4BXUA

Structure of pex14 in complex with pex5 lvxef motif
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
GAMATPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADEPSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PEX14
publication title A Novel Pex14 Interacting Site of Human Pex5 is Critical for Matrix Protein Import Into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bxuA00
4WCGA 1HBXG 1LB2A 2EFPA 1IN5A 5JHUA 4Q5SF 4HF1A 3FHZA 3DFGA 2JTVA 2FF4A 1X3UA 2P6SA 5K1YA 3K1MA 2Y75A 4UVCA 3L00A 1XSVA 2XASA 3D0SA 3HRTA 1YS6A 2V1UA 2P4WA 4BHCA 1RI7A 1LEAA 1QGPA 1TQIA 3IWFA 5LRSA 4PZJA 2CO5A 2CG4A 3O3KA 3B73A 3BZ6A 1IW7F 2AS5F 2PG4A 2XKPA 2IA0A 4KDPA 4ON0A 4HOBA 5LEKA 1S7OA 4XRFA 5CVVA 1YIOA 3GFIA 2EFQA 4BXUA 2UZKA 2GIVA 5ICFA 4WK8F 3CLOA 3P7NA 2L3DA 2VE8A 2ZMEA 3IC7A 3MAJA 2WV0A 1IN4A 2W85A 1H0MA 4G9YA 1IAWA 4HV5A 3E97A 1K6OA 4PGGA 5HDGA 2PBIA 3R61A 2BYVE 4R79A 1ON1A 2NRAC 2FQ3A 1BC8C 3J7AO 1RIOH 3GVAA 1P4XA 2TDXA 2ADUA 2B0LA 4JK1X 4UXNA 2G9WA 1YW7A 3BY6A 4HX4A 1ZG3A 2A69F 5DUIA 1O3QA 1V4RA 5L3FA 3QU6A 4I01A 5HOOA 2CQKA 2EFNA 3MZHA 1IZ1A 1S29A 1G4DA 1Z6RA 1R7JA 2A68F 4OMZA 1OYWA 3TO6A 4OU0A 4UV9A 1R58A 5LRRA 2ETHA 2VBZA 3M8EA 3V7CA 2KKOA 2OBPA 3WU0A 2HTSA 5D5XB 2EK5A 3P9IA 4G94A 1FC3A 4GCVA 5IT3A 3HRSA 4AIKA 4OIPF 1VTNC 4R8HA 2D1HA 3GUDA 2FSWA 2P5VA 3EYYA 3G73A 4UUVA 1J2XA 1KU3A 3C7JA 3RYRA 3U1DA 4DQ2A 4CHUA 4FT8A 1FX7A 4L9JA 4EJUA 2M1BA 4RGUA 2QQBA 4ASNA 1SFUA 3MWMA 4MEXF 1R36A 2DAOA 4ENKA 2ZNYA 4AVPA 2HZTA 3R0JA 1RUNA 1XCVA 5L3GA 3LAPA 1KGSA 2EV6A 3M9AA 3GFMA 2XVCA 3R60A 3J80Z 2VBYA 2OA4A 1ZYRF 3JAMK 2QQ9A 2A61A 1W4MA 3E5UA 4ENNA 2KRFA 3ZQ7A 3GZ6A 5E8GA 1YTYA 4HDUA 2LF8A 5K5RA 5FLXK 1FYLA 5ERIA 2HFHA 5D5UB 1NHAA 4MTEA 3QRFF 3HTUA 4I0AA 4LB6B 4U0VA 2JRTA 1ODDA 1BOAA 1USTA 4BH9A 2MC3A 5JR3A 3F72A 2HTJA 4MQVA 1CF7A 5FD6A 3FM3A 3WGIA 4MHGA 2FXAA 3KP3A 4O6JA 1Z7UA 3DPLC 4IJAA 5FB2A 1D5VA 3NQOA 1TNTA 5E1ZB 3M1EA 3TGNA 2XAFA 4QLCU 2W24A 4I98B 3MEXA 1QPMA 5LGTA 2Z5UA 5FD5A 1FPQA 2O61A 2E7WA 5HLHA 1XGNA 2PI0A 4G6QA 1HSJA 2DK8A 4LLLA 1I6XA 1BI2A 4P55A 2FMLA 4KNYA 1I1GA 2Q0OA 3BWGA 2L4AA 5E18F 3KP4A 1ZARA 3KZZA 3WG9A 2CSOA 3AAFA 4IHSA 4O3MA 3DF8A 1QBJA 1MD0A 1FSHA 2DT5A 4GXOA 5LHIA 4OIOF 3QOPA 3BPXA 2H94A 5H6RA 4Y13A 3TDZC 3CDHA 2JSCA 2XIGA 2WC2A 4G6DA 2K7LA 5ILUA 3P9CA 3WE2A 3PQKA 3WTVC 2F5CA 1FOKA 3HSFA 4M6XA 3WODF 2HYGD 3MZYA 3RIRA 2L02A 2H27A 1FYKA 5HDKA 3EQLF 1L3LA 3RKWA 1RNLA 1XSDA 2L4MA 3D5LA 1ZGAA 2PMHA 5ILVA 2GWRA 3BJOA 1SD5A 3QPHA 4I0BA 3HHGA 4U0WA 3RJPA 1ZRDA 5LHHA 3LFKA 1HKTA 1F5TA 4RB1A 4XLPF 3M7GA 4XSZF 3HOTA 4M6YA 4UNOA 3I54A 5BPDA 2HR3A 2STTA 2ZFWA 4O5VA 3QU3A 3E5QA 2M8EA 1WQ2A 5HDNA 4G7HF 1KQ9A 4IXAA 2KIUA 1IXRC 3RTRA 4OOIA 2G7HA 1GXPA 1XD7A 4UVBA 3F21A 3VFZA 3O6BB 4OIQF 1JHHA 2VC1A 1QQIA 2VOOA 2HQRA 1B1BA 2V79A 1F4KA 3CUQA 1XMKA 1YFHA 3GFLA 4CYDA 1T39A 2GXBA 4EJOA 5DV5A 3ROUA 3BOQA 3KETA 4RGXA 2QM3A 1IN7A 4YIFA 1LDKB 4A12A 2LF7A 4A0XA 3GO5A 5HVQC 5ILSA 2OQRA 4CGZA 3J81K 3OV8A 2CW0F 5DYMA 3WTTC 1R23A 4HX7A 3FX3A 5CVIA 3IKVA 1JE8A 2XHKA 3RYPA 5D8KB 2VODA 5TRDA 2WWYA 3KP2A 2VE9A 1SMTA 4LMYA 3LWFA 3DKWA 2ZMEB 1UHWA 1FBSA 3F8MA 2V9VA 1XGMA 4ZYGA 1R5HA 3L9FA 2W57A 1B6AA 1FP2A 2F5FA 3HRMA 5H20A 5BMZA 1W7PA 1PP8F 2KIFA 4Q48A 3GZ5A 2RDPA 4TV7A 1REPC 5H6QA 4BYYA 4LG0A 3C1DA 2LKPA 2EV0A 3REOA 3FF5A 3EYIA 3JW4A 5L3DA 2E7XA 2XAJA 4KMFA 1HKQA 2FMYA 4RB3C 5IT9K 4ZZDA 3H3ZA 3I64A 3ISPA 4M73A 4LLGF 1U6GA 1BM9A 1AWCA 2VC0A 3DPTA 2XGXA 4YFNF 1V3FA 4Y17A 5LLQA 2MA3A 2LDUA 3JTHA 4UV8A 4L0YB 2VOPA 4L18B 3ZN0A 5BS6A 1KYWA 1HXDA 1WWXA 3WTZA 2EA4A 1J7KA 2P8TA 2P5KA 1EH6A 4E70A 2EB7A 2MLKA 5AONA 2IA1A 4HW0A 5L3EA 4P5OA 2D1VA 3RPUA 3VB2A 2BE5F 2HDCA 4WXHA 4HA8A 3SFZA 2HEOA 3F6VA 4K2EA 5CVJA 1K78B 2X4HA 2GXGA 3E6DA 2RV8A 2JPCA 4YFKF 3BDDA 4FX4A 1FBQA 1F1ZA 1MJBA 1IRGA 3GX4X 2OZ6A 2QUFA 1BI1A 6PAXA 3WTWC 1MJ9A 3BJ6A 3LQRA 3ZMZA 5D6EA 4HQMA 1H9GA 4M71A 3BROA 1DP7P 5ICEA 5ICCA 4U0YA 1ON2A 4A0ZA 2XAHA 1OR7A 2W25A 2F5EA 4BNCA 1KU9A 1D8JA 4AD9A 5A2QK 1DPRA 3HRUA 1QZYA 4D0PA 5HLGA 1EH8A 4EGZA 4OMYA 1SD4A 1QZZA 1GXQA 1I1SA 2DI3A 2ACJA 3TQNA 4OIRF 2HKOA 2FE3A 1YG2A 4N0BA 2M87A 4LD5A 3PFIA 3GFJA 1B9MA 4LB5A 1CF7B 3I71A 1UCRA 2FU4A 2HS5A 2VONA 1LDJA 5L3BA 5KVRA 1WRJA 3KP5A 2D45A 5BPIA 5EEGA 3R0AA 1J9IA 1YQAA 1KU2A 1U78A 1T0FA 3TO9A 5DUKA 1FT9A 2O3FA 5E1XA 4IRHA 3HUGA 4KUMA 4NB5A 5K5QA 4ENJA 1YW8A 3F6OA 2A3SA 5FFXA 3ERED 5E1WA 5BQTA 4R1HA 4LK1F 5FFZA 3U2RA 2VT2A 2CWEA 2ZKZA 2RVCA 4EGYA 2ZJ2A 3KCCA 4ENMA 5DD8A 1G3TA 1UFMA 3F8NA 3Q9SA 4BHPA 3JAMZ 1HW2A 3F3XA 3HSRA 2Y48A 4ESBA 2K86A 4ZH4F 2E1NA 2FNAA 4L5JA 3ZN1A 1SD7A 4L0ZB 4ZYDA 4LJZF 2F2EA 2UXNA 1XB4A 3DV8A 5D6FA 1TW2A 5DCMB 3WTSC 3T8RA 4L9VA 1MZBA 2ESNA 2O03A 2A6HF 2GAUA 2XUBA 2IVMA 3LA7A 4LGWA 5CYVA 3WTXC 3O2PE 2EFWA 3HSEA 4PCQA 2P5LC 1Z9CA 3EDPA 5D5VB 2O0YA 3I59A 2QBYA 3IWZA 1LQ1A 3IRRA 1XCBA 1BI0A 5DCFA 1S8NA 1D8KA 3ZP5A 2FA5A 4EJVA 2MH9A 2Z9OA 5CVUA 3LA2A 3MQ0A 1W5TA 4FHTA 3JTGA 3GEZA 1HW5A 4H0EA 2DQRA 3KEQA 1L0OC 3ABTA 3RI4A 5EEHA 2P7CB 1O3SA 3I5UA 3V7RA 3WE3A 4G7ZF 1IF1A 3CUQB 4IRGA 1KYZA 2PFBA 1B59A 1YS7A 4RAZA 1U5TB 2HOEA 4XSXF 3W6JB 3CO6C 2V1DA 1TQPA 1YLFA 2PQ8A 3CO7C 1HQCA 1EV7A 4EJWA 1BBYA 2K4JA 4KT5C 2ZNZA 1O7FA 5J8FA 2FBKA 1R22A 1P2FA 4ZYEA 1CGPA 1P4WA 2ELHA 4IRIA 1O3RA 3L09A 4IPAA 4KMUX 1OYIA 2QYOA 5AIPA 2VT3A 2PJPA 1R1TA 3QP6A 3HOSA 1J0RA 1WSUA 3ZMUA 2YU3A 1USSA 4B8XA 5D5WB 3T8TA 3OOPA 1TLHB 1J59A 4ESJA 4UHTA 4CZZA 3E5XA 3C18A 5E20A 1W7PB 5HS9A 3F23A 4P96A 2XAGA 1XGSA 4JBAA 2HWVA 2DTRA 2EFOA 3N4MA 2M45A 1BN5A 3E6BA 3F8FA 3G3ZA 3FMSA 2HYFA 5LEJA 4KIBA 3KFWX 1XDUA 2CFXA 4GGGA 4EMSA 4L5IA 2L54A 1LVAA 5F6FA 1S3JA 4P9UA 2W84A 1LNWA 3WGHA 2P7VB 1GVJA 1IUYA 5CJ9A 2OD5A 3HIFA 2FBHA 1A04A 2GQQA 1ZLKA 4L9TA 4MQ9F 1RUOA 3FM5A 4YFXF 5L3CA 1ZLJA 4HF0A 4G8XA 4L9NA 3L2CA 2KIMA 1E2XA 3LA3A 2AXLA 3FMQA 4HYEA 3I0TA 1SAXA 4HQEA 4P9FA 3Q9VA 2JT1A 2H6BA 1F9NA 3J81Z 2XAQA 2ZBKA 4U7DA 1ZG1A 2MH2A 2IJLA 1BI3A 1Z6TA 4XBFA 2OZUA 4BQAA 3ZMTA 2FEZA 1MDMA 2EJRA 3RDIA 4M9ZA 4WWCA 1PUEE 3QP5A 1KQ8A 4GYIA 1KA8A 3V7SA 3ML6A 4CO8A 2VN2A 4ETSA 4HLYA 4KIGA 1YW9A 1BIBA 4RS8A 4WXDA 1SMYF 4CICA 1ONVA 3H92A 1K79A 4AIHA 3N97A 3WTYC 4N9HA 1ZRCA 4KA4A 1AOYA 3CJNA 5JFRA 1U8RA 1S7AA 3GW2A 4RGRA 3BJAA 1STZA 1KQ0A 1UB9A 4Q47A 1HKSA 1Y0UA 3V8LA 2XROA 3FXQA 3SQNA 3B02A 1LDDA 1UHMA 3S2WA 2ISZA 1MKMA 1JXSA 2GZWA 1P4AA 1SD6A 5F1RA 3T5XA 3K2ZA 3GWZA 1I27A 2Q8KA 3ZMDA 5ICGA 4LFUA 2UWMA 1ZRFA 1I5ZA 1O57A 3TOAA 3M8FA 1B9NA 4U7BA 2ESHA 1XGOA 1WI9A 3BP8A 4RB2C 2YX7A 3Q5FA 3I4PA 4KICA 5TJJA 1FBUA 1W7PD 2R3SA 5J6XA 3P9KA 3KP7A 4DNCA 2M30A 1EH7A 1DPUA 3DEUA 3KE2A 5AIQA 4LK0F 1XDSA 5DEQA 3LSTA 5E8IA 4KN7X 4M74A 4GO1A 2PMUA 4KIFA 3VODA 4MTDA 2IT0A 4NQWA 2V1XA 4HLXA 1KU7A 3HHHA 3ZMVA 3GLXA 3RKXA 3F8CA 1ZGJA 2QLZA 3LQQA 1IN6A 2A07F 2K4BA 5A2QZ 4IF4A 4ESFA 4S04A 3T0YA 4RB0A 3K9TA 2Z3YA 1RZ4A 1DDNA 2RKHA 3RPQA 3WTUC 3CUOA 2HKXA 4HDVA 4YIIA 3TO7A 1G3SA 5HS7A 2M5WA 4G7OF 1QNTA 2O6GE 2DO7A 1E17A 4JQFA 3FXRA 3K69A 4OINF 2VBWA 4BAYA 3I58A 1MJAA 3VEPA 3E3VA 3K0LA 3JSOA 1ULYA 2YPRA 1ZG5A 2A6EF 3I59B 1T2KA 4I02A 1JGSA 2KJCA 4QWQA 2QBYB 3F8BA 2EA2A 2PN6A 2Y0MA 5K5OA 2PLYA 2MD5A 4Z2YA 4EV0A 2NNNA 1ZHFA 2NNYA 2RN7A 1G6NA 5FGMA 3FWEA 3T1BA 2EV5A 3GYHX 1ZN2A 3CTAA 3GXOA 1TW3A 1FZPB 2K27A 2MBFA 5KK1A 3MCZA 1JHFA 3QAHA 1BIAA 3KP6A 2LNBA 3EETA 1FP1D 4I2OA 4EM0B 5DDGA 1YYVA 1LJ9A 1K78A 2NYXA 1K7AA 3WGGA 5LBQA 3SHFA 3J80K 4IVNA 4HBLA 1XMAA 2ZO4A 1OKRA 2GA1A 4EVIA 1P6RA 2OQGA 1HW1A 5FLXZ 1XSXA 1DUXC 2DW4A 1T6SA 1HSTA 4PDKA 3E6CC 2ZCWA 5E17F 4A5MA 4HF2A 1QO0D 2G7UA 2NS0A 1G3YA 4U88A 2CYYA 2BGCA 1PDNC 4KFCA 4MGRA 2NAZA 2D2WA 5CLSA 3MFKA 2DFIA 1Q1HA 4EM2A 2FRHA 4LLNA 2COMA 2L01A 2V6CA 4A5NA 3ECOA 5JI6A 3BPVA 3IRQA 2FNPA 2DPDA 2O8XA 1D3YA 2QENA 2KJBA 2HQNA 1FSEA 4Q4ZF 4EM1A 1LEBA 4AIJA 3C3WA 3R6SA 2BBYA 2Z99A 2LSOA 3HTSB 1G3WA 2A5YB 4UVAA 4RGSA 5LHGA 2Z33A 4WF2A 2JPBA 3WU1B 1SFEA 1O3TA 1GHCA 3EUHA 1OMIA 1TQMA 5D4SA 5CVRA 2J5OA 1FWZA 3K1NA 4NHJA 2H6CA 4Y15A 2X0LA 5ED4A 1P92A 3FMRA 4EJTA 4WX9A 4B09A 2QWWA 3V8JA 2DQLA 4A0YA 4GYGA 4A6EA 3K1PA 2XRNA 4EQQA 3NEUA 3ZPLA 2F5DA 2DK5A 3GF2A 2HGCA 1ZREA 2YSRA 3DXJF 2OAZA 3SZTA 4F7ZA 1Z91A 4M9SA 1U2WA 2XKOA 4AWXB 5J8CA 2YR2A 5FO5A 3ZMSA 2H09A 4KYWA 1MDMB 1S6LA 3I53A 2STWA 1BC7C 5D8LB 5DCMA 3KZYA 2RQPA 5LGNA 4HAMA 3RKYA 1PP7U 1J5YA 4I09A 3KLNA 2CGPA 3JSPA 4BHBA 1J75A 4MNUA 2IW5A 5F64A 5HS8A 1YO5C 1MGTA 2DBBA 1OYYA 2VXZA 3VOEA 4LG0B 1R1UA 4YG2F 1TNSA 3SXYA 1R5GA 3W6KB 3ELKA 1FLIA 2ISYA 2PEXA 2C6YA 1IXCA 3DP7A 3FXUA 1B4AA 2IA2A 1SFXA 3ULQB 2BEOA 2Q2EA 3E6MA 2P6TA 2UXXA 4ZYHA 3TOBA 2OU2A 3L7WA 4HV6A 4CDGA 1TBXA 2RC4A 3IKTA 4RAYA 2R7FA 4IHTA 3ECHA 2R7DA 2JZYA 2VBXA 5D4RA 2QVOA 3KEOA 4WXCA 1C0WA 1WKMA 2YX4A 4MEYF 4A2UA 3F22A 3HYIA 2MLGA 2K02A 1IRFA 2DLLA 2IPQX 4HX8A 4FX0A 2DU9A 2EWNA 3FZVA 1U5TA 1IN8A 4CXFA 3DQVC 1W5SA 2XV4S 3ABUA 5HLIA 1TTYA 3H3UA 2BV6A 1R00A 1IXSB 1R1VA 4A6DA 3LAJA 2RNJA 2DPUA 1FYMA 2ZXJA 3R4KA 3TKYA 1XN7A 2WTEA 3NRVA 2E1CA 3QPTA 2IRFG 3U9GA 3COAC 3V4GA 5BOXA 4I7HA 3SZPA 1ZAOA 4XLNF 4N9IA 1H9TA 4KN4X 2RGVA 3PQJA 5JVTA 3CUQC 4M72A 2GA2A 2IP2A 2J5PA 2QQAA 1BJAA 1T38A 2QZ8A 3V8KA 2FOKA 1U5TC 4PGHA 5IT9Z 4S05A 1U3EM 1T98A 4HZFA 2FBIA 1Z05A 1FY7A 3IL2A 3TDUC 3KLOA 4ZZLA 5LGUA 5DD4A 1OPCA 1O7LA 1FNNA 1ZH5A 4M9XA 3IHUA 1Z1DA
chains in the Genus database with same CATH superfamily
4WCGA 1HBXG 1TP4A 1AHDP 1HF0A 3H9GA 1LB2A 2EFPA 1IN5A 5JHUA 1SAUA 2DN0A 4Q5SF 3ABLH 2L7MP 3ASNH 2K85A 3H35A 2VB6A 4HF1A 3FHZA 4E7KA 3DFGA 3HL2A 2IGKA 2JTVA 2FF4A 1DGWY 2FQ4A 3BC8A 5B1BH 1X3UA 5B3SH 2P6SA 5K1YA 3K1MA 2Y75A 4UVCA 4QTRA 3L00A 2IXSA 2VJ5A 1XSVA 2LYCA 2XASA 3D0SA 3HRTA 2CU7A 2COBA 3HOVJ 1YS6A 2V1UA 2WB1A 2O8KA 2P4WA 3HUGB 3GCMA 1T56A 1P7IA 1DU0A 4BHCA 1RI7A 1LEAA 1QGPA 5EEAA 4BXFA 1TQIA 3IWFA 1TWGJ 5LRSA 4PZJA 3K70C 2CO5A 2CG4A 3O3KA 4QPQA 3U1KA 3FK7A 3ZGKA 2R0QC 3B73A 3K4BA 3BZ6A 1IW7F 1WJFA 4DBRA 4HNTA 1MSFC 2AS5F 2PG4A 3CCVI 2FD5A 2LKSA 2XKPA 2IA0A 4A3FJ 4KDPA 4ON0A 4HOBA 1UG0A 5LEKA 1S7OA 4XRFA 1MNMC 2I5UA 3J7YJ 5CVVA 1YIOA 1YJWI 2XAUA 4Y33A 2LY9A 2EFQA 3FXKA 4BXUA 3GFIA 3OY9A 3QPLA 2UZKA 3OYKA 1N75A 2GIVA 4FETA 5ICFA 4WK8F 5F04A 1B8IB 3CLOA 4JX6A 3P7NA 2WV1A 1LVKA 2L3DA 1W0UA 2VE8A 3CP2A 2ZMEA 5GP9A 2VKEA 3IC7A 3MAJA 4PSXA 4UB8C 2WV0A 4B3AA 3PIOF 3GTJJ 4BJTA 4ZDLA 1S7EA 3LSHA 1IN4A 2R7WA 2VKDA 2W85A 4DZPA 1H0MA 4G9YA 1IAWA 4BL0B 2BY3A 4HV5A 3E97A 1K6OA 2FJ1A 4PGGA 3UKGA 5HDGA 2N8GA 4D7NA 2PBIA 2EZHA 3R61A 1H89C 2BYVE 5J3LA 4R79A 4E7LA 1ON1A 2NRAC 1I39A 2FQ3A 1F36A 3A02A 1PJRA 1BC8C 1P9QC 1N77A 2R7TA 2HPMA 3J7AO 1RIOH 3GVAA 1P4XA 2XF5A 3LMMA 4Z6YA 2ZC2A 2TDXA 3G1MA 3S16J 2ADUA 2B0LA 4JK1X 3W2AA 2VL8A 4HNVA 4UXNA 1MMAA 2G9WA 1YW7A 2EZKA 3BY6A 3FBIB 4HX4A 3OYDA 4LIVA 1IV6A 1ZG3A 5J4VA 4BACA 4KITB 2A69F 3MD2A 1Z67A 4PK4A 4CCLA 5DUIA 5C44J 1O3QA 2VJ4A 4YELA 1MBGA 1V4RA 4BBRJ 5L3FA 3QU6A 4I01A 5HOOA 2CQKA 4ANJA 2EFNA 4MFDA 4XNFA 3MZHA 2K3PA 3LNQA 4HSRA 1R71A 3WHCA 1IZ1A 3BG7A 5EGOB 2TRTA 2B9SA 1TWFJ 4AM3A 1S29A 4XICA 1G4DA 2Z16A 1Z6RA 2DYSH 2NVQJ 1R7JA 2R5ZA 2A68F 1GDTA 4OMZA 1OYWA 3TO6A 1V5EA 2VQGA 4OU0A 4UV9A 3VYRB 3S1NJ 1R58A 5LRRA 2ETHA 2PMZA 2VBZA 3M8EA 3V7CA 1DQUA 4H4KC 2KKOA 1B72B 2OBPA 3WU0A 2HTSA 5D5XB 1ZQ3P 2I8DA 4M3FA 2EK5A 2K3FA 5F08A 4F3QA 3L2RA 1A35A 3P9IA 4G94A 2XPVA 1FC3A 3HM5A 1K83J 4GCVA 5IT3A 3HRSA 3TP0A 4AIKA 3CC7I 4OIPF 1VTNC 2VLAA 4R8HA 2D1HA 2XRLA 3GUDA 2FSWA 2P5VA 3EYYA 4IKFA 3G73A 2JA7J 4D1QA 4UUVA 1OR7C 1J2XA 1APLC 1KU3A 2DMTA 3C7JA 2G0EA 3K7AJ 1VQPI 2ZSHB 1QA6A 3RYRA 3U1DA 3C2GA 4DQ2A 3DTKA 4XLHA 4CHUA 4FT8A 1FX7A 3J7ZI 4L9JA 4NUBA 5JHFA 2VJIA 4EJUA 5EG0B 2M1BA 4RGUA 2CV0A 2HXOA 2QQBA 1FOYA 4ASNA 1SFUA 2NOJB 4HNUA 3SYTA 3PL8A 3MWMA 4G6TB 4MEXF 4XL9A 1YJ9I 1R36A 1ZR2A 1LE8B 2DAOA 4ENKA 1HOMA 2ZNYA 4AVPA 2HZTA 3DEWA 3RKQA 3R0JA 1RUNA 1XCVA 5L3GA 2KDOA 4XKWA 3LAPA 1KGSA 4NBQA 2EV6A 5FKKA 3M9AA 1G8XA 4B1RA 3GFMA 1U0JA 3HOYJ 2XVCA 3R60A 3J80Z 4XORA 2VBYA 1W36C 2OA4A 2E60A 3CC2I 4BE2A 2GOMA 3JAMK 4A3JJ 2QQ9A 1LFPA 1NTCA 4M3GA 5H2FC 2A61A 3K4CA 2K40A 4BU2A 2DMUA 1W4MA 2M0CA 2K5CA 3E5UA 2E71A 1ORKA 5KAIC 2XB5A 2ZB9A 4ENNA 2KRFA 4C2UA 2KDZA 3ZQ7A 3GZ6A 3VSLA 5E8GA 1V54H 1YTYA 4HDUA 2LF8A 3LSRA 1V55H 5K5RA 1PUFA 4XQFA 3OL3A 5FLXK 3OSFA 1T0FC 1OFCX 1FYLA 1OCCH 5ERIA 2HFHA 3J7AY 4F55A 5D5UB 3QYBA 1NHAA 1MIJA 4MTEA 1WJCA 3QRFF 3HTUA 4I0AA 2BVLA 4LB6B 1VQMI 4U0VA 1FEXA 2JRTA 4ZDOA 1ODDA 1BOAA 1USTA 4BH9A 2MC3A 4II3A 4KT6A 5JR3A 3CJTB 3KPHA 3F72A 4MLOA 2HTJA 4MQVA 5C4JJ 3S17J 1CF7A 5FD6A 3FM3A 3WGIA 1RC9A 3PSIA 3TP3A 2LP0A 4M3DA 2JMWA 4MHGA 3IH4A 2DXIA 1XS9A 2FXAA 2EILH 2E34A 3KP3A 4AC0A 4O6JA 3TEDA 1Z7UA 3DPLC 4CCJA 3BG6A 4IJAA 5FB2A 1D5VA 3NQOA 4L5EA 1TNTA 5E1ZB 1MBJA 3M1EA 3I55I 3TGNA 2XAFA 5J4YA 4QLCU 4BDYA 4XN3A 3HXLA 2W24A 4I98B 3MEXA 4OAYA 1RESA 1QPMA 2HOAA 2LH9A 1HLVA 4F93B 1ETVA 5LGTA 2Z5UA 5FD5A 3DBRB 1OCRH 3B6CA 1FPQA 4BQOA 4DW6A 3OYHA 5GPAA 2O61A 2E7WA 5HLHA 1XGNA 4A3LJ 2PI0A 4G6QA 1HSJA 1DP3A 2DK8A 4ZJZA 4LLLA 4M6VA 1VQKI 2FX0A 1I6XA 2R7UA 1BI2A 4P55A 5FJ8J 2FMLA 4KNYA 1I1GA 4W1UA 5IOZA 3CP8A 2Q0OA 3PSFA 3Q0WA 3JRFA 3K10A 2FUG2 4HPQA 4A3DJ 3BWGA 2GXAA 1MH4A 4CZCA 1ZKGA 2L9RA 3I56I 1BR2A 2L4AA 3KP4A 5E18F 1VFCA 2V7FA 1ZARA 3KZZA 1X3WB 3SDGA 3WG9A 1VNDA 2CSOA 3AAFA 1VZ0A 3TBIA 4IHSA 4O3MA 4CYCA 1TT0A 3DF8A 1QBJA 1MD0A 1FSHA 4PJNA 1IUFA 2BY1A 2DT5A 1BR1A 4GXOA 1YJNI 1VQ8I 1W1WE 4A3CJ 5LHIA 5CKTA 2WAFA 4OIOF 3AL0C 2IGOA 2JA2A 3QOPA 3BPXA 3FDYA 2H94A 5H6RA 4Y13A 3TDZC 2VPLA 3CDHA 2JSCA 3ZQFA 2XIGA 1MBFA 2RQQA 1X1DA 2MC4A 2NVXJ 1RETA 2HU9A 5DM6F 2XSDC 2WC2A 3HOUJ 4G6DA 2K7LA 5ILUA 2GBYA 3P9CA 3WE2A 3PQKA 3W2WA 3WTVC 2F5CA 1FOKA 1GUUA 3HSFA 2OV7A 4DZJA 1D0XA 3NARA 4M6XA 3WODF 2HYGD 3MZYA 3RIRA 1HDDC 2L02A 2H27A 4BBSJ 3BR6A 2OUMA 1FOWA 1FYKA 5HDKA 2BXZA 3EQLF 1L3LA 1FOXA 3RKWA 4EEFG 3QODA 2R93J 1RNLA 4XLEA 1XSDA 2L4MA 3H5RA 3D5LA 3HBLA 1ZGAA 2PMHA 2QQ8A 3H9JA 3OR2C 3LSGA 4ITVA 2CV1A 5J1YA 2KPMA 2OF7A 5ILVA 2GWRA 4C2MJ 3BJOA 3MKZA 1JJ6C 1AKHB 1UELB 1SD5A 4NC7A 3QPHA 4I0BA 3HHGA 2DA7A 4U0WA 3RJPA 1ZRDA 5LHHA 3LFKA 2R7RA 4D7MA 3CZ6A 1HKTA 2R7VA 1F5TA 2IGMA 4RB1A 4XLPF 2BW3B 2NOGA 3BR0A 3G71I 2CQQA 5GTHC 3M7GA 5IY5H 4XSZF 3HOTA 3GBGA 2R7XA 4BY1J 3ZQCA 3HEFA 5F0CA 4M6YA 4UNOA 3I54A 5K7HA 1I50J 1DGRM 5BPDA 2X9DA 4DGWB 2DDBA 2F6CA 2HR3A 2HPIA 2STTA 2ZFWA 4IQ4A 2F4IA 4O5VA 4W97A 3QU3A 3IP4B 3E5QA 4PSWA 3IAS2 3BTCA 4II2A 5KCMA 2M8EA 3VYUB 1WQ2A 5HDNA 4G7HF 1KQ9A 3BQYA 3CDIA 4IXAA 3FIWA 2KIUA 1IXRC 1MBKA 4XM3A 1SC7A 3RTRA 3W2VA 2IGNA 3DTEA 4OOIA 3H5NA 2G7HA 1GXPA 1XD7A 1U9NA 4UVBA 3F21A 3W6VA 3HJEA 1RKWA 1QZEA 4IX7A 3UNGC 1EKEA 2K9SA 3VFZA 2LBFA 3O6BB 2E2HJ 4OIQF 1JHHA 2VC1A 1QQIA 3DWLE 5B66C 2VOOA 2HQRA 1B1BA 3ZQQA 2RAEA 2V79A 3RZOJ 2V9KA 1QVTA 3FXOA 2M9HA 3SEQA 2IS1A 4B3XA 4A3KJ 5GADJ 1NG7A 4LIUA 1F4KA 3CUQA 1XMKA 4JX5A 1YFHA 3GFLA 1MBHA 4E6KG 2Y0SA 4CYDA 1T39A 2GXBA 3BQZA 4DYRA 4CA0A 4EJOA 3I4MJ 4RM2A 1S9HA 3S8PA 2R5YA 2E2JJ 2R7OA 2LY2A 1A5JA 2AXTC 5DV5A 1WI3A 2M4KA 3DLAA 3ROUA 3BOQA 3CCEI 3KETA 1EJ9A 2L2OA 4RGXA 2QM3A 1IN7A 4YIFA 3G2BA 4DBQA 1LDKB 1Z21A 4A12A 2LF7A 4A0XA 3GO5A 5HVQC 5ILSA 1IGNA 2OQRA 4NDLA 4CGZA 3J81K 3OV8A 2CW0F 5DYMA 3WTTC 1WVRA 4IHXA 1R23A 4HX7A 1RR8C 3FX3A 5CVIA 3IKVA 1JE8A 2XHKA 3RYPA 2L7ZA 3D1NI 5D8KB 2VODA 5TRDA 2WWYA 3KP2A 5IOYA 2VE9A 1SMTA 4LMYA 3LWFA 2F5VA 2ME0A 3DKWA 5K7ZA 2ZMEB 2ZXHA 1UHWA 2I10A 2CJJA 3RQ4A 1FBSA 3F8MA 3FISA 5M5WJ 2E36A 2V9VA 1XGMA 3TW6A 4ZYGA 4X0GA 3N05A 3CMEI 3GTKJ 3PIPF 1R5HA 5IP7J 2GOXB 2QCOA 2ZJPF 3L9FA 2W57A 1B6AA 1FP2A 2F5FA 1POGA 2VIXA 3HRMA 2BY2A 2JK3A 2KZVA 5H20A 2E5ZA 1YRNA 5BMZA 2DOFA 1W7PA 1PP8F 2H1KA 2KIFA 4J19A 4V19K 2LK2A 3HG9A 4Q48A 1X19A 3BG5A 3GZ5A 2W82A 2RDPA 4TV7A 5GAHJ 5B1AH 1REPC 2LY1A 3K4JA 3C2BA 4BDZA 3M8JA 5H6QA 1XG1A 4LG0A 3NWTA 4BYYA 3C1DA 2LKPA 3KIOA 2EV0A 3REOA 4RLQA 1JKQC 3BR1A 3NAUA 2A6TA 3FF5A 3DU6A 3EYIA 3JW4A 5L3DA 2E7XA 2X1EA 2XAJA 4KMFA 1HKQA 2FMYA 1MNEA 4RB3C 2E5NA 4UB6C 3MKLA 4XN0A 5IT9K 4ZZDA 1ZG1A 3H3ZA 5LD2C 2WA0A 2Z2SB 3I64A 1D1AA 3ISPA 4M73A 4XLFA 1WGXA 4IOAF 4LLGF 3VYTB 3CF2A 2QEXI 1U6GA 1BM9A 4F92B 2R5ZB 2ZJRF 1AWCA 2VC0A 3DPTA 2QSGX 3SFIA 3VPRA 2XGXA 3DKYA 4YFNF 1V3FA 4Y17A 5EJCA 1JUMA 1HC8A 5LLQA 1Y8RB 2MA3A 4D5FA 1R49A 2HQ5A 4PFPA 2LDUA 3JTHA 3AG1H 2ME6A 2E35A 1IG7A 1WHUA 4UV8A 4L0YB 3MZ8A 3AKZA 2VOPA 4L18B 3ZN0A 5BS6A 1KYWA 4E7ZA 1HXDA 2X1CA 1WWXA 3WTZA 2EA4A 3QYFA 1MMSA 1MSEC 1J7KA 2P8TA 2ZFUA 1OJLA 2P5KA 1EH6A 4FISA 3ZQHA 2BY0A 4E70A 4UY8I 2EB7A 2MLKA 5AONA 2IA1A 4HW0A 5L3EA 4P5OA 1ETXA 2D1VA 3RPUA 3VB2A 2BE5F 2HDCA 2MGQA 4HA8A 4WXHA 3CQZJ 3SFZA 2HEOA 4HEA2 4D9JA 1ETWA 3F6VA 4K2EA 5CVJA 1K78B 2X4HA 2GXGA 3E6DA 2RV8A 2JPCA 3ZQIA 4YFKF 3BDDA 4FX4A 1JKRC 2UV1A 1FBQA 2DTZA 1F1ZA 1VF9A 5FROA 1MJBA 3H0DA 1IRGA 3GX4X 2OZ6A 5JLWA 2QUFA 1BI1A 1I6HJ 6PAXA 4M3BA 3WTWC 2PJRA 1MJ9A 3BJ6A 3LQRA 3ZMZA 5D6EA 4HQMA 4FE7A 1R4NB 4XOPA 1QPIA 1X1PA 5DS9A 4GRIA 3V42A 1H9GA 4M71A 3OS0A 2BVMA 3A01B 3BROA 3DPUA 3IV5A 1DP7P 5ICEA 4ZDPA 5ICCA 2IBDA 3OIPA 4U0YA 1ON2A 4A0ZA 3FKIJ 2XAHA 1JKOC 1MW7A 1OR7A 2HQAA 2F5EA 2W25A 1KU9A 3JRAA 4BNCA 2GIZA 4AD9A 5A2QK 1DPRA 2Q1ZB 1D8JA 3HRUA 2R7QA 1QZYA 4D0PA 2ELJA 3PUBA 2HYJA 5HLGA 1EH8A 4EGZA 4OMYA 1SD4A 1QZZA 1GXQA 1I1SA 2E1MC 2DI3A 3OOUA 2ACJA 1RRJA 3TQNA 2VQLA 4OIRF 4A3EJ 2HKOA 2FE3A 1ZH5A 3RSNA 1YG2A 4N0BA 2M87A 2H8WA 4LD5A 3PFIA 2Z1DA 3GFJA 1B9MA 2WAQN 4LB5A 2XPUA 2HVRA 1CF7B 3I71A 2L9NA 1UCRA 2FU4A 2HS5A 2Y31A 2VONA 3GTOJ 4PUSA 1LDJA 2KZGA 2DFHA 3G4SI 5L3BA 3PO3J 2XGDA 1YI2I 5KVRA 2K9QA 4ABZA 4FCYA 1WRJA 2OCCH 3KP5A 2HVQA 2D45A 5BPIA 2O7OA 5EEGA 3R0AA 1J9IA 4B47A 1ETOA 1YQAA 3K4KA 4BEHA 3KEYA 3ZRGA 4A3MJ 1KU2A 2LR8A 1U78A 2M34A 2QGUA 2LRDA 3CCMI 1W0TA 1LKXA 1T0FA 3TO9A 3VWBA 1SFKA 4RAFA 5DUKA 3X2QH 1FT9A 2CUEA 3JRCA 2HXIA 2JRMA 2O3FA 2X6WA 5E1XA 3CCRI 2LFBA 4IRHA 3HUGA 4KUMA 4XKBA 1X2MA 4NB5A 2DOAA 5K5QA 4ENJA 1YW8A 3F6OA 2A3SA 5FFXA 1A6QA 3OYIA 2DMQA 1SANA 3ERED 1XPXA 5E1WA 1JJ8C 1A6IA 1GLNA 1X2NA 3A0HC 4R1HA 5BQTA 3F9KA 4LK1F 5FFZA 1VQLI 3U2RA 2VT2A 3FXMA 1VQ4I 3HKZN 3IH3A 1S72I 2CWEA 2ZKZA 2RVCA 2CRGA 4DIQA 4EGYA 3OYCA 3MKWB 1ENHA 2W1OA 2V4JC 2ZJ2A 3KCCA 4ENMA 3AG4H 3CESA 1ZR4A 1N25A 4FASD 2L7FP 5DD8A 1G3TA 1UFMA 3HOXJ 2VXDA 3F8NA 2QKLB 3Q9SA 4BE1A 4CYCB 4BHPA 3JAMZ 5JLXA 1HW2A 3F3XA 1Q1VA 1Z3YA 4XLAA 5LFAA 1Y1VJ 3HSRA 4G12A 4BQQA 1OCTC 2Y48A 1D1BA 4ESBA 3BTJA 1OCPA 2EIMH 2K86A 2V6EA 4ZH4F 2E1NA 2FNAA 2X1DA 4L5JA 3ZN1A 3RCOA 2KMUA 3AG3H 1SD7A 4L0ZB 4ZYDA 4LJZF 2F2EA 3JRDA 4XRSA 1FMVA 2UXNA 3S14J 1ZTRA 1XB4A 3DV8A 5D6FA 2A05A 1Y1WJ 1TW2A 3HDDA 5DCMB 3G1OA 3WTSC 3T8RA 2ID3A 4J00A 4L9VA 1JUPA 1MZBA 2ESNA 5FRMA 2O03A 2A6HF 2GAUA 2XPWA 4BKXA 3ABMH 2BHZA 2XUBA 2YU9J 2IVMA 3LA7A 1TWHJ 1X4OA 4LGWA 5CYVA 3WTXC 2EIJH 5HNFA 1JT0A 4RA2A 1WJDA 1YX5A 3DKXA 4Y3OA 3O2PE 3GTPJ 2EFWA 3OYEA 3HSEA 1ZGWA 3FK6A 1XTAA 3ONQA 4PCQA 2P5LC 3OS1A 1Z9CA 3DTIA 3EDPA 2HOSA 2KISA 2LC2A 2DT6A 3K4MA 5D5VB 2O0YA 3WHBA 3I59A 4M3EA 4KJZA 5EF6A 2QBYA 2NVTJ 3LSPA 5TGTA 3IWZA 1LQ1A 3IRRA 2VQHA 1BI0A 5DCFA 1S8NA 1IJWC 2Q2EB 1D8KA 2WB1N 3ZP5A 3S1RJ 1E3OC 2EBIA 2FA5A 4EJVA 2ICWG 2MH9A 1BA5A 2MSYA 3CCLI 2Z9OA 2CV2A 2VKHA 3DEEA 4XKVA 3K2AA 4ZC3A 5CVUA 4A3GJ 3LA2A 1ZK8A 1Y0NA 3MQ0A 1W5TA 3S1QJ 1D0ZA 4FHTA 3JTGA 3GEZA 3BG9A 1XX5A 4AU7A 3CLQA 1HW5A 4H0EA 3HZJA 2DQRA 3KEQA 1L0OC 3NWSA 3ABTA 4C3JJ 3RI4A 3PNVA 2LBFB 2BOLA 1VQ6I 3G6EI 2Y9YA 2DDAA 5EEHA 2WY7Q 2VASA 2P7CB 1O3SA 3I5UA 3V7RA 3WE3A 4G7ZF 4YIRX 4RDUA 1IF1A 3CUQB 4AYBN 4DJAA 3S2HJ 3KYCB 4IRGA 1KYZA 2PFBA 3HGYA 1PYVA 1B59A 4XR6A 5F0FA 4F52A 3IHUA 1YS7A 1XMXA 4RAZA 1U5TB 2HOEA 4XSXF 1LPQA 2R5YB 3W6JB 3CO6C 2V1DA 3LSIA 3DU5A 1TQPA 4YEJA 1YLFA 2CFOA 2PQ8A 3CO7C 1HQCA 3WU2C 1EV7A 2HVSA 4EJWA 1BBYA 1RKTA 2K4JA 4KT5C 2ZNZA 1O7FA 5JVGF 5J8FA 2FBKA 5M5YJ 3RQIA 2UUZA 1R22A 4RM3A 1P2FA 2JVHA 3M4OJ 4ZYEA 3I4NJ 1CGPA 2CQ7A 2H8RA 1P4WA 2ELHA 4IRIA 1O3RA 2YS9A 4B44A 1OCOH 3L09A 4IPAA 1H8AC 4KMUX 4DYQA 3MVPA 3EPZA 1OYIA 2QYOA 5AIPA 1JI8A 2VT3A 3VDXA 1PVEA 2PJPA 3L2VA 2XF7A 2V9PA 3JRHA 1R1TA 2DFFA 2F48A 3QP6A 3HOSA 1JUSA 5EZHA 4KISA 2R7SA 1WCMJ 2E19A 4XIDA 1J0RA 1WSUA 2R7ZJ 3ZMUA 2OTJI 2YU3A 3SDBA 1FJLA 1USSA 2JSPA 4B8XA 5D5WB 3BCAA 3T8TA 1D0YA 3OOPA 1TLHB 4OWRB 4XK4A 2A5WA 1J59A 4ESJA 4UHTA 1VQNI 4CZZA 3E5XA 2LOOA 3F0CA 4CCOA 5J47A 3C18A 5E20A 4IHYA 1YRNB 2K9MA 1W7PB 3BG3A 5HS9A 3F23A 4P96A 2IAIA 2XAGA 1XGSA 1FTTA 3ESWB 4JBAA 2HWVA 2DTRA 2VKVA 5F27A 2EFOA 3N4MA 3LSMA 4PFOA 2M45A 4IQJA 1ACIA 1BN5A 3E6BA 2ZXIA 3F8FA 3JRBA 3BTLA 3G3ZA 2ZSIB 3FMSA 3H9QA 2HYFA 3ASOH 3CDLA 1NG6A 5E3LA 5IPAA 5LEJA 4KIBA 3KFWX 3PUFA 1XDUA 1WH5A 2CFXA 2EZIA 4GGGA 4EMSA 1HA8A 4L5IA 2L54A 1IO2A 3DLLF 5FKLA 1LVAA 5KHDA 2QKMB 1YITI 5F6FA 1S3JA 3AFHA 2WAQA 3CCYA 1G2HA 3FXJA 4P9UA 1R5ID 2W84A 1LNWA 3KZIC 3WGHA 4XRSG 2Y69H 1FMWA 2DFEA 4X6AJ 2P7VB 1GVJA 1IUYA 3A0BC 5CJ9A 2OD5A 3HIFA 2FBHA 1A04A 2GQQA 1ZLKA 2VPRA 4L9TA 4MQ9F 2XF6A 1RUOA 1UAAA 3W3CA 1V5GA 3FM5A 1SVMA 4YFXF 5L3CA 1ZLJA 4HF0A 5BNGA 4G8XA 4L9NA 2LKXA 1Y39A 3L2CA 5IYDJ 2KIMA 2IS2A 1E2XA 1ZELA 3MKYB 3LA3A 2AXLA 3FMQA 4HYEA 4PJLA 3I0TA 1A31A 1SAXA 4HQEA 4P9FA 3Q9VA 2JT1A 1Y6IA 5FKOA 2H6BA 4QIWN 1F9NA 2ECCA 2XAQA 2ZBKA 2KHMA 2CH0A 3KYDB 1T08B 5DM7F 3J81Z 4U7DA 2JWTA 2AHQA 5EDNA 2O9LA 2MH2A 3BR3A 2KQRA 2IJLA 5IYCJ 2VQCA 1BI3A 3PNTA 3ZXSA 1Z6TA 2MW8A 3QOEA 4XBFA 2OZUA 1OCZH 1SVOA 1BL0A 4BQAA 3ZMTA 4BXXJ 2FEZA 1MDMA 2EJRA 2DA5A 2L7KA 3OMYA 3E1SA 3RDIA 2M2EA 4M9ZA 2XGCA 3M07A 4WWCA 1PUEE 2X6OA 3QP5A 4UUSA 1KQ8A 2PJRB 1OISA 4LITA 4BGDA 4GYIA 2VI6A 1KA8A 3V7SA 4AIDA 4Y52J 3ML6A 4CO8A 2VN2A 3LFUA 1VQ5I 4ETSA 5J1UA 2AQEA 4HLYA 3PO2J 3PM1A 3MN2A 3HGGA 2GM4A 4JX4A 4KIGA 1YW9A 1BIBA 2W48A 4CH7A 1WJBA 4OAZA 4RS8A 3CC4I 4WXDA 4CCKA 2B7EA 1SMYF 4CICA 5M5XJ 1ONVA 3H92A 4XLCA 2R92J 1K79A 4AIHA 2KIQA 5IP6A 3N97A 3GZNB 3WTYC 2XDVA 4IO9F 4N9HA 3OS2A 2YUSA 1ZRCA 4IEJA 4E7SA 1P7JA 4KA4A 3A03A 1AOYA 3CJNA 5JFRA 1U8RA 1SEUA 2DCEA 1S7AA 3GW2A 4RGRA 3BJAA 1STZA 2MABA 1KQ0A 4V2GA 3ZR8X 2R4GA 1UB9A 2RREA 3OIOA 4Q47A 2AO9A 3IH2A 1HKSA 2IS6A 5CPRB 1X3ZB 3JRIA 2BZTA 1Y0UA 3V8LA 2XROA 2EINH 3FXQA 3SQNA 3B02A 2X51A 3WG7H 3D5SC 1LDDA 1UHMA 2F4MB 2NS7A 3S2WA 2W4SA 2ISZA 1MKMA 1JXSA 4GFBA 1OQYA 2GZWA 1P4AA 1SD6A 5F1RA 3T5XA 3K2ZA 3CMMA 3GWZA 2JA5J 1I27A 1WJ5A 4JOMA 2Q8KA 2DJNA 3ZMDA 5ICGA 3AG2H 4CCNA 2NS8A 3H5AA 4LFUA 4BEHB 2X85A 3OYAA 2UWMA 1ZRFA 1I5ZA 1O57A 1KZHA 3S2DJ 4A3BJ 3QQAA 3TOAA 3M8FA 1AU7A 3FBNB 1B9NA 4HG2A 1BR4A 4U7BA 4MIMA 2ESHA 3BR2A 1XGOA 3ZQGA 1WI9A 3BP8A 4RMNA 4RB2C 2YX7A 4J01A 2OTLI 3Q5FA 3EUKL 2LLKA 3I4PA 5FKNA 4KICA 3CF5F 4Y7NJ 5TJJA 4DOZA 1FBUA 1W7PD 3LOCA 5M3MJ 3K70D 1QHGA 1UG2A 2R3SA 2Y30A 5J6XA 3P9KA 3KP7A 4DNCA 2M30A 1EH7A 1DPUA 3DEUA 3KE2A 3ERMA 5AIQA 4LK0F 1XDSA 1E3PA 3A4CA 5DEQA 3LSTA 1QVUA 1KONA 5E8IA 2H1LA 4KN7X 2FOWA 4M74A 4GO1A 3U21A 2PMUA 5IP9J 4KIFA 2LG4A 4BE0A 3VODA 4MTDA 2IT0A 3KYLA 2BHYA 4NQWA 1T95A 2QSHX 2V1XA 4DYCA 4HLXA 1KU7A 2LTPA 4BS9A 1K4TA 3M1CA 3HHHA 4MO7A 3ZMVA 1WJAA 3GLXA 3RKXA 4AYBA 3F8CA 3SJMA 1MBEA 2MG4A 3TMOA 1ZGJA 2QLZA 2DT7B 4C3HJ 1IV8A 1MMDA 3LQQA 3SEZA 3CJRB 1PUFB 1IN6A 2A07F 2K4BA 5A2QZ 3GTLJ 2DYRH 2ID6A 4IF4A 2W00A 4ESFA 4S04A 3T0YA 3CCJI 2D5VA 4RB0A 4E7HA 3LSJA 4A93J 3K9TA 2CUJA 2WY8Q 1WFXA 2Z3YA 1RZ4A 1DDNA 2RKHA 3RPQA 3OSGA 3WTUC 3OYJA 3CUOA 2HKXA 4HDVA 2MFZA 4YIIA 3TO7A 3QWLA 1ITYA 3CD6I 1G3SA 5HS7A 2M5WA 4G7OF 1QNTA 2JA8J 2O6GE 5C4XJ 2Y9ZA 1E0EA 3A2KA 5KNLA 2DO7A 1E17A 4JQFA 3SZGA 3FXRA 3K69A 1JT6A 3S1MJ 4OINF 2VBWA 4BAYA 2EZLA 2JQ7A 3I58A 4IZZA 1MJAA 2LREA 1TT5B 3VEPA 1F43A 3E3VA 1XC5A 2M7AA 3RPUD 4BQNA 3H1CA 3K0LA 2HI3A 3AL0B 3JSOA 1ULYA 1CQTA 3BTIA 2YPRA 3LL7A 2LD5A 1ZG5A 2A6EF 3I59B 1T2KA 4I02A 3PJRA 1JGSA 4F91B 2KJCA 4QWQA 1LFBA 3C2HA 3F8BA 2KRCA 2QBYB 1ERDA 2EA2A 1JTYA 2ZMEC 4NC6A 2GLOA 3CMYA 2PN6A 3BT9A 4C9YA 2Y0MA 5K5OA 2JUGA 1YX3A 3Q0VA 3KX2A 3ABKH 2PLYA 1Z77A 3BZCA 2Y0SN 2MYSA 5EYRA 2MD5A 4Z2YA 4EV0A 2NNNA 1K6YA 3IAM2 3OIQA 1ZHFA 2NNYA 4A69C 1MMNA 1JKPC 2RN7A 2XGEA 1G6NA 2JN6A 4I99C 5FGMA 3FWEA 3T1BA 2WBMA 3CCUI 2EV5A 3GYHX 1ZN2A 4E7JA 3S93A 3CTAA 3GXOA 1TW3A 2KP6A 5DTDA 3MMYB 1FZPB 2K27A 2MBFA 5KK1A 1S5LC 2LVSA 4PJMA 1UJ8A 2QSFX 3MCZA 1JHFA 3QAHA 2NVYJ 1BIAA 4B48A 1I3AA 3KP6A 2E1OA 2LNBA 3L2UA 3EETA 1FP1D 4I2OA 5J40A 4EM0B 1IRXA 2M8GX 5DDGA 1X4PA 5E3OA 2W7NA 1B8IA 1OLTA 1X1BA 1YYVA 1LJ9A 1K78A 2K9NA 2NYXA 3OYGA 3OYNA 4ZTJA 1M1EB 5M3FJ 1K7AA 3WGGA 5LBQA 2OCEA 1H88C 4HRIA 5E79C 3SHFA 3Q3SA 3J80K 4IVNA 3EUAA 3Q0UA 1GV2A 1XMAA 2DJIA 2ZO4A 4HBLA 2RNGA 4XONA 1OKRA 1W36D 3HPHA 2ZXWH 2GA1A 4EVIA 1P6RA 1JTXA 2OQGA 3S3OA 1HW1A 1RPWA 4U87A 5FLXZ 1RR7A 2Y2ZA 1XSXA 3FKJA 1DUXC 1TL8A 3RZDJ 2DW4A 5GAGJ 1T6SA 1HSTA 4PDKA 3A01A 3A1YA 3E6CC 1GV5A 2ZCWA 1ETYA 5FLMJ 5E17F 2JJ7A 1D5YA 2PX9A 4A5MA 1A36A 4HF2A 1QO0D 2G7UA 2K9LA 4PJ0C 1MMGA 4BUPA 2NS0A 3G1LA 3GMEA 3BZKA 1G3YA 4U88A 2CYYA 4AUXA 2BGCA 1FIPA 1PDNC 5J1RA 1WZ2A 1YHQI 4KFCA 4MGRA 1VQ9I 2DA3A 2NAZA 2D2WA 5CLSA 3MFKA 2DFIA 1Q1HA 1GT0C 1Z7LA 4EM2A 2OJED 2FRHA 4E4HA 4LLNA 3OYLA 2COMA 1Y8QB 2L01A 2CMPA 2V6CA 1I3QJ 4A5NA 1FIAA 3ECOA 4B43A 1GVDA 3BPVA 5JI6A 3IRQA 5EGOA 5FLVA 2FNPA 2O5RA 1TWAJ 2DPDA 1R6RA 4HSTA 2O8XA 1AA7A 1D3YA 1LFUP 2QENA 3GTQJ 4RAGA 2KJBA 1HDPA 2HQNA 1FSEA 4Q4ZF 4EM1A 5K7FA 4AIJA 1LEBA 3C3WA 4FE4A 4XMYA 2X6XA 1JGGA 3I3LA 3R6SA 1B72A 1R4MB 1YOVB 2BBYA 4YRVA 2Z99A 4IL6C 1T8IA 3HOZJ 2LSOA 1LUJB 3HTSB 2M7BA 1G3WA 2A5YB 4UVAA 1R9TJ 4ZTFA 5GTIC 4RGSA 4A3IJ 2L0KA 5LHGA 4M9XA 4P1WA 2Z33A 4WF2A 2JPBA 5E3MA 3S3NA 3WU1B 1X1AA 1SFEA 1O3TA 1GHCA 3EUHA 1OMIA 3GLLA 1G59A 1TQMA 5D4SA 5CVRA 5EG0A 5IYBJ 2J5OA 4AVZA 1WJEA 3QYEA 1FWZA 2DMNA 3B6AA 1N78A 2HDDA 3K1NA 4CUGA 2P81A 1QU3A 1E3HA 1LE8A 4NHJA 2H6CA 4Y15A 1YIJI 2X0LA 5ED4A 3CCSI 1P92A 3FMRA 4EJTA 4WX9A 5B5EC 4LOCA 4B09A 1SFOJ 3QPSA 3LSKA 2QWWA 2F4OB 2L9SA 5EZGA 2JUCA 3V8JA 1UMQA 4IHVA 2DA4A 1QRYA 2DQLA 4A0YA 4GYGA 4A6EA 4IHWA 2JVGA 2EQRA 3K1PA 2L5QA 2XRNA 4X1EA 2KRHA 4EQQA 2DA1A 3NEUA 3E7LA 3ZPLA 1UHSA 2F5DA 2DK5A 1TZLA 3GF2A 2IS4A 2HGCA 1ZREA 2YSRA 4XOTA 3PNYA 3JCUC 4XRMA 3DXJF 3JR9A 1VQOI 1WH7A 1X58A 2OAZA 3SZTA 1NH3A 4F7ZA 1Z91A 4M9SA 1U2WA 5F1JA 2XKOA 3PFYA 3ZQLA 4AWXB 1IDYA 1IDZA 2TCTA 2X48A 5J8CA 2V26A 2YR2A 2CS3A 4Y4RA 5FO5A 3ZMSA 2H09A 4KYWA 1MDMB 1S6LA 4FQGA 2CW8A 3I53A 1W5CC 2STWA 2EPFA 2AQFA 4I6ZA 1BC7C 5D8LB 4XKCA 3EUHC 5DCMA 2MD0A 3KZYA 3OWTA 4UUSB 1FTZA 3H0GJ 5KAFC 3L2WA 1MNDA 3HOWJ 1VI0A 2RQPA 1QHHD 1X1CA 5LGNA 3BCBA 3CJQB 2EH3A 2LMDA 3CMAI 3BR5A 4HAMA 5GPCA 2KL4A 3RKYA 1PP7U 1J5YA 4I09A 5GAEJ 3KLNA 5HODA 2CGPA 2JA6J 3JSPA 4BHBA 4C3IJ 1J75A 3M3YJ 1BW5A 3OYFA 2PMZN 4MNUA 1Z0XA 2IW5A 5F64A 2KLOA 5HS8A 5FKMA 1YO5C 1EA3A 2M4GA 1MGTA 2DBBA 4B4CA 1K61A 1OYYA 2DMPA 4BY7J 2VXZA 4QPOA 3VOEA 4LG0B 1R1UA 3OR1C 4YG2F 1TNSA 9ANTA 4D5CA 3SXYA 1R5GA 3HC7A 2CQXA 3ELKA 3W6KB 1SVLA 1FLIA 2ISYA 2PEXA 2WAEA 3DCFA 2C6YA 1IXCA 3DP7A 2XB0X 3FXUA 1B4AA 2IA2A 3P5JA 3FXLA 1SFXA 3DBLB 3ULQB 2DA2A 4QSHA 1IC8A 2BEOA 2CUZA 2Q2EA 4LG3A 3E6MA 1BW6A 3IUOA 2P6TA 4MFEA 3VSKA 5CQGA 3L2QA 5FRNA 1TC3C 4CCMA 1DU6A 1UZCA 2UXXA 3FHNA 1V5FA 2DOEA 2X6YA 4ZYHA 4ZYAA 2M3AA 3TOBA 2CUFA 5TISC 2OU2A 3L7WA 4HV6A 4CDGA 1TBXA 2RC4A 3IKTA 3OL4A 4RAYA 2HZDA 2HNHA 2R7FA 4IHTA 3ECHA 1O4XA 2DODA 2KFDA 3S15J 2R7DA 5F0HA 2JZYA 2VBXA 1NK3P 5D4RA 2QVOA 5HNHA 2VJJA 4FTHA 2B63J 3KEOA 4WXCA 1C0WA 1WKMA 4GDFA 2YX4A 4MEYF 1K4SA 4A2UA 1Z3XA 3F22A 3HYIA 4V2FA 2MLGA 2K02A 1IRFA 2DLLA 2IPQX 4HX8A 3D5RC 2E1MB 3O8HA 1TWCJ 1U9OA 3K4NA 1J09A 2WADA 1BJZA 4FX0A 2DU9A 2ECBA 2EWNA 3FZVA 2QF7A 3JRGA 1U5TA 3VYSB 4IOCF 1IN8A 4I76A 3ZCOA 5C3EJ 4CXFA 3DQVC 2OPTA 1W5SA 2XV4S 3ABUA 5HLIA 1TTYA 1WPKA 2BV6A 3H3UA 1R00A 3OYBA 1IXSB 2NVUB 1R1VA 4A6DA 3HKZA 2CW7A 4PJJA 3LAJA 2RNJA 2DPUA 1T33A 3TW7A 1FYMA 2ZXJA 4N4OB 3H3VK 3I9V2 4EATA 4NQWB 4JP0A 3GTMJ 5CQEA 3JREA 1VQ7I 2NXNB 2VUMJ 3S32A 2IEKA 2QA4I 3R4KA 3TKYA 1XN7A 2BXYA 2EIKH 2OC6A 2L9VA 2WTEA 4JYKA 3NRVA 2E1CA 3QPTA 3UR3C 2ELKA 3CCQI 3BLYA 2IRFG 3K6GA 3U9GA 2E2IJ 3DBHB 3COAC 3V4GA 5BOXA 4I7HA 1Y56A 1U8BA 1AKHA 3SZPA 1ZAOA 1IRZA 3HB9A 4XLNF 3OYMA 2HOTA 4S0HB 4N9IA 4N4NB 1H9TA 3L1PA 4KN4X 2P0WA 3K4LA 2RGVA 3H36A 3TL4X 2CQNA 3PQJA 4NC8A 5JVTA 1BOBA 4UUTA 3ZOBA 2BW3A 3CUQC 4M72A 2M0MA 2GA2A 4E7IA 1D1CA 2IP2A 2J5PA 5HLTA 2QQAA 1BJAA 2XC7A 1T38A 4NNJA 2QZ8A 1ETQA 2FOKA 2XSJC 1ETKA 1U5TC 3V8KA 1NK2P 3O8GA 3S3MA 2KT0A 4RBOA 4PGHA 2V1NA 1MH3A 5IT9Z 1HCRA 4S05A 1U3EM 1T98A 4HZFA 4RLFA 2FBIA 4C2TA 1Z05A 4C30A 1FY7A 1YE9A 3IL2A 5E3NA 3GTGJ 3TDUC 3KLOA 4CSWA 2HDWA 4ZZLA 4BJ6C 5LGUA 5DD4A 3E0JB 1OPCA 4BJ5C 2DA6A 1O7LA 3HPGA 1FNNA 1EF4A 2ZJQF 1ZYRF 1XCBA 1Z1DA
chains in the Genus database with same CATH topology
4WCGA 1HBXG 1LB2A 2EFPA 1IN5A 5JHUA 4Q5SF 4HF1A 3FHZA 3DFGA 2JTVA 2FF4A 1X3UA 2P6SA 5K1YA 3K1MA 2Y75A 4UVCA 3L00A 1XSVA 2XASA 3D0SA 3HRTA 1YS6A 2V1UA 2P4WA 4BHCA 1RI7A 1LEAA 1QGPA 1TQIA 3IWFA 5LRSA 4PZJA 2CO5A 2CG4A 3O3KA 3B73A 3BZ6A 1IW7F 2AS5F 2PG4A 2XKPA 2IA0A 4KDPA 4ON0A 4HOBA 5LEKA 1S7OA 4XRFA 5CVVA 1YIOA 3GFIA 2EFQA 4BXUA 2UZKA 2GIVA 5ICFA 4WK8F 3CLOA 3P7NA 2L3DA 2VE8A 2ZMEA 3IC7A 3MAJA 2WV0A 1IN4A 2W85A 1H0MA 4G9YA 1IAWA 4HV5A 3E97A 1K6OA 4PGGA 5HDGA 2PBIA 3R61A 2BYVE 4R79A 1ON1A 2NRAC 2FQ3A 1BC8C 3J7AO 1RIOH 3GVAA 1P4XA 2TDXA 2ADUA 2B0LA 4JK1X 4UXNA 2G9WA 1YW7A 3BY6A 4HX4A 1ZG3A 2A69F 5DUIA 1O3QA 1V4RA 5L3FA 3QU6A 4I01A 5HOOA 2CQKA 2EFNA 3MZHA 1IZ1A 1S29A 1G4DA 1Z6RA 1R7JA 2A68F 4OMZA 1OYWA 3TO6A 4OU0A 4UV9A 1R58A 5LRRA 2ETHA 2VBZA 3M8EA 3V7CA 2KKOA 2OBPA 3WU0A 2HTSA 5D5XB 2EK5A 3P9IA 4G94A 1FC3A 4GCVA 5IT3A 3HRSA 4AIKA 4OIPF 1VTNC 4R8HA 2D1HA 3GUDA 2FSWA 2P5VA 3EYYA 3G73A 4UUVA 1J2XA 1KU3A 3C7JA 3RYRA 3U1DA 4DQ2A 4CHUA 4FT8A 1FX7A 4L9JA 4EJUA 2M1BA 4RGUA 2QQBA 4ASNA 1SFUA 3MWMA 4MEXF 1R36A 2DAOA 4ENKA 2ZNYA 4AVPA 2HZTA 3R0JA 1RUNA 1XCVA 5L3GA 3LAPA 1KGSA 2EV6A 3M9AA 3GFMA 2XVCA 3R60A 3J80Z 2VBYA 2OA4A 1ZYRF 3JAMK 2QQ9A 2A61A 1W4MA 3E5UA 4ENNA 2KRFA 3ZQ7A 3GZ6A 5E8GA 1YTYA 4HDUA 2LF8A 5K5RA 5FLXK 1FYLA 5ERIA 2HFHA 5D5UB 1NHAA 4MTEA 3QRFF 3HTUA 4I0AA 4LB6B 4U0VA 2JRTA 1ODDA 1BOAA 1USTA 4BH9A 2MC3A 5JR3A 3F72A 2HTJA 4MQVA 1CF7A 5FD6A 3FM3A 3WGIA 4MHGA 2FXAA 3KP3A 4O6JA 1Z7UA 3DPLC 4IJAA 5FB2A 1D5VA 3NQOA 1TNTA 5E1ZB 3M1EA 3TGNA 2XAFA 4QLCU 2W24A 4I98B 3MEXA 1QPMA 5LGTA 2Z5UA 5FD5A 1FPQA 2O61A 2E7WA 5HLHA 1XGNA 2PI0A 4G6QA 1HSJA 2DK8A 4LLLA 1I6XA 1BI2A 4P55A 2FMLA 4KNYA 1I1GA 2Q0OA 3BWGA 2L4AA 5E18F 3KP4A 1ZARA 3KZZA 3WG9A 2CSOA 3AAFA 4IHSA 4O3MA 3DF8A 1QBJA 1MD0A 1FSHA 2DT5A 4GXOA 5LHIA 4OIOF 3QOPA 3BPXA 2H94A 5H6RA 4Y13A 3TDZC 3CDHA 2JSCA 2XIGA 2WC2A 4G6DA 2K7LA 5ILUA 3P9CA 3WE2A 3PQKA 3WTVC 2F5CA 1FOKA 3HSFA 4M6XA 3WODF 2HYGD 3MZYA 3RIRA 2L02A 2H27A 1FYKA 5HDKA 3EQLF 1L3LA 3RKWA 1RNLA 1XSDA 2L4MA 3D5LA 1ZGAA 2PMHA 5ILVA 2GWRA 3BJOA 1SD5A 3QPHA 4I0BA 3HHGA 4U0WA 3RJPA 1ZRDA 5LHHA 3LFKA 1HKTA 1F5TA 4RB1A 4XLPF 3M7GA 4XSZF 3HOTA 4M6YA 4UNOA 3I54A 5BPDA 2HR3A 2STTA 2ZFWA 4O5VA 3QU3A 3E5QA 2M8EA 1WQ2A 5HDNA 4G7HF 1KQ9A 4IXAA 2KIUA 1IXRC 3RTRA 4OOIA 2G7HA 1GXPA 1XD7A 4UVBA 3F21A 3VFZA 3O6BB 4OIQF 1JHHA 2VC1A 1QQIA 2VOOA 2HQRA 1B1BA 2V79A 1F4KA 3CUQA 1XMKA 1YFHA 3GFLA 4CYDA 1T39A 2GXBA 4EJOA 5DV5A 3ROUA 3BOQA 3KETA 4RGXA 2QM3A 1IN7A 4YIFA 1LDKB 4A12A 2LF7A 4A0XA 3GO5A 5HVQC 5ILSA 2OQRA 4CGZA 3J81K 3OV8A 2CW0F 5DYMA 3WTTC 1R23A 4HX7A 3FX3A 5CVIA 3IKVA 1JE8A 2XHKA 3RYPA 5D8KB 2VODA 5TRDA 2WWYA 3KP2A 2VE9A 1SMTA 4LMYA 3LWFA 3DKWA 2ZMEB 1UHWA 1FBSA 3F8MA 2V9VA 1XGMA 4ZYGA 1R5HA 3L9FA 2W57A 1B6AA 1FP2A 2F5FA 3HRMA 5H20A 5BMZA 1W7PA 1PP8F 2KIFA 4Q48A 3GZ5A 2RDPA 4TV7A 1REPC 5H6QA 4BYYA 4LG0A 3C1DA 2LKPA 2EV0A 3REOA 3FF5A 3EYIA 3JW4A 5L3DA 2E7XA 2XAJA 4KMFA 1HKQA 2FMYA 4RB3C 5IT9K 4ZZDA 3H3ZA 3I64A 3ISPA 4M73A 4LLGF 1U6GA 1BM9A 1AWCA 2VC0A 3DPTA 2XGXA 4YFNF 1V3FA 4Y17A 5LLQA 2MA3A 2LDUA 3JTHA 4UV8A 4L0YB 2VOPA 4L18B 3ZN0A 5BS6A 1KYWA 1HXDA 1WWXA 3WTZA 2EA4A 1J7KA 2P8TA 2P5KA 1EH6A 4E70A 2EB7A 2MLKA 5AONA 2IA1A 4HW0A 5L3EA 4P5OA 2D1VA 3RPUA 3VB2A 2BE5F 2HDCA 4WXHA 4HA8A 3SFZA 2HEOA 3F6VA 4K2EA 5CVJA 1K78B 2X4HA 2GXGA 3E6DA 2RV8A 2JPCA 4YFKF 3BDDA 4FX4A 1FBQA 1F1ZA 1MJBA 1IRGA 3GX4X 2OZ6A 2QUFA 1BI1A 6PAXA 3WTWC 1MJ9A 3BJ6A 3LQRA 3ZMZA 5D6EA 4HQMA 1H9GA 4M71A 3BROA 1DP7P 5ICEA 5ICCA 4U0YA 1ON2A 4A0ZA 2XAHA 1OR7A 2W25A 2F5EA 4BNCA 1KU9A 1D8JA 4AD9A 5A2QK 1DPRA 3HRUA 1QZYA 4D0PA 5HLGA 1EH8A 4EGZA 4OMYA 1SD4A 1QZZA 1GXQA 1I1SA 2DI3A 2ACJA 3TQNA 4OIRF 2HKOA 2FE3A 1YG2A 4N0BA 2M87A 4LD5A 3PFIA 3GFJA 1B9MA 4LB5A 1CF7B 3I71A 1UCRA 2FU4A 2HS5A 2VONA 1LDJA 5L3BA 5KVRA 1WRJA 3KP5A 2D45A 5BPIA 5EEGA 3R0AA 1J9IA 1YQAA 1KU2A 1U78A 1T0FA 3TO9A 5DUKA 1FT9A 2O3FA 5E1XA 4IRHA 3HUGA 4KUMA 4NB5A 5K5QA 4ENJA 1YW8A 3F6OA 2A3SA 5FFXA 3ERED 5E1WA 5BQTA 4R1HA 4LK1F 5FFZA 3U2RA 2VT2A 2CWEA 2ZKZA 2RVCA 4EGYA 2ZJ2A 3KCCA 4ENMA 5DD8A 1G3TA 1UFMA 3F8NA 3Q9SA 4BHPA 3JAMZ 1HW2A 3F3XA 3HSRA 2Y48A 4ESBA 2K86A 4ZH4F 2E1NA 2FNAA 4L5JA 3ZN1A 1SD7A 4L0ZB 4ZYDA 4LJZF 2F2EA 2UXNA 1XB4A 3DV8A 5D6FA 1TW2A 5DCMB 3WTSC 3T8RA 4L9VA 1MZBA 2ESNA 2O03A 2A6HF 2GAUA 2XUBA 2IVMA 3LA7A 4LGWA 5CYVA 3WTXC 3O2PE 2EFWA 3HSEA 4PCQA 2P5LC 1Z9CA 3EDPA 5D5VB 2O0YA 3I59A 2QBYA 3IWZA 1LQ1A 3IRRA 1XCBA 1BI0A 5DCFA 1S8NA 1D8KA 3ZP5A 2FA5A 4EJVA 2MH9A 2Z9OA 5CVUA 3LA2A 3MQ0A 1W5TA 4FHTA 3JTGA 3GEZA 1HW5A 4H0EA 2DQRA 3KEQA 1L0OC 3ABTA 3RI4A 5EEHA 2P7CB 1O3SA 3I5UA 3V7RA 3WE3A 4G7ZF 1IF1A 3CUQB 4IRGA 1KYZA 2PFBA 1B59A 1YS7A 4RAZA 1U5TB 2HOEA 4XSXF 3W6JB 3CO6C 2V1DA 1TQPA 1YLFA 2PQ8A 3CO7C 1HQCA 1EV7A 4EJWA 1BBYA 2K4JA 4KT5C 2ZNZA 1O7FA 5J8FA 2FBKA 1R22A 1P2FA 4ZYEA 1CGPA 1P4WA 2ELHA 4IRIA 1O3RA 3L09A 4IPAA 4KMUX 1OYIA 2QYOA 5AIPA 2VT3A 2PJPA 1R1TA 3QP6A 3HOSA 1J0RA 1WSUA 3ZMUA 2YU3A 1USSA 4B8XA 5D5WB 3T8TA 3OOPA 1TLHB 1J59A 4ESJA 4UHTA 4CZZA 3E5XA 3C18A 5E20A 1W7PB 5HS9A 3F23A 4P96A 2XAGA 1XGSA 4JBAA 2HWVA 2DTRA 2EFOA 3N4MA 2M45A 1BN5A 3E6BA 3F8FA 3G3ZA 3FMSA 2HYFA 5LEJA 4KIBA 3KFWX 1XDUA 2CFXA 4GGGA 4EMSA 4L5IA 2L54A 1LVAA 5F6FA 1S3JA 4P9UA 2W84A 1LNWA 3WGHA 2P7VB 1GVJA 1IUYA 5CJ9A 2OD5A 3HIFA 2FBHA 1A04A 2GQQA 1ZLKA 4L9TA 4MQ9F 1RUOA 3FM5A 4YFXF 5L3CA 1ZLJA 4HF0A 4G8XA 4L9NA 3L2CA 2KIMA 1E2XA 3LA3A 2AXLA 3FMQA 4HYEA 3I0TA 1SAXA 4HQEA 4P9FA 3Q9VA 2JT1A 2H6BA 1F9NA 3J81Z 2XAQA 2ZBKA 4U7DA 1ZG1A 2MH2A 2IJLA 1BI3A 1Z6TA 4XBFA 2OZUA 4BQAA 3ZMTA 2FEZA 1MDMA 2EJRA 3RDIA 4M9ZA 4WWCA 1PUEE 3QP5A 1KQ8A 4GYIA 1KA8A 3V7SA 3ML6A 4CO8A 2VN2A 4ETSA 4HLYA 4KIGA 1YW9A 1BIBA 4RS8A 4WXDA 1SMYF 4CICA 1ONVA 3H92A 1K79A 4AIHA 3N97A 3WTYC 4N9HA 1ZRCA 4KA4A 1AOYA 3CJNA 5JFRA 1U8RA 1S7AA 3GW2A 4RGRA 3BJAA 1STZA 1KQ0A 1UB9A 4Q47A 1HKSA 1Y0UA 3V8LA 2XROA 3FXQA 3SQNA 3B02A 1LDDA 1UHMA 3S2WA 2ISZA 1MKMA 1JXSA 2GZWA 1P4AA 1SD6A 5F1RA 3T5XA 3K2ZA 3GWZA 1I27A 2Q8KA 3ZMDA 5ICGA 4LFUA 2UWMA 1ZRFA 1I5ZA 1O57A 3TOAA 3M8FA 1B9NA 4U7BA 2ESHA 1XGOA 1WI9A 3BP8A 4RB2C 2YX7A 3Q5FA 3I4PA 4KICA 5TJJA 1FBUA 1W7PD 2R3SA 5J6XA 3P9KA 3KP7A 4DNCA 2M30A 1EH7A 1DPUA 3DEUA 3KE2A 5AIQA 4LK0F 1XDSA 5DEQA 3LSTA 5E8IA 4KN7X 4M74A 4GO1A 2PMUA 4KIFA 3VODA 4MTDA 2IT0A 4NQWA 2V1XA 4HLXA 1KU7A 3HHHA 3ZMVA 3GLXA 3RKXA 3F8CA 1ZGJA 2QLZA 3LQQA 1IN6A 2A07F 2K4BA 5A2QZ 4IF4A 4ESFA 4S04A 3T0YA 4RB0A 3K9TA 2Z3YA 1RZ4A 1DDNA 2RKHA 3RPQA 3WTUC 3CUOA 2HKXA 4HDVA 4YIIA 3TO7A 1G3SA 5HS7A 2M5WA 4G7OF 1QNTA 2O6GE 2DO7A 1E17A 4JQFA 3FXRA 3K69A 4OINF 2VBWA 4BAYA 3I58A 1MJAA 3VEPA 3E3VA 3K0LA 3JSOA 1ULYA 2YPRA 1ZG5A 2A6EF 3I59B 1T2KA 4I02A 1JGSA 2KJCA 4QWQA 2QBYB 3F8BA 2EA2A 2PN6A 2Y0MA 5K5OA 2PLYA 2MD5A 4Z2YA 4EV0A 2NNNA 1ZHFA 2NNYA 2RN7A 1G6NA 5FGMA 3FWEA 3T1BA 2EV5A 3GYHX 1ZN2A 3CTAA 3GXOA 1TW3A 1FZPB 2K27A 2MBFA 5KK1A 3MCZA 1JHFA 3QAHA 1BIAA 3KP6A 2LNBA 3EETA 1FP1D 4I2OA 4EM0B 5DDGA 1YYVA 1LJ9A 1K78A 2NYXA 1K7AA 3WGGA 5LBQA 3SHFA 3J80K 4IVNA 4HBLA 1XMAA 2ZO4A 1OKRA 2GA1A 4EVIA 1P6RA 2OQGA 1HW1A 5FLXZ 1XSXA 1DUXC 2DW4A 1T6SA 1HSTA 4PDKA 3E6CC 2ZCWA 5E17F 4A5MA 4HF2A 1QO0D 2G7UA 2NS0A 1G3YA 4U88A 2CYYA 2BGCA 1PDNC 4KFCA 4MGRA 2NAZA 2D2WA 5CLSA 3MFKA 2DFIA 1Q1HA 4EM2A 2FRHA 4LLNA 2COMA 2L01A 2V6CA 4A5NA 3ECOA 5JI6A 3BPVA 3IRQA 2FNPA 2DPDA 2O8XA 1D3YA 2QENA 2KJBA 2HQNA 1FSEA 4Q4ZF 4EM1A 1LEBA 4AIJA 3C3WA 3R6SA 2BBYA 2Z99A 2LSOA 3HTSB 1G3WA 2A5YB 4UVAA 4RGSA 5LHGA 2Z33A 4WF2A 2JPBA 3WU1B 1SFEA 1O3TA 1GHCA 3EUHA 1OMIA 1TQMA 5D4SA 5CVRA 2J5OA 1FWZA 3K1NA 4NHJA 2H6CA 4Y15A 2X0LA 5ED4A 1P92A 3FMRA 4EJTA 4WX9A 4B09A 2QWWA 3V8JA 2DQLA 4A0YA 4GYGA 4A6EA 3K1PA 2XRNA 4EQQA 3NEUA 3ZPLA 2F5DA 2DK5A 3GF2A 2HGCA 1ZREA 2YSRA 3DXJF 2OAZA 3SZTA 4F7ZA 1Z91A 4M9SA 1U2WA 2XKOA 4AWXB 5J8CA 2YR2A 5FO5A 3ZMSA 2H09A 4KYWA 1MDMB 1S6LA 3I53A 2STWA 1BC7C 5D8LB 5DCMA 3KZYA 2RQPA 5LGNA 4HAMA 3RKYA 1PP7U 1J5YA 4I09A 3KLNA 2CGPA 3JSPA 4BHBA 1J75A 4MNUA 2IW5A 5F64A 5HS8A 1YO5C 1MGTA 2DBBA 1OYYA 2VXZA 3VOEA 4LG0B 1R1UA 4YG2F 1TNSA 3SXYA 1R5GA 3W6KB 3ELKA 1FLIA 2ISYA 2PEXA 2C6YA 1IXCA 3DP7A 3FXUA 1B4AA 2IA2A 1SFXA 3ULQB 2BEOA 2Q2EA 3E6MA 2P6TA 2UXXA 4ZYHA 3TOBA 2OU2A 3L7WA 4HV6A 4CDGA 1TBXA 2RC4A 3IKTA 4RAYA 2R7FA 4IHTA 3ECHA 2R7DA 2JZYA 2VBXA 5D4RA 2QVOA 3KEOA 4WXCA 1C0WA 1WKMA 2YX4A 4MEYF 4A2UA 3F22A 3HYIA 2MLGA 2K02A 1IRFA 2DLLA 2IPQX 4HX8A 4FX0A 2DU9A 2EWNA 3FZVA 1U5TA 1IN8A 4CXFA 3DQVC 1W5SA 2XV4S 3ABUA 5HLIA 1TTYA 3H3UA 2BV6A 1R00A 1IXSB 1R1VA 4A6DA 3LAJA 2RNJA 2DPUA 1FYMA 2ZXJA 3R4KA 3TKYA 1XN7A 2WTEA 3NRVA 2E1CA 3QPTA 2IRFG 3U9GA 3COAC 3V4GA 5BOXA 4I7HA 3SZPA 1ZAOA 4XLNF 4N9IA 1H9TA 4KN4X 2RGVA 3PQJA 5JVTA 3CUQC 4M72A 2GA2A 2IP2A 2J5PA 2QQAA 1BJAA 1T38A 2QZ8A 3V8KA 2FOKA 1U5TC 4PGHA 5IT9Z 4S05A 1U3EM 1T98A 4HZFA 2FBIA 1Z05A 1FY7A 3IL2A 3TDUC 3KLOA 4ZZLA 5LGUA 5DD4A 1OPCA 1O7LA 1FNNA 1ZH5A 4M9XA 3IHUA 1Z1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCG A;  1HBX G;  1LB2 A;  2EFP A;  1IN5 A;  5JHU A;  4Q5S F;  4HF1 A;  3FHZ A;  3DFG A;  2JTV A;  2FF4 A;  1X3U A;  2P6S A;  5K1Y A;  3K1M A;  2Y75 A;  4UVC A;  3L00 A;  1XSV A;  2XAS A;  3D0S A;  3HRT A;  1YS6 A;  2V1U A;  2P4W A;  4BHC A;  1RI7 A;  1LEA A;  1QGP A;  1TQI A;  3IWF A;  5LRS A;  4PZJ A;  2CO5 A;  2CG4 A;  3O3K A;  3B73 A;  3BZ6 A;  1IW7 F;  2AS5 F;  2PG4 A;  2XKP A;  2IA0 A;  4KDP A;  4ON0 A;  4HOB A;  5LEK A;  1S7O A;  4XRF A;  5CVV A;  1YIO A;  3GFI A;  2EFQ A;  4BXU A;  2UZK A;  2GIV A;  5ICF A;  4WK8 F;  3CLO A;  3P7N A;  2L3D A;  2VE8 A;  2ZME A;  3IC7 A;  3MAJ A;  2WV0 A;  1IN4 A;  2W85 A;  1H0M A;  4G9Y A;  1IAW A;  4HV5 A;  3E97 A;  1K6O A;  4PGG A;  5HDG A;  2PBI A;  3R61 A;  2BYV E;  4R79 A;  1ON1 A;  2NRA C;  2FQ3 A;  1BC8 C;  3J7A O;  1RIO H;  3GVA A;  1P4X A;  2TDX A;  2ADU A;  2B0L A;  4JK1 X;  4UXN A;  2G9W A;  1YW7 A;  3BY6 A;  4HX4 A;  1ZG3 A;  2A69 F;  5DUI A;  1O3Q A;  1V4R A;  5L3F A;  3QU6 A;  4I01 A;  5HOO A;  2CQK A;  2EFN A;  3MZH A;  1IZ1 A;  1S29 A;  1G4D A;  1Z6R A;  1R7J A;  2A68 F;  4OMZ A;  1OYW A;  3TO6 A;  4OU0 A;  4UV9 A;  1R58 A;  5LRR A;  2ETH A;  2VBZ A;  3M8E A;  3V7C A;  2KKO A;  2OBP A;  3WU0 A;  2HTS A;  5D5X B;  2EK5 A;  3P9I A;  4G94 A;  1FC3 A;  4GCV A;  5IT3 A;  3HRS A;  4AIK A;  4OIP F;  1VTN C;  4R8H A;  2D1H A;  3GUD A;  2FSW A;  2P5V A;  3EYY A;  3G73 A;  4UUV A;  1J2X A;  1KU3 A;  3C7J A;  3RYR A;  3U1D A;  4DQ2 A;  4CHU A;  4FT8 A;  1FX7 A;  4L9J A;  4EJU A;  2M1B A;  4RGU A;  2QQB A;  4ASN A;  1SFU A;  3MWM A;  4MEX F;  1R36 A;  2DAO A;  4ENK A;  2ZNY A;  4AVP A;  2HZT A;  3R0J A;  1RUN A;  1XCV A;  5L3G A;  3LAP A;  1KGS A;  2EV6 A;  3M9A A;  3GFM A;  2XVC A;  3R60 A;  3J80 Z;  2VBY A;  2OA4 A;  1ZYR F;  3JAM K;  2QQ9 A;  2A61 A;  1W4M A;  3E5U A;  4ENN A;  2KRF A;  3ZQ7 A;  3GZ6 A;  5E8G A;  1YTY A;  4HDU A;  2LF8 A;  5K5R A;  5FLX K;  1FYL A;  5ERI A;  2HFH A;  5D5U B;  1NHA A;  4MTE A;  3QRF F;  3HTU A;  4I0A A;  4LB6 B;  4U0V A;  2JRT A;  1ODD A;  1BOA A;  1UST A;  4BH9 A;  2MC3 A;  5JR3 A;  3F72 A;  2HTJ A;  4MQV A;  1CF7 A;  5FD6 A;  3FM3 A;  3WGI A;  4MHG A;  2FXA A;  3KP3 A;  4O6J A;  1Z7U A;  3DPL C;  4IJA A;  5FB2 A;  1D5V A;  3NQO A;  1TNT A;  5E1Z B;  3M1E A;  3TGN A;  2XAF A;  4QLC U;  2W24 A;  4I98 B;  3MEX A;  1QPM A;  5LGT A;  2Z5U A;  5FD5 A;  1FPQ A;  2O61 A;  2E7W A;  5HLH A;  1XGN A;  2PI0 A;  4G6Q A;  1HSJ A;  2DK8 A;  4LLL A;  1I6X A;  1BI2 A;  4P55 A;  2FML A;  4KNY A;  1I1G A;  2Q0O A;  3BWG A;  2L4A A;  5E18 F;  3KP4 A;  1ZAR A;  3KZZ A;  3WG9 A;  2CSO A;  3AAF A;  4IHS A;  4O3M A;  3DF8 A;  1QBJ A;  1MD0 A;  1FSH A;  2DT5 A;  4GXO A;  5LHI A;  4OIO F;  3QOP A;  3BPX A;  2H94 A;  5H6R A;  4Y13 A;  3TDZ C;  3CDH A;  2JSC A;  2XIG A;  2WC2 A;  4G6D A;  2K7L A;  5ILU A;  3P9C A;  3WE2 A;  3PQK A;  3WTV C;  2F5C A;  1FOK A;  3HSF A;  4M6X A;  3WOD F;  2HYG D;  3MZY A;  3RIR A;  2L02 A;  2H27 A;  1FYK A;  5HDK A;  3EQL F;  1L3L A;  3RKW A;  1RNL A;  1XSD A;  2L4M A;  3D5L A;  1ZGA A;  2PMH A;  5ILV A;  2GWR A;  3BJO A;  1SD5 A;  3QPH A;  4I0B A;  3HHG A;  4U0W A;  3RJP A;  1ZRD A;  5LHH A;  3LFK A;  1HKT A;  1F5T A;  4RB1 A;  4XLP F;  3M7G A;  4XSZ F;  3HOT A;  4M6Y A;  4UNO A;  3I54 A;  5BPD A;  2HR3 A;  2STT A;  2ZFW A;  4O5V A;  3QU3 A;  3E5Q A;  2M8E A;  1WQ2 A;  5HDN A;  4G7H F;  1KQ9 A;  4IXA A;  2KIU A;  1IXR C;  3RTR A;  4OOI A;  2G7H A;  1GXP A;  1XD7 A;  4UVB A;  3F21 A;  3VFZ A;  3O6B B;  4OIQ F;  1JHH A;  2VC1 A;  1QQI A;  2VOO A;  2HQR A;  1B1B A;  2V79 A;  1F4K A;  3CUQ A;  1XMK A;  1YFH A;  3GFL A;  4CYD A;  1T39 A;  2GXB A;  4EJO A;  5DV5 A;  3ROU A;  3BOQ A;  3KET A;  4RGX A;  2QM3 A;  1IN7 A;  4YIF A;  1LDK B;  4A12 A;  2LF7 A;  4A0X A;  3GO5 A;  5HVQ C;  5ILS A;  2OQR A;  4CGZ A;  3J81 K;  3OV8 A;  2CW0 F;  5DYM A;  3WTT C;  1R23 A;  4HX7 A;  3FX3 A;  5CVI A;  3IKV A;  1JE8 A;  2XHK A;  3RYP A;  5D8K B;  2VOD A;  5TRD A;  2WWY A;  3KP2 A;  2VE9 A;  1SMT A;  4LMY A;  3LWF A;  3DKW A;  2ZME B;  1UHW A;  1FBS A;  3F8M A;  2V9V A;  1XGM A;  4ZYG A;  1R5H A;  3L9F A;  2W57 A;  1B6A A;  1FP2 A;  2F5F A;  3HRM A;  5H20 A;  5BMZ A;  1W7P A;  1PP8 F;  2KIF A;  4Q48 A;  3GZ5 A;  2RDP A;  4TV7 A;  1REP C;  5H6Q A;  4BYY A;  4LG0 A;  3C1D A;  2LKP A;  2EV0 A;  3REO A;  3FF5 A;  3EYI A;  3JW4 A;  5L3D A;  2E7X A;  2XAJ A;  4KMF A;  1HKQ A;  2FMY A;  4RB3 C;  5IT9 K;  4ZZD A;  3H3Z A;  3I64 A;  3ISP A;  4M73 A;  4LLG F;  1U6G A;  1BM9 A;  1AWC A;  2VC0 A;  3DPT A;  2XGX A;  4YFN F;  1V3F A;  4Y17 A;  5LLQ A;  2MA3 A;  2LDU A;  3JTH A;  4UV8 A;  4L0Y B;  2VOP A;  4L18 B;  3ZN0 A;  5BS6 A;  1KYW A;  1HXD A;  1WWX A;  3WTZ A;  2EA4 A;  1J7K A;  2P8T A;  2P5K A;  1EH6 A;  4E70 A;  2EB7 A;  2MLK A;  5AON A;  2IA1 A;  4HW0 A;  5L3E A;  4P5O A;  2D1V A;  3RPU A;  3VB2 A;  2BE5 F;  2HDC A;  4WXH A;  4HA8 A;  3SFZ A;  2HEO A;  3F6V A;  4K2E A;  5CVJ A;  1K78 B;  2X4H A;  2GXG A;  3E6D A;  2RV8 A;  2JPC A;  4YFK F;  3BDD A;  4FX4 A;  1FBQ A;  1F1Z A;  1MJB A;  1IRG A;  3GX4 X;  2OZ6 A;  2QUF A;  1BI1 A;  6PAX A;  3WTW C;  1MJ9 A;  3BJ6 A;  3LQR A;  3ZMZ A;  5D6E A;  4HQM A;  1H9G A;  4M71 A;  3BRO A;  1DP7 P;  5ICE A;  5ICC A;  4U0Y A;  1ON2 A;  4A0Z A;  2XAH A;  1OR7 A;  2W25 A;  2F5E A;  4BNC A;  1KU9 A;  1D8J A;  4AD9 A;  5A2Q K;  1DPR A;  3HRU A;  1QZY A;  4D0P A;  5HLG A;  1EH8 A;  4EGZ A;  4OMY A;  1SD4 A;  1QZZ A;  1GXQ A;  1I1S A;  2DI3 A;  2ACJ A;  3TQN A;  4OIR F;  2HKO A;  2FE3 A;  1YG2 A;  4N0B A;  2M87 A;  4LD5 A;  3PFI A;  3GFJ A;  1B9M A;  4LB5 A;  1CF7 B;  3I71 A;  1UCR A;  2FU4 A;  2HS5 A;  2VON A;  1LDJ A;  5L3B A;  5KVR A;  1WRJ A;  3KP5 A;  2D45 A;  5BPI A;  5EEG A;  3R0A A;  1J9I A;  1YQA A;  1KU2 A;  1U78 A;  1T0F A;  3TO9 A;  5DUK A;  1FT9 A;  2O3F A;  5E1X A;  4IRH A;  3HUG A;  4KUM A;  4NB5 A;  5K5Q A;  4ENJ A;  1YW8 A;  3F6O A;  2A3S A;  5FFX A;  3ERE D;  5E1W A;  5BQT A;  4R1H A;  4LK1 F;  5FFZ A;  3U2R A;  2VT2 A;  2CWE A;  2ZKZ A;  2RVC A;  4EGY A;  2ZJ2 A;  3KCC A;  4ENM A;  5DD8 A;  1G3T A;  1UFM A;  3F8N A;  3Q9S A;  4BHP A;  3JAM Z;  1HW2 A;  3F3X A;  3HSR A;  2Y48 A;  4ESB A;  2K86 A;  4ZH4 F;  2E1N A;  2FNA A;  4L5J A;  3ZN1 A;  1SD7 A;  4L0Z B;  4ZYD A;  4LJZ F;  2F2E A;  2UXN A;  1XB4 A;  3DV8 A;  5D6F A;  1TW2 A;  5DCM B;  3WTS C;  3T8R A;  4L9V A;  1MZB A;  2ESN A;  2O03 A;  2A6H F;  2GAU A;  2XUB A;  2IVM A;  3LA7 A;  4LGW A;  5CYV A;  3WTX C;  3O2P E;  2EFW A;  3HSE A;  4PCQ A;  2P5L C;  1Z9C A;  3EDP A;  5D5V B;  2O0Y A;  3I59 A;  2QBY A;  3IWZ A;  1LQ1 A;  3IRR A;  1XCB A;  1BI0 A;  5DCF A;  1S8N A;  1D8K A;  3ZP5 A;  2FA5 A;  4EJV A;  2MH9 A;  2Z9O A;  5CVU A;  3LA2 A;  3MQ0 A;  1W5T A;  4FHT A;  3JTG A;  3GEZ A;  1HW5 A;  4H0E A;  2DQR A;  3KEQ A;  1L0O C;  3ABT A;  3RI4 A;  5EEH A;  2P7C B;  1O3S A;  3I5U A;  3V7R A;  3WE3 A;  4G7Z F;  1IF1 A;  3CUQ B;  4IRG A;  1KYZ A;  2PFB A;  1B59 A;  1YS7 A;  4RAZ A;  1U5T B;  2HOE A;  4XSX F;  3W6J B;  3CO6 C;  2V1D A;  1TQP A;  1YLF A;  2PQ8 A;  3CO7 C;  1HQC A;  1EV7 A;  4EJW A;  1BBY A;  2K4J A;  4KT5 C;  2ZNZ A;  1O7F A;  5J8F A;  2FBK A;  1R22 A;  1P2F A;  4ZYE A;  1CGP A;  1P4W A;  2ELH A;  4IRI A;  1O3R A;  3L09 A;  4IPA A;  4KMU X;  1OYI A;  2QYO A;  5AIP A;  2VT3 A;  2PJP A;  1R1T A;  3QP6 A;  3HOS A;  1J0R A;  1WSU A;  3ZMU A;  2YU3 A;  1USS A;  4B8X A;  5D5W B;  3T8T A;  3OOP A;  1TLH B;  1J59 A;  4ESJ A;  4UHT A;  4CZZ A;  3E5X A;  3C18 A;  5E20 A;  1W7P B;  5HS9 A;  3F23 A;  4P96 A;  2XAG A;  1XGS A;  4JBA A;  2HWV A;  2DTR A;  2EFO A;  3N4M A;  2M45 A;  1BN5 A;  3E6B A;  3F8F A;  3G3Z A;  3FMS A;  2HYF A;  5LEJ A;  4KIB A;  3KFW X;  1XDU A;  2CFX A;  4GGG A;  4EMS A;  4L5I A;  2L54 A;  1LVA A;  5F6F A;  1S3J A;  4P9U A;  2W84 A;  1LNW A;  3WGH A;  2P7V B;  1GVJ A;  1IUY A;  5CJ9 A;  2OD5 A;  3HIF A;  2FBH A;  1A04 A;  2GQQ A;  1ZLK A;  4L9T A;  4MQ9 F;  1RUO A;  3FM5 A;  4YFX F;  5L3C A;  1ZLJ A;  4HF0 A;  4G8X A;  4L9N A;  3L2C A;  2KIM A;  1E2X A;  3LA3 A;  2AXL A;  3FMQ A;  4HYE A;  3I0T A;  1SAX A;  4HQE A;  4P9F A;  3Q9V A;  2JT1 A;  2H6B A;  1F9N A;  3J81 Z;  2XAQ A;  2ZBK A;  4U7D A;  1ZG1 A;  2MH2 A;  2IJL A;  1BI3 A;  1Z6T A;  4XBF A;  2OZU A;  4BQA A;  3ZMT A;  2FEZ A;  1MDM A;  2EJR A;  3RDI A;  4M9Z A;  4WWC A;  1PUE E;  3QP5 A;  1KQ8 A;  4GYI A;  1KA8 A;  3V7S A;  3ML6 A;  4CO8 A;  2VN2 A;  4ETS A;  4HLY A;  4KIG A;  1YW9 A;  1BIB A;  4RS8 A;  4WXD A;  1SMY F;  4CIC A;  1ONV A;  3H92 A;  1K79 A;  4AIH A;  3N97 A;  3WTY C;  4N9H A;  1ZRC A;  4KA4 A;  1AOY A;  3CJN A;  5JFR A;  1U8R A;  1S7A A;  3GW2 A;  4RGR A;  3BJA A;  1STZ A;  1KQ0 A;  1UB9 A;  4Q47 A;  1HKS A;  1Y0U A;  3V8L A;  2XRO A;  3FXQ A;  3SQN A;  3B02 A;  1LDD A;  1UHM A;  3S2W A;  2ISZ A;  1MKM A;  1JXS A;  2GZW A;  1P4A A;  1SD6 A;  5F1R A;  3T5X A;  3K2Z A;  3GWZ A;  1I27 A;  2Q8K A;  3ZMD A;  5ICG A;  4LFU A;  2UWM A;  1ZRF A;  1I5Z A;  1O57 A;  3TOA A;  3M8F A;  1B9N A;  4U7B A;  2ESH A;  1XGO A;  1WI9 A;  3BP8 A;  4RB2 C;  2YX7 A;  3Q5F A;  3I4P A;  4KIC A;  5TJJ A;  1FBU A;  1W7P D;  2R3S A;  5J6X A;  3P9K A;  3KP7 A;  4DNC A;  2M30 A;  1EH7 A;  1DPU A;  3DEU A;  3KE2 A;  5AIQ A;  4LK0 F;  1XDS A;  5DEQ A;  3LST A;  5E8I A;  4KN7 X;  4M74 A;  4GO1 A;  2PMU A;  4KIF A;  3VOD A;  4MTD A;  2IT0 A;  4NQW A;  2V1X A;  4HLX A;  1KU7 A;  3HHH A;  3ZMV A;  3GLX A;  3RKX A;  3F8C A;  1ZGJ A;  2QLZ A;  3LQQ A;  1IN6 A;  2A07 F;  2K4B A;  5A2Q Z;  4IF4 A;  4ESF A;  4S04 A;  3T0Y A;  4RB0 A;  3K9T A;  2Z3Y A;  1RZ4 A;  1DDN A;  2RKH A;  3RPQ A;  3WTU C;  3CUO A;  2HKX A;  4HDV A;  4YII A;  3TO7 A;  1G3S A;  5HS7 A;  2M5W A;  4G7O F;  1QNT A;  2O6G E;  2DO7 A;  1E17 A;  4JQF A;  3FXR A;  3K69 A;  4OIN F;  2VBW A;  4BAY A;  3I58 A;  1MJA A;  3VEP A;  3E3V A;  3K0L A;  3JSO A;  1ULY A;  2YPR A;  1ZG5 A;  2A6E F;  3I59 B;  1T2K A;  4I02 A;  1JGS A;  2KJC A;  4QWQ A;  2QBY B;  3F8B A;  2EA2 A;  2PN6 A;  2Y0M A;  5K5O A;  2PLY A;  2MD5 A;  4Z2Y A;  4EV0 A;  2NNN A;  1ZHF A;  2NNY A;  2RN7 A;  1G6N A;  5FGM A;  3FWE A;  3T1B A;  2EV5 A;  3GYH X;  1ZN2 A;  3CTA A;  3GXO A;  1TW3 A;  1FZP B;  2K27 A;  2MBF A;  5KK1 A;  3MCZ A;  1JHF A;  3QAH A;  1BIA A;  3KP6 A;  2LNB A;  3EET A;  1FP1 D;  4I2O A;  4EM0 B;  5DDG A;  1YYV A;  1LJ9 A;  1K78 A;  2NYX A;  1K7A A;  3WGG A;  5LBQ A;  3SHF A;  3J80 K;  4IVN A;  4HBL A;  1XMA A;  2ZO4 A;  1OKR A;  2GA1 A;  4EVI A;  1P6R A;  2OQG A;  1HW1 A;  5FLX Z;  1XSX A;  1DUX C;  2DW4 A;  1T6S A;  1HST A;  4PDK A;  3E6C C;  2ZCW A;  5E17 F;  4A5M A;  4HF2 A;  1QO0 D;  2G7U A;  2NS0 A;  1G3Y A;  4U88 A;  2CYY A;  2BGC A;  1PDN C;  4KFC A;  4MGR A;  2NAZ A;  2D2W A;  5CLS A;  3MFK A;  2DFI A;  1Q1H A;  4EM2 A;  2FRH A;  4LLN A;  2COM A;  2L01 A;  2V6C A;  4A5N A;  3ECO A;  5JI6 A;  3BPV A;  3IRQ A;  2FNP A;  2DPD A;  2O8X A;  1D3Y A;  2QEN A;  2KJB A;  2HQN A;  1FSE A;  4Q4Z F;  4EM1 A;  1LEB A;  4AIJ A;  3C3W A;  3R6S A;  2BBY A;  2Z99 A;  2LSO A;  3HTS B;  1G3W A;  2A5Y B;  4UVA A;  4RGS A;  5LHG A;  2Z33 A;  4WF2 A;  2JPB A;  3WU1 B;  1SFE A;  1O3T A;  1GHC A;  3EUH A;  1OMI A;  1TQM A;  5D4S A;  5CVR A;  2J5O A;  1FWZ A;  3K1N A;  4NHJ A;  2H6C A;  4Y15 A;  2X0L A;  5ED4 A;  1P92 A;  3FMR A;  4EJT A;  4WX9 A;  4B09 A;  2QWW A;  3V8J A;  2DQL A;  4A0Y A;  4GYG A;  4A6E A;  3K1P A;  2XRN A;  4EQQ A;  3NEU A;  3ZPL A;  2F5D A;  2DK5 A;  3GF2 A;  2HGC A;  1ZRE A;  2YSR A;  3DXJ F;  2OAZ A;  3SZT A;  4F7Z A;  1Z91 A;  4M9S A;  1U2W A;  2XKO A;  4AWX B;  5J8C A;  2YR2 A;  5FO5 A;  3ZMS A;  2H09 A;  4KYW A;  1MDM B;  1S6L A;  3I53 A;  2STW A;  1BC7 C;  5D8L B;  5DCM A;  3KZY A;  2RQP A;  5LGN A;  4HAM A;  3RKY A;  1PP7 U;  1J5Y A;  4I09 A;  3KLN A;  2CGP A;  3JSP A;  4BHB A;  1J75 A;  4MNU A;  2IW5 A;  5F64 A;  5HS8 A;  1YO5 C;  1MGT A;  2DBB A;  1OYY A;  2VXZ A;  3VOE A;  4LG0 B;  1R1U A;  4YG2 F;  1TNS A;  3SXY A;  1R5G A;  3W6K B;  3ELK A;  1FLI A;  2ISY A;  2PEX A;  2C6Y A;  1IXC A;  3DP7 A;  3FXU A;  1B4A A;  2IA2 A;  1SFX A;  3ULQ B;  2BEO A;  2Q2E A;  3E6M A;  2P6T A;  2UXX A;  4ZYH A;  3TOB A;  2OU2 A;  3L7W A;  4HV6 A;  4CDG A;  1TBX A;  2RC4 A;  3IKT A;  4RAY A;  2R7F A;  4IHT A;  3ECH A;  2R7D A;  2JZY A;  2VBX A;  5D4R A;  2QVO A;  3KEO A;  4WXC A;  1C0W A;  1WKM A;  2YX4 A;  4MEY F;  4A2U A;  3F22 A;  3HYI A;  2MLG A;  2K02 A;  1IRF A;  2DLL A;  2IPQ X;  4HX8 A;  4FX0 A;  2DU9 A;  2EWN A;  3FZV A;  1U5T A;  1IN8 A;  4CXF A;  3DQV C;  1W5S A;  2XV4 S;  3ABU A;  5HLI A;  1TTY A;  3H3U A;  2BV6 A;  1R00 A;  1IXS B;  1R1V A;  4A6D A;  3LAJ A;  2RNJ A;  2DPU A;  1FYM A;  2ZXJ A;  3R4K A;  3TKY A;  1XN7 A;  2WTE A;  3NRV A;  2E1C A;  3QPT A;  2IRF G;  3U9G A;  3COA C;  3V4G A;  5BOX A;  4I7H A;  3SZP A;  1ZAO A;  4XLN F;  4N9I A;  1H9T A;  4KN4 X;  2RGV A;  3PQJ A;  5JVT A;  3CUQ C;  4M72 A;  2GA2 A;  2IP2 A;  2J5P A;  2QQA A;  1BJA A;  1T38 A;  2QZ8 A;  3V8K A;  2FOK A;  1U5T C;  4PGH A;  5IT9 Z;  4S05 A;  1U3E M;  1T98 A;  4HZF A;  2FBI A;  1Z05 A;  1FY7 A;  3IL2 A;  3TDU C;  3KLO A;  4ZZL A;  5LGU A;  5DD4 A;  1OPC A;  1O7L A;  1FNN A;  1ZH5 A;  4M9X A;  3IHU A;  1Z1D A; 
#chains in the Genus database with same CATH topology
 4WCG A;  1HBX G;  1TP4 A;  1AHD P;  1HF0 A;  3H9G A;  1LB2 A;  2EFP A;  1IN5 A;  5JHU A;  1SAU A;  2DN0 A;  4Q5S F;  3ABL H;  2L7M P;  3ASN H;  2K85 A;  3H35 A;  2VB6 A;  4HF1 A;  3FHZ A;  4E7K A;  3DFG A;  3HL2 A;  2IGK A;  2JTV A;  2FF4 A;  1DGW Y;  2FQ4 A;  3BC8 A;  5B1B H;  1X3U A;  5B3S H;  2P6S A;  5K1Y A;  3K1M A;  2Y75 A;  4UVC A;  4QTR A;  3L00 A;  2IXS A;  2VJ5 A;  1XSV A;  2LYC A;  2XAS A;  3D0S A;  3HRT A;  2CU7 A;  2COB A;  3HOV J;  1YS6 A;  2V1U A;  2WB1 A;  2O8K A;  2P4W A;  3HUG B;  3GCM A;  1T56 A;  1P7I A;  1DU0 A;  4BHC A;  1RI7 A;  1LEA A;  1QGP A;  5EEA A;  4BXF A;  1TQI A;  3IWF A;  1TWG J;  5LRS A;  4PZJ A;  3K70 C;  2CO5 A;  2CG4 A;  3O3K A;  4QPQ A;  3U1K A;  3FK7 A;  3ZGK A;  2R0Q C;  3B73 A;  3K4B A;  3BZ6 A;  1IW7 F;  1WJF A;  4DBR A;  4HNT A;  1MSF C;  2AS5 F;  2PG4 A;  3CCV I;  2FD5 A;  2LKS A;  2XKP A;  2IA0 A;  4A3F J;  4KDP A;  4ON0 A;  4HOB A;  1UG0 A;  5LEK A;  1S7O A;  4XRF A;  1MNM C;  2I5U A;  3J7Y J;  5CVV A;  1YIO A;  1YJW I;  2XAU A;  4Y33 A;  2LY9 A;  2EFQ A;  3FXK A;  4BXU A;  3GFI A;  3OY9 A;  3QPL A;  2UZK A;  3OYK A;  1N75 A;  2GIV A;  4FET A;  5ICF A;  4WK8 F;  5F04 A;  1B8I B;  3CLO A;  4JX6 A;  3P7N A;  2WV1 A;  1LVK A;  2L3D A;  1W0U A;  2VE8 A;  3CP2 A;  2ZME A;  5GP9 A;  2VKE A;  3IC7 A;  3MAJ A;  4PSX A;  4UB8 C;  2WV0 A;  4B3A A;  3PIO F;  3GTJ J;  4BJT A;  4ZDL A;  1S7E A;  3LSH A;  1IN4 A;  2R7W A;  2VKD A;  2W85 A;  4DZP A;  1H0M A;  4G9Y A;  1IAW A;  4BL0 B;  2BY3 A;  4HV5 A;  3E97 A;  1K6O A;  2FJ1 A;  4PGG A;  3UKG A;  5HDG A;  2N8G A;  4D7N A;  2PBI A;  2EZH A;  3R61 A;  1H89 C;  2BYV E;  5J3L A;  4R79 A;  4E7L A;  1ON1 A;  2NRA C;  1I39 A;  2FQ3 A;  1F36 A;  3A02 A;  1PJR A;  1BC8 C;  1P9Q C;  1N77 A;  2R7T A;  2HPM A;  3J7A O;  1RIO H;  3GVA A;  1P4X A;  2XF5 A;  3LMM A;  4Z6Y A;  2ZC2 A;  2TDX A;  3G1M A;  3S16 J;  2ADU A;  2B0L A;  4JK1 X;  3W2A A;  2VL8 A;  4HNV A;  4UXN A;  1MMA A;  2G9W A;  1YW7 A;  2EZK A;  3BY6 A;  3FBI B;  4HX4 A;  3OYD A;  4LIV A;  1IV6 A;  1ZG3 A;  5J4V A;  4BAC A;  4KIT B;  2A69 F;  3MD2 A;  1Z67 A;  4PK4 A;  4CCL A;  5DUI A;  5C44 J;  1O3Q A;  2VJ4 A;  4YEL A;  1MBG A;  1V4R A;  4BBR J;  5L3F A;  3QU6 A;  4I01 A;  5HOO A;  2CQK A;  4ANJ A;  2EFN A;  4MFD A;  4XNF A;  3MZH A;  2K3P A;  3LNQ A;  4HSR A;  1R71 A;  3WHC A;  1IZ1 A;  3BG7 A;  5EGO B;  2TRT A;  2B9S A;  1TWF J;  4AM3 A;  1S29 A;  4XIC A;  1G4D A;  2Z16 A;  1Z6R A;  2DYS H;  2NVQ J;  1R7J A;  2R5Z A;  2A68 F;  1GDT A;  4OMZ A;  1OYW A;  3TO6 A;  1V5E A;  2VQG A;  4OU0 A;  4UV9 A;  3VYR B;  3S1N J;  1R58 A;  5LRR A;  2ETH A;  2PMZ A;  2VBZ A;  3M8E A;  3V7C A;  1DQU A;  4H4K C;  2KKO A;  1B72 B;  2OBP A;  3WU0 A;  2HTS A;  5D5X B;  1ZQ3 P;  2I8D A;  4M3F A;  2EK5 A;  2K3F A;  5F08 A;  4F3Q A;  3L2R A;  1A35 A;  3P9I A;  4G94 A;  2XPV A;  1FC3 A;  3HM5 A;  1K83 J;  4GCV A;  5IT3 A;  3HRS A;  3TP0 A;  4AIK A;  3CC7 I;  4OIP F;  1VTN C;  2VLA A;  4R8H A;  2D1H A;  2XRL A;  3GUD A;  2FSW A;  2P5V A;  3EYY A;  4IKF A;  3G73 A;  2JA7 J;  4D1Q A;  4UUV A;  1OR7 C;  1J2X A;  1APL C;  1KU3 A;  2DMT A;  3C7J A;  2G0E A;  3K7A J;  1VQP I;  2ZSH B;  1QA6 A;  3RYR A;  3U1D A;  3C2G A;  4DQ2 A;  3DTK A;  4XLH A;  4CHU A;  4FT8 A;  1FX7 A;  3J7Z I;  4L9J A;  4NUB A;  5JHF A;  2VJI A;  4EJU A;  5EG0 B;  2M1B A;  4RGU A;  2CV0 A;  2HXO A;  2QQB A;  1FOY A;  4ASN A;  1SFU A;  2NOJ B;  4HNU A;  3SYT A;  3PL8 A;  3MWM A;  4G6T B;  4MEX F;  4XL9 A;  1YJ9 I;  1R36 A;  1ZR2 A;  1LE8 B;  2DAO A;  4ENK A;  1HOM A;  2ZNY A;  4AVP A;  2HZT A;  3DEW A;  3RKQ A;  3R0J A;  1RUN A;  1XCV A;  5L3G A;  2KDO A;  4XKW A;  3LAP A;  1KGS A;  4NBQ A;  2EV6 A;  5FKK A;  3M9A A;  1G8X A;  4B1R A;  3GFM A;  1U0J A;  3HOY J;  2XVC A;  3R60 A;  3J80 Z;  4XOR A;  2VBY A;  1W36 C;  2OA4 A;  2E60 A;  3CC2 I;  4BE2 A;  2GOM A;  3JAM K;  4A3J J;  2QQ9 A;  1LFP A;  1NTC A;  4M3G A;  5H2F C;  2A61 A;  3K4C A;  2K40 A;  4BU2 A;  2DMU A;  1W4M A;  2M0C A;  2K5C A;  3E5U A;  2E71 A;  1ORK A;  5KAI C;  2XB5 A;  2ZB9 A;  4ENN A;  2KRF A;  4C2U A;  2KDZ A;  3ZQ7 A;  3GZ6 A;  3VSL A;  5E8G A;  1V54 H;  1YTY A;  4HDU A;  2LF8 A;  3LSR A;  1V55 H;  5K5R A;  1PUF A;  4XQF A;  3OL3 A;  5FLX K;  3OSF A;  1T0F C;  1OFC X;  1FYL A;  1OCC H;  5ERI A;  2HFH A;  3J7A Y;  4F55 A;  5D5U B;  3QYB A;  1NHA A;  1MIJ A;  4MTE A;  1WJC A;  3QRF F;  3HTU A;  4I0A A;  2BVL A;  4LB6 B;  1VQM I;  4U0V A;  1FEX A;  2JRT A;  4ZDO A;  1ODD A;  1BOA A;  1UST A;  4BH9 A;  2MC3 A;  4II3 A;  4KT6 A;  5JR3 A;  3CJT B;  3KPH A;  3F72 A;  4MLO A;  2HTJ A;  4MQV A;  5C4J J;  3S17 J;  1CF7 A;  5FD6 A;  3FM3 A;  3WGI A;  1RC9 A;  3PSI A;  3TP3 A;  2LP0 A;  4M3D A;  2JMW A;  4MHG A;  3IH4 A;  2DXI A;  1XS9 A;  2FXA A;  2EIL H;  2E34 A;  3KP3 A;  4AC0 A;  4O6J A;  3TED A;  1Z7U A;  3DPL C;  4CCJ A;  3BG6 A;  4IJA A;  5FB2 A;  1D5V A;  3NQO A;  4L5E A;  1TNT A;  5E1Z B;  1MBJ A;  3M1E A;  3I55 I;  3TGN A;  2XAF A;  5J4Y A;  4QLC U;  4BDY A;  4XN3 A;  3HXL A;  2W24 A;  4I98 B;  3MEX A;  4OAY A;  1RES A;  1QPM A;  2HOA A;  2LH9 A;  1HLV A;  4F93 B;  1ETV A;  5LGT A;  2Z5U A;  5FD5 A;  3DBR B;  1OCR H;  3B6C A;  1FPQ A;  4BQO A;  4DW6 A;  3OYH A;  5GPA A;  2O61 A;  2E7W A;  5HLH A;  1XGN A;  4A3L J;  2PI0 A;  4G6Q A;  1HSJ A;  1DP3 A;  2DK8 A;  4ZJZ A;  4LLL A;  4M6V A;  1VQK I;  2FX0 A;  1I6X A;  2R7U A;  1BI2 A;  4P55 A;  5FJ8 J;  2FML A;  4KNY A;  1I1G A;  4W1U A;  5IOZ A;  3CP8 A;  2Q0O A;  3PSF A;  3Q0W A;  3JRF A;  3K10 A;  2FUG 2;  4HPQ A;  4A3D J;  3BWG A;  2GXA A;  1MH4 A;  4CZC A;  1ZKG A;  2L9R A;  3I56 I;  1BR2 A;  2L4A A;  3KP4 A;  5E18 F;  1VFC A;  2V7F A;  1ZAR A;  3KZZ A;  1X3W B;  3SDG A;  3WG9 A;  1VND A;  2CSO A;  3AAF A;  1VZ0 A;  3TBI A;  4IHS A;  4O3M A;  4CYC A;  1TT0 A;  3DF8 A;  1QBJ A;  1MD0 A;  1FSH A;  4PJN A;  1IUF A;  2BY1 A;  2DT5 A;  1BR1 A;  4GXO A;  1YJN I;  1VQ8 I;  1W1W E;  4A3C J;  5LHI A;  5CKT A;  2WAF A;  4OIO F;  3AL0 C;  2IGO A;  2JA2 A;  3QOP A;  3BPX A;  3FDY A;  2H94 A;  5H6R A;  4Y13 A;  3TDZ C;  2VPL A;  3CDH A;  2JSC A;  3ZQF A;  2XIG A;  1MBF A;  2RQQ A;  1X1D A;  2MC4 A;  2NVX J;  1RET A;  2HU9 A;  5DM6 F;  2XSD C;  2WC2 A;  3HOU J;  4G6D A;  2K7L A;  5ILU A;  2GBY A;  3P9C A;  3WE2 A;  3PQK A;  3W2W A;  3WTV C;  2F5C A;  1FOK A;  1GUU A;  3HSF A;  2OV7 A;  4DZJ A;  1D0X A;  3NAR A;  4M6X A;  3WOD F;  2HYG D;  3MZY A;  3RIR A;  1HDD C;  2L02 A;  2H27 A;  4BBS J;  3BR6 A;  2OUM A;  1FOW A;  1FYK A;  5HDK A;  2BXZ A;  3EQL F;  1L3L A;  1FOX A;  3RKW A;  4EEF G;  3QOD A;  2R93 J;  1RNL A;  4XLE A;  1XSD A;  2L4M A;  3H5R A;  3D5L A;  3HBL A;  1ZGA A;  2PMH A;  2QQ8 A;  3H9J A;  3OR2 C;  3LSG A;  4ITV A;  2CV1 A;  5J1Y A;  2KPM A;  2OF7 A;  5ILV A;  2GWR A;  4C2M J;  3BJO A;  3MKZ A;  1JJ6 C;  1AKH B;  1UEL B;  1SD5 A;  4NC7 A;  3QPH A;  4I0B A;  3HHG A;  2DA7 A;  4U0W A;  3RJP A;  1ZRD A;  5LHH A;  3LFK A;  2R7R A;  4D7M A;  3CZ6 A;  1HKT A;  2R7V A;  1F5T A;  2IGM A;  4RB1 A;  4XLP F;  2BW3 B;  2NOG A;  3BR0 A;  3G71 I;  2CQQ A;  5GTH C;  3M7G A;  5IY5 H;  4XSZ F;  3HOT A;  3GBG A;  2R7X A;  4BY1 J;  3ZQC A;  3HEF A;  5F0C A;  4M6Y A;  4UNO A;  3I54 A;  5K7H A;  1I50 J;  1DGR M;  5BPD A;  2X9D A;  4DGW B;  2DDB A;  2F6C A;  2HR3 A;  2HPI A;  2STT A;  2ZFW A;  4IQ4 A;  2F4I A;  4O5V A;  4W97 A;  3QU3 A;  3IP4 B;  3E5Q A;  4PSW A;  3IAS 2;  3BTC A;  4II2 A;  5KCM A;  2M8E A;  3VYU B;  1WQ2 A;  5HDN A;  4G7H F;  1KQ9 A;  3BQY A;  3CDI A;  4IXA A;  3FIW A;  2KIU A;  1IXR C;  1MBK A;  4XM3 A;  1SC7 A;  3RTR A;  3W2V A;  2IGN A;  3DTE A;  4OOI A;  3H5N A;  2G7H A;  1GXP A;  1XD7 A;  1U9N A;  4UVB A;  3F21 A;  3W6V A;  3HJE A;  1RKW A;  1QZE A;  4IX7 A;  3UNG C;  1EKE A;  2K9S A;  3VFZ A;  2LBF A;  3O6B B;  2E2H J;  4OIQ F;  1JHH A;  2VC1 A;  1QQI A;  3DWL E;  5B66 C;  2VOO A;  2HQR A;  1B1B A;  3ZQQ A;  2RAE A;  2V79 A;  3RZO J;  2V9K A;  1QVT A;  3FXO A;  2M9H A;  3SEQ A;  2IS1 A;  4B3X A;  4A3K J;  5GAD J;  1NG7 A;  4LIU A;  1F4K A;  3CUQ A;  1XMK A;  4JX5 A;  1YFH A;  3GFL A;  1MBH A;  4E6K G;  2Y0S A;  4CYD A;  1T39 A;  2GXB A;  3BQZ A;  4DYR A;  4CA0 A;  4EJO A;  3I4M J;  4RM2 A;  1S9H A;  3S8P A;  2R5Y A;  2E2J J;  2R7O A;  2LY2 A;  1A5J A;  2AXT C;  5DV5 A;  1WI3 A;  2M4K A;  3DLA A;  3ROU A;  3BOQ A;  3CCE I;  3KET A;  1EJ9 A;  2L2O A;  4RGX A;  2QM3 A;  1IN7 A;  4YIF A;  3G2B A;  4DBQ A;  1LDK B;  1Z21 A;  4A12 A;  2LF7 A;  4A0X A;  3GO5 A;  5HVQ C;  5ILS A;  1IGN A;  2OQR A;  4NDL A;  4CGZ A;  3J81 K;  3OV8 A;  2CW0 F;  5DYM A;  3WTT C;  1WVR A;  4IHX A;  1R23 A;  4HX7 A;  1RR8 C;  3FX3 A;  5CVI A;  3IKV A;  1JE8 A;  2XHK A;  3RYP A;  2L7Z A;  3D1N I;  5D8K B;  2VOD A;  5TRD A;  2WWY A;  3KP2 A;  5IOY A;  2VE9 A;  1SMT A;  4LMY A;  3LWF A;  2F5V A;  2ME0 A;  3DKW A;  5K7Z A;  2ZME B;  2ZXH A;  1UHW A;  2I10 A;  2CJJ A;  3RQ4 A;  1FBS A;  3F8M A;  3FIS A;  5M5W J;  2E36 A;  2V9V A;  1XGM A;  3TW6 A;  4ZYG A;  4X0G A;  3N05 A;  3CME I;  3GTK J;  3PIP F;  1R5H A;  5IP7 J;  2GOX B;  2QCO A;  2ZJP F;  3L9F A;  2W57 A;  1B6A A;  1FP2 A;  2F5F A;  1POG A;  2VIX A;  3HRM A;  2BY2 A;  2JK3 A;  2KZV A;  5H20 A;  2E5Z A;  1YRN A;  5BMZ A;  2DOF A;  1W7P A;  1PP8 F;  2H1K A;  2KIF A;  4J19 A;  4V19 K;  2LK2 A;  3HG9 A;  4Q48 A;  1X19 A;  3BG5 A;  3GZ5 A;  2W82 A;  2RDP A;  4TV7 A;  5GAH J;  5B1A H;  1REP C;  2LY1 A;  3K4J A;  3C2B A;  4BDZ A;  3M8J A;  5H6Q A;  1XG1 A;  4LG0 A;  3NWT A;  4BYY A;  3C1D A;  2LKP A;  3KIO A;  2EV0 A;  3REO A;  4RLQ A;  1JKQ C;  3BR1 A;  3NAU A;  2A6T A;  3FF5 A;  3DU6 A;  3EYI A;  3JW4 A;  5L3D A;  2E7X A;  2X1E A;  2XAJ A;  4KMF A;  1HKQ A;  2FMY A;  1MNE A;  4RB3 C;  2E5N A;  4UB6 C;  3MKL A;  4XN0 A;  5IT9 K;  4ZZD A;  1ZG1 A;  3H3Z A;  5LD2 C;  2WA0 A;  2Z2S B;  3I64 A;  1D1A A;  3ISP A;  4M73 A;  4XLF A;  1WGX A;  4IOA F;  4LLG F;  3VYT B;  3CF2 A;  2QEX I;  1U6G A;  1BM9 A;  4F92 B;  2R5Z B;  2ZJR F;  1AWC A;  2VC0 A;  3DPT A;  2QSG X;  3SFI A;  3VPR A;  2XGX A;  3DKY A;  4YFN F;  1V3F A;  4Y17 A;  5EJC A;  1JUM A;  1HC8 A;  5LLQ A;  1Y8R B;  2MA3 A;  4D5F A;  1R49 A;  2HQ5 A;  4PFP A;  2LDU A;  3JTH A;  3AG1 H;  2ME6 A;  2E35 A;  1IG7 A;  1WHU A;  4UV8 A;  4L0Y B;  3MZ8 A;  3AKZ A;  2VOP A;  4L18 B;  3ZN0 A;  5BS6 A;  1KYW A;  4E7Z A;  1HXD A;  2X1C A;  1WWX A;  3WTZ A;  2EA4 A;  3QYF A;  1MMS A;  1MSE C;  1J7K A;  2P8T A;  2ZFU A;  1OJL A;  2P5K A;  1EH6 A;  4FIS A;  3ZQH A;  2BY0 A;  4E70 A;  4UY8 I;  2EB7 A;  2MLK A;  5AON A;  2IA1 A;  4HW0 A;  5L3E A;  4P5O A;  1ETX A;  2D1V A;  3RPU A;  3VB2 A;  2BE5 F;  2HDC A;  2MGQ A;  4HA8 A;  4WXH A;  3CQZ J;  3SFZ A;  2HEO A;  4HEA 2;  4D9J A;  1ETW A;  3F6V A;  4K2E A;  5CVJ A;  1K78 B;  2X4H A;  2GXG A;  3E6D A;  2RV8 A;  2JPC A;  3ZQI A;  4YFK F;  3BDD A;  4FX4 A;  1JKR C;  2UV1 A;  1FBQ A;  2DTZ A;  1F1Z A;  1VF9 A;  5FRO A;  1MJB A;  3H0D A;  1IRG A;  3GX4 X;  2OZ6 A;  5JLW A;  2QUF A;  1BI1 A;  1I6H J;  6PAX A;  4M3B A;  3WTW C;  2PJR A;  1MJ9 A;  3BJ6 A;  3LQR A;  3ZMZ A;  5D6E A;  4HQM A;  4FE7 A;  1R4N B;  4XOP A;  1QPI A;  1X1P A;  5DS9 A;  4GRI A;  3V42 A;  1H9G A;  4M71 A;  3OS0 A;  2BVM A;  3A01 B;  3BRO A;  3DPU A;  3IV5 A;  1DP7 P;  5ICE A;  4ZDP A;  5ICC A;  2IBD A;  3OIP A;  4U0Y A;  1ON2 A;  4A0Z A;  3FKI J;  2XAH A;  1JKO C;  1MW7 A;  1OR7 A;  2HQA A;  2F5E A;  2W25 A;  1KU9 A;  3JRA A;  4BNC A;  2GIZ A;  4AD9 A;  5A2Q K;  1DPR A;  2Q1Z B;  1D8J A;  3HRU A;  2R7Q A;  1QZY A;  4D0P A;  2ELJ A;  3PUB A;  2HYJ A;  5HLG A;  1EH8 A;  4EGZ A;  4OMY A;  1SD4 A;  1QZZ A;  1GXQ A;  1I1S A;  2E1M C;  2DI3 A;  3OOU A;  2ACJ A;  1RRJ A;  3TQN A;  2VQL A;  4OIR F;  4A3E J;  2HKO A;  2FE3 A;  1ZH5 A;  3RSN A;  1YG2 A;  4N0B A;  2M87 A;  2H8W A;  4LD5 A;  3PFI A;  2Z1D A;  3GFJ A;  1B9M A;  2WAQ N;  4LB5 A;  2XPU A;  2HVR A;  1CF7 B;  3I71 A;  2L9N A;  1UCR A;  2FU4 A;  2HS5 A;  2Y31 A;  2VON A;  3GTO J;  4PUS A;  1LDJ A;  2KZG A;  2DFH A;  3G4S I;  5L3B A;  3PO3 J;  2XGD A;  1YI2 I;  5KVR A;  2K9Q A;  4ABZ A;  4FCY A;  1WRJ A;  2OCC H;  3KP5 A;  2HVQ A;  2D45 A;  5BPI A;  2O7O A;  5EEG A;  3R0A A;  1J9I A;  4B47 A;  1ETO A;  1YQA A;  3K4K A;  4BEH A;  3KEY A;  3ZRG A;  4A3M J;  1KU2 A;  2LR8 A;  1U78 A;  2M34 A;  2QGU A;  2LRD A;  3CCM I;  1W0T A;  1LKX A;  1T0F A;  3TO9 A;  3VWB A;  1SFK A;  4RAF A;  5DUK A;  3X2Q H;  1FT9 A;  2CUE A;  3JRC A;  2HXI A;  2JRM A;  2O3F A;  2X6W A;  5E1X A;  3CCR I;  2LFB A;  4IRH A;  3HUG A;  4KUM A;  4XKB A;  1X2M A;  4NB5 A;  2DOA A;  5K5Q A;  4ENJ A;  1YW8 A;  3F6O A;  2A3S A;  5FFX A;  1A6Q A;  3OYI A;  2DMQ A;  1SAN A;  3ERE D;  1XPX A;  5E1W A;  1JJ8 C;  1A6I A;  1GLN A;  1X2N A;  3A0H C;  4R1H A;  5BQT A;  3F9K A;  4LK1 F;  5FFZ A;  1VQL I;  3U2R A;  2VT2 A;  3FXM A;  1VQ4 I;  3HKZ N;  3IH3 A;  1S72 I;  2CWE A;  2ZKZ A;  2RVC A;  2CRG A;  4DIQ A;  4EGY A;  3OYC A;  3MKW B;  1ENH A;  2W1O A;  2V4J C;  2ZJ2 A;  3KCC A;  4ENM A;  3AG4 H;  3CES A;  1ZR4 A;  1N25 A;  4FAS D;  2L7F P;  5DD8 A;  1G3T A;  1UFM A;  3HOX J;  2VXD A;  3F8N A;  2QKL B;  3Q9S A;  4BE1 A;  4CYC B;  4BHP A;  3JAM Z;  5JLX A;  1HW2 A;  3F3X A;  1Q1V A;  1Z3Y A;  4XLA A;  5LFA A;  1Y1V J;  3HSR A;  4G12 A;  4BQQ A;  1OCT C;  2Y48 A;  1D1B A;  4ESB A;  3BTJ A;  1OCP A;  2EIM H;  2K86 A;  2V6E A;  4ZH4 F;  2E1N A;  2FNA A;  2X1D A;  4L5J A;  3ZN1 A;  3RCO A;  2KMU A;  3AG3 H;  1SD7 A;  4L0Z B;  4ZYD A;  4LJZ F;  2F2E A;  3JRD A;  4XRS A;  1FMV A;  2UXN A;  3S14 J;  1ZTR A;  1XB4 A;  3DV8 A;  5D6F A;  2A05 A;  1Y1W J;  1TW2 A;  3HDD A;  5DCM B;  3G1O A;  3WTS C;  3T8R A;  2ID3 A;  4J00 A;  4L9V A;  1JUP A;  1MZB A;  2ESN A;  5FRM A;  2O03 A;  2A6H F;  2GAU A;  2XPW A;  4BKX A;  3ABM H;  2BHZ A;  2XUB A;  2YU9 J;  2IVM A;  3LA7 A;  1TWH J;  1X4O A;  4LGW A;  5CYV A;  3WTX C;  2EIJ H;  5HNF A;  1JT0 A;  4RA2 A;  1WJD A;  1YX5 A;  3DKX A;  4Y3O A;  3O2P E;  3GTP J;  2EFW A;  3OYE A;  3HSE A;  1ZGW A;  3FK6 A;  1XTA A;  3ONQ A;  4PCQ A;  2P5L C;  3OS1 A;  1Z9C A;  3DTI A;  3EDP A;  2HOS A;  2KIS A;  2LC2 A;  2DT6 A;  3K4M A;  5D5V B;  2O0Y A;  3WHB A;  3I59 A;  4M3E A;  4KJZ A;  5EF6 A;  2QBY A;  2NVT J;  3LSP A;  5TGT A;  3IWZ A;  1LQ1 A;  3IRR A;  2VQH A;  1BI0 A;  5DCF A;  1S8N A;  1IJW C;  2Q2E B;  1D8K A;  2WB1 N;  3ZP5 A;  3S1R J;  1E3O C;  2EBI A;  2FA5 A;  4EJV A;  2ICW G;  2MH9 A;  1BA5 A;  2MSY A;  3CCL I;  2Z9O A;  2CV2 A;  2VKH A;  3DEE A;  4XKV A;  3K2A A;  4ZC3 A;  5CVU A;  4A3G J;  3LA2 A;  1ZK8 A;  1Y0N A;  3MQ0 A;  1W5T A;  3S1Q J;  1D0Z A;  4FHT A;  3JTG A;  3GEZ A;  3BG9 A;  1XX5 A;  4AU7 A;  3CLQ A;  1HW5 A;  4H0E A;  3HZJ A;  2DQR A;  3KEQ A;  1L0O C;  3NWS A;  3ABT A;  4C3J J;  3RI4 A;  3PNV A;  2LBF B;  2BOL A;  1VQ6 I;  3G6E I;  2Y9Y A;  2DDA A;  5EEH A;  2WY7 Q;  2VAS A;  2P7C B;  1O3S A;  3I5U A;  3V7R A;  3WE3 A;  4G7Z F;  4YIR X;  4RDU A;  1IF1 A;  3CUQ B;  4AYB N;  4DJA A;  3S2H J;  3KYC B;  4IRG A;  1KYZ A;  2PFB A;  3HGY A;  1PYV A;  1B59 A;  4XR6 A;  5F0F A;  4F52 A;  3IHU A;  1YS7 A;  1XMX A;  4RAZ A;  1U5T B;  2HOE A;  4XSX F;  1LPQ A;  2R5Y B;  3W6J B;  3CO6 C;  2V1D A;  3LSI A;  3DU5 A;  1TQP A;  4YEJ A;  1YLF A;  2CFO A;  2PQ8 A;  3CO7 C;  1HQC A;  3WU2 C;  1EV7 A;  2HVS A;  4EJW A;  1BBY A;  1RKT A;  2K4J A;  4KT5 C;  2ZNZ A;  1O7F A;  5JVG F;  5J8F A;  2FBK A;  5M5Y J;  3RQI A;  2UUZ A;  1R22 A;  4RM3 A;  1P2F A;  2JVH A;  3M4O J;  4ZYE A;  3I4N J;  1CGP A;  2CQ7 A;  2H8R A;  1P4W A;  2ELH A;  4IRI A;  1O3R A;  2YS9 A;  4B44 A;  1OCO H;  3L09 A;  4IPA A;  1H8A C;  4KMU X;  4DYQ A;  3MVP A;  3EPZ A;  1OYI A;  2QYO A;  5AIP A;  1JI8 A;  2VT3 A;  3VDX A;  1PVE A;  2PJP A;  3L2V A;  2XF7 A;  2V9P A;  3JRH A;  1R1T A;  2DFF A;  2F48 A;  3QP6 A;  3HOS A;  1JUS A;  5EZH A;  4KIS A;  2R7S A;  1WCM J;  2E19 A;  4XID A;  1J0R A;  1WSU A;  2R7Z J;  3ZMU A;  2OTJ I;  2YU3 A;  3SDB A;  1FJL A;  1USS A;  2JSP A;  4B8X A;  5D5W B;  3BCA A;  3T8T A;  1D0Y A;  3OOP A;  1TLH B;  4OWR B;  4XK4 A;  2A5W A;  1J59 A;  4ESJ A;  4UHT A;  1VQN I;  4CZZ A;  3E5X A;  2LOO A;  3F0C A;  4CCO A;  5J47 A;  3C18 A;  5E20 A;  4IHY A;  1YRN B;  2K9M A;  1W7P B;  3BG3 A;  5HS9 A;  3F23 A;  4P96 A;  2IAI A;  2XAG A;  1XGS A;  1FTT A;  3ESW B;  4JBA A;  2HWV A;  2DTR A;  2VKV A;  5F27 A;  2EFO A;  3N4M A;  3LSM A;  4PFO A;  2M45 A;  4IQJ A;  1ACI A;  1BN5 A;  3E6B A;  2ZXI A;  3F8F A;  3JRB A;  3BTL A;  3G3Z A;  2ZSI B;  3FMS A;  3H9Q A;  2HYF A;  3ASO H;  3CDL A;  1NG6 A;  5E3L A;  5IPA A;  5LEJ A;  4KIB A;  3KFW X;  3PUF A;  1XDU A;  1WH5 A;  2CFX A;  2EZI A;  4GGG A;  4EMS A;  1HA8 A;  4L5I A;  2L54 A;  1IO2 A;  3DLL F;  5FKL A;  1LVA A;  5KHD A;  2QKM B;  1YIT I;  5F6F A;  1S3J A;  3AFH A;  2WAQ A;  3CCY A;  1G2H A;  3FXJ A;  4P9U A;  1R5I D;  2W84 A;  1LNW A;  3KZI C;  3WGH A;  4XRS G;  2Y69 H;  1FMW A;  2DFE A;  4X6A J;  2P7V B;  1GVJ A;  1IUY A;  3A0B C;  5CJ9 A;  2OD5 A;  3HIF A;  2FBH A;  1A04 A;  2GQQ A;  1ZLK A;  2VPR A;  4L9T A;  4MQ9 F;  2XF6 A;  1RUO A;  1UAA A;  3W3C A;  1V5G A;  3FM5 A;  1SVM A;  4YFX F;  5L3C A;  1ZLJ A;  4HF0 A;  5BNG A;  4G8X A;  4L9N A;  2LKX A;  1Y39 A;  3L2C A;  5IYD J;  2KIM A;  2IS2 A;  1E2X A;  1ZEL A;  3MKY B;  3LA3 A;  2AXL A;  3FMQ A;  4HYE A;  4PJL A;  3I0T A;  1A31 A;  1SAX A;  4HQE A;  4P9F A;  3Q9V A;  2JT1 A;  1Y6I A;  5FKO A;  2H6B A;  4QIW N;  1F9N A;  2ECC A;  2XAQ A;  2ZBK A;  2KHM A;  2CH0 A;  3KYD B;  1T08 B;  5DM7 F;  3J81 Z;  4U7D A;  2JWT A;  2AHQ A;  5EDN A;  2O9L A;  2MH2 A;  3BR3 A;  2KQR A;  2IJL A;  5IYC J;  2VQC A;  1BI3 A;  3PNT A;  3ZXS A;  1Z6T A;  2MW8 A;  3QOE A;  4XBF A;  2OZU A;  1OCZ H;  1SVO A;  1BL0 A;  4BQA A;  3ZMT A;  4BXX J;  2FEZ A;  1MDM A;  2EJR A;  2DA5 A;  2L7K A;  3OMY A;  3E1S A;  3RDI A;  2M2E A;  4M9Z A;  2XGC A;  3M07 A;  4WWC A;  1PUE E;  2X6O A;  3QP5 A;  4UUS A;  1KQ8 A;  2PJR B;  1OIS A;  4LIT A;  4BGD A;  4GYI A;  2VI6 A;  1KA8 A;  3V7S A;  4AID A;  4Y52 J;  3ML6 A;  4CO8 A;  2VN2 A;  3LFU A;  1VQ5 I;  4ETS A;  5J1U A;  2AQE A;  4HLY A;  3PO2 J;  3PM1 A;  3MN2 A;  3HGG A;  2GM4 A;  4JX4 A;  4KIG A;  1YW9 A;  1BIB A;  2W48 A;  4CH7 A;  1WJB A;  4OAZ A;  4RS8 A;  3CC4 I;  4WXD A;  4CCK A;  2B7E A;  1SMY F;  4CIC A;  5M5X J;  1ONV A;  3H92 A;  4XLC A;  2R92 J;  1K79 A;  4AIH A;  2KIQ A;  5IP6 A;  3N97 A;  3GZN B;  3WTY C;  2XDV A;  4IO9 F;  4N9H A;  3OS2 A;  2YUS A;  1ZRC A;  4IEJ A;  4E7S A;  1P7J A;  4KA4 A;  3A03 A;  1AOY A;  3CJN A;  5JFR A;  1U8R A;  1SEU A;  2DCE A;  1S7A A;  3GW2 A;  4RGR A;  3BJA A;  1STZ A;  2MAB A;  1KQ0 A;  4V2G A;  3ZR8 X;  2R4G A;  1UB9 A;  2RRE A;  3OIO A;  4Q47 A;  2AO9 A;  3IH2 A;  1HKS A;  2IS6 A;  5CPR B;  1X3Z B;  3JRI A;  2BZT A;  1Y0U A;  3V8L A;  2XRO A;  2EIN H;  3FXQ A;  3SQN A;  3B02 A;  2X51 A;  3WG7 H;  3D5S C;  1LDD A;  1UHM A;  2F4M B;  2NS7 A;  3S2W A;  2W4S A;  2ISZ A;  1MKM A;  1JXS A;  4GFB A;  1OQY A;  2GZW A;  1P4A A;  1SD6 A;  5F1R A;  3T5X A;  3K2Z A;  3CMM A;  3GWZ A;  2JA5 J;  1I27 A;  1WJ5 A;  4JOM A;  2Q8K A;  2DJN A;  3ZMD A;  5ICG A;  3AG2 H;  4CCN A;  2NS8 A;  3H5A A;  4LFU A;  4BEH B;  2X85 A;  3OYA A;  2UWM A;  1ZRF A;  1I5Z A;  1O57 A;  1KZH A;  3S2D J;  4A3B J;  3QQA A;  3TOA A;  3M8F A;  1AU7 A;  3FBN B;  1B9N A;  4HG2 A;  1BR4 A;  4U7B A;  4MIM A;  2ESH A;  3BR2 A;  1XGO A;  3ZQG A;  1WI9 A;  3BP8 A;  4RMN A;  4RB2 C;  2YX7 A;  4J01 A;  2OTL I;  3Q5F A;  3EUK L;  2LLK A;  3I4P A;  5FKN A;  4KIC A;  3CF5 F;  4Y7N J;  5TJJ A;  4DOZ A;  1FBU A;  1W7P D;  3LOC A;  5M3M J;  3K70 D;  1QHG A;  1UG2 A;  2R3S A;  2Y30 A;  5J6X A;  3P9K A;  3KP7 A;  4DNC A;  2M30 A;  1EH7 A;  1DPU A;  3DEU A;  3KE2 A;  3ERM A;  5AIQ A;  4LK0 F;  1XDS A;  1E3P A;  3A4C A;  5DEQ A;  3LST A;  1QVU A;  1KON A;  5E8I A;  2H1L A;  4KN7 X;  2FOW A;  4M74 A;  4GO1 A;  3U21 A;  2PMU A;  5IP9 J;  4KIF A;  2LG4 A;  4BE0 A;  3VOD A;  4MTD A;  2IT0 A;  3KYL A;  2BHY A;  4NQW A;  1T95 A;  2QSH X;  2V1X A;  4DYC A;  4HLX A;  1KU7 A;  2LTP A;  4BS9 A;  1K4T A;  3M1C A;  3HHH A;  4MO7 A;  3ZMV A;  1WJA A;  3GLX A;  3RKX A;  4AYB A;  3F8C A;  3SJM A;  1MBE A;  2MG4 A;  3TMO A;  1ZGJ A;  2QLZ A;  2DT7 B;  4C3H J;  1IV8 A;  1MMD A;  3LQQ A;  3SEZ A;  3CJR B;  1PUF B;  1IN6 A;  2A07 F;  2K4B A;  5A2Q Z;  3GTL J;  2DYR H;  2ID6 A;  4IF4 A;  2W00 A;  4ESF A;  4S04 A;  3T0Y A;  3CCJ I;  2D5V A;  4RB0 A;  4E7H A;  3LSJ A;  4A93 J;  3K9T A;  2CUJ A;  2WY8 Q;  1WFX A;  2Z3Y A;  1RZ4 A;  1DDN A;  2RKH A;  3RPQ A;  3OSG A;  3WTU C;  3OYJ A;  3CUO A;  2HKX A;  4HDV A;  2MFZ A;  4YII A;  3TO7 A;  3QWL A;  1ITY A;  3CD6 I;  1G3S A;  5HS7 A;  2M5W A;  4G7O F;  1QNT A;  2JA8 J;  2O6G E;  5C4X J;  2Y9Z A;  1E0E A;  3A2K A;  5KNL A;  2DO7 A;  1E17 A;  4JQF A;  3SZG A;  3FXR A;  3K69 A;  1JT6 A;  3S1M J;  4OIN F;  2VBW A;  4BAY A;  2EZL A;  2JQ7 A;  3I58 A;  4IZZ A;  1MJA A;  2LRE A;  1TT5 B;  3VEP A;  1F43 A;  3E3V A;  1XC5 A;  2M7A A;  3RPU D;  4BQN A;  3H1C A;  3K0L A;  2HI3 A;  3AL0 B;  3JSO A;  1ULY A;  1CQT A;  3BTI A;  2YPR A;  3LL7 A;  2LD5 A;  1ZG5 A;  2A6E F;  3I59 B;  1T2K A;  4I02 A;  3PJR A;  1JGS A;  4F91 B;  2KJC A;  4QWQ A;  1LFB A;  3C2H A;  3F8B A;  2KRC A;  2QBY B;  1ERD A;  2EA2 A;  1JTY A;  2ZME C;  4NC6 A;  2GLO A;  3CMY A;  2PN6 A;  3BT9 A;  4C9Y A;  2Y0M A;  5K5O A;  2JUG A;  1YX3 A;  3Q0V A;  3KX2 A;  3ABK H;  2PLY A;  1Z77 A;  3BZC A;  2Y0S N;  2MYS A;  5EYR A;  2MD5 A;  4Z2Y A;  4EV0 A;  2NNN A;  1K6Y A;  3IAM 2;  3OIQ A;  1ZHF A;  2NNY A;  4A69 C;  1MMN A;  1JKP C;  2RN7 A;  2XGE A;  1G6N A;  2JN6 A;  4I99 C;  5FGM A;  3FWE A;  3T1B A;  2WBM A;  3CCU I;  2EV5 A;  3GYH X;  1ZN2 A;  4E7J A;  3S93 A;  3CTA A;  3GXO A;  1TW3 A;  2KP6 A;  5DTD A;  3MMY B;  1FZP B;  2K27 A;  2MBF A;  5KK1 A;  1S5L C;  2LVS A;  4PJM A;  1UJ8 A;  2QSF X;  3MCZ A;  1JHF A;  3QAH A;  2NVY J;  1BIA A;  4B48 A;  1I3A A;  3KP6 A;  2E1O A;  2LNB A;  3L2U A;  3EET A;  1FP1 D;  4I2O A;  5J40 A;  4EM0 B;  1IRX A;  2M8G X;  5DDG A;  1X4P A;  5E3O A;  2W7N A;  1B8I A;  1OLT A;  1X1B A;  1YYV A;  1LJ9 A;  1K78 A;  2K9N A;  2NYX A;  3OYG A;  3OYN A;  4ZTJ A;  1M1E B;  5M3F J;  1K7A A;  3WGG A;  5LBQ A;  2OCE A;  1H88 C;  4HRI A;  5E79 C;  3SHF A;  3Q3S A;  3J80 K;  4IVN A;  3EUA A;  3Q0U A;  1GV2 A;  1XMA A;  2DJI A;  2ZO4 A;  4HBL A;  2RNG A;  4XON A;  1OKR A;  1W36 D;  3HPH A;  2ZXW H;  2GA1 A;  4EVI A;  1P6R A;  1JTX A;  2OQG A;  3S3O A;  1HW1 A;  1RPW A;  4U87 A;  5FLX Z;  1RR7 A;  2Y2Z A;  1XSX A;  3FKJ A;  1DUX C;  1TL8 A;  3RZD J;  2DW4 A;  5GAG J;  1T6S A;  1HST A;  4PDK A;  3A01 A;  3A1Y A;  3E6C C;  1GV5 A;  2ZCW A;  1ETY A;  5FLM J;  5E17 F;  2JJ7 A;  1D5Y A;  2PX9 A;  4A5M A;  1A36 A;  4HF2 A;  1QO0 D;  2G7U A;  2K9L A;  4PJ0 C;  1MMG A;  4BUP A;  2NS0 A;  3G1L A;  3GME A;  3BZK A;  1G3Y A;  4U88 A;  2CYY A;  4AUX A;  2BGC A;  1FIP A;  1PDN C;  5J1R A;  1WZ2 A;  1YHQ I;  4KFC A;  4MGR A;  1VQ9 I;  2DA3 A;  2NAZ A;  2D2W A;  5CLS A;  3MFK A;  2DFI A;  1Q1H A;  1GT0 C;  1Z7L A;  4EM2 A;  2OJE D;  2FRH A;  4E4H A;  4LLN A;  3OYL A;  2COM A;  1Y8Q B;  2L01 A;  2CMP A;  2V6C A;  1I3Q J;  4A5N A;  1FIA A;  3ECO A;  4B43 A;  1GVD A;  3BPV A;  5JI6 A;  3IRQ A;  5EGO A;  5FLV A;  2FNP A;  2O5R A;  1TWA J;  2DPD A;  1R6R A;  4HST A;  2O8X A;  1AA7 A;  1D3Y A;  1LFU P;  2QEN A;  3GTQ J;  4RAG A;  2KJB A;  1HDP A;  2HQN A;  1FSE A;  4Q4Z F;  4EM1 A;  5K7F A;  4AIJ A;  1LEB A;  3C3W A;  4FE4 A;  4XMY A;  2X6X A;  1JGG A;  3I3L A;  3R6S A;  1B72 A;  1R4M B;  1YOV B;  2BBY A;  4YRV A;  2Z99 A;  4IL6 C;  1T8I A;  3HOZ J;  2LSO A;  1LUJ B;  3HTS B;  2M7B A;  1G3W A;  2A5Y B;  4UVA A;  1R9T J;  4ZTF A;  5GTI C;  4RGS A;  4A3I J;  2L0K A;  5LHG A;  4M9X A;  4P1W A;  2Z33 A;  4WF2 A;  2JPB A;  5E3M A;  3S3N A;  3WU1 B;  1X1A A;  1SFE A;  1O3T A;  1GHC A;  3EUH A;  1OMI A;  3GLL A;  1G59 A;  1TQM A;  5D4S A;  5CVR A;  5EG0 A;  5IYB J;  2J5O A;  4AVZ A;  1WJE A;  3QYE A;  1FWZ A;  2DMN A;  3B6A A;  1N78 A;  2HDD A;  3K1N A;  4CUG A;  2P81 A;  1QU3 A;  1E3H A;  1LE8 A;  4NHJ A;  2H6C A;  4Y15 A;  1YIJ I;  2X0L A;  5ED4 A;  3CCS I;  1P92 A;  3FMR A;  4EJT A;  4WX9 A;  5B5E C;  4LOC A;  4B09 A;  1SFO J;  3QPS A;  3LSK A;  2QWW A;  2F4O B;  2L9S A;  5EZG A;  2JUC A;  3V8J A;  1UMQ A;  4IHV A;  2DA4 A;  1QRY A;  2DQL A;  4A0Y A;  4GYG A;  4A6E A;  4IHW A;  2JVG A;  2EQR A;  3K1P A;  2L5Q A;  2XRN A;  4X1E A;  2KRH A;  4EQQ A;  2DA1 A;  3NEU A;  3E7L A;  3ZPL A;  1UHS A;  2F5D A;  2DK5 A;  1TZL A;  3GF2 A;  2IS4 A;  2HGC A;  1ZRE A;  2YSR A;  4XOT A;  3PNY A;  3JCU C;  4XRM A;  3DXJ F;  3JR9 A;  1VQO I;  1WH7 A;  1X58 A;  2OAZ A;  3SZT A;  1NH3 A;  4F7Z A;  1Z91 A;  4M9S A;  1U2W A;  5F1J A;  2XKO A;  3PFY A;  3ZQL A;  4AWX B;  1IDY A;  1IDZ A;  2TCT A;  2X48 A;  5J8C A;  2V26 A;  2YR2 A;  2CS3 A;  4Y4R A;  5FO5 A;  3ZMS A;  2H09 A;  4KYW A;  1MDM B;  1S6L A;  4FQG A;  2CW8 A;  3I53 A;  1W5C C;  2STW A;  2EPF A;  2AQF A;  4I6Z A;  1BC7 C;  5D8L B;  4XKC A;  3EUH C;  5DCM A;  2MD0 A;  3KZY A;  3OWT A;  4UUS B;  1FTZ A;  3H0G J;  5KAF C;  3L2W A;  1MND A;  3HOW J;  1VI0 A;  2RQP A;  1QHH D;  1X1C A;  5LGN A;  3BCB A;  3CJQ B;  2EH3 A;  2LMD A;  3CMA I;  3BR5 A;  4HAM A;  5GPC A;  2KL4 A;  3RKY A;  1PP7 U;  1J5Y A;  4I09 A;  5GAE J;  3KLN A;  5HOD A;  2CGP A;  2JA6 J;  3JSP A;  4BHB A;  4C3I J;  1J75 A;  3M3Y J;  1BW5 A;  3OYF A;  2PMZ N;  4MNU A;  1Z0X A;  2IW5 A;  5F64 A;  2KLO A;  5HS8 A;  5FKM A;  1YO5 C;  1EA3 A;  2M4G A;  1MGT A;  2DBB A;  4B4C A;  1K61 A;  1OYY A;  2DMP A;  4BY7 J;  2VXZ A;  4QPO A;  3VOE A;  4LG0 B;  1R1U A;  3OR1 C;  4YG2 F;  1TNS A;  9ANT A;  4D5C A;  3SXY A;  1R5G A;  3HC7 A;  2CQX A;  3ELK A;  3W6K B;  1SVL A;  1FLI A;  2ISY A;  2PEX A;  2WAE A;  3DCF A;  2C6Y A;  1IXC A;  3DP7 A;  2XB0 X;  3FXU A;  1B4A A;  2IA2 A;  3P5J A;  3FXL A;  1SFX A;  3DBL B;  3ULQ B;  2DA2 A;  4QSH A;  1IC8 A;  2BEO A;  2CUZ A;  2Q2E A;  4LG3 A;  3E6M A;  1BW6 A;  3IUO A;  2P6T A;  4MFE A;  3VSK A;  5CQG A;  3L2Q A;  5FRN A;  1TC3 C;  4CCM A;  1DU6 A;  1UZC A;  2UXX A;  3FHN A;  1V5F A;  2DOE A;  2X6Y A;  4ZYH A;  4ZYA A;  2M3A A;  3TOB A;  2CUF A;  5TIS C;  2OU2 A;  3L7W A;  4HV6 A;  4CDG A;  1TBX A;  2RC4 A;  3IKT A;  3OL4 A;  4RAY A;  2HZD A;  2HNH A;  2R7F A;  4IHT A;  3ECH A;  1O4X A;  2DOD A;  2KFD A;  3S15 J;  2R7D A;  5F0H A;  2JZY A;  2VBX A;  1NK3 P;  5D4R A;  2QVO A;  5HNH A;  2VJJ A;  4FTH A;  2B63 J;  3KEO A;  4WXC A;  1C0W A;  1WKM A;  4GDF A;  2YX4 A;  4MEY F;  1K4S A;  4A2U A;  1Z3X A;  3F22 A;  3HYI A;  4V2F A;  2MLG A;  2K02 A;  1IRF A;  2DLL A;  2IPQ X;  4HX8 A;  3D5R C;  2E1M B;  3O8H A;  1TWC J;  1U9O A;  3K4N A;  1J09 A;  2WAD A;  1BJZ A;  4FX0 A;  2DU9 A;  2ECB A;  2EWN A;  3FZV A;  2QF7 A;  3JRG A;  1U5T A;  3VYS B;  4IOC F;  1IN8 A;  4I76 A;  3ZCO A;  5C3E J;  4CXF A;  3DQV C;  2OPT A;  1W5S A;  2XV4 S;  3ABU A;  5HLI A;  1TTY A;  1WPK A;  2BV6 A;  3H3U A;  1R00 A;  3OYB A;  1IXS B;  2NVU B;  1R1V A;  4A6D A;  3HKZ A;  2CW7 A;  4PJJ A;  3LAJ A;  2RNJ A;  2DPU A;  1T33 A;  3TW7 A;  1FYM A;  2ZXJ A;  4N4O B;  3H3V K;  3I9V 2;  4EAT A;  4NQW B;  4JP0 A;  3GTM J;  5CQE A;  3JRE A;  1VQ7 I;  2NXN B;  2VUM J;  3S32 A;  2IEK A;  2QA4 I;  3R4K A;  3TKY A;  1XN7 A;  2BXY A;  2EIK H;  2OC6 A;  2L9V A;  2WTE A;  4JYK A;  3NRV A;  2E1C A;  3QPT A;  3UR3 C;  2ELK A;  3CCQ I;  3BLY A;  2IRF G;  3K6G A;  3U9G A;  2E2I J;  3DBH B;  3COA C;  3V4G A;  5BOX A;  4I7H A;  1Y56 A;  1U8B A;  1AKH A;  3SZP A;  1ZAO A;  1IRZ A;  3HB9 A;  4XLN F;  3OYM A;  2HOT A;  4S0H B;  4N9I A;  4N4N B;  1H9T A;  3L1P A;  4KN4 X;  2P0W A;  3K4L A;  2RGV A;  3H36 A;  3TL4 X;  2CQN A;  3PQJ A;  4NC8 A;  5JVT A;  1BOB A;  4UUT A;  3ZOB A;  2BW3 A;  3CUQ C;  4M72 A;  2M0M A;  2GA2 A;  4E7I A;  1D1C A;  2IP2 A;  2J5P A;  5HLT A;  2QQA A;  1BJA A;  2XC7 A;  1T38 A;  4NNJ A;  2QZ8 A;  1ETQ A;  2FOK A;  2XSJ C;  1ETK A;  1U5T C;  3V8K A;  1NK2 P;  3O8G A;  3S3M A;  2KT0 A;  4RBO A;  4PGH A;  2V1N A;  1MH3 A;  5IT9 Z;  1HCR A;  4S05 A;  1U3E M;  1T98 A;  4HZF A;  4RLF A;  2FBI A;  4C2T A;  1Z05 A;  4C30 A;  1FY7 A;  1YE9 A;  3IL2 A;  5E3N A;  3GTG J;  3TDU C;  3KLO A;  4CSW A;  2HDW A;  4ZZL A;  4BJ6 C;  5LGU A;  5DD4 A;  3E0J B;  1OPC A;  4BJ5 C;  2DA6 A;  1O7L A;  3HPG A;  1FNN A;  1EF4 A;  2ZJQ F;  1ZYR F;  1XCB A;  1Z1D A; 
#chains in the Genus database with same CATH homology
 4WCG A;  1HBX G;  1LB2 A;  2EFP A;  1IN5 A;  5JHU A;  4Q5S F;  4HF1 A;  3FHZ A;  3DFG A;  2JTV A;  2FF4 A;  1X3U A;  2P6S A;  5K1Y A;  3K1M A;  2Y75 A;  4UVC A;  3L00 A;  1XSV A;  2XAS A;  3D0S A;  3HRT A;  1YS6 A;  2V1U A;  2P4W A;  4BHC A;  1RI7 A;  1LEA A;  1QGP A;  1TQI A;  3IWF A;  5LRS A;  4PZJ A;  2CO5 A;  2CG4 A;  3O3K A;  3B73 A;  3BZ6 A;  1IW7 F;  2AS5 F;  2PG4 A;  2XKP A;  2IA0 A;  4KDP A;  4ON0 A;  4HOB A;  5LEK A;  1S7O A;  4XRF A;  5CVV A;  1YIO A;  3GFI A;  2EFQ A;  4BXU A;  2UZK A;  2GIV A;  5ICF A;  4WK8 F;  3CLO A;  3P7N A;  2L3D A;  2VE8 A;  2ZME A;  3IC7 A;  3MAJ A;  2WV0 A;  1IN4 A;  2W85 A;  1H0M A;  4G9Y A;  1IAW A;  4HV5 A;  3E97 A;  1K6O A;  4PGG A;  5HDG A;  2PBI A;  3R61 A;  2BYV E;  4R79 A;  1ON1 A;  2NRA C;  2FQ3 A;  1BC8 C;  3J7A O;  1RIO H;  3GVA A;  1P4X A;  2TDX A;  2ADU A;  2B0L A;  4JK1 X;  4UXN A;  2G9W A;  1YW7 A;  3BY6 A;  4HX4 A;  1ZG3 A;  2A69 F;  5DUI A;  1O3Q A;  1V4R A;  5L3F A;  3QU6 A;  4I01 A;  5HOO A;  2CQK A;  2EFN A;  3MZH A;  1IZ1 A;  1S29 A;  1G4D A;  1Z6R A;  1R7J A;  2A68 F;  4OMZ A;  1OYW A;  3TO6 A;  4OU0 A;  4UV9 A;  1R58 A;  5LRR A;  2ETH A;  2VBZ A;  3M8E A;  3V7C A;  2KKO A;  2OBP A;  3WU0 A;  2HTS A;  5D5X B;  2EK5 A;  3P9I A;  4G94 A;  1FC3 A;  4GCV A;  5IT3 A;  3HRS A;  4AIK A;  4OIP F;  1VTN C;  4R8H A;  2D1H A;  3GUD A;  2FSW A;  2P5V A;  3EYY A;  3G73 A;  4UUV A;  1J2X A;  1KU3 A;  3C7J A;  3RYR A;  3U1D A;  4DQ2 A;  4CHU A;  4FT8 A;  1FX7 A;  4L9J A;  4EJU A;  2M1B A;  4RGU A;  2QQB A;  4ASN A;  1SFU A;  3MWM A;  4MEX F;  1R36 A;  2DAO A;  4ENK A;  2ZNY A;  4AVP A;  2HZT A;  3R0J A;  1RUN A;  1XCV A;  5L3G A;  3LAP A;  1KGS A;  2EV6 A;  3M9A A;  3GFM A;  2XVC A;  3R60 A;  3J80 Z;  2VBY A;  2OA4 A;  1ZYR F;  3JAM K;  2QQ9 A;  2A61 A;  1W4M A;  3E5U A;  4ENN A;  2KRF A;  3ZQ7 A;  3GZ6 A;  5E8G A;  1YTY A;  4HDU A;  2LF8 A;  5K5R A;  5FLX K;  1FYL A;  5ERI A;  2HFH A;  5D5U B;  1NHA A;  4MTE A;  3QRF F;  3HTU A;  4I0A A;  4LB6 B;  4U0V A;  2JRT A;  1ODD A;  1BOA A;  1UST A;  4BH9 A;  2MC3 A;  5JR3 A;  3F72 A;  2HTJ A;  4MQV A;  1CF7 A;  5FD6 A;  3FM3 A;  3WGI A;  4MHG A;  2FXA A;  3KP3 A;  4O6J A;  1Z7U A;  3DPL C;  4IJA A;  5FB2 A;  1D5V A;  3NQO A;  1TNT A;  5E1Z B;  3M1E A;  3TGN A;  2XAF A;  4QLC U;  2W24 A;  4I98 B;  3MEX A;  1QPM A;  5LGT A;  2Z5U A;  5FD5 A;  1FPQ A;  2O61 A;  2E7W A;  5HLH A;  1XGN A;  2PI0 A;  4G6Q A;  1HSJ A;  2DK8 A;  4LLL A;  1I6X A;  1BI2 A;  4P55 A;  2FML A;  4KNY A;  1I1G A;  2Q0O A;  3BWG A;  2L4A A;  5E18 F;  3KP4 A;  1ZAR A;  3KZZ A;  3WG9 A;  2CSO A;  3AAF A;  4IHS A;  4O3M A;  3DF8 A;  1QBJ A;  1MD0 A;  1FSH A;  2DT5 A;  4GXO A;  5LHI A;  4OIO F;  3QOP A;  3BPX A;  2H94 A;  5H6R A;  4Y13 A;  3TDZ C;  3CDH A;  2JSC A;  2XIG A;  2WC2 A;  4G6D A;  2K7L A;  5ILU A;  3P9C A;  3WE2 A;  3PQK A;  3WTV C;  2F5C A;  1FOK A;  3HSF A;  4M6X A;  3WOD F;  2HYG D;  3MZY A;  3RIR A;  2L02 A;  2H27 A;  1FYK A;  5HDK A;  3EQL F;  1L3L A;  3RKW A;  1RNL A;  1XSD A;  2L4M A;  3D5L A;  1ZGA A;  2PMH A;  5ILV A;  2GWR A;  3BJO A;  1SD5 A;  3QPH A;  4I0B A;  3HHG A;  4U0W A;  3RJP A;  1ZRD A;  5LHH A;  3LFK A;  1HKT A;  1F5T A;  4RB1 A;  4XLP F;  3M7G A;  4XSZ F;  3HOT A;  4M6Y A;  4UNO A;  3I54 A;  5BPD A;  2HR3 A;  2STT A;  2ZFW A;  4O5V A;  3QU3 A;  3E5Q A;  2M8E A;  1WQ2 A;  5HDN A;  4G7H F;  1KQ9 A;  4IXA A;  2KIU A;  1IXR C;  3RTR A;  4OOI A;  2G7H A;  1GXP A;  1XD7 A;  4UVB A;  3F21 A;  3VFZ A;  3O6B B;  4OIQ F;  1JHH A;  2VC1 A;  1QQI A;  2VOO A;  2HQR A;  1B1B A;  2V79 A;  1F4K A;  3CUQ A;  1XMK A;  1YFH A;  3GFL A;  4CYD A;  1T39 A;  2GXB A;  4EJO A;  5DV5 A;  3ROU A;  3BOQ A;  3KET A;  4RGX A;  2QM3 A;  1IN7 A;  4YIF A;  1LDK B;  4A12 A;  2LF7 A;  4A0X A;  3GO5 A;  5HVQ C;  5ILS A;  2OQR A;  4CGZ A;  3J81 K;  3OV8 A;  2CW0 F;  5DYM A;  3WTT C;  1R23 A;  4HX7 A;  3FX3 A;  5CVI A;  3IKV A;  1JE8 A;  2XHK A;  3RYP A;  5D8K B;  2VOD A;  5TRD A;  2WWY A;  3KP2 A;  2VE9 A;  1SMT A;  4LMY A;  3LWF A;  3DKW A;  2ZME B;  1UHW A;  1FBS A;  3F8M A;  2V9V A;  1XGM A;  4ZYG A;  1R5H A;  3L9F A;  2W57 A;  1B6A A;  1FP2 A;  2F5F A;  3HRM A;  5H20 A;  5BMZ A;  1W7P A;  1PP8 F;  2KIF A;  4Q48 A;  3GZ5 A;  2RDP A;  4TV7 A;  1REP C;  5H6Q A;  4BYY A;  4LG0 A;  3C1D A;  2LKP A;  2EV0 A;  3REO A;  3FF5 A;  3EYI A;  3JW4 A;  5L3D A;  2E7X A;  2XAJ A;  4KMF A;  1HKQ A;  2FMY A;  4RB3 C;  5IT9 K;  4ZZD A;  3H3Z A;  3I64 A;  3ISP A;  4M73 A;  4LLG F;  1U6G A;  1BM9 A;  1AWC A;  2VC0 A;  3DPT A;  2XGX A;  4YFN F;  1V3F A;  4Y17 A;  5LLQ A;  2MA3 A;  2LDU A;  3JTH A;  4UV8 A;  4L0Y B;  2VOP A;  4L18 B;  3ZN0 A;  5BS6 A;  1KYW A;  1HXD A;  1WWX A;  3WTZ A;  2EA4 A;  1J7K A;  2P8T A;  2P5K A;  1EH6 A;  4E70 A;  2EB7 A;  2MLK A;  5AON A;  2IA1 A;  4HW0 A;  5L3E A;  4P5O A;  2D1V A;  3RPU A;  3VB2 A;  2BE5 F;  2HDC A;  4WXH A;  4HA8 A;  3SFZ A;  2HEO A;  3F6V A;  4K2E A;  5CVJ A;  1K78 B;  2X4H A;  2GXG A;  3E6D A;  2RV8 A;  2JPC A;  4YFK F;  3BDD A;  4FX4 A;  1FBQ A;  1F1Z A;  1MJB A;  1IRG A;  3GX4 X;  2OZ6 A;  2QUF A;  1BI1 A;  6PAX A;  3WTW C;  1MJ9 A;  3BJ6 A;  3LQR A;  3ZMZ A;  5D6E A;  4HQM A;  1H9G A;  4M71 A;  3BRO A;  1DP7 P;  5ICE A;  5ICC A;  4U0Y A;  1ON2 A;  4A0Z A;  2XAH A;  1OR7 A;  2W25 A;  2F5E A;  4BNC A;  1KU9 A;  1D8J A;  4AD9 A;  5A2Q K;  1DPR A;  3HRU A;  1QZY A;  4D0P A;  5HLG A;  1EH8 A;  4EGZ A;  4OMY A;  1SD4 A;  1QZZ A;  1GXQ A;  1I1S A;  2DI3 A;  2ACJ A;  3TQN A;  4OIR F;  2HKO A;  2FE3 A;  1YG2 A;  4N0B A;  2M87 A;  4LD5 A;  3PFI A;  3GFJ A;  1B9M A;  4LB5 A;  1CF7 B;  3I71 A;  1UCR A;  2FU4 A;  2HS5 A;  2VON A;  1LDJ A;  5L3B A;  5KVR A;  1WRJ A;  3KP5 A;  2D45 A;  5BPI A;  5EEG A;  3R0A A;  1J9I A;  1YQA A;  1KU2 A;  1U78 A;  1T0F A;  3TO9 A;  5DUK A;  1FT9 A;  2O3F A;  5E1X A;  4IRH A;  3HUG A;  4KUM A;  4NB5 A;  5K5Q A;  4ENJ A;  1YW8 A;  3F6O A;  2A3S A;  5FFX A;  3ERE D;  5E1W A;  5BQT A;  4R1H A;  4LK1 F;  5FFZ A;  3U2R A;  2VT2 A;  2CWE A;  2ZKZ A;  2RVC A;  4EGY A;  2ZJ2 A;  3KCC A;  4ENM A;  5DD8 A;  1G3T A;  1UFM A;  3F8N A;  3Q9S A;  4BHP A;  3JAM Z;  1HW2 A;  3F3X A;  3HSR A;  2Y48 A;  4ESB A;  2K86 A;  4ZH4 F;  2E1N A;  2FNA A;  4L5J A;  3ZN1 A;  1SD7 A;  4L0Z B;  4ZYD A;  4LJZ F;  2F2E A;  2UXN A;  1XB4 A;  3DV8 A;  5D6F A;  1TW2 A;  5DCM B;  3WTS C;  3T8R A;  4L9V A;  1MZB A;  2ESN A;  2O03 A;  2A6H F;  2GAU A;  2XUB A;  2IVM A;  3LA7 A;  4LGW A;  5CYV A;  3WTX C;  3O2P E;  2EFW A;  3HSE A;  4PCQ A;  2P5L C;  1Z9C A;  3EDP A;  5D5V B;  2O0Y A;  3I59 A;  2QBY A;  3IWZ A;  1LQ1 A;  3IRR A;  1XCB A;  1BI0 A;  5DCF A;  1S8N A;  1D8K A;  3ZP5 A;  2FA5 A;  4EJV A;  2MH9 A;  2Z9O A;  5CVU A;  3LA2 A;  3MQ0 A;  1W5T A;  4FHT A;  3JTG A;  3GEZ A;  1HW5 A;  4H0E A;  2DQR A;  3KEQ A;  1L0O C;  3ABT A;  3RI4 A;  5EEH A;  2P7C B;  1O3S A;  3I5U A;  3V7R A;  3WE3 A;  4G7Z F;  1IF1 A;  3CUQ B;  4IRG A;  1KYZ A;  2PFB A;  1B59 A;  1YS7 A;  4RAZ A;  1U5T B;  2HOE A;  4XSX F;  3W6J B;  3CO6 C;  2V1D A;  1TQP A;  1YLF A;  2PQ8 A;  3CO7 C;  1HQC A;  1EV7 A;  4EJW A;  1BBY A;  2K4J A;  4KT5 C;  2ZNZ A;  1O7F A;  5J8F A;  2FBK A;  1R22 A;  1P2F A;  4ZYE A;  1CGP A;  1P4W A;  2ELH A;  4IRI A;  1O3R A;  3L09 A;  4IPA A;  4KMU X;  1OYI A;  2QYO A;  5AIP A;  2VT3 A;  2PJP A;  1R1T A;  3QP6 A;  3HOS A;  1J0R A;  1WSU A;  3ZMU A;  2YU3 A;  1USS A;  4B8X A;  5D5W B;  3T8T A;  3OOP A;  1TLH B;  1J59 A;  4ESJ A;  4UHT A;  4CZZ A;  3E5X A;  3C18 A;  5E20 A;  1W7P B;  5HS9 A;  3F23 A;  4P96 A;  2XAG A;  1XGS A;  4JBA A;  2HWV A;  2DTR A;  2EFO A;  3N4M A;  2M45 A;  1BN5 A;  3E6B A;  3F8F A;  3G3Z A;  3FMS A;  2HYF A;  5LEJ A;  4KIB A;  3KFW X;  1XDU A;  2CFX A;  4GGG A;  4EMS A;  4L5I A;  2L54 A;  1LVA A;  5F6F A;  1S3J A;  4P9U A;  2W84 A;  1LNW A;  3WGH A;  2P7V B;  1GVJ A;  1IUY A;  5CJ9 A;  2OD5 A;  3HIF A;  2FBH A;  1A04 A;  2GQQ A;  1ZLK A;  4L9T A;  4MQ9 F;  1RUO A;  3FM5 A;  4YFX F;  5L3C A;  1ZLJ A;  4HF0 A;  4G8X A;  4L9N A;  3L2C A;  2KIM A;  1E2X A;  3LA3 A;  2AXL A;  3FMQ A;  4HYE A;  3I0T A;  1SAX A;  4HQE A;  4P9F A;  3Q9V A;  2JT1 A;  2H6B A;  1F9N A;  3J81 Z;  2XAQ A;  2ZBK A;  4U7D A;  1ZG1 A;  2MH2 A;  2IJL A;  1BI3 A;  1Z6T A;  4XBF A;  2OZU A;  4BQA A;  3ZMT A;  2FEZ A;  1MDM A;  2EJR A;  3RDI A;  4M9Z A;  4WWC A;  1PUE E;  3QP5 A;  1KQ8 A;  4GYI A;  1KA8 A;  3V7S A;  3ML6 A;  4CO8 A;  2VN2 A;  4ETS A;  4HLY A;  4KIG A;  1YW9 A;  1BIB A;  4RS8 A;  4WXD A;  1SMY F;  4CIC A;  1ONV A;  3H92 A;  1K79 A;  4AIH A;  3N97 A;  3WTY C;  4N9H A;  1ZRC A;  4KA4 A;  1AOY A;  3CJN A;  5JFR A;  1U8R A;  1S7A A;  3GW2 A;  4RGR A;  3BJA A;  1STZ A;  1KQ0 A;  1UB9 A;  4Q47 A;  1HKS A;  1Y0U A;  3V8L A;  2XRO A;  3FXQ A;  3SQN A;  3B02 A;  1LDD A;  1UHM A;  3S2W A;  2ISZ A;  1MKM A;  1JXS A;  2GZW A;  1P4A A;  1SD6 A;  5F1R A;  3T5X A;  3K2Z A;  3GWZ A;  1I27 A;  2Q8K A;  3ZMD A;  5ICG A;  4LFU A;  2UWM A;  1ZRF A;  1I5Z A;  1O57 A;  3TOA A;  3M8F A;  1B9N A;  4U7B A;  2ESH A;  1XGO A;  1WI9 A;  3BP8 A;  4RB2 C;  2YX7 A;  3Q5F A;  3I4P A;  4KIC A;  5TJJ A;  1FBU A;  1W7P D;  2R3S A;  5J6X A;  3P9K A;  3KP7 A;  4DNC A;  2M30 A;  1EH7 A;  1DPU A;  3DEU A;  3KE2 A;  5AIQ A;  4LK0 F;  1XDS A;  5DEQ A;  3LST A;  5E8I A;  4KN7 X;  4M74 A;  4GO1 A;  2PMU A;  4KIF A;  3VOD A;  4MTD A;  2IT0 A;  4NQW A;  2V1X A;  4HLX A;  1KU7 A;  3HHH A;  3ZMV A;  3GLX A;  3RKX A;  3F8C A;  1ZGJ A;  2QLZ A;  3LQQ A;  1IN6 A;  2A07 F;  2K4B A;  5A2Q Z;  4IF4 A;  4ESF A;  4S04 A;  3T0Y A;  4RB0 A;  3K9T A;  2Z3Y A;  1RZ4 A;  1DDN A;  2RKH A;  3RPQ A;  3WTU C;  3CUO A;  2HKX A;  4HDV A;  4YII A;  3TO7 A;  1G3S A;  5HS7 A;  2M5W A;  4G7O F;  1QNT A;  2O6G E;  2DO7 A;  1E17 A;  4JQF A;  3FXR A;  3K69 A;  4OIN F;  2VBW A;  4BAY A;  3I58 A;  1MJA A;  3VEP A;  3E3V A;  3K0L A;  3JSO A;  1ULY A;  2YPR A;  1ZG5 A;  2A6E F;  3I59 B;  1T2K A;  4I02 A;  1JGS A;  2KJC A;  4QWQ A;  2QBY B;  3F8B A;  2EA2 A;  2PN6 A;  2Y0M A;  5K5O A;  2PLY A;  2MD5 A;  4Z2Y A;  4EV0 A;  2NNN A;  1ZHF A;  2NNY A;  2RN7 A;  1G6N A;  5FGM A;  3FWE A;  3T1B A;  2EV5 A;  3GYH X;  1ZN2 A;  3CTA A;  3GXO A;  1TW3 A;  1FZP B;  2K27 A;  2MBF A;  5KK1 A;  3MCZ A;  1JHF A;  3QAH A;  1BIA A;  3KP6 A;  2LNB A;  3EET A;  1FP1 D;  4I2O A;  4EM0 B;  5DDG A;  1YYV A;  1LJ9 A;  1K78 A;  2NYX A;  1K7A A;  3WGG A;  5LBQ A;  3SHF A;  3J80 K;  4IVN A;  4HBL A;  1XMA A;  2ZO4 A;  1OKR A;  2GA1 A;  4EVI A;  1P6R A;  2OQG A;  1HW1 A;  5FLX Z;  1XSX A;  1DUX C;  2DW4 A;  1T6S A;  1HST A;  4PDK A;  3E6C C;  2ZCW A;  5E17 F;  4A5M A;  4HF2 A;  1QO0 D;  2G7U A;  2NS0 A;  1G3Y A;  4U88 A;  2CYY A;  2BGC A;  1PDN C;  4KFC A;  4MGR A;  2NAZ A;  2D2W A;  5CLS A;  3MFK A;  2DFI A;  1Q1H A;  4EM2 A;  2FRH A;  4LLN A;  2COM A;  2L01 A;  2V6C A;  4A5N A;  3ECO A;  5JI6 A;  3BPV A;  3IRQ A;  2FNP A;  2DPD A;  2O8X A;  1D3Y A;  2QEN A;  2KJB A;  2HQN A;  1FSE A;  4Q4Z F;  4EM1 A;  1LEB A;  4AIJ A;  3C3W A;  3R6S A;  2BBY A;  2Z99 A;  2LSO A;  3HTS B;  1G3W A;  2A5Y B;  4UVA A;  4RGS A;  5LHG A;  2Z33 A;  4WF2 A;  2JPB A;  3WU1 B;  1SFE A;  1O3T A;  1GHC A;  3EUH A;  1OMI A;  1TQM A;  5D4S A;  5CVR A;  2J5O A;  1FWZ A;  3K1N A;  4NHJ A;  2H6C A;  4Y15 A;  2X0L A;  5ED4 A;  1P92 A;  3FMR A;  4EJT A;  4WX9 A;  4B09 A;  2QWW A;  3V8J A;  2DQL A;  4A0Y A;  4GYG A;  4A6E A;  3K1P A;  2XRN A;  4EQQ A;  3NEU A;  3ZPL A;  2F5D A;  2DK5 A;  3GF2 A;  2HGC A;  1ZRE A;  2YSR A;  3DXJ F;  2OAZ A;  3SZT A;  4F7Z A;  1Z91 A;  4M9S A;  1U2W A;  2XKO A;  4AWX B;  5J8C A;  2YR2 A;  5FO5 A;  3ZMS A;  2H09 A;  4KYW A;  1MDM B;  1S6L A;  3I53 A;  2STW A;  1BC7 C;  5D8L B;  5DCM A;  3KZY A;  2RQP A;  5LGN A;  4HAM A;  3RKY A;  1PP7 U;  1J5Y A;  4I09 A;  3KLN A;  2CGP A;  3JSP A;  4BHB A;  1J75 A;  4MNU A;  2IW5 A;  5F64 A;  5HS8 A;  1YO5 C;  1MGT A;  2DBB A;  1OYY A;  2VXZ A;  3VOE A;  4LG0 B;  1R1U A;  4YG2 F;  1TNS A;  3SXY A;  1R5G A;  3W6K B;  3ELK A;  1FLI A;  2ISY A;  2PEX A;  2C6Y A;  1IXC A;  3DP7 A;  3FXU A;  1B4A A;  2IA2 A;  1SFX A;  3ULQ B;  2BEO A;  2Q2E A;  3E6M A;  2P6T A;  2UXX A;  4ZYH A;  3TOB A;  2OU2 A;  3L7W A;  4HV6 A;  4CDG A;  1TBX A;  2RC4 A;  3IKT A;  4RAY A;  2R7F A;  4IHT A;  3ECH A;  2R7D A;  2JZY A;  2VBX A;  5D4R A;  2QVO A;  3KEO A;  4WXC A;  1C0W A;  1WKM A;  2YX4 A;  4MEY F;  4A2U A;  3F22 A;  3HYI A;  2MLG A;  2K02 A;  1IRF A;  2DLL A;  2IPQ X;  4HX8 A;  4FX0 A;  2DU9 A;  2EWN A;  3FZV A;  1U5T A;  1IN8 A;  4CXF A;  3DQV C;  1W5S A;  2XV4 S;  3ABU A;  5HLI A;  1TTY A;  3H3U A;  2BV6 A;  1R00 A;  1IXS B;  1R1V A;  4A6D A;  3LAJ A;  2RNJ A;  2DPU A;  1FYM A;  2ZXJ A;  3R4K A;  3TKY A;  1XN7 A;  2WTE A;  3NRV A;  2E1C A;  3QPT A;  2IRF G;  3U9G A;  3COA C;  3V4G A;  5BOX A;  4I7H A;  3SZP A;  1ZAO A;  4XLN F;  4N9I A;  1H9T A;  4KN4 X;  2RGV A;  3PQJ A;  5JVT A;  3CUQ C;  4M72 A;  2GA2 A;  2IP2 A;  2J5P A;  2QQA A;  1BJA A;  1T38 A;  2QZ8 A;  3V8K A;  2FOK A;  1U5T C;  4PGH A;  5IT9 Z;  4S05 A;  1U3E M;  1T98 A;  4HZF A;  2FBI A;  1Z05 A;  1FY7 A;  3IL2 A;  3TDU C;  3KLO A;  4ZZL A;  5LGU A;  5DD4 A;  1OPC A;  1O7L A;  1FNN A;  1ZH5 A;  4M9X A;  3IHU A;  1Z1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...