2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
1H9GA 4R54A 1LB2A 1XSXA 5JFRA 1HSZA 1SMTA 2OOSA 4M8SA 2XAQA 3JQFA 2IEDA 4NK5A 1R6DA 2EKQA 3SHFA 2PGLA 4AJJA 1ZEJA 2W98A 1LJ9A 4CV3A 1WW8A 3O8QB 4BNCA 1UFMA 2IZ1A 3GY0A 1HKQA 4TQGA 1S6LA 2HMVA 1H6BA 1O7LA 3UAGA 5H81A 2VBYA 4Q47A 1LC0A 4YRBA 1JWBB 4Q48A 2PEXA 3NEPX 4R68A 5A9SA 5KVVA 2V1UA 5IT3A 4WLEA 2EHDA 3TJRA 1AUPA 1B15A 3UGKA 2J3KA 3E18A 1BIAA 2QZZA 3KB6A 3PJDA 4ZVVA 2V1XA 3GF2A 4D0PA 1G1AA 4N7RA 1SO8A 4RGRA 1BC8C 2HCTA 1DPUA 4CQMB 1PQWA 4GCVA 5D5XB 3HOTA 4D46A 4LISA 5BS6A 2AXLA 5DNAA 4S05A 2ZFWA 1WSUA 1FYMA 1DRWA 4NK4A 4YVFA 4ESBA 3VPSA 4PLTA 3MTGA 1DHTA 1ZW1A 1YFHA 2AHRA 4U7BA 5JMPA 4WCGA 4RGBA 2I3GA 2ACJA 2KIMA 2ZMEB 5HOOA 2OMEA 2Y67A 2EB7A 1ISMA 4YJHA 2Q1SA 2ISYA 3F9IA 2JT1A 3FMSA 2I67A 4B8ZA 4C7KA 1F4KA 4WEQA 4MVJF 4JBHA 2HSDA 4FGSA 3KV3O 4U0JA 4RLHA 4MTDA 2JD2A 2MLKA 3JSAA 1LDDA 2YSRA 3NDJA 4YXFA 3P7MA 4Y15A 1IZ0A 1GQQA 3H4VA 1Z1DA 4PLYA 1BM9A 2XROA 3W4IA 4CM8B 3WYEA 4D3DA 4HLXA 4DLAA 4D0SA 3MZYA 1GUYA 3E03A 3EAGA 3GVXA 4PVCA 4FT8A 2HQRA 4QWQA 3L0DA 4UUNA 2OZUA 2UXNA 4EV0A 1ZUD1 2HMSA 1LDEA 3ICPA 1JWAB 2VUUA 4Q3NA 3WSWA 8LDHA 3GRPA 4ZU3A 3R0AA 1B59A 2JHFA 1JA9A 3TFOA 2YPRA 1WDMA 3ITKA 1E7QA 4W6ZA 2PZKA 5L95A 4HLYA 1JDJA 1M6WA 2YJZA 4NPCA 4I1IA 3V4GA 1DLIA 2JJYA 3MOIA 3RBZA 4CMGA 3VZPA 1EH6A 1NQOA 1Z6TA 2NQ8A 1L1FA 4O5VA 3F46A 2NYXA 1PP7U 1ISGA 2ET6A 4A26A 1QYXA 3TOAA 3WOHA 2CZCA 4L5IA 3NJ4A 4XQGA 5TIIA 1PX0A 4E21A 1Z7BA 4BIIA 3I53A 3R0IA 5I8WA 2FNPA 4CM5A 3LC1O 3HADA 4DYVA 1XA0A 4R3WA 1T2EA 2X0JA 4PG8A 1T24A 1JHHA 1IXSB 1CETA 3FMQA 2MA3A 4Y6PA 5CDTA 3I83A 1LEAA 1NNUA 1X7DA 4BQAA 4AJ2A 2PNFA 2AEJA 5TJJA 4WX9A 3HHHA 5LGNA 1H0MA 3GDGA 2PD6A 4MP8A 4QX6A 3RQSA 4G7HF 5H82A 4UREA 2PWZA 1NX6A 1EFKA 2OORA 3NJ8A 3PGJA 3RI4A 3L07A 1BMDA 1QYVA 5FD6A 5THQA 1Y9AA 5TT1A 1P6RA 1FX7A 4EJUA 4ASNA 5DZSA 4Z3DA 4BMVA 3S8MA 2XAAA 2RH4A 4MVJM 1YS6A 4M73A 4AIJA 3OSUA 3EK2A 4MVJA 1Z73A 4EW6A 2BGLA 4OAQA 1HW1A 4J43A 1VTNC 5I9NA 2IA1A 5T8KA 3KRTA 3DEUA 4ON0A 2RH8A 2WSBA 1QZYA 4IJKA 4KUGA 2PMUA 1MUUA 4GO1A 1TVEA 4HKTA 5E8GA 3ECOA 2ZQYA 4YQZA 3RU7A 3HDYA 3MWDB 3CUQA 1DO8A 2E6UX 4NJMA 4NQWA 1EFLA 4I02A 2AMFA 2UUPA 1PZHA 2A3SA 3PJGA 5KKAA 3WFJA 1PJBA 4LLNA 5D4SA 1L0OC 1YDWA 4WOKA 3ZN2A 1LVAA 1KEVA 3WGYA 2J3JA 5KVRA 1U78A 5DDGA 3JQGA 1XSDA 1UR5A 4IJWA 4D79A 3JYPA 4M87A 1YB5A 2IDZA 1I5RA 5I9MA 1OYIA 1R4MB 4N18A 4NBRA 5CDUA 5IZCC 3SVTA 5L3GA 3BMNA 1LDYA 4UVEA 5B4TA 4Q4ZF 3V7SA 4R4JA 2B37A 2W57A 4XGIA 3CTAA 1KVTA 5IDWA 3KP7A 1HXHA 1UP4A 4ZQHA 1IF1A 4OMYA 2H9IA 5BOXA 3ZWNA 4IRGA 3R0JA 3L2CA 5JY6A 2A5YB 3TF5A 1MG5A 2ILTA 3TSCA 1XDSA 4XQCA 2B0LA 5DP2A 5ILUA 3DZKA 3L4SO 1VL8A 3AFMA 3NDIA 3OA2A 3DDNA 3BP8A 3BROA 2YDYA 2W90A 1FLIA 4J1TA 4RORA 3BPVA 3X2FA 2CF6A 5I7EA 1D4FA 3R6DA 5A03A 4Y6SA 1YO6A 5FFZA 2C20A 5C7OO 3OBBA 3EY4A 5I9LA 1EUDA 1DRVA 3DPTA 1DC3A 1Q0QA 1ZO8A 4BV9A 2ADUA 2GCGA 4BGVA 5K5RA 4J0EA 4B8WA 3K2ZA 4IJAA 3IMFA 1HDRA 2X6TA 2FMUA 4KUMA 1IW7F 3CZRA 1XMAA 3PFIA 1QKIA 4YAKA 1ZFNA 4AJEA 1DHRA 2QLZA 1FDVA 1QGPA 4NR0A 2ZBKA 5CG1A 2P9CA 3UFXA 3AOEC 3F6YA 5CHEA 3O2PE 4QUKA 1V8BA 4CV1A 1ZSYA 5C5IA 3D4NA 4TKMA 2HLPA 1CJCA 4KQWA 1VJ0A 5A5EA 5ILGA 2RN7A 1KU3A 4AD9A 5ICGA 2NADA 2ZB3A 4PLGA 3FI9A 4XYBA 3PIIA 4XSZF 4FJ1A 4O5OA 3IRRA 3GFJA 3KSUA 1OMOA 4L5JA 1GD1O 1FXSA 2EV0A 2Y75A 3P2YA 4HQEA 1Y5RA 3GN2A 5ER6A 3GG2A 4Y13A 3IDSA 2ZO4A 2G17A 2H6BA 4NDNE 3ZQ7A 4TRJA 2F00A 1F0YA 4RF2A 3WR5A 1CRWG 2LDXA 4FR5A 2O7SA 1TW2A 2Q2WA 1W7PA 1UAYA 2E48A 2NTJA 4B4OA 5H20A 1NHWA 2XPCA 1JHFA 1IYZA 2B5WA 2BH9A 3FBGA 5A4DA 4F6LA 1O7FA 3TFQA 5TQVA 4UEJA 1MJ9A 4G65A 5CEJA 5AIPA 1RYDA 2HKXA 1YRLA 2OP0A 3ZV3A 3H8VA 2M45A 1GPDG 2NUAA 3G3ZA 5AIQA 3RYRA 1GPJA 1LSSA 3GMDA 3LT1A 3NT2A 3ISPA 3L9XA 4AIHA 4UUOA 4WLNA 1O3SA 3ZWYA 2VE8A 4DIOA 4EEXA 4K1LA 4AJIA 1WI9A 4KUHA 3H2ZA 1USTA 1OR7A 4HX7A 1MKMA 2Y1FA 3E9MA 2YFHA 2VRCA 1UCRA 2ZJ2A 4FN4A 3GLQA 4NMHA 3WB9A 3V7RA 1ZH5A 1MZBA 4XYGA 4YYZA 5IDYA 3PEFA 3GZ5A 1JGSA 4EZBA 3SX2A 4HDUA 3F8NA 4K2EA 4GX5A 3ZNNA 4BO7A 4XJTA 3C1OA 4LLLA 3GZNB 2Y05A 2UXXA 4QT0A 5B4VA 3DFZA 4BNTA 3QWAA 3PQJA 4GX0A 3CKYA 4NFHA 3GUDA 3O3KA 5LRSA 5A1TA 2NTVA 1RIOH 4PZCA 1GL3A 4FB5A 1UP6A 1Y8RA 3MJCA 4AJNA 2SCUA 4EITA 5TX7A 4R8HA 4BO4A 2YHUA 4QFCA 1PS8A 3WTUC 5ICCA 5JCJD 2UDPA 3SZTA 3PWZA 2CDCA 2X5OA 4RCVA 3DZGA 9LDTA 1Y5MA 4OM8A 3JD3A 1ON2A 3WNQA 4BGEA 5ITWA 2QBYB 3NTRA 3EYYA 3AWDA 4R5MA 4CMIB 3ZNQA 4ALLA 1YQGA 5E20A 1J4AA 4BO8A 3C7CB 4CLDA 4CMKA 4M86A 3DF8A 1MG0A 3U62A 3M8EA 1BI1A 1I24A 5IZ4A 1YIOA 3CINA 5ICFA 5F5LA 1I1SA 1X14A 2AXQA 4Y6RA 1LXCA 2CD9A 2HMTA 2PG4A 1ZREA 2PZMA 4HFNA 3ZHYA 4R01A 4A5OA 4KA4A 1K79A 1YQXA 5C7LO 4D41A 4NIMA 4CMEA 1YBMA 1UH5A 4BH9A 4J9VA 1ZSNA 3KE2A 3W6ZA 1I10A 1LSOA 4A10A 3NRVA 3BMQB 2Y93A 1O6ZA 2GDZA 1DXYA 2ZNZA 3ANMA 3KP3A 1HDZA 4ESOA 5BSFA 1QV6A 3GX4X 1B4AA 2VYNA 3ZWOA 4AJPA 4BNJA 5KJFA 4F7ZA 1MB4A 2W25A 4IM7A 2WD7B 4L0YB 2B36A 1QNTA 4BKUA 2Y0CA 4CUZA 3WTZA 3WLFA 1P45A 1IE3A 1XQ1A 2PGDA 3CMCO 4BMSA 1XGOA 2JKVA 4WCFB 1HZJA 1LTHR 4RGSA 1IRFA 3G0OA 1C0WA 3QVSA 4IQ8A 2PFGA 1HL3A 2CVQA 3QWHA 3KZYA 3A06A 5F1OA 1HW2A 1E3JA 2NTNA 2QHXA 3AM5A 4L9JA 3CE6A 4CMAA 2EW8A 4OKNA 1C1XA 4GI2A 3M8FA 2J5PA 1DFGA 2Q2VA 4XQ9A 5BNFA 4CLRB 2HS5A 2O0YA 3TOBA 2EJRA 3DXFA 2VRCD 2UAGA 2FOIA 1BC7C 4Q3EA 1A9ZA 1E3EA 1J0RA 1I36A 3GT0A 3ULKA 4MINA 3F8CA 2C7GA 1G3SA 4JX8A 2BRUA 1K5HA 1GYPA 4IRIA 4MVJH 1U5TC 4J90A 2FR1A 3M1AA 1D8KA 3ETDA 4JXKA 1YLFA 4CICA 4Z6KA 4LCEA 3ZV6A 3IQDB 3RYPA 4WXCA 5E8IA 1PJCA 4ND4A 1E5QA 2I3AA 4GAEA 5DV5A 4HFMA 1P74A 3DHEA 1BSVA 3K73O 4WXHA 1ZLKA 1LDGA 5KVQA 5F6FA 3I23A 3H5RA 2DK5A 4YJFA 2POQX 1ZGAA 1YONA 3R4KA 3RROA 3TOZA 4ZICA 1S7AA 1P4XA 4EGFA 4S1VA 5G2OA 4YIFA 3ETGA 3KHUA 1DIRA 3CIFA 4FBGA 1D8JA 2NAZA 3DBLB 3UICA 2AQ8A 1ISJA 3GEDA 3DB2A 1G3WA 4DPKA 1NM5A 1WNTA 3BMOA 4AJOA 4OIMA 1TTYA 7ADHA 2JZYA 3K5PA 3BMCA 1MJAA 3H5NA 3JD1A 3HHGA 3CDHA 3KP5A 1ZMTA 5DCYA 1MP0A 4YEDA 1PQUA 2V1DA 2CFXA 4FFPA 3INTA 3DOOA 2DW4A 2VHZA 3IRQA 3KO8A 4KWIA 4D3SA 1T6SA 3TRIA 3RIHA 3W6UA 2GZ3A 1N9GB 4E33A 1RPNA 5B4UA 1LNQA 3KEQA 3JQBA 1LDNA 3PHJA 4GMFA 3OECA 4JK3A 4K9DA 1JLLA 3WTCA 3JTMA 5ES3A 2ZKZA 3GH3A 3UCXA 1ML3A 2P4QA 2Q2EA 4BHBA 1KVRA 5CFZA 4G6QA 2PBIA 3D0SA 2DLLA 4BB5A 3JQAB 3GFMA 2CUKA 2R7DA 1PJTA 4J6FA 1ZK4A 4R9RA 2GD1O 2A92A 4BV8A 4ND1A 3DFGA 1UP7A 1VRWA 5TNXA 1WDLA 2DPUA 1E0DA 1A04A 2EEZA 1BN5A 2DBQA 1EDZA 1FNNA 1E3SA 2O3TA 4INAA 2QQ9A 1PL7A 4HXYA 4TKLA 2XXJA 4BMNA 1XYGA 4IPTA 3W8FA 1EH8A 3VODA 2DFVA 3DO5A 1OMIA 3QU3A 3HHPA 2F5CA 4R1UA 3S2EA 1AXEA 1XSVA 1RKXA 2Z95A 3FWNA 2EP5A 2C59A 4KZPA 5EL0A 3ZNPA 5CAEA 2ZB7A 5TRDA 2J8ZA 1V4RA 5DD4A 1IOLA 1J9IA 2DBRA 3E82A 1FYLA 3TDKA 1GEEA 1XMKA 1R4NA 3LFKA 2J5KA 2P68A 4ZYGA 4Z9YA 4ALIA 3ZMTA 2IT0A 3BTOA 2P4HX 2F5DA 1K78A 4KDPA 3F47A 4M89A 3SC4A 2JTVA 1HBXG 3T5XA 5LEKA 1P1RA 2OL4A 3PWKA 1T0FA 3WTWC 1T38A 4L18B 3COSA 1VL6A 2BHLA 3JV7A 4ONEA 3P7NA 1EV7A 2IXBA 4I08A 4IQGA 4JBGA 3IP3A 2Y66A 1DFIA 4W82A 3GNQA 1TQMA 3KP6A 5GMOA 4ESFA 1YB1A 1YVEI 5G4KB 3AK4A 5JLAA 1LQ1A 4NHEA 4IIUA 1EEHA 4YFNF 4GGGA 1UDBA 4MDHA 3D3WB 1GYQA 3V5NA 4RGUA 1NR1A 4J0FA 2EA2A 4L9TA 3OQBA 2V7PA 2P4WA 4CR8A 4HAMA 3HUGA 3ORFA 1ZKMA 1Y1PA 4G9YA 2O8XA 2CO5A 2X0RA 4NNJA 3WWZA 4WNCA 1Y9EA 1FY7A 4IMRA 5JDIC 2VNAA 4RQUA 2VC0A 4DLBA 3GFGA 1BXGA 3PHGA 3MAJA 4YAGA 2EK5A 3DOCA 2HDHA 4WLUA 2RCYA 3CTMA 5JAIA 4TRRA 4O3MA 3G49A 1RUNA 2H1SA 3PDUA 1T39A 4M72A 2RIRA 3OETA 4RAZA 2PKRA 3WBFA 4K6CA 4BO0A 3K9TA 1AOYA 4Y8VA 3WJ7A 1BI3A 4B7XA 5ENVA 2HRZA 2BGKA 2XV4S 1JKFA 2PA3A 3TZ6A 2C2XA 3TQNA 1IN7A 2VZ9A 3I59A 2XAGA 4ALKA 2ISZA 1E1KA 3D5TA 3RKUA 4JQFA 4UVGA 3FM5A 3NUGA 5FWNA 5ED4A 2D2WA 1MJBA 1NQAO 4PDKA 1XU9A 4S04A 2D0IA 2VHWA 3AUAA 2L4AA 4NB5A 5FFXA 4EGZA 1TT7A 2FMLA 1PWXA 4QEDA 5BPIA 2CFCA 4NBUA 3OJFA 5L9AA 3VOEA 2D5AA 1HE3A 3WGTA 1WMAA 5C37A 3JQ7B 4J1NA 1R37A 2P9EA 1H6AA 4Q39A 4BNHA 2Z33A 4D42A 4WUVA 2OBYA 2P6SA 4ZD6A 4HV6A 1T2CA 1DAPA 3EETA 1KVSA 1BDBA 1KETA 3C1AA 4LVUA 4WASA 5FI5A 1PR3A 1B9NA 3RKYA 5U4QA 5DCMA 3AW9A 4ILKA 1I2BA 1N7HA 3HDQA 1E7WA 2VHYA 2W2LD 2VTEA 1VI2A 5A02A 1PZGA 3AI2A 2WE7A 1T1RA 3FD8A 1PDNC 3PGXA 2D45A 3VOSA 4B4VA 2GGSA 1PJ4A 3C1DA 2M30A 4WXDA 2Q1WA 2XXBA 3IS3A 4ZYHA 4JN6B 5TJHA 4B3JA 2M87A 3Q9SA 1TNSA 4JBAA 1O9BA 3JQ9A 4GVXA 3GFIA 1KY5A 4IDAA 4LB5A 3GF4A 1TLHB 4ROSA 2O23A 1HRDA 2STTA 4DQXA 1EUZA 1MDMB 2ZCWA 3MFKA 2W84A 4ENNA 1QQIA 2AQKA 2PZJA 3BA1A 2XVCA 3QWBA 2NU8A 2XIGA 2Q3EA 2PZLA 2TMDA 4YBZA 1WQ2A 2V6BA 4GXOA 2WYUA 4R5HA 2MBFA 1R7JA 4YAIA 5CPBA 4ESJA 1I01A 3ZPLA 3WWYA 2QENA 5A3JA 2XAJA 1RM5A 2W4QA 3HNPA 3I9KA 3R3JA 4RAYA 4IBOA 1E1NA 1IXRC 4EM2A 2AQHA 3NQOA 2P2SA 2AE2A 3O8QA 1P2FA 4MKZA 3KLMX 4A0XA 1YL6A 3ONFA 3SLKA 1OC4A 4ZHSA 1Z7UA 1KC1A 3K8ZA 4LLGF 2YY7A 4LFUA 3U3XA 3REOA 4PG5A 1LDJA 1SAXA 2WEKA 1JVSA 5DOVA 4GMGA 5JS6A 2LDBA 4XYMA 3GEGA 2I66A 3S2GA 4ZN6A 3FSRA 3B20A 5E17F 1SEVA 2GUGA 4OXYA 4CQMA 1ZMOA 1PL6A 5FLXZ 1BHSA 3FNHA 3JQDA 4XIJA 3RAJA 3E5XA 2XAFA 2OZ6A 4U0WA 1AWCA 3EHEA 4QQRA 1XLTA 2E37A 1RNLA 3H7AA 3WE3A 1OI7A 1QR6A 4IPAA 2FPPA 2X9VA 3PYXA 4RPKA 4J3FA 1AXGA 3WTBA 4DPLA 2W85A 2A4KA 1A72A 1WMBA 1QYWA 1VM6A 1ON1A 1DDOA 4KWHA 2ZMEA 3U9LA 4GBJA 3K69A 5IG2A 4XRFA 3B02A 4HF1A 1DPGA 2O48X 3E9QA 5ITVA 1E7SA 2JFFA 1EQ2A 4TV7A 1MA0A 1ONPA 2BFOA 1PEDA 3V2GA 5KTKA 1PGQA 3G73A 3M9AA 1SFEA 2Z3YA 3ZV5A 3E6MA 1LDMA 3RTRA 3WS7A 2HU2A 1VE9A 1KBZA 3FWZA 5JC8A 2H27A 5HLGA 1ZSVA 5T8KC 3N97A 3KBOA 1U5TB 4DRYA 3ZP5A 1MGTA 2W24A 1OOEA 3ZMDA 5HDKA 4CM8A 2FPIA 3ROKA 1KEPA 1UZMA 3K92A 2VT3A 4OIQF 5IDXA 1GY8A 2PLYA 1O3TA 1RI7A 2GZ1A 3EMKA 5TLSA 1GZ3A 1JQBA 1I2CA 4GL4A 3MZHA 2IE0A 3NRCA 4OOEA 4Z3KA 2IRWA 1A71A 4PGFA 3RFXA 1ULYA 4J4TA 2PR2A 4ZGWA 1I30A 3RPQA 3QA9A 3PQFA 3GXOA 4BNXA 2HJSA 4WLVA 2BV6A 3RUIA 1CF7B 4E2WA 4FW8A 1U1IA 5G0WA 2PI0A 3KEOA 2VZ0A 1H5QA 5IAAA 1R5GA 1V3FA 3DXJF 3U4CA 1P1JA 1HYEA 2HOEA 1U3VA 2Y0MA 1WRJA 1HSTA 2ZQZA 2ZATA 4M1QA 5EQDA 1YXMA 3WDSA 2QYTA 1IZ9A 2EIHA 1K0UA 2WE8A 2VWPA 4PLCA 1I3LA 3ZZNA 3T1BA 5A06A 2X4GA 1J2XA 3MOGA 3UXYA 1KYZA 1NPTO 2GLXA 1V0JA 3WGIA 3PPIA 1IN6A 5LLQA 5FLXK 5E1XA 2GRAA 5TJ9A 2O3SA 2VBXA 1LJ8A 4P4LA 4NFSA 3F5QA 4DQUA 5L51A 1GZ6A 4LGWA 4F45A 4U8GA 4UEKA 1LLCA 1E1MA 1QG6A 1U4SA 2PKQP 3RKXA 3FXQA 3MCZA 1PJ2A 1PJ3A 3BJ6A 4KNYA 2RC4A 1Y6JA 2QIOA 1E7RA 2Z9OA 3C8MA 4GKVA 4I2OA 4UUPA 3ZWWA 2UUOA 4DC1A 1FYKA 1T4BA 4II2A 3ROQA 3WODF 1K6OA 2R00C 4DMLA 3SJUA 1M2WA 3H9QA 2L02A 3WU1B 2FQ3A 4Q3CA 1B26A 1FJHA 2C7VA 3FTPA 4J7XA 4NI5A 1H6DA 1STZA 5ERIA 1AGNA 4RF3A 4UVDA 4MNUA 5DCUA 3WIEA 5CVVA 1EVJA 5TSDA 5L3BA 4I0AA 4WNIA 4R1SA 2XKPA 3HIFA 1KIFA 1YO5C 1LRLA 3QWFA 4XYLA 3HFSA 3QPTA 1ZRDA 2A69F 2X9NA 3BOQA 2RHCA 1QO0D 1R4MA 3A9WA 3CUKA 4IIVA 2EWNA 3DP7A 4EJOA 3ZGYA 4TZKA 1C0LA 5EERA 2GIVA 4CV2A 2X0IA 3K31A 1XKQA 4RF4A 1J75A 1D8AA 4PVDA 3VPGA 3VAZA 2OQGA 3ZWXA 3Q0EA 3GGGA 2DQLA 3AU9A 4QECA 3QHAA 3EGOA 3ZU4A 2B83A 3JW4A 1SAYA 1DIGA 3Q3CA 3ADOA 1N2SA 3N7UA 2K86A 5JR3A 1B14A 2I5PO 3EVNA 3FR7A 4F46A 1ZH8A 2NM0A 4UAGA 1P92A 1NFQA 5U9CA 4A6EA 4GWGA 1D1SA 3I52A 4MP3A 5U1PA 2VOPA 4UXNA 3F6OA 2BD0A 4W9NC 1B8VA 4L9VA 4LG0B 1VJTA 3A1NA 3UVEA 3BIOA 4ZRNA 1WLYA 4E2XA 3IP1A 3A14A 3DWFA 2DVMA 1M76A 3W4KA 2IA0A 1DDNA 2ZYDA 1WPQA 4IDEA 5THKA 2NV6A 2Z1NA 3BZUA 1FMCA 4WCDA 4YIIA 3J80Z 2NSDA 3X2EA 9LDBA 1BTOA 1C0PA 5HLIA 4M55A 2PK3A 1Q7GA 4PLVA 4ZYEA 5K5OA 2OFPA 3RUHA 3KOUA 2C2YA 1GTMA 4EYEA 5D5VB 5H83A 3ZMVA 3ZN1A 2P91A 4BHCA 1XELA 2A35A 3UUWA 1AE1A 1P1IA 4FFLA 4HDVA 2BEOA 1ODDA 2C54A 4I9NA 4R16A 3ZHXA 4D7AA 5DUIA 3I6IA 2O2SA 3NDRA 3AM3A 4PZDA 3H3UA 4EUHA 2JSCA 2EP7A 1HEUA 1BW9B 3RFTA 3OOPA 3QU6A 1L3LA 3PRJA 4YB8A 1EBFA 3VPXA 1Z7EA 3V8KA 2JPBA 3LAJA 5LHGA 3ZMSA 1FDWA 3SLGA 3RDIA 3KLPX 5CDSA 2GN9A 3PYMA 4NBWA 4CM9A 3DL2A 3F1LA 1OPCA 4BUCA 2J5QA 3VDQA 1OAAA 5LCXA 3VEPA 1IN5A 3ZMUA 1E77A 4UVHA 3UOGA 3OM9A 3GFBA 1YYVA 1C3VA 3E1KA 1ZXLA 4EDFA 3KVOA 4ZH4F 4KDFA 3AOGA 4UHTA 3VTZA 3EDPA 3WJAA 4BGUA 2FBIA 2X22A 3EUHA 4CMEC 3F8MA 4EQQA 1JAXA 1ENZA 4YRAA 3P9KA 4U7DA 1CERA 4WCFA 1SOVA 4CLXA 3WU0A 2D59A 2Q4BA 3VFZA 1M6HA 3TGNA 2AEFA 1UXJA 3VPFA 3DFUA 3AM4A 4RB3C 1W6UA 2VQ3A 3GR6A 3QOPA 3WTSC 2QQAA 2VZ8A 3JSOA 4OQYA 4Z0HO 4CM4B 2PV7A 2MD5A 4NHJA 2YUTA 4EMSA 2TMGA 4WK6A 5L4NA 1DFHA 3DONA 4OYRA 2K02A 5KKCA 1MLDA 3F1KA 4I5EA 2COMA 2VONA 3NV9A 2NRAC 1F8FA 4I98B 3GZNA 4MIOA 1J7KA 4L9RA 1NP3A 2X7HA 3I5UA 1MV8A 4Y17A 4L0ZB 3M2PA 5F5NA 4A27A 1GU7A 1I2ZA 2VWGA 2EJVA 3BYZA 4F6CA 3QVWA 4IUYA 5JPIA 3KCCA 3RFVA 1HE5A 1Z9CA 3S55A 1Z82A 3WQQA 1R5HA 4DYDA 1ZG1A 1TQIA 1QYCA 4FX4A 1MXFA 2I99A 1OZAA 3CMMA 3J80K 3AAFA 5GZ6A 4PGGA 1MD0A 4ZZLA 1TB4A 1JKJA 5CVJA 3DBVO 4LJZF 5JW6A 3HSRA 3H9UA 5DCWA 4RPLA 1YS4A 2EV9A 5K9ZA 2KIFA 4YFXF 4JNKA 3ZNOA 5L7YA 3RU9A 2EW2A 3H9EO 3IAHA 2O4UX 2QBYA 4CLOB 4CMIA 3JQCA 4GGPA 3NAQA 4FJ2A 1HE2A 1NFFA 3QSGA 4RF5A 4PRKA 1V6AA 4XDZA 5HS6A 2HKOA 3S2WA 4XB1A 2D2IA 2J6IA 3LC7O 5JDCC 5DEQA 3LAPA 3WQSB 5GZ1A 2GR9A 3HQ4O 3JYLA 4FC6A 2GA2A 1K7AA 2H94A 5TRTA 5JNLA 1V3VA 5L7TA 4YAEA 3VH3A 4MHGA 1SD5A 3C85A 1ENYA 2UV8A 1QBJA 1ZCJA 2VOOA 3RKWA 2JHGA 4MVJD 2ZYAA 1EZ4A 3STHA 3ROPA 3R6SA 3KSDO 3T7CA 1P0CA 2MH9A 4KN4X 3E9NA 1DJQA 4EJ0A 1N92A 3WE2A 1LQUA 3GQVA 4R79A 1VJ1A 1ZHFA 1X0XA 4HBLA 2M5WA 3BMQA 1YBAA 1BG6A 1GFSA 5K5QA 3O4RA 3BY6A 2O7QA 3JD0A 4Z9FA 3QAHA 2IRFG 2BLLA 2A9FA 1PL8A 1ZVMA 2DKNA 4CM9D 4IS3A 1CWUA 2WD7A 4Y9DA 3UCEA 4E32A 2YHIB 2YV1A 4KIGA 3DPLC 4XR4A 5TGDA 1LLQA 2WC2A 2FHSA 4L75A 4MTEA 1WVGA 4N5MA 1PTJA 1LLUA 1X3UA 3KLOA 1NVTA 4MQ9F 1IHXA 2DBZA 1KQ0A 4OOFA 4RZHA 1HKTA 3K1MA 3WTXC 1GZ4A 3AUUA 4EUEA 4PN3A 3F23A 3UN1A 4IXTA 3L7WA 3PI7A 2XASA 4P9UA 1E1LA 2VWHA 4MOWA 4LRTB 4DBVO 3I54A 1ZIDA 2K27A 1KEWA 2RKHA 3K0LA 2XHKA 3JQBC 5TC4A 4EJ6A 5L7WA 3DKWA 1U5CA 3RC7A 2W2KB 2MLGA 2YX7A 4I0BA 1H2HA 5CP8A 4PLZA 4BNWA 4CLRA 1SPXA 4TRNA 5D6EA 1IHYA 3ABTA 3FXRA 4ITUA 4KYWA 2YR2A 1NAHA 2DUWA 3OIFA 3QLJA 2HTSA 5DBFA 2Y1CA 3PZBA 4AJ4A 2BI8A 4QO7A 4JGBA 3H9GA 4BNZA 4JCOA 4BNVA 1Z6RA 1TXGA 4PLWA 4G7OF 3CUOA 3ZWBA 1O0SA 1X1TA 3OH8A 3GGPA 4P9FA 3PYLA 3JCZA 3DZBA 3PJEA 4B3IA 3U5TA 2WJPA 3CEAA 2ZB4A 1F9NA 1S29A 1X7GA 5FO5A 3SZPA 2ZKLA 1GR0A 5JXWA 3AI1A 4BNLA 3M1EA 4R1TA 1X1EA 1TT5B 4A73A 2LNBA 2BMAA 1G0NA 3DC2A 1YJ8A 2P9GA 1E6UA 3ZWCA 3MJEA 3O6BB 4KTTE 2QW8A 4HP8A 1CDOA 3G17A 2LDUA 1R22A 2VOJA 5H6RA 1GCOA 3KYDB 3I9OA 4DIFA 3ERED 3PQDA 2LF8A 2QM3A 4A6DA 5AOVA 4IDDA 5TT0A 3C3WA 4AVPA 3ENKA 5L4LA 3HE3A 3T4XA 5KJ6A 3DBLA 2AW5A 4U0VA 1E3WB 1Y8QB 2WWYA 3E48A 4IF4A 1GCUA 1YH3A 4LSWA 2L01A 5KVCA 2FN7A 4Q3AA 4WE3A 2EJWA 4A5NA 1HF3A 4DREA 1E92A 4BKRA 2Q50A 4A2CA 2OP1A 4MP6A 4WOJA 3P2OA 4OMZA 5D6FA 5MDHA 3LC2O 2L54A 1J6UA 4DTIA 1YQDA 1USSA 3INRA 4R9SA 1UB9A 1W5SA 2YU3A 3KSZO 5HBRA 1N9GA 2YQ4A 4E0BA 5DN9A 4BHTA 3ABIA 2IEBA 1Q0LA 1IN8A 1W7PD 1U4OA 1U3TA 2C0CA 4GYGA 1EQUA 2C5AA 2DTXA 3Q9NA 3FPCA 4P4GA 2O4CA 3I9NA 4FS3A 5COBA 4BNUA 2DAOA 4OGWA 1C1DB 2ZTUA 3SJ7A 5I7VA 5AXBA 2IJLA 3JQAA 4IDCA 5IZCA 5E1ZB 4XRRA 4LMYA 3I6QA 2HMUA 4NJOA 5JO9A 3L6DA 3LT2A 3KZZA 2P5LC 1TLTA 4AL4A 3I4FA 5BQFA 2V9VA 3DV8A 4NU6A 4ZA2A 3RJ9A 1QLHA 2FY8A 3MTJA 3TZQA 3OFSA 2QRKA 4OQZA 1KERA 5HDNA 3QY9A 1NAIA 1U6GA 5K6AA 2CNBA 5FGMA 2BF7A 2FRDA 1N7GA 4Z2YA 1HSJA 4YT2A 1FT9A 3QRFF 3EDMA 4Z0TA 3ZMZA 5IN5A 1GQYA 1HYGA 3WNVA 1P33A 5IXYA 3GDOA 4W99A 1UHMA 4CUKA 3JQ8B 2HKIA 3FNFA 4QTZA 4LN1A 5HLHA 1FK8A 2CSOA 4IRHA 2P6TA 1O3RA 1XU7A 2FEZA 1SD6A 3Q2IA 1YW8A 3RCBA 4BKOA 1T1SA 5CEFA 2PD4A 2ZK7A 5AQ1A 3DBRB 1HDXA 1AN9A 1NR7A 3GVIA 4GWKA 4DLLA 2FZEA 2Z5LA 3L00A 2Y1GA 4MVJI 4UV8A 1LA2A 3U0BA 2QZ8A 4KIBA 4ENKA 1QSGA 1B1BA 5BSGA 2EGHA 2DU9A 1H93A 3MWEB 4IDBA 2NVUB 4OU0A 4XSXF 1U8RA 4OH1A 1RJWA 2G0TA 1Y0UA 3Q5FA 5JY1A 4P96A 1X15A 3H9JA 4K28A 1EVYA 2R6JA 4J49A 5G4KA 1LDKB 2DAPA 4BNIA 4J7UA 3RPUA 3FXUA 3CO6C 1SZJG 4PCQA 4RVSA 4GX2A 4F3YA 4CDGA 1P0FA 1W4MA 1EMDA 3D3WA 4WJZA 3RC9A 3EQLF 3E5RA 4RVUA 2L4MA 5JBIA 1R0SA 3V8LA 4YPOA 2IZ0A 4A5MA 5F1RA 1R15A 3DZFA 3D1LA 3P19A 1M67A 1PS0A 3SEFA 4RPJA 4RB0A 3KYBA 4Y67A 1PGNA 4AWXB 1PR9A 3WYBA 3O38A 4MQVA 4KDEA 1OYYA 2EGGA 2CSUA 2FMYA 2G1UA 5AXCA 3WGOA 5DD8A 3T8RA 4RPGA 2B4TO 1ZRCA 1WWKA 2OA4A 1YWGO 2O3RA 1O5IA 4ND5A 3TO7A 1U3EM 5F64A 1X13A 2VYND 4CQLB 2WTEA 2BELA 4UVIA 1N1EA 8ADHA 2OBNA 5KNLA 3K1PA 5CVRA 3BTUA 4YJGB 1KOLA 2BE5F 4IHSA 1ENPA 5HA5A 5DP1A 2EKLA 3WYCA 1ZJYA 1BOAA 4Q5SF 2EKPA 4CO8A 3COAC 2I76A 4RO0A 1FBQA 2DK8A 2AQIA 2O6GE 3KFWX 3AY7A 3KLNA 3GUYA 3JQAD 1ISIA 3LLVA 2FSWA 2Q46A 1HWYA 4M6XA 3JQ7A 1ZN2A 4WGGA 1A4UA 4QO8A 4U0YA 2Q0OA 2NNNA 1B8PA 2Z99A 2X5JO 1AHIA 1P44A 3PVZA 3T0YA 4X54A 3WBBA 3BZ6A 4LK3A 4XX0A 3PTZA 4BHPA 1Q7CA 1ENOA 3A28A 1IPFA 4FFRA 3NKLA 4HX5A 4YRDA 1IRGA 3TO9A 2HGCA 2G7UA 2YX4A 2QUFA 3SFZA 1E7MA 4LVCA 4PLFA 5DT9A 3WTVC 1GV1A 1HDGO 3D4OA 3F8FA 3F3SA 3FBTA 4J4HA 3P9CA 5DOZA 3AFNA 4XB2A 1VC2A 3E6BA 3F22A 5IT9Z 1TI7A 4JQCA 1NWCA 2IP2A 2Q4EA 2UVDA 1N1GA 4JBIA 4QXMA 3FTNA 3W1VA 2GAUA 2VTDA 4IXAA 1GUZA 2EFWA 1ISHA 1JE8A 1MDMA 1FOKA 1LEBA 4I01A 3VH4A 5ADHA 3HRMA 1DRUA 1NWHA 1R0LA 4HWKA 2B4RO 4OIRF 3RJPA 4IS2A 3VH1A 3DBHB 2R2GA 3QVTA 1HQCA 1B3RA 3DMTC 3GVHA 1FP1D 3T4EA 2PFBA 1PS9A 4RS8A 2B69A 3OJOA 4U6QA 4AVYA 1BIBA 1ZNQO 1I32A 1GQ2A 4BO9A 5ICEA 3EYIA 3AUSA 5K0ZA 1WDKA 3IHUA 3IWFA 4HFJA 4XLNF 1P77A 3TL2A 1NASA 1YOVB 4RJTA 1P4WA 3WGGA 2Q49A 1RUOA 2IVMA 4AJKA 3H3FA 2EFOA 1ZRFA 1FBUA 1MX3A 5LGUA 2YYYA 3E5MA 4H15A 1D7OA 3D4PA 3F4BA 1HW5A 4J1SA 4O6VA 4MVJG 4XA8A 3LVFO 3SXPA 4XZ3A 2O3JA 1CGPA 3QVXA 3JQFC 4A2UA 3QVOA 2NLOA 4I5GA 3GRKA 3GHHA 4QSMA 5HDGA 4R41A 5CEEA 1LU9A 4W7HA 3IC7A 4O1MA 3WGZA 3P9IA 4CR7A 4IGFA 3RC2A 4HNGA 4DNCA 4OSOA 3OV8A 4OSPA 3WSVA 1GVJA 1XGMA 1HDOA 3ROMA 2EERA 4EI2A 5G0UA 4IJVA 2BBYA 2G82A 4KT5C 4WK8F 4K26A 4ID9A 1TBXA 4EM1A 3PHHA 4KUEA 4I5FA 1N8KA 4YR9A 2P5KA 3WGQA 3IC5A 2GYYA 4ZRMA 4MEXF 2Y68A 1WWXA 4B3HA 3ADPA 3VVBA 2LKPA 1A4IA 3I5MA 1U8XX 2BYVE 1K3TA 2IXAA 3B1JA 4I09A 4RVHA 4XIYA 3O9ZA 1QPMA 4MPDA 5IXSA 1K89A 3TQHA 3TL3A 2D8AA 1NFRA 1WKMA 5C3MA 5A04A 3JSPA 4R51A 2ZCUA 5T64A 4U88A 3GEZA 1O3QA 1R66A 3GWZA 1N5DA 3QRWA 2JFHA 3EW7A 1ZJZA 2GN6A 2KJBA 4YCAA 3WG9A 4KFCA 3RUDA 4XRGA 1X7HA 2GASA 1DIAA 4TZTA 5KVSA 3K9QO 1ONOA 2RQPA 2GWRA 1U5TA 3G79A 2H5LA 5IT9K 3Q9UA 4FQ8A 4J9UE 4LMRA 1O8CA 1IULA 5E1WA 1YDEA 4B09A 4G6DA 4IZHA 1EH7A 1UAGA 1G4DA 4II3A 4CUJA 3ZW8A 1BI0A 3BWGA 4OJNA 2NU9A 2ETHA 2XGXA 3ZV4A 5LHIA 2HQ1A 2NACA 1YGYA 1RZ4A 3GO5A 4EJVA 3V8JA 1KA8A 1KQ8A 1DB3A 2X5KO 1U2GA 4KTVE 4WPGA 2HO5A 3GN1A 3LU1A 2ZXJA 3M6IA 4U7WA 4B4UA 2H63A 1NQTA 4GX1A 1ARZA 1TA4A 2ZIZA 4RDHA 3J81Z 5KCZA 1HKUA 1CF7A 2Q99A 1EVZA 1H0KA 3OA0A 4D44A 1RM4A 3U9GA 5BNIA 3FCOA 3HSKA 1V3UA 1I27A 2DPDA 2HTJA 5BSEA 3F6VA 2X9GA 2WTBA 4W4TA 1I3MA 4DVJA 4OINF 4GQAA 4KICA 4MVJE 2VOEA 4H0EA 5DBGA 1YG2A 4UUVA 1M66A 2EV6A 4XJSA 4AJHA 2JAPA 4MO2A 4DC0A 3LT0A 4PG7A 1PZFA 1PZEA 5JI6A 1NHGA 3ZCXA 1SFXA 4E4YA 1OFGA 2O2YA 4HF2A 2Y99A 1J49A 2V65A 3OEYA 3PP8A 4XLPF 4BVAA 3HZZA 1NXQA 4HBGA 4CR6A 3BPXA 3TWOA 1RM0A 1XQ6A 3NEUA 1JN0A 1SMYF 4LW8A 2DFDA 1CQIA 2C07A 5KJ1A 1F5TA 4Q3DA 3QP9A 3QV1A 3U4DA 4FGWA 1KU2A 2GZ2A 4RQTA 3ZWPA 5FEUA 1I0ZA 2FNAA 3ELKA 4AG3A 4CHUA 5L40A 2D3TA 4J16A 3ASUA 1XIVA 4ZQFA 3LQQA 4KMUX 5G4LA 1H94A 4E2YA 2X0NA 2Y0DA 1G0OA 1LLDA 4IJUA 3FR8A 3QP6A 4GVLA 4J91A 1OKRA 3B73A 5GY7A 4PLPA 3IL2A 5LBQA 2EF1A 4RGXA 4JLWA 3PIDA 1K2WA 3Q1LA 4Q9NA 2JPCA 2BFPA 3MJTA 1U5AA 3U1DA 2G9WA 1FF9A 2NU6A 5HVQC 3GNTA 4YJDA 3HB5X 4NBVA 2NS0A 4CPDA 3D64A 4WEOA 1Y81A 2PH5A 4HNHA 1EUCA 3MQ0A 2X86A 4LSMA 5DULA 4O6JA 1EK5A 4XKJA 3L6EA 1O94A 1OC2A 1NBOA 3U2RA 5EQFA 1Z74A 2DI3A 1D3YA 3IOYA 5D8LB 1XD7A 1R1UA 1PQPA 2QG4A 1NHAA 1R58A 1GV0A 2DQ4A 4Z9XA 4FOSA 1X0VA 1QYDA 2QYSA 3GVPA 3CUQC 3HG7A 1EE2A 3OJEA 5G0SA 4FDAA 4OOIA 1E5LA 3LF1A 1DUXC 3F3XA 1UDAA 4E5NA 4GYIA 4O63O 2AG8A 4D43A 3IWZA 4M9ZA 5DF1A 3ZWVA 1XEAA 1AHHA 1REPC 4B79A 1LNWA 3J81K 2E7XA 2WYWA 5JAZA 3F4LA 2J3IA 1I3NA 2IYOA 4GLOA 3OICA 2Y1OA 4EVIA 3VHRA 3CH6A 1E6WA 4TSKA 5LHHA 3GG9A 1DLJA 3PWSA 2OU2A 2I6TA 1RM3A 4YAJA 2QRJA 3IJPA 3E97A 3L9FA 2BGCA 4LG0A 1R12A 1M75A 2X1HA 1J0XO 2X0LA 3D0OA 2EFPA 2EA4A 3Q9VA 3J7AO 1JW9B 2VUSA 1ZBQA 4I5DA 4RPHA 4M9SA 1U9JA 2GNAA 1KYWA 2CF5A 3GAZA 5HS7A 1YB4A 1O57A 1VLLA 5DYMA 4H16A 4J7CA 5JCXA 3WLEA 1DBVO 2VBWA 4YG2F 3IIEA 2RNJA 4CM6A 3TZCA 3L9WA 4Z0PA 5J23A 3GPIA 2OBPA 2A61A 3KXDA 2BI7A 4R69A 3GGOA 3DZIA 4AJ1A 2X23A 4RVGA 1JU9A 3ZU5A 2OD5A 1U2WA 4GGOA 3PXXA 4ND3A 1BGVA 5IDQA 4CQMD 3KUXA 1FDTA 3V1TC 2OGUA 2MC3A 3GC6A 3VTFA 3A4VA 1TQPA 1QRRA 1QORA 2DUUA 3RUCA 4IXWA 5DCFA 4AICA 2GN4A 3W4JA 1IY8A 1BW9A 5COQA 4L4XA 4UVBA 1HXDA 3DOJA 3FN4A 2QYOA 4JK1X 4A03A 1IAWA 4E13A 7MDHA 6ADHA 3KETA 1A7KA 1XGNA 3RSHA 1I5ZA 2QQBA 2PMHA 3F8BA 3FF5A 2AA3A 3OIDA 2ZCVA 1PP8F 1D1TA 2AG5A 4BO2A 5LDHA 3BHIA 2AS5F 1E3LA 2ZJ0A 5G0TA 1DAOA 2KJCA 3HRUA 3LA2A 2HMWA 1HZZA 3C24A 2D1YA 1DIHA 1WXDA 4P38A 2E1CA 2GXGA 4IMPA 3RUEA 1F12A 1ZK3A 3LZ6A 3Q2KA 4HUJA 4DMMA 1T2KA 2CW0F 1EDOA 3BJOA 1VKNA 2J3HA 4C4OA 3N74A 2XRNA 1GDHA 4L4RA 2RHRA 3DTTA 3DEYX 1J5YA 4NZ9A 1UXIA 3V2HA 2JCYA 4HADA 4EBFA 5COAA 3VDRA 1YW9A 2P5VA 4CM4A 4CM3A 3CJNA 1DP7P 1HLPA 5HS9A 1KGSA 2H6CA 2V6MA 2A6HF 3PFWO 3QE3A 4JROA 3V8BA 1UZNA 3PFFA 4WCFC 5FF9A 4DIBA 4BQRA 2ESNA 4JJFA 4YA6A 2CQKA 2P8TA 1FP2A 3UHAA 1SBYA 3ANNA 4Y98A 5FI3A 3RWBA 1W5TA 2FR0A 4MIEA 4HY3A 4ALMA 3SXYA 1GXPA 3C3XA 3DHNA 3ULQB 1PJQA 1NPDA 5AXAA 3KYCB 2NNYA 4FJ0A 4C7JA 4M74A 3ANLA 1YJQA 3U4HA 1YKFA 1B6AA 2ZTLA 4XBFA 1BXZA 5GZ3A 1XDUA 3N58A 3E6CC 1HDCA 1VSVA 4NG5A 2FBKA 1ISFA 3DAFA 3HB4X 4IDGA 4CZZA 3OHSX 4KP7A 2IYPA 1OBFO 3JAMZ 1ADCA 1RYEA 3KM0A 5JYEA 1E6EA 5AYVA 3UF0A 1QLJA 3E3VA 3GW2A 4CLOA 1LBEA 3PHLA 3QJ5A 1SB8A 2RAFA 3K96A 3VB2A 3C7JA 5ER9A 1C0IA 4PGHA 4IINA 4BNMA 5L45A 3MEXA 2WV0A 3K1NA 3OEWA 3OQ6A 4O0LA 5A9SB 3E8XA 4FD3A 2BFMA 3ZWMA 1ZG5A 4RDIA 4W7IA 2GN8A 2JD0A 4S3MA 2IW5A 1QMGA 2A07F 2E1NA 3H6KA 3I9LA 1DPRA 2GZWA 2VODA 3QIVA 3BAZA 1ID1A 1UXKA 3D3EA 4XD2A 3WICA 2JL1A 2XOXA 4LB6B 2WMDA 2HQNA 3AJRA 3LQFA 4BO6A 4E30A 2HZTA 1P3DA 4PZJA 3E5QA 4J2OA 3OQ1A 4MIYA 1LRKA 3IKVA 1GAEO 2UZKA 1S7CA 3L4BA 1LQTA 2IA2A 1PSDA 4DUPA 3AY6A 3VZSA 2OZPA 2YV3A 1J5PA 5ILVA 4I9UA 1XG5A 4BXUA 1YQAA 1GHCA 1HETA 4I9HA 2FXAA 1D5VA 2WDZA 3S2IA 1U3UA 3MEQA 3I9MA 1JVBA 4P22A 2YHIA 4PLHA 3WTYC 2DBVO 4HV4A 4BNGA 5CDYA 2DTRA 3HN7A 1DOHA 4H3VA 2FU4A 2BKAA 4J2HA 4MJLA 4YJHB 2F5EA 4ALJA 5HM8A 1GADO 4NQZA 1IPEA 3RVDA 1T98A 3ROUA 4H7PA 3GHYA 4OXKA 4CLEA 5ILOA 3OJLA 5EEHA 1YTYA 4WWCA 1PWZA 2VN8A 1Q1HA 3SQNA 5DBIA 3RBXA 3ZU3A 4CMCA 2V6GA 2I9PA 4TRMA 5CPFA 3WX0A 2GERA 3LSYA 5D8KB 4FIZA 2PJPA 1YBVA 1O89A 3HJAA 1HE4A 1P9LA 2E82A 1UXGA 2W2KA 4IDFA 3VC7A 4EGYA 2Q8KA 1EK6A 3GOHA 4IGEA 3VH2A 1KS9A 2K4BA 3RBVA 1YS7A 5BMZA 1Z6ZA 1KYQA 2F5FA 3MJVA 5HTOA 4NFYA 3SBOA 4IQ0A 1WZEA 4LD5A 3I0TA 5LC1A 5DUKA 2TDXA 4ZJUA 1D3AA 5T67A 4YWJA 3MWMA 1G3TA 1QXSA 3PJFA 4PZEA 5EN4A 5FYDA 1WZIA 2FOKA 5K6AC 3UH1A 3M7GA 1P1FA 3BHMA 1PGJA 5HWSA 4IHTA 4CL8A 3HOSA 1TT5A 3JAMK 4TVBA 4LK1F 5D5UB 3WXBA 4E6PA 1U7HA 2C6YA 2GF2A 2OQRA 5L3DA 1HTBA 2X8LA 2X58A 3DMYA 3K2BA 3GDFA 5A05A 2GA1A 2Z1MA 3KYDA 1ORRA 5L3FA 5LRRA 1FBSA 1BVUA 4M9XA 5JHUA 2Q1TA 3I3OA 4WLOA 5JCJA 1I8TA 2EFNA 5KIAA 5L4SA 1L7DA 3K6JA 4ETSA 2VRBA 3B70A 3EZYA 3BJAA 4G5HA 2KKOA 1G6KA 2VUTA 1E3WA 1JTVA 1Y8QA 1V9LA 2PN6A 4PG4A 3G3EA 1XR3A 3EYWA 3AY3A 1MFPA 2AE1A 4E5YA 4CMHA 4MVJP 3H5AA 4YQYA 4DXHA 5D5WB 5H6QA 1PIWA 1R16A 2GQQA 1B2LA 2R00A 2ZJ1A 1FC3A 1EBUA 3O26A 3WMXA 2E49A 4UV9A 2DFIA 3V7CA 1S6YA 4G8XA 3ZHBA 5IN4A 1P4AA 3KZVA 1CF2O 4YFKF 1C14A 2Q45A 3FRJA 4XQEA 3GPDG 3EUWA 2FA5A 2BFAA 3GZ6A 3PK0A 3GLXA 1CQJA 1LDBA 2C5EA 2CY0A 2B4QA 4UUMA 3ZU2A 2CDBA 4RV9A 2ZYGA 4TROA 4CODB 3WTTC 4HA8A 1ADGA 1C1DA 3TO6A 1ONNA 2JFGA 2PLAA 4MKRA 4XEHA 2VXZA 5BQTA 3T7EA 2DTEA 4DQVA 5ICMA 2JAHA 1FZPB 3CUQB 2GXBA 5J8FA 3FPLA 3JQ6A 4IZIA 2O50A 3DAGA 4N9IA 1NQ5A 4NJMB 3T8TA 3EVTA 4GPD1 5BSHA 1T4DA 1BBYA 3W8DA 1P31A 2FP4A 3NT4A 1ZK1A 5I7SA 1ZAOA 5IFLA 4AIKA 4N0BA 1JAYA 2FE3A 1SNYA 1EE9A 1Q2XA 2HK7A 3IUPA 3JD2A 3JQGB 4OMUA 1XN7A 2X4HA 4B7CA 5CYVA 4MEYF 2G5CA 5T57A 3ON5A 1NYTA 3BMNB 4KOAA 2QVOA 1U2DA 4TVOA 3U09A 2Z5UA 3CPSA 3JQ8A 5LEJA 3MJ4A 4D0RA 3FNGA 4BO3A 4W9NA 3BTSA 1P1HA 1SMKA 4HW0A 3FHZA 4JP2A 3TDUC 2NU7A 2RV8A 3NGLA 5EIOA 2HJRA 3G1TA 3DR3A 3JD4A 4AFNA 3ZW9A 4BB6A 4YT8A 3DBRA 1ZGJA 4BAYA 2DPHA 2W8ZA 2JCXA 4GSKA 1ZXBA 4RZIA 5DDIP 1XSEA 1KEUA 2DU8A 4B4WA 5B12A 4BYYA 3IJRA 2G7HA 1FDSA 2HEOA 3C18A 2YV2A 1B7GO 4HFRA 2D1HA 2Q2QA 4L74A 2AEMA 2NVUA 3LF2A 1S8NA 4CLHA 4L4SA 3CXRA 3D5QA 2CDAA 4TWRA 5EESA 3IUSA 4NBTA 3HTSB 1O95A 4M49A 4YT5A 3JYOA 1XHLA 2GO1A 1UUFA 4P55A 1IL0A 3ZI0A 5BPDA 4E5MA 2XKOA 3HN2A 2J5RA 1J59A 2PD3A 5JSFA 2KRFA 4RLSA 3RD5A 3HRSA 4FHTA 2D1VA 1Q1NA 4BOYA 1Q7BA 4HYEA 3RI3A 2A94A 2QRLA 4LGVA 2GPTA 4RL6A 4BGIA 3NYWA 2WD8A 4BO1A 2PKQO 1SEPA 3TZKA 2DC1A 1G3YA 3QPHA 1UJMA 1MC5A 1BDMA 5JO0A 3FM3A 1A27A 2JRTA 1MC4A 5FD5A 1Z05A 5L3EA 3P5SA 3M1LA 3CZMA 4KMFA 2WM3A 5ICSA 4AJLA 3LQRA 4KIFA 3KP2A 2ZTMA 2DQRA 4OKIA 3ECHA 1BWSA 1TW3A 2CMDA 3H3ZA 1HKSA 1EVIA 1E2XA 3GUCA 4KMSA 4MGRA 4XWYA 2HK8A 4ZYDA 4CQLA 3DTYA 2DT5A 3GAFA 2LSOA 4CL3A 4D45A 3OMLA 4HF0A 4R1HA 2P7CB 4FPXA 4N9HA 4XGNA 3SC6A 3OP4A 1DC4A 4YJGA 2K4JA 1W7PB 2HK9A 2VHXA 3O03A 3PDJA 1JKIA 5EINA 4HQMA 5J8CA 1T2AA 5G0VA 1IUKA 1RWBA 3H2SA 5AONA 2RGVA 3HWRA 4EEZA 1R0KA 1IXCA 2JCVA 4QFDA 5JE8A 1R1VA 3MZ0A 1MFZA 1SB9A 3FMRA 1ZZEA 2FSSA 5EJ2A 1SCUA 3TZHA 3BHJA 4ND2A 5F1KA 4CMBA 4LMPA 5CG2A 1F06A 1W0CA 3FHLA 4M6YA 1PGOA 5B37A 1I3KA 3ITDA 2VE9A 3R1IA 3NTOA 1XCBA 4O59O 3S1LA 5LGTA 2E4AA 1SFUA 3NGXA 1GEGA 4FCCA 3TNLA 4CGZA 4DPMA 1VSUA 4K6FA 2QZ9A 2O3UA 2WWRA 2CVOA 1I33A 1LX6A 4I7HA 2IPQX 1ZARA 4EJTA 1DSSG 4MKXA 4UNOA 4E5KA 4EUFA 3H3JA 4A0SA 1A5ZA 2RDPA 3CLOA 3ZN0A 3FF4A 3U49A 3AOEA 5L3ZA 5A3VA 4CJXA 4HX8A 4GKBA 5K1YA 3GNSA 4ZQBA 4BKPA 1Y8RB 5F21A 2DBBA 1IN4A 4FSHA 3VZRA 3DBHA 1LC3A 3M2TA 4EM0B 4OIPF 3LWFA 3JQ9C 4N5LA 3VKVA 5JDCA 4DWVA 2YW9A 1U7TA 5I7FA 2FF4A 1MGOA 3F72A 3R61A 2HYGD 1YOVA 5I8ZA 1B0AA 2ZTVA 3GZ4A 4DBZA 1H2BA 1KU7A 3HRTA 1ZK2A 3E5UA 2FSVA 3F21A 3H65A 3JYNA 4URFA 3RJ5A 1C0KA 3GK3A 4R3NA 3CSDA 1WAMA 3VZQA 3FNEA 4OO3A 2A6EF 1A7AA 1DC6A 4P4NA 3CO7C 3VPHA 1BJAA 5EMHA 2UYYA 3ENNA 2JD1A 2PQ8A 4E5PA 5KOIA 1PU2A 1H9TA 2FPGA 5A5FA 2ELHA 1HYHA 2DO7A 4ENMA 5E18F 1GUFA 4A12A 4B7UA 4G81A 4OXNA 3INGA 3DQVC 1CYDA 3OF2A 4HZFA 5A9RA 3TKYA 1LI4A 4L8VA 4FFMA 4RVFA 4U5QA 5KWEA 4IY1A 4QLCU 2EG9A 1YL5A 4BNYA 2MH2A 4U6SA 3LK7A 5HS8A 2E7WA 1YE3A 4L0QA 4UVCA 3L6OO 4YDRA 1E3IA 2V6CA 4YTEA 5B1YA 5C7IO 1KVQA 4UVAA 2CGPA 4B8XA 4A0YA 4UEOA 4RB1A 5CDGA 4FC7A 4R1NA 3RIRA 2ZB8A 3VVCA 2O3FA 3ONEA 4CMJA 2EXXA 3E6DA 4A7PA 1T25A 4HOBA 1ADBA 3LYLA 2C29D 4DGSA 5T5QA 1R1TA 1C1XB 1U8FO 2PTGA 4XYEA 1K6XA 2HRBA 1XDWA 3GVCA 1T2FA 4L73A 4E3ZA 1TNTA 4LK0F 2O61A 5A2QZ 3NTQA 1U3WA 2XAHA 4TMFA 5KJCA 4E70A 4JP3A 4EJWA 2P5UA 3KP4A 2PGJA 1DC5A 3C1TA 3Q11A 3ST7A 2PY6A 2W2LA 4BNKA 1F1ZA 2HDCA 2HAEA 5J6XA 3ASVA 1DIBA 3FZVA 3DHYA 2ESHA 4BS9A 1UHWA 3F5SA 2RBEA 4LRSB 4YT4A 3HYIA 2STWA 1ZLJA 4M71A 1I1GA 3B6ZA 3D7LA 3G1UA 4GLLA 4WLFA 5JC1A 2IODA 4N54A 3GEMA 2B35A 3PLRA 4ZQEA 3H92A 1P1KA 2DTDA 2WYVA 1XGSA 1W4ZA 1ULSA 1W8DA 4L9NA 1ZK0A 4UULA 4CYDA 3E6AA 1TEHA 3V2UA 4KN7X 4ALNA 2UWMA 4CM1A 3BXXA 3WIDA 1XWFA 3JYQA 4YJFB 4CXFA 2FBHA 1WP4A 5EPOA 5CJ9A 2CG4A 2IZZA 5JYDA 1BXKA 4G2NA 1NVGA 3PQKA 3UCFA 3LDHA 4J4BA 2VC1A 1V35A 4E31A 2DLDA 3GMSA 1NPYA 1B3BA 5JAMA 1Q0HA 2B0JA 1ONVA 1S7OA 2CVZA 4DQ2A 1DJNA 3LT4A 1QP8A 3ZDFA 3BMOB 1QZZA 3NT5A 3VKUA 1FWZA 5BNTA 5KK1A 1HDYA 1FSHA 1T2DA 1SOWA 2OXIA 3BMCB 1G6NA 4PFJA 3L09A 4G7ZF 1R36A 3QWIA 3R60A 2NNLD 4WF2A 1SD7A 1B16A 2K7LA 3AUTA 3DQPA 3HTUA 2VNSA 2VBZA 1L7EA 2Y1EA 3GVAA 3OJ0A 1SD4A 1IUYA 1SC6A 2D5CA 1E17A 2VYVA 3FX3A 1U28A 1CEQA 2V6FA 4PRLA 2OAZA 1ZEMA 2QQ5A 2VWQA 1HSOA 3WGHA 1GXQA 3QQPA 4GH5A 4JJGA 3S2FA 1XCVA 2YQ5A 2H6EA 4HX4A 2EFQA 4E2ZA 1OYWA 2G76A 2OO5A 1LRJA 3I4CA 5BR7A 2HFHA 1F14A 3DZHA 3W6KB 2FR8A 2CWEA 1ZG3A 3FWEA 2VHVA 3AU8A 4CV0A 5L53A 2KIUA 3DZJA 1H9AA 4E12A 1KQ9A 3NX4A 1PGPA 2O3QA 1ZYRF 2EWMA 3K2EA 3ETEA 5A2QK 1IB6A 2QX7A 2VT2A 4DA9A 2A68F 3I58A 2M8EA 3QP5A 1JXSA 1UDCA 5AVOA 3PQEA 1S3JA 3TDZC 1LUAA 1B8UA 3U4IA 4XCVA 5FFFA 3RUAA 4PIVA 1BVRA 1F8GA 4LCJA 3GFLA 3ZHZA 2RVCA 2C82A 1YL7A 2V79A 4FX0A 1XB4A 2FRHA 1DEHA 1R4NB 2NWQA 3JQEA 5TF4A 3RKRA 1BRMA 3WQRA 5MGBA 1VPDA 2YZ7A 2Y48A 2HR3A 3PHIA 3W8EA 4BQPA 6PAXA 1GYRA 1K78B 5ENDA 3BTVA 2NQTA 4DL9A 2VCYA 1Z45A 4XDYA 3ZWAA 5F3RA 3D5LA 4HV5A 1V3TA 3WFIA 1W73A 3HDJA 3TPCA 4ENJA 3KTDA 1NVMB 1Y7TA 5KJEA 1CIVA 1LSJA 1I6XA 2HWVA 1LEHA 2VN2A 3RUFA 2XUBA 2J5OA 1ULUA 4OHUA 5IJZA 3LA7A 3EC7A 4D3FA 1T26A 3QW2A 5T6BA 2P5YA 5CLSA 1YW7A 4M54A 2D4AA 4U0KA 3UKOA 2DPGA 4BNNA 5ILSA 3B1KA 1FPQA 2F1KA 2NVWA 5A9TA 4L76A 3ML6A 1BXGB 1KU9A 1B9MA 1ADFA 3EZLA 3HFGA 3HUDA 3V1UA 2HUNA 3WMWA 4RVDA 3LA3A 2PH3A 3MCVA 1H9BA 4Q3BA 3N4MA 1Z75A 3PLNA 4N5NA 3RC1A 2OUIA 4JIGA 1R00A 4I8XA 5TS3A 1R23A 3GA0A 3MJSA 2F2EA 3JTGA 4FFNA 4NU5A 2Y0EA 1Z91A 1MXHA 5HRUA 4IVNA 2GSDA 3IKTA 5D4RA 3GYHX 4J1QA 3I59B 6LDHA 2VYVD 1VKOA 3HSFA 2XF8A 3JTHA 4OIOF 2FWMX 5F1PA 4XGKA 3TOXA 5HS4A 3HSEA 2Q1UA 2Y1DA 2LF7A 5EEGA 3LSTA 5AXDA 5BT9A 2H09A 1FDUA 1HLDA 4CM7A 4BNFA 4BKQA 1VL0A 2L3DA 1E7YA 2I65A 4BO5A 4BL5A 4FOOA 4EJMA 1HT0A 1UXHA 1K6JA 1A9YA 4WKGA 3TN7A 2NVBA 2OHXA 2CYYA 2EV5A 3I64A 2DM6A 3ICCA 3RASA 4OL9A 5JFOA 3AI3A 4A0ZA 1BI2A 3C7DB 2B5VA 3L4BC 5CVUA 1IZ1A 4P8RA 5DCMB 4WECA 2QWWA 4PG6A 2BGMA 3B1FA 5JMWA 4NH4A 1QV7A 4XR9A 3DAPA 1K6IA 2YFQA 4PCVA 2YDXA 2FZWA 1F17A 5JAQA 3UW3A 4GSLA 2ZNYA 4KQXA 1KVUA 4JJIA 3I9JA 3OIGA 4YACA 3C7AA 3HDHA 4FFOA 1KY4A 3I71A 5LDGA 2R3SA 1H6CA 3DMTA 5L3CA 1PJLA 2P7VB 1XGKA 2O03A 3Q6IA 1UZLA 1LSUA 3V1YA 3I4PA 3I1JA 3PZRA 4ZQGA 4G94A 3ZH2A 2HYFA 3KYCA 5IF3A 3ABUA 1FSEA 4RB2C 5JDIA 1PJSA 3R3SA 5FB2A 2M1BA 2R7FA 3BDDA 1KC3A 1PUEE 3LLSA 3ONDA 3W6JB 4P5OA 5CVIA 4ZZDA 5JVTA 3K30A 1NTOA 3L77A
chains in the Genus database with same CATH superfamily
1KFJB 4X90A 2GAOA 1E32A 2BE7A 1LJ9A 4FMCF 5JJIA 1YCHA 4TQGA 2PEXA 2ZT7A 5LLSA 3RYFB 3GF2A 1WBBA 1DPUA 5D5XB 2IFTA 5DBOA 2FHPA 1ECLA 3S2ZA 2PGOA 2Q1ZB 2R93J 5JMPA 2HZ7A 3HVRA 2QU8A 1ISMA 2PMZN 2HU9A 2ZBUA 2CEKA 2GEBA 4MVJF 4RLHA 4ZREA 2RGEA 5CB4A 4H1VA 2YC2C 1EWTA 4K3VA 4QDXA 1P72A 2HQRA 4RZXA 1QE5A 1E7QA 5AKEA 5LR6A 3MM4A 3DAOA 2WF5A 1RT9A 3F46A 3I01M 1OGYA 5TR9A 3AVXA 1Z7BA 1XA0A 3U7GA 4F5EA 5CRIA 4WX9A 2UYCA 3GDGA 5LGNA 4EGSA 3NM4A 1D5WA 1DDIA 1QYVA 4CIXA 3EGDA 4DTCA 4QLOA 4M36A 2IA1A 5T8KA 3KRTA 1QS0B 3K8QA 1X9IA 1TVEA 2BT4A 2ZQYA 2HSZA 2VJMA 4Z4GA 4V2GA 4LLNA 5KTRA 3WGYA 3WLSA 2E5WA 4HQKA 3OQMA 1N5RA 3R0JA 1XDSA 1I50J 2VJIA 3W8EA 4MR7B 1VL8A 3GPBA 5IWAB 3OEEA 3DPTA 4BV9A 5EG5A 4BGVA 4J0EA 2IP4A 1M2EA 4J0HA 1B93A 3C3BA 2JIOA 5L3SA 1F38A 4B76A 1FDVA 3PM1A 4NR0A 2IYFA 3GTPJ 2BJWA 4KQWA 3LNCA 5ILGA 1NVVR 5IUKC 2HY7A 3MJHA 4OK3A 4HQEA 2BV3A 3AF0A 3ZQ7A 2A1IA 1UAYA 2HNBA 3FBGA 2L5QA 3ZX5A 4F2HA 4F8YA 3BT9A 4Y2XA 4KE9A 3A6GA 4UCXA 2ONKA 4N6OA 3VDXA 1YACA 1O3SA 4ER0A 3C8HA 1USTA 2KISA 4E03A 1L7RA 3C1OA 2YZGA 1J1IA 3RLIA 1ODKA 1UP6A 3HB9A 2G70A 1X2MA 2IIVA 4BC0A 4R8HA 2HDDA 1Q83A 2GPBA 3L0BA 2WYOA 2X5OA 5CLFA 4OM8A 1TKRA 4R5MA 4TTIA 3WYFA 4MGZR 5JCZA 5A7FA 4M9RA 4Y6RA 3LNQA 3NGMA 4R01A 1MQ9A 4QC2A 3EGVA 1I1HA 3STWA 3SX0A 5IVHA 3OYDA 1X2BA 5JXIA 1QV6A 4DG9A 3LAWA 4LRWA 2X0DA 4LHEA 4YLEA 5AVJA 3A06A 3F9CA 2YZMA 1AOXA 4YCJA 2HS5A 3P1JA 1N3LA 2Y3IA 3OYNA 2CHGA 4E88A 4YUAA 1JUSA 1XVIA 3P2KA 2F4IA 4F4JA 4MVJH 3QODA 1YLFA 4K2AA 5FNVF 3LUPA 4ND4A 3UAVA 4Z7JA 2WICA 3M1YA 1QOPB 2DK5A 3BG6A 4YJFA 2XA2A 1REQB 2MOKA 4QDJA 4RA2A 1TZBA 4P3XA 4MUNA 1NM5A 1TTYA 1P9OA 1K7CA 3H5NA 1KI4A 4RIEA 1PQUA 2YS9A 1JLLA 3QU7A 2ELJA 2P4QA 3ZDXB 4E7JA 3D0SA 4BB5A 4PX5A 1HLGA 2V7XA 4NCHA 5B6IA 3KPVA 1T9BA 3UTCA 2BYTA 1GTSA 2VKVA 4A23A 1CUIA 1LB1B 5C9ZA 5I7RA 4CYMA 1P1RA 1XP8A 2I1WA 1N6LA 3CR3C 4YAWA 1RZRD 1SXJB 3C5HA 4X1IB 3B1YA 4B6OA 5K0EA 1JJ8C 3NHBA 4C2BA 4K46A 4HDAA 4RQUA 3L05A 3KR0A 3AR7A 4HJXA 1RUNA 1BU5A 4JODA 4QBTA 1ETWA 1Q3KA 4R84A 1RW4A 3TZ6A 2X40A 2L9NA 2CJFA 4HZUB 3SU8A 4NBUA 3D8HA 4CZ2A 5HRCA 5L9AA 4OBBA 3A1SA 3EXAA 2NV2B 1DG1G 2V45A 4D42A 5FNVB 2HPVA 3PI6A 3SK0A 5FPSA 1OD6A 3BULA 1Z5WA 2VTEA 2FN3A 3FD8A 1TTHA 3FYTA 4ZYHA 3GFIA 4HI0E 2A33A 2IX9A 3LSHA 2O23A 2BP7B 4L5CA 2TMDA 4GXOA 1HX7A 5CA1A 1MOSA 2SBTA 2OENG 3D8NA 3TOCA 5JV5A 4Y2UA 1PK9A 3O8CA 4WTOA 4S0XA 4EF6A 4ILEA 4BNDA 2COUA 5JBQA 1ETYA 3Q3SA 2CC2A 2AMLA 4NNPA 5TQ2A 3AG6A 5BN3A 3H7AA 4LJSA 3WTBA 5DM70 3OOHA 4GBJA 3G7NA 1WKVA 3B02A 1GKLA 3DEWA 3GA7A 3N8IA 4Q00A 1JEDA 5A3RA 1SFEA 5CB0A 1V4NA 3FJ1A 5DKFA 2W24A 2PT7A 1E3OC 3GLFB 4OBEA 5JH7A 1JHUA 1O3TA 2NQ2C 1IZ7A 4G8JA 3DD5A 4ETMA 1A71A 5AM0A 3T1TA 2HWKA 1IQUA 1SOMA 3RUIA 4LC9A 1DXQA 3DXJF 3D6HA 3L49A 2ZQZA 4M1QA 3WDSA 3ZZNA 2VWPA 1K7YA 3QBJA 3IVMA 4NUBA 2RGXA 2YVQA 3K71B 1MO5A 1P19A 2FPPB 3S1RJ 3OE7D 4II2A 2HNHA 4QPCA 4KLNA 2GMWA 4EP1A 1CS0A 4WZ6A 3IVRA 3H2YA 4EY7A 1G8YA 4HNSA 3AYXB 3X43A 2HT1A 1KY2A 1CQZA 2XXAA 2X0IA 4I4CA 3ZC3A 3ZWXA 1U9IA 3H3XA 2B83A 5ALOA 2H9YA 3MRXA 2QLNA 3TVDA 2H5EA 3FDYA 2XOKA 4S1NA 3F6OA 4W9NC 3ZQLA 1LBQA 1BE1A 3KC2A 2GHIA 4PWZA 1F1JA 2ZYDA 4GBGA 2Z1NA 4WCDA 1FMCA 1C0PA 3RVQA 5DI9A 3P97A 2OFPA 3FVWA 4AMZA 2P91A 1XELA 5SYMA 4ZO4A 1U4NA 3LX8A 2BEOA 1YASA 4L0CA 4M0PA 1E2IA 4IEFB 1BVHA 1HEUA 3OOPA 4CM9A 2LMDA 4D8XA 1P0PA 3H42B 3FG9A 1DGRM 5LMNB 1C3VA 4RTQA 3F8MA 2C1ZA 2RAPA 1UXJA 1XDDA 3M8KA 2G4LA 2G6BA 5A2GA 3GTMJ 1KXZA 2QNBA 1F8FA 1FFHA 2UKDA 2X42A 4L9RA 1WD7A 3S40A 4IL5A 2O8EA 4L0ZB 3M2PA 4ND8B 4TLMB 1Z88A 4IUYA 5F4BA 5JPIA 1UMDA 3RFVA 3V1LA 3S32A 1NVEA 3M6UA 4XLFA 5GPBA 4PGGA 3NHKA 5JW6A 2BR3A 4JLDA 4YMWA 5DCWA 4MKHA 1MC8A 4JNKA 1WBDA 4PHFA 4RKYA 3RU9A 2O4UX 2BRUC 3PGKA 2AX4A 5JDCC 3VR6A 2GA2A 4BQSA 3RSNA 1DU6A 1U8TA 3VYWA 2ADOA 2H4XA 1U0BB 1T6ZA 1D2HA 1XTPA 3T7CA 4EJ0A 3W2HA 4MS1A 4R79A 4BX0A 3BMQA 1AV7A 3BY6A 3VR5D 2P4EA 3ZDZB 3BAFA 1N6IA 1DT5A 2YV1A 4ZYAA 1H1DA 2DBZA 4OOFA 4BJ5C 3VSAA 2JGIA 5DGTA 1IIBA 2N75A 3DKWA 5ICSA 1KDYA 2ZRHA 1SPXA 4TRNA 3VR4H 1POXA 4QO7A 1W2HA 1JXMA 4LZJA 3PJEA 4BVHA 1S29A 5BMVF 3NBAA 4R1TA 5DYYA 5BP7A 4RK5A 1W5EA 1BJKA 1I3OA 2EDCA 1ZRNA 3KYDB 3QHPA 5K5EA 5CCXA 2BXYA 4V0MA 1H42A 1EJ2A 4AVPA 4CNBA 1C4KA 1E3WB 1T0FC 1MO3A 4FI3F 2V8OA 4E0BA 5DN9A 3Q87B 2O7NA 1Q0LA 4RIHA 4F4CA 2O4CA 4M8LA 3HG9A 4L27A 1AK9A 1A5SB 1WH7A 3SJ7A 1N1MA 3FNIA 1BE8A 5CLIA 1M9NA 2LNDA 4G0UA 3WNDA 3LL7A 5HDNA 2JC3A 4ZI5A 1GWNA 1X86B 4OA5A 1Y9JA 3BCAA 3UK7A 2WJZB 1FK8A 1GGEA 1XTAA 1T1SA 3DBRB 1D1PA 2C96A 2ENWA 2FZEA 1N5KA 5EIXA 2EGHA 3AR2A 3Q5FA 3IH4A 4O2LA 5G4KA 1T2VA 1P0FA 4JC5A 2VL7A 3WRYC 4RPJA 1Q15A 1R8JA 4L5YA 1OYYA 3BFJA 1TUEA 1UKZA 1WD5A 1IU9A 2ZWMA 2YCBA 1Z5UA 4CKCA 2GM5A 4ERNA 4XJXA 4DAOA 2E71A 2OBNA 3INYA 5CVRA 1JEJA 4R8MA 2B1QA 2EKLA 1ZJYA 3ASZA 4EHAA 1OREA 2O6GE 4HS4A 3QGMA 4D9GA 1QHHA 4LPKA 5EP3A 3HL0A 3QKRA 5BMVB 2Z99A 1AHIA 4V0LA 3A4NA 3MD9A 4MDFA 3ZXXA 1TYZA 4FFRA 5ELMA 2E1MC 5DOZA 1TI7A 2IP2A 3R7DA 3JXEA 4PZ9A 1DS6A 2AZTA 2EFWA 1JE8A 3MTEA 1OTXA 1ZNQO 3C39A 4WRRA 1E2QA 1IK6A 1PKEA 2YYYA 4JZKA 1YIAA 2AZDA 4XA8A 2Z83A 3QVOA 1TAGA 1FZQA 2H2IA 1BX0A 1YJCA 1SWWA 1NOKA 3A4LA 5G0UA 4LYEA 3D43A 4WK8F 4I5FA 1YCFA 1SU7A 4B1FA 4BDYA 3PA8A 4HWTA 4BDSA 1GUAA 3TQHA 4EABA 1NDQA 4R51A 1EXVA 5JU6A 5KINB 3QOYA 5FTJA 1HDEA 4KFCA 5KVSA 2JVKA 3KQKA 3ZD6A 4FFWA 1Z62A 1F2VA 3LKVA 1N2XA 3ZV4A 4FE3A 1IZZA 3GO5A 3BRSA 3GN1A 5BQPA 1TA4A 4BE7B 3WLPA 3BQMB 5K3FA 2HTJA 3C6ZA 4KR9A 5JNWA 4OINF 3IQGX 2HXYA 4PG7A 2V6EA 1WXQA 4LUCA 1D4ZA 2P8JA 2V7FA 4LW8A 1CYEA 5CT9A 2XF7A 4Z9AA 3I6BA 4JYKA 3QEKA 2OCEA 2OZLA 5GY7A 4PLPA 2BGWA 3PIDA 1N7IA 3TOVA 2VDWA 4XM0A 2GA8A 5HVQC 1BKDR 4NBVA 3TXYA 4Z7QB 2IS4A 2WC1A 1ZRHA 5AVZA 4B3AA 3D2AA 2ZP1A 3L6EA 4WN9B 1NBOA 1M8FA 2AF4C 1D3YA 2VXBA 4FOSA 4TZ6A 1X0VA 5G0SA 1H66A 1EFRD 5FADA 1U04A 2BMFA 2XADA 1A2QA 1S2GA 4LYYA 4YRJA 3OICA 4U9HS 3E97A 4UNRA 4M9SA 1SG9A 1DJMA 3WLEA 1M2OB 1T3LA 5J23A 2WQ7A 1U9ZA 3DZIA 2XWBF 4PZZA 5SYNA 3SHQA 1JU9A 3OZSA 1L2TA 4TZ0A 3WWOA 4JLAA 5DCFA 4AICA 1TMYA 4TYNA 4EKYA 3P9YA 2QQBA 1UJCA 2GCNA 5L6LB 3WIUA 4F11A 5G0TA 3EVCA 4P38A 3ZD8A 4DUYB 1V5FA 2QN2A 4JL6A 2P6RA 2I80A 2ZWPA 4G9GA 2PLRA 4N7JA 4AF6A 2CQKA 3UHAA 3ANNA 2C78A 3RSSA 4CIBA 3SXYA 3LIPA 1GAWA 1GGNA 5C34B 1E5DA 1HA3A 4BZQA 2TSYB 1R18A 4V19K 2R0QC 2PV0A 2Z5GA 1QLJA 1DWQA 4MYTA 5ER9A 4O0LA 4KKXB 3NIBA 3BAZA 3ND7A 1TZJA 3PFYA 5HILA 2CLOB 4KXYA 5E3MA 1P2SA 5HOEA 3FXMA 3HN7A 4J2HA 4BDZA 3ZQGA 5JFGA 4DR6B 2IT1A 1ZBDA 2JNWA 1WHTA 3OX4A 1P9LA 2E82A 2P8SA 1MSEC 1GRVA 4BVKA 5GGYA 3IMGA 4DRXA 1QH8B 5T4FA 3SZGA 4HRIA 1PI3A 4BPBA 1H1LA 4LRYA 2EFNA 1R8YA 3NORA 1EDEA 4XONA 4RDXA 2XUAA 3B8HA 1J7JA 1YA4A 5JWOA 2E49A 5DNDA 2GN0A 3GPDG 1QCYA 2Z8YM 2V9PA 1M33A 2CDBA 1ONNA 3TXXA 1ECGA 3FPLA 5J8FA 3EVTA 2IH5A 2FP4A 3OVMA 2BH2A 4N0BA 3JQGB 4U39A 1VBNA 4KOAA 3ECAA 4NXMB 3THWA 3U09A 3SQXA 3JQ8A 3P9NA 4O29A 2J5XA 2ZYUX 2IGTA 1T9GS 3L6RA 4HATA 1OWNA 2W8ZA 2EOAA 5C81A 3REQB 3KSRA 2KLHA 3CVYA 3A4IA 2H4FA 4PJLA 3SQMA 3HTSB 2RGGA 3HBLA 2SHKA 1AF7A 1JMKC 3A4CA 2EX0A 2SKDA 4XFDA 1XVUA 4JKIA 5FD5A 1M8GA 5FJIA 3LA8A 2ZYSA 2CL6X 1HKSA 1CZHA 2HK8A 4CQLA 1XFAA 3Q7QA 2FMXA 4FPXA 4HF0A 4PZ0A 3OP4A 3PDJA 3F49S 3O03A 2DFLA 3FPKA 4EEZA 3S8EA 4QGFA 2FSSA 3BZWA 4JFAA 3DTIA 3WKAA 1V5EA 2ODEA 3ABMH 5B37A 3ITDA 4Z1OA 2YJTD 2AYZA 4FGJA 4K6FA 2JFPA 4MGIR 4Z7OB 5KQRA 4UNOA 5GM1A 2GAJA 1YIDA 1QHEA 2WVJA 3DLCA 2XSZD 2NUTA 3IOCA 4R7ZA 1GM5A 4BFTA 2R7XA 2B34A 3ANSA 4EPYA 2VQLA 4RJ2A 3GDHA 2C2MA 2J3MA 5JASA 2A6EF 1QJ4A 4JT4A 1TVMA 2CVFA 2PQ8A 3X1DA 4WK0B 3CBGA 4CFSA 3DNMA 3L7MA 3BG7A 3S2UA 2DWOA 3L1UA 3CF6R 1MBEA 3LK7A 4YDRA 4KQKA 4MLPA 1PDOA 1OIVA 2Z4SA 4CMJA 1T25A 2CFSA 4Q7KA 4J6EA 5B5EC 1K6XA 1Y1SA 2HRBA 4G0MA 1LF0A 4YJ3F 1V55H 2XAHA 4RKEA 1F1ZA 1XPUA 3VM6A 4NYMQ 1VECA 2ICAA 2UYQA 1G66A 3QVGA 2IYTA 3B6ZA 2GZRA 4E21A 5EKSA 2ATIA 4NSNA 4ALNA 3ZR4B 3HKDB 4OREX 2XQVA 4B43A 2VG8A 3UA4A 4EK9A 1AHDP 4JI6B 3D5EA 4MUYA 5A7GA 4KPYA 1G55A 4KFTA 3TEDA 4I1VA 5BR7A 3PQ6A 3IAFA 1KQ9A 3NAZA 1R10A 3INNA 2O3QA 4F4HA 5FEMA 2IJGX 4X92A 2A68F 2M7BA 3U4IA 1SFOJ 2Q5LA 3P71T 2CQ7A 5B1AH 3GFLA 4QE3A 5BNGA 1JTEA 3CCCA 1Q92A 3LUDA 2HR3A 2RREA 2NQTA 4GMXA 3LECA 4FIDA 3OFNA 1EAMA 3R3UA 1CIVA 1LSJA 3G85A 2L0KA 3OZDA 3P9PA 4TKVA 5EVJA 2GCPA 5EMNA 3KOWA 1JJ7A 1YW7A 3PE3A 1I0IA 2R6R1 2B4KA 3EZLA 2XVAA 2HUNA 4ZEVA 2FW9A 3MCVA 3I2GA 3N2EA 1T35A 2MYPA 4E7SA 1RWMA 3V3TA 4YJ3B 2XQJA 4D3YA 1ZQ9A 4XGKA 2Q1UA 5EEGA 2UUCB 4FTHA 4PFOA 1CZRA 4BO5A 4EFLA 4U7HA 4WKGA 4JUDX 5K7ZA 1E5TA 2PX8A 1ZNYA 2HTFA 2ZTSA 4ZVQA 5HTKA 3PUZA 1JIQA 2UZAA 1QV7A 5LBIA 4EKDA 4EDHA 3I71A 5B7QA 1R5BA 5IAJA 4EY4A 4FP9A 3CRVA 3WZMA 1X87A 3GV0A 5CK4A 4GM1A 3S7TA 3R3SA 1IM2A 3W9YA 4HDKA 1KC3A 1H9GA 4NARA 5E2IA 2KFDA 3CLVA 2W98A 4CV3A 3K72B 2JLUA 3L2UA 1XCMA 4YRBA 1JWBB 2R8ZA 3NCTA 1RPJA 2V1UA 2P40A 1SO8A 1MRSA 3OQOA 3SJCA 2XYPA 2IUFA 4D2IA 4MB2A 3NWEA 1BRTA 1DHTA 4ER5A 4WGFA 3TLCA 3K4LA 4NV0A 5AJTA 4C7KA 3D2BA 5MHTA 2SICE 1GZ5A 1P4RA 1J06A 3IAAA 3WMGA 1O6CA 3GLVA 3LCCA 2OQVA 4HLXA 5DNWA 5H8WA 1GGJA 1XJQA 5LA6A 1ZUD1 5AJUA 3H2BA 3WSWA 4CHGA 2I3ZA 2JHFA 3ZKAA 1WDMA 5ALPA 4MA0A 4NPCA 3N8NA 5IABA 3S1MJ 2CZCA 3DU5A 4K05A 3A03A 5KX5F 1P5JA 3O90A 2DMRA 1WXGA 1H0MA 4RFSB 4HNRA 2FPSA 2HNAA 3CRW1 5DHAA 1YS6A 3OSUA 3BA6A 2NZ8A 3J7AC 3WDMA 3W77A 2A1TR 5DXAA 2CXTA 1XWIA 3K94A 1RRKA 5AUPB 3PJGA 3E5NA 1U78A 1MTOA 2H7VA 3EQ6A 2IDZA 1ZDMA 1P2DA 3RGGA 3PX3A 2YIJA 2BJHA 2C83A 3FPEA 3DZKA 3DDNA 3BCRA 3FYUB 4B45A 3T06B 1JKPC 3M9WA 4O4LA 3NKFA 4XM3A 3MGKA 1ZUHA 3UZUA 5CG1A 2ZIFA 2O8FB 1FTZA 5C5IA 1TYEB 4PFKA 2OCCH 2R44A 3S1QJ 1T0BA 5ILQA 3VQTA 3K09C 1OBVA 4PNZA 2ZS8A 2Y69H 3PVCA 1AY0A 3CGWA 1FB5A 3GN2A 3Q3IA 2ZO4A 2G8LA 2F00A 2ANCA 1KYTA 1CRWG 3PGLA 1K4KA 3E1GA 2AK3A 2AMYA 3L8DA 4C2AA 2VHQA 3OOJA 1IVYA 1CCWA 3QKUA 1NUSA 4RTMA 3ET5A 1UPCA 2AL7A 2DHEA 5KX5B 2IELA 4BO7A 4B0OA 3B5JA 4K87A 4JVNA 3DFZA 1F2TB 4NFHA 4HH1A 1GL3A 1Z5PA 3UGQA 1Y8RA 4B3DA 1XN1A 4AN4A 4YJ2B 4G97A 2DECA 3MRSA 1MG0A 1WY7A 4FSDA 1ZREA 2JIBA 2C42A 2W9XA 4RK0A 4F7ZA 3JRGA 2PGDA 3TRJA 2XGMA 4RGSA 3QVSA 2EBUA 2CVQA 3B89A 3ZGXA 3HUFA 4MUAA 2WV9A 1ZTRA 2Q2VA 8OHMA 1ORKA 1QIFA 2UAGA 4Q3EA 1E3EA 1LPMA 1MC1A 2V55B 1G59A 4AKIA 2FR1A 3M1AA 1Q57A 5E8IA 2J9FB 4EJSA 3VR5H 3BK2A 4WXHA 5LU9A 1M1EB 5ECDA 2GOMA 3Q3EA 3OT5A 3M3PA 1A97A 1UBLS 2HCBA 5C4GB 1BA3A 1D2AA 1P7ZA 3K6SB 2BZTA 5SY4A 3JD1A 5FKJA 1MP0A 3FYSA 4HEA6 1Y48E 4U2DA 3HCBA 3AJ8A 3LWNA 2JGMA 1BXRB 1MX9A 2IE8A 1MH1A 2GJ4A 5KYWB 3W3CA 4AP9A