2KZVA

Solution nmr structure of cv_0373(175-257) protein from chromobacterium violaceum, northeast structural genomics consortium target cvr118a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
b'MPHKEKHPLQDMFTSAIEAVARDSGWAELSAVGSYLAKNDPSFDPRNWGHGRLSQMVKKLDFLTVQESRNGSKLHSEIRLRHDGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Chromobacterium violaceum
publication title Solution NMR structure of CV_0373(175-257) protein from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR118A.
rcsb
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kzvA01
2LY1A 3RCOA 2LY2A 2KZVA 3S93A 2KPMA 2LH9A
chains in the Genus database with same CATH superfamily
4A0XA 1IC8A 3MAJA 1T39A 1I6XA 3HBLA 3F8MA 3FISA 4KIGA 1I1SA 2KQRA 2Q2EA 1PP7U 3A4CA 5GPAA 4BL0B 3E5UA 4DW6A 2VN2A 2KP6A 1VNDA 4GYIA 3F0CA 3WU1B 2DMTA 5E1ZB 1ZH5A 2WV1A 2VL8A 4HX4A 1IUFA 4L5IA 1QPIA 4OMYA 4E7KA 1Y6IA 1MJAA 5AIQA 1R5ID 5F6FA 3T1BA 3LMMA 4LJZF 5E1XA 4M71A 4P55A 3H0DA 4CGZA 2NXNB 2EWNA 3ZMZA 2L7FP 3G6EI 1IZ1A 3TO6A 4OIQF 1IN4A 2QBYB 5CVRA 1QHHD 3QYBA 3DF8A 3K2ZA 3IHUA 2HDWA 3LFKA 4OMZA 3MWMA 2IT0A 2L3DA 2FA5A 4IPAA 3V7RA 3VOEA 3F8CA 3D5SC 1B4AA 3S3MA 2AXLA 2X9DA 4GGGA 2RV8A 1W0TA 1R5GA 4D9JA 2AQEA 2R7VA 4QPOA 1IF1A 5CQEA 4EGZA 1IN6A 2Y9YA 1GLNA 3HRMA 4MTEA 2HEOA 5IP9J 3UKGA 3KP2A 2DMPA 3ZXSA 4P5OA 2WTEA 2VB6A 3WTVC 5FD6A 3I71A 3OYAA 3CCUI 1XX5A 3ROUA 2Y48A 2LRDA 3TP3A 3WGHA 1VQ6I 5HLIA 2QF7A 4I0AA 3P9IA 3ZQFA 1A36A 2Z9OA 2DK5A 4KN7X 4U0VA 4CYCB 3BOQA 3FKJA 3WG9A 3K4NA 2EJRA 3F72A 1UAAA 1A04A 3FBIB 3H1CA 3V4GA 5EEAA 2F48A 4X0GA 4RGXA 2BW3A 4Q4ZF 3S3NA 3RSNA 4IHWA 4DZJA 4BYYA 2X4HA 4M9SA 2CV0A 4HAMA 4PFPA 2L9VA 1BR4A 4OAYA 4AU7A 4XRSG 1U6GA 2O8XA 2FBIA 3BTJA 1VQPI 4FE7A 1FIAA 5FLXZ 2XF5A 4S04A 1QU3A 2QGUA 3RIRA 2L2OA 3C2BA 2RAEA 1MBJA 2MFZA 5B5EC 1JI8A 4HNUA 3CP2A 2IRFG 4A3IJ 1ZELA 2QBYA 3ZQQA 1QPMA 1WHUA 1ZLJA 4OIPF 1OCCH 1J9IA 1WI9A 1TZLA 2EV6A 2FE3A 4F91B 1K79A 1EJ9A 2F2EA 2STWA 2BYVE 2DU9A 2VASA 3GEZA 3HXLA 3K4LA 2EIKH 3ZGKA 1GVJA 4XKWA 2B7EA 4C2MJ 1BI0A 2X6WA 3RCOA 1XDSA 1DUXC 3DEWA 2DA7A 2CU7A 1T8IA 2JQ7A 1F43A 3EETA 4Q47A 2NAZA 2MA3A 2PJPA 2E7WA 4AIKA 3K10A 2VXDA 1OR7C 2EBIA 1A6QA 2QQ8A 3D0SA 1LUJB 2CRGA 1HLVA 2LOOA 1AWCA 4IOAF 4UVAA 5GTHC 4UVCA 3C7JA 2P7CB 2XGCA 2X51A 2DMUA 3KEQA 3UNGC 3HRUA 4XRSA 4ON0A 3J7YJ 1Q1HA 2VOPA 5CPRB 4FHTA 1Z7LA 1Z3XA 1BOBA 2BHZA 3PUBA 2OA4A 1JGGA 4RS8A 3TW7A 1MMSA 4FE4A 3FXKA 2JA8J 1QZEA 3SDGA 3A01A 1FYKA 3C1DA 5FKKA 3GMEA 2KISA 1KYWA 2KHMA 1VI0A 3ULQB 3PFYA 3KPHA 2FD5A 4IHXA 5LGUA 1MIJA 5IT3A 1QZZA 1P4XA 3LAPA 5E1WA 3VWBA 3OYKA 1T98A 1F5TA 3FIWA 4B44A 3Q9SA 3OYCA 2ZSHB 5DS9A 1ETKA 1G3YA 2LY1A 4XK4A 3JRIA 2R7QA 1FT9A 2QENA 1SD5A 1RR8C 4HQMA 4G8XA 4B8XA 1Y1WJ 3PNVA 2O8KA 4ZYAA 2DA1A 2IEKA 4AYBA 1KGSA 1RPWA 2CQQA 3BJOA 4I76A 4ZTJA 4ENJA 3PSIA 5D4SA 3ZMSA 3LSJA 3MVPA 4F93B 2F5CA 2M7BA 3L7WA 3M8FA 4Q48A 2R7SA 2KIQA 5TISC 2NNYA 4N4OB 2IJLA 3HUGA 2XB0X 2CUZA 3HOYJ 2RREA 2JK3A 2I5UA 2L4AA 2OUMA 2XSJC 3VEPA 4N0BA 3W6JB 1AU7A 3J7ZI 4CXFA 1TNTA 1REPC 4LLNA 3NWSA 3O2PE 3LOCA 1W5SA 2V7FA 4AM3A 4MHGA 3HEFA 1WH5A 4PGHA 4UY8I 3OWTA 1YRNA 4UUSA 5GTIC 3WTXC 1LDJA 4WF2A 3W2VA 4BXUA 1GVDA 2XPWA 3CQZJ 4RBOA 2WY7Q 1U5TA 1JUMA 3S2DJ 1ZRDA 2ZFUA 5TRDA 4BBSJ 1ETWA 4IHYA 2EFWA 4HV6A 1HCRA 3VSLA 3OY9A 5F04A 1XS9A 1R49A 3BPVA 1H0MA 3U2RA 3I4NJ 3CMYA 9ANTA 4HG2A 4F52A 2EFNA 4PJMA 1MJBA 5J6XA 2QKMB 4MQVA 1A5JA 5M5XJ 2H8RA 2LF7A 2DLLA 3G1LA 3GTPJ 2JPBA 4KA4A 1KU7A 3B02A 2IVMA 2I8DA 3M1CA 3REOA 3E6CC 3BJAA 2GBYA 2CQ7A 3CUQC 5H20A 2NS0A 1TNSA 2LY9A 1E17A 1ZGWA 4AVZA 2ZKZA 3KZZA 1S7OA 3K4MA 2MLGA 4KMUX 1S8NA 2EK5A 2YX4A 5FKLA 3KX2A 3DCFA 1HKQA 4KITB 4RAGA 3ELKA 1ENHA 2ZJPF 4II2A 1KA8A 3LSTA 2R92J 2DO7A 1J75A 1JHHA 1G3WA 2M87A 4DYRA 4II3A 3E7LA 3CMAI 3K6GA 4YELA 2ZMEA 2EV5A 4XRFA 3HHHA 3BZKA 1CF7A 3CLOA 3DTEA 2Z2SB 3GLLA 4Y7NJ 2D1HA 2JVGA 3MZ8A 3R0AA 1SD6A 3U1DA 1FTZA 4D0PA 5BOXA 4U7DA 2FNPA 4UUVA 3SZPA 1MBEA 4L5EA 3E1SA 4I6ZA 4RLQA 1V5GA 4CUGA 2DK8A 2ZB9A 2M4GA 2OCCH 3EDPA 3P9KA 2CJJA 2RQPA 5FFZA 3JSOA 4IOCF 4FX4A 2V26A 2BY1A 5D5XB 4KMFA 2OTLI 1MBGA 4MEXF 1BI2A 4JK1X 1BJAA 4D1QA 2A07F 2R7OA 2A68F 4Y15A 2RC4A 1G3SA 4LB6B 1X1CA 3ONQA 3JRAA 1W5TA 4B1RA 4HA8A 1M1EB 4M3EA 4NC7A 2FQ4A 2ID6A 3HSRA 4NC6A 1KQ9A 3CCEI 4NDLA 1BI1A 1TWAJ 1R1UA 2HZDA 4WX9A 3DPUA 4CZZA 2K85A 2CGPA 3ZN0A 3BCAA 5IP6A 2K7LA 3TOBA 1VFCA 4HV5A 3ZQLA 2RVCA 1JE8A 2KJCA 3V42A 4LK0F 1AHDP 3CC7I 3HGGA 2FX0A 2Y0MA 3GZNB 3CF2A 3TP0A 2LMDA 1WRJA 2BY0A 4AUXA 3C2GA 2IGMA 3I59A 1W7PA 2B0LA 2ESHA 3G2BA 2PI0A 4ENMA 3OYEA 2DT5A 5B3SH 2J5OA 3H36A 3MKLA 3GZ5A 2G0EA 2HNHA 1XMAA 3DLAA 1VQ4I 1R1VA 4EJVA 2STTA 3K70C 2OU2A 3DEUA 3HOTA 3VFZA 3HC7A 3K4JA 1L3LA 1IRZA 2AHQA 5LHGA 1DPRA 3C3WA 2X6YA 1ZLKA 2R7FA 5IOYA 2R7XA 2FXAA 5EZHA 3DU5A 4H4KC 3FXLA 2K9SA 3HG9A 1BI3A 1G2HA 4CCOA 2NOGA 1AA7A 2TRTA 3LSGA 4KIBA 2QWWA 1ZYRF 2QQAA 5F1JA 5FB2A 3H92A 2GOMA 1U5TB 5J47A 2JT1A 4XLNF 2ELHA 4WCGA 4A3LJ 2HGCA 1WJ5A 3I58A 2NVTJ 3EUHC 4LG0B 2XAGA 3E97A 5E3MA 4HF1A 1N78A 4IVNA 3CCRI 3GZ6A 1TL8A 2I10A 2P81A 1GV2A 1YOVB 1S6LA 1IV8A 4M9ZA 4BE2A 3VDXA 4Q5SF 2WA0A 2JN6A 4K2EA 2W48A 3ZMTA 4IX7A 1Z21A 3S2WA 3I3LA 2GQQA 5DYMA 5F08A 2KMUA 1OYIA 3OMYA 4I0BA 3RZDJ 2K5CA 5K5OA 4GXOA 2L9NA 4Y4RA 2WY8Q 3HGYA 4GFBA 1LDKB 2HYGD 3W2WA 3FDYA 2F4MB 2W85A 4BU2A 1DGRM 2FSWA 3HPGA 1S72I 4XKBA 1LJ9A 1ETQA 1SFEA 4NBQA 1ZAOA 3M7GA 4D5FA 1WJFA 1OMIA 1E3OC 3ZCOA 3QPTA 1MMDA 5FD5A 1VTNC 3W3CA 2VPRA 1TQIA 4HLXA 2VQGA 1ZR4A 2PN6A 1F9NA 2A61A 3ABUA 3TMOA 3B6AA 2X85A 3KP6A 3FK6A 2ZMEB 1RZ4A 1A35A 5E8IA 5K5QA 5DV5A 2M0MA 4UB6C 1KONA 4C2UA 4ZYHA 3ERED 1RUNA 2Y31A 3E6DA 2JA7J 3BJ6A 3GFMA 1MKMA 1YIOA 1HOMA 2P7VB 1DDNA 1BR1A 2FMLA 1B6AA 1K6OA 1SD4A 4LB5A 1QQIA 2XRLA 4CCKA 1QVTA 4HNTA 4L9NA 1U0JA 2DI3A 4AC0A 5GADJ 2BW3B 2ME0A 4MTDA 2E35A 3DPTA 1QBJA 1WJBA 1X4OA 4C3HJ 2BVLA 1CGPA 4L5JA 3L2UA 2VBXA 3V8KA 2IBDA 1WI3A 4UHTA 2NNNA 2QCOA 2KZGA 5H6RA 5EF6A 1VQ8I 2J5PA 3JRFA 2HDCA 2OQRA 1IAWA 1IJWC 1A6IA 5CJ9A 3SZGA 2EPFA 3DEEA 3IKTA 1MZBA 5K5RA 3K9TA 3M07A 4FASD 2XDVA 2A6TA 2V1XA 1MDMB 1FYMA 2M45A 2WB1A 4UV8A 2VKDA 3A0HC 3BR2A 3AL0B 2N8GA 4IRIA 3CJTB 2DA2A 3HJEA 4UUTA 1WJDA 1TTYA 2M0CA 4B3AA 4A3GJ 1MMAA 3HDDA 2KT0A 3NRVA 3O3KA 3G71I 2GLOA 1DGWY 2JSCA 2IS4A 3CDLA 2W84A 5DM7F 4CH7A 3S16J 2OPTA 3OYHA 1MNMC 2CQNA 4BH9A 4U87A 4YFXF 1VQ7I 5FLVA 1Y0NA 4G7ZF 1ON2A 2ELKA 3CCYA 3PIOF 3VPRA 1PDNC 2K9QA 3LAJA 5E3NA 5L3CA 1DU6A 3TEDA 2MYSA 3M1EA 4YEJA 3HPHA 1J2XA 1YJNI 4BXXJ 2WAEA 3VODA 1QNTA 4EM2A 1PVEA 2F4IA 4PJNA 1Y8QB 2CW0F 5E20A 3I54A 1FLIA 2LKPA 1P9QC 3ECOA 3HOXJ 2L02A 1OCRH 2KIFA 2R7UA 2EFPA 4DBQA 1T56A 2HXIA 3F9KA 3GLXA 4KICA 3KP3A 2ECCA 3QOEA 1R00A 3D1NI 3OYFA 3LWFA 2UXXA 2Y0SN 5J40A 2IS6A 4KISA 2R7ZJ 4XLAA 3A0BC 1Z0XA 2LH9A 2W57A 2COBA 2E1NA 3SYTA 1F1ZA 3GUDA 4HSRA 4XBFA 4CCMA 1WJEA 1XSDA 2NYXA 1XG1A 1R1TA 4ASNA 2DYRH 1B72A 1TWFJ 5HLHA 3MKZA 2XUBA 5D8KB 2HFHA 4XQFA 1YJWI 2O6GE 1ZHFA 2FUG2 2V4JC 4P9FA 2X1EA 5E8GA 1E0EA 3RQIA 2K3PA 4FX0A 3FZVA 2VONA 4IQ4A 3ZQCA 3ABMH 1J59A 2ZJQF 4HEA2 4XSZF 5FRNA 4RAYA 5BPIA 2R7WA 2R7DA 1U8BA 2HVRA 4PCQA 1PP8F 3U1KA 4BDZA 3A01B 1WH7A 3DBHB 3RPUA 3J7AY 3HB9A 1FSHA 2X0LA 3N97A 2DT7B 3PM1A 3S2HJ 2FBHA 3E6MA 3WODF 1OCPA 4ABZA 4I7HA 2VI6A 2GWRA 2GXAA 1ULYA 2MLKA 2WV0A 3ISPA 1K61A 3KLNA 2K9LA 4RA2A 3GW2A 2PMHA 1JXSA 1Z6TA 1F36A 2LG4A 2VJIA 1U2WA 3D5LA 3TO9A 3JAMK 4XLEA 2MC3A 5ICGA 3FWEA 3S1RJ 1GHCA 1IRFA 1D1AA 1YIJI 2VLAA 4PSWA 1OR7A 3BG3A 1TT5B 3IP4B 1HW2A 3F6VA 3H5RA 3FMQA 4U88A 4BQQA 1XC5A 3WHBA 3BTLA 2XGXA 2DA5A 3K4BA 4DBRA 4ZZDA 3HUGB 5D4RA 2JZYA 2KIMA 1FMWA 2BBYA 2HS5A 2P5VA 2E5ZA 2V9KA 1UMQA 3HSEA 3OYIA 3IKVA 2XAFA 3HKZA 3OYGA 2DOAA 5JVTA 4NQWB 2FRHA 4CO8A 3F23A 1LFUP 5DTDA 5CQGA 2Z5UA 3WTWC 3OS1A 3H5NA 4RMNA 2D45A 1OCOH 2E36A 3I4PA 4M3BA 1AOYA 2VE9A 1GT0C 3BG9A 2E1CA 4L9TA 1JKQC 3T8RA 2E2JJ 3K7AJ 1RKWA 1SVOA 4C9YA 4D7NA 1LNWA 1YLFA 1C0WA 2L7KA 4HZFA 1EA3A 1FOYA 1SEUA 2DCEA 5LLQA 1NH3A 2E34A 2EV0A 2YU9J 3V8LA 3VYUB 1FX7A 2DPDA 5FKNA 1T6SA 2JWTA 4XN0A 2ZXIA 4B09A 2VQLA 4ITVA 2DFIA 1OCZH 3P7NA 5HS9A 4EM0B 1UFMA 4IHSA 2KL4A 1HKSA 3WTUC 3TBIA 5JVGF 1HDPA 2VBYA 2EIMH 1MBFA 2M2EA 2PBIA 4R1HA 3BZ6A 3RKYA 4DIQA 4HX8A 2V79A 1SFUA 3J80Z 3ZPLA 1S7EA 3V8JA 3FHZA 3CESA 3OIPA 3QAHA 3U21A 1TBXA 4PFOA 4A3CJ 3BG6A 2Z33A 3VYRB 4Y52J 2HYJA 1IN5A 3WE3A 2NVYJ 3FM3A 4MO7A 2VQCA 1WVRA 1U8RA 2XASA 3MZYA 4CCNA 3FMRA 2EZIA 3GVAA 1UG2A 1Z3YA 2HPIA 4JBAA 3FXQA 3HOVJ 2D5VA 3BTIA 2E7XA 4JX6A 3SEQA 4HRIA 1MNEA 4A6DA 3QP6A 2IAIA 1FC3A 4W97A 4EJUA 2AQFA 1HDDC 3DLLF 3VSKA 3CDIA 3F21A 3OOPA 2HTJA 3FKIJ 4QSHA 1XCVA 3LSHA 5D5VB 1S3JA 5TJJA 4EATA 3TOAA 4LFUA 1SVLA 3K4CA 5BQTA 1FIPA 3E0JB 5EG0B 3JRBA 4MFDA 4BNCA 5ILSA 5EDNA 1R71A 4AWXB 3IV5A 2BY2A 3GTGJ 1U9NA 4G9YA 4C3IJ 3QPHA 3HSFA 1FY7A 2XKOA 4JX5A 3LSIA 1BM9A 2W25A 3CJQB 4G94A 4PK4A 1ZGJA 5CVJA 2ZFWA 3RDIA 1CQTA 1O3QA 1ZRFA 1B72B 4HPQA 2VJ5A 5DD8A 4ZYDA 2CV2A 3CTAA 2V6EA 1YX3A 2WBMA 2EZLA 1YQAA 1RKTA 3CJNA 1JHFA 1W7PB 2WWYA 1XDUA 2ZXWH 1OYYA 3PQKA 4ESBA 3Q5FA 1BW5A 4ZJZA 1D0YA 5AIPA 3KYCB 2P5LC 4UV9A 4RB2C 2LKSA 5F0FA 2NVUB 2VBZA 1IW7F 2VKEA 2XPUA 4BQNA 2L7MP 2LF8A 2V9PA 3CCQI 4FQGA 2CUEA 2XV4S 1R4MB 1XMXA 4WXHA 4A69C 4QTRA 4OWRB 2E1MC 1YW8A 4XOPA 3MQ0A 5L3DA 3S3OA 4O3MA 1AKHA 2E71A 1LFBA 3SEZA 4GYGA 2VODA 2QUFA 4W1UA 2M3AA 4GO1A 4LIVA 4XIDA 3MKWB 3HOWJ 2VT2A 2LDUA 4LLLA 2RQQA 1I5ZA 4BY7J 3F22A 1Y8RB 1BR2A 3FBNB 2E1MB 2DW4A 3CMEI 1RESA 3COAC 4RGSA 2LY2A 3FF5A 3NARA 5KVRA 2DTZA 4KIFA 2HVSA 4A5MA 3HHGA 3D5RC 1O7LA 2V1DA 2R5ZB 4L9JA 2WB1N 2K27A 1U9OA 3IL2A 2FOWA 2UUZA 3LA7A 2DFFA 2A5WA 2CYYA 4XLCA 1YRNB 4A3BJ 4ESFA 3ASNH 2Y9ZA 3QODA 3OR2C 2R7RA 3WGIA 4X1EA 3JRDA 5CVVA 3BT9A 4A3JJ 1EH7A 4EJTA 1KU2A 5LEJA 3BY6A 3IAS2 5IT9K 3I64A 1K4SA 3FXOA 3R4KA 1RC9A 5E79C 2GM4A 2MABA 3ZQHA 4QLCU 1MH4A 2NS7A 2LR8A 1Y56A 3OYBA 4XNFA 1LVAA 2NS8A 3KZYA 2UXNA 2O3FA 2K02A 2LYCA 4B48A 4Y13A 3ZRGA 2ZJRF 1IG7A 2M9HA 2K9MA 3FK7A 1LDDA 5M5WJ 1W7PD 5EEHA 2HU9A 2ZC2A 2CH0A 2DBBA 3DU6A 3PUFA 1Y0UA 1B8IA 2PMZN 3HTUA 1YO5C 2B9SA 1TP4A 2JRTA 4F3QA 5HDNA 2XAQA 2A6HF 4UXNA 1YITI 2JVHA 4HF0A 3RPUD 2CQKA 1SAUA 4IJAA 3PFIA 4XL9A 1QZYA 1HBXG 3MCZA 4MGRA 3F8NA 3RKWA 2JPCA 5EG0A 3I59B 5DM6F 2V1NA 2D1VA 5LFAA 1W36D 2E60A 4D5CA 4MEYF 2GA1A 3S93A 1YHQI 1IDYA 3FHNA 3G1OA 3PJRA 4E6KG 4HDUA 3JAMZ 1KU3A 4J19A 1E2XA 2X48A 3LFUA 3W6KB 2VT3A 1LEAA 5BPDA 1H9TA 1UHWA 2ETHA 4X6AJ 3HRSA 3L1PA 4ZDOA 4G6DA 4BGDA 2GZWA 4PJJA 4BDYA 4ZDPA 2LSOA 1ZG1A 1D8KA 4YIIA 5KCMA 2VIXA 1MBHA 1ACIA 1V5FA 1MDMA 3H5AA 2QQBA 4I98B 4DQ2A 3CUQB 4H0EA 1P92A 4Y3OA 2VBWA 5ICCA 1X58A 4MNUA 5DDGA 2DQRA 3BWGA 3CO7C 1K83J 2OD5A 4EJOA 1X3ZB 2CV1A 3HOUJ 1G6NA 2CW8A 2KRHA 3KEYA 1LKXA 3TDUC 4V2GA 1TQMA 5FROA 4HDVA 3DWLE 1V54H 5C4JJ 2LC2A 2XAUA 2HWVA 1VF9A 4BXFA 2PLYA 1VQOI 2M1BA 4D7MA 3K0LA 1DQUA 1I50J 4IRGA 1D3YA 2JA5J 4ZC3A 3EUAA 2BVMA 3IRQA 3EYYA 1FTTA 4RB3C 2NOJB 1JKPC 4XR6A 1BC7C 5D6EA 4FISA 3Q0WA 2LBFA 2EFOA 2V6CA 3WGGA 2BOLA 3H9JA 3FX3A 2H09A 4XKVA 3MZHA 4V19K 1QO0D 4PSXA 3OYJA 4ETSA 1BN5A 3OYDA 4BE0A 2E2IJ 1S9HA 3LL7A 1X2MA 2W4SA 4RM3A 4I2OA 3A2KA 3HRTA 2MH9A 1MMNA 3CF5F 4FT8A 2Y0SA 4JX4A 3QQAA 4CA0A 2RDPA 4ZDLA 1ORKA 2QZ8A 5HLGA 1WPKA 4M6YA 2BEOA 1VQNI 3GYHX 2XSDC 3AG2H 1MMGA 1UHMA 5KNLA 4EVIA 3MMYB 1Z6RA 2HDDA 1MD0A 3WHCA 5LGTA 1T2KA 4BUPA 3QPLA 2K40A 3RTRA 1X19A 3A02A 4F55A 2NVQJ 3AFHA 4UUSB 4CZCA 1PYVA 3OYNA 1ODDA 3F3XA 4A3MJ 2ZJ2A 4EV0A 3OL3A 4O6JA 4CYDA 4HNVA 1O4XA 1FOXA 2EZHA 2O9LA 2WADA 2VJ4A 1RIOH 1STZA 3CC2I 1W0UA 5IY5H 1R5HA 4PJ0C 2DTRA 3FXUA 1NTCA 5F1RA 1T0FC 3BR5A 4A0YA 4UVBA 1ERDA 1PUEE 4O5VA 2F5FA 3CUOA 5KAIC 4E7SA 5K1YA 2F4OB 5E3OA 2H6CA 2BXZA 1Z91A 1KU9A 3U9GA 3RKXA 2VUMJ 3CD6I 4IZZA 4N4NB 3AG4H 4RAFA 3TO7A 5J8CA 2DDBA 4Y17A 2PEXA 4IXAA 1G3TA 2ZBKA 4E7HA 3JRGA 3BR3A 2DOEA 1ZK8A 2X1CA 3CJRB 2QEXI 3DFGA 5IPAA 3HIFA 1R36A 4GCVA 1D5VA 3NAUA 2QSGX 5LEKA 5K7HA 1E3PA 4LG0A 4QPQA 1MNDA 2CMPA 4IQJA 1B9NA 5H6QA 4I01A 5D5UB 2JA6J 2L9SA 1APLC 4XORA 4C2TA 2FJ1A 2M8GX 3GF2A 1P7IA 3LNQA 5J3LA 1G4DA 3CO6C 3I56I 4S0HB 4E7LA 2LP0A 1IN7A 4EQQA 4IEJA 4FTHA 2Y69H 1TW3A 4A2UA 2XB5A 3Q0UA 2DT6A 2FNAA 3L2WA 4BBRJ 1J0RA 2GIVA 3LQQA 4ESJA 1QA6A 4CHUA 5IYCJ 1BJZA 1Z05A 3OIQA 4A5NA 4CYCA 1WJAA 4IL6C 3E6BA 1D5YA 2P4WA 4E4HA 2EILH 4FCYA 5JHUA 3L2QA 5ILUA 3I55I 3JRHA 1XPXA 3A1YA 4PGGA 2XAHA 1UB9A 2EZKA 1LE8B 4A12A 2R5ZA 1FBUA 5KK1A 3GX4X 2HQNA 3ZN1A 2O7OA 1VQLI 1PUFB 3H9GA 2K86A 4G6QA 2MBFA 3RZOJ 1IXSB 3IRRA 3TDZC 4EMSA 5L3GA 3V7SA 2MGQA 3M9AA 1T33A 1GDTA 2HKXA 1G8XA 2GAUA 3FXRA 2P6TA 1ETVA 2VKVA 4BHBA 4ZZLA 2Z16A 3TL4X 1V4RA 1SD7A 3DQVC 4BACA 5HVQC 3AKZA 3F8FA 2LK2A 2X1DA 1ZG5A 2OF7A 3DV8A 1BW6A 4A3DJ 3GFIA 2P6SA 1V3FA 5FRMA 1JKOC 1HXDA 5CVUA 1FP1D 5F64A 3S17J 4XLFA 3KETA 1VQMI 3MKYB 5HDGA 4YIRX 3OYLA 2K9NA 1X1AA 1NG6A 2JUCA 5DCFA 3S1MJ 2GXBA 1IN8A 1J5YA 2A3SA 2NVXJ 3EQLF 1BBYA 1PJRA 2L01A 2E1OA 1N25A 2PG4A 3WTYC 2ELJA 2D2WA 3F8BA 4RB1A 1RUOA 4P1WA 1K6YA 1D0ZA 1TT0A 2LLKA 3HYIA 5C3EJ 1ETOA 3VB2A 2HQ5A 1V55H 5FKOA 2PMUA 2B63J 1Z67A 5FGMA 3GTKJ 1BOAA 2WAQA 4Y33A 3GTMJ 3IH4A 5EEGA 1FWZA 4OU0A 3DKYA 3A03A 3DKXA 5A2QZ 4HF2A 3BTCA 1OPCA 3DBRB 3KP4A 4LD5A 4DNCA 4DZPA 1H8AC 2DYSH 2IS2A 1MH3A 1ZGAA 5LHHA 3R61A 4AIHA 4BJ6C 1EH6A 3WU0A 5GAEJ 5LHIA 3KYLA 3G4SI 1FSEA 2JRMA 2OCEA 4TV7A 3SFZA 3E5QA 1OCTC 4NB5A 2VQHA 2LKXA 1FEXA 4G12A 1DP3A 1MW7A 1Z1DA 4R8HA 5L3BA 4A3FJ 1H88C 3ZQGA 4XN3A 4EEFG 3N4MA 3HZJA 5IYDJ 2V9VA 3PO2J 2XROA 2K4JA 5GAGJ 3R6SA 2RNGA 2JMWA 1IRGA 4S05A 4LG3A 2X6OA 3LSMA 5EZGA 3DBLB 5C4XJ 2PQ8A 3HTSB 4U7BA 3JR9A 3RPQA 5FKMA 1I3QJ 2HOTA 5JI6A 2LD5A 4N9IA 1HSTA 1Z77A 2KRCA 1Y1VJ 2EA2A 5J1UA 4AIDA 2W7NA 1SFKA 5CYVA 2ICWG 2IA2A 2ZCWA 5IP7J 2HOSA 1R4NB 3MN2A 4ZH4F 2QKLB 2IGKA 3IWFA 4LMYA 3OOUA 3V7CA 4E7JA 3MD2A 1WZ2A 4B4CA 1DP7P 5FLMJ 2XC7A 3PIPF 1O3SA 4ZYGA 2DJNA 3SZTA 1R23A 1KYZA 1OISA 1XGSA 2G9WA 1WCMJ 1ZREA 3ERMA 3S32A 3WTZA 3G3ZA 4ZTFA 1VQ9I 3BR0A 2DODA 2DOFA 1IV6A 4AD9A 2DMQA 3SDBA 4L9VA 1S7AA 3AAFA 5HLTA 1IXRC 2KLOA 3GFLA 4LLGF 3ZOBA 2Z3YA 1XN7A 1H9GA 1BL0A 4XLHA 3OS2A 3LQRA 1OQYA 1U5TC 2A6EF 1N75A 2C6YA 4EJWA 2CFXA 1H89C 3NEUA 3K4KA 2Q8KA 5FJ8J 2BY3A 2CFOA 2QYOA 5M3FJ 5DCMB 2DFHA 3SFIA 2IGOA 1RETA 4ZYEA 3RYRA 2PJRB 4IO9F 2RN7A 2F5DA 1K7AA 4KFCA 3TKYA 1ZR2A 3S1NJ 1RI7A 1X2NA 3BR1A 3SJMA 5JFRA 1GUUA 3L2CA 3K2AA 2HOEA 2KJBA 2O5RA 1I39A 4GDFA 1UELB 3J80K 4M9XA 4RDUA 1OFCX 1YYVA 2RGVA 5L3EA 4WK8F 2CG4A 2A69F 2P8TA 2L0KA 3E3VA 3P9CA 4RLFA 3H3UA 4IRHA 4PUSA 3CCMI 3ABLH 4ENNA 4NQWA 4E7ZA 5ERIA 2Z1DA 2YPRA 4RB0A 4B43A 3K1NA 3CZ6A 3I53A 1YJ9I 1JJ8C 2AXTC 1DPUA 4HLYA 3BR6A 1YE9A 5IYBJ 4CCJA 1MBKA 1XSXA 4L18B 2DQLA 3CLQA 4KYWA 2W82A 2M4KA 2EINH 4A6EA 4A3KJ 3I4MJ 3DKWA 5F0CA 3VYTB 1YW7A 5JR3A 2K3FA 3Q9VA 1S29A 1TWHJ 3BP8A 3MFKA 3L00A 3SXYA 3OL4A 5H2FC 5C44J 2DPUA 1T0FA 2YR2A 2CWEA 4JOMA 3CDHA 5EGOA 3CMMA 1D8JA 2HXOA 2W24A 3DTIA 2JUGA 5D8LB 2BHYA 1FP2A 2XVCA 2IA0A 5CVIA 4BKXA 2GA2A 3M3YJ 5FLXK 4KDPA 5LBQA 3KLOA 4CDGA 1CF7B 1JUPA 2IPQX 5HOOA 3T0YA 1U78A 1TW2A 3PO3J 2VJJA 3E5XA 3CCLI 5B1BH 3IC7A 3BDDA 2KRFA 3QP5A 5CKTA 4B3XA 1P4AA 4HBLA 4NNJA 4M72A 1O7FA 1WGXA 5DEQA 3R60A 3GTQJ 2PX9A 3M4OJ 2OQGA 1F4KA 1TC3C 1X1DA 5GPCA 2BZTA 2O61A 1TQPA 1JJ6C 2EH3A 3GWZA 2R0QC 1SC7A 1FBSA 2GXGA 1WJCA 1XCBA 1P7JA 3FXMA 4OOIA 2VC1A 3S14J 4C3JJ 2Y30A 5HS8A 5IOZA 4QIWN 4JP0A 1TWGJ 2QM3A 1EKEA 4BS9A 2KKOA 1R22A 2IS1A 1P6RA 2CSOA 4DYQA 1Z9CA 3P5JA 1ZN2A 2OV7A 2YS9A 3Q0VA 4DOZA 2P0WA 1UG0A 1XB4A 1ETYA 3BQZA 3CP8A 5GP9A 3JRCA 1QGPA 1PUFA 1GXQA 3CUQA 5FFXA 3KP7A 1HC8A 2H1LA 3L2RA 1TWCJ 1RR7A 2ZNYA 1WKMA 2CO5A 4BHCA 3M8JA 2JSPA 3Q3SA 5BNGA 5DUIA 2VE8A 1XGOA 3IH3A 4EGYA 4M3GA 4PJLA 3WE2A 2MH2A 4OINF 4OIRF 3UR3C 3LA3A 2F5VA 4XKCA 3OIOA 5EGOB 4WXCA 2HQAA 1GV5A 4KT5C 1MSEC 1VZ0A 2VOOA 1NHAA 1X3WB 3OS0A 2LFBA 4A93J 2FBKA 4LITA 2CQXA 1KZHA 2DA3A 5GAHJ 3QU3A 5CLSA 2FU4A 1W5CC 1W4MA 3AG3H 1U3EM 2VKHA 4BHPA 4CSWA 3VYSB 1JT6A 4AVPA 4I02A 2X6XA 4YRVA 1W36C 5HODA 3EYIA 3R0JA 5M5YJ 2OZ6A 2K4BA 3KFWX 2M30A 2KDZA 1XGNA 4PDKA 1KQ0A 2Q2EB 2EB7A 4AYBN 3HL2A 2DAOA 2JTVA 4RAZA 3TW6A 1P4WA 1BIBA 3BG7A 1G59A 2V1UA 5D5WB 2Z99A 3TQNA 3I0TA 2BE5F 3ASOH 3OSFA 2IXSA 1SVMA 4XLPF 3BG5A 3IAM2 4JQFA 5LRSA 2OAZA 4HSTA 3KYDB 5D6FA 4BEHB 1VQ5I 3G73A 2DDAA 4LGWA 3TGNA 4Z6YA 2IGNA 4G6TB 3F6OA 2G7UA 5K7ZA 3LA2A 3H35A 2ZSIB 5HNFA 1W1WE 2M34A 1T08B 2IW5A 2LVSA 3KP5A 3DP7A 4B47A 2L7ZA 3NQOA 3JSPA 4IHVA 1I3AA 1WWXA 1B59A 1ZG3A 3RKQA 4MIMA 3H3ZA 2E2HJ 1FPQA 3WG7H 2XKPA 2BV6A 4U0WA 1RRJA 1QVUA 2H6BA 4XRMA 4XM3A 3L2VA 4I99C 1LQ1A 4MLOA 2YU3A 1R7JA 4KT6A 1JTYA 2ADUA 2QQ9A 1KQ8A 1LB2A 4J01A 3DTKA 1FNNA 2W1OA 5J1YA 2E5NA 1USSA 2ZXHA 4KN4X 4HQEA 1ONVA 3RI4A 6PAXA 4V2FA 1TLHB 3K69A 4LIUA 3ML6A 4GRIA 1YX5A 2CW7A 4G7OF 4WWCA 3WTTC 3KEOA 5FO5A 5F27A 2LREA 1LPQA 2DMNA 3OSGA 2TCTA 2XHKA 2XPVA 1P2FA 4M74A 3PQJA 2OBPA 4HYEA 2L54A 4YG2F 1K4TA 4L0YB 1D1BA 3ESWB 2ZXJA 1POGA 2ISYA 3H0GJ 1EV7A 1WFXA 2FOKA 3GO5A 3BCBA 3NWTA 1MGTA 3ZQIA 2RKHA 2H1KA 3PNTA 3G1MA 1R58A 4E7IA 2M8EA 1R6RA 2ACJA 4BE1A 1N77A 5E17F 2QA4I 5DD4A 1ZARA 1HSJA 1X4PA 2LNBA 3GBGA 3HM5A 3O6BB 2DA4A 2QSFX 3QYEA 3OYMA 1XD7A 2NRAC 2XGEA 2MW8A 2LBFB 4ANJA 5L3FA 2YSRA 1VQKI 3KCCA 3HKZN 1ZRCA 5ILVA 5BS6A 2AS5F 3ABTA 4EM1A 1BIAA 1NK3P 4CCLA 1JUSA 4M3DA 3EPZA 2ME6A 4P9UA 2XF6A 3H3VK 3FXJA 3BPXA 3X2QH 2JA2A 3QOPA 5J8FA 4C30A 4XMYA 2PMZA 2XRNA 2RNJA 2BXYA 1X1BA 3O8HA 4F7ZA 3GTOJ 2ZO4A 3QPSA 1O3RA 2R5YB 1K78A 1X3UA 3LSPA 2QLZA 4I09A 5AONA 1SFXA 4BAYA 1UHSA 2H8WA 3W2AA 5A2QK 3S8PA 4DYCA 2HTSA 3AG1H 3C2HA 3S15J 3EUKL 2WC2A 5HNHA 5ED4A 3PNYA 2GIZA 3QYFA 3B6CA 3ZMVA 3CC4I 2FMYA 2PFBA 2P5KA 2H27A 3JW4A 2KZVA 4E70A 2KDOA 5KHDA 5IT9Z 5J1RA 2R4GA 3OV8A 3JCUC 2OZUA 2QVOA 2HPMA 3QU6A 4NUBA 5B66C 3MEXA 1BC8C 3S1QJ 1E3HA 1X1PA 4KUMA 2A05A 1OYWA 3HOSA 5J4VA 2HVQA 3H9QA 2MSYA 2DA6A 2LTPA 2UWMA 1I27A 4L0ZB 1XGMA 4MQ9F 2IA1A 5LGNA 1J09A 2ECBA 1A31A 1MSFC 2E19A 5ICFA 1RNLA 4IHTA 2OJED 3FM5A 4XONA 1J7KA 4NC8A 4RM2A 2EA4A 1D1CA 5LRRA 3KZIC 2W00A 2UZKA 3KE2A 4N9HA 2JJ7A 3CCVI 1USTA 1EH8A 3QWLA 4M6VA 4UNOA 2Y75A 1OLTA 1XMKA 1OJLA 3J7AO 1SMTA 2MG4A 1UZCA 3PSFA 4BJ5C 5JHFA 4M73A 2F6CA 1FMVA 1YTYA 1T95A 2Q1ZB 4MFEA 2M5WA 3RJPA 1V5EA 5E18F 5B1AH 1UCRA 1UJ8A 3K1PA 4RGUA 3ZMUA 2HKOA 3M8EA 1I1GA 2DFEA 4BEHA 4LOCA 3BZCA 3JTHA 5LD2C 4HX7A 4LK1F 2COMA 4BY1J 4DGWB 4XOTA 1B1BA 2YX7A 3W6VA 2Y2ZA 5EJCA 1ZQ3P 3CCSI 2TDXA 2Q0OA 2XIGA 1QHGA 3KIOA 3RQ4A 1FBQA 3DXJF 1SFOJ 3RYPA 1IDZA 1Q1VA 3C18A 2HI3A 1XSVA 4OAZA 5DUKA 1JTXA 2XAJA 1O57A 5TGTA 4A3EJ 1B9MA 1ITYA 3J81K 2R93J 3IWZA 1LEBA 2MD0A 5KAFC 3T5XA 2PJRA 2AO9A 4A0ZA 4DJAA 3O8GA 1ON1A 2HOAA 3SHFA 4BQOA 1SANA 4ENKA 3WU2C 2L4MA 3I9V2 3ZQ7A 2BGCA 2EFQA 1BA5A 4JYKA 4YFNF 1O3TA 2XGDA 2L9RA 4AIJA 1MJ9A 2ZNZA 3IH2A 1HKTA 1ETXA 3IUOA 1D0XA 5HDKA 2XF7A 4PZJA 4BQAA 2F5EA 2HQRA 4M3FA 2CUJA 2OTJI 1IUYA 2WAQN 2UV1A 3ZMDA 1ZKGA 3BC8A 3GXOA 1FJLA 4UB8C 3ZP5A 1HQCA 4NHJA 4CICA 1K78B 3AL0C 1WQ2A 1S5LC 4U0YA 2MD5A 3L09A 2VPLA 2R7TA 3K1MA 5HS7A 2DXIA 3LSRA 3JTGA 2G7HA 1HW1A 1HW5A 2A5YB 1EF4A 5JLWA 1L0OC 1SMYF 2EQRA 1XTAA 4RGRA 1B8IB 1NK2P 3ZR8X 4YIFA 3LSKA 1Y39A 1OKRA 4IF4A 3OR1C 1IXCA 1YS6A 1DU0A 2CS3A 2DN0A 1R9TJ 3T8TA 4WXDA 3K70D 4G7HF 2QSHX 1I6HJ 2CUFA 2WAFA 3ECHA 3N05A 3BLYA 2KIUA 4F92B 3JREA 5M3MJ 4HW0A 3HOZJ 4R79A 1FYLA 4BJTA 1Z7UA 4XSXF 1SAXA 2ISZA 4YFKF 5J4YA 1IGNA 2VXZA 3QRFF 1JT0A 1FOWA 3L9FA 2FF4A 2YUSA 3GTJJ 5BMZA 3GTLJ 3PL8A 2VC0A 2R3SA 4KJZA 1HF0A 2GOXB 2L5QA 3SQNA 2MC4A 2R5YA 5E3LA 4KNYA 1T38A 1IRXA 2H94A 2FQ3A 1JGSA 3ABKH 5EYRA 1WSUA 2ZMEC 1YG2A 1AKHB 2EIJH 3EUHA 5ICEA 2O0YA 2ESNA 2OC6A 4IKFA 3BQYA 4FETA 1LVKA 1GXPA 4XICA 1QRYA 4P96A 1NG7A 2DJIA 3DPLC 1YS7A 1LE8A 2O03A 2HR3A 3GFJA 4M6XA 4OIOF 2FEZA 5F0HA 5K7FA 1YI2I 3I5UA 2IP2A 3B73A 4HOBA 2HZTA 5DCMA 5JLXA 3J81Z 1YFHA 1ZTRA 1HA8A 2ID3A 2KFDA 1LFPA 2HYFA 3WTSC 3BROA 3CCJI 1YW9A 4Z2YA 2KPMA 1FOKA 1FZPB 1JKRC 1IO2A 3GCMA 4J00A 3FMSA 2M7AA 4QWQA
chains in the Genus database with same CATH topology
4CCKA 4HNTA 1U0JA 2BW3B 4Y3OA 3DPTA 2KQRA 1WJBA 1X4OA 3A4CA 4BL0B 2BVLA 2KP6A 1WJCA 3L2UA 2CV1A 2VL8A 2CW8A 2KRHA 4E7KA 1Y6IA 3KEYA 1LKXA 5FROA 4BS9A 3LMMA 3DWLE 3SZGA 2IS1A 2LC2A 3DEEA 2XAUA 3H0DA 2OV7A 4BXFA 4DOZA 4FASD 2XDVA 2P0WA 1UG0A 2A6TA 3CP8A 1QHHD 3QYBA 2WB1A 2VKDA 2HDWA 3AL0B 1DQUA 4ZC3A 3EUAA 2BVMA 3L2RA 1WJDA 2NOJB 3M8JA 1MMAA 2JSPA 3D5SC 4XR6A 3S3MA 1DGWY 2LBFA 4PJLA 2IS4A 2BOLA 3H9JA 4CH7A 3UR3C 2F5VA 4XKCA 4XKVA 3OYHA 4PSXA 4D9JA 3OYJA 3OYDA 2AQEA 2HQAA 4U87A 4BE0A 1S9HA 3LL7A 4QPOA 2R7VA 1VZ0A 5CQEA 2W4SA 4RM3A 3A2KA 1GLNA 3OS0A 1MMNA 4LITA 3ZXSA 4P5OA 2Y0SA 4CA0A 2VB6A 2MYSA 4ZDLA 4YEJA 3OYAA 2VKHA 2LRDA 3HPHA 4CSWA 1MMGA 3VYSB 5KNLA 3MMYB 5KCMA 2X6XA 3FKJA 3K4NA 2WAEA 4YRVA 1W36C 4BUPA 2F4IA 4PJNA 3RTRA 1X19A 4F55A 1UAAA 3FBIB 1P9QC 3AFHA 4X0GA 2R7UA 4CZCA 4DBQA 2BW3A 1PYVA 3OYNA 3S3NA 3F9KA 3RSNA 2Q2EB 3OL3A 3QOEA 3HL2A 3OYFA 2CV0A 2IS6A 4PFPA 3BG7A 1G59A 2WADA 2VJ4A 4KISA 1BR4A 4OAYA 4XLAA 4AU7A 2LH9A 3SYTA 2IXSA 4HSRA 4CCMA 1WJEA 2XF5A 1T0FC 1QU3A 2L2OA 3IAM2 4JQFA 1ERDA 2MFZA 1JI8A 4HSTA 4BEHB 4HNUA 3CP2A 4E7SA 1ZELA 3MKZA 3ZQQA 2IGNA 4XQFA 4G6TB 1TZLA 4IZZA 4F91B 2FUG2 4N4NB 5HNFA 3H35A 2V4JC 2ZSIB 2VASA 2X1EA 4E7HA 1E0EA 2K3PA 4B47A 2X1CA 4IQ4A 3CJRB 4HEA2 5FRNA 3HXLA 3K4LA 3ZGKA 4XKWA 2R7WA 4QPQA 2X6WA 3RCOA 1MNDA 2CMPA 4IQJA 2HVRA 2L9SA 4XM3A 3L2VA 4BDZA 4XORA 4C2TA 4MLOA 3J7AY 4KT6A 2DT7B 3K10A 2VXDA 3DTKA 4J01A 2W1OA 1OR7C 2E5NA 4E7LA 2ZXHA 2LOOA 4LIUA 2K9LA 4GRIA 1YX5A 2CW7A 2DT6A 2X51A 3L2WA 3UNGC 2LREA 2LG4A 2VJIA 3D5LA 3OIQA 5CPRB 4XLEA 1Z7LA 1Z3XA 1BOBA 1D1BA 1WJAA 3PUBA 4E4HA 1D1AA 2VLAA 1WFXA 3L2QA 4PSWA 3NWTA 3BCBA 3IP4B 3A1YA 2KHMA 3H5RA 3PFYA 3PNTA 4BQQA 4E7IA 1R6RA 4BE1A 1N77A 3K4BA 4DBRA 3VWBA 3OYKA 3H9GA 3HUGB 1X4PA 1FMWA 3OYIA 3OYCA 4B44A 2E5ZA 2V9KA 3GBGA 2ZSHB 3HKZA 3OYGA 2DOAA 3QYEA 2LY1A 3OYMA 4NQWB 1G8XA 2R7QA 5CQGA 2LBFB 4ANJA 2Z16A 3TL4X 3PNVA 3OS1A 3H5NA 3DQVC 4RMNA 4ZYAA 4BACA 5HVQC 3AKZA 2X1DA 4CCLA 4AYBA 3EPZA 2XF6A 4ZTJA 3PSIA 4C9YA 5FRMA 2JA2A 4F93B 2M7BA 4XLFA 2L7KA 2R7SA 1EA3A 4N4OB 4C30A 4XMYA 2PMZA 2DCEA 3MKYB 2CUZA 3OYLA 2RREA 1X1AA 1NG6A 1X1BA 3VYUB 2OUMA 2XSJC 4XN0A 2ZXIA 2VQLA 4ITVA 1PJRA 3NWSA 3W2AA 2ELJA 2V7FA 3S8PA 2KL4A 3C2HA 3TBIA 3OWTA 3EUKL 4P1WA 1K6YA 1D0ZA 1TT0A 5HNHA 3PNYA 3QYFA 3W2VA 4DIQA 2WY7Q 2KZVA 2KDOA 5KHDA 2ZFUA 4Y33A 2WAQA 3CESA 3OIPA 3U21A 2R4GA 3DKYA 4PFOA 3BG6A 3DKXA 2HPMA 4NUBA 3VYRB 3VSLA 3OY9A 2IS2A 3HOSA 2HVQA 2VQCA 4HG2A 4F52A 3H9QA 4PJMA 4CCNA 4BJ6C 2QKMB 2UWMA 1Z3YA 2HPIA 3KYLA 1J09A 2I8DA 3M1CA 3SEQA 4HRIA 1MNEA 2AQFA 2VQHA 4XONA 1DP3A 3VSKA 1MW7A 4NC8A 4RM2A 4AVZA 1D1CA 3K4MA 3LSHA 4XN3A 2W00A 3KX2A 4KITB 4EATA 2RNGA 4LG3A 3K4CA 1OLTA 3LSMA 4II2A 3E0JB 4U7BA 4II3A 3PSFA 4BJ5C 5JHFA 3K6GA 2F6CA 4YELA 1FMVA 1T95A 2KRCA 2Q1ZB 3DTEA 3LSIA 2Z2SB 1V5EA 2W7NA 1SFKA 2JVGA 3CJQB 4PK4A 3E1SA 4RLQA 1V5GA 2QKLB 2IGKA 4E7JA 3OOUA 4BEHA 4CUGA 4HPQA 5LD2C 2VJ5A 3MD2A 2M4GA 2CV2A 2V6EA 4DGWB 1YX3A 2WBMA 4XOTA 2V26A 2XC7A 4D1QA 2R7OA 3RQ4A 1QHGA 1X1CA 3ONQA 4ZJZA 1D0YA 3S32A 4OAZA 4ZTFA 5TGTA 4NC7A 4BQNA 2MD0A 2HZDA 3DPUA 3SDBA 2PJRA 4OWRB 2E1MC 3BCAA 4DJAA 5HLTA 2KLOA 4XOPA 4BQOA 3V42A 3S3OA 3I9V2 3CF2A 3SEZA 2M3AA 4LIVA 4XLHA 3C2GA 3OS2A 2IGMA 1N75A 3G2BA 3OYEA 3MKWB 2HNHA 2RQQA 3IUOA 1D0XA 2XF7A 1BR2A 3K4KA 3FBNB 2E1MB 2CFOA 3DLAA 2CUJA 3K70C 2UV1A 2IGOA 2LY2A 3BC8A 2PJRB 3HOTA 2HVSA 3HC7A 3K4JA 3AL0C 3D5RC 2VPLA 2O5RA 2X6YA 2R7TA 2R7XA 1UELB 2DXIA 2UUZA 3DU5A 2A5WA 4H4KC 4XLCA 3HG9A 4CCOA 1AA7A 3OR2C 3LSGA 3QODA 4RLFA 4PUSA 2R7RA 3ZR8X 3LSKA 2GOMA 3IAS2 3OR1C 4E7ZA 2Z1DA 1WJ5A 3EUHC 2CS3A 4B43A 2MABA 1N78A 3K70D 3CZ6A 2WAFA 3N05A 3BLYA 1Y56A 4F92B 4R79A 3OYBA 4BE2A 4BJTA 4XNFA 1YE9A 3VDXA 4B48A 4CCJA 2LYCA 2WA0A 3ZRGA 4IX7A 1Z21A 2K9MA 2VXZA 3I3LA 2KMUA 3OMYA 2HU9A 2W82A 2M4KA 3DU6A 2CH0A 2K5CA 2L9NA 3PL8A 4Y4RA 2WY8Q 1LDKB 3VYTB 4KJZA 2GOXB 2L5QA 2MC4A 3W2WA 3FDYA 4BU2A 4F3QA 1IRXA 1DGRM 3OL4A 2JVHA 3HPGA 3RPUD 4XKBA 1SAUA 4XL9A 1WJFA 2OC6A 4JOMA 3ZCOA 1MMDA 4IKFA 3CMMA 4FETA 1LVKA 3W3CA 2V1NA 5LFAA 3DTIA 2VQGA 2JUGA 1NG7A 2DJIA 2E60A 3DPLC 1W36D 3S93A 3TMOA 2X85A 3FHNA 3PJRA 4E6KG 3LFUA 5HOOA 1HA8A 1LFPA 2M0MA 2VJJA 1KONA 4C2UA 5CKTA 4B3XA 4ZDOA 4BGDA 2KPMA 4PJJA 4BDYA 4NNJA 4ZDPA 1BR1A 4J00A 2M7AA 2VIXA 1V5FA 1X1DA 3H5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY1 A;  3RCO A;  2LY2 A;  2KZV A;  3S93 A;  2KPM A;  2LH9 A; 
#chains in the Genus database with same CATH topology
 4A0X A;  1IC8 A;  3MAJ A;  1T39 A;  1I6X A;  3HBL A;  3F8M A;  3FIS A;  4KIG A;  1I1S A;  2KQR A;  2Q2E A;  1PP7 U;  3A4C A;  5GPA A;  4BL0 B;  3E5U A;  4DW6 A;  2VN2 A;  2KP6 A;  1VND A;  4GYI A;  3F0C A;  3WU1 B;  2DMT A;  5E1Z B;  1ZH5 A;  2WV1 A;  2VL8 A;  4HX4 A;  1IUF A;  4L5I A;  1QPI A;  4OMY A;  4E7K A;  1Y6I A;  1MJA A;  5AIQ A;  1R5I D;  5F6F A;  3T1B A;  3LMM A;  4LJZ F;  5E1X A;  4M71 A;  4P55 A;  3H0D A;  4CGZ A;  2NXN B;  2EWN A;  3ZMZ A;  2L7F P;  3G6E I;  1IZ1 A;  3TO6 A;  4OIQ F;  1IN4 A;  2QBY B;  5CVR A;  1QHH D;  3QYB A;  3DF8 A;  3K2Z A;  3IHU A;  2HDW A;  3LFK A;  4OMZ A;  3MWM A;  2IT0 A;  2L3D A;  2FA5 A;  4IPA A;  3V7R A;  3VOE A;  3F8C A;  3D5S C;  1B4A A;  3S3M A;  2AXL A;  2X9D A;  4GGG A;  2RV8 A;  1W0T A;  1R5G A;  4D9J A;  2AQE A;  2R7V A;  4QPO A;  1IF1 A;  5CQE A;  4EGZ A;  1IN6 A;  2Y9Y A;  1GLN A;  3HRM A;  4MTE A;  2HEO A;  5IP9 J;  3UKG A;  3KP2 A;  2DMP A;  3ZXS A;  4P5O A;  2WTE A;  2VB6 A;  3WTV C;  5FD6 A;  3I71 A;  3OYA A;  3CCU I;  1XX5 A;  3ROU A;  2Y48 A;  2LRD A;  3TP3 A;  3WGH A;  1VQ6 I;  5HLI A;  2QF7 A;  4I0A A;  3P9I A;  3ZQF A;  1A36 A;  2Z9O A;  2DK5 A;  4KN7 X;  4U0V A;  4CYC B;  3BOQ A;  3FKJ A;  3WG9 A;  3K4N A;  2EJR A;  3F72 A;  1UAA A;  1A04 A;  3FBI B;  3H1C A;  3V4G A;  5EEA A;  2F48 A;  4X0G A;  4RGX A;  2BW3 A;  4Q4Z F;  3S3N A;  3RSN A;  4IHW A;  4DZJ A;  4BYY A;  2X4H A;  4M9S A;  2CV0 A;  4HAM A;  4PFP A;  2L9V A;  1BR4 A;  4OAY A;  4AU7 A;  4XRS G;  1U6G A;  2O8X A;  2FBI A;  3BTJ A;  1VQP I;  4FE7 A;  1FIA A;  5FLX Z;  2XF5 A;  4S04 A;  1QU3 A;  2QGU A;  3RIR A;  2L2O A;  3C2B A;  2RAE A;  1MBJ A;  2MFZ A;  5B5E C;  1JI8 A;  4HNU A;  3CP2 A;  2IRF G;  4A3I J;  1ZEL A;  2QBY A;  3ZQQ A;  1QPM A;  1WHU A;  1ZLJ A;  4OIP F;  1OCC H;  1J9I A;  1WI9 A;  1TZL A;  2EV6 A;  2FE3 A;  4F91 B;  1K79 A;  1EJ9 A;  2F2E A;  2STW A;  2BYV E;  2DU9 A;  2VAS A;  3GEZ A;  3HXL A;  3K4L A;  2EIK H;  3ZGK A;  1GVJ A;  4XKW A;  2B7E A;  4C2M J;  1BI0 A;  2X6W A;  3RCO A;  1XDS A;  1DUX C;  3DEW A;  2DA7 A;  2CU7 A;  1T8I A;  2JQ7 A;  1F43 A;  3EET A;  4Q47 A;  2NAZ A;  2MA3 A;  2PJP A;  2E7W A;  4AIK A;  3K10 A;  2VXD A;  1OR7 C;  2EBI A;  1A6Q A;  2QQ8 A;  3D0S A;  1LUJ B;  2CRG A;  1HLV A;  2LOO A;  1AWC A;  4IOA F;  4UVA A;  5GTH C;  4UVC A;  3C7J A;  2P7C B;  2XGC A;  2X51 A;  2DMU A;  3KEQ A;  3UNG C;  3HRU A;  4XRS A;  4ON0 A;  3J7Y J;  1Q1H A;  2VOP A;  5CPR B;  4FHT A;  1Z7L A;  1Z3X A;  1BOB A;  2BHZ A;  3PUB A;  2OA4 A;  1JGG A;  4RS8 A;  3TW7 A;  1MMS A;  4FE4 A;  3FXK A;  2JA8 J;  1QZE A;  3SDG A;  3A01 A;  1FYK A;  3C1D A;  5FKK A;  3GME A;  2KIS A;  1KYW A;  2KHM A;  1VI0 A;  3ULQ B;  3PFY A;  3KPH A;  2FD5 A;  4IHX A;  5LGU A;  1MIJ A;  5IT3 A;  1QZZ A;  1P4X A;  3LAP A;  5E1W A;  3VWB A;  3OYK A;  1T98 A;  1F5T A;  3FIW A;  4B44 A;  3Q9S A;  3OYC A;  2ZSH B;  5DS9 A;  1ETK A;  1G3Y A;  2LY1 A;  4XK4 A;  3JRI A;  2R7Q A;  1FT9 A;  2QEN A;  1SD5 A;  1RR8 C;  4HQM A;  4G8X A;  4B8X A;  1Y1W J;  3PNV A;  2O8K A;  4ZYA A;  2DA1 A;  2IEK A;  4AYB A;  1KGS A;  1RPW A;  2CQQ A;  3BJO A;  4I76 A;  4ZTJ A;  4ENJ A;  3PSI A;  5D4S A;  3ZMS A;  3LSJ A;  3MVP A;  4F93 B;  2F5C A;  2M7B A;  3L7W A;  3M8F A;  4Q48 A;  2R7S A;  2KIQ A;  5TIS C;  2NNY A;  4N4O B;  2IJL A;  3HUG A;  2XB0 X;  2CUZ A;  3HOY J;  2RRE A;  2JK3 A;  2I5U A;  2L4A A;  2OUM A;  2XSJ C;  3VEP A;  4N0B A;  3W6J B;  1AU7 A;  3J7Z I;  4CXF A;  1TNT A;  1REP C;  4LLN A;  3NWS A;  3O2P E;  3LOC A;  1W5S A;  2V7F A;  4AM3 A;  4MHG A;  3HEF A;  1WH5 A;  4PGH A;  4UY8 I;  3OWT A;  1YRN A;  4UUS A;  5GTI C;  3WTX C;  1LDJ A;  4WF2 A;  3W2V A;  4BXU A;  1GVD A;  2XPW A;  3CQZ J;  4RBO A;  2WY7 Q;  1U5T A;  1JUM A;  3S2D J;  1ZRD A;  2ZFU A;  5TRD A;  4BBS J;  1ETW A;  4IHY A;  2EFW A;  4HV6 A;  1HCR A;  3VSL A;  3OY9 A;  5F04 A;  1XS9 A;  1R49 A;  3BPV A;  1H0M A;  3U2R A;  3I4N J;  3CMY A;  9ANT A;  4HG2 A;  4F52 A;  2EFN A;  4PJM A;  1MJB A;  5J6X A;  2QKM B;  4MQV A;  1A5J A;  5M5X J;  2H8R A;  2LF7 A;  2DLL A;  3G1L A;  3GTP J;  2JPB A;  4KA4 A;  1KU7 A;  3B02 A;  2IVM A;  2I8D A;  3M1C A;  3REO A;  3E6C C;  3BJA A;  2GBY A;  2CQ7 A;  3CUQ C;  5H20 A;  2NS0 A;  1TNS A;  2LY9 A;  1E17 A;  1ZGW A;  4AVZ A;  2ZKZ A;  3KZZ A;  1S7O A;  3K4M A;  2MLG A;  4KMU X;  1S8N A;  2EK5 A;  2YX4 A;  5FKL A;  3KX2 A;  3DCF A;  1HKQ A;  4KIT B;  4RAG A;  3ELK A;  1ENH A;  2ZJP F;  4II2 A;  1KA8 A;  3LST A;  2R92 J;  2DO7 A;  1J75 A;  1JHH A;  1G3W A;  2M87 A;  4DYR A;  4II3 A;  3E7L A;  3CMA I;  3K6G A;  4YEL A;  2ZME A;  2EV5 A;  4XRF A;  3HHH A;  3BZK A;  1CF7 A;  3CLO A;  3DTE A;  2Z2S B;  3GLL A;  4Y7N J;  2D1H A;  2JVG A;  3MZ8 A;  3R0A A;  1SD6 A;  3U1D A;  1FTZ A;  4D0P A;  5BOX A;  4U7D A;  2FNP A;  4UUV A;  3SZP A;  1MBE A;  4L5E A;  3E1S A;  4I6Z A;  4RLQ A;  1V5G A;  4CUG A;  2DK8 A;  2ZB9 A;  2M4G A;  2OCC H;  3EDP A;  3P9K A;  2CJJ A;  2RQP A;  5FFZ A;  3JSO A;  4IOC F;  4FX4 A;  2V26 A;  2BY1 A;  5D5X B;  4KMF A;  2OTL I;  1MBG A;  4MEX F;  1BI2 A;  4JK1 X;  1BJA A;  4D1Q A;  2A07 F;  2R7O A;  2A68 F;  4Y15 A;  2RC4 A;  1G3S A;  4LB6 B;  1X1C A;  3ONQ A;  3JRA A;  1W5T A;  4B1R A;  4HA8 A;  1M1E B;  4M3E A;  4NC7 A;  2FQ4 A;  2ID6 A;  3HSR A;  4NC6 A;  1KQ9 A;  3CCE I;  4NDL A;  1BI1 A;  1TWA J;  1R1U A;  2HZD A;  4WX9 A;  3DPU A;  4CZZ A;  2K85 A;  2CGP A;  3ZN0 A;  3BCA A;  5IP6 A;  2K7L A;  3TOB A;  1VFC A;  4HV5 A;  3ZQL A;  2RVC A;  1JE8 A;  2KJC A;  3V42 A;  4LK0 F;  1AHD P;  3CC7 I;  3HGG A;  2FX0 A;  2Y0M A;  3GZN B;  3CF2 A;  3TP0 A;  2LMD A;  1WRJ A;  2BY0 A;  4AUX A;  3C2G A;  2IGM A;  3I59 A;  1W7P A;  2B0L A;  2ESH A;  3G2B A;  2PI0 A;  4ENM A;  3OYE A;  2DT5 A;  5B3S H;  2J5O A;  3H36 A;  3MKL A;  3GZ5 A;  2G0E A;  2HNH A;  1XMA A;  3DLA A;  1VQ4 I;  1R1V A;  4EJV A;  2STT A;  3K70 C;  2OU2 A;  3DEU A;  3HOT A;  3VFZ A;  3HC7 A;  3K4J A;  1L3L A;  1IRZ A;  2AHQ A;  5LHG A;  1DPR A;  3C3W A;  2X6Y A;  1ZLK A;  2R7F A;  5IOY A;  2R7X A;  2FXA A;  5EZH A;  3DU5 A;  4H4K C;  3FXL A;  2K9S A;  3HG9 A;  1BI3 A;  1G2H A;  4CCO A;  2NOG A;  1AA7 A;  2TRT A;  3LSG A;  4KIB A;  2QWW A;  1ZYR F;  2QQA A;  5F1J A;  5FB2 A;  3H92 A;  2GOM A;  1U5T B;  5J47 A;  2JT1 A;  4XLN F;  2ELH A;  4WCG A;  4A3L J;  2HGC A;  1WJ5 A;  3I58 A;  2NVT J;  3EUH C;  4LG0 B;  2XAG A;  3E97 A;  5E3M A;  4HF1 A;  1N78 A;  4IVN A;  3CCR I;  3GZ6 A;  1TL8 A;  2I10 A;  2P81 A;  1GV2 A;  1YOV B;  1S6L A;  1IV8 A;  4M9Z A;  4BE2 A;  3VDX A;  4Q5S F;  2WA0 A;  2JN6 A;  4K2E A;  2W48 A;  3ZMT A;  4IX7 A;  1Z21 A;  3S2W A;  3I3L A;  2GQQ A;  5DYM A;  5F08 A;  2KMU A;  1OYI A;  3OMY A;  4I0B A;  3RZD J;  2K5C A;  5K5O A;  4GXO A;  2L9N A;  4Y4R A;  2WY8 Q;  3HGY A;  4GFB A;  1LDK B;  2HYG D;  3W2W A;  3FDY A;  2F4M B;  2W85 A;  4BU2 A;  1DGR M;  2FSW A;  3HPG A;  1S72 I;  4XKB A;  1LJ9 A;  1ETQ A;  1SFE A;  4NBQ A;  1ZAO A;  3M7G A;  4D5F A;  1WJF A;  1OMI A;  1E3O C;  3ZCO A;  3QPT A;  1MMD A;  5FD5 A;  1VTN C;  3W3C A;  2VPR A;  1TQI A;  4HLX A;  2VQG A;  1ZR4 A;  2PN6 A;  1F9N A;  2A61 A;  3ABU A;  3TMO A;  3B6A A;  2X85 A;  3KP6 A;  3FK6 A;  2ZME B;  1RZ4 A;  1A35 A;  5E8I A;  5K5Q A;  5DV5 A;  2M0M A;  4UB6 C;  1KON A;  4C2U A;  4ZYH A;  3ERE D;  1RUN A;  2Y31 A;  3E6D A;  2JA7 J;  3BJ6 A;  3GFM A;  1MKM A;  1YIO A;  1HOM A;  2P7V B;  1DDN A;  1BR1 A;  2FML A;  1B6A A;  1K6O A;  1SD4 A;  4LB5 A;  1QQI A;  2XRL A;  4CCK A;  1QVT A;  4HNT A;  4L9N A;  1U0J A;  2DI3 A;  4AC0 A;  5GAD J;  2BW3 B;  2ME0 A;  4MTD A;  2E35 A;  3DPT A;  1QBJ A;  1WJB A;  1X4O A;  4C3H J;  2BVL A;  1CGP A;  4L5J A;  3L2U A;  2VBX A;  3V8K A;  2IBD A;  1WI3 A;  4UHT A;  2NNN A;  2QCO A;  2KZG A;  5H6R A;  5EF6 A;  1VQ8 I;  2J5P A;  3JRF A;  2HDC A;  2OQR A;  1IAW A;  1IJW C;  1A6I A;  5CJ9 A;  3SZG A;  2EPF A;  3DEE A;  3IKT A;  1MZB A;  5K5R A;  3K9T A;  3M07 A;  4FAS D;  2XDV A;  2A6T A;  2V1X A;  1MDM B;  1FYM A;  2M45 A;  2WB1 A;  4UV8 A;  2VKD A;  3A0H C;  3BR2 A;  3AL0 B;  2N8G A;  4IRI A;  3CJT B;  2DA2 A;  3HJE A;  4UUT A;  1WJD A;  1TTY A;  2M0C A;  4B3A A;  4A3G J;  1MMA A;  3HDD A;  2KT0 A;  3NRV A;  3O3K A;  3G71 I;  2GLO A;  1DGW Y;  2JSC A;  2IS4 A;  3CDL A;  2W84 A;  5DM7 F;  4CH7 A;  3S16 J;  2OPT A;  3OYH A;  1MNM C;  2CQN A;  4BH9 A;  4U87 A;  4YFX F;  1VQ7 I;  5FLV A;  1Y0N A;  4G7Z F;  1ON2 A;  2ELK A;  3CCY A;  3PIO F;  3VPR A;  1PDN C;  2K9Q A;  3LAJ A;  5E3N A;  5L3C A;  1DU6 A;  3TED A;  2MYS A;  3M1E A;  4YEJ A;  3HPH A;  1J2X A;  1YJN I;  4BXX J;  2WAE A;  3VOD A;  1QNT A;  4EM2 A;  1PVE A;  2F4I A;  4PJN A;  1Y8Q B;  2CW0 F;  5E20 A;  3I54 A;  1FLI A;  2LKP A;  1P9Q C;  3ECO A;  3HOX J;  2L02 A;  1OCR H;  2KIF A;  2R7U A;  2EFP A;  4DBQ A;  1T56 A;  2HXI A;  3F9K A;  3GLX A;  4KIC A;  3KP3 A;  2ECC A;  3QOE A;  1R00 A;  3D1N I;  3OYF A;  3LWF A;  2UXX A;  2Y0S N;  5J40 A;  2IS6 A;  4KIS A;  2R7Z J;  4XLA A;  3A0B C;  1Z0X A;  2LH9 A;  2W57 A;  2COB A;  2E1N A;  3SYT A;  1F1Z A;  3GUD A;  4HSR A;  4XBF A;  4CCM A;  1WJE A;  1XSD A;  2NYX A;  1XG1 A;  1R1T A;  4ASN A;  2DYR H;  1B72 A;  1TWF J;  5HLH A;  3MKZ A;  2XUB A;  5D8K B;  2HFH A;  4XQF A;  1YJW I;  2O6G E;  1ZHF A;  2FUG 2;  2V4J C;  4P9F A;  2X1E A;  5E8G A;  1E0E A;  3RQI A;  2K3P A;  4FX0 A;  3FZV A;  2VON A;  4IQ4 A;  3ZQC A;  3ABM H;  1J59 A;  2ZJQ F;  4HEA 2;  4XSZ F;  5FRN A;  4RAY A;  5BPI A;  2R7W A;  2R7D A;  1U8B A;  2HVR A;  4PCQ A;  1PP8 F;  3U1K A;  4BDZ A;  3A01 B;  1WH7 A;  3DBH B;  3RPU A;  3J7A Y;  3HB9 A;  1FSH A;  2X0L A;  3N97 A;  2DT7 B;  3PM1 A;  3S2H J;  2FBH A;  3E6M A;  3WOD F;  1OCP A;  4ABZ A;  4I7H A;  2VI6 A;  2GWR A;  2GXA A;  1ULY A;  2MLK A;  2WV0 A;  3ISP A;  1K61 A;  3KLN A;  2K9L A;  4RA2 A;  3GW2 A;  2PMH A;  1JXS A;  1Z6T A;  1F36 A;  2LG4 A;  2VJI A;  1U2W A;  3D5L A;  3TO9 A;  3JAM K;  4XLE A;  2MC3 A;  5ICG A;  3FWE A;  3S1R J;  1GHC A;  1IRF A;  1D1A A;  1YIJ I;  2VLA A;  4PSW A;  1OR7 A;  3BG3 A;  1TT5 B;  3IP4 B;  1HW2 A;  3F6V A;  3H5R A;  3FMQ A;  4U88 A;  4BQQ A;  1XC5 A;  3WHB A;  3BTL A;  2XGX A;  2DA5 A;  3K4B A;  4DBR A;  4ZZD A;  3HUG B;  5D4R A;  2JZY A;  2KIM A;  1FMW A;  2BBY A;  2HS5 A;  2P5V A;  2E5Z A;  2V9K A;  1UMQ A;  3HSE A;  3OYI A;  3IKV A;  2XAF A;  3HKZ A;  3OYG A;  2DOA A;  5JVT A;  4NQW B;  2FRH A;  4CO8 A;  3F23 A;  1LFU P;  5DTD A;  5CQG A;  2Z5U A;  3WTW C;  3OS1 A;  3H5N A;  4RMN A;  2D45 A;  1OCO H;  2E36 A;  3I4P A;  4M3B A;  1AOY A;  2VE9 A;  1GT0 C;  3BG9 A;  2E1C A;  4L9T A;  1JKQ C;  3T8R A;  2E2J J;  3K7A J;  1RKW A;  1SVO A;  4C9Y A;  4D7N A;  1LNW A;  1YLF A;  1C0W A;  2L7K A;  4HZF A;  1EA3 A;  1FOY A;  1SEU A;  2DCE A;  5LLQ A;  1NH3 A;  2E34 A;  2EV0 A;  2YU9 J;  3V8L A;  3VYU B;  1FX7 A;  2DPD A;  5FKN A;  1T6S A;  2JWT A;  4XN0 A;  2ZXI A;  4B09 A;  2VQL A;  4ITV A;  2DFI A;  1OCZ H;  3P7N A;  5HS9 A;  4EM0 B;  1UFM A;  4IHS A;  2KL4 A;  1HKS A;  3WTU C;  3TBI A;  5JVG F;  1HDP A;  2VBY A;  2EIM H;  1MBF A;  2M2E A;  2PBI A;  4R1H A;  3BZ6 A;  3RKY A;  4DIQ A;  4HX8 A;  2V79 A;  1SFU A;  3J80 Z;  3ZPL A;  1S7E A;  3V8J A;  3FHZ A;  3CES A;  3OIP A;  3QAH A;  3U21 A;  1TBX A;  4PFO A;  4A3C J;  3BG6 A;  2Z33 A;  3VYR B;  4Y52 J;  2HYJ A;  1IN5 A;  3WE3 A;  2NVY J;  3FM3 A;  4MO7 A;  2VQC A;  1WVR A;  1U8R A;  2XAS A;  3MZY A;  4CCN A;  3FMR A;  2EZI A;  3GVA A;  1UG2 A;  1Z3Y A;  2HPI A;  4JBA A;  3FXQ A;  3HOV J;  2D5V A;  3BTI A;  2E7X A;  4JX6 A;  3SEQ A;  4HRI A;  1MNE A;  4A6D A;  3QP6 A;  2IAI A;  1FC3 A;  4W97 A;  4EJU A;  2AQF A;  1HDD C;  3DLL F;  3VSK A;  3CDI A;  3F21 A;  3OOP A;  2HTJ A;  3FKI J;  4QSH A;  1XCV A;  3LSH A;  5D5V B;  1S3J A;  5TJJ A;  4EAT A;  3TOA A;  4LFU A;  1SVL A;  3K4C A;  5BQT A;  1FIP A;  3E0J B;  5EG0 B;  3JRB A;  4MFD A;  4BNC A;  5ILS A;  5EDN A;  1R71 A;  4AWX B;  3IV5 A;  2BY2 A;  3GTG J;  1U9N A;  4G9Y A;  4C3I J;  3QPH A;  3HSF A;  1FY7 A;  2XKO A;  4JX5 A;  3LSI A;  1BM9 A;  2W25 A;  3CJQ B;  4G94 A;  4PK4 A;  1ZGJ A;  5CVJ A;  2ZFW A;  3RDI A;  1CQT A;  1O3Q A;  1ZRF A;  1B72 B;  4HPQ A;  2VJ5 A;  5DD8 A;  4ZYD A;  2CV2 A;  3CTA A;  2V6E A;  1YX3 A;  2WBM A;  2EZL A;  1YQA A;  1RKT A;  3CJN A;  1JHF A;  1W7P B;  2WWY A;  1XDU A;  2ZXW H;  1OYY A;  3PQK A;  4ESB A;  3Q5F A;  1BW5 A;  4ZJZ A;  1D0Y A;  5AIP A;  3KYC B;  2P5L C;  4UV9 A;  4RB2 C;  2LKS A;  5F0F A;  2NVU B;  2VBZ A;  1IW7 F;  2VKE A;  2XPU A;  4BQN A;  2L7M P;  2LF8 A;  2V9P A;  3CCQ I;  4FQG A;  2CUE A;  2XV4 S;  1R4M B;  1XMX A;  4WXH A;  4A69 C;  4QTR A;  4OWR B;  2E1M C;  1YW8 A;  4XOP A;  3MQ0 A;  5L3D A;  3S3O A;  4O3M A;  1AKH A;  2E71 A;  1LFB A;  3SEZ A;  4GYG A;  2VOD A;  2QUF A;  4W1U A;  2M3A A;  4GO1 A;  4LIV A;  4XID A;  3MKW B;  3HOW J;  2VT2 A;  2LDU A;  4LLL A;  2RQQ A;  1I5Z A;  4BY7 J;  3F22 A;  1Y8R B;  1BR2 A;  3FBN B;  2E1M B;  2DW4 A;  3CME I;  1RES A;  3COA C;  4RGS A;  2LY2 A;  3FF5 A;  3NAR A;  5KVR A;  2DTZ A;  4KIF A;  2HVS A;  4A5M A;  3HHG A;  3D5R C;  1O7L A;  2V1D A;  2R5Z B;  4L9J A;  2WB1 N;  2K27 A;  1U9O A;  3IL2 A;  2FOW A;  2UUZ A;  3LA7 A;  2DFF A;  2A5W A;  2CYY A;  4XLC A;  1YRN B;  4A3B J;  4ESF A;  3ASN H;  2Y9Z A;  3QOD A;  3OR2 C;  2R7R A;  3WGI A;  4X1E A;  3JRD A;  5CVV A;  3BT9 A;  4A3J J;  1EH7 A;  4EJT A;  1KU2 A;  5LEJ A;  3BY6 A;  3IAS 2;  5IT9 K;  3I64 A;  1K4S A;  3FXO A;  3R4K A;  1RC9 A;  5E79 C;  2GM4 A;  2MAB A;  3ZQH A;  4QLC U;  1MH4 A;  2NS7 A;  2LR8 A;  1Y56 A;  3OYB A;  4XNF A;  1LVA A;  2NS8 A;  3KZY A;  2UXN A;  2O3F A;  2K02 A;  2LYC A;  4B48 A;  4Y13 A;  3ZRG A;  2ZJR F;  1IG7 A;  2M9H A;  2K9M A;  3FK7 A;  1LDD A;  5M5W J;  1W7P D;  5EEH A;  2HU9 A;  2ZC2 A;  2CH0 A;  2DBB A;  3DU6 A;  3PUF A;  1Y0U A;  1B8I A;  2PMZ N;  3HTU A;  1YO5 C;  2B9S A;  1TP4 A;  2JRT A;  4F3Q A;  5HDN A;  2XAQ A;  2A6H F;  4UXN A;  1YIT I;  2JVH A;  4HF0 A;  3RPU D;  2CQK A;  1SAU A;  4IJA A;  3PFI A;  4XL9 A;  1QZY A;  1HBX G;  3MCZ A;  4MGR A;  3F8N A;  3RKW A;  2JPC A;  5EG0 A;  3I59 B;  5DM6 F;  2V1N A;  2D1V A;  5LFA A;  1W36 D;  2E60 A;  4D5C A;  4MEY F;  2GA1 A;  3S93 A;  1YHQ I;  1IDY A;  3FHN A;  3G1O A;  3PJR A;  4E6K G;  4HDU A;  3JAM Z;  1KU3 A;  4J19 A;  1E2X A;  2X48 A;  3LFU A;  3W6K B;  2VT3 A;  1LEA A;  5BPD A;  1H9T A;  1UHW A;  2ETH A;  4X6A J;  3HRS A;  3L1P A;  4ZDO A;  4G6D A;  4BGD A;  2GZW A;  4PJJ A;  4BDY A;  4ZDP A;  2LSO A;  1ZG1 A;  1D8K A;  4YII A;  5KCM A;  2VIX A;  1MBH A;  1ACI A;  1V5F A;  1MDM A;  3H5A A;  2QQB A;  4I98 B;  4DQ2 A;  3CUQ B;  4H0E A;  1P92 A;  4Y3O A;  2VBW A;  5ICC A;  1X58 A;  4MNU A;  5DDG A;  2DQR A;  3BWG A;  3CO7 C;  1K83 J;  2OD5 A;  4EJO A;  1X3Z B;  2CV1 A;  3HOU J;  1G6N A;  2CW8 A;  2KRH A;  3KEY A;  1LKX A;  3TDU C;  4V2G A;  1TQM A;  5FRO A;  4HDV A;  3DWL E;  1V54 H;  5C4J J;  2LC2 A;  2XAU A;  2HWV A;  1VF9 A;  4BXF A;  2PLY A;  1VQO I;  2M1B A;  4D7M A;  3K0L A;  1DQU A;  1I50 J;  4IRG A;  1D3Y A;  2JA5 J;  4ZC3 A;  3EUA A;  2BVM A;  3IRQ A;  3EYY A;  1FTT A;  4RB3 C;  2NOJ B;  1JKP C;  4XR6 A;  1BC7 C;  5D6E A;  4FIS A;  3Q0W A;  2LBF A;  2EFO A;  2V6C A;  3WGG A;  2BOL A;  3H9J A;  3FX3 A;  2H09 A;  4XKV A;  3MZH A;  4V19 K;  1QO0 D;  4PSX A;  3OYJ A;  4ETS A;  1BN5 A;  3OYD A;  4BE0 A;  2E2I J;  1S9H A;  3LL7 A;  1X2M A;  2W4S A;  4RM3 A;  4I2O A;  3A2K A;  3HRT A;  2MH9 A;  1MMN A;  3CF5 F;  4FT8 A;  2Y0S A;  4JX4 A;  3QQA A;  4CA0 A;  2RDP A;  4ZDL A;  1ORK A;  2QZ8 A;  5HLG A;  1WPK A;  4M6Y A;  2BEO A;  1VQN I;  3GYH X;  2XSD C;  3AG2 H;  1MMG A;  1UHM A;  5KNL A;  4EVI A;  3MMY B;  1Z6R A;  2HDD A;  1MD0 A;  3WHC A;  5LGT A;  1T2K A;  4BUP A;  3QPL A;  2K40 A;  3RTR A;  1X19 A;  3A02 A;  4F55 A;  2NVQ J;  3AFH A;  4UUS B;  4CZC A;  1PYV A;  3OYN A;  1ODD A;  3F3X A;  4A3M J;  2ZJ2 A;  4EV0 A;  3OL3 A;  4O6J A;  4CYD A;  4HNV A;  1O4X A;  1FOX A;  2EZH A;  2O9L A;  2WAD A;  2VJ4 A;  1RIO H;  1STZ A;  3CC2 I;  1W0U A;  5IY5 H;  1R5H A;  4PJ0 C;  2DTR A;  3FXU A;  1NTC A;  5F1R A;  1T0F C;  3BR5 A;  4A0Y A;  4UVB A;  1ERD A;  1PUE E;  4O5V A;  2F5F A;  3CUO A;  5KAI C;  4E7S A;  5K1Y A;  2F4O B;  5E3O A;  2H6C A;  2BXZ A;  1Z91 A;  1KU9 A;  3U9G A;  3RKX A;  2VUM J;  3CD6 I;  4IZZ A;  4N4N B;  3AG4 H;  4RAF A;  3TO7 A;  5J8C A;  2DDB A;  4Y17 A;  2PEX A;  4IXA A;  1G3T A;  2ZBK A;  4E7H A;  3JRG A;  3BR3 A;  2DOE A;  1ZK8 A;  2X1C A;  3CJR B;  2QEX I;  3DFG A;  5IPA A;  3HIF A;  1R36 A;  4GCV A;  1D5V A;  3NAU A;  2QSG X;  5LEK A;  5K7H A;  1E3P A;  4LG0 A;  4QPQ A;  1MND A;  2CMP A;  4IQJ A;  1B9N A;  5H6Q A;  4I01 A;  5D5U B;  2JA6 J;  2L9S A;  1APL C;  4XOR A;  4C2T A;  2FJ1 A;  2M8G X;  3GF2 A;  1P7I A;  3LNQ A;  5J3L A;  1G4D A;  3CO6 C;  3I56 I;  4S0H B;  4E7L A;  2LP0 A;  1IN7 A;  4EQQ A;  4IEJ A;  4FTH A;  2Y69 H;  1TW3 A;  4A2U A;  2XB5 A;  3Q0U A;  2DT6 A;  2FNA A;  3L2W A;  4BBR J;  1J0R A;  2GIV A;  3LQQ A;  4ESJ A;  1QA6 A;  4CHU A;  5IYC J;  1BJZ A;  1Z05 A;  3OIQ A;  4A5N A;  4CYC A;  1WJA A;  4IL6 C;  3E6B A;  1D5Y A;  2P4W A;  4E4H A;  2EIL H;  4FCY A;  5JHU A;  3L2Q A;  5ILU A;  3I55 I;  3JRH A;  1XPX A;  3A1Y A;  4PGG A;  2XAH A;  1UB9 A;  2EZK A;  1LE8 B;  4A12 A;  2R5Z A;  1FBU A;  5KK1 A;  3GX4 X;  2HQN A;  3ZN1 A;  2O7O A;  1VQL I;  1PUF B;  3H9G A;  2K86 A;  4G6Q A;  2MBF A;  3RZO J;  1IXS B;  3IRR A;  3TDZ C;  4EMS A;  5L3G A;  3V7S A;  2MGQ A;  3M9A A;  1T33 A;  1GDT A;  2HKX A;  1G8X A;  2GAU A;  3FXR A;  2P6T A;  1ETV A;  2VKV A;  4BHB A;  4ZZL A;  2Z16 A;  3TL4 X;  1V4R A;  1SD7 A;  3DQV C;  4BAC A;  5HVQ C;  3AKZ A;  3F8F A;  2LK2 A;  2X1D A;  1ZG5 A;  2OF7 A;  3DV8 A;  1BW6 A;  4A3D J;  3GFI A;  2P6S A;  1V3F A;  5FRM A;  1JKO C;  1HXD A;  5CVU A;  1FP1 D;  5F64 A;  3S17 J;  4XLF A;  3KET A;  1VQM I;  3MKY B;  5HDG A;  4YIR X;  3OYL A;  2K9N A;  1X1A A;  1NG6 A;  2JUC A;  5DCF A;  3S1M J;  2GXB A;  1IN8 A;  1J5Y A;  2A3S A;  2NVX J;  3EQL F;  1BBY A;  1PJR A;  2L01 A;  2E1O A;  1N25 A;  2PG4 A;  3WTY C;  2ELJ A;  2D2W A;  3F8B A;  4RB1 A;  1RUO A;  4P1W A;  1K6Y A;  1D0Z A;  1TT0 A;  2LLK A;  3HYI A;  5C3E J;  1ETO A;  3VB2 A;  2HQ5 A;  1V55 H;  5FKO A;  2PMU A;  2B63 J;  1Z67 A;  5FGM A;  3GTK J;  1BOA A;  2WAQ A;  4Y33 A;  3GTM J;  3IH4 A;  5EEG A;  1FWZ A;  4OU0 A;  3DKY A;  3A03 A;  3DKX A;  5A2Q Z;  4HF2 A;  3BTC A;  1OPC A;  3DBR B;  3KP4 A;  4LD5 A;  4DNC A;  4DZP A;  1H8A C;  2DYS H;  2IS2 A;  1MH3 A;  1ZGA A;  5LHH A;  3R61 A;  4AIH A;  4BJ6 C;  1EH6 A;  3WU0 A;  5GAE J;  5LHI A;  3KYL A;  3G4S I;  1FSE A;  2JRM A;  2OCE A;  4TV7 A;  3SFZ A;  3E5Q A;  1OCT C;  4NB5 A;  2VQH A;  2LKX A;  1FEX A;  4G12 A;  1DP3 A;  1MW7 A;  1Z1D A;  4R8H A;  5L3B A;  4A3F J;  1H88 C;  3ZQG A;  4XN3 A;  4EEF G;  3N4M A;  3HZJ A;  5IYD J;  2V9V A;  3PO2 J;  2XRO A;  2K4J A;  5GAG J;  3R6S A;  2RNG A;  2JMW A;  1IRG A;  4S05 A;  4LG3 A;  2X6O A;  3LSM A;  5EZG A;  3DBL B;  5C4X J;  2PQ8 A;  3HTS B;  4U7B A;  3JR9 A;  3RPQ A;  5FKM A;  1I3Q J;  2HOT A;  5JI6 A;  2LD5 A;  4N9I A;  1HST A;  1Z77 A;  2KRC A;  1Y1V J;  2EA2 A;  5J1U A;  4AID A;  2W7N A;  1SFK A;  5CYV A;  2ICW G;  2IA2 A;  2ZCW A;  5IP7 J;  2HOS A;  1R4N B;  3MN2 A;  4ZH4 F;  2QKL B;  2IGK A;  3IWF A;  4LMY A;  3OOU A;  3V7C A;  4E7J A;  3MD2 A;  1WZ2 A;  4B4C A;  1DP7 P;  5FLM J;  2XC7 A;  3PIP F;  1O3S A;  4ZYG A;  2DJN A;  3SZT A;  1R23 A;  1KYZ A;  1OIS A;  1XGS A;  2G9W A;  1WCM J;  1ZRE A;  3ERM A;  3S32 A;  3WTZ A;  3G3Z A;  4ZTF A;  1VQ9 I;  3BR0 A;  2DOD A;  2DOF A;  1IV6 A;  4AD9 A;  2DMQ A;  3SDB A;  4L9V A;  1S7A A;  3AAF A;  5HLT A;  1IXR C;  2KLO A;  3GFL A;  4LLG F;  3ZOB A;  2Z3Y A;  1XN7 A;  1H9G A;  1BL0 A;  4XLH A;  3OS2 A;  3LQR A;  1OQY A;  1U5T C;  2A6E F;  1N75 A;  2C6Y A;  4EJW A;  2CFX A;  1H89 C;  3NEU A;  3K4K A;  2Q8K A;  5FJ8 J;  2BY3 A;  2CFO A;  2QYO A;  5M3F J;  5DCM B;  2DFH A;  3SFI A;  2IGO A;  1RET A;  4ZYE A;  3RYR A;  2PJR B;  4IO9 F;  2RN7 A;  2F5D A;  1K7A A;  4KFC A;  3TKY A;  1ZR2 A;  3S1N J;  1RI7 A;  1X2N A;  3BR1 A;  3SJM A;  5JFR A;  1GUU A;  3L2C A;  3K2A A;  2HOE A;  2KJB A;  2O5R A;  1I39 A;  4GDF A;  1UEL B;  3J80 K;  4M9X A;  4RDU A;  1OFC X;  1YYV A;  2RGV A;  5L3E A;  4WK8 F;  2CG4 A;  2A69 F;  2P8T A;  2L0K A;  3E3V A;  3P9C A;  4RLF A;  3H3U A;  4IRH A;  4PUS A;  3CCM I;  3ABL H;  4ENN A;  4NQW A;  4E7Z A;  5ERI A;  2Z1D A;  2YPR A;  4RB0 A;  4B43 A;  3K1N A;  3CZ6 A;  3I53 A;  1YJ9 I;  1JJ8 C;  2AXT C;  1DPU A;  4HLY A;  3BR6 A;  1YE9 A;  5IYB J;  4CCJ A;  1MBK A;  1XSX A;  4L18 B;  2DQL A;  3CLQ A;  4KYW A;  2W82 A;  2M4K A;  2EIN H;  4A6E A;  4A3K J;  3I4M J;  3DKW A;  5F0C A;  3VYT B;  1YW7 A;  5JR3 A;  2K3F A;  3Q9V A;  1S29 A;  1TWH J;  3BP8 A;  3MFK A;  3L00 A;  3SXY A;  3OL4 A;  5H2F C;  5C44 J;  2DPU A;  1T0F A;  2YR2 A;  2CWE A;  4JOM A;  3CDH A;  5EGO A;  3CMM A;  1D8J A;  2HXO A;  2W24 A;  3DTI A;  2JUG A;  5D8L B;  2BHY A;  1FP2 A;  2XVC A;  2IA0 A;  5CVI A;  4BKX A;  2GA2 A;  3M3Y J;  5FLX K;  4KDP A;  5LBQ A;  3KLO A;  4CDG A;  1CF7 B;  1JUP A;  2IPQ X;  5HOO A;  3T0Y A;  1U78 A;  1TW2 A;  3PO3 J;  2VJJ A;  3E5X A;  3CCL I;  5B1B H;  3IC7 A;  3BDD A;  2KRF A;  3QP5 A;  5CKT A;  4B3X A;  1P4A A;  4HBL A;  4NNJ A;  4M72 A;  1O7F A;  1WGX A;  5DEQ A;  3R60 A;  3GTQ J;  2PX9 A;  3M4O J;  2OQG A;  1F4K A;  1TC3 C;  1X1D A;  5GPC A;  2BZT A;  2O61 A;  1TQP A;  1JJ6 C;  2EH3 A;  3GWZ A;  2R0Q C;  1SC7 A;  1FBS A;  2GXG A;  1WJC A;  1XCB A;  1P7J A;  3FXM A;  4OOI A;  2VC1 A;  3S14 J;  4C3J J;  2Y30 A;  5HS8 A;  5IOZ A;  4QIW N;  4JP0 A;  1TWG J;  2QM3 A;  1EKE A;  4BS9 A;  2KKO A;  1R22 A;  2IS1 A;  1P6R A;  2CSO A;  4DYQ A;  1Z9C A;  3P5J A;  1ZN2 A;  2OV7 A;  2YS9 A;  3Q0V A;  4DOZ A;  2P0W A;  1UG0 A;  1XB4 A;  1ETY A;  3BQZ A;  3CP8 A;  5GP9 A;  3JRC A;  1QGP A;  1PUF A;  1GXQ A;  3CUQ A;  5FFX A;  3KP7 A;  1HC8 A;  2H1L A;  3L2R A;  1TWC J;  1RR7 A;  2ZNY A;  1WKM A;  2CO5 A;  4BHC A;  3M8J A;  2JSP A;  3Q3S A;  5BNG A;  5DUI A;  2VE8 A;  1XGO A;  3IH3 A;  4EGY A;  4M3G A;  4PJL A;  3WE2 A;  2MH2 A;  4OIN F;  4OIR F;  3UR3 C;  3LA3 A;  2F5V A;  4XKC A;  3OIO A;  5EGO B;  4WXC A;  2HQA A;  1GV5 A;  4KT5 C;  1MSE C;  1VZ0 A;  2VOO A;  1NHA A;  1X3W B;  3OS0 A;  2LFB A;  4A93 J;  2FBK A;  4LIT A;  2CQX A;  1KZH A;  2DA3 A;  5GAH J;  3QU3 A;  5CLS A;  2FU4 A;  1W5C C;  1W4M A;  3AG3 H;  1U3E M;  2VKH A;  4BHP A;  4CSW A;  3VYS B;  1JT6 A;  4AVP A;  4I02 A;  2X6X A;  4YRV A;  1W36 C;  5HOD A;  3EYI A;  3R0J A;  5M5Y J;  2OZ6 A;  2K4B A;  3KFW X;  2M30 A;  2KDZ A;  1XGN A;  4PDK A;  1KQ0 A;  2Q2E B;  2EB7 A;  4AYB N;  3HL2 A;  2DAO A;  2JTV A;  4RAZ A;  3TW6 A;  1P4W A;  1BIB A;  3BG7 A;  1G59 A;  2V1U A;  5D5W B;  2Z99 A;  3TQN A;  3I0T A;  2BE5 F;  3ASO H;  3OSF A;  2IXS A;  1SVM A;  4XLP F;  3BG5 A;  3IAM 2;  4JQF A;  5LRS A;  2OAZ A;  4HST A;  3KYD B;  5D6F A;  4BEH B;  1VQ5 I;  3G73 A;  2DDA A;  4LGW A;  3TGN A;  4Z6Y A;  2IGN A;  4G6T B;  3F6O A;  2G7U A;  5K7Z A;  3LA2 A;  3H35 A;  2ZSI B;  5HNF A;  1W1W E;  2M34 A;  1T08 B;  2IW5 A;  2LVS A;  3KP5 A;  3DP7 A;  4B47 A;  2L7Z A;  3NQO A;  3JSP A;  4IHV A;  1I3A A;  1WWX A;  1B59 A;  1ZG3 A;  3RKQ A;  4MIM A;  3H3Z A;  2E2H J;  1FPQ A;  3WG7 H;  2XKP A;  2BV6 A;  4U0W A;  1RRJ A;  1QVU A;  2H6B A;  4XRM A;  4XM3 A;  3L2V A;  4I99 C;  1LQ1 A;  4MLO A;  2YU3 A;  1R7J A;  4KT6 A;  1JTY A;  2ADU A;  2QQ9 A;  1KQ8 A;  1LB2 A;  4J01 A;  3DTK A;  1FNN A;  2W1O A;  5J1Y A;  2E5N A;  1USS A;  2ZXH A;  4KN4 X;  4HQE A;  1ONV A;  3RI4 A;  6PAX A;  4V2F A;  1TLH B;  3K69 A;  4LIU A;  3ML6 A;  4GRI A;  1YX5 A;  2CW7 A;  4G7O F;  4WWC A;  3WTT C;  3KEO A;  5FO5 A;  5F27 A;  2LRE A;  1LPQ A;  2DMN A;  3OSG A;  2TCT A;  2XHK A;  2XPV A;  1P2F A;  4M74 A;  3PQJ A;  2OBP A;  4HYE A;  2L54 A;  4YG2 F;  1K4T A;  4L0Y B;  1D1B A;  3ESW B;  2ZXJ A;  1POG A;  2ISY A;  3H0G J;  1EV7 A;  1WFX A;  2FOK A;  3GO5 A;  3BCB A;  3NWT A;  1MGT A;  3ZQI A;  2RKH A;  2H1K A;  3PNT A;  3G1M A;  1R58 A;  4E7I A;  2M8E A;  1R6R A;  2ACJ A;  4BE1 A;  1N77 A;  5E17 F;  2QA4 I;  5DD4 A;  1ZAR A;  1HSJ A;  1X4P A;  2LNB A;  3GBG A;  3HM5 A;  3O6B B;  2DA4 A;  2QSF X;  3QYE A;  3OYM A;  1XD7 A;  2NRA C;  2XGE A;  2MW8 A;  2LBF B;  4ANJ A;  5L3F A;  2YSR A;  1VQK I;  3KCC A;  3HKZ N;  1ZRC A;  5ILV A;  5BS6 A;  2AS5 F;  3ABT A;  4EM1 A;  1BIA A;  1NK3 P;  4CCL A;  1JUS A;  4M3D A;  3EPZ A;  2ME6 A;  4P9U A;  2XF6 A;  3H3V K;  3FXJ A;  3BPX A;  3X2Q H;  2JA2 A;  3QOP A;  5J8F A;  4C30 A;  4XMY A;  2PMZ A;  2XRN A;  2RNJ A;  2BXY A;  1X1B A;  3O8H A;  4F7Z A;  3GTO J;  2ZO4 A;  3QPS A;  1O3R A;  2R5Y B;  1K78 A;  1X3U A;  3LSP A;  2QLZ A;  4I09 A;  5AON A;  1SFX A;  4BAY A;  1UHS A;  2H8W A;  3W2A A;  5A2Q K;  3S8P A;  4DYC A;  2HTS A;  3AG1 H;  3C2H A;  3S15 J;  3EUK L;  2WC2 A;  5HNH A;  5ED4 A;  3PNY A;  2GIZ A;  3QYF A;  3B6C A;  3ZMV A;  3CC4 I;  2FMY A;  2PFB A;  2P5K A;  2H27 A;  3JW4 A;  2KZV A;  4E70 A;  2KDO A;  5KHD A;  5IT9 Z;  5J1R A;  2R4G A;  3OV8 A;  3JCU C;  2OZU A;  2QVO A;  2HPM A;  3QU6 A;  4NUB A;  5B66 C;  3MEX A;  1BC8 C;  3S1Q J;  1E3H A;  1X1P A;  4KUM A;  2A05 A;  1OYW A;  3HOS A;  5J4V A;  2HVQ A;  3H9Q A;  2MSY A;  2DA6 A;  2LTP A;  2UWM A;  1I27 A;  4L0Z B;  1XGM A;  4MQ9 F;  2IA1 A;  5LGN A;  1J09 A;  2ECB A;  1A31 A;  1MSF C;  2E19 A;  5ICF A;  1RNL A;  4IHT A;  2OJE D;  3FM5 A;  4XON A;  1J7K A;  4NC8 A;  4RM2 A;  2EA4 A;  1D1C A;  5LRR A;  3KZI C;  2W00 A;  2UZK A;  3KE2 A;  4N9H A;  2JJ7 A;  3CCV I;  1UST A;  1EH8 A;  3QWL A;  4M6V A;  4UNO A;  2Y75 A;  1OLT A;  1XMK A;  1OJL A;  3J7A O;  1SMT A;  2MG4 A;  1UZC A;  3PSF A;  4BJ5 C;  5JHF A;  4M73 A;  2F6C A;  1FMV A;  1YTY A;  1T95 A;  2Q1Z B;  4MFE A;  2M5W A;  3RJP A;  1V5E A;  5E18 F;  5B1A H;  1UCR A;  1UJ8 A;  3K1P A;  4RGU A;  3ZMU A;  2HKO A;  3M8E A;  1I1G A;  2DFE A;  4BEH A;  4LOC A;  3BZC A;  3JTH A;  5LD2 C;  4HX7 A;  4LK1 F;  2COM A;  4BY1 J;  4DGW B;  4XOT A;  1B1B A;  2YX7 A;  3W6V A;  2Y2Z A;  5EJC A;  1ZQ3 P;  3CCS I;  2TDX A;  2Q0O A;  2XIG A;  1QHG A;  3KIO A;  3RQ4 A;  1FBQ A;  3DXJ F;  1SFO J;  3RYP A;  1IDZ A;  1Q1V A;  3C18 A;  2HI3 A;  1XSV A;  4OAZ A;  5DUK A;  1JTX A;  2XAJ A;  1O57 A;  5TGT A;  4A3E J;  1B9M A;  1ITY A;  3J81 K;  2R93 J;  3IWZ A;  1LEB A;  2MD0 A;  5KAF C;  3T5X A;  2PJR A;  2AO9 A;  4A0Z A;  4DJA A;  3O8G A;  1ON1 A;  2HOA A;  3SHF A;  4BQO A;  1SAN A;  4ENK A;  3WU2 C;  2L4M A;  3I9V 2;  3ZQ7 A;  2BGC A;  2EFQ A;  1BA5 A;  4JYK A;  4YFN F;  1O3T A;  2XGD A;  2L9R A;  4AIJ A;  1MJ9 A;  2ZNZ A;  3IH2 A;  1HKT A;  1ETX A;  3IUO A;  1D0X A;  5HDK A;  2XF7 A;  4PZJ A;  4BQA A;  2F5E A;  2HQR A;  4M3F A;  2CUJ A;  2OTJ I;  1IUY A;  2WAQ N;  2UV1 A;  3ZMD A;  1ZKG A;  3BC8 A;  3GXO A;  1FJL A;  4UB8 C;  3ZP5 A;  1HQC A;  4NHJ A;  4CIC A;  1K78 B;  3AL0 C;  1WQ2 A;  1S5L C;  4U0Y A;  2MD5 A;  3L09 A;  2VPL A;  2R7T A;  3K1M A;  5HS7 A;  2DXI A;  3LSR A;  3JTG A;  2G7H A;  1HW1 A;  1HW5 A;  2A5Y B;  1EF4 A;  5JLW A;  1L0O C;  1SMY F;  2EQR A;  1XTA A;  4RGR A;  1B8I B;  1NK2 P;  3ZR8 X;  4YIF A;  3LSK A;  1Y39 A;  1OKR A;  4IF4 A;  3OR1 C;  1IXC A;  1YS6 A;  1DU0 A;  2CS3 A;  2DN0 A;  1R9T J;  3T8T A;  4WXD A;  3K70 D;  4G7H F;  2QSH X;  1I6H J;  2CUF A;  2WAF A;  3ECH A;  3N05 A;  3BLY A;  2KIU A;  4F92 B;  3JRE A;  5M3M J;  4HW0 A;  3HOZ J;  4R79 A;  1FYL A;  4BJT A;  1Z7U A;  4XSX F;  1SAX A;  2ISZ A;  4YFK F;  5J4Y A;  1IGN A;  2VXZ A;  3QRF F;  1JT0 A;  1FOW A;  3L9F A;  2FF4 A;  2YUS A;  3GTJ J;  5BMZ A;  3GTL J;  3PL8 A;  2VC0 A;  2R3S A;  4KJZ A;  1HF0 A;  2GOX B;  2L5Q A;  3SQN A;  2MC4 A;  2R5Y A;  5E3L A;  4KNY A;  1T38 A;  1IRX A;  2H94 A;  2FQ3 A;  1JGS A;  3ABK H;  5EYR A;  1WSU A;  2ZME C;  1YG2 A;  1AKH B;  2EIJ H;  3EUH A;  5ICE A;  2O0Y A;  2ESN A;  2OC6 A;  4IKF A;  3BQY A;  4FET A;  1LVK A;  1GXP A;  4XIC A;  1QRY A;  4P96 A;  1NG7 A;  2DJI A;  3DPL C;  1YS7 A;  1LE8 A;  2O03 A;  2HR3 A;  3GFJ A;  4M6X A;  4OIO F;  2FEZ A;  5F0H A;  5K7F A;  1YI2 I;  3I5U A;  2IP2 A;  3B73 A;  4HOB A;  2HZT A;  5DCM A;  5JLX A;  3J81 Z;  1YFH A;  1ZTR A;  1HA8 A;  2ID3 A;  2KFD A;  1LFP A;  2HYF A;  3WTS C;  3BRO A;  3CCJ I;  1YW9 A;  4Z2Y A;  2KPM A;  1FOK A;  1FZP B;  1JKR C;  1IO2 A;  3GCM A;  4J00 A;  3FMS A;  2M7A A;  4QWQ A; 
#chains in the Genus database with same CATH homology
 4CCK A;  4HNT A;  1U0J A;  2BW3 B;  4Y3O A;  3DPT A;  2KQR A;  1WJB A;  1X4O A;  3A4C A;  4BL0 B;  2BVL A;  2KP6 A;  1WJC A;  3L2U A;  2CV1 A;  2VL8 A;  2CW8 A;  2KRH A;  4E7K A;  1Y6I A;  3KEY A;  1LKX A;  5FRO A;  4BS9 A;  3LMM A;  3DWL E;  3SZG A;  2IS1 A;  2LC2 A;  3DEE A;  2XAU A;  3H0D A;  2OV7 A;  4BXF A;  4DOZ A;  4FAS D;  2XDV A;  2P0W A;  1UG0 A;  2A6T A;  3CP8 A;  1QHH D;  3QYB A;  2WB1 A;  2VKD A;  2HDW A;  3AL0 B;  1DQU A;  4ZC3 A;  3EUA A;  2BVM A;  3L2R A;  1WJD A;  2NOJ B;  3M8J A;  1MMA A;  2JSP A;  3D5S C;  4XR6 A;  3S3M A;  1DGW Y;  2LBF A;  4PJL A;  2IS4 A;  2BOL A;  3H9J A;  4CH7 A;  3UR3 C;  2F5V A;  4XKC A;  4XKV A;  3OYH A;  4PSX A;  4D9J A;  3OYJ A;  3OYD A;  2AQE A;  2HQA A;  4U87 A;  4BE0 A;  1S9H A;  3LL7 A;  4QPO A;  2R7V A;  1VZ0 A;  5CQE A;  2W4S A;  4RM3 A;  3A2K A;  1GLN A;  3OS0 A;  1MMN A;  4LIT A;  3ZXS A;  4P5O A;  2Y0S A;  4CA0 A;  2VB6 A;  2MYS A;  4ZDL A;  4YEJ A;  3OYA A;  2VKH A;  2LRD A;  3HPH A;  4CSW A;  1MMG A;  3VYS B;  5KNL A;  3MMY B;  5KCM A;  2X6X A;  3FKJ A;  3K4N A;  2WAE A;  4YRV A;  1W36 C;  4BUP A;  2F4I A;  4PJN A;  3RTR A;  1X19 A;  4F55 A;  1UAA A;  3FBI B;  1P9Q C;  3AFH A;  4X0G A;  2R7U A;  4CZC A;  4DBQ A;  2BW3 A;  1PYV A;  3OYN A;  3S3N A;  3F9K A;  3RSN A;  2Q2E B;  3OL3 A;  3QOE A;  3HL2 A;  3OYF A;  2CV0 A;  2IS6 A;  4PFP A;  3BG7 A;  1G59 A;  2WAD A;  2VJ4 A;  4KIS A;  1BR4 A;  4OAY A;  4XLA A;  4AU7 A;  2LH9 A;  3SYT A;  2IXS A;  4HSR A;  4CCM A;  1WJE A;  2XF5 A;  1T0F C;  1QU3 A;  2L2O A;  3IAM 2;  4JQF A;  1ERD A;  2MFZ A;  1JI8 A;  4HST A;  4BEH B;  4HNU A;  3CP2 A;  4E7S A;  1ZEL A;  3MKZ A;  3ZQQ A;  2IGN A;  4XQF A;  4G6T B;  1TZL A;  4IZZ A;  4F91 B;  2FUG 2;  4N4N B;  5HNF A;  3H35 A;  2V4J C;  2ZSI B;  2VAS A;  2X1E A;  4E7H A;  1E0E A;  2K3P A;  4B47 A;  2X1C A;  4IQ4 A;  3CJR B;  4HEA 2;  5FRN A;  3HXL A;  3K4L A;  3ZGK A;  4XKW A;  2R7W A;  4QPQ A;  2X6W A;  3RCO A;  1MND A;  2CMP A;  4IQJ A;  2HVR A;  2L9S A;  4XM3 A;  3L2V A;  4BDZ A;  4XOR A;  4C2T A;  4MLO A;  3J7A Y;  4KT6 A;  2DT7 B;  3K10 A;  2VXD A;  3DTK A;  4J01 A;  2W1O A;  1OR7 C;  2E5N A;  4E7L A;  2ZXH A;  2LOO A;  4LIU A;  2K9L A;  4GRI A;  1YX5 A;  2CW7 A;  2DT6 A;  2X51 A;  3L2W A;  3UNG C;  2LRE A;  2LG4 A;  2VJI A;  3D5L A;  3OIQ A;  5CPR B;  4XLE A;  1Z7L A;  1Z3X A;  1BOB A;  1D1B A;  1WJA A;  3PUB A;  4E4H A;  1D1A A;  2VLA A;  1WFX A;  3L2Q A;  4PSW A;  3NWT A;  3BCB A;  3IP4 B;  3A1Y A;  2KHM A;  3H5R A;  3PFY A;  3PNT A;  4BQQ A;  4E7I A;  1R6R A;  4BE1 A;  1N77 A;  3K4B A;  4DBR A;  3VWB A;  3OYK A;  3H9G A;  3HUG B;  1X4P A;  1FMW A;  3OYI A;  3OYC A;  4B44 A;  2E5Z A;  2V9K A;  3GBG A;  2ZSH B;  3HKZ A;  3OYG A;  2DOA A;  3QYE A;  2LY1 A;  3OYM A;  4NQW B;  1G8X A;  2R7Q A;  5CQG A;  2LBF B;  4ANJ A;  2Z16 A;  3TL4 X;  3PNV A;  3OS1 A;  3H5N A;  3DQV C;  4RMN A;  4ZYA A;  4BAC A;  5HVQ C;  3AKZ A;  2X1D A;  4CCL A;  4AYB A;  3EPZ A;  2XF6 A;  4ZTJ A;  3PSI A;  4C9Y A;  5FRM A;  2JA2 A;  4F93 B;  2M7B A;  4XLF A;  2L7K A;  2R7S A;  1EA3 A;  4N4O B;  4C30 A;  4XMY A;  2PMZ A;  2DCE A;  3MKY B;  2CUZ A;  3OYL A;  2RRE A;  1X1A A;  1NG6 A;  1X1B A;  3VYU B;  2OUM A;  2XSJ C;  4XN0 A;  2ZXI A;  2VQL A;  4ITV A;  1PJR A;  3NWS A;  3W2A A;  2ELJ A;  2V7F A;  3S8P A;  2KL4 A;  3C2H A;  3TBI A;  3OWT A;  3EUK L;  4P1W A;  1K6Y A;  1D0Z A;  1TT0 A;  5HNH A;  3PNY A;  3QYF A;  3W2V A;  4DIQ A;  2WY7 Q;  2KZV A;  2KDO A;  5KHD A;  2ZFU A;  4Y33 A;  2WAQ A;  3CES A;  3OIP A;  3U21 A;  2R4G A;  3DKY A;  4PFO A;  3BG6 A;  3DKX A;  2HPM A;  4NUB A;  3VYR B;  3VSL A;  3OY9 A;  2IS2 A;  3HOS A;  2HVQ A;  2VQC A;  4HG2 A;  4F52 A;  3H9Q A;  4PJM A;  4CCN A;  4BJ6 C;  2QKM B;  2UWM A;  1Z3Y A;  2HPI A;  3KYL A;  1J09 A;  2I8D A;  3M1C A;  3SEQ A;  4HRI A;  1MNE A;  2AQF A;  2VQH A;  4XON A;  1DP3 A;  3VSK A;  1MW7 A;  4NC8 A;  4RM2 A;  4AVZ A;  1D1C A;  3K4M A;  3LSH A;  4XN3 A;  2W00 A;  3KX2 A;  4KIT B;  4EAT A;  2RNG A;  4LG3 A;  3K4C A;  1OLT A;  3LSM A;  4II2 A;  3E0J B;  4U7B A;  4II3 A;  3PSF A;  4BJ5 C;  5JHF A;  3K6G A;  2F6C A;  4YEL A;  1FMV A;  1T95 A;  2KRC A;  2Q1Z B;  3DTE A;  3LSI A;  2Z2S B;  1V5E A;  2W7N A;  1SFK A;  2JVG A;  3CJQ B;  4PK4 A;  3E1S A;  4RLQ A;  1V5G A;  2QKL B;  2IGK A;  4E7J A;  3OOU A;  4BEH A;  4CUG A;  4HPQ A;  5LD2 C;  2VJ5 A;  3MD2 A;  2M4G A;  2CV2 A;  2V6E A;  4DGW B;  1YX3 A;  2WBM A;  4XOT A;  2V26 A;  2XC7 A;  4D1Q A;  2R7O A;  3RQ4 A;  1QHG A;  1X1C A;  3ONQ A;  4ZJZ A;  1D0Y A;  3S32 A;  4OAZ A;  4ZTF A;  5TGT A;  4NC7 A;  4BQN A;  2MD0 A;  2HZD A;  3DPU A;  3SDB A;  2PJR A;  4OWR B;  2E1M C;  3BCA A;  4DJA A;  5HLT A;  2KLO A;  4XOP A;  4BQO A;  3V42 A;  3S3O A;  3I9V 2;  3CF2 A;  3SEZ A;  2M3A A;  4LIV A;  4XLH A;  3C2G A;  3OS2 A;  2IGM A;  1N75 A;  3G2B A;  3OYE A;  3MKW B;  2HNH A;  2RQQ A;  3IUO A;  1D0X A;  2XF7 A;  1BR2 A;  3K4K A;  3FBN B;  2E1M B;  2CFO A;  3DLA A;  2CUJ A;  3K70 C;  2UV1 A;  2IGO A;  2LY2 A;  3BC8 A;  2PJR B;  3HOT A;  2HVS A;  3HC7 A;  3K4J A;  3AL0 C;  3D5R C;  2VPL A;  2O5R A;  2X6Y A;  2R7T A;  2R7X A;  1UEL B;  2DXI A;  2UUZ A;  3DU5 A;  2A5W A;  4H4K C;  4XLC A;  3HG9 A;  4CCO A;  1AA7 A;  3OR2 C;  3LSG A;  3QOD A;  4RLF A;  4PUS A;  2R7R A;  3ZR8 X;  3LSK A;  2GOM A;  3IAS 2;  3OR1 C;  4E7Z A;  2Z1D A;  1WJ5 A;  3EUH C;  2CS3 A;  4B43 A;  2MAB A;  1N78 A;  3K70 D;  3CZ6 A;  2WAF A;  3N05 A;  3BLY A;  1Y56 A;  4F92 B;  4R79 A;  3OYB A;  4BE2 A;  4BJT A;  4XNF A;  1YE9 A;  3VDX A;  4B48 A;  4CCJ A;  2LYC A;  2WA0 A;  3ZRG A;  4IX7 A;  1Z21 A;  2K9M A;  2VXZ A;  3I3L A;  2KMU A;  3OMY A;  2HU9 A;  2W82 A;  2M4K A;  3DU6 A;  2CH0 A;  2K5C A;  2L9N A;  3PL8 A;  4Y4R A;  2WY8 Q;  1LDK B;  3VYT B;  4KJZ A;  2GOX B;  2L5Q A;  2MC4 A;  3W2W A;  3FDY A;  4BU2 A;  4F3Q A;  1IRX A;  1DGR M;  3OL4 A;  2JVH A;  3HPG A;  3RPU D;  4XKB A;  1SAU A;  4XL9 A;  1WJF A;  2OC6 A;  4JOM A;  3ZCO A;  1MMD A;  4IKF A;  3CMM A;  4FET A;  1LVK A;  3W3C A;  2V1N A;  5LFA A;  3DTI A;  2VQG A;  2JUG A;  1NG7 A;  2DJI A;  2E60 A;  3DPL C;  1W36 D;  3S93 A;  3TMO A;  2X85 A;  3FHN A;  3PJR A;  4E6K G;  3LFU A;  5HOO A;  1HA8 A;  1LFP A;  2M0M A;  2VJJ A;  1KON A;  4C2U A;  5CKT A;  4B3X A;  4ZDO A;  4BGD A;  2KPM A;  4PJJ A;  4BDY A;  4NNJ A;  4ZDP A;  1BR1 A;  4J00 A;  2M7A A;  2VIX A;  1V5F A;  1X1D A;  3H5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...