSA 1R9MA 4LG0B 1MEEA 2DA4A 1EK1A 1QJCA 4L7VA 1AF7A 3AB7A 3IKJA 4QDZA 1GRQA 2F2EA 3A03A 4HDRA 3BE6A 3T9CA 1MB3A 2YUIA 4I81A 4RH3A 1UKYA 2ES4A 1G3TA 1ZM3A 2WJWA 4D4KA 4RYDA 3IWFA 1H8EA 2J9YB 4OLFA 3CRZA 3K2EA 1NC3A 3ELWA 3HG9A 1SB9A 1GZ6A 2BEVA 3WYBA 4HHEA 5CDFE 4JBAA 3BL6A 4U6QA 4DAEA 4Q37A 3TGPA 3K9WA 2EJCA 4OXIA 4NVRA 6REQB 3D6JA 1NMSA 1ODKA 1BGWA 3M33A 3V2UA 1WY7A 3LSIA 1ISGA 2P6NA 1FYVA 2ZE8A 5K0BA 1A1SA 1W47A 4B34A 3DF7A 5F0FA 3CINA 3GAFA 4JL6A 4LIPD 4QREA 4RGBA 2WP8J 3DKIA 3EPRA 3FAZA 4D4MA 4EP1A 5FLVA 1DGQA 1WLSA 1M9NA 3G71I 5TMDA 2XWQA 2QWWA 3PC4A 2AQEA 1CUFA 3NHBA 3ACCA 4M1KA 2KE5A 4DRXB 3EWAA 4D92A 2Z16A 1Y1KE 1NMYA 4WE3A 4EPVA 4EKEA 3F6RA 1CUSA 2J4DA 1B2RA 2OHOA 1DQZA 2WAXA 3VNBA 1Y56A 1TVMA 1W59A 3I2FA 2WP0A 1ZK0A 3CUUA 1WJFA 4XWGA 2JHCA 1IY1A 2MDTA 4ND8A