3CMAI

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cmaI00
3I55I 3G71I 2NXNB 5GAEJ 3J7YJ 3PIPF 1VQ6I 3CCEI 4IOCF 5GAHJ 2FOWA 3CCUI 5DM7F 2E34A 2ZJPF 2QA4I 1S72I 1YI2I 2ZJRF 2OTLI 1YITI 3G6EI 5GAGJ 1FOWA 3CCRI 3J7ZI 2E36A 3CC4I 2K3FA 1FOYA 3CC2I 5JVGF 1VQ8I 5GADJ 3CCSI 3CC7I 3CCJI 1VQOI 2JQ7A 3CCMI 3I56I 2H8WA 3CJTB 4IO9F 1VQ4I 4V19K 1YJ9I 1MMSA 5DM6F 2ZJQF 1YJNI 1VQKI 3PIOF 1ACIA 1Y39A 1HC8A 2E35A 4UY8I 1YHQI 1VQLI 1VQ5I 1VQNI 1VQ9I 1FOXA 1QA6A 2QEXI 3CCQI 3G4SI 3CMEI 3CCLI 1VQMI 3CMAI 3CCVI 3CF5F 1YIJI 1VQ7I 3CD6I 2OTJI 1YJWI 4IOAF 1VQPI 3DLLF
chains in the Genus database with same CATH superfamily
1XGOA 4L5IA 3LQRA 2ME0A 2K27A 2RREA 3REOA 3KIOA 4A0ZA 3CCRI 3QP6A 4G6TB 2CUFA 3LSIA 3QPLA 1ENHA 2JPCA 1XC5A 1J09A 1T39A 2YX7A 5IT9Z 1ACIA 3RJPA 1GV5A 1IN4A 2WAFA 4UUSA 2Z16A 4BHCA 5FJ8J 1BOAA 4FE4A 2ELKA 3JW4A 5F64A 1GVDA 2WB1A 3I4PA 3FBIB 3HM5A 2KL4A 3DEUA 5FLXZ 1HF0A 3J7ZI 1R9TJ 3I5UA 4LG0A 2BY1A 4BXUA 4ESJA 3DFGA 1UHWA 3A03A 1WZ2A 1SANA 4NQWA 2GOMA 2P8TA 5JHUA 3SXYA 3CDIA 4A3FJ 2EFWA 1SVLA 1B72A 1FTTA 3PL8A 2OQGA 4IQ4A 3DWLE 2DA7A 1MSEC 3GTKJ 3OIPA 4WK8F 4CA0A 1GXQA 1DU6A 2DI3A 3ABUA 4MGRA 4YG2F 2BEOA 1ORKA 1ZGAA 3E6MA 3QOPA 5CVIA 4HLYA 1G8XA 2DMTA 2PEXA 1I27A 4JOMA 2W25A 2L2OA 4AU7A 5EZGA 3BR6A 3DTKA 2LKXA 1W5CC 3LSRA 2KFDA 2Z33A 1SFEA 2JVGA 2MD5A 2Y69H 3ZQGA 1ON1A 4U0VA 4E6KG 4MQVA 1R5ID 4P9FA 2XDVA 3QODA 2NVUB 2DMQA 3GZ5A 3H92A 2G7UA 3BWGA 3OIQA 3ESWB 1ZLJA 2B63J 4XLFA 2CFOA 2HVSA 2DYSH 2FBKA 5JVGF 2ECBA 2LYCA 3HSRA 1IDZA 4QPQA 3EYIA 4DYQA 3BJOA 3ZMVA 2ELJA 1B9NA 4BUPA 1Y39A 1W7PB 1VQLI 3BOQA 4HYEA 1XMKA 1E2XA 4DYRA 4DJAA 5HS9A 4X0GA 3OYFA 4XM3A 4YELA 4D7NA 5J1RA 2X1EA 2M9HA 4A3LJ 3ZQLA 4RB0A 1SVMA 2BYVE 4NC6A 3K4CA 2JTVA 2HGCA 1WKMA 5TRDA 2HOTA 3KPHA 3DF8A 1KU7A 2JQ7A 1JUSA 4XKVA 2LMDA 3PO2J 1O57A 4PJJA 2I8DA 2K4BA 1J75A 2L5QA 1ZR2A 2ESHA 3PO3J 3MVPA 1DUXC 1JHHA 4XICA 2QQBA 3OS1A 2NVTJ 2VUMJ 4MNUA 2E1OA 2V9VA 4CXFA 4CO8A 5ICCA 1FBUA 2Y9ZA 2A05A 3HRTA 3OYNA 3MKYB 2HQAA 4II2A 2GXGA 3EUAA 3MZYA 4RLFA 2M7BA 3HEFA 2AS5F 4OIOF 2CMPA 4Y3OA 5FKLA 1TQPA 1F36A 3OS0A 4V19K 2AXLA 3HB9A 1LKXA 2OD5A 2K9MA 4I0AA 4F92B 2M8GX 2NOGA 1D8JA 4N0BA 4ZZDA 4ITVA 4IQJA 1BA5A 3WU2C 3FMQA 1IN5A 1IN7A 2H6BA 1MBEA 2CSOA 3TO9A 3H9QA 1W4MA 4M74A 2VT2A 3OIOA 1T0FA 3HPGA 3L2RA 3GYHX 4RAFA 3JRAA 1XD7A 3KP6A 5D4SA 3BY6A 4C2UA 4ASNA 5DV5A 2STWA 2AQEA 3CCMI 1FMWA 1MBKA 2VL8A 3GMEA 4AM3A 4GXOA 5FKKA 2F4IA 1P9QC 2D2WA 1HW2A 2CUJA 3R0JA 4A0XA 3AKZA 1TWGJ 4LK1F 1REPC 4A3GJ 1IRZA 1ITYA 2XPUA 3PSIA 1AKHB 1VZ0A 3FKJA 2M4KA 3CUOA 3CD6I 3C18A 2HOEA 2V1UA 3OSGA 1NHAA 2VE8A 5J3LA 1S6LA 2BW3A 5TGTA 2E5NA 2OC6A 5BMZA 3SZTA 4AIHA 3AFHA 3GW2A 1T95A 4OIRF 3VWBA 1FOYA 4M72A 3E6CC 3IAS2 5HVQC 3WGGA 2JUCA 1ON2A 1Z6TA 4BHPA 2VI6A 4C3HJ 5IOYA 5JHFA 4HOBA 2R0QC 4ENNA 4LOCA 1XSVA 5L3FA 1U5TC 4HX4A 1VQ7I 3WTZA 3ONQA 3SDGA 3K0LA 4D0PA 2JA8J 4CYDA 1ZH5A 5DCFA 1DDNA 1Z91A 2VQCA 2X1CA 3KYCB 3OMYA 4IVNA 3CDLA 2GLOA 2FQ4A 4Y17A 2QSFX 4CCLA 1J5YA 5D5UB 3RPUA 2MC4A 4AC0A 5J8FA 5LRSA 2V26A 2DCEA 2LF8A 1UG0A 2HDDA 2B9SA 3HGGA 4BS9A 4RAYA 1K4TA 1ZHFA 3RKYA 1IC8A 1Z9CA 1X1CA 1OCRH 3ZN0A 4MTEA 4XSXF 1O7FA 5HDGA 4KISA 3PFIA 4I2OA 1O3QA 5E20A 3SZPA 3MQ0A 1K78A 2E2HJ 3U1DA 3L09A 2BOLA 2ZJPF 5LHHA 3AG4H 2KRHA 1R1VA 5LEKA 3L2QA 3ZPLA 2NNNA 3WTSC 3OSFA 3RCOA 1HA8A 1JGSA 5F08A 2LF7A 1MBHA 3OOUA 1V54H 2HFHA 4ON0A 5DM6F 2KJCA 5LD2C 5EEGA 1HBXG 3E7LA 4XN0A 3S1QJ 3H9GA 2H1LA 3C2BA 3KFWX 4J00A 3S1MJ 2XPVA 5ICGA 1BR2A 1SVOA 1OR7A 2EH3A 5M5WJ 1YLFA 4GFBA 4ZDPA 1X2MA 4LD5A 1W7PD 4XKBA 4OINF 3ZQHA 3IRRA 2CGPA 3DEWA 5DUKA 4D5CA 3FX3A 2X1DA 3L2UA 2AQFA 1VQ4I 4LLNA 1WHUA 4JBAA 3WE3A 3VDXA 2CU7A 2JMWA 2FMYA 4M71A 2DT6A 3ZMDA 2V79A 3EUHC 1E17A 2V1XA 1QQIA 2VJ4A 1ZK8A 4R79A 1MNDA 1ZQ3P 1HDDC 4K2EA 4RM2A 4I0BA 3TOAA 2DA5A 3HUGB 3S3MA 5F1RA 1IXCA 1V4RA 2F4MB 5BPIA 3K4BA 2VQLA 1X58A 2BZTA 2KDZA 2M34A 2O0YA 2HEOA 1FEXA 2FA5A 4YFXF 4RM3A 1GUUA 3I59B 1Z3XA 2MLKA 5GPCA 2DDBA 1H9GA 3FMSA 2V4JC 2GA1A 3BG9A 3WU0A 2A61A 3F3XA 5HLIA 4CYCB 3HKZN 4S0HB 4GYGA 2IJLA 2LKSA 5HS7A 2WTEA 3VEPA 4BEHA 3OYBA 1RIOH 3FXQA 2CFXA 3B6CA 1P4WA 2LREA 3BQYA 3N4MA 2IPQX 2KISA 2VC1A 1ETKA 2BY2A 1K6OA 1USTA 3P9CA 2P5VA 2NYXA 5E8GA 2BHYA 2EFQA 4PJNA 5L3GA 1B9MA 5DUIA 3A01A 1LDDA 3BT9A 4UHTA 4Y33A 4A3CJ 1K83J 1V55H 1RKTA 2WC2A 3QYBA 3PIOF 1WVRA 3J81K 1Z77A 4XOTA 4EM0B 1XCVA 3S3NA 2K40A 2G9WA 3B02A 4OU0A 5E1WA 2XASA 1EJ9A 2RC4A 4J01A 3JREA 1R5HA 1SAUA 2FUG2 4IJAA 2R7SA 1ETXA 2K3PA 2LVSA 1JUMA 2KMUA 3F6OA 4I01A 4XL9A 1QBJA 4M9ZA 3A2KA 1RUOA 2OZUA 3K10A 2GIVA 2GWRA 2DA6A 1G3SA 4ZYEA 1YQAA 1B1BA 3WHBA 4KUMA 3DU6A 2CYYA 2FOKA 5F04A 4DGWB 4YFKF 2A3SA 2VPRA 1SC7A 3L9FA 2VOPA 4M3EA 3MKZA 3OY9A 2DA3A 3S15J 4BL0B 3G1OA 2HYFA 4ANJA 4MTDA 5K5RA 3OR2C 3EETA 1VQMI 3CMAI 2W48A 1NG6A 3F8FA 1S8NA 1I6HJ 3V7SA 3AL0C 1UHSA 1K4SA 2KP6A 4IHYA 1R4NB 1U9NA 3ASOH 5DM7F 4IRIA 4OMYA 4HV6A 2OTLI 1Y8QB 2ZXIA 2CRGA 2LTPA 2XAFA 4PCQA 3G1MA 4AYBN 4JQFA 2F5CA 4G6DA 5DYMA 1WH7A 2LKPA 4RBOA 2Y2ZA 2Y31A 4FISA 2R7DA 1SFOJ 4KN7X 4OWRB 4XOPA 2QM3A 1OCCH 2MFZA 5CPRB 4PJLA 5CVUA 4XSZF 1LDJA 1LNWA 4RDUA 3BTJA 3DBHB 4PJ0C 2RN7A 5L3CA 1Z67A 4G6QA 3DEEA 2FF4A 3VOEA 1PJRA 3HRMA 3TKYA 3WGHA 1IRXA 3CUQA 4UUTA 3I4NJ 3WTUC 2E2JJ 3BCAA 4G9YA 1XGMA 4ENMA 3CJNA 3A02A 2ZFWA 2R7RA 2Z3YA 2Y0MA 5EJCA 2ZMEB 5FKMA 2L7KA 2R5YB 1FYKA 3K2ZA 3V7CA 1XGSA 4C30A 3RKXA 3FZVA 3LSGA 4KN4X 3GVAA 3FXUA 3I55I 3W6VA 1HC8A 2F48A 1Z7LA 2VKHA 4N4NB 3W2WA 2QSGX 3ROUA 1TWAJ 1F5TA 2CV1A 3K7AJ 1KONA 4BJTA 1N77A 2GXAA 2XAGA 1Y8RB 2NAZA 3QYFA 3K2AA 3K69A 5DS9A 2QBYB 3NEUA 1LVAA 1U5TB 1K7AA 1W1WE 2FNPA 2BXYA 2M1BA 3HG9A 4D5FA 3EUKL 4R8HA 2HNHA 4RB1A 2NVQJ 4LLLA 4MQ9F 2CUEA 2P7VB 3JSOA 3FISA 4UV9A 2P0WA 3SEQA 4DYCA 3DTIA 2HTSA 5GAEJ 2HR3A 2K5CA 1QPMA 4CGZA 1FY7A 1S5LC 1VI0A 2X6OA 4LGWA 5DD4A 3F22A 4EATA 3L2CA 1FTZA 2V7FA 4ZC3A 4A3EJ 3T1BA 2LY1A 3TW7A 2XB0X 5DCMB 3B73A 1TQIA 4HQEA 1DQUA 4I98B 2JA7J 1VQNI 3I53A 4EVIA 2IA0A 2M4GA 2Q1ZB 3KP4A 3MFKA 5CVJA 1BM9A 1OMIA 1MMDA 3KLNA 5E3OA 2OA4A 1YTYA 4CCJA 1JTXA 3P9KA 1YO5C 4M3FA 3WTYC 2D5VA 1G59A 2KIMA 1X3UA 3ABTA 3NARA 4NNJA 1LPQA 4Z2YA 1KU9A 3VYSB 2IS1A 2HI3A 1ZGJA 3CP2A 2BHZA 4DIQA 3CO6C 2N8GA 4N9HA 4ZTFA 2XAUA 1RUNA 1JT0A 4A3JJ 3S1NJ 3OV8A 2ZMEA 1WJEA 3KE2A 3RZDJ 4Y52J 3DU5A 4KMUX 1ZR4A 2PX9A 1PDNC 3AAFA 2BVMA 2IGKA 3E1SA 4BJ5C 1YFHA 4KDPA 2R5ZB 1BR4A 1VFCA 2F5DA 2X0LA 1SFUA 4KIGA 3BQZA 2O61A 1JE8A 2A5YB 4A12A 1Y6IA 3HSFA 4NDLA 5F0FA 2MABA 1ETWA 2DOEA 1IV8A 4UB8C 1R71A 4F3QA 4RA2A 2MSYA 2BGCA 2KZGA 4PJMA 4U87A 5CLSA 3JRFA 5IP9J 5A2QK 3QRFF 4F7ZA 1JKOC 2P81A 2HOAA 1WFXA 4WF2A 1QU3A 2HZDA 4I09A 4QWQA 4BE0A 4BACA 1OJLA 2Y0SN 4E7JA 1ODDA 3KZZA 4IX7A 4BBSJ 3SDBA 3L2WA 1ETVA 2EILH 4L9TA 3SFIA 1RRJA 3ZMTA 1HSJA 5CVVA 2TDXA 1IG7A 3H36A 2IBDA 4BH9A 4IRHA 5D6EA 2VQHA 2DW4A 4OAZA 1ULYA 1JKRC 5EGOA 2CS3A 2E2IJ 4M3BA 4EJUA 1O3RA 4WX9A 1O3SA 3G73A 3QP5A 1X1BA 3ZMZA 3L00A 3V42A 2E7WA 3DLLF 1TWHJ 3GF2A 4S04A 1ZLKA 5FLXK 2Y0SA 1YW7A 4B4CA 5GAHJ 2E34A 3H5RA 1JJ6C 3H0DA 2R4GA 1AU7A 2KLOA 4HNVA 2LY2A 2BXZA 3I58A 3CC2I 4H4KC 3KZYA 2O8XA 2WY7Q 1EH7A 2QGUA 1WJDA 4GCVA 4ENKA 2ZMEC 2ELHA 2QENA 1ZG3A 1H9TA 5L3DA 3H5NA 1TTYA 3R4KA 5JR3A 3E5UA 1BL0A 5AIPA 5M5YJ 3VYTB 4DW6A 2Z9OA 1BW5A 3DBRB 1APLC 3H3ZA 4FQGA 2HXOA 2QEXI 2VOOA 1A6QA 4PSWA 3JRHA 4FETA 2D1VA 3WU1B 3R61A 2IGOA 3BTCA 3IHUA 2H6CA 1WJAA 3CCYA 3K4JA 4RGSA 1UJ8A 3Q0VA 4XLNF 3X2QH 2E36A 1XX5A 3QU3A 1JKPC 4BXXJ 2A69F 1KQ9A 1SFXA 3PUFA 4XBFA 3ZGKA 3J80K 1W7PA 3V8LA 1QVUA 1MNEA 2K9NA 4O6JA 4L0ZB 1IN8A 3JTGA 2F6CA 3ELKA 2DO7A 3K6GA 2M30A 2IXSA 3CJQB 1KZHA 5H20A 1MNMC 1HW5A 1OKRA 4HNTA 4RMNA 2EB7A 4M3GA 2HKOA 2VJ5A 3OL3A 3ZRGA 3JRDA 1POGA 3I59A 2AHQA 3M8JA 4BGDA 3IAM2 1ETYA 3LSPA 3F21A 2VJJA 2FBIA 1HDPA 3N05A 2GQQA 3PQJA 5CQEA 1TW3A 1B6AA 3MMYB 5DTDA 3LFKA 3MKWB 1QO0D 2L02A 5H6RA 2PBIA 4NC7A 3DV8A 2LLKA 5IT9K 3ERMA 2QCOA 5K7HA 3H1CA 1FOXA 4C9YA 3LSTA 2H8RA 3DPUA 3RIRA 5BOXA 2HTJA 2XAQA 1H0MA 4HDVA 3IP4B 3P5JA 2V6CA 5EEHA 1D5VA 2P5LC 5IPAA 5EGOB 1G3YA 2X51A 5FGMA 3M4OJ 3HOUJ 2ZO4A 1HLVA 1XTAA 2W84A 1F1ZA 2A6HF 4XMYA 2VLAA 4BE1A 1IGNA 4KMFA 5IP6A 3S17J 1MD0A 2P7CB 2XGXA 2F5FA 3R60A 5B66C 5H2FC 4OMZA 1VQ5I 1MMNA 1R1TA 1S7OA 3FXOA 3RQIA 3O8HA 3OYAA 1NK3P 1T38A 2CQXA 4LG0B 1UZCA 2HWVA 1G4DA 4XQFA 1KGSA 2L7ZA 3K1NA 4IRGA 2RKHA 2MW8A 5GP9A 5D5XB 2AXTC 4XLAA 3GTQJ 2UV1A 4XLEA 1RPWA 1QHHD 3FIWA 3E97A 4L5JA 4MIMA 5LFAA 2K7LA 2LC2A 1PVEA 2A07F 2MC3A 3PNVA 4P96A 3IH3A 1QA6A 3AG3H 4Y4RA 2R92J 2ESNA 5D8KB 1UELB 5C44J 3FMRA 2LK2A 4U7BA 2K4JA 1BI1A 1BJZA 2QQ8A 1BJAA 2UUZA 4HG2A 3TP0A 2ZKZA 1FWZA 1ETOA 4U7DA 2PI0A 2HDWA 3GTGJ 1GDTA 2K86A 2F4OB 1Z7UA 3JCUC 5ED4A 1BBYA 5ICEA 2VBYA 2IGMA 1EH6A 1QPIA 4G94A 2HQRA 3LSKA 3WG7H 1HKQA 2WWYA 1SMTA 4QIWN 3HRSA 3DCFA 4E7SA 3JR9A 3ZQIA 1OYIA 4CCKA 2W7NA 3G71I 3PIPF 2OUMA 4IOCF 2CUZA 2DODA 2I10A 1O7LA 1ZAOA 2ZBKA 3LA2A 5EG0B 3FXKA 3I9V2 1GHCA 1LB2A 3ZXSA 3E5QA 2DA2A 2KIFA 5IY5H 1I5ZA 3BR2A 3G2BA 4MHGA 4UNOA 3MWMA 4XLPF 5H6QA 2CW7A 4CICA 4HRIA 3KEQA 1D0XA 4L0YB 2O8KA 3CMMA 2QWWA 3HYIA 4HSTA 2HDCA 4Y13A 2CQKA 5E3NA 3S1RJ 1FT9A 5M3MJ 3IUOA 3L7WA 4EJTA 1ZRCA 3GTPJ 1VQ6I 2ZB9A 2ZFUA 1EA3A 4ZZLA 5E1XA 3HPHA 4FE7A 1WJCA 1D1BA 1IRFA 2QBYA 2P4WA 5C3EJ 5J47A 1IF1A 1U0JA 2CWEA 1FSHA 3G1LA 3SJMA 3SZGA 1YJ9I 1NK2P 4LFUA 2PMZN 1H89C 4NHJA 2XAHA 5FD6A 3H35A 2FJ1A 4I7HA 1I39A 3A0HC 3R0AA 4ZJZA 1TQMA 1SD6A 4QTRA 4U88A 3OYLA 5LRRA 2E7XA 2KJBA 3JRBA 1NH3A 1T6SA 4ZH4F 3EYYA 3GFLA 2MD0A 1WRJA 4X1EA 1LJ9A 4E7IA 3P9IA 2PG4A 4EM2A 3VODA 2IA2A 1XN7A 2EJRA 1R00A 1JI8A 2KZVA 2X85A 3HJEA 3TBIA 2HQ5A 2Z1DA 3BG5A 4C3IJ 1SAXA 5CQGA 3GFMA 2DT7B 2PJRA 3CLOA 5E18F 1VNDA 4AIDA 1TZLA 2EINH 4B43A 4I6ZA 1R6RA 1LFPA 3G3ZA 2DYRH 1YX3A 3CP8A 3I64A 3LAJA 2DMNA 2W57A 1YG2A 2EZHA 2ZNZA 1IO2A 4UVAA 3BR5A 1JUPA 3K9TA 3U21A 1KA8A 4HZFA 3J80Z 1TNTA 1OCPA 3NQOA 3BZCA 1RETA 1YW8A 2Q2EB 1IAWA 1B8IA 1VQ9I 3CCQI 3CMEI 1W36D 1MDMA 2L7MP 1K6YA 4YIRX 4H0EA 4XONA 4IF4A 1U8BA 4BYYA 1FYLA 1OCOH 5K5QA 2RVCA 3OYDA 1YW9A 3PSFA 2WAQN 2ADUA 3KLOA 3GFIA 3AL0B 2VN2A 2R5ZA 3NRVA 3S32A 2JT1A 2BY3A 2VQGA 3OYKA 1HCRA 4GO1A 5FB2A 9ANTA 3V4GA 1MSFC 2H8WA 4ZYHA 3GZNB 4XRSA 3N97A 1H88C 1BI2A 1D8KA 3D5RC 1Q1VA 2OCCH 4GYIA 1LVKA 1RKWA 1FPQA 3W2AA 4QPOA 2NS8A 3T5XA 2PMUA 2JRMA 4XIDA 2JPBA 2ME6A 4BQOA 2X6XA 1U3EM 3MEXA 4XLHA 4TV7A 3S16J 1SD7A 3VYUB 5DD8A 4C3JJ 1G3WA 3LA7A 5A2QZ 2QF7A 4BJ6C 4DQ2A 3LOCA 1U5TA 2WV1A 1IUYA 5BNGA 1YX5A 2JA5J 1X1AA 2IVMA 1A04A 3KP5A 3HOXJ 2VBWA 1RC9A 1KQ8A 1B72B 3SYTA 5IYCJ 4C2TA 5C4JJ 3LMMA 1XMXA 2H27A 3CUQC 2JWTA 2OV7A 2KDOA 4O3MA 1VQ8I 4XRMA 3WHCA 3CCSI 1XPXA 1DPUA 3VFZA 2WAEA 3RI4A 1U2WA 5LGNA 2ZJQF 4IHVA 2COBA 3HHHA 2O7OA 1PYVA 3GWZA 2IGNA 1WPKA 1DP3A 4W1UA 3HDDA 3W3CA 3DPLC 3BR3A 2LBFB 4WCGA 1CQTA 2FNAA 2OBPA 2CJJA 2IAIA 3QPSA 2NS0A 1PUEE 2LP0A 2ZNYA 1LUJB 3F0CA 5ERIA 3ECHA 4M73A 3H5AA 2QA4I 5TISC 2L54A 3TDUC 5FRNA 4LIUA 4HPQA 1LEBA 4IXAA 1HW1A 1IDYA 5CKTA 5FD5A 3IV5A 3GX4X 2HOSA 4PGHA 1R22A 1B59A 3ASNH 4Z6YA 3KYDB 1IRGA 2AO9A 2X9DA 2PMHA 4CZZA 4N9IA 2MA3A 2VXZA 3QPHA 4AD9A 2P6SA 2BVLA 5BS6A 5ILVA 4PK4A 2W85A 1UMQA 4BAYA 3ZP5A 1WH5A 2YR2A 4HAMA 2XROA 1RR8C 1OISA 3GLXA 1XG1A 5EDNA 1FBQA 3W2VA 1EV7A 1Z6RA 3JRGA 3ZMSA 3Q9VA 2DJNA 3RQ4A 3OR1C 2DA1A 2EA2A 2PQ8A 3ZOBA 1IN6A 4WWCA 2R7WA 1FYMA 1STZA 3BR1A 4LB5A 4NBQA 5KAIC 3VB2A 1WI3A 2DLLA 2A6TA 2M7AA 5B1AH 2HPMA 4P1WA 5HS8A 2R7QA 1AWCA 2PMZA 1R58A 2F5VA 2TRTA 3K4MA 5KNLA 3HTSB 3KX2A 1MW7A 1X4PA 4XNFA 3CCLI 1YYVA 1IUFA 3CF2A 4B48A 3BG6A 3BZ6A 3V8KA 4OIQF 3FK6A 2FOWA 2XRLA 2B7EA 5HLTA 3C1DA 5FLVA 2GAUA 3GUDA 1D5YA 3ZR8X 2WB1N 3M7GA 1IXSB 3CC7I 3JTHA 1A31A 4BBRJ 1MJAA 3TOBA 1BN5A 5BPDA 1D0YA 1MZBA 5D4RA 2QKMB 3HOSA 3KZIC 5J1YA 4OAYA 4HNUA 1KU3A 2W00A 3WE2A 1JHFA 4UXNA 4WXHA 4HSRA 3HXLA 3CF5F 2GZWA 2FRHA 3WTVC 1E3HA 3J7YJ 2UZKA 1OYWA 4L9VA 3QOEA 1FIPA 3BG3A 1FLIA 1D1CA 3OS2A 1WJ5A 4XN3A 2Z5UA 3M1EA 4LB6B 5D5VB 2XIGA 1R49A 2V1DA 4A5MA 3S3OA 4XKWA 2IT0A 2L0KA 3PNYA 3H0GJ 2RQPA 4B47A 2M2EA 4L9JA 1XDUA 3ABLH 3T8RA 2EK5A 3U1KA 3CQZJ 4EQQA 1Z21A 3OL4A 1QZYA 2E71A 3G4SI 3COAC 2R7UA 1LEAA 5J4VA 4LMYA 3A4CA 1TBXA 5E79C 5K5OA 1HKSA 1ZN2A 1OPCA 2NXNB 1TWFJ 5EG0A 4KFCA 4DNCA 4IZZA 1U9OA 3MKLA 4Q48A 5L3BA 1MMGA 3BP8A 3IL2A 5J8CA 5EZHA 2OJED 3R6SA 3GTOJ 3PJRA 4RAGA 4YIIA 5FROA 2LSOA 1P2FA 2V6EA 1P7IA 3GLLA 3L1PA 1D0ZA 3F8NA 2F2EA 4A3MJ 1OR7C 2BV6A 4J19A 2MYSA 2IP2A 1T0FC 4A5NA 1IXRC 3AG1H 2CW8A 2XHKA 3LNQA 3OWTA 1NTCA 4CUGA 1FP1D 3CC4I 2XKOA 2FQ3A 4OIPF 2EA4A 5CJ9A 2RGVA 1NG7A 2XB5A 1G6NA 3LA3A 2ZXJA 5KAFC 2NS7A 3GFJA 4JX4A 1OYYA 4LLGF 3C7JA 3BTLA 1R23A 4E7KA 1ZG1A 3J7AO 3E6DA 1TLHB 2CQQA 4HX7A 3ZQ7A 1I1GA 2PFBA 4AVPA 3OYHA 2IA1A 2A5WA 3F72A 5CYVA 5E8IA 1OCTC 2VKVA 2HS5A 2KIUA 5D8LB 3KETA 3BR0A 3TW6A 2K85A 1MGTA 3CCVI 4HLXA 3DKXA 3QYEA 4KT6A 3KEOA 3E5XA 4I02A 2EIMH 4D7MA 2B0LA 4KIBA 5J4YA 2NOJB 1YITI 1UG2A 3JAMZ 2UWMA 2FSWA 3TO6A 2H09A 5HODA 3GTLJ 3C3WA 3K4LA 1Y0UA 4BXFA 2PJPA 1MBJA 1XDSA 4BU2A 3H3VK 4RGXA 4KIFA 2X48A 4IPAA 4BQAA 4U0WA 1N75A 1KQ0A 2DA4A 4OOIA 3AG2H 4IEJA 2WBMA 2Z99A 3IH4A 4RGRA 1V5FA 3RYPA 3F23A 1X1DA 1SEUA 2HYGD 1XCBA 4X6AJ 3RTRA 2O3FA 4EGYA 1R1UA 4S05A 2R5YA 3CCUI 3TEDA 2M0CA 2K9QA 3M1CA 1JT6A 4DBQA 3GTMJ 2FD5A 2IEKA 1XSXA 3ECOA 4Q4ZF 2V1NA 2EV6A 3HHGA 3CTAA 5IP7J 5F0CA 2DFEA 2JA2A 2YSRA 5FKNA 4XRFA 1K78B 1Z05A 4A3IJ 1CF7B 3OYIA 3EQLF 4EJWA 2QYOA 4KNYA 3HBLA 4CHUA 1EF4A 2FU4A 5D6FA 3OOPA 5DDGA 3Q3SA 3Q0UA 2L4AA 2J5PA 1ZELA 5JLXA 1X19A 2W4SA 3RKWA 3IC7A 2ZXWH 3IWFA 5IYBJ 2K02A 2R7OA 3CO7C 1V3FA 4JYKA 2HYJA 4NC8A 3HL2A 3TL4X 5M3FJ 4BQNA 4RGUA 2KIQA 4F52A 1I3AA 1XSDA 1U78A 4V2FA 2DXIA 3SHFA 1WSUA 2WADA 3P7NA 2YS9A 1PP8F 2E1CA 3K4NA 1MMAA 4IOAF 2CH0A 3F8MA 4HA8A 5CVRA 5DCMA 4WXDA 4M6XA 3KYLA 4F55A 3U2RA 1BC7C 4I99C 1YI2I 2W24A 3HOZJ 2K9SA 5FRMA 4RB3C 2O9LA 1WWXA 4RAZA 2NVXJ 3UR3C 2XGEA 3O8GA 1ZTRA 2P5KA 3PNTA 1T56A 1TP4A 1HKTA 1YHQI 3LFUA 4PGGA 2BE5F 1A6IA 1LDKB 1VTNC 4IHSA 1UB9A 3MZ8A 3M8FA 3CLQA 3CUQB 1Y0NA 1OFCX 2RNJA 4BNCA 1YS7A 4UUSB 2KHMA 3VPRA 2QSHX 4ZYDA 4ESBA 2DK8A 2XF5A 2BY0A 2JZYA 1WJFA 1LQ1A 3BROA 3VYRB 2ECCA 2WV0A 2X4HA 4PUSA 4HX8A 4E4HA 1M1EB 1MMSA 1E3PA 5FO5A 4RB2C 4CCMA 2M3AA 2L7FP 2IRFG 5J40A 1TNSA 3CZ6A 3RSNA 4EEFG 4EMSA 1TT5B 1X4OA 2CQ7A 2Z2SB 5GTIC 2VB6A 2EBIA 2GM4A 2EFPA 1OLTA 1I3QJ 1WGXA 2GIZA 5K7ZA 1FOWA 3OYEA 2PJRB 2R7ZJ 4ZDOA 1XMAA 1PUFB 3ABKH 4EM1A 2LY9A 2OAZA 1YOVB 4G7HF 3FBNB 4IHXA 3SQNA 4FASD 2OPTA 4MEXF 5HOOA 2QKLB 2XF6A 4B1RA 3EUHA 1U8RA 5ILSA 3O3KA 4B09A 3HC7A 3FHZA 4BKXA 1SMYF 1ZYRF 1R7JA 2VE9A 2L01A 4HV5A 1LFUP 3J7AY 4JX5A 3ML6A 1HOMA 3KP2A 2FEZA 5FFZA 2MH2A 5AONA 4AVZA 1BIBA 4DZJA 3F9KA 1YIOA 2EFNA 1GT0C 3GCMA 4EGZA 3I0TA 4KYWA 2XSJC 1G2HA 2RDPA 2HZTA 1A36A 5KHDA 2VBXA 2PN6A 4ABZA 1FSEA 1R5GA 2DMUA 2HVRA 2FMLA 3WTXC 3FHNA 1SD5A 3HOYJ 1KYWA 2Q0OA 4M6VA 5HNFA 2HVQA 2DFIA 4GGGA 2XC7A 3BC8A 5HLHA 2LG4A 1YE9A 2JRTA 4EJVA 1P4XA 2IS2A 2NNYA 2EV0A 1TC3C 5IYDJ 3QQAA 4UVBA 1B4AA 2FBHA 2UXXA 4ZDLA 4N4OB 4CYCA 1JGGA 2JSPA 2FX0A 2Q8KA 1FC3A 2LNBA 3DKYA 1FJLA 2C6YA 2VXDA 1QGPA 2M0MA 2E19A 2DOFA 3WODF 1S7EA 5GTHC 4D1QA 3TO7A 3FDYA 2MLGA 2DAOA 3A01B 5F27A 1IZ1A 1RESA 1JXSA 1V5GA 3HIFA 5GADJ 3JRCA 1BI0A 4IHTA 5KK1A 1VQOI 2W1OA 1HQCA 3E0JB 2L9VA 1DGWY 3HKZA 5K1YA 4BQQA 3J81Z 1YJNI 3B6AA 2OF7A 1CF7A 2L3DA 1UHMA 2DOAA 3W6KB 2EZIA 1MKMA 2QVOA 2M5WA 4NB5A 3EDPA 4PFOA 4YEJA 2EPFA 4MO7A 1X1PA 2E1NA 1E3OC 1S72I 2GBYA 4CCNA 2PLYA 3GTJJ 1Z1DA 4O5VA 2XSDC 2CV0A 1OCZH 1R36A 1DP7P 1KU2A 4E7ZA 1IV6A 4HW0A 4FX4A 1RNLA 3MD2A 4B3AA 4Q5SF 3CCJI 2VJIA 1MIJA 3CDHA 4LIVA 2GA2A 2HU9A 3HUGA 2DFHA 4Y15A 4CH7A 4AIJA 4G8XA 2OQRA 3OYMA 4BE2A 4F93B 2MGQA 3MN2A 2XUBA 2ID6A 3M3YJ 2DQRA 3HTUA 1ZRDA 1USSA 1MDMB 4FTHA 2P6TA 4E7HA 5TJJA 1T33A 3ZCOA 5M5XJ 2EIJH 1AA7A 1N78A 3CJRB 2M87A 2RAEA 3DBLB 2LR8A 2LBFA 2L9RA 3ZQFA 1Q1HA 1L3LA 5HDNA 2VKEA 3DKWA 3WTTC 4IO9F 3HGYA 2ZSHB 3QWLA 5IT3A 1J59A 3SEZA 4DZPA 3IWZA 3Q5FA 1Z0XA 2ACJA 3S2HJ 4UVCA 1T98A 2DPDA 1FIAA 5LHIA 2CQNA 1X3WB 1IJWC 4PZJA 4CCOA 2DPUA 3TGNA 4G7ZF 1UCRA 2I5UA 1W5TA 2HXIA 4JP0A 2IS4A 2JJ7A 1UAAA 2LFBA 1MH4A 3HOVJ 3F8BA 4Q47A 2R3SA 2COMA 4V2GA 2YU9J 1TW2A 2DK5A 3KP7A 2HPIA 4I76A 5C4XJ 2DTRA 2W82A 4AIKA 2BBYA 2A6EF 3LSMA 3K70D 4HDUA 1TL8A 2IW5A 2VODA 1OQYA 2LOOA 6PAXA 2ZSIB 1SD4A 3FXMA 3GXOA 2YX4A 1L0OC 4R1HA 3ZQCA 2DU9A 3E3VA 2JA6J 4L5EA 2YUSA 5B1BH 5E17F 1LFBA 2BW3B 2M8EA 2DJIA 3FKIJ 2ETHA 1J0RA 1DGRM 3OYCA 2DTZA 1C0WA 3DXJF 2M45A 1O4XA 3E6BA 3GZ6A 2DT5A 2KRCA 1VQKI 1EH8A 5E3MA 3BJAA 2XVCA 1AOYA 1EKEA 1R4MB 3DPTA 1W0TA 5EEAA 1S9HA 4ENJA 2ID3A 4MLOA 1ERDA 4MEYF 4BHBA 1J2XA 2HKXA 4ESFA 3FK7A 5FFXA 4F91B 2EFOA 3Q9SA 1P6RA 4JX6A 3CCEI 3MAJA 4P9UA 3HSEA 1N25A 3UNGC 3FF5A 2WA0A 4HQMA 1ZG5A 1T8IA 4IL6C 3BTIA 1LE8B 1GXPA 2ZCWA 3S14J 3I54A 2DQLA 5LBQA 1YS6A 1WJBA 2KKOA 1BW6A 4B44A 4DOZA 1I6XA 3VSLA 2O6GE 2JN6A 2OU2A 3DLAA 3LSHA 1JKQC 4KJZA 1TT0A 3JSPA 1XS9A 3DP7A 1AHDP 2MG4A 5EYRA 3I4MJ 5E3LA 5L3EA 4CDGA 3BJ6A 2YPRA 2HQNA 3H3UA 2MBFA 3LL7A 1Y1WJ 5HDKA 1YRNA 4XLCA 2X6YA 4B8XA 4KITB 1HXDA 5KVRA 3DTEA 4BDZA 2WY8Q 3TMOA 3BG7A 5LLQA 3T0YA 1K79A 5F0HA 4A3BJ 2H1KA 1FMVA 3RZOJ 2Y9YA 4XORA 2LDUA 2RNGA 2DBBA 1CGPA 2XGCA 4CZCA 1TWCJ 1I50J 5K7FA 2D45A 2L9NA 2XPWA 4HF1A 2Y75A 1MBFA 1MJ9A 1VF9A 5J1UA 1K61A 2E60A 2O03A 2LH9A 4JK1X 4BDYA 4MFEA 1IW7F 1F4KA 1QHGA 4GRIA 5HLGA 4M9SA 1F9NA 4PSXA 1UFMA 3WG9A 4C2MJ 2EIKH 2CV2A 5ICFA 2YU3A 2OTJI 2LD5A 4E7LA 3NWSA 2QUFA 4G7OF 2ZJ2A 5EF6A 4IHWA 2EV5A 5F6FA 3RDIA 3NAUA 5B5EC 4E70A 3RPQA 4GDFA 2EQRA 2XAJA 2X6WA 3KEYA 3IH2A 4A3KJ 1E0EA 1RR7A 2K3FA 2O5RA 2KQRA 2UXNA 2NRAC 1FP2A 4KA4A 5HNHA 5D5WB 1FBSA 2L4MA 3MZHA 3PQKA 4Y7NJ 2V9PA 1ONVA 1ZKGA 2XF7A 4B3XA 4HEA2 4ETSA 2QLZA 3ERED 3RKQA 2STTA 3MCZA 4A0YA 3SFZA 2R7VA 4WXCA 1QVTA 3FXLA 2CW0F 2CO5A 1DPRA 1H8AC 1XGNA 3KCCA 1RZ4A 1PUFA 1FNNA 1A5JA 5B3SH 5JVTA 4BEHB 2XGDA 3HRUA 3QPTA 3ZN1A 5F1JA 3OYGA 3I56I 3CJTB 3I3LA 1QZEA 2XRNA 3KP3A 3BPXA 3BZKA 3LSJA 2JVHA 3S8PA 4UV8A 1G3TA 2QZ8A 4RS8A 1S29A 1ETQA 4NQWB 4M3DA 3K4KA 4QLCU 5KCMA 1WQ2A 3WGIA 3M8EA 1W36C 2GOXB 3BLYA 4FHTA 3O2PE 1Z3YA 2WAQA 2Y30A 1S7AA 2G0EA 1GV2A 2ZJRF 3G6EI 2VASA 4LITA 4ZYAA 2FXAA 2GXBA 1Y1VJ 2A68F 1JTYA 3K1PA 1BIAA 3U9GA 2VIXA 3O6BB 3C2HA 3WTWC 2IS6A 5J6XA 4UB6C 1BC8C 2ZC2A 3T8TA 4HF0A 4P55A 2VONA 5GPAA 2D1HA 3HZJA 4AWXB 1FZPB 4XKCA 1YRNB 4XRSG 2V9KA 3DQVC 1YJWI 2J5OA 2VPLA 4LJZF 4A93J 2R7FA 4L9NA 2QQAA 2XV4S 5IOZA 1P7JA 5LEJA 5FKOA 3HOTA 1MJBA 3F8CA 2RQQA 3V8JA 3V7RA 5E1ZB 4FCYA 2FE3A 1ZREA 2Q2EA 2EWNA 2ISYA 4NUBA 3TQNA 2JSCA 3ULQB 1PP7U 3PUBA 1BOBA 1GLNA 1ZARA 3HOWJ 3IKVA 4DBRA 3GO5A 1ZGWA 2KPMA 2NVYJ 3K1MA 1QZZA 1J7KA 4CSWA 2R93J 1A35A 1F43A 2E1MC 4D9JA 2R7XA 3GEZA 1QNTA 3FM5A 1XB4A 4EV0A 3CMYA 4FT8A 2VKDA 2L9SA 4HF2A 1S3JA 4II3A 2LRDA 4MFDA 2RV8A 4A6EA 4EJOA 5GAGJ 3S2WA 2OCEA 1SFKA 1MBGA 3IKTA 3D1NI 4AYBA 4FX0A 1W5SA 3TP3A 4YFNF 3JAMK 3LAPA 3L2VA 1FX7A 2E1MB 3D5SC 4L18B 3A1YA 1DU0A 4YIFA 1ZRFA 3LWFA 4XK4A 2MH9A 3RYRA 1V5EA 1T08B 3M9AA 3ISPA 1X2NA 1VQPI 3A0BC 3UKGA 3OYJA 2DDAA 4A6DA 4KICA 3FWEA 4A2UA 1D1AA 3QU6A 1T2KA 1BI3A 2EZKA 5DEQA 3IRQA 2TCTA 1WI9A 3JRIA 4ZTJA 4AUXA 2CG4A 2G7HA 1O3TA 2R7TA 1LE8A 2H94A 1J9IA 3F6VA 5LHGA 3FXJA 4UY8I 2ZXHA 4W97A 2DFFA 3K70C 2K9LA 4KT5C 3VSKA 5JFRA 2DN0A 2QQ9A 3ABMH 5JI6A 4IKFA 1B8IB 3CESA 5BQTA 4G12A 4HBLA 1GVJA 1P92A 2DMPA 3Q0WA 3PM1A 3ZQQA 1AKHA 2VBZA 2KRFA 2F5EA 3RPUD 3FM3A 3LQQA 1HSTA 4M6YA 1U6GA 2JK3A 2E5ZA 1X3ZB 2OZ6A 3H9JA 1Y56A 3M07A 1WCMJ 4RLQA 2ISZA 3I71A 3TDZC 2E35A 3NWTA 1FOKA 2KT0A 2XKPA 3S93A 1JJ8C 4A69C 2VC0A 5JLWA 3ZMUA 4PFPA 3GBGA 1MH3A 5LGUA 1KYZA 4QSHA 5AIQA 1D3YA 2EZLA 5ILUA 4U0YA 4BY7J 4XR6A 3QAHA 4P5OA 4YRVA 3FXRA 3EPZA 4M9XA 1P4AA 4LG3A 3BDDA 4ZYGA 5LGTA 4UUVA 3S2DJ 3W6JB 4LK0F 2ICWG 3BPVA 4PDKA 1W0UA 3D0SA 1I1SA 3C2GA 3BCBA 3D5LA 1BR1A 4A3DJ 2Y48A 3PFYA 5FLMJ 4BY1J 2VT3A 1QRYA 1RI7A 2JUGA 1YIJI
chains in the Genus database with same CATH topology
3I55I 3G71I 2NXNB 5GAEJ 3J7YJ 3PIPF 1VQ6I 3CCEI 4IOCF 5GAHJ 2FOWA 3CCUI 5DM7F 2E34A 2ZJPF 2QA4I 1S72I 1YI2I 2ZJRF 2OTLI 1YITI 3G6EI 5GAGJ 1FOWA 3CCRI 3J7ZI 2E36A 3CC4I 2K3FA 1FOYA 3CC2I 5JVGF 1VQ8I 5GADJ 3CCSI 3CC7I 3CCJI 1VQOI 2JQ7A 3CCMI 3I56I 2H8WA 3CJTB 4IO9F 1VQ4I 4V19K 1YJ9I 1MMSA 5DM6F 2ZJQF 1YJNI 1VQKI 3PIOF 1ACIA 1Y39A 1HC8A 2E35A 4UY8I 1YHQI 1VQLI 1VQ5I 1VQNI 1VQ9I 1FOXA 1QA6A 2QEXI 3CCQI 3G4SI 3CMEI 3CCLI 1VQMI 3CMAI 3CCVI 3CF5F 1YIJI 1VQ7I 3CD6I 2OTJI 1YJWI 4IOAF 1VQPI 3DLLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 I;  3G71 I;  2NXN B;  5GAE J;  3J7Y J;  3PIP F;  1VQ6 I;  3CCE I;  4IOC F;  5GAH J;  2FOW A;  3CCU I;  5DM7 F;  2E34 A;  2ZJP F;  2QA4 I;  1S72 I;  1YI2 I;  2ZJR F;  2OTL I;  1YIT I;  3G6E I;  5GAG J;  1FOW A;  3CCR I;  3J7Z I;  2E36 A;  3CC4 I;  2K3F A;  1FOY A;  3CC2 I;  5JVG F;  1VQ8 I;  5GAD J;  3CCS I;  3CC7 I;  3CCJ I;  1VQO I;  2JQ7 A;  3CCM I;  3I56 I;  2H8W A;  3CJT B;  4IO9 F;  1VQ4 I;  4V19 K;  1YJ9 I;  1MMS A;  5DM6 F;  2ZJQ F;  1YJN I;  1VQK I;  3PIO F;  1ACI A;  1Y39 A;  1HC8 A;  2E35 A;  4UY8 I;  1YHQ I;  1VQL I;  1VQ5 I;  1VQN I;  1VQ9 I;  1FOX A;  1QA6 A;  2QEX I;  3CCQ I;  3G4S I;  3CME I;  3CCL I;  1VQM I;  3CMA I;  3CCV I;  3CF5 F;  1YIJ I;  1VQ7 I;  3CD6 I;  2OTJ I;  1YJW I;  4IOA F;  1VQP I;  3DLL F; 
#chains in the Genus database with same CATH topology
 1XGO A;  4L5I A;  3LQR A;  2ME0 A;  2K27 A;  2RRE A;  3REO A;  3KIO A;  4A0Z A;  3CCR I;  3QP6 A;  4G6T B;  2CUF A;  3LSI A;  3QPL A;  1ENH A;  2JPC A;  1XC5 A;  1J09 A;  1T39 A;  2YX7 A;  5IT9 Z;  1ACI A;  3RJP A;  1GV5 A;  1IN4 A;  2WAF A;  4UUS A;  2Z16 A;  4BHC A;  5FJ8 J;  1BOA A;  4FE4 A;  2ELK A;  3JW4 A;  5F64 A;  1GVD A;  2WB1 A;  3I4P A;  3FBI B;  3HM5 A;  2KL4 A;  3DEU A;  5FLX Z;  1HF0 A;  3J7Z I;  1R9T J;  3I5U A;  4LG0 A;  2BY1 A;  4BXU A;  4ESJ A;  3DFG A;  1UHW A;  3A03 A;  1WZ2 A;  1SAN A;  4NQW A;  2GOM A;  2P8T A;  5JHU A;  3SXY A;  3CDI A;  4A3F J;  2EFW A;  1SVL A;  1B72 A;  1FTT A;  3PL8 A;  2OQG A;  4IQ4 A;  3DWL E;  2DA7 A;  1MSE C;  3GTK J;  3OIP A;  4WK8 F;  4CA0 A;  1GXQ A;  1DU6 A;  2DI3 A;  3ABU A;  4MGR A;  4YG2 F;  2BEO A;  1ORK A;  1ZGA A;  3E6M A;  3QOP A;  5CVI A;  4HLY A;  1G8X A;  2DMT A;  2PEX A;  1I27 A;  4JOM A;  2W25 A;  2L2O A;  4AU7 A;  5EZG A;  3BR6 A;  3DTK A;  2LKX A;  1W5C C;  3LSR A;  2KFD A;  2Z33 A;  1SFE A;  2JVG A;  2MD5 A;  2Y69 H;  3ZQG A;  1ON1 A;  4U0V A;  4E6K G;  4MQV A;  1R5I D;  4P9F A;  2XDV A;  3QOD A;  2NVU B;  2DMQ A;  3GZ5 A;  3H92 A;  2G7U A;  3BWG A;  3OIQ A;  3ESW B;  1ZLJ A;  2B63 J;  4XLF A;  2CFO A;  2HVS A;  2DYS H;  2FBK A;  5JVG F;  2ECB A;  2LYC A;  3HSR A;  1IDZ A;  4QPQ A;  3EYI A;  4DYQ A;  3BJO A;  3ZMV A;  2ELJ A;  1B9N A;  4BUP A;  1Y39 A;  1W7P B;  1VQL I;  3BOQ A;  4HYE A;  1XMK A;  1E2X A;  4DYR A;  4DJA A;  5HS9 A;  4X0G A;  3OYF A;  4XM3 A;  4YEL A;  4D7N A;  5J1R A;  2X1E A;  2M9H A;  4A3L J;  3ZQL A;  4RB0 A;  1SVM A;  2BYV E;  4NC6 A;  3K4C A;  2JTV A;  2HGC A;  1WKM A;  5TRD A;  2HOT A;  3KPH A;  3DF8 A;  1KU7 A;  2JQ7 A;  1JUS A;  4XKV A;  2LMD A;  3PO2 J;  1O57 A;  4PJJ A;  2I8D A;  2K4B A;  1J75 A;  2L5Q A;  1ZR2 A;  2ESH A;  3PO3 J;  3MVP A;  1DUX C;  1JHH A;  4XIC A;  2QQB A;  3OS1 A;  2NVT J;  2VUM J;  4MNU A;  2E1O A;  2V9V A;  4CXF A;  4CO8 A;  5ICC A;  1FBU A;  2Y9Z A;  2A05 A;  3HRT A;  3OYN A;  3MKY B;  2HQA A;  4II2 A;  2GXG A;  3EUA A;  3MZY A;  4RLF A;  2M7B A;  3HEF A;  2AS5 F;  4OIO F;  2CMP A;  4Y3O A;  5FKL A;  1TQP A;  1F36 A;  3OS0 A;  4V19 K;  2AXL A;  3HB9 A;  1LKX A;  2OD5 A;  2K9M A;  4I0A A;  4F92 B;  2M8G X;  2NOG A;  1D8J A;  4N0B A;  4ZZD A;  4ITV A;  4IQJ A;  1BA5 A;  3WU2 C;  3FMQ A;  1IN5 A;  1IN7 A;  2H6B A;  1MBE A;  2CSO A;  3TO9 A;  3H9Q A;  1W4M A;  4M74 A;  2VT2 A;  3OIO A;  1T0F A;  3HPG A;  3L2R A;  3GYH X;  4RAF A;  3JRA A;  1XD7 A;  3KP6 A;  5D4S A;  3BY6 A;  4C2U A;  4ASN A;  5DV5 A;  2STW A;  2AQE A;  3CCM I;  1FMW A;  1MBK A;  2VL8 A;  3GME A;  4AM3 A;  4GXO A;  5FKK A;  2F4I A;  1P9Q C;  2D2W A;  1HW2 A;  2CUJ A;  3R0J A;  4A0X A;  3AKZ A;  1TWG J;  4LK1 F;  1REP C;  4A3G J;  1IRZ A;  1ITY A;  2XPU A;  3PSI A;  1AKH B;  1VZ0 A;  3FKJ A;  2M4K A;  3CUO A;  3CD6 I;  3C18 A;  2HOE A;  2V1U A;  3OSG A;  1NHA A;  2VE8 A;  5J3L A;  1S6L A;  2BW3 A;  5TGT A;  2E5N A;  2OC6 A;  5BMZ A;  3SZT A;  4AIH A;  3AFH A;  3GW2 A;  1T95 A;  4OIR F;  3VWB A;  1FOY A;  4M72 A;  3E6C C;  3IAS 2;  5HVQ C;  3WGG A;  2JUC A;  1ON2 A;  1Z6T A;  4BHP A;  2VI6 A;  4C3H J;  5IOY A;  5JHF A;  4HOB A;  2R0Q C;  4ENN A;  4LOC A;  1XSV A;  5L3F A;  1U5T C;  4HX4 A;  1VQ7 I;  3WTZ A;  3ONQ A;  3SDG A;  3K0L A;  4D0P A;  2JA8 J;  4CYD A;  1ZH5 A;  5DCF A;  1DDN A;  1Z91 A;  2VQC A;  2X1C A;  3KYC B;  3OMY A;  4IVN A;  3CDL A;  2GLO A;  2FQ4 A;  4Y17 A;  2QSF X;  4CCL A;  1J5Y A;  5D5U B;  3RPU A;  2MC4 A;  4AC0 A;  5J8F A;  5LRS A;  2V26 A;  2DCE A;  2LF8 A;  1UG0 A;  2HDD A;  2B9S A;  3HGG A;  4BS9 A;  4RAY A;  1K4T A;  1ZHF A;  3RKY A;  1IC8 A;  1Z9C A;  1X1C A;  1OCR H;  3ZN0 A;  4MTE A;  4XSX F;  1O7F A;  5HDG A;  4KIS A;  3PFI A;  4I2O A;  1O3Q A;  5E20 A;  3SZP A;  3MQ0 A;  1K78 A;  2E2H J;  3U1D A;  3L09 A;  2BOL A;  2ZJP F;  5LHH A;  3AG4 H;  2KRH A;  1R1V A;  5LEK A;  3L2Q A;  3ZPL A;  2NNN A;  3WTS C;  3OSF A;  3RCO A;  1HA8 A;  1JGS A;  5F08 A;  2LF7 A;  1MBH A;  3OOU A;  1V54 H;  2HFH A;  4ON0 A;  5DM6 F;  2KJC A;  5LD2 C;  5EEG A;  1HBX G;  3E7L A;  4XN0 A;  3S1Q J;  3H9G A;  2H1L A;  3C2B A;  3KFW X;  4J00 A;  3S1M J;  2XPV A;  5ICG A;  1BR2 A;  1SVO A;  1OR7 A;  2EH3 A;  5M5W J;  1YLF A;  4GFB A;  4ZDP A;  1X2M A;  4LD5 A;  1W7P D;  4XKB A;  4OIN F;  3ZQH A;  3IRR A;  2CGP A;  3DEW A;  5DUK A;  4D5C A;  3FX3 A;  2X1D A;  3L2U A;  2AQF A;  1VQ4 I;  4LLN A;  1WHU A;  4JBA A;  3WE3 A;  3VDX A;  2CU7 A;  2JMW A;  2FMY A;  4M71 A;  2DT6 A;  3ZMD A;  2V79 A;  3EUH C;  1E17 A;  2V1X A;  1QQI A;  2VJ4 A;  1ZK8 A;  4R79 A;  1MND A;  1ZQ3 P;  1HDD C;  4K2E A;  4RM2 A;  4I0B A;  3TOA A;  2DA5 A;  3HUG B;  3S3M A;  5F1R A;  1IXC A;  1V4R A;  2F4M B;  5BPI A;  3K4B A;  2VQL A;  1X58 A;  2BZT A;  2KDZ A;  2M34 A;  2O0Y A;  2HEO A;  1FEX A;  2FA5 A;  4YFX F;  4RM3 A;  1GUU A;  3I59 B;  1Z3X A;  2MLK A;  5GPC A;  2DDB A;  1H9G A;  3FMS A;  2V4J C;  2GA1 A;  3BG9 A;  3WU0 A;  2A61 A;  3F3X A;  5HLI A;  4CYC B;  3HKZ N;  4S0H B;  4GYG A;  2IJL A;  2LKS A;  5HS7 A;  2WTE A;  3VEP A;  4BEH A;  3OYB A;  1RIO H;  3FXQ A;  2CFX A;  3B6C A;  1P4W A;  2LRE A;  3BQY A;  3N4M A;  2IPQ X;  2KIS A;  2VC1 A;  1ETK A;  2BY2 A;  1K6O A;  1UST A;  3P9C A;  2P5V A;  2NYX A;  5E8G A;  2BHY A;  2EFQ A;  4PJN A;  5L3G A;  1B9M A;  5DUI A;  3A01 A;  1LDD A;  3BT9 A;  4UHT A;  4Y33 A;  4A3C J;  1K83 J;  1V55 H;  1RKT A;  2WC2 A;  3QYB A;  3PIO F;  1WVR A;  3J81 K;  1Z77 A;  4XOT A;  4EM0 B;  1XCV A;  3S3N A;  2K40 A;  2G9W A;  3B02 A;  4OU0 A;  5E1W A;  2XAS A;  1EJ9 A;  2RC4 A;  4J01 A;  3JRE A;  1R5H A;  1SAU A;  2FUG 2;  4IJA A;  2R7S A;  1ETX A;  2K3P A;  2LVS A;  1JUM A;  2KMU A;  3F6O A;  4I01 A;  4XL9 A;  1QBJ A;  4M9Z A;  3A2K A;  1RUO A;  2OZU A;  3K10 A;  2GIV A;  2GWR A;  2DA6 A;  1G3S A;  4ZYE A;  1YQA A;  1B1B A;  3WHB A;  4KUM A;  3DU6 A;  2CYY A;  2FOK A;  5F04 A;  4DGW B;  4YFK F;  2A3S A;  2VPR A;  1SC7 A;  3L9F A;  2VOP A;  4M3E A;  3MKZ A;  3OY9 A;  2DA3 A;  3S15 J;  4BL0 B;  3G1O A;  2HYF A;  4ANJ A;  4MTD A;  5K5R A;  3OR2 C;  3EET A;  1VQM I;  3CMA I;  2W48 A;  1NG6 A;  3F8F A;  1S8N A;  1I6H J;  3V7S A;  3AL0 C;  1UHS A;  1K4S A;  2KP6 A;  4IHY A;  1R4N B;  1U9N A;  3ASO H;  5DM7 F;  4IRI A;  4OMY A;  4HV6 A;  2OTL I;  1Y8Q B;  2ZXI A;  2CRG A;  2LTP A;  2XAF A;  4PCQ A;  3G1M A;  4AYB N;  4JQF A;  2F5C A;  4G6D A;  5DYM A;  1WH7 A;  2LKP A;  4RBO A;  2Y2Z A;  2Y31 A;  4FIS A;  2R7D A;  1SFO J;  4KN7 X;  4OWR B;  4XOP A;  2QM3 A;  1OCC H;  2MFZ A;  5CPR B;  4PJL A;  5CVU A;  4XSZ F;  1LDJ A;  1LNW A;  4RDU A;  3BTJ A;  3DBH B;  4PJ0 C;  2RN7 A;  5L3C A;  1Z67 A;  4G6Q A;  3DEE A;  2FF4 A;  3VOE A;  1PJR A;  3HRM A;  3TKY A;  3WGH A;  1IRX A;  3CUQ A;  4UUT A;  3I4N J;  3WTU C;  2E2J J;  3BCA A;  4G9Y A;  1XGM A;  4ENM A;  3CJN A;  3A02 A;  2ZFW A;  2R7R A;  2Z3Y A;  2Y0M A;  5EJC A;  2ZME B;  5FKM A;  2L7K A;  2R5Y B;  1FYK A;  3K2Z A;  3V7C A;  1XGS A;  4C30 A;  3RKX A;  3FZV A;  3LSG A;  4KN4 X;  3GVA A;  3FXU A;  3I55 I;  3W6V A;  1HC8 A;  2F48 A;  1Z7L A;  2VKH A;  4N4N B;  3W2W A;  2QSG X;  3ROU A;  1TWA J;  1F5T A;  2CV1 A;  3K7A J;  1KON A;  4BJT A;  1N77 A;  2GXA A;  2XAG A;  1Y8R B;  2NAZ A;  3QYF A;  3K2A A;  3K69 A;  5DS9 A;  2QBY B;  3NEU A;  1LVA A;  1U5T B;  1K7A A;  1W1W E;  2FNP A;  2BXY A;  2M1B A;  3HG9 A;  4D5F A;  3EUK L;  4R8H A;  2HNH A;  4RB1 A;  2NVQ J;  4LLL A;  4MQ9 F;  2CUE A;  2P7V B;  3JSO A;  3FIS A;  4UV9 A;  2P0W A;  3SEQ A;  4DYC A;  3DTI A;  2HTS A;  5GAE J;  2HR3 A;  2K5C A;  1QPM A;  4CGZ A;  1FY7 A;  1S5L C;  1VI0 A;  2X6O A;  4LGW A;  5DD4 A;  3F22 A;  4EAT A;  3L2C A;  1FTZ A;  2V7F A;  4ZC3 A;  4A3E J;  3T1B A;  2LY1 A;  3TW7 A;  2XB0 X;  5DCM B;  3B73 A;  1TQI A;  4HQE A;  1DQU A;  4I98 B;  2JA7 J;  1VQN I;  3I53 A;  4EVI A;  2IA0 A;  2M4G A;  2Q1Z B;  3KP4 A;  3MFK A;  5CVJ A;  1BM9 A;  1OMI A;  1MMD A;  3KLN A;  5E3O A;  2OA4 A;  1YTY A;  4CCJ A;  1JTX A;  3P9K A;  1YO5 C;  4M3F A;  3WTY C;  2D5V A;  1G59 A;  2KIM A;  1X3U A;  3ABT A;  3NAR A;  4NNJ A;  1LPQ A;  4Z2Y A;  1KU9 A;  3VYS B;  2IS1 A;  2HI3 A;  1ZGJ A;  3CP2 A;  2BHZ A;  4DIQ A;  3CO6 C;  2N8G A;  4N9H A;  4ZTF A;  2XAU A;  1RUN A;  1JT0 A;  4A3J J;  3S1N J;  3OV8 A;  2ZME A;  1WJE A;  3KE2 A;  3RZD J;  4Y52 J;  3DU5 A;  4KMU X;  1ZR4 A;  2PX9 A;  1PDN C;  3AAF A;  2BVM A;  2IGK A;  3E1S A;  4BJ5 C;  1YFH A;  4KDP A;  2R5Z B;  1BR4 A;  1VFC A;  2F5D A;  2X0L A;  1SFU A;  4KIG A;  3BQZ A;  2O61 A;  1JE8 A;  2A5Y B;  4A12 A;  1Y6I A;  3HSF A;  4NDL A;  5F0F A;  2MAB A;  1ETW A;  2DOE A;  1IV8 A;  4UB8 C;  1R71 A;  4F3Q A;  4RA2 A;  2MSY A;  2BGC A;  2KZG A;  4PJM A;  4U87 A;  5CLS A;  3JRF A;  5IP9 J;  5A2Q K;  3QRF F;  4F7Z A;  1JKO C;  2P81 A;  2HOA A;  1WFX A;  4WF2 A;  1QU3 A;  2HZD A;  4I09 A;  4QWQ A;  4BE0 A;  4BAC A;  1OJL A;  2Y0S N;  4E7J A;  1ODD A;  3KZZ A;  4IX7 A;  4BBS J;  3SDB A;  3L2W A;  1ETV A;  2EIL H;  4L9T A;  3SFI A;  1RRJ A;  3ZMT A;  1HSJ A;  5CVV A;  2TDX A;  1IG7 A;  3H36 A;  2IBD A;  4BH9 A;  4IRH A;  5D6E A;  2VQH A;  2DW4 A;  4OAZ A;  1ULY A;  1JKR C;  5EGO A;  2CS3 A;  2E2I J;  4M3B A;  4EJU A;  1O3R A;  4WX9 A;  1O3S A;  3G73 A;  3QP5 A;  1X1B A;  3ZMZ A;  3L00 A;  3V42 A;  2E7W A;  3DLL F;  1TWH J;  3GF2 A;  4S04 A;  1ZLK A;  5FLX K;  2Y0S A;  1YW7 A;  4B4C A;  5GAH J;  2E34 A;  3H5R A;  1JJ6 C;  3H0D A;  2R4G A;  1AU7 A;  2KLO A;  4HNV A;  2LY2 A;  2BXZ A;  3I58 A;  3CC2 I;  4H4K C;  3KZY A;  2O8X A;  2WY7 Q;  1EH7 A;  2QGU A;  1WJD A;  4GCV A;  4ENK A;  2ZME C;  2ELH A;  2QEN A;  1ZG3 A;  1H9T A;  5L3D A;  3H5N A;  1TTY A;  3R4K A;  5JR3 A;  3E5U A;  1BL0 A;  5AIP A;  5M5Y J;  3VYT B;  4DW6 A;  2Z9O A;  1BW5 A;  3DBR B;  1APL C;  3H3Z A;  4FQG A;  2HXO A;  2QEX I;  2VOO A;  1A6Q A;  4PSW A;  3JRH A;  4FET A;  2D1V A;  3WU1 B;  3R61 A;  2IGO A;  3BTC A;  3IHU A;  2H6C A;  1WJA A;  3CCY A;  3K4J A;  4RGS A;  1UJ8 A;  3Q0V A;  4XLN F;  3X2Q H;  2E36 A;  1XX5 A;  3QU3 A;  1JKP C;  4BXX J;  2A69 F;  1KQ9 A;  1SFX A;  3PUF A;  4XBF A;  3ZGK A;  3J80 K;  1W7P A;  3V8L A;  1QVU A;  1MNE A;  2K9N A;  4O6J A;  4L0Z B;  1IN8 A;  3JTG A;  2F6C A;  3ELK A;  2DO7 A;  3K6G A;  2M30 A;  2IXS A;  3CJQ B;  1KZH A;  5H20 A;  1MNM C;  1HW5 A;  1OKR A;  4HNT A;  4RMN A;  2EB7 A;  4M3G A;  2HKO A;  2VJ5 A;  3OL3 A;  3ZRG A;  3JRD A;  1POG A;  3I59 A;  2AHQ A;  3M8J A;  4BGD A;  3IAM 2;  1ETY A;  3LSP A;  3F21 A;  2VJJ A;  2FBI A;  1HDP A;  3N05 A;  2GQQ A;  3PQJ A;  5CQE A;  1TW3 A;  1B6A A;  3MMY B;  5DTD A;  3LFK A;  3MKW B;  1QO0 D;  2L02 A;  5H6R A;  2PBI A;  4NC7 A;  3DV8 A;  2LLK A;  5IT9 K;  3ERM A;  2QCO A;  5K7H A;  3H1C A;  1FOX A;  4C9Y A;  3LST A;  2H8R A;  3DPU A;  3RIR A;  5BOX A;  2HTJ A;  2XAQ A;  1H0M A;  4HDV A;  3IP4 B;  3P5J A;  2V6C A;  5EEH A;  1D5V A;  2P5L C;  5IPA A;  5EGO B;  1G3Y A;  2X51 A;  5FGM A;  3M4O J;  3HOU J;  2ZO4 A;  1HLV A;  1XTA A;  2W84 A;  1F1Z A;  2A6H F;  4XMY A;  2VLA A;  4BE1 A;  1IGN A;  4KMF A;  5IP6 A;  3S17 J;  1MD0 A;  2P7C B;  2XGX A;  2F5F A;  3R60 A;  5B66 C;  5H2F C;  4OMZ A;  1VQ5 I;  1MMN A;  1R1T A;  1S7O A;  3FXO A;  3RQI A;  3O8H A;  3OYA A;  1NK3 P;  1T38 A;  2CQX A;  4LG0 B;  1UZC A;  2HWV A;  1G4D A;  4XQF A;  1KGS A;  2L7Z A;  3K1N A;  4IRG A;  2RKH A;  2MW8 A;  5GP9 A;  5D5X B;  2AXT C;  4XLA A;  3GTQ J;  2UV1 A;  4XLE A;  1RPW A;  1QHH D;  3FIW A;  3E97 A;  4L5J A;  4MIM A;  5LFA A;  2K7L A;  2LC2 A;  1PVE A;  2A07 F;  2MC3 A;  3PNV A;  4P96 A;  3IH3 A;  1QA6 A;  3AG3 H;  4Y4R A;  2R92 J;  2ESN A;  5D8K B;  1UEL B;  5C44 J;  3FMR A;  2LK2 A;  4U7B A;  2K4J A;  1BI1 A;  1BJZ A;  2QQ8 A;  1BJA A;  2UUZ A;  4HG2 A;  3TP0 A;  2ZKZ A;  1FWZ A;  1ETO A;  4U7D A;  2PI0 A;  2HDW A;  3GTG J;  1GDT A;  2K86 A;  2F4O B;  1Z7U A;  3JCU C;  5ED4 A;  1BBY A;  5ICE A;  2VBY A;  2IGM A;  1EH6 A;  1QPI A;  4G94 A;  2HQR A;  3LSK A;  3WG7 H;  1HKQ A;  2WWY A;  1SMT A;  4QIW N;  3HRS A;  3DCF A;  4E7S A;  3JR9 A;  3ZQI A;  1OYI A;  4CCK A;  2W7N A;  3G71 I;  3PIP F;  2OUM A;  4IOC F;  2CUZ A;  2DOD A;  2I10 A;  1O7L A;  1ZAO A;  2ZBK A;  3LA2 A;  5EG0 B;  3FXK A;  3I9V 2;  1GHC A;  1LB2 A;  3ZXS A;  3E5Q A;  2DA2 A;  2KIF A;  5IY5 H;  1I5Z A;  3BR2 A;  3G2B A;  4MHG A;  4UNO A;  3MWM A;  4XLP F;  5H6Q A;  2CW7 A;  4CIC A;  4HRI A;  3KEQ A;  1D0X A;  4L0Y B;  2O8K A;  3CMM A;  2QWW A;  3HYI A;  4HST A;  2HDC A;  4Y13 A;  2CQK A;  5E3N A;  3S1R J;  1FT9 A;  5M3M J;  3IUO A;  3L7W A;  4EJT A;  1ZRC A;  3GTP J;  1VQ6 I;  2ZB9 A;  2ZFU A;  1EA3 A;  4ZZL A;  5E1X A;  3HPH A;  4FE7 A;  1WJC A;  1D1B A;  1IRF A;  2QBY A;  2P4W A;  5C3E J;  5J47 A;  1IF1 A;  1U0J A;  2CWE A;  1FSH A;  3G1L A;  3SJM A;  3SZG A;  1YJ9 I;  1NK2 P;  4LFU A;  2PMZ N;  1H89 C;  4NHJ A;  2XAH A;  5FD6 A;  3H35 A;  2FJ1 A;  4I7H A;  1I39 A;  3A0H C;  3R0A A;  4ZJZ A;  1TQM A;  1SD6 A;  4QTR A;  4U88 A;  3OYL A;  5LRR A;  2E7X A;  2KJB A;  3JRB A;  1NH3 A;  1T6S A;  4ZH4 F;  3EYY A;  3GFL A;  2MD0 A;  1WRJ A;  4X1E A;  1LJ9 A;  4E7I A;  3P9I A;  2PG4 A;  4EM2 A;  3VOD A;  2IA2 A;  1XN7 A;  2EJR A;  1R00 A;  1JI8 A;  2KZV A;  2X85 A;  3HJE A;  3TBI A;  2HQ5 A;  2Z1D A;  3BG5 A;  4C3I J;  1SAX A;  5CQG A;  3GFM A;  2DT7 B;  2PJR A;  3CLO A;  5E18 F;  1VND A;  4AID A;  1TZL A;  2EIN H;  4B43 A;  4I6Z A;  1R6R A;  1LFP A;  3G3Z A;  2DYR H;  1YX3 A;  3CP8 A;  3I64 A;  3LAJ A;  2DMN A;  2W57 A;  1YG2 A;  2EZH A;  2ZNZ A;  1IO2 A;  4UVA A;  3BR5 A;  1JUP A;  3K9T A;  3U21 A;  1KA8 A;  4HZF A;  3J80 Z;  1TNT A;  1OCP A;  3NQO A;  3BZC A;  1RET A;  1YW8 A;  2Q2E B;  1IAW A;  1B8I A;  1VQ9 I;  3CCQ I;  3CME I;  1W36 D;  1MDM A;  2L7M P;  1K6Y A;  4YIR X;  4H0E A;  4XON A;  4IF4 A;  1U8B A;  4BYY A;  1FYL A;  1OCO H;  5K5Q A;  2RVC A;  3OYD A;  1YW9 A;  3PSF A;  2WAQ N;  2ADU A;  3KLO A;  3GFI A;  3AL0 B;  2VN2 A;  2R5Z A;  3NRV A;  3S32 A;  2JT1 A;  2BY3 A;  2VQG A;  3OYK A;  1HCR A;  4GO1 A;  5FB2 A;  9ANT A;  3V4G A;  1MSF C;  2H8W A;  4ZYH A;  3GZN B;  4XRS A;  3N97 A;  1H88 C;  1BI2 A;  1D8K A;  3D5R C;  1Q1V A;  2OCC H;  4GYI A;  1LVK A;  1RKW A;  1FPQ A;  3W2A A;  4QPO A;  2NS8 A;  3T5X A;  2PMU A;  2JRM A;  4XID A;  2JPB A;  2ME6 A;  4BQO A;  2X6X A;  1U3E M;  3MEX A;  4XLH A;  4TV7 A;  3S16 J;  1SD7 A;  3VYU B;  5DD8 A;  4C3J J;  1G3W A;  3LA7 A;  5A2Q Z;  2QF7 A;  4BJ6 C;  4DQ2 A;  3LOC A;  1U5T A;  2WV1 A;  1IUY A;  5BNG A;  1YX5 A;  2JA5 J;  1X1A A;  2IVM A;  1A04 A;  3KP5 A;  3HOX J;  2VBW A;  1RC9 A;  1KQ8 A;  1B72 B;  3SYT A;  5IYC J;  4C2T A;  5C4J J;  3LMM A;  1XMX A;  2H27 A;  3CUQ C;  2JWT A;  2OV7 A;  2KDO A;  4O3M A;  1VQ8 I;  4XRM A;  3WHC A;  3CCS I;  1XPX A;  1DPU A;  3VFZ A;  2WAE A;  3RI4 A;  1U2W A;  5LGN A;  2ZJQ F;  4IHV A;  2COB A;  3HHH A;  2O7O A;  1PYV A;  3GWZ A;  2IGN A;  1WPK A;  1DP3 A;  4W1U A;  3HDD A;  3W3C A;  3DPL C;  3BR3 A;  2LBF B;  4WCG A;  1CQT A;  2FNA A;  2OBP A;  2CJJ A;  2IAI A;  3QPS A;  2NS0 A;  1PUE E;  2LP0 A;  2ZNY A;  1LUJ B;  3F0C A;  5ERI A;  3ECH A;  4M73 A;  3H5A A;  2QA4 I;  5TIS C;  2L54 A;  3TDU C;  5FRN A;  4LIU A;  4HPQ A;  1LEB A;  4IXA A;  1HW1 A;  1IDY A;  5CKT A;  5FD5 A;  3IV5 A;  3GX4 X;  2HOS A;  4PGH A;  1R22 A;  1B59 A;  3ASN H;  4Z6Y A;  3KYD B;  1IRG A;  2AO9 A;  2X9D A;  2PMH A;  4CZZ A;  4N9I A;  2MA3 A;  2VXZ A;  3QPH A;  4AD9 A;  2P6S A;  2BVL A;  5BS6 A;  5ILV A;  4PK4 A;  2W85 A;  1UMQ A;  4BAY A;  3ZP5 A;  1WH5 A;  2YR2 A;  4HAM A;  2XRO A;  1RR8 C;  1OIS A;  3GLX A;  1XG1 A;  5EDN A;  1FBQ A;  3W2V A;  1EV7 A;  1Z6R A;  3JRG A;  3ZMS A;  3Q9V A;  2DJN A;  3RQ4 A;  3OR1 C;  2DA1 A;  2EA2 A;  2PQ8 A;  3ZOB A;  1IN6 A;  4WWC A;  2R7W A;  1FYM A;  1STZ A;  3BR1 A;  4LB5 A;  4NBQ A;  5KAI C;  3VB2 A;  1WI3 A;  2DLL A;  2A6T A;  2M7A A;  5B1A H;  2HPM A;  4P1W A;  5HS8 A;  2R7Q A;  1AWC A;  2PMZ A;  1R58 A;  2F5V A;  2TRT A;  3K4M A;  5KNL A;  3HTS B;  3KX2 A;  1MW7 A;  1X4P A;  4XNF A;  3CCL I;  1YYV A;  1IUF A;  3CF2 A;  4B48 A;  3BG6 A;  3BZ6 A;  3V8K A;  4OIQ F;  3FK6 A;  2FOW A;  2XRL A;  2B7E A;  5HLT A;  3C1D A;  5FLV A;  2GAU A;  3GUD A;  1D5Y A;  3ZR8 X;  2WB1 N;  3M7G A;  1IXS B;  3CC7 I;  3JTH A;  1A31 A;  4BBR J;  1MJA A;  3TOB A;  1BN5 A;  5BPD A;  1D0Y A;  1MZB A;  5D4R A;  2QKM B;  3HOS A;  3KZI C;  5J1Y A;  4OAY A;  4HNU A;  1KU3 A;  2W00 A;  3WE2 A;  1JHF A;  4UXN A;  4WXH A;  4HSR A;  3HXL A;  3CF5 F;  2GZW A;  2FRH A;  3WTV C;  1E3H A;  3J7Y J;  2UZK A;  1OYW A;  4L9V A;  3QOE A;  1FIP A;  3BG3 A;  1FLI A;  1D1C A;  3OS2 A;  1WJ5 A;  4XN3 A;  2Z5U A;  3M1E A;  4LB6 B;  5D5V B;  2XIG A;  1R49 A;  2V1D A;  4A5M A;  3S3O A;  4XKW A;  2IT0 A;  2L0K A;  3PNY A;  3H0G J;  2RQP A;  4B47 A;  2M2E A;  4L9J A;  1XDU A;  3ABL H;  3T8R A;  2EK5 A;  3U1K A;  3CQZ J;  4EQQ A;  1Z21 A;  3OL4 A;  1QZY A;  2E71 A;  3G4S I;  3COA C;  2R7U A;  1LEA A;  5J4V A;  4LMY A;  3A4C A;  1TBX A;  5E79 C;  5K5O A;  1HKS A;  1ZN2 A;  1OPC A;  2NXN B;  1TWF J;  5EG0 A;  4KFC A;  4DNC A;  4IZZ A;  1U9O A;  3MKL A;  4Q48 A;  5L3B A;  1MMG A;  3BP8 A;  3IL2 A;  5J8C A;  5EZH A;  2OJE D;  3R6S A;  3GTO J;  3PJR A;  4RAG A;  4YII A;  5FRO A;  2LSO A;  1P2F A;  2V6E A;  1P7I A;  3GLL A;  3L1P A;  1D0Z A;  3F8N A;  2F2E A;  4A3M J;  1OR7 C;  2BV6 A;  4J19 A;  2MYS A;  2IP2 A;  1T0F C;  4A5N A;  1IXR C;  3AG1 H;  2CW8 A;  2XHK A;  3LNQ A;  3OWT A;  1NTC A;  4CUG A;  1FP1 D;  3CC4 I;  2XKO A;  2FQ3 A;  4OIP F;  2EA4 A;  5CJ9 A;  2RGV A;  1NG7 A;  2XB5 A;  1G6N A;  3LA3 A;  2ZXJ A;  5KAF C;  2NS7 A;  3GFJ A;  4JX4 A;  1OYY A;  4LLG F;  3C7J A;  3BTL A;  1R23 A;  4E7K A;  1ZG1 A;  3J7A O;  3E6D A;  1TLH B;  2CQQ A;  4HX7 A;  3ZQ7 A;  1I1G A;  2PFB A;  4AVP A;  3OYH A;  2IA1 A;  2A5W A;  3F72 A;  5CYV A;  5E8I A;  1OCT C;  2VKV A;  2HS5 A;  2KIU A;  5D8L B;  3KET A;  3BR0 A;  3TW6 A;  2K85 A;  1MGT A;  3CCV I;  4HLX A;  3DKX A;  3QYE A;  4KT6 A;  3KEO A;  3E5X A;  4I02 A;  2EIM H;  4D7M A;  2B0L A;  4KIB A;  5J4Y A;  2NOJ B;  1YIT I;  1UG2 A;  3JAM Z;  2UWM A;  2FSW A;  3TO6 A;  2H09 A;  5HOD A;  3GTL J;  3C3W A;  3K4L A;  1Y0U A;  4BXF A;  2PJP A;  1MBJ A;  1XDS A;  4BU2 A;  3H3V K;  4RGX A;  4KIF A;  2X48 A;  4IPA A;  4BQA A;  4U0W A;  1N75 A;  1KQ0 A;  2DA4 A;  4OOI A;  3AG2 H;  4IEJ A;  2WBM A;  2Z99 A;  3IH4 A;  4RGR A;  1V5F A;  3RYP A;  3F23 A;  1X1D A;  1SEU A;  2HYG D;  1XCB A;  4X6A J;  3RTR A;  2O3F A;  4EGY A;  1R1U A;  4S05 A;  2R5Y A;  3CCU I;  3TED A;  2M0C A;  2K9Q A;  3M1C A;  1JT6 A;  4DBQ A;  3GTM J;  2FD5 A;  2IEK A;  1XSX A;  3ECO A;  4Q4Z F;  2V1N A;  2EV6 A;  3HHG A;  3CTA A;  5IP7 J;  5F0C A;  2DFE A;  2JA2 A;  2YSR A;  5FKN A;  4XRF A;  1K78 B;  1Z05 A;  4A3I J;  1CF7 B;  3OYI A;  3EQL F;  4EJW A;  2QYO A;  4KNY A;  3HBL A;  4CHU A;  1EF4 A;  2FU4 A;  5D6F A;  3OOP A;  5DDG A;  3Q3S A;  3Q0U A;  2L4A A;  2J5P A;  1ZEL A;  5JLX A;  1X19 A;  2W4S A;  3RKW A;  3IC7 A;  2ZXW H;  3IWF A;  5IYB J;  2K02 A;  2R7O A;  3CO7 C;  1V3F A;  4JYK A;  2HYJ A;  4NC8 A;  3HL2 A;  3TL4 X;  5M3F J;  4BQN A;  4RGU A;  2KIQ A;  4F52 A;  1I3A A;  1XSD A;  1U78 A;  4V2F A;  2DXI A;  3SHF A;  1WSU A;  2WAD A;  3P7N A;  2YS9 A;  1PP8 F;  2E1C A;  3K4N A;  1MMA A;  4IOA F;  2CH0 A;  3F8M A;  4HA8 A;  5CVR A;  5DCM A;  4WXD A;  4M6X A;  3KYL A;  4F55 A;  3U2R A;  1BC7 C;  4I99 C;  1YI2 I;  2W24 A;  3HOZ J;  2K9S A;  5FRM A;  4RB3 C;  2O9L A;  1WWX A;  4RAZ A;  2NVX J;  3UR3 C;  2XGE A;  3O8G A;  1ZTR A;  2P5K A;  3PNT A;  1T56 A;  1TP4 A;  1HKT A;  1YHQ I;  3LFU A;  4PGG A;  2BE5 F;  1A6I A;  1LDK B;  1VTN C;  4IHS A;  1UB9 A;  3MZ8 A;  3M8F A;  3CLQ A;  3CUQ B;  1Y0N A;  1OFC X;  2RNJ A;  4BNC A;  1YS7 A;  4UUS B;  2KHM A;  3VPR A;  2QSH X;  4ZYD A;  4ESB A;  2DK8 A;  2XF5 A;  2BY0 A;  2JZY A;  1WJF A;  1LQ1 A;  3BRO A;  3VYR B;  2ECC A;  2WV0 A;  2X4H A;  4PUS A;  4HX8 A;  4E4H A;  1M1E B;  1MMS A;  1E3P A;  5FO5 A;  4RB2 C;  4CCM A;  2M3A A;  2L7F P;  2IRF G;  5J40 A;  1TNS A;  3CZ6 A;  3RSN A;  4EEF G;  4EMS A;  1TT5 B;  1X4O A;  2CQ7 A;  2Z2S B;  5GTI C;  2VB6 A;  2EBI A;  2GM4 A;  2EFP A;  1OLT A;  1I3Q J;  1WGX A;  2GIZ A;  5K7Z A;  1FOW A;  3OYE A;  2PJR B;  2R7Z J;  4ZDO A;  1XMA A;  1PUF B;  3ABK H;  4EM1 A;  2LY9 A;  2OAZ A;  1YOV B;  4G7H F;  3FBN B;  4IHX A;  3SQN A;  4FAS D;  2OPT A;  4MEX F;  5HOO A;  2QKL B;  2XF6 A;  4B1R A;  3EUH A;  1U8R A;  5ILS A;  3O3K A;  4B09 A;  3HC7 A;  3FHZ A;  4BKX A;  1SMY F;  1ZYR F;  1R7J A;  2VE9 A;  2L01 A;  4HV5 A;  1LFU P;  3J7A Y;  4JX5 A;  3ML6 A;  1HOM A;  3KP2 A;  2FEZ A;  5FFZ A;  2MH2 A;  5AON A;  4AVZ A;  1BIB A;  4DZJ A;  3F9K A;  1YIO A;  2EFN A;  1GT0 C;  3GCM A;  4EGZ A;  3I0T A;  4KYW A;  2XSJ C;  1G2H A;  2RDP A;  2HZT A;  1A36 A;  5KHD A;  2VBX A;  2PN6 A;  4ABZ A;  1FSE A;  1R5G A;  2DMU A;  2HVR A;  2FML A;  3WTX C;  3FHN A;  1SD5 A;  3HOY J;  1KYW A;  2Q0O A;  4M6V A;  5HNF A;  2HVQ A;  2DFI A;  4GGG A;  2XC7 A;  3BC8 A;  5HLH A;  2LG4 A;  1YE9 A;  2JRT A;  4EJV A;  1P4X A;  2IS2 A;  2NNY A;  2EV0 A;  1TC3 C;  5IYD J;  3QQA A;  4UVB A;  1B4A A;  2FBH A;  2UXX A;  4ZDL A;  4N4O B;  4CYC A;  1JGG A;  2JSP A;  2FX0 A;  2Q8K A;  1FC3 A;  2LNB A;  3DKY A;  1FJL A;  2C6Y A;  2VXD A;  1QGP A;  2M0M A;  2E19 A;  2DOF A;  3WOD F;  1S7E A;  5GTH C;  4D1Q A;  3TO7 A;  3FDY A;  2MLG A;  2DAO A;  3A01 B;  5F27 A;  1IZ1 A;  1RES A;  1JXS A;  1V5G A;  3HIF A;  5GAD J;  3JRC A;  1BI0 A;  4IHT A;  5KK1 A;  1VQO I;  2W1O A;  1HQC A;  3E0J B;  2L9V A;  1DGW Y;  3HKZ A;  5K1Y A;  4BQQ A;  3J81 Z;  1YJN I;  3B6A A;  2OF7 A;  1CF7 A;  2L3D A;  1UHM A;  2DOA A;  3W6K B;  2EZI A;  1MKM A;  2QVO A;  2M5W A;  4NB5 A;  3EDP A;  4PFO A;  4YEJ A;  2EPF A;  4MO7 A;  1X1P A;  2E1N A;  1E3O C;  1S72 I;  2GBY A;  4CCN A;  2PLY A;  3GTJ J;  1Z1D A;  4O5V A;  2XSD C;  2CV0 A;  1OCZ H;  1R36 A;  1DP7 P;  1KU2 A;  4E7Z A;  1IV6 A;  4HW0 A;  4FX4 A;  1RNL A;  3MD2 A;  4B3A A;  4Q5S F;  3CCJ I;  2VJI A;  1MIJ A;  3CDH A;  4LIV A;  2GA2 A;  2HU9 A;  3HUG A;  2DFH A;  4Y15 A;  4CH7 A;  4AIJ A;  4G8X A;  2OQR A;  3OYM A;  4BE2 A;  4F93 B;  2MGQ A;  3MN2 A;  2XUB A;  2ID6 A;  3M3Y J;  2DQR A;  3HTU A;  1ZRD A;  1USS A;  1MDM B;  4FTH A;  2P6T A;  4E7H A;  5TJJ A;  1T33 A;  3ZCO A;  5M5X J;  2EIJ H;  1AA7 A;  1N78 A;  3CJR B;  2M87 A;  2RAE A;  3DBL B;  2LR8 A;  2LBF A;  2L9R A;  3ZQF A;  1Q1H A;  1L3L A;  5HDN A;  2VKE A;  3DKW A;  3WTT C;  4IO9 F;  3HGY A;  2ZSH B;  3QWL A;  5IT3 A;  1J59 A;  3SEZ A;  4DZP A;  3IWZ A;  3Q5F A;  1Z0X A;  2ACJ A;  3S2H J;  4UVC A;  1T98 A;  2DPD A;  1FIA A;  5LHI A;  2CQN A;  1X3W B;  1IJW C;  4PZJ A;  4CCO A;  2DPU A;  3TGN A;  4G7Z F;  1UCR A;  2I5U A;  1W5T A;  2HXI A;  4JP0 A;  2IS4 A;  2JJ7 A;  1UAA A;  2LFB A;  1MH4 A;  3HOV J;  3F8B A;  4Q47 A;  2R3S A;  2COM A;  4V2G A;  2YU9 J;  1TW2 A;  2DK5 A;  3KP7 A;  2HPI A;  4I76 A;  5C4X J;  2DTR A;  2W82 A;  4AIK A;  2BBY A;  2A6E F;  3LSM A;  3K70 D;  4HDU A;  1TL8 A;  2IW5 A;  2VOD A;  1OQY A;  2LOO A;  6PAX A;  2ZSI B;  1SD4 A;  3FXM A;  3GXO A;  2YX4 A;  1L0O C;  4R1H A;  3ZQC A;  2DU9 A;  3E3V A;  2JA6 J;  4L5E A;  2YUS A;  5B1B H;  5E17 F;  1LFB A;  2BW3 B;  2M8E A;  2DJI A;  3FKI J;  2ETH A;  1J0R A;  1DGR M;  3OYC A;  2DTZ A;  1C0W A;  3DXJ F;  2M45 A;  1O4X A;  3E6B A;  3GZ6 A;  2DT5 A;  2KRC A;  1VQK I;  1EH8 A;  5E3M A;  3BJA A;  2XVC A;  1AOY A;  1EKE A;  1R4M B;  3DPT A;  1W0T A;  5EEA A;  1S9H A;  4ENJ A;  2ID3 A;  4MLO A;  1ERD A;  4MEY F;  4BHB A;  1J2X A;  2HKX A;  4ESF A;  3FK7 A;  5FFX A;  4F91 B;  2EFO A;  3Q9S A;  1P6R A;  4JX6 A;  3CCE I;  3MAJ A;  4P9U A;  3HSE A;  1N25 A;  3UNG C;  3FF5 A;  2WA0 A;  4HQM A;  1ZG5 A;  1T8I A;  4IL6 C;  3BTI A;  1LE8 B;  1GXP A;  2ZCW A;  3S14 J;  3I54 A;  2DQL A;  5LBQ A;  1YS6 A;  1WJB A;  2KKO A;  1BW6 A;  4B44 A;  4DOZ A;  1I6X A;  3VSL A;  2O6G E;  2JN6 A;  2OU2 A;  3DLA A;  3LSH A;  1JKQ C;  4KJZ A;  1TT0 A;  3JSP A;  1XS9 A;  3DP7 A;  1AHD P;  2MG4 A;  5EYR A;  3I4M J;  5E3L A;  5L3E A;  4CDG A;  3BJ6 A;  2YPR A;  2HQN A;  3H3U A;  2MBF A;  3LL7 A;  1Y1W J;  5HDK A;  1YRN A;  4XLC A;  2X6Y A;  4B8X A;  4KIT B;  1HXD A;  5KVR A;  3DTE A;  4BDZ A;  2WY8 Q;  3TMO A;  3BG7 A;  5LLQ A;  3T0Y A;  1K79 A;  5F0H A;  4A3B J;  2H1K A;  1FMV A;  3RZO J;  2Y9Y A;  4XOR A;  2LDU A;  2RNG A;  2DBB A;  1CGP A;  2XGC A;  4CZC A;  1TWC J;  1I50 J;  5K7F A;  2D45 A;  2L9N A;  2XPW A;  4HF1 A;  2Y75 A;  1MBF A;  1MJ9 A;  1VF9 A;  5J1U A;  1K61 A;  2E60 A;  2O03 A;  2LH9 A;  4JK1 X;  4BDY A;  4MFE A;  1IW7 F;  1F4K A;  1QHG A;  4GRI A;  5HLG A;  4M9S A;  1F9N A;  4PSX A;  1UFM A;  3WG9 A;  4C2M J;  2EIK H;  2CV2 A;  5ICF A;  2YU3 A;  2OTJ I;  2LD5 A;  4E7L A;  3NWS A;  2QUF A;  4G7O F;  2ZJ2 A;  5EF6 A;  4IHW A;  2EV5 A;  5F6F A;  3RDI A;  3NAU A;  5B5E C;  4E70 A;  3RPQ A;  4GDF A;  2EQR A;  2XAJ A;  2X6W A;  3KEY A;  3IH2 A;  4A3K J;  1E0E A;  1RR7 A;  2K3F A;  2O5R A;  2KQR A;  2UXN A;  2NRA C;  1FP2 A;  4KA4 A;  5HNH A;  5D5W B;  1FBS A;  2L4M A;  3MZH A;  3PQK A;  4Y7N J;  2V9P A;  1ONV A;  1ZKG A;  2XF7 A;  4B3X A;  4HEA 2;  4ETS A;  2QLZ A;  3ERE D;  3RKQ A;  2STT A;  3MCZ A;  4A0Y A;  3SFZ A;  2R7V A;  4WXC A;  1QVT A;  3FXL A;  2CW0 F;  2CO5 A;  1DPR A;  1H8A C;  1XGN A;  3KCC A;  1RZ4 A;  1PUF A;  1FNN A;  1A5J A;  5B3S H;  5JVT A;  4BEH B;  2XGD A;  3HRU A;  3QPT A;  3ZN1 A;  5F1J A;  3OYG A;  3I56 I;  3CJT B;  3I3L A;  1QZE A;  2XRN A;  3KP3 A;  3BPX A;  3BZK A;  3LSJ A;  2JVH A;  3S8P A;  4UV8 A;  1G3T A;  2QZ8 A;  4RS8 A;  1S29 A;  1ETQ A;  4NQW B;  4M3D A;  3K4K A;  4QLC U;  5KCM A;  1WQ2 A;  3WGI A;  3M8E A;  1W36 C;  2GOX B;  3BLY A;  4FHT A;  3O2P E;  1Z3Y A;  2WAQ A;  2Y30 A;  1S7A A;  2G0E A;  1GV2 A;  2ZJR F;  3G6E I;  2VAS A;  4LIT A;  4ZYA A;  2FXA A;  2GXB A;  1Y1V J;  2A68 F;  1JTY A;  3K1P A;  1BIA A;  3U9G A;  2VIX A;  3O6B B;  3C2H A;  3WTW C;  2IS6 A;  5J6X A;  4UB6 C;  1BC8 C;  2ZC2 A;  3T8T A;  4HF0 A;  4P55 A;  2VON A;  5GPA A;  2D1H A;  3HZJ A;  4AWX B;  1FZP B;  4XKC A;  1YRN B;  4XRS G;  2V9K A;  3DQV C;  1YJW I;  2J5O A;  2VPL A;  4LJZ F;  4A93 J;  2R7F A;  4L9N A;  2QQA A;  2XV4 S;  5IOZ A;  1P7J A;  5LEJ A;  5FKO A;  3HOT A;  1MJB A;  3F8C A;  2RQQ A;  3V8J A;  3V7R A;  5E1Z B;  4FCY A;  2FE3 A;  1ZRE A;  2Q2E A;  2EWN A;  2ISY A;  4NUB A;  3TQN A;  2JSC A;  3ULQ B;  1PP7 U;  3PUB A;  1BOB A;  1GLN A;  1ZAR A;  3HOW J;  3IKV A;  4DBR A;  3GO5 A;  1ZGW A;  2KPM A;  2NVY J;  3K1M A;  1QZZ A;  1J7K A;  4CSW A;  2R93 J;  1A35 A;  1F43 A;  2E1M C;  4D9J A;  2R7X A;  3GEZ A;  1QNT A;  3FM5 A;  1XB4 A;  4EV0 A;  3CMY A;  4FT8 A;  2VKD A;  2L9S A;  4HF2 A;  1S3J A;  4II3 A;  2LRD A;  4MFD A;  2RV8 A;  4A6E A;  4EJO A;  5GAG J;  3S2W A;  2OCE A;  1SFK A;  1MBG A;  3IKT A;  3D1N I;  4AYB A;  4FX0 A;  1W5S A;  3TP3 A;  4YFN F;  3JAM K;  3LAP A;  3L2V A;  1FX7 A;  2E1M B;  3D5S C;  4L18 B;  3A1Y A;  1DU0 A;  4YIF A;  1ZRF A;  3LWF A;  4XK4 A;  2MH9 A;  3RYR A;  1V5E A;  1T08 B;  3M9A A;  3ISP A;  1X2N A;  1VQP I;  3A0B C;  3UKG A;  3OYJ A;  2DDA A;  4A6D A;  4KIC A;  3FWE A;  4A2U A;  1D1A A;  3QU6 A;  1T2K A;  1BI3 A;  2EZK A;  5DEQ A;  3IRQ A;  2TCT A;  1WI9 A;  3JRI A;  4ZTJ A;  4AUX A;  2CG4 A;  2G7H A;  1O3T A;  2R7T A;  1LE8 A;  2H94 A;  1J9I A;  3F6V A;  5LHG A;  3FXJ A;  4UY8 I;  2ZXH A;  4W97 A;  2DFF A;  3K70 C;  2K9L A;  4KT5 C;  3VSK A;  5JFR A;  2DN0 A;  2QQ9 A;  3ABM H;  5JI6 A;  4IKF A;  1B8I B;  3CES A;  5BQT A;  4G12 A;  4HBL A;  1GVJ A;  1P92 A;  2DMP A;  3Q0W A;  3PM1 A;  3ZQQ A;  1AKH A;  2VBZ A;  2KRF A;  2F5E A;  3RPU D;  3FM3 A;  3LQQ A;  1HST A;  4M6Y A;  1U6G A;  2JK3 A;  2E5Z A;  1X3Z B;  2OZ6 A;  3H9J A;  1Y56 A;  3M07 A;  1WCM J;  4RLQ A;  2ISZ A;  3I71 A;  3TDZ C;  2E35 A;  3NWT A;  1FOK A;  2KT0 A;  2XKP A;  3S93 A;  1JJ8 C;  4A69 C;  2VC0 A;  5JLW A;  3ZMU A;  4PFP A;  3GBG A;  1MH3 A;  5LGU A;  1KYZ A;  4QSH A;  5AIQ A;  1D3Y A;  2EZL A;  5ILU A;  4U0Y A;  4BY7 J;  4XR6 A;  3QAH A;  4P5O A;  4YRV A;  3FXR A;  3EPZ A;  4M9X A;  1P4A A;  4LG3 A;  3BDD A;  4ZYG A;  5LGT A;  4UUV A;  3S2D J;  3W6J B;  4LK0 F;  2ICW G;  3BPV A;  4PDK A;  1W0U A;  3D0S A;  1I1S A;  3C2G A;  3BCB A;  3D5L A;  1BR1 A;  4A3D J;  2Y48 A;  3PFY A;  5FLM J;  4BY1 J;  2VT3 A;  1QRY A;  1RI7 A;  2JUG A;  1YIJ I; 
#chains in the Genus database with same CATH homology
 3I55 I;  3G71 I;  2NXN B;  5GAE J;  3J7Y J;  3PIP F;  1VQ6 I;  3CCE I;  4IOC F;  5GAH J;  2FOW A;  3CCU I;  5DM7 F;  2E34 A;  2ZJP F;  2QA4 I;  1S72 I;  1YI2 I;  2ZJR F;  2OTL I;  1YIT I;  3G6E I;  5GAG J;  1FOW A;  3CCR I;  3J7Z I;  2E36 A;  3CC4 I;  2K3F A;  1FOY A;  3CC2 I;  5JVG F;  1VQ8 I;  5GAD J;  3CCS I;  3CC7 I;  3CCJ I;  1VQO I;  2JQ7 A;  3CCM I;  3I56 I;  2H8W A;  3CJT B;  4IO9 F;  1VQ4 I;  4V19 K;  1YJ9 I;  1MMS A;  5DM6 F;  2ZJQ F;  1YJN I;  1VQK I;  3PIO F;  1ACI A;  1Y39 A;  1HC8 A;  2E35 A;  4UY8 I;  1YHQ I;  1VQL I;  1VQ5 I;  1VQN I;  1VQ9 I;  1FOX A;  1QA6 A;  2QEX I;  3CCQ I;  3G4S I;  3CME I;  3CCL I;  1VQM I;  3CMA I;  3CCV I;  3CF5 F;  1YIJ I;  1VQ7 I;  3CD6 I;  2OTJ I;  1YJW I;  4IOA F;  1VQP I;  3DLL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...