4A3DJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3dJ00
2ME6A 1BJZA 1UHSA 3TP3A 1TWAJ 1UMQA 3G1MA 2LFBA 4C3JJ 1TWCJ 1QVUA 5K7ZA 4JX5A 5E3LA 4XK4A 3BG3A 2E1OA 2CUFA 3TW7A 1HF0A 3I4MJ 1FTTA 3O8HA 2DMNA 3HOYJ 4X1EA 2EZIA 5FJ8J 3B6CA 3S1QJ 2L7ZA 2JA6J 1Q1VA 2EZLA 2R7ZJ 1U9NA 4UUSB 3JRDA 1B8IB 3A03A 1JKRC 3HGGA 5GP9A 5J3LA 3QPSA 1E3OC 1QVTA 1MSFC 2NVXJ 3LSRA 2NVQJ 1IG7A 3BTIA 3HOUJ 1S7EA 4MO7A 1G2HA 3PO3J 1LE8B 3HOXJ 2QF7A 2Y0SN 3VPRA 4S0HB 2ECCA 3CCYA 1X58A 2OF7A 3JRBA 4UUSA 5M3MJ 2FQ4A 1B8IA 2YUSA 3LSGA 3OIOA 2XPVA 3GTMJ 4M3EA 2CUEA 1HOMA 4D7MA 5JLWA 2W48A 2XB0X 2D5VA 4A3IJ 2K9QA 4IHWA 3GTPJ 1LE8A 2NVTJ 1TWHJ 2JWTA 5F08A 5EF6A 1WH7A 3WHBA 1X2NA 3HOVJ 3GBGA 1POGA 1FJLA 2AO9A 3BG9A 4QTRA 4I6ZA 2M0CA 1VF9A 5FKLA 3OOUA 4IEJA 2O7OA 5M3FJ 1JT0A 3S1NJ 1Z0XA 2VKEA 2R92J 2B63J 1VNDA 2EH3A 3ZQFA 3TP0A 2XB5A 3L1PA 3M4OJ 2O8KA 1RPWA 4FTHA 1A6IA 3A01B 1GT0C 1BL0A 4DYCA 2YU9J 1XC5A 3BTJA 1MBFA 2XGEA 1Y1WJ 1WGXA 4A3KJ 2LP0A 2CQQA 5BNGA 1EF4A 1U8BA 3G1OA 2ELKA 1Y1VJ 2VKVA 2NOGA 1UG2A 2M9HA 2HOTA 3TW6A 2JK3A 5M5XJ 5FKOA 2EBIA 2CQXA 1WPKA 3A01A 4AC0A 3BR3A 3BTLA 4DZJA 5IOZA 3HBLA 3HB9A 2KDZA 2E2JJ 2CU7A 3Q0VA 5GPCA 1MBKA 1K83J 4A3GJ 5M5WJ 4HNVA 3BG5A 4BY1J 3GTKJ 1SANA 3NARA 5C44J 2HXIA 2ME0A 1X2MA 2CJJA 5F0CA 3M3YJ 2DMPA 4CYCA 2LTPA 3FK7A 1ETOA 1MBHA 4M3DA 1B72B 1QPIA 1OJLA 1PUFB 5HODA 3UKGA 1YRNB 2AHQA 4C2MJ 1JGGA 1I6HJ 5E3MA 4XIDA 2ID3A 4MIMA 4UUTA 1H88C 4V2FA 5E3NA 3CDLA 3Q0WA 3K7AJ 1HCRA 2JN6A 2LD5A 1B72A 1HDDC 5EEAA 2GBYA 1P7JA 1PUFA 2Y2ZA 2R5ZB 1YRNA 5IOYA 2XGCA 2H1KA 2VUMJ 3DCFA 2TCTA 2HDDA 3ZQLA 2XRLA 2O9LA 2WB1N 1ETWA 3MKLA 5FLVA 4A3EJ 5JLXA 1IDZA 5EGOB 3PO2J 1ENHA 4ABZA 2M2EA 2R5ZA 1ORKA 1AHDP 4JP0A 5EDNA 1WH5A 5K7FA 1QRYA 3B6AA 3ZOBA 4M3GA 1MNMC 1JJ8C 2K9SA 3BQZA 4B4CA 1MBJA 1JTXA 2VI6A 4IHYA 5J1YA 4A3LJ 2E19A 5EGOA 3SFIA 1IUFA 3RQIA 3RZOJ 2DN0A 4LOCA 1OFCX 3A02A 4DYQA 1W0TA 2JA5J 2XPUA 4Y7NJ 4GFBA 2R5YB 2I10A 4RBOA 2Y9ZA 2MGQA 1GV2A 3BR0A 3ZQGA 2HOSA 2HYJA 3JREA 4JYKA 5F1JA 1IRZA 3HM5A 3CMYA 3CQZJ 2JJ7A 2OPTA 5DTDA 5FKMA 4AYBN 1JKOC 3W6VA 4XRSA 4A69C 4MLOA 4FE4A 2R5YA 1Z77A 1H89C 1IC8A 1AU7A 4MFDA 2LKXA 5EYRA 5FKNA 2WV1A 5IYCJ 2XPWA 3K2AA 1JTYA 3WHCA 1JUMA 3S15J 3ZQHA 2L7MP 3D1NI 1XS9A 1IJWC 3BR2A 1GVDA 4QSHA 5C3EJ 2CRGA 4I76A 2XSDC 4W97A 1GUUA 2DTZA 2EQRA 2MSYA 2LLKA 5M5YJ 4BKXA 2GM4A 3S16J 3IH4A 3JRFA 4CYCB 2HOAA 3Q0UA 5IP9J 5EG0B 2ECBA 4D7NA 1T33A 4BXXJ 2X48A 2FD5A 2R93J 3GTOJ 1RESA 1JUPA 1A5JA 1WCMJ 3GTGJ 2ZB9A 3BR5A 1JUSA 1ETXA 2DA2A 3ZQIA 4V2GA 1MH3A 2DA1A 2Y9YA 2H8RA 5J1UA 3FKIJ 1MSEC 1IGNA 2MG4A 5EG0A 2IAIA 1RR7A 3RKQA 1ZK8A 4FISA 4IHVA 2X9DA 4A3JJ 1DU6A 3S1RJ 1RKWA 1MH4A 4JX4A 5EZGA 5IPAA 5F0HA 5F04A 4C3IJ 4A3MJ 2IEKA 1NK2P 3GTLJ 2DMQA 3ZQCA 3BTCA 1XG1A 3HOWJ 4FCYA 2DJNA 4A93J 5IYBJ 4M3BA 2M8GX 4D5FA 3SJMA 2R0QC 3JRIA 4B1RA 3BQYA 2VPRA 3S1MJ 4A3BJ 5FLMJ 3Q3SA 1WI3A 2QCOA 2LY9A 5F27A 4QIWN 2MW8A 3JRHA 1RKTA 1SFOJ 4IHXA 9ANTA 4BY7J 5DS9A 2NS8A 1BW5A 3JRCA 3RZDJ 1TWFJ 1T56A 1FIPA 2Y30A 5IP6A 4AUXA 3O8GA 5F0FA 2JA8J 3I4NJ 1ITYA 1ZKGA 3FK6A 2EZHA 3HGYA 3GTJJ 1VFCA 2WAQN 3BT9A 1DU0A 4DYRA 4XRSG 2FJ1A 2HI3A 2PMZN 2KT0A 3LSJA 1D5YA 1LFUP 5J1RA 3S14J 1NTCA 4XICA 3HEFA 1ZR4A 4G12A 1I50J 4MFEA 3SDGA 1TC3C 4DZPA 2P81A 1R9TJ 3S17J 1MBEA 3OSFA 3HDDA 4L5EA 4C3HJ 3BR1A 2LK2A 1ZQ3P 1GDTA 2LVSA 1K61A 1ZTRA 1GV5A 2L0KA 3HKZN 4A3FJ 4BBSJ 3QQAA 2XGDA 4FE7A 5GPAA 2JMWA 1U78A 2Y31A 3QPLA 5C4JJ 2L9RA 3PM1A 4BBRJ 3LOCA 3IH2A 2NS7A 2HXOA 1I3QJ 1P7IA 4A3DJ 3H0GJ 1ETQA 1ETYA 3G1LA 3DEWA 2L7FP 3F0CA 3MVPA 4X6AJ 1FEXA 2NVYJ 2ID6A 3FISA 5C4XJ 1HDPA 2DMUA 1NK3P 1JKPC 2E2HJ 4M6VA 1W0UA 1ETKA 4A3CJ 1ZR2A 1O4XA 2DA7A 3TEDA 2DA6A 3LSPA 1ZGWA 4EEFG 5IP7J 2M34A 3S2DJ 1U9OA 1OCPA 1RETA 1IV6A 1AKHB 1F36A 4RDUA 3S2HJ 4D5CA 4M3FA 2GLOA 3E7LA 3JR9A 3NAUA 3GTQJ 1F43A 3JRGA 1HLVA 1JKQC 1APLC 3OSGA 1BW6A 2K9NA 3BR6A 2N8GA 2IBDA 2HQ5A 2RAEA 4W1UA 3FIWA 3MN2A 1TWGJ 1ETVA 2G0EA 2LR8A 5FKKA 2K40A 2E2IJ 1CQTA 2DA5A 1AKHA 1LFBA 3IV5A 2YS9A 1VI0A 3LNQA 2DMTA 2DA3A 5K7HA 4DW6A 1H8AC 4JX6A 1MBGA 2TRTA 3H3VK 5IYDJ 3HOZJ 5EZHA 3IH3A 1FTZA 1IDYA 4B3AA 2JA7J 1JJ6C 3JRAA 1OCTC 1JT6A 2DA4A 2COBA 4NDLA 3C2BA 2EZKA 5E3OA 1BA5A 4XRMA 2FX0A 4Y52J 2X6OA 4J19A 1FIAA
chains in the Genus database with same CATH superfamily
3LSIA 1YG2A 1XDUA 4RM2A 2DYSH 5DD4A 3PSIA 4XKBA 2BXZA 4WF2A 4C3JJ 3GFIA 4A0ZA 5K7ZA 3H5NA 1W4MA 4IQ4A 2CO5A 1W7PD 1XMAA 2VT2A 2E1OA 5D5UB 1D0ZA 2KRFA 5E1XA 1HF0A 1DGRM 5AIQA 3I4MJ 2XV4S 1AA7A 5JFRA 3KX2A 2YPRA 4S05A 5FJ8J 5HNFA 2Z3YA 3B6CA 5B66C 2L4AA 2JA6J 3AL0C 4NQWB 2EB7A 4IRGA 4B09A 3TOBA 1L0OC 3A03A 2KZVA 2W82A 4LK0F 2MLGA 1MDMB 1QHGA 1XTAA 3BP8A 2NVXJ 3LSRA 3M7GA 2NVQJ 5F6FA 1IG7A 3CJRB 1S7EA 1G2HA 2PEXA 2DXIA 3HOXJ 2R7VA 2ECCA 4DGWB 2HPIA 3F8BA 4G8XA 3JRBA 3HL2A 2OUMA 2XF7A 4UUSA 4XLAA 2GA1A 3FHZA 1LNWA 4IHSA 1ON2A 2L7KA 5D5VB 2YUSA 4IQJA 1I5ZA 3OIOA 5GAGJ 2BY0A 2ZJ2A 5L3FA 2VJ4A 3WTUC 2R7TA 2V4JC 3OS1A 4D7MA 4E7IA 4R79A 1UELB 2JTVA 3CMMA 2D5VA 3LMMA 4L9NA 2K9QA 1TWHJ 2DJIA 2JWTA 1SD5A 2VE8A 2JPBA 3EUKL 1PVEA 3QU6A 3ZN1A 4KYWA 4GYGA 3LQRA 3WHBA 2I5UA 2GIVA 3H5AA 1POGA 3VYRB 4ENNA 4I6ZA 1YJNI 4MTDA 2M0CA 2PMHA 4KUMA 3ZN0A 3COAC 4E7ZA 3BZCA 2ZXIA 1I6XA 1TW2A 1WJ5A 2FEZA 2V9VA 2R92J 3CCVI 4I2OA 1HBXG 4WXHA 1F4KA 5LRRA 4KFCA 1ULYA 1EKEA 3HJEA 4OIRF 2O8KA 1A6IA 2CQNA 1G6NA 3TDZC 3GVAA 1XC5A 1JGSA 4XKCA 1X1BA 1BI1A 1MBFA 4BQOA 1Y1WJ 4A3KJ 1NG6A 3EPZA 1U8BA 4CHUA 1CGPA 3L9FA 3CZ6A 3G1OA 1RC9A 3P9CA 4PGGA 4IX7A 1RI7A 5K1YA 2JK3A 1UB9A 1Z67A 2WC2A 2Q2EB 2F5DA 1BR4A 3K4JA 1W5TA 2QYOA 2EIKH 3HBLA 3HB9A 1OPCA 2XF6A 5ED4A 1EV7A 1KU3A 3Q0VA 4EQQA 3E5QA 1IUYA 1MBKA 1IXRC 4G94A 3VB2A 2A6EF 4A3GJ 2HOEA 2YX7A 5C44J 5FD6A 3KZZA 1J2XA 2PN6A 2UXXA 1WJBA 2ZFWA 1MBHA 1XGMA 5HNHA 1Z7UA 3N97A 2IP2A 1OJLA 1IO2A 4N9IA 1ZRCA 2BOLA 5HODA 4Y33A 1YTYA 1YRNB 3CC4I 1O7LA 1ZG3A 1UCRA 2EFQA 3X2QH 4XIDA 2R7OA 5D4RA 3U21A 1V5GA 1VQPI 1FBUA 4F55A 4V2FA 1E3PA 1B59A 5TISC 5E3NA 2COMA 3RKXA 5A2QK 3ESWB 5TRDA 4HQEA 4XKWA 4UVCA 2JN6A 2KIUA 4PGHA 3J7YJ 4D1QA 1B72A 4KNYA 4EGZA 1SVLA 1AWCA 2Y2ZA 2R5ZB 4HBLA 4ZDOA 2VUMJ 3DCFA 4MEXF 3L2QA 2VIXA 2M5WA 5IT9Z 3T8TA 5B3SH 2TCTA 2LC2A 3ZQLA 4U0VA 2A6TA 3HUGB 1LEAA 1U5TC 3CJNA 3BDDA 1X19A 2GZWA 3F72A 3L2WA 1IDZA 4LLNA 5EGOB 3HXLA 4PJ0C 1OQYA 1FYMA 4BQNA 3F21A 4HF0A 2M2EA 4LB6B 2FNPA 2V1NA 5FGMA 5K7FA 3CMAI 1RRJA 1MJAA 1RUOA 3D5SC 4PFOA 1ZAOA 2M45A 3F9KA 2MLKA 3BQZA 3C1DA 4E7LA 2IW5A 1YS6A 5CJ9A 1IZ1A 1MBJA 4L5JA 4A3LJ 2BVLA 3I59A 2E34A 2LG4A 5E18F 3VYTB 2PJRB 3ECHA 3SZGA 3EUHA 4HLXA 4OINF 4Y17A 1MMDA 4GFBA 3L2RA 1SC7A 2R5YB 2HWVA 2K86A 3OYGA 3CTAA 1GV2A 4G6QA 2K7LA 5F1JA 1IRZA 3HHGA 5DEQA 3CMYA 3CQZJ 2JJ7A 4HRIA 3AKZA 3DBLB 2XGXA 1WVRA 3LSTA 5FKMA 1B6AA 2XSJC 3GMEA 4PK4A 3C2HA 3W6VA 2HKXA 5K5RA 4UUVA 1SFEA 2M8EA 5D8KB 3W2VA 5DM7F 1K4SA 3KP5A 5FFZA 5FB2A 1H89C 3H3UA 1IC8A 1TQMA 3T1BA 2NVUB 2WV1A 1OCZH 4RAGA 1Z6RA 3WHCA 3S15J 4BQAA 2P7CB 3REOA 1XS9A 3W6JB 1IJWC 4FASD 3CLQA 2QZ8A 3GFLA 3QPTA 4LG0A 3JW4A 4P9UA 2XSDC 5DUKA 2CW8A 5J8FA 2EQRA 5M5YJ 1PP7U 2GM4A 3IH4A 3JCUC 3CCEI 2HOAA 1B9NA 5EG0B 4G6TB 4YIRX 2VLAA 2PLYA 2CS3A 3OYFA 4FQGA 1D0XA 4BDZA 3CJQB 3F8NA 2R93J 2IS1A 1RESA 3MZHA 4XN3A 4IPAA 3KCCA 2ZB9A 3D5LA 5KAIC 2OJED 5F64A 1ETXA 2Y69H 4LITA 4X0GA 3CCUI 4XR6A 1A31A 2IGNA 4L18B 4YG2F 5J1UA 3OY9A 1IGNA 2MG4A 1WRJA 2KRHA 1KZHA 3RKQA 4IHVA 1V5EA 1DU6A 2Z9OA 4YELA 3ECOA 5F0HA 2IA0A 2GAUA 3S3OA 1TNTA 1PJRA 2QQAA 3GTLJ 3ZQCA 2P5KA 4ON0A 3PNVA 2QVOA 1D3YA 3JTHA 1D8KA 4FCYA 2DJNA 2OAZA 2XC7A 4XLPF 1USSA 1FSHA 1EJ9A 2ZNZA 4YIIA 1TNSA 3R6SA 3K1NA 2ZXWH 2GA2A 4HYEA 4NBQA 4OMZA 3JRIA 2E36A 2R0QC 2VPRA 1LDDA 1KQ8A 1D1CA 4EMSA 2XAQA 2NRAC 3KE2A 2LY9A 3SQNA 9ANTA 3ERED 4BY7J 1BW5A 5LBQA 3A1YA 3R0AA 2Y30A 1FZPB 1H9TA 4AUXA 3O8GA 5F0FA 1BOAA 2HNHA 2Y48A 3DQVC 4UY8I 2RV8A 3P9KA 2EINH 1P2FA 1ZKGA 3KEQA 2DCEA 2EIMH 2EZHA 1WJEA 2MC3A 1VFCA 4CICA 1DU0A 2IGKA 1QZYA 3IAS2 4XRSG 3KPHA 4IXAA 4G9YA 4BE0A 5H2FC 3G4SI 3H1CA 1YYVA 4ZYDA 5CYVA 1WJFA 1D5YA 2F5EA 4CYDA 1UAAA 1VTNC 2X4HA 1NTCA 4XICA 4PDKA 3HEFA 4Z2YA 1ZR4A 1QNTA 4UXNA 3F22A 4GGGA 1FOXA 5BS6A 1AOYA 3I5UA 3SDGA 3AL0B 1TC3C 4DZPA 5LGTA 3OSFA 4I09A 3HDDA 4C3HJ 4KICA 2O61A 1ERDA 1MJ9A 1ZQ3P 1K61A 3GYHX 2CQ7A 1KQ0A 2IA2A 2L0KA 3V7RA 3HKZN 3I64A 2R7DA 5LEKA 5K5OA 4BBSJ 1MNEA 3QQAA 1CF7A 4FE7A 4UV8A 2W84A 3HG9A 1WSUA 1HQCA 2F4IA 3W2AA 5C4JJ 4UV9A 2K9MA 1OCRH 3ZXSA 5CLSA 4ASNA 3QOPA 2BW3A 4ZJZA 3OYBA 4A3DJ 4PZJA 2FNAA 2JSPA 2LDUA 3F0CA 4B48A 4J01A 2NVYJ 2W4SA 2V9KA 3IHUA 4V19K 4M9XA 3RDIA 1VQ5I 2CGPA 1L3LA 2A05A 4A0XA 3OS0A 4O6JA 2GOXB 1HDPA 2VC1A 4CCKA 3C3WA 4BH9A 1ZLJA 1JKPC 1ETKA 2CH0A 2DA7A 2VQHA 1IRFA 4M73A 1K78B 2X1DA 5LFAA 1U9OA 1OCPA 4OMYA 2ELHA 4N4OB 4UVAA 1AKHB 1LVKA 2XUBA 4RM3A 4ETSA 2MBFA 3IWZA 2KPMA 3RYRA 3GTQJ 3BJOA 1O3TA 2QSFX 1F43A 3BLYA 4P5OA 1FBSA 2OCEA 3K69A 3IKTA 2HQNA 3KZIC 2F5VA 1PP8F 2G7UA 3FIWA 3DPUA 3MN2A 5DM6F 4FHTA 2HKOA 3CF2A 3GLLA 2E60A 2DA5A 2K5CA 1D8JA 2W7NA 2BEOA 5L3GA 2YSRA 5K7HA 3F6VA 4XLCA 2HTJA 1MMNA 1FTZA 4JK1X 1KGSA 3SDBA 3FF5A 1JT6A 4NDLA 2COBA 3BROA 3RQ4A 4ZH4F 2EZKA 1BA5A 5B5EC 2FX0A 3FM5A 1VQ7I 2EJRA 4J19A 1S5LC 1VQNI 2H8WA 1S8NA 1UHSA 3TP3A 5E8GA 1TWAJ 1VZ0A 2DT7B 2LFBA 1TWCJ 1G3YA 2H1LA 3HKZA 4JX5A 3KP6A 3S32A 1O3SA 2ACJA 1VQ8I 3BG3A 3H3ZA 3Q5FA 3K4LA 5LLQA 1IN6A 5CVRA 3TW7A 4U0WA 4A5NA 3M8FA 5D4SA 4X1EA 3IC7A 2XKOA 3L2UA 4B3XA 2EZLA 2LNBA 4UUSB 4UVBA 2BV6A 4LJZF 3K1PA 4P9FA 2XAJA 3CD6I 3MKZA 3HGGA 5J3LA 2LOOA 3DTEA 3GZ5A 1QVTA 3QPSA 5H20A 3G6EI 1E3OC 1DDNA 1MSFC 4AU7A 3H9QA 1IXCA 1LB2A 2G9WA 3BTIA 5EEGA 2QQ8A 2O0YA 4DBQA 3FXLA 4F7ZA 1Z1DA 1VQMI 3TBIA 3ZMVA 5FROA 2QF7A 2DT5A 3VPRA 3CCYA 1X58A 1P4AA 2OF7A 3G71I 1KA8A 2W57A 1J5YA 3H0DA 1B8IA 1Z05A 3LSGA 5ICGA 3FXOA 2X51A 5E8IA 2CUEA 3V7SA 1XX5A 3NQOA 3ZGKA 1HOMA 2XB0X 5D6EA 1Z3YA 2GWRA 2IRFG 2NVTJ 3FMQA 1FP1D 3W3CA 2KL4A 3WTYC 1ZYRF 2DDAA 1OMIA 2HYGD 1XSVA 1Y39A 5EF6A 3QODA 1WH7A 3ONQA 3FZVA 1XB4A 2AO9A 3NWTA 3HHHA 3WG9A 5FKLA 4KIGA 1MZBA 3DEEA 4F3QA 3GFJA 3OYJA 1JT0A 4UNOA 1XGSA 3S1NJ 3OYKA 1SD7A 1YIOA 2B63J 1VNDA 2VXDA 4ANJA 2EH3A 4RS8A 3IRQA 3W6KB 1V4RA 3WU1B 1BBYA 3M4OJ 1RPWA 1GT0C 1BL0A 3M8EA 2K85A 4MNUA 5KHDA 1YI2I 2PG4A 4P1WA 1Y56A 2ZMEA 1MMGA 2FBKA 4RB3C 1EF4A 4RLQA 2MC4A 3M9AA 1MIJA 1OYWA 3KP3A 2M9HA 5KVRA 2DTRA 2RGVA 4G7HF 2EBIA 3SHFA 4BJ5C 4HZFA 2P4WA 3A01A 3KLOA 3BTLA 4DZJA 4I7HA 2A5WA 5GAEJ 4RGSA 1BOBA 2WY7Q 2E2JJ 1OCOH 1P4XA 2CU7A 5KAFC 1VQ6I 1WI9A 4OOIA 1LFPA 1FT9A 3TKYA 1SFXA 2K27A 3RKWA 3H5RA 4XSZF 1V3FA 4HNVA 2PFBA 4BY1J 1DQUA 1UG0A 1SANA 2HU9A 2M30A 4HNUA 4EGYA 2HXIA 3Q9VA 4RLFA 4U7DA 3M3YJ 4CYCA 3FK7A 4I98B 3CLOA 1B72B 2R7SA 1PDNC 2XAUA 1LDJA 5BPIA 4ZTJA 4BEHA 3UKGA 1HW1A 1JGGA 1TTYA 1VQ4I 3CUQA 4ZDPA 4EJUA 4MIMA 1K6YA 2H6BA 2AQFA 1Z21A 3GW2A 3ZMUA 1YFHA 3DTIA 2ELJA 3BJAA 4E7JA 4NHJA 3Q0WA 4ZC3A 1FX7A 3K7AJ 1PUEE 1HCRA 4HPQA 4HDVA 1E17A 1BR2A 1PUFA 4XQFA 5IOYA 2H1KA 4AVPA 3V42A 3HC7A 3TO9A 4LFUA 3HRUA 1BI3A 3DF8A 2K02A 1KU9A 4P55A 3QWLA 3D0SA 4L9JA 2WB1N 1GVJA 3HSRA 3OL4A 1IF1A 1ETWA 1T0FA 2LY1A 2JVGA 3K0LA 4CDGA 4YFNF 3I59B 2V6EA 4FX0A 4CSWA 3PO2J 2R7FA 1HW2A 2WTEA 2CW7A 3RCOA 2DFEA 1D1BA 2M3AA 2M4GA 3L2VA 3HOTA 4JP0A 1KYZA 1WH5A 2IXSA 4YFXF 1MNMC 4M3GA 1FBQA 5CKTA 2BE5F 1B4AA 2RREA 2VASA 1S7OA 2VI6A 3OMYA 4M71A 4XLFA 4Y13A 1R71A 1FPQA 2E19A 3SFIA 3J7AY 3N05A 2DN0A 3GCMA 4LOCA 1OFCX 3A02A 1GLNA 2FQ3A 1J75A 3CO6C 2A5YB 2LRDA 1W0TA 1HKSA 1WJDA 1TW3A 2ISYA 2KJBA 4EM1A 1Z91A 1QPMA 4XN0A 3FWEA 4JYKA 1W7PA 4WCGA 2OZUA 2VXZA 4DIQA 2OPTA 1OKRA 4LG0B 3H35A 5FD5A 3ELKA 4M74A 2HVSA 3OR1C 2X1EA 3I3LA 3QRFF 2C6YA 2JUCA 2MYSA 1P4WA 1YX5A 2LKXA 1R5GA 4A69C 2R7RA 1JTYA 5DD8A 2PX9A 2K4JA 2CFOA 2L7MP 2R4GA 3BR2A 1GVDA 2ZJPF 2WV0A 3SXYA 1E2XA 5C3EJ 1T39A 2CRGA 4I76A 4W97A 1U8RA 2MSYA 5D5XB 1O3QA 2B9SA 2K4BA 3MD2A 3GWZA 2IJLA 2P8TA 4LIVA 4A6EA 2L9SA 4BAYA 4PJNA 3DEUA 4AIKA 4BXXJ 3UNGC 2X48A 2FD5A 4KJZA 3PUFA 2OU2A 1XDSA 3MAJA 4OWRB 1D5VA 3VFZA 3PUBA 1YJ9I 1JUSA 5LEJA 2DA2A 4EVIA 1MH3A 5DCMA 2DA1A 3QYBA 5IY5H 3J80K 4HV6A 3K1MA 2WB1A 2HDCA 3FKIJ 2KQRA 1RR7A 1Z7LA 4IO9F 2X9DA 3ZMDA 3OYLA 3S1RJ 4JX4A 1EH7A 4NC6A 2Q8KA 2STWA 4HNTA 2Q1ZB 3MKWB 4IF4A 2V26A 4A3MJ 3JTGA 1SAXA 2HVQA 4BQQA 3BTCA 4BYYA 5CQEA 3HYIA 3J81K 5CVUA 3RTRA 4IOCF 1T6SA 1V54H 5DV5A 5BPDA 3A4CA 2KISA 4IKFA 4HG2A 3GZNB 2QBYA 2DO7A 3OR2C 4II3A 4A3BJ 3WE2A 5FLMJ 3Q3SA 2QCOA 1WKMA 2F5FA 2W1OA 1N78A 3DLLF 5DS9A 2NS8A 4FX4A 2HDWA 3RZDJ 1TWFJ 1T56A 5LRSA 5IP6A 1LUJB 2VOPA 4IHTA 4QPQA 2ETHA 5HS9A 2L3DA 2E5NA 1R5HA 4B43A 3CJTB 3ROUA 3BT9A 2R7XA 2HGCA 4AD9A 3ABTA 3HOSA 4G7ZF 2RQQA 1HKQA 4OIPF 3AG3H 1GHCA 4F92B 2BY2A 2RC4A 4XOPA 2HI3A 1CF7B 2PMZN 1K79A 2KT0A 2AS5F 1LFUP 2BVMA 2NAZA 5KNLA 2VJIA 3MEXA 3DPLC 3KP7A 3V4GA 2ZNYA 4LLGF 1I50J 3TO7A 3O2PE 2VQCA 4PSWA 4MFEA 2P6TA 4BJ6C 5DUIA 1R9TJ 1YX3A 1R49A 5D6FA 3S17J 4L5EA 2BW3B 3BR1A 2LVSA 2DW4A 2IPQX 2BY3A 2HEOA 2XGDA 2M87A 3H92A 3J80Z 3K70C 3HRMA 3C7JA 1S3JA 2JMWA 4KMUX 2YR2A 3QYEA 2Y31A 1ODDA 2NS0A 5FLXK 5HDKA 3BC8A 2VODA 3E3VA 4PUSA 2K3PA 2DI3A 2W00A 4U87A 2V7FA 3RPUD 4XLEA 1P7IA 3E5UA 3K4CA 4Y3OA 4LD5A 2OQRA 2Q0OA 1E0EA 3DBHB 2OQGA 3G1LA 3DEWA 4Q48A 3CCJI 1SMYF 3MVPA 4E7KA 3I55I 3OS2A 5A2QZ 4KDPA 2HQAA 1R4MB 3ZMZA 3FISA 3MZ8A 1J09A 1BC7C 3DWLE 4M72A 3E6BA 2DMUA 2M7AA 3FDYA 1IRXA 1W0UA 1UJ8A 1ZR2A 2DA6A 1LEBA 5LGNA 3GFMA 3HTUA 4RAFA 2M34A 2MFZA 3I4PA 2PI0A 4PJLA 3CUOA 1F36A 2V9PA 4F52A 3L2CA 1V55H 2DU9A 2R7UA 2EFPA 3E7LA 2WADA 3JR9A 1KONA 3DV8A 1HLVA 4HX7A 1XCVA 4ESBA 3DPTA 4NC8A 4KITB 3D5RC 2LBFA 3CDHA 3K6GA 3IRRA 2N8GA 1P92A 2RAEA 1X4PA 1RIOH 1TT0A 4GRIA 1X1CA 1SVOA 1ETVA 4C30A 2K40A 2E2IJ 2DAOA 1LFBA 3IV5A 2FXAA 1VI0A 2KKOA 1YW9A 3IAM2 2LF7A 2DA3A 2H94A 4KA4A 3FM3A 4DW6A 1MBGA 2IS6A 2R3SA 2P0WA 5IYDJ 5EZHA 1IN5A 3IH3A 3QAHA 3BPXA 5HS7A 4B3AA 1I39A 1MMAA 2ZSIB 1ZG1A 2BGCA 1OCTC 2PMZA 4KIBA 1R36A 3IL2A 4BHBA 3C2BA 4JBAA 4R8HA 4A2UA 1G59A 5ILSA 1ZARA 1BM9A 1XSXA 2XRNA 5FLXZ 3LA3A 2ME6A 3EUHC 3CCSI 2L9VA 4HAMA 4JQFA 1X3UA 3G1MA 1ZLKA 4C2UA 2QUFA 2RNGA 3WU0A 2A3SA 3O3KA 4B47A 3ZCOA 2PQ8A 3CESA 2M4KA 2CUFA 4XSXF 3SZPA 1FTTA 1U3EM 3O8HA 3ZP5A 1HA8A 2DMNA 3SEZA 1SFUA 4MQ9F 3JAMK 4II2A 3HOYJ 4CO8A 3JSPA 3CCLI 2L7ZA 1XGNA 3JRDA 1WHUA 2A69F 1U6GA 1B8IB 4CUGA 1X3WB 3I56I 1JKRC 3ML6A 2IA1A 5GP9A 1SAUA 2UUZA 3GUDA 4BACA 1BI2A 3LA2A 3V7CA 3HOUJ 4D0PA 4XMYA 2JPCA 2W25A 3S3MA 1IN7A 2CUJA 3PIOF 4MO7A 5LHGA 1TL8A 1XN7A 3ASOH 3PO3J 3TQNA 4KIFA 3TGNA 2Y0SN 4S0HB 3S93A 4CCLA 2D1HA 5M3MJ 1MGTA 3F8CA 3S3NA 3VSLA 4O3MA 3BCAA 4E4HA 4M3EA 4CH7A 1QGPA 5JLWA 2VKHA 2W48A 3Q9SA 3KYDB 2BHYA 4A3IJ 1IAWA 3EQLF 4IHWA 5FO5A 4XRFA 1LE8A 3GTPJ 3E97A 4PCQA 4OAYA 3CP8A 4GCVA 2R7QA 3RI4A 3TL4X 1RZ4A 3FHNA 3WGIA 1A35A 1FJLA 5J6XA 4F91B 3WODF 2XF5A 3OOUA 4G6DA 4IEJA 5AONA 2ZFUA 1YS7A 2UXNA 2ZMEB 3L7WA 4E7SA 5ERIA 4AM3A 3MKYB 1Z0XA 5BOXA 1GXPA 1OCCH 2FMYA 1REPC 1YLFA 3ZQFA 3TP0A 2DDBA 4BL0B 1I27A 3L1PA 2E1MB 4FTHA 3A01B 2M0MA 2HVRA 1X1DA 4HLYA 2YU9J 2VT3A 1JE8A 3FX3A 3RIRA 1X4OA 3FXKA 4HW0A 1X1AA 2XGEA 1WGXA 4D9JA 1R1TA 2VOOA 4ZDLA 1W5SA 1H0MA 3KIOA 3JAMZ 1XCBA 3OYDA 1Y1VJ 1XD7A 3BPVA 1FMVA 3I53A 2XASA 2LYCA 1KU2A 1UG2A 5E1ZB 2HOTA 4OIOF 2R7WA 1DGWY 5M5XJ 2CMPA 2CQXA 1YITI 4AC0A 1MW7A 5KK1A 5IOZA 3K4BA 5D8LB 2VBZA 3WTVC 3BWGA 2KDZA 2V1XA 4BEHB 1A04A 3WG7H 4EV0A 3DBRB 3CUQB 4HX4A 5J4YA 2MH2A 1ZHFA 3HTSB 1K83J 2NNNA 4GYIA 5M5WJ 4LB5A 3C2GA 1YO5C 2VBXA 3NARA 2Z16A 2ME0A 1X2MA 2CJJA 1QZEA 4IVNA 1O3RA 5GAHJ 1OR7A 2F6CA 4NB5A 3DP7A 1ETOA 4A5MA 3CCRI 4M3DA 1QPIA 2LH9A 2XDVA 2DFHA 1PUFB 2E7XA 2AHQA 4C2MJ 1I6HJ 2Y0SA 2EFNA 1LKXA 4YEJA 2IGMA 1OYYA 2ID3A 4G7OF 4UUTA 1H88C 1LDKB 3BG7A 3IP4B 2OV7A 2ZSHB 4F93B 1STZA 3CDLA 4XBFA 3PQKA 4Y4RA 2NXNB 1FNNA 2GBYA 2OTLI 5GADJ 2CW0F 2V1DA 3LSKA 2Y75A 1R4NB 2G7HA 4N9HA 4ZYHA 2L54A 2RVCA 1MMSA 2VJ5A 2XRLA 2VC0A 1MJBA 2FA5A 4BUPA 2IGOA 4A3EJ 4CCJA 2FMLA 2RDPA 4CCMA 5J47A 3NEUA 3H36A 1ENHA 4XNFA 4ABZA 4BE2A 3KP2A 4MQVA 3JSOA 2WY8Q 2EA4A 3OL3A 1I1GA 1QRYA 3BZKA 2BZTA 2UZKA 1JJ8C 4QPOA 5HLTA 2UV1A 2P6SA 4ZZDA 2QENA 2W85A 1G4DA 1JTXA 3KFWX 4GXOA 4EJWA 4ZYEA 4IHYA 2MA3A 2NYXA 4EM2A 2NOJB 1W7PB 1QQIA 4IL6C 1IUFA 3TDUC 4IRIA 2BY1A 3ZQ7A 3F8MA 2HS5A 3DXJF 5CVJA 4OU0A 2DOAA 2DQRA 4JOMA 4DYQA 5HLGA 1MD0A 2HFHA 2KDOA 2O6GE 2JVHA 4B44A 4Y7NJ 3PIPF 2STTA 5LGUA 2I10A 1R22A 4RBOA 2Y9ZA 2MGQA 4HF2A 3BR0A 3KP4A 2HOSA 2HYJA 1FP2A 3R60A 4MGRA 2WAFA 3HM5A 4KN7X 4YRVA 5DTDA 3S2WA 3SFZA 1ZRFA 4AYBN 4PJMA 4LK1F 1JKOC 1T98A 4AIDA 1FLIA 3F6OA 1ON1A 2WWYA 4MLOA 2HPMA 3V8JA 1R6RA 1XGOA 4FE4A 1Z77A 5JVTA 1HW5A 1NG7A 2DT6A 4H4KC 2XPWA 4M9SA 2L01A 1JUMA 4HSTA 3ZQHA 3D1NI 3GX4X 4K2EA 4QSHA 2MD5A 2RNJA 5DCMB 2KZGA 1GUUA 2DTZA 4BKXA 3S16J 3JRFA 1G3TA 4RAZA 1KU7A 3BOQA 1B9MA 4D7NA 4M6XA 1T33A 3IKVA 3EETA 4WK8F 1QHHD 1SMTA 4FT8A 4HSRA 4BNCA 1KYWA 3GTOJ 1N25A 2DOEA 3KEYA 5FRNA 2IT0A 2FF4A 1WJCA 3LA7A 1QA6A 5K5QA 4QLCU 4RAYA 2OTJI 4NNJA 2KIFA 3ZQIA 5HS8A 3ZRGA 4V2GA 4BJTA 4I02A 3VSKA 3K2ZA 5ICCA 4XKVA 3VOEA 2QM3A 3AFHA 4YIFA 2MD0A 5L3EA 3DU5A 4FISA 3TOAA 3F8FA 3DFGA 3E0JB 1G8XA 4LG3A 1K6OA 5EZGA 2QBYB 2LY2A 4CCOA 3WTZA 1T38A 4XLNF 5IPAA 4BXFA 1ZGAA 2IEKA 2DMQA 4Y15A 2HTSA 2FOKA 4KN4X 2EA2A 3AG4H 4I01A 3HOWJ 3ABLH 4A93J 2JA2A 1IN4A 3ZQQA 3TO6A 3UR3C 1JHFA 2VQLA 3BQYA 1YE9A 1TP4A 3S1MJ 3GZ6A 1O7FA 2W24A 3FXRA 2WAEA 1WI3A 5F27A 3JRHA 2OBPA 2A68F 2L5QA 4KT5C 5ILUA 4WWCA 1X3ZB 3JRCA 4HA8A 5E17F 1SEUA 1FIPA 2CWEA 3QPHA 2JA8J 3I4NJ 1ITYA 1B1BA 4KISA 4IJAA 3GXOA 1U2WA 1QO0D 3GTJJ 1YQAA 2DYRH 4ENJA 4UHTA 2WAQN 5CVVA 3ABUA 4AYBA 3LSHA 4LMYA 3SEQA 3ZMSA 2PBIA 3LSJA 3MWMA 2QQ9A 3F3XA 1QZZA 3C18A 3WU2C 3LFUA 2ISZA 2ZMEC 4DOZA 3HPHA 3LAJA 2CV1A 1DP3A 2K3FA 3G2BA 3HRSA 2J5OA 2BXYA 4FETA 4G12A 2P81A 1LVAA 5FFXA 2F4MB 3KYCB 1LQ1A 4DJAA 1YW7A 1ZTRA 3HPGA 4UB8C 2E1MC 4A3FJ 3K70D 2GQQA 5GPAA 2ESHA 2DLLA 5HLIA 2AXLA 1W36C 3V8KA 4R1HA 3ABKH 3OV8A 2MH9A 4EJOA 4U7BA 1FOYA 3LOCA 3PNYA 2EV6A 4O5VA 2HXOA 1I3QJ 1K7AA 1W5CC 5LHHA 2QEXI 3TMOA 2HZDA 1ZREA 3A2KA 3H0GJ 2JT1A 1ETQA 1ETYA 2QKMB 2YX4A 2Z2SB 3DKXA 5BMZA 2IVMA 1U5TA 1T8IA 2AXTC 3U9GA 1FEXA 1QU3A 2ID6A 3I54A 1JI8A 5ICFA 3I58A 2CFXA 3FXQA 1BIAA 4XONA 1VQLI 2RKHA 3CUQC 5C4XJ 4PSXA 3PFIA 2LBFB 3RSNA 2F2EA 3VYUB 5IT9K 1O4XA 4XOTA 3TEDA 3E6CC 1ZGWA 1FMWA 4YFKF 4CCNA 2FBHA 4EEFG 5IP7J 2F5CA 2QSHX 4EM0B 2VB6A 1IV6A 3KZYA 4RA2A 5JHUA 2KIQA 2GOMA 1UHMA 3NAUA 2A07F 3JRGA 3LL7A 1ONVA 1BW6A 3K4MA 2OCCH 1EH8A 2IBDA 2JQ7A 1TWGJ 3L00A 4WX9A 2L02A 2ZJQF 1T0FC 3SZTA 3B02A 5TJJA 5FKKA 1CQTA 4B8XA 3HRTA 3CC7I 2DQLA 3EDPA 5LHIA 5H6RA 2DMTA 3OWTA 3OYHA 2DFFA 2VQGA 3LFKA 2WAQA 1H8AC 3RPQA 2TRTA 2EILH 5HVQC 1T2KA 3H3VK 3HOZJ 2GIZA 2D45A 4TV7A 1R7JA 1JJ6C 3JRAA 1J59A 4E70A 1IXSB 5JI6A 2E7WA 5J40A 5DDGA 2HQRA 5E3OA 4EJVA 4XRMA 4P96A 3OIQA 1WJAA 4BXUA 1NHAA 1WZ2A 1TBXA 3E1SA 1BJZA 2H6CA 5F1RA 1MKMA 1JXSA 1IW7F 3DKYA 3RYPA 1UMQA 4OAZA 1QVUA 5E3LA 4AWXB 4XK4A 1OISA 1ZELA 3G3ZA 3FMRA 1QBJA 3T8RA 3H9JA 3K10A 4IOAF 2L4MA 3AG1H 3T0YA 2DBBA 3E5XA 2EZIA 3N4MA 3BZ6A 2UWMA 2VL8A 4RB2C 3EYIA 1R23A 3S1QJ 1Q1VA 2R7ZJ 1U9NA 4CZCA 3KYLA 1HXDA 4L9VA 2P5LC 3U1KA 2FSWA 3M1CA 2EFOA 1FWZA 3OYEA 4OIQF 1Z3XA 3I71A 4RMNA 2E1CA 1D0YA 1LE8B 2D2WA 2M7BA 3WTXC 2ICWG 2QSGX 2E1NA 4BHPA 4NQWA 5DYMA 1TT5B 4NC7A 2FQ4A 4ENMA 1ZG5A 2PMUA 2X85A 3M8JA 1MDMA 2XPVA 3I9V2 1EH6A 3GTMJ 3NRVA 5L3DA 2IS2A 5HDNA 3ZMTA 4HDUA 2NNYA 2ZXHA 2A61A 2Z1DA 2EK5A 2ZO4A 2OD5A 2PJPA 5F08A 4ZYAA 1VQKI 2HR3A 1VQOI 3LWFA 3QOEA 5D5WB 1P9QC 1X2NA 3HOVJ 1S29A 3GBGA 3P9IA 2Z33A 3ZPLA 3EUAA 3BG9A 2VJJA 4QTRA 1BIBA 1F1ZA 6PAXA 3HIFA 1VF9A 3J81Z 4S04A 1R1UA 1TZLA 3H9GA 2EV0A 2O7OA 2ADUA 5M3FJ 1J9IA 4U0YA 4XL9A 4AIJA 1R5ID 2HZTA 2VKEA 3QU3A 5TGTA 4EJTA 4DQ2A 1P6RA 1FYKA 2X6WA 3J7AO 3CP2A 2XB5A 1T95A 2BYVE 1WWXA 1ZRDA 4HOBA 3LAPA 4UB6C 4I99C 4DYCA 2WA0A 2KLOA 5H6QA 1R58A 2V6CA 2E35A 3BTJA 2FU4A 5J4VA 2LP0A 5AIPA 2CQQA 5BNGA 3GO5A 1RR8C 2CQKA 2ELKA 4H0EA 2VKVA 2NOGA 1DP7P 3TW6A 3O6BB 3EYYA 5FKOA 4GDFA 1WPKA 3OYCA 2XVCA 2V79A 3WTWC 3BR3A 1I1SA 3KETA 3ERMA 4CGZA 1K4TA 2B7EA 2GXBA 2HYFA 3V8LA 5GPCA 2RQPA 2L9NA 4HF1A 2D1VA 3BG5A 3GTKJ 3VODA 1FSEA 2F4OB 1T08B 1XMXA 5F0CA 3RPUA 1S6LA 1PYVA 2DMPA 4J00A 4A0YA 2Q2EA 2LTPA 4HV5A 1IV8A 4ESJA 2CUZA 5CPRB 3WTTC 1TLHB 2X6XA 1XMKA 4BS9A 1J7KA 2JUGA 3HZJA 5L3BA 5E3MA 3HSEA 1O57A 4BU2A 4KMFA 2DK8A 1Y8QB 2FRHA 2TDXA 4WXCA 2DK5A 1X1PA 3A0HC 4E6KG 2LD5A 1DUXC 1HDDC 2O8XA 2XKPA 5HDGA 5EEAA 1FOWA 1P7JA 3E6MA 1Y6IA 2DPDA 1YRNA 3QYFA 1V5FA 2XGCA 2DOFA 2ZC2A 2WBMA 2F48A 2DODA 1H9GA 1SD4A 4I0BA 4BGDA 2HDDA 1SD6A 2JZYA 3MFKA 2O9LA 3P5JA 5EEHA 3FXMA 4AVZA 4BE1A 3MKLA 2KHMA 2BBYA 2ZJRF 4BHCA 3BCBA 1S72I 5FLVA 5JLXA 3G73A 1RNLA 4LIUA 4WXDA 3R61A 5BQTA 4I0AA 3L09A 3WE3A 3CDIA 3LSMA 1BJAA 2R5ZA 1ORKA 2GXAA 2LMDA 1AHDP 3ASNH 2J5PA 5EDNA 2KRCA 5LD2C 1XPXA 4N0BA 3K4NA 2KIMA 2E5ZA 3B6AA 3ZOBA 4L9TA 4Q4ZF 2K9SA 2P5VA 5JHFA 3FBIB 3HUGA 4B4CA 4HEA2 3MZYA 5J1YA 2CV0A 3ZR8X 4ZYGA 2ZBKA 5EGOA 2X6YA 1J0RA 2VBWA 1SFKA 4PFPA 1G3WA 3RQIA 3RZOJ 2VN2A 4Z6YA 2LREA 1SVMA 3NWSA 5CVIA 1ZH5A 2JA5J 4NUBA 2XPUA 2CV2A 3FKJA 1M1EB 1DPRA 3IUOA 4CZZA 2XROA 3S8PA 1TQPA 3E6DA 1E3HA 4MTEA 3ZQGA 4AIHA 3JREA 1A6QA 3P7NA 4ZZLA 3PQJA 5EJCA 4MEYF 4ENKA 3OYIA 4C9YA 2PJRA 2Y0MA 2VKDA 4XRSA 3FBNB 3M1EA 1F9NA 2VBYA 3R0JA 1KQ9A 3A0BC 3OIPA 2QWWA 3AG2H 1HKTA 4XLHA 2R5YA 2QLZA 3ISPA 1AU7A 4MFDA 4PJJA 5EYRA 5FKNA 1YIJI 5IYCJ 3K2AA 1WFXA 2AQEA 1R1VA 2JSCA 3OOPA 2H27A 2BHZA 4GO1A 2CG4A 3BG6A 2OA4A 1Y8RB 2X0LA 2FOWA 1BR1A 3BJ6A 4DNCA 2JRTA 2LLKA 1YW8A 3KLNA 4M6YA 1YJWI 3WGGA 4CYCB 3CMEI 1UFMA 3Q0UA 5IP9J 1YOVB 2ECBA 3W2WA 1OYIA 3ABMH 3FXUA 3IWFA 4QWQA 4BDYA 1FYLA 2OZ6A 5ILVA 4L0YB 1JUPA 1A5JA 2EPFA 1WCMJ 3GTGJ 3PSFA 3BR5A 2VE9A 3R4KA 1A36A 2MABA 1UHWA 2Y9YA 3CO7C 1Y0NA 4DBRA 2H8RA 2E71A 5KCMA 1MSEC 5EG0A 2IAIA 3F23A 2B0LA 1ZK8A 3VYSB 5L3CA 4C2TA 5FRMA 4Q5SF 4A3JJ 2CSOA 3K9TA 5IT3A 1RKWA 1MH4A 2L2OA 3FXJA 2EV5A 4RGXA 2A6HF 5F04A 4C3IJ 4RGRA 1NK2P 2LSOA 2DFIA 1XG1A 2JRMA 1ACIA 3QP5A 1D1AA 2XAHA 5E1WA 5IYBJ 4M3BA 2VPLA 4E7HA 1FOKA 2M8GX 1HSTA 2O5RA 1MNDA 2XAGA 1LJ9A 4D5FA 3SJMA 1VQ9I 5B1AH 4ITVA 4B1RA 1IRGA 1F5TA 2P7VB 3KEOA 1N75A 1XSDA 5ICEA 3J7ZI 1FY7A 1IN8A 4HX8A 4RB1A 4QIWN 2MW8A 4IHXA 1RKTA 4XM3A 1HSJA 3AAFA 1YHQI 1SFOJ 3B73A 1DPUA 3M07A 3I0TA 4KT6A 4L5IA 1C0WA 3DKWA 3U1DA 2X1CA 1WQ2A 2ESNA 3FK6A 3HGYA 3PJRA 4DYRA 1TQIA 1BI0A 2FJ1A 2XHKA 4A6DA 2K9LA 5E20A 1Q1HA 5JVGF 2XIGA 5J1RA 4XORA 2XAFA 3S14J 3RJPA 1RUNA 3VDXA 3CCMI 1I3AA 4IRHA 2V1UA 3PL8A 3CCQI 5CQGA 1MBEA 1U0JA 3HSFA 3WGHA 2LK2A 1GDTA 2KJCA 1GV5A 2QGUA 2I8DA 5GTIC 2M1BA 5J8CA 3MMYB 1U5TB 2H09A 2O3FA 1W36D 3VWBA 3OYMA 1U78A 3MCZA 1USTA 4M9ZA 3QPLA 1ZGJA 4LGWA 2L9RA 3PM1A 4BBRJ 3CF5F 1FC3A 2FUG2 4CXFA 2Z5UA 5HOOA 3GF2A 3GLXA 3IH2A 3LQQA 2NS7A 1UZCA 5HLHA 5DCFA 1Z9CA 4A12A 2KP6A 1OR7C 2L7FP 4IZZA 4EATA 2DPUA 4X6AJ 3SYTA 2FE3A 3RKYA 3ULQB 2QQBA 3PNTA 1LPQA 3QP6A 2O03A 1NK3P 2VONA 2E2HJ 4M6VA 4A3CJ 2OC6A 3LSPA 1ZN2A 3DU6A 2QA4I 1S9HA 4Q47A 3S2DJ 3U2RA 1BN5A 5B1BH 1RETA 1N77A 2LF8A 4RDUA 2EIJH 1EA3A 1OLTA 3S2HJ 4D5CA 4ZTFA 4M3FA 2GLOA 2ZXJA 5E79C 1W1WE 3OYAA 1HC8A 3FMSA 2LKPA 3PFYA 1JKQC 1APLC 4MHGA 3OSGA 2ZCWA 2EWNA 3K4KA 1BC8C 2IS4A 2K9NA 3BR6A 3BY6A 1R00A 2HQ5A 4W1UA 4LLLA 3VEPA 4HQMA 5GTHC 2CYYA 1K78A 3DTKA 2G0EA 3MQ0A 2LR8A 4ESFA 4CA0A 4U88A 4N4NB 1AKHA 3LNQA 2YS9A 2YU3A 2KFDA 2RN7A 3DLAA 1Y0UA 1GXQA 3CC2I 1Z6TA 4JX6A 1S7AA 3OYNA 2LKSA 3GEZA 4L0ZB 1JHHA 2KMUA 3WTSC 2QKLB 1IDYA 5JR3A 2JA7J 2ZKZA 2DA4A 2GXGA 2EFWA 2Z99A 4RB0A 2FBIA 4Y52J 4RGUA 1G3SA 3T5XA 2X6OA 1NH3A 1FIAA
chains in the Genus database with same CATH topology
2ME6A 1BJZA 1UHSA 3TP3A 1TWAJ 1UMQA 3G1MA 2LFBA 4C3JJ 1TWCJ 1QVUA 5K7ZA 4JX5A 5E3LA 4XK4A 3BG3A 2E1OA 2CUFA 3TW7A 1HF0A 3I4MJ 1FTTA 3O8HA 2DMNA 3HOYJ 4X1EA 2EZIA 5FJ8J 3B6CA 3S1QJ 2L7ZA 2JA6J 1Q1VA 2EZLA 2R7ZJ 1U9NA 4UUSB 3JRDA 1B8IB 3A03A 1JKRC 3HGGA 5GP9A 5J3LA 3QPSA 1E3OC 1QVTA 1MSFC 2NVXJ 3LSRA 2NVQJ 1IG7A 3BTIA 3HOUJ 1S7EA 4MO7A 1G2HA 3PO3J 1LE8B 3HOXJ 2QF7A 2Y0SN 3VPRA 4S0HB 2ECCA 3CCYA 1X58A 2OF7A 3JRBA 4UUSA 5M3MJ 2FQ4A 1B8IA 2YUSA 3LSGA 3OIOA 2XPVA 3GTMJ 4M3EA 2CUEA 1HOMA 4D7MA 5JLWA 2W48A 2XB0X 2D5VA 4A3IJ 2K9QA 4IHWA 3GTPJ 1LE8A 2NVTJ 1TWHJ 2JWTA 5F08A 5EF6A 1WH7A 3WHBA 1X2NA 3HOVJ 3GBGA 1POGA 1FJLA 2AO9A 3BG9A 4QTRA 4I6ZA 2M0CA 1VF9A 5FKLA 3OOUA 4IEJA 2O7OA 5M3FJ 1JT0A 3S1NJ 1Z0XA 2VKEA 2R92J 2B63J 1VNDA 2EH3A 3ZQFA 3TP0A 2XB5A 3L1PA 3M4OJ 2O8KA 1RPWA 4FTHA 1A6IA 3A01B 1GT0C 1BL0A 4DYCA 2YU9J 1XC5A 3BTJA 1MBFA 2XGEA 1Y1WJ 1WGXA 4A3KJ 2LP0A 2CQQA 5BNGA 1EF4A 1U8BA 3G1OA 2ELKA 1Y1VJ 2VKVA 2NOGA 1UG2A 2M9HA 2HOTA 3TW6A 2JK3A 5M5XJ 5FKOA 2EBIA 2CQXA 1WPKA 3A01A 4AC0A 3BR3A 3BTLA 4DZJA 5IOZA 3HBLA 3HB9A 2KDZA 2E2JJ 2CU7A 3Q0VA 5GPCA 1MBKA 1K83J 4A3GJ 5M5WJ 4HNVA 3BG5A 4BY1J 3GTKJ 1SANA 3NARA 5C44J 2HXIA 2ME0A 1X2MA 2CJJA 5F0CA 3M3YJ 2DMPA 4CYCA 2LTPA 3FK7A 1ETOA 1MBHA 4M3DA 1B72B 1QPIA 1OJLA 1PUFB 5HODA 3UKGA 1YRNB 2AHQA 4C2MJ 1JGGA 1I6HJ 5E3MA 4XIDA 2ID3A 4MIMA 4UUTA 1H88C 4V2FA 5E3NA 3CDLA 3Q0WA 3K7AJ 1HCRA 2JN6A 2LD5A 1B72A 1HDDC 5EEAA 2GBYA 1P7JA 1PUFA 2Y2ZA 2R5ZB 1YRNA 5IOYA 2XGCA 2H1KA 2VUMJ 3DCFA 2TCTA 2HDDA 3ZQLA 2XRLA 2O9LA 2WB1N 1ETWA 3MKLA 5FLVA 4A3EJ 5JLXA 1IDZA 5EGOB 3PO2J 1ENHA 4ABZA 2M2EA 2R5ZA 1ORKA 1AHDP 4JP0A 5EDNA 1WH5A 5K7FA 1QRYA 3B6AA 3ZOBA 4M3GA 1MNMC 1JJ8C 2K9SA 3BQZA 4B4CA 1MBJA 1JTXA 2VI6A 4IHYA 5J1YA 4A3LJ 2E19A 5EGOA 3SFIA 1IUFA 3RQIA 3RZOJ 2DN0A 4LOCA 1OFCX 3A02A 4DYQA 1W0TA 2JA5J 2XPUA 4Y7NJ 4GFBA 2R5YB 2I10A 4RBOA 2Y9ZA 2MGQA 1GV2A 3BR0A 3ZQGA 2HOSA 2HYJA 3JREA 4JYKA 5F1JA 1IRZA 3HM5A 3CMYA 3CQZJ 2JJ7A 2OPTA 5DTDA 5FKMA 4AYBN 1JKOC 3W6VA 4XRSA 4A69C 4MLOA 4FE4A 2R5YA 1Z77A 1H89C 1IC8A 1AU7A 4MFDA 2LKXA 5EYRA 5FKNA 2WV1A 5IYCJ 2XPWA 3K2AA 1JTYA 3WHCA 1JUMA 3S15J 3ZQHA 2L7MP 3D1NI 1XS9A 1IJWC 3BR2A 1GVDA 4QSHA 5C3EJ 2CRGA 4I76A 2XSDC 4W97A 1GUUA 2DTZA 2EQRA 2MSYA 2LLKA 5M5YJ 4BKXA 2GM4A 3S16J 3IH4A 3JRFA 4CYCB 2HOAA 3Q0UA 5IP9J 5EG0B 2ECBA 4D7NA 1T33A 4BXXJ 2X48A 2FD5A 2R93J 3GTOJ 1RESA 1JUPA 1A5JA 1WCMJ 3GTGJ 2ZB9A 3BR5A 1JUSA 1ETXA 2DA2A 3ZQIA 4V2GA 1MH3A 2DA1A 2Y9YA 2H8RA 5J1UA 3FKIJ 1MSEC 1IGNA 2MG4A 5EG0A 2IAIA 1RR7A 3RKQA 1ZK8A 4FISA 4IHVA 2X9DA 4A3JJ 1DU6A 3S1RJ 1RKWA 1MH4A 4JX4A 5EZGA 5IPAA 5F0HA 5F04A 4C3IJ 4A3MJ 2IEKA 1NK2P 3GTLJ 2DMQA 3ZQCA 3BTCA 1XG1A 3HOWJ 4FCYA 2DJNA 4A93J 5IYBJ 4M3BA 2M8GX 4D5FA 3SJMA 2R0QC 3JRIA 4B1RA 3BQYA 2VPRA 3S1MJ 4A3BJ 5FLMJ 3Q3SA 1WI3A 2QCOA 2LY9A 5F27A 4QIWN 2MW8A 3JRHA 1RKTA 1SFOJ 4IHXA 9ANTA 4BY7J 5DS9A 2NS8A 1BW5A 3JRCA 3RZDJ 1TWFJ 1T56A 1FIPA 2Y30A 5IP6A 4AUXA 3O8GA 5F0FA 2JA8J 3I4NJ 1ITYA 1ZKGA 3FK6A 2EZHA 3HGYA 3GTJJ 1VFCA 2WAQN 3BT9A 1DU0A 4DYRA 4XRSG 2FJ1A 2HI3A 2PMZN 2KT0A 3LSJA 1D5YA 1LFUP 5J1RA 3S14J 1NTCA 4XICA 3HEFA 1ZR4A 4G12A 1I50J 4MFEA 3SDGA 1TC3C 4DZPA 2P81A 1R9TJ 3S17J 1MBEA 3OSFA 3HDDA 4L5EA 4C3HJ 3BR1A 2LK2A 1ZQ3P 1GDTA 2LVSA 1K61A 1ZTRA 1GV5A 2L0KA 3HKZN 4A3FJ 4BBSJ 3QQAA 2XGDA 4FE7A 5GPAA 2JMWA 1U78A 2Y31A 3QPLA 5C4JJ 2L9RA 3PM1A 4BBRJ 3LOCA 3IH2A 2NS7A 2HXOA 1I3QJ 1P7IA 4A3DJ 3H0GJ 1ETQA 1ETYA 3G1LA 3DEWA 2L7FP 3F0CA 3MVPA 4X6AJ 1FEXA 2NVYJ 2ID6A 3FISA 5C4XJ 1HDPA 2DMUA 1NK3P 1JKPC 2E2HJ 4M6VA 1W0UA 1ETKA 4A3CJ 1ZR2A 1O4XA 2DA7A 3TEDA 2DA6A 3LSPA 1ZGWA 4EEFG 5IP7J 2M34A 3S2DJ 1U9OA 1OCPA 1RETA 1IV6A 1AKHB 1F36A 4RDUA 3S2HJ 4D5CA 4M3FA 2GLOA 3E7LA 3JR9A 3NAUA 3GTQJ 1F43A 3JRGA 1HLVA 1JKQC 1APLC 3OSGA 1BW6A 2K9NA 3BR6A 2N8GA 2IBDA 2HQ5A 2RAEA 4W1UA 3FIWA 3MN2A 1TWGJ 1ETVA 2G0EA 2LR8A 5FKKA 2K40A 2E2IJ 1CQTA 2DA5A 1AKHA 1LFBA 3IV5A 2YS9A 1VI0A 3LNQA 2DMTA 2DA3A 5K7HA 4DW6A 1H8AC 4JX6A 1MBGA 2TRTA 3H3VK 5IYDJ 3HOZJ 5EZHA 3IH3A 1FTZA 1IDYA 4B3AA 2JA7J 1JJ6C 3JRAA 1OCTC 1JT6A 2DA4A 2COBA 4NDLA 3C2BA 2EZKA 5E3OA 1BA5A 4XRMA 2FX0A 4Y52J 2X6OA 4J19A 1FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ME6 A;  1BJZ A;  1UHS A;  3TP3 A;  1TWA J;  1UMQ A;  3G1M A;  2LFB A;  4C3J J;  1TWC J;  1QVU A;  5K7Z A;  4JX5 A;  5E3L A;  4XK4 A;  3BG3 A;  2E1O A;  2CUF A;  3TW7 A;  1HF0 A;  3I4M J;  1FTT A;  3O8H A;  2DMN A;  3HOY J;  4X1E A;  2EZI A;  5FJ8 J;  3B6C A;  3S1Q J;  2L7Z A;  2JA6 J;  1Q1V A;  2EZL A;  2R7Z J;  1U9N A;  4UUS B;  3JRD A;  1B8I B;  3A03 A;  1JKR C;  3HGG A;  5GP9 A;  5J3L A;  3QPS A;  1E3O C;  1QVT A;  1MSF C;  2NVX J;  3LSR A;  2NVQ J;  1IG7 A;  3BTI A;  3HOU J;  1S7E A;  4MO7 A;  1G2H A;  3PO3 J;  1LE8 B;  3HOX J;  2QF7 A;  2Y0S N;  3VPR A;  4S0H B;  2ECC A;  3CCY A;  1X58 A;  2OF7 A;  3JRB A;  4UUS A;  5M3M J;  2FQ4 A;  1B8I A;  2YUS A;  3LSG A;  3OIO A;  2XPV A;  3GTM J;  4M3E A;  2CUE A;  1HOM A;  4D7M A;  5JLW A;  2W48 A;  2XB0 X;  2D5V A;  4A3I J;  2K9Q A;  4IHW A;  3GTP J;  1LE8 A;  2NVT J;  1TWH J;  2JWT A;  5F08 A;  5EF6 A;  1WH7 A;  3WHB A;  1X2N A;  3HOV J;  3GBG A;  1POG A;  1FJL A;  2AO9 A;  3BG9 A;  4QTR A;  4I6Z A;  2M0C A;  1VF9 A;  5FKL A;  3OOU A;  4IEJ A;  2O7O A;  5M3F J;  1JT0 A;  3S1N J;  1Z0X A;  2VKE A;  2R92 J;  2B63 J;  1VND A;  2EH3 A;  3ZQF A;  3TP0 A;  2XB5 A;  3L1P A;  3M4O J;  2O8K A;  1RPW A;  4FTH A;  1A6I A;  3A01 B;  1GT0 C;  1BL0 A;  4DYC A;  2YU9 J;  1XC5 A;  3BTJ A;  1MBF A;  2XGE A;  1Y1W J;  1WGX A;  4A3K J;  2LP0 A;  2CQQ A;  5BNG A;  1EF4 A;  1U8B A;  3G1O A;  2ELK A;  1Y1V J;  2VKV A;  2NOG A;  1UG2 A;  2M9H A;  2HOT A;  3TW6 A;  2JK3 A;  5M5X J;  5FKO A;  2EBI A;  2CQX A;  1WPK A;  3A01 A;  4AC0 A;  3BR3 A;  3BTL A;  4DZJ A;  5IOZ A;  3HBL A;  3HB9 A;  2KDZ A;  2E2J J;  2CU7 A;  3Q0V A;  5GPC A;  1MBK A;  1K83 J;  4A3G J;  5M5W J;  4HNV A;  3BG5 A;  4BY1 J;  3GTK J;  1SAN A;  3NAR A;  5C44 J;  2HXI A;  2ME0 A;  1X2M A;  2CJJ A;  5F0C A;  3M3Y J;  2DMP A;  4CYC A;  2LTP A;  3FK7 A;  1ETO A;  1MBH A;  4M3D A;  1B72 B;  1QPI A;  1OJL A;  1PUF B;  5HOD A;  3UKG A;  1YRN B;  2AHQ A;  4C2M J;  1JGG A;  1I6H J;  5E3M A;  4XID A;  2ID3 A;  4MIM A;  4UUT A;  1H88 C;  4V2F A;  5E3N A;  3CDL A;  3Q0W A;  3K7A J;  1HCR A;  2JN6 A;  2LD5 A;  1B72 A;  1HDD C;  5EEA A;  2GBY A;  1P7J A;  1PUF A;  2Y2Z A;  2R5Z B;  1YRN A;  5IOY A;  2XGC A;  2H1K A;  2VUM J;  3DCF A;  2TCT A;  2HDD A;  3ZQL A;  2XRL A;  2O9L A;  2WB1 N;  1ETW A;  3MKL A;  5FLV A;  4A3E J;  5JLX A;  1IDZ A;  5EGO B;  3PO2 J;  1ENH A;  4ABZ A;  2M2E A;  2R5Z A;  1ORK A;  1AHD P;  4JP0 A;  5EDN A;  1WH5 A;  5K7F A;  1QRY A;  3B6A A;  3ZOB A;  4M3G A;  1MNM C;  1JJ8 C;  2K9S A;  3BQZ A;  4B4C A;  1MBJ A;  1JTX A;  2VI6 A;  4IHY A;  5J1Y A;  4A3L J;  2E19 A;  5EGO A;  3SFI A;  1IUF A;  3RQI A;  3RZO J;  2DN0 A;  4LOC A;  1OFC X;  3A02 A;  4DYQ A;  1W0T A;  2JA5 J;  2XPU A;  4Y7N J;  4GFB A;  2R5Y B;  2I10 A;  4RBO A;  2Y9Z A;  2MGQ A;  1GV2 A;  3BR0 A;  3ZQG A;  2HOS A;  2HYJ A;  3JRE A;  4JYK A;  5F1J A;  1IRZ A;  3HM5 A;  3CMY A;  3CQZ J;  2JJ7 A;  2OPT A;  5DTD A;  5FKM A;  4AYB N;  1JKO C;  3W6V A;  4XRS A;  4A69 C;  4MLO A;  4FE4 A;  2R5Y A;  1Z77 A;  1H89 C;  1IC8 A;  1AU7 A;  4MFD A;  2LKX A;  5EYR A;  5FKN A;  2WV1 A;  5IYC J;  2XPW A;  3K2A A;  1JTY A;  3WHC A;  1JUM A;  3S15 J;  3ZQH A;  2L7M P;  3D1N I;  1XS9 A;  1IJW C;  3BR2 A;  1GVD A;  4QSH A;  5C3E J;  2CRG A;  4I76 A;  2XSD C;  4W97 A;  1GUU A;  2DTZ A;  2EQR A;  2MSY A;  2LLK A;  5M5Y J;  4BKX A;  2GM4 A;  3S16 J;  3IH4 A;  3JRF A;  4CYC B;  2HOA A;  3Q0U A;  5IP9 J;  5EG0 B;  2ECB A;  4D7N A;  1T33 A;  4BXX J;  2X48 A;  2FD5 A;  2R93 J;  3GTO J;  1RES A;  1JUP A;  1A5J A;  1WCM J;  3GTG J;  2ZB9 A;  3BR5 A;  1JUS A;  1ETX A;  2DA2 A;  3ZQI A;  4V2G A;  1MH3 A;  2DA1 A;  2Y9Y A;  2H8R A;  5J1U A;  3FKI J;  1MSE C;  1IGN A;  2MG4 A;  5EG0 A;  2IAI A;  1RR7 A;  3RKQ A;  1ZK8 A;  4FIS A;  4IHV A;  2X9D A;  4A3J J;  1DU6 A;  3S1R J;  1RKW A;  1MH4 A;  4JX4 A;  5EZG A;  5IPA A;  5F0H A;  5F04 A;  4C3I J;  4A3M J;  2IEK A;  1NK2 P;  3GTL J;  2DMQ A;  3ZQC A;  3BTC A;  1XG1 A;  3HOW J;  4FCY A;  2DJN A;  4A93 J;  5IYB J;  4M3B A;  2M8G X;  4D5F A;  3SJM A;  2R0Q C;  3JRI A;  4B1R A;  3BQY A;  2VPR A;  3S1M J;  4A3B J;  5FLM J;  3Q3S A;  1WI3 A;  2QCO A;  2LY9 A;  5F27 A;  4QIW N;  2MW8 A;  3JRH A;  1RKT A;  1SFO J;  4IHX A;  9ANT A;  4BY7 J;  5DS9 A;  2NS8 A;  1BW5 A;  3JRC A;  3RZD J;  1TWF J;  1T56 A;  1FIP A;  2Y30 A;  5IP6 A;  4AUX A;  3O8G A;  5F0F A;  2JA8 J;  3I4N J;  1ITY A;  1ZKG A;  3FK6 A;  2EZH A;  3HGY A;  3GTJ J;  1VFC A;  2WAQ N;  3BT9 A;  1DU0 A;  4DYR A;  4XRS G;  2FJ1 A;  2HI3 A;  2PMZ N;  2KT0 A;  3LSJ A;  1D5Y A;  1LFU P;  5J1R A;  3S14 J;  1NTC A;  4XIC A;  3HEF A;  1ZR4 A;  4G12 A;  1I50 J;  4MFE A;  3SDG A;  1TC3 C;  4DZP A;  2P81 A;  1R9T J;  3S17 J;  1MBE A;  3OSF A;  3HDD A;  4L5E A;  4C3H J;  3BR1 A;  2LK2 A;  1ZQ3 P;  1GDT A;  2LVS A;  1K61 A;  1ZTR A;  1GV5 A;  2L0K A;  3HKZ N;  4A3F J;  4BBS J;  3QQA A;  2XGD A;  4FE7 A;  5GPA A;  2JMW A;  1U78 A;  2Y31 A;  3QPL A;  5C4J J;  2L9R A;  3PM1 A;  4BBR J;  3LOC A;  3IH2 A;  2NS7 A;  2HXO A;  1I3Q J;  1P7I A;  4A3D J;  3H0G J;  1ETQ A;  1ETY A;  3G1L A;  3DEW A;  2L7F P;  3F0C A;  3MVP A;  4X6A J;  1FEX A;  2NVY J;  2ID6 A;  3FIS A;  5C4X J;  1HDP A;  2DMU A;  1NK3 P;  1JKP C;  2E2H J;  4M6V A;  1W0U A;  1ETK A;  4A3C J;  1ZR2 A;  1O4X A;  2DA7 A;  3TED A;  2DA6 A;  3LSP A;  1ZGW A;  4EEF G;  5IP7 J;  2M34 A;  3S2D J;  1U9O A;  1OCP A;  1RET A;  1IV6 A;  1AKH B;  1F36 A;  4RDU A;  3S2H J;  4D5C A;  4M3F A;  2GLO A;  3E7L A;  3JR9 A;  3NAU A;  3GTQ J;  1F43 A;  3JRG A;  1HLV A;  1JKQ C;  1APL C;  3OSG A;  1BW6 A;  2K9N A;  3BR6 A;  2N8G A;  2IBD A;  2HQ5 A;  2RAE A;  4W1U A;  3FIW A;  3MN2 A;  1TWG J;  1ETV A;  2G0E A;  2LR8 A;  5FKK A;  2K40 A;  2E2I J;  1CQT A;  2DA5 A;  1AKH A;  1LFB A;  3IV5 A;  2YS9 A;  1VI0 A;  3LNQ A;  2DMT A;  2DA3 A;  5K7H A;  4DW6 A;  1H8A C;  4JX6 A;  1MBG A;  2TRT A;  3H3V K;  5IYD J;  3HOZ J;  5EZH A;  3IH3 A;  1FTZ A;  1IDY A;  4B3A A;  2JA7 J;  1JJ6 C;  3JRA A;  1OCT C;  1JT6 A;  2DA4 A;  2COB A;  4NDL A;  3C2B A;  2EZK A;  5E3O A;  1BA5 A;  4XRM A;  2FX0 A;  4Y52 J;  2X6O A;  4J19 A;  1FIA A; 
#chains in the Genus database with same CATH topology
 3LSI A;  1YG2 A;  1XDU A;  4RM2 A;  2DYS H;  5DD4 A;  3PSI A;  4XKB A;  2BXZ A;  4WF2 A;  4C3J J;  3GFI A;  4A0Z A;  5K7Z A;  3H5N A;  1W4M A;  4IQ4 A;  2CO5 A;  1W7P D;  1XMA A;  2VT2 A;  2E1O A;  5D5U B;  1D0Z A;  2KRF A;  5E1X A;  1HF0 A;  1DGR M;  5AIQ A;  3I4M J;  2XV4 S;  1AA7 A;  5JFR A;  3KX2 A;  2YPR A;  4S05 A;  5FJ8 J;  5HNF A;  2Z3Y A;  3B6C A;  5B66 C;  2L4A A;  2JA6 J;  3AL0 C;  4NQW B;  2EB7 A;  4IRG A;  4B09 A;  3TOB A;  1L0O C;  3A03 A;  2KZV A;  2W82 A;  4LK0 F;  2MLG A;  1MDM B;  1QHG A;  1XTA A;  3BP8 A;  2NVX J;  3LSR A;  3M7G A;  2NVQ J;  5F6F A;  1IG7 A;  3CJR B;  1S7E A;  1G2H A;  2PEX A;  2DXI A;  3HOX J;  2R7V A;  2ECC A;  4DGW B;  2HPI A;  3F8B A;  4G8X A;  3JRB A;  3HL2 A;  2OUM A;  2XF7 A;  4UUS A;  4XLA A;  2GA1 A;  3FHZ A;  1LNW A;  4IHS A;  1ON2 A;  2L7K A;  5D5V B;  2YUS A;  4IQJ A;  1I5Z A;  3OIO A;  5GAG J;  2BY0 A;  2ZJ2 A;  5L3F A;  2VJ4 A;  3WTU C;  2R7T A;  2V4J C;  3OS1 A;  4D7M A;  4E7I A;  4R79 A;  1UEL B;  2JTV A;  3CMM A;  2D5V A;  3LMM A;  4L9N A;  2K9Q A;  1TWH J;  2DJI A;  2JWT A;  1SD5 A;  2VE8 A;  2JPB A;  3EUK L;  1PVE A;  3QU6 A;  3ZN1 A;  4KYW A;  4GYG A;  3LQR A;  3WHB A;  2I5U A;  2GIV A;  3H5A A;  1POG A;  3VYR B;  4ENN A;  4I6Z A;  1YJN I;  4MTD A;  2M0C A;  2PMH A;  4KUM A;  3ZN0 A;  3COA C;  4E7Z A;  3BZC A;  2ZXI A;  1I6X A;  1TW2 A;  1WJ5 A;  2FEZ A;  2V9V A;  2R92 J;  3CCV I;  4I2O A;  1HBX G;  4WXH A;  1F4K A;  5LRR A;  4KFC A;  1ULY A;  1EKE A;  3HJE A;  4OIR F;  2O8K A;  1A6I A;  2CQN A;  1G6N A;  3TDZ C;  3GVA A;  1XC5 A;  1JGS A;  4XKC A;  1X1B A;  1BI1 A;  1MBF A;  4BQO A;  1Y1W J;  4A3K J;  1NG6 A;  3EPZ A;  1U8B A;  4CHU A;  1CGP A;  3L9F A;  3CZ6 A;  3G1O A;  1RC9 A;  3P9C A;  4PGG A;  4IX7 A;  1RI7 A;  5K1Y A;  2JK3 A;  1UB9 A;  1Z67 A;  2WC2 A;  2Q2E B;  2F5D A;  1BR4 A;  3K4J A;  1W5T A;  2QYO A;  2EIK H;  3HBL A;  3HB9 A;  1OPC A;  2XF6 A;  5ED4 A;  1EV7 A;  1KU3 A;  3Q0V A;  4EQQ A;  3E5Q A;  1IUY A;  1MBK A;  1IXR C;  4G94 A;  3VB2 A;  2A6E F;  4A3G J;  2HOE A;  2YX7 A;  5C44 J;  5FD6 A;  3KZZ A;  1J2X A;  2PN6 A;  2UXX A;  1WJB A;  2ZFW A;  1MBH A;  1XGM A;  5HNH A;  1Z7U A;  3N97 A;  2IP2 A;  1OJL A;  1IO2 A;  4N9I A;  1ZRC A;  2BOL A;  5HOD A;  4Y33 A;  1YTY A;  1YRN B;  3CC4 I;  1O7L A;  1ZG3 A;  1UCR A;  2EFQ A;  3X2Q H;  4XID A;  2R7O A;  5D4R A;  3U21 A;  1V5G A;  1VQP I;  1FBU A;  4F55 A;  4V2F A;  1E3P A;  1B59 A;  5TIS C;  5E3N A;  2COM A;  3RKX A;  5A2Q K;  3ESW B;  5TRD A;  4HQE A;  4XKW A;  4UVC A;  2JN6 A;  2KIU A;  4PGH A;  3J7Y J;  4D1Q A;  1B72 A;  4KNY A;  4EGZ A;  1SVL A;  1AWC A;  2Y2Z A;  2R5Z B;  4HBL A;  4ZDO A;  2VUM J;  3DCF A;  4MEX F;  3L2Q A;  2VIX A;  2M5W A;  5IT9 Z;  3T8T A;  5B3S H;  2TCT A;  2LC2 A;  3ZQL A;  4U0V A;  2A6T A;  3HUG B;  1LEA A;  1U5T C;  3CJN A;  3BDD A;  1X19 A;  2GZW A;  3F72 A;  3L2W A;  1IDZ A;  4LLN A;  5EGO B;  3HXL A;  4PJ0 C;  1OQY A;  1FYM A;  4BQN A;  3F21 A;  4HF0 A;  2M2E A;  4LB6 B;  2FNP A;  2V1N A;  5FGM A;  5K7F A;  3CMA I;  1RRJ A;  1MJA A;  1RUO A;  3D5S C;  4PFO A;  1ZAO A;  2M45 A;  3F9K A;  2MLK A;  3BQZ A;  3C1D A;  4E7L A;  2IW5 A;  1YS6 A;  5CJ9 A;  1IZ1 A;  1MBJ A;  4L5J A;  4A3L J;  2BVL A;  3I59 A;  2E34 A;  2LG4 A;  5E18 F;  3VYT B;  2PJR B;  3ECH A;  3SZG A;  3EUH A;  4HLX A;  4OIN F;  4Y17 A;  1MMD A;  4GFB A;  3L2R A;  1SC7 A;  2R5Y B;  2HWV A;  2K86 A;  3OYG A;  3CTA A;  1GV2 A;  4G6Q A;  2K7L A;  5F1J A;  1IRZ A;  3HHG A;  5DEQ A;  3CMY A;  3CQZ J;  2JJ7 A;  4HRI A;  3AKZ A;  3DBL B;  2XGX A;  1WVR A;  3LST A;  5FKM A;  1B6A A;  2XSJ C;  3GME A;  4PK4 A;  3C2H A;  3W6V A;  2HKX A;  5K5R A;  4UUV A;  1SFE A;  2M8E A;  5D8K B;  3W2V A;  5DM7 F;  1K4S A;  3KP5 A;  5FFZ A;  5FB2 A;  1H89 C;  3H3U A;  1IC8 A;  1TQM A;  3T1B A;  2NVU B;  2WV1 A;  1OCZ H;  4RAG A;  1Z6R A;  3WHC A;  3S15 J;  4BQA A;  2P7C B;  3REO A;  1XS9 A;  3W6J B;  1IJW C;  4FAS D;  3CLQ A;  2QZ8 A;  3GFL A;  3QPT A;  4LG0 A;  3JW4 A;  4P9U A;  2XSD C;  5DUK A;  2CW8 A;  5J8F A;  2EQR A;  5M5Y J;  1PP7 U;  2GM4 A;  3IH4 A;  3JCU C;  3CCE I;  2HOA A;  1B9N A;  5EG0 B;  4G6T B;  4YIR X;  2VLA A;  2PLY A;  2CS3 A;  3OYF A;  4FQG A;  1D0X A;  4BDZ A;  3CJQ B;  3F8N A;  2R93 J;  2IS1 A;  1RES A;  3MZH A;  4XN3 A;  4IPA A;  3KCC A;  2ZB9 A;  3D5L A;  5KAI C;  2OJE D;  5F64 A;  1ETX A;  2Y69 H;  4LIT A;  4X0G A;  3CCU I;  4XR6 A;  1A31 A;  2IGN A;  4L18 B;  4YG2 F;  5J1U A;  3OY9 A;  1IGN A;  2MG4 A;  1WRJ A;  2KRH A;  1KZH A;  3RKQ A;  4IHV A;  1V5E A;  1DU6 A;  2Z9O A;  4YEL A;  3ECO A;  5F0H A;  2IA0 A;  2GAU A;  3S3O A;  1TNT A;  1PJR A;  2QQA A;  3GTL J;  3ZQC A;  2P5K A;  4ON0 A;  3PNV A;  2QVO A;  1D3Y A;  3JTH A;  1D8K A;  4FCY A;  2DJN A;  2OAZ A;  2XC7 A;  4XLP F;  1USS A;  1FSH A;  1EJ9 A;  2ZNZ A;  4YII A;  1TNS A;  3R6S A;  3K1N A;  2ZXW H;  2GA2 A;  4HYE A;  4NBQ A;  4OMZ A;  3JRI A;  2E36 A;  2R0Q C;  2VPR A;  1LDD A;  1KQ8 A;  1D1C A;  4EMS A;  2XAQ A;  2NRA C;  3KE2 A;  2LY9 A;  3SQN A;  9ANT A;  3ERE D;  4BY7 J;  1BW5 A;  5LBQ A;  3A1Y A;  3R0A A;  2Y30 A;  1FZP B;  1H9T A;  4AUX A;  3O8G A;  5F0F A;  1BOA A;  2HNH A;  2Y48 A;  3DQV C;  4UY8 I;  2RV8 A;  3P9K A;  2EIN H;  1P2F A;  1ZKG A;  3KEQ A;  2DCE A;  2EIM H;  2EZH A;  1WJE A;  2MC3 A;  1VFC A;  4CIC A;  1DU0 A;  2IGK A;  1QZY A;  3IAS 2;  4XRS G;  3KPH A;  4IXA A;  4G9Y A;  4BE0 A;  5H2F C;  3G4S I;  3H1C A;  1YYV A;  4ZYD A;  5CYV A;  1WJF A;  1D5Y A;  2F5E A;  4CYD A;  1UAA A;  1VTN C;  2X4H A;  1NTC A;  4XIC A;  4PDK A;  3HEF A;  4Z2Y A;  1ZR4 A;  1QNT A;  4UXN A;  3F22 A;  4GGG A;  1FOX A;  5BS6 A;  1AOY A;  3I5U A;  3SDG A;  3AL0 B;  1TC3 C;  4DZP A;  5LGT A;  3OSF A;  4I09 A;  3HDD A;  4C3H J;  4KIC A;  2O61 A;  1ERD A;  1MJ9 A;  1ZQ3 P;  1K61 A;  3GYH X;  2CQ7 A;  1KQ0 A;  2IA2 A;  2L0K A;  3V7R A;  3HKZ N;  3I64 A;  2R7D A;  5LEK A;  5K5O A;  4BBS J;  1MNE A;  3QQA A;  1CF7 A;  4FE7 A;  4UV8 A;  2W84 A;  3HG9 A;  1WSU A;  1HQC A;  2F4I A;  3W2A A;  5C4J J;  4UV9 A;  2K9M A;  1OCR H;  3ZXS A;  5CLS A;  4ASN A;  3QOP A;  2BW3 A;  4ZJZ A;  3OYB A;  4A3D J;  4PZJ A;  2FNA A;  2JSP A;  2LDU A;  3F0C A;  4B48 A;  4J01 A;  2NVY J;  2W4S A;  2V9K A;  3IHU A;  4V19 K;  4M9X A;  3RDI A;  1VQ5 I;  2CGP A;  1L3L A;  2A05 A;  4A0X A;  3OS0 A;  4O6J A;  2GOX B;  1HDP A;  2VC1 A;  4CCK A;  3C3W A;  4BH9 A;  1ZLJ A;  1JKP C;  1ETK A;  2CH0 A;  2DA7 A;  2VQH A;  1IRF A;  4M73 A;  1K78 B;  2X1D A;  5LFA A;  1U9O A;  1OCP A;  4OMY A;  2ELH A;  4N4O B;  4UVA A;  1AKH B;  1LVK A;  2XUB A;  4RM3 A;  4ETS A;  2MBF A;  3IWZ A;  2KPM A;  3RYR A;  3GTQ J;  3BJO A;  1O3T A;  2QSF X;  1F43 A;  3BLY A;  4P5O A;  1FBS A;  2OCE A;  3K69 A;  3IKT A;  2HQN A;  3KZI C;  2F5V A;  1PP8 F;  2G7U A;  3FIW A;  3DPU A;  3MN2 A;  5DM6 F;  4FHT A;  2HKO A;  3CF2 A;  3GLL A;  2E60 A;  2DA5 A;  2K5C A;  1D8J A;  2W7N A;  2BEO A;  5L3G A;  2YSR A;  5K7H A;  3F6V A;  4XLC A;  2HTJ A;  1MMN A;  1FTZ A;  4JK1 X;  1KGS A;  3SDB A;  3FF5 A;  1JT6 A;  4NDL A;  2COB A;  3BRO A;  3RQ4 A;  4ZH4 F;  2EZK A;  1BA5 A;  5B5E C;  2FX0 A;  3FM5 A;  1VQ7 I;  2EJR A;  4J19 A;  1S5L C;  1VQN I;  2H8W A;  1S8N A;  1UHS A;  3TP3 A;  5E8G A;  1TWA J;  1VZ0 A;  2DT7 B;  2LFB A;  1TWC J;  1G3Y A;  2H1L A;  3HKZ A;  4JX5 A;  3KP6 A;  3S32 A;  1O3S A;  2ACJ A;  1VQ8 I;  3BG3 A;  3H3Z A;  3Q5F A;  3K4L A;  5LLQ A;  1IN6 A;  5CVR A;  3TW7 A;  4U0W A;  4A5N A;  3M8F A;  5D4S A;  4X1E A;  3IC7 A;  2XKO A;  3L2U A;  4B3X A;  2EZL A;  2LNB A;  4UUS B;  4UVB A;  2BV6 A;  4LJZ F;  3K1P A;  4P9F A;  2XAJ A;  3CD6 I;  3MKZ A;  3HGG A;  5J3L A;  2LOO A;  3DTE A;  3GZ5 A;  1QVT A;  3QPS A;  5H20 A;  3G6E I;  1E3O C;  1DDN A;  1MSF C;  4AU7 A;  3H9Q A;  1IXC A;  1LB2 A;  2G9W A;  3BTI A;  5EEG A;  2QQ8 A;  2O0Y A;  4DBQ A;  3FXL A;  4F7Z A;  1Z1D A;  1VQM I;  3TBI A;  3ZMV A;  5FRO A;  2QF7 A;  2DT5 A;  3VPR A;  3CCY A;  1X58 A;  1P4A A;  2OF7 A;  3G71 I;  1KA8 A;  2W57 A;  1J5Y A;  3H0D A;  1B8I A;  1Z05 A;  3LSG A;  5ICG A;  3FXO A;  2X51 A;  5E8I A;  2CUE A;  3V7S A;  1XX5 A;  3NQO A;  3ZGK A;  1HOM A;  2XB0 X;  5D6E A;  1Z3Y A;  2GWR A;  2IRF G;  2NVT J;  3FMQ A;  1FP1 D;  3W3C A;  2KL4 A;  3WTY C;  1ZYR F;  2DDA A;  1OMI A;  2HYG D;  1XSV A;  1Y39 A;  5EF6 A;  3QOD A;  1WH7 A;  3ONQ A;  3FZV A;  1XB4 A;  2AO9 A;  3NWT A;  3HHH A;  3WG9 A;  5FKL A;  4KIG A;  1MZB A;  3DEE A;  4F3Q A;  3GFJ A;  3OYJ A;  1JT0 A;  4UNO A;  1XGS A;  3S1N J;  3OYK A;  1SD7 A;  1YIO A;  2B63 J;  1VND A;  2VXD A;  4ANJ A;  2EH3 A;  4RS8 A;  3IRQ A;  3W6K B;  1V4R A;  3WU1 B;  1BBY A;  3M4O J;  1RPW A;  1GT0 C;  1BL0 A;  3M8E A;  2K85 A;  4MNU A;  5KHD A;  1YI2 I;  2PG4 A;  4P1W A;  1Y56 A;  2ZME A;  1MMG A;  2FBK A;  4RB3 C;  1EF4 A;  4RLQ A;  2MC4 A;  3M9A A;  1MIJ A;  1OYW A;  3KP3 A;  2M9H A;  5KVR A;  2DTR A;  2RGV A;  4G7H F;  2EBI A;  3SHF A;  4BJ5 C;  4HZF A;  2P4W A;  3A01 A;  3KLO A;  3BTL A;  4DZJ A;  4I7H A;  2A5W A;  5GAE J;  4RGS A;  1BOB A;  2WY7 Q;  2E2J J;  1OCO H;  1P4X A;  2CU7 A;  5KAF C;  1VQ6 I;  1WI9 A;  4OOI A;  1LFP A;  1FT9 A;  3TKY A;  1SFX A;  2K27 A;  3RKW A;  3H5R A;  4XSZ F;  1V3F A;  4HNV A;  2PFB A;  4BY1 J;  1DQU A;  1UG0 A;  1SAN A;  2HU9 A;  2M30 A;  4HNU A;  4EGY A;  2HXI A;  3Q9V A;  4RLF A;  4U7D A;  3M3Y J;  4CYC A;  3FK7 A;  4I98 B;  3CLO A;  1B72 B;  2R7S A;  1PDN C;  2XAU A;  1LDJ A;  5BPI A;  4ZTJ A;  4BEH A;  3UKG A;  1HW1 A;  1JGG A;  1TTY A;  1VQ4 I;  3CUQ A;  4ZDP A;  4EJU A;  4MIM A;  1K6Y A;  2H6B A;  2AQF A;  1Z21 A;  3GW2 A;  3ZMU A;  1YFH A;  3DTI A;  2ELJ A;  3BJA A;  4E7J A;  4NHJ A;  3Q0W A;  4ZC3 A;  1FX7 A;  3K7A J;  1PUE E;  1HCR A;  4HPQ A;  4HDV A;  1E17 A;  1BR2 A;  1PUF A;  4XQF A;  5IOY A;  2H1K A;  4AVP A;  3V42 A;  3HC7 A;  3TO9 A;  4LFU A;  3HRU A;  1BI3 A;  3DF8 A;  2K02 A;  1KU9 A;  4P55 A;  3QWL A;  3D0S A;  4L9J A;  2WB1 N;  1GVJ A;  3HSR A;  3OL4 A;  1IF1 A;  1ETW A;  1T0F A;  2LY1 A;  2JVG A;  3K0L A;  4CDG A;  4YFN F;  3I59 B;  2V6E A;  4FX0 A;  4CSW A;  3PO2 J;  2R7F A;  1HW2 A;  2WTE A;  2CW7 A;  3RCO A;  2DFE A;  1D1B A;  2M3A A;  2M4G A;  3L2V A;  3HOT A;  4JP0 A;  1KYZ A;  1WH5 A;  2IXS A;  4YFX F;  1MNM C;  4M3G A;  1FBQ A;  5CKT A;  2BE5 F;  1B4A A;  2RRE A;  2VAS A;  1S7O A;  2VI6 A;  3OMY A;  4M71 A;  4XLF A;  4Y13 A;  1R71 A;  1FPQ A;  2E19 A;  3SFI A;  3J7A Y;  3N05 A;  2DN0 A;  3GCM A;  4LOC A;  1OFC X;  3A02 A;  1GLN A;  2FQ3 A;  1J75 A;  3CO6 C;  2A5Y B;  2LRD A;  1W0T A;  1HKS A;  1WJD A;  1TW3 A;  2ISY A;  2KJB A;  4EM1 A;  1Z91 A;  1QPM A;  4XN0 A;  3FWE A;  4JYK A;  1W7P A;  4WCG A;  2OZU A;  2VXZ A;  4DIQ A;  2OPT A;  1OKR A;  4LG0 B;  3H35 A;  5FD5 A;  3ELK A;  4M74 A;  2HVS A;  3OR1 C;  2X1E A;  3I3L A;  3QRF F;  2C6Y A;  2JUC A;  2MYS A;  1P4W A;  1YX5 A;  2LKX A;  1R5G A;  4A69 C;  2R7R A;  1JTY A;  5DD8 A;  2PX9 A;  2K4J A;  2CFO A;  2L7M P;  2R4G A;  3BR2 A;  1GVD A;  2ZJP F;  2WV0 A;  3SXY A;  1E2X A;  5C3E J;  1T39 A;  2CRG A;  4I76 A;  4W97 A;  1U8R A;  2MSY A;  5D5X B;  1O3Q A;  2B9S A;  2K4B A;  3MD2 A;  3GWZ A;  2IJL A;  2P8T A;  4LIV A;  4A6E A;  2L9S A;  4BAY A;  4PJN A;  3DEU A;  4AIK A;  4BXX J;  3UNG C;  2X48 A;  2FD5 A;  4KJZ A;  3PUF A;  2OU2 A;  1XDS A;  3MAJ A;  4OWR B;  1D5V A;  3VFZ A;  3PUB A;  1YJ9 I;  1JUS A;  5LEJ A;  2DA2 A;  4EVI A;  1MH3 A;  5DCM A;  2DA1 A;  3QYB A;  5IY5 H;  3J80 K;  4HV6 A;  3K1M A;  2WB1 A;  2HDC A;  3FKI J;  2KQR A;  1RR7 A;  1Z7L A;  4IO9 F;  2X9D A;  3ZMD A;  3OYL A;  3S1R J;  4JX4 A;  1EH7 A;  4NC6 A;  2Q8K A;  2STW A;  4HNT A;  2Q1Z B;  3MKW B;  4IF4 A;  2V26 A;  4A3M J;  3JTG A;  1SAX A;  2HVQ A;  4BQQ A;  3BTC A;  4BYY A;  5CQE A;  3HYI A;  3J81 K;  5CVU A;  3RTR A;  4IOC F;  1T6S A;  1V54 H;  5DV5 A;  5BPD A;  3A4C A;  2KIS A;  4IKF A;  4HG2 A;  3GZN B;  2QBY A;  2DO7 A;  3OR2 C;  4II3 A;  4A3B J;  3WE2 A;  5FLM J;  3Q3S A;  2QCO A;  1WKM A;  2F5F A;  2W1O A;  1N78 A;  3DLL F;  5DS9 A;  2NS8 A;  4FX4 A;  2HDW A;  3RZD J;  1TWF J;  1T56 A;  5LRS A;  5IP6 A;  1LUJ B;  2VOP A;  4IHT A;  4QPQ A;  2ETH A;  5HS9 A;  2L3D A;  2E5N A;  1R5H A;  4B43 A;  3CJT B;  3ROU A;  3BT9 A;  2R7X A;  2HGC A;  4AD9 A;  3ABT A;  3HOS A;  4G7Z F;  2RQQ A;  1HKQ A;  4OIP F;  3AG3 H;  1GHC A;  4F92 B;  2BY2 A;  2RC4 A;  4XOP A;  2HI3 A;  1CF7 B;  2PMZ N;  1K79 A;  2KT0 A;  2AS5 F;  1LFU P;  2BVM A;  2NAZ A;  5KNL A;  2VJI A;  3MEX A;  3DPL C;  3KP7 A;  3V4G A;  2ZNY A;  4LLG F;  1I50 J;  3TO7 A;  3O2P E;  2VQC A;  4PSW A;  4MFE A;  2P6T A;  4BJ6 C;  5DUI A;  1R9T J;  1YX3 A;  1R49 A;  5D6F A;  3S17 J;  4L5E A;  2BW3 B;  3BR1 A;  2LVS A;  2DW4 A;  2IPQ X;  2BY3 A;  2HEO A;  2XGD A;  2M87 A;  3H92 A;  3J80 Z;  3K70 C;  3HRM A;  3C7J A;  1S3J A;  2JMW A;  4KMU X;  2YR2 A;  3QYE A;  2Y31 A;  1ODD A;  2NS0 A;  5FLX K;  5HDK A;  3BC8 A;  2VOD A;  3E3V A;  4PUS A;  2K3P A;  2DI3 A;  2W00 A;  4U87 A;  2V7F A;  3RPU D;  4XLE A;  1P7I A;  3E5U A;  3K4C A;  4Y3O A;  4LD5 A;  2OQR A;  2Q0O A;  1E0E A;  3DBH B;  2OQG A;  3G1L A;  3DEW A;  4Q48 A;  3CCJ I;  1SMY F;  3MVP A;  4E7K A;  3I55 I;  3OS2 A;  5A2Q Z;  4KDP A;  2HQA A;  1R4M B;  3ZMZ A;  3FIS A;  3MZ8 A;  1J09 A;  1BC7 C;  3DWL E;  4M72 A;  3E6B A;  2DMU A;  2M7A A;  3FDY A;  1IRX A;  1W0U A;  1UJ8 A;  1ZR2 A;  2DA6 A;  1LEB A;  5LGN A;  3GFM A;  3HTU A;  4RAF A;  2M34 A;  2MFZ A;  3I4P A;  2PI0 A;  4PJL A;  3CUO A;  1F36 A;  2V9P A;  4F52 A;  3L2C A;  1V55 H;  2DU9 A;  2R7U A;  2EFP A;  3E7L A;  2WAD A;  3JR9 A;  1KON A;  3DV8 A;  1HLV A;  4HX7 A;  1XCV A;  4ESB A;  3DPT A;  4NC8 A;  4KIT B;  3D5R C;  2LBF A;  3CDH A;  3K6G A;  3IRR A;  2N8G A;  1P92 A;  2RAE A;  1X4P A;  1RIO H;  1TT0 A;  4GRI A;  1X1C A;  1SVO A;  1ETV A;  4C30 A;  2K40 A;  2E2I J;  2DAO A;  1LFB A;  3IV5 A;  2FXA A;  1VI0 A;  2KKO A;  1YW9 A;  3IAM 2;  2LF7 A;  2DA3 A;  2H94 A;  4KA4 A;  3FM3 A;  4DW6 A;  1MBG A;  2IS6 A;  2R3S A;  2P0W A;  5IYD J;  5EZH A;  1IN5 A;  3IH3 A;  3QAH A;  3BPX A;  5HS7 A;  4B3A A;  1I39 A;  1MMA A;  2ZSI B;  1ZG1 A;  2BGC A;  1OCT C;  2PMZ A;  4KIB A;  1R36 A;  3IL2 A;  4BHB A;  3C2B A;  4JBA A;  4R8H A;  4A2U A;  1G59 A;  5ILS A;  1ZAR A;  1BM9 A;  1XSX A;  2XRN A;  5FLX Z;  3LA3 A;  2ME6 A;  3EUH C;  3CCS I;  2L9V A;  4HAM A;  4JQF A;  1X3U A;  3G1M A;  1ZLK A;  4C2U A;  2QUF A;  2RNG A;  3WU0 A;  2A3S A;  3O3K A;  4B47 A;  3ZCO A;  2PQ8 A;  3CES A;  2M4K A;  2CUF A;  4XSX F;  3SZP A;  1FTT A;  1U3E M;  3O8H A;  3ZP5 A;  1HA8 A;  2DMN A;  3SEZ A;  1SFU A;  4MQ9 F;  3JAM K;  4II2 A;  3HOY J;  4CO8 A;  3JSP A;  3CCL I;  2L7Z A;  1XGN A;  3JRD A;  1WHU A;  2A69 F;  1U6G A;  1B8I B;  4CUG A;  1X3W B;  3I56 I;  1JKR C;  3ML6 A;  2IA1 A;  5GP9 A;  1SAU A;  2UUZ A;  3GUD A;  4BAC A;  1BI2 A;  3LA2 A;  3V7C A;  3HOU J;  4D0P A;  4XMY A;  2JPC A;  2W25 A;  3S3M A;  1IN7 A;  2CUJ A;  3PIO F;  4MO7 A;  5LHG A;  1TL8 A;  1XN7 A;  3ASO H;  3PO3 J;  3TQN A;  4KIF A;  3TGN A;  2Y0S N;  4S0H B;  3S93 A;  4CCL A;  2D1H A;  5M3M J;  1MGT A;  3F8C A;  3S3N A;  3VSL A;  4O3M A;  3BCA A;  4E4H A;  4M3E A;  4CH7 A;  1QGP A;  5JLW A;  2VKH A;  2W48 A;  3Q9S A;  3KYD B;  2BHY A;  4A3I J;  1IAW A;  3EQL F;  4IHW A;  5FO5 A;  4XRF A;  1LE8 A;  3GTP J;  3E97 A;  4PCQ A;  4OAY A;  3CP8 A;  4GCV A;  2R7Q A;  3RI4 A;  3TL4 X;  1RZ4 A;  3FHN A;  3WGI A;  1A35 A;  1FJL A;  5J6X A;  4F91 B;  3WOD F;  2XF5 A;  3OOU A;  4G6D A;  4IEJ A;  5AON A;  2ZFU A;  1YS7 A;  2UXN A;  2ZME B;  3L7W A;  4E7S A;  5ERI A;  4AM3 A;  3MKY B;  1Z0X A;  5BOX A;  1GXP A;  1OCC H;  2FMY A;  1REP C;  1YLF A;  3ZQF A;  3TP0 A;  2DDB A;  4BL0 B;  1I27 A;  3L1P A;  2E1M B;  4FTH A;  3A01 B;  2M0M A;  2HVR A;  1X1D A;  4HLY A;  2YU9 J;  2VT3 A;  1JE8 A;  3FX3 A;  3RIR A;  1X4O A;  3FXK A;  4HW0 A;  1X1A A;  2XGE A;  1WGX A;  4D9J A;  1R1T A;  2VOO A;  4ZDL A;  1W5S A;  1H0M A;  3KIO A;  3JAM Z;  1XCB A;  3OYD A;  1Y1V J;  1XD7 A;  3BPV A;  1FMV A;  3I53 A;  2XAS A;  2LYC A;  1KU2 A;  1UG2 A;  5E1Z B;  2HOT A;  4OIO F;  2R7W A;  1DGW Y;  5M5X J;  2CMP A;  2CQX A;  1YIT I;  4AC0 A;  1MW7 A;  5KK1 A;  5IOZ A;  3K4B A;  5D8L B;  2VBZ A;  3WTV C;  3BWG A;  2KDZ A;  2V1X A;  4BEH B;  1A04 A;  3WG7 H;  4EV0 A;  3DBR B;  3CUQ B;  4HX4 A;  5J4Y A;  2MH2 A;  1ZHF A;  3HTS B;  1K83 J;  2NNN A;  4GYI A;  5M5W J;  4LB5 A;  3C2G A;  1YO5 C;  2VBX A;  3NAR A;  2Z16 A;  2ME0 A;  1X2M A;  2CJJ A;  1QZE A;  4IVN A;  1O3R A;  5GAH J;  1OR7 A;  2F6C A;  4NB5 A;  3DP7 A;  1ETO A;  4A5M A;  3CCR I;  4M3D A;  1QPI A;  2LH9 A;  2XDV A;  2DFH A;  1PUF B;  2E7X A;  2AHQ A;  4C2M J;  1I6H J;  2Y0S A;  2EFN A;  1LKX A;  4YEJ A;  2IGM A;  1OYY A;  2ID3 A;  4G7O F;  4UUT A;  1H88 C;  1LDK B;  3BG7 A;  3IP4 B;  2OV7 A;  2ZSH B;  4F93 B;  1STZ A;  3CDL A;  4XBF A;  3PQK A;  4Y4R A;  2NXN B;  1FNN A;  2GBY A;  2OTL I;  5GAD J;  2CW0 F;  2V1D A;  3LSK A;  2Y75 A;  1R4N B;  2G7H A;  4N9H A;  4ZYH A;  2L54 A;  2RVC A;  1MMS A;  2VJ5 A;  2XRL A;  2VC0 A;  1MJB A;  2FA5 A;  4BUP A;  2IGO A;  4A3E J;  4CCJ A;  2FML A;  2RDP A;  4CCM A;  5J47 A;  3NEU A;  3H36 A;  1ENH A;  4XNF A;  4ABZ A;  4BE2 A;  3KP2 A;  4MQV A;  3JSO A;  2WY8 Q;  2EA4 A;  3OL3 A;  1I1G A;  1QRY A;  3BZK A;  2BZT A;  2UZK A;  1JJ8 C;  4QPO A;  5HLT A;  2UV1 A;  2P6S A;  4ZZD A;  2QEN A;  2W85 A;  1G4D A;  1JTX A;  3KFW X;  4GXO A;  4EJW A;  4ZYE A;  4IHY A;  2MA3 A;  2NYX A;  4EM2 A;  2NOJ B;  1W7P B;  1QQI A;  4IL6 C;  1IUF A;  3TDU C;  4IRI A;  2BY1 A;  3ZQ7 A;  3F8M A;  2HS5 A;  3DXJ F;  5CVJ A;  4OU0 A;  2DOA A;  2DQR A;  4JOM A;  4DYQ A;  5HLG A;  1MD0 A;  2HFH A;  2KDO A;  2O6G E;  2JVH A;  4B44 A;  4Y7N J;  3PIP F;  2STT A;  5LGU A;  2I10 A;  1R22 A;  4RBO A;  2Y9Z A;  2MGQ A;  4HF2 A;  3BR0 A;  3KP4 A;  2HOS A;  2HYJ A;  1FP2 A;  3R60 A;  4MGR A;  2WAF A;  3HM5 A;  4KN7 X;  4YRV A;  5DTD A;  3S2W A;  3SFZ A;  1ZRF A;  4AYB N;  4PJM A;  4LK1 F;  1JKO C;  1T98 A;  4AID A;  1FLI A;  3F6O A;  1ON1 A;  2WWY A;  4MLO A;  2HPM A;  3V8J A;  1R6R A;  1XGO A;  4FE4 A;  1Z77 A;  5JVT A;  1HW5 A;  1NG7 A;  2DT6 A;  4H4K C;  2XPW A;  4M9S A;  2L01 A;  1JUM A;  4HST A;  3ZQH A;  3D1N I;  3GX4 X;  4K2E A;  4QSH A;  2MD5 A;  2RNJ A;  5DCM B;  2KZG A;  1GUU A;  2DTZ A;  4BKX A;  3S16 J;  3JRF A;  1G3T A;  4RAZ A;  1KU7 A;  3BOQ A;  1B9M A;  4D7N A;  4M6X A;  1T33 A;  3IKV A;  3EET A;  4WK8 F;  1QHH D;  1SMT A;  4FT8 A;  4HSR A;  4BNC A;  1KYW A;  3GTO J;  1N25 A;  2DOE A;  3KEY A;  5FRN A;  2IT0 A;  2FF4 A;  1WJC A;  3LA7 A;  1QA6 A;  5K5Q A;  4QLC U;  4RAY A;  2OTJ I;  4NNJ A;  2KIF A;  3ZQI A;  5HS8 A;  3ZRG A;  4V2G A;  4BJT A;  4I02 A;  3VSK A;  3K2Z A;  5ICC A;  4XKV A;  3VOE A;  2QM3 A;  3AFH A;  4YIF A;  2MD0 A;  5L3E A;  3DU5 A;  4FIS A;  3TOA A;  3F8F A;  3DFG A;  3E0J B;  1G8X A;  4LG3 A;  1K6O A;  5EZG A;  2QBY B;  2LY2 A;  4CCO A;  3WTZ A;  1T38 A;  4XLN F;  5IPA A;  4BXF A;  1ZGA A;  2IEK A;  2DMQ A;  4Y15 A;  2HTS A;  2FOK A;  4KN4 X;  2EA2 A;  3AG4 H;  4I01 A;  3HOW J;  3ABL H;  4A93 J;  2JA2 A;  1IN4 A;  3ZQQ A;  3TO6 A;  3UR3 C;  1JHF A;  2VQL A;  3BQY A;  1YE9 A;  1TP4 A;  3S1M J;  3GZ6 A;  1O7F A;  2W24 A;  3FXR A;  2WAE A;  1WI3 A;  5F27 A;  3JRH A;  2OBP A;  2A68 F;  2L5Q A;  4KT5 C;  5ILU A;  4WWC A;  1X3Z B;  3JRC A;  4HA8 A;  5E17 F;  1SEU A;  1FIP A;  2CWE A;  3QPH A;  2JA8 J;  3I4N J;  1ITY A;  1B1B A;  4KIS A;  4IJA A;  3GXO A;  1U2W A;  1QO0 D;  3GTJ J;  1YQA A;  2DYR H;  4ENJ A;  4UHT A;  2WAQ N;  5CVV A;  3ABU A;  4AYB A;  3LSH A;  4LMY A;  3SEQ A;  3ZMS A;  2PBI A;  3LSJ A;  3MWM A;  2QQ9 A;  3F3X A;  1QZZ A;  3C18 A;  3WU2 C;  3LFU A;  2ISZ A;  2ZME C;  4DOZ A;  3HPH A;  3LAJ A;  2CV1 A;  1DP3 A;  2K3F A;  3G2B A;  3HRS A;  2J5O A;  2BXY A;  4FET A;  4G12 A;  2P81 A;  1LVA A;  5FFX A;  2F4M B;  3KYC B;  1LQ1 A;  4DJA A;  1YW7 A;  1ZTR A;  3HPG A;  4UB8 C;  2E1M C;  4A3F J;  3K70 D;  2GQQ A;  5GPA A;  2ESH A;  2DLL A;  5HLI A;  2AXL A;  1W36 C;  3V8K A;  4R1H A;  3ABK H;  3OV8 A;  2MH9 A;  4EJO A;  4U7B A;  1FOY A;  3LOC A;  3PNY A;  2EV6 A;  4O5V A;  2HXO A;  1I3Q J;  1K7A A;  1W5C C;  5LHH A;  2QEX I;  3TMO A;  2HZD A;  1ZRE A;  3A2K A;  3H0G J;  2JT1 A;  1ETQ A;  1ETY A;  2QKM B;  2YX4 A;  2Z2S B;  3DKX A;  5BMZ A;  2IVM A;  1U5T A;  1T8I A;  2AXT C;  3U9G A;  1FEX A;  1QU3 A;  2ID6 A;  3I54 A;  1JI8 A;  5ICF A;  3I58 A;  2CFX A;  3FXQ A;  1BIA A;  4XON A;  1VQL I;  2RKH A;  3CUQ C;  5C4X J;  4PSX A;  3PFI A;  2LBF B;  3RSN A;  2F2E A;  3VYU B;  5IT9 K;  1O4X A;  4XOT A;  3TED A;  3E6C C;  1ZGW A;  1FMW A;  4YFK F;  4CCN A;  2FBH A;  4EEF G;  5IP7 J;  2F5C A;  2QSH X;  4EM0 B;  2VB6 A;  1IV6 A;  3KZY A;  4RA2 A;  5JHU A;  2KIQ A;  2GOM A;  1UHM A;  3NAU A;  2A07 F;  3JRG A;  3LL7 A;  1ONV A;  1BW6 A;  3K4M A;  2OCC H;  1EH8 A;  2IBD A;  2JQ7 A;  1TWG J;  3L00 A;  4WX9 A;  2L02 A;  2ZJQ F;  1T0F C;  3SZT A;  3B02 A;  5TJJ A;  5FKK A;  1CQT A;  4B8X A;  3HRT A;  3CC7 I;  2DQL A;  3EDP A;  5LHI A;  5H6R A;  2DMT A;  3OWT A;  3OYH A;  2DFF A;  2VQG A;  3LFK A;  2WAQ A;  1H8A C;  3RPQ A;  2TRT A;  2EIL H;  5HVQ C;  1T2K A;  3H3V K;  3HOZ J;  2GIZ A;  2D45 A;  4TV7 A;  1R7J A;  1JJ6 C;  3JRA A;  1J59 A;  4E70 A;  1IXS B;  5JI6 A;  2E7W A;  5J40 A;  5DDG A;  2HQR A;  5E3O A;  4EJV A;  4XRM A;  4P96 A;  3OIQ A;  1WJA A;  4BXU A;  1NHA A;  1WZ2 A;  1TBX A;  3E1S A;  1BJZ A;  2H6C A;  5F1R A;  1MKM A;  1JXS A;  1IW7 F;  3DKY A;  3RYP A;  1UMQ A;  4OAZ A;  1QVU A;  5E3L A;  4AWX B;  4XK4 A;  1OIS A;  1ZEL A;  3G3Z A;  3FMR A;  1QBJ A;  3T8R A;  3H9J A;  3K10 A;  4IOA F;  2L4M A;  3AG1 H;  3T0Y A;  2DBB A;  3E5X A;  2EZI A;  3N4M A;  3BZ6 A;  2UWM A;  2VL8 A;  4RB2 C;  3EYI A;  1R23 A;  3S1Q J;  1Q1V A;  2R7Z J;  1U9N A;  4CZC A;  3KYL A;  1HXD A;  4L9V A;  2P5L C;  3U1K A;  2FSW A;  3M1C A;  2EFO A;  1FWZ A;  3OYE A;  4OIQ F;  1Z3X A;  3I71 A;  4RMN A;  2E1C A;  1D0Y A;  1LE8 B;  2D2W A;  2M7B A;  3WTX C;  2ICW G;  2QSG X;  2E1N A;  4BHP A;  4NQW A;  5DYM A;  1TT5 B;  4NC7 A;  2FQ4 A;  4ENM A;  1ZG5 A;  2PMU A;  2X85 A;  3M8J A;  1MDM A;  2XPV A;  3I9V 2;  1EH6 A;  3GTM J;  3NRV A;  5L3D A;  2IS2 A;  5HDN A;  3ZMT A;  4HDU A;  2NNY A;  2ZXH A;  2A61 A;  2Z1D A;  2EK5 A;  2ZO4 A;  2OD5 A;  2PJP A;  5F08 A;  4ZYA A;  1VQK I;  2HR3 A;  1VQO I;  3LWF A;  3QOE A;  5D5W B;  1P9Q C;  1X2N A;  3HOV J;  1S29 A;  3GBG A;  3P9I A;  2Z33 A;  3ZPL A;  3EUA A;  3BG9 A;  2VJJ A;  4QTR A;  1BIB A;  1F1Z A;  6PAX A;  3HIF A;  1VF9 A;  3J81 Z;  4S04 A;  1R1U A;  1TZL A;  3H9G A;  2EV0 A;  2O7O A;  2ADU A;  5M3F J;  1J9I A;  4U0Y A;  4XL9 A;  4AIJ A;  1R5I D;  2HZT A;  2VKE A;  3QU3 A;  5TGT A;  4EJT A;  4DQ2 A;  1P6R A;  1FYK A;  2X6W A;  3J7A O;  3CP2 A;  2XB5 A;  1T95 A;  2BYV E;  1WWX A;  1ZRD A;  4HOB A;  3LAP A;  4UB6 C;  4I99 C;  4DYC A;  2WA0 A;  2KLO A;  5H6Q A;  1R58 A;  2V6C A;  2E35 A;  3BTJ A;  2FU4 A;  5J4V A;  2LP0 A;  5AIP A;  2CQQ A;  5BNG A;  3GO5 A;  1RR8 C;  2CQK A;  2ELK A;  4H0E A;  2VKV A;  2NOG A;  1DP7 P;  3TW6 A;  3O6B B;  3EYY A;  5FKO A;  4GDF A;  1WPK A;  3OYC A;  2XVC A;  2V79 A;  3WTW C;  3BR3 A;  1I1S A;  3KET A;  3ERM A;  4CGZ A;  1K4T A;  2B7E A;  2GXB A;  2HYF A;  3V8L A;  5GPC A;  2RQP A;  2L9N A;  4HF1 A;  2D1V A;  3BG5 A;  3GTK J;  3VOD A;  1FSE A;  2F4O B;  1T08 B;  1XMX A;  5F0C A;  3RPU A;  1S6L A;  1PYV A;  2DMP A;  4J00 A;  4A0Y A;  2Q2E A;  2LTP A;  4HV5 A;  1IV8 A;  4ESJ A;  2CUZ A;  5CPR B;  3WTT C;  1TLH B;  2X6X A;  1XMK A;  4BS9 A;  1J7K A;  2JUG A;  3HZJ A;  5L3B A;  5E3M A;  3HSE A;  1O57 A;  4BU2 A;  4KMF A;  2DK8 A;  1Y8Q B;  2FRH A;  2TDX A;  4WXC A;  2DK5 A;  1X1P A;  3A0H C;  4E6K G;  2LD5 A;  1DUX C;  1HDD C;  2O8X A;  2XKP A;  5HDG A;  5EEA A;  1FOW A;  1P7J A;  3E6M A;  1Y6I A;  2DPD A;  1YRN A;  3QYF A;  1V5F A;  2XGC A;  2DOF A;  2ZC2 A;  2WBM A;  2F48 A;  2DOD A;  1H9G A;  1SD4 A;  4I0B A;  4BGD A;  2HDD A;  1SD6 A;  2JZY A;  3MFK A;  2O9L A;  3P5J A;  5EEH A;  3FXM A;  4AVZ A;  4BE1 A;  3MKL A;  2KHM A;  2BBY A;  2ZJR F;  4BHC A;  3BCB A;  1S72 I;  5FLV A;  5JLX A;  3G73 A;  1RNL A;  4LIU A;  4WXD A;  3R61 A;  5BQT A;  4I0A A;  3L09 A;  3WE3 A;  3CDI A;  3LSM A;  1BJA A;  2R5Z A;  1ORK A;  2GXA A;  2LMD A;  1AHD P;  3ASN H;  2J5P A;  5EDN A;  2KRC A;  5LD2 C;  1XPX A;  4N0B A;  3K4N A;  2KIM A;  2E5Z A;  3B6A A;  3ZOB A;  4L9T A;  4Q4Z F;  2K9S A;  2P5V A;  5JHF A;  3FBI B;  3HUG A;  4B4C A;  4HEA 2;  3MZY A;  5J1Y A;  2CV0 A;  3ZR8 X;  4ZYG A;  2ZBK A;  5EGO A;  2X6Y A;  1J0R A;  2VBW A;  1SFK A;  4PFP A;  1G3W A;  3RQI A;  3RZO J;  2VN2 A;  4Z6Y A;  2LRE A;  1SVM A;  3NWS A;  5CVI A;  1ZH5 A;  2JA5 J;  4NUB A;  2XPU A;  2CV2 A;  3FKJ A;  1M1E B;  1DPR A;  3IUO A;  4CZZ A;  2XRO A;  3S8P A;  1TQP A;  3E6D A;  1E3H A;  4MTE A;  3ZQG A;  4AIH A;  3JRE A;  1A6Q A;  3P7N A;  4ZZL A;  3PQJ A;  5EJC A;  4MEY F;  4ENK A;  3OYI A;  4C9Y A;  2PJR A;  2Y0M A;  2VKD A;  4XRS A;  3FBN B;  3M1E A;  1F9N A;  2VBY A;  3R0J A;  1KQ9 A;  3A0B C;  3OIP A;  2QWW A;  3AG2 H;  1HKT A;  4XLH A;  2R5Y A;  2QLZ A;  3ISP A;  1AU7 A;  4MFD A;  4PJJ A;  5EYR A;  5FKN A;  1YIJ I;  5IYC J;  3K2A A;  1WFX A;  2AQE A;  1R1V A;  2JSC A;  3OOP A;  2H27 A;  2BHZ A;  4GO1 A;  2CG4 A;  3BG6 A;  2OA4 A;  1Y8R B;  2X0L A;  2FOW A;  1BR1 A;  3BJ6 A;  4DNC A;  2JRT A;  2LLK A;  1YW8 A;  3KLN A;  4M6Y A;  1YJW I;  3WGG A;  4CYC B;  3CME I;  1UFM A;  3Q0U A;  5IP9 J;  1YOV B;  2ECB A;  3W2W A;  1OYI A;  3ABM H;  3FXU A;  3IWF A;  4QWQ A;  4BDY A;  1FYL A;  2OZ6 A;  5ILV A;  4L0Y B;  1JUP A;  1A5J A;  2EPF A;  1WCM J;  3GTG J;  3PSF A;  3BR5 A;  2VE9 A;  3R4K A;  1A36 A;  2MAB A;  1UHW A;  2Y9Y A;  3CO7 C;  1Y0N A;  4DBR A;  2H8R A;  2E71 A;  5KCM A;  1MSE C;  5EG0 A;  2IAI A;  3F23 A;  2B0L A;  1ZK8 A;  3VYS B;  5L3C A;  4C2T A;  5FRM A;  4Q5S F;  4A3J J;  2CSO A;  3K9T A;  5IT3 A;  1RKW A;  1MH4 A;  2L2O A;  3FXJ A;  2EV5 A;  4RGX A;  2A6H F;  5F04 A;  4C3I J;  4RGR A;  1NK2 P;  2LSO A;  2DFI A;  1XG1 A;  2JRM A;  1ACI A;  3QP5 A;  1D1A A;  2XAH A;  5E1W A;  5IYB J;  4M3B A;  2VPL A;  4E7H A;  1FOK A;  2M8G X;  1HST A;  2O5R A;  1MND A;  2XAG A;  1LJ9 A;  4D5F A;  3SJM A;  1VQ9 I;  5B1A H;  4ITV A;  4B1R A;  1IRG A;  1F5T A;  2P7V B;  3KEO A;  1N75 A;  1XSD A;  5ICE A;  3J7Z I;  1FY7 A;  1IN8 A;  4HX8 A;  4RB1 A;  4QIW N;  2MW8 A;  4IHX A;  1RKT A;  4XM3 A;  1HSJ A;  3AAF A;  1YHQ I;  1SFO J;  3B73 A;  1DPU A;  3M07 A;  3I0T A;  4KT6 A;  4L5I A;  1C0W A;  3DKW A;  3U1D A;  2X1C A;  1WQ2 A;  2ESN A;  3FK6 A;  3HGY A;  3PJR A;  4DYR A;  1TQI A;  1BI0 A;  2FJ1 A;  2XHK A;  4A6D A;  2K9L A;  5E20 A;  1Q1H A;  5JVG F;  2XIG A;  5J1R A;  4XOR A;  2XAF A;  3S14 J;  3RJP A;  1RUN A;  3VDX A;  3CCM I;  1I3A A;  4IRH A;  2V1U A;  3PL8 A;  3CCQ I;  5CQG A;  1MBE A;  1U0J A;  3HSF A;  3WGH A;  2LK2 A;  1GDT A;  2KJC A;  1GV5 A;  2QGU A;  2I8D A;  5GTI C;  2M1B A;  5J8C A;  3MMY B;  1U5T B;  2H09 A;  2O3F A;  1W36 D;  3VWB A;  3OYM A;  1U78 A;  3MCZ A;  1UST A;  4M9Z A;  3QPL A;  1ZGJ A;  4LGW A;  2L9R A;  3PM1 A;  4BBR J;  3CF5 F;  1FC3 A;  2FUG 2;  4CXF A;  2Z5U A;  5HOO A;  3GF2 A;  3GLX A;  3IH2 A;  3LQQ A;  2NS7 A;  1UZC A;  5HLH A;  5DCF A;  1Z9C A;  4A12 A;  2KP6 A;  1OR7 C;  2L7F P;  4IZZ A;  4EAT A;  2DPU A;  4X6A J;  3SYT A;  2FE3 A;  3RKY A;  3ULQ B;  2QQB A;  3PNT A;  1LPQ A;  3QP6 A;  2O03 A;  1NK3 P;  2VON A;  2E2H J;  4M6V A;  4A3C J;  2OC6 A;  3LSP A;  1ZN2 A;  3DU6 A;  2QA4 I;  1S9H A;  4Q47 A;  3S2D J;  3U2R A;  1BN5 A;  5B1B H;  1RET A;  1N77 A;  2LF8 A;  4RDU A;  2EIJ H;  1EA3 A;  1OLT A;  3S2H J;  4D5C A;  4ZTF A;  4M3F A;  2GLO A;  2ZXJ A;  5E79 C;  1W1W E;  3OYA A;  1HC8 A;  3FMS A;  2LKP A;  3PFY A;  1JKQ C;  1APL C;  4MHG A;  3OSG A;  2ZCW A;  2EWN A;  3K4K A;  1BC8 C;  2IS4 A;  2K9N A;  3BR6 A;  3BY6 A;  1R00 A;  2HQ5 A;  4W1U A;  4LLL A;  3VEP A;  4HQM A;  5GTH C;  2CYY A;  1K78 A;  3DTK A;  2G0E A;  3MQ0 A;  2LR8 A;  4ESF A;  4CA0 A;  4U88 A;  4N4N B;  1AKH A;  3LNQ A;  2YS9 A;  2YU3 A;  2KFD A;  2RN7 A;  3DLA A;  1Y0U A;  1GXQ A;  3CC2 I;  1Z6T A;  4JX6 A;  1S7A A;  3OYN A;  2LKS A;  3GEZ A;  4L0Z B;  1JHH A;  2KMU A;  3WTS C;  2QKL B;  1IDY A;  5JR3 A;  2JA7 J;  2ZKZ A;  2DA4 A;  2GXG A;  2EFW A;  2Z99 A;  4RB0 A;  2FBI A;  4Y52 J;  4RGU A;  1G3S A;  3T5X A;  2X6O A;  1NH3 A;  1FIA A; 
#chains in the Genus database with same CATH homology
 2ME6 A;  1BJZ A;  1UHS A;  3TP3 A;  1TWA J;  1UMQ A;  3G1M A;  2LFB A;  4C3J J;  1TWC J;  1QVU A;  5K7Z A;  4JX5 A;  5E3L A;  4XK4 A;  3BG3 A;  2E1O A;  2CUF A;  3TW7 A;  1HF0 A;  3I4M J;  1FTT A;  3O8H A;  2DMN A;  3HOY J;  4X1E A;  2EZI A;  5FJ8 J;  3B6C A;  3S1Q J;  2L7Z A;  2JA6 J;  1Q1V A;  2EZL A;  2R7Z J;  1U9N A;  4UUS B;  3JRD A;  1B8I B;  3A03 A;  1JKR C;  3HGG A;  5GP9 A;  5J3L A;  3QPS A;  1E3O C;  1QVT A;  1MSF C;  2NVX J;  3LSR A;  2NVQ J;  1IG7 A;  3BTI A;  3HOU J;  1S7E A;  4MO7 A;  1G2H A;  3PO3 J;  1LE8 B;  3HOX J;  2QF7 A;  2Y0S N;  3VPR A;  4S0H B;  2ECC A;  3CCY A;  1X58 A;  2OF7 A;  3JRB A;  4UUS A;  5M3M J;  2FQ4 A;  1B8I A;  2YUS A;  3LSG A;  3OIO A;  2XPV A;  3GTM J;  4M3E A;  2CUE A;  1HOM A;  4D7M A;  5JLW A;  2W48 A;  2XB0 X;  2D5V A;  4A3I J;  2K9Q A;  4IHW A;  3GTP J;  1LE8 A;  2NVT J;  1TWH J;  2JWT A;  5F08 A;  5EF6 A;  1WH7 A;  3WHB A;  1X2N A;  3HOV J;  3GBG A;  1POG A;  1FJL A;  2AO9 A;  3BG9 A;  4QTR A;  4I6Z A;  2M0C A;  1VF9 A;  5FKL A;  3OOU A;  4IEJ A;  2O7O A;  5M3F J;  1JT0 A;  3S1N J;  1Z0X A;  2VKE A;  2R92 J;  2B63 J;  1VND A;  2EH3 A;  3ZQF A;  3TP0 A;  2XB5 A;  3L1P A;  3M4O J;  2O8K A;  1RPW A;  4FTH A;  1A6I A;  3A01 B;  1GT0 C;  1BL0 A;  4DYC A;  2YU9 J;  1XC5 A;  3BTJ A;  1MBF A;  2XGE A;  1Y1W J;  1WGX A;  4A3K J;  2LP0 A;  2CQQ A;  5BNG A;  1EF4 A;  1U8B A;  3G1O A;  2ELK A;  1Y1V J;  2VKV A;  2NOG A;  1UG2 A;  2M9H A;  2HOT A;  3TW6 A;  2JK3 A;  5M5X J;  5FKO A;  2EBI A;  2CQX A;  1WPK A;  3A01 A;  4AC0 A;  3BR3 A;  3BTL A;  4DZJ A;  5IOZ A;  3HBL A;  3HB9 A;  2KDZ A;  2E2J J;  2CU7 A;  3Q0V A;  5GPC A;  1MBK A;  1K83 J;  4A3G J;  5M5W J;  4HNV A;  3BG5 A;  4BY1 J;  3GTK J;  1SAN A;  3NAR A;  5C44 J;  2HXI A;  2ME0 A;  1X2M A;  2CJJ A;  5F0C A;  3M3Y J;  2DMP A;  4CYC A;  2LTP A;  3FK7 A;  1ETO A;  1MBH A;  4M3D A;  1B72 B;  1QPI A;  1OJL A;  1PUF B;  5HOD A;  3UKG A;  1YRN B;  2AHQ A;  4C2M J;  1JGG A;  1I6H J;  5E3M A;  4XID A;  2ID3 A;  4MIM A;  4UUT A;  1H88 C;  4V2F A;  5E3N A;  3CDL A;  3Q0W A;  3K7A J;  1HCR A;  2JN6 A;  2LD5 A;  1B72 A;  1HDD C;  5EEA A;  2GBY A;  1P7J A;  1PUF A;  2Y2Z A;  2R5Z B;  1YRN A;  5IOY A;  2XGC A;  2H1K A;  2VUM J;  3DCF A;  2TCT A;  2HDD A;  3ZQL A;  2XRL A;  2O9L A;  2WB1 N;  1ETW A;  3MKL A;  5FLV A;  4A3E J;  5JLX A;  1IDZ A;  5EGO B;  3PO2 J;  1ENH A;  4ABZ A;  2M2E A;  2R5Z A;  1ORK A;  1AHD P;  4JP0 A;  5EDN A;  1WH5 A;  5K7F A;  1QRY A;  3B6A A;  3ZOB A;  4M3G A;  1MNM C;  1JJ8 C;  2K9S A;  3BQZ A;  4B4C A;  1MBJ A;  1JTX A;  2VI6 A;  4IHY A;  5J1Y A;  4A3L J;  2E19 A;  5EGO A;  3SFI A;  1IUF A;  3RQI A;  3RZO J;  2DN0 A;  4LOC A;  1OFC X;  3A02 A;  4DYQ A;  1W0T A;  2JA5 J;  2XPU A;  4Y7N J;  4GFB A;  2R5Y B;  2I10 A;  4RBO A;  2Y9Z A;  2MGQ A;  1GV2 A;  3BR0 A;  3ZQG A;  2HOS A;  2HYJ A;  3JRE A;  4JYK A;  5F1J A;  1IRZ A;  3HM5 A;  3CMY A;  3CQZ J;  2JJ7 A;  2OPT A;  5DTD A;  5FKM A;  4AYB N;  1JKO C;  3W6V A;  4XRS A;  4A69 C;  4MLO A;  4FE4 A;  2R5Y A;  1Z77 A;  1H89 C;  1IC8 A;  1AU7 A;  4MFD A;  2LKX A;  5EYR A;  5FKN A;  2WV1 A;  5IYC J;  2XPW A;  3K2A A;  1JTY A;  3WHC A;  1JUM A;  3S15 J;  3ZQH A;  2L7M P;  3D1N I;  1XS9 A;  1IJW C;  3BR2 A;  1GVD A;  4QSH A;  5C3E J;  2CRG A;  4I76 A;  2XSD C;  4W97 A;  1GUU A;  2DTZ A;  2EQR A;  2MSY A;  2LLK A;  5M5Y J;  4BKX A;  2GM4 A;  3S16 J;  3IH4 A;  3JRF A;  4CYC B;  2HOA A;  3Q0U A;  5IP9 J;  5EG0 B;  2ECB A;  4D7N A;  1T33 A;  4BXX J;  2X48 A;  2FD5 A;  2R93 J;  3GTO J;  1RES A;  1JUP A;  1A5J A;  1WCM J;  3GTG J;  2ZB9 A;  3BR5 A;  1JUS A;  1ETX A;  2DA2 A;  3ZQI A;  4V2G A;  1MH3 A;  2DA1 A;  2Y9Y A;  2H8R A;  5J1U A;  3FKI J;  1MSE C;  1IGN A;  2MG4 A;  5EG0 A;  2IAI A;  1RR7 A;  3RKQ A;  1ZK8 A;  4FIS A;  4IHV A;  2X9D A;  4A3J J;  1DU6 A;  3S1R J;  1RKW A;  1MH4 A;  4JX4 A;  5EZG A;  5IPA A;  5F0H A;  5F04 A;  4C3I J;  4A3M J;  2IEK A;  1NK2 P;  3GTL J;  2DMQ A;  3ZQC A;  3BTC A;  1XG1 A;  3HOW J;  4FCY A;  2DJN A;  4A93 J;  5IYB J;  4M3B A;  2M8G X;  4D5F A;  3SJM A;  2R0Q C;  3JRI A;  4B1R A;  3BQY A;  2VPR A;  3S1M J;  4A3B J;  5FLM J;  3Q3S A;  1WI3 A;  2QCO A;  2LY9 A;  5F27 A;  4QIW N;  2MW8 A;  3JRH A;  1RKT A;  1SFO J;  4IHX A;  9ANT A;  4BY7 J;  5DS9 A;  2NS8 A;  1BW5 A;  3JRC A;  3RZD J;  1TWF J;  1T56 A;  1FIP A;  2Y30 A;  5IP6 A;  4AUX A;  3O8G A;  5F0F A;  2JA8 J;  3I4N J;  1ITY A;  1ZKG A;  3FK6 A;  2EZH A;  3HGY A;  3GTJ J;  1VFC A;  2WAQ N;  3BT9 A;  1DU0 A;  4DYR A;  4XRS G;  2FJ1 A;  2HI3 A;  2PMZ N;  2KT0 A;  3LSJ A;  1D5Y A;  1LFU P;  5J1R A;  3S14 J;  1NTC A;  4XIC A;  3HEF A;  1ZR4 A;  4G12 A;  1I50 J;  4MFE A;  3SDG A;  1TC3 C;  4DZP A;  2P81 A;  1R9T J;  3S17 J;  1MBE A;  3OSF A;  3HDD A;  4L5E A;  4C3H J;  3BR1 A;  2LK2 A;  1ZQ3 P;  1GDT A;  2LVS A;  1K61 A;  1ZTR A;  1GV5 A;  2L0K A;  3HKZ N;  4A3F J;  4BBS J;  3QQA A;  2XGD A;  4FE7 A;  5GPA A;  2JMW A;  1U78 A;  2Y31 A;  3QPL A;  5C4J J;  2L9R A;  3PM1 A;  4BBR J;  3LOC A;  3IH2 A;  2NS7 A;  2HXO A;  1I3Q J;  1P7I A;  4A3D J;  3H0G J;  1ETQ A;  1ETY A;  3G1L A;  3DEW A;  2L7F P;  3F0C A;  3MVP A;  4X6A J;  1FEX A;  2NVY J;  2ID6 A;  3FIS A;  5C4X J;  1HDP A;  2DMU A;  1NK3 P;  1JKP C;  2E2H J;  4M6V A;  1W0U A;  1ETK A;  4A3C J;  1ZR2 A;  1O4X A;  2DA7 A;  3TED A;  2DA6 A;  3LSP A;  1ZGW A;  4EEF G;  5IP7 J;  2M34 A;  3S2D J;  1U9O A;  1OCP A;  1RET A;  1IV6 A;  1AKH B;  1F36 A;  4RDU A;  3S2H J;  4D5C A;  4M3F A;  2GLO A;  3E7L A;  3JR9 A;  3NAU A;  3GTQ J;  1F43 A;  3JRG A;  1HLV A;  1JKQ C;  1APL C;  3OSG A;  1BW6 A;  2K9N A;  3BR6 A;  2N8G A;  2IBD A;  2HQ5 A;  2RAE A;  4W1U A;  3FIW A;  3MN2 A;  1TWG J;  1ETV A;  2G0E A;  2LR8 A;  5FKK A;  2K40 A;  2E2I J;  1CQT A;  2DA5 A;  1AKH A;  1LFB A;  3IV5 A;  2YS9 A;  1VI0 A;  3LNQ A;  2DMT A;  2DA3 A;  5K7H A;  4DW6 A;  1H8A C;  4JX6 A;  1MBG A;  2TRT A;  3H3V K;  5IYD J;  3HOZ J;  5EZH A;  3IH3 A;  1FTZ A;  1IDY A;  4B3A A;  2JA7 J;  1JJ6 C;  3JRA A;  1OCT C;  1JT6 A;  2DA4 A;  2COB A;  4NDL A;  3C2B A;  2EZK A;  5E3O A;  1BA5 A;  4XRM A;  2FX0 A;  4Y52 J;  2X6O A;  4J19 A;  1FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...