3CMAI

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cmaI00
1FOYA 5GAHJ 4V19K 3DLLF 5GAEJ 3CCJI 5GAGJ 1VQLI 3PIOF 3CCVI 3CMEI 2H8WA 3G6EI 3PIPF 1YJNI 2QA4I 2E35A 2ZJPF 3CJTB 3CCLI 2OTJI 3CCSI 1VQNI 3G71I 5DM7F 1HC8A 3CCEI 3CCQI 1YITI 1VQ7I 1VQPI 1FOXA 5JVGF 4IO9F 2QEXI 3CCUI 3J7ZI 2ZJRF 1VQ6I 3CCMI 3G4SI 1YI2I 2NXNB 1VQ9I 1QA6A 3I56I 1FOWA 1Y39A 3CD6I 2ZJQF 2K3FA 4IOAF 3J7YJ 3CCRI 1YIJI 1VQ8I 3CF5F 3CC7I 3CC4I 3I55I 3CC2I 1MMSA 4IOCF 1VQ5I 2JQ7A 2FOWA 1YJWI 3CMAI 1YJ9I 2E36A 2OTLI 1VQMI 4UY8I 1VQ4I 1S72I 1YHQI 5DM6F 2E34A 1VQOI 1ACIA 5GADJ 1VQKI
chains in the Genus database with same CATH superfamily
3QPLA 1YS7A 3H36A 3SXYA 1KQ9A 3I3LA 1X4PA 1KONA 2G7HA 3DPTA 4PDKA 5D8LB 3FX3A 2BHZA 3W3CA 1FBQA 5KNLA 3DLLF 3MQ0A 1DGWY 1E0EA 2DPDA 2QQ8A 3VYUB 2JUGA 1DGRM 2L5QA 1R6RA 3TOBA 3VYTB 2HFHA 2DA5A 4HLYA 3VDXA 2Z16A 3EYYA 4G7HF 3HKZN 2B63J 3I9V2 5E1WA 2JMWA 3JRIA 5E79C 3E0JB 3GTOJ 3DBRB 2L9RA 3PNVA 2DLLA 4IHSA 1WPKA 3BP8A 3ASOH 3CCSI 5M5YJ 3HOVJ 1S5LC 1RKWA 3G73A 1X3ZB 3GZ6A 1R4MB 2DO7A 4XN3A 2M7AA 4IX7A 1IXSB 2HNHA 1OJLA 3CCQI 2IT0A 1EA3A 5FRMA 3OS0A 1FTTA 2FU4A 3GUDA 1TQMA 2DMQA 1LVKA 3G1LA 4S04A 2P5LC 4CDGA 1VQ7I 1OYIA 3VB2A 4LLGF 4XORA 2VQLA 4IO9F 5F08A 1X1CA 4DW6A 3OYFA 5HS7A 1RKTA 5HDKA 3TW7A 1OISA 2JA2A 2FMLA 1LJ9A 5FKKA 1D0ZA 1QNTA 2DOEA 4BEHB 4D1QA 1IN8A 2X6WA 3HPHA 4XLPF 1I6HJ 3FBIB 2OCEA 3BZCA 1E17A 2ZSHB 3E6BA 2R7QA 2ETHA 4BQQA 3TEDA 3WHBA 2R5ZA 3JRFA 1I27A 2CUFA 1RRJA 5D8KB 1ULYA 4XLNF 3HBLA 1YQAA 1ETQA 2ZNYA 3RQ4A 2P5VA 1I1SA 3DWLE 4A3IJ 1ZG5A 4AVZA 1HKTA 2M4KA 2UUZA 1UZCA 4I7HA 2R5ZB 1UHMA 3FK7A 5FLXZ 1UHSA 3E97A 1S6LA 3ZCOA 1YJ9I 4IQJA 2XAGA 1Z6TA 2FQ4A 2UWMA 1L0OC 2Z5UA 5CVUA 1V5GA 1U6GA 4IRIA 4NB5A 4N9IA 3C2BA 4GFBA 3K6GA 5AIPA 3DFGA 2B9SA 1ETWA 1I39A 5BOXA 5FD6A 2LG4A 3S8PA 1BW6A 2UXNA 1C0WA 2FRHA 2RC4A 2WA0A 3TDUC 4EEFG 2BYVE 3NAUA 4Q48A 1D8JA 1A5JA 2KIUA 2EZKA 1R5HA 1WH5A 2HU9A 5J4YA 4YIRX 2CFOA 2V9PA 1P4AA 3CUQA 3H9QA 3K4JA 2P4WA 4CCNA 5HNFA 1PVEA 3NWSA 3DEUA 3CMEI 4I01A 4IHVA 1W36C 3PFIA 3U21A 2DMNA 2R7ZJ 4RM2A 4PSWA 4WXCA 4BUPA 4GGGA 2JA8J 4ZTFA 3BZ6A 5LHHA 2CUJA 3S3OA 1XC5A 3OOPA 4OAZA 3FHZA 3QU6A 4F92B 1MJBA 1GDTA 2JSPA 1Z7LA 2GA1A 2VC1A 3CESA 3C7JA 2TRTA 2XGDA 3R4KA 4QIWN 2VUMJ 2CW7A 2KMUA 4O5VA 2X0LA 1XMXA 1PDNC 2H1KA 1Z21A 2ZMEC 4UXNA 2HS5A 2MGQA 3WU0A 1JJ8C 4X0GA 2XIGA 2LR8A 2HXOA 1QPIA 5E1XA 4BJ6C 3QPTA 3ZQQA 3E1SA 4RB0A 3S16J 1FSEA 2A6HF 3CCMI 1JHHA 1SVLA 1R4NB 1MW7A 4D5FA 1OPCA 1XX5A 2EA2A 4YG2F 2DMPA 2EV5A 4P9FA 3M1EA 1T38A 1MH4A 4YEJA 5F6FA 3CD6I 5LRRA 3WTUC 5GTIC 3QP5A 5ICCA 1XCBA 5DCMA 5B1AH 3BCBA 2J5OA 3S3NA 2DN0A 1PP7U 3LOCA 2W1OA 4EATA 2FOWA 5EGOA 4UUTA 1F36A 2KL4A 4XLFA 1K4SA 2CW0F 5DCMB 5DDGA 4RB2C 4LITA 1Z9CA 1QVTA 2RN7A 3WTZA 3MKYB 2IBDA 4IHXA 1JUSA 5EGOB 2DA6A 4II2A 3H92A 3ERED 3H3VK 2DYSH 3MWMA 2LD5A 2KHMA 2WTEA 3HRMA 2OQRA 3W6KB 3WTTC 2OJED 3S15J 1IG7A 4Y4RA 4FX4A 5IP7J 2X85A 1YS6A 2R7XA 3JAMK 1WJCA 4KMFA 1U5TC 1WKMA 3VSKA 4Q47A 3IKTA 1HLVA 1IRFA 5GAHJ 4CHUA 4MGRA 3CUOA 2R7OA 1LVAA 1BBYA 2ZC2A 5GAEJ 4MEXF 2QQ9A 1MZBA 2XGEA 3D5LA 3KP3A 3LA2A 4CH7A 1GVDA 4XSXF 4PSXA 4XKCA 2VPLA 4BHPA 2VBWA 1Z77A 2M0MA 4HA8A 2BZTA 3FXQA 1OFCX 3ZMSA 4ESBA 3HTUA 1FMVA 2E1MB 2ID6A 2QVOA 3LQQA 2M30A 2XF5A 4F91B 2KZVA 4D7MA 4UV8A 3S2WA 4HV6A 1FWZA 1PJRA 2DFFA 1BA5A 1XGNA 2JT1A 2JSCA 3WHCA 3NEUA 3BPVA 3CDIA 3CCEI 2L7ZA 3HL2A 2FUG2 2COMA 2L3DA 3TGNA 2D45A 2HVRA 3J7AO 3DKYA 2ZFUA 3JW4A 5GPCA 1ON2A 3E6DA 2LY1A 3R0AA 2L7FP 2HKOA 4BGDA 4CSWA 1Z67A 4DBQA 1XB4A 1A35A 5EEHA 5DEQA 1QZZA 2OCCH 2LYCA 1FC3A 2A05A 4NC6A 1USSA 4XONA 4BQNA 1JI8A 3K4LA 4KT5C 4L0YB 1B9NA 2LTPA 1EH8A 3QPSA 3IWZA 1H89C 2CGPA 4LB5A 1XG1A 4ZYGA 2V79A 2XKPA 2ZXHA 1FOWA 5FFZA 1X4OA 4Y3OA 3H5RA 2D1HA 3CC7I 4BY7J 4MTDA 3BJAA 2FBIA 4EV0A 4ZDPA 3WTWC 4BAYA 3KEOA 3H5NA 2X1CA 1USTA 4Q4ZF 2R93J 4M3EA 1KQ8A 3P9KA 4A3MJ 1YJWI 5EG0A 3HPGA 1X19A 2OF7A 2DFEA 3ABLH 5FKNA 2FJ1A 1QBJA 5LEJA 1DP3A 5FRNA 2R7TA 5FROA 3GVAA 3K1PA 2EINH 2XHKA 2E7WA 3QYFA 2ZBKA 3EQLF 3ABMH 5CQGA 4KUMA 1TQPA 1XSVA 4FETA 4DYCA 1Z91A 2OZ6A 2KLOA 1GV5A 3MD2A 4MFDA 4PZJA 4RA2A 4F55A 3MZHA 2XVCA 4M3DA 2D5VA 5FKOA 3JRGA 1QU3A 1LEBA 2RREA 4RDUA 2WAEA 4U0YA 3OY9A 2MLKA 2EFNA 1MSEC 1O57A 3S1QJ 3HRTA 2V1UA 1XGOA 5IYCJ 1LE8A 3OYKA 3OYMA 2FXAA 1YX5A 2Z1DA 3FXUA 1REPC 1Y1WJ 1Z3XA 3A4CA 3GTKJ 2VLAA 2KPMA 3KLNA 1WVRA 2P6SA 5KVRA 3I64A 4HW0A 1J7KA 3IL2A 1GUUA 5LFAA 1AU7A 2VJJA 2G9WA 2GIVA 2R7UA 4B3XA 1T33A 4NUBA 2K85A 3GF2A 5JFRA 3HEFA 1R1TA 5CPRB 3PIPF 1HDDC 1RUNA 9ANTA 1DU0A 3GTPJ 5GP9A 2DFHA 3KIOA 3CJTB 4NQWA 5EDNA 1D0YA 5J1UA 4CCKA 3M07A 5K5OA 1HW1A 1W7PA 5K1YA 3H35A 1R5ID 2W24A 2O9LA 1RI7A 4ZDOA 3WE2A 1HXDA 2OZUA 3Q9VA 3MZYA 1G4DA 3DU5A 2L4AA 1HC8A 4NQWB 3ZQCA 3CP2A 2W25A 2DFIA 5LEKA 1R36A 3DCFA 1P4XA 2FD5A 5IOZA 2DA7A 1QZYA 2F5CA 2FEZA 3ZXSA 3UR3C 2EIJH 3TKYA 3IH4A 4Y7NJ 1I50J 2NS8A 1ZK8A 3JRBA 5M3MJ 4J19A 4UUSA 3DV8A 3RIRA 4OMYA 2UXXA 3PM1A 3DPUA 2GXGA 4ENJA 1BM9A 4X1EA 2QGUA 2HXIA 3RPQA 2V9VA 3KFWX 1HOMA 4E7HA 4P96A 3KLOA 4BDYA 4BE1A 2CFXA 4UUSB 3E6CC 3RSNA 3AG1H 4BU2A 5C3EJ 4UVBA 4CCOA 4XNFA 2X48A 4DNCA 1CGPA 1HCRA 2V6CA 3F8NA 3L2WA 2LKXA 3LNQA 4OINF 3HHGA 2F5VA 2TCTA 3ASNH 2A69F 4GRIA 3BDDA 4E70A 1YIOA 4OWRB 4M3FA 1J09A 5C44J 4V2GA 1G3SA 2VQGA 2Y0MA 3ABKH 3CMMA 5AONA 1O4XA 4I76A 2E34A 4HX7A 3E5XA 1E3OC 1ACIA 1H9TA 2CWEA 2EV0A 2VI6A 4BL0B 3Q0VA 3CZ6A 4KISA 1GT0C 2UV1A 2ZXJA 2NVQJ 4EJWA 5LRSA 1HSJA 1XDUA 1TC3C 2K3PA 4XRSG 5KAFC 2RQQA 3WG7H 4WXHA 4JP0A 3FMRA 3CMYA 3KX2A 2VJIA 3FKIJ 4AVPA 2WV0A 2LSOA 3Q3SA 3OYCA 2JZYA 5DD4A 5LHGA 1ZRDA 2OC6A 1OCPA 1Q1HA 2QA4I 4C2UA 2VQHA 4KYWA 3U2RA 3Q0WA 1OMIA 4I6ZA 3F6VA 3OYEA 3ZRGA 3NRVA 3HSRA 4M6XA 1BL0A 3PUFA 2YU3A 2R4GA 4HAMA 4KT6A 4E4HA 3DP7A 3OL3A 3F8FA 5JLXA 2YR2A 4Q5SF 2XDVA 1WJEA 4HF0A 1HA8A 3BWGA 1YITI 3H3UA 1WFXA 1TNSA 4PGGA 3F23A 1LDKB 4WF2A 4ABZA 3HYIA 1B6AA 4AM3A 1FOXA 4A3JJ 3LSPA 1UAAA 5HS9A 2IGMA 5BMZA 1IRZA 1HKQA 4HQEA 1ITYA 1U0JA 3LSJA 1MMAA 2ZMEA 3HRSA 3J7ZI 4BE0A 1SFXA 4ETSA 2K4BA 2VL8A 1N75A 1RNLA 2G7UA 2JRTA 4RGXA 4ZYAA 2ELJA 2CQNA 3FMQA 3OL4A 2Y2ZA 2ID3A 4UB8C 4RMNA 1V54H 2XAHA 3OMYA 2ME6A 3FISA 2AXTC 2XF6A 3QODA 2DU9A 2QF7A 5TISC 2ZMEB 4HF2A 3K4NA 4IOAF 2AS5F 1D3YA 4F3QA 3GEZA 1YIJI 2MH2A 2VN2A 3P7NA 2LDUA 1HW5A 4M3BA 2JTVA 2XUBA 5LBQA 2GXBA 4YFNF 5FO5A 3ZQFA 4XMYA 4H0EA 4L9VA 1V55H 3FBNB 2FNAA 2IA0A 4JQFA 3JRCA 1Z3YA 2IGOA 3GTJJ 4KICA 1A6IA 2G0EA 4HX4A 1IN7A 3GCMA 3K10A 4XKVA 2GOXB 2GQQA 4PJJA 2K86A 3H3ZA 5K5RA 1B8IA 1IUFA 2XASA 3NWTA 5ICEA 5E8GA 3ZQHA 5JI6A 3HIFA 1R71A 1K61A 2VJ4A 3BQZA 3L1PA 3DEWA 3BG3A 3CO6C 3IAM2 1X1BA 4DQ2A 1K83J 2BXYA 3BR6A 3M8EA 4JX6A 5D5WB 1XS9A 2LMDA 2DK8A 4XOPA 2FQ3A 2BW3A 4IVNA 2W7NA 1B8IB 3DPLC 4D7NA 2LREA 1E3PA 4G12A 4Y17A 4BKXA 4B09A 2QCOA 2YX7A 3DBLB 1U5TA 2HZDA 4BHCA 4CCJA 2VBZA 4KFCA 2LLKA 4D0PA 5K5QA 4OU0A 5M3FJ 3N97A 3V8LA 1JXSA 4GCVA 3MFKA 5J47A 5D5UB 3B6AA 1IN6A 1SAUA 1U5TB 3TO6A 3MCZA 2E1OA 3TO7A 1SEUA 2DJIA 2B0LA 1FLIA 2H6CA 2FSWA 1IO2A 3IC7A 2VXDA 3CTAA 2YU9J 2PEXA 1YOVB 4ZYEA 3HGYA 2GOMA 4A5MA 3PNTA 2E19A 2A68F 4BQOA 1XPXA 2CYYA 2EA4A 3A01A 2L7KA 1J0RA 2RQPA 3GTLJ 1BOAA 4P55A 1ON1A 5E20A 3J80K 3G3ZA 4L9NA 2LNBA 1LFPA 3QWLA 2HPIA 2ZB9A 2AHQA 1TQIA 4ENMA 1DUXC 2V6EA 1XSXA 3A01B 3QYEA 3FDYA 4BH9A 1YW9A 2PJPA 5F04A 4XRFA 5KCMA 1VQ9I 5DS9A 1D1AA 3ZP5A 1U3EM 3OOUA 5E3NA 2VPRA 3N4MA 2P6TA 4RAYA 1VQ8I 4OIQF 4BEHA 3SDBA 3RTRA 3L2RA 1FBUA 4A0YA 2VE9A 5KK1A 1JT0A 2HDWA 3FXJA 3RYRA 1JT6A 1GVJA 2MA3A 1TW2A 1E3HA 2R7FA 4II3A 4FTHA 1OCZH 3M9AA 4MO7A 3FIWA 3RZOJ 5IYDJ 2IXSA 2W00A 4HDUA 2A5YB 3TMOA 1HQCA 3JTGA 2NAZA 4M72A 2R7WA 2V1NA 1MMGA 4G6DA 2XC7A 3RKYA 2XB5A 2CS3A 1Y56A 4RGSA 2P7VB 2DOFA 2ZO4A 3AAFA 5F0HA 1MJAA 4G9YA 1VQKI 1ZGJA 2WAQA 2A6TA 2VOPA 3A1YA 2A07F 1SAXA 3AG2H 3SHFA 1MH3A 4A6EA 1K6YA 4A3GJ 1T6SA 2BV6A 2NVYJ 3GWZA 3C1DA 3M7GA 3BG9A 5ILVA 2A3SA 4LLNA 3L2UA 5TGTA 2O8KA 3JSOA 3SZTA 1Y0NA 5D5VB 3OYNA 2DMTA 4N4NB 2H8WA 1GLNA 1T98A 2K9NA 3HSFA 1KA8A 1QZEA 1XSDA 4IF4A 4M73A 3ZQ7A 3RKXA 1G2HA 3ZMZA 3M8FA 2GIZA 2I10A 1ETKA 2LKSA 2M4GA 3QP6A 3KZZA 2XSJC 1KZHA 1MBGA 1VQNI 5DM7F 1FP1D 1GXQA 3QAHA 4FT8A 5EEGA 1MDMA 4HNUA 3RPUA 3QU3A 3J81K 3HJEA 2QM3A 2QSHX 2MD5A 2TDXA 2KRFA 5F27A 4RAGA 1SD4A 1Y1VJ 1KGSA 5B3SH 1X1AA 2LF7A 2EH3A 3S93A 4PJNA 2UZKA 2BHYA 1DPRA 3OIPA 1MDMB 3KEQA 3DTIA 2F5FA 1OCRH 5H2FC 2CUEA 3CCYA 2VASA 4R8HA 1PP8F 3OIOA 3F0CA 1AWCA 3T1BA 1D5YA 2E71A 1SD5A 1BI2A 1BR2A 3G1MA 1SMYF 2B7EA 2H94A 1Z7UA 1SD7A 3U1KA 3JAMZ 1FY7A 4CA0A 1X2NA 4D9JA 3E7LA 1T2KA 3PO3J 5CJ9A 4M9XA 1W4MA 2BY2A 1S3JA 2O03A 4PFPA 3VEPA 3RYPA 3HOYJ 4G6QA 1BR4A 1T0FC 4FISA 3GFJA 3S1MJ 1ZTRA 5IOYA 3EYIA 3LAPA 2VBXA 1VI0A 2W84A 3ABUA 4F52A 1SANA 1IV6A 1HKSA 1YX3A 2ME0A 4LK0F 3PSFA 2FOKA 2QYOA 4UY8I 1IZ1A 2PMZA 1IF1A 2VQCA 2DA1A 2FF4A 2Q1ZB 1D1CA 1PYVA 4XLHA 3QRFF 1JTXA 4E7SA 3MEXA 1EH7A 1IGNA 2K5CA 3IHUA 1XN7A 2X6YA 4EM2A 4E6KG 3A0BC 1F1ZA 1UCRA 1I5ZA 2MW8A 1TT5B 2EPFA 4JX5A 5L3GA 1B59A 1FOYA 2CW8A 1SFOJ 1APLC 2MD0A 2QENA 3FM5A 3ZPLA 2EFOA 4A12A 2DT5A 4V19K 1ZHFA 3IH2A 3CCJI 4HRIA 2NVTJ 4GYIA 4W97A 3COAC 2HTJA 1NH3A 1R49A 1I3QJ 2OQGA 5FGMA 4K2EA 3FMSA 4XICA 3EPZA 4LJZF 2RV8A 4LG3A 3AFHA 2V4JC 4RLQA 3SZGA 2ZJPF 3GTGJ 5E1ZB 3ELKA 2Q8KA 2F48A 1TLHB 3C18A 4XM3A 1VTNC 2E2JJ 4ZDLA 1KYZA 2DAOA 2L9SA 3H5AA 1U78A 3VYSB 2Q0OA 2JWTA 3I71A 4V2FA 3G71I 4OIOF 5CVIA 1FP2A 2K02A 6PAXA 2ADUA 1YE9A 1Y8RB 5JHFA 5HDNA 3GO5A 3RQIA 3U9GA 4DGWB 4KITB 2CUZA 1FYKA 1G59A 1Y8QB 2BGCA 2EQRA 3H0DA 1VQPI 5GTHC 1BI0A 2L02A 5BQTA 1NTCA 2KRCA 2QBYA 1ZG3A 3ZGKA 2IS4A 2VODA 4MHGA 2DW4A 2IAIA 2K9SA 2HYGD 2NXNB 1TW3A 1R7JA 2PMUA 1BI3A 5HLGA 4BXXJ 2XB0X 2XSDC 1YRNB 1TP4A 4U0VA 2M0CA 2QKLB 5EZGA 2QBYB 4CGZA 5KAIC 2HQRA 1XMAA 1WJAA 4ZC3A 3EUHA 2VIXA 1O3QA 2YUSA 1MBKA 5DUKA 2QLZA 4DJAA 1IJWC 3MMYB 3PJRA 3KZYA 2HVSA 5JHUA 1ODDA 5F0CA 2ZJ2A 1JGSA 3LSGA 1B4AA 2HKXA 2D2WA 5IT3A 1K4TA 3CF2A 3GTMJ 5IT9K 2E36A 2ISYA 3S14J 2LK2A 2DI3A 2LOOA 1BR1A 2VT2A 1MJ9A 3ZOBA 3L2QA 4HPQA 4MNUA 1UHWA 2DDBA 1HW2A 3CJNA 2AXLA 5E3MA 3BR1A 3HSEA 3LQRA 5J3LA 5D5XB 1UG2A 3OWTA 3WTSC 2JK3A 3RZDJ 3AL0C 4MLOA 1R22A 1RESA 1UFMA 3JSPA 2MG4A 2KZGA 5CQEA 3EUAA 1BIBA 4JOMA 2Z33A 2P81A 4A2UA 1KU9A 3GXOA 3ZMDA 1LDDA 1ETOA 1MNDA 2M8EA 4ANJA 1GHCA 3BG6A 1V5EA 3IV5A 2O7OA 3E5QA 2IPQX 3W2WA 4XIDA 1E2XA 4ZYHA 1ZR2A 5IY5H 3SZPA 3I4MJ 1S7OA 4E7IA 3PL8A 2DYRH 1YJNI 1AA7A 3OYJA 1WJDA 3FM3A 3OYDA 3M4OJ 1ZRCA 1BI1A 5JLWA 2L01A 3HOWJ 3JCUC 1FMWA 3DQVC 4U87A 4RGUA 1K78A 1N25A 4G6TB 1TWCJ 3K69A 3KP7A 3ML6A 1IDYA 4BNCA 3O3KA 2IP2A 3PUBA 3CLOA 2HQAA 4LG0A 1RC9A 3BTIA 4KNYA 4UB6C 2KISA 4DOZA 3IP4B 1K78B 3K70D 1FT9A 4WXDA 4PFOA 2KT0A 1TTYA 2WAQN 4AIDA 3OS1A 3K4MA 3CCUI 1IAWA 5J1YA 4ZZLA 2VXZA 4HNTA 5A2QZ 4LG0B 1FSHA 2Y9YA 1MKMA 2HWVA 4XRSA 2ISZA 2KRHA 1ZREA 4OAYA 2STWA 1SVMA 1LQ1A 1QA6A 5BPDA 2JN6A 5K7FA 1KYWA 1W7PD 1QO0D 1WQ2A 2K3FA 4L9TA 3J7YJ 3CLQA 3CC2I 2ECCA 2KQRA 1T08B 3CJQB 4YFXF 1FPQA 2QZ8A 4EVIA 3A0HC 3REOA 2ZNZA 5IP9J 2LVSA 3S17J 1ORKA 5JVTA 3A03A 3C2HA 2OTLI 2L0KA 2HZTA 4E7LA 1J75A 1UG0A 1WJFA 1U2WA 2F5EA 3B02A 5ERIA 3PNYA 1MIJA 3I59A 4EJOA 2OU2A 1FNNA 2IGNA 1X2MA 4TV7A 3PQKA 3V7SA 4P9UA 1CQTA 3F8MA 3CDHA 3DKWA 2EFQA 2Y75A 3RKWA 1LEAA 3DEEA 2PX9A 1ETVA 4XKWA 4L9JA 3FHNA 2VONA 3UKGA 5K7ZA 4A3BJ 3LWFA 3I59B 3SEQA 2ZKZA 5C4XJ 3OS2A 3IWFA 1UB9A 1QVUA 2Y48A 3GTQJ 3BPXA 1HF0A 2JA5J 2X4HA 3H9GA 1JKRC 4FX0A 4CO8A 4M9ZA 5GAGJ 4BYYA 1ZLJA 2LRDA 3LMMA 3MKWB 2IS6A 1MGTA 3PIOF 5A2QK 1YFHA 3MAJA 4C3HJ 3OV8A 1TWAJ 3LSIA 2M3AA 3N05A 5DD8A 1ZYRF 2E35A 5HLHA 3BR0A 3GZNB 2BY0A 2M87A 2LBFA 4DBRA 3SFZA 1S7EA 5E8IA 1SMTA 5EF6A 1H0MA 3KETA 4AC0A 3BROA 3RCOA 2PMZN 1NK3P 1ZELA 2P8TA 1WCMJ 2Z9OA 2LBFB 3HTSB 1FEXA 1W5SA 4FE4A 4U0WA 4A6DA 3S2HJ 2K27A 4H4KC 2DOAA 3FXKA 3L00A 4RB1A 4O6JA 1O3SA 3F3XA 5LHIA 2KIFA 2HTSA 4E7ZA 4I2OA 1IW7F 4IJAA 1SVOA 3CJRB 4D5CA 4AYBN 4WX9A 4RAFA 3BCAA 4P5OA 5H20A 1TBXA 5DTDA 3G4SI 4QWQA 4XRMA 1YI2I 3I5UA 5BPIA 3V4GA 1ENHA 4M9SA 5E17F 1W5TA 2ESNA 1FIPA 4A3LJ 1EKEA 2EZHA 4HV5A 4EJVA 1W36D 4HLXA 1WHUA 5HNHA 3BR3A 2CH0A 4ENNA 3RJPA 1OR7C 4G7ZF 4XLEA 4L18B 2RGVA 4HSTA 1GXPA 1G3TA 3I54A 2D1VA 3LA3A 5FFXA 3IAS2 3CMAI 4ZJZA 2KDOA 5M5XJ 2IA1A 3P5JA 2QQBA 5HODA 2MFZA 2JPCA 1T0FA 2HQ5A 2F2EA 2ZXIA 3EUHC 1STZA 2N8GA 1SFEA 3K4BA 5F1RA 4IHYA 3ZMTA 3T8RA 2A6EF 2PMHA 1P9QC 4A3CJ 3BZKA 4YIIA 4BS9A 1LDJA 1R23A 2M9HA 3F8CA 1YLFA 1V5FA 2XGXA 5HOOA 4YFKF 2RNJA 3EDPA 2KJBA 3P9CA 4YIFA 2HDCA 1ERDA 2DQLA 3L2VA 3T8TA 3LSTA 2H09A 2ICWG 5ED4A 3GX4X 2Y0SN 5EEAA 2ELHA 2KIMA 4IHWA 3KYDB 2GBYA 4FHTA 3GFLA 3TP0A 4MIMA 1QGPA 3A02A 3J80Z 2A5WA 1JKPC 4M74A 1JUPA 4UHTA 1IN4A 2F4MB 4UUVA 4BXUA 4AUXA 3BJ6A 3CCVI 3D1NI 4A69C 3A2KA 2BY1A 1POGA 2EZIA 4PUSA 1O7FA 3V42A 2JA6J 2L9NA 2W4SA 4O3MA 2W57A 4XLAA 2IW5A 4FQGA 3V8KA 3VOEA 2XKOA 2V26A 2PFBA 3CCLI 3VWBA 3IH3A 4KDPA 3E6MA 3TL4X 2JA7J 3M3YJ 4KMUX 1JGGA 5CVJA 3O8GA 4G94A 4LB6B 2IJLA 3JTHA 4EGYA 4LIUA 3Q5FA 1LKXA 3LSMA 4DZJA 3O6BB 2CRGA 1B9MA 3TOAA 3C3WA 2O0YA 4FE7A 2IVMA 5KHDA 5FLVA 5JVGF 3IKVA 5CVVA 1DPUA 1VZ0A 4GDFA 3I0TA 4HQMA 2STTA 2KKOA 2MC4A 1BIAA 2JPBA 1IRGA 3BR2A 2NYXA 3K2AA 1JKOC 1GV2A 4P1WA 1TWFJ 3H0GJ 4U7BA 4A3EJ 2EV6A 2HYJA 2K9MA 4HOBA 4IXAA 3OYHA 4KJZA 4CZZA 2ZCWA 4RBOA 4BQAA 4XK4A 5EZHA 1FYMA 2XPVA 3CC4I 1X3UA 4IOCF 3K4CA 3QOPA 4EQQA 1NK2P 2M8GX 1F9NA 4MTEA 4J01A 3O2PE 2DA3A 4QTRA 4B47A 2YS9A 4LFUA 4KN4X 3QQAA 3KCCA 3LL7A 4M6VA 4EM0B 1NG6A 3ZMVA 4A93J 3K4KA 4L5EA 3ROUA 3IUOA 2C6YA 2M34A 4BHBA 2R7SA 3CO7C 2DK5A 4G8XA 1FYLA 1XGMA 2OV7A 2VE8A 1V4RA 1WWXA 2BY3A 5LGNA 2COBA 2OAZA 4HDVA 5LGTA 2X1DA 3F21A 1B72A 1VQOI 2P7CB 4L0ZB 4HX8A 5DCFA 2XAQA 2NS7A 2CU7A 3MKLA 1JKQC 1A36A 1JTYA 4XL9A 5FLMJ 1ZARA 1U8BA 2VKEA 4RGRA 3VODA 4LD5A 3J81Z 1QQIA 3KP2A 5FKLA 1F5TA 1B72B 3ZQGA 1DDNA 4DYQA 2F4IA 4PK4A 4C9YA 1D8KA 4CYDA 4C3IJ 4M6YA 1ZG1A 2H1LA 5FD5A 3HC7A 5LD2C 2KIQA 4HG2A 3HG9A 3C2GA 3DTEA 5FJ8J 2FNPA 2CO5A 3Q9SA 4DZPA 2MH9A 3ONQA 2AQEA 3AL0B 1P7IA 5F1JA 3M1CA 1JUMA 2L7MP 3DU6A 4I0BA 1JHFA 1J9IA 3MVPA 1OCOH 4NBQA 5GPAA 1U8RA 2DPUA 3R60A 3FK6A 2OTJI 2MSYA 2F4OB 1D0XA 1R5GA 3CP8A 4R1HA 2M7BA 3P9IA 1RETA 2GXAA 2GZWA 4LLLA 4KA4A 1Z6RA 4RLFA 1FZPB 3TO9A 2L9VA 2E2IJ 2DT6A 4B8XA 1G8XA 2PI0A 4IKFA 2XROA 4HNVA 4MEYF 4PJMA 4Y13A 2Y30A 3F9KA 3W2AA 2ESHA 1QPMA 3ZR8X 3JR9A 4A3KJ 3F22A 1MSFC 4AD9A 1N78A 4RB3C 1ONVA 3K0LA 3DTKA 3OSFA 2HEOA 3CDLA 1H8AC 3TQNA 3TBIA 3WODF 1UELB 2O8XA 2DBBA 4DYRA 4BJ5C 2CV1A 2O5RA 2WB1N 4YELA 4S05A 5AIQA 1WSUA 3PSIA 4DIQA 3HXLA 5F64A 2JRMA 5J4VA 3HOZJ 4BJTA 2XAUA 2ELKA 1P6RA 2VKDA 1ZQ3P 2Y9ZA 4QSHA 3CF5F 2EIMH 4NC7A 2E7XA 4ESJA 1S8NA 2F5DA 3KP6A 1RR7A 1VQ5I 3BTCA 4L5IA 5LLQA 2DA2A 4A5NA 2Z3YA 3OYLA 4MQVA 4MFEA 4BBRJ 3QYBA 5D6FA 4BXFA 3RPUD 4XQFA 3GFIA 1WI3A 3VFZA 2KP6A 3M8JA 4IRHA 4OIRF 2VC0A 2X6OA 4ZTJA 1T39A 3HUGA 2MYSA 4B4CA 1FTZA 1A04A 1XGSA 1MBFA 2CJJA 5ILSA 1VQ4I 1R1VA 4XBFA 1X1PA 3JRAA 3CUQB 2Z2SB 4QPOA 1M1EB 4Y15A 1HDPA 2EIKH 2LP0A 3HUGB 2JVHA 1W0TA 2YSRA 4I98B 4N0BA 3CQZJ 1WH7A 1H9GA 2M45A 4B43A 1YTYA 3H9JA 2IEKA 1FBSA 1XCVA 4I09A 3WG9A 4QLCU 2XPUA 1JE8A 1RZ4A 2I5UA 1BJZA 3RDIA 1X3WB 4GXOA 5FLXK 1YW8A 3BTJA 3DBHB 4ON0A 1O7LA 2DCEA 4EJUA 4B3AA 3G6EI 4KIGA 2V7FA 3DXJF 2X6XA 2EZLA 1ETYA 3JREA 4L5JA 3OYAA 2M2EA 2CQXA 4JYKA 2R7DA 1XDSA 4RAZA 1Z1DA 5HLTA 2X1EA 4A0XA 4AYBA 1ZGAA 3GLLA 4HSRA 2DT7B 3ABTA 1MBJA 3LSRA 4CCMA 3D5RC 2HQNA 4F7ZA 2IA2A 3HOSA 2MABA 1K6OA 5DYMA 2HOEA 3EUKL 2LFBA 1I3AA 3HRUA 2IGKA 3WGHA 3K2ZA 5HDGA 1TNTA 3ZMUA 1W5CC 2HR3A 1KU2A 3OR2C 2R5YA 3VYRB 2RAEA 5IT9Z 1D1BA 1IXCA 3BTLA 3HOUJ 2R0QC 4G7OF 3I58A 1ETXA 1DP7P 2XAFA 1MD0A 4WK8F 4BBSJ 4C2TA 1U9NA 2E60A 3WTYC 1IC8A 4MQ9F 2R5YB 2DTRA 2DXIA 4I02A 2OA4A 2RNGA 2R3SA 1W0UA 2WWYA 3DLAA 1YW7A 1D5VA 4A3DJ 1WZ2A 1F43A 1VF9A 3ESWB 3L09A 4KN7X 3OYIA 1Y39A 3DKXA 4CICA 3JRDA 3CCRI 2O61A 2CV0A 2Z99A 4EGZA 1MMSA 2DJNA 4BACA 1R1UA 1UMQA 5B66C 1PUFA 1PUEE 2WBMA 1YRNA 2V1XA 4NC8A 3HB9A 4PJLA 4B48A 4BE2A 1P4WA 1OR7A 5CYVA 2XF7A 3SEZA 4UVAA 1LNWA 2Y0SA 5B5EC 4IQ4A 4ESFA 4OIPF 1S29A 1MBHA 1PUFB 4XN0A 4C3JJ 4BDZA 1AOYA 3G2BA 1HBXG 4Z2YA 2PQ8A 3TDZC 2FE3A 1YHQI 4OMZA 3HHHA 4EM1A 2DQRA 1IDZA 2V1DA 2GWRA 4UV9A 4IRGA 3HGGA 3UNGC 2CV2A 3I4NJ 1TT0A 2VB6A 3L2CA 1ZN2A 3L7WA 2NVUB 2P0WA 3OR1C 2VJ5A 4N9HA 1Y0UA 4PJ0C 1K7AA 1LFUP 2EBIA 3KP5A 1NG7A 2YX4A 3K7AJ 4S0HB 4AIKA 3F8BA 4LK1F 1B1BA 3R61A 5FKMA 4NDLA 2XGCA 3BLYA 1MMNA 1DU6A 3V7RA 1BC7C 2QSFX 1IV8A 5DUIA 4RS8A 4RM3A 2P5KA 3SYTA 4J00A 2IS2A 1P92A 2L4MA 2AQFA 2DODA 3FF5A 2DA4A 1NHAA 4AIJA 3AG4H 1LB2A 2R7VA 3I4PA 3WTXC 1N77A 1IN5A 2IS1A 3WTVC 3T5XA 4E7JA 2GLOA 2JUCA 2K40A 1MNEA 3W6VA 4F93B 4UVCA 2L54A 3O8HA 3WGGA 1OCTC 1K79A 3BG5A 2HI3A 2EFPA 1AHDP 3HDDA 3Q0UA 1YG2A 2OPTA 1S7AA 2RVCA 3ZN0A 4B1RA 5FB2A 2EFWA 1KU7A 1IUYA 1X58A 5IPAA 4LOCA 1VQ6I 4HYEA 4ZH4F 1OKRA 3B6CA 4R79A 2Y31A 5HLIA 2M1BA 2QKMB 3VPRA 4M71A 4Z6YA 2HYFA 3BOQA 2WY8Q 5EG0B 3KP4A 1QHHD 3DF8A 2ZJQF 4LMYA 2BE5F 1F4KA 2K9LA 3E3VA 3QPHA 5BNGA 3OYBA 2E5ZA 2WV1A 3LA7A 4C2MJ 4WWCA 1FJLA 2PLYA 3HKZA 4HF1A 4U7DA 4YRVA 1EV7A 3V8JA 1UJ8A 1EF4A 3IRQA 2NS0A 2WC2A 2A61A 3L9FA 1T95A 4QPQA 2BBYA 3IRRA 3K1NA 1EH6A 2OBPA 2CQ7A 4C30A 5F0FA 1LE8B 1DQUA 4OOIA 2EWNA 3BT9A 2J5PA 5HVQC 2BVLA 2VKHA 1WJBA 4W1UA 2R92J 4FCYA 2LF8A 1HSTA 2LC2A 2VKVA 3SFIA 4B44A 1YO5C 5J1RA 5DM6F 5M5WJ 2EJRA 4ENKA 3HM5A 4NHJA 1XTAA 1VFCA 5GADJ 4Y52J 3CUQC 2GA2A 2HOTA 2K4JA 3I53A 5ICFA 1SFKA 3ECHA 3FKJA 1S9HA 2H27A 3WU2C 3ZN1A 1TL8A 3FXRA 1W7PB 2FBKA 3WU1B 3GZ5A 1CF7A 2LY9A 3FXOA 1Z05A 2KFDA 2VT3A 2OD5A 2JJ7A 5DV5A 2PG4A 2CMPA 4X6AJ 4U88A 1X1DA 2X51A 3E5UA 2NVXJ 4PGHA 3FZVA 2EK5A 2V9KA 1T8IA 3S2DJ 5IP6A 2K9QA 1O3TA 1CF7B 2XRNA 2M5WA 3OIQA 2O6GE 5L3DA 3NQOA 1FIAA 2HOSA 1Y6IA 2WB1A 2ZXWH 4PCQA 5ILUA 2MC3A 5CLSA 3U1DA 4UNOA 3LSKA 1WRJA 1MNMC 5J8FA 2CQKA 2XPWA 3FWEA 5L3BA 1I6XA 4HBLA 2MLGA 4ZYDA 3GMEA 5JR3A 2DTZA 3OYGA 1OYWA 3F6OA 2YPRA 4XSZF 1G3YA 1BJAA 1TWGJ 1ZR4A 3VSLA 2WAFA 2JVGA 2E1NA 4E7KA 3FXMA 1P7JA 1H88C 1LPQA 3K9TA 2WY7Q 5CKTA 2ZJRF 2O3FA 3B73A 1V3FA 3BJOA 2GAUA 1G6NA 2EILH 1OCCH 3D5SC 5E18F 2XAJA 1WI9A 2E2HJ 3SQNA 1MMDA 5J40A 4M3GA 2OUMA 1RUOA 2CQQA 4EMSA 5CVRA 1QRYA 2FX0A 4IEJA 2QWWA 4CUGA 1I1GA 1LUJB 3ECOA 5EJCA 4I99C 3RKQA 3T0YA 1ZGWA 3W6JB 2JQ7A 3R0JA 5TJJA 1OQYA 2ZFWA 5E3LA 1R9TJ 3WE3A 3BG7A 4NNJA 2XV4S 1TWHJ 5L3CA 4CXFA 1RIOH 3HOTA 1L3LA 2KJCA 3BY6A 3R6SA 2QUFA 4CZCA 1KQ0A 2W82A 5H6QA 3S1RJ 3JRHA 2ECBA 3MN2A 4IHTA 3D0SA 1ZH5A 2MBFA 1VQMI 2PBIA 5K7HA 3S3MA 5TRDA 1P2FA 3ERMA 4ZZDA 3TW6A 3ISPA 2CSOA 4CCLA 3KYCB 3OSGA 1OYYA 2EB7A 1BW5A 2H8RA 3ZQLA 1W1WE 2NNYA 4Y33A 2FBHA 1G3WA 4XOTA 3S1NJ 2NNNA 4XLCA 2FA5A 2BXZA 4JK1X 1BOBA 5HS8A 4BY1J 3H1CA 2HOAA 1ZAOA 1FOKA 2GM4A 4KIBA 2E1MC 2PN6A 4A3FJ 3BC8A 1JJ6C 1YYVA 1J59A 2I8DA 5H6RA 2WADA 3GFMA 2E5NA 3LFUA 3MKZA 4I0AA 1VQLI 4CYCA 1R58A 2BOLA 2QQAA 3KZIC 1Q1VA 3KPHA 5ICGA 3S32A 4N4OB 5J8CA 3LAJA 2X9DA 5D4SA 2F6CA 5EYRA 3GYHX 2LH9A 1SD6A 4JX4A 5IYBJ 1LFBA 5J6XA 3G1OA 4CYCB 3AKZA 2NRAC 5L3EA 4FASD 2Q2EA 4LGWA 2DDAA 2XRLA 3ULQB 2RDPA 1J5YA 4AWXB 2BEOA 3GW2A 4IL6C 4WCGA 5B1BH 2R7RA 3BQYA 5LGUA 3SJMA 1RR8C 3FXLA 2DMUA 4KIFA 2Q2EB 3RI4A 2HDDA 1BN5A 1KU3A 4HEA2 2FMYA 1OLTA 2LKPA 4A0ZA 3QOEA 4GYGA 5L3FA 2QEXI 2ACJA 2HPMA 2NOGA 4IPAA 3PQJA 4AIHA 1T56A 1ZKGA 1A31A 3X2QH 2RKHA 3SDGA 2VBYA 3K1MA 4ASNA 3AG3H 1WJ5A 3BR5A 2IRFG 2HGCA 1MBEA 1ZRFA 4LIVA 1TZLA 3WGIA 3I56I 1SFUA 1Z0XA 5BS6A 3F72A 4HZFA 3KEYA 4XKBA 1FX7A 2LY2A 3I55I 1IXRC 3KE2A 1SC7A 1VNDA 1WGXA 5E3OA 1IRXA 2NOJB 3GBGA 1RPWA 3LFKA 1QHGA 4EJTA 3NARA 4ITVA 3PFYA 1AKHA 5D6EA 3LSHA 2AO9A 3PO2J 2PJRA 3EETA 4GO1A 1XD7A 1J2XA 2W48A 3TP3A 5D4RA 1R00A 2QSGX 2W85A 3MZ8A 3GLXA 1ZLKA 2H6BA 4XR6A 3HZJA 3HOXJ 3ZQIA 1A6QA 1AKHB 2BW3B 2BVMA 2ZSIB 2Y69H 1O3RA 3J7AY 2K7LA 3KYLA 4IZZA 2PJRB 3V7CA 1S72I 2KDZA 1BC8C 1EJ9A 4AU7A 5C4JJ 2VOOA 2HVQA 3W2VA 3K70C 1XMKA 2E1CA 1U9OA 2CG4A 4JBAA 2L2OA
chains in the Genus database with same CATH topology
1FOYA 5GAHJ 4V19K 3DLLF 5GAEJ 3CCJI 5GAGJ 1VQLI 3PIOF 3CCVI 3CMEI 2H8WA 3G6EI 3PIPF 1YJNI 2QA4I 2E35A 2ZJPF 3CJTB 3CCLI 2OTJI 3CCSI 1VQNI 3G71I 5DM7F 1HC8A 3CCEI 3CCQI 1YITI 1VQ7I 1VQPI 1FOXA 5JVGF 4IO9F 2QEXI 3CCUI 3J7ZI 2ZJRF 1VQ6I 3CCMI 3G4SI 1YI2I 2NXNB 1VQ9I 1QA6A 3I56I 1FOWA 1Y39A 3CD6I 2ZJQF 2K3FA 4IOAF 3J7YJ 3CCRI 1YIJI 1VQ8I 3CF5F 3CC7I 3CC4I 3I55I 3CC2I 1MMSA 4IOCF 1VQ5I 2JQ7A 2FOWA 1YJWI 3CMAI 1YJ9I 2E36A 2OTLI 1VQMI 4UY8I 1VQ4I 1S72I 1YHQI 5DM6F 2E34A 1VQOI 1ACIA 5GADJ 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOY A;  5GAH J;  4V19 K;  3DLL F;  5GAE J;  3CCJ I;  5GAG J;  1VQL I;  3PIO F;  3CCV I;  3CME I;  2H8W A;  3G6E I;  3PIP F;  1YJN I;  2QA4 I;  2E35 A;  2ZJP F;  3CJT B;  3CCL I;  2OTJ I;  3CCS I;  1VQN I;  3G71 I;  5DM7 F;  1HC8 A;  3CCE I;  3CCQ I;  1YIT I;  1VQ7 I;  1VQP I;  1FOX A;  5JVG F;  4IO9 F;  2QEX I;  3CCU I;  3J7Z I;  2ZJR F;  1VQ6 I;  3CCM I;  3G4S I;  1YI2 I;  2NXN B;  1VQ9 I;  1QA6 A;  3I56 I;  1FOW A;  1Y39 A;  3CD6 I;  2ZJQ F;  2K3F A;  4IOA F;  3J7Y J;  3CCR I;  1YIJ I;  1VQ8 I;  3CF5 F;  3CC7 I;  3CC4 I;  3I55 I;  3CC2 I;  1MMS A;  4IOC F;  1VQ5 I;  2JQ7 A;  2FOW A;  1YJW I;  3CMA I;  1YJ9 I;  2E36 A;  2OTL I;  1VQM I;  4UY8 I;  1VQ4 I;  1S72 I;  1YHQ I;  5DM6 F;  2E34 A;  1VQO I;  1ACI A;  5GAD J;  1VQK I; 
#chains in the Genus database with same CATH topology
 3QPL A;  1YS7 A;  3H36 A;  3SXY A;  1KQ9 A;  3I3L A;  1X4P A;  1KON A;  2G7H A;  3DPT A;  4PDK A;  5D8L B;  3FX3 A;  2BHZ A;  3W3C A;  1FBQ A;  5KNL A;  3DLL F;  3MQ0 A;  1DGW Y;  1E0E A;  2DPD A;  2QQ8 A;  3VYU B;  2JUG A;  1DGR M;  2L5Q A;  1R6R A;  3TOB A;  3VYT B;  2HFH A;  2DA5 A;  4HLY A;  3VDX A;  2Z16 A;  3EYY A;  4G7H F;  3HKZ N;  2B63 J;  3I9V 2;  5E1W A;  2JMW A;  3JRI A;  5E79 C;  3E0J B;  3GTO J;  3DBR B;  2L9R A;  3PNV A;  2DLL A;  4IHS A;  1WPK A;  3BP8 A;  3ASO H;  3CCS I;  5M5Y J;  3HOV J;  1S5L C;  1RKW A;  3G73 A;  1X3Z B;  3GZ6 A;  1R4M B;  2DO7 A;  4XN3 A;  2M7A A;  4IX7 A;  1IXS B;  2HNH A;  1OJL A;  3CCQ I;  2IT0 A;  1EA3 A;  5FRM A;  3OS0 A;  1FTT A;  2FU4 A;  3GUD A;  1TQM A;  2DMQ A;  1LVK A;  3G1L A;  4S04 A;  2P5L C;  4CDG A;  1VQ7 I;  1OYI A;  3VB2 A;  4LLG F;  4XOR A;  2VQL A;  4IO9 F;  5F08 A;  1X1C A;  4DW6 A;  3OYF A;  5HS7 A;  1RKT A;  5HDK A;  3TW7 A;  1OIS A;  2JA2 A;  2FML A;  1LJ9 A;  5FKK A;  1D0Z A;  1QNT A;  2DOE A;  4BEH B;  4D1Q A;  1IN8 A;  2X6W A;  3HPH A;  4XLP F;  1I6H J;  3FBI B;  2OCE A;  3BZC A;  1E17 A;  2ZSH B;  3E6B A;  2R7Q A;  2ETH A;  4BQQ A;  3TED A;  3WHB A;  2R5Z A;  3JRF A;  1I27 A;  2CUF A;  1RRJ A;  5D8K B;  1ULY A;  4XLN F;  3HBL A;  1YQA A;  1ETQ A;  2ZNY A;  3RQ4 A;  2P5V A;  1I1S A;  3DWL E;  4A3I J;  1ZG5 A;  4AVZ A;  1HKT A;  2M4K A;  2UUZ A;  1UZC A;  4I7H A;  2R5Z B;  1UHM A;  3FK7 A;  5FLX Z;  1UHS A;  3E97 A;  1S6L A;  3ZCO A;  1YJ9 I;  4IQJ A;  2XAG A;  1Z6T A;  2FQ4 A;  2UWM A;  1L0O C;  2Z5U A;  5CVU A;  1V5G A;  1U6G A;  4IRI A;  4NB5 A;  4N9I A;  3C2B A;  4GFB A;  3K6G A;  5AIP A;  3DFG A;  2B9S A;  1ETW A;  1I39 A;  5BOX A;  5FD6 A;  2LG4 A;  3S8P A;  1BW6 A;  2UXN A;  1C0W A;  2FRH A;  2RC4 A;  2WA0 A;  3TDU C;  4EEF G;  2BYV E;  3NAU A;  4Q48 A;  1D8J A;  1A5J A;  2KIU A;  2EZK A;  1R5H A;  1WH5 A;  2HU9 A;  5J4Y A;  4YIR X;  2CFO A;  2V9P A;  1P4A A;  3CUQ A;  3H9Q A;  3K4J A;  2P4W A;  4CCN A;  5HNF A;  1PVE A;  3NWS A;  3DEU A;  3CME I;  4I01 A;  4IHV A;  1W36 C;  3PFI A;  3U21 A;  2DMN A;  2R7Z J;  4RM2 A;  4PSW A;  4WXC A;  4BUP A;  4GGG A;  2JA8 J;  4ZTF A;  3BZ6 A;  5LHH A;  2CUJ A;  3S3O A;  1XC5 A;  3OOP A;  4OAZ A;  3FHZ A;  3QU6 A;  4F92 B;  1MJB A;  1GDT A;  2JSP A;  1Z7L A;  2GA1 A;  2VC1 A;  3CES A;  3C7J A;  2TRT A;  2XGD A;  3R4K A;  4QIW N;  2VUM J;  2CW7 A;  2KMU A;  4O5V A;  2X0L A;  1XMX A;  1PDN C;  2H1K A;  1Z21 A;  2ZME C;  4UXN A;  2HS5 A;  2MGQ A;  3WU0 A;  1JJ8 C;  4X0G A;  2XIG A;  2LR8 A;  2HXO A;  1QPI A;  5E1X A;  4BJ6 C;  3QPT A;  3ZQQ A;  3E1S A;  4RB0 A;  3S16 J;  1FSE A;  2A6H F;  3CCM I;  1JHH A;  1SVL A;  1R4N B;  1MW7 A;  4D5F A;  1OPC A;  1XX5 A;  2EA2 A;  4YG2 F;  2DMP A;  2EV5 A;  4P9F A;  3M1E A;  1T38 A;  1MH4 A;  4YEJ A;  5F6F A;  3CD6 I;  5LRR A;  3WTU C;  5GTI C;  3QP5 A;  5ICC A;  1XCB A;  5DCM A;  5B1A H;  3BCB A;  2J5O A;  3S3N A;  2DN0 A;  1PP7 U;  3LOC A;  2W1O A;  4EAT A;  2FOW A;  5EGO A;  4UUT A;  1F36 A;  2KL4 A;  4XLF A;  1K4S A;  2CW0 F;  5DCM B;  5DDG A;  4RB2 C;  4LIT A;  1Z9C A;  1QVT A;  2RN7 A;  3WTZ A;  3MKY B;  2IBD A;  4IHX A;  1JUS A;  5EGO B;  2DA6 A;  4II2 A;  3H92 A;  3ERE D;  3H3V K;  2DYS H;  3MWM A;  2LD5 A;  2KHM A;  2WTE A;  3HRM A;  2OQR A;  3W6K B;  3WTT C;  2OJE D;  3S15 J;  1IG7 A;  4Y4R A;  4FX4 A;  5IP7 J;  2X85 A;  1YS6 A;  2R7X A;  3JAM K;  1WJC A;  4KMF A;  1U5T C;  1WKM A;  3VSK A;  4Q47 A;  3IKT A;  1HLV A;  1IRF A;  5GAH J;  4CHU A;  4MGR A;  3CUO A;  2R7O A;  1LVA A;  1BBY A;  2ZC2 A;  5GAE J;  4MEX F;  2QQ9 A;  1MZB A;  2XGE A;  3D5L A;  3KP3 A;  3LA2 A;  4CH7 A;  1GVD A;  4XSX F;  4PSX A;  4XKC A;  2VPL A;  4BHP A;  2VBW A;  1Z77 A;  2M0M A;  4HA8 A;  2BZT A;  3FXQ A;  1OFC X;  3ZMS A;  4ESB A;  3HTU A;  1FMV A;  2E1M B;  2ID6 A;  2QVO A;  3LQQ A;  2M30 A;  2XF5 A;  4F91 B;  2KZV A;  4D7M A;  4UV8 A;  3S2W A;  4HV6 A;  1FWZ A;  1PJR A;  2DFF A;  1BA5 A;  1XGN A;  2JT1 A;  2JSC A;  3WHC A;  3NEU A;  3BPV A;  3CDI A;  3CCE I;  2L7Z A;  3HL2 A;  2FUG 2;  2COM A;  2L3D A;  3TGN A;  2D45 A;  2HVR A;  3J7A O;  3DKY A;  2ZFU A;  3JW4 A;  5GPC A;  1ON2 A;  3E6D A;  2LY1 A;  3R0A A;  2L7F P;  2HKO A;  4BGD A;  4CSW A;  1Z67 A;  4DBQ A;  1XB4 A;  1A35 A;  5EEH A;  5DEQ A;  1QZZ A;  2OCC H;  2LYC A;  1FC3 A;  2A05 A;  4NC6 A;  1USS A;  4XON A;  4BQN A;  1JI8 A;  3K4L A;  4KT5 C;  4L0Y B;  1B9N A;  2LTP A;  1EH8 A;  3QPS A;  3IWZ A;  1H89 C;  2CGP A;  4LB5 A;  1XG1 A;  4ZYG A;  2V79 A;  2XKP A;  2ZXH A;  1FOW A;  5FFZ A;  1X4O A;  4Y3O A;  3H5R A;  2D1H A;  3CC7 I;  4BY7 J;  4MTD A;  3BJA A;  2FBI A;  4EV0 A;  4ZDP A;  3WTW C;  4BAY A;  3KEO A;  3H5N A;  2X1C A;  1UST A;  4Q4Z F;  2R93 J;  4M3E A;  1KQ8 A;  3P9K A;  4A3M J;  1YJW I;  5EG0 A;  3HPG A;  1X19 A;  2OF7 A;  2DFE A;  3ABL H;  5FKN A;  2FJ1 A;  1QBJ A;  5LEJ A;  1DP3 A;  5FRN A;  2R7T A;  5FRO A;  3GVA A;  3K1P A;  2EIN H;  2XHK A;  2E7W A;  3QYF A;  2ZBK A;  3EQL F;  3ABM H;  5CQG A;  4KUM A;  1TQP A;  1XSV A;  4FET A;  4DYC A;  1Z91 A;  2OZ6 A;  2KLO A;  1GV5 A;  3MD2 A;  4MFD A;  4PZJ A;  4RA2 A;  4F55 A;  3MZH A;  2XVC A;  4M3D A;  2D5V A;  5FKO A;  3JRG A;  1QU3 A;  1LEB A;  2RRE A;  4RDU A;  2WAE A;  4U0Y A;  3OY9 A;  2MLK A;  2EFN A;  1MSE C;  1O57 A;  3S1Q J;  3HRT A;  2V1U A;  1XGO A;  5IYC J;  1LE8 A;  3OYK A;  3OYM A;  2FXA A;  1YX5 A;  2Z1D A;  3FXU A;  1REP C;  1Y1W J;  1Z3X A;  3A4C A;  3GTK J;  2VLA A;  2KPM A;  3KLN A;  1WVR A;  2P6S A;  5KVR A;  3I64 A;  4HW0 A;  1J7K A;  3IL2 A;  1GUU A;  5LFA A;  1AU7 A;  2VJJ A;  2G9W A;  2GIV A;  2R7U A;  4B3X A;  1T33 A;  4NUB A;  2K85 A;  3GF2 A;  5JFR A;  3HEF A;  1R1T A;  5CPR B;  3PIP F;  1HDD C;  1RUN A;  9ANT A;  1DU0 A;  3GTP J;  5GP9 A;  2DFH A;  3KIO A;  3CJT B;  4NQW A;  5EDN A;  1D0Y A;  5J1U A;  4CCK A;  3M07 A;  5K5O A;  1HW1 A;  1W7P A;  5K1Y A;  3H35 A;  1R5I D;  2W24 A;  2O9L A;  1RI7 A;  4ZDO A;  3WE2 A;  1HXD A;  2OZU A;  3Q9V A;  3MZY A;  1G4D A;  3DU5 A;  2L4A A;  1HC8 A;  4NQW B;  3ZQC A;  3CP2 A;  2W25 A;  2DFI A;  5LEK A;  1R36 A;  3DCF A;  1P4X A;  2FD5 A;  5IOZ A;  2DA7 A;  1QZY A;  2F5C A;  2FEZ A;  3ZXS A;  3UR3 C;  2EIJ H;  3TKY A;  3IH4 A;  4Y7N J;  1I50 J;  2NS8 A;  1ZK8 A;  3JRB A;  5M3M J;  4J19 A;  4UUS A;  3DV8 A;  3RIR A;  4OMY A;  2UXX A;  3PM1 A;  3DPU A;  2GXG A;  4ENJ A;  1BM9 A;  4X1E A;  2QGU A;  2HXI A;  3RPQ A;  2V9V A;  3KFW X;  1HOM A;  4E7H A;  4P96 A;  3KLO A;  4BDY A;  4BE1 A;  2CFX A;  4UUS B;  3E6C C;  3RSN A;  3AG1 H;  4BU2 A;  5C3E J;  4UVB A;  4CCO A;  4XNF A;  2X48 A;  4DNC A;  1CGP A;  1HCR A;  2V6C A;  3F8N A;  3L2W A;  2LKX A;  3LNQ A;  4OIN F;  3HHG A;  2F5V A;  2TCT A;  3ASN H;  2A69 F;  4GRI A;  3BDD A;  4E70 A;  1YIO A;  4OWR B;  4M3F A;  1J09 A;  5C44 J;  4V2G A;  1G3S A;  2VQG A;  2Y0M A;  3ABK H;  3CMM A;  5AON A;  1O4X A;  4I76 A;  2E34 A;  4HX7 A;  3E5X A;  1E3O C;  1ACI A;  1H9T A;  2CWE A;  2EV0 A;  2VI6 A;  4BL0 B;  3Q0V A;  3CZ6 A;  4KIS A;  1GT0 C;  2UV1 A;  2ZXJ A;  2NVQ J;  4EJW A;  5LRS A;  1HSJ A;  1XDU A;  1TC3 C;  2K3P A;  4XRS G;  5KAF C;  2RQQ A;  3WG7 H;  4WXH A;  4JP0 A;  3FMR A;  3CMY A;  3KX2 A;  2VJI A;  3FKI J;  4AVP A;  2WV0 A;  2LSO A;  3Q3S A;  3OYC A;  2JZY A;  5DD4 A;  5LHG A;  1ZRD A;  2OC6 A;  1OCP A;  1Q1H A;  2QA4 I;  4C2U A;  2VQH A;  4KYW A;  3U2R A;  3Q0W A;  1OMI A;  4I6Z A;  3F6V A;  3OYE A;  3ZRG A;  3NRV A;  3HSR A;  4M6X A;  1BL0 A;  3PUF A;  2YU3 A;  2R4G A;  4HAM A;  4KT6 A;  4E4H A;  3DP7 A;  3OL3 A;  3F8F A;  5JLX A;  2YR2 A;  4Q5S F;  2XDV A;  1WJE A;  4HF0 A;  1HA8 A;  3BWG A;  1YIT I;  3H3U A;  1WFX A;  1TNS A;  4PGG A;  3F23 A;  1LDK B;  4WF2 A;  4ABZ A;  3HYI A;  1B6A A;  4AM3 A;  1FOX A;  4A3J J;  3LSP A;  1UAA A;  5HS9 A;  2IGM A;  5BMZ A;  1IRZ A;  1HKQ A;  4HQE A;  1ITY A;  1U0J A;  3LSJ A;  1MMA A;  2ZME A;  3HRS A;  3J7Z I;  4BE0 A;  1SFX A;  4ETS A;  2K4B A;  2VL8 A;  1N75 A;  1RNL A;  2G7U A;  2JRT A;  4RGX A;  4ZYA A;  2ELJ A;  2CQN A;  3FMQ A;  3OL4 A;  2Y2Z A;  2ID3 A;  4UB8 C;  4RMN A;  1V54 H;  2XAH A;  3OMY A;  2ME6 A;  3FIS A;  2AXT C;  2XF6 A;  3QOD A;  2DU9 A;  2QF7 A;  5TIS C;  2ZME B;  4HF2 A;  3K4N A;  4IOA F;  2AS5 F;  1D3Y A;  4F3Q A;  3GEZ A;  1YIJ I;  2MH2 A;  2VN2 A;  3P7N A;  2LDU A;  1HW5 A;  4M3B A;  2JTV A;  2XUB A;  5LBQ A;  2GXB A;  4YFN F;  5FO5 A;  3ZQF A;  4XMY A;  4H0E A;  4L9V A;  1V55 H;  3FBN B;  2FNA A;  2IA0 A;  4JQF A;  3JRC A;  1Z3Y A;  2IGO A;  3GTJ J;  4KIC A;  1A6I A;  2G0E A;  4HX4 A;  1IN7 A;  3GCM A;  3K10 A;  4XKV A;  2GOX B;  2GQQ A;  4PJJ A;  2K86 A;  3H3Z A;  5K5R A;  1B8I A;  1IUF A;  2XAS A;  3NWT A;  5ICE A;  5E8G A;  3ZQH A;  5JI6 A;  3HIF A;  1R71 A;  1K61 A;  2VJ4 A;  3BQZ A;  3L1P A;  3DEW A;  3BG3 A;  3CO6 C;  3IAM 2;  1X1B A;  4DQ2 A;  1K83 J;  2BXY A;  3BR6 A;  3M8E A;  4JX6 A;  5D5W B;  1XS9 A;  2LMD A;  2DK8 A;  4XOP A;  2FQ3 A;  2BW3 A;  4IVN A;  2W7N A;  1B8I B;  3DPL C;  4D7N A;  2LRE A;  1E3P A;  4G12 A;  4Y17 A;  4BKX A;  4B09 A;  2QCO A;  2YX7 A;  3DBL B;  1U5T A;  2HZD A;  4BHC A;  4CCJ A;  2VBZ A;  4KFC A;  2LLK A;  4D0P A;  5K5Q A;  4OU0 A;  5M3F J;  3N97 A;  3V8L A;  1JXS A;  4GCV A;  3MFK A;  5J47 A;  5D5U B;  3B6A A;  1IN6 A;  1SAU A;  1U5T B;  3TO6 A;  3MCZ A;  2E1O A;  3TO7 A;  1SEU A;  2DJI A;  2B0L A;  1FLI A;  2H6C A;  2FSW A;  1IO2 A;  3IC7 A;  2VXD A;  3CTA A;  2YU9 J;  2PEX A;  1YOV B;  4ZYE A;  3HGY A;  2GOM A;  4A5M A;  3PNT A;  2E19 A;  2A68 F;  4BQO A;  1XPX A;  2CYY A;  2EA4 A;  3A01 A;  2L7K A;  1J0R A;  2RQP A;  3GTL J;  1BOA A;  4P55 A;  1ON1 A;  5E20 A;  3J80 K;  3G3Z A;  4L9N A;  2LNB A;  1LFP A;  3QWL A;  2HPI A;  2ZB9 A;  2AHQ A;  1TQI A;  4ENM A;  1DUX C;  2V6E A;  1XSX A;  3A01 B;  3QYE A;  3FDY A;  4BH9 A;  1YW9 A;  2PJP A;  5F04 A;  4XRF A;  5KCM A;  1VQ9 I;  5DS9 A;  1D1A A;  3ZP5 A;  1U3E M;  3OOU A;  5E3N A;  2VPR A;  3N4M A;  2P6T A;  4RAY A;  1VQ8 I;  4OIQ F;  4BEH A;  3SDB A;  3RTR A;  3L2R A;  1FBU A;  4A0Y A;  2VE9 A;  5KK1 A;  1JT0 A;  2HDW A;  3FXJ A;  3RYR A;  1JT6 A;  1GVJ A;  2MA3 A;  1TW2 A;  1E3H A;  2R7F A;  4II3 A;  4FTH A;  1OCZ H;  3M9A A;  4MO7 A;  3FIW A;  3RZO J;  5IYD J;  2IXS A;  2W00 A;  4HDU A;  2A5Y B;  3TMO A;  1HQC A;  3JTG A;  2NAZ A;  4M72 A;  2R7W A;  2V1N A;  1MMG A;  4G6D A;  2XC7 A;  3RKY A;  2XB5 A;  2CS3 A;  1Y56 A;  4RGS A;  2P7V B;  2DOF A;  2ZO4 A;  3AAF A;  5F0H A;  1MJA A;  4G9Y A;  1VQK I;  1ZGJ A;  2WAQ A;  2A6T A;  2VOP A;  3A1Y A;  2A07 F;  1SAX A;  3AG2 H;  3SHF A;  1MH3 A;  4A6E A;  1K6Y A;  4A3G J;  1T6S A;  2BV6 A;  2NVY J;  3GWZ A;  3C1D A;  3M7G A;  3BG9 A;  5ILV A;  2A3S A;  4LLN A;  3L2U A;  5TGT A;  2O8K A;  3JSO A;  3SZT A;  1Y0N A;  5D5V B;  3OYN A;  2DMT A;  4N4N B;  2H8W A;  1GLN A;  1T98 A;  2K9N A;  3HSF A;  1KA8 A;  1QZE A;  1XSD A;  4IF4 A;  4M73 A;  3ZQ7 A;  3RKX A;  1G2H A;  3ZMZ A;  3M8F A;  2GIZ A;  2I10 A;  1ETK A;  2LKS A;  2M4G A;  3QP6 A;  3KZZ A;  2XSJ C;  1KZH A;  1MBG A;  1VQN I;  5DM7 F;  1FP1 D;  1GXQ A;  3QAH A;  4FT8 A;  5EEG A;  1MDM A;  4HNU A;  3RPU A;  3QU3 A;  3J81 K;  3HJE A;  2QM3 A;  2QSH X;  2MD5 A;  2TDX A;  2KRF A;  5F27 A;  4RAG A;  1SD4 A;  1Y1V J;  1KGS A;  5B3S H;  1X1A A;  2LF7 A;  2EH3 A;  3S93 A;  4PJN A;  2UZK A;  2BHY A;  1DPR A;  3OIP A;  1MDM B;  3KEQ A;  3DTI A;  2F5F A;  1OCR H;  5H2F C;  2CUE A;  3CCY A;  2VAS A;  4R8H A;  1PP8 F;  3OIO A;  3F0C A;  1AWC A;  3T1B A;  1D5Y A;  2E71 A;  1SD5 A;  1BI2 A;  1BR2 A;  3G1M A;  1SMY F;  2B7E A;  2H94 A;  1Z7U A;  1SD7 A;  3U1K A;  3JAM Z;  1FY7 A;  4CA0 A;  1X2N A;  4D9J A;  3E7L A;  1T2K A;  3PO3 J;  5CJ9 A;  4M9X A;  1W4M A;  2BY2 A;  1S3J A;  2O03 A;  4PFP A;  3VEP A;  3RYP A;  3HOY J;  4G6Q A;  1BR4 A;  1T0F C;  4FIS A;  3GFJ A;  3S1M J;  1ZTR A;  5IOY A;  3EYI A;  3LAP A;  2VBX A;  1VI0 A;  2W84 A;  3ABU A;  4F52 A;  1SAN A;  1IV6 A;  1HKS A;  1YX3 A;  2ME0 A;  4LK0 F;  3PSF A;  2FOK A;  2QYO A;  4UY8 I;  1IZ1 A;  2PMZ A;  1IF1 A;  2VQC A;  2DA1 A;  2FF4 A;  2Q1Z B;  1D1C A;  1PYV A;  4XLH A;  3QRF F;  1JTX A;  4E7S A;  3MEX A;  1EH7 A;  1IGN A;  2K5C A;  3IHU A;  1XN7 A;  2X6Y A;  4EM2 A;  4E6K G;  3A0B C;  1F1Z A;  1UCR A;  1I5Z A;  2MW8 A;  1TT5 B;  2EPF A;  4JX5 A;  5L3G A;  1B59 A;  1FOY A;  2CW8 A;  1SFO J;  1APL C;  2MD0 A;  2QEN A;  3FM5 A;  3ZPL A;  2EFO A;  4A12 A;  2DT5 A;  4V19 K;  1ZHF A;  3IH2 A;  3CCJ I;  4HRI A;  2NVT J;  4GYI A;  4W97 A;  3COA C;  2HTJ A;  1NH3 A;  1R49 A;  1I3Q J;  2OQG A;  5FGM A;  4K2E A;  3FMS A;  4XIC A;  3EPZ A;  4LJZ F;  2RV8 A;  4LG3 A;  3AFH A;  2V4J C;  4RLQ A;  3SZG A;  2ZJP F;  3GTG J;  5E1Z B;  3ELK A;  2Q8K A;  2F48 A;  1TLH B;  3C18 A;  4XM3 A;  1VTN C;  2E2J J;  4ZDL A;  1KYZ A;  2DAO A;  2L9S A;  3H5A A;  1U78 A;  3VYS B;  2Q0O A;  2JWT A;  3I71 A;  4V2F A;  3G71 I;  4OIO F;  5CVI A;  1FP2 A;  2K02 A;  6PAX A;  2ADU A;  1YE9 A;  1Y8R B;  5JHF A;  5HDN A;  3GO5 A;  3RQI A;  3U9G A;  4DGW B;  4KIT B;  2CUZ A;  1FYK A;  1G59 A;  1Y8Q B;  2BGC A;  2EQR A;  3H0D A;  1VQP I;  5GTH C;  1BI0 A;  2L02 A;  5BQT A;  1NTC A;  2KRC A;  2QBY A;  1ZG3 A;  3ZGK A;  2IS4 A;  2VOD A;  4MHG A;  2DW4 A;  2IAI A;  2K9S A;  2HYG D;  2NXN B;  1TW3 A;  1R7J A;  2PMU A;  1BI3 A;  5HLG A;  4BXX J;  2XB0 X;  2XSD C;  1YRN B;  1TP4 A;  4U0V A;  2M0C A;  2QKL B;  5EZG A;  2QBY B;  4CGZ A;  5KAI C;  2HQR A;  1XMA A;  1WJA A;  4ZC3 A;  3EUH A;  2VIX A;  1O3Q A;  2YUS A;  1MBK A;  5DUK A;  2QLZ A;  4DJA A;  1IJW C;  3MMY B;  3PJR A;  3KZY A;  2HVS A;  5JHU A;  1ODD A;  5F0C A;  2ZJ2 A;  1JGS A;  3LSG A;  1B4A A;  2HKX A;  2D2W A;  5IT3 A;  1K4T A;  3CF2 A;  3GTM J;  5IT9 K;  2E36 A;  2ISY A;  3S14 J;  2LK2 A;  2DI3 A;  2LOO A;  1BR1 A;  2VT2 A;  1MJ9 A;  3ZOB A;  3L2Q A;  4HPQ A;  4MNU A;  1UHW A;  2DDB A;  1HW2 A;  3CJN A;  2AXL A;  5E3M A;  3BR1 A;  3HSE A;  3LQR A;  5J3L A;  5D5X B;  1UG2 A;  3OWT A;  3WTS C;  2JK3 A;  3RZD J;  3AL0 C;  4MLO A;  1R22 A;  1RES A;  1UFM A;  3JSP A;  2MG4 A;  2KZG A;  5CQE A;  3EUA A;  1BIB A;  4JOM A;  2Z33 A;  2P81 A;  4A2U A;  1KU9 A;  3GXO A;  3ZMD A;  1LDD A;  1ETO A;  1MND A;  2M8E A;  4ANJ A;  1GHC A;  3BG6 A;  1V5E A;  3IV5 A;  2O7O A;  3E5Q A;  2IPQ X;  3W2W A;  4XID A;  1E2X A;  4ZYH A;  1ZR2 A;  5IY5 H;  3SZP A;  3I4M J;  1S7O A;  4E7I A;  3PL8 A;  2DYR H;  1YJN I;  1AA7 A;  3OYJ A;  1WJD A;  3FM3 A;  3OYD A;  3M4O J;  1ZRC A;  1BI1 A;  5JLW A;  2L01 A;  3HOW J;  3JCU C;  1FMW A;  3DQV C;  4U87 A;  4RGU A;  1K78 A;  1N25 A;  4G6T B;  1TWC J;  3K69 A;  3KP7 A;  3ML6 A;  1IDY A;  4BNC A;  3O3K A;  2IP2 A;  3PUB A;  3CLO A;  2HQA A;  4LG0 A;  1RC9 A;  3BTI A;  4KNY A;  4UB6 C;  2KIS A;  4DOZ A;  3IP4 B;  1K78 B;  3K70 D;  1FT9 A;  4WXD A;  4PFO A;  2KT0 A;  1TTY A;  2WAQ N;  4AID A;  3OS1 A;  3K4M A;  3CCU I;  1IAW A;  5J1Y A;  4ZZL A;  2VXZ A;  4HNT A;  5A2Q Z;  4LG0 B;  1FSH A;  2Y9Y A;  1MKM A;  2HWV A;  4XRS A;  2ISZ A;  2KRH A;  1ZRE A;  4OAY A;  2STW A;  1SVM A;  1LQ1 A;  1QA6 A;  5BPD A;  2JN6 A;  5K7F A;  1KYW A;  1W7P D;  1QO0 D;  1WQ2 A;  2K3F A;  4L9T A;  3J7Y J;  3CLQ A;  3CC2 I;  2ECC A;  2KQR A;  1T08 B;  3CJQ B;  4YFX F;  1FPQ A;  2QZ8 A;  4EVI A;  3A0H C;  3REO A;  2ZNZ A;  5IP9 J;  2LVS A;  3S17 J;  1ORK A;  5JVT A;  3A03 A;  3C2H A;  2OTL I;  2L0K A;  2HZT A;  4E7L A;  1J75 A;  1UG0 A;  1WJF A;  1U2W A;  2F5E A;  3B02 A;  5ERI A;  3PNY A;  1MIJ A;  3I59 A;  4EJO A;  2OU2 A;  1FNN A;  2IGN A;  1X2M A;  4TV7 A;  3PQK A;  3V7S A;  4P9U A;  1CQT A;  3F8M A;  3CDH A;  3DKW A;  2EFQ A;  2Y75 A;  3RKW A;  1LEA A;  3DEE A;  2PX9 A;  1ETV A;  4XKW A;  4L9J A;  3FHN A;  2VON A;  3UKG A;  5K7Z A;  4A3B J;  3LWF A;  3I59 B;  3SEQ A;  2ZKZ A;  5C4X J;  3OS2 A;  3IWF A;  1UB9 A;  1QVU A;  2Y48 A;  3GTQ J;  3BPX A;  1HF0 A;  2JA5 J;  2X4H A;  3H9G A;  1JKR C;  4FX0 A;  4CO8 A;  4M9Z A;  5GAG J;  4BYY A;  1ZLJ A;  2LRD A;  3LMM A;  3MKW B;  2IS6 A;  1MGT A;  3PIO F;  5A2Q K;  1YFH A;  3MAJ A;  4C3H J;  3OV8 A;  1TWA J;  3LSI A;  2M3A A;  3N05 A;  5DD8 A;  1ZYR F;  2E35 A;  5HLH A;  3BR0 A;  3GZN B;  2BY0 A;  2M87 A;  2LBF A;  4DBR A;  3SFZ A;  1S7E A;  5E8I A;  1SMT A;  5EF6 A;  1H0M A;  3KET A;  4AC0 A;  3BRO A;  3RCO A;  2PMZ N;  1NK3 P;  1ZEL A;  2P8T A;  1WCM J;  2Z9O A;  2LBF B;  3HTS B;  1FEX A;  1W5S A;  4FE4 A;  4U0W A;  4A6D A;  3S2H J;  2K27 A;  4H4K C;  2DOA A;  3FXK A;  3L00 A;  4RB1 A;  4O6J A;  1O3S A;  3F3X A;  5LHI A;  2KIF A;  2HTS A;  4E7Z A;  4I2O A;  1IW7 F;  4IJA A;  1SVO A;  3CJR B;  4D5C A;  4AYB N;  4WX9 A;  4RAF A;  3BCA A;  4P5O A;  5H20 A;  1TBX A;  5DTD A;  3G4S I;  4QWQ A;  4XRM A;  1YI2 I;  3I5U A;  5BPI A;  3V4G A;  1ENH A;  4M9S A;  5E17 F;  1W5T A;  2ESN A;  1FIP A;  4A3L J;  1EKE A;  2EZH A;  4HV5 A;  4EJV A;  1W36 D;  4HLX A;  1WHU A;  5HNH A;  3BR3 A;  2CH0 A;  4ENN A;  3RJP A;  1OR7 C;  4G7Z F;  4XLE A;  4L18 B;  2RGV A;  4HST A;  1GXP A;  1G3T A;  3I54 A;  2D1V A;  3LA3 A;  5FFX A;  3IAS 2;  3CMA I;  4ZJZ A;  2KDO A;  5M5X J;  2IA1 A;  3P5J A;  2QQB A;  5HOD A;  2MFZ A;  2JPC A;  1T0F A;  2HQ5 A;  2F2E A;  2ZXI A;  3EUH C;  1STZ A;  2N8G A;  1SFE A;  3K4B A;  5F1R A;  4IHY A;  3ZMT A;  3T8R A;  2A6E F;  2PMH A;  1P9Q C;  4A3C J;  3BZK A;  4YII A;  4BS9 A;  1LDJ A;  1R23 A;  2M9H A;  3F8C A;  1YLF A;  1V5F A;  2XGX A;  5HOO A;  4YFK F;  2RNJ A;  3EDP A;  2KJB A;  3P9C A;  4YIF A;  2HDC A;  1ERD A;  2DQL A;  3L2V A;  3T8T A;  3LST A;  2H09 A;  2ICW G;  5ED4 A;  3GX4 X;  2Y0S N;  5EEA A;  2ELH A;  2KIM A;  4IHW A;  3KYD B;  2GBY A;  4FHT A;  3GFL A;  3TP0 A;  4MIM A;  1QGP A;  3A02 A;  3J80 Z;  2A5W A;  1JKP C;  4M74 A;  1JUP A;  4UHT A;  1IN4 A;  2F4M B;  4UUV A;  4BXU A;  4AUX A;  3BJ6 A;  3CCV I;  3D1N I;  4A69 C;  3A2K A;  2BY1 A;  1POG A;  2EZI A;  4PUS A;  1O7F A;  3V42 A;  2JA6 J;  2L9N A;  2W4S A;  4O3M A;  2W57 A;  4XLA A;  2IW5 A;  4FQG A;  3V8K A;  3VOE A;  2XKO A;  2V26 A;  2PFB A;  3CCL I;  3VWB A;  3IH3 A;  4KDP A;  3E6M A;  3TL4 X;  2JA7 J;  3M3Y J;  4KMU X;  1JGG A;  5CVJ A;  3O8G A;  4G94 A;  4LB6 B;  2IJL A;  3JTH A;  4EGY A;  4LIU A;  3Q5F A;  1LKX A;  3LSM A;  4DZJ A;  3O6B B;  2CRG A;  1B9M A;  3TOA A;  3C3W A;  2O0Y A;  4FE7 A;  2IVM A;  5KHD A;  5FLV A;  5JVG F;  3IKV A;  5CVV A;  1DPU A;  1VZ0 A;  4GDF A;  3I0T A;  4HQM A;  2STT A;  2KKO A;  2MC4 A;  1BIA A;  2JPB A;  1IRG A;  3BR2 A;  2NYX A;  3K2A A;  1JKO C;  1GV2 A;  4P1W A;  1TWF J;  3H0G J;  4U7B A;  4A3E J;  2EV6 A;  2HYJ A;  2K9M A;  4HOB A;  4IXA A;  3OYH A;  4KJZ A;  4CZZ A;  2ZCW A;  4RBO A;  4BQA A;  4XK4 A;  5EZH A;  1FYM A;  2XPV A;  3CC4 I;  1X3U A;  4IOC F;  3K4C A;  3QOP A;  4EQQ A;  1NK2 P;  2M8G X;  1F9N A;  4MTE A;  4J01 A;  3O2P E;  2DA3 A;  4QTR A;  4B47 A;  2YS9 A;  4LFU A;  4KN4 X;  3QQA A;  3KCC A;  3LL7 A;  4M6V A;  4EM0 B;  1NG6 A;  3ZMV A;  4A93 J;  3K4K A;  4L5E A;  3ROU A;  3IUO A;  2C6Y A;  2M34 A;  4BHB A;  2R7S A;  3CO7 C;  2DK5 A;  4G8X A;  1FYL A;  1XGM A;  2OV7 A;  2VE8 A;  1V4R A;  1WWX A;  2BY3 A;  5LGN A;  2COB A;  2OAZ A;  4HDV A;  5LGT A;  2X1D A;  3F21 A;  1B72 A;  1VQO I;  2P7C B;  4L0Z B;  4HX8 A;  5DCF A;  2XAQ A;  2NS7 A;  2CU7 A;  3MKL A;  1JKQ C;  1A36 A;  1JTY A;  4XL9 A;  5FLM J;  1ZAR A;  1U8B A;  2VKE A;  4RGR A;  3VOD A;  4LD5 A;  3J81 Z;  1QQI A;  3KP2 A;  5FKL A;  1F5T A;  1B72 B;  3ZQG A;  1DDN A;  4DYQ A;  2F4I A;  4PK4 A;  4C9Y A;  1D8K A;  4CYD A;  4C3I J;  4M6Y A;  1ZG1 A;  2H1L A;  5FD5 A;  3HC7 A;  5LD2 C;  2KIQ A;  4HG2 A;  3HG9 A;  3C2G A;  3DTE A;  5FJ8 J;  2FNP A;  2CO5 A;  3Q9S A;  4DZP A;  2MH9 A;  3ONQ A;  2AQE A;  3AL0 B;  1P7I A;  5F1J A;  3M1C A;  1JUM A;  2L7M P;  3DU6 A;  4I0B A;  1JHF A;  1J9I A;  3MVP A;  1OCO H;  4NBQ A;  5GPA A;  1U8R A;  2DPU A;  3R60 A;  3FK6 A;  2OTJ I;  2MSY A;  2F4O B;  1D0X A;  1R5G A;  3CP8 A;  4R1H A;  2M7B A;  3P9I A;  1RET A;  2GXA A;  2GZW A;  4LLL A;  4KA4 A;  1Z6R A;  4RLF A;  1FZP B;  3TO9 A;  2L9V A;  2E2I J;  2DT6 A;  4B8X A;  1G8X A;  2PI0 A;  4IKF A;  2XRO A;  4HNV A;  4MEY F;  4PJM A;  4Y13 A;  2Y30 A;  3F9K A;  3W2A A;  2ESH A;  1QPM A;  3ZR8 X;  3JR9 A;  4A3K J;  3F22 A;  1MSF C;  4AD9 A;  1N78 A;  4RB3 C;  1ONV A;  3K0L A;  3DTK A;  3OSF A;  2HEO A;  3CDL A;  1H8A C;  3TQN A;  3TBI A;  3WOD F;  1UEL B;  2O8X A;  2DBB A;  4DYR A;  4BJ5 C;  2CV1 A;  2O5R A;  2WB1 N;  4YEL A;  4S05 A;  5AIQ A;  1WSU A;  3PSI A;  4DIQ A;  3HXL A;  5F64 A;  2JRM A;  5J4V A;  3HOZ J;  4BJT A;  2XAU A;  2ELK A;  1P6R A;  2VKD A;  1ZQ3 P;  2Y9Z A;  4QSH A;  3CF5 F;  2EIM H;  4NC7 A;  2E7X A;  4ESJ A;  1S8N A;  2F5D A;  3KP6 A;  1RR7 A;  1VQ5 I;  3BTC A;  4L5I A;  5LLQ A;  2DA2 A;  4A5N A;  2Z3Y A;  3OYL A;  4MQV A;  4MFE A;  4BBR J;  3QYB A;  5D6F A;  4BXF A;  3RPU D;  4XQF A;  3GFI A;  1WI3 A;  3VFZ A;  2KP6 A;  3M8J A;  4IRH A;  4OIR F;  2VC0 A;  2X6O A;  4ZTJ A;  1T39 A;  3HUG A;  2MYS A;  4B4C A;  1FTZ A;  1A04 A;  1XGS A;  1MBF A;  2CJJ A;  5ILS A;  1VQ4 I;  1R1V A;  4XBF A;  1X1P A;  3JRA A;  3CUQ B;  2Z2S B;  4QPO A;  1M1E B;  4Y15 A;  1HDP A;  2EIK H;  2LP0 A;  3HUG B;  2JVH A;  1W0T A;  2YSR A;  4I98 B;  4N0B A;  3CQZ J;  1WH7 A;  1H9G A;  2M45 A;  4B43 A;  1YTY A;  3H9J A;  2IEK A;  1FBS A;  1XCV A;  4I09 A;  3WG9 A;  4QLC U;  2XPU A;  1JE8 A;  1RZ4 A;  2I5U A;  1BJZ A;  3RDI A;  1X3W B;  4GXO A;  5FLX K;  1YW8 A;  3BTJ A;  3DBH B;  4ON0 A;  1O7L A;  2DCE A;  4EJU A;  4B3A A;  3G6E I;  4KIG A;  2V7F A;  3DXJ F;  2X6X A;  2EZL A;  1ETY A;  3JRE A;  4L5J A;  3OYA A;  2M2E A;  2CQX A;  4JYK A;  2R7D A;  1XDS A;  4RAZ A;  1Z1D A;  5HLT A;  2X1E A;  4A0X A;  4AYB A;  1ZGA A;  3GLL A;  4HSR A;  2DT7 B;  3ABT A;  1MBJ A;  3LSR A;  4CCM A;  3D5R C;  2HQN A;  4F7Z A;  2IA2 A;  3HOS A;  2MAB A;  1K6O A;  5DYM A;  2HOE A;  3EUK L;  2LFB A;  1I3A A;  3HRU A;  2IGK A;  3WGH A;  3K2Z A;  5HDG A;  1TNT A;  3ZMU A;  1W5C C;  2HR3 A;  1KU2 A;  3OR2 C;  2R5Y A;  3VYR B;  2RAE A;  5IT9 Z;  1D1B A;  1IXC A;  3BTL A;  3HOU J;  2R0Q C;  4G7O F;  3I58 A;  1ETX A;  1DP7 P;  2XAF A;  1MD0 A;  4WK8 F;  4BBS J;  4C2T A;  1U9N A;  2E60 A;  3WTY C;  1IC8 A;  4MQ9 F;  2R5Y B;  2DTR A;  2DXI A;  4I02 A;  2OA4 A;  2RNG A;  2R3S A;  1W0U A;  2WWY A;  3DLA A;  1YW7 A;  1D5V A;  4A3D J;  1WZ2 A;  1F43 A;  1VF9 A;  3ESW B;  3L09 A;  4KN7 X;  3OYI A;  1Y39 A;  3DKX A;  4CIC A;  3JRD A;  3CCR I;  2O61 A;  2CV0 A;  2Z99 A;  4EGZ A;  1MMS A;  2DJN A;  4BAC A;  1R1U A;  1UMQ A;  5B66 C;  1PUF A;  1PUE E;  2WBM A;  1YRN A;  2V1X A;  4NC8 A;  3HB9 A;  4PJL A;  4B48 A;  4BE2 A;  1P4W A;  1OR7 A;  5CYV A;  2XF7 A;  3SEZ A;  4UVA A;  1LNW A;  2Y0S A;  5B5E C;  4IQ4 A;  4ESF A;  4OIP F;  1S29 A;  1MBH A;  1PUF B;  4XN0 A;  4C3J J;  4BDZ A;  1AOY A;  3G2B A;  1HBX G;  4Z2Y A;  2PQ8 A;  3TDZ C;  2FE3 A;  1YHQ I;  4OMZ A;  3HHH A;  4EM1 A;  2DQR A;  1IDZ A;  2V1D A;  2GWR A;  4UV9 A;  4IRG A;  3HGG A;  3UNG C;  2CV2 A;  3I4N J;  1TT0 A;  2VB6 A;  3L2C A;  1ZN2 A;  3L7W A;  2NVU B;  2P0W A;  3OR1 C;  2VJ5 A;  4N9H A;  1Y0U A;  4PJ0 C;  1K7A A;  1LFU P;  2EBI A;  3KP5 A;  1NG7 A;  2YX4 A;  3K7A J;  4S0H B;  4AIK A;  3F8B A;  4LK1 F;  1B1B A;  3R61 A;  5FKM A;  4NDL A;  2XGC A;  3BLY A;  1MMN A;  1DU6 A;  3V7R A;  1BC7 C;  2QSF X;  1IV8 A;  5DUI A;  4RS8 A;  4RM3 A;  2P5K A;  3SYT A;  4J00 A;  2IS2 A;  1P92 A;  2L4M A;  2AQF A;  2DOD A;  3FF5 A;  2DA4 A;  1NHA A;  4AIJ A;  3AG4 H;  1LB2 A;  2R7V A;  3I4P A;  3WTX C;  1N77 A;  1IN5 A;  2IS1 A;  3WTV C;  3T5X A;  4E7J A;  2GLO A;  2JUC A;  2K40 A;  1MNE A;  3W6V A;  4F93 B;  4UVC A;  2L54 A;  3O8H A;  3WGG A;  1OCT C;  1K79 A;  3BG5 A;  2HI3 A;  2EFP A;  1AHD P;  3HDD A;  3Q0U A;  1YG2 A;  2OPT A;  1S7A A;  2RVC A;  3ZN0 A;  4B1R A;  5FB2 A;  2EFW A;  1KU7 A;  1IUY A;  1X58 A;  5IPA A;  4LOC A;  1VQ6 I;  4HYE A;  4ZH4 F;  1OKR A;  3B6C A;  4R79 A;  2Y31 A;  5HLI A;  2M1B A;  2QKM B;  3VPR A;  4M71 A;  4Z6Y A;  2HYF A;  3BOQ A;  2WY8 Q;  5EG0 B;  3KP4 A;  1QHH D;  3DF8 A;  2ZJQ F;  4LMY A;  2BE5 F;  1F4K A;  2K9L A;  3E3V A;  3QPH A;  5BNG A;  3OYB A;  2E5Z A;  2WV1 A;  3LA7 A;  4C2M J;  4WWC A;  1FJL A;  2PLY A;  3HKZ A;  4HF1 A;  4U7D A;  4YRV A;  1EV7 A;  3V8J A;  1UJ8 A;  1EF4 A;  3IRQ A;  2NS0 A;  2WC2 A;  2A61 A;  3L9F A;  1T95 A;  4QPQ A;  2BBY A;  3IRR A;  3K1N A;  1EH6 A;  2OBP A;  2CQ7 A;  4C30 A;  5F0F A;  1LE8 B;  1DQU A;  4OOI A;  2EWN A;  3BT9 A;  2J5P A;  5HVQ C;  2BVL A;  2VKH A;  1WJB A;  4W1U A;  2R92 J;  4FCY A;  2LF8 A;  1HST A;  2LC2 A;  2VKV A;  3SFI A;  4B44 A;  1YO5 C;  5J1R A;  5DM6 F;  5M5W J;  2EJR A;  4ENK A;  3HM5 A;  4NHJ A;  1XTA A;  1VFC A;  5GAD J;  4Y52 J;  3CUQ C;  2GA2 A;  2HOT A;  2K4J A;  3I53 A;  5ICF A;  1SFK A;  3ECH A;  3FKJ A;  1S9H A;  2H27 A;  3WU2 C;  3ZN1 A;  1TL8 A;  3FXR A;  1W7P B;  2FBK A;  3WU1 B;  3GZ5 A;  1CF7 A;  2LY9 A;  3FXO A;  1Z05 A;  2KFD A;  2VT3 A;  2OD5 A;  2JJ7 A;  5DV5 A;  2PG4 A;  2CMP A;  4X6A J;  4U88 A;  1X1D A;  2X51 A;  3E5U A;  2NVX J;  4PGH A;  3FZV A;  2EK5 A;  2V9K A;  1T8I A;  3S2D J;  5IP6 A;  2K9Q A;  1O3T A;  1CF7 B;  2XRN A;  2M5W A;  3OIQ A;  2O6G E;  5L3D A;  3NQO A;  1FIA A;  2HOS A;  1Y6I A;  2WB1 A;  2ZXW H;  4PCQ A;  5ILU A;  2MC3 A;  5CLS A;  3U1D A;  4UNO A;  3LSK A;  1WRJ A;  1MNM C;  5J8F A;  2CQK A;  2XPW A;  3FWE A;  5L3B A;  1I6X A;  4HBL A;  2MLG A;  4ZYD A;  3GME A;  5JR3 A;  2DTZ A;  3OYG A;  1OYW A;  3F6O A;  2YPR A;  4XSZ F;  1G3Y A;  1BJA A;  1TWG J;  1ZR4 A;  3VSL A;  2WAF A;  2JVG A;  2E1N A;  4E7K A;  3FXM A;  1P7J A;  1H88 C;  1LPQ A;  3K9T A;  2WY7 Q;  5CKT A;  2ZJR F;  2O3F A;  3B73 A;  1V3F A;  3BJO A;  2GAU A;  1G6N A;  2EIL H;  1OCC H;  3D5S C;  5E18 F;  2XAJ A;  1WI9 A;  2E2H J;  3SQN A;  1MMD A;  5J40 A;  4M3G A;  2OUM A;  1RUO A;  2CQQ A;  4EMS A;  5CVR A;  1QRY A;  2FX0 A;  4IEJ A;  2QWW A;  4CUG A;  1I1G A;  1LUJ B;  3ECO A;  5EJC A;  4I99 C;  3RKQ A;  3T0Y A;  1ZGW A;  3W6J B;  2JQ7 A;  3R0J A;  5TJJ A;  1OQY A;  2ZFW A;  5E3L A;  1R9T J;  3WE3 A;  3BG7 A;  4NNJ A;  2XV4 S;  1TWH J;  5L3C A;  4CXF A;  1RIO H;  3HOT A;  1L3L A;  2KJC A;  3BY6 A;  3R6S A;  2QUF A;  4CZC A;  1KQ0 A;  2W82 A;  5H6Q A;  3S1R J;  3JRH A;  2ECB A;  3MN2 A;  4IHT A;  3D0S A;  1ZH5 A;  2MBF A;  1VQM I;  2PBI A;  5K7H A;  3S3M A;  5TRD A;  1P2F A;  3ERM A;  4ZZD A;  3TW6 A;  3ISP A;  2CSO A;  4CCL A;  3KYC B;  3OSG A;  1OYY A;  2EB7 A;  1BW5 A;  2H8R A;  3ZQL A;  1W1W E;  2NNY A;  4Y33 A;  2FBH A;  1G3W A;  4XOT A;  3S1N J;  2NNN A;  4XLC A;  2FA5 A;  2BXZ A;  4JK1 X;  1BOB A;  5HS8 A;  4BY1 J;  3H1C A;  2HOA A;  1ZAO A;  1FOK A;  2GM4 A;  4KIB A;  2E1M C;  2PN6 A;  4A3F J;  3BC8 A;  1JJ6 C;  1YYV A;  1J59 A;  2I8D A;  5H6R A;  2WAD A;  3GFM A;  2E5N A;  3LFU A;  3MKZ A;  4I0A A;  1VQL I;  4CYC A;  1R58 A;  2BOL A;  2QQA A;  3KZI C;  1Q1V A;  3KPH A;  5ICG A;  3S32 A;  4N4O B;  5J8C A;  3LAJ A;  2X9D A;  5D4S A;  2F6C A;  5EYR A;  3GYH X;  2LH9 A;  1SD6 A;  4JX4 A;  5IYB J;  1LFB A;  5J6X A;  3G1O A;  4CYC B;  3AKZ A;  2NRA C;  5L3E A;  4FAS D;  2Q2E A;  4LGW A;  2DDA A;  2XRL A;  3ULQ B;  2RDP A;  1J5Y A;  4AWX B;  2BEO A;  3GW2 A;  4IL6 C;  4WCG A;  5B1B H;  2R7R A;  3BQY A;  5LGU A;  3SJM A;  1RR8 C;  3FXL A;  2DMU A;  4KIF A;  2Q2E B;  3RI4 A;  2HDD A;  1BN5 A;  1KU3 A;  4HEA 2;  2FMY A;  1OLT A;  2LKP A;  4A0Z A;  3QOE A;  4GYG A;  5L3F A;  2QEX I;  2ACJ A;  2HPM A;  2NOG A;  4IPA A;  3PQJ A;  4AIH A;  1T56 A;  1ZKG A;  1A31 A;  3X2Q H;  2RKH A;  3SDG A;  2VBY A;  3K1M A;  4ASN A;  3AG3 H;  1WJ5 A;  3BR5 A;  2IRF G;  2HGC A;  1MBE A;  1ZRF A;  4LIV A;  1TZL A;  3WGI A;  3I56 I;  1SFU A;  1Z0X A;  5BS6 A;  3F72 A;  4HZF A;  3KEY A;  4XKB A;  1FX7 A;  2LY2 A;  3I55 I;  1IXR C;  3KE2 A;  1SC7 A;  1VND A;  1WGX A;  5E3O A;  1IRX A;  2NOJ B;  3GBG A;  1RPW A;  3LFK A;  1QHG A;  4EJT A;  3NAR A;  4ITV A;  3PFY A;  1AKH A;  5D6E A;  3LSH A;  2AO9 A;  3PO2 J;  2PJR A;  3EET A;  4GO1 A;  1XD7 A;  1J2X A;  2W48 A;  3TP3 A;  5D4R A;  1R00 A;  2QSG X;  2W85 A;  3MZ8 A;  3GLX A;  1ZLK A;  2H6B A;  4XR6 A;  3HZJ A;  3HOX J;  3ZQI A;  1A6Q A;  1AKH B;  2BW3 B;  2BVM A;  2ZSI B;  2Y69 H;  1O3R A;  3J7A Y;  2K7L A;  3KYL A;  4IZZ A;  2PJR B;  3V7C A;  1S72 I;  2KDZ A;  1BC8 C;  1EJ9 A;  4AU7 A;  5C4J J;  2VOO A;  2HVQ A;  3W2V A;  3K70 C;  1XMK A;  2E1C A;  1U9O A;  2CG4 A;  4JBA A;  2L2O A; 
#chains in the Genus database with same CATH homology
 1FOY A;  5GAH J;  4V19 K;  3DLL F;  5GAE J;  3CCJ I;  5GAG J;  1VQL I;  3PIO F;  3CCV I;  3CME I;  2H8W A;  3G6E I;  3PIP F;  1YJN I;  2QA4 I;  2E35 A;  2ZJP F;  3CJT B;  3CCL I;  2OTJ I;  3CCS I;  1VQN I;  3G71 I;  5DM7 F;  1HC8 A;  3CCE I;  3CCQ I;  1YIT I;  1VQ7 I;  1VQP I;  1FOX A;  5JVG F;  4IO9 F;  2QEX I;  3CCU I;  3J7Z I;  2ZJR F;  1VQ6 I;  3CCM I;  3G4S I;  1YI2 I;  2NXN B;  1VQ9 I;  1QA6 A;  3I56 I;  1FOW A;  1Y39 A;  3CD6 I;  2ZJQ F;  2K3F A;  4IOA F;  3J7Y J;  3CCR I;  1YIJ I;  1VQ8 I;  3CF5 F;  3CC7 I;  3CC4 I;  3I55 I;  3CC2 I;  1MMS A;  4IOC F;  1VQ5 I;  2JQ7 A;  2FOW A;  1YJW I;  3CMA I;  1YJ9 I;  2E36 A;  2OTL I;  1VQM I;  4UY8 I;  1VQ4 I;  1S72 I;  1YHQ I;  5DM6 F;  2E34 A;  1VQO I;  1ACI A;  5GAD J;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...