2KZVA

Solution nmr structure of cv_0373(175-257) protein from chromobacterium violaceum, northeast structural genomics consortium target cvr118a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MPHKEKHPLQDMFTSAIEAVARDSGWAELSAVGSYLAKNDPSFDPRNWGHGRLSQMVKKLDFLTVQESRNGSKLHSEIRLRHDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of CV_0373(175-257) protein from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR118A.
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kzvA01
3S93A 3RCOA 2KZVA 2LH9A 2LY2A 2LY1A 2KPMA
chains in the Genus database with same CATH superfamily
2CQNA 2XPUA 1GVJA 4HNTA 1ITYA 2MSYA 5F64A 1J0RA 1HDPA 1R58A 3SZGA 4G8XA 3GTLJ 1J7KA 1FWZA 5DV5A 4BBSJ 2NS7A 5D8LB 3KETA 2H6CA 3BR0A 2NVYJ 4ANJA 1RC9A 3FWEA 3W2WA 3SFIA 1JKOC 1WJ5A 4A3MJ 1UHWA 2ZXWH 2GOMA 1FBQA 2QBYB 1XC5A 1QQIA 4BACA 4UUTA 1ZGAA 2ZO4A 3T8RA 1UFMA 3JTGA 3F0CA 2M9HA 5JHUA 3WE3A 1H9GA 4L9TA 2CJJA 3OR2C 4WCGA 2KDZA 5LLQA 2PJRA 1YS6A 3GXOA 5BS6A 5K7FA 2OZUA 5CVIA 1OQYA 5AIQA 3DPTA 1S72I 3SZTA 2UXXA 4ENKA 3N4MA 3CJQB 2F4OB 3K4NA 1USTA 3ABLH 1S7EA 3DU5A 4RGSA 2L9VA 1YRNB 1QZEA 4D9JA 3ZN1A 1FP1D 1MJ9A 2EA2A 3VWBA 1EH8A 4L5IA 3Q9SA 5FKMA 4A2UA 3ECHA 4UXNA 2Q0OA 1W7PD 4EEFG 2K9QA 2E60A 1CGPA 2O9LA 2COBA 1MBFA 2XIGA 2R7DA 2F2EA 3MCZA 2VQLA 4BXXJ 1FOYA 3TKYA 2ID3A 3W6VA 3CUQC 2JPCA 1X2NA 2KIUA 2O8XA 3H9GA 2XSDC 1D1AA 4A3IJ 1YIJI 3BQYA 1Z6RA 4GDFA 4XLFA 5KVRA 2CFXA 2HKOA 4RB2C 4XOPA 2CMPA 1SD6A 2L4MA 3OMYA 4YFNF 3RYPA 4MLOA 1R9TJ 5J3LA 1BL0A 2X6WA 1XN7A 3OYEA 1MBGA 4S05A 4JQFA 2QGUA 4F3QA 1G3TA 3QQAA 1JHFA 1XMAA 4Q4ZF 3KP4A 3E5UA 1B4AA 1I39A 2HVSA 4A6EA 3FK7A 2L5QA 1F9NA 2L9SA 1KQ9A 3S3OA 3CP8A 4B44A 2VL8A 1O4XA 1KQ8A 1D1BA 4NC8A 1W36D 4NHJA 2IS1A 2BY2A 1GV5A 4WF2A 4DJAA 1U9NA 2XASA 4KUMA 5FLMJ 1SC7A 3CC2I 2M1BA 3DEWA 2IP2A 2Y0SN 1EF4A 2EIMH 3OY9A 1TBXA 2DW4A 1LFBA 4M3FA 4KIGA 3ERED 3CMYA 5TISC 3WHCA 1DGWY 1T95A 5J1YA 1LVKA 4LK1F 3BPVA 4B48A 3GUDA 2VKEA 2GBYA 1IGNA 4MNUA 2V1XA 5FD5A 2CS3A 4R1HA 3E6CC 2BEOA 2JVGA 3W3CA 2DA7A 4DYCA 2TCTA 5HS8A 3ESWB 2E1CA 2Y31A 3CJRB 1OCZH 4NC7A 4MHGA 2DT6A 3EUHC 2VBWA 4FQGA 5C44J 3ULQB 3OYJA 3FXLA 4FE4A 3HSEA 2NRAC 2M7AA 1K78B 4Y3OA 4M9SA 3K4JA 2ELKA 1DPRA 5F0HA 5LFAA 3DLLF 4L5EA 3PFIA 3OOUA 4M3EA 2R5YB 2YR2A 2K85A 2MYSA 3OS2A 3NWTA 1JUMA 2KP6A 1XS9A 4B8XA 3V7RA 3AKZA 4M9XA 3I53A 4DYRA 3ZMUA 1MMGA 2DLLA 4CCJA 3WU0A 3K1PA 5DTDA 1TP4A 1ENHA 2V6EA 3V8KA 3GEZA 2LP0A 5L3DA 1G59A 1IG7A 4FETA 2YSRA 3RQ4A 2R3SA 2X85A 5GP9A 3RKXA 2VJ4A 2XGEA 4CCNA 3QRFF 3LNQA 2E1OA 2HQAA 1VQ6I 1P6RA 1DPUA 1FMWA 1ON1A 5DDGA 1TQPA 1U5TC 3K1MA 1YJ9I 4A6DA 4U0VA 3DLAA 4A3CJ 1OLTA 4RM3A 3WU2C 2K02A 2KJBA 4ON0A 4X0GA 2XRNA 4BU2A 1XMXA 4M3BA 3PL8A 4I99C 3V4GA 2CQQA 2ISYA 3IH4A 1TNSA 2HWVA 3BR2A 1BC8C 3LAJA 1EH7A 3FXJA 3K1NA 1RR7A 2L9NA 1YTYA 1H88C 1FEXA 3RKYA 3KYLA 1X4OA 1SD7A 1RNLA 2XVCA 3PNTA 4P55A 3LSKA 3H92A 3REOA 2HOTA 5J4VA 2D1VA 4I6ZA 1VFCA 1PP8F 3E6DA 1SVLA 4IHWA 2ZCWA 3R6SA 2QUFA 1TQIA 2XSJC 5E3LA 1LB2A 3HRMA 3CDHA 1HKTA 2A68F 3CF2A 2EFPA 2YPRA 2MGQA 3H5AA 2JUGA 3HDDA 2COMA 3G4SI 3FHZA 4UVAA 1W1WE 4EQQA 3OYAA 5GADJ 3F8CA 2FNPA 1O7FA 2PI0A 1SD5A 1YLFA 2GXBA 1L3LA 1Z05A 4L0YB 1UG2A 1UHMA 1IN8A 4C3HJ 1ZH5A 4GGGA 1N25A 2HKXA 4IXAA 1PDNC 5JVGF 1MMAA 5KAFC 3HZJA 5F6FA 2H09A 1IJWC 3S17J 4YIRX 1UELB 1O3SA 4J00A 4ZYGA 2VONA 3VYSB 2HZDA 4CCLA 2VPRA 3GZ6A 3FBIB 2PN6A 4XLHA 3WE2A 1VQNI 3IV5A 1R22A 5FROA 4M74A 3RIRA 4IHXA 4IF4A 3JRFA 4HPQA 1YQAA 2R7SA 4H4KC 5BOXA 2K9NA 3L9FA 1ULYA 1ZN2A 5IYBJ 1QU3A 1X1AA 4Z6YA 4XN0A 5ILUA 3MN2A 3CD6I 2EA4A 4BHCA 3UKGA 2ECCA 1RRJA 2CV0A 3CCEI 2QM3A 3F8NA 3P9CA 3CZ6A 3FX3A 3KLOA 3DTIA 3TDZC 4AIJA 3LSIA 1FSHA 1VQLI 1CQTA 3JRHA 1FNNA 5EF6A 3OYNA 1HLVA 4IRHA 4LGWA 4ZYHA 1X3WB 2E34A 3H5NA 2MD0A 3TO6A 4F7ZA 2EILH 3AAFA 1T38A 2IPQX 3VB2A 1ZREA 1S6LA 3M8FA 4WK8F 2XAHA 1VQ8I 2R7TA 1VQ7I 5CJ9A 4BUPA 1BI2A 2BXYA 1ERDA 3I71A 3EPZA 4IRGA 2OQGA 1FJLA 3HKZN 3M8JA 3NARA 4PZJA 2R7UA 3EUAA 5JLWA 3K4MA 3C1DA 1FYKA 3F9KA 4G94A 1GDTA 5FLXK 4EVIA 1BR1A 2DA2A 4FCYA 2B0LA 3CO6C 4AU7A 2V1DA 1OR7A 2JMWA 2KZVA 2H1KA 1IXRC 4DW6A 5D5VB 2VE8A 3F8BA 3S15J 1RKTA 1SFEA 3NQOA 2IJLA 4BY7J 3CCLI 3TEDA 2KFDA 1YO5C 1ZHFA 1G3WA 5F04A 1KQ0A 3DXJF 4MEYF 1B72A 2XC7A 3GYHX 1FZPB 2PJPA 4ESBA 2CW7A 5HLGA 2DBBA 3P9KA 4LK0F 2LREA 4M6VA 3GF2A 2K86A 4DIQA 2WB1N 1T6SA 2WBMA 3P5JA 2GIZA 1UZCA 4EJOA 3S93A 2X51A 4MQ9F 4R8HA 2F4MB 2X0LA 3BC8A 4BDZA 1IRGA 2M0CA 4MFEA 4IEJA 4AD9A 5L3GA 5A2QK 2CQXA 1DUXC 3WTSC 3FXUA 3GTQJ 4QSHA 2AO9A 4HV6A 3COAC 1E0EA 4ZH4F 4BE1A 1IV8A 4KMUX 5GPAA 3GTOJ 3KZYA 2HXIA 2L7ZA 3BR3A 2P6SA 3DU6A 5DM6F 3DPUA 2UZKA 4HEA2 1ETKA 3DQVC 2MLKA 3TOAA 1LE8B 3WTUC 1BN5A 2CO5A 2N8GA 4XLCA 2ZFWA 3R0JA 2R7VA 3DP7A 3M4OJ 1N78A 4LFUA 3BR5A 4CDGA 5FJ8J 1X4PA 2F5CA 4XL9A 4HDUA 1MSFC 4RGRA 3HOVJ 3JAMZ 4M9ZA 1ZR2A 4CCOA 1Q1VA 5M5YJ 2GWRA 2YU3A 3VFZA 4GYGA 2WWYA 5ILSA 3G71I 1EJ9A 2BGCA 5H2FC 4CCMA 1BR2A 2LKPA 4IOAF 5GAGJ 5DCFA 5C3EJ 5LRRA 4YFKF 4E7KA 2V9PA 1JXSA 3BJAA 2IGOA 1KONA 1UJ8A 3MZHA 3QYEA 1IN4A 2HFHA 1R71A 1XX5A 3OS0A 4JK1X 4PJJA 4ZJZA 2CQ7A 2CW0F 4I2OA 3HYIA 5ICFA 4EGYA 4YG2F 2KRFA 4B3AA 2H1LA 3CC4I 3FKJA 5D4SA 5C4XJ 2A3SA 2OA4A 2XRLA 2VXZA 4D5CA 2Z16A 1S29A 4II2A 3DCFA 4XICA 4G7HF 1BI1A 1QZYA 4A3BJ 1XSDA 3S1MJ 1ORKA 2JUCA 1IRXA 2NVQJ 1R5ID 3LOCA 3CF5F 5GPCA 3PUBA 3OL4A 5CVVA 1K83J 1YIOA 2HOEA 3SXYA 3HBLA 1S7OA 2W85A 1JT0A 1HKSA 3FHNA 4D7NA 1WJDA 3GLXA 2EFNA 3HTSB 3GMEA 3CLOA 4AIKA 2FQ3A 3HKZA 3WHBA 1WFXA 3QAHA 4XKVA 5F08A 1MJBA 4DGWB 1OISA 1ZRFA 4Y52J 4GCVA 1F4KA 5D5UB 3HUGB 4V2GA 4XLEA 4BQAA 4L9JA 1P4XA 3UNGC 3SEQA 2LY1A 2AQFA 3ZMSA 5EGOA 1MJAA 2O3FA 2M45A 3A1YA 3FMQA 1T08B 3ZMZA 5K7ZA 4XLNF 4G6DA 3VYUB 3OYBA 3BP8A 4EJWA 2DOFA 2F5EA 3BTCA 1GVDA 3DEUA 4E6KG 3LL7A 3L1PA 2BW3A 4YIIA 1ZG1A 2ISZA 1A04A 1RKWA 2JA7J 3CCJI 3I4MJ 2G9WA 4LG0B 2P4WA 2E71A 1B9NA 5LEJA 3CCRI 5BPDA 4FT8A 4GFBA 3MZYA 3KFWX 5ICEA 4C2MJ 4UV8A 3PIOF 3QU6A 1ZR4A 4AYBN 2R5ZA 2BE5F 3I4PA 3K10A 1MH4A 3OR1C 4HLXA 1D1CA 3I3LA 4Y4RA 3RPUD 3IL2A 3HG9A 3F22A 1V4RA 2ME6A 2OU2A 4IX7A 1K4SA 3F6OA 2EQRA 3SHFA 2RGVA 3GFLA 4XSZF 5DD8A 3ABKH 2GA1A 1HQCA 5LHIA 4C30A 3VDXA 1LEBA 2H8RA 2DI3A 2M7BA 3I59B 1GLNA 2A5WA 3H3VK 3U1KA 2WAEA 4C2TA 1MZBA 5LGUA 3GTJJ 3FISA 1TW2A 3GO5A 4KNYA 3LSRA 3OWTA 4XONA 3TOBA 4U0YA 1RUOA 2RNGA 5CPRB 4BQOA 5LRSA 4HG2A 4FASD 3ZR8X 5KCMA 2KRHA 3L2CA 3HHHA 1MD0A 1MDMA 4RAYA 2W48A 2EWNA 5J8CA 4A0XA 4Y33A 4BQNA 2A69F 1HXDA 4A5MA 1Y39A 2GAUA 2DMPA 1TWGJ 3SDBA 2LLKA 1FY7A 1U9OA 5DCMA 5B66C 3S2WA 3LSTA 2K3PA 4JOMA 3O8HA 1HKQA 4KYWA 1B8IA 2FOKA 1Z3XA 3JAMK 2PMZN 4G12A 3NAUA 4ABZA 3ABTA 3IAS2 1Y8RB 2DA5A 2YX4A 1QPIA 1SMYF 5HLHA 3MKLA 3K2ZA 4E7JA 5HS7A 1QHHD 2Y48A 2OAZA 3DV8A 1BBYA 1W7PB 1XDSA 3KEOA 4RAGA 4AWXB 1IUFA 1D0ZA 1GUUA 2BOLA 2HPIA 3MAJA 2VBZA 3FBNB 5FFXA 2JZYA 2F48A 2LC2A 3QP5A 3E5QA 3H3UA 1XCVA 1MNDA 5FKKA 1BW6A 1D0YA 4CCKA 2E2IJ 2QZ8A 2ZMEC 3HTUA 4RLFA 1LKXA 3I9V2 2RQPA 4PDKA 4BQQA 3ABUA 3M1EA 1BI3A 2A6EF 5FO5A 3AL0C 1QVTA 3QPSA 1OCRH 5EZGA 3OYGA 1FC3A 2PMZA 3B73A 4RAFA 2KIMA 3ASNH 3LSHA 5IT9K 5E1ZB 2L01A 2IA2A 3PO3J 3H5RA 1U0JA 3G6EI 4PJNA 3ZQQA 2FOWA 2H94A 1O3QA 1YITI 2NS0A 3ZXSA 4X6AJ 3BG7A 2E7XA 3KPHA 4YRVA 5K1YA 3OL3A 4DZJA 2FBKA 1GXQA 2CRGA 4EJUA 5HLIA 4I09A 2O03A 3QPLA 4OAYA 5B3SH 1HW1A 4V2FA 2GOXB 2DA3A 2HYJA 1Y8QB 1ZGJA 4HF0A 1AOYA 1BI0A 3CQZJ 1ZG5A 3OSFA 3HSRA 2O7OA 1J2XA 3SQNA 3OYFA 1R1TA 3WGHA 4LB6B 2DODA 4LLNA 4RLQA 1VQ4I 1Z77A 1RZ4A 1T98A 1IN6A 4WXHA 2DA1A 4MTDA 4IO9F 2R5ZB 4BDYA 5HODA 5HLTA 4DOZA 4I0BA 1LFPA 1FLIA 1VZ0A 3ZQGA 4E7ZA 1FSEA 1GHCA 2VQHA 3CMEI 1S3JA 1IN5A 3A0BC 1TT5B 1QO0D 1ETYA 4CO8A 2TDXA 2ZJ2A 4NQWB 4Y7NJ 2O6GE 2KMUA 2VUMJ 2WADA 4RGXA 1P4AA 2HYGD 5H6QA 4ZYAA 3JTHA 4BL0B 4HX8A 2CUFA 2XUBA 3FMRA 2B9SA 3B6AA 5DUKA 2E1MC 5IPAA 3Q5FA 4F93B 2K5CA 1ZYRF 3GZNB 1XSVA 2FRHA 3ZQFA 4FTHA 3CCSI 4I76A 2O8KA 5IP6A 3HRSA 4XIDA 3OOPA 3KP5A 1XTAA 5K5RA 1Y56A 3HUGA 5L3EA 5C4JJ 3CJNA 3HOXJ 2LOOA 5EDNA 4FISA 3CDLA 4RAZA 1K4TA 1JTXA 5KK1A 2IGNA 2QF7A 3DEEA 4XSXF 2CG4A 2EZLA 1WJEA 2WY7Q 2NVUB 1T2KA 3U2RA 3J80Z 3HHGA 5CQGA 1DU0A 2EH3A 4OMZA 3C3WA 1XPXA 1YX5A 1YW7A 3DBRB 3GTKJ 1NG7A 4XQFA 4KN7X 5BPIA 2VN2A 1LJ9A 1R6RA 3FIWA 4RA2A 3ZMTA 1X1CA 5F0CA 4LG0A 1JTYA 1AA7A 1O7LA 2DOEA 2HQRA 4I0AA 3FM3A 3OS1A 4MFDA 2K7LA 2RKHA 3QP6A 1RUNA 1IZ1A 4R79A 1WHUA 1B6AA 1TWHJ 4EM0B 1R5HA 2IGKA 2RVCA 5J8FA 4QLCU 4UV9A 1FOWA 4OWRB 2D45A 4N4OB 3DKXA 3I54A 2JA6J 3BG3A 3HGGA 3PQKA 4HF2A 5FB2A 4MQVA 4KFCA 4HF1A 4W1UA 5HDKA 1V5GA 1FX7A 2JA5J 1K6YA 4IL6C 3QU3A 2EZHA 4HV5A 4GO1A 2JRTA 1A6IA 2PLYA 1BOAA 5LHHA 2CW8A 2HXOA 3IH3A 2YU9J 3DFGA 2EPFA 1ETQA 4NB5A 3E6MA 3FXQA 1GV2A 2LY9A 1YS7A 3VEPA 3FK6A 2OUMA 4IQJA 2IEKA 5GAHJ 2FNAA 4Q47A 1AHDP 2IGMA 2EK5A 2A5YB 4YFXF 1UG0A 2Y30A 1G4DA 1TWFJ 3CMAI 3S1NJ 1BJAA 2HQ5A 2X48A 2XAUA 3KX2A 3LQRA 1D0XA 2GXGA 3TDUC 4PJMA 4Z2YA 1WJBA 4ITVA 4KITB 4BJ6C 1J09A 5JVTA 1XGMA 3H0DA 3EDPA 3H9JA 3M7GA 1SMTA 3LMMA 1G6NA 1VQMI 2W84A 5BQTA 3V7SA 4S0HB 2ZBKA 5IOYA 5CVRA 4CZZA 3FXRA 2ZMEB 2F6CA 4WXDA 4YELA 2JA2A 3CCQI 2NNYA 2LFBA 3ZQCA 5DYMA 2CUEA 5B1AH 2DYRH 4PFOA 2G0EA 3J7ZI 3K9TA 5D5XB 4P9FA 4IQ4A 4C3IJ 3P9IA 3KEQA 5GTHC 2LDUA 1AKHA 4RM2A 3SJMA 1LDKB 2QBYA 3PIPF 2F5DA 1N77A 2A6TA 2K9SA 2RAEA 4A3JJ 1A5JA 2K3FA 3H36A 1G3SA 1U6GA 1LEAA 1Y6IA 4XK4A 2OZ6A 3S32A 3I59A 4L9VA 3TO9A 4AYBA 4A3KJ 1UCRA 1OR7C 3AG1H 3F8FA 2R7WA 1D5YA 2E2HJ 1HOMA 3IWFA 5K5OA 2JA8J 2GZWA 2XPWA 5GAEJ 2R7XA 4RDUA 3MFKA 4WX9A 4E7HA 2F5FA 1OKRA 4LIUA 4UB6C 2CH0A 4CGZA 1B1BA 1TC3C 2E1MB 1Z91A 2I10A 1OFCX 2AS5F 4RB3C 4D7MA 3OV8A 3GLLA 4UVCA 5EZHA 1A31A 4CUGA 4XRFA 2ZNZA 3J80K 4IOCF 1DGRM 2R93J 2WTEA 3G1MA 4M3GA 5TGTA 2WC2A 2Z9OA 2V79A 2IS6A 5DS9A 1IXCA 4E70A 5IOZA 1J5YA 2DOAA 4C3JJ 4MTEA 2LH9A 1MMNA 4U0WA 2JSCA 2KIQA 1XD7A 4JBAA 3S2DJ 1MMDA 1X19A 3PQJA 3J81Z 4K2EA 4W97A 3SDGA 3TL4X 5FKOA 3DBLB 1PJRA 2MD5A 3IRRA 1QNTA 1RIOH 3GTMJ 2QSFX 3HM5A 3CUQB 5E1WA 1HSJA 3PSIA 4HNVA 2UXNA 5J1UA 2P6TA 4O5VA 5E79C 4XRSG 1UMQA 4BNCA 3D0SA 1X1PA 4Y17A 3ZMVA 3GBGA 3FZVA 3I58A 3Q3SA 2HYFA 4HQEA 3O3KA 2LMDA 3GX4X 2ZKZA 2K27A 3ML6A 4N0BA 1WI9A 1YOVB 4L9NA 2G7HA 1APLC 4UUSB 2GLOA 5LHGA 4LITA 5D5WB 2CYYA 2IA1A 1Z67A 3QOEA 1P2FA 2XAQA 2H8WA 2OC6A 2Z5UA 3OYDA 5B1BH 3I4NJ 2VJ5A 2KHMA 3ELKA 4ZYEA 3A01B 4JX4A 2DFEA 2P7VB 2HQNA 3AL0B 3S14J 1KYWA 2LKXA 1OYWA 1K6OA 2YX7A 1AWCA 4UUVA 2HPMA 1EH6A 2VJJA 2Z99A 2LTPA 2Y0MA 4ESFA 1VQPI 3GFMA 5LEKA 3V8LA 1R1VA 3WTTC 3K70D 2IRFG 4DNCA 2AXLA 3FF5A 3NEUA 4EATA 3JRDA 4A12A 1U5TB 1E3HA 1QRYA 4XKWA 4F92B 2FBIA 2DFFA 3O8GA 3D1NI 3ZQHA 4DZPA 1WH5A 2PMUA 3EUHA 1J59A 3IKVA 1SANA 5E3NA 2FSWA 3VOEA 1XGSA 5M5WJ 2FX0A 3ZCOA 2EB7A 3O6BB 1TW3A 1T33A 3RPQA 3ZQ7A 5GTIC 4H0EA 3IUOA 2HVQA 4NBQA 3N97A 2ZJRF 2L2OA 2WAQA 3HPHA 2QKLB 3A4CA 2J5OA 3GFIA 1GXPA 5FLXZ 3LWFA 2L7FP 3N05A 3W6JB 5E18F 4QTRA 1H0MA 1RI7A 3Q0UA 2FUG2 3DTEA 1B59A 3DKWA 3T8TA 2Y2ZA 1R00A 3S1QJ 1RETA 1TWAJ 2DAOA 2EJRA 1Z7UA 1K7AA 1T56A 2STTA 1ONVA 1USSA 1DP3A 2IT0A 4ZZDA 2IW5A 2EV0A 3S3MA 1PYVA 3LFUA 4P96A 5JHFA 2DTZA 1F5TA 2VOPA 5IY5H 1JGGA 2I5UA 4XNFA 3TMOA 2BYVE 2EZKA 4HW0A 5IYCJ 5CYVA 2JPBA 3KCCA 3OIOA 2X6YA 4CHUA 4L18B 3WTVC 1H8AC 3VSLA 1ZK8A 3AFHA 1WZ2A 2A07F 4EM2A 1XCBA 2VLAA 3PJRA 1X1DA 2HZTA 2P7CB 2NVXJ 3E7LA 1NG6A 2ELHA 2Q2EA 3MWMA 1JUSA 3R4KA 4ZYDA 3L2UA 3L2WA 1GT0C 2HTSA 1ETWA 4G9YA 4J01A 4IHVA 4NUBA 2NVTJ 1HA8A 2VI6A 2KJCA 2IBDA 1TL8A 3K7AJ 5FFZA 2XGDA 1E3PA 2JN6A 5EEHA 4B09A 3D5SC 2W57A 1OMIA 1QA6A 5ED4A 1W0UA 2QQAA 4OIRF 4DYQA 2I8DA 3DBHB 3BJ6A 5H20A 2DYSH 3JRBA 3RTRA 1WWXA 4NC6A 1VNDA 3L2VA 1TNTA 4EM1A 3LA3A 2VKVA 2GIVA 5D8KB 2J5PA 3WU1B 1V55H 2QQ9A 3L2RA 1SFKA 3HOYJ 2XGCA 3LSPA 2OTJI 2V9KA 3G1OA 2KT0A 3Q0VA 2HNHA 4RB0A 1IO2A 2K9MA 4PFPA 4M72A 1R49A 3C18A 5E3MA 1W7PA 3WTZA 1OCCH 4II3A 4DBRA 3ISPA 4A93J 1Z7LA 5KAIC 1I6XA 1D3YA 2VT2A 1CF7B 1ZLJA 3J81K 3BZKA 2EFQA 4LB5A 4ZDPA 2ESHA 2UUZA 3E5XA 2DMUA 1KU7A 3H9QA 2HR3A 2ACJA 4GYIA 5J40A 3FXMA 3PUFA 4Q5SF 2KRCA 5K5QA 2LVSA 1OCPA 3ZQIA 1A36A 2KZGA 2CSOA 2CUJA 3WGIA 2KISA 3FMSA 1H89C 4LD5A 4EJVA 3H0GJ 1IC8A 5IYDJ 1X3UA 3MZ8A 2CWEA 3MD2A 4BHPA 3D5RC 4GRIA 3S2HJ 1AKHB 5EEAA 2LYCA 1WKMA 2EZIA 1WI3A 2M4GA 2AXTC 2QQBA 5M3MJ 3U1DA 2EFWA 3F6VA 3KE2A 1I3QJ 2W00A 1XMKA 2OQRA 2R5YA 1FIAA 4AIDA 1HSTA 3OYIA 3QOPA 1K78A 3ZQLA 1S5LC 1H9TA 3L09A 2HU9A 4S04A 4MEXF 3U9GA 3K70C 1XG1A 4PSWA 3EETA 4XN3A 3K4LA 3CO7C 1BA5A 2L3DA 2W7NA 4A3GJ 1J9IA 4A3EJ 3M07A 4A3LJ 1IXSB 2FE3A 1Z3YA 3DF8A 4N9HA 5L3BA 5J6XA 4JX6A 2DJNA 2W82A 1HW2A 1D8KA 2R7FA 1E3OC 1P7JA 3CCUI 3T0YA 1A35A 4CXFA 1MW7A 2EV6A 5ILVA 2PQ8A 2LSOA 3IHUA 2XAFA 3BOQA 4QWQA 2DQLA 2BW3B 1DDNA 2VE9A 3PFYA 1JHHA 4M73A 1X58A 2KLOA 3S3NA 4BYYA 3HXLA 3NRVA 1W0TA 2X6OA 2E1NA 2R4GA 3KZIC 2BV6A 1U8BA 3I5UA 2O61A 2LKSA 1W5SA 2OPTA 2LF7A 1IDZA 3TW7A 3RYRA 4EV0A 3FKIJ 3TO7A 2Y9ZA 3WG7H 1VQ5I 2ESNA 5CVJA 2XF7A 4XLPF 2XDVA 4TV7A 4F55A 3S8PA 3VSKA 5M3FJ 5TRDA 1JUPA 1NH3A 2IA0A 4IVNA 3OSGA 2CV1A 2L4AA 5IT9Z 2VBXA 4M71A 1MIJA 4XBFA 4B43A 2E7WA 1UAAA 2VC0A 5DD4A 4N4NB 2DA6A 4KN4X 1LQ1A 3Q0WA 2DT5A 3HGYA 3KYDB 4LJZF 4M6XA 5E1XA 5LD2C 1CF7A 4ASNA 3VODA 4BJTA 2L54A 4M6YA 5EEGA 1G8XA 3HPGA 3CC7I 4BE2A 4NNJA 1NTCA 5CQEA 1RR8C 2M8EA 2O0YA 2QEXI 2QYOA 4JX5A 1TWCJ 4EMSA 4N9IA 3MEXA 4QPOA 4ZDLA 5TJJA 1OJLA 3KZZA 1B72B 2FMLA 2IXSA 2DDBA 5LGTA 3P7NA 5HNHA 1ETXA 2ZXHA 3R0AA 4M3DA 5D6FA 4IJAA 1YRNA 2EINH 2BHYA 2E5NA 2L7KA 1B9MA 2WY8Q 3W2AA 2EIKH 2VKDA 1ZAOA 3BG6A 3WTWC 2A05A 3GCMA 3K4KA 1EKEA 4PSXA 4HLYA 1JI8A 3TW6A 1TQMA 3HL2A 1BC7C 3PSFA 1MBEA 2B63J 2PFBA 3BT9A 1WRJA 2O5RA 1STZA 2FBHA 1IRFA 3ZN0A 1W5TA 1VQ9I 2W24A 1WCMJ 5HS9A 3HOUJ 5E8IA 3RZDJ 2V26A 2LD5A 4CSWA 3BJOA 3ZRGA 5M5XJ 1R1UA 4ZZLA 5BMZA 1R4MB 2XV4S 1UB9A 2DMNA 2XKPA 4IKFA 6PAXA 2ZMEA 2ZNYA 2HDCA 3HRUA 2FA5A 2K4BA 2NAZA 4NQWA 3CJTB 1IV6A 5E20A 3KP6A 4KIFA 4D0PA 1IRZA 3CESA 1YJNI 1YW8A 3JRAA 1PUFA 1JGSA 4AUXA 3JRGA 4F52A 2DK5A 3JRCA 2K4JA 1WJCA 2VBYA 2Y69H 1U8RA 1EA3A 3K69A 1T8IA 2JSPA 1ZRDA 2HEOA 4PCQA 2H27A 1OCTC 3CMMA 2C6YA 1KA8A 1LNWA 4A0ZA 4F91B 1YW9A 3H35A 3IC7A 5K7HA 2GXAA 2M2EA 2VQCA 4ZC3A 1KZHA 4V19K 4BHBA 4BXUA 1IN7A 2PBIA 3HB9A 1I27A 3SZPA 3WG9A 2EV5A 2P0WA 4RBOA 3T1BA 4L0ZB 2KQRA 3RZOJ 5J4YA 5FKLA 2WAFA 3K6GA 5LGNA 1YX3A 1WGXA 1W5CC 1Y0UA 4BKXA 3AG3H 1SD4A 2XHKA 2Q2EB 5FRMA 1LUJB 3AG4H 3F21A 1NK2P 2G7UA 4XRMA 2GA2A 4OAZA 4E7IA 2VXDA 3A02A 4FHTA 3K4BA 2LBFB 4CYCB 3HEFA 3CCVI 1I5ZA 5ICCA 2XF5A 1PUEE 4HSRA 4C9YA 2XB0X 2P5VA 3ZP5A 1S9HA 4B3XA 2WV1A 2ETHA 3BWGA 2QKMB 3WODF 3KYCB 4XLAA 5B5EC 4L5JA 3DKYA 4BH9A 2Z2SB 3RKWA 5FD6A 3A2KA 2PX9A 3PM1A 2HGCA 4GXOA 2QENA 4BEHB 1P4WA 1BJZA 4HRIA 3E3VA 2VC1A 3E97A 1QVUA 2D1HA 2DXIA 3MKYB 2QVOA 3AG2H 5DM7F 2DDAA 2CU7A 2KIFA 4HOBA 4HNUA 1QZZA 3CP2A 1W36C 2DO7A 3CUOA 1MH3A 1X2MA 2AQEA 2VASA 3SYTA 3I64A 1XGNA 3TBIA 4BY1J 3W6KB 2QA4I 1E17A 2XF6A 3LA2A 3I56I 1X3ZB 3G1LA 4CYCA 2FF4A 4I98B 5FKNA 3ZOBA 3M8EA 5IP7J 4PGGA 4ESJA 3OIQA 3CCMI 1MGTA 4LLGF 2OV7A 2K9LA 3O2PE 2ECBA 3MVPA 4MO7A 3LA7A 2M87A 1MNMC 4BGDA 5J47A 4I02A 1R7JA 1IUYA 2DCEA 4G7ZF 1VTNC 4G7OF 5EYRA 4AC0A 3RKQA 1LVAA 5ICGA 2Q1ZB 1E2XA 1O57A 2RN7A 2RDPA 4EGZA 3IRQA 1QBJA 5E17F 3QODA 4LLLA 3J7AO 1D5VA 2WA0A 2NXNB 2HOAA 2L02A 1EV7A 4XKBA 9ANTA 4A3FJ 3M9AA 3GW2A 4KIBA 2NS8A 4NDLA 4LG3A 1MBJA 2BVLA 4FE7A 5HDNA 3F8MA 3EYIA 1JKPC 2D5VA 3EUKL 1O3RA 2WAQN 1Z6TA 4UB8C 5KHDA 4OINF 4AIHA 5HVQC 2R7RA 1JKQC 5F27A 2OF7A 1KU2A 2HI3A 2ADUA 2DFIA 3HOSA 3QYBA 2VPLA 2BXZA 5CLSA 1WJAA 3S1RJ 1HF0A 1YG2A 2XGXA 3V8JA 2H6BA 4BAYA 1UHSA 4B1RA 1HDDC 3E6BA 3JSOA 2JQ7A 4FX4A 3VYTB 1Z0XA 4CA0A 3TP3A 3MKZA 1XSXA 3MQ0A 1R4NB 2HDDA 2ZSIB 4P1WA 3G73A 3BR6A 2F5VA 3FM5A 5JLXA 5JFRA 1VI0A 3W2VA 3G2BA 1L0OC 1HCRA 4HYEA 1X1BA 4YIFA 1SFOJ 4ZTJA 1ODDA 1RESA 2V9VA 4PJLA 4C2UA 4PGHA 1FYLA 2LY2A 1Y0NA 1JKRC 2WB1A 1Z9CA 5ERIA 3EYYA 2R7ZJ 3VPRA 4A69C 2P8TA 2JRMA 3BG9A 3QYFA 4KT6A 2V6CA 2MC3A 3F72A 1T0FC 4PJ0C 2ZFUA 2CV2A 3IH2A 4LMYA 4IZZA 1RPWA 2W25A 2CUZA 1ZQ3P 4KDPA 3ASOH 2ELJA 3V7CA 1ZGWA 3FXOA 2VB6A 2M34A 5EJCA 5EG0A 4DBQA 1YFHA 2UWMA 1MNEA 4UUSA 3KP2A 2W1OA 3IAM2 3KIOA 1XB4A 1C0WA 2MH2A 2IVMA 4HDVA 1KU9A 1BOBA 4PUSA 1B8IB 4IHSA 4RGUA 2WV0A 4LIVA 2B7EA 2JTVA 4P9UA 2DN0A 4CH7A 3CDIA 2X1EA 2EFOA 3IWZA 1P9QC 1DQUA 1KU3A 4HA8A 1VF9A 2HVRA 2QSGX 2A6HF 3S16J 3BR1A 3FDYA 2HDWA 2OTLI 1WQ2A 2R0QC 1YI2I 2FXAA 3BZCA 2OBPA 2KPMA 3BZ6A 2M8GX 3ROUA 4Y13A 3M3YJ 4CZCA 2FQ4A 3BCAA 3D5LA 2E5ZA 4XMYA 3SEZA 4OIQF 5A2QZ 1D8JA 1FYMA 1I1GA 1LDJA 4XORA 3K2AA 2LRDA 2RREA 3BPXA 1F1ZA 2ZXIA 1F36A 5JR3A 3PO2J 3CTAA 4ZDOA 2BHZA 3KP3A 2BBYA 2EBIA 2LK2A 2IS4A 4O6JA 3JRIA 2A61A 1WJFA 3DTKA 2R7OA 2Z3YA 3JSPA 4CICA 2NYXA 4IHTA 3LSJA 4HQMA 3ZMDA 3X2QH 1ACIA 3HOWJ 3RDIA 1W4MA 2XB5A 3I55I 1HW5A 5J1RA 4WXCA 1NK3P 2DMTA 1HC8A 2XAGA 4G6TB 4E4HA 3BROA 2P5KA 1MMSA 2K40A 2DFHA 2X6XA 3BY6A 2VODA 3L2QA 1AU7A 3BG5A 2BY1A 4QIWN 5LBQA 2MBFA 2DMQA 2VKHA 3BLYA 4RMNA 3K0LA 4ENJA 2MC4A 1N75A 1POGA 4KICA 3I0TA 1LPQA 3T5XA 1K61A 2STWA 2JK3A 1BIBA 3BQZA 1ZARA 2PG4A 1NHAA 2PJRB 2M0MA 3NWSA 5EGOB 4A5NA 1Y1WJ 1J75A 1M1EB 3OYHA 1LE8A 2X1CA 5L3CA 2Y75A 5E3OA 4O3MA 1V54H 1TTYA 2E35A 3RSNA 4ETSA 5FLVA 1G2HA 1ZELA 4UHTA 2EIJH 3KP7A 4I01A 4XR6A 3B6CA 4KMFA 4U7BA 2FMYA 2JWTA 1YHQI 2NOJB 5HOOA 1VQKI 2M4KA 2ZSHB 1BIAA 1ETOA 1HBXG 3JCUC 1BM9A 3G3ZA 4JYKA 1IF1A 1FOKA 3DPLC 1V3FA 3JW4A 1IW7F 4KISA 2XPVA 2XKOA 1S7AA 2RQQA 3C2GA 1FOXA 1Z21A 4OMYA 3BTIA 3R61A 4U7DA 3OYMA 2P81A 3WGGA 2E19A 1ETVA 4BEHA 2VQGA 2OJED 4OOIA 1T0FA 2MH9A 3TQNA 3GZ5A 2OD5A 1PP7U 4UNOA 2KL4A 2V1UA 3M1CA 1WSUA 2PEXA 4B4CA 3BDDA 3HC7A 4E7SA 1DP7P 1FBUA 5AIPA 3VYRB 3J7AY 3GTGJ 3TP0A 2E2JJ 1TZLA 2DA4A 3IKTA 3B02A 3E0JB 2KDOA 3PNYA 3PNVA 3V42A 2QWWA 2V7FA 5E8GA 3QPTA 3L00A 3CLQA 4MIMA 5FRNA 1YJWI 2Y0SA 3U21A 1WH7A 4LOCA 2E36A 4YEJA 1KYZA 2M3AA 1A6QA 2VJIA 4KJZA 2Y9YA 5H6RA 1MSEC 2Z1DA 3CCYA 1QGPA 3A03A 4HBLA 1SAUA 1SFXA 2MG4A 2QCOA 1I3AA 3EQLF 1R36A 3RQIA 1IDYA 3FXKA 4HX7A 2DJIA 2MW8A 3LSMA 2ME0A 5L3FA 5HNFA 1FTTA 3HRTA 2M30A 3OIPA 2VIXA 2CFOA 4EJTA 3Q9VA 2L9RA 1MBHA 1Q1HA 4J19A 2NOGA 5AONA 2YS9A 3E1SA 3GWZA 2GQQA 3GVAA 4D5FA 2M5WA 5EG0B 2HS5A 4MGRA 2ZC2A 2F4IA 2LR8A 3WTYC 4AM3A 1WVRA 1FMVA 3OYCA 1REPC 4OU0A 3J7YJ 1TLHB 1PVEA 1JE8A 1MKMA 1SVOA 4FX0A 4U88A 4HZFA 2P5LC 3OYKA 4OIPF 2RV8A 5DUIA 2HOSA 1I6HJ 2VT3A 1LDDA 1SEUA 2Q8KA 3HJEA 3RJPA 3F23A 5JI6A 1FPQA 3OYLA 2AHQA 2CGPA 2BY3A 2PMHA 2X9DA 2XROA 3JREA 3LAPA 1OPCA 4XM3A 1R5GA 3MMYB 2Z33A 1PUFB 4ENNA 3BTLA 4ZTFA 3A0HC 4XKCA 3QWLA 2ZJQF 2DQRA 2NNNA 3H1CA 3C7JA 3H3ZA 5CVUA 4RB1A 1DU6A 1OCOH 3GTPJ 2RC4A 2ICWG 1P92A 1ZKGA 2LBFA 4BJ5C 1WPKA 2DTRA 1FP2A 2UV1A 4WWCA 1Y1VJ 3GFJA 1OYIA 4JP0A 5HDGA 2LG4A 2LF8A 2R7QA 1QHGA 3LQQA 3ONQA 3KEYA 4B47A 4PK4A 1F43A 4QPQA 1MDMB 1S8NA 2QQ8A 4Y15A 2R92J 2V4JC 1ZLKA 4IHYA 1LFUP 3BCBA 2X1DA 1SVMA 5FGMA 2L0KA 5IT3A 4I7HA 2ZJPF 4P5OA 3DWLE 1YE9A 4AVZA 1JJ8C 2L7MP 3ECOA 2DPDA 1ZG3A 4BE0A 2LNBA 2MLGA 1XGOA 3RCOA 4X1EA 1SAXA 2MA3A 2IS2A 5CKTA 2JT1A 2FEZA 1U5TA 5KNLA 2RNJA 1VQOI 1ZTRA 5D4RA 2D2WA 4IPAA 3ZPLA 1G3YA 4D1QA 1YYVA 3A01A 1U3EM 1T39A 1IAWA 3F3XA 4U87A 1BR4A 3JR9A 3ERMA 3RPUA 2DPUA 3BTJA 3LFKA 2BVMA 5F1RA 1K79A 3TGNA 3UR3C 1TT0A 4RS8A 4UY8I 3ABMH 5BNGA 2ID6A 3R60A 1U78A 2DU9A 2OCEA 2DK8A 3HOZJ 3SFZA 3KLNA 2TRTA 2CQKA 3QPHA 1V5EA 2XAJA 1FT9A 5DCMB 4E7LA 4CYDA 1O3TA 1V5FA 2YUSA 2BZTA 4KT5C 4BBRJ 1JJ6C 1OYYA 4A0YA 3C2BA 1QPMA 1I50J 4HAMA 3WTXC 1FBSA 3L7WA 3HOTA 2KKOA 2FJ1A 4UVBA 4BXFA 4ENMA 1FTZA 2DT7B 1BW5A 2OCCH 4HX4A 3RI4A 1U2WA 2W4SA 1XDUA 3CUQA 4BS9A 3HSFA 2FD5A 1ON2A 5F0FA 5IP9J 1P7IA 4HSTA 2MFZA 4XRSA 2FU4A 2JVHA 5D6EA 3K4CA 3ZGKA 1MBKA 2IAIA 2QLZA 3IP4B 5DEQA 2V1NA 1R23A 3C2HA 1KGSA 2ZXJA 3MKWB 3HIFA 5F1JA 2JJ7A 2HTJA 4Q48A 4IRIA 2ZB9A 2GM4A 2QSHX 4XOTA 2BY0A 4AVPA 1ZRCA 1FIPA 4G6QA 4A3DJ 2X4HA 4KA4A 1I1SA 4OIOF 2VOOA 3LSGA 2MABA 1SFUA 4DQ2A 1JT6A 1Z1DA
chains in the Genus database with same CATH topology
2VJJA 4HNTA 4BGDA 3VYUB 3OYBA 2DCEA 4E6KG 3LL7A 3SZGA 2BW3A 3K70D 2Q1ZB 4EATA 3QODA 4ANJA 4XKWA 3W2WA 2WA0A 4F92B 1WJ5A 2GOMA 4XKBA 4BACA 4LG3A 2BVLA 3EUKL 3RPUD 3K10A 3OR1C 4Y4RA 3ZCOA 1D1CA 3I3LA 3HG9A 5KHDA 3OR2C 3IUOA 2HVQA 2PJRA 5HVQC 4IX7A 2R7RA 3DPTA 3HPHA 2L2OA 2WAQA 3HOSA 2QKLB 3A4CA 3CJQB 3QYBA 3K4NA 4C30A 2VPLA 3DU5A 3VDXA 1WJAA 2M7BA 3N05A 1GLNA 4D9JA 2A5WA 2FUG2 2WAEA 3DTEA 3VWBA 4C2TA 3VYTB 3OWTA 4XONA 4CA0A 2E60A 3MKZA 2RNGA 5CPRB 4BQOA 4HG2A 4FASD 2ZSIB 4P1WA 3ZR8X 5KCMA 1DP3A 2KRHA 2F5VA 2VQLA 3S3MA 1PYVA 3LFUA 5JHFA 3W2VA 4Y33A 3G2BA 4BQNA 3H9GA 1D1AA 1X1BA 4ZTJA 3SDBA 4XLFA 4XNFA 3TMOA 4PJLA 4C2UA 2LY2A 4XOPA 2CMPA 2WB1A 2K3PA 2X6YA 3OMYA 4JOMA 4MLOA 3VSLA 3AFHA 1Z3XA 2X6WA 3QYFA 4KT6A 2VLAA 3OYEA 3PJRA 1X1DA 4JQFA 1T0FC 3IAS2 2ZFUA 4F3QA 2CV2A 1NG6A 4IZZA 3L2WA 4E7JA 2CUZA 3L2UA 1QHHD 2HVSA 4J01A 2ELJA 2VB6A 2L5QA 1HA8A 4NUBA 2L9SA 1D0ZA 4DBQA 3S3OA 2BOLA 2HPIA 3CP8A 2VL8A 4B44A 3FBNB 1MNEA 2UWMA 2W1OA 1D1BA 2LC2A 3IAM2 4NC8A 1W36D 2IS1A 3D5SC 4DJAA 1BOBA 1MNDA 4PUSA 1D0YA 4CCKA 2I8DA 4RLFA 4LIVA 3OY9A 3RTRA 1LKXA 3I9V2 3L2VA 4BQQA 4CH7A 2X1EA 1DGWY 1T95A 3AL0C 1P9QC 1DQUA 1LVKA 4B48A 3OYGA 1SFKA 3L2RA 2PMZA 2V9KA 2HVRA 3LSHA 2CS3A 2HNHA 2K9MA 2JVGA 3FDYA 2HDWA 3W3CA 4PFPA 3H5RA 1U0JA 4PJNA 3ZQQA 2KPMA 3CJRB 4II3A 4NC7A 4DBRA 2DT6A 3EUHC 1Z7LA 3ZXSA 3OYJA 3BG7A 4CZCA 4YRVA 3BCAA 3D5LA 2E5ZA 4XMYA 2M7AA 3OL3A 3SEZA 4Y3OA 3K4JA 4XORA 5LFAA 2LRDA 2RREA 3OOUA 4ZDPA 2UUZA 2ZXIA 4OAYA 3H9QA 2MYSA 4ZDOA 3OS2A 3NWTA 2GOXB 2KP6A 2KRCA 2IS4A 3AKZA 2CUJA 1MMGA 1WJFA 4CCJA 3OYFA 3DTKA 2R7OA 2V6EA 3MD2A 4RLQA 3D5RC 4GRIA 1G59A 4FETA 4BDYA 3RQ4A 4DOZA 5HLTA 2X85A 2LYCA 2M4GA 1LFPA 1VZ0A 4E7ZA 2VJ4A 2VQHA 4CCNA 2W00A 2HQAA 4G6TB 4E4HA 1FMWA 3OYIA 2X6XA 4NQWB 3L2QA 2HU9A 2KMUA 3DLAA 2WADA 1OLTA 4RM3A 3K70C 4X0GA 4PSWA 4XN3A 4BU2A 3K4LA 4ZYAA 4BL0B 2VKHA 3BLYA 4RMNA 2W7NA 2MC4A 3PL8A 1N75A 1Z3YA 2E1MC 4F93B 2K5CA 2PJRB 2L9NA 2M0MA 2W82A 3NWSA 3OYHA 3KYLA 1X4OA 3PNTA 2X1CA 3LSKA 1MW7A 3RSNA 1Y56A 1ZELA 2LOOA 4XR6A 2XSJC 2BW3B 3PFYA 2IGNA 4U7BA 3DEEA 2KLOA 3S3NA 3HXLA 3CF2A 2NOJB 5HOOA 1WJEA 2WY7Q 2M4KA 3H5AA 2JUGA 2ZSHB 2R4GA 5CQGA 3OYAA 3DPLC 4KISA 3C2GA 2RQQA 1YX5A 1Z21A 2XF7A 3OYMA 2XDVA 4F55A 3S8PA 3VSKA 4BEHA 2VQGA 1NG7A 1MMAA 2CV1A 4XQFA 1R6RA 2KL4A 4B43A 1UELB 3M1CA 4J00A 1X1CA 3VYSB 2HZDA 3HC7A 1UAAA 4CCLA 4E7SA 4N4NB 3FBIB 3VYRB 4XLHA 3J7AY 1AA7A 5LD2C 3OS1A 5FROA 1TZLA 2R7SA 4BJTA 4HPQA 4R79A 3E0JB 2KDOA 2IGKA 3PNYA 3PNVA 4H4KC 2V7FA 3V42A 4OWRB 1QU3A 1G8XA 3HPGA 1X1AA 4N4OB 3DKXA 4BE2A 4NNJA 2Y0SA 3U21A 5FRNA 5CQEA 4XN0A 4YEJA 2M3AA 2VJIA 4KJZA 2Z1DA 4QPOA 4ZDLA 1SAUA 2CV0A 1V5GA 3CZ6A 1K6YA 3DTIA 3LSIA 2IXSA 2DJIA 5HNFA 3LSMA 5HNHA 2ZXHA 3OIPA 2CW8A 3OYNA 2VIXA 2CFOA 2E5NA 2L7KA 3H5NA 2MD0A 2WY8Q 2OUMA 3W2AA 4IQJA 2VKDA 3E1SA 2IGMA 1UG0A 3BG6A 2R7TA 3K4KA 2F4IA 2XAUA 3KX2A 1FMVA 4BUPA 4PSXA 1D0XA 3OYCA 4PJMA 1ERDA 1JI8A 3EPZA 1WJBA 3M8JA 4ITVA 4KITB 3HL2A 2R7UA 3OYKA 4BJ6C 1J09A 3PSFA 3EUAA 3K4MA 2O5RA 3H0DA 3H9JA 3F9KA 3LMMA 1BR1A 3OYLA 4AU7A 2V26A 4XM3A 3MMYB 4CSWA 2KZVA 3ZRGA 4ZTFA 4YELA 2F6CA 4XKCA 2JA2A 4IKFA 4PFOA 2LBFA 3CESA 4BJ5C 2XC7A 4IQ4A 2CW7A 2UV1A 4F52A 2LREA 2LG4A 3ONQA 2R7QA 1QHGA 3KEYA 4B47A 1WJCA 4PK4A 4QPQA 1EA3A 4RM2A 4DIQA 1LDKB 2WBMA 2JSPA 1N77A 2A6TA 3S93A 2V4JC 2X51A 3CMMA 4F91B 3BC8A 4BDZA 3BCBA 2X1DA 3H35A 1Y6IA 2VQCA 4ZC3A 3S32A 4P5OA 3DWLE 1YE9A 4AVZA 4AYBA 1OR7C 2R7WA 1E0EA 4BE0A 2P0WA 3RCOA 2HPMA 4BE1A 2IS2A 5CKTA 2KQRA 2R7XA 5KNLA 4E7HA 2WAFA 3K6GA 3DU6A 1YX3A 3DPUA 4D1QA 4HEA2 4LIUA 3DQVC 2CH0A 4U87A 2E1MB 1BR4A 4XLCA 2Q2EB 5FRMA 1N78A 2R7VA 2BVMA 1X4PA 4XL9A 4CUGA 4OAZA 1DGRM 3UR3C 4E7IA 1TT0A 2VXDA 4CCOA 3K4BA 2LBFB 5TGTA 2XF5A 4HSRA 4C9YA 4CCMA 1BR2A 2IS6A 1S9HA 4B3XA 2QKMB 2DOAA 4E7KA 1V5EA 2IGOA 1KONA 2LH9A 3QYEA 4XLAA 1MMNA 4E7LA 3OS0A 1V5FA 4PJJA 4ZJZA 3DKYA 1MMDA 1X19A 2Z2SB 3TL4X 3A2KA 3FKJA 2VXZA 3HOTA 2Z16A 4BXFA 4II2A 1PJRA 4BEHB 4HRIA 2DT7B 2DXIA 2W4SA 3MKYB 3PSIA 1IRXA 4BS9A 4HSTA 3PUBA 2MFZA 3OL4A 2JVHA 3K4CA 3ZGKA 4HNUA 3FHNA 3GBGA 1WJDA 3IP4B 2V1NA 3CP2A 1W36C 3C2HA 2AQEA 3HKZA 1WFXA 2VASA 3MKWB 4XKVA 4DGWB 3SYTA 3TBIA 4LITA 3QOEA 3HUGB 4XLEA 2OC6A 3OYDA 2XF6A 2VJ5A 2KHMA 3UNGC 4XOTA 3SEQA 2LY1A 2AQFA 3AL0B 3A1YA 3OIQA 2OV7A 2K9LA 3LSGA 2MABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S93 A;  3RCO A;  2KZV A;  2LH9 A;  2LY2 A;  2LY1 A;  2KPM A; 
#chains in the Genus database with same CATH topology
 2CQN A;  2XPU A;  1GVJ A;  4HNT A;  1ITY A;  2MSY A;  5F64 A;  1J0R A;  1HDP A;  1R58 A;  3SZG A;  4G8X A;  3GTL J;  1J7K A;  1FWZ A;  5DV5 A;  4BBS J;  2NS7 A;  5D8L B;  3KET A;  2H6C A;  3BR0 A;  2NVY J;  4ANJ A;  1RC9 A;  3FWE A;  3W2W A;  3SFI A;  1JKO C;  1WJ5 A;  4A3M J;  1UHW A;  2ZXW H;  2GOM A;  1FBQ A;  2QBY B;  1XC5 A;  1QQI A;  4BAC A;  4UUT A;  1ZGA A;  2ZO4 A;  3T8R A;  1UFM A;  3JTG A;  3F0C A;  2M9H A;  5JHU A;  3WE3 A;  1H9G A;  4L9T A;  2CJJ A;  3OR2 C;  4WCG A;  2KDZ A;  5LLQ A;  2PJR A;  1YS6 A;  3GXO A;  5BS6 A;  5K7F A;  2OZU A;  5CVI A;  1OQY A;  5AIQ A;  3DPT A;  1S72 I;  3SZT A;  2UXX A;  4ENK A;  3N4M A;  3CJQ B;  2F4O B;  3K4N A;  1UST A;  3ABL H;  1S7E A;  3DU5 A;  4RGS A;  2L9V A;  1YRN B;  1QZE A;  4D9J A;  3ZN1 A;  1FP1 D;  1MJ9 A;  2EA2 A;  3VWB A;  1EH8 A;  4L5I A;  3Q9S A;  5FKM A;  4A2U A;  3ECH A;  4UXN A;  2Q0O A;  1W7P D;  4EEF G;  2K9Q A;  2E60 A;  1CGP A;  2O9L A;  2COB A;  1MBF A;  2XIG A;  2R7D A;  2F2E A;  3MCZ A;  2VQL A;  4BXX J;  1FOY A;  3TKY A;  2ID3 A;  3W6V A;  3CUQ C;  2JPC A;  1X2N A;  2KIU A;  2O8X A;  3H9G A;  2XSD C;  1D1A A;  4A3I J;  1YIJ I;  3BQY A;  1Z6R A;  4GDF A;  4XLF A;  5KVR A;  2CFX A;  2HKO A;  4RB2 C;  4XOP A;  2CMP A;  1SD6 A;  2L4M A;  3OMY A;  4YFN F;  3RYP A;  4MLO A;  1R9T J;  5J3L A;  1BL0 A;  2X6W A;  1XN7 A;  3OYE A;  1MBG A;  4S05 A;  4JQF A;  2QGU A;  4F3Q A;  1G3T A;  3QQA A;  1JHF A;  1XMA A;  4Q4Z F;  3KP4 A;  3E5U A;  1B4A A;  1I39 A;  2HVS A;  4A6E A;  3FK7 A;  2L5Q A;  1F9N A;  2L9S A;  1KQ9 A;  3S3O A;  3CP8 A;  4B44 A;  2VL8 A;  1O4X A;  1KQ8 A;  1D1B A;  4NC8 A;  1W36 D;  4NHJ A;  2IS1 A;  2BY2 A;  1GV5 A;  4WF2 A;  4DJA A;  1U9N A;  2XAS A;  4KUM A;  5FLM J;  1SC7 A;  3CC2 I;  2M1B A;  3DEW A;  2IP2 A;  2Y0S N;  1EF4 A;  2EIM H;  3OY9 A;  1TBX A;  2DW4 A;  1LFB A;  4M3F A;  4KIG A;  3ERE D;  3CMY A;  5TIS C;  3WHC A;  1DGW Y;  1T95 A;  5J1Y A;  1LVK A;  4LK1 F;  3BPV A;  4B48 A;  3GUD A;  2VKE A;  2GBY A;  1IGN A;  4MNU A;  2V1X A;  5FD5 A;  2CS3 A;  4R1H A;  3E6C C;  2BEO A;  2JVG A;  3W3C A;  2DA7 A;  4DYC A;  2TCT A;  5HS8 A;  3ESW B;  2E1C A;  2Y31 A;  3CJR B;  1OCZ H;  4NC7 A;  4MHG A;  2DT6 A;  3EUH C;  2VBW A;  4FQG A;  5C44 J;  3ULQ B;  3OYJ A;  3FXL A;  4FE4 A;  3HSE A;  2NRA C;  2M7A A;  1K78 B;  4Y3O A;  4M9S A;  3K4J A;  2ELK A;  1DPR A;  5F0H A;  5LFA A;  3DLL F;  4L5E A;  3PFI A;  3OOU A;  4M3E A;  2R5Y B;  2YR2 A;  2K85 A;  2MYS A;  3OS2 A;  3NWT A;  1JUM A;  2KP6 A;  1XS9 A;  4B8X A;  3V7R A;  3AKZ A;  4M9X A;  3I53 A;  4DYR A;  3ZMU A;  1MMG A;  2DLL A;  4CCJ A;  3WU0 A;  3K1P A;  5DTD A;  1TP4 A;  1ENH A;  2V6E A;  3V8K A;  3GEZ A;  2LP0 A;  5L3D A;  1G59 A;  1IG7 A;  4FET A;  2YSR A;  3RQ4 A;  2R3S A;  2X85 A;  5GP9 A;  3RKX A;  2VJ4 A;  2XGE A;  4CCN A;  3QRF F;  3LNQ A;  2E1O A;  2HQA A;  1VQ6 I;  1P6R A;  1DPU A;  1FMW A;  1ON1 A;  5DDG A;  1TQP A;  1U5T C;  3K1M A;  1YJ9 I;  4A6D A;  4U0V A;  3DLA A;  4A3C J;  1OLT A;  4RM3 A;  3WU2 C;  2K02 A;  2KJB A;  4ON0 A;  4X0G A;  2XRN A;  4BU2 A;  1XMX A;  4M3B A;  3PL8 A;  4I99 C;  3V4G A;  2CQQ A;  2ISY A;  3IH4 A;  1TNS A;  2HWV A;  3BR2 A;  1BC8 C;  3LAJ A;  1EH7 A;  3FXJ A;  3K1N A;  1RR7 A;  2L9N A;  1YTY A;  1H88 C;  1FEX A;  3RKY A;  3KYL A;  1X4O A;  1SD7 A;  1RNL A;  2XVC A;  3PNT A;  4P55 A;  3LSK A;  3H92 A;  3REO A;  2HOT A;  5J4V A;  2D1V A;  4I6Z A;  1VFC A;  1PP8 F;  3E6D A;  1SVL A;  4IHW A;  2ZCW A;  3R6S A;  2QUF A;  1TQI A;  2XSJ C;  5E3L A;  1LB2 A;  3HRM A;  3CDH A;  1HKT A;  2A68 F;  3CF2 A;  2EFP A;  2YPR A;  2MGQ A;  3H5A A;  2JUG A;  3HDD A;  2COM A;  3G4S I;  3FHZ A;  4UVA A;  1W1W E;  4EQQ A;  3OYA A;  5GAD J;  3F8C A;  2FNP A;  1O7F A;  2PI0 A;  1SD5 A;  1YLF A;  2GXB A;  1L3L A;  1Z05 A;  4L0Y B;  1UG2 A;  1UHM A;  1IN8 A;  4C3H J;  1ZH5 A;  4GGG A;  1N25 A;  2HKX A;  4IXA A;  1PDN C;  5JVG F;  1MMA A;  5KAF C;  3HZJ A;  5F6F A;  2H09 A;  1IJW C;  3S17 J;  4YIR X;  1UEL B;  1O3S A;  4J00 A;  4ZYG A;  2VON A;  3VYS B;  2HZD A;  4CCL A;  2VPR A;  3GZ6 A;  3FBI B;  2PN6 A;  4XLH A;  3WE2 A;  1VQN I;  3IV5 A;  1R22 A;  5FRO A;  4M74 A;  3RIR A;  4IHX A;  4IF4 A;  3JRF A;  4HPQ A;  1YQA A;  2R7S A;  4H4K C;  5BOX A;  2K9N A;  3L9F A;  1ULY A;  1ZN2 A;  5IYB J;  1QU3 A;  1X1A A;  4Z6Y A;  4XN0 A;  5ILU A;  3MN2 A;  3CD6 I;  2EA4 A;  4BHC A;  3UKG A;  2ECC A;  1RRJ A;  2CV0 A;  3CCE I;  2QM3 A;  3F8N A;  3P9C A;  3CZ6 A;  3FX3 A;  3KLO A;  3DTI A;  3TDZ C;  4AIJ A;  3LSI A;  1FSH A;  1VQL I;  1CQT A;  3JRH A;  1FNN A;  5EF6 A;  3OYN A;  1HLV A;  4IRH A;  4LGW A;  4ZYH A;  1X3W B;  2E34 A;  3H5N A;  2MD0 A;  3TO6 A;  4F7Z A;  2EIL H;  3AAF A;  1T38 A;  2IPQ X;  3VB2 A;  1ZRE A;  1S6L A;  3M8F A;  4WK8 F;  2XAH A;  1VQ8 I;  2R7T A;  1VQ7 I;  5CJ9 A;  4BUP A;  1BI2 A;  2BXY A;  1ERD A;  3I71 A;  3EPZ A;  4IRG A;  2OQG A;  1FJL A;  3HKZ N;  3M8J A;  3NAR A;  4PZJ A;  2R7U A;  3EUA A;  5JLW A;  3K4M A;  3C1D A;  1FYK A;  3F9K A;  4G94 A;  1GDT A;  5FLX K;  4EVI A;  1BR1 A;  2DA2 A;  4FCY A;  2B0L A;  3CO6 C;  4AU7 A;  2V1D A;  1OR7 A;  2JMW A;  2KZV A;  2H1K A;  1IXR C;  4DW6 A;  5D5V B;  2VE8 A;  3F8B A;  3S15 J;  1RKT A;  1SFE A;  3NQO A;  2IJL A;  4BY7 J;  3CCL I;  3TED A;  2KFD A;  1YO5 C;  1ZHF A;  1G3W A;  5F04 A;  1KQ0 A;  3DXJ F;  4MEY F;  1B72 A;  2XC7 A;  3GYH X;  1FZP B;  2PJP A;  4ESB A;  2CW7 A;  5HLG A;  2DBB A;  3P9K A;  4LK0 F;  2LRE A;  4M6V A;  3GF2 A;  2K86 A;  4DIQ A;  2WB1 N;  1T6S A;  2WBM A;  3P5J A;  2GIZ A;  1UZC A;  4EJO A;  3S93 A;  2X51 A;  4MQ9 F;  4R8H A;  2F4M B;  2X0L A;  3BC8 A;  4BDZ A;  1IRG A;  2M0C A;  4MFE A;  4IEJ A;  4AD9 A;  5L3G A;  5A2Q K;  2CQX A;  1DUX C;  3WTS C;  3FXU A;  3GTQ J;  4QSH A;  2AO9 A;  4HV6 A;  3COA C;  1E0E A;  4ZH4 F;  4BE1 A;  1IV8 A;  4KMU X;  5GPA A;  3GTO J;  3KZY A;  2HXI A;  2L7Z A;  3BR3 A;  2P6S A;  3DU6 A;  5DM6 F;  3DPU A;  2UZK A;  4HEA 2;  1ETK A;  3DQV C;  2MLK A;  3TOA A;  1LE8 B;  3WTU C;  1BN5 A;  2CO5 A;  2N8G A;  4XLC A;  2ZFW A;  3R0J A;  2R7V A;  3DP7 A;  3M4O J;  1N78 A;  4LFU A;  3BR5 A;  4CDG A;  5FJ8 J;  1X4P A;  2F5C A;  4XL9 A;  4HDU A;  1MSF C;  4RGR A;  3HOV J;  3JAM Z;  4M9Z A;  1ZR2 A;  4CCO A;  1Q1V A;  5M5Y J;  2GWR A;  2YU3 A;  3VFZ A;  4GYG A;  2WWY A;  5ILS A;  3G71 I;  1EJ9 A;  2BGC A;  5H2F C;  4CCM A;  1BR2 A;  2LKP A;  4IOA F;  5GAG J;  5DCF A;  5C3E J;  5LRR A;  4YFK F;  4E7K A;  2V9P A;  1JXS A;  3BJA A;  2IGO A;  1KON A;  1UJ8 A;  3MZH A;  3QYE A;  1IN4 A;  2HFH A;  1R71 A;  1XX5 A;  3OS0 A;  4JK1 X;  4PJJ A;  4ZJZ A;  2CQ7 A;  2CW0 F;  4I2O A;  3HYI A;  5ICF A;  4EGY A;  4YG2 F;  2KRF A;  4B3A A;  2H1L A;  3CC4 I;  3FKJ A;  5D4S A;  5C4X J;  2A3S A;  2OA4 A;  2XRL A;  2VXZ A;  4D5C A;  2Z16 A;  1S29 A;  4II2 A;  3DCF A;  4XIC A;  4G7H F;  1BI1 A;  1QZY A;  4A3B J;  1XSD A;  3S1M J;  1ORK A;  2JUC A;  1IRX A;  2NVQ J;  1R5I D;  3LOC A;  3CF5 F;  5GPC A;  3PUB A;  3OL4 A;  5CVV A;  1K83 J;  1YIO A;  2HOE A;  3SXY A;  3HBL A;  1S7O A;  2W85 A;  1JT0 A;  1HKS A;  3FHN A;  4D7N A;  1WJD A;  3GLX A;  2EFN A;  3HTS B;  3GME A;  3CLO A;  4AIK A;  2FQ3 A;  3HKZ A;  3WHB A;  1WFX A;  3QAH A;  4XKV A;  5F08 A;  1MJB A;  4DGW B;  1OIS A;  1ZRF A;  4Y52 J;  4GCV A;  1F4K A;  5D5U B;  3HUG B;  4V2G A;  4XLE A;  4BQA A;  4L9J A;  1P4X A;  3UNG C;  3SEQ A;  2LY1 A;  2AQF A;  3ZMS A;  5EGO A;  1MJA A;  2O3F A;  2M45 A;  3A1Y A;  3FMQ A;  1T08 B;  3ZMZ A;  5K7Z A;  4XLN F;  4G6D A;  3VYU B;  3OYB A;  3BP8 A;  4EJW A;  2DOF A;  2F5E A;  3BTC A;  1GVD A;  3DEU A;  4E6K G;  3LL7 A;  3L1P A;  2BW3 A;  4YII A;  1ZG1 A;  2ISZ A;  1A04 A;  1RKW A;  2JA7 J;  3CCJ I;  3I4M J;  2G9W A;  4LG0 B;  2P4W A;  2E71 A;  1B9N A;  5LEJ A;  3CCR I;  5BPD A;  4FT8 A;  4GFB A;  3MZY A;  3KFW X;  5ICE A;  4C2M J;  4UV8 A;  3PIO F;  3QU6 A;  1ZR4 A;  4AYB N;  2R5Z A;  2BE5 F;  3I4P A;  3K10 A;  1MH4 A;  3OR1 C;  4HLX A;  1D1C A;  3I3L A;  4Y4R A;  3RPU D;  3IL2 A;  3HG9 A;  3F22 A;  1V4R A;  2ME6 A;  2OU2 A;  4IX7 A;  1K4S A;  3F6O A;  2EQR A;  3SHF A;  2RGV A;  3GFL A;  4XSZ F;  5DD8 A;  3ABK H;  2GA1 A;  1HQC A;  5LHI A;  4C30 A;  3VDX A;  1LEB A;  2H8R A;  2DI3 A;  2M7B A;  3I59 B;  1GLN A;  2A5W A;  3H3V K;  3U1K A;  2WAE A;  4C2T A;  1MZB A;  5LGU A;  3GTJ J;  3FIS A;  1TW2 A;  3GO5 A;  4KNY A;  3LSR A;  3OWT A;  4XON A;  3TOB A;  4U0Y A;  1RUO A;  2RNG A;  5CPR B;  4BQO A;  5LRS A;  4HG2 A;  4FAS D;  3ZR8 X;  5KCM A;  2KRH A;  3L2C A;  3HHH A;  1MD0 A;  1MDM A;  4RAY A;  2W48 A;  2EWN A;  5J8C A;  4A0X A;  4Y33 A;  4BQN A;  2A69 F;  1HXD A;  4A5M A;  1Y39 A;  2GAU A;  2DMP A;  1TWG J;  3SDB A;  2LLK A;  1FY7 A;  1U9O A;  5DCM A;  5B66 C;  3S2W A;  3LST A;  2K3P A;  4JOM A;  3O8H A;  1HKQ A;  4KYW A;  1B8I A;  2FOK A;  1Z3X A;  3JAM K;  2PMZ N;  4G12 A;  3NAU A;  4ABZ A;  3ABT A;  3IAS 2;  1Y8R B;  2DA5 A;  2YX4 A;  1QPI A;  1SMY F;  5HLH A;  3MKL A;  3K2Z A;  4E7J A;  5HS7 A;  1QHH D;  2Y48 A;  2OAZ A;  3DV8 A;  1BBY A;  1W7P B;  1XDS A;  3KEO A;  4RAG A;  4AWX B;  1IUF A;  1D0Z A;  1GUU A;  2BOL A;  2HPI A;  3MAJ A;  2VBZ A;  3FBN B;  5FFX A;  2JZY A;  2F48 A;  2LC2 A;  3QP5 A;  3E5Q A;  3H3U A;  1XCV A;  1MND A;  5FKK A;  1BW6 A;  1D0Y A;  4CCK A;  2E2I J;  2QZ8 A;  2ZME C;  3HTU A;  4RLF A;  1LKX A;  3I9V 2;  2RQP A;  4PDK A;  4BQQ A;  3ABU A;  3M1E A;  1BI3 A;  2A6E F;  5FO5 A;  3AL0 C;  1QVT A;  3QPS A;  1OCR H;  5EZG A;  3OYG A;  1FC3 A;  2PMZ A;  3B73 A;  4RAF A;  2KIM A;  3ASN H;  3LSH A;  5IT9 K;  5E1Z B;  2L01 A;  2IA2 A;  3PO3 J;  3H5R A;  1U0J A;  3G6E I;  4PJN A;  3ZQQ A;  2FOW A;  2H94 A;  1O3Q A;  1YIT I;  2NS0 A;  3ZXS A;  4X6A J;  3BG7 A;  2E7X A;  3KPH A;  4YRV A;  5K1Y A;  3OL3 A;  4DZJ A;  2FBK A;  1GXQ A;  2CRG A;  4EJU A;  5HLI A;  4I09 A;  2O03 A;  3QPL A;  4OAY A;  5B3S H;  1HW1 A;  4V2F A;  2GOX B;  2DA3 A;  2HYJ A;  1Y8Q B;  1ZGJ A;  4HF0 A;  1AOY A;  1BI0 A;  3CQZ J;  1ZG5 A;  3OSF A;  3HSR A;  2O7O A;  1J2X A;  3SQN A;  3OYF A;  1R1T A;  3WGH A;  4LB6 B;  2DOD A;  4LLN A;  4RLQ A;  1VQ4 I;  1Z77 A;  1RZ4 A;  1T98 A;  1IN6 A;  4WXH A;  2DA1 A;  4MTD A;  4IO9 F;  2R5Z B;  4BDY A;  5HOD A;  5HLT A;  4DOZ A;  4I0B A;  1LFP A;  1FLI A;  1VZ0 A;  3ZQG A;  4E7Z A;  1FSE A;  1GHC A;  2VQH A;  3CME I;  1S3J A;  1IN5 A;  3A0B C;  1TT5 B;  1QO0 D;  1ETY A;  4CO8 A;  2TDX A;  2ZJ2 A;  4NQW B;  4Y7N J;  2O6G E;  2KMU A;  2VUM J;  2WAD A;  4RGX A;  1P4A A;  2HYG D;  5H6Q A;  4ZYA A;  3JTH A;  4BL0 B;  4HX8 A;  2CUF A;  2XUB A;  3FMR A;  2B9S A;  3B6A A;  5DUK A;  2E1M C;  5IPA A;  3Q5F A;  4F93 B;  2K5C A;  1ZYR F;  3GZN B;  1XSV A;  2FRH A;  3ZQF A;  4FTH A;  3CCS I;  4I76 A;  2O8K A;  5IP6 A;  3HRS A;  4XID A;  3OOP A;  3KP5 A;  1XTA A;  5K5R A;  1Y56 A;  3HUG A;  5L3E A;  5C4J J;  3CJN A;  3HOX J;  2LOO A;  5EDN A;  4FIS A;  3CDL A;  4RAZ A;  1K4T A;  1JTX A;  5KK1 A;  2IGN A;  2QF7 A;  3DEE A;  4XSX F;  2CG4 A;  2EZL A;  1WJE A;  2WY7 Q;  2NVU B;  1T2K A;  3U2R A;  3J80 Z;  3HHG A;  5CQG A;  1DU0 A;  2EH3 A;  4OMZ A;  3C3W A;  1XPX A;  1YX5 A;  1YW7 A;  3DBR B;  3GTK J;  1NG7 A;  4XQF A;  4KN7 X;  5BPI A;  2VN2 A;  1LJ9 A;  1R6R A;  3FIW A;  4RA2 A;  3ZMT A;  1X1C A;  5F0C A;  4LG0 A;  1JTY A;  1AA7 A;  1O7L A;  2DOE A;  2HQR A;  4I0A A;  3FM3 A;  3OS1 A;  4MFD A;  2K7L A;  2RKH A;  3QP6 A;  1RUN A;  1IZ1 A;  4R79 A;  1WHU A;  1B6A A;  1TWH J;  4EM0 B;  1R5H A;  2IGK A;  2RVC A;  5J8F A;  4QLC U;  4UV9 A;  1FOW A;  4OWR B;  2D45 A;  4N4O B;  3DKX A;  3I54 A;  2JA6 J;  3BG3 A;  3HGG A;  3PQK A;  4HF2 A;  5FB2 A;  4MQV A;  4KFC A;  4HF1 A;  4W1U A;  5HDK A;  1V5G A;  1FX7 A;  2JA5 J;  1K6Y A;  4IL6 C;  3QU3 A;  2EZH A;  4HV5 A;  4GO1 A;  2JRT A;  1A6I A;  2PLY A;  1BOA A;  5LHH A;  2CW8 A;  2HXO A;  3IH3 A;  2YU9 J;  3DFG A;  2EPF A;  1ETQ A;  4NB5 A;  3E6M A;  3FXQ A;  1GV2 A;  2LY9 A;  1YS7 A;  3VEP A;  3FK6 A;  2OUM A;  4IQJ A;  2IEK A;  5GAH J;  2FNA A;  4Q47 A;  1AHD P;  2IGM A;  2EK5 A;  2A5Y B;  4YFX F;  1UG0 A;  2Y30 A;  1G4D A;  1TWF J;  3CMA I;  3S1N J;  1BJA A;  2HQ5 A;  2X48 A;  2XAU A;  3KX2 A;  3LQR A;  1D0X A;  2GXG A;  3TDU C;  4PJM A;  4Z2Y A;  1WJB A;  4ITV A;  4KIT B;  4BJ6 C;  1J09 A;  5JVT A;  1XGM A;  3H0D A;  3EDP A;  3H9J A;  3M7G A;  1SMT A;  3LMM A;  1G6N A;  1VQM I;  2W84 A;  5BQT A;  3V7S A;  4S0H B;  2ZBK A;  5IOY A;  5CVR A;  4CZZ A;  3FXR A;  2ZME B;  2F6C A;  4WXD A;  4YEL A;  2JA2 A;  3CCQ I;  2NNY A;  2LFB A;  3ZQC A;  5DYM A;  2CUE A;  5B1A H;  2DYR H;  4PFO A;  2G0E A;  3J7Z I;  3K9T A;  5D5X B;  4P9F A;  4IQ4 A;  4C3I J;  3P9I A;  3KEQ A;  5GTH C;  2LDU A;  1AKH A;  4RM2 A;  3SJM A;  1LDK B;  2QBY A;  3PIP F;  2F5D A;  1N77 A;  2A6T A;  2K9S A;  2RAE A;  4A3J J;  1A5J A;  2K3F A;  3H36 A;  1G3S A;  1U6G A;  1LEA A;  1Y6I A;  4XK4 A;  2OZ6 A;  3S32 A;  3I59 A;  4L9V A;  3TO9 A;  4AYB A;  4A3K J;  1UCR A;  1OR7 C;  3AG1 H;  3F8F A;  2R7W A;  1D5Y A;  2E2H J;  1HOM A;  3IWF A;  5K5O A;  2JA8 J;  2GZW A;  2XPW A;  5GAE J;  2R7X A;  4RDU A;  3MFK A;  4WX9 A;  4E7H A;  2F5F A;  1OKR A;  4LIU A;  4UB6 C;  2CH0 A;  4CGZ A;  1B1B A;  1TC3 C;  2E1M B;  1Z91 A;  2I10 A;  1OFC X;  2AS5 F;  4RB3 C;  4D7M A;  3OV8 A;  3GLL A;  4UVC A;  5EZH A;  1A31 A;  4CUG A;  4XRF A;  2ZNZ A;  3J80 K;  4IOC F;  1DGR M;  2R93 J;  2WTE A;  3G1M A;  4M3G A;  5TGT A;  2WC2 A;  2Z9O A;  2V79 A;  2IS6 A;  5DS9 A;  1IXC A;  4E70 A;  5IOZ A;  1J5Y A;  2DOA A;  4C3J J;  4MTE A;  2LH9 A;  1MMN A;  4U0W A;  2JSC A;  2KIQ A;  1XD7 A;  4JBA A;  3S2D J;  1MMD A;  1X19 A;  3PQJ A;  3J81 Z;  4K2E A;  4W97 A;  3SDG A;  3TL4 X;  5FKO A;  3DBL B;  1PJR A;  2MD5 A;  3IRR A;  1QNT A;  1RIO H;  3GTM J;  2QSF X;  3HM5 A;  3CUQ B;  5E1W A;  1HSJ A;  3PSI A;  4HNV A;  2UXN A;  5J1U A;  2P6T A;  4O5V A;  5E79 C;  4XRS G;  1UMQ A;  4BNC A;  3D0S A;  1X1P A;  4Y17 A;  3ZMV A;  3GBG A;  3FZV A;  3I58 A;  3Q3S A;  2HYF A;  4HQE A;  3O3K A;  2LMD A;  3GX4 X;  2ZKZ A;  2K27 A;  3ML6 A;  4N0B A;  1WI9 A;  1YOV B;  4L9N A;  2G7H A;  1APL C;  4UUS B;  2GLO A;  5LHG A;  4LIT A;  5D5W B;  2CYY A;  2IA1 A;  1Z67 A;  3QOE A;  1P2F A;  2XAQ A;  2H8W A;  2OC6 A;  2Z5U A;  3OYD A;  5B1B H;  3I4N J;  2VJ5 A;  2KHM A;  3ELK A;  4ZYE A;  3A01 B;  4JX4 A;  2DFE A;  2P7V B;  2HQN A;  3AL0 B;  3S14 J;  1KYW A;  2LKX A;  1OYW A;  1K6O A;  2YX7 A;  1AWC A;  4UUV A;  2HPM A;  1EH6 A;  2VJJ A;  2Z99 A;  2LTP A;  2Y0M A;  4ESF A;  1VQP I;  3GFM A;  5LEK A;  3V8L A;  1R1V A;  3WTT C;  3K70 D;  2IRF G;  4DNC A;  2AXL A;  3FF5 A;  3NEU A;  4EAT A;  3JRD A;  4A12 A;  1U5T B;  1E3H A;  1QRY A;  4XKW A;  4F92 B;  2FBI A;  2DFF A;  3O8G A;  3D1N I;  3ZQH A;  4DZP A;  1WH5 A;  2PMU A;  3EUH A;  1J59 A;  3IKV A;  1SAN A;  5E3N A;  2FSW A;  3VOE A;  1XGS A;  5M5W J;  2FX0 A;  3ZCO A;  2EB7 A;  3O6B B;  1TW3 A;  1T33 A;  3RPQ A;  3ZQ7 A;  5GTI C;  4H0E A;  3IUO A;  2HVQ A;  4NBQ A;  3N97 A;  2ZJR F;  2L2O A;  2WAQ A;  3HPH A;  2QKL B;  3A4C A;  2J5O A;  3GFI A;  1GXP A;  5FLX Z;  3LWF A;  2L7F P;  3N05 A;  3W6J B;  5E18 F;  4QTR A;  1H0M A;  1RI7 A;  3Q0U A;  2FUG 2;  3DTE A;  1B59 A;  3DKW A;  3T8T A;  2Y2Z A;  1R00 A;  3S1Q J;  1RET A;  1TWA J;  2DAO A;  2EJR A;  1Z7U A;  1K7A A;  1T56 A;  2STT A;  1ONV A;  1USS A;  1DP3 A;  2IT0 A;  4ZZD A;  2IW5 A;  2EV0 A;  3S3M A;  1PYV A;  3LFU A;  4P96 A;  5JHF A;  2DTZ A;  1F5T A;  2VOP A;  5IY5 H;  1JGG A;  2I5U A;  4XNF A;  3TMO A;  2BYV E;  2EZK A;  4HW0 A;  5IYC J;  5CYV A;  2JPB A;  3KCC A;  3OIO A;  2X6Y A;  4CHU A;  4L18 B;  3WTV C;  1H8A C;  3VSL A;  1ZK8 A;  3AFH A;  1WZ2 A;  2A07 F;  4EM2 A;  1XCB A;  2VLA A;  3PJR A;  1X1D A;  2HZT A;  2P7C B;  2NVX J;  3E7L A;  1NG6 A;  2ELH A;  2Q2E A;  3MWM A;  1JUS A;  3R4K A;  4ZYD A;  3L2U A;  3L2W A;  1GT0 C;  2HTS A;  1ETW A;  4G9Y A;  4J01 A;  4IHV A;  4NUB A;  2NVT J;  1HA8 A;  2VI6 A;  2KJC A;  2IBD A;  1TL8 A;  3K7A J;  5FFZ A;  2XGD A;  1E3P A;  2JN6 A;  5EEH A;  4B09 A;  3D5S C;  2W57 A;  1OMI A;  1QA6 A;  5ED4 A;  1W0U A;  2QQA A;  4OIR F;  4DYQ A;  2I8D A;  3DBH B;  3BJ6 A;  5H20 A;  2DYS H;  3JRB A;  3RTR A;  1WWX A;  4NC6 A;  1VND A;  3L2V A;  1TNT A;  4EM1 A;  3LA3 A;  2VKV A;  2GIV A;  5D8K B;  2J5P A;  3WU1 B;  1V55 H;  2QQ9 A;  3L2R A;  1SFK A;  3HOY J;  2XGC A;  3LSP A;  2OTJ I;  2V9K A;  3G1O A;  2KT0 A;  3Q0V A;  2HNH A;  4RB0 A;  1IO2 A;  2K9M A;  4PFP A;  4M72 A;  1R49 A;  3C18 A;  5E3M A;  1W7P A;  3WTZ A;  1OCC H;  4II3 A;  4DBR A;  3ISP A;  4A93 J;  1Z7L A;  5KAI C;  1I6X A;  1D3Y A;  2VT2 A;  1CF7 B;  1ZLJ A;  3J81 K;  3BZK A;  2EFQ A;  4LB5 A;  4ZDP A;  2ESH A;  2UUZ A;  3E5X A;  2DMU A;  1KU7 A;  3H9Q A;  2HR3 A;  2ACJ A;  4GYI A;  5J40 A;  3FXM A;  3PUF A;  4Q5S F;  2KRC A;  5K5Q A;  2LVS A;  1OCP A;  3ZQI A;  1A36 A;  2KZG A;  2CSO A;  2CUJ A;  3WGI A;  2KIS A;  3FMS A;  1H89 C;  4LD5 A;  4EJV A;  3H0G J;  1IC8 A;  5IYD J;  1X3U A;  3MZ8 A;  2CWE A;  3MD2 A;  4BHP A;  3D5R C;  4GRI A;  3S2H J;  1AKH B;  5EEA A;  2LYC A;  1WKM A;  2EZI A;  1WI3 A;  2M4G A;  2AXT C;  2QQB A;  5M3M J;  3U1D A;  2EFW A;  3F6V A;  3KE2 A;  1I3Q J;  2W00 A;  1XMK A;  2OQR A;  2R5Y A;  1FIA A;  4AID A;  1HST A;  3OYI A;  3QOP A;  1K78 A;  3ZQL A;  1S5L C;  1H9T A;  3L09 A;  2HU9 A;  4S04 A;  4MEX F;  3U9G A;  3K70 C;  1XG1 A;  4PSW A;  3EET A;  4XN3 A;  3K4L A;  3CO7 C;  1BA5 A;  2L3D A;  2W7N A;  4A3G J;  1J9I A;  4A3E J;  3M07 A;  4A3L J;  1IXS B;  2FE3 A;  1Z3Y A;  3DF8 A;  4N9H A;  5L3B A;  5J6X A;  4JX6 A;  2DJN A;  2W82 A;  1HW2 A;  1D8K A;  2R7F A;  1E3O C;  1P7J A;  3CCU I;  3T0Y A;  1A35 A;  4CXF A;  1MW7 A;  2EV6 A;  5ILV A;  2PQ8 A;  2LSO A;  3IHU A;  2XAF A;  3BOQ A;  4QWQ A;  2DQL A;  2BW3 B;  1DDN A;  2VE9 A;  3PFY A;  1JHH A;  4M73 A;  1X58 A;  2KLO A;  3S3N A;  4BYY A;  3HXL A;  3NRV A;  1W0T A;  2X6O A;  2E1N A;  2R4G A;  3KZI C;  2BV6 A;  1U8B A;  3I5U A;  2O61 A;  2LKS A;  1W5S A;  2OPT A;  2LF7 A;  1IDZ A;  3TW7 A;  3RYR A;  4EV0 A;  3FKI J;  3TO7 A;  2Y9Z A;  3WG7 H;  1VQ5 I;  2ESN A;  5CVJ A;  2XF7 A;  4XLP F;  2XDV A;  4TV7 A;  4F55 A;  3S8P A;  3VSK A;  5M3F J;  5TRD A;  1JUP A;  1NH3 A;  2IA0 A;  4IVN A;  3OSG A;  2CV1 A;  2L4A A;  5IT9 Z;  2VBX A;  4M71 A;  1MIJ A;  4XBF A;  4B43 A;  2E7W A;  1UAA A;  2VC0 A;  5DD4 A;  4N4N B;  2DA6 A;  4KN4 X;  1LQ1 A;  3Q0W A;  2DT5 A;  3HGY A;  3KYD B;  4LJZ F;  4M6X A;  5E1X A;  5LD2 C;  1CF7 A;  4ASN A;  3VOD A;  4BJT A;  2L54 A;  4M6Y A;  5EEG A;  1G8X A;  3HPG A;  3CC7 I;  4BE2 A;  4NNJ A;  1NTC A;  5CQE A;  1RR8 C;  2M8E A;  2O0Y A;  2QEX I;  2QYO A;  4JX5 A;  1TWC J;  4EMS A;  4N9I A;  3MEX A;  4QPO A;  4ZDL A;  5TJJ A;  1OJL A;  3KZZ A;  1B72 B;  2FML A;  2IXS A;  2DDB A;  5LGT A;  3P7N A;  5HNH A;  1ETX A;  2ZXH A;  3R0A A;  4M3D A;  5D6F A;  4IJA A;  1YRN A;  2EIN H;  2BHY A;  2E5N A;  2L7K A;  1B9M A;  2WY8 Q;  3W2A A;  2EIK H;  2VKD A;  1ZAO A;  3BG6 A;  3WTW C;  2A05 A;  3GCM A;  3K4K A;  1EKE A;  4PSX A;  4HLY A;  1JI8 A;  3TW6 A;  1TQM A;  3HL2 A;  1BC7 C;  3PSF A;  1MBE A;  2B63 J;  2PFB A;  3BT9 A;  1WRJ A;  2O5R A;  1STZ A;  2FBH A;  1IRF A;  3ZN0 A;  1W5T A;  1VQ9 I;  2W24 A;  1WCM J;  5HS9 A;  3HOU J;  5E8I A;  3RZD J;  2V26 A;  2LD5 A;  4CSW A;  3BJO A;  3ZRG A;  5M5X J;  1R1U A;  4ZZL A;  5BMZ A;  1R4M B;  2XV4 S;  1UB9 A;  2DMN A;  2XKP A;  4IKF A;  6PAX A;  2ZME A;  2ZNY A;  2HDC A;  3HRU A;  2FA5 A;  2K4B A;  2NAZ A;  4NQW A;  3CJT B;  1IV6 A;  5E20 A;  3KP6 A;  4KIF A;  4D0P A;  1IRZ A;  3CES A;  1YJN I;  1YW8 A;  3JRA A;  1PUF A;  1JGS A;  4AUX A;  3JRG A;  4F52 A;  2DK5 A;  3JRC A;  2K4J A;  1WJC A;  2VBY A;  2Y69 H;  1U8R A;  1EA3 A;  3K69 A;  1T8I A;  2JSP A;  1ZRD A;  2HEO A;  4PCQ A;  2H27 A;  1OCT C;  3CMM A;  2C6Y A;  1KA8 A;  1LNW A;  4A0Z A;  4F91 B;  1YW9 A;  3H35 A;  3IC7 A;  5K7H A;  2GXA A;  2M2E A;  2VQC A;  4ZC3 A;  1KZH A;  4V19 K;  4BHB A;  4BXU A;  1IN7 A;  2PBI A;  3HB9 A;  1I27 A;  3SZP A;  3WG9 A;  2EV5 A;  2P0W A;  4RBO A;  3T1B A;  4L0Z B;  2KQR A;  3RZO J;  5J4Y A;  5FKL A;  2WAF A;  3K6G A;  5LGN A;  1YX3 A;  1WGX A;  1W5C C;  1Y0U A;  4BKX A;  3AG3 H;  1SD4 A;  2XHK A;  2Q2E B;  5FRM A;  1LUJ B;  3AG4 H;  3F21 A;  1NK2 P;  2G7U A;  4XRM A;  2GA2 A;  4OAZ A;  4E7I A;  2VXD A;  3A02 A;  4FHT A;  3K4B A;  2LBF B;  4CYC B;  3HEF A;  3CCV I;  1I5Z A;  5ICC A;  2XF5 A;  1PUE E;  4HSR A;  4C9Y A;  2XB0 X;  2P5V A;  3ZP5 A;  1S9H A;  4B3X A;  2WV1 A;  2ETH A;  3BWG A;  2QKM B;  3WOD F;  3KYC B;  4XLA A;  5B5E C;  4L5J A;  3DKY A;  4BH9 A;  2Z2S B;  3RKW A;  5FD6 A;  3A2K A;  2PX9 A;  3PM1 A;  2HGC A;  4GXO A;  2QEN A;  4BEH B;  1P4W A;  1BJZ A;  4HRI A;  3E3V A;  2VC1 A;  3E97 A;  1QVU A;  2D1H A;  2DXI A;  3MKY B;  2QVO A;  3AG2 H;  5DM7 F;  2DDA A;  2CU7 A;  2KIF A;  4HOB A;  4HNU A;  1QZZ A;  3CP2 A;  1W36 C;  2DO7 A;  3CUO A;  1MH3 A;  1X2M A;  2AQE A;  2VAS A;  3SYT A;  3I64 A;  1XGN A;  3TBI A;  4BY1 J;  3W6K B;  2QA4 I;  1E17 A;  2XF6 A;  3LA2 A;  3I56 I;  1X3Z B;  3G1L A;  4CYC A;  2FF4 A;  4I98 B;  5FKN A;  3ZOB A;  3M8E A;  5IP7 J;  4PGG A;  4ESJ A;  3OIQ A;  3CCM I;  1MGT A;  4LLG F;  2OV7 A;  2K9L A;  3O2P E;  2ECB A;  3MVP A;  4MO7 A;  3LA7 A;  2M87 A;  1MNM C;  4BGD A;  5J47 A;  4I02 A;  1R7J A;  1IUY A;  2DCE A;  4G7Z F;  1VTN C;  4G7O F;  5EYR A;  4AC0 A;  3RKQ A;  1LVA A;  5ICG A;  2Q1Z B;  1E2X A;  1O57 A;  2RN7 A;  2RDP A;  4EGZ A;  3IRQ A;  1QBJ A;  5E17 F;  3QOD A;  4LLL A;  3J7A O;  1D5V A;  2WA0 A;  2NXN B;  2HOA A;  2L02 A;  1EV7 A;  4XKB A;  9ANT A;  4A3F J;  3M9A A;  3GW2 A;  4KIB A;  2NS8 A;  4NDL A;  4LG3 A;  1MBJ A;  2BVL A;  4FE7 A;  5HDN A;  3F8M A;  3EYI A;  1JKP C;  2D5V A;  3EUK L;  1O3R A;  2WAQ N;  1Z6T A;  4UB8 C;  5KHD A;  4OIN F;  4AIH A;  5HVQ C;  2R7R A;  1JKQ C;  5F27 A;  2OF7 A;  1KU2 A;  2HI3 A;  2ADU A;  2DFI A;  3HOS A;  3QYB A;  2VPL A;  2BXZ A;  5CLS A;  1WJA A;  3S1R J;  1HF0 A;  1YG2 A;  2XGX A;  3V8J A;  2H6B A;  4BAY A;  1UHS A;  4B1R A;  1HDD C;  3E6B A;  3JSO A;  2JQ7 A;  4FX4 A;  3VYT B;  1Z0X A;  4CA0 A;  3TP3 A;  3MKZ A;  1XSX A;  3MQ0 A;  1R4N B;  2HDD A;  2ZSI B;  4P1W A;  3G73 A;  3BR6 A;  2F5V A;  3FM5 A;  5JLX A;  5JFR A;  1VI0 A;  3W2V A;  3G2B A;  1L0O C;  1HCR A;  4HYE A;  1X1B A;  4YIF A;  1SFO J;  4ZTJ A;  1ODD A;  1RES A;  2V9V A;  4PJL A;  4C2U A;  4PGH A;  1FYL A;  2LY2 A;  1Y0N A;  1JKR C;  2WB1 A;  1Z9C A;  5ERI A;  3EYY A;  2R7Z J;  3VPR A;  4A69 C;  2P8T A;  2JRM A;  3BG9 A;  3QYF A;  4KT6 A;  2V6C A;  2MC3 A;  3F72 A;  1T0F C;  4PJ0 C;  2ZFU A;  2CV2 A;  3IH2 A;  4LMY A;  4IZZ A;  1RPW A;  2W25 A;  2CUZ A;  1ZQ3 P;  4KDP A;  3ASO H;  2ELJ A;  3V7C A;  1ZGW A;  3FXO A;  2VB6 A;  2M34 A;  5EJC A;  5EG0 A;  4DBQ A;  1YFH A;  2UWM A;  1MNE A;  4UUS A;  3KP2 A;  2W1O A;  3IAM 2;  3KIO A;  1XB4 A;  1C0W A;  2MH2 A;  2IVM A;  4HDV A;  1KU9 A;  1BOB A;  4PUS A;  1B8I B;  4IHS A;  4RGU A;  2WV0 A;  4LIV A;  2B7E A;  2JTV A;  4P9U A;  2DN0 A;  4CH7 A;  3CDI A;  2X1E A;  2EFO A;  3IWZ A;  1P9Q C;  1DQU A;  1KU3 A;  4HA8 A;  1VF9 A;  2HVR A;  2QSG X;  2A6H F;  3S16 J;  3BR1 A;  3FDY A;  2HDW A;  2OTL I;  1WQ2 A;  2R0Q C;  1YI2 I;  2FXA A;  3BZC A;  2OBP A;  2KPM A;  3BZ6 A;  2M8G X;  3ROU A;  4Y13 A;  3M3Y J;  4CZC A;  2FQ4 A;  3BCA A;  3D5L A;  2E5Z A;  4XMY A;  3SEZ A;  4OIQ F;  5A2Q Z;  1D8J A;  1FYM A;  1I1G A;  1LDJ A;  4XOR A;  3K2A A;  2LRD A;  2RRE A;  3BPX A;  1F1Z A;  2ZXI A;  1F36 A;  5JR3 A;  3PO2 J;  3CTA A;  4ZDO A;  2BHZ A;  3KP3 A;  2BBY A;  2EBI A;  2LK2 A;  2IS4 A;  4O6J A;  3JRI A;  2A61 A;  1WJF A;  3DTK A;  2R7O A;  2Z3Y A;  3JSP A;  4CIC A;  2NYX A;  4IHT A;  3LSJ A;  4HQM A;  3ZMD A;  3X2Q H;  1ACI A;  3HOW J;  3RDI A;  1W4M A;  2XB5 A;  3I55 I;  1HW5 A;  5J1R A;  4WXC A;  1NK3 P;  2DMT A;  1HC8 A;  2XAG A;  4G6T B;  4E4H A;  3BRO A;  2P5K A;  1MMS A;  2K40 A;  2DFH A;  2X6X A;  3BY6 A;  2VOD A;  3L2Q A;  1AU7 A;  3BG5 A;  2BY1 A;  4QIW N;  5LBQ A;  2MBF A;  2DMQ A;  2VKH A;  3BLY A;  4RMN A;  3K0L A;  4ENJ A;  2MC4 A;  1N75 A;  1POG A;  4KIC A;  3I0T A;  1LPQ A;  3T5X A;  1K61 A;  2STW A;  2JK3 A;  1BIB A;  3BQZ A;  1ZAR A;  2PG4 A;  1NHA A;  2PJR B;  2M0M A;  3NWS A;  5EGO B;  4A5N A;  1Y1W J;  1J75 A;  1M1E B;  3OYH A;  1LE8 A;  2X1C A;  5L3C A;  2Y75 A;  5E3O A;  4O3M A;  1V54 H;  1TTY A;  2E35 A;  3RSN A;  4ETS A;  5FLV A;  1G2H A;  1ZEL A;  4UHT A;  2EIJ H;  3KP7 A;  4I01 A;  4XR6 A;  3B6C A;  4KMF A;  4U7B A;  2FMY A;  2JWT A;  1YHQ I;  2NOJ B;  5HOO A;  1VQK I;  2M4K A;  2ZSH B;  1BIA A;  1ETO A;  1HBX G;  3JCU C;  1BM9 A;  3G3Z A;  4JYK A;  1IF1 A;  1FOK A;  3DPL C;  1V3F A;  3JW4 A;  1IW7 F;  4KIS A;  2XPV A;  2XKO A;  1S7A A;  2RQQ A;  3C2G A;  1FOX A;  1Z21 A;  4OMY A;  3BTI A;  3R61 A;  4U7D A;  3OYM A;  2P81 A;  3WGG A;  2E19 A;  1ETV A;  4BEH A;  2VQG A;  2OJE D;  4OOI A;  1T0F A;  2MH9 A;  3TQN A;  3GZ5 A;  2OD5 A;  1PP7 U;  4UNO A;  2KL4 A;  2V1U A;  3M1C A;  1WSU A;  2PEX A;  4B4C A;  3BDD A;  3HC7 A;  4E7S A;  1DP7 P;  1FBU A;  5AIP A;  3VYR B;  3J7A Y;  3GTG J;  3TP0 A;  2E2J J;  1TZL A;  2DA4 A;  3IKT A;  3B02 A;  3E0J B;  2KDO A;  3PNY A;  3PNV A;  3V42 A;  2QWW A;  2V7F A;  5E8G A;  3QPT A;  3L00 A;  3CLQ A;  4MIM A;  5FRN A;  1YJW I;  2Y0S A;  3U21 A;  1WH7 A;  4LOC A;  2E36 A;  4YEJ A;  1KYZ A;  2M3A A;  1A6Q A;  2VJI A;  4KJZ A;  2Y9Y A;  5H6R A;  1MSE C;  2Z1D A;  3CCY A;  1QGP A;  3A03 A;  4HBL A;  1SAU A;  1SFX A;  2MG4 A;  2QCO A;  1I3A A;  3EQL F;  1R36 A;  3RQI A;  1IDY A;  3FXK A;  4HX7 A;  2DJI A;  2MW8 A;  3LSM A;  2ME0 A;  5L3F A;  5HNF A;  1FTT A;  3HRT A;  2M30 A;  3OIP A;  2VIX A;  2CFO A;  4EJT A;  3Q9V A;  2L9R A;  1MBH A;  1Q1H A;  4J19 A;  2NOG A;  5AON A;  2YS9 A;  3E1S A;  3GWZ A;  2GQQ A;  3GVA A;  4D5F A;  2M5W A;  5EG0 B;  2HS5 A;  4MGR A;  2ZC2 A;  2F4I A;  2LR8 A;  3WTY C;  4AM3 A;  1WVR A;  1FMV A;  3OYC A;  1REP C;  4OU0 A;  3J7Y J;  1TLH B;  1PVE A;  1JE8 A;  1MKM A;  1SVO A;  4FX0 A;  4U88 A;  4HZF A;  2P5L C;  3OYK A;  4OIP F;  2RV8 A;  5DUI A;  2HOS A;  1I6H J;  2VT3 A;  1LDD A;  1SEU A;  2Q8K A;  3HJE A;  3RJP A;  3F23 A;  5JI6 A;  1FPQ A;  3OYL A;  2AHQ A;  2CGP A;  2BY3 A;  2PMH A;  2X9D A;  2XRO A;  3JRE A;  3LAP A;  1OPC A;  4XM3 A;  1R5G A;  3MMY B;  2Z33 A;  1PUF B;  4ENN A;  3BTL A;  4ZTF A;  3A0H C;  4XKC A;  3QWL A;  2ZJQ F;  2DQR A;  2NNN A;  3H1C A;  3C7J A;  3H3Z A;  5CVU A;  4RB1 A;  1DU6 A;  1OCO H;  3GTP J;  2RC4 A;  2ICW G;  1P92 A;  1ZKG A;  2LBF A;  4BJ5 C;  1WPK A;  2DTR A;  1FP2 A;  2UV1 A;  4WWC A;  1Y1V J;  3GFJ A;  1OYI A;  4JP0 A;  5HDG A;  2LG4 A;  2LF8 A;  2R7Q A;  1QHG A;  3LQQ A;  3ONQ A;  3KEY A;  4B47 A;  4PK4 A;  1F43 A;  4QPQ A;  1MDM B;  1S8N A;  2QQ8 A;  4Y15 A;  2R92 J;  2V4J C;  1ZLK A;  4IHY A;  1LFU P;  3BCB A;  2X1D A;  1SVM A;  5FGM A;  2L0K A;  5IT3 A;  4I7H A;  2ZJP F;  4P5O A;  3DWL E;  1YE9 A;  4AVZ A;  1JJ8 C;  2L7M P;  3ECO A;  2DPD A;  1ZG3 A;  4BE0 A;  2LNB A;  2MLG A;  1XGO A;  3RCO A;  4X1E A;  1SAX A;  2MA3 A;  2IS2 A;  5CKT A;  2JT1 A;  2FEZ A;  1U5T A;  5KNL A;  2RNJ A;  1VQO I;  1ZTR A;  5D4R A;  2D2W A;  4IPA A;  3ZPL A;  1G3Y A;  4D1Q A;  1YYV A;  3A01 A;  1U3E M;  1T39 A;  1IAW A;  3F3X A;  4U87 A;  1BR4 A;  3JR9 A;  3ERM A;  3RPU A;  2DPU A;  3BTJ A;  3LFK A;  2BVM A;  5F1R A;  1K79 A;  3TGN A;  3UR3 C;  1TT0 A;  4RS8 A;  4UY8 I;  3ABM H;  5BNG A;  2ID6 A;  3R60 A;  1U78 A;  2DU9 A;  2OCE A;  2DK8 A;  3HOZ J;  3SFZ A;  3KLN A;  2TRT A;  2CQK A;  3QPH A;  1V5E A;  2XAJ A;  1FT9 A;  5DCM B;  4E7L A;  4CYD A;  1O3T A;  1V5F A;  2YUS A;  2BZT A;  4KT5 C;  4BBR J;  1JJ6 C;  1OYY A;  4A0Y A;  3C2B A;  1QPM A;  1I50 J;  4HAM A;  3WTX C;  1FBS A;  3L7W A;  3HOT A;  2KKO A;  2FJ1 A;  4UVB A;  4BXF A;  4ENM A;  1FTZ A;  2DT7 B;  1BW5 A;  2OCC H;  4HX4 A;  3RI4 A;  1U2W A;  2W4S A;  1XDU A;  3CUQ A;  4BS9 A;  3HSF A;  2FD5 A;  1ON2 A;  5F0F A;  5IP9 J;  1P7I A;  4HST A;  2MFZ A;  4XRS A;  2FU4 A;  2JVH A;  5D6E A;  3K4C A;  3ZGK A;  1MBK A;  2IAI A;  2QLZ A;  3IP4 B;  5DEQ A;  2V1N A;  1R23 A;  3C2H A;  1KGS A;  2ZXJ A;  3MKW B;  3HIF A;  5F1J A;  2JJ7 A;  2HTJ A;  4Q48 A;  4IRI A;  2ZB9 A;  2GM4 A;  2QSH X;  4XOT A;  2BY0 A;  4AVP A;  1ZRC A;  1FIP A;  4G6Q A;  4A3D J;  2X4H A;  4KA4 A;  1I1S A;  4OIO F;  2VOO A;  3LSG A;  2MAB A;  1SFU A;  4DQ2 A;  1JT6 A;  1Z1D A; 
#chains in the Genus database with same CATH homology
 2VJJ A;  4HNT A;  4BGD A;  3VYU B;  3OYB A;  2DCE A;  4E6K G;  3LL7 A;  3SZG A;  2BW3 A;  3K70 D;  2Q1Z B;  4EAT A;  3QOD A;  4ANJ A;  4XKW A;  3W2W A;  2WA0 A;  4F92 B;  1WJ5 A;  2GOM A;  4XKB A;  4BAC A;  4LG3 A;  2BVL A;  3EUK L;  3RPU D;  3K10 A;  3OR1 C;  4Y4R A;  3ZCO A;  1D1C A;  3I3L A;  3HG9 A;  5KHD A;  3OR2 C;  3IUO A;  2HVQ A;  2PJR A;  5HVQ C;  4IX7 A;  2R7R A;  3DPT A;  3HPH A;  2L2O A;  2WAQ A;  3HOS A;  2QKL B;  3A4C A;  3CJQ B;  3QYB A;  3K4N A;  4C30 A;  2VPL A;  3DU5 A;  3VDX A;  1WJA A;  2M7B A;  3N05 A;  1GLN A;  4D9J A;  2A5W A;  2FUG 2;  2WAE A;  3DTE A;  3VWB A;  4C2T A;  3VYT B;  3OWT A;  4XON A;  4CA0 A;  2E60 A;  3MKZ A;  2RNG A;  5CPR B;  4BQO A;  4HG2 A;  4FAS D;  2ZSI B;  4P1W A;  3ZR8 X;  5KCM A;  1DP3 A;  2KRH A;  2F5V A;  2VQL A;  3S3M A;  1PYV A;  3LFU A;  5JHF A;  3W2V A;  4Y33 A;  3G2B A;  4BQN A;  3H9G A;  1D1A A;  1X1B A;  4ZTJ A;  3SDB A;  4XLF A;  4XNF A;  3TMO A;  4PJL A;  4C2U A;  2LY2 A;  4XOP A;  2CMP A;  2WB1 A;  2K3P A;  2X6Y A;  3OMY A;  4JOM A;  4MLO A;  3VSL A;  3AFH A;  1Z3X A;  2X6W A;  3QYF A;  4KT6 A;  2VLA A;  3OYE A;  3PJR A;  1X1D A;  4JQF A;  1T0F C;  3IAS 2;  2ZFU A;  4F3Q A;  2CV2 A;  1NG6 A;  4IZZ A;  3L2W A;  4E7J A;  2CUZ A;  3L2U A;  1QHH D;  2HVS A;  4J01 A;  2ELJ A;  2VB6 A;  2L5Q A;  1HA8 A;  4NUB A;  2L9S A;  1D0Z A;  4DBQ A;  3S3O A;  2BOL A;  2HPI A;  3CP8 A;  2VL8 A;  4B44 A;  3FBN B;  1MNE A;  2UWM A;  2W1O A;  1D1B A;  2LC2 A;  3IAM 2;  4NC8 A;  1W36 D;  2IS1 A;  3D5S C;  4DJA A;  1BOB A;  1MND A;  4PUS A;  1D0Y A;  4CCK A;  2I8D A;  4RLF A;  4LIV A;  3OY9 A;  3RTR A;  1LKX A;  3I9V 2;  3L2V A;  4BQQ A;  4CH7 A;  2X1E A;  1DGW Y;  1T95 A;  3AL0 C;  1P9Q C;  1DQU A;  1LVK A;  4B48 A;  3OYG A;  1SFK A;  3L2R A;  2PMZ A;  2V9K A;  2HVR A;  3LSH A;  2CS3 A;  2HNH A;  2K9M A;  2JVG A;  3FDY A;  2HDW A;  3W3C A;  4PFP A;  3H5R A;  1U0J A;  4PJN A;  3ZQQ A;  2KPM A;  3CJR B;  4II3 A;  4NC7 A;  4DBR A;  2DT6 A;  3EUH C;  1Z7L A;  3ZXS A;  3OYJ A;  3BG7 A;  4CZC A;  4YRV A;  3BCA A;  3D5L A;  2E5Z A;  4XMY A;  2M7A A;  3OL3 A;  3SEZ A;  4Y3O A;  3K4J A;  4XOR A;  5LFA A;  2LRD A;  2RRE A;  3OOU A;  4ZDP A;  2UUZ A;  2ZXI A;  4OAY A;  3H9Q A;  2MYS A;  4ZDO A;  3OS2 A;  3NWT A;  2GOX B;  2KP6 A;  2KRC A;  2IS4 A;  3AKZ A;  2CUJ A;  1MMG A;  1WJF A;  4CCJ A;  3OYF A;  3DTK A;  2R7O A;  2V6E A;  3MD2 A;  4RLQ A;  3D5R C;  4GRI A;  1G59 A;  4FET A;  4BDY A;  3RQ4 A;  4DOZ A;  5HLT A;  2X85 A;  2LYC A;  2M4G A;  1LFP A;  1VZ0 A;  4E7Z A;  2VJ4 A;  2VQH A;  4CCN A;  2W00 A;  2HQA A;  4G6T B;  4E4H A;  1FMW A;  3OYI A;  2X6X A;  4NQW B;  3L2Q A;  2HU9 A;  2KMU A;  3DLA A;  2WAD A;  1OLT A;  4RM3 A;  3K70 C;  4X0G A;  4PSW A;  4XN3 A;  4BU2 A;  3K4L A;  4ZYA A;  4BL0 B;  2VKH A;  3BLY A;  4RMN A;  2W7N A;  2MC4 A;  3PL8 A;  1N75 A;  1Z3Y A;  2E1M C;  4F93 B;  2K5C A;  2PJR B;  2L9N A;  2M0M A;  2W82 A;  3NWS A;  3OYH A;  3KYL A;  1X4O A;  3PNT A;  2X1C A;  3LSK A;  1MW7 A;  3RSN A;  1Y56 A;  1ZEL A;  2LOO A;  4XR6 A;  2XSJ C;  2BW3 B;  3PFY A;  2IGN A;  4U7B A;  3DEE A;  2KLO A;  3S3N A;  3HXL A;  3CF2 A;  2NOJ B;  5HOO A;  1WJE A;  2WY7 Q;  2M4K A;  3H5A A;  2JUG A;  2ZSH B;  2R4G A;  5CQG A;  3OYA A;  3DPL C;  4KIS A;  3C2G A;  2RQQ A;  1YX5 A;  1Z21 A;  2XF7 A;  3OYM A;  2XDV A;  4F55 A;  3S8P A;  3VSK A;  4BEH A;  2VQG A;  1NG7 A;  1MMA A;  2CV1 A;  4XQF A;  1R6R A;  2KL4 A;  4B43 A;  1UEL B;  3M1C A;  4J00 A;  1X1C A;  3VYS B;  2HZD A;  3HC7 A;  1UAA A;  4CCL A;  4E7S A;  4N4N B;  3FBI B;  3VYR B;  4XLH A;  3J7A Y;  1AA7 A;  5LD2 C;  3OS1 A;  5FRO A;  1TZL A;  2R7S A;  4BJT A;  4HPQ A;  4R79 A;  3E0J B;  2KDO A;  2IGK A;  3PNY A;  3PNV A;  4H4K C;  2V7F A;  3V42 A;  4OWR B;  1QU3 A;  1G8X A;  3HPG A;  1X1A A;  4N4O B;  3DKX A;  4BE2 A;  4NNJ A;  2Y0S A;  3U21 A;  5FRN A;  5CQE A;  4XN0 A;  4YEJ A;  2M3A A;  2VJI A;  4KJZ A;  2Z1D A;  4QPO A;  4ZDL A;  1SAU A;  2CV0 A;  1V5G A;  3CZ6 A;  1K6Y A;  3DTI A;  3LSI A;  2IXS A;  2DJI A;  5HNF A;  3LSM A;  5HNH A;  2ZXH A;  3OIP A;  2CW8 A;  3OYN A;  2VIX A;  2CFO A;  2E5N A;  2L7K A;  3H5N A;  2MD0 A;  2WY8 Q;  2OUM A;  3W2A A;  4IQJ A;  2VKD A;  3E1S A;  2IGM A;  1UG0 A;  3BG6 A;  2R7T A;  3K4K A;  2F4I A;  2XAU A;  3KX2 A;  1FMV A;  4BUP A;  4PSX A;  1D0X A;  3OYC A;  4PJM A;  1ERD A;  1JI8 A;  3EPZ A;  1WJB A;  3M8J A;  4ITV A;  4KIT B;  3HL2 A;  2R7U A;  3OYK A;  4BJ6 C;  1J09 A;  3PSF A;  3EUA A;  3K4M A;  2O5R A;  3H0D A;  3H9J A;  3F9K A;  3LMM A;  1BR1 A;  3OYL A;  4AU7 A;  2V26 A;  4XM3 A;  3MMY B;  4CSW A;  2KZV A;  3ZRG A;  4ZTF A;  4YEL A;  2F6C A;  4XKC A;  2JA2 A;  4IKF A;  4PFO A;  2LBF A;  3CES A;  4BJ5 C;  2XC7 A;  4IQ4 A;  2CW7 A;  2UV1 A;  4F52 A;  2LRE A;  2LG4 A;  3ONQ A;  2R7Q A;  1QHG A;  3KEY A;  4B47 A;  1WJC A;  4PK4 A;  4QPQ A;  1EA3 A;  4RM2 A;  4DIQ A;  1LDK B;  2WBM A;  2JSP A;  1N77 A;  2A6T A;  3S93 A;  2V4J C;  2X51 A;  3CMM A;  4F91 B;  3BC8 A;  4BDZ A;  3BCB A;  2X1D A;  3H35 A;  1Y6I A;  2VQC A;  4ZC3 A;  3S32 A;  4P5O A;  3DWL E;  1YE9 A;  4AVZ A;  4AYB A;  1OR7 C;  2R7W A;  1E0E A;  4BE0 A;  2P0W A;  3RCO A;  2HPM A;  4BE1 A;  2IS2 A;  5CKT A;  2KQR A;  2R7X A;  5KNL A;  4E7H A;  2WAF A;  3K6G A;  3DU6 A;  1YX3 A;  3DPU A;  4D1Q A;  4HEA 2;  4LIU A;  3DQV C;  2CH0 A;  4U87 A;  2E1M B;  1BR4 A;  4XLC A;  2Q2E B;  5FRM A;  1N78 A;  2R7V A;  2BVM A;  1X4P A;  4XL9 A;  4CUG A;  4OAZ A;  1DGR M;  3UR3 C;  4E7I A;  1TT0 A;  2VXD A;  4CCO A;  3K4B A;  2LBF B;  5TGT A;  2XF5 A;  4HSR A;  4C9Y A;  4CCM A;  1BR2 A;  2IS6 A;  1S9H A;  4B3X A;  2QKM B;  2DOA A;  4E7K A;  1V5E A;  2IGO A;  1KON A;  2LH9 A;  3QYE A;  4XLA A;  1MMN A;  4E7L A;  3OS0 A;  1V5F A;  4PJJ A;  4ZJZ A;  3DKY A;  1MMD A;  1X19 A;  2Z2S B;  3TL4 X;  3A2K A;  3FKJ A;  2VXZ A;  3HOT A;  2Z16 A;  4BXF A;  4II2 A;  1PJR A;  4BEH B;  4HRI A;  2DT7 B;  2DXI A;  2W4S A;  3MKY B;  3PSI A;  1IRX A;  4BS9 A;  4HST A;  3PUB A;  2MFZ A;  3OL4 A;  2JVH A;  3K4C A;  3ZGK A;  4HNU A;  3FHN A;  3GBG A;  1WJD A;  3IP4 B;  2V1N A;  3CP2 A;  1W36 C;  3C2H A;  2AQE A;  3HKZ A;  1WFX A;  2VAS A;  3MKW B;  4XKV A;  4DGW B;  3SYT A;  3TBI A;  4LIT A;  3QOE A;  3HUG B;  4XLE A;  2OC6 A;  3OYD A;  2XF6 A;  2VJ5 A;  2KHM A;  3UNG C;  4XOT A;  3SEQ A;  2LY1 A;  2AQF A;  3AL0 B;  3A1Y A;  3OIQ A;  2OV7 A;  2K9L A;  3LSG A;  2MAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...