1FYMA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a tail-to-tail orientation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
86
Chain Sequence
b'ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL-TO-TAIL HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 25
structure length 86
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fymA00
4UVAA 2XKOA 2QM3A 1OYYA 3ISPA 2QUFA 2PMUA 4L5JA 2VXZA 3GFLA 1Z9CA 3IHUA 4IRHA 2IJLA 1ZRCA 3KP3A 4KUMA 1OMIA 4HX4A 1TW2A 4BH9A 3BPXA 4G6QA 3MWMA 1IZ1A 4ENKA 4RS8A 4PGHA 4ZYHA 2CWEA 2XROA 3DV8A 1B9NA 1VTNC 2W57A 2VE9A 3FWEA 2YSRA 4WWCA 3ML6A 3N97A 1QNTA 3JW4A 4K2EA 3CDHA 4UV8A 4HA8A 4HF2A 1I5ZA 1TNSA 3N4MA 1BI2A 2ZO4A 2HZTA 2EV5A 5AONA 3FM5A 2LSOA 5DDGA 1XCBA 5HDKA 3G3ZA 1FNNA 4KN7X 4G6DA 2NRAC 3KP2A 1BOAA 1JHFA 4L0ZB 3B02A 1TBXA 3EDPA 3DKWA 2STTA 2EFQA 3RYPA 4I98B 5LGTA 3BJAA 1P4XA 1Z05A 3GW2A 4B09A 1ZAOA 1ON2A 4GCVA 4IRGA 3R0AA 3G73A 3WGGA 2HYFA 2MD5A 3SZTA 2EK5A 2R7FA 1RUNA 3R4KA 2G9WA 1O3QA 2K86A 1FP1D 4ZYEA 2QWWA 2MLGA 3WTXC 4N9IA 5LGNA 4ENMA 1SFEA 3RI4A 4WK8F 2P5KA 2PFBA 1UCRA 1MJ9A 2M45A 3BPVA 2XGXA 4KYWA 2K7LA 5FO5A 5K5OA 2M8EA 2JPBA 2WV0A 2DBBA 4EQQA 3RKYA 2UXNA 1E17A 5LGUA 2WWYA 4A0XA 2CG4A 5ILSA 1PP8F 1H9TA 2DTRA 4YFXF 2V1UA 1XMKA 4O5VA 1JXSA 2P6TA 3ABTA 2V9VA 4HQMA 1GHCA 1BC8C 2UWMA 4GYGA 1G3SA 3ULQB 2PN6A 1T98A 2KIMA 2RGVA 2PG4A 2OZ6A 2XAFA 5FB2A 3PFIA 4UHTA 1QGPA 1SAXA 3DXJF 1R00A 2R3SA 2GZWA 1HQCA 2XKPA 1R5HA 1YYVA 3MFKA 1W7PB 2HQNA 4LB6B 3I5UA 4HDVA 3SHFA 1HW5A 4M71A 2O3FA 4KIBA 4U0WA 2LNBA 2ISYA 2YX7A 1RNLA 1ULYA 2D45A 1T2KA 4HAMA 3T0YA 3VODA 4DNCA 2MH2A 3TOAA 2NAZA 5FD5A 3KLOA 3HRTA 5D5XB 3GEZA 4B8XA 5FGMA 3L00A 3ELKA 2GA2A 2KJCA 4UNOA 4RB1A 1LDJA 2V1DA 5CVJA 3TGNA 4TV7A 3IC7A 2ACJA 1IXSB 2DFIA 3M1EA 3HOTA 1SD4A 2EFOA 1MJBA 2OQGA 1W5TA 1B4AA 1S7AA 3COAC 3HRUA 3J7AO 2FMYA 2JSCA 4FT8A 4AIJA 5E1ZB 1REPC 1D5VA 5ICCA 5KVRA 4UVBA 4OIQF 2X4HA 3MZHA 2MA3A 4YG2F 5HLIA 3AAFA 1DUXC 3DQVC 1FSEA 1ZYRF 3KEOA 3JAMK 2ZJ2A 3LA2A 1KA8A 4PDKA 4MTDA 5JFRA 3ZPLA 2WTEA 1ZRFA 4M73A 5J8CA 5HLGA 1R1UA 4ENNA 1BC7C 3O2PE 2VC1A 2UZKA 4U7DA 1F1ZA 4U0VA 1W4MA 1YW7A 3CUQC 2GXGA 1FOKA 4ZYGA 2DW4A 3E6BA 5FLXZ 4AIKA 1FBQA 1FC3A 2DT5A 3Q9VA 5D6EA 3KZZA 3ZMVA 4Z2YA 1TQMA 4R79A 3GX4X 4I09A 5H6QA 3E6MA 1TTYA 2RVCA 4IPAA 4KICA 2XAGA 4KMUX 1O7FA 3MAJA 2A6EF 2Q2EA 4A2UA 2OA4A 4XLPF 4LLGF 3KP6A 1MDMB 1ZLKA 1B9MA 1CGPA 3HYIA 4CHUA 2ADUA 1XDSA 3CO6C 2XRNA 2DLLA 2DI3A 2GAUA 1KQ8A 4G94A 3K0LA 4JBAA 3L09A 3F22A 5AIQA 4L9NA 4PZJA 5D5UB 3F6VA 3WTTC 4LG0A 3V8JA 5D4RA 2BE5F 2FRHA 2EV6A 3C1DA 2WC2A 2ZMEB 2O0YA 1O3TA 3P9CA 2FOKA 4P96A 1QPMA 2V1XA 4I7HA 3IKTA 1GXPA 1FZPB 4BQAA 5E17F 4HOBA 2PQ8A 1XD7A 3K1NA 3LA7A 3J80Z 1ZGJA 3WG9A 3GLXA 3IRQA 4M6XA 5LHGA 3RJPA 3DP7A 3V4GA 1V4RA 2GIVA 2O03A 4IF4A 3I59A 2QYOA 4AIHA 2HEOA 3GVAA 3T8TA 4HLYA 4BHBA 1IF1A 1SD7A 1TQPA 2HFHA 4LK1F 1EH7A 5ICFA 2EFWA 4CICA 4RB3C 2E1NA 2Y48A 2JPCA 2PBIA 3EUHA 4BHPA 5CLSA 5K5QA 2QVOA 1D8JA 2HGCA 4ENJA 2LF8A 2OQRA 3FZVA 3BY6A 3C3WA 5K1YA 4IHSA 3T1BA 3TKYA 2NYXA 3F23A 1W5SA 4M9ZA 2ZXJA 1T39A 4EM2A 4A5MA 4YFKF 3LQQA 4P9UA 2W25A 3HTSB 1LDKB 2GWRA 2XVCA 3HSRA 1Z6TA 4AVPA 3FHZA 3TDZC 2P5VA 1TLHB 1WQ2A 4IVNA 1R22A 3TOBA 4L9VA 3MEXA 1WRJA 3GO5A 3WU0A 4U7BA 4U88A 3F8NA 5LEKA 3F6OA 3WTVC 1BJAA 5EEHA 3F8MA 3WE3A 1S29A 3I64A 2P8TA 2ZNZA 1U2WA 3FXQA 2VBZA 1A04A 2CW0F 2G7HA 1G3TA 1KQ9A 3NQOA 3EYIA 3I58A 2DK8A 1I1GA 3VB2A 2Q0OA 1YFHA 2PJPA 5CJ9A 3WGHA 3L7WA 3TO9A 3HIFA 3Q9SA 1F4KA 2HS5A 1RZ4A 1DPUA 2XAQA 1R7JA 1LDDA 5CVRA 1SD5A 2DQLA 4Y15A 1P4AA 1R5GA 5FD6A 1R1TA 1U8RA 5DCMB 2XIGA 3CO7C 4LK0F 3KEQA 2M30A 3FMRA 3KETA 3C7JA 3WTZA 2L02A 2Z3YA 5LLQA 2MC3A 5DUIA 3LAPA 4BAYA 5E1XA 1HSJA 1MJAA 3REOA 1KGSA 3SQNA 2AXLA 5J6XA 1DDNA 2M87A 1KYWA 4XSXF 3EYYA 3QRFF 4AWXB 2HDCA 1G6NA 3R0JA 2NNYA 4UV9A 4EJWA 3SZPA 2MH9A 1U5TA 2K4BA 3QU6A 4N9HA 4WXDA 3W6KB 3O3KA 3JSOA 2JZYA 5A2QZ 3BJ6A 1XSVA 2A3SA 4A0ZA 4CXFA 4G8XA 4EJOA 2P5LC 1UB9A 4NQWA 3WTSC 2KIFA 1XSXA 5FLXK 5JVTA 1J5YA 3EETA 4NB5A 3DF8A 3IKVA 4S04A 5LRSA 1IN6A 3QAHA 3HUGA 5H20A 1BI1A 5D5VB 1QQIA 3E6CC 2CO5A 1Q1HA 3KP4A 5D4SA 2PI0A 3V8KA 4CGZA 1CF7A 2DO7A 2A07F 4M72A 3LAJA 1UHWA 2K02A 1ZREA 3K2ZA 1S6LA 2L01A 1MZBA 4A0YA 1T38A 2M1BA 1JHHA 3MQ0A 1BI0A 3LFKA 3WTWC 2K4JA 2D2WA 2HKOA 1WSUA 2EA2A 1O7LA 4LMYA 4CO8A 4HF0A 1USTA 3GFIA 2LKPA 2A61A 1ZARA 1K78B 2VT2A 4Q5SF 1L3LA 2A5YB 1SFXA 2Z99A 4RAZA 2P4WA 5D8KB 3GZ5A 3GUDA 3CUQA 1NHAA 1HSTA 3HRMA 1D3YA 2BYVE 1T6SA 4KN4X 1BN5A 3IRRA 4HYEA 2B0LA 4PCQA 1FX7A 5FFXA 3I54A 2RKHA 3BOQA 3QPHA 3E5XA 2VONA 3LA3A 1S3JA 3DPTA 2IVMA 5D8LB 1U5TC 5HDGA 3J80K 2STWA 1LEBA 4L5IA 2O6GE 2QQBA 1UFMA 2KIUA 1ON1A 5BPIA 3WODF 4D0PA 2J5OA 4ESFA 2FEZA 1C0WA 1LQ1A 3ZN0A 4OIRF 1U78A 2KJBA 3NEUA 2PMHA 3H92A 4ON0A 4IJAA 4JK1X 5F1RA 2V79A 4MEYF 2FA5A 3JSPA 2NNNA 1ZN2A 4P5OA 1BI3A 4OIOF 2H94A 4RB2C 1YQAA 4I0BA 3E5UA 5K5RA 3D5LA 3PQKA 4HBLA 3OV8A 1IRGA 2XHKA 2AS5F 4HX8A 4I02A 3BJOA 1FWZA 2HYGD 3I53A 1R1VA 1KU3A 2HQRA 1O57A 1QZYA 1YTYA 1D8KA 1BM9A 2GQQA 5KK1A 2OAZA 5E18F 4CZZA 2JTVA 2QQ9A 1SFUA 4QWQA 3ZN1A 1XGNA 5HS8A 2QBYA 4A6EA 3P9IA 4F7ZA 1H0MA 4MGRA 2ZCWA 2OD5A 3BDDA 4KMFA 5DUKA 4OOIA 1RI7A 3GWZA 4LGWA 3V7SA 5TRDA 2IT0A 5L3CA 4GXOA 2EFPA 3VFZA 1XCVA 2TDXA 3CJNA 3QU3A 4H0EA 2O8XA 2V6CA 2RN7A 4RGXA 1KU7A 1HW2A 3KLNA 1QO0D 3E5QA 2FU4A 3TO7A 4EJVA 1O3RA 3BZ6A 2BGCA 1XMAA 1HKTA 3HTUA 4RB0A 2ZBKA 4AD9A 1WKMA 4GO1A 4FX4A 5E20A 1B6AA 2Z9OA 2R7DA 1J0RA 1ZLJA 3PQJA 4EGYA 2G7UA 2VBWA 2QLZA 4P55A 3ZMTA 2DU9A 5L3EA 1OR7A 2H27A 4RGRA 3M9AA 4M74A 5BQTA 3F21A 3F8CA 4RGSA 4G7ZF 1XB4A 2L54A 4KFCA 4N0BA 1K6OA 1R58A 3QPTA 3FX3A 2VBXA 3R60A 4L9JA 2RNJA 1AWCA 1RUOA 1YS6A 2QZ8A 3FM3A 1OKRA 1BBYA 3V7CA 1EV7A 5DV5A 4OMYA 5A2QK 2E7XA 4XLNF 3FF5A 1GVJA 2VN2A 1IN5A 4Q48A 2DK5A 3JTGA 3M8EA 1OYIA 2CGPA 2EB7A 2O61A 3EQLF 3RTRA 4LLNA 2KRFA 4EM1A 3SFZA 4XSZF 1YW9A 4KDPA 1FY7A 2KKOA 1GXQA 2FNPA 2RV8A 3H3UA 3IWFA 4HLXA 3TQNA 3WTUC 4P9FA 1QBJA 3T8RA 5ERIA 1S8NA 3R61A 5CYVA 1F5TA 1PP7U 2HWVA 5AIPA 4HV5A 3ZQ7A 5JR3A 4MQ9F 1KU9A 1K79A 4MQVA 3V8LA 1MGTA 3R6SA 4ZZLA 4LD5A 2VOOA 2NS0A 1HBXG 1ZHFA 1IN8A 5DCFA 4ESJA 2J5PA 4WCGA 3J81Z 1TNTA 1E2XA 4UVCA 3JTHA 3TO6A 2IPQX 2XAJA 3L9FA 2RQPA 3ZMZA 1ZG1A 1DP7P 1XGSA 1JGSA 1EH6A 4FHTA 1SMYF 3CTAA 1LVAA 1G3WA 5LBQA 2E1CA 3E3VA 5LHIA 2Z33A 4HQEA 5ICEA 3HHHA 3FMQA 1ZGAA 4R8HA 2LF7A 4M6YA 3MCZA 2IA1A 2L4MA 3GFMA 4G9YA 2COMA 4U0YA 3DEUA 2CQKA 3ZP5A 5ED4A 3RPUA 2ELHA 4MEXF 3RKXA 1V3FA 2VE8A 4WF2A 3K69A 2QENA 2IA2A 1IN4A 1XDUA 1Z7UA 1FPQA 1HXDA 4Y17A 4KIFA 2FNAA 2A6HF 4DQ2A 4S05A 2YR2A 4A12A 3B73A 5ILVA 1YW8A 4UUVA 4BNCA 5DD8A 4EJTA 2BEOA 2H6BA 2VBYA 4LG0B 5IT9Z 3GF2A 1W7PA 2FXAA 2L3DA 4OINF 5LEJA 4EVIA 4ZYDA 1AOYA 4LLLA 5J8FA 4WX9A 2W85A 1P92A 3WGIA 1BIAA 1YO5C 5HDNA 4PGGA 1HKQA 3P9KA 1FBSA 3FXUA 2A68F 4YIIA 5IT3A 2DPUA 3NRVA 1JE8A 4RAYA 1F9NA 2H6CA 4GGGA 2EA4A 3KCCA 2E7WA 3K1MA 2ESNA 3I59B 3RDIA 3DPLC 2HKXA 1Y0UA 2ZKZA 1Z6RA 4EM0B 3VEPA 4BXUA 4LB5A 2VOPA 2K27A 2YPRA 3OOPA 3I4PA 2YU3A 4LFUA 1STZA 4BYYA 2OU2A 4FX0A 1B1BA 3BROA 2F5FA 2RC4A 4EGZA 2Q8KA 5LRRA 3O6BB 5HS9A 1IXRC 1PDNC 1FP2A 3M8FA 5DEQA 2D1HA 2ZNYA 4Q4ZF 3KP7A 3I71A 3HSEA 3IL2A 4E70A 3RYRA 3HOSA 5F64A 4KA4A 1R36A 4NHJA 1R23A 2FQ3A 2HOEA 2YX4A 4KT5C 3L2CA 2HR3A 3M7GA 4HF1A 4QLCU 3K1PA 2XUBA 1I27A 3KZYA 3RIRA 4I2OA 2X0LA 1LJ9A 4JQFA 4A5NA 5LHHA 3ZMDA 3ZMUA 1J9IA 3WTYC 4CDGA 3GZ6A 2DPDA 1MDMA 4RGUA 3F72A 5BMZA 3HHGA 1H9GA 3IWZA 2F5EA 1FYLA 3HRSA 3ROUA 3U1DA 2OZUA 1J59A 2DQRA 2P7CB 4Y13A 1KYZA 3GXOA 2GA1A 4WXHA 5D6FA 1I6XA 1ZRDA 2LDUA 1IN7A 4XRFA 5E8IA 1FT9A 2VC0A 4HW0A 4L0YB 1Z1DA 1LB2A 3SXYA 2L4AA 2HTJA 3C18A 2BV6A 2ZMEA 5L3FA 3MZYA 1J7KA 2PLYA 4ASNA 5HOOA 1G4DA 1KQ0A 3V7RA 1EH8A 4YIFA 1PUEE 2FF4A 4M9SA 1OYWA 1IW7F 2ISZA 2IRFG 4IRIA 2FSWA 1ZG5A 2XASA 5HVQC 2BBYA 1U5TB 2MBFA 5CVVA 2HTSA 3LQRA 4HX7A 2IW5A 2JT1A 2XV4S 2IA0A 4HDUA 4GYIA 2EWNA 5TJJA 1O3SA 2QQAA 3J81K 1TQIA 4BHCA 3KP5A 1XGMA 3I0TA 1LNWA 2EJRA 1J75A 3FMSA 3S2WA 4OU0A 5HS7A 5JI6A 1QZZA 2CFXA 4O3MA 2F2EA 5HLHA 5D5WB 5L3DA 5E8GA 2EFNA 1MKMA 3BP8A 3KFWX 2A69F 4ESBA 3QOPA 2XAHA 5L3GA 3P7NA 5EEGA 4KNYA 1KU2A 3HSFA 1CF7B 1T0FA 6PAXA 1FSHA 1U3EM 5E1WA 1MD0A 1ODDA 2MLKA 3WU1B 1ZG3A 1IXCA 3GYHX 4KIGA 4IHTA 3TDUC 2H09A 4I0AA 2P7VB 1XSDA 4IXAA 2JRTA 4OIPF 4HV6A 4MHGA 3DFGA 1Z91A 2FE3A 3E97A 1B59A 1G3YA 2DAOA 1XGOA 5IT9K 2W24A 3CUQB 2FBKA 2ETHA 2VODA 5ILUA 3LWFA 4O6JA 5L3BA 4EMSA 2VT3A 4OMZA 4ZH4F 2CYYA 5DD4A 3ZMSA 1SMTA 3LSTA 1P2FA 1K7AA 1TW3A 2FBHA 3CLOA 3RPQA 3ECOA 2W84A 1L0OC 2F5DA 5FFZA 3GFJA 3F8BA 4WXCA 3CUOA 3QP5A 5DCMA 2C6YA 1RIOH 3KE2A 2Y75A 1UHMA 4UXNA 4Q47A 4EV0A 5BS6A 2EV0A 5H6RA 4EJUA 1BIBA 1WWXA 1SD6A 5CVUA 1IUYA 3ABUA 1P4WA 1OPCA 1FYKA 1HW1A 2F5CA 4XBFA 3ERED 5BOXA 1WI9A 4G7OF 5F6FA 4M9XA 5BPDA 1FBUA 1YS7A 1LEAA 3F3XA 1IRFA 5ICGA 4ETSA 1YG2A 3BWGA 2QBYB 2D1VA 2UXXA 3U2RA 2GXBA 3WE2A 3U9GA 4R1HA 1IAWA 3F8FA 2P6SA 1FYMA 2OBPA 4HZFA 4I01A 4YFNF 3T5XA 3H3ZA 3Q5FA 1U6GA 2M5WA 1ONVA 3K9TA 4A6DA 3QP6A 1YIOA 2IP2A 1P6RA 1XN7A 1USSA 4L9TA 3W6JB 2Z5UA 2RDPA 3VOEA 5CVIA 4L18B 2ESHA 3ECHA 5DYMA 3JAMZ 4CYDA 3E6DA 1W7PD 1K78A 1ZH5A 1S7OA 1J2XA 1HKSA 1X3UA 2CSOA 4MNUA 1I1SA 2FBIA 3D0SA 4ZZDA 2PEXA 4MTEA 1YLFA 2FMLA 3FXRA 2ZFWA 4LJZF 1FLIA 3RKWA 5JHUA 1DPRA 2Y0MA 4G7HF
chains in the Genus database with same CATH superfamily
2LYCA 4UVAA 3BTIA 5CQEA 3MZ8A 2LP0A 2XKOA 2QM3A 1OYYA 1LFBA 2GOXB 3ISPA 2QUFA 2PMUA 4L5JA 2HVQA 2X6XA 4M6VA 2VXZA 3GFLA 1DGRM 1MMAA 1D1AA 1Z9CA 1N75A 3IHUA 4IRHA 3RZDJ 2IJLA 2VXDA 4XNFA 4QSHA 1ZRCA 3KP3A 4KUMA 4M3EA 5E3LA 4BE1A 1OMIA 5IYCJ 4HX4A 2M4KA 2RQQA 1TW2A 2WAQN 4BH9A 3H0GJ 3BPXA 4G6QA 3BQYA 3MWMA 4ITVA 1IZ1A 4ENKA 4RS8A 3CJTB 1MBJA 4DZPA 4PGHA 4ZYHA 2CWEA 5FJ8J 2XROA 2L9RA 2M34A 3KZIC 1X1AA 3DV8A 2XF6A 2W7NA 1B9NA 4BS9A 1VTNC 4YEJA 1O4XA 3G2BA 2W57A 1Z67A 2VE9A 3E0JB 2WB1A 3FWEA 1YHQI 1JUPA 2YSRA 4WWCA 3ML6A 4XLCA 3N97A 1QNTA 3JW4A 4K2EA 4BE0A 2HI3A 3CDHA 2ME6A 2JA2A 3JCUC 4UV8A 2CUJA 1MSEC 2ZXIA 1D0ZA 3NWSA 4HA8A 4HNVA 4HF2A 2CV2A 1I5ZA 1TNSA 4FASD 3AKZA 2HPIA 3N4MA 1BI2A 2ZO4A 1R5ID 4HRIA 5EEAA 2HZTA 2EV5A 4BE2A 3JRGA 1A36A 2X1CA 4BKXA 5AONA 2PJRB 3FM5A 1WH5A 2LSOA 5DDGA 1IJWC 3PM1A 1XCBA 2MGQA 3TW6A 3A0HC 5HDKA 3G3ZA 4UY8I 3LSMA 1FNNA 4JP0A 4KN7X 1GT0C 4G6DA 3BR6A 2NRAC 5EZHA 3S14J 3KP2A 1BOAA 1JHFA 4L0ZB 3B02A 1TBXA 1ZQ3P 3OSFA 4XKVA 1W36D 3EDPA 3O8HA 5M5WJ 3LL7A 2X48A 3DKWA 2STTA 3CP8A 2EFQA 4PSWA 4QPOA 2LLKA 3RYPA 2EBIA 4I98B 4XL9A 5LGTA 2M4GA 1P4XA 1Z05A 3BJAA 3GW2A 4BQQA 4B09A 1ZAOA 1ON2A 2A6TA 4GCVA 4IRGA 5LD2C 3R0AA 3G73A 2ZB9A 2M0CA 1VQMI 2W48A 2K9NA 2Y0SA 5J1YA 1X19A 3WGGA 4AC0A 3M07A 2HYFA 2PX9A 2MD5A 1ZK8A 4MO7A 3RCOA 3SZTA 2EK5A 2R7FA 1U0JA 3S3NA 1RUNA 3KPHA 3R4KA 2EQRA 4NC6A 1ETWA 2G9WA 1O3QA 2R7SA 4GFBA 2K86A 4OAZA 1FP1D 4ZYEA 4FTHA 2QWWA 3FK6A 2MLGA 3WTXC 4N9IA 5LGNA 3TL4X 1PJRA 4ENMA 1SFEA 1FMWA 1LKXA 3RI4A 4WK8F 1RPWA 2P5KA 1SANA 2PFBA 1UCRA 2R5ZB 1MJ9A 2EIJH 1OCTC 2M45A 3BPVA 2XGXA 4KYWA 2ICWG 2K7LA 4UB8C 5FO5A 5K5OA 2M8EA 2JPBA 2WV0A 2VJJA 2K9SA 1YITI 2DBBA 4B4CA 4EQQA 1MW7A 3RKYA 2WAEA 2UXNA 2F48A 4G6TB 1E17A 5F04A 2K85A 5E3NA 2WAFA 5LGUA 2WWYA 2HXOA 4A0XA 1S9HA 2CG4A 3JRAA 2L7FP 5ILSA 1PP8F 1H9TA 2DODA 3TEDA 2QSFX 4BACA 5B5EC 2K3PA 2YUSA 4PJMA 2DTRA 4YFXF 2HZDA 2R5YB 2V1UA 1X1DA 1N25A 1XMKA 4O5VA 1NTCA 1JXSA 2P6TA 3ABTA 2V9VA 4HQMA 1K6YA 3JRDA 1GHCA 1BC8C 2UWMA 4GYGA 1G3SA 1QA6A 1YX5A 2PN6A 3ULQB 5B66C 1WH7A 1H88C 4BBSJ 1T98A 1JUMA 2KIMA 2RGVA 2PG4A 2OZ6A 2XAFA 3OYGA 3ZCOA 5FB2A 3BR1A 1WVRA 3PFIA 4P1WA 4UHTA 2VLAA 1QGPA 4DBRA 4W97A 1SAXA 3DPUA 3DXJF 1R00A 1VQ8I 2R3SA 2GZWA 1HQCA 4M3BA 2XKPA 1R5HA 1YYVA 2XB0X 3MFKA 1SEUA 1W7PB 2HQNA 2R7UA 4AVZA 1N77A 4LB6B 1GDTA 3I5UA 4HDVA 3SHFA 1HW5A 2VPLA 4M71A 3H9JA 2O3FA 5FKMA 1VF9A 2DA1A 4KIBA 1T33A 4B43A 2QF7A 4U0WA 2LNBA 2ISYA 1MMDA 2LMDA 2JWTA 1RNLA 2RREA 2YX7A 5M5XJ 1ULYA 1YOVB 2D45A 1T2KA 4HAMA 3T0YA 4ZTFA 3VODA 4DNCA 2MH2A 2WB1N 3TOAA 2NAZA 5FD5A 1GLNA 1SVOA 1X2NA 3DCFA 3KLOA 3ONQA 4JX6A 5GAGJ 3FK7A 3HRTA 4C2MJ 2ELKA 5D5XB 3GEZA 4B8XA 4H4KC 1VQNI 1I6HJ 3CZ6A 2OPTA 5EGOA 2LR8A 5FGMA 3L00A 3ELKA 2GA2A 2KJCA 4UNOA 1MBGA 4RB1A 1LDJA 3MD2A 1TWCJ 2V1DA 5CVJA 2K9LA 3TGNA 2KP6A 4TV7A 3IC7A 2ACJA 1IXSB 2DFIA 1JGGA 2HVRA 3M1EA 3HOTA 4XMYA 1SD4A 3V42A 2EFOA 4M3GA 1MJBA 4XOTA 2KQRA 1XMXA 2OQGA 1W5TA 1B4AA 2ECCA 4J19A 1S7AA 3COAC 3HRUA 3J7AO 2VQGA 2K9MA 1SAUA 4HSTA 1OISA 2FMYA 2JSCA 4FT8A 2R4GA 4E7HA 4AIJA 5E1ZB 1REPC 2BW3B 1D5VA 5ICCA 5KVRA 3W2WA 4II3A 4UVBA 2CUFA 4OIQF 2X4HA 2EZHA 4RM2A 4ZC3A 3MZHA 2L7MP 2GBYA 2VASA 2MA3A 4YG2F 5KHDA 2LY9A 5HLIA 1X2MA 4PJLA 3K2AA 5FROA 3AAFA 3DQVC 5GTIC 1DUXC 1MMSA 1FSEA 3G4SI 1ZYRF 3KEOA 1ZKGA 3JAMK 2ZJ2A 3LA2A 1Z7LA 5IOZA 2Y0SN 1KA8A 4PDKA 4MTDA 5JFRA 3OSGA 3ZPLA 2LH9A 2WTEA 3W2AA 1ZRFA 4M73A 5J8CA 5HLGA 1R1UA 5IPAA 4HG2A 4ENNA 1BC7C 5JHFA 3O2PE 2VC1A 3KIOA 2UZKA 4U7DA 1J09A 4FETA 4XRSA 5J47A 1F1ZA 4U0VA 1W4MA 1IO2A 2HXIA 1T08B 1YW7A 1V5EA 1WPKA 3CUQC 2GXGA 4XONA 1ZR2A 1FOKA 2H8RA 4ZYGA 3HKZA 1GV5A 2DW4A 4E7LA 3E6BA 1MIJA 5FLXZ 5FLVA 4CCMA 3CCRI 1QHHD 4AIKA 1FBQA 1FC3A 2DT5A 2QEXI 3Q9VA 5D6EA 2CUZA 3KZZA 3ZMVA 5EYRA 4Z2YA 1TQMA 1S5LC 4R79A 4EEFG 4C3JJ 3GX4X 1OCPA 4I09A 5H6QA 2I10A 3E6MA 3BZCA 1TTYA 3PIOF 3S16J 2RVCA 2EH3A 4IPAA 4KJZA 4KICA 1ETOA 2BXZA 3OYJA 3SEQA 3GMEA 2E71A 2XAGA 3PIPF 4KMUX 1O7FA 4ZDLA 3MAJA 2A6EF 5CQGA 1QVUA 2Q2EA 4A2UA 2GOMA 2DYRH 2R0QC 2OA4A 4XLPF 4LLGF 2LFBA 1GUUA 3KP6A 5M3FJ 1MDMB 3G1MA 1ZLKA 1B9MA 1XPXA 2CJJA 1CGPA 1FIAA 3DTIA 3HYIA 4CHUA 2JK3A 1HOMA 2ADUA 2OTLI 2M3AA 3LMMA 1XDSA 3CO6C 4AU7A 1Y0NA 1V55H 4RAFA 1T8IA 2XRNA 2DLLA 2DI3A 2GAUA 3TMOA 1KQ8A 4G94A 3CCVI 3FBIB 3K0LA 4JBAA 2E1MC 5F08A 5FLMJ 1JI8A 1TL8A 3L09A 2DTZA 3F22A 5AIQA 1V5FA 2NS7A 4L9NA 4PZJA 5D5UB 2IS1A 3F6VA 2BHZA 3WTTC 4BJTA 2F4IA 4LG0A 3V8JA 3FHNA 2H8WA 2KFDA 5D4RA 1IV6A 2BE5F 2FRHA 4IKFA 2EV6A 3C1DA 2WC2A 2DA7A 2ZMEB 2O0YA 4NUBA 1O3TA 1HDDC 2LKSA 3P5JA 3P9CA 2FOKA 1JKRC 1MSFC 4P96A 2EIMH 4B44A 1QPMA 2V1XA 1HLVA 5K7ZA 2HDWA 2B9SA 4I7HA 3IKTA 1BW6A 1GXPA 4UB6C 4XM3A 2IGKA 2OV7A 4D5CA 1FZPB 4BQAA 3CESA 5E17F 1OCRH 4HOBA 3OYIA 4BY7J 2PQ8A 1XD7A 3K1NA 1VQ9I 3LA7A 1W0UA 3J80Z 1M1EB 3ASOH 1ZGJA 3WG9A 3GLXA 3IRQA 4M6XA 2YU9J 5LHGA 3RJPA 3DP7A 3RSNA 3V4GA 2DMQA 3CF2A 1V4RA 1JT0A 3SFIA 4X6AJ 3OIPA 2GIVA 1H8AC 4DIQA 2O03A 4IF4A 3I59A 2HNHA 5TISC 2QYOA 4AIHA 1VZ0A 5J4YA 4IL6C 1SFKA 3L1PA 3OYLA 2QKLB 2HEOA 3GVAA 2XC7A 2O8KA 2K9QA 2E34A 3T8TA 4HLYA 2ME0A 4BHBA 3D5RC 2MC4A 2VB6A 4IHVA 3MKYB 4XR6A 4C2UA 4RMNA 1IF1A 1SD7A 2DMUA 1TQPA 1I39A 2HFHA 4LK1F 1EH7A 5ICFA 2EFWA 1TT0A 1TC3C 4CICA 3CJQB 3QYEA 4RB3C 2E1NA 4V2GA 2Y48A 2JPCA 2PBIA 3EUHA 5E3OA 2LKXA 4BHPA 2BVMA 5CLSA 5K5QA 2QVOA 1D8JA 2HGCA 1K4SA 3ZGKA 4ENJA 2LF8A 2OQRA 3PSIA 3S1MJ 3FZVA 3BY6A 3C3WA 3RKQA 2W82A 5K1YA 4I76A 1P7IA 4IHSA 5IP6A 3T1BA 2DFHA 5M3MJ 3TKYA 2NVQJ 2HVSA 2NYXA 3PL8A 3F23A 1W5SA 4M9ZA 2ZXJA 1T39A 4EM2A 1Y1VJ 4A5MA 2Q1ZB 4YFKF 1OFCX 1XC5A 4IOCF 2ZXWH 1Z3YA 1MBKA 2CMPA 2DJIA 2MG4A 3LQQA 5HNHA 1UAAA 4P9UA 2W25A 3HTSB 1LDKB 2GWRA 2XVCA 3ZQIA 3G6EI 3HSRA 1A35A 1Z6TA 3HKZN 4AVPA 3FHZA 2P81A 3TDZC 3GTJJ 1IUFA 4Y4RA 3WU2C 3OL4A 2P5VA 1R6RA 2GLOA 2JUCA 3UKGA 3DKYA 1UJ8A 3H9QA 3DU5A 3DKXA 3AL0B 2DMNA 1TLHB 1WQ2A 3S32A 4IVNA 1UG2A 1TWFJ 4RM3A 5IYDJ 1R22A 3QPSA 3TOBA 1X3WB 4PJJA 1RESA 3CC7I 4L9VA 3MEXA 1WRJA 3GO5A 2L7KA 3WU0A 4U7BA 4U88A 3F8NA 3IH4A 5LEKA 3F6OA 3WTVC 4ZDPA 1BJAA 5EEHA 4QTRA 3F8MA 1DP3A 3WE3A 1S29A 3I64A 2DMTA 2XF7A 3K70C 3ZQGA 2P8TA 4BJ6C 2ZNZA 1U2WA 3FXQA 3BC8A 3A01B 2CH0A 2VBZA 4XLHA 1A04A 2CW0F 2DDAA 2G7HA 2VJ4A 3HGYA 2JN6A 1QPIA 1G3TA 1KQ9A 3NQOA 3EYIA 3I58A 4BEHA 2DK8A 1I1GA 4C30A 3VB2A 2Q0OA 1YFHA 1T95A 2PJPA 3MMYB 3ZQCA 5CJ9A 3KEYA 3WGHA 3L7WA 3TO9A 3HIFA 3Q9SA 1F4KA 2HS5A 1YRNA 1RZ4A 1DPUA 2XAQA 1R7JA 1LDDA 3ZR8X 5CVRA 3GTKJ 3BZKA 1SD5A 3CCLI 3CD6I 2DQLA 4V19K 4Y15A 1P4AA 1XTAA 3DU6A 1R5GA 2BY3A 2EZLA 2LK2A 4OAYA 5FD6A 3L2UA 3GZNB 3I4NJ 3CMAI 1R1TA 1U8RA 2LY2A 5DCMB 2EZKA 2XIGA 1JKPC 3OYEA 3CO7C 4LK0F 3KEQA 1PVEA 3Q0UA 1Y1WJ 2M30A 3CQZJ 2Y69H 2ZSHB 3FMRA 4UUSA 3KETA 1AHDP 1FOXA 3C7JA 3WTZA 1EJ9A 1FTTA 2AQEA 2A5WA 2L02A 2NOGA 2FOWA 2Z3YA 3A2KA 5LLQA 2MC3A 1YI2I 2HQ5A 1HC8A 5DUIA 3LAPA 4BAYA 5E1XA 1HSJA 1MJAA 3HOZJ 3REOA 1KGSA 3SQNA 3ZRGA 2AXLA 5J6XA 1DDNA 2DA6A 1B8IB 2M87A 3F0CA 3DLLF 2CS3A 1KYWA 4XSXF 3EYYA 1DQUA 4XKBA 3QRFF 1VQ7I 1D5YA 4M3FA 3MKLA 2FJ1A 5JVGF 3J7AY 4AWXB 2HDCA 3EUHC 2DOEA 9ANTA 3G71I 1G6NA 3R0JA 2NNYA 1MH3A 4XN0A 2IAIA 4UV9A 4ZYAA 3OYHA 2W00A 3GTGJ 4EJWA 1Q1VA 3SZPA 3K4NA 3VPRA 2GIZA 3DLAA 1D1BA 2MH9A 3S1RJ 4PJNA 1U5TA 2K4BA 1JT6A 3QU6A 2R7OA 1RC9A 4N9HA 4D1QA 3H9GA 2XF5A 1MMGA 4CYCB 5C3EJ 4WXDA 1JUSA 3W6KB 3O3KA 3JSOA 2JZYA 3BR3A 5A2QZ 3BJ6A 3K4BA 1XSVA 2A3SA 4A0ZA 1X1BA 3RQIA 3QWLA 4CXFA 1X3ZB 4G8XA 3PUFA 4EJOA 2P5LC 1UB9A 2DA4A 4NQWA 1JJ6C 2X51A 3WTSC 2KIFA 4KITB 1XSXA 5FLXK 2HYJA 5JVTA 2HU9A 1J5YA 3EETA 4NB5A 1ZR4A 2LG4A 3DF8A 1WJ5A 3IKVA 4S04A 1IN6A 3QAHA 5LRSA 3HUGA 5H20A 5DM6F 4BDZA 2UV1A 2XPWA 1ZTRA 1BI1A 5IP7J 2X9DA 1SFOJ 2L0KA 5D5VB 4N4NB 3FXJA 2KZVA 3HOYJ 1QQIA 4D7NA 2CO5A 1Q1HA 3KP4A 4X1EA 5D4SA 2X1EA 3E6CC 4A3MJ 2CQNA 2PI0A 3V8KA 3JR9A 1UHSA 2BVLA 2IXSA 4CGZA 2JA6J 1CF7A 2DO7A 2A07F 4M72A 4XQFA 1UHWA 2K02A 3LAJA 3ASNH 1ZREA 5J4VA 3K2ZA 3HOXJ 1S6LA 2L01A 1MZBA 1FMVA 1MBHA 4A0YA 1WJEA 1T38A 2M1BA 3M1CA 1JHHA 2LBFB 3MQ0A 5EG0A 1BI0A 3LFKA 3WTWC 2K4JA 4A3GJ 2D2WA 2HKOA 1WSUA 2EA2A 1O7LA 4LMYA 4CO8A 5JLXA 4HF0A 3OS2A 1USTA 4PFOA 3IV5A 3GFIA 1KONA 2ELJA 2LKPA 2A61A 1ZARA 1HCRA 2TCTA 4A3EJ 1K78B 2VT2A 3QPLA 2LREA 4Q5SF 1V5GA 1L3LA 2A5YB 4CUGA 1SFXA 2Z99A 2DA5A 1CQTA 2CV0A 4RAZA 2P4WA 5D8KB 3GZ5A 2HDDA 3GUDA 4OWRB 4Y3OA 2DN0A 1Z77A 3EPZA 2E60A 1RETA 3K4LA 5EF6A 3H0DA 3CUQA 1AKHA 1IRXA 3OIOA 1NHAA 2QSHX 3GTPJ 1HSTA 1T56A 3HRMA 1D3YA 2BYVE 1FEXA 3FXKA 1T6SA 3DBRB 2D5VA 4KN4X 1BN5A 1B72B 3IRRA 3MN2A 1TP4A 4HYEA 1JJ8C 3S2HJ 2B0LA 4PCQA 1FX7A 5FFXA 3I54A 2RKHA 4U87A 3NARA 3CCEI 3BOQA 3QPHA 3E5XA 1ORKA 2E2IJ 3VYSB 3DBHB 3CCUI 4CCJA 2ZJRF 2VONA 3LA3A 1S3JA 3DPTA 2IVMA 3SYTA 1U5TC 5HDGA 5D8LB 3J80K 3AG2H 2STWA 1LEBA 1D0YA 1BR1A 4L5IA 3ABLH 2O6GE 5FKKA 2QQBA 2DOAA 3CMYA 1UFMA 3AG3H 1R71A 2DXIA 2KIUA 4C3IJ 1ON1A 5BPIA 3WODF 4D0PA 2J5OA 4DBQA 4ESFA 2FEZA 1C0WA 3H5NA 3PO3J 3CF5F 2NXNB 1LQ1A 3ZN0A 3K7AJ 4OIRF 1U78A 2KJBA 3NEUA 3PO2J 2PMHA 3H92A 4BGDA 4PSXA 4ON0A 4IJAA 2X6OA 4JK1X 3HOUJ 3PNYA 2KT0A 5F1RA 3FXMA 2V79A 3I3LA 2FA5A 4MEYF 1VQOI 3JSPA 2NNNA 4IQJA 4GRIA 1ZN2A 3OYMA 4CCLA 2QGUA 4P5OA 2Z1DA 1BI3A 3L2RA 4OIOF 4B48A 3LOCA 2H94A 4RB2C 2X6WA 1YQAA 4I0BA 2KPMA 1LFPA 4Z6YA 4D7MA 1W1WE 5HNFA 5DM7F 3BTLA 4ABZA 3E5UA 2M7BA 3D5LA 5K5RA 3SJMA 3PQKA 4EATA 4HBLA 2A05A 4RA2A 3OV8A 5KAIC 1DU0A 2KL4A 1IRGA 2XHKA 2WBMA 4BQNA 1OQYA 4M3DA 5FKNA 4AYBA 2ZJPF 2AS5F 4HX8A 4I02A 1YJNI 1ETYA 3BJOA 4BBRJ 1FWZA 1MNMC 2HYGD 2CW8A 3I53A 1D0XA 1KU3A 1R1VA 2HQRA 4E7KA 1E3OC 5IYBJ 1O57A 1QZYA 4BXFA 3M4OJ 2OF7A 1YTYA 1D8KA 1BM9A 2GQQA 5KK1A 2OAZA 2E5ZA 2VKDA 2CW7A 5E18F 2F4MB 1X1CA 4CZZA 2JTVA 2QQ9A 3WHBA 3OYBA 1SFUA 2W1OA 2KZGA 4QWQA 2R92J 3X2QH 3ZN1A 5FKLA 2Y2ZA 4KISA 1XGNA 5HS8A 4XRMA 2QBYA 3P9IA 1F36A 4A6EA 4F7ZA 1H0MA 4MGRA 2ZCWA 2OD5A 3EUAA 3BDDA 3HOVJ 4KMFA 5DUKA 1LE8A 2L5QA 4OOIA 4DOZA 1RI7A 3S1NJ 2H1LA 3GWZA 4LGWA 3V7SA 2O9LA 5TRDA 2WADA 4CCKA 2R7VA 2IT0A 5L3CA 4YRVA 4GXOA 2EFPA 4BXXJ 3VFZA 1XCVA 2TDXA 3CJNA 3QU3A 4H0EA 1IV8A 2O8XA 4BY1J 4DJAA 2V6CA 2RN7A 1MBFA 4RGXA 1KU7A 1HW2A 2JUGA 3HJEA 4HNTA 3KLNA 3O8GA 1QO0D 5E3MA 3E5QA 4RLQA 2FU4A 3H5RA 2VQCA 3TO7A 3AG4H 3B6AA 4EJVA 3NAUA 1O3RA 3BZ6A 4V2FA 2BGCA 1XMAA 2ZSIB 4A3DJ 3HTUA 1HKTA 3ZOBA 2EINH 1Y8RB 3CMMA 4NBQA 1KZHA 5EG0B 2O7OA 2HQAA 3B6CA 4RB0A 2ZBKA 3QYBA 4AD9A 1WKMA 4GO1A 4E7IA 2XRLA 2VIXA 4NC8A 4FX4A 5E20A 3U21A 1B6AA 2Z9OA 2R7DA 1J0RA 1ZLJA 3PQJA 4EGYA 1BA5A 1RR8C 1X1PA 2VQLA 5IOYA 1UELB 2G7UA 3K70D 3HC7A 2VBWA 4E7ZA 2UUZA 4N4OB 2XGCA 2QLZA 3QODA 2EPFA 4P55A 1HDPA 3ZMTA 2DU9A 5L3EA 2ZFUA 1NK2P 5C44J 1OR7A 2H27A 4RGRA 3M9AA 4M74A 5BQTA 1Y6IA 1ETQA 3F21A 3F8CA 4RGSA 4QIWN 4CA0A 2I8DA 3IAM2 2L2OA 4G7ZF 1XS9A 2X6YA 1XB4A 2KIQA 3SZGA 4I6ZA 3ERMA 1U9NA 2L54A 4A93J 4KFCA 2Y31A 2KHMA 3CLQA 4N0BA 5HLTA 3PJRA 1WJFA 1K6OA 1R58A 3QPTA 3C2GA 3FX3A 1WGXA 1A5JA 2VBXA 1PYVA 1OLTA 3R60A 5GPCA 3FXLA 4L9JA 1MH4A 3LSPA 2RNJA 3UNGC 3CCQI 1AWCA 3GTLJ 1RUOA 5GPAA 2BY2A 3M8JA 1YS6A 3BQZA 2QZ8A 3FM3A 2DT7B 3OR1C 3LSIA 1OKRA 1BBYA 1BW5A 4PFPA 3V7CA 1EV7A 2JA7J 3S3OA 2MFZA 3H3VK 3A02A 5DV5A 4OMYA 5A2QK 4XICA 3HOWJ 2E7XA 4XLNF 2CQXA 3FF5A 2CU7A 1GVJA 2VN2A 3OYCA 1PUFA 1SVLA 3OOUA 4FE4A 4D9JA 1IN5A 3D5SC 5FRNA 3N05A 4ZDOA 4E7JA 4Q48A 5EGOB 2DK5A 2EIKH 3S15J 3JTGA 3M8EA 4BL0B 1OYIA 4PUSA 3CCJI 5CKTA 2CGPA 2EB7A 3BR2A 3BTCA 4LIVA 3EQLF 3K10A 2O61A 3RTRA 1VQ6I 4RAGA 2E1MB 4HNUA 4CH7A 3KYDB 4CZCA 1WI3A 4LLNA 2E19A 2KRFA 4EM1A 3SFZA 2V4JC 4XSZF 3BG7A 3QQAA 1YW9A 3JRHA 3L2QA 2PJRA 4KDPA 5FRMA 1FY7A 4IQ4A 2KKOA 3A4CA 1GXQA 3HL2A 2Y30A 2FNPA 2RV8A 3H3UA 3IWFA 4HLXA 3TQNA 2NVYJ 3WTUC 2G0EA 2RNGA 3DEEA 1I3AA 3AFHA 3IAS2 3Q0VA 4P9FA 1QBJA 1MBEA 3T8RA 5ERIA 4Y52J 2OJED 5M5YJ 2MD0A 1S8NA 1FOYA 2IEKA 3HPHA 3H1CA 3R61A 3A1YA 5CYVA 1F5TA 3OYKA 5F27A 2K5CA 4IOAF 4B1RA 1PP7U 2HWVA 3C2HA 1VFCA 4LIUA 4PJ0C 2EILH 5AIPA 3TW7A 1U8BA 4HV5A 1LFUP 3ZQ7A 5JR3A 4MQ9F 2IS4A 1KU9A 1K79A 4MQVA 4NDLA 3V8LA 1MGTA 4FISA 3R6SA 4ZZLA 2IBDA 4LD5A 3OYAA 2HPMA 1IDZA 4BUPA 4X0GA 2VOOA 2NS0A 3E7LA 5JLWA 3L2VA 1HBXG 1ZHFA 1OR7C 1IN8A 2O5RA 5DCFA 4J00A 4F3QA 4ESJA 1I3QJ 2J5PA 1E0EA 4WCGA 3J81Z 1A6IA 1TNTA 4ZJZA 1E2XA 1JTXA 4UVCA 1MMNA 2M2EA 3JTHA 3TO6A 2IPQX 2XAJA 4C2TA 1JTYA 3L9FA 2RQPA 2R5ZA 3ZMZA 2PMZA 1ZG1A 1NG6A 1DP7P 1XGSA 2LY1A 1IDYA 1VQLI 2CUEA 1DGWY 1JGSA 1EH6A 4FHTA 1SMYF 3CTAA 3HEFA 1F43A 1LVAA 4E6KG 5KNLA 4F93B 1G3WA 5LBQA 2XGDA 2E1CA 1APLC 3E3VA 5LHIA 2XPVA 1I50J 3SEZA 4QPQA 1OCCH 2Z33A 1OCOH 3C2BA 4HQEA 2ECBA 5ICEA 2BHYA 3HHHA 3FMQA 1ZGAA 4R8HA 2LF7A 3ESWB 4M6YA 4CCNA 3SDGA 4E7SA 3MCZA 1D1CA 2IA1A 2L4MA 2Q2EB 3GFMA 4G9YA 2R5YA 2OCEA 1R9TJ 4A3JJ 4F52A 2COMA 4U0YA 3DEUA 1Y39A 3F9KA 2CQKA 5J1UA 3ZP5A 5ED4A 3HGGA 3RPUA 1A6QA 2E35A 1VNDA 2ELHA 4MEXF 3RKXA 1V3FA 1VQ4I 2VE8A 4WF2A 2F5VA 3K69A 2ZJQF 2QENA 2IA2A 3JRBA 1IN4A 4DW6A 1XDUA 1YE9A 3DBLB 1Z7UA 4XN3A 1XG1A 1FPQA 4A69C 1HXDA 3FXOA 4Y17A 4A3IJ 4KIFA 2E1OA 2FNAA 2A6HF 4DQ2A 4S05A 2BY1A 5C4XJ 1WHUA 2QKMB 2KISA 2YR2A 4A12A 3B73A 5ILVA 4A3FJ 1EA3A 5C4JJ 1YW8A 3ZQHA 4UUVA 2WY7Q 3BT9A 3E1SA 4BNCA 5DD8A 2ID6A 2CQ7A 2BEOA 4EJTA 2H6BA 2VBYA 3I4MJ 2CRGA 4LG0B 2M0MA 2VKEA 4MFDA 1P7JA 3MKZA 5IT9Z 3GF2A 4IZZA 1W7PA 2FXAA 2L3DA 4OINF 5LEJA 4UUTA 3OR2C 4EVIA 1Y56A 4ZYDA 1AOYA 1IGNA 2Y9ZA 2E2JJ 2LTPA 1QVTA 4LLLA 1SC7A 1DU6A 5J8FA 3PNTA 4WX9A 1A31A 3OS0A 2W85A 1P92A 3WGIA 1BIAA 1YO5C 1EF4A 5HDNA 4PGGA 1HKQA 2KRCA 3P9KA 1PUFB 1FBSA 3FXUA 4AUXA 2R7WA 2A68F 2LRDA 3QOEA 4YIIA 5IT3A 2ID3A 4J01A 2DPUA 1ZELA 1LUJB 3NRVA 3VYUB 1JE8A 4RAYA 2X85A 1F9NA 1WCMJ 2H6CA 2IGOA 4GGGA 2E2HJ 4RBOA 2EA4A 3I9V2 2E7WA 3KCCA 5GP9A 5B1BH 3K1MA 2V6EA 2ESNA 5IY5H 3I59B 3RDIA 3DPLC 1U9OA 2HKXA 1Y0UA 1TT5B 2ZKZA 3HPGA 1AA7A 1Z6RA 2JVGA 3VEPA 4EM0B 3CCMI 2L9VA 5GAHJ 4BXUA 2BW3A 4LB5A 2H1KA 3K4CA 2VOPA 2K27A 2DFFA 1YJWI 1WFXA 1QRYA 3RZOJ 1WJAA 2YPRA 3OOPA 3MKWB 3J7YJ 2Z16A 3OWTA 3I4PA 1H89C 2YU3A 4LFUA 1STZA 2DJNA 3FDYA 4BYYA 3ABKH 3PNVA 2OU2A 4FX0A 1QHGA 1B1BA 3I55I 3BROA 3LSJA 5HODA 2F5FA 1RKWA 3JREA 2QA4I 2RC4A 4MIMA 2DDBA 5KCMA 4EGZA 3LNQA 3LSHA 2BZTA 2Q8KA 4DYQA 5LRRA 2NVXJ 3GCMA 3VSKA 2R7QA 3O6BB 1WZ2A 3GTMJ 5HS9A 1IXRC 2AXTC 1PDNC 3CMEI 2VQHA 1VQ5I 3AG1H 4XKWA 1FP2A 2HOSA 3PSFA 3M8FA 2DCEA 3PFYA 3OYDA 2JA5J 3VYRB 2D1HA 1N78A 2KDZA 4IHWA 2ZNYA 2V9PA 4Q4ZF 2JSPA 2PMZN 3A0BC 3FKJA 3KP7A 2V9KA 3I71A 3HSEA 3IL2A 4E70A 1BR2A 2DFEA 3BG6A 3RYRA 3HOSA 2NVTJ 3DEWA 2AO9A 5F64A 3S17J 4KA4A 3H36A 1R36A 3GLLA 4NHJA 2IGMA 3BR0A 3TP0A 1GVDA 1R23A 2FQ3A 2HOEA 2WA0A 2I5UA 3CJRB 2CQQA 1YJ9I 2B7EA 2MSYA 2YX4A 2W4SA 4KT5C 3L2CA 3OMYA 1MNDA 5BNGA 2HR3A 2R7TA 3M7GA 4HF1A 4QLCU 3K1PA 3BG3A 2WY8Q 2XUBA 1I27A 2E5NA 2JA8J 3KZYA 3RIRA 4I2OA 2B63J 1P9QC 2X1DA 2X0LA 1LJ9A 4JQFA 4A5NA 4E4HA 5LHHA 2JJ7A 4XLAA 3ZMDA 5GADJ 4DYCA 3ZMUA 1J9IA 3WTYC 2XSJC 4CDGA 3GZ6A 4BEHB 2DPDA 3VDXA 1MDMA 3IP4B 4RGUA 3F72A 4IHYA 5IP9J 5BMZA 1YRNB 3HHGA 3U1KA 1H9GA 3IWZA 1RRJA 2F5EA 1FYLA 3CDIA 3DWLE 2K40A 3FBNB 3HRSA 3ROUA 3U1DA 2IS2A 2OZUA 1J59A 2DQRA 2P7CB 3VWBA 2Z2SB 2V7FA 4Y13A 1KYZA 3OY9A 2VKVA 3GXOA 2GA1A 3G1OA 4WXHA 3HBLA 3PUBA 1NG7A 5D6FA 1I6XA 1ZRDA 2LDUA 1IN7A 2Y9YA 2V1NA 4UUSB 4XRFA 3S3MA 5E8IA 1FT9A 2VC0A 4HW0A 1OCZH 2JQ7A 4L0YB 1HF0A 4C9YA 1Z1DA 1LB2A 4AM3A 3SXYA 1ZGWA 1TWHJ 2L4AA 2XDVA 2HTJA 3C18A 2BV6A 2ZMEA 4D5FA 4LOCA 5L3FA 3MZYA 3S2DJ 1J7KA 3BCAA 4IO9F 2KRHA 3OIQA 2PLYA 2YS9A 4ASNA 5HOOA 1V54H 3TBIA 4DZJA 1G4DA 1KQ0A 3V7RA 1EH8A 4YIFA 2NVUB 1PUEE 3I56I 4LG3A 2FF4A 4M9SA 1OYWA 2FUG2 1IW7F 2OC6A 4KT6A 5DTDA 2ISZA 4L5EA 2IRFG 3FKIJ 1FJLA 1BJZA 4IRIA 1ACIA 4BU2A 2FSWA 1ZG5A 3HB9A 2XASA 1POGA 5HVQC 2BBYA 1U5TB 4XLEA 2MBFA 4HPQA 5CVVA 1X4PA 3H5AA 2HTSA 2FQ4A 2R7RA 1G2HA 3IH3A 3LQRA 2M8GX 1R4NB 2FX0A 2WV1A 4HX7A 4A3LJ 2DOFA 2MABA 5E79C 2IW5A 2JT1A 2XV4S 3OL3A 5H2FC 2F4OB 2HOAA 2IA0A 4HDUA 1JKOC 2MW8A 4A3KJ 4GYIA 1ITYA 2EWNA 5TJJA 1O3SA 1E3PA 5B1AH 3M3YJ 1VI0A 2QQAA 3J81K 3JRCA 3ABMH 5LFAA 3CCYA 2M7AA 2VJ5A 1TQIA 4BHCA 1FOWA 1R4MB 4DGWB 3NWTA 4G12A 3KP5A 1XGMA 4ZTJA 1EKEA 4NQWB 3I0TA 3WG7H 1LNWA 2EJRA 5F1JA 1J75A 3FMSA 3S2WA 4OU0A 5HS7A 5JI6A 1QZZA 2CFXA 4O3MA 2F2EA 3TP3A 5HLHA 5EZGA 1W36C 2R7ZJ 3HUGB 4F92B 5K7FA 3ZQLA 2JMWA 5D5WB 4NNJA 3IUOA 5L3DA 1G59A 5E8GA 5F0HA 4HEA2 2EFNA 4S0HB 1MKMA 1QZEA 3BP8A 3KFWX 1TZLA 1MNEA 2A69F 5CPRB 4ESBA 3LSKA 3CCSI 2FD5A 3QOPA 2L9SA 2XAHA 5L3GA 3P7NA 2KDOA 2E36A 5F0CA 2VI6A 5EEGA 4KNYA 1KU2A 3HSFA 1CF7B 2BXYA 1T0FA 2OUMA 6PAXA 2MYSA 1FSHA 3OS1A 4LITA 5J40A 1U3EM 4BJ5C 3HM5A 5TGTA 5E1WA 1MD0A 1ODDA 3BG5A 4JYKA 5DS9A 3K4KA 5FKOA 3FISA 4FQGA 2MLKA 2LC2A 3BG9A 5GAEJ 3WU1B 2DMPA 2QQ8A 1ZG3A 2KLOA 4DYRA 3S1QJ 1IXCA 3GYHX 2NS8A 1NH3A 1W0TA 3W2VA 2R7XA 4KIGA 4HSRA 4IHTA 3K6GA 3LFUA 3CDLA 4JX5A 4B3AA 2VL8A 3TDUC 2H09A 4I0AA 1LPQA 2P7VB 4IX7A 1XSDA 4IXAA 2JRTA 2CV1A 1LVKA 4XIDA 4OIPF 4HV6A 4MHGA 3DFGA 1Z91A 2FE3A 2AHQA 2NOJB 3E97A 3HZJA 1B59A 1GV2A 2OCCH 1G3YA 2DAOA 4MLOA 4NC7A 1NK3P 1XGOA 3SDBA 5IT9K 2W24A 3HG9A 3GBGA 3ZXSA 1AKHB 3CUQB 3CC2I 5K7HA 2FBKA 2ETHA 1K61A 2VODA 1ERDA 4XORA 5ILUA 1X58A 2ZMEC 4F55A 3LWFA 4O6JA 3A01A 3G1LA 5L3BA 3OYFA 4EMSA 1S7EA 3QYFA 2VT3A 1Z0XA 4OMZA 4ZH4F 2CYYA 3J7ZI 1VQPI 5DD4A 4FCYA 2F6CA 3RQ4A 3ZMSA 1SMTA 3LSTA 2HOTA 3EUKL 1P2FA 1VQKI 1UG0A 1K7AA 1TW3A 2FBHA 3CC4I 2IS6A 2OTJI 3CLOA 3RPQA 2QSGX 2N8GA 3ECOA 2W84A 3D1NI 4F91B 2ZXHA 1L0OC 2AQFA 2F5DA 5FFZA 3IH2A 3GFJA 1IC8A 2M9HA 3F8BA 4I99C 1HA8A 3BCBA 2GXAA 4XRSG 2VKHA 1K4TA 4W1UA 2WAQA 1TWGJ 3CP2A 3CUOA 4WXCA 3QP5A 5DCMA 2C6YA 3ZQFA 4JX4A 1RIOH 1WJCA 3KE2A 2Y75A 3BR5A 5GTHC 1UHMA 1S72I 2BOLA 4UXNA 4Q47A 3W3CA 4A3BJ 2RAEA 4Y7NJ 4EV0A 3LSGA 1W5CC 4BQOA 5BS6A 2EV0A 5H6RA 4EJUA 1BIBA 1WWXA 5EJCA 1SD6A 1B8IA 5CVUA 1IUYA 3KYCB 1FTZA 1TWAJ 3ABUA 3L2WA 1P4WA 1X4OA 1OPCA 1UMQA 3WHCA 1JKQC 2CFOA 4XOPA 4AYBN 3JRIA 2JVHA 2VJIA 3BTJA 3W6VA 5KAFC 3DTEA 2V26A 1FYKA 4GDFA 2DA3A 1E3HA 5J3LA 1HW1A 2F5CA 3LSRA 1RKTA 4XBFA 3KYLA 3ERED 5BOXA 1R49A 3HXLA 4B47A 1ETVA 1WI9A 4G7OF 3FIWA 2QCOA 5F6FA 1WJDA 4CYCA 4M9XA 4G7HF 5BPDA 3BLYA 1FBUA 1T0FC 1YS7A 2DA2A 2LVSA 5B3SH 1FIPA 1LEAA 2LOOA 3HDDA 2VPRA 3MVPA 2LD5A 3F3XA 1IRFA 5F0FA 5ICGA 1YX3A 2L7ZA 4ETSA 1YG2A 2ZC2A 3OYNA 3BWGA 3K4JA 2QBYB 2D1VA 3KX2A 4CCOA 1BR4A 4RLFA 2P0WA 2UXXA 4XK4A 2DT6A 3U2RA 3VYTB 3VSLA 2DYSH 2GXBA 1LE8B 2GM4A 5EDNA 3WE2A 3AL0C 4PK4A 1K83J 3H35A 4YIRX 3U9GA 2COBA 4R1HA 4FE7A 1IAWA 2XGEA 3F8FA 2XSDC 2P6SA 1FYMA 2OBPA 4JOMA 4HZFA 2XPUA 4I01A 4YFNF 3DTKA 3T5XA 4XLFA 3H3ZA 4Y33A 1IRZA 2IGNA 3Q5FA 1U6GA 2XAUA 2K3FA 1BOBA 2M5WA 1ONVA 1Z21A 3RPUD 2XB5A 1ETKA 3K9TA 5J1RA 4A6DA 3QP6A 1YIOA 2R93J 2IP2A 4B3XA 1AU7A 1P6RA 1ENHA 1XN7A 4IEJA 1USSA 4L9TA 2LBFA 3W6JB 2Z5UA 2EZIA 2RDPA 3VOEA 5CVIA 2JRMA 4L18B 4AIDA 3GTQJ 2BY0A 3GTOJ 1ETXA 2ESHA 3ECHA 5DYMA 4MFEA 3JAMZ 4II2A 1WJBA 1G8XA 4CYDA 4BDYA 3E6DA 3S8PA 1W7PD 4CSWA 1K78A 1BL0A 3JRFA 1Y8QB 3Q3SA 1OJLA 1ZH5A 3ZQQA 1S7OA 3Q0WA 1YIJI 1J2XA 1XX5A 1HKSA 1X3UA 2CSOA 2TRTA 4MNUA 1IG7A 4A3CJ 1I1SA 2FBIA 3D0SA 3A03A 2L9NA 4ZZDA 4XKCA 1SVMA 2PEXA 4MTEA 1YLFA 2FMLA 3FXRA 1Z3XA 2ZFWA 3UR3C 4LJZF 4YELA 1FLIA 2KMUA 1QU3A 1RR7A 3RKWA 5JHUA 3S93A 1B72A 1UZCA 4IHXA 4RDUA 1DPRA 2VUMJ 2Y0MA 5DEQA 4C3HJ 4ANJA 3K4MA
chains in the Genus database with same CATH topology
4UVAA 2XKOA 2QM3A 1OYYA 3ISPA 2QUFA 2PMUA 4L5JA 2VXZA 3GFLA 1Z9CA 3IHUA 4IRHA 2IJLA 1ZRCA 3KP3A 4KUMA 1OMIA 4HX4A 1TW2A 4BH9A 3BPXA 4G6QA 3MWMA 1IZ1A 4ENKA 4RS8A 4PGHA 4ZYHA 2CWEA 2XROA 3DV8A 1B9NA 1VTNC 2W57A 2VE9A 3FWEA 2YSRA 4WWCA 3ML6A 3N97A 1QNTA 3JW4A 4K2EA 3CDHA 4UV8A 4HA8A 4HF2A 1I5ZA 1TNSA 3N4MA 1BI2A 2ZO4A 2HZTA 2EV5A 5AONA 3FM5A 2LSOA 5DDGA 1XCBA 5HDKA 3G3ZA 1FNNA 4KN7X 4G6DA 2NRAC 3KP2A 1BOAA 1JHFA 4L0ZB 3B02A 1TBXA 3EDPA 3DKWA 2STTA 2EFQA 3RYPA 4I98B 5LGTA 3BJAA 1P4XA 1Z05A 3GW2A 4B09A 1ZAOA 1ON2A 4GCVA 4IRGA 3R0AA 3G73A 3WGGA 2HYFA 2MD5A 3SZTA 2EK5A 2R7FA 1RUNA 3R4KA 2G9WA 1O3QA 2K86A 1FP1D 4ZYEA 2QWWA 2MLGA 3WTXC 4N9IA 5LGNA 4ENMA 1SFEA 3RI4A 4WK8F 2P5KA 2PFBA 1UCRA 1MJ9A 2M45A 3BPVA 2XGXA 4KYWA 2K7LA 5FO5A 5K5OA 2M8EA 2JPBA 2WV0A 2DBBA 4EQQA 3RKYA 2UXNA 1E17A 5LGUA 2WWYA 4A0XA 2CG4A 5ILSA 1PP8F 1H9TA 2DTRA 4YFXF 2V1UA 1XMKA 4O5VA 1JXSA 2P6TA 3ABTA 2V9VA 4HQMA 1GHCA 1BC8C 2UWMA 4GYGA 1G3SA 3ULQB 2PN6A 1T98A 2KIMA 2RGVA 2PG4A 2OZ6A 2XAFA 5FB2A 3PFIA 4UHTA 1QGPA 1SAXA 3DXJF 1R00A 2R3SA 2GZWA 1HQCA 2XKPA 1R5HA 1YYVA 3MFKA 1W7PB 2HQNA 4LB6B 3I5UA 4HDVA 3SHFA 1HW5A 4M71A 2O3FA 4KIBA 4U0WA 2LNBA 2ISYA 2YX7A 1RNLA 1ULYA 2D45A 1T2KA 4HAMA 3T0YA 3VODA 4DNCA 2MH2A 3TOAA 2NAZA 5FD5A 3KLOA 3HRTA 5D5XB 3GEZA 4B8XA 5FGMA 3L00A 3ELKA 2GA2A 2KJCA 4UNOA 4RB1A 1LDJA 2V1DA 5CVJA 3TGNA 4TV7A 3IC7A 2ACJA 1IXSB 2DFIA 3M1EA 3HOTA 1SD4A 2EFOA 1MJBA 2OQGA 1W5TA 1B4AA 1S7AA 3COAC 3HRUA 3J7AO 2FMYA 2JSCA 4FT8A 4AIJA 5E1ZB 1REPC 1D5VA 5ICCA 5KVRA 4UVBA 4OIQF 2X4HA 3MZHA 2MA3A 4YG2F 5HLIA 3AAFA 1DUXC 3DQVC 1FSEA 1ZYRF 3KEOA 3JAMK 2ZJ2A 3LA2A 1KA8A 4PDKA 4MTDA 5JFRA 3ZPLA 2WTEA 1ZRFA 4M73A 5J8CA 5HLGA 1R1UA 4ENNA 1BC7C 3O2PE 2VC1A 2UZKA 4U7DA 1F1ZA 4U0VA 1W4MA 1YW7A 3CUQC 2GXGA 1FOKA 4ZYGA 2DW4A 3E6BA 5FLXZ 4AIKA 1FBQA 1FC3A 2DT5A 3Q9VA 5D6EA 3KZZA 3ZMVA 4Z2YA 1TQMA 4R79A 3GX4X 4I09A 5H6QA 3E6MA 1TTYA 2RVCA 4IPAA 4KICA 2XAGA 4KMUX 1O7FA 3MAJA 2A6EF 2Q2EA 4A2UA 2OA4A 4XLPF 4LLGF 3KP6A 1MDMB 1ZLKA 1B9MA 1CGPA 3HYIA 4CHUA 2ADUA 1XDSA 3CO6C 2XRNA 2DLLA 2DI3A 2GAUA 1KQ8A 4G94A 3K0LA 4JBAA 3L09A 3F22A 5AIQA 4L9NA 4PZJA 5D5UB 3F6VA 3WTTC 4LG0A 3V8JA 5D4RA 2BE5F 2FRHA 2EV6A 3C1DA 2WC2A 2ZMEB 2O0YA 1O3TA 3P9CA 2FOKA 4P96A 1QPMA 2V1XA 4I7HA 3IKTA 1GXPA 1FZPB 4BQAA 5E17F 4HOBA 2PQ8A 1XD7A 3K1NA 3LA7A 3J80Z 1ZGJA 3WG9A 3GLXA 3IRQA 4M6XA 5LHGA 3RJPA 3DP7A 3V4GA 1V4RA 2GIVA 2O03A 4IF4A 3I59A 2QYOA 4AIHA 2HEOA 3GVAA 3T8TA 4HLYA 4BHBA 1IF1A 1SD7A 1TQPA 2HFHA 4LK1F 1EH7A 5ICFA 2EFWA 4CICA 4RB3C 2E1NA 2Y48A 2JPCA 2PBIA 3EUHA 4BHPA 5CLSA 5K5QA 2QVOA 1D8JA 2HGCA 4ENJA 2LF8A 2OQRA 3FZVA 3BY6A 3C3WA 5K1YA 4IHSA 3T1BA 3TKYA 2NYXA 3F23A 1W5SA 4M9ZA 2ZXJA 1T39A 4EM2A 4A5MA 4YFKF 3LQQA 4P9UA 2W25A 3HTSB 1LDKB 2GWRA 2XVCA 3HSRA 1Z6TA 4AVPA 3FHZA 3TDZC 2P5VA 1TLHB 1WQ2A 4IVNA 1R22A 3TOBA 4L9VA 3MEXA 1WRJA 3GO5A 3WU0A 4U7BA 4U88A 3F8NA 5LEKA 3F6OA 3WTVC 1BJAA 5EEHA 3F8MA 3WE3A 1S29A 3I64A 2P8TA 2ZNZA 1U2WA 3FXQA 2VBZA 1A04A 2CW0F 2G7HA 1G3TA 1KQ9A 3NQOA 3EYIA 3I58A 2DK8A 1I1GA 3VB2A 2Q0OA 1YFHA 2PJPA 5CJ9A 3WGHA 3L7WA 3TO9A 3HIFA 3Q9SA 1F4KA 2HS5A 1RZ4A 1DPUA 2XAQA 1R7JA 1LDDA 5CVRA 1SD5A 2DQLA 4Y15A 1P4AA 1R5GA 5FD6A 1R1TA 1U8RA 5DCMB 2XIGA 3CO7C 4LK0F 3KEQA 2M30A 3FMRA 3KETA 3C7JA 3WTZA 2L02A 2Z3YA 5LLQA 2MC3A 5DUIA 3LAPA 4BAYA 5E1XA 1HSJA 1MJAA 3REOA 1KGSA 3SQNA 2AXLA 5J6XA 1DDNA 2M87A 1KYWA 4XSXF 3EYYA 3QRFF 4AWXB 2HDCA 1G6NA 3R0JA 2NNYA 4UV9A 4EJWA 3SZPA 2MH9A 1U5TA 2K4BA 3QU6A 4N9HA 4WXDA 3W6KB 3O3KA 3JSOA 2JZYA 5A2QZ 3BJ6A 1XSVA 2A3SA 4A0ZA 4CXFA 4G8XA 4EJOA 2P5LC 1UB9A 4NQWA 3WTSC 2KIFA 1XSXA 5FLXK 5JVTA 1J5YA 3EETA 4NB5A 3DF8A 3IKVA 4S04A 5LRSA 1IN6A 3QAHA 3HUGA 5H20A 1BI1A 5D5VB 1QQIA 3E6CC 2CO5A 1Q1HA 3KP4A 5D4SA 2PI0A 3V8KA 4CGZA 1CF7A 2DO7A 2A07F 4M72A 3LAJA 1UHWA 2K02A 1ZREA 3K2ZA 1S6LA 2L01A 1MZBA 4A0YA 1T38A 2M1BA 1JHHA 3MQ0A 1BI0A 3LFKA 3WTWC 2K4JA 2D2WA 2HKOA 1WSUA 2EA2A 1O7LA 4LMYA 4CO8A 4HF0A 1USTA 3GFIA 2LKPA 2A61A 1ZARA 1K78B 2VT2A 4Q5SF 1L3LA 2A5YB 1SFXA 2Z99A 4RAZA 2P4WA 5D8KB 3GZ5A 3GUDA 3CUQA 1NHAA 1HSTA 3HRMA 1D3YA 2BYVE 1T6SA 4KN4X 1BN5A 3IRRA 4HYEA 2B0LA 4PCQA 1FX7A 5FFXA 3I54A 2RKHA 3BOQA 3QPHA 3E5XA 2VONA 3LA3A 1S3JA 3DPTA 2IVMA 5D8LB 1U5TC 5HDGA 3J80K 2STWA 1LEBA 4L5IA 2O6GE 2QQBA 1UFMA 2KIUA 1ON1A 5BPIA 3WODF 4D0PA 2J5OA 4ESFA 2FEZA 1C0WA 1LQ1A 3ZN0A 4OIRF 1U78A 2KJBA 3NEUA 2PMHA 3H92A 4ON0A 4IJAA 4JK1X 5F1RA 2V79A 4MEYF 2FA5A 3JSPA 2NNNA 1ZN2A 4P5OA 1BI3A 4OIOF 2H94A 4RB2C 1YQAA 4I0BA 3E5UA 5K5RA 3D5LA 3PQKA 4HBLA 3OV8A 1IRGA 2XHKA 2AS5F 4HX8A 4I02A 3BJOA 1FWZA 2HYGD 3I53A 1R1VA 1KU3A 2HQRA 1O57A 1QZYA 1YTYA 1D8KA 1BM9A 2GQQA 5KK1A 2OAZA 5E18F 4CZZA 2JTVA 2QQ9A 1SFUA 4QWQA 3ZN1A 1XGNA 5HS8A 2QBYA 4A6EA 3P9IA 4F7ZA 1H0MA 4MGRA 2ZCWA 2OD5A 3BDDA 4KMFA 5DUKA 4OOIA 1RI7A 3GWZA 4LGWA 3V7SA 5TRDA 2IT0A 5L3CA 4GXOA 2EFPA 3VFZA 1XCVA 2TDXA 3CJNA 3QU3A 4H0EA 2O8XA 2V6CA 2RN7A 4RGXA 1KU7A 1HW2A 3KLNA 1QO0D 3E5QA 2FU4A 3TO7A 4EJVA 1O3RA 3BZ6A 2BGCA 1XMAA 1HKTA 3HTUA 4RB0A 2ZBKA 4AD9A 1WKMA 4GO1A 4FX4A 5E20A 1B6AA 2Z9OA 2R7DA 1J0RA 1ZLJA 3PQJA 4EGYA 2G7UA 2VBWA 2QLZA 4P55A 3ZMTA 2DU9A 5L3EA 1OR7A 2H27A 4RGRA 3M9AA 4M74A 5BQTA 3F21A 3F8CA 4RGSA 4G7ZF 1XB4A 2L54A 4KFCA 4N0BA 1K6OA 1R58A 3QPTA 3FX3A 2VBXA 3R60A 4L9JA 2RNJA 1AWCA 1RUOA 1YS6A 2QZ8A 3FM3A 1OKRA 1BBYA 3V7CA 1EV7A 5DV5A 4OMYA 5A2QK 2E7XA 4XLNF 3FF5A 1GVJA 2VN2A 1IN5A 4Q48A 2DK5A 3JTGA 3M8EA 1OYIA 2CGPA 2EB7A 2O61A 3EQLF 3RTRA 4LLNA 2KRFA 4EM1A 3SFZA 4XSZF 1YW9A 4KDPA 1FY7A 2KKOA 1GXQA 2FNPA 2RV8A 3H3UA 3IWFA 4HLXA 3TQNA 3WTUC 4P9FA 1QBJA 3T8RA 5ERIA 1S8NA 3R61A 5CYVA 1F5TA 1PP7U 2HWVA 5AIPA 4HV5A 3ZQ7A 5JR3A 4MQ9F 1KU9A 1K79A 4MQVA 3V8LA 1MGTA 3R6SA 4ZZLA 4LD5A 2VOOA 2NS0A 1HBXG 1ZHFA 1IN8A 5DCFA 4ESJA 2J5PA 4WCGA 3J81Z 1TNTA 1E2XA 4UVCA 3JTHA 3TO6A 2IPQX 2XAJA 3L9FA 2RQPA 3ZMZA 1ZG1A 1DP7P 1XGSA 1JGSA 1EH6A 4FHTA 1SMYF 3CTAA 1LVAA 1G3WA 5LBQA 2E1CA 3E3VA 5LHIA 2Z33A 4HQEA 5ICEA 3HHHA 3FMQA 1ZGAA 4R8HA 2LF7A 4M6YA 3MCZA 2IA1A 2L4MA 3GFMA 4G9YA 2COMA 4U0YA 3DEUA 2CQKA 3ZP5A 5ED4A 3RPUA 2ELHA 4MEXF 3RKXA 1V3FA 2VE8A 4WF2A 3K69A 2QENA 2IA2A 1IN4A 1XDUA 1Z7UA 1FPQA 1HXDA 4Y17A 4KIFA 2FNAA 2A6HF 4DQ2A 4S05A 2YR2A 4A12A 3B73A 5ILVA 1YW8A 4UUVA 4BNCA 5DD8A 4EJTA 2BEOA 2H6BA 2VBYA 4LG0B 5IT9Z 3GF2A 1W7PA 2FXAA 2L3DA 4OINF 5LEJA 4EVIA 4ZYDA 1AOYA 4LLLA 5J8FA 4WX9A 2W85A 1P92A 3WGIA 1BIAA 1YO5C 5HDNA 4PGGA 1HKQA 3P9KA 1FBSA 3FXUA 2A68F 4YIIA 5IT3A 2DPUA 3NRVA 1JE8A 4RAYA 1F9NA 2H6CA 4GGGA 2EA4A 3KCCA 2E7WA 3K1MA 2ESNA 3I59B 3RDIA 3DPLC 2HKXA 1Y0UA 2ZKZA 1Z6RA 4EM0B 3VEPA 4BXUA 4LB5A 2VOPA 2K27A 2YPRA 3OOPA 3I4PA 2YU3A 4LFUA 1STZA 4BYYA 2OU2A 4FX0A 1B1BA 3BROA 2F5FA 2RC4A 4EGZA 2Q8KA 5LRRA 3O6BB 5HS9A 1IXRC 1PDNC 1FP2A 3M8FA 5DEQA 2D1HA 2ZNYA 4Q4ZF 3KP7A 3I71A 3HSEA 3IL2A 4E70A 3RYRA 3HOSA 5F64A 4KA4A 1R36A 4NHJA 1R23A 2FQ3A 2HOEA 2YX4A 4KT5C 3L2CA 2HR3A 3M7GA 4HF1A 4QLCU 3K1PA 2XUBA 1I27A 3KZYA 3RIRA 4I2OA 2X0LA 1LJ9A 4JQFA 4A5NA 5LHHA 3ZMDA 3ZMUA 1J9IA 3WTYC 4CDGA 3GZ6A 2DPDA 1MDMA 4RGUA 3F72A 5BMZA 3HHGA 1H9GA 3IWZA 2F5EA 1FYLA 3HRSA 3ROUA 3U1DA 2OZUA 1J59A 2DQRA 2P7CB 4Y13A 1KYZA 3GXOA 2GA1A 4WXHA 5D6FA 1I6XA 1ZRDA 2LDUA 1IN7A 4XRFA 5E8IA 1FT9A 2VC0A 4HW0A 4L0YB 1Z1DA 1LB2A 3SXYA 2L4AA 2HTJA 3C18A 2BV6A 2ZMEA 5L3FA 3MZYA 1J7KA 2PLYA 4ASNA 5HOOA 1G4DA 1KQ0A 3V7RA 1EH8A 4YIFA 1PUEE 2FF4A 4M9SA 1OYWA 1IW7F 2ISZA 2IRFG 4IRIA 2FSWA 1ZG5A 2XASA 5HVQC 2BBYA 1U5TB 2MBFA 5CVVA 2HTSA 3LQRA 4HX7A 2IW5A 2JT1A 2XV4S 2IA0A 4HDUA 4GYIA 2EWNA 5TJJA 1O3SA 2QQAA 3J81K 1TQIA 4BHCA 3KP5A 1XGMA 3I0TA 1LNWA 2EJRA 1J75A 3FMSA 3S2WA 4OU0A 5HS7A 5JI6A 1QZZA 2CFXA 4O3MA 2F2EA 5HLHA 5D5WB 5L3DA 5E8GA 2EFNA 1MKMA 3BP8A 3KFWX 2A69F 4ESBA 3QOPA 2XAHA 5L3GA 3P7NA 5EEGA 4KNYA 1KU2A 3HSFA 1CF7B 1T0FA 6PAXA 1FSHA 1U3EM 5E1WA 1MD0A 1ODDA 2MLKA 3WU1B 1ZG3A 1IXCA 3GYHX 4KIGA 4IHTA 3TDUC 2H09A 4I0AA 2P7VB 1XSDA 4IXAA 2JRTA 4OIPF 4HV6A 4MHGA 3DFGA 1Z91A 2FE3A 3E97A 1B59A 1G3YA 2DAOA 1XGOA 5IT9K 2W24A 3CUQB 2FBKA 2ETHA 2VODA 5ILUA 3LWFA 4O6JA 5L3BA 4EMSA 2VT3A 4OMZA 4ZH4F 2CYYA 5DD4A 3ZMSA 1SMTA 3LSTA 1P2FA 1K7AA 1TW3A 2FBHA 3CLOA 3RPQA 3ECOA 2W84A 1L0OC 2F5DA 5FFZA 3GFJA 3F8BA 4WXCA 3CUOA 3QP5A 5DCMA 2C6YA 1RIOH 3KE2A 2Y75A 1UHMA 4UXNA 4Q47A 4EV0A 5BS6A 2EV0A 5H6RA 4EJUA 1BIBA 1WWXA 1SD6A 5CVUA 1IUYA 3ABUA 1P4WA 1OPCA 1FYKA 1HW1A 2F5CA 4XBFA 3ERED 5BOXA 1WI9A 4G7OF 5F6FA 4M9XA 5BPDA 1FBUA 1YS7A 1LEAA 3F3XA 1IRFA 5ICGA 4ETSA 1YG2A 3BWGA 2QBYB 2D1VA 2UXXA 3U2RA 2GXBA 3WE2A 3U9GA 4R1HA 1IAWA 3F8FA 2P6SA 1FYMA 2OBPA 4HZFA 4I01A 4YFNF 3T5XA 3H3ZA 3Q5FA 1U6GA 2M5WA 1ONVA 3K9TA 4A6DA 3QP6A 1YIOA 2IP2A 1P6RA 1XN7A 1USSA 4L9TA 3W6JB 2Z5UA 2RDPA 3VOEA 5CVIA 4L18B 2ESHA 3ECHA 5DYMA 3JAMZ 4CYDA 3E6DA 1W7PD 1K78A 1ZH5A 1S7OA 1J2XA 1HKSA 1X3UA 2CSOA 4MNUA 1I1SA 2FBIA 3D0SA 4ZZDA 2PEXA 4MTEA 1YLFA 2FMLA 3FXRA 2ZFWA 4LJZF 1FLIA 3RKWA 5JHUA 1DPRA 2Y0MA 4G7HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVA A;  2XKO A;  2QM3 A;  1OYY A;  3ISP A;  2QUF A;  2PMU A;  4L5J A;  2VXZ A;  3GFL A;  1Z9C A;  3IHU A;  4IRH A;  2IJL A;  1ZRC A;  3KP3 A;  4KUM A;  1OMI A;  4HX4 A;  1TW2 A;  4BH9 A;  3BPX A;  4G6Q A;  3MWM A;  1IZ1 A;  4ENK A;  4RS8 A;  4PGH A;  4ZYH A;  2CWE A;  2XRO A;  3DV8 A;  1B9N A;  1VTN C;  2W57 A;  2VE9 A;  3FWE A;  2YSR A;  4WWC A;  3ML6 A;  3N97 A;  1QNT A;  3JW4 A;  4K2E A;  3CDH A;  4UV8 A;  4HA8 A;  4HF2 A;  1I5Z A;  1TNS A;  3N4M A;  1BI2 A;  2ZO4 A;  2HZT A;  2EV5 A;  5AON A;  3FM5 A;  2LSO A;  5DDG A;  1XCB A;  5HDK A;  3G3Z A;  1FNN A;  4KN7 X;  4G6D A;  2NRA C;  3KP2 A;  1BOA A;  1JHF A;  4L0Z B;  3B02 A;  1TBX A;  3EDP A;  3DKW A;  2STT A;  2EFQ A;  3RYP A;  4I98 B;  5LGT A;  3BJA A;  1P4X A;  1Z05 A;  3GW2 A;  4B09 A;  1ZAO A;  1ON2 A;  4GCV A;  4IRG A;  3R0A A;  3G73 A;  3WGG A;  2HYF A;  2MD5 A;  3SZT A;  2EK5 A;  2R7F A;  1RUN A;  3R4K A;  2G9W A;  1O3Q A;  2K86 A;  1FP1 D;  4ZYE A;  2QWW A;  2MLG A;  3WTX C;  4N9I A;  5LGN A;  4ENM A;  1SFE A;  3RI4 A;  4WK8 F;  2P5K A;  2PFB A;  1UCR A;  1MJ9 A;  2M45 A;  3BPV A;  2XGX A;  4KYW A;  2K7L A;  5FO5 A;  5K5O A;  2M8E A;  2JPB A;  2WV0 A;  2DBB A;  4EQQ A;  3RKY A;  2UXN A;  1E17 A;  5LGU A;  2WWY A;  4A0X A;  2CG4 A;  5ILS A;  1PP8 F;  1H9T A;  2DTR A;  4YFX F;  2V1U A;  1XMK A;  4O5V A;  1JXS A;  2P6T A;  3ABT A;  2V9V A;  4HQM A;  1GHC A;  1BC8 C;  2UWM A;  4GYG A;  1G3S A;  3ULQ B;  2PN6 A;  1T98 A;  2KIM A;  2RGV A;  2PG4 A;  2OZ6 A;  2XAF A;  5FB2 A;  3PFI A;  4UHT A;  1QGP A;  1SAX A;  3DXJ F;  1R00 A;  2R3S A;  2GZW A;  1HQC A;  2XKP A;  1R5H A;  1YYV A;  3MFK A;  1W7P B;  2HQN A;  4LB6 B;  3I5U A;  4HDV A;  3SHF A;  1HW5 A;  4M71 A;  2O3F A;  4KIB A;  4U0W A;  2LNB A;  2ISY A;  2YX7 A;  1RNL A;  1ULY A;  2D45 A;  1T2K A;  4HAM A;  3T0Y A;  3VOD A;  4DNC A;  2MH2 A;  3TOA A;  2NAZ A;  5FD5 A;  3KLO A;  3HRT A;  5D5X B;  3GEZ A;  4B8X A;  5FGM A;  3L00 A;  3ELK A;  2GA2 A;  2KJC A;  4UNO A;  4RB1 A;  1LDJ A;  2V1D A;  5CVJ A;  3TGN A;  4TV7 A;  3IC7 A;  2ACJ A;  1IXS B;  2DFI A;  3M1E A;  3HOT A;  1SD4 A;  2EFO A;  1MJB A;  2OQG A;  1W5T A;  1B4A A;  1S7A A;  3COA C;  3HRU A;  3J7A O;  2FMY A;  2JSC A;  4FT8 A;  4AIJ A;  5E1Z B;  1REP C;  1D5V A;  5ICC A;  5KVR A;  4UVB A;  4OIQ F;  2X4H A;  3MZH A;  2MA3 A;  4YG2 F;  5HLI A;  3AAF A;  1DUX C;  3DQV C;  1FSE A;  1ZYR F;  3KEO A;  3JAM K;  2ZJ2 A;  3LA2 A;  1KA8 A;  4PDK A;  4MTD A;  5JFR A;  3ZPL A;  2WTE A;  1ZRF A;  4M73 A;  5J8C A;  5HLG A;  1R1U A;  4ENN A;  1BC7 C;  3O2P E;  2VC1 A;  2UZK A;  4U7D A;  1F1Z A;  4U0V A;  1W4M A;  1YW7 A;  3CUQ C;  2GXG A;  1FOK A;  4ZYG A;  2DW4 A;  3E6B A;  5FLX Z;  4AIK A;  1FBQ A;  1FC3 A;  2DT5 A;  3Q9V A;  5D6E A;  3KZZ A;  3ZMV A;  4Z2Y A;  1TQM A;  4R79 A;  3GX4 X;  4I09 A;  5H6Q A;  3E6M A;  1TTY A;  2RVC A;  4IPA A;  4KIC A;  2XAG A;  4KMU X;  1O7F A;  3MAJ A;  2A6E F;  2Q2E A;  4A2U A;  2OA4 A;  4XLP F;  4LLG F;  3KP6 A;  1MDM B;  1ZLK A;  1B9M A;  1CGP A;  3HYI A;  4CHU A;  2ADU A;  1XDS A;  3CO6 C;  2XRN A;  2DLL A;  2DI3 A;  2GAU A;  1KQ8 A;  4G94 A;  3K0L A;  4JBA A;  3L09 A;  3F22 A;  5AIQ A;  4L9N A;  4PZJ A;  5D5U B;  3F6V A;  3WTT C;  4LG0 A;  3V8J A;  5D4R A;  2BE5 F;  2FRH A;  2EV6 A;  3C1D A;  2WC2 A;  2ZME B;  2O0Y A;  1O3T A;  3P9C A;  2FOK A;  4P96 A;  1QPM A;  2V1X A;  4I7H A;  3IKT A;  1GXP A;  1FZP B;  4BQA A;  5E17 F;  4HOB A;  2PQ8 A;  1XD7 A;  3K1N A;  3LA7 A;  3J80 Z;  1ZGJ A;  3WG9 A;  3GLX A;  3IRQ A;  4M6X A;  5LHG A;  3RJP A;  3DP7 A;  3V4G A;  1V4R A;  2GIV A;  2O03 A;  4IF4 A;  3I59 A;  2QYO A;  4AIH A;  2HEO A;  3GVA A;  3T8T A;  4HLY A;  4BHB A;  1IF1 A;  1SD7 A;  1TQP A;  2HFH A;  4LK1 F;  1EH7 A;  5ICF A;  2EFW A;  4CIC A;  4RB3 C;  2E1N A;  2Y48 A;  2JPC A;  2PBI A;  3EUH A;  4BHP A;  5CLS A;  5K5Q A;  2QVO A;  1D8J A;  2HGC A;  4ENJ A;  2LF8 A;  2OQR A;  3FZV A;  3BY6 A;  3C3W A;  5K1Y A;  4IHS A;  3T1B A;  3TKY A;  2NYX A;  3F23 A;  1W5S A;  4M9Z A;  2ZXJ A;  1T39 A;  4EM2 A;  4A5M A;  4YFK F;  3LQQ A;  4P9U A;  2W25 A;  3HTS B;  1LDK B;  2GWR A;  2XVC A;  3HSR A;  1Z6T A;  4AVP A;  3FHZ A;  3TDZ C;  2P5V A;  1TLH B;  1WQ2 A;  4IVN A;  1R22 A;  3TOB A;  4L9V A;  3MEX A;  1WRJ A;  3GO5 A;  3WU0 A;  4U7B A;  4U88 A;  3F8N A;  5LEK A;  3F6O A;  3WTV C;  1BJA A;  5EEH A;  3F8M A;  3WE3 A;  1S29 A;  3I64 A;  2P8T A;  2ZNZ A;  1U2W A;  3FXQ A;  2VBZ A;  1A04 A;  2CW0 F;  2G7H A;  1G3T A;  1KQ9 A;  3NQO A;  3EYI A;  3I58 A;  2DK8 A;  1I1G A;  3VB2 A;  2Q0O A;  1YFH A;  2PJP A;  5CJ9 A;  3WGH A;  3L7W A;  3TO9 A;  3HIF A;  3Q9S A;  1F4K A;  2HS5 A;  1RZ4 A;  1DPU A;  2XAQ A;  1R7J A;  1LDD A;  5CVR A;  1SD5 A;  2DQL A;  4Y15 A;  1P4A A;  1R5G A;  5FD6 A;  1R1T A;  1U8R A;  5DCM B;  2XIG A;  3CO7 C;  4LK0 F;  3KEQ A;  2M30 A;  3FMR A;  3KET A;  3C7J A;  3WTZ A;  2L02 A;  2Z3Y A;  5LLQ A;  2MC3 A;  5DUI A;  3LAP A;  4BAY A;  5E1X A;  1HSJ A;  1MJA A;  3REO A;  1KGS A;  3SQN A;  2AXL A;  5J6X A;  1DDN A;  2M87 A;  1KYW A;  4XSX F;  3EYY A;  3QRF F;  4AWX B;  2HDC A;  1G6N A;  3R0J A;  2NNY A;  4UV9 A;  4EJW A;  3SZP A;  2MH9 A;  1U5T A;  2K4B A;  3QU6 A;  4N9H A;  4WXD A;  3W6K B;  3O3K A;  3JSO A;  2JZY A;  5A2Q Z;  3BJ6 A;  1XSV A;  2A3S A;  4A0Z A;  4CXF A;  4G8X A;  4EJO A;  2P5L C;  1UB9 A;  4NQW A;  3WTS C;  2KIF A;  1XSX A;  5FLX K;  5JVT A;  1J5Y A;  3EET A;  4NB5 A;  3DF8 A;  3IKV A;  4S04 A;  5LRS A;  1IN6 A;  3QAH A;  3HUG A;  5H20 A;  1BI1 A;  5D5V B;  1QQI A;  3E6C C;  2CO5 A;  1Q1H A;  3KP4 A;  5D4S A;  2PI0 A;  3V8K A;  4CGZ A;  1CF7 A;  2DO7 A;  2A07 F;  4M72 A;  3LAJ A;  1UHW A;  2K02 A;  1ZRE A;  3K2Z A;  1S6L A;  2L01 A;  1MZB A;  4A0Y A;  1T38 A;  2M1B A;  1JHH A;  3MQ0 A;  1BI0 A;  3LFK A;  3WTW C;  2K4J A;  2D2W A;  2HKO A;  1WSU A;  2EA2 A;  1O7L A;  4LMY A;  4CO8 A;  4HF0 A;  1UST A;  3GFI A;  2LKP A;  2A61 A;  1ZAR A;  1K78 B;  2VT2 A;  4Q5S F;  1L3L A;  2A5Y B;  1SFX A;  2Z99 A;  4RAZ A;  2P4W A;  5D8K B;  3GZ5 A;  3GUD A;  3CUQ A;  1NHA A;  1HST A;  3HRM A;  1D3Y A;  2BYV E;  1T6S A;  4KN4 X;  1BN5 A;  3IRR A;  4HYE A;  2B0L A;  4PCQ A;  1FX7 A;  5FFX A;  3I54 A;  2RKH A;  3BOQ A;  3QPH A;  3E5X A;  2VON A;  3LA3 A;  1S3J A;  3DPT A;  2IVM A;  5D8L B;  1U5T C;  5HDG A;  3J80 K;  2STW A;  1LEB A;  4L5I A;  2O6G E;  2QQB A;  1UFM A;  2KIU A;  1ON1 A;  5BPI A;  3WOD F;  4D0P A;  2J5O A;  4ESF A;  2FEZ A;  1C0W A;  1LQ1 A;  3ZN0 A;  4OIR F;  1U78 A;  2KJB A;  3NEU A;  2PMH A;  3H92 A;  4ON0 A;  4IJA A;  4JK1 X;  5F1R A;  2V79 A;  4MEY F;  2FA5 A;  3JSP A;  2NNN A;  1ZN2 A;  4P5O A;  1BI3 A;  4OIO F;  2H94 A;  4RB2 C;  1YQA A;  4I0B A;  3E5U A;  5K5R A;  3D5L A;  3PQK A;  4HBL A;  3OV8 A;  1IRG A;  2XHK A;  2AS5 F;  4HX8 A;  4I02 A;  3BJO A;  1FWZ A;  2HYG D;  3I53 A;  1R1V A;  1KU3 A;  2HQR A;  1O57 A;  1QZY A;  1YTY A;  1D8K A;  1BM9 A;  2GQQ A;  5KK1 A;  2OAZ A;  5E18 F;  4CZZ A;  2JTV A;  2QQ9 A;  1SFU A;  4QWQ A;  3ZN1 A;  1XGN A;  5HS8 A;  2QBY A;  4A6E A;  3P9I A;  4F7Z A;  1H0M A;  4MGR A;  2ZCW A;  2OD5 A;  3BDD A;  4KMF A;  5DUK A;  4OOI A;  1RI7 A;  3GWZ A;  4LGW A;  3V7S A;  5TRD A;  2IT0 A;  5L3C A;  4GXO A;  2EFP A;  3VFZ A;  1XCV A;  2TDX A;  3CJN A;  3QU3 A;  4H0E A;  2O8X A;  2V6C A;  2RN7 A;  4RGX A;  1KU7 A;  1HW2 A;  3KLN A;  1QO0 D;  3E5Q A;  2FU4 A;  3TO7 A;  4EJV A;  1O3R A;  3BZ6 A;  2BGC A;  1XMA A;  1HKT A;  3HTU A;  4RB0 A;  2ZBK A;  4AD9 A;  1WKM A;  4GO1 A;  4FX4 A;  5E20 A;  1B6A A;  2Z9O A;  2R7D A;  1J0R A;  1ZLJ A;  3PQJ A;  4EGY A;  2G7U A;  2VBW A;  2QLZ A;  4P55 A;  3ZMT A;  2DU9 A;  5L3E A;  1OR7 A;  2H27 A;  4RGR A;  3M9A A;  4M74 A;  5BQT A;  3F21 A;  3F8C A;  4RGS A;  4G7Z F;  1XB4 A;  2L54 A;  4KFC A;  4N0B A;  1K6O A;  1R58 A;  3QPT A;  3FX3 A;  2VBX A;  3R60 A;  4L9J A;  2RNJ A;  1AWC A;  1RUO A;  1YS6 A;  2QZ8 A;  3FM3 A;  1OKR A;  1BBY A;  3V7C A;  1EV7 A;  5DV5 A;  4OMY A;  5A2Q K;  2E7X A;  4XLN F;  3FF5 A;  1GVJ A;  2VN2 A;  1IN5 A;  4Q48 A;  2DK5 A;  3JTG A;  3M8E A;  1OYI A;  2CGP A;  2EB7 A;  2O61 A;  3EQL F;  3RTR A;  4LLN A;  2KRF A;  4EM1 A;  3SFZ A;  4XSZ F;  1YW9 A;  4KDP A;  1FY7 A;  2KKO A;  1GXQ A;  2FNP A;  2RV8 A;  3H3U A;  3IWF A;  4HLX A;  3TQN A;  3WTU C;  4P9F A;  1QBJ A;  3T8R A;  5ERI A;  1S8N A;  3R61 A;  5CYV A;  1F5T A;  1PP7 U;  2HWV A;  5AIP A;  4HV5 A;  3ZQ7 A;  5JR3 A;  4MQ9 F;  1KU9 A;  1K79 A;  4MQV A;  3V8L A;  1MGT A;  3R6S A;  4ZZL A;  4LD5 A;  2VOO A;  2NS0 A;  1HBX G;  1ZHF A;  1IN8 A;  5DCF A;  4ESJ A;  2J5P A;  4WCG A;  3J81 Z;  1TNT A;  1E2X A;  4UVC A;  3JTH A;  3TO6 A;  2IPQ X;  2XAJ A;  3L9F A;  2RQP A;  3ZMZ A;  1ZG1 A;  1DP7 P;  1XGS A;  1JGS A;  1EH6 A;  4FHT A;  1SMY F;  3CTA A;  1LVA A;  1G3W A;  5LBQ A;  2E1C A;  3E3V A;  5LHI A;  2Z33 A;  4HQE A;  5ICE A;  3HHH A;  3FMQ A;  1ZGA A;  4R8H A;  2LF7 A;  4M6Y A;  3MCZ A;  2IA1 A;  2L4M A;  3GFM A;  4G9Y A;  2COM A;  4U0Y A;  3DEU A;  2CQK A;  3ZP5 A;  5ED4 A;  3RPU A;  2ELH A;  4MEX F;  3RKX A;  1V3F A;  2VE8 A;  4WF2 A;  3K69 A;  2QEN A;  2IA2 A;  1IN4 A;  1XDU A;  1Z7U A;  1FPQ A;  1HXD A;  4Y17 A;  4KIF A;  2FNA A;  2A6H F;  4DQ2 A;  4S05 A;  2YR2 A;  4A12 A;  3B73 A;  5ILV A;  1YW8 A;  4UUV A;  4BNC A;  5DD8 A;  4EJT A;  2BEO A;  2H6B A;  2VBY A;  4LG0 B;  5IT9 Z;  3GF2 A;  1W7P A;  2FXA A;  2L3D A;  4OIN F;  5LEJ A;  4EVI A;  4ZYD A;  1AOY A;  4LLL A;  5J8F A;  4WX9 A;  2W85 A;  1P92 A;  3WGI A;  1BIA A;  1YO5 C;  5HDN A;  4PGG A;  1HKQ A;  3P9K A;  1FBS A;  3FXU A;  2A68 F;  4YII A;  5IT3 A;  2DPU A;  3NRV A;  1JE8 A;  4RAY A;  1F9N A;  2H6C A;  4GGG A;  2EA4 A;  3KCC A;  2E7W A;  3K1M A;  2ESN A;  3I59 B;  3RDI A;  3DPL C;  2HKX A;  1Y0U A;  2ZKZ A;  1Z6R A;  4EM0 B;  3VEP A;  4BXU A;  4LB5 A;  2VOP A;  2K27 A;  2YPR A;  3OOP A;  3I4P A;  2YU3 A;  4LFU A;  1STZ A;  4BYY A;  2OU2 A;  4FX0 A;  1B1B A;  3BRO A;  2F5F A;  2RC4 A;  4EGZ A;  2Q8K A;  5LRR A;  3O6B B;  5HS9 A;  1IXR C;  1PDN C;  1FP2 A;  3M8F A;  5DEQ A;  2D1H A;  2ZNY A;  4Q4Z F;  3KP7 A;  3I71 A;  3HSE A;  3IL2 A;  4E70 A;  3RYR A;  3HOS A;  5F64 A;  4KA4 A;  1R36 A;  4NHJ A;  1R23 A;  2FQ3 A;  2HOE A;  2YX4 A;  4KT5 C;  3L2C A;  2HR3 A;  3M7G A;  4HF1 A;  4QLC U;  3K1P A;  2XUB A;  1I27 A;  3KZY A;  3RIR A;  4I2O A;  2X0L A;  1LJ9 A;  4JQF A;  4A5N A;  5LHH A;  3ZMD A;  3ZMU A;  1J9I A;  3WTY C;  4CDG A;  3GZ6 A;  2DPD A;  1MDM A;  4RGU A;  3F72 A;  5BMZ A;  3HHG A;  1H9G A;  3IWZ A;  2F5E A;  1FYL A;  3HRS A;  3ROU A;  3U1D A;  2OZU A;  1J59 A;  2DQR A;  2P7C B;  4Y13 A;  1KYZ A;  3GXO A;  2GA1 A;  4WXH A;  5D6F A;  1I6X A;  1ZRD A;  2LDU A;  1IN7 A;  4XRF A;  5E8I A;  1FT9 A;  2VC0 A;  4HW0 A;  4L0Y B;  1Z1D A;  1LB2 A;  3SXY A;  2L4A A;  2HTJ A;  3C18 A;  2BV6 A;  2ZME A;  5L3F A;  3MZY A;  1J7K A;  2PLY A;  4ASN A;  5HOO A;  1G4D A;  1KQ0 A;  3V7R A;  1EH8 A;  4YIF A;  1PUE E;  2FF4 A;  4M9S A;  1OYW A;  1IW7 F;  2ISZ A;  2IRF G;  4IRI A;  2FSW A;  1ZG5 A;  2XAS A;  5HVQ C;  2BBY A;  1U5T B;  2MBF A;  5CVV A;  2HTS A;  3LQR A;  4HX7 A;  2IW5 A;  2JT1 A;  2XV4 S;  2IA0 A;  4HDU A;  4GYI A;  2EWN A;  5TJJ A;  1O3S A;  2QQA A;  3J81 K;  1TQI A;  4BHC A;  3KP5 A;  1XGM A;  3I0T A;  1LNW A;  2EJR A;  1J75 A;  3FMS A;  3S2W A;  4OU0 A;  5HS7 A;  5JI6 A;  1QZZ A;  2CFX A;  4O3M A;  2F2E A;  5HLH A;  5D5W B;  5L3D A;  5E8G A;  2EFN A;  1MKM A;  3BP8 A;  3KFW X;  2A69 F;  4ESB A;  3QOP A;  2XAH A;  5L3G A;  3P7N A;  5EEG A;  4KNY A;  1KU2 A;  3HSF A;  1CF7 B;  1T0F A;  6PAX A;  1FSH A;  1U3E M;  5E1W A;  1MD0 A;  1ODD A;  2MLK A;  3WU1 B;  1ZG3 A;  1IXC A;  3GYH X;  4KIG A;  4IHT A;  3TDU C;  2H09 A;  4I0A A;  2P7V B;  1XSD A;  4IXA A;  2JRT A;  4OIP F;  4HV6 A;  4MHG A;  3DFG A;  1Z91 A;  2FE3 A;  3E97 A;  1B59 A;  1G3Y A;  2DAO A;  1XGO A;  5IT9 K;  2W24 A;  3CUQ B;  2FBK A;  2ETH A;  2VOD A;  5ILU A;  3LWF A;  4O6J A;  5L3B A;  4EMS A;  2VT3 A;  4OMZ A;  4ZH4 F;  2CYY A;  5DD4 A;  3ZMS A;  1SMT A;  3LST A;  1P2F A;  1K7A A;  1TW3 A;  2FBH A;  3CLO A;  3RPQ A;  3ECO A;  2W84 A;  1L0O C;  2F5D A;  5FFZ A;  3GFJ A;  3F8B A;  4WXC A;  3CUO A;  3QP5 A;  5DCM A;  2C6Y A;  1RIO H;  3KE2 A;  2Y75 A;  1UHM A;  4UXN A;  4Q47 A;  4EV0 A;  5BS6 A;  2EV0 A;  5H6R A;  4EJU A;  1BIB A;  1WWX A;  1SD6 A;  5CVU A;  1IUY A;  3ABU A;  1P4W A;  1OPC A;  1FYK A;  1HW1 A;  2F5C A;  4XBF A;  3ERE D;  5BOX A;  1WI9 A;  4G7O F;  5F6F A;  4M9X A;  5BPD A;  1FBU A;  1YS7 A;  1LEA A;  3F3X A;  1IRF A;  5ICG A;  4ETS A;  1YG2 A;  3BWG A;  2QBY B;  2D1V A;  2UXX A;  3U2R A;  2GXB A;  3WE2 A;  3U9G A;  4R1H A;  1IAW A;  3F8F A;  2P6S A;  1FYM A;  2OBP A;  4HZF A;  4I01 A;  4YFN F;  3T5X A;  3H3Z A;  3Q5F A;  1U6G A;  2M5W A;  1ONV A;  3K9T A;  4A6D A;  3QP6 A;  1YIO A;  2IP2 A;  1P6R A;  1XN7 A;  1USS A;  4L9T A;  3W6J B;  2Z5U A;  2RDP A;  3VOE A;  5CVI A;  4L18 B;  2ESH A;  3ECH A;  5DYM A;  3JAM Z;  4CYD A;  3E6D A;  1W7P D;  1K78 A;  1ZH5 A;  1S7O A;  1J2X A;  1HKS A;  1X3U A;  2CSO A;  4MNU A;  1I1S A;  2FBI A;  3D0S A;  4ZZD A;  2PEX A;  4MTE A;  1YLF A;  2FML A;  3FXR A;  2ZFW A;  4LJZ F;  1FLI A;  3RKW A;  5JHU A;  1DPR A;  2Y0M A;  4G7H F; 
#chains in the Genus database with same CATH topology
 2LYC A;  4UVA A;  3BTI A;  5CQE A;  3MZ8 A;  2LP0 A;  2XKO A;  2QM3 A;  1OYY A;  1LFB A;  2GOX B;  3ISP A;  2QUF A;  2PMU A;  4L5J A;  2HVQ A;  2X6X A;  4M6V A;  2VXZ A;  3GFL A;  1DGR M;  1MMA A;  1D1A A;  1Z9C A;  1N75 A;  3IHU A;  4IRH A;  3RZD J;  2IJL A;  2VXD A;  4XNF A;  4QSH A;  1ZRC A;  3KP3 A;  4KUM A;  4M3E A;  5E3L A;  4BE1 A;  1OMI A;  5IYC J;  4HX4 A;  2M4K A;  2RQQ A;  1TW2 A;  2WAQ N;  4BH9 A;  3H0G J;  3BPX A;  4G6Q A;  3BQY A;  3MWM A;  4ITV A;  1IZ1 A;  4ENK A;  4RS8 A;  3CJT B;  1MBJ A;  4DZP A;  4PGH A;  4ZYH A;  2CWE A;  5FJ8 J;  2XRO A;  2L9R A;  2M34 A;  3KZI C;  1X1A A;  3DV8 A;  2XF6 A;  2W7N A;  1B9N A;  4BS9 A;  1VTN C;  4YEJ A;  1O4X A;  3G2B A;  2W57 A;  1Z67 A;  2VE9 A;  3E0J B;  2WB1 A;  3FWE A;  1YHQ I;  1JUP A;  2YSR A;  4WWC A;  3ML6 A;  4XLC A;  3N97 A;  1QNT A;  3JW4 A;  4K2E A;  4BE0 A;  2HI3 A;  3CDH A;  2ME6 A;  2JA2 A;  3JCU C;  4UV8 A;  2CUJ A;  1MSE C;  2ZXI A;  1D0Z A;  3NWS A;  4HA8 A;  4HNV A;  4HF2 A;  2CV2 A;  1I5Z A;  1TNS A;  4FAS D;  3AKZ A;  2HPI A;  3N4M A;  1BI2 A;  2ZO4 A;  1R5I D;  4HRI A;  5EEA A;  2HZT A;  2EV5 A;  4BE2 A;  3JRG A;  1A36 A;  2X1C A;  4BKX A;  5AON A;  2PJR B;  3FM5 A;  1WH5 A;  2LSO A;  5DDG A;  1IJW C;  3PM1 A;  1XCB A;  2MGQ A;  3TW6 A;  3A0H C;  5HDK A;  3G3Z A;  4UY8 I;  3LSM A;  1FNN A;  4JP0 A;  4KN7 X;  1GT0 C;  4G6D A;  3BR6 A;  2NRA C;  5EZH A;  3S14 J;  3KP2 A;  1BOA A;  1JHF A;  4L0Z B;  3B02 A;  1TBX A;  1ZQ3 P;  3OSF A;  4XKV A;  1W36 D;  3EDP A;  3O8H A;  5M5W J;  3LL7 A;  2X48 A;  3DKW A;  2STT A;  3CP8 A;  2EFQ A;  4PSW A;  4QPO A;  2LLK A;  3RYP A;  2EBI A;  4I98 B;  4XL9 A;  5LGT A;  2M4G A;  1P4X A;  1Z05 A;  3BJA A;  3GW2 A;  4BQQ A;  4B09 A;  1ZAO A;  1ON2 A;  2A6T A;  4GCV A;  4IRG A;  5LD2 C;  3R0A A;  3G73 A;  2ZB9 A;  2M0C A;  1VQM I;  2W48 A;  2K9N A;  2Y0S A;  5J1Y A;  1X19 A;  3WGG A;  4AC0 A;  3M07 A;  2HYF A;  2PX9 A;  2MD5 A;  1ZK8 A;  4MO7 A;  3RCO A;  3SZT A;  2EK5 A;  2R7F A;  1U0J A;  3S3N A;  1RUN A;  3KPH A;  3R4K A;  2EQR A;  4NC6 A;  1ETW A;  2G9W A;  1O3Q A;  2R7S A;  4GFB A;  2K86 A;  4OAZ A;  1FP1 D;  4ZYE A;  4FTH A;  2QWW A;  3FK6 A;  2MLG A;  3WTX C;  4N9I A;  5LGN A;  3TL4 X;  1PJR A;  4ENM A;  1SFE A;  1FMW A;  1LKX A;  3RI4 A;  4WK8 F;  1RPW A;  2P5K A;  1SAN A;  2PFB A;  1UCR A;  2R5Z B;  1MJ9 A;  2EIJ H;  1OCT C;  2M45 A;  3BPV A;  2XGX A;  4KYW A;  2ICW G;  2K7L A;  4UB8 C;  5FO5 A;  5K5O A;  2M8E A;  2JPB A;  2WV0 A;  2VJJ A;  2K9S A;  1YIT I;  2DBB A;  4B4C A;  4EQQ A;  1MW7 A;  3RKY A;  2WAE A;  2UXN A;  2F48 A;  4G6T B;  1E17 A;  5F04 A;  2K85 A;  5E3N A;  2WAF A;  5LGU A;  2WWY A;  2HXO A;  4A0X A;  1S9H A;  2CG4 A;  3JRA A;  2L7F P;  5ILS A;  1PP8 F;  1H9T A;  2DOD A;  3TED A;  2QSF X;  4BAC A;  5B5E C;  2K3P A;  2YUS A;  4PJM A;  2DTR A;  4YFX F;  2HZD A;  2R5Y B;  2V1U A;  1X1D A;  1N25 A;  1XMK A;  4O5V A;  1NTC A;  1JXS A;  2P6T A;  3ABT A;  2V9V A;  4HQM A;  1K6Y A;  3JRD A;  1GHC A;  1BC8 C;  2UWM A;  4GYG A;  1G3S A;  1QA6 A;  1YX5 A;  2PN6 A;  3ULQ B;  5B66 C;  1WH7 A;  1H88 C;  4BBS J;  1T98 A;  1JUM A;  2KIM A;  2RGV A;  2PG4 A;  2OZ6 A;  2XAF A;  3OYG A;  3ZCO A;  5FB2 A;  3BR1 A;  1WVR A;  3PFI A;  4P1W A;  4UHT A;  2VLA A;  1QGP A;  4DBR A;  4W97 A;  1SAX A;  3DPU A;  3DXJ F;  1R00 A;  1VQ8 I;  2R3S A;  2GZW A;  1HQC A;  4M3B A;  2XKP A;  1R5H A;  1YYV A;  2XB0 X;  3MFK A;  1SEU A;  1W7P B;  2HQN A;  2R7U A;  4AVZ A;  1N77 A;  4LB6 B;  1GDT A;  3I5U A;  4HDV A;  3SHF A;  1HW5 A;  2VPL A;  4M71 A;  3H9J A;  2O3F A;  5FKM A;  1VF9 A;  2DA1 A;  4KIB A;  1T33 A;  4B43 A;  2QF7 A;  4U0W A;  2LNB A;  2ISY A;  1MMD A;  2LMD A;  2JWT A;  1RNL A;  2RRE A;  2YX7 A;  5M5X J;  1ULY A;  1YOV B;  2D45 A;  1T2K A;  4HAM A;  3T0Y A;  4ZTF A;  3VOD A;  4DNC A;  2MH2 A;  2WB1 N;  3TOA A;  2NAZ A;  5FD5 A;  1GLN A;  1SVO A;  1X2N A;  3DCF A;  3KLO A;  3ONQ A;  4JX6 A;  5GAG J;  3FK7 A;  3HRT A;  4C2M J;  2ELK A;  5D5X B;  3GEZ A;  4B8X A;  4H4K C;  1VQN I;  1I6H J;  3CZ6 A;  2OPT A;  5EGO A;  2LR8 A;  5FGM A;  3L00 A;  3ELK A;  2GA2 A;  2KJC A;  4UNO A;  1MBG A;  4RB1 A;  1LDJ A;  3MD2 A;  1TWC J;  2V1D A;  5CVJ A;  2K9L A;  3TGN A;  2KP6 A;  4TV7 A;  3IC7 A;  2ACJ A;  1IXS B;  2DFI A;  1JGG A;  2HVR A;  3M1E A;  3HOT A;  4XMY A;  1SD4 A;  3V42 A;  2EFO A;  4M3G A;  1MJB A;  4XOT A;  2KQR A;  1XMX A;  2OQG A;  1W5T A;  1B4A A;  2ECC A;  4J19 A;  1S7A A;  3COA C;  3HRU A;  3J7A O;  2VQG A;  2K9M A;  1SAU A;  4HST A;  1OIS A;  2FMY A;  2JSC A;  4FT8 A;  2R4G A;  4E7H A;  4AIJ A;  5E1Z B;  1REP C;  2BW3 B;  1D5V A;  5ICC A;  5KVR A;  3W2W A;  4II3 A;  4UVB A;  2CUF A;  4OIQ F;  2X4H A;  2EZH A;  4RM2 A;  4ZC3 A;  3MZH A;  2L7M P;  2GBY A;  2VAS A;  2MA3 A;  4YG2 F;  5KHD A;  2LY9 A;  5HLI A;  1X2M A;  4PJL A;  3K2A A;  5FRO A;  3AAF A;  3DQV C;  5GTI C;  1DUX C;  1MMS A;  1FSE A;  3G4S I;  1ZYR F;  3KEO A;  1ZKG A;  3JAM K;  2ZJ2 A;  3LA2 A;  1Z7L A;  5IOZ A;  2Y0S N;  1KA8 A;  4PDK A;  4MTD A;  5JFR A;  3OSG A;  3ZPL A;  2LH9 A;  2WTE A;  3W2A A;  1ZRF A;  4M73 A;  5J8C A;  5HLG A;  1R1U A;  5IPA A;  4HG2 A;  4ENN A;  1BC7 C;  5JHF A;  3O2P E;  2VC1 A;  3KIO A;  2UZK A;  4U7D A;  1J09 A;  4FET A;  4XRS A;  5J47 A;  1F1Z A;  4U0V A;  1W4M A;  1IO2 A;  2HXI A;  1T08 B;  1YW7 A;  1V5E A;  1WPK A;  3CUQ C;  2GXG A;  4XON A;  1ZR2 A;  1FOK A;  2H8R A;  4ZYG A;  3HKZ A;  1GV5 A;  2DW4 A;  4E7L A;  3E6B A;  1MIJ A;  5FLX Z;  5FLV A;  4CCM A;  3CCR I;  1QHH D;  4AIK A;  1FBQ A;  1FC3 A;  2DT5 A;  2QEX I;  3Q9V A;  5D6E A;  2CUZ A;  3KZZ A;  3ZMV A;  5EYR A;  4Z2Y A;  1TQM A;  1S5L C;  4R79 A;  4EEF G;  4C3J J;  3GX4 X;  1OCP A;  4I09 A;  5H6Q A;  2I10 A;  3E6M A;  3BZC A;  1TTY A;  3PIO F;  3S16 J;  2RVC A;  2EH3 A;  4IPA A;  4KJZ A;  4KIC A;  1ETO A;  2BXZ A;  3OYJ A;  3SEQ A;  3GME A;  2E71 A;  2XAG A;  3PIP F;  4KMU X;  1O7F A;  4ZDL A;  3MAJ A;  2A6E F;  5CQG A;  1QVU A;  2Q2E A;  4A2U A;  2GOM A;  2DYR H;  2R0Q C;  2OA4 A;  4XLP F;  4LLG F;  2LFB A;  1GUU A;  3KP6 A;  5M3F J;  1MDM B;  3G1M A;  1ZLK A;  1B9M A;  1XPX A;  2CJJ A;  1CGP A;  1FIA A;  3DTI A;  3HYI A;  4CHU A;  2JK3 A;  1HOM A;  2ADU A;  2OTL I;  2M3A A;  3LMM A;  1XDS A;  3CO6 C;  4AU7 A;  1Y0N A;  1V55 H;  4RAF A;  1T8I A;  2XRN A;  2DLL A;  2DI3 A;  2GAU A;  3TMO A;  1KQ8 A;  4G94 A;  3CCV I;  3FBI B;  3K0L A;  4JBA A;  2E1M C;  5F08 A;  5FLM J;  1JI8 A;  1TL8 A;  3L09 A;  2DTZ A;  3F22 A;  5AIQ A;  1V5F A;  2NS7 A;  4L9N A;  4PZJ A;  5D5U B;  2IS1 A;  3F6V A;  2BHZ A;  3WTT C;  4BJT A;  2F4I A;  4LG0 A;  3V8J A;  3FHN A;  2H8W A;  2KFD A;  5D4R A;  1IV6 A;  2BE5 F;  2FRH A;  4IKF A;  2EV6 A;  3C1D A;  2WC2 A;  2DA7 A;  2ZME B;  2O0Y A;  4NUB A;  1O3T A;  1HDD C;  2LKS A;  3P5J A;  3P9C A;  2FOK A;  1JKR C;  1MSF C;  4P96 A;  2EIM H;  4B44 A;  1QPM A;  2V1X A;  1HLV A;  5K7Z A;  2HDW A;  2B9S A;  4I7H A;  3IKT A;  1BW6 A;  1GXP A;  4UB6 C;  4XM3 A;  2IGK A;  2OV7 A;  4D5C A;  1FZP B;  4BQA A;  3CES A;  5E17 F;  1OCR H;  4HOB A;  3OYI A;  4BY7 J;  2PQ8 A;  1XD7 A;  3K1N A;  1VQ9 I;  3LA7 A;  1W0U A;  3J80 Z;  1M1E B;  3ASO H;  1ZGJ A;  3WG9 A;  3GLX A;  3IRQ A;  4M6X A;  2YU9 J;  5LHG A;  3RJP A;  3DP7 A;  3RSN A;  3V4G A;  2DMQ A;  3CF2 A;  1V4R A;  1JT0 A;  3SFI A;  4X6A J;  3OIP A;  2GIV A;  1H8A C;  4DIQ A;  2O03 A;  4IF4 A;  3I59 A;  2HNH A;  5TIS C;  2QYO A;  4AIH A;  1VZ0 A;  5J4Y A;  4IL6 C;  1SFK A;  3L1P A;  3OYL A;  2QKL B;  2HEO A;  3GVA A;  2XC7 A;  2O8K A;  2K9Q A;  2E34 A;  3T8T A;  4HLY A;  2ME0 A;  4BHB A;  3D5R C;  2MC4 A;  2VB6 A;  4IHV A;  3MKY B;  4XR6 A;  4C2U A;  4RMN A;  1IF1 A;  1SD7 A;  2DMU A;  1TQP A;  1I39 A;  2HFH A;  4LK1 F;  1EH7 A;  5ICF A;  2EFW A;  1TT0 A;  1TC3 C;  4CIC A;  3CJQ B;  3QYE A;  4RB3 C;  2E1N A;  4V2G A;  2Y48 A;  2JPC A;  2PBI A;  3EUH A;  5E3O A;  2LKX A;  4BHP A;  2BVM A;  5CLS A;  5K5Q A;  2QVO A;  1D8J A;  2HGC A;  1K4S A;  3ZGK A;  4ENJ A;  2LF8 A;  2OQR A;  3PSI A;  3S1M J;  3FZV A;  3BY6 A;  3C3W A;  3RKQ A;  2W82 A;  5K1Y A;  4I76 A;  1P7I A;  4IHS A;  5IP6 A;  3T1B A;  2DFH A;  5M3M J;  3TKY A;  2NVQ J;  2HVS A;  2NYX A;  3PL8 A;  3F23 A;  1W5S A;  4M9Z A;  2ZXJ A;  1T39 A;  4EM2 A;  1Y1V J;  4A5M A;  2Q1Z B;  4YFK F;  1OFC X;  1XC5 A;  4IOC F;  2ZXW H;  1Z3Y A;  1MBK A;  2CMP A;  2DJI A;  2MG4 A;  3LQQ A;  5HNH A;  1UAA A;  4P9U A;  2W25 A;  3HTS B;  1LDK B;  2GWR A;  2XVC A;  3ZQI A;  3G6E I;  3HSR A;  1A35 A;  1Z6T A;  3HKZ N;  4AVP A;  3FHZ A;  2P81 A;  3TDZ C;  3GTJ J;  1IUF A;  4Y4R A;  3WU2 C;  3OL4 A;  2P5V A;  1R6R A;  2GLO A;  2JUC A;  3UKG A;  3DKY A;  1UJ8 A;  3H9Q A;  3DU5 A;  3DKX A;  3AL0 B;  2DMN A;  1TLH B;  1WQ2 A;  3S32 A;  4IVN A;  1UG2 A;  1TWF J;  4RM3 A;  5IYD J;  1R22 A;  3QPS A;  3TOB A;  1X3W B;  4PJJ A;  1RES A;  3CC7 I;  4L9V A;  3MEX A;  1WRJ A;  3GO5 A;  2L7K A;  3WU0 A;  4U7B A;  4U88 A;  3F8N A;  3IH4 A;  5LEK A;  3F6O A;  3WTV C;  4ZDP A;  1BJA A;  5EEH A;  4QTR A;  3F8M A;  1DP3 A;  3WE3 A;  1S29 A;  3I64 A;  2DMT A;  2XF7 A;  3K70 C;  3ZQG A;  2P8T A;  4BJ6 C;  2ZNZ A;  1U2W A;  3FXQ A;  3BC8 A;  3A01 B;  2CH0 A;  2VBZ A;  4XLH A;  1A04 A;  2CW0 F;  2DDA A;  2G7H A;  2VJ4 A;  3HGY A;  2JN6 A;  1QPI A;  1G3T A;  1KQ9 A;  3NQO A;  3EYI A;  3I58 A;  4BEH A;  2DK8 A;  1I1G A;  4C30 A;  3VB2 A;  2Q0O A;  1YFH A;  1T95 A;  2PJP A;  3MMY B;  3ZQC A;  5CJ9 A;  3KEY A;  3WGH A;  3L7W A;  3TO9 A;  3HIF A;  3Q9S A;  1F4K A;  2HS5 A;  1YRN A;  1RZ4 A;  1DPU A;  2XAQ A;  1R7J A;  1LDD A;  3ZR8 X;  5CVR A;  3GTK J;  3BZK A;  1SD5 A;  3CCL I;  3CD6 I;  2DQL A;  4V19 K;  4Y15 A;  1P4A A;  1XTA A;  3DU6 A;  1R5G A;  2BY3 A;  2EZL A;  2LK2 A;  4OAY A;  5FD6 A;  3L2U A;  3GZN B;  3I4N J;  3CMA I;  1R1T A;  1U8R A;  2LY2 A;  5DCM B;  2EZK A;  2XIG A;  1JKP C;  3OYE A;  3CO7 C;  4LK0 F;  3KEQ A;  1PVE A;  3Q0U A;  1Y1W J;  2M30 A;  3CQZ J;  2Y69 H;  2ZSH B;  3FMR A;  4UUS A;  3KET A;  1AHD P;  1FOX A;  3C7J A;  3WTZ A;  1EJ9 A;  1FTT A;  2AQE A;  2A5W A;  2L02 A;  2NOG A;  2FOW A;  2Z3Y A;  3A2K A;  5LLQ A;  2MC3 A;  1YI2 I;  2HQ5 A;  1HC8 A;  5DUI A;  3LAP A;  4BAY A;  5E1X A;  1HSJ A;  1MJA A;  3HOZ J;  3REO A;  1KGS A;  3SQN A;  3ZRG A;  2AXL A;  5J6X A;  1DDN A;  2DA6 A;  1B8I B;  2M87 A;  3F0C A;  3DLL F;  2CS3 A;  1KYW A;  4XSX F;  3EYY A;  1DQU A;  4XKB A;  3QRF F;  1VQ7 I;  1D5Y A;  4M3F A;  3MKL A;  2FJ1 A;  5JVG F;  3J7A Y;  4AWX B;  2HDC A;  3EUH C;  2DOE A;  9ANT A;  3G71 I;  1G6N A;  3R0J A;  2NNY A;  1MH3 A;  4XN0 A;  2IAI A;  4UV9 A;  4ZYA A;  3OYH A;  2W00 A;  3GTG J;  4EJW A;  1Q1V A;  3SZP A;  3K4N A;  3VPR A;  2GIZ A;  3DLA A;  1D1B A;  2MH9 A;  3S1R J;  4PJN A;  1U5T A;  2K4B A;  1JT6 A;  3QU6 A;  2R7O A;  1RC9 A;  4N9H A;  4D1Q A;  3H9G A;  2XF5 A;  1MMG A;  4CYC B;  5C3E J;  4WXD A;  1JUS A;  3W6K B;  3O3K A;  3JSO A;  2JZY A;  3BR3 A;  5A2Q Z;  3BJ6 A;  3K4B A;  1XSV A;  2A3S A;  4A0Z A;  1X1B A;  3RQI A;  3QWL A;  4CXF A;  1X3Z B;  4G8X A;  3PUF A;  4EJO A;  2P5L C;  1UB9 A;  2DA4 A;  4NQW A;  1JJ6 C;  2X51 A;  3WTS C;  2KIF A;  4KIT B;  1XSX A;  5FLX K;  2HYJ A;  5JVT A;  2HU9 A;  1J5Y A;  3EET A;  4NB5 A;  1ZR4 A;  2LG4 A;  3DF8 A;  1WJ5 A;  3IKV A;  4S04 A;  1IN6 A;  3QAH A;  5LRS A;  3HUG A;  5H20 A;  5DM6 F;  4BDZ A;  2UV1 A;  2XPW A;  1ZTR A;  1BI1 A;  5IP7 J;  2X9D A;  1SFO J;  2L0K A;  5D5V B;  4N4N B;  3FXJ A;  2KZV A;  3HOY J;  1QQI A;  4D7N A;  2CO5 A;  1Q1H A;  3KP4 A;  4X1E A;  5D4S A;  2X1E A;  3E6C C;  4A3M J;  2CQN A;  2PI0 A;  3V8K A;  3JR9 A;  1UHS A;  2BVL A;  2IXS A;  4CGZ A;  2JA6 J;  1CF7 A;  2DO7 A;  2A07 F;  4M72 A;  4XQF A;  1UHW A;  2K02 A;  3LAJ A;  3ASN H;  1ZRE A;  5J4V A;  3K2Z A;  3HOX J;  1S6L A;  2L01 A;  1MZB A;  1FMV A;  1MBH A;  4A0Y A;  1WJE A;  1T38 A;  2M1B A;  3M1C A;  1JHH A;  2LBF B;  3MQ0 A;  5EG0 A;  1BI0 A;  3LFK A;  3WTW C;  2K4J A;  4A3G J;  2D2W A;  2HKO A;  1WSU A;  2EA2 A;  1O7L A;  4LMY A;  4CO8 A;  5JLX A;  4HF0 A;  3OS2 A;  1UST A;  4PFO A;  3IV5 A;  3GFI A;  1KON A;  2ELJ A;  2LKP A;  2A61 A;  1ZAR A;  1HCR A;  2TCT A;  4A3E J;  1K78 B;  2VT2 A;  3QPL A;  2LRE A;  4Q5S F;  1V5G A;  1L3L A;  2A5Y B;  4CUG A;  1SFX A;  2Z99 A;  2DA5 A;  1CQT A;  2CV0 A;  4RAZ A;  2P4W A;  5D8K B;  3GZ5 A;  2HDD A;  3GUD A;  4OWR B;  4Y3O A;  2DN0 A;  1Z77 A;  3EPZ A;  2E60 A;  1RET A;  3K4L A;  5EF6 A;  3H0D A;  3CUQ A;  1AKH A;  1IRX A;  3OIO A;  1NHA A;  2QSH X;  3GTP J;  1HST A;  1T56 A;  3HRM A;  1D3Y A;  2BYV E;  1FEX A;  3FXK A;  1T6S A;  3DBR B;  2D5V A;  4KN4 X;  1BN5 A;  1B72 B;  3IRR A;  3MN2 A;  1TP4 A;  4HYE A;  1JJ8 C;  3S2H J;  2B0L A;  4PCQ A;  1FX7 A;  5FFX A;  3I54 A;  2RKH A;  4U87 A;  3NAR A;  3CCE I;  3BOQ A;  3QPH A;  3E5X A;  1ORK A;  2E2I J;  3VYS B;  3DBH B;  3CCU I;  4CCJ A;  2ZJR F;  2VON A;  3LA3 A;  1S3J A;  3DPT A;  2IVM A;  3SYT A;  1U5T C;  5HDG A;  5D8L B;  3J80 K;  3AG2 H;  2STW A;  1LEB A;  1D0Y A;  1BR1 A;  4L5I A;  3ABL H;  2O6G E;  5FKK A;  2QQB A;  2DOA A;  3CMY A;  1UFM A;  3AG3 H;  1R71 A;  2DXI A;  2KIU A;  4C3I J;  1ON1 A;  5BPI A;  3WOD F;  4D0P A;  2J5O A;  4DBQ A;  4ESF A;  2FEZ A;  1C0W A;  3H5N A;  3PO3 J;  3CF5 F;  2NXN B;  1LQ1 A;  3ZN0 A;  3K7A J;  4OIR F;  1U78 A;  2KJB A;  3NEU A;  3PO2 J;  2PMH A;  3H92 A;  4BGD A;  4PSX A;  4ON0 A;  4IJA A;  2X6O A;  4JK1 X;  3HOU J;  3PNY A;  2KT0 A;  5F1R A;  3FXM A;  2V79 A;  3I3L A;  2FA5 A;  4MEY F;  1VQO I;  3JSP A;  2NNN A;  4IQJ A;  4GRI A;  1ZN2 A;  3OYM A;  4CCL A;  2QGU A;  4P5O A;  2Z1D A;  1BI3 A;  3L2R A;  4OIO F;  4B48 A;  3LOC A;  2H94 A;  4RB2 C;  2X6W A;  1YQA A;  4I0B A;  2KPM A;  1LFP A;  4Z6Y A;  4D7M A;  1W1W E;  5HNF A;  5DM7 F;  3BTL A;  4ABZ A;  3E5U A;  2M7B A;  3D5L A;  5K5R A;  3SJM A;  3PQK A;  4EAT A;  4HBL A;  2A05 A;  4RA2 A;  3OV8 A;  5KAI C;  1DU0 A;  2KL4 A;  1IRG A;  2XHK A;  2WBM A;  4BQN A;  1OQY A;  4M3D A;  5FKN A;  4AYB A;  2ZJP F;  2AS5 F;  4HX8 A;  4I02 A;  1YJN I;  1ETY A;  3BJO A;  4BBR J;  1FWZ A;  1MNM C;  2HYG D;  2CW8 A;  3I53 A;  1D0X A;  1KU3 A;  1R1V A;  2HQR A;  4E7K A;  1E3O C;  5IYB J;  1O57 A;  1QZY A;  4BXF A;  3M4O J;  2OF7 A;  1YTY A;  1D8K A;  1BM9 A;  2GQQ A;  5KK1 A;  2OAZ A;  2E5Z A;  2VKD A;  2CW7 A;  5E18 F;  2F4M B;  1X1C A;  4CZZ A;  2JTV A;  2QQ9 A;  3WHB A;  3OYB A;  1SFU A;  2W1O A;  2KZG A;  4QWQ A;  2R92 J;  3X2Q H;  3ZN1 A;  5FKL A;  2Y2Z A;  4KIS A;  1XGN A;  5HS8 A;  4XRM A;  2QBY A;  3P9I A;  1F36 A;  4A6E A;  4F7Z A;  1H0M A;  4MGR A;  2ZCW A;  2OD5 A;  3EUA A;  3BDD A;  3HOV J;  4KMF A;  5DUK A;  1LE8 A;  2L5Q A;  4OOI A;  4DOZ A;  1RI7 A;  3S1N J;  2H1L A;  3GWZ A;  4LGW A;  3V7S A;  2O9L A;  5TRD A;  2WAD A;  4CCK A;  2R7V A;  2IT0 A;  5L3C A;  4YRV A;  4GXO A;  2EFP A;  4BXX J;  3VFZ A;  1XCV A;  2TDX A;  3CJN A;  3QU3 A;  4H0E A;  1IV8 A;  2O8X A;  4BY1 J;  4DJA A;  2V6C A;  2RN7 A;  1MBF A;  4RGX A;  1KU7 A;  1HW2 A;  2JUG A;  3HJE A;  4HNT A;  3KLN A;  3O8G A;  1QO0 D;  5E3M A;  3E5Q A;  4RLQ A;  2FU4 A;  3H5R A;  2VQC A;  3TO7 A;  3AG4 H;  3B6A A;  4EJV A;  3NAU A;  1O3R A;  3BZ6 A;  4V2F A;  2BGC A;  1XMA A;  2ZSI B;  4A3D J;  3HTU A;  1HKT A;  3ZOB A;  2EIN H;  1Y8R B;  3CMM A;  4NBQ A;  1KZH A;  5EG0 B;  2O7O A;  2HQA A;  3B6C A;  4RB0 A;  2ZBK A;  3QYB A;  4AD9 A;  1WKM A;  4GO1 A;  4E7I A;  2XRL A;  2VIX A;  4NC8 A;  4FX4 A;  5E20 A;  3U21 A;  1B6A A;  2Z9O A;  2R7D A;  1J0R A;  1ZLJ A;  3PQJ A;  4EGY A;  1BA5 A;  1RR8 C;  1X1P A;  2VQL A;  5IOY A;  1UEL B;  2G7U A;  3K70 D;  3HC7 A;  2VBW A;  4E7Z A;  2UUZ A;  4N4O B;  2XGC A;  2QLZ A;  3QOD A;  2EPF A;  4P55 A;  1HDP A;  3ZMT A;  2DU9 A;  5L3E A;  2ZFU A;  1NK2 P;  5C44 J;  1OR7 A;  2H27 A;  4RGR A;  3M9A A;  4M74 A;  5BQT A;  1Y6I A;  1ETQ A;  3F21 A;  3F8C A;  4RGS A;  4QIW N;  4CA0 A;  2I8D A;  3IAM 2;  2L2O A;  4G7Z F;  1XS9 A;  2X6Y A;  1XB4 A;  2KIQ A;  3SZG A;  4I6Z A;  3ERM A;  1U9N A;  2L54 A;  4A93 J;  4KFC A;  2Y31 A;  2KHM A;  3CLQ A;  4N0B A;  5HLT A;  3PJR A;  1WJF A;  1K6O A;  1R58 A;  3QPT A;  3C2G A;  3FX3 A;  1WGX A;  1A5J A;  2VBX A;  1PYV A;  1OLT A;  3R60 A;  5GPC A;  3FXL A;  4L9J A;  1MH4 A;  3LSP A;  2RNJ A;  3UNG C;  3CCQ I;  1AWC A;  3GTL J;  1RUO A;  5GPA A;  2BY2 A;  3M8J A;  1YS6 A;  3BQZ A;  2QZ8 A;  3FM3 A;  2DT7 B;  3OR1 C;  3LSI A;  1OKR A;  1BBY A;  1BW5 A;  4PFP A;  3V7C A;  1EV7 A;  2JA7 J;  3S3O A;  2MFZ A;  3H3V K;  3A02 A;  5DV5 A;  4OMY A;  5A2Q K;  4XIC A;  3HOW J;  2E7X A;  4XLN F;  2CQX A;  3FF5 A;  2CU7 A;  1GVJ A;  2VN2 A;  3OYC A;  1PUF A;  1SVL A;  3OOU A;  4FE4 A;  4D9J A;  1IN5 A;  3D5S C;  5FRN A;  3N05 A;  4ZDO A;  4E7J A;  4Q48 A;  5EGO B;  2DK5 A;  2EIK H;  3S15 J;  3JTG A;  3M8E A;  4BL0 B;  1OYI A;  4PUS A;  3CCJ I;  5CKT A;  2CGP A;  2EB7 A;  3BR2 A;  3BTC A;  4LIV A;  3EQL F;  3K10 A;  2O61 A;  3RTR A;  1VQ6 I;  4RAG A;  2E1M B;  4HNU A;  4CH7 A;  3KYD B;  4CZC A;  1WI3 A;  4LLN A;  2E19 A;  2KRF A;  4EM1 A;  3SFZ A;  2V4J C;  4XSZ F;  3BG7 A;  3QQA A;  1YW9 A;  3JRH A;  3L2Q A;  2PJR A;  4KDP A;  5FRM A;  1FY7 A;  4IQ4 A;  2KKO A;  3A4C A;  1GXQ A;  3HL2 A;  2Y30 A;  2FNP A;  2RV8 A;  3H3U A;  3IWF A;  4HLX A;  3TQN A;  2NVY J;  3WTU C;  2G0E A;  2RNG A;  3DEE A;  1I3A A;  3AFH A;  3IAS 2;  3Q0V A;  4P9F A;  1QBJ A;  1MBE A;  3T8R A;  5ERI A;  4Y52 J;  2OJE D;  5M5Y J;  2MD0 A;  1S8N A;  1FOY A;  2IEK A;  3HPH A;  3H1C A;  3R61 A;  3A1Y A;  5CYV A;  1F5T A;  3OYK A;  5F27 A;  2K5C A;  4IOA F;  4B1R A;  1PP7 U;  2HWV A;  3C2H A;  1VFC A;  4LIU A;  4PJ0 C;  2EIL H;  5AIP A;  3TW7 A;  1U8B A;  4HV5 A;  1LFU P;  3ZQ7 A;  5JR3 A;  4MQ9 F;  2IS4 A;  1KU9 A;  1K79 A;  4MQV A;  4NDL A;  3V8L A;  1MGT A;  4FIS A;  3R6S A;  4ZZL A;  2IBD A;  4LD5 A;  3OYA A;  2HPM A;  1IDZ A;  4BUP A;  4X0G A;  2VOO A;  2NS0 A;  3E7L A;  5JLW A;  3L2V A;  1HBX G;  1ZHF A;  1OR7 C;  1IN8 A;  2O5R A;  5DCF A;  4J00 A;  4F3Q A;  4ESJ A;  1I3Q J;  2J5P A;  1E0E A;  4WCG A;  3J81 Z;  1A6I A;  1TNT A;  4ZJZ A;  1E2X A;  1JTX A;  4UVC A;  1MMN A;  2M2E A;  3JTH A;  3TO6 A;  2IPQ X;  2XAJ A;  4C2T A;  1JTY A;  3L9F A;  2RQP A;  2R5Z A;  3ZMZ A;  2PMZ A;  1ZG1 A;  1NG6 A;  1DP7 P;  1XGS A;  2LY1 A;  1IDY A;  1VQL I;  2CUE A;  1DGW Y;  1JGS A;  1EH6 A;  4FHT A;  1SMY F;  3CTA A;  3HEF A;  1F43 A;  1LVA A;  4E6K G;  5KNL A;  4F93 B;  1G3W A;  5LBQ A;  2XGD A;  2E1C A;  1APL C;  3E3V A;  5LHI A;  2XPV A;  1I50 J;  3SEZ A;  4QPQ A;  1OCC H;  2Z33 A;  1OCO H;  3C2B A;  4HQE A;  2ECB A;  5ICE A;  2BHY A;  3HHH A;  3FMQ A;  1ZGA A;  4R8H A;  2LF7 A;  3ESW B;  4M6Y A;  4CCN A;  3SDG A;  4E7S A;  3MCZ A;  1D1C A;  2IA1 A;  2L4M A;  2Q2E B;  3GFM A;  4G9Y A;  2R5Y A;  2OCE A;  1R9T J;  4A3J J;  4F52 A;  2COM A;  4U0Y A;  3DEU A;  1Y39 A;  3F9K A;  2CQK A;  5J1U A;  3ZP5 A;  5ED4 A;  3HGG A;  3RPU A;  1A6Q A;  2E35 A;  1VND A;  2ELH A;  4MEX F;  3RKX A;  1V3F A;  1VQ4 I;  2VE8 A;  4WF2 A;  2F5V A;  3K69 A;  2ZJQ F;  2QEN A;  2IA2 A;  3JRB A;  1IN4 A;  4DW6 A;  1XDU A;  1YE9 A;  3DBL B;  1Z7U A;  4XN3 A;  1XG1 A;  1FPQ A;  4A69 C;  1HXD A;  3FXO A;  4Y17 A;  4A3I J;  4KIF A;  2E1O A;  2FNA A;  2A6H F;  4DQ2 A;  4S05 A;  2BY1 A;  5C4X J;  1WHU A;  2QKM B;  2KIS A;  2YR2 A;  4A12 A;  3B73 A;  5ILV A;  4A3F J;  1EA3 A;  5C4J J;  1YW8 A;  3ZQH A;  4UUV A;  2WY7 Q;  3BT9 A;  3E1S A;  4BNC A;  5DD8 A;  2ID6 A;  2CQ7 A;  2BEO A;  4EJT A;  2H6B A;  2VBY A;  3I4M J;  2CRG A;  4LG0 B;  2M0M A;  2VKE A;  4MFD A;  1P7J A;  3MKZ A;  5IT9 Z;  3GF2 A;  4IZZ A;  1W7P A;  2FXA A;  2L3D A;  4OIN F;  5LEJ A;  4UUT A;  3OR2 C;  4EVI A;  1Y56 A;  4ZYD A;  1AOY A;  1IGN A;  2Y9Z A;  2E2J J;  2LTP A;  1QVT A;  4LLL A;  1SC7 A;  1DU6 A;  5J8F A;  3PNT A;  4WX9 A;  1A31 A;  3OS0 A;  2W85 A;  1P92 A;  3WGI A;  1BIA A;  1YO5 C;  1EF4 A;  5HDN A;  4PGG A;  1HKQ A;  2KRC A;  3P9K A;  1PUF B;  1FBS A;  3FXU A;  4AUX A;  2R7W A;  2A68 F;  2LRD A;  3QOE A;  4YII A;  5IT3 A;  2ID3 A;  4J01 A;  2DPU A;  1ZEL A;  1LUJ B;  3NRV A;  3VYU B;  1JE8 A;  4RAY A;  2X85 A;  1F9N A;  1WCM J;  2H6C A;  2IGO A;  4GGG A;  2E2H J;  4RBO A;  2EA4 A;  3I9V 2;  2E7W A;  3KCC A;  5GP9 A;  5B1B H;  3K1M A;  2V6E A;  2ESN A;  5IY5 H;  3I59 B;  3RDI A;  3DPL C;  1U9O A;  2HKX A;  1Y0U A;  1TT5 B;  2ZKZ A;  3HPG A;  1AA7 A;  1Z6R A;  2JVG A;  3VEP A;  4EM0 B;  3CCM I;  2L9V A;  5GAH J;  4BXU A;  2BW3 A;  4LB5 A;  2H1K A;  3K4C A;  2VOP A;  2K27 A;  2DFF A;  1YJW I;  1WFX A;  1QRY A;  3RZO J;  1WJA A;  2YPR A;  3OOP A;  3MKW B;  3J7Y J;  2Z16 A;  3OWT A;  3I4P A;  1H89 C;  2YU3 A;  4LFU A;  1STZ A;  2DJN A;  3FDY A;  4BYY A;  3ABK H;  3PNV A;  2OU2 A;  4FX0 A;  1QHG A;  1B1B A;  3I55 I;  3BRO A;  3LSJ A;  5HOD A;  2F5F A;  1RKW A;  3JRE A;  2QA4 I;  2RC4 A;  4MIM A;  2DDB A;  5KCM A;  4EGZ A;  3LNQ A;  3LSH A;  2BZT A;  2Q8K A;  4DYQ A;  5LRR A;  2NVX J;  3GCM A;  3VSK A;  2R7Q A;  3O6B B;  1WZ2 A;  3GTM J;  5HS9 A;  1IXR C;  2AXT C;  1PDN C;  3CME I;  2VQH A;  1VQ5 I;  3AG1 H;  4XKW A;  1FP2 A;  2HOS A;  3PSF A;  3M8F A;  2DCE A;  3PFY A;  3OYD A;  2JA5 J;  3VYR B;  2D1H A;  1N78 A;  2KDZ A;  4IHW A;  2ZNY A;  2V9P A;  4Q4Z F;  2JSP A;  2PMZ N;  3A0B C;  3FKJ A;  3KP7 A;  2V9K A;  3I71 A;  3HSE A;  3IL2 A;  4E70 A;  1BR2 A;  2DFE A;  3BG6 A;  3RYR A;  3HOS A;  2NVT J;  3DEW A;  2AO9 A;  5F64 A;  3S17 J;  4KA4 A;  3H36 A;  1R36 A;  3GLL A;  4NHJ A;  2IGM A;  3BR0 A;  3TP0 A;  1GVD A;  1R23 A;  2FQ3 A;  2HOE A;  2WA0 A;  2I5U A;  3CJR B;  2CQQ A;  1YJ9 I;  2B7E A;  2MSY A;  2YX4 A;  2W4S A;  4KT5 C;  3L2C A;  3OMY A;  1MND A;  5BNG A;  2HR3 A;  2R7T A;  3M7G A;  4HF1 A;  4QLC U;  3K1P A;  3BG3 A;  2WY8 Q;  2XUB A;  1I27 A;  2E5N A;  2JA8 J;  3KZY A;  3RIR A;  4I2O A;  2B63 J;  1P9Q C;  2X1D A;  2X0L A;  1LJ9 A;  4JQF A;  4A5N A;  4E4H A;  5LHH A;  2JJ7 A;  4XLA A;  3ZMD A;  5GAD J;  4DYC A;  3ZMU A;  1J9I A;  3WTY C;  2XSJ C;  4CDG A;  3GZ6 A;  4BEH B;  2DPD A;  3VDX A;  1MDM A;  3IP4 B;  4RGU A;  3F72 A;  4IHY A;  5IP9 J;  5BMZ A;  1YRN B;  3HHG A;  3U1K A;  1H9G A;  3IWZ A;  1RRJ A;  2F5E A;  1FYL A;  3CDI A;  3DWL E;  2K40 A;  3FBN B;  3HRS A;  3ROU A;  3U1D A;  2IS2 A;  2OZU A;  1J59 A;  2DQR A;  2P7C B;  3VWB A;  2Z2S B;  2V7F A;  4Y13 A;  1KYZ A;  3OY9 A;  2VKV A;  3GXO A;  2GA1 A;  3G1O A;  4WXH A;  3HBL A;  3PUB A;  1NG7 A;  5D6F A;  1I6X A;  1ZRD A;  2LDU A;  1IN7 A;  2Y9Y A;  2V1N A;  4UUS B;  4XRF A;  3S3M A;  5E8I A;  1FT9 A;  2VC0 A;  4HW0 A;  1OCZ H;  2JQ7 A;  4L0Y B;  1HF0 A;  4C9Y A;  1Z1D A;  1LB2 A;  4AM3 A;  3SXY A;  1ZGW A;  1TWH J;  2L4A A;  2XDV A;  2HTJ A;  3C18 A;  2BV6 A;  2ZME A;  4D5F A;  4LOC A;  5L3F A;  3MZY A;  3S2D J;  1J7K A;  3BCA A;  4IO9 F;  2KRH A;  3OIQ A;  2PLY A;  2YS9 A;  4ASN A;  5HOO A;  1V54 H;  3TBI A;  4DZJ A;  1G4D A;  1KQ0 A;  3V7R A;  1EH8 A;  4YIF A;  2NVU B;  1PUE E;  3I56 I;  4LG3 A;  2FF4 A;  4M9S A;  1OYW A;  2FUG 2;  1IW7 F;  2OC6 A;  4KT6 A;  5DTD A;  2ISZ A;  4L5E A;  2IRF G;  3FKI J;  1FJL A;  1BJZ A;  4IRI A;  1ACI A;  4BU2 A;  2FSW A;  1ZG5 A;  3HB9 A;  2XAS A;  1POG A;  5HVQ C;  2BBY A;  1U5T B;  4XLE A;  2MBF A;  4HPQ A;  5CVV A;  1X4P A;  3H5A A;  2HTS A;  2FQ4 A;  2R7R A;  1G2H A;  3IH3 A;  3LQR A;  2M8G X;  1R4N B;  2FX0 A;  2WV1 A;  4HX7 A;  4A3L J;  2DOF A;  2MAB A;  5E79 C;  2IW5 A;  2JT1 A;  2XV4 S;  3OL3 A;  5H2F C;  2F4O B;  2HOA A;  2IA0 A;  4HDU A;  1JKO C;  2MW8 A;  4A3K J;  4GYI A;  1ITY A;  2EWN A;  5TJJ A;  1O3S A;  1E3P A;  5B1A H;  3M3Y J;  1VI0 A;  2QQA A;  3J81 K;  3JRC A;  3ABM H;  5LFA A;  3CCY A;  2M7A A;  2VJ5 A;  1TQI A;  4BHC A;  1FOW A;  1R4M B;  4DGW B;  3NWT A;  4G12 A;  3KP5 A;  1XGM A;  4ZTJ A;  1EKE A;  4NQW B;  3I0T A;  3WG7 H;  1LNW A;  2EJR A;  5F1J A;  1J75 A;  3FMS A;  3S2W A;  4OU0 A;  5HS7 A;  5JI6 A;  1QZZ A;  2CFX A;  4O3M A;  2F2E A;  3TP3 A;  5HLH A;  5EZG A;  1W36 C;  2R7Z J;  3HUG B;  4F92 B;  5K7F A;  3ZQL A;  2JMW A;  5D5W B;  4NNJ A;  3IUO A;  5L3D A;  1G59 A;  5E8G A;  5F0H A;  4HEA 2;  2EFN A;  4S0H B;  1MKM A;  1QZE A;  3BP8 A;  3KFW X;  1TZL A;  1MNE A;  2A69 F;  5CPR B;  4ESB A;  3LSK A;  3CCS I;  2FD5 A;  3QOP A;  2L9S A;  2XAH A;  5L3G A;  3P7N A;  2KDO A;  2E36 A;  5F0C A;  2VI6 A;  5EEG A;  4KNY A;  1KU2 A;  3HSF A;  1CF7 B;  2BXY A;  1T0F A;  2OUM A;  6PAX A;  2MYS A;  1FSH A;  3OS1 A;  4LIT A;  5J40 A;  1U3E M;  4BJ5 C;  3HM5 A;  5TGT A;  5E1W A;  1MD0 A;  1ODD A;  3BG5 A;  4JYK A;  5DS9 A;  3K4K A;  5FKO A;  3FIS A;  4FQG A;  2MLK A;  2LC2 A;  3BG9 A;  5GAE J;  3WU1 B;  2DMP A;  2QQ8 A;  1ZG3 A;  2KLO A;  4DYR A;  3S1Q J;  1IXC A;  3GYH X;  2NS8 A;  1NH3 A;  1W0T A;  3W2V A;  2R7X A;  4KIG A;  4HSR A;  4IHT A;  3K6G A;  3LFU A;  3CDL A;  4JX5 A;  4B3A A;  2VL8 A;  3TDU C;  2H09 A;  4I0A A;  1LPQ A;  2P7V B;  4IX7 A;  1XSD A;  4IXA A;  2JRT A;  2CV1 A;  1LVK A;  4XID A;  4OIP F;  4HV6 A;  4MHG A;  3DFG A;  1Z91 A;  2FE3 A;  2AHQ A;  2NOJ B;  3E97 A;  3HZJ A;  1B59 A;  1GV2 A;  2OCC H;  1G3Y A;  2DAO A;  4MLO A;  4NC7 A;  1NK3 P;  1XGO A;  3SDB A;  5IT9 K;  2W24 A;  3HG9 A;  3GBG A;  3ZXS A;  1AKH B;  3CUQ B;  3CC2 I;  5K7H A;  2FBK A;  2ETH A;  1K61 A;  2VOD A;  1ERD A;  4XOR A;  5ILU A;  1X58 A;  2ZME C;  4F55 A;  3LWF A;  4O6J A;  3A01 A;  3G1L A;  5L3B A;  3OYF A;  4EMS A;  1S7E A;  3QYF A;  2VT3 A;  1Z0X A;  4OMZ A;  4ZH4 F;  2CYY A;  3J7Z I;  1VQP I;  5DD4 A;  4FCY A;  2F6C A;  3RQ4 A;  3ZMS A;  1SMT A;  3LST A;  2HOT A;  3EUK L;  1P2F A;  1VQK I;  1UG0 A;  1K7A A;  1TW3 A;  2FBH A;  3CC4 I;  2IS6 A;  2OTJ I;  3CLO A;  3RPQ A;  2QSG X;  2N8G A;  3ECO A;  2W84 A;  3D1N I;  4F91 B;  2ZXH A;  1L0O C;  2AQF A;  2F5D A;  5FFZ A;  3IH2 A;  3GFJ A;  1IC8 A;  2M9H A;  3F8B A;  4I99 C;  1HA8 A;  3BCB A;  2GXA A;  4XRS G;  2VKH A;  1K4T A;  4W1U A;  2WAQ A;  1TWG J;  3CP2 A;  3CUO A;  4WXC A;  3QP5 A;  5DCM A;  2C6Y A;  3ZQF A;  4JX4 A;  1RIO H;  1WJC A;  3KE2 A;  2Y75 A;  3BR5 A;  5GTH C;  1UHM A;  1S72 I;  2BOL A;  4UXN A;  4Q47 A;  3W3C A;  4A3B J;  2RAE A;  4Y7N J;  4EV0 A;  3LSG A;  1W5C C;  4BQO A;  5BS6 A;  2EV0 A;  5H6R A;  4EJU A;  1BIB A;  1WWX A;  5EJC A;  1SD6 A;  1B8I A;  5CVU A;  1IUY A;  3KYC B;  1FTZ A;  1TWA J;  3ABU A;  3L2W A;  1P4W A;  1X4O A;  1OPC A;  1UMQ A;  3WHC A;  1JKQ C;  2CFO A;  4XOP A;  4AYB N;  3JRI A;  2JVH A;  2VJI A;  3BTJ A;  3W6V A;  5KAF C;  3DTE A;  2V26 A;  1FYK A;  4GDF A;  2DA3 A;  1E3H A;  5J3L A;  1HW1 A;  2F5C A;  3LSR A;  1RKT A;  4XBF A;  3KYL A;  3ERE D;  5BOX A;  1R49 A;  3HXL A;  4B47 A;  1ETV A;  1WI9 A;  4G7O F;  3FIW A;  2QCO A;  5F6F A;  1WJD A;  4CYC A;  4M9X A;  4G7H F;  5BPD A;  3BLY A;  1FBU A;  1T0F C;  1YS7 A;  2DA2 A;  2LVS A;  5B3S H;  1FIP A;  1LEA A;  2LOO A;  3HDD A;  2VPR A;  3MVP A;  2LD5 A;  3F3X A;  1IRF A;  5F0F A;  5ICG A;  1YX3 A;  2L7Z A;  4ETS A;  1YG2 A;  2ZC2 A;  3OYN A;  3BWG A;  3K4J A;  2QBY B;  2D1V A;  3KX2 A;  4CCO A;  1BR4 A;  4RLF A;  2P0W A;  2UXX A;  4XK4 A;  2DT6 A;  3U2R A;  3VYT B;  3VSL A;  2DYS H;  2GXB A;  1LE8 B;  2GM4 A;  5EDN A;  3WE2 A;  3AL0 C;  4PK4 A;  1K83 J;  3H35 A;  4YIR X;  3U9G A;  2COB A;  4R1H A;  4FE7 A;  1IAW A;  2XGE A;  3F8F A;  2XSD C;  2P6S A;  1FYM A;  2OBP A;  4JOM A;  4HZF A;  2XPU A;  4I01 A;  4YFN F;  3DTK A;  3T5X A;  4XLF A;  3H3Z A;  4Y33 A;  1IRZ A;  2IGN A;  3Q5F A;  1U6G A;  2XAU A;  2K3F A;  1BOB A;  2M5W A;  1ONV A;  1Z21 A;  3RPU D;  2XB5 A;  1ETK A;  3K9T A;  5J1R A;  4A6D A;  3QP6 A;  1YIO A;  2R93 J;  2IP2 A;  4B3X A;  1AU7 A;  1P6R A;  1ENH A;  1XN7 A;  4IEJ A;  1USS A;  4L9T A;  2LBF A;  3W6J B;  2Z5U A;  2EZI A;  2RDP A;  3VOE A;  5CVI A;  2JRM A;  4L18 B;  4AID A;  3GTQ J;  2BY0 A;  3GTO J;  1ETX A;  2ESH A;  3ECH A;  5DYM A;  4MFE A;  3JAM Z;  4II2 A;  1WJB A;  1G8X A;  4CYD A;  4BDY A;  3E6D A;  3S8P A;  1W7P D;  4CSW A;  1K78 A;  1BL0 A;  3JRF A;  1Y8Q B;  3Q3S A;  1OJL A;  1ZH5 A;  3ZQQ A;  1S7O A;  3Q0W A;  1YIJ I;  1J2X A;  1XX5 A;  1HKS A;  1X3U A;  2CSO A;  2TRT A;  4MNU A;  1IG7 A;  4A3C J;  1I1S A;  2FBI A;  3D0S A;  3A03 A;  2L9N A;  4ZZD A;  4XKC A;  1SVM A;  2PEX A;  4MTE A;  1YLF A;  2FML A;  3FXR A;  1Z3X A;  2ZFW A;  3UR3 C;  4LJZ F;  4YEL A;  1FLI A;  2KMU A;  1QU3 A;  1RR7 A;  3RKW A;  5JHU A;  3S93 A;  1B72 A;  1UZC A;  4IHX A;  4RDU A;  1DPR A;  2VUM J;  2Y0M A;  5DEQ A;  4C3H J;  4ANJ A;  3K4M A; 
#chains in the Genus database with same CATH homology
 4UVA A;  2XKO A;  2QM3 A;  1OYY A;  3ISP A;  2QUF A;  2PMU A;  4L5J A;  2VXZ A;  3GFL A;  1Z9C A;  3IHU A;  4IRH A;  2IJL A;  1ZRC A;  3KP3 A;  4KUM A;  1OMI A;  4HX4 A;  1TW2 A;  4BH9 A;  3BPX A;  4G6Q A;  3MWM A;  1IZ1 A;  4ENK A;  4RS8 A;  4PGH A;  4ZYH A;  2CWE A;  2XRO A;  3DV8 A;  1B9N A;  1VTN C;  2W57 A;  2VE9 A;  3FWE A;  2YSR A;  4WWC A;  3ML6 A;  3N97 A;  1QNT A;  3JW4 A;  4K2E A;  3CDH A;  4UV8 A;  4HA8 A;  4HF2 A;  1I5Z A;  1TNS A;  3N4M A;  1BI2 A;  2ZO4 A;  2HZT A;  2EV5 A;  5AON A;  3FM5 A;  2LSO A;  5DDG A;  1XCB A;  5HDK A;  3G3Z A;  1FNN A;  4KN7 X;  4G6D A;  2NRA C;  3KP2 A;  1BOA A;  1JHF A;  4L0Z B;  3B02 A;  1TBX A;  3EDP A;  3DKW A;  2STT A;  2EFQ A;  3RYP A;  4I98 B;  5LGT A;  3BJA A;  1P4X A;  1Z05 A;  3GW2 A;  4B09 A;  1ZAO A;  1ON2 A;  4GCV A;  4IRG A;  3R0A A;  3G73 A;  3WGG A;  2HYF A;  2MD5 A;  3SZT A;  2EK5 A;  2R7F A;  1RUN A;  3R4K A;  2G9W A;  1O3Q A;  2K86 A;  1FP1 D;  4ZYE A;  2QWW A;  2MLG A;  3WTX C;  4N9I A;  5LGN A;  4ENM A;  1SFE A;  3RI4 A;  4WK8 F;  2P5K A;  2PFB A;  1UCR A;  1MJ9 A;  2M45 A;  3BPV A;  2XGX A;  4KYW A;  2K7L A;  5FO5 A;  5K5O A;  2M8E A;  2JPB A;  2WV0 A;  2DBB A;  4EQQ A;  3RKY A;  2UXN A;  1E17 A;  5LGU A;  2WWY A;  4A0X A;  2CG4 A;  5ILS A;  1PP8 F;  1H9T A;  2DTR A;  4YFX F;  2V1U A;  1XMK A;  4O5V A;  1JXS A;  2P6T A;  3ABT A;  2V9V A;  4HQM A;  1GHC A;  1BC8 C;  2UWM A;  4GYG A;  1G3S A;  3ULQ B;  2PN6 A;  1T98 A;  2KIM A;  2RGV A;  2PG4 A;  2OZ6 A;  2XAF A;  5FB2 A;  3PFI A;  4UHT A;  1QGP A;  1SAX A;  3DXJ F;  1R00 A;  2R3S A;  2GZW A;  1HQC A;  2XKP A;  1R5H A;  1YYV A;  3MFK A;  1W7P B;  2HQN A;  4LB6 B;  3I5U A;  4HDV A;  3SHF A;  1HW5 A;  4M71 A;  2O3F A;  4KIB A;  4U0W A;  2LNB A;  2ISY A;  2YX7 A;  1RNL A;  1ULY A;  2D45 A;  1T2K A;  4HAM A;  3T0Y A;  3VOD A;  4DNC A;  2MH2 A;  3TOA A;  2NAZ A;  5FD5 A;  3KLO A;  3HRT A;  5D5X B;  3GEZ A;  4B8X A;  5FGM A;  3L00 A;  3ELK A;  2GA2 A;  2KJC A;  4UNO A;  4RB1 A;  1LDJ A;  2V1D A;  5CVJ A;  3TGN A;  4TV7 A;  3IC7 A;  2ACJ A;  1IXS B;  2DFI A;  3M1E A;  3HOT A;  1SD4 A;  2EFO A;  1MJB A;  2OQG A;  1W5T A;  1B4A A;  1S7A A;  3COA C;  3HRU A;  3J7A O;  2FMY A;  2JSC A;  4FT8 A;  4AIJ A;  5E1Z B;  1REP C;  1D5V A;  5ICC A;  5KVR A;  4UVB A;  4OIQ F;  2X4H A;  3MZH A;  2MA3 A;  4YG2 F;  5HLI A;  3AAF A;  1DUX C;  3DQV C;  1FSE A;  1ZYR F;  3KEO A;  3JAM K;  2ZJ2 A;  3LA2 A;  1KA8 A;  4PDK A;  4MTD A;  5JFR A;  3ZPL A;  2WTE A;  1ZRF A;  4M73 A;  5J8C A;  5HLG A;  1R1U A;  4ENN A;  1BC7 C;  3O2P E;  2VC1 A;  2UZK A;  4U7D A;  1F1Z A;  4U0V A;  1W4M A;  1YW7 A;  3CUQ C;  2GXG A;  1FOK A;  4ZYG A;  2DW4 A;  3E6B A;  5FLX Z;  4AIK A;  1FBQ A;  1FC3 A;  2DT5 A;  3Q9V A;  5D6E A;  3KZZ A;  3ZMV A;  4Z2Y A;  1TQM A;  4R79 A;  3GX4 X;  4I09 A;  5H6Q A;  3E6M A;  1TTY A;  2RVC A;  4IPA A;  4KIC A;  2XAG A;  4KMU X;  1O7F A;  3MAJ A;  2A6E F;  2Q2E A;  4A2U A;  2OA4 A;  4XLP F;  4LLG F;  3KP6 A;  1MDM B;  1ZLK A;  1B9M A;  1CGP A;  3HYI A;  4CHU A;  2ADU A;  1XDS A;  3CO6 C;  2XRN A;  2DLL A;  2DI3 A;  2GAU A;  1KQ8 A;  4G94 A;  3K0L A;  4JBA A;  3L09 A;  3F22 A;  5AIQ A;  4L9N A;  4PZJ A;  5D5U B;  3F6V A;  3WTT C;  4LG0 A;  3V8J A;  5D4R A;  2BE5 F;  2FRH A;  2EV6 A;  3C1D A;  2WC2 A;  2ZME B;  2O0Y A;  1O3T A;  3P9C A;  2FOK A;  4P96 A;  1QPM A;  2V1X A;  4I7H A;  3IKT A;  1GXP A;  1FZP B;  4BQA A;  5E17 F;  4HOB A;  2PQ8 A;  1XD7 A;  3K1N A;  3LA7 A;  3J80 Z;  1ZGJ A;  3WG9 A;  3GLX A;  3IRQ A;  4M6X A;  5LHG A;  3RJP A;  3DP7 A;  3V4G A;  1V4R A;  2GIV A;  2O03 A;  4IF4 A;  3I59 A;  2QYO A;  4AIH A;  2HEO A;  3GVA A;  3T8T A;  4HLY A;  4BHB A;  1IF1 A;  1SD7 A;  1TQP A;  2HFH A;  4LK1 F;  1EH7 A;  5ICF A;  2EFW A;  4CIC A;  4RB3 C;  2E1N A;  2Y48 A;  2JPC A;  2PBI A;  3EUH A;  4BHP A;  5CLS A;  5K5Q A;  2QVO A;  1D8J A;  2HGC A;  4ENJ A;  2LF8 A;  2OQR A;  3FZV A;  3BY6 A;  3C3W A;  5K1Y A;  4IHS A;  3T1B A;  3TKY A;  2NYX A;  3F23 A;  1W5S A;  4M9Z A;  2ZXJ A;  1T39 A;  4EM2 A;  4A5M A;  4YFK F;  3LQQ A;  4P9U A;  2W25 A;  3HTS B;  1LDK B;  2GWR A;  2XVC A;  3HSR A;  1Z6T A;  4AVP A;  3FHZ A;  3TDZ C;  2P5V A;  1TLH B;  1WQ2 A;  4IVN A;  1R22 A;  3TOB A;  4L9V A;  3MEX A;  1WRJ A;  3GO5 A;  3WU0 A;  4U7B A;  4U88 A;  3F8N A;  5LEK A;  3F6O A;  3WTV C;  1BJA A;  5EEH A;  3F8M A;  3WE3 A;  1S29 A;  3I64 A;  2P8T A;  2ZNZ A;  1U2W A;  3FXQ A;  2VBZ A;  1A04 A;  2CW0 F;  2G7H A;  1G3T A;  1KQ9 A;  3NQO A;  3EYI A;  3I58 A;  2DK8 A;  1I1G A;  3VB2 A;  2Q0O A;  1YFH A;  2PJP A;  5CJ9 A;  3WGH A;  3L7W A;  3TO9 A;  3HIF A;  3Q9S A;  1F4K A;  2HS5 A;  1RZ4 A;  1DPU A;  2XAQ A;  1R7J A;  1LDD A;  5CVR A;  1SD5 A;  2DQL A;  4Y15 A;  1P4A A;  1R5G A;  5FD6 A;  1R1T A;  1U8R A;  5DCM B;  2XIG A;  3CO7 C;  4LK0 F;  3KEQ A;  2M30 A;  3FMR A;  3KET A;  3C7J A;  3WTZ A;  2L02 A;  2Z3Y A;  5LLQ A;  2MC3 A;  5DUI A;  3LAP A;  4BAY A;  5E1X A;  1HSJ A;  1MJA A;  3REO A;  1KGS A;  3SQN A;  2AXL A;  5J6X A;  1DDN A;  2M87 A;  1KYW A;  4XSX F;  3EYY A;  3QRF F;  4AWX B;  2HDC A;  1G6N A;  3R0J A;  2NNY A;  4UV9 A;  4EJW A;  3SZP A;  2MH9 A;  1U5T A;  2K4B A;  3QU6 A;  4N9H A;  4WXD A;  3W6K B;  3O3K A;  3JSO A;  2JZY A;  5A2Q Z;  3BJ6 A;  1XSV A;  2A3S A;  4A0Z A;  4CXF A;  4G8X A;  4EJO A;  2P5L C;  1UB9 A;  4NQW A;  3WTS C;  2KIF A;  1XSX A;  5FLX K;  5JVT A;  1J5Y A;  3EET A;  4NB5 A;  3DF8 A;  3IKV A;  4S04 A;  5LRS A;  1IN6 A;  3QAH A;  3HUG A;  5H20 A;  1BI1 A;  5D5V B;  1QQI A;  3E6C C;  2CO5 A;  1Q1H A;  3KP4 A;  5D4S A;  2PI0 A;  3V8K A;  4CGZ A;  1CF7 A;  2DO7 A;  2A07 F;  4M72 A;  3LAJ A;  1UHW A;  2K02 A;  1ZRE A;  3K2Z A;  1S6L A;  2L01 A;  1MZB A;  4A0Y A;  1T38 A;  2M1B A;  1JHH A;  3MQ0 A;  1BI0 A;  3LFK A;  3WTW C;  2K4J A;  2D2W A;  2HKO A;  1WSU A;  2EA2 A;  1O7L A;  4LMY A;  4CO8 A;  4HF0 A;  1UST A;  3GFI A;  2LKP A;  2A61 A;  1ZAR A;  1K78 B;  2VT2 A;  4Q5S F;  1L3L A;  2A5Y B;  1SFX A;  2Z99 A;  4RAZ A;  2P4W A;  5D8K B;  3GZ5 A;  3GUD A;  3CUQ A;  1NHA A;  1HST A;  3HRM A;  1D3Y A;  2BYV E;  1T6S A;  4KN4 X;  1BN5 A;  3IRR A;  4HYE A;  2B0L A;  4PCQ A;  1FX7 A;  5FFX A;  3I54 A;  2RKH A;  3BOQ A;  3QPH A;  3E5X A;  2VON A;  3LA3 A;  1S3J A;  3DPT A;  2IVM A;  5D8L B;  1U5T C;  5HDG A;  3J80 K;  2STW A;  1LEB A;  4L5I A;  2O6G E;  2QQB A;  1UFM A;  2KIU A;  1ON1 A;  5BPI A;  3WOD F;  4D0P A;  2J5O A;  4ESF A;  2FEZ A;  1C0W A;  1LQ1 A;  3ZN0 A;  4OIR F;  1U78 A;  2KJB A;  3NEU A;  2PMH A;  3H92 A;  4ON0 A;  4IJA A;  4JK1 X;  5F1R A;  2V79 A;  4MEY F;  2FA5 A;  3JSP A;  2NNN A;  1ZN2 A;  4P5O A;  1BI3 A;  4OIO F;  2H94 A;  4RB2 C;  1YQA A;  4I0B A;  3E5U A;  5K5R A;  3D5L A;  3PQK A;  4HBL A;  3OV8 A;  1IRG A;  2XHK A;  2AS5 F;  4HX8 A;  4I02 A;  3BJO A;  1FWZ A;  2HYG D;  3I53 A;  1R1V A;  1KU3 A;  2HQR A;  1O57 A;  1QZY A;  1YTY A;  1D8K A;  1BM9 A;  2GQQ A;  5KK1 A;  2OAZ A;  5E18 F;  4CZZ A;  2JTV A;  2QQ9 A;  1SFU A;  4QWQ A;  3ZN1 A;  1XGN A;  5HS8 A;  2QBY A;  4A6E A;  3P9I A;  4F7Z A;  1H0M A;  4MGR A;  2ZCW A;  2OD5 A;  3BDD A;  4KMF A;  5DUK A;  4OOI A;  1RI7 A;  3GWZ A;  4LGW A;  3V7S A;  5TRD A;  2IT0 A;  5L3C A;  4GXO A;  2EFP A;  3VFZ A;  1XCV A;  2TDX A;  3CJN A;  3QU3 A;  4H0E A;  2O8X A;  2V6C A;  2RN7 A;  4RGX A;  1KU7 A;  1HW2 A;  3KLN A;  1QO0 D;  3E5Q A;  2FU4 A;  3TO7 A;  4EJV A;  1O3R A;  3BZ6 A;  2BGC A;  1XMA A;  1HKT A;  3HTU A;  4RB0 A;  2ZBK A;  4AD9 A;  1WKM A;  4GO1 A;  4FX4 A;  5E20 A;  1B6A A;  2Z9O A;  2R7D A;  1J0R A;  1ZLJ A;  3PQJ A;  4EGY A;  2G7U A;  2VBW A;  2QLZ A;  4P55 A;  3ZMT A;  2DU9 A;  5L3E A;  1OR7 A;  2H27 A;  4RGR A;  3M9A A;  4M74 A;  5BQT A;  3F21 A;  3F8C A;  4RGS A;  4G7Z F;  1XB4 A;  2L54 A;  4KFC A;  4N0B A;  1K6O A;  1R58 A;  3QPT A;  3FX3 A;  2VBX A;  3R60 A;  4L9J A;  2RNJ A;  1AWC A;  1RUO A;  1YS6 A;  2QZ8 A;  3FM3 A;  1OKR A;  1BBY A;  3V7C A;  1EV7 A;  5DV5 A;  4OMY A;  5A2Q K;  2E7X A;  4XLN F;  3FF5 A;  1GVJ A;  2VN2 A;  1IN5 A;  4Q48 A;  2DK5 A;  3JTG A;  3M8E A;  1OYI A;  2CGP A;  2EB7 A;  2O61 A;  3EQL F;  3RTR A;  4LLN A;  2KRF A;  4EM1 A;  3SFZ A;  4XSZ F;  1YW9 A;  4KDP A;  1FY7 A;  2KKO A;  1GXQ A;  2FNP A;  2RV8 A;  3H3U A;  3IWF A;  4HLX A;  3TQN A;  3WTU C;  4P9F A;  1QBJ A;  3T8R A;  5ERI A;  1S8N A;  3R61 A;  5CYV A;  1F5T A;  1PP7 U;  2HWV A;  5AIP A;  4HV5 A;  3ZQ7 A;  5JR3 A;  4MQ9 F;  1KU9 A;  1K79 A;  4MQV A;  3V8L A;  1MGT A;  3R6S A;  4ZZL A;  4LD5 A;  2VOO A;  2NS0 A;  1HBX G;  1ZHF A;  1IN8 A;  5DCF A;  4ESJ A;  2J5P A;  4WCG A;  3J81 Z;  1TNT A;  1E2X A;  4UVC A;  3JTH A;  3TO6 A;  2IPQ X;  2XAJ A;  3L9F A;  2RQP A;  3ZMZ A;  1ZG1 A;  1DP7 P;  1XGS A;  1JGS A;  1EH6 A;  4FHT A;  1SMY F;  3CTA A;  1LVA A;  1G3W A;  5LBQ A;  2E1C A;  3E3V A;  5LHI A;  2Z33 A;  4HQE A;  5ICE A;  3HHH A;  3FMQ A;  1ZGA A;  4R8H A;  2LF7 A;  4M6Y A;  3MCZ A;  2IA1 A;  2L4M A;  3GFM A;  4G9Y A;  2COM A;  4U0Y A;  3DEU A;  2CQK A;  3ZP5 A;  5ED4 A;  3RPU A;  2ELH A;  4MEX F;  3RKX A;  1V3F A;  2VE8 A;  4WF2 A;  3K69 A;  2QEN A;  2IA2 A;  1IN4 A;  1XDU A;  1Z7U A;  1FPQ A;  1HXD A;  4Y17 A;  4KIF A;  2FNA A;  2A6H F;  4DQ2 A;  4S05 A;  2YR2 A;  4A12 A;  3B73 A;  5ILV A;  1YW8 A;  4UUV A;  4BNC A;  5DD8 A;  4EJT A;  2BEO A;  2H6B A;  2VBY A;  4LG0 B;  5IT9 Z;  3GF2 A;  1W7P A;  2FXA A;  2L3D A;  4OIN F;  5LEJ A;  4EVI A;  4ZYD A;  1AOY A;  4LLL A;  5J8F A;  4WX9 A;  2W85 A;  1P92 A;  3WGI A;  1BIA A;  1YO5 C;  5HDN A;  4PGG A;  1HKQ A;  3P9K A;  1FBS A;  3FXU A;  2A68 F;  4YII A;  5IT3 A;  2DPU A;  3NRV A;  1JE8 A;  4RAY A;  1F9N A;  2H6C A;  4GGG A;  2EA4 A;  3KCC A;  2E7W A;  3K1M A;  2ESN A;  3I59 B;  3RDI A;  3DPL C;  2HKX A;  1Y0U A;  2ZKZ A;  1Z6R A;  4EM0 B;  3VEP A;  4BXU A;  4LB5 A;  2VOP A;  2K27 A;  2YPR A;  3OOP A;  3I4P A;  2YU3 A;  4LFU A;  1STZ A;  4BYY A;  2OU2 A;  4FX0 A;  1B1B A;  3BRO A;  2F5F A;  2RC4 A;  4EGZ A;  2Q8K A;  5LRR A;  3O6B B;  5HS9 A;  1IXR C;  1PDN C;  1FP2 A;  3M8F A;  5DEQ A;  2D1H A;  2ZNY A;  4Q4Z F;  3KP7 A;  3I71 A;  3HSE A;  3IL2 A;  4E70 A;  3RYR A;  3HOS A;  5F64 A;  4KA4 A;  1R36 A;  4NHJ A;  1R23 A;  2FQ3 A;  2HOE A;  2YX4 A;  4KT5 C;  3L2C A;  2HR3 A;  3M7G A;  4HF1 A;  4QLC U;  3K1P A;  2XUB A;  1I27 A;  3KZY A;  3RIR A;  4I2O A;  2X0L A;  1LJ9 A;  4JQF A;  4A5N A;  5LHH A;  3ZMD A;  3ZMU A;  1J9I A;  3WTY C;  4CDG A;  3GZ6 A;  2DPD A;  1MDM A;  4RGU A;  3F72 A;  5BMZ A;  3HHG A;  1H9G A;  3IWZ A;  2F5E A;  1FYL A;  3HRS A;  3ROU A;  3U1D A;  2OZU A;  1J59 A;  2DQR A;  2P7C B;  4Y13 A;  1KYZ A;  3GXO A;  2GA1 A;  4WXH A;  5D6F A;  1I6X A;  1ZRD A;  2LDU A;  1IN7 A;  4XRF A;  5E8I A;  1FT9 A;  2VC0 A;  4HW0 A;  4L0Y B;  1Z1D A;  1LB2 A;  3SXY A;  2L4A A;  2HTJ A;  3C18 A;  2BV6 A;  2ZME A;  5L3F A;  3MZY A;  1J7K A;  2PLY A;  4ASN A;  5HOO A;  1G4D A;  1KQ0 A;  3V7R A;  1EH8 A;  4YIF A;  1PUE E;  2FF4 A;  4M9S A;  1OYW A;  1IW7 F;  2ISZ A;  2IRF G;  4IRI A;  2FSW A;  1ZG5 A;  2XAS A;  5HVQ C;  2BBY A;  1U5T B;  2MBF A;  5CVV A;  2HTS A;  3LQR A;  4HX7 A;  2IW5 A;  2JT1 A;  2XV4 S;  2IA0 A;  4HDU A;  4GYI A;  2EWN A;  5TJJ A;  1O3S A;  2QQA A;  3J81 K;  1TQI A;  4BHC A;  3KP5 A;  1XGM A;  3I0T A;  1LNW A;  2EJR A;  1J75 A;  3FMS A;  3S2W A;  4OU0 A;  5HS7 A;  5JI6 A;  1QZZ A;  2CFX A;  4O3M A;  2F2E A;  5HLH A;  5D5W B;  5L3D A;  5E8G A;  2EFN A;  1MKM A;  3BP8 A;  3KFW X;  2A69 F;  4ESB A;  3QOP A;  2XAH A;  5L3G A;  3P7N A;  5EEG A;  4KNY A;  1KU2 A;  3HSF A;  1CF7 B;  1T0F A;  6PAX A;  1FSH A;  1U3E M;  5E1W A;  1MD0 A;  1ODD A;  2MLK A;  3WU1 B;  1ZG3 A;  1IXC A;  3GYH X;  4KIG A;  4IHT A;  3TDU C;  2H09 A;  4I0A A;  2P7V B;  1XSD A;  4IXA A;  2JRT A;  4OIP F;  4HV6 A;  4MHG A;  3DFG A;  1Z91 A;  2FE3 A;  3E97 A;  1B59 A;  1G3Y A;  2DAO A;  1XGO A;  5IT9 K;  2W24 A;  3CUQ B;  2FBK A;  2ETH A;  2VOD A;  5ILU A;  3LWF A;  4O6J A;  5L3B A;  4EMS A;  2VT3 A;  4OMZ A;  4ZH4 F;  2CYY A;  5DD4 A;  3ZMS A;  1SMT A;  3LST A;  1P2F A;  1K7A A;  1TW3 A;  2FBH A;  3CLO A;  3RPQ A;  3ECO A;  2W84 A;  1L0O C;  2F5D A;  5FFZ A;  3GFJ A;  3F8B A;  4WXC A;  3CUO A;  3QP5 A;  5DCM A;  2C6Y A;  1RIO H;  3KE2 A;  2Y75 A;  1UHM A;  4UXN A;  4Q47 A;  4EV0 A;  5BS6 A;  2EV0 A;  5H6R A;  4EJU A;  1BIB A;  1WWX A;  1SD6 A;  5CVU A;  1IUY A;  3ABU A;  1P4W A;  1OPC A;  1FYK A;  1HW1 A;  2F5C A;  4XBF A;  3ERE D;  5BOX A;  1WI9 A;  4G7O F;  5F6F A;  4M9X A;  5BPD A;  1FBU A;  1YS7 A;  1LEA A;  3F3X A;  1IRF A;  5ICG A;  4ETS A;  1YG2 A;  3BWG A;  2QBY B;  2D1V A;  2UXX A;  3U2R A;  2GXB A;  3WE2 A;  3U9G A;  4R1H A;  1IAW A;  3F8F A;  2P6S A;  1FYM A;  2OBP A;  4HZF A;  4I01 A;  4YFN F;  3T5X A;  3H3Z A;  3Q5F A;  1U6G A;  2M5W A;  1ONV A;  3K9T A;  4A6D A;  3QP6 A;  1YIO A;  2IP2 A;  1P6R A;  1XN7 A;  1USS A;  4L9T A;  3W6J B;  2Z5U A;  2RDP A;  3VOE A;  5CVI A;  4L18 B;  2ESH A;  3ECH A;  5DYM A;  3JAM Z;  4CYD A;  3E6D A;  1W7P D;  1K78 A;  1ZH5 A;  1S7O A;  1J2X A;  1HKS A;  1X3U A;  2CSO A;  4MNU A;  1I1S A;  2FBI A;  3D0S A;  4ZZD A;  2PEX A;  4MTE A;  1YLF A;  2FML A;  3FXR A;  2ZFW A;  4LJZ F;  1FLI A;  3RKW A;  5JHU A;  1DPR A;  2Y0M A;  4G7H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...