2VT3A

Structure and functional properties of the bacillus subtilis transcriptional repressor rex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
199
structure length
185
Chain Sequence
ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGYNVDYLLSFFRKTLDQDDVILIGVGNLGTAFLHYNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX
publication title Structure and functional properties of the Bacillus subtilis transcriptional repressor Rex.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 59
structure length 185
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02629 CoA_binding CoA binding domain
A PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vt3A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vt3A02
1K6IA 1NAHA 2D59A 5BNTA 5K5QA 3C3WA 3WNVA 4GGOA 4BNGA 3WG9A 1HYGA 1MZBA 1U28A 3RCBA 1O94A 4CR6A 3JQ7B 2PLYA 3AY7A 4CDGA 3ZWVA 3STHA 1HZJA 4EJWA 2QHXA 3IDSA 1KYWA 2VUTA 1SCUA 1QRRA 3D64A 4BYYA 1B7GO 2UYYA 2WDZA 3GEDA 3U62A 5AQ1A 1GPJA 2HDHA 1SOVA 2YDXA 4J7XA 4NDNE 2DTDA 5GZ3A 3SZPA 5TJJA 1FDWA 3EVNA 4GX5A 4YJGB 1A4UA 1QSGA 2VONA 3H9EO 5JAQA 4CM1A 4EJ6A 2B69A 5DBGA 1FSEA 3WR5A 5MGBA 2HR3A 2LDUA 3JYLA 1AN9A 2FSWA 4Y6SA 3I9JA 3L6EA 3GUDA 3H9GA 1KU9A 3ORFA 3DTTA 3OBBA 4GH5A 3QOPA 5HLGA 3E5MA 4NU6A 2VN8A 4OIQF 1E5LA 1NQTA 3RFXA 3LA3A 3RBVA 3WDSA 3ZN2A 1B8VA 5D8KB 2BGMA 1W5TA 1ISMA 1SNYA 4RVGA 1X7GA 3WSWA 1IE3A 4GYIA 1E7MA 1VI2A 2DAOA 2VXZA 3LYLA 3WBFA 3WGIA 3L00A 4L76A 2EXXA 3R0JA 4PG4A 1FXSA 3V1TC 1GADO 4EJOA 1HKQA 2RVCA 4CGZA 2P7CB 4MKXA 1H2BA 4IGEA 2XF8A 3DPTA 4MTDA 4IUYA 3U5TA 3CIFA 3RD5A 5HWSA 1ZKMA 4YIFA 3ELKA 3JD2A 3AK4A 2XAGA 2O50A 3WTSC 1JQBA 4L4SA 3FXQA 3KRTA 2XGXA 2K4JA 1RKXA 3P9CA 1T2DA 4JROA 4BO2A 4W9NC 3E1KA 3GPDG 3KE2A 3FN4A 3H9JA 2DQRA 4WLOA 2YX4A 4CV1A 2P5YA 4E5KA 1DPRA 2QVOA 2ZCWA 1FDTA 1V35A 2RBEA 1BI0A 4KDFA 3DAGA 3I52A 1Y0UA 5T8KC 4DPMA 1IXRC 4LFUA 3PGJA 2KRFA 2E4AA 5D4SA 4ALIA 4JBIA 1YO6A 3JQAB 3PHLA 4KFCA 5DDIP 1ADBA 5TIIA 3K6JA 1NFRA 5CLSA 1F4KA 1XIVA 4JXKA 4NMHA 1U1IA 3QVWA 3OOPA 3F5SA 3I5UA 3HDQA 1T1RA 4ESOA 3I4CA 3GAFA 3RSHA 4PLFA 2P5LC 1I0ZA 2Q2VA 4KP7A 4ALLA 5I9MA 3OETA 5F6FA 4EV0A 2Y1CA 2C20A 3COSA 2FE3A 5F64A 3SBOA 5FEUA 1BSVA 4PG6A 2O6GE 2ZB3A 1V0JA 1ZLKA 2IDZA 2A3SA 3E5QA 3A06A 2WD7B 3DDNA 3HIFA 4PVCA 2Z33A 4HX7A 1RM0A 4NK5A 5ILUA 2YJZA 1P0CA 3GFMA 4MEXF 1O5IA 4YJHB 2GN8A 1P45A 4IDFA 3C7DB 4R69A 4E0BA 3WTTC 3RI3A 5JAIA 1H0KA 3WSVA 2GXGA 4ZYDA 5IJZA 3H3UA 4L4XA 2V6CA 1HT0A 1JDJA 2I3GA 4CMAA 4EDFA 2YR2A 2QBYA 3ZMVA 4J0EA 3H9UA 2XUBA 3K5PA 3ROKA 3WQSB 4BNTA 5FFFA 4EITA 3W4JA 4RB3C 2PLAA 2O2YA 3PYXA 3GRKA 4U6SA 5A9TA 3ZCXA 4HV4A 4NBWA 2OAZA 3KYBA 1HDXA 5KJCA 2JSCA 2ZQZA 3ZWWA 3LLSA 1X3UA 1H93A 1NYTA 3WNQA 4AJLA 1K7AA 4R51A 3G17A 1EDOA 1RWBA 5J6XA 4AJPA 4DA9A 5H82A 3GR6A 2XOXA 4HNGA 3WB9A 4FBGA 5ENVA 1MUUA 3UXYA 2I6TA 3DZFA 1WI9A 1ZRDA 2SCUA 3ETDA 4XD2A 2JRTA 2NTNA 3S8MA 4YR9A 5H83A 2XAFA 3MAJA 3HUDA 1GR0A 1Z75A 2PGDA 3JQGA 4E6PA 2O3QA 4Q4ZF 3WLFA 1VJ0A 2FR0A 5EESA 5IDXA 5HS7A 3QRFF 2PEXA 2FOIA 1UXKA 2BFPA 3AW9A 4DLBA 2F5FA 3ZWCA 4ENMA 4DTIA 2VN2A 3FR7A 2EFNA 4OMZA 3ZMZA 3D4NA 3Q11A 2GQQA 1LDKB 3C1AA 1RZ4A 1IHXA 2V6FA 2WE7A 2WWYA 2VT3A 2Y0EA 4DRYA 4CMKA 4TRRA 2XKPA 2X23A 2X0LA 2EF1A 1GXQA 4DREA 5FI3A 1LLDA 1O9BA 3CKYA 1MJAA 4BV8A 1N7HA 5KVCA 5CG2A 2RCYA 1KY4A 2CNBA 3OFSA 4BNYA 5DOVA 3AU8A 3KP7A 3O2PE 5HVQC 4WCGA 4A5NA 1S7OA 2PMUA 3PHIA 1FWZA 4EGYA 4UHTA 1OC2A 3HADA 3S55A 5TRDA 2DBRA 3O38A 1C14A 1WWXA 4OIMA 4R54A 4FPXA 5JXWA 5TLSA 1RUOA 3L9XA 1E7RA 4WPGA 3GDOA 1C1XA 4I5FA 2PKQO 1C0WA 3IMFA 3L07A 3QP9A 5JO9A 1DC5A 3W4IA 2X0JA 5T5QA 3UN1A 3RKUA 3ECHA 1U5TA 1GZ6A 3KOUA 3L9FA 3HE3A 4JGBA 4ASNA 2NV6A 1ZXBA 2NQTA 3JQ9A 2FMLA 3SC4A 3VODA 2RDPA 1BVRA 4EM2A 3DHYA 3GK3A 4XYEA 4A10A 1LDYA 4B3IA 1A9YA 1PX0A 1R7JA 1M67A 5L7WA 3BAZA 3PYLA 4WXHA 3DHNA 5IT3A 3FZVA 3QU6A 3AUTA 4PVDA 5DBIA 2VHWA 3HB5X 2C5EA 1QO0D 2OBNA 4P9UA 4L75A 4XGKA 2O7SA 2F5CA 5L3FA 1RYEA 3HOTA 1V3FA 2DK5A 4HYEA 2IRWA 2VHZA 3B1JA 4EJTA 3EGOA 3FHLA 3NT4A 4XJTA 4ROSA 3ZV4A 1M66A 3HSRA 3QWHA 4XA8A 4CLRB 1BI1A 1U8XX 1B1BA 1LU9A 3W8FA 1EE2A 1HLPA 3JYOA 1ZCJA 4J9VA 4BKQA 1R16A 4KNYA 5CVUA 3VPXA 3DBLB 5KJFA 3C7AA 3F72A 3IWZA 3P7NA 2A35A 4OXNA 2Q1SA 1GXPA 1FF9A 2GF2A 2B0JA 2HK9A 4M6YA 3HOSA 1R5GA 1K78A 1PJ2A 2JCVA 2ZCVA 4PZCA 5DV5A 4DPLA 3PWZA 1RIOH 5DNAA 1I3NA 4CV3A 3GZ6A 2DK8A 4A73A 2JPBA 3T8RA 2FPGA 2P5UA 2EB7A 1K89A 2PH5A 3G1UA 3KV3O 4IJUA 4TVOA 3QSGA 3BMOA 1DJQA 4WLUA 3UICA 5HDNA 4Z6KA 2GD1O 1V8BA 2OFPA 1J5YA 2P6SA 4BQAA 1ML3A 1MP0A 2D1VA 4I7HA 1YDEA 3J81Z 1L0OC 2IXBA 3CUKA 3VPSA 1KS9A 3D3EA 4Z0HO 3RIHA 2XVCA 2KIFA 1U7HA 3GLQA 1P1FA 3UCXA 1N1EA 2OA4A 3U4CA 2IT0A 3ZZNA 3DWFA 3JAMZ 2EFWA 1KQ9A 2OO5A 3O9ZA 2YY7A 3HSKA 4I08A 4BHTA 4CUKA 3CUOA 5JDIC 4CR7A 2DVMA 2HWVA 3LFKA 4CLDA 4MJLA 3IJPA 4EUEA 3W8DA 1QG6A 1ZIDA 2ZQYA 1IZ9A 3INTA 1YL7A 5CVIA 1ARZA 2WWRA 3DO5A 1P4XA 3DV8A 3DPLC 4R5MA 4A27A 1U5TB 3NDJA 2Q50A 1XMKA 2GDZA 1MD0A 1D3AA 5BOXA 4ONEA 3TQHA 1S29A 4RDHA 2HOEA 2IEDA 3WMXA 2P5KA 1NWCA 1EUZA 1FT9A 2B35A 2HUNA 1MC4A 3VDRA 2G7HA 4W6ZA 1Z1DA 3TSCA 4AFNA 1SZJG 5BSEA 4XB2A 1R23A 4I0BA 3FXRA 1CERA 3F8CA 1UP4A 1FYMA 3LVFO 3QV1A 4JP3A 3S1LA 3F3XA 5IDWA 4GPD1 5ERIA 4B4OA 2DT5A 1YS7A 1KETA 1LSSA 1EV7A 4PLHA 1Z7UA 1I3KA 4MQ9F 2VRCD 3IP1A 3L6OO 4LG0B 3J7AO 1BJAA 1WDLA 4HNHA 1K6OA 4AJ2A 1R4NB 5KK1A 1B15A 4KICA 2PH3A 4GL4A 2EW8A 5CVRA 2P9EA 1E1KA 2Q4EA 4O5OA 1TNTA 1REPC 2DBZA 3HDJA 4PGFA 5G0TA 5F5LA 1ULYA 1IN6A 3DFGA 5CVVA 3HQ4O 3WGTA 3TO9A 3RJPA 4CM3A 3I9OA 1A27A 1BXKA 1VC2A 1TA4A 2QIOA 2LNBA 1MFZA 1A5ZA 3Q9VA 3WQQA 2W4QA 5DF1A 3EDMA 2X5KO 4WLFA 5DT9A 4AJ4A 1H6CA 4ID9A 4S05A 1CDOA 3CMCO 4N7RA 5D6FA 1YQXA 2ZTVA 3CSDA 1LI4A 3QHAA 3WYEA 4U88A 5FWNA 1I3LA 3I54A 2YV1A 3DAFA 5G0WA 1ONVA 2J3JA 4EM1A 4JLWA 3WWYA 4HBGA 4OU0A 1SAXA 1HRDA 4RVUA 2L3DA 3FM3A 2JJYA 2EWNA 4IJKA 1D7OA 2GPTA 5HLIA 5LHHA 3IUPA 4HW0A 1MDMB 4EEXA 2D5CA 2RIRA 3V5NA 2CF6A 4LMRA 1GZ3A 3U4HA 1T0FA 4I09A 3RC9A 3ST7A 3ADOA 4PG8A 3WJ7A 4XKJA 3JQCA 3I9KA 3JQEA 1PS8A 4WCDA 2C5AA 4IPAA 4Y17A 1P31A 1B14A 1TT5A 2DLDA 1H94A 3OIDA 2EJRA 4DVJA 4LK0F 2GN4A 1R4MB 2Q1WA 4KN7X 5U1PA 3H6KA 4RPLA 2IXAA 1IY8A 3WXBA 1PZEA 4BAYA 4EVIA 3JSOA 1XA0A 1U3UA 5JC1A 5EEHA 1ADGA 1CQIA 1YXMA 4YDRA 4R1NA 3GT0A 3GO5A 3U4DA 1TI7A 3RC7A 2EFQA 5G0VA 1E7WA 5C5IA 4YEDA 3GF4A 3E03A 2C07A 4FFMA 4FFOA 1B3BA 1LRKA 1X13A 3DOJA 4UULA 1AXGA 4DQXA 1TB4A 5AXAA 5A1TA 2QM3A 2HMWA 2J5OA 4WCFC 4RLSA 3T1BA 1CIVA 1EEHA 5JFOA 2DBQA 3TKYA 3EYYA 1W5SA 2JHGA 4K1LA 5I8ZA 1HWYA 3IQDB 4BNMA 4CLOA 3NRCA 3CEAA 4RB2C 4OMUA 3ZMSA 3EMKA 2JPCA 3A4VA 2G9WA 1RM5A 1U7TA 2IYOA 2Q1UA 3AM3A 1NHWA 3AI1A 5HBRA 3ZI0A 3T7EA 2LSOA 1HEUA 1FX7A 2WYWA 3OQ6A 3ONDA 1J0RA 3N4MA 1NVTA 3PZRA 4PG5A 3R0IA 4LRTB 1BBYA 2F5DA 2Z1NA 1HDYA 2OOSA 1STZA 5CDTA 4R68A 2QRJA 2Y05A 3IIEA 5CHEA 3TF5A 1LEBA 4DQ2A 3BMQA 4L9NA 1ZXLA 2B0LA 2KKOA 4OOIA 1Y6JA 1LEAA 1O6ZA 1PQWA 4MNUA 3H92A 4I5EA 4XB1A 3OQBA 4LLLA 3JCZA 1J5PA 4MINA 2Y0DA 3TFOA 5G2OA 3OJEA 2BGKA 3JQ8B 5A9RA 2ZFWA 2WM3A 4W4TA 4R79A 4A6DA 1ISHA 5U4QA 2CVQA 1UXIA 3DBRA 2KIUA 3WGGA 4JJIA 1ISGA 4I1IA 4GYGA 4MOWA 4ND3A 3ANMA 4BH9A 1MJ9A 4A12A 4L0QA 1TNSA 1SD5A 3S2EA 4U0JA 2HLPA 3MZ0A 2CFXA 2AXLA 5BMZA 4HDVA 3QQPA 4RDIA 3GEMA 1ON2A 3PQFA 3FTNA 4JX8A 4ALNA 2VE9A 4HLXA 2Q3EA 4GLLA 5K6AA 1ENYA 1KERA 3TFQA 2P9CA 3HDYA 4BO3A 3PTZA 2GGSA 2XHKA 4GVLA 5C7OO 1JAXA 1F06A 1Z6TA 3TZHA 5EPOA 2UWMA 1B9MA 3KHUA 3V4GA 3ENKA 1P0FA 2UV8A 2O8XA 1YFHA 3HN7A 5IZ4A 3D0SA 3ZNNA 2POQX 4M9SA 4WK8F 4UUVA 1NHGA 5AXCA 3TL2A 4A0ZA 1EBFA 2C29D 2E1NA 1I5RA 4FW8A 2G5CA 3K69A 3ZQ7A 2DFVA 4RAYA 3FNGA 1VL6A 3H4VA 1R1VA 3M7GA 3ROQA 3S2GA 3WGOA 3QWBA 3A9WA 2J3HA 3GFIA 1WW8A 3AOEC 4E33A 1ZGAA 1YVEI 4GGGA 2Q99A 2OL4A 5IZCC 2XAAA 3LLVA 3VH4A 1WXDA 4S1VA 1GTMA 5E8GA 2D45A 1Y8RB 2X58A 4K28A 1P3DA 4EEZA 4QSMA 1XSVA 3J81K 1PEDA 2IZ0A 1RPNA 4GLOA 3Q5FA 3QRWA 3QVTA 1IUYA 4YAIA 2DTRA 5JAZA 4BHBA 4AIHA 4S04A 1VKNA 1LDEA 4TKLA 5IN4A 5F21A 2O7QA 2FQ3A 3PFIA 2ZB8A 4FGWA 1UH5A 2OP1A 4G7ZF 4RPGA 3RASA 4BKRA 4ZICA 1U3TA 5AOVA 3BMQB 5LHGA 3I83A 2G1UA 4BGUA 2VBYA 2PI0A 2RV8A 1OFGA 1XSXA 4BO7A 2FNPA 3Q6IA 4E2WA 4L9RA 2DPUA 1L7EA 2CDAA 3DBVO 2GSDA 2QZZA 2V9VA 3GAZA 4GVXA 2CF5A 2O23A 2D0IA 1YTYA 3MWMA 2V6MA 2H6BA 1GPDG 2IZZA 1I6XA 1I10A 1P1KA 1GHCA 2JAPA 3GVAA 2VWPA 2X6TA 3R60A 3SZTA 1H9GA 1XHLA 3S2WA 4NFSA 5G4LA 3ZWXA 4CM9D 5D4RA 2W84A 1F8FA 2CY0A 4HQEA 1USSA 2Q2QA 5AVOA 4FT8A 4PN3A 4FSHA 5ENDA 3TN7A 4TRNA 3VH1A 4UNOA 5JDCC 1CEQA 5TSDA 1Q7GA 4B79A 1T1SA 1YS6A 1U4SA 3I6IA 2A9FA 3GH3A 3OIFA 3KYDB 4EW6A 4MVJA 3GZNB 2AG8A 1DRUA 1ZUD1 2VQ3A 2WD8A 3MWEB 2NNLD 2Y93A 4Y13A 3OM9A 4CM5A 1EVIA 3AUSA 1I2BA 4E3ZA 2GXBA 1KC1A 4J43A 5LEKA 1Q0HA 3EETA 2ZJ2A 2X22A 3TOZA 4L4RA 3DEUA 1JHHA 1I1GA 1D8KA 3TPCA 5H20A 5JC8A 3D5TA 1D8JA 3CO7C 4IHTA 2FXAA 2JKVA 3U3XA 5DUIA 5D5XB 1FP1D 4J7UA 4ESJA 2O3FA 1NFQA 3UW3A 4DIOA 4OM8A 4DXHA 4MKRA 1IN4A 1EE9A 4QX6A 4PG7A 1E7SA 3NX4A 5F5NA 1LTHR 3DFZA 2UUPA 5I9LA 3RUAA 4JJGA 4DC0A 4KT5C 1DRWA 4OIOF 4BMSA 1WMBA 4W7HA 3RDIA 5FYDA 2HK7A 5JYDA 5A05A 2HKXA 5DUKA 2O3RA 1R15A 4TVBA 4XRRA 4YJFA 1QNTA 4HX8A 2PD6A 3H8VA 1P1JA 4ENKA 2GLXA 4XEHA 4KYWA 3M8FA 3PZBA 3IL2A 3WQRA 1YQGA 4CICA 4B09A 2HJSA 4XDYA 1XB4A 3RUFA 4OO3A 1BXGB 3PWKA 2P5VA 3FHZA 3WU0A 1UAGA 5C37A 3MZYA 2QRLA 3E3VA 2WSBA 1SD6A 3GUYA 2BMAA 2LKPA 1I2ZA 3H5NA 3WGQA 2I67A 2Q8KA 4M49A 4N5MA 5HTOA 4YRAA 3G79A 4MEYF 3ML6A 4B7CA 1T2AA 3JQ7A 4ZHSA 3PVZA 1X7DA 4GBJA 4IPTA 4UEJA 2ZKZA 3DR3A 1E5QA 1R66A 4NBRA 2JT1A 2UUOA 1E6EA 3ZWOA 3D3WB 1DC4A 4IS2A 4BO8A 1DBVO 2A6HF 1LJ9A 3WMWA 1R1TA 5L45A 3T0YA 2HZTA 1ADCA 1PR3A 2C82A 4ND5A 2GWRA 3QU3A 3NTQA 4NQZA 2VWHA 4YJGA 1DO8A 4YFKF 3JQFA 4AJKA 1Y8QB 4D0SA 4DUPA 2ZBKA 3GGPA 1JVBA 1F8GA 3W1VA 3GG2A 1GUFA 3I59B 4AWXB 4M74A 4PCQA 2P91A 1W7PB 2VBXA 4CR8A 1JGSA 1IL0A 4L9TA 1KVSA 1X0XA 4MPDA 3ROPA 1TW2A 1ORRA 2EP7A 4I9HA 1MC5A 3C7JA 5FD6A 1USTA 4ZZDA 2HK8A 2O3JA 2QRKA 1FNNA 3GA0A 4HP8A 2H27A 3HHPA 4TZKA 4G81A 3BA1A 5A9SA 4BNWA 4OMYA 3V7CA 3E6AA 2PD3A 1ZAOA 3HDHA 5F1OA 5IN5A 3SXYA 4AICA 7ADHA 5AONA 4A5OA 5BQTA 2AQHA 4UAGA 3BROA 2R3SA 3DBHA 3FTPA 4AJ1A 1LSOA 4D43A 3P2YA 2ZCUA 3G3EA 4UREA 3QA9A 4GX1A 1CRWG 5CDUA 1HW2A 1KIFA 4JBGA 1G6KA 2YQ4A 3AY6A 3HRTA 4O6JA 4GQAA 3N97A 2IA1A 4Y15A 4HZFA 4WLEA 3H65A 2EFPA 2EP5A 2PK3A 1IPEA 3JQAD 4IJAA 3IOYA 4RL6A 5DP1A 3LA2A 2BH9A 5T67A 1KOLA 3O8QB 4CUZA 4FJ2A 1LDJA 3DOOA 1KBZA 1ZNQO 1E0DA 4D3DA 2R7FA 1DAOA 1VL8A 4LGVA 1PU2A 4UUOA 1WPQA 4F46A 1LQ1A 4YT2A 2X9NA 4YACA 1DEHA 3LQRA 3OP4A 3ZWMA 4I01A 1H9TA 1U5CA 2BFMA 4HF2A 2EK5A 1IRFA 5DCWA 3QIVA 3ONEA 1H5QA 1L3LA 1ID1A 2M8EA 3GGOA 3OA2A 3ZWNA 2VYND 3JQAA 5C7IO 5L3BA 3VPFA 3QPTA 2K7LA 2BD0A 2FZEA 3U1DA 1ZK3A 1M75A 5JFRA 3GRPA 3ZU2A 4AJEA 1HE3A 4BMNA 5B4TA 3QVXA 4PCVA 1N5DA 3Q9UA 5DZSA 1K79A 5CP8A 4GMFA 1BTOA 1LDNA 3SFZA 3TO6A 1PGNA 2V6GA 4RF4A 4PLPA 1M76A 1T98A 3G0OA 3DZGA 5FFZA 2VYNA 3BZUA 5IT9Z 2ZTUA 4O1MA 3KP5A 1ZK4A 1G6NA 3KBOA 4NNJA 3UHAA 5E1ZB 4A0SA 1B8UA 2NUAA 2M30A 5TT1A 4XIYA 5B4VA 1PWZA 3IJRA 3BZ6A 4EJMA 2QLZA 5E1XA 2CSUA 2AW5A 2WD7A 2X0IA 4EGZA 4HDUA 1UCRA 2NS0A 2E6UX 2HU2A 2P2SA 1J59A 4Y9DA 1M6WA 1KU3A 4KZPA 3GEZA 3PQEA 1R36A 3HRUA 1L7DA 1HETA 1QYXA 2QWWA 1J7KA 2FSSA 4EI2A 3C1TA 1Y5RA 1D1TA 4WEQA 4CMJA 2VT2A 5CDSA 4M9XA 3AFNA 4XQ9A 1MJBA 5JY6A 4D7AA 5A9SB 1ULUA 2OQRA 3E6DA 3WTYC 4FX4A 1N92A 2FR8A 3D4OA 1Y9EA 3GQVA 1YW7A 1HTBA 4U7WA 5A3VA 3I3OA 1YG2A 1TEHA 4RGBA 3J80Z 4PRKA 1FP2A 1W4MA 3DBHB 3GNTA 1I32A 2HMTA 2IE0A 3M2TA 1KEPA 2CZCA 1ULSA 1WLYA 1SO8A 4KMFA 2NWQA 5DCFA 3LF1A 1SMTA 3IHUA 3LSTA 4ZYEA 3FM5A 2EGGA 5LCXA 1DOHA 4OSPA 1HDCA 2ET6A 3C1OA 3DOCA 1AXEA 1UZLA 2ZYGA 4MTEA 1EH8A 1RM4A 2IP2A 3JD1A 2PJPA 1ZMOA 4ZQFA 4KQXA 4DWVA 3K96A 3O26A 4YJDA 2ADUA 2UDPA 1YE3A 2I66A 1PP7U 3DONA 1VKOA 2E49A 3L9WA 1XCVA 4DNCA 2NTJA 4B4UA 1YQDA 1IOLA 2Q0OA 1OOEA 2R7DA 4OXKA 3SLKA 4BO9A 4WWCA 4CMBA 4JBHA 3CZRA 4J2OA 1A72A 2YPRA 1I30A 5THQA 4R3NA 3HRSA 3R0AA 1UP7A 2DM6A 4R16A 1YBAA 3SLGA 3FMRA 4L0ZB 3F8BA 3RIRA 4H0EA 5IFLA 1QZZA 4I98B 3DQPA 3QW2A 1U78A 5COQA 4AVPA 1R12A 2BGLA 2OZ6A 4XCVA 2J5RA 3GNSA 1TQPA 3B20A 4R9RA 3WS7A 2A69F 2COMA 3PQJA 4AJOA 1BGVA 1LXCA 4U7DA 2X1HA 3EY4A 3ZWYA 1PZHA 5ICEA 3GFJA 4DMMA 3CE6A 3OA0A 4KDPA 3X2FA 4NB5A 3QP6A 2JD1A 1Z7BA 4WCFB 3UF0A 5IXYA 3BPVA 2JHFA 1KEUA 2PFBA 3BXXA 1KVQA 2CO5A 3AOEA 4G5HA 4CM6A 2TMGA 2HQRA 4R9SA 5IZCA 3G49A 3L6DA 4IMPA 3BWGA 3KSZO 2HQNA 3NGXA 1O3TA 1HDGO 5HS9A 1EUDA 1MLDA 4QFDA 1PQUA 2LF8A 1WSUA 1GYQA 1ISFA 1GYRA 4BUCA 5K0ZA 3U09A 1TQIA 1P44A 4WASA 1RUNA 3B02A 4XIJA 4CM4B 4NG5A 4A5MA 1UZMA 1ZEJA 5GY7A 1SB9A 3WICA 4E5PA 5F1RA 2J6IA 4IDCA 4WK6A 4I2OA 2IVMA 1T4DA 3R4KA 1BW9A 4HF1A 1JKFA 4PLTA 1BMDA 3G3ZA 4EMSA 2UZKA 1MB4A 1U3WA 2O4UX 4XYBA 5A04A 1PWXA 4CL3A 4DLLA 3TDUC 4WEOA 3ZNOA 4K2EA 2VTEA 3NYWA 1FYLA 2CWEA 2VHVA 3EUWA 2Y66A 3H2ZA 4H15A 1QMGA 2I5PO 3DB2A 3RJ5A 4TMFA 1OYWA 5CG1A 1VM6A 1ZK1A 3SQNA 2ZB7A 3Q1LA 4BB6A 4CLRA 3E82A 1EVJA 2O3TA 3DF8A 5EQFA 4RORA 3GWZA 2O3UA 3DBLA 2MLKA 4XYGA 5DD8A 5BPIA 3WIDA 2IEBA 2Q49A 1U6GA 1BC8C 1KC3A 2A4KA 1IN8A 1FLIA 1A9ZA 2QQ9A 4QFCA 2DI3A 1GQQA 3DMTC 2A5YB 4FCCA 4OKIA 2NSDA 4O59O 4BNZA 4BNVA 4NIMA 2DW4A 2GIVA 5G4KB 5JDCA 2FY8A 3V7RA 1Z45A 3F22A 3I9MA 2FBKA 5EINA 5ED4A 1HW5A 1F5TA 4ON0A 1ZEMA 2CD9A 5ER6A 2BLLA 3F6YA 1E2XA 4U0KA 1FBUA 1HDRA 2EJVA 4NHJA 1QZYA 2JCXA 4M86A 1TLTA 1PJLA 2P4QA 4RCVA 4RB1A 2GR9A 2ZB4A 4RF5A 2R00C 2OXIA 1ZG5A 3L09A 1NQAO 4YWJA 3TOBA 1CJCA 4GX2A 4AL4A 4AJJA 4CM7A 5L4SA 1BHSA 2B36A 2G76A 3GPIA 4D3SA 3ULQB 4LVUA 4IS3A 2CUKA 4Z0PA 4U0VA 3WE2A 1QV6A 1XKQA 3ASUA 4RVDA 2Y1OA 3TL3A 3WYBA 4WE3A 3NJ4A 2FF4A 1U2GA 1SEPA 2MH9A 4LJZF 1U8FO 3JQBA 3GF2A 1G0OA 5T6BA 3ANLA 1WNTA 3U4IA 4NJOA 3VTFA 1JN0A 2BE5F 5LLQA 1JE8A 1PTJA 4UVHA 3JQ6A 1GD1O 2HEOA 5A03A 4CQMD 5HS8A 3B73A 4G9YA 1P77A 2CQKA 3FR8A 3PJDA 4ILKA 1P4AA 4LD5A 1BW9B 3UUWA 1P1RA 2DPHA 2RGVA 2RN7A 1L1FA 2ESNA 1HQCA 1EVZA 4D41A 2DBBA 2QZ8A 5T57A 4R1SA 2WV0A 1ZRFA 5FO5A 3LF2A 4XSZF 2ILTA 2JTVA 3RPUA 3KP2A 2V79A 1K2WA 2DUWA 3PLRA 4FGSA 4M89A 1Z73A 2FN7A 3PIIA 4CQMA 2NU7A 3NAQA 3COAC 3FMSA 5JPIA 3CZMA 2QENA 2B5WA 4UV9A 4BKPA 4E4YA 2NM0A 2GA1A 4YA6A 3R3SA 4EBFA 3U9GA 3OQ1A 4LG0A 3JD4A 2PZKA 2DFIA 3LC7O 4NBVA 1R4NA 4IDDA 1E6WA 4ZYHA 1ONNA 2VTDA 3ZNPA 5CDGA 1JLLA 3FBGA 1DHRA 1SOWA 3L7WA 1ZG3A 4Q3CA 1W8DA 4U8GA 2ACJA 4JK1X 4ZYGA 4OOFA 5EIOA 2EA2A 5ICSA 3BY6A 2R6JA 2ZKLA 3WTUC 1YW9A 4E32A 5IT9K 5MDHA 5A02A 1Z74A 3HN2A 1O3QA 1WZEA 1QYCA 3ECOA 3PPIA 3CPSA 2GUGA 3TGNA 3DAPA 4ZA2A 1BI3A 3O6BB 2XXJA 3ROMA 3RUCA 3GW2A 4N18A 3GVIA 2VZ9A 3WTVC 5A2QZ 4D0PA 1PUEE 1PGQA 3BPXA 5JMPA 1X15A 3MEXA 4BHCA 3WYCA 1SC6A 1LC3A 3K8ZA 4K6FA 1T26A 1W6UA 3HTUA 4P96A 2YZ7A 1HXHA 2VCYA 3WTCA 1PS9A 2Y0CA 1GDHA 3D7LA 2EKQA 3GDFA 3AWDA 1MDMA 4Q47A 4A2UA 2GCGA 3HSEA 3ABTA 2NACA 4NHEA 3J80K 5HLHA 2JL1A 3FWZA 1UZNA 4LK3A 1ZO8A 5L95A 4W99A 2A6EF 2OUIA 1W0CA 3KEQA 4JNKA 4I5GA 4H16A 1DP7P 3VVCA 4BOYA 4KUGA 1ODDA 3B1FA 4FJ0A 1FDUA 1R4MA 1KQ8A 2FBIA 1AGNA 4A0XA 3EHEA 4P4GA 4DPKA 5FLXZ 2VC0A 1U3VA 3H3FA 1VSUA 5JBIA 2DU9A 1F17A 3RYPA 4RAZA 4D44A 1JVSA 3AUUA 5EQDA 4CMIA 3EZYA 3GUCA 3L77A 3MOIA 4MO2A 4Z3DA 1ZBQA 2MD5A 4CQMB 2Y0MA 4IXWA 5DD4A 3W6ZA 3WFIA 4U5QA 4ENJA 5ILGA 3WBBA 4WF2A 2VOOA 3I23A 2Y68A 3GFBA 4R4JA 4TRJA 3ZHZA 1SMKA 2NVBA 3BOQA 3FPCA 4RGRA 3FI9A 1P74A 2K86A 1HKSA 4UV8A 2H63A 4J49A 4LSWA 2PFGA 1Y81A 3EYWA 3OH8A 2CYYA 5H6QA 2C59A 3GHHA 4R1TA 1HW1A 3KLPX 2WEKA 1R1UA 5IDQA 5LHIA 3ZPLA 3R1IA 1V3VA 2EKLA 1TLHB 5EEGA 1HDZA 3ZU5A 5DEQA 4DIBA 3EC7A 4E31A 1GU7A 2QQAA 4J3FA 3IC7A 5COAA 3B1KA 3CTMA 1C0KA 4BIIA 4URFA 4CMGA 2PG4A 1ZK2A 3KB6A 2O3SA 4XSXF 3GG9A 4UVBA 3KZYA 5THKA 3SJUA 2FR1A 1OPCA 4QO8A 3K0LA 1HE4A 3PI7A 3JW4A 1EH7A 2V6BA 1N1GA 3NUGA 1KEWA 4L18B 1R6DA 4FDAA 5KKAA 4L9VA 1LUAA 4J4BA 4OIRF 1CQJA 2WJPA 2IRFG 3H3JA 1LLUA 1O95A 3K2EA 2RHCA 1CGPA 2JAHA 3JQ8A 2OP0A 5BNFA 1J75A 5L4LA 1DIHA 1HE2A 1QYDA 3BTSA 3FWNA 1NQOA 2X0RA 1MG5A 2VNSA 4CYDA 1LEHA 2L02A 4MKZA 1TQMA 4B3JA 3RBXA 5IXSA 2O0YA 1ZREA 2BI7A 1XGMA 4MDHA 1BC7C 3JYPA 4ZZLA 1O7FA 1OYYA 2VBWA 4RGUA 1LSUA 3AJRA 2HS5A 5DULA 1E17A 1G4DA 3NRVA 4X54A 1DFHA 4LISA 4KOAA 1PJTA 1F12A 1ZLJA 5DCMB 2GYYA 4L0YB 3NTOA 3QVOA 4MP8A 4CMEC 1GCUA 5LDHA 4W9NA 4ZRMA 4C7JA 2QG4A 2XV4S 3LK7A 1I27A 1DFGA 4C7KA 4CMIB 2EGHA 1LNWA 4N9IA 4KN4X 1E3JA 2CW0F 3GN1A 4MIYA 3RUIA 2ISYA 5AYVA 3ICCA 5CPBA 4ZJUA 1ADFA 2F00A 3LT1A 4TRMA 3CINA 5DCYA 3IS3A 5T8KA 5CEFA 4WUVA 4G94A 3VDQA 4LSMA 3FXUA 3K1MA 4OHUA 3DP7A 1I1SA 2QQ5A 4NJMB 1NTOA 4MP3A 2STTA 5HS6A 2HMVA 1GFSA 3MJSA 4ND1A 4MP6A 4LMPA 1VSVA 3RKYA 2NYXA 1J2XA 2M87A 3EW7A 1YB5A 2AQ8A 4GGPA 4RPHA 1NVMB 4P38A 5JY1A 2PKRA 3Q2KA 2BGCA 5ICFA 1YL5A 3K30A 2OBYA 3PHJA 3ZWPA 1BWSA 1Y8RA 4MVJM 3I9LA 3EVTA 3ETEA 4CXFA 3RVDA 2D1YA 1HF3A 5JW6A 3IRQA 3OEYA 2AHRA 3M1AA 4LLGF 4II2A 3AOGA 4RPKA 1YW8A 1LB2A 2GZ1A 4GAEA 2CVOA 4L73A 3RUDA 3SXPA 1XYGA 2VE8A 5ITVA 2HTJA 3PGXA 3SX2A 4TROA 3BMCA 3INRA 3BHMA 3UAGA 3I1JA 2FA5A 2JZYA 2XKOA 5G0SA 2CG4A 3UVEA 2QYOA 1JA9A 3NTRA 2X8LA 4N9HA 2E48A 1LQUA 2AEFA 1EZ4A 2MA3A 2QZ9A 4NR0A 1B4AA 2CSOA 5I8WA 4KA4A 1YJQA 2EIHA 3FBTA 3PQDA 4PLYA 1OC4A 4FJ1A 3I53A 3I58A 2XXBA 4J91A 1HE5A 4CO8A 3E48A 5L4NA 3FX3A 2FEZA 2F1KA 3ZP5A 4BL5A 1NPDA 2D8AA 1QLHA 4FHTA 2YFQA 4M8SA 2FSVA 1KVUA 4I02A 4MHGA 2W57A 1ZN2A 4XRGA 2K27A 1GEEA 3KLMX 2YUTA 4BO6A 1NR7A 3LAPA 1E3WB 1MX3A 1PP8F 5COBA 4RGXA 1H6BA 4GSKA 4M73A 2GASA 3W4KA 3KYDA 3QAHA 1NAIA 3GZNA 2H6CA 1XU9A 5CDYA 5L3CA 5DCUA 1NVGA 4GWGA 2PN6A 3ZW9A 1DDNA 3OEWA 5IF3A 4UUPA 1A7KA 3PHGA 3VZPA 2VHXA 4OGWA 1P9LA 2PY6A 4BHPA 5LGTA 1VE9A 2XROA 1N2SA 4DYDA 4YQYA 1Q0LA 1PR9A 1ZFNA 1MG0A 1XSDA 2BF7A 2W2LD 4K26A 1FY7A 2OD5A 1ON1A 3GFGA 2HMSA 4IBOA 4AG3A 4PLCA 3E18A 5K5OA 4L5IA 1C1DB 2ESHA 3F8MA 5TX7A 3ZDFA 4OXYA 2QYTA 4Q39A 2FRHA 1SB8A 2XRNA 4UEKA 4RQTA 4M72A 1T2FA 3ONFA 3OSUA 1E1NA 4CM8A 5G0UA 5TF4A 5GZ6A 1NR1A 4IJWA 1EVYA 5HDKA 4WECA 4KTVE 4B7UA 1ONOA 5A2QK 2EV9A 2BFOA 3VOSA 2X0NA 4XGNA 5J23A 2W2LA 4DBVO 4EYEA 3RYRA 4RQUA 3VZSA 1A04A 2VC1A 1Z6ZA 2O4CA 2DO7A 5JR3A 4RJTA 8LDHA 3HG7A 2MC3A 3WE3A 4MVJP 1U2WA 2R00A 2X5JO 3R3JA 4RVHA 4BO0A 3HYIA 4AIKA 1KYZA 3WU1B 2HDCA 3IP3A 3PDUA 4J16A 4EUFA 1O3RA 3BMCB 1QR6A 5BSGA 1PS0A 2DPDA 2DU8A 2HQ1A 2H9IA 2Y75A 1GV1A 1T6SA 2A94A 1V9LA 2HYGD 3BMNB 4ZQBA 4DYVA 2J3KA 1LC0A 5KJEA 2EV0A 2J8ZA 2Y1GA 4JIGA 3AUAA 1H9BA 2XAQA 1MGOA 2B5VA 4NI5A 4PRLA 1TXGA 1YYVA 3JTGA 1BXGA 1JW9B 2CDCA 4D42A 3REOA 4ESBA 2GN9A 3KP3A 4Y8VA 2IW5A 1KY5A 3PLNA 2HSDA 1LDMA 4MVJD 5FLXK 3O4RA 5FB2A 3H2SA 4B4VA 4KQWA 2HTSA 4NZ9A 4QEDA 3WFJA 1DIRA 2ELHA 2ISZA 4KMUX 5KIAA 1EBUA 4RS8A 2YHIA 1X1TA 5KJ1A 3D3WA 3K31A 1W7PD 2ETHA 4HKTA 5ICCA 3P9IA 1VTNC 4CLEA 4KWIA 2QYSA 3NV9A 5D5UB 3DHEA 2RHRA 4JQFA 3FPLA 3VVBA 1IZ1A 1J9IA 1AUPA 5HDGA 1HYHA 1Y8QA 3HB4X 3PFFA 3PXXA 2ZYDA 3SHFA 1LA2A 3M1LA 4KMSA 4E5NA 2CVZA 4HOBA 2P4HX 4IZIA 3I59A 5ILOA 1W7PA 1HSJA 3JSPA 1G0NA 1M2WA 2K4BA 3C24A 1FDSA 5EERA 3DZIA 2RAFA 4BB5A 3T8TA 4BNJA 3ERED 3VTZA 2PGJA 3KLNA 1BIBA 3EUHA 3WX0A 3OJFA 2DQ4A 3ZWBA 4CM8B 3P2OA 2O03A 4N54A 3VKVA 4BXUA 4FQ8A 4E12A 4ITUA 1HSOA 1D1SA 1OBFO 3DZKA 3OJ0A 4HQMA 4PDKA 2NVWA 2RNJA 5JHUA 4J4HA 2FHSA 3ZNQA 5TT0A 2DTXA 2X9VA 4HXYA 4G2NA 1ZH8A 2EW2A 4CV2A 1P33A 1JWBB 1X1EA 2Y99A 3CXRA 3KXDA 4F3YA 3GEGA 2M1BA 2B4TO 1IYZA 2HKOA 4PZEA 1IN5A 2BKAA 2Q4BA 4HADA 4IINA 3E5XA 4J90A 1SFUA 3PP8A 3C1DA 4HFMA 5JDIA 4R41A 3O8QA 2I99A 5F3RA 1RM3A 2G82A 5BR7A 3TQNA 2FNAA 2AXQA 3VZQA 1FZPB 3VOEA 3E9MA 4W7IA 4P55A 1HDOA 4E2XA 4B8XA 3HNPA 3NGLA 5BS6A 4OYRA 3V8LA 3CO6C 3CUQB 1KVRA 2YQ5A 3EQLF 3LT4A 2KIMA 1XD7A 1GQYA 4PZDA 3DL2A 1J0XO 1KYQA 3FCOA 4BNKA 1I5ZA 2HMUA 3GZ4A 4W82A 5K1YA 3KP6A 2WYUA 9LDBA 3WTWC 3JQ9C 4EZBA 3DMYA 2D2WA 5L7YA 3GC6A 1ZG1A 3N74A 5ITWA 3GDGA 1Z7EA 3GX4X 5LGNA 1T4BA 2YHIB 3WLEA 4CMHA 5JI6A 3F8FA 4TWRA 1E3IA 5FI5A 4IJVA 4BMVA 4NU5A 3AM4A 4FX0A 3OIGA 5CAEA 1E77A 3PDJA 3L4SO 5ES3A 1DIBA 5TGDA 5F1PA 4WOKA 4JQCA 1SFEA 3C8MA 5JS6A 7MDHA 2NU8A 2AA3A 3Q9SA 3GGGA 3FNFA 2J5PA 4N0BA 1DDOA 4A03A 1SAYA 2EG9A 2AG5A 1PJQA 3MJ4A 2CGPA 1SFXA 3N7UA 1GUZA 4AJHA 1LNQA 1IUKA 4XWYA 1E3SA 4FC7A 1TTYA 1Q2XA 3S2IA 5CEJA 3ADPA 3E5RA 5HM8A 2VHYA 2V1DA 1TW3A 2Y48A 5FGMA 1DHTA 1FBSA 1EQUA 4G7OF 1K6JA 1S7CA 3VEPA 1HSTA 2VZ0A 2FMYA 2UXNA 2NVUB 4PIVA 3TRIA 3FF5A 4ALMA 4A7PA 3T5XA 4PLGA 2Y1EA 2EV6A 1HKUA 3Q3CA 3UH1A 5JO0A 4JBAA 5LRSA 4BV9A 1U8RA 2PGLA 3DTYA 1XG5A 4CV0A 5A5EA 1K5HA 1CETA 5TQVA 4WXCA 1T38A 1NPTO 1NFFA 2DLLA 2HCTA 2HO5A 4MIEA 4NK4A 4PLZA 5FFXA 5EN4A 4KIBA 4LB5A 3ZU3A 3F5QA 1D5VA 1CF7B 1ZMTA 3HRMA 1YGYA 3UCFA 3K73O 2HRBA 5JSFA 4IIUA 1AHIA 2P68A 2HYFA 1IB6A 4OL9A 4G7HF 3ABUA 1QXSA 2ZJ1A 3HZZA 4ZU3A 3W6UA 3ZHBA 3ZV6A 4CJXA 3AM5A 4RF2A 4KDEA 2PMHA 1I8TA 3KSUA 1GV0A 4Q3EA 1SD4A 4YJHA 1OI7A 3UKOA 1XGOA 3ULKA 4S3MA 5ADHA 5D5VB 4OKNA 4ZQHA 4EJUA 1T2CA 3OECA 4R5HA 4WLVA 5H81A 2AEJA 2FP4A 4ZQGA 2JD0A 4NQWA 3Q2IA 3KLOA 1PIWA 3HFSA 5KJ6A 1J4AA 1XLTA 2JFGA 2L54A 1ZARA 3PJGA 4GKVA 2P4WA 3HTSB 1LBEA 2GERA 4I9UA 3CMMA 5L3GA 4P5OA 2RH8A 3DFUA 5GMOA 1OR7A 2ZMEA 3I71A 3WGZA 2Y1FA 3TZKA 1WAMA 2YV3A 3VH3A 4G8XA 3PK0A 1T24A 1ZHFA 4UXNA 2NADA 1PJBA 2HGCA 1ZZEA 4D45A 1BI2A 2IPQX 1I01A 5HS4A 2KJCA 4KUMA 5CYVA 1IZ0A 3GVHA 4CODB 1PJ4A 2VOJA 3D0OA 5TNXA 1FJHA 3QY9A 3EDPA 1H2HA 3N58A 1PL7A 3W6KB 3WTZA 4YRDA 1G1AA 1NM5A 2R2GA 3GOHA 4WCFA 4QXMA 5C3MA 2FMUA 3BDDA 5J8CA 1B2LA 3WJAA 3BTOA 1E92A 2E7WA 3E6MA 4FD3A 3UOGA 4D46A 1H9AA 1I33A 3AI2A 4Z3KA 3MJCA 1DSSG 1N8KA 5CEEA 4ZGWA 4HAMA 1LRJA 5IAAA 3P9KA 1GL3A 3EYIA 4BKOA 4ZN6A 2B4RO 4LB6B 2VUSA 4XQCA 3K1NA 4DMLA 3TO7A 2AMFA 2BV6A 4G65A 3MJTA 2BBYA 1Q7CA 2G0TA 1GUYA 4DIFA 2NAZA 3U2RA 2Y67A 4CM4A 1IPFA 1R58A 1EDZA 4GO1A 4J2HA 3C18A 1NNUA 3KCCA 1BVUA 1XEAA 3IAHA 1V3UA 4ALKA 1DIGA 3RJ9A 4AD9A 1PGJA 4TV7A 1YONA 6LDHA 2GZWA 1P1IA 3KM0A 5K5RA 1VRWA 1R22A 1LDGA 1XGKA 2GNAA 3KYCB 3WGHA 2W90A 3V8BA 1VJTA 4JP2A 1AHHA 3E6BA 1SBYA 4WJZA 4M55A 2FWMX 8ADHA 2XIGA 3TNLA 2DBVO 4AJNA 3RBZA 3F6OA 3GZ5A 3H7AA 3M6IA 3ZMTA 5HRUA 2Q46A 2VRBA 3V1UA 1WZIA 3AU9A 1RYDA 1PJ3A 1ZJYA 2Q45A 4XR4A 3FD8A 3ICPA 3F9IA 1BXZA 4FS3A 4Y98A 2PTGA 3RPQA 2X4HA 4HF0A 2VUUA 4IIVA 4JK3A 4OH1A 1S6LA 4AVYA 3U0BA 2OMEA 4FN4A 4Q9NA 5G4KA 3E9QA 5L3DA 2NQ8A 1ZK0A 1NPYA 1GQ2A 2W24A 3I5MA 3OICA 2PZLA 5JE8A 3V7SA 2EV5A 2ZMEB 1D8AA 4IMRA 5GZ1A 1TBXA 2BYVE 5D5WB 1GEGA 2NTVA 1E7YA 3K2BA 4J4TA 4UUNA 1P92A 1DC6A 2XAJA 4J9UE 1UB9A 1YWGO 1M6HA 4BKUA 4FFLA 1C0IA 1UDAA 4HUJA 4BNFA 3RFTA 3T4EA 4F6LA 5KKCA 2OQGA 1FOKA 1LSJA 4QECA 4DQUA 3E8XA 5ILVA 4CHUA 1JHFA 2GZ3A 5L40A 1FC3A 1IF1A 1RJWA 5DN9A 4QQRA 1P2FA 4RGSA 4XYLA 4HX4A 1BN5A 5E1WA 3E5UA 4Q3DA 4IDEA 1Q0QA 5TC4A 2O2SA 3MQ0A 2C2YA 2NNNA 1VL0A 2OZPA 3BTVA 2YYYA 3R6DA 4J0FA 5KTKA 1C0LA 3KP4A 1WKMA 4Z2YA 3DXFA 4FOSA 2V65A 3WIEA 4BNUA 3MTJA 4E2ZA 2X4GA 1SMYF 2CDBA 3ANNA 1GVJA 6PAXA 5L51A 2Z99A 1HKTA 1OMIA 5DDGA 3O03A 3DKWA 2JCYA 4DBZA 1JAYA 4LCEA 2V1XA 1XDWA 2Z5UA 3K2ZA 3I9NA 4DC1A 2Z3YA 5T64A 4ENNA 1PL8A 5B12A 1ENPA 5KVSA 1XCBA 3GLXA 4PGHA 1IAWA 2G17A 5CJ9A 1GCOA 1UDCA 3GVPA 1EUCA 2NLOA 2Z5LA 4Y67A 1IXCA 3V2UA 3DQVC 2LDXA 4BS9A 3C3XA 3OF2A 4KWHA 3RKRA 3RKXA 2P9GA 4YVFA 1I3MA 3EZLA 2DQLA 4D0RA 3PRJA 4MVJE 4HLYA 4FFPA 4P4NA 4KIFA 2FBHA 3K9QO 1E3LA 1ZJZA 3PQKA 3IKTA 1NASA 4WOJA 4IM7A 1PZFA 4OJNA 4YQZA 4YT8A 3P7MA 4BO1A 4YRBA 3LA7A 2QW8A 2E7XA 4XRFA 5LRRA 3D5QA 3PFWO 5LEJA 4Q3NA 5DP2A 3VKUA 4B7XA 4YB8A 3RQSA 5I7EA 4OAQA 5JAMA 5K6AC 3ENNA 1QORA 4BO4A 4G6DA 2YU3A 1WVGA 2GA2A 2YW9A 1G3WA 1W4ZA 1UR5A 3W6JB 4M87A 2A68F 2H6EA 4N5NA 2XAHA 4UVAA 3QLJA 1UP6A 4WXDA 3K92A 1S3JA 3QE3A 2OBPA 1UUFA 3ZMUA 1R00A 3VPGA 2W8ZA 1JXSA 4EJVA 2AQIA 3R61A 3LAJA 3JV7A 2W98A 4LVCA 1Z05A 3NT5A 3MOGA 3SVTA 4ZVVA 3GVXA 1ZSVA 1O8CA 2UAGA 1CYDA 4MVJG 3L2CA 1K6XA 4CZZA 2PA3A 4R3WA 4IQ8A 3SJ7A 1O7LA 1U2DA 1ZGJA 4BNHA 5ER9A 1LLQA 1R5HA 3L4BC 3FMQA 4ETSA 3BHJA 1DJNA 1RNLA 1JKIA 1FYKA 1R37A 4NPCA 4I5DA 3ZV5A 1QKIA 5KCZA 1MXHA 1H6DA 3VPHA 4IHSA 1N7GA 1WP4A 3CUQC 3NT2A 2PKQP 3P5SA 3DZHA 1P1HA 5AXDA 4KIGA 1RI7A 3FWEA 2JFHA 4M1QA 4O0LA 1JU9A 2HJRA 4OINF 2CFCA 1FBQA 5CPFA 1YL6A 4XZ3A 5EMHA 4BO5A 1IULA 2EJWA 4A6EA 2W85A 4HFRA 1B3RA 4Z9FA 3FRJA 1WMAA 5I7FA 2O48X 4YFXF 2EERA 4FOOA 3NDIA 2BHLA 1PJCA 4JJFA 1YS4A 1X14A 2WC2A 3FNHA 5IG2A 3ZV3A 3RWBA 4E21A 5C7LO 4IDAA 3AAFA 4M71A 1FDVA 2EHDA 1XMAA 4B4WA 2IJLA 4LRSB 4BNNA 4K9DA 2C2XA 4BGIA 4NBUA 2QBYB 3I4FA 4HV6A 1E7QA 1O0SA 3HSFA 2B37A 1PGPA 1KU7A 4Z0TA 3LT0A 3DZBA 2QX7A 3UCEA 5JLAA 1PGOA 1N9GA 1OMOA 4BGEA 2L4MA 5ICGA 4I9NA 4ZRNA 3DZJA 4YCAA 3TDZC 1W73A 2RKHA 4NFHA 4F6CA 4TZTA 1KEVA 4XLPF 1S6YA 1VPDA 3KUXA 3QWIA 2LDBA 2BEOA 3AI3A 4J1TA 1BRMA 3QJ5A 2F5EA 4D3FA 4M6XA 4WNCA 3LSYA 3JQGB 4P22A 4RVSA 4QO7A 3R6SA 5I9NA 4L9JA 3ROUA 3GMSA 2NU6A 4Z9XA 4A2CA 3V1YA 3PWSA 4XQGA 4EM0B 4IXAA 3VAZA 2MBFA 3L0DA 4IXTA 1KVTA 2ZO4A 3TOXA 1EH6A 1P4WA 1QQIA 2PZJA 1QLJA 3KZZA 1HZZA 4HWKA 2GZ2A 2FU4A 2PWZA 3RUHA 2X7HA 1BM9A 4YAEA 3JQDA 2G7UA 4WX9A 5E17F 2WTEA 2YFHA 3RC2A 1GAEO 4GX0A 1X7HA 4R8HA 1XDUA 1YIOA 4ZH4F 4AJIA 1WDMA 5LDGA 3RFVA 3ZW8A 1KGSA 3F47A 5BT9A 1CF2O 1MFPA 3Q9NA 3SC6A 4IY1A 1X0VA 2VOPA 4B8ZA 1ZSNA 5BSFA 5TJHA 3RTRA 1Y1PA 5DCMA 4L8VA 1O89A 1JWAB 1ZH5A 2HAEA 4Y6RA 1LDBA 2DFDA 1NX6A 2C0CA 3VB2A 3ASVA 3LWFA 4GMGA 4YFNF 3M8EA 1C1XB 5BPDA 1LX6A 2H94A 1NQ5A 1OAAA 3ZGYA 4YAJA 3GN2A 1T2KA 1S8NA 2X5OA 2L01A 4HX5A 4I8XA 4MVJI 2ZATA 4CLHA 4YT5A 3I4PA 1DUXC 4IRGA 3F8NA 2AE2A 1I2CA 1MV8A 4NJMA 3QWFA 4OSOA 1UDBA 3F4LA 3D1LA 3LC1O 3RI4A 3K9TA 2VWGA 4GCVA 2P6TA 4H7PA 4O63O 4P9FA 1N9GB 3NQOA 5BSHA 3H9QA 3G73A 1UXGA 2UXXA 3RU9A 2IA0A 3HHHA 5LGUA 4HFJA 3F6VA 2VODA 1B26A 4IQGA 1B0AA 2A92A 4UVEA 2NNYA 4RVFA 1J6UA 2B4QA 4Q5SF 4H3VA 4I0AA 3CDHA 3JQFC 3FSRA 5JCXA 2B83A 3MFKA 1DLJA 1DC3A 2X86A 5L3ZA 1LJ8A 1XR3A 2RC4A 1YOVA 2I9PA 1XN7A 1Z6RA 2OORA 2E82A 4U7BA 1K78B 3K1PA 3M1EA 5FD5A 2YDYA 4K6CA 3MCVA 3JYQA 3TZCA 3KEOA 1I36A 2MH2A 5A06A 4G6QA 3TOAA 1F0YA 1JTVA 3ITKA 4DGSA 1XU7A 3KETA 1P6RA 2HKIA 3GY0A 5FF9A 4XYMA 3ETGA 3BMOB 2Z95A 1YLFA 5E18F 3VHRA 4KUEA 4IDGA 1XQ1A 2VRCA 1HLDA 4IDBA 1NHAA 4R01A 3WODF 4RV9A 2BFAA 5F1KA 3LDHA 4OIPF 3LT2A 3U49A 2DPGA 1T25A 4LGWA 1ZYRF 1MXFA 4N5LA 3T4XA 1E1LA 2WMDA 4YTEA 2DC1A 1Y5MA 3CLOA 4DQVA 4IF4A 5IDYA 2HFHA 2D4AA 4ND2A 3VC7A 2FOKA 3BJAA 1HL3A 1E3WA 3BIOA 3OJLA 1UHWA 1DB3A 3MCZA 2ZYAA 2EWMA 3F1LA 4NH4A 3NEPX 4BGVA 2EA4A 1NP3A 2Y1DA 4TSKA 1IW7F 3NDRA 4LCJA 2EEZA 4YXFA 3HUGA 5CFZA 4J7CA 4NBTA 3B70A 3LQQA 1AWCA 1UFMA 4O5VA 3NEUA 1B59A 1U4OA 2C54A 4D79A 5U9CA 1R0KA 2TMDA 4QUKA 3UGKA 2PD4A 4B8WA 1H6AA 2IZ1A 2DAPA 1E3EA 1S7AA 3JTHA 1QBJA 1R0LA 1C1DA 1XWFA 1FK8A 3TDKA 3TJRA 5I7VA 2UVDA 4BNLA 2V7PA 2ZNZA 2BRUA 4IGFA 4F7ZA 3TWOA 4IRIA 5DBFA 4YAGA 2ZK7A 4UVIA 1MGTA 4PLWA 4IQ0A 4DL9A 3IKVA 4XLNF 4EJ0A 2ZJ0A 3ZWAA 3BHIA 3RKWA 1IRGA 2DTEA 1VJ1A 3GHYA 1U9JA 3SEFA 4Y6PA 4J1QA 4QT0A 1BOAA 3ZMDA 2X9GA 4E30A 1YOVB 4RZHA 3JD0A 3MWDB 3A1NA 1PQPA 1PSDA 2EKPA 2IYPA 3GYHX 3A14A 5EJ2A 1GYPA 2DKNA 1UXJA 2VYVD 3FF4A 3H5RA 5A4DA 5L3EA 3BMNA 1J49A 2XPCA 3Q0EA 2Q2EA 4RB0A 2CMDA 3RC1A 5KVQA 1HSZA 2MLGA 3QPHA 2E1CA 4CQLA 1ZVMA 1B9NA 5LC1A 5CVJA 4HFNA 3F46A 1MA0A 5A3JA 4L74A 4FB5A 4QTZA 1UHMA 1E6UA 1XELA 2J5QA 4M9ZA 4CMCA 1YB4A 4IZHA 5TRTA 2VYVA 4ZD6A 2OHXA 2VZ8A 4TKMA 1NBOA 4BQRA 4HA8A 1O57A 1KU2A 1Y9AA 2PNFA 2FPIA 1V3TA 4ND4A 1DLIA 4U0YA 3DEYX 4U6QA 5B1YA 4YIIA 3ISPA 1GZ4A 3PIDA 4R1HA 4CPDA 3ZN0A 2I76A 3A28A 4C4OA 1QPMA 4INAA 1UXHA 1V6AA 2JD2A 3I6QA 1MKMA 3KO8A 3IWFA 5H6RA 2Z1MA 4XJSA 3RU7A 2Q1TA 4CUJA 4OQZA 5JMWA 3IRRA 5AIPA 1PDNC 4MQVA 1DPUA 2PBIA 3MEQA 3P19A 1D3YA 4TQGA 4UVDA 3QVSA 1F14A 1G3SA 1TT5B 4CL8A 3S2FA 1AOYA 1U5AA 1YBVA 1C3VA 3DMTA 5E20A 2VOEA 4GKBA 1C0PA 1SPXA 1HBXG 3MJEA 1YDWA 5D6EA 2OU2A 3F4BA 2M5WA 4IVNA 1H0MA 1NWHA 2O61A 4KTTE 2OGUA 2C7GA 5EL0A 4GSLA 4Q3AA 2HRZA 1FMCA 1K0UA 4J1NA 5HA5A 4YT4A 2C6YA 2QUFA 2ZTMA 4Q48A 2JFFA 2RQPA 2PQ8A 2BI8A 3PHHA 3OV8A 1ENZA 3UFXA 4LLNA 1EFLA 3PJEA 2YV2A 5KOIA 1HXDA 5D8LB 3C85A 3H5AA 1O3SA 4LW8A 1GY8A 2OZUA 3RAJA 2ZNYA 5TS3A 4OOEA 1YRLA 1IN7A 1EFKA 5I7SA 3OHSX 2H1SA 4BQPA 1Q7BA 4HBLA 4LK1F 3L4BA 2AE1A 1ENOA 4XGIA 4CLOB 2J5KA 5KNLA 3GVCA 2IODA 1K3TA 1EMDA 1YKFA 3V8KA 2D1HA 3KZVA 3FNEA 3PJFA 4YG2F 3ZU4A 2TDXA 2FRDA 3CJNA 1LLCA 4FIZA 4PLVA 4CQLB 2XASA 3CUQA 3D4PA 3ZN1A 3WTXC 1D4FA 2I3AA 4BVAA 1B6AA 2VWQA 1B16A 4PGGA 3JAMK 1YB1A 2K02A 1LDDA 1TVEA 1ZW1A 5JYEA 4UEOA 4WLNA 3INGA 3CH6A 4UVGA 3IC5A 1NXQA 4GWKA 2PR2A 1VLLA 4XX0A 5K9ZA 4BNCA 4LN1A 2D5AA 2D3TA 4ZQEA 2YHUA 3NJ8A 1DXYA 4EGFA 2M45A 3BJOA 5J8FA 4U0WA 4FFRA 3PYMA 5JCJD 4CLXA 1T39A 3DBRB 3OJOA 4AIJA 1IHYA 4FC6A 4II3A 2GO1A 2A61A 1BG6A 4RLHA 4A0YA 1A4IA 4RPJA 4L5JA 3ON5A 4RF3A 2E37A 1Z9CA 2P8TA 3F23A 2BELA 4QWQA 1QP8A 1XSEA 3ZHYA 4E2YA 1F1ZA 2QQBA 1IXSB 1SD7A 4P4LA 3GXOA 2NVUA 1BDMA 5JCJA 1YO5C 3D5LA 1Q1HA 2WYVA 3EAGA 4PZJA 2NRAC 1WWKA 4A26A 1JKJA 4CM9A 3VZRA 4QLCU 2H5LA 5L53A 2STWA 2A07F 5TJ9A 1BIAA 1Z91A 3AY3A 4F45A 3MJVA 1DPGA 5B37A 3RROA 4UVCA 4IRHA 2IA2A 1OYIA 2W2KA 4HY3A 4MVJH 1XGSA 4Q3BA 1ZRCA 1PJSA 1CF7A 3KFWX 2I65A 5LBQA 1V4RA 1WQ2A 1KA8A 3V2GA 1YQAA 4O6VA 6ADHA 1E1MA 5L9AA 2AS5F 3MZHA 1ONPA 1WRJA 5AIQA 1DIAA 1DFIA 3JQBC 3JD3A 1TT7A 3KSDO 3X2EA 4YPOA 3RUEA 3F1KA 3LZ6A 2V1UA 1OZAA 2EFOA 4XR9A 1SEVA 3KTDA 4J6FA 1QGPA 1ZSYA 5BQFA 1U5TC 1QYVA 4R1UA 3ZH2A 1Z82A 4E5MA 2GAUA 2L4AA 3JYNA 4WKGA 5DOZA 9LDTA 1YH3A 3JSAA 4DLAA 4RZIA 3TZ6A 2P7VB 3E6CC 3WTBA 3GMDA 1PL6A 2D2IA 3HJAA 3WGYA 1YBMA 3M9AA 3KVOA 4XQEA 1F9NA 5DYMA 3LU1A 4KUHA 3HHGA 3O3KA 5KVVA 4BNXA 3QP5A 1ISJA 4PFJA 3NKLA 4MIOA 4EUHA 1T2EA 3WWZA 1LQTA 4FFNA 3ABIA 4ESFA 2ZXJA 1BDBA 2RH4A 1WDKA 3MTGA 3BJ6A 3U9LA 1OKRA 4LMYA 3WOHA 2H09A 2PZMA 5KWEA 3HFGA 1Y7TA 2ZIZA 3B6ZA 4YAKA 2J3IA 3BYZA 3CTAA 4XDZA 3AFMA 1G3YA 1HYEA 3E9NA 1A71A 4Z9YA 4GI2A 4UUMA 3VFZA 1DAPA 3I0TA 1QV7A 4XBFA 3G1TA 1XGNA 2YSRA 1UAYA 2PV7A 3LC2O 5AXBA 3TZQA 5BNIA 1R0SA 4HV5A 4ALJA 3V2HA 3GNQA 3C7CB 3F21A 2VBZA 2NU9A 4EQQA 5L7TA 4E70A 1LRLA 4P8RA 1Q1NA 4MVJF 4E13A 4J1SA 4BNIA 4E5YA 1B8PA 5KVRA 2W2KB 4GXOA 4WNIA 5A5FA 1EQ2A 1CWUA 4JCOA 5JNLA 1KQ0A 2F2EA 3BP8A 3DC2A 4O3MA 1I24A 3GFLA 3KYCA 3LQFA 3F3SA 2YX7A 4FR5A 1YJ8A 2VNAA 3IUSA 1A7AA 4M54A 3V8JA 5HOOA 3ZHXA 4RO0A 2Q2WA 5ICMA 1G3TA 5E8IA 2WTBA 1LVAA 3E97A 2C7VA 2W25A 2FPPA 5ILSA 2Z9OA 2AQKA 1U3EM 4JN6B 1XDSA 1XQ6A 1ISIA 4YBZA 2GN6A 1UJMA 4YYZA 2AEMA 3VH2A 1QYWA 4MGRA 1DRVA 3BTUA 5B4UA 1PZGA 3T7CA 3OMLA 2LF7A 2GRAA 1AE1A 1EK5A 4YJFB 4CMEA 4B3HA 3EK2A 3JTMA 3M2PA 2ZTLA 4WGGA 3DXJF 5JVTA 4NFYA 2FZWA 3HWRA 3I64A 3ITDA 3PEFA 4OQYA 1FPQA 1EK6A 3QWAA 3W8EA 3H3ZA 2DUUA 2KJBA 2WE8A 1FSHA
chains in the Genus database with same CATH superfamily
2BY2A 4Q1FA 3B38A 2HJWA 1KQNA 1R5ID 4LV5B 5SY4A 1HZJA 1V3QE 1BVYF 3DE6X 2M6SA 3G1MA 4KRFA 1ZOIA 3TVYA 3E35A 2YDXA 2GJSA 1A5TA 2FZ4A 3EXHA 5MGBA 4RESA 3HXPA 4JMLA 1XPUA 3AEXA 4GH5A 4HGZA 1JJFA 3RFXA 1T2UA 5LZ2A 2BJWA 4D4JA 3W2HA 2VXZA 2P3SA 4L76A 5MFZA 2OV3A 2X5NA 1VIDA 3K2QA 4IGEA 3VISA 3FGPA 3FLEA 2OC9A 5KU1A 3SEQA 1O96B 5CB6A 4QIWN 3FKJA 3P9CA 4WLOA 3II6X 2QVOA 3ABLH 1ADBA 3TIXB 1U0BB 3TM4A 3WIVA 5KQSA 1U1IA 4HDSB 4R31A 1I7DA 1Z8HA 4WHMA 5FNVB 2P5LC 2QA5A 2C20A 3HG9A 3I72A 3AWIA 5FEUA 4MW6A 2ORED 3CYFA 6PFKA 5JAIA 4MLDA 4EFDA 2IEYA 1E0JA 3H9UA 3ECSA 2UZ0A 3VPDA 2QMQA 3GRKA 4XICA 1SHTX 3HU2A 3S2UA 3GRVA 2XOXA 3GJ5A 1ELOA 4I1RA 2J46A 3ZWDA 3PF9A 3Q0IA 3WLFA 2QV0A 2FR0A 1OAKA 2GFIA 4Z9BA 5HRAA 2BGJA 5DLDA 3CUEF 1U2TA 2E5LB 3C1AA 4KYUA 4CMKA 3T7JA 3BTCA 1MJAA 2HPHA 5CG2A 5GTDA 4H77A 1OC2A 2ZXFA 3S55A 3UJBA 1MU0A 1PEAA 1V5IA 2X2EA 1R8YA 1RRVA 2W8BA 1D2AA 5FLEX 1AG9A 1XRQA 4CCKA 5IM4F 4KLZA 1NSFA 4QDZA 3GK3A 3V4FA 5KTYA 1DQUA 2PCLA 5KWIA 3AUTA 4K9NA 4L75A 5L3FA 1B72A 2VHZA 1V3FA 4DCMA 4B81A 1J33A 4UHEA 1FJXA 2XB5A 1TFRA 4B44A 2B78A 1CY6A 3T8RA 1O6CA 3QSGA 2YRWA 2XZTA 1VZ2A 2UUBB 1IWOA 2JAQA 3GLQA 1JPUA 3JAMZ 5FBQB 2EFWA 3N2NA 2XKKA 2E71A 4IEJA 3LBAA 1KIMA 3LNQA 3ZHTA 4B3MB 2YW2A 1ARZA 1VL1A 4Y9SA 2UV1A 3QEAZ 1POXA 2B35A 1O03A 1V8DA 2NUBA 4AFNA 4KPYA 4LOAA 3WLNA 4WL0A 4UM7A 1SQ6A 5BR1A 4MQ9F 3DKPA 5KK1A 1CW2B 2W6CX 2G6BA 3HQ4O 1FU8A 4M3FA 1VC2A 2QIOA 4WLFA 1GVHA 3WYEA 2MSNA 4UNPA 1ZP6A 3WWYA 4Q9DA 5FWAA 3IUPA 2Q5CA 1Y0NA 2XPVA 1LS6A 1XL1A 1V11B 2O06A 2C5AA 2F48A 4DVJA 5EWJB 2WJWA 4RA9B 4A3MJ 4BAYA 1U04A 2CL7X 4G4SO 1T15A 1XX6A 2OYRA 1JIKA 3FMIA 3PC7A 1HG1A 3K7AJ 2P75A 3H0CA 2LD4A 4YH1A 5IJ0A 4TOIA 1SK8A 3NRCA 3ZMSA 1RM5A 3T7EA 2WYWA 3FWKA 2DH5A 2VQGA 1TTQB 1WHTB 4PTLA 2QMZA 2R1TB 4CIVA 2C4NA 4XFJA 3V8VA 2Q8NA 4W4TA 1GZDA 1U0OC 2TSYB 1ECPA 3REQB 5B5SA 4G36A 4HLXA 3T0IA 1X3SA 1G19A 4YRTA 2CU7A 1KJZA 1QRDA 2GK6A 2P9HA 4ZOLA 3Q2OA 4XPZA 3A9WA 4MWTA 3W5CA 3LLVA 3R0ZA 2HHLA 4XCXA 5A3QA 1G21A 3OZXA 5B3LA 621PA 3N2GA 4RPGA 1N2XA 5AOVA 1JDVA 4BO7A 1X1PA 4NHOA 1ZWLA 4M8KA 3MWMA 4LDRA 5A62A 4QBHA 2AFHB 5K8UA 2JAPA 4D9IA 4CL0A 4IO0A 2G9QA 5D4RA 2W84A 3ABMH 4M1SA 5FORA 1T1SA 4GNKA 4EPTA 1N6PA 1AU9A 2JIOA 4NU8X 4E3ZA 2YJ6A 1XLWA 4J43A 5HFNA 4MWEA 5LEKA 3MLBA 4CCYB 2VP9A 3L40A 3CPJB 1JPVA 3HBFA 4N03A 1C3XA 5F5NA 1DARA 4BMSA 3A2LA 2FUEA 4UCFA 3WRYC 4GC5A 2FSGA 5JMOA 1K4SA 4TYWA 2EJBA 2VQLA 3FPKA 3WQRA 4JQSA 2P5VA 3RHTA 2O1EA 4LVOA 2QRLA 3RDPA 1I50J 1TYAE 2XQKA 1D2GA 4GBJA 3DR3A 2HRCA 4NBRA 1N3LA 2Z9DA 1XTTA 4YLGA 2KWIA 5AVXA 4BMYA 1KO1A 3GWGA 4R2XA 3CCEI 3BJRA 3ZOZA 2DBYA 2ADOA 3WZLA 5F52A 1NQXA 1HZZC 2G1AA 1ZCFA 1Z15A 2RMKA 4HP8A 2H27A 2P0YA 3FPEA 3BA1A 3VHXB 3BF8A 1HNZB 3GBPA 1NXPA 3UJHA 2OQIA 2K5CA 1FOWA 4JBGA 3UHFA 5EJ6A 3H6HA 2IA1A 2TRSB 4HDNA 5DP1A 2O0JA 3HL2A 3L8YA 1ZWKA 4F46A 3W5BA 4ZWNA 3LQRA 1JIQA 1H9TA 2BFMA 4A5SA 3P0FA 1KSHA 3ONEA 3LCUA 2EJUA 3K6KA 3KOOA 3T4UA 3ZU2A 1HEIA 4UTPA 2YX1A 1KOGA 3AR5A 1LDNA 3SFZA 4TL7A 5C46F 1BCRB 3BZUA 2L7KA 4MUXA 4NNJA 3KP5A 1V96A 4A0SA 3UHAA 4MR9B 1W0KD 3S2DJ 1UG0A 2VIIA 5E1XA 2ZAMA 3V1NA 4AS3A 5KQMA 4P0QB 4BY9E 1W0KA 3GQVA 3WTYC 4W7HA 1I94B 2G9VA 4Y7NJ 3G8AA 1T0PA 1KEPA 4UOQA 2ZLBA 3IAUA 3BKWA 4OJQA 1ETWA 5ALFA 1YRYE 3JD1A 1XTBA 2YTZA 3CZRA 4P33A 4D9BA 4IZOA 3HRSA 5IM5A 2Q3FA 1YBAA 4AY3A 3FMRA 1QZZA 4JA2A 3WS7A 3PQJA 3EY4A 2VAPA 1PZHA 3ZHRA 4BMPB 2ADFA 3OA0A 3GO4A 4NB5A 2DEUA 3GLVA 1KVQA 1CS4C 2AXEA 4IMPA 3CW9A 4O2BA 5K0ZA 2ZZMA 3PIPF 4NG5A 5GY7A 4RWZA 1BEZA 5BMVF 3O95A 4B3AA 2B6HA 1Y5NA 4DLLA 2PZGA 3ESCA 4EARA 1B00A 4CLRA 2PX3A 5ALTA 4X7BA 4OUKX 2N8GA 2O3UA 4C4ZA 2Q49A 1H2FA 4DXAA 3K0CC 3FOFC 2FSFA 4FKMA 3IP8A 1SKUA 3NJRA 4ZTUB 3MMYB 2ECBA 3PB3A 2CD9A 1JI0A 4NMWA 1MB3A 3K7EA 4ZDOA 4TKUB 3QFSA 2V9PA 3BEDA 5GOTA 3C5VA 4CM7A 1UOOA 4TN1A 3ASUA 4MITA 3QM1A 4DNXA 2XMPA 5ELXA 4CQMD 1DDGA 1UC5B 4G9YA 3ECAA 2DFEA 2RGVA 1X4OA 2QTVB 2VPZA 3UMGA 2OBBA 2X19A 1EUCB 4CQNA 2IHTA 2DUJA 1E2PA 4CQMA 3P9YA 4YHHB 1A7UA 2AMJA 4UV9A 2NM0A 3WSTA 3U9GA 5K7SA 3VKWA 4LGMA 4H1TA 2VTDA 3UKGA 2OHFA 4NV1A 2Y0SA 4I50B 3V8NA 3BY6A 1X39A 4G8CA 3OMYA 2EYQA 3O6BB 4M7WA 4EG7A 3LV8A 1I9CA 4JUIA 3GIDA 4C3JJ 2VUHB 4I5GA 4HSEA 2Q5HA 1AGNA 2PZ8A 3ESBA 1PFGA 1VSUA 2JJ1D 4RAZA 1DO2A 5K6TA 3H11A 1D0YA 5B1HA 2JJ1A 3BOQA 3FPCA 4YALA 3JYHA 1GRRA 3GFFA 4R1TA 2CFRA 2WSYB 1ZMXA 5LOVF 4ZT5A 3LSHA 1V1RB 4FCWA 1SXGA 4Q6WA 3AF3A 3D6HA 3HH8A 1TZKA 1QHXA 2CV2A 4OAZA 4JEMA 4OIRF 2R9VA 1CQJA 2IRFG 3RBXA 1TF5A 2PT6A 4G5QA 1SUIA 4RK4A 4OHCA 5DULA 4DT1B 1MJGM 5LMNB 1Z17A 4A91A 4W9NA 4L7VA 1T13A 1VYHA 1Z06A 2OC4A 1RYBA 3U1TA 1H2ZA 3VDQA 3DFMA 4JKOA 1NM5C 4D9CA 1FTGA 5U4XA 2NPFA 2X6XA 3OOYA 5FL7D 1Z0UA 3H17A 5E3IA 1ACMA 4GPZA 1MH3A 1GFWA 3H83A 2D5VA 1HF3A 2AHRA 3M1AA 4URYR 5FL7A 5KVAA 1J09A 3R9WA 1EK1A 1LBIA 4M3BA 1WW3A 2CJYA 3O74A 1YJQA 1ONSA 1Y37A 3MMNA 1OSNA 1J00A 2CYBA 3NOVA 1THTA 3LVBA 1KZYC 4GE0A 5EIHA 1KVUA 1OF1A 1ZN2A 2K27A 3KUDA 4QDJA 1PP8F 2JUGA 4XRSG 4C7XA 3U19A 1JSXA 2VJ4A 3LO5A 3IA7A 1VQ4I 1YMVA 2G9UA 2QD3A 3H42B 3EGVA 4PK4A 3E18A 3F8MA 2R6CA 5FWYA 3M8JA 1E1NA 4F5ZA 4XM1A 4WECA 5A2QK 2EV9A 5AK3A 3VOSA 2O4CA 2DO7A 1NNI1 1O1YA 4RVHA 1ZVKA 3WU1B 1JYFA 3IP3A 1DX4A 2DU8A 3RNLA 2WSLA 1PZMA 1BC5A 4D26A 4XCQA 3RS4A 4Y8VA 1WPXA 3BBPA 4ZDJA 1JXQA 4UNNA 1DIRA 4NV3A 3E84A 3HSSA 5GADJ 2RNGA 2ISZA 4YMVA 4LDNA 4P2BA 1JAZA 2YXPX 2ZP1A 2OK7A 2ERCA 3JRWA 4F2PA 4R2IA 3PXXA 4V1CA 3UB4A 4BJ1A 2A5LA 2VYCA 2C61A 1TKAA 2JRCA 1DMRA 1WPKA 4CM8B 4JX4A 1SURA 3RANA 4HQMA 4FXOA 5B1IA 3KXDA 3RHSA 4JVLA 4PZEA 1IN5A 2BKAA 1X7XB 3E5XA 1XC7A 4LWPA 3AEQB 5BR7A 3TQNA 5AI4A 3TOCA 1G41A 3INYA 2WYUA 5A6SB 1Y6GA 3GJYA 1CJUC 4IJVA 4E5UA 3LIPA 2W6QA 1CEXA 4IWNA 1LFAA 2WK1A 2FGJA 3QVMA 5CEJA 4C0BA 1RI1A 4C6RA 5CW2A 3FH0A 2O05A 4NPHA 1LK7A 1V8ZA 3Q3CA 3W78A 2G40A 2PGLA 1CR2A 3ZLUA 1P8AA 4PLZA 2HO5A 4L15A 2HF9A 2ID7A 2C5GA 4YRZA 5JSFA 3BIXA 1R4AA 3C2BA 3U3KA 2Y76A 4UCQA 1Z5PA 2Y4OA 4P34A 3KTAA 3Q2IA 4X62B 1Z39A 2W6ZA 2P4WA 1B0PA 2V7FA 2W0MA 2C5HA 3VH3A 2NADA 5DNVA 2OJED 3S2YA 4WBNB 2XC7A 3UG7A 4H6PA 4OLBA 1PL7A 4EENA 221PA 3L8FA 4NC6A 3AP2A 3P9KA 3C48A 2AMFA 2BV6A 1VKRA 3T3DA 3EIEA 1P1IA 2GNAA 2W90A 3IKMB 1X80A 5CJPA 3N7AA 3RVPA 2JGDA 5BN4B 5TY0A 1N2CE 2AN4A 5G4KA 2NQ8A 2CXSA 2ZBRA 2W24A 2Z2ZA 1V1JA 5IULC 3KXLA 1N6HA 1VRCA 1R74A 1E9BA 4XKBA 3SZLA 4KPFC 1U8TA 4WKBA 2C2YA 4ZI7B 2NNNA 3BTVA 4BPRA 3SSAA 3OFKA 3HUUA 2X4GA 1MEJA 5EUMA 2CB9A 4ILEA 1AA9A 5T64A 1M72A 4GF5A 5HS4A 3V2UA 3LDGA 2FDRA 1CF4A 1ZA1A 2XB2A 3D5QA 5K6AC 3AVUA 4EHNA 2EIMH 1A0OA 4AX8A 3PE6A 2WFLA 3O2SB 4RQBA 4DOZA 1FP6A 1V37A 5CJ2A 2EFDB 2QKLB 1U2DA 4PCAA 2GLTA 1FYKA 1QKIA 1W94A 4R1QA 3VPHA 3DZHA 6GPBA 1FBQA 4XZ3A 1J1IA 4A6EA 1ZOPA 4HEA6 3MINA 4BUZA 5JS7A 4AQYB 1YS4A 3BR0A 3LUDA 3OJWA 2CW8A 4K8OA 1L3IA 5CU7A 1J8YF 1Q92A 2P0EA 1G18A 4ZQCB 1KSJA 3IAS6 1C8BA 4IIGA 4YCAA 4WMLA 1GPLA 1PT9A 4X1IB 3AI3A 2A9JA 1P72A 3R6SA 5KYXA 4LJSA 4EM0B 2ZO4A 1YR1A 5ALJA 1SGWA 1TZBA 2G8NA 2HXYA 3RC2A 5ESXA 4IIDA 5BT9A 3CNOA 1JWAB 3PPYA 3EWAA 3EZ6A 3VR1A 1QIGA 3P45A 4YMTA 4O08A 4O4LB 2X5OA 5BOSB 4GR4A 3U17A 1QQTA 3OS2A 3WRVA 3T0GA 3H9QA 4D9GA 1M2VB 3ZY4A 3AL0C 2B4QA 4FEGA 4ZC3A 3ODGA 4HQFA 3JQFC 4MCIA 1L5LA 3VR5H 3JYQA 4XGRA 1I36A 2PL1A 1IVYA 2Z95A 2UVPB 1K08A 1FSZA 3ZQKA 4CF6A 1ZRHA 1LZLA 2W6PA 2EA4A 5J9FA 1LX7A 2EEZA 3ILYA 1Z62A 2BLNA 1URPA 3R7WB 1H6AA 5GAEJ 4IGAA 2MSCB 3TDKA 4NATA 4C07A 1OYVA 5FCDA 4XIGS 1DRJA 2LR0A 3LM8A 3SEFA 2OM6A 1BOAA 1GFIA 2WIKA 3DEZA 2PUWA 3MSXA 4CF3A 3L1PA 4HEJA 2PMZA 1HSZA 1EX6A 4CQLA 1WJ5A 2V7GA 1SCKA 4RADA 1YB4A 5TRTA 4ZD6A 2OHXA 1PD1A 1XZLA 3C3KA 3RTBA 2A1TS 4YIIA 1QDEA 2H2AA 1KDVA 4IQFA 4C4OA 2QYHA 3BA6A 3F0CA 2FPOA 4MQVA 3P19A 4REQB 3IUQA 3ENWA 2VOEA 1V1MA 1SPXA 1JHDA 1JILA 2OGUA 5E4TA 5FBHA 4K9SA 3PHHA 1RSZA 2X6QA 5D8LB 4JA0A 1EJ9A 2OHGA 1QAMA 1IN7A 5I7SA 4RH0A 2WMOB 1NW9B 1ENOA 4MW7A 4YG2F 1UZUA 3WTXC 1JS1X 3AJ8A 2YJ3A 2K02A 3A9TA 4LPKA 2G06A 1VLLA 4LZZA 2D3TA 2DFKB 1NTCA 4ARZB 1BGXT 2ZIGA 4L8WB 5JWHA 1K61A 2BELA 3DB1A 4P4LA 1YZLA 2E9SA 4F96A 3HM9A 2JMWA 2QM8A 2H5LA 5FHRA 5ANRB 3CZ4A 1VB3A 5B37A 4MROA 4Z4GA 3FXLA 3RVOA 1PJSA 2XQFA 1CF7A 5LQUA 4ZOLF 1DEAA 4PJLA 4CSWA 2VKVA 2ZYSA 2JZNA 4Y1RA 5FHQA 1ZSYA 4UD6A 4R1UA 4HWPA 2G36A 2QQGA 4IDQA 3CBGA 2P7VB 1CD5A 4QHYA 3RVSA 3WTBA 1JUSA 4QQFA 2B2CA 1R6UA 2YJ4A 4LTDA 2KM1A 3SK0A 3CJQB 3IVAA 4RANA 4QA9A 2KHMA 4Z9YA 3G1TA 1R0SA 4LYGA 3V2HA 4KVFA 5IKEA 5ECGC 1XO1A 1OAOA 4KACA 2E2IJ 5CA1A 4E13A 4BNIA 2X9DA 3H19A 1KQ0A 3F3SA 4KIWA 5C53B 5BN3A 3IHLA 4TS3A 2A88A 4HLQB 3K2AA 2C8VA 1EK5A 1RZVA 1TAGA 2QVYX 2ILVA 3HWRA 3W8EA 2O14A 1AS0A 2L7ZA 5KOJB 1N6OA 5KQPA 1T5HX 1G2IA 3SX0A 4N40A 1VSTA 2F90A 4K81B 1U8CB 5AVTA 3K53A 3AL0B 5DSTA 1DWUA 1JG7A 4EJ6A 3CX4A 2UU9B 1JKOC 1I6KA 1WXIA 3N8HA 1WCMJ 4UM9B 2UZIR 3L1UA 1WV1A 1NY5A 3WAKA 3E5MA 3N0WA 1TCVA 4DV5B 1T4CB 4G5OA 2ELJA 2ZJPF 1V8OA 2DYKA 1U8YA 4DA6A 3AR9A 3RNOA 2DKOA 3FDJA 3P97A 3QK7A 4CT5A 4B3XA 2R5ZA 5DRYA 4QREA 2FG6C 4M1TA 3LKZA 4KXFB 3R3WA 1DPRA 5AHRA 3DAGA 5A5GA 4P84A 1Q6ZA 2BMDA 1S5PA 1ZM4A 5K01A 5M04A 3OLQA 4HT3B 5CLSA 3FA2A 3PFNA 3QNMA 4GOXA 1DIOB 1G3QA 2FE3A 5T6MA 5AM5A 1RE1A 1M8GA 5ILUA 5FOVA 4IDFA 2A5FA 2WMNB 4ZYDA 4E7HA 5D2CA 4EI2A 2Z8ZA 4C6TB 5FFFA 4WXRA 2GZSA 2XBMA 1YS9A 3HZHA 3KYBA 3MWLA 2Q7XA 4ZK6A 3Q3SA 3TRHA 2OUKA 3ZY5A 4U7GA 5F4ZA 1U02A 1R18A 2ZSDA 4NCAA 3SE7A 2QIPA 2IYTA 5HHTA 5KYUA 3BM5A 1T8YA 1DOAA 1E0KA 1XRLA 2BFPA 4TVKA 3D4NA 3AJAA 4C2MJ 2GQQA 3A1TA 2WE7A 4EG6A 2Q5JA 5KX5B 3F2IA 3C97A 4JP1A 1VHDA 3JATB 3MOSA 1W1UA 3AU8A 5JH7A 3PHIA 3WKEA 1GFZA 3TUIC 2BEKA 2IGMA 2Z2JA 2Y0SN 3QEMB 4XWAA 1QH8A 4Y1EA 2L9VA 1SXJD 4OQMA 4O2BF 4EKGA 4ASNA 2BBSA 2NV6A 2LCFA 3GLHE 3OSFA 4K9QA 3FXKA 2VK4A 2WJGA 2WFMA 1L7BA 4Q9IA 1MC1A 1GXPA 2GF2A 2WJJA 1PJ2A 4DPLA 1XAGA 2FEPA 2DMTA 2ONCA 1DTSA 2PRYA 1YDEA 1MP0A 3X1KA 2C9BA 5DT2A 3R0QA 3VPSA 1RR8C 3Q88A 5AKZA 3ZZNA 2DHEA 4RV4A 4LJKA 4BHTA 4CUKA 2VJQA 5JDIC 2DVMA 4QTUB 2LVBA 3S2ZA 4F84A 5BOXA 1AUXA 1MC4A 3NS7A 1P4JA 2DQSA 2YUSA 4KYVA 2F1HA 3IQIX 2VF2A 3OOUA 1I3KA 2ZYVX 4WX2B 5AKKA 3MILA 1DOZA 1P7VA 3Q6NA 3ZK8A 2IUUA 2JBHA 4EA6A 1TA9A 3OKPA 3KXIA 5LZ8A 1X7YB 1ZN8A 3G2JA 5DF1A 5AK5A 4S05A 3CMCO 2PXCA 2UYHA 1LI4A 1I3LA 4IUBS 3RRFA 3EYAA 1P17A 1KZGB 3L7OA 4RVUA 5JANA 3TCNA 2Z98A 4G4GA 5HLIA 2RIRA 4Z54A 4R9VA 3L43A 2OQ2A 2C97A 3I9KA 4WCDA 4IPAA 1WJAA 1DBPA 1L5WA 1JFFB 3OIDA 1DUIA 4OXQA 1AT1A 1CV2A 4YUXA 1FVOA 4D9FA 4R1NA 3HS3A 1IJWC 2GAOA 4BX9A 2WHYA 2WD9A 3DVAA 1TB4A 5A1TA 1EBBA 2DBQA