2KZVA

Solution nmr structure of cv_0373(175-257) protein from chromobacterium violaceum, northeast structural genomics consortium target cvr118a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MPHKEKHPLQDMFTSAIEAVARDSGWAELSAVGSYLAKNDPSFDPRNWGHGRLSQMVKKLDFLTVQESRNGSKLHSEIRLRHDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CV_0373(175-257) protein from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR118A.
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kzvA01
3RCOA 2KZVA 2LH9A 2LY1A 2KPMA 3S93A 2LY2A
chains in the Genus database with same CATH superfamily
2TCTA 3PQJA 1R4MB 1H89C 3GTMJ 2FNPA 2M0CA 4ITVA 2BW3B 2EK5A 2JRMA 3LA2A 4A5MA 4A3DJ 1R7JA 3H92A 1FPQA 4ZDOA 1BOBA 2EWNA 4E7KA 2GZWA 2L7FP 2DCEA 2VBWA 2XPWA 3FXRA 3LOCA 5EYRA 3J81K 5E3OA 1VZ0A 3G6EI 3GTLJ 4MTDA 3I71A 1A6QA 3TOBA 1EH6A 1H9GA 1JJ8C 3H5RA 3WODF 4HF1A 4UUVA 2CUJA 1WZ2A 3K2AA 2ZCWA 4GYIA 1MH4A 5JR3A 1DUXC 2ZFUA 1K6YA 4B48A 2E5NA 3HOWJ 4I02A 1KYWA 2LY2A 2EILH 4ZTJA 1VFCA 1TW3A 4BJ6C 1B9MA 4D1QA 2K9NA 1IRFA 4RDUA 2PQ8A 1POGA 3DBRB 4AD9A 4ENMA 5D8LB 3I4MJ 3NWSA 2Z33A 4PK4A 1EJ9A 4X6AJ 3WU2C 5D5WB 4ANJA 2K4BA 5D5UB 1S9HA 1WJDA 1A04A 1KU2A 4LLGF 1P2FA 2NVQJ 4XSXF 1EA3A 2A6TA 4OU0A 1G3TA 4BBRJ 3BJ6A 2WC2A 1GT0C 2RGVA 3HM5A 4WCGA 4FHTA 1USTA 5HS8A 2KLOA 3F6OA 1SD4A 1T8IA 5CVRA 1TNTA 1MBEA 1IN5A 3OL4A 4ZYHA 3CUOA 5CVUA 1OYIA 4RS8A 2R3SA 4HEA2 4U0VA 5GPAA 3HL2A 4ESFA 4HOBA 2PJPA 3ZMUA 2LVSA 4ENNA 1W5CC 2M30A 2R5YA 5F64A 3F0CA 4H0EA 3SFIA 5DD8A 2ZNZA 2IW5A 4M6XA 2DYRH 1B59A 3LSMA 2IVMA 5ILUA 1HDDC 4KDPA 4P5OA 3CF2A 3GUDA 2JRTA 5KAIC 3D1NI 3FF5A 2PJRB 3M9AA 1F43A 2R7QA 1AKHB 2EZHA 3M1EA 5L3FA 1QQIA 4R8HA 3CJTB 4XIDA 1MJAA 3PO2J 2XAUA 3I59A 1HCRA 4AIKA 5E1WA 1EV7A 5LHGA 3EPZA 2OPTA 4XMYA 2KHMA 3QOPA 5HLIA 2CW8A 5EG0A 2MC3A 4XOTA 4CYDA 2IP2A 4XLFA 3RYPA 5HNFA 1V5GA 4PJLA 2YSRA 3F21A 3KE2A 1YYVA 1KU7A 2JVGA 4MLOA 2Y30A 2AXTC 3LL7A 3HGYA 3VYSB 2CFOA 4I99C 2HR3A 1R5HA 1NHAA 1D0YA 1OR7A 5IT9K 1D5VA 1IV8A 4I7HA 1V54H 3TQNA 4A93J 4F7ZA 3KP5A 3S3MA 1MW7A 1Y8QB 2DT7B 2DJIA 4MIMA 3ZXSA 2NVYJ 3KIOA 1ZR2A 1JT6A 4M3BA 1JUSA 2F4IA 2BY1A 2KZGA 2M5WA 5ED4A 3DV8A 1Y8RB 5ICCA 4HZFA 1S8NA 5ERIA 2R5ZA 2OUMA 2F4OB 1W0TA 3ZCOA 3BR2A 1APLC 2JVHA 2BBYA 2ECCA 4ZH4F 3QU3A 2W48A 2HKXA 3GFMA 2LKXA 3HIFA 3FHZA 1BW6A 2AQFA 2AQEA 2JA5J 2LBFA 3CLOA 3G4SI 3QAHA 3OYAA 4RM2A 4S0HB 3HBLA 3G1MA 2K3FA 4HAMA 2PMZA 1OFCX 4RGUA 3QU6A 1YHQI 3PSIA 1PP8F 2DOAA 5LLQA 4CGZA 1XDUA 1QO0D 2F6CA 1QGPA 4LITA 3BR1A 3LAPA 3MQ0A 3BJOA 2F5EA 1XCBA 2D1VA 3W6KB 1U5TC 4OIOF 1X2NA 2KDZA 2F5DA 4BXUA 4BDYA 1S72I 3GTOJ 5CYVA 1TQMA 3QYEA 3HOYJ 1WRJA 3HOSA 3MKZA 2HQAA 2X51A 4Z2YA 2EZLA 2VQCA 4E7SA 2DQRA 2B7EA 2RN7A 4LJZF 1WPKA 2PX9A 1H9TA 1KQ9A 1GDTA 4L9TA 4G6TB 1FBUA 4JX5A 4RB1A 2XSDC 4IOCF 5F0HA 1X58A 2CS3A 2DMQA 5F08A 1LEAA 4E7HA 2WY7Q 2KRFA 3FHNA 3M8FA 4NUBA 2BHYA 4FQGA 3G2BA 3B6AA 1BBYA 1MMDA 2QZ8A 2ZJPF 2WB1A 3OOUA 2A5WA 2E1OA 3FKJA 1Z21A 1B8IB 1YJ9I 4A3EJ 1BL0A 3I64A 3DF8A 1T39A 1WGXA 3M1CA 4FE4A 1Z9CA 4DYQA 2JTVA 2LYCA 3JTHA 1DQUA 2AO9A 3DKWA 3IC7A 2BHZA 3S3OA 2MBFA 3FDYA 3RJPA 2VJ4A 2TDXA 3HXLA 3FBNB 4B8XA 2WAQA 2R7ZJ 2Y0MA 1D1BA 4IL6C 5K5QA 4IQ4A 2FUG2 2DK5A 4RGSA 3JCUC 1I50J 1MDMB 3K7AJ 1ETQA 3WHBA 3CCLI 4XKWA 4HLYA 3GYHX 2M1BA 2ZBKA 3EYYA 2ICWG 3P5JA 4CA0A 4CICA 5C4XJ 2VQLA 5IOYA 3ZQIA 4A3KJ 3A01B 5LGNA 1YE9A 2X1DA 5KHDA 1XSDA 1R36A 2JZYA 2DJNA 3ZMTA 1J5YA 1T98A 1BR2A 3A03A 1T33A 3FXMA 2UZKA 2JA8J 4JP0A 4HX4A 2OTJI 4RA2A 1OCRH 3ZQFA 1E17A 2CUZA 3KP7A 4KT6A 2RDPA 2EJRA 3TDZC 4P55A 4B47A 3NEUA 4U88A 4BE0A 2VT3A 1X3UA 1RRJA 4OAZA 4PJNA 1N77A 4XLEA 2QLZA 2JN6A 3KPHA 1AOYA 5HOOA 4EJTA 3I4NJ 2DTZA 2VKHA 2A05A 3UKGA 4PGHA 2DMNA 4B1RA 1K79A 2JT1A 3TW6A 1MSEC 1DU0A 3F3XA 4BU2A 4DBRA 4UUSA 4D0PA 3L09A 2COMA 2CGPA 2UXNA 1DGRM 1VQ4I 2DMPA 2XKOA 1IF1A 3BQYA 3CZ6A 3K4NA 1J2XA 1RR8C 3SEQA 3WU0A 4A5NA 2XAFA 5LEJA 2XGDA 4IKFA 3R61A 1MZBA 4XL9A 5BQTA 1VQ7I 3GTJJ 1USSA 2EINH 3K1NA 1FX7A 5E1XA 3VFZA 2VJIA 5E8IA 1IV6A 1TQPA 1XX5A 1YITI 2E1MB 1FYKA 3QQAA 3JSOA 3S2WA 4BQOA 1K61A 4HX7A 1FTZA 5ICFA 3S16J 2V1NA 2IEKA 2LD5A 2PG4A 2EFPA 1B1BA 4QPOA 3BWGA 2V4JC 3LSIA 4Q5SF 3QYBA 4ZZLA 2QBYB 1U78A 2IJLA 2VKEA 1YW9A 1BIAA 3O8HA 5CLSA 3MMYB 4M9XA 3ZP5A 1YTYA 1MNMC 1TT5B 2P5KA 4Y15A 2ZMEB 4A3MJ 1O3TA 1D8KA 1U5TA 2F5CA 3KYCB 4ON0A 2WWYA 1ZQ3P 3H3UA 2BVMA 3E7LA 4AVPA 1HC8A 3CDHA 2AS5F 4S05A 1OCTC 1D1AA 1XN7A 1VQNI 5CPRB 1S6LA 3JRFA 1DGWY 3D5LA 3P9KA 2UXXA 4ETSA 3HB9A 1YG2A 3MZYA 5DEQA 4H4KC 3MCZA 2EPFA 3HJEA 2IGKA 1IXCA 2V7FA 3AG2H 2N8GA 3TOAA 3OYFA 2QYOA 2PN6A 3BR6A 1TNSA 4KJZA 1O3RA 4YFNF 4MHGA 2XSJC 1BM9A 1Y56A 1LFBA 1MD0A 1XMKA 4BE2A 1ETKA 3ZRGA 1X1DA 1JKOC 1RNLA 2MD0A 4NDLA 1ULYA 4A3CJ 1SANA 2XUBA 1VNDA 2B0LA 2HYFA 5K5RA 4MO7A 4LG0A 1TWAJ 4NBQA 1ZR4A 2IGNA 1GLNA 3BTIA 1EKEA 1JTYA 4WF2A 2HPIA 2BV6A 4PSXA 4YIRX 2V9KA 2O61A 3VYTB 3D5RC 3AKZA 4OOIA 3H36A 3ABLH 2ZXHA 2E71A 2IS2A 4N0BA 4HYEA 5LBQA 3D5SC 1TTYA 4AIJA 2DFIA 4HV6A 2HVRA 1Q1VA 3NWTA 2F48A 3JRBA 1ZG3A 2GA1A 2P6SA 1WJBA 3J81Z 1HW5A 2WTEA 3ISPA 4L0ZB 2QGUA 3FWEA 1QZYA 3CJRB 3K4CA 2WBMA 4IHVA 1T0FC 1WJAA 2LF7A 2QSFX 3HOXJ 1P7IA 1KONA 4QLCU 4MFDA 2XAQA 2G7HA 3FZVA 2EB7A 1MNEA 2RNGA 3P9IA 3OYIA 2ESHA 4A6EA 2QQ9A 4LFUA 5E3NA 3CMYA 2OJED 3AL0C 3OR2C 2FQ3A 3AG4H 1PUFA 2NVXJ 4KUMA 4EJUA 3GBGA 4KMUX 4EM1A 4ZYGA 3LSKA 2CG4A 3KP2A 3SQNA 4WWCA 1OLTA 3U1KA 2XRNA 4LIUA 4UNOA 2DPUA 3KYDB 2E1CA 2W1OA 4KYWA 2VODA 2QEXI 4IQJA 4C2UA 1BN5A 2DTRA 4M3DA 3C7JA 1E3HA 3K4KA 2E34A 2OU2A 4LLLA 3HOUJ 4CUGA 3OIPA 2DFEA 3LSTA 1OCCH 3BTLA 2E1NA 1U2WA 3K2ZA 2KPMA 1LE8A 3ABMH 3ZMVA 4R79A 5A2QZ 1VQ8I 1WWXA 1V55H 2VC0A 3SZGA 1J9IA 2BY0A 2LOOA 3IWFA 2QSHX 5FGMA 3GMEA 2IA2A 2JMWA 4F93B 2HWVA 1YW7A 4QPQA 2H6BA 5FD6A 5E79C 4HNVA 4XSZF 1XCVA 2ISYA 4CCOA 2WY8Q 3BPVA 1PP7U 3BR0A 1I27A 1R6RA 4Q4ZF 1L0OC 1ZELA 2HNHA 4D7MA 4AVZA 1OJLA 1ON1A 2R5YB 3BC8A 1UAAA 3ZQ7A 2CUFA 2FU4A 3E3VA 3C2BA 2P4WA 2RC4A 4U7DA 1BR4A 2K7LA 1T95A 3JAMZ 3JRAA 2LDUA 3I53A 5CJ9A 3QP5A 5BNGA 3DU5A 3OYBA 4K2EA 5E3LA 2P7VB 1IDZA 1WJEA 2WAQN 4OMYA 2LH9A 3RZDJ 1GV2A 1U9NA 3IWZA 4LMYA 2DYSH 3R0AA 2ESNA 1Z91A 3I59B 5HS9A 5FB2A 2E36A 2XDVA 3V42A 2V1DA 3CC2I 1BW5A 2Y2ZA 1UG0A 3EUHC 3GF2A 3C3WA 5CVIA 3VWBA 2EIJH 1O57A 2E2HJ 3CF5F 5EG0B 4M3EA 4XKVA 3T5XA 1E0EA 3H0GJ 2X6OA 3R60A 3MWMA 2XF6A 2VBYA 4M72A 4HSTA 1FZPB 3L2UA 2VJJA 1S7OA 3DPUA 1WSUA 2DPDA 4XLNF 5K7HA 3J7AY 2L5QA 3BG9A 5IT9Z 2ZC2A 5E8GA 1ODDA 3F72A 5J3LA 4NC8A 5EZGA 3OL3A 4HNTA 3K9TA 3WTXC 4XLHA 1YX5A 4J00A 4W1UA 4V19K 2HGCA 2XC7A 4M9SA 3M07A 3CUQC 1VQOI 3B02A 1YW8A 3BTCA 3V7SA 5M5XJ 3JSPA 1GXQA 4XOPA 2DK8A 4IZZA 3GTKJ 2VJ5A 4RGXA 5E3MA 4UUTA 4DZJA 1I3AA 3PFIA 2UUZA 2MA3A 3VSLA 2IPQX 4E7JA 2X1CA 2JPBA 3FXKA 4FISA 2ZXJA 5GAHJ 3VYUB 3K4BA 2R7TA 2NOJB 4BHPA 2OV7A 2KL4A 2P81A 3ONQA 4A6DA 2R5ZB 4B4CA 1D3YA 5J47A 2OBPA 2GQQA 1D1CA 4EEFG 4V2GA 3E6BA 3K0LA 3LSPA 1XGNA 1NH3A 4YG2F 3WGIA 3T8TA 5D5VB 3J7AO 2MLGA 3U21A 4YFXF 1G6NA 3OS0A 4BJTA 1R9TJ 4OIPF 3H3ZA 3F8FA 3OIQA 4M6VA 2LBFB 1FYLA 5IT3A 2D2WA 1KQ0A 1Z6TA 2EIKH 4LG3A 1CGPA 2JA6J 3H5NA 3MZ8A 3SFZA 4O6JA 3MKWB 4RLFA 3F23A 1HF0A 2M8EA 3HEFA 1DP7P 3L2WA 2FOWA 4RB2C 5D4RA 1A36A 4M6YA 1F1ZA 4XRSA 2VOOA 1TZLA 4BBSJ 2Z1DA 3FMSA 1T0FA 3I54A 2Y9ZA 4I01A 1RKTA 1LNWA 4C9YA 4FASD 1JKPC 2DLLA 2BXYA 2P6TA 3FM3A 1OQYA 4G6QA 1LDKB 2E35A 1VQ5I 4ZDLA 1YIOA 2QWWA 4L9JA 2KT0A 1XB4A 1ON2A 3L2CA 1VQ6I 4A3JJ 3CDIA 1R1VA 5DUIA 2NNNA 1KU9A 2L7KA 3KEYA 2L9VA 2W00A 4RM3A 1QVUA 1Z6RA 2DBBA 2GOMA 2D5VA 5M3FJ 1YOVB 1ZG5A 2K85A 5FLXK 4RB3C 1IXSB 3CO7C 4G12A 4BYYA 1R58A 2FX0A 1RI7A 1F4KA 2STWA 2QQ8A 1H0MA 2DA1A 1UB9A 1IC8A 3BZKA 3KP4A 2QQBA 2VBZA 4EM0B 2HXOA 5FD5A 3K69A 4JX6A 2A69F 2X85A 1VQMI 1RUOA 3G1LA 5E20A 4DQ2A 2R0QC 2CJJA 2DDAA 3RQ4A 3ZPLA 2H1LA 3AFHA 4BY7J 2I8DA 1DP3A 4IRGA 3I56I 3IRRA 4HF0A 1VTNC 1IDYA 3U9GA 2PI0A 1ZHFA 1F5TA 3JR9A 5DYMA 2DOFA 1OKRA 1P6RA 2BY3A 1MBJA 3S14J 1PDNC 3U2RA 5GADJ 4EGZA 4ASNA 4HNUA 1AU7A 3L2RA 5FO5A 4EATA 4P1WA 1FSHA 1P4WA 2VXZA 2XGCA 2OCEA 4P96A 4XBFA 3CCJI 2CMPA 2JUGA 1OPCA 2DW4A 1SMTA 2HDDA 2WV1A 1M1EB 3ESWB 1V3FA 2L9RA 2L02A 2WAFA 2M4KA 1MBHA 1X1BA 3EUHA 4PUSA 1V5EA 4KNYA 5H6RA 2Q1ZB 4Q47A 2M7BA 2CH0A 2CU7A 2K4JA 2OZUA 3TDUC 4Z6YA 4CXFA 3VYRB 5D8KB 3FMQA 4HQEA 2ZB9A 1E2XA 2A6EF 4O3MA 4UXNA 4RAZA 1TQIA 5IYDJ 1JI8A 3BPXA 5GP9A 5KVRA 1WQ2A 4DZPA 4M3GA 1JTXA 2O5RA 3Q0VA 3S93A 3ZMDA 5JVGF 4YIFA 3LAJA 2XKPA 3ROUA 2R7XA 4PJMA 1I1SA 5EEHA 4IO9F 1FLIA 4HSRA 1LJ9A 3CUQA 4UUSB 5BPIA 1OYYA 1QHGA 2AHQA 3CCRI 1X1PA 2WV0A 5LD2C 3CMAI 2O6GE 1SFKA 1FWZA 3GX4X 2HZTA 1UHMA 4F3QA 2DT5A 3OV8A 3H9JA 4XLCA 2DA3A 3ULQB 2R7UA 1MH3A 2Z99A 4BACA 2DA6A 3HUGA 2M34A 4EVIA 2KIUA 2H09A 4RLQA 2DU9A 3CC7I 4E6KG 1P4AA 5FLVA 3RTRA 4BL0B 2VBXA 3DP7A 4XN3A 4YRVA 3BG3A 2VIXA 3WGGA 2X4HA 5FFZA 2QSGX 2LY1A 3C2GA 4BHCA 3L2QA 3OY9A 1S5LC 2P5LC 2HKOA 2CO5A 2L4AA 4IVNA 3RZOJ 3I3LA 3RQIA 4XLPF 1YIJI 1JUMA 3E97A 1SFEA 1XGOA 5F0FA 3HTSB 3GFJA 1IUYA 3SZTA 4AUXA 2X0LA 1A31A 3CCQI 5D6EA 2JSCA 3GFIA 2VQGA 2WAEA 4CCMA 3ZQCA 1U5TB 2XB5A 1XSXA 4ZYDA 5K7ZA 4M9ZA 3V8JA 2X9DA 5JHFA 1X3WB 2M87A 1IZ1A 3DEWA 3E6DA 1YX3A 3MKYB 4WXCA 3OYJA 4G7HF 3DKXA 2B63J 4PGGA 2XROA 1UG2A 2NS0A 4AYBN 5F1JA 2XAJA 2ECBA 1MKMA 2HQ5A 1J0RA 4N9HA 3E5XA 1ONVA 3PL8A 4KN7X 3PIPF 3DU6A 2X1EA 3C18A 1P92A 3REOA 4KFCA 5JI6A 3CJNA 4LGWA 2QVOA 4G9YA 1B9NA 3V7CA 1TP4A 1JKRC 5KCMA 1JGGA 5DV5A 1I6HJ 5HS7A 3CESA 3UR3C 2FF4A 1LPQA 4IHYA 4N4NB 4CZZA 4J01A 4X0GA 4UB6C 3LSGA 3F8NA 3L7WA 2EIMH 4FX4A 1FIPA 3RCOA 2OD5A 1W7PA 3GW2A 4LG0B 2LNBA 4N4OB 2HEOA 6PAXA 2ME6A 1ZRFA 2NS7A 2MSYA 4LB5A 3FBIB 5KK1A 4M3FA 2Q2EA 1UHWA 3E6MA 3E0JB 2DA5A 3ZR8X 4G7ZF 3KEQA 5FKOA 4MEXF 2NS8A 2FMLA 3GWZA 1QNTA 2PLYA 1TWHJ 2VONA 3SXYA 4QWQA 4ZC3A 3WTVC 2DAOA 2VPLA 1MMSA 2W7NA 4PJJA 4YIIA 3U1DA 1IG7A 4FE7A 3HDDA 2KMUA 1FP1D 2XPUA 1VI0A 1SAXA 2CSOA 3DTKA 4BQNA 2FE3A 5EEAA 1I39A 1O4XA 5J8FA 2KKOA 1P4XA 1HKSA 4KISA 3JREA 1A5JA 4IRIA 5C4JJ 3OYEA 5CVJA 5FKKA 1TWGJ 2ID6A 1PUFB 2HOSA 3PNVA 2MLKA 4DJAA 1Y1VJ 2H27A 4TV7A 4IEJA 2GLOA 1Z3XA 1JJ6C 3I9V2 3OYGA 3E5UA 2HYJA 3O2PE 3BR3A 1ETYA 4L9NA 2I10A 2RQQA 3NQOA 4Y3OA 3ZQQA 3DKYA 3I5UA 1K78A 2O7OA 4IHWA 5FRMA 3MN2A 3RDIA 4KIBA 3MEXA 1LQ1A 2BYVE 1IN4A 2ID3A 2J5PA 4A3BJ 3F6VA 2H8WA 1SD6A 3J80K 3RKXA 1TC3C 2VOPA 3LQQA 3EUKL 3CCUI 1LE8B 3JW4A 4XONA 5DM7F 1FYMA 1LVKA 2L3DA 3ECHA 2A6HF 3WTUC 3S1MJ 1R1TA 2JK3A 3FK6A 3OR1C 5GTHC 4GCVA 1XMAA 4BH9A 1U0JA 5J8CA 3BZ6A 3NAUA 1HSJA 2M0MA 3Q5FA 3LSJA 2ELKA 4ZTFA 2QKLB 9ANTA 1K4SA 3HSRA 4RMNA 2C6YA 1IW7F 2E60A 4OIRF 2K9QA 1S3JA 4CCJA 3K1PA 2JSPA 2A68F 3JTGA 2GWRA 3FISA 2L01A 4ZYEA 4E7LA 5EJCA 2DA2A 2GIZA 3SHFA 3DLLF 3ABUA 5M3MJ 2X48A 1OYWA 1P7JA 3DCFA 3HHHA 1BR1A 2M7AA 3TW7A 1YJNI 3QYFA 1GHCA 1TWFJ 3ZQHA 3MAJA 4BNCA 4XNFA 4A0YA 3DEEA 3WE2A 1QPIA 5DD4A 2GOXB 3H35A 1Z05A 3ZQLA 3BLYA 4BAYA 2GXGA 2EQRA 2KISA 1K6OA 1V4RA 2R7FA 2OTLI 1R00A 2LP0A 4HG2A 1I6XA 2VN2A 5K5OA 3QODA 2HFHA 1HW1A 5L3BA 4OWRB 3ZGKA 4MFEA 3HOTA 4JYKA 2W25A 2LFBA 2F5VA 4ZZDA 3S17J 3CCMI 3IHUA 2ME0A 1MIJA 2VUMJ 1S7EA 3HPGA 4WK8F 2ELHA 3BCBA 1W36C 3RI4A 3GZ6A 3PJRA 2NNYA 3LFKA 2R93J 1X19A 5L3CA 2HTJA 3SDBA 1SFUA 3S32A 1ETOA 3V7RA 4F55A 1Z7UA 4S04A 2CW7A 1WJ5A 1R49A 3EUAA 3HOZJ 2ELJA 1D8JA 1T56A 2PEXA 1NTCA 4CO8A 1PVEA 3T0YA 2BVLA 4XRMA 2RV8A 1ZRDA 3ZQGA 4WXDA 3WU1B 1X1CA 4XR6A 3DTEA 3EDPA 5HODA 3Q3SA 5KNLA 1A6IA 2VI6A 4XRFA 5AIQA 5HLTA 2K86A 2VE9A 2B9SA 1IO2A 1T08B 2PMUA 4RAFA 2H1KA 2HQRA 3M7GA 3IKTA 3LWFA 3CO6C 3GO5A 2EFQA 1K83J 1F9NA 3IRQA 1RC9A 1JUPA 4MNUA 4O5VA 3M8JA 2DFHA 1B72A 2UWMA 2Q8KA 2LKPA 4J19A 4BXXJ 3QPTA 3FMRA 3GFLA 4BEHA 4KITB 1TBXA 3CMMA 5B1AH 2BOLA 1MBGA 1SMYF 2CWEA 1HBXG 3DFGA 2LF8A 4KIGA 4KA4A 2IXSA 2RREA 1ENHA 1E3OC 5EGOA 3S2HJ 3TKYA 3RSNA 4MEYF 1IGNA 3MZHA 1WCMJ 1CQTA 2ISZA 2HXIA 2EA4A 4G6DA 3Q9VA 1ZG1A 5B5EC 4M74A 1FC3A 4CDGA 1OCZH 4IJAA 4BJ5C 2JWTA 4D9JA 3NARA 3OYKA 1IN6A 2DFFA 5H2FC 5J1UA 2P8TA 1RKWA 1ERDA 2VPRA 3O6BB 3PQKA 5DS9A 1PUEE 5IP7J 4Y33A 2KDOA 1VF9A 3F8BA 2HS5A 3W6JB 1FMVA 2R92J 2KZVA 1OISA 3P7NA 5TISC 1G3YA 4I76A 3DLAA 3ZN1A 5IPAA 4NHJA 5E1ZB 3AL0B 2OQRA 1ZYRF 2L9SA 3RPQA 5FLXZ 2MC4A 4XQFA 1A35A 3SEZA 2NRAC 5GAEJ 2A5YB 5K7FA 3B73A 4NC7A 3OS2A 3KLOA 3OS1A 5D4SA 2MW8A 2ADUA 1FOKA 3D0SA 5EEGA 4JK1X 4WXHA 2QA4I 5CKTA 5DTDA 3DPTA 1BA5A 4AU7A 3TMOA 3CP8A 1XDSA 3KX2A 4NQWA 2F5FA 2JJ7A 2O03A 1WI9A 2MH2A 1R71A 1LUJB 2DA7A 4AWXB 2D45A 3I4PA 3VPRA 4CZCA 1DDNA 5DM6F 1N78A 2ZJRF 1UZCA 1FIAA 4NB5A 1IJWC 1RETA 2LC2A 4C3JJ 4C30A 4HDVA 3GTQJ 3BG6A 3L9FA 3G71I 3KCCA 3H5AA 5J1YA 3JRDA 4IPAA 1ZAOA 3I55I 2XV4S 1FP2A 3OYNA 3MFKA 1X2MA 4HX8A 4KN4X 2XASA 3LFUA 3WG7H 1I5ZA 4UHTA 2IS4A 2K9LA 4CYCA 1KYZA 4ESJA 2KIFA 4AYBA 1W1WE 1SD7A 2OCCH 2ZXWH 3PM1A 1F36A 1FT9A 4BE1A 3BG5A 3DWLE 3K4MA 3V4GA 1MSFC 4R1HA 4DBQA 1YS6A 3BP8A 3L00A 4MGRA 1UCRA 2GBYA 2QENA 4IF4A 4Y17A 3HRUA 3S1QJ 4A69C 1HXDA 3TP3A 5LEKA 1MGTA 1SVOA 1TW2A 3E5QA 1XS9A 4D5FA 3DQVC 4HPQA 3A2KA 1UHSA 3TEDA 5EDNA 3DBLB 3F8MA 1B6AA 2WA0A 3GZ5A 5TJJA 1U9OA 4B3AA 2W84A 1LKXA 5DCMA 4C3IJ 3ZOBA 4IOAF 4FCYA 2DXIA 4EJOA 4HW0A 2FNAA 3O8GA 3H3VK 3S1RJ 3CCEI 1Z7LA 3ERMA 3WTWC 2EV0A 4L5EA 5DDGA 2NXNB 2OZ6A 1ZGAA 3CUQB 3JRHA 1RZ4A 4PSWA 2OC6A 4G8XA 3WGHA 1MJBA 4BY1J 5B66C 2Z16A 5L3DA 1D0XA 4D5CA 4LD5A 2X6WA 2CV1A 2V79A 2JUCA 2L7MP 1VQLI 3LQRA 3HUGB 1UFMA 2Y48A 5F27A 3VB2A 2FBHA 4NC6A 2DODA 1FBSA 2BXZA 2IA1A 3GXOA 5FRNA 3V8LA 4ZJZA 2Y9YA 4B43A 1QHHD 1CF7A 4OAYA 1RUNA 5HDNA 1VQ9I 2VE8A 4L0YB 1STZA 2VT2A 5F6FA 4RAYA 4P9UA 2VKVA 3GTPJ 1R5GA 1LVAA 4JX4A 3UNGC 2J5OA 4Y4RA 1FOYA 4XM3A 1UMQA 2Z3YA 2M45A 1VQPI 1YRNA 2EV5A 2K9SA 3PNTA 2R7WA 2E2JJ 1KGSA 5LFAA 2GM4A 4DOZA 3HOVJ 1XPXA 1FBQA 2P0WA 4UV9A 4A3LJ 1TWCJ 3OMYA 1H88C 3IH3A 2KQRA 5BOXA 2L0KA 2LK2A 1N75A 1IXRC 1V5FA 3HKZA 1QZZA 2M3AA 3H9GA 2E5ZA 3IKVA 4FT8A 4XN0A 2HPMA 1ZREA 5GTIC 1W4MA 2VC1A 2A3SA 4UVAA 3TO6A 2FMYA 3QPLA 2ZJQF 1Y6IA 5J4YA 3OYLA 5BPDA 4CCNA 1BI0A 3RPUA 3OSFA 2QKMB 3QP6A 4CCKA 1LB2A 5GAGJ 2KP6A 3TO7A 3JRCA 3HSFA 5F04A 1X1AA 4XORA 5HNHA 4IXAA 3FXOA 3TP0A 3DPLC 4KIFA 4B3XA 3FXUA 3J7ZI 2FBIA 1R4NB 1WH7A 5LGUA 4RGRA 3KZZA 1R22A 2FQ4A 2IA0A 3J7YJ 2XVCA 2A61A 5C44J 5JFRA 3HSEA 3I0TA 5F0CA 3CLQA 1RPWA 2F2EA 4LK1F 4RBOA 1RESA 4UV8A 3Q9SA 3ZMZA 3QRFF 3P9CA 4GO1A 1JT0A 3G73A 2NYXA 2K9MA 2BEOA 4LK0F 2M8GX 2K27A 1KZHA 3K70C 4KICA 2CV2A 2EH3A 4N9IA 3ABKH 1FSEA 2OQGA 1QA6A 2W85A 1W7PB 2XPVA 3QPHA 2Y0SN 1XGSA 2GAUA 4NNJA 5FLMJ 3BY6A 2FRHA 3GVAA 4A3FJ 4I09A 2Q2EB 3WE3A 5A2QK 2V26A 2FOKA 2O8XA 5GPCA 3F9KA 3M8EA 3KP6A 3ML6A 1Y39A 4HDUA 1FEXA 1O3SA 2M9HA 2CFXA 3FKIJ 5H20A 1MBKA 4C2MJ 1PYVA 4FETA 2W57A 1GVJA 5J6XA 2NVUB 2DT6A 2IBDA 3OIOA 1EH7A 2LSOA 4EJVA 4GFBA 2CQQA 3T8RA 2D1HA 4YELA 3EQLF 2V6CA 3G1OA 4W97A 2KIMA 2QUFA 3JAMK 2EA2A 2EFWA 3PNYA 1Z77A 2O3FA 3E6CC 1G59A 2R7DA 3PUBA 3N05A 3DTIA 1U8BA 2KJBA 2RKHA 2KRCA 2DI3A 1LDDA 2UV1A 4UVBA 3PO3J 1NG6A 4MTEA 1MNDA 1HW2A 4II3A 2DN0A 2MD5A 2ZSIB 2YU9J 2DO7A 3W2VA 2PBIA 1JXSA 2LY9A 4EV0A 1XG1A 3J80Z 4AIHA 2VKDA 1WFXA 2LKSA 1XSVA 3CCVI 1QZEA 2PMHA 3BG7A 1K78B 2G0EA 1OMIA 4PZJA 3RKYA 4CCLA 4C2TA 4HF2A 3KZIC 5ICEA 2RQPA 2E19A 5IP9J 3N97A 3OYHA 1XC5A 2CUEA 5F1RA 4AM3A 4E70A 3VOEA 2VL8A 1HQCA 2QCOA 1X4OA 2M2EA 1X4PA 5B1BH 4B44A 2H8RA 2STTA 2TRTA 4I2OA 2EZKA 1DU6A 1R1UA 2ZJ2A 3HYIA 3GCMA 2HDWA 2R4GA 3KEOA 1HDPA 4BUPA 1S29A 1QU3A 3IAS2 1Y0NA 1HOMA 1UELB 1T38A 1AWCA 1NK3P 3C1DA 1KQ8A 2O9LA 3IP4B 1JGSA 4MQVA 3CCSI 1YQAA 2EZIA 4D7NA 2ACJA 1L3LA 2ZFWA 3AG1H 2CQKA 4G94A 1VQKI 1IRXA 2I5UA 2OF7A 2KIQA 1YFHA 1GXPA 5DCFA 3TO9A 1HLVA 2KJCA 4HA8A 1REPC 3T1BA 2MABA 1IAWA 2IRFG 3Q0UA 3VODA 1YO5C 5LRSA 2BW3A 4HRIA 4IHSA 2NOGA 2LRDA 2XGXA 2H6CA 2IAIA 4ENJA 4F52A 1W5SA 2IGOA 1Y1WJ 3HRTA 3HHGA 1W0UA 4KT5C 3IAM2 3M4OJ 2XRLA 3H1CA 4BGDA 3K4LA 1K7AA 3OYCA 2GXAA 1YLFA 3BQZA 5TGTA 1ZK8A 4E4HA 3LA7A 4EMSA 1Q1HA 2DDBA 1JE8A 3ABTA 1IN8A 1E3PA 2G7UA 1S7AA 4A2UA 2MH9A 2HVQA 4XICA 4CHUA 2BZTA 4BKXA 4EQQA 3QPSA 4Q48A 1HKQA 1BI1A 2XGEA 1SD5A 2YU3A 3SDGA 2YX4A 1BJZA 4AIDA 2NVTJ 4KMFA 3V8KA 3LSRA 4U0YA 2V6EA 4BQAA 2RNJA 4L9VA 2R7VA 1WI3A 2AXLA 1BC8C 1GUUA 4DYCA 1JHHA 4ESBA 4P9FA 4U7BA 5HVQC 2KFDA 2R7SA 1GVDA 3CCYA 3VSKA 3OYMA 3HC7A 1R5ID 1BJAA 1FMWA 3L2VA 1QPMA 5EZHA 1XD7A 4PJ0C 2CW0F 4M73A 1I1GA 3DEUA 3BDDA 3WHCA 3RKQA 1W36D 1WKMA 2V9PA 4HLXA 2IT0A 4OIQF 1B72B 1RR7A 3NRVA 3S2DJ 2ZO4A 3ASNH 4LIVA 4BEHB 1SVLA 3BZCA 4XRSG 3CJQB 4XKBA 2BE5F 4QTRA 3K1MA 1IUFA 5EGOB 2P7CB 1QRYA 1YJWI 2MFZA 3AG3H 5L3EA 2PJRA 2OAZA 1JKQC 1AKHA 4XKCA 2EFNA 3CMEI 4ABZA 2W24A 4A12A 1R23A 5FFXA 5DUKA 3BCAA 5HDGA 4QIWN 4DYRA 3PIOF 1J59A 3KFWX 3H0DA 1G2HA 1SAUA 4PFPA 3M3YJ 3S15J 1ZLJA 5AONA 5KAFC 1SC7A 2K02A 4I0BA 2XAHA 3W2WA 5E17F 3FX3A 5FKLA 1BI3A 3ECOA 4B09A 2MGQA 2K3PA 3CD6I 4GGGA 5IYBJ 5IY5H 3FXLA 4A3GJ 2YPRA 1O7FA 3HKZN 2XF7A 5FKNA 1PJRA 3BTJA 2V1XA 4UY8I 1ITYA 1N25A 2YR2A 3BT9A 3CQZJ 1WHUA 4A3IJ 1YI2I 5CQGA 3MKLA 4CSWA 3R6SA 2E7XA 1SFXA 4XLAA 3RPUD 2RAEA 5EF6A 2M4GA 1ZTRA 2Z2SB 3A4CA 2MG4A 3IH4A 3QOEA 2L9NA 1ZARA 2YS9A 3FXJA 4NQWB 1K4TA 2X6YA 3A02A 4GRIA 1Z1DA 1XMXA 4A0ZA 3DXJF 5M5WJ 2E1MC 1MBFA 3BROA 3KETA 4L5JA 3N4MA 2FA5A 1LFPA 2E7WA 1TT0A 5JVTA 4BS9A 5FKMA 3LA3A 2JQ7A 3KYLA 5D5XB 4UB8C 1WH5A 4M71A 3S8PA 1WJCA 3WG9A 3ELKA 1ETVA 2CQXA 3C2HA 4IHTA 3K6GA 1J75A 3FXQA 5TRDA 2VASA 4PFOA 5BMZA 3TBIA 2GA2A 2QM3A 3FM5A 3CDLA 2CRGA 2Z5UA 3G3ZA 4OMZA 2L54A 1ZKGA 1U6GA 1P9QC 4CYCB 3JRIA 4FTHA 4EJWA 2HU9A 2ZMEC 1JHFA 1QBJA 2IGMA 2Y75A 4MQ9F 4RB0A 2COBA 4L18B 4DNCA 2ETHA 2L4MA 4HBLA 2F4MB 3ERED 2JA7J 1HA8A 5FJ8J 1T6SA 1DPUA 4XK4A 4DGWB 5ICGA 4E7IA 2LMDA 4BHBA 1Z67A 3Q0WA 4DIQA 2Z9OA 2HOAA 3SYTA 3IL2A 3HTUA 3ZN0A 2FBKA 2CQNA 4IRHA 1ZRCA 2HOEA 5BS6A 3HZJA 1SFOJ 5DCMB 2Y0SA 1OCPA 4E7ZA 2HDCA 4V2FA 1BI2A 3RIRA 3CP2A 4FX0A 1Z3YA 1UJ8A 1ZH5A 2K5CA 5JHUA 1DPRA 5L3GA 5CQEA 2VLAA 2HTSA 3OOPA 4DW6A 1B8IA 1FOXA 5H6QA 1ZGJA 4IX7A 1RIOH 5ILSA 1D0ZA 2VQHA 4AC0A 5D6FA 3WTZA 4YEJA 4I98B 3GZNB 3K10A 1LFUP 1I3QJ 2XF5A 2GIVA 1FJLA 3HRMA 1Y0UA 2FSWA 3W2AA 2BGCA 2OA4A 2LREA 1TL8A 1CF7B 3R4KA 1IRGA 3WTSC 1WVRA 4BXFA 4ZYAA 1MDMA 1NK2P 2CYYA 1G8XA 2W82A 2HYGD 2IS6A 1G3WA 4GXOA 2Y31A 1YRNB 3PFYA 3RYRA 5LHIA 4II2A 3GTGJ 3KZYA 4Y52J 4EM2A 3FK7A 4JOMA 4X1EA 1GV5A 3A0HC 3O3KA 4EGYA 3A01A 2EBIA 3S3NA 2XIGA 2A07F 2O0YA 3F22A 4UVCA 1J09A 1O7LA 3MVPA 3X2QH 1FTTA 4PDKA 1G4DA 1O3QA 2FD5A 1SVMA 3A1YA 1OCOH 5ILVA 3TL4X 2Y69H 4WX9A 3COAC 1B4AA 2V1UA 3ZMSA 4ZDPA 2DA4A 2PMZN 2RVCA 3DBHB 3JRGA 2JPCA 5E18F 5CVVA 1ORKA 3ASOH 2G9WA 2L7ZA 4Y7NJ 2FXAA 2IS1A 5B3SH 4G7OF 1BOAA 2GXBA 3HGGA 4CH7A 3L1PA 1IRZA 1EH8A 3TGNA 4GDFA 2ZXIA 2E2IJ 2NAZA 4GYGA 5LRRA 2XB0X 2YUSA 3LSHA 2XAGA 2DMUA 3WTTC 3OWTA 2R7RA 3BJAA 1D5YA 3QWLA 5LHHA 3W3CA 4JQFA 1BIBA 3H9QA 3K4JA 2LTPA 1FY7A 4RAGA 4U0WA 2HOTA 1ETXA 2H94A 3I58A 1J7KA 3GLXA 1AA7A 5HLHA 3HG9A 1NG7A 5LGTA 4BQQA 5FROA 1QVTA 1FNNA 2WADA 3S1NJ 2LLKA 2HZDA 1LDJA 2JA2A 2O8KA 1ZGWA 2L2OA 1C0WA 4JBAA 2DQLA 3SJMA 1TLHB 2VXDA 2WB1N 1H8AC 1W7PD 5C3EJ 1SEUA 2FEZA 2YX7A 2ZNYA 4LLNA 1MJ9A 3R0JA 3HPHA 3PSFA 5M5YJ 3HRSA 3B6CA 2LG4A 3A0BC 2EFOA 1HSTA 2FJ1A 4L5IA 3VDXA 3K70D 2QBYA 1MMGA 1G3SA 3IV5A 2P5VA 3IH2A 1Z0XA 4IHXA 1HKTA 4LB6B 3CC4I 1FOWA 1AHDP 2KRHA 2V9VA 3LNQA 1MMNA 4PCQA 3W6VA 5JLWA 2ZMEA 2QF7A 1ACIA 3E1SA 5J40A 2HVSA 2W4SA 4QSHA 3PUFA 2X6XA 2CV0A 4HQMA 1LEBA 2MYSA 1OR7C 2HQNA 4ENKA 4F91B 2QQAA 2K40A 3KLNA 2CQ7A 3LMMA 1KU3A 4LOCA 1U8RA 2DMTA 2BY2A 2EV6A 2ZSHB 3IUOA 1EF4A 2PFBA 1ETWA 2XHKA 4I6ZA 1IN7A 4YFKF 3OYDA 3EYIA 2ZKZA 3BOQA 4C3HJ 5K1YA 1XTAA 2DOEA 1ZLKA 3F8CA 3OSGA 5HLGA 1XGMA 1W5TA 3EETA 3MD2A 1YS7A 5J1RA 1KA8A 5IP6A 3SZPA 3VEPA 1WJFA 1U3EM 4BDZA 5HDKA 2Q0OA 1T2KA 1X3ZB 4I0AA 4Y13A 5IYCJ 5IOZA 2VB6A 3WTYC 1ZN2A 4U87A 4HV5A 3GEZA 4F92B 3AAFA 1BC7C 5JLXA 5J4VA 2HI3A 3RKWA 4A0XA 3CTAA 2R7OA 1MMAA 3KP3A 3FIWA 3BR5A 5AIPA 2LR8A 4OINF 3GLLA
chains in the Genus database with same CATH topology
2HDWA 2R4GA 4BUPA 3LSKA 1QU3A 3IAS2 3EUKL 4ITVA 1OLTA 1UELB 2BW3B 4LIUA 4XONA 3IP4B 2W1OA 1LVKA 4ZDOA 1BOBA 4E7KA 4IQJA 2DCEA 4C2UA 1IRXA 1VZ0A 3OR1C 3K4KA 4CUGA 3OIPA 1U0JA 3H5RA 2CUJA 2M0MA 2MABA 4ZTFA 2QKLB 2ZFUA 1K6YA 4B48A 4RMNA 2E5NA 2KPMA 2E60A 2BW3A 2LY2A 4CCJA 4ZTJA 4HRIA 4R79A 2JSPA 4BJ6C 2LRDA 4D1QA 3SZGA 4F52A 2IGOA 2LOOA 4E7LA 3IAM2 4F93B 3NWSA 4PK4A 4BGDA 3K4LA 3OYCA 4QPQA 5TGTA 1BR1A 4ANJA 2M7AA 4E4HA 1S9HA 3QYFA 1WJDA 4CCOA 2WY8Q 4XNFA 1EA3A 2A6TA 1R6RA 3DEEA 1ZELA 2HNHA 2GOXB 2HVQA 3H35A 4AVZA 3BC8A 2KLOA 1UAAA 3OL4A 3BLYA 1BR4A 1T95A 3OYBA 3DU5A 4HG2A 2V6EA 3QODA 1WJEA 2R7VA 4OWRB 2LH9A 3ZGKA 4HEA2 3HOTA 3HL2A 2F5VA 2XDVA 3V42A 1UG0A 3EUHC 3HPGA 4U7BA 5HVQC 3BCBA 1W36C 2R7SA 3VWBA 3VSKA 3LSMA 3PJRA 4XKVA 3OYMA 3HC7A 4P5OA 3CF2A 1FMWA 1X19A 3L2VA 1E0EA 2XF6A 3SDBA 3S32A 4HSTA 2PJRB 4F55A 2R7QA 3L2UA 2CW7A 2VJJA 3DPUA 1W36D 1WJ5A 3EUAA 2ELJA 3J7AY 2L5QA 2XAUA 2BVLA 4HNTA 4LIVA 4NC8A 4J00A 3OL3A 4XLHA 1YX5A 4BEHB 3EPZA 4XMYA 2KHMA 3CJQB 4XKBA 2XC7A 1X1CA 4XR6A 2CW8A 3DTEA 5KNLA 4XOTA 5HLTA 4XLFA 5HNFA 1V5GA 4PJLA 4XOPA 2MFZA 2PJRA 4IZZA 2VJ5A 4XKCA 3VSLA 2UUZA 2JVGA 4E7JA 2X1CA 2UWMA 3M8JA 3BCAA 4MLOA 3LL7A 3VYUB 3VYSB 2CFOA 4BEHA 3K4BA 4KITB 2NOJB 3CMMA 2R7TA 2OV7A 2BOLA 2KL4A 3H0DA 1SAUA 4PFPA 3ONQA 1D0YA 2IXSA 2RREA 3RSNA 1D1CA 3S3MA 3W2WA 1MW7A 2DT7B 2DJIA 3U21A 3ZXSA 3OS0A 4BJTA 2K3PA 2F4IA 4BJ5C 3OIQA 2LBFB 4D9JA 3OYKA 2XF7A 4LG3A 1PJRA 2OUMA 3H5NA 1ERDA 3ZCOA 2JVHA 3MKWB 4RLFA 5CQGA 4Y33A 2KDOA 4CSWA 1FMVA 2KZVA 3L2WA 4XLAA 3DLAA 3RPUD 2M4GA 3AL0B 2Z2SB 3A4CA 2AQFA 2AQEA 2L9SA 2L9NA 3QOEA 2LBFA 2MC4A 4NQWB 4XQFA 3OYAA 4RM2A 1TZLA 3SEZA 2X6YA 2Z1DA 4NC7A 3OS2A 2PMZA 4GRIA 3OS1A 2E1MC 3PSIA 2DOAA 1LFPA 1TT0A 4C9YA 4FASD 2F6CA 4LITA 4BS9A 5CKTA 3DPTA 1LDKB 4AU7A 4ZDLA 3KYLA 3S8PA 3TMOA 3CP8A 1WJCA 4BDYA 3KX2A 3C2HA 3K6GA 3QYEA 2VASA 4PFOA 3TBIA 2L7KA 3KEYA 3HOSA 3MKZA 2W00A 4RM3A 2GOMA 2HQAA 2X51A 1P9QC 2VQCA 4E7SA 4CZCA 2HU9A 1N78A 2IGMA 2LC2A 4C30A 4G6TB 3BG6A 3H5AA 2CS3A 3OYNA 2X85A 4E7HA 1HA8A 2WY7Q 3LFUA 3RQ4A 3FHNA 2IS4A 2K9LA 4NUBA 4AYBA 3AFHA 3G2BA 2I8DA 4DGWB 1DP3A 1MMDA 4E7IA 2WB1A 3OOUA 2A5WA 3FKJA 4DIQA 4BE1A 1Z21A 3DWLE 3SYTA 3K4MA 4DBQA 3M1CA 2Y0SA 4E7ZA 2LYCA 1DQUA 3CP2A 4HNUA 1Z3YA 3S3OA 3L2RA 2K5CA 3DQVC 3FDYA 4EATA 4HPQA 4P1WA 2VJ4A 2VXZA 3HXLA 3FBNB 2WAQA 3A2KA 5CQEA 2VLAA 1D1BA 4IQ4A 2FUG2 2CMPA 2JUGA 4IX7A 2WA0A 1D0ZA 2VQHA 4YEJA 1LKXA 2WAFA 4XKWA 3K10A 2M4KA 2DXIA 2XF5A 1X1BA 1Z7LA 4PUSA 1V5EA 3W2AA 4CA0A 2Q1ZB 2LREA 2VQLA 2M7BA 4PSWA 1YE9A 2CH0A 2OC6A 2X1DA 5KHDA 3VYRB 2Z16A 4BXFA 1BR2A 1D0XA 4ZYAA 1JI8A 2X6WA 2CV1A 1G8XA 2W82A 2IS6A 3HUGB 2O5RA 3S93A 2CUZA 3PFYA 4KT6A 4II2A 2R7XA 4PJMA 4B47A 5FRNA 4ZJZA 4BE0A 4HSRA 4JOMA 4OAZA 4B43A 4PJNA 1QHHD 1N77A 1QHGA 4OAYA 4XLEA 5LD2C 1SFKA 5HOOA 3S3NA 1J09A 4F3QA 2VKHA 4XLCA 3H9JA 2R7UA 3UNGC 4BACA 4Y4RA 4XM3A 3A1YA 3PNTA 3TL4X 2R7WA 4ZDPA 5LFAA 4BU2A 4DBRA 4RLQA 4DOZA 4E6KG 1DGRM 2P0WA 3RTRA 4BL0B 3CZ6A 3K4NA 3OMYA 4XN3A 2KQRA 3SEQA 4YRVA 2VIXA 1N75A 1V5FA 3HKZA 2LY1A 2M3AA 3C2GA 2E5ZA 3H9GA 4XN0A 4IKFA 2IS1A 3L2QA 3OY9A 2HPMA 4XL9A 4CH7A 3I3LA 2VJIA 1Y6IA 3OYLA 2ZXIA 4CCNA 2QKMB 4CCKA 3LSHA 2E1MB 2KP6A 3OWTA 4BQOA 2R7RA 1X1AA 4XORA 5HNHA 2V1NA 2VQGA 2WAEA 3DPLC 4CCMA 4B3XA 3W3CA 4JQFA 3H9QA 3K4JA 4QPOA 5JHFA 3LSIA 2V4JC 3QYBA 1AA7A 1YX3A 3HG9A 1NG7A 3MKYB 3OYJA 4BQQA 5FROA 3DKXA 2WADA 2HZDA 2JA2A 2L2OA 3MMYB 2VXDA 2K9MA 3K70C 2CV2A 3PL8A 3DU6A 2X1EA 2BVMA 3HPHA 3PSFA 2LG4A 4NNJA 3VDXA 3K70D 1MMGA 1D1AA 5CPRB 5KCMA 2Q2EB 3UR3C 3CESA 2V26A 1DGWY 3F9KA 2KRHA 4N4NB 4J01A 1MMNA 3D5LA 4X0GA 3LSGA 3E1SA 3RCOA 2HVSA 2W4SA 1PYVA 4FETA 4H4KC 4N4OB 2IGKA 2V7FA 3OYFA 2DT6A 2X6XA 2CV0A 4KJZA 3FBIB 2MYSA 1OR7C 2XSJC 1Y56A 4YELA 3E0JB 4F91B 4BE2A 3ZR8X 3ZRGA 1X1DA 3LMMA 2MD0A 3PNYA 2ZSHB 3IUOA 4ZC3A 1G59A 3PUBA 3N05A 3DTIA 2KRCA 2UV1A 3OYDA 2VPLA 1NG6A 2W7NA 1MNDA 4PJJA 2IGNA 1GLNA 4II3A 2HPIA 4PSXA 2V9KA 2ZSIB 3VYTB 3D5RC 2KMUA 3W2VA 3AKZA 2ZXHA 2IS2A 3DTKA 2VKDA 4BQNA 1WFXA 3D5SC 3MD2A 2HVRA 3BG7A 4KISA 3NWTA 1WJFA 4CCLA 3OYEA 1WJBA 4C2TA 4BDZA 3PNVA 4DJAA 3K4CA 3CJRB 3OYHA 2WBMA 2VB6A 1T0FC 1Z3XA 1WJAA 3I9V2 4U87A 3OYGA 4F92B 2VL8A 1KONA 1X4OA 1X4PA 4B44A 2RQQA 1MNEA 2RNGA 4Y3OA 3OYIA 3ZQQA 3DKYA 5FRMA 2R7OA 1MMAA 3AL0C 3OR2C 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCO A;  2KZV A;  2LH9 A;  2LY1 A;  2KPM A;  3S93 A;  2LY2 A; 
#chains in the Genus database with same CATH topology
 2TCT A;  3PQJ A;  1R4M B;  1H89 C;  3GTM J;  2FNP A;  2M0C A;  4ITV A;  2BW3 B;  2EK5 A;  2JRM A;  3LA2 A;  4A5M A;  4A3D J;  1R7J A;  3H92 A;  1FPQ A;  4ZDO A;  1BOB A;  2EWN A;  4E7K A;  2GZW A;  2L7F P;  2DCE A;  2VBW A;  2XPW A;  3FXR A;  3LOC A;  5EYR A;  3J81 K;  5E3O A;  1VZ0 A;  3G6E I;  3GTL J;  4MTD A;  3I71 A;  1A6Q A;  3TOB A;  1EH6 A;  1H9G A;  1JJ8 C;  3H5R A;  3WOD F;  4HF1 A;  4UUV A;  2CUJ A;  1WZ2 A;  3K2A A;  2ZCW A;  4GYI A;  1MH4 A;  5JR3 A;  1DUX C;  2ZFU A;  1K6Y A;  4B48 A;  2E5N A;  3HOW J;  4I02 A;  1KYW A;  2LY2 A;  2EIL H;  4ZTJ A;  1VFC A;  1TW3 A;  4BJ6 C;  1B9M A;  4D1Q A;  2K9N A;  1IRF A;  4RDU A;  2PQ8 A;  1POG A;  3DBR B;  4AD9 A;  4ENM A;  5D8L B;  3I4M J;  3NWS A;  2Z33 A;  4PK4 A;  1EJ9 A;  4X6A J;  3WU2 C;  5D5W B;  4ANJ A;  2K4B A;  5D5U B;  1S9H A;  1WJD A;  1A04 A;  1KU2 A;  4LLG F;  1P2F A;  2NVQ J;  4XSX F;  1EA3 A;  2A6T A;  4OU0 A;  1G3T A;  4BBR J;  3BJ6 A;  2WC2 A;  1GT0 C;  2RGV A;  3HM5 A;  4WCG A;  4FHT A;  1UST A;  5HS8 A;  2KLO A;  3F6O A;  1SD4 A;  1T8I A;  5CVR A;  1TNT A;  1MBE A;  1IN5 A;  3OL4 A;  4ZYH A;  3CUO A;  5CVU A;  1OYI A;  4RS8 A;  2R3S A;  4HEA 2;  4U0V A;  5GPA A;  3HL2 A;  4ESF A;  4HOB A;  2PJP A;  3ZMU A;  2LVS A;  4ENN A;  1W5C C;  2M30 A;  2R5Y A;  5F64 A;  3F0C A;  4H0E A;  3SFI A;  5DD8 A;  2ZNZ A;  2IW5 A;  4M6X A;  2DYR H;  1B59 A;  3LSM A;  2IVM A;  5ILU A;  1HDD C;  4KDP A;  4P5O A;  3CF2 A;  3GUD A;  2JRT A;  5KAI C;  3D1N I;  3FF5 A;  2PJR B;  3M9A A;  1F43 A;  2R7Q A;  1AKH B;  2EZH A;  3M1E A;  5L3F A;  1QQI A;  4R8H A;  3CJT B;  4XID A;  1MJA A;  3PO2 J;  2XAU A;  3I59 A;  1HCR A;  4AIK A;  5E1W A;  1EV7 A;  5LHG A;  3EPZ A;  2OPT A;  4XMY A;  2KHM A;  3QOP A;  5HLI A;  2CW8 A;  5EG0 A;  2MC3 A;  4XOT A;  4CYD A;  2IP2 A;  4XLF A;  3RYP A;  5HNF A;  1V5G A;  4PJL A;  2YSR A;  3F21 A;  3KE2 A;  1YYV A;  1KU7 A;  2JVG A;  4MLO A;  2Y30 A;  2AXT C;  3LL7 A;  3HGY A;  3VYS B;  2CFO A;  4I99 C;  2HR3 A;  1R5H A;  1NHA A;  1D0Y A;  1OR7 A;  5IT9 K;  1D5V A;  1IV8 A;  4I7H A;  1V54 H;  3TQN A;  4A93 J;  4F7Z A;  3KP5 A;  3S3M A;  1MW7 A;  1Y8Q B;  2DT7 B;  2DJI A;  4MIM A;  3ZXS A;  2NVY J;  3KIO A;  1ZR2 A;  1JT6 A;  4M3B A;  1JUS A;  2F4I A;  2BY1 A;  2KZG A;  2M5W A;  5ED4 A;  3DV8 A;  1Y8R B;  5ICC A;  4HZF A;  1S8N A;  5ERI A;  2R5Z A;  2OUM A;  2F4O B;  1W0T A;  3ZCO A;  3BR2 A;  1APL C;  2JVH A;  2BBY A;  2ECC A;  4ZH4 F;  3QU3 A;  2W48 A;  2HKX A;  3GFM A;  2LKX A;  3HIF A;  3FHZ A;  1BW6 A;  2AQF A;  2AQE A;  2JA5 J;  2LBF A;  3CLO A;  3G4S I;  3QAH A;  3OYA A;  4RM2 A;  4S0H B;  3HBL A;  3G1M A;  2K3F A;  4HAM A;  2PMZ A;  1OFC X;  4RGU A;  3QU6 A;  1YHQ I;  3PSI A;  1PP8 F;  2DOA A;  5LLQ A;  4CGZ A;  1XDU A;  1QO0 D;  2F6C A;  1QGP A;  4LIT A;  3BR1 A;  3LAP A;  3MQ0 A;  3BJO A;  2F5E A;  1XCB A;  2D1V A;  3W6K B;  1U5T C;  4OIO F;  1X2N A;  2KDZ A;  2F5D A;  4BXU A;  4BDY A;  1S72 I;  3GTO J;  5CYV A;  1TQM A;  3QYE A;  3HOY J;  1WRJ A;  3HOS A;  3MKZ A;  2HQA A;  2X51 A;  4Z2Y A;  2EZL A;  2VQC A;  4E7S A;  2DQR A;  2B7E A;  2RN7 A;  4LJZ F;  1WPK A;  2PX9 A;  1H9T A;  1KQ9 A;  1GDT A;  4L9T A;  4G6T B;  1FBU A;  4JX5 A;  4RB1 A;  2XSD C;  4IOC F;  5F0H A;  1X58 A;  2CS3 A;  2DMQ A;  5F08 A;  1LEA A;  4E7H A;  2WY7 Q;  2KRF A;  3FHN A;  3M8F A;  4NUB A;  2BHY A;  4FQG A;  3G2B A;  3B6A A;  1BBY A;  1MMD A;  2QZ8 A;  2ZJP F;  2WB1 A;  3OOU A;  2A5W A;  2E1O A;  3FKJ A;  1Z21 A;  1B8I B;  1YJ9 I;  4A3E J;  1BL0 A;  3I64 A;  3DF8 A;  1T39 A;  1WGX A;  3M1C A;  4FE4 A;  1Z9C A;  4DYQ A;  2JTV A;  2LYC A;  3JTH A;  1DQU A;  2AO9 A;  3DKW A;  3IC7 A;  2BHZ A;  3S3O A;  2MBF A;  3FDY A;  3RJP A;  2VJ4 A;  2TDX A;  3HXL A;  3FBN B;  4B8X A;  2WAQ A;  2R7Z J;  2Y0M A;  1D1B A;  4IL6 C;  5K5Q A;  4IQ4 A;  2FUG 2;  2DK5 A;  4RGS A;  3JCU C;  1I50 J;  1MDM B;  3K7A J;  1ETQ A;  3WHB A;  3CCL I;  4XKW A;  4HLY A;  3GYH X;  2M1B A;  2ZBK A;  3EYY A;  2ICW G;  3P5J A;  4CA0 A;  4CIC A;  5C4X J;  2VQL A;  5IOY A;  3ZQI A;  4A3K J;  3A01 B;  5LGN A;  1YE9 A;  2X1D A;  5KHD A;  1XSD A;  1R36 A;  2JZY A;  2DJN A;  3ZMT A;  1J5Y A;  1T98 A;  1BR2 A;  3A03 A;  1T33 A;  3FXM A;  2UZK A;  2JA8 J;  4JP0 A;  4HX4 A;  2OTJ I;  4RA2 A;  1OCR H;  3ZQF A;  1E17 A;  2CUZ A;  3KP7 A;  4KT6 A;  2RDP A;  2EJR A;  3TDZ C;  4P55 A;  4B47 A;  3NEU A;  4U88 A;  4BE0 A;  2VT3 A;  1X3U A;  1RRJ A;  4OAZ A;  4PJN A;  1N77 A;  4XLE A;  2QLZ A;  2JN6 A;  3KPH A;  1AOY A;  5HOO A;  4EJT A;  3I4N J;  2DTZ A;  2VKH A;  2A05 A;  3UKG A;  4PGH A;  2DMN A;  4B1R A;  1K79 A;  2JT1 A;  3TW6 A;  1MSE C;  1DU0 A;  3F3X A;  4BU2 A;  4DBR A;  4UUS A;  4D0P A;  3L09 A;  2COM A;  2CGP A;  2UXN A;  1DGR M;  1VQ4 I;  2DMP A;  2XKO A;  1IF1 A;  3BQY A;  3CZ6 A;  3K4N A;  1J2X A;  1RR8 C;  3SEQ A;  3WU0 A;  4A5N A;  2XAF A;  5LEJ A;  2XGD A;  4IKF A;  3R61 A;  1MZB A;  4XL9 A;  5BQT A;  1VQ7 I;  3GTJ J;  1USS A;  2EIN H;  3K1N A;  1FX7 A;  5E1X A;  3VFZ A;  2VJI A;  5E8I A;  1IV6 A;  1TQP A;  1XX5 A;  1YIT I;  2E1M B;  1FYK A;  3QQA A;  3JSO A;  3S2W A;  4BQO A;  1K61 A;  4HX7 A;  1FTZ A;  5ICF A;  3S16 J;  2V1N A;  2IEK A;  2LD5 A;  2PG4 A;  2EFP A;  1B1B A;  4QPO A;  3BWG A;  2V4J C;  3LSI A;  4Q5S F;  3QYB A;  4ZZL A;  2QBY B;  1U78 A;  2IJL A;  2VKE A;  1YW9 A;  1BIA A;  3O8H A;  5CLS A;  3MMY B;  4M9X A;  3ZP5 A;  1YTY A;  1MNM C;  1TT5 B;  2P5K A;  4Y15 A;  2ZME B;  4A3M J;  1O3T A;  1D8K A;  1U5T A;  2F5C A;  3KYC B;  4ON0 A;  2WWY A;  1ZQ3 P;  3H3U A;  2BVM A;  3E7L A;  4AVP A;  1HC8 A;  3CDH A;  2AS5 F;  4S05 A;  1OCT C;  1D1A A;  1XN7 A;  1VQN I;  5CPR B;  1S6L A;  3JRF A;  1DGW Y;  3D5L A;  3P9K A;  2UXX A;  4ETS A;  3HB9 A;  1YG2 A;  3MZY A;  5DEQ A;  4H4K C;  3MCZ A;  2EPF A;  3HJE A;  2IGK A;  1IXC A;  2V7F A;  3AG2 H;  2N8G A;  3TOA A;  3OYF A;  2QYO A;  2PN6 A;  3BR6 A;  1TNS A;  4KJZ A;  1O3R A;  4YFN F;  4MHG A;  2XSJ C;  1BM9 A;  1Y56 A;  1LFB A;  1MD0 A;  1XMK A;  4BE2 A;  1ETK A;  3ZRG A;  1X1D A;  1JKO C;  1RNL A;  2MD0 A;  4NDL A;  1ULY A;  4A3C J;  1SAN A;  2XUB A;  1VND A;  2B0L A;  2HYF A;  5K5R A;  4MO7 A;  4LG0 A;  1TWA J;  4NBQ A;  1ZR4 A;  2IGN A;  1GLN A;  3BTI A;  1EKE A;  1JTY A;  4WF2 A;  2HPI A;  2BV6 A;  4PSX A;  4YIR X;  2V9K A;  2O61 A;  3VYT B;  3D5R C;  3AKZ A;  4OOI A;  3H36 A;  3ABL H;  2ZXH A;  2E71 A;  2IS2 A;  4N0B A;  4HYE A;  5LBQ A;  3D5S C;  1TTY A;  4AIJ A;  2DFI A;  4HV6 A;  2HVR A;  1Q1V A;  3NWT A;  2F48 A;  3JRB A;  1ZG3 A;  2GA1 A;  2P6S A;  1WJB A;  3J81 Z;  1HW5 A;  2WTE A;  3ISP A;  4L0Z B;  2QGU A;  3FWE A;  1QZY A;  3CJR B;  3K4C A;  2WBM A;  4IHV A;  1T0F C;  1WJA A;  2LF7 A;  2QSF X;  3HOX J;  1P7I A;  1KON A;  4QLC U;  4MFD A;  2XAQ A;  2G7H A;  3FZV A;  2EB7 A;  1MNE A;  2RNG A;  3P9I A;  3OYI A;  2ESH A;  4A6E A;  2QQ9 A;  4LFU A;  5E3N A;  3CMY A;  2OJE D;  3AL0 C;  3OR2 C;  2FQ3 A;  3AG4 H;  1PUF A;  2NVX J;  4KUM A;  4EJU A;  3GBG A;  4KMU X;  4EM1 A;  4ZYG A;  3LSK A;  2CG4 A;  3KP2 A;  3SQN A;  4WWC A;  1OLT A;  3U1K A;  2XRN A;  4LIU A;  4UNO A;  2DPU A;  3KYD B;  2E1C A;  2W1O A;  4KYW A;  2VOD A;  2QEX I;  4IQJ A;  4C2U A;  1BN5 A;  2DTR A;  4M3D A;  3C7J A;  1E3H A;  3K4K A;  2E34 A;  2OU2 A;  4LLL A;  3HOU J;  4CUG A;  3OIP A;  2DFE A;  3LST A;  1OCC H;  3BTL A;  2E1N A;  1U2W A;  3K2Z A;  2KPM A;  1LE8 A;  3ABM H;  3ZMV A;  4R79 A;  5A2Q Z;  1VQ8 I;  1WWX A;  1V55 H;  2VC0 A;  3SZG A;  1J9I A;  2BY0 A;  2LOO A;  3IWF A;  2QSH X;  5FGM A;  3GME A;  2IA2 A;  2JMW A;  4F93 B;  2HWV A;  1YW7 A;  4QPQ A;  2H6B A;  5FD6 A;  5E79 C;  4HNV A;  4XSZ F;  1XCV A;  2ISY A;  4CCO A;  2WY8 Q;  3BPV A;  1PP7 U;  3BR0 A;  1I27 A;  1R6R A;  4Q4Z F;  1L0O C;  1ZEL A;  2HNH A;  4D7M A;  4AVZ A;  1OJL A;  1ON1 A;  2R5Y B;  3BC8 A;  1UAA A;  3ZQ7 A;  2CUF A;  2FU4 A;  3E3V A;  3C2B A;  2P4W A;  2RC4 A;  4U7D A;  1BR4 A;  2K7L A;  1T95 A;  3JAM Z;  3JRA A;  2LDU A;  3I53 A;  5CJ9 A;  3QP5 A;  5BNG A;  3DU5 A;  3OYB A;  4K2E A;  5E3L A;  2P7V B;  1IDZ A;  1WJE A;  2WAQ N;  4OMY A;  2LH9 A;  3RZD J;  1GV2 A;  1U9N A;  3IWZ A;  4LMY A;  2DYS H;  3R0A A;  2ESN A;  1Z91 A;  3I59 B;  5HS9 A;  5FB2 A;  2E36 A;  2XDV A;  3V42 A;  2V1D A;  3CC2 I;  1BW5 A;  2Y2Z A;  1UG0 A;  3EUH C;  3GF2 A;  3C3W A;  5CVI A;  3VWB A;  2EIJ H;  1O57 A;  2E2H J;  3CF5 F;  5EG0 B;  4M3E A;  4XKV A;  3T5X A;  1E0E A;  3H0G J;  2X6O A;  3R60 A;  3MWM A;  2XF6 A;  2VBY A;  4M72 A;  4HST A;  1FZP B;  3L2U A;  2VJJ A;  1S7O A;  3DPU A;  1WSU A;  2DPD A;  4XLN F;  5K7H A;  3J7A Y;  2L5Q A;  3BG9 A;  5IT9 Z;  2ZC2 A;  5E8G A;  1ODD A;  3F72 A;  5J3L A;  4NC8 A;  5EZG A;  3OL3 A;  4HNT A;  3K9T A;  3WTX C;  4XLH A;  1YX5 A;  4J00 A;  4W1U A;  4V19 K;  2HGC A;  2XC7 A;  4M9S A;  3M07 A;  3CUQ C;  1VQO I;  3B02 A;  1YW8 A;  3BTC A;  3V7S A;  5M5X J;  3JSP A;  1GXQ A;  4XOP A;  2DK8 A;  4IZZ A;  3GTK J;  2VJ5 A;  4RGX A;  5E3M A;  4UUT A;  4DZJ A;  1I3A A;  3PFI A;  2UUZ A;  2MA3 A;  3VSL A;  2IPQ X;  4E7J A;  2X1C A;  2JPB A;  3FXK A;  4FIS A;  2ZXJ A;  5GAH J;  3VYU B;  3K4B A;  2R7T A;  2NOJ B;  4BHP A;  2OV7 A;  2KL4 A;  2P81 A;  3ONQ A;  4A6D A;  2R5Z B;  4B4C A;  1D3Y A;  5J47 A;  2OBP A;  2GQQ A;  1D1C A;  4EEF G;  4V2G A;  3E6B A;  3K0L A;  3LSP A;  1XGN A;  1NH3 A;  4YG2 F;  3WGI A;  3T8T A;  5D5V B;  3J7A O;  2MLG A;  3U21 A;  4YFX F;  1G6N A;  3OS0 A;  4BJT A;  1R9T J;  4OIP F;  3H3Z A;  3F8F A;  3OIQ A;  4M6V A;  2LBF B;  1FYL A;  5IT3 A;  2D2W A;  1KQ0 A;  1Z6T A;  2EIK H;  4LG3 A;  1CGP A;  2JA6 J;  3H5N A;  3MZ8 A;  3SFZ A;  4O6J A;  3MKW B;  4RLF A;  3F23 A;  1HF0 A;  2M8E A;  3HEF A;  1DP7 P;  3L2W A;  2FOW A;  4RB2 C;  5D4R A;  1A36 A;  4M6Y A;  1F1Z A;  4XRS A;  2VOO A;  1TZL A;  4BBS J;  2Z1D A;  3FMS A;  1T0F A;  3I54 A;  2Y9Z A;  4I01 A;  1RKT A;  1LNW A;  4C9Y A;  4FAS D;  1JKP C;  2DLL A;  2BXY A;  2P6T A;  3FM3 A;  1OQY A;  4G6Q A;  1LDK B;  2E35 A;  1VQ5 I;  4ZDL A;  1YIO A;  2QWW A;  4L9J A;  2KT0 A;  1XB4 A;  1ON2 A;  3L2C A;  1VQ6 I;  4A3J J;  3CDI A;  1R1V A;  5DUI A;  2NNN A;  1KU9 A;  2L7K A;  3KEY A;  2L9V A;  2W00 A;  4RM3 A;  1QVU A;  1Z6R A;  2DBB A;  2GOM A;  2D5V A;  5M3F J;  1YOV B;  1ZG5 A;  2K85 A;  5FLX K;  4RB3 C;  1IXS B;  3CO7 C;  4G12 A;  4BYY A;  1R58 A;  2FX0 A;  1RI7 A;  1F4K A;  2STW A;  2QQ8 A;  1H0M A;  2DA1 A;  1UB9 A;  1IC8 A;  3BZK A;  3KP4 A;  2QQB A;  2VBZ A;  4EM0 B;  2HXO A;  5FD5 A;  3K69 A;  4JX6 A;  2A69 F;  2X85 A;  1VQM I;  1RUO A;  3G1L A;  5E20 A;  4DQ2 A;  2R0Q C;  2CJJ A;  2DDA A;  3RQ4 A;  3ZPL A;  2H1L A;  3AFH A;  4BY7 J;  2I8D A;  1DP3 A;  4IRG A;  3I56 I;  3IRR A;  4HF0 A;  1VTN C;  1IDY A;  3U9G A;  2PI0 A;  1ZHF A;  1F5T A;  3JR9 A;  5DYM A;  2DOF A;  1OKR A;  1P6R A;  2BY3 A;  1MBJ A;  3S14 J;  1PDN C;  3U2R A;  5GAD J;  4EGZ A;  4ASN A;  4HNU A;  1AU7 A;  3L2R A;  5FO5 A;  4EAT A;  4P1W A;  1FSH A;  1P4W A;  2VXZ A;  2XGC A;  2OCE A;  4P96 A;  4XBF A;  3CCJ I;  2CMP A;  2JUG A;  1OPC A;  2DW4 A;  1SMT A;  2HDD A;  2WV1 A;  1M1E B;  3ESW B;  1V3F A;  2L9R A;  2L02 A;  2WAF A;  2M4K A;  1MBH A;  1X1B A;  3EUH A;  4PUS A;  1V5E A;  4KNY A;  5H6R A;  2Q1Z B;  4Q47 A;  2M7B A;  2CH0 A;  2CU7 A;  2K4J A;  2OZU A;  3TDU C;  4Z6Y A;  4CXF A;  3VYR B;  5D8K B;  3FMQ A;  4HQE A;  2ZB9 A;  1E2X A;  2A6E F;  4O3M A;  4UXN A;  4RAZ A;  1TQI A;  5IYD J;  1JI8 A;  3BPX A;  5GP9 A;  5KVR A;  1WQ2 A;  4DZP A;  4M3G A;  1JTX A;  2O5R A;  3Q0V A;  3S93 A;  3ZMD A;  5JVG F;  4YIF A;  3LAJ A;  2XKP A;  3ROU A;  2R7X A;  4PJM A;  1I1S A;  5EEH A;  4IO9 F;  1FLI A;  4HSR A;  1LJ9 A;  3CUQ A;  4UUS B;  5BPI A;  1OYY A;  1QHG A;  2AHQ A;  3CCR I;  1X1P A;  2WV0 A;  5LD2 C;  3CMA I;  2O6G E;  1SFK A;  1FWZ A;  3GX4 X;  2HZT A;  1UHM A;  4F3Q A;  2DT5 A;  3OV8 A;  3H9J A;  4XLC A;  2DA3 A;  3ULQ B;  2R7U A;  1MH3 A;  2Z99 A;  4BAC A;  2DA6 A;  3HUG A;  2M34 A;  4EVI A;  2KIU A;  2H09 A;  4RLQ A;  2DU9 A;  3CC7 I;  4E6K G;  1P4A A;  5FLV A;  3RTR A;  4BL0 B;  2VBX A;  3DP7 A;  4XN3 A;  4YRV A;  3BG3 A;  2VIX A;  3WGG A;  2X4H A;  5FFZ A;  2QSG X;  2LY1 A;  3C2G A;  4BHC A;  3L2Q A;  3OY9 A;  1S5L C;  2P5L C;  2HKO A;  2CO5 A;  2L4A A;  4IVN A;  3RZO J;  3I3L A;  3RQI A;  4XLP F;  1YIJ I;  1JUM A;  3E97 A;  1SFE A;  1XGO A;  5F0F A;  3HTS B;  3GFJ A;  1IUY A;  3SZT A;  4AUX A;  2X0L A;  1A31 A;  3CCQ I;  5D6E A;  2JSC A;  3GFI A;  2VQG A;  2WAE A;  4CCM A;  3ZQC A;  1U5T B;  2XB5 A;  1XSX A;  4ZYD A;  5K7Z A;  4M9Z A;  3V8J A;  2X9D A;  5JHF A;  1X3W B;  2M87 A;  1IZ1 A;  3DEW A;  3E6D A;  1YX3 A;  3MKY B;  4WXC A;  3OYJ A;  4G7H F;  3DKX A;  2B63 J;  4PGG A;  2XRO A;  1UG2 A;  2NS0 A;  4AYB N;  5F1J A;  2XAJ A;  2ECB A;  1MKM A;  2HQ5 A;  1J0R A;  4N9H A;  3E5X A;  1ONV A;  3PL8 A;  4KN7 X;  3PIP F;  3DU6 A;  2X1E A;  3C18 A;  1P92 A;  3REO A;  4KFC A;  5JI6 A;  3CJN A;  4LGW A;  2QVO A;  4G9Y A;  1B9N A;  3V7C A;  1TP4 A;  1JKR C;  5KCM A;  1JGG A;  5DV5 A;  1I6H J;  5HS7 A;  3CES A;  3UR3 C;  2FF4 A;  1LPQ A;  4IHY A;  4N4N B;  4CZZ A;  4J01 A;  4X0G A;  4UB6 C;  3LSG A;  3F8N A;  3L7W A;  2EIM H;  4FX4 A;  1FIP A;  3RCO A;  2OD5 A;  1W7P A;  3GW2 A;  4LG0 B;  2LNB A;  4N4O B;  2HEO A;  6PAX A;  2ME6 A;  1ZRF A;  2NS7 A;  2MSY A;  4LB5 A;  3FBI B;  5KK1 A;  4M3F A;  2Q2E A;  1UHW A;  3E6M A;  3E0J B;  2DA5 A;  3ZR8 X;  4G7Z F;  3KEQ A;  5FKO A;  4MEX F;  2NS8 A;  2FML A;  3GWZ A;  1QNT A;  2PLY A;  1TWH J;  2VON A;  3SXY A;  4QWQ A;  4ZC3 A;  3WTV C;  2DAO A;  2VPL A;  1MMS A;  2W7N A;  4PJJ A;  4YII A;  3U1D A;  1IG7 A;  4FE7 A;  3HDD A;  2KMU A;  1FP1 D;  2XPU A;  1VI0 A;  1SAX A;  2CSO A;  3DTK A;  4BQN A;  2FE3 A;  5EEA A;  1I39 A;  1O4X A;  5J8F A;  2KKO A;  1P4X A;  1HKS A;  4KIS A;  3JRE A;  1A5J A;  4IRI A;  5C4J J;  3OYE A;  5CVJ A;  5FKK A;  1TWG J;  2ID6 A;  1PUF B;  2HOS A;  3PNV A;  2MLK A;  4DJA A;  1Y1V J;  2H27 A;  4TV7 A;  4IEJ A;  2GLO A;  1Z3X A;  1JJ6 C;  3I9V 2;  3OYG A;  3E5U A;  2HYJ A;  3O2P E;  3BR3 A;  1ETY A;  4L9N A;  2I10 A;  2RQQ A;  3NQO A;  4Y3O A;  3ZQQ A;  3DKY A;  3I5U A;  1K78 A;  2O7O A;  4IHW A;  5FRM A;  3MN2 A;  3RDI A;  4KIB A;  3MEX A;  1LQ1 A;  2BYV E;  1IN4 A;  2ID3 A;  2J5P A;  4A3B J;  3F6V A;  2H8W A;  1SD6 A;  3J80 K;  3RKX A;  1TC3 C;  2VOP A;  3LQQ A;  3EUK L;  3CCU I;  1LE8 B;  3JW4 A;  4XON A;  5DM7 F;  1FYM A;  1LVK A;  2L3D A;  3ECH A;  2A6H F;  3WTU C;  3S1M J;  1R1T A;  2JK3 A;  3FK6 A;  3OR1 C;  5GTH C;  4GCV A;  1XMA A;  4BH9 A;  1U0J A;  5J8C A;  3BZ6 A;  3NAU A;  1HSJ A;  2M0M A;  3Q5F A;  3LSJ A;  2ELK A;  4ZTF A;  2QKL B;  9ANT A;  1K4S A;  3HSR A;  4RMN A;  2C6Y A;  1IW7 F;  2E60 A;  4OIR F;  2K9Q A;  1S3J A;  4CCJ A;  3K1P A;  2JSP A;  2A68 F;  3JTG A;  2GWR A;  3FIS A;  2L01 A;  4ZYE A;  4E7L A;  5EJC A;  2DA2 A;  2GIZ A;  3SHF A;  3DLL F;  3ABU A;  5M3M J;  2X48 A;  1OYW A;  1P7J A;  3DCF A;  3HHH A;  1BR1 A;  2M7A A;  3TW7 A;  1YJN I;  3QYF A;  1GHC A;  1TWF J;  3ZQH A;  3MAJ A;  4BNC A;  4XNF A;  4A0Y A;  3DEE A;  3WE2 A;  1QPI A;  5DD4 A;  2GOX B;  3H35 A;  1Z05 A;  3ZQL A;  3BLY A;  4BAY A;  2GXG A;  2EQR A;  2KIS A;  1K6O A;  1V4R A;  2R7F A;  2OTL I;  1R00 A;  2LP0 A;  4HG2 A;  1I6X A;  2VN2 A;  5K5O A;  3QOD A;  2HFH A;  1HW1 A;  5L3B A;  4OWR B;  3ZGK A;  4MFE A;  3HOT A;  4JYK A;  2W25 A;  2LFB A;  2F5V A;  4ZZD A;  3S17 J;  3CCM I;  3IHU A;  2ME0 A;  1MIJ A;  2VUM J;  1S7E A;  3HPG A;  4WK8 F;  2ELH A;  3BCB A;  1W36 C;  3RI4 A;  3GZ6 A;  3PJR A;  2NNY A;  3LFK A;  2R93 J;  1X19 A;  5L3C A;  2HTJ A;  3SDB A;  1SFU A;  3S32 A;  1ETO A;  3V7R A;  4F55 A;  1Z7U A;  4S04 A;  2CW7 A;  1WJ5 A;  1R49 A;  3EUA A;  3HOZ J;  2ELJ A;  1D8J A;  1T56 A;  2PEX A;  1NTC A;  4CO8 A;  1PVE A;  3T0Y A;  2BVL A;  4XRM A;  2RV8 A;  1ZRD A;  3ZQG A;  4WXD A;  3WU1 B;  1X1C A;  4XR6 A;  3DTE A;  3EDP A;  5HOD A;  3Q3S A;  5KNL A;  1A6I A;  2VI6 A;  4XRF A;  5AIQ A;  5HLT A;  2K86 A;  2VE9 A;  2B9S A;  1IO2 A;  1T08 B;  2PMU A;  4RAF A;  2H1K A;  2HQR A;  3M7G A;  3IKT A;  3LWF A;  3CO6 C;  3GO5 A;  2EFQ A;  1K83 J;  1F9N A;  3IRQ A;  1RC9 A;  1JUP A;  4MNU A;  4O5V A;  3M8J A;  2DFH A;  1B72 A;  2UWM A;  2Q8K A;  2LKP A;  4J19 A;  4BXX J;  3QPT A;  3FMR A;  3GFL A;  4BEH A;  4KIT B;  1TBX A;  3CMM A;  5B1A H;  2BOL A;  1MBG A;  1SMY F;  2CWE A;  1HBX G;  3DFG A;  2LF8 A;  4KIG A;  4KA4 A;  2IXS A;  2RRE A;  1ENH A;  1E3O C;  5EGO A;  3S2H J;  3TKY A;  3RSN A;  4MEY F;  1IGN A;  3MZH A;  1WCM J;  1CQT A;  2ISZ A;  2HXI A;  2EA4 A;  4G6D A;  3Q9V A;  1ZG1 A;  5B5E C;  4M74 A;  1FC3 A;  4CDG A;  1OCZ H;  4IJA A;  4BJ5 C;  2JWT A;  4D9J A;  3NAR A;  3OYK A;  1IN6 A;  2DFF A;  5H2F C;  5J1U A;  2P8T A;  1RKW A;  1ERD A;  2VPR A;  3O6B B;  3PQK A;  5DS9 A;  1PUE E;  5IP7 J;  4Y33 A;  2KDO A;  1VF9 A;  3F8B A;  2HS5 A;  3W6J B;  1FMV A;  2R92 J;  2KZV A;  1OIS A;  3P7N A;  5TIS C;  1G3Y A;  4I76 A;  3DLA A;  3ZN1 A;  5IPA A;  4NHJ A;  5E1Z B;  3AL0 B;  2OQR A;  1ZYR F;  2L9S A;  3RPQ A;  5FLX Z;  2MC4 A;  4XQF A;  1A35 A;  3SEZ A;  2NRA C;  5GAE J;  2A5Y B;  5K7F A;  3B73 A;  4NC7 A;  3OS2 A;  3KLO A;  3OS1 A;  5D4S A;  2MW8 A;  2ADU A;  1FOK A;  3D0S A;  5EEG A;  4JK1 X;  4WXH A;  2QA4 I;  5CKT A;  5DTD A;  3DPT A;  1BA5 A;  4AU7 A;  3TMO A;  3CP8 A;  1XDS A;  3KX2 A;  4NQW A;  2F5F A;  2JJ7 A;  2O03 A;  1WI9 A;  2MH2 A;  1R71 A;  1LUJ B;  2DA7 A;  4AWX B;  2D45 A;  3I4P A;  3VPR A;  4CZC A;  1DDN A;  5DM6 F;  1N78 A;  2ZJR F;  1UZC A;  1FIA A;  4NB5 A;  1IJW C;  1RET A;  2LC2 A;  4C3J J;  4C30 A;  4HDV A;  3GTQ J;  3BG6 A;  3L9F A;  3G71 I;  3KCC A;  3H5A A;  5J1Y A;  3JRD A;  4IPA A;  1ZAO A;  3I55 I;  2XV4 S;  1FP2 A;  3OYN A;  3MFK A;  1X2M A;  4HX8 A;  4KN4 X;  2XAS A;  3LFU A;  3WG7 H;  1I5Z A;  4UHT A;  2IS4 A;  2K9L A;  4CYC A;  1KYZ A;  4ESJ A;  2KIF A;  4AYB A;  1W1W E;  1SD7 A;  2OCC H;  2ZXW H;  3PM1 A;  1F36 A;  1FT9 A;  4BE1 A;  3BG5 A;  3DWL E;  3K4M A;  3V4G A;  1MSF C;  4R1H A;  4DBQ A;  1YS6 A;  3BP8 A;  3L00 A;  4MGR A;  1UCR A;  2GBY A;  2QEN A;  4IF4 A;  4Y17 A;  3HRU A;  3S1Q J;  4A69 C;  1HXD A;  3TP3 A;  5LEK A;  1MGT A;  1SVO A;  1TW2 A;  3E5Q A;  1XS9 A;  4D5F A;  3DQV C;  4HPQ A;  3A2K A;  1UHS A;  3TED A;  5EDN A;  3DBL B;  3F8M A;  1B6A A;  2WA0 A;  3GZ5 A;  5TJJ A;  1U9O A;  4B3A A;  2W84 A;  1LKX A;  5DCM A;  4C3I J;  3ZOB A;  4IOA F;  4FCY A;  2DXI A;  4EJO A;  4HW0 A;  2FNA A;  3O8G A;  3H3V K;  3S1R J;  3CCE I;  1Z7L A;  3ERM A;  3WTW C;  2EV0 A;  4L5E A;  5DDG A;  2NXN B;  2OZ6 A;  1ZGA A;  3CUQ B;  3JRH A;  1RZ4 A;  4PSW A;  2OC6 A;  4G8X A;  3WGH A;  1MJB A;  4BY1 J;  5B66 C;  2Z16 A;  5L3D A;  1D0X A;  4D5C A;  4LD5 A;  2X6W A;  2CV1 A;  2V79 A;  2JUC A;  2L7M P;  1VQL I;  3LQR A;  3HUG B;  1UFM A;  2Y48 A;  5F27 A;  3VB2 A;  2FBH A;  4NC6 A;  2DOD A;  1FBS A;  2BXZ A;  2IA1 A;  3GXO A;  5FRN A;  3V8L A;  4ZJZ A;  2Y9Y A;  4B43 A;  1QHH D;  1CF7 A;  4OAY A;  1RUN A;  5HDN A;  1VQ9 I;  2VE8 A;  4L0Y B;  1STZ A;  2VT2 A;  5F6F A;  4RAY A;  4P9U A;  2VKV A;  3GTP J;  1R5G A;  1LVA A;  4JX4 A;  3UNG C;  2J5O A;  4Y4R A;  1FOY A;  4XM3 A;  1UMQ A;  2Z3Y A;  2M45 A;  1VQP I;  1YRN A;  2EV5 A;  2K9S A;  3PNT A;  2R7W A;  2E2J J;  1KGS A;  5LFA A;  2GM4 A;  4DOZ A;  3HOV J;  1XPX A;  1FBQ A;  2P0W A;  4UV9 A;  4A3L J;  1TWC J;  3OMY A;  1H88 C;  3IH3 A;  2KQR A;  5BOX A;  2L0K A;  2LK2 A;  1N75 A;  1IXR C;  1V5F A;  3HKZ A;  1QZZ A;  2M3A A;  3H9G A;  2E5Z A;  3IKV A;  4FT8 A;  4XN0 A;  2HPM A;  1ZRE A;  5GTI C;  1W4M A;  2VC1 A;  2A3S A;  4UVA A;  3TO6 A;  2FMY A;  3QPL A;  2ZJQ F;  1Y6I A;  5J4Y A;  3OYL A;  5BPD A;  4CCN A;  1BI0 A;  3RPU A;  3OSF A;  2QKM B;  3QP6 A;  4CCK A;  1LB2 A;  5GAG J;  2KP6 A;  3TO7 A;  3JRC A;  3HSF A;  5F04 A;  1X1A A;  4XOR A;  5HNH A;  4IXA A;  3FXO A;  3TP0 A;  3DPL C;  4KIF A;  4B3X A;  3FXU A;  3J7Z I;  2FBI A;  1R4N B;  1WH7 A;  5LGU A;  4RGR A;  3KZZ A;  1R22 A;  2FQ4 A;  2IA0 A;  3J7Y J;  2XVC A;  2A61 A;  5C44 J;  5JFR A;  3HSE A;  3I0T A;  5F0C A;  3CLQ A;  1RPW A;  2F2E A;  4LK1 F;  4RBO A;  1RES A;  4UV8 A;  3Q9S A;  3ZMZ A;  3QRF F;  3P9C A;  4GO1 A;  1JT0 A;  3G73 A;  2NYX A;  2K9M A;  2BEO A;  4LK0 F;  2M8G X;  2K27 A;  1KZH A;  3K70 C;  4KIC A;  2CV2 A;  2EH3 A;  4N9I A;  3ABK H;  1FSE A;  2OQG A;  1QA6 A;  2W85 A;  1W7P B;  2XPV A;  3QPH A;  2Y0S N;  1XGS A;  2GAU A;  4NNJ A;  5FLM J;  3BY6 A;  2FRH A;  3GVA A;  4A3F J;  4I09 A;  2Q2E B;  3WE3 A;  5A2Q K;  2V26 A;  2FOK A;  2O8X A;  5GPC A;  3F9K A;  3M8E A;  3KP6 A;  3ML6 A;  1Y39 A;  4HDU A;  1FEX A;  1O3S A;  2M9H A;  2CFX A;  3FKI J;  5H20 A;  1MBK A;  4C2M J;  1PYV A;  4FET A;  2W57 A;  1GVJ A;  5J6X A;  2NVU B;  2DT6 A;  2IBD A;  3OIO A;  1EH7 A;  2LSO A;  4EJV A;  4GFB A;  2CQQ A;  3T8R A;  2D1H A;  4YEL A;  3EQL F;  2V6C A;  3G1O A;  4W97 A;  2KIM A;  2QUF A;  3JAM K;  2EA2 A;  2EFW A;  3PNY A;  1Z77 A;  2O3F A;  3E6C C;  1G59 A;  2R7D A;  3PUB A;  3N05 A;  3DTI A;  1U8B A;  2KJB A;  2RKH A;  2KRC A;  2DI3 A;  1LDD A;  2UV1 A;  4UVB A;  3PO3 J;  1NG6 A;  4MTE A;  1MND A;  1HW2 A;  4II3 A;  2DN0 A;  2MD5 A;  2ZSI B;  2YU9 J;  2DO7 A;  3W2V A;  2PBI A;  1JXS A;  2LY9 A;  4EV0 A;  1XG1 A;  3J80 Z;  4AIH A;  2VKD A;  1WFX A;  2LKS A;  1XSV A;  3CCV I;  1QZE A;  2PMH A;  3BG7 A;  1K78 B;  2G0E A;  1OMI A;  4PZJ A;  3RKY A;  4CCL A;  4C2T A;  4HF2 A;  3KZI C;  5ICE A;  2RQP A;  2E19 A;  5IP9 J;  3N97 A;  3OYH A;  1XC5 A;  2CUE A;  5F1R A;  4AM3 A;  4E70 A;  3VOE A;  2VL8 A;  1HQC A;  2QCO A;  1X4O A;  2M2E A;  1X4P A;  5B1B H;  4B44 A;  2H8R A;  2STT A;  2TRT A;  4I2O A;  2EZK A;  1DU6 A;  1R1U A;  2ZJ2 A;  3HYI A;  3GCM A;  2HDW A;  2R4G A;  3KEO A;  1HDP A;  4BUP A;  1S29 A;  1QU3 A;  3IAS 2;  1Y0N A;  1HOM A;  1UEL B;  1T38 A;  1AWC A;  1NK3 P;  3C1D A;  1KQ8 A;  2O9L A;  3IP4 B;  1JGS A;  4MQV A;  3CCS I;  1YQA A;  2EZI A;  4D7N A;  2ACJ A;  1L3L A;  2ZFW A;  3AG1 H;  2CQK A;  4G94 A;  1VQK I;  1IRX A;  2I5U A;  2OF7 A;  2KIQ A;  1YFH A;  1GXP A;  5DCF A;  3TO9 A;  1HLV A;  2KJC A;  4HA8 A;  1REP C;  3T1B A;  2MAB A;  1IAW A;  2IRF G;  3Q0U A;  3VOD A;  1YO5 C;  5LRS A;  2BW3 A;  4HRI A;  4IHS A;  2NOG A;  2LRD A;  2XGX A;  2H6C A;  2IAI A;  4ENJ A;  4F52 A;  1W5S A;  2IGO A;  1Y1W J;  3HRT A;  3HHG A;  1W0U A;  4KT5 C;  3IAM 2;  3M4O J;  2XRL A;  3H1C A;  4BGD A;  3K4L A;  1K7A A;  3OYC A;  2GXA A;  1YLF A;  3BQZ A;  5TGT A;  1ZK8 A;  4E4H A;  3LA7 A;  4EMS A;  1Q1H A;  2DDB A;  1JE8 A;  3ABT A;  1IN8 A;  1E3P A;  2G7U A;  1S7A A;  4A2U A;  2MH9 A;  2HVQ A;  4XIC A;  4CHU A;  2BZT A;  4BKX A;  4EQQ A;  3QPS A;  4Q48 A;  1HKQ A;  1BI1 A;  2XGE A;  1SD5 A;  2YU3 A;  3SDG A;  2YX4 A;  1BJZ A;  4AID A;  2NVT J;  4KMF A;  3V8K A;  3LSR A;  4U0Y A;  2V6E A;  4BQA A;  2RNJ A;  4L9V A;  2R7V A;  1WI3 A;  2AXL A;  1BC8 C;  1GUU A;  4DYC A;  1JHH A;  4ESB A;  4P9F A;  4U7B A;  5HVQ C;  2KFD A;  2R7S A;  1GVD A;  3CCY A;  3VSK A;  3OYM A;  3HC7 A;  1R5I D;  1BJA A;  1FMW A;  3L2V A;  1QPM A;  5EZH A;  1XD7 A;  4PJ0 C;  2CW0 F;  4M73 A;  1I1G A;  3DEU A;  3BDD A;  3WHC A;  3RKQ A;  1W36 D;  1WKM A;  2V9P A;  4HLX A;  2IT0 A;  4OIQ F;  1B72 B;  1RR7 A;  3NRV A;  3S2D J;  2ZO4 A;  3ASN H;  4LIV A;  4BEH B;  1SVL A;  3BZC A;  4XRS G;  3CJQ B;  4XKB A;  2BE5 F;  4QTR A;  3K1M A;  1IUF A;  5EGO B;  2P7C B;  1QRY A;  1YJW I;  2MFZ A;  3AG3 H;  5L3E A;  2PJR A;  2OAZ A;  1JKQ C;  1AKH A;  4XKC A;  2EFN A;  3CME I;  4ABZ A;  2W24 A;  4A12 A;  1R23 A;  5FFX A;  5DUK A;  3BCA A;  5HDG A;  4QIW N;  4DYR A;  3PIO F;  1J59 A;  3KFW X;  3H0D A;  1G2H A;  1SAU A;  4PFP A;  3M3Y J;  3S15 J;  1ZLJ A;  5AON A;  5KAF C;  1SC7 A;  2K02 A;  4I0B A;  2XAH A;  3W2W A;  5E17 F;  3FX3 A;  5FKL A;  1BI3 A;  3ECO A;  4B09 A;  2MGQ A;  2K3P A;  3CD6 I;  4GGG A;  5IYB J;  5IY5 H;  3FXL A;  4A3G J;  2YPR A;  1O7F A;  3HKZ N;  2XF7 A;  5FKN A;  1PJR A;  3BTJ A;  2V1X A;  4UY8 I;  1ITY A;  1N25 A;  2YR2 A;  3BT9 A;  3CQZ J;  1WHU A;  4A3I J;  1YI2 I;  5CQG A;  3MKL A;  4CSW A;  3R6S A;  2E7X A;  1SFX A;  4XLA A;  3RPU D;  2RAE A;  5EF6 A;  2M4G A;  1ZTR A;  2Z2S B;  3A4C A;  2MG4 A;  3IH4 A;  3QOE A;  2L9N A;  1ZAR A;  2YS9 A;  3FXJ A;  4NQW B;  1K4T A;  2X6Y A;  3A02 A;  4GRI A;  1Z1D A;  1XMX A;  4A0Z A;  3DXJ F;  5M5W J;  2E1M C;  1MBF A;  3BRO A;  3KET A;  4L5J A;  3N4M A;  2FA5 A;  1LFP A;  2E7W A;  1TT0 A;  5JVT A;  4BS9 A;  5FKM A;  3LA3 A;  2JQ7 A;  3KYL A;  5D5X B;  4UB8 C;  1WH5 A;  4M71 A;  3S8P A;  1WJC A;  3WG9 A;  3ELK A;  1ETV A;  2CQX A;  3C2H A;  4IHT A;  3K6G A;  1J75 A;  3FXQ A;  5TRD A;  2VAS A;  4PFO A;  5BMZ A;  3TBI A;  2GA2 A;  2QM3 A;  3FM5 A;  3CDL A;  2CRG A;  2Z5U A;  3G3Z A;  4OMZ A;  2L54 A;  1ZKG A;  1U6G A;  1P9Q C;  4CYC B;  3JRI A;  4FTH A;  4EJW A;  2HU9 A;  2ZME C;  1JHF A;  1QBJ A;  2IGM A;  2Y75 A;  4MQ9 F;  4RB0 A;  2COB A;  4L18 B;  4DNC A;  2ETH A;  2L4M A;  4HBL A;  2F4M B;  3ERE D;  2JA7 J;  1HA8 A;  5FJ8 J;  1T6S A;  1DPU A;  4XK4 A;  4DGW B;  5ICG A;  4E7I A;  2LMD A;  4BHB A;  1Z67 A;  3Q0W A;  4DIQ A;  2Z9O A;  2HOA A;  3SYT A;  3IL2 A;  3HTU A;  3ZN0 A;  2FBK A;  2CQN A;  4IRH A;  1ZRC A;  2HOE A;  5BS6 A;  3HZJ A;  1SFO J;  5DCM B;  2Y0S A;  1OCP A;  4E7Z A;  2HDC A;  4V2F A;  1BI2 A;  3RIR A;  3CP2 A;  4FX0 A;  1Z3Y A;  1UJ8 A;  1ZH5 A;  2K5C A;  5JHU A;  1DPR A;  5L3G A;  5CQE A;  2VLA A;  2HTS A;  3OOP A;  4DW6 A;  1B8I A;  1FOX A;  5H6Q A;  1ZGJ A;  4IX7 A;  1RIO H;  5ILS A;  1D0Z A;  2VQH A;  4AC0 A;  5D6F A;  3WTZ A;  4YEJ A;  4I98 B;  3GZN B;  3K10 A;  1LFU P;  1I3Q J;  2XF5 A;  2GIV A;  1FJL A;  3HRM A;  1Y0U A;  2FSW A;  3W2A A;  2BGC A;  2OA4 A;  2LRE A;  1TL8 A;  1CF7 B;  3R4K A;  1IRG A;  3WTS C;  1WVR A;  4BXF A;  4ZYA A;  1MDM A;  1NK2 P;  2CYY A;  1G8X A;  2W82 A;  2HYG D;  2IS6 A;  1G3W A;  4GXO A;  2Y31 A;  1YRN B;  3PFY A;  3RYR A;  5LHI A;  4II2 A;  3GTG J;  3KZY A;  4Y52 J;  4EM2 A;  3FK7 A;  4JOM A;  4X1E A;  1GV5 A;  3A0H C;  3O3K A;  4EGY A;  3A01 A;  2EBI A;  3S3N A;  2XIG A;  2A07 F;  2O0Y A;  3F22 A;  4UVC A;  1J09 A;  1O7L A;  3MVP A;  3X2Q H;  1FTT A;  4PDK A;  1G4D A;  1O3Q A;  2FD5 A;  1SVM A;  3A1Y A;  1OCO H;  5ILV A;  3TL4 X;  2Y69 H;  4WX9 A;  3COA C;  1B4A A;  2V1U A;  3ZMS A;  4ZDP A;  2DA4 A;  2PMZ N;  2RVC A;  3DBH B;  3JRG A;  2JPC A;  5E18 F;  5CVV A;  1ORK A;  3ASO H;  2G9W A;  2L7Z A;  4Y7N J;  2FXA A;  2IS1 A;  5B3S H;  4G7O F;  1BOA A;  2GXB A;  3HGG A;  4CH7 A;  3L1P A;  1IRZ A;  1EH8 A;  3TGN A;  4GDF A;  2ZXI A;  2E2I J;  2NAZ A;  4GYG A;  5LRR A;  2XB0 X;  2YUS A;  3LSH A;  2XAG A;  2DMU A;  3WTT C;  3OWT A;  2R7R A;  3BJA A;  1D5Y A;  3QWL A;  5LHH A;  3W3C A;  4JQF A;  1BIB A;  3H9Q A;  3K4J A;  2LTP A;  1FY7 A;  4RAG A;  4U0W A;  2HOT A;  1ETX A;  2H94 A;  3I58 A;  1J7K A;  3GLX A;  1AA7 A;  5HLH A;  3HG9 A;  1NG7 A;  5LGT A;  4BQQ A;  5FRO A;  1QVT A;  1FNN A;  2WAD A;  3S1N J;  2LLK A;  2HZD A;  1LDJ A;  2JA2 A;  2O8K A;  1ZGW A;  2L2O A;  1C0W A;  4JBA A;  2DQL A;  3SJM A;  1TLH B;  2VXD A;  2WB1 N;  1H8A C;  1W7P D;  5C3E J;  1SEU A;  2FEZ A;  2YX7 A;  2ZNY A;  4LLN A;  1MJ9 A;  3R0J A;  3HPH A;  3PSF A;  5M5Y J;  3HRS A;  3B6C A;  2LG4 A;  3A0B C;  2EFO A;  1HST A;  2FJ1 A;  4L5I A;  3VDX A;  3K70 D;  2QBY A;  1MMG A;  1G3S A;  3IV5 A;  2P5V A;  3IH2 A;  1Z0X A;  4IHX A;  1HKT A;  4LB6 B;  3CC4 I;  1FOW A;  1AHD P;  2KRH A;  2V9V A;  3LNQ A;  1MMN A;  4PCQ A;  3W6V A;  5JLW A;  2ZME A;  2QF7 A;  1ACI A;  3E1S A;  5J40 A;  2HVS A;  2W4S A;  4QSH A;  3PUF A;  2X6X A;  2CV0 A;  4HQM A;  1LEB A;  2MYS A;  1OR7 C;  2HQN A;  4ENK A;  4F91 B;  2QQA A;  2K40 A;  3KLN A;  2CQ7 A;  3LMM A;  1KU3 A;  4LOC A;  1U8R A;  2DMT A;  2BY2 A;  2EV6 A;  2ZSH B;  3IUO A;  1EF4 A;  2PFB A;  1ETW A;  2XHK A;  4I6Z A;  1IN7 A;  4YFK F;  3OYD A;  3EYI A;  2ZKZ A;  3BOQ A;  4C3H J;  5K1Y A;  1XTA A;  2DOE A;  1ZLK A;  3F8C A;  3OSG A;  5HLG A;  1XGM A;  1W5T A;  3EET A;  3MD2 A;  1YS7 A;  5J1R A;  1KA8 A;  5IP6 A;  3SZP A;  3VEP A;  1WJF A;  1U3E M;  4BDZ A;  5HDK A;  2Q0O A;  1T2K A;  1X3Z B;  4I0A A;  4Y13 A;  5IYC J;  5IOZ A;  2VB6 A;  3WTY C;  1ZN2 A;  4U87 A;  4HV5 A;  3GEZ A;  4F92 B;  3AAF A;  1BC7 C;  5JLX A;  5J4V A;  2HI3 A;  3RKW A;  4A0X A;  3CTA A;  2R7O A;  1MMA A;  3KP3 A;  3FIW A;  3BR5 A;  5AIP A;  2LR8 A;  4OIN F;  3GLL A; 
#chains in the Genus database with same CATH homology
 2HDW A;  2R4G A;  4BUP A;  3LSK A;  1QU3 A;  3IAS 2;  3EUK L;  4ITV A;  1OLT A;  1UEL B;  2BW3 B;  4LIU A;  4XON A;  3IP4 B;  2W1O A;  1LVK A;  4ZDO A;  1BOB A;  4E7K A;  4IQJ A;  2DCE A;  4C2U A;  1IRX A;  1VZ0 A;  3OR1 C;  3K4K A;  4CUG A;  3OIP A;  1U0J A;  3H5R A;  2CUJ A;  2M0M A;  2MAB A;  4ZTF A;  2QKL B;  2ZFU A;  1K6Y A;  4B48 A;  4RMN A;  2E5N A;  2KPM A;  2E60 A;  2BW3 A;  2LY2 A;  4CCJ A;  4ZTJ A;  4HRI A;  4R79 A;  2JSP A;  4BJ6 C;  2LRD A;  4D1Q A;  3SZG A;  4F52 A;  2IGO A;  2LOO A;  4E7L A;  3IAM 2;  4F93 B;  3NWS A;  4PK4 A;  4BGD A;  3K4L A;  3OYC A;  4QPQ A;  5TGT A;  1BR1 A;  4ANJ A;  2M7A A;  4E4H A;  1S9H A;  3QYF A;  1WJD A;  4CCO A;  2WY8 Q;  4XNF A;  1EA3 A;  2A6T A;  1R6R A;  3DEE A;  1ZEL A;  2HNH A;  2GOX B;  2HVQ A;  3H35 A;  4AVZ A;  3BC8 A;  2KLO A;  1UAA A;  3OL4 A;  3BLY A;  1BR4 A;  1T95 A;  3OYB A;  3DU5 A;  4HG2 A;  2V6E A;  3QOD A;  1WJE A;  2R7V A;  4OWR B;  2LH9 A;  3ZGK A;  4HEA 2;  3HOT A;  3HL2 A;  2F5V A;  2XDV A;  3V42 A;  1UG0 A;  3EUH C;  3HPG A;  4U7B A;  5HVQ C;  3BCB A;  1W36 C;  2R7S A;  3VWB A;  3VSK A;  3LSM A;  3PJR A;  4XKV A;  3OYM A;  3HC7 A;  4P5O A;  3CF2 A;  1FMW A;  1X19 A;  3L2V A;  1E0E A;  2XF6 A;  3SDB A;  3S32 A;  4HST A;  2PJR B;  4F55 A;  2R7Q A;  3L2U A;  2CW7 A;  2VJJ A;  3DPU A;  1W36 D;  1WJ5 A;  3EUA A;  2ELJ A;  3J7A Y;  2L5Q A;  2XAU A;  2BVL A;  4HNT A;  4LIV A;  4NC8 A;  4J00 A;  3OL3 A;  4XLH A;  1YX5 A;  4BEH B;  3EPZ A;  4XMY A;  2KHM A;  3CJQ B;  4XKB A;  2XC7 A;  1X1C A;  4XR6 A;  2CW8 A;  3DTE A;  5KNL A;  4XOT A;  5HLT A;  4XLF A;  5HNF A;  1V5G A;  4PJL A;  4XOP A;  2MFZ A;  2PJR A;  4IZZ A;  2VJ5 A;  4XKC A;  3VSL A;  2UUZ A;  2JVG A;  4E7J A;  2X1C A;  2UWM A;  3M8J A;  3BCA A;  4MLO A;  3LL7 A;  3VYU B;  3VYS B;  2CFO A;  4BEH A;  3K4B A;  4KIT B;  2NOJ B;  3CMM A;  2R7T A;  2OV7 A;  2BOL A;  2KL4 A;  3H0D A;  1SAU A;  4PFP A;  3ONQ A;  1D0Y A;  2IXS A;  2RRE A;  3RSN A;  1D1C A;  3S3M A;  3W2W A;  1MW7 A;  2DT7 B;  2DJI A;  3U21 A;  3ZXS A;  3OS0 A;  4BJT A;  2K3P A;  2F4I A;  4BJ5 C;  3OIQ A;  2LBF B;  4D9J A;  3OYK A;  2XF7 A;  4LG3 A;  1PJR A;  2OUM A;  3H5N A;  1ERD A;  3ZCO A;  2JVH A;  3MKW B;  4RLF A;  5CQG A;  4Y33 A;  2KDO A;  4CSW A;  1FMV A;  2KZV A;  3L2W A;  4XLA A;  3DLA A;  3RPU D;  2M4G A;  3AL0 B;  2Z2S B;  3A4C A;  2AQF A;  2AQE A;  2L9S A;  2L9N A;  3QOE A;  2LBF A;  2MC4 A;  4NQW B;  4XQF A;  3OYA A;  4RM2 A;  1TZL A;  3SEZ A;  2X6Y A;  2Z1D A;  4NC7 A;  3OS2 A;  2PMZ A;  4GRI A;  3OS1 A;  2E1M C;  3PSI A;  2DOA A;  1LFP A;  1TT0 A;  4C9Y A;  4FAS D;  2F6C A;  4LIT A;  4BS9 A;  5CKT A;  3DPT A;  1LDK B;  4AU7 A;  4ZDL A;  3KYL A;  3S8P A;  3TMO A;  3CP8 A;  1WJC A;  4BDY A;  3KX2 A;  3C2H A;  3K6G A;  3QYE A;  2VAS A;  4PFO A;  3TBI A;  2L7K A;  3KEY A;  3HOS A;  3MKZ A;  2W00 A;  4RM3 A;  2GOM A;  2HQA A;  2X51 A;  1P9Q C;  2VQC A;  4E7S A;  4CZC A;  2HU9 A;  1N78 A;  2IGM A;  2LC2 A;  4C30 A;  4G6T B;  3BG6 A;  3H5A A;  2CS3 A;  3OYN A;  2X85 A;  4E7H A;  1HA8 A;  2WY7 Q;  3LFU A;  3RQ4 A;  3FHN A;  2IS4 A;  2K9L A;  4NUB A;  4AYB A;  3AFH A;  3G2B A;  2I8D A;  4DGW B;  1DP3 A;  1MMD A;  4E7I A;  2WB1 A;  3OOU A;  2A5W A;  3FKJ A;  4DIQ A;  4BE1 A;  1Z21 A;  3DWL E;  3SYT A;  3K4M A;  4DBQ A;  3M1C A;  2Y0S A;  4E7Z A;  2LYC A;  1DQU A;  3CP2 A;  4HNU A;  1Z3Y A;  3S3O A;  3L2R A;  2K5C A;  3DQV C;  3FDY A;  4EAT A;  4HPQ A;  4P1W A;  2VJ4 A;  2VXZ A;  3HXL A;  3FBN B;  2WAQ A;  3A2K A;  5CQE A;  2VLA A;  1D1B A;  4IQ4 A;  2FUG 2;  2CMP A;  2JUG A;  4IX7 A;  2WA0 A;  1D0Z A;  2VQH A;  4YEJ A;  1LKX A;  2WAF A;  4XKW A;  3K10 A;  2M4K A;  2DXI A;  2XF5 A;  1X1B A;  1Z7L A;  4PUS A;  1V5E A;  3W2A A;  4CA0 A;  2Q1Z B;  2LRE A;  2VQL A;  2M7B A;  4PSW A;  1YE9 A;  2CH0 A;  2OC6 A;  2X1D A;  5KHD A;  3VYR B;  2Z16 A;  4BXF A;  1BR2 A;  1D0X A;  4ZYA A;  1JI8 A;  2X6W A;  2CV1 A;  1G8X A;  2W82 A;  2IS6 A;  3HUG B;  2O5R A;  3S93 A;  2CUZ A;  3PFY A;  4KT6 A;  4II2 A;  2R7X A;  4PJM A;  4B47 A;  5FRN A;  4ZJZ A;  4BE0 A;  4HSR A;  4JOM A;  4OAZ A;  4B43 A;  4PJN A;  1QHH D;  1N77 A;  1QHG A;  4OAY A;  4XLE A;  5LD2 C;  1SFK A;  5HOO A;  3S3N A;  1J09 A;  4F3Q A;  2VKH A;  4XLC A;  3H9J A;  2R7U A;  3UNG C;  4BAC A;  4Y4R A;  4XM3 A;  3A1Y A;  3PNT A;  3TL4 X;  2R7W A;  4ZDP A;  5LFA A;  4BU2 A;  4DBR A;  4RLQ A;  4DOZ A;  4E6K G;  1DGR M;  2P0W A;  3RTR A;  4BL0 B;  3CZ6 A;  3K4N A;  3OMY A;  4XN3 A;  2KQR A;  3SEQ A;  4YRV A;  2VIX A;  1N75 A;  1V5F A;  3HKZ A;  2LY1 A;  2M3A A;  3C2G A;  2E5Z A;  3H9G A;  4XN0 A;  4IKF A;  2IS1 A;  3L2Q A;  3OY9 A;  2HPM A;  4XL9 A;  4CH7 A;  3I3L A;  2VJI A;  1Y6I A;  3OYL A;  2ZXI A;  4CCN A;  2QKM B;  4CCK A;  3LSH A;  2E1M B;  2KP6 A;  3OWT A;  4BQO A;  2R7R A;  1X1A A;  4XOR A;  5HNH A;  2V1N A;  2VQG A;  2WAE A;  3DPL C;  4CCM A;  4B3X A;  3W3C A;  4JQF A;  3H9Q A;  3K4J A;  4QPO A;  5JHF A;  3LSI A;  2V4J C;  3QYB A;  1AA7 A;  1YX3 A;  3HG9 A;  1NG7 A;  3MKY B;  3OYJ A;  4BQQ A;  5FRO A;  3DKX A;  2WAD A;  2HZD A;  2JA2 A;  2L2O A;  3MMY B;  2VXD A;  2K9M A;  3K70 C;  2CV2 A;  3PL8 A;  3DU6 A;  2X1E A;  2BVM A;  3HPH A;  3PSF A;  2LG4 A;  4NNJ A;  3VDX A;  3K70 D;  1MMG A;  1D1A A;  5CPR B;  5KCM A;  2Q2E B;  3UR3 C;  3CES A;  2V26 A;  1DGW Y;  3F9K A;  2KRH A;  4N4N B;  4J01 A;  1MMN A;  3D5L A;  4X0G A;  3LSG A;  3E1S A;  3RCO A;  2HVS A;  2W4S A;  1PYV A;  4FET A;  4H4K C;  4N4O B;  2IGK A;  2V7F A;  3OYF A;  2DT6 A;  2X6X A;  2CV0 A;  4KJZ A;  3FBI B;  2MYS A;  1OR7 C;  2XSJ C;  1Y56 A;  4YEL A;  3E0J B;  4F91 B;  4BE2 A;  3ZR8 X;  3ZRG A;  1X1D A;  3LMM A;  2MD0 A;  3PNY A;  2ZSH B;  3IUO A;  4ZC3 A;  1G59 A;  3PUB A;  3N05 A;  3DTI A;  2KRC A;  2UV1 A;  3OYD A;  2VPL A;  1NG6 A;  2W7N A;  1MND A;  4PJJ A;  2IGN A;  1GLN A;  4II3 A;  2HPI A;  4PSX A;  2V9K A;  2ZSI B;  3VYT B;  3D5R C;  2KMU A;  3W2V A;  3AKZ A;  2ZXH A;  2IS2 A;  3DTK A;  2VKD A;  4BQN A;  1WFX A;  3D5S C;  3MD2 A;  2HVR A;  3BG7 A;  4KIS A;  3NWT A;  1WJF A;  4CCL A;  3OYE A;  1WJB A;  4C2T A;  4BDZ A;  3PNV A;  4DJA A;  3K4C A;  3CJR B;  3OYH A;  2WBM A;  2VB6 A;  1T0F C;  1Z3X A;  1WJA A;  3I9V 2;  4U87 A;  3OYG A;  4F92 B;  2VL8 A;  1KON A;  1X4O A;  1X4P A;  4B44 A;  2RQQ A;  1MNE A;  2RNG A;  4Y3O A;  3OYI A;  3ZQQ A;  3DKY A;  5FRM A;  2R7O A;  1MMA A;  3AL0 C;  3OR2 C;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...