4AIJA

Crystal structure of rova from yersinia in complex with a rova promoter fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aijA00
5A2QK 3GX4X 2EFNA 1FBQA 1JHFA 4EGZA 2GWRA 2HYGD 1KQ0A 1PUEE 1SMYF 2O0YA 1B9MA 1H9GA 1K6OA 2DAOA 3E6CC 3WTYC 5D6EA 1I6XA 4G7ZF 1UHWA 4LFUA 2ZMEB 1QQIA 2CG4A 2NYXA 1TQPA 3I64A 2XAGA 4ENJA 5FB2A 1EV7A 1LQ1A 4CO8A 5J6XA 1Z05A 2OZ6A 3NEUA 3RKWA 2EFQA 4FX0A 2IW5A 3F8MA 2HGCA 2ADUA 3I58A 3IHUA 5FO5A 2K27A 4A0ZA 3ZMUA 2XRNA 4L9VA 4B09A 1OKRA 3GLXA 2RN7A 2CFXA 1CF7A 2JTVA 4RB2C 3T8RA 4OIPF 1JGSA 1SFXA 2F5CA 1IN7A 5E18F 3F8NA 3CUQC 1KQ8A 3GZ5A 3BPVA 2BEOA 2FBHA 3SQNA 2VE9A 1W7PB 2P4WA 3SXYA 5HVQC 3CO6C 1P92A 2XKPA 1ON1A 2GQQA 3IRQA 1I1GA 5JR3A 3FF5A 2HWVA 2A68F 2VBWA 1FYMA 5DUKA 5LBQA 2CW0F 5HS8A 1LEAA 4EM0B 3GFJA 2H09A 2DQRA 2HS5A 4IF4A 2EV5A 4LLGF 1IN5A 4LLLA 1REPC 4OMYA 2XV4S 4AVPA 2M45A 1MDMA 1KU9A 4HF1A 4A5NA 1LDDA 3WTZA 2YX7A 2EJRA 4HA8A 2H6CA 1QO0D 5HLGA 1IN4A 4I0BA 2K7LA 5TJJA 4EGYA 3V8LA 1FX7A 4YFXF 1KU2A 3WU0A 3TOAA 4M6YA 1FY7A 3RDIA 5FGMA 1U3EM 1G3SA 3QP5A 3HRSA 4UVCA 1USTA 2FMYA 4O6JA 3VFZA 4LD5A 1EH6A 3RPQA 5LGNA 4OIRF 3KP4A 3H3ZA 4PZJA 3HOTA 1HSJA 3K1NA 3FZVA 4HDVA 1HQCA 3BDDA 4HQMA 2D1HA 2RQPA 4PDKA 1HKQA 3HSEA 1PP8F 2Y0MA 1BIAA 2O61A 4K2EA 4QWQA 3VODA 1HKTA 1ZLJA 3ZMDA 3J80Z 1TQIA 3T1BA 3KCCA 3M1EA 3SFZA 3WTSC 5DCFA 3RI4A 1P4WA 2XROA 4M71A 3V7SA 4Q5SF 3FMRA 4MQ9F 1ZARA 1YW8A 4ENMA 2OQGA 3NQOA 3D0SA 1OYYA 2PEXA 1U5TC 5HS9A 4Y15A 1YIOA 1YS6A 1FBUA 2K4BA 2STWA 2J5PA 2XKOA 4HX8A 2MD5A 3LA2A 2Z33A 2W57A 3IWZA 1DPUA 1YW7A 2ZMEA 2RGVA 1B59A 2L4AA 4HLYA 4UVBA 2M1BA 4M73A 3AAFA 3COAC 5D5XB 2ESNA 5AIQA 1LB2A 2KIMA 3O6BB 3MWMA 3ZPLA 1R5HA 4LB6B 1ZGAA 1J7KA 3TO6A 4A5MA 2RKHA 3U1DA 3WTTC 1B4AA 1R1VA 3FXQA 2FNPA 1O7FA 2MH2A 3R0JA 4Q48A 1FYLA 2FBIA 3Q5FA 1DPRA 2RNJA 1ZREA 4A6DA 2D45A 3HHGA 1W7PA 3CDHA 1ZG5A 1FP1D 2ISZA 1QPMA 2EA2A 1R58A 2M5WA 4G6QA 1EH7A 5BPIA 1R36A 5DCMB 1ON2A 2EWNA 2ZO4A 4WCGA 3WGIA 4YIIA 4YFKF 1P4AA 1G3WA 3REOA 4Q4ZF 2ZCWA 1PP7U 1QNTA 4M9XA 5J8CA 2F5EA 3GW2A 3FM3A 2IA2A 3RJPA 3MCZA 4Y17A 1ZG1A 1MD0A 1ZAOA 2ELHA 4ON0A 2EV0A 1IUYA 2V1UA 2AXLA 4N0BA 2NRAC 3JSPA 2OA4A 4UVAA 1BM9A 1LJ9A 3CUOA 3JAMZ 1DDNA 4IXAA 1WWXA 4RS8A 3RKYA 3FMQA 2VC0A 5HDKA 4KIGA 1IXRC 4KN4X 2E1NA 2L02A 3ZN1A 3M7GA 5FLXZ 1TW2A 1IXSB 5IT9Z 1W7PD 2W85A 1J5YA 4R1HA 3IKTA 5BPDA 2M30A 3L2CA 1B6AA 3LQQA 2FE3A 2XASA 4FHTA 1VTNC 5CLSA 2QYOA 4G6DA 3O3KA 4R8HA 4EQQA 3CLOA 2KJBA 5DEQA 2BBYA 3U2RA 3BZ6A 1IRFA 4AIJA 4LK1F 4CZZA 2GIVA 1W5TA 2HKXA 3L7WA 3HRUA 1HKSA 4ESFA 1ZHFA 3ABUA 4KDPA 4PGGA 4WK8F 1AOYA 3HIFA 3J81K 4ESBA 2PQ8A 2MLKA 4A2UA 1UFMA 4ZH4F 1JXSA 1QZYA 2QVOA 4WXHA 4P9FA 5D4RA 5BOXA 3WTUC 5DD8A 2CGPA 2V1DA 2G9WA 3KP7A 3P9IA 3K69A 2L3DA 1HW1A 2NAZA 3W6JB 3HSFA 2XIGA 1YS7A 1SD6A 1T39A 5EEHA 2VBYA 2L54A 2EA4A 3E6DA 5AONA 4ZZDA 1T0FA 3CTAA 2LKPA 1JHHA 1TQMA 1BN5A 3FMSA 5F64A 4DQ2A 4EVIA 2QWWA 2CWEA 2W24A 5E1XA 1YQAA 2YU3A 1O3SA 1Z1DA 1F9NA 2FBKA 4RB0A 3QPTA 1DP7P 2Y75A 2GXBA 1WRJA 4MHGA 4S04A 4M72A 3L9FA 3U9GA 3WTWC 2VC1A 2A69F 1U5TB 1XDSA 2HOEA 2DT5A 3I0TA 4A0XA 3TO9A 4M9SA 3M8EA 5IT3A 3C1DA 4KFCA 2OU2A 4L0YB 2JSCA 1ZG3A 5ICCA 2GZWA 1G3TA 2PFBA 5DCMA 3C3WA 4MTDA 2K02A 4EMSA 2QLZA 4ASNA 2VT2A 4P96A 5HOOA 2DPUA 2UXXA 2KJCA 2IJLA 1R7JA 4A0YA 4HX4A 2CQKA 1U8RA 2E7WA 2P5LC 2FXAA 3DPTA 3O2PE 2GA2A 4U7BA 3VOEA 2G7HA 1WI9A 3GFLA 2VT3A 3S2WA 1XGSA 1IF1A 2STTA 3BJ6A 1J0RA 1YTYA 3FWEA 3CUQA 2VONA 2MC3A 2HZTA 4EJVA 3KFWX 1IAWA 1WKMA 4U88A 2VE8A 3HSRA 5E17F 1F1ZA 2NNNA 2HR3A 2DPDA 2LDUA 4KT5C 1KU3A 4GYGA 1Z7UA 4RGXA 3B02A 1FSHA 2CSOA 1ODDA 3TQNA 4G9YA 1SFUA 4JK1X 3R61A 4QLCU 5L3BA 3BWGA 4ENNA 4UUVA 1ULYA 3HRMA 3QU3A 4L5IA 5H6QA 2LNBA 2H94A 4IHTA 5FD6A 5HDGA 2UWMA 4OIOF 1W5SA 3LSTA 1F4KA 3DKWA 4YG2F 3LFKA 1QGPA 2A07F 1LVAA 4RB3C 1ZH5A 3HTSB 3GXOA 2P6SA 5LEKA 5F6FA 2FMLA 5H20A 2A6HF 4I7HA 2HQNA 3W6KB 1TNSA 3KETA 3E3VA 5A2QZ 1STZA 2VODA 3IRRA 1GXPA 3RIRA 4E70A 4L9NA 3ELKA 1FWZA 2WTEA 2YX4A 4L18B 3LAPA 2PBIA 4ETSA 2K4JA 4XSZF 4U0WA 4EJUA 3I59B 1NHAA 4OOIA 3DQVC 2FA5A 2BGCA 3FXRA 3KEQA 3P7NA 2QBYB 1V3FA 4G94A 4N9IA 2ZJ2A 4TV7A 2Q0OA 4KN7X 2MBFA 5E1WA 1OYWA 1D8KA 1UB9A 4LJZF 3TDZC 1D3YA 3T5XA 5DYMA 3R4KA 1U5TA 3RPUA 5LLQA 3QRFF 2XAFA 1R1TA 4XRFA 2LF7A 2QQAA 3V8KA 2ZKZA 3ROUA 1EH8A 3BJAA 3Q9SA 1TNTA 1KYWA 3HHHA 3KP6A 1T98A 1MJ9A 1UHMA 1PDNC 1IXCA 1SD4A 1DUXC 3F8BA 1XSDA 1XCVA 3R60A 4RAZA 1Z6TA 1FZPB 1GVJA 2UXNA 5FFZA 4XLPF 3JW4A 4Q47A 4A12A 3E5UA 2NS0A 3F21A 2CO5A 4BYYA 4KMUX 3CJNA 3ABTA 5BMZA 4UHTA 4HOBA 1YYVA 1FT9A 2DK5A 4CICA 2A6EF 1YW9A 3KZZA 1ZGJA 1G6NA 1CGPA 1WQ2A 1P4XA 4RAYA 3FXUA 4OU0A 4IRHA 5CVUA 4BHBA 1T6SA 2JPCA 4IRIA 2R7FA 2Z5UA 4XLNF 1S29A 2EB7A 5D5WB 3TO7A 1T38A 2YPRA 1RIOH 2DTRA 3MAJA 4HF2A 4I02A 3K9TA 1G3YA 5LHGA 2BV6A 2FF4A 2HTSA 3ZN0A 2KRFA 3JSOA 2XHKA 5AIPA 1B1BA 4WX9A 5ERIA 3L09A 1V4RA 2IP2A 2GXGA 4P5OA 2FQ3A 5ICFA 3ISPA 3RKXA 1F5TA 4D0PA 5HLHA 1L3LA 1H9TA 3C18A 4P55A 5F1RA 5H6RA 3GYHX 3E6BA 3G73A 1FPQA 1KGSA 1RUNA 1IW7F 3R6SA 5L3CA 3K2ZA 5LHIA 4HX7A 2BE5F 4WF2A 5L3EA 1I1SA 2WWYA 1OYIA 2R7DA 5ICGA 2QM3A 1IRGA 1D5VA 5CYVA 4CDGA 3KZYA 2LSOA 3K1PA 4UXNA 3L00A 1Z91A 1SMTA 2H6BA 4L9TA 2PMUA 5ED4A 1XD7A 3CUQB 5FD5A 2GAUA 2Z9OA 3ML6A 5K1YA 3PQKA 3TDUC 1YFHA 1SD7A 5CVIA 1S7OA 3P9KA 1G4DA 4LG0B 3F23A 2OAZA 3I59A 2JPBA 2VOOA 1Z9CA 4KA4A 2AS5F 2EFOA 4XSXF 2QBYA 3KEOA 4AIHA 3QU6A 4LMYA 1E17A 3GVAA 1XDUA 2Q2EA 3MQ0A 1RZ4A 5JHUA 2V79A 4B8XA 1XMKA 3CO7C 4KIFA 1BI1A 5LHHA 1KA8A 3ZMZA 1TTYA 1XGOA 3WGGA 4MNUA 3ZMTA 3I54A 2ZXJA 4JBAA 5CJ9A 1YG2A 4U0YA 3WTXC 4NHJA 1I27A 3DF8A 4ENKA 4U0VA 4KICA 2XAQA 3F8CA 1BOAA 1J9IA 3EETA 3V7RA 4A6EA 3T0YA 1RNLA 2OQRA 2JRTA 2WV0A 4CXFA 3I71A 5HLIA 4S05A 2DK8A 3ZQ7A 4ZYEA 2E7XA 4GCVA 4M9ZA 3E5XA 5ILUA 1BJAA 3OOPA 5D8KB 1YLFA 2FNAA 4HDUA 1IZ1A 1S8NA 4P9UA 2QZ8A 3F72A 4AIKA 1USSA 2WC2A 5D8LB 1XB4A 3JTHA 2F5DA 1TLHB 3DP7A 5E8IA 2K86A 5JFRA 3D5LA 3RYPA 2DU9A 4RGUA 4EM1A 3LQRA 2W84A 2V6CA 4BAYA 3F3XA 2C6YA 2JT1A 1K7AA 2RC4A 4CGZA 1KQ9A 1R1UA 1AWCA 5J8FA 2Y48A 3T8TA 2HEOA 4OMZA 1OMIA 1BI3A 1K78B 5ICEA 2FEZA 1UCRA 3H92A 3WE2A 2KIUA 5FFXA 3V7CA 3DV8A 1IN8A 4GGGA 1O57A 2D1VA 3ZP5A 3VB2A 1GHCA 2RDPA 1FP2A 3R0AA 3V4GA 2E1CA 4WXCA 4XBFA 3GF2A 4AWXB 3N4MA 5E1ZB 1TBXA 2UZKA 2DBBA 2EK5A 1GXQA 4EV0A 4HF0A 4I0AA 3J7AO 1ZYRF 2J5OA 2BYVE 1U78A 4LB5A 3J81Z 2F5FA 4FX4A 4MGRA 1K79A 1LDKB 4LK0F 2IT0A 4IHSA 4ZYHA 3J80K 4O3MA 3ZMVA 3EYYA 4LG0A 1U6GA 2B0LA 3E6MA 5LGTA 3I5UA 3PFIA 2YSRA 2M8EA 3G3ZA 5HS7A 1O3QA 2PN6A 1ZRDA 3FX3A 2TDXA 3K0LA 2PLYA 3DXJF 1O7LA 1S3JA 2DW4A 2VBZA 3EQLF 4L0ZB 2LF8A 4RB1A 5LRSA 3EDPA 3QPHA 5LRRA 1LNWA 4OINF 1XSXA 4R79A 3HRTA 2O6GE 3KP2A 5JI6A 2P5KA 3P9CA 3QOPA 5ILVA 1SFEA 1T2KA 4I98B 4MTEA 2XUBA 1XGNA 4ESJA 4KUMA 1XSVA 4L9JA 1R00A 2ISYA 2DLLA 2OZUA 2Q8KA 3MZHA 3DFGA 5DDGA 2CYYA 2MLGA 3WTVC 2IVMA 3WODF 4BNCA 3I4PA 2HKOA 4OIQF 2OBPA 2X4HA 3I53A 4HAMA 1X3UA 3WGHA 3EYIA 1S6LA 2HTJA 2IPQX 4KNYA 2O8XA 3KP3A 2VOPA 2R3SA 3ECHA 1B9NA 4N9HA 2IRFG 1C0WA 2QQBA 3SHFA 4I09A 4KIBA 3HOSA 5DV5A 5L3FA 2QQ9A 2ACJA 5D5UB 2P7CB 4UV9A 3N97A 4DNCA 3KLNA 2X0LA 4GYIA 1LEBA 2L4MA 2G7UA 4BH9A 1KYZA 4CHUA 4GXOA 1BI2A 2DQLA 3TGNA 4M6XA 3F22A 5E20A 4M74A 5LEJA 1P6RA 1ZRCA 1OR7A 3WG9A 1QBJA 3B73A 4LLNA 3IKVA 1A04A 4HW0A 1K78A 2VXZA 4HBLA 3JAMK 1WSUA 5D6FA 1FNNA 2XAJA 3Q9VA 4AD9A 1KU7A 1MJAA 2VN2A 5FLXK 4FT8A 3IC7A 3GFIA 4L5JA 5IT9K 3H3UA 4I01A 4NB5A 1R5GA 1ZN2A 3FHZA 2MA3A 1XCBA 1HSTA 4BQAA 4HQEA 4I2OA 2ZNYA 2P7VB 3IL2A 4KMFA 1OPCA 3DPLC 1U2WA 3F6VA 4RGSA 2DI3A 1W4MA 3QP6A 3WU1B 2O03A 1I5ZA 2RV8A 1H0MA 5ILSA 2FU4A 2VBXA 3WE3A 2EFPA 2GA1A 5KVRA 3DEUA 5K5RA 3OV8A 2L01A 3LAJA 3V8JA 5D4SA 2EFWA 3HUGA 1ZRFA 3GEZA 2P5VA 1R22A 2FRHA 1JE8A 2F2EA 1RI7A 4ZYGA 4Z2YA 1L0OC 3IWFA 1FLIA 3F6OA 1J2XA 1LDJA 4NQWA 1FSEA 3E97A 2D2WA 1SAXA 1HW2A 5BS6A 3LWFA 4IVNA 4G7OF 2A5YB 2KIFA 1FOKA 1YO5C 1MGTA 2ETHA 2Z3YA 5JVTA 5BQTA 1XMAA 1ZLKA 2H27A 2NNYA 2DO7A 2DFIA 1BC8C 3TKYA 2XAHA 2XVCA 3BOQA 2COMA 3HTUA 3GWZA 3ERED 2W25A 3BROA 1P2FA 2MH9A 5E8GA 3FM5A 1MZBA 4HZFA 3GO5A 4HLXA 3JTGA 3MZYA 5DUIA 3MEXA 3VEPA 5LGUA 3KP5A 1MKMA 1MJBA 3EUHA 3NRVA 3SZTA 3GZ6A 5TRDA 2OD5A 4BHCA 6PAXA 2V1XA 4MEXF 2EV6A 1BIBA 1QZZA 3RTRA 2QUFA 4HV5A 2O3FA 2ZFWA 2HYFA 4EJTA 1J75A 4ZYDA 2FSWA 2A61A 5K5QA 2P8TA 1XGMA 2HFHA 1R23A 2RVCA 4IJAA 5EEGA 1O3TA 1CF7B 3SZPA 2IA0A 1FC3A 2PJPA 2ZBKA 4PGHA 4YFNF 4PCQA 2JZYA 1Z6RA 4EJOA 1BC7C 2V9VA 2QENA 2ESHA 4IRGA 4EM2A 2FOKA 3GFMA 4WWCA 4GO1A 3C7JA 5DD4A 1SD5A 2PG4A 4KYWA 4MQVA 4IPAA 1HW5A 4JQFA 4CYDA 4YIFA 2PI0A 3BPXA 3KE2A 3TOBA 3LA3A 3M9AA 2Z99A 4O5VA 4BHPA 1D8JA 4UV8A 2PMHA 4HV6A 1Q1HA 3PQJA 1MDMB 1J59A 2M87A 5KK1A 3F8FA 1S7AA 2HQRA 2HDCA 1FBSA 2ZNZA 3HYIA 4HYEA 5L3GA 4Y13A 5CVVA 4G7HF 4G8XA 5CVRA 1O3RA 5L3DA 1IN6A 2IA1A 3BJOA 4LGWA 2YR2A 1BI0A 2A3SA 1TW3A 1E2XA 1Y0UA 1HXDA 2KKOA 3KLOA 4RGRA 4WXDA 4EJWA 3E5QA 3MFKA 1HBXG 3ULQB 4H0EA 4BXUA 4F7ZA 1XN7A 4ZZLA 2P6TA 3ECOA 5K5OA 3GUDA 3RYRA 3ZMSA 5D5VB 1BBYA 3BY6A 1FYKA 2XGXA 3K1MA 4UNOA 4U7DA 3BP8A 1RUOA 4MEYF 1ONVA 5CVJA 3QAHA 3LA7A 3M8FA 5HDNA
chains in the Genus database with same CATH superfamily
5A2QK 4XIDA 3MVPA 3GX4X 2EFNA 3PUBA 1B72B 4LITA 1FBQA 1GV5A 1JHFA 2MSYA 2QKMB 2CUFA 4EGZA 2GWRA 2HYGD 1KQ0A 2KISA 3FXOA 3QWLA 4OAYA 1PUEE 2NVUB 1SMYF 4W1UA 4A3KJ 3VYRB 2O0YA 4II2A 1B9MA 2XRLA 2HXIA 2X9DA 1H9GA 1IRXA 5B66C 4HNTA 1K6OA 2DAOA 1OLTA 2K3PA 2N8GA 3E6CC 1HCRA 3WTYC 5D6EA 5J4YA 1I6XA 1K83J 1YI2I 3UKGA 1T08B 4HSRA 2R5YA 2G0EA 4BU2A 4G7ZF 1UHWA 4LFUA 2ZMEB 1QQIA 2BY2A 3BG5A 2CG4A 4D7NA 2XDVA 2NYXA 5EG0B 1TQPA 3I64A 2XAGA 3DCFA 2MG4A 4ENJA 5FB2A 1EV7A 1LQ1A 3OYEA 4CO8A 4LIVA 5J6XA 1Z05A 4BE2A 2FD5A 2M3AA 2OZ6A 3NEUA 4AM3A 4I99C 1WCMJ 3H0GJ 1N25A 1V5FA 3RKWA 2EFQA 4A3LJ 3J7ZI 1ORKA 3A4CA 3FK6A 4BBSJ 3IV5A 2XGEA 4FX0A 3HZJA 2IW5A 2NVQJ 3F8MA 2HGCA 2LKSA 2X6XA 1QRYA 2ADUA 3I58A 3IHUA 1PUFA 5FO5A 4S0HB 5GTIC 1VQKI 1G8XA 2K27A 3LSHA 3MZ8A 4A0ZA 3ZMUA 2XRNA 5K7FA 2HVSA 3CC4I 4L9VA 4B09A 3H36A 1OKRA 1Z77A 3GLXA 2RN7A 2R7UA 1TWCJ 2CFXA 1CF7A 2JTVA 2LG4A 4RB2C 4XLEA 3T8RA 3HEFA 1JGSA 4OIPF 1YJ9I 2F5VA 1W1WE 2MFZA 1ZGWA 1SFXA 1IO2A 3CCSI 2F5CA 4XLAA 1D5YA 2DYSH 2V26A 4M3GA 3A01B 4C2UA 4BE1A 1ZR2A 1IN7A 5E18F 2PMZA 1HOMA 3F8NA 3CCJI 3AG1H 3BG9A 3CUQC 1NTCA 4N4NB 4XRSG 3W3CA 1YX5A 2R93J 1KQ8A 1POGA 5KNLA 3IH3A 3GZ5A 3BPVA 2V1NA 4H4KC 3K70D 2BEOA 2BXZA 2FBHA 3SQNA 2VE9A 3RZDJ 1W7PB 5EJCA 1MH3A 3S2HJ 3TP3A 1VFCA 3C2HA 2LKXA 2VASA 2LY2A 2P4WA 2DFEA 3SXYA 3FXKA 1P92A 5KAIC 5HVQC 3CO6C 2HPMA 1ITYA 2XKPA 3OY9A 1ON1A 2GQQA 3IRQA 1I1GA 3CC7I 5JR3A 3FF5A 4Y33A 3HL2A 2HWVA 2R7OA 2A68F 2VBWA 1FYMA 5DUKA 5LBQA 2CW0F 1AKHA 2X48A 4U87A 5HS8A 1V54H 1LEAA 1QZEA 5E3OA 3PNTA 4EM0B 3GFJA 2H09A 3W2VA 2WY8Q 2DQRA 3ZQQA 1IDYA 1P9QC 4F92B 3E1SA 2HS5A 4IF4A 1FIPA 2EV5A 1IN5A 4LLGF 4LLLA 1REPC 4OMYA 2XV4S 4D5CA 4F52A 4AVPA 2M45A 4BXFA 5C4XJ 1MDMA 2X85A 3HPGA 4QPQA 1KU9A 2O5RA 4HF1A 4A5NA 1LDDA 2UV1A 3WTZA 2YX7A 2EJRA 2HNHA 2H6CA 4HA8A 3ZR8X 1QO0D 3S93A 5HLGA 1IN4A 4BUPA 1WHUA 4I0BA 2K7LA 5TJJA 4EGYA 3V8LA 3BR3A 1FX7A 2W48A 4YFXF 1S9HA 1KU2A 4IL6C 2E1MB 4F93B 9ANTA 3WU0A 2M0CA 2LMDA 2PX9A 3LOCA 4XMYA 3TOAA 4M6YA 2RNGA 1FY7A 3RDIA 1TWFJ 3N05A 5FGMA 1U3EM 2BY3A 1G3SA 2V9PA 3KEYA 3QP5A 1W0UA 4XM3A 3HRSA 4D9JA 4UVCA 2X6YA 1USTA 2R4GA 4HEA2 2HVRA 2FMYA 1X4PA 2BY0A 4O6JA 3VFZA 4LD5A 1EH6A 3RPQA 3L1PA 2I10A 5LGNA 2X6OA 2Z16A 3OIQA 4DZPA 4OIRF 3UR3C 1RR8C 3KP4A 4E4HA 1WJ5A 3HOZJ 3H3ZA 2KT0A 3PJRA 2V9KA 2LRDA 4PZJA 1WH5A 3ZQLA 3HOTA 1HSJA 3K1NA 4BJTA 1QPIA 3BQZA 3FZVA 4HDVA 1HQCA 1X4OA 1VQOI 3BDDA 1ENHA 4HQMA 3ABLH 2D1HA 2RQPA 4PDKA 3L2QA 2L9VA 1HKQA 3HSEA 2IS4A 1PP8F 2Y0MA 2M9HA 4DGWB 3ZOBA 1BIAA 2O61A 2XSJC 4K2EA 4QWQA 1XMXA 3VODA 1MBJA 1HKTA 2VJIA 1ZLJA 3ZMDA 3J80Z 1TQIA 4RLQA 4AU7A 3T1BA 3U21A 3KCCA 3M1EA 5FKMA 2I8DA 3SFZA 5K7HA 1D1BA 1E3PA 3WTSC 5DCFA 2VPRA 3RI4A 1P4WA 2XROA 4M71A 3V7SA 1ZR4A 1E3OC 4Q5SF 1TL8A 2KZGA 2VL8A 3FMRA 4MQ9F 3LNQA 1ZARA 4IHWA 1YW8A 4ENMA 2OQGA 3NQOA 2DMUA 3BR5A 3D0SA 1OYYA 2PEXA 3X2QH 3PIOF 1U5TC 3VWBA 5HS9A 4Y15A 1YIOA 2CQ7A 3HKZN 1YS6A 1FBUA 2K4BA 3BZKA 2DT7B 4XONA 2AO9A 2STWA 2J5PA 2XKOA 1Z67A 4HX8A 3ZGKA 5GAHJ 2MD5A 3LA2A 4XN0A 2Z33A 2W57A 2K9LA 2X1CA 4X0GA 4RM2A 3IWZA 5CPRB 1DPUA 1YW7A 2ZMEA 2RGVA 1IV8A 1B59A 2L4AA 5EG0A 4HLYA 4UVBA 2M1BA 4M73A 1WJDA 3I55I 4IX7A 3AAFA 3AG4H 3COAC 4E7SA 3GTLJ 5D5XB 1O4XA 4YRVA 3OIPA 1JJ8C 2ESNA 5AIQA 1LB2A 2KIMA 4W97A 1EF4A 2M2EA 3O6BB 1W5CC 3MWMA 2VQHA 3ZPLA 1R5HA 2AQEA 4DYRA 4LB6B 1ZGAA 1J7KA 2JN6A 5M3MJ 4LG3A 3TO6A 4A5MA 2RKHA 2F4OB 3U1DA 2NVYJ 3WTTC 3PSIA 4NNJA 1B4AA 3OYKA 1R1VA 3FXQA 2HI3A 1MSEC 3A03A 2MABA 2M0MA 2FNPA 5E79C 3L2RA 4J00A 3OYCA 4XKCA 1O7FA 2MH2A 1SEUA 3R0JA 4B43A 2XF5A 4Q48A 1FYLA 2FBIA 3Q5FA 1DU6A 1DPRA 2RNJA 3B6CA 1ZREA 2JWTA 4A6DA 4NUBA 2IS1A 3G2BA 3ONQA 2KL4A 2D45A 3HHGA 1W7PA 3CDHA 1ZG5A 5M3FJ 1FP1D 2ISZA 3FHNA 1QPMA 3CMMA 4BE0A 2WB1A 1A35A 1LUJB 3CMYA 2GBYA 2EA2A 3MKLA 4DYQA 1R58A 2M5WA 4G6QA 3DEEA 4NBQA 4HNUA 4V2GA 1EH7A 5BPIA 1R36A 4XNFA 5DCMB 1ON2A 1RC9A 3S1QJ 2EWNA 2LR8A 2ZO4A 4WCGA 4BS9A 4ANJA 4C30A 4YIIA 4YFKF 1AA7A 1P4AA 3WGIA 1VQ8I 5DM7F 1G3WA 3REOA 4DW6A 4EEFG 4Q4ZF 2M8GX 2ELJA 2ZCWA 1QHHD 2R5YB 1PP7U 2XGDA 2RQQA 1GV2A 1QNTA 4M9XA 5J8CA 2F5EA 3GW2A 2ID3A 4P1WA 3FM3A 2IA2A 3RJPA 3MCZA 2EIKH 4Y17A 1ZG1A 1MD0A 1ZAOA 4MLOA 1W36C 2ELHA 4ON0A 2EV0A 3KPHA 1IUYA 2V1UA 2AXLA 3OYGA 4N0BA 1N75A 4LOCA 2NRAC 5IYCJ 3JSPA 2E34A 1TWAJ 1VQ6I 4NC8A 2OA4A 4UVAA 1BM9A 2UUZA 1LJ9A 3CUOA 3JAMZ 1DDNA 4IXAA 3LSPA 1WWXA 4RS8A 3RKYA 5E3LA 3FMQA 2LY9A 2VC0A 5HDKA 2H1KA 4KIGA 3CCQI 1IXRC 1VZ0A 4KN4X 2E1NA 5IP9J 2L02A 2ZJRF 3ZN1A 3SJMA 3M7GA 1OQYA 2CRGA 5FLXZ 1TW2A 1IV6A 1GUUA 2DXIA 1J09A 1IXSB 5IT9Z 4MO7A 5KCMA 3SYTA 3CQZJ 3DEWA 1OCCH 1W7PD 3FKIJ 1CQTA 2W85A 1J5YA 4R1HA 3IKTA 5BPDA 2M30A 3L2CA 1B6AA 1ETVA 2F4MB 2Y9YA 3LQQA 2FE3A 1MNDA 2XASA 1APLC 2O9LA 1Z7LA 1MMNA 4FHTA 2LFBA 3BLYA 1VTNC 1R71A 5CLSA 2QYOA 4B4CA 3HXLA 3H35A 4G6DA 3O3KA 1LKXA 3MKWB 4PJMA 4R8HA 4EQQA 3CLOA 3RSNA 4BJ6C 4HPQA 2KJBA 3HG9A 5DEQA 2BBYA 1BR4A 3U2RA 1H89C 4ZDPA 3BZ6A 3JRFA 1IRFA 1S5LC 4AIJA 1AU7A 4LK1F 1VQPI 4CZZA 2GIVA 1JT6A 1QA6A 2DA7A 1QVUA 1W5TA 2K9MA 2HKXA 3L7WA 1OCOH 3HRUA 1HKSA 4ESFA 1ZHFA 3ABUA 4KDPA 3BR0A 4PGGA 2AXTC 2XPVA 4X1EA 4WK8F 3RZOJ 1AOYA 3HIFA 2VKHA 3J81K 3M8JA 4ESBA 1WVRA 2PQ8A 2MLKA 2XAUA 4RA2A 4A2UA 2EZLA 3I3LA 1UFMA 2KHMA 4Y4RA 4ZH4F 3PNVA 1JXSA 1IRZA 1QZYA 3H1CA 4HSTA 2QVOA 4WXHA 3GTGJ 4P9FA 5D4RA 5BOXA 3WTUC 5DD8A 4ZDLA 2CGPA 2V1DA 2YU9J 3S16J 2G9WA 3KP7A 5HNFA 3P9IA 3OYHA 3QQAA 3OR1C 1XC5A 3K69A 2HDWA 5GPAA 4E6KG 4PJJA 2DMQA 2L3DA 1HW1A 1T33A 1LFPA 2NAZA 4YIRX 1TZLA 1R5ID 3W6JB 4A3EJ 3SZGA 3HSFA 3GTMJ 2R7WA 2XIGA 3DTKA 1XS9A 4AYBN 4Y3OA 1YS7A 3BZCA 1SD6A 2A5WA 1T39A 5EEHA 2VBYA 2L54A 2EA4A 3F9KA 3E6DA 1LFBA 5AONA 5B1AH 4ZZDA 2E2HJ 3K2AA 1T0FA 3CTAA 5IOYA 2LKPA 1JHHA 2E71A 2L2OA 4UY8I 1TQMA 1BN5A 3FMSA 5F64A 4DQ2A 4EVIA 2QWWA 2CWEA 2W24A 5E1XA 1YQAA 2DTZA 2YU3A 1ETQA 4BEHB 1O3SA 1Z1DA 1F9NA 2FBKA 4RB0A 1JUPA 3QPTA 1X1AA 1DP7P 1IGNA 2Y75A 2GXBA 1WRJA 4MHGA 4S04A 4DJAA 4M72A 2WBMA 3L9FA 1ETKA 3U9GA 1PJRA 3WTWC 2R7TA 2VC1A 2A69F 1U5TB 1XDSA 2HOEA 2CV0A 2KIQA 5J40A 2DMNA 2DT5A 1DQUA 3I0TA 1X1BA 4A0XA 1FOXA 3TO9A 1U9NA 4M9SA 3M8EA 4F91B 5IT3A 3C1DA 4KFCA 2OU2A 3FXMA 4XLHA 4L0YB 2VLAA 2JSCA 3ZQCA 1ZG3A 1S7EA 5ICCA 2GZWA 1G3TA 2W4SA 2PFBA 5DCMA 3C3WA 4MTDA 2QF7A 2HZDA 2K02A 4EMSA 2QLZA 2WAQN 2CU7A 4ASNA 2VT2A 1Y8QB 4P96A 1BW6A 5HOOA 2DPUA 5JHFA 3MMYB 4G6TB 2KQRA 2CQQA 2UXXA 4CSWA 1VQNI 2O8KA 2KJCA 3WG7H 2IJLA 2ECBA 1R7JA 3IH4A 4A0YA 4HX4A 2CQKA 1U8RA 2E7WA 5IOZA 3G4SI 2FXAA 2P5LC 4Y52J 1Z21A 3DPTA 3O2PE 3ASNH 3H9JA 2GA2A 4U7BA 5JLXA 3JRAA 3VOEA 1MNMC 2G7HA 3KYLA 1VQ7I 2JA6J 1A6IA 2L7MP 1EA3A 1WI9A 1YIJI 4BKXA 2M7BA 3GFLA 2VT3A 3S2WA 2MC4A 5HODA 1XGSA 5EEAA 1IF1A 2STTA 1Y1VJ 2HDDA 3CCRI 4XOPA 2LD5A 4NC7A 3BJ6A 1J0RA 1YTYA 4RAGA 3FWEA 1NG6A 5FROA 5DS9A 1WZ2A 2BZTA 3CUQA 2VONA 2BVMA 2MC3A 2HZTA 3LSKA 4EJVA 4C2TA 3KFWX 1IAWA 1YE9A 4UUSB 1WKMA 2EBIA 2M4GA 1HDPA 2VUMJ 4U88A 1X1DA 4M3EA 1TP4A 2VE8A 3HSRA 5E17F 1F1ZA 2NNNA 2HR3A 4HRIA 3NWSA 3PSFA 2DPDA 3Q0VA 3OS0A 1HLVA 1YX3A 4ZTJA 2LDUA 4KT5C 2CV2A 1KU3A 2JUCA 3CZ6A 4GYGA 2CUZA 1Z7UA 4RGXA 3B02A 1FSHA 2QA4I 2CSOA 5IYDJ 1ODDA 1DP3A 3TQNA 4XKBA 4B3AA 4E7LA 4BDZA 4G9YA 1SFUA 4JK1X 3R61A 4QLCU 3CMEI 5L3BA 3BWGA 4D7MA 2LOOA 2IS6A 2FOWA 1OCRH 3QYFA 2HOAA 4F55A 4ENNA 4UUVA 4A3IJ 1ULYA 3HRMA 3QU3A 4L5IA 1KONA 1YJWI 4XICA 1MBGA 5H6QA 1WI3A 1G59A 2LNBA 4C3JJ 2BHZA 1OCPA 2H8RA 2HPIA 2H94A 4CCJA 4IHTA 2DCEA 5FD6A 5HDGA 3S3OA 5FLMJ 2JQ7A 1MMDA 2UWMA 4M3DA 2DYRH 2NOJB 4OIOF 1W5SA 3OMYA 3GMEA 3LSRA 2ZB9A 3B6AA 3LSTA 2R7VA 3HC7A 1F4KA 3DKWA 4YG2F 2OF7A 4BY1J 3LFKA 1QGPA 2A07F 1LVAA 2GOXB 1JUSA 2TCTA 4RB3C 1ZH5A 2LY1A 3HTSB 3GXOA 3DKXA 2P6SA 5LEKA 5F6FA 2FMLA 5H20A 2A6HF 4I7HA 2HQNA 3W6KB 1TNSA 5IY5H 3KETA 3GTPJ 3S3MA 2QSGX 3E3VA 1SVLA 3VYUB 5A2QZ 1STZA 4UB6C 2OPTA 4YEJA 2WAEA 2XF6A 2DA2A 3BG3A 3IAM2 3IRRA 2VODA 1GXPA 1WH7A 2HQAA 3RIRA 4E70A 4L9NA 3ELKA 5GAEJ 2EZKA 1FWZA 5DM6F 2WTEA 2YX4A 4I76A 4XL9A 3VYSB 4L18B 3LAPA 1RESA 1A5JA 4ZDOA 3LSJA 4FTHA 2EH3A 2PBIA 3K7AJ 4ETSA 2K4JA 2BOLA 1X2MA 2LREA 4XSZF 4U0WA 4EJUA 3I4NJ 1BR1A 3I59B 1NHAA 4OOIA 2DN0A 1GT0C 3DQVC 1P7JA 2FA5A 2Y9ZA 2BGCA 3FXRA 1F43A 3KEQA 4DBRA 3P7NA 4FQGA 2QBYB 1V3FA 2Y30A 4G94A 4N9IA 2ZJ2A 4TV7A 4BGDA 2Q0OA 4KN7X 2MBFA 1QVTA 5E1WA 1OYWA 3HGGA 2Q2EB 4BEHA 3VPRA 1D8KA 1UB9A 4LJZF 3TDZC 1D3YA 2DA3A 3T5XA 4PSXA 4F3QA 2OV7A 5DYMA 3WHCA 5C44J 2QEXI 1VQMI 3R4KA 1U5TA 3RPUA 5LLQA 3QRFF 2XAFA 1R1TA 3Q3SA 4XRFA 1D0XA 5J47A 1SC7A 2LF7A 2QQAA 3V8KA 2ZKZA 1KZHA 4FETA 5B1BH 1QHGA 3ROUA 3S1RJ 2GM4A 2V6EA 1Y8RB 4AC0A 3AG2H 1EH8A 3A0HC 1IDZA 3BJAA 3Q9SA 4YELA 4FCYA 2WA0A 1TNTA 1NK2P 1KYWA 3TEDA 3HHHA 3ZQFA 3CF5F 3KP6A 4AUXA 1T98A 2NOGA 1RRJA 1MJ9A 1UHMA 1PDNC 1IXCA 3PO2J 1SD4A 5B5EC 1BR2A 2KPMA 5LFAA 1UHSA 2IGKA 1DUXC 1JGGA 1DGWY 2E5NA 3G1MA 3F8BA 1XSDA 1XCVA 3R60A 4IEJA 4RAZA 3P5JA 1Z6TA 5F0FA 1FZPB 1I6HJ 1GVJA 2UXNA 2PJRB 1Z0XA 1FEXA 5FFZA 3ASOH 4C3HJ 1YRNB 2CUJA 1OR7C 3JW4A 4Q47A 4XLPF 4A12A 1WJAA 3PUFA 3E5UA 1WFXA 2NS0A 3BG6A 3CCMI 3F21A 3MD2A 2CO5A 4BYYA 1IC8A 4KMUX 4IKFA 4BQQA 3D1NI 1D1AA 3CJNA 4BBRJ 3ABTA 2VB6A 5BMZA 2IS2A 1QU3A 4UHTA 4A3FJ 4HOBA 1YYVA 1FT9A 1XG1A 3E7LA 1MBHA 2DK5A 4CICA 2A6EF 1YW9A 3VSKA 3KZZA 4DIQA 5KHDA 1ZGJA 2JRMA 2LK2A 1G6NA 1LFUP 1CGPA 3PFYA 1ZK8A 2QGUA 2Y31A 1WQ2A 1P4XA 4RAYA 4DZJA 2E35A 1OFCX 3OYJA 2KDZA 3JRIA 3FXUA 2ZXHA 1RETA 4CCNA 2XPWA 1YITI 4OU0A 5J4VA 5JVGF 3CCVI 3DTEA 4UUSA 4IRHA 5CVUA 4BHBA 3S14J 5HNHA 1T6SA 2JPCA 4IRIA 1ERDA 2R7FA 3FBNB 2Z5UA 3ZCOA 4XLNF 4BQOA 1S29A 2EB7A 5D5WB 5CQEA 2Y0SN 3TO7A 4J19A 1T38A 1T56A 3RQ4A 2YPRA 1RIOH 1OCTC 2DTRA 3MAJA 3OSGA 4PJLA 2LH9A 4I02A 4HF2A 4OAZA 3K9TA 1G3YA 3LMMA 4CA0A 5LHGA 2BV6A 2FF4A 2HTSA 3ZN0A 3CDLA 2KRFA 3JSOA 1Y1WJ 2XHKA 3GLLA 2EIMH 1Q1VA 5AIPA 4FISA 4V2FA 1MH4A 1B1BA 4WX9A 5ERIA 1UELB 2P81A 3L09A 1IJWC 5EDNA 1V4RA 2OC6A 4PK4A 4A3CJ 2IP2A 1P7IA 2GXGA 5JLWA 4P5OA 4LIUA 2FQ3A 5ICFA 1AHDP 3ISPA 2X51A 3RKXA 1F5TA 3S32A 1JKRC 2R92J 4D0PA 2HVQA 1FJLA 3FBIB 5HLHA 4GDFA 1L3LA 2A6TA 1H9TA 3C18A 2QSFX 3TBIA 4P55A 5EZGA 1I50J 1NH3A 1R6RA 5F1RA 1LVKA 3H9GA 5H6RA 4CYCB 3GYHX 3E6BA 1U9OA 5EGOB 3DLLF 1WJFA 3G73A 1FPQA 3DBHB 1KGSA 1RUNA 1IW7F 3SDBA 3DU6A 3R6SA 3TL4X 5L3CA 3K2ZA 3RCOA 5LHIA 4HX7A 4MFEA 2BE5F 4WF2A 3SEZA 5L3EA 4A3MJ 1I1SA 2WWYA 4B44A 5M5YJ 1OYIA 2R7DA 5ICGA 2QM3A 1IRGA 1D5VA 1FMWA 3A02A 4PUSA 1JKPC 2PMZN 1MIJA 5CYVA 4CDGA 1WJEA 3KZYA 2LSOA 2LC2A 3K1PA 5F08A 5C3EJ 4UXNA 3L00A 3M3YJ 2CW8A 3A1YA 1Z91A 1JI8A 1SMTA 3TMOA 2H6BA 4L9TA 2PMUA 5ED4A 1XD7A 1S72I 3OYIA 2DA4A 3CUQB 2JA7J 2K3FA 4AIDA 2DJNA 5FD5A 2GAUA 3BTIA 2Z9OA 3FIWA 3ML6A 4IQJA 5K1YA 3PQKA 3TDUC 5CKTA 1YFHA 3EUHC 1SD7A 3DWLE 2ZJQF 5CVIA 1S7OA 3OYLA 1UJ8A 2DMPA 3P9KA 2Z2SB 3ABKH 1G4DA 4LG0B 3F23A 3RKQA 1BOBA 3IP4B 2OAZA 2XF7A 3NARA 3I59A 3K10A 2DOAA 2WV1A 2R5ZB 2X1EA 2JPBA 2VOOA 4J01A 2IGMA 1OJLA 4CCKA 1MBEA 1Z9CA 4KA4A 2AS5F 2EFOA 4XSXF 4RBOA 2QBYA 3KEOA 4AIHA 4A3JJ 3QU6A 4LMYA 1E17A 2X1DA 4IO9F 3GVAA 1XDUA 2Q2EA 3MQ0A 4JP0A 3S1NJ 2OTJI 1RZ4A 4EATA 5JHUA 3KX2A 2V79A 2V4JC 2ECCA 4B8XA 1XMKA 3CO7C 4KIFA 2DOEA 1BI1A 5LHHA 3GTKJ 3H5RA 4CUGA 1KA8A 3ZMZA 1TTYA 1XGOA 1TWGJ 2L9SA 2M4KA 3WGGA 4MNUA 3ZMTA 3I54A 3JRBA 2ZXJA 2IBDA 4JBAA 5CJ9A 3HGYA 1ETOA 2H1LA 3GZNB 1YG2A 1LE8B 4U0YA 3WTXC 4NHJA 3OS1A 3JREA 2ZXIA 1MSFC 1I27A 2VI6A 3DF8A 4ENKA 3JRHA 4U0VA 3H9QA 2VJ4A 4KICA 2XAQA 5CQGA 3LL7A 4BY7J 3F8CA 2L7FP 3SEQA 1BOAA 2QQ8A 1J9IA 3EETA 1Y6IA 3V7RA 4A6EA 1K4TA 3OL4A 3H0DA 3M1CA 1RNLA 2OQRA 3T0YA 2JRTA 2WV0A 1JTXA 1JKQC 4CXFA 2KFDA 2L7KA 1MBKA 3I71A 5HLIA 3S17J 1SFOJ 4S05A 2DK8A 3BQYA 3ZQ7A 4ZYEA 2WY7Q 2CV1A 2O7OA 2PJRA 2H8WA 3H5NA 4I6ZA 3BTJA 2LYCA 4PSWA 1YRNA 2E7XA 3K4KA 3I4MJ 1WGXA 4A93J 4GCVA 1X1PA 4M9ZA 2E36A 3D5RC 3KZIC 5KAFC 2ZJPF 3E5XA 5ILUA 2KMUA 2HOSA 4X6AJ 1JTYA 2W00A 1E0EA 2K9NA 1BJAA 2EIJH 3OOPA 4UB8C 1YLFA 2FNAA 5D8KB 5GADJ 2VQCA 2JA2A 4HDUA 4E7JA 3GTOJ 2GOMA 1IZ1A 4FE4A 5FKKA 5H2FC 2ID6A 1S8NA 3BG7A 4V19K 4P9UA 1W0TA 3DTIA 3W2AA 1VF9A 1MMSA 2QZ8A 2E1OA 3F72A 4AIKA 2LP0A 1UZCA 1USSA 2WC2A 3D5SC 1XB4A 3BR6A 5D8LB 4II3A 1MNEA 5EF6A 3JTHA 2F5DA 1TLHB 4L5EA 2BXYA 3DP7A 1A6QA 5F1JA 4NC6A 3DKYA 5E8IA 5FLVA 2K86A 5JFRA 3HKZA 3W2WA 3D5LA 3RYPA 2DU9A 5K7ZA 2EINH 5E3MA 1ZTRA 2LVSA 4RGUA 4EM1A 3LQRA 2W84A 1JKOC 2V6CA 4BAYA 1HA8A 2CUEA 3AFHA 4RM3A 1G2HA 3OIOA 5M5WJ 4IZZA 3F3XA 3CLQA 3A0BC 3V42A 3G71I 2C6YA 1UMQA 2JT1A 1K7AA 2HQ5A 1X3ZB 2RC4A 3E0JB 4C3IJ 2DA6A 1VQ4I 4CGZA 1KQ9A 3PNYA 1R1UA 1AWCA 2L7ZA 5J8FA 2Y48A 3T8TA 1FOWA 3DPUA 4E7HA 4JX5A 1OMIA 4OMZA 2HEOA 3CJRB 1N78A 3TW6A 4Y7NJ 1BI3A 1K78B 3K6GA 5ICEA 3MKZA 2FEZA 1UCRA 5TGTA 1R49A 2EQRA 2I5UA 2XC7A 1T0FC 2LBFB 3H92A 1MBFA 4JX6A 1Z3XA 3K4BA 2L9RA 3WE2A 2KIUA 2DA5A 3MKYB 2E5ZA 2CS3A 3CJQB 1I3AA 3CCUI 3F0CA 2B9SA 1Y56A 5FFXA 2K9QA 3DV8A 3V7CA 4XRMA 4XLFA 4CYCA 1IN8A 4GGGA 1O57A 3S8PA 3VYTB 3S15J 5EGOA 2D1VA 3J7AY 3ZP5A 3VB2A 3PM1A 3JRGA 1GHCA 1D1CA 2RDPA 1DU0A 1FP2A 1HF0A 1YOVB 2Y0SA 3R0AA 2WADA 3OYNA 3V4GA 2ME0A 3JCUC 2E1CA 2DT6A 4B48A 4WXCA 4XBFA 2HXOA 3GF2A 1MW7A 4AWXB 3GCMA 3N4MA 5E1ZB 1TBXA 3QPSA 2UZKA 2DBBA 1WJCA 1T8IA 2EK5A 2FJ1A 1FIAA 4XR6A 3W6VA 1GXQA 4KISA 4EV0A 4HF0A 2M34A 4I0AA 3J7AO 1ZYRF 2J5OA 5BNGA 2BYVE 1RKWA 3VSLA 1R4NB 1U78A 3K70C 5FKNA 4DOZA 4LB5A 2R7ZJ 1I39A 4Z6YA 2WB1N 3J81Z 2F5FA 3IH2A 4A69C 2ZXWH 3ERMA 3HUGB 4FX4A 1YHQI 4MGRA 1K79A 3EPZA 1LDKB 1X1CA 4LK0F 2IT0A 4IHSA 4ZYHA 2F6CA 1BA5A 2QCOA 2F4IA 4M6VA 3BR2A 2R7SA 2GXAA 3G6EI 3J80K 4O3MA 2W7NA 2XB0X 3ZMVA 2Y69H 3EYYA 3K4CA 4NQWB 1U6GA 4LG0A 1LPQA 1B8IB 2B0LA 3E6MA 5LGTA 3AL0C 3I5UA 3HB9A 3PFIA 3HOWJ 2YSRA 2R5ZA 3KYDB 5F04A 5IPAA 3CD6I 1JUMA 5HLTA 3JRCA 2M8EA 1SAUA 1VNDA 3G3ZA 5HS7A 1O3QA 2PN6A 5E3NA 2NVTJ 3AG3H 2JA5J 1OCZH 4JX4A 1ZRDA 1N77A 1BL0A 3FX3A 2TDXA 4BQNA 4E7KA 4E7IA 3K0LA 2PLYA 3DXJF 3EUAA 1O7LA 4XQFA 1S3JA 2DW4A 3HBLA 2VBZA 3TP0A 3EQLF 1ACIA 3ZRGA 4L0ZB 2LF8A 4RB1A 5LRSA 4JOMA 2E60A 1U0JA 3EDPA 3QPHA 5LRRA 1LNWA 4OINF 1XSXA 2LLKA 1LE8A 4R79A 5GPCA 3HRTA 2O6GE 2CQNA 2JUGA 5J1YA 3HJEA 3KP2A 5JI6A 2P5KA 4CCLA 3P9CA 2MD0A 3QOPA 1OISA 3O8HA 5ILVA 3OYFA 1A36A 2W82A 3BTCA 3OWTA 3PIPF 1SFEA 5F0HA 1T2KA 4I98B 4MTEA 2XUBA 3GTJJ 1SVOA 1XGNA 4ESJA 4KUMA 3OYBA 2DMTA 1XSVA 1RPWA 4L9JA 2V7FA 1R00A 2ISYA 2DLLA 2EPFA 2OZUA 2Q8KA 3MZHA 1H8AC 3DFGA 3M4OJ 4UUTA 5DDGA 3CMAI 2CYYA 2MLGA 3ABMH 3WTVC 2IVMA 3WODF 4BNCA 3I4PA 2HKOA 3BCAA 1WPKA 4OIQF 3OYDA 1ETXA 2Z1DA 4QIWN 2MGQA 2OBPA 2KP6A 2X4HA 3I53A 4HAMA 1X3UA 4RAFA 2KDOA 2E2JJ 1XPXA 2E19A 3WGHA 3K4LA 3CCYA 5GP9A 3EYIA 1S6LA 2AQFA 2HTJA 2IPQX 4BDYA 1MMGA 4KNYA 2O8XA 3KP3A 2VOPA 2R3SA 3GBGA 1TC3C 3ECHA 1B9NA 1BJZA 4AVZA 4N9HA 5F0CA 1V55H 3J7YJ 2IRFG 1C0WA 3CP2A 2QQBA 1I3QJ 3SHFA 4I09A 2COBA 4KIBA 2VKEA 3HOSA 1PVEA 5DV5A 2QQ9A 4ZC3A 5L3FA 2ACJA 2XGCA 4FE7A 5D5UB 2P7CB 4UV9A 4CZCA 3N97A 4DNCA 3KLNA 4MIMA 2HU9A 2X0LA 1EKEA 5GTHC 4GYIA 1LEBA 2K40A 2L4MA 2G7UA 4BH9A 1KYZA 4CHUA 4GXOA 1BI2A 4IHVA 2OCEA 2DQLA 3LSGA 2W1OA 4XORA 3TGNA 4N4OB 4M6XA 3ZQHA 2ZFUA 4GRIA 1R9TJ 3F22A 5E20A 4M74A 5LEJA 5FRMA 1P6RA 1ZRCA 3ZQGA 1JT0A 1OR7A 1ZKGA 3CP8A 1X3WB 2JSPA 3WG9A 2Q1ZB 3B73A 1QBJA 4LLNA 2CW7A 3IKVA 4AYBA 1A04A 4HW0A 1FTZA 1K78A 2R7XA 2VXZA 3CF2A 4ZTFA 1TT0A 3WHBA 4HBLA 3JAMK 2LBFA 1WSUA 4RLFA 5D6FA 4XLCA 1X58A 2IEKA 1VQLI 3DBRB 1HDDC 3QOEA 1FNNA 2XAJA 3Q9VA 4AD9A 2LTPA 1KU7A 1MJAA 1B72A 1K61A 2VN2A 2BVLA 3ZQIA 4FT8A 3IUOA 1FOYA 3IC7A 5FLXK 4IQ4A 4KITB 2D5VA 1RR7A 3GFIA 1R4MB 4L5JA 5IT9K 3H3UA 4I01A 4NB5A 1R5GA 1ZN2A 3FHZA 2MA3A 2Y2ZA 1XX5A 2HYJA 1XCBA 1HSTA 2VXDA 4BQAA 4HQEA 5FKLA 2BY1A 3PL8A 4I2OA 2ZNYA 2P7VB 4XRSA 4RMNA 5M5XJ 3S1MJ 3IL2A 4E7ZA 4KMFA 1OPCA 2GIZA 3DPLC 1U2WA 2RAEA 3F6VA 4RGSA 2DI3A 1W4MA 3QP6A 2L0KA 3WU1B 1PYVA 2ZC2A 2O03A 1I5ZA 1Y0NA 4A3DJ 2MYSA 2RV8A 3OSFA 1BW5A 3HOYJ 3HOXJ 1H0MA 5ILSA 2BHYA 5FJ8J 2FU4A 2VBXA 3OR2C 3WE3A 1VQ5I 2DJIA 3DBLB 2EFPA 2GA1A 5KVRA 3DEUA 5K5RA 3OV8A 3TW7A 2L01A 4MFDA 4BL0B 2FUG2 3RPUD 3LAJA 3H5AA 3V8JA 5D4SA 2EFWA 2JVHA 4IHYA 3HUGA 1H88C 1ZRFA 3GEZA 2P5VA 2WAQA 1R22A 4C9YA 4QTRA 2FRHA 2JMWA 2ICWG 2DFHA 3KYCB 2ZMEC 2ME6A 2F2EA 1RI7A 4ZYGA 4M3BA 1JE8A 4Z2YA 4RDUA 4NDLA 2ZSHB 1L0OC 2MW8A 3CDIA 3IWFA 1GDTA 1FLIA 3OL3A 3NAUA 3F6OA 1J2XA 1LDJA 3DU5A 5J1RA 2BW3B 2OCCH 4NQWA 1FSEA 3E97A 1B8IA 1M1EB 2FQ4A 2D2WA 1SAXA 1HW2A 4BJ5C 5BS6A 3WU2C 3LWFA 2VKDA 3EUKL 4IVNA 4G7OF 3GTQJ 2A5YB 2KIFA 2KRHA 1FOKA 1YO5C 2JA8J 1Z3YA 3LFUA 1K6YA 3A01A 3OYMA 2OTLI 1MGTA 3C2BA 2ETHA 3C2GA 3KIOA 3QYEA 1XTAA 3HM5A 3SFIA 2Z3YA 3LSIA 5JVTA 3CCLI 3CJTB 3QYBA 5BQTA 1XMAA 3HOVJ 4XKWA 1YJNI 1ZLKA 2H27A 2NNYA 2DO7A 2DFIA 1VI0A 2F48A 1BC8C 1V5EA 3U1KA 3TKYA 2XAHA 3I9V2 2XVCA 3BOQA 5IP6A 2COMA 4KJZA 2K5CA 4BACA 3Q0UA 3CCEI 3HTUA 3GWZA 1ZELA 3ERED 2W25A 3BROA 1P2FA 2MH9A 5E8GA 3VDXA 3O8GA 3RQIA 3FM5A 1MZBA 2OUMA 2DDBA 1FMVA 4HZFA 2ZSIB 4M3FA 3ZXSA 4A3BJ 3GO5A 3BC8A 4HLXA 2JK3A 5EZHA 3JRDA 1E3HA 2X6WA 3K4MA 2CFOA 3MZYA 3JTGA 5DUIA 2EZIA 3MEXA 1TT5B 2M7AA 3VEPA 5LGUA 3KP5A 1MKMA 2K9SA 2CQXA 1MJBA 3BR1A 2R7RA 3EUHA 3NRVA 4C2MJ 3SZTA 3UNGC 4XK4A 3GZ6A 5TRDA 2OD5A 3NWTA 3PO3J 4BHCA 6PAXA 2VQGA 2V1XA 1UG0A 5J1UA 2NVXJ 4MEXF 2XPUA 2EV6A 2JJ7A 1BIBA 2JVGA 4ABZA 1QZZA 2KRCA 3AL0B 4GFBA 3RTRA 2QUFA 4HV5A 2O3FA 2L5QA 5C4JJ 2ZFWA 1SANA 2HYFA 1FTTA 4EJTA 1J75A 2IGOA 4ZYDA 3JR9A 4HNVA 2FSWA 2A61A 2AHQA 5K5QA 4IOCF 2B63J 3CESA 4B1RA 2P8TA 2NXNB 1XGMA 1EJ9A 2HFHA 3FXLA 3OOUA 2R0QC 2QKLB 4BXXJ 1R23A 5FKOA 4B47A 1PUFB 2RVCA 2HOTA 2DFFA 3A2KA 3BCBA 4IJAA 5F27A 4CCMA 5EEGA 1O3TA 3MN2A 1CF7B 1D0YA 1SFKA 1W36D 5IYBJ 3FKJA 3SZPA 2FX0A 2IA0A 3G1LA 3M07A 4QSHA 3BT9A 3G1OA 1FC3A 2PJPA 2ZBKA 4PGHA 4JYKA 4YFNF 3S3NA 4PCQA 5LD2C 2IGNA 2JZYA 1Z6RA 4EJOA 1BC7C 2V9VA 2QENA 2ESHA 4IRGA 4XN3A 4EM2A 4DYCA 4A3GJ 2E1MC 1ETYA 2FOKA 1GVDA 3GFMA 4QPOA 5TISC 3L2VA 1Y39A 2IAIA 3LSMA 4ITVA 4WWCA 4GO1A 3C7JA 2IXSA 4ZJZA 2EZHA 1JJ6C 5DD4A 1SD5A 4D5FA 2PG4A 4KYWA 4MQVA 4B3XA 1U8BA 2DA1A 3HOUJ 3FXJA 4IPAA 2YUSA 3BTLA 1HW5A 4JQFA 4CYDA 1SVMA 4YIFA 5B3SH 2PI0A 4FASD 3FK7A 3OYAA 2RREA 3BPXA 2R7QA 3K4NA 4IHXA 2K85A 2DODA 2EILH 3KE2A 3TOBA 2VPLA 1AKHB 1RKTA 3LA3A 3M9AA 3HPHA 2Z99A 3Q0WA 4O5VA 4BHPA 3FISA 2L9NA 2VQLA 5J3LA 1D8JA 4UV8A 1T95A 1VQ9I 2VKVA 2PMHA 4HV6A 5IP7J 4PJNA 1Q1HA 1GLNA 4XKVA 5GAGJ 2NS7A 1NG7A 3PQJA 1MDMB 1J59A 2VJ5A 2WAFA 2XB5A 2M87A 5KK1A 3F8FA 1NK3P 4CH7A 1S7AA 2HQRA 3SDGA 2HDCA 1FBSA 1A31A 1ETWA 2ZNZA 3HYIA 4G12A 4HYEA 5L3GA 2P0WA 4Y13A 5CVVA 2QSHX 4IOAF 4G7HF 1ZQ3P 4G8XA 3FDYA 5CVRA 2XSDC 1WJBA 1O3RA 1IUFA 4PFOA 3S2DJ 3QODA 5L3DA 1IN6A 2IA1A 3BJOA 4LGWA 1F36A 2YR2A 2VJJA 1BI0A 4PJ0C 2A3SA 2KZVA 1TW3A 4PFPA 1IG7A 1E2XA 1Y0UA 1HXDA 2OJED 1MMAA 3OS2A 2KKOA 1K4SA 2GLOA 3KLOA 2E2IJ 2CMPA 4RGRA 4WXDA 2VIXA 4EJWA 5FRNA 3QPLA 3L2UA 1X2NA 3E5QA 1TWHJ 3MFKA 4DBQA 1HBXG 4HG2A 3ULQB 4H0EA 2CH0A 2ELKA 5EYRA 3AKZA 4BXUA 4F7ZA 2BW3A 2TRTA 1XN7A 2KLOA 1UAAA 4ZZLA 2P6TA 4XOTA 2DOFA 3ECOA 5K5OA 3GUDA 4OWRB 1DGRM 3RYRA 3ZMSA 5D5VB 2A05A 1D0ZA 5DTDA 3IAS2 1BBYA 3CC2I 4CCOA 3BY6A 3HDDA 1FYKA 3ESWB 3H3VK 3I56I 2XGXA 3L2WA 3K1MA 2NS8A 4UNOA 4U7DA 1X19A 3BP8A 4KT6A 1RUOA 2B7EA 3K4JA 4MEYF 1ONVA 2CJJA 2DDAA 5CVJA 4ZYAA 1UG2A 3QAHA 3LA7A 4D1QA 1V5GA 3M8FA 1HC8A 3DLAA 5HDNA 2YS9A
chains in the Genus database with same CATH topology
5A2QK 3GX4X 2EFNA 1FBQA 1JHFA 4EGZA 2GWRA 2HYGD 1KQ0A 1PUEE 1SMYF 2O0YA 1B9MA 1H9GA 1K6OA 2DAOA 3E6CC 3WTYC 5D6EA 1I6XA 4G7ZF 1UHWA 4LFUA 2ZMEB 1QQIA 2CG4A 2NYXA 1TQPA 3I64A 2XAGA 4ENJA 5FB2A 1EV7A 1LQ1A 4CO8A 5J6XA 1Z05A 2OZ6A 3NEUA 3RKWA 2EFQA 4FX0A 2IW5A 3F8MA 2HGCA 2ADUA 3I58A 3IHUA 5FO5A 2K27A 4A0ZA 3ZMUA 2XRNA 4L9VA 4B09A 1OKRA 3GLXA 2RN7A 2CFXA 1CF7A 2JTVA 4RB2C 3T8RA 4OIPF 1JGSA 1SFXA 2F5CA 1IN7A 5E18F 3F8NA 3CUQC 1KQ8A 3GZ5A 3BPVA 2BEOA 2FBHA 3SQNA 2VE9A 1W7PB 2P4WA 3SXYA 5HVQC 3CO6C 1P92A 2XKPA 1ON1A 2GQQA 3IRQA 1I1GA 5JR3A 3FF5A 2HWVA 2A68F 2VBWA 1FYMA 5DUKA 5LBQA 2CW0F 5HS8A 1LEAA 4EM0B 3GFJA 2H09A 2DQRA 2HS5A 4IF4A 2EV5A 4LLGF 1IN5A 4LLLA 1REPC 4OMYA 2XV4S 4AVPA 2M45A 1MDMA 1KU9A 4HF1A 4A5NA 1LDDA 3WTZA 2YX7A 2EJRA 4HA8A 2H6CA 1QO0D 5HLGA 1IN4A 4I0BA 2K7LA 5TJJA 4EGYA 3V8LA 1FX7A 4YFXF 1KU2A 3WU0A 3TOAA 4M6YA 1FY7A 3RDIA 5FGMA 1U3EM 1G3SA 3QP5A 3HRSA 4UVCA 1USTA 2FMYA 4O6JA 3VFZA 4LD5A 1EH6A 3RPQA 5LGNA 4OIRF 3KP4A 3H3ZA 4PZJA 3HOTA 1HSJA 3K1NA 3FZVA 4HDVA 1HQCA 3BDDA 4HQMA 2D1HA 2RQPA 4PDKA 1HKQA 3HSEA 1PP8F 2Y0MA 1BIAA 2O61A 4K2EA 4QWQA 3VODA 1HKTA 1ZLJA 3ZMDA 3J80Z 1TQIA 3T1BA 3KCCA 3M1EA 3SFZA 3WTSC 5DCFA 3RI4A 1P4WA 2XROA 4M71A 3V7SA 4Q5SF 3FMRA 4MQ9F 1ZARA 1YW8A 4ENMA 2OQGA 3NQOA 3D0SA 1OYYA 2PEXA 1U5TC 5HS9A 4Y15A 1YIOA 1YS6A 1FBUA 2K4BA 2STWA 2J5PA 2XKOA 4HX8A 2MD5A 3LA2A 2Z33A 2W57A 3IWZA 1DPUA 1YW7A 2ZMEA 2RGVA 1B59A 2L4AA 4HLYA 4UVBA 2M1BA 4M73A 3AAFA 3COAC 5D5XB 2ESNA 5AIQA 1LB2A 2KIMA 3O6BB 3MWMA 3ZPLA 1R5HA 4LB6B 1ZGAA 1J7KA 3TO6A 4A5MA 2RKHA 3U1DA 3WTTC 1B4AA 1R1VA 3FXQA 2FNPA 1O7FA 2MH2A 3R0JA 4Q48A 1FYLA 2FBIA 3Q5FA 1DPRA 2RNJA 1ZREA 4A6DA 2D45A 3HHGA 1W7PA 3CDHA 1ZG5A 1FP1D 2ISZA 1QPMA 2EA2A 1R58A 2M5WA 4G6QA 1EH7A 5BPIA 1R36A 5DCMB 1ON2A 2EWNA 2ZO4A 4WCGA 3WGIA 4YIIA 4YFKF 1P4AA 1G3WA 3REOA 4Q4ZF 2ZCWA 1PP7U 1QNTA 4M9XA 5J8CA 2F5EA 3GW2A 3FM3A 2IA2A 3RJPA 3MCZA 4Y17A 1ZG1A 1MD0A 1ZAOA 2ELHA 4ON0A 2EV0A 1IUYA 2V1UA 2AXLA 4N0BA 2NRAC 3JSPA 2OA4A 4UVAA 1BM9A 1LJ9A 3CUOA 3JAMZ 1DDNA 4IXAA 1WWXA 4RS8A 3RKYA 3FMQA 2VC0A 5HDKA 4KIGA 1IXRC 4KN4X 2E1NA 2L02A 3ZN1A 3M7GA 5FLXZ 1TW2A 1IXSB 5IT9Z 1W7PD 2W85A 1J5YA 4R1HA 3IKTA 5BPDA 2M30A 3L2CA 1B6AA 3LQQA 2FE3A 2XASA 4FHTA 1VTNC 5CLSA 2QYOA 4G6DA 3O3KA 4R8HA 4EQQA 3CLOA 2KJBA 5DEQA 2BBYA 3U2RA 3BZ6A 1IRFA 4AIJA 4LK1F 4CZZA 2GIVA 1W5TA 2HKXA 3L7WA 3HRUA 1HKSA 4ESFA 1ZHFA 3ABUA 4KDPA 4PGGA 4WK8F 1AOYA 3HIFA 3J81K 4ESBA 2PQ8A 2MLKA 4A2UA 1UFMA 4ZH4F 1JXSA 1QZYA 2QVOA 4WXHA 4P9FA 5D4RA 5BOXA 3WTUC 5DD8A 2CGPA 2V1DA 2G9WA 3KP7A 3P9IA 3K69A 2L3DA 1HW1A 2NAZA 3W6JB 3HSFA 2XIGA 1YS7A 1SD6A 1T39A 5EEHA 2VBYA 2L54A 2EA4A 3E6DA 5AONA 4ZZDA 1T0FA 3CTAA 2LKPA 1JHHA 1TQMA 1BN5A 3FMSA 5F64A 4DQ2A 4EVIA 2QWWA 2CWEA 2W24A 5E1XA 1YQAA 2YU3A 1O3SA 1Z1DA 1F9NA 2FBKA 4RB0A 3QPTA 1DP7P 2Y75A 2GXBA 1WRJA 4MHGA 4S04A 4M72A 3L9FA 3U9GA 3WTWC 2VC1A 2A69F 1U5TB 1XDSA 2HOEA 2DT5A 3I0TA 4A0XA 3TO9A 4M9SA 3M8EA 5IT3A 3C1DA 4KFCA 2OU2A 4L0YB 2JSCA 1ZG3A 5ICCA 2GZWA 1G3TA 2PFBA 5DCMA 3C3WA 4MTDA 2K02A 4EMSA 2QLZA 4ASNA 2VT2A 4P96A 5HOOA 2DPUA 2UXXA 2KJCA 2IJLA 1R7JA 4A0YA 4HX4A 2CQKA 1U8RA 2E7WA 2P5LC 2FXAA 3DPTA 3O2PE 2GA2A 4U7BA 3VOEA 2G7HA 1WI9A 3GFLA 2VT3A 3S2WA 1XGSA 1IF1A 2STTA 3BJ6A 1J0RA 1YTYA 3FWEA 3CUQA 2VONA 2MC3A 2HZTA 4EJVA 3KFWX 1IAWA 1WKMA 4U88A 2VE8A 3HSRA 5E17F 1F1ZA 2NNNA 2HR3A 2DPDA 2LDUA 4KT5C 1KU3A 4GYGA 1Z7UA 4RGXA 3B02A 1FSHA 2CSOA 1ODDA 3TQNA 4G9YA 1SFUA 4JK1X 3R61A 4QLCU 5L3BA 3BWGA 4ENNA 4UUVA 1ULYA 3HRMA 3QU3A 4L5IA 5H6QA 2LNBA 2H94A 4IHTA 5FD6A 5HDGA 2UWMA 4OIOF 1W5SA 3LSTA 1F4KA 3DKWA 4YG2F 3LFKA 1QGPA 2A07F 1LVAA 4RB3C 1ZH5A 3HTSB 3GXOA 2P6SA 5LEKA 5F6FA 2FMLA 5H20A 2A6HF 4I7HA 2HQNA 3W6KB 1TNSA 3KETA 3E3VA 5A2QZ 1STZA 2VODA 3IRRA 1GXPA 3RIRA 4E70A 4L9NA 3ELKA 1FWZA 2WTEA 2YX4A 4L18B 3LAPA 2PBIA 4ETSA 2K4JA 4XSZF 4U0WA 4EJUA 3I59B 1NHAA 4OOIA 3DQVC 2FA5A 2BGCA 3FXRA 3KEQA 3P7NA 2QBYB 1V3FA 4G94A 4N9IA 2ZJ2A 4TV7A 2Q0OA 4KN7X 2MBFA 5E1WA 1OYWA 1D8KA 1UB9A 4LJZF 3TDZC 1D3YA 3T5XA 5DYMA 3R4KA 1U5TA 3RPUA 5LLQA 3QRFF 2XAFA 1R1TA 4XRFA 2LF7A 2QQAA 3V8KA 2ZKZA 3ROUA 1EH8A 3BJAA 3Q9SA 1TNTA 1KYWA 3HHHA 3KP6A 1T98A 1MJ9A 1UHMA 1PDNC 1IXCA 1SD4A 1DUXC 3F8BA 1XSDA 1XCVA 3R60A 4RAZA 1Z6TA 1FZPB 1GVJA 2UXNA 5FFZA 4XLPF 3JW4A 4Q47A 4A12A 3E5UA 2NS0A 3F21A 2CO5A 4BYYA 4KMUX 3CJNA 3ABTA 5BMZA 4UHTA 4HOBA 1YYVA 1FT9A 2DK5A 4CICA 2A6EF 1YW9A 3KZZA 1ZGJA 1G6NA 1CGPA 1WQ2A 1P4XA 4RAYA 3FXUA 4OU0A 4IRHA 5CVUA 4BHBA 1T6SA 2JPCA 4IRIA 2R7FA 2Z5UA 4XLNF 1S29A 2EB7A 5D5WB 3TO7A 1T38A 2YPRA 1RIOH 2DTRA 3MAJA 4HF2A 4I02A 3K9TA 1G3YA 5LHGA 2BV6A 2FF4A 2HTSA 3ZN0A 2KRFA 3JSOA 2XHKA 5AIPA 1B1BA 4WX9A 5ERIA 3L09A 1V4RA 2IP2A 2GXGA 4P5OA 2FQ3A 5ICFA 3ISPA 3RKXA 1F5TA 4D0PA 5HLHA 1L3LA 1H9TA 3C18A 4P55A 5F1RA 5H6RA 3GYHX 3E6BA 3G73A 1FPQA 1KGSA 1RUNA 1IW7F 3R6SA 5L3CA 3K2ZA 5LHIA 4HX7A 2BE5F 4WF2A 5L3EA 1I1SA 2WWYA 1OYIA 2R7DA 5ICGA 2QM3A 1IRGA 1D5VA 5CYVA 4CDGA 3KZYA 2LSOA 3K1PA 4UXNA 3L00A 1Z91A 1SMTA 2H6BA 4L9TA 2PMUA 5ED4A 1XD7A 3CUQB 5FD5A 2GAUA 2Z9OA 3ML6A 5K1YA 3PQKA 3TDUC 1YFHA 1SD7A 5CVIA 1S7OA 3P9KA 1G4DA 4LG0B 3F23A 2OAZA 3I59A 2JPBA 2VOOA 1Z9CA 4KA4A 2AS5F 2EFOA 4XSXF 2QBYA 3KEOA 4AIHA 3QU6A 4LMYA 1E17A 3GVAA 1XDUA 2Q2EA 3MQ0A 1RZ4A 5JHUA 2V79A 4B8XA 1XMKA 3CO7C 4KIFA 1BI1A 5LHHA 1KA8A 3ZMZA 1TTYA 1XGOA 3WGGA 4MNUA 3ZMTA 3I54A 2ZXJA 4JBAA 5CJ9A 1YG2A 4U0YA 3WTXC 4NHJA 1I27A 3DF8A 4ENKA 4U0VA 4KICA 2XAQA 3F8CA 1BOAA 1J9IA 3EETA 3V7RA 4A6EA 3T0YA 1RNLA 2OQRA 2JRTA 2WV0A 4CXFA 3I71A 5HLIA 4S05A 2DK8A 3ZQ7A 4ZYEA 2E7XA 4GCVA 4M9ZA 3E5XA 5ILUA 1BJAA 3OOPA 5D8KB 1YLFA 2FNAA 4HDUA 1IZ1A 1S8NA 4P9UA 2QZ8A 3F72A 4AIKA 1USSA 2WC2A 5D8LB 1XB4A 3JTHA 2F5DA 1TLHB 3DP7A 5E8IA 2K86A 5JFRA 3D5LA 3RYPA 2DU9A 4RGUA 4EM1A 3LQRA 2W84A 2V6CA 4BAYA 3F3XA 2C6YA 2JT1A 1K7AA 2RC4A 4CGZA 1KQ9A 1R1UA 1AWCA 5J8FA 2Y48A 3T8TA 2HEOA 4OMZA 1OMIA 1BI3A 1K78B 5ICEA 2FEZA 1UCRA 3H92A 3WE2A 2KIUA 5FFXA 3V7CA 3DV8A 1IN8A 4GGGA 1O57A 2D1VA 3ZP5A 3VB2A 1GHCA 2RDPA 1FP2A 3R0AA 3V4GA 2E1CA 4WXCA 4XBFA 3GF2A 4AWXB 3N4MA 5E1ZB 1TBXA 2UZKA 2DBBA 2EK5A 1GXQA 4EV0A 4HF0A 4I0AA 3J7AO 1ZYRF 2J5OA 2BYVE 1U78A 4LB5A 3J81Z 2F5FA 4FX4A 4MGRA 1K79A 1LDKB 4LK0F 2IT0A 4IHSA 4ZYHA 3J80K 4O3MA 3ZMVA 3EYYA 4LG0A 1U6GA 2B0LA 3E6MA 5LGTA 3I5UA 3PFIA 2YSRA 2M8EA 3G3ZA 5HS7A 1O3QA 2PN6A 1ZRDA 3FX3A 2TDXA 3K0LA 2PLYA 3DXJF 1O7LA 1S3JA 2DW4A 2VBZA 3EQLF 4L0ZB 2LF8A 4RB1A 5LRSA 3EDPA 3QPHA 5LRRA 1LNWA 4OINF 1XSXA 4R79A 3HRTA 2O6GE 3KP2A 5JI6A 2P5KA 3P9CA 3QOPA 5ILVA 1SFEA 1T2KA 4I98B 4MTEA 2XUBA 1XGNA 4ESJA 4KUMA 1XSVA 4L9JA 1R00A 2ISYA 2DLLA 2OZUA 2Q8KA 3MZHA 3DFGA 5DDGA 2CYYA 2MLGA 3WTVC 2IVMA 3WODF 4BNCA 3I4PA 2HKOA 4OIQF 2OBPA 2X4HA 3I53A 4HAMA 1X3UA 3WGHA 3EYIA 1S6LA 2HTJA 2IPQX 4KNYA 2O8XA 3KP3A 2VOPA 2R3SA 3ECHA 1B9NA 4N9HA 2IRFG 1C0WA 2QQBA 3SHFA 4I09A 4KIBA 3HOSA 5DV5A 5L3FA 2QQ9A 2ACJA 5D5UB 2P7CB 4UV9A 3N97A 4DNCA 3KLNA 2X0LA 4GYIA 1LEBA 2L4MA 2G7UA 4BH9A 1KYZA 4CHUA 4GXOA 1BI2A 2DQLA 3TGNA 4M6XA 3F22A 5E20A 4M74A 5LEJA 1P6RA 1ZRCA 1OR7A 3WG9A 1QBJA 3B73A 4LLNA 3IKVA 1A04A 4HW0A 1K78A 2VXZA 4HBLA 3JAMK 1WSUA 5D6FA 1FNNA 2XAJA 3Q9VA 4AD9A 1KU7A 1MJAA 2VN2A 5FLXK 4FT8A 3IC7A 3GFIA 4L5JA 5IT9K 3H3UA 4I01A 4NB5A 1R5GA 1ZN2A 3FHZA 2MA3A 1XCBA 1HSTA 4BQAA 4HQEA 4I2OA 2ZNYA 2P7VB 3IL2A 4KMFA 1OPCA 3DPLC 1U2WA 3F6VA 4RGSA 2DI3A 1W4MA 3QP6A 3WU1B 2O03A 1I5ZA 2RV8A 1H0MA 5ILSA 2FU4A 2VBXA 3WE3A 2EFPA 2GA1A 5KVRA 3DEUA 5K5RA 3OV8A 2L01A 3LAJA 3V8JA 5D4SA 2EFWA 3HUGA 1ZRFA 3GEZA 2P5VA 1R22A 2FRHA 1JE8A 2F2EA 1RI7A 4ZYGA 4Z2YA 1L0OC 3IWFA 1FLIA 3F6OA 1J2XA 1LDJA 4NQWA 1FSEA 3E97A 2D2WA 1SAXA 1HW2A 5BS6A 3LWFA 4IVNA 4G7OF 2A5YB 2KIFA 1FOKA 1YO5C 1MGTA 2ETHA 2Z3YA 5JVTA 5BQTA 1XMAA 1ZLKA 2H27A 2NNYA 2DO7A 2DFIA 1BC8C 3TKYA 2XAHA 2XVCA 3BOQA 2COMA 3HTUA 3GWZA 3ERED 2W25A 3BROA 1P2FA 2MH9A 5E8GA 3FM5A 1MZBA 4HZFA 3GO5A 4HLXA 3JTGA 3MZYA 5DUIA 3MEXA 3VEPA 5LGUA 3KP5A 1MKMA 1MJBA 3EUHA 3NRVA 3SZTA 3GZ6A 5TRDA 2OD5A 4BHCA 6PAXA 2V1XA 4MEXF 2EV6A 1BIBA 1QZZA 3RTRA 2QUFA 4HV5A 2O3FA 2ZFWA 2HYFA 4EJTA 1J75A 4ZYDA 2FSWA 2A61A 5K5QA 2P8TA 1XGMA 2HFHA 1R23A 2RVCA 4IJAA 5EEGA 1O3TA 1CF7B 3SZPA 2IA0A 1FC3A 2PJPA 2ZBKA 4PGHA 4YFNF 4PCQA 2JZYA 1Z6RA 4EJOA 1BC7C 2V9VA 2QENA 2ESHA 4IRGA 4EM2A 2FOKA 3GFMA 4WWCA 4GO1A 3C7JA 5DD4A 1SD5A 2PG4A 4KYWA 4MQVA 4IPAA 1HW5A 4JQFA 4CYDA 4YIFA 2PI0A 3BPXA 3KE2A 3TOBA 3LA3A 3M9AA 2Z99A 4O5VA 4BHPA 1D8JA 4UV8A 2PMHA 4HV6A 1Q1HA 3PQJA 1MDMB 1J59A 2M87A 5KK1A 3F8FA 1S7AA 2HQRA 2HDCA 1FBSA 2ZNZA 3HYIA 4HYEA 5L3GA 4Y13A 5CVVA 4G7HF 4G8XA 5CVRA 1O3RA 5L3DA 1IN6A 2IA1A 3BJOA 4LGWA 2YR2A 1BI0A 2A3SA 1TW3A 1E2XA 1Y0UA 1HXDA 2KKOA 3KLOA 4RGRA 4WXDA 4EJWA 3E5QA 3MFKA 1HBXG 3ULQB 4H0EA 4BXUA 4F7ZA 1XN7A 4ZZLA 2P6TA 3ECOA 5K5OA 3GUDA 3RYRA 3ZMSA 5D5VB 1BBYA 3BY6A 1FYKA 2XGXA 3K1MA 4UNOA 4U7DA 3BP8A 1RUOA 4MEYF 1ONVA 5CVJA 3QAHA 3LA7A 3M8FA 5HDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q K;  3GX4 X;  2EFN A;  1FBQ A;  1JHF A;  4EGZ A;  2GWR A;  2HYG D;  1KQ0 A;  1PUE E;  1SMY F;  2O0Y A;  1B9M A;  1H9G A;  1K6O A;  2DAO A;  3E6C C;  3WTY C;  5D6E A;  1I6X A;  4G7Z F;  1UHW A;  4LFU A;  2ZME B;  1QQI A;  2CG4 A;  2NYX A;  1TQP A;  3I64 A;  2XAG A;  4ENJ A;  5FB2 A;  1EV7 A;  1LQ1 A;  4CO8 A;  5J6X A;  1Z05 A;  2OZ6 A;  3NEU A;  3RKW A;  2EFQ A;  4FX0 A;  2IW5 A;  3F8M A;  2HGC A;  2ADU A;  3I58 A;  3IHU A;  5FO5 A;  2K27 A;  4A0Z A;  3ZMU A;  2XRN A;  4L9V A;  4B09 A;  1OKR A;  3GLX A;  2RN7 A;  2CFX A;  1CF7 A;  2JTV A;  4RB2 C;  3T8R A;  4OIP F;  1JGS A;  1SFX A;  2F5C A;  1IN7 A;  5E18 F;  3F8N A;  3CUQ C;  1KQ8 A;  3GZ5 A;  3BPV A;  2BEO A;  2FBH A;  3SQN A;  2VE9 A;  1W7P B;  2P4W A;  3SXY A;  5HVQ C;  3CO6 C;  1P92 A;  2XKP A;  1ON1 A;  2GQQ A;  3IRQ A;  1I1G A;  5JR3 A;  3FF5 A;  2HWV A;  2A68 F;  2VBW A;  1FYM A;  5DUK A;  5LBQ A;  2CW0 F;  5HS8 A;  1LEA A;  4EM0 B;  3GFJ A;  2H09 A;  2DQR A;  2HS5 A;  4IF4 A;  2EV5 A;  4LLG F;  1IN5 A;  4LLL A;  1REP C;  4OMY A;  2XV4 S;  4AVP A;  2M45 A;  1MDM A;  1KU9 A;  4HF1 A;  4A5N A;  1LDD A;  3WTZ A;  2YX7 A;  2EJR A;  4HA8 A;  2H6C A;  1QO0 D;  5HLG A;  1IN4 A;  4I0B A;  2K7L A;  5TJJ A;  4EGY A;  3V8L A;  1FX7 A;  4YFX F;  1KU2 A;  3WU0 A;  3TOA A;  4M6Y A;  1FY7 A;  3RDI A;  5FGM A;  1U3E M;  1G3S A;  3QP5 A;  3HRS A;  4UVC A;  1UST A;  2FMY A;  4O6J A;  3VFZ A;  4LD5 A;  1EH6 A;  3RPQ A;  5LGN A;  4OIR F;  3KP4 A;  3H3Z A;  4PZJ A;  3HOT A;  1HSJ A;  3K1N A;  3FZV A;  4HDV A;  1HQC A;  3BDD A;  4HQM A;  2D1H A;  2RQP A;  4PDK A;  1HKQ A;  3HSE A;  1PP8 F;  2Y0M A;  1BIA A;  2O61 A;  4K2E A;  4QWQ A;  3VOD A;  1HKT A;  1ZLJ A;  3ZMD A;  3J80 Z;  1TQI A;  3T1B A;  3KCC A;  3M1E A;  3SFZ A;  3WTS C;  5DCF A;  3RI4 A;  1P4W A;  2XRO A;  4M71 A;  3V7S A;  4Q5S F;  3FMR A;  4MQ9 F;  1ZAR A;  1YW8 A;  4ENM A;  2OQG A;  3NQO A;  3D0S A;  1OYY A;  2PEX A;  1U5T C;  5HS9 A;  4Y15 A;  1YIO A;  1YS6 A;  1FBU A;  2K4B A;  2STW A;  2J5P A;  2XKO A;  4HX8 A;  2MD5 A;  3LA2 A;  2Z33 A;  2W57 A;  3IWZ A;  1DPU A;  1YW7 A;  2ZME A;  2RGV A;  1B59 A;  2L4A A;  4HLY A;  4UVB A;  2M1B A;  4M73 A;  3AAF A;  3COA C;  5D5X B;  2ESN A;  5AIQ A;  1LB2 A;  2KIM A;  3O6B B;  3MWM A;  3ZPL A;  1R5H A;  4LB6 B;  1ZGA A;  1J7K A;  3TO6 A;  4A5M A;  2RKH A;  3U1D A;  3WTT C;  1B4A A;  1R1V A;  3FXQ A;  2FNP A;  1O7F A;  2MH2 A;  3R0J A;  4Q48 A;  1FYL A;  2FBI A;  3Q5F A;  1DPR A;  2RNJ A;  1ZRE A;  4A6D A;  2D45 A;  3HHG A;  1W7P A;  3CDH A;  1ZG5 A;  1FP1 D;  2ISZ A;  1QPM A;  2EA2 A;  1R58 A;  2M5W A;  4G6Q A;  1EH7 A;  5BPI A;  1R36 A;  5DCM B;  1ON2 A;  2EWN A;  2ZO4 A;  4WCG A;  3WGI A;  4YII A;  4YFK F;  1P4A A;  1G3W A;  3REO A;  4Q4Z F;  2ZCW A;  1PP7 U;  1QNT A;  4M9X A;  5J8C A;  2F5E A;  3GW2 A;  3FM3 A;  2IA2 A;  3RJP A;  3MCZ A;  4Y17 A;  1ZG1 A;  1MD0 A;  1ZAO A;  2ELH A;  4ON0 A;  2EV0 A;  1IUY A;  2V1U A;  2AXL A;  4N0B A;  2NRA C;  3JSP A;  2OA4 A;  4UVA A;  1BM9 A;  1LJ9 A;  3CUO A;  3JAM Z;  1DDN A;  4IXA A;  1WWX A;  4RS8 A;  3RKY A;  3FMQ A;  2VC0 A;  5HDK A;  4KIG A;  1IXR C;  4KN4 X;  2E1N A;  2L02 A;  3ZN1 A;  3M7G A;  5FLX Z;  1TW2 A;  1IXS B;  5IT9 Z;  1W7P D;  2W85 A;  1J5Y A;  4R1H A;  3IKT A;  5BPD A;  2M30 A;  3L2C A;  1B6A A;  3LQQ A;  2FE3 A;  2XAS A;  4FHT A;  1VTN C;  5CLS A;  2QYO A;  4G6D A;  3O3K A;  4R8H A;  4EQQ A;  3CLO A;  2KJB A;  5DEQ A;  2BBY A;  3U2R A;  3BZ6 A;  1IRF A;  4AIJ A;  4LK1 F;  4CZZ A;  2GIV A;  1W5T A;  2HKX A;  3L7W A;  3HRU A;  1HKS A;  4ESF A;  1ZHF A;  3ABU A;  4KDP A;  4PGG A;  4WK8 F;  1AOY A;  3HIF A;  3J81 K;  4ESB A;  2PQ8 A;  2MLK A;  4A2U A;  1UFM A;  4ZH4 F;  1JXS A;  1QZY A;  2QVO A;  4WXH A;  4P9F A;  5D4R A;  5BOX A;  3WTU C;  5DD8 A;  2CGP A;  2V1D A;  2G9W A;  3KP7 A;  3P9I A;  3K69 A;  2L3D A;  1HW1 A;  2NAZ A;  3W6J B;  3HSF A;  2XIG A;  1YS7 A;  1SD6 A;  1T39 A;  5EEH A;  2VBY A;  2L54 A;  2EA4 A;  3E6D A;  5AON A;  4ZZD A;  1T0F A;  3CTA A;  2LKP A;  1JHH A;  1TQM A;  1BN5 A;  3FMS A;  5F64 A;  4DQ2 A;  4EVI A;  2QWW A;  2CWE A;  2W24 A;  5E1X A;  1YQA A;  2YU3 A;  1O3S A;  1Z1D A;  1F9N A;  2FBK A;  4RB0 A;  3QPT A;  1DP7 P;  2Y75 A;  2GXB A;  1WRJ A;  4MHG A;  4S04 A;  4M72 A;  3L9F A;  3U9G A;  3WTW C;  2VC1 A;  2A69 F;  1U5T B;  1XDS A;  2HOE A;  2DT5 A;  3I0T A;  4A0X A;  3TO9 A;  4M9S A;  3M8E A;  5IT3 A;  3C1D A;  4KFC A;  2OU2 A;  4L0Y B;  2JSC A;  1ZG3 A;  5ICC A;  2GZW A;  1G3T A;  2PFB A;  5DCM A;  3C3W A;  4MTD A;  2K02 A;  4EMS A;  2QLZ A;  4ASN A;  2VT2 A;  4P96 A;  5HOO A;  2DPU A;  2UXX A;  2KJC A;  2IJL A;  1R7J A;  4A0Y A;  4HX4 A;  2CQK A;  1U8R A;  2E7W A;  2P5L C;  2FXA A;  3DPT A;  3O2P E;  2GA2 A;  4U7B A;  3VOE A;  2G7H A;  1WI9 A;  3GFL A;  2VT3 A;  3S2W A;  1XGS A;  1IF1 A;  2STT A;  3BJ6 A;  1J0R A;  1YTY A;  3FWE A;  3CUQ A;  2VON A;  2MC3 A;  2HZT A;  4EJV A;  3KFW X;  1IAW A;  1WKM A;  4U88 A;  2VE8 A;  3HSR A;  5E17 F;  1F1Z A;  2NNN A;  2HR3 A;  2DPD A;  2LDU A;  4KT5 C;  1KU3 A;  4GYG A;  1Z7U A;  4RGX A;  3B02 A;  1FSH A;  2CSO A;  1ODD A;  3TQN A;  4G9Y A;  1SFU A;  4JK1 X;  3R61 A;  4QLC U;  5L3B A;  3BWG A;  4ENN A;  4UUV A;  1ULY A;  3HRM A;  3QU3 A;  4L5I A;  5H6Q A;  2LNB A;  2H94 A;  4IHT A;  5FD6 A;  5HDG A;  2UWM A;  4OIO F;  1W5S A;  3LST A;  1F4K A;  3DKW A;  4YG2 F;  3LFK A;  1QGP A;  2A07 F;  1LVA A;  4RB3 C;  1ZH5 A;  3HTS B;  3GXO A;  2P6S A;  5LEK A;  5F6F A;  2FML A;  5H20 A;  2A6H F;  4I7H A;  2HQN A;  3W6K B;  1TNS A;  3KET A;  3E3V A;  5A2Q Z;  1STZ A;  2VOD A;  3IRR A;  1GXP A;  3RIR A;  4E70 A;  4L9N A;  3ELK A;  1FWZ A;  2WTE A;  2YX4 A;  4L18 B;  3LAP A;  2PBI A;  4ETS A;  2K4J A;  4XSZ F;  4U0W A;  4EJU A;  3I59 B;  1NHA A;  4OOI A;  3DQV C;  2FA5 A;  2BGC A;  3FXR A;  3KEQ A;  3P7N A;  2QBY B;  1V3F A;  4G94 A;  4N9I A;  2ZJ2 A;  4TV7 A;  2Q0O A;  4KN7 X;  2MBF A;  5E1W A;  1OYW A;  1D8K A;  1UB9 A;  4LJZ F;  3TDZ C;  1D3Y A;  3T5X A;  5DYM A;  3R4K A;  1U5T A;  3RPU A;  5LLQ A;  3QRF F;  2XAF A;  1R1T A;  4XRF A;  2LF7 A;  2QQA A;  3V8K A;  2ZKZ A;  3ROU A;  1EH8 A;  3BJA A;  3Q9S A;  1TNT A;  1KYW A;  3HHH A;  3KP6 A;  1T98 A;  1MJ9 A;  1UHM A;  1PDN C;  1IXC A;  1SD4 A;  1DUX C;  3F8B A;  1XSD A;  1XCV A;  3R60 A;  4RAZ A;  1Z6T A;  1FZP B;  1GVJ A;  2UXN A;  5FFZ A;  4XLP F;  3JW4 A;  4Q47 A;  4A12 A;  3E5U A;  2NS0 A;  3F21 A;  2CO5 A;  4BYY A;  4KMU X;  3CJN A;  3ABT A;  5BMZ A;  4UHT A;  4HOB A;  1YYV A;  1FT9 A;  2DK5 A;  4CIC A;  2A6E F;  1YW9 A;  3KZZ A;  1ZGJ A;  1G6N A;  1CGP A;  1WQ2 A;  1P4X A;  4RAY A;  3FXU A;  4OU0 A;  4IRH A;  5CVU A;  4BHB A;  1T6S A;  2JPC A;  4IRI A;  2R7F A;  2Z5U A;  4XLN F;  1S29 A;  2EB7 A;  5D5W B;  3TO7 A;  1T38 A;  2YPR A;  1RIO H;  2DTR A;  3MAJ A;  4HF2 A;  4I02 A;  3K9T A;  1G3Y A;  5LHG A;  2BV6 A;  2FF4 A;  2HTS A;  3ZN0 A;  2KRF A;  3JSO A;  2XHK A;  5AIP A;  1B1B A;  4WX9 A;  5ERI A;  3L09 A;  1V4R A;  2IP2 A;  2GXG A;  4P5O A;  2FQ3 A;  5ICF A;  3ISP A;  3RKX A;  1F5T A;  4D0P A;  5HLH A;  1L3L A;  1H9T A;  3C18 A;  4P55 A;  5F1R A;  5H6R A;  3GYH X;  3E6B A;  3G73 A;  1FPQ A;  1KGS A;  1RUN A;  1IW7 F;  3R6S A;  5L3C A;  3K2Z A;  5LHI A;  4HX7 A;  2BE5 F;  4WF2 A;  5L3E A;  1I1S A;  2WWY A;  1OYI A;  2R7D A;  5ICG A;  2QM3 A;  1IRG A;  1D5V A;  5CYV A;  4CDG A;  3KZY A;  2LSO A;  3K1P A;  4UXN A;  3L00 A;  1Z91 A;  1SMT A;  2H6B A;  4L9T A;  2PMU A;  5ED4 A;  1XD7 A;  3CUQ B;  5FD5 A;  2GAU A;  2Z9O A;  3ML6 A;  5K1Y A;  3PQK A;  3TDU C;  1YFH A;  1SD7 A;  5CVI A;  1S7O A;  3P9K A;  1G4D A;  4LG0 B;  3F23 A;  2OAZ A;  3I59 A;  2JPB A;  2VOO A;  1Z9C A;  4KA4 A;  2AS5 F;  2EFO A;  4XSX F;  2QBY A;  3KEO A;  4AIH A;  3QU6 A;  4LMY A;  1E17 A;  3GVA A;  1XDU A;  2Q2E A;  3MQ0 A;  1RZ4 A;  5JHU A;  2V79 A;  4B8X A;  1XMK A;  3CO7 C;  4KIF A;  1BI1 A;  5LHH A;  1KA8 A;  3ZMZ A;  1TTY A;  1XGO A;  3WGG A;  4MNU A;  3ZMT A;  3I54 A;  2ZXJ A;  4JBA A;  5CJ9 A;  1YG2 A;  4U0Y A;  3WTX C;  4NHJ A;  1I27 A;  3DF8 A;  4ENK A;  4U0V A;  4KIC A;  2XAQ A;  3F8C A;  1BOA A;  1J9I A;  3EET A;  3V7R A;  4A6E A;  3T0Y A;  1RNL A;  2OQR A;  2JRT A;  2WV0 A;  4CXF A;  3I71 A;  5HLI A;  4S05 A;  2DK8 A;  3ZQ7 A;  4ZYE A;  2E7X A;  4GCV A;  4M9Z A;  3E5X A;  5ILU A;  1BJA A;  3OOP A;  5D8K B;  1YLF A;  2FNA A;  4HDU A;  1IZ1 A;  1S8N A;  4P9U A;  2QZ8 A;  3F72 A;  4AIK A;  1USS A;  2WC2 A;  5D8L B;  1XB4 A;  3JTH A;  2F5D A;  1TLH B;  3DP7 A;  5E8I A;  2K86 A;  5JFR A;  3D5L A;  3RYP A;  2DU9 A;  4RGU A;  4EM1 A;  3LQR A;  2W84 A;  2V6C A;  4BAY A;  3F3X A;  2C6Y A;  2JT1 A;  1K7A A;  2RC4 A;  4CGZ A;  1KQ9 A;  1R1U A;  1AWC A;  5J8F A;  2Y48 A;  3T8T A;  2HEO A;  4OMZ A;  1OMI A;  1BI3 A;  1K78 B;  5ICE A;  2FEZ A;  1UCR A;  3H92 A;  3WE2 A;  2KIU A;  5FFX A;  3V7C A;  3DV8 A;  1IN8 A;  4GGG A;  1O57 A;  2D1V A;  3ZP5 A;  3VB2 A;  1GHC A;  2RDP A;  1FP2 A;  3R0A A;  3V4G A;  2E1C A;  4WXC A;  4XBF A;  3GF2 A;  4AWX B;  3N4M A;  5E1Z B;  1TBX A;  2UZK A;  2DBB A;  2EK5 A;  1GXQ A;  4EV0 A;  4HF0 A;  4I0A A;  3J7A O;  1ZYR F;  2J5O A;  2BYV E;  1U78 A;  4LB5 A;  3J81 Z;  2F5F A;  4FX4 A;  4MGR A;  1K79 A;  1LDK B;  4LK0 F;  2IT0 A;  4IHS A;  4ZYH A;  3J80 K;  4O3M A;  3ZMV A;  3EYY A;  4LG0 A;  1U6G A;  2B0L A;  3E6M A;  5LGT A;  3I5U A;  3PFI A;  2YSR A;  2M8E A;  3G3Z A;  5HS7 A;  1O3Q A;  2PN6 A;  1ZRD A;  3FX3 A;  2TDX A;  3K0L A;  2PLY A;  3DXJ F;  1O7L A;  1S3J A;  2DW4 A;  2VBZ A;  3EQL F;  4L0Z B;  2LF8 A;  4RB1 A;  5LRS A;  3EDP A;  3QPH A;  5LRR A;  1LNW A;  4OIN F;  1XSX A;  4R79 A;  3HRT A;  2O6G E;  3KP2 A;  5JI6 A;  2P5K A;  3P9C A;  3QOP A;  5ILV A;  1SFE A;  1T2K A;  4I98 B;  4MTE A;  2XUB A;  1XGN A;  4ESJ A;  4KUM A;  1XSV A;  4L9J A;  1R00 A;  2ISY A;  2DLL A;  2OZU A;  2Q8K A;  3MZH A;  3DFG A;  5DDG A;  2CYY A;  2MLG A;  3WTV C;  2IVM A;  3WOD F;  4BNC A;  3I4P A;  2HKO A;  4OIQ F;  2OBP A;  2X4H A;  3I53 A;  4HAM A;  1X3U A;  3WGH A;  3EYI A;  1S6L A;  2HTJ A;  2IPQ X;  4KNY A;  2O8X A;  3KP3 A;  2VOP A;  2R3S A;  3ECH A;  1B9N A;  4N9H A;  2IRF G;  1C0W A;  2QQB A;  3SHF A;  4I09 A;  4KIB A;  3HOS A;  5DV5 A;  5L3F A;  2QQ9 A;  2ACJ A;  5D5U B;  2P7C B;  4UV9 A;  3N97 A;  4DNC A;  3KLN A;  2X0L A;  4GYI A;  1LEB A;  2L4M A;  2G7U A;  4BH9 A;  1KYZ A;  4CHU A;  4GXO A;  1BI2 A;  2DQL A;  3TGN A;  4M6X A;  3F22 A;  5E20 A;  4M74 A;  5LEJ A;  1P6R A;  1ZRC A;  1OR7 A;  3WG9 A;  1QBJ A;  3B73 A;  4LLN A;  3IKV A;  1A04 A;  4HW0 A;  1K78 A;  2VXZ A;  4HBL A;  3JAM K;  1WSU A;  5D6F A;  1FNN A;  2XAJ A;  3Q9V A;  4AD9 A;  1KU7 A;  1MJA A;  2VN2 A;  5FLX K;  4FT8 A;  3IC7 A;  3GFI A;  4L5J A;  5IT9 K;  3H3U A;  4I01 A;  4NB5 A;  1R5G A;  1ZN2 A;  3FHZ A;  2MA3 A;  1XCB A;  1HST A;  4BQA A;  4HQE A;  4I2O A;  2ZNY A;  2P7V B;  3IL2 A;  4KMF A;  1OPC A;  3DPL C;  1U2W A;  3F6V A;  4RGS A;  2DI3 A;  1W4M A;  3QP6 A;  3WU1 B;  2O03 A;  1I5Z A;  2RV8 A;  1H0M A;  5ILS A;  2FU4 A;  2VBX A;  3WE3 A;  2EFP A;  2GA1 A;  5KVR A;  3DEU A;  5K5R A;  3OV8 A;  2L01 A;  3LAJ A;  3V8J A;  5D4S A;  2EFW A;  3HUG A;  1ZRF A;  3GEZ A;  2P5V A;  1R22 A;  2FRH A;  1JE8 A;  2F2E A;  1RI7 A;  4ZYG A;  4Z2Y A;  1L0O C;  3IWF A;  1FLI A;  3F6O A;  1J2X A;  1LDJ A;  4NQW A;  1FSE A;  3E97 A;  2D2W A;  1SAX A;  1HW2 A;  5BS6 A;  3LWF A;  4IVN A;  4G7O F;  2A5Y B;  2KIF A;  1FOK A;  1YO5 C;  1MGT A;  2ETH A;  2Z3Y A;  5JVT A;  5BQT A;  1XMA A;  1ZLK A;  2H27 A;  2NNY A;  2DO7 A;  2DFI A;  1BC8 C;  3TKY A;  2XAH A;  2XVC A;  3BOQ A;  2COM A;  3HTU A;  3GWZ A;  3ERE D;  2W25 A;  3BRO A;  1P2F A;  2MH9 A;  5E8G A;  3FM5 A;  1MZB A;  4HZF A;  3GO5 A;  4HLX A;  3JTG A;  3MZY A;  5DUI A;  3MEX A;  3VEP A;  5LGU A;  3KP5 A;  1MKM A;  1MJB A;  3EUH A;  3NRV A;  3SZT A;  3GZ6 A;  5TRD A;  2OD5 A;  4BHC A;  6PAX A;  2V1X A;  4MEX F;  2EV6 A;  1BIB A;  1QZZ A;  3RTR A;  2QUF A;  4HV5 A;  2O3F A;  2ZFW A;  2HYF A;  4EJT A;  1J75 A;  4ZYD A;  2FSW A;  2A61 A;  5K5Q A;  2P8T A;  1XGM A;  2HFH A;  1R23 A;  2RVC A;  4IJA A;  5EEG A;  1O3T A;  1CF7 B;  3SZP A;  2IA0 A;  1FC3 A;  2PJP A;  2ZBK A;  4PGH A;  4YFN F;  4PCQ A;  2JZY A;  1Z6R A;  4EJO A;  1BC7 C;  2V9V A;  2QEN A;  2ESH A;  4IRG A;  4EM2 A;  2FOK A;  3GFM A;  4WWC A;  4GO1 A;  3C7J A;  5DD4 A;  1SD5 A;  2PG4 A;  4KYW A;  4MQV A;  4IPA A;  1HW5 A;  4JQF A;  4CYD A;  4YIF A;  2PI0 A;  3BPX A;  3KE2 A;  3TOB A;  3LA3 A;  3M9A A;  2Z99 A;  4O5V A;  4BHP A;  1D8J A;  4UV8 A;  2PMH A;  4HV6 A;  1Q1H A;  3PQJ A;  1MDM B;  1J59 A;  2M87 A;  5KK1 A;  3F8F A;  1S7A A;  2HQR A;  2HDC A;  1FBS A;  2ZNZ A;  3HYI A;  4HYE A;  5L3G A;  4Y13 A;  5CVV A;  4G7H F;  4G8X A;  5CVR A;  1O3R A;  5L3D A;  1IN6 A;  2IA1 A;  3BJO A;  4LGW A;  2YR2 A;  1BI0 A;  2A3S A;  1TW3 A;  1E2X A;  1Y0U A;  1HXD A;  2KKO A;  3KLO A;  4RGR A;  4WXD A;  4EJW A;  3E5Q A;  3MFK A;  1HBX G;  3ULQ B;  4H0E A;  4BXU A;  4F7Z A;  1XN7 A;  4ZZL A;  2P6T A;  3ECO A;  5K5O A;  3GUD A;  3RYR A;  3ZMS A;  5D5V B;  1BBY A;  3BY6 A;  1FYK A;  2XGX A;  3K1M A;  4UNO A;  4U7D A;  3BP8 A;  1RUO A;  4MEY F;  1ONV A;  5CVJ A;  3QAH A;  3LA7 A;  3M8F A;  5HDN A; 
#chains in the Genus database with same CATH topology
 5A2Q K;  4XID A;  3MVP A;  3GX4 X;  2EFN A;  3PUB A;  1B72 B;  4LIT A;  1FBQ A;  1GV5 A;  1JHF A;  2MSY A;  2QKM B;  2CUF A;  4EGZ A;  2GWR A;  2HYG D;  1KQ0 A;  2KIS A;  3FXO A;  3QWL A;  4OAY A;  1PUE E;  2NVU B;  1SMY F;  4W1U A;  4A3K J;  3VYR B;  2O0Y A;  4II2 A;  1B9M A;  2XRL A;  2HXI A;  2X9D A;  1H9G A;  1IRX A;  5B66 C;  4HNT A;  1K6O A;  2DAO A;  1OLT A;  2K3P A;  2N8G A;  3E6C C;  1HCR A;  3WTY C;  5D6E A;  5J4Y A;  1I6X A;  1K83 J;  1YI2 I;  3UKG A;  1T08 B;  4HSR A;  2R5Y A;  2G0E A;  4BU2 A;  4G7Z F;  1UHW A;  4LFU A;  2ZME B;  1QQI A;  2BY2 A;  3BG5 A;  2CG4 A;  4D7N A;  2XDV A;  2NYX A;  5EG0 B;  1TQP A;  3I64 A;  2XAG A;  3DCF A;  2MG4 A;  4ENJ A;  5FB2 A;  1EV7 A;  1LQ1 A;  3OYE A;  4CO8 A;  4LIV A;  5J6X A;  1Z05 A;  4BE2 A;  2FD5 A;  2M3A A;  2OZ6 A;  3NEU A;  4AM3 A;  4I99 C;  1WCM J;  3H0G J;  1N25 A;  1V5F A;  3RKW A;  2EFQ A;  4A3L J;  3J7Z I;  1ORK A;  3A4C A;  3FK6 A;  4BBS J;  3IV5 A;  2XGE A;  4FX0 A;  3HZJ A;  2IW5 A;  2NVQ J;  3F8M A;  2HGC A;  2LKS A;  2X6X A;  1QRY A;  2ADU A;  3I58 A;  3IHU A;  1PUF A;  5FO5 A;  4S0H B;  5GTI C;  1VQK I;  1G8X A;  2K27 A;  3LSH A;  3MZ8 A;  4A0Z A;  3ZMU A;  2XRN A;  5K7F A;  2HVS A;  3CC4 I;  4L9V A;  4B09 A;  3H36 A;  1OKR A;  1Z77 A;  3GLX A;  2RN7 A;  2R7U A;  1TWC J;  2CFX A;  1CF7 A;  2JTV A;  2LG4 A;  4RB2 C;  4XLE A;  3T8R A;  3HEF A;  1JGS A;  4OIP F;  1YJ9 I;  2F5V A;  1W1W E;  2MFZ A;  1ZGW A;  1SFX A;  1IO2 A;  3CCS I;  2F5C A;  4XLA A;  1D5Y A;  2DYS H;  2V26 A;  4M3G A;  3A01 B;  4C2U A;  4BE1 A;  1ZR2 A;  1IN7 A;  5E18 F;  2PMZ A;  1HOM A;  3F8N A;  3CCJ I;  3AG1 H;  3BG9 A;  3CUQ C;  1NTC A;  4N4N B;  4XRS G;  3W3C A;  1YX5 A;  2R93 J;  1KQ8 A;  1POG A;  5KNL A;  3IH3 A;  3GZ5 A;  3BPV A;  2V1N A;  4H4K C;  3K70 D;  2BEO A;  2BXZ A;  2FBH A;  3SQN A;  2VE9 A;  3RZD J;  1W7P B;  5EJC A;  1MH3 A;  3S2H J;  3TP3 A;  1VFC A;  3C2H A;  2LKX A;  2VAS A;  2LY2 A;  2P4W A;  2DFE A;  3SXY A;  3FXK A;  1P92 A;  5KAI C;  5HVQ C;  3CO6 C;  2HPM A;  1ITY A;  2XKP A;  3OY9 A;  1ON1 A;  2GQQ A;  3IRQ A;  1I1G A;  3CC7 I;  5JR3 A;  3FF5 A;  4Y33 A;  3HL2 A;  2HWV A;  2R7O A;  2A68 F;  2VBW A;  1FYM A;  5DUK A;  5LBQ A;  2CW0 F;  1AKH A;  2X48 A;  4U87 A;  5HS8 A;  1V54 H;  1LEA A;  1QZE A;  5E3O A;  3PNT A;  4EM0 B;  3GFJ A;  2H09 A;  3W2V A;  2WY8 Q;  2DQR A;  3ZQQ A;  1IDY A;  1P9Q C;  4F92 B;  3E1S A;  2HS5 A;  4IF4 A;  1FIP A;  2EV5 A;  1IN5 A;  4LLG F;  4LLL A;  1REP C;  4OMY A;  2XV4 S;  4D5C A;  4F52 A;  4AVP A;  2M45 A;  4BXF A;  5C4X J;  1MDM A;  2X85 A;  3HPG A;  4QPQ A;  1KU9 A;  2O5R A;  4HF1 A;  4A5N A;  1LDD A;  2UV1 A;  3WTZ A;  2YX7 A;  2EJR A;  2HNH A;  2H6C A;  4HA8 A;  3ZR8 X;  1QO0 D;  3S93 A;  5HLG A;  1IN4 A;  4BUP A;  1WHU A;  4I0B A;  2K7L A;  5TJJ A;  4EGY A;  3V8L A;  3BR3 A;  1FX7 A;  2W48 A;  4YFX F;  1S9H A;  1KU2 A;  4IL6 C;  2E1M B;  4F93 B;  9ANT A;  3WU0 A;  2M0C A;  2LMD A;  2PX9 A;  3LOC A;  4XMY A;  3TOA A;  4M6Y A;  2RNG A;  1FY7 A;  3RDI A;  1TWF J;  3N05 A;  5FGM A;  1U3E M;  2BY3 A;  1G3S A;  2V9P A;  3KEY A;  3QP5 A;  1W0U A;  4XM3 A;  3HRS A;  4D9J A;  4UVC A;  2X6Y A;  1UST A;  2R4G A;  4HEA 2;  2HVR A;  2FMY A;  1X4P A;  2BY0 A;  4O6J A;  3VFZ A;  4LD5 A;  1EH6 A;  3RPQ A;  3L1P A;  2I10 A;  5LGN A;  2X6O A;  2Z16 A;  3OIQ A;  4DZP A;  4OIR F;  3UR3 C;  1RR8 C;  3KP4 A;  4E4H A;  1WJ5 A;  3HOZ J;  3H3Z A;  2KT0 A;  3PJR A;  2V9K A;  2LRD A;  4PZJ A;  1WH5 A;  3ZQL A;  3HOT A;  1HSJ A;  3K1N A;  4BJT A;  1QPI A;  3BQZ A;  3FZV A;  4HDV A;  1HQC A;  1X4O A;  1VQO I;  3BDD A;  1ENH A;  4HQM A;  3ABL H;  2D1H A;  2RQP A;  4PDK A;  3L2Q A;  2L9V A;  1HKQ A;  3HSE A;  2IS4 A;  1PP8 F;  2Y0M A;  2M9H A;  4DGW B;  3ZOB A;  1BIA A;  2O61 A;  2XSJ C;  4K2E A;  4QWQ A;  1XMX A;  3VOD A;  1MBJ A;  1HKT A;  2VJI A;  1ZLJ A;  3ZMD A;  3J80 Z;  1TQI A;  4RLQ A;  4AU7 A;  3T1B A;  3U21 A;  3KCC A;  3M1E A;  5FKM A;  2I8D A;  3SFZ A;  5K7H A;  1D1B A;  1E3P A;  3WTS C;  5DCF A;  2VPR A;  3RI4 A;  1P4W A;  2XRO A;  4M71 A;  3V7S A;  1ZR4 A;  1E3O C;  4Q5S F;  1TL8 A;  2KZG A;  2VL8 A;  3FMR A;  4MQ9 F;  3LNQ A;  1ZAR A;  4IHW A;  1YW8 A;  4ENM A;  2OQG A;  3NQO A;  2DMU A;  3BR5 A;  3D0S A;  1OYY A;  2PEX A;  3X2Q H;  3PIO F;  1U5T C;  3VWB A;  5HS9 A;  4Y15 A;  1YIO A;  2CQ7 A;  3HKZ N;  1YS6 A;  1FBU A;  2K4B A;  3BZK A;  2DT7 B;  4XON A;  2AO9 A;  2STW A;  2J5P A;  2XKO A;  1Z67 A;  4HX8 A;  3ZGK A;  5GAH J;  2MD5 A;  3LA2 A;  4XN0 A;  2Z33 A;  2W57 A;  2K9L A;  2X1C A;  4X0G A;  4RM2 A;  3IWZ A;  5CPR B;  1DPU A;  1YW7 A;  2ZME A;  2RGV A;  1IV8 A;  1B59 A;  2L4A A;  5EG0 A;  4HLY A;  4UVB A;  2M1B A;  4M73 A;  1WJD A;  3I55 I;  4IX7 A;  3AAF A;  3AG4 H;  3COA C;  4E7S A;  3GTL J;  5D5X B;  1O4X A;  4YRV A;  3OIP A;  1JJ8 C;  2ESN A;  5AIQ A;  1LB2 A;  2KIM A;  4W97 A;  1EF4 A;  2M2E A;  3O6B B;  1W5C C;  3MWM A;  2VQH A;  3ZPL A;  1R5H A;  2AQE A;  4DYR A;  4LB6 B;  1ZGA A;  1J7K A;  2JN6 A;  5M3M J;  4LG3 A;  3TO6 A;  4A5M A;  2RKH A;  2F4O B;  3U1D A;  2NVY J;  3WTT C;  3PSI A;  4NNJ A;  1B4A A;  3OYK A;  1R1V A;  3FXQ A;  2HI3 A;  1MSE C;  3A03 A;  2MAB A;  2M0M A;  2FNP A;  5E79 C;  3L2R A;  4J00 A;  3OYC A;  4XKC A;  1O7F A;  2MH2 A;  1SEU A;  3R0J A;  4B43 A;  2XF5 A;  4Q48 A;  1FYL A;  2FBI A;  3Q5F A;  1DU6 A;  1DPR A;  2RNJ A;  3B6C A;  1ZRE A;  2JWT A;  4A6D A;  4NUB A;  2IS1 A;  3G2B A;  3ONQ A;  2KL4 A;  2D45 A;  3HHG A;  1W7P A;  3CDH A;  1ZG5 A;  5M3F J;  1FP1 D;  2ISZ A;  3FHN A;  1QPM A;  3CMM A;  4BE0 A;  2WB1 A;  1A35 A;  1LUJ B;  3CMY A;  2GBY A;  2EA2 A;  3MKL A;  4DYQ A;  1R58 A;  2M5W A;  4G6Q A;  3DEE A;  4NBQ A;  4HNU A;  4V2G A;  1EH7 A;  5BPI A;  1R36 A;  4XNF A;  5DCM B;  1ON2 A;  1RC9 A;  3S1Q J;  2EWN A;  2LR8 A;  2ZO4 A;  4WCG A;  4BS9 A;  4ANJ A;  4C30 A;  4YII A;  4YFK F;  1AA7 A;  1P4A A;  3WGI A;  1VQ8 I;  5DM7 F;  1G3W A;  3REO A;  4DW6 A;  4EEF G;  4Q4Z F;  2M8G X;  2ELJ A;  2ZCW A;  1QHH D;  2R5Y B;  1PP7 U;  2XGD A;  2RQQ A;  1GV2 A;  1QNT A;  4M9X A;  5J8C A;  2F5E A;  3GW2 A;  2ID3 A;  4P1W A;  3FM3 A;  2IA2 A;  3RJP A;  3MCZ A;  2EIK H;  4Y17 A;  1ZG1 A;  1MD0 A;  1ZAO A;  4MLO A;  1W36 C;  2ELH A;  4ON0 A;  2EV0 A;  3KPH A;  1IUY A;  2V1U A;  2AXL A;  3OYG A;  4N0B A;  1N75 A;  4LOC A;  2NRA C;  5IYC J;  3JSP A;  2E34 A;  1TWA J;  1VQ6 I;  4NC8 A;  2OA4 A;  4UVA A;  1BM9 A;  2UUZ A;  1LJ9 A;  3CUO A;  3JAM Z;  1DDN A;  4IXA A;  3LSP A;  1WWX A;  4RS8 A;  3RKY A;  5E3L A;  3FMQ A;  2LY9 A;  2VC0 A;  5HDK A;  2H1K A;  4KIG A;  3CCQ I;  1IXR C;  1VZ0 A;  4KN4 X;  2E1N A;  5IP9 J;  2L02 A;  2ZJR F;  3ZN1 A;  3SJM A;  3M7G A;  1OQY A;  2CRG A;  5FLX Z;  1TW2 A;  1IV6 A;  1GUU A;  2DXI A;  1J09 A;  1IXS B;  5IT9 Z;  4MO7 A;  5KCM A;  3SYT A;  3CQZ J;  3DEW A;  1OCC H;  1W7P D;  3FKI J;  1CQT A;  2W85 A;  1J5Y A;  4R1H A;  3IKT A;  5BPD A;  2M30 A;  3L2C A;  1B6A A;  1ETV A;  2F4M B;  2Y9Y A;  3LQQ A;  2FE3 A;  1MND A;  2XAS A;  1APL C;  2O9L A;  1Z7L A;  1MMN A;  4FHT A;  2LFB A;  3BLY A;  1VTN C;  1R71 A;  5CLS A;  2QYO A;  4B4C A;  3HXL A;  3H35 A;  4G6D A;  3O3K A;  1LKX A;  3MKW B;  4PJM A;  4R8H A;  4EQQ A;  3CLO A;  3RSN A;  4BJ6 C;  4HPQ A;  2KJB A;  3HG9 A;  5DEQ A;  2BBY A;  1BR4 A;  3U2R A;  1H89 C;  4ZDP A;  3BZ6 A;  3JRF A;  1IRF A;  1S5L C;  4AIJ A;  1AU7 A;  4LK1 F;  1VQP I;  4CZZ A;  2GIV A;  1JT6 A;  1QA6 A;  2DA7 A;  1QVU A;  1W5T A;  2K9M A;  2HKX A;  3L7W A;  1OCO H;  3HRU A;  1HKS A;  4ESF A;  1ZHF A;  3ABU A;  4KDP A;  3BR0 A;  4PGG A;  2AXT C;  2XPV A;  4X1E A;  4WK8 F;  3RZO J;  1AOY A;  3HIF A;  2VKH A;  3J81 K;  3M8J A;  4ESB A;  1WVR A;  2PQ8 A;  2MLK A;  2XAU A;  4RA2 A;  4A2U A;  2EZL A;  3I3L A;  1UFM A;  2KHM A;  4Y4R A;  4ZH4 F;  3PNV A;  1JXS A;  1IRZ A;  1QZY A;  3H1C A;  4HST A;  2QVO A;  4WXH A;  3GTG J;  4P9F A;  5D4R A;  5BOX A;  3WTU C;  5DD8 A;  4ZDL A;  2CGP A;  2V1D A;  2YU9 J;  3S16 J;  2G9W A;  3KP7 A;  5HNF A;  3P9I A;  3OYH A;  3QQA A;  3OR1 C;  1XC5 A;  3K69 A;  2HDW A;  5GPA A;  4E6K G;  4PJJ A;  2DMQ A;  2L3D A;  1HW1 A;  1T33 A;  1LFP A;  2NAZ A;  4YIR X;  1TZL A;  1R5I D;  3W6J B;  4A3E J;  3SZG A;  3HSF A;  3GTM J;  2R7W A;  2XIG A;  3DTK A;  1XS9 A;  4AYB N;  4Y3O A;  1YS7 A;  3BZC A;  1SD6 A;  2A5W A;  1T39 A;  5EEH A;  2VBY A;  2L54 A;  2EA4 A;  3F9K A;  3E6D A;  1LFB A;  5AON A;  5B1A H;  4ZZD A;  2E2H J;  3K2A A;  1T0F A;  3CTA A;  5IOY A;  2LKP A;  1JHH A;  2E71 A;  2L2O A;  4UY8 I;  1TQM A;  1BN5 A;  3FMS A;  5F64 A;  4DQ2 A;  4EVI A;  2QWW A;  2CWE A;  2W24 A;  5E1X A;  1YQA A;  2DTZ A;  2YU3 A;  1ETQ A;  4BEH B;  1O3S A;  1Z1D A;  1F9N A;  2FBK A;  4RB0 A;  1JUP A;  3QPT A;  1X1A A;  1DP7 P;  1IGN A;  2Y75 A;  2GXB A;  1WRJ A;  4MHG A;  4S04 A;  4DJA A;  4M72 A;  2WBM A;  3L9F A;  1ETK A;  3U9G A;  1PJR A;  3WTW C;  2R7T A;  2VC1 A;  2A69 F;  1U5T B;  1XDS A;  2HOE A;  2CV0 A;  2KIQ A;  5J40 A;  2DMN A;  2DT5 A;  1DQU A;  3I0T A;  1X1B A;  4A0X A;  1FOX A;  3TO9 A;  1U9N A;  4M9S A;  3M8E A;  4F91 B;  5IT3 A;  3C1D A;  4KFC A;  2OU2 A;  3FXM A;  4XLH A;  4L0Y B;  2VLA A;  2JSC A;  3ZQC A;  1ZG3 A;  1S7E A;  5ICC A;  2GZW A;  1G3T A;  2W4S A;  2PFB A;  5DCM A;  3C3W A;  4MTD A;  2QF7 A;  2HZD A;  2K02 A;  4EMS A;  2QLZ A;  2WAQ N;  2CU7 A;  4ASN A;  2VT2 A;  1Y8Q B;  4P96 A;  1BW6 A;  5HOO A;  2DPU A;  5JHF A;  3MMY B;  4G6T B;  2KQR A;  2CQQ A;  2UXX A;  4CSW A;  1VQN I;  2O8K A;  2KJC A;  3WG7 H;  2IJL A;  2ECB A;  1R7J A;  3IH4 A;  4A0Y A;  4HX4 A;  2CQK A;  1U8R A;  2E7W A;  5IOZ A;  3G4S I;  2FXA A;  2P5L C;  4Y52 J;  1Z21 A;  3DPT A;  3O2P E;  3ASN H;  3H9J A;  2GA2 A;  4U7B A;  5JLX A;  3JRA A;  3VOE A;  1MNM C;  2G7H A;  3KYL A;  1VQ7 I;  2JA6 J;  1A6I A;  2L7M P;  1EA3 A;  1WI9 A;  1YIJ I;  4BKX A;  2M7B A;  3GFL A;  2VT3 A;  3S2W A;  2MC4 A;  5HOD A;  1XGS A;  5EEA A;  1IF1 A;  2STT A;  1Y1V J;  2HDD A;  3CCR I;  4XOP A;  2LD5 A;  4NC7 A;  3BJ6 A;  1J0R A;  1YTY A;  4RAG A;  3FWE A;  1NG6 A;  5FRO A;  5DS9 A;  1WZ2 A;  2BZT A;  3CUQ A;  2VON A;  2BVM A;  2MC3 A;  2HZT A;  3LSK A;  4EJV A;  4C2T A;  3KFW X;  1IAW A;  1YE9 A;  4UUS B;  1WKM A;  2EBI A;  2M4G A;  1HDP A;  2VUM J;  4U88 A;  1X1D A;  4M3E A;  1TP4 A;  2VE8 A;  3HSR A;  5E17 F;  1F1Z A;  2NNN A;  2HR3 A;  4HRI A;  3NWS A;  3PSF A;  2DPD A;  3Q0V A;  3OS0 A;  1HLV A;  1YX3 A;  4ZTJ A;  2LDU A;  4KT5 C;  2CV2 A;  1KU3 A;  2JUC A;  3CZ6 A;  4GYG A;  2CUZ A;  1Z7U A;  4RGX A;  3B02 A;  1FSH A;  2QA4 I;  2CSO A;  5IYD J;  1ODD A;  1DP3 A;  3TQN A;  4XKB A;  4B3A A;  4E7L A;  4BDZ A;  4G9Y A;  1SFU A;  4JK1 X;  3R61 A;  4QLC U;  3CME I;  5L3B A;  3BWG A;  4D7M A;  2LOO A;  2IS6 A;  2FOW A;  1OCR H;  3QYF A;  2HOA A;  4F55 A;  4ENN A;  4UUV A;  4A3I J;  1ULY A;  3HRM A;  3QU3 A;  4L5I A;  1KON A;  1YJW I;  4XIC A;  1MBG A;  5H6Q A;  1WI3 A;  1G59 A;  2LNB A;  4C3J J;  2BHZ A;  1OCP A;  2H8R A;  2HPI A;  2H94 A;  4CCJ A;  4IHT A;  2DCE A;  5FD6 A;  5HDG A;  3S3O A;  5FLM J;  2JQ7 A;  1MMD A;  2UWM A;  4M3D A;  2DYR H;  2NOJ B;  4OIO F;  1W5S A;  3OMY A;  3GME A;  3LSR A;  2ZB9 A;  3B6A A;  3LST A;  2R7V A;  3HC7 A;  1F4K A;  3DKW A;  4YG2 F;  2OF7 A;  4BY1 J;  3LFK A;  1QGP A;  2A07 F;  1LVA A;  2GOX B;  1JUS A;  2TCT A;  4RB3 C;  1ZH5 A;  2LY1 A;  3HTS B;  3GXO A;  3DKX A;  2P6S A;  5LEK A;  5F6F A;  2FML A;  5H20 A;  2A6H F;  4I7H A;  2HQN A;  3W6K B;  1TNS A;  5IY5 H;  3KET A;  3GTP J;  3S3M A;  2QSG X;  3E3V A;  1SVL A;  3VYU B;  5A2Q Z;  1STZ A;  4UB6 C;  2OPT A;  4YEJ A;  2WAE A;  2XF6 A;  2DA2 A;  3BG3 A;  3IAM 2;  3IRR A;  2VOD A;  1GXP A;  1WH7 A;  2HQA A;  3RIR A;  4E70 A;  4L9N A;  3ELK A;  5GAE J;  2EZK A;  1FWZ A;  5DM6 F;  2WTE A;  2YX4 A;  4I76 A;  4XL9 A;  3VYS B;  4L18 B;  3LAP A;  1RES A;  1A5J A;  4ZDO A;  3LSJ A;  4FTH A;  2EH3 A;  2PBI A;  3K7A J;  4ETS A;  2K4J A;  2BOL A;  1X2M A;  2LRE A;  4XSZ F;  4U0W A;  4EJU A;  3I4N J;  1BR1 A;  3I59 B;  1NHA A;  4OOI A;  2DN0 A;  1GT0 C;  3DQV C;  1P7J A;  2FA5 A;  2Y9Z A;  2BGC A;  3FXR A;  1F43 A;  3KEQ A;  4DBR A;  3P7N A;  4FQG A;  2QBY B;  1V3F A;  2Y30 A;  4G94 A;  4N9I A;  2ZJ2 A;  4TV7 A;  4BGD A;  2Q0O A;  4KN7 X;  2MBF A;  1QVT A;  5E1W A;  1OYW A;  3HGG A;  2Q2E B;  4BEH A;  3VPR A;  1D8K A;  1UB9 A;  4LJZ F;  3TDZ C;  1D3Y A;  2DA3 A;  3T5X A;  4PSX A;  4F3Q A;  2OV7 A;  5DYM A;  3WHC A;  5C44 J;  2QEX I;  1VQM I;  3R4K A;  1U5T A;  3RPU A;  5LLQ A;  3QRF F;  2XAF A;  1R1T A;  3Q3S A;  4XRF A;  1D0X A;  5J47 A;  1SC7 A;  2LF7 A;  2QQA A;  3V8K A;  2ZKZ A;  1KZH A;  4FET A;  5B1B H;  1QHG A;  3ROU A;  3S1R J;  2GM4 A;  2V6E A;  1Y8R B;  4AC0 A;  3AG2 H;  1EH8 A;  3A0H C;  1IDZ A;  3BJA A;  3Q9S A;  4YEL A;  4FCY A;  2WA0 A;  1TNT A;  1NK2 P;  1KYW A;  3TED A;  3HHH A;  3ZQF A;  3CF5 F;  3KP6 A;  4AUX A;  1T98 A;  2NOG A;  1RRJ A;  1MJ9 A;  1UHM A;  1PDN C;  1IXC A;  3PO2 J;  1SD4 A;  5B5E C;  1BR2 A;  2KPM A;  5LFA A;  1UHS A;  2IGK A;  1DUX C;  1JGG A;  1DGW Y;  2E5N A;  3G1M A;  3F8B A;  1XSD A;  1XCV A;  3R60 A;  4IEJ A;  4RAZ A;  3P5J A;  1Z6T A;  5F0F A;  1FZP B;  1I6H J;  1GVJ A;  2UXN A;  2PJR B;  1Z0X A;  1FEX A;  5FFZ A;  3ASO H;  4C3H J;  1YRN B;  2CUJ A;  1OR7 C;  3JW4 A;  4Q47 A;  4XLP F;  4A12 A;  1WJA A;  3PUF A;  3E5U A;  1WFX A;  2NS0 A;  3BG6 A;  3CCM I;  3F21 A;  3MD2 A;  2CO5 A;  4BYY A;  1IC8 A;  4KMU X;  4IKF A;  4BQQ A;  3D1N I;  1D1A A;  3CJN A;  4BBR J;  3ABT A;  2VB6 A;  5BMZ A;  2IS2 A;  1QU3 A;  4UHT A;  4A3F J;  4HOB A;  1YYV A;  1FT9 A;  1XG1 A;  3E7L A;  1MBH A;  2DK5 A;  4CIC A;  2A6E F;  1YW9 A;  3VSK A;  3KZZ A;  4DIQ A;  5KHD A;  1ZGJ A;  2JRM A;  2LK2 A;  1G6N A;  1LFU P;  1CGP A;  3PFY A;  1ZK8 A;  2QGU A;  2Y31 A;  1WQ2 A;  1P4X A;  4RAY A;  4DZJ A;  2E35 A;  1OFC X;  3OYJ A;  2KDZ A;  3JRI A;  3FXU A;  2ZXH A;  1RET A;  4CCN A;  2XPW A;  1YIT I;  4OU0 A;  5J4V A;  5JVG F;  3CCV I;  3DTE A;  4UUS A;  4IRH A;  5CVU A;  4BHB A;  3S14 J;  5HNH A;  1T6S A;  2JPC A;  4IRI A;  1ERD A;  2R7F A;  3FBN B;  2Z5U A;  3ZCO A;  4XLN F;  4BQO A;  1S29 A;  2EB7 A;  5D5W B;  5CQE A;  2Y0S N;  3TO7 A;  4J19 A;  1T38 A;  1T56 A;  3RQ4 A;  2YPR A;  1RIO H;  1OCT C;  2DTR A;  3MAJ A;  3OSG A;  4PJL A;  2LH9 A;  4I02 A;  4HF2 A;  4OAZ A;  3K9T A;  1G3Y A;  3LMM A;  4CA0 A;  5LHG A;  2BV6 A;  2FF4 A;  2HTS A;  3ZN0 A;  3CDL A;  2KRF A;  3JSO A;  1Y1W J;  2XHK A;  3GLL A;  2EIM H;  1Q1V A;  5AIP A;  4FIS A;  4V2F A;  1MH4 A;  1B1B A;  4WX9 A;  5ERI A;  1UEL B;  2P81 A;  3L09 A;  1IJW C;  5EDN A;  1V4R A;  2OC6 A;  4PK4 A;  4A3C J;  2IP2 A;  1P7I A;  2GXG A;  5JLW A;  4P5O A;  4LIU A;  2FQ3 A;  5ICF A;  1AHD P;  3ISP A;  2X51 A;  3RKX A;  1F5T A;  3S32 A;  1JKR C;  2R92 J;  4D0P A;  2HVQ A;  1FJL A;  3FBI B;  5HLH A;  4GDF A;  1L3L A;  2A6T A;  1H9T A;  3C18 A;  2QSF X;  3TBI A;  4P55 A;  5EZG A;  1I50 J;  1NH3 A;  1R6R A;  5F1R A;  1LVK A;  3H9G A;  5H6R A;  4CYC B;  3GYH X;  3E6B A;  1U9O A;  5EGO B;  3DLL F;  1WJF A;  3G73 A;  1FPQ A;  3DBH B;  1KGS A;  1RUN A;  1IW7 F;  3SDB A;  3DU6 A;  3R6S A;  3TL4 X;  5L3C A;  3K2Z A;  3RCO A;  5LHI A;  4HX7 A;  4MFE A;  2BE5 F;  4WF2 A;  3SEZ A;  5L3E A;  4A3M J;  1I1S A;  2WWY A;  4B44 A;  5M5Y J;  1OYI A;  2R7D A;  5ICG A;  2QM3 A;  1IRG A;  1D5V A;  1FMW A;  3A02 A;  4PUS A;  1JKP C;  2PMZ N;  1MIJ A;  5CYV A;  4CDG A;  1WJE A;  3KZY A;  2LSO A;  2LC2 A;  3K1P A;  5F08 A;  5C3E J;  4UXN A;  3L00 A;  3M3Y J;  2CW8 A;  3A1Y A;  1Z91 A;  1JI8 A;  1SMT A;  3TMO A;  2H6B A;  4L9T A;  2PMU A;  5ED4 A;  1XD7 A;  1S72 I;  3OYI A;  2DA4 A;  3CUQ B;  2JA7 J;  2K3F A;  4AID A;  2DJN A;  5FD5 A;  2GAU A;  3BTI A;  2Z9O A;  3FIW A;  3ML6 A;  4IQJ A;  5K1Y A;  3PQK A;  3TDU C;  5CKT A;  1YFH A;  3EUH C;  1SD7 A;  3DWL E;  2ZJQ F;  5CVI A;  1S7O A;  3OYL A;  1UJ8 A;  2DMP A;  3P9K A;  2Z2S B;  3ABK H;  1G4D A;  4LG0 B;  3F23 A;  3RKQ A;  1BOB A;  3IP4 B;  2OAZ A;  2XF7 A;  3NAR A;  3I59 A;  3K10 A;  2DOA A;  2WV1 A;  2R5Z B;  2X1E A;  2JPB A;  2VOO A;  4J01 A;  2IGM A;  1OJL A;  4CCK A;  1MBE A;  1Z9C A;  4KA4 A;  2AS5 F;  2EFO A;  4XSX F;  4RBO A;  2QBY A;  3KEO A;  4AIH A;  4A3J J;  3QU6 A;  4LMY A;  1E17 A;  2X1D A;  4IO9 F;  3GVA A;  1XDU A;  2Q2E A;  3MQ0 A;  4JP0 A;  3S1N J;  2OTJ I;  1RZ4 A;  4EAT A;  5JHU A;  3KX2 A;  2V79 A;  2V4J C;  2ECC A;  4B8X A;  1XMK A;  3CO7 C;  4KIF A;  2DOE A;  1BI1 A;  5LHH A;  3GTK J;  3H5R A;  4CUG A;  1KA8 A;  3ZMZ A;  1TTY A;  1XGO A;  1TWG J;  2L9S A;  2M4K A;  3WGG A;  4MNU A;  3ZMT A;  3I54 A;  3JRB A;  2ZXJ A;  2IBD A;  4JBA A;  5CJ9 A;  3HGY A;  1ETO A;  2H1L A;  3GZN B;  1YG2 A;  1LE8 B;  4U0Y A;  3WTX C;  4NHJ A;  3OS1 A;  3JRE A;  2ZXI A;  1MSF C;  1I27 A;  2VI6 A;  3DF8 A;  4ENK A;  3JRH A;  4U0V A;  3H9Q A;  2VJ4 A;  4KIC A;  2XAQ A;  5CQG A;  3LL7 A;  4BY7 J;  3F8C A;  2L7F P;  3SEQ A;  1BOA A;  2QQ8 A;  1J9I A;  3EET A;  1Y6I A;  3V7R A;  4A6E A;  1K4T A;  3OL4 A;  3H0D A;  3M1C A;  1RNL A;  2OQR A;  3T0Y A;  2JRT A;  2WV0 A;  1JTX A;  1JKQ C;  4CXF A;  2KFD A;  2L7K A;  1MBK A;  3I71 A;  5HLI A;  3S17 J;  1SFO J;  4S05 A;  2DK8 A;  3BQY A;  3ZQ7 A;  4ZYE A;  2WY7 Q;  2CV1 A;  2O7O A;  2PJR A;  2H8W A;  3H5N A;  4I6Z A;  3BTJ A;  2LYC A;  4PSW A;  1YRN A;  2E7X A;  3K4K A;  3I4M J;  1WGX A;  4A93 J;  4GCV A;  1X1P A;  4M9Z A;  2E36 A;  3D5R C;  3KZI C;  5KAF C;  2ZJP F;  3E5X A;  5ILU A;  2KMU A;  2HOS A;  4X6A J;  1JTY A;  2W00 A;  1E0E A;  2K9N A;  1BJA A;  2EIJ H;  3OOP A;  4UB8 C;  1YLF A;  2FNA A;  5D8K B;  5GAD J;  2VQC A;  2JA2 A;  4HDU A;  4E7J A;  3GTO J;  2GOM A;  1IZ1 A;  4FE4 A;  5FKK A;  5H2F C;  2ID6 A;  1S8N A;  3BG7 A;  4V19 K;  4P9U A;  1W0T A;  3DTI A;  3W2A A;  1VF9 A;  1MMS A;  2QZ8 A;  2E1O A;  3F72 A;  4AIK A;  2LP0 A;  1UZC A;  1USS A;  2WC2 A;  3D5S C;  1XB4 A;  3BR6 A;  5D8L B;  4II3 A;  1MNE A;  5EF6 A;  3JTH A;  2F5D A;  1TLH B;  4L5E A;  2BXY A;  3DP7 A;  1A6Q A;  5F1J A;  4NC6 A;  3DKY A;  5E8I A;  5FLV A;  2K86 A;  5JFR A;  3HKZ A;  3W2W A;  3D5L A;  3RYP A;  2DU9 A;  5K7Z A;  2EIN H;  5E3M A;  1ZTR A;  2LVS A;  4RGU A;  4EM1 A;  3LQR A;  2W84 A;  1JKO C;  2V6C A;  4BAY A;  1HA8 A;  2CUE A;  3AFH A;  4RM3 A;  1G2H A;  3OIO A;  5M5W J;  4IZZ A;  3F3X A;  3CLQ A;  3A0B C;  3V42 A;  3G71 I;  2C6Y A;  1UMQ A;  2JT1 A;  1K7A A;  2HQ5 A;  1X3Z B;  2RC4 A;  3E0J B;  4C3I J;  2DA6 A;  1VQ4 I;  4CGZ A;  1KQ9 A;  3PNY A;  1R1U A;  1AWC A;  2L7Z A;  5J8F A;  2Y48 A;  3T8T A;  1FOW A;  3DPU A;  4E7H A;  4JX5 A;  1OMI A;  4OMZ A;  2HEO A;  3CJR B;  1N78 A;  3TW6 A;  4Y7N J;  1BI3 A;  1K78 B;  3K6G A;  5ICE A;  3MKZ A;  2FEZ A;  1UCR A;  5TGT A;  1R49 A;  2EQR A;  2I5U A;  2XC7 A;  1T0F C;  2LBF B;  3H92 A;  1MBF A;  4JX6 A;  1Z3X A;  3K4B A;  2L9R A;  3WE2 A;  2KIU A;  2DA5 A;  3MKY B;  2E5Z A;  2CS3 A;  3CJQ B;  1I3A A;  3CCU I;  3F0C A;  2B9S A;  1Y56 A;  5FFX A;  2K9Q A;  3DV8 A;  3V7C A;  4XRM A;  4XLF A;  4CYC A;  1IN8 A;  4GGG A;  1O57 A;  3S8P A;  3VYT B;  3S15 J;  5EGO A;  2D1V A;  3J7A Y;  3ZP5 A;  3VB2 A;  3PM1 A;  3JRG A;  1GHC A;  1D1C A;  2RDP A;  1DU0 A;  1FP2 A;  1HF0 A;  1YOV B;  2Y0S A;  3R0A A;  2WAD A;  3OYN A;  3V4G A;  2ME0 A;  3JCU C;  2E1C A;  2DT6 A;  4B48 A;  4WXC A;  4XBF A;  2HXO A;  3GF2 A;  1MW7 A;  4AWX B;  3GCM A;  3N4M A;  5E1Z B;  1TBX A;  3QPS A;  2UZK A;  2DBB A;  1WJC A;  1T8I A;  2EK5 A;  2FJ1 A;  1FIA A;  4XR6 A;  3W6V A;  1GXQ A;  4KIS A;  4EV0 A;  4HF0 A;  2M34 A;  4I0A A;  3J7A O;  1ZYR F;  2J5O A;  5BNG A;  2BYV E;  1RKW A;  3VSL A;  1R4N B;  1U78 A;  3K70 C;  5FKN A;  4DOZ A;  4LB5 A;  2R7Z J;  1I39 A;  4Z6Y A;  2WB1 N;  3J81 Z;  2F5F A;  3IH2 A;  4A69 C;  2ZXW H;  3ERM A;  3HUG B;  4FX4 A;  1YHQ I;  4MGR A;  1K79 A;  3EPZ A;  1LDK B;  1X1C A;  4LK0 F;  2IT0 A;  4IHS A;  4ZYH A;  2F6C A;  1BA5 A;  2QCO A;  2F4I A;  4M6V A;  3BR2 A;  2R7S A;  2GXA A;  3G6E I;  3J80 K;  4O3M A;  2W7N A;  2XB0 X;  3ZMV A;  2Y69 H;  3EYY A;  3K4C A;  4NQW B;  1U6G A;  4LG0 A;  1LPQ A;  1B8I B;  2B0L A;  3E6M A;  5LGT A;  3AL0 C;  3I5U A;  3HB9 A;  3PFI A;  3HOW J;  2YSR A;  2R5Z A;  3KYD B;  5F04 A;  5IPA A;  3CD6 I;  1JUM A;  5HLT A;  3JRC A;  2M8E A;  1SAU A;  1VND A;  3G3Z A;  5HS7 A;  1O3Q A;  2PN6 A;  5E3N A;  2NVT J;  3AG3 H;  2JA5 J;  1OCZ H;  4JX4 A;  1ZRD A;  1N77 A;  1BL0 A;  3FX3 A;  2TDX A;  4BQN A;  4E7K A;  4E7I A;  3K0L A;  2PLY A;  3DXJ F;  3EUA A;  1O7L A;  4XQF A;  1S3J A;  2DW4 A;  3HBL A;  2VBZ A;  3TP0 A;  3EQL F;  1ACI A;  3ZRG A;  4L0Z B;  2LF8 A;  4RB1 A;  5LRS A;  4JOM A;  2E60 A;  1U0J A;  3EDP A;  3QPH A;  5LRR A;  1LNW A;  4OIN F;  1XSX A;  2LLK A;  1LE8 A;  4R79 A;  5GPC A;  3HRT A;  2O6G E;  2CQN A;  2JUG A;  5J1Y A;  3HJE A;  3KP2 A;  5JI6 A;  2P5K A;  4CCL A;  3P9C A;  2MD0 A;  3QOP A;  1OIS A;  3O8H A;  5ILV A;  3OYF A;  1A36 A;  2W82 A;  3BTC A;  3OWT A;  3PIP F;  1SFE A;  5F0H A;  1T2K A;  4I98 B;  4MTE A;  2XUB A;  3GTJ J;  1SVO A;  1XGN A;  4ESJ A;  4KUM A;  3OYB A;  2DMT A;  1XSV A;  1RPW A;  4L9J A;  2V7F A;  1R00 A;  2ISY A;  2DLL A;  2EPF A;  2OZU A;  2Q8K A;  3MZH A;  1H8A C;  3DFG A;  3M4O J;  4UUT A;  5DDG A;  3CMA I;  2CYY A;  2MLG A;  3ABM H;  3WTV C;  2IVM A;  3WOD F;  4BNC A;  3I4P A;  2HKO A;  3BCA A;  1WPK A;  4OIQ F;  3OYD A;  1ETX A;  2Z1D A;  4QIW N;  2MGQ A;  2OBP A;  2KP6 A;  2X4H A;  3I53 A;  4HAM A;  1X3U A;  4RAF A;  2KDO A;  2E2J J;  1XPX A;  2E19 A;  3WGH A;  3K4L A;  3CCY A;  5GP9 A;  3EYI A;  1S6L A;  2AQF A;  2HTJ A;  2IPQ X;  4BDY A;  1MMG A;  4KNY A;  2O8X A;  3KP3 A;  2VOP A;  2R3S A;  3GBG A;  1TC3 C;  3ECH A;  1B9N A;  1BJZ A;  4AVZ A;  4N9H A;  5F0C A;  1V55 H;  3J7Y J;  2IRF G;  1C0W A;  3CP2 A;  2QQB A;  1I3Q J;  3SHF A;  4I09 A;  2COB A;  4KIB A;  2VKE A;  3HOS A;  1PVE A;  5DV5 A;  2QQ9 A;  4ZC3 A;  5L3F A;  2ACJ A;  2XGC A;  4FE7 A;  5D5U B;  2P7C B;  4UV9 A;  4CZC A;  3N97 A;  4DNC A;  3KLN A;  4MIM A;  2HU9 A;  2X0L A;  1EKE A;  5GTH C;  4GYI A;  1LEB A;  2K40 A;  2L4M A;  2G7U A;  4BH9 A;  1KYZ A;  4CHU A;  4GXO A;  1BI2 A;  4IHV A;  2OCE A;  2DQL A;  3LSG A;  2W1O A;  4XOR A;  3TGN A;  4N4O B;  4M6X A;  3ZQH A;  2ZFU A;  4GRI A;  1R9T J;  3F22 A;  5E20 A;  4M74 A;  5LEJ A;  5FRM A;  1P6R A;  1ZRC A;  3ZQG A;  1JT0 A;  1OR7 A;  1ZKG A;  3CP8 A;  1X3W B;  2JSP A;  3WG9 A;  2Q1Z B;  3B73 A;  1QBJ A;  4LLN A;  2CW7 A;  3IKV A;  4AYB A;  1A04 A;  4HW0 A;  1FTZ A;  1K78 A;  2R7X A;  2VXZ A;  3CF2 A;  4ZTF A;  1TT0 A;  3WHB A;  4HBL A;  3JAM K;  2LBF A;  1WSU A;  4RLF A;  5D6F A;  4XLC A;  1X58 A;  2IEK A;  1VQL I;  3DBR B;  1HDD C;  3QOE A;  1FNN A;  2XAJ A;  3Q9V A;  4AD9 A;  2LTP A;  1KU7 A;  1MJA A;  1B72 A;  1K61 A;  2VN2 A;  2BVL A;  3ZQI A;  4FT8 A;  3IUO A;  1FOY A;  3IC7 A;  5FLX K;  4IQ4 A;  4KIT B;  2D5V A;  1RR7 A;  3GFI A;  1R4M B;  4L5J A;  5IT9 K;  3H3U A;  4I01 A;  4NB5 A;  1R5G A;  1ZN2 A;  3FHZ A;  2MA3 A;  2Y2Z A;  1XX5 A;  2HYJ A;  1XCB A;  1HST A;  2VXD A;  4BQA A;  4HQE A;  5FKL A;  2BY1 A;  3PL8 A;  4I2O A;  2ZNY A;  2P7V B;  4XRS A;  4RMN A;  5M5X J;  3S1M J;  3IL2 A;  4E7Z A;  4KMF A;  1OPC A;  2GIZ A;  3DPL C;  1U2W A;  2RAE A;  3F6V A;  4RGS A;  2DI3 A;  1W4M A;  3QP6 A;  2L0K A;  3WU1 B;  1PYV A;  2ZC2 A;  2O03 A;  1I5Z A;  1Y0N A;  4A3D J;  2MYS A;  2RV8 A;  3OSF A;  1BW5 A;  3HOY J;  3HOX J;  1H0M A;  5ILS A;  2BHY A;  5FJ8 J;  2FU4 A;  2VBX A;  3OR2 C;  3WE3 A;  1VQ5 I;  2DJI A;  3DBL B;  2EFP A;  2GA1 A;  5KVR A;  3DEU A;  5K5R A;  3OV8 A;  3TW7 A;  2L01 A;  4MFD A;  4BL0 B;  2FUG 2;  3RPU D;  3LAJ A;  3H5A A;  3V8J A;  5D4S A;  2EFW A;  2JVH A;  4IHY A;  3HUG A;  1H88 C;  1ZRF A;  3GEZ A;  2P5V A;  2WAQ A;  1R22 A;  4C9Y A;  4QTR A;  2FRH A;  2JMW A;  2ICW G;  2DFH A;  3KYC B;  2ZME C;  2ME6 A;  2F2E A;  1RI7 A;  4ZYG A;  4M3B A;  1JE8 A;  4Z2Y A;  4RDU A;  4NDL A;  2ZSH B;  1L0O C;  2MW8 A;  3CDI A;  3IWF A;  1GDT A;  1FLI A;  3OL3 A;  3NAU A;  3F6O A;  1J2X A;  1LDJ A;  3DU5 A;  5J1R A;  2BW3 B;  2OCC H;  4NQW A;  1FSE A;  3E97 A;  1B8I A;  1M1E B;  2FQ4 A;  2D2W A;  1SAX A;  1HW2 A;  4BJ5 C;  5BS6 A;  3WU2 C;  3LWF A;  2VKD A;  3EUK L;  4IVN A;  4G7O F;  3GTQ J;  2A5Y B;  2KIF A;  2KRH A;  1FOK A;  1YO5 C;  2JA8 J;  1Z3Y A;  3LFU A;  1K6Y A;  3A01 A;  3OYM A;  2OTL I;  1MGT A;  3C2B A;  2ETH A;  3C2G A;  3KIO A;  3QYE A;  1XTA A;  3HM5 A;  3SFI A;  2Z3Y A;  3LSI A;  5JVT A;  3CCL I;  3CJT B;  3QYB A;  5BQT A;  1XMA A;  3HOV J;  4XKW A;  1YJN I;  1ZLK A;  2H27 A;  2NNY A;  2DO7 A;  2DFI A;  1VI0 A;  2F48 A;  1BC8 C;  1V5E A;  3U1K A;  3TKY A;  2XAH A;  3I9V 2;  2XVC A;  3BOQ A;  5IP6 A;  2COM A;  4KJZ A;  2K5C A;  4BAC A;  3Q0U A;  3CCE I;  3HTU A;  3GWZ A;  1ZEL A;  3ERE D;  2W25 A;  3BRO A;  1P2F A;  2MH9 A;  5E8G A;  3VDX A;  3O8G A;  3RQI A;  3FM5 A;  1MZB A;  2OUM A;  2DDB A;  1FMV A;  4HZF A;  2ZSI B;  4M3F A;  3ZXS A;  4A3B J;  3GO5 A;  3BC8 A;  4HLX A;  2JK3 A;  5EZH A;  3JRD A;  1E3H A;  2X6W A;  3K4M A;  2CFO A;  3MZY A;  3JTG A;  5DUI A;  2EZI A;  3MEX A;  1TT5 B;  2M7A A;  3VEP A;  5LGU A;  3KP5 A;  1MKM A;  2K9S A;  2CQX A;  1MJB A;  3BR1 A;  2R7R A;  3EUH A;  3NRV A;  4C2M J;  3SZT A;  3UNG C;  4XK4 A;  3GZ6 A;  5TRD A;  2OD5 A;  3NWT A;  3PO3 J;  4BHC A;  6PAX A;  2VQG A;  2V1X A;  1UG0 A;  5J1U A;  2NVX J;  4MEX F;  2XPU A;  2EV6 A;  2JJ7 A;  1BIB A;  2JVG A;  4ABZ A;  1QZZ A;  2KRC A;  3AL0 B;  4GFB A;  3RTR A;  2QUF A;  4HV5 A;  2O3F A;  2L5Q A;  5C4J J;  2ZFW A;  1SAN A;  2HYF A;  1FTT A;  4EJT A;  1J75 A;  2IGO A;  4ZYD A;  3JR9 A;  4HNV A;  2FSW A;  2A61 A;  2AHQ A;  5K5Q A;  4IOC F;  2B63 J;  3CES A;  4B1R A;  2P8T A;  2NXN B;  1XGM A;  1EJ9 A;  2HFH A;  3FXL A;  3OOU A;  2R0Q C;  2QKL B;  4BXX J;  1R23 A;  5FKO A;  4B47 A;  1PUF B;  2RVC A;  2HOT A;  2DFF A;  3A2K A;  3BCB A;  4IJA A;  5F27 A;  4CCM A;  5EEG A;  1O3T A;  3MN2 A;  1CF7 B;  1D0Y A;  1SFK A;  1W36 D;  5IYB J;  3FKJ A;  3SZP A;  2FX0 A;  2IA0 A;  3G1L A;  3M07 A;  4QSH A;  3BT9 A;  3G1O A;  1FC3 A;  2PJP A;  2ZBK A;  4PGH A;  4JYK A;  4YFN F;  3S3N A;  4PCQ A;  5LD2 C;  2IGN A;  2JZY A;  1Z6R A;  4EJO A;  1BC7 C;  2V9V A;  2QEN A;  2ESH A;  4IRG A;  4XN3 A;  4EM2 A;  4DYC A;  4A3G J;  2E1M C;  1ETY A;  2FOK A;  1GVD A;  3GFM A;  4QPO A;  5TIS C;  3L2V A;  1Y39 A;  2IAI A;  3LSM A;  4ITV A;  4WWC A;  4GO1 A;  3C7J A;  2IXS A;  4ZJZ A;  2EZH A;  1JJ6 C;  5DD4 A;  1SD5 A;  4D5F A;  2PG4 A;  4KYW A;  4MQV A;  4B3X A;  1U8B A;  2DA1 A;  3HOU J;  3FXJ A;  4IPA A;  2YUS A;  3BTL A;  1HW5 A;  4JQF A;  4CYD A;  1SVM A;  4YIF A;  5B3S H;  2PI0 A;  4FAS D;  3FK7 A;  3OYA A;  2RRE A;  3BPX A;  2R7Q A;  3K4N A;  4IHX A;  2K85 A;  2DOD A;  2EIL H;  3KE2 A;  3TOB A;  2VPL A;  1AKH B;  1RKT A;  3LA3 A;  3M9A A;  3HPH A;  2Z99 A;  3Q0W A;  4O5V A;  4BHP A;  3FIS A;  2L9N A;  2VQL A;  5J3L A;  1D8J A;  4UV8 A;  1T95 A;  1VQ9 I;  2VKV A;  2PMH A;  4HV6 A;  5IP7 J;  4PJN A;  1Q1H A;  1GLN A;  4XKV A;  5GAG J;  2NS7 A;  1NG7 A;  3PQJ A;  1MDM B;  1J59 A;  2VJ5 A;  2WAF A;  2XB5 A;  2M87 A;  5KK1 A;  3F8F A;  1NK3 P;  4CH7 A;  1S7A A;  2HQR A;  3SDG A;  2HDC A;  1FBS A;  1A31 A;  1ETW A;  2ZNZ A;  3HYI A;  4G12 A;  4HYE A;  5L3G A;  2P0W A;  4Y13 A;  5CVV A;  2QSH X;  4IOA F;  4G7H F;  1ZQ3 P;  4G8X A;  3FDY A;  5CVR A;  2XSD C;  1WJB A;  1O3R A;  1IUF A;  4PFO A;  3S2D J;  3QOD A;  5L3D A;  1IN6 A;  2IA1 A;  3BJO A;  4LGW A;  1F36 A;  2YR2 A;  2VJJ A;  1BI0 A;  4PJ0 C;  2A3S A;  2KZV A;  1TW3 A;  4PFP A;  1IG7 A;  1E2X A;  1Y0U A;  1HXD A;  2OJE D;  1MMA A;  3OS2 A;  2KKO A;  1K4S A;  2GLO A;  3KLO A;  2E2I J;  2CMP A;  4RGR A;  4WXD A;  2VIX A;  4EJW A;  5FRN A;  3QPL A;  3L2U A;  1X2N A;  3E5Q A;  1TWH J;  3MFK A;  4DBQ A;  1HBX G;  4HG2 A;  3ULQ B;  4H0E A;  2CH0 A;  2ELK A;  5EYR A;  3AKZ A;  4BXU A;  4F7Z A;  2BW3 A;  2TRT A;  1XN7 A;  2KLO A;  1UAA A;  4ZZL A;  2P6T A;  4XOT A;  2DOF A;  3ECO A;  5K5O A;  3GUD A;  4OWR B;  1DGR M;  3RYR A;  3ZMS A;  5D5V B;  2A05 A;  1D0Z A;  5DTD A;  3IAS 2;  1BBY A;  3CC2 I;  4CCO A;  3BY6 A;  3HDD A;  1FYK A;  3ESW B;  3H3V K;  3I56 I;  2XGX A;  3L2W A;  3K1M A;  2NS8 A;  4UNO A;  4U7D A;  1X19 A;  3BP8 A;  4KT6 A;  1RUO A;  2B7E A;  3K4J A;  4MEY F;  1ONV A;  2CJJ A;  2DDA A;  5CVJ A;  4ZYA A;  1UG2 A;  3QAH A;  3LA7 A;  4D1Q A;  1V5G A;  3M8F A;  1HC8 A;  3DLA A;  5HDN A;  2YS9 A; 
#chains in the Genus database with same CATH homology
 5A2Q K;  3GX4 X;  2EFN A;  1FBQ A;  1JHF A;  4EGZ A;  2GWR A;  2HYG D;  1KQ0 A;  1PUE E;  1SMY F;  2O0Y A;  1B9M A;  1H9G A;  1K6O A;  2DAO A;  3E6C C;  3WTY C;  5D6E A;  1I6X A;  4G7Z F;  1UHW A;  4LFU A;  2ZME B;  1QQI A;  2CG4 A;  2NYX A;  1TQP A;  3I64 A;  2XAG A;  4ENJ A;  5FB2 A;  1EV7 A;  1LQ1 A;  4CO8 A;  5J6X A;  1Z05 A;  2OZ6 A;  3NEU A;  3RKW A;  2EFQ A;  4FX0 A;  2IW5 A;  3F8M A;  2HGC A;  2ADU A;  3I58 A;  3IHU A;  5FO5 A;  2K27 A;  4A0Z A;  3ZMU A;  2XRN A;  4L9V A;  4B09 A;  1OKR A;  3GLX A;  2RN7 A;  2CFX A;  1CF7 A;  2JTV A;  4RB2 C;  3T8R A;  4OIP F;  1JGS A;  1SFX A;  2F5C A;  1IN7 A;  5E18 F;  3F8N A;  3CUQ C;  1KQ8 A;  3GZ5 A;  3BPV A;  2BEO A;  2FBH A;  3SQN A;  2VE9 A;  1W7P B;  2P4W A;  3SXY A;  5HVQ C;  3CO6 C;  1P92 A;  2XKP A;  1ON1 A;  2GQQ A;  3IRQ A;  1I1G A;  5JR3 A;  3FF5 A;  2HWV A;  2A68 F;  2VBW A;  1FYM A;  5DUK A;  5LBQ A;  2CW0 F;  5HS8 A;  1LEA A;  4EM0 B;  3GFJ A;  2H09 A;  2DQR A;  2HS5 A;  4IF4 A;  2EV5 A;  4LLG F;  1IN5 A;  4LLL A;  1REP C;  4OMY A;  2XV4 S;  4AVP A;  2M45 A;  1MDM A;  1KU9 A;  4HF1 A;  4A5N A;  1LDD A;  3WTZ A;  2YX7 A;  2EJR A;  4HA8 A;  2H6C A;  1QO0 D;  5HLG A;  1IN4 A;  4I0B A;  2K7L A;  5TJJ A;  4EGY A;  3V8L A;  1FX7 A;  4YFX F;  1KU2 A;  3WU0 A;  3TOA A;  4M6Y A;  1FY7 A;  3RDI A;  5FGM A;  1U3E M;  1G3S A;  3QP5 A;  3HRS A;  4UVC A;  1UST A;  2FMY A;  4O6J A;  3VFZ A;  4LD5 A;  1EH6 A;  3RPQ A;  5LGN A;  4OIR F;  3KP4 A;  3H3Z A;  4PZJ A;  3HOT A;  1HSJ A;  3K1N A;  3FZV A;  4HDV A;  1HQC A;  3BDD A;  4HQM A;  2D1H A;  2RQP A;  4PDK A;  1HKQ A;  3HSE A;  1PP8 F;  2Y0M A;  1BIA A;  2O61 A;  4K2E A;  4QWQ A;  3VOD A;  1HKT A;  1ZLJ A;  3ZMD A;  3J80 Z;  1TQI A;  3T1B A;  3KCC A;  3M1E A;  3SFZ A;  3WTS C;  5DCF A;  3RI4 A;  1P4W A;  2XRO A;  4M71 A;  3V7S A;  4Q5S F;  3FMR A;  4MQ9 F;  1ZAR A;  1YW8 A;  4ENM A;  2OQG A;  3NQO A;  3D0S A;  1OYY A;  2PEX A;  1U5T C;  5HS9 A;  4Y15 A;  1YIO A;  1YS6 A;  1FBU A;  2K4B A;  2STW A;  2J5P A;  2XKO A;  4HX8 A;  2MD5 A;  3LA2 A;  2Z33 A;  2W57 A;  3IWZ A;  1DPU A;  1YW7 A;  2ZME A;  2RGV A;  1B59 A;  2L4A A;  4HLY A;  4UVB A;  2M1B A;  4M73 A;  3AAF A;  3COA C;  5D5X B;  2ESN A;  5AIQ A;  1LB2 A;  2KIM A;  3O6B B;  3MWM A;  3ZPL A;  1R5H A;  4LB6 B;  1ZGA A;  1J7K A;  3TO6 A;  4A5M A;  2RKH A;  3U1D A;  3WTT C;  1B4A A;  1R1V A;  3FXQ A;  2FNP A;  1O7F A;  2MH2 A;  3R0J A;  4Q48 A;  1FYL A;  2FBI A;  3Q5F A;  1DPR A;  2RNJ A;  1ZRE A;  4A6D A;  2D45 A;  3HHG A;  1W7P A;  3CDH A;  1ZG5 A;  1FP1 D;  2ISZ A;  1QPM A;  2EA2 A;  1R58 A;  2M5W A;  4G6Q A;  1EH7 A;  5BPI A;  1R36 A;  5DCM B;  1ON2 A;  2EWN A;  2ZO4 A;  4WCG A;  3WGI A;  4YII A;  4YFK F;  1P4A A;  1G3W A;  3REO A;  4Q4Z F;  2ZCW A;  1PP7 U;  1QNT A;  4M9X A;  5J8C A;  2F5E A;  3GW2 A;  3FM3 A;  2IA2 A;  3RJP A;  3MCZ A;  4Y17 A;  1ZG1 A;  1MD0 A;  1ZAO A;  2ELH A;  4ON0 A;  2EV0 A;  1IUY A;  2V1U A;  2AXL A;  4N0B A;  2NRA C;  3JSP A;  2OA4 A;  4UVA A;  1BM9 A;  1LJ9 A;  3CUO A;  3JAM Z;  1DDN A;  4IXA A;  1WWX A;  4RS8 A;  3RKY A;  3FMQ A;  2VC0 A;  5HDK A;  4KIG A;  1IXR C;  4KN4 X;  2E1N A;  2L02 A;  3ZN1 A;  3M7G A;  5FLX Z;  1TW2 A;  1IXS B;  5IT9 Z;  1W7P D;  2W85 A;  1J5Y A;  4R1H A;  3IKT A;  5BPD A;  2M30 A;  3L2C A;  1B6A A;  3LQQ A;  2FE3 A;  2XAS A;  4FHT A;  1VTN C;  5CLS A;  2QYO A;  4G6D A;  3O3K A;  4R8H A;  4EQQ A;  3CLO A;  2KJB A;  5DEQ A;  2BBY A;  3U2R A;  3BZ6 A;  1IRF A;  4AIJ A;  4LK1 F;  4CZZ A;  2GIV A;  1W5T A;  2HKX A;  3L7W A;  3HRU A;  1HKS A;  4ESF A;  1ZHF A;  3ABU A;  4KDP A;  4PGG A;  4WK8 F;  1AOY A;  3HIF A;  3J81 K;  4ESB A;  2PQ8 A;  2MLK A;  4A2U A;  1UFM A;  4ZH4 F;  1JXS A;  1QZY A;  2QVO A;  4WXH A;  4P9F A;  5D4R A;  5BOX A;  3WTU C;  5DD8 A;  2CGP A;  2V1D A;  2G9W A;  3KP7 A;  3P9I A;  3K69 A;  2L3D A;  1HW1 A;  2NAZ A;  3W6J B;  3HSF A;  2XIG A;  1YS7 A;  1SD6 A;  1T39 A;  5EEH A;  2VBY A;  2L54 A;  2EA4 A;  3E6D A;  5AON A;  4ZZD A;  1T0F A;  3CTA A;  2LKP A;  1JHH A;  1TQM A;  1BN5 A;  3FMS A;  5F64 A;  4DQ2 A;  4EVI A;  2QWW A;  2CWE A;  2W24 A;  5E1X A;  1YQA A;  2YU3 A;  1O3S A;  1Z1D A;  1F9N A;  2FBK A;  4RB0 A;  3QPT A;  1DP7 P;  2Y75 A;  2GXB A;  1WRJ A;  4MHG A;  4S04 A;  4M72 A;  3L9F A;  3U9G A;  3WTW C;  2VC1 A;  2A69 F;  1U5T B;  1XDS A;  2HOE A;  2DT5 A;  3I0T A;  4A0X A;  3TO9 A;  4M9S A;  3M8E A;  5IT3 A;  3C1D A;  4KFC A;  2OU2 A;  4L0Y B;  2JSC A;  1ZG3 A;  5ICC A;  2GZW A;  1G3T A;  2PFB A;  5DCM A;  3C3W A;  4MTD A;  2K02 A;  4EMS A;  2QLZ A;  4ASN A;  2VT2 A;  4P96 A;  5HOO A;  2DPU A;  2UXX A;  2KJC A;  2IJL A;  1R7J A;  4A0Y A;  4HX4 A;  2CQK A;  1U8R A;  2E7W A;  2P5L C;  2FXA A;  3DPT A;  3O2P E;  2GA2 A;  4U7B A;  3VOE A;  2G7H A;  1WI9 A;  3GFL A;  2VT3 A;  3S2W A;  1XGS A;  1IF1 A;  2STT A;  3BJ6 A;  1J0R A;  1YTY A;  3FWE A;  3CUQ A;  2VON A;  2MC3 A;  2HZT A;  4EJV A;  3KFW X;  1IAW A;  1WKM A;  4U88 A;  2VE8 A;  3HSR A;  5E17 F;  1F1Z A;  2NNN A;  2HR3 A;  2DPD A;  2LDU A;  4KT5 C;  1KU3 A;  4GYG A;  1Z7U A;  4RGX A;  3B02 A;  1FSH A;  2CSO A;  1ODD A;  3TQN A;  4G9Y A;  1SFU A;  4JK1 X;  3R61 A;  4QLC U;  5L3B A;  3BWG A;  4ENN A;  4UUV A;  1ULY A;  3HRM A;  3QU3 A;  4L5I A;  5H6Q A;  2LNB A;  2H94 A;  4IHT A;  5FD6 A;  5HDG A;  2UWM A;  4OIO F;  1W5S A;  3LST A;  1F4K A;  3DKW A;  4YG2 F;  3LFK A;  1QGP A;  2A07 F;  1LVA A;  4RB3 C;  1ZH5 A;  3HTS B;  3GXO A;  2P6S A;  5LEK A;  5F6F A;  2FML A;  5H20 A;  2A6H F;  4I7H A;  2HQN A;  3W6K B;  1TNS A;  3KET A;  3E3V A;  5A2Q Z;  1STZ A;  2VOD A;  3IRR A;  1GXP A;  3RIR A;  4E70 A;  4L9N A;  3ELK A;  1FWZ A;  2WTE A;  2YX4 A;  4L18 B;  3LAP A;  2PBI A;  4ETS A;  2K4J A;  4XSZ F;  4U0W A;  4EJU A;  3I59 B;  1NHA A;  4OOI A;  3DQV C;  2FA5 A;  2BGC A;  3FXR A;  3KEQ A;  3P7N A;  2QBY B;  1V3F A;  4G94 A;  4N9I A;  2ZJ2 A;  4TV7 A;  2Q0O A;  4KN7 X;  2MBF A;  5E1W A;  1OYW A;  1D8K A;  1UB9 A;  4LJZ F;  3TDZ C;  1D3Y A;  3T5X A;  5DYM A;  3R4K A;  1U5T A;  3RPU A;  5LLQ A;  3QRF F;  2XAF A;  1R1T A;  4XRF A;  2LF7 A;  2QQA A;  3V8K A;  2ZKZ A;  3ROU A;  1EH8 A;  3BJA A;  3Q9S A;  1TNT A;  1KYW A;  3HHH A;  3KP6 A;  1T98 A;  1MJ9 A;  1UHM A;  1PDN C;  1IXC A;  1SD4 A;  1DUX C;  3F8B A;  1XSD A;  1XCV A;  3R60 A;  4RAZ A;  1Z6T A;  1FZP B;  1GVJ A;  2UXN A;  5FFZ A;  4XLP F;  3JW4 A;  4Q47 A;  4A12 A;  3E5U A;  2NS0 A;  3F21 A;  2CO5 A;  4BYY A;  4KMU X;  3CJN A;  3ABT A;  5BMZ A;  4UHT A;  4HOB A;  1YYV A;  1FT9 A;  2DK5 A;  4CIC A;  2A6E F;  1YW9 A;  3KZZ A;  1ZGJ A;  1G6N A;  1CGP A;  1WQ2 A;  1P4X A;  4RAY A;  3FXU A;  4OU0 A;  4IRH A;  5CVU A;  4BHB A;  1T6S A;  2JPC A;  4IRI A;  2R7F A;  2Z5U A;  4XLN F;  1S29 A;  2EB7 A;  5D5W B;  3TO7 A;  1T38 A;  2YPR A;  1RIO H;  2DTR A;  3MAJ A;  4HF2 A;  4I02 A;  3K9T A;  1G3Y A;  5LHG A;  2BV6 A;  2FF4 A;  2HTS A;  3ZN0 A;  2KRF A;  3JSO A;  2XHK A;  5AIP A;  1B1B A;  4WX9 A;  5ERI A;  3L09 A;  1V4R A;  2IP2 A;  2GXG A;  4P5O A;  2FQ3 A;  5ICF A;  3ISP A;  3RKX A;  1F5T A;  4D0P A;  5HLH A;  1L3L A;  1H9T A;  3C18 A;  4P55 A;  5F1R A;  5H6R A;  3GYH X;  3E6B A;  3G73 A;  1FPQ A;  1KGS A;  1RUN A;  1IW7 F;  3R6S A;  5L3C A;  3K2Z A;  5LHI A;  4HX7 A;  2BE5 F;  4WF2 A;  5L3E A;  1I1S A;  2WWY A;  1OYI A;  2R7D A;  5ICG A;  2QM3 A;  1IRG A;  1D5V A;  5CYV A;  4CDG A;  3KZY A;  2LSO A;  3K1P A;  4UXN A;  3L00 A;  1Z91 A;  1SMT A;  2H6B A;  4L9T A;  2PMU A;  5ED4 A;  1XD7 A;  3CUQ B;  5FD5 A;  2GAU A;  2Z9O A;  3ML6 A;  5K1Y A;  3PQK A;  3TDU C;  1YFH A;  1SD7 A;  5CVI A;  1S7O A;  3P9K A;  1G4D A;  4LG0 B;  3F23 A;  2OAZ A;  3I59 A;  2JPB A;  2VOO A;  1Z9C A;  4KA4 A;  2AS5 F;  2EFO A;  4XSX F;  2QBY A;  3KEO A;  4AIH A;  3QU6 A;  4LMY A;  1E17 A;  3GVA A;  1XDU A;  2Q2E A;  3MQ0 A;  1RZ4 A;  5JHU A;  2V79 A;  4B8X A;  1XMK A;  3CO7 C;  4KIF A;  1BI1 A;  5LHH A;  1KA8 A;  3ZMZ A;  1TTY A;  1XGO A;  3WGG A;  4MNU A;  3ZMT A;  3I54 A;  2ZXJ A;  4JBA A;  5CJ9 A;  1YG2 A;  4U0Y A;  3WTX C;  4NHJ A;  1I27 A;  3DF8 A;  4ENK A;  4U0V A;  4KIC A;  2XAQ A;  3F8C A;  1BOA A;  1J9I A;  3EET A;  3V7R A;  4A6E A;  3T0Y A;  1RNL A;  2OQR A;  2JRT A;  2WV0 A;  4CXF A;  3I71 A;  5HLI A;  4S05 A;  2DK8 A;  3ZQ7 A;  4ZYE A;  2E7X A;  4GCV A;  4M9Z A;  3E5X A;  5ILU A;  1BJA A;  3OOP A;  5D8K B;  1YLF A;  2FNA A;  4HDU A;  1IZ1 A;  1S8N A;  4P9U A;  2QZ8 A;  3F72 A;  4AIK A;  1USS A;  2WC2 A;  5D8L B;  1XB4 A;  3JTH A;  2F5D A;  1TLH B;  3DP7 A;  5E8I A;  2K86 A;  5JFR A;  3D5L A;  3RYP A;  2DU9 A;  4RGU A;  4EM1 A;  3LQR A;  2W84 A;  2V6C A;  4BAY A;  3F3X A;  2C6Y A;  2JT1 A;  1K7A A;  2RC4 A;  4CGZ A;  1KQ9 A;  1R1U A;  1AWC A;  5J8F A;  2Y48 A;  3T8T A;  2HEO A;  4OMZ A;  1OMI A;  1BI3 A;  1K78 B;  5ICE A;  2FEZ A;  1UCR A;  3H92 A;  3WE2 A;  2KIU A;  5FFX A;  3V7C A;  3DV8 A;  1IN8 A;  4GGG A;  1O57 A;  2D1V A;  3ZP5 A;  3VB2 A;  1GHC A;  2RDP A;  1FP2 A;  3R0A A;  3V4G A;  2E1C A;  4WXC A;  4XBF A;  3GF2 A;  4AWX B;  3N4M A;  5E1Z B;  1TBX A;  2UZK A;  2DBB A;  2EK5 A;  1GXQ A;  4EV0 A;  4HF0 A;  4I0A A;  3J7A O;  1ZYR F;  2J5O A;  2BYV E;  1U78 A;  4LB5 A;  3J81 Z;  2F5F A;  4FX4 A;  4MGR A;  1K79 A;  1LDK B;  4LK0 F;  2IT0 A;  4IHS A;  4ZYH A;  3J80 K;  4O3M A;  3ZMV A;  3EYY A;  4LG0 A;  1U6G A;  2B0L A;  3E6M A;  5LGT A;  3I5U A;  3PFI A;  2YSR A;  2M8E A;  3G3Z A;  5HS7 A;  1O3Q A;  2PN6 A;  1ZRD A;  3FX3 A;  2TDX A;  3K0L A;  2PLY A;  3DXJ F;  1O7L A;  1S3J A;  2DW4 A;  2VBZ A;  3EQL F;  4L0Z B;  2LF8 A;  4RB1 A;  5LRS A;  3EDP A;  3QPH A;  5LRR A;  1LNW A;  4OIN F;  1XSX A;  4R79 A;  3HRT A;  2O6G E;  3KP2 A;  5JI6 A;  2P5K A;  3P9C A;  3QOP A;  5ILV A;  1SFE A;  1T2K A;  4I98 B;  4MTE A;  2XUB A;  1XGN A;  4ESJ A;  4KUM A;  1XSV A;  4L9J A;  1R00 A;  2ISY A;  2DLL A;  2OZU A;  2Q8K A;  3MZH A;  3DFG A;  5DDG A;  2CYY A;  2MLG A;  3WTV C;  2IVM A;  3WOD F;  4BNC A;  3I4P A;  2HKO A;  4OIQ F;  2OBP A;  2X4H A;  3I53 A;  4HAM A;  1X3U A;  3WGH A;  3EYI A;  1S6L A;  2HTJ A;  2IPQ X;  4KNY A;  2O8X A;  3KP3 A;  2VOP A;  2R3S A;  3ECH A;  1B9N A;  4N9H A;  2IRF G;  1C0W A;  2QQB A;  3SHF A;  4I09 A;  4KIB A;  3HOS A;  5DV5 A;  5L3F A;  2QQ9 A;  2ACJ A;  5D5U B;  2P7C B;  4UV9 A;  3N97 A;  4DNC A;  3KLN A;  2X0L A;  4GYI A;  1LEB A;  2L4M A;  2G7U A;  4BH9 A;  1KYZ A;  4CHU A;  4GXO A;  1BI2 A;  2DQL A;  3TGN A;  4M6X A;  3F22 A;  5E20 A;  4M74 A;  5LEJ A;  1P6R A;  1ZRC A;  1OR7 A;  3WG9 A;  1QBJ A;  3B73 A;  4LLN A;  3IKV A;  1A04 A;  4HW0 A;  1K78 A;  2VXZ A;  4HBL A;  3JAM K;  1WSU A;  5D6F A;  1FNN A;  2XAJ A;  3Q9V A;  4AD9 A;  1KU7 A;  1MJA A;  2VN2 A;  5FLX K;  4FT8 A;  3IC7 A;  3GFI A;  4L5J A;  5IT9 K;  3H3U A;  4I01 A;  4NB5 A;  1R5G A;  1ZN2 A;  3FHZ A;  2MA3 A;  1XCB A;  1HST A;  4BQA A;  4HQE A;  4I2O A;  2ZNY A;  2P7V B;  3IL2 A;  4KMF A;  1OPC A;  3DPL C;  1U2W A;  3F6V A;  4RGS A;  2DI3 A;  1W4M A;  3QP6 A;  3WU1 B;  2O03 A;  1I5Z A;  2RV8 A;  1H0M A;  5ILS A;  2FU4 A;  2VBX A;  3WE3 A;  2EFP A;  2GA1 A;  5KVR A;  3DEU A;  5K5R A;  3OV8 A;  2L01 A;  3LAJ A;  3V8J A;  5D4S A;  2EFW A;  3HUG A;  1ZRF A;  3GEZ A;  2P5V A;  1R22 A;  2FRH A;  1JE8 A;  2F2E A;  1RI7 A;  4ZYG A;  4Z2Y A;  1L0O C;  3IWF A;  1FLI A;  3F6O A;  1J2X A;  1LDJ A;  4NQW A;  1FSE A;  3E97 A;  2D2W A;  1SAX A;  1HW2 A;  5BS6 A;  3LWF A;  4IVN A;  4G7O F;  2A5Y B;  2KIF A;  1FOK A;  1YO5 C;  1MGT A;  2ETH A;  2Z3Y A;  5JVT A;  5BQT A;  1XMA A;  1ZLK A;  2H27 A;  2NNY A;  2DO7 A;  2DFI A;  1BC8 C;  3TKY A;  2XAH A;  2XVC A;  3BOQ A;  2COM A;  3HTU A;  3GWZ A;  3ERE D;  2W25 A;  3BRO A;  1P2F A;  2MH9 A;  5E8G A;  3FM5 A;  1MZB A;  4HZF A;  3GO5 A;  4HLX A;  3JTG A;  3MZY A;  5DUI A;  3MEX A;  3VEP A;  5LGU A;  3KP5 A;  1MKM A;  1MJB A;  3EUH A;  3NRV A;  3SZT A;  3GZ6 A;  5TRD A;  2OD5 A;  4BHC A;  6PAX A;  2V1X A;  4MEX F;  2EV6 A;  1BIB A;  1QZZ A;  3RTR A;  2QUF A;  4HV5 A;  2O3F A;  2ZFW A;  2HYF A;  4EJT A;  1J75 A;  4ZYD A;  2FSW A;  2A61 A;  5K5Q A;  2P8T A;  1XGM A;  2HFH A;  1R23 A;  2RVC A;  4IJA A;  5EEG A;  1O3T A;  1CF7 B;  3SZP A;  2IA0 A;  1FC3 A;  2PJP A;  2ZBK A;  4PGH A;  4YFN F;  4PCQ A;  2JZY A;  1Z6R A;  4EJO A;  1BC7 C;  2V9V A;  2QEN A;  2ESH A;  4IRG A;  4EM2 A;  2FOK A;  3GFM A;  4WWC A;  4GO1 A;  3C7J A;  5DD4 A;  1SD5 A;  2PG4 A;  4KYW A;  4MQV A;  4IPA A;  1HW5 A;  4JQF A;  4CYD A;  4YIF A;  2PI0 A;  3BPX A;  3KE2 A;  3TOB A;  3LA3 A;  3M9A A;  2Z99 A;  4O5V A;  4BHP A;  1D8J A;  4UV8 A;  2PMH A;  4HV6 A;  1Q1H A;  3PQJ A;  1MDM B;  1J59 A;  2M87 A;  5KK1 A;  3F8F A;  1S7A A;  2HQR A;  2HDC A;  1FBS A;  2ZNZ A;  3HYI A;  4HYE A;  5L3G A;  4Y13 A;  5CVV A;  4G7H F;  4G8X A;  5CVR A;  1O3R A;  5L3D A;  1IN6 A;  2IA1 A;  3BJO A;  4LGW A;  2YR2 A;  1BI0 A;  2A3S A;  1TW3 A;  1E2X A;  1Y0U A;  1HXD A;  2KKO A;  3KLO A;  4RGR A;  4WXD A;  4EJW A;  3E5Q A;  3MFK A;  1HBX G;  3ULQ B;  4H0E A;  4BXU A;  4F7Z A;  1XN7 A;  4ZZL A;  2P6T A;  3ECO A;  5K5O A;  3GUD A;  3RYR A;  3ZMS A;  5D5V B;  1BBY A;  3BY6 A;  1FYK A;  2XGX A;  3K1M A;  4UNO A;  4U7D A;  3BP8 A;  1RUO A;  4MEY F;  1ONV A;  5CVJ A;  3QAH A;  3LA7 A;  3M8F A;  5HDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...