1FYMA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a tail-to-tail orientation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
86
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords TAIL-TO-TAIL HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 25
structure length 86
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fymA00
3GLXA 4M72A 1XD7A 4MGRA 1FC3A 2PFBA 1RUOA 1L3LA 1FBSA 4YFXF 2E1NA 4CO8A 4ZZDA 1LB2A 5ICGA 1ZH5A 5IT9Z 2R3SA 2QLZA 2JSCA 4Y13A 4G7OF 1BBYA 2EFWA 4OIRF 2XKPA 4ETSA 4FX4A 4O3MA 3F8FA 4I98B 3FMSA 4G7HF 4CYDA 1XCVA 3T5XA 2R7FA 1USSA 1FSEA 4FT8A 2TDXA 1OYYA 3MWMA 1YFHA 1YQAA 5A2QZ 1EH8A 3WE2A 2VXZA 2O6GE 4U7BA 2JPBA 4RGUA 2KRFA 2YPRA 3KETA 4WWCA 1REPC 4A0XA 2E7XA 3IWZA 1R1VA 4OIOF 3R4KA 2EK5A 1FSHA 5H6RA 2VT2A 1P4XA 1TNSA 3V8KA 1BOAA 5D5UB 1D3YA 3MFKA 2UXXA 4P5OA 2O03A 2L02A 1O3RA 3RKWA 5BS6A 5JHUA 3FXUA 5HS8A 4YG2F 1B9NA 3J80K 3M7GA 3TQNA 4LMYA 5HLGA 3E6CC 2UXNA 3N4MA 1SD5A 2AS5F 4G6QA 1RNLA 3CLOA 2DI3A 3KLNA 5LBQA 5TJJA 2XKOA 3I59A 1I5ZA 4LGWA 5CLSA 2ADUA 2W84A 1DUXC 4H0EA 3GEZA 2EV6A 1S29A 4ZYDA 3KP2A 4Y15A 1ZLJA 4ESJA 3NRVA 3MQ0A 4MEYF 3FZVA 2MD5A 2PI0A 4EGZA 3WTXC 3SZPA 5LEKA 3GZ5A 1LNWA 4PDKA 2L01A 2RDPA 1R00A 4WK8F 2P5LC 4UHTA 2XV4S 3NEUA 5D5WB 1ZG1A 2JZYA 3L09A 2VBYA 1BIAA 1W5SA 2EFQA 4I02A 3ZMSA 2MH9A 4OIPF 5CVRA 1IN7A 2EFOA 1XSDA 1G3YA 3GUDA 1H9GA 3P9CA 4LB6B 5L3DA 4BYYA 1YW7A 4WXDA 3WTZA 2ELHA 2NYXA 3REOA 3GW2A 4BXUA 2BGCA 3WTTC 1O3TA 5K5QA 3KP7A 4KIBA 4TV7A 4IHSA 3BJAA 4A2UA 3U1DA 2X0LA 3C7JA 4BHBA 2F5EA 2W25A 4U88A 5HDKA 3M1EA 2LKPA 1B4AA 3M8FA 2QZ8A 1ZG5A 2V1UA 5CVUA 3ZPLA 1ZREA 2DT5A 4XLPF 5BOXA 3KP4A 4WXHA 2OD5A 3ROUA 4N9HA 3GX4X 3R0JA 1PP7U 4ZYEA 3F8MA 4CGZA 3SHFA 2ESNA 4EM1A 1IXRC 3WTVC 6PAXA 2JTVA 2XAQA 4EMSA 2G7HA 1UB9A 5E1XA 3E3VA 2VN2A 1O7FA 1XGSA 4EQQA 1Q1HA 3MZYA 5ICEA 2VOOA 3GWZA 4U0VA 3MEXA 4U0YA 3MCZA 3FMRA 4RGSA 2V79A 4K2EA 4F7ZA 3QP5A 4HF1A 3V4GA 1HW2A 4BQAA 2M45A 4KN7X 1R7JA 3F6VA 1SAXA 1R1UA 1JHHA 3B73A 3HRMA 4QWQA 2YX4A 4IHTA 5AIPA 3VEPA 1FNNA 1R1TA 3VFZA 3DQVC 2DQLA 1Z05A 1XGMA 2ACJA 1C0WA 2HKXA 1IUYA 5LHHA 2XROA 1KU3A 2DTRA 1HBXG 2GXBA 1SMYF 1F4KA 1BM9A 3PFIA 4L5JA 2IA2A 4OINF 5LEJA 4NB5A 1Z9CA 3JTGA 5H20A 2Z33A 3ZQ7A 1T0FA 3TKYA 5HDGA 3ZP5A 2Z3YA 2A6HF 1J7KA 3ERED 3O2PE 1UHMA 3GFJA 1Z7UA 2WV0A 5D6FA 2OQGA 2L3DA 2EFNA 2ZMEB 3HOTA 5CYVA 2RKHA 1V4RA 2KJCA 5IT9K 1L0OC 2XIGA 2QQ9A 2MA3A 4G8XA 4BHCA 4M73A 2O3FA 1NHAA 2M8EA 3V7RA 1J0RA 1ZGAA 2Q8KA 3F8NA 1ON2A 2GWRA 3E5XA 1K78A 3LQQA 2E1CA 1FYKA 2YSRA 1T38A 2PMHA 4UV9A 1ZYRF 1G3WA 4Z2YA 2WC2A 3JW4A 2QM3A 1R5HA 2PEXA 1ZAOA 1IRGA 4KIGA 5A2QK 1DDNA 2M5WA 4G9YA 5J6XA 1MD0A 3K9TA 1IN4A 2CW0F 4ZZLA 2IA1A 5E18F 2GA2A 3CUQB 3G3ZA 1EV7A 3I64A 1YW9A 5FFXA 2QENA 3EETA 1U3EM 5LRSA 2FU4A 4R1HA 2DW4A 4A12A 3WTYC 5DCMA 4JBAA 1U5TB 4HDUA 4PCQA 1W5TA 3FM5A 3KP3A 4A0ZA 1K79A 3L7WA 3OV8A 4DQ2A 1TQIA 1T98A 1YTYA 4RGXA 1AOYA 4L0YB 3RKXA 2EA2A 2A3SA 4D0PA 2NRAC 3H92A 2GZWA 2VONA 4WCGA 3IRQA 3TO9A 3FWEA 5D6EA 4WX9A 3Q5FA 2XRNA 3BPVA 4HF0A 3F6OA 5ERIA 1SFEA 3VOEA 3WODF 2HWVA 2HYGD 3I71A 4LD5A 1A04A 4LB5A 1O3QA 5AIQA 1SD4A 4A5MA 1CF7A 1FOKA 5CVVA 4I09A 2CG4A 4P55A 4P9FA 5ICCA 3LQRA 1BI1A 4BHPA 1YIOA 1G3SA 4ASNA 5JR3A 3IHUA 4HLXA 3RTRA 4ZYGA 3O6BB 4DNCA 5L3EA 1I1GA 1R5GA 4ESFA 5LGUA 4IRIA 3G73A 3LA2A 1F5TA 2XAFA 4M74A 4KA4A 5CVIA 2FMYA 4MQ9F 3LFKA 2DU9A 2QUFA 3SXYA 2H09A 2DPDA 3F8BA 3ABTA 3F3XA 1S8NA 2Q0OA 1UFMA 2ZFWA 2F2EA 1WSUA 2F5DA 3FXRA 2D2WA 2IT0A 3WU1B 4UVAA 1J2XA 1BN5A 2NS0A 2Z9OA 2XASA 5LRRA 3RI4A 2GXGA 2RVCA 2CWEA 3WGIA 5K5RA 4WF2A 2YU3A 5FGMA 1EH7A 1BI3A 4CHUA 4ZH4F 4AWXB 1R36A 1QNTA 2ZO4A 3DF8A 2DK5A 1IXCA 2FXAA 4HV5A 5IT3A 5HS9A 5DEQA 3KEOA 3V8JA 1OKRA 1ON1A 1DPRA 2DK8A 2VC0A 5FD6A 4EJWA 3KZYA 1YYVA 1ZN2A 4HX4A 3ZMDA 2BE5F 3CO6C 2A6EF 2LSOA 3WE3A 4LFUA 4OOIA 2ZCWA 5ILSA 4RAYA 2GQQA 2V6CA 1XMKA 2FQ3A 2D1HA 2H6BA 1J75A 2YX7A 3HSFA 3FXQA 4HF2A 2FSWA 3T8RA 1HKQA 3BY6A 3K69A 1LEAA 4HQMA 4AIKA 4UVCA 1Y0UA 4HQEA 4KT5C 3MZHA 3KLOA 1T6SA 2HZTA 4BAYA 3DPTA 2FMLA 3HYIA 4XLNF 1KA8A 1G3TA 3CDHA 2O8XA 1IXSB 5D5VB 1ZLKA 2FOKA 2QWWA 2JT1A 1B9MA 3QAHA 3TO7A 2CFXA 3C3WA 2PG4A 5E1ZB 3ZN0A 4G6DA 2K02A 5LGTA 3I58A 2AXLA 5ICFA 3QPHA 5F6FA 1GXQA 2RNJA 4Q48A 4JK1X 2IA0A 1E17A 2OZ6A 1UHWA 3TOAA 4JQFA 3TGNA 4PZJA 3IRRA 2G9WA 3DFGA 3VODA 4CZZA 1ZARA 4GO1A 2HTJA 1OPCA 5E8GA 5HS7A 2IJLA 4I7HA 3EUHA 4LG0A 2VE9A 3JSPA 1P92A 2BEOA 3H3ZA 1JXSA 5KVRA 3CUOA 2HFHA 3R61A 2EV0A 1QZYA 3FMQA 1S3JA 3BOQA 4UV8A 2EFPA 1D8JA 1J5YA 4EJVA 2ETHA 4EJUA 1UCRA 4IPAA 2A5YB 3C1DA 1CGPA 3ABUA 5F64A 5D8LB 1P6RA 1MJ9A 2Z5UA 4RB1A 1ZGJA 2P8TA 2IP2A 1D8KA 4LLNA 3HUGA 2H94A 1JE8A 2OBPA 3HRTA 3HRSA 1QQIA 3LAPA 1MDMA 2PQ8A 2K4BA 2K27A 2G7UA 2K86A 5JVTA 2QBYB 2K4JA 3HSEA 3HHHA 1S6LA 2C6YA 2HS5A 3QU6A 1TLHB 4EV0A 2W24A 1G6NA 2RV8A 3S2WA 1BC8C 1B6AA 1E2XA 1SMTA 2HOEA 1W7PA 4U7DA 5TRDA 2F5FA 2EA4A 2RGVA 1XGOA 2FNPA 2XUBA 3KCCA 2V1DA 4G94A 3U2RA 1HW5A 1WI9A 4RB0A 2XAHA 3KP6A 4B8XA 5D4SA 3E5QA 4ENMA 1ZHFA 4EM2A 3RJPA 4EVIA 4OU0A 2FF4A 3P7NA 1PUEE 3N97A 4YFKF 3EDPA 3DP7A 1P2FA 3FHZA 1FP1D 2KKOA 2DLLA 2OA4A 4RB2C 4HLYA 3CUQA 4HYEA 2DFIA 2PN6A 2RQPA 2F5CA 2FBHA 3SZTA 4BNCA 1U5TA 2XHKA 4KMFA 3I5UA 3QRFF 2WWYA 3BROA 4IXAA 3I4PA 3J81Z 1W4MA 1F9NA 5LHIA 3WTWC 3DKWA 1I27A 4LLLA 3DPLC 5L3CA 5DYMA 1YO5C 2HEOA 1XGNA 4RB3C 2JRTA 5L3FA 2MLKA 2EV5A 4KMUX 2ISZA 3V7SA 4UUVA 2IVMA 3ZMZA 5ILUA 4LK0F 5FLXZ 3RPUA 3PQKA 4I01A 5DD8A 4ENNA 1MJAA 1HW1A 4LLGF 1FYMA 3JAMZ 2Q2EA 3D5LA 3CO7C 4CICA 1BC7C 1FBUA 4HX7A 4YIFA 4OMYA 2BYVE 3E5UA 5H6QA 4I0AA 3KP5A 4M6YA 4IRGA 4GYGA 1ULYA 1ZRFA 2VBZA 3HTUA 2FNAA 2P7VB 1R23A 3E6MA 1QBJA 1O7LA 4ENKA 5E20A 3L9FA 4XSXF 5EEGA 4AD9A 3HOSA 2UZKA 1ZRCA 2ZXJA 1KQ9A 5JI6A 3V7CA 4AVPA 4A6DA 4HV6A 4Q5SF 3RYPA 1GVJA 3F23A 1USTA 4KNYA 1MGTA 2E7WA 5HDNA 3GFMA 2MLGA 5DD4A 4QLCU 4P9UA 1IZ1A 4L9JA 1MZBA 3Q9VA 2VT3A 2ZNYA 1U78A 3TDZC 2P6SA 2STWA 1TQMA 2XAJA 4KICA 5HOOA 3CUQC 2JPCA 1K7AA 4M9SA 4I0BA 5K1YA 3IKVA 4KFCA 2COMA 4EM0B 4XSZF 4G7ZF 1T2KA 1U5TC 4S05A 2YR2A 5BQTA 1P4AA 3WGGA 3L2CA 4HAMA 3I0TA 3NQOA 4S04A 1XDUA 4A0YA 2W57A 3GO5A 5ILVA 3IC7A 2PLYA 3ECHA 3JSOA 2CO5A 1MKMA 3HTSB 3T1BA 2HYFA 4L0ZB 1S7AA 1G4DA 2ZBKA 3B02A 1FWZA 2HQNA 4M9ZA 2STTA 1XN7A 4MNUA 2HTSA 3E6BA 2EWNA 3ML6A 3C18A 3F8CA 2MBFA 3GFLA 2DPUA 3DXJF 5HLHA 4O6JA 1HKSA 3OOPA 2R7DA 1JHFA 1TW2A 2VBWA 3IKTA 1SFUA 2LNBA 1K78B 2MH2A 3WG9A 3F21A 2V1XA 1GXPA 3IL2A 3KFWX 2GA1A 4IRHA 1VTNC 2VOPA 2PMUA 5ED4A 3ISPA 1I1SA 1H9TA 1KQ0A 2M1BA 5D4RA 3H3UA 1QGPA 1WKMA 2XAGA 3QU3A 3RKYA 3BWGA 1IAWA 2H27A 2FE3A 2DBBA 3K0LA 2P4WA 5DCMB 4L18B 4PGGA 5FD5A 4AIJA 4P96A 1FPQA 3FM3A 4A5NA 3J7AO 3LA3A 1FT9A 2BBYA 4RGRA 4PGHA 1HKTA 2OZUA 3ELKA 3LWFA 1IW7F 1TTYA 2M30A 2P5KA 1XB4A 5HLIA 3WGHA 1WRJA 3M8EA 4HA8A 3D0SA 3KZZA 1XSXA 2X4HA 5F1RA 3F72A 3KE2A 3U9GA 3R0AA 4WXCA 4KDPA 3LA7A 1TW3A 4HZFA 3F22A 2HR3A 1CF7B 5LGNA 1XCBA 1Z1DA 4O5VA 5DUIA 1YLFA 1FLIA 3R60A 2QBYA 2L4MA 4RAZA 3HSRA 2GAUA 1BJAA 1ONVA 4HX8A 1XDSA 2OAZA 3Q9SA 2OQRA 5FO5A 2QQBA 1XMAA 3J81K 3CJNA 3HIFA 1KYWA 2FBKA 2A68F 4GXOA 4N0BA 1Z6TA 3BJ6A 1R58A 1TNTA 3QPTA 1HSJA 4AIHA 3P9KA 3QP6A 2LDUA 2PJPA 1PP8F 4UNOA 5FLXK 5DDGA 3HRUA 4NQWA 5JFRA 4MTDA 1DPUA 4MHGA 3JAMK 3E6DA 4R79A 2WTEA 3GFIA 1ZRDA 2PBIA 4ON0A 3W6JB 5DCFA 4UXNA 1STZA 2CQKA 4Q47A 1YW8A 1U8RA 1FYLA 5K5OA 2O61A 1GHCA 1FBQA 1LDJA 3WU0A 2L4AA 4EJTA 3KEQA 3BPXA 4LJZF 1OYWA 3GVAA 1H0MA 2BV6A 3DEUA 3K1PA 2IPQX 1K6OA 3BP8A 1BIBA 1ZG3A 4FHTA 4GCVA 1HSTA 4IJAA 5L3BA 4OMZA 4L9VA 4MQVA 2CSOA 4L9TA 2KIMA 2HDCA 2O0YA 2FA5A 3O3KA 1EH6A 2FRHA 1P4WA 1IN8A 1YS7A 1LEBA 2ZKZA 3M9AA 1O3SA 2ESHA 1WWXA 4YIIA 1D5VA 2P6TA 2ZMEA 1LQ1A 1IF1A 3SQNA 1KU2A 3ZN1A 1KQ8A 5FB2A 2IW5A 3BZ6A 5E1WA 4Q4ZF 3EYIA 5KK1A 3AAFA 1QO0D 4A6EA 3R6SA 4HBLA 1RUNA 4BH9A 3RPQA 3LAJA 3JTHA 4HOBA 4I2OA 2QQAA 2KIFA 2EB7A 3MAJA 4M6XA 1J9IA 3I59B 3PQJA 1YS6A 3GF2A 1OYIA 3HHGA 1B1BA 3W6KB 5D5XB 2UWMA 4IVNA 3GXOA 3TO6A 4RS8A 2H6CA 4UVBA 2CYYA 2QYOA 2J5OA 1PDNC 5CVJA 2ISYA 2VE8A 4MEXF 4B09A 2VODA 3T8TA 5AONA 4LG0B 4CDGA 1FX7A 5LHGA 1KU7A 1WQ2A 3L00A 3I53A 2FBIA 1FY7A 4KIFA 1FP2A 1LDKB 4YFNF 3J80Z 5J8CA 2EJRA 1KGSA 2Y48A 1RIOH 1BI0A 4XRFA 1IN5A 1U6GA 2M87A 1QZZA 1LDDA 1QPMA 2ZJ2A 3K2ZA 2A07F 5LLQA 1SFXA 4LK1F 1I6XA 4E70A 2RC4A 3GZ6A 3ZMVA 4M9XA 3ULQB 4N9IA 1Z91A 4R8HA 3BJOA 3LSTA 5L3GA 2XGXA 5DV5A 3T0YA 1IRFA 1LVAA 2Y0MA 1MDMB 1OMIA 5J8FA 2RN7A 4EGYA 5EEHA 2Y75A 3FF5A 4ESBA 4M71A 4KUMA 5CJ9A 4IF4A 4OIQF 4ZYHA 3K1MA 1HXDA 3ECOA 2HGCA 3EYYA 3VB2A 4FX0A 4GYIA 1W7PD 1W7PB 3EQLF 1U2WA 3TOBA 2CGPA 3WTSC 3V8LA 2VC1A 2IRFG 1KYZA 4HW0A 2LF8A 2OU2A 3I54A 4U0WA 2DQRA 3QOPA 1F1ZA 2LF7A 1OR7A 1AWCA 5E8IA 1B59A 4CXFA 2V9VA 2D1VA 3ZMUA 3TDUC 2D45A 2W85A 4EJOA 3GYHX 5DUKA 1IN6A 1XSVA 1HQCA 4ENJA 2A61A 3WTUC 2J5PA 5E17F 5D8KB 5HVQC 3RDIA 2FEZA 2P7CB 2NNNA 1Z6RA 2L54A 1SD6A 1DP7P 4L5IA 3BDDA 2VBXA 3E97A 4HDVA 4XBFA 3DV8A 3FX3A 2DAOA 1JGSA 3K1NA 2KJBA 5BMZA 2K7LA 1J59A 4GGGA 1KU9A 1ODDA 4NHJA 2A69F 1S7OA 3RIRA 4KYWA 4L9NA 1FZPB 5BPIA 2DO7A 2QVOA 5FFZA 2MC3A 1SD7A 1RZ4A 4KN4X 1TQPA 1T39A 3IWFA 2KIUA 3RYRA 3COAC 1TBXA 2ZNZA 1R22A 1LJ9A 1MJBA 3CTAA 1YG2A 1BI2A 4MTEA 1RI7A 2NNYA 2NAZA 2XVCA 2Z99A 2P5VA 1O57A 3SFZA 4Y17A 3P9IA 1X3UA 2HQRA 3ZMTA 1V3FA 2GIVA 5BPDA 2HKOA 2B0LA
chains in the Genus database with same CATH superfamily
2EZKA 2LRDA 3GLXA 2X9DA 2XDVA 2DMTA 3PNTA 4BUPA 1YX5A 3E7LA 4M72A 4BBRJ 1MH3A 1XD7A 3G4SI 5F0CA 4IL6C 4MGRA 1FC3A 2PFBA 1RUOA 3W2VA 1L3LA 1FBSA 4YFXF 2E1NA 4CO8A 4ZZDA 1LB2A 2JUGA 5ICGA 1ZH5A 5IT9Z 1JUSA 2R3SA 1X2NA 2QLZA 5J1RA 2JSCA 4Y13A 4G7OF 2ZSHB 1BBYA 2EFWA 4OIRF 3JRFA 2XKPA 4ETSA 4FX4A 4O3MA 3F8FA 2XAUA 4AM3A 1U0JA 2MC4A 4HG2A 2PMZA 4I98B 4F91B 3FMSA 4G7HF 1RR7A 4CYDA 1XCVA 5F0FA 2BY0A 3BG6A 3T5XA 3CC7I 2R7FA 3IAS2 1FMWA 1R49A 1USSA 1NK3P 3HGYA 1FSEA 2A05A 3GZNB 1TL8A 3BR6A 4FT8A 2TDXA 1OYYA 2L7KA 4I99C 1V5EA 3MWMA 5FKKA 4DIQA 4A3DJ 2DA1A 1ZQ3P 1YFHA 3ZRGA 1YQAA 1WCMJ 5A2QZ 1EH8A 1IG7A 2M4GA 3WE2A 2VXZA 2L7ZA 3JRGA 2O6GE 3QYEA 4U7BA 2JPBA 4RGUA 2KRFA 2YPRA 1NH3A 3KETA 2M9HA 1LE8A 4WWCA 3PFYA 3VWBA 1REPC 3FXJA 4C9YA 4A0XA 2E7XA 4N4NB 3IWZA 3RKQA 3ERMA 1R1VA 3BTLA 4BKXA 2WV1A 4XIDA 4OIOF 1EA3A 2EBIA 3R4KA 2EK5A 2E35A 1FSHA 3PNYA 5H6RA 2ZJPF 3E1SA 2VT2A 5M3FJ 3H9GA 1P4XA 3BZKA 1TNSA 3V8KA 4G12A 1BOAA 3ZXSA 5D5UB 1D3YA 2ZXWH 3MFKA 2UXXA 4P5OA 4A93J 2LKSA 2O03A 2L02A 2FD5A 1ZKGA 1O3RA 1B72A 2FUG2 3RKWA 2ECCA 5BS6A 5M5XJ 1VNDA 5JHUA 1N77A 3PUBA 3FXUA 5HS8A 3LSHA 4YG2F 1B9NA 3J80K 2GLOA 4RM2A 1I50J 3M7GA 3D1NI 2IS2A 3TQNA 4LMYA 5JHFA 4E7LA 5HLGA 2RQQA 3E6CC 2UXNA 2L9SA 4II3A 3K2AA 1IJWC 3N4MA 1SD5A 1MMGA 3AG2H 1K4SA 2AS5F 4G6QA 1RNLA 3GBGA 3CLOA 5M5YJ 2DI3A 3KLNA 5LBQA 3KZIC 2DXIA 3ABMH 1Z3XA 1YHQI 5TJJA 2XKOA 3I59A 2L2OA 2Z1DA 1I5ZA 2WY8Q 1E3PA 3ZQCA 2ZXIA 4LGWA 4HSTA 5CLSA 4PJLA 2ADUA 1QA6A 2W84A 3WHCA 5IYDJ 1N78A 1DUXC 4H0EA 5C4XJ 3GEZA 3DCFA 2EV6A 1MBEA 3CMMA 1S29A 4ZYDA 3KP2A 3BTIA 4Y15A 2EZHA 2LYCA 1ZLJA 1APLC 4XLEA 4ESJA 3NRVA 2K9MA 3MQ0A 2FOWA 4MEYF 3FZVA 2MD5A 2PI0A 1W1WE 4W1UA 2KLOA 4EGZA 3WTXC 4OAYA 3HBLA 3GLLA 3SZPA 5LEKA 3GZ5A 2OV7A 2OTLI 2NVXJ 2MGQA 1LNWA 4M3FA 4PDKA 4J01A 2L01A 2RDPA 3W6VA 1R00A 4WK8F 2P5LC 5J4YA 4UHTA 2XV4S 3NEUA 5D5WB 4LG3A 1ZG1A 2R5ZA 2JZYA 1HCRA 3L09A 1TT5B 4X0GA 2VBYA 3HPHA 1BIAA 2DA6A 3QPLA 1W5SA 2EFQA 4I02A 3ZMSA 1UAAA 2MH9A 2B63J 4OIPF 2GBYA 2VKVA 5CVRA 2CV2A 3OYBA 1E3OC 1IV6A 1IN7A 2EFOA 1XSDA 1G3YA 1PJRA 2XGCA 3CCMI 1RETA 3GUDA 1H9GA 3P9CA 4LB6B 2K3FA 5L3DA 5F04A 4BYYA 1YW7A 4WXDA 2GXAA 1S9HA 2K9NA 4IHVA 3WTZA 2ELHA 2NYXA 3REOA 3GW2A 4BXUA 2BGCA 2R7OA 3WTTC 3JRCA 5DTDA 1O3TA 1Z7LA 2CFOA 5K5QA 3KP7A 4KIBA 4TV7A 3VYUB 3TW6A 4IHSA 1T56A 3BLYA 1IRXA 1BR2A 2WAEA 3BJAA 4A3CJ 1A6IA 3N05A 4A2UA 2DDBA 3U1DA 1HOMA 4JX4A 2X0LA 1OISA 3C7JA 4BHBA 2F5EA 2W25A 3A0HC 4U88A 5HDKA 2QKLB 3GTKJ 3M1EA 2LKPA 1B4AA 3M8FA 2QZ8A 2IS1A 2CUJA 1ZG5A 1DU0A 2V1UA 5CVUA 3A03A 3ZPLA 1ZREA 3I56I 2EIMH 2DT5A 3CC2I 3FBIB 4XLPF 5BOXA 3KP4A 2M7AA 4WXHA 2OD5A 5IP7J 1AA7A 2HU9A 2L0KA 3SYTA 3ROUA 3AG1H 4N9HA 3GX4X 3R0JA 3DLAA 2VUMJ 1PP7U 4ZYEA 3CCLI 1SVLA 3QYBA 4A3FJ 3F8MA 4CGZA 2X48A 3CMAI 3W2AA 3SHFA 5HODA 2ESNA 3BR2A 1IXRC 3O8GA 4EM1A 4PSWA 3WTVC 6PAXA 2Y9YA 1NG6A 2JTVA 2XAQA 4DYCA 3K7AJ 1MBHA 2DJNA 4EMSA 1P7JA 2G7HA 1UB9A 4HRIA 4E7ZA 5E1XA 3FKIJ 1Y8RB 2L5QA 2QSFX 3E3VA 2OC6A 2VN2A 5E3NA 1O7FA 1XGSA 2F4MB 4EQQA 1Q1HA 3MZYA 5ICEA 2VOOA 4DW6A 1JT0A 4D5FA 3GWZA 1ORKA 1SEUA 4U0VA 3MEXA 4U0YA 2X1EA 5CPRB 3TBIA 3GTGJ 3K70D 3MCZA 3FMRA 1BJZA 4RGSA 1G59A 2V79A 3OYKA 4K2EA 4F7ZA 3QYFA 3DEEA 3QP5A 4NQWB 4HF1A 3V4GA 1MNEA 1HW2A 2X6WA 4BQAA 2M45A 4CCNA 3S3MA 2DT7B 4KN7X 1R7JA 3F6VA 2AQEA 5HNFA 4L5EA 1SAXA 2FQ4A 2KL4A 3B73A 1JHHA 1R1UA 3HRMA 2TRTA 4IKFA 4QWQA 2YX4A 4IHTA 3LSKA 5AIPA 3VEPA 1FNNA 3KIOA 2WBMA 4QPOA 1R1TA 2CV1A 3VFZA 3DQVC 2DQLA 4XICA 1UMQA 1GVDA 1Z05A 1R6RA 1XGMA 2ACJA 1C0WA 2HKXA 1IUYA 5LHHA 2L7MP 2XROA 4BJTA 5HNHA 1KU3A 4RA2A 2DTRA 4AYBA 1HBXG 4C2UA 2ME0A 3GCMA 2GXBA 1X3WB 3FK7A 5F0HA 1SMYF 1F4KA 1BM9A 3UKGA 3PFIA 4L5JA 2IA2A 4OINF 5LEJA 1R4MB 2VXDA 2LFBA 2X1DA 1FOWA 4NB5A 1Z9CA 1B8IA 2R7ZJ 2CU7A 4BY1J 3JTGA 5H20A 2Z33A 3EUAA 3M1CA 3ZQ7A 3G6EI 3CMYA 3OMYA 3RQ4A 4UUSA 1T0FA 3TKYA 3FK6A 1Y1VJ 5HDGA 3ZP5A 2Z3YA 2A6HF 1J7KA 3ERED 3O2PE 1UHMA 4BXFA 3GFJA 3NARA 2WV0A 1Z7UA 1QHHD 3DWLE 5D6FA 2Y69H 2NVQJ 4CH7A 2OQGA 2L3DA 1W36D 2EFNA 1PUFA 2ZMEB 3HOTA 2XF5A 3H9JA 1EKEA 5CYVA 5EG0A 2RKHA 1V4RA 1VQNI 3K4JA 2V4JC 2KJCA 5IT9K 1L0OC 3CP2A 2XIGA 4UB6C 2QQ9A 2MA3A 4G8XA 4BHCA 3K10A 4M73A 2O3FA 4XQFA 1AKHB 4NC6A 1NHAA 4M3DA 4CCJA 2M8EA 4JX6A 3V7RA 1J0RA 2A6TA 3A01A 1ZGAA 4KISA 2Q8KA 3F8NA 2JQ7A 1ON2A 2GWRA 2Y0SN 5EF6A 2AO9A 2MD0A 3MMYB 3E5XA 4E7SA 4W97A 1K78A 3LQQA 1ZTRA 2E1CA 4NUBA 1FYKA 2YSRA 1T38A 5CKTA 2PMHA 3BR3A 3WG7H 1FTZA 2HI3A 1IDYA 2JRMA 3TMOA 2WAQN 4UV9A 2LC2A 1ZYRF 3GTOJ 1G3WA 4Z2YA 2QQ8A 2WC2A 5FROA 4QTRA 3JW4A 2WB1N 2EILH 2XPWA 1ETYA 2QM3A 4DBQA 2PX9A 1R5HA 2PEXA 1NTCA 2P0WA 3U21A 1ZAOA 2DA7A 1IRGA 2BHZA 5JLXA 1CQTA 4KIGA 2DA4A 1V55H 5A2QK 3S14J 2HZDA 1DDNA 2M5WA 4G9YA 5J6XA 3NWTA 3DEWA 1MD0A 3K9TA 3Q0UA 1IN4A 2CW0F 4ZZLA 2IA1A 3DBRB 4OAZA 4FETA 4XR6A 2NVYJ 5E18F 2GA2A 3CUQB 2M7BA 2DFEA 3G3ZA 1EV7A 3I64A 3HKZA 1YW9A 4LOCA 5FFXA 3ZQFA 2QENA 3EETA 1U3EM 5LRSA 2FU4A 2L9RA 4R1HA 3PO3J 2DDAA 3Q0VA 2DW4A 4A12A 3WTYC 3HEFA 5DCMA 4JBAA 2E1MB 1BR1A 1U5TB 4BE1A 4P1WA 4HDUA 1ENHA 1YI2I 4PCQA 1WGXA 2NVTJ 1W5TA 3FM5A 3KP3A 4A0ZA 1K79A 3L7WA 2VL8A 2E34A 1XTAA 4Y33A 3OV8A 4DQ2A 1TQIA 1T98A 4RLQA 1YTYA 4C3JJ 2KPMA 3TEDA 4RGXA 1AOYA 4L0YB 3RKXA 3TP0A 2EA2A 5EGOB 2DFFA 2A3SA 4D0PA 2NRAC 2MYSA 1ZR4A 3H92A 2H8RA 2GZWA 4NC8A 1T8IA 2VONA 3ZQIA 2WY7Q 2V9PA 4WCGA 3IRQA 1K4TA 1VI0A 3TO9A 3FWEA 5D6EA 1MSEC 3AL0B 2R7SA 2JWTA 3H0GJ 3RPUD 4WX9A 4CYCA 3Q5FA 2XRNA 3BPVA 4HF0A 2R0QC 3F6OA 2PMZN 1TWFJ 5ERIA 1T0FC 1OCCH 1SFEA 1X1AA 3V42A 4E7KA 3JRHA 3QOEA 1ZK8A 2DTZA 3VOEA 2Q2EB 4BGDA 1P7IA 3HPGA 3WODF 3OYLA 2NS7A 2HWVA 2HYGD 2BXYA 3I71A 2K85A 4LD5A 2AHQA 1A04A 2NOJB 2X6OA 2V9KA 4LB5A 3S2HJ 3K4LA 1LUJB 1O3QA 2DOAA 5AIQA 4A3KJ 2ID3A 1SD4A 4A5MA 1CF7A 1FOKA 2G0EA 4J19A 5CVVA 4GDFA 4I09A 2CG4A 4P55A 4P9FA 1X1DA 5ICCA 3LQRA 1BI1A 5F27A 4BHPA 1YIOA 1G3SA 4BE2A 4XK4A 4ASNA 4B43A 5JR3A 3IHUA 2VKDA 4HLXA 2KFDA 3RTRA 2B9SA 1K61A 1HDDC 5KCMA 4ZYGA 3Q0WA 3O6BB 3W3CA 4DNCA 5L3EA 1I1GA 1QVTA 1R5GA 4ESFA 1HLVA 5DS9A 4Y4RA 5LGUA 4IRIA 2L9NA 3G73A 3A2KA 4ZDOA 2AXTC 4PJJA 3LA2A 1F5TA 2CW7A 2XAFA 1XPXA 1D1AA 3G71I 2QSHX 3EPZA 4M74A 4KA4A 3CCUI 4OWRB 5CVIA 2FMYA 4MQ9F 3LFKA 2DU9A 2QUFA 3SXYA 2KRHA 3S3NA 3JREA 2H09A 4ABZA 1TT0A 2DPDA 2BW3A 3F8BA 3ABTA 1ACIA 3F3XA 1S8NA 2Q0OA 1UFMA 2ZFWA 2F2EA 4PSXA 2X85A 1WSUA 2F5DA 3CDIA 3FXRA 5M5WJ 5FLMJ 3BCBA 2D2WA 1SAUA 1VQ7I 3WU1B 2IT0A 5B3SH 4UVAA 1J2XA 4BJ5C 2LD5A 1BN5A 2NS0A 2Z9OA 3SEQA 2XASA 4BEHA 3OYMA 2LY9A 5LRRA 4YRVA 3RI4A 2GXGA 2RVCA 1JTXA 3C2GA 2CWEA 3WGIA 5K5RA 4WF2A 2YU3A 3FIWA 5FGMA 1EH7A 4A3MJ 1BI3A 3MD2A 2FX0A 4CHUA 5GTHC 1MBKA 3PM1A 4ZH4F 4MIMA 4AWXB 2V1NA 1F43A 4IX7A 1R36A 1QNTA 1VQLI 2ZO4A 3DF8A 2DK5A 1IXCA 2FXAA 5DM6F 3BZCA 1G8XA 4HV5A 5IT3A 3HOXJ 2XSJC 1W0TA 1VZ0A 5HS9A 5DEQA 4CUGA 5DM7F 3FISA 3FXKA 3KEOA 3V8JA 1OKRA 2DYSH 1I3QJ 1ON1A 4U87A 1DPRA 4UUTA 1YOVB 2DK8A 4FE4A 4C2MJ 2VC0A 5FD6A 1S7EA 2CRGA 4EJWA 4KITB 3KZYA 1YYVA 1ZN2A 4HX4A 3ZMDA 1V5GA 2BE5F 3CO6C 2A6EF 2LSOA 3WE3A 4C2TA 2VLAA 1I39A 4LFUA 4OOIA 3CMEI 2ZCWA 5ILSA 1E0EA 4LITA 4RAYA 4IHYA 2GQQA 2V6CA 3VPRA 1FIAA 1XMKA 2FQ3A 2D1HA 4IO9F 4Z6YA 1T95A 2H6BA 5J3LA 1J75A 4AVZA 2YX7A 3HSFA 3FXQA 1K83J 3S8PA 3VSKA 2FSWA 1FJLA 4HF2A 1QHGA 3T8RA 4G6TB 1HKQA 1KONA 3BY6A 1Z21A 4QSHA 1S5LC 3DU5A 3K69A 4F3QA 1LEAA 4B48A 4HQMA 4BS9A 4AIKA 4UVCA 1OCOH 4N4OB 1Y0UA 2WADA 3PIPF 4HQEA 2CMPA 3I4NJ 4KT5C 3HOVJ 4ANJA 2OCEA 3MKLA 3CCEI 3KLOA 3MZHA 1R5ID 1T6SA 2CQQA 5K7HA 1U9NA 1OCRH 2HZTA 4RBOA 4BAYA 5HLTA 2V6EA 3DPTA 2FMLA 3HYIA 4XLNF 1KA8A 1D1CA 1G3TA 4BQNA 4Y52J 2ECBA 1LPQA 1BA5A 1YITI 3CDHA 2O8XA 4PFOA 4DBRA 1IXSB 1QPIA 5D5VB 1ZLKA 2FOKA 2QWWA 2JT1A 1O4XA 1B9MA 3QAHA 1RKTA 1GDTA 3TO7A 2CFXA 3C3WA 2PG4A 5E1ZB 3ZN0A 5J1YA 4G6DA 2K02A 5EEAA 2DMPA 2Z16A 5LGTA 3I58A 1Z67A 4A3BJ 2AXLA 5ICFA 3J7AY 3QPHA 5F6FA 1GXQA 4XNFA 3J7YJ 2RNJA 4Q48A 5C3EJ 4JK1X 2IA0A 1E17A 2OZ6A 2QKMB 1UHWA 2R7WA 3BT9A 3S1MJ 3TOAA 4JQFA 5GPCA 1D5YA 3TGNA 4PZJA 2IS6A 4NNJA 4DZPA 3IRRA 2G9WA 3FXOA 3DFGA 2XB5A 3VODA 4CZZA 1ZARA 4GO1A 4XLHA 1WVRA 1WJBA 3B6AA 3AG3H 2XSDC 2HTJA 1OPCA 3CF2A 2QEXI 2ICWG 5E8GA 5HS7A 2K9SA 2IJLA 4I7HA 3EUHA 4LG0A 2VE9A 1EF4A 3JSPA 2H1KA 1P92A 2BEOA 3H3ZA 4XN3A 1VQ9I 1JXSA 2JK3A 2JA2A 2YS9A 2IGMA 3MKWB 2HPMA 3M3YJ 5JLWA 5KVRA 2JA5J 3CUOA 1JJ6C 2HFHA 1ETXA 3R61A 2CV0A 2EV0A 3BTCA 1SANA 2LK2A 3JRDA 4PJNA 3CD6I 1QZYA 3H5AA 3FMQA 1S3JA 2L7FP 3BOQA 4UV8A 2EFPA 4A3IJ 1D8JA 3BQZA 4II2A 3RZDJ 1J5YA 2R92J 4EJVA 2ETHA 4EJUA 1MNMC 1UCRA 1Z77A 3G2BA 3IH2A 5IOZA 2BVMA 2JA7J 2DMQA 1LFBA 2DODA 4IPAA 2W82A 4PJ0C 1TWCJ 2A5YB 3C1DA 1LFUP 1CGPA 3ABUA 5F64A 4BY7J 1P6RA 2R4GA 5D8LB 1AU7A 5EDNA 3FXMA 3S2DJ 1MJ9A 3NAUA 3OL3A 2HXIA 2Z5UA 4RB1A 1ZGJA 2P8TA 3CJTB 2IP2A 2EIJH 2VIXA 4D7NA 4B1RA 1D8KA 4LLNA 3PSFA 4JOMA 1LE8B 3HUGA 1F36A 2H94A 4E4HA 1IC8A 2TCTA 2OBPA 3HRTA 1JE8A 4IQJA 4PJMA 1ERDA 3HRSA 2RAEA 1QQIA 3S1NJ 5J4VA 1QVUA 5IOYA 3DTKA 1E3HA 3LAPA 1MDMA 2PQ8A 3VYRB 2K4BA 4XOPA 9ANTA 2K27A 2G7UA 2Q1ZB 2K86A 5JVTA 1VQ8I 4JYKA 2QBYB 2K4JA 3HSEA 3HHHA 1S6LA 4E6KG 2C6YA 2PJRB 4XRSA 2DT6A 2HS5A 2R93J 3QU6A 4E7HA 1TLHB 4EV0A 2DMNA 2W24A 1G6NA 2RV8A 2MSYA 5H2FC 3S2WA 1AKHA 1BC8C 1RR8C 1B6AA 1E2XA 2XF7A 5B66C 1SMTA 4BL0B 2HOEA 5FKLA 3L2RA 4I76A 2JMWA 1QZEA 5FJ8J 3OYDA 1W7PA 4U7DA 1EJ9A 2HVQA 3IH4A 5TRDA 3I3LA 2F5FA 1YRNA 2EA4A 3B6CA 1BR4A 2E2JJ 2RGVA 1ZELA 3K4NA 1XGOA 4XM3A 3L2VA 3PNVA 2FNPA 3BG3A 1RKWA 1A31A 4ZC3A 5GAEJ 2XUBA 3KCCA 2V1DA 4G94A 1W5CC 4MLOA 2HYJA 3U2RA 1HW5A 3RZOJ 1WI9A 1JUMA 4RB0A 2XAHA 3KP6A 3S93A 4B8XA 2LP0A 2VQCA 5D4SA 1IV8A 3E5QA 5J40A 1ZHFA 4ENMA 4EM2A 2HVSA 3RJPA 1A35A 2FJ1A 4EVIA 4C3IJ 4OU0A 2FF4A 3P7NA 1ZGWA 1PUEE 1IGNA 3L2UA 3N97A 4YFKF 3EDPA 3DP7A 2WA0A 3DPUA 3OR1C 3CF5F 1P2FA 3TP3A 2CH0A 3FHZA 2RREA 1FP1D 2KKOA 3E0JB 2DLLA 3K70C 1GV5A 2OA4A 4X1EA 4RB2C 4HLYA 2E5NA 3CUQA 4HYEA 2DFIA 3JRAA 2B7EA 2CUFA 2PN6A 3OSGA 2VPLA 2RQPA 2R5ZB 1WHUA 4B4CA 2JA6J 2F5CA 3EUHC 4HSRA 3OYIA 4A3GJ 2FBHA 1J09A 3SZTA 1U5TA 4BNCA 2XHKA 4KMFA 3I5UA 3QRFF 2Y2ZA 2LY1A 2WWYA 3BROA 3HKZN 4IXAA 2GOXB 3I4PA 2UV1A 3J81Z 4PK4A 1W4MA 1WJDA 2JJ7A 1F9NA 3GMEA 4S0HB 3DKWA 2VB6A 3MVPA 2LREA 5LHIA 3WTWC 1I27A 3OL4A 1JKPC 1WH7A 4LLLA 2V26A 4DJAA 3DPLC 5L3CA 5DYMA 1YO5C 2HEOA 1XGNA 4RB3C 2JRTA 4GRIA 5IP6A 1YIJI 3PJRA 2HOSA 2R5YA 5L3FA 3H5RA 2MLKA 2AQFA 1SFOJ 2EV5A 4KMUX 3FBNB 5IPAA 2ISZA 4F55A 2VPRA 2OPTA 3V7SA 4UUVA 2K5CA 2IVMA 2O5RA 3ZMZA 2JSPA 4MFDA 2KT0A 5ILUA 4LK0F 2NOGA 5FLXZ 1Z3YA 3RPUA 2EPFA 3PQKA 4I01A 3L1PA 2QGUA 5DD8A 2DMUA 2M8GX 4ZDPA 4JX5A 1GLNA 4ENNA 1SVMA 1MJAA 1GV2A 1HW1A 4LLGF 2Z2SB 3JAMZ 1FYMA 2IEKA 1OQYA 2Q2EA 4C30A 3D5LA 3CO7C 4CICA 3H0DA 1BC7C 1FBUA 4HX7A 4YIFA 4OMYA 5GP9A 2BYVE 3E5UA 3MKZA 1ITYA 5H6QA 4I0AA 3KP5A 4M6YA 3IUOA 3LSJA 3S1RJ 3S17J 1I3AA 4IRGA 4GYGA 2HNHA 1ULYA 5K7FA 1ZRFA 1A5JA 2VBZA 3CLQA 3HTUA 2FNAA 2BHYA 3S15J 2P7VB 3GTMJ 3ONQA 1A36A 1HA8A 1R23A 1TZLA 1JI8A 3E6MA 1BL0A 3ZQHA 4BXXJ 1QBJA 1O7LA 1OCPA 4X6AJ 4FISA 1WJ5A 4ENKA 4RAFA 5E20A 3L9FA 4XSXF 5KAFC 5IP9J 4XKBA 5EEGA 1TWHJ 3FXLA 3OS0A 1H8AC 4CA0A 4AD9A 4NBQA 3HOSA 2UZKA 2DA3A 1ZRCA 3BR5A 3OIPA 1JGGA 4M3EA 1MW7A 2ZXJA 1KQ9A 1IO2A 5JI6A 3V7CA 2RNGA 4ZJZA 4KJZA 2CS3A 2IGKA 3SJMA 4AVPA 1LVKA 4A6DA 4XKCA 4FASD 4HV6A 4Q5SF 3RYPA 3ABKH 1GVJA 2HOTA 1X3ZB 3F23A 4RM3A 2QCOA 1USTA 4KNYA 1MGTA 2E7WA 5HDNA 1PVEA 2IAIA 3GFMA 2MLGA 5DD4A 4QLCU 4P9UA 1IZ1A 4L9JA 1H89C 2KDZA 2BY3A 1MZBA 2KIQA 1D1BA 3Q9VA 2VT3A 2ZNYA 1POGA 2JN6A 2DJIA 2YU9J 1U78A 4YIRX 3TDZC 2P6SA 3LFUA 3U1KA 3ZQLA 4D7MA 1TQMA 2XAJA 3AG4H 4KICA 2STWA 5HOOA 3CUQC 2JPCA 2F5VA 5M3MJ 1FOXA 1K7AA 4M9SA 4I0BA 5K1YA 3IKVA 3RSNA 2LOOA 3A1YA 2O8KA 2GM4A 4KFCA 2COMA 4BE0A 4EM0B 4XSZF 2DOEA 1WFXA 2BY1A 3OYAA 2Y9ZA 4G7ZF 3CCSI 2E1MC 3F0CA 1T2KA 1U5TC 1ETOA 1OCTC 4S05A 2YR2A 3CQZJ 3CC4I 5TGTA 3OIOA 5BQTA 3MKYB 1P4AA 3OR2C 3WGGA 3L2CA 5FLVA 2XB0X 2KMUA 1DU6A 2KZVA 4HAMA 1YJ9I 3I0TA 3NQOA 4S04A 1XDUA 3KYLA 3S16J 1B8IB 4CCLA 4A0YA 3A4CA 2W57A 3GO5A 4PUSA 4Y7NJ 5ILVA 3IC7A 3H36A 2PLYA 3ECHA 3JSOA 2HVRA 3K4KA 1VQKI 1G2HA 2CO5A 1MKMA 2GOMA 3HTSB 3T1BA 3FDYA 2HYFA 2MFZA 4L0ZB 1S7AA 1G4DA 2ZBKA 2DOFA 1YX3A 1JKQC 4ZTFA 4M3BA 2VKHA 4LIVA 4BDYA 3B02A 1FWZA 4B47A 2HQNA 2R7XA 4M9ZA 4EATA 2STTA 3LOCA 1XN7A 4MNUA 2HTSA 3E6BA 1YJWI 2EWNA 4XKVA 3ML6A 3C18A 3F8CA 2MBFA 2DFHA 5E3OA 2X51A 3CCYA 5EG0B 5FKOA 4BQQA 2Y0SA 3GFLA 1NG7A 3ZQGA 2DPUA 3CCRI 1MSFC 1ETWA 3DXJF 1JTYA 4M6VA 5HLHA 2CUZA 4O6JA 1HKSA 3BR0A 3WHBA 3OOPA 2R7DA 4XRSG 1JHFA 1TW2A 1IRZA 3A01B 1UELB 2VBWA 2E2IJ 3OYEA 1X2MA 3IKTA 4XN0A 1KZHA 1DGRM 1M1EB 2VQLA 2WB1A 4F52A 3LSMA 1SFUA 3VDXA 2LNBA 1K78B 2MH2A 3WG9A 3S1QJ 2V7FA 2W7NA 2V1XA 1WI3A 3F21A 4BDZA 1GXPA 2BXZA 2LR8A 2M4KA 3IL2A 2ZXHA 3KFWX 4KT6A 3OS2A 1MMNA 2OUMA 2GA1A 4V2FA 5IYCJ 1IUFA 4IRHA 2XF6A 3DLLF 3LNQA 4XMYA 5EZGA 1D0XA 1VTNC 2VOPA 2PMUA 4HEA2 5ED4A 3ISPA 2IS4A 1I1SA 1H9TA 4A3JJ 1KQ0A 2M1BA 3SDBA 2E2HJ 2R7QA 4J00A 5D4RA 2LY2A 3H3UA 1QRYA 1MIJA 3Q3SA 4FQGA 1QGPA 1WKMA 3SDGA 2P81A 1D0ZA 2XAGA 2M0CA 3QU3A 3RKYA 3BWGA 2CJJA 5GAHJ 2H8WA 1IAWA 2H27A 2FE3A 2DBBA 3K0LA 1Y6IA 2P4WA 5DCMB 2ZJQF 4L18B 4LIUA 2VJIA 4NC7A 2LTPA 3LL7A 4PGGA 5FD5A 4AIJA 2XC7A 4P96A 2X6YA 3ASNH 3LSGA 3QODA 3PSIA 1FPQA 3FM3A 1VQ6I 4A5NA 4QIWN 3J7AO 1OLTA 2E5ZA 3LA3A 1FT9A 3HL2A 2VI6A 3H5NA 2I8DA 4Y3OA 3ASOH 4ZTJA 4CCOA 4AIDA 2BBYA 3BTJA 4RGRA 2IGNA 5EZHA 3I4MJ 1UHSA 4RMNA 4PGHA 1HKTA 2OZUA 3ELKA 3LWFA 1FOYA 3G1OA 4E7JA 4IEJA 1IW7F 3UNGC 1TTYA 4D5CA 2LMDA 5B1BH 2M30A 2P5KA 1XB4A 4CYCB 5HLIA 3WGHA 1WRJA 5E3LA 3M8EA 4HA8A 4ITVA 1R71A 2R7VA 3OY9A 3D0SA 3KZZA 2KZGA 1I6HJ 1WZ2A 1XSXA 2X4HA 2I10A 2VJ4A 2X6XA 3BQYA 2XGEA 3D5SC 5F1RA 3F72A 2E71A 2ZSIB 3KE2A 2EINH 1MMDA 3U9GA 3R0AA 4WXCA 1FEXA 1VQOI 2KISA 4KDPA 3LA7A 1BW5A 1TW3A 4HZFA 1OJLA 2DA5A 3CZ6A 1WPKA 3HJEA 1W0UA 3HG9A 3IH3A 3F22A 2HR3A 4IOAF 1CF7B 5LGNA 2VQHA 4F93B 1XCBA 2BVLA 4IQ4A 1Z0XA 1Z1DA 4O5VA 2Y31A 4E7IA 4V2GA 3DTEA 5F1JA 5DUIA 1YLFA 4XLAA 1FLIA 3R60A 4RLFA 3WU2C 2QBYA 2L4MA 2PJRA 4RAZA 3HSRA 1TWAJ 4CSWA 2GAUA 1R4NB 2DYRH 1BJAA 4DYQA 1YE9A 2NVUB 2ZJRF 1RRJA 1ONVA 3A0BC 4HX8A 1XDSA 2OAZA 4A3EJ 3Q9SA 2OQRA 4BQOA 3OYNA 5FO5A 3F9KA 2QQBA 1XMAA 1BW6A 3J81K 3CJNA 4IHWA 3A02A 3HIFA 1KYWA 2LBFB 2FBKA 2KDOA 2A68F 4GXOA 1Z6TA 4N0BA 3BJ6A 4FCYA 1R58A 3VYTB 2M34A 1TNTA 4YEJA 5EYRA 2R7TA 4RDUA 3QPTA 1HSJA 1HDPA 4AIHA 4DOZA 2BW3B 4BACA 5LFAA 3P9KA 1UZCA 3QP6A 3HOUJ 2LDUA 2PJPA 1PP8F 3K4MA 4C3HJ 5IY5H 4UNOA 5DDGA 5FLXK 1JKOC 3CCVI 1VF9A 3HRUA 5E79C 1XMXA 4NQWA 2L9VA 5JFRA 1IDZA 4BEHB 3CCQI 2OJED 4MTDA 1DPUA 4MHGA 3J7ZI 1LFPA 3S32A 1VFCA 3JAMK 3E6DA 4R79A 1VQMI 2WTEA 3GFIA 3CDLA 3LSIA 4XLFA 1GT0C 3K4BA 1ZRDA 2PBIA 4ON0A 4V19K 3CESA 4F92B 3H35A 3W6JB 2M3AA 5DCFA 3ZCOA 4UXNA 1STZA 5LD2C 2CQKA 4Q47A 1YW8A 1U8RA 1OCZH 4A3LJ 5FKMA 1FYLA 2CQXA 5K5OA 2M2EA 2O61A 1GHCA 1MNDA 1FBQA 1LDJA 4MFEA 3WU0A 2L4AA 3MZ8A 5C44J 4EJTA 3KEQA 3BCAA 3BPXA 2ZB9A 4LJZF 2QSGX 2VJ5A 1OYWA 3GVAA 4XKWA 3CJQB 4AUXA 5C4JJ 2R7RA 1H0MA 2BV6A 3DEUA 1TP4A 3K1PA 2IPQX 2XRLA 1K6OA 2N8GA 1HC8A 3BP8A 3S3OA 1BIBA 3HOZJ 1ZG3A 4DGWB 1Y0NA 4FHTA 1WJAA 4GCVA 1HSTA 4AYBN 4IJAA 5L3BA 5GPAA 4ZDLA 3RQIA 3PIOF 4OMZA 4L9VA 4MQVA 2UUZA 2CSOA 1U8BA 5IYBJ 4ZYAA 4L9TA 2KIMA 4GFBA 5GADJ 2HDCA 2O0YA 3OWTA 2FA5A 3O3KA 1EH6A 4HNTA 2FRHA 2OTJI 1P4WA 4HNUA 3HOYJ 2CQ7A 4XONA 1IN8A 2XPUA 2F6CA 1YS7A 3ZOBA 3I55I 2EZIA 3H9QA 1LEBA 2ZKZA 3M9AA 1O3SA 3DU6A 3HZJA 4AU7A 5J47A 2ESHA 4A69C 2I5UA 4B44A 1WWXA 4YIIA 3JRIA 3L2WA 2DCEA 1VQ5I 1D5VA 2P6TA 2ZMEA 4YELA 1LQ1A 3VYSB 1LKXA 2VJJA 1B72B 5E3MA 2ELKA 1IF1A 3SQNA 1KU2A 1X1PA 2KHMA 3ZN1A 1KQ8A 2E60A 5FB2A 2IW5A 3BZ6A 2BY2A 5E1WA 5BNGA 1MMAA 3K4CA 4Q4ZF 1OFCX 4UY8I 1N25A 2K3PA 3EYIA 5KK1A 3AAFA 3OOUA 1QO0D 4A6EA 3R6SA 2BOLA 3OIQA 4HBLA 1RUNA 4BH9A 3RPQA 3LAJA 3JTHA 4HOBA 5CQGA 4I2OA 1T33A 2KIFA 2QQAA 2NS8A 1FMVA 2EB7A 2W1OA 2MG4A 3MAJA 4M6XA 4XOTA 1J9IA 3I59B 3PQJA 4IOCF 1JJ8C 1YS6A 4NDLA 3GF2A 3ZGKA 1OYIA 2DN0A 1Q1VA 3GTJJ 3HHGA 1B1BA 4BU2A 1X1CA 3DKXA 3W6KB 2JUCA 4HNVA 1JKRC 5D5XB 2JA8J 2UWMA 4IVNA 3GXOA 4CCKA 1VQ4I 4UB8C 1RPWA 3TO6A 1AHDP 4RS8A 2R7UA 2H6CA 2CUEA 4UVBA 2ZFUA 2CYYA 1XS9A 2KQRA 2QYOA 2J5OA 2JVGA 1PDNC 2ELJA 4DZJA 5KAIC 5TISC 3LSRA 1SFKA 5B1AH 3HXLA 3SZGA 5CVJA 2ISYA 2VE8A 1A6QA 4MEXF 1MBFA 4B09A 2HQ5A 2X1CA 2VODA 3T8TA 5AONA 3ZR8X 1WH5A 4LG0B 5JVGF 4CDGA 4HPQA 4DYRA 4B3AA 1FX7A 5LHGA 1KU7A 1WQ2A 3L00A 3I53A 2FBIA 1FY7A 2HQAA 4KIFA 1FP2A 3HB9A 1LDKB 5CQEA 4YFNF 3JR9A 3ZQQA 3J80Z 2K40A 5J8CA 2CQNA 2Y30A 3W2WA 4PFPA 4FE7A 5EGOA 2K9QA 2BZTA 2EJRA 1KGSA 2Y48A 5EJCA 1X1BA 1RIOH 1BI0A 4XRFA 5J1UA 2QF7A 3G1MA 1IN5A 1U6GA 2M87A 1Y56A 1QZZA 2JVHA 1LDDA 1QPMA 2ZJ2A 4BJ6C 2E1OA 3GTQJ 3K2ZA 3AKZA 3OYFA 2A07F 1MMSA 2A5WA 2EQRA 3X2QH 3QPSA 3DBHB 5LLQA 1SFXA 2KRCA 3GTPJ 4LK1F 1GUUA 3DKYA 1I6XA 4D9JA 2F48A 2RC4A 4E70A 3GZ6A 1DQUA 3ZMVA 4M9XA 1Y1WJ 2K9LA 3KYCB 3HUGB 3ULQB 2YUSA 4N9IA 1ETQA 1Z91A 1WJFA 4R8HA 3BJOA 3LSTA 5KHDA 4IHXA 2O7OA 1RC9A 3CJRB 3H1CA 5L3GA 2HPIA 2XGXA 5DV5A 1XX5A 3T0YA 1IRFA 1LVAA 2XGDA 2Y0MA 1VQPI 1MDMB 1OMIA 5J8FA 2RN7A 3HC7A 5FRNA 4M3GA 4EGYA 5EEHA 2Y75A 3FF5A 4ESBA 2ID6A 1W36C 4M71A 2ZMEC 2KP6A 5K7ZA 4KUMA 5CJ9A 4IF4A 4FTHA 4OIQF 1BOBA 1ZR2A 1FTTA 4ZYHA 3K1MA 4CCMA 5GTIC 1HXDA 2IXSA 4JP0A 3ECOA 1X4OA 3ABLH 3KYDB 1ETVA 2HGCA 2LVSA 3BG7A 3EYYA 3VB2A 4FX0A 4H4KC 3OYJA 4GYIA 2HXOA 1W7PD 1W7PB 3BC8A 2W4SA 5KNLA 3OS1A 3ESWB 2EZLA 3BG5A 1SVOA 2COBA 3EQLF 1YRNB 1U2WA 3TOBA 2CGPA 3OYGA 3WTSC 3V8LA 2VC1A 2IRFG 1KYZA 4HW0A 1V5FA 1XC5A 2LF8A 3SEZA 3G1LA 2DA2A 2OU2A 3I54A 1TWGJ 3DTIA 4U0WA 2DQRA 3QOPA 1WJEA 1F1ZA 3VSLA 2LF7A 1SC7A 1ETKA 2W48A 3QWLA 4I6ZA 1OR7A 1AWCA 5E8IA 3BR1A 4XLCA 1MBGA 1B59A 4CXFA 2V9VA 2CW8A 2MW8A 3PL8A 1UG0A 2D1VA 3ZMUA 3TDUC 1H88C 5GAGJ 3AFHA 2HDDA 2D45A 3SFIA 4RAGA 2W85A 3CP8A 1NK2P 3JCUC 1MBJA 4EJOA 1JUPA 3GYHX 3HM5A 5DUKA 1IN6A 5FKNA 1XSVA 3O8HA 1HQCA 4B3XA 3GTLJ 2F4OB 2OCCH 4ENJA 2OF7A 2A61A 2NXNB 3WTUC 2J5PA 1N75A 3C2BA 5E17F 4XL9A 5D8KB 5HVQC 2VKEA 3RDIA 5B5EC 1YJNI 4XRMA 3FHNA 3L2QA 2FEZA 3UR3C 2P7CB 2VASA 2NNNA 1XG1A 1Z6RA 2L54A 5F08A 1SD6A 2WAFA 1DP7P 2HDWA 3IP4B 3BDDA 4L5IA 2VBXA 3E97A 2LLKA 2ME6A 4HDVA 1HF0A 1UG2A 3H3VK 1JT6A 4XBFA 3DV8A 4UUSB 4XORA 3FX3A 3OSFA 3NWSA 2DAOA 3FKJA 1X58A 2R5YB 3M07A 1JGSA 3K1NA 3C2HA 2KJBA 5BMZA 2K7LA 2W00A 3KPHA 1V54H 4QPQA 2MABA 1J59A 3QQAA 2F4IA 4GGGA 2QA4I 3AL0C 1KU9A 1ODDA 2M0MA 4AC0A 2XPVA 3IV5A 1S72I 3EUKL 4NHJA 1Y39A 2ZC2A 2A69F 1S7OA 2LH9A 3RIRA 1WJCA 2VQGA 3KX2A 4L9NA 4KYWA 3BG9A 2E36A 1PUFB 1FZPB 5BPIA 1UJ8A 2H1LA 1RESA 2DO7A 2QVOA 3KEYA 3OYCA 3OYHA 5FFZA 3IAM2 2EIKH 3I9V2 3P5JA 2MC3A 1SD7A 1T08B 3LSPA 3PUFA 4EEFG 4IZZA 1RZ4A 4KN4X 2O9LA 1TQPA 1Y8QB 1T39A 3IWFA 2KIUA 3RYRA 3M8JA 3COAC 1TBXA 2WAQA 3RCOA 2LG4A 2ZNZA 3K6GA 1R22A 3CCJI 1PYVA 3CTAA 1LJ9A 1MJBA 3TW7A 1R9TJ 1YG2A 1TC3C 3LMMA 2GIZA 3MN2A 1FIPA 1BI2A 2IBDA 4MO7A 3HOWJ 2LKXA 3M4OJ 1X4PA 4MTEA 1RI7A 3HDDA 2NNYA 2NAZA 2XVCA 2Z99A 4BBSJ 5FRMA 2P5VA 2HOAA 1D0YA 1O57A 1P9QC 3SFZA 1DP3A 3D5RC 4CZCA 1MH4A 1U9OA 2EH3A 1QU3A 4Y17A 3P9IA 1X3UA 2LBFA 3JRBA 2HQRA 3ZMTA 3PO2J 2E19A 3TL4X 1V3FA 1X19A 1DGWY 2GIVA 5BPDA 2D5VA 2IGOA 2HKOA 1K6YA 3HGGA 2B0LA 3DBLB 4D1QA 1OR7C
chains in the Genus database with same CATH topology
3GLXA 4M72A 1XD7A 4MGRA 1FC3A 2PFBA 1RUOA 1L3LA 1FBSA 4YFXF 2E1NA 4CO8A 4ZZDA 1LB2A 5ICGA 1ZH5A 5IT9Z 2R3SA 2QLZA 2JSCA 4Y13A 4G7OF 1BBYA 2EFWA 4OIRF 2XKPA 4ETSA 4FX4A 4O3MA 3F8FA 4I98B 3FMSA 4G7HF 4CYDA 1XCVA 3T5XA 2R7FA 1USSA 1FSEA 4FT8A 2TDXA 1OYYA 3MWMA 1YFHA 1YQAA 5A2QZ 1EH8A 3WE2A 2VXZA 2O6GE 4U7BA 2JPBA 4RGUA 2KRFA 2YPRA 3KETA 4WWCA 1REPC 4A0XA 2E7XA 3IWZA 1R1VA 4OIOF 3R4KA 2EK5A 1FSHA 5H6RA 2VT2A 1P4XA 1TNSA 3V8KA 1BOAA 5D5UB 1D3YA 3MFKA 2UXXA 4P5OA 2O03A 2L02A 1O3RA 3RKWA 5BS6A 5JHUA 3FXUA 5HS8A 4YG2F 1B9NA 3J80K 3M7GA 3TQNA 4LMYA 5HLGA 3E6CC 2UXNA 3N4MA 1SD5A 2AS5F 4G6QA 1RNLA 3CLOA 2DI3A 3KLNA 5LBQA 5TJJA 2XKOA 3I59A 1I5ZA 4LGWA 5CLSA 2ADUA 2W84A 1DUXC 4H0EA 3GEZA 2EV6A 1S29A 4ZYDA 3KP2A 4Y15A 1ZLJA 4ESJA 3NRVA 3MQ0A 4MEYF 3FZVA 2MD5A 2PI0A 4EGZA 3WTXC 3SZPA 5LEKA 3GZ5A 1LNWA 4PDKA 2L01A 2RDPA 1R00A 4WK8F 2P5LC 4UHTA 2XV4S 3NEUA 5D5WB 1ZG1A 2JZYA 3L09A 2VBYA 1BIAA 1W5SA 2EFQA 4I02A 3ZMSA 2MH9A 4OIPF 5CVRA 1IN7A 2EFOA 1XSDA 1G3YA 3GUDA 1H9GA 3P9CA 4LB6B 5L3DA 4BYYA 1YW7A 4WXDA 3WTZA 2ELHA 2NYXA 3REOA 3GW2A 4BXUA 2BGCA 3WTTC 1O3TA 5K5QA 3KP7A 4KIBA 4TV7A 4IHSA 3BJAA 4A2UA 3U1DA 2X0LA 3C7JA 4BHBA 2F5EA 2W25A 4U88A 5HDKA 3M1EA 2LKPA 1B4AA 3M8FA 2QZ8A 1ZG5A 2V1UA 5CVUA 3ZPLA 1ZREA 2DT5A 4XLPF 5BOXA 3KP4A 4WXHA 2OD5A 3ROUA 4N9HA 3GX4X 3R0JA 1PP7U 4ZYEA 3F8MA 4CGZA 3SHFA 2ESNA 4EM1A 1IXRC 3WTVC 6PAXA 2JTVA 2XAQA 4EMSA 2G7HA 1UB9A 5E1XA 3E3VA 2VN2A 1O7FA 1XGSA 4EQQA 1Q1HA 3MZYA 5ICEA 2VOOA 3GWZA 4U0VA 3MEXA 4U0YA 3MCZA 3FMRA 4RGSA 2V79A 4K2EA 4F7ZA 3QP5A 4HF1A 3V4GA 1HW2A 4BQAA 2M45A 4KN7X 1R7JA 3F6VA 1SAXA 1R1UA 1JHHA 3B73A 3HRMA 4QWQA 2YX4A 4IHTA 5AIPA 3VEPA 1FNNA 1R1TA 3VFZA 3DQVC 2DQLA 1Z05A 1XGMA 2ACJA 1C0WA 2HKXA 1IUYA 5LHHA 2XROA 1KU3A 2DTRA 1HBXG 2GXBA 1SMYF 1F4KA 1BM9A 3PFIA 4L5JA 2IA2A 4OINF 5LEJA 4NB5A 1Z9CA 3JTGA 5H20A 2Z33A 3ZQ7A 1T0FA 3TKYA 5HDGA 3ZP5A 2Z3YA 2A6HF 1J7KA 3ERED 3O2PE 1UHMA 3GFJA 1Z7UA 2WV0A 5D6FA 2OQGA 2L3DA 2EFNA 2ZMEB 3HOTA 5CYVA 2RKHA 1V4RA 2KJCA 5IT9K 1L0OC 2XIGA 2QQ9A 2MA3A 4G8XA 4BHCA 4M73A 2O3FA 1NHAA 2M8EA 3V7RA 1J0RA 1ZGAA 2Q8KA 3F8NA 1ON2A 2GWRA 3E5XA 1K78A 3LQQA 2E1CA 1FYKA 2YSRA 1T38A 2PMHA 4UV9A 1ZYRF 1G3WA 4Z2YA 2WC2A 3JW4A 2QM3A 1R5HA 2PEXA 1ZAOA 1IRGA 4KIGA 5A2QK 1DDNA 2M5WA 4G9YA 5J6XA 1MD0A 3K9TA 1IN4A 2CW0F 4ZZLA 2IA1A 5E18F 2GA2A 3CUQB 3G3ZA 1EV7A 3I64A 1YW9A 5FFXA 2QENA 3EETA 1U3EM 5LRSA 2FU4A 4R1HA 2DW4A 4A12A 3WTYC 5DCMA 4JBAA 1U5TB 4HDUA 4PCQA 1W5TA 3FM5A 3KP3A 4A0ZA 1K79A 3L7WA 3OV8A 4DQ2A 1TQIA 1T98A 1YTYA 4RGXA 1AOYA 4L0YB 3RKXA 2EA2A 2A3SA 4D0PA 2NRAC 3H92A 2GZWA 2VONA 4WCGA 3IRQA 3TO9A 3FWEA 5D6EA 4WX9A 3Q5FA 2XRNA 3BPVA 4HF0A 3F6OA 5ERIA 1SFEA 3VOEA 3WODF 2HWVA 2HYGD 3I71A 4LD5A 1A04A 4LB5A 1O3QA 5AIQA 1SD4A 4A5MA 1CF7A 1FOKA 5CVVA 4I09A 2CG4A 4P55A 4P9FA 5ICCA 3LQRA 1BI1A 4BHPA 1YIOA 1G3SA 4ASNA 5JR3A 3IHUA 4HLXA 3RTRA 4ZYGA 3O6BB 4DNCA 5L3EA 1I1GA 1R5GA 4ESFA 5LGUA 4IRIA 3G73A 3LA2A 1F5TA 2XAFA 4M74A 4KA4A 5CVIA 2FMYA 4MQ9F 3LFKA 2DU9A 2QUFA 3SXYA 2H09A 2DPDA 3F8BA 3ABTA 3F3XA 1S8NA 2Q0OA 1UFMA 2ZFWA 2F2EA 1WSUA 2F5DA 3FXRA 2D2WA 2IT0A 3WU1B 4UVAA 1J2XA 1BN5A 2NS0A 2Z9OA 2XASA 5LRRA 3RI4A 2GXGA 2RVCA 2CWEA 3WGIA 5K5RA 4WF2A 2YU3A 5FGMA 1EH7A 1BI3A 4CHUA 4ZH4F 4AWXB 1R36A 1QNTA 2ZO4A 3DF8A 2DK5A 1IXCA 2FXAA 4HV5A 5IT3A 5HS9A 5DEQA 3KEOA 3V8JA 1OKRA 1ON1A 1DPRA 2DK8A 2VC0A 5FD6A 4EJWA 3KZYA 1YYVA 1ZN2A 4HX4A 3ZMDA 2BE5F 3CO6C 2A6EF 2LSOA 3WE3A 4LFUA 4OOIA 2ZCWA 5ILSA 4RAYA 2GQQA 2V6CA 1XMKA 2FQ3A 2D1HA 2H6BA 1J75A 2YX7A 3HSFA 3FXQA 4HF2A 2FSWA 3T8RA 1HKQA 3BY6A 3K69A 1LEAA 4HQMA 4AIKA 4UVCA 1Y0UA 4HQEA 4KT5C 3MZHA 3KLOA 1T6SA 2HZTA 4BAYA 3DPTA 2FMLA 3HYIA 4XLNF 1KA8A 1G3TA 3CDHA 2O8XA 1IXSB 5D5VB 1ZLKA 2FOKA 2QWWA 2JT1A 1B9MA 3QAHA 3TO7A 2CFXA 3C3WA 2PG4A 5E1ZB 3ZN0A 4G6DA 2K02A 5LGTA 3I58A 2AXLA 5ICFA 3QPHA 5F6FA 1GXQA 2RNJA 4Q48A 4JK1X 2IA0A 1E17A 2OZ6A 1UHWA 3TOAA 4JQFA 3TGNA 4PZJA 3IRRA 2G9WA 3DFGA 3VODA 4CZZA 1ZARA 4GO1A 2HTJA 1OPCA 5E8GA 5HS7A 2IJLA 4I7HA 3EUHA 4LG0A 2VE9A 3JSPA 1P92A 2BEOA 3H3ZA 1JXSA 5KVRA 3CUOA 2HFHA 3R61A 2EV0A 1QZYA 3FMQA 1S3JA 3BOQA 4UV8A 2EFPA 1D8JA 1J5YA 4EJVA 2ETHA 4EJUA 1UCRA 4IPAA 2A5YB 3C1DA 1CGPA 3ABUA 5F64A 5D8LB 1P6RA 1MJ9A 2Z5UA 4RB1A 1ZGJA 2P8TA 2IP2A 1D8KA 4LLNA 3HUGA 2H94A 1JE8A 2OBPA 3HRTA 3HRSA 1QQIA 3LAPA 1MDMA 2PQ8A 2K4BA 2K27A 2G7UA 2K86A 5JVTA 2QBYB 2K4JA 3HSEA 3HHHA 1S6LA 2C6YA 2HS5A 3QU6A 1TLHB 4EV0A 2W24A 1G6NA 2RV8A 3S2WA 1BC8C 1B6AA 1E2XA 1SMTA 2HOEA 1W7PA 4U7DA 5TRDA 2F5FA 2EA4A 2RGVA 1XGOA 2FNPA 2XUBA 3KCCA 2V1DA 4G94A 3U2RA 1HW5A 1WI9A 4RB0A 2XAHA 3KP6A 4B8XA 5D4SA 3E5QA 4ENMA 1ZHFA 4EM2A 3RJPA 4EVIA 4OU0A 2FF4A 3P7NA 1PUEE 3N97A 4YFKF 3EDPA 3DP7A 1P2FA 3FHZA 1FP1D 2KKOA 2DLLA 2OA4A 4RB2C 4HLYA 3CUQA 4HYEA 2DFIA 2PN6A 2RQPA 2F5CA 2FBHA 3SZTA 4BNCA 1U5TA 2XHKA 4KMFA 3I5UA 3QRFF 2WWYA 3BROA 4IXAA 3I4PA 3J81Z 1W4MA 1F9NA 5LHIA 3WTWC 3DKWA 1I27A 4LLLA 3DPLC 5L3CA 5DYMA 1YO5C 2HEOA 1XGNA 4RB3C 2JRTA 5L3FA 2MLKA 2EV5A 4KMUX 2ISZA 3V7SA 4UUVA 2IVMA 3ZMZA 5ILUA 4LK0F 5FLXZ 3RPUA 3PQKA 4I01A 5DD8A 4ENNA 1MJAA 1HW1A 4LLGF 1FYMA 3JAMZ 2Q2EA 3D5LA 3CO7C 4CICA 1BC7C 1FBUA 4HX7A 4YIFA 4OMYA 2BYVE 3E5UA 5H6QA 4I0AA 3KP5A 4M6YA 4IRGA 4GYGA 1ULYA 1ZRFA 2VBZA 3HTUA 2FNAA 2P7VB 1R23A 3E6MA 1QBJA 1O7LA 4ENKA 5E20A 3L9FA 4XSXF 5EEGA 4AD9A 3HOSA 2UZKA 1ZRCA 2ZXJA 1KQ9A 5JI6A 3V7CA 4AVPA 4A6DA 4HV6A 4Q5SF 3RYPA 1GVJA 3F23A 1USTA 4KNYA 1MGTA 2E7WA 5HDNA 3GFMA 2MLGA 5DD4A 4QLCU 4P9UA 1IZ1A 4L9JA 1MZBA 3Q9VA 2VT3A 2ZNYA 1U78A 3TDZC 2P6SA 2STWA 1TQMA 2XAJA 4KICA 5HOOA 3CUQC 2JPCA 1K7AA 4M9SA 4I0BA 5K1YA 3IKVA 4KFCA 2COMA 4EM0B 4XSZF 4G7ZF 1T2KA 1U5TC 4S05A 2YR2A 5BQTA 1P4AA 3WGGA 3L2CA 4HAMA 3I0TA 3NQOA 4S04A 1XDUA 4A0YA 2W57A 3GO5A 5ILVA 3IC7A 2PLYA 3ECHA 3JSOA 2CO5A 1MKMA 3HTSB 3T1BA 2HYFA 4L0ZB 1S7AA 1G4DA 2ZBKA 3B02A 1FWZA 2HQNA 4M9ZA 2STTA 1XN7A 4MNUA 2HTSA 3E6BA 2EWNA 3ML6A 3C18A 3F8CA 2MBFA 3GFLA 2DPUA 3DXJF 5HLHA 4O6JA 1HKSA 3OOPA 2R7DA 1JHFA 1TW2A 2VBWA 3IKTA 1SFUA 2LNBA 1K78B 2MH2A 3WG9A 3F21A 2V1XA 1GXPA 3IL2A 3KFWX 2GA1A 4IRHA 1VTNC 2VOPA 2PMUA 5ED4A 3ISPA 1I1SA 1H9TA 1KQ0A 2M1BA 5D4RA 3H3UA 1QGPA 1WKMA 2XAGA 3QU3A 3RKYA 3BWGA 1IAWA 2H27A 2FE3A 2DBBA 3K0LA 2P4WA 5DCMB 4L18B 4PGGA 5FD5A 4AIJA 4P96A 1FPQA 3FM3A 4A5NA 3J7AO 3LA3A 1FT9A 2BBYA 4RGRA 4PGHA 1HKTA 2OZUA 3ELKA 3LWFA 1IW7F 1TTYA 2M30A 2P5KA 1XB4A 5HLIA 3WGHA 1WRJA 3M8EA 4HA8A 3D0SA 3KZZA 1XSXA 2X4HA 5F1RA 3F72A 3KE2A 3U9GA 3R0AA 4WXCA 4KDPA 3LA7A 1TW3A 4HZFA 3F22A 2HR3A 1CF7B 5LGNA 1XCBA 1Z1DA 4O5VA 5DUIA 1YLFA 1FLIA 3R60A 2QBYA 2L4MA 4RAZA 3HSRA 2GAUA 1BJAA 1ONVA 4HX8A 1XDSA 2OAZA 3Q9SA 2OQRA 5FO5A 2QQBA 1XMAA 3J81K 3CJNA 3HIFA 1KYWA 2FBKA 2A68F 4GXOA 4N0BA 1Z6TA 3BJ6A 1R58A 1TNTA 3QPTA 1HSJA 4AIHA 3P9KA 3QP6A 2LDUA 2PJPA 1PP8F 4UNOA 5FLXK 5DDGA 3HRUA 4NQWA 5JFRA 4MTDA 1DPUA 4MHGA 3JAMK 3E6DA 4R79A 2WTEA 3GFIA 1ZRDA 2PBIA 4ON0A 3W6JB 5DCFA 4UXNA 1STZA 2CQKA 4Q47A 1YW8A 1U8RA 1FYLA 5K5OA 2O61A 1GHCA 1FBQA 1LDJA 3WU0A 2L4AA 4EJTA 3KEQA 3BPXA 4LJZF 1OYWA 3GVAA 1H0MA 2BV6A 3DEUA 3K1PA 2IPQX 1K6OA 3BP8A 1BIBA 1ZG3A 4FHTA 4GCVA 1HSTA 4IJAA 5L3BA 4OMZA 4L9VA 4MQVA 2CSOA 4L9TA 2KIMA 2HDCA 2O0YA 2FA5A 3O3KA 1EH6A 2FRHA 1P4WA 1IN8A 1YS7A 1LEBA 2ZKZA 3M9AA 1O3SA 2ESHA 1WWXA 4YIIA 1D5VA 2P6TA 2ZMEA 1LQ1A 1IF1A 3SQNA 1KU2A 3ZN1A 1KQ8A 5FB2A 2IW5A 3BZ6A 5E1WA 4Q4ZF 3EYIA 5KK1A 3AAFA 1QO0D 4A6EA 3R6SA 4HBLA 1RUNA 4BH9A 3RPQA 3LAJA 3JTHA 4HOBA 4I2OA 2QQAA 2KIFA 2EB7A 3MAJA 4M6XA 1J9IA 3I59B 3PQJA 1YS6A 3GF2A 1OYIA 3HHGA 1B1BA 3W6KB 5D5XB 2UWMA 4IVNA 3GXOA 3TO6A 4RS8A 2H6CA 4UVBA 2CYYA 2QYOA 2J5OA 1PDNC 5CVJA 2ISYA 2VE8A 4MEXF 4B09A 2VODA 3T8TA 5AONA 4LG0B 4CDGA 1FX7A 5LHGA 1KU7A 1WQ2A 3L00A 3I53A 2FBIA 1FY7A 4KIFA 1FP2A 1LDKB 4YFNF 3J80Z 5J8CA 2EJRA 1KGSA 2Y48A 1RIOH 1BI0A 4XRFA 1IN5A 1U6GA 2M87A 1QZZA 1LDDA 1QPMA 2ZJ2A 3K2ZA 2A07F 5LLQA 1SFXA 4LK1F 1I6XA 4E70A 2RC4A 3GZ6A 3ZMVA 4M9XA 3ULQB 4N9IA 1Z91A 4R8HA 3BJOA 3LSTA 5L3GA 2XGXA 5DV5A 3T0YA 1IRFA 1LVAA 2Y0MA 1MDMB 1OMIA 5J8FA 2RN7A 4EGYA 5EEHA 2Y75A 3FF5A 4ESBA 4M71A 4KUMA 5CJ9A 4IF4A 4OIQF 4ZYHA 3K1MA 1HXDA 3ECOA 2HGCA 3EYYA 3VB2A 4FX0A 4GYIA 1W7PD 1W7PB 3EQLF 1U2WA 3TOBA 2CGPA 3WTSC 3V8LA 2VC1A 2IRFG 1KYZA 4HW0A 2LF8A 2OU2A 3I54A 4U0WA 2DQRA 3QOPA 1F1ZA 2LF7A 1OR7A 1AWCA 5E8IA 1B59A 4CXFA 2V9VA 2D1VA 3ZMUA 3TDUC 2D45A 2W85A 4EJOA 3GYHX 5DUKA 1IN6A 1XSVA 1HQCA 4ENJA 2A61A 3WTUC 2J5PA 5E17F 5D8KB 5HVQC 3RDIA 2FEZA 2P7CB 2NNNA 1Z6RA 2L54A 1SD6A 1DP7P 4L5IA 3BDDA 2VBXA 3E97A 4HDVA 4XBFA 3DV8A 3FX3A 2DAOA 1JGSA 3K1NA 2KJBA 5BMZA 2K7LA 1J59A 4GGGA 1KU9A 1ODDA 4NHJA 2A69F 1S7OA 3RIRA 4KYWA 4L9NA 1FZPB 5BPIA 2DO7A 2QVOA 5FFZA 2MC3A 1SD7A 1RZ4A 4KN4X 1TQPA 1T39A 3IWFA 2KIUA 3RYRA 3COAC 1TBXA 2ZNZA 1R22A 1LJ9A 1MJBA 3CTAA 1YG2A 1BI2A 4MTEA 1RI7A 2NNYA 2NAZA 2XVCA 2Z99A 2P5VA 1O57A 3SFZA 4Y17A 3P9IA 1X3UA 2HQRA 3ZMTA 1V3FA 2GIVA 5BPDA 2HKOA 2B0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLX A;  4M72 A;  1XD7 A;  4MGR A;  1FC3 A;  2PFB A;  1RUO A;  1L3L A;  1FBS A;  4YFX F;  2E1N A;  4CO8 A;  4ZZD A;  1LB2 A;  5ICG A;  1ZH5 A;  5IT9 Z;  2R3S A;  2QLZ A;  2JSC A;  4Y13 A;  4G7O F;  1BBY A;  2EFW A;  4OIR F;  2XKP A;  4ETS A;  4FX4 A;  4O3M A;  3F8F A;  4I98 B;  3FMS A;  4G7H F;  4CYD A;  1XCV A;  3T5X A;  2R7F A;  1USS A;  1FSE A;  4FT8 A;  2TDX A;  1OYY A;  3MWM A;  1YFH A;  1YQA A;  5A2Q Z;  1EH8 A;  3WE2 A;  2VXZ A;  2O6G E;  4U7B A;  2JPB A;  4RGU A;  2KRF A;  2YPR A;  3KET A;  4WWC A;  1REP C;  4A0X A;  2E7X A;  3IWZ A;  1R1V A;  4OIO F;  3R4K A;  2EK5 A;  1FSH A;  5H6R A;  2VT2 A;  1P4X A;  1TNS A;  3V8K A;  1BOA A;  5D5U B;  1D3Y A;  3MFK A;  2UXX A;  4P5O A;  2O03 A;  2L02 A;  1O3R A;  3RKW A;  5BS6 A;  5JHU A;  3FXU A;  5HS8 A;  4YG2 F;  1B9N A;  3J80 K;  3M7G A;  3TQN A;  4LMY A;  5HLG A;  3E6C C;  2UXN A;  3N4M A;  1SD5 A;  2AS5 F;  4G6Q A;  1RNL A;  3CLO A;  2DI3 A;  3KLN A;  5LBQ A;  5TJJ A;  2XKO A;  3I59 A;  1I5Z A;  4LGW A;  5CLS A;  2ADU A;  2W84 A;  1DUX C;  4H0E A;  3GEZ A;  2EV6 A;  1S29 A;  4ZYD A;  3KP2 A;  4Y15 A;  1ZLJ A;  4ESJ A;  3NRV A;  3MQ0 A;  4MEY F;  3FZV A;  2MD5 A;  2PI0 A;  4EGZ A;  3WTX C;  3SZP A;  5LEK A;  3GZ5 A;  1LNW A;  4PDK A;  2L01 A;  2RDP A;  1R00 A;  4WK8 F;  2P5L C;  4UHT A;  2XV4 S;  3NEU A;  5D5W B;  1ZG1 A;  2JZY A;  3L09 A;  2VBY A;  1BIA A;  1W5S A;  2EFQ A;  4I02 A;  3ZMS A;  2MH9 A;  4OIP F;  5CVR A;  1IN7 A;  2EFO A;  1XSD A;  1G3Y A;  3GUD A;  1H9G A;  3P9C A;  4LB6 B;  5L3D A;  4BYY A;  1YW7 A;  4WXD A;  3WTZ A;  2ELH A;  2NYX A;  3REO A;  3GW2 A;  4BXU A;  2BGC A;  3WTT C;  1O3T A;  5K5Q A;  3KP7 A;  4KIB A;  4TV7 A;  4IHS A;  3BJA A;  4A2U A;  3U1D A;  2X0L A;  3C7J A;  4BHB A;  2F5E A;  2W25 A;  4U88 A;  5HDK A;  3M1E A;  2LKP A;  1B4A A;  3M8F A;  2QZ8 A;  1ZG5 A;  2V1U A;  5CVU A;  3ZPL A;  1ZRE A;  2DT5 A;  4XLP F;  5BOX A;  3KP4 A;  4WXH A;  2OD5 A;  3ROU A;  4N9H A;  3GX4 X;  3R0J A;  1PP7 U;  4ZYE A;  3F8M A;  4CGZ A;  3SHF A;  2ESN A;  4EM1 A;  1IXR C;  3WTV C;  6PAX A;  2JTV A;  2XAQ A;  4EMS A;  2G7H A;  1UB9 A;  5E1X A;  3E3V A;  2VN2 A;  1O7F A;  1XGS A;  4EQQ A;  1Q1H A;  3MZY A;  5ICE A;  2VOO A;  3GWZ A;  4U0V A;  3MEX A;  4U0Y A;  3MCZ A;  3FMR A;  4RGS A;  2V79 A;  4K2E A;  4F7Z A;  3QP5 A;  4HF1 A;  3V4G A;  1HW2 A;  4BQA A;  2M45 A;  4KN7 X;  1R7J A;  3F6V A;  1SAX A;  1R1U A;  1JHH A;  3B73 A;  3HRM A;  4QWQ A;  2YX4 A;  4IHT A;  5AIP A;  3VEP A;  1FNN A;  1R1T A;  3VFZ A;  3DQV C;  2DQL A;  1Z05 A;  1XGM A;  2ACJ A;  1C0W A;  2HKX A;  1IUY A;  5LHH A;  2XRO A;  1KU3 A;  2DTR A;  1HBX G;  2GXB A;  1SMY F;  1F4K A;  1BM9 A;  3PFI A;  4L5J A;  2IA2 A;  4OIN F;  5LEJ A;  4NB5 A;  1Z9C A;  3JTG A;  5H20 A;  2Z33 A;  3ZQ7 A;  1T0F A;  3TKY A;  5HDG A;  3ZP5 A;  2Z3Y A;  2A6H F;  1J7K A;  3ERE D;  3O2P E;  1UHM A;  3GFJ A;  1Z7U A;  2WV0 A;  5D6F A;  2OQG A;  2L3D A;  2EFN A;  2ZME B;  3HOT A;  5CYV A;  2RKH A;  1V4R A;  2KJC A;  5IT9 K;  1L0O C;  2XIG A;  2QQ9 A;  2MA3 A;  4G8X A;  4BHC A;  4M73 A;  2O3F A;  1NHA A;  2M8E A;  3V7R A;  1J0R A;  1ZGA A;  2Q8K A;  3F8N A;  1ON2 A;  2GWR A;  3E5X A;  1K78 A;  3LQQ A;  2E1C A;  1FYK A;  2YSR A;  1T38 A;  2PMH A;  4UV9 A;  1ZYR F;  1G3W A;  4Z2Y A;  2WC2 A;  3JW4 A;  2QM3 A;  1R5H A;  2PEX A;  1ZAO A;  1IRG A;  4KIG A;  5A2Q K;  1DDN A;  2M5W A;  4G9Y A;  5J6X A;  1MD0 A;  3K9T A;  1IN4 A;  2CW0 F;  4ZZL A;  2IA1 A;  5E18 F;  2GA2 A;  3CUQ B;  3G3Z A;  1EV7 A;  3I64 A;  1YW9 A;  5FFX A;  2QEN A;  3EET A;  1U3E M;  5LRS A;  2FU4 A;  4R1H A;  2DW4 A;  4A12 A;  3WTY C;  5DCM A;  4JBA A;  1U5T B;  4HDU A;  4PCQ A;  1W5T A;  3FM5 A;  3KP3 A;  4A0Z A;  1K79 A;  3L7W A;  3OV8 A;  4DQ2 A;  1TQI A;  1T98 A;  1YTY A;  4RGX A;  1AOY A;  4L0Y B;  3RKX A;  2EA2 A;  2A3S A;  4D0P A;  2NRA C;  3H92 A;  2GZW A;  2VON A;  4WCG A;  3IRQ A;  3TO9 A;  3FWE A;  5D6E A;  4WX9 A;  3Q5F A;  2XRN A;  3BPV A;  4HF0 A;  3F6O A;  5ERI A;  1SFE A;  3VOE A;  3WOD F;  2HWV A;  2HYG D;  3I71 A;  4LD5 A;  1A04 A;  4LB5 A;  1O3Q A;  5AIQ A;  1SD4 A;  4A5M A;  1CF7 A;  1FOK A;  5CVV A;  4I09 A;  2CG4 A;  4P55 A;  4P9F A;  5ICC A;  3LQR A;  1BI1 A;  4BHP A;  1YIO A;  1G3S A;  4ASN A;  5JR3 A;  3IHU A;  4HLX A;  3RTR A;  4ZYG A;  3O6B B;  4DNC A;  5L3E A;  1I1G A;  1R5G A;  4ESF A;  5LGU A;  4IRI A;  3G73 A;  3LA2 A;  1F5T A;  2XAF A;  4M74 A;  4KA4 A;  5CVI A;  2FMY A;  4MQ9 F;  3LFK A;  2DU9 A;  2QUF A;  3SXY A;  2H09 A;  2DPD A;  3F8B A;  3ABT A;  3F3X A;  1S8N A;  2Q0O A;  1UFM A;  2ZFW A;  2F2E A;  1WSU A;  2F5D A;  3FXR A;  2D2W A;  2IT0 A;  3WU1 B;  4UVA A;  1J2X A;  1BN5 A;  2NS0 A;  2Z9O A;  2XAS A;  5LRR A;  3RI4 A;  2GXG A;  2RVC A;  2CWE A;  3WGI A;  5K5R A;  4WF2 A;  2YU3 A;  5FGM A;  1EH7 A;  1BI3 A;  4CHU A;  4ZH4 F;  4AWX B;  1R36 A;  1QNT A;  2ZO4 A;  3DF8 A;  2DK5 A;  1IXC A;  2FXA A;  4HV5 A;  5IT3 A;  5HS9 A;  5DEQ A;  3KEO A;  3V8J A;  1OKR A;  1ON1 A;  1DPR A;  2DK8 A;  2VC0 A;  5FD6 A;  4EJW A;  3KZY A;  1YYV A;  1ZN2 A;  4HX4 A;  3ZMD A;  2BE5 F;  3CO6 C;  2A6E F;  2LSO A;  3WE3 A;  4LFU A;  4OOI A;  2ZCW A;  5ILS A;  4RAY A;  2GQQ A;  2V6C A;  1XMK A;  2FQ3 A;  2D1H A;  2H6B A;  1J75 A;  2YX7 A;  3HSF A;  3FXQ A;  4HF2 A;  2FSW A;  3T8R A;  1HKQ A;  3BY6 A;  3K69 A;  1LEA A;  4HQM A;  4AIK A;  4UVC A;  1Y0U A;  4HQE A;  4KT5 C;  3MZH A;  3KLO A;  1T6S A;  2HZT A;  4BAY A;  3DPT A;  2FML A;  3HYI A;  4XLN F;  1KA8 A;  1G3T A;  3CDH A;  2O8X A;  1IXS B;  5D5V B;  1ZLK A;  2FOK A;  2QWW A;  2JT1 A;  1B9M A;  3QAH A;  3TO7 A;  2CFX A;  3C3W A;  2PG4 A;  5E1Z B;  3ZN0 A;  4G6D A;  2K02 A;  5LGT A;  3I58 A;  2AXL A;  5ICF A;  3QPH A;  5F6F A;  1GXQ A;  2RNJ A;  4Q48 A;  4JK1 X;  2IA0 A;  1E17 A;  2OZ6 A;  1UHW A;  3TOA A;  4JQF A;  3TGN A;  4PZJ A;  3IRR A;  2G9W A;  3DFG A;  3VOD A;  4CZZ A;  1ZAR A;  4GO1 A;  2HTJ A;  1OPC A;  5E8G A;  5HS7 A;  2IJL A;  4I7H A;  3EUH A;  4LG0 A;  2VE9 A;  3JSP A;  1P92 A;  2BEO A;  3H3Z A;  1JXS A;  5KVR A;  3CUO A;  2HFH A;  3R61 A;  2EV0 A;  1QZY A;  3FMQ A;  1S3J A;  3BOQ A;  4UV8 A;  2EFP A;  1D8J A;  1J5Y A;  4EJV A;  2ETH A;  4EJU A;  1UCR A;  4IPA A;  2A5Y B;  3C1D A;  1CGP A;  3ABU A;  5F64 A;  5D8L B;  1P6R A;  1MJ9 A;  2Z5U A;  4RB1 A;  1ZGJ A;  2P8T A;  2IP2 A;  1D8K A;  4LLN A;  3HUG A;  2H94 A;  1JE8 A;  2OBP A;  3HRT A;  3HRS A;  1QQI A;  3LAP A;  1MDM A;  2PQ8 A;  2K4B A;  2K27 A;  2G7U A;  2K86 A;  5JVT A;  2QBY B;  2K4J A;  3HSE A;  3HHH A;  1S6L A;  2C6Y A;  2HS5 A;  3QU6 A;  1TLH B;  4EV0 A;  2W24 A;  1G6N A;  2RV8 A;  3S2W A;  1BC8 C;  1B6A A;  1E2X A;  1SMT A;  2HOE A;  1W7P A;  4U7D A;  5TRD A;  2F5F A;  2EA4 A;  2RGV A;  1XGO A;  2FNP A;  2XUB A;  3KCC A;  2V1D A;  4G94 A;  3U2R A;  1HW5 A;  1WI9 A;  4RB0 A;  2XAH A;  3KP6 A;  4B8X A;  5D4S A;  3E5Q A;  4ENM A;  1ZHF A;  4EM2 A;  3RJP A;  4EVI A;  4OU0 A;  2FF4 A;  3P7N A;  1PUE E;  3N97 A;  4YFK F;  3EDP A;  3DP7 A;  1P2F A;  3FHZ A;  1FP1 D;  2KKO A;  2DLL A;  2OA4 A;  4RB2 C;  4HLY A;  3CUQ A;  4HYE A;  2DFI A;  2PN6 A;  2RQP A;  2F5C A;  2FBH A;  3SZT A;  4BNC A;  1U5T A;  2XHK A;  4KMF A;  3I5U A;  3QRF F;  2WWY A;  3BRO A;  4IXA A;  3I4P A;  3J81 Z;  1W4M A;  1F9N A;  5LHI A;  3WTW C;  3DKW A;  1I27 A;  4LLL A;  3DPL C;  5L3C A;  5DYM A;  1YO5 C;  2HEO A;  1XGN A;  4RB3 C;  2JRT A;  5L3F A;  2MLK A;  2EV5 A;  4KMU X;  2ISZ A;  3V7S A;  4UUV A;  2IVM A;  3ZMZ A;  5ILU A;  4LK0 F;  5FLX Z;  3RPU A;  3PQK A;  4I01 A;  5DD8 A;  4ENN A;  1MJA A;  1HW1 A;  4LLG F;  1FYM A;  3JAM Z;  2Q2E A;  3D5L A;  3CO7 C;  4CIC A;  1BC7 C;  1FBU A;  4HX7 A;  4YIF A;  4OMY A;  2BYV E;  3E5U A;  5H6Q A;  4I0A A;  3KP5 A;  4M6Y A;  4IRG A;  4GYG A;  1ULY A;  1ZRF A;  2VBZ A;  3HTU A;  2FNA A;  2P7V B;  1R23 A;  3E6M A;  1QBJ A;  1O7L A;  4ENK A;  5E20 A;  3L9F A;  4XSX F;  5EEG A;  4AD9 A;  3HOS A;  2UZK A;  1ZRC A;  2ZXJ A;  1KQ9 A;  5JI6 A;  3V7C A;  4AVP A;  4A6D A;  4HV6 A;  4Q5S F;  3RYP A;  1GVJ A;  3F23 A;  1UST A;  4KNY A;  1MGT A;  2E7W A;  5HDN A;  3GFM A;  2MLG A;  5DD4 A;  4QLC U;  4P9U A;  1IZ1 A;  4L9J A;  1MZB A;  3Q9V A;  2VT3 A;  2ZNY A;  1U78 A;  3TDZ C;  2P6S A;  2STW A;  1TQM A;  2XAJ A;  4KIC A;  5HOO A;  3CUQ C;  2JPC A;  1K7A A;  4M9S A;  4I0B A;  5K1Y A;  3IKV A;  4KFC A;  2COM A;  4EM0 B;  4XSZ F;  4G7Z F;  1T2K A;  1U5T C;  4S05 A;  2YR2 A;  5BQT A;  1P4A A;  3WGG A;  3L2C A;  4HAM A;  3I0T A;  3NQO A;  4S04 A;  1XDU A;  4A0Y A;  2W57 A;  3GO5 A;  5ILV A;  3IC7 A;  2PLY A;  3ECH A;  3JSO A;  2CO5 A;  1MKM A;  3HTS B;  3T1B A;  2HYF A;  4L0Z B;  1S7A A;  1G4D A;  2ZBK A;  3B02 A;  1FWZ A;  2HQN A;  4M9Z A;  2STT A;  1XN7 A;  4MNU A;  2HTS A;  3E6B A;  2EWN A;  3ML6 A;  3C18 A;  3F8C A;  2MBF A;  3GFL A;  2DPU A;  3DXJ F;  5HLH A;  4O6J A;  1HKS A;  3OOP A;  2R7D A;  1JHF A;  1TW2 A;  2VBW A;  3IKT A;  1SFU A;  2LNB A;  1K78 B;  2MH2 A;  3WG9 A;  3F21 A;  2V1X A;  1GXP A;  3IL2 A;  3KFW X;  2GA1 A;  4IRH A;  1VTN C;  2VOP A;  2PMU A;  5ED4 A;  3ISP A;  1I1S A;  1H9T A;  1KQ0 A;  2M1B A;  5D4R A;  3H3U A;  1QGP A;  1WKM A;  2XAG A;  3QU3 A;  3RKY A;  3BWG A;  1IAW A;  2H27 A;  2FE3 A;  2DBB A;  3K0L A;  2P4W A;  5DCM B;  4L18 B;  4PGG A;  5FD5 A;  4AIJ A;  4P96 A;  1FPQ A;  3FM3 A;  4A5N A;  3J7A O;  3LA3 A;  1FT9 A;  2BBY A;  4RGR A;  4PGH A;  1HKT A;  2OZU A;  3ELK A;  3LWF A;  1IW7 F;  1TTY A;  2M30 A;  2P5K A;  1XB4 A;  5HLI A;  3WGH A;  1WRJ A;  3M8E A;  4HA8 A;  3D0S A;  3KZZ A;  1XSX A;  2X4H A;  5F1R A;  3F72 A;  3KE2 A;  3U9G A;  3R0A A;  4WXC A;  4KDP A;  3LA7 A;  1TW3 A;  4HZF A;  3F22 A;  2HR3 A;  1CF7 B;  5LGN A;  1XCB A;  1Z1D A;  4O5V A;  5DUI A;  1YLF A;  1FLI A;  3R60 A;  2QBY A;  2L4M A;  4RAZ A;  3HSR A;  2GAU A;  1BJA A;  1ONV A;  4HX8 A;  1XDS A;  2OAZ A;  3Q9S A;  2OQR A;  5FO5 A;  2QQB A;  1XMA A;  3J81 K;  3CJN A;  3HIF A;  1KYW A;  2FBK A;  2A68 F;  4GXO A;  4N0B A;  1Z6T A;  3BJ6 A;  1R58 A;  1TNT A;  3QPT A;  1HSJ A;  4AIH A;  3P9K A;  3QP6 A;  2LDU A;  2PJP A;  1PP8 F;  4UNO A;  5FLX K;  5DDG A;  3HRU A;  4NQW A;  5JFR A;  4MTD A;  1DPU A;  4MHG A;  3JAM K;  3E6D A;  4R79 A;  2WTE A;  3GFI A;  1ZRD A;  2PBI A;  4ON0 A;  3W6J B;  5DCF A;  4UXN A;  1STZ A;  2CQK A;  4Q47 A;  1YW8 A;  1U8R A;  1FYL A;  5K5O A;  2O61 A;  1GHC A;  1FBQ A;  1LDJ A;  3WU0 A;  2L4A A;  4EJT A;  3KEQ A;  3BPX A;  4LJZ F;  1OYW A;  3GVA A;  1H0M A;  2BV6 A;  3DEU A;  3K1P A;  2IPQ X;  1K6O A;  3BP8 A;  1BIB A;  1ZG3 A;  4FHT A;  4GCV A;  1HST A;  4IJA A;  5L3B A;  4OMZ A;  4L9V A;  4MQV A;  2CSO A;  4L9T A;  2KIM A;  2HDC A;  2O0Y A;  2FA5 A;  3O3K A;  1EH6 A;  2FRH A;  1P4W A;  1IN8 A;  1YS7 A;  1LEB A;  2ZKZ A;  3M9A A;  1O3S A;  2ESH A;  1WWX A;  4YII A;  1D5V A;  2P6T A;  2ZME A;  1LQ1 A;  1IF1 A;  3SQN A;  1KU2 A;  3ZN1 A;  1KQ8 A;  5FB2 A;  2IW5 A;  3BZ6 A;  5E1W A;  4Q4Z F;  3EYI A;  5KK1 A;  3AAF A;  1QO0 D;  4A6E A;  3R6S A;  4HBL A;  1RUN A;  4BH9 A;  3RPQ A;  3LAJ A;  3JTH A;  4HOB A;  4I2O A;  2QQA A;  2KIF A;  2EB7 A;  3MAJ A;  4M6X A;  1J9I A;  3I59 B;  3PQJ A;  1YS6 A;  3GF2 A;  1OYI A;  3HHG A;  1B1B A;  3W6K B;  5D5X B;  2UWM A;  4IVN A;  3GXO A;  3TO6 A;  4RS8 A;  2H6C A;  4UVB A;  2CYY A;  2QYO A;  2J5O A;  1PDN C;  5CVJ A;  2ISY A;  2VE8 A;  4MEX F;  4B09 A;  2VOD A;  3T8T A;  5AON A;  4LG0 B;  4CDG A;  1FX7 A;  5LHG A;  1KU7 A;  1WQ2 A;  3L00 A;  3I53 A;  2FBI A;  1FY7 A;  4KIF A;  1FP2 A;  1LDK B;  4YFN F;  3J80 Z;  5J8C A;  2EJR A;  1KGS A;  2Y48 A;  1RIO H;  1BI0 A;  4XRF A;  1IN5 A;  1U6G A;  2M87 A;  1QZZ A;  1LDD A;  1QPM A;  2ZJ2 A;  3K2Z A;  2A07 F;  5LLQ A;  1SFX A;  4LK1 F;  1I6X A;  4E70 A;  2RC4 A;  3GZ6 A;  3ZMV A;  4M9X A;  3ULQ B;  4N9I A;  1Z91 A;  4R8H A;  3BJO A;  3LST A;  5L3G A;  2XGX A;  5DV5 A;  3T0Y A;  1IRF A;  1LVA A;  2Y0M A;  1MDM B;  1OMI A;  5J8F A;  2RN7 A;  4EGY A;  5EEH A;  2Y75 A;  3FF5 A;  4ESB A;  4M71 A;  4KUM A;  5CJ9 A;  4IF4 A;  4OIQ F;  4ZYH A;  3K1M A;  1HXD A;  3ECO A;  2HGC A;  3EYY A;  3VB2 A;  4FX0 A;  4GYI A;  1W7P D;  1W7P B;  3EQL F;  1U2W A;  3TOB A;  2CGP A;  3WTS C;  3V8L A;  2VC1 A;  2IRF G;  1KYZ A;  4HW0 A;  2LF8 A;  2OU2 A;  3I54 A;  4U0W A;  2DQR A;  3QOP A;  1F1Z A;  2LF7 A;  1OR7 A;  1AWC A;  5E8I A;  1B59 A;  4CXF A;  2V9V A;  2D1V A;  3ZMU A;  3TDU C;  2D45 A;  2W85 A;  4EJO A;  3GYH X;  5DUK A;  1IN6 A;  1XSV A;  1HQC A;  4ENJ A;  2A61 A;  3WTU C;  2J5P A;  5E17 F;  5D8K B;  5HVQ C;  3RDI A;  2FEZ A;  2P7C B;  2NNN A;  1Z6R A;  2L54 A;  1SD6 A;  1DP7 P;  4L5I A;  3BDD A;  2VBX A;  3E97 A;  4HDV A;  4XBF A;  3DV8 A;  3FX3 A;  2DAO A;  1JGS A;  3K1N A;  2KJB A;  5BMZ A;  2K7L A;  1J59 A;  4GGG A;  1KU9 A;  1ODD A;  4NHJ A;  2A69 F;  1S7O A;  3RIR A;  4KYW A;  4L9N A;  1FZP B;  5BPI A;  2DO7 A;  2QVO A;  5FFZ A;  2MC3 A;  1SD7 A;  1RZ4 A;  4KN4 X;  1TQP A;  1T39 A;  3IWF A;  2KIU A;  3RYR A;  3COA C;  1TBX A;  2ZNZ A;  1R22 A;  1LJ9 A;  1MJB A;  3CTA A;  1YG2 A;  1BI2 A;  4MTE A;  1RI7 A;  2NNY A;  2NAZ A;  2XVC A;  2Z99 A;  2P5V A;  1O57 A;  3SFZ A;  4Y17 A;  3P9I A;  1X3U A;  2HQR A;  3ZMT A;  1V3F A;  2GIV A;  5BPD A;  2HKO A;  2B0L A; 
#chains in the Genus database with same CATH topology
 2EZK A;  2LRD A;  3GLX A;  2X9D A;  2XDV A;  2DMT A;  3PNT A;  4BUP A;  1YX5 A;  3E7L A;  4M72 A;  4BBR J;  1MH3 A;  1XD7 A;  3G4S I;  5F0C A;  4IL6 C;  4MGR A;  1FC3 A;  2PFB A;  1RUO A;  3W2V A;  1L3L A;  1FBS A;  4YFX F;  2E1N A;  4CO8 A;  4ZZD A;  1LB2 A;  2JUG A;  5ICG A;  1ZH5 A;  5IT9 Z;  1JUS A;  2R3S A;  1X2N A;  2QLZ A;  5J1R A;  2JSC A;  4Y13 A;  4G7O F;  2ZSH B;  1BBY A;  2EFW A;  4OIR F;  3JRF A;  2XKP A;  4ETS A;  4FX4 A;  4O3M A;  3F8F A;  2XAU A;  4AM3 A;  1U0J A;  2MC4 A;  4HG2 A;  2PMZ A;  4I98 B;  4F91 B;  3FMS A;  4G7H F;  1RR7 A;  4CYD A;  1XCV A;  5F0F A;  2BY0 A;  3BG6 A;  3T5X A;  3CC7 I;  2R7F A;  3IAS 2;  1FMW A;  1R49 A;  1USS A;  1NK3 P;  3HGY A;  1FSE A;  2A05 A;  3GZN B;  1TL8 A;  3BR6 A;  4FT8 A;  2TDX A;  1OYY A;  2L7K A;  4I99 C;  1V5E A;  3MWM A;  5FKK A;  4DIQ A;  4A3D J;  2DA1 A;  1ZQ3 P;  1YFH A;  3ZRG A;  1YQA A;  1WCM J;  5A2Q Z;  1EH8 A;  1IG7 A;  2M4G A;  3WE2 A;  2VXZ A;  2L7Z A;  3JRG A;  2O6G E;  3QYE A;  4U7B A;  2JPB A;  4RGU A;  2KRF A;  2YPR A;  1NH3 A;  3KET A;  2M9H A;  1LE8 A;  4WWC A;  3PFY A;  3VWB A;  1REP C;  3FXJ A;  4C9Y A;  4A0X A;  2E7X A;  4N4N B;  3IWZ A;  3RKQ A;  3ERM A;  1R1V A;  3BTL A;  4BKX A;  2WV1 A;  4XID A;  4OIO F;  1EA3 A;  2EBI A;  3R4K A;  2EK5 A;  2E35 A;  1FSH A;  3PNY A;  5H6R A;  2ZJP F;  3E1S A;  2VT2 A;  5M3F J;  3H9G A;  1P4X A;  3BZK A;  1TNS A;  3V8K A;  4G12 A;  1BOA A;  3ZXS A;  5D5U B;  1D3Y A;  2ZXW H;  3MFK A;  2UXX A;  4P5O A;  4A93 J;  2LKS A;  2O03 A;  2L02 A;  2FD5 A;  1ZKG A;  1O3R A;  1B72 A;  2FUG 2;  3RKW A;  2ECC A;  5BS6 A;  5M5X J;  1VND A;  5JHU A;  1N77 A;  3PUB A;  3FXU A;  5HS8 A;  3LSH A;  4YG2 F;  1B9N A;  3J80 K;  2GLO A;  4RM2 A;  1I50 J;  3M7G A;  3D1N I;  2IS2 A;  3TQN A;  4LMY A;  5JHF A;  4E7L A;  5HLG A;  2RQQ A;  3E6C C;  2UXN A;  2L9S A;  4II3 A;  3K2A A;  1IJW C;  3N4M A;  1SD5 A;  1MMG A;  3AG2 H;  1K4S A;  2AS5 F;  4G6Q A;  1RNL A;  3GBG A;  3CLO A;  5M5Y J;  2DI3 A;  3KLN A;  5LBQ A;  3KZI C;  2DXI A;  3ABM H;  1Z3X A;  1YHQ I;  5TJJ A;  2XKO A;  3I59 A;  2L2O A;  2Z1D A;  1I5Z A;  2WY8 Q;  1E3P A;  3ZQC A;  2ZXI A;  4LGW A;  4HST A;  5CLS A;  4PJL A;  2ADU A;  1QA6 A;  2W84 A;  3WHC A;  5IYD J;  1N78 A;  1DUX C;  4H0E A;  5C4X J;  3GEZ A;  3DCF A;  2EV6 A;  1MBE A;  3CMM A;  1S29 A;  4ZYD A;  3KP2 A;  3BTI A;  4Y15 A;  2EZH A;  2LYC A;  1ZLJ A;  1APL C;  4XLE A;  4ESJ A;  3NRV A;  2K9M A;  3MQ0 A;  2FOW A;  4MEY F;  3FZV A;  2MD5 A;  2PI0 A;  1W1W E;  4W1U A;  2KLO A;  4EGZ A;  3WTX C;  4OAY A;  3HBL A;  3GLL A;  3SZP A;  5LEK A;  3GZ5 A;  2OV7 A;  2OTL I;  2NVX J;  2MGQ A;  1LNW A;  4M3F A;  4PDK A;  4J01 A;  2L01 A;  2RDP A;  3W6V A;  1R00 A;  4WK8 F;  2P5L C;  5J4Y A;  4UHT A;  2XV4 S;  3NEU A;  5D5W B;  4LG3 A;  1ZG1 A;  2R5Z A;  2JZY A;  1HCR A;  3L09 A;  1TT5 B;  4X0G A;  2VBY A;  3HPH A;  1BIA A;  2DA6 A;  3QPL A;  1W5S A;  2EFQ A;  4I02 A;  3ZMS A;  1UAA A;  2MH9 A;  2B63 J;  4OIP F;  2GBY A;  2VKV A;  5CVR A;  2CV2 A;  3OYB A;  1E3O C;  1IV6 A;  1IN7 A;  2EFO A;  1XSD A;  1G3Y A;  1PJR A;  2XGC A;  3CCM I;  1RET A;  3GUD A;  1H9G A;  3P9C A;  4LB6 B;  2K3F A;  5L3D A;  5F04 A;  4BYY A;  1YW7 A;  4WXD A;  2GXA A;  1S9H A;  2K9N A;  4IHV A;  3WTZ A;  2ELH A;  2NYX A;  3REO A;  3GW2 A;  4BXU A;  2BGC A;  2R7O A;  3WTT C;  3JRC A;  5DTD A;  1O3T A;  1Z7L A;  2CFO A;  5K5Q A;  3KP7 A;  4KIB A;  4TV7 A;  3VYU B;  3TW6 A;  4IHS A;  1T56 A;  3BLY A;  1IRX A;  1BR2 A;  2WAE A;  3BJA A;  4A3C J;  1A6I A;  3N05 A;  4A2U A;  2DDB A;  3U1D A;  1HOM A;  4JX4 A;  2X0L A;  1OIS A;  3C7J A;  4BHB A;  2F5E A;  2W25 A;  3A0H C;  4U88 A;  5HDK A;  2QKL B;  3GTK J;  3M1E A;  2LKP A;  1B4A A;  3M8F A;  2QZ8 A;  2IS1 A;  2CUJ A;  1ZG5 A;  1DU0 A;  2V1U A;  5CVU A;  3A03 A;  3ZPL A;  1ZRE A;  3I56 I;  2EIM H;  2DT5 A;  3CC2 I;  3FBI B;  4XLP F;  5BOX A;  3KP4 A;  2M7A A;  4WXH A;  2OD5 A;  5IP7 J;  1AA7 A;  2HU9 A;  2L0K A;  3SYT A;  3ROU A;  3AG1 H;  4N9H A;  3GX4 X;  3R0J A;  3DLA A;  2VUM J;  1PP7 U;  4ZYE A;  3CCL I;  1SVL A;  3QYB A;  4A3F J;  3F8M A;  4CGZ A;  2X48 A;  3CMA I;  3W2A A;  3SHF A;  5HOD A;  2ESN A;  3BR2 A;  1IXR C;  3O8G A;  4EM1 A;  4PSW A;  3WTV C;  6PAX A;  2Y9Y A;  1NG6 A;  2JTV A;  2XAQ A;  4DYC A;  3K7A J;  1MBH A;  2DJN A;  4EMS A;  1P7J A;  2G7H A;  1UB9 A;  4HRI A;  4E7Z A;  5E1X A;  3FKI J;  1Y8R B;  2L5Q A;  2QSF X;  3E3V A;  2OC6 A;  2VN2 A;  5E3N A;  1O7F A;  1XGS A;  2F4M B;  4EQQ A;  1Q1H A;  3MZY A;  5ICE A;  2VOO A;  4DW6 A;  1JT0 A;  4D5F A;  3GWZ A;  1ORK A;  1SEU A;  4U0V A;  3MEX A;  4U0Y A;  2X1E A;  5CPR B;  3TBI A;  3GTG J;  3K70 D;  3MCZ A;  3FMR A;  1BJZ A;  4RGS A;  1G59 A;  2V79 A;  3OYK A;  4K2E A;  4F7Z A;  3QYF A;  3DEE A;  3QP5 A;  4NQW B;  4HF1 A;  3V4G A;  1MNE A;  1HW2 A;  2X6W A;  4BQA A;  2M45 A;  4CCN A;  3S3M A;  2DT7 B;  4KN7 X;  1R7J A;  3F6V A;  2AQE A;  5HNF A;  4L5E A;  1SAX A;  2FQ4 A;  2KL4 A;  3B73 A;  1JHH A;  1R1U A;  3HRM A;  2TRT A;  4IKF A;  4QWQ A;  2YX4 A;  4IHT A;  3LSK A;  5AIP A;  3VEP A;  1FNN A;  3KIO A;  2WBM A;  4QPO A;  1R1T A;  2CV1 A;  3VFZ A;  3DQV C;  2DQL A;  4XIC A;  1UMQ A;  1GVD A;  1Z05 A;  1R6R A;  1XGM A;  2ACJ A;  1C0W A;  2HKX A;  1IUY A;  5LHH A;  2L7M P;  2XRO A;  4BJT A;  5HNH A;  1KU3 A;  4RA2 A;  2DTR A;  4AYB A;  1HBX G;  4C2U A;  2ME0 A;  3GCM A;  2GXB A;  1X3W B;  3FK7 A;  5F0H A;  1SMY F;  1F4K A;  1BM9 A;  3UKG A;  3PFI A;  4L5J A;  2IA2 A;  4OIN F;  5LEJ A;  1R4M B;  2VXD A;  2LFB A;  2X1D A;  1FOW A;  4NB5 A;  1Z9C A;  1B8I A;  2R7Z J;  2CU7 A;  4BY1 J;  3JTG A;  5H20 A;  2Z33 A;  3EUA A;  3M1C A;  3ZQ7 A;  3G6E I;  3CMY A;  3OMY A;  3RQ4 A;  4UUS A;  1T0F A;  3TKY A;  3FK6 A;  1Y1V J;  5HDG A;  3ZP5 A;  2Z3Y A;  2A6H F;  1J7K A;  3ERE D;  3O2P E;  1UHM A;  4BXF A;  3GFJ A;  3NAR A;  2WV0 A;  1Z7U A;  1QHH D;  3DWL E;  5D6F A;  2Y69 H;  2NVQ J;  4CH7 A;  2OQG A;  2L3D A;  1W36 D;  2EFN A;  1PUF A;  2ZME B;  3HOT A;  2XF5 A;  3H9J A;  1EKE A;  5CYV A;  5EG0 A;  2RKH A;  1V4R A;  1VQN I;  3K4J A;  2V4J C;  2KJC A;  5IT9 K;  1L0O C;  3CP2 A;  2XIG A;  4UB6 C;  2QQ9 A;  2MA3 A;  4G8X A;  4BHC A;  3K10 A;  4M73 A;  2O3F A;  4XQF A;  1AKH B;  4NC6 A;  1NHA A;  4M3D A;  4CCJ A;  2M8E A;  4JX6 A;  3V7R A;  1J0R A;  2A6T A;  3A01 A;  1ZGA A;  4KIS A;  2Q8K A;  3F8N A;  2JQ7 A;  1ON2 A;  2GWR A;  2Y0S N;  5EF6 A;  2AO9 A;  2MD0 A;  3MMY B;  3E5X A;  4E7S A;  4W97 A;  1K78 A;  3LQQ A;  1ZTR A;  2E1C A;  4NUB A;  1FYK A;  2YSR A;  1T38 A;  5CKT A;  2PMH A;  3BR3 A;  3WG7 H;  1FTZ A;  2HI3 A;  1IDY A;  2JRM A;  3TMO A;  2WAQ N;  4UV9 A;  2LC2 A;  1ZYR F;  3GTO J;  1G3W A;  4Z2Y A;  2QQ8 A;  2WC2 A;  5FRO A;  4QTR A;  3JW4 A;  2WB1 N;  2EIL H;  2XPW A;  1ETY A;  2QM3 A;  4DBQ A;  2PX9 A;  1R5H A;  2PEX A;  1NTC A;  2P0W A;  3U21 A;  1ZAO A;  2DA7 A;  1IRG A;  2BHZ A;  5JLX A;  1CQT A;  4KIG A;  2DA4 A;  1V55 H;  5A2Q K;  3S14 J;  2HZD A;  1DDN A;  2M5W A;  4G9Y A;  5J6X A;  3NWT A;  3DEW A;  1MD0 A;  3K9T A;  3Q0U A;  1IN4 A;  2CW0 F;  4ZZL A;  2IA1 A;  3DBR B;  4OAZ A;  4FET A;  4XR6 A;  2NVY J;  5E18 F;  2GA2 A;  3CUQ B;  2M7B A;  2DFE A;  3G3Z A;  1EV7 A;  3I64 A;  3HKZ A;  1YW9 A;  4LOC A;  5FFX A;  3ZQF A;  2QEN A;  3EET A;  1U3E M;  5LRS A;  2FU4 A;  2L9R A;  4R1H A;  3PO3 J;  2DDA A;  3Q0V A;  2DW4 A;  4A12 A;  3WTY C;  3HEF A;  5DCM A;  4JBA A;  2E1M B;  1BR1 A;  1U5T B;  4BE1 A;  4P1W A;  4HDU A;  1ENH A;  1YI2 I;  4PCQ A;  1WGX A;  2NVT J;  1W5T A;  3FM5 A;  3KP3 A;  4A0Z A;  1K79 A;  3L7W A;  2VL8 A;  2E34 A;  1XTA A;  4Y33 A;  3OV8 A;  4DQ2 A;  1TQI A;  1T98 A;  4RLQ A;  1YTY A;  4C3J J;  2KPM A;  3TED A;  4RGX A;  1AOY A;  4L0Y B;  3RKX A;  3TP0 A;  2EA2 A;  5EGO B;  2DFF A;  2A3S A;  4D0P A;  2NRA C;  2MYS A;  1ZR4 A;  3H92 A;  2H8R A;  2GZW A;  4NC8 A;  1T8I A;  2VON A;  3ZQI A;  2WY7 Q;  2V9P A;  4WCG A;  3IRQ A;  1K4T A;  1VI0 A;  3TO9 A;  3FWE A;  5D6E A;  1MSE C;  3AL0 B;  2R7S A;  2JWT A;  3H0G J;  3RPU D;  4WX9 A;  4CYC A;  3Q5F A;  2XRN A;  3BPV A;  4HF0 A;  2R0Q C;  3F6O A;  2PMZ N;  1TWF J;  5ERI A;  1T0F C;  1OCC H;  1SFE A;  1X1A A;  3V42 A;  4E7K A;  3JRH A;  3QOE A;  1ZK8 A;  2DTZ A;  3VOE A;  2Q2E B;  4BGD A;  1P7I A;  3HPG A;  3WOD F;  3OYL A;  2NS7 A;  2HWV A;  2HYG D;  2BXY A;  3I71 A;  2K85 A;  4LD5 A;  2AHQ A;  1A04 A;  2NOJ B;  2X6O A;  2V9K A;  4LB5 A;  3S2H J;  3K4L A;  1LUJ B;  1O3Q A;  2DOA A;  5AIQ A;  4A3K J;  2ID3 A;  1SD4 A;  4A5M A;  1CF7 A;  1FOK A;  2G0E A;  4J19 A;  5CVV A;  4GDF A;  4I09 A;  2CG4 A;  4P55 A;  4P9F A;  1X1D A;  5ICC A;  3LQR A;  1BI1 A;  5F27 A;  4BHP A;  1YIO A;  1G3S A;  4BE2 A;  4XK4 A;  4ASN A;  4B43 A;  5JR3 A;  3IHU A;  2VKD A;  4HLX A;  2KFD A;  3RTR A;  2B9S A;  1K61 A;  1HDD C;  5KCM A;  4ZYG A;  3Q0W A;  3O6B B;  3W3C A;  4DNC A;  5L3E A;  1I1G A;  1QVT A;  1R5G A;  4ESF A;  1HLV A;  5DS9 A;  4Y4R A;  5LGU A;  4IRI A;  2L9N A;  3G73 A;  3A2K A;  4ZDO A;  2AXT C;  4PJJ A;  3LA2 A;  1F5T A;  2CW7 A;  2XAF A;  1XPX A;  1D1A A;  3G71 I;  2QSH X;  3EPZ A;  4M74 A;  4KA4 A;  3CCU I;  4OWR B;  5CVI A;  2FMY A;  4MQ9 F;  3LFK A;  2DU9 A;  2QUF A;  3SXY A;  2KRH A;  3S3N A;  3JRE A;  2H09 A;  4ABZ A;  1TT0 A;  2DPD A;  2BW3 A;  3F8B A;  3ABT A;  1ACI A;  3F3X A;  1S8N A;  2Q0O A;  1UFM A;  2ZFW A;  2F2E A;  4PSX A;  2X85 A;  1WSU A;  2F5D A;  3CDI A;  3FXR A;  5M5W J;  5FLM J;  3BCB A;  2D2W A;  1SAU A;  1VQ7 I;  3WU1 B;  2IT0 A;  5B3S H;  4UVA A;  1J2X A;  4BJ5 C;  2LD5 A;  1BN5 A;  2NS0 A;  2Z9O A;  3SEQ A;  2XAS A;  4BEH A;  3OYM A;  2LY9 A;  5LRR A;  4YRV A;  3RI4 A;  2GXG A;  2RVC A;  1JTX A;  3C2G A;  2CWE A;  3WGI A;  5K5R A;  4WF2 A;  2YU3 A;  3FIW A;  5FGM A;  1EH7 A;  4A3M J;  1BI3 A;  3MD2 A;  2FX0 A;  4CHU A;  5GTH C;  1MBK A;  3PM1 A;  4ZH4 F;  4MIM A;  4AWX B;  2V1N A;  1F43 A;  4IX7 A;  1R36 A;  1QNT A;  1VQL I;  2ZO4 A;  3DF8 A;  2DK5 A;  1IXC A;  2FXA A;  5DM6 F;  3BZC A;  1G8X A;  4HV5 A;  5IT3 A;  3HOX J;  2XSJ C;  1W0T A;  1VZ0 A;  5HS9 A;  5DEQ A;  4CUG A;  5DM7 F;  3FIS A;  3FXK A;  3KEO A;  3V8J A;  1OKR A;  2DYS H;  1I3Q J;  1ON1 A;  4U87 A;  1DPR A;  4UUT A;  1YOV B;  2DK8 A;  4FE4 A;  4C2M J;  2VC0 A;  5FD6 A;  1S7E A;  2CRG A;  4EJW A;  4KIT B;  3KZY A;  1YYV A;  1ZN2 A;  4HX4 A;  3ZMD A;  1V5G A;  2BE5 F;  3CO6 C;  2A6E F;  2LSO A;  3WE3 A;  4C2T A;  2VLA A;  1I39 A;  4LFU A;  4OOI A;  3CME I;  2ZCW A;  5ILS A;  1E0E A;  4LIT A;  4RAY A;  4IHY A;  2GQQ A;  2V6C A;  3VPR A;  1FIA A;  1XMK A;  2FQ3 A;  2D1H A;  4IO9 F;  4Z6Y A;  1T95 A;  2H6B A;  5J3L A;  1J75 A;  4AVZ A;  2YX7 A;  3HSF A;  3FXQ A;  1K83 J;  3S8P A;  3VSK A;  2FSW A;  1FJL A;  4HF2 A;  1QHG A;  3T8R A;  4G6T B;  1HKQ A;  1KON A;  3BY6 A;  1Z21 A;  4QSH A;  1S5L C;  3DU5 A;  3K69 A;  4F3Q A;  1LEA A;  4B48 A;  4HQM A;  4BS9 A;  4AIK A;  4UVC A;  1OCO H;  4N4O B;  1Y0U A;  2WAD A;  3PIP F;  4HQE A;  2CMP A;  3I4N J;  4KT5 C;  3HOV J;  4ANJ A;  2OCE A;  3MKL A;  3CCE I;  3KLO A;  3MZH A;  1R5I D;  1T6S A;  2CQQ A;  5K7H A;  1U9N A;  1OCR H;  2HZT A;  4RBO A;  4BAY A;  5HLT A;  2V6E A;  3DPT A;  2FML A;  3HYI A;  4XLN F;  1KA8 A;  1D1C A;  1G3T A;  4BQN A;  4Y52 J;  2ECB A;  1LPQ A;  1BA5 A;  1YIT I;  3CDH A;  2O8X A;  4PFO A;  4DBR A;  1IXS B;  1QPI A;  5D5V B;  1ZLK A;  2FOK A;  2QWW A;  2JT1 A;  1O4X A;  1B9M A;  3QAH A;  1RKT A;  1GDT A;  3TO7 A;  2CFX A;  3C3W A;  2PG4 A;  5E1Z B;  3ZN0 A;  5J1Y A;  4G6D A;  2K02 A;  5EEA A;  2DMP A;  2Z16 A;  5LGT A;  3I58 A;  1Z67 A;  4A3B J;  2AXL A;  5ICF A;  3J7A Y;  3QPH A;  5F6F A;  1GXQ A;  4XNF A;  3J7Y J;  2RNJ A;  4Q48 A;  5C3E J;  4JK1 X;  2IA0 A;  1E17 A;  2OZ6 A;  2QKM B;  1UHW A;  2R7W A;  3BT9 A;  3S1M J;  3TOA A;  4JQF A;  5GPC A;  1D5Y A;  3TGN A;  4PZJ A;  2IS6 A;  4NNJ A;  4DZP A;  3IRR A;  2G9W A;  3FXO A;  3DFG A;  2XB5 A;  3VOD A;  4CZZ A;  1ZAR A;  4GO1 A;  4XLH A;  1WVR A;  1WJB A;  3B6A A;  3AG3 H;  2XSD C;  2HTJ A;  1OPC A;  3CF2 A;  2QEX I;  2ICW G;  5E8G A;  5HS7 A;  2K9S A;  2IJL A;  4I7H A;  3EUH A;  4LG0 A;  2VE9 A;  1EF4 A;  3JSP A;  2H1K A;  1P92 A;  2BEO A;  3H3Z A;  4XN3 A;  1VQ9 I;  1JXS A;  2JK3 A;  2JA2 A;  2YS9 A;  2IGM A;  3MKW B;  2HPM A;  3M3Y J;  5JLW A;  5KVR A;  2JA5 J;  3CUO A;  1JJ6 C;  2HFH A;  1ETX A;  3R61 A;  2CV0 A;  2EV0 A;  3BTC A;  1SAN A;  2LK2 A;  3JRD A;  4PJN A;  3CD6 I;  1QZY A;  3H5A A;  3FMQ A;  1S3J A;  2L7F P;  3BOQ A;  4UV8 A;  2EFP A;  4A3I J;  1D8J A;  3BQZ A;  4II2 A;  3RZD J;  1J5Y A;  2R92 J;  4EJV A;  2ETH A;  4EJU A;  1MNM C;  1UCR A;  1Z77 A;  3G2B A;  3IH2 A;  5IOZ A;  2BVM A;  2JA7 J;  2DMQ A;  1LFB A;  2DOD A;  4IPA A;  2W82 A;  4PJ0 C;  1TWC J;  2A5Y B;  3C1D A;  1LFU P;  1CGP A;  3ABU A;  5F64 A;  4BY7 J;  1P6R A;  2R4G A;  5D8L B;  1AU7 A;  5EDN A;  3FXM A;  3S2D J;  1MJ9 A;  3NAU A;  3OL3 A;  2HXI A;  2Z5U A;  4RB1 A;  1ZGJ A;  2P8T A;  3CJT B;  2IP2 A;  2EIJ H;  2VIX A;  4D7N A;  4B1R A;  1D8K A;  4LLN A;  3PSF A;  4JOM A;  1LE8 B;  3HUG A;  1F36 A;  2H94 A;  4E4H A;  1IC8 A;  2TCT A;  2OBP A;  3HRT A;  1JE8 A;  4IQJ A;  4PJM A;  1ERD A;  3HRS A;  2RAE A;  1QQI A;  3S1N J;  5J4V A;  1QVU A;  5IOY A;  3DTK A;  1E3H A;  3LAP A;  1MDM A;  2PQ8 A;  3VYR B;  2K4B A;  4XOP A;  9ANT A;  2K27 A;  2G7U A;  2Q1Z B;  2K86 A;  5JVT A;  1VQ8 I;  4JYK A;  2QBY B;  2K4J A;  3HSE A;  3HHH A;  1S6L A;  4E6K G;  2C6Y A;  2PJR B;  4XRS A;  2DT6 A;  2HS5 A;  2R93 J;  3QU6 A;  4E7H A;  1TLH B;  4EV0 A;  2DMN A;  2W24 A;  1G6N A;  2RV8 A;  2MSY A;  5H2F C;  3S2W A;  1AKH A;  1BC8 C;  1RR8 C;  1B6A A;  1E2X A;  2XF7 A;  5B66 C;  1SMT A;  4BL0 B;  2HOE A;  5FKL A;  3L2R A;  4I76 A;  2JMW A;  1QZE A;  5FJ8 J;  3OYD A;  1W7P A;  4U7D A;  1EJ9 A;  2HVQ A;  3IH4 A;  5TRD A;  3I3L A;  2F5F A;  1YRN A;  2EA4 A;  3B6C A;  1BR4 A;  2E2J J;  2RGV A;  1ZEL A;  3K4N A;  1XGO A;  4XM3 A;  3L2V A;  3PNV A;  2FNP A;  3BG3 A;  1RKW A;  1A31 A;  4ZC3 A;  5GAE J;  2XUB A;  3KCC A;  2V1D A;  4G94 A;  1W5C C;  4MLO A;  2HYJ A;  3U2R A;  1HW5 A;  3RZO J;  1WI9 A;  1JUM A;  4RB0 A;  2XAH A;  3KP6 A;  3S93 A;  4B8X A;  2LP0 A;  2VQC A;  5D4S A;  1IV8 A;  3E5Q A;  5J40 A;  1ZHF A;  4ENM A;  4EM2 A;  2HVS A;  3RJP A;  1A35 A;  2FJ1 A;  4EVI A;  4C3I J;  4OU0 A;  2FF4 A;  3P7N A;  1ZGW A;  1PUE E;  1IGN A;  3L2U A;  3N97 A;  4YFK F;  3EDP A;  3DP7 A;  2WA0 A;  3DPU A;  3OR1 C;  3CF5 F;  1P2F A;  3TP3 A;  2CH0 A;  3FHZ A;  2RRE A;  1FP1 D;  2KKO A;  3E0J B;  2DLL A;  3K70 C;  1GV5 A;  2OA4 A;  4X1E A;  4RB2 C;  4HLY A;  2E5N A;  3CUQ A;  4HYE A;  2DFI A;  3JRA A;  2B7E A;  2CUF A;  2PN6 A;  3OSG A;  2VPL A;  2RQP A;  2R5Z B;  1WHU A;  4B4C A;  2JA6 J;  2F5C A;  3EUH C;  4HSR A;  3OYI A;  4A3G J;  2FBH A;  1J09 A;  3SZT A;  1U5T A;  4BNC A;  2XHK A;  4KMF A;  3I5U A;  3QRF F;  2Y2Z A;  2LY1 A;  2WWY A;  3BRO A;  3HKZ N;  4IXA A;  2GOX B;  3I4P A;  2UV1 A;  3J81 Z;  4PK4 A;  1W4M A;  1WJD A;  2JJ7 A;  1F9N A;  3GME A;  4S0H B;  3DKW A;  2VB6 A;  3MVP A;  2LRE A;  5LHI A;  3WTW C;  1I27 A;  3OL4 A;  1JKP C;  1WH7 A;  4LLL A;  2V26 A;  4DJA A;  3DPL C;  5L3C A;  5DYM A;  1YO5 C;  2HEO A;  1XGN A;  4RB3 C;  2JRT A;  4GRI A;  5IP6 A;  1YIJ I;  3PJR A;  2HOS A;  2R5Y A;  5L3F A;  3H5R A;  2MLK A;  2AQF A;  1SFO J;  2EV5 A;  4KMU X;  3FBN B;  5IPA A;  2ISZ A;  4F55 A;  2VPR A;  2OPT A;  3V7S A;  4UUV A;  2K5C A;  2IVM A;  2O5R A;  3ZMZ A;  2JSP A;  4MFD A;  2KT0 A;  5ILU A;  4LK0 F;  2NOG A;  5FLX Z;  1Z3Y A;  3RPU A;  2EPF A;  3PQK A;  4I01 A;  3L1P A;  2QGU A;  5DD8 A;  2DMU A;  2M8G X;  4ZDP A;  4JX5 A;  1GLN A;  4ENN A;  1SVM A;  1MJA A;  1GV2 A;  1HW1 A;  4LLG F;  2Z2S B;  3JAM Z;  1FYM A;  2IEK A;  1OQY A;  2Q2E A;  4C30 A;  3D5L A;  3CO7 C;  4CIC A;  3H0D A;  1BC7 C;  1FBU A;  4HX7 A;  4YIF A;  4OMY A;  5GP9 A;  2BYV E;  3E5U A;  3MKZ A;  1ITY A;  5H6Q A;  4I0A A;  3KP5 A;  4M6Y A;  3IUO A;  3LSJ A;  3S1R J;  3S17 J;  1I3A A;  4IRG A;  4GYG A;  2HNH A;  1ULY A;  5K7F A;  1ZRF A;  1A5J A;  2VBZ A;  3CLQ A;  3HTU A;  2FNA A;  2BHY A;  3S15 J;  2P7V B;  3GTM J;  3ONQ A;  1A36 A;  1HA8 A;  1R23 A;  1TZL A;  1JI8 A;  3E6M A;  1BL0 A;  3ZQH A;  4BXX J;  1QBJ A;  1O7L A;  1OCP A;  4X6A J;  4FIS A;  1WJ5 A;  4ENK A;  4RAF A;  5E20 A;  3L9F A;  4XSX F;  5KAF C;  5IP9 J;  4XKB A;  5EEG A;  1TWH J;  3FXL A;  3OS0 A;  1H8A C;  4CA0 A;  4AD9 A;  4NBQ A;  3HOS A;  2UZK A;  2DA3 A;  1ZRC A;  3BR5 A;  3OIP A;  1JGG A;  4M3E A;  1MW7 A;  2ZXJ A;  1KQ9 A;  1IO2 A;  5JI6 A;  3V7C A;  2RNG A;  4ZJZ A;  4KJZ A;  2CS3 A;  2IGK A;  3SJM A;  4AVP A;  1LVK A;  4A6D A;  4XKC A;  4FAS D;  4HV6 A;  4Q5S F;  3RYP A;  3ABK H;  1GVJ A;  2HOT A;  1X3Z B;  3F23 A;  4RM3 A;  2QCO A;  1UST A;  4KNY A;  1MGT A;  2E7W A;  5HDN A;  1PVE A;  2IAI A;  3GFM A;  2MLG A;  5DD4 A;  4QLC U;  4P9U A;  1IZ1 A;  4L9J A;  1H89 C;  2KDZ A;  2BY3 A;  1MZB A;  2KIQ A;  1D1B A;  3Q9V A;  2VT3 A;  2ZNY A;  1POG A;  2JN6 A;  2DJI A;  2YU9 J;  1U78 A;  4YIR X;  3TDZ C;  2P6S A;  3LFU A;  3U1K A;  3ZQL A;  4D7M A;  1TQM A;  2XAJ A;  3AG4 H;  4KIC A;  2STW A;  5HOO A;  3CUQ C;  2JPC A;  2F5V A;  5M3M J;  1FOX A;  1K7A A;  4M9S A;  4I0B A;  5K1Y A;  3IKV A;  3RSN A;  2LOO A;  3A1Y A;  2O8K A;  2GM4 A;  4KFC A;  2COM A;  4BE0 A;  4EM0 B;  4XSZ F;  2DOE A;  1WFX A;  2BY1 A;  3OYA A;  2Y9Z A;  4G7Z F;  3CCS I;  2E1M C;  3F0C A;  1T2K A;  1U5T C;  1ETO A;  1OCT C;  4S05 A;  2YR2 A;  3CQZ J;  3CC4 I;  5TGT A;  3OIO A;  5BQT A;  3MKY B;  1P4A A;  3OR2 C;  3WGG A;  3L2C A;  5FLV A;  2XB0 X;  2KMU A;  1DU6 A;  2KZV A;  4HAM A;  1YJ9 I;  3I0T A;  3NQO A;  4S04 A;  1XDU A;  3KYL A;  3S16 J;  1B8I B;  4CCL A;  4A0Y A;  3A4C A;  2W57 A;  3GO5 A;  4PUS A;  4Y7N J;  5ILV A;  3IC7 A;  3H36 A;  2PLY A;  3ECH A;  3JSO A;  2HVR A;  3K4K A;  1VQK I;  1G2H A;  2CO5 A;  1MKM A;  2GOM A;  3HTS B;  3T1B A;  3FDY A;  2HYF A;  2MFZ A;  4L0Z B;  1S7A A;  1G4D A;  2ZBK A;  2DOF A;  1YX3 A;  1JKQ C;  4ZTF A;  4M3B A;  2VKH A;  4LIV A;  4BDY A;  3B02 A;  1FWZ A;  4B47 A;  2HQN A;  2R7X A;  4M9Z A;  4EAT A;  2STT A;  3LOC A;  1XN7 A;  4MNU A;  2HTS A;  3E6B A;  1YJW I;  2EWN A;  4XKV A;  3ML6 A;  3C18 A;  3F8C A;  2MBF A;  2DFH A;  5E3O A;  2X51 A;  3CCY A;  5EG0 B;  5FKO A;  4BQQ A;  2Y0S A;  3GFL A;  1NG7 A;  3ZQG A;  2DPU A;  3CCR I;  1MSF C;  1ETW A;  3DXJ F;  1JTY A;  4M6V A;  5HLH A;  2CUZ A;  4O6J A;  1HKS A;  3BR0 A;  3WHB A;  3OOP A;  2R7D A;  4XRS G;  1JHF A;  1TW2 A;  1IRZ A;  3A01 B;  1UEL B;  2VBW A;  2E2I J;  3OYE A;  1X2M A;  3IKT A;  4XN0 A;  1KZH A;  1DGR M;  1M1E B;  2VQL A;  2WB1 A;  4F52 A;  3LSM A;  1SFU A;  3VDX A;  2LNB A;  1K78 B;  2MH2 A;  3WG9 A;  3S1Q J;  2V7F A;  2W7N A;  2V1X A;  1WI3 A;  3F21 A;  4BDZ A;  1GXP A;  2BXZ A;  2LR8 A;  2M4K A;  3IL2 A;  2ZXH A;  3KFW X;  4KT6 A;  3OS2 A;  1MMN A;  2OUM A;  2GA1 A;  4V2F A;  5IYC J;  1IUF A;  4IRH A;  2XF6 A;  3DLL F;  3LNQ A;  4XMY A;  5EZG A;  1D0X A;  1VTN C;  2VOP A;  2PMU A;  4HEA 2;  5ED4 A;  3ISP A;  2IS4 A;  1I1S A;  1H9T A;  4A3J J;  1KQ0 A;  2M1B A;  3SDB A;  2E2H J;  2R7Q A;  4J00 A;  5D4R A;  2LY2 A;  3H3U A;  1QRY A;  1MIJ A;  3Q3S A;  4FQG A;  1QGP A;  1WKM A;  3SDG A;  2P81 A;  1D0Z A;  2XAG A;  2M0C A;  3QU3 A;  3RKY A;  3BWG A;  2CJJ A;  5GAH J;  2H8W A;  1IAW A;  2H27 A;  2FE3 A;  2DBB A;  3K0L A;  1Y6I A;  2P4W A;  5DCM B;  2ZJQ F;  4L18 B;  4LIU A;  2VJI A;  4NC7 A;  2LTP A;  3LL7 A;  4PGG A;  5FD5 A;  4AIJ A;  2XC7 A;  4P96 A;  2X6Y A;  3ASN H;  3LSG A;  3QOD A;  3PSI A;  1FPQ A;  3FM3 A;  1VQ6 I;  4A5N A;  4QIW N;  3J7A O;  1OLT A;  2E5Z A;  3LA3 A;  1FT9 A;  3HL2 A;  2VI6 A;  3H5N A;  2I8D A;  4Y3O A;  3ASO H;  4ZTJ A;  4CCO A;  4AID A;  2BBY A;  3BTJ A;  4RGR A;  2IGN A;  5EZH A;  3I4M J;  1UHS A;  4RMN A;  4PGH A;  1HKT A;  2OZU A;  3ELK A;  3LWF A;  1FOY A;  3G1O A;  4E7J A;  4IEJ A;  1IW7 F;  3UNG C;  1TTY A;  4D5C A;  2LMD A;  5B1B H;  2M30 A;  2P5K A;  1XB4 A;  4CYC B;  5HLI A;  3WGH A;  1WRJ A;  5E3L A;  3M8E A;  4HA8 A;  4ITV A;  1R71 A;  2R7V A;  3OY9 A;  3D0S A;  3KZZ A;  2KZG A;  1I6H J;  1WZ2 A;  1XSX A;  2X4H A;  2I10 A;  2VJ4 A;  2X6X A;  3BQY A;  2XGE A;  3D5S C;  5F1R A;  3F72 A;  2E71 A;  2ZSI B;  3KE2 A;  2EIN H;  1MMD A;  3U9G A;  3R0A A;  4WXC A;  1FEX A;  1VQO I;  2KIS A;  4KDP A;  3LA7 A;  1BW5 A;  1TW3 A;  4HZF A;  1OJL A;  2DA5 A;  3CZ6 A;  1WPK A;  3HJE A;  1W0U A;  3HG9 A;  3IH3 A;  3F22 A;  2HR3 A;  4IOA F;  1CF7 B;  5LGN A;  2VQH A;  4F93 B;  1XCB A;  2BVL A;  4IQ4 A;  1Z0X A;  1Z1D A;  4O5V A;  2Y31 A;  4E7I A;  4V2G A;  3DTE A;  5F1J A;  5DUI A;  1YLF A;  4XLA A;  1FLI A;  3R60 A;  4RLF A;  3WU2 C;  2QBY A;  2L4M A;  2PJR A;  4RAZ A;  3HSR A;  1TWA J;  4CSW A;  2GAU A;  1R4N B;  2DYR H;  1BJA A;  4DYQ A;  1YE9 A;  2NVU B;  2ZJR F;  1RRJ A;  1ONV A;  3A0B C;  4HX8 A;  1XDS A;  2OAZ A;  4A3E J;  3Q9S A;  2OQR A;  4BQO A;  3OYN A;  5FO5 A;  3F9K A;  2QQB A;  1XMA A;  1BW6 A;  3J81 K;  3CJN A;  4IHW A;  3A02 A;  3HIF A;  1KYW A;  2LBF B;  2FBK A;  2KDO A;  2A68 F;  4GXO A;  1Z6T A;  4N0B A;  3BJ6 A;  4FCY A;  1R58 A;  3VYT B;  2M34 A;  1TNT A;  4YEJ A;  5EYR A;  2R7T A;  4RDU A;  3QPT A;  1HSJ A;  1HDP A;  4AIH A;  4DOZ A;  2BW3 B;  4BAC A;  5LFA A;  3P9K A;  1UZC A;  3QP6 A;  3HOU J;  2LDU A;  2PJP A;  1PP8 F;  3K4M A;  4C3H J;  5IY5 H;  4UNO A;  5DDG A;  5FLX K;  1JKO C;  3CCV I;  1VF9 A;  3HRU A;  5E79 C;  1XMX A;  4NQW A;  2L9V A;  5JFR A;  1IDZ A;  4BEH B;  3CCQ I;  2OJE D;  4MTD A;  1DPU A;  4MHG A;  3J7Z I;  1LFP A;  3S32 A;  1VFC A;  3JAM K;  3E6D A;  4R79 A;  1VQM I;  2WTE A;  3GFI A;  3CDL A;  3LSI A;  4XLF A;  1GT0 C;  3K4B A;  1ZRD A;  2PBI A;  4ON0 A;  4V19 K;  3CES A;  4F92 B;  3H35 A;  3W6J B;  2M3A A;  5DCF A;  3ZCO A;  4UXN A;  1STZ A;  5LD2 C;  2CQK A;  4Q47 A;  1YW8 A;  1U8R A;  1OCZ H;  4A3L J;  5FKM A;  1FYL A;  2CQX A;  5K5O A;  2M2E A;  2O61 A;  1GHC A;  1MND A;  1FBQ A;  1LDJ A;  4MFE A;  3WU0 A;  2L4A A;  3MZ8 A;  5C44 J;  4EJT A;  3KEQ A;  3BCA A;  3BPX A;  2ZB9 A;  4LJZ F;  2QSG X;  2VJ5 A;  1OYW A;  3GVA A;  4XKW A;  3CJQ B;  4AUX A;  5C4J J;  2R7R A;  1H0M A;  2BV6 A;  3DEU A;  1TP4 A;  3K1P A;  2IPQ X;  2XRL A;  1K6O A;  2N8G A;  1HC8 A;  3BP8 A;  3S3O A;  1BIB A;  3HOZ J;  1ZG3 A;  4DGW B;  1Y0N A;  4FHT A;  1WJA A;  4GCV A;  1HST A;  4AYB N;  4IJA A;  5L3B A;  5GPA A;  4ZDL A;  3RQI A;  3PIO F;  4OMZ A;  4L9V A;  4MQV A;  2UUZ A;  2CSO A;  1U8B A;  5IYB J;  4ZYA A;  4L9T A;  2KIM A;  4GFB A;  5GAD J;  2HDC A;  2O0Y A;  3OWT A;  2FA5 A;  3O3K A;  1EH6 A;  4HNT A;  2FRH A;  2OTJ I;  1P4W A;  4HNU A;  3HOY J;  2CQ7 A;  4XON A;  1IN8 A;  2XPU A;  2F6C A;  1YS7 A;  3ZOB A;  3I55 I;  2EZI A;  3H9Q A;  1LEB A;  2ZKZ A;  3M9A A;  1O3S A;  3DU6 A;  3HZJ A;  4AU7 A;  5J47 A;  2ESH A;  4A69 C;  2I5U A;  4B44 A;  1WWX A;  4YII A;  3JRI A;  3L2W A;  2DCE A;  1VQ5 I;  1D5V A;  2P6T A;  2ZME A;  4YEL A;  1LQ1 A;  3VYS B;  1LKX A;  2VJJ A;  1B72 B;  5E3M A;  2ELK A;  1IF1 A;  3SQN A;  1KU2 A;  1X1P A;  2KHM A;  3ZN1 A;  1KQ8 A;  2E60 A;  5FB2 A;  2IW5 A;  3BZ6 A;  2BY2 A;  5E1W A;  5BNG A;  1MMA A;  3K4C A;  4Q4Z F;  1OFC X;  4UY8 I;  1N25 A;  2K3P A;  3EYI A;  5KK1 A;  3AAF A;  3OOU A;  1QO0 D;  4A6E A;  3R6S A;  2BOL A;  3OIQ A;  4HBL A;  1RUN A;  4BH9 A;  3RPQ A;  3LAJ A;  3JTH A;  4HOB A;  5CQG A;  4I2O A;  1T33 A;  2KIF A;  2QQA A;  2NS8 A;  1FMV A;  2EB7 A;  2W1O A;  2MG4 A;  3MAJ A;  4M6X A;  4XOT A;  1J9I A;  3I59 B;  3PQJ A;  4IOC F;  1JJ8 C;  1YS6 A;  4NDL A;  3GF2 A;  3ZGK A;  1OYI A;  2DN0 A;  1Q1V A;  3GTJ J;  3HHG A;  1B1B A;  4BU2 A;  1X1C A;  3DKX A;  3W6K B;  2JUC A;  4HNV A;  1JKR C;  5D5X B;  2JA8 J;  2UWM A;  4IVN A;  3GXO A;  4CCK A;  1VQ4 I;  4UB8 C;  1RPW A;  3TO6 A;  1AHD P;  4RS8 A;  2R7U A;  2H6C A;  2CUE A;  4UVB A;  2ZFU A;  2CYY A;  1XS9 A;  2KQR A;  2QYO A;  2J5O A;  2JVG A;  1PDN C;  2ELJ A;  4DZJ A;  5KAI C;  5TIS C;  3LSR A;  1SFK A;  5B1A H;  3HXL A;  3SZG A;  5CVJ A;  2ISY A;  2VE8 A;  1A6Q A;  4MEX F;  1MBF A;  4B09 A;  2HQ5 A;  2X1C A;  2VOD A;  3T8T A;  5AON A;  3ZR8 X;  1WH5 A;  4LG0 B;  5JVG F;  4CDG A;  4HPQ A;  4DYR A;  4B3A A;  1FX7 A;  5LHG A;  1KU7 A;  1WQ2 A;  3L00 A;  3I53 A;  2FBI A;  1FY7 A;  2HQA A;  4KIF A;  1FP2 A;  3HB9 A;  1LDK B;  5CQE A;  4YFN F;  3JR9 A;  3ZQQ A;  3J80 Z;  2K40 A;  5J8C A;  2CQN A;  2Y30 A;  3W2W A;  4PFP A;  4FE7 A;  5EGO A;  2K9Q A;  2BZT A;  2EJR A;  1KGS A;  2Y48 A;  5EJC A;  1X1B A;  1RIO H;  1BI0 A;  4XRF A;  5J1U A;  2QF7 A;  3G1M A;  1IN5 A;  1U6G A;  2M87 A;  1Y56 A;  1QZZ A;  2JVH A;  1LDD A;  1QPM A;  2ZJ2 A;  4BJ6 C;  2E1O A;  3GTQ J;  3K2Z A;  3AKZ A;  3OYF A;  2A07 F;  1MMS A;  2A5W A;  2EQR A;  3X2Q H;  3QPS A;  3DBH B;  5LLQ A;  1SFX A;  2KRC A;  3GTP J;  4LK1 F;  1GUU A;  3DKY A;  1I6X A;  4D9J A;  2F48 A;  2RC4 A;  4E70 A;  3GZ6 A;  1DQU A;  3ZMV A;  4M9X A;  1Y1W J;  2K9L A;  3KYC B;  3HUG B;  3ULQ B;  2YUS A;  4N9I A;  1ETQ A;  1Z91 A;  1WJF A;  4R8H A;  3BJO A;  3LST A;  5KHD A;  4IHX A;  2O7O A;  1RC9 A;  3CJR B;  3H1C A;  5L3G A;  2HPI A;  2XGX A;  5DV5 A;  1XX5 A;  3T0Y A;  1IRF A;  1LVA A;  2XGD A;  2Y0M A;  1VQP I;  1MDM B;  1OMI A;  5J8F A;  2RN7 A;  3HC7 A;  5FRN A;  4M3G A;  4EGY A;  5EEH A;  2Y75 A;  3FF5 A;  4ESB A;  2ID6 A;  1W36 C;  4M71 A;  2ZME C;  2KP6 A;  5K7Z A;  4KUM A;  5CJ9 A;  4IF4 A;  4FTH A;  4OIQ F;  1BOB A;  1ZR2 A;  1FTT A;  4ZYH A;  3K1M A;  4CCM A;  5GTI C;  1HXD A;  2IXS A;  4JP0 A;  3ECO A;  1X4O A;  3ABL H;  3KYD B;  1ETV A;  2HGC A;  2LVS A;  3BG7 A;  3EYY A;  3VB2 A;  4FX0 A;  4H4K C;  3OYJ A;  4GYI A;  2HXO A;  1W7P D;  1W7P B;  3BC8 A;  2W4S A;  5KNL A;  3OS1 A;  3ESW B;  2EZL A;  3BG5 A;  1SVO A;  2COB A;  3EQL F;  1YRN B;  1U2W A;  3TOB A;  2CGP A;  3OYG A;  3WTS C;  3V8L A;  2VC1 A;  2IRF G;  1KYZ A;  4HW0 A;  1V5F A;  1XC5 A;  2LF8 A;  3SEZ A;  3G1L A;  2DA2 A;  2OU2 A;  3I54 A;  1TWG J;  3DTI A;  4U0W A;  2DQR A;  3QOP A;  1WJE A;  1F1Z A;  3VSL A;  2LF7 A;  1SC7 A;  1ETK A;  2W48 A;  3QWL A;  4I6Z A;  1OR7 A;  1AWC A;  5E8I A;  3BR1 A;  4XLC A;  1MBG A;  1B59 A;  4CXF A;  2V9V A;  2CW8 A;  2MW8 A;  3PL8 A;  1UG0 A;  2D1V A;  3ZMU A;  3TDU C;  1H88 C;  5GAG J;  3AFH A;  2HDD A;  2D45 A;  3SFI A;  4RAG A;  2W85 A;  3CP8 A;  1NK2 P;  3JCU C;  1MBJ A;  4EJO A;  1JUP A;  3GYH X;  3HM5 A;  5DUK A;  1IN6 A;  5FKN A;  1XSV A;  3O8H A;  1HQC A;  4B3X A;  3GTL J;  2F4O B;  2OCC H;  4ENJ A;  2OF7 A;  2A61 A;  2NXN B;  3WTU C;  2J5P A;  1N75 A;  3C2B A;  5E17 F;  4XL9 A;  5D8K B;  5HVQ C;  2VKE A;  3RDI A;  5B5E C;  1YJN I;  4XRM A;  3FHN A;  3L2Q A;  2FEZ A;  3UR3 C;  2P7C B;  2VAS A;  2NNN A;  1XG1 A;  1Z6R A;  2L54 A;  5F08 A;  1SD6 A;  2WAF A;  1DP7 P;  2HDW A;  3IP4 B;  3BDD A;  4L5I A;  2VBX A;  3E97 A;  2LLK A;  2ME6 A;  4HDV A;  1HF0 A;  1UG2 A;  3H3V K;  1JT6 A;  4XBF A;  3DV8 A;  4UUS B;  4XOR A;  3FX3 A;  3OSF A;  3NWS A;  2DAO A;  3FKJ A;  1X58 A;  2R5Y B;  3M07 A;  1JGS A;  3K1N A;  3C2H A;  2KJB A;  5BMZ A;  2K7L A;  2W00 A;  3KPH A;  1V54 H;  4QPQ A;  2MAB A;  1J59 A;  3QQA A;  2F4I A;  4GGG A;  2QA4 I;  3AL0 C;  1KU9 A;  1ODD A;  2M0M A;  4AC0 A;  2XPV A;  3IV5 A;  1S72 I;  3EUK L;  4NHJ A;  1Y39 A;  2ZC2 A;  2A69 F;  1S7O A;  2LH9 A;  3RIR A;  1WJC A;  2VQG A;  3KX2 A;  4L9N A;  4KYW A;  3BG9 A;  2E36 A;  1PUF B;  1FZP B;  5BPI A;  1UJ8 A;  2H1L A;  1RES A;  2DO7 A;  2QVO A;  3KEY A;  3OYC A;  3OYH A;  5FFZ A;  3IAM 2;  2EIK H;  3I9V 2;  3P5J A;  2MC3 A;  1SD7 A;  1T08 B;  3LSP A;  3PUF A;  4EEF G;  4IZZ A;  1RZ4 A;  4KN4 X;  2O9L A;  1TQP A;  1Y8Q B;  1T39 A;  3IWF A;  2KIU A;  3RYR A;  3M8J A;  3COA C;  1TBX A;  2WAQ A;  3RCO A;  2LG4 A;  2ZNZ A;  3K6G A;  1R22 A;  3CCJ I;  1PYV A;  3CTA A;  1LJ9 A;  1MJB A;  3TW7 A;  1R9T J;  1YG2 A;  1TC3 C;  3LMM A;  2GIZ A;  3MN2 A;  1FIP A;  1BI2 A;  2IBD A;  4MO7 A;  3HOW J;  2LKX A;  3M4O J;  1X4P A;  4MTE A;  1RI7 A;  3HDD A;  2NNY A;  2NAZ A;  2XVC A;  2Z99 A;  4BBS J;  5FRM A;  2P5V A;  2HOA A;  1D0Y A;  1O57 A;  1P9Q C;  3SFZ A;  1DP3 A;  3D5R C;  4CZC A;  1MH4 A;  1U9O A;  2EH3 A;  1QU3 A;  4Y17 A;  3P9I A;  1X3U A;  2LBF A;  3JRB A;  2HQR A;  3ZMT A;  3PO2 J;  2E19 A;  3TL4 X;  1V3F A;  1X19 A;  1DGW Y;  2GIV A;  5BPD A;  2D5V A;  2IGO A;  2HKO A;  1K6Y A;  3HGG A;  2B0L A;  3DBL B;  4D1Q A;  1OR7 C; 
#chains in the Genus database with same CATH homology
 3GLX A;  4M72 A;  1XD7 A;  4MGR A;  1FC3 A;  2PFB A;  1RUO A;  1L3L A;  1FBS A;  4YFX F;  2E1N A;  4CO8 A;  4ZZD A;  1LB2 A;  5ICG A;  1ZH5 A;  5IT9 Z;  2R3S A;  2QLZ A;  2JSC A;  4Y13 A;  4G7O F;  1BBY A;  2EFW A;  4OIR F;  2XKP A;  4ETS A;  4FX4 A;  4O3M A;  3F8F A;  4I98 B;  3FMS A;  4G7H F;  4CYD A;  1XCV A;  3T5X A;  2R7F A;  1USS A;  1FSE A;  4FT8 A;  2TDX A;  1OYY A;  3MWM A;  1YFH A;  1YQA A;  5A2Q Z;  1EH8 A;  3WE2 A;  2VXZ A;  2O6G E;  4U7B A;  2JPB A;  4RGU A;  2KRF A;  2YPR A;  3KET A;  4WWC A;  1REP C;  4A0X A;  2E7X A;  3IWZ A;  1R1V A;  4OIO F;  3R4K A;  2EK5 A;  1FSH A;  5H6R A;  2VT2 A;  1P4X A;  1TNS A;  3V8K A;  1BOA A;  5D5U B;  1D3Y A;  3MFK A;  2UXX A;  4P5O A;  2O03 A;  2L02 A;  1O3R A;  3RKW A;  5BS6 A;  5JHU A;  3FXU A;  5HS8 A;  4YG2 F;  1B9N A;  3J80 K;  3M7G A;  3TQN A;  4LMY A;  5HLG A;  3E6C C;  2UXN A;  3N4M A;  1SD5 A;  2AS5 F;  4G6Q A;  1RNL A;  3CLO A;  2DI3 A;  3KLN A;  5LBQ A;  5TJJ A;  2XKO A;  3I59 A;  1I5Z A;  4LGW A;  5CLS A;  2ADU A;  2W84 A;  1DUX C;  4H0E A;  3GEZ A;  2EV6 A;  1S29 A;  4ZYD A;  3KP2 A;  4Y15 A;  1ZLJ A;  4ESJ A;  3NRV A;  3MQ0 A;  4MEY F;  3FZV A;  2MD5 A;  2PI0 A;  4EGZ A;  3WTX C;  3SZP A;  5LEK A;  3GZ5 A;  1LNW A;  4PDK A;  2L01 A;  2RDP A;  1R00 A;  4WK8 F;  2P5L C;  4UHT A;  2XV4 S;  3NEU A;  5D5W B;  1ZG1 A;  2JZY A;  3L09 A;  2VBY A;  1BIA A;  1W5S A;  2EFQ A;  4I02 A;  3ZMS A;  2MH9 A;  4OIP F;  5CVR A;  1IN7 A;  2EFO A;  1XSD A;  1G3Y A;  3GUD A;  1H9G A;  3P9C A;  4LB6 B;  5L3D A;  4BYY A;  1YW7 A;  4WXD A;  3WTZ A;  2ELH A;  2NYX A;  3REO A;  3GW2 A;  4BXU A;  2BGC A;  3WTT C;  1O3T A;  5K5Q A;  3KP7 A;  4KIB A;  4TV7 A;  4IHS A;  3BJA A;  4A2U A;  3U1D A;  2X0L A;  3C7J A;  4BHB A;  2F5E A;  2W25 A;  4U88 A;  5HDK A;  3M1E A;  2LKP A;  1B4A A;  3M8F A;  2QZ8 A;  1ZG5 A;  2V1U A;  5CVU A;  3ZPL A;  1ZRE A;  2DT5 A;  4XLP F;  5BOX A;  3KP4 A;  4WXH A;  2OD5 A;  3ROU A;  4N9H A;  3GX4 X;  3R0J A;  1PP7 U;  4ZYE A;  3F8M A;  4CGZ A;  3SHF A;  2ESN A;  4EM1 A;  1IXR C;  3WTV C;  6PAX A;  2JTV A;  2XAQ A;  4EMS A;  2G7H A;  1UB9 A;  5E1X A;  3E3V A;  2VN2 A;  1O7F A;  1XGS A;  4EQQ A;  1Q1H A;  3MZY A;  5ICE A;  2VOO A;  3GWZ A;  4U0V A;  3MEX A;  4U0Y A;  3MCZ A;  3FMR A;  4RGS A;  2V79 A;  4K2E A;  4F7Z A;  3QP5 A;  4HF1 A;  3V4G A;  1HW2 A;  4BQA A;  2M45 A;  4KN7 X;  1R7J A;  3F6V A;  1SAX A;  1R1U A;  1JHH A;  3B73 A;  3HRM A;  4QWQ A;  2YX4 A;  4IHT A;  5AIP A;  3VEP A;  1FNN A;  1R1T A;  3VFZ A;  3DQV C;  2DQL A;  1Z05 A;  1XGM A;  2ACJ A;  1C0W A;  2HKX A;  1IUY A;  5LHH A;  2XRO A;  1KU3 A;  2DTR A;  1HBX G;  2GXB A;  1SMY F;  1F4K A;  1BM9 A;  3PFI A;  4L5J A;  2IA2 A;  4OIN F;  5LEJ A;  4NB5 A;  1Z9C A;  3JTG A;  5H20 A;  2Z33 A;  3ZQ7 A;  1T0F A;  3TKY A;  5HDG A;  3ZP5 A;  2Z3Y A;  2A6H F;  1J7K A;  3ERE D;  3O2P E;  1UHM A;  3GFJ A;  1Z7U A;  2WV0 A;  5D6F A;  2OQG A;  2L3D A;  2EFN A;  2ZME B;  3HOT A;  5CYV A;  2RKH A;  1V4R A;  2KJC A;  5IT9 K;  1L0O C;  2XIG A;  2QQ9 A;  2MA3 A;  4G8X A;  4BHC A;  4M73 A;  2O3F A;  1NHA A;  2M8E A;  3V7R A;  1J0R A;  1ZGA A;  2Q8K A;  3F8N A;  1ON2 A;  2GWR A;  3E5X A;  1K78 A;  3LQQ A;  2E1C A;  1FYK A;  2YSR A;  1T38 A;  2PMH A;  4UV9 A;  1ZYR F;  1G3W A;  4Z2Y A;  2WC2 A;  3JW4 A;  2QM3 A;  1R5H A;  2PEX A;  1ZAO A;  1IRG A;  4KIG A;  5A2Q K;  1DDN A;  2M5W A;  4G9Y A;  5J6X A;  1MD0 A;  3K9T A;  1IN4 A;  2CW0 F;  4ZZL A;  2IA1 A;  5E18 F;  2GA2 A;  3CUQ B;  3G3Z A;  1EV7 A;  3I64 A;  1YW9 A;  5FFX A;  2QEN A;  3EET A;  1U3E M;  5LRS A;  2FU4 A;  4R1H A;  2DW4 A;  4A12 A;  3WTY C;  5DCM A;  4JBA A;  1U5T B;  4HDU A;  4PCQ A;  1W5T A;  3FM5 A;  3KP3 A;  4A0Z A;  1K79 A;  3L7W A;  3OV8 A;  4DQ2 A;  1TQI A;  1T98 A;  1YTY A;  4RGX A;  1AOY A;  4L0Y B;  3RKX A;  2EA2 A;  2A3S A;  4D0P A;  2NRA C;  3H92 A;  2GZW A;  2VON A;  4WCG A;  3IRQ A;  3TO9 A;  3FWE A;  5D6E A;  4WX9 A;  3Q5F A;  2XRN A;  3BPV A;  4HF0 A;  3F6O A;  5ERI A;  1SFE A;  3VOE A;  3WOD F;  2HWV A;  2HYG D;  3I71 A;  4LD5 A;  1A04 A;  4LB5 A;  1O3Q A;  5AIQ A;  1SD4 A;  4A5M A;  1CF7 A;  1FOK A;  5CVV A;  4I09 A;  2CG4 A;  4P55 A;  4P9F A;  5ICC A;  3LQR A;  1BI1 A;  4BHP A;  1YIO A;  1G3S A;  4ASN A;  5JR3 A;  3IHU A;  4HLX A;  3RTR A;  4ZYG A;  3O6B B;  4DNC A;  5L3E A;  1I1G A;  1R5G A;  4ESF A;  5LGU A;  4IRI A;  3G73 A;  3LA2 A;  1F5T A;  2XAF A;  4M74 A;  4KA4 A;  5CVI A;  2FMY A;  4MQ9 F;  3LFK A;  2DU9 A;  2QUF A;  3SXY A;  2H09 A;  2DPD A;  3F8B A;  3ABT A;  3F3X A;  1S8N A;  2Q0O A;  1UFM A;  2ZFW A;  2F2E A;  1WSU A;  2F5D A;  3FXR A;  2D2W A;  2IT0 A;  3WU1 B;  4UVA A;  1J2X A;  1BN5 A;  2NS0 A;  2Z9O A;  2XAS A;  5LRR A;  3RI4 A;  2GXG A;  2RVC A;  2CWE A;  3WGI A;  5K5R A;  4WF2 A;  2YU3 A;  5FGM A;  1EH7 A;  1BI3 A;  4CHU A;  4ZH4 F;  4AWX B;  1R36 A;  1QNT A;  2ZO4 A;  3DF8 A;  2DK5 A;  1IXC A;  2FXA A;  4HV5 A;  5IT3 A;  5HS9 A;  5DEQ A;  3KEO A;  3V8J A;  1OKR A;  1ON1 A;  1DPR A;  2DK8 A;  2VC0 A;  5FD6 A;  4EJW A;  3KZY A;  1YYV A;  1ZN2 A;  4HX4 A;  3ZMD A;  2BE5 F;  3CO6 C;  2A6E F;  2LSO A;  3WE3 A;  4LFU A;  4OOI A;  2ZCW A;  5ILS A;  4RAY A;  2GQQ A;  2V6C A;  1XMK A;  2FQ3 A;  2D1H A;  2H6B A;  1J75 A;  2YX7 A;  3HSF A;  3FXQ A;  4HF2 A;  2FSW A;  3T8R A;  1HKQ A;  3BY6 A;  3K69 A;  1LEA A;  4HQM A;  4AIK A;  4UVC A;  1Y0U A;  4HQE A;  4KT5 C;  3MZH A;  3KLO A;  1T6S A;  2HZT A;  4BAY A;  3DPT A;  2FML A;  3HYI A;  4XLN F;  1KA8 A;  1G3T A;  3CDH A;  2O8X A;  1IXS B;  5D5V B;  1ZLK A;  2FOK A;  2QWW A;  2JT1 A;  1B9M A;  3QAH A;  3TO7 A;  2CFX A;  3C3W A;  2PG4 A;  5E1Z B;  3ZN0 A;  4G6D A;  2K02 A;  5LGT A;  3I58 A;  2AXL A;  5ICF A;  3QPH A;  5F6F A;  1GXQ A;  2RNJ A;  4Q48 A;  4JK1 X;  2IA0 A;  1E17 A;  2OZ6 A;  1UHW A;  3TOA A;  4JQF A;  3TGN A;  4PZJ A;  3IRR A;  2G9W A;  3DFG A;  3VOD A;  4CZZ A;  1ZAR A;  4GO1 A;  2HTJ A;  1OPC A;  5E8G A;  5HS7 A;  2IJL A;  4I7H A;  3EUH A;  4LG0 A;  2VE9 A;  3JSP A;  1P92 A;  2BEO A;  3H3Z A;  1JXS A;  5KVR A;  3CUO A;  2HFH A;  3R61 A;  2EV0 A;  1QZY A;  3FMQ A;  1S3J A;  3BOQ A;  4UV8 A;  2EFP A;  1D8J A;  1J5Y A;  4EJV A;  2ETH A;  4EJU A;  1UCR A;  4IPA A;  2A5Y B;  3C1D A;  1CGP A;  3ABU A;  5F64 A;  5D8L B;  1P6R A;  1MJ9 A;  2Z5U A;  4RB1 A;  1ZGJ A;  2P8T A;  2IP2 A;  1D8K A;  4LLN A;  3HUG A;  2H94 A;  1JE8 A;  2OBP A;  3HRT A;  3HRS A;  1QQI A;  3LAP A;  1MDM A;  2PQ8 A;  2K4B A;  2K27 A;  2G7U A;  2K86 A;  5JVT A;  2QBY B;  2K4J A;  3HSE A;  3HHH A;  1S6L A;  2C6Y A;  2HS5 A;  3QU6 A;  1TLH B;  4EV0 A;  2W24 A;  1G6N A;  2RV8 A;  3S2W A;  1BC8 C;  1B6A A;  1E2X A;  1SMT A;  2HOE A;  1W7P A;  4U7D A;  5TRD A;  2F5F A;  2EA4 A;  2RGV A;  1XGO A;  2FNP A;  2XUB A;  3KCC A;  2V1D A;  4G94 A;  3U2R A;  1HW5 A;  1WI9 A;  4RB0 A;  2XAH A;  3KP6 A;  4B8X A;  5D4S A;  3E5Q A;  4ENM A;  1ZHF A;  4EM2 A;  3RJP A;  4EVI A;  4OU0 A;  2FF4 A;  3P7N A;  1PUE E;  3N97 A;  4YFK F;  3EDP A;  3DP7 A;  1P2F A;  3FHZ A;  1FP1 D;  2KKO A;  2DLL A;  2OA4 A;  4RB2 C;  4HLY A;  3CUQ A;  4HYE A;  2DFI A;  2PN6 A;  2RQP A;  2F5C A;  2FBH A;  3SZT A;  4BNC A;  1U5T A;  2XHK A;  4KMF A;  3I5U A;  3QRF F;  2WWY A;  3BRO A;  4IXA A;  3I4P A;  3J81 Z;  1W4M A;  1F9N A;  5LHI A;  3WTW C;  3DKW A;  1I27 A;  4LLL A;  3DPL C;  5L3C A;  5DYM A;  1YO5 C;  2HEO A;  1XGN A;  4RB3 C;  2JRT A;  5L3F A;  2MLK A;  2EV5 A;  4KMU X;  2ISZ A;  3V7S A;  4UUV A;  2IVM A;  3ZMZ A;  5ILU A;  4LK0 F;  5FLX Z;  3RPU A;  3PQK A;  4I01 A;  5DD8 A;  4ENN A;  1MJA A;  1HW1 A;  4LLG F;  1FYM A;  3JAM Z;  2Q2E A;  3D5L A;  3CO7 C;  4CIC A;  1BC7 C;  1FBU A;  4HX7 A;  4YIF A;  4OMY A;  2BYV E;  3E5U A;  5H6Q A;  4I0A A;  3KP5 A;  4M6Y A;  4IRG A;  4GYG A;  1ULY A;  1ZRF A;  2VBZ A;  3HTU A;  2FNA A;  2P7V B;  1R23 A;  3E6M A;  1QBJ A;  1O7L A;  4ENK A;  5E20 A;  3L9F A;  4XSX F;  5EEG A;  4AD9 A;  3HOS A;  2UZK A;  1ZRC A;  2ZXJ A;  1KQ9 A;  5JI6 A;  3V7C A;  4AVP A;  4A6D A;  4HV6 A;  4Q5S F;  3RYP A;  1GVJ A;  3F23 A;  1UST A;  4KNY A;  1MGT A;  2E7W A;  5HDN A;  3GFM A;  2MLG A;  5DD4 A;  4QLC U;  4P9U A;  1IZ1 A;  4L9J A;  1MZB A;  3Q9V A;  2VT3 A;  2ZNY A;  1U78 A;  3TDZ C;  2P6S A;  2STW A;  1TQM A;  2XAJ A;  4KIC A;  5HOO A;  3CUQ C;  2JPC A;  1K7A A;  4M9S A;  4I0B A;  5K1Y A;  3IKV A;  4KFC A;  2COM A;  4EM0 B;  4XSZ F;  4G7Z F;  1T2K A;  1U5T C;  4S05 A;  2YR2 A;  5BQT A;  1P4A A;  3WGG A;  3L2C A;  4HAM A;  3I0T A;  3NQO A;  4S04 A;  1XDU A;  4A0Y A;  2W57 A;  3GO5 A;  5ILV A;  3IC7 A;  2PLY A;  3ECH A;  3JSO A;  2CO5 A;  1MKM A;  3HTS B;  3T1B A;  2HYF A;  4L0Z B;  1S7A A;  1G4D A;  2ZBK A;  3B02 A;  1FWZ A;  2HQN A;  4M9Z A;  2STT A;  1XN7 A;  4MNU A;  2HTS A;  3E6B A;  2EWN A;  3ML6 A;  3C18 A;  3F8C A;  2MBF A;  3GFL A;  2DPU A;  3DXJ F;  5HLH A;  4O6J A;  1HKS A;  3OOP A;  2R7D A;  1JHF A;  1TW2 A;  2VBW A;  3IKT A;  1SFU A;  2LNB A;  1K78 B;  2MH2 A;  3WG9 A;  3F21 A;  2V1X A;  1GXP A;  3IL2 A;  3KFW X;  2GA1 A;  4IRH A;  1VTN C;  2VOP A;  2PMU A;  5ED4 A;  3ISP A;  1I1S A;  1H9T A;  1KQ0 A;  2M1B A;  5D4R A;  3H3U A;  1QGP A;  1WKM A;  2XAG A;  3QU3 A;  3RKY A;  3BWG A;  1IAW A;  2H27 A;  2FE3 A;  2DBB A;  3K0L A;  2P4W A;  5DCM B;  4L18 B;  4PGG A;  5FD5 A;  4AIJ A;  4P96 A;  1FPQ A;  3FM3 A;  4A5N A;  3J7A O;  3LA3 A;  1FT9 A;  2BBY A;  4RGR A;  4PGH A;  1HKT A;  2OZU A;  3ELK A;  3LWF A;  1IW7 F;  1TTY A;  2M30 A;  2P5K A;  1XB4 A;  5HLI A;  3WGH A;  1WRJ A;  3M8E A;  4HA8 A;  3D0S A;  3KZZ A;  1XSX A;  2X4H A;  5F1R A;  3F72 A;  3KE2 A;  3U9G A;  3R0A A;  4WXC A;  4KDP A;  3LA7 A;  1TW3 A;  4HZF A;  3F22 A;  2HR3 A;  1CF7 B;  5LGN A;  1XCB A;  1Z1D A;  4O5V A;  5DUI A;  1YLF A;  1FLI A;  3R60 A;  2QBY A;  2L4M A;  4RAZ A;  3HSR A;  2GAU A;  1BJA A;  1ONV A;  4HX8 A;  1XDS A;  2OAZ A;  3Q9S A;  2OQR A;  5FO5 A;  2QQB A;  1XMA A;  3J81 K;  3CJN A;  3HIF A;  1KYW A;  2FBK A;  2A68 F;  4GXO A;  4N0B A;  1Z6T A;  3BJ6 A;  1R58 A;  1TNT A;  3QPT A;  1HSJ A;  4AIH A;  3P9K A;  3QP6 A;  2LDU A;  2PJP A;  1PP8 F;  4UNO A;  5FLX K;  5DDG A;  3HRU A;  4NQW A;  5JFR A;  4MTD A;  1DPU A;  4MHG A;  3JAM K;  3E6D A;  4R79 A;  2WTE A;  3GFI A;  1ZRD A;  2PBI A;  4ON0 A;  3W6J B;  5DCF A;  4UXN A;  1STZ A;  2CQK A;  4Q47 A;  1YW8 A;  1U8R A;  1FYL A;  5K5O A;  2O61 A;  1GHC A;  1FBQ A;  1LDJ A;  3WU0 A;  2L4A A;  4EJT A;  3KEQ A;  3BPX A;  4LJZ F;  1OYW A;  3GVA A;  1H0M A;  2BV6 A;  3DEU A;  3K1P A;  2IPQ X;  1K6O A;  3BP8 A;  1BIB A;  1ZG3 A;  4FHT A;  4GCV A;  1HST A;  4IJA A;  5L3B A;  4OMZ A;  4L9V A;  4MQV A;  2CSO A;  4L9T A;  2KIM A;  2HDC A;  2O0Y A;  2FA5 A;  3O3K A;  1EH6 A;  2FRH A;  1P4W A;  1IN8 A;  1YS7 A;  1LEB A;  2ZKZ A;  3M9A A;  1O3S A;  2ESH A;  1WWX A;  4YII A;  1D5V A;  2P6T A;  2ZME A;  1LQ1 A;  1IF1 A;  3SQN A;  1KU2 A;  3ZN1 A;  1KQ8 A;  5FB2 A;  2IW5 A;  3BZ6 A;  5E1W A;  4Q4Z F;  3EYI A;  5KK1 A;  3AAF A;  1QO0 D;  4A6E A;  3R6S A;  4HBL A;  1RUN A;  4BH9 A;  3RPQ A;  3LAJ A;  3JTH A;  4HOB A;  4I2O A;  2QQA A;  2KIF A;  2EB7 A;  3MAJ A;  4M6X A;  1J9I A;  3I59 B;  3PQJ A;  1YS6 A;  3GF2 A;  1OYI A;  3HHG A;  1B1B A;  3W6K B;  5D5X B;  2UWM A;  4IVN A;  3GXO A;  3TO6 A;  4RS8 A;  2H6C A;  4UVB A;  2CYY A;  2QYO A;  2J5O A;  1PDN C;  5CVJ A;  2ISY A;  2VE8 A;  4MEX F;  4B09 A;  2VOD A;  3T8T A;  5AON A;  4LG0 B;  4CDG A;  1FX7 A;  5LHG A;  1KU7 A;  1WQ2 A;  3L00 A;  3I53 A;  2FBI A;  1FY7 A;  4KIF A;  1FP2 A;  1LDK B;  4YFN F;  3J80 Z;  5J8C A;  2EJR A;  1KGS A;  2Y48 A;  1RIO H;  1BI0 A;  4XRF A;  1IN5 A;  1U6G A;  2M87 A;  1QZZ A;  1LDD A;  1QPM A;  2ZJ2 A;  3K2Z A;  2A07 F;  5LLQ A;  1SFX A;  4LK1 F;  1I6X A;  4E70 A;  2RC4 A;  3GZ6 A;  3ZMV A;  4M9X A;  3ULQ B;  4N9I A;  1Z91 A;  4R8H A;  3BJO A;  3LST A;  5L3G A;  2XGX A;  5DV5 A;  3T0Y A;  1IRF A;  1LVA A;  2Y0M A;  1MDM B;  1OMI A;  5J8F A;  2RN7 A;  4EGY A;  5EEH A;  2Y75 A;  3FF5 A;  4ESB A;  4M71 A;  4KUM A;  5CJ9 A;  4IF4 A;  4OIQ F;  4ZYH A;  3K1M A;  1HXD A;  3ECO A;  2HGC A;  3EYY A;  3VB2 A;  4FX0 A;  4GYI A;  1W7P D;  1W7P B;  3EQL F;  1U2W A;  3TOB A;  2CGP A;  3WTS C;  3V8L A;  2VC1 A;  2IRF G;  1KYZ A;  4HW0 A;  2LF8 A;  2OU2 A;  3I54 A;  4U0W A;  2DQR A;  3QOP A;  1F1Z A;  2LF7 A;  1OR7 A;  1AWC A;  5E8I A;  1B59 A;  4CXF A;  2V9V A;  2D1V A;  3ZMU A;  3TDU C;  2D45 A;  2W85 A;  4EJO A;  3GYH X;  5DUK A;  1IN6 A;  1XSV A;  1HQC A;  4ENJ A;  2A61 A;  3WTU C;  2J5P A;  5E17 F;  5D8K B;  5HVQ C;  3RDI A;  2FEZ A;  2P7C B;  2NNN A;  1Z6R A;  2L54 A;  1SD6 A;  1DP7 P;  4L5I A;  3BDD A;  2VBX A;  3E97 A;  4HDV A;  4XBF A;  3DV8 A;  3FX3 A;  2DAO A;  1JGS A;  3K1N A;  2KJB A;  5BMZ A;  2K7L A;  1J59 A;  4GGG A;  1KU9 A;  1ODD A;  4NHJ A;  2A69 F;  1S7O A;  3RIR A;  4KYW A;  4L9N A;  1FZP B;  5BPI A;  2DO7 A;  2QVO A;  5FFZ A;  2MC3 A;  1SD7 A;  1RZ4 A;  4KN4 X;  1TQP A;  1T39 A;  3IWF A;  2KIU A;  3RYR A;  3COA C;  1TBX A;  2ZNZ A;  1R22 A;  1LJ9 A;  1MJB A;  3CTA A;  1YG2 A;  1BI2 A;  4MTE A;  1RI7 A;  2NNY A;  2NAZ A;  2XVC A;  2Z99 A;  2P5V A;  1O57 A;  3SFZ A;  4Y17 A;  3P9I A;  1X3U A;  2HQR A;  3ZMT A;  1V3F A;  2GIV A;  5BPD A;  2HKO A;  2B0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...