1FYMA

Serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a tail-to-tail orientation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
92
structure length
86
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL-TO-TAIL HSE
publication title Crystal packing interaction that blocks crystallization of a site-specific DNA binding protein-DNA complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
total genus 25
structure length 86
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fymA00
2QQAA 3W6JB 1HXDA 3FMQA 4MQVA 3V7CA 3GYHX 2L3DA 2VC0A 2M8EA 1MDMA 2VBYA 3J7AO 1UCRA 1IN8A 3HRUA 5A2QK 2Y48A 3O2PE 5HS9A 3I5UA 4IHSA 2FSWA 1IUYA 4H0EA 2JPBA 2ZO4A 1F9NA 1QGPA 1O57A 3WGIA 2PFBA 2GWRA 3LWFA 3MZHA 4WCGA 3F21A 3U1DA 4L18B 1Z05A 4AD9A 4P9FA 1R58A 1XSXA 4BHBA 2JTVA 4HOBA 2ADUA 3Q9VA 3HSEA 4HQMA 2M1BA 3D5LA 2ZMEA 4HX4A 2UZKA 2R7DA 4G7HF 4A0XA 3RKYA 3CJNA 3CUQA 3ZQ7A 2QVOA 4Z2YA 3MAJA 1OYYA 4ASNA 4IVNA 2H6BA 3TKYA 1TQMA 4LJZF 3N97A 1DDNA 5H6RA 3E6DA 1J9IA 4ENJA 2XV4S 1QO0D 5H20A 1MZBA 3EUHA 1MGTA 5FLXK 1BC8C 3L7WA 2QWWA 4L5IA 2IRFG 1L3LA 2RKHA 1R00A 2QUFA 4IRIA 4OU0A 2HZTA 3G73A 4M9SA 5K5RA 1YW9A 2RN7A 3E6BA 1USTA 1ONVA 2EA4A 2P4WA 1FBSA 3DKWA 2XVCA 3P9IA 2QENA 3V8LA 2X4HA 2A69F 3SQNA 2LSOA 3CTAA 4IXAA 3GW2A 2HOEA 5DCMA 2FF4A 3T1BA 4LFUA 3NEUA 1YTYA 3ELKA 2PQ8A 3V7RA 3GZ6A 4ZZDA 1ZAOA 4OINF 1FP2A 2K27A 4IJAA 5LBQA 4RB3C 2B0LA 3QP6A 5HLGA 3SZTA 1S6LA 2A6EF 1RNLA 2H27A 2QBYA 2E7WA 1YYVA 4AIKA 2HYFA 2EJRA 3WE3A 1T6SA 3HRSA 2JSCA 3FHZA 5E8IA 4P55A 3KP5A 2NS0A 3RPUA 2GQQA 3RI4A 4AIHA 3JW4A 5J6XA 1FBQA 1XN7A 4NQWA 3AAFA 2DT5A 1U5TA 1P4AA 4ESJA 1VTNC 4WX9A 5D6EA 2FBHA 5L3CA 2XIGA 1TQPA 4MQ9F 3ZPLA 4LLLA 3L9FA 1SMYF 4UVAA 4ETSA 2G7UA 2WV0A 2ZNZA 4LG0B 2PLYA 4G8XA 2PEXA 1ZG3A 5TRDA 4JBAA 4QLCU 1ON1A 3IRRA 4I0AA 4IRGA 2Q2EA 3QOPA 3ZMVA 3COAC 5BQTA 4EJOA 1PUEE 2IT0A 3HHGA 2FMYA 1FLIA 2CW0F 3IWFA 2P5LC 2O6GE 3LQRA 5D5UB 1L0OC 2D1VA 2DW4A 2OQRA 4M6XA 1D5VA 1ZG1A 1YS6A 1JGSA 1I1SA 1R1TA 2XRNA 1NHAA 4XLPF 3ERED 1KYZA 1TQIA 1FSEA 5CYVA 2FEZA 3DPTA 4RB0A 1B6AA 4RGRA 1IXRC 2PMUA 1BM9A 4N9HA 2H6CA 4HF0A 1B9NA 4PCQA 1FP1D 1ZGAA 2BYVE 2VXZA 5TJJA 1Y0UA 1P4WA 1S3JA 1R5HA 1R7JA 2DQRA 5E20A 3TDZC 1WQ2A 1T2KA 5HS7A 4A12A 1E2XA 1T0FA 2V1XA 1FNNA 4EM0B 2HYGD 1LNWA 2M45A 1SFXA 2DPDA 3WE2A 1T39A 1XGOA 3MQ0A 4B8XA 1B4AA 4MTDA 4KIBA 1K7AA 3WTUC 4OOIA 3ABTA 3P9CA 5ICEA 3C1DA 2OA4A 4GO1A 1O3SA 3JSPA 2E1NA 1SFEA 4BQAA 3GXOA 1QNTA 3HHHA 2CQKA 4HX7A 4I01A 2O03A 1ZRDA 1O3TA 1I1GA 3SFZA 1ZH5A 2MLKA 5D5VB 4G9YA 4U88A 3DEUA 4HW0A 3HTUA 1FSHA 1S7OA 2HTJA 1K78B 3QU6A 2DK5A 5JR3A 2WWYA 3DPLC 1YW7A 1IRGA 2EV0A 1I6XA 5LHHA 5DYMA 1OKRA 2VBZA 3E5QA 1OYIA 2K86A 4GGGA 2K02A 1Q1HA 1IN5A 2Z99A 3HRTA 2GXGA 3BOQA 3HOTA 4CICA 2VBWA 4BH9A 1ZN2A 3DQVC 3ZMSA 4OIQF 3KP6A 4N9IA 3K2ZA 3WGGA 3VODA 4ZZLA 3RDIA 2YU3A 2OZUA 2XASA 2F5DA 3E6MA 5AIQA 3K1PA 1KGSA 3FXRA 5HVQC 3I71A 4L9VA 2BGCA 2H09A 2XKOA 4KYWA 1BI3A 4U7BA 4RB1A 4EGYA 1C0WA 1X3UA 2L4AA 1FYKA 4BYYA 2RV8A 3C3WA 1PDNC 2UWMA 5BPIA 3VFZA 2DO7A 1FX7A 4I09A 4HLYA 1IN6A 4LMYA 5HDNA 1J0RA 4G6DA 4EM1A 4BAYA 2YR2A 3B02A 1RIOH 2K4JA 1IXSB 5L3DA 4KNYA 2KIFA 1KU2A 2ELHA 2GIVA 4ENNA 1XDSA 2XUBA 3JTHA 1W7PB 4BHPA 2XAGA 5ICCA 1D8KA 4A5MA 3QP5A 3KCCA 3WTVC 4EV0A 4XRFA 1SD6A 3F8FA 4ESFA 4I0BA 2IA2A 1SMTA 1I5ZA 2RVCA 3ISPA 2W57A 2Q8KA 2V9VA 3ABUA 3TOBA 5LGTA 1DP7P 1LDKB 2IP2A 4I7HA 2ACJA 4M71A 3HIFA 4B09A 3SZPA 3H3UA 4LGWA 3F8NA 3PQKA 1REPC 2GA1A 5DUKA 2D45A 1RUNA 4HLXA 2DBBA 1FT9A 3EETA 5HOOA 2CG4A 5D4RA 4GCVA 4BHCA 5LRSA 5AONA 5IT9K 2A68F 4RS8A 3V4GA 3SXYA 3RPQA 2EFPA 1RI7A 1PP8F 2PJPA 2EV5A 5LEKA 1O3RA 1W4MA 5JI6A 4G94A 3MFKA 1IXCA 1HKSA 1IN4A 3DXJF 4MTEA 1HSJA 2CYYA 2OZ6A 2P5VA 1ZRCA 2ISYA 3GFJA 1RZ4A 1JHFA 1TBXA 1Z6TA 2UXNA 4M72A 5JHUA 3F72A 4MEXF 4WXDA 2A6HF 2VOPA 1XGMA 1OYWA 4LB6B 3GWZA 5D8LB 1XD7A 1HW5A 4M73A 5BMZA 1QBJA 2FE3A 4AIJA 1GHCA 3BJ6A 2V79A 5EEHA 2KRFA 4UHTA 2O8XA 4L5JA 1F5TA 4RB2C 6PAXA 4OIOF 3MWMA 3ZN0A 1LB2A 1CF7B 4NHJA 5FD5A 4KUMA 3U9GA 5IT3A 1TNTA 4ZYDA 3E5UA 2FRHA 2DPUA 5ICGA 1GVJA 4LLGF 1JHHA 1GXPA 3P9KA 4YIFA 1IN7A 2GXBA 1UHMA 4M9XA 4ESBA 2VODA 1P2FA 2M5WA 1R22A 3KLNA 1KU9A 4P96A 1R1VA 4EVIA 3EDPA 2HGCA 2D1HA 2O0YA 3ZMDA 3WTTC 2HTSA 2PG4A 1G4DA 1O7LA 3K1NA 5FB2A 4CZZA 2GZWA 4HA8A 4HF2A 4WK8F 3FXUA 2RGVA 3J81K 2JT1A 2HDCA 4UXNA 2VC1A 4ZYEA 2G9WA 5JFRA 4EM2A 4KIGA 1ZLJA 1USSA 4LB5A 3RKWA 1J59A 5L3GA 1XDUA 4FX0A 2C6YA 3T0YA 1HBXG 2CGPA 1HSTA 1V3FA 4Q47A 3BROA 2XKPA 4GYGA 5DDGA 5LHIA 1BIAA 5ILUA 1PP7U 4OMZA 4ENKA 4Y13A 4G7ZF 2TDXA 1MJBA 2JZYA 2DLLA 1EH8A 3BY6A 2ETHA 3GF2A 5E8GA 5E17F 1J5YA 4Y15A 1B9MA 3QPHA 3FWEA 2DTRA 4EQQA 5IT9Z 3REOA 3JTGA 3KETA 3EQLF 1HW2A 4NB5A 3E6CC 3OV8A 4OMYA 3F8BA 3GFLA 2RC4A 4A2UA 5A2QZ 1AOYA 4R8HA 4EJVA 4OIRF 4IF4A 3IKVA 1I27A 3J80K 4YG2F 3E3VA 2FMLA 4TV7A 3WODF 5E1XA 5J8CA 2ZCWA 2NRAC 3F8MA 3VB2A 4WXCA 3BPVA 2EK5A 4CO8A 5D6FA 3VOEA 3L2CA 2ESHA 2BBYA 1YFHA 2RQPA 3I58A 3KP7A 3WTYC 2ESNA 3I4PA 1XB4A 1F1ZA 4A5NA 2V1DA 2F2EA 3HSFA 1BN5A 3FF5A 3FM3A 1BBYA 1ZHFA 3DP7A 3R60A 4Q4ZF 2L4MA 1QZYA 4EJWA 1HKTA 3CUQC 2DU9A 3HRMA 3WGHA 5K1YA 5FLXZ 4CGZA 3T8TA 4EMSA 2GAUA 1ZRFA 1W5TA 3F6OA 5LEJA 1MDMB 2VE8A 2Z33A 4UVBA 1ZG5A 2LDUA 4LLNA 3GVAA 4IPAA 2MC3A 3C18A 1J2XA 1O7FA 4S04A 3QAHA 3WTWC 3K1MA 3KZZA 2AS5F 3FXQA 4HYEA 4S05A 4FHTA 1FYLA 1A04A 3GEZA 5DUIA 1CF7A 5F64A 1MKMA 4G6QA 4UV8A 4ZYGA 1Z1DA 4HV6A 1FYMA 2DK8A 3KZYA 2ZMEB 2NAZA 1G3SA 3M9AA 1KQ9A 4WWCA 2L01A 1LEAA 1SD5A 2AXLA 4O3MA 3CUQB 3NQOA 3GZ5A 1V4RA 1TLHB 2VONA 3WTXC 3WU0A 2QM3A 1TW3A 3MCZA 4RAZA 2EA2A 4UUVA 1OMIA 1EV7A 3IL2A 4PGGA 2MA3A 3KP2A 2VBXA 4YFNF 4GYIA 3FMRA 3F6VA 3RJPA 3RYPA 4RGUA 2W84A 1YLFA 2IW5A 5AIPA 4XSZF 5ILSA 4FT8A 4HZFA 2HKXA 2ZXJA 4KMUX 3IWZA 4HQEA 1DUXC 2JRTA 3R61A 4PDKA 2P7VB 5LHGA 3I53A 3VEPA 3GUDA 1G3TA 4MNUA 1BI0A 2ZJ2A 1U5TC 4YFXF 1QQIA 3V8JA 2J5PA 3EYYA 4BNCA 2LF7A 4LK1F 1TNSA 3PQJA 3H3ZA 1XGSA 3HYIA 1Z9CA 3RIRA 3IHUA 1KQ0A 2H94A 4U7DA 3ZMTA 3ZMZA 2FQ3A 1S29A 5HLIA 4UV9A 2RDPA 4I02A 1D8JA 5L3FA 3W6KB 2FU4A 2BEOA 2QBYB 2MBFA 2BE5F 1OPCA 4LG0A 3L09A 1R5GA 3RTRA 1KYWA 1P6RA 5FFZA 4D0PA 2BV6A 3CDHA 4HDVA 1U5TB 4AWXB 3P7NA 3LAJA 1LQ1A 2ISZA 3LQQA 2YPRA 3BJAA 3G3ZA 2L54A 5DCFA 2XAJA 3E97A 3GO5A 2HQNA 2IPQX 1FC3A 1U78A 5DD4A 2L02A 3I59B 3I64A 3EYIA 3LFKA 5LGNA 1T98A 2MD5A 3GLXA 3FX3A 1ZARA 4HBLA 5LGUA 2DAOA 1J7KA 1QZZA 3BWGA 2CO5A 2KJBA 1CGPA 3V7SA 2D2WA 4KN4X 2FNAA 2A07F 2P8TA 2CSOA 4QWQA 2COMA 1WKMA 2VT2A 1E17A 1G3WA 5KK1A 2ZBKA 1H0MA 2ZNYA 1JE8A 3S2WA 3CLOA 2Y75A 2A61A 3R6SA 5D5WB 4MGRA 2QZ8A 3TQNA 1W7PD 4U0VA 1XGNA 5CVVA 5BPDA 4A0YA 2LNBA 1U6GA 3CUOA 3WTSC 3LAPA 3F3XA 1IF1A 5H6QA 2HQRA 3T8RA 2O3FA 1MD0A 5ED4A 5CVRA 2W85A 4KICA 3N4MA 1MJ9A 3CO7C 3KP4A 3JAMK 1ZLKA 4R1HA 4KT5C 2K7LA 3ECOA 1JXSA 3ZN1A 3FMSA 1Z7UA 2EFNA 2UXXA 4HV5A 3HOSA 4A6EA 2FOKA 1J75A 2F5FA 1K78A 4AVPA 1D3YA 3R4KA 1LEBA 2E7XA 4JQFA 1R23A 4LK0F 4P5OA 3Q5FA 2Z5UA 3ROUA 3TGNA 2FA5A 4UNOA 3DFGA 2QQ9A 4LD5A 4EJTA 4M6YA 4ZYHA 2R3SA 1T38A 2PI0A 4O6JA 2A5YB 2FXAA 2QLZA 4A6DA 1UB9A 4Q48A 4F7ZA 1EH7A 4I2OA 2IVMA 3F23A 1SD4A 2LKPA 5LRRA 2EV6A 1YQAA 2OBPA 4G7OF 1BIBA 5FO5A 3HSRA 2VN2A 5FFXA 3DV8A 1B1BA 1KQ8A 3GFIA 2HEOA 1DPUA 5K5QA 3GFMA 4CYDA 3H92A 1Z6RA 2ZFWA 2EFWA 5FD6A 5K5OA 4MEYF 4DNCA 3IRQA 4CXFA 2P6TA 3V8KA 2PN6A 1FZPB 1FWZA 1BC7C 4ON0A 2VT3A 3TO7A 2NNYA 4KFCA 4OIPF 2DFIA 3TOAA 4BXUA 1YW8A 4HDUA 1K79A 3WG9A 1LVAA 5CVIA 3LA3A 5E1WA 2XAFA 3Q9SA 2XHKA 1FPQA 1BI1A 1TW2A 3R0AA 2A3SA 2JPCA 4L0YB 4YIIA 5LLQA 1YS7A 3BDDA 5E18F 4U0YA 5CVUA 1UHWA 4YFKF 2ZKZA 3KE2A 2W25A 5DV5A 3RYRA 2FBKA 4L9TA 2GA2A 1H9GA 3ULQB 1FBUA 2P5KA 5D4SA 1W7PA 4GXOA 4HF1A 3TO6A 3GX4X 4PGHA 2HFHA 3QU3A 1FOKA 1QPMA 2F5EA 4IRHA 2DQLA 3IKTA 1YO5C 4HAMA 4K2EA 4KIFA 2Z9OA 2X0LA 5J8FA 1G6NA 5JVTA 3E5XA 3I59A 1XCVA 1BOAA 1XCBA 3SHFA 1SAXA 2CWEA 1IRFA 1HQCA 1KU7A 2M30A 3M7GA 1W5SA 2G7HA 3JAMZ 2P7CB 4UVCA 5ERIA 2PMHA 3ECHA 4KDPA 5HLHA 1XMKA 2KKOA 1U8RA 4RAYA 3DF8A 3KFWX 1IW7F 1TTYA 2XGXA 3D0SA 1ZYRF 1FY7A 1WWXA 1ON2A 1R36A 1XSVA 1XSDA 2O61A 1SD7A 1STZA 4P9UA 3I0TA 4KMFA 4I98B 5DD8A 2MH2A 1OR7A 2STWA 3OOPA 4ENMA 3M1EA 5FGMA 3KP3A 3K69A 2OAZA 3QPTA 2HS5A 1ULYA 3KEOA 1WRJA 4EGZA 1LDJA 4KN7X 4FX4A 3K9TA 5DEQA 2MH9A 2XROA 2PBIA 3F22A 2E1CA 4IHTA 2MLGA 1WI9A 3J81Z 3LA7A 1XMAA 3T5XA 4PZJA 2OD5A 1EH6A 5D8KB 2CFXA 5F6FA 2QYOA 4R79A 1Z91A 1LDDA 3MZYA 3M8FA 2FBIA 3IC7A 5L3BA 2VE9A 3C7JA 4CHUA 3MEXA 3BPXA 2IA1A 5L3EA 2OQGA 1S7AA 4Q5SF 3LA2A 3HUGA 3F8CA 5HDGA 4WF2A 1UFMA 5EEGA 2RNJA 3FZVA 2OU2A 4E70A 2F5CA 2Q0OA 2V6CA 2NNNA 4EJUA 2HR3A 3FM5A 3RKXA 4RGXA 3K0LA 1F4KA 1YG2A 2VOOA 2KJCA 1K6OA 1P92A 2KIUA 2YX4A 3TO9A 3KEQA 4CDGA 4WXHA 2LF8A 4XLNF 3B73A 4M74A 3WU1B 2J5OA 1IAWA 4MHGA 4N0BA 2EB7A 1B59A 3O6BB 1R1UA 1ODDA 3J80Z 3TDUC 2WC2A 5CLSA 1KA8A 1G3YA 2IJLA 5DCMB 2STTA 2XAHA 1MJAA 3NRVA 3ZMUA 1AWCA 3WTZA 1GXQA 4A0ZA 3I54A 3O3KA 4XSXF 1O3QA 1BJAA 3HTSB 1YIOA 4M9ZA 4RGSA 2WTEA 3PFIA 2W24A 1SFUA 1U3EM 1HKQA 1RUOA 3BP8A 5E1ZB 5F1RA 5D5XB 4L0ZB 2YSRA 5ICFA 3JSOA 4KA4A 5CVJA 4O5VA 2QQBA 2EFQA 1HW1A 2Y0MA 1U2WA 1BI2A 4Y17A 4L9NA 3BZ6A 3M8EA 1P4XA 2M87A 2EWNA 5HDKA 3KLOA 4U0WA 3QRFF 4DQ2A 1KU3A 1ZREA 1ZGJA 3BJOA 2K4BA 2HKOA 2R7FA 2Z3YA 3L00A 2YX7A 1WSUA 2DI3A 3ZP5A 3ML6A 2IA0A 5BOXA 1DPRA 5ILVA 4HX8A 4XBFA 2P6SA 2NYXA 4ZH4F 5BS6A 1LJ9A 4L9JA 5CJ9A 1S8NA 1IZ1A 3R0JA 4JK1X 2KIMA 5HS8A 5KVRA 2V1UA 3U2RA 3LSTA 2FNPA 2HWVA 2EFOA 2XAQA 1H9TA 3CO6C
chains in the Genus database with same CATH superfamily
3W2WA 3SFIA 2QQAA 3W6JB 1I50J 4JYKA 1OCPA 4DBRA 1HXDA 2OJED 3FMQA 4MQVA 3V7CA 3GYHX 2L3DA 2O9LA 3JR9A 2VC0A 2M8EA 2WAEA 3RQIA 1MDMA 2VBYA 1Y0NA 1X1PA 5TGTA 3J7AO 1UCRA 5FJ8J 4N4OB 1IN8A 3HRUA 5A2QK 2Y48A 3O2PE 3OY9A 5IOYA 2CU7A 5HS9A 2OTLI 2CH0A 1R4MB 2L2OA 2COBA 3I5UA 3EUKL 2XF5A 3P5JA 2FSWA 5DS9A 4IHSA 3OIPA 1IUYA 4H0EA 2JPBA 1FOXA 2ZO4A 1F9NA 1QGPA 3AFHA 3BZCA 1O57A 3WGIA 2PFBA 2GWRA 3LWFA 3MZHA 4WCGA 3F21A 3U1DA 4L18B 1Z05A 1JI8A 4AD9A 2DA4A 4P9FA 1R58A 2KDOA 2JWTA 4CZCA 1XSXA 4BHBA 1Y8QB 3LSRA 2JTVA 1W0TA 4HOBA 1Y39A 2ADUA 2DFHA 3HSEA 3Q9VA 4HQMA 3PIPF 2M1BA 4JP0A 4BE1A 3D5LA 2KZGA 2PJRA 2H1KA 2ZMEA 3I3LA 4HX4A 2UZKA 2R7DA 4G7HF 2DT7B 2EILH 2BVMA 4A0XA 3RKYA 3CJNA 3CUQA 3BR0A 3ZQ7A 2AXTC 2QVOA 3DEWA 4Z2YA 3MAJA 1LKXA 1OYYA 5GAEJ 3L1PA 4ASNA 4IVNA 1OCTC 3QPLA 1N25A 2H6BA 4IOCF 2W82A 3TKYA 2R7XA 1TQMA 3QYBA 4LJZF 2ZSHB 1JUPA 3N97A 1DDNA 1S7EA 2K9NA 4DZJA 1HA8A 4I99C 5H6RA 4CCNA 3E6DA 1J9IA 2LG4A 4ENJA 2XV4S 1QO0D 2JSPA 5H20A 2M34A 1MZBA 3EUHA 1PUFB 2WB1N 1OCOH 1MGTA 5FLXK 1BC8C 3GTQJ 3L7WA 1E3HA 2QWWA 4L5IA 3M07A 5KNLA 3NWSA 2R7QA 2IRFG 1L3LA 2WADA 2RKHA 3KYDB 5E3LA 5GPCA 4A3DJ 1R00A 4YRVA 2QUFA 3ERMA 4IRIA 2L0KA 4OU0A 1MMAA 2HZTA 3IP4B 3FBNB 4PJLA 3G73A 3QPSA 4M9SA 1Y6IA 2N8GA 2V9KA 2IBDA 3FK7A 4XKWA 5K5RA 1YW9A 4MO7A 1NH3A 2RN7A 3E6BA 4HG2A 1USTA 1ONVA 2EA4A 1W36D 3SYTA 2P4WA 1FBSA 3DKYA 3DKWA 3A01A 2XVCA 2R7TA 4DYCA 3P9IA 2QENA 4D7NA 3LFUA 2IS4A 3V8LA 2DJNA 2X4HA 2A69F 3SQNA 3G6EI 4UUSB 4KISA 5EDNA 4A3KJ 1IDZA 4A93J 2LSOA 3WU2C 5K7HA 3CTAA 4IXAA 5JHFA 3GW2A 1VQKI 2HOEA 5DCMA 4BL0B 2FF4A 3T1BA 4LFUA 2XPUA 4FE4A 2ELJA 3NEUA 1EA3A 1YHQI 4MFDA 1YTYA 3ELKA 2PQ8A 3I4NJ 3V7RA 3GZ6A 4ZZDA 4BU2A 1ZAOA 5GP9A 4OINF 1FP2A 2K27A 4IJAA 5KCMA 4XRSA 4CYCB 2KRHA 5LBQA 2B0LA 4RB3C 3LSIA 3QP6A 5HLGA 2LP0A 3SZTA 1VF9A 2IGMA 2QCOA 3I55I 3PM1A 2ZFUA 5F1JA 3ZGKA 1S6LA 2A6EF 1RNLA 1AHDP 2H27A 2QBYA 2E7WA 1YYVA 4AIKA 3AL0C 2HYFA 4J00A 2EIMH 3JCUC 2EJRA 3WE3A 1T6SA 3HRSA 1NG7A 4BDYA 2JSCA 1BR1A 1ETYA 3FHZA 3BR2A 1UHSA 2NS8A 5E8IA 1RC9A 3CCMI 4P55A 1NK3P 3H9GA 3BT9A 3KP5A 4M3DA 2IS2A 2NS0A 3RPUA 2GQQA 1H8AC 3TW7A 3RI4A 4AIHA 3JW4A 2R0QC 1K4SA 5J6XA 1FBQA 1XN7A 4NQWA 3AAFA 2DT5A 1U5TA 2X48A 1P4AA 2H8WA 4ESJA 1VTNC 4C9YA 1APLC 4MIMA 4WX9A 3PNTA 5D6EA 1K4TA 1I39A 2FBHA 4ZDPA 5L3CA 2XIGA 3VYUB 1TQPA 4MQ9F 3ZPLA 4LLLA 3L9FA 1IDYA 1SMYF 2XPVA 4UVAA 2Y69H 4ETSA 2ZB9A 2G7UA 2WV0A 2ZNZA 4RM3A 2NVYJ 4HNUA 5B1AH 4LG0B 4XRMA 2DT6A 3BC8A 1GV2A 5B5EC 2PLYA 4G8XA 2PEXA 1ZG3A 5TRDA 4JBAA 1OISA 4QLCU 3HOVJ 1JKQC 1ON1A 2VQCA 3IRRA 4QSHA 4I0AA 3HOXJ 2DMTA 4IRGA 2Q2EA 4PSWA 4C3HJ 3BTLA 2NS7A 2VJ4A 3QOPA 4NDLA 5JVGF 4IEJA 3ZMVA 4E4HA 3COAC 3HGGA 5BQTA 3RZOJ 2E1OA 1YOVB 4EJOA 3ZRGA 3OSGA 1PUEE 3ZQFA 1D1AA 3HOYJ 3AL0B 1K6YA 3FISA 3GBGA 1V55H 3OS0A 2IT0A 3HHGA 3H5AA 3JREA 3IUOA 2FMYA 4CCMA 1FLIA 2CW0F 1SVMA 3IWFA 2F6CA 5EZHA 2P5LC 2O6GE 3LQRA 1X58A 1A6QA 4ITVA 5D5UB 1L0OC 2D1VA 3DBRB 1MH3A 2DW4A 2OQRA 2W1OA 4M6XA 1D5VA 2E60A 3BCBA 1ZG1A 4M3FA 1YS6A 5CQEA 2XC7A 1YI2I 1JGSA 1MW7A 4B3XA 1G8XA 1I1SA 1R1TA 2XRNA 1NHAA 4XLPF 1JJ6C 3JRHA 3ERED 1KYZA 1TQIA 1FSEA 4CUGA 2HXIA 5CYVA 2FEZA 4E7KA 2R7UA 3DPTA 2H8RA 4RB0A 1B6AA 4RGRA 3OYIA 1K61A 3EUAA 1IXRC 2PMUA 1BM9A 3ESWB 4N9HA 2H6CA 4HF0A 1H88C 1B9NA 4PCQA 1FP1D 1ZGAA 2LK2A 2BYVE 2XGDA 3U21A 2VXZA 1LFUP 3FXKA 1OLTA 2VJIA 3ZQIA 5TJJA 2LOOA 1Y0UA 3FKIJ 4BY1J 1P4WA 4E7ZA 2CW7A 1TWFJ 1S3JA 1R5HA 2MFZA 2XSJC 1R7JA 3SJMA 2DQRA 1HOMA 5E20A 3TDZC 1WQ2A 1T2KA 2DMNA 5HS7A 4A12A 3CJQB 5CKTA 1E2XA 3S16J 3K2AA 1WJFA 1T0FA 2V1XA 1V5GA 1TT5B 4XQFA 1FNNA 4EM0B 2HYGD 3AKZA 1LNWA 2M45A 1SFXA 3KX2A 2DPDA 3WE2A 3S2DJ 1T39A 3S3NA 1ENHA 1XGOA 3MQ0A 1YJNI 1JT0A 4B8XA 2M0CA 4XLHA 5GTHC 3AG4H 1B4AA 4MTDA 4A3EJ 4KIBA 1K7AA 2O5RA 3LMMA 3WTUC 2WV1A 4C2TA 1X1CA 3S15J 4OOIA 5DTDA 3ABTA 5CQGA 2LBFA 3P9CA 3TBIA 2EZLA 3C1DA 5ICEA 3M8JA 2OA4A 2WY7Q 1UELB 4NC7A 4GO1A 1O3SA 1RPWA 3JSPA 2E1NA 1JGGA 3SZGA 1SFEA 1XX5A 4BQAA 4BBSJ 3GXOA 4B47A 1QNTA 2M4KA 3HKZA 5F27A 3HHHA 4D1QA 2CQKA 1VZ0A 4HX7A 1S72I 4I01A 2O03A 1ZRDA 1O3TA 3FXLA 1I1GA 3SFZA 2AHQA 1ZH5A 2MLKA 1DGWY 5D5VB 3CZ6A 3ZXSA 4CSWA 4G9YA 4U88A 3DEUA 2LKSA 2KDZA 4HW0A 4DIQA 1R4NB 2JA8J 1Z21A 2WAFA 3HTUA 1FSHA 1S7OA 2HTJA 2CUEA 2L9NA 1K78B 3QU6A 2DK5A 5JR3A 1M1EB 2WWYA 3OYBA 3DPLC 1PUFA 2MGQA 4HNTA 2CUJA 1YW7A 2ZXIA 4BXFA 1IRGA 1D5YA 2EV0A 1I6XA 5LHHA 1DU0A 3HOZJ 5DYMA 2DMUA 4BS9A 1OKRA 2JA6J 2OCEA 2VBZA 2K3FA 3E5QA 1OYIA 2K86A 4NC6A 2EZHA 4GGGA 2K02A 2UV1A 1Q1HA 1VI0A 2JA2A 4F93B 2Z99A 1IN5A 2DOEA 3HRTA 3M4OJ 2GXGA 3BOQA 3K4LA 1NK2P 1X3ZB 2LY9A 2X51A 1H89C 2DJIA 1FTZA 3OR1C 2K40A 2IAIA 2LR8A 3HOTA 4CICA 4BJ6C 2VBWA 2OF7A 3MD2A 1WCMJ 2O7OA 4BH9A 1ZN2A 3CC7I 3WG7H 4HEA2 3DQVC 3U1KA 3ZMSA 4OIQF 1RRJA 3KP6A 4N9IA 3K2ZA 3WGGA 2E36A 3VODA 4BEHB 3GCMA 3MMYB 4ZZLA 3RDIA 2KT0A 2YU3A 2HDWA 3OWTA 4LOCA 3GLLA 4GRIA 1ERDA 1LVKA 4AC0A 2OZUA 3PO2J 1KZHA 2XASA 2F5DA 2XRLA 3E6MA 5AIQA 3K7AJ 2CQ7A 3PUBA 1TZLA 2FUG2 4G12A 1WVRA 3K1PA 1KGSA 3ASNH 4BACA 3FXRA 5HVQC 3I71A 3A2KA 2VQHA 4D7MA 2QSFX 4L9VA 2BGCA 2H09A 2XKOA 1SEUA 2Y31A 3TP3A 4KYWA 2MC4A 1HDDC 1BI3A 3CCVI 2OC6A 2IGKA 4U7BA 2G0EA 3FXOA 4RB1A 4EGYA 1C0WA 1X3UA 2L4AA 4PK4A 1FYKA 4X0GA 4BYYA 2RV8A 3C3WA 2DOFA 3C2BA 2LMDA 1PDNC 2UWMA 5BPIA 1N77A 5J3LA 1YX5A 4XLCA 1FEXA 3VFZA 4FQGA 2DO7A 1FX7A 4I09A 4HLYA 1IN6A 4LMYA 4V2FA 5HDNA 1WJDA 4BBRJ 2OPTA 3AG1H 1J0RA 4XOTA 3L2UA 2LFBA 4G6DA 2KISA 4EM1A 4BAYA 2ZSIB 2YR2A 3DTKA 3B02A 1RIOH 2K4JA 1T33A 1IXSB 1P9QC 5L3DA 4ANJA 1IGNA 5FRMA 4KNYA 3TMOA 2KFDA 1F43A 2KIFA 3RSNA 1KU2A 2ELHA 2GIVA 3JRFA 1D0XA 4ENNA 1XDSA 2XUBA 3JTHA 3G1LA 3L2RA 2YUSA 4IO9F 1W7PB 4IZZA 1WFXA 5FKOA 2XAGA 4BHPA 3O8HA 1D8KA 5ICCA 4A5MA 2EPFA 3FXMA 3KCCA 3QP5A 3WTVC 4RLQA 4EV0A 3HBLA 2LY1A 4XRFA 1SD6A 3F8FA 2Z2SB 4ESFA 4I0BA 1TP4A 2IA2A 4AUXA 1SMTA 1I5ZA 2RVCA 4DZPA 3ISPA 1A31A 4RMNA 2W57A 1VNDA 1SC7A 1AU7A 5J4YA 2DXIA 1YIJI 5FRNA 2Q8KA 3RCOA 2V9VA 3F0CA 4KITB 2ME0A 5FLVA 4C30A 3ABUA 3PNYA 1OR7C 3TOBA 1HLVA 2LVSA 4PJNA 5LGTA 1DP7P 4E6KG 1LDKB 2IP2A 4I7HA 2ACJA 4M71A 1IV6A 3MKYB 3HIFA 4B09A 3SZPA 3H3UA 4LGWA 2EINH 2HDDA 2VL8A 4XK4A 3F8NA 3PQKA 1REPC 4FCYA 2GA1A 5DUKA 2DA1A 2D45A 1RUNA 4HLXA 2DYRH 2ID3A 1RESA 5IYDJ 2DBBA 3GTGJ 1FT9A 4BKXA 3EETA 5HOOA 2CG4A 2VKDA 5D4RA 4GCVA 4AYBN 1NG6A 4BHCA 5LRSA 1W36C 5AONA 2R7SA 5IT9K 4OAYA 3LSGA 5F0FA 2A68F 2X6YA 5GADJ 4RS8A 2QGUA 3SXYA 3RPQA 1IUFA 3V4GA 1B72A 2EFPA 1VQ6I 1RI7A 5M5WJ 4YEJA 1OJLA 1PP8F 2PJPA 4CCJA 2VUMJ 2ZJQF 2ME6A 2EV5A 5LEKA 3FDYA 1O3RA 2I8DA 1W4MA 3ZQQA 5JI6A 4G94A 3MFKA 1IXCA 1HKSA 1DGRM 2CS3A 1IN4A 3DXJF 4MTEA 1HSJA 1FIAA 2CYYA 1B8IA 3CDLA 3H0GJ 2OZ6A 2P5VA 1ZRCA 2ISYA 2WBMA 3GFJA 4D9JA 1RZ4A 3GZNB 3M3YJ 1JHFA 1TBXA 1Z6TA 2UXNA 4M72A 5IP9J 5JHUA 5EEAA 3F72A 2WY8Q 2R5ZB 4MEXF 3B6CA 5EG0A 4WXDA 1RKTA 2A6HF 2DA2A 2VOPA 1XGMA 3E0JB 1OYWA 3JRGA 4LB6B 2XAUA 3GWZA 2YU9J 1HF0A 5D8LB 3H5RA 4HNVA 1XD7A 1HW5A 4M73A 3PNVA 4Y52J 5BMZA 1MNMC 1QBJA 3EPZA 4DYRA 2QKMB 3Q0WA 2R5YB 2FE3A 3HPHA 4AIJA 3VSLA 1WZ2A 2BW3B 2VASA 3DKXA 1GHCA 3HL2A 3BJ6A 2PX9A 2V79A 1UMQA 1AKHB 2BY3A 3DCFA 5EEHA 2KRFA 4UHTA 2O8XA 4L5JA 4XRSG 3QYFA 1YRNA 5HODA 1F5TA 4BY7J 2M3AA 4RB2C 1MBHA 6PAXA 4OIOF 3MWMA 3ZN0A 1LB2A 2XB5A 1CF7B 5FD5A 4NHJA 2WAQA 3GTKJ 4KUMA 4A3LJ 1Z67A 3U9GA 5IT3A 1TNTA 4ZYDA 3MKWB 2Z1DA 3E5UA 4RAGA 4PSXA 2JUGA 2FRHA 3CF5F 2DPUA 5ICGA 4DJAA 1GVJA 4JX6A 4LLGF 1JHHA 5F08A 1GXPA 3P9KA 4YIFA 1IN7A 1FMVA 4DBQA 2GXBA 1UHMA 1ZELA 4Y33A 3H1CA 4M9XA 4ESBA 2Z16A 2VODA 1P2FA 2M5WA 2W4SA 3HUGB 1TWHJ 1R22A 1OFCX 3BG7A 1KU9A 2CQQA 3KLNA 4P96A 4EATA 3HB9A 3S3MA 1R1VA 4EVIA 3EDPA 2R7OA 2HGCA 3S8PA 2D1HA 4CH7A 2O0YA 1ZR4A 3ZMDA 2DODA 1K83J 3WTTC 2HTSA 2PG4A 1G4DA 3OYAA 1O7LA 3K1NA 5FB2A 4CZZA 2GZWA 3ZCOA 4HA8A 1A5JA 4HF2A 4WK8F 3ZQHA 3FXUA 2IEKA 2RGVA 2F5VA 3ABLH 3BR6A 3J81K 2X1DA 1A35A 2JT1A 2HDCA 4UXNA 3G2BA 1SFKA 2VC1A 4ZYEA 2G9WA 2VXDA 4A69C 2IS1A 1QHHD 3BZKA 5JFRA 4J19A 3B6AA 3PSFA 3HM5A 4IQJA 5TISC 2VB6A 2A05A 4D5CA 4EM2A 4IKFA 4KIGA 1ZLJA 1JJ8C 1USSA 1ETXA 4LB5A 3RKWA 1J59A 2QA4I 4FISA 5L3GA 1ORKA 1XDUA 4FX0A 1MMDA 2C6YA 3T0YA 1U9OA 1HBXG 2CGPA 3BG6A 1HSTA 1JTYA 3DWLE 1DP3A 1V3FA 1MBJA 2CFOA 3BG5A 4Q47A 3BROA 2Y2ZA 4MFEA 2XKPA 2BOLA 2K85A 2KQRA 1N75A 2L7MP 3OYMA 4GYGA 5DDGA 2CUZA 5EZGA 3BQZA 5LHIA 1AA7A 1BIAA 5ILUA 2A6TA 1PP7U 1Z3XA 1Y8RB 3LSHA 2JN6A 2F4MB 4OMZA 4ENKA 4Y13A 3BTIA 2TDXA 4G7ZF 1MJBA 2JZYA 2DLLA 1EH8A 1XG1A 2V1NA 4A3CJ 1UG2A 3HGYA 3K70D 3BY6A 2ETHA 2VQGA 3GF2A 2LH9A 5E8GA 5E17F 1J5YA 4Y15A 1UAAA 1B9MA 4BDZA 3QPHA 3FWEA 2DFFA 2DTRA 4EQQA 3SEZA 5IT9Z 3REOA 3CCRI 5JLXA 3JTGA 4IHXA 3KETA 3EQLF 1ZR2A 1HW2A 4NB5A 1XPXA 3E6CC 3OV8A 2CMPA 4OMYA 3F8BA 5IP7J 3GFLA 1S5LC 2RC4A 2YS9A 4A2UA 2KPMA 4C2UA 5A2QZ 3SEQA 2DMPA 5K7ZA 1AOYA 4MLOA 4R8HA 4EJVA 3OYNA 2K3PA 4IF4A 4OIRF 3ZQCA 5IY5H 2HOTA 2M8GX 3HXLA 3IKVA 4E7JA 1I27A 2LLKA 3J80K 4YG2F 2EZKA 4M3GA 3E3VA 2FMLA 3IAS2 4TV7A 4CCLA 3GTOJ 2GBYA 3WODF 2MYSA 5E1XA 5GTIC 5EGOB 3OYFA 2HVQA 1RR8C 1BR2A 5J8CA 2ZCWA 2NRAC 1X4OA 3F8MA 2GIZA 2ZJRF 2EIJH 4BE0A 1LE8B 3A4CA 3VB2A 3BCAA 1X19A 3BPVA 4WXCA 2EK5A 4CO8A 3RQ4A 2LC2A 5D6FA 3LNQA 3VOEA 3L2CA 2ESHA 2BBYA 1YFHA 3WHCA 4IHVA 1BW6A 2WB1A 2DA6A 2RQPA 3I58A 3OYEA 3DLAA 3KP7A 3WTYC 3LSMA 1VQOI 3GTLJ 2ESNA 2XDVA 3I4PA 4XN0A 4M6VA 3H35A 3HC7A 1OCCH 1JUMA 2VKVA 1XB4A 1F1ZA 4IL6C 4A5NA 1QPIA 2V1DA 2F2EA 1BL0A 1Z77A 2W7NA 4A3GJ 3ZQLA 3HSFA 1TWAJ 3PIOF 1BN5A 3FF5A 1T95A 3PFYA 3H0DA 3FM3A 2V6EA 1GLNA 1BBYA 1ZHFA 2HU9A 3DP7A 3R60A 3OS1A 4Q4ZF 1G59A 2L4MA 2ZMEC 1QZYA 3K4CA 2CV2A 1U9NA 4EJWA 1HKTA 5M5YJ 4RBOA 1PVEA 3CUQC 2DU9A 3HRMA 3WGHA 5K1YA 5FLXZ 4CGZA 3T8TA 4EMSA 2GAUA 1WPKA 1ZRFA 2BY1A 4RAFA 4KT6A 4LIUA 4J01A 1D1CA 2K9SA 1W5TA 3F6OA 3ONQA 5LEJA 1MDMB 2VE8A 1QU3A 2Z33A 4AIDA 1MMGA 3CCYA 3S1QJ 2OV7A 2HYJA 4UVBA 3IV5A 1ZG5A 2LDUA 4LLNA 1Z7LA 3GVAA 4AM3A 4IPAA 5IYCJ 3I4MJ 2MC3A 3CCJI 3C18A 1J2XA 2XSDC 1O7FA 3EUHC 4S04A 1AKHA 3K6GA 1E0EA 3QAHA 3WTWC 2KHMA 3Q0VA 4F92B 1MNDA 4ZC3A 3K1MA 4A3IJ 3CCQI 3KZZA 2AS5F 3FXQA 4FE7A 4HYEA 2X6WA 4FHTA 4S05A 1FYLA 2B63J 4ZTJA 1A04A 3GEZA 2H1LA 2EZIA 3K4BA 4AVZA 1POGA 2BVLA 5DUIA 1CF7A 5F64A 1MKMA 3MKLA 4ZDLA 3OYHA 4G6QA 4UV8A 2L7FP 4B43A 1WJCA 1ETQA 1Z1DA 2XB0X 4HV6A 4ZYGA 1FYMA 2DK8A 3KZYA 3O8GA 2ELKA 2PJRB 2ZMEB 2NAZA 1I3QJ 1G3SA 3M9AA 1KQ9A 4XKCA 4WWCA 2L01A 1LEAA 1SD5A 3TEDA 3DTEA 3MVPA 3I9V2 3PO3J 2AXLA 4O3MA 4NNJA 3CUQB 3NQOA 4BGDA 1TT0A 2CQNA 3GZ5A 1PJRA 3F9KA 1V4RA 3K4JA 3GTJJ 1TLHB 1QRYA 3PJRA 2HQAA 3WTXC 2VONA 1VQ5I 3H9QA 2V26A 3WU0A 2W48A 2QM3A 2D5VA 1XS9A 5IOZA 1TW3A 3MCZA 3ABKH 4II2A 4RAZA 5JLWA 2EA2A 5J4VA 4UUVA 2PMZA 1OMIA 3A0BC 3GTPJ 1EV7A 1LUJB 4RM2A 1JKOC 2DN0A 3IL2A 4PGGA 2MA3A 3KP2A 1VQMI 4D5FA 1X1AA 2VBXA 3LL7A 4YFNF 4GYIA 3FMRA 2E2HJ 2R7VA 3F6VA 4B1RA 3RJPA 2BZTA 2VI6A 3RYPA 4RGUA 4UUSA 2W84A 2LYCA 1YLFA 2IW5A 1RR7A 5AIPA 3JRAA 4XSZF 1QVTA 5ILSA 4FT8A 2V4JC 1JUSA 4HZFA 2HKXA 4M3BA 1VQ8I 2ZXJA 4KMUX 4F3QA 4XIDA 3IWZA 4HQEA 3E7LA 3Q3SA 1DUXC 4M3EA 2JRTA 3R61A 4PDKA 1GT0C 3K4NA 2P7VB 2MABA 5LHGA 1MNEA 4CYCA 2EBIA 2XPWA 3I53A 3GUDA 3IH3A 3VEPA 1G3TA 4MNUA 1BI0A 4XKVA 4PJ0C 2ZJ2A 3OIQA 1U5TC 4E7HA 3VYRB 4B3AA 1DU6A 1FMWA 4YFXF 1QQIA 4XOPA 1JKPC 1VQ4I 3H5NA 3V8JA 3CCSI 4IHWA 3OYCA 2J5PA 3A01B 1WHUA 3EYYA 4BNCA 2LF7A 4XMYA 4LK1F 1TNSA 2GOXB 3H3ZA 3K10A 3PQJA 1QA6A 1XGSA 3HYIA 2RNGA 3RIRA 4A3MJ 3IHUA 1Z9CA 1KQ0A 2H94A 4U7DA 3ZMTA 1QHGA 1X2NA 5IYBJ 3ZMZA 2O8KA 3FIWA 4EEFG 2FQ3A 1S29A 3KZIC 4ZDOA 2OUMA 2VKHA 3JRIA 2R7RA 5HLIA 4F91B 4UV9A 3DLLF 1X2MA 2JK3A 1TWGJ 2RDPA 3KIOA 4I02A 9ANTA 1D8JA 2OCCH 1WH7A 4PFPA 3J7ZI 5L3FA 3W6KB 2FU4A 2DDBA 2BEOA 2QBYB 5HNHA 2ECCA 2MBFA 4LG3A 2EIKH 2LD5A 4HPQA 3A0HC 1Y1WJ 1ZGWA 3MZ8A 2E71A 3H3VK 2BE5F 3OL4A 1R6RA 2DMQA 1OPCA 4XNFA 4LG0A 5IP6A 1HC8A 3L09A 1R5GA 3RTRA 1KYWA 3HEFA 2CRGA 1P6RA 3MN2A 5FFZA 4D0PA 1XMXA 2VPLA 3FBIB 2BV6A 2HZDA 2E2IJ 5FROA 3CDHA 2WAQN 4HDVA 3CC2I 4QIWN 1U5TB 4W1UA 5C3EJ 4L5EA 1MSFC 4AWXB 2VLAA 3P7NA 3LAJA 1LQ1A 4XL9A 2ISZA 3LQQA 3JRCA 2JMWA 1HCRA 2JQ7A 2YPRA 3BJAA 3G3ZA 1E3PA 2L54A 5DCFA 1WJAA 2XAJA 1WJBA 1ZKGA 3E97A 3GO5A 2HQNA 2IPQX 1FC3A 1U78A 5DD4A 1RETA 2L02A 2KP6A 3I59B 1NTCA 3I64A 3EYIA 2HQ5A 2BY2A 3LFKA 5LGNA 2Y0SA 1MIJA 3W2VA 1T98A 2E34A 2Q2EB 2MD5A 2VIXA 4B48A 1Z3YA 3HG9A 3HOWJ 5E3NA 4XONA 3IH4A 3GLXA 3FX3A 4XORA 1ZARA 1T0FC 4HBLA 4X1EA 4XKBA 3VYSB 5LGUA 1OCZH 1J7KA 1QZZA 1X1DA 1X4PA 2DAOA 3BWGA 3MKZA 5GAHJ 4DGWB 2CO5A 4E7SA 3BG9A 1WJ5A 4XN3A 5E79C 2AQEA 2VJ5A 2VJJA 2KJBA 3OYJA 1CGPA 1GUUA 2JVGA 3V7SA 2D2WA 1D0YA 4KN4X 2FNAA 2A07F 2P8TA 4NBQA 2CSOA 4QWQA 2COMA 3WHBA 1MBKA 1WKMA 4BUPA 3JRDA 2VT2A 1E17A 1G3WA 5KK1A 2ZBKA 1H0MA 2ZNYA 3TL4X 1JE8A 2KMUA 3S2WA 1Y1VJ 3CLOA 4II3A 2OTJI 3DU5A 2Y75A 5C44J 2A61A 3R6SA 3G1OA 5D5WB 4MGRA 2HOSA 3CMMA 3CDIA 3I56I 2QZ8A 3M1CA 2KRCA 3TQNA 1W7PD 4GFBA 4U0VA 1XGNA 1SVLA 5CVVA 4DYQA 5BPDA 2VPRA 2K9MA 2ID6A 3GMEA 4FETA 4A0YA 2LNBA 3LOCA 1WGXA 5DM7F 1U6GA 2DDAA 3CUOA 3HZJA 5LFAA 3WTSC 3LAPA 1V5EA 3F3XA 1F36A 4DOZA 4UUTA 1IF1A 2HVSA 5H6QA 2HQRA 1HDPA 3T8RA 3VSKA 2HNHA 2O3FA 1RKWA 1MD0A 5ED4A 3C2HA 1ETOA 5CVRA 4AU7A 1LFBA 3VYTB 2W85A 4KICA 3QYEA 1DQUA 3N4MA 1MJ9A 4YIRX 1GDTA 3CO7C 3KP4A 3JAMK 1ZLKA 4R1HA 3BQYA 4KT5C 2M2EA 5HLTA 2E2JJ 2HI3A 2BY0A 2K7LA 3ECOA 2E5ZA 3LSKA 4A3BJ 3GTMJ 3ZN1A 1JXSA 1I6HJ 2F4OB 2FOWA 3FMSA 2V9PA 3ABMH 5KAIC 3K70C 1Z7UA 2HVRA 2K9LA 1VFCA 2EFNA 2UXXA 4NUBA 4HV5A 3HOSA 4A6EA 2FOKA 2L9RA 3H36A 1BOBA 2TCTA 3X2QH 3S32A 2F5FA 4IQ4A 3PSIA 1J75A 1R5ID 3OIOA 2LREA 2BHYA 1K78A 2P81A 4AVPA 2M7AA 3V42A 1D3YA 3R4KA 2IGNA 4QPQA 2LBFB 1LEBA 2E7XA 5FKMA 4JQFA 1R23A 4LK0F 3S17J 4P5OA 3Q5FA 3CCLI 1O4XA 2Z5UA 3ROUA 1VQLI 3TGNA 3CMEI 2FA5A 1JT6A 4UNOA 5B1BH 3N05A 5KAFC 1OCRH 2ICWG 3DFGA 2CJJA 2QQ9A 4LD5A 4OAZA 4PUSA 4EJTA 1X1BA 4M6YA 4ZYHA 2R3SA 1A36A 4I6ZA 1T38A 5FLMJ 5DM6F 3OOUA 2PI0A 4B44A 4S0HB 3S1NJ 2Y30A 4O6JA 2A5YB 2FXAA 2QLZA 4A6DA 1UB9A 2X6OA 3AG2H 2CQXA 4Q48A 2JJ7A 4F7ZA 1EH7A 2IXSA 1A6IA 2R7WA 3S1MJ 4I2OA 2IVMA 1FTTA 2JUCA 2ECBA 2M7BA 3F23A 1SD4A 3ZQGA 1E3OC 1W0UA 2LKPA 2AO9A 5LRRA 2EV6A 2DA7A 1YQAA 1J09A 2OBPA 4G7OF 3CQZJ 1BIBA 1WJEA 2DA5A 5FO5A 1I3AA 3HSRA 4BEHA 5EJCA 1GV5A 1ZQ3P 2VN2A 2K5CA 3KEYA 2V7FA 3HJEA 5FFXA 3CP8A 3DV8A 5F0CA 4ZYAA 1B1BA 4C2MJ 1KQ8A 2DYSH 3OYLA 3GFIA 1MMNA 3A1YA 2HEOA 3FHNA 1DPUA 1VQPI 2RQQA 3HOUJ 3E1SA 5K5QA 3GFMA 2LTPA 4CYDA 3H92A 2E5NA 1Z6RA 2ZFWA 2EFWA 5FD6A 5K5OA 2ZXWH 5F0HA 4MEYF 3OL3A 4DNCA 3S14J 3IRQA 3ASOH 2Y9YA 4DW6A 4CXFA 5M5XJ 2P6TA 1VQ7I 3V8KA 3BTCA 3PUFA 1WI3A 2PN6A 4AYBA 1FZPB 1FWZA 3CCEI 1OQYA 1SAUA 4BJTA 1BC7C 4ON0A 2R7ZJ 2VT3A 3TO7A 1TC3C 2QSHX 2NNYA 4KFCA 4OIPF 2DFIA 3TOAA 2QQ8A 4BXUA 2KZVA 1YW8A 4HDUA 2K9QA 3FK6A 3S3OA 1K79A 4W97A 3WG9A 2E19A 1LVAA 3CJRB 4HRIA 5CVIA 3LA3A 5E1WA 2XAFA 5GAGJ 3Q9SA 3BR5A 2KIQA 2XHKA 1QVUA 3UKGA 4RDUA 1FPQA 1BI1A 1TW2A 3R0AA 1MH4A 2A3SA 2JPCA 4L0YB 2WA0A 1KONA 4YIIA 3S2HJ 3HKZN 2VQLA 4UY8I 2BHZA 5LLQA 1UG0A 1YS7A 3BDDA 4F52A 4FTHA 5E18F 3ZOBA 1W5CC 4U0YA 5CVUA 1UHWA 2VKEA 3AG3H 4YFKF 4Z6YA 2ZKZA 4BQOA 3KE2A 3CJTB 2I5UA 1U8BA 1MBGA 5EYRA 2W25A 3DTIA 5DV5A 3RYRA 2FBKA 4L9TA 2GA2A 4BQNA 1H9GA 3ULQB 1FBUA 1ETWA 2M0MA 2P5KA 5D4SA 5LD2C 5C4JJ 1W7PA 4GXOA 4HF1A 2KL4A 3TO6A 4BXXJ 3GX4X 4PGHA 3W6VA 2HFHA 3QU3A 3JRBA 1T8IA 1FOKA 1MBEA 4RLFA 5B66C 5K7FA 1PYVA 1QPMA 2F5EA 2Y9ZA 1BA5A 4IRHA 2DQLA 5J1YA 4I76A 3L2VA 3TW6A 3IKTA 2F48A 1YO5C 4HAMA 4K2EA 2GXAA 4KIFA 3S93A 2JA5J 2Z9OA 4IX7A 4V2GA 1UJ8A 4QPOA 2X0LA 5J8FA 1G6NA 4XLAA 3E5XA 3I59A 5JVTA 1MSEC 3OS2A 2W00A 1XCVA 1BOAA 1XCBA 4RA2A 2QEXI 4XLFA 3SHFA 4KJZA 1SAXA 5HNFA 1D0ZA 2CWEA 1IRFA 1HQCA 2PMZN 1D1BA 3CMAI 3CC4I 1KU7A 2M30A 2QSGX 3M7GA 1IRZA 1W5SA 3W3CA 2G7HA 3NARA 3JAMZ 1MBFA 2P7CB 4UVCA 2MW8A 5ERIA 2CV1A 3UR3C 4P1WA 5C4XJ 2PMHA 2DA3A 1IJWC 4BE2A 3J7YJ 3ECHA 4KDPA 2R4GA 4X6AJ 3NWTA 5HLHA 1XMKA 2KKOA 1U8RA 1ACIA 2B7EA 2NVTJ 4RAYA 3DF8A 4XM3A 3KFWX 1IW7F 2X6XA 1TTYA 4NC8A 2XGXA 2XGEA 3D0SA 3TP0A 1ZYRF 1FY7A 1WWXA 4HSTA 1ON2A 1R36A 1XSVA 2IS6A 3UNGC 2CUFA 1XSDA 2O61A 1V5FA 2RREA 1EF4A 1ETKA 1SD7A 1STZA 4P9UA 3BG3A 5B3SH 3I0TA 4KMFA 2R5ZA 1U0JA 3OMYA 4I98B 5DD8A 2MH2A 3CF2A 1OR7A 1B72B 2STWA 3OOPA 1GVDA 1YX3A 2BXZA 4ENMA 3CLQA 3M1EA 4XLEA 5FGMA 5BNGA 3KP3A 3W2AA 2JVHA 2A5WA 3K69A 2EH3A 5KHDA 1IO2A 1P7JA 1G2HA 3DBLB 2DFEA 2OAZA 4V19K 1Q1VA 3QPTA 2HS5A 1ULYA 4UB8C 3KEOA 1WRJA 4EGZA 1BW5A 2R5YA 1LDJA 4KN7X 2BW3A 4CCOA 4FX4A 1EJ9A 3DEEA 3K9TA 1W1WE 2M9HA 4YELA 5DEQA 1B8IB 4JOMA 2FJ1A 2MH9A 2NVUB 4IHYA 5J1RA 2XROA 2P0WA 2PBIA 3DPUA 3F22A 2E1CA 4IHTA 2MLGA 1IG7A 1WI9A 3J81Z 3LA7A 5EG0B 2M4GA 1XMAA 3T5XA 2NVXJ 4PZJA 4IOAF 2OD5A 1EH6A 1VQ9I 3BLYA 1S9HA 2CFXA 5D8KB 1IC8A 2F4IA 2MD0A 3OYDA 2EQRA 5F6FA 4E7IA 2QYOA 3CD6I 3C2GA 3VPRA 5E3OA 3VWBA 3NAUA 1XTAA 3RKQA 4A3FJ 3VDXA 2E35A 2HPMA 5F04A 4R79A 1Z91A 1LDDA 3FXJA 2R92J 1IV8A 3MZYA 4N4NB 3QODA 4UB6C 3D1NI 3M8FA 2FBIA 2LRDA 3IC7A 3OYKA 5L3BA 4HSRA 4PJMA 1MMSA 3QWLA 2VE9A 3C7JA 4CHUA 3MEXA 3BTJA 3BPXA 2IA1A 2DCEA 1R71A 3D5RC 5L3EA 2OQGA 1S7AA 4Q5SF 1YRNB 3LA2A 2E1MC 2Q1ZB 3HUGA 2Y0SN 2ZC2A 3F8CA 3LSJA 4CA0A 4FASD 5HDGA 4WF2A 3L2QA 1UFMA 5EEGA 2NXNB 2RNJA 3FZVA 2OU2A 4ABZA 3RZDJ 4E70A 2F5CA 2Q0OA 3PL8A 3D5SC 4PJJA 3HDDA 4GDFA 1T08B 2IGOA 2V6CA 1XC5A 2L9VA 2NNNA 2R93J 2L7KA 4EJUA 2HR3A 3FM5A 3RKXA 4RGXA 3K0LA 3K4KA 1R49A 1F4KA 2NVQJ 1YG2A 2VOOA 1IRXA 3G71I 5J47A 2KJCA 3DU6A 1K6OA 2ZXHA 1P92A 3BR1A 2KIUA 4XR6A 2YX4A 3TO9A 1WH5A 3KEQA 1ZK8A 5CPRB 4Y7NJ 2QF7A 4CDGA 3IAM2 4WXHA 2LF8A 2QKLB 1JTXA 2NOGA 4XLNF 2JRMA 5IPAA 4C3IJ 3B73A 4A3JJ 3Q0UA 4M74A 3WU1B 1JKRC 1N78A 2J5OA 1IAWA 4MHGA 4N0BA 1SANA 2EB7A 1B59A 3G4SI 2XF7A 2NOJB 3CESA 3A03A 3O6BB 2I10A 3KYLA 1R1UA 1ODDA 3CMYA 3J80Z 2L9SA 2JA7J 5M3MJ 3TDUC 2WC2A 4Y4RA 3SDGA 5CLSA 1KA8A 1TL8A 1G3YA 2E1MB 1UZCA 2IJLA 5DCMB 5M3FJ 4H4KC 2STTA 2XAHA 2LY2A 1MJAA 3NRVA 3ZMUA 1TWCJ 1AWCA 3H9JA 4CCKA 3WTZA 3L2WA 1GXQA 5FKKA 4C3JJ 4BQQA 2XGCA 4A0ZA 3I54A 3O3KA 4XSXF 4B4CA 3QOEA 4JX4A 1BJAA 1T56A 1SFOJ 1O3QA 1YIOA 3HTSB 3DBHB 4M9ZA 1ITYA 4RGSA 2X9DA 2WTEA 3PFIA 1FJLA 4XICA 2W24A 5E3MA 1SFUA 1U3EM 1V54H 2X1CA 1HKQA 5GPAA 1RUOA 3BP8A 2AQFA 5E1ZB 5F1RA 2ZJPF 5D5XB 2LKXA 4LITA 1QZEA 5EF6A 1LPQA 1X3WB 4L0ZB 2RAEA 2DTZA 1P7IA 2YSRA 5ICFA 3JSOA 4KA4A 1BR4A 2FX0A 1LFPA 2GM4A 4NQWB 4ZTFA 4BJ5C 2XF6A 2X1EA 5CVJA 2GLOA 1Z0XA 4E7LA 4O5VA 2QQBA 2EFQA 1HW1A 2Y0MA 1U2WA 1BI2A 4Y17A 4PFOA 1VQNI 2HPIA 3BZ6A 4L9NA 3CP2A 2MG4A 3M8EA 3OYGA 5EGOA 1YE9A 1P4XA 2M87A 4QTRA 2EWNA 5HDKA 3KLOA 2CW8A 3BR3A 4OWRB 4U0WA 3QRFF 1CQTA 4DQ2A 3IH2A 1KU3A 1LE8A 1ZREA 1FIPA 1ZGJA 5J1UA 5FKLA 4G6TB 1FOYA 3BJOA 2DOAA 2K4BA 2MSYA 2BXYA 3KPHA 2HKOA 3ZR8X 2FQ4A 2R7FA 3CCUI 2UUZA 1YITI 4U87A 2Z3YA 3L00A 2YX7A 1WSUA 2DI3A 3KYCB 3G1MA 3OR2C 3ZP5A 4LIVA 2L5QA 3ML6A 4ZJZA 2IA0A 5BOXA 2B9SA 1DPRA 2GOMA 4HX8A 5ILVA 4Y3OA 5FKNA 3HPGA 5H2FC 4XBFA 2P6SA 2NYXA 4ZH4F 5BS6A 1LJ9A 2KLOA 4L9JA 5CJ9A 5J40A 1SVOA 1R9TJ 2L7ZA 1BJZA 1ZTRA 1S8NA 1IZ1A 2X85A 1YJ9I 3R0JA 1Y56A 4JX5A 2HOAA 3OSFA 3FKJA 3S1RJ 4JK1X 2KIMA 5HS8A 2CV0A 4F55A 1EKEA 5KVRA 2V1UA 3U2RA 3A02A 3K4MA 2TRTA 3QQAA 2FD5A 3LSTA 2HXOA 3LSPA 3SDBA 2FNPA 2HWVA 3RPUD 1ETVA 2EFOA 3J7AY 1FOWA 1YJWI 2XAQA 1H9TA 3CO6C
chains in the Genus database with same CATH topology
2QQAA 3W6JB 1HXDA 3FMQA 4MQVA 3V7CA 3GYHX 2L3DA 2VC0A 2M8EA 1MDMA 2VBYA 3J7AO 1UCRA 1IN8A 3HRUA 5A2QK 2Y48A 3O2PE 5HS9A 3I5UA 4IHSA 2FSWA 1IUYA 4H0EA 2JPBA 2ZO4A 1F9NA 1QGPA 1O57A 3WGIA 2PFBA 2GWRA 3LWFA 3MZHA 4WCGA 3F21A 3U1DA 4L18B 1Z05A 4AD9A 4P9FA 1R58A 1XSXA 4BHBA 2JTVA 4HOBA 2ADUA 3Q9VA 3HSEA 4HQMA 2M1BA 3D5LA 2ZMEA 4HX4A 2UZKA 2R7DA 4G7HF 4A0XA 3RKYA 3CJNA 3CUQA 3ZQ7A 2QVOA 4Z2YA 3MAJA 1OYYA 4ASNA 4IVNA 2H6BA 3TKYA 1TQMA 4LJZF 3N97A 1DDNA 5H6RA 3E6DA 1J9IA 4ENJA 2XV4S 1QO0D 5H20A 1MZBA 3EUHA 1MGTA 5FLXK 1BC8C 3L7WA 2QWWA 4L5IA 2IRFG 1L3LA 2RKHA 1R00A 2QUFA 4IRIA 4OU0A 2HZTA 3G73A 4M9SA 5K5RA 1YW9A 2RN7A 3E6BA 1USTA 1ONVA 2EA4A 2P4WA 1FBSA 3DKWA 2XVCA 3P9IA 2QENA 3V8LA 2X4HA 2A69F 3SQNA 2LSOA 3CTAA 4IXAA 3GW2A 2HOEA 5DCMA 2FF4A 3T1BA 4LFUA 3NEUA 1YTYA 3ELKA 2PQ8A 3V7RA 3GZ6A 4ZZDA 1ZAOA 4OINF 1FP2A 2K27A 4IJAA 5LBQA 4RB3C 2B0LA 3QP6A 5HLGA 3SZTA 1S6LA 2A6EF 1RNLA 2H27A 2QBYA 2E7WA 1YYVA 4AIKA 2HYFA 2EJRA 3WE3A 1T6SA 3HRSA 2JSCA 3FHZA 5E8IA 4P55A 3KP5A 2NS0A 3RPUA 2GQQA 3RI4A 4AIHA 3JW4A 5J6XA 1FBQA 1XN7A 4NQWA 3AAFA 2DT5A 1U5TA 1P4AA 4ESJA 1VTNC 4WX9A 5D6EA 2FBHA 5L3CA 2XIGA 1TQPA 4MQ9F 3ZPLA 4LLLA 3L9FA 1SMYF 4UVAA 4ETSA 2G7UA 2WV0A 2ZNZA 4LG0B 2PLYA 4G8XA 2PEXA 1ZG3A 5TRDA 4JBAA 4QLCU 1ON1A 3IRRA 4I0AA 4IRGA 2Q2EA 3QOPA 3ZMVA 3COAC 5BQTA 4EJOA 1PUEE 2IT0A 3HHGA 2FMYA 1FLIA 2CW0F 3IWFA 2P5LC 2O6GE 3LQRA 5D5UB 1L0OC 2D1VA 2DW4A 2OQRA 4M6XA 1D5VA 1ZG1A 1YS6A 1JGSA 1I1SA 1R1TA 2XRNA 1NHAA 4XLPF 3ERED 1KYZA 1TQIA 1FSEA 5CYVA 2FEZA 3DPTA 4RB0A 1B6AA 4RGRA 1IXRC 2PMUA 1BM9A 4N9HA 2H6CA 4HF0A 1B9NA 4PCQA 1FP1D 1ZGAA 2BYVE 2VXZA 5TJJA 1Y0UA 1P4WA 1S3JA 1R5HA 1R7JA 2DQRA 5E20A 3TDZC 1WQ2A 1T2KA 5HS7A 4A12A 1E2XA 1T0FA 2V1XA 1FNNA 4EM0B 2HYGD 1LNWA 2M45A 1SFXA 2DPDA 3WE2A 1T39A 1XGOA 3MQ0A 4B8XA 1B4AA 4MTDA 4KIBA 1K7AA 3WTUC 4OOIA 3ABTA 3P9CA 5ICEA 3C1DA 2OA4A 4GO1A 1O3SA 3JSPA 2E1NA 1SFEA 4BQAA 3GXOA 1QNTA 3HHHA 2CQKA 4HX7A 4I01A 2O03A 1ZRDA 1O3TA 1I1GA 3SFZA 1ZH5A 2MLKA 5D5VB 4G9YA 4U88A 3DEUA 4HW0A 3HTUA 1FSHA 1S7OA 2HTJA 1K78B 3QU6A 2DK5A 5JR3A 2WWYA 3DPLC 1YW7A 1IRGA 2EV0A 1I6XA 5LHHA 5DYMA 1OKRA 2VBZA 3E5QA 1OYIA 2K86A 4GGGA 2K02A 1Q1HA 1IN5A 2Z99A 3HRTA 2GXGA 3BOQA 3HOTA 4CICA 2VBWA 4BH9A 1ZN2A 3DQVC 3ZMSA 4OIQF 3KP6A 4N9IA 3K2ZA 3WGGA 3VODA 4ZZLA 3RDIA 2YU3A 2OZUA 2XASA 2F5DA 3E6MA 5AIQA 3K1PA 1KGSA 3FXRA 5HVQC 3I71A 4L9VA 2BGCA 2H09A 2XKOA 4KYWA 1BI3A 4U7BA 4RB1A 4EGYA 1C0WA 1X3UA 2L4AA 1FYKA 4BYYA 2RV8A 3C3WA 1PDNC 2UWMA 5BPIA 3VFZA 2DO7A 1FX7A 4I09A 4HLYA 1IN6A 4LMYA 5HDNA 1J0RA 4G6DA 4EM1A 4BAYA 2YR2A 3B02A 1RIOH 2K4JA 1IXSB 5L3DA 4KNYA 2KIFA 1KU2A 2ELHA 2GIVA 4ENNA 1XDSA 2XUBA 3JTHA 1W7PB 4BHPA 2XAGA 5ICCA 1D8KA 4A5MA 3QP5A 3KCCA 3WTVC 4EV0A 4XRFA 1SD6A 3F8FA 4ESFA 4I0BA 2IA2A 1SMTA 1I5ZA 2RVCA 3ISPA 2W57A 2Q8KA 2V9VA 3ABUA 3TOBA 5LGTA 1DP7P 1LDKB 2IP2A 4I7HA 2ACJA 4M71A 3HIFA 4B09A 3SZPA 3H3UA 4LGWA 3F8NA 3PQKA 1REPC 2GA1A 5DUKA 2D45A 1RUNA 4HLXA 2DBBA 1FT9A 3EETA 5HOOA 2CG4A 5D4RA 4GCVA 4BHCA 5LRSA 5AONA 5IT9K 2A68F 4RS8A 3V4GA 3SXYA 3RPQA 2EFPA 1RI7A 1PP8F 2PJPA 2EV5A 5LEKA 1O3RA 1W4MA 5JI6A 4G94A 3MFKA 1IXCA 1HKSA 1IN4A 3DXJF 4MTEA 1HSJA 2CYYA 2OZ6A 2P5VA 1ZRCA 2ISYA 3GFJA 1RZ4A 1JHFA 1TBXA 1Z6TA 2UXNA 4M72A 5JHUA 3F72A 4MEXF 4WXDA 2A6HF 2VOPA 1XGMA 1OYWA 4LB6B 3GWZA 5D8LB 1XD7A 1HW5A 4M73A 5BMZA 1QBJA 2FE3A 4AIJA 1GHCA 3BJ6A 2V79A 5EEHA 2KRFA 4UHTA 2O8XA 4L5JA 1F5TA 4RB2C 6PAXA 4OIOF 3MWMA 3ZN0A 1LB2A 1CF7B 4NHJA 5FD5A 4KUMA 3U9GA 5IT3A 1TNTA 4ZYDA 3E5UA 2FRHA 2DPUA 5ICGA 1GVJA 4LLGF 1JHHA 1GXPA 3P9KA 4YIFA 1IN7A 2GXBA 1UHMA 4M9XA 4ESBA 2VODA 1P2FA 2M5WA 1R22A 3KLNA 1KU9A 4P96A 1R1VA 4EVIA 3EDPA 2HGCA 2D1HA 2O0YA 3ZMDA 3WTTC 2HTSA 2PG4A 1G4DA 1O7LA 3K1NA 5FB2A 4CZZA 2GZWA 4HA8A 4HF2A 4WK8F 3FXUA 2RGVA 3J81K 2JT1A 2HDCA 4UXNA 2VC1A 4ZYEA 2G9WA 5JFRA 4EM2A 4KIGA 1ZLJA 1USSA 4LB5A 3RKWA 1J59A 5L3GA 1XDUA 4FX0A 2C6YA 3T0YA 1HBXG 2CGPA 1HSTA 1V3FA 4Q47A 3BROA 2XKPA 4GYGA 5DDGA 5LHIA 1BIAA 5ILUA 1PP7U 4OMZA 4ENKA 4Y13A 4G7ZF 2TDXA 1MJBA 2JZYA 2DLLA 1EH8A 3BY6A 2ETHA 3GF2A 5E8GA 5E17F 1J5YA 4Y15A 1B9MA 3QPHA 3FWEA 2DTRA 4EQQA 5IT9Z 3REOA 3JTGA 3KETA 3EQLF 1HW2A 4NB5A 3E6CC 3OV8A 4OMYA 3F8BA 3GFLA 2RC4A 4A2UA 5A2QZ 1AOYA 4R8HA 4EJVA 4OIRF 4IF4A 3IKVA 1I27A 3J80K 4YG2F 3E3VA 2FMLA 4TV7A 3WODF 5E1XA 5J8CA 2ZCWA 2NRAC 3F8MA 3VB2A 4WXCA 3BPVA 2EK5A 4CO8A 5D6FA 3VOEA 3L2CA 2ESHA 2BBYA 1YFHA 2RQPA 3I58A 3KP7A 3WTYC 2ESNA 3I4PA 1XB4A 1F1ZA 4A5NA 2V1DA 2F2EA 3HSFA 1BN5A 3FF5A 3FM3A 1BBYA 1ZHFA 3DP7A 3R60A 4Q4ZF 2L4MA 1QZYA 4EJWA 1HKTA 3CUQC 2DU9A 3HRMA 3WGHA 5K1YA 5FLXZ 4CGZA 3T8TA 4EMSA 2GAUA 1ZRFA 1W5TA 3F6OA 5LEJA 1MDMB 2VE8A 2Z33A 4UVBA 1ZG5A 2LDUA 4LLNA 3GVAA 4IPAA 2MC3A 3C18A 1J2XA 1O7FA 4S04A 3QAHA 3WTWC 3K1MA 3KZZA 2AS5F 3FXQA 4HYEA 4S05A 4FHTA 1FYLA 1A04A 3GEZA 5DUIA 1CF7A 5F64A 1MKMA 4G6QA 4UV8A 4ZYGA 1Z1DA 4HV6A 1FYMA 2DK8A 3KZYA 2ZMEB 2NAZA 1G3SA 3M9AA 1KQ9A 4WWCA 2L01A 1LEAA 1SD5A 2AXLA 4O3MA 3CUQB 3NQOA 3GZ5A 1V4RA 1TLHB 2VONA 3WTXC 3WU0A 2QM3A 1TW3A 3MCZA 4RAZA 2EA2A 4UUVA 1OMIA 1EV7A 3IL2A 4PGGA 2MA3A 3KP2A 2VBXA 4YFNF 4GYIA 3FMRA 3F6VA 3RJPA 3RYPA 4RGUA 2W84A 1YLFA 2IW5A 5AIPA 4XSZF 5ILSA 4FT8A 4HZFA 2HKXA 2ZXJA 4KMUX 3IWZA 4HQEA 1DUXC 2JRTA 3R61A 4PDKA 2P7VB 5LHGA 3I53A 3VEPA 3GUDA 1G3TA 4MNUA 1BI0A 2ZJ2A 1U5TC 4YFXF 1QQIA 3V8JA 2J5PA 3EYYA 4BNCA 2LF7A 4LK1F 1TNSA 3PQJA 3H3ZA 1XGSA 3HYIA 1Z9CA 3RIRA 3IHUA 1KQ0A 2H94A 4U7DA 3ZMTA 3ZMZA 2FQ3A 1S29A 5HLIA 4UV9A 2RDPA 4I02A 1D8JA 5L3FA 3W6KB 2FU4A 2BEOA 2QBYB 2MBFA 2BE5F 1OPCA 4LG0A 3L09A 1R5GA 3RTRA 1KYWA 1P6RA 5FFZA 4D0PA 2BV6A 3CDHA 4HDVA 1U5TB 4AWXB 3P7NA 3LAJA 1LQ1A 2ISZA 3LQQA 2YPRA 3BJAA 3G3ZA 2L54A 5DCFA 2XAJA 3E97A 3GO5A 2HQNA 2IPQX 1FC3A 1U78A 5DD4A 2L02A 3I59B 3I64A 3EYIA 3LFKA 5LGNA 1T98A 2MD5A 3GLXA 3FX3A 1ZARA 4HBLA 5LGUA 2DAOA 1J7KA 1QZZA 3BWGA 2CO5A 2KJBA 1CGPA 3V7SA 2D2WA 4KN4X 2FNAA 2A07F 2P8TA 2CSOA 4QWQA 2COMA 1WKMA 2VT2A 1E17A 1G3WA 5KK1A 2ZBKA 1H0MA 2ZNYA 1JE8A 3S2WA 3CLOA 2Y75A 2A61A 3R6SA 5D5WB 4MGRA 2QZ8A 3TQNA 1W7PD 4U0VA 1XGNA 5CVVA 5BPDA 4A0YA 2LNBA 1U6GA 3CUOA 3WTSC 3LAPA 3F3XA 1IF1A 5H6QA 2HQRA 3T8RA 2O3FA 1MD0A 5ED4A 5CVRA 2W85A 4KICA 3N4MA 1MJ9A 3CO7C 3KP4A 3JAMK 1ZLKA 4R1HA 4KT5C 2K7LA 3ECOA 1JXSA 3ZN1A 3FMSA 1Z7UA 2EFNA 2UXXA 4HV5A 3HOSA 4A6EA 2FOKA 1J75A 2F5FA 1K78A 4AVPA 1D3YA 3R4KA 1LEBA 2E7XA 4JQFA 1R23A 4LK0F 4P5OA 3Q5FA 2Z5UA 3ROUA 3TGNA 2FA5A 4UNOA 3DFGA 2QQ9A 4LD5A 4EJTA 4M6YA 4ZYHA 2R3SA 1T38A 2PI0A 4O6JA 2A5YB 2FXAA 2QLZA 4A6DA 1UB9A 4Q48A 4F7ZA 1EH7A 4I2OA 2IVMA 3F23A 1SD4A 2LKPA 5LRRA 2EV6A 1YQAA 2OBPA 4G7OF 1BIBA 5FO5A 3HSRA 2VN2A 5FFXA 3DV8A 1B1BA 1KQ8A 3GFIA 2HEOA 1DPUA 5K5QA 3GFMA 4CYDA 3H92A 1Z6RA 2ZFWA 2EFWA 5FD6A 5K5OA 4MEYF 4DNCA 3IRQA 4CXFA 2P6TA 3V8KA 2PN6A 1FZPB 1FWZA 1BC7C 4ON0A 2VT3A 3TO7A 2NNYA 4KFCA 4OIPF 2DFIA 3TOAA 4BXUA 1YW8A 4HDUA 1K79A 3WG9A 1LVAA 5CVIA 3LA3A 5E1WA 2XAFA 3Q9SA 2XHKA 1FPQA 1BI1A 1TW2A 3R0AA 2A3SA 2JPCA 4L0YB 4YIIA 5LLQA 1YS7A 3BDDA 5E18F 4U0YA 5CVUA 1UHWA 4YFKF 2ZKZA 3KE2A 2W25A 5DV5A 3RYRA 2FBKA 4L9TA 2GA2A 1H9GA 3ULQB 1FBUA 2P5KA 5D4SA 1W7PA 4GXOA 4HF1A 3TO6A 3GX4X 4PGHA 2HFHA 3QU3A 1FOKA 1QPMA 2F5EA 4IRHA 2DQLA 3IKTA 1YO5C 4HAMA 4K2EA 4KIFA 2Z9OA 2X0LA 5J8FA 1G6NA 5JVTA 3E5XA 3I59A 1XCVA 1BOAA 1XCBA 3SHFA 1SAXA 2CWEA 1IRFA 1HQCA 1KU7A 2M30A 3M7GA 1W5SA 2G7HA 3JAMZ 2P7CB 4UVCA 5ERIA 2PMHA 3ECHA 4KDPA 5HLHA 1XMKA 2KKOA 1U8RA 4RAYA 3DF8A 3KFWX 1IW7F 1TTYA 2XGXA 3D0SA 1ZYRF 1FY7A 1WWXA 1ON2A 1R36A 1XSVA 1XSDA 2O61A 1SD7A 1STZA 4P9UA 3I0TA 4KMFA 4I98B 5DD8A 2MH2A 1OR7A 2STWA 3OOPA 4ENMA 3M1EA 5FGMA 3KP3A 3K69A 2OAZA 3QPTA 2HS5A 1ULYA 3KEOA 1WRJA 4EGZA 1LDJA 4KN7X 4FX4A 3K9TA 5DEQA 2MH9A 2XROA 2PBIA 3F22A 2E1CA 4IHTA 2MLGA 1WI9A 3J81Z 3LA7A 1XMAA 3T5XA 4PZJA 2OD5A 1EH6A 5D8KB 2CFXA 5F6FA 2QYOA 4R79A 1Z91A 1LDDA 3MZYA 3M8FA 2FBIA 3IC7A 5L3BA 2VE9A 3C7JA 4CHUA 3MEXA 3BPXA 2IA1A 5L3EA 2OQGA 1S7AA 4Q5SF 3LA2A 3HUGA 3F8CA 5HDGA 4WF2A 1UFMA 5EEGA 2RNJA 3FZVA 2OU2A 4E70A 2F5CA 2Q0OA 2V6CA 2NNNA 4EJUA 2HR3A 3FM5A 3RKXA 4RGXA 3K0LA 1F4KA 1YG2A 2VOOA 2KJCA 1K6OA 1P92A 2KIUA 2YX4A 3TO9A 3KEQA 4CDGA 4WXHA 2LF8A 4XLNF 3B73A 4M74A 3WU1B 2J5OA 1IAWA 4MHGA 4N0BA 2EB7A 1B59A 3O6BB 1R1UA 1ODDA 3J80Z 3TDUC 2WC2A 5CLSA 1KA8A 1G3YA 2IJLA 5DCMB 2STTA 2XAHA 1MJAA 3NRVA 3ZMUA 1AWCA 3WTZA 1GXQA 4A0ZA 3I54A 3O3KA 4XSXF 1O3QA 1BJAA 3HTSB 1YIOA 4M9ZA 4RGSA 2WTEA 3PFIA 2W24A 1SFUA 1U3EM 1HKQA 1RUOA 3BP8A 5E1ZB 5F1RA 5D5XB 4L0ZB 2YSRA 5ICFA 3JSOA 4KA4A 5CVJA 4O5VA 2QQBA 2EFQA 1HW1A 2Y0MA 1U2WA 1BI2A 4Y17A 4L9NA 3BZ6A 3M8EA 1P4XA 2M87A 2EWNA 5HDKA 3KLOA 4U0WA 3QRFF 4DQ2A 1KU3A 1ZREA 1ZGJA 3BJOA 2K4BA 2HKOA 2R7FA 2Z3YA 3L00A 2YX7A 1WSUA 2DI3A 3ZP5A 3ML6A 2IA0A 5BOXA 1DPRA 5ILVA 4HX8A 4XBFA 2P6SA 2NYXA 4ZH4F 5BS6A 1LJ9A 4L9JA 5CJ9A 1S8NA 1IZ1A 3R0JA 4JK1X 2KIMA 5HS8A 5KVRA 2V1UA 3U2RA 3LSTA 2FNPA 2HWVA 2EFOA 2XAQA 1H9TA 3CO6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQA A;  3W6J B;  1HXD A;  3FMQ A;  4MQV A;  3V7C A;  3GYH X;  2L3D A;  2VC0 A;  2M8E A;  1MDM A;  2VBY A;  3J7A O;  1UCR A;  1IN8 A;  3HRU A;  5A2Q K;  2Y48 A;  3O2P E;  5HS9 A;  3I5U A;  4IHS A;  2FSW A;  1IUY A;  4H0E A;  2JPB A;  2ZO4 A;  1F9N A;  1QGP A;  1O57 A;  3WGI A;  2PFB A;  2GWR A;  3LWF A;  3MZH A;  4WCG A;  3F21 A;  3U1D A;  4L18 B;  1Z05 A;  4AD9 A;  4P9F A;  1R58 A;  1XSX A;  4BHB A;  2JTV A;  4HOB A;  2ADU A;  3Q9V A;  3HSE A;  4HQM A;  2M1B A;  3D5L A;  2ZME A;  4HX4 A;  2UZK A;  2R7D A;  4G7H F;  4A0X A;  3RKY A;  3CJN A;  3CUQ A;  3ZQ7 A;  2QVO A;  4Z2Y A;  3MAJ A;  1OYY A;  4ASN A;  4IVN A;  2H6B A;  3TKY A;  1TQM A;  4LJZ F;  3N97 A;  1DDN A;  5H6R A;  3E6D A;  1J9I A;  4ENJ A;  2XV4 S;  1QO0 D;  5H20 A;  1MZB A;  3EUH A;  1MGT A;  5FLX K;  1BC8 C;  3L7W A;  2QWW A;  4L5I A;  2IRF G;  1L3L A;  2RKH A;  1R00 A;  2QUF A;  4IRI A;  4OU0 A;  2HZT A;  3G73 A;  4M9S A;  5K5R A;  1YW9 A;  2RN7 A;  3E6B A;  1UST A;  1ONV A;  2EA4 A;  2P4W A;  1FBS A;  3DKW A;  2XVC A;  3P9I A;  2QEN A;  3V8L A;  2X4H A;  2A69 F;  3SQN A;  2LSO A;  3CTA A;  4IXA A;  3GW2 A;  2HOE A;  5DCM A;  2FF4 A;  3T1B A;  4LFU A;  3NEU A;  1YTY A;  3ELK A;  2PQ8 A;  3V7R A;  3GZ6 A;  4ZZD A;  1ZAO A;  4OIN F;  1FP2 A;  2K27 A;  4IJA A;  5LBQ A;  4RB3 C;  2B0L A;  3QP6 A;  5HLG A;  3SZT A;  1S6L A;  2A6E F;  1RNL A;  2H27 A;  2QBY A;  2E7W A;  1YYV A;  4AIK A;  2HYF A;  2EJR A;  3WE3 A;  1T6S A;  3HRS A;  2JSC A;  3FHZ A;  5E8I A;  4P55 A;  3KP5 A;  2NS0 A;  3RPU A;  2GQQ A;  3RI4 A;  4AIH A;  3JW4 A;  5J6X A;  1FBQ A;  1XN7 A;  4NQW A;  3AAF A;  2DT5 A;  1U5T A;  1P4A A;  4ESJ A;  1VTN C;  4WX9 A;  5D6E A;  2FBH A;  5L3C A;  2XIG A;  1TQP A;  4MQ9 F;  3ZPL A;  4LLL A;  3L9F A;  1SMY F;  4UVA A;  4ETS A;  2G7U A;  2WV0 A;  2ZNZ A;  4LG0 B;  2PLY A;  4G8X A;  2PEX A;  1ZG3 A;  5TRD A;  4JBA A;  4QLC U;  1ON1 A;  3IRR A;  4I0A A;  4IRG A;  2Q2E A;  3QOP A;  3ZMV A;  3COA C;  5BQT A;  4EJO A;  1PUE E;  2IT0 A;  3HHG A;  2FMY A;  1FLI A;  2CW0 F;  3IWF A;  2P5L C;  2O6G E;  3LQR A;  5D5U B;  1L0O C;  2D1V A;  2DW4 A;  2OQR A;  4M6X A;  1D5V A;  1ZG1 A;  1YS6 A;  1JGS A;  1I1S A;  1R1T A;  2XRN A;  1NHA A;  4XLP F;  3ERE D;  1KYZ A;  1TQI A;  1FSE A;  5CYV A;  2FEZ A;  3DPT A;  4RB0 A;  1B6A A;  4RGR A;  1IXR C;  2PMU A;  1BM9 A;  4N9H A;  2H6C A;  4HF0 A;  1B9N A;  4PCQ A;  1FP1 D;  1ZGA A;  2BYV E;  2VXZ A;  5TJJ A;  1Y0U A;  1P4W A;  1S3J A;  1R5H A;  1R7J A;  2DQR A;  5E20 A;  3TDZ C;  1WQ2 A;  1T2K A;  5HS7 A;  4A12 A;  1E2X A;  1T0F A;  2V1X A;  1FNN A;  4EM0 B;  2HYG D;  1LNW A;  2M45 A;  1SFX A;  2DPD A;  3WE2 A;  1T39 A;  1XGO A;  3MQ0 A;  4B8X A;  1B4A A;  4MTD A;  4KIB A;  1K7A A;  3WTU C;  4OOI A;  3ABT A;  3P9C A;  5ICE A;  3C1D A;  2OA4 A;  4GO1 A;  1O3S A;  3JSP A;  2E1N A;  1SFE A;  4BQA A;  3GXO A;  1QNT A;  3HHH A;  2CQK A;  4HX7 A;  4I01 A;  2O03 A;  1ZRD A;  1O3T A;  1I1G A;  3SFZ A;  1ZH5 A;  2MLK A;  5D5V B;  4G9Y A;  4U88 A;  3DEU A;  4HW0 A;  3HTU A;  1FSH A;  1S7O A;  2HTJ A;  1K78 B;  3QU6 A;  2DK5 A;  5JR3 A;  2WWY A;  3DPL C;  1YW7 A;  1IRG A;  2EV0 A;  1I6X A;  5LHH A;  5DYM A;  1OKR A;  2VBZ A;  3E5Q A;  1OYI A;  2K86 A;  4GGG A;  2K02 A;  1Q1H A;  1IN5 A;  2Z99 A;  3HRT A;  2GXG A;  3BOQ A;  3HOT A;  4CIC A;  2VBW A;  4BH9 A;  1ZN2 A;  3DQV C;  3ZMS A;  4OIQ F;  3KP6 A;  4N9I A;  3K2Z A;  3WGG A;  3VOD A;  4ZZL A;  3RDI A;  2YU3 A;  2OZU A;  2XAS A;  2F5D A;  3E6M A;  5AIQ A;  3K1P A;  1KGS A;  3FXR A;  5HVQ C;  3I71 A;  4L9V A;  2BGC A;  2H09 A;  2XKO A;  4KYW A;  1BI3 A;  4U7B A;  4RB1 A;  4EGY A;  1C0W A;  1X3U A;  2L4A A;  1FYK A;  4BYY A;  2RV8 A;  3C3W A;  1PDN C;  2UWM A;  5BPI A;  3VFZ A;  2DO7 A;  1FX7 A;  4I09 A;  4HLY A;  1IN6 A;  4LMY A;  5HDN A;  1J0R A;  4G6D A;  4EM1 A;  4BAY A;  2YR2 A;  3B02 A;  1RIO H;  2K4J A;  1IXS B;  5L3D A;  4KNY A;  2KIF A;  1KU2 A;  2ELH A;  2GIV A;  4ENN A;  1XDS A;  2XUB A;  3JTH A;  1W7P B;  4BHP A;  2XAG A;  5ICC A;  1D8K A;  4A5M A;  3QP5 A;  3KCC A;  3WTV C;  4EV0 A;  4XRF A;  1SD6 A;  3F8F A;  4ESF A;  4I0B A;  2IA2 A;  1SMT A;  1I5Z A;  2RVC A;  3ISP A;  2W57 A;  2Q8K A;  2V9V A;  3ABU A;  3TOB A;  5LGT A;  1DP7 P;  1LDK B;  2IP2 A;  4I7H A;  2ACJ A;  4M71 A;  3HIF A;  4B09 A;  3SZP A;  3H3U A;  4LGW A;  3F8N A;  3PQK A;  1REP C;  2GA1 A;  5DUK A;  2D45 A;  1RUN A;  4HLX A;  2DBB A;  1FT9 A;  3EET A;  5HOO A;  2CG4 A;  5D4R A;  4GCV A;  4BHC A;  5LRS A;  5AON A;  5IT9 K;  2A68 F;  4RS8 A;  3V4G A;  3SXY A;  3RPQ A;  2EFP A;  1RI7 A;  1PP8 F;  2PJP A;  2EV5 A;  5LEK A;  1O3R A;  1W4M A;  5JI6 A;  4G94 A;  3MFK A;  1IXC A;  1HKS A;  1IN4 A;  3DXJ F;  4MTE A;  1HSJ A;  2CYY A;  2OZ6 A;  2P5V A;  1ZRC A;  2ISY A;  3GFJ A;  1RZ4 A;  1JHF A;  1TBX A;  1Z6T A;  2UXN A;  4M72 A;  5JHU A;  3F72 A;  4MEX F;  4WXD A;  2A6H F;  2VOP A;  1XGM A;  1OYW A;  4LB6 B;  3GWZ A;  5D8L B;  1XD7 A;  1HW5 A;  4M73 A;  5BMZ A;  1QBJ A;  2FE3 A;  4AIJ A;  1GHC A;  3BJ6 A;  2V79 A;  5EEH A;  2KRF A;  4UHT A;  2O8X A;  4L5J A;  1F5T A;  4RB2 C;  6PAX A;  4OIO F;  3MWM A;  3ZN0 A;  1LB2 A;  1CF7 B;  4NHJ A;  5FD5 A;  4KUM A;  3U9G A;  5IT3 A;  1TNT A;  4ZYD A;  3E5U A;  2FRH A;  2DPU A;  5ICG A;  1GVJ A;  4LLG F;  1JHH A;  1GXP A;  3P9K A;  4YIF A;  1IN7 A;  2GXB A;  1UHM A;  4M9X A;  4ESB A;  2VOD A;  1P2F A;  2M5W A;  1R22 A;  3KLN A;  1KU9 A;  4P96 A;  1R1V A;  4EVI A;  3EDP A;  2HGC A;  2D1H A;  2O0Y A;  3ZMD A;  3WTT C;  2HTS A;  2PG4 A;  1G4D A;  1O7L A;  3K1N A;  5FB2 A;  4CZZ A;  2GZW A;  4HA8 A;  4HF2 A;  4WK8 F;  3FXU A;  2RGV A;  3J81 K;  2JT1 A;  2HDC A;  4UXN A;  2VC1 A;  4ZYE A;  2G9W A;  5JFR A;  4EM2 A;  4KIG A;  1ZLJ A;  1USS A;  4LB5 A;  3RKW A;  1J59 A;  5L3G A;  1XDU A;  4FX0 A;  2C6Y A;  3T0Y A;  1HBX G;  2CGP A;  1HST A;  1V3F A;  4Q47 A;  3BRO A;  2XKP A;  4GYG A;  5DDG A;  5LHI A;  1BIA A;  5ILU A;  1PP7 U;  4OMZ A;  4ENK A;  4Y13 A;  4G7Z F;  2TDX A;  1MJB A;  2JZY A;  2DLL A;  1EH8 A;  3BY6 A;  2ETH A;  3GF2 A;  5E8G A;  5E17 F;  1J5Y A;  4Y15 A;  1B9M A;  3QPH A;  3FWE A;  2DTR A;  4EQQ A;  5IT9 Z;  3REO A;  3JTG A;  3KET A;  3EQL F;  1HW2 A;  4NB5 A;  3E6C C;  3OV8 A;  4OMY A;  3F8B A;  3GFL A;  2RC4 A;  4A2U A;  5A2Q Z;  1AOY A;  4R8H A;  4EJV A;  4OIR F;  4IF4 A;  3IKV A;  1I27 A;  3J80 K;  4YG2 F;  3E3V A;  2FML A;  4TV7 A;  3WOD F;  5E1X A;  5J8C A;  2ZCW A;  2NRA C;  3F8M A;  3VB2 A;  4WXC A;  3BPV A;  2EK5 A;  4CO8 A;  5D6F A;  3VOE A;  3L2C A;  2ESH A;  2BBY A;  1YFH A;  2RQP A;  3I58 A;  3KP7 A;  3WTY C;  2ESN A;  3I4P A;  1XB4 A;  1F1Z A;  4A5N A;  2V1D A;  2F2E A;  3HSF A;  1BN5 A;  3FF5 A;  3FM3 A;  1BBY A;  1ZHF A;  3DP7 A;  3R60 A;  4Q4Z F;  2L4M A;  1QZY A;  4EJW A;  1HKT A;  3CUQ C;  2DU9 A;  3HRM A;  3WGH A;  5K1Y A;  5FLX Z;  4CGZ A;  3T8T A;  4EMS A;  2GAU A;  1ZRF A;  1W5T A;  3F6O A;  5LEJ A;  1MDM B;  2VE8 A;  2Z33 A;  4UVB A;  1ZG5 A;  2LDU A;  4LLN A;  3GVA A;  4IPA A;  2MC3 A;  3C18 A;  1J2X A;  1O7F A;  4S04 A;  3QAH A;  3WTW C;  3K1M A;  3KZZ A;  2AS5 F;  3FXQ A;  4HYE A;  4S05 A;  4FHT A;  1FYL A;  1A04 A;  3GEZ A;  5DUI A;  1CF7 A;  5F64 A;  1MKM A;  4G6Q A;  4UV8 A;  4ZYG A;  1Z1D A;  4HV6 A;  1FYM A;  2DK8 A;  3KZY A;  2ZME B;  2NAZ A;  1G3S A;  3M9A A;  1KQ9 A;  4WWC A;  2L01 A;  1LEA A;  1SD5 A;  2AXL A;  4O3M A;  3CUQ B;  3NQO A;  3GZ5 A;  1V4R A;  1TLH B;  2VON A;  3WTX C;  3WU0 A;  2QM3 A;  1TW3 A;  3MCZ A;  4RAZ A;  2EA2 A;  4UUV A;  1OMI A;  1EV7 A;  3IL2 A;  4PGG A;  2MA3 A;  3KP2 A;  2VBX A;  4YFN F;  4GYI A;  3FMR A;  3F6V A;  3RJP A;  3RYP A;  4RGU A;  2W84 A;  1YLF A;  2IW5 A;  5AIP A;  4XSZ F;  5ILS A;  4FT8 A;  4HZF A;  2HKX A;  2ZXJ A;  4KMU X;  3IWZ A;  4HQE A;  1DUX C;  2JRT A;  3R61 A;  4PDK A;  2P7V B;  5LHG A;  3I53 A;  3VEP A;  3GUD A;  1G3T A;  4MNU A;  1BI0 A;  2ZJ2 A;  1U5T C;  4YFX F;  1QQI A;  3V8J A;  2J5P A;  3EYY A;  4BNC A;  2LF7 A;  4LK1 F;  1TNS A;  3PQJ A;  3H3Z A;  1XGS A;  3HYI A;  1Z9C A;  3RIR A;  3IHU A;  1KQ0 A;  2H94 A;  4U7D A;  3ZMT A;  3ZMZ A;  2FQ3 A;  1S29 A;  5HLI A;  4UV9 A;  2RDP A;  4I02 A;  1D8J A;  5L3F A;  3W6K B;  2FU4 A;  2BEO A;  2QBY B;  2MBF A;  2BE5 F;  1OPC A;  4LG0 A;  3L09 A;  1R5G A;  3RTR A;  1KYW A;  1P6R A;  5FFZ A;  4D0P A;  2BV6 A;  3CDH A;  4HDV A;  1U5T B;  4AWX B;  3P7N A;  3LAJ A;  1LQ1 A;  2ISZ A;  3LQQ A;  2YPR A;  3BJA A;  3G3Z A;  2L54 A;  5DCF A;  2XAJ A;  3E97 A;  3GO5 A;  2HQN A;  2IPQ X;  1FC3 A;  1U78 A;  5DD4 A;  2L02 A;  3I59 B;  3I64 A;  3EYI A;  3LFK A;  5LGN A;  1T98 A;  2MD5 A;  3GLX A;  3FX3 A;  1ZAR A;  4HBL A;  5LGU A;  2DAO A;  1J7K A;  1QZZ A;  3BWG A;  2CO5 A;  2KJB A;  1CGP A;  3V7S A;  2D2W A;  4KN4 X;  2FNA A;  2A07 F;  2P8T A;  2CSO A;  4QWQ A;  2COM A;  1WKM A;  2VT2 A;  1E17 A;  1G3W A;  5KK1 A;  2ZBK A;  1H0M A;  2ZNY A;  1JE8 A;  3S2W A;  3CLO A;  2Y75 A;  2A61 A;  3R6S A;  5D5W B;  4MGR A;  2QZ8 A;  3TQN A;  1W7P D;  4U0V A;  1XGN A;  5CVV A;  5BPD A;  4A0Y A;  2LNB A;  1U6G A;  3CUO A;  3WTS C;  3LAP A;  3F3X A;  1IF1 A;  5H6Q A;  2HQR A;  3T8R A;  2O3F A;  1MD0 A;  5ED4 A;  5CVR A;  2W85 A;  4KIC A;  3N4M A;  1MJ9 A;  3CO7 C;  3KP4 A;  3JAM K;  1ZLK A;  4R1H A;  4KT5 C;  2K7L A;  3ECO A;  1JXS A;  3ZN1 A;  3FMS A;  1Z7U A;  2EFN A;  2UXX A;  4HV5 A;  3HOS A;  4A6E A;  2FOK A;  1J75 A;  2F5F A;  1K78 A;  4AVP A;  1D3Y A;  3R4K A;  1LEB A;  2E7X A;  4JQF A;  1R23 A;  4LK0 F;  4P5O A;  3Q5F A;  2Z5U A;  3ROU A;  3TGN A;  2FA5 A;  4UNO A;  3DFG A;  2QQ9 A;  4LD5 A;  4EJT A;  4M6Y A;  4ZYH A;  2R3S A;  1T38 A;  2PI0 A;  4O6J A;  2A5Y B;  2FXA A;  2QLZ A;  4A6D A;  1UB9 A;  4Q48 A;  4F7Z A;  1EH7 A;  4I2O A;  2IVM A;  3F23 A;  1SD4 A;  2LKP A;  5LRR A;  2EV6 A;  1YQA A;  2OBP A;  4G7O F;  1BIB A;  5FO5 A;  3HSR A;  2VN2 A;  5FFX A;  3DV8 A;  1B1B A;  1KQ8 A;  3GFI A;  2HEO A;  1DPU A;  5K5Q A;  3GFM A;  4CYD A;  3H92 A;  1Z6R A;  2ZFW A;  2EFW A;  5FD6 A;  5K5O A;  4MEY F;  4DNC A;  3IRQ A;  4CXF A;  2P6T A;  3V8K A;  2PN6 A;  1FZP B;  1FWZ A;  1BC7 C;  4ON0 A;  2VT3 A;  3TO7 A;  2NNY A;  4KFC A;  4OIP F;  2DFI A;  3TOA A;  4BXU A;  1YW8 A;  4HDU A;  1K79 A;  3WG9 A;  1LVA A;  5CVI A;  3LA3 A;  5E1W A;  2XAF A;  3Q9S A;  2XHK A;  1FPQ A;  1BI1 A;  1TW2 A;  3R0A A;  2A3S A;  2JPC A;  4L0Y B;  4YII A;  5LLQ A;  1YS7 A;  3BDD A;  5E18 F;  4U0Y A;  5CVU A;  1UHW A;  4YFK F;  2ZKZ A;  3KE2 A;  2W25 A;  5DV5 A;  3RYR A;  2FBK A;  4L9T A;  2GA2 A;  1H9G A;  3ULQ B;  1FBU A;  2P5K A;  5D4S A;  1W7P A;  4GXO A;  4HF1 A;  3TO6 A;  3GX4 X;  4PGH A;  2HFH A;  3QU3 A;  1FOK A;  1QPM A;  2F5E A;  4IRH A;  2DQL A;  3IKT A;  1YO5 C;  4HAM A;  4K2E A;  4KIF A;  2Z9O A;  2X0L A;  5J8F A;  1G6N A;  5JVT A;  3E5X A;  3I59 A;  1XCV A;  1BOA A;  1XCB A;  3SHF A;  1SAX A;  2CWE A;  1IRF A;  1HQC A;  1KU7 A;  2M30 A;  3M7G A;  1W5S A;  2G7H A;  3JAM Z;  2P7C B;  4UVC A;  5ERI A;  2PMH A;  3ECH A;  4KDP A;  5HLH A;  1XMK A;  2KKO A;  1U8R A;  4RAY A;  3DF8 A;  3KFW X;  1IW7 F;  1TTY A;  2XGX A;  3D0S A;  1ZYR F;  1FY7 A;  1WWX A;  1ON2 A;  1R36 A;  1XSV A;  1XSD A;  2O61 A;  1SD7 A;  1STZ A;  4P9U A;  3I0T A;  4KMF A;  4I98 B;  5DD8 A;  2MH2 A;  1OR7 A;  2STW A;  3OOP A;  4ENM A;  3M1E A;  5FGM A;  3KP3 A;  3K69 A;  2OAZ A;  3QPT A;  2HS5 A;  1ULY A;  3KEO A;  1WRJ A;  4EGZ A;  1LDJ A;  4KN7 X;  4FX4 A;  3K9T A;  5DEQ A;  2MH9 A;  2XRO A;  2PBI A;  3F22 A;  2E1C A;  4IHT A;  2MLG A;  1WI9 A;  3J81 Z;  3LA7 A;  1XMA A;  3T5X A;  4PZJ A;  2OD5 A;  1EH6 A;  5D8K B;  2CFX A;  5F6F A;  2QYO A;  4R79 A;  1Z91 A;  1LDD A;  3MZY A;  3M8F A;  2FBI A;  3IC7 A;  5L3B A;  2VE9 A;  3C7J A;  4CHU A;  3MEX A;  3BPX A;  2IA1 A;  5L3E A;  2OQG A;  1S7A A;  4Q5S F;  3LA2 A;  3HUG A;  3F8C A;  5HDG A;  4WF2 A;  1UFM A;  5EEG A;  2RNJ A;  3FZV A;  2OU2 A;  4E70 A;  2F5C A;  2Q0O A;  2V6C A;  2NNN A;  4EJU A;  2HR3 A;  3FM5 A;  3RKX A;  4RGX A;  3K0L A;  1F4K A;  1YG2 A;  2VOO A;  2KJC A;  1K6O A;  1P92 A;  2KIU A;  2YX4 A;  3TO9 A;  3KEQ A;  4CDG A;  4WXH A;  2LF8 A;  4XLN F;  3B73 A;  4M74 A;  3WU1 B;  2J5O A;  1IAW A;  4MHG A;  4N0B A;  2EB7 A;  1B59 A;  3O6B B;  1R1U A;  1ODD A;  3J80 Z;  3TDU C;  2WC2 A;  5CLS A;  1KA8 A;  1G3Y A;  2IJL A;  5DCM B;  2STT A;  2XAH A;  1MJA A;  3NRV A;  3ZMU A;  1AWC A;  3WTZ A;  1GXQ A;  4A0Z A;  3I54 A;  3O3K A;  4XSX F;  1O3Q A;  1BJA A;  3HTS B;  1YIO A;  4M9Z A;  4RGS A;  2WTE A;  3PFI A;  2W24 A;  1SFU A;  1U3E M;  1HKQ A;  1RUO A;  3BP8 A;  5E1Z B;  5F1R A;  5D5X B;  4L0Z B;  2YSR A;  5ICF A;  3JSO A;  4KA4 A;  5CVJ A;  4O5V A;  2QQB A;  2EFQ A;  1HW1 A;  2Y0M A;  1U2W A;  1BI2 A;  4Y17 A;  4L9N A;  3BZ6 A;  3M8E A;  1P4X A;  2M87 A;  2EWN A;  5HDK A;  3KLO A;  4U0W A;  3QRF F;  4DQ2 A;  1KU3 A;  1ZRE A;  1ZGJ A;  3BJO A;  2K4B A;  2HKO A;  2R7F A;  2Z3Y A;  3L00 A;  2YX7 A;  1WSU A;  2DI3 A;  3ZP5 A;  3ML6 A;  2IA0 A;  5BOX A;  1DPR A;  5ILV A;  4HX8 A;  4XBF A;  2P6S A;  2NYX A;  4ZH4 F;  5BS6 A;  1LJ9 A;  4L9J A;  5CJ9 A;  1S8N A;  1IZ1 A;  3R0J A;  4JK1 X;  2KIM A;  5HS8 A;  5KVR A;  2V1U A;  3U2R A;  3LST A;  2FNP A;  2HWV A;  2EFO A;  2XAQ A;  1H9T A;  3CO6 C; 
#chains in the Genus database with same CATH topology
 3W2W A;  3SFI A;  2QQA A;  3W6J B;  1I50 J;  4JYK A;  1OCP A;  4DBR A;  1HXD A;  2OJE D;  3FMQ A;  4MQV A;  3V7C A;  3GYH X;  2L3D A;  2O9L A;  3JR9 A;  2VC0 A;  2M8E A;  2WAE A;  3RQI A;  1MDM A;  2VBY A;  1Y0N A;  1X1P A;  5TGT A;  3J7A O;  1UCR A;  5FJ8 J;  4N4O B;  1IN8 A;  3HRU A;  5A2Q K;  2Y48 A;  3O2P E;  3OY9 A;  5IOY A;  2CU7 A;  5HS9 A;  2OTL I;  2CH0 A;  1R4M B;  2L2O A;  2COB A;  3I5U A;  3EUK L;  2XF5 A;  3P5J A;  2FSW A;  5DS9 A;  4IHS A;  3OIP A;  1IUY A;  4H0E A;  2JPB A;  1FOX A;  2ZO4 A;  1F9N A;  1QGP A;  3AFH A;  3BZC A;  1O57 A;  3WGI A;  2PFB A;  2GWR A;  3LWF A;  3MZH A;  4WCG A;  3F21 A;  3U1D A;  4L18 B;  1Z05 A;  1JI8 A;  4AD9 A;  2DA4 A;  4P9F A;  1R58 A;  2KDO A;  2JWT A;  4CZC A;  1XSX A;  4BHB A;  1Y8Q B;  3LSR A;  2JTV A;  1W0T A;  4HOB A;  1Y39 A;  2ADU A;  2DFH A;  3HSE A;  3Q9V A;  4HQM A;  3PIP F;  2M1B A;  4JP0 A;  4BE1 A;  3D5L A;  2KZG A;  2PJR A;  2H1K A;  2ZME A;  3I3L A;  4HX4 A;  2UZK A;  2R7D A;  4G7H F;  2DT7 B;  2EIL H;  2BVM A;  4A0X A;  3RKY A;  3CJN A;  3CUQ A;  3BR0 A;  3ZQ7 A;  2AXT C;  2QVO A;  3DEW A;  4Z2Y A;  3MAJ A;  1LKX A;  1OYY A;  5GAE J;  3L1P A;  4ASN A;  4IVN A;  1OCT C;  3QPL A;  1N25 A;  2H6B A;  4IOC F;  2W82 A;  3TKY A;  2R7X A;  1TQM A;  3QYB A;  4LJZ F;  2ZSH B;  1JUP A;  3N97 A;  1DDN A;  1S7E A;  2K9N A;  4DZJ A;  1HA8 A;  4I99 C;  5H6R A;  4CCN A;  3E6D A;  1J9I A;  2LG4 A;  4ENJ A;  2XV4 S;  1QO0 D;  2JSP A;  5H20 A;  2M34 A;  1MZB A;  3EUH A;  1PUF B;  2WB1 N;  1OCO H;  1MGT A;  5FLX K;  1BC8 C;  3GTQ J;  3L7W A;  1E3H A;  2QWW A;  4L5I A;  3M07 A;  5KNL A;  3NWS A;  2R7Q A;  2IRF G;  1L3L A;  2WAD A;  2RKH A;  3KYD B;  5E3L A;  5GPC A;  4A3D J;  1R00 A;  4YRV A;  2QUF A;  3ERM A;  4IRI A;  2L0K A;  4OU0 A;  1MMA A;  2HZT A;  3IP4 B;  3FBN B;  4PJL A;  3G73 A;  3QPS A;  4M9S A;  1Y6I A;  2N8G A;  2V9K A;  2IBD A;  3FK7 A;  4XKW A;  5K5R A;  1YW9 A;  4MO7 A;  1NH3 A;  2RN7 A;  3E6B A;  4HG2 A;  1UST A;  1ONV A;  2EA4 A;  1W36 D;  3SYT A;  2P4W A;  1FBS A;  3DKY A;  3DKW A;  3A01 A;  2XVC A;  2R7T A;  4DYC A;  3P9I A;  2QEN A;  4D7N A;  3LFU A;  2IS4 A;  3V8L A;  2DJN A;  2X4H A;  2A69 F;  3SQN A;  3G6E I;  4UUS B;  4KIS A;  5EDN A;  4A3K J;  1IDZ A;  4A93 J;  2LSO A;  3WU2 C;  5K7H A;  3CTA A;  4IXA A;  5JHF A;  3GW2 A;  1VQK I;  2HOE A;  5DCM A;  4BL0 B;  2FF4 A;  3T1B A;  4LFU A;  2XPU A;  4FE4 A;  2ELJ A;  3NEU A;  1EA3 A;  1YHQ I;  4MFD A;  1YTY A;  3ELK A;  2PQ8 A;  3I4N J;  3V7R A;  3GZ6 A;  4ZZD A;  4BU2 A;  1ZAO A;  5GP9 A;  4OIN F;  1FP2 A;  2K27 A;  4IJA A;  5KCM A;  4XRS A;  4CYC B;  2KRH A;  5LBQ A;  2B0L A;  4RB3 C;  3LSI A;  3QP6 A;  5HLG A;  2LP0 A;  3SZT A;  1VF9 A;  2IGM A;  2QCO A;  3I55 I;  3PM1 A;  2ZFU A;  5F1J A;  3ZGK A;  1S6L A;  2A6E F;  1RNL A;  1AHD P;  2H27 A;  2QBY A;  2E7W A;  1YYV A;  4AIK A;  3AL0 C;  2HYF A;  4J00 A;  2EIM H;  3JCU C;  2EJR A;  3WE3 A;  1T6S A;  3HRS A;  1NG7 A;  4BDY A;  2JSC A;  1BR1 A;  1ETY A;  3FHZ A;  3BR2 A;  1UHS A;  2NS8 A;  5E8I A;  1RC9 A;  3CCM I;  4P55 A;  1NK3 P;  3H9G A;  3BT9 A;  3KP5 A;  4M3D A;  2IS2 A;  2NS0 A;  3RPU A;  2GQQ A;  1H8A C;  3TW7 A;  3RI4 A;  4AIH A;  3JW4 A;  2R0Q C;  1K4S A;  5J6X A;  1FBQ A;  1XN7 A;  4NQW A;  3AAF A;  2DT5 A;  1U5T A;  2X48 A;  1P4A A;  2H8W A;  4ESJ A;  1VTN C;  4C9Y A;  1APL C;  4MIM A;  4WX9 A;  3PNT A;  5D6E A;  1K4T A;  1I39 A;  2FBH A;  4ZDP A;  5L3C A;  2XIG A;  3VYU B;  1TQP A;  4MQ9 F;  3ZPL A;  4LLL A;  3L9F A;  1IDY A;  1SMY F;  2XPV A;  4UVA A;  2Y69 H;  4ETS A;  2ZB9 A;  2G7U A;  2WV0 A;  2ZNZ A;  4RM3 A;  2NVY J;  4HNU A;  5B1A H;  4LG0 B;  4XRM A;  2DT6 A;  3BC8 A;  1GV2 A;  5B5E C;  2PLY A;  4G8X A;  2PEX A;  1ZG3 A;  5TRD A;  4JBA A;  1OIS A;  4QLC U;  3HOV J;  1JKQ C;  1ON1 A;  2VQC A;  3IRR A;  4QSH A;  4I0A A;  3HOX J;  2DMT A;  4IRG A;  2Q2E A;  4PSW A;  4C3H J;  3BTL A;  2NS7 A;  2VJ4 A;  3QOP A;  4NDL A;  5JVG F;  4IEJ A;  3ZMV A;  4E4H A;  3COA C;  3HGG A;  5BQT A;  3RZO J;  2E1O A;  1YOV B;  4EJO A;  3ZRG A;  3OSG A;  1PUE E;  3ZQF A;  1D1A A;  3HOY J;  3AL0 B;  1K6Y A;  3FIS A;  3GBG A;  1V55 H;  3OS0 A;  2IT0 A;  3HHG A;  3H5A A;  3JRE A;  3IUO A;  2FMY A;  4CCM A;  1FLI A;  2CW0 F;  1SVM A;  3IWF A;  2F6C A;  5EZH A;  2P5L C;  2O6G E;  3LQR A;  1X58 A;  1A6Q A;  4ITV A;  5D5U B;  1L0O C;  2D1V A;  3DBR B;  1MH3 A;  2DW4 A;  2OQR A;  2W1O A;  4M6X A;  1D5V A;  2E60 A;  3BCB A;  1ZG1 A;  4M3F A;  1YS6 A;  5CQE A;  2XC7 A;  1YI2 I;  1JGS A;  1MW7 A;  4B3X A;  1G8X A;  1I1S A;  1R1T A;  2XRN A;  1NHA A;  4XLP F;  1JJ6 C;  3JRH A;  3ERE D;  1KYZ A;  1TQI A;  1FSE A;  4CUG A;  2HXI A;  5CYV A;  2FEZ A;  4E7K A;  2R7U A;  3DPT A;  2H8R A;  4RB0 A;  1B6A A;  4RGR A;  3OYI A;  1K61 A;  3EUA A;  1IXR C;  2PMU A;  1BM9 A;  3ESW B;  4N9H A;  2H6C A;  4HF0 A;  1H88 C;  1B9N A;  4PCQ A;  1FP1 D;  1ZGA A;  2LK2 A;  2BYV E;  2XGD A;  3U21 A;  2VXZ A;  1LFU P;  3FXK A;  1OLT A;  2VJI A;  3ZQI A;  5TJJ A;  2LOO A;  1Y0U A;  3FKI J;  4BY1 J;  1P4W A;  4E7Z A;  2CW7 A;  1TWF J;  1S3J A;  1R5H A;  2MFZ A;  2XSJ C;  1R7J A;  3SJM A;  2DQR A;  1HOM A;  5E20 A;  3TDZ C;  1WQ2 A;  1T2K A;  2DMN A;  5HS7 A;  4A12 A;  3CJQ B;  5CKT A;  1E2X A;  3S16 J;  3K2A A;  1WJF A;  1T0F A;  2V1X A;  1V5G A;  1TT5 B;  4XQF A;  1FNN A;  4EM0 B;  2HYG D;  3AKZ A;  1LNW A;  2M45 A;  1SFX A;  3KX2 A;  2DPD A;  3WE2 A;  3S2D J;  1T39 A;  3S3N A;  1ENH A;  1XGO A;  3MQ0 A;  1YJN I;  1JT0 A;  4B8X A;  2M0C A;  4XLH A;  5GTH C;  3AG4 H;  1B4A A;  4MTD A;  4A3E J;  4KIB A;  1K7A A;  2O5R A;  3LMM A;  3WTU C;  2WV1 A;  4C2T A;  1X1C A;  3S15 J;  4OOI A;  5DTD A;  3ABT A;  5CQG A;  2LBF A;  3P9C A;  3TBI A;  2EZL A;  3C1D A;  5ICE A;  3M8J A;  2OA4 A;  2WY7 Q;  1UEL B;  4NC7 A;  4GO1 A;  1O3S A;  1RPW A;  3JSP A;  2E1N A;  1JGG A;  3SZG A;  1SFE A;  1XX5 A;  4BQA A;  4BBS J;  3GXO A;  4B47 A;  1QNT A;  2M4K A;  3HKZ A;  5F27 A;  3HHH A;  4D1Q A;  2CQK A;  1VZ0 A;  4HX7 A;  1S72 I;  4I01 A;  2O03 A;  1ZRD A;  1O3T A;  3FXL A;  1I1G A;  3SFZ A;  2AHQ A;  1ZH5 A;  2MLK A;  1DGW Y;  5D5V B;  3CZ6 A;  3ZXS A;  4CSW A;  4G9Y A;  4U88 A;  3DEU A;  2LKS A;  2KDZ A;  4HW0 A;  4DIQ A;  1R4N B;  2JA8 J;  1Z21 A;  2WAF A;  3HTU A;  1FSH A;  1S7O A;  2HTJ A;  2CUE A;  2L9N A;  1K78 B;  3QU6 A;  2DK5 A;  5JR3 A;  1M1E B;  2WWY A;  3OYB A;  3DPL C;  1PUF A;  2MGQ A;  4HNT A;  2CUJ A;  1YW7 A;  2ZXI A;  4BXF A;  1IRG A;  1D5Y A;  2EV0 A;  1I6X A;  5LHH A;  1DU0 A;  3HOZ J;  5DYM A;  2DMU A;  4BS9 A;  1OKR A;  2JA6 J;  2OCE A;  2VBZ A;  2K3F A;  3E5Q A;  1OYI A;  2K86 A;  4NC6 A;  2EZH A;  4GGG A;  2K02 A;  2UV1 A;  1Q1H A;  1VI0 A;  2JA2 A;  4F93 B;  2Z99 A;  1IN5 A;  2DOE A;  3HRT A;  3M4O J;  2GXG A;  3BOQ A;  3K4L A;  1NK2 P;  1X3Z B;  2LY9 A;  2X51 A;  1H89 C;  2DJI A;  1FTZ A;  3OR1 C;  2K40 A;  2IAI A;  2LR8 A;  3HOT A;  4CIC A;  4BJ6 C;  2VBW A;  2OF7 A;  3MD2 A;  1WCM J;  2O7O A;  4BH9 A;  1ZN2 A;  3CC7 I;  3WG7 H;  4HEA 2;  3DQV C;  3U1K A;  3ZMS A;  4OIQ F;  1RRJ A;  3KP6 A;  4N9I A;  3K2Z A;  3WGG A;  2E36 A;  3VOD A;  4BEH B;  3GCM A;  3MMY B;  4ZZL A;  3RDI A;  2KT0 A;  2YU3 A;  2HDW A;  3OWT A;  4LOC A;  3GLL A;  4GRI A;  1ERD A;  1LVK A;  4AC0 A;  2OZU A;  3PO2 J;  1KZH A;  2XAS A;  2F5D A;  2XRL A;  3E6M A;  5AIQ A;  3K7A J;  2CQ7 A;  3PUB A;  1TZL A;  2FUG 2;  4G12 A;  1WVR A;  3K1P A;  1KGS A;  3ASN H;  4BAC A;  3FXR A;  5HVQ C;  3I71 A;  3A2K A;  2VQH A;  4D7M A;  2QSF X;  4L9V A;  2BGC A;  2H09 A;  2XKO A;  1SEU A;  2Y31 A;  3TP3 A;  4KYW A;  2MC4 A;  1HDD C;  1BI3 A;  3CCV I;  2OC6 A;  2IGK A;  4U7B A;  2G0E A;  3FXO A;  4RB1 A;  4EGY A;  1C0W A;  1X3U A;  2L4A A;  4PK4 A;  1FYK A;  4X0G A;  4BYY A;  2RV8 A;  3C3W A;  2DOF A;  3C2B A;  2LMD A;  1PDN C;  2UWM A;  5BPI A;  1N77 A;  5J3L A;  1YX5 A;  4XLC A;  1FEX A;  3VFZ A;  4FQG A;  2DO7 A;  1FX7 A;  4I09 A;  4HLY A;  1IN6 A;  4LMY A;  4V2F A;  5HDN A;  1WJD A;  4BBR J;  2OPT A;  3AG1 H;  1J0R A;  4XOT A;  3L2U A;  2LFB A;  4G6D A;  2KIS A;  4EM1 A;  4BAY A;  2ZSI B;  2YR2 A;  3DTK A;  3B02 A;  1RIO H;  2K4J A;  1T33 A;  1IXS B;  1P9Q C;  5L3D A;  4ANJ A;  1IGN A;  5FRM A;  4KNY A;  3TMO A;  2KFD A;  1F43 A;  2KIF A;  3RSN A;  1KU2 A;  2ELH A;  2GIV A;  3JRF A;  1D0X A;  4ENN A;  1XDS A;  2XUB A;  3JTH A;  3G1L A;  3L2R A;  2YUS A;  4IO9 F;  1W7P B;  4IZZ A;  1WFX A;  5FKO A;  2XAG A;  4BHP A;  3O8H A;  1D8K A;  5ICC A;  4A5M A;  2EPF A;  3FXM A;  3KCC A;  3QP5 A;  3WTV C;  4RLQ A;  4EV0 A;  3HBL A;  2LY1 A;  4XRF A;  1SD6 A;  3F8F A;  2Z2S B;  4ESF A;  4I0B A;  1TP4 A;  2IA2 A;  4AUX A;  1SMT A;  1I5Z A;  2RVC A;  4DZP A;  3ISP A;  1A31 A;  4RMN A;  2W57 A;  1VND A;  1SC7 A;  1AU7 A;  5J4Y A;  2DXI A;  1YIJ I;  5FRN A;  2Q8K A;  3RCO A;  2V9V A;  3F0C A;  4KIT B;  2ME0 A;  5FLV A;  4C30 A;  3ABU A;  3PNY A;  1OR7 C;  3TOB A;  1HLV A;  2LVS A;  4PJN A;  5LGT A;  1DP7 P;  4E6K G;  1LDK B;  2IP2 A;  4I7H A;  2ACJ A;  4M71 A;  1IV6 A;  3MKY B;  3HIF A;  4B09 A;  3SZP A;  3H3U A;  4LGW A;  2EIN H;  2HDD A;  2VL8 A;  4XK4 A;  3F8N A;  3PQK A;  1REP C;  4FCY A;  2GA1 A;  5DUK A;  2DA1 A;  2D45 A;  1RUN A;  4HLX A;  2DYR H;  2ID3 A;  1RES A;  5IYD J;  2DBB A;  3GTG J;  1FT9 A;  4BKX A;  3EET A;  5HOO A;  2CG4 A;  2VKD A;  5D4R A;  4GCV A;  4AYB N;  1NG6 A;  4BHC A;  5LRS A;  1W36 C;  5AON A;  2R7S A;  5IT9 K;  4OAY A;  3LSG A;  5F0F A;  2A68 F;  2X6Y A;  5GAD J;  4RS8 A;  2QGU A;  3SXY A;  3RPQ A;  1IUF A;  3V4G A;  1B72 A;  2EFP A;  1VQ6 I;  1RI7 A;  5M5W J;  4YEJ A;  1OJL A;  1PP8 F;  2PJP A;  4CCJ A;  2VUM J;  2ZJQ F;  2ME6 A;  2EV5 A;  5LEK A;  3FDY A;  1O3R A;  2I8D A;  1W4M A;  3ZQQ A;  5JI6 A;  4G94 A;  3MFK A;  1IXC A;  1HKS A;  1DGR M;  2CS3 A;  1IN4 A;  3DXJ F;  4MTE A;  1HSJ A;  1FIA A;  2CYY A;  1B8I A;  3CDL A;  3H0G J;  2OZ6 A;  2P5V A;  1ZRC A;  2ISY A;  2WBM A;  3GFJ A;  4D9J A;  1RZ4 A;  3GZN B;  3M3Y J;  1JHF A;  1TBX A;  1Z6T A;  2UXN A;  4M72 A;  5IP9 J;  5JHU A;  5EEA A;  3F72 A;  2WY8 Q;  2R5Z B;  4MEX F;  3B6C A;  5EG0 A;  4WXD A;  1RKT A;  2A6H F;  2DA2 A;  2VOP A;  1XGM A;  3E0J B;  1OYW A;  3JRG A;  4LB6 B;  2XAU A;  3GWZ A;  2YU9 J;  1HF0 A;  5D8L B;  3H5R A;  4HNV A;  1XD7 A;  1HW5 A;  4M73 A;  3PNV A;  4Y52 J;  5BMZ A;  1MNM C;  1QBJ A;  3EPZ A;  4DYR A;  2QKM B;  3Q0W A;  2R5Y B;  2FE3 A;  3HPH A;  4AIJ A;  3VSL A;  1WZ2 A;  2BW3 B;  2VAS A;  3DKX A;  1GHC A;  3HL2 A;  3BJ6 A;  2PX9 A;  2V79 A;  1UMQ A;  1AKH B;  2BY3 A;  3DCF A;  5EEH A;  2KRF A;  4UHT A;  2O8X A;  4L5J A;  4XRS G;  3QYF A;  1YRN A;  5HOD A;  1F5T A;  4BY7 J;  2M3A A;  4RB2 C;  1MBH A;  6PAX A;  4OIO F;  3MWM A;  3ZN0 A;  1LB2 A;  2XB5 A;  1CF7 B;  5FD5 A;  4NHJ A;  2WAQ A;  3GTK J;  4KUM A;  4A3L J;  1Z67 A;  3U9G A;  5IT3 A;  1TNT A;  4ZYD A;  3MKW B;  2Z1D A;  3E5U A;  4RAG A;  4PSX A;  2JUG A;  2FRH A;  3CF5 F;  2DPU A;  5ICG A;  4DJA A;  1GVJ A;  4JX6 A;  4LLG F;  1JHH A;  5F08 A;  1GXP A;  3P9K A;  4YIF A;  1IN7 A;  1FMV A;  4DBQ A;  2GXB A;  1UHM A;  1ZEL A;  4Y33 A;  3H1C A;  4M9X A;  4ESB A;  2Z16 A;  2VOD A;  1P2F A;  2M5W A;  2W4S A;  3HUG B;  1TWH J;  1R22 A;  1OFC X;  3BG7 A;  1KU9 A;  2CQQ A;  3KLN A;  4P96 A;  4EAT A;  3HB9 A;  3S3M A;  1R1V A;  4EVI A;  3EDP A;  2R7O A;  2HGC A;  3S8P A;  2D1H A;  4CH7 A;  2O0Y A;  1ZR4 A;  3ZMD A;  2DOD A;  1K83 J;  3WTT C;  2HTS A;  2PG4 A;  1G4D A;  3OYA A;  1O7L A;  3K1N A;  5FB2 A;  4CZZ A;  2GZW A;  3ZCO A;  4HA8 A;  1A5J A;  4HF2 A;  4WK8 F;  3ZQH A;  3FXU A;  2IEK A;  2RGV A;  2F5V A;  3ABL H;  3BR6 A;  3J81 K;  2X1D A;  1A35 A;  2JT1 A;  2HDC A;  4UXN A;  3G2B A;  1SFK A;  2VC1 A;  4ZYE A;  2G9W A;  2VXD A;  4A69 C;  2IS1 A;  1QHH D;  3BZK A;  5JFR A;  4J19 A;  3B6A A;  3PSF A;  3HM5 A;  4IQJ A;  5TIS C;  2VB6 A;  2A05 A;  4D5C A;  4EM2 A;  4IKF A;  4KIG A;  1ZLJ A;  1JJ8 C;  1USS A;  1ETX A;  4LB5 A;  3RKW A;  1J59 A;  2QA4 I;  4FIS A;  5L3G A;  1ORK A;  1XDU A;  4FX0 A;  1MMD A;  2C6Y A;  3T0Y A;  1U9O A;  1HBX G;  2CGP A;  3BG6 A;  1HST A;  1JTY A;  3DWL E;  1DP3 A;  1V3F A;  1MBJ A;  2CFO A;  3BG5 A;  4Q47 A;  3BRO A;  2Y2Z A;  4MFE A;  2XKP A;  2BOL A;  2K85 A;  2KQR A;  1N75 A;  2L7M P;  3OYM A;  4GYG A;  5DDG A;  2CUZ A;  5EZG A;  3BQZ A;  5LHI A;  1AA7 A;  1BIA A;  5ILU A;  2A6T A;  1PP7 U;  1Z3X A;  1Y8R B;  3LSH A;  2JN6 A;  2F4M B;  4OMZ A;  4ENK A;  4Y13 A;  3BTI A;  2TDX A;  4G7Z F;  1MJB A;  2JZY A;  2DLL A;  1EH8 A;  1XG1 A;  2V1N A;  4A3C J;  1UG2 A;  3HGY A;  3K70 D;  3BY6 A;  2ETH A;  2VQG A;  3GF2 A;  2LH9 A;  5E8G A;  5E17 F;  1J5Y A;  4Y15 A;  1UAA A;  1B9M A;  4BDZ A;  3QPH A;  3FWE A;  2DFF A;  2DTR A;  4EQQ A;  3SEZ A;  5IT9 Z;  3REO A;  3CCR I;  5JLX A;  3JTG A;  4IHX A;  3KET A;  3EQL F;  1ZR2 A;  1HW2 A;  4NB5 A;  1XPX A;  3E6C C;  3OV8 A;  2CMP A;  4OMY A;  3F8B A;  5IP7 J;  3GFL A;  1S5L C;  2RC4 A;  2YS9 A;  4A2U A;  2KPM A;  4C2U A;  5A2Q Z;  3SEQ A;  2DMP A;  5K7Z A;  1AOY A;  4MLO A;  4R8H A;  4EJV A;  3OYN A;  2K3P A;  4IF4 A;  4OIR F;  3ZQC A;  5IY5 H;  2HOT A;  2M8G X;  3HXL A;  3IKV A;  4E7J A;  1I27 A;  2LLK A;  3J80 K;  4YG2 F;  2EZK A;  4M3G A;  3E3V A;  2FML A;  3IAS 2;  4TV7 A;  4CCL A;  3GTO J;  2GBY A;  3WOD F;  2MYS A;  5E1X A;  5GTI C;  5EGO B;  3OYF A;  2HVQ A;  1RR8 C;  1BR2 A;  5J8C A;  2ZCW A;  2NRA C;  1X4O A;  3F8M A;  2GIZ A;  2ZJR F;  2EIJ H;  4BE0 A;  1LE8 B;  3A4C A;  3VB2 A;  3BCA A;  1X19 A;  3BPV A;  4WXC A;  2EK5 A;  4CO8 A;  3RQ4 A;  2LC2 A;  5D6F A;  3LNQ A;  3VOE A;  3L2C A;  2ESH A;  2BBY A;  1YFH A;  3WHC A;  4IHV A;  1BW6 A;  2WB1 A;  2DA6 A;  2RQP A;  3I58 A;  3OYE A;  3DLA A;  3KP7 A;  3WTY C;  3LSM A;  1VQO I;  3GTL J;  2ESN A;  2XDV A;  3I4P A;  4XN0 A;  4M6V A;  3H35 A;  3HC7 A;  1OCC H;  1JUM A;  2VKV A;  1XB4 A;  1F1Z A;  4IL6 C;  4A5N A;  1QPI A;  2V1D A;  2F2E A;  1BL0 A;  1Z77 A;  2W7N A;  4A3G J;  3ZQL A;  3HSF A;  1TWA J;  3PIO F;  1BN5 A;  3FF5 A;  1T95 A;  3PFY A;  3H0D A;  3FM3 A;  2V6E A;  1GLN A;  1BBY A;  1ZHF A;  2HU9 A;  3DP7 A;  3R60 A;  3OS1 A;  4Q4Z F;  1G59 A;  2L4M A;  2ZME C;  1QZY A;  3K4C A;  2CV2 A;  1U9N A;  4EJW A;  1HKT A;  5M5Y J;  4RBO A;  1PVE A;  3CUQ C;  2DU9 A;  3HRM A;  3WGH A;  5K1Y A;  5FLX Z;  4CGZ A;  3T8T A;  4EMS A;  2GAU A;  1WPK A;  1ZRF A;  2BY1 A;  4RAF A;  4KT6 A;  4LIU A;  4J01 A;  1D1C A;  2K9S A;  1W5T A;  3F6O A;  3ONQ A;  5LEJ A;  1MDM B;  2VE8 A;  1QU3 A;  2Z33 A;  4AID A;  1MMG A;  3CCY A;  3S1Q J;  2OV7 A;  2HYJ A;  4UVB A;  3IV5 A;  1ZG5 A;  2LDU A;  4LLN A;  1Z7L A;  3GVA A;  4AM3 A;  4IPA A;  5IYC J;  3I4M J;  2MC3 A;  3CCJ I;  3C18 A;  1J2X A;  2XSD C;  1O7F A;  3EUH C;  4S04 A;  1AKH A;  3K6G A;  1E0E A;  3QAH A;  3WTW C;  2KHM A;  3Q0V A;  4F92 B;  1MND A;  4ZC3 A;  3K1M A;  4A3I J;  3CCQ I;  3KZZ A;  2AS5 F;  3FXQ A;  4FE7 A;  4HYE A;  2X6W A;  4FHT A;  4S05 A;  1FYL A;  2B63 J;  4ZTJ A;  1A04 A;  3GEZ A;  2H1L A;  2EZI A;  3K4B A;  4AVZ A;  1POG A;  2BVL A;  5DUI A;  1CF7 A;  5F64 A;  1MKM A;  3MKL A;  4ZDL A;  3OYH A;  4G6Q A;  4UV8 A;  2L7F P;  4B43 A;  1WJC A;  1ETQ A;  1Z1D A;  2XB0 X;  4HV6 A;  4ZYG A;  1FYM A;  2DK8 A;  3KZY A;  3O8G A;  2ELK A;  2PJR B;  2ZME B;  2NAZ A;  1I3Q J;  1G3S A;  3M9A A;  1KQ9 A;  4XKC A;  4WWC A;  2L01 A;  1LEA A;  1SD5 A;  3TED A;  3DTE A;  3MVP A;  3I9V 2;  3PO3 J;  2AXL A;  4O3M A;  4NNJ A;  3CUQ B;  3NQO A;  4BGD A;  1TT0 A;  2CQN A;  3GZ5 A;  1PJR A;  3F9K A;  1V4R A;  3K4J A;  3GTJ J;  1TLH B;  1QRY A;  3PJR A;  2HQA A;  3WTX C;  2VON A;  1VQ5 I;  3H9Q A;  2V26 A;  3WU0 A;  2W48 A;  2QM3 A;  2D5V A;  1XS9 A;  5IOZ A;  1TW3 A;  3MCZ A;  3ABK H;  4II2 A;  4RAZ A;  5JLW A;  2EA2 A;  5J4V A;  4UUV A;  2PMZ A;  1OMI A;  3A0B C;  3GTP J;  1EV7 A;  1LUJ B;  4RM2 A;  1JKO C;  2DN0 A;  3IL2 A;  4PGG A;  2MA3 A;  3KP2 A;  1VQM I;  4D5F A;  1X1A A;  2VBX A;  3LL7 A;  4YFN F;  4GYI A;  3FMR A;  2E2H J;  2R7V A;  3F6V A;  4B1R A;  3RJP A;  2BZT A;  2VI6 A;  3RYP A;  4RGU A;  4UUS A;  2W84 A;  2LYC A;  1YLF A;  2IW5 A;  1RR7 A;  5AIP A;  3JRA A;  4XSZ F;  1QVT A;  5ILS A;  4FT8 A;  2V4J C;  1JUS A;  4HZF A;  2HKX A;  4M3B A;  1VQ8 I;  2ZXJ A;  4KMU X;  4F3Q A;  4XID A;  3IWZ A;  4HQE A;  3E7L A;  3Q3S A;  1DUX C;  4M3E A;  2JRT A;  3R61 A;  4PDK A;  1GT0 C;  3K4N A;  2P7V B;  2MAB A;  5LHG A;  1MNE A;  4CYC A;  2EBI A;  2XPW A;  3I53 A;  3GUD A;  3IH3 A;  3VEP A;  1G3T A;  4MNU A;  1BI0 A;  4XKV A;  4PJ0 C;  2ZJ2 A;  3OIQ A;  1U5T C;  4E7H A;  3VYR B;  4B3A A;  1DU6 A;  1FMW A;  4YFX F;  1QQI A;  4XOP A;  1JKP C;  1VQ4 I;  3H5N A;  3V8J A;  3CCS I;  4IHW A;  3OYC A;  2J5P A;  3A01 B;  1WHU A;  3EYY A;  4BNC A;  2LF7 A;  4XMY A;  4LK1 F;  1TNS A;  2GOX B;  3H3Z A;  3K10 A;  3PQJ A;  1QA6 A;  1XGS A;  3HYI A;  2RNG A;  3RIR A;  4A3M J;  3IHU A;  1Z9C A;  1KQ0 A;  2H94 A;  4U7D A;  3ZMT A;  1QHG A;  1X2N A;  5IYB J;  3ZMZ A;  2O8K A;  3FIW A;  4EEF G;  2FQ3 A;  1S29 A;  3KZI C;  4ZDO A;  2OUM A;  2VKH A;  3JRI A;  2R7R A;  5HLI A;  4F91 B;  4UV9 A;  3DLL F;  1X2M A;  2JK3 A;  1TWG J;  2RDP A;  3KIO A;  4I02 A;  9ANT A;  1D8J A;  2OCC H;  1WH7 A;  4PFP A;  3J7Z I;  5L3F A;  3W6K B;  2FU4 A;  2DDB A;  2BEO A;  2QBY B;  5HNH A;  2ECC A;  2MBF A;  4LG3 A;  2EIK H;  2LD5 A;  4HPQ A;  3A0H C;  1Y1W J;  1ZGW A;  3MZ8 A;  2E71 A;  3H3V K;  2BE5 F;  3OL4 A;  1R6R A;  2DMQ A;  1OPC A;  4XNF A;  4LG0 A;  5IP6 A;  1HC8 A;  3L09 A;  1R5G A;  3RTR A;  1KYW A;  3HEF A;  2CRG A;  1P6R A;  3MN2 A;  5FFZ A;  4D0P A;  1XMX A;  2VPL A;  3FBI B;  2BV6 A;  2HZD A;  2E2I J;  5FRO A;  3CDH A;  2WAQ N;  4HDV A;  3CC2 I;  4QIW N;  1U5T B;  4W1U A;  5C3E J;  4L5E A;  1MSF C;  4AWX B;  2VLA A;  3P7N A;  3LAJ A;  1LQ1 A;  4XL9 A;  2ISZ A;  3LQQ A;  3JRC A;  2JMW A;  1HCR A;  2JQ7 A;  2YPR A;  3BJA A;  3G3Z A;  1E3P A;  2L54 A;  5DCF A;  1WJA A;  2XAJ A;  1WJB A;  1ZKG A;  3E97 A;  3GO5 A;  2HQN A;  2IPQ X;  1FC3 A;  1U78 A;  5DD4 A;  1RET A;  2L02 A;  2KP6 A;  3I59 B;  1NTC A;  3I64 A;  3EYI A;  2HQ5 A;  2BY2 A;  3LFK A;  5LGN A;  2Y0S A;  1MIJ A;  3W2V A;  1T98 A;  2E34 A;  2Q2E B;  2MD5 A;  2VIX A;  4B48 A;  1Z3Y A;  3HG9 A;  3HOW J;  5E3N A;  4XON A;  3IH4 A;  3GLX A;  3FX3 A;  4XOR A;  1ZAR A;  1T0F C;  4HBL A;  4X1E A;  4XKB A;  3VYS B;  5LGU A;  1OCZ H;  1J7K A;  1QZZ A;  1X1D A;  1X4P A;  2DAO A;  3BWG A;  3MKZ A;  5GAH J;  4DGW B;  2CO5 A;  4E7S A;  3BG9 A;  1WJ5 A;  4XN3 A;  5E79 C;  2AQE A;  2VJ5 A;  2VJJ A;  2KJB A;  3OYJ A;  1CGP A;  1GUU A;  2JVG A;  3V7S A;  2D2W A;  1D0Y A;  4KN4 X;  2FNA A;  2A07 F;  2P8T A;  4NBQ A;  2CSO A;  4QWQ A;  2COM A;  3WHB A;  1MBK A;  1WKM A;  4BUP A;  3JRD A;  2VT2 A;  1E17 A;  1G3W A;  5KK1 A;  2ZBK A;  1H0M A;  2ZNY A;  3TL4 X;  1JE8 A;  2KMU A;  3S2W A;  1Y1V J;  3CLO A;  4II3 A;  2OTJ I;  3DU5 A;  2Y75 A;  5C44 J;  2A61 A;  3R6S A;  3G1O A;  5D5W B;  4MGR A;  2HOS A;  3CMM A;  3CDI A;  3I56 I;  2QZ8 A;  3M1C A;  2KRC A;  3TQN A;  1W7P D;  4GFB A;  4U0V A;  1XGN A;  1SVL A;  5CVV A;  4DYQ A;  5BPD A;  2VPR A;  2K9M A;  2ID6 A;  3GME A;  4FET A;  4A0Y A;  2LNB A;  3LOC A;  1WGX A;  5DM7 F;  1U6G A;  2DDA A;  3CUO A;  3HZJ A;  5LFA A;  3WTS C;  3LAP A;  1V5E A;  3F3X A;  1F36 A;  4DOZ A;  4UUT A;  1IF1 A;  2HVS A;  5H6Q A;  2HQR A;  1HDP A;  3T8R A;  3VSK A;  2HNH A;  2O3F A;  1RKW A;  1MD0 A;  5ED4 A;  3C2H A;  1ETO A;  5CVR A;  4AU7 A;  1LFB A;  3VYT B;  2W85 A;  4KIC A;  3QYE A;  1DQU A;  3N4M A;  1MJ9 A;  4YIR X;  1GDT A;  3CO7 C;  3KP4 A;  3JAM K;  1ZLK A;  4R1H A;  3BQY A;  4KT5 C;  2M2E A;  5HLT A;  2E2J J;  2HI3 A;  2BY0 A;  2K7L A;  3ECO A;  2E5Z A;  3LSK A;  4A3B J;  3GTM J;  3ZN1 A;  1JXS A;  1I6H J;  2F4O B;  2FOW A;  3FMS A;  2V9P A;  3ABM H;  5KAI C;  3K70 C;  1Z7U A;  2HVR A;  2K9L A;  1VFC A;  2EFN A;  2UXX A;  4NUB A;  4HV5 A;  3HOS A;  4A6E A;  2FOK A;  2L9R A;  3H36 A;  1BOB A;  2TCT A;  3X2Q H;  3S32 A;  2F5F A;  4IQ4 A;  3PSI A;  1J75 A;  1R5I D;  3OIO A;  2LRE A;  2BHY A;  1K78 A;  2P81 A;  4AVP A;  2M7A A;  3V42 A;  1D3Y A;  3R4K A;  2IGN A;  4QPQ A;  2LBF B;  1LEB A;  2E7X A;  5FKM A;  4JQF A;  1R23 A;  4LK0 F;  3S17 J;  4P5O A;  3Q5F A;  3CCL I;  1O4X A;  2Z5U A;  3ROU A;  1VQL I;  3TGN A;  3CME I;  2FA5 A;  1JT6 A;  4UNO A;  5B1B H;  3N05 A;  5KAF C;  1OCR H;  2ICW G;  3DFG A;  2CJJ A;  2QQ9 A;  4LD5 A;  4OAZ A;  4PUS A;  4EJT A;  1X1B A;  4M6Y A;  4ZYH A;  2R3S A;  1A36 A;  4I6Z A;  1T38 A;  5FLM J;  5DM6 F;  3OOU A;  2PI0 A;  4B44 A;  4S0H B;  3S1N J;  2Y30 A;  4O6J A;  2A5Y B;  2FXA A;  2QLZ A;  4A6D A;  1UB9 A;  2X6O A;  3AG2 H;  2CQX A;  4Q48 A;  2JJ7 A;  4F7Z A;  1EH7 A;  2IXS A;  1A6I A;  2R7W A;  3S1M J;  4I2O A;  2IVM A;  1FTT A;  2JUC A;  2ECB A;  2M7B A;  3F23 A;  1SD4 A;  3ZQG A;  1E3O C;  1W0U A;  2LKP A;  2AO9 A;  5LRR A;  2EV6 A;  2DA7 A;  1YQA A;  1J09 A;  2OBP A;  4G7O F;  3CQZ J;  1BIB A;  1WJE A;  2DA5 A;  5FO5 A;  1I3A A;  3HSR A;  4BEH A;  5EJC A;  1GV5 A;  1ZQ3 P;  2VN2 A;  2K5C A;  3KEY A;  2V7F A;  3HJE A;  5FFX A;  3CP8 A;  3DV8 A;  5F0C A;  4ZYA A;  1B1B A;  4C2M J;  1KQ8 A;  2DYS H;  3OYL A;  3GFI A;  1MMN A;  3A1Y A;  2HEO A;  3FHN A;  1DPU A;  1VQP I;  2RQQ A;  3HOU J;  3E1S A;  5K5Q A;  3GFM A;  2LTP A;  4CYD A;  3H92 A;  2E5N A;  1Z6R A;  2ZFW A;  2EFW A;  5FD6 A;  5K5O A;  2ZXW H;  5F0H A;  4MEY F;  3OL3 A;  4DNC A;  3S14 J;  3IRQ A;  3ASO H;  2Y9Y A;  4DW6 A;  4CXF A;  5M5X J;  2P6T A;  1VQ7 I;  3V8K A;  3BTC A;  3PUF A;  1WI3 A;  2PN6 A;  4AYB A;  1FZP B;  1FWZ A;  3CCE I;  1OQY A;  1SAU A;  4BJT A;  1BC7 C;  4ON0 A;  2R7Z J;  2VT3 A;  3TO7 A;  1TC3 C;  2QSH X;  2NNY A;  4KFC A;  4OIP F;  2DFI A;  3TOA A;  2QQ8 A;  4BXU A;  2KZV A;  1YW8 A;  4HDU A;  2K9Q A;  3FK6 A;  3S3O A;  1K79 A;  4W97 A;  3WG9 A;  2E19 A;  1LVA A;  3CJR B;  4HRI A;  5CVI A;  3LA3 A;  5E1W A;  2XAF A;  5GAG J;  3Q9S A;  3BR5 A;  2KIQ A;  2XHK A;  1QVU A;  3UKG A;  4RDU A;  1FPQ A;  1BI1 A;  1TW2 A;  3R0A A;  1MH4 A;  2A3S A;  2JPC A;  4L0Y B;  2WA0 A;  1KON A;  4YII A;  3S2H J;  3HKZ N;  2VQL A;  4UY8 I;  2BHZ A;  5LLQ A;  1UG0 A;  1YS7 A;  3BDD A;  4F52 A;  4FTH A;  5E18 F;  3ZOB A;  1W5C C;  4U0Y A;  5CVU A;  1UHW A;  2VKE A;  3AG3 H;  4YFK F;  4Z6Y A;  2ZKZ A;  4BQO A;  3KE2 A;  3CJT B;  2I5U A;  1U8B A;  1MBG A;  5EYR A;  2W25 A;  3DTI A;  5DV5 A;  3RYR A;  2FBK A;  4L9T A;  2GA2 A;  4BQN A;  1H9G A;  3ULQ B;  1FBU A;  1ETW A;  2M0M A;  2P5K A;  5D4S A;  5LD2 C;  5C4J J;  1W7P A;  4GXO A;  4HF1 A;  2KL4 A;  3TO6 A;  4BXX J;  3GX4 X;  4PGH A;  3W6V A;  2HFH A;  3QU3 A;  3JRB A;  1T8I A;  1FOK A;  1MBE A;  4RLF A;  5B66 C;  5K7F A;  1PYV A;  1QPM A;  2F5E A;  2Y9Z A;  1BA5 A;  4IRH A;  2DQL A;  5J1Y A;  4I76 A;  3L2V A;  3TW6 A;  3IKT A;  2F48 A;  1YO5 C;  4HAM A;  4K2E A;  2GXA A;  4KIF A;  3S93 A;  2JA5 J;  2Z9O A;  4IX7 A;  4V2G A;  1UJ8 A;  4QPO A;  2X0L A;  5J8F A;  1G6N A;  4XLA A;  3E5X A;  3I59 A;  5JVT A;  1MSE C;  3OS2 A;  2W00 A;  1XCV A;  1BOA A;  1XCB A;  4RA2 A;  2QEX I;  4XLF A;  3SHF A;  4KJZ A;  1SAX A;  5HNF A;  1D0Z A;  2CWE A;  1IRF A;  1HQC A;  2PMZ N;  1D1B A;  3CMA I;  3CC4 I;  1KU7 A;  2M30 A;  2QSG X;  3M7G A;  1IRZ A;  1W5S A;  3W3C A;  2G7H A;  3NAR A;  3JAM Z;  1MBF A;  2P7C B;  4UVC A;  2MW8 A;  5ERI A;  2CV1 A;  3UR3 C;  4P1W A;  5C4X J;  2PMH A;  2DA3 A;  1IJW C;  4BE2 A;  3J7Y J;  3ECH A;  4KDP A;  2R4G A;  4X6A J;  3NWT A;  5HLH A;  1XMK A;  2KKO A;  1U8R A;  1ACI A;  2B7E A;  2NVT J;  4RAY A;  3DF8 A;  4XM3 A;  3KFW X;  1IW7 F;  2X6X A;  1TTY A;  4NC8 A;  2XGX A;  2XGE A;  3D0S A;  3TP0 A;  1ZYR F;  1FY7 A;  1WWX A;  4HST A;  1ON2 A;  1R36 A;  1XSV A;  2IS6 A;  3UNG C;  2CUF A;  1XSD A;  2O61 A;  1V5F A;  2RRE A;  1EF4 A;  1ETK A;  1SD7 A;  1STZ A;  4P9U A;  3BG3 A;  5B3S H;  3I0T A;  4KMF A;  2R5Z A;  1U0J A;  3OMY A;  4I98 B;  5DD8 A;  2MH2 A;  3CF2 A;  1OR7 A;  1B72 B;  2STW A;  3OOP A;  1GVD A;  1YX3 A;  2BXZ A;  4ENM A;  3CLQ A;  3M1E A;  4XLE A;  5FGM A;  5BNG A;  3KP3 A;  3W2A A;  2JVH A;  2A5W A;  3K69 A;  2EH3 A;  5KHD A;  1IO2 A;  1P7J A;  1G2H A;  3DBL B;  2DFE A;  2OAZ A;  4V19 K;  1Q1V A;  3QPT A;  2HS5 A;  1ULY A;  4UB8 C;  3KEO A;  1WRJ A;  4EGZ A;  1BW5 A;  2R5Y A;  1LDJ A;  4KN7 X;  2BW3 A;  4CCO A;  4FX4 A;  1EJ9 A;  3DEE A;  3K9T A;  1W1W E;  2M9H A;  4YEL A;  5DEQ A;  1B8I B;  4JOM A;  2FJ1 A;  2MH9 A;  2NVU B;  4IHY A;  5J1R A;  2XRO A;  2P0W A;  2PBI A;  3DPU A;  3F22 A;  2E1C A;  4IHT A;  2MLG A;  1IG7 A;  1WI9 A;  3J81 Z;  3LA7 A;  5EG0 B;  2M4G A;  1XMA A;  3T5X A;  2NVX J;  4PZJ A;  4IOA F;  2OD5 A;  1EH6 A;  1VQ9 I;  3BLY A;  1S9H A;  2CFX A;  5D8K B;  1IC8 A;  2F4I A;  2MD0 A;  3OYD A;  2EQR A;  5F6F A;  4E7I A;  2QYO A;  3CD6 I;  3C2G A;  3VPR A;  5E3O A;  3VWB A;  3NAU A;  1XTA A;  3RKQ A;  4A3F J;  3VDX A;  2E35 A;  2HPM A;  5F04 A;  4R79 A;  1Z91 A;  1LDD A;  3FXJ A;  2R92 J;  1IV8 A;  3MZY A;  4N4N B;  3QOD A;  4UB6 C;  3D1N I;  3M8F A;  2FBI A;  2LRD A;  3IC7 A;  3OYK A;  5L3B A;  4HSR A;  4PJM A;  1MMS A;  3QWL A;  2VE9 A;  3C7J A;  4CHU A;  3MEX A;  3BTJ A;  3BPX A;  2IA1 A;  2DCE A;  1R71 A;  3D5R C;  5L3E A;  2OQG A;  1S7A A;  4Q5S F;  1YRN B;  3LA2 A;  2E1M C;  2Q1Z B;  3HUG A;  2Y0S N;  2ZC2 A;  3F8C A;  3LSJ A;  4CA0 A;  4FAS D;  5HDG A;  4WF2 A;  3L2Q A;  1UFM A;  5EEG A;  2NXN B;  2RNJ A;  3FZV A;  2OU2 A;  4ABZ A;  3RZD J;  4E70 A;  2F5C A;  2Q0O A;  3PL8 A;  3D5S C;  4PJJ A;  3HDD A;  4GDF A;  1T08 B;  2IGO A;  2V6C A;  1XC5 A;  2L9V A;  2NNN A;  2R93 J;  2L7K A;  4EJU A;  2HR3 A;  3FM5 A;  3RKX A;  4RGX A;  3K0L A;  3K4K A;  1R49 A;  1F4K A;  2NVQ J;  1YG2 A;  2VOO A;  1IRX A;  3G71 I;  5J47 A;  2KJC A;  3DU6 A;  1K6O A;  2ZXH A;  1P92 A;  3BR1 A;  2KIU A;  4XR6 A;  2YX4 A;  3TO9 A;  1WH5 A;  3KEQ A;  1ZK8 A;  5CPR B;  4Y7N J;  2QF7 A;  4CDG A;  3IAM 2;  4WXH A;  2LF8 A;  2QKL B;  1JTX A;  2NOG A;  4XLN F;  2JRM A;  5IPA A;  4C3I J;  3B73 A;  4A3J J;  3Q0U A;  4M74 A;  3WU1 B;  1JKR C;  1N78 A;  2J5O A;  1IAW A;  4MHG A;  4N0B A;  1SAN A;  2EB7 A;  1B59 A;  3G4S I;  2XF7 A;  2NOJ B;  3CES A;  3A03 A;  3O6B B;  2I10 A;  3KYL A;  1R1U A;  1ODD A;  3CMY A;  3J80 Z;  2L9S A;  2JA7 J;  5M3M J;  3TDU C;  2WC2 A;  4Y4R A;  3SDG A;  5CLS A;  1KA8 A;  1TL8 A;  1G3Y A;  2E1M B;  1UZC A;  2IJL A;  5DCM B;  5M3F J;  4H4K C;  2STT A;  2XAH A;  2LY2 A;  1MJA A;  3NRV A;  3ZMU A;  1TWC J;  1AWC A;  3H9J A;  4CCK A;  3WTZ A;  3L2W A;  1GXQ A;  5FKK A;  4C3J J;  4BQQ A;  2XGC A;  4A0Z A;  3I54 A;  3O3K A;  4XSX F;  4B4C A;  3QOE A;  4JX4 A;  1BJA A;  1T56 A;  1SFO J;  1O3Q A;  1YIO A;  3HTS B;  3DBH B;  4M9Z A;  1ITY A;  4RGS A;  2X9D A;  2WTE A;  3PFI A;  1FJL A;  4XIC A;  2W24 A;  5E3M A;  1SFU A;  1U3E M;  1V54 H;  2X1C A;  1HKQ A;  5GPA A;  1RUO A;  3BP8 A;  2AQF A;  5E1Z B;  5F1R A;  2ZJP F;  5D5X B;  2LKX A;  4LIT A;  1QZE A;  5EF6 A;  1LPQ A;  1X3W B;  4L0Z B;  2RAE A;  2DTZ A;  1P7I A;  2YSR A;  5ICF A;  3JSO A;  4KA4 A;  1BR4 A;  2FX0 A;  1LFP A;  2GM4 A;  4NQW B;  4ZTF A;  4BJ5 C;  2XF6 A;  2X1E A;  5CVJ A;  2GLO A;  1Z0X A;  4E7L A;  4O5V A;  2QQB A;  2EFQ A;  1HW1 A;  2Y0M A;  1U2W A;  1BI2 A;  4Y17 A;  4PFO A;  1VQN I;  2HPI A;  3BZ6 A;  4L9N A;  3CP2 A;  2MG4 A;  3M8E A;  3OYG A;  5EGO A;  1YE9 A;  1P4X A;  2M87 A;  4QTR A;  2EWN A;  5HDK A;  3KLO A;  2CW8 A;  3BR3 A;  4OWR B;  4U0W A;  3QRF F;  1CQT A;  4DQ2 A;  3IH2 A;  1KU3 A;  1LE8 A;  1ZRE A;  1FIP A;  1ZGJ A;  5J1U A;  5FKL A;  4G6T B;  1FOY A;  3BJO A;  2DOA A;  2K4B A;  2MSY A;  2BXY A;  3KPH A;  2HKO A;  3ZR8 X;  2FQ4 A;  2R7F A;  3CCU I;  2UUZ A;  1YIT I;  4U87 A;  2Z3Y A;  3L00 A;  2YX7 A;  1WSU A;  2DI3 A;  3KYC B;  3G1M A;  3OR2 C;  3ZP5 A;  4LIV A;  2L5Q A;  3ML6 A;  4ZJZ A;  2IA0 A;  5BOX A;  2B9S A;  1DPR A;  2GOM A;  4HX8 A;  5ILV A;  4Y3O A;  5FKN A;  3HPG A;  5H2F C;  4XBF A;  2P6S A;  2NYX A;  4ZH4 F;  5BS6 A;  1LJ9 A;  2KLO A;  4L9J A;  5CJ9 A;  5J40 A;  1SVO A;  1R9T J;  2L7Z A;  1BJZ A;  1ZTR A;  1S8N A;  1IZ1 A;  2X85 A;  1YJ9 I;  3R0J A;  1Y56 A;  4JX5 A;  2HOA A;  3OSF A;  3FKJ A;  3S1R J;  4JK1 X;  2KIM A;  5HS8 A;  2CV0 A;  4F55 A;  1EKE A;  5KVR A;  2V1U A;  3U2R A;  3A02 A;  3K4M A;  2TRT A;  3QQA A;  2FD5 A;  3LST A;  2HXO A;  3LSP A;  3SDB A;  2FNP A;  2HWV A;  3RPU D;  1ETV A;  2EFO A;  3J7A Y;  1FOW A;  1YJW I;  2XAQ A;  1H9T A;  3CO6 C; 
#chains in the Genus database with same CATH homology
 2QQA A;  3W6J B;  1HXD A;  3FMQ A;  4MQV A;  3V7C A;  3GYH X;  2L3D A;  2VC0 A;  2M8E A;  1MDM A;  2VBY A;  3J7A O;  1UCR A;  1IN8 A;  3HRU A;  5A2Q K;  2Y48 A;  3O2P E;  5HS9 A;  3I5U A;  4IHS A;  2FSW A;  1IUY A;  4H0E A;  2JPB A;  2ZO4 A;  1F9N A;  1QGP A;  1O57 A;  3WGI A;  2PFB A;  2GWR A;  3LWF A;  3MZH A;  4WCG A;  3F21 A;  3U1D A;  4L18 B;  1Z05 A;  4AD9 A;  4P9F A;  1R58 A;  1XSX A;  4BHB A;  2JTV A;  4HOB A;  2ADU A;  3Q9V A;  3HSE A;  4HQM A;  2M1B A;  3D5L A;  2ZME A;  4HX4 A;  2UZK A;  2R7D A;  4G7H F;  4A0X A;  3RKY A;  3CJN A;  3CUQ A;  3ZQ7 A;  2QVO A;  4Z2Y A;  3MAJ A;  1OYY A;  4ASN A;  4IVN A;  2H6B A;  3TKY A;  1TQM A;  4LJZ F;  3N97 A;  1DDN A;  5H6R A;  3E6D A;  1J9I A;  4ENJ A;  2XV4 S;  1QO0 D;  5H20 A;  1MZB A;  3EUH A;  1MGT A;  5FLX K;  1BC8 C;  3L7W A;  2QWW A;  4L5I A;  2IRF G;  1L3L A;  2RKH A;  1R00 A;  2QUF A;  4IRI A;  4OU0 A;  2HZT A;  3G73 A;  4M9S A;  5K5R A;  1YW9 A;  2RN7 A;  3E6B A;  1UST A;  1ONV A;  2EA4 A;  2P4W A;  1FBS A;  3DKW A;  2XVC A;  3P9I A;  2QEN A;  3V8L A;  2X4H A;  2A69 F;  3SQN A;  2LSO A;  3CTA A;  4IXA A;  3GW2 A;  2HOE A;  5DCM A;  2FF4 A;  3T1B A;  4LFU A;  3NEU A;  1YTY A;  3ELK A;  2PQ8 A;  3V7R A;  3GZ6 A;  4ZZD A;  1ZAO A;  4OIN F;  1FP2 A;  2K27 A;  4IJA A;  5LBQ A;  4RB3 C;  2B0L A;  3QP6 A;  5HLG A;  3SZT A;  1S6L A;  2A6E F;  1RNL A;  2H27 A;  2QBY A;  2E7W A;  1YYV A;  4AIK A;  2HYF A;  2EJR A;  3WE3 A;  1T6S A;  3HRS A;  2JSC A;  3FHZ A;  5E8I A;  4P55 A;  3KP5 A;  2NS0 A;  3RPU A;  2GQQ A;  3RI4 A;  4AIH A;  3JW4 A;  5J6X A;  1FBQ A;  1XN7 A;  4NQW A;  3AAF A;  2DT5 A;  1U5T A;  1P4A A;  4ESJ A;  1VTN C;  4WX9 A;  5D6E A;  2FBH A;  5L3C A;  2XIG A;  1TQP A;  4MQ9 F;  3ZPL A;  4LLL A;  3L9F A;  1SMY F;  4UVA A;  4ETS A;  2G7U A;  2WV0 A;  2ZNZ A;  4LG0 B;  2PLY A;  4G8X A;  2PEX A;  1ZG3 A;  5TRD A;  4JBA A;  4QLC U;  1ON1 A;  3IRR A;  4I0A A;  4IRG A;  2Q2E A;  3QOP A;  3ZMV A;  3COA C;  5BQT A;  4EJO A;  1PUE E;  2IT0 A;  3HHG A;  2FMY A;  1FLI A;  2CW0 F;  3IWF A;  2P5L C;  2O6G E;  3LQR A;  5D5U B;  1L0O C;  2D1V A;  2DW4 A;  2OQR A;  4M6X A;  1D5V A;  1ZG1 A;  1YS6 A;  1JGS A;  1I1S A;  1R1T A;  2XRN A;  1NHA A;  4XLP F;  3ERE D;  1KYZ A;  1TQI A;  1FSE A;  5CYV A;  2FEZ A;  3DPT A;  4RB0 A;  1B6A A;  4RGR A;  1IXR C;  2PMU A;  1BM9 A;  4N9H A;  2H6C A;  4HF0 A;  1B9N A;  4PCQ A;  1FP1 D;  1ZGA A;  2BYV E;  2VXZ A;  5TJJ A;  1Y0U A;  1P4W A;  1S3J A;  1R5H A;  1R7J A;  2DQR A;  5E20 A;  3TDZ C;  1WQ2 A;  1T2K A;  5HS7 A;  4A12 A;  1E2X A;  1T0F A;  2V1X A;  1FNN A;  4EM0 B;  2HYG D;  1LNW A;  2M45 A;  1SFX A;  2DPD A;  3WE2 A;  1T39 A;  1XGO A;  3MQ0 A;  4B8X A;  1B4A A;  4MTD A;  4KIB A;  1K7A A;  3WTU C;  4OOI A;  3ABT A;  3P9C A;  5ICE A;  3C1D A;  2OA4 A;  4GO1 A;  1O3S A;  3JSP A;  2E1N A;  1SFE A;  4BQA A;  3GXO A;  1QNT A;  3HHH A;  2CQK A;  4HX7 A;  4I01 A;  2O03 A;  1ZRD A;  1O3T A;  1I1G A;  3SFZ A;  1ZH5 A;  2MLK A;  5D5V B;  4G9Y A;  4U88 A;  3DEU A;  4HW0 A;  3HTU A;  1FSH A;  1S7O A;  2HTJ A;  1K78 B;  3QU6 A;  2DK5 A;  5JR3 A;  2WWY A;  3DPL C;  1YW7 A;  1IRG A;  2EV0 A;  1I6X A;  5LHH A;  5DYM A;  1OKR A;  2VBZ A;  3E5Q A;  1OYI A;  2K86 A;  4GGG A;  2K02 A;  1Q1H A;  1IN5 A;  2Z99 A;  3HRT A;  2GXG A;  3BOQ A;  3HOT A;  4CIC A;  2VBW A;  4BH9 A;  1ZN2 A;  3DQV C;  3ZMS A;  4OIQ F;  3KP6 A;  4N9I A;  3K2Z A;  3WGG A;  3VOD A;  4ZZL A;  3RDI A;  2YU3 A;  2OZU A;  2XAS A;  2F5D A;  3E6M A;  5AIQ A;  3K1P A;  1KGS A;  3FXR A;  5HVQ C;  3I71 A;  4L9V A;  2BGC A;  2H09 A;  2XKO A;  4KYW A;  1BI3 A;  4U7B A;  4RB1 A;  4EGY A;  1C0W A;  1X3U A;  2L4A A;  1FYK A;  4BYY A;  2RV8 A;  3C3W A;  1PDN C;  2UWM A;  5BPI A;  3VFZ A;  2DO7 A;  1FX7 A;  4I09 A;  4HLY A;  1IN6 A;  4LMY A;  5HDN A;  1J0R A;  4G6D A;  4EM1 A;  4BAY A;  2YR2 A;  3B02 A;  1RIO H;  2K4J A;  1IXS B;  5L3D A;  4KNY A;  2KIF A;  1KU2 A;  2ELH A;  2GIV A;  4ENN A;  1XDS A;  2XUB A;  3JTH A;  1W7P B;  4BHP A;  2XAG A;  5ICC A;  1D8K A;  4A5M A;  3QP5 A;  3KCC A;  3WTV C;  4EV0 A;  4XRF A;  1SD6 A;  3F8F A;  4ESF A;  4I0B A;  2IA2 A;  1SMT A;  1I5Z A;  2RVC A;  3ISP A;  2W57 A;  2Q8K A;  2V9V A;  3ABU A;  3TOB A;  5LGT A;  1DP7 P;  1LDK B;  2IP2 A;  4I7H A;  2ACJ A;  4M71 A;  3HIF A;  4B09 A;  3SZP A;  3H3U A;  4LGW A;  3F8N A;  3PQK A;  1REP C;  2GA1 A;  5DUK A;  2D45 A;  1RUN A;  4HLX A;  2DBB A;  1FT9 A;  3EET A;  5HOO A;  2CG4 A;  5D4R A;  4GCV A;  4BHC A;  5LRS A;  5AON A;  5IT9 K;  2A68 F;  4RS8 A;  3V4G A;  3SXY A;  3RPQ A;  2EFP A;  1RI7 A;  1PP8 F;  2PJP A;  2EV5 A;  5LEK A;  1O3R A;  1W4M A;  5JI6 A;  4G94 A;  3MFK A;  1IXC A;  1HKS A;  1IN4 A;  3DXJ F;  4MTE A;  1HSJ A;  2CYY A;  2OZ6 A;  2P5V A;  1ZRC A;  2ISY A;  3GFJ A;  1RZ4 A;  1JHF A;  1TBX A;  1Z6T A;  2UXN A;  4M72 A;  5JHU A;  3F72 A;  4MEX F;  4WXD A;  2A6H F;  2VOP A;  1XGM A;  1OYW A;  4LB6 B;  3GWZ A;  5D8L B;  1XD7 A;  1HW5 A;  4M73 A;  5BMZ A;  1QBJ A;  2FE3 A;  4AIJ A;  1GHC A;  3BJ6 A;  2V79 A;  5EEH A;  2KRF A;  4UHT A;  2O8X A;  4L5J A;  1F5T A;  4RB2 C;  6PAX A;  4OIO F;  3MWM A;  3ZN0 A;  1LB2 A;  1CF7 B;  4NHJ A;  5FD5 A;  4KUM A;  3U9G A;  5IT3 A;  1TNT A;  4ZYD A;  3E5U A;  2FRH A;  2DPU A;  5ICG A;  1GVJ A;  4LLG F;  1JHH A;  1GXP A;  3P9K A;  4YIF A;  1IN7 A;  2GXB A;  1UHM A;  4M9X A;  4ESB A;  2VOD A;  1P2F A;  2M5W A;  1R22 A;  3KLN A;  1KU9 A;  4P96 A;  1R1V A;  4EVI A;  3EDP A;  2HGC A;  2D1H A;  2O0Y A;  3ZMD A;  3WTT C;  2HTS A;  2PG4 A;  1G4D A;  1O7L A;  3K1N A;  5FB2 A;  4CZZ A;  2GZW A;  4HA8 A;  4HF2 A;  4WK8 F;  3FXU A;  2RGV A;  3J81 K;  2JT1 A;  2HDC A;  4UXN A;  2VC1 A;  4ZYE A;  2G9W A;  5JFR A;  4EM2 A;  4KIG A;  1ZLJ A;  1USS A;  4LB5 A;  3RKW A;  1J59 A;  5L3G A;  1XDU A;  4FX0 A;  2C6Y A;  3T0Y A;  1HBX G;  2CGP A;  1HST A;  1V3F A;  4Q47 A;  3BRO A;  2XKP A;  4GYG A;  5DDG A;  5LHI A;  1BIA A;  5ILU A;  1PP7 U;  4OMZ A;  4ENK A;  4Y13 A;  4G7Z F;  2TDX A;  1MJB A;  2JZY A;  2DLL A;  1EH8 A;  3BY6 A;  2ETH A;  3GF2 A;  5E8G A;  5E17 F;  1J5Y A;  4Y15 A;  1B9M A;  3QPH A;  3FWE A;  2DTR A;  4EQQ A;  5IT9 Z;  3REO A;  3JTG A;  3KET A;  3EQL F;  1HW2 A;  4NB5 A;  3E6C C;  3OV8 A;  4OMY A;  3F8B A;  3GFL A;  2RC4 A;  4A2U A;  5A2Q Z;  1AOY A;  4R8H A;  4EJV A;  4OIR F;  4IF4 A;  3IKV A;  1I27 A;  3J80 K;  4YG2 F;  3E3V A;  2FML A;  4TV7 A;  3WOD F;  5E1X A;  5J8C A;  2ZCW A;  2NRA C;  3F8M A;  3VB2 A;  4WXC A;  3BPV A;  2EK5 A;  4CO8 A;  5D6F A;  3VOE A;  3L2C A;  2ESH A;  2BBY A;  1YFH A;  2RQP A;  3I58 A;  3KP7 A;  3WTY C;  2ESN A;  3I4P A;  1XB4 A;  1F1Z A;  4A5N A;  2V1D A;  2F2E A;  3HSF A;  1BN5 A;  3FF5 A;  3FM3 A;  1BBY A;  1ZHF A;  3DP7 A;  3R60 A;  4Q4Z F;  2L4M A;  1QZY A;  4EJW A;  1HKT A;  3CUQ C;  2DU9 A;  3HRM A;  3WGH A;  5K1Y A;  5FLX Z;  4CGZ A;  3T8T A;  4EMS A;  2GAU A;  1ZRF A;  1W5T A;  3F6O A;  5LEJ A;  1MDM B;  2VE8 A;  2Z33 A;  4UVB A;  1ZG5 A;  2LDU A;  4LLN A;  3GVA A;  4IPA A;  2MC3 A;  3C18 A;  1J2X A;  1O7F A;  4S04 A;  3QAH A;  3WTW C;  3K1M A;  3KZZ A;  2AS5 F;  3FXQ A;  4HYE A;  4S05 A;  4FHT A;  1FYL A;  1A04 A;  3GEZ A;  5DUI A;  1CF7 A;  5F64 A;  1MKM A;  4G6Q A;  4UV8 A;  4ZYG A;  1Z1D A;  4HV6 A;  1FYM A;  2DK8 A;  3KZY A;  2ZME B;  2NAZ A;  1G3S A;  3M9A A;  1KQ9 A;  4WWC A;  2L01 A;  1LEA A;  1SD5 A;  2AXL A;  4O3M A;  3CUQ B;  3NQO A;  3GZ5 A;  1V4R A;  1TLH B;  2VON A;  3WTX C;  3WU0 A;  2QM3 A;  1TW3 A;  3MCZ A;  4RAZ A;  2EA2 A;  4UUV A;  1OMI A;  1EV7 A;  3IL2 A;  4PGG A;  2MA3 A;  3KP2 A;  2VBX A;  4YFN F;  4GYI A;  3FMR A;  3F6V A;  3RJP A;  3RYP A;  4RGU A;  2W84 A;  1YLF A;  2IW5 A;  5AIP A;  4XSZ F;  5ILS A;  4FT8 A;  4HZF A;  2HKX A;  2ZXJ A;  4KMU X;  3IWZ A;  4HQE A;  1DUX C;  2JRT A;  3R61 A;  4PDK A;  2P7V B;  5LHG A;  3I53 A;  3VEP A;  3GUD A;  1G3T A;  4MNU A;  1BI0 A;  2ZJ2 A;  1U5T C;  4YFX F;  1QQI A;  3V8J A;  2J5P A;  3EYY A;  4BNC A;  2LF7 A;  4LK1 F;  1TNS A;  3PQJ A;  3H3Z A;  1XGS A;  3HYI A;  1Z9C A;  3RIR A;  3IHU A;  1KQ0 A;  2H94 A;  4U7D A;  3ZMT A;  3ZMZ A;  2FQ3 A;  1S29 A;  5HLI A;  4UV9 A;  2RDP A;  4I02 A;  1D8J A;  5L3F A;  3W6K B;  2FU4 A;  2BEO A;  2QBY B;  2MBF A;  2BE5 F;  1OPC A;  4LG0 A;  3L09 A;  1R5G A;  3RTR A;  1KYW A;  1P6R A;  5FFZ A;  4D0P A;  2BV6 A;  3CDH A;  4HDV A;  1U5T B;  4AWX B;  3P7N A;  3LAJ A;  1LQ1 A;  2ISZ A;  3LQQ A;  2YPR A;  3BJA A;  3G3Z A;  2L54 A;  5DCF A;  2XAJ A;  3E97 A;  3GO5 A;  2HQN A;  2IPQ X;  1FC3 A;  1U78 A;  5DD4 A;  2L02 A;  3I59 B;  3I64 A;  3EYI A;  3LFK A;  5LGN A;  1T98 A;  2MD5 A;  3GLX A;  3FX3 A;  1ZAR A;  4HBL A;  5LGU A;  2DAO A;  1J7K A;  1QZZ A;  3BWG A;  2CO5 A;  2KJB A;  1CGP A;  3V7S A;  2D2W A;  4KN4 X;  2FNA A;  2A07 F;  2P8T A;  2CSO A;  4QWQ A;  2COM A;  1WKM A;  2VT2 A;  1E17 A;  1G3W A;  5KK1 A;  2ZBK A;  1H0M A;  2ZNY A;  1JE8 A;  3S2W A;  3CLO A;  2Y75 A;  2A61 A;  3R6S A;  5D5W B;  4MGR A;  2QZ8 A;  3TQN A;  1W7P D;  4U0V A;  1XGN A;  5CVV A;  5BPD A;  4A0Y A;  2LNB A;  1U6G A;  3CUO A;  3WTS C;  3LAP A;  3F3X A;  1IF1 A;  5H6Q A;  2HQR A;  3T8R A;  2O3F A;  1MD0 A;  5ED4 A;  5CVR A;  2W85 A;  4KIC A;  3N4M A;  1MJ9 A;  3CO7 C;  3KP4 A;  3JAM K;  1ZLK A;  4R1H A;  4KT5 C;  2K7L A;  3ECO A;  1JXS A;  3ZN1 A;  3FMS A;  1Z7U A;  2EFN A;  2UXX A;  4HV5 A;  3HOS A;  4A6E A;  2FOK A;  1J75 A;  2F5F A;  1K78 A;  4AVP A;  1D3Y A;  3R4K A;  1LEB A;  2E7X A;  4JQF A;  1R23 A;  4LK0 F;  4P5O A;  3Q5F A;  2Z5U A;  3ROU A;  3TGN A;  2FA5 A;  4UNO A;  3DFG A;  2QQ9 A;  4LD5 A;  4EJT A;  4M6Y A;  4ZYH A;  2R3S A;  1T38 A;  2PI0 A;  4O6J A;  2A5Y B;  2FXA A;  2QLZ A;  4A6D A;  1UB9 A;  4Q48 A;  4F7Z A;  1EH7 A;  4I2O A;  2IVM A;  3F23 A;  1SD4 A;  2LKP A;  5LRR A;  2EV6 A;  1YQA A;  2OBP A;  4G7O F;  1BIB A;  5FO5 A;  3HSR A;  2VN2 A;  5FFX A;  3DV8 A;  1B1B A;  1KQ8 A;  3GFI A;  2HEO A;  1DPU A;  5K5Q A;  3GFM A;  4CYD A;  3H92 A;  1Z6R A;  2ZFW A;  2EFW A;  5FD6 A;  5K5O A;  4MEY F;  4DNC A;  3IRQ A;  4CXF A;  2P6T A;  3V8K A;  2PN6 A;  1FZP B;  1FWZ A;  1BC7 C;  4ON0 A;  2VT3 A;  3TO7 A;  2NNY A;  4KFC A;  4OIP F;  2DFI A;  3TOA A;  4BXU A;  1YW8 A;  4HDU A;  1K79 A;  3WG9 A;  1LVA A;  5CVI A;  3LA3 A;  5E1W A;  2XAF A;  3Q9S A;  2XHK A;  1FPQ A;  1BI1 A;  1TW2 A;  3R0A A;  2A3S A;  2JPC A;  4L0Y B;  4YII A;  5LLQ A;  1YS7 A;  3BDD A;  5E18 F;  4U0Y A;  5CVU A;  1UHW A;  4YFK F;  2ZKZ A;  3KE2 A;  2W25 A;  5DV5 A;  3RYR A;  2FBK A;  4L9T A;  2GA2 A;  1H9G A;  3ULQ B;  1FBU A;  2P5K A;  5D4S A;  1W7P A;  4GXO A;  4HF1 A;  3TO6 A;  3GX4 X;  4PGH A;  2HFH A;  3QU3 A;  1FOK A;  1QPM A;  2F5E A;  4IRH A;  2DQL A;  3IKT A;  1YO5 C;  4HAM A;  4K2E A;  4KIF A;  2Z9O A;  2X0L A;  5J8F A;  1G6N A;  5JVT A;  3E5X A;  3I59 A;  1XCV A;  1BOA A;  1XCB A;  3SHF A;  1SAX A;  2CWE A;  1IRF A;  1HQC A;  1KU7 A;  2M30 A;  3M7G A;  1W5S A;  2G7H A;  3JAM Z;  2P7C B;  4UVC A;  5ERI A;  2PMH A;  3ECH A;  4KDP A;  5HLH A;  1XMK A;  2KKO A;  1U8R A;  4RAY A;  3DF8 A;  3KFW X;  1IW7 F;  1TTY A;  2XGX A;  3D0S A;  1ZYR F;  1FY7 A;  1WWX A;  1ON2 A;  1R36 A;  1XSV A;  1XSD A;  2O61 A;  1SD7 A;  1STZ A;  4P9U A;  3I0T A;  4KMF A;  4I98 B;  5DD8 A;  2MH2 A;  1OR7 A;  2STW A;  3OOP A;  4ENM A;  3M1E A;  5FGM A;  3KP3 A;  3K69 A;  2OAZ A;  3QPT A;  2HS5 A;  1ULY A;  3KEO A;  1WRJ A;  4EGZ A;  1LDJ A;  4KN7 X;  4FX4 A;  3K9T A;  5DEQ A;  2MH9 A;  2XRO A;  2PBI A;  3F22 A;  2E1C A;  4IHT A;  2MLG A;  1WI9 A;  3J81 Z;  3LA7 A;  1XMA A;  3T5X A;  4PZJ A;  2OD5 A;  1EH6 A;  5D8K B;  2CFX A;  5F6F A;  2QYO A;  4R79 A;  1Z91 A;  1LDD A;  3MZY A;  3M8F A;  2FBI A;  3IC7 A;  5L3B A;  2VE9 A;  3C7J A;  4CHU A;  3MEX A;  3BPX A;  2IA1 A;  5L3E A;  2OQG A;  1S7A A;  4Q5S F;  3LA2 A;  3HUG A;  3F8C A;  5HDG A;  4WF2 A;  1UFM A;  5EEG A;  2RNJ A;  3FZV A;  2OU2 A;  4E70 A;  2F5C A;  2Q0O A;  2V6C A;  2NNN A;  4EJU A;  2HR3 A;  3FM5 A;  3RKX A;  4RGX A;  3K0L A;  1F4K A;  1YG2 A;  2VOO A;  2KJC A;  1K6O A;  1P92 A;  2KIU A;  2YX4 A;  3TO9 A;  3KEQ A;  4CDG A;  4WXH A;  2LF8 A;  4XLN F;  3B73 A;  4M74 A;  3WU1 B;  2J5O A;  1IAW A;  4MHG A;  4N0B A;  2EB7 A;  1B59 A;  3O6B B;  1R1U A;  1ODD A;  3J80 Z;  3TDU C;  2WC2 A;  5CLS A;  1KA8 A;  1G3Y A;  2IJL A;  5DCM B;  2STT A;  2XAH A;  1MJA A;  3NRV A;  3ZMU A;  1AWC A;  3WTZ A;  1GXQ A;  4A0Z A;  3I54 A;  3O3K A;  4XSX F;  1O3Q A;  1BJA A;  3HTS B;  1YIO A;  4M9Z A;  4RGS A;  2WTE A;  3PFI A;  2W24 A;  1SFU A;  1U3E M;  1HKQ A;  1RUO A;  3BP8 A;  5E1Z B;  5F1R A;  5D5X B;  4L0Z B;  2YSR A;  5ICF A;  3JSO A;  4KA4 A;  5CVJ A;  4O5V A;  2QQB A;  2EFQ A;  1HW1 A;  2Y0M A;  1U2W A;  1BI2 A;  4Y17 A;  4L9N A;  3BZ6 A;  3M8E A;  1P4X A;  2M87 A;  2EWN A;  5HDK A;  3KLO A;  4U0W A;  3QRF F;  4DQ2 A;  1KU3 A;  1ZRE A;  1ZGJ A;  3BJO A;  2K4B A;  2HKO A;  2R7F A;  2Z3Y A;  3L00 A;  2YX7 A;  1WSU A;  2DI3 A;  3ZP5 A;  3ML6 A;  2IA0 A;  5BOX A;  1DPR A;  5ILV A;  4HX8 A;  4XBF A;  2P6S A;  2NYX A;  4ZH4 F;  5BS6 A;  1LJ9 A;  4L9J A;  5CJ9 A;  1S8N A;  1IZ1 A;  3R0J A;  4JK1 X;  2KIM A;  5HS8 A;  5KVR A;  2V1U A;  3U2R A;  3LST A;  2FNP A;  2HWV A;  2EFO A;  2XAQ A;  1H9T A;  3CO6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...