2KZVA

Solution nmr structure of cv_0373(175-257) protein from chromobacterium violaceum, northeast structural genomics consortium target cvr118a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MPHKEKHPLQDMFTSAIEAVARDSGWAELSAVGSYLAKNDPSFDPRNWGHGRLSQMVKKLDFLTVQESRNGSKLHSEIRLRHDGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CV_0373(175-257) protein from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR118A.
rcsb
source organism Chromobacterium violaceum
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12872 OST-HTH OST-HTH/LOTUS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2kzvA01
2KZVA 2LY2A 3S93A 2LH9A 2KPMA 3RCOA 2LY1A
chains in the Genus database with same CATH superfamily
3EYYA 2L4AA 2E1MC 3ZMZA 1MJAA 3ABKH 4ZC3A 4DBRA 2LVSA 1MBKA 4MO7A 2E5ZA 2HU9A 1HXDA 2FD5A 1YE9A 3FISA 3M07A 2MD5A 2GLOA 2PX9A 1X4PA 1W0TA 4D5FA 3L09A 2UZKA 3L2QA 2H1LA 4YIFA 4KISA 3K1PA 3OIPA 1J59A 4A3LJ 2KIMA 4LLGF 1SD4A 3KLNA 3H92A 2ZB9A 5FKOA 1IUYA 1JTYA 2D2WA 5DD8A 3BJAA 1LQ1A 2F4MB 3FMSA 4PSWA 1J75A 5FLXK 4RLQA 5DV5A 3QYFA 3OYIA 1T39A 2O5RA 1MH4A 4IVNA 4E7HA 3PJRA 2R7VA 2QZ8A 3NWTA 3ZQQA 4M3GA 3PO2J 3S16J 3H0DA 4FQGA 1YX3A 1TT0A 1Y0UA 3GFJA 4B4CA 1RKWA 3H5AA 4I76A 4CHUA 4XRSA 4E7KA 2E5NA 2P5KA 2ISYA 2PEXA 3BLYA 2XB5A 1ZGAA 1Z67A 5IOZA 2M34A 4KN7X 2EB7A 3NRVA 1IXCA 1J7KA 1RR7A 3A0HC 3M8EA 2LBFB 2JQ7A 4L18B 4CXFA 3SHFA 5LEKA 3T5XA 2WAEA 3ZMSA 2HPMA 3L9FA 3WE3A 4E7SA 1B1BA 1MH3A 1ZR2A 2EZLA 4ZYAA 1T8IA 3H3VK 5E3LA 4V2FA 2P0WA 1WI3A 3V7SA 3V7CA 1MSEC 2MH9A 4YIRX 2W85A 3EYIA 4LIUA 1BW5A 2NAZA 4KYWA 1BC7C 4IPAA 4E7IA 2GAUA 2QM3A 5F0HA 2O0YA 1Z6RA 1WWXA 4C2TA 4PGGA 3MZ8A 1MSFC 2XAHA 5FKKA 2E1MB 1OISA 2WAQA 4W97A 3I58A 5EJCA 3TL4X 3HM5A 5J4YA 5KNLA 1NH3A 3WTXC 4KT5C 4V2GA 4B8XA 1YJWI 1PDNC 2F48A 3QPSA 5J1RA 4N4OB 3ZCOA 1Y56A 3CMEI 3BR0A 1TC3C 3FZVA 2GA1A 3OV8A 4B3AA 2GXGA 3E6DA 4UUTA 4RMNA 2FBKA 3WU1B 4XLFA 3G2BA 4U0WA 2M30A 2LREA 3CCQI 3GTLJ 3DWLE 3PNYA 4HDVA 2A5YB 2VOOA 1ZKGA 3OOPA 1F5TA 4ESJA 1FLIA 3U1KA 1LVAA 3V8JA 2LH9A 4ZZLA 3RCOA 2L5QA 3IV5A 4MGRA 1L0OC 2UXNA 1KA8A 1B9NA 3DCFA 2L9RA 2KPMA 5DCMA 1OCOH 4AVPA 2XRLA 4FISA 2BY2A 1QGPA 5H2FC 2HGCA 3K0LA 1Z6TA 1IN6A 2E2JJ 1SFKA 3I64A 2R7RA 1ETOA 2CWEA 1MW7A 1P2FA 2WAFA 1OCTC 1OCRH 3R6SA 4D5CA 2NVXJ 3GFMA 2F5VA 3KZZA 3QAHA 2COMA 2IGOA 2X4HA 1YRNA 4IHTA 4MTEA 5FKLA 4C30A 1BOBA 3C7JA 3IAS2 1ZK8A 3O2PE 4R1HA 5K5OA 2DODA 2ECCA 1YW9A 1HCRA 2WWYA 2EV0A 3MKZA 1Z3XA 3NQOA 1MMNA 3EQLF 1KYWA 2IP2A 1GDTA 2FOKA 2CYYA 2Z99A 2HTJA 3V8KA 2A69F 5IOYA 1WSUA 3K7AJ 1B6AA 3BG3A 4YRVA 3KCCA 4UNOA 1MJBA 4A69C 4XLHA 1FIPA 2R4GA 2W24A 3HRUA 1JXSA 3ZGKA 2KKOA 4HF1A 4IF4A 1H9GA 4BXFA 1YQAA 4KMUX 2RNGA 3WGIA 2QYOA 3CJQB 3H0GJ 4NQWB 1LE8B 1R7JA 4KN4X 1P4AA 3GZ5A 1REPC 1EV7A 2F2EA 3UKGA 2KLOA 2WV0A 3HKZA 3RPUA 1ZRDA 4HW0A 4Y3OA 3FK7A 1SAXA 3L1PA 2K9LA 1BL0A 1EH8A 3ZQGA 1UG0A 1UFMA 3CUQC 2BW3A 1EH7A 2XAGA 2Q1ZB 2G7HA 2P81A 5LFAA 4L9NA 5LGUA 2RDPA 3WTSC 4LB5A 3BQYA 3J7AY 3OSGA 3OYLA 2PJRA 3O3KA 2W00A 5E3NA 3ZR8X 4BDZA 2WB1N 4X1EA 3V7RA 1XDSA 3D1NI 4PJJA 1SEUA 2JUCA 4X0GA 5IT9K 1V5FA 5DEQA 2VI6A 3GVAA 1BIBA 5L3CA 4L0ZB 4RB1A 2E7WA 4NBQA 2X85A 4UVCA 3CC4I 2QSFX 1XCVA 3FHNA 4FASD 4ITVA 1F9NA 1R5ID 2R7UA 1S8NA 1LDKB 4RAGA 1I27A 3BZCA 2E34A 3WTZA 3ZN0A 2GA2A 5TJJA 1IG7A 4KIFA 3DBLB 2HOSA 2RNJA 2A05A 3GBGA 2XGXA 2XUBA 4DNCA 2HVQA 2FQ3A 5GADJ 1HQCA 2Y75A 5HDNA 2LMDA 5F64A 4HV6A 4LK0F 4BUPA 3DBHB 4E7JA 1FSHA 3E97A 1O3QA 2L54A 5LGTA 2F5DA 3QP6A 3T1BA 4EJOA 4JOMA 2YX4A 2ECBA 1VQ8I 2HQRA 1R9TJ 1ETXA 5FLMJ 1MBEA 3A01A 2PQ8A 1R23A 1MMSA 2YSRA 3WTUC 1BR1A 3PM1A 2ZSHB 2QQ9A 4B43A 5DUKA 3WTVC 1JKRC 2M8GX 1X58A 2PMHA 2XF7A 3GFLA 4AD9A 1YO5C 2QKMB 3VYSB 1HLVA 4IO9F 4I2OA 2HWVA 1EJ9A 1O3RA 1G8XA 3BC8A 2DK8A 3CUQB 2VODA 1FOXA 2OAZA 2WC2A 4CUGA 3HDDA 1IGNA 4I09A 1Z77A 4FX0A 3JW4A 2VPRA 4NUBA 1TW2A 3M1CA 2W84A 4AIJA 4FE7A 4XOPA 2K27A 2LY9A 2MLKA 3FXOA 1WJAA 3OYCA 2AQEA 2OV7A 2LNBA 5GPAA 1MDMB 3ZMVA 2G9WA 5KCMA 5D5WB 2X9DA 1Z9CA 1PP8F 5BS6A 2MC3A 3QRFF 1VFCA 2R7ZJ 1VQOI 1ZTRA 4UUSA 2OA4A 3CF2A 2L3DA 4XK4A 2EIKH 1WJBA 2FNAA 3OMYA 4F3QA 4S05A 4AIDA 4HQMA 4KMFA 2EIMH 1D0XA 3A1YA 1P6RA 2XASA 1X1CA 5JI6A 3J81K 1BR4A 2DDAA 2VASA 1Z05A 1I1SA 1AWCA 1OCZH 3MCZA 2KIQA 2JRMA 1Y1VJ 4ENKA 1E3OC 2VB6A 4H0EA 2DT6A 5TISC 4HF2A 1V3FA 4BEHB 2FOWA 5EG0A 2QVOA 4BQQA 1O7FA 1WJCA 4NC6A 5ICGA 5F1RA 5FLVA 5EZGA 4CSWA 2W82A 1GVJA 1WJFA 3EUHC 1IXSB 3H1CA 3K4JA 3PSFA 4XRFA 5FB2A 4U7BA 3ZQCA 2XAFA 4RB3C 3KYCB 3DKXA 2XPWA 4WX9A 1G4DA 2Y0MA 3VB2A 3J80K 2M8EA 2MD0A 2E7XA 2H6BA 3KP2A 1A35A 1R1UA 2LDUA 1IF1A 2NS7A 3OIOA 1WH7A 1HC8A 1P4WA 2VIXA 2CUFA 3GO5A 1ZG1A 1B8IA 1FOYA 2O8XA 5J8CA 1MNDA 5JLWA 5C44J 1RRJA 1MNMC 3S14J 3TW7A 1BA5A 3IP4B 5KAIC 1FP1D 2BGCA 1HSTA 3AG3H 4W1UA 4NC7A 1FBSA 2R3SA 1IDYA 1W5TA 3Q0VA 2DA6A 1FOKA 4CYCA 4BL0B 4OOIA 3H5NA 1USSA 1ZN2A 1STZA 4ZYEA 3TMOA 5E1WA 4OIPF 3QPHA 2E1CA 4G7ZF 2GWRA 5H20A 1E17A 1LFUP 3BDDA 4MEYF 3U9GA 3EPZA 2DQLA 1Z91A 2ETHA 3HHHA 2CMPA 2RQQA 4DYQA 4HQEA 3LAPA 3BY6A 1FJLA 3H3UA 5EYRA 3HOTA 1SFEA 2DFFA 2DJNA 3E0JB 3DPLC 1YHQI 2CQNA 2JRTA 4E6KG 4U88A 5L3DA 2I5UA 2ZJPF 3AG4H 3SYTA 4A6EA 4DZJA 5HDGA 4B1RA 2JA6J 2IXSA 1FMWA 5EGOA 2HQ5A 3JRIA 2EZIA 4IZZA 1GV2A 3W6VA 3HIFA 4L5IA 3I3LA 4O5VA 3CP8A 1QRYA 1U9NA 3JAMZ 2E71A 1R5HA 3FKJA 1AKHB 4LG0A 1XX5A 4A0YA 4ZTFA 2R7FA 1POGA 2MH2A 3FBIB 2XGDA 4KIBA 1UAAA 4BQNA 1ETQA 2HS5A 4BNCA 2M45A 2IS6A 1JUMA 1HKSA 3G4SI 3G3ZA 1NG7A 3ABUA 5E1XA 3DTEA 5GAEJ 2M9HA 3VYUB 2OCCH 4Z2YA 2GQQA 2XPUA 3H5RA 4J01A 3HPGA 1Y39A 3L2VA 1HDDC 5J1UA 1PUFB 3CCRI 2JJ7A 4OWRB 2Z5UA 1PYVA 3S3MA 1UHSA 1KONA 4YFNF 4CGZA 1B8IB 4JYKA 2RQPA 2ZNZA 2ZXIA 4XLNF 2W4SA 1FBUA 2DPDA 5BPIA 3H9GA 2BEOA 2CV1A 3OYGA 5GPCA 4HYEA 2JMWA 2DQRA 3FWEA 2K9QA 4XIDA 4M3FA 2X1EA 5HDKA 2ICWG 2GZWA 2KIFA 2CQQA 1FC3A 3PNVA 2Z9OA 1G3SA 1G6NA 2ZSIB 1XB4A 4HDUA 3HBLA 4P96A 1JJ6C 1FNNA 2K9SA 1O57A 2BOLA 3L7WA 4IKFA 2V6CA 1KZHA 4F52A 4HNVA 3G71I 4M6XA 1LEAA 4LB6B 3W2WA 3FXJA 1XMKA 2CS3A 2FXAA 3TDZC 4M9ZA 2ACJA 2F4IA 1FYMA 3I5UA 3G1MA 2WAQN 3KEOA 2M1BA 5BMZA 1ZAOA 2GXBA 3TEDA 1KQ8A 3QQAA 1G2HA 3KX2A 1D0YA 3ZOBA 5D4SA 5LGNA 1XS9A 3HL2A 3E1SA 3DTKA 3JRDA 1U5TC 2Y2ZA 3C3WA 3LA3A 4RGUA 4AUXA 1XD7A 2AQFA 2BXYA 3ISPA 1RNLA 2OTJI 4ANJA 4LMYA 2LK2A 2RC4A 3CCSI 1R4NB 1YJNI 2VBXA 3K69A 3IRQA 3MEXA 5B5EC 3T8RA 1R00A 2H94A 2GBYA 4UV9A 3IC7A 2VKHA 1K6OA 5DYMA 2DA3A 1FYLA 1T0FC 2KFDA 3D5SC 4IX7A 3BR1A 1HKQA 2EFOA 2IS1A 2DMQA 2MYSA 3HRTA 4ETSA 4EJUA 4F91B 5F0FA 1ZARA 2HXIA 3I55I 4UVBA 3CCMI 1BI0A 1FEXA 1R5GA 3LSMA 4NC8A 3BG7A 2XF5A 3OS1A 1ITYA 5JLXA 4PCQA 1A6IA 3K6GA 2B7EA 3E3VA 3VEPA 4LJZF 2DOEA 1EA3A 4MNUA 4HNUA 1FWZA 4QIWN 5LHHA 5BNGA 3OYEA 1LKXA 4AWXB 3MN2A 4II3A 1DU6A 1S7AA 3KIOA 5FGMA 3K9TA 3DEUA 1D1AA 1VQKI 1WKMA 4HX8A 2O3FA 4LG3A 2DOFA 2XB0X 5E3MA 3K1NA 1ZR4A 4L9JA 4PZJA 3QPTA 4XICA 2TCTA 5J6XA 2B63J 1RETA 3R0AA 4XRMA 3BT9A 1SFXA 4J19A 3F8BA 3BWGA 3I59B 3MKWB 3CMYA 4BYYA 4B44A 1BIAA 4YIIA 2RAEA 1O3SA 2R5YA 1W4MA 1U5TB 2IT0A 3CZ6A 3U2RA 3WHCA 2YU3A 2ID3A 1T33A 2IGNA 4RBOA 5LLQA 3FX3A 4HZFA 2QEXI 5JVGF 3I54A 3ZP5A 3WGGA 3HKZN 4E7LA 3M8JA 1GUUA 4S0HB 2LR8A 1Y1WJ 2BV6A 3K2AA 2E35A 1TT5B 3M1EA 1F43A 1DGWY 3LWFA 1MJ9A 4XR6A 3ZRGA 5L3BA 3LSGA 3NWSA 4A2UA 1XSXA 4Q48A 4M74A 2DMUA 4PFOA 5F0CA 1WVRA 3Q0UA 4D0PA 1QZZA 3DV8A 3HOVJ 2LP0A 5FLXZ 1IN7A 1WJEA 5F27A 2LKSA 2YX7A 4DYCA 2AXLA 3HRMA 1K78B 3R61A 1RUNA 3RPUD 3S1RJ 3AG2H 1JI8A 2QCOA 5IT3A 1V5GA 2Z3YA 1DDNA 1X2NA 3H9QA 5B1BH 5DCFA 3FXRA 4J00A 4RM3A 4CCJA 2CV2A 3HGYA 4XN3A 4RAFA 3EUKL 2DBBA 1JTXA 1W1WE 3JR9A 4II2A 5M3FJ 4G8XA 2JSPA 3OS2A 3QYBA 3F8NA 2J5PA 1ULYA 2PMZA 3OYKA 2ZXJA 3CF5F 3CCJI 2O61A 5CLSA 2HDDA 5KHDA 3FKIJ 3ZQHA 1HDPA 3ONQA 1YTYA 3QPLA 2IPQX 2VC0A 4PJNA 5AIPA 2LD5A 5E79C 1IV8A 2ELKA 2BXZA 1ZREA 4B09A 1BC8C 1U8BA 1SVMA 2LY1A 4N9IA 3LSTA 2EJRA 4BJ6C 4B47A 3TO7A 1VQMI 2M3AA 3SFZA 4ESBA 1WH5A 2ID6A 1ZG5A 1B72A 4R79A 4M9XA 4U0YA 2DA4A 1T95A 3KEYA 3REOA 2OQGA 2E2HJ 3GTQJ 1FIAA 1ZRCA 3FF5A 2W57A 2K3FA 4PJMA 2JSCA 2M0MA 4BJ5C 4B48A 1BR2A 1YW8A 4AIHA 3I0TA 4DQ2A 5EEHA 4AU7A 1BOAA 4XMYA 3DXJF 3CLOA 5CYVA 2STTA 1W0UA 2KZVA 3N4MA 2CO5A 4RS8A 1EF4A 1JT0A 1ZGWA 5L3EA 2RREA 2P8TA 4IHYA 3LSHA 1TWHJ 3HSRA 2Z16A 3WU0A 4P55A 1IDZA 3S2DJ 1X3UA 3GTMJ 2HDCA 1ZLJA 5ILSA 1V55H 4WF2A 3CUOA 1MIJA 5CVUA 3D0SA 1QVUA 4U87A 5FO5A 5IPAA 2A5WA 1Z0XA 2XKPA 4P5OA 5GTHC 1VQ5I 4L0YB 1QHHD 3FXQA 3D5LA 2Y69H 1OYIA 4IJAA 5K1YA 2IVMA 5J47A 1YJ9I 2OZUA 3NEUA 5FD6A 4HEA2 4ZYDA 1KGSA 2CU7A 4XNFA 3WG9A 3C1DA 2K9MA 3CCVI 1TLHB 1SD6A 2V9VA 3AG1H 3R60A 1A5JA 2UV1A 3ZMTA 1R1TA 1JGGA 1K7AA 4OINF 4EJTA 4HLYA 1YS6A 2VJJA 1R36A 1R71A 2WV1A 1JKPC 2DOAA 3NAUA 4CCMA 2CRGA 3J7AO 1DPRA 4Y33A 4A0XA 2H09A 1Y0NA 2WY7Q 4GO1A 3SEQA 5D5UB 1DGRM 5E3OA 1ACIA 2V1DA 3EUAA 2JVHA 5E18F 4FT8A 4AYBA 1M1EB 2ZMEA 2BY0A 1GXPA 3QU3A 4XLPF 5E17F 2DT7B 4BAYA 2X6YA 1IN8A 2RGVA 3ABLH 4KA4A 1W5CC 4HRIA 1HSJA 3RI4A 4Y7NJ 2X0LA 1IV6A 1HW2A 3GZ6A 1WJ5A 4ON0A 3DU6A 1TQPA 2PJPA 1BN5A 3B6CA 4E7ZA 1KQ9A 4A3GJ 3BJ6A 4G94A 2QENA 3E5XA 3L2WA 1D0ZA 2A61A 5K7FA 5D8KB 2L4MA 3IHUA 2COBA 3LOCA 4A3JJ 4CCOA 4QWQA 3BTJA 3VDXA 2CSOA 3S1MJ 2ZC2A 3VPRA 4MFDA 3PSIA 4B3XA 1GHCA 3PFYA 5L3FA 1KYZA 5CVRA 2QLZA 5IT9Z 4HSRA 3G1OA 3P9CA 3CMMA 4HPQA 2B9SA 3DBRB 1Y8QB 4M9SA 3D5RC 3CC2I 1RR8C 5AIQA 2P5LC 3MZYA 2IEKA 4XLCA 1SANA 4MTDA 1ZRFA 2WY8Q 4PFPA 4U7DA 2HVRA 3MQ0A 3IWZA 2HKXA 2OC6A 5DCMB 4GXOA 3JCUC 3BPXA 1Q1VA 2OBPA 3SJMA 2ZBKA 3OYDA 1I50J 3LSRA 3DQVC 3P9KA 3JRAA 2JA7J 2R7QA 3S2WA 3HOUJ 1O4XA 1K6YA 3ZN1A 1P7IA 1FT9A 2BY1A 3F3XA 5EDNA 2RKHA 3JRBA 3KLOA 2EZHA 3PNTA 4M73A 1S7OA 3ZQFA 5IYDJ 3CO7C 1K83J 2JK3A 5IYBJ 4EM0B 1YRNB 1V54H 2R7XA 1UELB 4F93B 2R7DA 4JX4A 2ISZA 3CQZJ 2DA7A 3JRGA 2X51A 5D4RA 3ZMDA 1WFXA 1TWGJ 1VQNI 4G6DA 2FF4A 2KP6A 3VODA 3I53A 2NRAC 2LRDA 4EJVA 2ZFWA 4GDFA 1GLNA 2EWNA 3OR1C 4I0BA 3W3CA 2XAQA 4QLCU 2M7AA 3TP0A 3CMAI 3JRHA 4UY8I 5B3SH 2QBYA 2NOGA 3BZ6A 3RYPA 1X1BA 5A2QZ 3S1NJ 2VQLA 4G7HF 2LF8A 4BBSJ 4CO8A 3LQRA 4DOZA 3CDLA 5LEJA 5HLIA 4L9TA 1FZPB 1HKTA 3LA2A 4R8HA 1PJRA 5F6FA 1JJ8C 2ESNA 2HOAA 5KVRA 3M9AA 3BG6A 1ON1A 2ME6A 3I4PA 1R1VA 5HVQC 3CCEI 1VF9A 3FMRA 1UHWA 5GP9A 2BW3B 2WBMA 1ODDA 2M5WA 3V4GA 3GTJJ 2XV4S 5EZHA 2K4BA 4D7MA 2F4OB 5LBQA 2AS5F 1VQ9I 3DTIA 1SMTA 3KEQA 1TBXA 3ASNH 2FE3A 2XC7A 4XL9A 3J81Z 4XM3A 2PJRB 4M6VA 3TGNA 2YU9J 4G6QA 3Q5FA 2NYXA 3HUGA 3PUFA 1J0RA 2VN2A 1ZYRF 1RI7A 2CUZA 3S1QJ 1I39A 4HBLA 2NNYA 2DA1A 3P7NA 4RGXA 2R5ZA 2DO7A 1LFPA 2M2EA 1XC5A 2JA2A 2NNNA 4AC0A 2P6TA 1EKEA 5GTIC 4HF0A 3OYJA 9ANTA 5HOOA 1MZBA 1XSDA 2DT5A 2LLKA 4M3DA 3SZPA 4UV8A 1X2MA 3GTPJ 2JN6A 2RN7A 4AM3A 1IAWA 3H9JA 2XPVA 2VUMJ 6PAXA 2EH3A 1X1PA 5C3EJ 1QA6A 1UB9A 1BJAA 4HNTA 3RJPA 1H8AC 5AONA 1B59A 5FKNA 2KRFA 3K70D 1QZYA 1U6GA 2L7ZA 3OSFA 3ZQIA 1T98A 3RSNA 1FOWA 1RKTA 2DW4A 1S29A 3CC7I 2W1OA 4EV0A 5FKMA 4BKXA 1CF7A 3A01B 1A6QA 1D8JA 3SZGA 2CH0A 2QF7A 1UCRA 2EPFA 2DAOA 2VKVA 3BZKA 4JBAA 5M5XJ 1QNTA 1WJDA 1X19A 2K02A 5LD2C 2CV0A 1U2WA 3S17J 2VQCA 3HPHA 3UNGC 2AXTC 3BR2A 4G7OF 4LIVA 2O6GE 4I01A 4JK1X 1IRFA 3IKTA 1HBXG 3IH4A 2LY2A 4YFXF 2P7CB 2DMTA 1YG2A 3GEZA 3JRFA 1WHUA 2Z33A 1JKOC 4CCLA 2IGMA 3QP5A 2VBWA 3OL3A 1Z3YA 1K79A 3ESWB 1QPMA 4ABZA 5JHFA 1FTZA 3PO3J 3M4OJ 3BR3A 1FX7A 4LOCA 4UUSB 2YR2A 3OY9A 1SC7A 4AVZA 1SFOJ 4KIGA 5JR3A 1RIOH 3M7GA 4G12A 3H36A 2CJJA 5H6RA 2CQ7A 2WA0A 2Y30A 1T38A 3O6BB 1R49A 5DTDA 3HOZJ 4IHWA 2Y31A 5ERIA 1WPKA 3N97A 2ZFUA 3A2KA 3OWTA 3I71A 4P9UA 1HOMA 2IAIA 2KRCA 2K4JA 4GYGA 2HI3A 3MFKA 1OYWA 4MLOA 4BQAA 3KZIC 5HLGA 1BBYA 2HTSA 2EFWA 5CKTA 2KL4A 3KP6A 2EK5A 2X6OA 5BPDA 5EEAA 2P7VB 3CESA 3TOBA 3CDIA 5EG0B 2CW7A 4MQVA 4LLNA 1BI1A 4ENMA 1QBJA 4BGDA 5GAGJ 3K10A 4BACA 4RB2C 3CD6I 2J5OA 2TDXA 3LFUA 4F7ZA 1WZ2A 3JREA 1D1CA 3PUBA 1OMIA 4RA2A 1IC8A 1L3LA 2NVTJ 1MBFA 2VBYA 1T6SA 4BY7J 1DU0A 3ERED 2CFOA 3GF2A 3LA7A 1FYKA 4LITA 3FXKA 3AKZA 3GUDA 2KDZA 1BI3A 1BM9A 2KQRA 1RESA 1LDJA 1T56A 1X3ZB 4IOCF 2EFPA 3S3NA 3HHGA 1N78A 2AO9A 3W6JB 2EQRA 2TRTA 2L7FP 5M3MJ 2XSDC 1D5YA 4WK8F 1QPIA 4A3BJ 2PMZN 3DU5A 3K4CA 4E4HA 4CYCB 1PVEA 3N05A 4MIMA 3TOAA 3CO6C 4CH7A 4Q5SF 4U0VA 3TO6A 2Q2EA 3F9KA 2VPLA 3MKLA 2CUEA 1I5ZA 1K4TA 4M71A 1W7PA 4KDPA 2HZDA 3GTGJ 2LF7A 1MNEA 4ZDPA 3OIQA 4C9YA 2FUG2 2RV8A 3GTOJ 2EZKA 3A0BC 2N8GA 2BBYA 2DYSH 2QUFA 2K40A 2HXOA 2DA5A 1I3AA 1ZG3A 4Q47A 1G59A 4C3HJ 4L9VA 2VJ5A 3R4KA 1AA7A 4N0BA 1XGSA 3LSIA 5EGOB 2Y0SN 1TL8A 2VC1A 1A36A 4CZZA 4XKBA 2MBFA 1I3QJ 2E2IJ 1QU3A 3IUOA 3FXLA 3TDUC 2PBIA 4IXAA 1IW7F 1K61A 3KFWX 2QWWA 4LG0B 3CCYA 4O6JA 3S8PA 3HRSA 2JPBA 2DTZA 2VKEA 2DA2A 3H3ZA 3BTLA 4IRIA 2W25A 2XGEA 3PIOF 1AHDP 5J40A 2L01A 5K5RA 3HJEA 2ESHA 3K70C 1IN4A 2XAJA 3TKYA 1B4AA 2DFEA 5DM6F 3MWMA 3RDIA 1DPUA 3MAJA 1ETWA 3C2HA 4DZPA 1Z21A 5DUIA 2XGCA 2X1DA 1N25A 2JT1A 4XORA 4GCVA 3U21A 3K4MA 3ELKA 1GVDA 3QOEA 4A5MA 3F22A 3JTHA 4A0ZA 2ELHA 2VE8A 1UHMA 3BTIA 1UJ8A 1VZ0A 3SQNA 2DTRA 2XDVA 1OR7A 1IRGA 1R6RA 2KHMA 3E5UA 4I98B 2A68F 4XLAA 1K4SA 1MMGA 2R7TA 5F04A 4IQJA 1S3JA 1SFUA 2L9NA 4BXXJ 2VOPA 3NARA 5E20A 5ED4A 1LDDA 3KP7A 2MFZA 3SDGA 2HNHA 1U0JA 3TQNA 2LFBA 3ERMA 1MMDA 4BS9A 2M4GA 3E6BA 1I6HJ 1FMVA 2KZGA 3ASOH 4KJZA 4RAZA 4Y17A 3KPHA 1XSVA 3RKWA 5J4VA 3BP8A 3MZHA 2PLYA 1NK3P 5B1AH 4PGHA 2LBFA 3HZJA 4GFBA 3I9V2 2BVLA 4AYBN 3HG9A 3GLXA 3HSFA 1Z7LA 3BOQA 4FTHA 2QSGX 3VSLA 1LNWA 3HXLA 2XIGA 1UMQA 2K7LA 3RPQA 4DW6A 2F5CA 2YS9A 1X1DA 2MA3A 5K7ZA 4OU0A 2IW5A 2DDBA 3ROUA 2BZTA 2EFQA 2OPTA 1FSEA 2IA1A 2V79A 2MG4A 3KP4A 4ASNA 2R93J 3BG9A 3TP3A 4PSXA 1Z1DA 3K4KA 3S3OA 1X1AA 3IH3A 3BG5A 5KK1A 2VBZA 2RVCA 3HC7A 5HNFA 4A6DA 1NK2P 3WHBA 2NVQJ 3K4BA 1JE8A 2LC2A 2FRHA 3HGGA 2ZO4A 2X6XA 3HB9A 1N75A 1I6XA 5ILVA 5F08A 2V4JC 5ICEA 2OCEA 3FM5A 5CVJA 2E1OA 1JT6A 1JHHA 1DQUA 1VQPI 4FE4A 3SZTA 4RDUA 2D1VA 5D8LB 2PMUA 2VJIA 4I02A 3SFIA 4WXCA 1SD5A 2ZXHA 3E6CC 4EMSA 3BR6A 1OYYA 4WXHA 4XBFA 2GIZA 4OIRF 3HTUA 4DYRA 4I99C 2G7UA 1LFBA 2MABA 5FJ8J 5LHGA 1XGMA 3F8CA 2IS2A 4P1WA 2VQGA 1JKQC 4RGSA 5LRSA 4BXUA 2VLAA 5IP6A 5TRDA 2DFIA 2A6HF 1TWAJ 2VJ4A 4OAYA 1XDUA 4RM2A 4ZYGA 1XGNA 3T0YA 3BJOA 1V5EA 4ENNA 2CW0F 4KITB 2ZJRF 2R7SA 1GV5A 1MKMA 2UUZA 3OYHA 1OKRA 3IH2A 1P92A 3G6EI 4V19K 2PFBA 1J2XA 4JQFA 1VQLI 4OIOF 1AU7A 1YIOA 1E3HA 1MMAA 3GCMA 1TP4A 4C2MJ 3KYLA 1R4MB 4LFUA 4AIKA 5CVVA 4XQFA 1NG6A 1S6LA 3RZDJ 1C0WA 4CDGA 1OPCA 2HQNA 4LK1F 4Y4RA 3DF8A 5IP7J 3LSJA 2IRFG 4BU2A 4ZDOA 4BDYA 2DMNA 2FJ1A 3CTAA 2VT3A 3RKQA 2HPIA 4BE1A 1R22A 5ICFA 2XHKA 2R5YB 2Y0SA 5LHIA 1S72I 3E5QA 3C18A 3QU6A 4XONA 5DDGA 3E7LA 4BH9A 2BHZA 2QGUA 2ZXWH 1W5SA 4F55A 1TNTA 2LSOA 3Q3SA 1T08B 3FMQA 5FD5A 5CVIA 3BTCA 3TO9A 1LE8A 4IHSA 1KU2A 4NQWA 5CPRB 4A3KJ 1IXRC 1ETYA 4ZZDA 4CYDA 5C4JJ 3K1MA 4PJLA 4NNJA 2P5VA 4JX5A 1OJLA 1HW1A 1JUSA 4L5EA 2MSYA 3HEFA 3MVPA 1SMYF 4D9JA 5BQTA 2L9VA 1I1GA 4CA0A 4YFKF 4EM1A 4A3FJ 2R0QC 3CJTB 1YFHA 2NS8A 3KZYA 4KNYA 2X48A 2Q0OA 3K4NA 3GX4X 2FNPA 1GT0C 2BVMA 5D5XB 3HOXJ 1JHFA 2VXZA 3BCBA 5IP9J 1O7LA 4I0AA 5K5QA 3HOYJ 1IZ1A 3V42A 5C4XJ 2V6EA 4EVIA 4BJTA 3R0JA 4H4KC 4A3MJ 5IYCJ 3VYRB 3LQQA 1O3TA 4BHBA 2GOMA 3OYNA 3DFGA 4C3JJ 3X2QH 3OYAA 1WCMJ 2FMLA 3FDYA 2CQKA 5HLTA 4A5NA 3RQ4A 2HZTA 4MFEA 3ML6A 4ZJZA 1NTCA 2M4KA 3F6VA 3ZQLA 3F8MA 1N77A 3K4LA 1BJZA 3BR5A 3C2GA 3F72A 3BQZA 4MHGA 2V1UA 2FBIA 1IO2A 3CLQA 2EBIA 2ME0A 1YX5A 3TW6A 4OIQF 3VYTB 3WGHA 1PP7U 3F8FA 4YELA 2HQAA 4HX4A 1QO0D 2CG4A 3KETA 1S7EA 2ZJ2A 1B72B 4OMYA 2OUMA 1XPXA 1VQ6I 3WTTC 3P9IA 1J9IA 5CJ9A 3PQKA 4EATA 3A02A 2ZMEC 2O7OA 2QQ8A 3O8HA 2K86A 3PL8A 1ERDA 3U1DA 2KMUA 1TQIA 2FMYA 2FX0A 3CP2A 4A3CJ 1SVLA 5ILUA 1JUPA 3W2AA 4PK4A 1DUXC 5D6FA 2K9NA 4M3EA 2X6WA 4Y52J 2L02A 1F1ZA 4D7NA 2VL8A 2XRNA 5EEGA 3CUQA 2LG4A 2DI3A 2H8WA 3HYIA 3OYMA 3W6KB 4XRSG 4WWCA 2JPCA 1P9QC 1ZQ3P 1XCBA 1G3WA 2QSHX 4TV7A 1A31A 1ZELA 2HDWA 1D8KA 3ECHA 3W2VA 1LEBA 1MDMA 2KJCA 4ZYHA 3L2UA 1TQMA 3JSPA 3I4NJ 4UB6C 5E8GA 3PQJA 2LYCA 1RPWA 3MKYB 1W36D 2FQ4A 4ZDLA 2HFHA 3DKWA 3S15J 1UG2A 1P4XA 2O03A 1D1BA 3CDHA 2BYVE 4G6TB 1ZH5A 3J7YJ 2NOJB 2WADA 1X3WB 3FK6A 2R7WA 2WTEA 3WU2C 2FEZA 3LFKA 1KU3A 1KQ0A 3DP7A 5D5VB 4XKWA 1D5VA 4HX7A 3VWBA 3P5JA 5EF6A 4XKVA 1FY7A 2H1KA 3ZPLA 2XROA 4BEHA 2XKOA 2UWMA 2NS0A 3LNQA 2A3SA 3CJNA 1TWFJ 2EV5A 3G1LA 2Y9YA 3L00A 3VSKA 2H8RA 2VQHA 2HR3A 2OD5A 5DS9A 5K7HA 4G9YA 4XKCA 2M87A 2X1CA 1HW5A 3UR3C 4IHVA 4CICA 1OCCH 5FROA 3SEZA 4PJ0C 2ZMEB 2EA2A 3WTWC 1LVKA 1H88C 4M6YA 5FRNA 4DIQA 1LUJB 4HAMA 2W48A 3Q9SA 2PI0A 2CQXA 1WRJA 2G0EA 1ETKA 2HOTA 1MD0A 2ZNYA 3GZNB 4XSZF 3HSEA 1DP3A 1YOVB 1XG1A 1E2XA 5JHUA 3JTGA 1ETVA 4NDLA 4Y15A 4E70A 3OYBA 3MD2A 2V7FA 2QQAA 3GMEA 1YITI 2Y9ZA 3S2HJ 3VOEA 3RQIA 2MLGA 5A2QK 5JFRA 1FBQA 1WQ2A 5IY5H 5HLHA 3QWLA 3HOWJ 5B66C 4EM2A 3DPUA 3L2RA 3MMYB 2F6CA 2BY3A 4RLFA 5H6QA 2HYJA 1YYVA 1V4RA 1SD7A 1W7PD 2D1HA 1YLFA 2L7MP 2OU2A 4UHTA 3A4CA 2ZJQF 4BHCA 1TTYA 1XMXA 2NVUB 3WG7H 2JA5J 1OCPA 2EA4A 3QODA 1YIJI 2NVYJ 5J3LA 3ZXSA 4BHPA 1QHGA 1OQYA 2HYFA 2CW8A 2IGKA 3DKYA 4A3DJ 3FM3A 1XN7A 1BW6A 1MGTA 3J80Z 1TNSA 1TWCJ 4UVAA 1AKHA 2E19A 4HSTA 3RKYA 4BE2A 4QSHA 3EUHA 4JX6A 1HA8A 2YUSA 3IWFA 1RUOA 2KT0A 1APLC 1S5LC 3E6MA 1TZLA 3KP5A 2VE9A 3IAM2 2PN6A 2BHYA 4LGWA 3FIWA 5BOXA 3AFHA 4DJAA 2JA8J 3DLAA 4OAZA 2EFNA 3Q0WA 2L7KA 2MGQA 4LLLA 1F36A 1Z7UA 4FHTA 3DEEA 3PFIA 3CJRB 4GYIA 4IHXA 4XN0A 4IRHA 1U78A 2QBYB 1IRZA 3M3YJ 1PUFA 2NXNB 2M7BA 3AL0C 2HEOA 1VI0A 3LSKA 3GFIA 1YI2I 3S93A 2XAUA 2LKXA 2HOEA 1VQ7I 3HTSB 4N9HA 4HOBA 1OFCX 2OQRA 1Y8RB 2E36A 2E60A 2EIJH 5HODA 3M8FA 3LAJA 1J09A 2P4WA 2I8DA 2EV6A 2IA0A 4Z6YA 2KRHA 1U9OA 2GM4A 1WGXA 4RB0A 2ADUA 2DPUA 2VT2A 3WE2A 4A12A 1ZLKA 2IS4A 4HA8A 2M0CA 3RZOJ 5TGTA 1B9MA 2HYGD 3EDPA 1MBGA 3BROA 2A6TA 3F23A 3Q9VA 4HG2A 2FBHA 2VONA 2L2OA 4C3IJ 3DPTA 1W36C 3GLLA 3AAFA 2L0KA 4XOTA 2STWA 2F5FA 5F1JA 1ENHA 2KISA 1GXQA 2L9SA 4YEJA 3G73A 1H9TA 2LKPA 3HUGB 3ZQ7A 3IKVA 4RAYA 2A07F 3CCLI 2Z1DA 2ZCWA 5LRRA 3GTKJ 4A3EJ 2LOOA 3VFZA 2W7NA 2V26A 2YPRA 1YW7A 2WB1A 2XF6A 4DGWB 2GXAA 2KDOA 4K2EA 2R5ZB 4RGRA 1S9HA 1ORKA 5KAFC 3ZMUA 1ZHFA 3OOUA 4BE0A 4ESFA 3BCAA 4L5JA 1KU9A 3OS0A 1EH6A 3KP3A 4HLXA 2D45A 3FBNB 4S04A 2BE5F 2CGPA 1AOYA 1NHAA 4CZCA 3LL7A 4I6ZA 3RTRA 1SAUA 4ENJA 4C2UA 3JAMK 4Q4ZF 2EILH 1TW3A 1F4KA 2XSJC 2R7OA 4JP0A 1FTTA 3WTYC 1RC9A 3ABTA 2DMPA 4F92B 3F6OA 2LTPA 2JWTA 3H35A 2Z2SB 2DXIA 4EQQA 2MW8A 4UUVA 1UZCA 3AL0B 1U3EM 1CF7B 1D3YA 1FPQA 5DD4A 3CCUI 4A3IJ 1JGSA 1VTNC 1IJWC 2V9PA 2AHQA 2IJLA 2DJIA 2FSWA 3F21A 2QA4I 2OZ6A 2XVCA 3DEWA 1P7JA 4PDKA 2PG4A 4FX4A 4ZH4F 4OMZA 3JRCA 1WI9A 4M3BA 2JZYA 4EJWA 5DM7F 3WODF 4EGZA 4IEJA 2A6EF 4A93J 1G3TA 2V9KA 1LB2A 3L2CA 1ONVA 4BY1J 2OTLI 2OJED 3ULQB 2DK5A 4NB5A 4DBQA 2JUGA 2H6CA 3FXUA 1OLTA 5HS9A 3EETA 2K5CA 4HV5A 2IBDA 1IUFA 1QVTA 2JTVA 2H27A 5D6EA 5ICCA 1CGPA 3ABMH 1BI2A 5HNHA 1ZGJA 3LMMA 2F5EA 3DLLF 3QYEA 4XLEA 1XTAA 4NHJA 1YS7A 1Q1HA 2KJBA 4QPQA 3RIRA 1G3YA 2FA5A 5L3GA 2CUJA 4MQ9F 3V8LA 1USTA 1DP7P 3IRRA 5FRMA 2I10A 3SDBA 4D1QA 4O3MA 2R92J 2GOXB 3I59A 2DCEA 5CQEA 3COAC 2V1NA 2QQBA 3FXMA 1E0EA 4GGGA 3OL4A 1U5TA 4EGYA 3OR2C 4UB8C 4I7HA 4XSXF 2OF7A 4N4NB 1H89C 5GAHJ 1XMAA 4BBRJ 1PUEE 3IL2A 4IRGA 1IRXA 3PIPF 1KU7A 1MBJA 4PUSA 4FETA 2EINH 3B73A 4KFCA 1J5YA 1E3PA 3BPVA 2E1NA 4QPOA 2C6YA 4IL6C 2DYRH 5HS7A 5J8FA 4CCNA 2ZKZA 1T0FA 2JVGA 2K3PA 2P6SA 2Y48A 3A03A 1QZEA 2HKOA 3RKXA 2B0LA 5FFXA 1LJ9A 4GRIA 4P9FA 1K78A 3OYFA 1HF0A 3RYRA 4IQ4A 4KUMA 4FCYA 4KT6A 2O9LA 1SVOA 1LPQA 1U8RA 1OR7C 3LSPA 2KIUA 4QTRA 2ELJA 2Q8KA 3TBIA 2D5VA 2DLLA 1CQTA 2Q2EB 5FFZA 3SXYA 2GIVA 2DN0A 3F0CA 3GXOA 2FU4A 1T2KA 3O8GA 4EEFG 4UXNA 1W7PB 3KYDB 4CCKA 4IOAF 5J1YA 3S32A 2DFHA 3JSOA 2VXDA 3B6AA 3GYHX 1XGOA 1A04A 5E1ZB 5E8IA 4KICA 1RZ4A 5CQGA 5M5YJ 3KE2A 2DU9A 2O8KA 4YG2F 5HS8A 1QQIA 1X4OA 4MEXF 1R58A 3C2BA 3HOSA 1VQ4I 2IA2A 5M5WJ 3GWZA 1MBHA 4LD5A 1Y6IA 4BQOA 1IN5A 3K2ZA 2VKDA 2QKLB 1FP2A 2UXXA 3ECOA 2V1XA 2MC4A 3I56I 4M72A 1VNDA 3QOPA 4WCGA 2HVSA 3I4MJ 2CFXA 4Y13A 3GW2A 1H0MA 3FHZA 3B02A 1ON2A 4ZTJA 5JVTA 3T8TA 2K85A 4WXDA 4X6AJ 3J7ZI
chains in the Genus database with same CATH topology
1YX5A 2E1MC 4DBRA 4ZC3A 3VYTB 2E5ZA 2ZXIA 4YELA 2HU9A 2W4SA 2HQAA 1YE9A 2CUZA 3H9GA 2OUMA 2CV1A 3OYGA 1X4PA 4EATA 1LFPA 2JA2A 3L2QA 3OYJA 4KISA 5HOOA 2X1EA 3PL8A 1ERDA 2KMUA 3OIPA 3PNVA 2ZSIB 3CP2A 3W2AA 4PK4A 3H9JA 4PSWA 2X6WA 4RLQA 2BOLA 3QYFA 3OYIA 4IKFA 2O5RA 2VL8A 4F52A 4HNTA 4E7HA 2LG4A 3PJRA 3OYMA 3K70D 2R7VA 3NWTA 3W2WA 3ZQQA 1P9QC 2CS3A 3H0DA 2F4IA 1YX3A 1ZELA 3RSNA 1TT0A 2HDWA 3H5AA 2W1OA 3W2VA 3SZGA 4E7KA 2E5NA 2CH0A 3BLYA 3L2UA 3KX2A 1D0YA 1X19A 1WJDA 2LBFB 3HL2A 3E1SA 3DTKA 5LD2C 2LYCA 3MKYB 1W36D 2CV0A 4ZDLA 2WAEA 2AQFA 2VQCA 3HPHA 3UNGC 2HPMA 4E7SA 4ANJA 4LIVA 4ZYAA 1D1BA 4G6TB 2NOJB 2WADA 2P0WA 2R7WA 2LY2A 4LIUA 4E7IA 2VKHA 4XKWA 3VWBA 4CCLA 1T0FC 2IGMA 4XKVA 4C2TA 3D5SC 4IX7A 2IS1A 3OL3A 1Z3YA 2MYSA 4BEHA 2UWMA 2E1MB 4F91B 2WAQA 5JHFA 3TL4X 5KNLA 3OY9A 3VSKA 2VQHA 4AVZA 3LSMA 4NC8A 3BG7A 2XF5A 3OS1A 4XKCA 2X1CA 3UR3C 4N4OB 3ZCOA 2WA0A 1Y56A 3K6GA 5FROA 3SEZA 1LVKA 1EA3A 5FRNA 4HNUA 4DIQA 2ZFUA 4RMNA 3OWTA 3A2KA 4XLFA 3G2BA 2KRCA 3OYEA 1LKXA 2LREA 4MLOA 3DWLE 3PNYA 4II3A 5CKTA 2KL4A 1D1AA 1DP3A 3CESA 2CW7A 4LG3A 2LH9A 3RCOA 4BGDA 2L5QA 3K10A 4BACA 3LFUA 2KPMA 1D1CA 3PUBA 3OYBA 3MD2A 2V7FA 3MKWB 2CFOA 4LITA 4B44A 1SFKA 3AKZA 2R7RA 1MW7A 2WAFA 2KQRA 3CZ6A 2IGNA 3S3NA 3DPUA 1N78A 2F5VA 3MMYB 3L2RA 2IGOA 2F6CA 4RLFA 4C30A 4E7LA 1BOBA 3IAS2 3M8JA 3DU5A 3K4CA 4E4HA 3A4CA 1DGWY 3N05A 4XR6A 3ZRGA 4CH7A 3MKZA 1Z3XA 3LSGA 1MMNA 3NWSA 3QODA 3F9KA 2VPLA 4PFOA 3ZXSA 1QHGA 2CW8A 2IGKA 3DKYA 4YRVA 1WJEA 2HZDA 4XLHA 2R4GA 1MNEA 4ZDPA 3OIQA 4HSTA 3RPUD 4C9YA 4BE2A 2FUG2 3ZGKA 1JI8A 1HA8A 1V5GA 4BXFA 3H9QA 2RNGA 3CJQB 4NQWB 1TZLA 4J00A 4RM3A 4CCJA 3IAM2 2CV2A 4XN3A 1G59A 3EUKL 3AFHA 4DJAA 2VJ5A 1AA7A 2KLOA 3DLAA 4OAZA 3HKZA 2L7KA 4II2A 4Y3OA 3LSIA 2JSPA 2K9LA 3OS2A 3QYBA 1UG0A 2PMZA 3OYKA 2BW3A 3DEEA 4XKBA 1QU3A 3IUOA 5KHDA 2Q1ZB 3CJRB 5LFAA 4XN0A 3ONQA 3S8PA 3J7AY 4PJNA 2M7BA 3AL0C 3OYLA 2PJRA 3LSKA 2W00A 3S93A 2XAUA 3ZR8X 4BDZA 2LY1A 3K70C 2E60A 4PJJA 4B47A 4BJ6C 4X0GA 2M3AA 1V5FA 1J09A 2I8DA 2KRHA 3C2HA 4R79A 1Z21A 3KEYA 1T95A 2X1DA 2IS4A 2X85A 4XORA 5TGTA 3U21A 3K4MA 3QOEA 3FHNA 4FASD 4ITVA 2R7UA 1LDKB 2A6TA 4PJMA 2M0MA 4HG2A 2L2OA 4BJ5C 1VZ0A 1BR2A 3DPTA 4B48A 1W36C 4XOTA 2XDVA 4AU7A 4XMYA 3GBGA 1R6RA 2KHMA 2L9SA 2HVQA 4YEJA 2KZVA 4XLAA 3HUGB 1MMGA 2R7TA 4BUPA 4E7JA 2Z1DA 2RREA 2LOOA 4IQJA 2W7NA 2V26A 2L9NA 2WB1A 3LSHA 4JOMA 2MFZA 2XF6A 2Z16A 4DGWB 2HNHA 1U0JA 2KDOA 1MMDA 4BS9A 2M4GA 1S9HA 1FMVA 4KJZA 1BR1A 3OOUA 2ZSHB 4B43A 4BE0A 2XF7A 2LBFA 3BCAA 3I9V2 2BVLA 4U87A 3OS0A 3HG9A 2QKMB 3VYSB 3FBNB 1Z7LA 2A5WA 4P5OA 3LL7A 3VSLA 4CZCA 3RTRA 3HXLA 1SAUA 4C2UA 1X1DA 1QHHD 1G8XA 3D5LA 3BC8A 2XSJC 2R7OA 4CUGA 4HEA2 4XNFA 4F92B 2K9MA 4NUBA 4PSXA 3K4KA 3S3OA 1X1AA 3H35A 3M1CA 2Z2SB 4XOPA 3OYCA 2DXIA 2UV1A 1WJAA 2AQEA 2OV7A 3AL0B 3HC7A 5HNFA 2VJJA 5KCMA 3K4BA 2LC2A 2DOAA 2X6XA 2DJIA 4CCMA 1N75A 4Y33A 2WY7Q 2V4JC 3SEQA 3CF2A 1DGRM 1WJBA 1DQUA 3EUAA 3OMYA 4F3QA 2JVHA 1D0XA 2V9KA 3A1YA 4AYBA 2VJIA 1X1CA 1BR4A 2ZXHA 2VASA 2DT7B 2X6YA 4DBQA 2JUGA 1OLTA 4HRIA 2K5CA 2VB6A 2DT6A 2MABA 4BEHB 5HNHA 1WJ5A 2IS2A 3LMMA 3DU6A 4P1WA 2VQGA 3QYEA 4BQQA 4XLEA 4E7ZA 1WJCA 4QPQA 2VLAA 2CUJA 4CSWA 2W82A 1WJFA 3EUHC 3K4JA 3PSFA 3L2WA 1D0ZA 4U7BA 2VJ4A 4OAYA 4RM2A 5FRMA 3SDBA 3DKXA 4D1QA 2GOXB 2DCEA 2MD0A 5CQEA 4CCOA 2V1NA 1V5EA 3VDXA 4KITB 1E0EA 2R7SA 3OL4A 4B3XA 3PSIA 2UUZA 3OYHA 3PFYA 2VIXA 3OR2C 4JQFA 4HSRA 4N4NB 1MNDA 3CMMA 4HPQA 3IP4B 1IRXA 3D5RC 1MMAA 4NC7A 4PUSA 3KYLA 4FETA 4XLCA 4XQFA 1NG6A 2WY8Q 4PFPA 4Y4RA 4QPOA 2HVRA 4BL0B 4BU2A 4ZDOA 3H5NA 2OC6A 4BDYA 3TMOA 4CCNA 2HPIA 2JVGA 4BE1A 2K3PA 3OYDA 3DQVC 2R7QA 2Y0SA 1K6YA 3EPZA 4GRIA 3OYFA 4XONA 2CMPA 2RQQA 3PNTA 4F55A 4IQ4A 3HOTA 2R7XA 4KT6A 1UELB 5CPRB 4F93B 3E0JB 3DPLC 2X51A 1WFXA 4E6KG 4PJLA 4NNJA 1OR7C 2KP6A 3SYTA 2LRDA 2ELJA 3TBIA 2IXSA 1GLNA 1FMWA 2Q2EB 3OR1C 4D9JA 3W3CA 4IZZA 4CA0A 3I3LA 3CP8A 4CCKA 2M7AA 3S32A 3K4NA 3FKJA 2VXDA 2BVMA 1X1BA 4ZTFA 2VXZA 3BCBA 2VQLA 5CQGA 3FBIB 4DOZA 3V42A 1X4OA 2V6EA 1UAAA 4BQNA 4BJTA 4H4KC 1PJRA 3HOSA 3VYRB 2IS6A 2GOMA 3OYNA 3BG6A 1NG7A 3OYAA 5HVQC 1Y6IA 3FDYA 4BQOA 5HLTA 3DTEA 2VKDA 2QKLB 3RQ4A 2BW3B 2WBMA 3VYUB 4ZJZA 2MC4A 2M4KA 3H5RA 4J01A 3HPGA 2HVSA 3DTIA 3L2VA 4OWRB 4XL9A 2XC7A 4ZTJA 1N77A 2PJRB 4XM3A 3K4LA 1PYVA 3C2GA 3S3MA 1KONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZV A;  2LY2 A;  3S93 A;  2LH9 A;  2KPM A;  3RCO A;  2LY1 A; 
#chains in the Genus database with same CATH topology
 3EYY A;  2L4A A;  2E1M C;  3ZMZ A;  1MJA A;  3ABK H;  4ZC3 A;  4DBR A;  2LVS A;  1MBK A;  4MO7 A;  2E5Z A;  2HU9 A;  1HXD A;  2FD5 A;  1YE9 A;  3FIS A;  3M07 A;  2MD5 A;  2GLO A;  2PX9 A;  1X4P A;  1W0T A;  4D5F A;  3L09 A;  2UZK A;  3L2Q A;  2H1L A;  4YIF A;  4KIS A;  3K1P A;  3OIP A;  1J59 A;  4A3L J;  2KIM A;  4LLG F;  1SD4 A;  3KLN A;  3H92 A;  2ZB9 A;  5FKO A;  1IUY A;  1JTY A;  2D2W A;  5DD8 A;  3BJA A;  1LQ1 A;  2F4M B;  3FMS A;  4PSW A;  1J75 A;  5FLX K;  4RLQ A;  5DV5 A;  3QYF A;  3OYI A;  1T39 A;  2O5R A;  1MH4 A;  4IVN A;  4E7H A;  3PJR A;  2R7V A;  2QZ8 A;  3NWT A;  3ZQQ A;  4M3G A;  3PO2 J;  3S16 J;  3H0D A;  4FQG A;  1YX3 A;  1TT0 A;  1Y0U A;  3GFJ A;  4B4C A;  1RKW A;  3H5A A;  4I76 A;  4CHU A;  4XRS A;  4E7K A;  2E5N A;  2P5K A;  2ISY A;  2PEX A;  3BLY A;  2XB5 A;  1ZGA A;  1Z67 A;  5IOZ A;  2M34 A;  4KN7 X;  2EB7 A;  3NRV A;  1IXC A;  1J7K A;  1RR7 A;  3A0H C;  3M8E A;  2LBF B;  2JQ7 A;  4L18 B;  4CXF A;  3SHF A;  5LEK A;  3T5X A;  2WAE A;  3ZMS A;  2HPM A;  3L9F A;  3WE3 A;  4E7S A;  1B1B A;  1MH3 A;  1ZR2 A;  2EZL A;  4ZYA A;  1T8I A;  3H3V K;  5E3L A;  4V2F A;  2P0W A;  1WI3 A;  3V7S A;  3V7C A;  1MSE C;  2MH9 A;  4YIR X;  2W85 A;  3EYI A;  4LIU A;  1BW5 A;  2NAZ A;  4KYW A;  1BC7 C;  4IPA A;  4E7I A;  2GAU A;  2QM3 A;  5F0H A;  2O0Y A;  1Z6R A;  1WWX A;  4C2T A;  4PGG A;  3MZ8 A;  1MSF C;  2XAH A;  5FKK A;  2E1M B;  1OIS A;  2WAQ A;  4W97 A;  3I58 A;  5EJC A;  3TL4 X;  3HM5 A;  5J4Y A;  5KNL A;  1NH3 A;  3WTX C;  4KT5 C;  4V2G A;  4B8X A;  1YJW I;  1PDN C;  2F48 A;  3QPS A;  5J1R A;  4N4O B;  3ZCO A;  1Y56 A;  3CME I;  3BR0 A;  1TC3 C;  3FZV A;  2GA1 A;  3OV8 A;  4B3A A;  2GXG A;  3E6D A;  4UUT A;  4RMN A;  2FBK A;  3WU1 B;  4XLF A;  3G2B A;  4U0W A;  2M30 A;  2LRE A;  3CCQ I;  3GTL J;  3DWL E;  3PNY A;  4HDV A;  2A5Y B;  2VOO A;  1ZKG A;  3OOP A;  1F5T A;  4ESJ A;  1FLI A;  3U1K A;  1LVA A;  3V8J A;  2LH9 A;  4ZZL A;  3RCO A;  2L5Q A;  3IV5 A;  4MGR A;  1L0O C;  2UXN A;  1KA8 A;  1B9N A;  3DCF A;  2L9R A;  2KPM A;  5DCM A;  1OCO H;  4AVP A;  2XRL A;  4FIS A;  2BY2 A;  1QGP A;  5H2F C;  2HGC A;  3K0L A;  1Z6T A;  1IN6 A;  2E2J J;  1SFK A;  3I64 A;  2R7R A;  1ETO A;  2CWE A;  1MW7 A;  1P2F A;  2WAF A;  1OCT C;  1OCR H;  3R6S A;  4D5C A;  2NVX J;  3GFM A;  2F5V A;  3KZZ A;  3QAH A;  2COM A;  2IGO A;  2X4H A;  1YRN A;  4IHT A;  4MTE A;  5FKL A;  4C30 A;  1BOB A;  3C7J A;  3IAS 2;  1ZK8 A;  3O2P E;  4R1H A;  5K5O A;  2DOD A;  2ECC A;  1YW9 A;  1HCR A;  2WWY A;  2EV0 A;  3MKZ A;  1Z3X A;  3NQO A;  1MMN A;  3EQL F;  1KYW A;  2IP2 A;  1GDT A;  2FOK A;  2CYY A;  2Z99 A;  2HTJ A;  3V8K A;  2A69 F;  5IOY A;  1WSU A;  3K7A J;  1B6A A;  3BG3 A;  4YRV A;  3KCC A;  4UNO A;  1MJB A;  4A69 C;  4XLH A;  1FIP A;  2R4G A;  2W24 A;  3HRU A;  1JXS A;  3ZGK A;  2KKO A;  4HF1 A;  4IF4 A;  1H9G A;  4BXF A;  1YQA A;  4KMU X;  2RNG A;  3WGI A;  2QYO A;  3CJQ B;  3H0G J;  4NQW B;  1LE8 B;  1R7J A;  4KN4 X;  1P4A A;  3GZ5 A;  1REP C;  1EV7 A;  2F2E A;  3UKG A;  2KLO A;  2WV0 A;  3HKZ A;  3RPU A;  1ZRD A;  4HW0 A;  4Y3O A;  3FK7 A;  1SAX A;  3L1P A;  2K9L A;  1BL0 A;  1EH8 A;  3ZQG A;  1UG0 A;  1UFM A;  3CUQ C;  2BW3 A;  1EH7 A;  2XAG A;  2Q1Z B;  2G7H A;  2P81 A;  5LFA A;  4L9N A;  5LGU A;  2RDP A;  3WTS C;  4LB5 A;  3BQY A;  3J7A Y;  3OSG A;  3OYL A;  2PJR A;  3O3K A;  2W00 A;  5E3N A;  3ZR8 X;  4BDZ A;  2WB1 N;  4X1E A;  3V7R A;  1XDS A;  3D1N I;  4PJJ A;  1SEU A;  2JUC A;  4X0G A;  5IT9 K;  1V5F A;  5DEQ A;  2VI6 A;  3GVA A;  1BIB A;  5L3C A;  4L0Z B;  4RB1 A;  2E7W A;  4NBQ A;  2X85 A;  4UVC A;  3CC4 I;  2QSF X;  1XCV A;  3FHN A;  4FAS D;  4ITV A;  1F9N A;  1R5I D;  2R7U A;  1S8N A;  1LDK B;  4RAG A;  1I27 A;  3BZC A;  2E34 A;  3WTZ A;  3ZN0 A;  2GA2 A;  5TJJ A;  1IG7 A;  4KIF A;  3DBL B;  2HOS A;  2RNJ A;  2A05 A;  3GBG A;  2XGX A;  2XUB A;  4DNC A;  2HVQ A;  2FQ3 A;  5GAD J;  1HQC A;  2Y75 A;  5HDN A;  2LMD A;  5F64 A;  4HV6 A;  4LK0 F;  4BUP A;  3DBH B;  4E7J A;  1FSH A;  3E97 A;  1O3Q A;  2L54 A;  5LGT A;  2F5D A;  3QP6 A;  3T1B A;  4EJO A;  4JOM A;  2YX4 A;  2ECB A;  1VQ8 I;  2HQR A;  1R9T J;  1ETX A;  5FLM J;  1MBE A;  3A01 A;  2PQ8 A;  1R23 A;  1MMS A;  2YSR A;  3WTU C;  1BR1 A;  3PM1 A;  2ZSH B;  2QQ9 A;  4B43 A;  5DUK A;  3WTV C;  1JKR C;  2M8G X;  1X58 A;  2PMH A;  2XF7 A;  3GFL A;  4AD9 A;  1YO5 C;  2QKM B;  3VYS B;  1HLV A;  4IO9 F;  4I2O A;  2HWV A;  1EJ9 A;  1O3R A;  1G8X A;  3BC8 A;  2DK8 A;  3CUQ B;  2VOD A;  1FOX A;  2OAZ A;  2WC2 A;  4CUG A;  3HDD A;  1IGN A;  4I09 A;  1Z77 A;  4FX0 A;  3JW4 A;  2VPR A;  4NUB A;  1TW2 A;  3M1C A;  2W84 A;  4AIJ A;  4FE7 A;  4XOP A;  2K27 A;  2LY9 A;  2MLK A;  3FXO A;  1WJA A;  3OYC A;  2AQE A;  2OV7 A;  2LNB A;  5GPA A;  1MDM B;  3ZMV A;  2G9W A;  5KCM A;  5D5W B;  2X9D A;  1Z9C A;  1PP8 F;  5BS6 A;  2MC3 A;  3QRF F;  1VFC A;  2R7Z J;  1VQO I;  1ZTR A;  4UUS A;  2OA4 A;  3CF2 A;  2L3D A;  4XK4 A;  2EIK H;  1WJB A;  2FNA A;  3OMY A;  4F3Q A;  4S05 A;  4AID A;  4HQM A;  4KMF A;  2EIM H;  1D0X A;  3A1Y A;  1P6R A;  2XAS A;  1X1C A;  5JI6 A;  3J81 K;  1BR4 A;  2DDA A;  2VAS A;  1Z05 A;  1I1S A;  1AWC A;  1OCZ H;  3MCZ A;  2KIQ A;  2JRM A;  1Y1V J;  4ENK A;  1E3O C;  2VB6 A;  4H0E A;  2DT6 A;  5TIS C;  4HF2 A;  1V3F A;  4BEH B;  2FOW A;  5EG0 A;  2QVO A;  4BQQ A;  1O7F A;  1WJC A;  4NC6 A;  5ICG A;  5F1R A;  5FLV A;  5EZG A;  4CSW A;  2W82 A;  1GVJ A;  1WJF A;  3EUH C;  1IXS B;  3H1C A;  3K4J A;  3PSF A;  4XRF A;  5FB2 A;  4U7B A;  3ZQC A;  2XAF A;  4RB3 C;  3KYC B;  3DKX A;  2XPW A;  4WX9 A;  1G4D A;  2Y0M A;  3VB2 A;  3J80 K;  2M8E A;  2MD0 A;  2E7X A;  2H6B A;  3KP2 A;  1A35 A;  1R1U A;  2LDU A;  1IF1 A;  2NS7 A;  3OIO A;  1WH7 A;  1HC8 A;  1P4W A;  2VIX A;  2CUF A;  3GO5 A;  1ZG1 A;  1B8I A;  1FOY A;  2O8X A;  5J8C A;  1MND A;  5JLW A;  5C44 J;  1RRJ A;  1MNM C;  3S14 J;  3TW7 A;  1BA5 A;  3IP4 B;  5KAI C;  1FP1 D;  2BGC A;  1HST A;  3AG3 H;  4W1U A;  4NC7 A;  1FBS A;  2R3S A;  1IDY A;  1W5T A;  3Q0V A;  2DA6 A;  1FOK A;  4CYC A;  4BL0 B;  4OOI A;  3H5N A;  1USS A;  1ZN2 A;  1STZ A;  4ZYE A;  3TMO A;  5E1W A;  4OIP F;  3QPH A;  2E1C A;  4G7Z F;  2GWR A;  5H20 A;  1E17 A;  1LFU P;  3BDD A;  4MEY F;  3U9G A;  3EPZ A;  2DQL A;  1Z91 A;  2ETH A;  3HHH A;  2CMP A;  2RQQ A;  4DYQ A;  4HQE A;  3LAP A;  3BY6 A;  1FJL A;  3H3U A;  5EYR A;  3HOT A;  1SFE A;  2DFF A;  2DJN A;  3E0J B;  3DPL C;  1YHQ I;  2CQN A;  2JRT A;  4E6K G;  4U88 A;  5L3D A;  2I5U A;  2ZJP F;  3AG4 H;  3SYT A;  4A6E A;  4DZJ A;  5HDG A;  4B1R A;  2JA6 J;  2IXS A;  1FMW A;  5EGO A;  2HQ5 A;  3JRI A;  2EZI A;  4IZZ A;  1GV2 A;  3W6V A;  3HIF A;  4L5I A;  3I3L A;  4O5V A;  3CP8 A;  1QRY A;  1U9N A;  3JAM Z;  2E71 A;  1R5H A;  3FKJ A;  1AKH B;  4LG0 A;  1XX5 A;  4A0Y A;  4ZTF A;  2R7F A;  1POG A;  2MH2 A;  3FBI B;  2XGD A;  4KIB A;  1UAA A;  4BQN A;  1ETQ A;  2HS5 A;  4BNC A;  2M45 A;  2IS6 A;  1JUM A;  1HKS A;  3G4S I;  3G3Z A;  1NG7 A;  3ABU A;  5E1X A;  3DTE A;  5GAE J;  2M9H A;  3VYU B;  2OCC H;  4Z2Y A;  2GQQ A;  2XPU A;  3H5R A;  4J01 A;  3HPG A;  1Y39 A;  3L2V A;  1HDD C;  5J1U A;  1PUF B;  3CCR I;  2JJ7 A;  4OWR B;  2Z5U A;  1PYV A;  3S3M A;  1UHS A;  1KON A;  4YFN F;  4CGZ A;  1B8I B;  4JYK A;  2RQP A;  2ZNZ A;  2ZXI A;  4XLN F;  2W4S A;  1FBU A;  2DPD A;  5BPI A;  3H9G A;  2BEO A;  2CV1 A;  3OYG A;  5GPC A;  4HYE A;  2JMW A;  2DQR A;  3FWE A;  2K9Q A;  4XID A;  4M3F A;  2X1E A;  5HDK A;  2ICW G;  2GZW A;  2KIF A;  2CQQ A;  1FC3 A;  3PNV A;  2Z9O A;  1G3S A;  1G6N A;  2ZSI B;  1XB4 A;  4HDU A;  3HBL A;  4P96 A;  1JJ6 C;  1FNN A;  2K9S A;  1O57 A;  2BOL A;  3L7W A;  4IKF A;  2V6C A;  1KZH A;  4F52 A;  4HNV A;  3G71 I;  4M6X A;  1LEA A;  4LB6 B;  3W2W A;  3FXJ A;  1XMK A;  2CS3 A;  2FXA A;  3TDZ C;  4M9Z A;  2ACJ A;  2F4I A;  1FYM A;  3I5U A;  3G1M A;  2WAQ N;  3KEO A;  2M1B A;  5BMZ A;  1ZAO A;  2GXB A;  3TED A;  1KQ8 A;  3QQA A;  1G2H A;  3KX2 A;  1D0Y A;  3ZOB A;  5D4S A;  5LGN A;  1XS9 A;  3HL2 A;  3E1S A;  3DTK A;  3JRD A;  1U5T C;  2Y2Z A;  3C3W A;  3LA3 A;  4RGU A;  4AUX A;  1XD7 A;  2AQF A;  2BXY A;  3ISP A;  1RNL A;  2OTJ I;  4ANJ A;  4LMY A;  2LK2 A;  2RC4 A;  3CCS I;  1R4N B;  1YJN I;  2VBX A;  3K69 A;  3IRQ A;  3MEX A;  5B5E C;  3T8R A;  1R00 A;  2H94 A;  2GBY A;  4UV9 A;  3IC7 A;  2VKH A;  1K6O A;  5DYM A;  2DA3 A;  1FYL A;  1T0F C;  2KFD A;  3D5S C;  4IX7 A;  3BR1 A;  1HKQ A;  2EFO A;  2IS1 A;  2DMQ A;  2MYS A;  3HRT A;  4ETS A;  4EJU A;  4F91 B;  5F0F A;  1ZAR A;  2HXI A;  3I55 I;  4UVB A;  3CCM I;  1BI0 A;  1FEX A;  1R5G A;  3LSM A;  4NC8 A;  3BG7 A;  2XF5 A;  3OS1 A;  1ITY A;  5JLX A;  4PCQ A;  1A6I A;  3K6G A;  2B7E A;  3E3V A;  3VEP A;  4LJZ F;  2DOE A;  1EA3 A;  4MNU A;  4HNU A;  1FWZ A;  4QIW N;  5LHH A;  5BNG A;  3OYE A;  1LKX A;  4AWX B;  3MN2 A;  4II3 A;  1DU6 A;  1S7A A;  3KIO A;  5FGM A;  3K9T A;  3DEU A;  1D1A A;  1VQK I;  1WKM A;  4HX8 A;  2O3F A;  4LG3 A;  2DOF A;  2XB0 X;  5E3M A;  3K1N A;  1ZR4 A;  4L9J A;  4PZJ A;  3QPT A;  4XIC A;  2TCT A;  5J6X A;  2B63 J;  1RET A;  3R0A A;  4XRM A;  3BT9 A;  1SFX A;  4J19 A;  3F8B A;  3BWG A;  3I59 B;  3MKW B;  3CMY A;  4BYY A;  4B44 A;  1BIA A;  4YII A;  2RAE A;  1O3S A;  2R5Y A;  1W4M A;  1U5T B;  2IT0 A;  3CZ6 A;  3U2R A;  3WHC A;  2YU3 A;  2ID3 A;  1T33 A;  2IGN A;  4RBO A;  5LLQ A;  3FX3 A;  4HZF A;  2QEX I;  5JVG F;  3I54 A;  3ZP5 A;  3WGG A;  3HKZ N;  4E7L A;  3M8J A;  1GUU A;  4S0H B;  2LR8 A;  1Y1W J;  2BV6 A;  3K2A A;  2E35 A;  1TT5 B;  3M1E A;  1F43 A;  1DGW Y;  3LWF A;  1MJ9 A;  4XR6 A;  3ZRG A;  5L3B A;  3LSG A;  3NWS A;  4A2U A;  1XSX A;  4Q48 A;  4M74 A;  2DMU A;  4PFO A;  5F0C A;  1WVR A;  3Q0U A;  4D0P A;  1QZZ A;  3DV8 A;  3HOV J;  2LP0 A;  5FLX Z;  1IN7 A;  1WJE A;  5F27 A;  2LKS A;  2YX7 A;  4DYC A;  2AXL A;  3HRM A;  1K78 B;  3R61 A;  1RUN A;  3RPU D;  3S1R J;  3AG2 H;  1JI8 A;  2QCO A;  5IT3 A;  1V5G A;  2Z3Y A;  1DDN A;  1X2N A;  3H9Q A;  5B1B H;  5DCF A;  3FXR A;  4J00 A;  4RM3 A;  4CCJ A;  2CV2 A;  3HGY A;  4XN3 A;  4RAF A;  3EUK L;  2DBB A;  1JTX A;  1W1W E;  3JR9 A;  4II2 A;  5M3F J;  4G8X A;  2JSP A;  3OS2 A;  3QYB A;  3F8N A;  2J5P A;  1ULY A;  2PMZ A;  3OYK A;  2ZXJ A;  3CF5 F;  3CCJ I;  2O61 A;  5CLS A;  2HDD A;  5KHD A;  3FKI J;  3ZQH A;  1HDP A;  3ONQ A;  1YTY A;  3QPL A;  2IPQ X;  2VC0 A;  4PJN A;  5AIP A;  2LD5 A;  5E79 C;  1IV8 A;  2ELK A;  2BXZ A;  1ZRE A;  4B09 A;  1BC8 C;  1U8B A;  1SVM A;  2LY1 A;  4N9I A;  3LST A;  2EJR A;  4BJ6 C;  4B47 A;  3TO7 A;  1VQM I;  2M3A A;  3SFZ A;  4ESB A;  1WH5 A;  2ID6 A;  1ZG5 A;  1B72 A;  4R79 A;  4M9X A;  4U0Y A;  2DA4 A;  1T95 A;  3KEY A;  3REO A;  2OQG A;  2E2H J;  3GTQ J;  1FIA A;  1ZRC A;  3FF5 A;  2W57 A;  2K3F A;  4PJM A;  2JSC A;  2M0M A;  4BJ5 C;  4B48 A;  1BR2 A;  1YW8 A;  4AIH A;  3I0T A;  4DQ2 A;  5EEH A;  4AU7 A;  1BOA A;  4XMY A;  3DXJ F;  3CLO A;  5CYV A;  2STT A;  1W0U A;  2KZV A;  3N4M A;  2CO5 A;  4RS8 A;  1EF4 A;  1JT0 A;  1ZGW A;  5L3E A;  2RRE A;  2P8T A;  4IHY A;  3LSH A;  1TWH J;  3HSR A;  2Z16 A;  3WU0 A;  4P55 A;  1IDZ A;  3S2D J;  1X3U A;  3GTM J;  2HDC A;  1ZLJ A;  5ILS A;  1V55 H;  4WF2 A;  3CUO A;  1MIJ A;  5CVU A;  3D0S A;  1QVU A;  4U87 A;  5FO5 A;  5IPA A;  2A5W A;  1Z0X A;  2XKP A;  4P5O A;  5GTH C;  1VQ5 I;  4L0Y B;  1QHH D;  3FXQ A;  3D5L A;  2Y69 H;  1OYI A;  4IJA A;  5K1Y A;  2IVM A;  5J47 A;  1YJ9 I;  2OZU A;  3NEU A;  5FD6 A;  4HEA 2;  4ZYD A;  1KGS A;  2CU7 A;  4XNF A;  3WG9 A;  3C1D A;  2K9M A;  3CCV I;  1TLH B;  1SD6 A;  2V9V A;  3AG1 H;  3R60 A;  1A5J A;  2UV1 A;  3ZMT A;  1R1T A;  1JGG A;  1K7A A;  4OIN F;  4EJT A;  4HLY A;  1YS6 A;  2VJJ A;  1R36 A;  1R71 A;  2WV1 A;  1JKP C;  2DOA A;  3NAU A;  4CCM A;  2CRG A;  3J7A O;  1DPR A;  4Y33 A;  4A0X A;  2H09 A;  1Y0N A;  2WY7 Q;  4GO1 A;  3SEQ A;  5D5U B;  1DGR M;  5E3O A;  1ACI A;  2V1D A;  3EUA A;  2JVH A;  5E18 F;  4FT8 A;  4AYB A;  1M1E B;  2ZME A;  2BY0 A;  1GXP A;  3QU3 A;  4XLP F;  5E17 F;  2DT7 B;  4BAY A;  2X6Y A;  1IN8 A;  2RGV A;  3ABL H;  4KA4 A;  1W5C C;  4HRI A;  1HSJ A;  3RI4 A;  4Y7N J;  2X0L A;  1IV6 A;  1HW2 A;  3GZ6 A;  1WJ5 A;  4ON0 A;  3DU6 A;  1TQP A;  2PJP A;  1BN5 A;  3B6C A;  4E7Z A;  1KQ9 A;  4A3G J;  3BJ6 A;  4G94 A;  2QEN A;  3E5X A;  3L2W A;  1D0Z A;  2A61 A;  5K7F A;  5D8K B;  2L4M A;  3IHU A;  2COB A;  3LOC A;  4A3J J;  4CCO A;  4QWQ A;  3BTJ A;  3VDX A;  2CSO A;  3S1M J;  2ZC2 A;  3VPR A;  4MFD A;  3PSI A;  4B3X A;  1GHC A;  3PFY A;  5L3F A;  1KYZ A;  5CVR A;  2QLZ A;  5IT9 Z;  4HSR A;  3G1O A;  3P9C A;  3CMM A;  4HPQ A;  2B9S A;  3DBR B;  1Y8Q B;  4M9S A;  3D5R C;  3CC2 I;  1RR8 C;  5AIQ A;  2P5L C;  3MZY A;  2IEK A;  4XLC A;  1SAN A;  4MTD A;  1ZRF A;  2WY8 Q;  4PFP A;  4U7D A;  2HVR A;  3MQ0 A;  3IWZ A;  2HKX A;  2OC6 A;  5DCM B;  4GXO A;  3JCU C;  3BPX A;  1Q1V A;  2OBP A;  3SJM A;  2ZBK A;  3OYD A;  1I50 J;  3LSR A;  3DQV C;  3P9K A;  3JRA A;  2JA7 J;  2R7Q A;  3S2W A;  3HOU J;  1O4X A;  1K6Y A;  3ZN1 A;  1P7I A;  1FT9 A;  2BY1 A;  3F3X A;  5EDN A;  2RKH A;  3JRB A;  3KLO A;  2EZH A;  3PNT A;  4M73 A;  1S7O A;  3ZQF A;  5IYD J;  3CO7 C;  1K83 J;  2JK3 A;  5IYB J;  4EM0 B;  1YRN B;  1V54 H;  2R7X A;  1UEL B;  4F93 B;  2R7D A;  4JX4 A;  2ISZ A;  3CQZ J;  2DA7 A;  3JRG A;  2X51 A;  5D4R A;  3ZMD A;  1WFX A;  1TWG J;  1VQN I;  4G6D A;  2FF4 A;  2KP6 A;  3VOD A;  3I53 A;  2NRA C;  2LRD A;  4EJV A;  2ZFW A;  4GDF A;  1GLN A;  2EWN A;  3OR1 C;  4I0B A;  3W3C A;  2XAQ A;  4QLC U;  2M7A A;  3TP0 A;  3CMA I;  3JRH A;  4UY8 I;  5B3S H;  2QBY A;  2NOG A;  3BZ6 A;  3RYP A;  1X1B A;  5A2Q Z;  3S1N J;  2VQL A;  4G7H F;  2LF8 A;  4BBS J;  4CO8 A;  3LQR A;  4DOZ A;  3CDL A;  5LEJ A;  5HLI A;  4L9T A;  1FZP B;  1HKT A;  3LA2 A;  4R8H A;  1PJR A;  5F6F A;  1JJ8 C;  2ESN A;  2HOA A;  5KVR A;  3M9A A;  3BG6 A;  1ON1 A;  2ME6 A;  3I4P A;  1R1V A;  5HVQ C;  3CCE I;  1VF9 A;  3FMR A;  1UHW A;  5GP9 A;  2BW3 B;  2WBM A;  1ODD A;  2M5W A;  3V4G A;  3GTJ J;  2XV4 S;  5EZH A;  2K4B A;  4D7M A;  2F4O B;  5LBQ A;  2AS5 F;  1VQ9 I;  3DTI A;  1SMT A;  3KEQ A;  1TBX A;  3ASN H;  2FE3 A;  2XC7 A;  4XL9 A;  3J81 Z;  4XM3 A;  2PJR B;  4M6V A;  3TGN A;  2YU9 J;  4G6Q A;  3Q5F A;  2NYX A;  3HUG A;  3PUF A;  1J0R A;  2VN2 A;  1ZYR F;  1RI7 A;  2CUZ A;  3S1Q J;  1I39 A;  4HBL A;  2NNY A;  2DA1 A;  3P7N A;  4RGX A;  2R5Z A;  2DO7 A;  1LFP A;  2M2E A;  1XC5 A;  2JA2 A;  2NNN A;  4AC0 A;  2P6T A;  1EKE A;  5GTI C;  4HF0 A;  3OYJ A;  9ANT A;  5HOO A;  1MZB A;  1XSD A;  2DT5 A;  2LLK A;  4M3D A;  3SZP A;  4UV8 A;  1X2M A;  3GTP J;  2JN6 A;  2RN7 A;  4AM3 A;  1IAW A;  3H9J A;  2XPV A;  2VUM J;  6PAX A;  2EH3 A;  1X1P A;  5C3E J;  1QA6 A;  1UB9 A;  1BJA A;  4HNT A;  3RJP A;  1H8A C;  5AON A;  1B59 A;  5FKN A;  2KRF A;  3K70 D;  1QZY A;  1U6G A;  2L7Z A;  3OSF A;  3ZQI A;  1T98 A;  3RSN A;  1FOW A;  1RKT A;  2DW4 A;  1S29 A;  3CC7 I;  2W1O A;  4EV0 A;  5FKM A;  4BKX A;  1CF7 A;  3A01 B;  1A6Q A;  1D8J A;  3SZG A;  2CH0 A;  2QF7 A;  1UCR A;  2EPF A;  2DAO A;  2VKV A;  3BZK A;  4JBA A;  5M5X J;  1QNT A;  1WJD A;  1X19 A;  2K02 A;  5LD2 C;  2CV0 A;  1U2W A;  3S17 J;  2VQC A;  3HPH A;  3UNG C;  2AXT C;  3BR2 A;  4G7O F;  4LIV A;  2O6G E;  4I01 A;  4JK1 X;  1IRF A;  3IKT A;  1HBX G;  3IH4 A;  2LY2 A;  4YFX F;  2P7C B;  2DMT A;  1YG2 A;  3GEZ A;  3JRF A;  1WHU A;  2Z33 A;  1JKO C;  4CCL A;  2IGM A;  3QP5 A;  2VBW A;  3OL3 A;  1Z3Y A;  1K79 A;  3ESW B;  1QPM A;  4ABZ A;  5JHF A;  1FTZ A;  3PO3 J;  3M4O J;  3BR3 A;  1FX7 A;  4LOC A;  4UUS B;  2YR2 A;  3OY9 A;  1SC7 A;  4AVZ A;  1SFO J;  4KIG A;  5JR3 A;  1RIO H;  3M7G A;  4G12 A;  3H36 A;  2CJJ A;  5H6R A;  2CQ7 A;  2WA0 A;  2Y30 A;  1T38 A;  3O6B B;  1R49 A;  5DTD A;  3HOZ J;  4IHW A;  2Y31 A;  5ERI A;  1WPK A;  3N97 A;  2ZFU A;  3A2K A;  3OWT A;  3I71 A;  4P9U A;  1HOM A;  2IAI A;  2KRC A;  2K4J A;  4GYG A;  2HI3 A;  3MFK A;  1OYW A;  4MLO A;  4BQA A;  3KZI C;  5HLG A;  1BBY A;  2HTS A;  2EFW A;  5CKT A;  2KL4 A;  3KP6 A;  2EK5 A;  2X6O A;  5BPD A;  5EEA A;  2P7V B;  3CES A;  3TOB A;  3CDI A;  5EG0 B;  2CW7 A;  4MQV A;  4LLN A;  1BI1 A;  4ENM A;  1QBJ A;  4BGD A;  5GAG J;  3K10 A;  4BAC A;  4RB2 C;  3CD6 I;  2J5O A;  2TDX A;  3LFU A;  4F7Z A;  1WZ2 A;  3JRE A;  1D1C A;  3PUB A;  1OMI A;  4RA2 A;  1IC8 A;  1L3L A;  2NVT J;  1MBF A;  2VBY A;  1T6S A;  4BY7 J;  1DU0 A;  3ERE D;  2CFO A;  3GF2 A;  3LA7 A;  1FYK A;  4LIT A;  3FXK A;  3AKZ A;  3GUD A;  2KDZ A;  1BI3 A;  1BM9 A;  2KQR A;  1RES A;  1LDJ A;  1T56 A;  1X3Z B;  4IOC F;  2EFP A;  3S3N A;  3HHG A;  1N78 A;  2AO9 A;  3W6J B;  2EQR A;  2TRT A;  2L7F P;  5M3M J;  2XSD C;  1D5Y A;  4WK8 F;  1QPI A;  4A3B J;  2PMZ N;  3DU5 A;  3K4C A;  4E4H A;  4CYC B;  1PVE A;  3N05 A;  4MIM A;  3TOA A;  3CO6 C;  4CH7 A;  4Q5S F;  4U0V A;  3TO6 A;  2Q2E A;  3F9K A;  2VPL A;  3MKL A;  2CUE A;  1I5Z A;  1K4T A;  4M71 A;  1W7P A;  4KDP A;  2HZD A;  3GTG J;  2LF7 A;  1MNE A;  4ZDP A;  3OIQ A;  4C9Y A;  2FUG 2;  2RV8 A;  3GTO J;  2EZK A;  3A0B C;  2N8G A;  2BBY A;  2DYS H;  2QUF A;  2K40 A;  2HXO A;  2DA5 A;  1I3A A;  1ZG3 A;  4Q47 A;  1G59 A;  4C3H J;  4L9V A;  2VJ5 A;  3R4K A;  1AA7 A;  4N0B A;  1XGS A;  3LSI A;  5EGO B;  2Y0S N;  1TL8 A;  2VC1 A;  1A36 A;  4CZZ A;  4XKB A;  2MBF A;  1I3Q J;  2E2I J;  1QU3 A;  3IUO A;  3FXL A;  3TDU C;  2PBI A;  4IXA A;  1IW7 F;  1K61 A;  3KFW X;  2QWW A;  4LG0 B;  3CCY A;  4O6J A;  3S8P A;  3HRS A;  2JPB A;  2DTZ A;  2VKE A;  2DA2 A;  3H3Z A;  3BTL A;  4IRI A;  2W25 A;  2XGE A;  3PIO F;  1AHD P;  5J40 A;  2L01 A;  5K5R A;  3HJE A;  2ESH A;  3K70 C;  1IN4 A;  2XAJ A;  3TKY A;  1B4A A;  2DFE A;  5DM6 F;  3MWM A;  3RDI A;  1DPU A;  3MAJ A;  1ETW A;  3C2H A;  4DZP A;  1Z21 A;  5DUI A;  2XGC A;  2X1D A;  1N25 A;  2JT1 A;  4XOR A;  4GCV A;  3U21 A;  3K4M A;  3ELK A;  1GVD A;  3QOE A;  4A5M A;  3F22 A;  3JTH A;  4A0Z A;  2ELH A;  2VE8 A;  1UHM A;  3BTI A;  1UJ8 A;  1VZ0 A;  3SQN A;  2DTR A;  2XDV A;  1OR7 A;  1IRG A;  1R6R A;  2KHM A;  3E5U A;  4I98 B;  2A68 F;  4XLA A;  1K4S A;  1MMG A;  2R7T A;  5F04 A;  4IQJ A;  1S3J A;  1SFU A;  2L9N A;  4BXX J;  2VOP A;  3NAR A;  5E20 A;  5ED4 A;  1LDD A;  3KP7 A;  2MFZ A;  3SDG A;  2HNH A;  1U0J A;  3TQN A;  2LFB A;  3ERM A;  1MMD A;  4BS9 A;  2M4G A;  3E6B A;  1I6H J;  1FMV A;  2KZG A;  3ASO H;  4KJZ A;  4RAZ A;  4Y17 A;  3KPH A;  1XSV A;  3RKW A;  5J4V A;  3BP8 A;  3MZH A;  2PLY A;  1NK3 P;  5B1A H;  4PGH A;  2LBF A;  3HZJ A;  4GFB A;  3I9V 2;  2BVL A;  4AYB N;  3HG9 A;  3GLX A;  3HSF A;  1Z7L A;  3BOQ A;  4FTH A;  2QSG X;  3VSL A;  1LNW A;  3HXL A;  2XIG A;  1UMQ A;  2K7L A;  3RPQ A;  4DW6 A;  2F5C A;  2YS9 A;  1X1D A;  2MA3 A;  5K7Z A;  4OU0 A;  2IW5 A;  2DDB A;  3ROU A;  2BZT A;  2EFQ A;  2OPT A;  1FSE A;  2IA1 A;  2V79 A;  2MG4 A;  3KP4 A;  4ASN A;  2R93 J;  3BG9 A;  3TP3 A;  4PSX A;  1Z1D A;  3K4K A;  3S3O A;  1X1A A;  3IH3 A;  3BG5 A;  5KK1 A;  2VBZ A;  2RVC A;  3HC7 A;  5HNF A;  4A6D A;  1NK2 P;  3WHB A;  2NVQ J;  3K4B A;  1JE8 A;  2LC2 A;  2FRH A;  3HGG A;  2ZO4 A;  2X6X A;  3HB9 A;  1N75 A;  1I6X A;  5ILV A;  5F08 A;  2V4J C;  5ICE A;  2OCE A;  3FM5 A;  5CVJ A;  2E1O A;  1JT6 A;  1JHH A;  1DQU A;  1VQP I;  4FE4 A;  3SZT A;  4RDU A;  2D1V A;  5D8L B;  2PMU A;  2VJI A;  4I02 A;  3SFI A;  4WXC A;  1SD5 A;  2ZXH A;  3E6C C;  4EMS A;  3BR6 A;  1OYY A;  4WXH A;  4XBF A;  2GIZ A;  4OIR F;  3HTU A;  4DYR A;  4I99 C;  2G7U A;  1LFB A;  2MAB A;  5FJ8 J;  5LHG A;  1XGM A;  3F8C A;  2IS2 A;  4P1W A;  2VQG A;  1JKQ C;  4RGS A;  5LRS A;  4BXU A;  2VLA A;  5IP6 A;  5TRD A;  2DFI A;  2A6H F;  1TWA J;  2VJ4 A;  4OAY A;  1XDU A;  4RM2 A;  4ZYG A;  1XGN A;  3T0Y A;  3BJO A;  1V5E A;  4ENN A;  2CW0 F;  4KIT B;  2ZJR F;  2R7S A;  1GV5 A;  1MKM A;  2UUZ A;  3OYH A;  1OKR A;  3IH2 A;  1P92 A;  3G6E I;  4V19 K;  2PFB A;  1J2X A;  4JQF A;  1VQL I;  4OIO F;  1AU7 A;  1YIO A;  1E3H A;  1MMA A;  3GCM A;  1TP4 A;  4C2M J;  3KYL A;  1R4M B;  4LFU A;  4AIK A;  5CVV A;  4XQF A;  1NG6 A;  1S6L A;  3RZD J;  1C0W A;  4CDG A;  1OPC A;  2HQN A;  4LK1 F;  4Y4R A;  3DF8 A;  5IP7 J;  3LSJ A;  2IRF G;  4BU2 A;  4ZDO A;  4BDY A;  2DMN A;  2FJ1 A;  3CTA A;  2VT3 A;  3RKQ A;  2HPI A;  4BE1 A;  1R22 A;  5ICF A;  2XHK A;  2R5Y B;  2Y0S A;  5LHI A;  1S72 I;  3E5Q A;  3C18 A;  3QU6 A;  4XON A;  5DDG A;  3E7L A;  4BH9 A;  2BHZ A;  2QGU A;  2ZXW H;  1W5S A;  4F55 A;  1TNT A;  2LSO A;  3Q3S A;  1T08 B;  3FMQ A;  5FD5 A;  5CVI A;  3BTC A;  3TO9 A;  1LE8 A;  4IHS A;  1KU2 A;  4NQW A;  5CPR B;  4A3K J;  1IXR C;  1ETY A;  4ZZD A;  4CYD A;  5C4J J;  3K1M A;  4PJL A;  4NNJ A;  2P5V A;  4JX5 A;  1OJL A;  1HW1 A;  1JUS A;  4L5E A;  2MSY A;  3HEF A;  3MVP A;  1SMY F;  4D9J A;  5BQT A;  2L9V A;  1I1G A;  4CA0 A;  4YFK F;  4EM1 A;  4A3F J;  2R0Q C;  3CJT B;  1YFH A;  2NS8 A;  3KZY A;  4KNY A;  2X48 A;  2Q0O A;  3K4N A;  3GX4 X;  2FNP A;  1GT0 C;  2BVM A;  5D5X B;  3HOX J;  1JHF A;  2VXZ A;  3BCB A;  5IP9 J;  1O7L A;  4I0A A;  5K5Q A;  3HOY J;  1IZ1 A;  3V42 A;  5C4X J;  2V6E A;  4EVI A;  4BJT A;  3R0J A;  4H4K C;  4A3M J;  5IYC J;  3VYR B;  3LQQ A;  1O3T A;  4BHB A;  2GOM A;  3OYN A;  3DFG A;  4C3J J;  3X2Q H;  3OYA A;  1WCM J;  2FML A;  3FDY A;  2CQK A;  5HLT A;  4A5N A;  3RQ4 A;  2HZT A;  4MFE A;  3ML6 A;  4ZJZ A;  1NTC A;  2M4K A;  3F6V A;  3ZQL A;  3F8M A;  1N77 A;  3K4L A;  1BJZ A;  3BR5 A;  3C2G A;  3F72 A;  3BQZ A;  4MHG A;  2V1U A;  2FBI A;  1IO2 A;  3CLQ A;  2EBI A;  2ME0 A;  1YX5 A;  3TW6 A;  4OIQ F;  3VYT B;  3WGH A;  1PP7 U;  3F8F A;  4YEL A;  2HQA A;  4HX4 A;  1QO0 D;  2CG4 A;  3KET A;  1S7E A;  2ZJ2 A;  1B72 B;  4OMY A;  2OUM A;  1XPX A;  1VQ6 I;  3WTT C;  3P9I A;  1J9I A;  5CJ9 A;  3PQK A;  4EAT A;  3A02 A;  2ZME C;  2O7O A;  2QQ8 A;  3O8H A;  2K86 A;  3PL8 A;  1ERD A;  3U1D A;  2KMU A;  1TQI A;  2FMY A;  2FX0 A;  3CP2 A;  4A3C J;  1SVL A;  5ILU A;  1JUP A;  3W2A A;  4PK4 A;  1DUX C;  5D6F A;  2K9N A;  4M3E A;  2X6W A;  4Y52 J;  2L02 A;  1F1Z A;  4D7N A;  2VL8 A;  2XRN A;  5EEG A;  3CUQ A;  2LG4 A;  2DI3 A;  2H8W A;  3HYI A;  3OYM A;  3W6K B;  4XRS G;  4WWC A;  2JPC A;  1P9Q C;  1ZQ3 P;  1XCB A;  1G3W A;  2QSH X;  4TV7 A;  1A31 A;  1ZEL A;  2HDW A;  1D8K A;  3ECH A;  3W2V A;  1LEB A;  1MDM A;  2KJC A;  4ZYH A;  3L2U A;  1TQM A;  3JSP A;  3I4N J;  4UB6 C;  5E8G A;  3PQJ A;  2LYC A;  1RPW A;  3MKY B;  1W36 D;  2FQ4 A;  4ZDL A;  2HFH A;  3DKW A;  3S15 J;  1UG2 A;  1P4X A;  2O03 A;  1D1B A;  3CDH A;  2BYV E;  4G6T B;  1ZH5 A;  3J7Y J;  2NOJ B;  2WAD A;  1X3W B;  3FK6 A;  2R7W A;  2WTE A;  3WU2 C;  2FEZ A;  3LFK A;  1KU3 A;  1KQ0 A;  3DP7 A;  5D5V B;  4XKW A;  1D5V A;  4HX7 A;  3VWB A;  3P5J A;  5EF6 A;  4XKV A;  1FY7 A;  2H1K A;  3ZPL A;  2XRO A;  4BEH A;  2XKO A;  2UWM A;  2NS0 A;  3LNQ A;  2A3S A;  3CJN A;  1TWF J;  2EV5 A;  3G1L A;  2Y9Y A;  3L00 A;  3VSK A;  2H8R A;  2VQH A;  2HR3 A;  2OD5 A;  5DS9 A;  5K7H A;  4G9Y A;  4XKC A;  2M87 A;  2X1C A;  1HW5 A;  3UR3 C;  4IHV A;  4CIC A;  1OCC H;  5FRO A;  3SEZ A;  4PJ0 C;  2ZME B;  2EA2 A;  3WTW C;  1LVK A;  1H88 C;  4M6Y A;  5FRN A;  4DIQ A;  1LUJ B;  4HAM A;  2W48 A;  3Q9S A;  2PI0 A;  2CQX A;  1WRJ A;  2G0E A;  1ETK A;  2HOT A;  1MD0 A;  2ZNY A;  3GZN B;  4XSZ F;  3HSE A;  1DP3 A;  1YOV B;  1XG1 A;  1E2X A;  5JHU A;  3JTG A;  1ETV A;  4NDL A;  4Y15 A;  4E70 A;  3OYB A;  3MD2 A;  2V7F A;  2QQA A;  3GME A;  1YIT I;  2Y9Z A;  3S2H J;  3VOE A;  3RQI A;  2MLG A;  5A2Q K;  5JFR A;  1FBQ A;  1WQ2 A;  5IY5 H;  5HLH A;  3QWL A;  3HOW J;  5B66 C;  4EM2 A;  3DPU A;  3L2R A;  3MMY B;  2F6C A;  2BY3 A;  4RLF A;  5H6Q A;  2HYJ A;  1YYV A;  1V4R A;  1SD7 A;  1W7P D;  2D1H A;  1YLF A;  2L7M P;  2OU2 A;  4UHT A;  3A4C A;  2ZJQ F;  4BHC A;  1TTY A;  1XMX A;  2NVU B;  3WG7 H;  2JA5 J;  1OCP A;  2EA4 A;  3QOD A;  1YIJ I;  2NVY J;  5J3L A;  3ZXS A;  4BHP A;  1QHG A;  1OQY A;  2HYF A;  2CW8 A;  2IGK A;  3DKY A;  4A3D J;  3FM3 A;  1XN7 A;  1BW6 A;  1MGT A;  3J80 Z;  1TNS A;  1TWC J;  4UVA A;  1AKH A;  2E19 A;  4HST A;  3RKY A;  4BE2 A;  4QSH A;  3EUH A;  4JX6 A;  1HA8 A;  2YUS A;  3IWF A;  1RUO A;  2KT0 A;  1APL C;  1S5L C;  3E6M A;  1TZL A;  3KP5 A;  2VE9 A;  3IAM 2;  2PN6 A;  2BHY A;  4LGW A;  3FIW A;  5BOX A;  3AFH A;  4DJA A;  2JA8 J;  3DLA A;  4OAZ A;  2EFN A;  3Q0W A;  2L7K A;  2MGQ A;  4LLL A;  1F36 A;  1Z7U A;  4FHT A;  3DEE A;  3PFI A;  3CJR B;  4GYI A;  4IHX A;  4XN0 A;  4IRH A;  1U78 A;  2QBY B;  1IRZ A;  3M3Y J;  1PUF A;  2NXN B;  2M7B A;  3AL0 C;  2HEO A;  1VI0 A;  3LSK A;  3GFI A;  1YI2 I;  3S93 A;  2XAU A;  2LKX A;  2HOE A;  1VQ7 I;  3HTS B;  4N9H A;  4HOB A;  1OFC X;  2OQR A;  1Y8R B;  2E36 A;  2E60 A;  2EIJ H;  5HOD A;  3M8F A;  3LAJ A;  1J09 A;  2P4W A;  2I8D A;  2EV6 A;  2IA0 A;  4Z6Y A;  2KRH A;  1U9O A;  2GM4 A;  1WGX A;  4RB0 A;  2ADU A;  2DPU A;  2VT2 A;  3WE2 A;  4A12 A;  1ZLK A;  2IS4 A;  4HA8 A;  2M0C A;  3RZO J;  5TGT A;  1B9M A;  2HYG D;  3EDP A;  1MBG A;  3BRO A;  2A6T A;  3F23 A;  3Q9V A;  4HG2 A;  2FBH A;  2VON A;  2L2O A;  4C3I J;  3DPT A;  1W36 C;  3GLL A;  3AAF A;  2L0K A;  4XOT A;  2STW A;  2F5F A;  5F1J A;  1ENH A;  2KIS A;  1GXQ A;  2L9S A;  4YEJ A;  3G73 A;  1H9T A;  2LKP A;  3HUG B;  3ZQ7 A;  3IKV A;  4RAY A;  2A07 F;  3CCL I;  2Z1D A;  2ZCW A;  5LRR A;  3GTK J;  4A3E J;  2LOO A;  3VFZ A;  2W7N A;  2V26 A;  2YPR A;  1YW7 A;  2WB1 A;  2XF6 A;  4DGW B;  2GXA A;  2KDO A;  4K2E A;  2R5Z B;  4RGR A;  1S9H A;  1ORK A;  5KAF C;  3ZMU A;  1ZHF A;  3OOU A;  4BE0 A;  4ESF A;  3BCA A;  4L5J A;  1KU9 A;  3OS0 A;  1EH6 A;  3KP3 A;  4HLX A;  2D45 A;  3FBN B;  4S04 A;  2BE5 F;  2CGP A;  1AOY A;  1NHA A;  4CZC A;  3LL7 A;  4I6Z A;  3RTR A;  1SAU A;  4ENJ A;  4C2U A;  3JAM K;  4Q4Z F;  2EIL H;  1TW3 A;  1F4K A;  2XSJ C;  2R7O A;  4JP0 A;  1FTT A;  3WTY C;  1RC9 A;  3ABT A;  2DMP A;  4F92 B;  3F6O A;  2LTP A;  2JWT A;  3H35 A;  2Z2S B;  2DXI A;  4EQQ A;  2MW8 A;  4UUV A;  1UZC A;  3AL0 B;  1U3E M;  1CF7 B;  1D3Y A;  1FPQ A;  5DD4 A;  3CCU I;  4A3I J;  1JGS A;  1VTN C;  1IJW C;  2V9P A;  2AHQ A;  2IJL A;  2DJI A;  2FSW A;  3F21 A;  2QA4 I;  2OZ6 A;  2XVC A;  3DEW A;  1P7J A;  4PDK A;  2PG4 A;  4FX4 A;  4ZH4 F;  4OMZ A;  3JRC A;  1WI9 A;  4M3B A;  2JZY A;  4EJW A;  5DM7 F;  3WOD F;  4EGZ A;  4IEJ A;  2A6E F;  4A93 J;  1G3T A;  2V9K A;  1LB2 A;  3L2C A;  1ONV A;  4BY1 J;  2OTL I;  2OJE D;  3ULQ B;  2DK5 A;  4NB5 A;  4DBQ A;  2JUG A;  2H6C A;  3FXU A;  1OLT A;  5HS9 A;  3EET A;  2K5C A;  4HV5 A;  2IBD A;  1IUF A;  1QVT A;  2JTV A;  2H27 A;  5D6E A;  5ICC A;  1CGP A;  3ABM H;  1BI2 A;  5HNH A;  1ZGJ A;  3LMM A;  2F5E A;  3DLL F;  3QYE A;  4XLE A;  1XTA A;  4NHJ A;  1YS7 A;  1Q1H A;  2KJB A;  4QPQ A;  3RIR A;  1G3Y A;  2FA5 A;  5L3G A;  2CUJ A;  4MQ9 F;  3V8L A;  1UST A;  1DP7 P;  3IRR A;  5FRM A;  2I10 A;  3SDB A;  4D1Q A;  4O3M A;  2R92 J;  2GOX B;  3I59 A;  2DCE A;  5CQE A;  3COA C;  2V1N A;  2QQB A;  3FXM A;  1E0E A;  4GGG A;  3OL4 A;  1U5T A;  4EGY A;  3OR2 C;  4UB8 C;  4I7H A;  4XSX F;  2OF7 A;  4N4N B;  1H89 C;  5GAH J;  1XMA A;  4BBR J;  1PUE E;  3IL2 A;  4IRG A;  1IRX A;  3PIP F;  1KU7 A;  1MBJ A;  4PUS A;  4FET A;  2EIN H;  3B73 A;  4KFC A;  1J5Y A;  1E3P A;  3BPV A;  2E1N A;  4QPO A;  2C6Y A;  4IL6 C;  2DYR H;  5HS7 A;  5J8F A;  4CCN A;  2ZKZ A;  1T0F A;  2JVG A;  2K3P A;  2P6S A;  2Y48 A;  3A03 A;  1QZE A;  2HKO A;  3RKX A;  2B0L A;  5FFX A;  1LJ9 A;  4GRI A;  4P9F A;  1K78 A;  3OYF A;  1HF0 A;  3RYR A;  4IQ4 A;  4KUM A;  4FCY A;  4KT6 A;  2O9L A;  1SVO A;  1LPQ A;  1U8R A;  1OR7 C;  3LSP A;  2KIU A;  4QTR A;  2ELJ A;  2Q8K A;  3TBI A;  2D5V A;  2DLL A;  1CQT A;  2Q2E B;  5FFZ A;  3SXY A;  2GIV A;  2DN0 A;  3F0C A;  3GXO A;  2FU4 A;  1T2K A;  3O8G A;  4EEF G;  4UXN A;  1W7P B;  3KYD B;  4CCK A;  4IOA F;  5J1Y A;  3S32 A;  2DFH A;  3JSO A;  2VXD A;  3B6A A;  3GYH X;  1XGO A;  1A04 A;  5E1Z B;  5E8I A;  4KIC A;  1RZ4 A;  5CQG A;  5M5Y J;  3KE2 A;  2DU9 A;  2O8K A;  4YG2 F;  5HS8 A;  1QQI A;  1X4O A;  4MEX F;  1R58 A;  3C2B A;  3HOS A;  1VQ4 I;  2IA2 A;  5M5W J;  3GWZ A;  1MBH A;  4LD5 A;  1Y6I A;  4BQO A;  1IN5 A;  3K2Z A;  2VKD A;  2QKL B;  1FP2 A;  2UXX A;  3ECO A;  2V1X A;  2MC4 A;  3I56 I;  4M72 A;  1VND A;  3QOP A;  4WCG A;  2HVS A;  3I4M J;  2CFX A;  4Y13 A;  3GW2 A;  1H0M A;  3FHZ A;  3B02 A;  1ON2 A;  4ZTJ A;  5JVT A;  3T8T A;  2K85 A;  4WXD A;  4X6A J;  3J7Z I; 
#chains in the Genus database with same CATH homology
 1YX5 A;  2E1M C;  4DBR A;  4ZC3 A;  3VYT B;  2E5Z A;  2ZXI A;  4YEL A;  2HU9 A;  2W4S A;  2HQA A;  1YE9 A;  2CUZ A;  3H9G A;  2OUM A;  2CV1 A;  3OYG A;  1X4P A;  4EAT A;  1LFP A;  2JA2 A;  3L2Q A;  3OYJ A;  4KIS A;  5HOO A;  2X1E A;  3PL8 A;  1ERD A;  2KMU A;  3OIP A;  3PNV A;  2ZSI B;  3CP2 A;  3W2A A;  4PK4 A;  3H9J A;  4PSW A;  2X6W A;  4RLQ A;  2BOL A;  3QYF A;  3OYI A;  4IKF A;  2O5R A;  2VL8 A;  4F52 A;  4HNT A;  4E7H A;  2LG4 A;  3PJR A;  3OYM A;  3K70 D;  2R7V A;  3NWT A;  3W2W A;  3ZQQ A;  1P9Q C;  2CS3 A;  3H0D A;  2F4I A;  1YX3 A;  1ZEL A;  3RSN A;  1TT0 A;  2HDW A;  3H5A A;  2W1O A;  3W2V A;  3SZG A;  4E7K A;  2E5N A;  2CH0 A;  3BLY A;  3L2U A;  3KX2 A;  1D0Y A;  1X19 A;  1WJD A;  2LBF B;  3HL2 A;  3E1S A;  3DTK A;  5LD2 C;  2LYC A;  3MKY B;  1W36 D;  2CV0 A;  4ZDL A;  2WAE A;  2AQF A;  2VQC A;  3HPH A;  3UNG C;  2HPM A;  4E7S A;  4ANJ A;  4LIV A;  4ZYA A;  1D1B A;  4G6T B;  2NOJ B;  2WAD A;  2P0W A;  2R7W A;  2LY2 A;  4LIU A;  4E7I A;  2VKH A;  4XKW A;  3VWB A;  4CCL A;  1T0F C;  2IGM A;  4XKV A;  4C2T A;  3D5S C;  4IX7 A;  2IS1 A;  3OL3 A;  1Z3Y A;  2MYS A;  4BEH A;  2UWM A;  2E1M B;  4F91 B;  2WAQ A;  5JHF A;  3TL4 X;  5KNL A;  3OY9 A;  3VSK A;  2VQH A;  4AVZ A;  3LSM A;  4NC8 A;  3BG7 A;  2XF5 A;  3OS1 A;  4XKC A;  2X1C A;  3UR3 C;  4N4O B;  3ZCO A;  2WA0 A;  1Y56 A;  3K6G A;  5FRO A;  3SEZ A;  1LVK A;  1EA3 A;  5FRN A;  4HNU A;  4DIQ A;  2ZFU A;  4RMN A;  3OWT A;  3A2K A;  4XLF A;  3G2B A;  2KRC A;  3OYE A;  1LKX A;  2LRE A;  4MLO A;  3DWL E;  3PNY A;  4II3 A;  5CKT A;  2KL4 A;  1D1A A;  1DP3 A;  3CES A;  2CW7 A;  4LG3 A;  2LH9 A;  3RCO A;  4BGD A;  2L5Q A;  3K10 A;  4BAC A;  3LFU A;  2KPM A;  1D1C A;  3PUB A;  3OYB A;  3MD2 A;  2V7F A;  3MKW B;  2CFO A;  4LIT A;  4B44 A;  1SFK A;  3AKZ A;  2R7R A;  1MW7 A;  2WAF A;  2KQR A;  3CZ6 A;  2IGN A;  3S3N A;  3DPU A;  1N78 A;  2F5V A;  3MMY B;  3L2R A;  2IGO A;  2F6C A;  4RLF A;  4C30 A;  4E7L A;  1BOB A;  3IAS 2;  3M8J A;  3DU5 A;  3K4C A;  4E4H A;  3A4C A;  1DGW Y;  3N05 A;  4XR6 A;  3ZRG A;  4CH7 A;  3MKZ A;  1Z3X A;  3LSG A;  1MMN A;  3NWS A;  3QOD A;  3F9K A;  2VPL A;  4PFO A;  3ZXS A;  1QHG A;  2CW8 A;  2IGK A;  3DKY A;  4YRV A;  1WJE A;  2HZD A;  4XLH A;  2R4G A;  1MNE A;  4ZDP A;  3OIQ A;  4HST A;  3RPU D;  4C9Y A;  4BE2 A;  2FUG 2;  3ZGK A;  1JI8 A;  1HA8 A;  1V5G A;  4BXF A;  3H9Q A;  2RNG A;  3CJQ B;  4NQW B;  1TZL A;  4J00 A;  4RM3 A;  4CCJ A;  3IAM 2;  2CV2 A;  4XN3 A;  1G59 A;  3EUK L;  3AFH A;  4DJA A;  2VJ5 A;  1AA7 A;  2KLO A;  3DLA A;  4OAZ A;  3HKZ A;  2L7K A;  4II2 A;  4Y3O A;  3LSI A;  2JSP A;  2K9L A;  3OS2 A;  3QYB A;  1UG0 A;  2PMZ A;  3OYK A;  2BW3 A;  3DEE A;  4XKB A;  1QU3 A;  3IUO A;  5KHD A;  2Q1Z B;  3CJR B;  5LFA A;  4XN0 A;  3ONQ A;  3S8P A;  3J7A Y;  4PJN A;  2M7B A;  3AL0 C;  3OYL A;  2PJR A;  3LSK A;  2W00 A;  3S93 A;  2XAU A;  3ZR8 X;  4BDZ A;  2LY1 A;  3K70 C;  2E60 A;  4PJJ A;  4B47 A;  4BJ6 C;  4X0G A;  2M3A A;  1V5F A;  1J09 A;  2I8D A;  2KRH A;  3C2H A;  4R79 A;  1Z21 A;  3KEY A;  1T95 A;  2X1D A;  2IS4 A;  2X85 A;  4XOR A;  5TGT A;  3U21 A;  3K4M A;  3QOE A;  3FHN A;  4FAS D;  4ITV A;  2R7U A;  1LDK B;  2A6T A;  4PJM A;  2M0M A;  4HG2 A;  2L2O A;  4BJ5 C;  1VZ0 A;  1BR2 A;  3DPT A;  4B48 A;  1W36 C;  4XOT A;  2XDV A;  4AU7 A;  4XMY A;  3GBG A;  1R6R A;  2KHM A;  2L9S A;  2HVQ A;  4YEJ A;  2KZV A;  4XLA A;  3HUG B;  1MMG A;  2R7T A;  4BUP A;  4E7J A;  2Z1D A;  2RRE A;  2LOO A;  4IQJ A;  2W7N A;  2V26 A;  2L9N A;  2WB1 A;  3LSH A;  4JOM A;  2MFZ A;  2XF6 A;  2Z16 A;  4DGW B;  2HNH A;  1U0J A;  2KDO A;  1MMD A;  4BS9 A;  2M4G A;  1S9H A;  1FMV A;  4KJZ A;  1BR1 A;  3OOU A;  2ZSH B;  4B43 A;  4BE0 A;  2XF7 A;  2LBF A;  3BCA A;  3I9V 2;  2BVL A;  4U87 A;  3OS0 A;  3HG9 A;  2QKM B;  3VYS B;  3FBN B;  1Z7L A;  2A5W A;  4P5O A;  3LL7 A;  3VSL A;  4CZC A;  3RTR A;  3HXL A;  1SAU A;  4C2U A;  1X1D A;  1QHH D;  1G8X A;  3D5L A;  3BC8 A;  2XSJ C;  2R7O A;  4CUG A;  4HEA 2;  4XNF A;  4F92 B;  2K9M A;  4NUB A;  4PSX A;  3K4K A;  3S3O A;  1X1A A;  3H35 A;  3M1C A;  2Z2S B;  4XOP A;  3OYC A;  2DXI A;  2UV1 A;  1WJA A;  2AQE A;  2OV7 A;  3AL0 B;  3HC7 A;  5HNF A;  2VJJ A;  5KCM A;  3K4B A;  2LC2 A;  2DOA A;  2X6X A;  2DJI A;  4CCM A;  1N75 A;  4Y33 A;  2WY7 Q;  2V4J C;  3SEQ A;  3CF2 A;  1DGR M;  1WJB A;  1DQU A;  3EUA A;  3OMY A;  4F3Q A;  2JVH A;  1D0X A;  2V9K A;  3A1Y A;  4AYB A;  2VJI A;  1X1C A;  1BR4 A;  2ZXH A;  2VAS A;  2DT7 B;  2X6Y A;  4DBQ A;  2JUG A;  1OLT A;  4HRI A;  2K5C A;  2VB6 A;  2DT6 A;  2MAB A;  4BEH B;  5HNH A;  1WJ5 A;  2IS2 A;  3LMM A;  3DU6 A;  4P1W A;  2VQG A;  3QYE A;  4BQQ A;  4XLE A;  4E7Z A;  1WJC A;  4QPQ A;  2VLA A;  2CUJ A;  4CSW A;  2W82 A;  1WJF A;  3EUH C;  3K4J A;  3PSF A;  3L2W A;  1D0Z A;  4U7B A;  2VJ4 A;  4OAY A;  4RM2 A;  5FRM A;  3SDB A;  3DKX A;  4D1Q A;  2GOX B;  2DCE A;  2MD0 A;  5CQE A;  4CCO A;  2V1N A;  1V5E A;  3VDX A;  4KIT B;  1E0E A;  2R7S A;  3OL4 A;  4B3X A;  3PSI A;  2UUZ A;  3OYH A;  3PFY A;  2VIX A;  3OR2 C;  4JQF A;  4HSR A;  4N4N B;  1MND A;  3CMM A;  4HPQ A;  3IP4 B;  1IRX A;  3D5R C;  1MMA A;  4NC7 A;  4PUS A;  3KYL A;  4FET A;  4XLC A;  4XQF A;  1NG6 A;  2WY8 Q;  4PFP A;  4Y4R A;  4QPO A;  2HVR A;  4BL0 B;  4BU2 A;  4ZDO A;  3H5N A;  2OC6 A;  4BDY A;  3TMO A;  4CCN A;  2HPI A;  2JVG A;  4BE1 A;  2K3P A;  3OYD A;  3DQV C;  2R7Q A;  2Y0S A;  1K6Y A;  3EPZ A;  4GRI A;  3OYF A;  4XON A;  2CMP A;  2RQQ A;  3PNT A;  4F55 A;  4IQ4 A;  3HOT A;  2R7X A;  4KT6 A;  1UEL B;  5CPR B;  4F93 B;  3E0J B;  3DPL C;  2X51 A;  1WFX A;  4E6K G;  4PJL A;  4NNJ A;  1OR7 C;  2KP6 A;  3SYT A;  2LRD A;  2ELJ A;  3TBI A;  2IXS A;  1GLN A;  1FMW A;  2Q2E B;  3OR1 C;  4D9J A;  3W3C A;  4IZZ A;  4CA0 A;  3I3L A;  3CP8 A;  4CCK A;  2M7A A;  3S32 A;  3K4N A;  3FKJ A;  2VXD A;  2BVM A;  1X1B A;  4ZTF A;  2VXZ A;  3BCB A;  2VQL A;  5CQG A;  3FBI B;  4DOZ A;  3V42 A;  1X4O A;  2V6E A;  1UAA A;  4BQN A;  4BJT A;  4H4K C;  1PJR A;  3HOS A;  3VYR B;  2IS6 A;  2GOM A;  3OYN A;  3BG6 A;  1NG7 A;  3OYA A;  5HVQ C;  1Y6I A;  3FDY A;  4BQO A;  5HLT A;  3DTE A;  2VKD A;  2QKL B;  3RQ4 A;  2BW3 B;  2WBM A;  3VYU B;  4ZJZ A;  2MC4 A;  2M4K A;  3H5R A;  4J01 A;  3HPG A;  2HVS A;  3DTI A;  3L2V A;  4OWR B;  4XL9 A;  2XC7 A;  4ZTJ A;  1N77 A;  2PJR B;  4XM3 A;  3K4L A;  1PYV A;  3C2G A;  3S3M A;  1KON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...