3CMAI

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cmaI00
3DLLF 4IO9F 1VQNI 3G6EI 3CCVI 3I55I 3CCQI 1VQOI 4IOCF 1Y39A 3CF5F 1VQ7I 3CMAI 2ZJQF 1YJWI 2E34A 5DM7F 5GADJ 2NXNB 2ZJPF 4V19K 1FOYA 3I56I 3J7ZI 1QA6A 2OTLI 1HC8A 1ACIA 5GAGJ 1VQMI 2QA4I 3CD6I 2FOWA 1VQ4I 1S72I 1VQ6I 2E36A 3G71I 1YIJI 1YJNI 3PIPF 3CCEI 5DM6F 1FOWA 5GAHJ 3CCUI 2H8WA 3PIOF 1VQKI 3G4SI 3CMEI 1YHQI 1VQ8I 3CCMI 5GAEJ 2ZJRF 1YI2I 1VQLI 3CC2I 4UY8I 1YJ9I 1YITI 2OTJI 3CCRI 1VQ5I 3CC4I 1VQPI 3CJTB 3CCJI 1FOXA 5JVGF 3CC7I 3CCLI 2E35A 1VQ9I 2QEXI 2JQ7A 4IOAF 1MMSA 2K3FA 3J7YJ 3CCSI
chains in the Genus database with same CATH superfamily
2NAZA 1IRGA 1P2FA 4A0XA 2M87A 2QVOA 1EA3A 2VBWA 1FOYA 3TW7A 4RBOA 3HPGA 2VKHA 2EB7A 4OIOF 4UV9A 3BPXA 4XK4A 2OTJI 1FOWA 3BJ6A 3NEUA 1KQ9A 3DU5A 1ZGAA 3HIFA 2CUZA 5E1XA 3FDYA 1R23A 4A12A 2A6EF 2C6YA 2PX9A 2FMLA 3HYIA 3H3VK 2MYSA 2PI0A 4CYDA 1QZZA 4L0ZB 1MDMA 1ULYA 4A69C 3G1OA 5F6FA 2XSDC 3F22A 2M0MA 4UUTA 2L9SA 2QSFX 1FIPA 3G73A 3KLOA 3HSRA 2QF7A 3CCEI 3HBLA 3S93A 3NAUA 1ZG5A 3M1EA 2VIXA 1SFOJ 4RMNA 2KJCA 4NQWB 5J6XA 4OAYA 1R6RA 4BBRJ 3UNGC 5FLVA 2FU4A 3ECHA 1TLHB 1LDDA 5J8FA 1VQ9I 2R4GA 3WTUC 2STWA 2VN2A 3Q0VA 1NG7A 3IKTA 2HNHA 1HXDA 3RTRA 3HOZJ 1RETA 3M1CA 3H0DA 2ELJA 2YX7A 1VNDA 1ZTRA 3OYNA 2O03A 4U0WA 1MJBA 4IXAA 1Y0UA 4B4CA 4RM3A 1EJ9A 1FX7A 2VBYA 1T38A 5TGTA 3L00A 4OMZA 1HCRA 1MMNA 5M3MJ 1YI2I 3TQNA 1ZG3A 1H8AC 2ZC2A 2L4AA 3O6BB 4WK8F 2G7UA 3ELKA 2V4JC 4BYYA 3GFLA 4XM3A 4AIJA 4X1EA 2QM3A 5L3DA 4ZTFA 2P7VB 2UXXA 3ZPLA 5HLTA 3HB9A 4HW0A 3QQAA 1RC9A 5E8IA 3GLXA 3H9QA 2TDXA 1TQIA 5IY5H 1WKMA 5GTHC 1FP2A 1U0JA 2Z16A 1IV6A 4XRMA 1WGXA 3K4NA 3I58A 4I6ZA 1U5TA 2R7DA 1UELB 4QTRA 3RZDJ 5ILUA 1D8JA 4UV8A 3TGNA 3CDLA 4E7KA 2M7BA 3RYRA 4KDPA 2DN0A 3KP2A 1XGNA 4OINF 4MEXF 3IH4A 4XICA 4YFXF 1LUJB 1I3AA 3LA2A 2E71A 3HRSA 3Q3SA 3CF5F 4QLCU 1VQ7I 2UV1A 4BE0A 1MBKA 1MBGA 2EIJH 4I0AA 5GAGJ 3KEQA 1S7EA 1LNWA 2F4MB 3V8KA 2MA3A 2A05A 1T33A 4N0BA 5IYBJ 4EQQA 1JHFA 2HXOA 3WTZA 4BQAA 4ZYEA 1A04A 3Q5FA 2CFXA 1WQ2A 3RPUD 1B8IB 3ZQGA 2X1CA 1J75A 1EH7A 1I27A 2KZGA 4GXOA 4HX8A 3MKZA 1NG6A 4ENNA 1OYWA 4M3FA 1P9QC 3H9JA 4Y3OA 4XONA 5ICFA 1I6XA 4GYGA 3PSFA 3OYDA 2A68F 4IHTA 2CH0A 1SAXA 1JUPA 2IGKA 2KMUA 3E5QA 4KIFA 4P1WA 3T5XA 1TWHJ 3HOSA 2DA4A 2HS5A 3S3OA 3BZCA 1JXSA 2KL4A 4M6XA 2CUFA 2FBIA 5ILVA 5C3EJ 4LG0B 3GFMA 4N9HA 2P8TA 1DU6A 2E1OA 1WJ5A 4BGDA 2VPLA 2HYGD 3JRGA 4LIUA 2QQBA 1ETYA 1U2WA 1ETKA 2YSRA 2XROA 3OSFA 4RGXA 2EFPA 2F5FA 4ANJA 2ZJRF 5AIQA 2MD5A 2R7WA 3GTQJ 3CJNA 4XLCA 3A0HC 4PJJA 1PUEE 5HS8A 2KDZA 2QQAA 1A5JA 1L0OC 4LLNA 3G6EI 2Z1DA 3V8JA 3OYEA 2CMPA 4A3GJ 1IJWC 1YX3A 2H8RA 1Y1WJ 3J80Z 1IN8A 2Y0SA 3CDIA 2LC2A 3SDBA 2XUBA 1EV7A 3VSLA 2GXAA 1QPMA 1YW9A 6PAXA 4KIGA 2V1NA 4L0YB 2A61A 1TQMA 2ME6A 2L9VA 4M73A 1G59A 4AYBN 2H1KA 2KT0A 2UXNA 3FF5A 3AL0C 1G3SA 2R5ZB 1MMSA 1MKMA 2F5EA 1CGPA 2R93J 5C4JJ 3S2DJ 1ON1A 2MG4A 3BT9A 1D0YA 2HXIA 2Q1ZB 1KU2A 1ZK8A 2X0LA 2K9QA 1ZKGA 3FWEA 4JK1X 5CVVA 3BG6A 3GCMA 3LA3A 2X1EA 2GM4A 5JFRA 1W0UA 1X1AA 2COBA 3OV8A 2BY0A 2EBIA 4CZCA 2JUCA 2VBZA 5E20A 2KQRA 3CUQC 2OU2A 4JYKA 4MFDA 2QEXI 1XMKA 2ZJ2A 1BIBA 2LP0A 2IJLA 1E3HA 3NQOA 4LB5A 1WZ2A 3FX3A 1HW1A 3M8JA 4KT5C 4LITA 2A6HF 1UCRA 5FJ8J 1ZREA 2DTRA 1ZQ3P 2DPDA 3HM5A 4XKBA 1ON2A 3GEZA 3ZGKA 4XQFA 3S3MA 4C2UA 5M5XJ 5IYDJ 4CA0A 4LD5A 3A1YA 3JSPA 5GAHJ 3EYIA 4CXFA 3G4SI 3GTLJ 4PFPA 4CCJA 4M3GA 2L9NA 2XIGA 2LREA 3M8FA 2JA7J 1IZ1A 3MEXA 1JHHA 2HQAA 3KEOA 3G3ZA 2L7ZA 1AKHA 3IC7A 1F4KA 4EJTA 3EUHC 2A5WA 3L2RA 3OS1A 2FQ3A 2B7EA 4I02A 3J7ZI 1GVDA 4HDVA 2IA2A 4JBAA 5CVIA 2IGMA 4BACA 4XNFA 5FRNA 4BQOA 1W5TA 1RNLA 4IJAA 4U7DA 2WAQN 4XOTA 1MIJA 4XRFA 2E19A 3B6AA 3GXOA 1K78A 1MJAA 3D5LA 3IUOA 5AONA 2E5NA 3SZTA 4MQ9F 3GTOJ 1YJWI 2DA2A 3CCSI 4MLOA 3ZMUA 1LEAA 3KYLA 2A3SA 3GTGJ 1OPCA 5IT9K 2I8DA 2F48A 5ILSA 2V1XA 1U5TB 1JJ8C 3CO6C 1O3SA 2IS2A 3ZQIA 3ZN1A 1YQAA 1X4PA 4IZZA 5E18F 3GWZA 1B9MA 3IV5A 3C2GA 4HNUA 4BQNA 2DFEA 2HPMA 4XIDA 2HOEA 4J01A 2DA1A 1N78A 4CO8A 3HOYJ 4F7ZA 2JA5J 2DMTA 3H5RA 2DJNA 4A2UA 3HHHA 1BL0A 4F93B 5FD6A 5KCMA 1ZGJA 3RKYA 5EEGA 1B1BA 2FBKA 3U21A 2KIQA 2L5QA 5GPAA 1VQMI 4ZDLA 3LL7A 2D45A 4KJZA 2O3FA 4G8XA 4CZZA 5FRMA 1FSHA 2K40A 2CQQA 5E79C 3OL3A 4XSXF 2OC6A 1Z6RA 2DK5A 2QKLB 4BL0B 1S6LA 1HSTA 4EMSA 1J0RA 3MWMA 3H0GJ 2RQQA 2VQLA 5E3OA 3ABLH 4C3JJ 4Q5SF 3P7NA 1SFEA 2VQGA 1S7AA 2EV0A 4LFUA 3HKZA 2QYOA 4M72A 1D0ZA 3F6VA 2R7OA 3CD6I 1T8IA 2DYSH 2XRNA 5DYMA 1K4SA 3IL2A 1BC7C 3H92A 1P7IA 3L2VA 5D4SA 2R92J 2JSPA 5GAEJ 4FASD 1BBYA 4HX7A 2KKOA 4UB8C 3KZYA 3LQRA 3DKWA 3SXYA 3IHUA 3KP6A 5FFZA 4KN4X 5D6FA 4ZDOA 2R0QC 3PL8A 1XTAA 2QQ9A 1JTYA 1R58A 3GTMJ 1TWFJ 1TT0A 2LF8A 1IF1A 2CW7A 4BBSJ 1MJ9A 3E6CC 4MEYF 4ENJA 2YUSA 2V7FA 4UVCA 2Z5UA 1R36A 3C18A 1Z21A 2JJ7A 1I3QJ 3TMOA 4RB0A 3LSRA 5B1AH 1FYMA 3KIOA 3L9FA 1XCBA 1FY7A 3TBIA 3CCMI 3OYLA 3LNQA 1IN5A 2QENA 2XKOA 2ESNA 5H20A 1O3TA 2MBFA 2VXDA 4OWRB 4UVBA 4RB2C 2LY2A 2V26A 4FQGA 4A5NA 4E4HA 4XLNF 2K4BA 5EG0A 2Z33A 5EZGA 2HQNA 2UUZA 2FUG2 2WB1N 2L4MA 3H9GA 1FBUA 3CTAA 4QIWN 3MD2A 1ZRCA 1ZH5A 3KP5A 4B1RA 2O61A 2B63J 3ZN0A 2RV8A 2D5VA 3S16J 1VQ6I 1Z05A 3EPZA 4R1HA 3J81K 3K4KA 1MD0A 5FLXK 3K70D 2Y2ZA 2MLGA 4NC6A 1LPQA 5BPIA 4E7IA 3M3YJ 3QU6A 2WAQA 3RPUA 2LKXA 2G0EA 3SYTA 1SC7A 1WI3A 1YOVB 2LFBA 4DOZA 4CDGA 4BS9A 3KEYA 2K9NA 5DD4A 1S5LC 1KONA 2X85A 1KA8A 3H36A 1KU7A 4HNVA 3ZRGA 2R7QA 1QVTA 1J2XA 4DYRA 1RZ4A 1R7JA 4LIVA 1MW7A 1TBXA 3MZHA 1K4TA 2W82A 4FE7A 2WTEA 4FTHA 1G2HA 1WRJA 2CV0A 3WTSC 4L9VA 1IUYA 3FXOA 2BHZA 3RSNA 3LWFA 2OUMA 2EIMH 4PK4A 2VUMJ 5FKLA 3EDPA 1NK3P 5K5OA 1PDNC 2BOLA 5HOOA 2O9LA 1AWCA 2DODA 4LK0F 4BHPA 4V19K 3BZ6A 5KVRA 1POGA 4Q48A 1O3QA 1OKRA 3OIPA 3OWTA 1FMVA 2QA4I 2WWYA 4IOAF 2GWRA 4BH9A 2XHKA 2VBXA 1ENHA 3ZCOA 4RDUA 4IRGA 1I39A 2GZWA 3LQQA 3SEQA 5E3MA 1UB9A 4MFEA 4ZYAA 3SFZA 2E1CA 2ZFUA 4WWCA 3W6VA 2HOSA 3K1NA 3CLOA 4I01A 5ERIA 2OA4A 2JN6A 2HPIA 2WY8Q 4II2A 1P4XA 4IHYA 3HZJA 1UFMA 2M34A 3ASNH 3BG5A 3S1MJ 4KMUX 1EH6A 1OCZH 4OIQF 1UHWA 3O2PE 2JRTA 1X2NA 4DZJA 4BEHB 1OQYA 5BPDA 2ZXHA 3EETA 1JI8A 1H9GA 3SFIA 2PQ8A 4CH7A 3HDDA 4XMYA 3SZGA 4CCOA 2BBYA 1OYYA 2KP6A 2RKHA 3BLYA 1D5VA 2CRGA 4BJ5C 4V2GA 1K6OA 2B0LA 1WI9A 4LJZF 3EQLF 3QPSA 1KYWA 3KX2A 2DBBA 2M8EA 2K02A 2PJRB 3V7SA 3MN2A 1U8BA 1BJZA 5J1UA 4YG2F 5ICCA 3ISPA 1U78A 4UY8I 5CVRA 5F08A 5D4RA 3GTKJ 3CJQB 1N25A 3RPQA 1ZYRF 4EJUA 3QOEA 4M6VA 1F9NA 2NOGA 5FKOA 4HAMA 4B44A 1ZRDA 4BAYA 4A3EJ 5LRSA 5IP7J 3GW2A 1OFCX 3TO6A 5EGOB 5M3FJ 3VOEA 4UHTA 4NC8A 1HQCA 4A93J 2FX0A 5BS6A 5JVTA 5LHIA 4A3IJ 3S1RJ 5JLXA 2HZDA 3WG9A 1SFXA 1W4MA 3GO5A 1X19A 3HRUA 3FISA 3RJPA 1U3EM 1YS7A 4BUPA 3OYHA 2BVLA 3OOUA 2RDPA 2P6SA 3R4KA 2M45A 3BOQA 4OMYA 4M9SA 3WHBA 1VTNC 2P7CB 3FZVA 4NB5A 1X2MA 1IW7F 1R4NB 4II3A 4U7BA 2JMWA 3P9IA 1ETVA 2UZKA 1R1VA 2BW3A 3IP4B 2K7LA 3I9V2 3KP4A 1ETQA 3DBHB 1WHUA 1I5ZA 3HC7A 5HLHA 2AQEA 4X0GA 2R7FA 1LDKB 2CQNA 3WTXC 2EV6A 3K4LA 1J9IA 1QNTA 2DMUA 2ELKA 2XF7A 1XMXA 3QPHA 3NRVA 1FBQA 2ISYA 1YO5C 1BA5A 3DV8A 3DF8A 2HFHA 2ZNZA 3LFUA 2EV5A 1GXQA 4D9JA 2MC3A 1XB4A 1YLFA 2QGUA 1PVEA 4EGYA 3LOCA 2R3SA 1U6GA 2IEKA 2OF7A 4AUXA 1ZLKA 5FFXA 1IUFA 3DPLC 1U9OA 3QODA 4PJMA 1G3WA 3ABUA 3O8HA 1JUSA 3V8LA 3HPHA 1GT0C 2E2IJ 3K69A 2UWMA 4WCGA 5DUKA 5A2QK 4AYBA 4IQJA 5L3BA 2E2JJ 4DQ2A 1RIOH 4RGSA 1KYZA 2DTZA 3CJRB 2LF7A 2PN6A 2VKVA 1RRJA 2I5UA 5CVJA 2CQKA 2LNBA 3NWTA 2W4SA 3AG3H 2VQCA 2ECCA 1IXSB 4E7LA 3WU2C 1R5ID 2CUJA 1X1DA 2RAEA 3PIOF 1K79A 4JOMA 4PGHA 1N77A 1WJFA 2OCCH 3HOXJ 3CO7C 2DFFA 1S8NA 1X58A 2ACJA 1UG0A 3JRCA 4WXDA 3VYTB 3CCLI 4A3KJ 4FE4A 3K4MA 3W6KB 2VT2A 3BJAA 3HUGB 4LGWA 2IA1A 2QQ8A 3G2BA 3TP3A 3K70C 1BJAA 4AU7A 1UZCA 3WTVC 2A07F 5DEQA 5B5EC 3VEPA 2LBFB 1R1TA 3PNTA 1LFUP 2DPUA 1YJNI 3ZQFA 2VODA 1V5EA 1T98A 2CO5A 4RLQA 2M4GA 2O8XA 2EA2A 2M1BA 4KUMA 4M74A 2RVCA 4XKVA 1HSJA 4JX6A 1LKXA 1V54H 2F2EA 2X1DA 3T8TA 3BQYA 4WF2A 1G8XA 1QRYA 3L7WA 3CCYA 3H3UA 5LHHA 2IGNA 3E7LA 1ETXA 1A6QA 5EDNA 2MH2A 1SD5A 2CWEA 4I98B 1FNNA 1P7JA 4CYCB 3GTPJ 4PFOA 3FXRA 1TW3A 5K5QA 3OY9A 3MMYB 1NH3A 1GUUA 4HOBA 3IAS2 3ONQA 2L54A 3WE3A 1WJAA 5L3EA 4RAFA 3DCFA 5D5UB 1E3PA 4G7HF 1XSXA 4HEA2 1H88C 4ITVA 2H1LA 5FB2A 1RR7A 5E3LA 2FBHA 1SD6A 1ZRFA 3BJOA 4A3CJ 2BEOA 3OYKA 1J5YA 3DQVC 1MGTA 2BY1A 3CMAI 5LEJA 3J81Z 3OS0A 2XGDA 5H6QA 2NVTJ 1MH3A 2P0WA 5CPRB 5LGNA 2HVRA 2IAIA 2R7TA 1SVMA 2HOTA 3E0JB 3M07A 3WGGA 1Q1VA 3HOTA 5HODA 1E2XA 2STTA 3GF2A 3ZR8X 2LR8A 2JVHA 4PSWA 2AHQA 4G6QA 3LSHA 1Z3YA 4XLEA 1WVRA 2GQQA 2PJPA 4DGWB 1JE8A 3S2WA 3BP8A 5EYRA 4F92B 1ZGWA 4Y13A 3O3KA 2MW8A 1FTZA 2CJJA 3JW4A 5FLXZ 2PBIA 3KCCA 3JTHA 1XMAA 5E17F 1KU9A 3REOA 4AC0A 1RKWA 1TW2A 4OOIA 4PJNA 5CLSA 2NS7A 5DS9A 1Y8RB 3PFYA 2W7NA 1QZEA 5DTDA 4ZC3A 3FM5A 1PP8F 1QGPA 2KRHA 2XVCA 1B59A 4NDLA 2EFQA 2NS0A 5E8GA 3TO9A 5JVGF 3HJEA 2VI6A 1XDSA 4BHBA 1XGSA 2LSOA 3VYRB 3I54A 1WJCA 4G6TB 4HQMA 5ICEA 5J47A 2DT5A 4NBQA 2DT6A 2PLYA 4GDFA 2VOPA 4KN7X 2FE3A 3N97A 3HOVJ 2VB6A 1GV5A 3F72A 3BG9A 5BQTA 5DCMA 1S3JA 3Q9VA 3MCZA 4DIQA 3S2HJ 2DT7B 2EPFA 2EFWA 2HTJA 3SEZA 2IXSA 2FNAA 4E7ZA 1A6IA 2VC0A 4QSHA 2XF6A 3HOWJ 2KRCA 1XSVA 1GV2A 4X6AJ 1FOXA 4LMYA 1PP7U 1OCCH 3K9TA 1W5SA 5HS9A 2K27A 1B6AA 2OBPA 5K5RA 2ZMEC 5GTIC 4CGZA 3GFJA 3FXUA 1I50J 3Q0UA 4JX4A 5ICGA 1R00A 3ML6A 5FLMJ 4KT6A 3LSPA 1HW2A 3E1SA 3W2VA 4D5FA 3TL4X 2E5ZA 3I56I 1YRNB 4HYEA 2O8KA 4R79A 2WV0A 2IS4A 3JRIA 1Z91A 1IXCA 4CCLA 3AKZA 3ZMZA 1TWGJ 3GX4X 3MFKA 3CDHA 5A2QZ 2ADUA 2OZUA 2H94A 3FMQA 4ABZA 1YX5A 4XL9A 3WGIA 5FROA 3S15J 2NNYA 2P5VA 3A03A 5FD5A 3RKXA 2VKEA 3E5UA 1QU3A 4WXCA 5EJCA 4PJ0C 1ZR2A 1JT0A 1G3YA 1TZLA 1D3YA 3R0JA 5KAIC 2F5DA 1DDNA 5KAFC 5AIPA 1Y56A 1UJ8A 1E3OC 5F1RA 1SMTA 3BY6A 5IP9J 3GLLA 1MSFC 2V1UA 3AL0B 1HDDC 2ZNYA 4A5MA 1WH5A 2K85A 1MBFA 3J7AO 3N4MA 4ZTJA 4G12A 4NC7A 3JCUC 3JSOA 1RPWA 1DP3A 1WJDA 1HKQA 3A2KA 5HLIA 3CZ6A 2DLLA 5EZHA 2DJIA 3A02A 1S72I 4G7ZF 1T0FC 1PUFB 1PYVA 2P5LC 1ZR4A 1DPRA 5E3NA 1HKSA 5IYCJ 2E1MC 1ZAOA 2KISA 1SEUA 4IPAA 2P4WA 1A35A 1F5TA 4FISA 2BGCA 3ZQCA 3CC7I 1VZ0A 4CCNA 2XAGA 5CQGA 4BY7J 3ROUA 2XAHA 4IO9F 3JR9A 3CUQA 3U1KA 3A01B 4CYCA 5JI6A 1F43A 2O7OA 1QVUA 5KK1A 3GUDA 3CP2A 4AVZA 4BE1A 1ACIA 3EUAA 1IXRC 1JKRC 2V6CA 2CQXA 3H35A 2R7XA 2VJJA 3K0LA 3C7JA 3QAHA 2IT0A 4O5VA 1LFBA 3DEWA 2NYXA 3DTKA 4I99C 4FX4A 3BR6A 3QOPA 4Y4RA 2X6OA 2PMUA 2IA0A 1R5HA 1FYLA 1BI0A 4YFKF 3H1CA 2V79A 1EH8A 4UB6C 3CCQI 4M3DA 5B1BH 1Y39A 4J00A 4KYWA 4RAGA 3QYBA 3H5NA 5B66C 3OYCA 2DMQA 3ZXSA 3OMYA 1D0XA 2FOWA 3WG7H 1VQ4I 2P81A 1MZBA 3D0SA 3W3CA 1V55H 3RYPA 2LD5A 3HOUJ 4KA4A 2LBFA 3CC2I 5HNFA 2DQRA 3VWBA 3FMSA 1TNSA 3I64A 1SD4A 1SVOA 2VKDA 3B73A 2MABA 4UUSB 1P6RA 3EYYA 2QBYA 1YW8A 1N75A 1UAAA 3OYGA 4MQVA 4CUGA 1U5TC 2LOOA 3LFKA 3GFIA 1O7FA 2Y0MA 2ICWG 4B3XA 3SDGA 4ZYHA 4IHXA 3X2QH 4U88A 4XSZF 2XC7A 3JTGA 5BNGA 2YPRA 2E1NA 1FP1D 3M8EA 3RKQA 1M1EB 3HXLA 3CCJI 1SVLA 1RR8C 4I7HA 2FF4A 4E7HA 1IAWA 2ZXWH 2BY3A 2L2OA 3U1DA 1E0EA 1ERDA 1K7AA 5DCMB 1TQPA 1J7KA 2OQRA 3BDDA 1QQIA 2GXGA 1I1GA 4ZJZA 2IRFG 2K9SA 4XLAA 3PUBA 2B9SA 3MKLA 5CQEA 2VJ5A 4GFBA 3WE2A 2JA8J 2H8WA 2OV7A 2FD5A 3GYHX 3LSIA 4XKWA 1XGMA 2M2EA 2YU3A 2LY9A 4QPQA 1BI2A 4C2MJ 1OCTC 3J7AY 2LKPA 3MKWB 2DU9A 1T95A 2JZYA 1T2KA 1BIAA 1BI3A 3WODF 4BXFA 3KFWX 4EJVA 4C30A 1OISA 1KQ0A 2QUFA 1G4DA 3P9CA 1RKTA 2HI3A 3LSGA 1ZN2A 4XLFA 3TO7A 4YIFA 2X6XA 3VYUB 5B3SH 3LAJA 2KZVA 2MLKA 4A0YA 5CVUA 3JAMK 4C3HJ 4OAZA 1P4AA 3F6OA 4ZH4F 4RB3C 4IF4A 5JHUA 1ZELA 3BTIA 3BC8A 1FWZA 3BWGA 5J4VA 2EJRA 1TNTA 2DW4A 4JQFA 1LFPA 1RI7A 2LYCA 2X51A 5LEKA 1XSDA 4P9UA 1PJRA 3QYFA 4D5CA 2E1MB 1A31A 2DFIA 1FOKA 2LK2A 1ODDA 4XN3A 2DAOA 2PEXA 1IO2A 2NNNA 1RESA 3MKYB 2WAEA 3QPTA 3T8RA 1W1WE 2EZLA 3F8CA 4E6KG 4XRSA 2HTSA 1S7OA 2XAJA 4LB6B 3OIOA 3ZQQA 1UG2A 2D1HA 1BOBA 3A4CA 1OCOH 3CMMA 3E6BA 5DM7F 2PJRA 1K83J 2TRTA 1IV8A 1XCVA 4I09A 1LEBA 3GZ5A 3T1BA 1B9NA 2G9WA 3TW6A 5GP9A 3OL4A 3FKIJ 3KZIC 3JRAA 3U2RA 3SJMA 3G1MA 1X3ZB 3DKYA 4B3AA 3BR3A 3FXMA 4DBRA 5F1JA 2ZSHB 1J09A 2CU7A 3W2WA 1BC8C 3I4PA 2G7HA 4U0VA 2R5YB 1MSEC 2XF5A 4A3FJ 2ZFWA 1WJBA 4A6EA 2EH3A 2IBDA 2IVMA 2Y75A 2ZMEA 2KIUA 1TTYA 4XORA 1YYVA 2HKOA 1GHCA 3AFHA 3ESWB 2FXAA 2ETHA 1FBSA 2PMHA 1D1AA 2OJED 2AXTC 3OS2A 3QPLA 2KRFA 2WV1A 3H5AA 2GIVA 5LGUA 4L5JA 2Y0SN 4HLXA 3F21A 1ZARA 1APLC 4ZYGA 3TEDA 3ZQHA 1GVJA 2XRLA 2IS6A 2DMPA 1MNEA 2AQFA 3FBNB 3DBLB 1BR4A 5DUIA 1XN7A 2AO9A 2H27A 1S9HA 4F55A 4ESFA 1ETOA 2J5PA 4AM3A 3WTWC 4W1UA 2CYYA 4MIMA 5KNLA 2KFDA 1FEXA 4AD9A 2TCTA 1BM9A 2GOXB 2Z2SB 3HG9A 1YHQI 4BKXA 4TV7A 1IN4A 4RAYA 1RUOA 2NS8A 2D1VA 1V4RA 1AA7A 1PUFA 4UNOA 4BQQA 4M9ZA 3J7YJ 4GCVA 2EZKA 4HDUA 2ZCWA 3OYAA 1FYKA 2L01A 2Y30A 1P92A 5IT3A 4HSTA 3G1LA 2XGCA 2LRDA 4QWQA 1T0FA 3C1DA 1IDZA 2IGOA 3S1QJ 2LKSA 2RNGA 3G71I 1YIJI 1MDMB 5F64A 3BR1A 5J1RA 1NTCA 3M9AA 4FHTA 3L2CA 2VC1A 4MHGA 1HLVA 2F5VA 2DYRH 2ZMEB 1LB2A 3HSFA 5D5WB 1KQ8A 5EEAA 3HGGA 3CQZJ 4O6JA 3KP7A 3TDZC 1CF7A 1ONVA 3E6MA 3TKYA 4F52A 1UHSA 1LQ1A 2E2HJ 2XGXA 4PDKA 3VDXA 3VSKA 2DDAA 5FGMA 2W57A 2QCOA 5C44J 1W7PB 2COMA 4BDYA 5DD8A 1NHAA 5BOXA 4BJTA 2VONA 3PIPF 2EFOA 2HDWA 2QZ8A 4RLFA 3FM3A 2IW5A 3CP8A 4ZZDA 3GZNB 2EWNA 4Y33A 1MBHA 4L5IA 2QWWA 2ZB9A 3BG7A 4HNTA 4M6YA 4F91B 2PMZA 3SHFA 4MTDA 2F5CA 4HF2A 1TP4A 1MBEA 2F6CA 4EV0A 3PNVA 2LTPA 2RREA 4UUSA 1OCRH 1X1PA 4DYCA 3OSGA 1H9TA 2IS1A 1QO0D 4RGRA 2M7AA 1VI0A 4RB1A 4IL6C 5LLQA 3R60A 4EM1A 4LLLA 2VL8A 3ZMVA 2VPRA 5FKKA 2K9LA 3CUQB 3A01A 5CJ9A 2NVUB 2Z99A 2W85A 2EINH 4HX4A 2QLZA 1CQTA 2JQ7A 1SD7A 1GDTA 4PSXA 3AG2H 4D7NA 5L3CA 5TRDA 4KFCA 2K86A 4IOCF 2HOAA 1A36A 2HQRA 3IWZA 4HF0A 2R5ZA 2ZJPF 1LE8A 2R7UA 4KITB 4A3BJ 2EILH 3CLQA 4QPOA 3TOBA 4D0PA 5F0CA 4AWXB 2NOJB 5HLGA 5K7FA 2V1DA 3VPRA 2BZTA 1IN6A 1BOAA 4GRIA 1TT5B 4YEJA 3M7GA 4D1QA 2JT1A 2MFZA 3R6SA 3DWLE 3MAJA 3UKGA 5M5YJ 2GA1A 1HF0A 2EZHA 4IRHA 2XDVA 3D5RC 3V7RA 3OIQA 4RAZA 5LFAA 1ORKA 3ZOBA 1GXPA 1BR2A 1FMWA 1SMYF 3R0AA 1JGGA 2DA3A 3Q9SA 3GVAA 3IRRA 3M4OJ 4GYIA 3F23A 2W00A 2QSGX 4K2EA 4AIKA 2HGCA 2OAZA 2V9KA 2LY1A 4L9NA 4NQWA 1R71A 4PZJA 4FX0A 4KMFA 4Z2YA 4N4OB 2R7VA 3BPVA 2PMZN 3L2WA 3CC4I 4Q47A 5CYVA 1VQPI 2W24A 4G9YA 4S05A 2M4KA 3HTSB 1G6NA 3F8BA 4XRSG 2LH9A 4L18B 1IGNA 2DMNA 2FJ1A 4CICA 1DGRM 3ABKH 1VQOI 2CGPA 4HZFA 4CHUA 3PJRA 2CW0F 2OCEA 2OD5A 2FMYA 3CF2A 1CF7B 3RCOA 3UR3C 1FPQA 4NUBA 1U9NA 5HS7A 4E7JA 3ECOA 3K2ZA 3DFGA 3GBGA 5E1WA 3OYJA 1VQ8I 2OPTA 2W48A 5J3LA 1WJEA 1Z7LA 4RA2A 4MGRA 4RM2A 3OYFA 4DBQA 1JJ6C 3ZP5A 4ENMA 1BW5A 3ABMH 4A0ZA 4KICA 3OYIA 2MC4A 1LE8B 2O5RA 2BV6A 1AOYA 5CKTA 1LDJA 5FO5A 3V7CA 3BTLA 2ZJQF 2HVSA 2EA4A 1BR1A 1JTXA 2JK3A 5F0HA 2P6TA 4N4NB 2VXZA 4P55A 1Z6TA 3ZQ7A 5DM6F 1YIOA 2LVSA 1LVKA 2Q2EA 2H09A 2M8GX 2X6YA 4EVIA 1F1ZA 3BR5A 3D1NI 3GTJJ 3WTYC 1HW5A 2YU9J 5KHDA 3OOPA 3RKWA 2R5YA 1DP7P 1VQNI 4HBLA 3ZQLA 2VT3A 3RIRA 2XPUA 2ID6A 1UHMA 3PUFA 4LOCA 1WH7A 3I0TA 4D7MA 2DDBA 2KIFA 2XASA 3WHCA 2HWVA 1XPXA 1SANA 2XAFA 3EUKL 1O3RA 2CUEA 3I5UA 2JRMA 2A6TA 2ME0A 5J1YA 4N9IA 1Y1VJ 2DI3A 2M30A 4XN0A 3KE2A 1EF4A 2XKPA 1JKOC 4BXUA 4ETSA 4HV6A 1JGSA 2GIZA 3K2AA 2KDOA 1USSA 1X4OA 3BR0A 5J4YA 2PFBA 2K4JA 4ON0A 1Z1DA 3CMYA 1YFHA 4I2OA 1ZLJA 2A69F 2LMDA 3F8MA 2DK8A 2QKMB 2E60A 2L3DA 2H6CA 1YRNA 3N05A 4FT8A 3QP6A 2IPQX 2EIKH 1BW6A 1WCMJ 3LSMA 4M71A 2DFHA 1F36A 2HR3A 5L3GA 3ZMDA 5LBQA 4BDZA 1B72B 1FIAA 2CQ7A 3FHNA 3C3WA 3U9GA 3FHZA 1Q1HA 1W7PA 4YIIA 5FKMA 2KPMA 1JKQC 3K6GA 3DEUA 2L7MP 3I59B 4DNCA 2CG4A 2LLKA 1V3FA 2Q2EB 1K78B 4JX5A 5HVQC 3I4MJ 2HQ5A 2FRHA 1VQKI 3MQ0A 2GOMA 4I0BA 1YG2A 1MBJA 2D2WA 1LVAA 3F8FA 3IKVA 5HDKA 2BW3B 3RQIA 2K5CA 3IRQA 3L2UA 3HL2A 1YS6A 4HF1A 1S29A 2Y9YA 1Z3XA 3QU3A 5LRRA 1GLNA 2IP2A 1O7LA 1W5CC 2XSJC 2VE9A 4YRVA 5LHGA 3HGYA 2JPBA 1W36C 1P4WA 1USTA 1SFKA 2LG4A 2XB0X 2DXIA 3HEFA 2GA2A 3S32A 4B43A 1AKHB 3MZYA 5D8KB 3S3NA 4BNCA 1SFUA 2ZBKA 2HYFA 4OIRF 5K1YA 2RC4A 1QHGA 2BVMA 3F8NA 3K1MA 3K7AJ 3VYSB 3BCAA 1XGOA 5DV5A 1T6SA 2V9VA 2GBYA 1DU0A 3DU6A 3CCUI 1QZYA 2EQRA 2RGVA 5E1ZB 2AS5F 1OYIA 3LA7A 3CUOA 3RQ4A 4EEFG 4G94A 5IOYA 3CESA 1H89C 1XD7A 2DCEA 5F04A 1BI1A 4A3JJ 4L9TA 3FXJA 1MNDA 3C2HA 1B4AA 2ECBA 3PQKA 2NVXJ 2P5KA 2JTVA 5H2FC 1K6YA 4B47A 1MMDA 2FSWA 4ZYDA 4Q4ZF 4H0EA 2ID3A 4ZZLA 3LAPA 2E7WA 4UXNA 2V9PA 2XPWA 1XC5A 1IDYA 1REPC 2RN7A 1D1BA 1EKEA 2O0YA 4J19A 3NWSA 2L9RA 2L7KA 4L9JA 4P9FA 4UUVA 3QRFF 3BTCA 2HYJA 2DA5A 2WB1A 2V6EA 2CW8A 3F3XA 4Y7NJ 3HRMA 2WBMA 5JHFA 3DTIA 2FEZA 1X3UA 2M5WA 4HV5A 4CCMA 4HSRA 2DOAA 4AVPA 1OLTA 3KZZA 1DGWY 3RZOJ 2XB5A 2R7ZJ 4ASNA 3ERMA 3FBIB 3BTJA 3LSTA 4M3EA 2AXLA 3WGHA 4NNJA 4BEHA 3LSKA 1JT6A 5HDGA 1ITYA 5EEHA 5JR3A 9ANTA 2ZXIA 2ZXJA 4IVNA 2Z9OA 3KPHA 5D5XB 3FXQA 4E7SA 4PCQA 1VQ5I 3LSJA 3SQNA 3L2QA 2KIMA 1SAUA 2KHMA 1Z7UA 2OQGA 4PUSA 4U87A 2HDDA 4XLPF 3CCVI 1Z77A 3K4CA 3E5XA 3KYCB 2FNPA 4WXHA 2WA0A 4S0HB 5GADJ 3DLAA 1OR7C 2NXNB 3DBRB 4DYQA 2OTLI 2M0CA 1HC8A 3E97A 2Y69H 3K4BA 4ZDPA 4GO1A 3CMEI 4LK1F 1E17A 1D1CA 2N8GA 1R49A 2WAFA 5L3FA 3AG1H 4A6DA 1IRXA 2X4HA 2VLAA 2R7RA 2R7SA 3L1PA 4M9XA 3WTTC 4LG3A 2OZ6A 4DW6A 4ESBA 3OR1C 4Z6YA 2H6BA 1T08B 3SZPA 4A3LJ 4EATA 1LJ9A 3F9KA 3A0BC 2RNJA 1WFXA 4HG2A 1T39A 1J59A 5EG0B 4YELA 3JRDA 1OJLA 3LMMA 4C2TA 1MNMC 1D5YA 4HPQA 4Y17A 4Y15A 2LDUA 3HSEA 2VQHA 4FETA 3VODA 3BCBA 2BXYA 3DXJF 2DA7A 1W7PD 2JA2A 2Q0OA 4IX7A 1MH4A 2X48A 4BE2A 1STZA 2HKXA 2Z3YA 3JAMZ 3JRFA 1B8IA 3S17J 5JLWA 1I6HJ 3HTUA 2XV4S 3ABTA 5D5VB 1W0TA 3QWLA 1KZHA 2KLOA 4R8HA 4IHVA 3C2BA 4C9YA 3PQJA 1IN7A 4LLGF 2VJIA 1QPIA 3MVPA 1IG7A 4G7OF 1X3WB 1BN5A 3IH2A 2BYVE 2O6GE 1TL8A 1FJLA 3S14J 1DQUA 1YITI 3TDUC 2F4IA 3CCRI 4ESJA 4A3MJ 1IC8A 2VJ4A 4O3MA 2CS3A 2JSCA 2CFOA 4DJAA 1X1BA 2BHYA 2FQ4A 1H0MA 3ULQB 2HU9A 4GGGA 3K10A 4NHJA 4XKCA 2MGQA 2JA6J 1XDUA 3PFIA 4KISA 2GXBA 2L0KA 1R5GA 4XBFA 2HDCA 4BY1J 1TWAJ 5DCFA 2W1OA 2W25A 1OCPA 4PJLA 3P9KA 4KIBA 1XG1A 5C4XJ 2L02A 4M3BA 4V2FA 5J40A 1FSEA 4ENKA 4BXXJ 4JP0A 4W97A 3WU1B 3ASOH 1HBXG 2VOOA 3I3LA 1V5FA 3IWFA 3COAC 3DPUA 3K1PA 3TP0A 4FCYA 2JVGA 2K3FA 3KYDB 2EZIA 3I59A 2L7FP 2Y48A 1WSUA 3FKJA 5FKNA 1TWCJ 2MH9A 1O4XA 3K4JA 2VE8A 2XPVA 4AIHA 1O57A 5M5WJ 1TC3C 2DQLA 4EM2A 2MD0A 3VB2A 3GZ6A 3ZMTA 3W6JB 1FTTA 3E6DA 3L09A 2QBYB 3KLNA 4MNUA 3S8PA 2DOEA 4A3DJ 4UVAA 3V4GA 3HHGA 1ETWA 2EK5A 2JWTA 4B8XA 5EF6A 1W36D 3JREA 4IKFA 3PO3J 1ZHFA 1YJ9I 1XS9A 3H3ZA 3HUGA 3AAFA 3PNYA 3QYEA 2WY7Q 3BROA 2YS9A 3WU0A 2ZSIB 2CSOA 1X1CA 2Y31A 3B6CA 1Y6IA 3FMRA 2M3AA 1K61A 1Z67A 2ESHA 2WC2A 2NRAC 2FOKA 3DP7A 1XX5A 2ZKZA 2K9MA 4P96A 1C0WA 3I53A 3DTEA 4EJOA 4IRIA 3KP3A 4EJWA 3HKZN 3V42A 4IHWA 4CSWA 1D8KA 2CV1A 1UMQA 2ELHA 1VQLI 2XAUA 4KNYA 1Y8QB 2A5YB 3OR2C 4RGUA 4G6DA 1I1SA 4EGZA 2MSYA 3CJTB 3JRBA 1DUXC 5DDGA 2E35A 3TOAA 5D6EA 4PGGA 4BU2A 3DLLF 1WWXA 3ZMSA 2BY2A 1RUNA 1V5GA 2Q8KA 1YE9A 2EFNA 3HRTA 1OR7A 4BJ6C 1QA6A 4P5OA 5H6RA 4B48A 5TJJA 4IHSA 2BE5F 3Q0WA 1HOMA 1QHHD 3OYBA 1FT9A 3J80K 4I76A 1T56A 5HDNA 3JRHA 1R22A 2CV2A 5ED4A 2PG4A 3BZKA 2KJBA 3FK6A 5K7ZA 4YIRX 1KU3A 4OU0A 4LG0A 2GAUA 3VFZA 1AHDP 2DO7A 2DA6A 2X6WA 4HQEA 1U8RA 3B02A 5IPAA 3PO2J 1AU7A 4HA8A 2WADA 3QP5A 3BG3A 4U0YA 4CCKA 1QBJA 2HVQA 2DOFA 3FXLA 1FZPB 4F3QA 3BR2A 1FC3A 3RI4A 1Z0XA 1R1UA 5D8LB 2E36A 2YX4A 4EM0B 5EGOA 3PSIA 1B72A 3O8GA 4HLYA 1ZG1A 3MZ8A 2QSHX 3W2AA 4Y52J 5GPCA 1FLIA 3GMEA 3EUHA 3NARA 1MMGA 4E70A 1HDPA 5BMZA 1Z9CA 3I55I 1OMIA 4C3IJ 3PM1A 1Y0NA 2E34A 2M9HA 3AG4H 3I71A 3I4NJ 1HA8A 2RQPA 4AIDA 3F0CA 1WPKA 3IH3A 4IQ4A 1NK2P 2E7XA 2W84A 2HZTA 4XR6A 4WX9A 4HRIA 4H4KC 2K3PA 2J5OA 4MTEA 2XGEA 1VFCA 5IOZA 4XOPA 4B09A 2Y9ZA 2GLOA 2HEOA 5IP6A 1DPUA 3D5SC 3P5JA 3KETA 1IRZA 3DEEA 4RS8A 3IAM2 4BHCA 3RDIA 1JKPC 2JPCA 1R9TJ 3OYMA 2ISZA 5F0FA 1IRFA 2BXZA 3R61A 1VF9A 2VASA 2F4OB 4YFNF 3FXKA 5K7HA 1L3LA 5IT9Z 4XLHA 3E3VA 1YTYA 5HNHA 3DKXA 5TISC 3T0YA 1MMAA 2NVQJ 3FK7A 4L5EA 2YR2A 5LD2C 1JUMA 1YW7A 3S1NJ 5F27A 1R4MB 2ZO4A 4MO7A 5LGTA 3DPTA 2JUGA 4DZPA 2FA5A 2NVYJ 4OIPF 5J8CA 4S04A 3ERED 2I10A 1KGSA 2XAQA 1G3TA 3FIWA 1HKTA 4IEJA 2X9DA 3BQZA
chains in the Genus database with same CATH topology
3DLLF 4IO9F 1VQNI 3G6EI 3CCVI 3I55I 3CCQI 1VQOI 4IOCF 1Y39A 3CF5F 1VQ7I 3CMAI 2ZJQF 1YJWI 2E34A 5DM7F 5GADJ 2NXNB 2ZJPF 4V19K 1FOYA 3I56I 3J7ZI 1QA6A 2OTLI 1HC8A 1ACIA 5GAGJ 1VQMI 2QA4I 3CD6I 2FOWA 1VQ4I 1S72I 1VQ6I 2E36A 3G71I 1YIJI 1YJNI 3PIPF 3CCEI 5DM6F 1FOWA 5GAHJ 3CCUI 2H8WA 3PIOF 1VQKI 3G4SI 3CMEI 1YHQI 1VQ8I 3CCMI 5GAEJ 2ZJRF 1YI2I 1VQLI 3CC2I 4UY8I 1YJ9I 1YITI 2OTJI 3CCRI 1VQ5I 3CC4I 1VQPI 3CJTB 3CCJI 1FOXA 5JVGF 3CC7I 3CCLI 2E35A 1VQ9I 2QEXI 2JQ7A 4IOAF 1MMSA 2K3FA 3J7YJ 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL F;  4IO9 F;  1VQN I;  3G6E I;  3CCV I;  3I55 I;  3CCQ I;  1VQO I;  4IOC F;  1Y39 A;  3CF5 F;  1VQ7 I;  3CMA I;  2ZJQ F;  1YJW I;  2E34 A;  5DM7 F;  5GAD J;  2NXN B;  2ZJP F;  4V19 K;  1FOY A;  3I56 I;  3J7Z I;  1QA6 A;  2OTL I;  1HC8 A;  1ACI A;  5GAG J;  1VQM I;  2QA4 I;  3CD6 I;  2FOW A;  1VQ4 I;  1S72 I;  1VQ6 I;  2E36 A;  3G71 I;  1YIJ I;  1YJN I;  3PIP F;  3CCE I;  5DM6 F;  1FOW A;  5GAH J;  3CCU I;  2H8W A;  3PIO F;  1VQK I;  3G4S I;  3CME I;  1YHQ I;  1VQ8 I;  3CCM I;  5GAE J;  2ZJR F;  1YI2 I;  1VQL I;  3CC2 I;  4UY8 I;  1YJ9 I;  1YIT I;  2OTJ I;  3CCR I;  1VQ5 I;  3CC4 I;  1VQP I;  3CJT B;  3CCJ I;  1FOX A;  5JVG F;  3CC7 I;  3CCL I;  2E35 A;  1VQ9 I;  2QEX I;  2JQ7 A;  4IOA F;  1MMS A;  2K3F A;  3J7Y J;  3CCS I; 
#chains in the Genus database with same CATH topology
 2NAZ A;  1IRG A;  1P2F A;  4A0X A;  2M87 A;  2QVO A;  1EA3 A;  2VBW A;  1FOY A;  3TW7 A;  4RBO A;  3HPG A;  2VKH A;  2EB7 A;  4OIO F;  4UV9 A;  3BPX A;  4XK4 A;  2OTJ I;  1FOW A;  3BJ6 A;  3NEU A;  1KQ9 A;  3DU5 A;  1ZGA A;  3HIF A;  2CUZ A;  5E1X A;  3FDY A;  1R23 A;  4A12 A;  2A6E F;  2C6Y A;  2PX9 A;  2FML A;  3HYI A;  3H3V K;  2MYS A;  2PI0 A;  4CYD A;  1QZZ A;  4L0Z B;  1MDM A;  1ULY A;  4A69 C;  3G1O A;  5F6F A;  2XSD C;  3F22 A;  2M0M A;  4UUT A;  2L9S A;  2QSF X;  1FIP A;  3G73 A;  3KLO A;  3HSR A;  2QF7 A;  3CCE I;  3HBL A;  3S93 A;  3NAU A;  1ZG5 A;  3M1E A;  2VIX A;  1SFO J;  4RMN A;  2KJC A;  4NQW B;  5J6X A;  4OAY A;  1R6R A;  4BBR J;  3UNG C;  5FLV A;  2FU4 A;  3ECH A;  1TLH B;  1LDD A;  5J8F A;  1VQ9 I;  2R4G A;  3WTU C;  2STW A;  2VN2 A;  3Q0V A;  1NG7 A;  3IKT A;  2HNH A;  1HXD A;  3RTR A;  3HOZ J;  1RET A;  3M1C A;  3H0D A;  2ELJ A;  2YX7 A;  1VND A;  1ZTR A;  3OYN A;  2O03 A;  4U0W A;  1MJB A;  4IXA A;  1Y0U A;  4B4C A;  4RM3 A;  1EJ9 A;  1FX7 A;  2VBY A;  1T38 A;  5TGT A;  3L00 A;  4OMZ A;  1HCR A;  1MMN A;  5M3M J;  1YI2 I;  3TQN A;  1ZG3 A;  1H8A C;  2ZC2 A;  2L4A A;  3O6B B;  4WK8 F;  2G7U A;  3ELK A;  2V4J C;  4BYY A;  3GFL A;  4XM3 A;  4AIJ A;  4X1E A;  2QM3 A;  5L3D A;  4ZTF A;  2P7V B;  2UXX A;  3ZPL A;  5HLT A;  3HB9 A;  4HW0 A;  3QQA A;  1RC9 A;  5E8I A;  3GLX A;  3H9Q A;  2TDX A;  1TQI A;  5IY5 H;  1WKM A;  5GTH C;  1FP2 A;  1U0J A;  2Z16 A;  1IV6 A;  4XRM A;  1WGX A;  3K4N A;  3I58 A;  4I6Z A;  1U5T A;  2R7D A;  1UEL B;  4QTR A;  3RZD J;  5ILU A;  1D8J A;  4UV8 A;  3TGN A;  3CDL A;  4E7K A;  2M7B A;  3RYR A;  4KDP A;  2DN0 A;  3KP2 A;  1XGN A;  4OIN F;  4MEX F;  3IH4 A;  4XIC A;  4YFX F;  1LUJ B;  1I3A A;  3LA2 A;  2E71 A;  3HRS A;  3Q3S A;  3CF5 F;  4QLC U;  1VQ7 I;  2UV1 A;  4BE0 A;  1MBK A;  1MBG A;  2EIJ H;  4I0A A;  5GAG J;  3KEQ A;  1S7E A;  1LNW A;  2F4M B;  3V8K A;  2MA3 A;  2A05 A;  1T33 A;  4N0B A;  5IYB J;  4EQQ A;  1JHF A;  2HXO A;  3WTZ A;  4BQA A;  4ZYE A;  1A04 A;  3Q5F A;  2CFX A;  1WQ2 A;  3RPU D;  1B8I B;  3ZQG A;  2X1C A;  1J75 A;  1EH7 A;  1I27 A;  2KZG A;  4GXO A;  4HX8 A;  3MKZ A;  1NG6 A;  4ENN A;  1OYW A;  4M3F A;  1P9Q C;  3H9J A;  4Y3O A;  4XON A;  5ICF A;  1I6X A;  4GYG A;  3PSF A;  3OYD A;  2A68 F;  4IHT A;  2CH0 A;  1SAX A;  1JUP A;  2IGK A;  2KMU A;  3E5Q A;  4KIF A;  4P1W A;  3T5X A;  1TWH J;  3HOS A;  2DA4 A;  2HS5 A;  3S3O A;  3BZC A;  1JXS A;  2KL4 A;  4M6X A;  2CUF A;  2FBI A;  5ILV A;  5C3E J;  4LG0 B;  3GFM A;  4N9H A;  2P8T A;  1DU6 A;  2E1O A;  1WJ5 A;  4BGD A;  2VPL A;  2HYG D;  3JRG A;  4LIU A;  2QQB A;  1ETY A;  1U2W A;  1ETK A;  2YSR A;  2XRO A;  3OSF A;  4RGX A;  2EFP A;  2F5F A;  4ANJ A;  2ZJR F;  5AIQ A;  2MD5 A;  2R7W A;  3GTQ J;  3CJN A;  4XLC A;  3A0H C;  4PJJ A;  1PUE E;  5HS8 A;  2KDZ A;  2QQA A;  1A5J A;  1L0O C;  4LLN A;  3G6E I;  2Z1D A;  3V8J A;  3OYE A;  2CMP A;  4A3G J;  1IJW C;  1YX3 A;  2H8R A;  1Y1W J;  3J80 Z;  1IN8 A;  2Y0S A;  3CDI A;  2LC2 A;  3SDB A;  2XUB A;  1EV7 A;  3VSL A;  2GXA A;  1QPM A;  1YW9 A;  6PAX A;  4KIG A;  2V1N A;  4L0Y B;  2A61 A;  1TQM A;  2ME6 A;  2L9V A;  4M73 A;  1G59 A;  4AYB N;  2H1K A;  2KT0 A;  2UXN A;  3FF5 A;  3AL0 C;  1G3S A;  2R5Z B;  1MMS A;  1MKM A;  2F5E A;  1CGP A;  2R93 J;  5C4J J;  3S2D J;  1ON1 A;  2MG4 A;  3BT9 A;  1D0Y A;  2HXI A;  2Q1Z B;  1KU2 A;  1ZK8 A;  2X0L A;  2K9Q A;  1ZKG A;  3FWE A;  4JK1 X;  5CVV A;  3BG6 A;  3GCM A;  3LA3 A;  2X1E A;  2GM4 A;  5JFR A;  1W0U A;  1X1A A;  2COB A;  3OV8 A;  2BY0 A;  2EBI A;  4CZC A;  2JUC A;  2VBZ A;  5E20 A;  2KQR A;  3CUQ C;  2OU2 A;  4JYK A;  4MFD A;  2QEX I;  1XMK A;  2ZJ2 A;  1BIB A;  2LP0 A;  2IJL A;  1E3H A;  3NQO A;  4LB5 A;  1WZ2 A;  3FX3 A;  1HW1 A;  3M8J A;  4KT5 C;  4LIT A;  2A6H F;  1UCR A;  5FJ8 J;  1ZRE A;  2DTR A;  1ZQ3 P;  2DPD A;  3HM5 A;  4XKB A;  1ON2 A;  3GEZ A;  3ZGK A;  4XQF A;  3S3M A;  4C2U A;  5M5X J;  5IYD J;  4CA0 A;  4LD5 A;  3A1Y A;  3JSP A;  5GAH J;  3EYI A;  4CXF A;  3G4S I;  3GTL J;  4PFP A;  4CCJ A;  4M3G A;  2L9N A;  2XIG A;  2LRE A;  3M8F A;  2JA7 J;  1IZ1 A;  3MEX A;  1JHH A;  2HQA A;  3KEO A;  3G3Z A;  2L7Z A;  1AKH A;  3IC7 A;  1F4K A;  4EJT A;  3EUH C;  2A5W A;  3L2R A;  3OS1 A;  2FQ3 A;  2B7E A;  4I02 A;  3J7Z I;  1GVD A;  4HDV A;  2IA2 A;  4JBA A;  5CVI A;  2IGM A;  4BAC A;  4XNF A;  5FRN A;  4BQO A;  1W5T A;  1RNL A;  4IJA A;  4U7D A;  2WAQ N;  4XOT A;  1MIJ A;  4XRF A;  2E19 A;  3B6A A;  3GXO A;  1K78 A;  1MJA A;  3D5L A;  3IUO A;  5AON A;  2E5N A;  3SZT A;  4MQ9 F;  3GTO J;  1YJW I;  2DA2 A;  3CCS I;  4MLO A;  3ZMU A;  1LEA A;  3KYL A;  2A3S A;  3GTG J;  1OPC A;  5IT9 K;  2I8D A;  2F48 A;  5ILS A;  2V1X A;  1U5T B;  1JJ8 C;  3CO6 C;  1O3S A;  2IS2 A;  3ZQI A;  3ZN1 A;  1YQA A;  1X4P A;  4IZZ A;  5E18 F;  3GWZ A;  1B9M A;  3IV5 A;  3C2G A;  4HNU A;  4BQN A;  2DFE A;  2HPM A;  4XID A;  2HOE A;  4J01 A;  2DA1 A;  1N78 A;  4CO8 A;  3HOY J;  4F7Z A;  2JA5 J;  2DMT A;  3H5R A;  2DJN A;  4A2U A;  3HHH A;  1BL0 A;  4F93 B;  5FD6 A;  5KCM A;  1ZGJ A;  3RKY A;  5EEG A;  1B1B A;  2FBK A;  3U21 A;  2KIQ A;  2L5Q A;  5GPA A;  1VQM I;  4ZDL A;  3LL7 A;  2D45 A;  4KJZ A;  2O3F A;  4G8X A;  4CZZ A;  5FRM A;  1FSH A;  2K40 A;  2CQQ A;  5E79 C;  3OL3 A;  4XSX F;  2OC6 A;  1Z6R A;  2DK5 A;  2QKL B;  4BL0 B;  1S6L A;  1HST A;  4EMS A;  1J0R A;  3MWM A;  3H0G J;  2RQQ A;  2VQL A;  5E3O A;  3ABL H;  4C3J J;  4Q5S F;  3P7N A;  1SFE A;  2VQG A;  1S7A A;  2EV0 A;  4LFU A;  3HKZ A;  2QYO A;  4M72 A;  1D0Z A;  3F6V A;  2R7O A;  3CD6 I;  1T8I A;  2DYS H;  2XRN A;  5DYM A;  1K4S A;  3IL2 A;  1BC7 C;  3H92 A;  1P7I A;  3L2V A;  5D4S A;  2R92 J;  2JSP A;  5GAE J;  4FAS D;  1BBY A;  4HX7 A;  2KKO A;  4UB8 C;  3KZY A;  3LQR A;  3DKW A;  3SXY A;  3IHU A;  3KP6 A;  5FFZ A;  4KN4 X;  5D6F A;  4ZDO A;  2R0Q C;  3PL8 A;  1XTA A;  2QQ9 A;  1JTY A;  1R58 A;  3GTM J;  1TWF J;  1TT0 A;  2LF8 A;  1IF1 A;  2CW7 A;  4BBS J;  1MJ9 A;  3E6C C;  4MEY F;  4ENJ A;  2YUS A;  2V7F A;  4UVC A;  2Z5U A;  1R36 A;  3C18 A;  1Z21 A;  2JJ7 A;  1I3Q J;  3TMO A;  4RB0 A;  3LSR A;  5B1A H;  1FYM A;  3KIO A;  3L9F A;  1XCB A;  1FY7 A;  3TBI A;  3CCM I;  3OYL A;  3LNQ A;  1IN5 A;  2QEN A;  2XKO A;  2ESN A;  5H20 A;  1O3T A;  2MBF A;  2VXD A;  4OWR B;  4UVB A;  4RB2 C;  2LY2 A;  2V26 A;  4FQG A;  4A5N A;  4E4H A;  4XLN F;  2K4B A;  5EG0 A;  2Z33 A;  5EZG A;  2HQN A;  2UUZ A;  2FUG 2;  2WB1 N;  2L4M A;  3H9G A;  1FBU A;  3CTA A;  4QIW N;  3MD2 A;  1ZRC A;  1ZH5 A;  3KP5 A;  4B1R A;  2O61 A;  2B63 J;  3ZN0 A;  2RV8 A;  2D5V A;  3S16 J;  1VQ6 I;  1Z05 A;  3EPZ A;  4R1H A;  3J81 K;  3K4K A;  1MD0 A;  5FLX K;  3K70 D;  2Y2Z A;  2MLG A;  4NC6 A;  1LPQ A;  5BPI A;  4E7I A;  3M3Y J;  3QU6 A;  2WAQ A;  3RPU A;  2LKX A;  2G0E A;  3SYT A;  1SC7 A;  1WI3 A;  1YOV B;  2LFB A;  4DOZ A;  4CDG A;  4BS9 A;  3KEY A;  2K9N A;  5DD4 A;  1S5L C;  1KON A;  2X85 A;  1KA8 A;  3H36 A;  1KU7 A;  4HNV A;  3ZRG A;  2R7Q A;  1QVT A;  1J2X A;  4DYR A;  1RZ4 A;  1R7J A;  4LIV A;  1MW7 A;  1TBX A;  3MZH A;  1K4T A;  2W82 A;  4FE7 A;  2WTE A;  4FTH A;  1G2H A;  1WRJ A;  2CV0 A;  3WTS C;  4L9V A;  1IUY A;  3FXO A;  2BHZ A;  3RSN A;  3LWF A;  2OUM A;  2EIM H;  4PK4 A;  2VUM J;  5FKL A;  3EDP A;  1NK3 P;  5K5O A;  1PDN C;  2BOL A;  5HOO A;  2O9L A;  1AWC A;  2DOD A;  4LK0 F;  4BHP A;  4V19 K;  3BZ6 A;  5KVR A;  1POG A;  4Q48 A;  1O3Q A;  1OKR A;  3OIP A;  3OWT A;  1FMV A;  2QA4 I;  2WWY A;  4IOA F;  2GWR A;  4BH9 A;  2XHK A;  2VBX A;  1ENH A;  3ZCO A;  4RDU A;  4IRG A;  1I39 A;  2GZW A;  3LQQ A;  3SEQ A;  5E3M A;  1UB9 A;  4MFE A;  4ZYA A;  3SFZ A;  2E1C A;  2ZFU A;  4WWC A;  3W6V A;  2HOS A;  3K1N A;  3CLO A;  4I01 A;  5ERI A;  2OA4 A;  2JN6 A;  2HPI A;  2WY8 Q;  4II2 A;  1P4X A;  4IHY A;  3HZJ A;  1UFM A;  2M34 A;  3ASN H;  3BG5 A;  3S1M J;  4KMU X;  1EH6 A;  1OCZ H;  4OIQ F;  1UHW A;  3O2P E;  2JRT A;  1X2N A;  4DZJ A;  4BEH B;  1OQY A;  5BPD A;  2ZXH A;  3EET A;  1JI8 A;  1H9G A;  3SFI A;  2PQ8 A;  4CH7 A;  3HDD A;  4XMY A;  3SZG A;  4CCO A;  2BBY A;  1OYY A;  2KP6 A;  2RKH A;  3BLY A;  1D5V A;  2CRG A;  4BJ5 C;  4V2G A;  1K6O A;  2B0L A;  1WI9 A;  4LJZ F;  3EQL F;  3QPS A;  1KYW A;  3KX2 A;  2DBB A;  2M8E A;  2K02 A;  2PJR B;  3V7S A;  3MN2 A;  1U8B A;  1BJZ A;  5J1U A;  4YG2 F;  5ICC A;  3ISP A;  1U78 A;  4UY8 I;  5CVR A;  5F08 A;  5D4R A;  3GTK J;  3CJQ B;  1N25 A;  3RPQ A;  1ZYR F;  4EJU A;  3QOE A;  4M6V A;  1F9N A;  2NOG A;  5FKO A;  4HAM A;  4B44 A;  1ZRD A;  4BAY A;  4A3E J;  5LRS A;  5IP7 J;  3GW2 A;  1OFC X;  3TO6 A;  5EGO B;  5M3F J;  3VOE A;  4UHT A;  4NC8 A;  1HQC A;  4A93 J;  2FX0 A;  5BS6 A;  5JVT A;  5LHI A;  4A3I J;  3S1R J;  5JLX A;  2HZD A;  3WG9 A;  1SFX A;  1W4M A;  3GO5 A;  1X19 A;  3HRU A;  3FIS A;  3RJP A;  1U3E M;  1YS7 A;  4BUP A;  3OYH A;  2BVL A;  3OOU A;  2RDP A;  2P6S A;  3R4K A;  2M45 A;  3BOQ A;  4OMY A;  4M9S A;  3WHB A;  1VTN C;  2P7C B;  3FZV A;  4NB5 A;  1X2M A;  1IW7 F;  1R4N B;  4II3 A;  4U7B A;  2JMW A;  3P9I A;  1ETV A;  2UZK A;  1R1V A;  2BW3 A;  3IP4 B;  2K7L A;  3I9V 2;  3KP4 A;  1ETQ A;  3DBH B;  1WHU A;  1I5Z A;  3HC7 A;  5HLH A;  2AQE A;  4X0G A;  2R7F A;  1LDK B;  2CQN A;  3WTX C;  2EV6 A;  3K4L A;  1J9I A;  1QNT A;  2DMU A;  2ELK A;  2XF7 A;  1XMX A;  3QPH A;  3NRV A;  1FBQ A;  2ISY A;  1YO5 C;  1BA5 A;  3DV8 A;  3DF8 A;  2HFH A;  2ZNZ A;  3LFU A;  2EV5 A;  1GXQ A;  4D9J A;  2MC3 A;  1XB4 A;  1YLF A;  2QGU A;  1PVE A;  4EGY A;  3LOC A;  2R3S A;  1U6G A;  2IEK A;  2OF7 A;  4AUX A;  1ZLK A;  5FFX A;  1IUF A;  3DPL C;  1U9O A;  3QOD A;  4PJM A;  1G3W A;  3ABU A;  3O8H A;  1JUS A;  3V8L A;  3HPH A;  1GT0 C;  2E2I J;  3K69 A;  2UWM A;  4WCG A;  5DUK A;  5A2Q K;  4AYB A;  4IQJ A;  5L3B A;  2E2J J;  4DQ2 A;  1RIO H;  4RGS A;  1KYZ A;  2DTZ A;  3CJR B;  2LF7 A;  2PN6 A;  2VKV A;  1RRJ A;  2I5U A;  5CVJ A;  2CQK A;  2LNB A;  3NWT A;  2W4S A;  3AG3 H;  2VQC A;  2ECC A;  1IXS B;  4E7L A;  3WU2 C;  1R5I D;  2CUJ A;  1X1D A;  2RAE A;  3PIO F;  1K79 A;  4JOM A;  4PGH A;  1N77 A;  1WJF A;  2OCC H;  3HOX J;  3CO7 C;  2DFF A;  1S8N A;  1X58 A;  2ACJ A;  1UG0 A;  3JRC A;  4WXD A;  3VYT B;  3CCL I;  4A3K J;  4FE4 A;  3K4M A;  3W6K B;  2VT2 A;  3BJA A;  3HUG B;  4LGW A;  2IA1 A;  2QQ8 A;  3G2B A;  3TP3 A;  3K70 C;  1BJA A;  4AU7 A;  1UZC A;  3WTV C;  2A07 F;  5DEQ A;  5B5E C;  3VEP A;  2LBF B;  1R1T A;  3PNT A;  1LFU P;  2DPU A;  1YJN I;  3ZQF A;  2VOD A;  1V5E A;  1T98 A;  2CO5 A;  4RLQ A;  2M4G A;  2O8X A;  2EA2 A;  2M1B A;  4KUM A;  4M74 A;  2RVC A;  4XKV A;  1HSJ A;  4JX6 A;  1LKX A;  1V54 H;  2F2E A;  2X1D A;  3T8T A;  3BQY A;  4WF2 A;  1G8X A;  1QRY A;  3L7W A;  3CCY A;  3H3U A;  5LHH A;  2IGN A;  3E7L A;  1ETX A;  1A6Q A;  5EDN A;  2MH2 A;  1SD5 A;  2CWE A;  4I98 B;  1FNN A;  1P7J A;  4CYC B;  3GTP J;  4PFO A;  3FXR A;  1TW3 A;  5K5Q A;  3OY9 A;  3MMY B;  1NH3 A;  1GUU A;  4HOB A;  3IAS 2;  3ONQ A;  2L54 A;  3WE3 A;  1WJA A;  5L3E A;  4RAF A;  3DCF A;  5D5U B;  1E3P A;  4G7H F;  1XSX A;  4HEA 2;  1H88 C;  4ITV A;  2H1L A;  5FB2 A;  1RR7 A;  5E3L A;  2FBH A;  1SD6 A;  1ZRF A;  3BJO A;  4A3C J;  2BEO A;  3OYK A;  1J5Y A;  3DQV C;  1MGT A;  2BY1 A;  3CMA I;  5LEJ A;  3J81 Z;  3OS0 A;  2XGD A;  5H6Q A;  2NVT J;  1MH3 A;  2P0W A;  5CPR B;  5LGN A;  2HVR A;  2IAI A;  2R7T A;  1SVM A;  2HOT A;  3E0J B;  3M07 A;  3WGG A;  1Q1V A;  3HOT A;  5HOD A;  1E2X A;  2STT A;  3GF2 A;  3ZR8 X;  2LR8 A;  2JVH A;  4PSW A;  2AHQ A;  4G6Q A;  3LSH A;  1Z3Y A;  4XLE A;  1WVR A;  2GQQ A;  2PJP A;  4DGW B;  1JE8 A;  3S2W A;  3BP8 A;  5EYR A;  4F92 B;  1ZGW A;  4Y13 A;  3O3K A;  2MW8 A;  1FTZ A;  2CJJ A;  3JW4 A;  5FLX Z;  2PBI A;  3KCC A;  3JTH A;  1XMA A;  5E17 F;  1KU9 A;  3REO A;  4AC0 A;  1RKW A;  1TW2 A;  4OOI A;  4PJN A;  5CLS A;  2NS7 A;  5DS9 A;  1Y8R B;  3PFY A;  2W7N A;  1QZE A;  5DTD A;  4ZC3 A;  3FM5 A;  1PP8 F;  1QGP A;  2KRH A;  2XVC A;  1B59 A;  4NDL A;  2EFQ A;  2NS0 A;  5E8G A;  3TO9 A;  5JVG F;  3HJE A;  2VI6 A;  1XDS A;  4BHB A;  1XGS A;  2LSO A;  3VYR B;  3I54 A;  1WJC A;  4G6T B;  4HQM A;  5ICE A;  5J47 A;  2DT5 A;  4NBQ A;  2DT6 A;  2PLY A;  4GDF A;  2VOP A;  4KN7 X;  2FE3 A;  3N97 A;  3HOV J;  2VB6 A;  1GV5 A;  3F72 A;  3BG9 A;  5BQT A;  5DCM A;  1S3J A;  3Q9V A;  3MCZ A;  4DIQ A;  3S2H J;  2DT7 B;  2EPF A;  2EFW A;  2HTJ A;  3SEZ A;  2IXS A;  2FNA A;  4E7Z A;  1A6I A;  2VC0 A;  4QSH A;  2XF6 A;  3HOW J;  2KRC A;  1XSV A;  1GV2 A;  4X6A J;  1FOX A;  4LMY A;  1PP7 U;  1OCC H;  3K9T A;  1W5S A;  5HS9 A;  2K27 A;  1B6A A;  2OBP A;  5K5R A;  2ZME C;  5GTI C;  4CGZ A;  3GFJ A;  3FXU A;  1I50 J;  3Q0U A;  4JX4 A;  5ICG A;  1R00 A;  3ML6 A;  5FLM J;  4KT6 A;  3LSP A;  1HW2 A;  3E1S A;  3W2V A;  4D5F A;  3TL4 X;  2E5Z A;  3I56 I;  1YRN B;  4HYE A;  2O8K A;  4R79 A;  2WV0 A;  2IS4 A;  3JRI A;  1Z91 A;  1IXC A;  4CCL A;  3AKZ A;  3ZMZ A;  1TWG J;  3GX4 X;  3MFK A;  3CDH A;  5A2Q Z;  2ADU A;  2OZU A;  2H94 A;  3FMQ A;  4ABZ A;  1YX5 A;  4XL9 A;  3WGI A;  5FRO A;  3S15 J;  2NNY A;  2P5V A;  3A03 A;  5FD5 A;  3RKX A;  2VKE A;  3E5U A;  1QU3 A;  4WXC A;  5EJC A;  4PJ0 C;  1ZR2 A;  1JT0 A;  1G3Y A;  1TZL A;  1D3Y A;  3R0J A;  5KAI C;  2F5D A;  1DDN A;  5KAF C;  5AIP A;  1Y56 A;  1UJ8 A;  1E3O C;  5F1R A;  1SMT A;  3BY6 A;  5IP9 J;  3GLL A;  1MSF C;  2V1U A;  3AL0 B;  1HDD C;  2ZNY A;  4A5M A;  1WH5 A;  2K85 A;  1MBF A;  3J7A O;  3N4M A;  4ZTJ A;  4G12 A;  4NC7 A;  3JCU C;  3JSO A;  1RPW A;  1DP3 A;  1WJD A;  1HKQ A;  3A2K A;  5HLI A;  3CZ6 A;  2DLL A;  5EZH A;  2DJI A;  3A02 A;  1S72 I;  4G7Z F;  1T0F C;  1PUF B;  1PYV A;  2P5L C;  1ZR4 A;  1DPR A;  5E3N A;  1HKS A;  5IYC J;  2E1M C;  1ZAO A;  2KIS A;  1SEU A;  4IPA A;  2P4W A;  1A35 A;  1F5T A;  4FIS A;  2BGC A;  3ZQC A;  3CC7 I;  1VZ0 A;  4CCN A;  2XAG A;  5CQG A;  4BY7 J;  3ROU A;  2XAH A;  4IO9 F;  3JR9 A;  3CUQ A;  3U1K A;  3A01 B;  4CYC A;  5JI6 A;  1F43 A;  2O7O A;  1QVU A;  5KK1 A;  3GUD A;  3CP2 A;  4AVZ A;  4BE1 A;  1ACI A;  3EUA A;  1IXR C;  1JKR C;  2V6C A;  2CQX A;  3H35 A;  2R7X A;  2VJJ A;  3K0L A;  3C7J A;  3QAH A;  2IT0 A;  4O5V A;  1LFB A;  3DEW A;  2NYX A;  3DTK A;  4I99 C;  4FX4 A;  3BR6 A;  3QOP A;  4Y4R A;  2X6O A;  2PMU A;  2IA0 A;  1R5H A;  1FYL A;  1BI0 A;  4YFK F;  3H1C A;  2V79 A;  1EH8 A;  4UB6 C;  3CCQ I;  4M3D A;  5B1B H;  1Y39 A;  4J00 A;  4KYW A;  4RAG A;  3QYB A;  3H5N A;  5B66 C;  3OYC A;  2DMQ A;  3ZXS A;  3OMY A;  1D0X A;  2FOW A;  3WG7 H;  1VQ4 I;  2P81 A;  1MZB A;  3D0S A;  3W3C A;  1V55 H;  3RYP A;  2LD5 A;  3HOU J;  4KA4 A;  2LBF A;  3CC2 I;  5HNF A;  2DQR A;  3VWB A;  3FMS A;  1TNS A;  3I64 A;  1SD4 A;  1SVO A;  2VKD A;  3B73 A;  2MAB A;  4UUS B;  1P6R A;  3EYY A;  2QBY A;  1YW8 A;  1N75 A;  1UAA A;  3OYG A;  4MQV A;  4CUG A;  1U5T C;  2LOO A;  3LFK A;  3GFI A;  1O7F A;  2Y0M A;  2ICW G;  4B3X A;  3SDG A;  4ZYH A;  4IHX A;  3X2Q H;  4U88 A;  4XSZ F;  2XC7 A;  3JTG A;  5BNG A;  2YPR A;  2E1N A;  1FP1 D;  3M8E A;  3RKQ A;  1M1E B;  3HXL A;  3CCJ I;  1SVL A;  1RR8 C;  4I7H A;  2FF4 A;  4E7H A;  1IAW A;  2ZXW H;  2BY3 A;  2L2O A;  3U1D A;  1E0E A;  1ERD A;  1K7A A;  5DCM B;  1TQP A;  1J7K A;  2OQR A;  3BDD A;  1QQI A;  2GXG A;  1I1G A;  4ZJZ A;  2IRF G;  2K9S A;  4XLA A;  3PUB A;  2B9S A;  3MKL A;  5CQE A;  2VJ5 A;  4GFB A;  3WE2 A;  2JA8 J;  2H8W A;  2OV7 A;  2FD5 A;  3GYH X;  3LSI A;  4XKW A;  1XGM A;  2M2E A;  2YU3 A;  2LY9 A;  4QPQ A;  1BI2 A;  4C2M J;  1OCT C;  3J7A Y;  2LKP A;  3MKW B;  2DU9 A;  1T95 A;  2JZY A;  1T2K A;  1BIA A;  1BI3 A;  3WOD F;  4BXF A;  3KFW X;  4EJV A;  4C30 A;  1OIS A;  1KQ0 A;  2QUF A;  1G4D A;  3P9C A;  1RKT A;  2HI3 A;  3LSG A;  1ZN2 A;  4XLF A;  3TO7 A;  4YIF A;  2X6X A;  3VYU B;  5B3S H;  3LAJ A;  2KZV A;  2MLK A;  4A0Y A;  5CVU A;  3JAM K;  4C3H J;  4OAZ A;  1P4A A;  3F6O A;  4ZH4 F;  4RB3 C;  4IF4 A;  5JHU A;  1ZEL A;  3BTI A;  3BC8 A;  1FWZ A;  3BWG A;  5J4V A;  2EJR A;  1TNT A;  2DW4 A;  4JQF A;  1LFP A;  1RI7 A;  2LYC A;  2X51 A;  5LEK A;  1XSD A;  4P9U A;  1PJR A;  3QYF A;  4D5C A;  2E1M B;  1A31 A;  2DFI A;  1FOK A;  2LK2 A;  1ODD A;  4XN3 A;  2DAO A;  2PEX A;  1IO2 A;  2NNN A;  1RES A;  3MKY B;  2WAE A;  3QPT A;  3T8R A;  1W1W E;  2EZL A;  3F8C A;  4E6K G;  4XRS A;  2HTS A;  1S7O A;  2XAJ A;  4LB6 B;  3OIO A;  3ZQQ A;  1UG2 A;  2D1H A;  1BOB A;  3A4C A;  1OCO H;  3CMM A;  3E6B A;  5DM7 F;  2PJR A;  1K83 J;  2TRT A;  1IV8 A;  1XCV A;  4I09 A;  1LEB A;  3GZ5 A;  3T1B A;  1B9N A;  2G9W A;  3TW6 A;  5GP9 A;  3OL4 A;  3FKI J;  3KZI C;  3JRA A;  3U2R A;  3SJM A;  3G1M A;  1X3Z B;  3DKY A;  4B3A A;  3BR3 A;  3FXM A;  4DBR A;  5F1J A;  2ZSH B;  1J09 A;  2CU7 A;  3W2W A;  1BC8 C;  3I4P A;  2G7H A;  4U0V A;  2R5Y B;  1MSE C;  2XF5 A;  4A3F J;  2ZFW A;  1WJB A;  4A6E A;  2EH3 A;  2IBD A;  2IVM A;  2Y75 A;  2ZME A;  2KIU A;  1TTY A;  4XOR A;  1YYV A;  2HKO A;  1GHC A;  3AFH A;  3ESW B;  2FXA A;  2ETH A;  1FBS A;  2PMH A;  1D1A A;  2OJE D;  2AXT C;  3OS2 A;  3QPL A;  2KRF A;  2WV1 A;  3H5A A;  2GIV A;  5LGU A;  4L5J A;  2Y0S N;  4HLX A;  3F21 A;  1ZAR A;  1APL C;  4ZYG A;  3TED A;  3ZQH A;  1GVJ A;  2XRL A;  2IS6 A;  2DMP A;  1MNE A;  2AQF A;  3FBN B;  3DBL B;  1BR4 A;  5DUI A;  1XN7 A;  2AO9 A;  2H27 A;  1S9H A;  4F55 A;  4ESF A;  1ETO A;  2J5P A;  4AM3 A;  3WTW C;  4W1U A;  2CYY A;  4MIM A;  5KNL A;  2KFD A;  1FEX A;  4AD9 A;  2TCT A;  1BM9 A;  2GOX B;  2Z2S B;  3HG9 A;  1YHQ I;  4BKX A;  4TV7 A;  1IN4 A;  4RAY A;  1RUO A;  2NS8 A;  2D1V A;  1V4R A;  1AA7 A;  1PUF A;  4UNO A;  4BQQ A;  4M9Z A;  3J7Y J;  4GCV A;  2EZK A;  4HDU A;  2ZCW A;  3OYA A;  1FYK A;  2L01 A;  2Y30 A;  1P92 A;  5IT3 A;  4HST A;  3G1L A;  2XGC A;  2LRD A;  4QWQ A;  1T0F A;  3C1D A;  1IDZ A;  2IGO A;  3S1Q J;  2LKS A;  2RNG A;  3G71 I;  1YIJ I;  1MDM B;  5F64 A;  3BR1 A;  5J1R A;  1NTC A;  3M9A A;  4FHT A;  3L2C A;  2VC1 A;  4MHG A;  1HLV A;  2F5V A;  2DYR H;  2ZME B;  1LB2 A;  3HSF A;  5D5W B;  1KQ8 A;  5EEA A;  3HGG A;  3CQZ J;  4O6J A;  3KP7 A;  3TDZ C;  1CF7 A;  1ONV A;  3E6M A;  3TKY A;  4F52 A;  1UHS A;  1LQ1 A;  2E2H J;  2XGX A;  4PDK A;  3VDX A;  3VSK A;  2DDA A;  5FGM A;  2W57 A;  2QCO A;  5C44 J;  1W7P B;  2COM A;  4BDY A;  5DD8 A;  1NHA A;  5BOX A;  4BJT A;  2VON A;  3PIP F;  2EFO A;  2HDW A;  2QZ8 A;  4RLF A;  3FM3 A;  2IW5 A;  3CP8 A;  4ZZD A;  3GZN B;  2EWN A;  4Y33 A;  1MBH A;  4L5I A;  2QWW A;  2ZB9 A;  3BG7 A;  4HNT A;  4M6Y A;  4F91 B;  2PMZ A;  3SHF A;  4MTD A;  2F5C A;  4HF2 A;  1TP4 A;  1MBE A;  2F6C A;  4EV0 A;  3PNV A;  2LTP A;  2RRE A;  4UUS A;  1OCR H;  1X1P A;  4DYC A;  3OSG A;  1H9T A;  2IS1 A;  1QO0 D;  4RGR A;  2M7A A;  1VI0 A;  4RB1 A;  4IL6 C;  5LLQ A;  3R60 A;  4EM1 A;  4LLL A;  2VL8 A;  3ZMV A;  2VPR A;  5FKK A;  2K9L A;  3CUQ B;  3A01 A;  5CJ9 A;  2NVU B;  2Z99 A;  2W85 A;  2EIN H;  4HX4 A;  2QLZ A;  1CQT A;  2JQ7 A;  1SD7 A;  1GDT A;  4PSX A;  3AG2 H;  4D7N A;  5L3C A;  5TRD A;  4KFC A;  2K86 A;  4IOC F;  2HOA A;  1A36 A;  2HQR A;  3IWZ A;  4HF0 A;  2R5Z A;  2ZJP F;  1LE8 A;  2R7U A;  4KIT B;  4A3B J;  2EIL H;  3CLQ A;  4QPO A;  3TOB A;  4D0P A;  5F0C A;  4AWX B;  2NOJ B;  5HLG A;  5K7F A;  2V1D A;  3VPR A;  2BZT A;  1IN6 A;  1BOA A;  4GRI A;  1TT5 B;  4YEJ A;  3M7G A;  4D1Q A;  2JT1 A;  2MFZ A;  3R6S A;  3DWL E;  3MAJ A;  3UKG A;  5M5Y J;  2GA1 A;  1HF0 A;  2EZH A;  4IRH A;  2XDV A;  3D5R C;  3V7R A;  3OIQ A;  4RAZ A;  5LFA A;  1ORK A;  3ZOB A;  1GXP A;  1BR2 A;  1FMW A;  1SMY F;  3R0A A;  1JGG A;  2DA3 A;  3Q9S A;  3GVA A;  3IRR A;  3M4O J;  4GYI A;  3F23 A;  2W00 A;  2QSG X;  4K2E A;  4AIK A;  2HGC A;  2OAZ A;  2V9K A;  2LY1 A;  4L9N A;  4NQW A;  1R71 A;  4PZJ A;  4FX0 A;  4KMF A;  4Z2Y A;  4N4O B;  2R7V A;  3BPV A;  2PMZ N;  3L2W A;  3CC4 I;  4Q47 A;  5CYV A;  1VQP I;  2W24 A;  4G9Y A;  4S05 A;  2M4K A;  3HTS B;  1G6N A;  3F8B A;  4XRS G;  2LH9 A;  4L18 B;  1IGN A;  2DMN A;  2FJ1 A;  4CIC A;  1DGR M;  3ABK H;  1VQO I;  2CGP A;  4HZF A;  4CHU A;  3PJR A;  2CW0 F;  2OCE A;  2OD5 A;  2FMY A;  3CF2 A;  1CF7 B;  3RCO A;  3UR3 C;  1FPQ A;  4NUB A;  1U9N A;  5HS7 A;  4E7J A;  3ECO A;  3K2Z A;  3DFG A;  3GBG A;  5E1W A;  3OYJ A;  1VQ8 I;  2OPT A;  2W48 A;  5J3L A;  1WJE A;  1Z7L A;  4RA2 A;  4MGR A;  4RM2 A;  3OYF A;  4DBQ A;  1JJ6 C;  3ZP5 A;  4ENM A;  1BW5 A;  3ABM H;  4A0Z A;  4KIC A;  3OYI A;  2MC4 A;  1LE8 B;  2O5R A;  2BV6 A;  1AOY A;  5CKT A;  1LDJ A;  5FO5 A;  3V7C A;  3BTL A;  2ZJQ F;  2HVS A;  2EA4 A;  1BR1 A;  1JTX A;  2JK3 A;  5F0H A;  2P6T A;  4N4N B;  2VXZ A;  4P55 A;  1Z6T A;  3ZQ7 A;  5DM6 F;  1YIO A;  2LVS A;  1LVK A;  2Q2E A;  2H09 A;  2M8G X;  2X6Y A;  4EVI A;  1F1Z A;  3BR5 A;  3D1N I;  3GTJ J;  3WTY C;  1HW5 A;  2YU9 J;  5KHD A;  3OOP A;  3RKW A;  2R5Y A;  1DP7 P;  1VQN I;  4HBL A;  3ZQL A;  2VT3 A;  3RIR A;  2XPU A;  2ID6 A;  1UHM A;  3PUF A;  4LOC A;  1WH7 A;  3I0T A;  4D7M A;  2DDB A;  2KIF A;  2XAS A;  3WHC A;  2HWV A;  1XPX A;  1SAN A;  2XAF A;  3EUK L;  1O3R A;  2CUE A;  3I5U A;  2JRM A;  2A6T A;  2ME0 A;  5J1Y A;  4N9I A;  1Y1V J;  2DI3 A;  2M30 A;  4XN0 A;  3KE2 A;  1EF4 A;  2XKP A;  1JKO C;  4BXU A;  4ETS A;  4HV6 A;  1JGS A;  2GIZ A;  3K2A A;  2KDO A;  1USS A;  1X4O A;  3BR0 A;  5J4Y A;  2PFB A;  2K4J A;  4ON0 A;  1Z1D A;  3CMY A;  1YFH A;  4I2O A;  1ZLJ A;  2A69 F;  2LMD A;  3F8M A;  2DK8 A;  2QKM B;  2E60 A;  2L3D A;  2H6C A;  1YRN A;  3N05 A;  4FT8 A;  3QP6 A;  2IPQ X;  2EIK H;  1BW6 A;  1WCM J;  3LSM A;  4M71 A;  2DFH A;  1F36 A;  2HR3 A;  5L3G A;  3ZMD A;  5LBQ A;  4BDZ A;  1B72 B;  1FIA A;  2CQ7 A;  3FHN A;  3C3W A;  3U9G A;  3FHZ A;  1Q1H A;  1W7P A;  4YII A;  5FKM A;  2KPM A;  1JKQ C;  3K6G A;  3DEU A;  2L7M P;  3I59 B;  4DNC A;  2CG4 A;  2LLK A;  1V3F A;  2Q2E B;  1K78 B;  4JX5 A;  5HVQ C;  3I4M J;  2HQ5 A;  2FRH A;  1VQK I;  3MQ0 A;  2GOM A;  4I0B A;  1YG2 A;  1MBJ A;  2D2W A;  1LVA A;  3F8F A;  3IKV A;  5HDK A;  2BW3 B;  3RQI A;  2K5C A;  3IRQ A;  3L2U A;  3HL2 A;  1YS6 A;  4HF1 A;  1S29 A;  2Y9Y A;  1Z3X A;  3QU3 A;  5LRR A;  1GLN A;  2IP2 A;  1O7L A;  1W5C C;  2XSJ C;  2VE9 A;  4YRV A;  5LHG A;  3HGY A;  2JPB A;  1W36 C;  1P4W A;  1UST A;  1SFK A;  2LG4 A;  2XB0 X;  2DXI A;  3HEF A;  2GA2 A;  3S32 A;  4B43 A;  1AKH B;  3MZY A;  5D8K B;  3S3N A;  4BNC A;  1SFU A;  2ZBK A;  2HYF A;  4OIR F;  5K1Y A;  2RC4 A;  1QHG A;  2BVM A;  3F8N A;  3K1M A;  3K7A J;  3VYS B;  3BCA A;  1XGO A;  5DV5 A;  1T6S A;  2V9V A;  2GBY A;  1DU0 A;  3DU6 A;  3CCU I;  1QZY A;  2EQR A;  2RGV A;  5E1Z B;  2AS5 F;  1OYI A;  3LA7 A;  3CUO A;  3RQ4 A;  4EEF G;  4G94 A;  5IOY A;  3CES A;  1H89 C;  1XD7 A;  2DCE A;  5F04 A;  1BI1 A;  4A3J J;  4L9T A;  3FXJ A;  1MND A;  3C2H A;  1B4A A;  2ECB A;  3PQK A;  2NVX J;  2P5K A;  2JTV A;  5H2F C;  1K6Y A;  4B47 A;  1MMD A;  2FSW A;  4ZYD A;  4Q4Z F;  4H0E A;  2ID3 A;  4ZZL A;  3LAP A;  2E7W A;  4UXN A;  2V9P A;  2XPW A;  1XC5 A;  1IDY A;  1REP C;  2RN7 A;  1D1B A;  1EKE A;  2O0Y A;  4J19 A;  3NWS A;  2L9R A;  2L7K A;  4L9J A;  4P9F A;  4UUV A;  3QRF F;  3BTC A;  2HYJ A;  2DA5 A;  2WB1 A;  2V6E A;  2CW8 A;  3F3X A;  4Y7N J;  3HRM A;  2WBM A;  5JHF A;  3DTI A;  2FEZ A;  1X3U A;  2M5W A;  4HV5 A;  4CCM A;  4HSR A;  2DOA A;  4AVP A;  1OLT A;  3KZZ A;  1DGW Y;  3RZO J;  2XB5 A;  2R7Z J;  4ASN A;  3ERM A;  3FBI B;  3BTJ A;  3LST A;  4M3E A;  2AXL A;  3WGH A;  4NNJ A;  4BEH A;  3LSK A;  1JT6 A;  5HDG A;  1ITY A;  5EEH A;  5JR3 A;  9ANT A;  2ZXI A;  2ZXJ A;  4IVN A;  2Z9O A;  3KPH A;  5D5X B;  3FXQ A;  4E7S A;  4PCQ A;  1VQ5 I;  3LSJ A;  3SQN A;  3L2Q A;  2KIM A;  1SAU A;  2KHM A;  1Z7U A;  2OQG A;  4PUS A;  4U87 A;  2HDD A;  4XLP F;  3CCV I;  1Z77 A;  3K4C A;  3E5X A;  3KYC B;  2FNP A;  4WXH A;  2WA0 A;  4S0H B;  5GAD J;  3DLA A;  1OR7 C;  2NXN B;  3DBR B;  4DYQ A;  2OTL I;  2M0C A;  1HC8 A;  3E97 A;  2Y69 H;  3K4B A;  4ZDP A;  4GO1 A;  3CME I;  4LK1 F;  1E17 A;  1D1C A;  2N8G A;  1R49 A;  2WAF A;  5L3F A;  3AG1 H;  4A6D A;  1IRX A;  2X4H A;  2VLA A;  2R7R A;  2R7S A;  3L1P A;  4M9X A;  3WTT C;  4LG3 A;  2OZ6 A;  4DW6 A;  4ESB A;  3OR1 C;  4Z6Y A;  2H6B A;  1T08 B;  3SZP A;  4A3L J;  4EAT A;  1LJ9 A;  3F9K A;  3A0B C;  2RNJ A;  1WFX A;  4HG2 A;  1T39 A;  1J59 A;  5EG0 B;  4YEL A;  3JRD A;  1OJL A;  3LMM A;  4C2T A;  1MNM C;  1D5Y A;  4HPQ A;  4Y17 A;  4Y15 A;  2LDU A;  3HSE A;  2VQH A;  4FET A;  3VOD A;  3BCB A;  2BXY A;  3DXJ F;  2DA7 A;  1W7P D;  2JA2 A;  2Q0O A;  4IX7 A;  1MH4 A;  2X48 A;  4BE2 A;  1STZ A;  2HKX A;  2Z3Y A;  3JAM Z;  3JRF A;  1B8I A;  3S17 J;  5JLW A;  1I6H J;  3HTU A;  2XV4 S;  3ABT A;  5D5V B;  1W0T A;  3QWL A;  1KZH A;  2KLO A;  4R8H A;  4IHV A;  3C2B A;  4C9Y A;  3PQJ A;  1IN7 A;  4LLG F;  2VJI A;  1QPI A;  3MVP A;  1IG7 A;  4G7O F;  1X3W B;  1BN5 A;  3IH2 A;  2BYV E;  2O6G E;  1TL8 A;  1FJL A;  3S14 J;  1DQU A;  1YIT I;  3TDU C;  2F4I A;  3CCR I;  4ESJ A;  4A3M J;  1IC8 A;  2VJ4 A;  4O3M A;  2CS3 A;  2JSC A;  2CFO A;  4DJA A;  1X1B A;  2BHY A;  2FQ4 A;  1H0M A;  3ULQ B;  2HU9 A;  4GGG A;  3K10 A;  4NHJ A;  4XKC A;  2MGQ A;  2JA6 J;  1XDU A;  3PFI A;  4KIS A;  2GXB A;  2L0K A;  1R5G A;  4XBF A;  2HDC A;  4BY1 J;  1TWA J;  5DCF A;  2W1O A;  2W25 A;  1OCP A;  4PJL A;  3P9K A;  4KIB A;  1XG1 A;  5C4X J;  2L02 A;  4M3B A;  4V2F A;  5J40 A;  1FSE A;  4ENK A;  4BXX J;  4JP0 A;  4W97 A;  3WU1 B;  3ASO H;  1HBX G;  2VOO A;  3I3L A;  1V5F A;  3IWF A;  3COA C;  3DPU A;  3K1P A;  3TP0 A;  4FCY A;  2JVG A;  2K3F A;  3KYD B;  2EZI A;  3I59 A;  2L7F P;  2Y48 A;  1WSU A;  3FKJ A;  5FKN A;  1TWC J;  2MH9 A;  1O4X A;  3K4J A;  2VE8 A;  2XPV A;  4AIH A;  1O57 A;  5M5W J;  1TC3 C;  2DQL A;  4EM2 A;  2MD0 A;  3VB2 A;  3GZ6 A;  3ZMT A;  3W6J B;  1FTT A;  3E6D A;  3L09 A;  2QBY B;  3KLN A;  4MNU A;  3S8P A;  2DOE A;  4A3D J;  4UVA A;  3V4G A;  3HHG A;  1ETW A;  2EK5 A;  2JWT A;  4B8X A;  5EF6 A;  1W36 D;  3JRE A;  4IKF A;  3PO3 J;  1ZHF A;  1YJ9 I;  1XS9 A;  3H3Z A;  3HUG A;  3AAF A;  3PNY A;  3QYE A;  2WY7 Q;  3BRO A;  2YS9 A;  3WU0 A;  2ZSI B;  2CSO A;  1X1C A;  2Y31 A;  3B6C A;  1Y6I A;  3FMR A;  2M3A A;  1K61 A;  1Z67 A;  2ESH A;  2WC2 A;  2NRA C;  2FOK A;  3DP7 A;  1XX5 A;  2ZKZ A;  2K9M A;  4P96 A;  1C0W A;  3I53 A;  3DTE A;  4EJO A;  4IRI A;  3KP3 A;  4EJW A;  3HKZ N;  3V42 A;  4IHW A;  4CSW A;  1D8K A;  2CV1 A;  1UMQ A;  2ELH A;  1VQL I;  2XAU A;  4KNY A;  1Y8Q B;  2A5Y B;  3OR2 C;  4RGU A;  4G6D A;  1I1S A;  4EGZ A;  2MSY A;  3CJT B;  3JRB A;  1DUX C;  5DDG A;  2E35 A;  3TOA A;  5D6E A;  4PGG A;  4BU2 A;  3DLL F;  1WWX A;  3ZMS A;  2BY2 A;  1RUN A;  1V5G A;  2Q8K A;  1YE9 A;  2EFN A;  3HRT A;  1OR7 A;  4BJ6 C;  1QA6 A;  4P5O A;  5H6R A;  4B48 A;  5TJJ A;  4IHS A;  2BE5 F;  3Q0W A;  1HOM A;  1QHH D;  3OYB A;  1FT9 A;  3J80 K;  4I76 A;  1T56 A;  5HDN A;  3JRH A;  1R22 A;  2CV2 A;  5ED4 A;  2PG4 A;  3BZK A;  2KJB A;  3FK6 A;  5K7Z A;  4YIR X;  1KU3 A;  4OU0 A;  4LG0 A;  2GAU A;  3VFZ A;  1AHD P;  2DO7 A;  2DA6 A;  2X6W A;  4HQE A;  1U8R A;  3B02 A;  5IPA A;  3PO2 J;  1AU7 A;  4HA8 A;  2WAD A;  3QP5 A;  3BG3 A;  4U0Y A;  4CCK A;  1QBJ A;  2HVQ A;  2DOF A;  3FXL A;  1FZP B;  4F3Q A;  3BR2 A;  1FC3 A;  3RI4 A;  1Z0X A;  1R1U A;  5D8L B;  2E36 A;  2YX4 A;  4EM0 B;  5EGO A;  3PSI A;  1B72 A;  3O8G A;  4HLY A;  1ZG1 A;  3MZ8 A;  2QSH X;  3W2A A;  4Y52 J;  5GPC A;  1FLI A;  3GME A;  3EUH A;  3NAR A;  1MMG A;  4E70 A;  1HDP A;  5BMZ A;  1Z9C A;  3I55 I;  1OMI A;  4C3I J;  3PM1 A;  1Y0N A;  2E34 A;  2M9H A;  3AG4 H;  3I71 A;  3I4N J;  1HA8 A;  2RQP A;  4AID A;  3F0C A;  1WPK A;  3IH3 A;  4IQ4 A;  1NK2 P;  2E7X A;  2W84 A;  2HZT A;  4XR6 A;  4WX9 A;  4HRI A;  4H4K C;  2K3P A;  2J5O A;  4MTE A;  2XGE A;  1VFC A;  5IOZ A;  4XOP A;  4B09 A;  2Y9Z A;  2GLO A;  2HEO A;  5IP6 A;  1DPU A;  3D5S C;  3P5J A;  3KET A;  1IRZ A;  3DEE A;  4RS8 A;  3IAM 2;  4BHC A;  3RDI A;  1JKP C;  2JPC A;  1R9T J;  3OYM A;  2ISZ A;  5F0F A;  1IRF A;  2BXZ A;  3R61 A;  1VF9 A;  2VAS A;  2F4O B;  4YFN F;  3FXK A;  5K7H A;  1L3L A;  5IT9 Z;  4XLH A;  3E3V A;  1YTY A;  5HNH A;  3DKX A;  5TIS C;  3T0Y A;  1MMA A;  2NVQ J;  3FK7 A;  4L5E A;  2YR2 A;  5LD2 C;  1JUM A;  1YW7 A;  3S1N J;  5F27 A;  1R4M B;  2ZO4 A;  4MO7 A;  5LGT A;  3DPT A;  2JUG A;  4DZP A;  2FA5 A;  2NVY J;  4OIP F;  5J8C A;  4S04 A;  3ERE D;  2I10 A;  1KGS A;  2XAQ A;  1G3T A;  3FIW A;  1HKT A;  4IEJ A;  2X9D A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 3DLL F;  4IO9 F;  1VQN I;  3G6E I;  3CCV I;  3I55 I;  3CCQ I;  1VQO I;  4IOC F;  1Y39 A;  3CF5 F;  1VQ7 I;  3CMA I;  2ZJQ F;  1YJW I;  2E34 A;  5DM7 F;  5GAD J;  2NXN B;  2ZJP F;  4V19 K;  1FOY A;  3I56 I;  3J7Z I;  1QA6 A;  2OTL I;  1HC8 A;  1ACI A;  5GAG J;  1VQM I;  2QA4 I;  3CD6 I;  2FOW A;  1VQ4 I;  1S72 I;  1VQ6 I;  2E36 A;  3G71 I;  1YIJ I;  1YJN I;  3PIP F;  3CCE I;  5DM6 F;  1FOW A;  5GAH J;  3CCU I;  2H8W A;  3PIO F;  1VQK I;  3G4S I;  3CME I;  1YHQ I;  1VQ8 I;  3CCM I;  5GAE J;  2ZJR F;  1YI2 I;  1VQL I;  3CC2 I;  4UY8 I;  1YJ9 I;  1YIT I;  2OTJ I;  3CCR I;  1VQ5 I;  3CC4 I;  1VQP I;  3CJT B;  3CCJ I;  1FOX A;  5JVG F;  3CC7 I;  3CCL I;  2E35 A;  1VQ9 I;  2QEX I;  2JQ7 A;  4IOA F;  1MMS A;  2K3F A;  3J7Y J;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...