2H1KA

Crystal structure of the pdx1 homeodomain in complex with dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
RTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 15-mer DNA
publication title Structural basis for induced fit mechanisms in DNA recognition by the pdx1 homeodomain
pubmed doi rcsb
source organism Mesocricetus auratus
total genus 17
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2h1kA00
2PMZN 4NDLA 3B6CA 3HOWJ 1ZKGA 2X6OA 2ID6A 2NVTJ 1OFCX 5FKKA 2LK2A 2XPUA 2XGDA 4FE7A 2K9QA 1IUFA 3IH3A 1ZR2A 1I50J 2KDZA 5FLMJ 1JTYA 2XPVA 4JX4A 1E3OC 1RETA 3BG3A 4M6VA 1JKPC 4MO7A 2ECCA 3BG5A 5EZHA 1ITYA 2DA1A 1MBJA 3ZQFA 1LFUP 3SFIA 1IDZA 2E2HJ 5EDNA 1O4XA 3ZOBA 2ME6A 4DYCA 4RDUA 1MBGA 1UHSA 4M3GA 3IV5A 4M3FA 2R5ZA 4MFEA 1X2NA 2Y9YA 2P81A 4MLOA 2CU7A 1QRYA 2DJNA 1X2MA 3TP3A 1QVUA 1AU7A 4QSHA 1IGNA 1MBKA 2DA4A 4A3FJ 1A6IA 5F04A 5GP9A 3S2HJ 4DYQA 3GTPJ 3HGYA 5BNGA 1MH4A 3ZQHA 1MSFC 1I3QJ 2JA7J 1ETYA 3JREA 4B1RA 1XS9A 2DMTA 4JYKA 2WAQN 1IG7A 1MBHA 3W6VA 4S0HB 4D7MA 1FIAA 1JT6A 1T33A 1POGA 3MN2A 3BR0A 3HDDA 1Q1VA 3B6AA 3ZQGA 4JX6A 4C3IJ 4I6ZA 4Y52J 2QCOA 1WCMJ 5EGOA 2EZIA 4A69C 2FD5A 5M5WJ 1ETQA 4DW6A 4X1EA 2NS8A 3JRHA 3G1MA 4X6AJ 2HXOA 5M3FJ 1F36A 2FJ1A 3GTJJ 2OF7A 2R7ZJ 2ECBA 1B8IB 3WHCA 2JN6A 3HM5A 1RPWA 2LTPA 2HI3A 2NVYJ 2EQRA 4W1UA 4JX5A 1H8AC 3ZQCA 1HCRA 3OIOA 2JWTA 4FE4A 2E19A 1IDYA 1HF0A 1G2HA 1B72A 1ZGWA 1IC8A 2L7ZA 1OJLA 3HOXJ 1JKRC 1NK2P 3CDLA 1TWFJ 2M0CA 4A3JJ 3SJMA 3L1PA 2CQXA 2JMWA 5GPAA 3FK7A 3BR5A 1MBFA 4M3EA 3PO3J 2WB1N 2LLKA 3GTMJ 1X58A 3LSRA 1JTXA 3BR6A 2TRTA 3M3YJ 2JA6J 2LVSA 4A3CJ 1GT0C 3HOYJ 4UUTA 2R5ZB 1VFCA 3NAUA 2R0QC 1W0UA 2CQQA 5J1UA 4D5CA 2G0EA 1W0TA 4I76A 4RBOA 5IYBJ 2DMNA 2NVQJ 5FKMA 1U8BA 1AKHB 4B3AA 2DA3A 3IH4A 3CCYA 2RAEA 3OOUA 1Y1WJ 1UMQA 2CUEA 2MW8A 3HEFA 2M34A 4G12A 1PUFA 1TWHJ 3C2BA 4AYBN 1ZTRA 3CQZJ 5K7ZA 2K9SA 5F1JA 2L0KA 2XPWA 1JUPA 2XB0X 4FISA 1WH7A 5K7FA 1A5JA 4J19A 1FJLA 2GBYA 4IHVA 1BJZA 5DS9A 4UUSB 1DU0A 4GFBA 1QVTA 2JJ7A 1XG1A 2DN0A 3BT9A 3HOUJ 1JKQC 2GLOA 2MG4A 4JP0A 4FTHA 5C4XJ 2AO9A 4ABZA 5EGOB 3Q0VA 4FCYA 2HQ5A 3JRAA 1U78A 4C3JJ 4D5FA 2L9RA 3FIWA 5F0FA 1RR7A 3LSGA 5J1YA 4XRMA 4L5EA 1H88C 2IBDA 3JRFA 2Y0SN 2ME0A 1NTCA 3G1OA 3S15J 3O8GA 1ETKA 3MVPA 4XK4A 4XIDA 2NS7A 2DA2A 2EH3A 5EG0A 3BTLA 4IHYA 1NK3P 1RESA 2B63J 2COBA 3K7AJ 2ELKA 3BR1A 1QPIA 3JRDA 2R5YA 2CJJA 1B72B 3JRBA 1JT0A 1LE8B 2LKXA 3BQZA 3DCFA 3GTKJ 5IP9J 5EZGA 4A3KJ 4HNVA 1HDDC 4A3IJ 1DU6A 4Y7NJ 2JK3A 3JRIA 1K83J 2HOSA 1HLVA 3I4MJ 3HGGA 4A3BJ 1WPKA 2O8KA 1FEXA 5F0CA 5IOZA 2N8GA 4A3EJ 1H89C 2EZKA 2D5VA 5E3MA 2O7OA 5E3NA 4W97A 5F08A 1FTZA 1OCPA 4V2GA 2ZB9A 1I6HJ 3A01A 4BBSJ 1JUMA 2M9HA 3BTJA 3S2DJ 5FLVA 5F27A 5J1RA 2ID3A 1GUUA 4M3DA 3H0GJ 5FJ8J 4QTRA 3S1RJ 3RZOJ 1K61A 4BY7J 3ZQIA 2LFBA 4D7NA 3S14J 2X9DA 3NARA 1VF9A 5E3OA 1ZK8A 1PUFB 4BY1J 2MSYA 4BXXJ 2WV1A 5M5XJ 2IEKA 2KT0A 3QQAA 2VPRA 3LOCA 3O8HA 3H3VK 3GTGJ 4A93J 1D5YA 1LFBA 2E2JJ 3TEDA 2YU9J 1JUSA 3BTCA 3UKGA 1JGGA 2TCTA 3GBGA 2LR8A 1IJWC 3S16J 2EZLA 2DA6A 4AUXA 1Y1VJ 3IH2A 5EF6A 3GTLJ 3A03A 5E3LA 3RZDJ 2HDDA 3K2AA 3RQIA 3DEWA 1SFOJ 2MGQA 2L7MP 1YRNA 4EEFG 3TP0A 2DMPA 1ETOA 2DA5A 2Y9ZA 4IEJA 3JRCA 5FKNA 3S1QJ 5F0HA 3RKQA 4IHXA 1ORKA 2LP0A 3E7LA 4C3HJ 2HOTA 1UG2A 9ANTA 1RKWA 3VPRA 2VKEA 5C4JJ 2Y2ZA 3PO2J 2VI6A 2R92J 3HOVJ 2EBIA 2VKVA 5IYDJ 2EZHA 5FKOA 1XC5A 1FTTA 1WI3A 1BA5A 2XRLA 2I10A 3OSFA 1VI0A 2R5YB 1P7JA 2YS9A 3BR3A 3I4NJ 1TWAJ 2E1OA 2HYJA 5K7HA 2OPTA 1ZR4A 2K9NA 2W48A 1JJ8C 1Z77A 2Y30A 2GM4A 4XICA 1IRZA 5JLWA 2LY9A 3PM1A 5J3LA 1OCTC 2M8GX 1TC3C 5JLXA 4CYCA 1RKTA 4M3BA 5EYRA 3FK6A 3SDGA 2YUSA 4AC0A 1T56A 2DA7A 4LOCA 3HKZN 3MKLA 3ZQLA 4A3DJ 1U9NA 1R9TJ 1MBEA 3A01B 3HOZJ 4DZPA 1GV2A 1AHDP 2HOAA 4A3GJ 5IP7J 1BL0A 1MSEC 1AKHA 1ETXA 3QPLA 5IPAA 3S1MJ 2XSDC 3S17J 1VNDA 3BTIA 2NVXJ 3GTQJ 1TWCJ 1WH5A 1MH3A 2HXIA 2FX0A 1ENHA 2L7FP 2DTZA 1U9OA 1CQTA 5FKLA 4IHWA 3QPSA 5GPCA 1P7IA 2X48A 4B4CA 4DZJA 2AHQA 2LD5A 1GV5A 3D1NI 4C2MJ 5IOYA 5IP6A 2H1KA 4UUSA 4MIMA 2Y31A 3TW7A 1IV6A 2NOGA 3Q0WA 2VUMJ 1MNMC 1TWGJ 1FIPA 3BR2A 4BBRJ 3F0CA 3S1NJ 1YRNB 1S7EA 3HBLA 5EEAA 2XB5A 1WGXA 1ETWA 1BW6A 2JA8J 3WHBA 4MFDA 3FISA 3BQYA 2R93J 5C3EJ 3GTOJ 1JJ6C 5C44J 1F43A 3Q3SA 3BG9A 4A3MJ 3A02A 2K40A 1GVDA 2M2EA 2XGCA 5M3MJ 3G1LA 5IYCJ 3LSPA 3OSGA 2O9LA 1BW5A 1LE8A 3TW6A 3HB9A 5HODA 3LNQA 3JR9A 2IAIA 3LSJA 5M5YJ 2CRGA 1Z0XA 3M4OJ 2E2IJ 1APLC 2QF7A 4XRSG 2DMQA 3JRGA 1ZQ3P 5DTDA 4XRSA 2JA5J 4BKXA 3FKIJ 2XGEA 2FQ4A 1JKOC 3CMYA 2CUFA 4V2FA 1SANA 3Q0UA 4CYCB 1EF4A 4DYRA 1HDPA 4A3LJ 1B8IA 1HOMA 2H8RA 4QIWN 5EG0B 1ETVA 2DMUA 1GDTA
chains in the Genus database with same CATH superfamily
4N4NB 2BZTA 1Y0NA 4EV0A 2FMYA 3HOWJ 2ADUA 4HOBA 3FDYA 2V1DA 2XPUA 2HU9A 3BLYA 4KMUX 1T0FC 4ZZDA 3DPTA 5LHHA 2Z9OA 1U3EM 5IT3A 1X19A 4HX4A 4G6QA 4NB5A 3LFKA 2HTJA 3P5JA 3K70C 4ESJA 1ZR2A 5D6EA 3M8EA 2IJLA 1LEAA 2OZUA 1JTYA 2L9VA 1E3OC 3HKZA 1JKPC 3CJNA 1VQ8I 3M8JA 1JHHA 4KT6A 1SD6A 3OYCA 2BOLA 3OYAA 2EFWA 2ZMEC 4ENJA 5JI6A 2DA1A 4B48A 2FBHA 2DYSH 2BW3B 5L3BA 1BOBA 2KKOA 2E2HJ 1P6RA 5EDNA 4DYCA 3CUQA 3KEYA 2ZJRF 3IL2A 3DEEA 2DW4A 1L3LA 4RM2A 3GX4X 3CJRB 1G8XA 5H6QA 1PP8F 2DQLA 2CU7A 2CW7A 4HV5A 4DNCA 1YG2A 3WGHA 5K5OA 1MJBA 2VOPA 1MMAA 3GZ5A 4LMYA 2A6TA 1VQ7I 1KU7A 4N4OB 1B4AA 4QSHA 1XD7A 3F9KA 3GFJA 2GXAA 3SZPA 4A3FJ 3RPUD 3S2HJ 1XPXA 1Z1DA 1WJEA 3HGYA 3VFZA 1A35A 2O03A 3L09A 3WTXC 3GTPJ 1YITI 3MKWB 4HX7A 3LA3A 4CICA 2VOOA 4F93B 1IG7A 1MBHA 1TLHB 1FIAA 3LSMA 1BOAA 3FBIB 3ZPLA 1EJ9A 2NAZA 3A4CA 3MN2A 3KYLA 2UWMA 2E7XA 4XSZF 3B6AA 3ZXSA 5LLQA 3CO6C 1TZLA 2CS3A 4Y52J 4NHJA 1VQLI 5EGOA 2FD5A 5M5WJ 1D1BA 2M3AA 2NS8A 4GO1A 1FY7A 4CZCA 2R7XA 4XOTA 3GTJJ 2R7ZJ 3RKYA 4BACA 2QQ8A 4F52A 3WHCA 2JN6A 5HDNA 2CG4A 1RPWA 3FX3A 4PJNA 3KYCB 1XB4A 2L7KA 2HI3A 2ICWG 4IL6C 1Z21A 4FETA 3OS0A 1FSEA 3H35A 4P1WA 2JWTA 4FE4A 1G2HA 5FD6A 2EV5A 3MFKA 4R8HA 1JKRC 3F8BA 4E7LA 3ULQB 4A3JJ 4IOCF 1B6AA 2KISA 4DOZA 1KGSA 2IGKA 2W24A 2JMWA 1I1SA 2CQNA 2Y75A 3GCMA 1E0EA 2RGVA 3BR5A 2PMZA 1YW8A 3IKVA 4LITA 4PGHA 5DCMB 1X58A 3GTMJ 1SVOA 1JTXA 1TT5B 1UJ8A 2TRTA 4OMYA 1XCBA 2LVSA 4EJVA 5DUIA 1O3SA 3FHZA 4UUTA 3W2AA 2QEXI 3IRQA 2JSPA 2DK5A 1MKMA 2O6GE 2HS5A 3GFIA 4I76A 1O57A 1T2KA 1QZZA 2NVQJ 3ABKH 4HSRA 3O3KA 4F7ZA 4XM3A 1AKHB 2DA3A 4E6KG 2R3SA 4ZYHA 1J59A 3OOUA 1O7LA 1UMQA 4H4KC 4ENKA 3P9IA 3TOBA 2IS1A 5FROA 4G12A 1G3TA 4LB5A 3CQZJ 4XLCA 2K9SA 2XPWA 3ABTA 4FISA 2OQRA 4WWCA 3T5XA 2Q2EB 4BHPA 4J19A 2GBYA 5F1RA 1D8JA 2CW0F 3WTYC 4RAYA 4IHVA 5BQTA 2W82A 5DS9A 3HIFA 1LJ9A 2CSOA 2FU4A 4M9SA 3V4GA 3P7NA 3FXLA 2JJ7A 1UHMA 1XG1A 2DN0A 4EM0B 3DU6A 1F9NA 3AG1H 5FLXK 2Z33A 2V6CA 3JRAA 3ZMSA 4C3JJ 4O3MA 2OC6A 1IZ1A 1QHHD 3JW4A 4LG0A 3I4PA 4DBQA 4HDVA 2ISZA 1IXSB 1RR7A 5F0FA 3JRFA 2WAQA 3G1OA 2MYSA 5K5RA 3IAM2 1X1PA 1IV8A 1G6NA 1VTNC 1T8IA 1FP2A 1TQIA 2Y69H 4JOMA 4ZTFA 1NK3P 2B63J 2QBYB 5E17F 1LDKB 2E5NA 3K1NA 3K7AJ 2EPFA 2WA0A 1KYZA 2LY1A 2M0MA 2XAGA 1MMDA 2K9LA 4JK1X 5E1XA 1Z91A 5LHGA 2VQGA 2R5YA 3HTSB 3DCFA 6PAXA 1XGNA 3IRRA 1MGTA 2HTSA 1DUXC 1TQMA 1K78B 2R7RA 2W4SA 2AXLA 1J7KA 3F8MA 1HLVA 1ONVA 1EH8A 2X6WA 4J00A 2BY2A 2KL4A 3IWZA 4BYYA 2O8KA 2JRTA 3KZIC 5IOZA 3T8RA 2N8GA 2RNGA 2FNAA 4A3EJ 1YW9A 4BJ6C 1FBSA 1CGPA 2XF5A 2A5YB 4FQGA 4W97A 5F08A 4L5IA 1USSA 3DTKA 3H0DA 2ZB9A 3KP7A 1I6HJ 3A01A 3DPLC 4BHBA 3OY9A 2JZYA 1R1TA 2O61A 3PSIA 1G3WA 4Y13A 4IQJA 4IRHA 5ED4A 1K6YA 5F27A 5LGUA 5AIQA 4M74A 3ROUA 4OAZA 1LNWA 3MKYB 1VQKI 1K61A 5GADJ 2K4JA 2B7EA 2IT0A 3W2VA 3UR3C 4PJMA 3M9AA 3TMOA 3ISPA 4BY1J 3OL3A 5M5XJ 3K4JA 1ERDA 2KT0A 3SZTA 4PFOA 5H2FC 3O8HA 4EQQA 2E1CA 1MMNA 1SAUA 4HNUA 1D5YA 1LFBA 2QWWA 3TEDA 2L2OA 3JSOA 2ZJQF 4YFNF 2H09A 4K2EA 2XIGA 4AUXA 1RUOA 1Y1VJ 3KFWX 2W84A 3I56I 2HPMA 3RQIA 3S32A 1FWZA 2K02A 3K4BA 3DEWA 5HLTA 3KP2A 2MGQA 2L7MP 4AYBA 1HW2A 2XKPA 3M1CA 1ZGAA 3OMYA 2Y9ZA 5FKNA 3DWLE 2OQGA 1YJWI 1IF1A 1IRFA 2O3FA 4C3HJ 3ELKA 1QA6A 2KP6A 2R7QA 4P9FA 3VPRA 4E7ZA 1G59A 1J0RA 1T6SA 2FUG2 4BL0B 1JXSA 3MZHA 3K69A 3VDXA 3CCJI 2QM3A 2V7FA 3KX2A 5IYDJ 2WY8Q 3LAJA 2VQCA 2K3PA 4RAZA 1F4KA 1BA5A 1VQ6I 2I10A 3KP4A 3H3ZA 1F1ZA 2YS9A 2HKOA 1T95A 3K4NA 2E1OA 2OPTA 3PUBA 1ZR4A 4LFUA 4J01A 4E7SA 2XAUA 1X1BA 2W48A 5B66C 3IWFA 4OINF 2ZO4A 3KEOA 3BJAA 1AOYA 5JLWA 4RGUA 4RA2A 3BZCA 1D8KA 3E97A 2OU2A 2CUZA 3PM1A 1S8NA 3GWZA 3CCEI 3VYUB 1HKTA 3DXJF 3EUKL 4CZZA 3GXOA 3ZMDA 2IW5A 4M3BA 4E70A 3CCUI 2DQRA 2YUSA 4BEHA 2XROA 3HKZN 1W5TA 2CV1A 1U9NA 3QPTA 4BH9A 3HOZJ 2MBFA 4ZDPA 2ZBKA 3DEUA 4YRVA 1GV2A 2ZSHB 4UVAA 4O6JA 2HOAA 5CVVA 5IP7J 2K9MA 4A3GJ 4PUSA 1BL0A 5BPIA 1YFHA 1KZHA 1FOKA 2W57A 5J6XA 5EJCA 3I5UA 2YX7A 3K2ZA 3OL4A 1SD4A 3RTRA 1VQOI 1KA8A 3HHHA 1ENHA 2L7FP 1U9OA 4XLPF 2IS4A 2LF7A 1BC7C 1P7IA 2DK8A 1HW5A 2X48A 2AHQA 2LD5A 2L3DA 3D1NI 2ZMEA 5DD8A 4UUSA 2ZXHA 1X1CA 5ILVA 2W85A 3RI4A 2ESNA 1IV6A 1WJCA 4BE0A 2D1HA 2ESHA 2ZJPF 3TOAA 1BC8C 3F0CA 4KNYA 3S1NJ 1KQ8A 3PIOF 4B8XA 1YRNB 2HYFA 2L9NA 2EIJH 5DM6F 1S7EA 2KQRA 3HBLA 2NXNB 3A1YA 3S3OA 2A05A 4ZDOA 1WGXA 3MQ0A 4EMSA 2E1MB 2F2EA 4I0AA 1S29A 1D1CA 3WGGA 3MCZA 3U21A 3GFMA 4NC8A 2B9SA 3HZJA 4ZJZA 4ZTJA 4ZYEA 3W3CA 3M8FA 4MFDA 3IKTA 5A2QK 4KICA 2XF7A 1LPQA 2XAHA 4CGZA 1FPQA 4U0VA 2GXBA 2A6HF 5KAFC 4X0GA 1K4TA 2M2EA 1R5ID 1I6XA 3BROA 4I01A 5B1BH 2LYCA 3EPZA 2QZ8A 3C7JA 3MMYB 2IAIA 2L4AA 1Z05A 2VLAA 5M5YJ 1Z0XA 2V1UA 2K27A 3PJRA 2KRCA 2HWVA 1HA8A 5J8CA 4EJWA 1JHFA 3FKIJ 3C18A 1ZG1A 4QPOA 3U1DA 3WE2A 5JFRA 2OJED 3Q0UA 4CYCB 1EF4A 1U2WA 1X3WB 4UVBA 1HOMA 1IXCA 1GDTA 3DPUA 2PMZN 2VJJA 4EGZA 1KONA 4NDLA 2XHKA 1ZN2A 5LEKA 3ONQA 1HBXG 2NVTJ 3WG9A 5E20A 2KIFA 5CQGA 1PYVA 1IUFA 3IH3A 3ZN0A 2A61A 2RDPA 1DP7P 2WY7Q 2DJIA 4KYWA 5FLMJ 2KRFA 2HPIA 1IN7A 4CDGA 2ECCA 2EWNA 1YHQI 3WU0A 3NWSA 3J7YJ 4YIRX 1W5SA 5CQEA 1MBJA 2BGCA 2L02A 3ZQFA 5A2QZ 2R7SA 3NEUA 2ZKZA 1MBGA 4M3GA 1H9GA 4M3FA 2PBIA 1VQNI 2LBFA 1X2NA 3H9QA 4O5VA 1FP1D 3V8LA 2P81A 3GLLA 2STTA 3OYEA 2DJNA 2HGCA 5FGMA 4CHUA 1QVUA 1KYWA 2KIMA 4XLHA 2XF6A 5DV5A 1Z7UA 2F48A 1IGNA 4XKWA 1MBKA 3PUFA 1SMTA 3K4LA 4FX4A 5F04A 2F4OB 4RAGA 2IVMA 4H0EA 3H5NA 2DXIA 1V5FA 3D5SC 1MH4A 2V1NA 2R7DA 3CMEI 3G4SI 3LQRA 4R79A 3KZZA 3V42A 2OCEA 1ETYA 1FBUA 2F4MB 3JREA 1MJ9A 1XS9A 2DMTA 4JYKA 2WAQN 2I8DA 3W6VA 4ENNA 1Z9CA 2P7VB 3CD6I 4XOPA 4CCOA 3OS2A 1JT6A 1YYVA 3U9GA 1MMGA 2QYOA 3K4CA 1OYIA 5E18F 3BR0A 1Q1VA 1W7PB 5LEJA 3R4KA 4YIFA 4I6ZA 2Z99A 2XC7A 2K85A 3ZGKA 1A04A 4A69C 2M8EA 2PFBA 1ETQA 4DW6A 1DQUA 2V26A 4X1EA 1QGPA 2VPLA 4UV8A 3QU3A 2E34A 3G1MA 4G9YA 4X6AJ 3CUOA 1F36A 2FJ1A 3QU6A 1C0WA 2OF7A 3G3ZA 2H27A 3OR1C 2G9WA 3COAC 2CV0A 1ZLKA 4D0PA 4AIKA 2X6YA 3BJ6A 2HNHA 4NQWA 4FHTA 5L3GA 5HDGA 2NVYJ 2EQRA 3J7AO 2K4BA 1O3TA 2IP2A 3OIOA 3KIOA 5K1YA 2E1NA 2E19A 4KFCA 2A3SA 2QLZA 4HZFA 1WVRA 1IC8A 2WB1A 3TQNA 1OYYA 1OJLA 1S9HA 1XSVA 2L7ZA 5D6FA 3OYDA 3HOXJ 2JQ7A 3ZMZA 2JTVA 4XLNF 4RB1A 3WTUC 1KU9A 1RR8C 3HSEA 2FBKA 3FK7A 4RGRA 1D0ZA 3GLXA 2VASA 2LREA 1MBFA 2EILH 1OCCH 2PJRA 3HUGA 5BMZA 3LSRA 5HVQC 3CESA 4DIQA 1IRXA 2WAFA 3ZP5A 2L01A 3M3YJ 5CLSA 4ZYAA 1GT0C 2DI3A 4ZDLA 3EYIA 4NC6A 1J09A 1IXRC 4XL9A 4NBQA 4A0XA 3FZVA 1U8RA 1W0UA 4GYGA 4HSTA 4RB0A 2XAQA 1W0TA 4HF1A 3EUHC 4DQ2A 2DMNA 4ASNA 1X1DA 3BG7A 5FKMA 1D1AA 2W25A 1YQAA 4CXFA 4KMFA 1I5ZA 4B3AA 5LFAA 2G7HA 2YR2A 3A0BC 2V9VA 3CCYA 5GTHC 4S05A 1Y1WJ 3J7AY 2QVOA 1YE9A 5CVIA 5D5UB 2M34A 1FMVA 2M7BA 1ZLJA 1TWHJ 3C2BA 4AYBN 1ZTRA 2QGUA 4QPQA 5K7ZA 2L0KA 4IHTA 1WH7A 3HPGA 5LGNA 2Q0OA 5HNHA 1FJLA 3SYTA 1D3YA 3KETA 1QNTA 4G8XA 2RC4A 3CJTB 4UB8C 3ZMTA 4BDZA 3H3UA 2HEOA 4ZYDA 5HS7A 4L0ZB 4E7IA 2JA2A 2K3FA 3HPHA 4M6YA 2QA4I 1K7AA 1O3RA 3VOEA 1SC7A 1VQ4I 2MLKA 5C4XJ 4ABZA 5EGOB 3V7CA 3KP5A 2FF4A 3KLOA 1U78A 1FZPB 1R1VA 1Y56A 4I0BA 3FIWA 3FKJA 4XRMA 2CFOA 4L5EA 2IBDA 1NTCA 1B59A 5KHDA 1E3PA 3O8GA 4XK4A 2DAOA 2EIKH 2NS7A 4XIDA 5LD2C 4U88A 3BTLA 2VC0A 4U0WA 2GZWA 1LVAA 2E60A 2COBA 1QZYA 4XMYA 2ETHA 2ELKA 5L3EA 1QPIA 4OU0A 1LVKA 4KN7X 4DGWB 2UXXA 3E6MA 2CJJA 1N77A 1LE8B 2LKXA 2YSRA 3U2RA 3GTKJ 5IP9J 5HOOA 4A3IJ 4Q4ZF 1S6LA 2IA2A 2R7WA 2BV6A 2MABA 4OIPF 2VBXA 1K83J 3I4MJ 3HGGA 5B5EC 1ON2A 1DGWY 2M45A 1XDSA 2ZSIB 5F0CA 3FXJA 2D5VA 1IN6A 3M7GA 3ERMA 2HVSA 2NYXA 1ON1A 2KFDA 2DYRH 2LMDA 1OCPA 3CC7I 3NRVA 3H5RA 1X1AA 4Y3OA 2M9HA 2BVLA 4GRIA 1SD7A 4A5MA 3LA2A 2X0LA 1V4RA 2MFZA 2E1MC 3F3XA 2HDCA 1GUUA 3H0GJ 4XLFA 1P4AA 3S1RJ 3RZOJ 3WU1B 4BY7J 2Q1ZB 1TQPA 2OBPA 3EETA 2WC2A 5D4RA 3S3NA 5FO5A 4D7NA 2R4GA 3ERED 2IGNA 5E3OA 4PGGA 2IS2A 2OZ6A 1J5YA 1TP4A 2BHZA 2WV1A 4XN3A 2RN7A 2VPRA 3KP6A 3GTGJ 2L5QA 2VXDA 3HOTA 3CMAI 1Q1HA 4A93J 4OIOF 4IQ4A 4AIJA 2H1LA 3FXQA 5BPDA 3BTCA 4EM1A 3UKGA 1HXDA 2LR8A 3GBGA 4P96A 3DKYA 3BDDA 2HZDA 3IH2A 3T1BA 3MKZA 1HKSA 3RZDJ 2HDDA 3GTLJ 3DLLF 1UG0A 2QQBA 3OV8A 4BJ5C 5F6FA 2DMPA 5DEQA 3PIPF 4IEJA 1VZ0A 3WTTC 4RMNA 4LG0B 4F91B 2QQAA 4IHXA 2BVMA 2H6BA 3E7LA 2J5OA 4MQ9F 2RNJA 1RKWA 5HNFA 2VJ4A 2K7LA 2VKEA 2Y2ZA 2KDOA 5J4VA 5HLHA 2EZHA 5FKOA 4RGXA 1VQPI 3F8FA 2X85A 4EJOA 1X3ZB 2R5YB 3BR3A 3F6OA 1J75A 1ACIA 3D0SA 3H1CA 5K7HA 4CA0A 2LC2A 3L2UA 5E8IA 3L2QA 3OR2C 2F5CA 2GM4A 2GA2A 4XICA 5GAEJ 2RV8A 3ASNH 1N25A 1Z6TA 2DDBA 3HSFA 4YG2F 4MEXF 4BU2A 4M73A 4AIDA 1FOXA 2O5RA 1ZREA 5JVTA 5CVUA 4ENMA 3H5AA 5K5QA 1TC3C 1PP7U 1D0YA 3HYIA 5DD4A 2X1DA 1RKTA 4LD5A 1QU3A 4IPAA 3SDGA 4L9TA 1T56A 3TO9A 1ZG5A 1XCVA 2MC3A 1R9TJ 1MBEA 4WCGA 3A01B 1FYKA 1UB9A 2QENA 2FMLA 2P7CB 1ZARA 4B09A 1ZELA 1YX5A 1AKHA 1ETXA 2QKLB 1P2FA 2GA1A 2O0YA 5CVRA 3S17J 3VYTB 4UV9A 5EEGA 2XRNA 1XDUA 2B0LA 1SFUA 2DTZA 1S7AA 2JUGA 2M4KA 4ESFA 2FEZA 5ILSA 3QPSA 2ZXWH 3RDIA 1FYLA 2O8XA 5FRNA 2Q8KA 4XLEA 2H1KA 2GQQA 3HTUA 3TDZC 1OCOH 2OTJI 3TGNA 2EV0A 3Q0WA 3DKWA 2R7UA 3SEQA 3O2PE 1TWGJ 1FIPA 4ZZLA 3FXUA 3L00A 1XMAA 2VT3A 4PK4A 3D5LA 5EEAA 1IAWA 1G4DA 3LFUA 2PJPA 3LSHA 1ETWA 4WXCA 5DYMA 1W7PD 4MGRA 2LRDA 1FT9A 2NNYA 1SEUA 3LA7A 4CSWA 2R93J 4II2A 1JJ6C 1F43A 3VYSB 4HF0A 1PJRA 1TT0A 3I64A 2DU9A 3T8TA 3KLNA 3G1LA 5IYCJ 3LSPA 1AWCA 3TW6A 3K10A 5HODA 4E7HA 2R7OA 3AG2H 2PN6A 2CRGA 1BR1A 4BJTA 4XORA 3JRGA 1U5TB 1NG6A 5F64A 4QWQA 4B47A 4XKCA 5FFXA 2XGEA 3SZGA 1HQCA 3CMYA 3BOQA 1YTYA 1JKOC 3ZN1A 3WE3A 4EATA 3HC7A 1B8IA 5J8FA 4I2OA 4BEHB 5EG0B 3CCSI 1R5GA 3TO6A 3WG7H 4OWRB 5LHIA 2DOAA 4P9UA 1X3UA 2NS0A 2Z2SB 3DBLB 3Q9VA 2DDAA 3B6CA 4A5NA 2RQQA 1ZKGA 2HOEA 4KA4A 5JHFA 3I55I 4XR6A 3R61A 3WGIA 3RJPA 2XGDA 4FE7A 1REPC 2XGXA 4UNOA 2K9QA 4HG2A 5ICCA 2HZTA 1U6GA 2M87A 3RYPA 2FE3A 3GEZA 4ON0A 4A2UA 3M07A 1OCRH 4XKBA 1UFMA 2EV6A 4S04A 1MNDA 4M6VA 1WKMA 3G6EI 1QBJA 2W7NA 3AFHA 2CFXA 2YPRA 3D5RC 4I98B 1BR2A 1ITYA 3OYNA 4XKVA 3SFIA 3PFIA 3DQVC 3JAMZ 1EA3A 1O4XA 3ZOBA 2WBMA 4YEJA 5BS6A 2R5ZA 3WTSC 4MFEA 4Y33A 3I54A 4JQFA 3R6SA 3PL8A 1OQYA 3HXLA 4MLOA 3B02A 3TP3A 3EUHA 4OOIA 1YLFA 2ACJA 1T0FA 3DTIA 2DA4A 1TBXA 4PFPA 1A6IA 5FD5A 2UXNA 3I59A 3K4KA 2EFNA 4DYQA 3OYBA 4IOAF 1DPRA 3ZQHA 5IT9Z 3SXYA 1JE8A 4A6EA 5GTIC 1WJ5A 3OYFA 2GAUA 2WAEA 4L9NA 1H0MA 4AVZA 1VQMI 2F4IA 3BCBA 3RSNA 3VWBA 3VODA 3ABMH 2ZNZA 4S0HB 5CPRB 2I5UA 1T38A 1POGA 4HQEA 3JSPA 4A12A 3CF2A 3HDDA 3ZQGA 3RPUA 2TDXA 3GW2A 5E1ZB 1STZA 1WCMJ 3FBNB 2EZIA 3L2CA 1SVLA 3P9CA 1XMKA 4F92B 5M3FJ 4XRFA 1F5TA 4RAFA 3IC7A 1T98A 5ERIA 3QP6A 1E3HA 4AWXB 1IUYA 2K86A 3J7ZI 1SFEA 4XN0A 1KQ0A 1BR4A 3JTHA 1V3FA 3E6DA 3ZQCA 4L0YB 3TBIA 3DF8A 2OTLI 2WWYA 2A68F 2XDVA 1B72A 1FX7A 2A6EF 3AG4H 1NK2P 3GZ6A 4ESBA 3CDLA 1E2XA 1TWFJ 4IHSA 3E0JB 1V55H 4L18B 1Z7LA 3CP2A 3ABLH 2ISYA 2P6SA 4PZJA 5CJ9A 1GLNA 4R1HA 1E17A 3I58A 5DCFA 3DBHB 2F5FA 2IXSA 3WTWC 3CC2I 2ZJ2A 2LKPA 2QKMB 3BR6A 3MWMA 1HKQA 4OIRF 2JA6J 4Z2YA 2F5EA 2Y0MA 1YS7A 2LOOA 3SEZA 3N05A 4A3CJ 3HOYJ 1OR7C 2CWEA 2FBIA 3AG3H 1B9NA 4BUPA 2BY3A 4NC7A 2CQKA 5KK1A 5J1UA 3RQ4A 4RBOA 2C6YA 2A5WA 5IYBJ 2BY0A 2IA1A 1Y8RB 1R4NB 1U8BA 2NVUB 1R71A 3F8CA 3F21A 5TGTA 2V79A 1FOWA 2RAEA 3QAHA 3RCOA 2FOKA 3JTGA 4TV7A 2MW8A 4D1QA 1ZYRF 4BDYA 1IO2A 3HEFA 1PUFA 3MAJA 1A31A 4BE1A 5E8GA 2HVRA 2VIXA 1PDNC 3F8NA 4ANJA 1JUPA 2XB0X 5KNLA 2DTRA 1HSJA 1PVEA 5K7FA 4B44A 2CV2A 1LUJB 4CUGA 3QYBA 1R5HA 2JRMA 4KISA 3J81Z 5H20A 3PQKA 4PSWA 2NNNA 4NUBA 3Q5FA 1DU0A 5FRMA 4GFBA 1PUEE 4IJAA 2BE5F 1XSXA 3HOUJ 2GLOA 2MG4A 3ZMVA 4FTHA 2UZKA 2AO9A 3Q0VA 4I02A 2R7VA 4D5FA 3QRFF 4BQOA 2L9RA 1QZEA 2W1OA 3BPVA 3ML6A 2M7AA 2BXZA 2ME0A 3S15J 2OV7A 3MVPA 1CF7A 4OIQF 3H36A 1DPUA 2G7UA 4C2TA 3VEPA 1S5LC 3IHUA 1MDMB 1KQ9A 4II3A 4NQWB 3BR1A 3PFYA 3JRDA 2KIQA 2VJ5A 1DGRM 1WHUA 3S8PA 5DUKA 3ABUA 4YELA 3SDBA 3FXKA 2GOXB 4E7JA 2ZFWA 3V7RA 2M30A 5LRRA 5EZGA 2LNBA 4A3KJ 1VQ9I 1T39A 1ZG3A 1HDDC 3V8KA 4M71A 1ZGJA 2IA0A 5D5VB 1WWXA 1DU6A 1RUNA 3SQNA 3C2HA 2ZNYA 3JRIA 4WXDA 3CLQA 2HOSA 2ZXJA 1BIAA 3W6KB 2IRFG 1WPKA 1FEXA 3WU2C 2QSGX 1IN4A 3HUGB 1R58A 3CCLI 5E3MA 1XGOA 4MEYF 2HQAA 2NOJB 5E3NA 3V7SA 1I27A 4KJZA 1VQ5I 2EK5A 3K9TA 4HYEA 1FTZA 2IPQX 1Z6RA 4L5JA 3CF5F 1LB2A 3E1SA 3ZMUA 4CCLA 2P5VA 2PMUA 4BBSJ 3BTJA 2FSWA 2UUZA 3S2DJ 4OAYA 2JPCA 2HQNA 2X1CA 2YX4A 4IXAA 3V8JA 5FLVA 4M6XA 4M3DA 2KZGA 1MJAA 4QTRA 1UCRA 2P4WA 3QPHA 1XGMA 2PLYA 1BI0A 4N0BA 1GHCA 3ZQIA 2LFBA 5FB2A 3E5UA 2X9DA 1VF9A 3TKYA 2JSCA 4KT5C 3A0HC 1BI2A 1R4MB 4L9VA 2P5LC 4BXXJ 4BHCA 4BQAA 4HA8A 3RKWA 2JVGA 3LOCA 3H3VK 1BM9A 2D2WA 1ZRFA 1ODDA 3ECHA 1OCZH 2DOFA 4XLAA 3E6BA 3LWFA 4RS8A 2YU9J 1JUSA 4HX8A 1JGGA 3AL0B 3G71I 1HC8A 1IJWC 2EZLA 4BS9A 1W36C 4YFKF 1U5TC 1MW7A 2X6XA 3CUQB 4RM3A 1W7PA 4LK0F 2WV0A 3O6BB 1P9QC 3R0AA 3GVAA 1T08B 2PQ8A 2ZC2A 3FWEA 3N97A 3PSFA 4EVIA 4HBLA 3J80Z 4Q5SF 1R1UA 3TP0A 1ETOA 3KEQA 5E1WA 1S72I 1XN7A 3JCUC 3S1QJ 3RKQA 4C30A 2ELHA 1ORKA 2V1XA 2VQHA 1G3YA 3F6VA 4BXFA 2HOTA 3RYRA 1UG2A 9ANTA 3DKXA 4KIBA 4L9JA 4UVCA 1BBYA 3PO2J 1BIBA 4LJZF 4HEA2 1W36D 2KHMA 2EBIA 2DO7A 1XC5A 1WI3A 1M1EB 1FMWA 2XRLA 4RB3C 2DODA 1I1GA 4UY8I 4HDUA 1P7JA 3I4NJ 4LG3A 1TWAJ 3HG9A 1SAXA 2HYJA 2Y0SA 3NQOA 3KZYA 1WI9A 1Z77A 2Y30A 1SFXA 2BHYA 1AA7A 3VSLA 1IN8A 1XX5A 4NNJA 3W6JB 5CVJA 3QYEA 4B43A 1GXQA 3EQLF 1KU3A 4KUMA 3L2WA 1OLTA 2VXZA 4CCMA 3R60A 1QO0D 3BCAA 1BI1A 4AC0A 1OMIA 2COMA 2OD5A 4AU7A 2H94A 3ZQLA 4EJTA 3K70D 3GZNB 2IS6A 4CCKA 4AVPA 4RGSA 1AHDP 3E5QA 4IX7A 2MC4A 3WTVC 3I53A 4M72A 2PEXA 1YOVB 1MSEC 4CCJA 1WJAA 4YFXF 2IGOA 4GXOA 5IPAA 1DP3A 1TW3A 1Z3XA 2XSDC 1UAAA 2PG4A 2NVXJ 2HR3A 1WSUA 3L7WA 4LK1F 4JBAA 4EJUA 4B3XA 1CQTA 5HS8A 4HLXA 4IHWA 5D8KB 2RVCA 4B4CA 4DZJA 2A07F 2JPBA 4Y17A 4HF2A 2BW3A 3BJOA 1NG7A 5IOYA 5IP6A 3K1PA 3AKZA 3H9JA 1R49A 5CYVA 4YIIA 2HDWA 3C3WA 2VT2A 4MIMA 2Y31A 3TW7A 3GF2A 2VUMJ 3LSIA 3QOPA 3HSRA 4BNCA 5HS9A 3BR2A 2KZVA 4HAMA 1XTAA 2VONA 4PSXA 3ZQ7A 3KP3A 1X4PA 2IGMA 1WJDA 2XB5A 4BGDA 4C2UA 3OYIA 4Q48A 3F23A 1WQ2A 2KLOA 4KIGA 3GUDA 1BW6A 5JVGF 2HQRA 4UXNA 2LH9A 2JA8J 2DPUA 3WHBA 4KDPA 5ICFA 3TO7A 3M1EA 3FISA 3BQYA 4I09A 4V19K 2XSJC 1TL8A 3Q3SA 3BG9A 1OISA 3EDPA 1KU2A 2K40A 4A3MJ 2YU3A 1GVDA 2XGCA 2KMUA 3EUAA 1S7OA 5M3MJ 1FC3A 2V6EA 3BPXA 1HW1A 1RZ4A 5GAHJ 1LE8A 3HB9A 4GDFA 1R00A 4XBFA 3FM5A 3QOEA 4GYIA 3RKXA 2MA3A 4E4HA 5J40A 2FOWA 3LSJA 1UZCA 3M4OJ 5TJJA 2M1BA 2E2IJ 2E71A 4MTDA 1A6QA 2CYYA 3GO5A 2DMQA 3VB2A 3DFGA 5DTDA 4M9ZA 4IKFA 2QSHX 4XONA 1UELB 4XRSA 1NH3A 3VSKA 2CUFA 3OIPA 4V2FA 1P4WA 1MZBA 3IAS2 3HOSA 1HDPA 4A3LJ 3LQQA 2WTEA 2GIZA 1R23A 1ETVA 2DMUA 2P8TA 5ILUA 2HKXA 4EGYA 2OAZA 2ELJA 1ZH5A 2P6TA 1WJFA 4CH7A 1R6RA 2X6OA 2ID6A 5KCMA 1OFCX 3LL7A 5FKKA 2LK2A 5IY5H 5AONA 1P4XA 3KYDB 5EEHA 4ZC3A 1Z67A 3E3VA 4U7BA 1I50J 2KDZA 1Y6IA 3ZRGA 2XPVA 4JX4A 3OYLA 1YJ9I 1RETA 3BG3A 1R36A 1FYMA 3CDHA 2DPDA 4MO7A 5JHUA 3BG5A 5DCMA 5EZHA 2XAJA 5B1AH 4BQNA 3ZR8X 3KPHA 5B3SH 3R0JA 1LFUP 2KJBA 3HRMA 1IDZA 1QPMA 5HDKA 4RDUA 3HRSA 3LSTA 2ME6A 1N78A 1UHSA 1XGSA 2LG4A 3IV5A 1WZ2A 4HRIA 1RNLA 2Z3YA 2DFFA 2H6CA 5DM7F 2Y9YA 4MNUA 3CJQB 2HVQA 1YX3A 3DBRB 1OR7A 2DFEA 1QRYA 3H92A 2X4HA 2EA2A 1X2MA 3HL2A 3TL4X 1AU7A 3REOA 1B1BA 2XKOA 4RLQA 1LKXA 3FHNA 2VL8A 1FBQA 2EFOA 5GP9A 2LSOA 1LEBA 2Z16A 5BNGA 2MD0A 4AD9A 3HRUA 1MSFC 5L3DA 3BC8A 3S93A 2PI0A 1I3QJ 1ZAOA 3UNGC 5BOXA 2JA7J 3CZ6A 2GIVA 2Q2EA 4CYDA 4IO9F 1A36A 1LFPA 4G6TB 4B1RA 4G7ZF 1USTA 1MMSA 3P9KA 4D7MA 3GYHX 5D4SA 5JR3A 1T33A 3L9FA 4GCVA 2CW8A 2R7FA 2L9SA 3C2GA 2KIUA 1TTYA 3OOPA 2BY1A 4JX6A 1QHGA 2M4GA 4FT8A 3W2WA 3DV8A 4C3IJ 5LGTA 2QCOA 1Y0UA 2MLGA 4LIVA 4Z6YA 2X1EA 2CH0A 3JRHA 3E5XA 4AIHA 2HXOA 1W5CC 3X2QH 4PJ0C 2VC1A 2ECBA 2ZCWA 1B8IB 2X51A 1YIOA 3HM5A 1XMXA 2QBYA 1IRGA 2LTPA 2DBBA 4N9IA 1OPCA 3JAMK 2Y48A 4W1UA 2KJCA 4JX5A 1H8AC 1HCRA 3SHFA 2NRAC 4WX9A 1WJBA 1YJNI 1IDYA 1HF0A 5ICGA 1MNEA 3B73A 3SFZA 1ZGWA 4P5OA 4HPQA 3CC4I 5FLXZ 2VKHA 2M0CA 2VN2A 3OIQA 3SJMA 3L1PA 1YW7A 1EV7A 2CQXA 2V4JC 4UHTA 1K78A 2L4MA 3BY6A 5GPAA 2P5KA 1P92A 4KN4X 4F55A 2CUJA 3AL0C 4M3EA 3PO3J 2WB1N 2LLKA 2GXGA 5IT9K 5KAIC 1OKRA 1LDJA 3I3LA 3CUQC 3E6CC 2DFIA 4GGGA 2VBWA 3MZ8A 3K6GA 3PNVA 3A2KA 2E7WA 2QSFX 4KITB 5ICEA 1JGSA 2R5ZB 3FXOA 1VFCA 3NAUA 2R0QC 2CQQA 2LKSA 4D5CA 2G0EA 3ASOH 2QUFA 3FMQA 2PMHA 1YO5C 2BBYA 4OMZA 2EIMH 1K4SA 3DLAA 3OWTA 1K79A 2BEOA 3IH4A 3OYJA 1W4MA 2CUEA 1WRJA 1ZRDA 1ZRCA 2A69F 3C1DA 2FNPA 1HSTA 2LF8A 2VE9A 1O3QA 3I59B 2GWRA 2KPMA 4RLFA 3DP7A 2BXYA 1FOYA 5F1JA 2AXTC 3S2WA 1Y8QB 3FXMA 1A5JA 4BXUA 3AAFA 4LLNA 2OUMA 4KIFA 3T0YA 1YI2I 2ZMEB 3QWLA 1BJZA 2DCEA 4LLGF 4CO8A 4UUSB 1LQ1A 2Z1DA 3U1KA 5D8LB 1QVTA 2JT1A 3Q9SA 1D5VA 4HV6A 3PQJA 1Z3YA 3BT9A 2AQEA 1JKQC 1U5TA 4JP0A 1O7FA 4F3QA 4RB2C 3GFLA 4FCYA 2HQ5A 5HLIA 3HRTA 2XAFA 1I3AA 4ZYGA 1TNSA 5D5XB 3LSGA 5J1YA 1H88C 4IF4A 4ZH4F 2WADA 2Y0SN 2VJIA 3KCCA 4P55A 3OYHA 2AS5F 4G6DA 4A6DA 1ETKA 1L0OC 2DA2A 2QQ9A 3LAPA 1TW2A 2EH3A 5EG0A 4IZZA 3I71A 1FSHA 3RPQA 4IHYA 1RESA 3BG6A 2W00A 3BZKA 5D5WB 3MEXA 4XNFA 2ZFUA 1MD0A 3ESWB 2K5CA 2JVHA 4ITVA 1B72B 3JRBA 1JT0A 3BQZA 4DJAA 2PX9A 1GVJA 1U0JA 4HNVA 1SVMA 5E79C 3OYKA 3CTAA 2KRHA 3ZCOA 2STWA 1EH7A 4Y7NJ 3BP8A 2JK3A 4WXHA 5TRDA 3FXRA 5CKTA 3QYFA 4A3BJ 4BE2A 1J2XA 1H89C 2EZKA 3F22A 4Y4RA 1SMYF 1W1WE 3ECOA 3WODF 2O7OA 3I9V2 3LSKA 2JUCA 4U7DA 3RIRA 1FNNA 1EKEA 3KE2A 3BZ6A 4FASD 2GOMA 1I39A 4V2GA 4MQVA 1XSDA 1YIJI 1JUMA 3J81K 2R7TA 4UUVA 1YS6A 2FXAA 2CQ7A 5J1RA 3TDUC 2ID3A 1S3JA 5FJ8J 3K4MA 1V54H 4EM2A 3G73A 3MD2A 3CCRI 2EA4A 4HW0A 3WTZA 2CO5A 3S14J 1UHWA 3NARA 4C9YA 3FM3A 1ZK8A 3L2VA 1PUFB 2MSYA 3CCQI 1ZHFA 2IEKA 3QQAA 4LB6B 3QODA 3I0TA 4CCNA 3IP4B 3K0LA 2E2JJ 1DDNA 2VB6A 5GAGJ 2XASA 3OS1A 2E35A 4HLYA 2TCTA 3S16J 2Z5UA 2E5ZA 2DT6A 1N75A 2DA6A 4MHGA 3OYGA 3FMSA 2M5WA 4HQMA 2MD5A 4N9HA 5FFZA 5EF6A 3A03A 5E3LA 1RIOH 3K2AA 4IVNA 2EJRA 2LBFB 1SFOJ 4U0YA 2FA5A 1YRNA 1RI7A 4EEFG 1H9TA 2DA5A 2DFHA 3JRCA 4PCQA 3FMRA 4MTEA 5F0HA 4WK8F 5H6RA 2MH2A 3DTEA 2VQLA 1RC9A 2LP0A 1EH6A 1CF7B 1QQIA 5C4JJ 1R22A 1IW7F 2VI6A 2R92J 1BI3A 3HHGA 3HOVJ 4XQFA 2H8WA 2F5DA 2VKVA 4HNTA 2VE8A 4U87A 1FTTA 1LDDA 1BJAA 3OSFA 1VI0A 2CMPA 4AM3A 2L54A 1RRJA 2RREA 3MZYA 4PDKA 4G94A 1ULYA 2K9NA 2XUBA 1JJ8C 3CCMI 1IRZA 4WF2A 1BN5A 1JI8A 2XVCA 3DU5A 3VYRB 2LY9A 1J9IA 1TNTA 2VBYA 5J3LA 2EINH 1OCTC 2M8GX 5JLXA 4CYCA 2MH9A 4G7HF 1WFXA 5EYRA 3PNYA 3FK6A 3ZQQA 4PJJA 1FLIA 3H9GA 2DA7A 4LOCA 3MKLA 3CDIA 3F72A 3NWTA 4A3DJ 3BWGA 5TISC 4I7HA 2UV1A 4G7OF 4DZPA 5AIPA 2DOEA 2XV4S 2HYGD 3CMMA 2D1VA 2OA4A 4QLCU 1Y39A 4D9JA 2BYVE 1MIJA 3LMMA 2J5PA 3QPLA 3J80K 3IUOA 2P0WA 3S1MJ 3K1MA 2EFQA 4A0ZA 4IRIA 1IN5A 2FRHA 1VNDA 3BTIA 2DLLA 2VBZA 3G2BA 2HFHA 3GTQJ 1TWCJ 1WH5A 3CCVI 1MH3A 4BQQA 2HXIA 4ETSA 2FX0A 3PNTA 3CP8A 2V9PA 4UB6C 4XSXF 5FKLA 1D0XA 2PJRB 5GPCA 4FX0A 5L3FA 2RQPA 1GV5A 4C2MJ 1OYWA 3N4MA 5DDGA 2V9KA 2D45A 2NOGA 1MNMC 1G3SA 2OCCH 3GMEA 4BBRJ 1R7JA 1SD5A 1V5EA 3OYMA 1NHAA 1B9MA 5LRSA 4LLLA 4LGWA 4LIUA 2ZXIA 2EFPA 2E36A 2EB7A 2DT7B 2LY2A 2FQ3A 3L2RA 4Y15A 5HLGA 2CGPA 2LDUA 4A0YA 1MDMA 2RKHA 5C3EJ 3GTOJ 5J47A 5C44J 5KVRA 3S3MA 5LBQA 3A02A 3QP5A 4DBRA 3OSGA 1BW5A 2O9LA 4I99C 3LNQA 3HJEA 2AQFA 2F5VA 3JR9A 4E7KA 3CO7C 1SFKA 4Q47A 1APLC 2QF7A 4XRSG 5J4YA 1ZQ3P 1GXPA 2JA5J 4BKXA 1K6OA 2FQ4A 4BAYA 3CLOA 5L3CA 2VKDA 1SANA 4DYRA 4PJLA 1X4OA 1V5GA 3EYYA 2DT5A 2VODA 2H8RA 4QIWN 4IRGA 2F6CA 4M9XA 3FF5A
chains in the Genus database with same CATH topology
2PMZN 4NDLA 3B6CA 3HOWJ 1ZKGA 2X6OA 2ID6A 2NVTJ 1OFCX 5FKKA 2LK2A 2XPUA 2XGDA 4FE7A 2K9QA 1IUFA 3IH3A 1ZR2A 1I50J 2KDZA 5FLMJ 1JTYA 2XPVA 4JX4A 1E3OC 1RETA 3BG3A 4M6VA 1JKPC 4MO7A 2ECCA 3BG5A 5EZHA 1ITYA 2DA1A 1MBJA 3ZQFA 1LFUP 3SFIA 1IDZA 2E2HJ 5EDNA 1O4XA 3ZOBA 2ME6A 4DYCA 4RDUA 1MBGA 1UHSA 4M3GA 3IV5A 4M3FA 2R5ZA 4MFEA 1X2NA 2Y9YA 2P81A 4MLOA 2CU7A 1QRYA 2DJNA 1X2MA 3TP3A 1QVUA 1AU7A 4QSHA 1IGNA 1MBKA 2DA4A 4A3FJ 1A6IA 5F04A 5GP9A 3S2HJ 4DYQA 3GTPJ 3HGYA 5BNGA 1MH4A 3ZQHA 1MSFC 1I3QJ 2JA7J 1ETYA 3JREA 4B1RA 1XS9A 2DMTA 4JYKA 2WAQN 1IG7A 1MBHA 3W6VA 4S0HB 4D7MA 1FIAA 1JT6A 1T33A 1POGA 3MN2A 3BR0A 3HDDA 1Q1VA 3B6AA 3ZQGA 4JX6A 4C3IJ 4I6ZA 4Y52J 2QCOA 1WCMJ 5EGOA 2EZIA 4A69C 2FD5A 5M5WJ 1ETQA 4DW6A 4X1EA 2NS8A 3JRHA 3G1MA 4X6AJ 2HXOA 5M3FJ 1F36A 2FJ1A 3GTJJ 2OF7A 2R7ZJ 2ECBA 1B8IB 3WHCA 2JN6A 3HM5A 1RPWA 2LTPA 2HI3A 2NVYJ 2EQRA 4W1UA 4JX5A 1H8AC 3ZQCA 1HCRA 3OIOA 2JWTA 4FE4A 2E19A 1IDYA 1HF0A 1G2HA 1B72A 1ZGWA 1IC8A 2L7ZA 1OJLA 3HOXJ 1JKRC 1NK2P 3CDLA 1TWFJ 2M0CA 4A3JJ 3SJMA 3L1PA 2CQXA 2JMWA 5GPAA 3FK7A 3BR5A 1MBFA 4M3EA 3PO3J 2WB1N 2LLKA 3GTMJ 1X58A 3LSRA 1JTXA 3BR6A 2TRTA 3M3YJ 2JA6J 2LVSA 4A3CJ 1GT0C 3HOYJ 4UUTA 2R5ZB 1VFCA 3NAUA 2R0QC 1W0UA 2CQQA 5J1UA 4D5CA 2G0EA 1W0TA 4I76A 4RBOA 5IYBJ 2DMNA 2NVQJ 5FKMA 1U8BA 1AKHB 4B3AA 2DA3A 3IH4A 3CCYA 2RAEA 3OOUA 1Y1WJ 1UMQA 2CUEA 2MW8A 3HEFA 2M34A 4G12A 1PUFA 1TWHJ 3C2BA 4AYBN 1ZTRA 3CQZJ 5K7ZA 2K9SA 5F1JA 2L0KA 2XPWA 1JUPA 2XB0X 4FISA 1WH7A 5K7FA 1A5JA 4J19A 1FJLA 2GBYA 4IHVA 1BJZA 5DS9A 4UUSB 1DU0A 4GFBA 1QVTA 2JJ7A 1XG1A 2DN0A 3BT9A 3HOUJ 1JKQC 2GLOA 2MG4A 4JP0A 4FTHA 5C4XJ 2AO9A 4ABZA 5EGOB 3Q0VA 4FCYA 2HQ5A 3JRAA 1U78A 4C3JJ 4D5FA 2L9RA 3FIWA 5F0FA 1RR7A 3LSGA 5J1YA 4XRMA 4L5EA 1H88C 2IBDA 3JRFA 2Y0SN 2ME0A 1NTCA 3G1OA 3S15J 3O8GA 1ETKA 3MVPA 4XK4A 4XIDA 2NS7A 2DA2A 2EH3A 5EG0A 3BTLA 4IHYA 1NK3P 1RESA 2B63J 2COBA 3K7AJ 2ELKA 3BR1A 1QPIA 3JRDA 2R5YA 2CJJA 1B72B 3JRBA 1JT0A 1LE8B 2LKXA 3BQZA 3DCFA 3GTKJ 5IP9J 5EZGA 4A3KJ 4HNVA 1HDDC 4A3IJ 1DU6A 4Y7NJ 2JK3A 3JRIA 1K83J 2HOSA 1HLVA 3I4MJ 3HGGA 4A3BJ 1WPKA 2O8KA 1FEXA 5F0CA 5IOZA 2N8GA 4A3EJ 1H89C 2EZKA 2D5VA 5E3MA 2O7OA 5E3NA 4W97A 5F08A 1FTZA 1OCPA 4V2GA 2ZB9A 1I6HJ 3A01A 4BBSJ 1JUMA 2M9HA 3BTJA 3S2DJ 5FLVA 5F27A 5J1RA 2ID3A 1GUUA 4M3DA 3H0GJ 5FJ8J 4QTRA 3S1RJ 3RZOJ 1K61A 4BY7J 3ZQIA 2LFBA 4D7NA 3S14J 2X9DA 3NARA 1VF9A 5E3OA 1ZK8A 1PUFB 4BY1J 2MSYA 4BXXJ 2WV1A 5M5XJ 2IEKA 2KT0A 3QQAA 2VPRA 3LOCA 3O8HA 3H3VK 3GTGJ 4A93J 1D5YA 1LFBA 2E2JJ 3TEDA 2YU9J 1JUSA 3BTCA 3UKGA 1JGGA 2TCTA 3GBGA 2LR8A 1IJWC 3S16J 2EZLA 2DA6A 4AUXA 1Y1VJ 3IH2A 5EF6A 3GTLJ 3A03A 5E3LA 3RZDJ 2HDDA 3K2AA 3RQIA 3DEWA 1SFOJ 2MGQA 2L7MP 1YRNA 4EEFG 3TP0A 2DMPA 1ETOA 2DA5A 2Y9ZA 4IEJA 3JRCA 5FKNA 3S1QJ 5F0HA 3RKQA 4IHXA 1ORKA 2LP0A 3E7LA 4C3HJ 2HOTA 1UG2A 9ANTA 1RKWA 3VPRA 2VKEA 5C4JJ 2Y2ZA 3PO2J 2VI6A 2R92J 3HOVJ 2EBIA 2VKVA 5IYDJ 2EZHA 5FKOA 1XC5A 1FTTA 1WI3A 1BA5A 2XRLA 2I10A 3OSFA 1VI0A 2R5YB 1P7JA 2YS9A 3BR3A 3I4NJ 1TWAJ 2E1OA 2HYJA 5K7HA 2OPTA 1ZR4A 2K9NA 2W48A 1JJ8C 1Z77A 2Y30A 2GM4A 4XICA 1IRZA 5JLWA 2LY9A 3PM1A 5J3LA 1OCTC 2M8GX 1TC3C 5JLXA 4CYCA 1RKTA 4M3BA 5EYRA 3FK6A 3SDGA 2YUSA 4AC0A 1T56A 2DA7A 4LOCA 3HKZN 3MKLA 3ZQLA 4A3DJ 1U9NA 1R9TJ 1MBEA 3A01B 3HOZJ 4DZPA 1GV2A 1AHDP 2HOAA 4A3GJ 5IP7J 1BL0A 1MSEC 1AKHA 1ETXA 3QPLA 5IPAA 3S1MJ 2XSDC 3S17J 1VNDA 3BTIA 2NVXJ 3GTQJ 1TWCJ 1WH5A 1MH3A 2HXIA 2FX0A 1ENHA 2L7FP 2DTZA 1U9OA 1CQTA 5FKLA 4IHWA 3QPSA 5GPCA 1P7IA 2X48A 4B4CA 4DZJA 2AHQA 2LD5A 1GV5A 3D1NI 4C2MJ 5IOYA 5IP6A 2H1KA 4UUSA 4MIMA 2Y31A 3TW7A 1IV6A 2NOGA 3Q0WA 2VUMJ 1MNMC 1TWGJ 1FIPA 3BR2A 4BBRJ 3F0CA 3S1NJ 1YRNB 1S7EA 3HBLA 5EEAA 2XB5A 1WGXA 1ETWA 1BW6A 2JA8J 3WHBA 4MFDA 3FISA 3BQYA 2R93J 5C3EJ 3GTOJ 1JJ6C 5C44J 1F43A 3Q3SA 3BG9A 4A3MJ 3A02A 2K40A 1GVDA 2M2EA 2XGCA 5M3MJ 3G1LA 5IYCJ 3LSPA 3OSGA 2O9LA 1BW5A 1LE8A 3TW6A 3HB9A 5HODA 3LNQA 3JR9A 2IAIA 3LSJA 5M5YJ 2CRGA 1Z0XA 3M4OJ 2E2IJ 1APLC 2QF7A 4XRSG 2DMQA 3JRGA 1ZQ3P 5DTDA 4XRSA 2JA5J 4BKXA 3FKIJ 2XGEA 2FQ4A 1JKOC 3CMYA 2CUFA 4V2FA 1SANA 3Q0UA 4CYCB 1EF4A 4DYRA 1HDPA 4A3LJ 1B8IA 1HOMA 2H8RA 4QIWN 5EG0B 1ETVA 2DMUA 1GDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ N;  4NDL A;  3B6C A;  3HOW J;  1ZKG A;  2X6O A;  2ID6 A;  2NVT J;  1OFC X;  5FKK A;  2LK2 A;  2XPU A;  2XGD A;  4FE7 A;  2K9Q A;  1IUF A;  3IH3 A;  1ZR2 A;  1I50 J;  2KDZ A;  5FLM J;  1JTY A;  2XPV A;  4JX4 A;  1E3O C;  1RET A;  3BG3 A;  4M6V A;  1JKP C;  4MO7 A;  2ECC A;  3BG5 A;  5EZH A;  1ITY A;  2DA1 A;  1MBJ A;  3ZQF A;  1LFU P;  3SFI A;  1IDZ A;  2E2H J;  5EDN A;  1O4X A;  3ZOB A;  2ME6 A;  4DYC A;  4RDU A;  1MBG A;  1UHS A;  4M3G A;  3IV5 A;  4M3F A;  2R5Z A;  4MFE A;  1X2N A;  2Y9Y A;  2P81 A;  4MLO A;  2CU7 A;  1QRY A;  2DJN A;  1X2M A;  3TP3 A;  1QVU A;  1AU7 A;  4QSH A;  1IGN A;  1MBK A;  2DA4 A;  4A3F J;  1A6I A;  5F04 A;  5GP9 A;  3S2H J;  4DYQ A;  3GTP J;  3HGY A;  5BNG A;  1MH4 A;  3ZQH A;  1MSF C;  1I3Q J;  2JA7 J;  1ETY A;  3JRE A;  4B1R A;  1XS9 A;  2DMT A;  4JYK A;  2WAQ N;  1IG7 A;  1MBH A;  3W6V A;  4S0H B;  4D7M A;  1FIA A;  1JT6 A;  1T33 A;  1POG A;  3MN2 A;  3BR0 A;  3HDD A;  1Q1V A;  3B6A A;  3ZQG A;  4JX6 A;  4C3I J;  4I6Z A;  4Y52 J;  2QCO A;  1WCM J;  5EGO A;  2EZI A;  4A69 C;  2FD5 A;  5M5W J;  1ETQ A;  4DW6 A;  4X1E A;  2NS8 A;  3JRH A;  3G1M A;  4X6A J;  2HXO A;  5M3F J;  1F36 A;  2FJ1 A;  3GTJ J;  2OF7 A;  2R7Z J;  2ECB A;  1B8I B;  3WHC A;  2JN6 A;  3HM5 A;  1RPW A;  2LTP A;  2HI3 A;  2NVY J;  2EQR A;  4W1U A;  4JX5 A;  1H8A C;  3ZQC A;  1HCR A;  3OIO A;  2JWT A;  4FE4 A;  2E19 A;  1IDY A;  1HF0 A;  1G2H A;  1B72 A;  1ZGW A;  1IC8 A;  2L7Z A;  1OJL A;  3HOX J;  1JKR C;  1NK2 P;  3CDL A;  1TWF J;  2M0C A;  4A3J J;  3SJM A;  3L1P A;  2CQX A;  2JMW A;  5GPA A;  3FK7 A;  3BR5 A;  1MBF A;  4M3E A;  3PO3 J;  2WB1 N;  2LLK A;  3GTM J;  1X58 A;  3LSR A;  1JTX A;  3BR6 A;  2TRT A;  3M3Y J;  2JA6 J;  2LVS A;  4A3C J;  1GT0 C;  3HOY J;  4UUT A;  2R5Z B;  1VFC A;  3NAU A;  2R0Q C;  1W0U A;  2CQQ A;  5J1U A;  4D5C A;  2G0E A;  1W0T A;  4I76 A;  4RBO A;  5IYB J;  2DMN A;  2NVQ J;  5FKM A;  1U8B A;  1AKH B;  4B3A A;  2DA3 A;  3IH4 A;  3CCY A;  2RAE A;  3OOU A;  1Y1W J;  1UMQ A;  2CUE A;  2MW8 A;  3HEF A;  2M34 A;  4G12 A;  1PUF A;  1TWH J;  3C2B A;  4AYB N;  1ZTR A;  3CQZ J;  5K7Z A;  2K9S A;  5F1J A;  2L0K A;  2XPW A;  1JUP A;  2XB0 X;  4FIS A;  1WH7 A;  5K7F A;  1A5J A;  4J19 A;  1FJL A;  2GBY A;  4IHV A;  1BJZ A;  5DS9 A;  4UUS B;  1DU0 A;  4GFB A;  1QVT A;  2JJ7 A;  1XG1 A;  2DN0 A;  3BT9 A;  3HOU J;  1JKQ C;  2GLO A;  2MG4 A;  4JP0 A;  4FTH A;  5C4X J;  2AO9 A;  4ABZ A;  5EGO B;  3Q0V A;  4FCY A;  2HQ5 A;  3JRA A;  1U78 A;  4C3J J;  4D5F A;  2L9R A;  3FIW A;  5F0F A;  1RR7 A;  3LSG A;  5J1Y A;  4XRM A;  4L5E A;  1H88 C;  2IBD A;  3JRF A;  2Y0S N;  2ME0 A;  1NTC A;  3G1O A;  3S15 J;  3O8G A;  1ETK A;  3MVP A;  4XK4 A;  4XID A;  2NS7 A;  2DA2 A;  2EH3 A;  5EG0 A;  3BTL A;  4IHY A;  1NK3 P;  1RES A;  2B63 J;  2COB A;  3K7A J;  2ELK A;  3BR1 A;  1QPI A;  3JRD A;  2R5Y A;  2CJJ A;  1B72 B;  3JRB A;  1JT0 A;  1LE8 B;  2LKX A;  3BQZ A;  3DCF A;  3GTK J;  5IP9 J;  5EZG A;  4A3K J;  4HNV A;  1HDD C;  4A3I J;  1DU6 A;  4Y7N J;  2JK3 A;  3JRI A;  1K83 J;  2HOS A;  1HLV A;  3I4M J;  3HGG A;  4A3B J;  1WPK A;  2O8K A;  1FEX A;  5F0C A;  5IOZ A;  2N8G A;  4A3E J;  1H89 C;  2EZK A;  2D5V A;  5E3M A;  2O7O A;  5E3N A;  4W97 A;  5F08 A;  1FTZ A;  1OCP A;  4V2G A;  2ZB9 A;  1I6H J;  3A01 A;  4BBS J;  1JUM A;  2M9H A;  3BTJ A;  3S2D J;  5FLV A;  5F27 A;  5J1R A;  2ID3 A;  1GUU A;  4M3D A;  3H0G J;  5FJ8 J;  4QTR A;  3S1R J;  3RZO J;  1K61 A;  4BY7 J;  3ZQI A;  2LFB A;  4D7N A;  3S14 J;  2X9D A;  3NAR A;  1VF9 A;  5E3O A;  1ZK8 A;  1PUF B;  4BY1 J;  2MSY A;  4BXX J;  2WV1 A;  5M5X J;  2IEK A;  2KT0 A;  3QQA A;  2VPR A;  3LOC A;  3O8H A;  3H3V K;  3GTG J;  4A93 J;  1D5Y A;  1LFB A;  2E2J J;  3TED A;  2YU9 J;  1JUS A;  3BTC A;  3UKG A;  1JGG A;  2TCT A;  3GBG A;  2LR8 A;  1IJW C;  3S16 J;  2EZL A;  2DA6 A;  4AUX A;  1Y1V J;  3IH2 A;  5EF6 A;  3GTL J;  3A03 A;  5E3L A;  3RZD J;  2HDD A;  3K2A A;  3RQI A;  3DEW A;  1SFO J;  2MGQ A;  2L7M P;  1YRN A;  4EEF G;  3TP0 A;  2DMP A;  1ETO A;  2DA5 A;  2Y9Z A;  4IEJ A;  3JRC A;  5FKN A;  3S1Q J;  5F0H A;  3RKQ A;  4IHX A;  1ORK A;  2LP0 A;  3E7L A;  4C3H J;  2HOT A;  1UG2 A;  9ANT A;  1RKW A;  3VPR A;  2VKE A;  5C4J J;  2Y2Z A;  3PO2 J;  2VI6 A;  2R92 J;  3HOV J;  2EBI A;  2VKV A;  5IYD J;  2EZH A;  5FKO A;  1XC5 A;  1FTT A;  1WI3 A;  1BA5 A;  2XRL A;  2I10 A;  3OSF A;  1VI0 A;  2R5Y B;  1P7J A;  2YS9 A;  3BR3 A;  3I4N J;  1TWA J;  2E1O A;  2HYJ A;  5K7H A;  2OPT A;  1ZR4 A;  2K9N A;  2W48 A;  1JJ8 C;  1Z77 A;  2Y30 A;  2GM4 A;  4XIC A;  1IRZ A;  5JLW A;  2LY9 A;  3PM1 A;  5J3L A;  1OCT C;  2M8G X;  1TC3 C;  5JLX A;  4CYC A;  1RKT A;  4M3B A;  5EYR A;  3FK6 A;  3SDG A;  2YUS A;  4AC0 A;  1T56 A;  2DA7 A;  4LOC A;  3HKZ N;  3MKL A;  3ZQL A;  4A3D J;  1U9N A;  1R9T J;  1MBE A;  3A01 B;  3HOZ J;  4DZP A;  1GV2 A;  1AHD P;  2HOA A;  4A3G J;  5IP7 J;  1BL0 A;  1MSE C;  1AKH A;  1ETX A;  3QPL A;  5IPA A;  3S1M J;  2XSD C;  3S17 J;  1VND A;  3BTI A;  2NVX J;  3GTQ J;  1TWC J;  1WH5 A;  1MH3 A;  2HXI A;  2FX0 A;  1ENH A;  2L7F P;  2DTZ A;  1U9O A;  1CQT A;  5FKL A;  4IHW A;  3QPS A;  5GPC A;  1P7I A;  2X48 A;  4B4C A;  4DZJ A;  2AHQ A;  2LD5 A;  1GV5 A;  3D1N I;  4C2M J;  5IOY A;  5IP6 A;  2H1K A;  4UUS A;  4MIM A;  2Y31 A;  3TW7 A;  1IV6 A;  2NOG A;  3Q0W A;  2VUM J;  1MNM C;  1TWG J;  1FIP A;  3BR2 A;  4BBR J;  3F0C A;  3S1N J;  1YRN B;  1S7E A;  3HBL A;  5EEA A;  2XB5 A;  1WGX A;  1ETW A;  1BW6 A;  2JA8 J;  3WHB A;  4MFD A;  3FIS A;  3BQY A;  2R93 J;  5C3E J;  3GTO J;  1JJ6 C;  5C44 J;  1F43 A;  3Q3S A;  3BG9 A;  4A3M J;  3A02 A;  2K40 A;  1GVD A;  2M2E A;  2XGC A;  5M3M J;  3G1L A;  5IYC J;  3LSP A;  3OSG A;  2O9L A;  1BW5 A;  1LE8 A;  3TW6 A;  3HB9 A;  5HOD A;  3LNQ A;  3JR9 A;  2IAI A;  3LSJ A;  5M5Y J;  2CRG A;  1Z0X A;  3M4O J;  2E2I J;  1APL C;  2QF7 A;  4XRS G;  2DMQ A;  3JRG A;  1ZQ3 P;  5DTD A;  4XRS A;  2JA5 J;  4BKX A;  3FKI J;  2XGE A;  2FQ4 A;  1JKO C;  3CMY A;  2CUF A;  4V2F A;  1SAN A;  3Q0U A;  4CYC B;  1EF4 A;  4DYR A;  1HDP A;  4A3L J;  1B8I A;  1HOM A;  2H8R A;  4QIW N;  5EG0 B;  1ETV A;  2DMU A;  1GDT A; 
#chains in the Genus database with same CATH topology
 4N4N B;  2BZT A;  1Y0N A;  4EV0 A;  2FMY A;  3HOW J;  2ADU A;  4HOB A;  3FDY A;  2V1D A;  2XPU A;  2HU9 A;  3BLY A;  4KMU X;  1T0F C;  4ZZD A;  3DPT A;  5LHH A;  2Z9O A;  1U3E M;  5IT3 A;  1X19 A;  4HX4 A;  4G6Q A;  4NB5 A;  3LFK A;  2HTJ A;  3P5J A;  3K70 C;  4ESJ A;  1ZR2 A;  5D6E A;  3M8E A;  2IJL A;  1LEA A;  2OZU A;  1JTY A;  2L9V A;  1E3O C;  3HKZ A;  1JKP C;  3CJN A;  1VQ8 I;  3M8J A;  1JHH A;  4KT6 A;  1SD6 A;  3OYC A;  2BOL A;  3OYA A;  2EFW A;  2ZME C;  4ENJ A;  5JI6 A;  2DA1 A;  4B48 A;  2FBH A;  2DYS H;  2BW3 B;  5L3B A;  1BOB A;  2KKO A;  2E2H J;  1P6R A;  5EDN A;  4DYC A;  3CUQ A;  3KEY A;  2ZJR F;  3IL2 A;  3DEE A;  2DW4 A;  1L3L A;  4RM2 A;  3GX4 X;  3CJR B;  1G8X A;  5H6Q A;  1PP8 F;  2DQL A;  2CU7 A;  2CW7 A;  4HV5 A;  4DNC A;  1YG2 A;  3WGH A;  5K5O A;  1MJB A;  2VOP A;  1MMA A;  3GZ5 A;  4LMY A;  2A6T A;  1VQ7 I;  1KU7 A;  4N4O B;  1B4A A;  4QSH A;  1XD7 A;  3F9K A;  3GFJ A;  2GXA A;  3SZP A;  4A3F J;  3RPU D;  3S2H J;  1XPX A;  1Z1D A;  1WJE A;  3HGY A;  3VFZ A;  1A35 A;  2O03 A;  3L09 A;  3WTX C;  3GTP J;  1YIT I;  3MKW B;  4HX7 A;  3LA3 A;  4CIC A;  2VOO A;  4F93 B;  1IG7 A;  1MBH A;  1TLH B;  1FIA A;  3LSM A;  1BOA A;  3FBI B;  3ZPL A;  1EJ9 A;  2NAZ A;  3A4C A;  3MN2 A;  3KYL A;  2UWM A;  2E7X A;  4XSZ F;  3B6A A;  3ZXS A;  5LLQ A;  3CO6 C;  1TZL A;  2CS3 A;  4Y52 J;  4NHJ A;  1VQL I;  5EGO A;  2FD5 A;  5M5W J;  1D1B A;  2M3A A;  2NS8 A;  4GO1 A;  1FY7 A;  4CZC A;  2R7X A;  4XOT A;  3GTJ J;  2R7Z J;  3RKY A;  4BAC A;  2QQ8 A;  4F52 A;  3WHC A;  2JN6 A;  5HDN A;  2CG4 A;  1RPW A;  3FX3 A;  4PJN A;  3KYC B;  1XB4 A;  2L7K A;  2HI3 A;  2ICW G;  4IL6 C;  1Z21 A;  4FET A;  3OS0 A;  1FSE A;  3H35 A;  4P1W A;  2JWT A;  4FE4 A;  1G2H A;  5FD6 A;  2EV5 A;  3MFK A;  4R8H A;  1JKR C;  3F8B A;  4E7L A;  3ULQ B;  4A3J J;  4IOC F;  1B6A A;  2KIS A;  4DOZ A;  1KGS A;  2IGK A;  2W24 A;  2JMW A;  1I1S A;  2CQN A;  2Y75 A;  3GCM A;  1E0E A;  2RGV A;  3BR5 A;  2PMZ A;  1YW8 A;  3IKV A;  4LIT A;  4PGH A;  5DCM B;  1X58 A;  3GTM J;  1SVO A;  1JTX A;  1TT5 B;  1UJ8 A;  2TRT A;  4OMY A;  1XCB A;  2LVS A;  4EJV A;  5DUI A;  1O3S A;  3FHZ A;  4UUT A;  3W2A A;  2QEX I;  3IRQ A;  2JSP A;  2DK5 A;  1MKM A;  2O6G E;  2HS5 A;  3GFI A;  4I76 A;  1O57 A;  1T2K A;  1QZZ A;  2NVQ J;  3ABK H;  4HSR A;  3O3K A;  4F7Z A;  4XM3 A;  1AKH B;  2DA3 A;  4E6K G;  2R3S A;  4ZYH A;  1J59 A;  3OOU A;  1O7L A;  1UMQ A;  4H4K C;  4ENK A;  3P9I A;  3TOB A;  2IS1 A;  5FRO A;  4G12 A;  1G3T A;  4LB5 A;  3CQZ J;  4XLC A;  2K9S A;  2XPW A;  3ABT A;  4FIS A;  2OQR A;  4WWC A;  3T5X A;  2Q2E B;  4BHP A;  4J19 A;  2GBY A;  5F1R A;  1D8J A;  2CW0 F;  3WTY C;  4RAY A;  4IHV A;  5BQT A;  2W82 A;  5DS9 A;  3HIF A;  1LJ9 A;  2CSO A;  2FU4 A;  4M9S A;  3V4G A;  3P7N A;  3FXL A;  2JJ7 A;  1UHM A;  1XG1 A;  2DN0 A;  4EM0 B;  3DU6 A;  1F9N A;  3AG1 H;  5FLX K;  2Z33 A;  2V6C A;  3JRA A;  3ZMS A;  4C3J J;  4O3M A;  2OC6 A;  1IZ1 A;  1QHH D;  3JW4 A;  4LG0 A;  3I4P A;  4DBQ A;  4HDV A;  2ISZ A;  1IXS B;  1RR7 A;  5F0F A;  3JRF A;  2WAQ A;  3G1O A;  2MYS A;  5K5R A;  3IAM 2;  1X1P A;  1IV8 A;  1G6N A;  1VTN C;  1T8I A;  1FP2 A;  1TQI A;  2Y69 H;  4JOM A;  4ZTF A;  1NK3 P;  2B63 J;  2QBY B;  5E17 F;  1LDK B;  2E5N A;  3K1N A;  3K7A J;  2EPF A;  2WA0 A;  1KYZ A;  2LY1 A;  2M0M A;  2XAG A;  1MMD A;  2K9L A;  4JK1 X;  5E1X A;  1Z91 A;  5LHG A;  2VQG A;  2R5Y A;  3HTS B;  3DCF A;  6PAX A;  1XGN A;  3IRR A;  1MGT A;  2HTS A;  1DUX C;  1TQM A;  1K78 B;  2R7R A;  2W4S A;  2AXL A;  1J7K A;  3F8M A;  1HLV A;  1ONV A;  1EH8 A;  2X6W A;  4J00 A;  2BY2 A;  2KL4 A;  3IWZ A;  4BYY A;  2O8K A;  2JRT A;  3KZI C;  5IOZ A;  3T8R A;  2N8G A;  2RNG A;  2FNA A;  4A3E J;  1YW9 A;  4BJ6 C;  1FBS A;  1CGP A;  2XF5 A;  2A5Y B;  4FQG A;  4W97 A;  5F08 A;  4L5I A;  1USS A;  3DTK A;  3H0D A;  2ZB9 A;  3KP7 A;  1I6H J;  3A01 A;  3DPL C;  4BHB A;  3OY9 A;  2JZY A;  1R1T A;  2O61 A;  3PSI A;  1G3W A;  4Y13 A;  4IQJ A;  4IRH A;  5ED4 A;  1K6Y A;  5F27 A;  5LGU A;  5AIQ A;  4M74 A;  3ROU A;  4OAZ A;  1LNW A;  3MKY B;  1VQK I;  1K61 A;  5GAD J;  2K4J A;  2B7E A;  2IT0 A;  3W2V A;  3UR3 C;  4PJM A;  3M9A A;  3TMO A;  3ISP A;  4BY1 J;  3OL3 A;  5M5X J;  3K4J A;  1ERD A;  2KT0 A;  3SZT A;  4PFO A;  5H2F C;  3O8H A;  4EQQ A;  2E1C A;  1MMN A;  1SAU A;  4HNU A;  1D5Y A;  1LFB A;  2QWW A;  3TED A;  2L2O A;  3JSO A;  2ZJQ F;  4YFN F;  2H09 A;  4K2E A;  2XIG A;  4AUX A;  1RUO A;  1Y1V J;  3KFW X;  2W84 A;  3I56 I;  2HPM A;  3RQI A;  3S32 A;  1FWZ A;  2K02 A;  3K4B A;  3DEW A;  5HLT A;  3KP2 A;  2MGQ A;  2L7M P;  4AYB A;  1HW2 A;  2XKP A;  3M1C A;  1ZGA A;  3OMY A;  2Y9Z A;  5FKN A;  3DWL E;  2OQG A;  1YJW I;  1IF1 A;  1IRF A;  2O3F A;  4C3H J;  3ELK A;  1QA6 A;  2KP6 A;  2R7Q A;  4P9F A;  3VPR A;  4E7Z A;  1G59 A;  1J0R A;  1T6S A;  2FUG 2;  4BL0 B;  1JXS A;  3MZH A;  3K69 A;  3VDX A;  3CCJ I;  2QM3 A;  2V7F A;  3KX2 A;  5IYD J;  2WY8 Q;  3LAJ A;  2VQC A;  2K3P A;  4RAZ A;  1F4K A;  1BA5 A;  1VQ6 I;  2I10 A;  3KP4 A;  3H3Z A;  1F1Z A;  2YS9 A;  2HKO A;  1T95 A;  3K4N A;  2E1O A;  2OPT A;  3PUB A;  1ZR4 A;  4LFU A;  4J01 A;  4E7S A;  2XAU A;  1X1B A;  2W48 A;  5B66 C;  3IWF A;  4OIN F;  2ZO4 A;  3KEO A;  3BJA A;  1AOY A;  5JLW A;  4RGU A;  4RA2 A;  3BZC A;  1D8K A;  3E97 A;  2OU2 A;  2CUZ A;  3PM1 A;  1S8N A;  3GWZ A;  3CCE I;  3VYU B;  1HKT A;  3DXJ F;  3EUK L;  4CZZ A;  3GXO A;  3ZMD A;  2IW5 A;  4M3B A;  4E70 A;  3CCU I;  2DQR A;  2YUS A;  4BEH A;  2XRO A;  3HKZ N;  1W5T A;  2CV1 A;  1U9N A;  3QPT A;  4BH9 A;  3HOZ J;  2MBF A;  4ZDP A;  2ZBK A;  3DEU A;  4YRV A;  1GV2 A;  2ZSH B;  4UVA A;  4O6J A;  2HOA A;  5CVV A;  5IP7 J;  2K9M A;  4A3G J;  4PUS A;  1BL0 A;  5BPI A;  1YFH A;  1KZH A;  1FOK A;  2W57 A;  5J6X A;  5EJC A;  3I5U A;  2YX7 A;  3K2Z A;  3OL4 A;  1SD4 A;  3RTR A;  1VQO I;  1KA8 A;  3HHH A;  1ENH A;  2L7F P;  1U9O A;  4XLP F;  2IS4 A;  2LF7 A;  1BC7 C;  1P7I A;  2DK8 A;  1HW5 A;  2X48 A;  2AHQ A;  2LD5 A;  2L3D A;  3D1N I;  2ZME A;  5DD8 A;  4UUS A;  2ZXH A;  1X1C A;  5ILV A;  2W85 A;  3RI4 A;  2ESN A;  1IV6 A;  1WJC A;  4BE0 A;  2D1H A;  2ESH A;  2ZJP F;  3TOA A;  1BC8 C;  3F0C A;  4KNY A;  3S1N J;  1KQ8 A;  3PIO F;  4B8X A;  1YRN B;  2HYF A;  2L9N A;  2EIJ H;  5DM6 F;  1S7E A;  2KQR A;  3HBL A;  2NXN B;  3A1Y A;  3S3O A;  2A05 A;  4ZDO A;  1WGX A;  3MQ0 A;  4EMS A;  2E1M B;  2F2E A;  4I0A A;  1S29 A;  1D1C A;  3WGG A;  3MCZ A;  3U21 A;  3GFM A;  4NC8 A;  2B9S A;  3HZJ A;  4ZJZ A;  4ZTJ A;  4ZYE A;  3W3C A;  3M8F A;  4MFD A;  3IKT A;  5A2Q K;  4KIC A;  2XF7 A;  1LPQ A;  2XAH A;  4CGZ A;  1FPQ A;  4U0V A;  2GXB A;  2A6H F;  5KAF C;  4X0G A;  1K4T A;  2M2E A;  1R5I D;  1I6X A;  3BRO A;  4I01 A;  5B1B H;  2LYC A;  3EPZ A;  2QZ8 A;  3C7J A;  3MMY B;  2IAI A;  2L4A A;  1Z05 A;  2VLA A;  5M5Y J;  1Z0X A;  2V1U A;  2K27 A;  3PJR A;  2KRC A;  2HWV A;  1HA8 A;  5J8C A;  4EJW A;  1JHF A;  3FKI J;  3C18 A;  1ZG1 A;  4QPO A;  3U1D A;  3WE2 A;  5JFR A;  2OJE D;  3Q0U A;  4CYC B;  1EF4 A;  1U2W A;  1X3W B;  4UVB A;  1HOM A;  1IXC A;  1GDT A;  3DPU A;  2PMZ N;  2VJJ A;  4EGZ A;  1KON A;  4NDL A;  2XHK A;  1ZN2 A;  5LEK A;  3ONQ A;  1HBX G;  2NVT J;  3WG9 A;  5E20 A;  2KIF A;  5CQG A;  1PYV A;  1IUF A;  3IH3 A;  3ZN0 A;  2A61 A;  2RDP A;  1DP7 P;  2WY7 Q;  2DJI A;  4KYW A;  5FLM J;  2KRF A;  2HPI A;  1IN7 A;  4CDG A;  2ECC A;  2EWN A;  1YHQ I;  3WU0 A;  3NWS A;  3J7Y J;  4YIR X;  1W5S A;  5CQE A;  1MBJ A;  2BGC A;  2L02 A;  3ZQF A;  5A2Q Z;  2R7S A;  3NEU A;  2ZKZ A;  1MBG A;  4M3G A;  1H9G A;  4M3F A;  2PBI A;  1VQN I;  2LBF A;  1X2N A;  3H9Q A;  4O5V A;  1FP1 D;  3V8L A;  2P81 A;  3GLL A;  2STT A;  3OYE A;  2DJN A;  2HGC A;  5FGM A;  4CHU A;  1QVU A;  1KYW A;  2KIM A;  4XLH A;  2XF6 A;  5DV5 A;  1Z7U A;  2F48 A;  1IGN A;  4XKW A;  1MBK A;  3PUF A;  1SMT A;  3K4L A;  4FX4 A;  5F04 A;  2F4O B;  4RAG A;  2IVM A;  4H0E A;  3H5N A;  2DXI A;  1V5F A;  3D5S C;  1MH4 A;  2V1N A;  2R7D A;  3CME I;  3G4S I;  3LQR A;  4R79 A;  3KZZ A;  3V42 A;  2OCE A;  1ETY A;  1FBU A;  2F4M B;  3JRE A;  1MJ9 A;  1XS9 A;  2DMT A;  4JYK A;  2WAQ N;  2I8D A;  3W6V A;  4ENN A;  1Z9C A;  2P7V B;  3CD6 I;  4XOP A;  4CCO A;  3OS2 A;  1JT6 A;  1YYV A;  3U9G A;  1MMG A;  2QYO A;  3K4C A;  1OYI A;  5E18 F;  3BR0 A;  1Q1V A;  1W7P B;  5LEJ A;  3R4K A;  4YIF A;  4I6Z A;  2Z99 A;  2XC7 A;  2K85 A;  3ZGK A;  1A04 A;  4A69 C;  2M8E A;  2PFB A;  1ETQ A;  4DW6 A;  1DQU A;  2V26 A;  4X1E A;  1QGP A;  2VPL A;  4UV8 A;  3QU3 A;  2E34 A;  3G1M A;  4G9Y A;  4X6A J;  3CUO A;  1F36 A;  2FJ1 A;  3QU6 A;  1C0W A;  2OF7 A;  3G3Z A;  2H27 A;  3OR1 C;  2G9W A;  3COA C;  2CV0 A;  1ZLK A;  4D0P A;  4AIK A;  2X6Y A;  3BJ6 A;  2HNH A;  4NQW A;  4FHT A;  5L3G A;  5HDG A;  2NVY J;  2EQR A;  3J7A O;  2K4B A;  1O3T A;  2IP2 A;  3OIO A;  3KIO A;  5K1Y A;  2E1N A;  2E19 A;  4KFC A;  2A3S A;  2QLZ A;  4HZF A;  1WVR A;  1IC8 A;  2WB1 A;  3TQN A;  1OYY A;  1OJL A;  1S9H A;  1XSV A;  2L7Z A;  5D6F A;  3OYD A;  3HOX J;  2JQ7 A;  3ZMZ A;  2JTV A;  4XLN F;  4RB1 A;  3WTU C;  1KU9 A;  1RR8 C;  3HSE A;  2FBK A;  3FK7 A;  4RGR A;  1D0Z A;  3GLX A;  2VAS A;  2LRE A;  1MBF A;  2EIL H;  1OCC H;  2PJR A;  3HUG A;  5BMZ A;  3LSR A;  5HVQ C;  3CES A;  4DIQ A;  1IRX A;  2WAF A;  3ZP5 A;  2L01 A;  3M3Y J;  5CLS A;  4ZYA A;  1GT0 C;  2DI3 A;  4ZDL A;  3EYI A;  4NC6 A;  1J09 A;  1IXR C;  4XL9 A;  4NBQ A;  4A0X A;  3FZV A;  1U8R A;  1W0U A;  4GYG A;  4HST A;  4RB0 A;  2XAQ A;  1W0T A;  4HF1 A;  3EUH C;  4DQ2 A;  2DMN A;  4ASN A;  1X1D A;  3BG7 A;  5FKM A;  1D1A A;  2W25 A;  1YQA A;  4CXF A;  4KMF A;  1I5Z A;  4B3A A;  5LFA A;  2G7H A;  2YR2 A;  3A0B C;  2V9V A;  3CCY A;  5GTH C;  4S05 A;  1Y1W J;  3J7A Y;  2QVO A;  1YE9 A;  5CVI A;  5D5U B;  2M34 A;  1FMV A;  2M7B A;  1ZLJ A;  1TWH J;  3C2B A;  4AYB N;  1ZTR A;  2QGU A;  4QPQ A;  5K7Z A;  2L0K A;  4IHT A;  1WH7 A;  3HPG A;  5LGN A;  2Q0O A;  5HNH A;  1FJL A;  3SYT A;  1D3Y A;  3KET A;  1QNT A;  4G8X A;  2RC4 A;  3CJT B;  4UB8 C;  3ZMT A;  4BDZ A;  3H3U A;  2HEO A;  4ZYD A;  5HS7 A;  4L0Z B;  4E7I A;  2JA2 A;  2K3F A;  3HPH A;  4M6Y A;  2QA4 I;  1K7A A;  1O3R A;  3VOE A;  1SC7 A;  1VQ4 I;  2MLK A;  5C4X J;  4ABZ A;  5EGO B;  3V7C A;  3KP5 A;  2FF4 A;  3KLO A;  1U78 A;  1FZP B;  1R1V A;  1Y56 A;  4I0B A;  3FIW A;  3FKJ A;  4XRM A;  2CFO A;  4L5E A;  2IBD A;  1NTC A;  1B59 A;  5KHD A;  1E3P A;  3O8G A;  4XK4 A;  2DAO A;  2EIK H;  2NS7 A;  4XID A;  5LD2 C;  4U88 A;  3BTL A;  2VC0 A;  4U0W A;  2GZW A;  1LVA A;  2E60 A;  2COB A;  1QZY A;  4XMY A;  2ETH A;  2ELK A;  5L3E A;  1QPI A;  4OU0 A;  1LVK A;  4KN7 X;  4DGW B;  2UXX A;  3E6M A;  2CJJ A;  1N77 A;  1LE8 B;  2LKX A;  2YSR A;  3U2R A;  3GTK J;  5IP9 J;  5HOO A;  4A3I J;  4Q4Z F;  1S6L A;  2IA2 A;  2R7W A;  2BV6 A;  2MAB A;  4OIP F;  2VBX A;  1K83 J;  3I4M J;  3HGG A;  5B5E C;  1ON2 A;  1DGW Y;  2M45 A;  1XDS A;  2ZSI B;  5F0C A;  3FXJ A;  2D5V A;  1IN6 A;  3M7G A;  3ERM A;  2HVS A;  2NYX A;  1ON1 A;  2KFD A;  2DYR H;  2LMD A;  1OCP A;  3CC7 I;  3NRV A;  3H5R A;  1X1A A;  4Y3O A;  2M9H A;  2BVL A;  4GRI A;  1SD7 A;  4A5M A;  3LA2 A;  2X0L A;  1V4R A;  2MFZ A;  2E1M C;  3F3X A;  2HDC A;  1GUU A;  3H0G J;  4XLF A;  1P4A A;  3S1R J;  3RZO J;  3WU1 B;  4BY7 J;  2Q1Z B;  1TQP A;  2OBP A;  3EET A;  2WC2 A;  5D4R A;  3S3N A;  5FO5 A;  4D7N A;  2R4G A;  3ERE D;  2IGN A;  5E3O A;  4PGG A;  2IS2 A;  2OZ6 A;  1J5Y A;  1TP4 A;  2BHZ A;  2WV1 A;  4XN3 A;  2RN7 A;  2VPR A;  3KP6 A;  3GTG J;  2L5Q A;  2VXD A;  3HOT A;  3CMA I;  1Q1H A;  4A93 J;  4OIO F;  4IQ4 A;  4AIJ A;  2H1L A;  3FXQ A;  5BPD A;  3BTC A;  4EM1 A;  3UKG A;  1HXD A;  2LR8 A;  3GBG A;  4P96 A;  3DKY A;  3BDD A;  2HZD A;  3IH2 A;  3T1B A;  3MKZ A;  1HKS A;  3RZD J;  2HDD A;  3GTL J;  3DLL F;  1UG0 A;  2QQB A;  3OV8 A;  4BJ5 C;  5F6F A;  2DMP A;  5DEQ A;  3PIP F;  4IEJ A;  1VZ0 A;  3WTT C;  4RMN A;  4LG0 B;  4F91 B;  2QQA A;  4IHX A;  2BVM A;  2H6B A;  3E7L A;  2J5O A;  4MQ9 F;  2RNJ A;  1RKW A;  5HNF A;  2VJ4 A;  2K7L A;  2VKE A;  2Y2Z A;  2KDO A;  5J4V A;  5HLH A;  2EZH A;  5FKO A;  4RGX A;  1VQP I;  3F8F A;  2X85 A;  4EJO A;  1X3Z B;  2R5Y B;  3BR3 A;  3F6O A;  1J75 A;  1ACI A;  3D0S A;  3H1C A;  5K7H A;  4CA0 A;  2LC2 A;  3L2U A;  5E8I A;  3L2Q A;  3OR2 C;  2F5C A;  2GM4 A;  2GA2 A;  4XIC A;  5GAE J;  2RV8 A;  3ASN H;  1N25 A;  1Z6T A;  2DDB A;  3HSF A;  4YG2 F;  4MEX F;  4BU2 A;  4M73 A;  4AID A;  1FOX A;  2O5R A;  1ZRE A;  5JVT A;  5CVU A;  4ENM A;  3H5A A;  5K5Q A;  1TC3 C;  1PP7 U;  1D0Y A;  3HYI A;  5DD4 A;  2X1D A;  1RKT A;  4LD5 A;  1QU3 A;  4IPA A;  3SDG A;  4L9T A;  1T56 A;  3TO9 A;  1ZG5 A;  1XCV A;  2MC3 A;  1R9T J;  1MBE A;  4WCG A;  3A01 B;  1FYK A;  1UB9 A;  2QEN A;  2FML A;  2P7C B;  1ZAR A;  4B09 A;  1ZEL A;  1YX5 A;  1AKH A;  1ETX A;  2QKL B;  1P2F A;  2GA1 A;  2O0Y A;  5CVR A;  3S17 J;  3VYT B;  4UV9 A;  5EEG A;  2XRN A;  1XDU A;  2B0L A;  1SFU A;  2DTZ A;  1S7A A;  2JUG A;  2M4K A;  4ESF A;  2FEZ A;  5ILS A;  3QPS A;  2ZXW H;  3RDI A;  1FYL A;  2O8X A;  5FRN A;  2Q8K A;  4XLE A;  2H1K A;  2GQQ A;  3HTU A;  3TDZ C;  1OCO H;  2OTJ I;  3TGN A;  2EV0 A;  3Q0W A;  3DKW A;  2R7U A;  3SEQ A;  3O2P E;  1TWG J;  1FIP A;  4ZZL A;  3FXU A;  3L00 A;  1XMA A;  2VT3 A;  4PK4 A;  3D5L A;  5EEA A;  1IAW A;  1G4D A;  3LFU A;  2PJP A;  3LSH A;  1ETW A;  4WXC A;  5DYM A;  1W7P D;  4MGR A;  2LRD A;  1FT9 A;  2NNY A;  1SEU A;  3LA7 A;  4CSW A;  2R93 J;  4II2 A;  1JJ6 C;  1F43 A;  3VYS B;  4HF0 A;  1PJR A;  1TT0 A;  3I64 A;  2DU9 A;  3T8T A;  3KLN A;  3G1L A;  5IYC J;  3LSP A;  1AWC A;  3TW6 A;  3K10 A;  5HOD A;  4E7H A;  2R7O A;  3AG2 H;  2PN6 A;  2CRG A;  1BR1 A;  4BJT A;  4XOR A;  3JRG A;  1U5T B;  1NG6 A;  5F64 A;  4QWQ A;  4B47 A;  4XKC A;  5FFX A;  2XGE A;  3SZG A;  1HQC A;  3CMY A;  3BOQ A;  1YTY A;  1JKO C;  3ZN1 A;  3WE3 A;  4EAT A;  3HC7 A;  1B8I A;  5J8F A;  4I2O A;  4BEH B;  5EG0 B;  3CCS I;  1R5G A;  3TO6 A;  3WG7 H;  4OWR B;  5LHI A;  2DOA A;  4P9U A;  1X3U A;  2NS0 A;  2Z2S B;  3DBL B;  3Q9V A;  2DDA A;  3B6C A;  4A5N A;  2RQQ A;  1ZKG A;  2HOE A;  4KA4 A;  5JHF A;  3I55 I;  4XR6 A;  3R61 A;  3WGI A;  3RJP A;  2XGD A;  4FE7 A;  1REP C;  2XGX A;  4UNO A;  2K9Q A;  4HG2 A;  5ICC A;  2HZT A;  1U6G A;  2M87 A;  3RYP A;  2FE3 A;  3GEZ A;  4ON0 A;  4A2U A;  3M07 A;  1OCR H;  4XKB A;  1UFM A;  2EV6 A;  4S04 A;  1MND A;  4M6V A;  1WKM A;  3G6E I;  1QBJ A;  2W7N A;  3AFH A;  2CFX A;  2YPR A;  3D5R C;  4I98 B;  1BR2 A;  1ITY A;  3OYN A;  4XKV A;  3SFI A;  3PFI A;  3DQV C;  3JAM Z;  1EA3 A;  1O4X A;  3ZOB A;  2WBM A;  4YEJ A;  5BS6 A;  2R5Z A;  3WTS C;  4MFE A;  4Y33 A;  3I54 A;  4JQF A;  3R6S A;  3PL8 A;  1OQY A;  3HXL A;  4MLO A;  3B02 A;  3TP3 A;  3EUH A;  4OOI A;  1YLF A;  2ACJ A;  1T0F A;  3DTI A;  2DA4 A;  1TBX A;  4PFP A;  1A6I A;  5FD5 A;  2UXN A;  3I59 A;  3K4K A;  2EFN A;  4DYQ A;  3OYB A;  4IOA F;  1DPR A;  3ZQH A;  5IT9 Z;  3SXY A;  1JE8 A;  4A6E A;  5GTI C;  1WJ5 A;  3OYF A;  2GAU A;  2WAE A;  4L9N A;  1H0M A;  4AVZ A;  1VQM I;  2F4I A;  3BCB A;  3RSN A;  3VWB A;  3VOD A;  3ABM H;  2ZNZ A;  4S0H B;  5CPR B;  2I5U A;  1T38 A;  1POG A;  4HQE A;  3JSP A;  4A12 A;  3CF2 A;  3HDD A;  3ZQG A;  3RPU A;  2TDX A;  3GW2 A;  5E1Z B;  1STZ A;  1WCM J;  3FBN B;  2EZI A;  3L2C A;  1SVL A;  3P9C A;  1XMK A;  4F92 B;  5M3F J;  4XRF A;  1F5T A;  4RAF A;  3IC7 A;  1T98 A;  5ERI A;  3QP6 A;  1E3H A;  4AWX B;  1IUY A;  2K86 A;  3J7Z I;  1SFE A;  4XN0 A;  1KQ0 A;  1BR4 A;  3JTH A;  1V3F A;  3E6D A;  3ZQC A;  4L0Y B;  3TBI A;  3DF8 A;  2OTL I;  2WWY A;  2A68 F;  2XDV A;  1B72 A;  1FX7 A;  2A6E F;  3AG4 H;  1NK2 P;  3GZ6 A;  4ESB A;  3CDL A;  1E2X A;  1TWF J;  4IHS A;  3E0J B;  1V55 H;  4L18 B;  1Z7L A;  3CP2 A;  3ABL H;  2ISY A;  2P6S A;  4PZJ A;  5CJ9 A;  1GLN A;  4R1H A;  1E17 A;  3I58 A;  5DCF A;  3DBH B;  2F5F A;  2IXS A;  3WTW C;  3CC2 I;  2ZJ2 A;  2LKP A;  2QKM B;  3BR6 A;  3MWM A;  1HKQ A;  4OIR F;  2JA6 J;  4Z2Y A;  2F5E A;  2Y0M A;  1YS7 A;  2LOO A;  3SEZ A;  3N05 A;  4A3C J;  3HOY J;  1OR7 C;  2CWE A;  2FBI A;  3AG3 H;  1B9N A;  4BUP A;  2BY3 A;  4NC7 A;  2CQK A;  5KK1 A;  5J1U A;  3RQ4 A;  4RBO A;  2C6Y A;  2A5W A;  5IYB J;  2BY0 A;  2IA1 A;  1Y8R B;  1R4N B;  1U8B A;  2NVU B;  1R71 A;  3F8C A;  3F21 A;  5TGT A;  2V79 A;  1FOW A;  2RAE A;  3QAH A;  3RCO A;  2FOK A;  3JTG A;  4TV7 A;  2MW8 A;  4D1Q A;  1ZYR F;  4BDY A;  1IO2 A;  3HEF A;  1PUF A;  3MAJ A;  1A31 A;  4BE1 A;  5E8G A;  2HVR A;  2VIX A;  1PDN C;  3F8N A;  4ANJ A;  1JUP A;  2XB0 X;  5KNL A;  2DTR A;  1HSJ A;  1PVE A;  5K7F A;  4B44 A;  2CV2 A;  1LUJ B;  4CUG A;  3QYB A;  1R5H A;  2JRM A;  4KIS A;  3J81 Z;  5H20 A;  3PQK A;  4PSW A;  2NNN A;  4NUB A;  3Q5F A;  1DU0 A;  5FRM A;  4GFB A;  1PUE E;  4IJA A;  2BE5 F;  1XSX A;  3HOU J;  2GLO A;  2MG4 A;  3ZMV A;  4FTH A;  2UZK A;  2AO9 A;  3Q0V A;  4I02 A;  2R7V A;  4D5F A;  3QRF F;  4BQO A;  2L9R A;  1QZE A;  2W1O A;  3BPV A;  3ML6 A;  2M7A A;  2BXZ A;  2ME0 A;  3S15 J;  2OV7 A;  3MVP A;  1CF7 A;  4OIQ F;  3H36 A;  1DPU A;  2G7U A;  4C2T A;  3VEP A;  1S5L C;  3IHU A;  1MDM B;  1KQ9 A;  4II3 A;  4NQW B;  3BR1 A;  3PFY A;  3JRD A;  2KIQ A;  2VJ5 A;  1DGR M;  1WHU A;  3S8P A;  5DUK A;  3ABU A;  4YEL A;  3SDB A;  3FXK A;  2GOX B;  4E7J A;  2ZFW A;  3V7R A;  2M30 A;  5LRR A;  5EZG A;  2LNB A;  4A3K J;  1VQ9 I;  1T39 A;  1ZG3 A;  1HDD C;  3V8K A;  4M71 A;  1ZGJ A;  2IA0 A;  5D5V B;  1WWX A;  1DU6 A;  1RUN A;  3SQN A;  3C2H A;  2ZNY A;  3JRI A;  4WXD A;  3CLQ A;  2HOS A;  2ZXJ A;  1BIA A;  3W6K B;  2IRF G;  1WPK A;  1FEX A;  3WU2 C;  2QSG X;  1IN4 A;  3HUG B;  1R58 A;  3CCL I;  5E3M A;  1XGO A;  4MEY F;  2HQA A;  2NOJ B;  5E3N A;  3V7S A;  1I27 A;  4KJZ A;  1VQ5 I;  2EK5 A;  3K9T A;  4HYE A;  1FTZ A;  2IPQ X;  1Z6R A;  4L5J A;  3CF5 F;  1LB2 A;  3E1S A;  3ZMU A;  4CCL A;  2P5V A;  2PMU A;  4BBS J;  3BTJ A;  2FSW A;  2UUZ A;  3S2D J;  4OAY A;  2JPC A;  2HQN A;  2X1C A;  2YX4 A;  4IXA A;  3V8J A;  5FLV A;  4M6X A;  4M3D A;  2KZG A;  1MJA A;  4QTR A;  1UCR A;  2P4W A;  3QPH A;  1XGM A;  2PLY A;  1BI0 A;  4N0B A;  1GHC A;  3ZQI A;  2LFB A;  5FB2 A;  3E5U A;  2X9D A;  1VF9 A;  3TKY A;  2JSC A;  4KT5 C;  3A0H C;  1BI2 A;  1R4M B;  4L9V A;  2P5L C;  4BXX J;  4BHC A;  4BQA A;  4HA8 A;  3RKW A;  2JVG A;  3LOC A;  3H3V K;  1BM9 A;  2D2W A;  1ZRF A;  1ODD A;  3ECH A;  1OCZ H;  2DOF A;  4XLA A;  3E6B A;  3LWF A;  4RS8 A;  2YU9 J;  1JUS A;  4HX8 A;  1JGG A;  3AL0 B;  3G71 I;  1HC8 A;  1IJW C;  2EZL A;  4BS9 A;  1W36 C;  4YFK F;  1U5T C;  1MW7 A;  2X6X A;  3CUQ B;  4RM3 A;  1W7P A;  4LK0 F;  2WV0 A;  3O6B B;  1P9Q C;  3R0A A;  3GVA A;  1T08 B;  2PQ8 A;  2ZC2 A;  3FWE A;  3N97 A;  3PSF A;  4EVI A;  4HBL A;  3J80 Z;  4Q5S F;  1R1U A;  3TP0 A;  1ETO A;  3KEQ A;  5E1W A;  1S72 I;  1XN7 A;  3JCU C;  3S1Q J;  3RKQ A;  4C30 A;  2ELH A;  1ORK A;  2V1X A;  2VQH A;  1G3Y A;  3F6V A;  4BXF A;  2HOT A;  3RYR A;  1UG2 A;  9ANT A;  3DKX A;  4KIB A;  4L9J A;  4UVC A;  1BBY A;  3PO2 J;  1BIB A;  4LJZ F;  4HEA 2;  1W36 D;  2KHM A;  2EBI A;  2DO7 A;  1XC5 A;  1WI3 A;  1M1E B;  1FMW A;  2XRL A;  4RB3 C;  2DOD A;  1I1G A;  4UY8 I;  4HDU A;  1P7J A;  3I4N J;  4LG3 A;  1TWA J;  3HG9 A;  1SAX A;  2HYJ A;  2Y0S A;  3NQO A;  3KZY A;  1WI9 A;  1Z77 A;  2Y30 A;  1SFX A;  2BHY A;  1AA7 A;  3VSL A;  1IN8 A;  1XX5 A;  4NNJ A;  3W6J B;  5CVJ A;  3QYE A;  4B43 A;  1GXQ A;  3EQL F;  1KU3 A;  4KUM A;  3L2W A;  1OLT A;  2VXZ A;  4CCM A;  3R60 A;  1QO0 D;  3BCA A;  1BI1 A;  4AC0 A;  1OMI A;  2COM A;  2OD5 A;  4AU7 A;  2H94 A;  3ZQL A;  4EJT A;  3K70 D;  3GZN B;  2IS6 A;  4CCK A;  4AVP A;  4RGS A;  1AHD P;  3E5Q A;  4IX7 A;  2MC4 A;  3WTV C;  3I53 A;  4M72 A;  2PEX A;  1YOV B;  1MSE C;  4CCJ A;  1WJA A;  4YFX F;  2IGO A;  4GXO A;  5IPA A;  1DP3 A;  1TW3 A;  1Z3X A;  2XSD C;  1UAA A;  2PG4 A;  2NVX J;  2HR3 A;  1WSU A;  3L7W A;  4LK1 F;  4JBA A;  4EJU A;  4B3X A;  1CQT A;  5HS8 A;  4HLX A;  4IHW A;  5D8K B;  2RVC A;  4B4C A;  4DZJ A;  2A07 F;  2JPB A;  4Y17 A;  4HF2 A;  2BW3 A;  3BJO A;  1NG7 A;  5IOY A;  5IP6 A;  3K1P A;  3AKZ A;  3H9J A;  1R49 A;  5CYV A;  4YII A;  2HDW A;  3C3W A;  2VT2 A;  4MIM A;  2Y31 A;  3TW7 A;  3GF2 A;  2VUM J;  3LSI A;  3QOP A;  3HSR A;  4BNC A;  5HS9 A;  3BR2 A;  2KZV A;  4HAM A;  1XTA A;  2VON A;  4PSX A;  3ZQ7 A;  3KP3 A;  1X4P A;  2IGM A;  1WJD A;  2XB5 A;  4BGD A;  4C2U A;  3OYI A;  4Q48 A;  3F23 A;  1WQ2 A;  2KLO A;  4KIG A;  3GUD A;  1BW6 A;  5JVG F;  2HQR A;  4UXN A;  2LH9 A;  2JA8 J;  2DPU A;  3WHB A;  4KDP A;  5ICF A;  3TO7 A;  3M1E A;  3FIS A;  3BQY A;  4I09 A;  4V19 K;  2XSJ C;  1TL8 A;  3Q3S A;  3BG9 A;  1OIS A;  3EDP A;  1KU2 A;  2K40 A;  4A3M J;  2YU3 A;  1GVD A;  2XGC A;  2KMU A;  3EUA A;  1S7O A;  5M3M J;  1FC3 A;  2V6E A;  3BPX A;  1HW1 A;  1RZ4 A;  5GAH J;  1LE8 A;  3HB9 A;  4GDF A;  1R00 A;  4XBF A;  3FM5 A;  3QOE A;  4GYI A;  3RKX A;  2MA3 A;  4E4H A;  5J40 A;  2FOW A;  3LSJ A;  1UZC A;  3M4O J;  5TJJ A;  2M1B A;  2E2I J;  2E71 A;  4MTD A;  1A6Q A;  2CYY A;  3GO5 A;  2DMQ A;  3VB2 A;  3DFG A;  5DTD A;  4M9Z A;  4IKF A;  2QSH X;  4XON A;  1UEL B;  4XRS A;  1NH3 A;  3VSK A;  2CUF A;  3OIP A;  4V2F A;  1P4W A;  1MZB A;  3IAS 2;  3HOS A;  1HDP A;  4A3L J;  3LQQ A;  2WTE A;  2GIZ A;  1R23 A;  1ETV A;  2DMU A;  2P8T A;  5ILU A;  2HKX A;  4EGY A;  2OAZ A;  2ELJ A;  1ZH5 A;  2P6T A;  1WJF A;  4CH7 A;  1R6R A;  2X6O A;  2ID6 A;  5KCM A;  1OFC X;  3LL7 A;  5FKK A;  2LK2 A;  5IY5 H;  5AON A;  1P4X A;  3KYD B;  5EEH A;  4ZC3 A;  1Z67 A;  3E3V A;  4U7B A;  1I50 J;  2KDZ A;  1Y6I A;  3ZRG A;  2XPV A;  4JX4 A;  3OYL A;  1YJ9 I;  1RET A;  3BG3 A;  1R36 A;  1FYM A;  3CDH A;  2DPD A;  4MO7 A;  5JHU A;  3BG5 A;  5DCM A;  5EZH A;  2XAJ A;  5B1A H;  4BQN A;  3ZR8 X;  3KPH A;  5B3S H;  3R0J A;  1LFU P;  2KJB A;  3HRM A;  1IDZ A;  1QPM A;  5HDK A;  4RDU A;  3HRS A;  3LST A;  2ME6 A;  1N78 A;  1UHS A;  1XGS A;  2LG4 A;  3IV5 A;  1WZ2 A;  4HRI A;  1RNL A;  2Z3Y A;  2DFF A;  2H6C A;  5DM7 F;  2Y9Y A;  4MNU A;  3CJQ B;  2HVQ A;  1YX3 A;  3DBR B;  1OR7 A;  2DFE A;  1QRY A;  3H92 A;  2X4H A;  2EA2 A;  1X2M A;  3HL2 A;  3TL4 X;  1AU7 A;  3REO A;  1B1B A;  2XKO A;  4RLQ A;  1LKX A;  3FHN A;  2VL8 A;  1FBQ A;  2EFO A;  5GP9 A;  2LSO A;  1LEB A;  2Z16 A;  5BNG A;  2MD0 A;  4AD9 A;  3HRU A;  1MSF C;  5L3D A;  3BC8 A;  3S93 A;  2PI0 A;  1I3Q J;  1ZAO A;  3UNG C;  5BOX A;  2JA7 J;  3CZ6 A;  2GIV A;  2Q2E A;  4CYD A;  4IO9 F;  1A36 A;  1LFP A;  4G6T B;  4B1R A;  4G7Z F;  1UST A;  1MMS A;  3P9K A;  4D7M A;  3GYH X;  5D4S A;  5JR3 A;  1T33 A;  3L9F A;  4GCV A;  2CW8 A;  2R7F A;  2L9S A;  3C2G A;  2KIU A;  1TTY A;  3OOP A;  2BY1 A;  4JX6 A;  1QHG A;  2M4G A;  4FT8 A;  3W2W A;  3DV8 A;  4C3I J;  5LGT A;  2QCO A;  1Y0U A;  2MLG A;  4LIV A;  4Z6Y A;  2X1E A;  2CH0 A;  3JRH A;  3E5X A;  4AIH A;  2HXO A;  1W5C C;  3X2Q H;  4PJ0 C;  2VC1 A;  2ECB A;  2ZCW A;  1B8I B;  2X51 A;  1YIO A;  3HM5 A;  1XMX A;  2QBY A;  1IRG A;  2LTP A;  2DBB A;  4N9I A;  1OPC A;  3JAM K;  2Y48 A;  4W1U A;  2KJC A;  4JX5 A;  1H8A C;  1HCR A;  3SHF A;  2NRA C;  4WX9 A;  1WJB A;  1YJN I;  1IDY A;  1HF0 A;  5ICG A;  1MNE A;  3B73 A;  3SFZ A;  1ZGW A;  4P5O A;  4HPQ A;  3CC4 I;  5FLX Z;  2VKH A;  2M0C A;  2VN2 A;  3OIQ A;  3SJM A;  3L1P A;  1YW7 A;  1EV7 A;  2CQX A;  2V4J C;  4UHT A;  1K78 A;  2L4M A;  3BY6 A;  5GPA A;  2P5K A;  1P92 A;  4KN4 X;  4F55 A;  2CUJ A;  3AL0 C;  4M3E A;  3PO3 J;  2WB1 N;  2LLK A;  2GXG A;  5IT9 K;  5KAI C;  1OKR A;  1LDJ A;  3I3L A;  3CUQ C;  3E6C C;  2DFI A;  4GGG A;  2VBW A;  3MZ8 A;  3K6G A;  3PNV A;  3A2K A;  2E7W A;  2QSF X;  4KIT B;  5ICE A;  1JGS A;  2R5Z B;  3FXO A;  1VFC A;  3NAU A;  2R0Q C;  2CQQ A;  2LKS A;  4D5C A;  2G0E A;  3ASO H;  2QUF A;  3FMQ A;  2PMH A;  1YO5 C;  2BBY A;  4OMZ A;  2EIM H;  1K4S A;  3DLA A;  3OWT A;  1K79 A;  2BEO A;  3IH4 A;  3OYJ A;  1W4M A;  2CUE A;  1WRJ A;  1ZRD A;  1ZRC A;  2A69 F;  3C1D A;  2FNP A;  1HST A;  2LF8 A;  2VE9 A;  1O3Q A;  3I59 B;  2GWR A;  2KPM A;  4RLF A;  3DP7 A;  2BXY A;  1FOY A;  5F1J A;  2AXT C;  3S2W A;  1Y8Q B;  3FXM A;  1A5J A;  4BXU A;  3AAF A;  4LLN A;  2OUM A;  4KIF A;  3T0Y A;  1YI2 I;  2ZME B;  3QWL A;  1BJZ A;  2DCE A;  4LLG F;  4CO8 A;  4UUS B;  1LQ1 A;  2Z1D A;  3U1K A;  5D8L B;  1QVT A;  2JT1 A;  3Q9S A;  1D5V A;  4HV6 A;  3PQJ A;  1Z3Y A;  3BT9 A;  2AQE A;  1JKQ C;  1U5T A;  4JP0 A;  1O7F A;  4F3Q A;  4RB2 C;  3GFL A;  4FCY A;  2HQ5 A;  5HLI A;  3HRT A;  2XAF A;  1I3A A;  4ZYG A;  1TNS A;  5D5X B;  3LSG A;  5J1Y A;  1H88 C;  4IF4 A;  4ZH4 F;  2WAD A;  2Y0S N;  2VJI A;  3KCC A;  4P55 A;  3OYH A;  2AS5 F;  4G6D A;  4A6D A;  1ETK A;  1L0O C;  2DA2 A;  2QQ9 A;  3LAP A;  1TW2 A;  2EH3 A;  5EG0 A;  4IZZ A;  3I71 A;  1FSH A;  3RPQ A;  4IHY A;  1RES A;  3BG6 A;  2W00 A;  3BZK A;  5D5W B;  3MEX A;  4XNF A;  2ZFU A;  1MD0 A;  3ESW B;  2K5C A;  2JVH A;  4ITV A;  1B72 B;  3JRB A;  1JT0 A;  3BQZ A;  4DJA A;  2PX9 A;  1GVJ A;  1U0J A;  4HNV A;  1SVM A;  5E79 C;  3OYK A;  3CTA A;  2KRH A;  3ZCO A;  2STW A;  1EH7 A;  4Y7N J;  3BP8 A;  2JK3 A;  4WXH A;  5TRD A;  3FXR A;  5CKT A;  3QYF A;  4A3B J;  4BE2 A;  1J2X A;  1H89 C;  2EZK A;  3F22 A;  4Y4R A;  1SMY F;  1W1W E;  3ECO A;  3WOD F;  2O7O A;  3I9V 2;  3LSK A;  2JUC A;  4U7D A;  3RIR A;  1FNN A;  1EKE A;  3KE2 A;  3BZ6 A;  4FAS D;  2GOM A;  1I39 A;  4V2G A;  4MQV A;  1XSD A;  1YIJ I;  1JUM A;  3J81 K;  2R7T A;  4UUV A;  1YS6 A;  2FXA A;  2CQ7 A;  5J1R A;  3TDU C;  2ID3 A;  1S3J A;  5FJ8 J;  3K4M A;  1V54 H;  4EM2 A;  3G73 A;  3MD2 A;  3CCR I;  2EA4 A;  4HW0 A;  3WTZ A;  2CO5 A;  3S14 J;  1UHW A;  3NAR A;  4C9Y A;  3FM3 A;  1ZK8 A;  3L2V A;  1PUF B;  2MSY A;  3CCQ I;  1ZHF A;  2IEK A;  3QQA A;  4LB6 B;  3QOD A;  3I0T A;  4CCN A;  3IP4 B;  3K0L A;  2E2J J;  1DDN A;  2VB6 A;  5GAG J;  2XAS A;  3OS1 A;  2E35 A;  4HLY A;  2TCT A;  3S16 J;  2Z5U A;  2E5Z A;  2DT6 A;  1N75 A;  2DA6 A;  4MHG A;  3OYG A;  3FMS A;  2M5W A;  4HQM A;  2MD5 A;  4N9H A;  5FFZ A;  5EF6 A;  3A03 A;  5E3L A;  1RIO H;  3K2A A;  4IVN A;  2EJR A;  2LBF B;  1SFO J;  4U0Y A;  2FA5 A;  1YRN A;  1RI7 A;  4EEF G;  1H9T A;  2DA5 A;  2DFH A;  3JRC A;  4PCQ A;  3FMR A;  4MTE A;  5F0H A;  4WK8 F;  5H6R A;  2MH2 A;  3DTE A;  2VQL A;  1RC9 A;  2LP0 A;  1EH6 A;  1CF7 B;  1QQI A;  5C4J J;  1R22 A;  1IW7 F;  2VI6 A;  2R92 J;  1BI3 A;  3HHG A;  3HOV J;  4XQF A;  2H8W A;  2F5D A;  2VKV A;  4HNT A;  2VE8 A;  4U87 A;  1FTT A;  1LDD A;  1BJA A;  3OSF A;  1VI0 A;  2CMP A;  4AM3 A;  2L54 A;  1RRJ A;  2RRE A;  3MZY A;  4PDK A;  4G94 A;  1ULY A;  2K9N A;  2XUB A;  1JJ8 C;  3CCM I;  1IRZ A;  4WF2 A;  1BN5 A;  1JI8 A;  2XVC A;  3DU5 A;  3VYR B;  2LY9 A;  1J9I A;  1TNT A;  2VBY A;  5J3L A;  2EIN H;  1OCT C;  2M8G X;  5JLX A;  4CYC A;  2MH9 A;  4G7H F;  1WFX A;  5EYR A;  3PNY A;  3FK6 A;  3ZQQ A;  4PJJ A;  1FLI A;  3H9G A;  2DA7 A;  4LOC A;  3MKL A;  3CDI A;  3F72 A;  3NWT A;  4A3D J;  3BWG A;  5TIS C;  4I7H A;  2UV1 A;  4G7O F;  4DZP A;  5AIP A;  2DOE A;  2XV4 S;  2HYG D;  3CMM A;  2D1V A;  2OA4 A;  4QLC U;  1Y39 A;  4D9J A;  2BYV E;  1MIJ A;  3LMM A;  2J5P A;  3QPL A;  3J80 K;  3IUO A;  2P0W A;  3S1M J;  3K1M A;  2EFQ A;  4A0Z A;  4IRI A;  1IN5 A;  2FRH A;  1VND A;  3BTI A;  2DLL A;  2VBZ A;  3G2B A;  2HFH A;  3GTQ J;  1TWC J;  1WH5 A;  3CCV I;  1MH3 A;  4BQQ A;  2HXI A;  4ETS A;  2FX0 A;  3PNT A;  3CP8 A;  2V9P A;  4UB6 C;  4XSX F;  5FKL A;  1D0X A;  2PJR B;  5GPC A;  4FX0 A;  5L3F A;  2RQP A;  1GV5 A;  4C2M J;  1OYW A;  3N4M A;  5DDG A;  2V9K A;  2D45 A;  2NOG A;  1MNM C;  1G3S A;  2OCC H;  3GME A;  4BBR J;  1R7J A;  1SD5 A;  1V5E A;  3OYM A;  1NHA A;  1B9M A;  5LRS A;  4LLL A;  4LGW A;  4LIU A;  2ZXI A;  2EFP A;  2E36 A;  2EB7 A;  2DT7 B;  2LY2 A;  2FQ3 A;  3L2R A;  4Y15 A;  5HLG A;  2CGP A;  2LDU A;  4A0Y A;  1MDM A;  2RKH A;  5C3E J;  3GTO J;  5J47 A;  5C44 J;  5KVR A;  3S3M A;  5LBQ A;  3A02 A;  3QP5 A;  4DBR A;  3OSG A;  1BW5 A;  2O9L A;  4I99 C;  3LNQ A;  3HJE A;  2AQF A;  2F5V A;  3JR9 A;  4E7K A;  3CO7 C;  1SFK A;  4Q47 A;  1APL C;  2QF7 A;  4XRS G;  5J4Y A;  1ZQ3 P;  1GXP A;  2JA5 J;  4BKX A;  1K6O A;  2FQ4 A;  4BAY A;  3CLO A;  5L3C A;  2VKD A;  1SAN A;  4DYR A;  4PJL A;  1X4O A;  1V5G A;  3EYY A;  2DT5 A;  2VOD A;  2H8R A;  4QIW N;  4IRG A;  2F6C A;  4M9X A;  3FF5 A; 
#chains in the Genus database with same CATH homology
 2PMZ N;  4NDL A;  3B6C A;  3HOW J;  1ZKG A;  2X6O A;  2ID6 A;  2NVT J;  1OFC X;  5FKK A;  2LK2 A;  2XPU A;  2XGD A;  4FE7 A;  2K9Q A;  1IUF A;  3IH3 A;  1ZR2 A;  1I50 J;  2KDZ A;  5FLM J;  1JTY A;  2XPV A;  4JX4 A;  1E3O C;  1RET A;  3BG3 A;  4M6V A;  1JKP C;  4MO7 A;  2ECC A;  3BG5 A;  5EZH A;  1ITY A;  2DA1 A;  1MBJ A;  3ZQF A;  1LFU P;  3SFI A;  1IDZ A;  2E2H J;  5EDN A;  1O4X A;  3ZOB A;  2ME6 A;  4DYC A;  4RDU A;  1MBG A;  1UHS A;  4M3G A;  3IV5 A;  4M3F A;  2R5Z A;  4MFE A;  1X2N A;  2Y9Y A;  2P81 A;  4MLO A;  2CU7 A;  1QRY A;  2DJN A;  1X2M A;  3TP3 A;  1QVU A;  1AU7 A;  4QSH A;  1IGN A;  1MBK A;  2DA4 A;  4A3F J;  1A6I A;  5F04 A;  5GP9 A;  3S2H J;  4DYQ A;  3GTP J;  3HGY A;  5BNG A;  1MH4 A;  3ZQH A;  1MSF C;  1I3Q J;  2JA7 J;  1ETY A;  3JRE A;  4B1R A;  1XS9 A;  2DMT A;  4JYK A;  2WAQ N;  1IG7 A;  1MBH A;  3W6V A;  4S0H B;  4D7M A;  1FIA A;  1JT6 A;  1T33 A;  1POG A;  3MN2 A;  3BR0 A;  3HDD A;  1Q1V A;  3B6A A;  3ZQG A;  4JX6 A;  4C3I J;  4I6Z A;  4Y52 J;  2QCO A;  1WCM J;  5EGO A;  2EZI A;  4A69 C;  2FD5 A;  5M5W J;  1ETQ A;  4DW6 A;  4X1E A;  2NS8 A;  3JRH A;  3G1M A;  4X6A J;  2HXO A;  5M3F J;  1F36 A;  2FJ1 A;  3GTJ J;  2OF7 A;  2R7Z J;  2ECB A;  1B8I B;  3WHC A;  2JN6 A;  3HM5 A;  1RPW A;  2LTP A;  2HI3 A;  2NVY J;  2EQR A;  4W1U A;  4JX5 A;  1H8A C;  3ZQC A;  1HCR A;  3OIO A;  2JWT A;  4FE4 A;  2E19 A;  1IDY A;  1HF0 A;  1G2H A;  1B72 A;  1ZGW A;  1IC8 A;  2L7Z A;  1OJL A;  3HOX J;  1JKR C;  1NK2 P;  3CDL A;  1TWF J;  2M0C A;  4A3J J;  3SJM A;  3L1P A;  2CQX A;  2JMW A;  5GPA A;  3FK7 A;  3BR5 A;  1MBF A;  4M3E A;  3PO3 J;  2WB1 N;  2LLK A;  3GTM J;  1X58 A;  3LSR A;  1JTX A;  3BR6 A;  2TRT A;  3M3Y J;  2JA6 J;  2LVS A;  4A3C J;  1GT0 C;  3HOY J;  4UUT A;  2R5Z B;  1VFC A;  3NAU A;  2R0Q C;  1W0U A;  2CQQ A;  5J1U A;  4D5C A;  2G0E A;  1W0T A;  4I76 A;  4RBO A;  5IYB J;  2DMN A;  2NVQ J;  5FKM A;  1U8B A;  1AKH B;  4B3A A;  2DA3 A;  3IH4 A;  3CCY A;  2RAE A;  3OOU A;  1Y1W J;  1UMQ A;  2CUE A;  2MW8 A;  3HEF A;  2M34 A;  4G12 A;  1PUF A;  1TWH J;  3C2B A;  4AYB N;  1ZTR A;  3CQZ J;  5K7Z A;  2K9S A;  5F1J A;  2L0K A;  2XPW A;  1JUP A;  2XB0 X;  4FIS A;  1WH7 A;  5K7F A;  1A5J A;  4J19 A;  1FJL A;  2GBY A;  4IHV A;  1BJZ A;  5DS9 A;  4UUS B;  1DU0 A;  4GFB A;  1QVT A;  2JJ7 A;  1XG1 A;  2DN0 A;  3BT9 A;  3HOU J;  1JKQ C;  2GLO A;  2MG4 A;  4JP0 A;  4FTH A;  5C4X J;  2AO9 A;  4ABZ A;  5EGO B;  3Q0V A;  4FCY A;  2HQ5 A;  3JRA A;  1U78 A;  4C3J J;  4D5F A;  2L9R A;  3FIW A;  5F0F A;  1RR7 A;  3LSG A;  5J1Y A;  4XRM A;  4L5E A;  1H88 C;  2IBD A;  3JRF A;  2Y0S N;  2ME0 A;  1NTC A;  3G1O A;  3S15 J;  3O8G A;  1ETK A;  3MVP A;  4XK4 A;  4XID A;  2NS7 A;  2DA2 A;  2EH3 A;  5EG0 A;  3BTL A;  4IHY A;  1NK3 P;  1RES A;  2B63 J;  2COB A;  3K7A J;  2ELK A;  3BR1 A;  1QPI A;  3JRD A;  2R5Y A;  2CJJ A;  1B72 B;  3JRB A;  1JT0 A;  1LE8 B;  2LKX A;  3BQZ A;  3DCF A;  3GTK J;  5IP9 J;  5EZG A;  4A3K J;  4HNV A;  1HDD C;  4A3I J;  1DU6 A;  4Y7N J;  2JK3 A;  3JRI A;  1K83 J;  2HOS A;  1HLV A;  3I4M J;  3HGG A;  4A3B J;  1WPK A;  2O8K A;  1FEX A;  5F0C A;  5IOZ A;  2N8G A;  4A3E J;  1H89 C;  2EZK A;  2D5V A;  5E3M A;  2O7O A;  5E3N A;  4W97 A;  5F08 A;  1FTZ A;  1OCP A;  4V2G A;  2ZB9 A;  1I6H J;  3A01 A;  4BBS J;  1JUM A;  2M9H A;  3BTJ A;  3S2D J;  5FLV A;  5F27 A;  5J1R A;  2ID3 A;  1GUU A;  4M3D A;  3H0G J;  5FJ8 J;  4QTR A;  3S1R J;  3RZO J;  1K61 A;  4BY7 J;  3ZQI A;  2LFB A;  4D7N A;  3S14 J;  2X9D A;  3NAR A;  1VF9 A;  5E3O A;  1ZK8 A;  1PUF B;  4BY1 J;  2MSY A;  4BXX J;  2WV1 A;  5M5X J;  2IEK A;  2KT0 A;  3QQA A;  2VPR A;  3LOC A;  3O8H A;  3H3V K;  3GTG J;  4A93 J;  1D5Y A;  1LFB A;  2E2J J;  3TED A;  2YU9 J;  1JUS A;  3BTC A;  3UKG A;  1JGG A;  2TCT A;  3GBG A;  2LR8 A;  1IJW C;  3S16 J;  2EZL A;  2DA6 A;  4AUX A;  1Y1V J;  3IH2 A;  5EF6 A;  3GTL J;  3A03 A;  5E3L A;  3RZD J;  2HDD A;  3K2A A;  3RQI A;  3DEW A;  1SFO J;  2MGQ A;  2L7M P;  1YRN A;  4EEF G;  3TP0 A;  2DMP A;  1ETO A;  2DA5 A;  2Y9Z A;  4IEJ A;  3JRC A;  5FKN A;  3S1Q J;  5F0H A;  3RKQ A;  4IHX A;  1ORK A;  2LP0 A;  3E7L A;  4C3H J;  2HOT A;  1UG2 A;  9ANT A;  1RKW A;  3VPR A;  2VKE A;  5C4J J;  2Y2Z A;  3PO2 J;  2VI6 A;  2R92 J;  3HOV J;  2EBI A;  2VKV A;  5IYD J;  2EZH A;  5FKO A;  1XC5 A;  1FTT A;  1WI3 A;  1BA5 A;  2XRL A;  2I10 A;  3OSF A;  1VI0 A;  2R5Y B;  1P7J A;  2YS9 A;  3BR3 A;  3I4N J;  1TWA J;  2E1O A;  2HYJ A;  5K7H A;  2OPT A;  1ZR4 A;  2K9N A;  2W48 A;  1JJ8 C;  1Z77 A;  2Y30 A;  2GM4 A;  4XIC A;  1IRZ A;  5JLW A;  2LY9 A;  3PM1 A;  5J3L A;  1OCT C;  2M8G X;  1TC3 C;  5JLX A;  4CYC A;  1RKT A;  4M3B A;  5EYR A;  3FK6 A;  3SDG A;  2YUS A;  4AC0 A;  1T56 A;  2DA7 A;  4LOC A;  3HKZ N;  3MKL A;  3ZQL A;  4A3D J;  1U9N A;  1R9T J;  1MBE A;  3A01 B;  3HOZ J;  4DZP A;  1GV2 A;  1AHD P;  2HOA A;  4A3G J;  5IP7 J;  1BL0 A;  1MSE C;  1AKH A;  1ETX A;  3QPL A;  5IPA A;  3S1M J;  2XSD C;  3S17 J;  1VND A;  3BTI A;  2NVX J;  3GTQ J;  1TWC J;  1WH5 A;  1MH3 A;  2HXI A;  2FX0 A;  1ENH A;  2L7F P;  2DTZ A;  1U9O A;  1CQT A;  5FKL A;  4IHW A;  3QPS A;  5GPC A;  1P7I A;  2X48 A;  4B4C A;  4DZJ A;  2AHQ A;  2LD5 A;  1GV5 A;  3D1N I;  4C2M J;  5IOY A;  5IP6 A;  2H1K A;  4UUS A;  4MIM A;  2Y31 A;  3TW7 A;  1IV6 A;  2NOG A;  3Q0W A;  2VUM J;  1MNM C;  1TWG J;  1FIP A;  3BR2 A;  4BBR J;  3F0C A;  3S1N J;  1YRN B;  1S7E A;  3HBL A;  5EEA A;  2XB5 A;  1WGX A;  1ETW A;  1BW6 A;  2JA8 J;  3WHB A;  4MFD A;  3FIS A;  3BQY A;  2R93 J;  5C3E J;  3GTO J;  1JJ6 C;  5C44 J;  1F43 A;  3Q3S A;  3BG9 A;  4A3M J;  3A02 A;  2K40 A;  1GVD A;  2M2E A;  2XGC A;  5M3M J;  3G1L A;  5IYC J;  3LSP A;  3OSG A;  2O9L A;  1BW5 A;  1LE8 A;  3TW6 A;  3HB9 A;  5HOD A;  3LNQ A;  3JR9 A;  2IAI A;  3LSJ A;  5M5Y J;  2CRG A;  1Z0X A;  3M4O J;  2E2I J;  1APL C;  2QF7 A;  4XRS G;  2DMQ A;  3JRG A;  1ZQ3 P;  5DTD A;  4XRS A;  2JA5 J;  4BKX A;  3FKI J;  2XGE A;  2FQ4 A;  1JKO C;  3CMY A;  2CUF A;  4V2F A;  1SAN A;  3Q0U A;  4CYC B;  1EF4 A;  4DYR A;  1HDP A;  4A3L J;  1B8I A;  1HOM A;  2H8R A;  4QIW N;  5EG0 B;  1ETV A;  2DMU A;  1GDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...