4AIJA

Crystal structure of rova from yersinia in complex with a rova promoter fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aijA00
3F22A 4U0YA 3ELKA 4BHCA 3G73A 2RKHA 1E17A 1I5ZA 5D8LB 3CTAA 3BOQA 5HS9A 4EJUA 2M45A 3HRMA 2VE8A 1FP1D 1B9NA 3GFLA 5HLIA 2HKXA 1DDNA 1YW7A 1LB2A 3GF2A 1HKQA 2UZKA 3OOPA 3MCZA 1YO5C 4EJTA 2LKPA 2YU3A 4JQFA 3PQKA 4WF2A 5LGNA 2Z5UA 2MBFA 4EMSA 4ZYEA 2KIMA 3ROUA 4A6DA 3ZMUA 4ZZDA 2J5OA 4EV0A 3M7GA 3HYIA 1QZZA 1H9GA 3I64A 3MQ0A 5AIPA 4EJVA 3GO5A 4N9HA 1T38A 2O3FA 3SQNA 1LVAA 4UV9A 2ZBKA 3QRFF 1R1TA 2GZWA 3GVAA 2A6HF 3KLNA 3DF8A 4HF2A 3GFIA 5EEHA 1XSDA 2IA1A 1D8JA 1P4AA 4HDUA 1YS7A 2D1HA 4PGGA 4BNCA 1QQIA 4KIFA 1R7JA 1IZ1A 1FYMA 5FFZA 5FB2A 4M9SA 1XB4A 3DEUA 4RS8A 2FU4A 3FHZA 2H27A 4LK1F 1SFUA 3K0LA 4KYWA 4LK0F 1DUXC 2P5KA 3DFGA 5AONA 3KE2A 3H92A 2Z33A 1G4DA 4M6YA 5HLGA 3P9CA 4BH9A 4M74A 2P7VB 2NNNA 2RQPA 3O6BB 1R00A 4JK1X 1F9NA 3QOPA 2F2EA 5D4RA 2OZUA 3WE2A 1OMIA 3L7WA 1I1GA 4ZYGA 1WRJA 1K6OA 3HSFA 3F23A 1B4AA 1SFEA 5FLXZ 4IRIA 3VOEA 4I01A 3Q9SA 2UWMA 4I0BA 3N97A 2XAFA 3CUQB 3ZQ7A 3FXRA 3RTRA 2PFBA 4ESBA 1ZAOA 1KQ9A 5BPIA 1O7FA 1LDJA 1O3QA 4GCVA 1S6LA 2PN6A 2RN7A 2R7FA 5LRRA 3G3ZA 5FLXK 5DV5A 4MEXF 5HDKA 4L5IA 1U5TB 2EV6A 2OBPA 2A3SA 1R5GA 3FM5A 2OZ6A 2A6EF 2NS0A 2LF7A 4ENMA 2MLGA 3KP4A 2QUFA 3O3KA 1YW9A 2Q2EA 3E5QA 1LJ9A 3BPVA 1ODDA 5JI6A 1Z05A 1VTNC 1YW8A 3V8KA 4Y17A 3V4GA 3BDDA 2QZ8A 4OMZA 3C7JA 3FZVA 5JR3A 3WTTC 4ESFA 1OYIA 1IRFA 4WXCA 4HQEA 2Q8KA 2QLZA 4G7OF 5ICCA 2CGPA 4OU0A 3RYPA 4IHSA 2FBIA 4RB1A 4BHBA 1QPMA 3Q5FA 1GXQA 3MZHA 4RGXA 2DT5A 3IHUA 3KEQA 3C18A 2R3SA 4DQ2A 3DQVC 4LJZF 3F6VA 5DCMA 4BAYA 4HAMA 2H09A 3LFKA 2EFNA 4OMYA 4CHUA 2ZO4A 1MDMB 4IJAA 1S7AA 4HBLA 2HFHA 2OQRA 4LG0A 1IUYA 2GA2A 1UHMA 1SAXA 1OKRA 2ZNZA 3V7CA 4ENKA 3DKWA 5H20A 1KYWA 4UV8A 2CSOA 5JFRA 2DI3A 5IT9Z 1R36A 1XMKA 2VODA 4MQ9F 1XCVA 5LBQA 3J80Z 1A04A 4HX4A 4RB2C 1IN4A 2IA2A 2BBYA 2FSWA 1YYVA 1P2FA 5HS8A 4MGRA 1KU7A 4BHPA 1ZRCA 1SMYF 1U5TC 3IWFA 3K1NA 1XDSA 1T0FA 3CUQC 1GVJA 2HDCA 4KNYA 3QU3A 2UXNA 4KUMA 4ZYHA 1O3RA 4EM2A 1QBJA 1KA8A 3P7NA 4HV6A 4L5JA 1SD6A 4LLGF 4FX4A 5H6RA 3CO7C 5EEGA 1MKMA 2OD5A 3FWEA 3T8TA 5E17F 1UHWA 3F8NA 2NYXA 1CF7A 4MHGA 2ESNA 2W84A 1S3JA 2P5LC 1O57A 1KU9A 4CZZA 2E7XA 5AIQA 3E6CC 1HW2A 1T39A 1FP2A 1B6AA 2M8EA 3ERED 3BJAA 4I98B 4DNCA 4O5VA 3WU1B 3FXQA 1E2XA 1S8NA 1LEBA 4CGZA 2VC0A 3I58A 1K7AA 2YPRA 4S05A 1IN8A 2JPBA 3BROA 3GYHX 3JW4A 4G6QA 3P9IA 2PEXA 2RGVA 2ZMEB 2BE5F 3TDZC 1SD7A 3M1EA 2OQGA 1XSXA 2HGCA 4FT8A 4A0XA 1TQMA 4AWXB 1O7LA 1HQCA 4YFXF 1W5TA 2V1DA 2LDUA 2QVOA 3M8EA 2EB7A 1BC8C 3J81K 2EWNA 1B59A 3M8FA 2WTEA 4KT5C 3LQRA 3GZ6A 1RUOA 2ESHA 4ASNA 2BGCA 3T8RA 3U2RA 5CJ9A 2P4WA 5CVVA 1DPRA 3V7RA 4A12A 4RGUA 3WTVC 4HYEA 3JTGA 1BOAA 2FRHA 4N9IA 2PI0A 1XGOA 2KJCA 2GA1A 4P9UA 5BMZA 5J8CA 3I0TA 2YX4A 1JXSA 5KVRA 4G7ZF 2HQNA 1EH7A 1CF7B 2MD5A 5HDGA 4B09A 4AIHA 4EQQA 1I6XA 1Y0UA 2PMHA 1FZPB 3FMSA 3GFJA 2QQBA 3DXJF 3E5UA 4AD9A 1J5YA 2KIFA 2DPUA 1TQPA 5LHIA 5DD4A 1FNNA 2QQAA 2D2WA 4A5NA 2ZJ2A 1FC3A 2MH2A 3SZPA 4YIFA 4Q48A 1MJAA 1O3TA 1LDKB 4HLYA 2H6BA 2GXGA 3HIFA 1B1BA 2VC1A 5D5WB 1RZ4A 4UNOA 4F7ZA 3QP6A 1ZG3A 2DQRA 4GXOA 3IRQA 2IP2A 2BYVE 4RB0A 1ZHFA 1D8KA 1XN7A 2Y0MA 4I02A 3R60A 3PFIA 2VT3A 3L9FA 1BM9A 1HKSA 3HSEA 3MAJA 5JHUA 1J0RA 3F8MA 2PJPA 1U8RA 2EK5A 2VBXA 4NQWA 2OAZA 3HRSA 1FOKA 3I59A 1BJAA 4A0ZA 1FBUA 1FYKA 1STZA 3HOTA 1FWZA 4LG0B 3LA3A 2COMA 2O8XA 1BI2A 2FE3A 2C6YA 5L3EA 1I27A 1F1ZA 1T98A 3IKVA 4R1HA 2HTJA 4E70A 2XKPA 2F5FA 1OPCA 3HUGA 1TW2A 5L3DA 2FXAA 1BIBA 1HXDA 1IXRC 2CQKA 4AVPA 5D5UB 4WX9A 4IVNA 1IRGA 1P6RA 2J5PA 1BI1A 1B9MA 1L0OC 3WTZA 5HVQC 4OIQF 2FBKA 2L01A 2XHKA 3RKXA 2IPQX 4EVIA 4B8XA 3P9KA 1DPUA 4YG2F 2HYFA 2FBHA 3QPTA 3E6BA 3BY6A 5DCFA 4L18B 4P96A 2XASA 3JAMK 3KP3A 5E1ZB 2FF4A 2WC2A 4ENNA 4IXAA 1Z9CA 2DO7A 2HEOA 1XGSA 3KP6A 3MWMA 2OA4A 5E8GA 3KFWX 3RKYA 3ISPA 5K5QA 1IW7F 1Q1HA 4GO1A 5LGTA 2W24A 3ECHA 1SFXA 3V7SA 4CDGA 3RYRA 1V3FA 4M6XA 2P6TA 1MD0A 1XMAA 4EM0B 3I71A 2D1VA 3KP2A 1J9IA 5E8IA 1ZN2A 2AS5F 4IRGA 2GQQA 2DAOA 4HX8A 1IXCA 1WQ2A 3SFZA 3ZN1A 1YG2A 1XGMA 4L9JA 2RNJA 5K1YA 1R22A 4KN4X 4KFCA 2QENA 2STTA 2B0LA 2EV0A 4G9YA 1H0MA 1QGPA 1HSTA 2IRFG 2V9VA 1REPC 3OV8A 1WKMA 3L09A 5JVTA 4Y15A 3WTXC 2Z99A 3QU6A 2XIGA 2Y75A 3EETA 2XUBA 4IRHA 1R1VA 1HSJA 5E1XA 3LA2A 4EJWA 2HWVA 3K2ZA 3RKWA 2FQ3A 4QLCU 3TO9A 2DQLA 1MDMA 1SD4A 2K02A 3WG9A 2KKOA 1IN6A 1L3LA 1NHAA 3VFZA 1U6GA 4WWCA 4XLPF 5KK1A 4IF4A 3VEPA 1J59A 4OIOF 2K4BA 4MTDA 5A2QK 4FHTA 2IVMA 2VONA 2FNAA 4L9TA 3E6DA 5IT9K 5FD6A 1P92A 2M1BA 1YQAA 1ZRFA 1YLFA 5D5VB 4RB3C 2D45A 3K69A 4ZZLA 2GIVA 3NRVA 5L3BA 4L0YB 5H6QA 3PQJA 5DD8A 2K27A 4M72A 1FT9A 2R7DA 4RGRA 3GXOA 3U1DA 3ZN0A 2EFPA 2HR3A 1PP8F 2A5YB 2ELHA 4R79A 4BQAA 1U5TA 3D0SA 2ZNYA 4LMYA 2NAZA 1ZGJA 5BPDA 1R1UA 1Z6RA 4KMUX 2MA3A 2EV5A 5ILVA 1ON1A 3BZ6A 2WV0A 1T6SA 1PDNC 1G3YA 1G3TA 1ZG5A 2FOKA 4FX0A 5IT3A 2QQ9A 4HZFA 4D0PA 2VXZA 4HLXA 3ZP5A 2ZXJA 4I0AA 3JSOA 5ICEA 2DW4A 4LFUA 3WE3A 1F5TA 3TGNA 3GX4X 2GXBA 3IRRA 1MJBA 1ZH5A 1RI7A 1FSHA 2HYGD 3JSPA 2F5CA 1ZLJA 3GW2A 2JT1A 4L9NA 5F6FA 3FF5A 2K7LA 2XKOA 1FY7A 2MC3A 4TV7A 4BYYA 2XAQA 2JPCA 5E20A 2P5VA 4M71A 2M30A 3E5XA 1TTYA 3TO7A 5CVUA 3QP5A 5BOXA 1BI3A 4OOIA 3KP7A 3ULQB 3DP7A 1O3SA 2XGXA 2XROA 2ETHA 2PQ8A 4L9VA 4XSZF 5K5OA 1P4WA 2M5WA 1IXSB 2HKOA 2X0LA 1Z7UA 1FX7A 2RVCA 2PBIA 1KYZA 3F21A 3C1DA 2KRFA 5ILUA 4RAZA 2XAHA 2A68F 1BC7C 1UB9A 2F5DA 3I54A 5LHHA 4S04A 4P9FA 3WU0A 2A61A 1Z6TA 3ZMVA 2VOOA 1R5HA 3ZPLA 3KLOA 4LGWA 4AIKA 4G94A 2DU9A 1KU3A 1EH6A 3WGGA 1W4MA 1FBSA 4XSXF 1YS6A 2PMUA 3TKYA 3I53A 4KMFA 2NNYA 2PG4A 2CYYA 4HQMA 1UFMA 2E1NA 4EGYA 3WTWC 3I59B 1W5SA 4WXHA 3HTSB 2UXXA 4I09A 3CUQA 5L3GA 1YTYA 4WCGA 3I5UA 4OIRF 3HSRA 5LEKA 4LD5A 4GGGA 4M9XA 3R4KA 2IT0A 2ZKZA 2JTVA 4CO8A 4LB5A 1AOYA 4I7HA 3W6JB 1MZBA 5E18F 4RGSA 3RI4A 4MNUA 4EGZA 3KETA 3RDIA 2CWEA 1ZGAA 4Q5SF 3T5XA 2RC4A 3DV8A 5FD5A 2V6CA 4A6EA 3W6KB 3ZMZA 3J7AO 4P5OA 4XLNF 2G7HA 3TOBA 3KEOA 3GWZA 3SHFA 1TW3A 1USSA 2CFXA 1HW1A 5ICFA 4HOBA 1EV7A 4Q47A 4ENJA 2YR2A 4RAYA 2NRAC 1KQ0A 4YIIA 3GUDA 3CUOA 3U9GA 3AAFA 1P4XA 3JTHA 1I1SA 3HHHA 1PUEE 4Q4ZF 5BS6A 3KCCA 3K9TA 2CG4A 2ISYA 4L0ZB 2EA2A 2O0YA 2BV6A 3N4MA 3FX3A 1ZYRF 3I4PA 3LSTA 2DPDA 5CVJA 4U7DA 3EYYA 3NQOA 4N0BA 2HZTA 4PCQA 2JRTA 1ZARA 4PZJA 2E1CA 2ISZA 2DFIA 2ACJA 1T2KA 2A69F 1TBXA 2X4HA 3EQLF 2HOEA 1K79A 4XRFA 3IL2A 4UXNA 1LQ1A 2VN2A 3K1MA 2XV4S 1W7PB 2EFOA 1TNTA 1RUNA 1S7OA 4CICA 3WTSC 5CLSA 4YFNF 5E1WA 2CO5A 2BEOA 5TJJA 1FYLA 2KJBA 1UCRA 4G6DA 1GHCA 1X3UA 4AIJA 4LLLA 3TDUC 3J80K 5BQTA 5D8KB 4HW0A 1W7PD 3VB2A 2LF8A 4YFKF 3MFKA 1YFHA 1HW5A 4HV5A 1Z91A 4UVAA 3CJNA 3VODA 2EFQA 4UVCA 1XDUA 5K5RA 3V8JA 1ZREA 4IPAA 1JHFA 5CVRA 3REOA 2STWA 3BJOA 2VBZA 2DTRA 1F4KA 3FMRA 2EJRA 2XAGA 4ON0A 1D3YA 2VT2A 5DCMB 3ECOA 5FGMA 2P6SA 5HS7A 2XAJA 4KN7X 4U0VA 1WWXA 1ON2A 2K86A 3E6MA 4WXDA 5CYVA 3T1BA 1DP7P 2G7UA 4HX7A 3BPXA 3IC7A 2HS5A 1QNTA 4KA4A 1JGSA 5CVIA 3WGHA 3F3XA 1XD7A 2VBWA 5ERIA 4PDKA 2DK8A 3L00A 2LNBA 1LNWA 3F8FA 3BJ6A 4NHJA 3R0AA 4O6JA 3F72A 3BP8A 4GYGA 3B02A 2IW5A 1U2WA 4I2OA 2JSCA 3ABTA 3WGIA 4G7HF 4LLNA 5DUKA 4M73A 2ZFWA 4LB6B 1W7PA 5J8FA 2G9WA 3E3VA 1LEAA 4UHTA 3TOAA 1ULYA 3C3WA 3F6OA 1ZRDA 2K4JA 2MH9A 4WK8F 2O61A 1J2XA 5F1RA 1ZG1A 2A07F 2W25A 3CLOA 3SXYA 1U3EM 1R23A 2Z9OA 4HDVA 4EJOA 4U88A 5TRDA 4UUVA 3HTUA 1EH8A 3H3ZA 6PAXA 1YIOA 4Z2YA 1Z1DA 1CGPA 2JZYA 4HF1A 4P55A 4R8HA 1RIOH 3RPQA 3HRUA 2HQRA 1G3SA 2L4AA 5FO5A 1OR7A 3GLXA 2VBYA 3J81Z 1GXPA 2QM3A 2P7CB 1SD5A 3F8BA 5A2QZ 2RDPA 2DLLA 2XVCA 4M9ZA 5F64A 5FFXA 1HKTA 4QWQA 4MTEA 1BIAA 2ADUA 5LHGA 1OYYA 3E97A 1S29A 2QWWA 1ONVA 2TDXA 4ESJA 1H9TA 3RJPA 1BI0A 2L54A 2KIUA 3LAJA 3CDHA 3ZMSA 2ZCWA 5ED4A 1V4RA 2Z3YA 3SZTA 3H3UA 1PP7U 1HBXG 2FA5A 1AWCA 4OIPF 2HTSA 3R0JA 1QZYA 2V1XA 3WODF 2QYOA 4JBAA 3ABUA 4O3MA 4KICA 2Y48A 4H0EA 3GFMA 1JE8A 1USTA 3KZYA 1D5VA 3WTUC 4IHTA 3EDPA 1G3WA 2GWRA 5J6XA 3MZYA 4NB5A 3BWGA 2EFWA 1FSEA 3ZMTA 2VOPA 2QBYA 1OYWA 1KGSA 2PLYA 3R6SA 4HA8A 3WTYC 1BN5A 1MGTA 4ZH4F 5ICGA 3QPHA 5D6EA 2H94A 3COAC 2QBYB 2W85A 3DPLC 2GAUA 4CXFA 2YX7A 1XGNA 1TQIA 3HHGA 3HRTA 4CYDA 1FPQA 4HF0A 1IF1A 3KZZA 5LGUA 2Q0OA 3FM3A 1RNLA 4EM1A 5HLHA 1QO0D 2E7WA 4OINF 4KIBA 2L02A 4A0YA 3F8CA 2O6GE 2O03A 4BXUA 4K2EA 2IA0A 1G6NA 5ILSA 1KQ8A 2WWYA 1IN7A 2L3DA 5HOOA 1J75A 3B73A 4ZYDA 3L2CA 4PGHA 5DYMA 1K78B 5LLQA 3HOSA 4A5MA 3LAPA 5D6FA 2IJLA 5DDGA 3LWFA 2OU2A 3M9AA 1K78A 3R61A 2FNPA 1FLIA 3LQQA 2EA4A 5L3CA 1WI9A 3KP5A 4A2UA 2W57A 5L3FA 3GZ5A 3JAMZ 3MEXA 5DEQA 4KIGA 2CW0F 4G8XA 1TLHB 2LSOA 4MQVA 1U78A 3NEUA 3DPTA 1KU2A 5D4SA 4U7BA 3LA7A 3FMQA 1J7KA 2FEZA 2M87A 5LEJA 4U0WA 4ETSA 2H6CA 1BBYA 4GYIA 1R58A 4Y13A 1TNSA 3D5LA 3EYIA 2YSRA 5HDNA 2RV8A 5D5XB 3IKTA 2VE9A 3K1PA 2DBBA 3TO6A 4XBFA 1XSVA 1WSUA 4KDPA 1SMTA 4MEYF 1ZLKA 2L4MA 3RIRA 5DUIA 2V79A 1LDDA 1MJ9A 2V1UA 2P8TA 3GEZA 4UVBA 1IAWA 1XCBA 2AXLA 3V8LA 1C0WA 3FXUA 3T0YA 3Q9VA 3QAHA 3IWZA 2DK5A 3ML6A 3RPUA 2FMLA 3CO6C 3TQNA 5LRSA 1IN5A 1JHHA 3ZMDA 2XRNA 3EUHA 2MLKA 2F5EA 3S2WA 2FMYA 3O2PE 1FBQA 2ZMEA
chains in the Genus database with same CATH superfamily
2DA3A 2UV1A 3F22A 2BXZA 1AA7A 2CS3A 5GTIC 2DA1A 2P81A 4U0YA 3ELKA 4BHCA 2XPVA 3G73A 1VQ4I 2RKHA 3CJTB 3VYRB 1I5ZA 1E17A 5D8LB 5K7FA 3G1OA 3CTAA 4A3CJ 3BOQA 1DGWY 3PFYA 5HS9A 4EJUA 2LOOA 1MMAA 3BTIA 2M45A 3HRMA 2VE8A 1FP1D 1X2MA 1B9NA 3GFLA 3L2WA 4M3BA 1ETYA 5HLIA 3L1PA 2DMNA 2MW8A 3OYKA 2HKXA 4D5FA 1DDNA 1YW7A 1LB2A 1ZTRA 3GF2A 2EILH 3CP8A 3LSIA 4PK4A 3BR1A 3M8JA 1HKQA 2UZKA 1N77A 3OOPA 2YUSA 3MCZA 3JR9A 1TT5B 1YO5C 3K6GA 4EJTA 2LKPA 3V42A 3RKQA 2YU3A 3LFUA 4JQFA 4A3LJ 3DEWA 3PQKA 3TBIA 4WF2A 2LR8A 5LGNA 4DW6A 2Z5UA 1T8IA 2MBFA 2WY7Q 4EMSA 4E7IA 4ZYEA 3FHNA 2DT7B 2VL8A 1VZ0A 2KIMA 3ROUA 4A6DA 3ZMUA 4ZZDA 2J5OA 3C2HA 2QSHX 4AYBA 1I3QJ 4EV0A 3M7GA 3HYIA 4F91B 1QZZA 2CW8A 4RA2A 1H9GA 5EF6A 3I64A 2D5VA 3MQ0A 5AIPA 5C3EJ 4EJVA 3GO5A 2DDBA 3A1YA 4N9HA 1T38A 2O3FA 3AFHA 2R93J 3SQNA 2R7ZJ 1LVAA 1BR4A 4UV9A 2ZBKA 4BE2A 3OYAA 3QRFF 1R1TA 2GZWA 4F52A 2BY3A 3DBRB 2LKXA 3GVAA 2A6HF 3QOEA 3KLNA 2DJNA 2IS2A 4LIVA 1ZQ3P 3E1SA 4BU2A 3DF8A 4HF2A 3QPSA 1V5FA 3GFIA 4QTRA 5EEHA 1XSDA 2KDOA 2IA1A 1MW7A 1D8JA 2ELKA 2VKEA 3L2QA 1P4AA 4HDUA 2N8GA 3KYCB 3H35A 1YS7A 2D1HA 4PGGA 3D1NI 2HDDA 4BNCA 1QQIA 4GRIA 1X1DA 3I9V2 4LG3A 4KIFA 1R7JA 2MC4A 4A3FJ 5DM6F 4Y7NJ 3PNTA 1IZ1A 1FYMA 2IS6A 3OIQA 2CV2A 5J1YA 5FFZA 5FB2A 3RSNA 4M9SA 1ACIA 1XB4A 3DEUA 4RS8A 5EDNA 2FU4A 3FHZA 2H27A 4LK1F 4CYCA 1SFUA 3K0LA 4KYWA 5FKOA 4LK0F 4LIUA 4IOCF 1DUXC 4UUTA 2P5KA 3DFGA 5AONA 3KE2A 1R4NB 3H92A 2Z33A 1E3PA 3K70D 4M6YA 1G4DA 3KYLA 2E1MC 5HLGA 3P9CA 4XNFA 4BH9A 4M74A 4Z6YA 2P7VB 1POGA 2NNNA 2RQPA 4E6KG 3O6BB 1YITI 1R00A 4JK1X 1I3AA 1BJZA 1F9NA 3QOPA 4C3HJ 2F2EA 5D4RA 2L9VA 2OZUA 4XKVA 3WE2A 1OMIA 3L7WA 1I1GA 4ZYGA 4JYKA 4X1EA 5GAEJ 1MBJA 5HNFA 1WRJA 2OTLI 1K6OA 3IP4B 3HSFA 2XSDC 3F23A 3CCUI 1B4AA 2OPTA 5KCMA 4XONA 1SFEA 5FLXZ 4IRIA 3VOEA 5F08A 4I01A 3SEQA 3Q9SA 1CQTA 2UWMA 2QKLB 4I0BA 1QHHD 3CUQB 2XAFA 3N97A 3M3YJ 3ZQ7A 3FXRA 3RTRA 4D7NA 4YIRX 3OYLA 1I50J 1NH3A 2EZHA 2PFBA 4ESBA 3OS0A 1W0UA 1ZAOA 2M0CA 2DMTA 2DMUA 1KQ9A 3A01B 1O7FA 5BPIA 4PJJA 1LDJA 4IHYA 2OTJI 3J7AY 1O3QA 1VQ8I 4GCVA 1S6LA 1RC9A 4XK4A 2PN6A 1O4XA 2BW3A 1RR8C 2R7UA 2BY1A 2RN7A 4XLHA 5DTDA 2R7FA 5LRRA 4HG2A 3G3ZA 1X4PA 4JX4A 5FLXK 4C3JJ 5F0FA 4C3IJ 3DBLB 5DV5A 4AU7A 3ZCOA 4MEXF 5HDKA 4L5IA 1U5TB 2EV6A 3TW7A 5JHFA 2OBPA 2CRGA 3CESA 2A3SA 3C2BA 4E4HA 4CCKA 1R5GA 2Y0SN 5B1BH 1JJ8C 3FM5A 2OZ6A 1LVKA 2A6EF 2NS0A 4NQWB 2LF7A 4ENMA 2EIJH 2WV1A 1U0JA 2MLGA 4HSRA 3KP4A 2QUFA 1M1EB 1OR7C 3O3KA 1ORKA 1W36C 1ZKGA 3PNYA 3WHCA 1YW9A 2Q2EA 2I10A 3E5QA 4CCJA 1ZELA 1B8IA 1LJ9A 3BPVA 1ODDA 5JI6A 1Z05A 1P9QC 1VTNC 2K9QA 1YW8A 2Q2EB 1W0TA 3V8KA 4Y17A 4I99C 3V4GA 3K4KA 3BDDA 2QZ8A 4OMZA 4XN3A 5KHDA 2LFBA 3C7JA 2LP0A 3FZVA 5JR3A 4E7JA 3WTTC 4ESFA 1OYIA 4M3FA 1IRFA 4WXCA 4HQEA 2Q8KA 2QLZA 2G0EA 4G7OF 5ICCA 1MSEC 2CGPA 4OU0A 3FXMA 1WJCA 4RM3A 3RYPA 4IHSA 1PUFA 3MVPA 4IL6C 3TP0A 5FJ8J 2FBIA 4RB1A 4BHBA 1JUMA 2LKSA 1QPMA 3Q5FA 5IP6A 1GXQA 3MZHA 1WH5A 4RGXA 2DODA 2DT5A 3IHUA 2X6XA 5E3LA 1T08B 3KEQA 3HUGB 3ABKH 3C18A 2XSJC 3H36A 4B3XA 2R3SA 1FTTA 3PIOF 2HNHA 4DQ2A 3DQVC 4XKWA 4LJZF 1BOBA 3F6VA 3VYSB 4ZDOA 1NTCA 5DCMA 4BAYA 4B48A 4HAMA 1P7IA 2H09A 2XC7A 3BR6A 3LFKA 4F92B 2EFNA 3D5RC 4N4OB 2NOJB 1VQ5I 3RZOJ 2KMUA 4OMYA 4OWRB 4EATA 4CHUA 2ZO4A 3OYGA 1MDMB 2X6YA 3JRFA 2HVSA 4IJAA 1S7AA 1YJNI 1BA5A 3PSIA 1XX5A 4HBLA 2HFHA 2OQRA 4LG0A 1IUYA 2GA2A 1UHMA 5C4JJ 1IJWC 1Q1VA 2Y9YA 2ZSIB 1SAXA 2Y2ZA 4QIWN 4XRMA 1APLC 1OKRA 5EGOA 1SVOA 2ZNZA 3V7CA 4ENKA 3DKWA 1ETXA 5H20A 1JTYA 3ZRGA 4B1RA 4BACA 1KYWA 2KISA 3BC8A 3H3VK 2X51A 5J40A 4UV8A 3G6EI 2CSOA 5JFRA 4C2MJ 4W1UA 2DI3A 5IT9Z 1R36A 1XMKA 2VODA 2Y69H 1IRZA 3PUBA 4MQ9F 1XCVA 5LBQA 3LSHA 3J80Z 1A04A 2PMZN 2E5NA 4HX4A 3S3OA 4BY1J 4RB2C 1IN4A 3HOVJ 2IA2A 3QPLA 2K3PA 4CSWA 2BBYA 2FSWA 3H0GJ 1YYVA 1P2FA 5HS8A 3AG1H 4MGRA 1IV6A 1KU7A 4BHPA 1ZRCA 1SMYF 1U5TC 4M3GA 4NC7A 3IWFA 3K1NA 2DYRH 1XDSA 1T0FA 3CUQC 1GVJA 2HDCA 2R0QC 4KNYA 2TCTA 3OL4A 3QU3A 4JOMA 1VI0A 2UXNA 4B4CA 1OFCX 5H2FC 4KUMA 3OYIA 4ZYHA 3BQZA 3WU2C 1D0XA 1O3RA 4EM2A 1QBJA 2JA8J 1KA8A 3P7NA 4B3AA 4HV6A 1JTXA 2VKHA 1ENHA 3OYNA 2M4GA 4L5JA 3OY9A 1SD6A 4LLGF 1Y39A 2IS1A 2L9RA 1Z77A 4FX4A 4XKBA 5H6RA 5EEGA 3CO7C 1MKMA 2OD5A 3FWEA 3T8TA 5E17F 1UHWA 3VYTB 4HNUA 1SVLA 3F8NA 2NYXA 1CF7A 3FK7A 4MHGA 2ESNA 3GTPJ 3HC7A 2W84A 4PSWA 1T95A 4ZC3A 1S3JA 2AXTC 2JK3A 3K2AA 1O57A 3KPHA 2LBFB 3CCJI 2P5LC 1KU9A 4E7KA 1YJ9I 3O8HA 4CZZA 2E7XA 2KP6A 4BE0A 3MD2A 1MH4A 3NAUA 1FJLA 2H8RA 5AIQA 2L0KA 3E6CC 1UAAA 1HW2A 1T39A 1WPKA 1FP2A 2VLAA 1B6AA 2WAQA 2M8EA 3ERED 4A3IJ 3BJAA 5F0CA 4I98B 4DNCA 2XF7A 4O5VA 3WU1B 3FXQA 1E0EA 4BEHA 1E2XA 1S8NA 1LEBA 2E19A 2V26A 2ME0A 4CGZA 2VC0A 5B66C 1MNDA 1Z67A 3GTLJ 3I58A 2BOLA 5FKMA 4C2TA 1K7AA 1T56A 2YPRA 4S05A 1IN8A 3RQ4A 2JPBA 3DKYA 3AL0B 2JSPA 3BROA 3GYHX 2R7SA 2CQXA 3JW4A 4G6QA 3P9IA 2CQQA 2PEXA 2RGVA 4RMNA 2ZMEB 2BE5F 3W2AA 5F0HA 3TDZC 3FXJA 1SD7A 3M1EA 4CH7A 2F5VA 2OQGA 1XSXA 2HGCA 4FT8A 1SFOJ 4A0XA 2BHZA 1TQMA 4AWXB 1O7LA 1HQCA 2LYCA 5GAHJ 1WGXA 4YFXF 1WJAA 1W5TA 2V1DA 3QYBA 2LDUA 2QVOA 2V4JC 3K70C 1ZK8A 3M8EA 2EB7A 3ASOH 4F93B 3S3NA 2CUEA 1BC8C 3J81K 1X1BA 2EWNA 1B59A 3M8FA 2F48A 2WTEA 3HGYA 4KT5C 4ANJA 3LQRA 3GZ6A 3RQIA 2GOMA 3CCLI 2ESHA 1RUOA 4ASNA 1U8BA 2BGCA 2LH9A 3T8RA 1WJEA 4BE1A 3U2RA 5CJ9A 1TP4A 2DN0A 2P4WA 2WB1N 5CVVA 1DPRA 3V7RA 4A12A 4RGUA 5HODA 1U9NA 3WTVC 3DPUA 4BQOA 4HYEA 3JTGA 1BOAA 4B44A 2E1OA 2FRHA 1MMSA 3HB9A 1TWCJ 4OAZA 4N9IA 4Y3OA 5EYRA 2PI0A 5IP7J 4V2GA 1XGOA 4C2UA 9ANTA 4IKFA 2KJCA 2GA1A 4P9UA 5BMZA 3ZXSA 5IYDJ 3K10A 2IEKA 4BJ5C 5J8CA 3S2DJ 3S8PA 3I0TA 4Y33A 1VQ6I 2YX4A 1HOMA 1JXSA 5KVRA 1R6RA 2HQNA 4G7ZF 2V9PA 1EH7A 1CF7B 2V1NA 3FXLA 2MD5A 3VSKA 2RNGA 3ZQGA 2FUG2 5GADJ 5HDGA 4B09A 1DU0A 1EF4A 1WJBA 2FQ4A 4MFDA 4AIHA 3GTQJ 4EQQA 1I6XA 5J47A 2UUZA 3U21A 1Y0UA 1S5LC 4MIMA 2PMHA 5B5EC 3JRDA 3OSGA 1FZPB 3RPUD 5FLMJ 3HZJA 2H8WA 2DA6A 3FMSA 2XGEA 3GFJA 2QQBA 1X1AA 3DXJF 1TWGJ 4C30A 3E5UA 4RAGA 3CDLA 1NK2P 4AD9A 1J5YA 2KIFA 2DPUA 1ETWA 4CUGA 1XTAA 2DOAA 3K4CA 1ETOA 1TQPA 5LHIA 1R49A 5DD4A 3VPRA 1FNNA 2QQAA 3OYFA 2D2WA 4A5NA 2ZJ2A 4HNVA 3CC2I 1FC3A 2MH2A 3SZPA 4YIFA 1JI8A 2E1MB 2JVHA 4Q48A 1MJAA 2ZSHB 1O3TA 2BZTA 1LDKB 2E34A 4HLYA 2H6BA 2GXGA 3HIFA 1B1BA 3S15J 1FEXA 3EPZA 2ZJQF 3S17J 2VC1A 5D5WB 1DP3A 1RZ4A 4UNOA 2DA4A 4F7ZA 3QP6A 1ZG3A 2DQRA 5LD2C 2Z2SB 1MH3A 1R4MB 1WVRA 2KL4A 4GXOA 3IRQA 3S14J 1HC8A 2IP2A 2OV7A 1X1CA 2BYVE 3PNVA 1AU7A 3CMYA 4BDZA 2M4KA 1MMDA 2VJ4A 4DZJA 4RB0A 1ZHFA 4MFEA 2HXIA 1D8KA 4BS9A 3CZ6A 3KX2A 1XN7A 2Y0MA 2R7RA 3AG4H 4I02A 3R60A 2FJ1A 1MBHA 3PFIA 1EKEA 2X9DA 2WY8Q 2VT3A 3L9FA 1BM9A 1HKSA 3GTKJ 3HSEA 3MAJA 3CP2A 3GTGJ 2DA2A 2LY2A 5JHUA 4ZDLA 1TL8A 1YX3A 1J0RA 3F8MA 3TMOA 2O8KA 2VIXA 2PJPA 1U8RA 2EK5A 2VBXA 4NQWA 2OAZA 3HRSA 1FOKA 3I59A 1BJAA 4A0ZA 2EQRA 3ZGKA 3H9JA 1XG1A 3MMYB 2MFZA 1FBUA 1FYKA 1STZA 3HOTA 1MMGA 1FWZA 3UKGA 1Y1VJ 3LA3A 4LG0B 3ZQIA 2ZJPF 2COMA 2O8XA 1BI2A 2FE3A 3HKZA 2QSGX 2C6YA 4DYRA 4ABZA 4AUXA 3OOUA 1FMVA 1I27A 5L3EA 1F1ZA 2KQRA 2XDVA 1T98A 3IKVA 4R1HA 1X58A 2VXDA 2HTJA 4E70A 1RR7A 3JREA 2XKPA 2F5FA 4IHWA 1OPCA 3HUGA 1TW2A 2CQ7A 3SZGA 5L3DA 2LY9A 2FXAA 3DKXA 1BIBA 1HXDA 1IXRC 1N25A 2CQKA 5CQGA 3PSFA 4AVPA 5D5UB 4WX9A 4IVNA 3HOXJ 3OSFA 1IRGA 1P6RA 1YX5A 4FE7A 2J5PA 1B9MA 1BI1A 1L0OC 2VPLA 1ERDA 3M07A 3WTZA 2M3AA 2FX0A 3PL8A 5HVQC 2KZGA 4OIQF 5DM7F 2FBKA 3F9KA 2L01A 4ZJZA 2XHKA 1T33A 3RKXA 2IPQX 4EVIA 1RESA 4B8XA 1ZR2A 4PUSA 3P9KA 1MNEA 1DPUA 4YG2F 3A2KA 2HYFA 2FBHA 5IYBJ 3QPTA 5M5XJ 3E6BA 3BY6A 5DCFA 1X2NA 4L18B 4P96A 3G1LA 2XASA 4DJAA 3JAMK 3OMYA 2CFOA 3JCUC 2VI6A 2NS8A 3KP3A 3K4JA 5E1ZB 2FF4A 2X1CA 2WC2A 4ENNA 2E36A 4IXAA 5J1UA 1Z9CA 3ZQCA 2LREA 2FD5A 1ZR4A 2DO7A 2HEOA 1XGSA 3KP6A 3MWMA 1IUFA 2OA4A 4I76A 5E8GA 3KFWX 3LSPA 3RKYA 3ISPA 5K5QA 2QF7A 1IW7F 1Q1HA 4HRIA 4GO1A 3ZQQA 2DT6A 4XR6A 3L2RA 5J1RA 4NUBA 5LGTA 4L5EA 2M0MA 2W24A 3ECHA 1SFXA 3KEYA 2WAEA 3V7SA 4BY7J 3BCBA 4CDGA 3RYRA 1V3FA 4M6XA 2VJ5A 4QPOA 2P6TA 3M1CA 1MD0A 3C2GA 1XMAA 3CJRB 3CCEI 1VQ7I 3PJRA 2E35A 2NS7A 3I71A 4EM0B 2D1VA 3FKIJ 3KP2A 1XS9A 2ZB9A 5J4VA 1J9IA 5FKKA 3DLLF 5E8IA 1ZN2A 2AS5F 4IRGA 4XKCA 5DS9A 2GQQA 1K4SA 2DAOA 3HL2A 4HX8A 1IXCA 1WQ2A 1YRNA 3SFZA 4XOTA 1I39A 2M7BA 1IGNA 3ZN1A 1YG2A 2F4IA 2Y0SA 1XGMA 5CQEA 4L9JA 2RNJA 4F3QA 5K1YA 1BL0A 2ID3A 1R22A 1QHGA 2HVRA 4KN4X 4KFCA 2QENA 4II3A 2STTA 1TWFJ 3JRAA 3AKZA 3N05A 4XIDA 1FIAA 2B0LA 2EV0A 2K3FA 4G9YA 1OCZH 1A5JA 1H0MA 1TC3C 2R7WA 1MIJA 1QGPA 3CCSI 1HSTA 2IRFG 2WB1A 1QA6A 2V9VA 1REPC 3OV8A 1WKMA 3L09A 4NNJA 5JVTA 4Y15A 3WTXC 2Z99A 3QU6A 2XIGA 2Y75A 1S7EA 3EETA 2XUBA 4IRHA 1R1VA 2WA0A 2VQHA 4DBQA 1HSJA 2CH0A 5E1XA 3LA2A 4EJWA 5JLWA 2HWVA 3K2ZA 4HSTA 3RKWA 2FQ3A 3IH4A 3S2HJ 3NARA 2LC2A 4QLCU 3TO9A 4IHXA 1D0ZA 2JVGA 3A03A 2DQLA 1MDMA 1SD4A 4JP0A 2K02A 1R71A 1KONA 1BR2A 3WG9A 3QWLA 2IAIA 4C9YA 2KKOA 3ASNH 1IN6A 1L3LA 2DOEA 1FTZA 1NHAA 3VFZA 4IQ4A 3S1MJ 1U6GA 1FIPA 2COBA 3GCMA 4Y4RA 4XLPF 4WWCA 1PJRA 2K9NA 5KK1A 4IF4A 3NWTA 3VEPA 1J59A 3K4MA 3FDYA 2L7ZA 3H5AA 4OIOF 2K4BA 4MTDA 3WHBA 5A2QK 3DLAA 2BY0A 1E3OC 4FHTA 2IVMA 5GPAA 2VONA 3LSGA 4FTHA 3DEEA 2KIQA 4CCMA 2FNAA 5FLVA 4L9TA 1NG6A 3E6DA 4JX5A 2ME6A 5IT9K 4CA0A 1UJ8A 4QPQA 5FD6A 1P92A 3JRHA 2M1BA 3CC7I 1YQAA 1ZRFA 1GV5A 4FE4A 1YLFA 3HOZJ 4FCYA 5D5VB 2VJIA 4RB3C 3IH2A 2Y30A 2D45A 3K69A 1VQPI 4ZZLA 2GIVA 3NRVA 2IGKA 3K7AJ 4PJ0C 2VQLA 2K9MA 1OCOH 2ECCA 3L2UA 5L3BA 4L0YB 5EJCA 5H6QA 3EUHC 3CMAI 1YIJI 3PQJA 5DD8A 1YHQI 4XORA 3RZDJ 2K27A 4M72A 1FT9A 2R7DA 4RGRA 3GXOA 3U1DA 1OJLA 3ZN0A 2CV1A 2EFPA 1EA3A 2IGMA 2NVXJ 1WJ5A 1JKPC 3HG9A 2HR3A 4A3BJ 1PP8F 4KISA 2A5YB 2F6CA 1X19A 2HQAA 5IY5H 1WJFA 2E71A 2ELHA 3IAS2 4R79A 1K83J 4BQAA 4DYQA 1U5TA 3D0SA 3LSJA 2ZNYA 3ZOBA 1Z3YA 4LMYA 2NAZA 3HGGA 1ZGJA 5BPDA 2CQNA 1R1UA 4E7HA 4A69C 3OL3A 1Z6RA 3DBHB 4KMUX 2MA3A 2EV5A 3FBNB 4E7SA 5ILVA 1ON1A 3BZ6A 2WV0A 4BGDA 1T6SA 4BQQA 1PDNC 3JRBA 3VYUB 1QU3A 1G3YA 3GBGA 2QA4I 1VQOI 1HA8A 1G3TA 2AO9A 4D1QA 1ZG5A 2FOKA 4FX0A 3AL0C 1WFXA 5IT3A 2QQ9A 4XM3A 2DMPA 4HZFA 4D0PA 4UUSA 2VXZA 4NBQA 1RETA 4HLXA 4Y52J 3ZP5A 2CUFA 2ZXJA 4I0AA 4EEFG 3JSOA 5ICEA 2JA7J 4J00A 2NXNB 2DW4A 3I3LA 1SANA 4LFUA 4BL0B 3WE3A 5FKNA 3CCVI 1F5TA 3TGNA 3RCOA 3OYDA 2BHYA 3GX4X 2R7TA 2GXBA 2LG4A 3IRRA 1MJBA 1ZH5A 4RBOA 2W00A 1RI7A 1FSHA 4CZCA 2L2OA 1SVMA 1ETKA 2HYGD 3JSPA 2F5CA 1ZLJA 4CCLA 3GW2A 2JT1A 4L9NA 5F6FA 3FF5A 3GTOJ 1OCCH 1A6IA 2EZLA 2JA6J 1BW5A 3E0JB 2K7LA 2XKOA 2HOSA 1FY7A 2R7XA 3TL4X 2MC3A 4TV7A 1WCMJ 4BYYA 2HOTA 2R4GA 2XAQA 2JPCA 5E20A 4F55A 4BDYA 2ELJA 4DGWB 2P5VA 4MLOA 2HI3A 1Y8QB 2DFHA 4M71A 2F4OB 2M30A 1I6HJ 5EG0A 2CW7A 3E5XA 1YRNB 1TTYA 3TO7A 5CVUA 1P7JA 1Z7LA 2M7AA 3QP5A 4XLFA 2MYSA 3PUFA 2JA2A 4XOPA 5BOXA 1A6QA 3DWLE 4XL9A 1BI3A 2BVLA 4OOIA 3KP7A 3ULQB 3DP7A 1O3SA 2XGXA 2XROA 2ETHA 2PQ8A 1PUFB 4L9VA 4XSZF 1G59A 2GM4A 2MABA 5K5OA 1P4WA 1JT0A 4KT6A 3BG3A 2M5WA 1IXSB 3BZCA 2HKOA 2X0LA 1Z7UA 4B43A 2DOFA 2PX9A 5JVGF 1OCTC 1FX7A 3TP3A 2PJRA 5GP9A 2RVCA 1LE8B 1R5ID 2PBIA 1Z21A 1KZHA 1KYZA 3F21A 3C1DA 3DCFA 2AHQA 1RKTA 2KRFA 5ILUA 4RAZA 3BG6A 1Y0NA 2XAHA 2Z1DA 3B6CA 2A68F 1BC7C 1UB9A 4U87A 3W3CA 2EIKH 1ETVA 2F5DA 3I54A 5LHHA 4S04A 4P9FA 4HNTA 2HDWA 3WU0A 5F04A 2A61A 1Z6TA 5BNGA 3ZMVA 2VPRA 3BR0A 3MN2A 2VOOA 1R5HA 3ZPLA 3KLOA 4LGWA 3WG7H 4AIKA 4G94A 3OYMA 2DU9A 1KU3A 1XC5A 1EH6A 3WGGA 1W4MA 1FBSA 1FOWA 2HVQA 4ITVA 2K5CA 4XSXF 3A0BC 2I5UA 1YS6A 2LVSA 2PMUA 2ICWG 3TKYA 4BQNA 3I53A 1QVTA 5J4YA 3S1NJ 4KMFA 2NNYA 2PG4A 3BZKA 2CYYA 4HQMA 3MKYB 1D5YA 1UFMA 2E1NA 4EGYA 1S72I 3WTWC 3M4OJ 1QPIA 3I59B 3W2WA 1HCRA 1W5SA 2L7MP 4IZZA 4PFPA 1VQMI 1OISA 4WXHA 2CU7A 3HTSB 1GLNA 1QVUA 3BR5A 2UXXA 4I09A 3CMEI 1JUPA 1X1PA 2VB6A 1WI3A 2K85A 3CUQA 1HLVA 5L3GA 1YTYA 3HDDA 2XGCA 3SFIA 4M3EA 2LRDA 4WCGA 2KLOA 2PJRB 3BG7A 2IGOA 3I5UA 4OIRF 2RREA 3HSRA 1FOYA 3IV5A 5LEKA 4LD5A 2NVQJ 4GGGA 4M9XA 5M5WJ 3R4KA 1F36A 2IT0A 2ZKZA 5K7HA 2JTVA 4IX7A 4UB6C 4CO8A 4LB5A 3OS2A 1AOYA 1Y8RB 3CMMA 3CC4I 4I7HA 3Q0UA 3W6JB 1MZBA 1MBKA 5IOZA 2YS9A 1TT0A 5E18F 1SC7A 5M3MJ 4CCOA 2WADA 4RGSA 3RI4A 1VQKI 2FOWA 3CQZJ 3ZQFA 4MNUA 3BR3A 4EGZA 3KETA 2M34A 3DU6A 2CWEA 3OIPA 3RDIA 1ZGAA 2IGNA 4IOAF 4Q5SF 3HKZN 1B72B 3GLLA 3T5XA 4IHVA 2RC4A 5EEAA 2I8DA 3DV8A 1SAUA 1IO2A 5FD5A 3ESWB 2GXAA 3D5SC 3K4LA 2V6CA 4A6EA 2Y9ZA 1UG0A 3W6KB 3ZMZA 3J7AO 4RLFA 4P5OA 4XLNF 2K9LA 2G7HA 3TOBA 2LLKA 3OYCA 2KT0A 1VF9A 3KEOA 2X1DA 3GWZA 1YI2I 2OCCH 1K6YA 3SHFA 3CCQI 2VASA 4IQJA 1TW3A 1USSA 3KIOA 4J01A 4QSHA 2CFXA 2R7VA 1HW1A 3BG9A 5ICFA 2VKVA 4RAFA 4YEJA 4HOBA 1EV7A 3SYTA 3SEZA 4Q47A 3PIPF 5EZHA 4ENJA 2QGUA 1VQNI 2YR2A 4LOCA 4RAYA 2NRAC 2XPWA 5KNLA 3QYEA 1KQ0A 1F43A 3BTCA 4YIIA 3GUDA 3CUOA 3U9GA 3FKJA 3AAFA 5FRNA 5FRMA 1JT6A 3HEFA 1IG7A 1P4XA 1LFBA 1V5EA 2W48A 3JTHA 5B1AH 2R5YA 1I1SA 1FMWA 1HF0A 3OWTA 3EUKL 3HHHA 1PUEE 4Q4ZF 5BS6A 1NG7A 3KCCA 2M9HA 4ZTJA 2E2HJ 3K9TA 4BEHB 2JRMA 2CG4A 2VUMJ 2ISYA 1A35A 3CJQB 4L0ZB 3BQYA 2EA2A 4A3MJ 2O0YA 2NOGA 2BV6A 3N4MA 3FX3A 1ZYRF 3I4PA 3LSTA 2DPDA 5CVJA 4U7DA 3EYYA 3NQOA 3VSLA 2DFFA 2MGQA 4N0BA 2HZTA 1G2HA 2K9SA 4PCQA 2JRTA 4BJ6C 1ZARA 1U9OA 4PZJA 4I6ZA 2HQ5A 3HPGA 2CV0A 4BUPA 2E1CA 3BTJA 2ISZA 3S3MA 3ONQA 4HPQA 4A93J 2DFIA 3QYFA 2ACJA 1T2KA 2CJJA 2A69F 1YOVB 1TBXA 2X4HA 1K61A 3EQLF 2HOEA 3VWBA 1S9HA 1K79A 2JUGA 4XRFA 4II2A 3VDXA 2ZMEC 2H1LA 2EIMH 4UXNA 5K7ZA 3IL2A 3X2QH 5IP9J 1LQ1A 2VN2A 3K1MA 2GBYA 1W7PB 2EFOA 2XV4S 1TNTA 1RUNA 3QQAA 3KZIC 1S7OA 1LFPA 4CICA 1MSFC 3CDIA 3WTSC 5CLSA 2DCEA 3G2BA 4YFNF 5E1WA 4CYCB 1V54H 2CO5A 4XRSA 2B63J 2BEOA 5TJJA 1FYLA 1GV2A 1MMNA 2ZXHA 3B6AA 2KJBA 2P0WA 1UCRA 3A4CA 4G6DA 3OS1A 1GHCA 1D1AA 3QODA 2MD0A 3DTEA 1X3UA 1AKHA 3GTMJ 1VQ9I 4AIJA 4LLLA 3TDUC 1Y1WJ 3I4NJ 3J80K 2WAFA 1W5CC 5BQTA 5D8KB 4HW0A 3OR1C 4YRVA 3CF5F 3PO2J 4G12A 3Q3SA 1W7PD 4JX6A 1A31A 3VB2A 2QKMB 2LF8A 3A0HC 2HU9A 4DOZA 5FKLA 4YFKF 4E7LA 1FOXA 1SFKA 5F1JA 3MFKA 4RDUA 1YFHA 1AHDP 2GIZA 3LOCA 1HW5A 1X3ZB 1DQUA 2LTPA 1JKRC 2XB0X 2XF6A 4HV5A 1Z91A 5GTHC 4UVAA 3CJNA 3FISA 3VODA 2DXIA 2EFQA 4UVCA 1XDUA 3AG3H 5K5RA 3V8JA 1V5GA 3ZQHA 3G4SI 1ZREA 1VNDA 4IPAA 1JHFA 5CVRA 5TGTA 3H5RA 3REOA 5HLTA 4X0GA 1OQYA 2XF5A 2JA5J 2M2EA 3BCAA 3F0CA 2STWA 2GOXB 5FROA 3BJOA 2VBZA 2DTRA 5KAIC 3BR2A 1F4KA 3FMRA 2WAQN 2EJRA 5JLXA 1J09A 2XAGA 4ON0A 1D3YA 2VT2A 5DCMB 2WBMA 3ECOA 5FGMA 3BT9A 2P6SA 5HS7A 2XAJA 4AM3A 4KN7X 3ZQLA 4FQGA 4U0VA 2V9KA 1WWXA 3I55I 1ON2A 1H8AC 3JRIA 1JKQC 3H0DA 2K86A 2B9SA 3E6MA 4WXDA 5CYVA 3T1BA 1TZLA 3KYDB 1UZCA 2G7UA 4HX7A 4PSXA 1DP7P 3BPXA 5GAGJ 2R5ZA 3IC7A 2HPMA 2HS5A 3GMEA 1WZ2A 4ZDPA 5HNHA 4ZYAA 1QNTA 4KA4A 2E2IJ 2EZKA 1JGSA 5CVIA 3WGHA 3PO3J 2W1OA 3F3XA 1XD7A 2VBWA 5ERIA 5KAFC 4PDKA 2DK8A 1LFUP 5B3SH 3L00A 3LL7A 2BY2A 5IOYA 2DDAA 2LNBA 1LNWA 1OCRH 3F8FA 5M5YJ 3BJ6A 4NHJA 2R92J 3R0AA 4O6JA 2OUMA 3F72A 3CF2A 3BP8A 2W7NA 1Z0XA 3HPHA 3I4MJ 2VQGA 1IV8A 4GYGA 3G1MA 3B02A 4XLEA 5CPRB 1RKWA 4A3JJ 2IW5A 3OIOA 1U2WA 1TWHJ 4I2OA 1LPQA 5IYCJ 2JSCA 4D5CA 3ABTA 1B8IB 3S32A 2XRLA 3WGIA 2NVTJ 4G7HF 1H88C 4LLNA 3UR3C 1WH7A 4RLQA 5DUKA 3S1RJ 5E3MA 5EG0B 1UHSA 4M73A 2ZFWA 2V7FA 4LB6B 1W7PA 5J8FA 2EZIA 1R9TJ 1GT0C 2G9WA 2X1EA 2EINH 3E3VA 1LEAA 4V19K 4UHTA 3TOAA 3SDBA 2JMWA 1ULYA 3C3WA 3F6OA 4KJZA 1ZRDA 1V55H 4PJNA 3SJMA 2K4JA 2MH9A 2YU9J 4WK8F 3HOYJ 3MKLA 2O61A 1BR1A 1J2XA 5F1RA 2EPFA 1ZG1A 4XN0A 1RRJA 2A07F 2W25A 4P1WA 3CLOA 3SXYA 3L2VA 1R23A 1U3EM 1B72A 4IEJA 2Z9OA 3DTKA 1G8XA 3H1CA 4V2FA 4HDVA 2OC6A 3AG2H 1GUUA 2QQ8A 4EJOA 4U88A 5TRDA 4UUVA 2JN6A 2W4SA 4FETA 4XMYA 4DBRA 2IS4A 3HTUA 1EH8A 1LKXA 2DYSH 3H3ZA 2Z16A 1YIOA 1MBEA 6PAXA 1IC8A 4Z2YA 2LMDA 3H9QA 1RPWA 1Z1DA 2E5ZA 3ZR8X 1CGPA 2JZYA 4AC0A 2DMQA 4HF1A 2L7FP 4P55A 3H9GA 4R8HA 3G71I 1RIOH 3RPQA 2EH3A 2OCEA 3HRUA 2HQRA 1G3SA 2L4AA 4M3DA 5FO5A 4UUSB 3J7YJ 1OR7A 3GLXA 4FISA 2VBYA 2IXSA 2MSYA 3S93A 2ID6A 3J81Z 2A6TA 3W2VA 3OYHA 1GXPA 3MZ8A 2QM3A 2P7CB 1D1BA 1SD5A 3FIWA 3OYEA 3F8BA 5A2QZ 2RDPA 2XAUA 2DLLA 2XVCA 4M9ZA 5F64A 5FFXA 1HKTA 4QWQA 3S1QJ 4MTEA 2QEXI 1BIAA 2ADUA 5LHGA 1OYYA 3E97A 4KITB 2L5QA 1S29A 4BBSJ 2ZFUA 2QWWA 1A36A 1ONVA 3LSKA 3H5NA 2TDXA 2H1KA 4A3EJ 1Y56A 2HXOA 4ESJA 1H9TA 3RJPA 1QRYA 1BI0A 2XPUA 2JUCA 4A3GJ 5F27A 2L54A 2K40A 2KIUA 3HM5A 3LAJA 4GFBA 4N4NB 2E60A 3CDHA 3ZMSA 4BXXJ 4YELA 1UMQA 2ZJRF 4X6AJ 3HBLA 4A3DJ 1DU6A 2ZCWA 3CCRI 3Q0WA 5ED4A 2F4MB 3FK6A 1V4RA 2DA5A 1MBGA 1N75A 1NK3P 2W82A 2Z3YA 3SZTA 3GTJJ 3J7ZI 3MKWB 2Y31A 2KPMA 2NVYJ 3BG5A 3H3UA 2RQQA 4J19A 1PP7U 2X48A 2AQFA 2M8GX 1HBXG 1HDDC 1E3HA 2FA5A 1WHUA 4BXFA 4S0HB 1AWCA 2ZC2A 4OIPF 2LY1A 2VKDA 3S16J 1XPXA 3EUAA 2HTSA 1K4TA 2HZDA 3OR2C 3R0JA 4CCNA 1QZYA 2V1XA 3WODF 2PMZA 2QYOA 4JBAA 1ZGWA 1EJ9A 3ABUA 3UNGC 4O3MA 1LE8A 2ZXIA 4KICA 2Y48A 2HPIA 4XLAA 4H0EA 3GFMA 1GVDA 3I56I 3ABLH 2A5WA 1JJ6C 1JE8A 2E2JJ 1MBFA 1USTA 3KZYA 3TEDA 3HOWJ 1D5VA 4MO7A 5M3FJ 3WTUC 4IHTA 3EDPA 3GZNB 1G3WA 2GWRA 2AQEA 5J6XA 3JRCA 3MZYA 1GDTA 4NB5A 1UELB 5EGOB 2GLOA 3BWGA 2EFWA 2R5ZB 2O7OA 2QSFX 1FSEA 5E3OA 1X3WB 3ZMTA 2O9LA 2VOPA 2QBYA 1OYWA 1KGSA 3A02A 3FBIB 4DZPA 2DFEA 3MKZA 3NWSA 3FXOA 2PLYA 3R6SA 3CLQA 4HA8A 1BN5A 2DJIA 3SDGA 3WTYC 1MGTA 1JUSA 4ZH4F 3HJEA 3A01A 2KDZA 3CCMI 2MG4A 2KHMA 2ZXWH 3QPHA 5ICGA 1D1CA 5D6EA 2X85A 2H94A 3U1KA 2A05A 3COAC 2QBYB 2W85A 1H89C 4M6VA 4AIDA 1OLTA 3DPLC 2GAUA 4CXFA 1W1WE 1IRXA 2YX7A 1Z3XA 1XGNA 2L9NA 5TISC 1TQIA 1YE9A 2XGDA 2R5YB 2LK2A 4D7MA 3HHGA 3HRTA 4HEA2 4CYDA 4AVZA 3CCYA 2EBIA 1FPQA 4HF0A 5C44J 2DA7A 3BTLA 3W6VA 1IF1A 1YJWI 4XRSG 3LSMA 2CUJA 3KZZA 4AYBN 4BJTA 5LGUA 2IBDA 2Q0OA 5GPCA 3FM3A 1RNLA 2BXYA 4EM1A 4NDLA 5HLHA 1QO0D 3LNQA 4D9JA 2E7WA 4PJMA 1ETQA 3PM1A 4OINF 5J3LA 4KIBA 1Y6IA 1TWAJ 2L02A 3HOUJ 1LUJB 1JKOC 2OF7A 3E7LA 4A0YA 3F8CA 5E79C 1AKHB 2O03A 2O6GE 4BXUA 4K2EA 2IA0A 1G6NA 2ECBA 5ILSA 2WWYA 1KQ8A 1IN7A 2L3DA 5HOOA 3P5JA 1J75A 3K4NA 3B73A 4ZYDA 2R7OA 4PJLA 3L2CA 1N78A 4PGHA 5DYMA 1K78B 1BW6A 4UB8C 2JQ7A 1WJDA 5LLQA 3ERMA 3HOSA 4A5MA 3FXKA 3LAPA 5D6FA 2IJLA 2KRCA 5DDGA 2HYJA 2OU2A 3LWFA 3M9AA 5IPAA 5CKTA 1K78A 2L9SA 3R61A 1XMXA 2FNPA 1FLIA 3LQQA 5C4XJ 3DU5A 2EA4A 5L3CA 1WI9A 1X4OA 2VJJA 3KP5A 4A2UA 2JJ7A 2X6WA 2RAEA 2W57A 4NC6A 2LD5A 4B47A 5L3FA 3GZ5A 3JAMZ 3MEXA 5DEQA 4KIGA 2L7KA 3JRGA 2CW0F 4G8XA 1TLHB 2BVMA 2LSOA 2KRHA 4MQVA 1U78A 1SEUA 2V6EA 3K4BA 3NEUA 2LBFA 3DPTA 1KU2A 5D4SA 2KZVA 5EZGA 4U7BA 3O8GA 1PYVA 3LA7A 4PFOA 3FMQA 1UG2A 2Q1ZB 2NVUB 1OCPA 5E3NA 1J7KA 2FEZA 2M87A 3OYJA 2TRTA 2QCOA 5LEJA 4FASD 4U0WA 4ETSA 2H6CA 1BBYA 4GYIA 1R58A 3LSRA 4Y13A 1QZEA 1TNSA 5LFAA 3D5LA 3LMMA 3EYIA 3Q0VA 2O5RA 2YSRA 4E7ZA 4XQFA 3DTIA 1ITYA 4NC8A 5HDNA 2RV8A 4XLCA 5D5XB 2HOAA 3BLYA 3IKTA 2VE9A 4DIQA 2XB5A 4G6TB 4XICA 3OYBA 1JGGA 1D0YA 3K1PA 1VFCA 2JWTA 2DBBA 3TO6A 4BKXA 4RM2A 4BBRJ 4XBFA 4A3KJ 1MNMC 3IUOA 1XSVA 4UY8I 2R7QA 1WSUA 4KDPA 1SMTA 4MEYF 1ZLKA 2L4MA 2B7EA 3RIRA 5DUIA 2BW3B 3ABMH 2CMPA 2OJED 1DGRM 2V79A 1LDDA 1MJ9A 2V1UA 2P8TA 1HDPA 1PVEA 3GEZA 4UVBA 1IDZA 1IAWA 4W97A 4ZTFA 3TW6A 1XCBA 2AXLA 4IO9F 1W36D 3V8LA 1C0WA 3FXUA 3HXLA 3T0YA 3Q9VA 3QAHA 4GDFA 3IWZA 2DK5A 4DYCA 3ML6A 4H4KC 2X6OA 3RPUA 2DTZA 2KFDA 1T0FC 2FMLA 1IDYA 3CO6C 2CUZA 4OAYA 4LITA 3TQNA 5LRSA 1IN5A 2VQCA 3IH3A 1JHHA 3ZMDA 2XRNA 3EUHA 1VQLI 3IAM2 3CD6I 2MLKA 2F5EA 3S2WA 2FMYA 3O2PE 1FBQA 2ZMEA
chains in the Genus database with same CATH topology
3F22A 4U0YA 3ELKA 4BHCA 3G73A 2RKHA 1E17A 1I5ZA 5D8LB 3CTAA 3BOQA 5HS9A 4EJUA 2M45A 3HRMA 2VE8A 1FP1D 1B9NA 3GFLA 5HLIA 2HKXA 1DDNA 1YW7A 1LB2A 3GF2A 1HKQA 2UZKA 3OOPA 3MCZA 1YO5C 4EJTA 2LKPA 2YU3A 4JQFA 3PQKA 4WF2A 5LGNA 2Z5UA 2MBFA 4EMSA 4ZYEA 2KIMA 3ROUA 4A6DA 3ZMUA 4ZZDA 2J5OA 4EV0A 3M7GA 3HYIA 1QZZA 1H9GA 3I64A 3MQ0A 5AIPA 4EJVA 3GO5A 4N9HA 1T38A 2O3FA 3SQNA 1LVAA 4UV9A 2ZBKA 3QRFF 1R1TA 2GZWA 3GVAA 2A6HF 3KLNA 3DF8A 4HF2A 3GFIA 5EEHA 1XSDA 2IA1A 1D8JA 1P4AA 4HDUA 1YS7A 2D1HA 4PGGA 4BNCA 1QQIA 4KIFA 1R7JA 1IZ1A 1FYMA 5FFZA 5FB2A 4M9SA 1XB4A 3DEUA 4RS8A 2FU4A 3FHZA 2H27A 4LK1F 1SFUA 3K0LA 4KYWA 4LK0F 1DUXC 2P5KA 3DFGA 5AONA 3KE2A 3H92A 2Z33A 1G4DA 4M6YA 5HLGA 3P9CA 4BH9A 4M74A 2P7VB 2NNNA 2RQPA 3O6BB 1R00A 4JK1X 1F9NA 3QOPA 2F2EA 5D4RA 2OZUA 3WE2A 1OMIA 3L7WA 1I1GA 4ZYGA 1WRJA 1K6OA 3HSFA 3F23A 1B4AA 1SFEA 5FLXZ 4IRIA 3VOEA 4I01A 3Q9SA 2UWMA 4I0BA 3N97A 2XAFA 3CUQB 3ZQ7A 3FXRA 3RTRA 2PFBA 4ESBA 1ZAOA 1KQ9A 5BPIA 1O7FA 1LDJA 1O3QA 4GCVA 1S6LA 2PN6A 2RN7A 2R7FA 5LRRA 3G3ZA 5FLXK 5DV5A 4MEXF 5HDKA 4L5IA 1U5TB 2EV6A 2OBPA 2A3SA 1R5GA 3FM5A 2OZ6A 2A6EF 2NS0A 2LF7A 4ENMA 2MLGA 3KP4A 2QUFA 3O3KA 1YW9A 2Q2EA 3E5QA 1LJ9A 3BPVA 1ODDA 5JI6A 1Z05A 1VTNC 1YW8A 3V8KA 4Y17A 3V4GA 3BDDA 2QZ8A 4OMZA 3C7JA 3FZVA 5JR3A 3WTTC 4ESFA 1OYIA 1IRFA 4WXCA 4HQEA 2Q8KA 2QLZA 4G7OF 5ICCA 2CGPA 4OU0A 3RYPA 4IHSA 2FBIA 4RB1A 4BHBA 1QPMA 3Q5FA 1GXQA 3MZHA 4RGXA 2DT5A 3IHUA 3KEQA 3C18A 2R3SA 4DQ2A 3DQVC 4LJZF 3F6VA 5DCMA 4BAYA 4HAMA 2H09A 3LFKA 2EFNA 4OMYA 4CHUA 2ZO4A 1MDMB 4IJAA 1S7AA 4HBLA 2HFHA 2OQRA 4LG0A 1IUYA 2GA2A 1UHMA 1SAXA 1OKRA 2ZNZA 3V7CA 4ENKA 3DKWA 5H20A 1KYWA 4UV8A 2CSOA 5JFRA 2DI3A 5IT9Z 1R36A 1XMKA 2VODA 4MQ9F 1XCVA 5LBQA 3J80Z 1A04A 4HX4A 4RB2C 1IN4A 2IA2A 2BBYA 2FSWA 1YYVA 1P2FA 5HS8A 4MGRA 1KU7A 4BHPA 1ZRCA 1SMYF 1U5TC 3IWFA 3K1NA 1XDSA 1T0FA 3CUQC 1GVJA 2HDCA 4KNYA 3QU3A 2UXNA 4KUMA 4ZYHA 1O3RA 4EM2A 1QBJA 1KA8A 3P7NA 4HV6A 4L5JA 1SD6A 4LLGF 4FX4A 5H6RA 3CO7C 5EEGA 1MKMA 2OD5A 3FWEA 3T8TA 5E17F 1UHWA 3F8NA 2NYXA 1CF7A 4MHGA 2ESNA 2W84A 1S3JA 2P5LC 1O57A 1KU9A 4CZZA 2E7XA 5AIQA 3E6CC 1HW2A 1T39A 1FP2A 1B6AA 2M8EA 3ERED 3BJAA 4I98B 4DNCA 4O5VA 3WU1B 3FXQA 1E2XA 1S8NA 1LEBA 4CGZA 2VC0A 3I58A 1K7AA 2YPRA 4S05A 1IN8A 2JPBA 3BROA 3GYHX 3JW4A 4G6QA 3P9IA 2PEXA 2RGVA 2ZMEB 2BE5F 3TDZC 1SD7A 3M1EA 2OQGA 1XSXA 2HGCA 4FT8A 4A0XA 1TQMA 4AWXB 1O7LA 1HQCA 4YFXF 1W5TA 2V1DA 2LDUA 2QVOA 3M8EA 2EB7A 1BC8C 3J81K 2EWNA 1B59A 3M8FA 2WTEA 4KT5C 3LQRA 3GZ6A 1RUOA 2ESHA 4ASNA 2BGCA 3T8RA 3U2RA 5CJ9A 2P4WA 5CVVA 1DPRA 3V7RA 4A12A 4RGUA 3WTVC 4HYEA 3JTGA 1BOAA 2FRHA 4N9IA 2PI0A 1XGOA 2KJCA 2GA1A 4P9UA 5BMZA 5J8CA 3I0TA 2YX4A 1JXSA 5KVRA 4G7ZF 2HQNA 1EH7A 1CF7B 2MD5A 5HDGA 4B09A 4AIHA 4EQQA 1I6XA 1Y0UA 2PMHA 1FZPB 3FMSA 3GFJA 2QQBA 3DXJF 3E5UA 4AD9A 1J5YA 2KIFA 2DPUA 1TQPA 5LHIA 5DD4A 1FNNA 2QQAA 2D2WA 4A5NA 2ZJ2A 1FC3A 2MH2A 3SZPA 4YIFA 4Q48A 1MJAA 1O3TA 1LDKB 4HLYA 2H6BA 2GXGA 3HIFA 1B1BA 2VC1A 5D5WB 1RZ4A 4UNOA 4F7ZA 3QP6A 1ZG3A 2DQRA 4GXOA 3IRQA 2IP2A 2BYVE 4RB0A 1ZHFA 1D8KA 1XN7A 2Y0MA 4I02A 3R60A 3PFIA 2VT3A 3L9FA 1BM9A 1HKSA 3HSEA 3MAJA 5JHUA 1J0RA 3F8MA 2PJPA 1U8RA 2EK5A 2VBXA 4NQWA 2OAZA 3HRSA 1FOKA 3I59A 1BJAA 4A0ZA 1FBUA 1FYKA 1STZA 3HOTA 1FWZA 4LG0B 3LA3A 2COMA 2O8XA 1BI2A 2FE3A 2C6YA 5L3EA 1I27A 1F1ZA 1T98A 3IKVA 4R1HA 2HTJA 4E70A 2XKPA 2F5FA 1OPCA 3HUGA 1TW2A 5L3DA 2FXAA 1BIBA 1HXDA 1IXRC 2CQKA 4AVPA 5D5UB 4WX9A 4IVNA 1IRGA 1P6RA 2J5PA 1BI1A 1B9MA 1L0OC 3WTZA 5HVQC 4OIQF 2FBKA 2L01A 2XHKA 3RKXA 2IPQX 4EVIA 4B8XA 3P9KA 1DPUA 4YG2F 2HYFA 2FBHA 3QPTA 3E6BA 3BY6A 5DCFA 4L18B 4P96A 2XASA 3JAMK 3KP3A 5E1ZB 2FF4A 2WC2A 4ENNA 4IXAA 1Z9CA 2DO7A 2HEOA 1XGSA 3KP6A 3MWMA 2OA4A 5E8GA 3KFWX 3RKYA 3ISPA 5K5QA 1IW7F 1Q1HA 4GO1A 5LGTA 2W24A 3ECHA 1SFXA 3V7SA 4CDGA 3RYRA 1V3FA 4M6XA 2P6TA 1MD0A 1XMAA 4EM0B 3I71A 2D1VA 3KP2A 1J9IA 5E8IA 1ZN2A 2AS5F 4IRGA 2GQQA 2DAOA 4HX8A 1IXCA 1WQ2A 3SFZA 3ZN1A 1YG2A 1XGMA 4L9JA 2RNJA 5K1YA 1R22A 4KN4X 4KFCA 2QENA 2STTA 2B0LA 2EV0A 4G9YA 1H0MA 1QGPA 1HSTA 2IRFG 2V9VA 1REPC 3OV8A 1WKMA 3L09A 5JVTA 4Y15A 3WTXC 2Z99A 3QU6A 2XIGA 2Y75A 3EETA 2XUBA 4IRHA 1R1VA 1HSJA 5E1XA 3LA2A 4EJWA 2HWVA 3K2ZA 3RKWA 2FQ3A 4QLCU 3TO9A 2DQLA 1MDMA 1SD4A 2K02A 3WG9A 2KKOA 1IN6A 1L3LA 1NHAA 3VFZA 1U6GA 4WWCA 4XLPF 5KK1A 4IF4A 3VEPA 1J59A 4OIOF 2K4BA 4MTDA 5A2QK 4FHTA 2IVMA 2VONA 2FNAA 4L9TA 3E6DA 5IT9K 5FD6A 1P92A 2M1BA 1YQAA 1ZRFA 1YLFA 5D5VB 4RB3C 2D45A 3K69A 4ZZLA 2GIVA 3NRVA 5L3BA 4L0YB 5H6QA 3PQJA 5DD8A 2K27A 4M72A 1FT9A 2R7DA 4RGRA 3GXOA 3U1DA 3ZN0A 2EFPA 2HR3A 1PP8F 2A5YB 2ELHA 4R79A 4BQAA 1U5TA 3D0SA 2ZNYA 4LMYA 2NAZA 1ZGJA 5BPDA 1R1UA 1Z6RA 4KMUX 2MA3A 2EV5A 5ILVA 1ON1A 3BZ6A 2WV0A 1T6SA 1PDNC 1G3YA 1G3TA 1ZG5A 2FOKA 4FX0A 5IT3A 2QQ9A 4HZFA 4D0PA 2VXZA 4HLXA 3ZP5A 2ZXJA 4I0AA 3JSOA 5ICEA 2DW4A 4LFUA 3WE3A 1F5TA 3TGNA 3GX4X 2GXBA 3IRRA 1MJBA 1ZH5A 1RI7A 1FSHA 2HYGD 3JSPA 2F5CA 1ZLJA 3GW2A 2JT1A 4L9NA 5F6FA 3FF5A 2K7LA 2XKOA 1FY7A 2MC3A 4TV7A 4BYYA 2XAQA 2JPCA 5E20A 2P5VA 4M71A 2M30A 3E5XA 1TTYA 3TO7A 5CVUA 3QP5A 5BOXA 1BI3A 4OOIA 3KP7A 3ULQB 3DP7A 1O3SA 2XGXA 2XROA 2ETHA 2PQ8A 4L9VA 4XSZF 5K5OA 1P4WA 2M5WA 1IXSB 2HKOA 2X0LA 1Z7UA 1FX7A 2RVCA 2PBIA 1KYZA 3F21A 3C1DA 2KRFA 5ILUA 4RAZA 2XAHA 2A68F 1BC7C 1UB9A 2F5DA 3I54A 5LHHA 4S04A 4P9FA 3WU0A 2A61A 1Z6TA 3ZMVA 2VOOA 1R5HA 3ZPLA 3KLOA 4LGWA 4AIKA 4G94A 2DU9A 1KU3A 1EH6A 3WGGA 1W4MA 1FBSA 4XSXF 1YS6A 2PMUA 3TKYA 3I53A 4KMFA 2NNYA 2PG4A 2CYYA 4HQMA 1UFMA 2E1NA 4EGYA 3WTWC 3I59B 1W5SA 4WXHA 3HTSB 2UXXA 4I09A 3CUQA 5L3GA 1YTYA 4WCGA 3I5UA 4OIRF 3HSRA 5LEKA 4LD5A 4GGGA 4M9XA 3R4KA 2IT0A 2ZKZA 2JTVA 4CO8A 4LB5A 1AOYA 4I7HA 3W6JB 1MZBA 5E18F 4RGSA 3RI4A 4MNUA 4EGZA 3KETA 3RDIA 2CWEA 1ZGAA 4Q5SF 3T5XA 2RC4A 3DV8A 5FD5A 2V6CA 4A6EA 3W6KB 3ZMZA 3J7AO 4P5OA 4XLNF 2G7HA 3TOBA 3KEOA 3GWZA 3SHFA 1TW3A 1USSA 2CFXA 1HW1A 5ICFA 4HOBA 1EV7A 4Q47A 4ENJA 2YR2A 4RAYA 2NRAC 1KQ0A 4YIIA 3GUDA 3CUOA 3U9GA 3AAFA 1P4XA 3JTHA 1I1SA 3HHHA 1PUEE 4Q4ZF 5BS6A 3KCCA 3K9TA 2CG4A 2ISYA 4L0ZB 2EA2A 2O0YA 2BV6A 3N4MA 3FX3A 1ZYRF 3I4PA 3LSTA 2DPDA 5CVJA 4U7DA 3EYYA 3NQOA 4N0BA 2HZTA 4PCQA 2JRTA 1ZARA 4PZJA 2E1CA 2ISZA 2DFIA 2ACJA 1T2KA 2A69F 1TBXA 2X4HA 3EQLF 2HOEA 1K79A 4XRFA 3IL2A 4UXNA 1LQ1A 2VN2A 3K1MA 2XV4S 1W7PB 2EFOA 1TNTA 1RUNA 1S7OA 4CICA 3WTSC 5CLSA 4YFNF 5E1WA 2CO5A 2BEOA 5TJJA 1FYLA 2KJBA 1UCRA 4G6DA 1GHCA 1X3UA 4AIJA 4LLLA 3TDUC 3J80K 5BQTA 5D8KB 4HW0A 1W7PD 3VB2A 2LF8A 4YFKF 3MFKA 1YFHA 1HW5A 4HV5A 1Z91A 4UVAA 3CJNA 3VODA 2EFQA 4UVCA 1XDUA 5K5RA 3V8JA 1ZREA 4IPAA 1JHFA 5CVRA 3REOA 2STWA 3BJOA 2VBZA 2DTRA 1F4KA 3FMRA 2EJRA 2XAGA 4ON0A 1D3YA 2VT2A 5DCMB 3ECOA 5FGMA 2P6SA 5HS7A 2XAJA 4KN7X 4U0VA 1WWXA 1ON2A 2K86A 3E6MA 4WXDA 5CYVA 3T1BA 1DP7P 2G7UA 4HX7A 3BPXA 3IC7A 2HS5A 1QNTA 4KA4A 1JGSA 5CVIA 3WGHA 3F3XA 1XD7A 2VBWA 5ERIA 4PDKA 2DK8A 3L00A 2LNBA 1LNWA 3F8FA 3BJ6A 4NHJA 3R0AA 4O6JA 3F72A 3BP8A 4GYGA 3B02A 2IW5A 1U2WA 4I2OA 2JSCA 3ABTA 3WGIA 4G7HF 4LLNA 5DUKA 4M73A 2ZFWA 4LB6B 1W7PA 5J8FA 2G9WA 3E3VA 1LEAA 4UHTA 3TOAA 1ULYA 3C3WA 3F6OA 1ZRDA 2K4JA 2MH9A 4WK8F 2O61A 1J2XA 5F1RA 1ZG1A 2A07F 2W25A 3CLOA 3SXYA 1U3EM 1R23A 2Z9OA 4HDVA 4EJOA 4U88A 5TRDA 4UUVA 3HTUA 1EH8A 3H3ZA 6PAXA 1YIOA 4Z2YA 1Z1DA 1CGPA 2JZYA 4HF1A 4P55A 4R8HA 1RIOH 3RPQA 3HRUA 2HQRA 1G3SA 2L4AA 5FO5A 1OR7A 3GLXA 2VBYA 3J81Z 1GXPA 2QM3A 2P7CB 1SD5A 3F8BA 5A2QZ 2RDPA 2DLLA 2XVCA 4M9ZA 5F64A 5FFXA 1HKTA 4QWQA 4MTEA 1BIAA 2ADUA 5LHGA 1OYYA 3E97A 1S29A 2QWWA 1ONVA 2TDXA 4ESJA 1H9TA 3RJPA 1BI0A 2L54A 2KIUA 3LAJA 3CDHA 3ZMSA 2ZCWA 5ED4A 1V4RA 2Z3YA 3SZTA 3H3UA 1PP7U 1HBXG 2FA5A 1AWCA 4OIPF 2HTSA 3R0JA 1QZYA 2V1XA 3WODF 2QYOA 4JBAA 3ABUA 4O3MA 4KICA 2Y48A 4H0EA 3GFMA 1JE8A 1USTA 3KZYA 1D5VA 3WTUC 4IHTA 3EDPA 1G3WA 2GWRA 5J6XA 3MZYA 4NB5A 3BWGA 2EFWA 1FSEA 3ZMTA 2VOPA 2QBYA 1OYWA 1KGSA 2PLYA 3R6SA 4HA8A 3WTYC 1BN5A 1MGTA 4ZH4F 5ICGA 3QPHA 5D6EA 2H94A 3COAC 2QBYB 2W85A 3DPLC 2GAUA 4CXFA 2YX7A 1XGNA 1TQIA 3HHGA 3HRTA 4CYDA 1FPQA 4HF0A 1IF1A 3KZZA 5LGUA 2Q0OA 3FM3A 1RNLA 4EM1A 5HLHA 1QO0D 2E7WA 4OINF 4KIBA 2L02A 4A0YA 3F8CA 2O6GE 2O03A 4BXUA 4K2EA 2IA0A 1G6NA 5ILSA 1KQ8A 2WWYA 1IN7A 2L3DA 5HOOA 1J75A 3B73A 4ZYDA 3L2CA 4PGHA 5DYMA 1K78B 5LLQA 3HOSA 4A5MA 3LAPA 5D6FA 2IJLA 5DDGA 3LWFA 2OU2A 3M9AA 1K78A 3R61A 2FNPA 1FLIA 3LQQA 2EA4A 5L3CA 1WI9A 3KP5A 4A2UA 2W57A 5L3FA 3GZ5A 3JAMZ 3MEXA 5DEQA 4KIGA 2CW0F 4G8XA 1TLHB 2LSOA 4MQVA 1U78A 3NEUA 3DPTA 1KU2A 5D4SA 4U7BA 3LA7A 3FMQA 1J7KA 2FEZA 2M87A 5LEJA 4U0WA 4ETSA 2H6CA 1BBYA 4GYIA 1R58A 4Y13A 1TNSA 3D5LA 3EYIA 2YSRA 5HDNA 2RV8A 5D5XB 3IKTA 2VE9A 3K1PA 2DBBA 3TO6A 4XBFA 1XSVA 1WSUA 4KDPA 1SMTA 4MEYF 1ZLKA 2L4MA 3RIRA 5DUIA 2V79A 1LDDA 1MJ9A 2V1UA 2P8TA 3GEZA 4UVBA 1IAWA 1XCBA 2AXLA 3V8LA 1C0WA 3FXUA 3T0YA 3Q9VA 3QAHA 3IWZA 2DK5A 3ML6A 3RPUA 2FMLA 3CO6C 3TQNA 5LRSA 1IN5A 1JHHA 3ZMDA 2XRNA 3EUHA 2MLKA 2F5EA 3S2WA 2FMYA 3O2PE 1FBQA 2ZMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F22 A;  4U0Y A;  3ELK A;  4BHC A;  3G73 A;  2RKH A;  1E17 A;  1I5Z A;  5D8L B;  3CTA A;  3BOQ A;  5HS9 A;  4EJU A;  2M45 A;  3HRM A;  2VE8 A;  1FP1 D;  1B9N A;  3GFL A;  5HLI A;  2HKX A;  1DDN A;  1YW7 A;  1LB2 A;  3GF2 A;  1HKQ A;  2UZK A;  3OOP A;  3MCZ A;  1YO5 C;  4EJT A;  2LKP A;  2YU3 A;  4JQF A;  3PQK A;  4WF2 A;  5LGN A;  2Z5U A;  2MBF A;  4EMS A;  4ZYE A;  2KIM A;  3ROU A;  4A6D A;  3ZMU A;  4ZZD A;  2J5O A;  4EV0 A;  3M7G A;  3HYI A;  1QZZ A;  1H9G A;  3I64 A;  3MQ0 A;  5AIP A;  4EJV A;  3GO5 A;  4N9H A;  1T38 A;  2O3F A;  3SQN A;  1LVA A;  4UV9 A;  2ZBK A;  3QRF F;  1R1T A;  2GZW A;  3GVA A;  2A6H F;  3KLN A;  3DF8 A;  4HF2 A;  3GFI A;  5EEH A;  1XSD A;  2IA1 A;  1D8J A;  1P4A A;  4HDU A;  1YS7 A;  2D1H A;  4PGG A;  4BNC A;  1QQI A;  4KIF A;  1R7J A;  1IZ1 A;  1FYM A;  5FFZ A;  5FB2 A;  4M9S A;  1XB4 A;  3DEU A;  4RS8 A;  2FU4 A;  3FHZ A;  2H27 A;  4LK1 F;  1SFU A;  3K0L A;  4KYW A;  4LK0 F;  1DUX C;  2P5K A;  3DFG A;  5AON A;  3KE2 A;  3H92 A;  2Z33 A;  1G4D A;  4M6Y A;  5HLG A;  3P9C A;  4BH9 A;  4M74 A;  2P7V B;  2NNN A;  2RQP A;  3O6B B;  1R00 A;  4JK1 X;  1F9N A;  3QOP A;  2F2E A;  5D4R A;  2OZU A;  3WE2 A;  1OMI A;  3L7W A;  1I1G A;  4ZYG A;  1WRJ A;  1K6O A;  3HSF A;  3F23 A;  1B4A A;  1SFE A;  5FLX Z;  4IRI A;  3VOE A;  4I01 A;  3Q9S A;  2UWM A;  4I0B A;  3N97 A;  2XAF A;  3CUQ B;  3ZQ7 A;  3FXR A;  3RTR A;  2PFB A;  4ESB A;  1ZAO A;  1KQ9 A;  5BPI A;  1O7F A;  1LDJ A;  1O3Q A;  4GCV A;  1S6L A;  2PN6 A;  2RN7 A;  2R7F A;  5LRR A;  3G3Z A;  5FLX K;  5DV5 A;  4MEX F;  5HDK A;  4L5I A;  1U5T B;  2EV6 A;  2OBP A;  2A3S A;  1R5G A;  3FM5 A;  2OZ6 A;  2A6E F;  2NS0 A;  2LF7 A;  4ENM A;  2MLG A;  3KP4 A;  2QUF A;  3O3K A;  1YW9 A;  2Q2E A;  3E5Q A;  1LJ9 A;  3BPV A;  1ODD A;  5JI6 A;  1Z05 A;  1VTN C;  1YW8 A;  3V8K A;  4Y17 A;  3V4G A;  3BDD A;  2QZ8 A;  4OMZ A;  3C7J A;  3FZV A;  5JR3 A;  3WTT C;  4ESF A;  1OYI A;  1IRF A;  4WXC A;  4HQE A;  2Q8K A;  2QLZ A;  4G7O F;  5ICC A;  2CGP A;  4OU0 A;  3RYP A;  4IHS A;  2FBI A;  4RB1 A;  4BHB A;  1QPM A;  3Q5F A;  1GXQ A;  3MZH A;  4RGX A;  2DT5 A;  3IHU A;  3KEQ A;  3C18 A;  2R3S A;  4DQ2 A;  3DQV C;  4LJZ F;  3F6V A;  5DCM A;  4BAY A;  4HAM A;  2H09 A;  3LFK A;  2EFN A;  4OMY A;  4CHU A;  2ZO4 A;  1MDM B;  4IJA A;  1S7A A;  4HBL A;  2HFH A;  2OQR A;  4LG0 A;  1IUY A;  2GA2 A;  1UHM A;  1SAX A;  1OKR A;  2ZNZ A;  3V7C A;  4ENK A;  3DKW A;  5H20 A;  1KYW A;  4UV8 A;  2CSO A;  5JFR A;  2DI3 A;  5IT9 Z;  1R36 A;  1XMK A;  2VOD A;  4MQ9 F;  1XCV A;  5LBQ A;  3J80 Z;  1A04 A;  4HX4 A;  4RB2 C;  1IN4 A;  2IA2 A;  2BBY A;  2FSW A;  1YYV A;  1P2F A;  5HS8 A;  4MGR A;  1KU7 A;  4BHP A;  1ZRC A;  1SMY F;  1U5T C;  3IWF A;  3K1N A;  1XDS A;  1T0F A;  3CUQ C;  1GVJ A;  2HDC A;  4KNY A;  3QU3 A;  2UXN A;  4KUM A;  4ZYH A;  1O3R A;  4EM2 A;  1QBJ A;  1KA8 A;  3P7N A;  4HV6 A;  4L5J A;  1SD6 A;  4LLG F;  4FX4 A;  5H6R A;  3CO7 C;  5EEG A;  1MKM A;  2OD5 A;  3FWE A;  3T8T A;  5E17 F;  1UHW A;  3F8N A;  2NYX A;  1CF7 A;  4MHG A;  2ESN A;  2W84 A;  1S3J A;  2P5L C;  1O57 A;  1KU9 A;  4CZZ A;  2E7X A;  5AIQ A;  3E6C C;  1HW2 A;  1T39 A;  1FP2 A;  1B6A A;  2M8E A;  3ERE D;  3BJA A;  4I98 B;  4DNC A;  4O5V A;  3WU1 B;  3FXQ A;  1E2X A;  1S8N A;  1LEB A;  4CGZ A;  2VC0 A;  3I58 A;  1K7A A;  2YPR A;  4S05 A;  1IN8 A;  2JPB A;  3BRO A;  3GYH X;  3JW4 A;  4G6Q A;  3P9I A;  2PEX A;  2RGV A;  2ZME B;  2BE5 F;  3TDZ C;  1SD7 A;  3M1E A;  2OQG A;  1XSX A;  2HGC A;  4FT8 A;  4A0X A;  1TQM A;  4AWX B;  1O7L A;  1HQC A;  4YFX F;  1W5T A;  2V1D A;  2LDU A;  2QVO A;  3M8E A;  2EB7 A;  1BC8 C;  3J81 K;  2EWN A;  1B59 A;  3M8F A;  2WTE A;  4KT5 C;  3LQR A;  3GZ6 A;  1RUO A;  2ESH A;  4ASN A;  2BGC A;  3T8R A;  3U2R A;  5CJ9 A;  2P4W A;  5CVV A;  1DPR A;  3V7R A;  4A12 A;  4RGU A;  3WTV C;  4HYE A;  3JTG A;  1BOA A;  2FRH A;  4N9I A;  2PI0 A;  1XGO A;  2KJC A;  2GA1 A;  4P9U A;  5BMZ A;  5J8C A;  3I0T A;  2YX4 A;  1JXS A;  5KVR A;  4G7Z F;  2HQN A;  1EH7 A;  1CF7 B;  2MD5 A;  5HDG A;  4B09 A;  4AIH A;  4EQQ A;  1I6X A;  1Y0U A;  2PMH A;  1FZP B;  3FMS A;  3GFJ A;  2QQB A;  3DXJ F;  3E5U A;  4AD9 A;  1J5Y A;  2KIF A;  2DPU A;  1TQP A;  5LHI A;  5DD4 A;  1FNN A;  2QQA A;  2D2W A;  4A5N A;  2ZJ2 A;  1FC3 A;  2MH2 A;  3SZP A;  4YIF A;  4Q48 A;  1MJA A;  1O3T A;  1LDK B;  4HLY A;  2H6B A;  2GXG A;  3HIF A;  1B1B A;  2VC1 A;  5D5W B;  1RZ4 A;  4UNO A;  4F7Z A;  3QP6 A;  1ZG3 A;  2DQR A;  4GXO A;  3IRQ A;  2IP2 A;  2BYV E;  4RB0 A;  1ZHF A;  1D8K A;  1XN7 A;  2Y0M A;  4I02 A;  3R60 A;  3PFI A;  2VT3 A;  3L9F A;  1BM9 A;  1HKS A;  3HSE A;  3MAJ A;  5JHU A;  1J0R A;  3F8M A;  2PJP A;  1U8R A;  2EK5 A;  2VBX A;  4NQW A;  2OAZ A;  3HRS A;  1FOK A;  3I59 A;  1BJA A;  4A0Z A;  1FBU A;  1FYK A;  1STZ A;  3HOT A;  1FWZ A;  4LG0 B;  3LA3 A;  2COM A;  2O8X A;  1BI2 A;  2FE3 A;  2C6Y A;  5L3E A;  1I27 A;  1F1Z A;  1T98 A;  3IKV A;  4R1H A;  2HTJ A;  4E70 A;  2XKP A;  2F5F A;  1OPC A;  3HUG A;  1TW2 A;  5L3D A;  2FXA A;  1BIB A;  1HXD A;  1IXR C;  2CQK A;  4AVP A;  5D5U B;  4WX9 A;  4IVN A;  1IRG A;  1P6R A;  2J5P A;  1BI1 A;  1B9M A;  1L0O C;  3WTZ A;  5HVQ C;  4OIQ F;  2FBK A;  2L01 A;  2XHK A;  3RKX A;  2IPQ X;  4EVI A;  4B8X A;  3P9K A;  1DPU A;  4YG2 F;  2HYF A;  2FBH A;  3QPT A;  3E6B A;  3BY6 A;  5DCF A;  4L18 B;  4P96 A;  2XAS A;  3JAM K;  3KP3 A;  5E1Z B;  2FF4 A;  2WC2 A;  4ENN A;  4IXA A;  1Z9C A;  2DO7 A;  2HEO A;  1XGS A;  3KP6 A;  3MWM A;  2OA4 A;  5E8G A;  3KFW X;  3RKY A;  3ISP A;  5K5Q A;  1IW7 F;  1Q1H A;  4GO1 A;  5LGT A;  2W24 A;  3ECH A;  1SFX A;  3V7S A;  4CDG A;  3RYR A;  1V3F A;  4M6X A;  2P6T A;  1MD0 A;  1XMA A;  4EM0 B;  3I71 A;  2D1V A;  3KP2 A;  1J9I A;  5E8I A;  1ZN2 A;  2AS5 F;  4IRG A;  2GQQ A;  2DAO A;  4HX8 A;  1IXC A;  1WQ2 A;  3SFZ A;  3ZN1 A;  1YG2 A;  1XGM A;  4L9J A;  2RNJ A;  5K1Y A;  1R22 A;  4KN4 X;  4KFC A;  2QEN A;  2STT A;  2B0L A;  2EV0 A;  4G9Y A;  1H0M A;  1QGP A;  1HST A;  2IRF G;  2V9V A;  1REP C;  3OV8 A;  1WKM A;  3L09 A;  5JVT A;  4Y15 A;  3WTX C;  2Z99 A;  3QU6 A;  2XIG A;  2Y75 A;  3EET A;  2XUB A;  4IRH A;  1R1V A;  1HSJ A;  5E1X A;  3LA2 A;  4EJW A;  2HWV A;  3K2Z A;  3RKW A;  2FQ3 A;  4QLC U;  3TO9 A;  2DQL A;  1MDM A;  1SD4 A;  2K02 A;  3WG9 A;  2KKO A;  1IN6 A;  1L3L A;  1NHA A;  3VFZ A;  1U6G A;  4WWC A;  4XLP F;  5KK1 A;  4IF4 A;  3VEP A;  1J59 A;  4OIO F;  2K4B A;  4MTD A;  5A2Q K;  4FHT A;  2IVM A;  2VON A;  2FNA A;  4L9T A;  3E6D A;  5IT9 K;  5FD6 A;  1P92 A;  2M1B A;  1YQA A;  1ZRF A;  1YLF A;  5D5V B;  4RB3 C;  2D45 A;  3K69 A;  4ZZL A;  2GIV A;  3NRV A;  5L3B A;  4L0Y B;  5H6Q A;  3PQJ A;  5DD8 A;  2K27 A;  4M72 A;  1FT9 A;  2R7D A;  4RGR A;  3GXO A;  3U1D A;  3ZN0 A;  2EFP A;  2HR3 A;  1PP8 F;  2A5Y B;  2ELH A;  4R79 A;  4BQA A;  1U5T A;  3D0S A;  2ZNY A;  4LMY A;  2NAZ A;  1ZGJ A;  5BPD A;  1R1U A;  1Z6R A;  4KMU X;  2MA3 A;  2EV5 A;  5ILV A;  1ON1 A;  3BZ6 A;  2WV0 A;  1T6S A;  1PDN C;  1G3Y A;  1G3T A;  1ZG5 A;  2FOK A;  4FX0 A;  5IT3 A;  2QQ9 A;  4HZF A;  4D0P A;  2VXZ A;  4HLX A;  3ZP5 A;  2ZXJ A;  4I0A A;  3JSO A;  5ICE A;  2DW4 A;  4LFU A;  3WE3 A;  1F5T A;  3TGN A;  3GX4 X;  2GXB A;  3IRR A;  1MJB A;  1ZH5 A;  1RI7 A;  1FSH A;  2HYG D;  3JSP A;  2F5C A;  1ZLJ A;  3GW2 A;  2JT1 A;  4L9N A;  5F6F A;  3FF5 A;  2K7L A;  2XKO A;  1FY7 A;  2MC3 A;  4TV7 A;  4BYY A;  2XAQ A;  2JPC A;  5E20 A;  2P5V A;  4M71 A;  2M30 A;  3E5X A;  1TTY A;  3TO7 A;  5CVU A;  3QP5 A;  5BOX A;  1BI3 A;  4OOI A;  3KP7 A;  3ULQ B;  3DP7 A;  1O3S A;  2XGX A;  2XRO A;  2ETH A;  2PQ8 A;  4L9V A;  4XSZ F;  5K5O A;  1P4W A;  2M5W A;  1IXS B;  2HKO A;  2X0L A;  1Z7U A;  1FX7 A;  2RVC A;  2PBI A;  1KYZ A;  3F21 A;  3C1D A;  2KRF A;  5ILU A;  4RAZ A;  2XAH A;  2A68 F;  1BC7 C;  1UB9 A;  2F5D A;  3I54 A;  5LHH A;  4S04 A;  4P9F A;  3WU0 A;  2A61 A;  1Z6T A;  3ZMV A;  2VOO A;  1R5H A;  3ZPL A;  3KLO A;  4LGW A;  4AIK A;  4G94 A;  2DU9 A;  1KU3 A;  1EH6 A;  3WGG A;  1W4M A;  1FBS A;  4XSX F;  1YS6 A;  2PMU A;  3TKY A;  3I53 A;  4KMF A;  2NNY A;  2PG4 A;  2CYY A;  4HQM A;  1UFM A;  2E1N A;  4EGY A;  3WTW C;  3I59 B;  1W5S A;  4WXH A;  3HTS B;  2UXX A;  4I09 A;  3CUQ A;  5L3G A;  1YTY A;  4WCG A;  3I5U A;  4OIR F;  3HSR A;  5LEK A;  4LD5 A;  4GGG A;  4M9X A;  3R4K A;  2IT0 A;  2ZKZ A;  2JTV A;  4CO8 A;  4LB5 A;  1AOY A;  4I7H A;  3W6J B;  1MZB A;  5E18 F;  4RGS A;  3RI4 A;  4MNU A;  4EGZ A;  3KET A;  3RDI A;  2CWE A;  1ZGA A;  4Q5S F;  3T5X A;  2RC4 A;  3DV8 A;  5FD5 A;  2V6C A;  4A6E A;  3W6K B;  3ZMZ A;  3J7A O;  4P5O A;  4XLN F;  2G7H A;  3TOB A;  3KEO A;  3GWZ A;  3SHF A;  1TW3 A;  1USS A;  2CFX A;  1HW1 A;  5ICF A;  4HOB A;  1EV7 A;  4Q47 A;  4ENJ A;  2YR2 A;  4RAY A;  2NRA C;  1KQ0 A;  4YII A;  3GUD A;  3CUO A;  3U9G A;  3AAF A;  1P4X A;  3JTH A;  1I1S A;  3HHH A;  1PUE E;  4Q4Z F;  5BS6 A;  3KCC A;  3K9T A;  2CG4 A;  2ISY A;  4L0Z B;  2EA2 A;  2O0Y A;  2BV6 A;  3N4M A;  3FX3 A;  1ZYR F;  3I4P A;  3LST A;  2DPD A;  5CVJ A;  4U7D A;  3EYY A;  3NQO A;  4N0B A;  2HZT A;  4PCQ A;  2JRT A;  1ZAR A;  4PZJ A;  2E1C A;  2ISZ A;  2DFI A;  2ACJ A;  1T2K A;  2A69 F;  1TBX A;  2X4H A;  3EQL F;  2HOE A;  1K79 A;  4XRF A;  3IL2 A;  4UXN A;  1LQ1 A;  2VN2 A;  3K1M A;  2XV4 S;  1W7P B;  2EFO A;  1TNT A;  1RUN A;  1S7O A;  4CIC A;  3WTS C;  5CLS A;  4YFN F;  5E1W A;  2CO5 A;  2BEO A;  5TJJ A;  1FYL A;  2KJB A;  1UCR A;  4G6D A;  1GHC A;  1X3U A;  4AIJ A;  4LLL A;  3TDU C;  3J80 K;  5BQT A;  5D8K B;  4HW0 A;  1W7P D;  3VB2 A;  2LF8 A;  4YFK F;  3MFK A;  1YFH A;  1HW5 A;  4HV5 A;  1Z91 A;  4UVA A;  3CJN A;  3VOD A;  2EFQ A;  4UVC A;  1XDU A;  5K5R A;  3V8J A;  1ZRE A;  4IPA A;  1JHF A;  5CVR A;  3REO A;  2STW A;  3BJO A;  2VBZ A;  2DTR A;  1F4K A;  3FMR A;  2EJR A;  2XAG A;  4ON0 A;  1D3Y A;  2VT2 A;  5DCM B;  3ECO A;  5FGM A;  2P6S A;  5HS7 A;  2XAJ A;  4KN7 X;  4U0V A;  1WWX A;  1ON2 A;  2K86 A;  3E6M A;  4WXD A;  5CYV A;  3T1B A;  1DP7 P;  2G7U A;  4HX7 A;  3BPX A;  3IC7 A;  2HS5 A;  1QNT A;  4KA4 A;  1JGS A;  5CVI A;  3WGH A;  3F3X A;  1XD7 A;  2VBW A;  5ERI A;  4PDK A;  2DK8 A;  3L00 A;  2LNB A;  1LNW A;  3F8F A;  3BJ6 A;  4NHJ A;  3R0A A;  4O6J A;  3F72 A;  3BP8 A;  4GYG A;  3B02 A;  2IW5 A;  1U2W A;  4I2O A;  2JSC A;  3ABT A;  3WGI A;  4G7H F;  4LLN A;  5DUK A;  4M73 A;  2ZFW A;  4LB6 B;  1W7P A;  5J8F A;  2G9W A;  3E3V A;  1LEA A;  4UHT A;  3TOA A;  1ULY A;  3C3W A;  3F6O A;  1ZRD A;  2K4J A;  2MH9 A;  4WK8 F;  2O61 A;  1J2X A;  5F1R A;  1ZG1 A;  2A07 F;  2W25 A;  3CLO A;  3SXY A;  1U3E M;  1R23 A;  2Z9O A;  4HDV A;  4EJO A;  4U88 A;  5TRD A;  4UUV A;  3HTU A;  1EH8 A;  3H3Z A;  6PAX A;  1YIO A;  4Z2Y A;  1Z1D A;  1CGP A;  2JZY A;  4HF1 A;  4P55 A;  4R8H A;  1RIO H;  3RPQ A;  3HRU A;  2HQR A;  1G3S A;  2L4A A;  5FO5 A;  1OR7 A;  3GLX A;  2VBY A;  3J81 Z;  1GXP A;  2QM3 A;  2P7C B;  1SD5 A;  3F8B A;  5A2Q Z;  2RDP A;  2DLL A;  2XVC A;  4M9Z A;  5F64 A;  5FFX A;  1HKT A;  4QWQ A;  4MTE A;  1BIA A;  2ADU A;  5LHG A;  1OYY A;  3E97 A;  1S29 A;  2QWW A;  1ONV A;  2TDX A;  4ESJ A;  1H9T A;  3RJP A;  1BI0 A;  2L54 A;  2KIU A;  3LAJ A;  3CDH A;  3ZMS A;  2ZCW A;  5ED4 A;  1V4R A;  2Z3Y A;  3SZT A;  3H3U A;  1PP7 U;  1HBX G;  2FA5 A;  1AWC A;  4OIP F;  2HTS A;  3R0J A;  1QZY A;  2V1X A;  3WOD F;  2QYO A;  4JBA A;  3ABU A;  4O3M A;  4KIC A;  2Y48 A;  4H0E A;  3GFM A;  1JE8 A;  1UST A;  3KZY A;  1D5V A;  3WTU C;  4IHT A;  3EDP A;  1G3W A;  2GWR A;  5J6X A;  3MZY A;  4NB5 A;  3BWG A;  2EFW A;  1FSE A;  3ZMT A;  2VOP A;  2QBY A;  1OYW A;  1KGS A;  2PLY A;  3R6S A;  4HA8 A;  3WTY C;  1BN5 A;  1MGT A;  4ZH4 F;  5ICG A;  3QPH A;  5D6E A;  2H94 A;  3COA C;  2QBY B;  2W85 A;  3DPL C;  2GAU A;  4CXF A;  2YX7 A;  1XGN A;  1TQI A;  3HHG A;  3HRT A;  4CYD A;  1FPQ A;  4HF0 A;  1IF1 A;  3KZZ A;  5LGU A;  2Q0O A;  3FM3 A;  1RNL A;  4EM1 A;  5HLH A;  1QO0 D;  2E7W A;  4OIN F;  4KIB A;  2L02 A;  4A0Y A;  3F8C A;  2O6G E;  2O03 A;  4BXU A;  4K2E A;  2IA0 A;  1G6N A;  5ILS A;  1KQ8 A;  2WWY A;  1IN7 A;  2L3D A;  5HOO A;  1J75 A;  3B73 A;  4ZYD A;  3L2C A;  4PGH A;  5DYM A;  1K78 B;  5LLQ A;  3HOS A;  4A5M A;  3LAP A;  5D6F A;  2IJL A;  5DDG A;  3LWF A;  2OU2 A;  3M9A A;  1K78 A;  3R61 A;  2FNP A;  1FLI A;  3LQQ A;  2EA4 A;  5L3C A;  1WI9 A;  3KP5 A;  4A2U A;  2W57 A;  5L3F A;  3GZ5 A;  3JAM Z;  3MEX A;  5DEQ A;  4KIG A;  2CW0 F;  4G8X A;  1TLH B;  2LSO A;  4MQV A;  1U78 A;  3NEU A;  3DPT A;  1KU2 A;  5D4S A;  4U7B A;  3LA7 A;  3FMQ A;  1J7K A;  2FEZ A;  2M87 A;  5LEJ A;  4U0W A;  4ETS A;  2H6C A;  1BBY A;  4GYI A;  1R58 A;  4Y13 A;  1TNS A;  3D5L A;  3EYI A;  2YSR A;  5HDN A;  2RV8 A;  5D5X B;  3IKT A;  2VE9 A;  3K1P A;  2DBB A;  3TO6 A;  4XBF A;  1XSV A;  1WSU A;  4KDP A;  1SMT A;  4MEY F;  1ZLK A;  2L4M A;  3RIR A;  5DUI A;  2V79 A;  1LDD A;  1MJ9 A;  2V1U A;  2P8T A;  3GEZ A;  4UVB A;  1IAW A;  1XCB A;  2AXL A;  3V8L A;  1C0W A;  3FXU A;  3T0Y A;  3Q9V A;  3QAH A;  3IWZ A;  2DK5 A;  3ML6 A;  3RPU A;  2FML A;  3CO6 C;  3TQN A;  5LRS A;  1IN5 A;  1JHH A;  3ZMD A;  2XRN A;  3EUH A;  2MLK A;  2F5E A;  3S2W A;  2FMY A;  3O2P E;  1FBQ A;  2ZME A; 
#chains in the Genus database with same CATH topology
 2DA3 A;  2UV1 A;  3F22 A;  2BXZ A;  1AA7 A;  2CS3 A;  5GTI C;  2DA1 A;  2P81 A;  4U0Y A;  3ELK A;  4BHC A;  2XPV A;  3G73 A;  1VQ4 I;  2RKH A;  3CJT B;  3VYR B;  1I5Z A;  1E17 A;  5D8L B;  5K7F A;  3G1O A;  3CTA A;  4A3C J;  3BOQ A;  1DGW Y;  3PFY A;  5HS9 A;  4EJU A;  2LOO A;  1MMA A;  3BTI A;  2M45 A;  3HRM A;  2VE8 A;  1FP1 D;  1X2M A;  1B9N A;  3GFL A;  3L2W A;  4M3B A;  1ETY A;  5HLI A;  3L1P A;  2DMN A;  2MW8 A;  3OYK A;  2HKX A;  4D5F A;  1DDN A;  1YW7 A;  1LB2 A;  1ZTR A;  3GF2 A;  2EIL H;  3CP8 A;  3LSI A;  4PK4 A;  3BR1 A;  3M8J A;  1HKQ A;  2UZK A;  1N77 A;  3OOP A;  2YUS A;  3MCZ A;  3JR9 A;  1TT5 B;  1YO5 C;  3K6G A;  4EJT A;  2LKP A;  3V42 A;  3RKQ A;  2YU3 A;  3LFU A;  4JQF A;  4A3L J;  3DEW A;  3PQK A;  3TBI A;  4WF2 A;  2LR8 A;  5LGN A;  4DW6 A;  2Z5U A;  1T8I A;  2MBF A;  2WY7 Q;  4EMS A;  4E7I A;  4ZYE A;  3FHN A;  2DT7 B;  2VL8 A;  1VZ0 A;  2KIM A;  3ROU A;  4A6D A;  3ZMU A;  4ZZD A;  2J5O A;  3C2H A;  2QSH X;  4AYB A;  1I3Q J;  4EV0 A;  3M7G A;  3HYI A;  4F91 B;  1QZZ A;  2CW8 A;  4RA2 A;  1H9G A;  5EF6 A;  3I64 A;  2D5V A;  3MQ0 A;  5AIP A;  5C3E J;  4EJV A;  3GO5 A;  2DDB A;  3A1Y A;  4N9H A;  1T38 A;  2O3F A;  3AFH A;  2R93 J;  3SQN A;  2R7Z J;  1LVA A;  1BR4 A;  4UV9 A;  2ZBK A;  4BE2 A;  3OYA A;  3QRF F;  1R1T A;  2GZW A;  4F52 A;  2BY3 A;  3DBR B;  2LKX A;  3GVA A;  2A6H F;  3QOE A;  3KLN A;  2DJN A;  2IS2 A;  4LIV A;  1ZQ3 P;  3E1S A;  4BU2 A;  3DF8 A;  4HF2 A;  3QPS A;  1V5F A;  3GFI A;  4QTR A;  5EEH A;  1XSD A;  2KDO A;  2IA1 A;  1MW7 A;  1D8J A;  2ELK A;  2VKE A;  3L2Q A;  1P4A A;  4HDU A;  2N8G A;  3KYC B;  3H35 A;  1YS7 A;  2D1H A;  4PGG A;  3D1N I;  2HDD A;  4BNC A;  1QQI A;  4GRI A;  1X1D A;  3I9V 2;  4LG3 A;  4KIF A;  1R7J A;  2MC4 A;  4A3F J;  5DM6 F;  4Y7N J;  3PNT A;  1IZ1 A;  1FYM A;  2IS6 A;  3OIQ A;  2CV2 A;  5J1Y A;  5FFZ A;  5FB2 A;  3RSN A;  4M9S A;  1ACI A;  1XB4 A;  3DEU A;  4RS8 A;  5EDN A;  2FU4 A;  3FHZ A;  2H27 A;  4LK1 F;  4CYC A;  1SFU A;  3K0L A;  4KYW A;  5FKO A;  4LK0 F;  4LIU A;  4IOC F;  1DUX C;  4UUT A;  2P5K A;  3DFG A;  5AON A;  3KE2 A;  1R4N B;  3H92 A;  2Z33 A;  1E3P A;  3K70 D;  4M6Y A;  1G4D A;  3KYL A;  2E1M C;  5HLG A;  3P9C A;  4XNF A;  4BH9 A;  4M74 A;  4Z6Y A;  2P7V B;  1POG A;  2NNN A;  2RQP A;  4E6K G;  3O6B B;  1YIT I;  1R00 A;  4JK1 X;  1I3A A;  1BJZ A;  1F9N A;  3QOP A;  4C3H J;  2F2E A;  5D4R A;  2L9V A;  2OZU A;  4XKV A;  3WE2 A;  1OMI A;  3L7W A;  1I1G A;  4ZYG A;  4JYK A;  4X1E A;  5GAE J;  1MBJ A;  5HNF A;  1WRJ A;  2OTL I;  1K6O A;  3IP4 B;  3HSF A;  2XSD C;  3F23 A;  3CCU I;  1B4A A;  2OPT A;  5KCM A;  4XON A;  1SFE A;  5FLX Z;  4IRI A;  3VOE A;  5F08 A;  4I01 A;  3SEQ A;  3Q9S A;  1CQT A;  2UWM A;  2QKL B;  4I0B A;  1QHH D;  3CUQ B;  2XAF A;  3N97 A;  3M3Y J;  3ZQ7 A;  3FXR A;  3RTR A;  4D7N A;  4YIR X;  3OYL A;  1I50 J;  1NH3 A;  2EZH A;  2PFB A;  4ESB A;  3OS0 A;  1W0U A;  1ZAO A;  2M0C A;  2DMT A;  2DMU A;  1KQ9 A;  3A01 B;  1O7F A;  5BPI A;  4PJJ A;  1LDJ A;  4IHY A;  2OTJ I;  3J7A Y;  1O3Q A;  1VQ8 I;  4GCV A;  1S6L A;  1RC9 A;  4XK4 A;  2PN6 A;  1O4X A;  2BW3 A;  1RR8 C;  2R7U A;  2BY1 A;  2RN7 A;  4XLH A;  5DTD A;  2R7F A;  5LRR A;  4HG2 A;  3G3Z A;  1X4P A;  4JX4 A;  5FLX K;  4C3J J;  5F0F A;  4C3I J;  3DBL B;  5DV5 A;  4AU7 A;  3ZCO A;  4MEX F;  5HDK A;  4L5I A;  1U5T B;  2EV6 A;  3TW7 A;  5JHF A;  2OBP A;  2CRG A;  3CES A;  2A3S A;  3C2B A;  4E4H A;  4CCK A;  1R5G A;  2Y0S N;  5B1B H;  1JJ8 C;  3FM5 A;  2OZ6 A;  1LVK A;  2A6E F;  2NS0 A;  4NQW B;  2LF7 A;  4ENM A;  2EIJ H;  2WV1 A;  1U0J A;  2MLG A;  4HSR A;  3KP4 A;  2QUF A;  1M1E B;  1OR7 C;  3O3K A;  1ORK A;  1W36 C;  1ZKG A;  3PNY A;  3WHC A;  1YW9 A;  2Q2E A;  2I10 A;  3E5Q A;  4CCJ A;  1ZEL A;  1B8I A;  1LJ9 A;  3BPV A;  1ODD A;  5JI6 A;  1Z05 A;  1P9Q C;  1VTN C;  2K9Q A;  1YW8 A;  2Q2E B;  1W0T A;  3V8K A;  4Y17 A;  4I99 C;  3V4G A;  3K4K A;  3BDD A;  2QZ8 A;  4OMZ A;  4XN3 A;  5KHD A;  2LFB A;  3C7J A;  2LP0 A;  3FZV A;  5JR3 A;  4E7J A;  3WTT C;  4ESF A;  1OYI A;  4M3F A;  1IRF A;  4WXC A;  4HQE A;  2Q8K A;  2QLZ A;  2G0E A;  4G7O F;  5ICC A;  1MSE C;  2CGP A;  4OU0 A;  3FXM A;  1WJC A;  4RM3 A;  3RYP A;  4IHS A;  1PUF A;  3MVP A;  4IL6 C;  3TP0 A;  5FJ8 J;  2FBI A;  4RB1 A;  4BHB A;  1JUM A;  2LKS A;  1QPM A;  3Q5F A;  5IP6 A;  1GXQ A;  3MZH A;  1WH5 A;  4RGX A;  2DOD A;  2DT5 A;  3IHU A;  2X6X A;  5E3L A;  1T08 B;  3KEQ A;  3HUG B;  3ABK H;  3C18 A;  2XSJ C;  3H36 A;  4B3X A;  2R3S A;  1FTT A;  3PIO F;  2HNH A;  4DQ2 A;  3DQV C;  4XKW A;  4LJZ F;  1BOB A;  3F6V A;  3VYS B;  4ZDO A;  1NTC A;  5DCM A;  4BAY A;  4B48 A;  4HAM A;  1P7I A;  2H09 A;  2XC7 A;  3BR6 A;  3LFK A;  4F92 B;  2EFN A;  3D5R C;  4N4O B;  2NOJ B;  1VQ5 I;  3RZO J;  2KMU A;  4OMY A;  4OWR B;  4EAT A;  4CHU A;  2ZO4 A;  3OYG A;  1MDM B;  2X6Y A;  3JRF A;  2HVS A;  4IJA A;  1S7A A;  1YJN I;  1BA5 A;  3PSI A;  1XX5 A;  4HBL A;  2HFH A;  2OQR A;  4LG0 A;  1IUY A;  2GA2 A;  1UHM A;  5C4J J;  1IJW C;  1Q1V A;  2Y9Y A;  2ZSI B;  1SAX A;  2Y2Z A;  4QIW N;  4XRM A;  1APL C;  1OKR A;  5EGO A;  1SVO A;  2ZNZ A;  3V7C A;  4ENK A;  3DKW A;  1ETX A;  5H20 A;  1JTY A;  3ZRG A;  4B1R A;  4BAC A;  1KYW A;  2KIS A;  3BC8 A;  3H3V K;  2X51 A;  5J40 A;  4UV8 A;  3G6E I;  2CSO A;  5JFR A;  4C2M J;  4W1U A;  2DI3 A;  5IT9 Z;  1R36 A;  1XMK A;  2VOD A;  2Y69 H;  1IRZ A;  3PUB A;  4MQ9 F;  1XCV A;  5LBQ A;  3LSH A;  3J80 Z;  1A04 A;  2PMZ N;  2E5N A;  4HX4 A;  3S3O A;  4BY1 J;  4RB2 C;  1IN4 A;  3HOV J;  2IA2 A;  3QPL A;  2K3P A;  4CSW A;  2BBY A;  2FSW A;  3H0G J;  1YYV A;  1P2F A;  5HS8 A;  3AG1 H;  4MGR A;  1IV6 A;  1KU7 A;  4BHP A;  1ZRC A;  1SMY F;  1U5T C;  4M3G A;  4NC7 A;  3IWF A;  3K1N A;  2DYR H;  1XDS A;  1T0F A;  3CUQ C;  1GVJ A;  2HDC A;  2R0Q C;  4KNY A;  2TCT A;  3OL4 A;  3QU3 A;  4JOM A;  1VI0 A;  2UXN A;  4B4C A;  1OFC X;  5H2F C;  4KUM A;  3OYI A;  4ZYH A;  3BQZ A;  3WU2 C;  1D0X A;  1O3R A;  4EM2 A;  1QBJ A;  2JA8 J;  1KA8 A;  3P7N A;  4B3A A;  4HV6 A;  1JTX A;  2VKH A;  1ENH A;  3OYN A;  2M4G A;  4L5J A;  3OY9 A;  1SD6 A;  4LLG F;  1Y39 A;  2IS1 A;  2L9R A;  1Z77 A;  4FX4 A;  4XKB A;  5H6R A;  5EEG A;  3CO7 C;  1MKM A;  2OD5 A;  3FWE A;  3T8T A;  5E17 F;  1UHW A;  3VYT B;  4HNU A;  1SVL A;  3F8N A;  2NYX A;  1CF7 A;  3FK7 A;  4MHG A;  2ESN A;  3GTP J;  3HC7 A;  2W84 A;  4PSW A;  1T95 A;  4ZC3 A;  1S3J A;  2AXT C;  2JK3 A;  3K2A A;  1O57 A;  3KPH A;  2LBF B;  3CCJ I;  2P5L C;  1KU9 A;  4E7K A;  1YJ9 I;  3O8H A;  4CZZ A;  2E7X A;  2KP6 A;  4BE0 A;  3MD2 A;  1MH4 A;  3NAU A;  1FJL A;  2H8R A;  5AIQ A;  2L0K A;  3E6C C;  1UAA A;  1HW2 A;  1T39 A;  1WPK A;  1FP2 A;  2VLA A;  1B6A A;  2WAQ A;  2M8E A;  3ERE D;  4A3I J;  3BJA A;  5F0C A;  4I98 B;  4DNC A;  2XF7 A;  4O5V A;  3WU1 B;  3FXQ A;  1E0E A;  4BEH A;  1E2X A;  1S8N A;  1LEB A;  2E19 A;  2V26 A;  2ME0 A;  4CGZ A;  2VC0 A;  5B66 C;  1MND A;  1Z67 A;  3GTL J;  3I58 A;  2BOL A;  5FKM A;  4C2T A;  1K7A A;  1T56 A;  2YPR A;  4S05 A;  1IN8 A;  3RQ4 A;  2JPB A;  3DKY A;  3AL0 B;  2JSP A;  3BRO A;  3GYH X;  2R7S A;  2CQX A;  3JW4 A;  4G6Q A;  3P9I A;  2CQQ A;  2PEX A;  2RGV A;  4RMN A;  2ZME B;  2BE5 F;  3W2A A;  5F0H A;  3TDZ C;  3FXJ A;  1SD7 A;  3M1E A;  4CH7 A;  2F5V A;  2OQG A;  1XSX A;  2HGC A;  4FT8 A;  1SFO J;  4A0X A;  2BHZ A;  1TQM A;  4AWX B;  1O7L A;  1HQC A;  2LYC A;  5GAH J;  1WGX A;  4YFX F;  1WJA A;  1W5T A;  2V1D A;  3QYB A;  2LDU A;  2QVO A;  2V4J C;  3K70 C;  1ZK8 A;  3M8E A;  2EB7 A;  3ASO H;  4F93 B;  3S3N A;  2CUE A;  1BC8 C;  3J81 K;  1X1B A;  2EWN A;  1B59 A;  3M8F A;  2F48 A;  2WTE A;  3HGY A;  4KT5 C;  4ANJ A;  3LQR A;  3GZ6 A;  3RQI A;  2GOM A;  3CCL I;  2ESH A;  1RUO A;  4ASN A;  1U8B A;  2BGC A;  2LH9 A;  3T8R A;  1WJE A;  4BE1 A;  3U2R A;  5CJ9 A;  1TP4 A;  2DN0 A;  2P4W A;  2WB1 N;  5CVV A;  1DPR A;  3V7R A;  4A12 A;  4RGU A;  5HOD A;  1U9N A;  3WTV C;  3DPU A;  4BQO A;  4HYE A;  3JTG A;  1BOA A;  4B44 A;  2E1O A;  2FRH A;  1MMS A;  3HB9 A;  1TWC J;  4OAZ A;  4N9I A;  4Y3O A;  5EYR A;  2PI0 A;  5IP7 J;  4V2G A;  1XGO A;  4C2U A;  9ANT A;  4IKF A;  2KJC A;  2GA1 A;  4P9U A;  5BMZ A;  3ZXS A;  5IYD J;  3K10 A;  2IEK A;  4BJ5 C;  5J8C A;  3S2D J;  3S8P A;  3I0T A;  4Y33 A;  1VQ6 I;  2YX4 A;  1HOM A;  1JXS A;  5KVR A;  1R6R A;  2HQN A;  4G7Z F;  2V9P A;  1EH7 A;  1CF7 B;  2V1N A;  3FXL A;  2MD5 A;  3VSK A;  2RNG A;  3ZQG A;  2FUG 2;  5GAD J;  5HDG A;  4B09 A;  1DU0 A;  1EF4 A;  1WJB A;  2FQ4 A;  4MFD A;  4AIH A;  3GTQ J;  4EQQ A;  1I6X A;  5J47 A;  2UUZ A;  3U21 A;  1Y0U A;  1S5L C;  4MIM A;  2PMH A;  5B5E C;  3JRD A;  3OSG A;  1FZP B;  3RPU D;  5FLM J;  3HZJ A;  2H8W A;  2DA6 A;  3FMS A;  2XGE A;  3GFJ A;  2QQB A;  1X1A A;  3DXJ F;  1TWG J;  4C30 A;  3E5U A;  4RAG A;  3CDL A;  1NK2 P;  4AD9 A;  1J5Y A;  2KIF A;  2DPU A;  1ETW A;  4CUG A;  1XTA A;  2DOA A;  3K4C A;  1ETO A;  1TQP A;  5LHI A;  1R49 A;  5DD4 A;  3VPR A;  1FNN A;  2QQA A;  3OYF A;  2D2W A;  4A5N A;  2ZJ2 A;  4HNV A;  3CC2 I;  1FC3 A;  2MH2 A;  3SZP A;  4YIF A;  1JI8 A;  2E1M B;  2JVH A;  4Q48 A;  1MJA A;  2ZSH B;  1O3T A;  2BZT A;  1LDK B;  2E34 A;  4HLY A;  2H6B A;  2GXG A;  3HIF A;  1B1B A;  3S15 J;  1FEX A;  3EPZ A;  2ZJQ F;  3S17 J;  2VC1 A;  5D5W B;  1DP3 A;  1RZ4 A;  4UNO A;  2DA4 A;  4F7Z A;  3QP6 A;  1ZG3 A;  2DQR A;  5LD2 C;  2Z2S B;  1MH3 A;  1R4M B;  1WVR A;  2KL4 A;  4GXO A;  3IRQ A;  3S14 J;  1HC8 A;  2IP2 A;  2OV7 A;  1X1C A;  2BYV E;  3PNV A;  1AU7 A;  3CMY A;  4BDZ A;  2M4K A;  1MMD A;  2VJ4 A;  4DZJ A;  4RB0 A;  1ZHF A;  4MFE A;  2HXI A;  1D8K A;  4BS9 A;  3CZ6 A;  3KX2 A;  1XN7 A;  2Y0M A;  2R7R A;  3AG4 H;  4I02 A;  3R60 A;  2FJ1 A;  1MBH A;  3PFI A;  1EKE A;  2X9D A;  2WY8 Q;  2VT3 A;  3L9F A;  1BM9 A;  1HKS A;  3GTK J;  3HSE A;  3MAJ A;  3CP2 A;  3GTG J;  2DA2 A;  2LY2 A;  5JHU A;  4ZDL A;  1TL8 A;  1YX3 A;  1J0R A;  3F8M A;  3TMO A;  2O8K A;  2VIX A;  2PJP A;  1U8R A;  2EK5 A;  2VBX A;  4NQW A;  2OAZ A;  3HRS A;  1FOK A;  3I59 A;  1BJA A;  4A0Z A;  2EQR A;  3ZGK A;  3H9J A;  1XG1 A;  3MMY B;  2MFZ A;  1FBU A;  1FYK A;  1STZ A;  3HOT A;  1MMG A;  1FWZ A;  3UKG A;  1Y1V J;  3LA3 A;  4LG0 B;  3ZQI A;  2ZJP F;  2COM A;  2O8X A;  1BI2 A;  2FE3 A;  3HKZ A;  2QSG X;  2C6Y A;  4DYR A;  4ABZ A;  4AUX A;  3OOU A;  1FMV A;  1I27 A;  5L3E A;  1F1Z A;  2KQR A;  2XDV A;  1T98 A;  3IKV A;  4R1H A;  1X58 A;  2VXD A;  2HTJ A;  4E70 A;  1RR7 A;  3JRE A;  2XKP A;  2F5F A;  4IHW A;  1OPC A;  3HUG A;  1TW2 A;  2CQ7 A;  3SZG A;  5L3D A;  2LY9 A;  2FXA A;  3DKX A;  1BIB A;  1HXD A;  1IXR C;  1N25 A;  2CQK A;  5CQG A;  3PSF A;  4AVP A;  5D5U B;  4WX9 A;  4IVN A;  3HOX J;  3OSF A;  1IRG A;  1P6R A;  1YX5 A;  4FE7 A;  2J5P A;  1B9M A;  1BI1 A;  1L0O C;  2VPL A;  1ERD A;  3M07 A;  3WTZ A;  2M3A A;  2FX0 A;  3PL8 A;  5HVQ C;  2KZG A;  4OIQ F;  5DM7 F;  2FBK A;  3F9K A;  2L01 A;  4ZJZ A;  2XHK A;  1T33 A;  3RKX A;  2IPQ X;  4EVI A;  1RES A;  4B8X A;  1ZR2 A;  4PUS A;  3P9K A;  1MNE A;  1DPU A;  4YG2 F;  3A2K A;  2HYF A;  2FBH A;  5IYB J;  3QPT A;  5M5X J;  3E6B A;  3BY6 A;  5DCF A;  1X2N A;  4L18 B;  4P96 A;  3G1L A;  2XAS A;  4DJA A;  3JAM K;  3OMY A;  2CFO A;  3JCU C;  2VI6 A;  2NS8 A;  3KP3 A;  3K4J A;  5E1Z B;  2FF4 A;  2X1C A;  2WC2 A;  4ENN A;  2E36 A;  4IXA A;  5J1U A;  1Z9C A;  3ZQC A;  2LRE A;  2FD5 A;  1ZR4 A;  2DO7 A;  2HEO A;  1XGS A;  3KP6 A;  3MWM A;  1IUF A;  2OA4 A;  4I76 A;  5E8G A;  3KFW X;  3LSP A;  3RKY A;  3ISP A;  5K5Q A;  2QF7 A;  1IW7 F;  1Q1H A;  4HRI A;  4GO1 A;  3ZQQ A;  2DT6 A;  4XR6 A;  3L2R A;  5J1R A;  4NUB A;  5LGT A;  4L5E A;  2M0M A;  2W24 A;  3ECH A;  1SFX A;  3KEY A;  2WAE A;  3V7S A;  4BY7 J;  3BCB A;  4CDG A;  3RYR A;  1V3F A;  4M6X A;  2VJ5 A;  4QPO A;  2P6T A;  3M1C A;  1MD0 A;  3C2G A;  1XMA A;  3CJR B;  3CCE I;  1VQ7 I;  3PJR A;  2E35 A;  2NS7 A;  3I71 A;  4EM0 B;  2D1V A;  3FKI J;  3KP2 A;  1XS9 A;  2ZB9 A;  5J4V A;  1J9I A;  5FKK A;  3DLL F;  5E8I A;  1ZN2 A;  2AS5 F;  4IRG A;  4XKC A;  5DS9 A;  2GQQ A;  1K4S A;  2DAO A;  3HL2 A;  4HX8 A;  1IXC A;  1WQ2 A;  1YRN A;  3SFZ A;  4XOT A;  1I39 A;  2M7B A;  1IGN A;  3ZN1 A;  1YG2 A;  2F4I A;  2Y0S A;  1XGM A;  5CQE A;  4L9J A;  2RNJ A;  4F3Q A;  5K1Y A;  1BL0 A;  2ID3 A;  1R22 A;  1QHG A;  2HVR A;  4KN4 X;  4KFC A;  2QEN A;  4II3 A;  2STT A;  1TWF J;  3JRA A;  3AKZ A;  3N05 A;  4XID A;  1FIA A;  2B0L A;  2EV0 A;  2K3F A;  4G9Y A;  1OCZ H;  1A5J A;  1H0M A;  1TC3 C;  2R7W A;  1MIJ A;  1QGP A;  3CCS I;  1HST A;  2IRF G;  2WB1 A;  1QA6 A;  2V9V A;  1REP C;  3OV8 A;  1WKM A;  3L09 A;  4NNJ A;  5JVT A;  4Y15 A;  3WTX C;  2Z99 A;  3QU6 A;  2XIG A;  2Y75 A;  1S7E A;  3EET A;  2XUB A;  4IRH A;  1R1V A;  2WA0 A;  2VQH A;  4DBQ A;  1HSJ A;  2CH0 A;  5E1X A;  3LA2 A;  4EJW A;  5JLW A;  2HWV A;  3K2Z A;  4HST A;  3RKW A;  2FQ3 A;  3IH4 A;  3S2H J;  3NAR A;  2LC2 A;  4QLC U;  3TO9 A;  4IHX A;  1D0Z A;  2JVG A;  3A03 A;  2DQL A;  1MDM A;  1SD4 A;  4JP0 A;  2K02 A;  1R71 A;  1KON A;  1BR2 A;  3WG9 A;  3QWL A;  2IAI A;  4C9Y A;  2KKO A;  3ASN H;  1IN6 A;  1L3L A;  2DOE A;  1FTZ A;  1NHA A;  3VFZ A;  4IQ4 A;  3S1M J;  1U6G A;  1FIP A;  2COB A;  3GCM A;  4Y4R A;  4XLP F;  4WWC A;  1PJR A;  2K9N A;  5KK1 A;  4IF4 A;  3NWT A;  3VEP A;  1J59 A;  3K4M A;  3FDY A;  2L7Z A;  3H5A A;  4OIO F;  2K4B A;  4MTD A;  3WHB A;  5A2Q K;  3DLA A;  2BY0 A;  1E3O C;  4FHT A;  2IVM A;  5GPA A;  2VON A;  3LSG A;  4FTH A;  3DEE A;  2KIQ A;  4CCM A;  2FNA A;  5FLV A;  4L9T A;  1NG6 A;  3E6D A;  4JX5 A;  2ME6 A;  5IT9 K;  4CA0 A;  1UJ8 A;  4QPQ A;  5FD6 A;  1P92 A;  3JRH A;  2M1B A;  3CC7 I;  1YQA A;  1ZRF A;  1GV5 A;  4FE4 A;  1YLF A;  3HOZ J;  4FCY A;  5D5V B;  2VJI A;  4RB3 C;  3IH2 A;  2Y30 A;  2D45 A;  3K69 A;  1VQP I;  4ZZL A;  2GIV A;  3NRV A;  2IGK A;  3K7A J;  4PJ0 C;  2VQL A;  2K9M A;  1OCO H;  2ECC A;  3L2U A;  5L3B A;  4L0Y B;  5EJC A;  5H6Q A;  3EUH C;  3CMA I;  1YIJ I;  3PQJ A;  5DD8 A;  1YHQ I;  4XOR A;  3RZD J;  2K27 A;  4M72 A;  1FT9 A;  2R7D A;  4RGR A;  3GXO A;  3U1D A;  1OJL A;  3ZN0 A;  2CV1 A;  2EFP A;  1EA3 A;  2IGM A;  2NVX J;  1WJ5 A;  1JKP C;  3HG9 A;  2HR3 A;  4A3B J;  1PP8 F;  4KIS A;  2A5Y B;  2F6C A;  1X19 A;  2HQA A;  5IY5 H;  1WJF A;  2E71 A;  2ELH A;  3IAS 2;  4R79 A;  1K83 J;  4BQA A;  4DYQ A;  1U5T A;  3D0S A;  3LSJ A;  2ZNY A;  3ZOB A;  1Z3Y A;  4LMY A;  2NAZ A;  3HGG A;  1ZGJ A;  5BPD A;  2CQN A;  1R1U A;  4E7H A;  4A69 C;  3OL3 A;  1Z6R A;  3DBH B;  4KMU X;  2MA3 A;  2EV5 A;  3FBN B;  4E7S A;  5ILV A;  1ON1 A;  3BZ6 A;  2WV0 A;  4BGD A;  1T6S A;  4BQQ A;  1PDN C;  3JRB A;  3VYU B;  1QU3 A;  1G3Y A;  3GBG A;  2QA4 I;  1VQO I;  1HA8 A;  1G3T A;  2AO9 A;  4D1Q A;  1ZG5 A;  2FOK A;  4FX0 A;  3AL0 C;  1WFX A;  5IT3 A;  2QQ9 A;  4XM3 A;  2DMP A;  4HZF A;  4D0P A;  4UUS A;  2VXZ A;  4NBQ A;  1RET A;  4HLX A;  4Y52 J;  3ZP5 A;  2CUF A;  2ZXJ A;  4I0A A;  4EEF G;  3JSO A;  5ICE A;  2JA7 J;  4J00 A;  2NXN B;  2DW4 A;  3I3L A;  1SAN A;  4LFU A;  4BL0 B;  3WE3 A;  5FKN A;  3CCV I;  1F5T A;  3TGN A;  3RCO A;  3OYD A;  2BHY A;  3GX4 X;  2R7T A;  2GXB A;  2LG4 A;  3IRR A;  1MJB A;  1ZH5 A;  4RBO A;  2W00 A;  1RI7 A;  1FSH A;  4CZC A;  2L2O A;  1SVM A;  1ETK A;  2HYG D;  3JSP A;  2F5C A;  1ZLJ A;  4CCL A;  3GW2 A;  2JT1 A;  4L9N A;  5F6F A;  3FF5 A;  3GTO J;  1OCC H;  1A6I A;  2EZL A;  2JA6 J;  1BW5 A;  3E0J B;  2K7L A;  2XKO A;  2HOS A;  1FY7 A;  2R7X A;  3TL4 X;  2MC3 A;  4TV7 A;  1WCM J;  4BYY A;  2HOT A;  2R4G A;  2XAQ A;  2JPC A;  5E20 A;  4F55 A;  4BDY A;  2ELJ A;  4DGW B;  2P5V A;  4MLO A;  2HI3 A;  1Y8Q B;  2DFH A;  4M71 A;  2F4O B;  2M30 A;  1I6H J;  5EG0 A;  2CW7 A;  3E5X A;  1YRN B;  1TTY A;  3TO7 A;  5CVU A;  1P7J A;  1Z7L A;  2M7A A;  3QP5 A;  4XLF A;  2MYS A;  3PUF A;  2JA2 A;  4XOP A;  5BOX A;  1A6Q A;  3DWL E;  4XL9 A;  1BI3 A;  2BVL A;  4OOI A;  3KP7 A;  3ULQ B;  3DP7 A;  1O3S A;  2XGX A;  2XRO A;  2ETH A;  2PQ8 A;  1PUF B;  4L9V A;  4XSZ F;  1G59 A;  2GM4 A;  2MAB A;  5K5O A;  1P4W A;  1JT0 A;  4KT6 A;  3BG3 A;  2M5W A;  1IXS B;  3BZC A;  2HKO A;  2X0L A;  1Z7U A;  4B43 A;  2DOF A;  2PX9 A;  5JVG F;  1OCT C;  1FX7 A;  3TP3 A;  2PJR A;  5GP9 A;  2RVC A;  1LE8 B;  1R5I D;  2PBI A;  1Z21 A;  1KZH A;  1KYZ A;  3F21 A;  3C1D A;  3DCF A;  2AHQ A;  1RKT A;  2KRF A;  5ILU A;  4RAZ A;  3BG6 A;  1Y0N A;  2XAH A;  2Z1D A;  3B6C A;  2A68 F;  1BC7 C;  1UB9 A;  4U87 A;  3W3C A;  2EIK H;  1ETV A;  2F5D A;  3I54 A;  5LHH A;  4S04 A;  4P9F A;  4HNT A;  2HDW A;  3WU0 A;  5F04 A;  2A61 A;  1Z6T A;  5BNG A;  3ZMV A;  2VPR A;  3BR0 A;  3MN2 A;  2VOO A;  1R5H A;  3ZPL A;  3KLO A;  4LGW A;  3WG7 H;  4AIK A;  4G94 A;  3OYM A;  2DU9 A;  1KU3 A;  1XC5 A;  1EH6 A;  3WGG A;  1W4M A;  1FBS A;  1FOW A;  2HVQ A;  4ITV A;  2K5C A;  4XSX F;  3A0B C;  2I5U A;  1YS6 A;  2LVS A;  2PMU A;  2ICW G;  3TKY A;  4BQN A;  3I53 A;  1QVT A;  5J4Y A;  3S1N J;  4KMF A;  2NNY A;  2PG4 A;  3BZK A;  2CYY A;  4HQM A;  3MKY B;  1D5Y A;  1UFM A;  2E1N A;  4EGY A;  1S72 I;  3WTW C;  3M4O J;  1QPI A;  3I59 B;  3W2W A;  1HCR A;  1W5S A;  2L7M P;  4IZZ A;  4PFP A;  1VQM I;  1OIS A;  4WXH A;  2CU7 A;  3HTS B;  1GLN A;  1QVU A;  3BR5 A;  2UXX A;  4I09 A;  3CME I;  1JUP A;  1X1P A;  2VB6 A;  1WI3 A;  2K85 A;  3CUQ A;  1HLV A;  5L3G A;  1YTY A;  3HDD A;  2XGC A;  3SFI A;  4M3E A;  2LRD A;  4WCG A;  2KLO A;  2PJR B;  3BG7 A;  2IGO A;  3I5U A;  4OIR F;  2RRE A;  3HSR A;  1FOY A;  3IV5 A;  5LEK A;  4LD5 A;  2NVQ J;  4GGG A;  4M9X A;  5M5W J;  3R4K A;  1F36 A;  2IT0 A;  2ZKZ A;  5K7H A;  2JTV A;  4IX7 A;  4UB6 C;  4CO8 A;  4LB5 A;  3OS2 A;  1AOY A;  1Y8R B;  3CMM A;  3CC4 I;  4I7H A;  3Q0U A;  3W6J B;  1MZB A;  1MBK A;  5IOZ A;  2YS9 A;  1TT0 A;  5E18 F;  1SC7 A;  5M3M J;  4CCO A;  2WAD A;  4RGS A;  3RI4 A;  1VQK I;  2FOW A;  3CQZ J;  3ZQF A;  4MNU A;  3BR3 A;  4EGZ A;  3KET A;  2M34 A;  3DU6 A;  2CWE A;  3OIP A;  3RDI A;  1ZGA A;  2IGN A;  4IOA F;  4Q5S F;  3HKZ N;  1B72 B;  3GLL A;  3T5X A;  4IHV A;  2RC4 A;  5EEA A;  2I8D A;  3DV8 A;  1SAU A;  1IO2 A;  5FD5 A;  3ESW B;  2GXA A;  3D5S C;  3K4L A;  2V6C A;  4A6E A;  2Y9Z A;  1UG0 A;  3W6K B;  3ZMZ A;  3J7A O;  4RLF A;  4P5O A;  4XLN F;  2K9L A;  2G7H A;  3TOB A;  2LLK A;  3OYC A;  2KT0 A;  1VF9 A;  3KEO A;  2X1D A;  3GWZ A;  1YI2 I;  2OCC H;  1K6Y A;  3SHF A;  3CCQ I;  2VAS A;  4IQJ A;  1TW3 A;  1USS A;  3KIO A;  4J01 A;  4QSH A;  2CFX A;  2R7V A;  1HW1 A;  3BG9 A;  5ICF A;  2VKV A;  4RAF A;  4YEJ A;  4HOB A;  1EV7 A;  3SYT A;  3SEZ A;  4Q47 A;  3PIP F;  5EZH A;  4ENJ A;  2QGU A;  1VQN I;  2YR2 A;  4LOC A;  4RAY A;  2NRA C;  2XPW A;  5KNL A;  3QYE A;  1KQ0 A;  1F43 A;  3BTC A;  4YII A;  3GUD A;  3CUO A;  3U9G A;  3FKJ A;  3AAF A;  5FRN A;  5FRM A;  1JT6 A;  3HEF A;  1IG7 A;  1P4X A;  1LFB A;  1V5E A;  2W48 A;  3JTH A;  5B1A H;  2R5Y A;  1I1S A;  1FMW A;  1HF0 A;  3OWT A;  3EUK L;  3HHH A;  1PUE E;  4Q4Z F;  5BS6 A;  1NG7 A;  3KCC A;  2M9H A;  4ZTJ A;  2E2H J;  3K9T A;  4BEH B;  2JRM A;  2CG4 A;  2VUM J;  2ISY A;  1A35 A;  3CJQ B;  4L0Z B;  3BQY A;  2EA2 A;  4A3M J;  2O0Y A;  2NOG A;  2BV6 A;  3N4M A;  3FX3 A;  1ZYR F;  3I4P A;  3LST A;  2DPD A;  5CVJ A;  4U7D A;  3EYY A;  3NQO A;  3VSL A;  2DFF A;  2MGQ A;  4N0B A;  2HZT A;  1G2H A;  2K9S A;  4PCQ A;  2JRT A;  4BJ6 C;  1ZAR A;  1U9O A;  4PZJ A;  4I6Z A;  2HQ5 A;  3HPG A;  2CV0 A;  4BUP A;  2E1C A;  3BTJ A;  2ISZ A;  3S3M A;  3ONQ A;  4HPQ A;  4A93 J;  2DFI A;  3QYF A;  2ACJ A;  1T2K A;  2CJJ A;  2A69 F;  1YOV B;  1TBX A;  2X4H A;  1K61 A;  3EQL F;  2HOE A;  3VWB A;  1S9H A;  1K79 A;  2JUG A;  4XRF A;  4II2 A;  3VDX A;  2ZME C;  2H1L A;  2EIM H;  4UXN A;  5K7Z A;  3IL2 A;  3X2Q H;  5IP9 J;  1LQ1 A;  2VN2 A;  3K1M A;  2GBY A;  1W7P B;  2EFO A;  2XV4 S;  1TNT A;  1RUN A;  3QQA A;  3KZI C;  1S7O A;  1LFP A;  4CIC A;  1MSF C;  3CDI A;  3WTS C;  5CLS A;  2DCE A;  3G2B A;  4YFN F;  5E1W A;  4CYC B;  1V54 H;  2CO5 A;  4XRS A;  2B63 J;  2BEO A;  5TJJ A;  1FYL A;  1GV2 A;  1MMN A;  2ZXH A;  3B6A A;  2KJB A;  2P0W A;  1UCR A;  3A4C A;  4G6D A;  3OS1 A;  1GHC A;  1D1A A;  3QOD A;  2MD0 A;  3DTE A;  1X3U A;  1AKH A;  3GTM J;  1VQ9 I;  4AIJ A;  4LLL A;  3TDU C;  1Y1W J;  3I4N J;  3J80 K;  2WAF A;  1W5C C;  5BQT A;  5D8K B;  4HW0 A;  3OR1 C;  4YRV A;  3CF5 F;  3PO2 J;  4G12 A;  3Q3S A;  1W7P D;  4JX6 A;  1A31 A;  3VB2 A;  2QKM B;  2LF8 A;  3A0H C;  2HU9 A;  4DOZ A;  5FKL A;  4YFK F;  4E7L A;  1FOX A;  1SFK A;  5F1J A;  3MFK A;  4RDU A;  1YFH A;  1AHD P;  2GIZ A;  3LOC A;  1HW5 A;  1X3Z B;  1DQU A;  2LTP A;  1JKR C;  2XB0 X;  2XF6 A;  4HV5 A;  1Z91 A;  5GTH C;  4UVA A;  3CJN A;  3FIS A;  3VOD A;  2DXI A;  2EFQ A;  4UVC A;  1XDU A;  3AG3 H;  5K5R A;  3V8J A;  1V5G A;  3ZQH A;  3G4S I;  1ZRE A;  1VND A;  4IPA A;  1JHF A;  5CVR A;  5TGT A;  3H5R A;  3REO A;  5HLT A;  4X0G A;  1OQY A;  2XF5 A;  2JA5 J;  2M2E A;  3BCA A;  3F0C A;  2STW A;  2GOX B;  5FRO A;  3BJO A;  2VBZ A;  2DTR A;  5KAI C;  3BR2 A;  1F4K A;  3FMR A;  2WAQ N;  2EJR A;  5JLX A;  1J09 A;  2XAG A;  4ON0 A;  1D3Y A;  2VT2 A;  5DCM B;  2WBM A;  3ECO A;  5FGM A;  3BT9 A;  2P6S A;  5HS7 A;  2XAJ A;  4AM3 A;  4KN7 X;  3ZQL A;  4FQG A;  4U0V A;  2V9K A;  1WWX A;  3I55 I;  1ON2 A;  1H8A C;  3JRI A;  1JKQ C;  3H0D A;  2K86 A;  2B9S A;  3E6M A;  4WXD A;  5CYV A;  3T1B A;  1TZL A;  3KYD B;  1UZC A;  2G7U A;  4HX7 A;  4PSX A;  1DP7 P;  3BPX A;  5GAG J;  2R5Z A;  3IC7 A;  2HPM A;  2HS5 A;  3GME A;  1WZ2 A;  4ZDP A;  5HNH A;  4ZYA A;  1QNT A;  4KA4 A;  2E2I J;  2EZK A;  1JGS A;  5CVI A;  3WGH A;  3PO3 J;  2W1O A;  3F3X A;  1XD7 A;  2VBW A;  5ERI A;  5KAF C;  4PDK A;  2DK8 A;  1LFU P;  5B3S H;  3L00 A;  3LL7 A;  2BY2 A;  5IOY A;  2DDA A;  2LNB A;  1LNW A;  1OCR H;  3F8F A;  5M5Y J;  3BJ6 A;  4NHJ A;  2R92 J;  3R0A A;  4O6J A;  2OUM A;  3F72 A;  3CF2 A;  3BP8 A;  2W7N A;  1Z0X A;  3HPH A;  3I4M J;  2VQG A;  1IV8 A;  4GYG A;  3G1M A;  3B02 A;  4XLE A;  5CPR B;  1RKW A;  4A3J J;  2IW5 A;  3OIO A;  1U2W A;  1TWH J;  4I2O A;  1LPQ A;  5IYC J;  2JSC A;  4D5C A;  3ABT A;  1B8I B;  3S32 A;  2XRL A;  3WGI A;  2NVT J;  4G7H F;  1H88 C;  4LLN A;  3UR3 C;  1WH7 A;  4RLQ A;  5DUK A;  3S1R J;  5E3M A;  5EG0 B;  1UHS A;  4M73 A;  2ZFW A;  2V7F A;  4LB6 B;  1W7P A;  5J8F A;  2EZI A;  1R9T J;  1GT0 C;  2G9W A;  2X1E A;  2EIN H;  3E3V A;  1LEA A;  4V19 K;  4UHT A;  3TOA A;  3SDB A;  2JMW A;  1ULY A;  3C3W A;  3F6O A;  4KJZ A;  1ZRD A;  1V55 H;  4PJN A;  3SJM A;  2K4J A;  2MH9 A;  2YU9 J;  4WK8 F;  3HOY J;  3MKL A;  2O61 A;  1BR1 A;  1J2X A;  5F1R A;  2EPF A;  1ZG1 A;  4XN0 A;  1RRJ A;  2A07 F;  2W25 A;  4P1W A;  3CLO A;  3SXY A;  3L2V A;  1R23 A;  1U3E M;  1B72 A;  4IEJ A;  2Z9O A;  3DTK A;  1G8X A;  3H1C A;  4V2F A;  4HDV A;  2OC6 A;  3AG2 H;  1GUU A;  2QQ8 A;  4EJO A;  4U88 A;  5TRD A;  4UUV A;  2JN6 A;  2W4S A;  4FET A;  4XMY A;  4DBR A;  2IS4 A;  3HTU A;  1EH8 A;  1LKX A;  2DYS H;  3H3Z A;  2Z16 A;  1YIO A;  1MBE A;  6PAX A;  1IC8 A;  4Z2Y A;  2LMD A;  3H9Q A;  1RPW A;  1Z1D A;  2E5Z A;  3ZR8 X;  1CGP A;  2JZY A;  4AC0 A;  2DMQ A;  4HF1 A;  2L7F P;  4P55 A;  3H9G A;  4R8H A;  3G71 I;  1RIO H;  3RPQ A;  2EH3 A;  2OCE A;  3HRU A;  2HQR A;  1G3S A;  2L4A A;  4M3D A;  5FO5 A;  4UUS B;  3J7Y J;  1OR7 A;  3GLX A;  4FIS A;  2VBY A;  2IXS A;  2MSY A;  3S93 A;  2ID6 A;  3J81 Z;  2A6T A;  3W2V A;  3OYH A;  1GXP A;  3MZ8 A;  2QM3 A;  2P7C B;  1D1B A;  1SD5 A;  3FIW A;  3OYE A;  3F8B A;  5A2Q Z;  2RDP A;  2XAU A;  2DLL A;  2XVC A;  4M9Z A;  5F64 A;  5FFX A;  1HKT A;  4QWQ A;  3S1Q J;  4MTE A;  2QEX I;  1BIA A;  2ADU A;  5LHG A;  1OYY A;  3E97 A;  4KIT B;  2L5Q A;  1S29 A;  4BBS J;  2ZFU A;  2QWW A;  1A36 A;  1ONV A;  3LSK A;  3H5N A;  2TDX A;  2H1K A;  4A3E J;  1Y56 A;  2HXO A;  4ESJ A;  1H9T A;  3RJP A;  1QRY A;  1BI0 A;  2XPU A;  2JUC A;  4A3G J;  5F27 A;  2L54 A;  2K40 A;  2KIU A;  3HM5 A;  3LAJ A;  4GFB A;  4N4N B;  2E60 A;  3CDH A;  3ZMS A;  4BXX J;  4YEL A;  1UMQ A;  2ZJR F;  4X6A J;  3HBL A;  4A3D J;  1DU6 A;  2ZCW A;  3CCR I;  3Q0W A;  5ED4 A;  2F4M B;  3FK6 A;  1V4R A;  2DA5 A;  1MBG A;  1N75 A;  1NK3 P;  2W82 A;  2Z3Y A;  3SZT A;  3GTJ J;  3J7Z I;  3MKW B;  2Y31 A;  2KPM A;  2NVY J;  3BG5 A;  3H3U A;  2RQQ A;  4J19 A;  1PP7 U;  2X48 A;  2AQF A;  2M8G X;  1HBX G;  1HDD C;  1E3H A;  2FA5 A;  1WHU A;  4BXF A;  4S0H B;  1AWC A;  2ZC2 A;  4OIP F;  2LY1 A;  2VKD A;  3S16 J;  1XPX A;  3EUA A;  2HTS A;  1K4T A;  2HZD A;  3OR2 C;  3R0J A;  4CCN A;  1QZY A;  2V1X A;  3WOD F;  2PMZ A;  2QYO A;  4JBA A;  1ZGW A;  1EJ9 A;  3ABU A;  3UNG C;  4O3M A;  1LE8 A;  2ZXI A;  4KIC A;  2Y48 A;  2HPI A;  4XLA A;  4H0E A;  3GFM A;  1GVD A;  3I56 I;  3ABL H;  2A5W A;  1JJ6 C;  1JE8 A;  2E2J J;  1MBF A;  1UST A;  3KZY A;  3TED A;  3HOW J;  1D5V A;  4MO7 A;  5M3F J;  3WTU C;  4IHT A;  3EDP A;  3GZN B;  1G3W A;  2GWR A;  2AQE A;  5J6X A;  3JRC A;  3MZY A;  1GDT A;  4NB5 A;  1UEL B;  5EGO B;  2GLO A;  3BWG A;  2EFW A;  2R5Z B;  2O7O A;  2QSF X;  1FSE A;  5E3O A;  1X3W B;  3ZMT A;  2O9L A;  2VOP A;  2QBY A;  1OYW A;  1KGS A;  3A02 A;  3FBI B;  4DZP A;  2DFE A;  3MKZ A;  3NWS A;  3FXO A;  2PLY A;  3R6S A;  3CLQ A;  4HA8 A;  1BN5 A;  2DJI A;  3SDG A;  3WTY C;  1MGT A;  1JUS A;  4ZH4 F;  3HJE A;  3A01 A;  2KDZ A;  3CCM I;  2MG4 A;  2KHM A;  2ZXW H;  3QPH A;  5ICG A;  1D1C A;  5D6E A;  2X85 A;  2H94 A;  3U1K A;  2A05 A;  3COA C;  2QBY B;  2W85 A;  1H89 C;  4M6V A;  4AID A;  1OLT A;  3DPL C;  2GAU A;  4CXF A;  1W1W E;  1IRX A;  2YX7 A;  1Z3X A;  1XGN A;  2L9N A;  5TIS C;  1TQI A;  1YE9 A;  2XGD A;  2R5Y B;  2LK2 A;  4D7M A;  3HHG A;  3HRT A;  4HEA 2;  4CYD A;  4AVZ A;  3CCY A;  2EBI A;  1FPQ A;  4HF0 A;  5C44 J;  2DA7 A;  3BTL A;  3W6V A;  1IF1 A;  1YJW I;  4XRS G;  3LSM A;  2CUJ A;  3KZZ A;  4AYB N;  4BJT A;  5LGU A;  2IBD A;  2Q0O A;  5GPC A;  3FM3 A;  1RNL A;  2BXY A;  4EM1 A;  4NDL A;  5HLH A;  1QO0 D;  3LNQ A;  4D9J A;  2E7W A;  4PJM A;  1ETQ A;  3PM1 A;  4OIN F;  5J3L A;  4KIB A;  1Y6I A;  1TWA J;  2L02 A;  3HOU J;  1LUJ B;  1JKO C;  2OF7 A;  3E7L A;  4A0Y A;  3F8C A;  5E79 C;  1AKH B;  2O03 A;  2O6G E;  4BXU A;  4K2E A;  2IA0 A;  1G6N A;  2ECB A;  5ILS A;  2WWY A;  1KQ8 A;  1IN7 A;  2L3D A;  5HOO A;  3P5J A;  1J75 A;  3K4N A;  3B73 A;  4ZYD A;  2R7O A;  4PJL A;  3L2C A;  1N78 A;  4PGH A;  5DYM A;  1K78 B;  1BW6 A;  4UB8 C;  2JQ7 A;  1WJD A;  5LLQ A;  3ERM A;  3HOS A;  4A5M A;  3FXK A;  3LAP A;  5D6F A;  2IJL A;  2KRC A;  5DDG A;  2HYJ A;  2OU2 A;  3LWF A;  3M9A A;  5IPA A;  5CKT A;  1K78 A;  2L9S A;  3R61 A;  1XMX A;  2FNP A;  1FLI A;  3LQQ A;  5C4X J;  3DU5 A;  2EA4 A;  5L3C A;  1WI9 A;  1X4O A;  2VJJ A;  3KP5 A;  4A2U A;  2JJ7 A;  2X6W A;  2RAE A;  2W57 A;  4NC6 A;  2LD5 A;  4B47 A;  5L3F A;  3GZ5 A;  3JAM Z;  3MEX A;  5DEQ A;  4KIG A;  2L7K A;  3JRG A;  2CW0 F;  4G8X A;  1TLH B;  2BVM A;  2LSO A;  2KRH A;  4MQV A;  1U78 A;  1SEU A;  2V6E A;  3K4B A;  3NEU A;  2LBF A;  3DPT A;  1KU2 A;  5D4S A;  2KZV A;  5EZG A;  4U7B A;  3O8G A;  1PYV A;  3LA7 A;  4PFO A;  3FMQ A;  1UG2 A;  2Q1Z B;  2NVU B;  1OCP A;  5E3N A;  1J7K A;  2FEZ A;  2M87 A;  3OYJ A;  2TRT A;  2QCO A;  5LEJ A;  4FAS D;  4U0W A;  4ETS A;  2H6C A;  1BBY A;  4GYI A;  1R58 A;  3LSR A;  4Y13 A;  1QZE A;  1TNS A;  5LFA A;  3D5L A;  3LMM A;  3EYI A;  3Q0V A;  2O5R A;  2YSR A;  4E7Z A;  4XQF A;  3DTI A;  1ITY A;  4NC8 A;  5HDN A;  2RV8 A;  4XLC A;  5D5X B;  2HOA A;  3BLY A;  3IKT A;  2VE9 A;  4DIQ A;  2XB5 A;  4G6T B;  4XIC A;  3OYB A;  1JGG A;  1D0Y A;  3K1P A;  1VFC A;  2JWT A;  2DBB A;  3TO6 A;  4BKX A;  4RM2 A;  4BBR J;  4XBF A;  4A3K J;  1MNM C;  3IUO A;  1XSV A;  4UY8 I;  2R7Q A;  1WSU A;  4KDP A;  1SMT A;  4MEY F;  1ZLK A;  2L4M A;  2B7E A;  3RIR A;  5DUI A;  2BW3 B;  3ABM H;  2CMP A;  2OJE D;  1DGR M;  2V79 A;  1LDD A;  1MJ9 A;  2V1U A;  2P8T A;  1HDP A;  1PVE A;  3GEZ A;  4UVB A;  1IDZ A;  1IAW A;  4W97 A;  4ZTF A;  3TW6 A;  1XCB A;  2AXL A;  4IO9 F;  1W36 D;  3V8L A;  1C0W A;  3FXU A;  3HXL A;  3T0Y A;  3Q9V A;  3QAH A;  4GDF A;  3IWZ A;  2DK5 A;  4DYC A;  3ML6 A;  4H4K C;  2X6O A;  3RPU A;  2DTZ A;  2KFD A;  1T0F C;  2FML A;  1IDY A;  3CO6 C;  2CUZ A;  4OAY A;  4LIT A;  3TQN A;  5LRS A;  1IN5 A;  2VQC A;  3IH3 A;  1JHH A;  3ZMD A;  2XRN A;  3EUH A;  1VQL I;  3IAM 2;  3CD6 I;  2MLK A;  2F5E A;  3S2W A;  2FMY A;  3O2P E;  1FBQ A;  2ZME A; 
#chains in the Genus database with same CATH homology
 3F22 A;  4U0Y A;  3ELK A;  4BHC A;  3G73 A;  2RKH A;  1E17 A;  1I5Z A;  5D8L B;  3CTA A;  3BOQ A;  5HS9 A;  4EJU A;  2M45 A;  3HRM A;  2VE8 A;  1FP1 D;  1B9N A;  3GFL A;  5HLI A;  2HKX A;  1DDN A;  1YW7 A;  1LB2 A;  3GF2 A;  1HKQ A;  2UZK A;  3OOP A;  3MCZ A;  1YO5 C;  4EJT A;  2LKP A;  2YU3 A;  4JQF A;  3PQK A;  4WF2 A;  5LGN A;  2Z5U A;  2MBF A;  4EMS A;  4ZYE A;  2KIM A;  3ROU A;  4A6D A;  3ZMU A;  4ZZD A;  2J5O A;  4EV0 A;  3M7G A;  3HYI A;  1QZZ A;  1H9G A;  3I64 A;  3MQ0 A;  5AIP A;  4EJV A;  3GO5 A;  4N9H A;  1T38 A;  2O3F A;  3SQN A;  1LVA A;  4UV9 A;  2ZBK A;  3QRF F;  1R1T A;  2GZW A;  3GVA A;  2A6H F;  3KLN A;  3DF8 A;  4HF2 A;  3GFI A;  5EEH A;  1XSD A;  2IA1 A;  1D8J A;  1P4A A;  4HDU A;  1YS7 A;  2D1H A;  4PGG A;  4BNC A;  1QQI A;  4KIF A;  1R7J A;  1IZ1 A;  1FYM A;  5FFZ A;  5FB2 A;  4M9S A;  1XB4 A;  3DEU A;  4RS8 A;  2FU4 A;  3FHZ A;  2H27 A;  4LK1 F;  1SFU A;  3K0L A;  4KYW A;  4LK0 F;  1DUX C;  2P5K A;  3DFG A;  5AON A;  3KE2 A;  3H92 A;  2Z33 A;  1G4D A;  4M6Y A;  5HLG A;  3P9C A;  4BH9 A;  4M74 A;  2P7V B;  2NNN A;  2RQP A;  3O6B B;  1R00 A;  4JK1 X;  1F9N A;  3QOP A;  2F2E A;  5D4R A;  2OZU A;  3WE2 A;  1OMI A;  3L7W A;  1I1G A;  4ZYG A;  1WRJ A;  1K6O A;  3HSF A;  3F23 A;  1B4A A;  1SFE A;  5FLX Z;  4IRI A;  3VOE A;  4I01 A;  3Q9S A;  2UWM A;  4I0B A;  3N97 A;  2XAF A;  3CUQ B;  3ZQ7 A;  3FXR A;  3RTR A;  2PFB A;  4ESB A;  1ZAO A;  1KQ9 A;  5BPI A;  1O7F A;  1LDJ A;  1O3Q A;  4GCV A;  1S6L A;  2PN6 A;  2RN7 A;  2R7F A;  5LRR A;  3G3Z A;  5FLX K;  5DV5 A;  4MEX F;  5HDK A;  4L5I A;  1U5T B;  2EV6 A;  2OBP A;  2A3S A;  1R5G A;  3FM5 A;  2OZ6 A;  2A6E F;  2NS0 A;  2LF7 A;  4ENM A;  2MLG A;  3KP4 A;  2QUF A;  3O3K A;  1YW9 A;  2Q2E A;  3E5Q A;  1LJ9 A;  3BPV A;  1ODD A;  5JI6 A;  1Z05 A;  1VTN C;  1YW8 A;  3V8K A;  4Y17 A;  3V4G A;  3BDD A;  2QZ8 A;  4OMZ A;  3C7J A;  3FZV A;  5JR3 A;  3WTT C;  4ESF A;  1OYI A;  1IRF A;  4WXC A;  4HQE A;  2Q8K A;  2QLZ A;  4G7O F;  5ICC A;  2CGP A;  4OU0 A;  3RYP A;  4IHS A;  2FBI A;  4RB1 A;  4BHB A;  1QPM A;  3Q5F A;  1GXQ A;  3MZH A;  4RGX A;  2DT5 A;  3IHU A;  3KEQ A;  3C18 A;  2R3S A;  4DQ2 A;  3DQV C;  4LJZ F;  3F6V A;  5DCM A;  4BAY A;  4HAM A;  2H09 A;  3LFK A;  2EFN A;  4OMY A;  4CHU A;  2ZO4 A;  1MDM B;  4IJA A;  1S7A A;  4HBL A;  2HFH A;  2OQR A;  4LG0 A;  1IUY A;  2GA2 A;  1UHM A;  1SAX A;  1OKR A;  2ZNZ A;  3V7C A;  4ENK A;  3DKW A;  5H20 A;  1KYW A;  4UV8 A;  2CSO A;  5JFR A;  2DI3 A;  5IT9 Z;  1R36 A;  1XMK A;  2VOD A;  4MQ9 F;  1XCV A;  5LBQ A;  3J80 Z;  1A04 A;  4HX4 A;  4RB2 C;  1IN4 A;  2IA2 A;  2BBY A;  2FSW A;  1YYV A;  1P2F A;  5HS8 A;  4MGR A;  1KU7 A;  4BHP A;  1ZRC A;  1SMY F;  1U5T C;  3IWF A;  3K1N A;  1XDS A;  1T0F A;  3CUQ C;  1GVJ A;  2HDC A;  4KNY A;  3QU3 A;  2UXN A;  4KUM A;  4ZYH A;  1O3R A;  4EM2 A;  1QBJ A;  1KA8 A;  3P7N A;  4HV6 A;  4L5J A;  1SD6 A;  4LLG F;  4FX4 A;  5H6R A;  3CO7 C;  5EEG A;  1MKM A;  2OD5 A;  3FWE A;  3T8T A;  5E17 F;  1UHW A;  3F8N A;  2NYX A;  1CF7 A;  4MHG A;  2ESN A;  2W84 A;  1S3J A;  2P5L C;  1O57 A;  1KU9 A;  4CZZ A;  2E7X A;  5AIQ A;  3E6C C;  1HW2 A;  1T39 A;  1FP2 A;  1B6A A;  2M8E A;  3ERE D;  3BJA A;  4I98 B;  4DNC A;  4O5V A;  3WU1 B;  3FXQ A;  1E2X A;  1S8N A;  1LEB A;  4CGZ A;  2VC0 A;  3I58 A;  1K7A A;  2YPR A;  4S05 A;  1IN8 A;  2JPB A;  3BRO A;  3GYH X;  3JW4 A;  4G6Q A;  3P9I A;  2PEX A;  2RGV A;  2ZME B;  2BE5 F;  3TDZ C;  1SD7 A;  3M1E A;  2OQG A;  1XSX A;  2HGC A;  4FT8 A;  4A0X A;  1TQM A;  4AWX B;  1O7L A;  1HQC A;  4YFX F;  1W5T A;  2V1D A;  2LDU A;  2QVO A;  3M8E A;  2EB7 A;  1BC8 C;  3J81 K;  2EWN A;  1B59 A;  3M8F A;  2WTE A;  4KT5 C;  3LQR A;  3GZ6 A;  1RUO A;  2ESH A;  4ASN A;  2BGC A;  3T8R A;  3U2R A;  5CJ9 A;  2P4W A;  5CVV A;  1DPR A;  3V7R A;  4A12 A;  4RGU A;  3WTV C;  4HYE A;  3JTG A;  1BOA A;  2FRH A;  4N9I A;  2PI0 A;  1XGO A;  2KJC A;  2GA1 A;  4P9U A;  5BMZ A;  5J8C A;  3I0T A;  2YX4 A;  1JXS A;  5KVR A;  4G7Z F;  2HQN A;  1EH7 A;  1CF7 B;  2MD5 A;  5HDG A;  4B09 A;  4AIH A;  4EQQ A;  1I6X A;  1Y0U A;  2PMH A;  1FZP B;  3FMS A;  3GFJ A;  2QQB A;  3DXJ F;  3E5U A;  4AD9 A;  1J5Y A;  2KIF A;  2DPU A;  1TQP A;  5LHI A;  5DD4 A;  1FNN A;  2QQA A;  2D2W A;  4A5N A;  2ZJ2 A;  1FC3 A;  2MH2 A;  3SZP A;  4YIF A;  4Q48 A;  1MJA A;  1O3T A;  1LDK B;  4HLY A;  2H6B A;  2GXG A;  3HIF A;  1B1B A;  2VC1 A;  5D5W B;  1RZ4 A;  4UNO A;  4F7Z A;  3QP6 A;  1ZG3 A;  2DQR A;  4GXO A;  3IRQ A;  2IP2 A;  2BYV E;  4RB0 A;  1ZHF A;  1D8K A;  1XN7 A;  2Y0M A;  4I02 A;  3R60 A;  3PFI A;  2VT3 A;  3L9F A;  1BM9 A;  1HKS A;  3HSE A;  3MAJ A;  5JHU A;  1J0R A;  3F8M A;  2PJP A;  1U8R A;  2EK5 A;  2VBX A;  4NQW A;  2OAZ A;  3HRS A;  1FOK A;  3I59 A;  1BJA A;  4A0Z A;  1FBU A;  1FYK A;  1STZ A;  3HOT A;  1FWZ A;  4LG0 B;  3LA3 A;  2COM A;  2O8X A;  1BI2 A;  2FE3 A;  2C6Y A;  5L3E A;  1I27 A;  1F1Z A;  1T98 A;  3IKV A;  4R1H A;  2HTJ A;  4E70 A;  2XKP A;  2F5F A;  1OPC A;  3HUG A;  1TW2 A;  5L3D A;  2FXA A;  1BIB A;  1HXD A;  1IXR C;  2CQK A;  4AVP A;  5D5U B;  4WX9 A;  4IVN A;  1IRG A;  1P6R A;  2J5P A;  1BI1 A;  1B9M A;  1L0O C;  3WTZ A;  5HVQ C;  4OIQ F;  2FBK A;  2L01 A;  2XHK A;  3RKX A;  2IPQ X;  4EVI A;  4B8X A;  3P9K A;  1DPU A;  4YG2 F;  2HYF A;  2FBH A;  3QPT A;  3E6B A;  3BY6 A;  5DCF A;  4L18 B;  4P96 A;  2XAS A;  3JAM K;  3KP3 A;  5E1Z B;  2FF4 A;  2WC2 A;  4ENN A;  4IXA A;  1Z9C A;  2DO7 A;  2HEO A;  1XGS A;  3KP6 A;  3MWM A;  2OA4 A;  5E8G A;  3KFW X;  3RKY A;  3ISP A;  5K5Q A;  1IW7 F;  1Q1H A;  4GO1 A;  5LGT A;  2W24 A;  3ECH A;  1SFX A;  3V7S A;  4CDG A;  3RYR A;  1V3F A;  4M6X A;  2P6T A;  1MD0 A;  1XMA A;  4EM0 B;  3I71 A;  2D1V A;  3KP2 A;  1J9I A;  5E8I A;  1ZN2 A;  2AS5 F;  4IRG A;  2GQQ A;  2DAO A;  4HX8 A;  1IXC A;  1WQ2 A;  3SFZ A;  3ZN1 A;  1YG2 A;  1XGM A;  4L9J A;  2RNJ A;  5K1Y A;  1R22 A;  4KN4 X;  4KFC A;  2QEN A;  2STT A;  2B0L A;  2EV0 A;  4G9Y A;  1H0M A;  1QGP A;  1HST A;  2IRF G;  2V9V A;  1REP C;  3OV8 A;  1WKM A;  3L09 A;  5JVT A;  4Y15 A;  3WTX C;  2Z99 A;  3QU6 A;  2XIG A;  2Y75 A;  3EET A;  2XUB A;  4IRH A;  1R1V A;  1HSJ A;  5E1X A;  3LA2 A;  4EJW A;  2HWV A;  3K2Z A;  3RKW A;  2FQ3 A;  4QLC U;  3TO9 A;  2DQL A;  1MDM A;  1SD4 A;  2K02 A;  3WG9 A;  2KKO A;  1IN6 A;  1L3L A;  1NHA A;  3VFZ A;  1U6G A;  4WWC A;  4XLP F;  5KK1 A;  4IF4 A;  3VEP A;  1J59 A;  4OIO F;  2K4B A;  4MTD A;  5A2Q K;  4FHT A;  2IVM A;  2VON A;  2FNA A;  4L9T A;  3E6D A;  5IT9 K;  5FD6 A;  1P92 A;  2M1B A;  1YQA A;  1ZRF A;  1YLF A;  5D5V B;  4RB3 C;  2D45 A;  3K69 A;  4ZZL A;  2GIV A;  3NRV A;  5L3B A;  4L0Y B;  5H6Q A;  3PQJ A;  5DD8 A;  2K27 A;  4M72 A;  1FT9 A;  2R7D A;  4RGR A;  3GXO A;  3U1D A;  3ZN0 A;  2EFP A;  2HR3 A;  1PP8 F;  2A5Y B;  2ELH A;  4R79 A;  4BQA A;  1U5T A;  3D0S A;  2ZNY A;  4LMY A;  2NAZ A;  1ZGJ A;  5BPD A;  1R1U A;  1Z6R A;  4KMU X;  2MA3 A;  2EV5 A;  5ILV A;  1ON1 A;  3BZ6 A;  2WV0 A;  1T6S A;  1PDN C;  1G3Y A;  1G3T A;  1ZG5 A;  2FOK A;  4FX0 A;  5IT3 A;  2QQ9 A;  4HZF A;  4D0P A;  2VXZ A;  4HLX A;  3ZP5 A;  2ZXJ A;  4I0A A;  3JSO A;  5ICE A;  2DW4 A;  4LFU A;  3WE3 A;  1F5T A;  3TGN A;  3GX4 X;  2GXB A;  3IRR A;  1MJB A;  1ZH5 A;  1RI7 A;  1FSH A;  2HYG D;  3JSP A;  2F5C A;  1ZLJ A;  3GW2 A;  2JT1 A;  4L9N A;  5F6F A;  3FF5 A;  2K7L A;  2XKO A;  1FY7 A;  2MC3 A;  4TV7 A;  4BYY A;  2XAQ A;  2JPC A;  5E20 A;  2P5V A;  4M71 A;  2M30 A;  3E5X A;  1TTY A;  3TO7 A;  5CVU A;  3QP5 A;  5BOX A;  1BI3 A;  4OOI A;  3KP7 A;  3ULQ B;  3DP7 A;  1O3S A;  2XGX A;  2XRO A;  2ETH A;  2PQ8 A;  4L9V A;  4XSZ F;  5K5O A;  1P4W A;  2M5W A;  1IXS B;  2HKO A;  2X0L A;  1Z7U A;  1FX7 A;  2RVC A;  2PBI A;  1KYZ A;  3F21 A;  3C1D A;  2KRF A;  5ILU A;  4RAZ A;  2XAH A;  2A68 F;  1BC7 C;  1UB9 A;  2F5D A;  3I54 A;  5LHH A;  4S04 A;  4P9F A;  3WU0 A;  2A61 A;  1Z6T A;  3ZMV A;  2VOO A;  1R5H A;  3ZPL A;  3KLO A;  4LGW A;  4AIK A;  4G94 A;  2DU9 A;  1KU3 A;  1EH6 A;  3WGG A;  1W4M A;  1FBS A;  4XSX F;  1YS6 A;  2PMU A;  3TKY A;  3I53 A;  4KMF A;  2NNY A;  2PG4 A;  2CYY A;  4HQM A;  1UFM A;  2E1N A;  4EGY A;  3WTW C;  3I59 B;  1W5S A;  4WXH A;  3HTS B;  2UXX A;  4I09 A;  3CUQ A;  5L3G A;  1YTY A;  4WCG A;  3I5U A;  4OIR F;  3HSR A;  5LEK A;  4LD5 A;  4GGG A;  4M9X A;  3R4K A;  2IT0 A;  2ZKZ A;  2JTV A;  4CO8 A;  4LB5 A;  1AOY A;  4I7H A;  3W6J B;  1MZB A;  5E18 F;  4RGS A;  3RI4 A;  4MNU A;  4EGZ A;  3KET A;  3RDI A;  2CWE A;  1ZGA A;  4Q5S F;  3T5X A;  2RC4 A;  3DV8 A;  5FD5 A;  2V6C A;  4A6E A;  3W6K B;  3ZMZ A;  3J7A O;  4P5O A;  4XLN F;  2G7H A;  3TOB A;  3KEO A;  3GWZ A;  3SHF A;  1TW3 A;  1USS A;  2CFX A;  1HW1 A;  5ICF A;  4HOB A;  1EV7 A;  4Q47 A;  4ENJ A;  2YR2 A;  4RAY A;  2NRA C;  1KQ0 A;  4YII A;  3GUD A;  3CUO A;  3U9G A;  3AAF A;  1P4X A;  3JTH A;  1I1S A;  3HHH A;  1PUE E;  4Q4Z F;  5BS6 A;  3KCC A;  3K9T A;  2CG4 A;  2ISY A;  4L0Z B;  2EA2 A;  2O0Y A;  2BV6 A;  3N4M A;  3FX3 A;  1ZYR F;  3I4P A;  3LST A;  2DPD A;  5CVJ A;  4U7D A;  3EYY A;  3NQO A;  4N0B A;  2HZT A;  4PCQ A;  2JRT A;  1ZAR A;  4PZJ A;  2E1C A;  2ISZ A;  2DFI A;  2ACJ A;  1T2K A;  2A69 F;  1TBX A;  2X4H A;  3EQL F;  2HOE A;  1K79 A;  4XRF A;  3IL2 A;  4UXN A;  1LQ1 A;  2VN2 A;  3K1M A;  2XV4 S;  1W7P B;  2EFO A;  1TNT A;  1RUN A;  1S7O A;  4CIC A;  3WTS C;  5CLS A;  4YFN F;  5E1W A;  2CO5 A;  2BEO A;  5TJJ A;  1FYL A;  2KJB A;  1UCR A;  4G6D A;  1GHC A;  1X3U A;  4AIJ A;  4LLL A;  3TDU C;  3J80 K;  5BQT A;  5D8K B;  4HW0 A;  1W7P D;  3VB2 A;  2LF8 A;  4YFK F;  3MFK A;  1YFH A;  1HW5 A;  4HV5 A;  1Z91 A;  4UVA A;  3CJN A;  3VOD A;  2EFQ A;  4UVC A;  1XDU A;  5K5R A;  3V8J A;  1ZRE A;  4IPA A;  1JHF A;  5CVR A;  3REO A;  2STW A;  3BJO A;  2VBZ A;  2DTR A;  1F4K A;  3FMR A;  2EJR A;  2XAG A;  4ON0 A;  1D3Y A;  2VT2 A;  5DCM B;  3ECO A;  5FGM A;  2P6S A;  5HS7 A;  2XAJ A;  4KN7 X;  4U0V A;  1WWX A;  1ON2 A;  2K86 A;  3E6M A;  4WXD A;  5CYV A;  3T1B A;  1DP7 P;  2G7U A;  4HX7 A;  3BPX A;  3IC7 A;  2HS5 A;  1QNT A;  4KA4 A;  1JGS A;  5CVI A;  3WGH A;  3F3X A;  1XD7 A;  2VBW A;  5ERI A;  4PDK A;  2DK8 A;  3L00 A;  2LNB A;  1LNW A;  3F8F A;  3BJ6 A;  4NHJ A;  3R0A A;  4O6J A;  3F72 A;  3BP8 A;  4GYG A;  3B02 A;  2IW5 A;  1U2W A;  4I2O A;  2JSC A;  3ABT A;  3WGI A;  4G7H F;  4LLN A;  5DUK A;  4M73 A;  2ZFW A;  4LB6 B;  1W7P A;  5J8F A;  2G9W A;  3E3V A;  1LEA A;  4UHT A;  3TOA A;  1ULY A;  3C3W A;  3F6O A;  1ZRD A;  2K4J A;  2MH9 A;  4WK8 F;  2O61 A;  1J2X A;  5F1R A;  1ZG1 A;  2A07 F;  2W25 A;  3CLO A;  3SXY A;  1U3E M;  1R23 A;  2Z9O A;  4HDV A;  4EJO A;  4U88 A;  5TRD A;  4UUV A;  3HTU A;  1EH8 A;  3H3Z A;  6PAX A;  1YIO A;  4Z2Y A;  1Z1D A;  1CGP A;  2JZY A;  4HF1 A;  4P55 A;  4R8H A;  1RIO H;  3RPQ A;  3HRU A;  2HQR A;  1G3S A;  2L4A A;  5FO5 A;  1OR7 A;  3GLX A;  2VBY A;  3J81 Z;  1GXP A;  2QM3 A;  2P7C B;  1SD5 A;  3F8B A;  5A2Q Z;  2RDP A;  2DLL A;  2XVC A;  4M9Z A;  5F64 A;  5FFX A;  1HKT A;  4QWQ A;  4MTE A;  1BIA A;  2ADU A;  5LHG A;  1OYY A;  3E97 A;  1S29 A;  2QWW A;  1ONV A;  2TDX A;  4ESJ A;  1H9T A;  3RJP A;  1BI0 A;  2L54 A;  2KIU A;  3LAJ A;  3CDH A;  3ZMS A;  2ZCW A;  5ED4 A;  1V4R A;  2Z3Y A;  3SZT A;  3H3U A;  1PP7 U;  1HBX G;  2FA5 A;  1AWC A;  4OIP F;  2HTS A;  3R0J A;  1QZY A;  2V1X A;  3WOD F;  2QYO A;  4JBA A;  3ABU A;  4O3M A;  4KIC A;  2Y48 A;  4H0E A;  3GFM A;  1JE8 A;  1UST A;  3KZY A;  1D5V A;  3WTU C;  4IHT A;  3EDP A;  1G3W A;  2GWR A;  5J6X A;  3MZY A;  4NB5 A;  3BWG A;  2EFW A;  1FSE A;  3ZMT A;  2VOP A;  2QBY A;  1OYW A;  1KGS A;  2PLY A;  3R6S A;  4HA8 A;  3WTY C;  1BN5 A;  1MGT A;  4ZH4 F;  5ICG A;  3QPH A;  5D6E A;  2H94 A;  3COA C;  2QBY B;  2W85 A;  3DPL C;  2GAU A;  4CXF A;  2YX7 A;  1XGN A;  1TQI A;  3HHG A;  3HRT A;  4CYD A;  1FPQ A;  4HF0 A;  1IF1 A;  3KZZ A;  5LGU A;  2Q0O A;  3FM3 A;  1RNL A;  4EM1 A;  5HLH A;  1QO0 D;  2E7W A;  4OIN F;  4KIB A;  2L02 A;  4A0Y A;  3F8C A;  2O6G E;  2O03 A;  4BXU A;  4K2E A;  2IA0 A;  1G6N A;  5ILS A;  1KQ8 A;  2WWY A;  1IN7 A;  2L3D A;  5HOO A;  1J75 A;  3B73 A;  4ZYD A;  3L2C A;  4PGH A;  5DYM A;  1K78 B;  5LLQ A;  3HOS A;  4A5M A;  3LAP A;  5D6F A;  2IJL A;  5DDG A;  3LWF A;  2OU2 A;  3M9A A;  1K78 A;  3R61 A;  2FNP A;  1FLI A;  3LQQ A;  2EA4 A;  5L3C A;  1WI9 A;  3KP5 A;  4A2U A;  2W57 A;  5L3F A;  3GZ5 A;  3JAM Z;  3MEX A;  5DEQ A;  4KIG A;  2CW0 F;  4G8X A;  1TLH B;  2LSO A;  4MQV A;  1U78 A;  3NEU A;  3DPT A;  1KU2 A;  5D4S A;  4U7B A;  3LA7 A;  3FMQ A;  1J7K A;  2FEZ A;  2M87 A;  5LEJ A;  4U0W A;  4ETS A;  2H6C A;  1BBY A;  4GYI A;  1R58 A;  4Y13 A;  1TNS A;  3D5L A;  3EYI A;  2YSR A;  5HDN A;  2RV8 A;  5D5X B;  3IKT A;  2VE9 A;  3K1P A;  2DBB A;  3TO6 A;  4XBF A;  1XSV A;  1WSU A;  4KDP A;  1SMT A;  4MEY F;  1ZLK A;  2L4M A;  3RIR A;  5DUI A;  2V79 A;  1LDD A;  1MJ9 A;  2V1U A;  2P8T A;  3GEZ A;  4UVB A;  1IAW A;  1XCB A;  2AXL A;  3V8L A;  1C0W A;  3FXU A;  3T0Y A;  3Q9V A;  3QAH A;  3IWZ A;  2DK5 A;  3ML6 A;  3RPU A;  2FML A;  3CO6 C;  3TQN A;  5LRS A;  1IN5 A;  1JHH A;  3ZMD A;  2XRN A;  3EUH A;  2MLK A;  2F5E A;  3S2W A;  2FMY A;  3O2P E;  1FBQ A;  2ZME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...