2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
b'ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
3MZYA 5IZCA 4CLXA 1ULSA 2P91A 2JZYA 4RPLA 1WDKA 1ENOA 4H16A 4RPKA 4ZYHA 3J81K 4CLHA 2Z3YA 1DEHA 3G17A 4U5QA 1TBXA 4ETSA 4AVYA 3OFSA 1DFIA 3IJRA 3WIDA 2PI0A 3L9XA 1SMYF 3EYWA 1BI1A 1XCBA 1T1RA 3FTNA 1EVYA 1KVUA 1GD1O 1J75A 3KOUA 5I9NA 3FBTA 5BPDA 4CM4A 2QVOA 3CIFA 5F1PA 4DXHA 3BROA 1I2CA 1GCUA 4BO2A 4EZBA 3CUQA 3VTZA 4KWHA 1TTYA 3ISPA 2ZYDA 4YB8A 1WQ2A 1FX7A 2TMDA 1RM5A 3DHYA 4UUMA 1Q1NA 3Q5FA 5EMHA 3E5UA 5E1WA 1HW2A 5G4KA 3RWBA 3M2PA 4UREA 1R16A 3QSGA 1HE4A 1LDBA 3I71A 1PJ3A 1YTYA 4IGFA 3H9GA 1JDJA 3RPQA 2XROA 5JMPA 1VM6A 5DZSA 5HWSA 3FF5A 2ZNZA 5IT9Z 3QWHA 3ZWYA 2ZB4A 3IP1A 1TQMA 4PCQA 4XLPF 2Q2QA 2W8ZA 3GEMA 4GKBA 4J49A 1KOLA 3WQRA 2PR2A 4YYZA 1KGSA 3HHPA 4UVGA 4CMBA 3ZNOA 2F5CA 4WLEA 1IRGA 2GR9A 3WTZA 5CDGA 2A07F 2BBYA 4OOEA 3AUTA 3GDGA 3D3EA 4YDRA 3PVZA 3OIGA 1VPDA 2C07A 4B09A 1QYWA 2GN6A 3NKLA 1K79A 3QJ5A 1NR1A 2B5VA 4XRRA 2D0IA 4Q3BA 4FW8A 1F5TA 3ZPLA 1H6AA 5J8FA 1IRFA 3IIEA 4HFRA 3H9EO 5U1PA 4R5HA 1BHSA 1YB5A 3RBVA 3V1UA 2IYPA 1EZ4A 4TZKA 1J4AA 2OAZA 1A71A 1SEPA 2RIRA 5U9CA 1LTHR 2MC3A 4FQ8A 3FR7A 3JTGA 1DJNA 1X1TA 3JTMA 1Q0LA 4FD3A 2YPRA 5E8GA 1QYDA 2PD3A 1T2FA 4MIOA 4U0WA 5COBA 4HLXA 2VT2A 3I9LA 4BGEA 3C7AA 4BO8A 3E03A 2Q3EA 3PGXA 2P9CA 2QYSA 5TNXA 4JGBA 4RDIA 4Q3AA 2WM3A 1QSGA 3SQNA 5DCYA 5ILSA 1KBZA 5IT9K 3HN2A 2IA2A 3JQBC 1LDDA 1E7QA 1FXSA 1I01A 2P2SA 1ZCJA 3KYDA 5DYMA 1CRWG 3GLQA 4AIHA 2XOXA 4FGSA 4IPAA 4KQXA 2Y05A 2Q49A 4UVIA 2F00A 3GNQA 3RC9A 3R1IA 3BWGA 1YL7A 3BMOA 1GVJA 3DL2A 3MJSA 3ABTA 1O6ZA 4FT8A 5A4DA 1GAEO 2SCUA 1ONVA 3QAHA 4HAMA 2A94A 2GRAA 2V6FA 2WD7B 3PFFA 1U3WA 2IZ0A 1T4BA 2Q2EA 3KZYA 1B6AA 3DBRA 3PHJA 3DBLB 3PJFA 3PWSA 4M1QA 5TRTA 5B1YA 5F1KA 5ICCA 3ECHA 3WLEA 1T4DA 3OJ0A 2O8XA 4OL9A 3NJ8A 5G4LA 3UN1A 1NVMB 1K0UA 4HZFA 3A9WA 3TGNA 1N9GA 4DMLA 5HS4A 1Y8QA 1SB9A 1JWAB 3A1NA 4MP8A 4OXNA 2YDXA 1ZN2A 4RQUA 2FOKA 3RU9A 5K1YA 1K6IA 4ENJA 1XU7A 2AEJA 4IJUA 2R7FA 5AOVA 4HNGA 3PQJA 3GZ4A 4YQYA 1IB6A 4WOJA 1I5ZA 4CXFA 4NDNE 4O0LA 5KVVA 3GZ6A 2JPCA 4GKVA 1NQ5A 4IXAA 1ZRCA 4XGNA 1Z91A 3D7LA 1XGNA 3F1KA 3DMYA 3OIDA 4JJGA 4JJIA 4HA8A 4JX8A 4BMVA 3OEYA 2AQHA 3PLRA 2IA0A 4UAGA 3GX4X 4P4GA 4GX1A 1W4ZA 3U4IA 2VHWA 1V3UA 5F5LA 1E7RA 1XGOA 1EQUA 4ZU3A 1PJCA 4AJLA 1V3FA 3CJNA 1O7FA 1L7DA 3GAZA 2C29D 3GEZA 4WCDA 3JQDA 2GAUA 5DBFA 5DBGA 3SX2A 4L76A 1YWGO 1TNTA 4B4WA 1P0CA 3GDOA 3PHHA 4DLBA 4M9ZA 4CQMB 3RUDA 4IZHA 1SAYA 2BFOA 3CZRA 1ODDA 1RNLA 3E6DA 3F8MA 5DCMB 4A03A 5JY6A 5K6AA 2W4QA 3NGXA 1P33A 4Y13A 5AXAA 5LEKA 1UXIA 4YTEA 1E1MA 2QZ9A 3FTPA 3L09A 3LAJA 4KUGA 4Z3DA 4J16A 3ANMA 4GCVA 4WGGA 4BNMA 4BHBA 1G1AA 3H5NA 3HDQA 3HJAA 3HWRA 2VE8A 1U9JA 1BXKA 4MVJD 3EDMA 5LC1A 4HF1A 2OORA 4BNIA 4KP7A 3DAGA 1LDJA 2EA4A 5CVJA 5D5WB 3VFZA 1UZMA 1VE9A 3S2GA 2YJZA 3ZU4A 4AJEA 3VH3A 2FMUA 5THQA 5F5NA 4RPJA 1TXGA 1B14A 3AUAA 1YVEI 4GWKA 3P2OA 2FR0A 1SMTA 4JJFA 4WASA 1Z6TA 3F3XA 4PGHA 4A0XA 4ZH4F 2HQ1A 1DIGA 1ZJZA 4R68A 2GXBA 3M9AA 4CM3A 4PG4A 3IWFA 4TVBA 3B70A 5LGTA 4IIVA 2WWRA 4RGUA 1VL6A 2DKNA 1Y0UA 1G3YA 4BO0A 1LJ8A 2OUIA 3WQQA 4CM9A 1TEHA 4UUVA 1V9LA 1WZIA 2C54A 2G1UA 1LDMA 2JHGA 1GZ4A 2VOEA 3BHMA 3MJCA 2PK3A 1E2XA 4S1VA 1LUAA 4KT5C 4CUZA 4UNOA 1SD6A 1PJ4A 1D3YA 4WCGA 4PLZA 2UVDA 3ULKA 3I1JA 1WI9A 3K2BA 3LDHA 4BKQA 4A6EA 4Y9DA 5TJ9A 4Y6PA 2JJYA 3N74A 3HSEA 1NWHA 3Q2IA 3RD5A 2XUBA 2VRBA 4HFJA 4BNVA 5BSEA 5F1OA 4DIBA 3INRA 3N58A 2L3DA 5FEUA 5EINA 1WSUA 2Y0CA 4Z9YA 4KYWA 3I3OA 2Z5LA 3OQBA 2YFQA 3FXRA 3R6DA 2EWMA 5C7OO 1F06A 1NXQA 1IYZA 4J9VA 1SPXA 5B12A 1GFSA 1NTOA 2E7WA 2BEOA 4G9YA 1EV7A 1NHWA 3IP3A 3FX3A 4N9HA 3E9NA 5EIOA 3DMTA 1DO8A 2QBYA 2LDBA 1R0SA 1ZYRF 2GA2A 2BRUA 3H9UA 2VHYA 2VUSA 3B73A 1HYHA 1LDYA 1FDVA 1BBYA 1Z45A 1ZNQO 2OZ6A 5T67A 4HV4A 1BXZA 1GR0A 1NWCA 5D5XB 1KEWA 3INTA 3SEFA 4EJ6A 2Q50A 2BD0A 2K4BA 2X5JO 5ED4A 1D8KA 2IRWA 4FN4A 4GYGA 3NRCA 3ZDFA 4BKPA 4M87A 3PI7A 4PLPA 1S6LA 3I9MA 1YL6A 4ALIA 3W4JA 4E5MA 4UEJA 3IRRA 3X2EA 5LCXA 1N2SA 3AUSA 3CTMA 1YKFA 1KEPA 2ZCVA 3OQ1A 4QFDA 2VTDA 1U5CA 4RB3C 4NMHA 3SXPA 2O0YA 4NBWA 3VPFA 4CV1A 1O9BA 4A5MA 1O95A 3OM9A 4XRFA 5AXCA 4II3A 5DEQA 1PIWA 2VE9A 1KS9A 1ZEJA 4UUOA 1E5LA 3AU9A 4FC6A 5KJ1A 1UH5A 1OMOA 4PG5A 5ENVA 1GXQA 3P2YA 3VOSA 3BXXA 1BI2A 3FHZA 3QHAA 4JBHA 4ZQBA 1Y9EA 4D43A 4ZYEA 4CLDA 4EEZA 1ISHA 2X5OA 1GQ2A 1IPEA 1NVTA 4RLHA 4D79A 3G1TA 3KUXA 4U6SA 5FFFA 1Y6JA 2JD2A 4B4VA 3ZN1A 1ORRA 2P4QA 2QX7A 4DBVO 3FR8A 3IJPA 3E9QA 3WLFA 3WOHA 3MFKA 5IG2A 2HGCA 1RKXA 5L7YA 2FR8A 1Z05A 2FSVA 2HUNA 3NDJA 3QQPA 4N9IA 2Z33A 3ZHZA 3ZWOA 4BV9A 3GEGA 2W2KB 2CVOA 2ZB3A 1SFUA 2OHXA 5L3GA 4RZIA 2WJPA 3ETDA 1M67A 4W7HA 5I9MA 1ZW1A 2VZ8A 1WMAA 3RUCA 3HTSB 4LGVA 3K30A 2ISYA 3GFIA 5ILUA 4CO8A 3JAMZ 2J5OA 4MVJM 4PG8A 1ZG3A 1BGVA 3HN7A 3RKYA 4F6LA 5TLSA 2VHVA 2XV4S 1YBMA 2O3SA 1MFZA 2VYNA 5DP1A 1D3AA 4YA6A 5HDKA 3WGYA 1IHXA 2AG8A 1OPCA 4A5OA 5L4NA 5BMZA 2L54A 3BMOB 1XHLA 2GNAA 4BO3A 1P1RA 4WNCA 3W8EA 2B83A 1ID1A 3QE3A 2L02A 4D42A 3KEOA 1VSUA 1C14A 3LA3A 1ZLKA 1DC6A 2Y1EA 3F6YA 3V1TC 3AFNA 1GQQA 4IDAA 1NQOA 4Y8VA 2HDHA 4J2OA 2XAJA 2AS5F 3JCZA 1EUCA 1NVGA 5JW6A 4PCVA 1BMDA 4WF2A 2I76A 3HTUA 3DOCA 1Z9CA 4R01A 3FM3A 1ZKMA 2VQ3A 2YX4A 1NPYA 1Y8QB 3QVXA 2HKXA 3RUHA 4BNUA 4E31A 1GV0A 4L9VA 2L4MA 2QQAA 4QT0A 4ZN6A 4GBJA 1HXDA 1PZEA 3BMQA 2PQ8A 3BZUA 1R5HA 1TT7A 4K2EA 1B7GO 3SLKA 3ZWMA 3FZVA 1XGKA 2DM6A 3IUSA 4MKXA 2NVUA 2H6EA 1KYZA 2ZTMA 4YT2A 1NFQA 4A26A 3WU0A 4BNZA 5ILOA 4ESBA 2FWMX 4IDCA 3JAMK 2X0NA 3VAZA 5KK1A 2Y99A 1JA9A 5HTOA 4E2ZA 4NFHA 1I3MA 4AJ1A 2J5KA 3H5AA 3UUWA 2HAEA 5C5IA 5CG2A 1EBUA 4TWRA 2NU7A 3GFLA 3GFBA 2I6TA 3VHRA 1ZK3A 4IDGA 4A0SA 1HXHA 2BELA 4EM2A 5ICEA 4HOBA 3NYWA 4ZA2A 3TDKA 3TNLA 3VZSA 2VUUA 3WGIA 3W6JB 2NQ8A 4Z0HO 1B26A 3CMMA 3MZ0A 1MDMA 1FNNA 2C5EA 3AOEA 4YBZA 1ZK4A 1JVSA 3GG2A 1I24A 3JSPA 5FGMA 1LC0A 3DV8A 3KTDA 3KP5A 2PLYA 4YT5A 1GZ3A 2EWNA 4TMFA 1T39A 2VC0A 2WC2A 1EBFA 3O3KA 1J6UA 1YBAA 2J3KA 2LKPA 2CMDA 3FI9A 3VKVA 3QIVA 1ISFA 4G6DA 1SC6A 2UXXA 2ZO4A 4WE3A 3AJRA 1DOHA 2IZZA 4WCFC 5HM8A 3IMFA 3JW4A 1LQTA 5IAAA 1H9AA 2Q4EA 2NV6A 5DOZA 4FJ2A 2J5PA 3TWOA 2HQNA 5JC8A 1U5TC 1FYKA 1HDGO 2GD1O 2ZATA 4L4XA 4ZQFA 3T8RA 3NTOA 3C1DA 5LGNA 4N54A 2LNBA 1CF7A 2YQ4A 1AN9A 2C20A 3R4KA 2DQRA 3RYRA 3NX4A 4LCEA 4W4TA 3L4BC 4NZ9A 1UDAA 5G0VA 5FLXZ 1PJBA 3HFGA 4I2OA 2H1SA 3TOAA 1HKSA 1YE3A 5FB2A 4AFNA 4XJSA 1DLIA 4RVFA 1ZREA 1U6GA 1XGSA 3T7CA 4AL4A 2XIGA 1TVEA 2PGLA 4ASNA 8ADHA 3IAHA 1CEQA 2JHFA 3KXDA 3GGPA 2YV2A 1HLPA 1ZSVA 3CTAA 3AI1A 2A35A 1DBVO 3W8FA 3C1AA 4IJAA 2PMHA 2VN2A 4NU6A 4HV6A 2IEDA 2VODA 1UZLA 1DB3A 4TROA 4YCAA 3V7SA 3A28A 4PLYA 4D0RA 2R7DA 4R9SA 3WQSB 1S7AA 2DPDA 2D8AA 3AI2A 3ST7A 4D3SA 2YV3A 5A9RA 3D3WA 1WKMA 4B4OA 2HR3A 4RS8A 2A4KA 2D1YA 1UJMA 2G17A 2V6GA 2W98A 1GPJA 5KVRA 5COQA 1P77A 4G2NA 3HQ4O 3GUYA 2IZ1A 4LK3A 4CMJA 4ZGWA 2Y1FA 2I9PA 3U49A 1OKRA 1E1KA 2A5YB 3T4EA 1U8RA 4ONEA 2KIFA 3TL3A 3GC6A 1KQ0A 2D2WA 3K69A 2VRCD 1ENYA 1P9LA 3JQBA 3JYOA 3KSUA 2WYUA 3JD0A 4NJOA 4R41A 3R0JA 4U0VA 1A72A 3DKWA 5D4SA 2X0LA 1FP2A 5FLXK 1DIBA 1O3TA 2DPHA 3H9JA 1HKQA 1B9NA 1ZBQA 3OICA 3FF4A 2OOSA 4NQWA 2IE0A 3NEPX 4AJOA 3IC5A 1PL7A 5JAMA 1HF3A 3V2HA 2OMEA 5IJZA 1BDBA 4BO4A 2QBYB 4R5MA 4F3YA 1R0KA 4YRDA 4YJHB 5C3MA 4LMRA 5LDHA 3HDHA 4M72A 1YJQA 2HRZA 2DLDA 2JFFA 1ONPA 1RI7A 2Z99A 2X8LA 3I83A 3F21A 4OIQF 1KQ9A 1F0YA 1Y1PA 3BTSA 3DZJA 3FPLA 3I9OA 3JQEA 3I64A 1NFFA 5E8IA 4J1NA 4M54A 1FBUA 3A4VA 3MWEB 4O3MA 3ONEA 1Z74A 3BYZA 3UICA 4DIOA 1LVAA 1YRLA 3E6BA 3QRWA 2X1HA 3AM4A 4IRHA 3GG9A 5A2QZ 4ALMA 2PZJA 3BMCB 3SJ7A 4HLYA 3JQAB 4QECA 5JPIA 3H65A 4W82A 4CV0A 3HRUA 4BNKA 3GVCA 2HOEA 4WLNA 5C7IO 5TJJA 1MXHA 2ZJ2A 2RQPA 4EGZA 3ZV4A 4HQMA 5F6FA 4UVHA 4BNLA 2DBVO 5AVOA 3AU8A 1ZAOA 4AIKA 3RVDA 4TRRA 2HMSA 3GVHA 5CHEA 3GRPA 1S8NA 1GL3A 1GDHA 4J4BA 4RVHA 3EAGA 1FLIA 3NJ4A 4RVSA 3TL2A 3DDNA 3LA2A 1GV1A 5CDYA 3ZMZA 3F23A 4PRKA 5T57A 3TZCA 2X23A 4AJ2A 1A27A 2QZ8A 2NQTA 5L3BA 1LNQA 4FR5A 4L74A 4HQEA 2CSUA 1IUKA 5CEEA 1UP6A 2CGPA 3LC2O 4IS2A 4EITA 2RAFA 2DBZA 1OFGA 3H2SA 4BUCA 1T98A 2QQ9A 4A2UA 1IZ1A 2DW4A 3KP2A 1IXRC 3KEQA 2QWWA 4XYBA 1ZK2A 2ZBKA 4LK1F 1HZZA 3PIDA 4UULA 2Y67A 3LT4A 1RYEA 4OYRA 5JYEA 2QLZA 1YH3A 1U4OA 2X9GA 1C1XB 2NU9A 2ZCUA 4I9HA 5JO9A 3ZZNA 3RC2A 1P0FA 1FPQA 2BI8A 3EZYA 2HLPA 3D4OA 1GYQA 4GMGA 3DQPA 4MNUA 4RAZA 2A6HF 5A2QK 1XR3A 3ROQA 3VVBA 4BGIA 3I6IA 2POQX 2I3GA 5A5FA 3JQFC 1O0SA 2G9WA 3NAQA 1XN7A 2HJRA 2E4AA 3EETA 1WDMA 3G0OA 2FPPA 3KFWX 3E6MA 4EVIA 4H15A 4XX0A 4NBVA 2DAOA 3KYBA 3ZGYA 5C37A 1A9YA 1EDOA 1XU9A 4I08A 4ENMA 4DA9A 3BA1A 3K1PA 4OSOA 2GWRA 3D5LA 1R6DA 1QLHA 4XIYA 4MVJA 3GOHA 4B3HA 4RO0A 4ZD6A 3QVTA 1UCRA 3WE3A 4EUFA 4XGIA 4RCVA 5ITWA 1U78A 2B4QA 2IODA 3P5SA 4FSHA 3RAJA 3ZMTA 3K8ZA 4J0FA 3DEYX 2FMYA 2X22A 1N1GA 4J3FA 2M87A 2PBIA 4CMCA 3Q9UA 3GQVA 3QOPA 3RUEA 1DAOA 4UVAA 2EV0A 1CETA 4R3NA 1V4RA 1B8UA 2JFHA 3P7MA 5GY7A 1H0MA 1QV6A 1EEHA 3WTWC 2NACA 1W7PD 5KJEA 3H92A 1NR7A 5HOOA 1T2AA 2JT1A 1HLDA 3ZV6A 3BMQB 3TZ6A 1OC2A 1S3JA 4RVGA 4J91A 4IDDA 2XAGA 1DFGA 4EDFA 2O2SA 4IIUA 2NVUB 4DNCA 3WTCA 2O3JA 4RLSA 1P4XA 4XIJA 3U9GA 1EVIA 2IYOA 4J43A 3PGJA 3AOGA 4XQGA 2HTSA 1YOVA 2D2IA 4IY1A 2RDPA 1TB4A 1FC3A 2QW8A 1U2WA 3W1VA 1N7HA 5B4VA 9LDTA 4KDFA 4WLUA 5JY1A 3DBHA 2XGXA 4AICA 3HSRA 4DC1A 4LRSB 2YHIA 4CJXA 4KTTE 2UV8A 3GFGA 1C0IA 3NUGA 1J49A 4IF4A 4B8XA 2J3JA 4J2HA 1I2BA 4NIMA 1MDMB 2EFQA 4UUNA 3A06A 4J1QA 3T7EA 5D5UB 4DC0A 2IXBA 4Q39A 2M8EA 5ADHA 1P1IA 5LHIA 1YLFA 4CYDA 1BDMA 2GASA 1R58A 2UYYA 3WDSA 4A0YA 4IDBA 5DDGA 4XR9A 5D4RA 4FGWA 2EK5A 2CWEA 3ZMUA 3G73A 1P6RA 1ZLJA 3UHAA 3TPCA 1USTA 4L9RA 1X15A 4L75A 1NYTA 2OP0A 1I32A 2DBRA 3P9IA 4K6CA 3NEUA 2O3RA 3FMRA 4IJVA 4OMUA 4LISA 3Q2KA 2DK8A 1BIAA 3HG7A 4HFNA 4KTVE 3WWZA 1FDUA 1I0ZA 3MJTA 1WWXA 3RC7A 5JSFA 1ADCA 2EG9A 1VRWA 4UHTA 2Z1MA 3AY6A 1IAWA 1OC4A 3LQQA 1CF7B 5D6FA 4FFMA 4CM5A 1XKQA 5JCJD 3V8JA 3WODF 3R0AA 3V7CA 5JDCC 3FXUA 4FFOA 5IT3A 2ET6A 3IKTA 2VTEA 3MOGA 3JTHA 3W4IA 4RVDA 4LB5A 4EJWA 2PJPA 1FDWA 5BQTA 2ZYAA 3PJDA 5JMWA 2VBWA 3RI4A 4OOFA 1PZFA 2VHZA 3CEAA 4OMYA 2HU2A 3DZIA 1MC4A 2FE3A 3NGLA 4Z0PA 4ZYDA 5A06A 1UHWA 3HUGA 1IL0A 4YT8A 5L4LA 1DLJA 4BNHA 5A9SA 1PS8A 1LLQA 4Y6RA 2MD5A 3ON5A 4FFPA 3WFIA 4E21A 1K6JA 4J1TA 1T6SA 2Q8KA 4IMPA 1ON1A 4HWKA 5BS6A 3S55A 1ZH8A 1DRVA 5JHUA 1A04A 4FDAA 1KVQA 1E7MA 2E6UX 1WLYA 2HMTA 4YIFA 2PY6A 1VLLA 3I9NA 4XYLA 3IHUA 4FPXA 4PLHA 3WICA 3D3WB 3ZNQA 4F7ZA 2PGDA 3DBVO 3EMKA 5TGDA 3S2IA 4R1NA 4MOWA 4CMAA 2JCVA 4FHTA 2ILTA 4I5EA 2XXJA 2QYOA 2YYYA 3BAZA 1LX6A 3RFVA 3AWDA 1NASA 3T8TA 3BIOA 1QGPA 2P8TA 4L0YB 1VJ0A 2R00C 3WYBA 3GEDA 1H6DA 2OZPA 1DIAA 4UV9A 3FBGA 2J5RA 4KQWA 5ITVA 2EJRA 1LRLA 4GI2A 4N0BA 3RJPA 5H83A 4CL8A 4I09A 5G0WA 1BW9A 1IXSB 1C0WA 3ECOA 4I7HA 1FP1D 3GF4A 1ADBA 4NPCA 1MKMA 2FEZA 4Q5SF 4J7XA 4NJMA 4XZ3A 2R2GA 1OR7A 4DPMA 1T25A 1R7JA 2FRDA 2XPCA 3ZP5A 4L0ZB 5H6RA 3WTUC 4Z2YA 5CG1A 1VKOA 1T2KA 1IUYA 1XEAA 3L2CA 3QW2A 4HX4A 3KHUA 4ND2A 5HVQC 1IN5A 2CSOA 1HKUA 5D8LB 3LF1A 1IY8A 1J9IA 1VC2A 3FNEA 4Y6SA 5BNTA 1BWSA 4BYYA 4TQGA 4G6QA 1IN7A 1F1ZA 1AWCA 1NP3A 4C7KA 5BOXA 2V9VA 2HMUA 3D4PA 3JQGA 4KOAA 2ZB8A 1CQJA 1SFXA 1WVGA 2Y68A 4IXTA 3OQ6A 2JCXA 5LHGA 1A4IA 1JAXA 2O3QA 3PZBA 4EI2A 1XWFA 3QVOA 3PTZA 5EQFA 2GYYA 1JE8A 3L4SO 3EDPA 4Y15A 1D1SA 4FS3A 4GX0A 4PRLA 5HBRA 1E3JA 1PTJA 4MTEA 3HRTA 3R6SA 4IQ0A 2QQBA 4MPDA 1JN0A 3B1JA 3PQDA 3QLJA 2MH9A 4YQZA 2DK5A 3V8LA 3E6CC 1RIOH 2VBYA 1XCVA 5A1TA 1XLTA 2GPTA 1ZFNA 5ICGA 5MDHA 1ZH5A 3CLOA 4W99A 1S7OA 3E82A 1DC5A 4J90A 1GYPA 4IHTA 2G82A 4BKOA 2ELHA 1ZZEA 2IP2A 2BKAA 5T8KC 1DIHA 2PGJA 3DC2A 3H2ZA 1PGJA 3TFQA 4YACA 5CVVA 1XMAA 2NNLD 3WIEA 4MVJI 4RGRA 1I8TA 2GIVA 2FP4A 3CZMA 4O6VA 4OSPA 3UCFA 5DBIA 5DCUA 3ITDA 2C0CA 4Y98A 3F8FA 1AGNA 1JU9A 1K5HA 2AQIA 1XQ6A 4RF5A 4G5HA 4JP3A 1LLUA 4CM1A 3I52A 5ICSA 3ZMSA 1UAYA 2FN7A 3BTVA 1MJ9A 1YQAA 4LSMA 1W4MA 3ELKA 2HJSA 3GH3A 4G7HF 3OJOA 4IXWA 4EW6A 4OIPF 4TZTA 1SFEA 4QLCU 4RPHA 4YXFA 3H5RA 3I9KA 4WCFA 4YFKF 4BV8A 4MVJP 1KERA 1HZJA 2CDAA 5TF4A 3U4DA 4OM8A 5L7WA 3U62A 1EK6A 2W84A 5CPFA 5JXWA 5KCZA 5BNFA 2X9NA 3T1BA 5CLSA 1FZPB 3PHGA 1QV7A 2H9IA 5HS9A 3O6BB 4CPDA 2DUWA 3TF5A 4F6CA 5KNLA 1BM9A 2OQRA 3TDZC 4M49A 2XAQA 4BAYA 1LB2A 1G0OA 1B9MA 2PZMA 4E13A 4B8WA 5HS7A 2Q4BA 3L4BA 4R16A 2C7GA 4GQAA 4FC7A 3O26A 3KRTA 2ZKLA 3ZU5A 4D3DA 4RB1A 4EMSA 1X7HA 4JROA 1LRKA 1JGSA 4HYEA 1SD4A 3OECA 2PMUA 2FBHA 2A6EF 1H2BA 1TT5A 4B8ZA 1CERA 3MJ4A 5G0UA 4CMIB 1QZYA 1XYGA 1NX6A 4Q3EA 1HDRA 1BJAA 4JQFA 3GHHA 4CM6A 4KA4A 2GUGA 2AXQA 2J3HA 3GXOA 2QZZA 5A05A 5A5EA 4GMFA 2MH2A 1O7LA 2DPUA 4O59O 4EQQA 3GA0A 3L6EA 4CQMD 2OBYA 3M1LA 4NH4A 3RIHA 1MGTA 4DL9A 3BP8A 2V65A 3JYNA 1BC8C 4PLGA 5KTKA 3C18A 1E7SA 3BDDA 5KJ6A 4WXCA 4MIYA 5TS3A 1Z7BA 4K9DA 3GFJA 2E1CA 1ENZA 5HS6A 3DPLC 1V8BA 4J0EA 2EFPA 1I5RA 4DYDA 1V35A 4UEOA 2RCYA 3C24A 4ESOA 3GO5A 2G7HA 2EJWA 3GY0A 3QY9A 4KZPA 5FYDA 1YOVB 1N5DA 1MLDA 1SD7A 2EF1A 3ULQB 4M73A 3PZRA 5CAEA 1CDOA 3DBHB 4QO8A 3WNQA 1M6HA 2ZMEA 1R00A 1X1EA 2YHIB 5DOVA 3M8EA 4XJTA 4LSWA 4BVAA 1HSZA 1BN5A 1GUFA 3ROKA 5FD5A 5ICFA 5JDIC 1XQ1A 1OAAA 1PGQA 3KETA 1WZEA 3VH4A 1NAIA 3WE2A 5AIPA 3IS3A 5JAZA 2PH3A 1SB8A 1U2GA 4YT4A 4M9XA 2GN9A 3RJ9A 2UWMA 1ZSNA 2ZXJA 4MEYF 1QQIA 1IULA 2CD9A 5DCWA 2VRCA 2Q45A 4PG6A 4HBLA 6PAXA 3J7AO 1UUFA 2Y0EA 2DTXA 1XDWA 3ETGA 3GVPA 2GZ1A 3QP9A 4WK6A 1DHRA 4DLAA 5JCXA 4WK8F 1U7TA 3JQ6A 4GLLA 4AJKA 5TT1A 3CMCO 3MEXA 1FDTA 2JTVA 1I10A 1ZMTA 2GSDA 3CUKA 4YG2F 1SNYA 3IOYA 4FOSA 2A61A 3PHIA 1R66A 3GF2A 2HMVA 3UXYA 5K0ZA 2ZTLA 1E7YA 2K86A 4BHCA 1R36A 1I3KA 2KIUA 3BTOA 4HF2A 3CE6A 1CQIA 4PLCA 1W5TA 4I01A 4IBOA 4EBFA 2O3TA 5IDXA 4ENKA 3ZH2A 2YHUA 4ZYGA 3U09A 3OMLA 3L7WA 3DEUA 1PU2A 1RYDA 3QWAA 2O7SA 3DZBA 4J9UE 4CM4B 3ITKA 5FI5A 5IFLA 4RVUA 3P9KA 4A6DA 3CUQB 3VODA 1O8CA 1R1TA 5CPBA 2VBXA 2VWQA 1NM5A 1O5IA 4OOIA 5F21A 5G4KB 2W57A 4GAEA 4WEQA 2X4GA 1GXPA 2VN8A 3E8XA 5A9SB 4I9NA 2VOJA 5KJCA 1W73A 4B7UA 3NTQA 3GUCA 4R4JA 1ZVMA 4ZZLA 4U88A 2FMLA 3FNGA 1ARZA 4B7CA 1Z7EA 3GDFA 5FWNA 5K5OA 1PQPA 4K26A 4E5NA 1PZGA 3WGHA 2FZEA 1DC4A 3C1TA 4AJPA 3E3VA 3U4HA 3OA2A 4RORA 1I1SA 3JD3A 2VZ0A 1RM3A 2CQKA 1YB1A 3B20A 4JN6B 4CM8A 3Q9SA 4GXOA 5HRUA 1K6OA 5JFRA 2JSCA 1M76A 1YONA 3DZGA 1M6WA 3ICCA 3LSYA 3V2UA 2KIMA 2X6TA 1GEGA 4RDHA 2PWZA 4HW0A 2EP5A 2C6YA 2O03A 1MA0A 3ETEA 4FCCA 3CO7C 3D5QA 4Q3CA 1EE2A 1XGMA 2DBBA 2ETHA 1CYDA 1WDLA 1GEEA 2JRTA 3WG9A 4LMPA 1L3LA 1LDEA 1J2XA 1HSJA 1BW9B 4KMSA 1F8GA 2BE5F 3LFKA 4JP2A 3FN4A 3EVTA 4MKZA 2OZUA 4QX6A 4NJMB 5I8ZA 3C3XA 1Y81A 3DFUA 3I59A 1GUZA 1P1HA 3RFTA 1YQGA 1I30A 4QEDA 4TKLA 1S6YA 2EFNA 2IXAA 2NTJA 1QORA 2E1NA 3B1FA 3ZHYA 3TKYA 4Q48A 4CMHA 2BGLA 5G0TA 4R79A 4ON0A 3GYHX 2CW0F 4TV7A 2LDUA 3VOEA 5BR7A 3L6DA 4RGBA 2B35A 3IUPA 3TZKA 1CGPA 2PH5A 3KYDB 3F3SA 4AJJA 4CMEA 3FXQA 1UFMA 3RUAA 4PDKA 3FM5A 1UDBA 1ZJYA 3PYXA 4J4TA 2D1HA 2TDXA 2PKQP 2IA1A 3D0OA 5LBQA 1ZXBA 3MAJA 2NYXA 2VYVD 4NFYA 1DDOA 2H94A 3KVOA 5KKCA 1C0PA 4FIZA 2Y1GA 3DBRB 1NQAO 3C8MA 3TO7A 2HO5A 3L77A 4CV2A 1T24A 2P5VA 3FMQA 3LT2A 2MBFA 3U5TA 4GGGA 4WLFA 1RJWA 3VPSA 3ZV3A 3JV7A 3PPIA 5L51A 1PJ2A 4MHGA 3B02A 3K2ZA 2JD0A 3K1MA 5L3ZA 1W7PA 2D59A 5H20A 4MVJG 1N9GB 4W6ZA 4YAIA 1T1SA 4XQ9A 2EHDA 1LLCA 2P5YA 3PDJA 5IDYA 4KIGA 2X86A 4M71A 4M8SA 4MJLA 4F45A 4ZHSA 3E18A 2H5LA 4G7OF 1GYRA 3ROMA 2NNYA 1D4FA 2P5LC 2BFPA 2GF2A 2P68A 4EEXA 1J5YA 3VDQA 5L9AA 1D7OA 5EEGA 3PK0A 3JSAA 4ND1A 1YS6A 3LF2A 3HHGA 4FJ0A 4HV5A 3GR6A 2HYGD 4L9TA 3EVNA 3RU7A 4OO3A 5A3JA 3ZW9A 3R61A 5IN4A 2DC1A 2OBPA 2WTBA 2Y0DA 3JD4A 4DQXA 2YR2A 3V8KA 3VKUA 1T38A 1EDZA 1LSSA 1ML3A 2A9FA 2UUOA 5GZ6A 3HDJA 5IZ4A 2J8ZA 3K9QO 3WU1B 2FF4A 3EYYA 1Q7GA 1J0RA 2DTDA 2NWQA 3GVXA 5CEJA 5B4UA 1IZ0A 4ROSA 4I5FA 3PFIA 2A3SA 4BQRA 3F8NA 3N97A 2DBQA 3CH6A 1TW3A 3QWIA 4OKIA 4D7AA 2K27A 4GVXA 3RYPA 3BJ6A 3KB6A 4DQUA 5JFOA 1JW9B 3KYCA 3CDHA 1E3WA 2Y66A 4JBAA 1PR3A 2ZNYA 3COSA 2K02A 2UDPA 3VEPA 1E92A 1EUDA 3BJOA 3BPXA 3COAC 5MGBA 2IVMA 2D1VA 2X0RA 3E5XA 2FHSA 1EH6A 1X0VA 1HTBA 4IVNA 1YIOA 3LWFA 4EM0B 1DUXC 3UF0A 3F4LA 1YXMA 4BIIA 2QENA 3LA7A 2LDXA 3RBZA 5AIQA 1DP7P 3PJGA 3KP4A 5EQDA 1TW2A 4IDFA 4QSMA 5JCJA 4A2CA 1DXYA 6ADHA 4BNTA 2XF8A 4NNJA 3K2EA 4YJGA 2CDCA 2DFVA 1QBJA 4EJVA 2GN8A 4XD2A 1XDSA 1XELA 1PS0A 2CFCA 2Q1TA 2JD1A 3GNTA 2PV7A 1UXGA 4JLWA 2V6BA 4TVOA 3OETA 4HFMA 4HNHA 3PQFA 1RUNA 2Q46A 3KLMX 4OIMA 2EKPA 4HX8A 1VJTA 1MJAA 4NFSA 5DNAA 1F14A 1P3DA 4RGSA 3NT4A 4DPLA 1RWBA 1ONNA 3TJRA 3CSDA 2GGSA 1UDCA 3D5TA 4Q3NA 3OBBA 1R15A 1G3TA 1W5SA 1FDSA 1Z6RA 4P9FA 4DVJA 2HFHA 2AE1A 2R00A 5K6AC 4EUHA 4BNJA 4UUPA 2CUKA 3UCXA 3WMXA 1R1VA 1HEUA 2X0JA 5I7VA 5IDWA 4FX4A 2HEOA 2Z5UA 3WTSC 1E7WA 2AMFA 4QXMA 2ZMEB 4DYVA 1I33A 2WYVA 3F1LA 1YW8A 3GFMA 1XSEA 4PZDA 5JO0A 2W24A 5L45A 1YQXA 2BGMA 1G3SA 2BYVE 2HYFA 4MVJF 3H3JA 3WWYA 4NBTA 4D41A 1YO5C 1A7KA 3GGGA 3K31A 1TNSA 4IGEA 4U7WA 1I27A 2HK8A 3OEWA 4OQZA 5GZ1A 2AEFA 2Q0OA 1Z73A 4I8XA 3FWZA 1GQYA 4AD9A 3EHEA 3K6JA 4WOKA 4CHUA 3K0LA 5L3DA 4EJTA 4LN1A 4J6FA 5GMOA 4TRJA 3WTXC 2ISZA 3DQVC 1HDZA 1XB4A 4NQZA 3QP6A 2YZ7A 4E4YA 3GWZA 4JXKA 3TSCA 3F8CA 4U8GA 5TX7A 4KMFA 1HQCA 1E77A 1PX0A 3Q9NA 5FI3A 3GZ5A 3P9CA 4RAYA 1IOLA 2VZ9A 3MTJA 2PFBA 1FWZA 1A7AA 1YJ8A 3K96A 3TOZA 4CUJA 4QQRA 3OJEA 2OO5A 2HK7A 3DHEA 5G0SA 5G2OA 2GQQA 7ADHA 2JPBA 2FPIA 3F47A 2VNAA 1HDXA 3VB2A 2PZKA 2NVBA 1IPFA 2V6MA 1DIRA 5HLIA 1JTVA 3PJEA 1GHCA 5T8KA 2H6CA 1K2WA 3U2RA 2B4RO 1KA8A 1IN6A 3GAFA 3QWBA 4RF3A 1F9NA 2HKOA 2P4WA 3M7GA 3LAPA 2PTGA 4Z9XA 3WSVA 4DIFA 4ESFA 1UHMA 2BHLA 4HX5A 3E5RA 1Q2XA 4XLNF 3MZHA 1K78A 3KBOA 5EERA 4BO5A 1R5GA 1Z75A 3ZMDA 2PEXA 4P8RA 3I4CA 5K5QA 2Y1CA 3DONA 3C7CB 2NUAA 5K9ZA 3HSKA 3G3ZA 3ZWWA 5AONA 2Z95A 5JNLA 3LLSA 5IDQA 1FK8A 1QPMA 1H94A 2I67A 5FFXA 3V1YA 2EXXA 1LNWA 1N7GA 2JFGA 2O48X 1ZO8A 4PIVA 1R23A 1J7KA 4OIRF 3GPIA 1FYLA 3P7NA 4BQPA 1ULUA 4PLVA 2D3TA 3KLNA 4CM8B 3DAFA 3RKUA 2V1XA 5IXYA 2DQ4A 1MG0A 4JBGA 4WKGA 3DMTC 1LQUA 1EQ2A 3AY3A 4J7CA 5A04A 1P4WA 1UZNA 3JQAD 2MLKA 1LBEA 1LLDA 1PR9A 4M74A 3JQ7A 3DBLA 4L18B 2WD8A 4BQAA 3K92A 4PZEA 4YVFA 3SLGA 5CVIA 4EJMA 3VH2A 1MV8A 5L40A 4L9JA 1AHIA 1E6WA 3DHNA 2HQRA 4AWXB 5KIAA 4D44A 3ZWCA 3BJAA 5I9LA 4II2A 1E17A 4LLGF 3KP6A 1I3NA 2CY0A 4UVCA 1Z7UA 3EUWA 1H9BA 3I59B 3S2WA 2P6SA 3T5XA 1S29A 4R54A 2BGCA 1R4MA 1ISJA 3TRIA 3JD2A 3ZU3A 1F4KA 4U6QA 2ADUA 3DOOA 5KVCA 4KFCA 1LJ9A 2NLOA 2ZIZA 2XXBA 3O4RA 4I98B 1K3TA 4OIOF 2RH8A 3JQ9C 2E7XA 3U3XA 4L8VA 4ZRNA 4CR7A 3PQEA 3DOJA 3RKXA 4LJZF 3P19A 2VWHA 3PWZA 4JK3A 5JAQA 2HKIA 4ZZDA 5DN9A 1ZRDA 1B16A 2PLAA 3E9MA 1QLJA 5J8CA 4FX0A 4HY3A 4B79A 1VTNC 1AXGA 1O3RA 2VCYA 4NK5A 5KKAA 4DRYA 4XQCA 4QO7A 1YS7A 2XASA 1PQWA 1QMGA 5ILGA 1B4AA 3HE3A 5BQFA 4GL4A 3PDUA 1MP0A 3M2TA 3RPUA 3TO9A 1X7DA 4EYEA 2FXAA 4U7BA 4WNIA 3E97A 4YIIA 4LD5A 1PGOA 2EIHA 1Q0QA 2B5WA 1O94A 2RBEA 4FFLA 3R60A 4TSKA 3RBXA 3OV8A 3WGQA 4MGRA 1W7PB 4YFXF 5LLQA 1KVSA 3RUFA 3KLOA 2NU8A 1PGNA 3HRSA 3DFGA 3NT5A 2YW9A 5DDIP 3VPGA 1U4SA 4I5DA 4E2XA 3GVAA 5DUIA 2FRHA 1IN4A 1FBSA 4NU5A 5JDIA 1HW1A 1U8XX 2ZQYA 1QYCA 4MVJH 1GADO 2HSDA 2XAFA 3GK3A 1KU9A 2KJCA 1XG5A 1EK5A 5EL0A 2XVCA 3H3ZA 5DT9A 1EUZA 1EMDA 3ZHXA 1E0DA 2YUTA 1U1IA 4CM7A 4KNYA 1MC5A 2FU4A 3VDRA 5HS8A 1YL5A 3E5MA 4MKRA 1X0XA 1UXJA 3E1KA 3Q3CA 4CQLA 1E6UA 2AQ8A 2YY7A 3E5QA 2X58A 1T2CA 2E37A 3KZZA 5ENDA 4DLLA 2C82A 4EJOA 1MUUA 1YW9A 4IPTA 1KU2A 3JQCA 5CFZA 3EZLA 4G8XA 4K1LA 2CVZA 2B4TO 2W2LD 3GZNA 3O8QA 3RJ5A 3HUDA 4XR4A 4DQ2A 1LU9A 4BS9A 3WTBA 1D8JA 4FFRA 4CUKA 1TQPA 1U5AA 3KP3A 4CGZA 1KYQA 3OF2A 1I2ZA 4KUMA 5L3CA 4DBZA 1E3WB 1O3SA 2DTEA 3C1OA 4X54A 5L7TA 4CV3A 1FT9A 1UR5A 2E49A 4Y67A 3KO8A 4XB2A 1KC1A 4RJTA 1LI4A 1N1EA 5L3EA 1GUYA 3IRQA 2NADA 4NHJA 3ZWVA 3N4MA 4XKJA 3BHIA 3DZFA 3GLXA 2LSOA 2GERA 5IXSA 4UV8A 3F5QA 1MXFA 3ZI0A 5KVSA 3DZHA 1O57A 4KIFA 4GGOA 2C5AA 1UB9A 2A69F 3QP5A 1P2FA 2QRJA 2BFAA 3WJ7A 1IN8A 3UW3A 2F5DA 4G81A 3RIRA 1U3VA 1P92A 2HRBA 4YJGB 4CL3A 5IN5A 5JS6A 4GPD1 1QO0D 4I1IA 2J5QA 4P4LA 1KEVA 1Z82A 5LEJA 1U3TA 4IHSA 2GO1A 4Q9NA 3MWMA 2B69A 4I0AA 4UXNA 1PJSA 4ENNA 4CZZA 1RZ4A 2IT0A 2DLLA 2X4HA 5LGUA 5KOIA 3Q11A 3F22A 2ZTUA 4WX9A 2Q2VA 4WJZA 2DTRA 1T26A 1H93A 4BKRA 1PS9A 4UVDA 2O61A 2DFIA 3FCOA 3GN1A 4FFNA 4FOOA 4WEOA 2HDCA 1LEBA 1D8AA 3AOEC 4PZCA 1PWZA 3JSOA 4YR9A 1MGOA 3DXJF 1Y5MA 1NFRA 4W9NC 1DRUA 2RV8A 1O89A 2R6JA 4HDVA 2OU2A 2XAAA 2ZB7A 4XA8A 1AUPA 5DD4A 4R9RA 2IJLA 2WMDA 1IW7F 4WXHA 1X13A 4I5GA 1G0NA 3FWNA 3LYLA 1CF2O 2GLXA 4RPGA 5TC4A 5L53A 4QWQA 1NHAA 2K4JA 4D0SA 2JAHA 1HETA 4YAKA 1LSJA 5FD6A 2D4AA 3EK2A 4UEKA 2HWVA 3LVFO 4Z6KA 5KJFA 2NAZA 4YAGA 4GLOA 2UAGA 2M30A 2COMA 2QYTA 2FBKA 4UVBA 4LVUA 4ND3A 3ONDA 3W6ZA 4ND5A 3BTUA 5CP8A 3VZRA 4E3ZA 2C59A 2EA2A 1P1FA 2EV5A 3F6VA 2I65A 5ILVA 2X5KO 2F2EA 2PKRA 1VI2A 2QG4A 2EFWA 1V6AA 2GDZA 3I23A 3GW2A 4RGXA 4MVJE 5IF3A 5HLGA 1KETA 2TMGA 1ONOA 2OXIA 4CMKA 3ABUA 1QRRA 4YFNF 4K6FA 3ROPA 4IS3A 1W0CA 2GXGA 1ZG1A 4GSLA 3O2PE 5D5VB 3MTGA 3ADPA 1V3TA 3SFZA 1TQIA 1YQDA 5COAA 4D0PA 4KN4X 4AIJA 5TJHA 1W6UA 2CNBA 3C85A 1JQBA 3LC7O 1FBQA 2MLGA 1H6BA 4Q4ZF 1WW8A 3GUDA 5TIIA 3OA0A 3SZTA 1KYWA 2VHXA 1HKTA 4BNGA 3ML6A 4EGYA 3PRJA 5HA5A 4XEHA 2LF8A 2WSBA 2EB7A 1SAXA 1QR6A 2FA5A 3OJLA 2C2YA 5F1RA 4R51A 1IE3A 2G76A 2JKVA 3VH1A 2VWGA 3IDSA 3OIFA 3FNHA 2VYVA 4MINA 3DP7A 4JNKA 1R4NA 3UOGA 1X3UA 1C0KA 3HNPA 3JYPA 4GGPA 4XYMA 4LLNA 3ANNA 2NRAC 4M89A 2GZ3A 2PA3A 4QUKA 1EH8A 2BLLA 2W2KA 3U4CA 1BC7C 4B3JA 2F5EA 1OYWA 2NS0A 1K78B 3L6OO 3NDIA 3DR3A 1XD7A 4L73A 3O38A 2CFXA 8LDHA 1EVZA 2CG4A 1ZGJA 2PNFA 3RASA 4BO1A 2F5FA 4CLEA 3E48A 3ENKA 2RNJA 4CLRA 3J80Z 1BSVA 2QHXA 4PGFA 1HDOA 4ZQGA 4M86A 3PYLA 3VPHA 4INAA 1A4UA 3MCZA 2OBNA 2V1UA 4AJNA 1ZIDA 1HWYA 4GSKA 1IZ9A 1YW7A 2AA3A 2ZTVA 3NV9A 2F1KA 5AYVA 4XSXF 1M75A 3OSUA 4AG3A 1JKFA 1BIBA 1WRJA 1MG5A 4GYIA 5EEHA 2O50A 3F72A 2RHCA 3C7DB 3DWFA 3LC1O 2WE8A 3ENNA 4CR8A 2XKPA 2EERA 1ADFA 3JQ7B 3SJUA 5BPIA 4N18A 3ZN0A 1D5VA 2NSDA 1I1GA 2WV0A 3MQ0A 1REPC 4NK4A 2H6BA 2ZKZA 1PL6A 3NDRA 5I7FA 3AM3A 3RI3A 4BH9A 2WTEA 3PYMA 1K7AA 4NBRA 3ZNNA 3CXRA 4ALNA 3GMDA 1R4MB 4TRNA 3RFXA 3RTRA 1LXCA 2EEZA 1U5TA 4HXYA 4MO2A 2QRLA 4I02A 2UZKA 4PG7A 3WJAA 3ANLA 1FY7A 4R1HA 3QRFF 2LF7A 4IZIA 5EPOA 2DU9A 3TQHA 4G7ZF 2E82A 3NRVA 2H63A 4BB5A 4XBFA 1HE5A 3J80K 1OOEA 2EP7A 2UUPA 3MWDB 3MJEA 4P96A 4IQGA 4O1MA 3AM5A 3SC4A 4PGGA 1NPTO 1AOYA 3RUIA 4AJHA 4E70A 3M6IA 5A3VA 2ZQZA 3HB5X 3WMWA 1H9TA 3O9ZA 3EW7A 2HS5A 5E1ZB 4S3MA 4AVPA 1AXEA 1G6NA 2O4UX 4NR0A 5TSDA 4RF2A 4TKMA 1U2DA 4C7JA 4OAQA 3EUHA 3UKOA 1P31A 4O5OA 1LSUA 1KC3A 4HUJA 1O3QA 4MTDA 2ZK7A 2GZ2A 4PVCA 3C7JA 4HADA 3Q9VA 1PUEE 5CVRA 4R3WA 1JHFA 2W25A 2ACJA 2D45A 1BXGA 1H2HA 1WWKA 3B1KA 4DWVA 3TN7A 5D8KB 2WYWA 2Y0MA 1X7GA 3S1LA 4LGWA 3K9TA 2UXNA 4PLTA 5A02A 2DI3A 1DFHA 2IEBA 3R3JA 1L1FA 5DV5A 4E5YA 3G49A 3KP7A 2RN7A 2P4HX 2O23A 3AI3A 2YV1A 1QG6A 3H6KA 2RVCA 3LU1A 3ORFA 3ZWXA 3ROUA 1UP7A 3FPCA 4E6PA 3V5NA 2XRNA 4URFA 1G6KA 5ERIA 1ZK1A 4CR6A 1SBYA 3WYCA 2OL4A 5JR3A 2AG5A 2NTVA 1R1UA 2FPGA 2ZJ0A 3GN2A 3GVIA 4RL6A 5HDGA 1OI7A 4KUHA 2P7VB 4CQLB 3GT0A 1K6XA 3LSTA 2BI7A 4BHTA 3RKWA 1E6EA 4LMYA 1ZGAA 1H9GA 3W6KB 3ZCXA 4FBGA 3PHLA 1ZRFA 1V3VA 2C7VA 1B15A 3GRKA 1LSOA 3JD1A 2B0JA 3GZNB 3O8QB 3IWZA 2KKOA 3KCCA 1KU7A 2M5WA 5FF9A 1CWUA 2G5CA 4IJWA 5FFZA 2I66A 3T4XA 2HTJA 1HSTA 3VZQA 4R1SA 2L01A 3GHYA 4YAJA 3ONFA 3F6OA 1ZG5A 2O3UA 4N5MA 5HDNA 2QIOA 3KE2A 4RB0A 3I6QA 3LQRA 4OQYA 2OD5A 1ZMOA 4XCVA 3ZHBA 2VT3A 2W85A 1ZK0A 1P1KA 1R12A 4CDGA 2AEMA 1XSVA 2GN4A 4M6XA 3WGZA 1Y8RA 1WXDA 4U0JA 1QNTA 1QYVA 1U7HA 3WGOA 3EC7A 4KICA 1ZXLA 4O5VA 4BNXA 4YRAA 1YG2A 1HRDA 5BSGA 3LLVA 1DC3A 1PP7U 3EYIA 4PZJA 2YX7A 1E5QA 2ZCWA 3ZQ7A 3L0DA 2B0LA 5B4TA 2B37A 1WPQA 3SZPA 3I54A 4ZQHA 5LHHA 1NNUA 3V7RA 1VKNA 1Q7CA 2BGKA 3WGGA 5E17F 2EKQA 2YDYA 3RKRA 4AJIA 1EVJA 7MDHA 2P6TA 2PN6A 3DTTA 3L9FA 3WYEA 1J59A 4IMRA 4F46A 4JCOA 3H3FA 3RDIA 1NPDA 4YJHA 4MQVA 2D5CA 4IM7A 5DCFA 1QZZA 4ITUA 3ZW8A 5AQ1A 4RV9A 2WWYA 1P45A 2FR1A 2DO7A 4MP3A 1PSDA 1FSEA 1FJHA 4AJ4A 5I8WA 1E3LA 1LEAA 4LG0A 1E3IA 1X14A 1YDEA 2O7QA 1BI0A 1OBFO 2Q2WA 5IZCC 2STTA 2EGGA 1A9ZA 2O4CA 4MQ9F 1HDCA 2A92A 4B7XA 4WXDA 5I7EA 4PLWA 1H6CA 3K1NA 4G94A 2X0IA 3BMCA 3PP8A 3JQ8A 3JQAA 5A9TA 5CVUA 3GNSA 4OMZA 4H0EA 1T2EA 4OH1A 3JQFA 3HHHA 4E2YA 2Y1OA 1OMIA 2V79A 4ZICA 4O6JA 1I6XA 4BNCA 2BFMA 3JQ9A 5EJ2A 3DF8A 1LQ1A 4EJ0A 4KWIA 1P44A 1SOVA 2CZCA 3SVTA 1FF9A 3WTYC 2GCGA 2V6CA 3CUQC 1Q7BA 2CF5A 2J3IA 1MB4A 1I36A 1QYXA 4HBGA 3RROA 4EGFA 2P9EA 2C2XA 2IDZA 3AK4A 2AW5A 4MIEA 1ZHFA 3REOA 1XSDA 3OJFA 2EW2A 2DT5A 5FO5A 4TRMA 5AXBA 2DAPA 2W90A 3W6UA 4RZHA 5CDTA 3H8VA 3BY6A 5T64A 3D0SA 5CJ9A 2WDZA 3MOIA 2PD4A 3WB9A 5CDSA 2Y75A 1UAGA 4A7PA 2Z9OA 3M8FA 2K7LA 4CLOA 2I5PO 3I4FA 4FB5A 3T0YA 3DFZA 1YGYA 1FOKA 2RC4A 2V1DA 2RGVA 4YWJA 2FSWA 4P55A 2XHKA 1C3VA 4UVEA 3JQGB 4Z3KA 3EQLF 2OFPA 2BV6A 2DU8A 4Z0TA 4EM1A 3FWEA 1C1XA 5H6QA 1R4NB 4NBUA 4EJUA 3HIFA 4P38A 5B37A 5JE8A 4P9UA 1P1JA 4BNFA 2O3FA 1AE1A 2NVWA 5DF1A 5U4QA 5H81A 3ASVA 4KMUX 4WECA 1U8FO 1TLTA 3CKYA 4OJNA 1OYIA 5ER6A 4CLRB 1VJ1A 2P7CB 1HDYA 3ERED 4OINF 1DHTA 5LRSA 5GZ3A 1DAPA 4LK0F 1YYVA 4BHPA 3MCVA 1YDWA 4P22A 4ZQEA 2MA3A 1LDNA 4XGKA 2D5AA 1ISIA 1AHHA 2ZFWA 5BSFA 2FQ3A 1N8KA 4BO6A 5AXDA 2O2YA 3TDUC 4WUVA 1C1DA 3STHA 2BF7A 4LCJA 1HE2A 1L0OC 1SO8A 2JAPA 3BMNA 2YU3A 2CO5A 3NT2A 4H7PA 2STWA 1EFKA 4XDZA 3I5MA 3RQSA 4KIBA 1UXHA 2P5UA 4YJFA 3ZU2A 2OGUA 4A73A 1B59A 4JQCA 3CINA 4ZVVA 3KSZO 3HOTA 1UXKA 1J0XO 1NBOA 2EJVA 3EY4A 3N7UA 2VBZA 2QM3A 4R1UA 3I5UA 1JVBA 2V7PA 3TQNA 4M55A 4U7DA 3TOBA 2EV6A 3K5PA 1ULYA 2CYYA 3PLNA 4BOYA 4WCFB 3I58A 2W2LA 2I3AA 4R69A 2VNSA 3OH8A 5ES3A 5TQVA 1PGPA 4J1SA 3RSHA 3UGKA 1U5TB 3PFWO 3R3SA 1GY8A 1HYGA 2Q1UA 3UH1A 3QPHA 4E30A 1JKJA 1ISMA 4L5IA 4CICA 5L4SA 3V4GA 2CVQA 5A03A 2YQ5A 3KLPX 2FBIA 4PLFA 2H27A 1E1NA 5JDCA 1NHGA 1R22A 3GMSA 4WLVA 4A12A 4B4UA 4DQVA 3BOQA 5JLAA 4D45A 5CEFA 3WFJA 1YFHA 1BOAA 1TT5B 4Q47A 3UAGA 4OXYA 5D6EA 4XSZF 4RB2C 2EKLA 2Q99A 3L9WA 1I3LA 1PQUA 4YEDA 3I53A 4KDEA 3SBOA 3ZWPA 2Y93A 1QXSA 1KY5A 2P9GA 5BSHA 1G3WA 1SOWA 4L4SA 2FOIA 1KU3A 1NAHA 1VL8A 2NTNA 3WGTA 3ZNPA 4W9NA 4E5PA 1BXGB 3UVEA 4I0BA 5EESA 3W8DA 1M2WA 3Q6IA 4P4NA 4CODB 4PN3A 4P5OA 3CO6C 3RCBA 3A14A 5T6BA 3VC7A 4CMGA 1Q1HA 4GO1A 1KEUA 3IC7A 9LDBA 1BVUA 1GZ6A 4N5NA 3FMSA 2Z1NA 1PEDA 4M6YA 1HL3A 4BNYA 3RC1A 2IW5A 2FZWA 2YFHA 1Z6ZA 5BT9A 3F9IA 4CQMA 3GPDG 1RPNA 1YBVA 2FY8A 4EUEA 1L7EA 4U0KA 1PWXA 4NHEA 2XAHA 4D46A 3FSRA 2WEKA 4LW8A 1B0AA 1JKIA 5JI6A 3PWKA 3BHJA 1XMKA 2DVMA 1KIFA 4XRGA 4L9NA 1ZUD1 2ESNA 4Z9FA 1DDNA 3I0TA 2DUUA 1LDGA 5JC1A 5C7LO 5TRDA 1R0LA 1D1TA 3WTTC 3TOXA 1ZARA 1WAMA 2QRKA 5JAIA 2L4AA 5JVTA 2EGHA 4OU0A 1VSVA 3PXXA 2EV9A 5DULA 1Y7TA 1ZEMA 4GX5A 1WMBA 4A0ZA 1HBXG 4CM9D 4L0QA 3LT0A 5CDUA 4KDPA 2E48A 4Q3DA 2A68F 4S04A 1HYEA 3S2FA 1C0LA 4Y17A 2J6IA 3QV1A 5H82A 3X2FA 1ADGA 4E33A 3M1AA 3H4VA 1Y8RB 2AE2A 2Y1DA 1OZAA 2DQLA 3NQOA 1IF1A 3JYLA 1LRJA 4IDEA 4E5KA 4IRGA 3AAFA 2IRFG 1E1LA 4FJ1A 1MJBA 1B8PA 2HMWA 3UCEA 4BL5A 2RHRA 5KVQA 1TLHB 4RF4A 2FNPA 1WNTA 2IPQX 4R1TA 5BNIA 2VONA 3G79A 4YPOA 2VC1A 2ZYGA 1VL0A 1DPUA 4JIGA 3HB4X 5L95A 1ZSYA 1V0JA 4NG5A 3F8BA 1H5QA 2X9VA 3VPXA 2VWPA 3U9LA 2RH4A 1ENPA 1LC3A 4HF0A 1HE3A 1JWBB 2NM0A 1RM4A 3AUUA 1DPRA 1SCUA 4RQTA 3V2GA 3LK7A 3TO6A 1PZHA 3B6ZA 3QA9A 2H09A 1KY4A 2AXLA 1S7CA 1Z1DA 5EN4A 5LRRA 2BH9A 3DAPA 1T0FA 3D1LA 3BZ6A 2AQKA 4MEXF 3H9QA 1MX3A 4ILKA 3W4KA 3LQFA 5ICMA 2X7HA 4PFJA 5DUKA 4DGSA 3CPSA 4ALLA 2VOOA 1ISGA 3TFOA 1R37A 3PEFA 3VVCA 2OA4A 3SXYA 2HZTA 1DRWA 3HZZA 4KUEA 4IJKA 1SZJG 4NI5A 4PVDA 5LDGA 1XIVA 1LEHA 4OGWA 3ABIA 3C3WA 4WWCA 4LG0B 1DJQA 5I7SA 4N5LA 3S2EA 2Y48A 4OXKA 4MDHA 2JL1A 3L00A 1YS4A 3ZWAA 4QTZA 3KZVA 1B3BA 2VUTA 4R8HA 4ID9A 5JBIA 3G3EA 2B36A 3JQ8B 4XQEA 2RKHA 2XKOA 1JXSA 2WD7A 1N92A 4E0BA 1B1BA 2PZLA 1B8VA 3D4NA 4MP6A 1F17A 2GA1A 5J6XA 3D64A 1P4AA 4GH5A 1HT0A 5K5RA 1UP4A 2G0TA 3MJVA 4YRBA 3HSFA 2QQ5A 3DO5A 2NNNA 3HFSA 4W7IA 1FSHA 4OKNA 3WSWA 4J4HA 3E6AA 2HK9A 5TT0A 4DUPA 2CDBA 4DPKA 2VXZA 1U28A 1JLLA 3DB2A 1RUOA 4E32A 1NQTA 4HKTA 3OOPA 5E20A 1KVRA 3LZ6A 1USSA 3QU3A 3FHLA 4WLOA 4GVLA 3ICPA 1XSXA 3CUOA 4JK1X 2R3SA 3EGOA 4NB5A 3PQKA 1QP8A 2ESHA 5DD8A 1EH7A 3HDYA 1RM0A 1GCOA 1Q0HA 3IQDB 2JCYA 2M1BA 1A5ZA 3I4PA 1BRMA 4CLOB 3O03A 1GPDG 4A5NA 1KVTA 1U3UA 4E2WA 4YAEA 1IHYA 4LLLA 3F5SA 2G7UA 3ZMVA 1W8DA 3I9JA 3WX0A 4OHUA 3WBBA 1MD0A 2YSRA 3HYIA 3QWFA 2CF6A 2PFGA 3QVSA 2M45A 2OQGA 4ALJA 1KQ8A 3H7AA 3LT1A 4EV0A 1JAYA 2EW8A 3F4BA 3K73O 4BGUA 3U0BA 4DTIA 3WTVC 1Y9AA 4H3VA 4GX2A 3VZPA 1LDKB 3KSDO 3G1UA 3S8MA 4K28A 1MFPA 4E12A 1WP4A 4BMSA 2BMAA 4L4RA 5F3RA 5ER9A 4XB1A 3H3UA 3WNVA 1SD5A 2QUFA 5L3FA 5DCMA 4BMNA 2DFDA 2NU6A 3BPVA 5F64A 4U0YA 4IUYA 3TZQA 4BKUA 4ZJUA 3DPTA 1T2DA 1PDNC 4IQ8A 3ZV5A 2EFOA 4ND4A 3ADOA 4D3FA 1BI3A 3ZWBA 4M9SA 2FNAA 3ZWNA 2VYND 3HRMA 3AW9A 2OP1A 3DTYA 2WE7A 3DXFA 4XYEA 1EE9A 2DPGA 4BXUA 1PJLA 1U3EM 1F8FA 1SMKA 4JBIA 5T5QA 1PP8F 4LVCA 1C1DB 4LRTB 1QKIA 2ZJ1A 5THKA 1GU7A 3V8BA 3ZN2A 4CMIA 4HX7A 3BMNB 3DZKA 1BG6A 4I9UA 4O63O 4HP8A 1FMCA 4LFUA 5E18F 3WXBA 4YJFB 3IL2A 3WBFA 4S05A 3HADA 3OHSX 2FSSA 5J23A 1MZBA 3WS7A 1B3RA 2KJBA 1XA0A 4C4OA 1CIVA 4CMEC 1H0KA 5CYVA 3OP4A 2VOPA 1F12A 1TA4A 1EFLA 4ZRMA 1PL8A 3WR5A 4J7UA 4DREA 1K89A 1CJCA 3R0IA 3J81Z 4XDYA 1J5PA 4L5JA 1E3SA 4LB6B 4IINA 1TI7A 3QU6A 1BTOA 4XWYA 3KM0A 1YO6A 2KRFA 2GZWA 2I99A 3AY7A 3TZHA 3VTFA 3ASUA 1P74A 3HOSA 3KYCB 3FD8A 5HLHA 1FYMA 3MEQA 1ON2A 2PG4A 3QVWA 4G65A 4BGVA 2PKQO 3FNFA 4ALKA 3UFXA 4BNNA 4ESJA 3GGOA 4A10A 2P5KA 1E3EA 2HCTA 4IRIA 4N7RA 2O6GE 1STZA 2AHRA 1JHHA 4BB6A 1GTMA 2PD6A 1HSOA 4BNWA 4B3IA 3F46A 3INGA 1BVRA 1Y5RA 3PIIA 3JYQA 3IKVA 1PJTA 4YJDA 1DSSG 3SC6A 4DMMA 1SEVA 1YB4A 1B2LA 3Q1LA 2Q1SA 4XYGA 3SHFA 1LA2A 5DP2A 4GWGA 5E1XA 4WPGA 4HDUA 1IXCA 3AFMA 3QPTA 3L07A 4BO9A 1OYYA 6LDHA 4A27A 1XDUA 3Q0EA 1G4DA 3NTRA 1PJQA 5JYDA 3M1EA 2Q1WA 3KV3O 3FRJA 4BO7A 5KWEA 3U1DA 1DPGA 1M66A 4KN7X 4QFCA 1HW5A
chains in the Genus database with same CATH superfamily
1T2VA 3IUOA 2P91A 1MAAA 1WDKA 2D7CA 3HJFA 1S4MA 3SWWA 2JIRA 4KE6A 5ESXA 2QVOA 5D1HA 2GYVA 4N65A 5CLIA 4H6WA 2CUEA 1X2NA 5LZ9A 3Q5FA 3RWBA 3VR5D 3ZGNA 1G3UA 3RPQA 1NH3A 3A3KA 4X1YB 3MAGA 4UMFA 3ESDA 3HHPA 2P9BA 4K3UA 4S24A 2GR9A 2HB6A 1VPDA 2IYZA 3UKGA 2BGNA 1E9VA 5ALLA 3CUTA 1BHSA 2UZ4A 2OAZA 1A71A 1SEPA 5FB3A 4FQ8A 3E9YA 3JTMA 4MIOA 2GK7A 4X66B 4P5PA 4GKJB 3WNZA 5IAGA 4IXNA 1WXQA 1XEFA 4Q3AA 2IA2A 5CBKA 1E7QA 2VSFA 4QHTA 1U9OA 4AIHA 2R87A 2F00A 1W0JD 2GRUA 2XVZA 4FT8A 3FGNA 3L5OA 3PFFA 3J7YJ 1RAEA 1PDVA 3PHJA 1N5RA 2OO5C 3ABSB 4I36A 4QJ3A 1N9GA 1JLLB 1TTQB 2YDXA 3TSWA 2LXNA 2AC7A 1JDPA 2AMJA 1TGYA 2ZULA 4MRPA 5AOVA 3JRAA 1KZ4A 1KFBB 4HZUA 5TPZD 2JPCA 1NQ5A 4IXAA 1DXQA 2R11A 4D7MA 2I87A 1FRQA 4HVLA 3R20A 3GAZA 1U7OA 1FB5A 2V7EA 2W00A 3LX4A 2L7FP 2CSXA 3H5NA 3HJAA 3D3JA 3RW9A 1Y3DE 2FWJA 4M1SA 2CMPA 2HTEA 1EFRA 3U7GA 3PXCX 1F2UB 1BRTA 3O8HA 3I62A 1ZJZA 3FNBA 4CKCA 1ZDMA 4UMEA 1WZIA 2G1UA 3X1XA 4NPAA 3BF8A 4MRNA 4CUZA 3TTYA 4UNOA 4FHCA 1ZVKA 4U3JB 4C0JA 2PUHA 4DBLC 4B3CA 1YZFA 3FXLA 3W5VA 1YCGA 2HZDA 3A01A 4KYWA 3I3OA 2YFQA 2IEZA 3H87A 4O2BA 5TQ0B 4J9VA 5B12A 2R1TA 4C7OB 5EIOA 3LOUA 4DA4A 1ZYRF 3R3ZA 4JJEA 2MC4A 1J5XA 2ZPAA 2K4BA 2Q7OE 1YJNI 1WSBA 2G1AA 1W1IA 3K9WA 3N8GA 3MGKA 1OU4A 1WIWA 5C4JJ 1QX3A 5KJ1A 1GL7A 3BXXA 1BI2A 2DA2A 1DKOA 1Y9EA 1SQSA 4P58A 1OLOA 2X5OA 1NVTA 1N6RA 1Y33E 1H3EA 4AU1A 2ERXA 1Z05A 3QQPA 3ZWOA 5IARA 1QJCA 4XVRA 2OHXA 3T35A 3ETDA 4HEA2 1R8QA 3O9MA 3OKAA 1DJOA 5K8TA 5ILUA 3GFIA 1S2MA 4CO8A 1VDZA 2I91A 5G41A 4LQCA 3SM3A 4DAOA 9ATCA 4RYLA 4YWHA 5ESWA 2Y69H 5K0EA 1AZSC 4D42A 3FMVA 1HC8A 3CUYA 3CESA 4Y8VA 3LA8A 3BWYA 1S2GA 3FM3A 4AIRA 1EESA 1X9GA 2ZBDA 3E9ZA 1P62B 2HX1A 2JJ7A 1SFOJ 5EXPA 3C3PA 4Y0NA 4E7OA 2HAEA 1JHAA 2P7HA 4GBMA 2V4ZA 2WTUA 4HOBA 3TDKA 4TSFA 3AM1A 2Y6VA 3E7WA 2PT9A 4EHFA 4TLAA 4RLQA 4YBZA 1ZK4A 3O92A 1ORDA 4QNMA 4RD2A 4QUEA 1T39A 2J3KA 4Y1GA 1RI4A 2JC3A 2I2AA 2LR8A 2IZZA 4YV7A 3ZY6A 2JJ8A 4K9KA 3T8RA 121PA 2LR0A 2CEKA 5IPFA 4EYSA 3BC8A 1L8OA 4W4TA 1Z68A 5KWJA 1E1CA 3TOAA 1WDWB 3KQYA 1ZREA 1XP5A 4IUDS 2ZSFA 4G2TA 4ZJZA 4AN0A 4ASNA 2GCNA 3IAHA 3SVZA 5B58C 1E6KA 5EJGA 2COUA 5C8YB 1GKKA 3NTVA 2BY1A 2G04A 2OV3A 4M0LA 3GMTA 4ONEA 2ZIEA 3RT1A 5M5YJ 3GC6A 1U80A 2FE1A 1KSGA 4Q82A 1Q1QA 1XP8A 3VJMA 2J6CA 1BD4A 4GOKA 5IJZA 1R0KA 4FVTA 1NATA 4AG5A 5AIAA 4J1NA 1TF7A 3MBIA 3RTBA 2NUPB 3UT5A 1B0PA 3QPCA 4LIPD 3GVCA 1JHZA 1X4PA 2ZJ2A 4L8LA 1ZAOA 4TRRA 1WKBA 1JU4A 4C2TA 3EAGA 1FLIA 4PRKA 4AP6A 1TKCA 1LNQA 2BL4A 2VTKA 1BX0A 2CXHA 4IS2A 1T98A 4R2JA 2HYIC 4LK1F 5DGDA 2QLZA 1YH3A 1E3MA 2X4LA 2GEBA 3AL3A 1T9BA 1A9OA 5A5FA 3QOEA 1R10A 2E4AA 1FZQA 3RYIB 1TCBA 3MWDA 2BZTA 5C37A 2NPOA 2XTMA 3NNSA 1R6DA 1L7XA 4OP3A 5LA6A 3VR4D 2ZWAA 4MGHA 5ITWA 4ZVKA 4EATA 3RAJA 4COKA 3K8ZA 3RUEA 5EQJB 2MGQA 4R3NA 1EWYA 2IV7A 4BDYA 1T6YA 4MPJA 5HOOA 1RYYA 3ZV6A 3CCRI 3AQIA 4OB7A 2O3JA 1ID8A 1R18A 2HTSA 4O4LF 4OLHA 4KDFA 4ER6A 4Z1OA 1G5TA 2VJKA 1TJ5A 2I3BA 2UV8A 1WX1A 3FBNB 3ZDXB 1R0XA 3EPRA 2ZJQF 4HO1X 1V11A 3GLSA 3T7EA 2FLVA 1I2AA 5LHIA 1NE7A 1IG7A 4FGWA 3PCRB 2A1IA 3ZMUA 3TX6A 1USTA 5MN5A 2GCOB 2C7PA 3PUJA 3NVKI 5IEJA 4LIUA 1BA2A 1KFEB 1XVUA 3IKTA 3W4IA 1KY2A 3HYRA 2GHTA 5L4LA 1UHWA 3L5KA 3ON5A 4DQKA 4IMPA 1ON1A 1DRVA 2VEDA 3IHUA 3IIJA 1GQFA 2YWEA 1FFXB 1O03A 5C52B 5LLDA 1YGPA 4BRWA 2PXXA 2R84A 1CEEA 3GEDA 2V3CC 4LZJA 1L4NA 2QVCA 5H83A 3BGOS 2Q3CA 3EULA 2BIFA 3U39A 4J7XA 4HX4A 1M34B 1Z4IA 2DCUA 1OH6A 3N6XA 2IWRA 1NLYA 3C6BA 3F7OA 3ESAA 3KELA 3I9V2 2R5YA 4MTEA 4XSGA 3CLOA 3R2JA 3WADA 1JDZA 2I33A 2DR0A 1JUPA 4JBNA 4LSZA 4E46A 1GRNA 1I8TA 2FP4A 2YYAA 1T0PA 4X24A 4OVKA 4RZ2A 3MYRA 2H92A 1T35A 3L1KA 1MJ9A 1NF9A 5AJVB 1XJWA 2FZ5A 3OYDA 4OIPF 4D6XA 2RGRA 1EK6A 3W2FA 4BL0B 1SKQA 3GPCA 1Y80A 2WT9A 1QV7A 3TDZC 2PZMA 4E13A 2GILA 2GLOA 4B8WA 4R16A 4D3DA 1X7HA 2PMUA 2IXGA 2OILA 2R48A 2XCIA 2BEUB 1O54A 1Y56A 5A5EA 1ZW6A 2JIQA 5T3YA 2XCQA 3JYNA 1X6VA 3O3OB 5ALWA 3I3SR 1Z7BA 4K9DA 1LZKA 3FOFC 3DQZA 5HS6A 4Y2SA 3SS8A 2QRQA 3FIUA 4TVKA 3UFXB 2OSBA 1YR8A 5CAEA 1G9TA 1M6HA 3LQ4A 1OAAA 1V4NA 5AIPA 3ERCA 4Q3KA 3CNHA 1P5RA 3MN1A 1O87A 2QMYA 3LT5A 5HHTA 2DJ5A 3GEIA 3M1IA 2GZMA 2XB4A 3NUQA 3CNOA 3HL0A 2FPSA 3EFOA 4A3IJ 2YHUA 3Q7RA 4OJTA 2AZTA 1RYDA 3QWAA 4PZLA 1GGVA 4QFMA 3CUQB 5P21A 4EHNA 2H07A 4ILEA 2V9KA 2W57A 2PANA 4I9NA 2VOJA 5KJCA 3STTA 3R6WA 2WJAA 3IJEB 3MMSA 2FMLA 3CQZJ 4JYAB 1P1BA 2AQEA 1F43A 4ERXA 4QBTA 4COOA 4NENB 1RM3A 4HEHA 4PBSA 4JN6B 3ACDA 2LV8A 4CNQA 4LE0A 1N3IA 3CO7C 4UJ3A 4MYCA 4KMSA 3W90A 1I30A 4FDTA 4DM3A 3E1GA 2R751 2HBYA 4H7HA 5CT6A 1Q7EA 2VYVD 1HT3A 3MXOA 1XZAA 1T5IA 3VR2A 2JI6A 4G1UC 3WSTA 1VJCA 3Q5DA 4JLJA 3A1YA 4V0NA 1E6LA 3PVCA 3BR5A 1VHQA 3HM5A 1AGRA 2ZUUA 2XB0X 4B74A 3UJ3X 2R96A 1ESNA 3MW8A 3MA0A 1BW5A 2C5GA 1NXTA 2QRHA 2L7MP 5JTTA 1T38A 5BWNA 1XTUA 1LPNA 5BMOA 5IZ4A 2I3ZA 3DAHA 3H1CA 1FEZA 3V7FA 3EXEA 4QBIA 1TCVA 4GVXA 2Y66A 1PR3A 1UKAA 2XNDA 3GARA 3R5XA 5A0FA 2HF2A 2LDXA 3PUVA 2NW6A 4AP9A 4LJRA 4DIDA 4QSMA 5DS9A 1DWUA 4ZZ1A 2ISSD 2PV7A 4HI0E 4AUKA 4Q37A 1RWBA 2EHJA 3TJRA 4BFWA 1U3CA 1B76A 1Z5WA 2XHZA 4EUHA 4OLJA 1XEXA 2CUKA 1N5MA 2VPXA 1CUGA 3U44A 1YW8A 4MVJF 1DWPA 2E55A 3WWYA 3T4PA 3OEWA 3EX7C 2D62A 1NRIA 4TRJA 4BVGA 4Y2UA 4B2LA 2A0YA 5B2EA 3T1NA 1NNEA 4ETMA 2QV0A 4PHHA 3CCYA 1HK7A 1NLZA 4HVCA 5LB4A 1EEXB 4R7GA 1GHCA 3NEAA 2W6ZA 2PVSA 4Z9XA 4MHSA 5EIFA 5K6RA 3O83A 3S7TA 1F2VA 5E4JA 1FMFA 1FSFA 2XDVA 2COBA 3PA6A 2XNJA 2DQ4A 1LKXA 1EQ2A 2WILA 4BYMA 1Z7YA 2NZ8A 4OHOA 1JECA 2HQRA 1G8FA 1FJLA 3F8TA 2GZSA 1NLUA 4U6QA 2HOSA 3A1CA 2YIDA 3GGDA 1LJ9A 1H89C 5CH8A 3PQEA 5EYPA 4YHBA 5A5VA 4UCFA 2NUTA 3RTEA 3LX5A 1EGHA 4V3CA 1ZGHA 4AKTA 1JHPA 5HGJA 4XJVA 3RS9A 2ZSBA 3A6GA 3M8KA 2IS6A 1KVSA 4NMXB 5EY5B 3NT5A 2YW9A 1JI0A 4E2XA 4P32A 3HY4A 3AUJB 2PX3A 3IQEA 3BERA 3INYA 1U8EA 4BRUA 1KU9A 1XPUA 3ONVA 3TMKA 1E2NA 2GS9A 5HS8A 4CKYA 2A84A 3M5CA 4ZGBA 2B78A 2A9VA 1YW9A 4G5SA 1YMVA 4DCNA 2J67A 3MG9A 4I3GA 4JVLA 3ZV7A 3FH0A 5HW0A 3GH1A 4GI3A 4KIFA 2PN1A 4X3CA 3RIRA 1ZM3A 5JS6A 5IN5A 2XLBA 3AG4H 2AVDA 2J5QA 1O08A 1EWRA 3MWMA 2ALJA 5KOIA 3HCPA 4EW3A 1IRZA 4QGGA 1AQLA 1LEBA 3JSOA 1D2NA 2JKYA 1XMPA 3JAKA 4RYDA 3FWPA 1CF2O 1GWNA 4KXFB 2CCJA 2GFIA 4Q66C 2D4AA 1Q77A 5ITSA 2Y3IA 4G89A 3K4NA 2VDMB 3PI6A 4M3FA 1QFJA 3R5FA 2JCGA 1V6AA 1UZAA 3ZKWA 3OVMA 2WJHA 3IHLA 1KYTA 2X2PA 3SOZA 4QJIA 4PC2A 1K9SA 1HKTA 5HA5A 4GQIA 3NYIA 2PX6A 4DT1A 2QTRA 2VWGA 3IDSA 2NTYC 4EFLA 3RVBA 4PANA 3CRRA 1ZGJA 2YJTD 16PKA 2W8BB 3AEKA 3D59A 2H7VA 2ORWA 3K6KA 3U3DA 1T0FC 1JKFA 2XKPA 3JQ7B 1QPIA 2FPKA 2WV0A 3IB6A 4U02A 2WTXA 3VKHA 1Z5VA 4H3SA 1U5TA 2IUSA 1J8MF 4BY1J 4XBFA 2QLNA 4FOTA 4IQGA 4PGGA 1AQJA 4ER3A 4H59A 4QPJC 4L85A 3DPSA 3IPXA 2BKVA 1LY1A 1I7NA 4IO1A 2VJYA 3MM4A 3QEOA 3S2UA 3CZAA 2Y0MA 2NVQJ 3KZXA 2JK1A 4I1UA 1TK9A 1B0ZA 1J8FA 1FDRA 5ERIA 1AKNA 3JVDA 2OL4A 2OYCA 2A33A 5HDGA 4YCJA 3CR3C 1R9TJ 2P7VB 3Q0VA 2BFNA 3UTDA 3TTWA 4ANFA 5IOYA 4E7SA 1PJRA 3GZNB 1KU7A 3O3MB 4EYQA 1Z8NA 1PV1A 1L5ZA 5TGZA 4PFSA 1H5NA 5M3FJ 4Q15A 2GCPA 3Q40A 4PTZA 2GTIA 4U0JA 4RESA 2FFHA 2DWQA 5DX8A 3AJ9A 2UYQA 1YRQA 1QNLA 2ZCWA 5J4VA 1VKNA 1WBBA 3QVGA 2I4TA 5AK6A 4AJIA 2P6TA 4JI1B 1KQGA 1ZIYA 1T0BA 3M4JA 4DYRA 1T36A 4B6FA 1E3LA 2CQQA 4LG0A 2Q2WA 2O4CA 2A92A 1EXDA 2F3TA 2OMKA 1TPZA 4PE5B 4OMZA 4MV1A 1RR6A 1LQ1A 1RXCA 3EUAA 1XTVA 2IHBA 4X0GA 4C0WA 3PFCA 4ZC8A 3OJFA 4L8WB 5FO5A 1X19A 2DAPA 4YCDA 5JVDB 4YLGA 1J9EA 3WB9A 1UAGA 4A7PA 2QMOA 4CEIA 3ZCRA 4FB5A 3OLXA 1I7LA 2RC4A 3TIXB 1XPOA 4LNHA 2BV6A 3FWEA 5JE8A 1P1JA 3K35A 5HSGA 5U4QA 1IZ7A 1HDEA 2I8DA 4QTYA 3DLLF 1FSZA 4YRKA 4WXMA 1VJ1A 4NNPA 1FQKA 1CUZA 2AF4C 2FQ3A 3DR5A 2XGJA 3NP9A 4YP5A 3I28A 1W5FA 1I3QJ 3HGMA 2QP4A 3KSZO 1JGTA 3TOBA 3K5PA 3PLNA 4DARA 3GRRA 5DTJA 3UH1A 1VBMA 3ADCA 4YROA 4A12A 4D45A 4TLDA 2LPMA 3RPEA 5C35A 4RB2C 1PQUA 4I50B 2JJQA 4RL4A 5HIAA 3NHFA 1MOPA 4P4NA 2HD4A 2VPLA 9LDBA 1FUEA 3G0CA 3DMDA 4M6YA 5B6JA 3EVGA 2PZ8A 4OK3A 1US8B 1XLUA 2FY8A 4KN8A 2CMKA 4F6RA 1LB1B 4ER7A 1XMKA 1JUSA 1IWOA 3VUFA 1XCLA 4RZXA 1SXGA 3U6BA 2PRYA 2OB1A 1HYEA 1XE3A 2ON6A 3H4VA 5ILQA 3V46A 2F1IA 1PFQA 4R1TA 4AKSA 5HX7A 3V2GA 4Q1CA 3TO6A 1EM8B 2C2ZA 4D8UA 1G7RA 2JFOA 1BXRA 1M6EX 1UBTS 2QWXA 1N0IA 4ZOCA 2CFIA 3AEUA 4NY1A 3KFXA 3PPYA 2RKHA 3QM1A 1N92A 3RYCB 5JS1A 4U7PB 2P9TA 3SHWA 3SOPA 1OTXA 2A1TS 1UP4A 2GD6A 1RCTE 3E22B 4YRBA 4GLJA 4J4HA 2TRTA 3R7WB 1RYFA 4F84A 4H17A 2HOTA 2R3SA 4NB5A 2H8RA 1XAHA 3QX8A 2LBFB 1OIWA 1RQGA 1ANKA 2ODWA 2PJZA 1AD2A 1X1PA 4L5CA 2BFDB 2PFGA 3QVSA 1YR9A 1JAYA 5K45A 4GPAA 2EQBA 4E12A 1WP4A 2BMAA 5EJAA 1NVBA 4BMNA 2VF4X 2EFOA 1JIKA 3ZWBA 4JLUA 3DXFA 1J97A 1T5DX 1IQPA 4ZT2A 1GU7A 1K7FB 5KS2A 3KXKA 2VPZA 1DQPA 4IRMA 2WHPA 3QXCA 5CYVA 2KRHA 3K1ZA 3J81Z 3FLMA 4WL0A 2G0EA 1YO6A 2Z2KA 2VHCA 2P30A 1IJBA 4D3XA 3FNFA 3OFJA 3QOYA 1ZMXA 3W5AA 3DZCA 3OLQA 3IKVA 3KQSA 3L07A 3NBXX 2G7ZA 4UNSA 2MFZA 3S32A 4F9TA 4LZAA 5E3JA 4GW3A 1QOQB 4C2MJ 2GZDA 3OZVA 4ZYHA 2Z3YA 3IPLA 1HLGA 1BI1A 4WY2A 3CR7A 3CN9A 2C77A 2NVTJ 2A7QA 3TBFA 4RFVA 2N8GA 5K7HA 4YB8A 1DU4A 4DKXA 1HW2A 1N5OX 4LDJA 1Z6XA 3I71A 1UK6A 3IV9A 5MFZA 1KOLA 2EZ9A 4WLEA 4I1VA 1I2DA 3GLVA 4MLCA 5L3SA 5I4KA 2C07A 1NR1A 4DIEA 4Q3BA 1OXXK 4H18A 4TZKA 3P0HA 1WSWA 2QVXX 4DG8A 4ZODA 4C78A 4I55B 5C32A 1HPLA 3LL4A 2E35A 1I4OA 1WEHA 4FMDF 1UMCA 1AKQA 1VPVA 4EITA 3GLQA 1ZOLA 3N8DA 3MJSA 3HKDB 1GAEO 2QJFA 2IZ0A 1B6AA 1VCHA 4FN5A 2Y0SN 5BQPA 1JPNA 4V24A 2KHMA 3OJ0A 3A9WA 1K0UA 3DVSX 4OXNA 1IDN1 1ZN2A 3PKJA 5JNTA 1XU7A 5LMCA 5AUPB 1H2YA 4NDNE 4FINA 4NZNA 3BCBA 3FZEA 3PLRA 1UQRA 1J42A 4EIWA 3W6VA 3DEAA 3WDMA 3TNFA 5EUMA 2PLRA 3CZQA 4CCYA 5SY9A 4G1MB 1UXIA 4EHLA 2ATIA 4ZHQB 1BQ4A 4Z3DA 1TCUA 3MUFA 2C7QA 2YW2A 2FLWA 3ERMA 1YZLA 3KJZA 3HCRA 3S2GA 1MOZA 5F5NA 4RPJA 4KXYA 2E85A 4MYRA 4WASA 3DH0A 3FAZA 1DIGA 1ZH0A 3RCOA 5GM1A 2DJIA 1LJ8A 1WCYA 2K2QB 2OUIA 3WQQA 4GXTA 5JD4A 3KTAB 5JNWA 5H0IA 4B75A 4X61A 2I4MA 3K2BA 2JJYA 3N74A 1PUFA 4DIBA 3FTCA 1VQ8I 2VRWA 2ZRPA 1OREA 3AG2H 4UOEA 2IYXA 1XAIA 5FUXA 3FXOA 1IYZA 3H83A 5AVSA 3PR2B 1NL3A 2BRUA 1Y6FA 4RJIA 4HV4A 3AUXA 4M1OA 3FVRA 4TXJA 5E9QA 3BXEA 4TL8A 2DYRH 1YAJA 4O4JA 3E3OA 1U7UA 1PD1A 2AHQA 2R5NA 5JS7A 2PRZA 4AQYB 4MS4A 3R76A 2CFRA 1I5OA 3QTBA 5FFFA 3ZZMA 3FR8A 3D7KA 1K86A 4ZTFA 2D1RA 4N9IA 4PYOA 3TRDA 2WJPA 4D8WA 3VZDA 4LGVA 2ZE5A 4KR9A 3BL8A 4PG8A 4EGJA 2VHVA 3EZXA 1PD0A 1OHHD 3BMOB 4WNCA 3W8EA 2SCUB 3R23A 4MA4A 1IEXA 1VI0A 3ANXA 3LKDA 3WJ2A 4RIIA 5AJWA 4PCVA 2I76A 4R01A 1CE8A 3AF4A 2BMEA 4DDVA 3QJGA 3KJGA 3DG9A 4BMXA 5KK1A 4YAWA 4E2ZA 5IKXA 3FMGA 3KKEA 3VNSA </