2H1KA

Crystal structure of the pdx1 homeodomain in complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
b'RTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 15-mer DNA
publication title Structural basis for induced fit mechanisms in DNA recognition by the pdx1 homeodomain
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Transcription/dna
total genus 17
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h1kA00
2DA1A 1QPIA 3FISA 4A3FJ 4M3FA 1Y1WJ 3FK7A 1ETVA 2TCTA 2GLOA 1VFCA 2JA6J 3ZQIA 5IP7J 4A3KJ 1P7IA 1OCTC 2K9QA 1T33A 3JRIA 2OPTA 4A3IJ 3Q0WA 1GUUA 3FKIJ 1ETQA 1ZKGA 1RR7A 2EH3A 4I76A 4AYBN 2R5ZA 3S2HJ 2KDZA 2ELKA 4MFEA 1HCRA 3HGYA 5C4JJ 1BA5A 2VI6A 4JX5A 1FJLA 1SANA 3BTJA 2VKEA 3ZOBA 1B72B 3E7LA 5E3LA 1AU7A 3ZQLA 1YRNA 3HDDA 4JP0A 1LFUP 5M3FJ 3NARA 2D5VA 3TEDA 2R5YA 2DA4A 3PM1A 2DMUA 3RZOJ 3A01A 2I10A 5M3MJ 5EGOB 2NOGA 5F27A 2YS9A 5IOYA 5J3LA 2JJ7A 2VKVA 1RKWA 3JRBA 4XICA 2HOSA 5M5YJ 2XRLA 5C44J 1I3QJ 4JX6A 4MIMA 3IV5A 3GTQJ 4J19A 1MBJA 4M6VA 1TWFJ 4C2MJ 1ETWA 2HQ5A 3MVPA 4XRSG 2M8GX 5EZHA 1TWAJ 5EYRA 4DYRA 2E2IJ 1Q1VA 4DW6A 4A3JJ 1TWCJ 1OFCX 3HKZN 4NDLA 4B4CA 5F0CA 3CMYA 3K7AJ 1HDPA 3SDGA 4BXXJ 2RAEA 4D7MA 2HOTA 5DTDA 4DYCA 1MBEA 4M3BA 2LFBA 2WB1N 1NK3P 3CQZJ 5EG0B 2QF7A 3SJMA 3HOYJ 5K7HA 2M0CA 4DZPA 4A3EJ 1IG7A 2CQXA 5FLVA 1JT6A 2XGCA 3HGGA 2DTZA 4S0HB 2E2JJ 1FTTA 1I50J 1IDYA 1WH7A 4M3GA 3ZQHA 1GDTA 3S2DJ 4A3DJ 3MKLA 1JTXA 2HYJA 4DYQA 1SFOJ 1PUFB 3S15J 4BBSJ 1JKPC 3LSJA 4MO7A 3JR9A 4LOCA 2Y31A 1XC5A 1IRZA 2EQRA 4XRMA 3B6AA 2GM4A 2WV1A 4IHYA 5BNGA 4A3LJ 3RZDJ 3RKQA 5C4XJ 3HOWJ 4B3AA 5K7ZA 1ETXA 5E3NA 2TRTA 1JKRC 2DA7A 2H1KA 3M4OJ 2JWTA 2K9NA 3QPLA 1R9TJ 2CUEA 3TW6A 4BY1J 2K9SA 4V2FA 3PO2J 1JT0A 4JYKA 2ECBA 3S1RJ 3FK6A 1IJWC 2CJJA 2QCOA 3BT9A 2LD5A 1LE8A 4A3BJ 1X2NA 3OIOA 4G12A 2XPUA 1WCMJ 2XGEA 2M34A 2ME0A 2OF7A 1QRYA 3LOCA 4C3JJ 1NTCA 3TP0A 1IUFA 5F0FA 4I6ZA 2ZB9A 2Y0SN 4A3MJ 4FE7A 1Y1VJ 1WH5A 2LKXA 1JUSA 4V2GA 1MBKA 1ZQ3P 2X9DA 2M9HA 1GV2A 4IHWA 3S1QJ 3OSGA 4FISA 4QSHA 4W97A 3LSRA 4X6AJ 2Y9YA 4UUTA 4C3IJ 3GTGJ 1FIAA 3BQZA 1U9OA 3CDLA 2E19A 2YU9J 2E1OA 1WPKA 1G2HA 1ETOA 2WAQN 2DMTA 4XIDA 3G1MA 2LP0A 2DMQA 2DMNA 2EBIA 3L1PA 3B6CA 5FKMA 1A5JA 4DZJA 1JUMA 1HF0A 5FLMJ 3HOZJ 2XPVA 1UG2A 4Y52J 2JMWA 3PO3J 1B8IB 3HEFA 3WHBA 1BJZA 5JLXA 5GPCA 1APLC 1UHSA 2CRGA 4MFDA 2L7ZA 4UUSB 4M3DA 4XK4A 5IYDJ 5IPAA 2JK3A 2XB0X 1EF4A 2L0KA 2HXOA 1OCPA 3ZQGA 2L7MP 2DA5A 1ENHA 1MH4A 1H88C 4FE4A 1POGA 5FKNA 2XSDC 1ZTRA 2MGQA 4CYCB 5JLWA 3QPSA 3S16J 1W0UA 4XRSA 3JRGA 3GTOJ 3BR6A 1HOMA 1P7JA 1U78A 3HOUJ 3S1MJ 2HOAA 1JTYA 2DN0A 3OOUA 1ZR4A 3LSGA 4IEJA 2X6OA 2P81A 2FD5A 1BW6A 5EEAA 2XPWA 3FIWA 5C3EJ 4FTHA 1B72A 4FCYA 2XGDA 2KT0A 5J1UA 2VPRA 4M3EA 2R5ZB 2R93J 2NS8A 4MLOA 1RKTA 5EDNA 1U8BA 1X2MA 2IBDA 2B63J 2LVSA 3BTCA 3HBLA 3GBGA 2E2HJ 1F43A 1ZK8A 5FKLA 4W1UA 1ITYA 5EGOA 3BTIA 3K2AA 3RQIA 2NVXJ 5IP9J 1QVUA 1X58A 2CU7A 5F08A 5M5WJ 2IAIA 3BR1A 1F36A 3QQAA 4AUXA 3A02A 3VPRA 1JJ6C 3A01B 3DEWA 1AHDP 1MSFC 3JRAA 3O8HA 1TC3C 1TWGJ 3IH4A 4UUSA 2X48A 1IC8A 1HDDC 4A3CJ 5GP9A 2NVYJ 5FJ8J 1K83J 1IV6A 2ECCA 1ZR2A 3BR3A 1ETYA 1CQTA 1TWHJ 3I4NJ 1HLVA 2LK2A 5FKOA 3ZQFA 2L9RA 5EG0A 2ID6A 2ID3A 3BG9A 1Z77A 2FJ1A 3C2BA 5EF6A 4D5CA 3CCYA 2LY9A 3O8GA 3IH3A 1GVDA 5HODA 5M5XJ 2ME6A 3HB9A 2Y2ZA 4QIWN 2NVTJ 2FX0A 1H8AC 1JGGA 2PMZN 1MBGA 1VNDA 3MN2A 1AKHB 5FKKA 2AO9A 9ANTA 1PUFA 3JREA 4A3GJ 2YUSA 1XG1A 1FEXA 3M3YJ 5IYCJ 2XB5A 3TW7A 2NVQJ 3H3VK 2COBA 3GTKJ 3G1LA 3Q0VA 1GT0C 1FTZA 2HDDA 3NAUA 3GTMJ 1O4XA 5J1YA 1Z0XA 3HM5A 1JUPA 3GTLJ 1H89C 2AHQA 2H8RA 2GBYA 4IHXA 2VUMJ 1DU0A 1FIPA 2LLKA 3DCFA 3BR5A 4Y7NJ 5E3MA 3JRCA 1IGNA 3JRFA 4B1RA 2IEKA 1LFBA 2Y9ZA 1RESA 4L5EA 1RPWA 1JKQC 1MSEC 1MH3A 5J1RA 2Y30A 3Q3SA 1D5YA 1NK2P 2HXIA 1ZGWA 1QVTA 3IH2A 4D5FA 1ETKA 4D7NA 1VF9A 2MW8A 3W6VA 3G1OA 5DS9A 3ZQCA 4C3HJ 2EZKA 4AC0A 1K61A 1BW5A 1I6HJ 1S7EA 2L7FP 1LE8B 5IYBJ 3OSFA 1T56A 3F0CA 2O9LA 1MBFA 1UMQA 3LSPA 1IDZA 1VI0A 4IHVA 4QTRA 2EZIA 2JN6A 3BQYA 2MG4A 2W48A 5F04A 1JKOC 1OJLA 5F0HA 2R7ZJ 1XS9A 3UKGA 2MSYA 3HOVJ 4ABZA 4BY7J 2CQQA 1ORKA 2JA7J 1WGXA 2NS7A 4HNVA 2JA8J 3TP3A 3JRDA 1AKHA 1A6IA 3D1NI 4BKXA 5K7FA 3H0GJ 1W0TA 2M2EA 3HOXJ 2EZLA 5EZGA 3JRHA 5E3OA 2JA5J 1JJ8C 1E3OC 2O7OA 4X1EA 5IOZA 2G0EA 2LTPA 1DU6A 1YRNB 3GTPJ 2HI3A 1MBHA 2K40A 2R0QC 3I4MJ 1BL0A 3A03A 5IP6A 3BR0A 2R5YB 2O8KA 3BTLA 2CUFA 4GFBA 3Q0UA 4BBRJ 4A93J 1B8IA 1RETA 2R92J 3BG5A 2DA3A 3SFIA 4RDUA 3BR2A 4JX4A 3S14J 2EZHA 2FQ4A 1WI3A 3WHCA 2DMPA 1MNMC 2DJNA 3BG3A 1GV5A 4EEFG 1U9NA 3LNQA 4RBOA 2N8GA 5F1JA 2DA6A 3GTJJ 2DA2A 4A69C 2LR8A 5GPAA 4CYCA 3S17J 3S1NJ
chains in the Genus database with same CATH superfamily
1NG7A 4PSXA 3DEEA 4Q4ZF 3KIOA 3PNTA 4M3FA 4LLNA 3M7GA 1RUNA 2RQQA 4OAYA 5DCMA 2XF6A 1OYIA 1B4AA 4G7HF 3OYCA 4DBRA 2EINH 1VZ0A 1D0YA 2K9QA 2VJ4A 3AFHA 3KLOA 4OU0A 5LHGA 1ZGJA 1MNDA 3K6GA 1HXDA 1OPCA 2XGXA 1X1PA 2VOPA 4EM0B 4LLGF 3ZMUA 2OU2A 1FPQA 1ETQA 2QQ9A 2FSWA 4AYBN 1VQLI 3ZQQA 3SYTA 5C4JJ 3DPLC 4R79A 2VI6A 3SXYA 1SANA 2IA0A 3DLLF 2DFHA 4LK1F 4I01A 2E1MC 2A5YB 3RDIA 4ZYDA 1PP8F 2JZYA 4MQ9F 3A4CA 3HDDA 1UG0A 3E6MA 3JTHA 3PFYA 5DV5A 4G8XA 3DBHB 2ZCWA 2CV1A 5HDKA 3DXJF 3GWZA 3RZOJ 3M9AA 2A69F 5F27A 1B9MA 5IOYA 5LHHA 2K27A 2ZJ2A 2JVHA 3CZ6A 3GZNB 4UHTA 2VKVA 1RKWA 3CUOA 3E3VA 3M1CA 1KQ9A 4P96A 2XRLA 1I3QJ 2QUFA 3F8BA 5GTHC 1D0XA 2EJRA 3R0JA 1MBJA 4M6VA 1TWFJ 1MMSA 4Z6YA 1IN5A 5FRNA 1YQAA 3RKYA 1TWAJ 2V9VA 4B44A 2W00A 2KHMA 2H94A 3HKZN 4NDLA 3ROUA 4A5MA 4EJOA 4A0YA 1YYVA 4I0AA 4UB8C 2RAEA 4D7MA 4YIFA 5DTDA 4UV8A 4DYCA 4A2UA 1IN6A 3H1CA 4HBLA 4Y33A 1SC7A 3BCAA 4WCGA 3CQZJ 4GYGA 4XMYA 2QF7A 3HXLA 4OINF 4XLPF 1A35A 3HOYJ 1D0ZA 1BC8C 3L09A 3W6KB 5ICCA 4PJ0C 4RGXA 3HHHA 4ESFA 2BBYA 3QYFA 1JT6A 3CJRB 4S0HB 4CCKA 2QQAA 3A2KA 1I50J 2VT3A 3GXOA 3J7AO 1WH7A 1X3UA 3V8LA 4A3DJ 4YIIA 1CF7B 3GFJA 3T5XA 1B6AA 1MGTA 4GGGA 2HYJA 4DYQA 1MDMB 3N4MA 1PUFB 3S15J 4BBSJ 2GIZA 2LDUA 3KP5A 3E0JB 1RRJA 5JVTA 1AWCA 4XSXF 3B6AA 2GM4A 2V9KA 1F1ZA 3LSKA 4BJ6C 2HQAA 3KP7A 3HOWJ 3LFKA 4CO8A 1W7PB 1T95A 4ZZLA 1U0JA 3DF8A 2H1KA 3M4OJ 2IW5A 5D5XB 1S6LA 2K3PA 5BPIA 2FMLA 4Z2YA 3FKJA 3TW6A 1SFEA 4HQMA 4L9NA 1GVJA 5LEJA 1HQCA 4GO1A 3KPHA 2ECBA 5DUIA 2ZMEA 2PI0A 1LDKB 1BI0A 1S7AA 2Z1DA 3D5SC 3L2WA 1LE8A 3FXJA 4ZDLA 3MZYA 4RA2A 4IJAA 2EFOA 3VEPA 4E7JA 4KYWA 2FMYA 2M4GA 1S8NA 1FYLA 1IN7A 1GLNA 2ZSHB 1K4SA 1WJ5A 1IXRC 3R0AA 1IW7F 3CCLI 1MBKA 1ZQ3P 2X9DA 4UVAA 2M9HA 1TW3A 4KIGA 1XMXA 2TDXA 4ENJA 2KJBA 2VQHA 4IO9F 3S1QJ 2IJLA 4E7IA 3MMYB 2A5WA 1WFXA 1NG6A 4KNYA 4FISA 5FGMA 2PJRA 2Y0SA 2Q0OA 3OYNA 4X6AJ 3F6VA 3QOEA 2Y9YA 4UUTA 4Q5SF 4C3IJ 4G6DA 3PSIA 1OYWA 1LKXA 2XHKA 2L54A 3W2VA 1QBJA 1IV8A 2E19A 1P6RA 1SFUA 3HJEA 1IUYA 1IRXA 2BZTA 2W7NA 3G1MA 4PDKA 2ACJA 4IRHA 1O3TA 3RTRA 2OZ6A 3HHGA 2WY8Q 1BR2A 1S9HA 4ANJA 4A0ZA 2JPCA 5FKMA 5KAIC 4DZJA 2DK8A 2KRCA 5E1ZB 1HF0A 5FLMJ 3ZCOA 5CVUA 5AONA 3RYRA 2WAQA 4U7BA 3A1YA 3C18A 3OYDA 5GPCA 3O6BB 1R1VA 4M6XA 2P8TA 3I0TA 1HSJA 1T98A 2EIJH 3U2RA 3ERMA 2XB0X 2HDCA 1YJNI 1XDUA 3P9IA 4E7KA 1WQ2A 3PNYA 4JQFA 3COAC 5K5QA 3G4SI 4IHTA 5GTIC 2VODA 2RNGA 1ENHA 4UVCA 5CVJA 3FXRA 4WXHA 2F4MB 1RR8C 2KLOA 4FE4A 5FKNA 2MYSA 2XSDC 1UELB 4FQGA 4CYCB 3I55I 2K4JA 3QU6A 5J4VA 3QPSA 3S16J 4XRSA 3GTOJ 3GCMA 1XGMA 3HOUJ 2I5UA 2QQ8A 1JTYA 3K1PA 3OOUA 1ZR4A 4F91B 2LH9A 2L9NA 4LGWA 2DT5A 4MGRA 4IHSA 2IGOA 1ZG1A 1BIBA 1OR7A 2CW0F 2HQNA 5FFZA 3CCUI 5DCFA 2EIKH 4HPQA 4PCQA 4ETSA 2HVSA 1OMIA 4IQJA 4AD9A 5J1UA 3NWSA 1G3WA 2JSPA 2R5ZB 3P5JA 2YX7A 1Z1DA 1ZYRF 1MNEA 6PAXA 2VB6A 3BTCA 1F43A 2Q1ZB 3CJQB 1HW5A 2EV0A 1SMTA 5FKLA 1ITYA 3I3LA 3UNGC 3RQ4A 1QVUA 1X58A 4FETA 3FZVA 1IF1A 2CU7A 3EUHC 5M5WJ 4HF1A 2WA0A 3JAMK 1F36A 4AUXA 3DLAA 3V42A 2BY2A 3PFIA 3VPRA 3GFMA 3JRAA 2OCCH 1JGSA 4HV5A 2HWVA 3VSKA 2Z33A 1R71A 2GWRA 1MKMA 3TDUC 4A3CJ 2FNPA 2NVYJ 3EUAA 4NC8A 5FJ8J 2C6YA 4KIFA 1FBQA 2XASA 1ONVA 4L5IA 1FMWA 1Z21A 4XONA 1U5TB 1BM9A 5AIPA 1TWHJ 2ZKZA 3SZGA 1ZH5A 2GXGA 3TGNA 3I4NJ 4PJJA 4RAZA 2X6WA 4ZJZA 4EMSA 2Z5UA 3WTYC 3ZQFA 1YO5C 1FZPB 5EG0A 2G7UA 2ID3A 1OYYA 2X6YA 2FJ1A 3C2BA 3TDZC 3FXKA 3WG9A 1S7OA 1R23A 2DLLA 2LY9A 5E8GA 3I64A 2WAFA 1H9GA 3KEYA 2ZJRF 3FM5A 3WGIA 1BBYA 1TT0A 1U3EM 2EWNA 4S04A 3LA3A 2L4MA 4QLCU 2V1UA 2F6CA 4ZYGA 9ANTA 2CQ7A 4A3GJ 3RI4A 2BY0A 3D0SA 1QO0D 1VQKI 3Q9VA 1V5FA 2UXNA 3M3YJ 3PJRA 3QPTA 2K5CA 2LMDA 3Q0VA 4XKBA 1SFXA 2HDDA 4BNCA 1O4XA 1YI2I 3HM5A 4TV7A 1SEUA 3DQVC 2LREA 3LFUA 2GBYA 3H9QA 4FT8A 3BR5A 4Y7NJ 2HS5A 2ZSIB 2A68F 2E35A 5LFAA 4ZDOA 2IEKA 3B73A 1RESA 3VYRB 1RPWA 3H92A 4EM2A 1P4XA 5D8KB 1MSEC 3BJ6A 3VFZA 4BGDA 3S3MA 4D1QA 1D5YA 3KP6A 1EH6A 2CW8A 3IH2A 2R3SA 1ETKA 4D5FA 4D7NA 4HQEA 4OIOF 4UUVA 2XAJA 5DS9A 1QHHD 2DU9A 2EK5A 2M1BA 1QPMA 5ILUA 4MEYF 1XGOA 1NH3A 2EZKA 2QM3A 3CCQI 3LA7A 1UHMA 1BW5A 1I6HJ 3ELKA 2HYFA 4LIUA 2ELJA 4E70A 3ZN1A 2FRHA 1ULYA 3FF5A 2CGPA 1XGSA 2LY2A 1WVRA 2E5NA 2VT2A 4KITB 1J9IA 2W48A 5F04A 1U2WA 1G8XA 2X85A 5HS9A 4F92B 3ZRGA 5ILSA 3OYAA 3BZCA 3K4LA 2OC6A 1FWZA 1YW9A 1P9QC 3K2ZA 3JW4A 3X2QH 1WGXA 3GYHX 3OYMA 1V5GA 2PLYA 2QSHX 3D1NI 2GXBA 4AWXB 1FNNA 2CWEA 2M2EA 2QBYA 3LL7A 2R7RA 3RKXA 1I27A 1ERDA 3GEZA 3MEXA 2XIGA 3HRTA 2X0LA 1D1CA 2JVGA 2E7XA 4RB2C 1AOYA 2JA5J 2FXAA 2NRAC 1E3HA 2O7OA 4X1EA 2F5CA 3FHNA 2A6TA 1Z9CA 2G0EA 2FU4A 3CUQB 2V4JC 3I4MJ 5FLXK 4KIBA 1Z6RA 1R5HA 2M5WA 2OTJI 2F4IA 2PBIA 4HX4A 5IP6A 3BR0A 2BGCA 4LK0F 4I09A 1VQ5I 4BUPA 4BL0B 3BG5A 2AQFA 1FY7A 2ZO4A 2I8DA 4JX4A 2BE5F 4CCNA 5ICGA 4LJZF 1ZLJA 4RM3A 3WTWC 2DAOA 2FQ4A 3VYSB 4CXFA 2CUZA 1J59A 1F9NA 3LSIA 3BPXA 2V7FA 3ZMSA 1VQOI 3MKZA 5LRRA 4RB3C 3U21A 2AXTC 4GCVA 3BG3A 4QPOA 3WGHA 4L0ZB 3LNQA 4RBOA 1SVLA 1HKTA 2DK5A 2LYCA 4YEJA 4BEHA 2DPDA 4A69C 1C0WA 3F8CA 2R7VA 3GX4X 4PJMA 3HSRA 4J01A 5TRDA 1ZN2A 1GHCA 2DA1A 1U8RA 4KISA 3FISA 4B8XA 3FDYA 4DIQA 3OIPA 2HU9A 1EH8A 2GLOA 5GADJ 5IP7J 2PEXA 4A0XA 3FM3A 1T33A 4HF0A 4R8HA 3HRSA 3SHFA 4IVNA 1RR7A 2F48A 2EH3A 2HZDA 4I76A 4L9TA 3MZ8A 3S2HJ 1BA5A 3BTJA 2VC0A 1O7LA 3G3ZA 2HNHA 2K85A 2K4BA 2ZC2A 2VKEA 3OYHA 1B72B 2F4OB 2CFXA 4JK1X 2WWYA 2R7WA 3CUQA 5HNFA 1P2FA 5E1XA 4JP0A 4F52A 1Z6TA 4RS8A 1FBUA 2ETHA 4AYBA 4YFNF 4BH9A 5K5RA 1YITI 3F22A 3DV8A 2DA4A 3ESWB 3A01A 2JUCA 2YS9A 5JFRA 4F7ZA 2BW3A 2JJ7A 3ABMH 1YX5A 3FBNB 1TP4A 2PJPA 2OUMA 1X4OA 4PZJA 4ZDPA 4MHGA 1S5LC 3QRFF 3J81Z 5FD6A 2O3FA 3IV5A 3GTQJ 2QKLB 3I5UA 2J5PA 4L18B 1ETWA 1F5TA 3MVPA 2M8GX 5E1WA 2NNYA 3ASOH 2VONA 3OL4A 2CMPA 4NC7A 2VBXA 4GRIA 2OV7A 5F0CA 3QPHA 4F55A 3RJPA 3K7AJ 1HDPA 4L9VA 2PQ8A 2E34A 3CJTB 2FEZA 4BDYA 2VOOA 1MBEA 5CKTA 1X4PA 2WB1N 1VQMI 4YIRX 4E6KG 4YRVA 1UCRA 2P5VA 5E18F 2VJ5A 4DZPA 4A3EJ 3HKZA 5FLVA 1R49A 1TQPA 1FTTA 3CJNA 5D4SA 1FOKA 3K4BA 3ZQHA 4M3GA 3S2DJ 1GDTA 1KQ0A 3MKLA 2M30A 1I5ZA 4C30A 1SFOJ 2BXYA 2W85A 5CVRA 3HRUA 2XF5A 1YE9A 2LBFB 2ISZA 3ABUA 1V4RA 1X1CA 3LSJA 1R36A 4N9HA 2QSFX 3JR9A 3H5NA 4ZTJA 2EQRA 2KIUA 4KT5C 4XRMA 1SAXA 3FBIB 2WV1A 2GAUA 5J40A 3KYLA 1DP3A 4A3LJ 3ZP5A 2LSOA 2ISYA 2K9LA 3RKQA 1KU3A 3I58A 3RZDJ 1HKQA 4RLQA 1VQ4I 1USTA 2RC4A 3G71I 1Y39A 3MCZA 1MMAA 4I02A 2OAZA 4IL6C 3RPUA 2RVCA 1O3QA 5E3NA 1SAUA 1WJBA 2DOEA 1CGPA 3OYIA 1K78B 2QWWA 4DOZA 4RLFA 2PFBA 3HOTA 2M45A 3K4KA 5H2FC 2K02A 2QLZA 1DUXC 4G7ZF 1OR7C 5HNHA 2AS5F 2IS6A 2WAEA 3S1RJ 3E6BA 3FK6A 3FXUA 2STWA 1Z7LA 1MIJA 2CJJA 2QCOA 2LD5A 4A3BJ 1X2NA 3OIOA 2XAUA 2LY1A 4EATA 3DKWA 1FP2A 2XGEA 5KVRA 3K4CA 2M34A 2EV6A 2OF7A 5J8FA 1FMVA 2VBZA 4C9YA 2CW7A 1YS7A 2ZFWA 3LQQA 4C3JJ 1NTCA 1OCZH 1XD7A 1IUFA 3K10A 3TP0A 4I6ZA 1MJ9A 3PIOF 2Y48A 2O03A 2A3SA 1TLHB 4EVIA 5HS7A 4MEXF 1XSXA 4FE7A 2LKXA 1RI7A 3OWTA 5E8IA 2YU3A 2R7SA 3FXQA 2MBFA 1KU2A 1WRJA 5EEGA 4IHWA 2FNAA 1MD0A 2JQ7A 3KP4A 5FFXA 4WF2A 3OSGA 1R4NB 4BQNA 1DGRM 5B1AH 1LB2A 1A6QA 4YFXF 2Q2EB 4Y4RA 2HFHA 5K1YA 4Y3OA 1B59A 3GTGJ 2OCEA 2X1DA 1XTAA 3JSPA 3CDLA 5KAFC 1WPKA 2B7EA 3CLOA 1QA6A 3E6DA 4XIDA 3AG1H 3BJOA 1MMNA 4BACA 4BXUA 2VQLA 2DMQA 3BPVA 1RC9A 2DMNA 1W5CC 3L1PA 3F21A 3B6CA 3PSFA 3H5AA 2BVMA 2LG4A 3KCCA 1QZEA 3AL0B 3HOZJ 1UG2A 3FWEA 4CHUA 1ZGAA 2JMWA 2K86A 3TMOA 5EEHA 2GIVA 4N9IA 1BJZA 4FASD 3WE3A 5J47A 1UHSA 1QZZA 3WODF 4IOAF 2CO5A 2MLGA 2P7VB 4E4HA 1PP7U 4II2A 1IXSB 2HDWA 2XDVA 4EM1A 1LPQA 4HOBA 2HXOA 2CYYA 1WJFA 2EB7A 3W2AA 4I99C 2L7MP 2DA5A 2KIFA 4P9FA 3QU3A 2CV0A 1YIJI 2MGQA 3BLYA 3DTKA 3QYBA 1DQUA 1TNTA 2CUJA 3GO5A 1XGNA 3ULQB 2D1HA 4HAMA 1ZLKA 4ZYEA 3GZ5A 3WTTC 2DN0A 4IQ4A 1J7KA 2BXZA 3LSGA 3U1KA 4XN0A 4IEJA 3IUOA 5K5OA 1WJDA 1SMYF 3HRMA 3HC7A 1K79A 4F93B 1D1BA 4YFKF 3MD2A 5BOXA 2HKXA 4XRFA 2XGDA 2MD0A 3L2UA 2XSJC 4CZZA 5L3EA 5ICFA 2R7XA 4M6YA 2IGMA 4EGYA 1FSHA 2DCEA 2R93J 3L2QA 2NS8A 1ZAOA 3VB2A 1X2MA 1BOAA 4FX4A 3AKZA 1ZK8A 5JR3A 1S29A 3BTIA 3DWLE 3RQIA 5IP9J 2DQLA 2FBKA 4DJAA 4ZC3A 3BR1A 1XB4A 3E5XA 1L0OC 4R1HA 4JOMA 5F1RA 2XROA 4U7DA 3DEWA 5CVIA 5LGUA 3O8HA 2M0MA 2JPBA 3A0BC 2X48A 4XOPA 3S3OA 3E97A 1I3AA 4ITVA 1MZBA 1ZR2A 3H5RA 3BR3A 1ETYA 4G6QA 4I0BA 3ERED 1WJEA 2FBIA 3H9GA 2FQ3A 1VQ9I 1Q1HA 1YJ9I 4D0PA 2IS1A 2DI3A 5ERIA 4HA8A 3F23A 5HLGA 3O8GA 1GVDA 4PSWA 3QYEA 5M5XJ 2ME6A 4RAYA 4HG2A 1JHHA 2P0WA 5DEQA 1J5YA 1DGWY 4QIWN 3Q9SA 1JE8A 3C7JA 1MBGA 1VNDA 1CF7A 2AO9A 4H4KC 1MDMA 4CCMA 1PUFA 2A07F 1XG1A 2CQNA 1FEXA 3ABTA 2NNNA 2B9SA 2NS0A 5IYCJ 4HW0A 3TW7A 2V1XA 3G1LA 5BQTA 1R7JA 3NAUA 3GTMJ 2OBPA 5J1YA 3NRVA 1Z0XA 3BOQA 1JUPA 1W7PA 2VQGA 3SDBA 3MQ0A 5LD2C 1TBXA 1FIPA 3DCFA 1IN4A 3CP8A 1XPXA 1K7AA 3JRFA 2VASA 1TQIA 2Y9ZA 1XDSA 2UWMA 1TT5B 3IP4B 1MH3A 5J1RA 4BHCA 3L2RA 2W57A 2BOLA 1ZGWA 3RKWA 2XRNA 3I9V2 4RAGA 3MFKA 1BOBA 1O57A 2V6CA 3HTUA 1RIOH 3CC2I 2VKDA 3KX2A 1LDJA 4CYDA 4L5JA 1K61A 1IAWA 1FYKA 4N0BA 3W6JB 3OSFA 1T56A 4HZFA 1BR4A 1UMQA 5DM6F 1QNTA 2E1MB 1IDZA 2Z3YA 1E3PA 3FMRA 2JN6A 3CF5F 2D2WA 3OMYA 4RGUA 1XS9A 3UKGA 2MSYA 3KZZA 2WV0A 4EJTA 1ORKA 4XR6A 3U9GA 3LSTA 4NC6A 2JA7J 2NS7A 3IKVA 3TP3A 3HPGA 4ENNA 3K1MA 2G9WA 4KMFA 4BKXA 1RZ4A 3H0GJ 4LLLA 4P9UA 4IOCF 5EZGA 5D6FA 2HQRA 3DEUA 2BY3A 1ZG5A 4XLNF 1WKMA 1JJ8C 1OCCH 2DT6A 2F5DA 1ZRDA 5CYVA 5CQEA 2LTPA 1DU6A 1YRNB 3CMAI 2HI3A 1MBHA 2R0QC 2DOFA 2OD5A 2VXDA 3OYLA 2E36A 4HX7A 4I7HA 2DPUA 2JRTA 3QWLA 2O8KA 3BC8A 3EDPA 3GFIA 4U0VA 2WY7Q 1RETA 2R92J 5LGNA 2L2OA 1ON2A 3BR2A 3FMSA 3BZ6A 2OQRA 4D9JA 4ZYAA 2EZHA 2DMPA 1ZREA 1MNMC 5JHFA 4KICA 2DJNA 2CG4A 2KQRA 1U9NA 3IKTA 3ISPA 2P5LC 1BI2A 3S2WA 2CFOA 1T2KA 2DA6A 2F5EA 2DA2A 4HLXA 1QQIA 3EPZA 5GPAA 4CYCA 1IN8A 3K1NA 2WTEA 4RAFA 2R4GA 3LSMA 5B3SH 1IRGA 1QPIA 3NQOA 3P9KA 5BMZA 1TNSA 4UVBA 1YW8A 5A2QZ 4PUSA 1EH7A 3FK7A 5KK1A 1ETVA 3ZR8X 4LB5A 4HDUA 1KONA 1VFCA 4DGWB 2JA6J 4A3KJ 1OCTC 2Y0MA 1Y6IA 1EJ9A 1MJAA 3REOA 4I98B 1HW2A 2OPTA 1L3LA 3N97A 4A3IJ 3Q0WA 2F2EA 3CCMI 1MMGA 2YSRA 4EJUA 1YJWI 4ON0A 1X19A 2DODA 2M3AA 2X1EA 4BHBA 2DXIA 1WZ2A 2R5ZA 1VQNI 2ELKA 4MFEA 1HCRA 3H9JA 3K9TA 1ODDA 1EA3A 3V7CA 1BI1A 2KDOA 2MABA 1DPRA 4XLAA 3WTZA 1AU7A 3ZQLA 4PFPA 3ZMVA 1V3FA 1T6SA 3S93A 3WTUC 1YRNA 2RQPA 4YELA 5LGTA 1TQMA 4MQVA 2D45A 1WHUA 1X3ZB 3DU6A 1TL8A 2MD5A 5HOOA 5JHUA 2EFQA 2D5VA 5DDGA 5TGTA 3PM1A 2DMUA 5M3MJ 5EGOB 1LUJB 4DBQA 1YFHA 4CZCA 2ZFUA 1W36D 4OWRB 3JRBA 4XICA 4QPQA 5M5YJ 5HVQC 2FE3A 5C44J 3F3XA 5TISC 3WTXC 1U6GA 3O3KA 4GXOA 3MKYB 3HSEA 4MIMA 1U5TA 3WU0A 4HNTA 2JRMA 5H6RA 4C2MJ 5IT9Z 2HPMA 2G7HA 5FD5A 3VSLA 5EZHA 2XKOA 3WTVC 4HDVA 1Q1VA 2BV6A 1JXSA 4NHJA 2ELHA 5HDGA 1TWCJ 4NB5A 4B4CA 2ZXWH 3CMYA 1OQYA 3FXMA 5GAHJ 4K2EA 5CQGA 4KT6A 3V7SA 5FRMA 3TKYA 2LFBA 2XV4S 4G9YA 1KA8A 1FOWA 1ZHFA 2JUGA 2NYXA 1B9NA 4B09A 3K69A 3ZGKA 2M0CA 3GFLA 1QHGA 4UNOA 1VQ6I 2P6TA 1XCBA 1Z67A 2UZKA 3HGGA 1PDNC 1I6XA 4RGRA 1IDYA 4Y17A 3HL2A 3H35A 4HYEA 2WB1A 1JTXA 2STTA 3KYCB 2VL8A 1WWXA 3EYYA 1XX5A 2MH9A 3SEQA 4BAYA 1H9TA 1JKPC 2DQRA 1Z7UA 2V26A 4CA0A 4Y13A 2ZXJA 1FC3A 2XAGA 3D5RC 1YTYA 4LOCA 1IRZA 1XC5A 5B5EC 3CO6C 4GYIA 3RIRA 2IGKA 2FUG2 3M07A 1E2XA 3J80Z 3IRQA 1IZ1A 1JKRC 2IXSA 3OS1A 3G73A 2K9NA 5BPDA 2P6SA 1OCOH 1R9TJ 3MWMA 1KZHA 1UB9A 1V55H 3AAFA 2UUZA 4BY1J 1X1AA 2K9SA 3PQJA 4RMNA 3K70D 4V2FA 3PO2J 2GA2A 3M8EA 1JT0A 3KEOA 2HTSA 1FP1D 2PG4A 4E7ZA 1IJWC 3BT9A 2OA4A 3DP7A 3HYIA 1UJ8A 1FOYA 1SD5A 2P4WA 2BYVE 2XPUA 1ZELA 1WCMJ 1IRFA 2ME0A 3TO9A 1MW7A 3LOCA 2DDAA 2ZXHA 3LAPA 2GOMA 2EV5A 3QOPA 5IY5H 1HC8A 3GLLA 4XQFA 4LD5A 3UR3C 3M1EA 3P9CA 4IRIA 3K4JA 1HSTA 2KL4A 1Y1VJ 1WH5A 3QP6A 1JUSA 2ZNZA 2BHYA 4XNFA 2LNBA 3QODA 4U0YA 2H09A 3WE2A 4HSRA 2CH0A 2ZMEC 3ZXSA 1W36C 3LQRA 2VXZA 3BG7A 4QSHA 4A6DA 3TO6A 1R1TA 4E7LA 3LSRA 5ED4A 4WK8F 2QQBA 5B66C 1I1SA 3LSHA 2AQEA 2VQCA 1FIAA 4L9JA 4B48A 2BVLA 3BQZA 1U9OA 1XSDA 2E1OA 1VQPI 1G2HA 3QAHA 2RREA 1Y8QB 3OOPA 2MC3A 4MTEA 5LRSA 2QVOA 1O7FA 2CQKA 4O3MA 1LJ9A 2EBIA 2IGNA 4NNJA 1A5JA 2GXAA 2W25A 4XLHA 2Z9OA 2CV2A 1B8IB 3HEFA 3MAJA 3WHBA 4WWCA 3FMQA 3LAJA 4MFDA 2IA2A 2L7ZA 4UUSB 1P4AA 4M3DA 3PNVA 1HKSA 2JSCA 4HLYA 4U88A 3KFWX 3GLXA 1OCPA 3ZQGA 3JSOA 3QP5A 3IHUA 1MH4A 5IT3A 1POGA 2XAFA 1ZTRA 2NXNB 4XLFA 1Z3XA 2F5FA 2K7LA 2KRHA 3ZMDA 3H0DA 5JLWA 2IS4A 2M4KA 3BR6A 4KFCA 1HOMA 1X1BA 2R7QA 2HPIA 1P7JA 1SD6A 2YX4A 2HOAA 1J09A 3J7ZI 2HEOA 4MNUA 3E5QA 1SVOA 3EYIA 5DCMB 5FB2A 1XN7A 2KISA 2WC2A 1BR1A 2X6OA 4Y15A 2A6EF 4OIPF 4PJLA 5EEAA 2XPWA 3GUDA 3NWTA 2FF4A 2ZJQF 2PX9A 4FCYA 1B72A 3S32A 5D5UB 4O5VA 3K70C 2KT0A 4PJNA 3ML6A 2L5QA 4XL9A 4M3EA 2ZJPF 1BI3A 3GW2A 4MLOA 1SFKA 2L3DA 1U8BA 2IBDA 3LWFA 2DTRA 3HBLA 4DNCA 3HG9A 2DDBA 4DQ2A 2E7WA 4W1UA 1LVKA 3CF2A 4BJTA 4BQAA 3TL4X 1E17A 3K2AA 2NVXJ 2E5ZA 4RM2A 3HOSA 5F08A 4UB6C 2K9MA 2R7DA 2DFIA 2DJIA 3QQAA 3S8PA 5JI6A 1BIAA 2X4HA 3CCRI 4EJVA 3N05A 3OYEA 1JJ6C 5L3GA 1OISA 1T38A 4HF2A 2DW4A 4UUSA 2L02A 4CICA 3DPUA 4Q47A 2IRFG 1OLTA 5GP9A 4XLCA 2ECCA 3CESA 4HNUA 1IV6A 2P7CB 4ASNA 4FX0A 5E17F 4LITA 2DT7B 3BY6A 2VE8A 4ZH4F 3GMEA 2V1NA 1HLVA 1UAAA 2IT0A 5FKOA 2KIQA 4ESBA 2KZVA 3OY9A 2KPMA 4EJWA 3WG7H 4C2TA 4UV9A 2ID6A 3I54A 1Z77A 1GXPA 2RKHA 3F9KA 4D5CA 1ZRCA 1JHFA 1Z91A 2XVCA 1LQ1A 3L2VA 2P5KA 2Y2ZA 3V8JA 2IS2A 3CDHA 2NVTJ 2FX0A 4U87A 3J81K 2LC2A 2B0LA 3L7WA 2PMZN 3MN2A 3V8KA 4CGZA 1ON1A 1SD4A 3G2BA 3L2CA 3JREA 2YUSA 2LBFA 1WSUA 2IVMA 2Z99A 3HIFA 2VC1A 1QU3A 3A0HC 3H3VK 3ECHA 3GTKJ 2LOOA 3DBRB 4IPAA 1D1AA 2RNJA 2QZ8A 5HDNA 1R58A 4O6JA 1PVEA 1G6NA 2AHQA 1EKEA 4PGGA 2A05A 4IHXA 1GXQA 2R7UA 2QYOA 1K78A 2KMUA 2LLKA 5ICEA 3D5LA 3C2HA 5E3MA 1IGNA 2KKOA 3EETA 4L5EA 5L3DA 4HV6A 2O61A 1JKQC 3W2WA 2W4SA 3Q5FA 2PN6A 1MMDA 4LG0B 3I4PA 1VQ8I 3PL8A 2MW8A 3G1OA 1IO2A 2J5OA 1FX7A 3ZQCA 4OMYA 3I71A 5HLTA 2ZMEB 3BROA 3ZMZA 1YHQI 3OR1C 2L7FP 1LE8B 3TOAA 3F0CA 4X0GA 1MBFA 1R6RA 1XMKA 4AU7A 3TOBA 4IHVA 2MH2A 2EZIA 4QTRA 3OR2C 5DD4A 1F4KA 3BQYA 2MG4A 1JKOC 2RN7A 2Y75A 2KFDA 1T8IA 2ESHA 1YW7A 4CDGA 2VN2A 1PYVA 2Q2EA 4ZZDA 4AIKA 2CS3A 3JRDA 1I1GA 1T08B 1V54H 2YR2A 5KNLA 3OYBA 2O8XA 5DM7F 1U5TC 2E1NA 5HS8A 1T0FA 1LEBA 2PJRB 5E3OA 4ENKA 1E3OC 1YOVB 4YG2F 2M87A 2M8EA 3ABLH 2BHZA 2VBYA 4MTDA 3ONQA 4LG3A 1J2XA 3E5UA 3F8NA 3W3CA 1BL0A 2H6BA 5J4YA 2RV8A 2R5YB 1FOXA 3BTLA 1XSVA 2CUFA 4GFBA 4BBRJ 3DTIA 4E7HA 2EPFA 1S3JA 2IPQX 3SFIA 4RDUA 1LEAA 3S14J 5D5VB 3WHCA 2JT1A 3F72A 3ZQ7A 1MJBA 4M72A 1GV5A 4LG0A 4A6EA 3L00A 5HLIA 3IC7A 4OIQF 4AVPA 5F1JA 1BJAA 2AXLA 4B47A 3VWBA 1Y0UA 3BZKA 1O3SA 3K4MA 1YG2A 2LF7A 2DBBA 4LFUA 3I53A 3S17J 3S1NJ 3T8TA 3ZN0A 4BQOA 2LKSA 4A3FJ 3CMEI 1FLIA 2HOEA 2XC7A 1XCVA 1Y1WJ 1ACIA 5E79C 5J8CA 4CH7A 4IX7A 1YIOA 4AM3A 2PMHA 2TCTA 4E7SA 5D5WB 3ZQIA 1P7IA 3AG2H 3CO7C 2V6EA 1H0MA 3VYTB 1YLFA 3JRIA 3SZTA 2KIMA 2OJED 3JAMZ 3VODA 1GUUA 3FKIJ 1Y8RB 1ZKGA 3O2PE 1NHAA 4OMZA 2F5VA 2KDZA 2DO7A 3HGYA 2W82A 3E6CC 2K3FA 2HZTA 4JX5A 1FJLA 1A36A 4G94A 5B1BH 5CLSA 3ZOBA 2QEXI 4OAZA 2O5RA 3E7LA 5E3LA 3OYJA 5H20A 3U1DA 2W1OA 3RPUD 2FA5A 2R7FA 2WADA 4I2OA 2VLAA 3SFZA 2DOAA 1R5GA 2RGVA 1LFUP 5M3FJ 3NARA 2JTVA 1TW2A 2R5YA 3TEDA 2XUBA 2L9SA 1P92A 3WU1B 2I10A 1DDNA 2NOGA 1SVMA 1PUEE 3K4NA 5J3LA 2KP6A 4KMUX 2GOXB 2HOSA 4H0EA 4LMYA 4G6TB 5LEKA 1T39A 4JX6A 3P7NA 2HVQA 4J19A 5LBQA 2HQ5A 1FSEA 3PIPF 1XMAA 5F6FA 5KCMA 1HW1A 3CUQC 4XRSG 1FT9A 5EYRA 4DYRA 2E2IJ 3M8FA 3R6SA 3DU5A 1G59A 2V79A 1HBXG 4DW6A 4A3JJ 1OFCX 1K6YA 1LDDA 2FOKA 3SDGA 2VPLA 4BXXJ 2HOTA 5D6EA 4XKCA 4M3BA 3BJAA 3C2GA 4CCJA 1NK3P 5CPRB 5EG0B 3SJMA 1QZYA 1REPC 5K7HA 1DPUA 2OZUA 4IRGA 4FHTA 4LB6B 4N4NB 1IG7A 2CQXA 4GDFA 2XGCA 2DTZA 2E2JJ 3HZJA 1TTYA 4KN7X 5CJ9A 5F64A 2EFWA 2JA2A 1W4MA 3OL3A 1P4WA 3E1SA 2FOWA 2KRFA 2L7KA 1I39A 3WU2C 3IWFA 3FX3A 4ZYHA 2W84A 2E60A 3RPQA 4MO7A 2Y31A 4IHYA 1OKRA 2VJIA 5BNGA 3CCSI 2LF8A 5C4XJ 4B3AA 4KA4A 4HX8A 5K7ZA 2H1LA 1ETXA 2TRTA 4M9ZA 4AIDA 4CCLA 2DA7A 3V7RA 2JWTA 3QPLA 3TO7A 5AIQA 2CUEA 3OV8A 3VYUB 1FYMA 1TZLA 5DUKA 1A31A 2NAZA 2MC4A 2D1VA 1LFPA 1J75A 4JYKA 1N75A 1G4DA 1N77A 1PJRA 1KU7A 4M73A 3MKWB 5LHIA 4G12A 1X1DA 2H27A 2DYSH 2L4AA 3R4KA 4NBQA 1LVAA 1QRYA 1SD7A 1WJCA 2YPRA 3C1DA 2HYGD 4ESJA 2EA4A 4BHPA 1LNWA 5F0FA 2ZB9A 2Y0SN 2EIMH 3F6OA 5FLXZ 5DD8A 1R4MB 4EQQA 3OS2A 3R61A 4A3MJ 4KDPA 5FROA 2EFPA 5HLHA 4V2GA 1Z05A 1RUOA 1GV2A 5JVGF 3CDIA 4BU2A 2HKOA 2R7OA 4P1WA 4W97A 2RDPA 3KZYA 4NUBA 3HSFA 1W1WE 3DFGA 1N78A 2QGUA 4XKVA 5GAEJ 3CTAA 2E71A 2QBYB 5E20A 2VKHA 2HGCA 3PQKA 2ICWG 2YU9J 1ETOA 2WAQN 2DMTA 2Q8KA 1M1EB 2BY1A 4KJZA 4EGZA 3S3NA 2LP0A 3DKXA 2Z16A 3V4GA 3CC4I 4C2UA 2GZWA 2EILH 1STZA 1JUMA 1RNLA 3H36A 4UXNA 5BS6A 2XPVA 2L9VA 4Y52J 3PO3J 1R00A 5CVVA 2COMA 5JLXA 1APLC 1AA7A 2CRGA 1D8JA 5LLQA 4XK4A 4OOIA 4BDZA 5IYDJ 5IPAA 2JK3A 2HR3A 3DBLB 1W5TA 2OTLI 1EF4A 2A6HF 2L0KA 4S05A 4AIHA 4U0WA 3HUGB 4BYYA 1H88C 2IP2A 2O0YA 1BN5A 4BEHB 3KP3A 4CUGA 2QSGX 1D8KA 3RYPA 1O3RA 1USSA 1KQ8A 1R22A 3BDDA 2MFZA 1R5ID 3IAS2 3JRGA 3EQLF 1W0UA 2GA1A 1U78A 4IKFA 3B02A 3S1MJ 4G7OF 3CLQA 3HTSB 4A12A 3GF2A 5TJJA 2NOJB 1K6OA 2P81A 4NQWB 3R60A 2FD5A 4IXAA 1ZRFA 1BW6A 2X1CA 3KZIC 3IAM2 3FIWA 3WGGA 1ZG3A 3H3UA 5C3EJ 4FTHA 1R1UA 2H6CA 1W7PD 3ZMTA 1KYZA 1E0EA 2VPRA 4V19K 3HPHA 4XSZF 1RKTA 5EDNA 2B63J 1EV7A 2LVSA 5A2QK 2E2HJ 3ABKH 3GBGA 3KEQA 4BS9A 3LA2A 5EGOA 2CSOA 4XOTA 2X51A 3SZPA 2A61A 3I56I 3BCBA 4F3QA 5GAGJ 4M74A 2QKMB 1G3SA 4M9SA 2IAIA 2M7AA 4QWQA 1D3YA 4OIRF 2ZNYA 4IZZA 3FXLA 3A02A 3OS0A 2DFEA 2QENA 1HA8A 3A01B 4PK4A 1AHDP 1MSFC 2FBHA 1TC3C 1TWGJ 3IH4A 2BW3B 2M7BA 1ZARA 1Y0NA 1IC8A 1HDDC 1K83J 3H3ZA 1T0FC 2VJJA 3T0YA 1A04A 1CQTA 2XAQA 3M8JA 4HSTA 5ILVA 3CP2A 1X3WB 3BP8A 3HUGA 2PMUA 4L0YB 2LK2A 1KU9A 4UY8I 2EA2A 2DYRH 1G3YA 2W24A 2L9RA 3BG9A 4XN3A 2H8WA 5EF6A 3AL0C 2LRDA 3CCYA 5KHDA 2X6XA 3IH3A 5HODA 2WBMA 3F8MA 4WXDA 2UV1A 3HB9A 3KP2A 1H8AC 1JGGA 1VQ7I 3CCJI 1QGPA 4BQQA 2DFFA 5FKKA 1AKHB 3FHZA 3RSNA 3CCEI 4NQWA 4BE0A 5IT9K 1JI8A 2L01A 3ECOA 3CC7I 2VIXA 3SQNA 4RB1A 1V5EA 5D4RA 2UXXA 3CMMA 3EUKL 1D5VA 2V9PA 4LIVA 2KZGA 2XB5A 2MA3A 2NVQJ 3ASNH 1KYWA 2COBA 4RB0A 1FTZA 1GT0C 2PMZA 3KLNA 2VBWA 1K4TA 3AG4H 3IRRA 2O6GE 2LKPA 1N25A 4BE1A 3I59B 5J6XA 3OYFA 1H89C 3GTLJ 2GQQA 3IL2A 2H8RA 3DKYA 3KETA 2NVUB 2VUMJ 1J0RA 1DU0A 2QA4I 4PGHA 4HEA2 3JRCA 3CD6I 4B1RA 4M9XA 2ZXIA 3JCUC 5EJCA 1LFBA 2ZBKA 3TQNA 4HRIA 3BG6A 4EV0A 4BJ5C 2Z2SB 4B3XA 1UFMA 1UZCA 3LMMA 3L9FA 4CSWA 2Y30A 3Q3SA 1NK2P 2HXIA 3F8FA 3T1BA 1QVTA 1Z3YA 4XORA 3WTSC 2Y69H 1FBSA 1VF9A 4XKWA 3PUBA 3W6VA 5H6QA 4BXFA 5D8LB 2XKPA 4B43A 3GZ6A 4P5OA 4PFOA 3G6EI 4C3HJ 4AC0A 4WXCA 4II3A 4JBAA 4AIJA 1S7EA 4AVZA 4XM3A 5IYBJ 3DTEA 1Y56A 2O9LA 5L3CA 3OYKA 3LSPA 2KJCA 3J80K 1VI0A 2XAHA 2VE9A 4XBFA 1YX3A 4P55A 3EUHA 5FO5A 1OJLA 2E1CA 5F0HA 2R7ZJ 4J00A 4CCOA 1WJAA 4RGSA 3KYDB 4KN4X 3HOVJ 4ABZA 3C3WA 3KE2A 5DYMA 4BY7J 2CQQA 3CCVI 2HVRA 2EFNA 1KGSA 4HNVA 2JA8J 1AKHA 1IXCA 1WI9A 1A6IA 4WX9A 1VTNC 3NEUA 5K7FA 2HTJA 1W0TA 3HOXJ 2EZLA 3JRHA 2V1DA 5L3BA 3JTGA 1UHWA 3J7AY 3DPTA 4IF4A 3OYGA 2OQGA 5IOZA 4Q48A 3TBIA 3GTPJ 2MLKA 2K40A 3GVAA 3I59A 4KUMA 3A03A 4BE2A 1DP7P 1W5SA 3IWZA 1B1BA 3K0LA 3Q0UA 4M71A 1G3TA 4A93J 1B8IA 4N4OB 2XF7A 2DA3A 3MZHA 3AG3H 3RCOA 2IA1A 4XLEA 1WI3A 3J7YJ 1OCRH 2ESNA 5L3FA 3PUFA 2R7TA 2BEOA 3BWGA 2ADUA 3FXOA 3OIQA 4EEFG 4ZTFA 3ZPLA 3T8RA 2N8GA 1S72I 3GTJJ 4A5NA 1YS6A 2LR8A 3SEZA 3VDXA 1BC7C 4ENMA 3VOEA
chains in the Genus database with same CATH topology
2DA1A 1QPIA 3FISA 4A3FJ 4M3FA 1Y1WJ 3FK7A 1ETVA 2TCTA 2GLOA 1VFCA 2JA6J 3ZQIA 5IP7J 4A3KJ 1P7IA 1OCTC 2K9QA 1T33A 3JRIA 2OPTA 4A3IJ 3Q0WA 1GUUA 3FKIJ 1ETQA 1ZKGA 1RR7A 2EH3A 4I76A 4AYBN 2R5ZA 3S2HJ 2KDZA 2ELKA 4MFEA 1HCRA 3HGYA 5C4JJ 1BA5A 2VI6A 4JX5A 1FJLA 1SANA 3BTJA 2VKEA 3ZOBA 1B72B 3E7LA 5E3LA 1AU7A 3ZQLA 1YRNA 3HDDA 4JP0A 1LFUP 5M3FJ 3NARA 2D5VA 3TEDA 2R5YA 2DA4A 3PM1A 2DMUA 3RZOJ 3A01A 2I10A 5M3MJ 5EGOB 2NOGA 5F27A 2YS9A 5IOYA 5J3LA 2JJ7A 2VKVA 1RKWA 3JRBA 4XICA 2HOSA 5M5YJ 2XRLA 5C44J 1I3QJ 4JX6A 4MIMA 3IV5A 3GTQJ 4J19A 1MBJA 4M6VA 1TWFJ 4C2MJ 1ETWA 2HQ5A 3MVPA 4XRSG 2M8GX 5EZHA 1TWAJ 5EYRA 4DYRA 2E2IJ 1Q1VA 4DW6A 4A3JJ 1TWCJ 1OFCX 3HKZN 4NDLA 4B4CA 5F0CA 3CMYA 3K7AJ 1HDPA 3SDGA 4BXXJ 2RAEA 4D7MA 2HOTA 5DTDA 4DYCA 1MBEA 4M3BA 2LFBA 2WB1N 1NK3P 3CQZJ 5EG0B 2QF7A 3SJMA 3HOYJ 5K7HA 2M0CA 4DZPA 4A3EJ 1IG7A 2CQXA 5FLVA 1JT6A 2XGCA 3HGGA 2DTZA 4S0HB 2E2JJ 1FTTA 1I50J 1IDYA 1WH7A 4M3GA 3ZQHA 1GDTA 3S2DJ 4A3DJ 3MKLA 1JTXA 2HYJA 4DYQA 1SFOJ 1PUFB 3S15J 4BBSJ 1JKPC 3LSJA 4MO7A 3JR9A 4LOCA 2Y31A 1XC5A 1IRZA 2EQRA 4XRMA 3B6AA 2GM4A 2WV1A 4IHYA 5BNGA 4A3LJ 3RZDJ 3RKQA 5C4XJ 3HOWJ 4B3AA 5K7ZA 1ETXA 5E3NA 2TRTA 1JKRC 2DA7A 2H1KA 3M4OJ 2JWTA 2K9NA 3QPLA 1R9TJ 2CUEA 3TW6A 4BY1J 2K9SA 4V2FA 3PO2J 1JT0A 4JYKA 2ECBA 3S1RJ 3FK6A 1IJWC 2CJJA 2QCOA 3BT9A 2LD5A 1LE8A 4A3BJ 1X2NA 3OIOA 4G12A 2XPUA 1WCMJ 2XGEA 2M34A 2ME0A 2OF7A 1QRYA 3LOCA 4C3JJ 1NTCA 3TP0A 1IUFA 5F0FA 4I6ZA 2ZB9A 2Y0SN 4A3MJ 4FE7A 1Y1VJ 1WH5A 2LKXA 1JUSA 4V2GA 1MBKA 1ZQ3P 2X9DA 2M9HA 1GV2A 4IHWA 3S1QJ 3OSGA 4FISA 4QSHA 4W97A 3LSRA 4X6AJ 2Y9YA 4UUTA 4C3IJ 3GTGJ 1FIAA 3BQZA 1U9OA 3CDLA 2E19A 2YU9J 2E1OA 1WPKA 1G2HA 1ETOA 2WAQN 2DMTA 4XIDA 3G1MA 2LP0A 2DMQA 2DMNA 2EBIA 3L1PA 3B6CA 5FKMA 1A5JA 4DZJA 1JUMA 1HF0A 5FLMJ 3HOZJ 2XPVA 1UG2A 4Y52J 2JMWA 3PO3J 1B8IB 3HEFA 3WHBA 1BJZA 5JLXA 5GPCA 1APLC 1UHSA 2CRGA 4MFDA 2L7ZA 4UUSB 4M3DA 4XK4A 5IYDJ 5IPAA 2JK3A 2XB0X 1EF4A 2L0KA 2HXOA 1OCPA 3ZQGA 2L7MP 2DA5A 1ENHA 1MH4A 1H88C 4FE4A 1POGA 5FKNA 2XSDC 1ZTRA 2MGQA 4CYCB 5JLWA 3QPSA 3S16J 1W0UA 4XRSA 3JRGA 3GTOJ 3BR6A 1HOMA 1P7JA 1U78A 3HOUJ 3S1MJ 2HOAA 1JTYA 2DN0A 3OOUA 1ZR4A 3LSGA 4IEJA 2X6OA 2P81A 2FD5A 1BW6A 5EEAA 2XPWA 3FIWA 5C3EJ 4FTHA 1B72A 4FCYA 2XGDA 2KT0A 5J1UA 2VPRA 4M3EA 2R5ZB 2R93J 2NS8A 4MLOA 1RKTA 5EDNA 1U8BA 1X2MA 2IBDA 2B63J 2LVSA 3BTCA 3HBLA 3GBGA 2E2HJ 1F43A 1ZK8A 5FKLA 4W1UA 1ITYA 5EGOA 3BTIA 3K2AA 3RQIA 2NVXJ 5IP9J 1QVUA 1X58A 2CU7A 5F08A 5M5WJ 2IAIA 3BR1A 1F36A 3QQAA 4AUXA 3A02A 3VPRA 1JJ6C 3A01B 3DEWA 1AHDP 1MSFC 3JRAA 3O8HA 1TC3C 1TWGJ 3IH4A 4UUSA 2X48A 1IC8A 1HDDC 4A3CJ 5GP9A 2NVYJ 5FJ8J 1K83J 1IV6A 2ECCA 1ZR2A 3BR3A 1ETYA 1CQTA 1TWHJ 3I4NJ 1HLVA 2LK2A 5FKOA 3ZQFA 2L9RA 5EG0A 2ID6A 2ID3A 3BG9A 1Z77A 2FJ1A 3C2BA 5EF6A 4D5CA 3CCYA 2LY9A 3O8GA 3IH3A 1GVDA 5HODA 5M5XJ 2ME6A 3HB9A 2Y2ZA 4QIWN 2NVTJ 2FX0A 1H8AC 1JGGA 2PMZN 1MBGA 1VNDA 3MN2A 1AKHB 5FKKA 2AO9A 9ANTA 1PUFA 3JREA 4A3GJ 2YUSA 1XG1A 1FEXA 3M3YJ 5IYCJ 2XB5A 3TW7A 2NVQJ 3H3VK 2COBA 3GTKJ 3G1LA 3Q0VA 1GT0C 1FTZA 2HDDA 3NAUA 3GTMJ 1O4XA 5J1YA 1Z0XA 3HM5A 1JUPA 3GTLJ 1H89C 2AHQA 2H8RA 2GBYA 4IHXA 2VUMJ 1DU0A 1FIPA 2LLKA 3DCFA 3BR5A 4Y7NJ 5E3MA 3JRCA 1IGNA 3JRFA 4B1RA 2IEKA 1LFBA 2Y9ZA 1RESA 4L5EA 1RPWA 1JKQC 1MSEC 1MH3A 5J1RA 2Y30A 3Q3SA 1D5YA 1NK2P 2HXIA 1ZGWA 1QVTA 3IH2A 4D5FA 1ETKA 4D7NA 1VF9A 2MW8A 3W6VA 3G1OA 5DS9A 3ZQCA 4C3HJ 2EZKA 4AC0A 1K61A 1BW5A 1I6HJ 1S7EA 2L7FP 1LE8B 5IYBJ 3OSFA 1T56A 3F0CA 2O9LA 1MBFA 1UMQA 3LSPA 1IDZA 1VI0A 4IHVA 4QTRA 2EZIA 2JN6A 3BQYA 2MG4A 2W48A 5F04A 1JKOC 1OJLA 5F0HA 2R7ZJ 1XS9A 3UKGA 2MSYA 3HOVJ 4ABZA 4BY7J 2CQQA 1ORKA 2JA7J 1WGXA 2NS7A 4HNVA 2JA8J 3TP3A 3JRDA 1AKHA 1A6IA 3D1NI 4BKXA 5K7FA 3H0GJ 1W0TA 2M2EA 3HOXJ 2EZLA 5EZGA 3JRHA 5E3OA 2JA5J 1JJ8C 1E3OC 2O7OA 4X1EA 5IOZA 2G0EA 2LTPA 1DU6A 1YRNB 3GTPJ 2HI3A 1MBHA 2K40A 2R0QC 3I4MJ 1BL0A 3A03A 5IP6A 3BR0A 2R5YB 2O8KA 3BTLA 2CUFA 4GFBA 3Q0UA 4BBRJ 4A93J 1B8IA 1RETA 2R92J 3BG5A 2DA3A 3SFIA 4RDUA 3BR2A 4JX4A 3S14J 2EZHA 2FQ4A 1WI3A 3WHCA 2DMPA 1MNMC 2DJNA 3BG3A 1GV5A 4EEFG 1U9NA 3LNQA 4RBOA 2N8GA 5F1JA 2DA6A 3GTJJ 2DA2A 4A69C 2LR8A 5GPAA 4CYCA 3S17J 3S1NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA1 A;  1QPI A;  3FIS A;  4A3F J;  4M3F A;  1Y1W J;  3FK7 A;  1ETV A;  2TCT A;  2GLO A;  1VFC A;  2JA6 J;  3ZQI A;  5IP7 J;  4A3K J;  1P7I A;  1OCT C;  2K9Q A;  1T33 A;  3JRI A;  2OPT A;  4A3I J;  3Q0W A;  1GUU A;  3FKI J;  1ETQ A;  1ZKG A;  1RR7 A;  2EH3 A;  4I76 A;  4AYB N;  2R5Z A;  3S2H J;  2KDZ A;  2ELK A;  4MFE A;  1HCR A;  3HGY A;  5C4J J;  1BA5 A;  2VI6 A;  4JX5 A;  1FJL A;  1SAN A;  3BTJ A;  2VKE A;  3ZOB A;  1B72 B;  3E7L A;  5E3L A;  1AU7 A;  3ZQL A;  1YRN A;  3HDD A;  4JP0 A;  1LFU P;  5M3F J;  3NAR A;  2D5V A;  3TED A;  2R5Y A;  2DA4 A;  3PM1 A;  2DMU A;  3RZO J;  3A01 A;  2I10 A;  5M3M J;  5EGO B;  2NOG A;  5F27 A;  2YS9 A;  5IOY A;  5J3L A;  2JJ7 A;  2VKV A;  1RKW A;  3JRB A;  4XIC A;  2HOS A;  5M5Y J;  2XRL A;  5C44 J;  1I3Q J;  4JX6 A;  4MIM A;  3IV5 A;  3GTQ J;  4J19 A;  1MBJ A;  4M6V A;  1TWF J;  4C2M J;  1ETW A;  2HQ5 A;  3MVP A;  4XRS G;  2M8G X;  5EZH A;  1TWA J;  5EYR A;  4DYR A;  2E2I J;  1Q1V A;  4DW6 A;  4A3J J;  1TWC J;  1OFC X;  3HKZ N;  4NDL A;  4B4C A;  5F0C A;  3CMY A;  3K7A J;  1HDP A;  3SDG A;  4BXX J;  2RAE A;  4D7M A;  2HOT A;  5DTD A;  4DYC A;  1MBE A;  4M3B A;  2LFB A;  2WB1 N;  1NK3 P;  3CQZ J;  5EG0 B;  2QF7 A;  3SJM A;  3HOY J;  5K7H A;  2M0C A;  4DZP A;  4A3E J;  1IG7 A;  2CQX A;  5FLV A;  1JT6 A;  2XGC A;  3HGG A;  2DTZ A;  4S0H B;  2E2J J;  1FTT A;  1I50 J;  1IDY A;  1WH7 A;  4M3G A;  3ZQH A;  1GDT A;  3S2D J;  4A3D J;  3MKL A;  1JTX A;  2HYJ A;  4DYQ A;  1SFO J;  1PUF B;  3S15 J;  4BBS J;  1JKP C;  3LSJ A;  4MO7 A;  3JR9 A;  4LOC A;  2Y31 A;  1XC5 A;  1IRZ A;  2EQR A;  4XRM A;  3B6A A;  2GM4 A;  2WV1 A;  4IHY A;  5BNG A;  4A3L J;  3RZD J;  3RKQ A;  5C4X J;  3HOW J;  4B3A A;  5K7Z A;  1ETX A;  5E3N A;  2TRT A;  1JKR C;  2DA7 A;  2H1K A;  3M4O J;  2JWT A;  2K9N A;  3QPL A;  1R9T J;  2CUE A;  3TW6 A;  4BY1 J;  2K9S A;  4V2F A;  3PO2 J;  1JT0 A;  4JYK A;  2ECB A;  3S1R J;  3FK6 A;  1IJW C;  2CJJ A;  2QCO A;  3BT9 A;  2LD5 A;  1LE8 A;  4A3B J;  1X2N A;  3OIO A;  4G12 A;  2XPU A;  1WCM J;  2XGE A;  2M34 A;  2ME0 A;  2OF7 A;  1QRY A;  3LOC A;  4C3J J;  1NTC A;  3TP0 A;  1IUF A;  5F0F A;  4I6Z A;  2ZB9 A;  2Y0S N;  4A3M J;  4FE7 A;  1Y1V J;  1WH5 A;  2LKX A;  1JUS A;  4V2G A;  1MBK A;  1ZQ3 P;  2X9D A;  2M9H A;  1GV2 A;  4IHW A;  3S1Q J;  3OSG A;  4FIS A;  4QSH A;  4W97 A;  3LSR A;  4X6A J;  2Y9Y A;  4UUT A;  4C3I J;  3GTG J;  1FIA A;  3BQZ A;  1U9O A;  3CDL A;  2E19 A;  2YU9 J;  2E1O A;  1WPK A;  1G2H A;  1ETO A;  2WAQ N;  2DMT A;  4XID A;  3G1M A;  2LP0 A;  2DMQ A;  2DMN A;  2EBI A;  3L1P A;  3B6C A;  5FKM A;  1A5J A;  4DZJ A;  1JUM A;  1HF0 A;  5FLM J;  3HOZ J;  2XPV A;  1UG2 A;  4Y52 J;  2JMW A;  3PO3 J;  1B8I B;  3HEF A;  3WHB A;  1BJZ A;  5JLX A;  5GPC A;  1APL C;  1UHS A;  2CRG A;  4MFD A;  2L7Z A;  4UUS B;  4M3D A;  4XK4 A;  5IYD J;  5IPA A;  2JK3 A;  2XB0 X;  1EF4 A;  2L0K A;  2HXO A;  1OCP A;  3ZQG A;  2L7M P;  2DA5 A;  1ENH A;  1MH4 A;  1H88 C;  4FE4 A;  1POG A;  5FKN A;  2XSD C;  1ZTR A;  2MGQ A;  4CYC B;  5JLW A;  3QPS A;  3S16 J;  1W0U A;  4XRS A;  3JRG A;  3GTO J;  3BR6 A;  1HOM A;  1P7J A;  1U78 A;  3HOU J;  3S1M J;  2HOA A;  1JTY A;  2DN0 A;  3OOU A;  1ZR4 A;  3LSG A;  4IEJ A;  2X6O A;  2P81 A;  2FD5 A;  1BW6 A;  5EEA A;  2XPW A;  3FIW A;  5C3E J;  4FTH A;  1B72 A;  4FCY A;  2XGD A;  2KT0 A;  5J1U A;  2VPR A;  4M3E A;  2R5Z B;  2R93 J;  2NS8 A;  4MLO A;  1RKT A;  5EDN A;  1U8B A;  1X2M A;  2IBD A;  2B63 J;  2LVS A;  3BTC A;  3HBL A;  3GBG A;  2E2H J;  1F43 A;  1ZK8 A;  5FKL A;  4W1U A;  1ITY A;  5EGO A;  3BTI A;  3K2A A;  3RQI A;  2NVX J;  5IP9 J;  1QVU A;  1X58 A;  2CU7 A;  5F08 A;  5M5W J;  2IAI A;  3BR1 A;  1F36 A;  3QQA A;  4AUX A;  3A02 A;  3VPR A;  1JJ6 C;  3A01 B;  3DEW A;  1AHD P;  1MSF C;  3JRA A;  3O8H A;  1TC3 C;  1TWG J;  3IH4 A;  4UUS A;  2X48 A;  1IC8 A;  1HDD C;  4A3C J;  5GP9 A;  2NVY J;  5FJ8 J;  1K83 J;  1IV6 A;  2ECC A;  1ZR2 A;  3BR3 A;  1ETY A;  1CQT A;  1TWH J;  3I4N J;  1HLV A;  2LK2 A;  5FKO A;  3ZQF A;  2L9R A;  5EG0 A;  2ID6 A;  2ID3 A;  3BG9 A;  1Z77 A;  2FJ1 A;  3C2B A;  5EF6 A;  4D5C A;  3CCY A;  2LY9 A;  3O8G A;  3IH3 A;  1GVD A;  5HOD A;  5M5X J;  2ME6 A;  3HB9 A;  2Y2Z A;  4QIW N;  2NVT J;  2FX0 A;  1H8A C;  1JGG A;  2PMZ N;  1MBG A;  1VND A;  3MN2 A;  1AKH B;  5FKK A;  2AO9 A;  9ANT A;  1PUF A;  3JRE A;  4A3G J;  2YUS A;  1XG1 A;  1FEX A;  3M3Y J;  5IYC J;  2XB5 A;  3TW7 A;  2NVQ J;  3H3V K;  2COB A;  3GTK J;  3G1L A;  3Q0V A;  1GT0 C;  1FTZ A;  2HDD A;  3NAU A;  3GTM J;  1O4X A;  5J1Y A;  1Z0X A;  3HM5 A;  1JUP A;  3GTL J;  1H89 C;  2AHQ A;  2H8R A;  2GBY A;  4IHX A;  2VUM J;  1DU0 A;  1FIP A;  2LLK A;  3DCF A;  3BR5 A;  4Y7N J;  5E3M A;  3JRC A;  1IGN A;  3JRF A;  4B1R A;  2IEK A;  1LFB A;  2Y9Z A;  1RES A;  4L5E A;  1RPW A;  1JKQ C;  1MSE C;  1MH3 A;  5J1R A;  2Y30 A;  3Q3S A;  1D5Y A;  1NK2 P;  2HXI A;  1ZGW A;  1QVT A;  3IH2 A;  4D5F A;  1ETK A;  4D7N A;  1VF9 A;  2MW8 A;  3W6V A;  3G1O A;  5DS9 A;  3ZQC A;  4C3H J;  2EZK A;  4AC0 A;  1K61 A;  1BW5 A;  1I6H J;  1S7E A;  2L7F P;  1LE8 B;  5IYB J;  3OSF A;  1T56 A;  3F0C A;  2O9L A;  1MBF A;  1UMQ A;  3LSP A;  1IDZ A;  1VI0 A;  4IHV A;  4QTR A;  2EZI A;  2JN6 A;  3BQY A;  2MG4 A;  2W48 A;  5F04 A;  1JKO C;  1OJL A;  5F0H A;  2R7Z J;  1XS9 A;  3UKG A;  2MSY A;  3HOV J;  4ABZ A;  4BY7 J;  2CQQ A;  1ORK A;  2JA7 J;  1WGX A;  2NS7 A;  4HNV A;  2JA8 J;  3TP3 A;  3JRD A;  1AKH A;  1A6I A;  3D1N I;  4BKX A;  5K7F A;  3H0G J;  1W0T A;  2M2E A;  3HOX J;  2EZL A;  5EZG A;  3JRH A;  5E3O A;  2JA5 J;  1JJ8 C;  1E3O C;  2O7O A;  4X1E A;  5IOZ A;  2G0E A;  2LTP A;  1DU6 A;  1YRN B;  3GTP J;  2HI3 A;  1MBH A;  2K40 A;  2R0Q C;  3I4M J;  1BL0 A;  3A03 A;  5IP6 A;  3BR0 A;  2R5Y B;  2O8K A;  3BTL A;  2CUF A;  4GFB A;  3Q0U A;  4BBR J;  4A93 J;  1B8I A;  1RET A;  2R92 J;  3BG5 A;  2DA3 A;  3SFI A;  4RDU A;  3BR2 A;  4JX4 A;  3S14 J;  2EZH A;  2FQ4 A;  1WI3 A;  3WHC A;  2DMP A;  1MNM C;  2DJN A;  3BG3 A;  1GV5 A;  4EEF G;  1U9N A;  3LNQ A;  4RBO A;  2N8G A;  5F1J A;  2DA6 A;  3GTJ J;  2DA2 A;  4A69 C;  2LR8 A;  5GPA A;  4CYC A;  3S17 J;  3S1N J; 
#chains in the Genus database with same CATH topology
 1NG7 A;  4PSX A;  3DEE A;  4Q4Z F;  3KIO A;  3PNT A;  4M3F A;  4LLN A;  3M7G A;  1RUN A;  2RQQ A;  4OAY A;  5DCM A;  2XF6 A;  1OYI A;  1B4A A;  4G7H F;  3OYC A;  4DBR A;  2EIN H;  1VZ0 A;  1D0Y A;  2K9Q A;  2VJ4 A;  3AFH A;  3KLO A;  4OU0 A;  5LHG A;  1ZGJ A;  1MND A;  3K6G A;  1HXD A;  1OPC A;  2XGX A;  1X1P A;  2VOP A;  4EM0 B;  4LLG F;  3ZMU A;  2OU2 A;  1FPQ A;  1ETQ A;  2QQ9 A;  2FSW A;  4AYB N;  1VQL I;  3ZQQ A;  3SYT A;  5C4J J;  3DPL C;  4R79 A;  2VI6 A;  3SXY A;  1SAN A;  2IA0 A;  3DLL F;  2DFH A;  4LK1 F;  4I01 A;  2E1M C;  2A5Y B;  3RDI A;  4ZYD A;  1PP8 F;  2JZY A;  4MQ9 F;  3A4C A;  3HDD A;  1UG0 A;  3E6M A;  3JTH A;  3PFY A;  5DV5 A;  4G8X A;  3DBH B;  2ZCW A;  2CV1 A;  5HDK A;  3DXJ F;  3GWZ A;  3RZO J;  3M9A A;  2A69 F;  5F27 A;  1B9M A;  5IOY A;  5LHH A;  2K27 A;  2ZJ2 A;  2JVH A;  3CZ6 A;  3GZN B;  4UHT A;  2VKV A;  1RKW A;  3CUO A;  3E3V A;  3M1C A;  1KQ9 A;  4P96 A;  2XRL A;  1I3Q J;  2QUF A;  3F8B A;  5GTH C;  1D0X A;  2EJR A;  3R0J A;  1MBJ A;  4M6V A;  1TWF J;  1MMS A;  4Z6Y A;  1IN5 A;  5FRN A;  1YQA A;  3RKY A;  1TWA J;  2V9V A;  4B44 A;  2W00 A;  2KHM A;  2H94 A;  3HKZ N;  4NDL A;  3ROU A;  4A5M A;  4EJO A;  4A0Y A;  1YYV A;  4I0A A;  4UB8 C;  2RAE A;  4D7M A;  4YIF A;  5DTD A;  4UV8 A;  4DYC A;  4A2U A;  1IN6 A;  3H1C A;  4HBL A;  4Y33 A;  1SC7 A;  3BCA A;  4WCG A;  3CQZ J;  4GYG A;  4XMY A;  2QF7 A;  3HXL A;  4OIN F;  4XLP F;  1A35 A;  3HOY J;  1D0Z A;  1BC8 C;  3L09 A;  3W6K B;  5ICC A;  4PJ0 C;  4RGX A;  3HHH A;  4ESF A;  2BBY A;  3QYF A;  1JT6 A;  3CJR B;  4S0H B;  4CCK A;  2QQA A;  3A2K A;  1I50 J;  2VT3 A;  3GXO A;  3J7A O;  1WH7 A;  1X3U A;  3V8L A;  4A3D J;  4YII A;  1CF7 B;  3GFJ A;  3T5X A;  1B6A A;  1MGT A;  4GGG A;  2HYJ A;  4DYQ A;  1MDM B;  3N4M A;  1PUF B;  3S15 J;  4BBS J;  2GIZ A;  2LDU A;  3KP5 A;  3E0J B;  1RRJ A;  5JVT A;  1AWC A;  4XSX F;  3B6A A;  2GM4 A;  2V9K A;  1F1Z A;  3LSK A;  4BJ6 C;  2HQA A;  3KP7 A;  3HOW J;  3LFK A;  4CO8 A;  1W7P B;  1T95 A;  4ZZL A;  1U0J A;  3DF8 A;  2H1K A;  3M4O J;  2IW5 A;  5D5X B;  1S6L A;  2K3P A;  5BPI A;  2FML A;  4Z2Y A;  3FKJ A;  3TW6 A;  1SFE A;  4HQM A;  4L9N A;  1GVJ A;  5LEJ A;  1HQC A;  4GO1 A;  3KPH A;  2ECB A;  5DUI A;  2ZME A;  2PI0 A;  1LDK B;  1BI0 A;  1S7A A;  2Z1D A;  3D5S C;  3L2W A;  1LE8 A;  3FXJ A;  4ZDL A;  3MZY A;  4RA2 A;  4IJA A;  2EFO A;  3VEP A;  4E7J A;  4KYW A;  2FMY A;  2M4G A;  1S8N A;  1FYL A;  1IN7 A;  1GLN A;  2ZSH B;  1K4S A;  1WJ5 A;  1IXR C;  3R0A A;  1IW7 F;  3CCL I;  1MBK A;  1ZQ3 P;  2X9D A;  4UVA A;  2M9H A;  1TW3 A;  4KIG A;  1XMX A;  2TDX A;  4ENJ A;  2KJB A;  2VQH A;  4IO9 F;  3S1Q J;  2IJL A;  4E7I A;  3MMY B;  2A5W A;  1WFX A;  1NG6 A;  4KNY A;  4FIS A;  5FGM A;  2PJR A;  2Y0S A;  2Q0O A;  3OYN A;  4X6A J;  3F6V A;  3QOE A;  2Y9Y A;  4UUT A;  4Q5S F;  4C3I J;  4G6D A;  3PSI A;  1OYW A;  1LKX A;  2XHK A;  2L54 A;  3W2V A;  1QBJ A;  1IV8 A;  2E19 A;  1P6R A;  1SFU A;  3HJE A;  1IUY A;  1IRX A;  2BZT A;  2W7N A;  3G1M A;  4PDK A;  2ACJ A;  4IRH A;  1O3T A;  3RTR A;  2OZ6 A;  3HHG A;  2WY8 Q;  1BR2 A;  1S9H A;  4ANJ A;  4A0Z A;  2JPC A;  5FKM A;  5KAI C;  4DZJ A;  2DK8 A;  2KRC A;  5E1Z B;  1HF0 A;  5FLM J;  3ZCO A;  5CVU A;  5AON A;  3RYR A;  2WAQ A;  4U7B A;  3A1Y A;  3C18 A;  3OYD A;  5GPC A;  3O6B B;  1R1V A;  4M6X A;  2P8T A;  3I0T A;  1HSJ A;  1T98 A;  2EIJ H;  3U2R A;  3ERM A;  2XB0 X;  2HDC A;  1YJN I;  1XDU A;  3P9I A;  4E7K A;  1WQ2 A;  3PNY A;  4JQF A;  3COA C;  5K5Q A;  3G4S I;  4IHT A;  5GTI C;  2VOD A;  2RNG A;  1ENH A;  4UVC A;  5CVJ A;  3FXR A;  4WXH A;  2F4M B;  1RR8 C;  2KLO A;  4FE4 A;  5FKN A;  2MYS A;  2XSD C;  1UEL B;  4FQG A;  4CYC B;  3I55 I;  2K4J A;  3QU6 A;  5J4V A;  3QPS A;  3S16 J;  4XRS A;  3GTO J;  3GCM A;  1XGM A;  3HOU J;  2I5U A;  2QQ8 A;  1JTY A;  3K1P A;  3OOU A;  1ZR4 A;  4F91 B;  2LH9 A;  2L9N A;  4LGW A;  2DT5 A;  4MGR A;  4IHS A;  2IGO A;  1ZG1 A;  1BIB A;  1OR7 A;  2CW0 F;  2HQN A;  5FFZ A;  3CCU I;  5DCF A;  2EIK H;  4HPQ A;  4PCQ A;  4ETS A;  2HVS A;  1OMI A;  4IQJ A;  4AD9 A;  5J1U A;  3NWS A;  1G3W A;  2JSP A;  2R5Z B;  3P5J A;  2YX7 A;  1Z1D A;  1ZYR F;  1MNE A;  6PAX A;  2VB6 A;  3BTC A;  1F43 A;  2Q1Z B;  3CJQ B;  1HW5 A;  2EV0 A;  1SMT A;  5FKL A;  1ITY A;  3I3L A;  3UNG C;  3RQ4 A;  1QVU A;  1X58 A;  4FET A;  3FZV A;  1IF1 A;  2CU7 A;  3EUH C;  5M5W J;  4HF1 A;  2WA0 A;  3JAM K;  1F36 A;  4AUX A;  3DLA A;  3V42 A;  2BY2 A;  3PFI A;  3VPR A;  3GFM A;  3JRA A;  2OCC H;  1JGS A;  4HV5 A;  2HWV A;  3VSK A;  2Z33 A;  1R71 A;  2GWR A;  1MKM A;  3TDU C;  4A3C J;  2FNP A;  2NVY J;  3EUA A;  4NC8 A;  5FJ8 J;  2C6Y A;  4KIF A;  1FBQ A;  2XAS A;  1ONV A;  4L5I A;  1FMW A;  1Z21 A;  4XON A;  1U5T B;  1BM9 A;  5AIP A;  1TWH J;  2ZKZ A;  3SZG A;  1ZH5 A;  2GXG A;  3TGN A;  3I4N J;  4PJJ A;  4RAZ A;  2X6W A;  4ZJZ A;  4EMS A;  2Z5U A;  3WTY C;  3ZQF A;  1YO5 C;  1FZP B;  5EG0 A;  2G7U A;  2ID3 A;  1OYY A;  2X6Y A;  2FJ1 A;  3C2B A;  3TDZ C;  3FXK A;  3WG9 A;  1S7O A;  1R23 A;  2DLL A;  2LY9 A;  5E8G A;  3I64 A;  2WAF A;  1H9G A;  3KEY A;  2ZJR F;  3FM5 A;  3WGI A;  1BBY A;  1TT0 A;  1U3E M;  2EWN A;  4S04 A;  3LA3 A;  2L4M A;  4QLC U;  2V1U A;  2F6C A;  4ZYG A;  9ANT A;  2CQ7 A;  4A3G J;  3RI4 A;  2BY0 A;  3D0S A;  1QO0 D;  1VQK I;  3Q9V A;  1V5F A;  2UXN A;  3M3Y J;  3PJR A;  3QPT A;  2K5C A;  2LMD A;  3Q0V A;  4XKB A;  1SFX A;  2HDD A;  4BNC A;  1O4X A;  1YI2 I;  3HM5 A;  4TV7 A;  1SEU A;  3DQV C;  2LRE A;  3LFU A;  2GBY A;  3H9Q A;  4FT8 A;  3BR5 A;  4Y7N J;  2HS5 A;  2ZSI B;  2A68 F;  2E35 A;  5LFA A;  4ZDO A;  2IEK A;  3B73 A;  1RES A;  3VYR B;  1RPW A;  3H92 A;  4EM2 A;  1P4X A;  5D8K B;  1MSE C;  3BJ6 A;  3VFZ A;  4BGD A;  3S3M A;  4D1Q A;  1D5Y A;  3KP6 A;  1EH6 A;  2CW8 A;  3IH2 A;  2R3S A;  1ETK A;  4D5F A;  4D7N A;  4HQE A;  4OIO F;  4UUV A;  2XAJ A;  5DS9 A;  1QHH D;  2DU9 A;  2EK5 A;  2M1B A;  1QPM A;  5ILU A;  4MEY F;  1XGO A;  1NH3 A;  2EZK A;  2QM3 A;  3CCQ I;  3LA7 A;  1UHM A;  1BW5 A;  1I6H J;  3ELK A;  2HYF A;  4LIU A;  2ELJ A;  4E70 A;  3ZN1 A;  2FRH A;  1ULY A;  3FF5 A;  2CGP A;  1XGS A;  2LY2 A;  1WVR A;  2E5N A;  2VT2 A;  4KIT B;  1J9I A;  2W48 A;  5F04 A;  1U2W A;  1G8X A;  2X85 A;  5HS9 A;  4F92 B;  3ZRG A;  5ILS A;  3OYA A;  3BZC A;  3K4L A;  2OC6 A;  1FWZ A;  1YW9 A;  1P9Q C;  3K2Z A;  3JW4 A;  3X2Q H;  1WGX A;  3GYH X;  3OYM A;  1V5G A;  2PLY A;  2QSH X;  3D1N I;  2GXB A;  4AWX B;  1FNN A;  2CWE A;  2M2E A;  2QBY A;  3LL7 A;  2R7R A;  3RKX A;  1I27 A;  1ERD A;  3GEZ A;  3MEX A;  2XIG A;  3HRT A;  2X0L A;  1D1C A;  2JVG A;  2E7X A;  4RB2 C;  1AOY A;  2JA5 J;  2FXA A;  2NRA C;  1E3H A;  2O7O A;  4X1E A;  2F5C A;  3FHN A;  2A6T A;  1Z9C A;  2G0E A;  2FU4 A;  3CUQ B;  2V4J C;  3I4M J;  5FLX K;  4KIB A;  1Z6R A;  1R5H A;  2M5W A;  2OTJ I;  2F4I A;  2PBI A;  4HX4 A;  5IP6 A;  3BR0 A;  2BGC A;  4LK0 F;  4I09 A;  1VQ5 I;  4BUP A;  4BL0 B;  3BG5 A;  2AQF A;  1FY7 A;  2ZO4 A;  2I8D A;  4JX4 A;  2BE5 F;  4CCN A;  5ICG A;  4LJZ F;  1ZLJ A;  4RM3 A;  3WTW C;  2DAO A;  2FQ4 A;  3VYS B;  4CXF A;  2CUZ A;  1J59 A;  1F9N A;  3LSI A;  3BPX A;  2V7F A;  3ZMS A;  1VQO I;  3MKZ A;  5LRR A;  4RB3 C;  3U21 A;  2AXT C;  4GCV A;  3BG3 A;  4QPO A;  3WGH A;  4L0Z B;  3LNQ A;  4RBO A;  1SVL A;  1HKT A;  2DK5 A;  2LYC A;  4YEJ A;  4BEH A;  2DPD A;  4A69 C;  1C0W A;  3F8C A;  2R7V A;  3GX4 X;  4PJM A;  3HSR A;  4J01 A;  5TRD A;  1ZN2 A;  1GHC A;  2DA1 A;  1U8R A;  4KIS A;  3FIS A;  4B8X A;  3FDY A;  4DIQ A;  3OIP A;  2HU9 A;  1EH8 A;  2GLO A;  5GAD J;  5IP7 J;  2PEX A;  4A0X A;  3FM3 A;  1T33 A;  4HF0 A;  4R8H A;  3HRS A;  3SHF A;  4IVN A;  1RR7 A;  2F48 A;  2EH3 A;  2HZD A;  4I76 A;  4L9T A;  3MZ8 A;  3S2H J;  1BA5 A;  3BTJ A;  2VC0 A;  1O7L A;  3G3Z A;  2HNH A;  2K85 A;  2K4B A;  2ZC2 A;  2VKE A;  3OYH A;  1B72 B;  2F4O B;  2CFX A;  4JK1 X;  2WWY A;  2R7W A;  3CUQ A;  5HNF A;  1P2F A;  5E1X A;  4JP0 A;  4F52 A;  1Z6T A;  4RS8 A;  1FBU A;  2ETH A;  4AYB A;  4YFN F;  4BH9 A;  5K5R A;  1YIT I;  3F22 A;  3DV8 A;  2DA4 A;  3ESW B;  3A01 A;  2JUC A;  2YS9 A;  5JFR A;  4F7Z A;  2BW3 A;  2JJ7 A;  3ABM H;  1YX5 A;  3FBN B;  1TP4 A;  2PJP A;  2OUM A;  1X4O A;  4PZJ A;  4ZDP A;  4MHG A;  1S5L C;  3QRF F;  3J81 Z;  5FD6 A;  2O3F A;  3IV5 A;  3GTQ J;  2QKL B;  3I5U A;  2J5P A;  4L18 B;  1ETW A;  1F5T A;  3MVP A;  2M8G X;  5E1W A;  2NNY A;  3ASO H;  2VON A;  3OL4 A;  2CMP A;  4NC7 A;  2VBX A;  4GRI A;  2OV7 A;  5F0C A;  3QPH A;  4F55 A;  3RJP A;  3K7A J;  1HDP A;  4L9V A;  2PQ8 A;  2E34 A;  3CJT B;  2FEZ A;  4BDY A;  2VOO A;  1MBE A;  5CKT A;  1X4P A;  2WB1 N;  1VQM I;  4YIR X;  4E6K G;  4YRV A;  1UCR A;  2P5V A;  5E18 F;  2VJ5 A;  4DZP A;  4A3E J;  3HKZ A;  5FLV A;  1R49 A;  1TQP A;  1FTT A;  3CJN A;  5D4S A;  1FOK A;  3K4B A;  3ZQH A;  4M3G A;  3S2D J;  1GDT A;  1KQ0 A;  3MKL A;  2M30 A;  1I5Z A;  4C30 A;  1SFO J;  2BXY A;  2W85 A;  5CVR A;  3HRU A;  2XF5 A;  1YE9 A;  2LBF B;  2ISZ A;  3ABU A;  1V4R A;  1X1C A;  3LSJ A;  1R36 A;  4N9H A;  2QSF X;  3JR9 A;  3H5N A;  4ZTJ A;  2EQR A;  2KIU A;  4KT5 C;  4XRM A;  1SAX A;  3FBI B;  2WV1 A;  2GAU A;  5J40 A;  3KYL A;  1DP3 A;  4A3L J;  3ZP5 A;  2LSO A;  2ISY A;  2K9L A;  3RKQ A;  1KU3 A;  3I58 A;  3RZD J;  1HKQ A;  4RLQ A;  1VQ4 I;  1UST A;  2RC4 A;  3G71 I;  1Y39 A;  3MCZ A;  1MMA A;  4I02 A;  2OAZ A;  4IL6 C;  3RPU A;  2RVC A;  1O3Q A;  5E3N A;  1SAU A;  1WJB A;  2DOE A;  1CGP A;  3OYI A;  1K78 B;  2QWW A;  4DOZ A;  4RLF A;  2PFB A;  3HOT A;  2M45 A;  3K4K A;  5H2F C;  2K02 A;  2QLZ A;  1DUX C;  4G7Z F;  1OR7 C;  5HNH A;  2AS5 F;  2IS6 A;  2WAE A;  3S1R J;  3E6B A;  3FK6 A;  3FXU A;  2STW A;  1Z7L A;  1MIJ A;  2CJJ A;  2QCO A;  2LD5 A;  4A3B J;  1X2N A;  3OIO A;  2XAU A;  2LY1 A;  4EAT A;  3DKW A;  1FP2 A;  2XGE A;  5KVR A;  3K4C A;  2M34 A;  2EV6 A;  2OF7 A;  5J8F A;  1FMV A;  2VBZ A;  4C9Y A;  2CW7 A;  1YS7 A;  2ZFW A;  3LQQ A;  4C3J J;  1NTC A;  1OCZ H;  1XD7 A;  1IUF A;  3K10 A;  3TP0 A;  4I6Z A;  1MJ9 A;  3PIO F;  2Y48 A;  2O03 A;  2A3S A;  1TLH B;  4EVI A;  5HS7 A;  4MEX F;  1XSX A;  4FE7 A;  2LKX A;  1RI7 A;  3OWT A;  5E8I A;  2YU3 A;  2R7S A;  3FXQ A;  2MBF A;  1KU2 A;  1WRJ A;  5EEG A;  4IHW A;  2FNA A;  1MD0 A;  2JQ7 A;  3KP4 A;  5FFX A;  4WF2 A;  3OSG A;  1R4N B;  4BQN A;  1DGR M;  5B1A H;  1LB2 A;  1A6Q A;  4YFX F;  2Q2E B;  4Y4R A;  2HFH A;  5K1Y A;  4Y3O A;  1B59 A;  3GTG J;  2OCE A;  2X1D A;  1XTA A;  3JSP A;  3CDL A;  5KAF C;  1WPK A;  2B7E A;  3CLO A;  1QA6 A;  3E6D A;  4XID A;  3AG1 H;  3BJO A;  1MMN A;  4BAC A;  4BXU A;  2VQL A;  2DMQ A;  3BPV A;  1RC9 A;  2DMN A;  1W5C C;  3L1P A;  3F21 A;  3B6C A;  3PSF A;  3H5A A;  2BVM A;  2LG4 A;  3KCC A;  1QZE A;  3AL0 B;  3HOZ J;  1UG2 A;  3FWE A;  4CHU A;  1ZGA A;  2JMW A;  2K86 A;  3TMO A;  5EEH A;  2GIV A;  4N9I A;  1BJZ A;  4FAS D;  3WE3 A;  5J47 A;  1UHS A;  1QZZ A;  3WOD F;  4IOA F;  2CO5 A;  2MLG A;  2P7V B;  4E4H A;  1PP7 U;  4II2 A;  1IXS B;  2HDW A;  2XDV A;  4EM1 A;  1LPQ A;  4HOB A;  2HXO A;  2CYY A;  1WJF A;  2EB7 A;  3W2A A;  4I99 C;  2L7M P;  2DA5 A;  2KIF A;  4P9F A;  3QU3 A;  2CV0 A;  1YIJ I;  2MGQ A;  3BLY A;  3DTK A;  3QYB A;  1DQU A;  1TNT A;  2CUJ A;  3GO5 A;  1XGN A;  3ULQ B;  2D1H A;  4HAM A;  1ZLK A;  4ZYE A;  3GZ5 A;  3WTT C;  2DN0 A;  4IQ4 A;  1J7K A;  2BXZ A;  3LSG A;  3U1K A;  4XN0 A;  4IEJ A;  3IUO A;  5K5O A;  1WJD A;  1SMY F;  3HRM A;  3HC7 A;  1K79 A;  4F93 B;  1D1B A;  4YFK F;  3MD2 A;  5BOX A;  2HKX A;  4XRF A;  2XGD A;  2MD0 A;  3L2U A;  2XSJ C;  4CZZ A;  5L3E A;  5ICF A;  2R7X A;  4M6Y A;  2IGM A;  4EGY A;  1FSH A;  2DCE A;  2R93 J;  3L2Q A;  2NS8 A;  1ZAO A;  3VB2 A;  1X2M A;  1BOA A;  4FX4 A;  3AKZ A;  1ZK8 A;  5JR3 A;  1S29 A;  3BTI A;  3DWL E;  3RQI A;  5IP9 J;  2DQL A;  2FBK A;  4DJA A;  4ZC3 A;  3BR1 A;  1XB4 A;  3E5X A;  1L0O C;  4R1H A;  4JOM A;  5F1R A;  2XRO A;  4U7D A;  3DEW A;  5CVI A;  5LGU A;  3O8H A;  2M0M A;  2JPB A;  3A0B C;  2X48 A;  4XOP A;  3S3O A;  3E97 A;  1I3A A;  4ITV A;  1MZB A;  1ZR2 A;  3H5R A;  3BR3 A;  1ETY A;  4G6Q A;  4I0B A;  3ERE D;  1WJE A;  2FBI A;  3H9G A;  2FQ3 A;  1VQ9 I;  1Q1H A;  1YJ9 I;  4D0P A;  2IS1 A;  2DI3 A;  5ERI A;  4HA8 A;  3F23 A;  5HLG A;  3O8G A;  1GVD A;  4PSW A;  3QYE A;  5M5X J;  2ME6 A;  4RAY A;  4HG2 A;  1JHH A;  2P0W A;  5DEQ A;  1J5Y A;  1DGW Y;  4QIW N;  3Q9S A;  1JE8 A;  3C7J A;  1MBG A;  1VND A;  1CF7 A;  2AO9 A;  4H4K C;  1MDM A;  4CCM A;  1PUF A;  2A07 F;  1XG1 A;  2CQN A;  1FEX A;  3ABT A;  2NNN A;  2B9S A;  2NS0 A;  5IYC J;  4HW0 A;  3TW7 A;  2V1X A;  3G1L A;  5BQT A;  1R7J A;  3NAU A;  3GTM J;  2OBP A;  5J1Y A;  3NRV A;  1Z0X A;  3BOQ A;  1JUP A;  1W7P A;  2VQG A;  3SDB A;  3MQ0 A;  5LD2 C;  1TBX A;  1FIP A;  3DCF A;  1IN4 A;  3CP8 A;  1XPX A;  1K7A A;  3JRF A;  2VAS A;  1TQI A;  2Y9Z A;  1XDS A;  2UWM A;  1TT5 B;  3IP4 B;  1MH3 A;  5J1R A;  4BHC A;  3L2R A;  2W57 A;  2BOL A;  1ZGW A;  3RKW A;  2XRN A;  3I9V 2;  4RAG A;  3MFK A;  1BOB A;  1O57 A;  2V6C A;  3HTU A;  1RIO H;  3CC2 I;  2VKD A;  3KX2 A;  1LDJ A;  4CYD A;  4L5J A;  1K61 A;  1IAW A;  1FYK A;  4N0B A;  3W6J B;  3OSF A;  1T56 A;  4HZF A;  1BR4 A;  1UMQ A;  5DM6 F;  1QNT A;  2E1M B;  1IDZ A;  2Z3Y A;  1E3P A;  3FMR A;  2JN6 A;  3CF5 F;  2D2W A;  3OMY A;  4RGU A;  1XS9 A;  3UKG A;  2MSY A;  3KZZ A;  2WV0 A;  4EJT A;  1ORK A;  4XR6 A;  3U9G A;  3LST A;  4NC6 A;  2JA7 J;  2NS7 A;  3IKV A;  3TP3 A;  3HPG A;  4ENN A;  3K1M A;  2G9W A;  4KMF A;  4BKX A;  1RZ4 A;  3H0G J;  4LLL A;  4P9U A;  4IOC F;  5EZG A;  5D6F A;  2HQR A;  3DEU A;  2BY3 A;  1ZG5 A;  4XLN F;  1WKM A;  1JJ8 C;  1OCC H;  2DT6 A;  2F5D A;  1ZRD A;  5CYV A;  5CQE A;  2LTP A;  1DU6 A;  1YRN B;  3CMA I;  2HI3 A;  1MBH A;  2R0Q C;  2DOF A;  2OD5 A;  2VXD A;  3OYL A;  2E36 A;  4HX7 A;  4I7H A;  2DPU A;  2JRT A;  3QWL A;  2O8K A;  3BC8 A;  3EDP A;  3GFI A;  4U0V A;  2WY7 Q;  1RET A;  2R92 J;  5LGN A;  2L2O A;  1ON2 A;  3BR2 A;  3FMS A;  3BZ6 A;  2OQR A;  4D9J A;  4ZYA A;  2EZH A;  2DMP A;  1ZRE A;  1MNM C;  5JHF A;  4KIC A;  2DJN A;  2CG4 A;  2KQR A;  1U9N A;  3IKT A;  3ISP A;  2P5L C;  1BI2 A;  3S2W A;  2CFO A;  1T2K A;  2DA6 A;  2F5E A;  2DA2 A;  4HLX A;  1QQI A;  3EPZ A;  5GPA A;  4CYC A;  1IN8 A;  3K1N A;  2WTE A;  4RAF A;  2R4G A;  3LSM A;  5B3S H;  1IRG A;  1QPI A;  3NQO A;  3P9K A;  5BMZ A;  1TNS A;  4UVB A;  1YW8 A;  5A2Q Z;  4PUS A;  1EH7 A;  3FK7 A;  5KK1 A;  1ETV A;  3ZR8 X;  4LB5 A;  4HDU A;  1KON A;  1VFC A;  4DGW B;  2JA6 J;  4A3K J;  1OCT C;  2Y0M A;  1Y6I A;  1EJ9 A;  1MJA A;  3REO A;  4I98 B;  1HW2 A;  2OPT A;  1L3L A;  3N97 A;  4A3I J;  3Q0W A;  2F2E A;  3CCM I;  1MMG A;  2YSR A;  4EJU A;  1YJW I;  4ON0 A;  1X19 A;  2DOD A;  2M3A A;  2X1E A;  4BHB A;  2DXI A;  1WZ2 A;  2R5Z A;  1VQN I;  2ELK A;  4MFE A;  1HCR A;  3H9J A;  3K9T A;  1ODD A;  1EA3 A;  3V7C A;  1BI1 A;  2KDO A;  2MAB A;  1DPR A;  4XLA A;  3WTZ A;  1AU7 A;  3ZQL A;  4PFP A;  3ZMV A;  1V3F A;  1T6S A;  3S93 A;  3WTU C;  1YRN A;  2RQP A;  4YEL A;  5LGT A;  1TQM A;  4MQV A;  2D45 A;  1WHU A;  1X3Z B;  3DU6 A;  1TL8 A;  2MD5 A;  5HOO A;  5JHU A;  2EFQ A;  2D5V A;  5DDG A;  5TGT A;  3PM1 A;  2DMU A;  5M3M J;  5EGO B;  1LUJ B;  4DBQ A;  1YFH A;  4CZC A;  2ZFU A;  1W36 D;  4OWR B;  3JRB A;  4XIC A;  4QPQ A;  5M5Y J;  5HVQ C;  2FE3 A;  5C44 J;  3F3X A;  5TIS C;  3WTX C;  1U6G A;  3O3K A;  4GXO A;  3MKY B;  3HSE A;  4MIM A;  1U5T A;  3WU0 A;  4HNT A;  2JRM A;  5H6R A;  4C2M J;  5IT9 Z;  2HPM A;  2G7H A;  5FD5 A;  3VSL A;  5EZH A;  2XKO A;  3WTV C;  4HDV A;  1Q1V A;  2BV6 A;  1JXS A;  4NHJ A;  2ELH A;  5HDG A;  1TWC J;  4NB5 A;  4B4C A;  2ZXW H;  3CMY A;  1OQY A;  3FXM A;  5GAH J;  4K2E A;  5CQG A;  4KT6 A;  3V7S A;  5FRM A;  3TKY A;  2LFB A;  2XV4 S;  4G9Y A;  1KA8 A;  1FOW A;  1ZHF A;  2JUG A;  2NYX A;  1B9N A;  4B09 A;  3K69 A;  3ZGK A;  2M0C A;  3GFL A;  1QHG A;  4UNO A;  1VQ6 I;  2P6T A;  1XCB A;  1Z67 A;  2UZK A;  3HGG A;  1PDN C;  1I6X A;  4RGR A;  1IDY A;  4Y17 A;  3HL2 A;  3H35 A;  4HYE A;  2WB1 A;  1JTX A;  2STT A;  3KYC B;  2VL8 A;  1WWX A;  3EYY A;  1XX5 A;  2MH9 A;  3SEQ A;  4BAY A;  1H9T A;  1JKP C;  2DQR A;  1Z7U A;  2V26 A;  4CA0 A;  4Y13 A;  2ZXJ A;  1FC3 A;  2XAG A;  3D5R C;  1YTY A;  4LOC A;  1IRZ A;  1XC5 A;  5B5E C;  3CO6 C;  4GYI A;  3RIR A;  2IGK A;  2FUG 2;  3M07 A;  1E2X A;  3J80 Z;  3IRQ A;  1IZ1 A;  1JKR C;  2IXS A;  3OS1 A;  3G73 A;  2K9N A;  5BPD A;  2P6S A;  1OCO H;  1R9T J;  3MWM A;  1KZH A;  1UB9 A;  1V55 H;  3AAF A;  2UUZ A;  4BY1 J;  1X1A A;  2K9S A;  3PQJ A;  4RMN A;  3K70 D;  4V2F A;  3PO2 J;  2GA2 A;  3M8E A;  1JT0 A;  3KEO A;  2HTS A;  1FP1 D;  2PG4 A;  4E7Z A;  1IJW C;  3BT9 A;  2OA4 A;  3DP7 A;  3HYI A;  1UJ8 A;  1FOY A;  1SD5 A;  2P4W A;  2BYV E;  2XPU A;  1ZEL A;  1WCM J;  1IRF A;  2ME0 A;  3TO9 A;  1MW7 A;  3LOC A;  2DDA A;  2ZXH A;  3LAP A;  2GOM A;  2EV5 A;  3QOP A;  5IY5 H;  1HC8 A;  3GLL A;  4XQF A;  4LD5 A;  3UR3 C;  3M1E A;  3P9C A;  4IRI A;  3K4J A;  1HST A;  2KL4 A;  1Y1V J;  1WH5 A;  3QP6 A;  1JUS A;  2ZNZ A;  2BHY A;  4XNF A;  2LNB A;  3QOD A;  4U0Y A;  2H09 A;  3WE2 A;  4HSR A;  2CH0 A;  2ZME C;  3ZXS A;  1W36 C;  3LQR A;  2VXZ A;  3BG7 A;  4QSH A;  4A6D A;  3TO6 A;  1R1T A;  4E7L A;  3LSR A;  5ED4 A;  4WK8 F;  2QQB A;  5B66 C;  1I1S A;  3LSH A;  2AQE A;  2VQC A;  1FIA A;  4L9J A;  4B48 A;  2BVL A;  3BQZ A;  1U9O A;  1XSD A;  2E1O A;  1VQP I;  1G2H A;  3QAH A;  2RRE A;  1Y8Q B;  3OOP A;  2MC3 A;  4MTE A;  5LRS A;  2QVO A;  1O7F A;  2CQK A;  4O3M A;  1LJ9 A;  2EBI A;  2IGN A;  4NNJ A;  1A5J A;  2GXA A;  2W25 A;  4XLH A;  2Z9O A;  2CV2 A;  1B8I B;  3HEF A;  3MAJ A;  3WHB A;  4WWC A;  3FMQ A;  3LAJ A;  4MFD A;  2IA2 A;  2L7Z A;  4UUS B;  1P4A A;  4M3D A;  3PNV A;  1HKS A;  2JSC A;  4HLY A;  4U88 A;  3KFW X;  3GLX A;  1OCP A;  3ZQG A;  3JSO A;  3QP5 A;  3IHU A;  1MH4 A;  5IT3 A;  1POG A;  2XAF A;  1ZTR A;  2NXN B;  4XLF A;  1Z3X A;  2F5F A;  2K7L A;  2KRH A;  3ZMD A;  3H0D A;  5JLW A;  2IS4 A;  2M4K A;  3BR6 A;  4KFC A;  1HOM A;  1X1B A;  2R7Q A;  2HPI A;  1P7J A;  1SD6 A;  2YX4 A;  2HOA A;  1J09 A;  3J7Z I;  2HEO A;  4MNU A;  3E5Q A;  1SVO A;  3EYI A;  5DCM B;  5FB2 A;  1XN7 A;  2KIS A;  2WC2 A;  1BR1 A;  2X6O A;  4Y15 A;  2A6E F;  4OIP F;  4PJL A;  5EEA A;  2XPW A;  3GUD A;  3NWT A;  2FF4 A;  2ZJQ F;  2PX9 A;  4FCY A;  1B72 A;  3S32 A;  5D5U B;  4O5V A;  3K70 C;  2KT0 A;  4PJN A;  3ML6 A;  2L5Q A;  4XL9 A;  4M3E A;  2ZJP F;  1BI3 A;  3GW2 A;  4MLO A;  1SFK A;  2L3D A;  1U8B A;  2IBD A;  3LWF A;  2DTR A;  3HBL A;  4DNC A;  3HG9 A;  2DDB A;  4DQ2 A;  2E7W A;  4W1U A;  1LVK A;  3CF2 A;  4BJT A;  4BQA A;  3TL4 X;  1E17 A;  3K2A A;  2NVX J;  2E5Z A;  4RM2 A;  3HOS A;  5F08 A;  4UB6 C;  2K9M A;  2R7D A;  2DFI A;  2DJI A;  3QQA A;  3S8P A;  5JI6 A;  1BIA A;  2X4H A;  3CCR I;  4EJV A;  3N05 A;  3OYE A;  1JJ6 C;  5L3G A;  1OIS A;  1T38 A;  4HF2 A;  2DW4 A;  4UUS A;  2L02 A;  4CIC A;  3DPU A;  4Q47 A;  2IRF G;  1OLT A;  5GP9 A;  4XLC A;  2ECC A;  3CES A;  4HNU A;  1IV6 A;  2P7C B;  4ASN A;  4FX0 A;  5E17 F;  4LIT A;  2DT7 B;  3BY6 A;  2VE8 A;  4ZH4 F;  3GME A;  2V1N A;  1HLV A;  1UAA A;  2IT0 A;  5FKO A;  2KIQ A;  4ESB A;  2KZV A;  3OY9 A;  2KPM A;  4EJW A;  3WG7 H;  4C2T A;  4UV9 A;  2ID6 A;  3I54 A;  1Z77 A;  1GXP A;  2RKH A;  3F9K A;  4D5C A;  1ZRC A;  1JHF A;  1Z91 A;  2XVC A;  1LQ1 A;  3L2V A;  2P5K A;  2Y2Z A;  3V8J A;  2IS2 A;  3CDH A;  2NVT J;  2FX0 A;  4U87 A;  3J81 K;  2LC2 A;  2B0L A;  3L7W A;  2PMZ N;  3MN2 A;  3V8K A;  4CGZ A;  1ON1 A;  1SD4 A;  3G2B A;  3L2C A;  3JRE A;  2YUS A;  2LBF A;  1WSU A;  2IVM A;  2Z99 A;  3HIF A;  2VC1 A;  1QU3 A;  3A0H C;  3H3V K;  3ECH A;  3GTK J;  2LOO A;  3DBR B;  4IPA A;  1D1A A;  2RNJ A;  2QZ8 A;  5HDN A;  1R58 A;  4O6J A;  1PVE A;  1G6N A;  2AHQ A;  1EKE A;  4PGG A;  2A05 A;  4IHX A;  1GXQ A;  2R7U A;  2QYO A;  1K78 A;  2KMU A;  2LLK A;  5ICE A;  3D5L A;  3C2H A;  5E3M A;  1IGN A;  2KKO A;  3EET A;  4L5E A;  5L3D A;  4HV6 A;  2O61 A;  1JKQ C;  3W2W A;  2W4S A;  3Q5F A;  2PN6 A;  1MMD A;  4LG0 B;  3I4P A;  1VQ8 I;  3PL8 A;  2MW8 A;  3G1O A;  1IO2 A;  2J5O A;  1FX7 A;  3ZQC A;  4OMY A;  3I71 A;  5HLT A;  2ZME B;  3BRO A;  3ZMZ A;  1YHQ I;  3OR1 C;  2L7F P;  1LE8 B;  3TOA A;  3F0C A;  4X0G A;  1MBF A;  1R6R A;  1XMK A;  4AU7 A;  3TOB A;  4IHV A;  2MH2 A;  2EZI A;  4QTR A;  3OR2 C;  5DD4 A;  1F4K A;  3BQY A;  2MG4 A;  1JKO C;  2RN7 A;  2Y75 A;  2KFD A;  1T8I A;  2ESH A;  1YW7 A;  4CDG A;  2VN2 A;  1PYV A;  2Q2E A;  4ZZD A;  4AIK A;  2CS3 A;  3JRD A;  1I1G A;  1T08 B;  1V54 H;  2YR2 A;  5KNL A;  3OYB A;  2O8X A;  5DM7 F;  1U5T C;  2E1N A;  5HS8 A;  1T0F A;  1LEB A;  2PJR B;  5E3O A;  4ENK A;  1E3O C;  1YOV B;  4YG2 F;  2M87 A;  2M8E A;  3ABL H;  2BHZ A;  2VBY A;  4MTD A;  3ONQ A;  4LG3 A;  1J2X A;  3E5U A;  3F8N A;  3W3C A;  1BL0 A;  2H6B A;  5J4Y A;  2RV8 A;  2R5Y B;  1FOX A;  3BTL A;  1XSV A;  2CUF A;  4GFB A;  4BBR J;  3DTI A;  4E7H A;  2EPF A;  1S3J A;  2IPQ X;  3SFI A;  4RDU A;  1LEA A;  3S14 J;  5D5V B;  3WHC A;  2JT1 A;  3F72 A;  3ZQ7 A;  1MJB A;  4M72 A;  1GV5 A;  4LG0 A;  4A6E A;  3L00 A;  5HLI A;  3IC7 A;  4OIQ F;  4AVP A;  5F1J A;  1BJA A;  2AXL A;  4B47 A;  3VWB A;  1Y0U A;  3BZK A;  1O3S A;  3K4M A;  1YG2 A;  2LF7 A;  2DBB A;  4LFU A;  3I53 A;  3S17 J;  3S1N J;  3T8T A;  3ZN0 A;  4BQO A;  2LKS A;  4A3F J;  3CME I;  1FLI A;  2HOE A;  2XC7 A;  1XCV A;  1Y1W J;  1ACI A;  5E79 C;  5J8C A;  4CH7 A;  4IX7 A;  1YIO A;  4AM3 A;  2PMH A;  2TCT A;  4E7S A;  5D5W B;  3ZQI A;  1P7I A;  3AG2 H;  3CO7 C;  2V6E A;  1H0M A;  3VYT B;  1YLF A;  3JRI A;  3SZT A;  2KIM A;  2OJE D;  3JAM Z;  3VOD A;  1GUU A;  3FKI J;  1Y8R B;  1ZKG A;  3O2P E;  1NHA A;  4OMZ A;  2F5V A;  2KDZ A;  2DO7 A;  3HGY A;  2W82 A;  3E6C C;  2K3F A;  2HZT A;  4JX5 A;  1FJL A;  1A36 A;  4G94 A;  5B1B H;  5CLS A;  3ZOB A;  2QEX I;  4OAZ A;  2O5R A;  3E7L A;  5E3L A;  3OYJ A;  5H20 A;  3U1D A;  2W1O A;  3RPU D;  2FA5 A;  2R7F A;  2WAD A;  4I2O A;  2VLA A;  3SFZ A;  2DOA A;  1R5G A;  2RGV A;  1LFU P;  5M3F J;  3NAR A;  2JTV A;  1TW2 A;  2R5Y A;  3TED A;  2XUB A;  2L9S A;  1P92 A;  3WU1 B;  2I10 A;  1DDN A;  2NOG A;  1SVM A;  1PUE E;  3K4N A;  5J3L A;  2KP6 A;  4KMU X;  2GOX B;  2HOS A;  4H0E A;  4LMY A;  4G6T B;  5LEK A;  1T39 A;  4JX6 A;  3P7N A;  2HVQ A;  4J19 A;  5LBQ A;  2HQ5 A;  1FSE A;  3PIP F;  1XMA A;  5F6F A;  5KCM A;  1HW1 A;  3CUQ C;  4XRS G;  1FT9 A;  5EYR A;  4DYR A;  2E2I J;  3M8F A;  3R6S A;  3DU5 A;  1G59 A;  2V79 A;  1HBX G;  4DW6 A;  4A3J J;  1OFC X;  1K6Y A;  1LDD A;  2FOK A;  3SDG A;  2VPL A;  4BXX J;  2HOT A;  5D6E A;  4XKC A;  4M3B A;  3BJA A;  3C2G A;  4CCJ A;  1NK3 P;  5CPR B;  5EG0 B;  3SJM A;  1QZY A;  1REP C;  5K7H A;  1DPU A;  2OZU A;  4IRG A;  4FHT A;  4LB6 B;  4N4N B;  1IG7 A;  2CQX A;  4GDF A;  2XGC A;  2DTZ A;  2E2J J;  3HZJ A;  1TTY A;  4KN7 X;  5CJ9 A;  5F64 A;  2EFW A;  2JA2 A;  1W4M A;  3OL3 A;  1P4W A;  3E1S A;  2FOW A;  2KRF A;  2L7K A;  1I39 A;  3WU2 C;  3IWF A;  3FX3 A;  4ZYH A;  2W84 A;  2E60 A;  3RPQ A;  4MO7 A;  2Y31 A;  4IHY A;  1OKR A;  2VJI A;  5BNG A;  3CCS I;  2LF8 A;  5C4X J;  4B3A A;  4KA4 A;  4HX8 A;  5K7Z A;  2H1L A;  1ETX A;  2TRT A;  4M9Z A;  4AID A;  4CCL A;  2DA7 A;  3V7R A;  2JWT A;  3QPL A;  3TO7 A;  5AIQ A;  2CUE A;  3OV8 A;  3VYU B;  1FYM A;  1TZL A;  5DUK A;  1A31 A;  2NAZ A;  2MC4 A;  2D1V A;  1LFP A;  1J75 A;  4JYK A;  1N75 A;  1G4D A;  1N77 A;  1PJR A;  1KU7 A;  4M73 A;  3MKW B;  5LHI A;  4G12 A;  1X1D A;  2H27 A;  2DYS H;  2L4A A;  3R4K A;  4NBQ A;  1LVA A;  1QRY A;  1SD7 A;  1WJC A;  2YPR A;  3C1D A;  2HYG D;  4ESJ A;  2EA4 A;  4BHP A;  1LNW A;  5F0F A;  2ZB9 A;  2Y0S N;  2EIM H;  3F6O A;  5FLX Z;  5DD8 A;  1R4M B;  4EQQ A;  3OS2 A;  3R61 A;  4A3M J;  4KDP A;  5FRO A;  2EFP A;  5HLH A;  4V2G A;  1Z05 A;  1RUO A;  1GV2 A;  5JVG F;  3CDI A;  4BU2 A;  2HKO A;  2R7O A;  4P1W A;  4W97 A;  2RDP A;  3KZY A;  4NUB A;  3HSF A;  1W1W E;  3DFG A;  1N78 A;  2QGU A;  4XKV A;  5GAE J;  3CTA A;  2E71 A;  2QBY B;  5E20 A;  2VKH A;  2HGC A;  3PQK A;  2ICW G;  2YU9 J;  1ETO A;  2WAQ N;  2DMT A;  2Q8K A;  1M1E B;  2BY1 A;  4KJZ A;  4EGZ A;  3S3N A;  2LP0 A;  3DKX A;  2Z16 A;  3V4G A;  3CC4 I;  4C2U A;  2GZW A;  2EIL H;  1STZ A;  1JUM A;  1RNL A;  3H36 A;  4UXN A;  5BS6 A;  2XPV A;  2L9V A;  4Y52 J;  3PO3 J;  1R00 A;  5CVV A;  2COM A;  5JLX A;  1APL C;  1AA7 A;  2CRG A;  1D8J A;  5LLQ A;  4XK4 A;  4OOI A;  4BDZ A;  5IYD J;  5IPA A;  2JK3 A;  2HR3 A;  3DBL B;  1W5T A;  2OTL I;  1EF4 A;  2A6H F;  2L0K A;  4S05 A;  4AIH A;  4U0W A;  3HUG B;  4BYY A;  1H88 C;  2IP2 A;  2O0Y A;  1BN5 A;  4BEH B;  3KP3 A;  4CUG A;  2QSG X;  1D8K A;  3RYP A;  1O3R A;  1USS A;  1KQ8 A;  1R22 A;  3BDD A;  2MFZ A;  1R5I D;  3IAS 2;  3JRG A;  3EQL F;  1W0U A;  2GA1 A;  1U78 A;  4IKF A;  3B02 A;  3S1M J;  4G7O F;  3CLQ A;  3HTS B;  4A12 A;  3GF2 A;  5TJJ A;  2NOJ B;  1K6O A;  2P81 A;  4NQW B;  3R60 A;  2FD5 A;  4IXA A;  1ZRF A;  1BW6 A;  2X1C A;  3KZI C;  3IAM 2;  3FIW A;  3WGG A;  1ZG3 A;  3H3U A;  5C3E J;  4FTH A;  1R1U A;  2H6C A;  1W7P D;  3ZMT A;  1KYZ A;  1E0E A;  2VPR A;  4V19 K;  3HPH A;  4XSZ F;  1RKT A;  5EDN A;  2B63 J;  1EV7 A;  2LVS A;  5A2Q K;  2E2H J;  3ABK H;  3GBG A;  3KEQ A;  4BS9 A;  3LA2 A;  5EGO A;  2CSO A;  4XOT A;  2X51 A;  3SZP A;  2A61 A;  3I56 I;  3BCB A;  4F3Q A;  5GAG J;  4M74 A;  2QKM B;  1G3S A;  4M9S A;  2IAI A;  2M7A A;  4QWQ A;  1D3Y A;  4OIR F;  2ZNY A;  4IZZ A;  3FXL A;  3A02 A;  3OS0 A;  2DFE A;  2QEN A;  1HA8 A;  3A01 B;  4PK4 A;  1AHD P;  1MSF C;  2FBH A;  1TC3 C;  1TWG J;  3IH4 A;  2BW3 B;  2M7B A;  1ZAR A;  1Y0N A;  1IC8 A;  1HDD C;  1K83 J;  3H3Z A;  1T0F C;  2VJJ A;  3T0Y A;  1A04 A;  1CQT A;  2XAQ A;  3M8J A;  4HST A;  5ILV A;  3CP2 A;  1X3W B;  3BP8 A;  3HUG A;  2PMU A;  4L0Y B;  2LK2 A;  1KU9 A;  4UY8 I;  2EA2 A;  2DYR H;  1G3Y A;  2W24 A;  2L9R A;  3BG9 A;  4XN3 A;  2H8W A;  5EF6 A;  3AL0 C;  2LRD A;  3CCY A;  5KHD A;  2X6X A;  3IH3 A;  5HOD A;  2WBM A;  3F8M A;  4WXD A;  2UV1 A;  3HB9 A;  3KP2 A;  1H8A C;  1JGG A;  1VQ7 I;  3CCJ I;  1QGP A;  4BQQ A;  2DFF A;  5FKK A;  1AKH B;  3FHZ A;  3RSN A;  3CCE I;  4NQW A;  4BE0 A;  5IT9 K;  1JI8 A;  2L01 A;  3ECO A;  3CC7 I;  2VIX A;  3SQN A;  4RB1 A;  1V5E A;  5D4R A;  2UXX A;  3CMM A;  3EUK L;  1D5V A;  2V9P A;  4LIV A;  2KZG A;  2XB5 A;  2MA3 A;  2NVQ J;  3ASN H;  1KYW A;  2COB A;  4RB0 A;  1FTZ A;  1GT0 C;  2PMZ A;  3KLN A;  2VBW A;  1K4T A;  3AG4 H;  3IRR A;  2O6G E;  2LKP A;  1N25 A;  4BE1 A;  3I59 B;  5J6X A;  3OYF A;  1H89 C;  3GTL J;  2GQQ A;  3IL2 A;  2H8R A;  3DKY A;  3KET A;  2NVU B;  2VUM J;  1J0R A;  1DU0 A;  2QA4 I;  4PGH A;  4HEA 2;  3JRC A;  3CD6 I;  4B1R A;  4M9X A;  2ZXI A;  3JCU C;  5EJC A;  1LFB A;  2ZBK A;  3TQN A;  4HRI A;  3BG6 A;  4EV0 A;  4BJ5 C;  2Z2S B;  4B3X A;  1UFM A;  1UZC A;  3LMM A;  3L9F A;  4CSW A;  2Y30 A;  3Q3S A;  1NK2 P;  2HXI A;  3F8F A;  3T1B A;  1QVT A;  1Z3Y A;  4XOR A;  3WTS C;  2Y69 H;  1FBS A;  1VF9 A;  4XKW A;  3PUB A;  3W6V A;  5H6Q A;  4BXF A;  5D8L B;  2XKP A;  4B43 A;  3GZ6 A;  4P5O A;  4PFO A;  3G6E I;  4C3H J;  4AC0 A;  4WXC A;  4II3 A;  4JBA A;  4AIJ A;  1S7E A;  4AVZ A;  4XM3 A;  5IYB J;  3DTE A;  1Y56 A;  2O9L A;  5L3C A;  3OYK A;  3LSP A;  2KJC A;  3J80 K;  1VI0 A;  2XAH A;  2VE9 A;  4XBF A;  1YX3 A;  4P55 A;  3EUH A;  5FO5 A;  1OJL A;  2E1C A;  5F0H A;  2R7Z J;  4J00 A;  4CCO A;  1WJA A;  4RGS A;  3KYD B;  4KN4 X;  3HOV J;  4ABZ A;  3C3W A;  3KE2 A;  5DYM A;  4BY7 J;  2CQQ A;  3CCV I;  2HVR A;  2EFN A;  1KGS A;  4HNV A;  2JA8 J;  1AKH A;  1IXC A;  1WI9 A;  1A6I A;  4WX9 A;  1VTN C;  3NEU A;  5K7F A;  2HTJ A;  1W0T A;  3HOX J;  2EZL A;  3JRH A;  2V1D A;  5L3B A;  3JTG A;  1UHW A;  3J7A Y;  3DPT A;  4IF4 A;  3OYG A;  2OQG A;  5IOZ A;  4Q48 A;  3TBI A;  3GTP J;  2MLK A;  2K40 A;  3GVA A;  3I59 A;  4KUM A;  3A03 A;  4BE2 A;  1DP7 P;  1W5S A;  3IWZ A;  1B1B A;  3K0L A;  3Q0U A;  4M71 A;  1G3T A;  4A93 J;  1B8I A;  4N4O B;  2XF7 A;  2DA3 A;  3MZH A;  3AG3 H;  3RCO A;  2IA1 A;  4XLE A;  1WI3 A;  3J7Y J;  1OCR H;  2ESN A;  5L3F A;  3PUF A;  2R7T A;  2BEO A;  3BWG A;  2ADU A;  3FXO A;  3OIQ A;  4EEF G;  4ZTF A;  3ZPL A;  3T8R A;  2N8G A;  1S72 I;  3GTJ J;  4A5N A;  1YS6 A;  2LR8 A;  3SEZ A;  3VDX A;  1BC7 C;  4ENM A;  3VOE A; 
#chains in the Genus database with same CATH homology
 2DA1 A;  1QPI A;  3FIS A;  4A3F J;  4M3F A;  1Y1W J;  3FK7 A;  1ETV A;  2TCT A;  2GLO A;  1VFC A;  2JA6 J;  3ZQI A;  5IP7 J;  4A3K J;  1P7I A;  1OCT C;  2K9Q A;  1T33 A;  3JRI A;  2OPT A;  4A3I J;  3Q0W A;  1GUU A;  3FKI J;  1ETQ A;  1ZKG A;  1RR7 A;  2EH3 A;  4I76 A;  4AYB N;  2R5Z A;  3S2H J;  2KDZ A;  2ELK A;  4MFE A;  1HCR A;  3HGY A;  5C4J J;  1BA5 A;  2VI6 A;  4JX5 A;  1FJL A;  1SAN A;  3BTJ A;  2VKE A;  3ZOB A;  1B72 B;  3E7L A;  5E3L A;  1AU7 A;  3ZQL A;  1YRN A;  3HDD A;  4JP0 A;  1LFU P;  5M3F J;  3NAR A;  2D5V A;  3TED A;  2R5Y A;  2DA4 A;  3PM1 A;  2DMU A;  3RZO J;  3A01 A;  2I10 A;  5M3M J;  5EGO B;  2NOG A;  5F27 A;  2YS9 A;  5IOY A;  5J3L A;  2JJ7 A;  2VKV A;  1RKW A;  3JRB A;  4XIC A;  2HOS A;  5M5Y J;  2XRL A;  5C44 J;  1I3Q J;  4JX6 A;  4MIM A;  3IV5 A;  3GTQ J;  4J19 A;  1MBJ A;  4M6V A;  1TWF J;  4C2M J;  1ETW A;  2HQ5 A;  3MVP A;  4XRS G;  2M8G X;  5EZH A;  1TWA J;  5EYR A;  4DYR A;  2E2I J;  1Q1V A;  4DW6 A;  4A3J J;  1TWC J;  1OFC X;  3HKZ N;  4NDL A;  4B4C A;  5F0C A;  3CMY A;  3K7A J;  1HDP A;  3SDG A;  4BXX J;  2RAE A;  4D7M A;  2HOT A;  5DTD A;  4DYC A;  1MBE A;  4M3B A;  2LFB A;  2WB1 N;  1NK3 P;  3CQZ J;  5EG0 B;  2QF7 A;  3SJM A;  3HOY J;  5K7H A;  2M0C A;  4DZP A;  4A3E J;  1IG7 A;  2CQX A;  5FLV A;  1JT6 A;  2XGC A;  3HGG A;  2DTZ A;  4S0H B;  2E2J J;  1FTT A;  1I50 J;  1IDY A;  1WH7 A;  4M3G A;  3ZQH A;  1GDT A;  3S2D J;  4A3D J;  3MKL A;  1JTX A;  2HYJ A;  4DYQ A;  1SFO J;  1PUF B;  3S15 J;  4BBS J;  1JKP C;  3LSJ A;  4MO7 A;  3JR9 A;  4LOC A;  2Y31 A;  1XC5 A;  1IRZ A;  2EQR A;  4XRM A;  3B6A A;  2GM4 A;  2WV1 A;  4IHY A;  5BNG A;  4A3L J;  3RZD J;  3RKQ A;  5C4X J;  3HOW J;  4B3A A;  5K7Z A;  1ETX A;  5E3N A;  2TRT A;  1JKR C;  2DA7 A;  2H1K A;  3M4O J;  2JWT A;  2K9N A;  3QPL A;  1R9T J;  2CUE A;  3TW6 A;  4BY1 J;  2K9S A;  4V2F A;  3PO2 J;  1JT0 A;  4JYK A;  2ECB A;  3S1R J;  3FK6 A;  1IJW C;  2CJJ A;  2QCO A;  3BT9 A;  2LD5 A;  1LE8 A;  4A3B J;  1X2N A;  3OIO A;  4G12 A;  2XPU A;  1WCM J;  2XGE A;  2M34 A;  2ME0 A;  2OF7 A;  1QRY A;  3LOC A;  4C3J J;  1NTC A;  3TP0 A;  1IUF A;  5F0F A;  4I6Z A;  2ZB9 A;  2Y0S N;  4A3M J;  4FE7 A;  1Y1V J;  1WH5 A;  2LKX A;  1JUS A;  4V2G A;  1MBK A;  1ZQ3 P;  2X9D A;  2M9H A;  1GV2 A;  4IHW A;  3S1Q J;  3OSG A;  4FIS A;  4QSH A;  4W97 A;  3LSR A;  4X6A J;  2Y9Y A;  4UUT A;  4C3I J;  3GTG J;  1FIA A;  3BQZ A;  1U9O A;  3CDL A;  2E19 A;  2YU9 J;  2E1O A;  1WPK A;  1G2H A;  1ETO A;  2WAQ N;  2DMT A;  4XID A;  3G1M A;  2LP0 A;  2DMQ A;  2DMN A;  2EBI A;  3L1P A;  3B6C A;  5FKM A;  1A5J A;  4DZJ A;  1JUM A;  1HF0 A;  5FLM J;  3HOZ J;  2XPV A;  1UG2 A;  4Y52 J;  2JMW A;  3PO3 J;  1B8I B;  3HEF A;  3WHB A;  1BJZ A;  5JLX A;  5GPC A;  1APL C;  1UHS A;  2CRG A;  4MFD A;  2L7Z A;  4UUS B;  4M3D A;  4XK4 A;  5IYD J;  5IPA A;  2JK3 A;  2XB0 X;  1EF4 A;  2L0K A;  2HXO A;  1OCP A;  3ZQG A;  2L7M P;  2DA5 A;  1ENH A;  1MH4 A;  1H88 C;  4FE4 A;  1POG A;  5FKN A;  2XSD C;  1ZTR A;  2MGQ A;  4CYC B;  5JLW A;  3QPS A;  3S16 J;  1W0U A;  4XRS A;  3JRG A;  3GTO J;  3BR6 A;  1HOM A;  1P7J A;  1U78 A;  3HOU J;  3S1M J;  2HOA A;  1JTY A;  2DN0 A;  3OOU A;  1ZR4 A;  3LSG A;  4IEJ A;  2X6O A;  2P81 A;  2FD5 A;  1BW6 A;  5EEA A;  2XPW A;  3FIW A;  5C3E J;  4FTH A;  1B72 A;  4FCY A;  2XGD A;  2KT0 A;  5J1U A;  2VPR A;  4M3E A;  2R5Z B;  2R93 J;  2NS8 A;  4MLO A;  1RKT A;  5EDN A;  1U8B A;  1X2M A;  2IBD A;  2B63 J;  2LVS A;  3BTC A;  3HBL A;  3GBG A;  2E2H J;  1F43 A;  1ZK8 A;  5FKL A;  4W1U A;  1ITY A;  5EGO A;  3BTI A;  3K2A A;  3RQI A;  2NVX J;  5IP9 J;  1QVU A;  1X58 A;  2CU7 A;  5F08 A;  5M5W J;  2IAI A;  3BR1 A;  1F36 A;  3QQA A;  4AUX A;  3A02 A;  3VPR A;  1JJ6 C;  3A01 B;  3DEW A;  1AHD P;  1MSF C;  3JRA A;  3O8H A;  1TC3 C;  1TWG J;  3IH4 A;  4UUS A;  2X48 A;  1IC8 A;  1HDD C;  4A3C J;  5GP9 A;  2NVY J;  5FJ8 J;  1K83 J;  1IV6 A;  2ECC A;  1ZR2 A;  3BR3 A;  1ETY A;  1CQT A;  1TWH J;  3I4N J;  1HLV A;  2LK2 A;  5FKO A;  3ZQF A;  2L9R A;  5EG0 A;  2ID6 A;  2ID3 A;  3BG9 A;  1Z77 A;  2FJ1 A;  3C2B A;  5EF6 A;  4D5C A;  3CCY A;  2LY9 A;  3O8G A;  3IH3 A;  1GVD A;  5HOD A;  5M5X J;  2ME6 A;  3HB9 A;  2Y2Z A;  4QIW N;  2NVT J;  2FX0 A;  1H8A C;  1JGG A;  2PMZ N;  1MBG A;  1VND A;  3MN2 A;  1AKH B;  5FKK A;  2AO9 A;  9ANT A;  1PUF A;  3JRE A;  4A3G J;  2YUS A;  1XG1 A;  1FEX A;  3M3Y J;  5IYC J;  2XB5 A;  3TW7 A;  2NVQ J;  3H3V K;  2COB A;  3GTK J;  3G1L A;  3Q0V A;  1GT0 C;  1FTZ A;  2HDD A;  3NAU A;  3GTM J;  1O4X A;  5J1Y A;  1Z0X A;  3HM5 A;  1JUP A;  3GTL J;  1H89 C;  2AHQ A;  2H8R A;  2GBY A;  4IHX A;  2VUM J;  1DU0 A;  1FIP A;  2LLK A;  3DCF A;  3BR5 A;  4Y7N J;  5E3M A;  3JRC A;  1IGN A;  3JRF A;  4B1R A;  2IEK A;  1LFB A;  2Y9Z A;  1RES A;  4L5E A;  1RPW A;  1JKQ C;  1MSE C;  1MH3 A;  5J1R A;  2Y30 A;  3Q3S A;  1D5Y A;  1NK2 P;  2HXI A;  1ZGW A;  1QVT A;  3IH2 A;  4D5F A;  1ETK A;  4D7N A;  1VF9 A;  2MW8 A;  3W6V A;  3G1O A;  5DS9 A;  3ZQC A;  4C3H J;  2EZK A;  4AC0 A;  1K61 A;  1BW5 A;  1I6H J;  1S7E A;  2L7F P;  1LE8 B;  5IYB J;  3OSF A;  1T56 A;  3F0C A;  2O9L A;  1MBF A;  1UMQ A;  3LSP A;  1IDZ A;  1VI0 A;  4IHV A;  4QTR A;  2EZI A;  2JN6 A;  3BQY A;  2MG4 A;  2W48 A;  5F04 A;  1JKO C;  1OJL A;  5F0H A;  2R7Z J;  1XS9 A;  3UKG A;  2MSY A;  3HOV J;  4ABZ A;  4BY7 J;  2CQQ A;  1ORK A;  2JA7 J;  1WGX A;  2NS7 A;  4HNV A;  2JA8 J;  3TP3 A;  3JRD A;  1AKH A;  1A6I A;  3D1N I;  4BKX A;  5K7F A;  3H0G J;  1W0T A;  2M2E A;  3HOX J;  2EZL A;  5EZG A;  3JRH A;  5E3O A;  2JA5 J;  1JJ8 C;  1E3O C;  2O7O A;  4X1E A;  5IOZ A;  2G0E A;  2LTP A;  1DU6 A;  1YRN B;  3GTP J;  2HI3 A;  1MBH A;  2K40 A;  2R0Q C;  3I4M J;  1BL0 A;  3A03 A;  5IP6 A;  3BR0 A;  2R5Y B;  2O8K A;  3BTL A;  2CUF A;  4GFB A;  3Q0U A;  4BBR J;  4A93 J;  1B8I A;  1RET A;  2R92 J;  3BG5 A;  2DA3 A;  3SFI A;  4RDU A;  3BR2 A;  4JX4 A;  3S14 J;  2EZH A;  2FQ4 A;  1WI3 A;  3WHC A;  2DMP A;  1MNM C;  2DJN A;  3BG3 A;  1GV5 A;  4EEF G;  1U9N A;  3LNQ A;  4RBO A;  2N8G A;  5F1J A;  2DA6 A;  3GTJ J;  2DA2 A;  4A69 C;  2LR8 A;  5GPA A;  4CYC A;  3S17 J;  3S1N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...