2KZVA

Solution nmr structure of cv_0373(175-257) protein from chromobacterium violaceum, northeast structural genomics consortium target cvr118a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MPHKEKHPLQDMFTSAIEAVARDSGWAELSAVGSYLAKNDPSFDPRNWGHGRLSQMVKKLDFLTVQESRNGSKLHSEIRLRHDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of CV_0373(175-257) protein from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR118A.
rcsb
source organism Chromobacterium violaceum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kzvA01
2LY2A 3S93A 2LH9A 2KZVA 2KPMA 2LY1A 3RCOA
chains in the Genus database with same CATH superfamily
3DKXA 4G8XA 5ILUA 3CCUI 2ELKA 3FM5A 3PJRA 2DI3A 2OQRA 3V8LA 2EFQA 2WBMA 2EPFA 3LOCA 1ZG1A 3OYMA 1EF4A 1JUPA 2W48A 5FFZA 1ZHFA 5H2FC 3IL2A 3GTPJ 2WWYA 1QHHD 2MLGA 4I7HA 2KRHA 1H0MA 4EATA 2F4OB 4RGUA 2E1MB 3HOWJ 3HOVJ 2LFBA 4Q48A 1WJ5A 3HOZJ 3R61A 3DWLE 2BYVE 4R8HA 2Z16A 4U7DA 4A3IJ 2IS6A 4LG0B 3ROUA 3ZMTA 2XPVA 2ZO4A 3IWFA 2WY8Q 3N97A 4IZZA 5JHUA 4QPOA 3ZMZA 2BY0A 3FMSA 1Z1DA 2VJIA 2Y69H 2K86A 4J01A 1SVLA 4P9UA 1YJ9I 4FCYA 3K7AJ 3SEZA 2XF7A 5D8LB 3FHZA 1MSFC 2O3FA 1LQ1A 1RKTA 3I4PA 1MIJA 5K5OA 3BR6A 3NWTA 4EM1A 3BROA 2FRHA 5HDKA 3SQNA 2P7CB 3KLOA 2DU9A 1ZAOA 3CDIA 5GPAA 4IOCF 1W7PA 2FE3A 3OYAA 4A3FJ 5BPIA 3ABUA 1M1EB 1ZLKA 4CA0A 3EYIA 3GTKJ 2IGMA 1I3QJ 4L0ZB 4X6AJ 2M9HA 2M1BA 2W1OA 1WQ2A 3A0BC 3OYCA 4ZYEA 3I53A 1OMIA 3JRHA 1VQPI 3WTVC 4DGWB 1N75A 5ICGA 3CUQB 3GCMA 5CYVA 2V4JC 2P8TA 1WZ2A 1QQIA 1GV2A 3J81Z 3LA3A 1YFHA 4M3GA 2VXZA 1XG1A 4XONA 1A31A 2LYCA 1YJWI 4A3DJ 1W7PD 2F5DA 2BW3A 3MVPA 9ANTA 3GXOA 1U2WA 1S7OA 2CQKA 3MZHA 1SANA 5GAEJ 1FIAA 1B9MA 2KIMA 2QYOA 3P9IA 4ANJA 1PUEE 3CCMI 3V7SA 3VYTB 3KP5A 2RN7A 3BT9A 1LNWA 2M0CA 2CW8A 5K5RA 1XN7A 1V5GA 1PJRA 4RMNA 4BXFA 4AVZA 2DQLA 3H3UA 3Q5FA 4RB1A 1MGTA 2ZFUA 2EV6A 1TWHJ 2JPBA 3KEYA 2CW0F 2MABA 3S3MA 4HW0A 2OQGA 4WWCA 4A6DA 3HOSA 2QKLB 1OCOH 2XB0X 1ON2A 2HVSA 3ZN0A 4XBFA 1TWGJ 4GYGA 1LKXA 2ESHA 5FB2A 5IPAA 2ELJA 2LY9A 4HEA2 2UXNA 5LGTA 5CLSA 1USTA 4Z2YA 4LFUA 2JWTA 2JPCA 2TDXA 3WTZA 1D1AA 3K6GA 3MQ0A 1QU3A 3OIPA 2O5RA 4HYEA 2O9LA 3Q0WA 1PP7U 4F92B 1LFPA 1ZH5A 2R7OA 4N9HA 3F9KA 5C4XJ 2E2IJ 4E7LA 1HSTA 3TP0A 4LMYA 5HDNA 4LGWA 4OAZA 2DYSH 3MKLA 2LKXA 1QGPA 1OCPA 2FMLA 3DKWA 3JRDA 4BNCA 3SZPA 4F7ZA 2L7FP 3JAMZ 4LLNA 3BY6A 4C2MJ 1DU6A 3KP3A 4HNUA 2E71A 2QENA 4Y13A 3S2DJ 2DTRA 2L4MA 3SZTA 4TV7A 2L4AA 2ZFWA 2M3AA 1DPRA 4EJOA 3DEWA 4MGRA 3J80K 4NBQA 1TT5B 3HOTA 1IV6A 1IN4A 4F3QA 1YHQI 4U87A 1WCMJ 1R5HA 1LPQA 4IQ4A 4M74A 4B3AA 3RZDJ 1BR4A 2QSHX 4G7HF 1HKTA 3DXJF 1OKRA 3E3VA 5FD6A 2R92J 3QYBA 4RAYA 2KJBA 2VQCA 5BOXA 3R0AA 1OJLA 1OLTA 2XUBA 3HSFA 5TRDA 2JVHA 1B59A 2ZSIB 4Q4ZF 4Q47A 3B02A 3UNGC 1OYYA 3GWZA 1UHWA 4II3A 2KIFA 1IW7F 2FJ1A 2PMUA 1N25A 1D0XA 3O8GA 3E0JB 1Z6TA 1R22A 1X2NA 1F1ZA 2FQ4A 2XRLA 3FMRA 1H8AC 1V55H 3R0JA 1R1TA 3JTGA 2UWMA 2VC0A 2R0QC 3WODF 3NARA 2JSPA 1Z67A 2CV1A 4OMYA 2FSWA 3CJTB 3FM3A 1IAWA 3CF5F 5J6XA 2ZNZA 4N9IA 3VB2A 4ZTJA 3ZQGA 1KQ9A 2DLLA 2CQ7A 2KDZA 4CYDA 1D1BA 2BEOA 1EH7A 2ISZA 4LG0A 1SFEA 4DBRA 1ACIA 1D5VA 3LA7A 3ERMA 3CMMA 3J7AY 2Q0OA 4DNCA 1B72A 4EEFG 3EETA 1MBFA 2KIUA 2OPTA 4DZJA 2I5UA 4ABZA 4I09A 3GBGA 1JUSA 3F22A 4M3DA 5JI6A 5C3EJ 3SJMA 3PL8A 2MH9A 2RDPA 3ZQCA 3E5XA 4KMFA 4AYBN 3S1QJ 5IP6A 1KU9A 2B63J 1MD0A 3CP8A 2R7RA 3VODA 2VOOA 4A3JJ 3GFMA 3EQLF 3OWTA 4PJ0C 2NVQJ 4AC0A 1IXRC 3ELKA 1W7PB 3HBLA 1FSHA 5K7HA 2AO9A 5J47A 2QVOA 3PIPF 1HW1A 4P5OA 4Y52J 4PK4A 4E7KA 1BIAA 2KP6A 4CO8A 1ETKA 3X2QH 3CC2I 3ISPA 2PN6A 2CRGA 4A69C 1T39A 2GQQA 2X0LA 3GLLA 3LQRA 2XDVA 3GF2A 3HSEA 3AFHA 1K7AA 3HJEA 5CPRB 1QNTA 3WGIA 2R7VA 2Y31A 1X1DA 1K78B 3RPQA 4KNYA 5B1AH 1FYKA 3MN2A 1MJ9A 3S2WA 4S0HB 4XQFA 1W1WE 5FRNA 4LOCA 2YSRA 3LSTA 4L5JA 4L5IA 3G1MA 1U8BA 3JTHA 1IN7A 3K4JA 1QZZA 1O7LA 3K2ZA 5FGMA 1D0YA 3OIQA 2XB5A 1T95A 3PUBA 4BUPA 1AKHA 5F04A 2OA4A 1FBUA 4A3EJ 1FY7A 3LSGA 2XV4S 1JGSA 2YX7A 3HEFA 1O3SA 4EGZA 3TW7A 1QPIA 1BR1A 2EQRA 4EM0B 3HRSA 2IT0A 3CO7C 4YIRX 4XN3A 4B3XA 4K2EA 3ML6A 4JX4A 4XRSG 2EWNA 2W4SA 4XKBA 2DTZA 3VSLA 5D6FA 4UUSA 2QM3A 4IHTA 2EFNA 1P4AA 5J4VA 2O03A 4EGYA 4IHXA 4BE2A 2EFWA 2W84A 3SDGA 2OV7A 5HLHA 5FLXK 1D0ZA 1A6QA 1HKQA 1Y56A 2QQ8A 2E1OA 3QODA 3WTSC 2BE5F 5KVRA 3JRAA 4NB5A 2VIXA 1XMXA 2E5NA 2VJJA 2IJLA 2DOEA 2P5KA 1DP3A 3FXQA 3E5QA 4RB0A 4PGHA 3ZXSA 1IDZA 4XL9A 1D8KA 3QU3A 1B72B 4BAYA 3BG7A 1IGNA 3JRFA 1V5EA 2XGDA 2STTA 2ZXHA 4E7SA 5CKTA 2QQBA 3LQQA 1HW2A 3GTGJ 2WY7Q 3GEZA 4HF2A 4M3BA 2MSYA 3K1NA 2BY3A 3HKZA 4CCJA 5J1RA 4HV6A 1TNTA 5IOYA 3GFIA 2L7MP 4DJAA 3AG3H 1TLHB 1Z6RA 3N4MA 3VEPA 1WGXA 3F72A 3H36A 1T08B 1O57A 1A6IA 4KFCA 3BCAA 3FXRA 3IH4A 1ETVA 3A01B 3HC7A 1EJ9A 1A36A 4MO7A 2QBYB 3BJAA 3VDXA 1ODDA 2LKPA 5F0FA 1JGGA 1MBJA 2DA6A 4D5FA 4AIJA 1LE8A 3BJOA 3QRFF 2VT3A 3BOQA 3E6MA 2FNPA 2VT2A 2QKMB 1RNLA 1X3UA 3DLLF 3F3XA 2M87A 1SAUA 2LF7A 3D0SA 3R6SA 4XSZF 1XC5A 4ASNA 5ERIA 5J8CA 3A4CA 2VJ5A 3RSNA 2E1NA 2W24A 2V7FA 4EV0A 3VYUB 4DBQA 1STZA 2LK2A 3COAC 1FOYA 4FT8A 1YTYA 2UZKA 3I71A 4AIDA 4YEJA 2R7TA 5FKKA 2RVCA 1K6OA 5JLXA 1AKHB 4LK0F 2VJ4A 4G94A 5E1WA 3ZRGA 1VI0A 2Y30A 4I2OA 1WJBA 1B6AA 5B3SH 1W36D 3VSKA 1YITI 1BI3A 5CQGA 3IH2A 1VQMI 3L2VA 2W00A 2VKVA 2ZC2A 3ZMDA 4FX0A 1LJ9A 3OV8A 2EIMH 1DQUA 4HDUA 4WF2A 3QPHA 4JYKA 3CCQI 2G9WA 4I0AA 4U0WA 1POGA 3KYDB 5EZGA 4E7JA 1JXSA 4QWQA 2JA6J 4PZJA 1JKOC 2FF4A 4AVPA 3FXLA 5LHHA 3KETA 3IAM2 2R93J 1ZGJA 2ZMEB 5JHFA 1IC8A 2Z5UA 5BQTA 2GBYA 1LDKB 5BNGA 3OS0A 4PJNA 4H0EA 2JVGA 5D5VB 2VONA 1F5TA 3RJPA 4A3LJ 3M4OJ 2FUG2 2CFXA 2B9SA 2JT1A 4E4HA 1X1CA 1HDDC 2ZJRF 1FZPB 3TP3A 3CCYA 2PJRB 4PSWA 1Z05A 2XAQA 3AG1H 2R4GA 2EA4A 2Y75A 3BQYA 3U1KA 3S17J 2X9DA 4AU7A 3MKZA 2A5YB 2ME0A 1UZCA 1W4MA 4NQWB 4BDYA 2GZWA 3OS1A 2IS2A 2OU2A 1XGOA 5ILSA 1Y1WJ 5IYDJ 2ZXWH 2QA4I 3CUOA 5AONA 2EJRA 2EFPA 2E5ZA 4GGGA 2E36A 1Y8RB 1ETOA 3RYRA 4PUSA 3ONQA 2PLYA 4D7MA 4CYCB 1O3QA 1RR7A 3V42A 4GDFA 1VF9A 4C3HJ 2Y9ZA 3MKWB 2QBYA 6PAXA 3LAPA 1LFBA 5HLIA 1YO5C 2O6GE 1FMWA 1R5GA 3KEOA 2BY1A 3K4BA 4BYYA 3FF5A 2DN0A 3TMOA 1IJWC 3OIOA 1FOWA 4XK4A 4GRIA 4XN0A 5FKOA 2DDAA 4CSWA 1U9OA 2V6EA 3I55I 1TQMA 3BR2A 1GDTA 3CTAA 2VBZA 2MC4A 3GMEA 4HA8A 4XORA 4XLPF 2F6CA 3L2RA 5DUKA 3G71I 3H3VK 3SEQA 2GWRA 1VQ9I 3IP4B 3CO6C 5L3FA 4D5CA 2RNJA 3BLYA 1K4TA 4HAMA 4QIWN 1RC9A 5L3GA 1QHGA 1XCBA 1V54H 1VFCA 4IXAA 2DT6A 2FU4A 2M45A 1VTNC 3NAUA 4F55A 5DD4A 2ICWG 1ZR2A 1OFCX 5FLXZ 4NNJA 2E1MC 1FYMA 2EZLA 4C2TA 4EQQA 2M2EA 3RKQA 4M9ZA 4BJ6C 1PYVA 3OYGA 1AA7A 1VQ7I 1S6LA 1ETWA 5HODA 4Y17A 4HNVA 4J00A 3UR3C 1X1PA 4BJ5C 3S3OA 4KDPA 4CUGA 2ETHA 2EIKH 1JJ8C 4GCVA 2NOGA 1J5YA 3L09A 3SFIA 3JCUC 5LBQA 2DFIA 4XNFA 1XGMA 4WK8F 4E7HA 3DU5A 3WGGA 3OY9A 2Q2EB 3RPUA 1OYWA 3W2VA 2XHKA 3HB9A 1ZELA 3RZOJ 3JRBA 4F52A 4MTDA 5CVJA 1T0FA 1FTZA 4U0YA 3MWMA 3TO7A 2GXBA 3H9GA 1BOBA 3W6VA 4EJWA 1O4XA 5FROA 5D5XB 2VBXA 3EUKL 2V6CA 3WE2A 2DMPA 3QPLA 5HOOA 2LLKA 2HOTA 4XLFA 2F5EA 3WTYC 4KYWA 2CWEA 3OYFA 4E7IA 2GA1A 3F21A 2GXGA 4L9JA 1EA3A 2HWVA 2MG4A 3QYEA 3A01A 1SVOA 2X48A 3CUQC 3K9TA 1QVUA 3FZVA 1TW3A 5EG0B 4CZCA 2E7WA 4BY7J 1QBJA 1SD6A 4ETSA 4XLNF 2NVXJ 4HV5A 4A3MJ 3OL4A 3MZ8A 1Z7LA 2LRDA 5DV5A 1FJLA 1AHDP 5FD5A 2WADA 5B66C 4IQJA 1R49A 3HPGA 1YYVA 4WXHA 4DQ2A 3RKWA 1G6NA 3G6EI 3WE3A 1I27A 1NH3A 2ZB9A 4XLEA 3U1DA 1X19A 2XRNA 2CUEA 1K83J 2D2WA 2K9SA 2Y48A 4D9JA 2CG4A 4QPQA 2P6TA 5A2QZ 3S15J 2F48A 2K9NA 3GX4X 1S7EA 4PJJA 3O3KA 2AXTC 2OJED 3HGGA 2X4HA 3UKGA 3E6BA 1FPQA 2JJ7A 2HTSA 4KT5C 3V4GA 2DFFA 1QZYA 3H5AA 2DYRH 3ZN1A 5FO5A 1QVTA 1HOMA 4A12A 4A6EA 1MBEA 1S5LC 1PUFA 3QP5A 1X58A 5HLTA 3DPUA 1MH4A 3OYDA 2HVRA 2DK5A 1SC7A 2IPQX 2LKSA 1MH3A 2KIQA 4XLCA 4Y33A 5DM6F 3OYNA 5L3DA 1RR8C 2H6BA 2KFDA 4XRFA 2R7DA 3U2RA 4JQFA 3W2WA 1V3FA 3G73A 1JKRC 2VKDA 5K7FA 3VPRA 2HNHA 4YIIA 4KISA 1GVJA 1Z9CA 1KYWA 3GVAA 1RIOH 2K4JA 2MC3A 3M8EA 2VE8A 2EZIA 2BXZA 1RUNA 1TC3C 3LMMA 2VASA 3JSPA 1H88C 4ZJZA 3G1LA 1JTYA 3KZYA 1JJ6C 2ZJ2A 4KA4A 2IAIA 3IKVA 4ZYHA 4ON0A 5TGTA 4HBLA 1E2XA 3CJRB 2P4WA 4OIRF 2XIGA 3ZQIA 2QSGX 2XF6A 4L18B 5J8FA 2V9VA 3M9AA 2M4KA 4G7OF 3LWFA 2NOJB 3ZQFA 4YFNF 2GA2A 3LAJA 2H09A 1I1SA 4RM2A 1MBHA 2FBKA 1TWCJ 3OYEA 4WXDA 1FLIA 3HRMA 4NQWA 2XAHA 5FKLA 1I3AA 4HQMA 4KIGA 1BIBA 2IBDA 2VOPA 1BR2A 2K7LA 2O7OA 2STWA 5K1YA 3IAS2 3GTOJ 3M1EA 2KJCA 1Y0NA 2HXIA 1HKSA 2A6HF 2RNGA 3FKIJ 1I6XA 2COBA 3ZMVA 1ZR4A 2X85A 1BA5A 2B7EA 3DBRB 3GUDA 1FX7A 2MBFA 5JFRA 3PO3J 4N0BA 4CXFA 5M5WJ 4BE0A 3ABKH 3DKYA 5EG0A 4S04A 4M9SA 3AAFA 4IHVA 1YW7A 3ERED 4HF0A 4L5EA 3ULQB 4XOPA 4C9YA 4GFBA 3BZCA 3P5JA 3FWEA 4CYCA 3H3ZA 4MFDA 2KZGA 2XKPA 4ZYAA 2PEXA 4UUTA 2QSFX 2OUMA 3TDUC 1Z7UA 4XMYA 2MW8A 1O3RA 1KQ8A 1MJBA 2NYXA 4U88A 4R79A 2A05A 4D1QA 3KX2A 1IN6A 1A04A 3CMAI 2QLZA 2NVUB 3EYYA 3DV8A 3HDDA 5DDGA 2O8KA 3SHFA 5E3MA 3C3WA 3K1MA 5DCMA 2VB6A 3T1BA 1TP4A 2JK3A 3HKZN 3E6CC 4A3GJ 4GXOA 3REOA 4EMSA 3C2GA 3BR1A 4A0YA 1BI0A 1LVAA 2M0MA 3GO5A 1VQKI 2ZXJA 3MCZA 4PFOA 4QLCU 2ELHA 2X1EA 5LLQA 1WHUA 5HNFA 3L00A 3CC7I 3OYIA 1PDNC 2L2OA 3WHCA 2FD5A 1WJEA 1ZG3A 5TJJA 3TBIA 3RPUD 3CCEI 4Z6YA 2HXOA 1JHFA 3A1YA 3BR0A 5A2QK 4F93B 1YIJI 3ZMUA 4BGDA 4FQGA 4UVCA 2CUJA 2YX4A 1QZEA 1R6RA 2NAZA 4BKXA 2HDWA 2CQXA 5M5YJ 3H1CA 1FSEA 3Q3SA 4BXUA 3RYPA 2EINH 5IY5H 1JTXA 2OCEA 3HYIA 1XS9A 3B73A 3PM1A 4XM3A 1W0TA 3WTTC 1I39A 4M6XA 4EJTA 4UY8I 5KAFC 2XGXA 5DTDA 2CSOA 1T98A 3JW4A 4C2UA 1FYLA 1QO0D 5E1XA 1FNNA 3ZP5A 4AUXA 4NC8A 3TO6A 3VYRB 3BZKA 2OBPA 4MEYF 5F08A 4BS9A 2CS3A 3ASNH 4EJVA 5IYCJ 2YUSA 3S93A 5FLVA 2GOMA 4L0YB 3K4CA 3OR1C 2M34A 4FTHA 1B8IB 1EKEA 3ZQLA 4UB8C 2IGKA 1MJAA 1XPXA 1HW5A 3E7LA 2YU3A 3S2HJ 3DBLB 1YRNB 2ID3A 3FK7A 1G3WA 5H6RA 1W0UA 3S14J 4AIHA 2E2JJ 3TEDA 1BI2A 3JRCA 2N8GA 1HCRA 2PMHA 2BVMA 1YQAA 1GXPA 3QPSA 2DO7A 1X4PA 1WVRA 2IGNA 5JR3A 1IDYA 4PJLA 1LDDA 2K27A 2IGOA 3A02A 1HC8A 5IP9J 2DA4A 2ECBA 4A0ZA 1JKQC 4QSHA 2MH2A 2P5LC 1P92A 2LREA 4A3CJ 5JVGF 2ME6A 2L9VA 3K1PA 5DYMA 5E8IA 4MFEA 1ORKA 1OR7C 4IRGA 1P7IA 1FBSA 4U0VA 2GOXB 3HOYJ 5CVIA 1IV8A 1ZRDA 1XDSA 1FP1D 2KISA 2VLAA 5BPDA 3T0YA 1PUFB 3WTUC 2NS8A 3Q9VA 2LD5A 2M8EA 1SFOJ 1ITYA 4BE1A 5DD8A 1FBQA 2P6SA 3WU0A 2VUMJ 2V9KA 3L9FA 3J7AO 4KN4X 3ZOBA 2QF7A 1X1BA 1F36A 1J09A 3G4SI 1HXDA 5AIQA 3MEXA 2PFBA 4RLQA 2IEKA 3HRUA 5IOZA 3OMYA 2DA3A 1EH6A 1MBGA 4BQQA 1YIOA 1P4WA 4ENNA 1OCCH 1PP8F 2M8GX 2XC7A 3IKTA 4B47A 4MLOA 4IHSA 3FIWA 3SFZA 2RGVA 4DYRA 1XSDA 4YFKF 3BTCA 3MKYB 1K4SA 3HGYA 3RCOA 2K3PA 4UVBA 2ZCWA 4MQ9F 4RDUA 1SFXA 2YPRA 4ZC3A 2FNAA 3LNQA 4ENKA 1U5TC 4NC7A 3LSJA 1ZLJA 2L01A 5LHIA 3ABLH 1U9NA 4IOAF 1U78A 5BMZA 4UB6C 4XRMA 3RIRA 1ZRCA 4B09A 1LE8B 3BTIA 2HU9A 2FEZA 4I02A 4HX4A 1N77A 5FRMA 1LEBA 4KT6A 2LMDA 1G3SA 2BHZA 3AG2H 4DYQA 2RQQA 5E3OA 1UCRA 1K61A 2FMYA 4UHTA 1YE9A 5CQEA 2XAUA 5M3MJ 3IUOA 2WV1A 3K0LA 4KICA 1OCTC 1G59A 1J75A 1WI9A 2NXNB 1MDMA 1RUOA 3S1NJ 1FEXA 1SEUA 4L9VA 1IO2A 4BDZA 2V26A 2DMUA 2JTVA 2KLOA 4BEHB 5GADJ 3ZGKA 4IO9F 3DQVC 2FBHA 2EV5A 2HOAA 3ZPLA 2X51A 2ZJQF 2OF7A 3L2CA 1UHSA 3IWZA 5FKMA 3VOEA 1FTTA 3F8MA 2G7UA 4IX7A 2LP0A 3T5XA 4M9XA 3BPXA 2R5YB 1S8NA 3GW2A 1CQTA 1F9NA 4R1HA 1KU7A 1NHAA 4OIQF 3QPTA 3F8CA 2A5WA 5E8GA 5DCMB 3V7RA 1WJAA 2O8XA 1DGRM 4G9YA 3GFJA 1I6HJ 1E17A 1ZYRF 2CU7A 2KKOA 3K70C 3RKYA 4CCLA 2M30A 1WJFA 4HZFA 1XX5A 2Z9OA 4HRIA 2CMPA 4M73A 4P1WA 1SD5A 3L2WA 2MGQA 3P7NA 2HKXA 1GVDA 2AS5F 3KYCB 2UXXA 2A07F 4LB5A 3J7ZI 1ZGWA 4A5MA 3K4KA 1S3JA 2VQHA 2L02A 2WV0A 1TQPA 3KP7A 1W5CC 1B4AA 1X2MA 5E20A 2DPDA 2LDUA 1P9QC 1Y6IA 1VQ4I 1RZ4A 2KL4A 3I3LA 1HF0A 2WAFA 4B8XA 3F6OA 1IRFA 3CCVI 1ONVA 1MMAA 2DA5A 1JUMA 2OC6A 2XPUA 3FMQA 3ABMH 5D5UB 1YOVB 1TQIA 3H0DA 2BOLA 3FXMA 5DS9A 5K7ZA 2BHYA 4RAFA 2JQ7A 1C0WA 1DPUA 3GYHX 2R5ZA 1NTCA 3PFYA 4O3MA 2WB1A 2LSOA 4XICA 5KCMA 3KE2A 2OZ6A 2G7HA 1FIPA 4AM3A 2JN6A 3OYLA 5F0HA 2HOSA 4ESBA 4CGZA 2EILH 2Y0SA 1YRNA 3OOUA 3QOEA 2I8DA 5H20A 4PGGA 1WFXA 1T6SA 3BG5A 3C18A 3TO9A 1VZ0A 4MQVA 5IT9Z 1JT6A 2JUCA 4I6ZA 3I59B 3AKZA 3J7YJ 2K40A 2CV0A 3NQOA 3KYLA 2DMQA 3I4MJ 3QP6A 4IRHA 4HG2A 2DJIA 2ZSHB 5FKNA 5ED4A 3PIOF 4OOIA 1S7AA 3VYSB 3LSKA 3KP4A 2Y9YA 3R60A 1VQ8I 2GIZA 4UNOA 2IW5A 4UUVA 2UUZA 2DT7B 5DCFA 1IUFA 3BTJA 1EH8A 3PQJA 3N05A 4KIFA 4RGXA 2HQAA 3CCLI 2OAZA 4I01A 1G3TA 2EIJH 3FDYA 3HPHA 2HZTA 3B6CA 2R7FA 3CP2A 4XKVA 2Z33A 3AL0C 2Q8KA 3J80Z 2EZKA 2ADUA 2WTEA 2QWWA 3KP6A 3IC7A 3OYKA 2ACJA 1WRJA 1NG7A 3IHUA 4JOMA 5M3FJ 4DZPA 2LH9A 2H27A 4BHBA 2HS5A 4M3FA 5BS6A 3JRIA 3ESWB 2KHMA 2VQLA 1V5FA 2NS7A 1B9NA 5H6QA 5GTHC 3S16J 1UFMA 4BQNA 2RREA 2X6YA 1E3HA 2VKEA 1UMQA 1I50J 3DU6A 2XKOA 4WXCA 5LGNA 2WC2A 5LEKA 2HPMA 3MD2A 3S3NA 3JRGA 3S1MJ 2NVTJ 4XKWA 4UVAA 2G0EA 2D1VA 3JREA 1F4KA 1U5TA 1K78A 4HSTA 1BJZA 1I5ZA 1TTYA 4RB3C 1P6RA 3CD6I 1MKMA 1Z21A 2DBBA 3DCFA 1TL8A 3ECHA 1GT0C 3ZQQA 1T8IA 2EA2A 2ECCA 5D4SA 1J0RA 3RDIA 4B44A 1AWCA 5K5QA 1BJAA 5HS8A 2LF8A 2PJRA 1LFUP 3FXUA 3M1CA 3FXKA 1D3YA 3PNVA 4CCKA 1IF1A 2CW7A 2HYGD 3PNTA 2BGCA 2DODA 3D5SC 2DK8A 3BP8A 1ZN2A 1HQCA 2P5VA 2CH0A 1IUYA 2EZHA 2W25A 2AQEA 1H9GA 1W5TA 4ZYGA 4HF1A 1XSXA 2LBFB 4BEHA 1TNSA 2Q2EA 1MMDA 3K4NA 2CV2A 1KU2A 2VQGA 4LIVA 5J1UA 2R7QA 3G1OA 4BH9A 1OPCA 4X0GA 1REPC 4UUSB 1T2KA 3I56I 2WAQN 1H89C 4HNTA 3QWLA 4V19K 2NVYJ 2K85A 1BC7C 3V8KA 2CFOA 2HVQA 3P9CA 3FK6A 2VC1A 3KZIC 4ZZLA 2MFZA 5EJCA 4B48A 3H35A 3DPTA 4RS8A 4C30A 4FASD 2M7AA 2GM4A 4XSXF 1KA8A 5TISC 2DA2A 1OCZH 1GLNA 1O7FA 2AHQA 3WG9A 2YS9A 1RI7A 2W57A 3G3ZA 3VWBA 5JVTA 3LSRA 1J9IA 3GTMJ 2P0WA 3EUAA 2F5VA 4RB2C 3QU6A 1BW6A 4DW6A 1R00A 3IV5A 5ICCA 2ISYA 4MHGA 1FOXA 4RBOA 1SFKA 1J2XA 1UG0A 2LNBA 4NDLA 5D6EA 4EJUA 1NK3P 1JKPC 4Q5SF 3EUHA 2K4BA 1KQ0A 3DEUA 2LY2A 2K9QA 1XD7A 5F64A 5EZHA 1R36A 3RQ4A 1X4OA 2R5YA 1BI1A 2JA5J 2O61A 3JR9A 1DGWY 2ZKZA 2XGCA 3PSFA 2R7WA 1FP2A 4IVNA 3ZQ7A 1FOKA 2CGPA 3HZJA 2FX0A 4YELA 1G2HA 4CZZA 1ON1A 3CZ6A 4OWRB 3B6AA 1U0JA 1WJDA 2JRTA 3CESA 1S9HA 2QQ9A 4HQEA 2FOKA 4NUBA 5EEAA 4X1EA 4XLHA 5ILVA 1OISA 2A3SA 1UHMA 2EBIA 4LJZF 2WAQA 2KMUA 2EH3A 3RTRA 2IA1A 3LA2A 2HQ5A 3I59A 3S32A 3CLOA 3ECOA 2BY2A 2GLOA 4BBSJ 2NNNA 3CCJI 2ZBKA 1YLFA 3LL7A 1TZLA 1J7KA 1JHHA 4O6JA 2LR8A 2TCTA 2EV0A 3H92A 3SXYA 2JUGA 3VFZA 4MEXF 1NG6A 3M07A 1IRXA 2BZTA 2Y0SN 3TDZC 1DP7P 5F27A 3RI4A 3C1DA 5IT9K 1OYIA 1ULYA 5E79C 2J5PA 3HTSB 1R1VA 4NHJA 2NNYA 2ZNYA 4B1RA 1EV7A 1L0OC 4HX8A 4AYBA 1YI2I 4HX7A 1O3TA 1BBYA 1DUXC 1AU7A 1UJ8A 4OINF 2Q1ZB 3W3CA 5FJ8J 4J19A 4KUMA 3MZYA 1W5SA 4II2A 4PDKA 3H9JA 1YX3A 5ICEA 1T0FC 3A0HC 5EGOA 3DTEA 5CJ9A 3WU1B 1Z0XA 5KHDA 1ETQA 2LVSA 2VBYA 3DTKA 1T56A 1BOAA 1ZK8A 4F91B 4BJTA 3P9KA 2LG4A 3F8BA 1GXQA 2H1LA 5LGUA 3SZGA 4ITVA 2I10A 2Z3YA 1YG2A 1SVMA 2WB1N 4OU0A 1Q1VA 1Y0UA 3FKJA 3KPHA 2COMA 2CJJA 2PMZN 1ENHA 2EFOA 1WJCA 2FXAA 2HTJA 2DCEA 1SMYF 2M5WA 2CO5A 4BHCA 2JSCA 3Q0UA 2AQFA 3RKXA 4ZZDA 4LK1F 5C44J 4N4OB 1U5TB 2P81A 2FBIA 4MNUA 1G8XA 1T33A 5E3LA 2K9LA 4P96A 3M8JA 4IPAA 4L9TA 1FC3A 4IEJA 4P9FA 3U9GA 3GLXA 3TL4X 2ZJPF 5GAGJ 4LB6B 1U3EM 4JP0A 4RM3A 4RLFA 1ZRFA 2O0YA 2H8RA 2K5CA 5DEQA 3OYBA 2IS1A 3S8PA 2BXYA 2JA8J 1R7JA 1UG2A 2OCCH 4OIPF 3CF2A 2DMNA 3R4KA 3FBNB 2DOAA 3WTXC 2R7XA 3BR3A 5D8KB 1P4XA 1HA8A 1D8JA 1T38A 2XASA 4A5NA 4LLLA 1S29A 2HEOA 4OIOF 3CCRI 1XB4A 1I1GA 3K4LA 2XSDC 2HDCA 2OD5A 3KP2A 1MNEA 4ESFA 1XGNA 4WX9A 3D1NI 3NEUA 4M72A 4BL0B 5ICFA 3M7GA 1N78A 2JA2A 3OL3A 3DF8A 3HG9A 4A3KJ 1SAXA 3L1PA 1WSUA 4XIDA 2FA5A 1CGPA 1X3WB 2QGUA 1YW8A 4BACA 3ZMSA 3I5UA 2LC2A 1FWZA 5IYBJ 2P7VB 2PI0A 1GV5A 1BW5A 1R9TJ 2L3DA 2DA7A 1Y1VJ 4DYCA 2XROA 5B1BH 4IRIA 5F0CA 2L7ZA 4M3EA 4P55A 4IL6C 5DUIA 3CDLA 3V8JA 3CQZJ 2DFEA 2A69F 1LDJA 2HR3A 5J3LA 4BXXJ 3DTIA 2HZDA 5GTIC 2VI6A 4EVIA 1G4DA 4C3JJ 2R3SA 4RA2A 4V2GA 4BY1J 2W85A 4DIQA 2GAUA 3HUGB 1UAAA 2PBIA 5D4RA 1B8IA 1RETA 5DM7F 3E1SA 4KITB 1R4MB 4RGRA 3TW6A 2PX9A 2V1DA 3ASOH 2D45A 5KK1A 3HL2A 5L3CA 4I99C 5E17F 5IP7J 1G3YA 3GZ6A 1JT0A 4CH7A 2KRCA 1MMSA 2HYJA 1WKMA 2WA0A 1R23A 4I76A 2Z1DA 4E70A 1K6YA 2MYSA 3KIOA 5F1RA 1LUJB 5KAIC 3O2PE 3LSHA 3IRQA 4JX6A 3CMEI 2VBWA 3DPLC 4RAGA 3SYTA 3FXOA 3I58A 4CCOA 3BPVA 2V1XA 3I9V2 4D7NA 4YIFA 5LRSA 1UELB 4MIMA 4YFXF 2XPWA 3A2KA 2IA0A 3IRRA 1V4RA 1ZARA 2K3FA 5GAHJ 3L2UA 1WH5A 3DBHB 3V7CA 3TQNA 3MMYB 1D1CA 2MD0A 5HNHA 2HDDA 2DFHA 4BQAA 3OYHA 2R7UA 2XAFA 3QYFA 4XOTA 2XGEA 4ZDPA 4I0BA 3CLQA 2IA2A 3E5UA 1S72I 3HHHA 3KLNA 4GO1A 4ZH4F 3K10A 4G6DA 3OR2C 3BDDA 2RV8A 3F6VA 1TWAJ 4ENMA 3DLAA 3H9QA 1VQ5I 3WHBA 3W6JB 1R5ID 5HLGA 1NK2P 3CCSI 4ZDOA 3QAHA 1B1BA 2FQ3A 5LRRA 3C7JA 3PQKA 4CDGA 4HPQA 4A0XA 4H4KC 1MBKA 4V2FA 2L7KA 2F4IA 4HSRA 1R71A 4DOZA 2QEXI 1IG7A 2EK5A 3BG6A 2M4GA 2ZXIA 3GZ5A 2PQ8A 3HTUA 3JSOA 2XF5A 4IKFA 4RGSA 4A2UA 2J5OA 2C6YA 2X1CA 2A68F 2JRMA 1QPMA 1Y39A 1YX5A 1LVKA 2H6CA 2RC4A 4PCQA 3HXLA 3SDBA 1E3PA 2VL8A 3PNYA 1VQOI 1DU0A 5GPCA 1SD7A 1MNDA 1XSVA 1XDUA 3JAMK 3FX3A 1E3OC 4YRVA 5JLWA 3AG4H 5EGOB 2XAGA 2PMZA 3IH3A 4LD5A 2LTPA 2UV1A 3FHNA 3BTLA 1LB2A 4E6KG 3W2AA 4IF4A 3G2BA 2RQPA 3HM5A 3FXJA 3K70D 4N4NB 1ERDA 1HLVA 2KQRA 3O8HA 4A93J 4BBRJ 2QUFA 2VXDA 2HKOA 2CQQA 1U6GA 2DT5A 2RAEA 2V1NA 3HUGA 1MDMB 4AD9A 3D5LA 1YS6A 3O6BB 2E34A 4PJMA 3L7WA 1A5JA 1APLC 1DDNA 3PSIA 3WG7H 2Y0MA 3BZ6A 4UXNA 1K79A 1QA6A 1P7JA 2E2HJ 1ZKGA 2KDOA 2VKHA 2GIVA 5HS9A 4C3IJ 3MFKA 2R7ZJ 4KN7X 3EPZA 1BN5A 4HDVA 2X6WA 2MLKA 2W7NA 4FETA 2PJPA 2V1UA 3OSFA 2ID6A 3QOPA 2VN2A 2QQAA 3LFKA 4G6QA 4XLAA 3HSRA 1WPKA 2VE9A 1IRZA 2MD5A 3DFGA 3TGNA 1ZGAA 1PVEA 3WU2C 1Z91A 5CVUA 2JMWA 4KJZA 4U7BA 2VODA 2A6EF 1TT0A 1GHCA 4HOBA 4HLXA 5B5EC 1X3ZB 1H9TA 2DA1A 4Y15A 1TBXA 2IRFG 3OOPA 4W1UA 1XMKA 1RKWA 2HPIA 4L9NA 1W36C 4G7ZF 1HDPA 2CYYA 2E1CA 1ZG5A 4BQOA 1VQLI 5F6FA 1R4NB 2L0KA 2E35A 3PFIA 4XRSA 2W82A 4LLGF 1XMAA 2X6OA 4FISA 3HRTA 3Q9SA 3OYJA 1R1UA 4LITA 2L54A 3CJQB 2OTJI 4M6VA 3BR5A 3E6DA 1IXSB 4I98B 4CCMA 3C2HA 2H1KA 4S05A 5F1JA 1E0EA 2IS4A 4UV8A 1J59A 4PFPA 1FMVA 1MSEC 4NC6A 4IJAA 5LHGA 3LFUA 2NRAC 2Z2SB 1CF7B 2KT0A 2KZVA 3BG3A 3Q0VA 4KMUX 1GUUA 2VPRA 3GTQJ 3L2QA 3DP7A 1IN8A 2R7SA 3BQZA 4M71A 3U21A 3WGHA 2DQRA 2KRFA 1Z77A 4JK1X 1IN5A 3F0CA 1RRJA 1LEAA 1MZBA 3BC8A 4GYIA 4HLYA 5J1YA 2HFHA 4G12A 2L9NA 2QZ8A 5EDNA 5KNLA 4XR6A 1BL0A 2L5QA 5E1ZB 1MMNA 1U8RA 2XAJA 2K9MA 1F43A 2HGCA 2ESNA 2LOOA 5E18F 2XVCA 2DMTA 5AIPA 4ZYDA 1BC8C 2E60A 2V9PA 3EUHC 1KZHA 5L3EA 2DW4A 2BVLA 3K2AA 2NS0A 1KGSA 2QCOA 2JA7J 4FX4A 3OSGA 3M8FA 3ZR8X 2OTLI 5E3NA 1VNDA 2KPMA 5EF6A 3T8RA 1FT9A 1ZREA 1Z3XA 3CC4I 4FE7A 4KIBA 4E7ZA 2RKHA 2R5ZB 1MW7A 2B0LA 3I64A 4PSXA 2ZMEC 3W6KB 5CVVA 3I0TA 4D0PA 4ENJA 3TOAA 4OMZA 2YU9J 3I4NJ 3BJ6A 4AWXB 4JBAA 3LSIA 5J4YA 3GZNB 3HIFA 5HS7A 4BU2A 3PO2J 4O5VA 3AL0B 3CJNA 3BWGA 3CDHA 4A3BJ 2X6XA 4RAZA 4IHWA 1WI3A 2IVMA 2F2EA 5EEGA 2PG4A 5LFAA 2DPUA 3J81K 2HOEA 5D5WB 2D1HA 1XTAA 5LEJA 3C2BA 1OR7A 3F23A 3ABTA 1R58A 2ZMEA 3F8NA 3ZCOA 1USSA 1YJNI 5HDGA 2TRTA 2Z99A 1KU3A 3GFLA 4YG2F 5FLMJ 1HSJA 5GP9A 2A61A 4AIKA 4CHUA 3S1RJ 2AXLA 2E19A 3EDPA 2WAEA 3KCCA 4OAYA 1VQNI 3HHGA 1TW2A 4Y4RA 3I54A 4BHPA 1Z3YA 2E7XA 2BW3B 2K02A 3MAJA 4Y7NJ 4ESJA 1AOYA 5M5XJ 2HQRA 2HYFA 2CUZA 1SD4A 2FOWA 3FBIB 2JZYA 1XCVA 3CMYA 2F5CA 3PUFA 5J40A 1D5YA 1IZ1A 1TWFJ 3RQIA 3H5RA 3HOUJ 3TOBA 4G6TB 4XKCA 2DDBA 4IHYA 2Y2ZA 1QRYA 1RPWA 4LIUA 4W97A 1IRGA 3FISA 2HI3A 3LSPA 2V79A 4JX5A 2BBYA 2M7BA 1WH7A 2DJNA 2L9SA 3H5NA 5EYRA 2CUFA 1BM9A 5L3BA 3BCBA 5LD2C 5EEHA 4LG3A 4QTRA 3F8FA 3D5RC 3BG9A 1JE8A 3E97A 2F5FA 1X1AA 2H94A 4M6YA 1YW9A 3K69A 1OQYA 5FFXA 4B43A 3GTLJ 1IXCA 3KFWX 3ZQHA 3HOXJ 5C4JJ 1XGSA 4EM2A 2BV6A 3WTWC 2X1DA 1SMTA 1RESA 1KYZA 1L3LA 4ZTFA 3K4MA 2YR2A 3QQAA 2MA3A 1SFUA 5CVRA 3DEEA 1Y8QB 2DAOA 3KEQA 4CCNA 3CUQA 2LY1A 1WWXA 4CICA 1VQ6I 1ZTRA 5IT3A 2VPLA 3NRVA 1UB9A 1JI8A 2EB7A 2A6TA 3TKYA 3M3YJ 1HBXG 3A03A 5HVQC 3H0GJ 1CF7A 1ETYA 4UV9A 2L9RA 1OCRH 2LBFA 4WCGA 1YS7A 1Q1HA 3NWSA 1KONA 2HQNA 1MNMC 1ZQ3P 3LSMA 3OS2A 1ETXA 2CQNA 4MTEA 3GTJJ 2D5VA 2DXIA 4FHTA 2DOFA 2F4MB 2H8WA 4B4CA 1MMGA 2GXAA 4Y3OA 4ZDLA 1A35A 3KZZA 2XSJC 3T8TA 2IP2A 2IXSA 2OZUA 1P2FA 4FE4A
chains in the Genus database with same CATH topology
3DKXA 3OS0A 4NC7A 3PJRA 4PJNA 2WBMA 2JVGA 2FUG2 3OYMA 4E4HA 1X1CA 2HU9A 5FRMA 1N77A 1QHHD 4KT6A 2PJRB 3DTIA 4PSWA 2KRHA 2HZDA 4EATA 2R4GA 2RQQA 2E1MB 4AU7A 1YE9A 3MKZA 5CQEA 2XAUA 1WJ5A 3IUOA 3DWLE 4DIQA 4NQWB 4BDYA 3OS1A 2Z16A 2IS6A 2IS2A 3HUGB 1G59A 1UAAA 2WY8Q 3E1SA 4KITB 4IZZA 4QPOA 4BDZA 2E5ZA 2V26A 2KLOA 4BEHB 3ZGKA 2VJIA 4PUSA 4J01A 3DQVC 3ONQA 2X51A 3HL2A 3V42A 3SEZA 2XF7A 4IX7A 3MKWB 3NWTA 4CH7A 1FMWA 2KRCA 2WA0A 3K4BA 2Z1DA 3TMOA 4GRIA 1K6YA 2MYSA 4XN0A 4CSWA 3OYAA 2A5WA 2V6EA 3LSHA 1WJAA 4CA0A 1DGRM 2IGMA 2MC4A 3K70C 3DPLC 4XORA 4CCLA 2W1OA 3OYCA 2F6CA 1WJFA 3L2RA 3SYTA 4CCOA 3SEQA 4HRIA 2CMPA 3IP4B 3I9V2 1N75A 4P1WA 4DGWB 1UELB 3L2WA 2V4JC 3A2KA 3BLYA 3L2UA 2VXZA 3K4KA 2VQHA 1QHGA 4XONA 2LYCA 3MMYB 1D1CA 2BW3A 2MD0A 2DT6A 5HNHA 1P9QC 1Y6IA 2KL4A 3I3LA 2WAFA 4F55A 3OYHA 2R7UA 3QYFA 4XOTA 4ZDPA 1MMAA 4ANJA 4NNJA 2E1MC 2OC6A 3VYTB 4C2TA 3H0DA 3K10A 2BOLA 2CW8A 4BJ6C 1PYVA 1V5GA 1AA7A 1PJRA 3OR2C 3OYGA 4RMNA 4J00A 4BXFA 3DLAA 3H9QA 3UR3C 4AVZA 4BJ5C 3S3OA 4CUGA 3PFYA 2WB1A 5KCMA 4ZDOA 2ZFUA 4HPQA 4XNFA 3KEYA 4H4KC 3OYLA 4E7HA 2L7KA 2F4IA 2MABA 3DU5A 4HSRA 2Q2EB 3OY9A 3S3MA 4DOZA 2Y0SA 3HOSA 2QKLB 3OOUA 3QOEA 2I8DA 3BG6A 3W2VA 2HVSA 2M4GA 1WFXA 1ZELA 2ZXIA 1LKXA 2XF5A 4F52A 4IKFA 2ELJA 1VZ0A 4HEA2 2X1CA 1YX5A 1LVKA 3H9GA 3AKZA 3HXLA 1BOBA 3SDBA 1D1AA 3K6GA 1QU3A 2VL8A 3PNYA 2CV0A 5FROA 3OIPA 3KYLA 3EUKL 2O5RA 1MNDA 5HOOA 4F92B 1LFPA 4HG2A 2DJIA 4XLFA 2ZSHB 2R7OA 4YRVA 3OYFA 4E7IA 3F9KA 3VYSB 2PMZA 3LSKA 1EA3A 4E7LA 3QYEA 2UV1A 3FHNA 4E6KG 3W2AA 2UUZA 2DT7B 4OAZA 3G2BA 3K70D 4N4NB 1ERDA 4CZCA 2KQRA 3N05A 2HQAA 2VXDA 2V1NA 3D5LA 3FDYA 3HPHA 4HNUA 3CP2A 4XKVA 3OL4A 4PJMA 3AL0C 1Z7LA 2LRDA 3PSIA 3OYKA 2WADA 1NG7A 2M3AA 4IQJA 4JOMA 3HPGA 2KDOA 2VKHA 3HOTA 2LH9A 4XLEA 4F3QA 1X19A 3EPZA 2KHMA 4D9JA 4U87A 4QPQA 2VQLA 1V5FA 4IQ4A 2X6WA 2W7NA 4FETA 1BR4A 4PJJA 4XLAA 4BQNA 2RREA 2X6YA 3QYBA 3DU6A 2HPMA 2VQCA 3H5AA 3MD2A 1OLTA 3S3NA 2JVHA 2ZSIB 4XKWA 4KJZA 4U7BA 3UNGC 1TT0A 4II3A 5HLTA 3DPUA 3OYDA 4HSTA 2HVRA 1D0XA 4XLCA 1Z21A 4Y33A 3OYNA 2HPIA 1W36C 3E0JB 3ZQQA 3W2WA 4JQFA 4B44A 2VKDA 4BQOA 2HNHA 4KISA 2UWMA 2PJRA 2JSPA 2W82A 3M1CA 2CV1A 3PNVA 4CCKA 3OYJA 2CW7A 4LITA 3CJQB 3LMMA 2VASA 4ZJZA 4ZTJA 3PNTA 3D5SC 4CCMA 3C2HA 1D1BA 1E0EA 2IS4A 4DBRA 4PFPA 5TGTA 1FMVA 2CH0A 3CMMA 3CJRB 3J7AY 2AQEA 2XF6A 2M4KA 3LFUA 2Z2SB 2LBFB 4BEHA 2KZVA 2NOJB 1MMDA 3GBGA 3K4NA 2CV2A 2VQGA 4LIVA 3L2QA 3PL8A 2R7SA 2R7QA 4RM2A 3U21A 3OYEA 4X0GA 3CP8A 2R7RA 3BC8A 3OWTA 4HNTA 1BR2A 3IAS2 2L9NA 2CFOA 2HVQA 5KNLA 4XR6A 2MFZA 4B48A 2L5QA 3H35A 3DPTA 1MMNA 4C30A 2K9MA 2RNGA 2M7AA 4P5OA 4FASD 4PK4A 4E7KA 2KP6A 2X85A 1GLNA 2LOOA 3VWBA 4BE0A 2XDVA 3DKYA 2P0WA 3AFHA 3EUAA 5CPRB 2F5VA 2R7VA 2E60A 3EUHC 1X1DA 2BVLA 4XOPA 4C9YA 1SFKA 1UG0A 4XQFA 5FRNA 3ZR8X 4ZYAA 2KPMA 2LY2A 2OUMA 3RQ4A 4XMYA 1X4OA 1Z3XA 3K4JA 4R79A 1D0YA 3OIQA 4D1QA 3KX2A 1DGWY 3PSFA 4E7ZA 1MW7A 1T95A 3PUBA 4PSXA 4BUPA 2R7WA 2VB6A 4YELA 3LSGA 3C2GA 3CZ6A 4OWRB 3LSIA 1U0JA 2M0MA 1WJDA 3CESA 1S9HA 4PFOA 4NUBA 2X1EA 1BR1A 4BU2A 4XLHA 5HNFA 3OYIA 4XN3A 4B3XA 2L2OA 2WAQA 2KMUA 3AL0B 3RTRA 2X6XA 1WJEA 2W4SA 3TBIA 4XKBA 3RPUD 3S32A 5LFAA 3A1YA 3VSLA 4F93B 3LL7A 1TZLA 4BGDA 2CUJA 2JUGA 1R6RA 1NG6A 1IRXA 3ZCOA 2HDWA 4BE2A 2OV7A 1D0ZA 1Y56A 3QODA 2WAEA 2VIXA 4XM3A 2E5NA 4OAYA 2VJJA 4AYBA 4Y4RA 1Z3YA 4C2UA 2BW3B 1DP3A 3ZXSA 2Q1ZB 4XL9A 4NC8A 3W3CA 3VYRB 2CUZA 3BG7A 4BS9A 2CS3A 3FBIB 1V5EA 2ZXHA 4II2A 3H9JA 4E7SA 1YX3A 1T0FC 3S93A 5CKTA 2GOMA 3DTEA 3H5RA 2WY7Q 3K4CA 5KHDA 3OR1C 4G6TB 3DTKA 4XKCA 3HKZA 4F91B 4CCJA 4BJTA 4LIUA 2LG4A 2IGKA 3SZGA 4ITVA 4DJAA 2M7BA 2L9SA 3H5NA 3FKJA 3BCAA 1WJCA 3BCBA 3HC7A 4LG3A 5LD2C 3D5RC 2DCEA 3VDXA 2BVMA 2AQFA 1X4PA 1X1AA 2IGNA 4N4OB 4PJLA 4B43A 2IGOA 1G8XA 2K9LA 2X1DA 2QKMB 3M8JA 4ZTFA 3K4MA 2LREA 1SAUA 3TL4X 4RM3A 4RLFA 3DEEA 1OR7C 2IS1A 2K5CA 3OYBA 3A4CA 2VJ5A 3S8PA 2GOXB 3RSNA 4CCNA 2LY1A 2V7FA 3VYUB 3CF2A 4DBQA 3FBNB 2VLAA 2DOAA 2VPLA 2R7XA 1HA8A 4YEJA 2R7TA 4BE1A 2V9KA 2VJ4A 1JI8A 1X1BA 2A6TA 1J09A 3K4LA 3ZRGA 5HVQC 1WJBA 2LBFA 4RLQA 1W36D 3VSKA 3NWSA 1MNEA 1KONA 3OMYA 5CQGA 4BQQA 4BL0B 3L2VA 1N78A 2JA2A 3OL3A 2W00A 2XC7A 3HG9A 3LSMA 3OS2A 1DQUA 4B47A 4E7JA 4MLOA 2DXIA 1MMGA 3MKYB 4Y3OA 4ZDLA 4BACA 3IAM2 2LC2A 3RCOA 2K3PA 2XSJC 5JHFA 2IXSA 4ZC3A 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY2 A;  3S93 A;  2LH9 A;  2KZV A;  2KPM A;  2LY1 A;  3RCO A; 
#chains in the Genus database with same CATH topology
 3DKX A;  4G8X A;  5ILU A;  3CCU I;  2ELK A;  3FM5 A;  3PJR A;  2DI3 A;  2OQR A;  3V8L A;  2EFQ A;  2WBM A;  2EPF A;  3LOC A;  1ZG1 A;  3OYM A;  1EF4 A;  1JUP A;  2W48 A;  5FFZ A;  1ZHF A;  5H2F C;  3IL2 A;  3GTP J;  2WWY A;  1QHH D;  2MLG A;  4I7H A;  2KRH A;  1H0M A;  4EAT A;  2F4O B;  4RGU A;  2E1M B;  3HOW J;  3HOV J;  2LFB A;  4Q48 A;  1WJ5 A;  3HOZ J;  3R61 A;  3DWL E;  2BYV E;  4R8H A;  2Z16 A;  4U7D A;  4A3I J;  2IS6 A;  4LG0 B;  3ROU A;  3ZMT A;  2XPV A;  2ZO4 A;  3IWF A;  2WY8 Q;  3N97 A;  4IZZ A;  5JHU A;  4QPO A;  3ZMZ A;  2BY0 A;  3FMS A;  1Z1D A;  2VJI A;  2Y69 H;  2K86 A;  4J01 A;  1SVL A;  4P9U A;  1YJ9 I;  4FCY A;  3K7A J;  3SEZ A;  2XF7 A;  5D8L B;  3FHZ A;  1MSF C;  2O3F A;  1LQ1 A;  1RKT A;  3I4P A;  1MIJ A;  5K5O A;  3BR6 A;  3NWT A;  4EM1 A;  3BRO A;  2FRH A;  5HDK A;  3SQN A;  2P7C B;  3KLO A;  2DU9 A;  1ZAO A;  3CDI A;  5GPA A;  4IOC F;  1W7P A;  2FE3 A;  3OYA A;  4A3F J;  5BPI A;  3ABU A;  1M1E B;  1ZLK A;  4CA0 A;  3EYI A;  3GTK J;  2IGM A;  1I3Q J;  4L0Z B;  4X6A J;  2M9H A;  2M1B A;  2W1O A;  1WQ2 A;  3A0B C;  3OYC A;  4ZYE A;  3I53 A;  1OMI A;  3JRH A;  1VQP I;  3WTV C;  4DGW B;  1N75 A;  5ICG A;  3CUQ B;  3GCM A;  5CYV A;  2V4J C;  2P8T A;  1WZ2 A;  1QQI A;  1GV2 A;  3J81 Z;  3LA3 A;  1YFH A;  4M3G A;  2VXZ A;  1XG1 A;  4XON A;  1A31 A;  2LYC A;  1YJW I;  4A3D J;  1W7P D;  2F5D A;  2BW3 A;  3MVP A;  9ANT A;  3GXO A;  1U2W A;  1S7O A;  2CQK A;  3MZH A;  1SAN A;  5GAE J;  1FIA A;  1B9M A;  2KIM A;  2QYO A;  3P9I A;  4ANJ A;  1PUE E;  3CCM I;  3V7S A;  3VYT B;  3KP5 A;  2RN7 A;  3BT9 A;  1LNW A;  2M0C A;  2CW8 A;  5K5R A;  1XN7 A;  1V5G A;  1PJR A;  4RMN A;  4BXF A;  4AVZ A;  2DQL A;  3H3U A;  3Q5F A;  4RB1 A;  1MGT A;  2ZFU A;  2EV6 A;  1TWH J;  2JPB A;  3KEY A;  2CW0 F;  2MAB A;  3S3M A;  4HW0 A;  2OQG A;  4WWC A;  4A6D A;  3HOS A;  2QKL B;  1OCO H;  2XB0 X;  1ON2 A;  2HVS A;  3ZN0 A;  4XBF A;  1TWG J;  4GYG A;  1LKX A;  2ESH A;  5FB2 A;  5IPA A;  2ELJ A;  2LY9 A;  4HEA 2;  2UXN A;  5LGT A;  5CLS A;  1UST A;  4Z2Y A;  4LFU A;  2JWT A;  2JPC A;  2TDX A;  3WTZ A;  1D1A A;  3K6G A;  3MQ0 A;  1QU3 A;  3OIP A;  2O5R A;  4HYE A;  2O9L A;  3Q0W A;  1PP7 U;  4F92 B;  1LFP A;  1ZH5 A;  2R7O A;  4N9H A;  3F9K A;  5C4X J;  2E2I J;  4E7L A;  1HST A;  3TP0 A;  4LMY A;  5HDN A;  4LGW A;  4OAZ A;  2DYS H;  3MKL A;  2LKX A;  1QGP A;  1OCP A;  2FML A;  3DKW A;  3JRD A;  4BNC A;  3SZP A;  4F7Z A;  2L7F P;  3JAM Z;  4LLN A;  3BY6 A;  4C2M J;  1DU6 A;  3KP3 A;  4HNU A;  2E71 A;  2QEN A;  4Y13 A;  3S2D J;  2DTR A;  2L4M A;  3SZT A;  4TV7 A;  2L4A A;  2ZFW A;  2M3A A;  1DPR A;  4EJO A;  3DEW A;  4MGR A;  3J80 K;  4NBQ A;  1TT5 B;  3HOT A;  1IV6 A;  1IN4 A;  4F3Q A;  1YHQ I;  4U87 A;  1WCM J;  1R5H A;  1LPQ A;  4IQ4 A;  4M74 A;  4B3A A;  3RZD J;  1BR4 A;  2QSH X;  4G7H F;  1HKT A;  3DXJ F;  1OKR A;  3E3V A;  5FD6 A;  2R92 J;  3QYB A;  4RAY A;  2KJB A;  2VQC A;  5BOX A;  3R0A A;  1OJL A;  1OLT A;  2XUB A;  3HSF A;  5TRD A;  2JVH A;  1B59 A;  2ZSI B;  4Q4Z F;  4Q47 A;  3B02 A;  3UNG C;  1OYY A;  3GWZ A;  1UHW A;  4II3 A;  2KIF A;  1IW7 F;  2FJ1 A;  2PMU A;  1N25 A;  1D0X A;  3O8G A;  3E0J B;  1Z6T A;  1R22 A;  1X2N A;  1F1Z A;  2FQ4 A;  2XRL A;  3FMR A;  1H8A C;  1V55 H;  3R0J A;  1R1T A;  3JTG A;  2UWM A;  2VC0 A;  2R0Q C;  3WOD F;  3NAR A;  2JSP A;  1Z67 A;  2CV1 A;  4OMY A;  2FSW A;  3CJT B;  3FM3 A;  1IAW A;  3CF5 F;  5J6X A;  2ZNZ A;  4N9I A;  3VB2 A;  4ZTJ A;  3ZQG A;  1KQ9 A;  2DLL A;  2CQ7 A;  2KDZ A;  4CYD A;  1D1B A;  2BEO A;  1EH7 A;  2ISZ A;  4LG0 A;  1SFE A;  4DBR A;  1ACI A;  1D5V A;  3LA7 A;  3ERM A;  3CMM A;  3J7A Y;  2Q0O A;  4DNC A;  1B72 A;  4EEF G;  3EET A;  1MBF A;  2KIU A;  2OPT A;  4DZJ A;  2I5U A;  4ABZ A;  4I09 A;  3GBG A;  1JUS A;  3F22 A;  4M3D A;  5JI6 A;  5C3E J;  3SJM A;  3PL8 A;  2MH9 A;  2RDP A;  3ZQC A;  3E5X A;  4KMF A;  4AYB N;  3S1Q J;  5IP6 A;  1KU9 A;  2B63 J;  1MD0 A;  3CP8 A;  2R7R A;  3VOD A;  2VOO A;  4A3J J;  3GFM A;  3EQL F;  3OWT A;  4PJ0 C;  2NVQ J;  4AC0 A;  1IXR C;  3ELK A;  1W7P B;  3HBL A;  1FSH A;  5K7H A;  2AO9 A;  5J47 A;  2QVO A;  3PIP F;  1HW1 A;  4P5O A;  4Y52 J;  4PK4 A;  4E7K A;  1BIA A;  2KP6 A;  4CO8 A;  1ETK A;  3X2Q H;  3CC2 I;  3ISP A;  2PN6 A;  2CRG A;  4A69 C;  1T39 A;  2GQQ A;  2X0L A;  3GLL A;  3LQR A;  2XDV A;  3GF2 A;  3HSE A;  3AFH A;  1K7A A;  3HJE A;  5CPR B;  1QNT A;  3WGI A;  2R7V A;  2Y31 A;  1X1D A;  1K78 B;  3RPQ A;  4KNY A;  5B1A H;  1FYK A;  3MN2 A;  1MJ9 A;  3S2W A;  4S0H B;  4XQF A;  1W1W E;  5FRN A;  4LOC A;  2YSR A;  3LST A;  4L5J A;  4L5I A;  3G1M A;  1U8B A;  3JTH A;  1IN7 A;  3K4J A;  1QZZ A;  1O7L A;  3K2Z A;  5FGM A;  1D0Y A;  3OIQ A;  2XB5 A;  1T95 A;  3PUB A;  4BUP A;  1AKH A;  5F04 A;  2OA4 A;  1FBU A;  4A3E J;  1FY7 A;  3LSG A;  2XV4 S;  1JGS A;  2YX7 A;  3HEF A;  1O3S A;  4EGZ A;  3TW7 A;  1QPI A;  1BR1 A;  2EQR A;  4EM0 B;  3HRS A;  2IT0 A;  3CO7 C;  4YIR X;  4XN3 A;  4B3X A;  4K2E A;  3ML6 A;  4JX4 A;  4XRS G;  2EWN A;  2W4S A;  4XKB A;  2DTZ A;  3VSL A;  5D6F A;  4UUS A;  2QM3 A;  4IHT A;  2EFN A;  1P4A A;  5J4V A;  2O03 A;  4EGY A;  4IHX A;  4BE2 A;  2EFW A;  2W84 A;  3SDG A;  2OV7 A;  5HLH A;  5FLX K;  1D0Z A;  1A6Q A;  1HKQ A;  1Y56 A;  2QQ8 A;  2E1O A;  3QOD A;  3WTS C;  2BE5 F;  5KVR A;  3JRA A;  4NB5 A;  2VIX A;  1XMX A;  2E5N A;  2VJJ A;  2IJL A;  2DOE A;  2P5K A;  1DP3 A;  3FXQ A;  3E5Q A;  4RB0 A;  4PGH A;  3ZXS A;  1IDZ A;  4XL9 A;  1D8K A;  3QU3 A;  1B72 B;  4BAY A;  3BG7 A;  1IGN A;  3JRF A;  1V5E A;  2XGD A;  2STT A;  2ZXH A;  4E7S A;  5CKT A;  2QQB A;  3LQQ A;  1HW2 A;  3GTG J;  2WY7 Q;  3GEZ A;  4HF2 A;  4M3B A;  2MSY A;  3K1N A;  2BY3 A;  3HKZ A;  4CCJ A;  5J1R A;  4HV6 A;  1TNT A;  5IOY A;  3GFI A;  2L7M P;  4DJA A;  3AG3 H;  1TLH B;  1Z6R A;  3N4M A;  3VEP A;  1WGX A;  3F72 A;  3H36 A;  1T08 B;  1O57 A;  1A6I A;  4KFC A;  3BCA A;  3FXR A;  3IH4 A;  1ETV A;  3A01 B;  3HC7 A;  1EJ9 A;  1A36 A;  4MO7 A;  2QBY B;  3BJA A;  3VDX A;  1ODD A;  2LKP A;  5F0F A;  1JGG A;  1MBJ A;  2DA6 A;  4D5F A;  4AIJ A;  1LE8 A;  3BJO A;  3QRF F;  2VT3 A;  3BOQ A;  3E6M A;  2FNP A;  2VT2 A;  2QKM B;  1RNL A;  1X3U A;  3DLL F;  3F3X A;  2M87 A;  1SAU A;  2LF7 A;  3D0S A;  3R6S A;  4XSZ F;  1XC5 A;  4ASN A;  5ERI A;  5J8C A;  3A4C A;  2VJ5 A;  3RSN A;  2E1N A;  2W24 A;  2V7F A;  4EV0 A;  3VYU B;  4DBQ A;  1STZ A;  2LK2 A;  3COA C;  1FOY A;  4FT8 A;  1YTY A;  2UZK A;  3I71 A;  4AID A;  4YEJ A;  2R7T A;  5FKK A;  2RVC A;  1K6O A;  5JLX A;  1AKH B;  4LK0 F;  2VJ4 A;  4G94 A;  5E1W A;  3ZRG A;  1VI0 A;  2Y30 A;  4I2O A;  1WJB A;  1B6A A;  5B3S H;  1W36 D;  3VSK A;  1YIT I;  1BI3 A;  5CQG A;  3IH2 A;  1VQM I;  3L2V A;  2W00 A;  2VKV A;  2ZC2 A;  3ZMD A;  4FX0 A;  1LJ9 A;  3OV8 A;  2EIM H;  1DQU A;  4HDU A;  4WF2 A;  3QPH A;  4JYK A;  3CCQ I;  2G9W A;  4I0A A;  4U0W A;  1POG A;  3KYD B;  5EZG A;  4E7J A;  1JXS A;  4QWQ A;  2JA6 J;  4PZJ A;  1JKO C;  2FF4 A;  4AVP A;  3FXL A;  5LHH A;  3KET A;  3IAM 2;  2R93 J;  1ZGJ A;  2ZME B;  5JHF A;  1IC8 A;  2Z5U A;  5BQT A;  2GBY A;  1LDK B;  5BNG A;  3OS0 A;  4PJN A;  4H0E A;  2JVG A;  5D5V B;  2VON A;  1F5T A;  3RJP A;  4A3L J;  3M4O J;  2FUG 2;  2CFX A;  2B9S A;  2JT1 A;  4E4H A;  1X1C A;  1HDD C;  2ZJR F;  1FZP B;  3TP3 A;  3CCY A;  2PJR B;  4PSW A;  1Z05 A;  2XAQ A;  3AG1 H;  2R4G A;  2EA4 A;  2Y75 A;  3BQY A;  3U1K A;  3S17 J;  2X9D A;  4AU7 A;  3MKZ A;  2A5Y B;  2ME0 A;  1UZC A;  1W4M A;  4NQW B;  4BDY A;  2GZW A;  3OS1 A;  2IS2 A;  2OU2 A;  1XGO A;  5ILS A;  1Y1W J;  5IYD J;  2ZXW H;  2QA4 I;  3CUO A;  5AON A;  2EJR A;  2EFP A;  2E5Z A;  4GGG A;  2E36 A;  1Y8R B;  1ETO A;  3RYR A;  4PUS A;  3ONQ A;  2PLY A;  4D7M A;  4CYC B;  1O3Q A;  1RR7 A;  3V42 A;  4GDF A;  1VF9 A;  4C3H J;  2Y9Z A;  3MKW B;  2QBY A;  6PAX A;  3LAP A;  1LFB A;  5HLI A;  1YO5 C;  2O6G E;  1FMW A;  1R5G A;  3KEO A;  2BY1 A;  3K4B A;  4BYY A;  3FF5 A;  2DN0 A;  3TMO A;  1IJW C;  3OIO A;  1FOW A;  4XK4 A;  4GRI A;  4XN0 A;  5FKO A;  2DDA A;  4CSW A;  1U9O A;  2V6E A;  3I55 I;  1TQM A;  3BR2 A;  1GDT A;  3CTA A;  2VBZ A;  2MC4 A;  3GME A;  4HA8 A;  4XOR A;  4XLP F;  2F6C A;  3L2R A;  5DUK A;  3G71 I;  3H3V K;  3SEQ A;  2GWR A;  1VQ9 I;  3IP4 B;  3CO6 C;  5L3F A;  4D5C A;  2RNJ A;  3BLY A;  1K4T A;  4HAM A;  4QIW N;  1RC9 A;  5L3G A;  1QHG A;  1XCB A;  1V54 H;  1VFC A;  4IXA A;  2DT6 A;  2FU4 A;  2M45 A;  1VTN C;  3NAU A;  4F55 A;  5DD4 A;  2ICW G;  1ZR2 A;  1OFC X;  5FLX Z;  4NNJ A;  2E1M C;  1FYM A;  2EZL A;  4C2T A;  4EQQ A;  2M2E A;  3RKQ A;  4M9Z A;  4BJ6 C;  1PYV A;  3OYG A;  1AA7 A;  1VQ7 I;  1S6L A;  1ETW A;  5HOD A;  4Y17 A;  4HNV A;  4J00 A;  3UR3 C;  1X1P A;  4BJ5 C;  3S3O A;  4KDP A;  4CUG A;  2ETH A;  2EIK H;  1JJ8 C;  4GCV A;  2NOG A;  1J5Y A;  3L09 A;  3SFI A;  3JCU C;  5LBQ A;  2DFI A;  4XNF A;  1XGM A;  4WK8 F;  4E7H A;  3DU5 A;  3WGG A;  3OY9 A;  2Q2E B;  3RPU A;  1OYW A;  3W2V A;  2XHK A;  3HB9 A;  1ZEL A;  3RZO J;  3JRB A;  4F52 A;  4MTD A;  5CVJ A;  1T0F A;  1FTZ A;  4U0Y A;  3MWM A;  3TO7 A;  2GXB A;  3H9G A;  1BOB A;  3W6V A;  4EJW A;  1O4X A;  5FRO A;  5D5X B;  2VBX A;  3EUK L;  2V6C A;  3WE2 A;  2DMP A;  3QPL A;  5HOO A;  2LLK A;  2HOT A;  4XLF A;  2F5E A;  3WTY C;  4KYW A;  2CWE A;  3OYF A;  4E7I A;  2GA1 A;  3F21 A;  2GXG A;  4L9J A;  1EA3 A;  2HWV A;  2MG4 A;  3QYE A;  3A01 A;  1SVO A;  2X48 A;  3CUQ C;  3K9T A;  1QVU A;  3FZV A;  1TW3 A;  5EG0 B;  4CZC A;  2E7W A;  4BY7 J;  1QBJ A;  1SD6 A;  4ETS A;  4XLN F;  2NVX J;  4HV5 A;  4A3M J;  3OL4 A;  3MZ8 A;  1Z7L A;  2LRD A;  5DV5 A;  1FJL A;  1AHD P;  5FD5 A;  2WAD A;  5B66 C;  4IQJ A;  1R49 A;  3HPG A;  1YYV A;  4WXH A;  4DQ2 A;  3RKW A;  1G6N A;  3G6E I;  3WE3 A;  1I27 A;  1NH3 A;  2ZB9 A;  4XLE A;  3U1D A;  1X19 A;  2XRN A;  2CUE A;  1K83 J;  2D2W A;  2K9S A;  2Y48 A;  4D9J A;  2CG4 A;  4QPQ A;  2P6T A;  5A2Q Z;  3S15 J;  2F48 A;  2K9N A;  3GX4 X;  1S7E A;  4PJJ A;  3O3K A;  2AXT C;  2OJE D;  3HGG A;  2X4H A;  3UKG A;  3E6B A;  1FPQ A;  2JJ7 A;  2HTS A;  4KT5 C;  3V4G A;  2DFF A;  1QZY A;  3H5A A;  2DYR H;  3ZN1 A;  5FO5 A;  1QVT A;  1HOM A;  4A12 A;  4A6E A;  1MBE A;  1S5L C;  1PUF A;  3QP5 A;  1X58 A;  5HLT A;  3DPU A;  1MH4 A;  3OYD A;  2HVR A;  2DK5 A;  1SC7 A;  2IPQ X;  2LKS A;  1MH3 A;  2KIQ A;  4XLC A;  4Y33 A;  5DM6 F;  3OYN A;  5L3D A;  1RR8 C;  2H6B A;  2KFD A;  4XRF A;  2R7D A;  3U2R A;  4JQF A;  3W2W A;  1V3F A;  3G73 A;  1JKR C;  2VKD A;  5K7F A;  3VPR A;  2HNH A;  4YII A;  4KIS A;  1GVJ A;  1Z9C A;  1KYW A;  3GVA A;  1RIO H;  2K4J A;  2MC3 A;  3M8E A;  2VE8 A;  2EZI A;  2BXZ A;  1RUN A;  1TC3 C;  3LMM A;  2VAS A;  3JSP A;  1H88 C;  4ZJZ A;  3G1L A;  1JTY A;  3KZY A;  1JJ6 C;  2ZJ2 A;  4KA4 A;  2IAI A;  3IKV A;  4ZYH A;  4ON0 A;  5TGT A;  4HBL A;  1E2X A;  3CJR B;  2P4W A;  4OIR F;  2XIG A;  3ZQI A;  2QSG X;  2XF6 A;  4L18 B;  5J8F A;  2V9V A;  3M9A A;  2M4K A;  4G7O F;  3LWF A;  2NOJ B;  3ZQF A;  4YFN F;  2GA2 A;  3LAJ A;  2H09 A;  1I1S A;  4RM2 A;  1MBH A;  2FBK A;  1TWC J;  3OYE A;  4WXD A;  1FLI A;  3HRM A;  4NQW A;  2XAH A;  5FKL A;  1I3A A;  4HQM A;  4KIG A;  1BIB A;  2IBD A;  2VOP A;  1BR2 A;  2K7L A;  2O7O A;  2STW A;  5K1Y A;  3IAS 2;  3GTO J;  3M1E A;  2KJC A;  1Y0N A;  2HXI A;  1HKS A;  2A6H F;  2RNG A;  3FKI J;  1I6X A;  2COB A;  3ZMV A;  1ZR4 A;  2X85 A;  1BA5 A;  2B7E A;  3DBR B;  3GUD A;  1FX7 A;  2MBF A;  5JFR A;  3PO3 J;  4N0B A;  4CXF A;  5M5W J;  4BE0 A;  3ABK H;  3DKY A;  5EG0 A;  4S04 A;  4M9S A;  3AAF A;  4IHV A;  1YW7 A;  3ERE D;  4HF0 A;  4L5E A;  3ULQ B;  4XOP A;  4C9Y A;  4GFB A;  3BZC A;  3P5J A;  3FWE A;  4CYC A;  3H3Z A;  4MFD A;  2KZG A;  2XKP A;  4ZYA A;  2PEX A;  4UUT A;  2QSF X;  2OUM A;  3TDU C;  1Z7U A;  4XMY A;  2MW8 A;  1O3R A;  1KQ8 A;  1MJB A;  2NYX A;  4U88 A;  4R79 A;  2A05 A;  4D1Q A;  3KX2 A;  1IN6 A;  1A04 A;  3CMA I;  2QLZ A;  2NVU B;  3EYY A;  3DV8 A;  3HDD A;  5DDG A;  2O8K A;  3SHF A;  5E3M A;  3C3W A;  3K1M A;  5DCM A;  2VB6 A;  3T1B A;  1TP4 A;  2JK3 A;  3HKZ N;  3E6C C;  4A3G J;  4GXO A;  3REO A;  4EMS A;  3C2G A;  3BR1 A;  4A0Y A;  1BI0 A;  1LVA A;  2M0M A;  3GO5 A;  1VQK I;  2ZXJ A;  3MCZ A;  4PFO A;  4QLC U;  2ELH A;  2X1E A;  5LLQ A;  1WHU A;  5HNF A;  3L00 A;  3CC7 I;  3OYI A;  1PDN C;  2L2O A;  3WHC A;  2FD5 A;  1WJE A;  1ZG3 A;  5TJJ A;  3TBI A;  3RPU D;  3CCE I;  4Z6Y A;  2HXO A;  1JHF A;  3A1Y A;  3BR0 A;  5A2Q K;  4F93 B;  1YIJ I;  3ZMU A;  4BGD A;  4FQG A;  4UVC A;  2CUJ A;  2YX4 A;  1QZE A;  1R6R A;  2NAZ A;  4BKX A;  2HDW A;  2CQX A;  5M5Y J;  3H1C A;  1FSE A;  3Q3S A;  4BXU A;  3RYP A;  2EIN H;  5IY5 H;  1JTX A;  2OCE A;  3HYI A;  1XS9 A;  3B73 A;  3PM1 A;  4XM3 A;  1W0T A;  3WTT C;  1I39 A;  4M6X A;  4EJT A;  4UY8 I;  5KAF C;  2XGX A;  5DTD A;  2CSO A;  1T98 A;  3JW4 A;  4C2U A;  1FYL A;  1QO0 D;  5E1X A;  1FNN A;  3ZP5 A;  4AUX A;  4NC8 A;  3TO6 A;  3VYR B;  3BZK A;  2OBP A;  4MEY F;  5F08 A;  4BS9 A;  2CS3 A;  3ASN H;  4EJV A;  5IYC J;  2YUS A;  3S93 A;  5FLV A;  2GOM A;  4L0Y B;  3K4C A;  3OR1 C;  2M34 A;  4FTH A;  1B8I B;  1EKE A;  3ZQL A;  4UB8 C;  2IGK A;  1MJA A;  1XPX A;  1HW5 A;  3E7L A;  2YU3 A;  3S2H J;  3DBL B;  1YRN B;  2ID3 A;  3FK7 A;  1G3W A;  5H6R A;  1W0U A;  3S14 J;  4AIH A;  2E2J J;  3TED A;  1BI2 A;  3JRC A;  2N8G A;  1HCR A;  2PMH A;  2BVM A;  1YQA A;  1GXP A;  3QPS A;  2DO7 A;  1X4P A;  1WVR A;  2IGN A;  5JR3 A;  1IDY A;  4PJL A;  1LDD A;  2K27 A;  2IGO A;  3A02 A;  1HC8 A;  5IP9 J;  2DA4 A;  2ECB A;  4A0Z A;  1JKQ C;  4QSH A;  2MH2 A;  2P5L C;  1P92 A;  2LRE A;  4A3C J;  5JVG F;  2ME6 A;  2L9V A;  3K1P A;  5DYM A;  5E8I A;  4MFE A;  1ORK A;  1OR7 C;  4IRG A;  1P7I A;  1FBS A;  4U0V A;  2GOX B;  3HOY J;  5CVI A;  1IV8 A;  1ZRD A;  1XDS A;  1FP1 D;  2KIS A;  2VLA A;  5BPD A;  3T0Y A;  1PUF B;  3WTU C;  2NS8 A;  3Q9V A;  2LD5 A;  2M8E A;  1SFO J;  1ITY A;  4BE1 A;  5DD8 A;  1FBQ A;  2P6S A;  3WU0 A;  2VUM J;  2V9K A;  3L9F A;  3J7A O;  4KN4 X;  3ZOB A;  2QF7 A;  1X1B A;  1F36 A;  1J09 A;  3G4S I;  1HXD A;  5AIQ A;  3MEX A;  2PFB A;  4RLQ A;  2IEK A;  3HRU A;  5IOZ A;  3OMY A;  2DA3 A;  1EH6 A;  1MBG A;  4BQQ A;  1YIO A;  1P4W A;  4ENN A;  1OCC H;  1PP8 F;  2M8G X;  2XC7 A;  3IKT A;  4B47 A;  4MLO A;  4IHS A;  3FIW A;  3SFZ A;  2RGV A;  4DYR A;  1XSD A;  4YFK F;  3BTC A;  3MKY B;  1K4S A;  3HGY A;  3RCO A;  2K3P A;  4UVB A;  2ZCW A;  4MQ9 F;  4RDU A;  1SFX A;  2YPR A;  4ZC3 A;  2FNA A;  3LNQ A;  4ENK A;  1U5T C;  4NC7 A;  3LSJ A;  1ZLJ A;  2L01 A;  5LHI A;  3ABL H;  1U9N A;  4IOA F;  1U78 A;  5BMZ A;  4UB6 C;  4XRM A;  3RIR A;  1ZRC A;  4B09 A;  1LE8 B;  3BTI A;  2HU9 A;  2FEZ A;  4I02 A;  4HX4 A;  1N77 A;  5FRM A;  1LEB A;  4KT6 A;  2LMD A;  1G3S A;  2BHZ A;  3AG2 H;  4DYQ A;  2RQQ A;  5E3O A;  1UCR A;  1K61 A;  2FMY A;  4UHT A;  1YE9 A;  5CQE A;  2XAU A;  5M3M J;  3IUO A;  2WV1 A;  3K0L A;  4KIC A;  1OCT C;  1G59 A;  1J75 A;  1WI9 A;  2NXN B;  1MDM A;  1RUO A;  3S1N J;  1FEX A;  1SEU A;  4L9V A;  1IO2 A;  4BDZ A;  2V26 A;  2DMU A;  2JTV A;  2KLO A;  4BEH B;  5GAD J;  3ZGK A;  4IO9 F;  3DQV C;  2FBH A;  2EV5 A;  2HOA A;  3ZPL A;  2X51 A;  2ZJQ F;  2OF7 A;  3L2C A;  1UHS A;  3IWZ A;  5FKM A;  3VOE A;  1FTT A;  3F8M A;  2G7U A;  4IX7 A;  2LP0 A;  3T5X A;  4M9X A;  3BPX A;  2R5Y B;  1S8N A;  3GW2 A;  1CQT A;  1F9N A;  4R1H A;  1KU7 A;  1NHA A;  4OIQ F;  3QPT A;  3F8C A;  2A5W A;  5E8G A;  5DCM B;  3V7R A;  1WJA A;  2O8X A;  1DGR M;  4G9Y A;  3GFJ A;  1I6H J;  1E17 A;  1ZYR F;  2CU7 A;  2KKO A;  3K70 C;  3RKY A;  4CCL A;  2M30 A;  1WJF A;  4HZF A;  1XX5 A;  2Z9O A;  4HRI A;  2CMP A;  4M73 A;  4P1W A;  1SD5 A;  3L2W A;  2MGQ A;  3P7N A;  2HKX A;  1GVD A;  2AS5 F;  3KYC B;  2UXX A;  2A07 F;  4LB5 A;  3J7Z I;  1ZGW A;  4A5M A;  3K4K A;  1S3J A;  2VQH A;  2L02 A;  2WV0 A;  1TQP A;  3KP7 A;  1W5C C;  1B4A A;  1X2M A;  5E20 A;  2DPD A;  2LDU A;  1P9Q C;  1Y6I A;  1VQ4 I;  1RZ4 A;  2KL4 A;  3I3L A;  1HF0 A;  2WAF A;  4B8X A;  3F6O A;  1IRF A;  3CCV I;  1ONV A;  1MMA A;  2DA5 A;  1JUM A;  2OC6 A;  2XPU A;  3FMQ A;  3ABM H;  5D5U B;  1YOV B;  1TQI A;  3H0D A;  2BOL A;  3FXM A;  5DS9 A;  5K7Z A;  2BHY A;  4RAF A;  2JQ7 A;  1C0W A;  1DPU A;  3GYH X;  2R5Z A;  1NTC A;  3PFY A;  4O3M A;  2WB1 A;  2LSO A;  4XIC A;  5KCM A;  3KE2 A;  2OZ6 A;  2G7H A;  1FIP A;  4AM3 A;  2JN6 A;  3OYL A;  5F0H A;  2HOS A;  4ESB A;  4CGZ A;  2EIL H;  2Y0S A;  1YRN A;  3OOU A;  3QOE A;  2I8D A;  5H20 A;  4PGG A;  1WFX A;  1T6S A;  3BG5 A;  3C18 A;  3TO9 A;  1VZ0 A;  4MQV A;  5IT9 Z;  1JT6 A;  2JUC A;  4I6Z A;  3I59 B;  3AKZ A;  3J7Y J;  2K40 A;  2CV0 A;  3NQO A;  3KYL A;  2DMQ A;  3I4M J;  3QP6 A;  4IRH A;  4HG2 A;  2DJI A;  2ZSH B;  5FKN A;  5ED4 A;  3PIO F;  4OOI A;  1S7A A;  3VYS B;  3LSK A;  3KP4 A;  2Y9Y A;  3R60 A;  1VQ8 I;  2GIZ A;  4UNO A;  2IW5 A;  4UUV A;  2UUZ A;  2DT7 B;  5DCF A;  1IUF A;  3BTJ A;  1EH8 A;  3PQJ A;  3N05 A;  4KIF A;  4RGX A;  2HQA A;  3CCL I;  2OAZ A;  4I01 A;  1G3T A;  2EIJ H;  3FDY A;  3HPH A;  2HZT A;  3B6C A;  2R7F A;  3CP2 A;  4XKV A;  2Z33 A;  3AL0 C;  2Q8K A;  3J80 Z;  2EZK A;  2ADU A;  2WTE A;  2QWW A;  3KP6 A;  3IC7 A;  3OYK A;  2ACJ A;  1WRJ A;  1NG7 A;  3IHU A;  4JOM A;  5M3F J;  4DZP A;  2LH9 A;  2H27 A;  4BHB A;  2HS5 A;  4M3F A;  5BS6 A;  3JRI A;  3ESW B;  2KHM A;  2VQL A;  1V5F A;  2NS7 A;  1B9N A;  5H6Q A;  5GTH C;  3S16 J;  1UFM A;  4BQN A;  2RRE A;  2X6Y A;  1E3H A;  2VKE A;  1UMQ A;  1I50 J;  3DU6 A;  2XKO A;  4WXC A;  5LGN A;  2WC2 A;  5LEK A;  2HPM A;  3MD2 A;  3S3N A;  3JRG A;  3S1M J;  2NVT J;  4XKW A;  4UVA A;  2G0E A;  2D1V A;  3JRE A;  1F4K A;  1U5T A;  1K78 A;  4HST A;  1BJZ A;  1I5Z A;  1TTY A;  4RB3 C;  1P6R A;  3CD6 I;  1MKM A;  1Z21 A;  2DBB A;  3DCF A;  1TL8 A;  3ECH A;  1GT0 C;  3ZQQ A;  1T8I A;  2EA2 A;  2ECC A;  5D4S A;  1J0R A;  3RDI A;  4B44 A;  1AWC A;  5K5Q A;  1BJA A;  5HS8 A;  2LF8 A;  2PJR A;  1LFU P;  3FXU A;  3M1C A;  3FXK A;  1D3Y A;  3PNV A;  4CCK A;  1IF1 A;  2CW7 A;  2HYG D;  3PNT A;  2BGC A;  2DOD A;  3D5S C;  2DK8 A;  3BP8 A;  1ZN2 A;  1HQC A;  2P5V A;  2CH0 A;  1IUY A;  2EZH A;  2W25 A;  2AQE A;  1H9G A;  1W5T A;  4ZYG A;  4HF1 A;  1XSX A;  2LBF B;  4BEH A;  1TNS A;  2Q2E A;  1MMD A;  3K4N A;  2CV2 A;  1KU2 A;  2VQG A;  4LIV A;  5J1U A;  2R7Q A;  3G1O A;  4BH9 A;  1OPC A;  4X0G A;  1REP C;  4UUS B;  1T2K A;  3I56 I;  2WAQ N;  1H89 C;  4HNT A;  3QWL A;  4V19 K;  2NVY J;  2K85 A;  1BC7 C;  3V8K A;  2CFO A;  2HVQ A;  3P9C A;  3FK6 A;  2VC1 A;  3KZI C;  4ZZL A;  2MFZ A;  5EJC A;  4B48 A;  3H35 A;  3DPT A;  4RS8 A;  4C30 A;  4FAS D;  2M7A A;  2GM4 A;  4XSX F;  1KA8 A;  5TIS C;  2DA2 A;  1OCZ H;  1GLN A;  1O7F A;  2AHQ A;  3WG9 A;  2YS9 A;  1RI7 A;  2W57 A;  3G3Z A;  3VWB A;  5JVT A;  3LSR A;  1J9I A;  3GTM J;  2P0W A;  3EUA A;  2F5V A;  4RB2 C;  3QU6 A;  1BW6 A;  4DW6 A;  1R00 A;  3IV5 A;  5ICC A;  2ISY A;  4MHG A;  1FOX A;  4RBO A;  1SFK A;  1J2X A;  1UG0 A;  2LNB A;  4NDL A;  5D6E A;  4EJU A;  1NK3 P;  1JKP C;  4Q5S F;  3EUH A;  2K4B A;  1KQ0 A;  3DEU A;  2LY2 A;  2K9Q A;  1XD7 A;  5F64 A;  5EZH A;  1R36 A;  3RQ4 A;  1X4O A;  2R5Y A;  1BI1 A;  2JA5 J;  2O61 A;  3JR9 A;  1DGW Y;  2ZKZ A;  2XGC A;  3PSF A;  2R7W A;  1FP2 A;  4IVN A;  3ZQ7 A;  1FOK A;  2CGP A;  3HZJ A;  2FX0 A;  4YEL A;  1G2H A;  4CZZ A;  1ON1 A;  3CZ6 A;  4OWR B;  3B6A A;  1U0J A;  1WJD A;  2JRT A;  3CES A;  1S9H A;  2QQ9 A;  4HQE A;  2FOK A;  4NUB A;  5EEA A;  4X1E A;  4XLH A;  5ILV A;  1OIS A;  2A3S A;  1UHM A;  2EBI A;  4LJZ F;  2WAQ A;  2KMU A;  2EH3 A;  3RTR A;  2IA1 A;  3LA2 A;  2HQ5 A;  3I59 A;  3S32 A;  3CLO A;  3ECO A;  2BY2 A;  2GLO A;  4BBS J;  2NNN A;  3CCJ I;  2ZBK A;  1YLF A;  3LL7 A;  1TZL A;  1J7K A;  1JHH A;  4O6J A;  2LR8 A;  2TCT A;  2EV0 A;  3H92 A;  3SXY A;  2JUG A;  3VFZ A;  4MEX F;  1NG6 A;  3M07 A;  1IRX A;  2BZT A;  2Y0S N;  3TDZ C;  1DP7 P;  5F27 A;  3RI4 A;  3C1D A;  5IT9 K;  1OYI A;  1ULY A;  5E79 C;  2J5P A;  3HTS B;  1R1V A;  4NHJ A;  2NNY A;  2ZNY A;  4B1R A;  1EV7 A;  1L0O C;  4HX8 A;  4AYB A;  1YI2 I;  4HX7 A;  1O3T A;  1BBY A;  1DUX C;  1AU7 A;  1UJ8 A;  4OIN F;  2Q1Z B;  3W3C A;  5FJ8 J;  4J19 A;  4KUM A;  3MZY A;  1W5S A;  4II2 A;  4PDK A;  3H9J A;  1YX3 A;  5ICE A;  1T0F C;  3A0H C;  5EGO A;  3DTE A;  5CJ9 A;  3WU1 B;  1Z0X A;  5KHD A;  1ETQ A;  2LVS A;  2VBY A;  3DTK A;  1T56 A;  1BOA A;  1ZK8 A;  4F91 B;  4BJT A;  3P9K A;  2LG4 A;  3F8B A;  1GXQ A;  2H1L A;  5LGU A;  3SZG A;  4ITV A;  2I10 A;  2Z3Y A;  1YG2 A;  1SVM A;  2WB1 N;  4OU0 A;  1Q1V A;  1Y0U A;  3FKJ A;  3KPH A;  2COM A;  2CJJ A;  2PMZ N;  1ENH A;  2EFO A;  1WJC A;  2FXA A;  2HTJ A;  2DCE A;  1SMY F;  2M5W A;  2CO5 A;  4BHC A;  2JSC A;  3Q0U A;  2AQF A;  3RKX A;  4ZZD A;  4LK1 F;  5C44 J;  4N4O B;  1U5T B;  2P81 A;  2FBI A;  4MNU A;  1G8X A;  1T33 A;  5E3L A;  2K9L A;  4P96 A;  3M8J A;  4IPA A;  4L9T A;  1FC3 A;  4IEJ A;  4P9F A;  3U9G A;  3GLX A;  3TL4 X;  2ZJP F;  5GAG J;  4LB6 B;  1U3E M;  4JP0 A;  4RM3 A;  4RLF A;  1ZRF A;  2O0Y A;  2H8R A;  2K5C A;  5DEQ A;  3OYB A;  2IS1 A;  3S8P A;  2BXY A;  2JA8 J;  1R7J A;  1UG2 A;  2OCC H;  4OIP F;  3CF2 A;  2DMN A;  3R4K A;  3FBN B;  2DOA A;  3WTX C;  2R7X A;  3BR3 A;  5D8K B;  1P4X A;  1HA8 A;  1D8J A;  1T38 A;  2XAS A;  4A5N A;  4LLL A;  1S29 A;  2HEO A;  4OIO F;  3CCR I;  1XB4 A;  1I1G A;  3K4L A;  2XSD C;  2HDC A;  2OD5 A;  3KP2 A;  1MNE A;  4ESF A;  1XGN A;  4WX9 A;  3D1N I;  3NEU A;  4M72 A;  4BL0 B;  5ICF A;  3M7G A;  1N78 A;  2JA2 A;  3OL3 A;  3DF8 A;  3HG9 A;  4A3K J;  1SAX A;  3L1P A;  1WSU A;  4XID A;  2FA5 A;  1CGP A;  1X3W B;  2QGU A;  1YW8 A;  4BAC A;  3ZMS A;  3I5U A;  2LC2 A;  1FWZ A;  5IYB J;  2P7V B;  2PI0 A;  1GV5 A;  1BW5 A;  1R9T J;  2L3D A;  2DA7 A;  1Y1V J;  4DYC A;  2XRO A;  5B1B H;  4IRI A;  5F0C A;  2L7Z A;  4M3E A;  4P55 A;  4IL6 C;  5DUI A;  3CDL A;  3V8J A;  3CQZ J;  2DFE A;  2A69 F;  1LDJ A;  2HR3 A;  5J3L A;  4BXX J;  3DTI A;  2HZD A;  5GTI C;  2VI6 A;  4EVI A;  1G4D A;  4C3J J;  2R3S A;  4RA2 A;  4V2G A;  4BY1 J;  2W85 A;  4DIQ A;  2GAU A;  3HUG B;  1UAA A;  2PBI A;  5D4R A;  1B8I A;  1RET A;  5DM7 F;  3E1S A;  4KIT B;  1R4M B;  4RGR A;  3TW6 A;  2PX9 A;  2V1D A;  3ASO H;  2D45 A;  5KK1 A;  3HL2 A;  5L3C A;  4I99 C;  5E17 F;  5IP7 J;  1G3Y A;  3GZ6 A;  1JT0 A;  4CH7 A;  2KRC A;  1MMS A;  2HYJ A;  1WKM A;  2WA0 A;  1R23 A;  4I76 A;  2Z1D A;  4E70 A;  1K6Y A;  2MYS A;  3KIO A;  5F1R A;  1LUJ B;  5KAI C;  3O2P E;  3LSH A;  3IRQ A;  4JX6 A;  3CME I;  2VBW A;  3DPL C;  4RAG A;  3SYT A;  3FXO A;  3I58 A;  4CCO A;  3BPV A;  2V1X A;  3I9V 2;  4D7N A;  4YIF A;  5LRS A;  1UEL B;  4MIM A;  4YFX F;  2XPW A;  3A2K A;  2IA0 A;  3IRR A;  1V4R A;  1ZAR A;  2K3F A;  5GAH J;  3L2U A;  1WH5 A;  3DBH B;  3V7C A;  3TQN A;  3MMY B;  1D1C A;  2MD0 A;  5HNH A;  2HDD A;  2DFH A;  4BQA A;  3OYH A;  2R7U A;  2XAF A;  3QYF A;  4XOT A;  2XGE A;  4ZDP A;  4I0B A;  3CLQ A;  2IA2 A;  3E5U A;  1S72 I;  3HHH A;  3KLN A;  4GO1 A;  4ZH4 F;  3K10 A;  4G6D A;  3OR2 C;  3BDD A;  2RV8 A;  3F6V A;  1TWA J;  4ENM A;  3DLA A;  3H9Q A;  1VQ5 I;  3WHB A;  3W6J B;  1R5I D;  5HLG A;  1NK2 P;  3CCS I;  4ZDO A;  3QAH A;  1B1B A;  2FQ3 A;  5LRR A;  3C7J A;  3PQK A;  4CDG A;  4HPQ A;  4A0X A;  4H4K C;  1MBK A;  4V2F A;  2L7K A;  2F4I A;  4HSR A;  1R71 A;  4DOZ A;  2QEX I;  1IG7 A;  2EK5 A;  3BG6 A;  2M4G A;  2ZXI A;  3GZ5 A;  2PQ8 A;  3HTU A;  3JSO A;  2XF5 A;  4IKF A;  4RGS A;  4A2U A;  2J5O A;  2C6Y A;  2X1C A;  2A68 F;  2JRM A;  1QPM A;  1Y39 A;  1YX5 A;  1LVK A;  2H6C A;  2RC4 A;  4PCQ A;  3HXL A;  3SDB A;  1E3P A;  2VL8 A;  3PNY A;  1VQO I;  1DU0 A;  5GPC A;  1SD7 A;  1MND A;  1XSV A;  1XDU A;  3JAM K;  3FX3 A;  1E3O C;  4YRV A;  5JLW A;  3AG4 H;  5EGO B;  2XAG A;  2PMZ A;  3IH3 A;  4LD5 A;  2LTP A;  2UV1 A;  3FHN A;  3BTL A;  1LB2 A;  4E6K G;  3W2A A;  4IF4 A;  3G2B A;  2RQP A;  3HM5 A;  3FXJ A;  3K70 D;  4N4N B;  1ERD A;  1HLV A;  2KQR A;  3O8H A;  4A93 J;  4BBR J;  2QUF A;  2VXD A;  2HKO A;  2CQQ A;  1U6G A;  2DT5 A;  2RAE A;  2V1N A;  3HUG A;  1MDM B;  4AD9 A;  3D5L A;  1YS6 A;  3O6B B;  2E34 A;  4PJM A;  3L7W A;  1A5J A;  1APL C;  1DDN A;  3PSI A;  3WG7 H;  2Y0M A;  3BZ6 A;  4UXN A;  1K79 A;  1QA6 A;  1P7J A;  2E2H J;  1ZKG A;  2KDO A;  2VKH A;  2GIV A;  5HS9 A;  4C3I J;  3MFK A;  2R7Z J;  4KN7 X;  3EPZ A;  1BN5 A;  4HDV A;  2X6W A;  2MLK A;  2W7N A;  4FET A;  2PJP A;  2V1U A;  3OSF A;  2ID6 A;  3QOP A;  2VN2 A;  2QQA A;  3LFK A;  4G6Q A;  4XLA A;  3HSR A;  1WPK A;  2VE9 A;  1IRZ A;  2MD5 A;  3DFG A;  3TGN A;  1ZGA A;  1PVE A;  3WU2 C;  1Z91 A;  5CVU A;  2JMW A;  4KJZ A;  4U7B A;  2VOD A;  2A6E F;  1TT0 A;  1GHC A;  4HOB A;  4HLX A;  5B5E C;  1X3Z B;  1H9T A;  2DA1 A;  4Y15 A;  1TBX A;  2IRF G;  3OOP A;  4W1U A;  1XMK A;  1RKW A;  2HPI A;  4L9N A;  1W36 C;  4G7Z F;  1HDP A;  2CYY A;  2E1C A;  1ZG5 A;  4BQO A;  1VQL I;  5F6F A;  1R4N B;  2L0K A;  2E35 A;  3PFI A;  4XRS A;  2W82 A;  4LLG F;  1XMA A;  2X6O A;  4FIS A;  3HRT A;  3Q9S A;  3OYJ A;  1R1U A;  4LIT A;  2L54 A;  3CJQ B;  2OTJ I;  4M6V A;  3BR5 A;  3E6D A;  1IXS B;  4I98 B;  4CCM A;  3C2H A;  2H1K A;  4S05 A;  5F1J A;  1E0E A;  2IS4 A;  4UV8 A;  1J59 A;  4PFP A;  1FMV A;  1MSE C;  4NC6 A;  4IJA A;  5LHG A;  3LFU A;  2NRA C;  2Z2S B;  1CF7 B;  2KT0 A;  2KZV A;  3BG3 A;  3Q0V A;  4KMU X;  1GUU A;  2VPR A;  3GTQ J;  3L2Q A;  3DP7 A;  1IN8 A;  2R7S A;  3BQZ A;  4M71 A;  3U21 A;  3WGH A;  2DQR A;  2KRF A;  1Z77 A;  4JK1 X;  1IN5 A;  3F0C A;  1RRJ A;  1LEA A;  1MZB A;  3BC8 A;  4GYI A;  4HLY A;  5J1Y A;  2HFH A;  4G12 A;  2L9N A;  2QZ8 A;  5EDN A;  5KNL A;  4XR6 A;  1BL0 A;  2L5Q A;  5E1Z B;  1MMN A;  1U8R A;  2XAJ A;  2K9M A;  1F43 A;  2HGC A;  2ESN A;  2LOO A;  5E18 F;  2XVC A;  2DMT A;  5AIP A;  4ZYD A;  1BC8 C;  2E60 A;  2V9P A;  3EUH C;  1KZH A;  5L3E A;  2DW4 A;  2BVL A;  3K2A A;  2NS0 A;  1KGS A;  2QCO A;  2JA7 J;  4FX4 A;  3OSG A;  3M8F A;  3ZR8 X;  2OTL I;  5E3N A;  1VND A;  2KPM A;  5EF6 A;  3T8R A;  1FT9 A;  1ZRE A;  1Z3X A;  3CC4 I;  4FE7 A;  4KIB A;  4E7Z A;  2RKH A;  2R5Z B;  1MW7 A;  2B0L A;  3I64 A;  4PSX A;  2ZME C;  3W6K B;  5CVV A;  3I0T A;  4D0P A;  4ENJ A;  3TOA A;  4OMZ A;  2YU9 J;  3I4N J;  3BJ6 A;  4AWX B;  4JBA A;  3LSI A;  5J4Y A;  3GZN B;  3HIF A;  5HS7 A;  4BU2 A;  3PO2 J;  4O5V A;  3AL0 B;  3CJN A;  3BWG A;  3CDH A;  4A3B J;  2X6X A;  4RAZ A;  4IHW A;  1WI3 A;  2IVM A;  2F2E A;  5EEG A;  2PG4 A;  5LFA A;  2DPU A;  3J81 K;  2HOE A;  5D5W B;  2D1H A;  1XTA A;  5LEJ A;  3C2B A;  1OR7 A;  3F23 A;  3ABT A;  1R58 A;  2ZME A;  3F8N A;  3ZCO A;  1USS A;  1YJN I;  5HDG A;  2TRT A;  2Z99 A;  1KU3 A;  3GFL A;  4YG2 F;  5FLM J;  1HSJ A;  5GP9 A;  2A61 A;  4AIK A;  4CHU A;  3S1R J;  2AXL A;  2E19 A;  3EDP A;  2WAE A;  3KCC A;  4OAY A;  1VQN I;  3HHG A;  1TW2 A;  4Y4R A;  3I54 A;  4BHP A;  1Z3Y A;  2E7X A;  2BW3 B;  2K02 A;  3MAJ A;  4Y7N J;  4ESJ A;  1AOY A;  5M5X J;  2HQR A;  2HYF A;  2CUZ A;  1SD4 A;  2FOW A;  3FBI B;  2JZY A;  1XCV A;  3CMY A;  2F5C A;  3PUF A;  5J40 A;  1D5Y A;  1IZ1 A;  1TWF J;  3RQI A;  3H5R A;  3HOU J;  3TOB A;  4G6T B;  4XKC A;  2DDB A;  4IHY A;  2Y2Z A;  1QRY A;  1RPW A;  4LIU A;  4W97 A;  1IRG A;  3FIS A;  2HI3 A;  3LSP A;  2V79 A;  4JX5 A;  2BBY A;  2M7B A;  1WH7 A;  2DJN A;  2L9S A;  3H5N A;  5EYR A;  2CUF A;  1BM9 A;  5L3B A;  3BCB A;  5LD2 C;  5EEH A;  4LG3 A;  4QTR A;  3F8F A;  3D5R C;  3BG9 A;  1JE8 A;  3E97 A;  2F5F A;  1X1A A;  2H94 A;  4M6Y A;  1YW9 A;  3K69 A;  1OQY A;  5FFX A;  4B43 A;  3GTL J;  1IXC A;  3KFW X;  3ZQH A;  3HOX J;  5C4J J;  1XGS A;  4EM2 A;  2BV6 A;  3WTW C;  2X1D A;  1SMT A;  1RES A;  1KYZ A;  1L3L A;  4ZTF A;  3K4M A;  2YR2 A;  3QQA A;  2MA3 A;  1SFU A;  5CVR A;  3DEE A;  1Y8Q B;  2DAO A;  3KEQ A;  4CCN A;  3CUQ A;  2LY1 A;  1WWX A;  4CIC A;  1VQ6 I;  1ZTR A;  5IT3 A;  2VPL A;  3NRV A;  1UB9 A;  1JI8 A;  2EB7 A;  2A6T A;  3TKY A;  3M3Y J;  1HBX G;  3A03 A;  5HVQ C;  3H0G J;  1CF7 A;  1ETY A;  4UV9 A;  2L9R A;  1OCR H;  2LBF A;  4WCG A;  1YS7 A;  1Q1H A;  3NWS A;  1KON A;  2HQN A;  1MNM C;  1ZQ3 P;  3LSM A;  3OS2 A;  1ETX A;  2CQN A;  4MTE A;  3GTJ J;  2D5V A;  2DXI A;  4FHT A;  2DOF A;  2F4M B;  2H8W A;  4B4C A;  1MMG A;  2GXA A;  4Y3O A;  4ZDL A;  1A35 A;  3KZZ A;  2XSJ C;  3T8T A;  2IP2 A;  2IXS A;  2OZU A;  1P2F A;  4FE4 A; 
#chains in the Genus database with same CATH homology
 3DKX A;  3OS0 A;  4NC7 A;  3PJR A;  4PJN A;  2WBM A;  2JVG A;  2FUG 2;  3OYM A;  4E4H A;  1X1C A;  2HU9 A;  5FRM A;  1N77 A;  1QHH D;  4KT6 A;  2PJR B;  3DTI A;  4PSW A;  2KRH A;  2HZD A;  4EAT A;  2R4G A;  2RQQ A;  2E1M B;  4AU7 A;  1YE9 A;  3MKZ A;  5CQE A;  2XAU A;  1WJ5 A;  3IUO A;  3DWL E;  4DIQ A;  4NQW B;  4BDY A;  3OS1 A;  2Z16 A;  2IS6 A;  2IS2 A;  3HUG B;  1G59 A;  1UAA A;  2WY8 Q;  3E1S A;  4KIT B;  4IZZ A;  4QPO A;  4BDZ A;  2E5Z A;  2V26 A;  2KLO A;  4BEH B;  3ZGK A;  2VJI A;  4PUS A;  4J01 A;  3DQV C;  3ONQ A;  2X51 A;  3HL2 A;  3V42 A;  3SEZ A;  2XF7 A;  4IX7 A;  3MKW B;  3NWT A;  4CH7 A;  1FMW A;  2KRC A;  2WA0 A;  3K4B A;  2Z1D A;  3TMO A;  4GRI A;  1K6Y A;  2MYS A;  4XN0 A;  4CSW A;  3OYA A;  2A5W A;  2V6E A;  3LSH A;  1WJA A;  4CA0 A;  1DGR M;  2IGM A;  2MC4 A;  3K70 C;  3DPL C;  4XOR A;  4CCL A;  2W1O A;  3OYC A;  2F6C A;  1WJF A;  3L2R A;  3SYT A;  4CCO A;  3SEQ A;  4HRI A;  2CMP A;  3IP4 B;  3I9V 2;  1N75 A;  4P1W A;  4DGW B;  1UEL B;  3L2W A;  2V4J C;  3A2K A;  3BLY A;  3L2U A;  2VXZ A;  3K4K A;  2VQH A;  1QHG A;  4XON A;  2LYC A;  3MMY B;  1D1C A;  2BW3 A;  2MD0 A;  2DT6 A;  5HNH A;  1P9Q C;  1Y6I A;  2KL4 A;  3I3L A;  2WAF A;  4F55 A;  3OYH A;  2R7U A;  3QYF A;  4XOT A;  4ZDP A;  1MMA A;  4ANJ A;  4NNJ A;  2E1M C;  2OC6 A;  3VYT B;  4C2T A;  3H0D A;  3K10 A;  2BOL A;  2CW8 A;  4BJ6 C;  1PYV A;  1V5G A;  1AA7 A;  1PJR A;  3OR2 C;  3OYG A;  4RMN A;  4J00 A;  4BXF A;  3DLA A;  3H9Q A;  3UR3 C;  4AVZ A;  4BJ5 C;  3S3O A;  4CUG A;  3PFY A;  2WB1 A;  5KCM A;  4ZDO A;  2ZFU A;  4HPQ A;  4XNF A;  3KEY A;  4H4K C;  3OYL A;  4E7H A;  2L7K A;  2F4I A;  2MAB A;  3DU5 A;  4HSR A;  2Q2E B;  3OY9 A;  3S3M A;  4DOZ A;  2Y0S A;  3HOS A;  2QKL B;  3OOU A;  3QOE A;  2I8D A;  3BG6 A;  3W2V A;  2HVS A;  2M4G A;  1WFX A;  1ZEL A;  2ZXI A;  1LKX A;  2XF5 A;  4F52 A;  4IKF A;  2ELJ A;  1VZ0 A;  4HEA 2;  2X1C A;  1YX5 A;  1LVK A;  3H9G A;  3AKZ A;  3HXL A;  1BOB A;  3SDB A;  1D1A A;  3K6G A;  1QU3 A;  2VL8 A;  3PNY A;  2CV0 A;  5FRO A;  3OIP A;  3KYL A;  3EUK L;  2O5R A;  1MND A;  5HOO A;  4F92 B;  1LFP A;  4HG2 A;  2DJI A;  4XLF A;  2ZSH B;  2R7O A;  4YRV A;  3OYF A;  4E7I A;  3F9K A;  3VYS B;  2PMZ A;  3LSK A;  1EA3 A;  4E7L A;  3QYE A;  2UV1 A;  3FHN A;  4E6K G;  3W2A A;  2UUZ A;  2DT7 B;  4OAZ A;  3G2B A;  3K70 D;  4N4N B;  1ERD A;  4CZC A;  2KQR A;  3N05 A;  2HQA A;  2VXD A;  2V1N A;  3D5L A;  3FDY A;  3HPH A;  4HNU A;  3CP2 A;  4XKV A;  3OL4 A;  4PJM A;  3AL0 C;  1Z7L A;  2LRD A;  3PSI A;  3OYK A;  2WAD A;  1NG7 A;  2M3A A;  4IQJ A;  4JOM A;  3HPG A;  2KDO A;  2VKH A;  3HOT A;  2LH9 A;  4XLE A;  4F3Q A;  1X19 A;  3EPZ A;  2KHM A;  4D9J A;  4U87 A;  4QPQ A;  2VQL A;  1V5F A;  4IQ4 A;  2X6W A;  2W7N A;  4FET A;  1BR4 A;  4PJJ A;  4XLA A;  4BQN A;  2RRE A;  2X6Y A;  3QYB A;  3DU6 A;  2HPM A;  2VQC A;  3H5A A;  3MD2 A;  1OLT A;  3S3N A;  2JVH A;  2ZSI B;  4XKW A;  4KJZ A;  4U7B A;  3UNG C;  1TT0 A;  4II3 A;  5HLT A;  3DPU A;  3OYD A;  4HST A;  2HVR A;  1D0X A;  4XLC A;  1Z21 A;  4Y33 A;  3OYN A;  2HPI A;  1W36 C;  3E0J B;  3ZQQ A;  3W2W A;  4JQF A;  4B44 A;  2VKD A;  4BQO A;  2HNH A;  4KIS A;  2UWM A;  2PJR A;  2JSP A;  2W82 A;  3M1C A;  2CV1 A;  3PNV A;  4CCK A;  3OYJ A;  2CW7 A;  4LIT A;  3CJQ B;  3LMM A;  2VAS A;  4ZJZ A;  4ZTJ A;  3PNT A;  3D5S C;  4CCM A;  3C2H A;  1D1B A;  1E0E A;  2IS4 A;  4DBR A;  4PFP A;  5TGT A;  1FMV A;  2CH0 A;  3CMM A;  3CJR B;  3J7A Y;  2AQE A;  2XF6 A;  2M4K A;  3LFU A;  2Z2S B;  2LBF B;  4BEH A;  2KZV A;  2NOJ B;  1MMD A;  3GBG A;  3K4N A;  2CV2 A;  2VQG A;  4LIV A;  3L2Q A;  3PL8 A;  2R7S A;  2R7Q A;  4RM2 A;  3U21 A;  3OYE A;  4X0G A;  3CP8 A;  2R7R A;  3BC8 A;  3OWT A;  4HNT A;  1BR2 A;  3IAS 2;  2L9N A;  2CFO A;  2HVQ A;  5KNL A;  4XR6 A;  2MFZ A;  4B48 A;  2L5Q A;  3H35 A;  3DPT A;  1MMN A;  4C30 A;  2K9M A;  2RNG A;  2M7A A;  4P5O A;  4FAS D;  4PK4 A;  4E7K A;  2KP6 A;  2X85 A;  1GLN A;  2LOO A;  3VWB A;  4BE0 A;  2XDV A;  3DKY A;  2P0W A;  3AFH A;  3EUA A;  5CPR B;  2F5V A;  2R7V A;  2E60 A;  3EUH C;  1X1D A;  2BVL A;  4XOP A;  4C9Y A;  1SFK A;  1UG0 A;  4XQF A;  5FRN A;  3ZR8 X;  4ZYA A;  2KPM A;  2LY2 A;  2OUM A;  3RQ4 A;  4XMY A;  1X4O A;  1Z3X A;  3K4J A;  4R79 A;  1D0Y A;  3OIQ A;  4D1Q A;  3KX2 A;  1DGW Y;  3PSF A;  4E7Z A;  1MW7 A;  1T95 A;  3PUB A;  4PSX A;  4BUP A;  2R7W A;  2VB6 A;  4YEL A;  3LSG A;  3C2G A;  3CZ6 A;  4OWR B;  3LSI A;  1U0J A;  2M0M A;  1WJD A;  3CES A;  1S9H A;  4PFO A;  4NUB A;  2X1E A;  1BR1 A;  4BU2 A;  4XLH A;  5HNF A;  3OYI A;  4XN3 A;  4B3X A;  2L2O A;  2WAQ A;  2KMU A;  3AL0 B;  3RTR A;  2X6X A;  1WJE A;  2W4S A;  3TBI A;  4XKB A;  3RPU D;  3S32 A;  5LFA A;  3A1Y A;  3VSL A;  4F93 B;  3LL7 A;  1TZL A;  4BGD A;  2CUJ A;  2JUG A;  1R6R A;  1NG6 A;  1IRX A;  3ZCO A;  2HDW A;  4BE2 A;  2OV7 A;  1D0Z A;  1Y56 A;  3QOD A;  2WAE A;  2VIX A;  4XM3 A;  2E5N A;  4OAY A;  2VJJ A;  4AYB A;  4Y4R A;  1Z3Y A;  4C2U A;  2BW3 B;  1DP3 A;  3ZXS A;  2Q1Z B;  4XL9 A;  4NC8 A;  3W3C A;  3VYR B;  2CUZ A;  3BG7 A;  4BS9 A;  2CS3 A;  3FBI B;  1V5E A;  2ZXH A;  4II2 A;  3H9J A;  4E7S A;  1YX3 A;  1T0F C;  3S93 A;  5CKT A;  2GOM A;  3DTE A;  3H5R A;  2WY7 Q;  3K4C A;  5KHD A;  3OR1 C;  4G6T B;  3DTK A;  4XKC A;  3HKZ A;  4F91 B;  4CCJ A;  4BJT A;  4LIU A;  2LG4 A;  2IGK A;  3SZG A;  4ITV A;  4DJA A;  2M7B A;  2L9S A;  3H5N A;  3FKJ A;  3BCA A;  1WJC A;  3BCB A;  3HC7 A;  4LG3 A;  5LD2 C;  3D5R C;  2DCE A;  3VDX A;  2BVM A;  2AQF A;  1X4P A;  1X1A A;  2IGN A;  4N4O B;  4PJL A;  4B43 A;  2IGO A;  1G8X A;  2K9L A;  2X1D A;  2QKM B;  3M8J A;  4ZTF A;  3K4M A;  2LRE A;  1SAU A;  3TL4 X;  4RM3 A;  4RLF A;  3DEE A;  1OR7 C;  2IS1 A;  2K5C A;  3OYB A;  3A4C A;  2VJ5 A;  3S8P A;  2GOX B;  3RSN A;  4CCN A;  2LY1 A;  2V7F A;  3VYU B;  3CF2 A;  4DBQ A;  3FBN B;  2VLA A;  2DOA A;  2VPL A;  2R7X A;  1HA8 A;  4YEJ A;  2R7T A;  4BE1 A;  2V9K A;  2VJ4 A;  1JI8 A;  1X1B A;  2A6T A;  1J09 A;  3K4L A;  3ZRG A;  5HVQ C;  1WJB A;  2LBF A;  4RLQ A;  1W36 D;  3VSK A;  3NWS A;  1MNE A;  1KON A;  3OMY A;  5CQG A;  4BQQ A;  4BL0 B;  3L2V A;  1N78 A;  2JA2 A;  3OL3 A;  2W00 A;  2XC7 A;  3HG9 A;  3LSM A;  3OS2 A;  1DQU A;  4B47 A;  4E7J A;  4MLO A;  2DXI A;  1MMG A;  3MKY B;  4Y3O A;  4ZDL A;  4BAC A;  3IAM 2;  2LC2 A;  3RCO A;  2K3P A;  2XSJ C;  5JHF A;  2IXS A;  4ZC3 A;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...