4A3DJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3dJ00
1A5JA 2E2JJ 3BR2A 3Q0WA 3GTLJ 1W0UA 2KDZA 1OCTC 3HOYJ 1WI3A 2XB5A 2JA5J 4UUSB 5K7HA 3LNQA 2IBDA 1T56A 2Y9ZA 5E3NA 1I6HJ 2M2EA 5IOYA 1ETKA 5EDNA 5EG0B 1MBHA 3RQIA 4Y7NJ 1GUUA 4A3LJ 5GPCA 1A6IA 2YU9J 2QCOA 4S0HB 1EF4A 2R7ZJ 2VKEA 2DMNA 1JGGA 4A93J 1B72B 4Y52J 2COBA 2L7FP 2JMWA 2LK2A 3LSPA 5M5XJ 2ME6A 2WV1A 5K7FA 2LKXA 1QVUA 2XPVA 3BTCA 1WCMJ 1G2HA 2DMPA 2XPUA 2ECBA 1QPIA 4MFEA 4DYRA 1CQTA 2E2HJ 1U9NA 4MFDA 4RDUA 1U8BA 4AC0A 3G1MA 1UMQA 3BR0A 2WB1N 1BJZA 2GBYA 1JUSA 3S2HJ 2XGEA 2CUFA 2LTPA 3ZQFA 3GTQJ 1YRNB 3S14J 1IJWC 1PUFA 3I4NJ 1WGXA 2NVXJ 3WHCA 2DA6A 2JA7J 4FE4A 1ZK8A 3OSGA 1AKHA 1RKWA 4UUTA 5C4XJ 2EQRA 4A3CJ 5J3LA 4XRSA 1TC3C 1GVDA 4A3IJ 2TRTA 4ABZA 4B1RA 3NAUA 2JWTA 1AHDP 1X2NA 4HNVA 3S1MJ 2B63J 4G12A 1F43A 2L9RA 2XPWA 4FTHA 2XGCA 3BR5A 1U78A 1IGNA 1ETVA 4D5CA 4M3DA 3BTIA 3FK6A 5JLXA 5F0CA 2FJ1A 4X6AJ 4M3EA 3H0GJ 5F08A 3SFIA 1UG2A 5E3MA 4LOCA 3HOVJ 4C3IJ 4M3FA 3FISA 3IH2A 4JX6A 2M9HA 4D5FA 3A02A 4IHYA 2Y9YA 3B6AA 1ZR2A 1JKRC 3IH4A 2R92J 1XG1A 3PO3J 1BL0A 1ETYA 1JTXA 2JA8J 1MBJA 3BTJA 3Q3SA 3DEWA 5EGOB 3TW6A 2CJJA 1TWFJ 2OF7A 4EEFG 3JRGA 1HOMA 2R5YB 2EBIA 2XGDA 3HM5A 5IP6A 2O9LA 1XS9A 3FIWA 2Y2ZA 1RKTA 2HYJA 5F1JA 2FD5A 4JX5A 3K7AJ 3BR1A 2XB0X 4IHVA 1JJ8C 1GV2A 2CU7A 1LFBA 2O8KA 1FIAA 3GBGA 5F04A 3ZOBA 4JYKA 3O8HA 4A3FJ 2LLKA 5HODA 3GTGJ 2DMTA 3S15J 1OFCX 2D5VA 2R0QC 3LSJA 2HOAA 2JJ7A 1X2MA 5IYCJ 2Y31A 2CUEA 1JJ6C 4DZPA 3JRBA 1IC8A 3HDDA 1P7IA 2MG4A 1MBGA 1IUFA 1HDPA 4CYCA 5C3EJ 3TEDA 4DYQA 2G0EA 2E19A 4BY7J 2K9NA 1GV5A 1JT0A 1ITYA 3BQYA 2K40A 3OSFA 5E3OA 2FQ4A 1BW6A 4C2MJ 2RAEA 1LE8A 2DA7A 2R5ZA 2M34A 2GM4A 3SDGA 5IOZA 4A69C 4X1EA 3RZDJ 1W0TA 3HGGA 1LFUP 3A03A 4XRSG 3S1QJ 1ETWA 3GTKJ 2CRGA 3HOXJ 2LY9A 1PUFB 3HGYA 3BG5A 5EZHA 3ZQCA 1QRYA 2DJNA 1AKHB 2X9DA 4MO7A 5J1UA 3JREA 1QVTA 3JRFA 4IHXA 2MSYA 1B8IA 4JX4A 5F27A 1VF9A 1ZGWA 4BBSJ 1SFOJ 2DN0A 3CCYA 5K7ZA 1H8AC 1TWHJ 1JKPC 5IP9J 4BXXJ 1JUMA 2LD5A 1BA5A 2L7ZA 4D7MA 1K61A 1H89C 1F36A 2AHQA 1JTYA 3OOUA 2L0KA 1AU7A 2H1KA 3BQZA 2ECCA 2CQXA 4XRMA 2ID3A 3GTMJ 5FKLA 3HOWJ 2HOSA 1IDZA 2JN6A 1POGA 4RBOA 1FIPA 4A3MJ 9ANTA 4XK4A 1X58A 3QPSA 1MH4A 3W6VA 5IPAA 3A01A 1Y1VJ 2VUMJ 1RPWA 1JUPA 3BT9A 3LSRA 4J19A 5FKOA 2VPRA 1VI0A 1IRZA 2DA2A 3NARA 3S1NJ 1ORKA 3PO2J 4V2GA 5DS9A 2KT0A 2GLOA 2HQ5A 1RETA 1ZR4A 1HF0A 1VFCA 3S16J 4A3JJ 1R9TJ 5FLVA 2P81A 2MW8A 5IYBJ 3M3YJ 3MVPA 2AO9A 3F0CA 1FJLA 2DMUA 3BG3A 3S1RJ 4A3DJ 2VKVA 5JLWA 3ZQLA 2NVTJ 1U9OA 5FKKA 2H8RA 1XC5A 1VNDA 4XIDA 1ETOA 2CQQA 3JRDA 1D5YA 4B4CA 4BY1J 2Y0SN 3DCFA 3H3VK 4FCYA 1GT0C 2EZLA 1BW5A 3JRAA 4DZJA 3RZOJ 4I76A 1O4XA 2DA5A 2EH3A 1MNMC 1JKOC 2LVSA 1P7JA 1NK2P 1WPKA 5EEAA 3G1OA 2OPTA 3TP3A 1IDYA 2DMQA 3PM1A 1K83J 1JT6A 3HOZJ 3IH3A 1RR7A 3BR6A 5FKMA 5EYRA 1Z0XA 5J1RA 4DYCA 2LFBA 4CYCB 1ETQA 3FKIJ 3BG9A 1ENHA 1FEXA 5BNGA 4W1UA 2EZIA 3VPRA 1ZTRA 4MLOA 1S7EA 3D1NI 2E1OA 2K9QA 2M0CA 1LE8B 5M5YJ 4BBRJ 2R5ZB 4L5EA 5FLMJ 4IHWA 1MH3A 5F0HA 1GDTA 4UUSA 2HOTA 2HXOA 2NVYJ 1WH7A 2NS8A 2YUSA 3CQZJ 2JK3A 2QF7A 5IP7J 1IG7A 1FTZA 1HCRA 5FKNA 2XRLA 2YS9A 4AYBN 2N8GA 3ZQGA 3LSGA 5EG0A 1I50J 1IV6A 3TW7A 2W48A 3Q0VA 4NDLA 4MIMA 2IEKA 1TWAJ 2DTZA 1ETXA 1Y1WJ 4I6ZA 1B8IB 1B72A 1SANA 3CDLA 4C3JJ 3HBLA 1MBEA 2NOGA 4V2FA 2LP0A 1MSFC 3JR9A 3HOUJ 1MBFA 5EF6A 2XSDC 1WH5A 2NS7A 1DU0A 5EZGA 1FTTA 3Q0UA 2X48A 2X6OA 4AUXA 4A3EJ 2HXIA 1JKQC 3CMYA 3FK7A 1YRNA 5M3FJ 3ZQHA 4FE7A 4B3AA 4A3BJ 3G1LA 3TP0A 5M3MJ 3GTJJ 3MKLA 5DTDA 4BKXA 3S17J 1H88C 3E7LA 2DA3A 1ZKGA 2HDDA 3O8GA 3JRIA 4DW6A 2WAQN 3LOCA 2L7MP 1Z77A 3HKZN 3L1PA 3UKGA 3A01B 4QSHA 2MGQA 2JA6J 2FX0A 4W97A 1TWGJ 2LR8A 1OCPA 3SJMA 1Q1VA 2ME0A 4A3GJ 3WHBA 2EZKA 2DA1A 5FJ8J 5C44J 3MN2A 2Y30A 4XICA 3GTOJ 1ZQ3P 2E2IJ 1UHSA 2ZB9A 2HI3A 3ZQIA 1T33A 3S2DJ 3GTPJ 2VI6A 2TCTA 2O7OA 1I3QJ 3RKQA 2PMZN 3JRHA 4FISA 5E3LA 3C2BA 3HEFA 3OIOA 4IEJA 5J1YA 3I4MJ 3HB9A 2R93J 2ELKA 3K2AA 4C3HJ 1MSEC 3QQAA 5F0FA 4QTRA 3BTLA 3B6CA 3M4OJ 5C4JJ 5M5WJ 4M6VA 5EGOA 5IYDJ 2ID6A 1NK3P 4M3GA 4D7NA 2R5YA 2DA4A 4GFBA 1E3OC 1NTCA 1TWCJ 5GP9A 4JP0A 3IV5A 4A3KJ 1RESA 1HLVA 2EZHA 2NVQJ 2M8GX 1APLC 4QIWN 1HDDC 5GPAA 1OJLA 2I10A 3QPLA 1DU6A 3JRCA 2IAIA 1MBKA 2K9SA 4M3BA 3BR3A
chains in the Genus database with same CATH superfamily
1A5JA 2H09A 4OIQF 1SVMA 1D0XA 3GTLJ 5D4RA 3HOYJ 1WI3A 3KZIC 2DOFA 3CUQB 1M1EB 1TTYA 4RAFA 3SZPA 2VC1A 5E3NA 2WWYA 1J5YA 4BE2A 1OQYA 4XOPA 4Q48A 3KYDB 1WJEA 4CUGA 2P0WA 5EDNA 1WFXA 4O6JA 4EMSA 4RAZA 1FOYA 2Q0OA 3IC7A 5DCMA 3M07A 4HW0A 2R7ZJ 2VKEA 2KJBA 1JGGA 2F5CA 2JVHA 3FXMA 2LYCA 1D0YA 4PGHA 3B02A 3SZTA 1FT9A 3VYTB 2L7FP 4BJTA 3CMEI 5M5XJ 4G9YA 2BGCA 1E2XA 2E7WA 2DMPA 2ESNA 2XPUA 2ECBA 1CQTA 4BYYA 4RAGA 2IGOA 3GWZA 4RGRA 3BR0A 2WB1N 2WADA 4N4OB 2EFNA 3UR3C 2ZXWH 2HKOA 4YIIA 3HTSB 4CZZA 4AWXB 2DPDA 4RGXA 2F5FA 1K6YA 4M6XA 1WJBA 2HU9A 5HS9A 5C4XJ 1AKHA 1BIAA 3KIOA 2EQRA 4BQOA 2HKXA 4I99C 4A3IJ 3E6DA 5B1BH 5JI6A 2E71A 3C7JA 2EB7A 4B1RA 1E17A 1TL8A 4RGSA 4F93B 4PJJA 2DBBA 1VQMI 4CHUA 1DPUA 4FTHA 5JVTA 3KFWX 4PGGA 4XR6A 3FK6A 1P9QC 5JLXA 3BJ6A 1P92A 2NNNA 4EATA 3ZPLA 3FKJA 5E3MA 4LOCA 5DD8A 1TQPA 4HQMA 1ZG3A 2OAZA 1W4MA 1KZHA 3CDIA 2COMA 5J6XA 4HX8A 5F6FA 3BZCA 4JX6A 2VPLA 3VYRB 5CQEA 5FGMA 2Y9YA 3H9QA 2H6BA 4BJ5C 1ZR2A 1S3JA 1UHWA 4OIRF 3PO3J 3REOA 4ZDPA 3WTZA 1ETYA 1JTXA 2ZMEB 2LOOA 3KP4A 5HS8A 2RVCA 3DEWA 2OCCH 5EGOB 1S7OA 2CJJA 3F6OA 4EEFG 4MTEA 1SD5A 3HRSA 3SZGA 1UB9A 1LPQA 3CZ6A 2A05A 1SAUA 4IPAA 1F4KA 5F1RA 1O7LA 2R7SA 2A6TA 4B09A 5F1JA 3TOBA 1DDNA 1HKQA 5L3GA 3GLLA 1KYWA 2XB0X 1JJ8C 3IAS2 3O2PE 2CU7A 1GXPA 2D2WA 1LFBA 2DOAA 2DK5A 1FIAA 2J5PA 4D1QA 4QPOA 2EFQA 4BUPA 1SFXA 3TDUC 1ZREA 3GTGJ 3S15J 2X1EA 3BZ6A 3HUGB 3DP7A 2R0QC 3PNYA 2PG4A 5IYCJ 2Y31A 3JRBA 1IC8A 1VQ9I 1SFUA 3MZYA 1XCVA 2TDXA 3EYYA 1ZLJA 2NOJB 2ZBKA 3Q9SA 3FM3A 4QPQA 2GOXB 3HTUA 3I59B 5C3EJ 4DYQA 1MGTA 3TEDA 2E19A 4BY7J 5DYMA 3GZNB 3I54A 1ITYA 3BQYA 3OSFA 5E3OA 1EA3A 4TV7A 2BY1A 3CTAA 3GMEA 3SHFA 2RAEA 1S29A 3V8KA 1R5ID 2L9NA 1WJFA 2GM4A 2FBHA 2IT0A 3SDGA 1X4PA 5LEKA 1YO5C 1HKTA 2QEXI 3U2RA 3A03A 4XRSG 3BROA 3J80K 1GXQA 1BC7C 1Y56A 2Z99A 1VQOI 3OV8A 4K2EA 3DTKA 2ELJA 1PUFB 4PJ0C 1OCOH 5EZHA 1ZG1A 4ZH4F 1NHAA 3EYIA 1QRYA 3H3ZA 1UJ8A 2DJNA 4XSXF 2W82A 1YFHA 5JR3A 2CYYA 5LRRA 3BPVA 2XAQA 3FM5A 3JREA 1IN4A 3MQ0A 1K6OA 2ZJRF 1Z9CA 1B8IA 1T8IA 3IKTA 1VF9A 2RN7A 3VYSB 4HAMA 3V7SA 3U1DA 1F9NA 3K10A 4ESBA 4BXXJ 3L09A 4KJZA 2LD5A 2L7ZA 4YRVA 4D7MA 1F36A 2BVLA 4RB1A 1DUXC 3DEEA 3J7YJ 2HWVA 1AU7A 1O3QA 4OU0A 2UXXA 4IVNA 2QBYA 2PJPA 3T1BA 3CCMI 1YW7A 2OJED 1O3RA 3LQRA 2CQXA 2QSHX 2STWA 5FKLA 2MD0A 5HS7A 2HOSA 1I6XA 2DFEA 3VWBA 2JN6A 4MGRA 4A3MJ 1G3YA 1FIPA 4RBOA 2X6XA 1K78B 4YIRX 1UELB 1X58A 3FBIB 2E34A 2NXNB 2JPCA 3PIOF 5IPAA 3D5SC 5GAGJ 3DU5A 2FOKA 5D5VB 3LSRA 4UB6C 3F6VA 4AYBA 5FLXK 1IRZA 4LB5A 4GYIA 4L5JA 3JW4A 5CVIA 2CQNA 4RB2C 1WSUA 2KT0A 3DU6A 4CDGA 3HPGA 2RNGA 3GLXA 4WXDA 1VFCA 2CV1A 1HC8A 3WTWC 2MW8A 4RAYA 1TZLA 3HOSA 3KP5A 1Y0UA 4IO9F 3BG3A 3ISPA 1TW2A 2ACJA 3MZ8A 3L2WA 2BOLA 1HW2A 3R61A 2FUG2 1B9NA 4XONA 1FLIA 1T38A 4BY1J 2OUMA 3KLOA 2QKMB 1J59A 4AU7A 4AVZA 2EZLA 5LGNA 4LLNA 5ICEA 2OA4A 2M7AA 3JCUC 1JKOC 2LVSA 2DCEA 2EA4A 3C1DA 1SEUA 1IRXA 3KP2A 1D1AA 1N78A 3ZN0A 1IDYA 1D3YA 4II3A 3HOZJ 3IH3A 2O0YA 2ZKZA 3E97A 1A6QA 5EYRA 1LEBA 4DYCA 1HQCA 3JSOA 2MH2A 2Q8KA 2A6EF 2V1UA 5E18F 1Y8RB 5CYVA 5CVRA 1FEXA 4Q4ZF 3DTEA 3HSFA 3IWFA 2OQRA 2DDAA 5FRMA 3H3UA 1W7PB 1MW7A 3D1NI 2VKDA 2K9QA 1L0OC 2M0CA 3K4BA 3RYPA 2V1DA 2R7VA 4Y17A 4XOTA 4BBRJ 2XAFA 4IHWA 1MH3A 5F0HA 4EM1A 1GDTA 3DF8A 2L9VA 5GAEJ 3CUQA 2HOTA 2HXOA 1WH7A 1YW8A 2CW7A 4EJOA 2ZNZA 2L4MA 2DYRH 3MCZA 1LJ9A 3CQZJ 2QF7A 4GGGA 1FZPB 2BE5F 4BHBA 1HCRA 1V5EA 3F21A 3GFLA 2VOPA 3PL8A 2OQGA 4AYBN 1OYWA 2GA2A 5E8IA 3TBIA 1I50J 2V26A 5A2QZ 3FX3A 4G6TB 2BZTA 1WRJA 3TW7A 2JA2A 2E35A 2L9SA 3M8EA 2MH9A 2IEKA 4FX0A 4BXFA 1TWAJ 1Y1WJ 4QWQA 3F3XA 3KYCB 4HA8A 2JTVA 3HL2A 1FSEA 2GOMA 2XSJC 1MSFC 2A61A 3FXLA 4D0PA 1S8NA 4DIQA 4AUXA 3H5RA 1YQAA 1P4WA 2FMLA 2HXIA 1MIJA 2K27A 1A31A 4HV5A 3ZQHA 2GQQA 3GUDA 4A3BJ 3VODA 3PJRA 1J2XA 3HOXJ 2EWNA 4WCGA 5KAIC 2MC3A 1YW9A 2XAJA 4RS8A 5DD4A 1H88C 2DA3A 4LITA 3O8GA 4BNCA 1VZ0A 4EJTA 4G8XA 2WAQN 1Z1DA 3LOCA 3PFYA 3HKZN 3L1PA 4U87A 1SMYF 4L9NA 2JA6J 4MTDA 2A07F 2CV2A 2B0LA 1TWGJ 5ILVA 2LR8A 3G6EI 3ABUA 1XCBA 2X6WA 3NEUA 2V1XA 2QM3A 3DBHB 1SFEA 3ECHA 2GIVA 3WHBA 2MLKA 2E36A 1FOWA 2DA1A 5K5RA 5C44J 2VJIA 2M1BA 4E7LA 3MN2A 1R5GA 5J47A 4I0BA 2WAFA 4F91B 4E7JA 1QA6A 2M5WA 2DXIA 1UHSA 1IV8A 3FWEA 2GZWA 4A12A 2MBFA 1CF7A 1FOXA 4N4NB 1R58A 4HEA2 3OY9A 3GTPJ 3QOPA 4A5NA 2P5VA 4Q5SF 2X85A 4FISA 1T95A 5E3LA 1U6GA 4HBLA 3OIOA 4A6EA 2R7OA 4P9UA 3K2AA 2CUJA 4C3HJ 2FE3A 2XF6A 2UV1A 2LC2A 2ZMEA 5FO5A 4KT5C 3K4LA 3LSMA 2QQAA 4OAYA 1ZYRF 3W2VA 1QZYA 1JHHA 5EGOA 2QUFA 3TGNA 4A0YA 4RLQA 1NK3P 1K4TA 4D7NA 2CO5A 1IZ1A 2F4OB 2E1MB 3WTUC 1QO0D 3OS2A 4GCVA 1KYZA 4PJLA 1HLVA 3EUHA 2M8GX 4ITVA 3LSKA 4WXCA 1BM9A 2F4IA 5J40A 4U7DA 2KIUA 3JRCA 2M0MA 4CCNA 1IXSB 3BR2A 3K4KA 3V7RA 4NQWB 2KDZA 2F5VA 2NAZA 2VT2A 1BI2A 2JA5J 4UUSB 3HUGA 2Y9ZA 3CMAI 1QNTA 3K70C 3BY6A 2M2EA 5HLTA 1IN7A 1UCRA 3KETA 3L7WA 1X1BA 3PUFA 3R0JA 3F72A 3WTXC 2VASA 1MBHA 2ZC2A 5D5XB 4HX4A 4Y7NJ 4A3LJ 5GPCA 3I59A 2QCOA 4S0HB 1MMSA 1EF4A 4BGDA 4ZTJA 2DMNA 3SXYA 4XLEA 4A93J 3CESA 1B72B 3BPXA 3BZKA 2YSRA 4Y52J 2COBA 2CQ7A 2JMWA 1TNTA 4U0VA 2F5DA 3LSPA 4UVCA 2WV1A 1O3TA 4ETSA 1QVUA 2V1NA 2XPVA 2ZJ2A 2ZXHA 1XGSA 1U2WA 3A0BC 4PSXA 5D4SA 4HQEA 4M72A 1X3UA 3J7ZI 4DYRA 3ZMDA 4MFDA 3SEQA 1D0ZA 3I4PA 4AC0A 1X4OA 1BJZA 5GAHJ 1JUSA 3T8RA 1XMAA 1GLNA 2CUFA 4PZJA 1EH8A 3S14J 1MMGA 3SEZA 5ILUA 1IJWC 3ROUA 4BL0B 1PUFA 2ISZA 3OL4A 3I4NJ 1TQIA 5E20A 3WHCA 1G8XA 1X1DA 1R7JA 2QZ8A 3NWSA 2PJRB 2ZJQF 1R1TA 2CW0F 3HXLA 2RGVA 3PSIA 3MKWB 1TC3C 1GVDA 1I3AA 2TRTA 4EM2A 1FNNA 3NAUA 1AA7A 1OISA 1X2NA 2V9KA 5H2FC 1MZBA 2VBYA 1PVEA 5HDKA 4G12A 1ACIA 1F43A 2L9RA 1TQMA 2JRMA 1U78A 3E6MA 3K69A 3HJEA 1FPQA 4D5CA 5F0CA 1FMWA 2VOOA 3ZGKA 4M3EA 4I01A 5F08A 3ZP5A 5H20A 2YPRA 1D5VA 5LHIA 3PNVA 4EVIA 3CF5F 2Q2EB 2K9MA 3TO9A 2X1CA 4A0ZA 1BI0A 3JAMZ 4M3FA 3FISA 3F8CA 4Y13A 1D8JA 1K78A 2M9HA 4D5FA 1P4XA 4YFKF 3WU2C 1G3TA 3W3CA 1W5SA 1YX3A 1XDSA 3OYKA 5IY5H 2CSOA 2VJ5A 4G7ZF 3K9TA 1XG1A 3OWTA 5D8LB 4ENNA 1BL0A 2FSWA 2AXTC 1I27A 3QYFA 3E5QA 1ODDA 3TDZC 3BTJA 4KA4A 2IS2A 2FF4A 3QODA 3WTTC 4R8HA 3JRGA 1HOMA 2XGDA 3TOAA 4E4HA 3OYEA 1ZELA 1RRJA 4KIBA 2DAOA 4L9VA 4LMYA 2Y2ZA 2XC7A 4BACA 1FYMA 2R7XA 2FD5A 5J4VA 5L3CA 3OYGA 4C9YA 2BVMA 3LQQA 4JOMA 3IHUA 1W5CC 2KHMA 3M1CA 3ZRGA 4KYWA 1QZZA 2X0LA 2HEOA 5HODA 3B73A 4KN4X 3DKXA 2H1LA 5LBQA 1Z6TA 2D5VA 4HNUA 3DPLC 1EJ9A 2XAHA 2B9SA 2W57A 3GCMA 2EINH 2G7UA 4DZPA 3I64A 4E7IA 1P7IA 2MG4A 4IRHA 4DGWB 1UG0A 1HDPA 1G4DA 5BPIA 2PLYA 1BR2A 4E6KG 2K40A 2WC2A 1W7PA 1BW6A 2HVQA 3KX2A 4EJVA 3E6CC 2V9VA 3K1MA 2JQ7A 3BJOA 4A69C 2HVSA 3RZDJ 3E6BA 1ZH5A 3J81K 4N9HA 3S1QJ 1REPC 2ZNYA 1BI3A 2CRGA 5TGTA 4X0GA 3RTRA 4FASD 1TT5B 3BG5A 1U5TB 1R00A 2K9LA 3ZQCA 2K85A 1IXCA 3IP4B 2FBIA 3BP8A 2X9DA 4BQAA 2XV4S 1B9MA 1QVTA 3RSNA 1HBXG 2RDPA 4ZZDA 1UAAA 4ANJA 4KT6A 3VB2A 3AL0B 1R23A 4FT8A 4EQQA 3KYLA 5K7ZA 1SD6A 4G6QA 4UVBA 5IP9J 4EV0A 5LGTA 3GYHX 1JUMA 1BA5A 2QSGX 1XGOA 4H4KC 1H89C 2MABA 1JTYA 2HOEA 1YI2I 1BOBA 2DFHA 3OOUA 4Y3OA 2L0KA 2MD5A 2BYVE 2Z16A 1B4AA 3QAHA 3ZMSA 2H1KA 4PSWA 2V79A 3BQZA 2ECCA 2M8EA 4XRMA 2ID3A 2ELHA 1DU6A 1N75A 3H1CA 1Y0NA 1IDZA 1DGWY 2LBFB 9ANTA 1W36D 3L2VA 2ZSHB 1Y1VJ 2RV8A 2R7WA 3ASNH 4LK1F 4RMNA 1S6LA 2VPRA 2HVRA 4CCKA 3TQNA 1H9TA 3NARA 4P9FA 1YHQI 1ZN2A 3PO2J 4V2GA 1P6RA 2HQ5A 3VDXA 1RZ4A 5JHUA 3S16J 3HZJA 2JUGA 2P81A 3S3NA 4B43A 4F3QA 3D0SA 1OR7A 1YIOA 3F0CA 4DJAA 3FXUA 2IRFG 4B44A 1ZRFA 3OIQA 5JLWA 3ZQLA 3RI4A 1X19A 1U9OA 3F8BA 5FKKA 3GFIA 5LLQA 1O57A 1ZRCA 1XC5A 2PMUA 4PCQA 1TW3A 1ETOA 2CQQA 1D5YA 1VQNI 4B4CA 2VKHA 2Z3YA 4UV9A 2Y0SN 3DCFA 3J81Z 1HKSA 1IRGA 3OYLA 1BW5A 4UUVA 1EH7A 2DT6A 4P96A 2RKHA 1NK2P 1HW1A 3G1OA 1LVKA 2DMQA 1K83J 5LGUA 1JT6A 2CFOA 4IQ4A 3BR6A 5FKMA 2F6CA 2WY7Q 2LFBA 4B8XA 3FKIJ 5CVUA 1FX7A 3BDDA 2CWEA 3BG9A 1W7PD 5BMZA 4W1UA 2EZIA 4G94A 3A0HC 2P4WA 3VPRA 2MC4A 4Y15A 1QBJA 1FSHA 2QQ8A 1V54H 2W24A 2VJ4A 4KISA 3CUOA 4JQFA 3MKZA 3EETA 1LE8B 4YG2F 5M5YJ 3L9FA 3JTGA 1FYLA 4L5EA 1T0FA 1G3WA 2KDOA 4NQWA 4OAZA 5FLMJ 1R49A 1OPCA 2OZUA 4UUSA 2STTA 4BXUA 4YIFA 4B48A 5IP7J 1IRFA 1FTZA 1ERDA 2PMZA 3I53A 5ICCA 2LF8A 3HG9A 1O3SA 2N8GA 3OR2C 3A1YA 3CCSI 4BE0A 4IKFA 2W48A 4M9XA 3Q0VA 2WTEA 4NDLA 1SMTA 1BJAA 4MIMA 1VQPI 3LAJA 1IN6A 3FXQA 1PUEE 2KZGA 1B72A 2V4JC 3C2HA 4C3JJ 2H8WA 5HLHA 4MEYF 1MNEA 2FMYA 3HOUJ 1VQLI 2XSDC 2NS7A 3F23A 5EZGA 1MMNA 2K3FA 3LAPA 4AVPA 1HW5A 2FEZA 1JKQC 3CUQC 3CMYA 3RQ4A 1ZARA 5M3FJ 2L3DA 4FE7A 2VQLA 3NRVA 3GTJJ 3MKLA 5DTDA 4BKXA 2XASA 3BJAA 1IAWA 2PJRA 4L9JA 2VXDA 1ZKGA 2ZXJA 2AXLA 3FMRA 5ICFA 2HDDA 1DPRA 3DQVC 2ZXIA 3WGIA 1Z77A 4HOBA 1RIOH 4KICA 3UKGA 3A01B 2XGXA 4QSHA 1QPMA 1LB2A 1DGRM 5A2QK 3ERMA 5HVQC 4A5MA 2YU3A 2DI3A 5BS6A 1XMXA 4M6YA 4CCLA 1OCPA 3I0TA 4A3GJ 4UXNA 3QYEA 2DFFA 1YS7A 4L0ZB 4M71A 5FJ8J 2F2EA 2OCEA 2OZ6A 4N0BA 1QQIA 4XICA 2ZB9A 1B1BA 2Q2EA 2NVUB 1JXSA 2AQFA 3S2DJ 2GWRA 1LNWA 4XMYA 2O7OA 1I3QJ 1Z7LA 2PMZN 3JRHA 3S2WA 5BPDA 3L2CA 1XGNA 3CLOA 3HEFA 3MFKA 2FOWA 5J1YA 1BI1A 3HB9A 2ELKA 2W7NA 4HRIA 4EGYA 3AAFA 3PSFA 1KQ0A 2MA3A 3G2BA 2E1CA 1WKMA 3FHZA 1Z21A 2EIKH 3M4OJ 1XPXA 2KKOA 4ZTFA 3SDBA 5LEJA 4CCJA 4BH9A 5M5WJ 5E1ZB 2EK5A 2NS0A 4PUSA 3LFKA 4CYDA 2XAGA 5IYDJ 1OKRA 2VBXA 4M3GA 1MMAA 3M1EA 4ENMA 2PX9A 2WAQA 4CCOA 4GFBA 4IOAF 3CP2A 3HKZA 1NTCA 1TWCJ 5GP9A 4BU2A 3AKZA 4EGZA 3TMOA 4AD9A 3IV5A 3AG2H 4H0EA 3IKVA 2EZHA 3SQNA 2LKSA 3I3LA 1SD7A 2VC0A 3OMYA 5TISC 4JBAA 5E8GA 3S32A 3OYMA 2QYOA 2ZFWA 1HDDC 1G6NA 3AG1H 3D5LA 2I10A 3HC7A 3M8JA 1P2FA 5EJCA 3L2QA 3C3WA 3OIPA 3COAC 2IAIA 4J00A 1MBKA 4UV8A 4M3BA 3N97A 3FZVA 1X1AA 5DM7F 3BR3A 2IP2A 1I1GA 4YELA 2E2JJ 4KMUX 3Q0WA 1W0UA 1OCTC 2I8DA 4ZYGA 3G3ZA 2I5UA 5K7HA 2P6SA 3LNQA 3K1PA 2IBDA 2XROA 2ZMEC 3J7AY 1QGPA 2XAUA 1QZEA 4LJZF 5IOYA 3LL7A 4OIOF 3WTYC 1ETKA 4BQQA 2CV0A 2WAEA 2KQRA 1FYKA 1KA8A 1YX5A 2PMHA 4I7HA 4B3XA 1OMIA 3JTHA 3BCBA 1VQKI 2K5CA 2BHYA 4XL9A 3RKWA 4WXHA 4P1WA 3EUHC 5H6RA 2LK2A 5KCMA 4KMFA 4XLPF 2G7HA 2ME6A 1E0EA 2MLGA 2E60A 3K4NA 5K7FA 2LKXA 1GHCA 3LA2A 1NH3A 2KPMA 1WCMJ 1QPIA 2W25A 1U9NA 4RGUA 4RDUA 3G1MA 3OYIA 2GIZA 1UMQA 2GBYA 3PNTA 5K1YA 4DBQA 2LTPA 1WJ5A 3S93A 3ZQFA 1YRNB 3GTQJ 2QQBA 2XRNA 1WZ2A 4L9TA 1YE9A 4YEJA 3DLLF 5HLGA 2GXAA 1U5TA 2DA6A 2QQ9A 3EQLF 3KP6A 2JA7J 4FE4A 3OSGA 4UUTA 4ZDOA 1V3FA 4ABZA 4PK4A 5FROA 4AIJA 3W2AA 5FRNA 4ZJZA 3LA7A 5E79C 2HZTA 3S1MJ 1LDDA 3V4GA 2B63J 3MD2A 2XPWA 4EM0B 2CG4A 3BR5A 3H5AA 3E0JB 4PDKA 1IGNA 2VODA 3J7AO 3BTIA 1IN5A 3FF5A 2CH0A 2FJ1A 3RPUA 2CS3A 2D1HA 1ZRDA 3IRQA 1RR8C 3SFIA 2OV7A 3FXRA 1T2KA 1KU3A 3TO7A 3HOVJ 2KP6A 4C3IJ 4J01A 2W4SA 3GX4X 1R36A 4NC6A 2LBFA 3IH2A 3A02A 4MEXF 2R7QA 4IRGA 3FBNB 3H0DA 4IHYA 4DBRA 4XKVA 5AIPA 4BEHB 5L3FA 5D5UB 2EA2A 1JKRC 1FBSA 1R6RA 4KIGA 2X51A 2Z9OA 4CSWA 3A2KA 1X1PA 2L7KA 4ESJA 3N05A 1U0JA 2ZSIB 3ZCOA 3Q3SA 4C30A 2OF7A 3EDPA 2ADUA 1HSTA 3HHHA 2EBIA 5KNLA 2PQ8A 1EKEA 3P7NA 4I0AA 1KU2A 5IP6A 5DUIA 3QRFF 3GZ5A 1XMKA 4WX9A 1WQ2A 4ZYHA 3FIWA 3ABTA 1RKTA 4CZCA 4KNYA 3K7AJ 1J0RA 1R5HA 3AG4H 3BR1A 4IHVA 4KN7X 4RLFA 3RDIA 2F4MB 3JAMK 3GBGA 5F04A 4ZYAA 3ZOBA 3C18A 3ELKA 3R0AA 3DV8A 4A3FJ 1W36C 2DOEA 3K2ZA 1OFCX 2KRCA 4LG3A 3LSJA 2JJ7A 3Q5FA 2EV5A 4LK0F 3T5XA 3OL3A 3GW2A 3QWLA 2DQLA 3L2RA 2DTRA 2VLAA 2ICWG 1IO2A 2QWWA 1HXDA 4F55A 4U88A 2KISA 1YLFA 3SYTA 2R3SA 3KLNA 4NBQA 2K02A 1BR4A 1N25A 3F8FA 2R4GA 1S72I 2G0EA 3VFZA 4S04A 2IGMA 1X1CA 1GV5A 2WV0A 4UB8C 3H36A 3LWFA 2Q1ZB 2R7DA 1ZGJA 1Z6RA 2FQ4A 2M4GA 4LGWA 4MQVA 2ZJPF 1R22A 4C2MJ 1LE8A 2M34A 3CCJI 4DQ2A 5DUKA 4G7OF 4X1EA 2EIMH 2ISYA 2P5LC 2M3AA 1W0TA 4LLLA 3MKYB 3ZMZA 4ZDLA 3DWLE 4L5IA 2BHZA 2XVCA 3DPTA 1MJ9A 2K3PA 1OLTA 2BY0A 2LY9A 3HGYA 3P9CA 3WTVC 3DXJF 4GDFA 1ZAOA 3KE2A 2MYSA 2JSCA 3LSIA 4MO7A 3S8PA 4YFNF 5IT3A 5J1UA 3IAM2 3BOQA 1RI7A 4IHTA 4JX4A 5F27A 1R1VA 1SFOJ 5DEQA 1LEAA 1B6AA 2MFZA 3V8LA 3GXOA 5HOOA 2AS5F 1TWHJ 3TKYA 2X6YA 1JKPC 2VN2A 1RUOA 2H6CA 3RPUD 5LFAA 1ON1A 3OS0A 3ZR8X 3CC7I 2W85A 4XLHA 2D45A 4C2TA 2XF7A 3BWGA 1XB4A 3FXKA 5CVJA 3WGHA 4BQNA 5KHDA 2KIMA 3DLAA 3HRTA 4CGZA 4Q47A 3LMMA 2W84A 3N4MA 3GTMJ 2O03A 3PQJA 3ZMTA 1POGA 1ZG5A 2NYXA 2M7BA 3A01A 2NRAC 4MHGA 1RPWA 1JUPA 2KZVA 4U7BA 5FKOA 5DCFA 1VI0A 4EJUA 2FXAA 3ERED 3CCVI 3CJRB 1HSJA 4ON0A 2GLOA 3MMYB 4U0YA 1LDJA 1ZR4A 1Z67A 3OYBA 2DFIA 3OYCA 4DNCA 1K4SA 4GO1A 1Y39A 1R9TJ 3ASOH 4BE1A 3OOPA 3RKXA 2UXNA 4CH7A 5IYBJ 3M3YJ 4KDPA 2LH9A 5FD5A 1FJLA 1P4AA 2DMUA 2Y69H 4S05A 3S1RJ 4A3DJ 1G59A 4HDUA 2NVTJ 3FHNA 2H8RA 4KUMA 4XIDA 3E5UA 1IXRC 3JRDA 1LDKB 2Z33A 2DJIA 4HNTA 5EEGA 2IS4A 3CC4I 4FCYA 2B7EA 1MJAA 1GT0C 3DBRB 3CO7C 4MQ9F 2GA1A 3OYJA 4DZJA 5LHHA 1VTNC 3RZOJ 2DA5A 2EH3A 4XN0A 1MNMC 1D1CA 1P7JA 1V5GA 1SVLA 2OPTA 3TP3A 4XSZF 2QLZA 2DYSH 1RR7A 3I5UA 1Z0XA 1Z91A 1L3LA 4CYCB 3KEOA 2QA4I 2Z2SB 1ETQA 2F48A 4NNJA 4G7HF 4OIPF 1TP4A 1SVOA 1BR1A 4HF0A 1Z3YA 3K4MA 3DTIA 1IW7F 1OR7C 3LFUA 3W2WA 3CCRI 2XUBA 1ZTRA 3KZYA 5ED4A 1K79A 4MLOA 1S7EA 1KQ8A 1V4RA 2E1OA 1XDUA 2K4BA 2P7VB 3M8FA 2IXSA 2NNYA 2R5ZB 1V55H 3GVAA 3FMSA 3WTSC 1LVAA 5KK1A 3HSEA 3ZXSA 2NS8A 3CJTB 2YUSA 2JK3A 1IG7A 2EFPA 2FNPA 3KEQA 4HYEA 5J4YA 4I2OA 4R79A 2XRLA 2YS9A 3OYHA 5AONA 3LSGA 2JZYA 2GAUA 1OCCH 4D9JA 1MKMA 4OWRB 2V9PA 4HV6A 4E7KA 2E1MC 2Y0SA 4NUBA 4IQJA 2WA0A 2DTZA 2XKPA 4UNOA 2UWMA 3EPZA 3PFIA 1F1ZA 1RC9A 3QU6A 4GRIA 1IN8A 3CCEI 3OS1A 3ABKH 5CJ9A 4V2FA 1T98A 2IJLA 5GADJ 2OTJI 2IPQX 2LP0A 4XKWA 3JR9A 1MBFA 5EF6A 1WH5A 4NC7A 3Q0UA 5E1WA 4A3EJ 3WODF 3G71I 1T0FC 4ESFA 1VQ7I 2Z1DA 2VIXA 1YRNA 1B59A 2HQRA 3BLYA 4XQFA 3ZMUA 3IL2A 4ENKA 3E3VA 5LRSA 3JRIA 4DW6A 2ZCWA 2L7MP 2XDVA 1KGSA 2DLLA 2QSFX 1J09A 4XLNF 2MGQA 1IUYA 4XORA 2FX0A 2QENA 1O7FA 2VXZA 4W97A 4FX4A 2OC6A 4QLCU 1Q1VA 1PP8F 2EZKA 2VBWA 4OMYA 2VBZA 2BV6A 1ZQ3P 5JVGF 1CF7B 1XD7A 5F64A 4ZZLA 1XGMA 1LFPA 1Z3XA 2HTJA 3K1NA 1T33A 2HYGD 1AOYA 2G9WA 2FA5A 3RCOA 4HPQA 2HQNA 2Y0MA 2VI6A 5CKTA 2TCTA 3VEPA 4ASNA 1FP2A 1WI9A 3DKYA 3ABLH 4IZZA 2H94A 3K70D 3C2BA 2VQHA 2Z5UA 3I4MJ 3NQOA 2CFXA 4BEHA 4L0YB 3QP6A 2IVMA 5HNFA 1MSEC 3QQAA 5F0FA 1YTYA 3BTLA 3B6CA 1QHGA 2XHKA 3DPUA 2O3FA 2KMUA 3F8NA 3QP5A 4GXOA 4BHPA 1H9GA 2VT3A 4I02A 3BC8A 4CO8A 4M6VA 3T0YA 3OYFA 1I39A 2QKLB 2ID6A 3DEUA 4KITB 2JSPA 4IL6C 2QVOA 2DA4A 3HHGA 3PQKA 2AQEA 3F8MA 5D6EA 4A6DA 2D1VA 4C2UA 1Q1HA 1E3OC 1WJCA 2RREA 4A3KJ 1RESA 1BN5A 2JVGA 4XLFA 2HPIA 1LKXA 3Q9VA 2QGUA 3CJQB 1TT0A 2ZO4A 2VB6A 3QPLA 2LRDA 2K7LA 3VYUB 1EV7A 4A0XA 1MDMB 2M87A 3V8JA 3U9GA 4IRIA 1XN7A 3E1SA 2V6CA 1SC7A 2XB5A 4RA2A 3QYBA 3BG7A 1T56A 4KIFA 2DPUA 3I71A 2PFBA 1JGSA 1I6HJ 1QHHD 1W1WE 3M9AA 2IGNA 3LA3A 2L4AA 1BIBA 4HSRA 4DOZA 3OR1C 2Y75A 5EG0B 3PIPF 3GF2A 3RQIA 4M73A 1GUUA 1A6IA 2YU9J 2EFWA 3WU1B 1SFKA 2EIJH 2HQAA 2WY8Q 4M9ZA 4FQGA 2LNBA 1KONA 1TBXA 3CLQA 4P55A 5K5OA 2HTSA 2L01A 3MWMA 3BTCA 5D5WB 2A69F 1LQ1A 3I58A 1G2HA 2H27A 5CVVA 4MFEA 2E2HJ 4AM3A 2YR2A 1U8BA 4EJWA 3QPHA 1XSDA 4IF4A 2DW4A 3IWZA 3S2HJ 1RUNA 3GFJA 2XGEA 3P9IA 2RQPA 4BJ6C 2OTLI 3W6JB 4AIHA 1R4NB 2W1OA 2RNJA 1WGXA 2NVXJ 2PI0A 4I98B 2PN6A 1FY7A 4HF1A 3EUAA 1ZK8A 3GEZA 2CUZA 1RKWA 2W00A 4A3CJ 1S5LC 5J3LA 4XLAA 1Y6IA 4XRSA 1C0WA 3K6GA 4XN3A 2L54A 2JWTA 3SFZA 3RIRA 1AHDP 1GVJA 5B66C 5DM6F 2V7FA 4HNVA 5ICGA 5L3BA 3OYDA 2HGCA 2XGCA 1ETVA 4M3DA 4HLYA 1G3SA 3I9V2 4YFXF 3P9KA 4HLXA 5J8CA 4X6AJ 5L3DA 4ZYEA 3H0GJ 4IOCF 1K7AA 1IF1A 2DT5A 1E3PA 3NWTA 1OCZH 2VL8A 2FU4A 1UG2A 3CCQI 5FFZA 4BAYA 1WVRA 3HSRA 2KL4A 2JT1A 4II2A 3U1KA 3DFGA 4NHJA 3C2GA 1FP1D 3WE2A 2PEXA 2OU2A 1U5TC 2DODA 3HOTA 1WJDA 4OMZA 4LIUA 4LG0B 2K4JA 2Y48A 3B6AA 2RQQA 1OCRH 1DP7P 1T08B 2OD5A 3IH4A 4CA0A 2R92J 3CD6I 2UUZA 2DK8A 2JA8J 1R71A 3AL0C 4IXAA 1VQ5I 4UHTA 2KLOA 3HRMA 5CQGA 3ZQ7A 1MBJA 1AWCA 4XKBA 3TW6A 1TWFJ 2EJRA 2LDUA 2CMPA 4F7ZA 2R5YB 1WJAA 1A04A 3HM5A 3CDHA 2O9LA 2EILH 1XS9A 1USTA 2E7XA 4PJMA 2HYJA 2DQRA 3D5RC 4JX5A 4HX7A 4N9IA 1SAXA 1PJRA 2BW3B 3T8TA 1GV2A 3V7CA 1PP7U 2O8KA 4FETA 2P6TA 3PUBA 3J80Z 4NC8A 3H9JA 4JYKA 2VQGA 1MMDA 3O8HA 2LLKA 2HFHA 2KJCA 3ESWB 2DMTA 2YX4A 4R1HA 4P5OA 2HOAA 3RPQA 1X2MA 4WK8F 1EH6A 2CUEA 3AFHA 4CCMA 1JJ6C 2A3SA 5HDGA 2GXGA 4B47A 3H5NA 3FDYA 1LUJB 5HNHA 5BOXA 1T39A 4XRFA 4OOIA 2O6GE 3GO5A 3HDDA 5CPRB 3K0LA 3VOEA 3QU3A 1MBGA 3RYRA 3UNGC 2C6YA 1DQUA 1IUFA 1YOVB 3GFMA 4CYCA 4O3MA 1QU3A 5DCMB 4BDYA 2K9NA 4E70A 5B3SH 3HPHA 5EEHA 5TRDA 1JT0A 2E5NA 1D8KA 1TNSA 5JHFA 3E5XA 4XLCA 1MNDA 5KAFC 4JK1X 2KFDA 4E7HA 3CO6C 2DA7A 1X3ZB 4GYGA 3JSPA 4LB6B 3VSLA 2R5ZA 3HYIA 3QPTA 2HYFA 1VQ8I 2A5WA 2ZFUA 5IOZA 1XSVA 4M74A 3K4CA 1HA8A 4WWCA 3HGGA 3L2UA 1LFUP 1ETWA 2HR3A 3FMQA 1BC8C 3GTKJ 4A2UA 3ZQQA 3M7GA 2A6HF 3WG7H 2JPBA 3MEXA 1ULYA 2LF7A 2YX7A 1XX5A 4HG2A 1AKHB 5L3EA 2PBIA 5FLXZ 1YJ9I 3H9GA 2FQ3A 1I5ZA 2R7UA 2OBPA 2V6EA 4LIVA 5D8KB 2F5EA 5LD2C 3JRFA 1YJWI 4IHXA 2MSYA 2M30A 2IA1A 1ZGWA 4BBSJ 3WE3A 2LKPA 6PAXA 2DN0A 3CCYA 1H8AC 4E7SA 1I1SA 2KIFA 1W5TA 3CP8A 5ILSA 2LMDA 1STZA 2EV0A 1K61A 1ZGAA 1ZHFA 5IT9K 2AHQA 2J5OA 2VQCA 2EV6A 2RC4A 2VONA 3ZMVA 3BG6A 1FOKA 3X2QH 3IRRA 1U3EM 2HDWA 3KEYA 4PJNA 5B5EC 3GZ6A 1YIJI 3HOWJ 4E7ZA 4UY8I 4XK4A 5E17F 2ESHA 2E5ZA 3QPSA 1XSXA 1MH4A 1KQ9A 3W6VA 4LD5A 2HNHA 2VUMJ 2WBMA 4HF2A 3F22A 5LHGA 4CICA 3BT9A 4J19A 1FWZA 5JFRA 2P5KA 5GTHC 5HDNA 4IHSA 2DA2A 3S1NJ 1ORKA 2BY2A 1A36A 5DS9A 4LFUA 4HSTA 3KZZA 4Z6YA 2IW5A 1YS6A 2CQKA 1RETA 1HF0A 1TLHB 1BBYA 4A3JJ 2X1DA 3V42A 1YYVA 5FLVA 3OYNA 5KVRA 3ONQA 3MVPA 4Z2YA 4V19K 2AO9A 3WG9A 2XIGA 1UZCA 2R7FA 2VKVA 2BBYA 2FBKA 2VE9A 2M4KA 4O5VA 3LSHA 2L02A 4HZFA 1VNDA 1FBQA 4FHTA 1R4MB 1KU9A 3RJPA 2A5YB 1WWXA 1JI8A 2HS5A 3H3VK 2IA0A 1ONVA 3H35A 4HDVA 4PFOA 3JRAA 2X4HA 3I55I 4I76A 3L00A 1O4XA 2EFOA 3R6SA 3AG3H 2LY1A 3FXOA 5FD6A 1WPKA 5EEAA 2O5RA 1NG6A 2IS1A 2E1NA 3IUOA 3PM1A 3U21A 1UFMA 2DT7B 5J1RA 2EPFA 2IGKA 4ENJA 1T6SA 5K5QA 3WU0A 3CJNA 1Y8QB 1ENHA 1OYYA 4PFPA 2KRFA 2FNAA 3R4KA 5BNGA 2O8XA 4Y33A 1SD4A 4F92B 2KRHA 5DV5A 2R7TA 1A35A 5IT9Z 3ABMH 3FXJA 4CXFA 2UZKA 1U8RA 1MDMA 1J75A 2HPMA 1UHMA 4RM2A 3TL4X 1S7AA 5AIQA 4ZYDA 2L5QA 5FFXA 2NVYJ 4MNUA 2LSOA 5FB2A 2GXBA 1RNLA 3EUKL 4L18B 5FKNA 3ML6A 3I56I 3MAJA 3BCAA 4G6DA 4LLGF 3WGGA 4U0WA 3KP7A 3ECOA 2VE8A 3ZQGA 5EG0A 3OYAA 3ULQB 2XKOA 1IV6A 2BXYA 4AIDA 4BDZA 3H92A 2FRHA 3MZHA 1VQ4I 2DO7A 1YG2A 1N77A 1Z7UA 2ETHA 5DDGA 1ETXA 4BS9A 4I6ZA 1B8IB 3DKWA 1SANA 5GTIC 3CCLI 3CDLA 3HBLA 1MBEA 1VQ6I 3RKYA 2NOGA 3TO6A 2JUCA 1DU0A 4WF2A 1FTTA 2CW8A 2X48A 4ZC3A 2X6OA 3R60A 4XNFA 3LSTA 3CCUI 1YJNI 2DDBA 3CC2I 1MD0A 1E3HA 4XBFA 3FK7A 2QBYB 1JE8A 1XTAA 4B3AA 5E1XA 3G1LA 3TP0A 5M3MJ 4RB3C 3QOEA 4KFCA 3S17J 2BXZA 3E7LA 1J9IA 3CMMA 3F9KA 4BHCA 2DU9A 2K86A 2L2OA 2R7RA 1F5TA 3O3KA 4NB5A 2CGPA 3G73A 3KPHA 1FBUA 1FMVA 2LY2A 2HDCA 4UVAA 1OYIA 2BEOA 2O61A 3HRUA 5TJJA 3SJMA 1ZLKA 2ME0A 2IS6A 2Y30A 5BQTA 3GTOJ 4OINF 3G4SI 1NG7A 2E2IJ 3CF2A 3ZN1A 3KP3A 3S3OA 2P7CB 2HI3A 2BY3A 3ZQIA 2HZDA 4M9SA 2KIQA 5ERIA 2JRTA 2XF5A 3RKQA 4AIKA 1JHFA 3O6BB 3A4CA 4IEJA 4I09A 1BOAA 2A68F 4LG0A 1CGPA 4XKCA 4IJAA 5HLIA 5B1AH 5H6QA 2R93J 2WB1A 1ON2A 4RM3A 1PYVA 3P5JA 5CLSA 3KCCA 4QTRA 2M45A 1KU7A 5C4JJ 1J7KA 1R1UA 1PDNC 4IX7A 1DP3A 4Y4RA 3W6KB 1S9HA 1Z05A 5J8FA 2R5YA 3HIFA 5D6FA 1MJBA 1V5FA 3K4JA 2VJJA 2LREA 1D1BA 4JP0A 1WHUA 2NVQJ 1APLC 4F52A 4QIWN 1YITI 4XM3A 5GPAA 1X3WB 1OJLA 2LG4A 2P8TA 1USSA 2BW3A 4RB0A 3DBLB 3VSKA 1FC3A 2IA2A 2K9SA 1H0MA 3S3MA
chains in the Genus database with same CATH topology
1A5JA 2E2JJ 3BR2A 3Q0WA 3GTLJ 1W0UA 2KDZA 1OCTC 3HOYJ 1WI3A 2XB5A 2JA5J 4UUSB 5K7HA 3LNQA 2IBDA 1T56A 2Y9ZA 5E3NA 1I6HJ 2M2EA 5IOYA 1ETKA 5EDNA 5EG0B 1MBHA 3RQIA 4Y7NJ 1GUUA 4A3LJ 5GPCA 1A6IA 2YU9J 2QCOA 4S0HB 1EF4A 2R7ZJ 2VKEA 2DMNA 1JGGA 4A93J 1B72B 4Y52J 2COBA 2L7FP 2JMWA 2LK2A 3LSPA 5M5XJ 2ME6A 2WV1A 5K7FA 2LKXA 1QVUA 2XPVA 3BTCA 1WCMJ 1G2HA 2DMPA 2XPUA 2ECBA 1QPIA 4MFEA 4DYRA 1CQTA 2E2HJ 1U9NA 4MFDA 4RDUA 1U8BA 4AC0A 3G1MA 1UMQA 3BR0A 2WB1N 1BJZA 2GBYA 1JUSA 3S2HJ 2XGEA 2CUFA 2LTPA 3ZQFA 3GTQJ 1YRNB 3S14J 1IJWC 1PUFA 3I4NJ 1WGXA 2NVXJ 3WHCA 2DA6A 2JA7J 4FE4A 1ZK8A 3OSGA 1AKHA 1RKWA 4UUTA 5C4XJ 2EQRA 4A3CJ 5J3LA 4XRSA 1TC3C 1GVDA 4A3IJ 2TRTA 4ABZA 4B1RA 3NAUA 2JWTA 1AHDP 1X2NA 4HNVA 3S1MJ 2B63J 4G12A 1F43A 2L9RA 2XPWA 4FTHA 2XGCA 3BR5A 1U78A 1IGNA 1ETVA 4D5CA 4M3DA 3BTIA 3FK6A 5JLXA 5F0CA 2FJ1A 4X6AJ 4M3EA 3H0GJ 5F08A 3SFIA 1UG2A 5E3MA 4LOCA 3HOVJ 4C3IJ 4M3FA 3FISA 3IH2A 4JX6A 2M9HA 4D5FA 3A02A 4IHYA 2Y9YA 3B6AA 1ZR2A 1JKRC 3IH4A 2R92J 1XG1A 3PO3J 1BL0A 1ETYA 1JTXA 2JA8J 1MBJA 3BTJA 3Q3SA 3DEWA 5EGOB 3TW6A 2CJJA 1TWFJ 2OF7A 4EEFG 3JRGA 1HOMA 2R5YB 2EBIA 2XGDA 3HM5A 5IP6A 2O9LA 1XS9A 3FIWA 2Y2ZA 1RKTA 2HYJA 5F1JA 2FD5A 4JX5A 3K7AJ 3BR1A 2XB0X 4IHVA 1JJ8C 1GV2A 2CU7A 1LFBA 2O8KA 1FIAA 3GBGA 5F04A 3ZOBA 4JYKA 3O8HA 4A3FJ 2LLKA 5HODA 3GTGJ 2DMTA 3S15J 1OFCX 2D5VA 2R0QC 3LSJA 2HOAA 2JJ7A 1X2MA 5IYCJ 2Y31A 2CUEA 1JJ6C 4DZPA 3JRBA 1IC8A 3HDDA 1P7IA 2MG4A 1MBGA 1IUFA 1HDPA 4CYCA 5C3EJ 3TEDA 4DYQA 2G0EA 2E19A 4BY7J 2K9NA 1GV5A 1JT0A 1ITYA 3BQYA 2K40A 3OSFA 5E3OA 2FQ4A 1BW6A 4C2MJ 2RAEA 1LE8A 2DA7A 2R5ZA 2M34A 2GM4A 3SDGA 5IOZA 4A69C 4X1EA 3RZDJ 1W0TA 3HGGA 1LFUP 3A03A 4XRSG 3S1QJ 1ETWA 3GTKJ 2CRGA 3HOXJ 2LY9A 1PUFB 3HGYA 3BG5A 5EZHA 3ZQCA 1QRYA 2DJNA 1AKHB 2X9DA 4MO7A 5J1UA 3JREA 1QVTA 3JRFA 4IHXA 2MSYA 1B8IA 4JX4A 5F27A 1VF9A 1ZGWA 4BBSJ 1SFOJ 2DN0A 3CCYA 5K7ZA 1H8AC 1TWHJ 1JKPC 5IP9J 4BXXJ 1JUMA 2LD5A 1BA5A 2L7ZA 4D7MA 1K61A 1H89C 1F36A 2AHQA 1JTYA 3OOUA 2L0KA 1AU7A 2H1KA 3BQZA 2ECCA 2CQXA 4XRMA 2ID3A 3GTMJ 5FKLA 3HOWJ 2HOSA 1IDZA 2JN6A 1POGA 4RBOA 1FIPA 4A3MJ 9ANTA 4XK4A 1X58A 3QPSA 1MH4A 3W6VA 5IPAA 3A01A 1Y1VJ 2VUMJ 1RPWA 1JUPA 3BT9A 3LSRA 4J19A 5FKOA 2VPRA 1VI0A 1IRZA 2DA2A 3NARA 3S1NJ 1ORKA 3PO2J 4V2GA 5DS9A 2KT0A 2GLOA 2HQ5A 1RETA 1ZR4A 1HF0A 1VFCA 3S16J 4A3JJ 1R9TJ 5FLVA 2P81A 2MW8A 5IYBJ 3M3YJ 3MVPA 2AO9A 3F0CA 1FJLA 2DMUA 3BG3A 3S1RJ 4A3DJ 2VKVA 5JLWA 3ZQLA 2NVTJ 1U9OA 5FKKA 2H8RA 1XC5A 1VNDA 4XIDA 1ETOA 2CQQA 3JRDA 1D5YA 4B4CA 4BY1J 2Y0SN 3DCFA 3H3VK 4FCYA 1GT0C 2EZLA 1BW5A 3JRAA 4DZJA 3RZOJ 4I76A 1O4XA 2DA5A 2EH3A 1MNMC 1JKOC 2LVSA 1P7JA 1NK2P 1WPKA 5EEAA 3G1OA 2OPTA 3TP3A 1IDYA 2DMQA 3PM1A 1K83J 1JT6A 3HOZJ 3IH3A 1RR7A 3BR6A 5FKMA 5EYRA 1Z0XA 5J1RA 4DYCA 2LFBA 4CYCB 1ETQA 3FKIJ 3BG9A 1ENHA 1FEXA 5BNGA 4W1UA 2EZIA 3VPRA 1ZTRA 4MLOA 1S7EA 3D1NI 2E1OA 2K9QA 2M0CA 1LE8B 5M5YJ 4BBRJ 2R5ZB 4L5EA 5FLMJ 4IHWA 1MH3A 5F0HA 1GDTA 4UUSA 2HOTA 2HXOA 2NVYJ 1WH7A 2NS8A 2YUSA 3CQZJ 2JK3A 2QF7A 5IP7J 1IG7A 1FTZA 1HCRA 5FKNA 2XRLA 2YS9A 4AYBN 2N8GA 3ZQGA 3LSGA 5EG0A 1I50J 1IV6A 3TW7A 2W48A 3Q0VA 4NDLA 4MIMA 2IEKA 1TWAJ 2DTZA 1ETXA 1Y1WJ 4I6ZA 1B8IB 1B72A 1SANA 3CDLA 4C3JJ 3HBLA 1MBEA 2NOGA 4V2FA 2LP0A 1MSFC 3JR9A 3HOUJ 1MBFA 5EF6A 2XSDC 1WH5A 2NS7A 1DU0A 5EZGA 1FTTA 3Q0UA 2X48A 2X6OA 4AUXA 4A3EJ 2HXIA 1JKQC 3CMYA 3FK7A 1YRNA 5M3FJ 3ZQHA 4FE7A 4B3AA 4A3BJ 3G1LA 3TP0A 5M3MJ 3GTJJ 3MKLA 5DTDA 4BKXA 3S17J 1H88C 3E7LA 2DA3A 1ZKGA 2HDDA 3O8GA 3JRIA 4DW6A 2WAQN 3LOCA 2L7MP 1Z77A 3HKZN 3L1PA 3UKGA 3A01B 4QSHA 2MGQA 2JA6J 2FX0A 4W97A 1TWGJ 2LR8A 1OCPA 3SJMA 1Q1VA 2ME0A 4A3GJ 3WHBA 2EZKA 2DA1A 5FJ8J 5C44J 3MN2A 2Y30A 4XICA 3GTOJ 1ZQ3P 2E2IJ 1UHSA 2ZB9A 2HI3A 3ZQIA 1T33A 3S2DJ 3GTPJ 2VI6A 2TCTA 2O7OA 1I3QJ 3RKQA 2PMZN 3JRHA 4FISA 5E3LA 3C2BA 3HEFA 3OIOA 4IEJA 5J1YA 3I4MJ 3HB9A 2R93J 2ELKA 3K2AA 4C3HJ 1MSEC 3QQAA 5F0FA 4QTRA 3BTLA 3B6CA 3M4OJ 5C4JJ 5M5WJ 4M6VA 5EGOA 5IYDJ 2ID6A 1NK3P 4M3GA 4D7NA 2R5YA 2DA4A 4GFBA 1E3OC 1NTCA 1TWCJ 5GP9A 4JP0A 3IV5A 4A3KJ 1RESA 1HLVA 2EZHA 2NVQJ 2M8GX 1APLC 4QIWN 1HDDC 5GPAA 1OJLA 2I10A 3QPLA 1DU6A 3JRCA 2IAIA 1MBKA 2K9SA 4M3BA 3BR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5J A;  2E2J J;  3BR2 A;  3Q0W A;  3GTL J;  1W0U A;  2KDZ A;  1OCT C;  3HOY J;  1WI3 A;  2XB5 A;  2JA5 J;  4UUS B;  5K7H A;  3LNQ A;  2IBD A;  1T56 A;  2Y9Z A;  5E3N A;  1I6H J;  2M2E A;  5IOY A;  1ETK A;  5EDN A;  5EG0 B;  1MBH A;  3RQI A;  4Y7N J;  1GUU A;  4A3L J;  5GPC A;  1A6I A;  2YU9 J;  2QCO A;  4S0H B;  1EF4 A;  2R7Z J;  2VKE A;  2DMN A;  1JGG A;  4A93 J;  1B72 B;  4Y52 J;  2COB A;  2L7F P;  2JMW A;  2LK2 A;  3LSP A;  5M5X J;  2ME6 A;  2WV1 A;  5K7F A;  2LKX A;  1QVU A;  2XPV A;  3BTC A;  1WCM J;  1G2H A;  2DMP A;  2XPU A;  2ECB A;  1QPI A;  4MFE A;  4DYR A;  1CQT A;  2E2H J;  1U9N A;  4MFD A;  4RDU A;  1U8B A;  4AC0 A;  3G1M A;  1UMQ A;  3BR0 A;  2WB1 N;  1BJZ A;  2GBY A;  1JUS A;  3S2H J;  2XGE A;  2CUF A;  2LTP A;  3ZQF A;  3GTQ J;  1YRN B;  3S14 J;  1IJW C;  1PUF A;  3I4N J;  1WGX A;  2NVX J;  3WHC A;  2DA6 A;  2JA7 J;  4FE4 A;  1ZK8 A;  3OSG A;  1AKH A;  1RKW A;  4UUT A;  5C4X J;  2EQR A;  4A3C J;  5J3L A;  4XRS A;  1TC3 C;  1GVD A;  4A3I J;  2TRT A;  4ABZ A;  4B1R A;  3NAU A;  2JWT A;  1AHD P;  1X2N A;  4HNV A;  3S1M J;  2B63 J;  4G12 A;  1F43 A;  2L9R A;  2XPW A;  4FTH A;  2XGC A;  3BR5 A;  1U78 A;  1IGN A;  1ETV A;  4D5C A;  4M3D A;  3BTI A;  3FK6 A;  5JLX A;  5F0C A;  2FJ1 A;  4X6A J;  4M3E A;  3H0G J;  5F08 A;  3SFI A;  1UG2 A;  5E3M A;  4LOC A;  3HOV J;  4C3I J;  4M3F A;  3FIS A;  3IH2 A;  4JX6 A;  2M9H A;  4D5F A;  3A02 A;  4IHY A;  2Y9Y A;  3B6A A;  1ZR2 A;  1JKR C;  3IH4 A;  2R92 J;  1XG1 A;  3PO3 J;  1BL0 A;  1ETY A;  1JTX A;  2JA8 J;  1MBJ A;  3BTJ A;  3Q3S A;  3DEW A;  5EGO B;  3TW6 A;  2CJJ A;  1TWF J;  2OF7 A;  4EEF G;  3JRG A;  1HOM A;  2R5Y B;  2EBI A;  2XGD A;  3HM5 A;  5IP6 A;  2O9L A;  1XS9 A;  3FIW A;  2Y2Z A;  1RKT A;  2HYJ A;  5F1J A;  2FD5 A;  4JX5 A;  3K7A J;  3BR1 A;  2XB0 X;  4IHV A;  1JJ8 C;  1GV2 A;  2CU7 A;  1LFB A;  2O8K A;  1FIA A;  3GBG A;  5F04 A;  3ZOB A;  4JYK A;  3O8H A;  4A3F J;  2LLK A;  5HOD A;  3GTG J;  2DMT A;  3S15 J;  1OFC X;  2D5V A;  2R0Q C;  3LSJ A;  2HOA A;  2JJ7 A;  1X2M A;  5IYC J;  2Y31 A;  2CUE A;  1JJ6 C;  4DZP A;  3JRB A;  1IC8 A;  3HDD A;  1P7I A;  2MG4 A;  1MBG A;  1IUF A;  1HDP A;  4CYC A;  5C3E J;  3TED A;  4DYQ A;  2G0E A;  2E19 A;  4BY7 J;  2K9N A;  1GV5 A;  1JT0 A;  1ITY A;  3BQY A;  2K40 A;  3OSF A;  5E3O A;  2FQ4 A;  1BW6 A;  4C2M J;  2RAE A;  1LE8 A;  2DA7 A;  2R5Z A;  2M34 A;  2GM4 A;  3SDG A;  5IOZ A;  4A69 C;  4X1E A;  3RZD J;  1W0T A;  3HGG A;  1LFU P;  3A03 A;  4XRS G;  3S1Q J;  1ETW A;  3GTK J;  2CRG A;  3HOX J;  2LY9 A;  1PUF B;  3HGY A;  3BG5 A;  5EZH A;  3ZQC A;  1QRY A;  2DJN A;  1AKH B;  2X9D A;  4MO7 A;  5J1U A;  3JRE A;  1QVT A;  3JRF A;  4IHX A;  2MSY A;  1B8I A;  4JX4 A;  5F27 A;  1VF9 A;  1ZGW A;  4BBS J;  1SFO J;  2DN0 A;  3CCY A;  5K7Z A;  1H8A C;  1TWH J;  1JKP C;  5IP9 J;  4BXX J;  1JUM A;  2LD5 A;  1BA5 A;  2L7Z A;  4D7M A;  1K61 A;  1H89 C;  1F36 A;  2AHQ A;  1JTY A;  3OOU A;  2L0K A;  1AU7 A;  2H1K A;  3BQZ A;  2ECC A;  2CQX A;  4XRM A;  2ID3 A;  3GTM J;  5FKL A;  3HOW J;  2HOS A;  1IDZ A;  2JN6 A;  1POG A;  4RBO A;  1FIP A;  4A3M J;  9ANT A;  4XK4 A;  1X58 A;  3QPS A;  1MH4 A;  3W6V A;  5IPA A;  3A01 A;  1Y1V J;  2VUM J;  1RPW A;  1JUP A;  3BT9 A;  3LSR A;  4J19 A;  5FKO A;  2VPR A;  1VI0 A;  1IRZ A;  2DA2 A;  3NAR A;  3S1N J;  1ORK A;  3PO2 J;  4V2G A;  5DS9 A;  2KT0 A;  2GLO A;  2HQ5 A;  1RET A;  1ZR4 A;  1HF0 A;  1VFC A;  3S16 J;  4A3J J;  1R9T J;  5FLV A;  2P81 A;  2MW8 A;  5IYB J;  3M3Y J;  3MVP A;  2AO9 A;  3F0C A;  1FJL A;  2DMU A;  3BG3 A;  3S1R J;  4A3D J;  2VKV A;  5JLW A;  3ZQL A;  2NVT J;  1U9O A;  5FKK A;  2H8R A;  1XC5 A;  1VND A;  4XID A;  1ETO A;  2CQQ A;  3JRD A;  1D5Y A;  4B4C A;  4BY1 J;  2Y0S N;  3DCF A;  3H3V K;  4FCY A;  1GT0 C;  2EZL A;  1BW5 A;  3JRA A;  4DZJ A;  3RZO J;  4I76 A;  1O4X A;  2DA5 A;  2EH3 A;  1MNM C;  1JKO C;  2LVS A;  1P7J A;  1NK2 P;  1WPK A;  5EEA A;  3G1O A;  2OPT A;  3TP3 A;  1IDY A;  2DMQ A;  3PM1 A;  1K83 J;  1JT6 A;  3HOZ J;  3IH3 A;  1RR7 A;  3BR6 A;  5FKM A;  5EYR A;  1Z0X A;  5J1R A;  4DYC A;  2LFB A;  4CYC B;  1ETQ A;  3FKI J;  3BG9 A;  1ENH A;  1FEX A;  5BNG A;  4W1U A;  2EZI A;  3VPR A;  1ZTR A;  4MLO A;  1S7E A;  3D1N I;  2E1O A;  2K9Q A;  2M0C A;  1LE8 B;  5M5Y J;  4BBR J;  2R5Z B;  4L5E A;  5FLM J;  4IHW A;  1MH3 A;  5F0H A;  1GDT A;  4UUS A;  2HOT A;  2HXO A;  2NVY J;  1WH7 A;  2NS8 A;  2YUS A;  3CQZ J;  2JK3 A;  2QF7 A;  5IP7 J;  1IG7 A;  1FTZ A;  1HCR A;  5FKN A;  2XRL A;  2YS9 A;  4AYB N;  2N8G A;  3ZQG A;  3LSG A;  5EG0 A;  1I50 J;  1IV6 A;  3TW7 A;  2W48 A;  3Q0V A;  4NDL A;  4MIM A;  2IEK A;  1TWA J;  2DTZ A;  1ETX A;  1Y1W J;  4I6Z A;  1B8I B;  1B72 A;  1SAN A;  3CDL A;  4C3J J;  3HBL A;  1MBE A;  2NOG A;  4V2F A;  2LP0 A;  1MSF C;  3JR9 A;  3HOU J;  1MBF A;  5EF6 A;  2XSD C;  1WH5 A;  2NS7 A;  1DU0 A;  5EZG A;  1FTT A;  3Q0U A;  2X48 A;  2X6O A;  4AUX A;  4A3E J;  2HXI A;  1JKQ C;  3CMY A;  3FK7 A;  1YRN A;  5M3F J;  3ZQH A;  4FE7 A;  4B3A A;  4A3B J;  3G1L A;  3TP0 A;  5M3M J;  3GTJ J;  3MKL A;  5DTD A;  4BKX A;  3S17 J;  1H88 C;  3E7L A;  2DA3 A;  1ZKG A;  2HDD A;  3O8G A;  3JRI A;  4DW6 A;  2WAQ N;  3LOC A;  2L7M P;  1Z77 A;  3HKZ N;  3L1P A;  3UKG A;  3A01 B;  4QSH A;  2MGQ A;  2JA6 J;  2FX0 A;  4W97 A;  1TWG J;  2LR8 A;  1OCP A;  3SJM A;  1Q1V A;  2ME0 A;  4A3G J;  3WHB A;  2EZK A;  2DA1 A;  5FJ8 J;  5C44 J;  3MN2 A;  2Y30 A;  4XIC A;  3GTO J;  1ZQ3 P;  2E2I J;  1UHS A;  2ZB9 A;  2HI3 A;  3ZQI A;  1T33 A;  3S2D J;  3GTP J;  2VI6 A;  2TCT A;  2O7O A;  1I3Q J;  3RKQ A;  2PMZ N;  3JRH A;  4FIS A;  5E3L A;  3C2B A;  3HEF A;  3OIO A;  4IEJ A;  5J1Y A;  3I4M J;  3HB9 A;  2R93 J;  2ELK A;  3K2A A;  4C3H J;  1MSE C;  3QQA A;  5F0F A;  4QTR A;  3BTL A;  3B6C A;  3M4O J;  5C4J J;  5M5W J;  4M6V A;  5EGO A;  5IYD J;  2ID6 A;  1NK3 P;  4M3G A;  4D7N A;  2R5Y A;  2DA4 A;  4GFB A;  1E3O C;  1NTC A;  1TWC J;  5GP9 A;  4JP0 A;  3IV5 A;  4A3K J;  1RES A;  1HLV A;  2EZH A;  2NVQ J;  2M8G X;  1APL C;  4QIW N;  1HDD C;  5GPA A;  1OJL A;  2I10 A;  3QPL A;  1DU6 A;  3JRC A;  2IAI A;  1MBK A;  2K9S A;  4M3B A;  3BR3 A; 
#chains in the Genus database with same CATH topology
 1A5J A;  2H09 A;  4OIQ F;  1SVM A;  1D0X A;  3GTL J;  5D4R A;  3HOY J;  1WI3 A;  3KZI C;  2DOF A;  3CUQ B;  1M1E B;  1TTY A;  4RAF A;  3SZP A;  2VC1 A;  5E3N A;  2WWY A;  1J5Y A;  4BE2 A;  1OQY A;  4XOP A;  4Q48 A;  3KYD B;  1WJE A;  4CUG A;  2P0W A;  5EDN A;  1WFX A;  4O6J A;  4EMS A;  4RAZ A;  1FOY A;  2Q0O A;  3IC7 A;  5DCM A;  3M07 A;  4HW0 A;  2R7Z J;  2VKE A;  2KJB A;  1JGG A;  2F5C A;  2JVH A;  3FXM A;  2LYC A;  1D0Y A;  4PGH A;  3B02 A;  3SZT A;  1FT9 A;  3VYT B;  2L7F P;  4BJT A;  3CME I;  5M5X J;  4G9Y A;  2BGC A;  1E2X A;  2E7W A;  2DMP A;  2ESN A;  2XPU A;  2ECB A;  1CQT A;  4BYY A;  4RAG A;  2IGO A;  3GWZ A;  4RGR A;  3BR0 A;  2WB1 N;  2WAD A;  4N4O B;  2EFN A;  3UR3 C;  2ZXW H;  2HKO A;  4YII A;  3HTS B;  4CZZ A;  4AWX B;  2DPD A;  4RGX A;  2F5F A;  1K6Y A;  4M6X A;  1WJB A;  2HU9 A;  5HS9 A;  5C4X J;  1AKH A;  1BIA A;  3KIO A;  2EQR A;  4BQO A;  2HKX A;  4I99 C;  4A3I J;  3E6D A;  5B1B H;  5JI6 A;  2E71 A;  3C7J A;  2EB7 A;  4B1R A;  1E17 A;  1TL8 A;  4RGS A;  4F93 B;  4PJJ A;  2DBB A;  1VQM I;  4CHU A;  1DPU A;  4FTH A;  5JVT A;  3KFW X;  4PGG A;  4XR6 A;  3FK6 A;  1P9Q C;  5JLX A;  3BJ6 A;  1P92 A;  2NNN A;  4EAT A;  3ZPL A;  3FKJ A;  5E3M A;  4LOC A;  5DD8 A;  1TQP A;  4HQM A;  1ZG3 A;  2OAZ A;  1W4M A;  1KZH A;  3CDI A;  2COM A;  5J6X A;  4HX8 A;  5F6F A;  3BZC A;  4JX6 A;  2VPL A;  3VYR B;  5CQE A;  5FGM A;  2Y9Y A;  3H9Q A;  2H6B A;  4BJ5 C;  1ZR2 A;  1S3J A;  1UHW A;  4OIR F;  3PO3 J;  3REO A;  4ZDP A;  3WTZ A;  1ETY A;  1JTX A;  2ZME B;  2LOO A;  3KP4 A;  5HS8 A;  2RVC A;  3DEW A;  2OCC H;  5EGO B;  1S7O A;  2CJJ A;  3F6O A;  4EEF G;  4MTE A;  1SD5 A;  3HRS A;  3SZG A;  1UB9 A;  1LPQ A;  3CZ6 A;  2A05 A;  1SAU A;  4IPA A;  1F4K A;  5F1R A;  1O7L A;  2R7S A;  2A6T A;  4B09 A;  5F1J A;  3TOB A;  1DDN A;  1HKQ A;  5L3G A;  3GLL A;  1KYW A;  2XB0 X;  1JJ8 C;  3IAS 2;  3O2P E;  2CU7 A;  1GXP A;  2D2W A;  1LFB A;  2DOA A;  2DK5 A;  1FIA A;  2J5P A;  4D1Q A;  4QPO A;  2EFQ A;  4BUP A;  1SFX A;  3TDU C;  1ZRE A;  3GTG J;  3S15 J;  2X1E A;  3BZ6 A;  3HUG B;  3DP7 A;  2R0Q C;  3PNY A;  2PG4 A;  5IYC J;  2Y31 A;  3JRB A;  1IC8 A;  1VQ9 I;  1SFU A;  3MZY A;  1XCV A;  2TDX A;  3EYY A;  1ZLJ A;  2NOJ B;  2ZBK A;  3Q9S A;  3FM3 A;  4QPQ A;  2GOX B;  3HTU A;  3I59 B;  5C3E J;  4DYQ A;  1MGT A;  3TED A;  2E19 A;  4BY7 J;  5DYM A;  3GZN B;  3I54 A;  1ITY A;  3BQY A;  3OSF A;  5E3O A;  1EA3 A;  4TV7 A;  2BY1 A;  3CTA A;  3GME A;  3SHF A;  2RAE A;  1S29 A;  3V8K A;  1R5I D;  2L9N A;  1WJF A;  2GM4 A;  2FBH A;  2IT0 A;  3SDG A;  1X4P A;  5LEK A;  1YO5 C;  1HKT A;  2QEX I;  3U2R A;  3A03 A;  4XRS G;  3BRO A;  3J80 K;  1GXQ A;  1BC7 C;  1Y56 A;  2Z99 A;  1VQO I;  3OV8 A;  4K2E A;  3DTK A;  2ELJ A;  1PUF B;  4PJ0 C;  1OCO H;  5EZH A;  1ZG1 A;  4ZH4 F;  1NHA A;  3EYI A;  1QRY A;  3H3Z A;  1UJ8 A;  2DJN A;  4XSX F;  2W82 A;  1YFH A;  5JR3 A;  2CYY A;  5LRR A;  3BPV A;  2XAQ A;  3FM5 A;  3JRE A;  1IN4 A;  3MQ0 A;  1K6O A;  2ZJR F;  1Z9C A;  1B8I A;  1T8I A;  3IKT A;  1VF9 A;  2RN7 A;  3VYS B;  4HAM A;  3V7S A;  3U1D A;  1F9N A;  3K10 A;  4ESB A;  4BXX J;  3L09 A;  4KJZ A;  2LD5 A;  2L7Z A;  4YRV A;  4D7M A;  1F36 A;  2BVL A;  4RB1 A;  1DUX C;  3DEE A;  3J7Y J;  2HWV A;  1AU7 A;  1O3Q A;  4OU0 A;  2UXX A;  4IVN A;  2QBY A;  2PJP A;  3T1B A;  3CCM I;  1YW7 A;  2OJE D;  1O3R A;  3LQR A;  2CQX A;  2QSH X;  2STW A;  5FKL A;  2MD0 A;  5HS7 A;  2HOS A;  1I6X A;  2DFE A;  3VWB A;  2JN6 A;  4MGR A;  4A3M J;  1G3Y A;  1FIP A;  4RBO A;  2X6X A;  1K78 B;  4YIR X;  1UEL B;  1X58 A;  3FBI B;  2E34 A;  2NXN B;  2JPC A;  3PIO F;  5IPA A;  3D5S C;  5GAG J;  3DU5 A;  2FOK A;  5D5V B;  3LSR A;  4UB6 C;  3F6V A;  4AYB A;  5FLX K;  1IRZ A;  4LB5 A;  4GYI A;  4L5J A;  3JW4 A;  5CVI A;  2CQN A;  4RB2 C;  1WSU A;  2KT0 A;  3DU6 A;  4CDG A;  3HPG A;  2RNG A;  3GLX A;  4WXD A;  1VFC A;  2CV1 A;  1HC8 A;  3WTW C;  2MW8 A;  4RAY A;  1TZL A;  3HOS A;  3KP5 A;  1Y0U A;  4IO9 F;  3BG3 A;  3ISP A;  1TW2 A;  2ACJ A;  3MZ8 A;  3L2W A;  2BOL A;  1HW2 A;  3R61 A;  2FUG 2;  1B9N A;  4XON A;  1FLI A;  1T38 A;  4BY1 J;  2OUM A;  3KLO A;  2QKM B;  1J59 A;  4AU7 A;  4AVZ A;  2EZL A;  5LGN A;  4LLN A;  5ICE A;  2OA4 A;  2M7A A;  3JCU C;  1JKO C;  2LVS A;  2DCE A;  2EA4 A;  3C1D A;  1SEU A;  1IRX A;  3KP2 A;  1D1A A;  1N78 A;  3ZN0 A;  1IDY A;  1D3Y A;  4II3 A;  3HOZ J;  3IH3 A;  2O0Y A;  2ZKZ A;  3E97 A;  1A6Q A;  5EYR A;  1LEB A;  4DYC A;  1HQC A;  3JSO A;  2MH2 A;  2Q8K A;  2A6E F;  2V1U A;  5E18 F;  1Y8R B;  5CYV A;  5CVR A;  1FEX A;  4Q4Z F;  3DTE A;  3HSF A;  3IWF A;  2OQR A;  2DDA A;  5FRM A;  3H3U A;  1W7P B;  1MW7 A;  3D1N I;  2VKD A;  2K9Q A;  1L0O C;  2M0C A;  3K4B A;  3RYP A;  2V1D A;  2R7V A;  4Y17 A;  4XOT A;  4BBR J;  2XAF A;  4IHW A;  1MH3 A;  5F0H A;  4EM1 A;  1GDT A;  3DF8 A;  2L9V A;  5GAE J;  3CUQ A;  2HOT A;  2HXO A;  1WH7 A;  1YW8 A;  2CW7 A;  4EJO A;  2ZNZ A;  2L4M A;  2DYR H;  3MCZ A;  1LJ9 A;  3CQZ J;  2QF7 A;  4GGG A;  1FZP B;  2BE5 F;  4BHB A;  1HCR A;  1V5E A;  3F21 A;  3GFL A;  2VOP A;  3PL8 A;  2OQG A;  4AYB N;  1OYW A;  2GA2 A;  5E8I A;  3TBI A;  1I50 J;  2V26 A;  5A2Q Z;  3FX3 A;  4G6T B;  2BZT A;  1WRJ A;  3TW7 A;  2JA2 A;  2E35 A;  2L9S A;  3M8E A;  2MH9 A;  2IEK A;  4FX0 A;  4BXF A;  1TWA J;  1Y1W J;  4QWQ A;  3F3X A;  3KYC B;  4HA8 A;  2JTV A;  3HL2 A;  1FSE A;  2GOM A;  2XSJ C;  1MSF C;  2A61 A;  3FXL A;  4D0P A;  1S8N A;  4DIQ A;  4AUX A;  3H5R A;  1YQA A;  1P4W A;  2FML A;  2HXI A;  1MIJ A;  2K27 A;  1A31 A;  4HV5 A;  3ZQH A;  2GQQ A;  3GUD A;  4A3B J;  3VOD A;  3PJR A;  1J2X A;  3HOX J;  2EWN A;  4WCG A;  5KAI C;  2MC3 A;  1YW9 A;  2XAJ A;  4RS8 A;  5DD4 A;  1H88 C;  2DA3 A;  4LIT A;  3O8G A;  4BNC A;  1VZ0 A;  4EJT A;  4G8X A;  2WAQ N;  1Z1D A;  3LOC A;  3PFY A;  3HKZ N;  3L1P A;  4U87 A;  1SMY F;  4L9N A;  2JA6 J;  4MTD A;  2A07 F;  2CV2 A;  2B0L A;  1TWG J;  5ILV A;  2LR8 A;  3G6E I;  3ABU A;  1XCB A;  2X6W A;  3NEU A;  2V1X A;  2QM3 A;  3DBH B;  1SFE A;  3ECH A;  2GIV A;  3WHB A;  2MLK A;  2E36 A;  1FOW A;  2DA1 A;  5K5R A;  5C44 J;  2VJI A;  2M1B A;  4E7L A;  3MN2 A;  1R5G A;  5J47 A;  4I0B A;  2WAF A;  4F91 B;  4E7J A;  1QA6 A;  2M5W A;  2DXI A;  1UHS A;  1IV8 A;  3FWE A;  2GZW A;  4A12 A;  2MBF A;  1CF7 A;  1FOX A;  4N4N B;  1R58 A;  4HEA 2;  3OY9 A;  3GTP J;  3QOP A;  4A5N A;  2P5V A;  4Q5S F;  2X85 A;  4FIS A;  1T95 A;  5E3L A;  1U6G A;  4HBL A;  3OIO A;  4A6E A;  2R7O A;  4P9U A;  3K2A A;  2CUJ A;  4C3H J;  2FE3 A;  2XF6 A;  2UV1 A;  2LC2 A;  2ZME A;  5FO5 A;  4KT5 C;  3K4L A;  3LSM A;  2QQA A;  4OAY A;  1ZYR F;  3W2V A;  1QZY A;  1JHH A;  5EGO A;  2QUF A;  3TGN A;  4A0Y A;  4RLQ A;  1NK3 P;  1K4T A;  4D7N A;  2CO5 A;  1IZ1 A;  2F4O B;  2E1M B;  3WTU C;  1QO0 D;  3OS2 A;  4GCV A;  1KYZ A;  4PJL A;  1HLV A;  3EUH A;  2M8G X;  4ITV A;  3LSK A;  4WXC A;  1BM9 A;  2F4I A;  5J40 A;  4U7D A;  2KIU A;  3JRC A;  2M0M A;  4CCN A;  1IXS B;  3BR2 A;  3K4K A;  3V7R A;  4NQW B;  2KDZ A;  2F5V A;  2NAZ A;  2VT2 A;  1BI2 A;  2JA5 J;  4UUS B;  3HUG A;  2Y9Z A;  3CMA I;  1QNT A;  3K70 C;  3BY6 A;  2M2E A;  5HLT A;  1IN7 A;  1UCR A;  3KET A;  3L7W A;  1X1B A;  3PUF A;  3R0J A;  3F72 A;  3WTX C;  2VAS A;  1MBH A;  2ZC2 A;  5D5X B;  4HX4 A;  4Y7N J;  4A3L J;  5GPC A;  3I59 A;  2QCO A;  4S0H B;  1MMS A;  1EF4 A;  4BGD A;  4ZTJ A;  2DMN A;  3SXY A;  4XLE A;  4A93 J;  3CES A;  1B72 B;  3BPX A;  3BZK A;  2YSR A;  4Y52 J;  2COB A;  2CQ7 A;  2JMW A;  1TNT A;  4U0V A;  2F5D A;  3LSP A;  4UVC A;  2WV1 A;  1O3T A;  4ETS A;  1QVU A;  2V1N A;  2XPV A;  2ZJ2 A;  2ZXH A;  1XGS A;  1U2W A;  3A0B C;  4PSX A;  5D4S A;  4HQE A;  4M72 A;  1X3U A;  3J7Z I;  4DYR A;  3ZMD A;  4MFD A;  3SEQ A;  1D0Z A;  3I4P A;  4AC0 A;  1X4O A;  1BJZ A;  5GAH J;  1JUS A;  3T8R A;  1XMA A;  1GLN A;  2CUF A;  4PZJ A;  1EH8 A;  3S14 J;  1MMG A;  3SEZ A;  5ILU A;  1IJW C;  3ROU A;  4BL0 B;  1PUF A;  2ISZ A;  3OL4 A;  3I4N J;  1TQI A;  5E20 A;  3WHC A;  1G8X A;  1X1D A;  1R7J A;  2QZ8 A;  3NWS A;  2PJR B;  2ZJQ F;  1R1T A;  2CW0 F;  3HXL A;  2RGV A;  3PSI A;  3MKW B;  1TC3 C;  1GVD A;  1I3A A;  2TRT A;  4EM2 A;  1FNN A;  3NAU A;  1AA7 A;  1OIS A;  1X2N A;  2V9K A;  5H2F C;  1MZB A;  2VBY A;  1PVE A;  5HDK A;  4G12 A;  1ACI A;  1F43 A;  2L9R A;  1TQM A;  2JRM A;  1U78 A;  3E6M A;  3K69 A;  3HJE A;  1FPQ A;  4D5C A;  5F0C A;  1FMW A;  2VOO A;  3ZGK A;  4M3E A;  4I01 A;  5F08 A;  3ZP5 A;  5H20 A;  2YPR A;  1D5V A;  5LHI A;  3PNV A;  4EVI A;  3CF5 F;  2Q2E B;  2K9M A;  3TO9 A;  2X1C A;  4A0Z A;  1BI0 A;  3JAM Z;  4M3F A;  3FIS A;  3F8C A;  4Y13 A;  1D8J A;  1K78 A;  2M9H A;  4D5F A;  1P4X A;  4YFK F;  3WU2 C;  1G3T A;  3W3C A;  1W5S A;  1YX3 A;  1XDS A;  3OYK A;  5IY5 H;  2CSO A;  2VJ5 A;  4G7Z F;  3K9T A;  1XG1 A;  3OWT A;  5D8L B;  4ENN A;  1BL0 A;  2FSW A;  2AXT C;  1I27 A;  3QYF A;  3E5Q A;  1ODD A;  3TDZ C;  3BTJ A;  4KA4 A;  2IS2 A;  2FF4 A;  3QOD A;  3WTT C;  4R8H A;  3JRG A;  1HOM A;  2XGD A;  3TOA A;  4E4H A;  3OYE A;  1ZEL A;  1RRJ A;  4KIB A;  2DAO A;  4L9V A;  4LMY A;  2Y2Z A;  2XC7 A;  4BAC A;  1FYM A;  2R7X A;  2FD5 A;  5J4V A;  5L3C A;  3OYG A;  4C9Y A;  2BVM A;  3LQQ A;  4JOM A;  3IHU A;  1W5C C;  2KHM A;  3M1C A;  3ZRG A;  4KYW A;  1QZZ A;  2X0L A;  2HEO A;  5HOD A;  3B73 A;  4KN4 X;  3DKX A;  2H1L A;  5LBQ A;  1Z6T A;  2D5V A;  4HNU A;  3DPL C;  1EJ9 A;  2XAH A;  2B9S A;  2W57 A;  3GCM A;  2EIN H;  2G7U A;  4DZP A;  3I64 A;  4E7I A;  1P7I A;  2MG4 A;  4IRH A;  4DGW B;  1UG0 A;  1HDP A;  1G4D A;  5BPI A;  2PLY A;  1BR2 A;  4E6K G;  2K40 A;  2WC2 A;  1W7P A;  1BW6 A;  2HVQ A;  3KX2 A;  4EJV A;  3E6C C;  2V9V A;  3K1M A;  2JQ7 A;  3BJO A;  4A69 C;  2HVS A;  3RZD J;  3E6B A;  1ZH5 A;  3J81 K;  4N9H A;  3S1Q J;  1REP C;  2ZNY A;  1BI3 A;  2CRG A;  5TGT A;  4X0G A;  3RTR A;  4FAS D;  1TT5 B;  3BG5 A;  1U5T B;  1R00 A;  2K9L A;  3ZQC A;  2K85 A;  1IXC A;  3IP4 B;  2FBI A;  3BP8 A;  2X9D A;  4BQA A;  2XV4 S;  1B9M A;  1QVT A;  3RSN A;  1HBX G;  2RDP A;  4ZZD A;  1UAA A;  4ANJ A;  4KT6 A;  3VB2 A;  3AL0 B;  1R23 A;  4FT8 A;  4EQQ A;  3KYL A;  5K7Z A;  1SD6 A;  4G6Q A;  4UVB A;  5IP9 J;  4EV0 A;  5LGT A;  3GYH X;  1JUM A;  1BA5 A;  2QSG X;  1XGO A;  4H4K C;  1H89 C;  2MAB A;  1JTY A;  2HOE A;  1YI2 I;  1BOB A;  2DFH A;  3OOU A;  4Y3O A;  2L0K A;  2MD5 A;  2BYV E;  2Z16 A;  1B4A A;  3QAH A;  3ZMS A;  2H1K A;  4PSW A;  2V79 A;  3BQZ A;  2ECC A;  2M8E A;  4XRM A;  2ID3 A;  2ELH A;  1DU6 A;  1N75 A;  3H1C A;  1Y0N A;  1IDZ A;  1DGW Y;  2LBF B;  9ANT A;  1W36 D;  3L2V A;  2ZSH B;  1Y1V J;  2RV8 A;  2R7W A;  3ASN H;  4LK1 F;  4RMN A;  1S6L A;  2VPR A;  2HVR A;  4CCK A;  3TQN A;  1H9T A;  3NAR A;  4P9F A;  1YHQ I;  1ZN2 A;  3PO2 J;  4V2G A;  1P6R A;  2HQ5 A;  3VDX A;  1RZ4 A;  5JHU A;  3S16 J;  3HZJ A;  2JUG A;  2P81 A;  3S3N A;  4B43 A;  4F3Q A;  3D0S A;  1OR7 A;  1YIO A;  3F0C A;  4DJA A;  3FXU A;  2IRF G;  4B44 A;  1ZRF A;  3OIQ A;  5JLW A;  3ZQL A;  3RI4 A;  1X19 A;  1U9O A;  3F8B A;  5FKK A;  3GFI A;  5LLQ A;  1O57 A;  1ZRC A;  1XC5 A;  2PMU A;  4PCQ A;  1TW3 A;  1ETO A;  2CQQ A;  1D5Y A;  1VQN I;  4B4C A;  2VKH A;  2Z3Y A;  4UV9 A;  2Y0S N;  3DCF A;  3J81 Z;  1HKS A;  1IRG A;  3OYL A;  1BW5 A;  4UUV A;  1EH7 A;  2DT6 A;  4P96 A;  2RKH A;  1NK2 P;  1HW1 A;  3G1O A;  1LVK A;  2DMQ A;  1K83 J;  5LGU A;  1JT6 A;  2CFO A;  4IQ4 A;  3BR6 A;  5FKM A;  2F6C A;  2WY7 Q;  2LFB A;  4B8X A;  3FKI J;  5CVU A;  1FX7 A;  3BDD A;  2CWE A;  3BG9 A;  1W7P D;  5BMZ A;  4W1U A;  2EZI A;  4G94 A;  3A0H C;  2P4W A;  3VPR A;  2MC4 A;  4Y15 A;  1QBJ A;  1FSH A;  2QQ8 A;  1V54 H;  2W24 A;  2VJ4 A;  4KIS A;  3CUO A;  4JQF A;  3MKZ A;  3EET A;  1LE8 B;  4YG2 F;  5M5Y J;  3L9F A;  3JTG A;  1FYL A;  4L5E A;  1T0F A;  1G3W A;  2KDO A;  4NQW A;  4OAZ A;  5FLM J;  1R49 A;  1OPC A;  2OZU A;  4UUS A;  2STT A;  4BXU A;  4YIF A;  4B48 A;  5IP7 J;  1IRF A;  1FTZ A;  1ERD A;  2PMZ A;  3I53 A;  5ICC A;  2LF8 A;  3HG9 A;  1O3S A;  2N8G A;  3OR2 C;  3A1Y A;  3CCS I;  4BE0 A;  4IKF A;  2W48 A;  4M9X A;  3Q0V A;  2WTE A;  4NDL A;  1SMT A;  1BJA A;  4MIM A;  1VQP I;  3LAJ A;  1IN6 A;  3FXQ A;  1PUE E;  2KZG A;  1B72 A;  2V4J C;  3C2H A;  4C3J J;  2H8W A;  5HLH A;  4MEY F;  1MNE A;  2FMY A;  3HOU J;  1VQL I;  2XSD C;  2NS7 A;  3F23 A;  5EZG A;  1MMN A;  2K3F A;  3LAP A;  4AVP A;  1HW5 A;  2FEZ A;  1JKQ C;  3CUQ C;  3CMY A;  3RQ4 A;  1ZAR A;  5M3F J;  2L3D A;  4FE7 A;  2VQL A;  3NRV A;  3GTJ J;  3MKL A;  5DTD A;  4BKX A;  2XAS A;  3BJA A;  1IAW A;  2PJR A;  4L9J A;  2VXD A;  1ZKG A;  2ZXJ A;  2AXL A;  3FMR A;  5ICF A;  2HDD A;  1DPR A;  3DQV C;  2ZXI A;  3WGI A;  1Z77 A;  4HOB A;  1RIO H;  4KIC A;  3UKG A;  3A01 B;  2XGX A;  4QSH A;  1QPM A;  1LB2 A;  1DGR M;  5A2Q K;  3ERM A;  5HVQ C;  4A5M A;  2YU3 A;  2DI3 A;  5BS6 A;  1XMX A;  4M6Y A;  4CCL A;  1OCP A;  3I0T A;  4A3G J;  4UXN A;  3QYE A;  2DFF A;  1YS7 A;  4L0Z B;  4M71 A;  5FJ8 J;  2F2E A;  2OCE A;  2OZ6 A;  4N0B A;  1QQI A;  4XIC A;  2ZB9 A;  1B1B A;  2Q2E A;  2NVU B;  1JXS A;  2AQF A;  3S2D J;  2GWR A;  1LNW A;  4XMY A;  2O7O A;  1I3Q J;  1Z7L A;  2PMZ N;  3JRH A;  3S2W A;  5BPD A;  3L2C A;  1XGN A;  3CLO A;  3HEF A;  3MFK A;  2FOW A;  5J1Y A;  1BI1 A;  3HB9 A;  2ELK A;  2W7N A;  4HRI A;  4EGY A;  3AAF A;  3PSF A;  1KQ0 A;  2MA3 A;  3G2B A;  2E1C A;  1WKM A;  3FHZ A;  1Z21 A;  2EIK H;  3M4O J;  1XPX A;  2KKO A;  4ZTF A;  3SDB A;  5LEJ A;  4CCJ A;  4BH9 A;  5M5W J;  5E1Z B;  2EK5 A;  2NS0 A;  4PUS A;  3LFK A;  4CYD A;  2XAG A;  5IYD J;  1OKR A;  2VBX A;  4M3G A;  1MMA A;  3M1E A;  4ENM A;  2PX9 A;  2WAQ A;  4CCO A;  4GFB A;  4IOA F;  3CP2 A;  3HKZ A;  1NTC A;  1TWC J;  5GP9 A;  4BU2 A;  3AKZ A;  4EGZ A;  3TMO A;  4AD9 A;  3IV5 A;  3AG2 H;  4H0E A;  3IKV A;  2EZH A;  3SQN A;  2LKS A;  3I3L A;  1SD7 A;  2VC0 A;  3OMY A;  5TIS C;  4JBA A;  5E8G A;  3S32 A;  3OYM A;  2QYO A;  2ZFW A;  1HDD C;  1G6N A;  3AG1 H;  3D5L A;  2I10 A;  3HC7 A;  3M8J A;  1P2F A;  5EJC A;  3L2Q A;  3C3W A;  3OIP A;  3COA C;  2IAI A;  4J00 A;  1MBK A;  4UV8 A;  4M3B A;  3N97 A;  3FZV A;  1X1A A;  5DM7 F;  3BR3 A;  2IP2 A;  1I1G A;  4YEL A;  2E2J J;  4KMU X;  3Q0W A;  1W0U A;  1OCT C;  2I8D A;  4ZYG A;  3G3Z A;  2I5U A;  5K7H A;  2P6S A;  3LNQ A;  3K1P A;  2IBD A;  2XRO A;  2ZME C;  3J7A Y;  1QGP A;  2XAU A;  1QZE A;  4LJZ F;  5IOY A;  3LL7 A;  4OIO F;  3WTY C;  1ETK A;  4BQQ A;  2CV0 A;  2WAE A;  2KQR A;  1FYK A;  1KA8 A;  1YX5 A;  2PMH A;  4I7H A;  4B3X A;  1OMI A;  3JTH A;  3BCB A;  1VQK I;  2K5C A;  2BHY A;  4XL9 A;  3RKW A;  4WXH A;  4P1W A;  3EUH C;  5H6R A;  2LK2 A;  5KCM A;  4KMF A;  4XLP F;  2G7H A;  2ME6 A;  1E0E A;  2MLG A;  2E60 A;  3K4N A;  5K7F A;  2LKX A;  1GHC A;  3LA2 A;  1NH3 A;  2KPM A;  1WCM J;  1QPI A;  2W25 A;  1U9N A;  4RGU A;  4RDU A;  3G1M A;  3OYI A;  2GIZ A;  1UMQ A;  2GBY A;  3PNT A;  5K1Y A;  4DBQ A;  2LTP A;  1WJ5 A;  3S93 A;  3ZQF A;  1YRN B;  3GTQ J;  2QQB A;  2XRN A;  1WZ2 A;  4L9T A;  1YE9 A;  4YEJ A;  3DLL F;  5HLG A;  2GXA A;  1U5T A;  2DA6 A;  2QQ9 A;  3EQL F;  3KP6 A;  2JA7 J;  4FE4 A;  3OSG A;  4UUT A;  4ZDO A;  1V3F A;  4ABZ A;  4PK4 A;  5FRO A;  4AIJ A;  3W2A A;  5FRN A;  4ZJZ A;  3LA7 A;  5E79 C;  2HZT A;  3S1M J;  1LDD A;  3V4G A;  2B63 J;  3MD2 A;  2XPW A;  4EM0 B;  2CG4 A;  3BR5 A;  3H5A A;  3E0J B;  4PDK A;  1IGN A;  2VOD A;  3J7A O;  3BTI A;  1IN5 A;  3FF5 A;  2CH0 A;  2FJ1 A;  3RPU A;  2CS3 A;  2D1H A;  1ZRD A;  3IRQ A;  1RR8 C;  3SFI A;  2OV7 A;  3FXR A;  1T2K A;  1KU3 A;  3TO7 A;  3HOV J;  2KP6 A;  4C3I J;  4J01 A;  2W4S A;  3GX4 X;  1R36 A;  4NC6 A;  2LBF A;  3IH2 A;  3A02 A;  4MEX F;  2R7Q A;  4IRG A;  3FBN B;  3H0D A;  4IHY A;  4DBR A;  4XKV A;  5AIP A;  4BEH B;  5L3F A;  5D5U B;  2EA2 A;  1JKR C;  1FBS A;  1R6R A;  4KIG A;  2X51 A;  2Z9O A;  4CSW A;  3A2K A;  1X1P A;  2L7K A;  4ESJ A;  3N05 A;  1U0J A;  2ZSI B;  3ZCO A;  3Q3S A;  4C30 A;  2OF7 A;  3EDP A;  2ADU A;  1HST A;  3HHH A;  2EBI A;  5KNL A;  2PQ8 A;  1EKE A;  3P7N A;  4I0A A;  1KU2 A;  5IP6 A;  5DUI A;  3QRF F;  3GZ5 A;  1XMK A;  4WX9 A;  1WQ2 A;  4ZYH A;  3FIW A;  3ABT A;  1RKT A;  4CZC A;  4KNY A;  3K7A J;  1J0R A;  1R5H A;  3AG4 H;  3BR1 A;  4IHV A;  4KN7 X;  4RLF A;  3RDI A;  2F4M B;  3JAM K;  3GBG A;  5F04 A;  4ZYA A;  3ZOB A;  3C18 A;  3ELK A;  3R0A A;  3DV8 A;  4A3F J;  1W36 C;  2DOE A;  3K2Z A;  1OFC X;  2KRC A;  4LG3 A;  3LSJ A;  2JJ7 A;  3Q5F A;  2EV5 A;  4LK0 F;  3T5X A;  3OL3 A;  3GW2 A;  3QWL A;  2DQL A;  3L2R A;  2DTR A;  2VLA A;  2ICW G;  1IO2 A;  2QWW A;  1HXD A;  4F55 A;  4U88 A;  2KIS A;  1YLF A;  3SYT A;  2R3S A;  3KLN A;  4NBQ A;  2K02 A;  1BR4 A;  1N25 A;  3F8F A;  2R4G A;  1S72 I;  2G0E A;  3VFZ A;  4S04 A;  2IGM A;  1X1C A;  1GV5 A;  2WV0 A;  4UB8 C;  3H36 A;  3LWF A;  2Q1Z B;  2R7D A;  1ZGJ A;  1Z6R A;  2FQ4 A;  2M4G A;  4LGW A;  4MQV A;  2ZJP F;  1R22 A;  4C2M J;  1LE8 A;  2M34 A;  3CCJ I;  4DQ2 A;  5DUK A;  4G7O F;  4X1E A;  2EIM H;  2ISY A;  2P5L C;  2M3A A;  1W0T A;  4LLL A;  3MKY B;  3ZMZ A;  4ZDL A;  3DWL E;  4L5I A;  2BHZ A;  2XVC A;  3DPT A;  1MJ9 A;  2K3P A;  1OLT A;  2BY0 A;  2LY9 A;  3HGY A;  3P9C A;  3WTV C;  3DXJ F;  4GDF A;  1ZAO A;  3KE2 A;  2MYS A;  2JSC A;  3LSI A;  4MO7 A;  3S8P A;  4YFN F;  5IT3 A;  5J1U A;  3IAM 2;  3BOQ A;  1RI7 A;  4IHT A;  4JX4 A;  5F27 A;  1R1V A;  1SFO J;  5DEQ A;  1LEA A;  1B6A A;  2MFZ A;  3V8L A;  3GXO A;  5HOO A;  2AS5 F;  1TWH J;  3TKY A;  2X6Y A;  1JKP C;  2VN2 A;  1RUO A;  2H6C A;  3RPU D;  5LFA A;  1ON1 A;  3OS0 A;  3ZR8 X;  3CC7 I;  2W85 A;  4XLH A;  2D45 A;  4C2T A;  2XF7 A;  3BWG A;  1XB4 A;  3FXK A;  5CVJ A;  3WGH A;  4BQN A;  5KHD A;  2KIM A;  3DLA A;  3HRT A;  4CGZ A;  4Q47 A;  3LMM A;  2W84 A;  3N4M A;  3GTM J;  2O03 A;  3PQJ A;  3ZMT A;  1POG A;  1ZG5 A;  2NYX A;  2M7B A;  3A01 A;  2NRA C;  4MHG A;  1RPW A;  1JUP A;  2KZV A;  4U7B A;  5FKO A;  5DCF A;  1VI0 A;  4EJU A;  2FXA A;  3ERE D;  3CCV I;  3CJR B;  1HSJ A;  4ON0 A;  2GLO A;  3MMY B;  4U0Y A;  1LDJ A;  1ZR4 A;  1Z67 A;  3OYB A;  2DFI A;  3OYC A;  4DNC A;  1K4S A;  4GO1 A;  1Y39 A;  1R9T J;  3ASO H;  4BE1 A;  3OOP A;  3RKX A;  2UXN A;  4CH7 A;  5IYB J;  3M3Y J;  4KDP A;  2LH9 A;  5FD5 A;  1FJL A;  1P4A A;  2DMU A;  2Y69 H;  4S05 A;  3S1R J;  4A3D J;  1G59 A;  4HDU A;  2NVT J;  3FHN A;  2H8R A;  4KUM A;  4XID A;  3E5U A;  1IXR C;  3JRD A;  1LDK B;  2Z33 A;  2DJI A;  4HNT A;  5EEG A;  2IS4 A;  3CC4 I;  4FCY A;  2B7E A;  1MJA A;  1GT0 C;  3DBR B;  3CO7 C;  4MQ9 F;  2GA1 A;  3OYJ A;  4DZJ A;  5LHH A;  1VTN C;  3RZO J;  2DA5 A;  2EH3 A;  4XN0 A;  1MNM C;  1D1C A;  1P7J A;  1V5G A;  1SVL A;  2OPT A;  3TP3 A;  4XSZ F;  2QLZ A;  2DYS H;  1RR7 A;  3I5U A;  1Z0X A;  1Z91 A;  1L3L A;  4CYC B;  3KEO A;  2QA4 I;  2Z2S B;  1ETQ A;  2F48 A;  4NNJ A;  4G7H F;  4OIP F;  1TP4 A;  1SVO A;  1BR1 A;  4HF0 A;  1Z3Y A;  3K4M A;  3DTI A;  1IW7 F;  1OR7 C;  3LFU A;  3W2W A;  3CCR I;  2XUB A;  1ZTR A;  3KZY A;  5ED4 A;  1K79 A;  4MLO A;  1S7E A;  1KQ8 A;  1V4R A;  2E1O A;  1XDU A;  2K4B A;  2P7V B;  3M8F A;  2IXS A;  2NNY A;  2R5Z B;  1V55 H;  3GVA A;  3FMS A;  3WTS C;  1LVA A;  5KK1 A;  3HSE A;  3ZXS A;  2NS8 A;  3CJT B;  2YUS A;  2JK3 A;  1IG7 A;  2EFP A;  2FNP A;  3KEQ A;  4HYE A;  5J4Y A;  4I2O A;  4R79 A;  2XRL A;  2YS9 A;  3OYH A;  5AON A;  3LSG A;  2JZY A;  2GAU A;  1OCC H;  4D9J A;  1MKM A;  4OWR B;  2V9P A;  4HV6 A;  4E7K A;  2E1M C;  2Y0S A;  4NUB A;  4IQJ A;  2WA0 A;  2DTZ A;  2XKP A;  4UNO A;  2UWM A;  3EPZ A;  3PFI A;  1F1Z A;  1RC9 A;  3QU6 A;  4GRI A;  1IN8 A;  3CCE I;  3OS1 A;  3ABK H;  5CJ9 A;  4V2F A;  1T98 A;  2IJL A;  5GAD J;  2OTJ I;  2IPQ X;  2LP0 A;  4XKW A;  3JR9 A;  1MBF A;  5EF6 A;  1WH5 A;  4NC7 A;  3Q0U A;  5E1W A;  4A3E J;  3WOD F;  3G71 I;  1T0F C;  4ESF A;  1VQ7 I;  2Z1D A;  2VIX A;  1YRN A;  1B59 A;  2HQR A;  3BLY A;  4XQF A;  3ZMU A;  3IL2 A;  4ENK A;  3E3V A;  5LRS A;  3JRI A;  4DW6 A;  2ZCW A;  2L7M P;  2XDV A;  1KGS A;  2DLL A;  2QSF X;  1J09 A;  4XLN F;  2MGQ A;  1IUY A;  4XOR A;  2FX0 A;  2QEN A;  1O7F A;  2VXZ A;  4W97 A;  4FX4 A;  2OC6 A;  4QLC U;  1Q1V A;  1PP8 F;  2EZK A;  2VBW A;  4OMY A;  2VBZ A;  2BV6 A;  1ZQ3 P;  5JVG F;  1CF7 B;  1XD7 A;  5F64 A;  4ZZL A;  1XGM A;  1LFP A;  1Z3X A;  2HTJ A;  3K1N A;  1T33 A;  2HYG D;  1AOY A;  2G9W A;  2FA5 A;  3RCO A;  4HPQ A;  2HQN A;  2Y0M A;  2VI6 A;  5CKT A;  2TCT A;  3VEP A;  4ASN A;  1FP2 A;  1WI9 A;  3DKY A;  3ABL H;  4IZZ A;  2H94 A;  3K70 D;  3C2B A;  2VQH A;  2Z5U A;  3I4M J;  3NQO A;  2CFX A;  4BEH A;  4L0Y B;  3QP6 A;  2IVM A;  5HNF A;  1MSE C;  3QQA A;  5F0F A;  1YTY A;  3BTL A;  3B6C A;  1QHG A;  2XHK A;  3DPU A;  2O3F A;  2KMU A;  3F8N A;  3QP5 A;  4GXO A;  4BHP A;  1H9G A;  2VT3 A;  4I02 A;  3BC8 A;  4CO8 A;  4M6V A;  3T0Y A;  3OYF A;  1I39 A;  2QKL B;  2ID6 A;  3DEU A;  4KIT B;  2JSP A;  4IL6 C;  2QVO A;  2DA4 A;  3HHG A;  3PQK A;  2AQE A;  3F8M A;  5D6E A;  4A6D A;  2D1V A;  4C2U A;  1Q1H A;  1E3O C;  1WJC A;  2RRE A;  4A3K J;  1RES A;  1BN5 A;  2JVG A;  4XLF A;  2HPI A;  1LKX A;  3Q9V A;  2QGU A;  3CJQ B;  1TT0 A;  2ZO4 A;  2VB6 A;  3QPL A;  2LRD A;  2K7L A;  3VYU B;  1EV7 A;  4A0X A;  1MDM B;  2M87 A;  3V8J A;  3U9G A;  4IRI A;  1XN7 A;  3E1S A;  2V6C A;  1SC7 A;  2XB5 A;  4RA2 A;  3QYB A;  3BG7 A;  1T56 A;  4KIF A;  2DPU A;  3I71 A;  2PFB A;  1JGS A;  1I6H J;  1QHH D;  1W1W E;  3M9A A;  2IGN A;  3LA3 A;  2L4A A;  1BIB A;  4HSR A;  4DOZ A;  3OR1 C;  2Y75 A;  5EG0 B;  3PIP F;  3GF2 A;  3RQI A;  4M73 A;  1GUU A;  1A6I A;  2YU9 J;  2EFW A;  3WU1 B;  1SFK A;  2EIJ H;  2HQA A;  2WY8 Q;  4M9Z A;  4FQG A;  2LNB A;  1KON A;  1TBX A;  3CLQ A;  4P55 A;  5K5O A;  2HTS A;  2L01 A;  3MWM A;  3BTC A;  5D5W B;  2A69 F;  1LQ1 A;  3I58 A;  1G2H A;  2H27 A;  5CVV A;  4MFE A;  2E2H J;  4AM3 A;  2YR2 A;  1U8B A;  4EJW A;  3QPH A;  1XSD A;  4IF4 A;  2DW4 A;  3IWZ A;  3S2H J;  1RUN A;  3GFJ A;  2XGE A;  3P9I A;  2RQP A;  4BJ6 C;  2OTL I;  3W6J B;  4AIH A;  1R4N B;  2W1O A;  2RNJ A;  1WGX A;  2NVX J;  2PI0 A;  4I98 B;  2PN6 A;  1FY7 A;  4HF1 A;  3EUA A;  1ZK8 A;  3GEZ A;  2CUZ A;  1RKW A;  2W00 A;  4A3C J;  1S5L C;  5J3L A;  4XLA A;  1Y6I A;  4XRS A;  1C0W A;  3K6G A;  4XN3 A;  2L54 A;  2JWT A;  3SFZ A;  3RIR A;  1AHD P;  1GVJ A;  5B66 C;  5DM6 F;  2V7F A;  4HNV A;  5ICG A;  5L3B A;  3OYD A;  2HGC A;  2XGC A;  1ETV A;  4M3D A;  4HLY A;  1G3S A;  3I9V 2;  4YFX F;  3P9K A;  4HLX A;  5J8C A;  4X6A J;  5L3D A;  4ZYE A;  3H0G J;  4IOC F;  1K7A A;  1IF1 A;  2DT5 A;  1E3P A;  3NWT A;  1OCZ H;  2VL8 A;  2FU4 A;  1UG2 A;  3CCQ I;  5FFZ A;  4BAY A;  1WVR A;  3HSR A;  2KL4 A;  2JT1 A;  4II2 A;  3U1K A;  3DFG A;  4NHJ A;  3C2G A;  1FP1 D;  3WE2 A;  2PEX A;  2OU2 A;  1U5T C;  2DOD A;  3HOT A;  1WJD A;  4OMZ A;  4LIU A;  4LG0 B;  2K4J A;  2Y48 A;  3B6A A;  2RQQ A;  1OCR H;  1DP7 P;  1T08 B;  2OD5 A;  3IH4 A;  4CA0 A;  2R92 J;  3CD6 I;  2UUZ A;  2DK8 A;  2JA8 J;  1R71 A;  3AL0 C;  4IXA A;  1VQ5 I;  4UHT A;  2KLO A;  3HRM A;  5CQG A;  3ZQ7 A;  1MBJ A;  1AWC A;  4XKB A;  3TW6 A;  1TWF J;  2EJR A;  2LDU A;  2CMP A;  4F7Z A;  2R5Y B;  1WJA A;  1A04 A;  3HM5 A;  3CDH A;  2O9L A;  2EIL H;  1XS9 A;  1UST A;  2E7X A;  4PJM A;  2HYJ A;  2DQR A;  3D5R C;  4JX5 A;  4HX7 A;  4N9I A;  1SAX A;  1PJR A;  2BW3 B;  3T8T A;  1GV2 A;  3V7C A;  1PP7 U;  2O8K A;  4FET A;  2P6T A;  3PUB A;  3J80 Z;  4NC8 A;  3H9J A;  4JYK A;  2VQG A;  1MMD A;  3O8H A;  2LLK A;  2HFH A;  2KJC A;  3ESW B;  2DMT A;  2YX4 A;  4R1H A;  4P5O A;  2HOA A;  3RPQ A;  1X2M A;  4WK8 F;  1EH6 A;  2CUE A;  3AFH A;  4CCM A;  1JJ6 C;  2A3S A;  5HDG A;  2GXG A;  4B47 A;  3H5N A;  3FDY A;  1LUJ B;  5HNH A;  5BOX A;  1T39 A;  4XRF A;  4OOI A;  2O6G E;  3GO5 A;  3HDD A;  5CPR B;  3K0L A;  3VOE A;  3QU3 A;  1MBG A;  3RYR A;  3UNG C;  2C6Y A;  1DQU A;  1IUF A;  1YOV B;  3GFM A;  4CYC A;  4O3M A;  1QU3 A;  5DCM B;  4BDY A;  2K9N A;  4E70 A;  5B3S H;  3HPH A;  5EEH A;  5TRD A;  1JT0 A;  2E5N A;  1D8K A;  1TNS A;  5JHF A;  3E5X A;  4XLC A;  1MND A;  5KAF C;  4JK1 X;  2KFD A;  4E7H A;  3CO6 C;  2DA7 A;  1X3Z B;  4GYG A;  3JSP A;  4LB6 B;  3VSL A;  2R5Z A;  3HYI A;  3QPT A;  2HYF A;  1VQ8 I;  2A5W A;  2ZFU A;  5IOZ A;  1XSV A;  4M74 A;  3K4C A;  1HA8 A;  4WWC A;  3HGG A;  3L2U A;  1LFU P;  1ETW A;  2HR3 A;  3FMQ A;  1BC8 C;  3GTK J;  4A2U A;  3ZQQ A;  3M7G A;  2A6H F;  3WG7 H;  2JPB A;  3MEX A;  1ULY A;  2LF7 A;  2YX7 A;  1XX5 A;  4HG2 A;  1AKH B;  5L3E A;  2PBI A;  5FLX Z;  1YJ9 I;  3H9G A;  2FQ3 A;  1I5Z A;  2R7U A;  2OBP A;  2V6E A;  4LIV A;  5D8K B;  2F5E A;  5LD2 C;  3JRF A;  1YJW I;  4IHX A;  2MSY A;  2M30 A;  2IA1 A;  1ZGW A;  4BBS J;  3WE3 A;  2LKP A;  6PAX A;  2DN0 A;  3CCY A;  1H8A C;  4E7S A;  1I1S A;  2KIF A;  1W5T A;  3CP8 A;  5ILS A;  2LMD A;  1STZ A;  2EV0 A;  1K61 A;  1ZGA A;  1ZHF A;  5IT9 K;  2AHQ A;  2J5O A;  2VQC A;  2EV6 A;  2RC4 A;  2VON A;  3ZMV A;  3BG6 A;  1FOK A;  3X2Q H;  3IRR A;  1U3E M;  2HDW A;  3KEY A;  4PJN A;  5B5E C;  3GZ6 A;  1YIJ I;  3HOW J;  4E7Z A;  4UY8 I;  4XK4 A;  5E17 F;  2ESH A;  2E5Z A;  3QPS A;  1XSX A;  1MH4 A;  1KQ9 A;  3W6V A;  4LD5 A;  2HNH A;  2VUM J;  2WBM A;  4HF2 A;  3F22 A;  5LHG A;  4CIC A;  3BT9 A;  4J19 A;  1FWZ A;  5JFR A;  2P5K A;  5GTH C;  5HDN A;  4IHS A;  2DA2 A;  3S1N J;  1ORK A;  2BY2 A;  1A36 A;  5DS9 A;  4LFU A;  4HST A;  3KZZ A;  4Z6Y A;  2IW5 A;  1YS6 A;  2CQK A;  1RET A;  1HF0 A;  1TLH B;  1BBY A;  4A3J J;  2X1D A;  3V42 A;  1YYV A;  5FLV A;  3OYN A;  5KVR A;  3ONQ A;  3MVP A;  4Z2Y A;  4V19 K;  2AO9 A;  3WG9 A;  2XIG A;  1UZC A;  2R7F A;  2VKV A;  2BBY A;  2FBK A;  2VE9 A;  2M4K A;  4O5V A;  3LSH A;  2L02 A;  4HZF A;  1VND A;  1FBQ A;  4FHT A;  1R4M B;  1KU9 A;  3RJP A;  2A5Y B;  1WWX A;  1JI8 A;  2HS5 A;  3H3V K;  2IA0 A;  1ONV A;  3H35 A;  4HDV A;  4PFO A;  3JRA A;  2X4H A;  3I55 I;  4I76 A;  3L00 A;  1O4X A;  2EFO A;  3R6S A;  3AG3 H;  2LY1 A;  3FXO A;  5FD6 A;  1WPK A;  5EEA A;  2O5R A;  1NG6 A;  2IS1 A;  2E1N A;  3IUO A;  3PM1 A;  3U21 A;  1UFM A;  2DT7 B;  5J1R A;  2EPF A;  2IGK A;  4ENJ A;  1T6S A;  5K5Q A;  3WU0 A;  3CJN A;  1Y8Q B;  1ENH A;  1OYY A;  4PFP A;  2KRF A;  2FNA A;  3R4K A;  5BNG A;  2O8X A;  4Y33 A;  1SD4 A;  4F92 B;  2KRH A;  5DV5 A;  2R7T A;  1A35 A;  5IT9 Z;  3ABM H;  3FXJ A;  4CXF A;  2UZK A;  1U8R A;  1MDM A;  1J75 A;  2HPM A;  1UHM A;  4RM2 A;  3TL4 X;  1S7A A;  5AIQ A;  4ZYD A;  2L5Q A;  5FFX A;  2NVY J;  4MNU A;  2LSO A;  5FB2 A;  2GXB A;  1RNL A;  3EUK L;  4L18 B;  5FKN A;  3ML6 A;  3I56 I;  3MAJ A;  3BCA A;  4G6D A;  4LLG F;  3WGG A;  4U0W A;  3KP7 A;  3ECO A;  2VE8 A;  3ZQG A;  5EG0 A;  3OYA A;  3ULQ B;  2XKO A;  1IV6 A;  2BXY A;  4AID A;  4BDZ A;  3H92 A;  2FRH A;  3MZH A;  1VQ4 I;  2DO7 A;  1YG2 A;  1N77 A;  1Z7U A;  2ETH A;  5DDG A;  1ETX A;  4BS9 A;  4I6Z A;  1B8I B;  3DKW A;  1SAN A;  5GTI C;  3CCL I;  3CDL A;  3HBL A;  1MBE A;  1VQ6 I;  3RKY A;  2NOG A;  3TO6 A;  2JUC A;  1DU0 A;  4WF2 A;  1FTT A;  2CW8 A;  2X48 A;  4ZC3 A;  2X6O A;  3R60 A;  4XNF A;  3LST A;  3CCU I;  1YJN I;  2DDB A;  3CC2 I;  1MD0 A;  1E3H A;  4XBF A;  3FK7 A;  2QBY B;  1JE8 A;  1XTA A;  4B3A A;  5E1X A;  3G1L A;  3TP0 A;  5M3M J;  4RB3 C;  3QOE A;  4KFC A;  3S17 J;  2BXZ A;  3E7L A;  1J9I A;  3CMM A;  3F9K A;  4BHC A;  2DU9 A;  2K86 A;  2L2O A;  2R7R A;  1F5T A;  3O3K A;  4NB5 A;  2CGP A;  3G73 A;  3KPH A;  1FBU A;  1FMV A;  2LY2 A;  2HDC A;  4UVA A;  1OYI A;  2BEO A;  2O61 A;  3HRU A;  5TJJ A;  3SJM A;  1ZLK A;  2ME0 A;  2IS6 A;  2Y30 A;  5BQT A;  3GTO J;  4OIN F;  3G4S I;  1NG7 A;  2E2I J;  3CF2 A;  3ZN1 A;  3KP3 A;  3S3O A;  2P7C B;  2HI3 A;  2BY3 A;  3ZQI A;  2HZD A;  4M9S A;  2KIQ A;  5ERI A;  2JRT A;  2XF5 A;  3RKQ A;  4AIK A;  1JHF A;  3O6B B;  3A4C A;  4IEJ A;  4I09 A;  1BOA A;  2A68 F;  4LG0 A;  1CGP A;  4XKC A;  4IJA A;  5HLI A;  5B1A H;  5H6Q A;  2R93 J;  2WB1 A;  1ON2 A;  4RM3 A;  1PYV A;  3P5J A;  5CLS A;  3KCC A;  4QTR A;  2M45 A;  1KU7 A;  5C4J J;  1J7K A;  1R1U A;  1PDN C;  4IX7 A;  1DP3 A;  4Y4R A;  3W6K B;  1S9H A;  1Z05 A;  5J8F A;  2R5Y A;  3HIF A;  5D6F A;  1MJB A;  1V5F A;  3K4J A;  2VJJ A;  2LRE A;  1D1B A;  4JP0 A;  1WHU A;  2NVQ J;  1APL C;  4F52 A;  4QIW N;  1YIT I;  4XM3 A;  5GPA A;  1X3W B;  1OJL A;  2LG4 A;  2P8T A;  1USS A;  2BW3 A;  4RB0 A;  3DBL B;  3VSK A;  1FC3 A;  2IA2 A;  2K9S A;  1H0M A;  3S3M A; 
#chains in the Genus database with same CATH homology
 1A5J A;  2E2J J;  3BR2 A;  3Q0W A;  3GTL J;  1W0U A;  2KDZ A;  1OCT C;  3HOY J;  1WI3 A;  2XB5 A;  2JA5 J;  4UUS B;  5K7H A;  3LNQ A;  2IBD A;  1T56 A;  2Y9Z A;  5E3N A;  1I6H J;  2M2E A;  5IOY A;  1ETK A;  5EDN A;  5EG0 B;  1MBH A;  3RQI A;  4Y7N J;  1GUU A;  4A3L J;  5GPC A;  1A6I A;  2YU9 J;  2QCO A;  4S0H B;  1EF4 A;  2R7Z J;  2VKE A;  2DMN A;  1JGG A;  4A93 J;  1B72 B;  4Y52 J;  2COB A;  2L7F P;  2JMW A;  2LK2 A;  3LSP A;  5M5X J;  2ME6 A;  2WV1 A;  5K7F A;  2LKX A;  1QVU A;  2XPV A;  3BTC A;  1WCM J;  1G2H A;  2DMP A;  2XPU A;  2ECB A;  1QPI A;  4MFE A;  4DYR A;  1CQT A;  2E2H J;  1U9N A;  4MFD A;  4RDU A;  1U8B A;  4AC0 A;  3G1M A;  1UMQ A;  3BR0 A;  2WB1 N;  1BJZ A;  2GBY A;  1JUS A;  3S2H J;  2XGE A;  2CUF A;  2LTP A;  3ZQF A;  3GTQ J;  1YRN B;  3S14 J;  1IJW C;  1PUF A;  3I4N J;  1WGX A;  2NVX J;  3WHC A;  2DA6 A;  2JA7 J;  4FE4 A;  1ZK8 A;  3OSG A;  1AKH A;  1RKW A;  4UUT A;  5C4X J;  2EQR A;  4A3C J;  5J3L A;  4XRS A;  1TC3 C;  1GVD A;  4A3I J;  2TRT A;  4ABZ A;  4B1R A;  3NAU A;  2JWT A;  1AHD P;  1X2N A;  4HNV A;  3S1M J;  2B63 J;  4G12 A;  1F43 A;  2L9R A;  2XPW A;  4FTH A;  2XGC A;  3BR5 A;  1U78 A;  1IGN A;  1ETV A;  4D5C A;  4M3D A;  3BTI A;  3FK6 A;  5JLX A;  5F0C A;  2FJ1 A;  4X6A J;  4M3E A;  3H0G J;  5F08 A;  3SFI A;  1UG2 A;  5E3M A;  4LOC A;  3HOV J;  4C3I J;  4M3F A;  3FIS A;  3IH2 A;  4JX6 A;  2M9H A;  4D5F A;  3A02 A;  4IHY A;  2Y9Y A;  3B6A A;  1ZR2 A;  1JKR C;  3IH4 A;  2R92 J;  1XG1 A;  3PO3 J;  1BL0 A;  1ETY A;  1JTX A;  2JA8 J;  1MBJ A;  3BTJ A;  3Q3S A;  3DEW A;  5EGO B;  3TW6 A;  2CJJ A;  1TWF J;  2OF7 A;  4EEF G;  3JRG A;  1HOM A;  2R5Y B;  2EBI A;  2XGD A;  3HM5 A;  5IP6 A;  2O9L A;  1XS9 A;  3FIW A;  2Y2Z A;  1RKT A;  2HYJ A;  5F1J A;  2FD5 A;  4JX5 A;  3K7A J;  3BR1 A;  2XB0 X;  4IHV A;  1JJ8 C;  1GV2 A;  2CU7 A;  1LFB A;  2O8K A;  1FIA A;  3GBG A;  5F04 A;  3ZOB A;  4JYK A;  3O8H A;  4A3F J;  2LLK A;  5HOD A;  3GTG J;  2DMT A;  3S15 J;  1OFC X;  2D5V A;  2R0Q C;  3LSJ A;  2HOA A;  2JJ7 A;  1X2M A;  5IYC J;  2Y31 A;  2CUE A;  1JJ6 C;  4DZP A;  3JRB A;  1IC8 A;  3HDD A;  1P7I A;  2MG4 A;  1MBG A;  1IUF A;  1HDP A;  4CYC A;  5C3E J;  3TED A;  4DYQ A;  2G0E A;  2E19 A;  4BY7 J;  2K9N A;  1GV5 A;  1JT0 A;  1ITY A;  3BQY A;  2K40 A;  3OSF A;  5E3O A;  2FQ4 A;  1BW6 A;  4C2M J;  2RAE A;  1LE8 A;  2DA7 A;  2R5Z A;  2M34 A;  2GM4 A;  3SDG A;  5IOZ A;  4A69 C;  4X1E A;  3RZD J;  1W0T A;  3HGG A;  1LFU P;  3A03 A;  4XRS G;  3S1Q J;  1ETW A;  3GTK J;  2CRG A;  3HOX J;  2LY9 A;  1PUF B;  3HGY A;  3BG5 A;  5EZH A;  3ZQC A;  1QRY A;  2DJN A;  1AKH B;  2X9D A;  4MO7 A;  5J1U A;  3JRE A;  1QVT A;  3JRF A;  4IHX A;  2MSY A;  1B8I A;  4JX4 A;  5F27 A;  1VF9 A;  1ZGW A;  4BBS J;  1SFO J;  2DN0 A;  3CCY A;  5K7Z A;  1H8A C;  1TWH J;  1JKP C;  5IP9 J;  4BXX J;  1JUM A;  2LD5 A;  1BA5 A;  2L7Z A;  4D7M A;  1K61 A;  1H89 C;  1F36 A;  2AHQ A;  1JTY A;  3OOU A;  2L0K A;  1AU7 A;  2H1K A;  3BQZ A;  2ECC A;  2CQX A;  4XRM A;  2ID3 A;  3GTM J;  5FKL A;  3HOW J;  2HOS A;  1IDZ A;  2JN6 A;  1POG A;  4RBO A;  1FIP A;  4A3M J;  9ANT A;  4XK4 A;  1X58 A;  3QPS A;  1MH4 A;  3W6V A;  5IPA A;  3A01 A;  1Y1V J;  2VUM J;  1RPW A;  1JUP A;  3BT9 A;  3LSR A;  4J19 A;  5FKO A;  2VPR A;  1VI0 A;  1IRZ A;  2DA2 A;  3NAR A;  3S1N J;  1ORK A;  3PO2 J;  4V2G A;  5DS9 A;  2KT0 A;  2GLO A;  2HQ5 A;  1RET A;  1ZR4 A;  1HF0 A;  1VFC A;  3S16 J;  4A3J J;  1R9T J;  5FLV A;  2P81 A;  2MW8 A;  5IYB J;  3M3Y J;  3MVP A;  2AO9 A;  3F0C A;  1FJL A;  2DMU A;  3BG3 A;  3S1R J;  4A3D J;  2VKV A;  5JLW A;  3ZQL A;  2NVT J;  1U9O A;  5FKK A;  2H8R A;  1XC5 A;  1VND A;  4XID A;  1ETO A;  2CQQ A;  3JRD A;  1D5Y A;  4B4C A;  4BY1 J;  2Y0S N;  3DCF A;  3H3V K;  4FCY A;  1GT0 C;  2EZL A;  1BW5 A;  3JRA A;  4DZJ A;  3RZO J;  4I76 A;  1O4X A;  2DA5 A;  2EH3 A;  1MNM C;  1JKO C;  2LVS A;  1P7J A;  1NK2 P;  1WPK A;  5EEA A;  3G1O A;  2OPT A;  3TP3 A;  1IDY A;  2DMQ A;  3PM1 A;  1K83 J;  1JT6 A;  3HOZ J;  3IH3 A;  1RR7 A;  3BR6 A;  5FKM A;  5EYR A;  1Z0X A;  5J1R A;  4DYC A;  2LFB A;  4CYC B;  1ETQ A;  3FKI J;  3BG9 A;  1ENH A;  1FEX A;  5BNG A;  4W1U A;  2EZI A;  3VPR A;  1ZTR A;  4MLO A;  1S7E A;  3D1N I;  2E1O A;  2K9Q A;  2M0C A;  1LE8 B;  5M5Y J;  4BBR J;  2R5Z B;  4L5E A;  5FLM J;  4IHW A;  1MH3 A;  5F0H A;  1GDT A;  4UUS A;  2HOT A;  2HXO A;  2NVY J;  1WH7 A;  2NS8 A;  2YUS A;  3CQZ J;  2JK3 A;  2QF7 A;  5IP7 J;  1IG7 A;  1FTZ A;  1HCR A;  5FKN A;  2XRL A;  2YS9 A;  4AYB N;  2N8G A;  3ZQG A;  3LSG A;  5EG0 A;  1I50 J;  1IV6 A;  3TW7 A;  2W48 A;  3Q0V A;  4NDL A;  4MIM A;  2IEK A;  1TWA J;  2DTZ A;  1ETX A;  1Y1W J;  4I6Z A;  1B8I B;  1B72 A;  1SAN A;  3CDL A;  4C3J J;  3HBL A;  1MBE A;  2NOG A;  4V2F A;  2LP0 A;  1MSF C;  3JR9 A;  3HOU J;  1MBF A;  5EF6 A;  2XSD C;  1WH5 A;  2NS7 A;  1DU0 A;  5EZG A;  1FTT A;  3Q0U A;  2X48 A;  2X6O A;  4AUX A;  4A3E J;  2HXI A;  1JKQ C;  3CMY A;  3FK7 A;  1YRN A;  5M3F J;  3ZQH A;  4FE7 A;  4B3A A;  4A3B J;  3G1L A;  3TP0 A;  5M3M J;  3GTJ J;  3MKL A;  5DTD A;  4BKX A;  3S17 J;  1H88 C;  3E7L A;  2DA3 A;  1ZKG A;  2HDD A;  3O8G A;  3JRI A;  4DW6 A;  2WAQ N;  3LOC A;  2L7M P;  1Z77 A;  3HKZ N;  3L1P A;  3UKG A;  3A01 B;  4QSH A;  2MGQ A;  2JA6 J;  2FX0 A;  4W97 A;  1TWG J;  2LR8 A;  1OCP A;  3SJM A;  1Q1V A;  2ME0 A;  4A3G J;  3WHB A;  2EZK A;  2DA1 A;  5FJ8 J;  5C44 J;  3MN2 A;  2Y30 A;  4XIC A;  3GTO J;  1ZQ3 P;  2E2I J;  1UHS A;  2ZB9 A;  2HI3 A;  3ZQI A;  1T33 A;  3S2D J;  3GTP J;  2VI6 A;  2TCT A;  2O7O A;  1I3Q J;  3RKQ A;  2PMZ N;  3JRH A;  4FIS A;  5E3L A;  3C2B A;  3HEF A;  3OIO A;  4IEJ A;  5J1Y A;  3I4M J;  3HB9 A;  2R93 J;  2ELK A;  3K2A A;  4C3H J;  1MSE C;  3QQA A;  5F0F A;  4QTR A;  3BTL A;  3B6C A;  3M4O J;  5C4J J;  5M5W J;  4M6V A;  5EGO A;  5IYD J;  2ID6 A;  1NK3 P;  4M3G A;  4D7N A;  2R5Y A;  2DA4 A;  4GFB A;  1E3O C;  1NTC A;  1TWC J;  5GP9 A;  4JP0 A;  3IV5 A;  4A3K J;  1RES A;  1HLV A;  2EZH A;  2NVQ J;  2M8G X;  1APL C;  4QIW N;  1HDD C;  5GPA A;  1OJL A;  2I10 A;  3QPL A;  1DU6 A;  3JRC A;  2IAI A;  1MBK A;  2K9S A;  4M3B A;  3BR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...