2VE9A

Xray structure of kops bound gamma domain of ftsk (p. aeruginosa)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
DDPLYDEAVRFVTESRRASISAVQRKLKIGYNRAARMIEAMEMAGVVTPMNTNGSREVIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanism of Sequence-Directed DNA Loading and Translocation by Ftsk.
pubmed doi rcsb
molecule keywords DNA TRANSLOCASE FTSK
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 17
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09397 FtsK_gamma Ftsk gamma domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ve9A01
3L09A 4I98B 1BC7C 5KVRA 4L9VA 2D1HA 2M5WA 3WGIA 3WTZA 5ICEA 2PEXA 1SD6A 3GFIA 2UZKA 4YIFA 2BV6A 2CO5A 1HBXG 5L3FA 1UFMA 3WTUC 4FHTA 1IRFA 4AIKA 3CO6C 2VN2A 3RYRA 2P5LC 2Z9OA 3IKTA 3V8KA 1G3SA 3M9AA 4ON0A 5HLIA 2H6CA 2FOKA 3ZMUA 1BI3A 1PP8F 4HLYA 2VC1A 4AIHA 1UCRA 4QWQA 1F1ZA 1QBJA 2XVCA 1FT9A 1FPQA 3WGGA 1MZBA 4KIBA 1U3EM 4UVBA 3BJAA 3E6MA 4ZYDA 5A2QZ 4N0BA 1ONVA 4ZZDA 4HZFA 5DD4A 3OOPA 1B4AA 2PBIA 4IRIA 1DPUA 3WODF 2EK5A 1LNWA 2CG4A 3RKYA 4A0XA 5HS7A 4HDUA 5DDGA 3R60A 4M71A 1S8NA 4RB0A 1ZLJA 2R7DA 2HEOA 2FE3A 3KEQA 3BWGA 4U0WA 3V7RA 2DBBA 5ED4A 2G7HA 4K2EA 4GGGA 1IZ1A 2DAOA 3KZZA 2PLYA 3R0AA 1P4WA 1IXSB 4MTEA 2JT1A 4EJWA 1O3TA 3GWZA 1LDJA 2MA3A 3F8CA 3LQRA 2P4WA 2QBYA 1B9MA 4MQ9F 3MFKA 1WSUA 2QQ9A 3VODA 2GQQA 5LRRA 3P9CA 1VTNC 2GXBA 2OZUA 3QPTA 4MEYF 3Q9SA 1DP7P 5BPIA 2IJLA 5LGTA 4F7ZA 2FMLA 4G94A 2F5EA 2DK5A 1P6RA 3T8TA 2W85A 1KQ0A 1I6XA 3EYYA 4HX8A 2VC0A 4IRHA 3K2ZA 1OYWA 3OV8A 2OU2A 3JSOA 3E5UA 2XAFA 3ZMDA 2B0LA 4MQVA 3K1PA 2QBYB 1FC3A 3F8BA 3GEZA 3ZPLA 4FX4A 2LF7A 5HDGA 2UXNA 4KMFA 2PMUA 2JTVA 3T8RA 5AIQA 3NQOA 1XMKA 4LJZF 2W84A 3KLOA 1AOYA 3VFZA 1STZA 2V1DA 2EA2A 1XN7A 1FNNA 3GVAA 3K1MA 3E6DA 1NHAA 2F5CA 2P5VA 4BQAA 3QP6A 3K1NA 3SZPA 4B8XA 1O3QA 2ELHA 3V8LA 3CUQA 4S04A 4EM0B 3U2RA 3PQJA 5BMZA 3K9TA 2EFOA 4EVIA 3RDIA 1I1SA 3C1DA 3FM5A 2UXXA 4CHUA 2RC4A 5LLQA 1XDSA 4A5MA 2STWA 1O7LA 1R7JA 1W7PB 4I7HA 2RNJA 2L02A 2E7WA 3FZVA 3HIFA 1ON1A 3BJOA 2W24A 1YTYA 2CYYA 3O6BB 1XSVA 3CUQB 1KGSA 2FBIA 2XV4S 3I71A 3P7NA 4EJTA 3WTWC 1LJ9A 2OAZA 2WWYA 2W25A 1IN5A 2FBKA 5L3EA 4I09A 4GYIA 2M45A 2DQRA 4I0AA 4BNCA 2HYGD 1BBYA 2QVOA 5FLXK 2BYVE 3LWFA 1HSTA 2IA1A 2RKHA 4Y13A 2JRTA 4EGZA 5ICCA 4A5NA 5DCFA 4IRGA 4PGGA 4RS8A 2K7LA 2HTSA 1R23A 1TW3A 3R0JA 3VEPA 1SD7A 5E18F 3ML6A 4M73A 4LLNA 2P7CB 4Q48A 3MQ0A 2F5FA 2DLLA 5H6RA 4LG0A 2STTA 1G4DA 5IT3A 2A6HF 4JQFA 5CYVA 3BROA 2XKOA 2XUBA 3BZ6A 3IKVA 3HRUA 5KK1A 5D5XB 3GO5A 2H94A 1GHCA 3TO9A 5BPDA 4I2OA 2ZO4A 2WTEA 1LEAA 1S7OA 4JK1X 1RZ4A 1BOAA 3COAC 2FNAA 4FT8A 1QZZA 1B59A 5F1RA 4LG0B 4WCGA 1MJAA 3LAPA 4KICA 1KQ8A 2E1CA 4UV9A 3BDDA 1P92A 2K86A 2J5PA 5HLGA 4ESJA 3K69A 3AAFA 4P9FA 2XAGA 3D0SA 4GXOA 2ETHA 1K7AA 5HVQC 2CFXA 1FBUA 4FX0A 4YFNF 3FX3A 3TDZC 3F8MA 2K02A 3QOPA 4NHJA 3CJNA 6PAXA 5E8GA 4ZH4F 2YX7A 1TQMA 1WKMA 4XSXF 4KA4A 2VE8A 1ZARA 2NS0A 3NRVA 4LB6B 5FLXZ 2DTRA 5LGUA 4RGSA 2NAZA 3DF8A 2NRAC 3GFMA 4Q4ZF 5DEQA 2QZ8A 1Z91A 1EH7A 3H92A 2CQKA 3FM3A 1V4RA 5A2QK 1KU2A 4UV8A 1ULYA 1J0RA 1U6GA 1EV7A 4N9HA 1ZLKA 1FBQA 3NEUA 2ZKZA 3M8EA 2D1VA 3EYIA 2FMYA 1ZH5A 1S6LA 5FFXA 4OIRF 2FQ3A 2L3DA 5DV5A 1MJ9A 2XAQA 2FBHA 4UVAA 2DQLA 5AIPA 2O3FA 3F6VA 3N4MA 3TOAA 4YFXF 5F64A 4XBFA 3RKWA 4CDGA 4U7BA 3RKXA 2O0YA 1SFEA 1OYYA 4M6YA 5LEKA 2YR2A 3PFIA 3T0YA 2EB7A 1XB4A 3BY6A 1IN7A 1T38A 3HTUA 2ISYA 3GFJA 5D6EA 5AONA 2GA1A 2VOOA 1JGSA 3ZN0A 3TDUC 2DI3A 3QPHA 4CYDA 4EGYA 1D5VA 3ROUA 4KT5C 4EM2A 2YPRA 3BP8A 2Y0MA 4ZYGA 2DFIA 1IN8A 2HDCA 1B1BA 5D8LB 1Z7UA 1MDMB 4AVPA 3B73A 2FNPA 4G9YA 1SD5A 2A68F 3WTVC 4ESFA 5E20A 1T2KA 1R5GA 4L9NA 3IRQA 3ELKA 1FOKA 2HYFA 3KLNA 2H27A 5LRSA 2KIMA 3T1BA 1RUOA 2ISZA 5D8KB 4M6XA 1HW5A 4G7HF 3FXUA 5LHHA 3DEUA 4M72A 1TLHB 1SD4A 1XD7A 5FFZA 4EJOA 3LAJA 2LKPA 1ZGJA 1U5TB 3BJ6A 4HDVA 4OIQF 2IP2A 1KYZA 3GLXA 2ZFWA 3EQLF 5ERIA 2IPQX 1YS7A 1E17A 2GWRA 1OPCA 1KU3A 2A5YB 5LGNA 1DDNA 1RUNA 2Y75A 5LEJA 1ZGAA 1HQCA 2L01A 2AXLA 2FF4A 3I53A 4M9SA 4BHCA 4PDKA 4CICA 3LA2A 4HBLA 4PZJA 1FZPB 2LSOA 2ZXJA 3GF2A 1T39A 3VOEA 2QLZA 2HOEA 2D45A 2XHKA 3JSPA 1AWCA 3FMQA 2IRFG 4M74A 4LGWA 4RB3C 1XDUA 3CUQC 1SMYF 1ZRCA 1YS6A 3DPLC 4G6QA 1D8KA 4L5IA 1I1GA 4KUMA 5E1XA 1HW1A 2VT3A 1QNTA 2XAJA 4BYYA 5L3BA 4L5JA 2P5KA 3W6KB 1BIBA 1IN4A 5FB2A 1RNLA 3BPVA 2ADUA 2EFPA 2O03A 3F72A 3GZ5A 5FO5A 3IL2A 5K5QA 4Z2YA 2FRHA 4HAMA 1P4XA 2JPCA 1W5SA 3CTAA 3C18A 4BH9A 3P9KA 2K4BA 5HS8A 3IC7A 5FD5A 2RN7A 1SMTA 3EDPA 2IT0A 5H20A 3FHZA 2OD5A 2RGVA 2DPUA 4NB5A 2KIUA 2V6CA 3REOA 4HQEA 4LLLA 4G6DA 5TJJA 1A04A 4DQ2A 4HYEA 4MEXF 2XROA 1PUEE 5ILSA 5HS9A 1L0OC 4G7OF 3O2PE 2TDXA 1XCBA 1PP7U 4AD9A 2HR3A 1OR7A 4R8HA 5BS6A 2XGXA 1KYWA 1T98A 1ZREA 1FX7A 2HKOA 4LLGF 1D8JA 2QQBA 1JE8A 3LSTA 1U8RA 2XAHA 4B09A 1TNSA 1W5TA 5IT9Z 3TO6A 2L54A 2V9VA 3JAMK 2OA4A 3DP7A 3ABUA 2MD5A 1WQ2A 1KU7A 2Y48A 4OMZA 2A61A 2D2WA 2IA0A 4Q47A 3U1DA 4RB2C 1J9IA 3G3ZA 1QZYA 4GO1A 1O3SA 3M1EA 3V7CA 3IWFA 2V1UA 4HQMA 2MBFA 1BM9A 4XSZF 4ZYHA 5DCMA 3L9FA 2XRNA 4M9ZA 3HHHA 1KQ9A 2LDUA 4HV5A 3KP7A 1USSA 2M8EA 2L4AA 2FEZA 5JVTA 3WTYC 1F9NA 3MEXA 2H6BA 3SXYA 2IVMA 2MH2A 5J8FA 3E6CC 5BQTA 5DCMB 5FD6A 5L3GA 2P7VB 3LFKA 3ZMZA 3MWMA 1BJAA 1QQIA 3TO7A 1X3UA 2L4MA 4D0PA 2EA4A 4I02A 5D5VB 1GVJA 3SQNA 3LA7A 5K5RA 4L18B 1FYLA 3GW2A 4U0VA 3HRSA 4GCVA 1RIOH 1L3LA 4HF2A 3ECOA 1P4AA 5DYMA 3R4KA 4RB1A 1F4KA 3IRRA 3RI4A 1S7AA 1TW2A 4ASNA 3ZMTA 3I59A 2EV0A 3GXOA 4AWXB 2O8XA 2BGCA 2FSWA 1YQAA 3C7JA 3DV8A 4EQQA 1E2XA 3WU0A 2Q2EA 2QENA 2A6EF 2DPDA 3HSFA 4LMYA 3JAMZ 3O3KA 2ACJA 4HV6A 3N97A 3WTXC 3HSEA 1LB2A 1H0MA 2P6TA 2X4HA 1HKQA 1P2FA 2Q0OA 1BI1A 1U5TC 2EWNA 2M87A 5HOOA 2ZMEA 3I59B 3DQVC 2VE9A 4BXUA 3KP6A 4UUVA 5J8CA 3R6SA 3I58A 1MJBA 2QM3A 5CVUA 4NQWA 1TNTA 3KP5A 4A0ZA 1OYIA 5JR3A 4L0YB 4BHBA 3KP3A 4P55A 5CVIA 1XMAA 3ZN1A 4PCQA 5J6XA 5EEGA 2HS5A 2C6YA 2CW0F 2RVCA 3HTSB 3F6OA 3ZP5A 2OZ6A 3GFLA 1RI7A 2PI0A 2ZMEB 2PQ8A 3WE3A 1ZAOA 5DUKA 3KEOA 2LNBA 4WX9A 5F6FA 4P96A 5ICGA 4U88A 4KNYA 4HA8A 1YW9A 3F22A 4G7ZF 4QLCU 1JHFA 4MHGA 1ZG3A 1LQ1A 1YW7A 3HHGA 3ULQB 4DNCA 4AIJA 1FYKA 4IVNA 5K1YA 1ZRFA 4UXNA 4XLPF 4P9UA 1HSJA 2M30A 1R1VA 5FGMA 2P6SA 1XGSA 1FP1D 2KJBA 3JTGA 3KFWX 1T6SA 4LK1F 1QGPA 4MTDA 3V4GA 1CF7A 1G3WA 3WE2A 1FYMA 5L3CA 5ILVA 1I27A 1J5YA 1Z6TA 4Y15A 4YG2F 4ESBA 3LQQA 3J81K 4HLXA 1OKRA 2HQNA 3T5XA 2E1NA 1K78A 1XGOA 1XSXA 1R22A 4EJUA 4EV0A 3I64A 4RAYA 2PJPA 3RTRA 3DFGA 2P8TA 3VB2A 4KYWA 5LHIA 5CVJA 2VBXA 3ECHA 4TV7A 4PGHA 2NYXA 1CF7B 3QAHA 2RDPA 3H3UA 4GYGA 1Z1DA 4Q5SF 4A6DA 2FXAA 4OIOF 1USTA 2F5DA 4IJAA 2OQGA 3BPXA 4KMUX 1K78B 3E5XA 1HKSA 1Z6RA 3RYPA 2KIFA 4CXFA 1TTYA 5D5UB 2G7UA 3C3WA 3FMRA 2HTJA 2RQPA 2MLGA 4ENMA 3CLOA 3K0LA 5EEHA 1FP2A 3ISPA 2VBZA 1ODDA 1ZYRF 2ZNYA 4RGRA 1IF1A 2Z3YA 3IHUA 2O6GE 2EFWA 5IT9K 1Z05A 3Q5FA 1PDNC 3KP2A 2R7FA 3JW4A 1LEBA 1R00A 2Z5UA 2KRFA 1B9NA 4ZYEA 3I4PA 3E97A 4OIPF 1YIOA 2K4JA 3W6JB 5JFRA 2MC3A 2IW5A 2JSCA 4L9JA 2GXGA 5JI6A 1TBXA 2JPBA 3CDHA 2BBYA 1KA8A 1YG2A 1YLFA 1CGPA 5D5WB 2IA2A 2NNNA 2DU9A 2EV6A 4WWCA 1JHHA 3J81Z 4LFUA 4XLNF 4R79A 4WXHA 4EJVA 3I0TA 4CGZA 4BHPA 1I5ZA 4YFKF 5TRDA 4XRFA 1H9TA 2GIVA 3HOTA 3M8FA 4Y17A 1B6AA 1ZRDA 1O3RA 1H9GA 1R1UA 4ENKA 5HDNA 3MAJA 3J80Z 2NNYA 4LD5A 4UVCA 1IW7F 5CVRA 4ETSA 2Z33A 1FWZA 1YW8A 1G3YA 4ENJA 3F8NA 1FSHA 4UNOA 2ESNA 2GA2A 3ABTA 1IAWA 4OOIA 1R5HA 1TQPA 3GX4X 4JBAA 5H6QA 3MCZA 1UB9A 2OQRA 4E70A 4KN4X 2A69F 1BN5A 2BE5F 2MLKA 5D6FA 1YO5C 4O3MA 3WTSC 2QQAA 4WXDA 1V3FA 4I0BA 1Q1HA 3LA3A 2EFQA 3FWEA 3JTHA 5ILUA 4RGXA 2XIGA 3DXJF 3SZTA 1WRJA 3KCCA 4U0YA 5DD8A 3CUOA 1Z9CA 4MGRA 3HOSA 1QPMA 2XKPA 3MZYA 3PQKA 3HRMA 3TQNA 4WF2A 1D3YA 2A3SA 3RPUA 1W7PA 3IWZA 1W4MA 2DW4A 4RGUA 5LBQA 1XSDA 1HKTA 3HYIA 5BOXA 1OMIA 4OMYA 1S29A 3E3VA 4OU0A 2X0LA 4N9IA 2VOPA 3D5LA 4I01A 3Q9VA 3F8FA 4BAYA 4LK0F 2HZTA 4S05A 4KIGA 4CZZA 3FF5A 3SFZA 1LDKB 3V8JA 4A12A 3QU3A 2HKXA 1Y0UA 5CJ9A 2KJCA 5DUIA 1UHWA 1YYVA 3R61A 2CGPA 1IRGA 1FBSA 4HOBA 2FA5A 1G6NA 3U9GA 2KKOA 1LVAA 4H0EA 3I54A 2V1XA 2UWMA 1HXDA 1W7PD 4HW0A 2K27A 1WWXA 4L0ZB 1HW2A 4CO8A 4U7DA 1J59A 2JZYA 3GUDA 4IHTA 4ZZLA 3E5QA 1DPRA 3FXQA 5E1WA 2QUFA 1GXPA 4EMSA 3GZ6A 5HDKA 1EH8A 1FLIA 2ZNZA 1J75A 2VODA 2DK8A 1MKMA 1ZN2A 3KETA 2J5OA 2QYOA 3V7SA 2COMA 2DO7A 2ESHA 2E7XA 4KN7X 1ON2A 4L9TA 1J7KA 4RAZA 2Q8KA 4UHTA 2RV8A 3TGNA 2ZJ2A 1FY7A 2VBYA 5K5OA 2WV0A 4A2UA 3H3ZA 2O61A 1SAXA 3GYHX 3J7AO 2R3SA 5E1ZB 1O57A 4IF4A 3DPTA 4IXAA 1ZG5A 4OINF 3WG9A 3BOQA 3CO7C 3S2WA 3E6BA 2YSRA 2WC2A 4P5OA 1FSEA 4WXCA 1UHMA 5D4RA 1LDDA 2YX4A 1O7FA 2PN6A 2DT5A 3WGHA 2PG4A 3I5UA 3FXRA 2OBPA 3RIRA 3RJPA 2EV5A 1ZHFA 1JXSA 1K79A 2GZWA 4EM1A 4O6JA 5CVVA 3P9IA 3EUHA 4ENNA 1BIAA 2HWVA 3WTTC 1BI0A 1R58A 1REPC 3ZMVA 2AS5F 2W57A 5E8IA 2V79A 2YU3A 2PFBA 1G3TA 1U78A 3M7GA 4O5VA 2EJRA 3L2CA 2VT2A 2CSOA 1J2XA 2XASA 4IHSA 1BI2A 3G73A 3EETA 3MZHA 3WU1B 4LB5A 3KP4A 2F2EA 1F5TA 5D4SA 3SHFA 3F23A 1U2WA 2BEOA 1GXQA 1IUYA 2VONA 4IPAA 3HSRA 2H09A 4MNUA 5JHUA 3HRTA 1TQIA 3FMSA 1YFHA 5HLHA 1IXRC 4KFCA 4A0YA 4R1HA 1MD0A 3TKYA 2GAUA 2A07F 1KU9A 2LF8A 1ZG1A 1IN6A 1XGNA 1SFUA 1R1TA 2EFNA 3L7WA 2G9WA 3KE2A 1T0FA 5ICFA 1XCVA 5L3DA 1XGMA 1SFXA 3KZYA 3HUGA 3F3XA 3ERED 1K6OA 1QO0D 1BC8C 3ZMSA 3TOBA 1WI9A 2PMHA 3L00A 3RPQA 4HX4A 3F21A 3ZQ7A 1MDMA 1IXCA 3B02A 4KDPA 3DKWA 1DUXC 1C0WA 4HF1A 2M1BA 2VBWA 3QU6A 2VXZA 4G8XA 5E17F 2HGCA 4A6EA 5LHGA 1R36A 2CWEA 5CLSA 4WK8F 2FU4A 1S3JA 1EH6A 3QRFF 2ZBKA 2HQRA 3J80K 2Z99A 3QP5A 1U5TA 1MGTA 2MH9A 4HF0A 4HX7A 4YIIA 4M9XA 2HFHA 2QWWA 4KIFA 2ZCWA
chains in the Genus database with same CATH superfamily
3OYDA 2H1LA 3L09A 5IOYA 2LLKA 4I98B 1BC7C 3OL4A 5KVRA 4L9VA 2CRGA 2D1HA 1D0XA 3B6AA 2M5WA 4A93J 3WGIA 3WTZA 5ICEA 2PEXA 3J7AY 1SD6A 3G1OA 4KJZA 1XPXA 2XC7A 3BR2A 4BY7J 1I3AA 3GFIA 2UZKA 1F43A 2DFEA 2HQ5A 3ZGKA 3HL2A 4YIFA 1V54H 2BV6A 4HSRA 2CO5A 1FOWA 1VF9A 3IAM2 1HBXG 3W2VA 5L3FA 1UFMA 4JYKA 5FKOA 3MN2A 3S2HJ 3WTUC 4FHTA 1IRFA 4Y3OA 4AIKA 4ITVA 3CO6C 3VSKA 2VN2A 2GXAA 3RYRA 3HJEA 2P5LC 2Z9OA 2L7FP 4D7NA 1A31A 3IP4B 3S2DJ 3IKTA 3V8KA 1Z7LA 1G3SA 3M9AA 4ON0A 5B5EC 5HLIA 2H6CA 2X48A 1R4MB 2FOKA 4FASD 3ZMUA 1BI3A 1PP8F 4ANJA 1NK2P 4HLYA 3M3YJ 2VC1A 3KIOA 4CYCA 4AIHA 1UCRA 2LK2A 1OJLA 4QWQA 3GTJJ 1F1ZA 1APLC 1QBJA 2XVCA 1FT9A 1FPQA 2CV2A 3ONQA 2DYSH 3WGGA 1MZBA 2IGKA 3S3OA 4KIBA 5M5YJ 1HDPA 5C4XJ 5C4JJ 1U3EM 3BTLA 4UVBA 3BJAA 3E6MA 4ZYDA 2BOLA 4BUPA 5A2QZ 4N0BA 1ONVA 4ZZDA 2KISA 4HZFA 1MBJA 5DD4A 5HLTA 3OOPA 1YJ9I 1B4AA 2PBIA 2IBDA 4IRIA 1DPUA 3WODF 2EK5A 1LNWA 2CG4A 3CJQB 1MMGA 2K3PA 3RKYA 1R4NB 4MLOA 5HS7A 4A0XA 2VPRA 4B43A 1ZGWA 4II2A 4HDUA 3X2QH 4HNUA 5DDGA 3UKGA 2LKSA 3R60A 4M71A 3LNQA 1QA6A 3K4CA 1S8NA 3OWTA 4RB0A 1ZLJA 2R7DA 3I9V2 2HEOA 2FE3A 4ZDPA 3KEQA 3SDGA 3BWGA 1PYVA 1VQPI 4U0WA 1R71A 3V7RA 2DBBA 5ED4A 2G7HA 4K2EA 3OYBA 4GGGA 1IZ1A 2DAOA 3KZZA 5GPCA 1LFUP 1MNMC 1N77A 2PLYA 3R0AA 1X2NA 1P4WA 1IXSB 4MTEA 4J19A 4I76A 2QKMB 2K9LA 2V1NA 2JT1A 4EJWA 3K6GA 1POGA 3N05A 1O3TA 3GWZA 1LDJA 2MA3A 3F8CA 3LQRA 1TL8A 2P4WA 2Z2SB 2DMNA 5EYRA 2R7VA 2QBYA 3K10A 3GTPJ 1B9MA 3W2WA 4MQ9F 3MFKA 1WSUA 1RR8C 2QQ9A 3VODA 2GQQA 2VUMJ 5LRRA 2M34A 3P9CA 1VTNC 2GXBA 2OZUA 3QPTA 5F04A 3H9GA 4MEYF 1MH3A 3Q9SA 1OLTA 4XR6A 3VYSB 1DP7P 5BPIA 2IJLA 3C2HA 5LGTA 4F52A 5IOZA 3H3VK 1UMQA 4F7ZA 2FMLA 2Y69H 1Z77A 3RCOA 4G94A 2F5EA 2M2EA 1GLNA 2DK5A 1P6RA 3T8TA 2W85A 1KQ0A 3RZDJ 3BTIA 3HEFA 1I6XA 2VIXA 3CMEI 2MYSA 3EYYA 4HX8A 2VC0A 4IRHA 2YS9A 3K2ZA 1OYWA 3OV8A 3A2KA 3DPUA 1XTAA 2OU2A 4CCOA 3CCLI 3GTKJ 3JSOA 3E5UA 2OF7A 4I6ZA 3AG2H 2XAFA 4B44A 3A0HC 2B0LA 4MQVA 3ZMDA 4FCYA 1OFCX 1VFCA 3K1PA 1VI0A 2QBYB 1FC3A 3DTEA 2W7NA 4PFOA 2BXZA 2WB1A 3F8BA 4YIRX 2XGDA 2R7TA 2KZGA 3GEZA 2QF7A 3ZPLA 4FX4A 2KMUA 3JRBA 3ERMA 2W82A 2LF7A 4QSHA 4D1QA 5HDGA 4XRMA 1YIJI 4EATA 2UXNA 2DOAA 4IKFA 2BHZA 1IV6A 4KMFA 2PMUA 2EIMH 2XB0X 3MKYB 2JTVA 3T8RA 5J4YA 5AIQA 1YJWI 1QRYA 3L2UA 3JCUC 2Y0SN 3NQOA 4M3FA 1XMKA 5DS9A 4LJZF 2W84A 3C2GA 1V5FA 3KLOA 1D1AA 1AOYA 3OL3A 4GDFA 2XF6A 3PNVA 3E1SA 3VFZA 1STZA 1WH7A 2V1DA 2EA2A 1XN7A 3BCBA 3AL0C 1FNNA 1RRJA 3GVAA 2JVGA 3BTCA 3E6DA 3K1MA 3JR9A 1X3WB 1WJBA 1NHAA 2F5CA 2P5VA 4IX7A 2KP6A 3AG4H 5IYDJ 4BQAA 3GMEA 3D1NI 3GTQJ 2FUG2 2Y31A 3QP6A 4DJAA 2B9SA 2EILH 2P81A 3K1NA 3W6VA 2EIKH 3SZPA 4B8XA 1O3QA 2ELHA 1XG1A 3V8LA 2QSGX 4B3XA 2M0MA 1YE9A 3CUQA 2IS2A 3A1YA 4S04A 4D7MA 4EM0B 3U2RA 4S0HB 3LFUA 3ZQCA 3PQJA 2R7QA 5BMZA 1I50J 3K9TA 2Z1DA 2Y30A 2EFOA 2L5QA 4EVIA 3RDIA 2MGQA 3HKZA 3HOUJ 1I1SA 3EUHC 3C1DA 3FM5A 4J00A 2X9DA 2UXXA 2AQFA 2BY2A 4HNTA 1LFBA 4CHUA 1EF4A 2RC4A 4GFBA 5LLQA 1XDSA 4MFDA 4A5MA 2STWA 2K5CA 1O7LA 4XQFA 2XGCA 1N78A 1R7JA 1W7PB 2R7OA 4I7HA 2RNJA 2L02A 2E7WA 3FZVA 3HIFA 3KYLA 2V9PA 5E3OA 3L2VA 1ON1A 1U9NA 3FBIB 1UG0A 3BJOA 2W24A 4OAZA 1YTYA 2VJ4A 1AA7A 2CYYA 3O6BB 1XSVA 3CUQB 3QYEA 5E3MA 1KGSA 2OPTA 2FBIA 2TRTA 2XV4S 2B63J 3I71A 3B6CA 1X2MA 3P7NA 4EJTA 1JT0A 3DU5A 2JSPA 3RQIA 3WTWC 2VQGA 2M7AA 3FK6A 1LJ9A 2CUFA 4XKVA 2OAZA 2WWYA 3C2BA 2KLOA 2W25A 4AVZA 1D5YA 5IYCJ 3H0GJ 1IN5A 3ESWB 2FBKA 5L3EA 1OCTC 2ID6A 5F0HA 1Z3YA 4I09A 4GYIA 4XLEA 2M45A 3I4MJ 2DQRA 2HXIA 4I0AA 5CQEA 2X1EA 1H89C 4BNCA 2HYGD 2QA4I 1N75A 5GADJ 1BBYA 2QVOA 5FLXK 1FTTA 2HOTA 2BYVE 2E19A 3LWFA 5GAHJ 1HSTA 5F08A 1WHUA 2IA1A 2RKHA 4Y13A 2JRTA 1FOYA 4EGZA 5ICCA 2E1OA 1TWHJ 2ZXWH 4A5NA 4E7LA 2ZJQF 4C3HJ 5DCFA 4IRGA 4PGGA 4RS8A 2ECCA 2K7LA 2VKVA 2HTSA 2RNGA 3QQAA 1R23A 1YI2I 1JGGA 1TW3A 3SZGA 4RA2A 3R0JA 3VEPA 4BGDA 1AKHA 1SD7A 3TP0A 2XF7A 2DMQA 2DDBA 5E18F 1D0ZA 3ML6A 3IH3A 1T0FC 2BVMA 4M73A 4LLNA 3MZ8A 4IOCF 2K9QA 2P7CB 4Q48A 2NVTJ 3CZ6A 3MQ0A 3I55I 2F5FA 2DLLA 2E36A 5H6RA 4LG0A 2STTA 3PNTA 3S3MA 2BHYA 2X1DA 1G4DA 5IT3A 2A6HF 3H5RA 5KAFC 4JQFA 2MSYA 2PX9A 5CYVA 1I3QJ 3QODA 1V55H 3BROA 3OS1A 5JLXA 4ZDOA 2XKOA 2XUBA 3BZ6A 3IKVA 2KT0A 3HRUA 3PJRA 5KK1A 5D5XB 1FIAA 3GO5A 2H94A 3I3LA 2KRHA 1GHCA 3BR0A 3HOWJ 3TO9A 5BPDA 4I2OA 4W97A 2ZO4A 2IS6A 1ETWA 2WTEA 1LEAA 1ETYA 5FKLA 2P0WA 1S7OA 4JK1X 5M3FJ 5EEAA 1RZ4A 1BOAA 1FIPA 2WA0A 3DLLF 2KFDA 1T08B 2K85A 3COAC 2X6WA 3Q0VA 3D5RC 3Q3SA 2FNAA 4PFPA 4FT8A 1QZZA 4NBQA 1B59A 5F1RA 4LG0B 3LSKA 4XLCA 4WCGA 2DOEA 2W1OA 1MJAA 1SFKA 3LAPA 4KICA 4H4KC 3OYKA 1VZ0A 2E1CA 1KQ8A 4UV9A 3BDDA 4XLHA 4M6VA 1P92A 4B1RA 2K86A 2J5PA 4U87A 4RAGA 3BR3A 3LSPA 5HLGA 3CLQA 4ESJA 1I39A 5C44J 3BZCA 4MO7A 3ZQFA 4BU2A 3K69A 3AAFA 4P9FA 2XAGA 2QCOA 1YHQI 3ZR8X 3D0SA 4GXOA 2ETHA 1JKOC 3W2AA 3S1NJ 3FXLA 1GT0C 1K7AA 3M1CA 5HVQC 2CFXA 1FBUA 2A5WA 4FX0A 2LH9A 3FX3A 1OCPA 4YFNF 3TDZC 4E6KG 5JHFA 1XC5A 2ID3A 3F8MA 2OJED 1B8IA 2GM4A 4NUBA 4I99C 2K02A 3GTMJ 1JUSA 3VYUB 3WG7H 4AYBN 3QOPA 3GTGJ 4XOTA 4NHJA 1ORKA 3CJNA 6PAXA 4C9YA 1MMSA 5E8GA 3JRCA 3P5JA 4ZH4F 2YX7A 1TQMA 1WI3A 1WKMA 4XSXF 3MD2A 3CC2I 4KA4A 1F36A 2VE8A 5B66C 1A36A 2M0CA 2F5VA 2W00A 4XICA 1ZARA 2NS0A 3FK7A 3NRVA 3JREA 4LB6B 1A35A 5FLXZ 2E2IJ 4MIMA 2DTRA 2R7SA 3IH4A 2WAQA 3BC8A 5LGUA 4RGSA 2NAZA 4NDLA 1X4PA 2E5NA 2DOFA 2EZLA 2ZFUA 3DF8A 3EUAA 1JKQC 2EINH 2NRAC 3GFMA 2D5VA 4Q4ZF 5DEQA 2QZ8A 4F91B 1Z91A 1EH7A 1WZ2A 3H92A 2OTJI 2CQKA 2V9KA 1V4RA 3FKJA 3FM3A 4QPQA 5EF6A 5A2QK 4G6TB 2PMZN 4LITA 2Z16A 4X0GA 1KU2A 4UV8A 1ULYA 1J0RA 1TWFJ 1U6GA 1EV7A 4N9HA 1ZLKA 1OCCH 2NXNB 1M1EB 2A05A 1FBQA 3NEUA 2BVLA 2ZKZA 1E3OC 5LD2C 3M8EA 2AQEA 2D1VA 1X1AA 3EYIA 4BXXJ 2FMYA 1ZH5A 1S6LA 5FFXA 4OIRF 3CD6I 1QZEA 2VQHA 2FQ3A 2L3DA 5DV5A 3ZQQA 1MJ9A 4RLQA 2XAQA 2FBHA 4UVAA 2LFBA 1BR1A 1X1PA 3FXJA 1E3HA 2DQLA 5AIPA 2F48A 1X1BA 2COBA 2O3FA 3F6VA 5J40A 2M4GA 3A01B 1MBKA 3N4MA 2DT6A 3PUFA 3TOAA 3OYFA 3HZJA 4YFXF 5F64A 4XBFA 3RKWA 4CDGA 4U7BA 3RKXA 4NC6A 2O0YA 1SFEA 1OYYA 4M6YA 3TMOA 5LEKA 2YR2A 2L7ZA 4B48A 2HOAA 3PFIA 3T0YA 2EB7A 1XB4A 1ZKGA 3BY6A 2R93J 1IN7A 4A3JJ 1T38A 3FXMA 3VDXA 1HCRA 4PUSA 3HTUA 2JA2A 4BE1A 2ISYA 1D1BA 3GFJA 5D6EA 4XRSA 5AONA 3K7AJ 2GA1A 2VOOA 1JGSA 3ZN0A 3TDUC 2DI3A 3QPHA 4CYDA 4EGYA 1BA5A 1U9OA 2R92J 1D5VA 5J1UA 5E3NA 3ROUA 2FJ1A 3Q0UA 4KT5C 4CCLA 4EM2A 2YPRA 2Y9ZA 4BACA 3CDIA 3BP8A 2DA7A 2Y0MA 2DFIA 1IN8A 4ZYGA 2HDCA 1B72B 1B1BA 3G4SI 3HDDA 1P7IA 5D8LB 2E60A 1Z7UA 1MDMB 3OOUA 5K7ZA 4AVPA 3B73A 3ABKH 1X19A 2FNPA 4G9YA 2MG4A 1SD5A 1H88C 2A68F 2WAEA 4DZJA 4ESFA 3WTVC 5E20A 4RAFA 1T2KA 1R5GA 4L9NA 3IRQA 3ELKA 1FOKA 1RESA 2HYFA 4BBSJ 1PJRA 3S32A 3IUOA 3KLNA 3ZRGA 4BDYA 4NC8A 2H27A 2JRMA 5LRSA 2KIMA 1JKPC 3T1BA 5IYBJ 3BR6A 1HC8A 1RUOA 2ISZA 2XAUA 5D8KB 2YU9J 4M6XA 1TT0A 1HW5A 4G7HF 3FXUA 1QHHD 5LHHA 3DEUA 4M72A 1WJFA 1TLHB 1BOBA 1SD4A 1YX3A 3S1RJ 3I4NJ 1XD7A 2KQRA 5FFZA 4EJOA 3LAJA 2LKPA 1ZGJA 1U5TB 2JN6A 2RQQA 3BJ6A 4BY1J 4HDVA 3BG6A 4OIQF 1GDTA 2IP2A 3ASNH 1KYZA 3GLXA 2ZFWA 3EQLF 2DA2A 5ERIA 4ZDLA 3K4KA 4KISA 2IPQX 1YS7A 1E17A 2CW8A 2AXTC 2GWRA 2HVQA 1OPCA 4P1WA 5EZHA 1KU3A 4YEJA 2A5YB 5GTHC 1BR2A 2DXIA 4XN3A 1UAAA 5LGNA 1DDNA 1RUNA 2Y75A 5LEJA 1ZGAA 4A3BJ 1HQCA 2L01A 2AXLA 2FF4A 4XIDA 1X3ZB 3I53A 4M9SA 4BHCA 4PDKA 1QHGA 3JRDA 3OYIA 4CICA 4DGWB 2XPWA 3DLAA 2E71A 3LA2A 4HBLA 4PZJA 1FZPB 2LSOA 2ZSHB 2ZXJA 1ZELA 4M3DA 2LD5A 3GF2A 1T39A 4ZJZA 3VOEA 3JRIA 2QLZA 2VKEA 2HOEA 2D45A 3OR2C 2DMTA 2XHKA 1JT6A 3JSPA 1AWCA 1VQLI 4IHYA 3FMQA 2IRFG 1PUFA 4M74A 4UY8I 1OCZH 4LGWA 3CMAI 1S7EA 4RB3C 1XDUA 1FMWA 3CUQC 4YELA 1BW6A 3DU6A 3DKXA 1SMYF 3I56I 1YS6A 1ZRCA 3FDYA 3DPLC 4G6QA 4CYCB 2OV7A 4E7JA 2VKDA 3OYAA 1D8KA 4L5IA 1I1GA 1K6YA 4KUMA 4L5EA 5E1XA 1HW1A 2OTLI 2VB6A 2VT3A 1QNTA 2OCCH 4J01A 4FETA 5GP9A 1TWGJ 2CUJA 2XAJA 4BYYA 5L3BA 4C2UA 4L5JA 1X58A 4ZC3A 1HDDC 2P5KA 1KONA 3W6KB 1BIBA 2HVRA 1NTCA 1K61A 1IN4A 1RNLA 5FB2A 3BPVA 2ADUA 2EFPA 2O03A 3F72A 3GZ5A 4PJLA 5FO5A 3IL2A 5FRMA 3HG9A 2VQLA 1ETVA 5K5QA 2VL8A 3H5NA 2HZDA 4Z2YA 4N4NB 2FRHA 4HAMA 3FBNB 1P4XA 1VNDA 2JPCA 2DT7B 1W5SA 1V5EA 3CTAA 2NVQJ 4Y52J 4PJMA 4C3JJ 4E7HA 1G2HA 3C18A 1RC9A 3FKIJ 4BH9A 3H36A 3P9KA 2K4BA 5HS8A 3FXKA 1J09A 3CP8A 3IC7A 5FD5A 5KCMA 2RN7A 2ZSIB 3PIPF 4JX6A 2QSFX 1SMTA 3EDPA 2IT0A 5H20A 3FHZA 1VQKI 2OD5A 2RGVA 2DPUA 2PJRA 4NB5A 2KIUA 4CSWA 2V6CA 3REOA 4HQEA 4BJ6C 4LLLA 1NG6A 1ETKA 1JI8A 4G6DA 5TJJA 1A04A 4DQ2A 1VQ4I 3L2QA 3JRGA 4HYEA 4MEXF 3CDLA 5EDNA 2XROA 3L1PA 3QPLA 5ILSA 1PUEE 3TBIA 5HS9A 5J1RA 3PSFA 1L0OC 4ZYAA 4PJNA 4XMYA 3H35A 2JK3A 1S9HA 5JLWA 3O2PE 2TDXA 4G7OF 1XCBA 1PP7U 5IP7J 2TCTA 2HR3A 4AD9A 2FD5A 1OR7A 4R8HA 2NVUB 5BS6A 4XKWA 2NOJB 2VLAA 3PSIA 2DTZA 5J3LA 2XGXA 1KYWA 1T98A 3IH2A 5F27A 1ZREA 2PJRB 4AIDA 3DWLE 1FX7A 2HKOA 2CV0A 3QYFA 3MKZA 4Z6YA 4LLGF 2VQCA 3IV5A 2ZC2A 1D8JA 2QQBA 4XN0A 3JRHA 4A3GJ 1JE8A 3LSTA 1U8RA 2VJIA 1RETA 4A3EJ 1GUUA 2XAHA 3F9KA 4B09A 1TNSA 1W5TA 3TW6A 5M3MJ 3TO6A 5IT9Z 2L54A 2V9VA 3BTJA 3JAMK 2OA4A 3DP7A 3BG3A 3ABUA 4LIUA 4C2TA 3CF2A 4RM2A 1X1DA 4BJTA 5FJ8J 2MD5A 3LSIA 3SEQA 3OY9A 1IDZA 1WQ2A 1KU7A 2Y48A 4OMZA 2A61A 3OS2A 2D2WA 3OYEA 4D5CA 1SC7A 2IA0A 3FISA 4Q47A 3U1DA 2R0QC 2WY8Q 4RB2C 2CQ7A 1J9IA 4EEFG 3G3ZA 2ZJRF 1QZYA 5KAIC 4GO1A 1O3SA 3M1EA 1TT5B 4G12A 3V7CA 2O7OA 3IWFA 3MMYB 2V1UA 2LTPA 4HQMA 2MBFA 1BM9A 4XSZF 4BL0B 4ZYHA 5DCMA 3L9FA 3K70C 2XRNA 4CUGA 4A3KJ 4M9ZA 3HHHA 1Y6IA 4JX4A 4UUSA 1GVDA 4HSTA 1KQ9A 3ASOH 1Z21A 2DJNA 2R7XA 2LDUA 4HV5A 3ZXSA 2G0EA 3KP7A 2L9VA 1K83J 3S16J 1USSA 4JP0A 4CCJA 2M8EA 2L4AA 2BXYA 2FEZA 2NS8A 1DQUA 2L9NA 2XPUA 5JVTA 4IHVA 3WTYC 3S1MJ 1G59A 9ANTA 3LOCA 3GBGA 1F9NA 2DA4A 3MEXA 1JTXA 2H6BA 1FMVA 2LKXA 1ZR2A 4FE7A 3SXYA 1YOVB 4DYRA 1Y1VJ 2X6YA 3VYTB 2IVMA 2MH2A 5J8FA 3H0DA 2IEKA 4BE0A 1R9TJ 3E6CC 3E7LA 4KT6A 5BQTA 2CJJA 1T56A 3TP3A 5JVGF 2NS7A 2K9NA 5DCMB 4CCNA 5FD6A 5L3GA 4XORA 5IY5H 2V26A 2P7VB 3LFKA 3ZMZA 2E2JJ 5J47A 3MWMA 5HNFA 1BJAA 1QQIA 2LBFA 4UUSB 3TO7A 5H2FC 5CKTA 1X3UA 2L4MA 2QGUA 2F4IA 1MBEA 4D0PA 2EA4A 4I02A 5D5VB 4ZTFA 1GVJA 1YX5A 1TZLA 3LA7A 4PK4A 3SQNA 2O5RA 5K5RA 4L18B 1IGNA 1FYLA 3GW2A 2JUCA 4U0VA 2V4JC 3QPSA 2Y0SA 1XX5A 3HRSA 4GCVA 1RIOH 1DGWY 1L3LA 1WFXA 4HF2A 5CPRB 3RSNA 2VI6A 4BEHA 2DDAA 2AHQA 3ECOA 3VYRB 2E35A 3LSHA 1P4AA 5DYMA 3R4KA 4LG3A 4RB1A 1F4KA 3IRRA 3RI4A 1Y39A 1S7AA 2BY3A 2LRDA 3OSGA 1TW2A 3PO3J 3S14J 2LBFB 3JRFA 4ASNA 3BG9A 2IS4A 2A6TA 1LFPA 3ZMTA 3I59A 2EV0A 3GXOA 2GOMA 4AWXB 2O8XA 3MVPA 2BGCA 2FSWA 2UV1A 3GCMA 5DTDA 1YQAA 3C7JA 1SFOJ 3DV8A 4XNFA 4EQQA 3PNYA 4X1EA 3G1MA 1E2XA 5J4VA 3WU0A 1AKHB 2Q2EA 2QENA 2A6EF 1IRXA 2DPDA 2WY7Q 3HSFA 4LMYA 2NVYJ 3JAMZ 1W0UA 3O3KA 4PSWA 2ACJA 4HV6A 3Q0WA 4BQOA 3N97A 3WTXC 2JA8J 4V2GA 2EBIA 3HSEA 1LB2A 1H0MA 1VQMI 3DBHB 2P6TA 4CH7A 4BEHB 5IPAA 2X4HA 1T8IA 3O8GA 1HKQA 2M8GX 3ABMH 1YITI 3CCJI 2I10A 1P2FA 2IAIA 4F92B 2Q0OA 4IZZA 3SJMA 1BI1A 1U5TC 3BCAA 4XONA 2EWNA 2M87A 5HOOA 3CCSI 2R7UA 3CMMA 2MFZA 2ZMEA 4BE2A 3I59B 5EGOA 3DQVC 2VE9A 1OCOH 4BXUA 3KP6A 4UUVA 5J8CA 3KX2A 2B7EA 4OAYA 2HXOA 3R6SA 2NOGA 3I58A 1EJ9A 1MJBA 1EKEA 2QM3A 5CVUA 4NQWA 1PVEA 1TNTA 3KP5A 2IGMA 4A0ZA 1OYIA 2L7MP 5JR3A 4L0YB 1A6QA 4BHBA 4CCKA 5B1AH 3KP3A 4P55A 2V6EA 5CVIA 4IQJA 3HOVJ 1XMAA 3OIPA 3M07A 3M8JA 3ZN1A 4PCQA 5J6XA 5EEGA 4DBRA 2HS5A 4ABZA 1YRNA 5IP6A 5FKNA 2GBYA 2C6YA 2K40A 3HXLA 3NAUA 2CW0F 3U1KA 2RVCA 3HTSB 5GAEJ 1JJ6C 3F6OA 3ZP5A 1MSEC 4M3GA 4RM3A 5FLVA 1I6HJ 2QQ8A 2OZ6A 3ZCOA 1Q1VA 3K4BA 3GFLA 1MNEA 3JRAA 1RI7A 3CC7I 4DW6A 2PI0A 3G71I 2DCEA 2RREA 3H1CA 2ZMEB 1Y8RB 3ZOBA 2PQ8A 1WH5A 2HNHA 3WE3A 1FOXA 1ZAOA 5DUKA 3KEOA 2LNBA 4WX9A 5F6FA 3OYHA 4P96A 5ICGA 4U88A 2R7RA 1CQTA 2QKLB 4KNYA 4HA8A 2JVHA 3BR1A 1YW9A 1UZCA 5CQGA 3F22A 2CV1A 4BQNA 1IJWC 1B8IB 1VQ6I 4G7ZF 4QLCU 1JHFA 3VSLA 1E3PA 4MHGA 1YRNB 2WV1A 1ZG3A 5J1YA 1LQ1A 1YW7A 3U21A 3HHGA 3ULQB 2F6CA 4DNCA 4AIJA 4Y7NJ 1FYKA 4IVNA 2HI3A 5K1YA 1ZRFA 4JX5A 3QWLA 4RBOA 4A3DJ 4UXNA 3OIOA 4XLPF 5FLMJ 2EZKA 4P9UA 2BY0A 1HSJA 1NH3A 2M30A 1NK3P 1R1VA 5FGMA 2P6SA 1XGSA 1BR4A 1FP1D 5DM6F 4QTRA 2FQ4A 2IXSA 4IEJA 2FOWA 2KJBA 2L9SA 3JTGA 3PIOF 1SVLA 4B47A 3GLLA 3KFWX 2QEXI 4IOAF 2I8DA 1T6SA 3KEYA 4LK1F 2R5ZA 1QGPA 4AC0A 4MTDA 4LIVA 1SVOA 4A3CJ 3V4GA 4E7SA 1X1CA 1HLVA 4DIQA 2Y9YA 1CF7A 4RMNA 1G3WA 3WE2A 2JUGA 1FYMA 5L3CA 2JA6J 2IGOA 1WVRA 4XRSG 2GIZA 5TISC 2HDWA 1N25A 5ILVA 4JOMA 1IDYA 4E7IA 1QU3A 2IGNA 1IUFA 1I27A 1J5YA 1Z6TA 4Y15A 2R5YA 4YG2F 3BQYA 1R49A 4ESBA 3LQQA 1ITYA 4IQ4A 4IO9F 3J81K 1A5JA 4LOCA 1LE8A 4HLXA 1OKRA 2HQNA 3T5XA 1DU0A 2E1NA 1K78A 3J7YJ 1XGOA 1XSXA 1MSFC 1GV5A 1R22A 4EJUA 4EV0A 3I64A 3PM1A 4RAYA 2PJPA 3RTRA 3DKYA 2MC4A 3CCMI 1EA3A 2P8TA 3DFGA 3VB2A 4KYWA 3WHBA 3HPHA 2CUEA 5DM7F 5LHIA 2R5ZB 3QOEA 5CVJA 5EZGA 1LPQA 2VBXA 3ECHA 1VQ8I 4TV7A 4PGHA 2NYXA 1CF7B 3QAHA 2L9RA 3HGYA 2Y2ZA 2RDPA 4FQGA 4HNVA 2XB5A 3HC7A 3PUBA 3H3UA 1TC3C 4GYGA 3KPHA 1Z1DA 5F0FA 4Q5SF 3A4CA 3DBLB 4A6DA 2CQXA 3H9QA 2FXAA 4OIOF 2CQQA 2WBMA 3ZQGA 1VQNI 3A03A 1USTA 1LE8B 2F5DA 4IJAA 5B1BH 1ETOA 3ZQHA 3HPGA 3HOYJ 2OQGA 1IO2A 2LG4A 3BPXA 4KMUX 4D5FA 1K78B 4AYBA 2VJ5A 2VXDA 1RR7A 3E5XA 1HKSA 2ZXHA 3KZIC 3CCVI 1Z6RA 3RYPA 3CCEI 2KIFA 3CQZJ 2WB1N 4CXFA 3K4MA 1TTYA 5D5UB 3RQ4A 2G7UA 3VWBA 3OSFA 3FXOA 1HF0A 3C3WA 3FMRA 1IRZA 1Z0XA 2JA5J 2HTJA 1MMNA 2RQPA 4PJJA 5GAGJ 1OR7C 2ZJPF 2DA6A 2MLGA 3CMYA 4ENMA 2LY9A 3CLOA 3G6EI 3MKWB 3K0LA 3KYCB 5EEHA 1FP2A 3ZQLA 1WCMJ 3ISPA 2VBZA 1ODDA 4HEA2 4DYQA 1ZYRF 1UHSA 2ZNYA 3SDBA 3DCFA 4RGRA 1IF1A 1K4TA 4A3LJ 2PMZA 2X51A 4BKXA 2Z3YA 3IHUA 1VQ9I 2O6GE 2EFWA 5IT9K 1DGRM 2DMPA 2LVSA 1Z05A 3Q5FA 1PDNC 3KP2A 4A3MJ 2R7FA 3BR5A 3JW4A 1LEBA 4PSXA 2DYRH 1LUJB 3HBLA 1R00A 2UUZA 2Z5UA 2KRFA 4E7KA 1B9NA 3HM5A 2FX0A 4ZYEA 1VQ5I 3I4PA 3E97A 4X6AJ 2JJ7A 2ME0A 2YUSA 3OS0A 4OIPF 3OR1C 1YIOA 1OISA 2H8WA 2K4JA 3W6JB 4KITB 5JFRA 1W36D 3TEDA 3TW7A 2MC3A 2IW5A 2JSCA 2KHMA 4L9JA 2GXGA 2RAEA 2OCEA 5JI6A 4V2FA 3CCUI 2KRCA 3OYMA 1TBXA 2JPBA 4UUTA 2F4OB 2W4SA 1QPIA 2HVSA 2R7ZJ 3VPRA 3CDHA 2BBYA 1KA8A 1YG2A 1YLFA 1CGPA 2O9LA 3HKZN 3BZKA 4AM3A 5D5WB 2IA2A 3CJRB 4C2MJ 1FJLA 2NNNA 2DU9A 4BQQA 2HPMA 3OYNA 2EV6A 4WWCA 1JHHA 3J81Z 4LFUA 1JUMA 4XLNF 5EG0A 4R79A 1PUFB 4BJ5C 4WXHA 4EJVA 3I0TA 4CGZA 2IS1A 1FEXA 4BHPA 1I5ZA 1P9QC 4YFKF 4XRFA 5TRDA 1H9TA 2GIVA 4RLFA 4HRIA 3K4LA 1VQOI 2ZXIA 3CCRI 1JTYA 2R7WA 1BW5A 3HOTA 3M8FA 4C3IJ 2R4GA 2MW8A 1B6AA 4Y17A 3FHNA 2O8KA 3SEZA 1ZRDA 1TWCJ 4FTHA 3OMYA 1O3RA 1H9GA 2E1MB 1R1UA 3A0BC 2ME6A 4ENKA 3SYTA 5HDNA 2EIJH 3MAJA 3J80Z 1K4SA 1BJZA 2NNYA 2QSHX 4LD5A 3CC4I 4UVCA 5LFAA 1IW7F 2NVXJ 5BNGA 2CUZA 5KHDA 5CVRA 3EPZA 1FTZA 1Y56A 5EG0B 4ETSA 2EZIA 3TL4X 1ZK8A 4C30A 2Z33A 1FWZA 1YW8A 5E3LA 1G3YA 3CESA 3F8NA 5M5WJ 4ENJA 1FSHA 2LP0A 4UNOA 2ESNA 2GA2A 3ABTA 1IAWA 4OOIA 5GTIC 1R5HA 1A6IA 1TQPA 3GX4X 2XSJC 4JBAA 5H6QA 1IC8A 1WJ5A 3MCZA 1UB9A 3CCQI 1BL0A 2KZVA 2OQRA 4GRIA 1ENHA 2F4MB 2GOXB 4E70A 5K7HA 5C3EJ 4CZCA 4KN4X 1UJ8A 2A69F 1QVUA 3L2WA 1BN5A 2BE5F 3DBRB 2ELKA 2MLKA 5D6FA 1YO5C 4O3MA 2LREA 3WTSC 2QQAA 4WXDA 1SEUA 1V3FA 4I0BA 1Q1HA 3LA3A 2EFQA 3FWEA 3JTHA 5ILUA 4RGXA 3FIWA 2X85A 2XIGA 3D5SC 4XLAA 3DXJF 3RZOJ 3SZTA 2LR8A 1WRJA 1MMAA 3KCCA 1TP4A 1E0EA 4U0YA 1Y8QB 5DD8A 1AHDP 2KPMA 3CUOA 2XGEA 1Z9CA 4MGRA 3HOSA 1QPMA 2XKPA 4CCMA 3V42A 3MZYA 2XSDC 3QYBA 3PQKA 1OCRH 4A3FJ 2ZB9A 3HRMA 3TQNA 3W3CA 2DA5A 4WF2A 1TWAJ 1D3YA 4XKCA 2A3SA 3DEWA 3O8HA 1W7PA 3IWZA 3RPUA 1W4MA 1R6RA 2DFHA 2DW4A 4FISA 3CP2A 4RGUA 2XF5A 4V19K 4XK4A 2CW7A 5LBQA 1XSDA 1HKTA 3HYIA 5BOXA 1OMIA 1H8AC 2KL4A 1ACIA 3RKQA 1WJEA 1T95A 2CH0A 4OMYA 1S29A 3WHCA 2XDVA 2LC2A 2CQNA 3E3VA 1Y0NA 2X0LA 4OU0A 4N9IA 1XS9A 4NC7A 2VOPA 3D5LA 2HQAA 4I01A 4M3EA 1D0YA 3Q9VA 3F8FA 1RKWA 4BAYA 1JKRC 1ZR4A 5FROA 4UB8C 2ZMEC 4LK0F 2HZTA 4S05A 4KIGA 4CZZA 2DA3A 3FF5A 3SFZA 1LDKB 3V8JA 2VASA 4A12A 3QU3A 2HKXA 2DN0A 2LOOA 1Y0UA 1RPWA 5CJ9A 4II3A 1WJCA 4A69C 2KDOA 2KJCA 5EGOB 5DUIA 1UHWA 3S93A 2KIQA 1YYVA 1OQYA 3R61A 2CGPA 2ELJA 2K3FA 3S17J 1IRGA 1FBSA 2ICWG 4HOBA 3MKLA 2FA5A 3GZNB 2MABA 3CCYA 1G6NA 3U9GA 3LSGA 1R5ID 2KKOA 1LVAA 4H0EA 2LYCA 3I54A 2V1XA 5EJCA 1ZQ3P 3K4NA 2I5UA 2UWMA 2VPLA 1HXDA 4XM3A 3F0CA 1W7PD 3RPUD 3HOXJ 4HW0A 1U8BA 4N4OB 5KNLA 3DTKA 1U0JA 2K27A 3ABLH 1WWXA 4L0ZB 5F1JA 5B3SH 1JUPA 1NG7A 3BG5A 3LSJA 2LMDA 3EUKL 4E4HA 1HW2A 2H1KA 4CO8A 4IHXA 1IV8A 4OWRB 3ZQIA 4U7DA 2EH3A 1KZHA 1J59A 2GLOA 4XLFA 1ERDA 1QVTA 1MBHA 2JZYA 3GUDA 3LSRA 4IHTA 4ZZLA 3BLYA 3E5QA 1DPRA 2DMUA 3FXQA 2CFOA 5E1WA 1O4XA 1MW7A 1G8XA 2WAQN 2QUFA 1GXPA 4E7ZA 3LSMA 4EMSA 2N8GA 3GZ6A 1UG2A 1EH8A 5HDKA 2ZNZA 3NWSA 1J75A 4BXFA 2DK8A 2VODA 1MKMA 1FLIA 3OIQA 3H5AA 1DP3A 3A02A 2DA1A 1ZN2A 3S8PA 1RKTA 4BS9A 2HYJA 3KETA 2M9HA 2J5OA 2QYOA 3UR3C 2OUMA 3V7SA 4B4CA 2X1CA 2COMA 2DO7A 2ESHA 2E7XA 4KN7X 1ON2A 4L9TA 1S72I 1J7KA 4RAZA 1W1WE 1YJNI 1GV2A 3PFYA 2Q8KA 4UHTA 2RV8A 2JQ7A 3TGNA 2ZJ2A 3PO2J 1FY7A 2VBYA 5K5OA 2WV0A 4PJ0C 2HOSA 2MD0A 4A2UA 1LKXA 3H3ZA 2O61A 1SAXA 3GYHX 3J7AO 2R3SA 3OYJA 5E1ZB 1O57A 3UNGC 4IF4A 2LY1A 3DPTA 4IXAA 1ZG5A 4F93B 1HA8A 2BW3A 4OINF 3WG9A 3BOQA 5E79C 4D9JA 4IL6C 1HOMA 3HOZJ 3AKZA 3CO7C 3S2WA 3E6BA 2YSRA 4FE4A 2WC2A 3NWTA 1XMXA 3IAS2 4P5OA 1FSEA 4WXCA 1UHMA 2BY1A 5D4RA 1MIJA 1LDDA 2YX4A 1ZTRA 1O7FA 2PN6A 2DT5A 3WGHA 2KDZA 3H9JA 2PG4A 3I5UA 3FXRA 1Z67A 2OBPA 3PL8A 3RIRA 2AO9A 2EV5A 3RJPA 1ZHFA 1JXSA 1K79A 2CS3A 2GZWA 4EM1A 3BT9A 4O6JA 1IG7A 5CVVA 3P9IA 3EUHA 4ENNA 1BIAA 2HWVA 3E0JB 1P7JA 3WTTC 1BI0A 1R58A 2E34A 1REPC 4M3BA 2DODA 4YRVA 3K2AA 3ZMVA 4DOZA 2W57A 2AS5F 3J7ZI 2Q1ZB 3L2RA 3AL0B 2Q2EB 4BBRJ 5E8IA 2V79A 2YU3A 5HODA 1ETQA 2PFBA 1G3TA 2EPFA 2K9SA 1U78A 3M7GA 4O5VA 1Z3XA 3KYDB 2OC6A 2BW3B 2EJRA 1MBGA 2VJJA 2VT2A 3L2CA 2CSOA 1J2XA 4XKBA 1MNDA 2XASA 4QIWN 4IHSA 4RDUA 1BI2A 3CJTB 3G73A 3EETA 3MZHA 4F55A 4CA0A 3SFIA 2L2OA 3WU1B 4LB5A 1MBFA 3KP4A 3BQZA 2F2EA 2VKHA 1V5GA 1F5TA 4MFEA 5D4SA 3SHFA 1W36C 1WGXA 5K7FA 3F23A 3BG7A 1U2WA 2BEOA 1GXQA 3CF5F 1W0TA 1IUYA 2VONA 4NQWB 2EQRA 1DU6A 4ZTJA 4IPAA 3HSRA 3G1LA 2H09A 4DYCA 3S1QJ 4MNUA 5JHUA 3HRTA 1TQIA 3FMSA 3LL7A 3HB9A 2JMWA 1Y1WJ 1YFHA 3K4JA 3OYCA 5HLHA 2JA7J 3A01A 1JJ8C 1IXRC 2M4KA 4KFCA 4Y4RA 4A0YA 4R1HA 1MD0A 2L0KA 3TKYA 2GAUA 2JWTA 2A07F 1KU9A 2LF8A 3S3NA 1UELB 1ZG1A 5M5XJ 3K70D 5FRNA 3M4OJ 2EZHA 1IN6A 1XGNA 4B3AA 1SFUA 4F3QA 2WADA 4IHWA 2XPVA 1R1TA 1SVMA 5HNHA 2EFNA 3L7WA 2DJIA 2G9WA 3KE2A 2HU9A 1T0FA 5F0CA 2M7BA 5ICFA 3AG1H 1XCVA 5L3DA 1S5LC 3DTIA 1XGMA 1SFXA 4W1UA 4QPOA 4UB6C 2V7FA 2LY2A 3KZYA 3HUGA 3F3XA 2CMPA 3ERED 1K6OA 4Y33A 3AG3H 1AU7A 1QO0D 1BC8C 1ETXA 3ZMSA 3TOBA 2E1MC 1WI9A 2PMHA 2E2HJ 3OYGA 1B72A 3L00A 3RPQA 2L7KA 1SANA 5IP9J 2XRLA 4HX4A 3F21A 1LVKA 3ZQ7A 1MDMA 3HGGA 1IXCA 3B02A 4KDPA 3DKWA 1DUXC 1C0WA 2HDDA 4HF1A 2M1BA 2VBWA 3QU6A 2VXZA 4G8XA 5E17F 3G2BA 1X4OA 2HGCA 4AU7A 2W48A 4A6EA 2HPIA 5LHGA 1R36A 2WAFA 4HPQA 2DFFA 2CWEA 3LMMA 5CLSA 4A3IJ 4WK8F 1MH4A 2CU7A 4XL9A 2E5ZA 2FU4A 5TGTA 3GTOJ 3HUGB 1S3JA 1EH6A 4XOPA 3QRFF 5FKMA 1W5CC 2ZBKA 2BZTA 5GPAA 4AUXA 1VQ7I 1WPKA 2HQRA 1MMDA 3J80K 3NARA 2Z99A 3QP5A 4NNJA 1U5TA 1WJAA 3AFHA 3WU2C 2X6OA 2R5YB 1MGTA 3OYLA 4DZPA 2MH9A 1T33A 2X6XA 3DEEA 2ECBA 4HF0A 4HX7A 4YIIA 4M9XA 2K9MA 1SAUA 2H8RA 3S15J 2HFHA 1D1CA 2QWWA 4HG2A 3GTLJ 2M3AA 1WJDA 5FKKA 4DBQA 4KIFA 2ZCWA 4BDZA
chains in the Genus database with same CATH topology
3L09A 4I98B 1BC7C 5KVRA 4L9VA 2D1HA 2M5WA 3WGIA 3WTZA 5ICEA 2PEXA 1SD6A 3GFIA 2UZKA 4YIFA 2BV6A 2CO5A 1HBXG 5L3FA 1UFMA 3WTUC 4FHTA 1IRFA 4AIKA 3CO6C 2VN2A 3RYRA 2P5LC 2Z9OA 3IKTA 3V8KA 1G3SA 3M9AA 4ON0A 5HLIA 2H6CA 2FOKA 3ZMUA 1BI3A 1PP8F 4HLYA 2VC1A 4AIHA 1UCRA 4QWQA 1F1ZA 1QBJA 2XVCA 1FT9A 1FPQA 3WGGA 1MZBA 4KIBA 1U3EM 4UVBA 3BJAA 3E6MA 4ZYDA 5A2QZ 4N0BA 1ONVA 4ZZDA 4HZFA 5DD4A 3OOPA 1B4AA 2PBIA 4IRIA 1DPUA 3WODF 2EK5A 1LNWA 2CG4A 3RKYA 4A0XA 5HS7A 4HDUA 5DDGA 3R60A 4M71A 1S8NA 4RB0A 1ZLJA 2R7DA 2HEOA 2FE3A 3KEQA 3BWGA 4U0WA 3V7RA 2DBBA 5ED4A 2G7HA 4K2EA 4GGGA 1IZ1A 2DAOA 3KZZA 2PLYA 3R0AA 1P4WA 1IXSB 4MTEA 2JT1A 4EJWA 1O3TA 3GWZA 1LDJA 2MA3A 3F8CA 3LQRA 2P4WA 2QBYA 1B9MA 4MQ9F 3MFKA 1WSUA 2QQ9A 3VODA 2GQQA 5LRRA 3P9CA 1VTNC 2GXBA 2OZUA 3QPTA 4MEYF 3Q9SA 1DP7P 5BPIA 2IJLA 5LGTA 4F7ZA 2FMLA 4G94A 2F5EA 2DK5A 1P6RA 3T8TA 2W85A 1KQ0A 1I6XA 3EYYA 4HX8A 2VC0A 4IRHA 3K2ZA 1OYWA 3OV8A 2OU2A 3JSOA 3E5UA 2XAFA 3ZMDA 2B0LA 4MQVA 3K1PA 2QBYB 1FC3A 3F8BA 3GEZA 3ZPLA 4FX4A 2LF7A 5HDGA 2UXNA 4KMFA 2PMUA 2JTVA 3T8RA 5AIQA 3NQOA 1XMKA 4LJZF 2W84A 3KLOA 1AOYA 3VFZA 1STZA 2V1DA 2EA2A 1XN7A 1FNNA 3GVAA 3K1MA 3E6DA 1NHAA 2F5CA 2P5VA 4BQAA 3QP6A 3K1NA 3SZPA 4B8XA 1O3QA 2ELHA 3V8LA 3CUQA 4S04A 4EM0B 3U2RA 3PQJA 5BMZA 3K9TA 2EFOA 4EVIA 3RDIA 1I1SA 3C1DA 3FM5A 2UXXA 4CHUA 2RC4A 5LLQA 1XDSA 4A5MA 2STWA 1O7LA 1R7JA 1W7PB 4I7HA 2RNJA 2L02A 2E7WA 3FZVA 3HIFA 1ON1A 3BJOA 2W24A 1YTYA 2CYYA 3O6BB 1XSVA 3CUQB 1KGSA 2FBIA 2XV4S 3I71A 3P7NA 4EJTA 3WTWC 1LJ9A 2OAZA 2WWYA 2W25A 1IN5A 2FBKA 5L3EA 4I09A 4GYIA 2M45A 2DQRA 4I0AA 4BNCA 2HYGD 1BBYA 2QVOA 5FLXK 2BYVE 3LWFA 1HSTA 2IA1A 2RKHA 4Y13A 2JRTA 4EGZA 5ICCA 4A5NA 5DCFA 4IRGA 4PGGA 4RS8A 2K7LA 2HTSA 1R23A 1TW3A 3R0JA 3VEPA 1SD7A 5E18F 3ML6A 4M73A 4LLNA 2P7CB 4Q48A 3MQ0A 2F5FA 2DLLA 5H6RA 4LG0A 2STTA 1G4DA 5IT3A 2A6HF 4JQFA 5CYVA 3BROA 2XKOA 2XUBA 3BZ6A 3IKVA 3HRUA 5KK1A 5D5XB 3GO5A 2H94A 1GHCA 3TO9A 5BPDA 4I2OA 2ZO4A 2WTEA 1LEAA 1S7OA 4JK1X 1RZ4A 1BOAA 3COAC 2FNAA 4FT8A 1QZZA 1B59A 5F1RA 4LG0B 4WCGA 1MJAA 3LAPA 4KICA 1KQ8A 2E1CA 4UV9A 3BDDA 1P92A 2K86A 2J5PA 5HLGA 4ESJA 3K69A 3AAFA 4P9FA 2XAGA 3D0SA 4GXOA 2ETHA 1K7AA 5HVQC 2CFXA 1FBUA 4FX0A 4YFNF 3FX3A 3TDZC 3F8MA 2K02A 3QOPA 4NHJA 3CJNA 6PAXA 5E8GA 4ZH4F 2YX7A 1TQMA 1WKMA 4XSXF 4KA4A 2VE8A 1ZARA 2NS0A 3NRVA 4LB6B 5FLXZ 2DTRA 5LGUA 4RGSA 2NAZA 3DF8A 2NRAC 3GFMA 4Q4ZF 5DEQA 2QZ8A 1Z91A 1EH7A 3H92A 2CQKA 3FM3A 1V4RA 5A2QK 1KU2A 4UV8A 1ULYA 1J0RA 1U6GA 1EV7A 4N9HA 1ZLKA 1FBQA 3NEUA 2ZKZA 3M8EA 2D1VA 3EYIA 2FMYA 1ZH5A 1S6LA 5FFXA 4OIRF 2FQ3A 2L3DA 5DV5A 1MJ9A 2XAQA 2FBHA 4UVAA 2DQLA 5AIPA 2O3FA 3F6VA 3N4MA 3TOAA 4YFXF 5F64A 4XBFA 3RKWA 4CDGA 4U7BA 3RKXA 2O0YA 1SFEA 1OYYA 4M6YA 5LEKA 2YR2A 3PFIA 3T0YA 2EB7A 1XB4A 3BY6A 1IN7A 1T38A 3HTUA 2ISYA 3GFJA 5D6EA 5AONA 2GA1A 2VOOA 1JGSA 3ZN0A 3TDUC 2DI3A 3QPHA 4CYDA 4EGYA 1D5VA 3ROUA 4KT5C 4EM2A 2YPRA 3BP8A 2Y0MA 4ZYGA 2DFIA 1IN8A 2HDCA 1B1BA 5D8LB 1Z7UA 1MDMB 4AVPA 3B73A 2FNPA 4G9YA 1SD5A 2A68F 3WTVC 4ESFA 5E20A 1T2KA 1R5GA 4L9NA 3IRQA 3ELKA 1FOKA 2HYFA 3KLNA 2H27A 5LRSA 2KIMA 3T1BA 1RUOA 2ISZA 5D8KB 4M6XA 1HW5A 4G7HF 3FXUA 5LHHA 3DEUA 4M72A 1TLHB 1SD4A 1XD7A 5FFZA 4EJOA 3LAJA 2LKPA 1ZGJA 1U5TB 3BJ6A 4HDVA 4OIQF 2IP2A 1KYZA 3GLXA 2ZFWA 3EQLF 5ERIA 2IPQX 1YS7A 1E17A 2GWRA 1OPCA 1KU3A 2A5YB 5LGNA 1DDNA 1RUNA 2Y75A 5LEJA 1ZGAA 1HQCA 2L01A 2AXLA 2FF4A 3I53A 4M9SA 4BHCA 4PDKA 4CICA 3LA2A 4HBLA 4PZJA 1FZPB 2LSOA 2ZXJA 3GF2A 1T39A 3VOEA 2QLZA 2HOEA 2D45A 2XHKA 3JSPA 1AWCA 3FMQA 2IRFG 4M74A 4LGWA 4RB3C 1XDUA 3CUQC 1SMYF 1ZRCA 1YS6A 3DPLC 4G6QA 1D8KA 4L5IA 1I1GA 4KUMA 5E1XA 1HW1A 2VT3A 1QNTA 2XAJA 4BYYA 5L3BA 4L5JA 2P5KA 3W6KB 1BIBA 1IN4A 5FB2A 1RNLA 3BPVA 2ADUA 2EFPA 2O03A 3F72A 3GZ5A 5FO5A 3IL2A 5K5QA 4Z2YA 2FRHA 4HAMA 1P4XA 2JPCA 1W5SA 3CTAA 3C18A 4BH9A 3P9KA 2K4BA 5HS8A 3IC7A 5FD5A 2RN7A 1SMTA 3EDPA 2IT0A 5H20A 3FHZA 2OD5A 2RGVA 2DPUA 4NB5A 2KIUA 2V6CA 3REOA 4HQEA 4LLLA 4G6DA 5TJJA 1A04A 4DQ2A 4HYEA 4MEXF 2XROA 1PUEE 5ILSA 5HS9A 1L0OC 4G7OF 3O2PE 2TDXA 1XCBA 1PP7U 4AD9A 2HR3A 1OR7A 4R8HA 5BS6A 2XGXA 1KYWA 1T98A 1ZREA 1FX7A 2HKOA 4LLGF 1D8JA 2QQBA 1JE8A 3LSTA 1U8RA 2XAHA 4B09A 1TNSA 1W5TA 5IT9Z 3TO6A 2L54A 2V9VA 3JAMK 2OA4A 3DP7A 3ABUA 2MD5A 1WQ2A 1KU7A 2Y48A 4OMZA 2A61A 2D2WA 2IA0A 4Q47A 3U1DA 4RB2C 1J9IA 3G3ZA 1QZYA 4GO1A 1O3SA 3M1EA 3V7CA 3IWFA 2V1UA 4HQMA 2MBFA 1BM9A 4XSZF 4ZYHA 5DCMA 3L9FA 2XRNA 4M9ZA 3HHHA 1KQ9A 2LDUA 4HV5A 3KP7A 1USSA 2M8EA 2L4AA 2FEZA 5JVTA 3WTYC 1F9NA 3MEXA 2H6BA 3SXYA 2IVMA 2MH2A 5J8FA 3E6CC 5BQTA 5DCMB 5FD6A 5L3GA 2P7VB 3LFKA 3ZMZA 3MWMA 1BJAA 1QQIA 3TO7A 1X3UA 2L4MA 4D0PA 2EA4A 4I02A 5D5VB 1GVJA 3SQNA 3LA7A 5K5RA 4L18B 1FYLA 3GW2A 4U0VA 3HRSA 4GCVA 1RIOH 1L3LA 4HF2A 3ECOA 1P4AA 5DYMA 3R4KA 4RB1A 1F4KA 3IRRA 3RI4A 1S7AA 1TW2A 4ASNA 3ZMTA 3I59A 2EV0A 3GXOA 4AWXB 2O8XA 2BGCA 2FSWA 1YQAA 3C7JA 3DV8A 4EQQA 1E2XA 3WU0A 2Q2EA 2QENA 2A6EF 2DPDA 3HSFA 4LMYA 3JAMZ 3O3KA 2ACJA 4HV6A 3N97A 3WTXC 3HSEA 1LB2A 1H0MA 2P6TA 2X4HA 1HKQA 1P2FA 2Q0OA 1BI1A 1U5TC 2EWNA 2M87A 5HOOA 2ZMEA 3I59B 3DQVC 2VE9A 4BXUA 3KP6A 4UUVA 5J8CA 3R6SA 3I58A 1MJBA 2QM3A 5CVUA 4NQWA 1TNTA 3KP5A 4A0ZA 1OYIA 5JR3A 4L0YB 4BHBA 3KP3A 4P55A 5CVIA 1XMAA 3ZN1A 4PCQA 5J6XA 5EEGA 2HS5A 2C6YA 2CW0F 2RVCA 3HTSB 3F6OA 3ZP5A 2OZ6A 3GFLA 1RI7A 2PI0A 2ZMEB 2PQ8A 3WE3A 1ZAOA 5DUKA 3KEOA 2LNBA 4WX9A 5F6FA 4P96A 5ICGA 4U88A 4KNYA 4HA8A 1YW9A 3F22A 4G7ZF 4QLCU 1JHFA 4MHGA 1ZG3A 1LQ1A 1YW7A 3HHGA 3ULQB 4DNCA 4AIJA 1FYKA 4IVNA 5K1YA 1ZRFA 4UXNA 4XLPF 4P9UA 1HSJA 2M30A 1R1VA 5FGMA 2P6SA 1XGSA 1FP1D 2KJBA 3JTGA 3KFWX 1T6SA 4LK1F 1QGPA 4MTDA 3V4GA 1CF7A 1G3WA 3WE2A 1FYMA 5L3CA 5ILVA 1I27A 1J5YA 1Z6TA 4Y15A 4YG2F 4ESBA 3LQQA 3J81K 4HLXA 1OKRA 2HQNA 3T5XA 2E1NA 1K78A 1XGOA 1XSXA 1R22A 4EJUA 4EV0A 3I64A 4RAYA 2PJPA 3RTRA 3DFGA 2P8TA 3VB2A 4KYWA 5LHIA 5CVJA 2VBXA 3ECHA 4TV7A 4PGHA 2NYXA 1CF7B 3QAHA 2RDPA 3H3UA 4GYGA 1Z1DA 4Q5SF 4A6DA 2FXAA 4OIOF 1USTA 2F5DA 4IJAA 2OQGA 3BPXA 4KMUX 1K78B 3E5XA 1HKSA 1Z6RA 3RYPA 2KIFA 4CXFA 1TTYA 5D5UB 2G7UA 3C3WA 3FMRA 2HTJA 2RQPA 2MLGA 4ENMA 3CLOA 3K0LA 5EEHA 1FP2A 3ISPA 2VBZA 1ODDA 1ZYRF 2ZNYA 4RGRA 1IF1A 2Z3YA 3IHUA 2O6GE 2EFWA 5IT9K 1Z05A 3Q5FA 1PDNC 3KP2A 2R7FA 3JW4A 1LEBA 1R00A 2Z5UA 2KRFA 1B9NA 4ZYEA 3I4PA 3E97A 4OIPF 1YIOA 2K4JA 3W6JB 5JFRA 2MC3A 2IW5A 2JSCA 4L9JA 2GXGA 5JI6A 1TBXA 2JPBA 3CDHA 2BBYA 1KA8A 1YG2A 1YLFA 1CGPA 5D5WB 2IA2A 2NNNA 2DU9A 2EV6A 4WWCA 1JHHA 3J81Z 4LFUA 4XLNF 4R79A 4WXHA 4EJVA 3I0TA 4CGZA 4BHPA 1I5ZA 4YFKF 5TRDA 4XRFA 1H9TA 2GIVA 3HOTA 3M8FA 4Y17A 1B6AA 1ZRDA 1O3RA 1H9GA 1R1UA 4ENKA 5HDNA 3MAJA 3J80Z 2NNYA 4LD5A 4UVCA 1IW7F 5CVRA 4ETSA 2Z33A 1FWZA 1YW8A 1G3YA 4ENJA 3F8NA 1FSHA 4UNOA 2ESNA 2GA2A 3ABTA 1IAWA 4OOIA 1R5HA 1TQPA 3GX4X 4JBAA 5H6QA 3MCZA 1UB9A 2OQRA 4E70A 4KN4X 2A69F 1BN5A 2BE5F 2MLKA 5D6FA 1YO5C 4O3MA 3WTSC 2QQAA 4WXDA 1V3FA 4I0BA 1Q1HA 3LA3A 2EFQA 3FWEA 3JTHA 5ILUA 4RGXA 2XIGA 3DXJF 3SZTA 1WRJA 3KCCA 4U0YA 5DD8A 3CUOA 1Z9CA 4MGRA 3HOSA 1QPMA 2XKPA 3MZYA 3PQKA 3HRMA 3TQNA 4WF2A 1D3YA 2A3SA 3RPUA 1W7PA 3IWZA 1W4MA 2DW4A 4RGUA 5LBQA 1XSDA 1HKTA 3HYIA 5BOXA 1OMIA 4OMYA 1S29A 3E3VA 4OU0A 2X0LA 4N9IA 2VOPA 3D5LA 4I01A 3Q9VA 3F8FA 4BAYA 4LK0F 2HZTA 4S05A 4KIGA 4CZZA 3FF5A 3SFZA 1LDKB 3V8JA 4A12A 3QU3A 2HKXA 1Y0UA 5CJ9A 2KJCA 5DUIA 1UHWA 1YYVA 3R61A 2CGPA 1IRGA 1FBSA 4HOBA 2FA5A 1G6NA 3U9GA 2KKOA 1LVAA 4H0EA 3I54A 2V1XA 2UWMA 1HXDA 1W7PD 4HW0A 2K27A 1WWXA 4L0ZB 1HW2A 4CO8A 4U7DA 1J59A 2JZYA 3GUDA 4IHTA 4ZZLA 3E5QA 1DPRA 3FXQA 5E1WA 2QUFA 1GXPA 4EMSA 3GZ6A 5HDKA 1EH8A 1FLIA 2ZNZA 1J75A 2VODA 2DK8A 1MKMA 1ZN2A 3KETA 2J5OA 2QYOA 3V7SA 2COMA 2DO7A 2ESHA 2E7XA 4KN7X 1ON2A 4L9TA 1J7KA 4RAZA 2Q8KA 4UHTA 2RV8A 3TGNA 2ZJ2A 1FY7A 2VBYA 5K5OA 2WV0A 4A2UA 3H3ZA 2O61A 1SAXA 3GYHX 3J7AO 2R3SA 5E1ZB 1O57A 4IF4A 3DPTA 4IXAA 1ZG5A 4OINF 3WG9A 3BOQA 3CO7C 3S2WA 3E6BA 2YSRA 2WC2A 4P5OA 1FSEA 4WXCA 1UHMA 5D4RA 1LDDA 2YX4A 1O7FA 2PN6A 2DT5A 3WGHA 2PG4A 3I5UA 3FXRA 2OBPA 3RIRA 3RJPA 2EV5A 1ZHFA 1JXSA 1K79A 2GZWA 4EM1A 4O6JA 5CVVA 3P9IA 3EUHA 4ENNA 1BIAA 2HWVA 3WTTC 1BI0A 1R58A 1REPC 3ZMVA 2AS5F 2W57A 5E8IA 2V79A 2YU3A 2PFBA 1G3TA 1U78A 3M7GA 4O5VA 2EJRA 3L2CA 2VT2A 2CSOA 1J2XA 2XASA 4IHSA 1BI2A 3G73A 3EETA 3MZHA 3WU1B 4LB5A 3KP4A 2F2EA 1F5TA 5D4SA 3SHFA 3F23A 1U2WA 2BEOA 1GXQA 1IUYA 2VONA 4IPAA 3HSRA 2H09A 4MNUA 5JHUA 3HRTA 1TQIA 3FMSA 1YFHA 5HLHA 1IXRC 4KFCA 4A0YA 4R1HA 1MD0A 3TKYA 2GAUA 2A07F 1KU9A 2LF8A 1ZG1A 1IN6A 1XGNA 1SFUA 1R1TA 2EFNA 3L7WA 2G9WA 3KE2A 1T0FA 5ICFA 1XCVA 5L3DA 1XGMA 1SFXA 3KZYA 3HUGA 3F3XA 3ERED 1K6OA 1QO0D 1BC8C 3ZMSA 3TOBA 1WI9A 2PMHA 3L00A 3RPQA 4HX4A 3F21A 3ZQ7A 1MDMA 1IXCA 3B02A 4KDPA 3DKWA 1DUXC 1C0WA 4HF1A 2M1BA 2VBWA 3QU6A 2VXZA 4G8XA 5E17F 2HGCA 4A6EA 5LHGA 1R36A 2CWEA 5CLSA 4WK8F 2FU4A 1S3JA 1EH6A 3QRFF 2ZBKA 2HQRA 3J80K 2Z99A 3QP5A 1U5TA 1MGTA 2MH9A 4HF0A 4HX7A 4YIIA 4M9XA 2HFHA 2QWWA 4KIFA 2ZCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L09 A;  4I98 B;  1BC7 C;  5KVR A;  4L9V A;  2D1H A;  2M5W A;  3WGI A;  3WTZ A;  5ICE A;  2PEX A;  1SD6 A;  3GFI A;  2UZK A;  4YIF A;  2BV6 A;  2CO5 A;  1HBX G;  5L3F A;  1UFM A;  3WTU C;  4FHT A;  1IRF A;  4AIK A;  3CO6 C;  2VN2 A;  3RYR A;  2P5L C;  2Z9O A;  3IKT A;  3V8K A;  1G3S A;  3M9A A;  4ON0 A;  5HLI A;  2H6C A;  2FOK A;  3ZMU A;  1BI3 A;  1PP8 F;  4HLY A;  2VC1 A;  4AIH A;  1UCR A;  4QWQ A;  1F1Z A;  1QBJ A;  2XVC A;  1FT9 A;  1FPQ A;  3WGG A;  1MZB A;  4KIB A;  1U3E M;  4UVB A;  3BJA A;  3E6M A;  4ZYD A;  5A2Q Z;  4N0B A;  1ONV A;  4ZZD A;  4HZF A;  5DD4 A;  3OOP A;  1B4A A;  2PBI A;  4IRI A;  1DPU A;  3WOD F;  2EK5 A;  1LNW A;  2CG4 A;  3RKY A;  4A0X A;  5HS7 A;  4HDU A;  5DDG A;  3R60 A;  4M71 A;  1S8N A;  4RB0 A;  1ZLJ A;  2R7D A;  2HEO A;  2FE3 A;  3KEQ A;  3BWG A;  4U0W A;  3V7R A;  2DBB A;  5ED4 A;  2G7H A;  4K2E A;  4GGG A;  1IZ1 A;  2DAO A;  3KZZ A;  2PLY A;  3R0A A;  1P4W A;  1IXS B;  4MTE A;  2JT1 A;  4EJW A;  1O3T A;  3GWZ A;  1LDJ A;  2MA3 A;  3F8C A;  3LQR A;  2P4W A;  2QBY A;  1B9M A;  4MQ9 F;  3MFK A;  1WSU A;  2QQ9 A;  3VOD A;  2GQQ A;  5LRR A;  3P9C A;  1VTN C;  2GXB A;  2OZU A;  3QPT A;  4MEY F;  3Q9S A;  1DP7 P;  5BPI A;  2IJL A;  5LGT A;  4F7Z A;  2FML A;  4G94 A;  2F5E A;  2DK5 A;  1P6R A;  3T8T A;  2W85 A;  1KQ0 A;  1I6X A;  3EYY A;  4HX8 A;  2VC0 A;  4IRH A;  3K2Z A;  1OYW A;  3OV8 A;  2OU2 A;  3JSO A;  3E5U A;  2XAF A;  3ZMD A;  2B0L A;  4MQV A;  3K1P A;  2QBY B;  1FC3 A;  3F8B A;  3GEZ A;  3ZPL A;  4FX4 A;  2LF7 A;  5HDG A;  2UXN A;  4KMF A;  2PMU A;  2JTV A;  3T8R A;  5AIQ A;  3NQO A;  1XMK A;  4LJZ F;  2W84 A;  3KLO A;  1AOY A;  3VFZ A;  1STZ A;  2V1D A;  2EA2 A;  1XN7 A;  1FNN A;  3GVA A;  3K1M A;  3E6D A;  1NHA A;  2F5C A;  2P5V A;  4BQA A;  3QP6 A;  3K1N A;  3SZP A;  4B8X A;  1O3Q A;  2ELH A;  3V8L A;  3CUQ A;  4S04 A;  4EM0 B;  3U2R A;  3PQJ A;  5BMZ A;  3K9T A;  2EFO A;  4EVI A;  3RDI A;  1I1S A;  3C1D A;  3FM5 A;  2UXX A;  4CHU A;  2RC4 A;  5LLQ A;  1XDS A;  4A5M A;  2STW A;  1O7L A;  1R7J A;  1W7P B;  4I7H A;  2RNJ A;  2L02 A;  2E7W A;  3FZV A;  3HIF A;  1ON1 A;  3BJO A;  2W24 A;  1YTY A;  2CYY A;  3O6B B;  1XSV A;  3CUQ B;  1KGS A;  2FBI A;  2XV4 S;  3I71 A;  3P7N A;  4EJT A;  3WTW C;  1LJ9 A;  2OAZ A;  2WWY A;  2W25 A;  1IN5 A;  2FBK A;  5L3E A;  4I09 A;  4GYI A;  2M45 A;  2DQR A;  4I0A A;  4BNC A;  2HYG D;  1BBY A;  2QVO A;  5FLX K;  2BYV E;  3LWF A;  1HST A;  2IA1 A;  2RKH A;  4Y13 A;  2JRT A;  4EGZ A;  5ICC A;  4A5N A;  5DCF A;  4IRG A;  4PGG A;  4RS8 A;  2K7L A;  2HTS A;  1R23 A;  1TW3 A;  3R0J A;  3VEP A;  1SD7 A;  5E18 F;  3ML6 A;  4M73 A;  4LLN A;  2P7C B;  4Q48 A;  3MQ0 A;  2F5F A;  2DLL A;  5H6R A;  4LG0 A;  2STT A;  1G4D A;  5IT3 A;  2A6H F;  4JQF A;  5CYV A;  3BRO A;  2XKO A;  2XUB A;  3BZ6 A;  3IKV A;  3HRU A;  5KK1 A;  5D5X B;  3GO5 A;  2H94 A;  1GHC A;  3TO9 A;  5BPD A;  4I2O A;  2ZO4 A;  2WTE A;  1LEA A;  1S7O A;  4JK1 X;  1RZ4 A;  1BOA A;  3COA C;  2FNA A;  4FT8 A;  1QZZ A;  1B59 A;  5F1R A;  4LG0 B;  4WCG A;  1MJA A;  3LAP A;  4KIC A;  1KQ8 A;  2E1C A;  4UV9 A;  3BDD A;  1P92 A;  2K86 A;  2J5P A;  5HLG A;  4ESJ A;  3K69 A;  3AAF A;  4P9F A;  2XAG A;  3D0S A;  4GXO A;  2ETH A;  1K7A A;  5HVQ C;  2CFX A;  1FBU A;  4FX0 A;  4YFN F;  3FX3 A;  3TDZ C;  3F8M A;  2K02 A;  3QOP A;  4NHJ A;  3CJN A;  6PAX A;  5E8G A;  4ZH4 F;  2YX7 A;  1TQM A;  1WKM A;  4XSX F;  4KA4 A;  2VE8 A;  1ZAR A;  2NS0 A;  3NRV A;  4LB6 B;  5FLX Z;  2DTR A;  5LGU A;  4RGS A;  2NAZ A;  3DF8 A;  2NRA C;  3GFM A;  4Q4Z F;  5DEQ A;  2QZ8 A;  1Z91 A;  1EH7 A;  3H92 A;  2CQK A;  3FM3 A;  1V4R A;  5A2Q K;  1KU2 A;  4UV8 A;  1ULY A;  1J0R A;  1U6G A;  1EV7 A;  4N9H A;  1ZLK A;  1FBQ A;  3NEU A;  2ZKZ A;  3M8E A;  2D1V A;  3EYI A;  2FMY A;  1ZH5 A;  1S6L A;  5FFX A;  4OIR F;  2FQ3 A;  2L3D A;  5DV5 A;  1MJ9 A;  2XAQ A;  2FBH A;  4UVA A;  2DQL A;  5AIP A;  2O3F A;  3F6V A;  3N4M A;  3TOA A;  4YFX F;  5F64 A;  4XBF A;  3RKW A;  4CDG A;  4U7B A;  3RKX A;  2O0Y A;  1SFE A;  1OYY A;  4M6Y A;  5LEK A;  2YR2 A;  3PFI A;  3T0Y A;  2EB7 A;  1XB4 A;  3BY6 A;  1IN7 A;  1T38 A;  3HTU A;  2ISY A;  3GFJ A;  5D6E A;  5AON A;  2GA1 A;  2VOO A;  1JGS A;  3ZN0 A;  3TDU C;  2DI3 A;  3QPH A;  4CYD A;  4EGY A;  1D5V A;  3ROU A;  4KT5 C;  4EM2 A;  2YPR A;  3BP8 A;  2Y0M A;  4ZYG A;  2DFI A;  1IN8 A;  2HDC A;  1B1B A;  5D8L B;  1Z7U A;  1MDM B;  4AVP A;  3B73 A;  2FNP A;  4G9Y A;  1SD5 A;  2A68 F;  3WTV C;  4ESF A;  5E20 A;  1T2K A;  1R5G A;  4L9N A;  3IRQ A;  3ELK A;  1FOK A;  2HYF A;  3KLN A;  2H27 A;  5LRS A;  2KIM A;  3T1B A;  1RUO A;  2ISZ A;  5D8K B;  4M6X A;  1HW5 A;  4G7H F;  3FXU A;  5LHH A;  3DEU A;  4M72 A;  1TLH B;  1SD4 A;  1XD7 A;  5FFZ A;  4EJO A;  3LAJ A;  2LKP A;  1ZGJ A;  1U5T B;  3BJ6 A;  4HDV A;  4OIQ F;  2IP2 A;  1KYZ A;  3GLX A;  2ZFW A;  3EQL F;  5ERI A;  2IPQ X;  1YS7 A;  1E17 A;  2GWR A;  1OPC A;  1KU3 A;  2A5Y B;  5LGN A;  1DDN A;  1RUN A;  2Y75 A;  5LEJ A;  1ZGA A;  1HQC A;  2L01 A;  2AXL A;  2FF4 A;  3I53 A;  4M9S A;  4BHC A;  4PDK A;  4CIC A;  3LA2 A;  4HBL A;  4PZJ A;  1FZP B;  2LSO A;  2ZXJ A;  3GF2 A;  1T39 A;  3VOE A;  2QLZ A;  2HOE A;  2D45 A;  2XHK A;  3JSP A;  1AWC A;  3FMQ A;  2IRF G;  4M74 A;  4LGW A;  4RB3 C;  1XDU A;  3CUQ C;  1SMY F;  1ZRC A;  1YS6 A;  3DPL C;  4G6Q A;  1D8K A;  4L5I A;  1I1G A;  4KUM A;  5E1X A;  1HW1 A;  2VT3 A;  1QNT A;  2XAJ A;  4BYY A;  5L3B A;  4L5J A;  2P5K A;  3W6K B;  1BIB A;  1IN4 A;  5FB2 A;  1RNL A;  3BPV A;  2ADU A;  2EFP A;  2O03 A;  3F72 A;  3GZ5 A;  5FO5 A;  3IL2 A;  5K5Q A;  4Z2Y A;  2FRH A;  4HAM A;  1P4X A;  2JPC A;  1W5S A;  3CTA A;  3C18 A;  4BH9 A;  3P9K A;  2K4B A;  5HS8 A;  3IC7 A;  5FD5 A;  2RN7 A;  1SMT A;  3EDP A;  2IT0 A;  5H20 A;  3FHZ A;  2OD5 A;  2RGV A;  2DPU A;  4NB5 A;  2KIU A;  2V6C A;  3REO A;  4HQE A;  4LLL A;  4G6D A;  5TJJ A;  1A04 A;  4DQ2 A;  4HYE A;  4MEX F;  2XRO A;  1PUE E;  5ILS A;  5HS9 A;  1L0O C;  4G7O F;  3O2P E;  2TDX A;  1XCB A;  1PP7 U;  4AD9 A;  2HR3 A;  1OR7 A;  4R8H A;  5BS6 A;  2XGX A;  1KYW A;  1T98 A;  1ZRE A;  1FX7 A;  2HKO A;  4LLG F;  1D8J A;  2QQB A;  1JE8 A;  3LST A;  1U8R A;  2XAH A;  4B09 A;  1TNS A;  1W5T A;  5IT9 Z;  3TO6 A;  2L54 A;  2V9V A;  3JAM K;  2OA4 A;  3DP7 A;  3ABU A;  2MD5 A;  1WQ2 A;  1KU7 A;  2Y48 A;  4OMZ A;  2A61 A;  2D2W A;  2IA0 A;  4Q47 A;  3U1D A;  4RB2 C;  1J9I A;  3G3Z A;  1QZY A;  4GO1 A;  1O3S A;  3M1E A;  3V7C A;  3IWF A;  2V1U A;  4HQM A;  2MBF A;  1BM9 A;  4XSZ F;  4ZYH A;  5DCM A;  3L9F A;  2XRN A;  4M9Z A;  3HHH A;  1KQ9 A;  2LDU A;  4HV5 A;  3KP7 A;  1USS A;  2M8E A;  2L4A A;  2FEZ A;  5JVT A;  3WTY C;  1F9N A;  3MEX A;  2H6B A;  3SXY A;  2IVM A;  2MH2 A;  5J8F A;  3E6C C;  5BQT A;  5DCM B;  5FD6 A;  5L3G A;  2P7V B;  3LFK A;  3ZMZ A;  3MWM A;  1BJA A;  1QQI A;  3TO7 A;  1X3U A;  2L4M A;  4D0P A;  2EA4 A;  4I02 A;  5D5V B;  1GVJ A;  3SQN A;  3LA7 A;  5K5R A;  4L18 B;  1FYL A;  3GW2 A;  4U0V A;  3HRS A;  4GCV A;  1RIO H;  1L3L A;  4HF2 A;  3ECO A;  1P4A A;  5DYM A;  3R4K A;  4RB1 A;  1F4K A;  3IRR A;  3RI4 A;  1S7A A;  1TW2 A;  4ASN A;  3ZMT A;  3I59 A;  2EV0 A;  3GXO A;  4AWX B;  2O8X A;  2BGC A;  2FSW A;  1YQA A;  3C7J A;  3DV8 A;  4EQQ A;  1E2X A;  3WU0 A;  2Q2E A;  2QEN A;  2A6E F;  2DPD A;  3HSF A;  4LMY A;  3JAM Z;  3O3K A;  2ACJ A;  4HV6 A;  3N97 A;  3WTX C;  3HSE A;  1LB2 A;  1H0M A;  2P6T A;  2X4H A;  1HKQ A;  1P2F A;  2Q0O A;  1BI1 A;  1U5T C;  2EWN A;  2M87 A;  5HOO A;  2ZME A;  3I59 B;  3DQV C;  2VE9 A;  4BXU A;  3KP6 A;  4UUV A;  5J8C A;  3R6S A;  3I58 A;  1MJB A;  2QM3 A;  5CVU A;  4NQW A;  1TNT A;  3KP5 A;  4A0Z A;  1OYI A;  5JR3 A;  4L0Y B;  4BHB A;  3KP3 A;  4P55 A;  5CVI A;  1XMA A;  3ZN1 A;  4PCQ A;  5J6X A;  5EEG A;  2HS5 A;  2C6Y A;  2CW0 F;  2RVC A;  3HTS B;  3F6O A;  3ZP5 A;  2OZ6 A;  3GFL A;  1RI7 A;  2PI0 A;  2ZME B;  2PQ8 A;  3WE3 A;  1ZAO A;  5DUK A;  3KEO A;  2LNB A;  4WX9 A;  5F6F A;  4P96 A;  5ICG A;  4U88 A;  4KNY A;  4HA8 A;  1YW9 A;  3F22 A;  4G7Z F;  4QLC U;  1JHF A;  4MHG A;  1ZG3 A;  1LQ1 A;  1YW7 A;  3HHG A;  3ULQ B;  4DNC A;  4AIJ A;  1FYK A;  4IVN A;  5K1Y A;  1ZRF A;  4UXN A;  4XLP F;  4P9U A;  1HSJ A;  2M30 A;  1R1V A;  5FGM A;  2P6S A;  1XGS A;  1FP1 D;  2KJB A;  3JTG A;  3KFW X;  1T6S A;  4LK1 F;  1QGP A;  4MTD A;  3V4G A;  1CF7 A;  1G3W A;  3WE2 A;  1FYM A;  5L3C A;  5ILV A;  1I27 A;  1J5Y A;  1Z6T A;  4Y15 A;  4YG2 F;  4ESB A;  3LQQ A;  3J81 K;  4HLX A;  1OKR A;  2HQN A;  3T5X A;  2E1N A;  1K78 A;  1XGO A;  1XSX A;  1R22 A;  4EJU A;  4EV0 A;  3I64 A;  4RAY A;  2PJP A;  3RTR A;  3DFG A;  2P8T A;  3VB2 A;  4KYW A;  5LHI A;  5CVJ A;  2VBX A;  3ECH A;  4TV7 A;  4PGH A;  2NYX A;  1CF7 B;  3QAH A;  2RDP A;  3H3U A;  4GYG A;  1Z1D A;  4Q5S F;  4A6D A;  2FXA A;  4OIO F;  1UST A;  2F5D A;  4IJA A;  2OQG A;  3BPX A;  4KMU X;  1K78 B;  3E5X A;  1HKS A;  1Z6R A;  3RYP A;  2KIF A;  4CXF A;  1TTY A;  5D5U B;  2G7U A;  3C3W A;  3FMR A;  2HTJ A;  2RQP A;  2MLG A;  4ENM A;  3CLO A;  3K0L A;  5EEH A;  1FP2 A;  3ISP A;  2VBZ A;  1ODD A;  1ZYR F;  2ZNY A;  4RGR A;  1IF1 A;  2Z3Y A;  3IHU A;  2O6G E;  2EFW A;  5IT9 K;  1Z05 A;  3Q5F A;  1PDN C;  3KP2 A;  2R7F A;  3JW4 A;  1LEB A;  1R00 A;  2Z5U A;  2KRF A;  1B9N A;  4ZYE A;  3I4P A;  3E97 A;  4OIP F;  1YIO A;  2K4J A;  3W6J B;  5JFR A;  2MC3 A;  2IW5 A;  2JSC A;  4L9J A;  2GXG A;  5JI6 A;  1TBX A;  2JPB A;  3CDH A;  2BBY A;  1KA8 A;  1YG2 A;  1YLF A;  1CGP A;  5D5W B;  2IA2 A;  2NNN A;  2DU9 A;  2EV6 A;  4WWC A;  1JHH A;  3J81 Z;  4LFU A;  4XLN F;  4R79 A;  4WXH A;  4EJV A;  3I0T A;  4CGZ A;  4BHP A;  1I5Z A;  4YFK F;  5TRD A;  4XRF A;  1H9T A;  2GIV A;  3HOT A;  3M8F A;  4Y17 A;  1B6A A;  1ZRD A;  1O3R A;  1H9G A;  1R1U A;  4ENK A;  5HDN A;  3MAJ A;  3J80 Z;  2NNY A;  4LD5 A;  4UVC A;  1IW7 F;  5CVR A;  4ETS A;  2Z33 A;  1FWZ A;  1YW8 A;  1G3Y A;  4ENJ A;  3F8N A;  1FSH A;  4UNO A;  2ESN A;  2GA2 A;  3ABT A;  1IAW A;  4OOI A;  1R5H A;  1TQP A;  3GX4 X;  4JBA A;  5H6Q A;  3MCZ A;  1UB9 A;  2OQR A;  4E70 A;  4KN4 X;  2A69 F;  1BN5 A;  2BE5 F;  2MLK A;  5D6F A;  1YO5 C;  4O3M A;  3WTS C;  2QQA A;  4WXD A;  1V3F A;  4I0B A;  1Q1H A;  3LA3 A;  2EFQ A;  3FWE A;  3JTH A;  5ILU A;  4RGX A;  2XIG A;  3DXJ F;  3SZT A;  1WRJ A;  3KCC A;  4U0Y A;  5DD8 A;  3CUO A;  1Z9C A;  4MGR A;  3HOS A;  1QPM A;  2XKP A;  3MZY A;  3PQK A;  3HRM A;  3TQN A;  4WF2 A;  1D3Y A;  2A3S A;  3RPU A;  1W7P A;  3IWZ A;  1W4M A;  2DW4 A;  4RGU A;  5LBQ A;  1XSD A;  1HKT A;  3HYI A;  5BOX A;  1OMI A;  4OMY A;  1S29 A;  3E3V A;  4OU0 A;  2X0L A;  4N9I A;  2VOP A;  3D5L A;  4I01 A;  3Q9V A;  3F8F A;  4BAY A;  4LK0 F;  2HZT A;  4S05 A;  4KIG A;  4CZZ A;  3FF5 A;  3SFZ A;  1LDK B;  3V8J A;  4A12 A;  3QU3 A;  2HKX A;  1Y0U A;  5CJ9 A;  2KJC A;  5DUI A;  1UHW A;  1YYV A;  3R61 A;  2CGP A;  1IRG A;  1FBS A;  4HOB A;  2FA5 A;  1G6N A;  3U9G A;  2KKO A;  1LVA A;  4H0E A;  3I54 A;  2V1X A;  2UWM A;  1HXD A;  1W7P D;  4HW0 A;  2K27 A;  1WWX A;  4L0Z B;  1HW2 A;  4CO8 A;  4U7D A;  1J59 A;  2JZY A;  3GUD A;  4IHT A;  4ZZL A;  3E5Q A;  1DPR A;  3FXQ A;  5E1W A;  2QUF A;  1GXP A;  4EMS A;  3GZ6 A;  5HDK A;  1EH8 A;  1FLI A;  2ZNZ A;  1J75 A;  2VOD A;  2DK8 A;  1MKM A;  1ZN2 A;  3KET A;  2J5O A;  2QYO A;  3V7S A;  2COM A;  2DO7 A;  2ESH A;  2E7X A;  4KN7 X;  1ON2 A;  4L9T A;  1J7K A;  4RAZ A;  2Q8K A;  4UHT A;  2RV8 A;  3TGN A;  2ZJ2 A;  1FY7 A;  2VBY A;  5K5O A;  2WV0 A;  4A2U A;  3H3Z A;  2O61 A;  1SAX A;  3GYH X;  3J7A O;  2R3S A;  5E1Z B;  1O57 A;  4IF4 A;  3DPT A;  4IXA A;  1ZG5 A;  4OIN F;  3WG9 A;  3BOQ A;  3CO7 C;  3S2W A;  3E6B A;  2YSR A;  2WC2 A;  4P5O A;  1FSE A;  4WXC A;  1UHM A;  5D4R A;  1LDD A;  2YX4 A;  1O7F A;  2PN6 A;  2DT5 A;  3WGH A;  2PG4 A;  3I5U A;  3FXR A;  2OBP A;  3RIR A;  3RJP A;  2EV5 A;  1ZHF A;  1JXS A;  1K79 A;  2GZW A;  4EM1 A;  4O6J A;  5CVV A;  3P9I A;  3EUH A;  4ENN A;  1BIA A;  2HWV A;  3WTT C;  1BI0 A;  1R58 A;  1REP C;  3ZMV A;  2AS5 F;  2W57 A;  5E8I A;  2V79 A;  2YU3 A;  2PFB A;  1G3T A;  1U78 A;  3M7G A;  4O5V A;  2EJR A;  3L2C A;  2VT2 A;  2CSO A;  1J2X A;  2XAS A;  4IHS A;  1BI2 A;  3G73 A;  3EET A;  3MZH A;  3WU1 B;  4LB5 A;  3KP4 A;  2F2E A;  1F5T A;  5D4S A;  3SHF A;  3F23 A;  1U2W A;  2BEO A;  1GXQ A;  1IUY A;  2VON A;  4IPA A;  3HSR A;  2H09 A;  4MNU A;  5JHU A;  3HRT A;  1TQI A;  3FMS A;  1YFH A;  5HLH A;  1IXR C;  4KFC A;  4A0Y A;  4R1H A;  1MD0 A;  3TKY A;  2GAU A;  2A07 F;  1KU9 A;  2LF8 A;  1ZG1 A;  1IN6 A;  1XGN A;  1SFU A;  1R1T A;  2EFN A;  3L7W A;  2G9W A;  3KE2 A;  1T0F A;  5ICF A;  1XCV A;  5L3D A;  1XGM A;  1SFX A;  3KZY A;  3HUG A;  3F3X A;  3ERE D;  1K6O A;  1QO0 D;  1BC8 C;  3ZMS A;  3TOB A;  1WI9 A;  2PMH A;  3L00 A;  3RPQ A;  4HX4 A;  3F21 A;  3ZQ7 A;  1MDM A;  1IXC A;  3B02 A;  4KDP A;  3DKW A;  1DUX C;  1C0W A;  4HF1 A;  2M1B A;  2VBW A;  3QU6 A;  2VXZ A;  4G8X A;  5E17 F;  2HGC A;  4A6E A;  5LHG A;  1R36 A;  2CWE A;  5CLS A;  4WK8 F;  2FU4 A;  1S3J A;  1EH6 A;  3QRF F;  2ZBK A;  2HQR A;  3J80 K;  2Z99 A;  3QP5 A;  1U5T A;  1MGT A;  2MH9 A;  4HF0 A;  4HX7 A;  4YII A;  4M9X A;  2HFH A;  2QWW A;  4KIF A;  2ZCW A; 
#chains in the Genus database with same CATH topology
 3OYD A;  2H1L A;  3L09 A;  5IOY A;  2LLK A;  4I98 B;  1BC7 C;  3OL4 A;  5KVR A;  4L9V A;  2CRG A;  2D1H A;  1D0X A;  3B6A A;  2M5W A;  4A93 J;  3WGI A;  3WTZ A;  5ICE A;  2PEX A;  3J7A Y;  1SD6 A;  3G1O A;  4KJZ A;  1XPX A;  2XC7 A;  3BR2 A;  4BY7 J;  1I3A A;  3GFI A;  2UZK A;  1F43 A;  2DFE A;  2HQ5 A;  3ZGK A;  3HL2 A;  4YIF A;  1V54 H;  2BV6 A;  4HSR A;  2CO5 A;  1FOW A;  1VF9 A;  3IAM 2;  1HBX G;  3W2V A;  5L3F A;  1UFM A;  4JYK A;  5FKO A;  3MN2 A;  3S2H J;  3WTU C;  4FHT A;  1IRF A;  4Y3O A;  4AIK A;  4ITV A;  3CO6 C;  3VSK A;  2VN2 A;  2GXA A;  3RYR A;  3HJE A;  2P5L C;  2Z9O A;  2L7F P;  4D7N A;  1A31 A;  3IP4 B;  3S2D J;  3IKT A;  3V8K A;  1Z7L A;  1G3S A;  3M9A A;  4ON0 A;  5B5E C;  5HLI A;  2H6C A;  2X48 A;  1R4M B;  2FOK A;  4FAS D;  3ZMU A;  1BI3 A;  1PP8 F;  4ANJ A;  1NK2 P;  4HLY A;  3M3Y J;  2VC1 A;  3KIO A;  4CYC A;  4AIH A;  1UCR A;  2LK2 A;  1OJL A;  4QWQ A;  3GTJ J;  1F1Z A;  1APL C;  1QBJ A;  2XVC A;  1FT9 A;  1FPQ A;  2CV2 A;  3ONQ A;  2DYS H;  3WGG A;  1MZB A;  2IGK A;  3S3O A;  4KIB A;  5M5Y J;  1HDP A;  5C4X J;  5C4J J;  1U3E M;  3BTL A;  4UVB A;  3BJA A;  3E6M A;  4ZYD A;  2BOL A;  4BUP A;  5A2Q Z;  4N0B A;  1ONV A;  4ZZD A;  2KIS A;  4HZF A;  1MBJ A;  5DD4 A;  5HLT A;  3OOP A;  1YJ9 I;  1B4A A;  2PBI A;  2IBD A;  4IRI A;  1DPU A;  3WOD F;  2EK5 A;  1LNW A;  2CG4 A;  3CJQ B;  1MMG A;  2K3P A;  3RKY A;  1R4N B;  4MLO A;  5HS7 A;  4A0X A;  2VPR A;  4B43 A;  1ZGW A;  4II2 A;  4HDU A;  3X2Q H;  4HNU A;  5DDG A;  3UKG A;  2LKS A;  3R60 A;  4M71 A;  3LNQ A;  1QA6 A;  3K4C A;  1S8N A;  3OWT A;  4RB0 A;  1ZLJ A;  2R7D A;  3I9V 2;  2HEO A;  2FE3 A;  4ZDP A;  3KEQ A;  3SDG A;  3BWG A;  1PYV A;  1VQP I;  4U0W A;  1R71 A;  3V7R A;  2DBB A;  5ED4 A;  2G7H A;  4K2E A;  3OYB A;  4GGG A;  1IZ1 A;  2DAO A;  3KZZ A;  5GPC A;  1LFU P;  1MNM C;  1N77 A;  2PLY A;  3R0A A;  1X2N A;  1P4W A;  1IXS B;  4MTE A;  4J19 A;  4I76 A;  2QKM B;  2K9L A;  2V1N A;  2JT1 A;  4EJW A;  3K6G A;  1POG A;  3N05 A;  1O3T A;  3GWZ A;  1LDJ A;  2MA3 A;  3F8C A;  3LQR A;  1TL8 A;  2P4W A;  2Z2S B;  2DMN A;  5EYR A;  2R7V A;  2QBY A;  3K10 A;  3GTP J;  1B9M A;  3W2W A;  4MQ9 F;  3MFK A;  1WSU A;  1RR8 C;  2QQ9 A;  3VOD A;  2GQQ A;  2VUM J;  5LRR A;  2M34 A;  3P9C A;  1VTN C;  2GXB A;  2OZU A;  3QPT A;  5F04 A;  3H9G A;  4MEY F;  1MH3 A;  3Q9S A;  1OLT A;  4XR6 A;  3VYS B;  1DP7 P;  5BPI A;  2IJL A;  3C2H A;  5LGT A;  4F52 A;  5IOZ A;  3H3V K;  1UMQ A;  4F7Z A;  2FML A;  2Y69 H;  1Z77 A;  3RCO A;  4G94 A;  2F5E A;  2M2E A;  1GLN A;  2DK5 A;  1P6R A;  3T8T A;  2W85 A;  1KQ0 A;  3RZD J;  3BTI A;  3HEF A;  1I6X A;  2VIX A;  3CME I;  2MYS A;  3EYY A;  4HX8 A;  2VC0 A;  4IRH A;  2YS9 A;  3K2Z A;  1OYW A;  3OV8 A;  3A2K A;  3DPU A;  1XTA A;  2OU2 A;  4CCO A;  3CCL I;  3GTK J;  3JSO A;  3E5U A;  2OF7 A;  4I6Z A;  3AG2 H;  2XAF A;  4B44 A;  3A0H C;  2B0L A;  4MQV A;  3ZMD A;  4FCY A;  1OFC X;  1VFC A;  3K1P A;  1VI0 A;  2QBY B;  1FC3 A;  3DTE A;  2W7N A;  4PFO A;  2BXZ A;  2WB1 A;  3F8B A;  4YIR X;  2XGD A;  2R7T A;  2KZG A;  3GEZ A;  2QF7 A;  3ZPL A;  4FX4 A;  2KMU A;  3JRB A;  3ERM A;  2W82 A;  2LF7 A;  4QSH A;  4D1Q A;  5HDG A;  4XRM A;  1YIJ I;  4EAT A;  2UXN A;  2DOA A;  4IKF A;  2BHZ A;  1IV6 A;  4KMF A;  2PMU A;  2EIM H;  2XB0 X;  3MKY B;  2JTV A;  3T8R A;  5J4Y A;  5AIQ A;  1YJW I;  1QRY A;  3L2U A;  3JCU C;  2Y0S N;  3NQO A;  4M3F A;  1XMK A;  5DS9 A;  4LJZ F;  2W84 A;  3C2G A;  1V5F A;  3KLO A;  1D1A A;  1AOY A;  3OL3 A;  4GDF A;  2XF6 A;  3PNV A;  3E1S A;  3VFZ A;  1STZ A;  1WH7 A;  2V1D A;  2EA2 A;  1XN7 A;  3BCB A;  3AL0 C;  1FNN A;  1RRJ A;  3GVA A;  2JVG A;  3BTC A;  3E6D A;  3K1M A;  3JR9 A;  1X3W B;  1WJB A;  1NHA A;  2F5C A;  2P5V A;  4IX7 A;  2KP6 A;  3AG4 H;  5IYD J;  4BQA A;  3GME A;  3D1N I;  3GTQ J;  2FUG 2;  2Y31 A;  3QP6 A;  4DJA A;  2B9S A;  2EIL H;  2P81 A;  3K1N A;  3W6V A;  2EIK H;  3SZP A;  4B8X A;  1O3Q A;  2ELH A;  1XG1 A;  3V8L A;  2QSG X;  4B3X A;  2M0M A;  1YE9 A;  3CUQ A;  2IS2 A;  3A1Y A;  4S04 A;  4D7M A;  4EM0 B;  3U2R A;  4S0H B;  3LFU A;  3ZQC A;  3PQJ A;  2R7Q A;  5BMZ A;  1I50 J;  3K9T A;  2Z1D A;  2Y30 A;  2EFO A;  2L5Q A;  4EVI A;  3RDI A;  2MGQ A;  3HKZ A;  3HOU J;  1I1S A;  3EUH C;  3C1D A;  3FM5 A;  4J00 A;  2X9D A;  2UXX A;  2AQF A;  2BY2 A;  4HNT A;  1LFB A;  4CHU A;  1EF4 A;  2RC4 A;  4GFB A;  5LLQ A;  1XDS A;  4MFD A;  4A5M A;  2STW A;  2K5C A;  1O7L A;  4XQF A;  2XGC A;  1N78 A;  1R7J A;  1W7P B;  2R7O A;  4I7H A;  2RNJ A;  2L02 A;  2E7W A;  3FZV A;  3HIF A;  3KYL A;  2V9P A;  5E3O A;  3L2V A;  1ON1 A;  1U9N A;  3FBI B;  1UG0 A;  3BJO A;  2W24 A;  4OAZ A;  1YTY A;  2VJ4 A;  1AA7 A;  2CYY A;  3O6B B;  1XSV A;  3CUQ B;  3QYE A;  5E3M A;  1KGS A;  2OPT A;  2FBI A;  2TRT A;  2XV4 S;  2B63 J;  3I71 A;  3B6C A;  1X2M A;  3P7N A;  4EJT A;  1JT0 A;  3DU5 A;  2JSP A;  3RQI A;  3WTW C;  2VQG A;  2M7A A;  3FK6 A;  1LJ9 A;  2CUF A;  4XKV A;  2OAZ A;  2WWY A;  3C2B A;  2KLO A;  2W25 A;  4AVZ A;  1D5Y A;  5IYC J;  3H0G J;  1IN5 A;  3ESW B;  2FBK A;  5L3E A;  1OCT C;  2ID6 A;  5F0H A;  1Z3Y A;  4I09 A;  4GYI A;  4XLE A;  2M45 A;  3I4M J;  2DQR A;  2HXI A;  4I0A A;  5CQE A;  2X1E A;  1H89 C;  4BNC A;  2HYG D;  2QA4 I;  1N75 A;  5GAD J;  1BBY A;  2QVO A;  5FLX K;  1FTT A;  2HOT A;  2BYV E;  2E19 A;  3LWF A;  5GAH J;  1HST A;  5F08 A;  1WHU A;  2IA1 A;  2RKH A;  4Y13 A;  2JRT A;  1FOY A;  4EGZ A;  5ICC A;  2E1O A;  1TWH J;  2ZXW H;  4A5N A;  4E7L A;  2ZJQ F;  4C3H J;  5DCF A;  4IRG A;  4PGG A;  4RS8 A;  2ECC A;  2K7L A;  2VKV A;  2HTS A;  2RNG A;  3QQA A;  1R23 A;  1YI2 I;  1JGG A;  1TW3 A;  3SZG A;  4RA2 A;  3R0J A;  3VEP A;  4BGD A;  1AKH A;  1SD7 A;  3TP0 A;  2XF7 A;  2DMQ A;  2DDB A;  5E18 F;  1D0Z A;  3ML6 A;  3IH3 A;  1T0F C;  2BVM A;  4M73 A;  4LLN A;  3MZ8 A;  4IOC F;  2K9Q A;  2P7C B;  4Q48 A;  2NVT J;  3CZ6 A;  3MQ0 A;  3I55 I;  2F5F A;  2DLL A;  2E36 A;  5H6R A;  4LG0 A;  2STT A;  3PNT A;  3S3M A;  2BHY A;  2X1D A;  1G4D A;  5IT3 A;  2A6H F;  3H5R A;  5KAF C;  4JQF A;  2MSY A;  2PX9 A;  5CYV A;  1I3Q J;  3QOD A;  1V55 H;  3BRO A;  3OS1 A;  5JLX A;  4ZDO A;  2XKO A;  2XUB A;  3BZ6 A;  3IKV A;  2KT0 A;  3HRU A;  3PJR A;  5KK1 A;  5D5X B;  1FIA A;  3GO5 A;  2H94 A;  3I3L A;  2KRH A;  1GHC A;  3BR0 A;  3HOW J;  3TO9 A;  5BPD A;  4I2O A;  4W97 A;  2ZO4 A;  2IS6 A;  1ETW A;  2WTE A;  1LEA A;  1ETY A;  5FKL A;  2P0W A;  1S7O A;  4JK1 X;  5M3F J;  5EEA A;  1RZ4 A;  1BOA A;  1FIP A;  2WA0 A;  3DLL F;  2KFD A;  1T08 B;  2K85 A;  3COA C;  2X6W A;  3Q0V A;  3D5R C;  3Q3S A;  2FNA A;  4PFP A;  4FT8 A;  1QZZ A;  4NBQ A;  1B59 A;  5F1R A;  4LG0 B;  3LSK A;  4XLC A;  4WCG A;  2DOE A;  2W1O A;  1MJA A;  1SFK A;  3LAP A;  4KIC A;  4H4K C;  3OYK A;  1VZ0 A;  2E1C A;  1KQ8 A;  4UV9 A;  3BDD A;  4XLH A;  4M6V A;  1P92 A;  4B1R A;  2K86 A;  2J5P A;  4U87 A;  4RAG A;  3BR3 A;  3LSP A;  5HLG A;  3CLQ A;  4ESJ A;  1I39 A;  5C44 J;  3BZC A;  4MO7 A;  3ZQF A;  4BU2 A;  3K69 A;  3AAF A;  4P9F A;  2XAG A;  2QCO A;  1YHQ I;  3ZR8 X;  3D0S A;  4GXO A;  2ETH A;  1JKO C;  3W2A A;  3S1N J;  3FXL A;  1GT0 C;  1K7A A;  3M1C A;  5HVQ C;  2CFX A;  1FBU A;  2A5W A;  4FX0 A;  2LH9 A;  3FX3 A;  1OCP A;  4YFN F;  3TDZ C;  4E6K G;  5JHF A;  1XC5 A;  2ID3 A;  3F8M A;  2OJE D;  1B8I A;  2GM4 A;  4NUB A;  4I99 C;  2K02 A;  3GTM J;  1JUS A;  3VYU B;  3WG7 H;  4AYB N;  3QOP A;  3GTG J;  4XOT A;  4NHJ A;  1ORK A;  3CJN A;  6PAX A;  4C9Y A;  1MMS A;  5E8G A;  3JRC A;  3P5J A;  4ZH4 F;  2YX7 A;  1TQM A;  1WI3 A;  1WKM A;  4XSX F;  3MD2 A;  3CC2 I;  4KA4 A;  1F36 A;  2VE8 A;  5B66 C;  1A36 A;  2M0C A;  2F5V A;  2W00 A;  4XIC A;  1ZAR A;  2NS0 A;  3FK7 A;  3NRV A;  3JRE A;  4LB6 B;  1A35 A;  5FLX Z;  2E2I J;  4MIM A;  2DTR A;  2R7S A;  3IH4 A;  2WAQ A;  3BC8 A;  5LGU A;  4RGS A;  2NAZ A;  4NDL A;  1X4P A;  2E5N A;  2DOF A;  2EZL A;  2ZFU A;  3DF8 A;  3EUA A;  1JKQ C;  2EIN H;  2NRA C;  3GFM A;  2D5V A;  4Q4Z F;  5DEQ A;  2QZ8 A;  4F91 B;  1Z91 A;  1EH7 A;  1WZ2 A;  3H92 A;  2OTJ I;  2CQK A;  2V9K A;  1V4R A;  3FKJ A;  3FM3 A;  4QPQ A;  5EF6 A;  5A2Q K;  4G6T B;  2PMZ N;  4LIT A;  2Z16 A;  4X0G A;  1KU2 A;  4UV8 A;  1ULY A;  1J0R A;  1TWF J;  1U6G A;  1EV7 A;  4N9H A;  1ZLK A;  1OCC H;  2NXN B;  1M1E B;  2A05 A;  1FBQ A;  3NEU A;  2BVL A;  2ZKZ A;  1E3O C;  5LD2 C;  3M8E A;  2AQE A;  2D1V A;  1X1A A;  3EYI A;  4BXX J;  2FMY A;  1ZH5 A;  1S6L A;  5FFX A;  4OIR F;  3CD6 I;  1QZE A;  2VQH A;  2FQ3 A;  2L3D A;  5DV5 A;  3ZQQ A;  1MJ9 A;  4RLQ A;  2XAQ A;  2FBH A;  4UVA A;  2LFB A;  1BR1 A;  1X1P A;  3FXJ A;  1E3H A;  2DQL A;  5AIP A;  2F48 A;  1X1B A;  2COB A;  2O3F A;  3F6V A;  5J40 A;  2M4G A;  3A01 B;  1MBK A;  3N4M A;  2DT6 A;  3PUF A;  3TOA A;  3OYF A;  3HZJ A;  4YFX F;  5F64 A;  4XBF A;  3RKW A;  4CDG A;  4U7B A;  3RKX A;  4NC6 A;  2O0Y A;  1SFE A;  1OYY A;  4M6Y A;  3TMO A;  5LEK A;  2YR2 A;  2L7Z A;  4B48 A;  2HOA A;  3PFI A;  3T0Y A;  2EB7 A;  1XB4 A;  1ZKG A;  3BY6 A;  2R93 J;  1IN7 A;  4A3J J;  1T38 A;  3FXM A;  3VDX A;  1HCR A;  4PUS A;  3HTU A;  2JA2 A;  4BE1 A;  2ISY A;  1D1B A;  3GFJ A;  5D6E A;  4XRS A;  5AON A;  3K7A J;  2GA1 A;  2VOO A;  1JGS A;  3ZN0 A;  3TDU C;  2DI3 A;  3QPH A;  4CYD A;  4EGY A;  1BA5 A;  1U9O A;  2R92 J;  1D5V A;  5J1U A;  5E3N A;  3ROU A;  2FJ1 A;  3Q0U A;  4KT5 C;  4CCL A;  4EM2 A;  2YPR A;  2Y9Z A;  4BAC A;  3CDI A;  3BP8 A;  2DA7 A;  2Y0M A;  2DFI A;  1IN8 A;  4ZYG A;  2HDC A;  1B72 B;  1B1B A;  3G4S I;  3HDD A;  1P7I A;  5D8L B;  2E60 A;  1Z7U A;  1MDM B;  3OOU A;  5K7Z A;  4AVP A;  3B73 A;  3ABK H;  1X19 A;  2FNP A;  4G9Y A;  2MG4 A;  1SD5 A;  1H88 C;  2A68 F;  2WAE A;  4DZJ A;  4ESF A;  3WTV C;  5E20 A;  4RAF A;  1T2K A;  1R5G A;  4L9N A;  3IRQ A;  3ELK A;  1FOK A;  1RES A;  2HYF A;  4BBS J;  1PJR A;  3S32 A;  3IUO A;  3KLN A;  3ZRG A;  4BDY A;  4NC8 A;  2H27 A;  2JRM A;  5LRS A;  2KIM A;  1JKP C;  3T1B A;  5IYB J;  3BR6 A;  1HC8 A;  1RUO A;  2ISZ A;  2XAU A;  5D8K B;  2YU9 J;  4M6X A;  1TT0 A;  1HW5 A;  4G7H F;  3FXU A;  1QHH D;  5LHH A;  3DEU A;  4M72 A;  1WJF A;  1TLH B;  1BOB A;  1SD4 A;  1YX3 A;  3S1R J;  3I4N J;  1XD7 A;  2KQR A;  5FFZ A;  4EJO A;  3LAJ A;  2LKP A;  1ZGJ A;  1U5T B;  2JN6 A;  2RQQ A;  3BJ6 A;  4BY1 J;  4HDV A;  3BG6 A;  4OIQ F;  1GDT A;  2IP2 A;  3ASN H;  1KYZ A;  3GLX A;  2ZFW A;  3EQL F;  2DA2 A;  5ERI A;  4ZDL A;  3K4K A;  4KIS A;  2IPQ X;  1YS7 A;  1E17 A;  2CW8 A;  2AXT C;  2GWR A;  2HVQ A;  1OPC A;  4P1W A;  5EZH A;  1KU3 A;  4YEJ A;  2A5Y B;  5GTH C;  1BR2 A;  2DXI A;  4XN3 A;  1UAA A;  5LGN A;  1DDN A;  1RUN A;  2Y75 A;  5LEJ A;  1ZGA A;  4A3B J;  1HQC A;  2L01 A;  2AXL A;  2FF4 A;  4XID A;  1X3Z B;  3I53 A;  4M9S A;  4BHC A;  4PDK A;  1QHG A;  3JRD A;  3OYI A;  4CIC A;  4DGW B;  2XPW A;  3DLA A;  2E71 A;  3LA2 A;  4HBL A;  4PZJ A;  1FZP B;  2LSO A;  2ZSH B;  2ZXJ A;  1ZEL A;  4M3D A;  2LD5 A;  3GF2 A;  1T39 A;  4ZJZ A;  3VOE A;  3JRI A;  2QLZ A;  2VKE A;  2HOE A;  2D45 A;  3OR2 C;  2DMT A;  2XHK A;  1JT6 A;  3JSP A;  1AWC A;  1VQL I;  4IHY A;  3FMQ A;  2IRF G;  1PUF A;  4M74 A;  4UY8 I;  1OCZ H;  4LGW A;  3CMA I;  1S7E A;  4RB3 C;  1XDU A;  1FMW A;  3CUQ C;  4YEL A;  1BW6 A;  3DU6 A;  3DKX A;  1SMY F;  3I56 I;  1YS6 A;  1ZRC A;  3FDY A;  3DPL C;  4G6Q A;  4CYC B;  2OV7 A;  4E7J A;  2VKD A;  3OYA A;  1D8K A;  4L5I A;  1I1G A;  1K6Y A;  4KUM A;  4L5E A;  5E1X A;  1HW1 A;  2OTL I;  2VB6 A;  2VT3 A;  1QNT A;  2OCC H;  4J01 A;  4FET A;  5GP9 A;  1TWG J;  2CUJ A;  2XAJ A;  4BYY A;  5L3B A;  4C2U A;  4L5J A;  1X58 A;  4ZC3 A;  1HDD C;  2P5K A;  1KON A;  3W6K B;  1BIB A;  2HVR A;  1NTC A;  1K61 A;  1IN4 A;  1RNL A;  5FB2 A;  3BPV A;  2ADU A;  2EFP A;  2O03 A;  3F72 A;  3GZ5 A;  4PJL A;  5FO5 A;  3IL2 A;  5FRM A;  3HG9 A;  2VQL A;  1ETV A;  5K5Q A;  2VL8 A;  3H5N A;  2HZD A;  4Z2Y A;  4N4N B;  2FRH A;  4HAM A;  3FBN B;  1P4X A;  1VND A;  2JPC A;  2DT7 B;  1W5S A;  1V5E A;  3CTA A;  2NVQ J;  4Y52 J;  4PJM A;  4C3J J;  4E7H A;  1G2H A;  3C18 A;  1RC9 A;  3FKI J;  4BH9 A;  3H36 A;  3P9K A;  2K4B A;  5HS8 A;  3FXK A;  1J09 A;  3CP8 A;  3IC7 A;  5FD5 A;  5KCM A;  2RN7 A;  2ZSI B;  3PIP F;  4JX6 A;  2QSF X;  1SMT A;  3EDP A;  2IT0 A;  5H20 A;  3FHZ A;  1VQK I;  2OD5 A;  2RGV A;  2DPU A;  2PJR A;  4NB5 A;  2KIU A;  4CSW A;  2V6C A;  3REO A;  4HQE A;  4BJ6 C;  4LLL A;  1NG6 A;  1ETK A;  1JI8 A;  4G6D A;  5TJJ A;  1A04 A;  4DQ2 A;  1VQ4 I;  3L2Q A;  3JRG A;  4HYE A;  4MEX F;  3CDL A;  5EDN A;  2XRO A;  3L1P A;  3QPL A;  5ILS A;  1PUE E;  3TBI A;  5HS9 A;  5J1R A;  3PSF A;  1L0O C;  4ZYA A;  4PJN A;  4XMY A;  3H35 A;  2JK3 A;  1S9H A;  5JLW A;  3O2P E;  2TDX A;  4G7O F;  1XCB A;  1PP7 U;  5IP7 J;  2TCT A;  2HR3 A;  4AD9 A;  2FD5 A;  1OR7 A;  4R8H A;  2NVU B;  5BS6 A;  4XKW A;  2NOJ B;  2VLA A;  3PSI A;  2DTZ A;  5J3L A;  2XGX A;  1KYW A;  1T98 A;  3IH2 A;  5F27 A;  1ZRE A;  2PJR B;  4AID A;  3DWL E;  1FX7 A;  2HKO A;  2CV0 A;  3QYF A;  3MKZ A;  4Z6Y A;  4LLG F;  2VQC A;  3IV5 A;  2ZC2 A;  1D8J A;  2QQB A;  4XN0 A;  3JRH A;  4A3G J;  1JE8 A;  3LST A;  1U8R A;  2VJI A;  1RET A;  4A3E J;  1GUU A;  2XAH A;  3F9K A;  4B09 A;  1TNS A;  1W5T A;  3TW6 A;  5M3M J;  3TO6 A;  5IT9 Z;  2L54 A;  2V9V A;  3BTJ A;  3JAM K;  2OA4 A;  3DP7 A;  3BG3 A;  3ABU A;  4LIU A;  4C2T A;  3CF2 A;  4RM2 A;  1X1D A;  4BJT A;  5FJ8 J;  2MD5 A;  3LSI A;  3SEQ A;  3OY9 A;  1IDZ A;  1WQ2 A;  1KU7 A;  2Y48 A;  4OMZ A;  2A61 A;  3OS2 A;  2D2W A;  3OYE A;  4D5C A;  1SC7 A;  2IA0 A;  3FIS A;  4Q47 A;  3U1D A;  2R0Q C;  2WY8 Q;  4RB2 C;  2CQ7 A;  1J9I A;  4EEF G;  3G3Z A;  2ZJR F;  1QZY A;  5KAI C;  4GO1 A;  1O3S A;  3M1E A;  1TT5 B;  4G12 A;  3V7C A;  2O7O A;  3IWF A;  3MMY B;  2V1U A;  2LTP A;  4HQM A;  2MBF A;  1BM9 A;  4XSZ F;  4BL0 B;  4ZYH A;  5DCM A;  3L9F A;  3K70 C;  2XRN A;  4CUG A;  4A3K J;  4M9Z A;  3HHH A;  1Y6I A;  4JX4 A;  4UUS A;  1GVD A;  4HST A;  1KQ9 A;  3ASO H;  1Z21 A;  2DJN A;  2R7X A;  2LDU A;  4HV5 A;  3ZXS A;  2G0E A;  3KP7 A;  2L9V A;  1K83 J;  3S16 J;  1USS A;  4JP0 A;  4CCJ A;  2M8E A;  2L4A A;  2BXY A;  2FEZ A;  2NS8 A;  1DQU A;  2L9N A;  2XPU A;  5JVT A;  4IHV A;  3WTY C;  3S1M J;  1G59 A;  9ANT A;  3LOC A;  3GBG A;  1F9N A;  2DA4 A;  3MEX A;  1JTX A;  2H6B A;  1FMV A;  2LKX A;  1ZR2 A;  4FE7 A;  3SXY A;  1YOV B;  4DYR A;  1Y1V J;  2X6Y A;  3VYT B;  2IVM A;  2MH2 A;  5J8F A;  3H0D A;  2IEK A;  4BE0 A;  1R9T J;  3E6C C;  3E7L A;  4KT6 A;  5BQT A;  2CJJ A;  1T56 A;  3TP3 A;  5JVG F;  2NS7 A;  2K9N A;  5DCM B;  4CCN A;  5FD6 A;  5L3G A;  4XOR A;  5IY5 H;  2V26 A;  2P7V B;  3LFK A;  3ZMZ A;  2E2J J;  5J47 A;  3MWM A;  5HNF A;  1BJA A;  1QQI A;  2LBF A;  4UUS B;  3TO7 A;  5H2F C;  5CKT A;  1X3U A;  2L4M A;  2QGU A;  2F4I A;  1MBE A;  4D0P A;  2EA4 A;  4I02 A;  5D5V B;  4ZTF A;  1GVJ A;  1YX5 A;  1TZL A;  3LA7 A;  4PK4 A;  3SQN A;  2O5R A;  5K5R A;  4L18 B;  1IGN A;  1FYL A;  3GW2 A;  2JUC A;  4U0V A;  2V4J C;  3QPS A;  2Y0S A;  1XX5 A;  3HRS A;  4GCV A;  1RIO H;  1DGW Y;  1L3L A;  1WFX A;  4HF2 A;  5CPR B;  3RSN A;  2VI6 A;  4BEH A;  2DDA A;  2AHQ A;  3ECO A;  3VYR B;  2E35 A;  3LSH A;  1P4A A;  5DYM A;  3R4K A;  4LG3 A;  4RB1 A;  1F4K A;  3IRR A;  3RI4 A;  1Y39 A;  1S7A A;  2BY3 A;  2LRD A;  3OSG A;  1TW2 A;  3PO3 J;  3S14 J;  2LBF B;  3JRF A;  4ASN A;  3BG9 A;  2IS4 A;  2A6T A;  1LFP A;  3ZMT A;  3I59 A;  2EV0 A;  3GXO A;  2GOM A;  4AWX B;  2O8X A;  3MVP A;  2BGC A;  2FSW A;  2UV1 A;  3GCM A;  5DTD A;  1YQA A;  3C7J A;  1SFO J;  3DV8 A;  4XNF A;  4EQQ A;  3PNY A;  4X1E A;  3G1M A;  1E2X A;  5J4V A;  3WU0 A;  1AKH B;  2Q2E A;  2QEN A;  2A6E F;  1IRX A;  2DPD A;  2WY7 Q;  3HSF A;  4LMY A;  2NVY J;  3JAM Z;  1W0U A;  3O3K A;  4PSW A;  2ACJ A;  4HV6 A;  3Q0W A;  4BQO A;  3N97 A;  3WTX C;  2JA8 J;  4V2G A;  2EBI A;  3HSE A;  1LB2 A;  1H0M A;  1VQM I;  3DBH B;  2P6T A;  4CH7 A;  4BEH B;  5IPA A;  2X4H A;  1T8I A;  3O8G A;  1HKQ A;  2M8G X;  3ABM H;  1YIT I;  3CCJ I;  2I10 A;  1P2F A;  2IAI A;  4F92 B;  2Q0O A;  4IZZ A;  3SJM A;  1BI1 A;  1U5T C;  3BCA A;  4XON A;  2EWN A;  2M87 A;  5HOO A;  3CCS I;  2R7U A;  3CMM A;  2MFZ A;  2ZME A;  4BE2 A;  3I59 B;  5EGO A;  3DQV C;  2VE9 A;  1OCO H;  4BXU A;  3KP6 A;  4UUV A;  5J8C A;  3KX2 A;  2B7E A;  4OAY A;  2HXO A;  3R6S A;  2NOG A;  3I58 A;  1EJ9 A;  1MJB A;  1EKE A;  2QM3 A;  5CVU A;  4NQW A;  1PVE A;  1TNT A;  3KP5 A;  2IGM A;  4A0Z A;  1OYI A;  2L7M P;  5JR3 A;  4L0Y B;  1A6Q A;  4BHB A;  4CCK A;  5B1A H;  3KP3 A;  4P55 A;  2V6E A;  5CVI A;  4IQJ A;  3HOV J;  1XMA A;  3OIP A;  3M07 A;  3M8J A;  3ZN1 A;  4PCQ A;  5J6X A;  5EEG A;  4DBR A;  2HS5 A;  4ABZ A;  1YRN A;  5IP6 A;  5FKN A;  2GBY A;  2C6Y A;  2K40 A;  3HXL A;  3NAU A;  2CW0 F;  3U1K A;  2RVC A;  3HTS B;  5GAE J;  1JJ6 C;  3F6O A;  3ZP5 A;  1MSE C;  4M3G A;  4RM3 A;  5FLV A;  1I6H J;  2QQ8 A;  2OZ6 A;  3ZCO A;  1Q1V A;  3K4B A;  3GFL A;  1MNE A;  3JRA A;  1RI7 A;  3CC7 I;  4DW6 A;  2PI0 A;  3G71 I;  2DCE A;  2RRE A;  3H1C A;  2ZME B;  1Y8R B;  3ZOB A;  2PQ8 A;  1WH5 A;  2HNH A;  3WE3 A;  1FOX A;  1ZAO A;  5DUK A;  3KEO A;  2LNB A;  4WX9 A;  5F6F A;  3OYH A;  4P96 A;  5ICG A;  4U88 A;  2R7R A;  1CQT A;  2QKL B;  4KNY A;  4HA8 A;  2JVH A;  3BR1 A;  1YW9 A;  1UZC A;  5CQG A;  3F22 A;  2CV1 A;  4BQN A;  1IJW C;  1B8I B;  1VQ6 I;  4G7Z F;  4QLC U;  1JHF A;  3VSL A;  1E3P A;  4MHG A;  1YRN B;  2WV1 A;  1ZG3 A;  5J1Y A;  1LQ1 A;  1YW7 A;  3U21 A;  3HHG A;  3ULQ B;  2F6C A;  4DNC A;  4AIJ A;  4Y7N J;  1FYK A;  4IVN A;  2HI3 A;  5K1Y A;  1ZRF A;  4JX5 A;  3QWL A;  4RBO A;  4A3D J;  4UXN A;  3OIO A;  4XLP F;  5FLM J;  2EZK A;  4P9U A;  2BY0 A;  1HSJ A;  1NH3 A;  2M30 A;  1NK3 P;  1R1V A;  5FGM A;  2P6S A;  1XGS A;  1BR4 A;  1FP1 D;  5DM6 F;  4QTR A;  2FQ4 A;  2IXS A;  4IEJ A;  2FOW A;  2KJB A;  2L9S A;  3JTG A;  3PIO F;  1SVL A;  4B47 A;  3GLL A;  3KFW X;  2QEX I;  4IOA F;  2I8D A;  1T6S A;  3KEY A;  4LK1 F;  2R5Z A;  1QGP A;  4AC0 A;  4MTD A;  4LIV A;  1SVO A;  4A3C J;  3V4G A;  4E7S A;  1X1C A;  1HLV A;  4DIQ A;  2Y9Y A;  1CF7 A;  4RMN A;  1G3W A;  3WE2 A;  2JUG A;  1FYM A;  5L3C A;  2JA6 J;  2IGO A;  1WVR A;  4XRS G;  2GIZ A;  5TIS C;  2HDW A;  1N25 A;  5ILV A;  4JOM A;  1IDY A;  4E7I A;  1QU3 A;  2IGN A;  1IUF A;  1I27 A;  1J5Y A;  1Z6T A;  4Y15 A;  2R5Y A;  4YG2 F;  3BQY A;  1R49 A;  4ESB A;  3LQQ A;  1ITY A;  4IQ4 A;  4IO9 F;  3J81 K;  1A5J A;  4LOC A;  1LE8 A;  4HLX A;  1OKR A;  2HQN A;  3T5X A;  1DU0 A;  2E1N A;  1K78 A;  3J7Y J;  1XGO A;  1XSX A;  1MSF C;  1GV5 A;  1R22 A;  4EJU A;  4EV0 A;  3I64 A;  3PM1 A;  4RAY A;  2PJP A;  3RTR A;  3DKY A;  2MC4 A;  3CCM I;  1EA3 A;  2P8T A;  3DFG A;  3VB2 A;  4KYW A;  3WHB A;  3HPH A;  2CUE A;  5DM7 F;  5LHI A;  2R5Z B;  3QOE A;  5CVJ A;  5EZG A;  1LPQ A;  2VBX A;  3ECH A;  1VQ8 I;  4TV7 A;  4PGH A;  2NYX A;  1CF7 B;  3QAH A;  2L9R A;  3HGY A;  2Y2Z A;  2RDP A;  4FQG A;  4HNV A;  2XB5 A;  3HC7 A;  3PUB A;  3H3U A;  1TC3 C;  4GYG A;  3KPH A;  1Z1D A;  5F0F A;  4Q5S F;  3A4C A;  3DBL B;  4A6D A;  2CQX A;  3H9Q A;  2FXA A;  4OIO F;  2CQQ A;  2WBM A;  3ZQG A;  1VQN I;  3A03 A;  1UST A;  1LE8 B;  2F5D A;  4IJA A;  5B1B H;  1ETO A;  3ZQH A;  3HPG A;  3HOY J;  2OQG A;  1IO2 A;  2LG4 A;  3BPX A;  4KMU X;  4D5F A;  1K78 B;  4AYB A;  2VJ5 A;  2VXD A;  1RR7 A;  3E5X A;  1HKS A;  2ZXH A;  3KZI C;  3CCV I;  1Z6R A;  3RYP A;  3CCE I;  2KIF A;  3CQZ J;  2WB1 N;  4CXF A;  3K4M A;  1TTY A;  5D5U B;  3RQ4 A;  2G7U A;  3VWB A;  3OSF A;  3FXO A;  1HF0 A;  3C3W A;  3FMR A;  1IRZ A;  1Z0X A;  2JA5 J;  2HTJ A;  1MMN A;  2RQP A;  4PJJ A;  5GAG J;  1OR7 C;  2ZJP F;  2DA6 A;  2MLG A;  3CMY A;  4ENM A;  2LY9 A;  3CLO A;  3G6E I;  3MKW B;  3K0L A;  3KYC B;  5EEH A;  1FP2 A;  3ZQL A;  1WCM J;  3ISP A;  2VBZ A;  1ODD A;  4HEA 2;  4DYQ A;  1ZYR F;  1UHS A;  2ZNY A;  3SDB A;  3DCF A;  4RGR A;  1IF1 A;  1K4T A;  4A3L J;  2PMZ A;  2X51 A;  4BKX A;  2Z3Y A;  3IHU A;  1VQ9 I;  2O6G E;  2EFW A;  5IT9 K;  1DGR M;  2DMP A;  2LVS A;  1Z05 A;  3Q5F A;  1PDN C;  3KP2 A;  4A3M J;  2R7F A;  3BR5 A;  3JW4 A;  1LEB A;  4PSX A;  2DYR H;  1LUJ B;  3HBL A;  1R00 A;  2UUZ A;  2Z5U A;  2KRF A;  4E7K A;  1B9N A;  3HM5 A;  2FX0 A;  4ZYE A;  1VQ5 I;  3I4P A;  3E97 A;  4X6A J;  2JJ7 A;  2ME0 A;  2YUS A;  3OS0 A;  4OIP F;  3OR1 C;  1YIO A;  1OIS A;  2H8W A;  2K4J A;  3W6J B;  4KIT B;  5JFR A;  1W36 D;  3TED A;  3TW7 A;  2MC3 A;  2IW5 A;  2JSC A;  2KHM A;  4L9J A;  2GXG A;  2RAE A;  2OCE A;  5JI6 A;  4V2F A;  3CCU I;  2KRC A;  3OYM A;  1TBX A;  2JPB A;  4UUT A;  2F4O B;  2W4S A;  1QPI A;  2HVS A;  2R7Z J;  3VPR A;  3CDH A;  2BBY A;  1KA8 A;  1YG2 A;  1YLF A;  1CGP A;  2O9L A;  3HKZ N;  3BZK A;  4AM3 A;  5D5W B;  2IA2 A;  3CJR B;  4C2M J;  1FJL A;  2NNN A;  2DU9 A;  4BQQ A;  2HPM A;  3OYN A;  2EV6 A;  4WWC A;  1JHH A;  3J81 Z;  4LFU A;  1JUM A;  4XLN F;  5EG0 A;  4R79 A;  1PUF B;  4BJ5 C;  4WXH A;  4EJV A;  3I0T A;  4CGZ A;  2IS1 A;  1FEX A;  4BHP A;  1I5Z A;  1P9Q C;  4YFK F;  4XRF A;  5TRD A;  1H9T A;  2GIV A;  4RLF A;  4HRI A;  3K4L A;  1VQO I;  2ZXI A;  3CCR I;  1JTY A;  2R7W A;  1BW5 A;  3HOT A;  3M8F A;  4C3I J;  2R4G A;  2MW8 A;  1B6A A;  4Y17 A;  3FHN A;  2O8K A;  3SEZ A;  1ZRD A;  1TWC J;  4FTH A;  3OMY A;  1O3R A;  1H9G A;  2E1M B;  1R1U A;  3A0B C;  2ME6 A;  4ENK A;  3SYT A;  5HDN A;  2EIJ H;  3MAJ A;  3J80 Z;  1K4S A;  1BJZ A;  2NNY A;  2QSH X;  4LD5 A;  3CC4 I;  4UVC A;  5LFA A;  1IW7 F;  2NVX J;  5BNG A;  2CUZ A;  5KHD A;  5CVR A;  3EPZ A;  1FTZ A;  1Y56 A;  5EG0 B;  4ETS A;  2EZI A;  3TL4 X;  1ZK8 A;  4C30 A;  2Z33 A;  1FWZ A;  1YW8 A;  5E3L A;  1G3Y A;  3CES A;  3F8N A;  5M5W J;  4ENJ A;  1FSH A;  2LP0 A;  4UNO A;  2ESN A;  2GA2 A;  3ABT A;  1IAW A;  4OOI A;  5GTI C;  1R5H A;  1A6I A;  1TQP A;  3GX4 X;  2XSJ C;  4JBA A;  5H6Q A;  1IC8 A;  1WJ5 A;  3MCZ A;  1UB9 A;  3CCQ I;  1BL0 A;  2KZV A;  2OQR A;  4GRI A;  1ENH A;  2F4M B;  2GOX B;  4E70 A;  5K7H A;  5C3E J;  4CZC A;  4KN4 X;  1UJ8 A;  2A69 F;  1QVU A;  3L2W A;  1BN5 A;  2BE5 F;  3DBR B;  2ELK A;  2MLK A;  5D6F A;  1YO5 C;  4O3M A;  2LRE A;  3WTS C;  2QQA A;  4WXD A;  1SEU A;  1V3F A;  4I0B A;  1Q1H A;  3LA3 A;  2EFQ A;  3FWE A;  3JTH A;  5ILU A;  4RGX A;  3FIW A;  2X85 A;  2XIG A;  3D5S C;  4XLA A;  3DXJ F;  3RZO J;  3SZT A;  2LR8 A;  1WRJ A;  1MMA A;  3KCC A;  1TP4 A;  1E0E A;  4U0Y A;  1Y8Q B;  5DD8 A;  1AHD P;  2KPM A;  3CUO A;  2XGE A;  1Z9C A;  4MGR A;  3HOS A;  1QPM A;  2XKP A;  4CCM A;  3V42 A;  3MZY A;  2XSD C;  3QYB A;  3PQK A;  1OCR H;  4A3F J;  2ZB9 A;  3HRM A;  3TQN A;  3W3C A;  2DA5 A;  4WF2 A;  1TWA J;  1D3Y A;  4XKC A;  2A3S A;  3DEW A;  3O8H A;  1W7P A;  3IWZ A;  3RPU A;  1W4M A;  1R6R A;  2DFH A;  2DW4 A;  4FIS A;  3CP2 A;  4RGU A;  2XF5 A;  4V19 K;  4XK4 A;  2CW7 A;  5LBQ A;  1XSD A;  1HKT A;  3HYI A;  5BOX A;  1OMI A;  1H8A C;  2KL4 A;  1ACI A;  3RKQ A;  1WJE A;  1T95 A;  2CH0 A;  4OMY A;  1S29 A;  3WHC A;  2XDV A;  2LC2 A;  2CQN A;  3E3V A;  1Y0N A;  2X0L A;  4OU0 A;  4N9I A;  1XS9 A;  4NC7 A;  2VOP A;  3D5L A;  2HQA A;  4I01 A;  4M3E A;  1D0Y A;  3Q9V A;  3F8F A;  1RKW A;  4BAY A;  1JKR C;  1ZR4 A;  5FRO A;  4UB8 C;  2ZME C;  4LK0 F;  2HZT A;  4S05 A;  4KIG A;  4CZZ A;  2DA3 A;  3FF5 A;  3SFZ A;  1LDK B;  3V8J A;  2VAS A;  4A12 A;  3QU3 A;  2HKX A;  2DN0 A;  2LOO A;  1Y0U A;  1RPW A;  5CJ9 A;  4II3 A;  1WJC A;  4A69 C;  2KDO A;  2KJC A;  5EGO B;  5DUI A;  1UHW A;  3S93 A;  2KIQ A;  1YYV A;  1OQY A;  3R61 A;  2CGP A;  2ELJ A;  2K3F A;  3S17 J;  1IRG A;  1FBS A;  2ICW G;  4HOB A;  3MKL A;  2FA5 A;  3GZN B;  2MAB A;  3CCY A;  1G6N A;  3U9G A;  3LSG A;  1R5I D;  2KKO A;  1LVA A;  4H0E A;  2LYC A;  3I54 A;  2V1X A;  5EJC A;  1ZQ3 P;  3K4N A;  2I5U A;  2UWM A;  2VPL A;  1HXD A;  4XM3 A;  3F0C A;  1W7P D;  3RPU D;  3HOX J;  4HW0 A;  1U8B A;  4N4O B;  5KNL A;  3DTK A;  1U0J A;  2K27 A;  3ABL H;  1WWX A;  4L0Z B;  5F1J A;  5B3S H;  1JUP A;  1NG7 A;  3BG5 A;  3LSJ A;  2LMD A;  3EUK L;  4E4H A;  1HW2 A;  2H1K A;  4CO8 A;  4IHX A;  1IV8 A;  4OWR B;  3ZQI A;  4U7D A;  2EH3 A;  1KZH A;  1J59 A;  2GLO A;  4XLF A;  1ERD A;  1QVT A;  1MBH A;  2JZY A;  3GUD A;  3LSR A;  4IHT A;  4ZZL A;  3BLY A;  3E5Q A;  1DPR A;  2DMU A;  3FXQ A;  2CFO A;  5E1W A;  1O4X A;  1MW7 A;  1G8X A;  2WAQ N;  2QUF A;  1GXP A;  4E7Z A;  3LSM A;  4EMS A;  2N8G A;  3GZ6 A;  1UG2 A;  1EH8 A;  5HDK A;  2ZNZ A;  3NWS A;  1J75 A;  4BXF A;  2DK8 A;  2VOD A;  1MKM A;  1FLI A;  3OIQ A;  3H5A A;  1DP3 A;  3A02 A;  2DA1 A;  1ZN2 A;  3S8P A;  1RKT A;  4BS9 A;  2HYJ A;  3KET A;  2M9H A;  2J5O A;  2QYO A;  3UR3 C;  2OUM A;  3V7S A;  4B4C A;  2X1C A;  2COM A;  2DO7 A;  2ESH A;  2E7X A;  4KN7 X;  1ON2 A;  4L9T A;  1S72 I;  1J7K A;  4RAZ A;  1W1W E;  1YJN I;  1GV2 A;  3PFY A;  2Q8K A;  4UHT A;  2RV8 A;  2JQ7 A;  3TGN A;  2ZJ2 A;  3PO2 J;  1FY7 A;  2VBY A;  5K5O A;  2WV0 A;  4PJ0 C;  2HOS A;  2MD0 A;  4A2U A;  1LKX A;  3H3Z A;  2O61 A;  1SAX A;  3GYH X;  3J7A O;  2R3S A;  3OYJ A;  5E1Z B;  1O57 A;  3UNG C;  4IF4 A;  2LY1 A;  3DPT A;  4IXA A;  1ZG5 A;  4F93 B;  1HA8 A;  2BW3 A;  4OIN F;  3WG9 A;  3BOQ A;  5E79 C;  4D9J A;  4IL6 C;  1HOM A;  3HOZ J;  3AKZ A;  3CO7 C;  3S2W A;  3E6B A;  2YSR A;  4FE4 A;  2WC2 A;  3NWT A;  1XMX A;  3IAS 2;  4P5O A;  1FSE A;  4WXC A;  1UHM A;  2BY1 A;  5D4R A;  1MIJ A;  1LDD A;  2YX4 A;  1ZTR A;  1O7F A;  2PN6 A;  2DT5 A;  3WGH A;  2KDZ A;  3H9J A;  2PG4 A;  3I5U A;  3FXR A;  1Z67 A;  2OBP A;  3PL8 A;  3RIR A;  2AO9 A;  2EV5 A;  3RJP A;  1ZHF A;  1JXS A;  1K79 A;  2CS3 A;  2GZW A;  4EM1 A;  3BT9 A;  4O6J A;  1IG7 A;  5CVV A;  3P9I A;  3EUH A;  4ENN A;  1BIA A;  2HWV A;  3E0J B;  1P7J A;  3WTT C;  1BI0 A;  1R58 A;  2E34 A;  1REP C;  4M3B A;  2DOD A;  4YRV A;  3K2A A;  3ZMV A;  4DOZ A;  2W57 A;  2AS5 F;  3J7Z I;  2Q1Z B;  3L2R A;  3AL0 B;  2Q2E B;  4BBR J;  5E8I A;  2V79 A;  2YU3 A;  5HOD A;  1ETQ A;  2PFB A;  1G3T A;  2EPF A;  2K9S A;  1U78 A;  3M7G A;  4O5V A;  1Z3X A;  3KYD B;  2OC6 A;  2BW3 B;  2EJR A;  1MBG A;  2VJJ A;  2VT2 A;  3L2C A;  2CSO A;  1J2X A;  4XKB A;  1MND A;  2XAS A;  4QIW N;  4IHS A;  4RDU A;  1BI2 A;  3CJT B;  3G73 A;  3EET A;  3MZH A;  4F55 A;  4CA0 A;  3SFI A;  2L2O A;  3WU1 B;  4LB5 A;  1MBF A;  3KP4 A;  3BQZ A;  2F2E A;  2VKH A;  1V5G A;  1F5T A;  4MFE A;  5D4S A;  3SHF A;  1W36 C;  1WGX A;  5K7F A;  3F23 A;  3BG7 A;  1U2W A;  2BEO A;  1GXQ A;  3CF5 F;  1W0T A;  1IUY A;  2VON A;  4NQW B;  2EQR A;  1DU6 A;  4ZTJ A;  4IPA A;  3HSR A;  3G1L A;  2H09 A;  4DYC A;  3S1Q J;  4MNU A;  5JHU A;  3HRT A;  1TQI A;  3FMS A;  3LL7 A;  3HB9 A;  2JMW A;  1Y1W J;  1YFH A;  3K4J A;  3OYC A;  5HLH A;  2JA7 J;  3A01 A;  1JJ8 C;  1IXR C;  2M4K A;  4KFC A;  4Y4R A;  4A0Y A;  4R1H A;  1MD0 A;  2L0K A;  3TKY A;  2GAU A;  2JWT A;  2A07 F;  1KU9 A;  2LF8 A;  3S3N A;  1UEL B;  1ZG1 A;  5M5X J;  3K70 D;  5FRN A;  3M4O J;  2EZH A;  1IN6 A;  1XGN A;  4B3A A;  1SFU A;  4F3Q A;  2WAD A;  4IHW A;  2XPV A;  1R1T A;  1SVM A;  5HNH A;  2EFN A;  3L7W A;  2DJI A;  2G9W A;  3KE2 A;  2HU9 A;  1T0F A;  5F0C A;  2M7B A;  5ICF A;  3AG1 H;  1XCV A;  5L3D A;  1S5L C;  3DTI A;  1XGM A;  1SFX A;  4W1U A;  4QPO A;  4UB6 C;  2V7F A;  2LY2 A;  3KZY A;  3HUG A;  3F3X A;  2CMP A;  3ERE D;  1K6O A;  4Y33 A;  3AG3 H;  1AU7 A;  1QO0 D;  1BC8 C;  1ETX A;  3ZMS A;  3TOB A;  2E1M C;  1WI9 A;  2PMH A;  2E2H J;  3OYG A;  1B72 A;  3L00 A;  3RPQ A;  2L7K A;  1SAN A;  5IP9 J;  2XRL A;  4HX4 A;  3F21 A;  1LVK A;  3ZQ7 A;  1MDM A;  3HGG A;  1IXC A;  3B02 A;  4KDP A;  3DKW A;  1DUX C;  1C0W A;  2HDD A;  4HF1 A;  2M1B A;  2VBW A;  3QU6 A;  2VXZ A;  4G8X A;  5E17 F;  3G2B A;  1X4O A;  2HGC A;  4AU7 A;  2W48 A;  4A6E A;  2HPI A;  5LHG A;  1R36 A;  2WAF A;  4HPQ A;  2DFF A;  2CWE A;  3LMM A;  5CLS A;  4A3I J;  4WK8 F;  1MH4 A;  2CU7 A;  4XL9 A;  2E5Z A;  2FU4 A;  5TGT A;  3GTO J;  3HUG B;  1S3J A;  1EH6 A;  4XOP A;  3QRF F;  5FKM A;  1W5C C;  2ZBK A;  2BZT A;  5GPA A;  4AUX A;  1VQ7 I;  1WPK A;  2HQR A;  1MMD A;  3J80 K;  3NAR A;  2Z99 A;  3QP5 A;  4NNJ A;  1U5T A;  1WJA A;  3AFH A;  3WU2 C;  2X6O A;  2R5Y B;  1MGT A;  3OYL A;  4DZP A;  2MH9 A;  1T33 A;  2X6X A;  3DEE A;  2ECB A;  4HF0 A;  4HX7 A;  4YII A;  4M9X A;  2K9M A;  1SAU A;  2H8R A;  3S15 J;  2HFH A;  1D1C A;  2QWW A;  4HG2 A;  3GTL J;  2M3A A;  1WJD A;  5FKK A;  4DBQ A;  4KIF A;  2ZCW A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 3L09 A;  4I98 B;  1BC7 C;  5KVR A;  4L9V A;  2D1H A;  2M5W A;  3WGI A;  3WTZ A;  5ICE A;  2PEX A;  1SD6 A;  3GFI A;  2UZK A;  4YIF A;  2BV6 A;  2CO5 A;  1HBX G;  5L3F A;  1UFM A;  3WTU C;  4FHT A;  1IRF A;  4AIK A;  3CO6 C;  2VN2 A;  3RYR A;  2P5L C;  2Z9O A;  3IKT A;  3V8K A;  1G3S A;  3M9A A;  4ON0 A;  5HLI A;  2H6C A;  2FOK A;  3ZMU A;  1BI3 A;  1PP8 F;  4HLY A;  2VC1 A;  4AIH A;  1UCR A;  4QWQ A;  1F1Z A;  1QBJ A;  2XVC A;  1FT9 A;  1FPQ A;  3WGG A;  1MZB A;  4KIB A;  1U3E M;  4UVB A;  3BJA A;  3E6M A;  4ZYD A;  5A2Q Z;  4N0B A;  1ONV A;  4ZZD A;  4HZF A;  5DD4 A;  3OOP A;  1B4A A;  2PBI A;  4IRI A;  1DPU A;  3WOD F;  2EK5 A;  1LNW A;  2CG4 A;  3RKY A;  4A0X A;  5HS7 A;  4HDU A;  5DDG A;  3R60 A;  4M71 A;  1S8N A;  4RB0 A;  1ZLJ A;  2R7D A;  2HEO A;  2FE3 A;  3KEQ A;  3BWG A;  4U0W A;  3V7R A;  2DBB A;  5ED4 A;  2G7H A;  4K2E A;  4GGG A;  1IZ1 A;  2DAO A;  3KZZ A;  2PLY A;  3R0A A;  1P4W A;  1IXS B;  4MTE A;  2JT1 A;  4EJW A;  1O3T A;  3GWZ A;  1LDJ A;  2MA3 A;  3F8C A;  3LQR A;  2P4W A;  2QBY A;  1B9M A;  4MQ9 F;  3MFK A;  1WSU A;  2QQ9 A;  3VOD A;  2GQQ A;  5LRR A;  3P9C A;  1VTN C;  2GXB A;  2OZU A;  3QPT A;  4MEY F;  3Q9S A;  1DP7 P;  5BPI A;  2IJL A;  5LGT A;  4F7Z A;  2FML A;  4G94 A;  2F5E A;  2DK5 A;  1P6R A;  3T8T A;  2W85 A;  1KQ0 A;  1I6X A;  3EYY A;  4HX8 A;  2VC0 A;  4IRH A;  3K2Z A;  1OYW A;  3OV8 A;  2OU2 A;  3JSO A;  3E5U A;  2XAF A;  3ZMD A;  2B0L A;  4MQV A;  3K1P A;  2QBY B;  1FC3 A;  3F8B A;  3GEZ A;  3ZPL A;  4FX4 A;  2LF7 A;  5HDG A;  2UXN A;  4KMF A;  2PMU A;  2JTV A;  3T8R A;  5AIQ A;  3NQO A;  1XMK A;  4LJZ F;  2W84 A;  3KLO A;  1AOY A;  3VFZ A;  1STZ A;  2V1D A;  2EA2 A;  1XN7 A;  1FNN A;  3GVA A;  3K1M A;  3E6D A;  1NHA A;  2F5C A;  2P5V A;  4BQA A;  3QP6 A;  3K1N A;  3SZP A;  4B8X A;  1O3Q A;  2ELH A;  3V8L A;  3CUQ A;  4S04 A;  4EM0 B;  3U2R A;  3PQJ A;  5BMZ A;  3K9T A;  2EFO A;  4EVI A;  3RDI A;  1I1S A;  3C1D A;  3FM5 A;  2UXX A;  4CHU A;  2RC4 A;  5LLQ A;  1XDS A;  4A5M A;  2STW A;  1O7L A;  1R7J A;  1W7P B;  4I7H A;  2RNJ A;  2L02 A;  2E7W A;  3FZV A;  3HIF A;  1ON1 A;  3BJO A;  2W24 A;  1YTY A;  2CYY A;  3O6B B;  1XSV A;  3CUQ B;  1KGS A;  2FBI A;  2XV4 S;  3I71 A;  3P7N A;  4EJT A;  3WTW C;  1LJ9 A;  2OAZ A;  2WWY A;  2W25 A;  1IN5 A;  2FBK A;  5L3E A;  4I09 A;  4GYI A;  2M45 A;  2DQR A;  4I0A A;  4BNC A;  2HYG D;  1BBY A;  2QVO A;  5FLX K;  2BYV E;  3LWF A;  1HST A;  2IA1 A;  2RKH A;  4Y13 A;  2JRT A;  4EGZ A;  5ICC A;  4A5N A;  5DCF A;  4IRG A;  4PGG A;  4RS8 A;  2K7L A;  2HTS A;  1R23 A;  1TW3 A;  3R0J A;  3VEP A;  1SD7 A;  5E18 F;  3ML6 A;  4M73 A;  4LLN A;  2P7C B;  4Q48 A;  3MQ0 A;  2F5F A;  2DLL A;  5H6R A;  4LG0 A;  2STT A;  1G4D A;  5IT3 A;  2A6H F;  4JQF A;  5CYV A;  3BRO A;  2XKO A;  2XUB A;  3BZ6 A;  3IKV A;  3HRU A;  5KK1 A;  5D5X B;  3GO5 A;  2H94 A;  1GHC A;  3TO9 A;  5BPD A;  4I2O A;  2ZO4 A;  2WTE A;  1LEA A;  1S7O A;  4JK1 X;  1RZ4 A;  1BOA A;  3COA C;  2FNA A;  4FT8 A;  1QZZ A;  1B59 A;  5F1R A;  4LG0 B;  4WCG A;  1MJA A;  3LAP A;  4KIC A;  1KQ8 A;  2E1C A;  4UV9 A;  3BDD A;  1P92 A;  2K86 A;  2J5P A;  5HLG A;  4ESJ A;  3K69 A;  3AAF A;  4P9F A;  2XAG A;  3D0S A;  4GXO A;  2ETH A;  1K7A A;  5HVQ C;  2CFX A;  1FBU A;  4FX0 A;  4YFN F;  3FX3 A;  3TDZ C;  3F8M A;  2K02 A;  3QOP A;  4NHJ A;  3CJN A;  6PAX A;  5E8G A;  4ZH4 F;  2YX7 A;  1TQM A;  1WKM A;  4XSX F;  4KA4 A;  2VE8 A;  1ZAR A;  2NS0 A;  3NRV A;  4LB6 B;  5FLX Z;  2DTR A;  5LGU A;  4RGS A;  2NAZ A;  3DF8 A;  2NRA C;  3GFM A;  4Q4Z F;  5DEQ A;  2QZ8 A;  1Z91 A;  1EH7 A;  3H92 A;  2CQK A;  3FM3 A;  1V4R A;  5A2Q K;  1KU2 A;  4UV8 A;  1ULY A;  1J0R A;  1U6G A;  1EV7 A;  4N9H A;  1ZLK A;  1FBQ A;  3NEU A;  2ZKZ A;  3M8E A;  2D1V A;  3EYI A;  2FMY A;  1ZH5 A;  1S6L A;  5FFX A;  4OIR F;  2FQ3 A;  2L3D A;  5DV5 A;  1MJ9 A;  2XAQ A;  2FBH A;  4UVA A;  2DQL A;  5AIP A;  2O3F A;  3F6V A;  3N4M A;  3TOA A;  4YFX F;  5F64 A;  4XBF A;  3RKW A;  4CDG A;  4U7B A;  3RKX A;  2O0Y A;  1SFE A;  1OYY A;  4M6Y A;  5LEK A;  2YR2 A;  3PFI A;  3T0Y A;  2EB7 A;  1XB4 A;  3BY6 A;  1IN7 A;  1T38 A;  3HTU A;  2ISY A;  3GFJ A;  5D6E A;  5AON A;  2GA1 A;  2VOO A;  1JGS A;  3ZN0 A;  3TDU C;  2DI3 A;  3QPH A;  4CYD A;  4EGY A;  1D5V A;  3ROU A;  4KT5 C;  4EM2 A;  2YPR A;  3BP8 A;  2Y0M A;  4ZYG A;  2DFI A;  1IN8 A;  2HDC A;  1B1B A;  5D8L B;  1Z7U A;  1MDM B;  4AVP A;  3B73 A;  2FNP A;  4G9Y A;  1SD5 A;  2A68 F;  3WTV C;  4ESF A;  5E20 A;  1T2K A;  1R5G A;  4L9N A;  3IRQ A;  3ELK A;  1FOK A;  2HYF A;  3KLN A;  2H27 A;  5LRS A;  2KIM A;  3T1B A;  1RUO A;  2ISZ A;  5D8K B;  4M6X A;  1HW5 A;  4G7H F;  3FXU A;  5LHH A;  3DEU A;  4M72 A;  1TLH B;  1SD4 A;  1XD7 A;  5FFZ A;  4EJO A;  3LAJ A;  2LKP A;  1ZGJ A;  1U5T B;  3BJ6 A;  4HDV A;  4OIQ F;  2IP2 A;  1KYZ A;  3GLX A;  2ZFW A;  3EQL F;  5ERI A;  2IPQ X;  1YS7 A;  1E17 A;  2GWR A;  1OPC A;  1KU3 A;  2A5Y B;  5LGN A;  1DDN A;  1RUN A;  2Y75 A;  5LEJ A;  1ZGA A;  1HQC A;  2L01 A;  2AXL A;  2FF4 A;  3I53 A;  4M9S A;  4BHC A;  4PDK A;  4CIC A;  3LA2 A;  4HBL A;  4PZJ A;  1FZP B;  2LSO A;  2ZXJ A;  3GF2 A;  1T39 A;  3VOE A;  2QLZ A;  2HOE A;  2D45 A;  2XHK A;  3JSP A;  1AWC A;  3FMQ A;  2IRF G;  4M74 A;  4LGW A;  4RB3 C;  1XDU A;  3CUQ C;  1SMY F;  1ZRC A;  1YS6 A;  3DPL C;  4G6Q A;  1D8K A;  4L5I A;  1I1G A;  4KUM A;  5E1X A;  1HW1 A;  2VT3 A;  1QNT A;  2XAJ A;  4BYY A;  5L3B A;  4L5J A;  2P5K A;  3W6K B;  1BIB A;  1IN4 A;  5FB2 A;  1RNL A;  3BPV A;  2ADU A;  2EFP A;  2O03 A;  3F72 A;  3GZ5 A;  5FO5 A;  3IL2 A;  5K5Q A;  4Z2Y A;  2FRH A;  4HAM A;  1P4X A;  2JPC A;  1W5S A;  3CTA A;  3C18 A;  4BH9 A;  3P9K A;  2K4B A;  5HS8 A;  3IC7 A;  5FD5 A;  2RN7 A;  1SMT A;  3EDP A;  2IT0 A;  5H20 A;  3FHZ A;  2OD5 A;  2RGV A;  2DPU A;  4NB5 A;  2KIU A;  2V6C A;  3REO A;  4HQE A;  4LLL A;  4G6D A;  5TJJ A;  1A04 A;  4DQ2 A;  4HYE A;  4MEX F;  2XRO A;  1PUE E;  5ILS A;  5HS9 A;  1L0O C;  4G7O F;  3O2P E;  2TDX A;  1XCB A;  1PP7 U;  4AD9 A;  2HR3 A;  1OR7 A;  4R8H A;  5BS6 A;  2XGX A;  1KYW A;  1T98 A;  1ZRE A;  1FX7 A;  2HKO A;  4LLG F;  1D8J A;  2QQB A;  1JE8 A;  3LST A;  1U8R A;  2XAH A;  4B09 A;  1TNS A;  1W5T A;  5IT9 Z;  3TO6 A;  2L54 A;  2V9V A;  3JAM K;  2OA4 A;  3DP7 A;  3ABU A;  2MD5 A;  1WQ2 A;  1KU7 A;  2Y48 A;  4OMZ A;  2A61 A;  2D2W A;  2IA0 A;  4Q47 A;  3U1D A;  4RB2 C;  1J9I A;  3G3Z A;  1QZY A;  4GO1 A;  1O3S A;  3M1E A;  3V7C A;  3IWF A;  2V1U A;  4HQM A;  2MBF A;  1BM9 A;  4XSZ F;  4ZYH A;  5DCM A;  3L9F A;  2XRN A;  4M9Z A;  3HHH A;  1KQ9 A;  2LDU A;  4HV5 A;  3KP7 A;  1USS A;  2M8E A;  2L4A A;  2FEZ A;  5JVT A;  3WTY C;  1F9N A;  3MEX A;  2H6B A;  3SXY A;  2IVM A;  2MH2 A;  5J8F A;  3E6C C;  5BQT A;  5DCM B;  5FD6 A;  5L3G A;  2P7V B;  3LFK A;  3ZMZ A;  3MWM A;  1BJA A;  1QQI A;  3TO7 A;  1X3U A;  2L4M A;  4D0P A;  2EA4 A;  4I02 A;  5D5V B;  1GVJ A;  3SQN A;  3LA7 A;  5K5R A;  4L18 B;  1FYL A;  3GW2 A;  4U0V A;  3HRS A;  4GCV A;  1RIO H;  1L3L A;  4HF2 A;  3ECO A;  1P4A A;  5DYM A;  3R4K A;  4RB1 A;  1F4K A;  3IRR A;  3RI4 A;  1S7A A;  1TW2 A;  4ASN A;  3ZMT A;  3I59 A;  2EV0 A;  3GXO A;  4AWX B;  2O8X A;  2BGC A;  2FSW A;  1YQA A;  3C7J A;  3DV8 A;  4EQQ A;  1E2X A;  3WU0 A;  2Q2E A;  2QEN A;  2A6E F;  2DPD A;  3HSF A;  4LMY A;  3JAM Z;  3O3K A;  2ACJ A;  4HV6 A;  3N97 A;  3WTX C;  3HSE A;  1LB2 A;  1H0M A;  2P6T A;  2X4H A;  1HKQ A;  1P2F A;  2Q0O A;  1BI1 A;  1U5T C;  2EWN A;  2M87 A;  5HOO A;  2ZME A;  3I59 B;  3DQV C;  2VE9 A;  4BXU A;  3KP6 A;  4UUV A;  5J8C A;  3R6S A;  3I58 A;  1MJB A;  2QM3 A;  5CVU A;  4NQW A;  1TNT A;  3KP5 A;  4A0Z A;  1OYI A;  5JR3 A;  4L0Y B;  4BHB A;  3KP3 A;  4P55 A;  5CVI A;  1XMA A;  3ZN1 A;  4PCQ A;  5J6X A;  5EEG A;  2HS5 A;  2C6Y A;  2CW0 F;  2RVC A;  3HTS B;  3F6O A;  3ZP5 A;  2OZ6 A;  3GFL A;  1RI7 A;  2PI0 A;  2ZME B;  2PQ8 A;  3WE3 A;  1ZAO A;  5DUK A;  3KEO A;  2LNB A;  4WX9 A;  5F6F A;  4P96 A;  5ICG A;  4U88 A;  4KNY A;  4HA8 A;  1YW9 A;  3F22 A;  4G7Z F;  4QLC U;  1JHF A;  4MHG A;  1ZG3 A;  1LQ1 A;  1YW7 A;  3HHG A;  3ULQ B;  4DNC A;  4AIJ A;  1FYK A;  4IVN A;  5K1Y A;  1ZRF A;  4UXN A;  4XLP F;  4P9U A;  1HSJ A;  2M30 A;  1R1V A;  5FGM A;  2P6S A;  1XGS A;  1FP1 D;  2KJB A;  3JTG A;  3KFW X;  1T6S A;  4LK1 F;  1QGP A;  4MTD A;  3V4G A;  1CF7 A;  1G3W A;  3WE2 A;  1FYM A;  5L3C A;  5ILV A;  1I27 A;  1J5Y A;  1Z6T A;  4Y15 A;  4YG2 F;  4ESB A;  3LQQ A;  3J81 K;  4HLX A;  1OKR A;  2HQN A;  3T5X A;  2E1N A;  1K78 A;  1XGO A;  1XSX A;  1R22 A;  4EJU A;  4EV0 A;  3I64 A;  4RAY A;  2PJP A;  3RTR A;  3DFG A;  2P8T A;  3VB2 A;  4KYW A;  5LHI A;  5CVJ A;  2VBX A;  3ECH A;  4TV7 A;  4PGH A;  2NYX A;  1CF7 B;  3QAH A;  2RDP A;  3H3U A;  4GYG A;  1Z1D A;  4Q5S F;  4A6D A;  2FXA A;  4OIO F;  1UST A;  2F5D A;  4IJA A;  2OQG A;  3BPX A;  4KMU X;  1K78 B;  3E5X A;  1HKS A;  1Z6R A;  3RYP A;  2KIF A;  4CXF A;  1TTY A;  5D5U B;  2G7U A;  3C3W A;  3FMR A;  2HTJ A;  2RQP A;  2MLG A;  4ENM A;  3CLO A;  3K0L A;  5EEH A;  1FP2 A;  3ISP A;  2VBZ A;  1ODD A;  1ZYR F;  2ZNY A;  4RGR A;  1IF1 A;  2Z3Y A;  3IHU A;  2O6G E;  2EFW A;  5IT9 K;  1Z05 A;  3Q5F A;  1PDN C;  3KP2 A;  2R7F A;  3JW4 A;  1LEB A;  1R00 A;  2Z5U A;  2KRF A;  1B9N A;  4ZYE A;  3I4P A;  3E97 A;  4OIP F;  1YIO A;  2K4J A;  3W6J B;  5JFR A;  2MC3 A;  2IW5 A;  2JSC A;  4L9J A;  2GXG A;  5JI6 A;  1TBX A;  2JPB A;  3CDH A;  2BBY A;  1KA8 A;  1YG2 A;  1YLF A;  1CGP A;  5D5W B;  2IA2 A;  2NNN A;  2DU9 A;  2EV6 A;  4WWC A;  1JHH A;  3J81 Z;  4LFU A;  4XLN F;  4R79 A;  4WXH A;  4EJV A;  3I0T A;  4CGZ A;  4BHP A;  1I5Z A;  4YFK F;  5TRD A;  4XRF A;  1H9T A;  2GIV A;  3HOT A;  3M8F A;  4Y17 A;  1B6A A;  1ZRD A;  1O3R A;  1H9G A;  1R1U A;  4ENK A;  5HDN A;  3MAJ A;  3J80 Z;  2NNY A;  4LD5 A;  4UVC A;  1IW7 F;  5CVR A;  4ETS A;  2Z33 A;  1FWZ A;  1YW8 A;  1G3Y A;  4ENJ A;  3F8N A;  1FSH A;  4UNO A;  2ESN A;  2GA2 A;  3ABT A;  1IAW A;  4OOI A;  1R5H A;  1TQP A;  3GX4 X;  4JBA A;  5H6Q A;  3MCZ A;  1UB9 A;  2OQR A;  4E70 A;  4KN4 X;  2A69 F;  1BN5 A;  2BE5 F;  2MLK A;  5D6F A;  1YO5 C;  4O3M A;  3WTS C;  2QQA A;  4WXD A;  1V3F A;  4I0B A;  1Q1H A;  3LA3 A;  2EFQ A;  3FWE A;  3JTH A;  5ILU A;  4RGX A;  2XIG A;  3DXJ F;  3SZT A;  1WRJ A;  3KCC A;  4U0Y A;  5DD8 A;  3CUO A;  1Z9C A;  4MGR A;  3HOS A;  1QPM A;  2XKP A;  3MZY A;  3PQK A;  3HRM A;  3TQN A;  4WF2 A;  1D3Y A;  2A3S A;  3RPU A;  1W7P A;  3IWZ A;  1W4M A;  2DW4 A;  4RGU A;  5LBQ A;  1XSD A;  1HKT A;  3HYI A;  5BOX A;  1OMI A;  4OMY A;  1S29 A;  3E3V A;  4OU0 A;  2X0L A;  4N9I A;  2VOP A;  3D5L A;  4I01 A;  3Q9V A;  3F8F A;  4BAY A;  4LK0 F;  2HZT A;  4S05 A;  4KIG A;  4CZZ A;  3FF5 A;  3SFZ A;  1LDK B;  3V8J A;  4A12 A;  3QU3 A;  2HKX A;  1Y0U A;  5CJ9 A;  2KJC A;  5DUI A;  1UHW A;  1YYV A;  3R61 A;  2CGP A;  1IRG A;  1FBS A;  4HOB A;  2FA5 A;  1G6N A;  3U9G A;  2KKO A;  1LVA A;  4H0E A;  3I54 A;  2V1X A;  2UWM A;  1HXD A;  1W7P D;  4HW0 A;  2K27 A;  1WWX A;  4L0Z B;  1HW2 A;  4CO8 A;  4U7D A;  1J59 A;  2JZY A;  3GUD A;  4IHT A;  4ZZL A;  3E5Q A;  1DPR A;  3FXQ A;  5E1W A;  2QUF A;  1GXP A;  4EMS A;  3GZ6 A;  5HDK A;  1EH8 A;  1FLI A;  2ZNZ A;  1J75 A;  2VOD A;  2DK8 A;  1MKM A;  1ZN2 A;  3KET A;  2J5O A;  2QYO A;  3V7S A;  2COM A;  2DO7 A;  2ESH A;  2E7X A;  4KN7 X;  1ON2 A;  4L9T A;  1J7K A;  4RAZ A;  2Q8K A;  4UHT A;  2RV8 A;  3TGN A;  2ZJ2 A;  1FY7 A;  2VBY A;  5K5O A;  2WV0 A;  4A2U A;  3H3Z A;  2O61 A;  1SAX A;  3GYH X;  3J7A O;  2R3S A;  5E1Z B;  1O57 A;  4IF4 A;  3DPT A;  4IXA A;  1ZG5 A;  4OIN F;  3WG9 A;  3BOQ A;  3CO7 C;  3S2W A;  3E6B A;  2YSR A;  2WC2 A;  4P5O A;  1FSE A;  4WXC A;  1UHM A;  5D4R A;  1LDD A;  2YX4 A;  1O7F A;  2PN6 A;  2DT5 A;  3WGH A;  2PG4 A;  3I5U A;  3FXR A;  2OBP A;  3RIR A;  3RJP A;  2EV5 A;  1ZHF A;  1JXS A;  1K79 A;  2GZW A;  4EM1 A;  4O6J A;  5CVV A;  3P9I A;  3EUH A;  4ENN A;  1BIA A;  2HWV A;  3WTT C;  1BI0 A;  1R58 A;  1REP C;  3ZMV A;  2AS5 F;  2W57 A;  5E8I A;  2V79 A;  2YU3 A;  2PFB A;  1G3T A;  1U78 A;  3M7G A;  4O5V A;  2EJR A;  3L2C A;  2VT2 A;  2CSO A;  1J2X A;  2XAS A;  4IHS A;  1BI2 A;  3G73 A;  3EET A;  3MZH A;  3WU1 B;  4LB5 A;  3KP4 A;  2F2E A;  1F5T A;  5D4S A;  3SHF A;  3F23 A;  1U2W A;  2BEO A;  1GXQ A;  1IUY A;  2VON A;  4IPA A;  3HSR A;  2H09 A;  4MNU A;  5JHU A;  3HRT A;  1TQI A;  3FMS A;  1YFH A;  5HLH A;  1IXR C;  4KFC A;  4A0Y A;  4R1H A;  1MD0 A;  3TKY A;  2GAU A;  2A07 F;  1KU9 A;  2LF8 A;  1ZG1 A;  1IN6 A;  1XGN A;  1SFU A;  1R1T A;  2EFN A;  3L7W A;  2G9W A;  3KE2 A;  1T0F A;  5ICF A;  1XCV A;  5L3D A;  1XGM A;  1SFX A;  3KZY A;  3HUG A;  3F3X A;  3ERE D;  1K6O A;  1QO0 D;  1BC8 C;  3ZMS A;  3TOB A;  1WI9 A;  2PMH A;  3L00 A;  3RPQ A;  4HX4 A;  3F21 A;  3ZQ7 A;  1MDM A;  1IXC A;  3B02 A;  4KDP A;  3DKW A;  1DUX C;  1C0W A;  4HF1 A;  2M1B A;  2VBW A;  3QU6 A;  2VXZ A;  4G8X A;  5E17 F;  2HGC A;  4A6E A;  5LHG A;  1R36 A;  2CWE A;  5CLS A;  4WK8 F;  2FU4 A;  1S3J A;  1EH6 A;  3QRF F;  2ZBK A;  2HQR A;  3J80 K;  2Z99 A;  3QP5 A;  1U5T A;  1MGT A;  2MH9 A;  4HF0 A;  4HX7 A;  4YII A;  4M9X A;  2HFH A;  2QWW A;  4KIF A;  2ZCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...