4AIJA

Crystal structure of rova from yersinia in complex with a rova promoter fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aijA00
2OBPA 1ON2A 1CF7B 3EYYA 1QQIA 2RV8A 3L09A 3GFIA 2K86A 1OMIA 5JHUA 2HWVA 1H9GA 4CZZA 1MD0A 2A3SA 2ZXJA 4D0PA 4I01A 3T8TA 1FBSA 1GVJA 4UUVA 3KFWX 2D2WA 3HRSA 3FX3A 3Q5FA 3SFZA 4KA4A 1R36A 1YLFA 3LFKA 1DP7P 4G7OF 4YFXF 3BJAA 3WTTC 3DQVC 1QO0D 2EA2A 2V1DA 2XASA 3V8LA 4L5JA 3DFGA 3H3UA 2J5OA 3ZN0A 4U7BA 4M72A 3KP2A 3KP5A 1IN8A 1FP2A 1XSVA 1SFEA 1J75A 4GXOA 5D8KB 1HQCA 2M45A 3T5XA 2MA3A 1FZPB 3CJNA 3H3ZA 3IKVA 3IWZA 4CDGA 3HRMA 1XSDA 4QWQA 1J0RA 2KIMA 3GFLA 2OZUA 1XDSA 4M9XA 1IW7F 3W6JB 3RIRA 4P96A 2CO5A 3I59A 4LMYA 5K5OA 1ONVA 1TQPA 1U5TB 2HS5A 2ESNA 3ZMVA 2VT2A 4UVAA 1TQMA 2UWMA 4N0BA 4U0WA 1QGPA 4F7ZA 1BC7C 2HKXA 3GZ6A 1MDMA 2VC1A 2CG4A 5LHIA 1STZA 1YO5C 3PQJA 2Q0OA 2L02A 2RGVA 2QZ8A 4BAYA 3CUQA 2P6TA 2EA4A 1IXRC 4AD9A 1K7AA 2KRFA 3DP7A 4NHJA 4RAZA 1IXCA 4FT8A 3KP7A 4TV7A 5DD8A 1LQ1A 3QP6A 5F6FA 2GXBA 1RZ4A 1LB2A 3R0JA 2E7XA 2A6EF 3QOPA 2K02A 3HTSB 2D1VA 2L3DA 5ED4A 1LEBA 3VODA 2FU4A 5CJ9A 2V9VA 3DPLC 3F8BA 5BS6A 4BHCA 2CW0F 2OU2A 3MZYA 4EM1A 1FNNA 3P9CA 4A0YA 1J9IA 1K6OA 2VT3A 1T6SA 3I0TA 1W7PB 3RPUA 3HSFA 1QZZA 1BN5A 4OIOF 4M71A 2P4WA 3CLOA 4KICA 3GXOA 3JTHA 4KN7X 1FYLA 3J81K 1HBXG 3HHGA 4XBFA 4EQQA 2RDPA 4IHTA 1G3YA 1SFUA 4BQAA 2LF7A 3RTRA 1YFHA 5FFXA 3LAJA 2GA2A 4LK0F 1JHHA 2NRAC 4MEYF 3IC7A 4KMUX 4L5IA 1EH8A 4EGYA 1G3TA 2JRTA 3GZ5A 2B0LA 2XROA 4RS8A 1FYMA 1KQ9A 1FLIA 1I5ZA 2VXZA 1O3TA 4YFKF 2KKOA 2EFOA 4I0BA 4L9TA 2LDUA 4HF2A 2DU9A 3ZN1A 2HEOA 3T0YA 1J59A 4M73A 1O57A 5D5WB 1LNWA 4AIHA 2EJRA 2DQRA 5E8IA 1IN7A 2MBFA 2HZTA 4A0ZA 3N97A 3RPQA 2M8EA 3AAFA 4S05A 2JSCA 3FWEA 1OYYA 2FRHA 1BIAA 2F5FA 3ZMTA 2IA2A 4RGRA 4WXCA 4EVIA 3F3XA 2ZKZA 2VE8A 5EEHA 2PN6A 2Y75A 3VEPA 3TOAA 1XMKA 5D6FA 1R1VA 2K4BA 5IT9K 1YTYA 1W5TA 5LGUA 2XUBA 2NNYA 2HR3A 4B09A 3L2CA 4LG0B 4CGZA 1RUOA 2JTVA 4FX0A 1RI7A 4KIGA 2QUFA 3M1EA 4BXUA 4KYWA 1XSXA 1A04A 3QRFF 1SD6A 1UCRA 5FFZA 4UV8A 2M87A 2HTSA 2DK5A 2VE9A 1F5TA 4IJAA 4LLNA 4ENKA 1OYWA 4RAYA 1ZGJA 4WXDA 3C7JA 3F8NA 1FP1D 3BP8A 4MQ9F 1XN7A 2FBHA 3FXQA 4G6DA 2YX4A 3TOBA 2H6CA 3GO5A 1R7JA 4EM0B 2HKOA 2W24A 5DYMA 1OR7A 3ABUA 4EGZA 2QBYB 3MAJA 4ZZDA 3EYIA 1HW1A 1R1UA 4HOBA 3WU1B 1G6NA 4G94A 3JSOA 4MGRA 3K1NA 3V8JA 2NNNA 1U5TA 4JQFA 1KGSA 1LEAA 2HOEA 3ULQB 2VBWA 2DPDA 3C18A 4LD5A 2XRNA 2ZCWA 4M6XA 5HS8A 4Q4ZF 1PP7U 2DLLA 5D5XB 5K1YA 3I5UA 4XLPF 1Q1HA 2DW4A 2GAUA 4LK1F 1GXQA 3E6MA 2JPCA 2X0LA 3KP4A 3F23A 3HYIA 3MFKA 3L00A 2WV0A 4U0VA 2CFXA 1LDJA 1R1TA 2QQAA 1P6RA 3P7NA 3RYPA 2ZJ2A 3KZYA 2QM3A 3IRRA 5ICFA 2TDXA 2NAZA 5HOOA 5CVIA 3J80K 3J7AO 5BOXA 1K79A 2VONA 1ZREA 3RJPA 1MZBA 4G8XA 4Y15A 2XAFA 4RGXA 1U6GA 4M74A 4KUMA 1TLHB 2PFBA 4G7HF 2O61A 1YW9A 1D8KA 5LRSA 4PGHA 1USSA 1QNTA 1YW8A 2KJBA 1D8JA 4N9HA 2Z9OA 1KQ8A 5LHGA 3ERED 3WGIA 5L3BA 2GWRA 3OV8A 4ESJA 2ZMEB 3LQQA 4RB0A 3KP6A 2GIVA 2R7FA 5HLHA 1ZG5A 4L9NA 1S29A 4HYEA 4OMYA 4IXAA 1ZH5A 1FY7A 2NS0A 3WODF 2ISZA 4EJTA 5DDGA 2W84A 4HF0A 1OKRA 1WKMA 1WQ2A 3MCZA 2G7UA 4XSXF 4WXHA 2PJPA 5BPDA 5TRDA 5A2QZ 5DEQA 1FPQA 1U8RA 2RQPA 4A6DA 1IN5A 1TW2A 3LA2A 2JT1A 4U88A 1I6XA 1R5GA 1Z9CA 2F5EA 5D6EA 3KZZA 1K78B 3RKXA 3SHFA 1O3QA 2QENA 1WSUA 2WTEA 3TO6A 1GHCA 1HKTA 2CQKA 1B9MA 5HDGA 4HDVA 1ULYA 2HQNA 2IA1A 1AOYA 5FB2A 3K1PA 5HDNA 1SD4A 3FXRA 1YS7A 3WE3A 1HKSA 1U2WA 2VN2A 3DV8A 2HYFA 4HAMA 5E8GA 3QAHA 2STWA 2GQQA 4A5MA 4HZFA 2NYXA 2E1CA 4KIBA 3CO7C 4LJZF 4ENMA 4Q47A 5ERIA 2Q2EA 2R3SA 1KYWA 4ESBA 3TDZC 4JK1X 2Z99A 5FGMA 1LDKB 2MD5A 2X4HA 4HQEA 1S8NA 2FE3A 3E5XA 1ON1A 2QQBA 3ZPLA 2O3FA 3ZP5A 3CDHA 3H92A 2LF8A 3DEUA 5E1ZB 4ASNA 4NQWA 2Z33A 4Q5SF 2VODA 3E5QA 3HOTA 1I27A 1REPC 1TNTA 1BI0A 4CXFA 4IRGA 3LAPA 1KA8A 3ISPA 3R60A 2YSRA 2H94A 3WGHA 1D5VA 1EH7A 1FBQA 4P9FA 4I02A 4BYYA 3ZMZA 4YFNF 1LJ9A 1QBJA 1J2XA 3BPXA 4O3MA 2ETHA 6PAXA 1T39A 1MKMA 2FSWA 5D4RA 4WF2A 5CVJA 2DFIA 1DDNA 2K7LA 2ZO4A 3CO6C 2QBYA 1FSHA 1GXPA 2XVCA 2IRFG 2M30A 2W85A 1NHAA 4N9IA 2P5VA 3ECHA 3RYRA 2V6CA 5HS9A 1AWCA 3FM5A 5DCFA 5HS7A 3M9AA 4WX9A 1IXSB 3JW4A 2PLYA 5CVUA 5H6RA 2HQRA 3SZPA 3BWGA 2BV6A 4ZYDA 4EV0A 5D5UB 4IVNA 2QLZA 1E17A 1B6AA 5HVQC 2BYVE 3VFZA 2EWNA 5J8CA 3IL2A 2DQLA 4ZH4F 3FXUA 1IN6A 2VC0A 5ICCA 1KYZA 5J6XA 3QU3A 2DTRA 2EB7A 1XGOA 4PDKA 2G9WA 2MH2A 2ACJA 3WGGA 4UVBA 3J81Z 2FMYA 2EFWA 3CUOA 3F72A 1PP8F 1SAXA 3G73A 2O8XA 3GUDA 4HX8A 1T0FA 1QPMA 3GFJA 4EJVA 2UXNA 1R5HA 1RIOH 1XCBA 2ZFWA 4ETSA 4HDUA 3M8FA 4K2EA 3VOEA 2PMHA 1WI9A 3EDPA 5F64A 3E3VA 3C3WA 1HW2A 4HW0A 1IF1A 2YR2A 4UV9A 4HLYA 3NQOA 2LKPA 4LB6B 4EJWA 5D5VB 3QP5A 2V1XA 1Z1DA 2F5DA 1ZRCA 3RKYA 5EEGA 3WTZA 3BY6A 2WWYA 2L4MA 2DAOA 4OMZA 2QQ9A 1TQIA 2FMLA 3V7CA 4AIKA 4MNUA 4DNCA 1O3SA 1RUNA 1Z6RA 3I71A 2RN7A 3MWMA 1SMYF 1CF7A 3K0LA 4DQ2A 1DUXC 2QWWA 1B4AA 5BQTA 3T1BA 2CWEA 3HHHA 2R7DA 4XRFA 1IN4A 2L4AA 2XHKA 3GLXA 2MLGA 5CYVA 4EMSA 4CHUA 5IT9Z 2OD5A 3O3KA 2PQ8A 5KVRA 5BMZA 3LWFA 1OPCA 5AONA 1OYIA 5TJJA 1ZYRF 2XAGA 3ECOA 3IRQA 4RGSA 1JXSA 5ILUA 2KIUA 2HFHA 1XMAA 4RB2C 1J5YA 5ICEA 3FMRA 4RGUA 5HLIA 2E7WA 4IF4A 5CVRA 3ML6A 1BOAA 5L3EA 4BH9A 3WTVC 1XD7A 1Y0UA 3K9TA 1ZAOA 1J7KA 4JBAA 4G7ZF 2L01A 3VB2A 1FC3A 3F22A 4E70A 4AWXB 3ELKA 1BI3A 4EJUA 2ESHA 1XB4A 3NEUA 1B1BA 1XCVA 3E97A 4IPAA 2JPBA 1ZLJA 2EFPA 3F8FA 3BROA 4A12A 2Z5UA 4HX4A 2C6YA 3BDDA 3K69A 4UXNA 3TKYA 2RKHA 4GCVA 2V1UA 4NB5A 5DCMB 1P4WA 1SMTA 4WK8F 4HA8A 3O6BB 2DPUA 4ON0A 1G4DA 5DD4A 4GO1A 3V4GA 5LGTA 2LSOA 4R1HA 3WTUC 3L9FA 1SD5A 1YS6A 1W7PD 1Z6TA 2EFNA 1ZLKA 4OIRF 1Z7UA 2CGPA 1UB9A 1T38A 3J80Z 3RDIA 1S6LA 3N4MA 1HXDA 2OAZA 3KE2A 3WTYC 4GGGA 1IAWA 3HUGA 1ZG3A 3SZTA 2MC3A 3WE2A 2AXLA 1YIOA 1HSTA 3U2RA 1KU3A 1W7PA 1E2XA 2PI0A 2RNJA 3E5UA 2ELHA 4G6QA 4XSZF 3GW2A 3EETA 2K27A 3JAMK 1FSEA 2F5CA 1YYVA 2COMA 3I64A 3I4PA 3ZMDA 4I7HA 5FD5A 4L0YB 1G3WA 1R22A 2IVMA 4A5NA 3QPTA 3TO9A 3ZMUA 4KN4X 5JR3A 2BE5F 5CLSA 1IRGA 5FLXK 3MZHA 3ZQ7A 1UHWA 3HRTA 4EM2A 1BM9A 2CYYA 2YX7A 2OA4A 4P55A 2HGCA 5ILVA 1FX7A 3KEQA 5E1XA 2P5LC 3KP3A 4H0EA 4YG2F 1BI1A 4GYGA 1S7AA 4ESFA 3FF5A 3RI4A 3WG9A 4GYIA 4BHPA 2A6HF 3R6SA 1EV7A 3GX4X 4KMFA 3IKTA 2F2EA 2FOKA 4R8HA 3WU0A 3P9IA 4UVCA 4KFCA 5AIQA 3BJ6A 1SFXA 3TGNA 4Y13A 1U3EM 1YG2A 2HDCA 3CTAA 5BPIA 4KIFA 1KU7A 4L18B 5JI6A 2IPQX 3DKWA 4HQMA 1U5TC 5KK1A 2LNBA 1ZARA 5CVVA 2EV0A 3K2ZA 2A07F 4M6YA 3PFIA 2OZ6A 4RB3C 4IRHA 3REOA 2BBYA 2EV6A 1ZRFA 3T8RA 3TQNA 4CO8A 4LFUA 1XGNA 1BJAA 1W4MA 2EK5A 3M7GA 2O0YA 3JSPA 2P7VB 4R79A 3F6VA 3L7WA 4LG0A 3HTUA 2XAHA 2KJCA 1TTYA 5D8LB 5LEKA 2O6GE 1BC8C 4MTDA 1U78A 2FEZA 2RVCA 3C1DA 3WTWC 1CGPA 3MEXA 1LVAA 5LRRA 2Z3YA 3E6CC 1WWXA 3Q9VA 4Z2YA 4L9VA 5D4SA 5J8FA 4WWCA 4I98B 3BZ6A 3F8CA 1Z05A 4MQVA 3KCCA 4HV6A 2W57A 4M9SA 1FBUA 2FBKA 5E17F 5H6QA 4OIQF 2L54A 3COAC 2O03A 1X3UA 3ABTA 5ICGA 3LA7A 3LA3A 1I1SA 3F8MA 1VTNC 4O6JA 5LEJA 2VBXA 5H20A 2IA0A 1TNSA 4OU0A 2DI3A 5DCMA 1MJ9A 3HOSA 3P9KA 4L9JA 2GXGA 3GYHX 5DUKA 1IZ1A 4UHTA 3S2WA 1TW3A 3D5LA 3LQRA 4G9YA 3KLOA 2P7CB 3FM3A 3GVAA 5LLQA 1KU9A 3KETA 1WRJA 2XV4S 4M9ZA 2XGXA 3QPHA 1FWZA 1S3JA 4PCQA 5HDKA 2EV5A 3BPVA 4LLLA 3GWZA 2J5PA 1MJAA 5JVTA 1V3FA 2UXXA 5L3CA 2PEXA 3OOPA 3NRVA 3FMQA 2ZNYA 2H27A 4HX7A 1XDUA 2GA1A 5ILSA 4L0ZB 4BNCA 2PMUA 3BOQA 3IHUA 4KNYA 2G7HA 5F1RA 2DT5A 1P2FA 4PGGA 2XIGA 4KDPA 1H0MA 4OIPF 1O7FA 1MGTA 1L0OC 4CICA 3BJOA 1YW7A 4I0AA 4PZJA 2ZBKA 4ENJA 1XGSA 2EFQA 3B73A 4HF1A 4Y17A 1R58A 3WTSC 2MH9A 5LBQA 4MEXF 2P8TA 1F1ZA 4ZYGA 2BGCA 2ZMEA 2QVOA 4P5OA 5JFRA 3TO7A 3FHZA 3F21A 5HLGA 4ZZLA 1PUEE 2K4JA 4UNOA 2Y48A 1FT9A 2IW5A 5E1WA 3LSTA 2BEOA 4OINF 2W25A 4ZYEA 3IWFA 1R23A 3JTGA 4IHSA 5FO5A 1IRFA 2WC2A 1B9NA 2P6SA 3B02A 2PG4A 4CYDA 2H09A 5FD6A 1HW5A 3V7RA 3O2PE 1IUYA 1QZYA 3I53A 4Q48A 1UHMA 5DUIA 1B59A 1DPUA 1K78A 1JGSA 4S04A 1KU2A 1F4KA 4MHGA 5DV5A 3SQNA 2ADUA 3CUQC 3ROUA 3I54A 1EH6A 1UFMA 2JZYA 1KQ0A 5LGNA 4B8XA 4RB1A 4HBLA 1H9TA 3I59B 4HV5A 1MJBA 2VOPA 1D3YA 1DPRA 2E1NA 3KEOA 3E6BA 3HSRA 3V8KA 4WCGA 3R4KA 1LDDA 4AVPA 3U1DA 4FHTA 1ZN2A 2P5KA 2VBYA 1YQAA 2XAQA 3HIFA 3DPTA 1JE8A 1MDMB 2FF4A 4MTEA 3R61A 5E20A 1ODDA 1V4RA 4LGWA 2IJLA 2XKOA 1ZGAA 3CUQB 1ZRDA 3EQLF 4A6EA 3ZMSA 3WTXC 1HKQA 2HTJA 2IP2A 1ZHFA 1FOKA 3D0SA 3HRUA 3M8EA 4U7DA 2D1HA 2PBIA 2FQ3A 4OOIA 2DK8A 2FNPA 2V79A 4LB5A 1T2KA 4O5VA 4XLNF 1G3SA 2M1BA 2DBBA 5AIPA 2MLKA 5IT3A 2OQRA 3SXYA 2OQGA 2A68F 1SD7A 4P9UA 3MQ0A 5L3FA 1USTA 4YIIA 2Q8KA 1F9NA 3PQKA 2XKPA 2AS5F 4BHBA 2IT0A 5K5QA 1L3LA 3R0AA 2FXAA 3V7SA 1TBXA 2STTA 3I58A 4HLXA 4A0XA 2A5YB 3FMSA 3KLNA 1T98A 4ZYHA 1RNLA 3E6DA 1P4XA 2FBIA 3GFMA 1HSJA 4A2UA 2H6BA 3RKWA 2DO7A 2YPRA 2A61A 1S7OA 3HSEA 2RC4A 2YU3A 4U0YA 4IRIA 3U9GA 2KIFA 5L3GA 2A69F 1JHFA 3DF8A 2VOOA 5L3DA 1BI2A 3GF2A 4AIJA 3K1MA 2VBZA 4I09A 1FYKA 5K5RA 4ENNA 4I2OA 3QU6A 2QYOA 2UZKA 2CSOA 2HYGD 2M5WA 1O3RA 3DXJF 1Z91A 3Q9SA 3TDUC 1ZG1A 1C0WA 3F6OA 1O7LA 1XGMA 4QLCU 3JAMZ 2FA5A 1PDNC 5E18F 2ISYA 3FZVA 4FX4A 2ZNZA 2Y0MA 4LLGF 1R00A 1P92A 3EUHA 1W5SA 3G3ZA 2XAJA 4EJOA 1P4AA 5FLXZ 4KT5C 3GEZA 2GZWA 4YIFA 5A2QK 5LHHA 1BBYA 1BIBA 2FNAA 1I1GA 3W6KB 2D45A
chains in the Genus database with same CATH superfamily
4IOCF 2KQRA 2OBPA 1ETXA 1ON2A 1ERDA 1CF7B 1IC8A 3EYYA 1QQIA 5BNGA 4ABZA 3OYCA 1IDZA 2RV8A 1YJNI 4M3FA 1ETQA 3L09A 4CSWA 3GFIA 1OR7C 1QHHD 4I99C 2F4OB 2K86A 2JJ7A 4PK4A 1OMIA 5JHUA 2HWVA 1H9GA 5IYBJ 1FOWA 4E7SA 2RQQA 4CZZA 1MD0A 5C44J 2A3SA 2ZXJA 4D0PA 4I01A 3T8TA 1FBSA 3IH4A 1GVJA 2KHMA 3BC8A 3VDXA 4UUVA 1SANA 3KFWX 1UELB 1OCOH 4XLEA 5EF6A 3MKWB 2D2WA 3HRSA 1S72I 3FX3A 1DU6A 2XPUA 3Q5FA 5FLVA 3SFZA 4KA4A 5E3LA 1R36A 1YLFA 3LFKA 1YI2I 1DP7P 4G7OF 4BUPA 1X2NA 4AM3A 4YFXF 2WAQA 3BJAA 3WTTC 2MD0A 1Z7LA 2E5ZA 3DQVC 3PFYA 4E7IA 1QO0D 2EA2A 2V1DA 2LY2A 2XASA 4HG2A 3V8LA 2JRMA 4L5JA 2VLAA 2JVGA 2IGKA 3DFGA 5IP7J 4Y52J 2L9RA 3H3UA 2J5OA 3WHCA 3PM1A 3ZN0A 4U7BA 4M72A 3KP2A 5M5XJ 3ONQA 3KP5A 3GTQJ 1IN8A 3TP3A 3H35A 5F04A 1FP2A 1XSVA 3B6AA 1DGRM 2ZJQF 3DBLB 2L9SA 1XG1A 1SFEA 1J75A 4GXOA 3ABLH 1OCZH 3CQZJ 5CQEA 3BTJA 1Z0XA 2LH9A 5HODA 2KZGA 5D8KB 1HQCA 4QPOA 2GBYA 2M45A 2AO9A 1D0ZA 3T5XA 5LD2C 2MA3A 2VJJA 1FZPB 3CJNA 3H3ZA 2VQGA 3IKVA 4ANJA 3IWZA 4CDGA 3RKQA 3OSFA 1GLNA 3HRMA 4DZPA 3HDDA 1XSDA 1BR4A 4QWQA 3A0BC 1J0RA 2KIMA 3GFLA 2OZUA 1VI0A 1XDSA 2DFFA 1IRZA 1WJ5A 1IW7F 4M9XA 3CJQB 3RIRA 2Y69H 3W6JB 3HGGA 3S15J 1ZTRA 4P96A 1X19A 2CO5A 3I59A 2VQHA 2IGNA 4LMYA 1N78A 5K5OA 1ONVA 1TQPA 1U5TB 4F92B 2GM4A 2HS5A 2ESNA 3ZMVA 3JRGA 1MNMC 3LSIA 4LIVA 1HLVA 1V5EA 2VT2A 2K9SA 4UVAA 5GAHJ 1VQLI 1QRYA 1TQMA 1XMXA 1WGXA 2UWMA 2X51A 4N0BA 2DA1A 4U0WA 1QGPA 3GTLJ 1R9TJ 1OQYA 4F7ZA 1BC7C 2HKXA 3OYBA 3OYIA 3M07A 3GZ6A 2CUZA 2XB5A 1MDMA 4CZCA 1ZR2A 1VQ6I 2BVMA 3DU5A 2VC1A 2CG4A 2VPRA 2ZXIA 5LHIA 1N25A 1STZA 3HOXJ 1YO5C 3PQJA 4IQ4A 1LPQA 1DP3A 1S9HA 2M4GA 2ICWG 5DM7F 4IHXA 1KZHA 2Q0OA 4PUSA 2L02A 3F0CA 2RGVA 2QZ8A 1N75A 4BAYA 3CUQA 1UAAA 2P6TA 2EA4A 1IXRC 2BY3A 4AD9A 2KRFA 1K7AA 3DP7A 4ZTJA 4NHJA 1G59A 3A2KA 4RAZA 3S1QJ 1IXCA 3CCVI 4FT8A 3OL3A 2ZC2A 3KP7A 3OYKA 4TV7A 3LSJA 5DD8A 1R4MB 3RPUD 5IPAA 3QP6A 1LQ1A 5F6FA 1V54H 4XNFA 2GXBA 1RZ4A 1LB2A 3R0JA 3LSMA 1X4OA 5IOYA 4PJMA 2E7XA 3G1MA 2A6EF 3QOPA 2K02A 3HTSB 3GTMJ 1TWCJ 2D1VA 2L3DA 4ZDLA 5EZGA 5ED4A 1LEBA 1W1WE 1JJ8C 1QPIA 2IGMA 3IAS2 2FU4A 3VODA 5CJ9A 2E35A 5B66C 2M7AA 2V9VA 3DPLC 3PUBA 2H8WA 2DOEA 1ZK8A 3F8BA 4DYRA 4F91B 5BS6A 2K9NA 3VYTB 4BHCA 2CW0F 2OU2A 1MH3A 2LOOA 3MZYA 4EM1A 1FNNA 4G12A 2N8GA 3P9CA 4A0YA 1J9IA 1K6OA 2VT3A 1T6SA 3I0TA 1W7PB 3RPUA 3HSFA 1QZZA 2ZXWH 2FJ1A 3H5RA 4GRIA 1BN5A 5JHFA 4OIOF 3K70C 1V55H 4M71A 2P4WA 3CLOA 2NVYJ 4H4KC 4KICA 1YHQI 2DMTA 2L7KA 3GXOA 2E5NA 3KEYA 3JTHA 2DFEA 4UUSA 4ZTFA 4KN7X 1FYLA 3OIOA 3J81K 1HBXG 3HHGA 1MSEC 1FJLA 4BE1A 4XBFA 4D7NA 2DMQA 4EQQA 2RDPA 4IHTA 1QU3A 1R4NB 1G3YA 2F4MB 2QQ8A 1SFUA 4IHWA 2OTJI 1OCTC 4BQAA 3DTEA 2LF7A 2BHYA 3RTRA 3WHBA 2ZSHB 1YFHA 3HB9A 2DA2A 2YU9J 1YJWI 2G0EA 5FFXA 1D1BA 3LAJA 2GA2A 2K3PA 2LMDA 4LK0F 1JHHA 4M3GA 3CCRI 2NRAC 4MEYF 2BVLA 2RAEA 3AG2H 1JT6A 2E60A 3IC7A 4CCLA 4D1QA 2RREA 4KMUX 2V7FA 1B72B 2ELJA 4L5IA 3BR1A 4A3BJ 1Y6IA 2ZJPF 2CQQA 3CC4I 1EH8A 4EGYA 1G3TA 5FKMA 2JRTA 3GZ5A 2B0LA 2XROA 2K5CA 2VL8A 4RS8A 3BG6A 2XGCA 2CH0A 3C2HA 1FYMA 1KQ9A 3ASOH 1FLIA 3RQIA 2QSGX 1I5ZA 2VXZA 3HEFA 1O3TA 4YFKF 2I8DA 2WB1A 1TWHJ 2DMNA 2EFOA 2KKOA 4I0BA 4L9TA 3OSGA 2LDUA 4EEFG 3A01A 5DM6F 1IV8A 1VQMI 4HF2A 2DU9A 5B1BH 3ZN1A 3K4NA 3VYSB 2HEOA 4A3CJ 3T0YA 1Z3YA 1O4XA 1J59A 4M73A 1O57A 2VB6A 4JX5A 5D5WB 2CW7A 1LNWA 4AIHA 3HOZJ 2EJRA 4B3AA 2DQRA 2JA7J 4E7KA 1RKWA 4X0GA 5E8IA 1JUSA 3DLAA 3PSFA 3DBRB 4NDLA 1IN7A 1U8BA 2MBFA 2HZTA 4A0ZA 1TT5B 2IAIA 4F52A 1FOXA 2JSPA 3RPQA 3N97A 2M8EA 3AAFA 3B6CA 4S05A 2JSCA 3BG9A 3BLYA 3FWEA 1OYYA 2FRHA 1BIAA 2F5FA 3ZMTA 4B47A 2IA2A 4RGRA 4WXCA 1JT0A 4EVIA 3VYUB 3F3XA 1Q1VA 1MBGA 2ZKZA 4GFBA 2VE8A 5EEHA 4OAZA 2PN6A 2Y75A 5D6FA 1XMKA 3TOAA 3VEPA 2GLOA 1SC7A 2M0MA 5M5WJ 1R1VA 2K4BA 2HOSA 3ABKH 5IT9K 1M1EB 1YTYA 1LVKA 1W5TA 5LGUA 2XUBA 2NNYA 3FBIB 5EGOB 3BCAA 3DTKA 2HR3A 4NQWB 4I6ZA 3A03A 4RMNA 4MIMA 4B09A 2R7QA 2NS8A 1TWGJ 5M5YJ 3OYHA 3L2CA 2V6EA 2DA7A 4LG0B 4CGZA 4DBRA 2R92J 1RUOA 2JTVA 4FX0A 1RI7A 4KIGA 4OAYA 1T8IA 2QUFA 3M1EA 4A3KJ 3L2UA 4BXUA 4KYWA 1XSXA 2EIKH 1A04A 1X4PA 1SD6A 1UCRA 2CQNA 2LLKA 3QRFF 2JA6J 5FFZA 4PJNA 4E7JA 4UV8A 3QPLA 2CQXA 2M87A 2HTSA 2DK5A 5JLWA 2VE9A 2DYRH 2WB1N 2MGQA 4JYKA 4XRSG 4DW6A 2V9PA 1F5TA 4IJAA 4LLNA 1ETVA 1LFPA 1WJCA 3GLLA 4ENKA 1OYWA 1QVUA 4RAYA 1ZGJA 2LC2A 3MD2A 4WXDA 2HDDA 1JUPA 2IS4A 3C7JA 1ZGWA 3F8NA 1FP1D 3BP8A 4YELA 4PSWA 4MQ9F 1XN7A 2FBHA 3FXQA 4G6DA 2YX4A 3TOBA 4FE4A 2XSJC 2H6CA 3GO5A 5GPAA 5GTIC 1R7JA 5B5EC 4CCNA 4EM0B 5J4VA 2HKOA 2W24A 5DYMA 1OR7A 2HQAA 3ABUA 4EGZA 2QBYB 3MAJA 4ZZDA 3EYIA 4XOPA 3M8JA 2CQ7A 3LSKA 1HW1A 4D5FA 4J00A 2DJNA 2IS2A 4F3QA 1R1UA 2Z1DA 4HOBA 2QSFX 3WU1B 3KYLA 1G6NA 2DMPA 4G94A 3JSOA 4MGRA 2KDZA 1DU0A 1WJFA 3PO3J 4XM3A 3S3MA 3FXJA 3K1NA 3V8JA 2X6YA 3SFIA 2NNNA 1U5TA 1TP4A 4JQFA 1KGSA 1T33A 4C9YA 1LEAA 2X85A 3C2GA 2CV0A 4HRIA 1U9NA 2HOEA 3ULQB 2VBWA 4RAGA 1T0FC 2DPDA 3C18A 4LD5A 2XRNA 2ZCWA 4M6XA 3S32A 5HS8A 4Q4ZF 1PP7U 2DLLA 2X6WA 5D5XB 1X1PA 5K1YA 3I5UA 4C2MJ 4XLPF 1Q1HA 2M0CA 5GAGJ 2DW4A 2LVSA 9ANTA 2GAUA 4LK1F 1GXQA 3E6MA 1VQKI 4PJJA 2JPCA 2X0LA 3KP4A 3F23A 1GVDA 3HYIA 1GV5A 1QVTA 1YX3A 3MFKA 3JRBA 3E0JB 1R71A 3L00A 4XIDA 4LIUA 1BOBA 2WV0A 4U0VA 2CFXA 3TW6A 2VKHA 5J1YA 1LDJA 3TBIA 1R1TA 2QQAA 3SZGA 1HDDC 3M4OJ 1P6RA 3P7NA 3RYPA 2ZMEC 1BJZA 3UKGA 2ZJ2A 3KZYA 3HOWJ 2CUFA 2CS3A 3GBGA 1VQNI 2QM3A 3IRRA 2DDAA 2EZIA 4ZDPA 3LOCA 2LBFA 1NTCA 3J7ZI 5ICFA 1UG0A 2TDXA 3EUKL 3OYGA 2NAZA 5HOOA 5C4JJ 3EUAA 3Q3SA 3OR2C 2L7MP 4D9JA 5CVIA 2MW8A 3J80K 3KPHA 3J7AO 5BOXA 1A6QA 4ZJZA 1K79A 4BE2A 4P1WA 2VONA 2Y9ZA 4J19A 3H5AA 1ZREA 1MH4A 4A3MJ 3RJPA 1MZBA 4G8XA 1WH5A 4Y15A 2XAFA 4ZC3A 3HC7A 4RGXA 1U6GA 2LFBA 1ZKGA 4M74A 3W2AA 4KUMA 1TLHB 4U87A 4FASD 4BY1J 4NC8A 2PFBA 4G7HF 2O61A 4RLFA 3U21A 1YW9A 1D8KA 3CJTB 1R6RA 5LRSA 4PGHA 3ZQHA 1D0YA 1USSA 3LSRA 1QNTA 1YW8A 2ID3A 3MMYB 1HCRA 1H88C 4LG3A 2KJBA 4IZZA 3QODA 4AYBA 4N9HA 1D8JA 2Z9OA 3GZNB 1N77A 4B43A 4BACA 1KQ8A 1G8XA 5K7HA 4XOTA 5LHGA 3G4SI 3ERED 3ZQGA 3WGIA 1LE8B 4BU2A 4CA0A 3HKZA 5L3BA 2GWRA 3OV8A 3ZQFA 4ESJA 5H2FC 4V2FA 2ZMEB 4CYCB 3LQQA 5EYRA 4RB0A 1FTZA 3KP6A 2A6TA 2GIVA 1WJEA 2R7FA 5HLHA 5K7FA 1SVOA 1ZG5A 3GTOJ 1OISA 4L9NA 1S29A 5LFAA 4HYEA 4OMYA 4IXAA 4II2A 1NG7A 1ZH5A 1FY7A 2EZLA 2NS0A 2P81A 3C2BA 3WODF 2ISZA 4EJTA 4FQGA 1ENHA 1MMDA 5DDGA 1R49A 3SEZA 2W84A 4HF0A 2HNHA 2HU9A 2XGEA 2R5YB 4DOZA 1OKRA 1WKMA 4A3GJ 3K70D 1IGNA 1WQ2A 3MCZA 2VXDA 4PFPA 5FKOA 3CJRB 2E2JJ 2OV7A 2HVSA 2NXNB 4X6AJ 1QHGA 3W2WA 2G7UA 4XSXF 4CCOA 4WXHA 1A31A 2PJPA 2QEXI 2Z2SB 3H0DA 5BPDA 1B72A 5TRDA 2R7ZJ 5A2QZ 2XPVA 5DEQA 1FPQA 3OWTA 3SDBA 1U8RA 2RQPA 3PNYA 3DBHB 2BXZA 2ZXHA 4A6DA 2R7XA 1IN5A 1TW2A 3LA2A 3JRCA 1W5CC 2JT1A 4E7LA 2HVQA 4U88A 1I6XA 4C2UA 1D1AA 1R5GA 1Z9CA 2F5EA 4PSXA 5D6EA 3OYLA 3KZZA 2IGOA 3RKXA 2K9LA 1K78B 3FXKA 3W3CA 3SHFA 2LKSA 1O3QA 4IHYA 2QENA 3K7AJ 4IL6C 1WSUA 2GOXB 2JK3A 2WTEA 2X9DA 3TO6A 1GHCA 1HKTA 2CQKA 1B9MA 1UHSA 5HDGA 5IP6A 4HDVA 2R7UA 4BJTA 1WJBA 1ULYA 2O9LA 2HQNA 2TCTA 2IA1A 2COBA 1AOYA 5FB2A 3ZRGA 3CDIA 4NNJA 3K1PA 1JKPC 1TWFJ 5HDNA 4IHVA 1SD4A 3FXRA 1WJAA 1YS7A 1S7EA 3WE3A 3IAM2 1HKSA 1U2WA 2VN2A 1GT0C 3DV8A 2HYFA 4HAMA 4ZYAA 3H1CA 5E8GA 3QAHA 2KZVA 2GQQA 4A5MA 4HZFA 2STWA 4MO7A 2NYXA 3J7AY 2K9QA 1VNDA 2E1CA 4B44A 4KIBA 3CO7C 4LJZF 3DLLF 4ENMA 4Q47A 5ERIA 5EJCA 4XRSA 2Q2EA 2R3SA 1KYWA 3DKYA 4HNVA 4XN3A 3S93A 4NUBA 1X1CA 4ESBA 4BDYA 1I50J 3ZGKA 3CCUI 1MIJA 3PSIA 3TDZC 4YIRX 4JK1X 2Z99A 5FGMA 1LDKB 2MD5A 2X4HA 4HQEA 1MMGA 1S8NA 2FE3A 5J1RA 2KMUA 2FX0A 2JQ7A 3E5XA 1E0EA 1ON1A 3I3LA 3ABMH 2QQBA 3ZPLA 2LRDA 3PJRA 3X2QH 2O3FA 3H0GJ 3ZP5A 3CDHA 3H92A 1LFBA 4BE0A 2BZTA 2LF8A 3DEUA 3W6VA 5EGOA 4FETA 5E1ZB 4FISA 1Z3XA 4ASNA 4RAFA 2KP6A 2FD5A 2A5WA 2KL4A 4NQWA 1EKEA 1YRNB 2Z33A 4Q5SF 2VODA 5DS9A 1B8IB 3E5QA 3HOTA 2F48A 2CV2A 1I27A 4IKFA 1REPC 1T56A 1X3WB 1XS9A 1TNTA 1JKQC 1RR7A 1ACIA 1BI0A 3DTIA 2GIZA 4Z6YA 4CXFA 4L5EA 4IRGA 3LAPA 3D1NI 1LUJB 1KA8A 3ISPA 2WY7Q 3R60A 3GTKJ 2YSRA 2H94A 3WGHA 4BY7J 4UUTA 2QCOA 1NH3A 1D5VA 1XTAA 1W0UA 2W82A 2R7VA 1EH7A 2LREA 3K4BA 5B3SH 1FBQA 4P9FA 2IS6A 4I02A 1FTTA 3CLQA 4BYYA 3Q0UA 5FJ8J 3ZMZA 5FKLA 3CCSI 4YFNF 1LJ9A 1WVRA 3PO2J 1QBJA 1J2XA 3BPXA 4O3MA 2ETHA 2W48A 3K4JA 6PAXA 1OCPA 3AG3H 1T39A 4IX7A 1MKMA 3RZOJ 2FSWA 2WAQN 5D4RA 3HPGA 4WF2A 3CMYA 2XSDC 1IO2A 5CVJA 2DFIA 1HOMA 3OL4A 2QKLB 1DDNA 1ZQ3P 2K7LA 2ZO4A 2BHZA 3CO6C 2QBYA 1FSHA 4LITA 2K85A 2YS9A 5EEAA 3AG4H 5E3MA 1GXPA 2FQ4A 2DA3A 2XVCA 2IRFG 2M30A 2W85A 1NHAA 4N9IA 3KX2A 2P5VA 1MBEA 2DT6A 3CMEI 3ECHA 3RYRA 3G6EI 2V6CA 3HBLA 4UB6C 5GP9A 3DEWA 5HS9A 1AWCA 3FM5A 5DCFA 3HUGB 5FKNA 5HS7A 3K10A 3M9AA 4WX9A 1IXSB 3JW4A 2PLYA 5CVUA 5H6RA 2HQRA 4D7MA 4NC7A 3D5SC 3SZPA 3BWGA 3JRFA 4XR6A 2BV6A 4ZYDA 4RLQA 3ZR8X 3CDLA 4EV0A 4XRMA 2V4JC 5D5UB 3FXLA 2DOFA 4IVNA 2QLZA 3TP0A 3G1LA 4XLFA 2M3AA 4JX4A 1E17A 5J1UA 3K4MA 1B6AA 5HVQC 5EZHA 2BYVE 3VFZA 3IP4B 1WI3A 2EWNA 1J09A 3QPSA 5J8CA 4PJ0C 3S8PA 3IL2A 1JJ6C 2DQLA 4XN0A 3FHNA 4ZH4F 3FXUA 1IN6A 2VC0A 5ICCA 1KYZA 5J6XA 2KRCA 3ZQCA 3QU3A 2E2HJ 2DTRA 2EB7A 1XGOA 4PDKA 2G9WA 1PUFB 3F9KA 1RC9A 3WU2C 2MH2A 1K4TA 2ACJA 3WGGA 1X1BA 4UVBA 3J81Z 2FMYA 1X58A 3JRDA 2BY2A 2EFWA 3CUOA 2MG4A 3ZCOA 3H9GA 2L9NA 4BEHB 1ZELA 4C30A 3F72A 3I4MJ 1W36C 1PP8F 1SAXA 4QTRA 3G73A 2O8XA 2ZSIB 3GUDA 2B63J 2X1DA 1ETOA 4HX8A 2CRGA 2DYSH 2WAEA 1HC8A 3A4CA 1T0FA 3QYBA 1QPMA 2M4KA 3GFJA 4EJVA 4W97A 2UXNA 1R5HA 1RIOH 1XCBA 2LY9A 3A0HC 3TL4X 3OIQA 1S5LC 2X48A 2ZFWA 2JMWA 1ITYA 1TT0A 4ETSA 3OIPA 4HDUA 5EDNA 3M8FA 1OFCX 2E1OA 2EBIA 4K2EA 4A3DJ 3VOEA 2PMHA 1WI9A 3EDPA 5F64A 2B9SA 2XC7A 3E3VA 3C3WA 3S2DJ 1HW2A 4HW0A 1IF1A 1APLC 3CMAI 2CJJA 3ESWB 1F36A 2VIXA 2YR2A 4CYCA 1MMSA 4AVZA 3FK6A 4AIDA 2KFDA 4UV9A 5KHDA 4E7HA 4HLYA 3NQOA 2LKPA 1UMQA 2CW8A 4EATA 4LB6B 1AKHB 4EJWA 5D5VB 4BBSJ 3QP5A 2V1XA 1Z1DA 2F5DA 3PNTA 1ZRCA 2ZB9A 5EEGA 3RKYA 3BY6A 3WTZA 2WWYA 2L4MA 3HG9A 2ZFUA 2WY8Q 2DAOA 1TZLA 2OCCH 4XKCA 4OMZA 3RSNA 2QQ9A 1TQIA 3CC7I 2FMLA 3GMEA 3V7CA 4AIKA 4MNUA 4DNCA 5IYCJ 1O3SA 1RUNA 1Z6RA 2Y31A 3I71A 2X6XA 4N4NB 2RN7A 3MWMA 4BJ6C 1KONA 1SMYF 3HOYJ 1CF7A 4AC0A 3K0LA 4DQ2A 1DUXC 2Y9YA 5C3EJ 3H9QA 1W0TA 3ZQIA 4FTHA 2QWWA 1B4AA 5BQTA 3M3YJ 3T1BA 2CWEA 1F43A 3HHHA 4Y3OA 2R7DA 4XRFA 3MVPA 1IN4A 4BL0B 3JRAA 2L4AA 2XHKA 3GLXA 2KLOA 1LKXA 5F1JA 4NBQA 1YIJI 4MFDA 3E1SA 2MLGA 5CYVA 3JRIA 4EMSA 2BXYA 4CHUA 3FDYA 3CF5F 2NVQJ 5CKTA 2E2IJ 5IT9Z 2OD5A 3HL2A 3O3KA 2PQ8A 3HXLA 5KVRA 3OYAA 5BMZA 3LWFA 2DOAA 3CCMI 1OPCA 2IXSA 5AONA 2TRTA 1OYIA 3I4NJ 5TJJA 1ZYRF 2XAGA 3ECOA 3IRQA 4RGSA 1JXSA 3ZXSA 4B3XA 5ILUA 2EPFA 2KIUA 2HFHA 3MKZA 4E4HA 4BS9A 1XMAA 3FIWA 4RB2C 4IOAF 1J5YA 5ICEA 3FMRA 4RGUA 5HLIA 2VPLA 2E7WA 3BQZA 4IF4A 5CVRA 3ML6A 4KISA 1BOAA 1SFKA 2DN0A 3L2WA 5L3EA 3S1MJ 4BH9A 3WTVC 1XD7A 1Y0UA 3K9TA 1ZAOA 3O8GA 1J7KA 5GADJ 1Y8RB 4ITVA 4JBAA 4G7ZF 2L01A 2V26A 2PMZA 1Z67A 1K61A 3VB2A 1FC3A 1BL0A 3F22A 3CD6I 1TWAJ 4E70A 1JI8A 4AWXB 4XKWA 3ELKA 1BI3A 4EJUA 2ESHA 5IYDJ 1XB4A 3NEUA 1WPKA 1FOYA 4XLCA 3ASNH 1B1BA 1SVMA 1XCVA 1FIAA 3G71I 3VYRB 1YRNA 2OC6A 3VPRA 3E97A 4AUXA 2HOAA 4XL9A 4IPAA 3RZDJ 2JPBA 1ZLJA 2EFPA 2YUSA 3OYDA 3F8FA 3NARA 4BXXJ 3HOUJ 2WA0A 3K2AA 3BROA 4B4CA 3JR9A 4A12A 2HXOA 2Z5UA 4HX4A 3QYFA 4RM2A 2C6YA 3BDDA 3BTIA 1QZEA 3K69A 5EG0B 3FXOA 4UXNA 3TKYA 2RKHA 4GCVA 2V1UA 2A05A 4DYQA 2HQ5A 4NB5A 5DCMB 1P4WA 4MLOA 1SMTA 3CP2A 2JUCA 4WK8F 3MKYB 1MBHA 2QKMB 1Y39A 4HA8A 3LSPA 3O6BB 4FE7A 2DPUA 4PFOA 4ON0A 1G4DA 5DD4A 5K7ZA 2NVXJ 2IS1A 1BW6A 4GO1A 3S1NJ 2LTPA 3V4GA 2L5QA 5LGTA 1K83J 2M8GX 3I56I 3BZKA 2HZDA 1T08B 2F5VA 2LSOA 4MFEA 1YJ9I 3LMMA 4R1HA 3H9JA 3WTUC 3L9FA 1XPXA 4HSTA 1GUUA 1SD5A 3OMYA 3QYEA 2BW3B 2IEKA 2Y0SA 1YS6A 3K4KA 2EQRA 1W7PD 1Z6TA 2GOMA 4M3DA 3HOVJ 1OCRH 2E19A 4UUSB 3CP8A 3IH3A 2EFNA 3I55I 4E6KG 1ZLKA 4OIRF 4XK4A 1P7IA 1R5ID 2KPMA 3E7LA 1Y1WJ 3D5RC 1Z7UA 4A3FJ 2CGPA 1UB9A 4IEJA 3TMOA 3FISA 5TISC 3J80Z 1T38A 3RDIA 1S6LA 2XF6A 3N4MA 4GDFA 2OCEA 1HXDA 5CQGA 5FKKA 2OAZA 3KE2A 3WTYC 1JTXA 5C4XJ 2CV1A 4GGGA 1IAWA 3HUGA 3OR1C 2AQFA 1ZG3A 3QQAA 3SZTA 2MC3A 2EZHA 3OY9A 3WE2A 1X2MA 2AXLA 1YIOA 1HSTA 3U2RA 3DU6A 2DFHA 4Y7NJ 5J3LA 1KU3A 3S17J 1DGWY 5FROA 1D1CA 1W7PA 1E2XA 1NK3P 3J7YJ 2PI0A 2RNJA 3E5UA 2QGUA 2VI6A 2ELHA 2EH3A 4G6QA 3DPUA 4C2TA 2BY0A 4XSZF 3PIOF 3GW2A 2NVTJ 3EETA 2DDBA 2K27A 2PJRB 3JAMK 1X3ZB 1FSEA 2F5CA 1YYVA 2COMA 3I64A 3I4PA 2M7BA 3ZMDA 2JA8J 2W1OA 1Z21A 1X1AA 2ELKA 4I7HA 5E3OA 1MBJA 2XB0X 2EIMH 1SEUA 2Z16A 5FD5A 4L0YB 1G3WA 1R22A 3A01B 2IVMA 3S2HJ 3BTCA 4A5NA 3QPTA 3BT9A 3TO9A 3ZMUA 4C3HJ 4KN4X 5JR3A 1I39A 2BE5F 5CLSA 5FLXK 3MZHA 1IRGA 2MSYA 3ZQ7A 2XPWA 1UHWA 1VQ9I 3HRTA 1YX5A 3SDGA 1BM9A 2CYYA 4EM2A 2YX7A 2OA4A 2DT7B 5CPRB 3L2RA 1E3HA 4XICA 4P55A 2HGCA 4A3JJ 2WADA 5ILVA 1FX7A 2JWTA 2VQCA 3KEQA 1SFOJ 2JA5J 5E1XA 3UR3C 2P5LC 1NK2P 3KP3A 4H0EA 2WBMA 3AL0C 2MYSA 4YG2F 2D5VA 1BI1A 3FKJA 2FOWA 3OYJA 2BY1A 1RESA 2VQLA 4GYGA 1S7AA 4ESFA 2I10A 3FF5A 3RI4A 1JGGA 3AG1H 3KZIC 4S0HB 3WG9A 3WG7H 1U0JA 1IRXA 4GYIA 4BHPA 2A6HF 3R6SA 1EV7A 3GX4X 4KMFA 3IKTA 4A69C 3CMMA 2F2EA 2FOKA 2K3FA 3V42A 4R8HA 3WU0A 3P9IA 4UVCA 4Y4RA 2HXIA 2E36A 4KFCA 5AIQA 1RKTA 3BJ6A 1PYVA 1SFXA 1AKHA 3JREA 2X6OA 3TGNA 4Y13A 1U3EM 1YG2A 2M34A 2HDCA 3CTAA 5BPIA 2M9HA 4AYBN 3FK7A 4KIFA 1JUMA 1KU7A 3HZJA 5JI6A 2IPQX 3DKWA 4KJZA 4L18B 1QA6A 4HQMA 1U5TC 1OJLA 2VJIA 2DCEA 2LNBA 3HKZN 1ZARA 5CVVA 5KK1A 3ZOBA 1IJWC 2EV0A 3K2ZA 2A07F 4M6YA 3PFIA 2OZ6A 4RB3C 4IRHA 3REOA 4J01A 2BBYA 1Y8QB 3BZCA 1XX5A 4B48A 2B7EA 2DODA 2EV6A 5B1AH 3HM5A 4B1RA 2H1KA 2X1CA 1ZRFA 3AL0B 4JP0A 2E1MC 5IP9J 3T8RA 3TQNA 4CO8A 4LFUA 1A36A 5FRMA 2O7OA 1CQTA 1XGNA 1BJAA 1W4MA 2EK5A 1A6IA 2O0YA 3M7GA 2ZJRF 3CCQI 5GPCA 2E34A 4BGDA 1GDTA 4ZDOA 3JSPA 2BOLA 2E71A 3CESA 3U1KA 2P7VB 4R79A 1VQ8I 3F6VA 3LFUA 4IQJA 2OPTA 3CC2I 3L7WA 4LG0A 3HTUA 2XAHA 4HNTA 5IY5H 1WH7A 2KJCA 1MW7A 1TTYA 3G2BA 5D8LB 5LEKA 2O6GE 4C3JJ 1BC8C 4MTDA 3GTGJ 1U78A 4JX6A 1D5YA 3GTPJ 2FEZA 2RVCA 1E3PA 1ETWA 3C1DA 4A3EJ 3FKIJ 3WTWC 1IUFA 3HGYA 1CGPA 3MEXA 1IG7A 1LVAA 5LRRA 2KIQA 2MFZA 2DXIA 1MSFC 2Z3YA 2VASA 2P0WA 3BG3A 3BR0A 4BJ5C 3E6CC 1WWXA 2R4GA 4IO9F 2EIJH 3Q9VA 2R7OA 3ZQLA 5J47A 4Z2YA 1X1DA 3DEEA 1RPWA 4L9VA 3HPHA 5D4SA 3BR5A 3BR3A 2ID6A 1T95A 5J8FA 3CCLI 1VQ4I 3SEQA 4WWCA 4I98B 4BQQA 2XAUA 3BZ6A 3F8CA 5GAEJ 1EF4A 3BG7A 2Y2ZA 1Z05A 4DGWB 2LKXA 3CF2A 3VSLA 1P7JA 4MQVA 5JVGF 3KCCA 2E1MB 3OS0A 4HV6A 3RCOA 3CCEI 2W57A 4XKVA 3VWBA 4M9SA 3KYCB 2R5ZB 1FBUA 2FBKA 2M2EA 5E17F 5KNLA 5H6QA 2L7FP 1A5JA 4G6TB 4OIQF 2L54A 2JVHA 3EUHC 3COAC 1Z77A 1Y0NA 2CUJA 2LBFB 2O03A 4HPQA 2ME6A 2ECBA 4CUGA 3PIPF 1BR2A 1X3UA 3ABTA 5ICGA 2DTZA 2LR8A 3LA7A 3LA3A 5EG0A 1VFCA 1I1SA 3F8MA 1VTNC 4O6JA 5LEJA 2VBXA 5H20A 2IA0A 1TNSA 5F0FA 1SVLA 4OU0A 2DI3A 5DCMA 1MJ9A 3HOSA 1RRJA 3P9KA 4L9JA 1ORKA 1P9QC 2GXGA 1MNDA 5GTHC 4A3IJ 1EJ9A 3GYHX 5DUKA 1IZ1A 4UHTA 3S2WA 1TW3A 3D5LA 3LQRA 4G9YA 3L2VA 4D5CA 3KLOA 2P7CB 2LG4A 3FM3A 3GVAA 5KCMA 5LLQA 1KU9A 3K4CA 3KETA 1E3OC 1WRJA 2HDWA 2XV4S 2JN6A 2PX9A 1IDYA 4XKBA 4M9ZA 1VQ5I 4QIWN 2XGXA 4HSRA 1MBFA 2JA2A 5HLTA 3QPHA 2F6CA 2DA6A 3K6GA 1FWZA 1K6YA 1S3JA 2NOJB 3OYNA 3KIOA 4PCQA 2W7NA 5HDKA 2LD5A 2EV5A 3BPVA 2DMUA 4LLLA 2BW3A 3GWZA 2J5PA 3S3OA 1MJAA 3KYDB 3H5NA 1V3FA 5TGTA 2UXXA 5JVTA 4KT6A 5L3CA 2PEXA 3OOPA 3NRVA 1JTYA 1UG2A 2XF7A 1AHDP 3FMQA 2ZNYA 1VQOI 2H27A 4HX7A 1XDUA 3TEDA 2GA1A 2KDOA 4LOCA 5ILSA 4L0ZB 4BNCA 2PMUA 3BOQA 3IHUA 2LYCA 2G7HA 3BR6A 1MBKA 5F1RA 4KNYA 2DT5A 1P2FA 2UV1A 3Q0WA 4PGGA 2RNGA 3OS2A 4UY8I 2MC4A 2Q1ZB 2XIGA 4XLHA 3BTLA 4KDPA 5F08A 1H0MA 4OIPF 2DJIA 1O7FA 2ECCA 1MGTA 5F0CA 2OTLI 1L0OC 4OWRB 4CICA 3BJOA 1YW7A 4DYCA 4I0AA 3LL7A 4PZJA 2HVRA 2ZBKA 4ENJA 1WZ2A 1XGSA 2EFQA 3B73A 2O8KA 4HF1A 2WV1A 4Y17A 4KITB 5M3FJ 1R58A 3WTSC 4F93B 2MH9A 1K4SA 2QF7A 2OF7A 3DCFA 1LE8A 5LBQA 4MEXF 2P8TA 1F1ZA 3CCYA 4ZYGA 3DKXA 2X1EA 2BGCA 2ZMEA 2PJRA 4M6VA 2QVOA 4P5OA 5JFRA 3TO7A 4QPQA 3FHZA 3F21A 2FUG2 5JLXA 5KAFC 4X1EA 2IBDA 4ZZLA 5J4YA 4XLAA 5HLGA 3AKZA 1PUEE 2K4JA 4II3A 4UNOA 2Y48A 1FT9A 2KRHA 2I5UA 2IW5A 1Y56A 5E1WA 3LSTA 2BEOA 1HDPA 1I3QJ 2R5YA 3G1OA 4OINF 2VJ5A 2W25A 4ZYEA 1MNEA 3S14J 3IWFA 2XRLA 1R23A 3JTGA 4IHSA 4PJLA 4XORA 5FO5A 1IRFA 2WC2A 2DA4A 1WHUA 1JKOC 3GTJJ 2V9KA 4DBQA 4JOMA 1B9NA 1FEXA 4V19K 3JCUC 2P6SA 3IV5A 3B02A 3S1RJ 4Y33A 2PG4A 4XMYA 4CYDA 1MMNA 2H09A 5FD6A 5FRNA 1HW5A 3V7RA 2GXAA 1XC5A 3O2PE 1IUYA 3BQYA 1QZYA 4M3BA 2Q2EB 3FBNB 3I53A 1FIPA 2KT0A 2WAFA 4Q48A 2VUMJ 1UHMA 3IUOA 5DUIA 5FLMJ 1B59A 3OYFA 3Q0VA 1DPUA 1K78A 1POGA 1JGSA 4AU7A 4S04A 1KU2A 2K9MA 1F4KA 5KAIC 4C3IJ 2ME0A 2AQEA 4NC6A 4MHGA 2VKVA 4HEA2 5DV5A 2XGDA 2ADUA 3CUQC 2JUGA 3ROUA 3SQNA 5IOZA 4QSHA 2QSHX 2HPMA 3I54A 3OS1A 1UZCA 3RQ4A 1EH6A 1UFMA 4CH7A 2JZYA 1SAUA 4E7ZA 5HNHA 1KQ0A 1H8AC 4A93J 5LGNA 1YE9A 2L9VA 1A35A 4B8XA 4RB1A 4HBLA 1H9TA 2CFOA 3I59B 4HV5A 1VZ0A 2VJ4A 2R93J 1MJBA 2VOPA 3CZ6A 1ZR4A 1D3YA 1DPRA 1UJ8A 4DIQA 4V2GA 3O8HA 1U9OA 2E1NA 4YRVA 3SYTA 3KEOA 1FMVA 3E6BA 3CCJI 3HSRA 3V8KA 4WCGA 4HNUA 1AU7A 3R4KA 1LDDA 2OUMA 4AVPA 3U1DA 4FHTA 1ZN2A 2HI3A 2P5KA 3LSHA 3PL8A 2F4IA 1ETKA 2VBYA 1MMAA 1YQAA 2MABA 2XAQA 3HIFA 3DPTA 1JE8A 4DJAA 1MDMB 2FF4A 4MTEA 3R61A 5E20A 1ODDA 1PJRA 2NVUB 4W1UA 1V5FA 4CCMA 1V4RA 4LGWA 2EILH 2IJLA 2R7TA 2XKOA 3PUFA 2AHQA 1LFUP 3LNQA 3H36A 1ZGAA 2W00A 1B8IA 2Y30A 2EZKA 3CUQB 3EQLF 1ZRDA 2QA4I 4BQOA 4BQNA 4A6EA 3ZMSA 3WTXC 3JRHA 3L2QA 1HKQA 2R7WA 2HTJA 2IP2A 1ZHFA 3K4LA 1FOKA 3D0SA 3HRUA 3M8EA 2V1NA 3NWSA 4RM3A 3HJEA 4U7DA 1VF9A 2D1HA 4DZJA 2PBIA 3MKLA 1YOVB 3A1YA 2FQ3A 2K40A 1VQPI 4OOIA 2DK8A 2FNPA 1WJDA 4RDUA 3PNVA 2V79A 4LB5A 1T2KA 1EA3A 4O5VA 3NAUA 2HYJA 4XLNF 3BCBA 1BW5A 1G3SA 3NWTA 1YITI 1FMWA 3L1PA 3FXMA 3ERMA 2M1BA 2W4SA 2DBBA 3LSGA 5AIPA 2MLKA 5IT3A 2DA5A 2R7RA 2OQRA 5F27A 3ZQQA 1BA5A 3SXYA 2OQGA 1TC3C 1GV2A 4XONA 2A68F 1SD7A 1OCCH 1RETA 1I3AA 4P9UA 4BKXA 3MQ0A 5L3FA 1USTA 3BG5A 4YIIA 1BR1A 2LP0A 2Q8KA 1F9NA 4BXFA 3PQKA 2XKPA 3TW7A 2AS5F 4FCYA 2VKEA 4BHBA 2IT0A 3OYEA 5K5QA 1L3LA 3R0AA 4I76A 1D0XA 3EPZA 4BBRJ 2FXAA 3V7SA 1TBXA 1WCMJ 3I58A 2STTA 4HLXA 5E3NA 2R5ZA 1TL8A 4A0XA 2A5YB 5J40A 3GCMA 3QOEA 3FMSA 3KLNA 4XQFA 3SJMA 2CMPA 1T98A 2R7SA 4ZYHA 1RNLA 2PMZN 3E6DA 1P4XA 2FBIA 3GFMA 3MN2A 1HSJA 4A2UA 2H6BA 2L7ZA 3RKWA 2VKDA 1JKRC 1Y1VJ 1RR8C 1DQUA 3UNGC 2DO7A 2YPRA 2A61A 1S7OA 3HSEA 1WFXA 3W2VA 2RC4A 3N05A 2HOTA 2UUZA 2YU3A 4U0YA 4IRIA 3S3NA 3U9GA 2KIFA 3M1CA 3H3VK 5L3GA 2A69F 1JHFA 3DF8A 2VOOA 4RBOA 4CCKA 2NS7A 3AFHA 5L3DA 1BI2A 2LY1A 3GF2A 2L0KA 4BDZA 4AIJA 3K1MA 2VBZA 4I09A 5M3MJ 2HPIA 1FYKA 4N4OB 5K5RA 5DTDA 4ENNA 4A3LJ 2CUEA 4I2OA 3QU6A 2H8RA 1AA7A 2QYOA 4UB8C 2UZKA 2CSOA 2HYGD 2M5WA 3P5JA 1O3RA 4RA2A 1VQ7I 3DXJF 1ETYA 1Z91A 4YEJA 3Q9SA 3TDUC 1ZG1A 1C0WA 3F6OA 1O7LA 3IH2A 1HA8A 1XGMA 1PVEA 1PUFA 1H89C 2O5RA 3JAMZ 4QLCU 3S16J 2FA5A 1PDNC 2AXTC 5E18F 1V5GA 2ISYA 3OOUA 3FZVA 4CCJA 4FX4A 3QWLA 2H1LA 2ZNZA 4BEHA 2Y0MA 4LLGF 1HF0A 3BR2A 1R00A 1P92A 2EINH 3EUHA 1W5SA 3G3ZA 3DWLE 2OJED 2L2OA 5F0HA 3A02A 2CU7A 2XDVA 2XAJA 3VSKA 4EJOA 4F55A 1P4AA 5E79C 5FLXZ 2R0QC 4KT5C 3GEZA 2GZWA 3I9V2 2Y0SN 4M3EA 1IV6A 4YIFA 5A2QK 2LK2A 3MZ8A 5LHHA 3OYMA 1I6HJ 1BBYA 5HNFA 1BIBA 2FNAA 1I1GA 3W6KB 2D45A 2XF5A 1G2HA 1OLTA 2KISA 2NOGA 1W36D 1NG6A
chains in the Genus database with same CATH topology
2OBPA 1ON2A 1CF7B 3EYYA 1QQIA 2RV8A 3L09A 3GFIA 2K86A 1OMIA 5JHUA 2HWVA 1H9GA 4CZZA 1MD0A 2A3SA 2ZXJA 4D0PA 4I01A 3T8TA 1FBSA 1GVJA 4UUVA 3KFWX 2D2WA 3HRSA 3FX3A 3Q5FA 3SFZA 4KA4A 1R36A 1YLFA 3LFKA 1DP7P 4G7OF 4YFXF 3BJAA 3WTTC 3DQVC 1QO0D 2EA2A 2V1DA 2XASA 3V8LA 4L5JA 3DFGA 3H3UA 2J5OA 3ZN0A 4U7BA 4M72A 3KP2A 3KP5A 1IN8A 1FP2A 1XSVA 1SFEA 1J75A 4GXOA 5D8KB 1HQCA 2M45A 3T5XA 2MA3A 1FZPB 3CJNA 3H3ZA 3IKVA 3IWZA 4CDGA 3HRMA 1XSDA 4QWQA 1J0RA 2KIMA 3GFLA 2OZUA 1XDSA 4M9XA 1IW7F 3W6JB 3RIRA 4P96A 2CO5A 3I59A 4LMYA 5K5OA 1ONVA 1TQPA 1U5TB 2HS5A 2ESNA 3ZMVA 2VT2A 4UVAA 1TQMA 2UWMA 4N0BA 4U0WA 1QGPA 4F7ZA 1BC7C 2HKXA 3GZ6A 1MDMA 2VC1A 2CG4A 5LHIA 1STZA 1YO5C 3PQJA 2Q0OA 2L02A 2RGVA 2QZ8A 4BAYA 3CUQA 2P6TA 2EA4A 1IXRC 4AD9A 1K7AA 2KRFA 3DP7A 4NHJA 4RAZA 1IXCA 4FT8A 3KP7A 4TV7A 5DD8A 1LQ1A 3QP6A 5F6FA 2GXBA 1RZ4A 1LB2A 3R0JA 2E7XA 2A6EF 3QOPA 2K02A 3HTSB 2D1VA 2L3DA 5ED4A 1LEBA 3VODA 2FU4A 5CJ9A 2V9VA 3DPLC 3F8BA 5BS6A 4BHCA 2CW0F 2OU2A 3MZYA 4EM1A 1FNNA 3P9CA 4A0YA 1J9IA 1K6OA 2VT3A 1T6SA 3I0TA 1W7PB 3RPUA 3HSFA 1QZZA 1BN5A 4OIOF 4M71A 2P4WA 3CLOA 4KICA 3GXOA 3JTHA 4KN7X 1FYLA 3J81K 1HBXG 3HHGA 4XBFA 4EQQA 2RDPA 4IHTA 1G3YA 1SFUA 4BQAA 2LF7A 3RTRA 1YFHA 5FFXA 3LAJA 2GA2A 4LK0F 1JHHA 2NRAC 4MEYF 3IC7A 4KMUX 4L5IA 1EH8A 4EGYA 1G3TA 2JRTA 3GZ5A 2B0LA 2XROA 4RS8A 1FYMA 1KQ9A 1FLIA 1I5ZA 2VXZA 1O3TA 4YFKF 2KKOA 2EFOA 4I0BA 4L9TA 2LDUA 4HF2A 2DU9A 3ZN1A 2HEOA 3T0YA 1J59A 4M73A 1O57A 5D5WB 1LNWA 4AIHA 2EJRA 2DQRA 5E8IA 1IN7A 2MBFA 2HZTA 4A0ZA 3N97A 3RPQA 2M8EA 3AAFA 4S05A 2JSCA 3FWEA 1OYYA 2FRHA 1BIAA 2F5FA 3ZMTA 2IA2A 4RGRA 4WXCA 4EVIA 3F3XA 2ZKZA 2VE8A 5EEHA 2PN6A 2Y75A 3VEPA 3TOAA 1XMKA 5D6FA 1R1VA 2K4BA 5IT9K 1YTYA 1W5TA 5LGUA 2XUBA 2NNYA 2HR3A 4B09A 3L2CA 4LG0B 4CGZA 1RUOA 2JTVA 4FX0A 1RI7A 4KIGA 2QUFA 3M1EA 4BXUA 4KYWA 1XSXA 1A04A 3QRFF 1SD6A 1UCRA 5FFZA 4UV8A 2M87A 2HTSA 2DK5A 2VE9A 1F5TA 4IJAA 4LLNA 4ENKA 1OYWA 4RAYA 1ZGJA 4WXDA 3C7JA 3F8NA 1FP1D 3BP8A 4MQ9F 1XN7A 2FBHA 3FXQA 4G6DA 2YX4A 3TOBA 2H6CA 3GO5A 1R7JA 4EM0B 2HKOA 2W24A 5DYMA 1OR7A 3ABUA 4EGZA 2QBYB 3MAJA 4ZZDA 3EYIA 1HW1A 1R1UA 4HOBA 3WU1B 1G6NA 4G94A 3JSOA 4MGRA 3K1NA 3V8JA 2NNNA 1U5TA 4JQFA 1KGSA 1LEAA 2HOEA 3ULQB 2VBWA 2DPDA 3C18A 4LD5A 2XRNA 2ZCWA 4M6XA 5HS8A 4Q4ZF 1PP7U 2DLLA 5D5XB 5K1YA 3I5UA 4XLPF 1Q1HA 2DW4A 2GAUA 4LK1F 1GXQA 3E6MA 2JPCA 2X0LA 3KP4A 3F23A 3HYIA 3MFKA 3L00A 2WV0A 4U0VA 2CFXA 1LDJA 1R1TA 2QQAA 1P6RA 3P7NA 3RYPA 2ZJ2A 3KZYA 2QM3A 3IRRA 5ICFA 2TDXA 2NAZA 5HOOA 5CVIA 3J80K 3J7AO 5BOXA 1K79A 2VONA 1ZREA 3RJPA 1MZBA 4G8XA 4Y15A 2XAFA 4RGXA 1U6GA 4M74A 4KUMA 1TLHB 2PFBA 4G7HF 2O61A 1YW9A 1D8KA 5LRSA 4PGHA 1USSA 1QNTA 1YW8A 2KJBA 1D8JA 4N9HA 2Z9OA 1KQ8A 5LHGA 3ERED 3WGIA 5L3BA 2GWRA 3OV8A 4ESJA 2ZMEB 3LQQA 4RB0A 3KP6A 2GIVA 2R7FA 5HLHA 1ZG5A 4L9NA 1S29A 4HYEA 4OMYA 4IXAA 1ZH5A 1FY7A 2NS0A 3WODF 2ISZA 4EJTA 5DDGA 2W84A 4HF0A 1OKRA 1WKMA 1WQ2A 3MCZA 2G7UA 4XSXF 4WXHA 2PJPA 5BPDA 5TRDA 5A2QZ 5DEQA 1FPQA 1U8RA 2RQPA 4A6DA 1IN5A 1TW2A 3LA2A 2JT1A 4U88A 1I6XA 1R5GA 1Z9CA 2F5EA 5D6EA 3KZZA 1K78B 3RKXA 3SHFA 1O3QA 2QENA 1WSUA 2WTEA 3TO6A 1GHCA 1HKTA 2CQKA 1B9MA 5HDGA 4HDVA 1ULYA 2HQNA 2IA1A 1AOYA 5FB2A 3K1PA 5HDNA 1SD4A 3FXRA 1YS7A 3WE3A 1HKSA 1U2WA 2VN2A 3DV8A 2HYFA 4HAMA 5E8GA 3QAHA 2STWA 2GQQA 4A5MA 4HZFA 2NYXA 2E1CA 4KIBA 3CO7C 4LJZF 4ENMA 4Q47A 5ERIA 2Q2EA 2R3SA 1KYWA 4ESBA 3TDZC 4JK1X 2Z99A 5FGMA 1LDKB 2MD5A 2X4HA 4HQEA 1S8NA 2FE3A 3E5XA 1ON1A 2QQBA 3ZPLA 2O3FA 3ZP5A 3CDHA 3H92A 2LF8A 3DEUA 5E1ZB 4ASNA 4NQWA 2Z33A 4Q5SF 2VODA 3E5QA 3HOTA 1I27A 1REPC 1TNTA 1BI0A 4CXFA 4IRGA 3LAPA 1KA8A 3ISPA 3R60A 2YSRA 2H94A 3WGHA 1D5VA 1EH7A 1FBQA 4P9FA 4I02A 4BYYA 3ZMZA 4YFNF 1LJ9A 1QBJA 1J2XA 3BPXA 4O3MA 2ETHA 6PAXA 1T39A 1MKMA 2FSWA 5D4RA 4WF2A 5CVJA 2DFIA 1DDNA 2K7LA 2ZO4A 3CO6C 2QBYA 1FSHA 1GXPA 2XVCA 2IRFG 2M30A 2W85A 1NHAA 4N9IA 2P5VA 3ECHA 3RYRA 2V6CA 5HS9A 1AWCA 3FM5A 5DCFA 5HS7A 3M9AA 4WX9A 1IXSB 3JW4A 2PLYA 5CVUA 5H6RA 2HQRA 3SZPA 3BWGA 2BV6A 4ZYDA 4EV0A 5D5UB 4IVNA 2QLZA 1E17A 1B6AA 5HVQC 2BYVE 3VFZA 2EWNA 5J8CA 3IL2A 2DQLA 4ZH4F 3FXUA 1IN6A 2VC0A 5ICCA 1KYZA 5J6XA 3QU3A 2DTRA 2EB7A 1XGOA 4PDKA 2G9WA 2MH2A 2ACJA 3WGGA 4UVBA 3J81Z 2FMYA 2EFWA 3CUOA 3F72A 1PP8F 1SAXA 3G73A 2O8XA 3GUDA 4HX8A 1T0FA 1QPMA 3GFJA 4EJVA 2UXNA 1R5HA 1RIOH 1XCBA 2ZFWA 4ETSA 4HDUA 3M8FA 4K2EA 3VOEA 2PMHA 1WI9A 3EDPA 5F64A 3E3VA 3C3WA 1HW2A 4HW0A 1IF1A 2YR2A 4UV9A 4HLYA 3NQOA 2LKPA 4LB6B 4EJWA 5D5VB 3QP5A 2V1XA 1Z1DA 2F5DA 1ZRCA 3RKYA 5EEGA 3WTZA 3BY6A 2WWYA 2L4MA 2DAOA 4OMZA 2QQ9A 1TQIA 2FMLA 3V7CA 4AIKA 4MNUA 4DNCA 1O3SA 1RUNA 1Z6RA 3I71A 2RN7A 3MWMA 1SMYF 1CF7A 3K0LA 4DQ2A 1DUXC 2QWWA 1B4AA 5BQTA 3T1BA 2CWEA 3HHHA 2R7DA 4XRFA 1IN4A 2L4AA 2XHKA 3GLXA 2MLGA 5CYVA 4EMSA 4CHUA 5IT9Z 2OD5A 3O3KA 2PQ8A 5KVRA 5BMZA 3LWFA 1OPCA 5AONA 1OYIA 5TJJA 1ZYRF 2XAGA 3ECOA 3IRQA 4RGSA 1JXSA 5ILUA 2KIUA 2HFHA 1XMAA 4RB2C 1J5YA 5ICEA 3FMRA 4RGUA 5HLIA 2E7WA 4IF4A 5CVRA 3ML6A 1BOAA 5L3EA 4BH9A 3WTVC 1XD7A 1Y0UA 3K9TA 1ZAOA 1J7KA 4JBAA 4G7ZF 2L01A 3VB2A 1FC3A 3F22A 4E70A 4AWXB 3ELKA 1BI3A 4EJUA 2ESHA 1XB4A 3NEUA 1B1BA 1XCVA 3E97A 4IPAA 2JPBA 1ZLJA 2EFPA 3F8FA 3BROA 4A12A 2Z5UA 4HX4A 2C6YA 3BDDA 3K69A 4UXNA 3TKYA 2RKHA 4GCVA 2V1UA 4NB5A 5DCMB 1P4WA 1SMTA 4WK8F 4HA8A 3O6BB 2DPUA 4ON0A 1G4DA 5DD4A 4GO1A 3V4GA 5LGTA 2LSOA 4R1HA 3WTUC 3L9FA 1SD5A 1YS6A 1W7PD 1Z6TA 2EFNA 1ZLKA 4OIRF 1Z7UA 2CGPA 1UB9A 1T38A 3J80Z 3RDIA 1S6LA 3N4MA 1HXDA 2OAZA 3KE2A 3WTYC 4GGGA 1IAWA 3HUGA 1ZG3A 3SZTA 2MC3A 3WE2A 2AXLA 1YIOA 1HSTA 3U2RA 1KU3A 1W7PA 1E2XA 2PI0A 2RNJA 3E5UA 2ELHA 4G6QA 4XSZF 3GW2A 3EETA 2K27A 3JAMK 1FSEA 2F5CA 1YYVA 2COMA 3I64A 3I4PA 3ZMDA 4I7HA 5FD5A 4L0YB 1G3WA 1R22A 2IVMA 4A5NA 3QPTA 3TO9A 3ZMUA 4KN4X 5JR3A 2BE5F 5CLSA 1IRGA 5FLXK 3MZHA 3ZQ7A 1UHWA 3HRTA 4EM2A 1BM9A 2CYYA 2YX7A 2OA4A 4P55A 2HGCA 5ILVA 1FX7A 3KEQA 5E1XA 2P5LC 3KP3A 4H0EA 4YG2F 1BI1A 4GYGA 1S7AA 4ESFA 3FF5A 3RI4A 3WG9A 4GYIA 4BHPA 2A6HF 3R6SA 1EV7A 3GX4X 4KMFA 3IKTA 2F2EA 2FOKA 4R8HA 3WU0A 3P9IA 4UVCA 4KFCA 5AIQA 3BJ6A 1SFXA 3TGNA 4Y13A 1U3EM 1YG2A 2HDCA 3CTAA 5BPIA 4KIFA 1KU7A 4L18B 5JI6A 2IPQX 3DKWA 4HQMA 1U5TC 5KK1A 2LNBA 1ZARA 5CVVA 2EV0A 3K2ZA 2A07F 4M6YA 3PFIA 2OZ6A 4RB3C 4IRHA 3REOA 2BBYA 2EV6A 1ZRFA 3T8RA 3TQNA 4CO8A 4LFUA 1XGNA 1BJAA 1W4MA 2EK5A 3M7GA 2O0YA 3JSPA 2P7VB 4R79A 3F6VA 3L7WA 4LG0A 3HTUA 2XAHA 2KJCA 1TTYA 5D8LB 5LEKA 2O6GE 1BC8C 4MTDA 1U78A 2FEZA 2RVCA 3C1DA 3WTWC 1CGPA 3MEXA 1LVAA 5LRRA 2Z3YA 3E6CC 1WWXA 3Q9VA 4Z2YA 4L9VA 5D4SA 5J8FA 4WWCA 4I98B 3BZ6A 3F8CA 1Z05A 4MQVA 3KCCA 4HV6A 2W57A 4M9SA 1FBUA 2FBKA 5E17F 5H6QA 4OIQF 2L54A 3COAC 2O03A 1X3UA 3ABTA 5ICGA 3LA7A 3LA3A 1I1SA 3F8MA 1VTNC 4O6JA 5LEJA 2VBXA 5H20A 2IA0A 1TNSA 4OU0A 2DI3A 5DCMA 1MJ9A 3HOSA 3P9KA 4L9JA 2GXGA 3GYHX 5DUKA 1IZ1A 4UHTA 3S2WA 1TW3A 3D5LA 3LQRA 4G9YA 3KLOA 2P7CB 3FM3A 3GVAA 5LLQA 1KU9A 3KETA 1WRJA 2XV4S 4M9ZA 2XGXA 3QPHA 1FWZA 1S3JA 4PCQA 5HDKA 2EV5A 3BPVA 4LLLA 3GWZA 2J5PA 1MJAA 5JVTA 1V3FA 2UXXA 5L3CA 2PEXA 3OOPA 3NRVA 3FMQA 2ZNYA 2H27A 4HX7A 1XDUA 2GA1A 5ILSA 4L0ZB 4BNCA 2PMUA 3BOQA 3IHUA 4KNYA 2G7HA 5F1RA 2DT5A 1P2FA 4PGGA 2XIGA 4KDPA 1H0MA 4OIPF 1O7FA 1MGTA 1L0OC 4CICA 3BJOA 1YW7A 4I0AA 4PZJA 2ZBKA 4ENJA 1XGSA 2EFQA 3B73A 4HF1A 4Y17A 1R58A 3WTSC 2MH9A 5LBQA 4MEXF 2P8TA 1F1ZA 4ZYGA 2BGCA 2ZMEA 2QVOA 4P5OA 5JFRA 3TO7A 3FHZA 3F21A 5HLGA 4ZZLA 1PUEE 2K4JA 4UNOA 2Y48A 1FT9A 2IW5A 5E1WA 3LSTA 2BEOA 4OINF 2W25A 4ZYEA 3IWFA 1R23A 3JTGA 4IHSA 5FO5A 1IRFA 2WC2A 1B9NA 2P6SA 3B02A 2PG4A 4CYDA 2H09A 5FD6A 1HW5A 3V7RA 3O2PE 1IUYA 1QZYA 3I53A 4Q48A 1UHMA 5DUIA 1B59A 1DPUA 1K78A 1JGSA 4S04A 1KU2A 1F4KA 4MHGA 5DV5A 3SQNA 2ADUA 3CUQC 3ROUA 3I54A 1EH6A 1UFMA 2JZYA 1KQ0A 5LGNA 4B8XA 4RB1A 4HBLA 1H9TA 3I59B 4HV5A 1MJBA 2VOPA 1D3YA 1DPRA 2E1NA 3KEOA 3E6BA 3HSRA 3V8KA 4WCGA 3R4KA 1LDDA 4AVPA 3U1DA 4FHTA 1ZN2A 2P5KA 2VBYA 1YQAA 2XAQA 3HIFA 3DPTA 1JE8A 1MDMB 2FF4A 4MTEA 3R61A 5E20A 1ODDA 1V4RA 4LGWA 2IJLA 2XKOA 1ZGAA 3CUQB 1ZRDA 3EQLF 4A6EA 3ZMSA 3WTXC 1HKQA 2HTJA 2IP2A 1ZHFA 1FOKA 3D0SA 3HRUA 3M8EA 4U7DA 2D1HA 2PBIA 2FQ3A 4OOIA 2DK8A 2FNPA 2V79A 4LB5A 1T2KA 4O5VA 4XLNF 1G3SA 2M1BA 2DBBA 5AIPA 2MLKA 5IT3A 2OQRA 3SXYA 2OQGA 2A68F 1SD7A 4P9UA 3MQ0A 5L3FA 1USTA 4YIIA 2Q8KA 1F9NA 3PQKA 2XKPA 2AS5F 4BHBA 2IT0A 5K5QA 1L3LA 3R0AA 2FXAA 3V7SA 1TBXA 2STTA 3I58A 4HLXA 4A0XA 2A5YB 3FMSA 3KLNA 1T98A 4ZYHA 1RNLA 3E6DA 1P4XA 2FBIA 3GFMA 1HSJA 4A2UA 2H6BA 3RKWA 2DO7A 2YPRA 2A61A 1S7OA 3HSEA 2RC4A 2YU3A 4U0YA 4IRIA 3U9GA 2KIFA 5L3GA 2A69F 1JHFA 3DF8A 2VOOA 5L3DA 1BI2A 3GF2A 4AIJA 3K1MA 2VBZA 4I09A 1FYKA 5K5RA 4ENNA 4I2OA 3QU6A 2QYOA 2UZKA 2CSOA 2HYGD 2M5WA 1O3RA 3DXJF 1Z91A 3Q9SA 3TDUC 1ZG1A 1C0WA 3F6OA 1O7LA 1XGMA 4QLCU 3JAMZ 2FA5A 1PDNC 5E18F 2ISYA 3FZVA 4FX4A 2ZNZA 2Y0MA 4LLGF 1R00A 1P92A 3EUHA 1W5SA 3G3ZA 2XAJA 4EJOA 1P4AA 5FLXZ 4KT5C 3GEZA 2GZWA 4YIFA 5A2QK 5LHHA 1BBYA 1BIBA 2FNAA 1I1GA 3W6KB 2D45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBP A;  1ON2 A;  1CF7 B;  3EYY A;  1QQI A;  2RV8 A;  3L09 A;  3GFI A;  2K86 A;  1OMI A;  5JHU A;  2HWV A;  1H9G A;  4CZZ A;  1MD0 A;  2A3S A;  2ZXJ A;  4D0P A;  4I01 A;  3T8T A;  1FBS A;  1GVJ A;  4UUV A;  3KFW X;  2D2W A;  3HRS A;  3FX3 A;  3Q5F A;  3SFZ A;  4KA4 A;  1R36 A;  1YLF A;  3LFK A;  1DP7 P;  4G7O F;  4YFX F;  3BJA A;  3WTT C;  3DQV C;  1QO0 D;  2EA2 A;  2V1D A;  2XAS A;  3V8L A;  4L5J A;  3DFG A;  3H3U A;  2J5O A;  3ZN0 A;  4U7B A;  4M72 A;  3KP2 A;  3KP5 A;  1IN8 A;  1FP2 A;  1XSV A;  1SFE A;  1J75 A;  4GXO A;  5D8K B;  1HQC A;  2M45 A;  3T5X A;  2MA3 A;  1FZP B;  3CJN A;  3H3Z A;  3IKV A;  3IWZ A;  4CDG A;  3HRM A;  1XSD A;  4QWQ A;  1J0R A;  2KIM A;  3GFL A;  2OZU A;  1XDS A;  4M9X A;  1IW7 F;  3W6J B;  3RIR A;  4P96 A;  2CO5 A;  3I59 A;  4LMY A;  5K5O A;  1ONV A;  1TQP A;  1U5T B;  2HS5 A;  2ESN A;  3ZMV A;  2VT2 A;  4UVA A;  1TQM A;  2UWM A;  4N0B A;  4U0W A;  1QGP A;  4F7Z A;  1BC7 C;  2HKX A;  3GZ6 A;  1MDM A;  2VC1 A;  2CG4 A;  5LHI A;  1STZ A;  1YO5 C;  3PQJ A;  2Q0O A;  2L02 A;  2RGV A;  2QZ8 A;  4BAY A;  3CUQ A;  2P6T A;  2EA4 A;  1IXR C;  4AD9 A;  1K7A A;  2KRF A;  3DP7 A;  4NHJ A;  4RAZ A;  1IXC A;  4FT8 A;  3KP7 A;  4TV7 A;  5DD8 A;  1LQ1 A;  3QP6 A;  5F6F A;  2GXB A;  1RZ4 A;  1LB2 A;  3R0J A;  2E7X A;  2A6E F;  3QOP A;  2K02 A;  3HTS B;  2D1V A;  2L3D A;  5ED4 A;  1LEB A;  3VOD A;  2FU4 A;  5CJ9 A;  2V9V A;  3DPL C;  3F8B A;  5BS6 A;  4BHC A;  2CW0 F;  2OU2 A;  3MZY A;  4EM1 A;  1FNN A;  3P9C A;  4A0Y A;  1J9I A;  1K6O A;  2VT3 A;  1T6S A;  3I0T A;  1W7P B;  3RPU A;  3HSF A;  1QZZ A;  1BN5 A;  4OIO F;  4M71 A;  2P4W A;  3CLO A;  4KIC A;  3GXO A;  3JTH A;  4KN7 X;  1FYL A;  3J81 K;  1HBX G;  3HHG A;  4XBF A;  4EQQ A;  2RDP A;  4IHT A;  1G3Y A;  1SFU A;  4BQA A;  2LF7 A;  3RTR A;  1YFH A;  5FFX A;  3LAJ A;  2GA2 A;  4LK0 F;  1JHH A;  2NRA C;  4MEY F;  3IC7 A;  4KMU X;  4L5I A;  1EH8 A;  4EGY A;  1G3T A;  2JRT A;  3GZ5 A;  2B0L A;  2XRO A;  4RS8 A;  1FYM A;  1KQ9 A;  1FLI A;  1I5Z A;  2VXZ A;  1O3T A;  4YFK F;  2KKO A;  2EFO A;  4I0B A;  4L9T A;  2LDU A;  4HF2 A;  2DU9 A;  3ZN1 A;  2HEO A;  3T0Y A;  1J59 A;  4M73 A;  1O57 A;  5D5W B;  1LNW A;  4AIH A;  2EJR A;  2DQR A;  5E8I A;  1IN7 A;  2MBF A;  2HZT A;  4A0Z A;  3N97 A;  3RPQ A;  2M8E A;  3AAF A;  4S05 A;  2JSC A;  3FWE A;  1OYY A;  2FRH A;  1BIA A;  2F5F A;  3ZMT A;  2IA2 A;  4RGR A;  4WXC A;  4EVI A;  3F3X A;  2ZKZ A;  2VE8 A;  5EEH A;  2PN6 A;  2Y75 A;  3VEP A;  3TOA A;  1XMK A;  5D6F A;  1R1V A;  2K4B A;  5IT9 K;  1YTY A;  1W5T A;  5LGU A;  2XUB A;  2NNY A;  2HR3 A;  4B09 A;  3L2C A;  4LG0 B;  4CGZ A;  1RUO A;  2JTV A;  4FX0 A;  1RI7 A;  4KIG A;  2QUF A;  3M1E A;  4BXU A;  4KYW A;  1XSX A;  1A04 A;  3QRF F;  1SD6 A;  1UCR A;  5FFZ A;  4UV8 A;  2M87 A;  2HTS A;  2DK5 A;  2VE9 A;  1F5T A;  4IJA A;  4LLN A;  4ENK A;  1OYW A;  4RAY A;  1ZGJ A;  4WXD A;  3C7J A;  3F8N A;  1FP1 D;  3BP8 A;  4MQ9 F;  1XN7 A;  2FBH A;  3FXQ A;  4G6D A;  2YX4 A;  3TOB A;  2H6C A;  3GO5 A;  1R7J A;  4EM0 B;  2HKO A;  2W24 A;  5DYM A;  1OR7 A;  3ABU A;  4EGZ A;  2QBY B;  3MAJ A;  4ZZD A;  3EYI A;  1HW1 A;  1R1U A;  4HOB A;  3WU1 B;  1G6N A;  4G94 A;  3JSO A;  4MGR A;  3K1N A;  3V8J A;  2NNN A;  1U5T A;  4JQF A;  1KGS A;  1LEA A;  2HOE A;  3ULQ B;  2VBW A;  2DPD A;  3C18 A;  4LD5 A;  2XRN A;  2ZCW A;  4M6X A;  5HS8 A;  4Q4Z F;  1PP7 U;  2DLL A;  5D5X B;  5K1Y A;  3I5U A;  4XLP F;  1Q1H A;  2DW4 A;  2GAU A;  4LK1 F;  1GXQ A;  3E6M A;  2JPC A;  2X0L A;  3KP4 A;  3F23 A;  3HYI A;  3MFK A;  3L00 A;  2WV0 A;  4U0V A;  2CFX A;  1LDJ A;  1R1T A;  2QQA A;  1P6R A;  3P7N A;  3RYP A;  2ZJ2 A;  3KZY A;  2QM3 A;  3IRR A;  5ICF A;  2TDX A;  2NAZ A;  5HOO A;  5CVI A;  3J80 K;  3J7A O;  5BOX A;  1K79 A;  2VON A;  1ZRE A;  3RJP A;  1MZB A;  4G8X A;  4Y15 A;  2XAF A;  4RGX A;  1U6G A;  4M74 A;  4KUM A;  1TLH B;  2PFB A;  4G7H F;  2O61 A;  1YW9 A;  1D8K A;  5LRS A;  4PGH A;  1USS A;  1QNT A;  1YW8 A;  2KJB A;  1D8J A;  4N9H A;  2Z9O A;  1KQ8 A;  5LHG A;  3ERE D;  3WGI A;  5L3B A;  2GWR A;  3OV8 A;  4ESJ A;  2ZME B;  3LQQ A;  4RB0 A;  3KP6 A;  2GIV A;  2R7F A;  5HLH A;  1ZG5 A;  4L9N A;  1S29 A;  4HYE A;  4OMY A;  4IXA A;  1ZH5 A;  1FY7 A;  2NS0 A;  3WOD F;  2ISZ A;  4EJT A;  5DDG A;  2W84 A;  4HF0 A;  1OKR A;  1WKM A;  1WQ2 A;  3MCZ A;  2G7U A;  4XSX F;  4WXH A;  2PJP A;  5BPD A;  5TRD A;  5A2Q Z;  5DEQ A;  1FPQ A;  1U8R A;  2RQP A;  4A6D A;  1IN5 A;  1TW2 A;  3LA2 A;  2JT1 A;  4U88 A;  1I6X A;  1R5G A;  1Z9C A;  2F5E A;  5D6E A;  3KZZ A;  1K78 B;  3RKX A;  3SHF A;  1O3Q A;  2QEN A;  1WSU A;  2WTE A;  3TO6 A;  1GHC A;  1HKT A;  2CQK A;  1B9M A;  5HDG A;  4HDV A;  1ULY A;  2HQN A;  2IA1 A;  1AOY A;  5FB2 A;  3K1P A;  5HDN A;  1SD4 A;  3FXR A;  1YS7 A;  3WE3 A;  1HKS A;  1U2W A;  2VN2 A;  3DV8 A;  2HYF A;  4HAM A;  5E8G A;  3QAH A;  2STW A;  2GQQ A;  4A5M A;  4HZF A;  2NYX A;  2E1C A;  4KIB A;  3CO7 C;  4LJZ F;  4ENM A;  4Q47 A;  5ERI A;  2Q2E A;  2R3S A;  1KYW A;  4ESB A;  3TDZ C;  4JK1 X;  2Z99 A;  5FGM A;  1LDK B;  2MD5 A;  2X4H A;  4HQE A;  1S8N A;  2FE3 A;  3E5X A;  1ON1 A;  2QQB A;  3ZPL A;  2O3F A;  3ZP5 A;  3CDH A;  3H92 A;  2LF8 A;  3DEU A;  5E1Z B;  4ASN A;  4NQW A;  2Z33 A;  4Q5S F;  2VOD A;  3E5Q A;  3HOT A;  1I27 A;  1REP C;  1TNT A;  1BI0 A;  4CXF A;  4IRG A;  3LAP A;  1KA8 A;  3ISP A;  3R60 A;  2YSR A;  2H94 A;  3WGH A;  1D5V A;  1EH7 A;  1FBQ A;  4P9F A;  4I02 A;  4BYY A;  3ZMZ A;  4YFN F;  1LJ9 A;  1QBJ A;  1J2X A;  3BPX A;  4O3M A;  2ETH A;  6PAX A;  1T39 A;  1MKM A;  2FSW A;  5D4R A;  4WF2 A;  5CVJ A;  2DFI A;  1DDN A;  2K7L A;  2ZO4 A;  3CO6 C;  2QBY A;  1FSH A;  1GXP A;  2XVC A;  2IRF G;  2M30 A;  2W85 A;  1NHA A;  4N9I A;  2P5V A;  3ECH A;  3RYR A;  2V6C A;  5HS9 A;  1AWC A;  3FM5 A;  5DCF A;  5HS7 A;  3M9A A;  4WX9 A;  1IXS B;  3JW4 A;  2PLY A;  5CVU A;  5H6R A;  2HQR A;  3SZP A;  3BWG A;  2BV6 A;  4ZYD A;  4EV0 A;  5D5U B;  4IVN A;  2QLZ A;  1E17 A;  1B6A A;  5HVQ C;  2BYV E;  3VFZ A;  2EWN A;  5J8C A;  3IL2 A;  2DQL A;  4ZH4 F;  3FXU A;  1IN6 A;  2VC0 A;  5ICC A;  1KYZ A;  5J6X A;  3QU3 A;  2DTR A;  2EB7 A;  1XGO A;  4PDK A;  2G9W A;  2MH2 A;  2ACJ A;  3WGG A;  4UVB A;  3J81 Z;  2FMY A;  2EFW A;  3CUO A;  3F72 A;  1PP8 F;  1SAX A;  3G73 A;  2O8X A;  3GUD A;  4HX8 A;  1T0F A;  1QPM A;  3GFJ A;  4EJV A;  2UXN A;  1R5H A;  1RIO H;  1XCB A;  2ZFW A;  4ETS A;  4HDU A;  3M8F A;  4K2E A;  3VOE A;  2PMH A;  1WI9 A;  3EDP A;  5F64 A;  3E3V A;  3C3W A;  1HW2 A;  4HW0 A;  1IF1 A;  2YR2 A;  4UV9 A;  4HLY A;  3NQO A;  2LKP A;  4LB6 B;  4EJW A;  5D5V B;  3QP5 A;  2V1X A;  1Z1D A;  2F5D A;  1ZRC A;  3RKY A;  5EEG A;  3WTZ A;  3BY6 A;  2WWY A;  2L4M A;  2DAO A;  4OMZ A;  2QQ9 A;  1TQI A;  2FML A;  3V7C A;  4AIK A;  4MNU A;  4DNC A;  1O3S A;  1RUN A;  1Z6R A;  3I71 A;  2RN7 A;  3MWM A;  1SMY F;  1CF7 A;  3K0L A;  4DQ2 A;  1DUX C;  2QWW A;  1B4A A;  5BQT A;  3T1B A;  2CWE A;  3HHH A;  2R7D A;  4XRF A;  1IN4 A;  2L4A A;  2XHK A;  3GLX A;  2MLG A;  5CYV A;  4EMS A;  4CHU A;  5IT9 Z;  2OD5 A;  3O3K A;  2PQ8 A;  5KVR A;  5BMZ A;  3LWF A;  1OPC A;  5AON A;  1OYI A;  5TJJ A;  1ZYR F;  2XAG A;  3ECO A;  3IRQ A;  4RGS A;  1JXS A;  5ILU A;  2KIU A;  2HFH A;  1XMA A;  4RB2 C;  1J5Y A;  5ICE A;  3FMR A;  4RGU A;  5HLI A;  2E7W A;  4IF4 A;  5CVR A;  3ML6 A;  1BOA A;  5L3E A;  4BH9 A;  3WTV C;  1XD7 A;  1Y0U A;  3K9T A;  1ZAO A;  1J7K A;  4JBA A;  4G7Z F;  2L01 A;  3VB2 A;  1FC3 A;  3F22 A;  4E70 A;  4AWX B;  3ELK A;  1BI3 A;  4EJU A;  2ESH A;  1XB4 A;  3NEU A;  1B1B A;  1XCV A;  3E97 A;  4IPA A;  2JPB A;  1ZLJ A;  2EFP A;  3F8F A;  3BRO A;  4A12 A;  2Z5U A;  4HX4 A;  2C6Y A;  3BDD A;  3K69 A;  4UXN A;  3TKY A;  2RKH A;  4GCV A;  2V1U A;  4NB5 A;  5DCM B;  1P4W A;  1SMT A;  4WK8 F;  4HA8 A;  3O6B B;  2DPU A;  4ON0 A;  1G4D A;  5DD4 A;  4GO1 A;  3V4G A;  5LGT A;  2LSO A;  4R1H A;  3WTU C;  3L9F A;  1SD5 A;  1YS6 A;  1W7P D;  1Z6T A;  2EFN A;  1ZLK A;  4OIR F;  1Z7U A;  2CGP A;  1UB9 A;  1T38 A;  3J80 Z;  3RDI A;  1S6L A;  3N4M A;  1HXD A;  2OAZ A;  3KE2 A;  3WTY C;  4GGG A;  1IAW A;  3HUG A;  1ZG3 A;  3SZT A;  2MC3 A;  3WE2 A;  2AXL A;  1YIO A;  1HST A;  3U2R A;  1KU3 A;  1W7P A;  1E2X A;  2PI0 A;  2RNJ A;  3E5U A;  2ELH A;  4G6Q A;  4XSZ F;  3GW2 A;  3EET A;  2K27 A;  3JAM K;  1FSE A;  2F5C A;  1YYV A;  2COM A;  3I64 A;  3I4P A;  3ZMD A;  4I7H A;  5FD5 A;  4L0Y B;  1G3W A;  1R22 A;  2IVM A;  4A5N A;  3QPT A;  3TO9 A;  3ZMU A;  4KN4 X;  5JR3 A;  2BE5 F;  5CLS A;  1IRG A;  5FLX K;  3MZH A;  3ZQ7 A;  1UHW A;  3HRT A;  4EM2 A;  1BM9 A;  2CYY A;  2YX7 A;  2OA4 A;  4P55 A;  2HGC A;  5ILV A;  1FX7 A;  3KEQ A;  5E1X A;  2P5L C;  3KP3 A;  4H0E A;  4YG2 F;  1BI1 A;  4GYG A;  1S7A A;  4ESF A;  3FF5 A;  3RI4 A;  3WG9 A;  4GYI A;  4BHP A;  2A6H F;  3R6S A;  1EV7 A;  3GX4 X;  4KMF A;  3IKT A;  2F2E A;  2FOK A;  4R8H A;  3WU0 A;  3P9I A;  4UVC A;  4KFC A;  5AIQ A;  3BJ6 A;  1SFX A;  3TGN A;  4Y13 A;  1U3E M;  1YG2 A;  2HDC A;  3CTA A;  5BPI A;  4KIF A;  1KU7 A;  4L18 B;  5JI6 A;  2IPQ X;  3DKW A;  4HQM A;  1U5T C;  5KK1 A;  2LNB A;  1ZAR A;  5CVV A;  2EV0 A;  3K2Z A;  2A07 F;  4M6Y A;  3PFI A;  2OZ6 A;  4RB3 C;  4IRH A;  3REO A;  2BBY A;  2EV6 A;  1ZRF A;  3T8R A;  3TQN A;  4CO8 A;  4LFU A;  1XGN A;  1BJA A;  1W4M A;  2EK5 A;  3M7G A;  2O0Y A;  3JSP A;  2P7V B;  4R79 A;  3F6V A;  3L7W A;  4LG0 A;  3HTU A;  2XAH A;  2KJC A;  1TTY A;  5D8L B;  5LEK A;  2O6G E;  1BC8 C;  4MTD A;  1U78 A;  2FEZ A;  2RVC A;  3C1D A;  3WTW C;  1CGP A;  3MEX A;  1LVA A;  5LRR A;  2Z3Y A;  3E6C C;  1WWX A;  3Q9V A;  4Z2Y A;  4L9V A;  5D4S A;  5J8F A;  4WWC A;  4I98 B;  3BZ6 A;  3F8C A;  1Z05 A;  4MQV A;  3KCC A;  4HV6 A;  2W57 A;  4M9S A;  1FBU A;  2FBK A;  5E17 F;  5H6Q A;  4OIQ F;  2L54 A;  3COA C;  2O03 A;  1X3U A;  3ABT A;  5ICG A;  3LA7 A;  3LA3 A;  1I1S A;  3F8M A;  1VTN C;  4O6J A;  5LEJ A;  2VBX A;  5H20 A;  2IA0 A;  1TNS A;  4OU0 A;  2DI3 A;  5DCM A;  1MJ9 A;  3HOS A;  3P9K A;  4L9J A;  2GXG A;  3GYH X;  5DUK A;  1IZ1 A;  4UHT A;  3S2W A;  1TW3 A;  3D5L A;  3LQR A;  4G9Y A;  3KLO A;  2P7C B;  3FM3 A;  3GVA A;  5LLQ A;  1KU9 A;  3KET A;  1WRJ A;  2XV4 S;  4M9Z A;  2XGX A;  3QPH A;  1FWZ A;  1S3J A;  4PCQ A;  5HDK A;  2EV5 A;  3BPV A;  4LLL A;  3GWZ A;  2J5P A;  1MJA A;  5JVT A;  1V3F A;  2UXX A;  5L3C A;  2PEX A;  3OOP A;  3NRV A;  3FMQ A;  2ZNY A;  2H27 A;  4HX7 A;  1XDU A;  2GA1 A;  5ILS A;  4L0Z B;  4BNC A;  2PMU A;  3BOQ A;  3IHU A;  4KNY A;  2G7H A;  5F1R A;  2DT5 A;  1P2F A;  4PGG A;  2XIG A;  4KDP A;  1H0M A;  4OIP F;  1O7F A;  1MGT A;  1L0O C;  4CIC A;  3BJO A;  1YW7 A;  4I0A A;  4PZJ A;  2ZBK A;  4ENJ A;  1XGS A;  2EFQ A;  3B73 A;  4HF1 A;  4Y17 A;  1R58 A;  3WTS C;  2MH9 A;  5LBQ A;  4MEX F;  2P8T A;  1F1Z A;  4ZYG A;  2BGC A;  2ZME A;  2QVO A;  4P5O A;  5JFR A;  3TO7 A;  3FHZ A;  3F21 A;  5HLG A;  4ZZL A;  1PUE E;  2K4J A;  4UNO A;  2Y48 A;  1FT9 A;  2IW5 A;  5E1W A;  3LST A;  2BEO A;  4OIN F;  2W25 A;  4ZYE A;  3IWF A;  1R23 A;  3JTG A;  4IHS A;  5FO5 A;  1IRF A;  2WC2 A;  1B9N A;  2P6S A;  3B02 A;  2PG4 A;  4CYD A;  2H09 A;  5FD6 A;  1HW5 A;  3V7R A;  3O2P E;  1IUY A;  1QZY A;  3I53 A;  4Q48 A;  1UHM A;  5DUI A;  1B59 A;  1DPU A;  1K78 A;  1JGS A;  4S04 A;  1KU2 A;  1F4K A;  4MHG A;  5DV5 A;  3SQN A;  2ADU A;  3CUQ C;  3ROU A;  3I54 A;  1EH6 A;  1UFM A;  2JZY A;  1KQ0 A;  5LGN A;  4B8X A;  4RB1 A;  4HBL A;  1H9T A;  3I59 B;  4HV5 A;  1MJB A;  2VOP A;  1D3Y A;  1DPR A;  2E1N A;  3KEO A;  3E6B A;  3HSR A;  3V8K A;  4WCG A;  3R4K A;  1LDD A;  4AVP A;  3U1D A;  4FHT A;  1ZN2 A;  2P5K A;  2VBY A;  1YQA A;  2XAQ A;  3HIF A;  3DPT A;  1JE8 A;  1MDM B;  2FF4 A;  4MTE A;  3R61 A;  5E20 A;  1ODD A;  1V4R A;  4LGW A;  2IJL A;  2XKO A;  1ZGA A;  3CUQ B;  1ZRD A;  3EQL F;  4A6E A;  3ZMS A;  3WTX C;  1HKQ A;  2HTJ A;  2IP2 A;  1ZHF A;  1FOK A;  3D0S A;  3HRU A;  3M8E A;  4U7D A;  2D1H A;  2PBI A;  2FQ3 A;  4OOI A;  2DK8 A;  2FNP A;  2V79 A;  4LB5 A;  1T2K A;  4O5V A;  4XLN F;  1G3S A;  2M1B A;  2DBB A;  5AIP A;  2MLK A;  5IT3 A;  2OQR A;  3SXY A;  2OQG A;  2A68 F;  1SD7 A;  4P9U A;  3MQ0 A;  5L3F A;  1UST A;  4YII A;  2Q8K A;  1F9N A;  3PQK A;  2XKP A;  2AS5 F;  4BHB A;  2IT0 A;  5K5Q A;  1L3L A;  3R0A A;  2FXA A;  3V7S A;  1TBX A;  2STT A;  3I58 A;  4HLX A;  4A0X A;  2A5Y B;  3FMS A;  3KLN A;  1T98 A;  4ZYH A;  1RNL A;  3E6D A;  1P4X A;  2FBI A;  3GFM A;  1HSJ A;  4A2U A;  2H6B A;  3RKW A;  2DO7 A;  2YPR A;  2A61 A;  1S7O A;  3HSE A;  2RC4 A;  2YU3 A;  4U0Y A;  4IRI A;  3U9G A;  2KIF A;  5L3G A;  2A69 F;  1JHF A;  3DF8 A;  2VOO A;  5L3D A;  1BI2 A;  3GF2 A;  4AIJ A;  3K1M A;  2VBZ A;  4I09 A;  1FYK A;  5K5R A;  4ENN A;  4I2O A;  3QU6 A;  2QYO A;  2UZK A;  2CSO A;  2HYG D;  2M5W A;  1O3R A;  3DXJ F;  1Z91 A;  3Q9S A;  3TDU C;  1ZG1 A;  1C0W A;  3F6O A;  1O7L A;  1XGM A;  4QLC U;  3JAM Z;  2FA5 A;  1PDN C;  5E18 F;  2ISY A;  3FZV A;  4FX4 A;  2ZNZ A;  2Y0M A;  4LLG F;  1R00 A;  1P92 A;  3EUH A;  1W5S A;  3G3Z A;  2XAJ A;  4EJO A;  1P4A A;  5FLX Z;  4KT5 C;  3GEZ A;  2GZW A;  4YIF A;  5A2Q K;  5LHH A;  1BBY A;  1BIB A;  2FNA A;  1I1G A;  3W6K B;  2D45 A; 
#chains in the Genus database with same CATH topology
 4IOC F;  2KQR A;  2OBP A;  1ETX A;  1ON2 A;  1ERD A;  1CF7 B;  1IC8 A;  3EYY A;  1QQI A;  5BNG A;  4ABZ A;  3OYC A;  1IDZ A;  2RV8 A;  1YJN I;  4M3F A;  1ETQ A;  3L09 A;  4CSW A;  3GFI A;  1OR7 C;  1QHH D;  4I99 C;  2F4O B;  2K86 A;  2JJ7 A;  4PK4 A;  1OMI A;  5JHU A;  2HWV A;  1H9G A;  5IYB J;  1FOW A;  4E7S A;  2RQQ A;  4CZZ A;  1MD0 A;  5C44 J;  2A3S A;  2ZXJ A;  4D0P A;  4I01 A;  3T8T A;  1FBS A;  3IH4 A;  1GVJ A;  2KHM A;  3BC8 A;  3VDX A;  4UUV A;  1SAN A;  3KFW X;  1UEL B;  1OCO H;  4XLE A;  5EF6 A;  3MKW B;  2D2W A;  3HRS A;  1S72 I;  3FX3 A;  1DU6 A;  2XPU A;  3Q5F A;  5FLV A;  3SFZ A;  4KA4 A;  5E3L A;  1R36 A;  1YLF A;  3LFK A;  1YI2 I;  1DP7 P;  4G7O F;  4BUP A;  1X2N A;  4AM3 A;  4YFX F;  2WAQ A;  3BJA A;  3WTT C;  2MD0 A;  1Z7L A;  2E5Z A;  3DQV C;  3PFY A;  4E7I A;  1QO0 D;  2EA2 A;  2V1D A;  2LY2 A;  2XAS A;  4HG2 A;  3V8L A;  2JRM A;  4L5J A;  2VLA A;  2JVG A;  2IGK A;  3DFG A;  5IP7 J;  4Y52 J;  2L9R A;  3H3U A;  2J5O A;  3WHC A;  3PM1 A;  3ZN0 A;  4U7B A;  4M72 A;  3KP2 A;  5M5X J;  3ONQ A;  3KP5 A;  3GTQ J;  1IN8 A;  3TP3 A;  3H35 A;  5F04 A;  1FP2 A;  1XSV A;  3B6A A;  1DGR M;  2ZJQ F;  3DBL B;  2L9S A;  1XG1 A;  1SFE A;  1J75 A;  4GXO A;  3ABL H;  1OCZ H;  3CQZ J;  5CQE A;  3BTJ A;  1Z0X A;  2LH9 A;  5HOD A;  2KZG A;  5D8K B;  1HQC A;  4QPO A;  2GBY A;  2M45 A;  2AO9 A;  1D0Z A;  3T5X A;  5LD2 C;  2MA3 A;  2VJJ A;  1FZP B;  3CJN A;  3H3Z A;  2VQG A;  3IKV A;  4ANJ A;  3IWZ A;  4CDG A;  3RKQ A;  3OSF A;  1GLN A;  3HRM A;  4DZP A;  3HDD A;  1XSD A;  1BR4 A;  4QWQ A;  3A0B C;  1J0R A;  2KIM A;  3GFL A;  2OZU A;  1VI0 A;  1XDS A;  2DFF A;  1IRZ A;  1WJ5 A;  1IW7 F;  4M9X A;  3CJQ B;  3RIR A;  2Y69 H;  3W6J B;  3HGG A;  3S15 J;  1ZTR A;  4P96 A;  1X19 A;  2CO5 A;  3I59 A;  2VQH A;  2IGN A;  4LMY A;  1N78 A;  5K5O A;  1ONV A;  1TQP A;  1U5T B;  4F92 B;  2GM4 A;  2HS5 A;  2ESN A;  3ZMV A;  3JRG A;  1MNM C;  3LSI A;  4LIV A;  1HLV A;  1V5E A;  2VT2 A;  2K9S A;  4UVA A;  5GAH J;  1VQL I;  1QRY A;  1TQM A;  1XMX A;  1WGX A;  2UWM A;  2X51 A;  4N0B A;  2DA1 A;  4U0W A;  1QGP A;  3GTL J;  1R9T J;  1OQY A;  4F7Z A;  1BC7 C;  2HKX A;  3OYB A;  3OYI A;  3M07 A;  3GZ6 A;  2CUZ A;  2XB5 A;  1MDM A;  4CZC A;  1ZR2 A;  1VQ6 I;  2BVM A;  3DU5 A;  2VC1 A;  2CG4 A;  2VPR A;  2ZXI A;  5LHI A;  1N25 A;  1STZ A;  3HOX J;  1YO5 C;  3PQJ A;  4IQ4 A;  1LPQ A;  1DP3 A;  1S9H A;  2M4G A;  2ICW G;  5DM7 F;  4IHX A;  1KZH A;  2Q0O A;  4PUS A;  2L02 A;  3F0C A;  2RGV A;  2QZ8 A;  1N75 A;  4BAY A;  3CUQ A;  1UAA A;  2P6T A;  2EA4 A;  1IXR C;  2BY3 A;  4AD9 A;  2KRF A;  1K7A A;  3DP7 A;  4ZTJ A;  4NHJ A;  1G59 A;  3A2K A;  4RAZ A;  3S1Q J;  1IXC A;  3CCV I;  4FT8 A;  3OL3 A;  2ZC2 A;  3KP7 A;  3OYK A;  4TV7 A;  3LSJ A;  5DD8 A;  1R4M B;  3RPU D;  5IPA A;  3QP6 A;  1LQ1 A;  5F6F A;  1V54 H;  4XNF A;  2GXB A;  1RZ4 A;  1LB2 A;  3R0J A;  3LSM A;  1X4O A;  5IOY A;  4PJM A;  2E7X A;  3G1M A;  2A6E F;  3QOP A;  2K02 A;  3HTS B;  3GTM J;  1TWC J;  2D1V A;  2L3D A;  4ZDL A;  5EZG A;  5ED4 A;  1LEB A;  1W1W E;  1JJ8 C;  1QPI A;  2IGM A;  3IAS 2;  2FU4 A;  3VOD A;  5CJ9 A;  2E35 A;  5B66 C;  2M7A A;  2V9V A;  3DPL C;  3PUB A;  2H8W A;  2DOE A;  1ZK8 A;  3F8B A;  4DYR A;  4F91 B;  5BS6 A;  2K9N A;  3VYT B;  4BHC A;  2CW0 F;  2OU2 A;  1MH3 A;  2LOO A;  3MZY A;  4EM1 A;  1FNN A;  4G12 A;  2N8G A;  3P9C A;  4A0Y A;  1J9I A;  1K6O A;  2VT3 A;  1T6S A;  3I0T A;  1W7P B;  3RPU A;  3HSF A;  1QZZ A;  2ZXW H;  2FJ1 A;  3H5R A;  4GRI A;  1BN5 A;  5JHF A;  4OIO F;  3K70 C;  1V55 H;  4M71 A;  2P4W A;  3CLO A;  2NVY J;  4H4K C;  4KIC A;  1YHQ I;  2DMT A;  2L7K A;  3GXO A;  2E5N A;  3KEY A;  3JTH A;  2DFE A;  4UUS A;  4ZTF A;  4KN7 X;  1FYL A;  3OIO A;  3J81 K;  1HBX G;  3HHG A;  1MSE C;  1FJL A;  4BE1 A;  4XBF A;  4D7N A;  2DMQ A;  4EQQ A;  2RDP A;  4IHT A;  1QU3 A;  1R4N B;  1G3Y A;  2F4M B;  2QQ8 A;  1SFU A;  4IHW A;  2OTJ I;  1OCT C;  4BQA A;  3DTE A;  2LF7 A;  2BHY A;  3RTR A;  3WHB A;  2ZSH B;  1YFH A;  3HB9 A;  2DA2 A;  2YU9 J;  1YJW I;  2G0E A;  5FFX A;  1D1B A;  3LAJ A;  2GA2 A;  2K3P A;  2LMD A;  4LK0 F;  1JHH A;  4M3G A;  3CCR I;  2NRA C;  4MEY F;  2BVL A;  2RAE A;  3AG2 H;  1JT6 A;  2E60 A;  3IC7 A;  4CCL A;  4D1Q A;  2RRE A;  4KMU X;  2V7F A;  1B72 B;  2ELJ A;  4L5I A;  3BR1 A;  4A3B J;  1Y6I A;  2ZJP F;  2CQQ A;  3CC4 I;  1EH8 A;  4EGY A;  1G3T A;  5FKM A;  2JRT A;  3GZ5 A;  2B0L A;  2XRO A;  2K5C A;  2VL8 A;  4RS8 A;  3BG6 A;  2XGC A;  2CH0 A;  3C2H A;  1FYM A;  1KQ9 A;  3ASO H;  1FLI A;  3RQI A;  2QSG X;  1I5Z A;  2VXZ A;  3HEF A;  1O3T A;  4YFK F;  2I8D A;  2WB1 A;  1TWH J;  2DMN A;  2EFO A;  2KKO A;  4I0B A;  4L9T A;  3OSG A;  2LDU A;  4EEF G;  3A01 A;  5DM6 F;  1IV8 A;  1VQM I;  4HF2 A;  2DU9 A;  5B1B H;  3ZN1 A;  3K4N A;  3VYS B;  2HEO A;  4A3C J;  3T0Y A;  1Z3Y A;  1O4X A;  1J59 A;  4M73 A;  1O57 A;  2VB6 A;  4JX5 A;  5D5W B;  2CW7 A;  1LNW A;  4AIH A;  3HOZ J;  2EJR A;  4B3A A;  2DQR A;  2JA7 J;  4E7K A;  1RKW A;  4X0G A;  5E8I A;  1JUS A;  3DLA A;  3PSF A;  3DBR B;  4NDL A;  1IN7 A;  1U8B A;  2MBF A;  2HZT A;  4A0Z A;  1TT5 B;  2IAI A;  4F52 A;  1FOX A;  2JSP A;  3RPQ A;  3N97 A;  2M8E A;  3AAF A;  3B6C A;  4S05 A;  2JSC A;  3BG9 A;  3BLY A;  3FWE A;  1OYY A;  2FRH A;  1BIA A;  2F5F A;  3ZMT A;  4B47 A;  2IA2 A;  4RGR A;  4WXC A;  1JT0 A;  4EVI A;  3VYU B;  3F3X A;  1Q1V A;  1MBG A;  2ZKZ A;  4GFB A;  2VE8 A;  5EEH A;  4OAZ A;  2PN6 A;  2Y75 A;  5D6F A;  1XMK A;  3TOA A;  3VEP A;  2GLO A;  1SC7 A;  2M0M A;  5M5W J;  1R1V A;  2K4B A;  2HOS A;  3ABK H;  5IT9 K;  1M1E B;  1YTY A;  1LVK A;  1W5T A;  5LGU A;  2XUB A;  2NNY A;  3FBI B;  5EGO B;  3BCA A;  3DTK A;  2HR3 A;  4NQW B;  4I6Z A;  3A03 A;  4RMN A;  4MIM A;  4B09 A;  2R7Q A;  2NS8 A;  1TWG J;  5M5Y J;  3OYH A;  3L2C A;  2V6E A;  2DA7 A;  4LG0 B;  4CGZ A;  4DBR A;  2R92 J;  1RUO A;  2JTV A;  4FX0 A;  1RI7 A;  4KIG A;  4OAY A;  1T8I A;  2QUF A;  3M1E A;  4A3K J;  3L2U A;  4BXU A;  4KYW A;  1XSX A;  2EIK H;  1A04 A;  1X4P A;  1SD6 A;  1UCR A;  2CQN A;  2LLK A;  3QRF F;  2JA6 J;  5FFZ A;  4PJN A;  4E7J A;  4UV8 A;  3QPL A;  2CQX A;  2M87 A;  2HTS A;  2DK5 A;  5JLW A;  2VE9 A;  2DYR H;  2WB1 N;  2MGQ A;  4JYK A;  4XRS G;  4DW6 A;  2V9P A;  1F5T A;  4IJA A;  4LLN A;  1ETV A;  1LFP A;  1WJC A;  3GLL A;  4ENK A;  1OYW A;  1QVU A;  4RAY A;  1ZGJ A;  2LC2 A;  3MD2 A;  4WXD A;  2HDD A;  1JUP A;  2IS4 A;  3C7J A;  1ZGW A;  3F8N A;  1FP1 D;  3BP8 A;  4YEL A;  4PSW A;  4MQ9 F;  1XN7 A;  2FBH A;  3FXQ A;  4G6D A;  2YX4 A;  3TOB A;  4FE4 A;  2XSJ C;  2H6C A;  3GO5 A;  5GPA A;  5GTI C;  1R7J A;  5B5E C;  4CCN A;  4EM0 B;  5J4V A;  2HKO A;  2W24 A;  5DYM A;  1OR7 A;  2HQA A;  3ABU A;  4EGZ A;  2QBY B;  3MAJ A;  4ZZD A;  3EYI A;  4XOP A;  3M8J A;  2CQ7 A;  3LSK A;  1HW1 A;  4D5F A;  4J00 A;  2DJN A;  2IS2 A;  4F3Q A;  1R1U A;  2Z1D A;  4HOB A;  2QSF X;  3WU1 B;  3KYL A;  1G6N A;  2DMP A;  4G94 A;  3JSO A;  4MGR A;  2KDZ A;  1DU0 A;  1WJF A;  3PO3 J;  4XM3 A;  3S3M A;  3FXJ A;  3K1N A;  3V8J A;  2X6Y A;  3SFI A;  2NNN A;  1U5T A;  1TP4 A;  4JQF A;  1KGS A;  1T33 A;  4C9Y A;  1LEA A;  2X85 A;  3C2G A;  2CV0 A;  4HRI A;  1U9N A;  2HOE A;  3ULQ B;  2VBW A;  4RAG A;  1T0F C;  2DPD A;  3C18 A;  4LD5 A;  2XRN A;  2ZCW A;  4M6X A;  3S32 A;  5HS8 A;  4Q4Z F;  1PP7 U;  2DLL A;  2X6W A;  5D5X B;  1X1P A;  5K1Y A;  3I5U A;  4C2M J;  4XLP F;  1Q1H A;  2M0C A;  5GAG J;  2DW4 A;  2LVS A;  9ANT A;  2GAU A;  4LK1 F;  1GXQ A;  3E6M A;  1VQK I;  4PJJ A;  2JPC A;  2X0L A;  3KP4 A;  3F23 A;  1GVD A;  3HYI A;  1GV5 A;  1QVT A;  1YX3 A;  3MFK A;  3JRB A;  3E0J B;  1R71 A;  3L00 A;  4XID A;  4LIU A;  1BOB A;  2WV0 A;  4U0V A;  2CFX A;  3TW6 A;  2VKH A;  5J1Y A;  1LDJ A;  3TBI A;  1R1T A;  2QQA A;  3SZG A;  1HDD C;  3M4O J;  1P6R A;  3P7N A;  3RYP A;  2ZME C;  1BJZ A;  3UKG A;  2ZJ2 A;  3KZY A;  3HOW J;  2CUF A;  2CS3 A;  3GBG A;  1VQN I;  2QM3 A;  3IRR A;  2DDA A;  2EZI A;  4ZDP A;  3LOC A;  2LBF A;  1NTC A;  3J7Z I;  5ICF A;  1UG0 A;  2TDX A;  3EUK L;  3OYG A;  2NAZ A;  5HOO A;  5C4J J;  3EUA A;  3Q3S A;  3OR2 C;  2L7M P;  4D9J A;  5CVI A;  2MW8 A;  3J80 K;  3KPH A;  3J7A O;  5BOX A;  1A6Q A;  4ZJZ A;  1K79 A;  4BE2 A;  4P1W A;  2VON A;  2Y9Z A;  4J19 A;  3H5A A;  1ZRE A;  1MH4 A;  4A3M J;  3RJP A;  1MZB A;  4G8X A;  1WH5 A;  4Y15 A;  2XAF A;  4ZC3 A;  3HC7 A;  4RGX A;  1U6G A;  2LFB A;  1ZKG A;  4M74 A;  3W2A A;  4KUM A;  1TLH B;  4U87 A;  4FAS D;  4BY1 J;  4NC8 A;  2PFB A;  4G7H F;  2O61 A;  4RLF A;  3U21 A;  1YW9 A;  1D8K A;  3CJT B;  1R6R A;  5LRS A;  4PGH A;  3ZQH A;  1D0Y A;  1USS A;  3LSR A;  1QNT A;  1YW8 A;  2ID3 A;  3MMY B;  1HCR A;  1H88 C;  4LG3 A;  2KJB A;  4IZZ A;  3QOD A;  4AYB A;  4N9H A;  1D8J A;  2Z9O A;  3GZN B;  1N77 A;  4B43 A;  4BAC A;  1KQ8 A;  1G8X A;  5K7H A;  4XOT A;  5LHG A;  3G4S I;  3ERE D;  3ZQG A;  3WGI A;  1LE8 B;  4BU2 A;  4CA0 A;  3HKZ A;  5L3B A;  2GWR A;  3OV8 A;  3ZQF A;  4ESJ A;  5H2F C;  4V2F A;  2ZME B;  4CYC B;  3LQQ A;  5EYR A;  4RB0 A;  1FTZ A;  3KP6 A;  2A6T A;  2GIV A;  1WJE A;  2R7F A;  5HLH A;  5K7F A;  1SVO A;  1ZG5 A;  3GTO J;  1OIS A;  4L9N A;  1S29 A;  5LFA A;  4HYE A;  4OMY A;  4IXA A;  4II2 A;  1NG7 A;  1ZH5 A;  1FY7 A;  2EZL A;  2NS0 A;  2P81 A;  3C2B A;  3WOD F;  2ISZ A;  4EJT A;  4FQG A;  1ENH A;  1MMD A;  5DDG A;  1R49 A;  3SEZ A;  2W84 A;  4HF0 A;  2HNH A;  2HU9 A;  2XGE A;  2R5Y B;  4DOZ A;  1OKR A;  1WKM A;  4A3G J;  3K70 D;  1IGN A;  1WQ2 A;  3MCZ A;  2VXD A;  4PFP A;  5FKO A;  3CJR B;  2E2J J;  2OV7 A;  2HVS A;  2NXN B;  4X6A J;  1QHG A;  3W2W A;  2G7U A;  4XSX F;  4CCO A;  4WXH A;  1A31 A;  2PJP A;  2QEX I;  2Z2S B;  3H0D A;  5BPD A;  1B72 A;  5TRD A;  2R7Z J;  5A2Q Z;  2XPV A;  5DEQ A;  1FPQ A;  3OWT A;  3SDB A;  1U8R A;  2RQP A;  3PNY A;  3DBH B;  2BXZ A;  2ZXH A;  4A6D A;  2R7X A;  1IN5 A;  1TW2 A;  3LA2 A;  3JRC A;  1W5C C;  2JT1 A;  4E7L A;  2HVQ A;  4U88 A;  1I6X A;  4C2U A;  1D1A A;  1R5G A;  1Z9C A;  2F5E A;  4PSX A;  5D6E A;  3OYL A;  3KZZ A;  2IGO A;  3RKX A;  2K9L A;  1K78 B;  3FXK A;  3W3C A;  3SHF A;  2LKS A;  1O3Q A;  4IHY A;  2QEN A;  3K7A J;  4IL6 C;  1WSU A;  2GOX B;  2JK3 A;  2WTE A;  2X9D A;  3TO6 A;  1GHC A;  1HKT A;  2CQK A;  1B9M A;  1UHS A;  5HDG A;  5IP6 A;  4HDV A;  2R7U A;  4BJT A;  1WJB A;  1ULY A;  2O9L A;  2HQN A;  2TCT A;  2IA1 A;  2COB A;  1AOY A;  5FB2 A;  3ZRG A;  3CDI A;  4NNJ A;  3K1P A;  1JKP C;  1TWF J;  5HDN A;  4IHV A;  1SD4 A;  3FXR A;  1WJA A;  1YS7 A;  1S7E A;  3WE3 A;  3IAM 2;  1HKS A;  1U2W A;  2VN2 A;  1GT0 C;  3DV8 A;  2HYF A;  4HAM A;  4ZYA A;  3H1C A;  5E8G A;  3QAH A;  2KZV A;  2GQQ A;  4A5M A;  4HZF A;  2STW A;  4MO7 A;  2NYX A;  3J7A Y;  2K9Q A;  1VND A;  2E1C A;  4B44 A;  4KIB A;  3CO7 C;  4LJZ F;  3DLL F;  4ENM A;  4Q47 A;  5ERI A;  5EJC A;  4XRS A;  2Q2E A;  2R3S A;  1KYW A;  3DKY A;  4HNV A;  4XN3 A;  3S93 A;  4NUB A;  1X1C A;  4ESB A;  4BDY A;  1I50 J;  3ZGK A;  3CCU I;  1MIJ A;  3PSI A;  3TDZ C;  4YIR X;  4JK1 X;  2Z99 A;  5FGM A;  1LDK B;  2MD5 A;  2X4H A;  4HQE A;  1MMG A;  1S8N A;  2FE3 A;  5J1R A;  2KMU A;  2FX0 A;  2JQ7 A;  3E5X A;  1E0E A;  1ON1 A;  3I3L A;  3ABM H;  2QQB A;  3ZPL A;  2LRD A;  3PJR A;  3X2Q H;  2O3F A;  3H0G J;  3ZP5 A;  3CDH A;  3H92 A;  1LFB A;  4BE0 A;  2BZT A;  2LF8 A;  3DEU A;  3W6V A;  5EGO A;  4FET A;  5E1Z B;  4FIS A;  1Z3X A;  4ASN A;  4RAF A;  2KP6 A;  2FD5 A;  2A5W A;  2KL4 A;  4NQW A;  1EKE A;  1YRN B;  2Z33 A;  4Q5S F;  2VOD A;  5DS9 A;  1B8I B;  3E5Q A;  3HOT A;  2F48 A;  2CV2 A;  1I27 A;  4IKF A;  1REP C;  1T56 A;  1X3W B;  1XS9 A;  1TNT A;  1JKQ C;  1RR7 A;  1ACI A;  1BI0 A;  3DTI A;  2GIZ A;  4Z6Y A;  4CXF A;  4L5E A;  4IRG A;  3LAP A;  3D1N I;  1LUJ B;  1KA8 A;  3ISP A;  2WY7 Q;  3R60 A;  3GTK J;  2YSR A;  2H94 A;  3WGH A;  4BY7 J;  4UUT A;  2QCO A;  1NH3 A;  1D5V A;  1XTA A;  1W0U A;  2W82 A;  2R7V A;  1EH7 A;  2LRE A;  3K4B A;  5B3S H;  1FBQ A;  4P9F A;  2IS6 A;  4I02 A;  1FTT A;  3CLQ A;  4BYY A;  3Q0U A;  5FJ8 J;  3ZMZ A;  5FKL A;  3CCS I;  4YFN F;  1LJ9 A;  1WVR A;  3PO2 J;  1QBJ A;  1J2X A;  3BPX A;  4O3M A;  2ETH A;  2W48 A;  3K4J A;  6PAX A;  1OCP A;  3AG3 H;  1T39 A;  4IX7 A;  1MKM A;  3RZO J;  2FSW A;  2WAQ N;  5D4R A;  3HPG A;  4WF2 A;  3CMY A;  2XSD C;  1IO2 A;  5CVJ A;  2DFI A;  1HOM A;  3OL4 A;  2QKL B;  1DDN A;  1ZQ3 P;  2K7L A;  2ZO4 A;  2BHZ A;  3CO6 C;  2QBY A;  1FSH A;  4LIT A;  2K85 A;  2YS9 A;  5EEA A;  3AG4 H;  5E3M A;  1GXP A;  2FQ4 A;  2DA3 A;  2XVC A;  2IRF G;  2M30 A;  2W85 A;  1NHA A;  4N9I A;  3KX2 A;  2P5V A;  1MBE A;  2DT6 A;  3CME I;  3ECH A;  3RYR A;  3G6E I;  2V6C A;  3HBL A;  4UB6 C;  5GP9 A;  3DEW A;  5HS9 A;  1AWC A;  3FM5 A;  5DCF A;  3HUG B;  5FKN A;  5HS7 A;  3K10 A;  3M9A A;  4WX9 A;  1IXS B;  3JW4 A;  2PLY A;  5CVU A;  5H6R A;  2HQR A;  4D7M A;  4NC7 A;  3D5S C;  3SZP A;  3BWG A;  3JRF A;  4XR6 A;  2BV6 A;  4ZYD A;  4RLQ A;  3ZR8 X;  3CDL A;  4EV0 A;  4XRM A;  2V4J C;  5D5U B;  3FXL A;  2DOF A;  4IVN A;  2QLZ A;  3TP0 A;  3G1L A;  4XLF A;  2M3A A;  4JX4 A;  1E17 A;  5J1U A;  3K4M A;  1B6A A;  5HVQ C;  5EZH A;  2BYV E;  3VFZ A;  3IP4 B;  1WI3 A;  2EWN A;  1J09 A;  3QPS A;  5J8C A;  4PJ0 C;  3S8P A;  3IL2 A;  1JJ6 C;  2DQL A;  4XN0 A;  3FHN A;  4ZH4 F;  3FXU A;  1IN6 A;  2VC0 A;  5ICC A;  1KYZ A;  5J6X A;  2KRC A;  3ZQC A;  3QU3 A;  2E2H J;  2DTR A;  2EB7 A;  1XGO A;  4PDK A;  2G9W A;  1PUF B;  3F9K A;  1RC9 A;  3WU2 C;  2MH2 A;  1K4T A;  2ACJ A;  3WGG A;  1X1B A;  4UVB A;  3J81 Z;  2FMY A;  1X58 A;  3JRD A;  2BY2 A;  2EFW A;  3CUO A;  2MG4 A;  3ZCO A;  3H9G A;  2L9N A;  4BEH B;  1ZEL A;  4C30 A;  3F72 A;  3I4M J;  1W36 C;  1PP8 F;  1SAX A;  4QTR A;  3G73 A;  2O8X A;  2ZSI B;  3GUD A;  2B63 J;  2X1D A;  1ETO A;  4HX8 A;  2CRG A;  2DYS H;  2WAE A;  1HC8 A;  3A4C A;  1T0F A;  3QYB A;  1QPM A;  2M4K A;  3GFJ A;  4EJV A;  4W97 A;  2UXN A;  1R5H A;  1RIO H;  1XCB A;  2LY9 A;  3A0H C;  3TL4 X;  3OIQ A;  1S5L C;  2X48 A;  2ZFW A;  2JMW A;  1ITY A;  1TT0 A;  4ETS A;  3OIP A;  4HDU A;  5EDN A;  3M8F A;  1OFC X;  2E1O A;  2EBI A;  4K2E A;  4A3D J;  3VOE A;  2PMH A;  1WI9 A;  3EDP A;  5F64 A;  2B9S A;  2XC7 A;  3E3V A;  3C3W A;  3S2D J;  1HW2 A;  4HW0 A;  1IF1 A;  1APL C;  3CMA I;  2CJJ A;  3ESW B;  1F36 A;  2VIX A;  2YR2 A;  4CYC A;  1MMS A;  4AVZ A;  3FK6 A;  4AID A;  2KFD A;  4UV9 A;  5KHD A;  4E7H A;  4HLY A;  3NQO A;  2LKP A;  1UMQ A;  2CW8 A;  4EAT A;  4LB6 B;  1AKH B;  4EJW A;  5D5V B;  4BBS J;  3QP5 A;  2V1X A;  1Z1D A;  2F5D A;  3PNT A;  1ZRC A;  2ZB9 A;  5EEG A;  3RKY A;  3BY6 A;  3WTZ A;  2WWY A;  2L4M A;  3HG9 A;  2ZFU A;  2WY8 Q;  2DAO A;  1TZL A;  2OCC H;  4XKC A;  4OMZ A;  3RSN A;  2QQ9 A;  1TQI A;  3CC7 I;  2FML A;  3GME A;  3V7C A;  4AIK A;  4MNU A;  4DNC A;  5IYC J;  1O3S A;  1RUN A;  1Z6R A;  2Y31 A;  3I71 A;  2X6X A;  4N4N B;  2RN7 A;  3MWM A;  4BJ6 C;  1KON A;  1SMY F;  3HOY J;  1CF7 A;  4AC0 A;  3K0L A;  4DQ2 A;  1DUX C;  2Y9Y A;  5C3E J;  3H9Q A;  1W0T A;  3ZQI A;  4FTH A;  2QWW A;  1B4A A;  5BQT A;  3M3Y J;  3T1B A;  2CWE A;  1F43 A;  3HHH A;  4Y3O A;  2R7D A;  4XRF A;  3MVP A;  1IN4 A;  4BL0 B;  3JRA A;  2L4A A;  2XHK A;  3GLX A;  2KLO A;  1LKX A;  5F1J A;  4NBQ A;  1YIJ I;  4MFD A;  3E1S A;  2MLG A;  5CYV A;  3JRI A;  4EMS A;  2BXY A;  4CHU A;  3FDY A;  3CF5 F;  2NVQ J;  5CKT A;  2E2I J;  5IT9 Z;  2OD5 A;  3HL2 A;  3O3K A;  2PQ8 A;  3HXL A;  5KVR A;  3OYA A;  5BMZ A;  3LWF A;  2DOA A;  3CCM I;  1OPC A;  2IXS A;  5AON A;  2TRT A;  1OYI A;  3I4N J;  5TJJ A;  1ZYR F;  2XAG A;  3ECO A;  3IRQ A;  4RGS A;  1JXS A;  3ZXS A;  4B3X A;  5ILU A;  2EPF A;  2KIU A;  2HFH A;  3MKZ A;  4E4H A;  4BS9 A;  1XMA A;  3FIW A;  4RB2 C;  4IOA F;  1J5Y A;  5ICE A;  3FMR A;  4RGU A;  5HLI A;  2VPL A;  2E7W A;  3BQZ A;  4IF4 A;  5CVR A;  3ML6 A;  4KIS A;  1BOA A;  1SFK A;  2DN0 A;  3L2W A;  5L3E A;  3S1M J;  4BH9 A;  3WTV C;  1XD7 A;  1Y0U A;  3K9T A;  1ZAO A;  3O8G A;  1J7K A;  5GAD J;  1Y8R B;  4ITV A;  4JBA A;  4G7Z F;  2L01 A;  2V26 A;  2PMZ A;  1Z67 A;  1K61 A;  3VB2 A;  1FC3 A;  1BL0 A;  3F22 A;  3CD6 I;  1TWA J;  4E70 A;  1JI8 A;  4AWX B;  4XKW A;  3ELK A;  1BI3 A;  4EJU A;  2ESH A;  5IYD J;  1XB4 A;  3NEU A;  1WPK A;  1FOY A;  4XLC A;  3ASN H;  1B1B A;  1SVM A;  1XCV A;  1FIA A;  3G71 I;  3VYR B;  1YRN A;  2OC6 A;  3VPR A;  3E97 A;  4AUX A;  2HOA A;  4XL9 A;  4IPA A;  3RZD J;  2JPB A;  1ZLJ A;  2EFP A;  2YUS A;  3OYD A;  3F8F A;  3NAR A;  4BXX J;  3HOU J;  2WA0 A;  3K2A A;  3BRO A;  4B4C A;  3JR9 A;  4A12 A;  2HXO A;  2Z5U A;  4HX4 A;  3QYF A;  4RM2 A;  2C6Y A;  3BDD A;  3BTI A;  1QZE A;  3K69 A;  5EG0 B;  3FXO A;  4UXN A;  3TKY A;  2RKH A;  4GCV A;  2V1U A;  2A05 A;  4DYQ A;  2HQ5 A;  4NB5 A;  5DCM B;  1P4W A;  4MLO A;  1SMT A;  3CP2 A;  2JUC A;  4WK8 F;  3MKY B;  1MBH A;  2QKM B;  1Y39 A;  4HA8 A;  3LSP A;  3O6B B;  4FE7 A;  2DPU A;  4PFO A;  4ON0 A;  1G4D A;  5DD4 A;  5K7Z A;  2NVX J;  2IS1 A;  1BW6 A;  4GO1 A;  3S1N J;  2LTP A;  3V4G A;  2L5Q A;  5LGT A;  1K83 J;  2M8G X;  3I56 I;  3BZK A;  2HZD A;  1T08 B;  2F5V A;  2LSO A;  4MFE A;  1YJ9 I;  3LMM A;  4R1H A;  3H9J A;  3WTU C;  3L9F A;  1XPX A;  4HST A;  1GUU A;  1SD5 A;  3OMY A;  3QYE A;  2BW3 B;  2IEK A;  2Y0S A;  1YS6 A;  3K4K A;  2EQR A;  1W7P D;  1Z6T A;  2GOM A;  4M3D A;  3HOV J;  1OCR H;  2E19 A;  4UUS B;  3CP8 A;  3IH3 A;  2EFN A;  3I55 I;  4E6K G;  1ZLK A;  4OIR F;  4XK4 A;  1P7I A;  1R5I D;  2KPM A;  3E7L A;  1Y1W J;  3D5R C;  1Z7U A;  4A3F J;  2CGP A;  1UB9 A;  4IEJ A;  3TMO A;  3FIS A;  5TIS C;  3J80 Z;  1T38 A;  3RDI A;  1S6L A;  2XF6 A;  3N4M A;  4GDF A;  2OCE A;  1HXD A;  5CQG A;  5FKK A;  2OAZ A;  3KE2 A;  3WTY C;  1JTX A;  5C4X J;  2CV1 A;  4GGG A;  1IAW A;  3HUG A;  3OR1 C;  2AQF A;  1ZG3 A;  3QQA A;  3SZT A;  2MC3 A;  2EZH A;  3OY9 A;  3WE2 A;  1X2M A;  2AXL A;  1YIO A;  1HST A;  3U2R A;  3DU6 A;  2DFH A;  4Y7N J;  5J3L A;  1KU3 A;  3S17 J;  1DGW Y;  5FRO A;  1D1C A;  1W7P A;  1E2X A;  1NK3 P;  3J7Y J;  2PI0 A;  2RNJ A;  3E5U A;  2QGU A;  2VI6 A;  2ELH A;  2EH3 A;  4G6Q A;  3DPU A;  4C2T A;  2BY0 A;  4XSZ F;  3PIO F;  3GW2 A;  2NVT J;  3EET A;  2DDB A;  2K27 A;  2PJR B;  3JAM K;  1X3Z B;  1FSE A;  2F5C A;  1YYV A;  2COM A;  3I64 A;  3I4P A;  2M7B A;  3ZMD A;  2JA8 J;  2W1O A;  1Z21 A;  1X1A A;  2ELK A;  4I7H A;  5E3O A;  1MBJ A;  2XB0 X;  2EIM H;  1SEU A;  2Z16 A;  5FD5 A;  4L0Y B;  1G3W A;  1R22 A;  3A01 B;  2IVM A;  3S2H J;  3BTC A;  4A5N A;  3QPT A;  3BT9 A;  3TO9 A;  3ZMU A;  4C3H J;  4KN4 X;  5JR3 A;  1I39 A;  2BE5 F;  5CLS A;  5FLX K;  3MZH A;  1IRG A;  2MSY A;  3ZQ7 A;  2XPW A;  1UHW A;  1VQ9 I;  3HRT A;  1YX5 A;  3SDG A;  1BM9 A;  2CYY A;  4EM2 A;  2YX7 A;  2OA4 A;  2DT7 B;  5CPR B;  3L2R A;  1E3H A;  4XIC A;  4P55 A;  2HGC A;  4A3J J;  2WAD A;  5ILV A;  1FX7 A;  2JWT A;  2VQC A;  3KEQ A;  1SFO J;  2JA5 J;  5E1X A;  3UR3 C;  2P5L C;  1NK2 P;  3KP3 A;  4H0E A;  2WBM A;  3AL0 C;  2MYS A;  4YG2 F;  2D5V A;  1BI1 A;  3FKJ A;  2FOW A;  3OYJ A;  2BY1 A;  1RES A;  2VQL A;  4GYG A;  1S7A A;  4ESF A;  2I10 A;  3FF5 A;  3RI4 A;  1JGG A;  3AG1 H;  3KZI C;  4S0H B;  3WG9 A;  3WG7 H;  1U0J A;  1IRX A;  4GYI A;  4BHP A;  2A6H F;  3R6S A;  1EV7 A;  3GX4 X;  4KMF A;  3IKT A;  4A69 C;  3CMM A;  2F2E A;  2FOK A;  2K3F A;  3V42 A;  4R8H A;  3WU0 A;  3P9I A;  4UVC A;  4Y4R A;  2HXI A;  2E36 A;  4KFC A;  5AIQ A;  1RKT A;  3BJ6 A;  1PYV A;  1SFX A;  1AKH A;  3JRE A;  2X6O A;  3TGN A;  4Y13 A;  1U3E M;  1YG2 A;  2M34 A;  2HDC A;  3CTA A;  5BPI A;  2M9H A;  4AYB N;  3FK7 A;  4KIF A;  1JUM A;  1KU7 A;  3HZJ A;  5JI6 A;  2IPQ X;  3DKW A;  4KJZ A;  4L18 B;  1QA6 A;  4HQM A;  1U5T C;  1OJL A;  2VJI A;  2DCE A;  2LNB A;  3HKZ N;  1ZAR A;  5CVV A;  5KK1 A;  3ZOB A;  1IJW C;  2EV0 A;  3K2Z A;  2A07 F;  4M6Y A;  3PFI A;  2OZ6 A;  4RB3 C;  4IRH A;  3REO A;  4J01 A;  2BBY A;  1Y8Q B;  3BZC A;  1XX5 A;  4B48 A;  2B7E A;  2DOD A;  2EV6 A;  5B1A H;  3HM5 A;  4B1R A;  2H1K A;  2X1C A;  1ZRF A;  3AL0 B;  4JP0 A;  2E1M C;  5IP9 J;  3T8R A;  3TQN A;  4CO8 A;  4LFU A;  1A36 A;  5FRM A;  2O7O A;  1CQT A;  1XGN A;  1BJA A;  1W4M A;  2EK5 A;  1A6I A;  2O0Y A;  3M7G A;  2ZJR F;  3CCQ I;  5GPC A;  2E34 A;  4BGD A;  1GDT A;  4ZDO A;  3JSP A;  2BOL A;  2E71 A;  3CES A;  3U1K A;  2P7V B;  4R79 A;  1VQ8 I;  3F6V A;  3LFU A;  4IQJ A;  2OPT A;  3CC2 I;  3L7W A;  4LG0 A;  3HTU A;  2XAH A;  4HNT A;  5IY5 H;  1WH7 A;  2KJC A;  1MW7 A;  1TTY A;  3G2B A;  5D8L B;  5LEK A;  2O6G E;  4C3J J;  1BC8 C;  4MTD A;  3GTG J;  1U78 A;  4JX6 A;  1D5Y A;  3GTP J;  2FEZ A;  2RVC A;  1E3P A;  1ETW A;  3C1D A;  4A3E J;  3FKI J;  3WTW C;  1IUF A;  3HGY A;  1CGP A;  3MEX A;  1IG7 A;  1LVA A;  5LRR A;  2KIQ A;  2MFZ A;  2DXI A;  1MSF C;  2Z3Y A;  2VAS A;  2P0W A;  3BG3 A;  3BR0 A;  4BJ5 C;  3E6C C;  1WWX A;  2R4G A;  4IO9 F;  2EIJ H;  3Q9V A;  2R7O A;  3ZQL A;  5J47 A;  4Z2Y A;  1X1D A;  3DEE A;  1RPW A;  4L9V A;  3HPH A;  5D4S A;  3BR5 A;  3BR3 A;  2ID6 A;  1T95 A;  5J8F A;  3CCL I;  1VQ4 I;  3SEQ A;  4WWC A;  4I98 B;  4BQQ A;  2XAU A;  3BZ6 A;  3F8C A;  5GAE J;  1EF4 A;  3BG7 A;  2Y2Z A;  1Z05 A;  4DGW B;  2LKX A;  3CF2 A;  3VSL A;  1P7J A;  4MQV A;  5JVG F;  3KCC A;  2E1M B;  3OS0 A;  4HV6 A;  3RCO A;  3CCE I;  2W57 A;  4XKV A;  3VWB A;  4M9S A;  3KYC B;  2R5Z B;  1FBU A;  2FBK A;  2M2E A;  5E17 F;  5KNL A;  5H6Q A;  2L7F P;  1A5J A;  4G6T B;  4OIQ F;  2L54 A;  2JVH A;  3EUH C;  3COA C;  1Z77 A;  1Y0N A;  2CUJ A;  2LBF B;  2O03 A;  4HPQ A;  2ME6 A;  2ECB A;  4CUG A;  3PIP F;  1BR2 A;  1X3U A;  3ABT A;  5ICG A;  2DTZ A;  2LR8 A;  3LA7 A;  3LA3 A;  5EG0 A;  1VFC A;  1I1S A;  3F8M A;  1VTN C;  4O6J A;  5LEJ A;  2VBX A;  5H20 A;  2IA0 A;  1TNS A;  5F0F A;  1SVL A;  4OU0 A;  2DI3 A;  5DCM A;  1MJ9 A;  3HOS A;  1RRJ A;  3P9K A;  4L9J A;  1ORK A;  1P9Q C;  2GXG A;  1MND A;  5GTH C;  4A3I J;  1EJ9 A;  3GYH X;  5DUK A;  1IZ1 A;  4UHT A;  3S2W A;  1TW3 A;  3D5L A;  3LQR A;  4G9Y A;  3L2V A;  4D5C A;  3KLO A;  2P7C B;  2LG4 A;  3FM3 A;  3GVA A;  5KCM A;  5LLQ A;  1KU9 A;  3K4C A;  3KET A;  1E3O C;  1WRJ A;  2HDW A;  2XV4 S;  2JN6 A;  2PX9 A;  1IDY A;  4XKB A;  4M9Z A;  1VQ5 I;  4QIW N;  2XGX A;  4HSR A;  1MBF A;  2JA2 A;  5HLT A;  3QPH A;  2F6C A;  2DA6 A;  3K6G A;  1FWZ A;  1K6Y A;  1S3J A;  2NOJ B;  3OYN A;  3KIO A;  4PCQ A;  2W7N A;  5HDK A;  2LD5 A;  2EV5 A;  3BPV A;  2DMU A;  4LLL A;  2BW3 A;  3GWZ A;  2J5P A;  3S3O A;  1MJA A;  3KYD B;  3H5N A;  1V3F A;  5TGT A;  2UXX A;  5JVT A;  4KT6 A;  5L3C A;  2PEX A;  3OOP A;  3NRV A;  1JTY A;  1UG2 A;  2XF7 A;  1AHD P;  3FMQ A;  2ZNY A;  1VQO I;  2H27 A;  4HX7 A;  1XDU A;  3TED A;  2GA1 A;  2KDO A;  4LOC A;  5ILS A;  4L0Z B;  4BNC A;  2PMU A;  3BOQ A;  3IHU A;  2LYC A;  2G7H A;  3BR6 A;  1MBK A;  5F1R A;  4KNY A;  2DT5 A;  1P2F A;  2UV1 A;  3Q0W A;  4PGG A;  2RNG A;  3OS2 A;  4UY8 I;  2MC4 A;  2Q1Z B;  2XIG A;  4XLH A;  3BTL A;  4KDP A;  5F08 A;  1H0M A;  4OIP F;  2DJI A;  1O7F A;  2ECC A;  1MGT A;  5F0C A;  2OTL I;  1L0O C;  4OWR B;  4CIC A;  3BJO A;  1YW7 A;  4DYC A;  4I0A A;  3LL7 A;  4PZJ A;  2HVR A;  2ZBK A;  4ENJ A;  1WZ2 A;  1XGS A;  2EFQ A;  3B73 A;  2O8K A;  4HF1 A;  2WV1 A;  4Y17 A;  4KIT B;  5M3F J;  1R58 A;  3WTS C;  4F93 B;  2MH9 A;  1K4S A;  2QF7 A;  2OF7 A;  3DCF A;  1LE8 A;  5LBQ A;  4MEX F;  2P8T A;  1F1Z A;  3CCY A;  4ZYG A;  3DKX A;  2X1E A;  2BGC A;  2ZME A;  2PJR A;  4M6V A;  2QVO A;  4P5O A;  5JFR A;  3TO7 A;  4QPQ A;  3FHZ A;  3F21 A;  2FUG 2;  5JLX A;  5KAF C;  4X1E A;  2IBD A;  4ZZL A;  5J4Y A;  4XLA A;  5HLG A;  3AKZ A;  1PUE E;  2K4J A;  4II3 A;  4UNO A;  2Y48 A;  1FT9 A;  2KRH A;  2I5U A;  2IW5 A;  1Y56 A;  5E1W A;  3LST A;  2BEO A;  1HDP A;  1I3Q J;  2R5Y A;  3G1O A;  4OIN F;  2VJ5 A;  2W25 A;  4ZYE A;  1MNE A;  3S14 J;  3IWF A;  2XRL A;  1R23 A;  3JTG A;  4IHS A;  4PJL A;  4XOR A;  5FO5 A;  1IRF A;  2WC2 A;  2DA4 A;  1WHU A;  1JKO C;  3GTJ J;  2V9K A;  4DBQ A;  4JOM A;  1B9N A;  1FEX A;  4V19 K;  3JCU C;  2P6S A;  3IV5 A;  3B02 A;  3S1R J;  4Y33 A;  2PG4 A;  4XMY A;  4CYD A;  1MMN A;  2H09 A;  5FD6 A;  5FRN A;  1HW5 A;  3V7R A;  2GXA A;  1XC5 A;  3O2P E;  1IUY A;  3BQY A;  1QZY A;  4M3B A;  2Q2E B;  3FBN B;  3I53 A;  1FIP A;  2KT0 A;  2WAF A;  4Q48 A;  2VUM J;  1UHM A;  3IUO A;  5DUI A;  5FLM J;  1B59 A;  3OYF A;  3Q0V A;  1DPU A;  1K78 A;  1POG A;  1JGS A;  4AU7 A;  4S04 A;  1KU2 A;  2K9M A;  1F4K A;  5KAI C;  4C3I J;  2ME0 A;  2AQE A;  4NC6 A;  4MHG A;  2VKV A;  4HEA 2;  5DV5 A;  2XGD A;  2ADU A;  3CUQ C;  2JUG A;  3ROU A;  3SQN A;  5IOZ A;  4QSH A;  2QSH X;  2HPM A;  3I54 A;  3OS1 A;  1UZC A;  3RQ4 A;  1EH6 A;  1UFM A;  4CH7 A;  2JZY A;  1SAU A;  4E7Z A;  5HNH A;  1KQ0 A;  1H8A C;  4A93 J;  5LGN A;  1YE9 A;  2L9V A;  1A35 A;  4B8X A;  4RB1 A;  4HBL A;  1H9T A;  2CFO A;  3I59 B;  4HV5 A;  1VZ0 A;  2VJ4 A;  2R93 J;  1MJB A;  2VOP A;  3CZ6 A;  1ZR4 A;  1D3Y A;  1DPR A;  1UJ8 A;  4DIQ A;  4V2G A;  3O8H A;  1U9O A;  2E1N A;  4YRV A;  3SYT A;  3KEO A;  1FMV A;  3E6B A;  3CCJ I;  3HSR A;  3V8K A;  4WCG A;  4HNU A;  1AU7 A;  3R4K A;  1LDD A;  2OUM A;  4AVP A;  3U1D A;  4FHT A;  1ZN2 A;  2HI3 A;  2P5K A;  3LSH A;  3PL8 A;  2F4I A;  1ETK A;  2VBY A;  1MMA A;  1YQA A;  2MAB A;  2XAQ A;  3HIF A;  3DPT A;  1JE8 A;  4DJA A;  1MDM B;  2FF4 A;  4MTE A;  3R61 A;  5E20 A;  1ODD A;  1PJR A;  2NVU B;  4W1U A;  1V5F A;  4CCM A;  1V4R A;  4LGW A;  2EIL H;  2IJL A;  2R7T A;  2XKO A;  3PUF A;  2AHQ A;  1LFU P;  3LNQ A;  3H36 A;  1ZGA A;  2W00 A;  1B8I A;  2Y30 A;  2EZK A;  3CUQ B;  3EQL F;  1ZRD A;  2QA4 I;  4BQO A;  4BQN A;  4A6E A;  3ZMS A;  3WTX C;  3JRH A;  3L2Q A;  1HKQ A;  2R7W A;  2HTJ A;  2IP2 A;  1ZHF A;  3K4L A;  1FOK A;  3D0S A;  3HRU A;  3M8E A;  2V1N A;  3NWS A;  4RM3 A;  3HJE A;  4U7D A;  1VF9 A;  2D1H A;  4DZJ A;  2PBI A;  3MKL A;  1YOV B;  3A1Y A;  2FQ3 A;  2K40 A;  1VQP I;  4OOI A;  2DK8 A;  2FNP A;  1WJD A;  4RDU A;  3PNV A;  2V79 A;  4LB5 A;  1T2K A;  1EA3 A;  4O5V A;  3NAU A;  2HYJ A;  4XLN F;  3BCB A;  1BW5 A;  1G3S A;  3NWT A;  1YIT I;  1FMW A;  3L1P A;  3FXM A;  3ERM A;  2M1B A;  2W4S A;  2DBB A;  3LSG A;  5AIP A;  2MLK A;  5IT3 A;  2DA5 A;  2R7R A;  2OQR A;  5F27 A;  3ZQQ A;  1BA5 A;  3SXY A;  2OQG A;  1TC3 C;  1GV2 A;  4XON A;  2A68 F;  1SD7 A;  1OCC H;  1RET A;  1I3A A;  4P9U A;  4BKX A;  3MQ0 A;  5L3F A;  1UST A;  3BG5 A;  4YII A;  1BR1 A;  2LP0 A;  2Q8K A;  1F9N A;  4BXF A;  3PQK A;  2XKP A;  3TW7 A;  2AS5 F;  4FCY A;  2VKE A;  4BHB A;  2IT0 A;  3OYE A;  5K5Q A;  1L3L A;  3R0A A;  4I76 A;  1D0X A;  3EPZ A;  4BBR J;  2FXA A;  3V7S A;  1TBX A;  1WCM J;  3I58 A;  2STT A;  4HLX A;  5E3N A;  2R5Z A;  1TL8 A;  4A0X A;  2A5Y B;  5J40 A;  3GCM A;  3QOE A;  3FMS A;  3KLN A;  4XQF A;  3SJM A;  2CMP A;  1T98 A;  2R7S A;  4ZYH A;  1RNL A;  2PMZ N;  3E6D A;  1P4X A;  2FBI A;  3GFM A;  3MN2 A;  1HSJ A;  4A2U A;  2H6B A;  2L7Z A;  3RKW A;  2VKD A;  1JKR C;  1Y1V J;  1RR8 C;  1DQU A;  3UNG C;  2DO7 A;  2YPR A;  2A61 A;  1S7O A;  3HSE A;  1WFX A;  3W2V A;  2RC4 A;  3N05 A;  2HOT A;  2UUZ A;  2YU3 A;  4U0Y A;  4IRI A;  3S3N A;  3U9G A;  2KIF A;  3M1C A;  3H3V K;  5L3G A;  2A69 F;  1JHF A;  3DF8 A;  2VOO A;  4RBO A;  4CCK A;  2NS7 A;  3AFH A;  5L3D A;  1BI2 A;  2LY1 A;  3GF2 A;  2L0K A;  4BDZ A;  4AIJ A;  3K1M A;  2VBZ A;  4I09 A;  5M3M J;  2HPI A;  1FYK A;  4N4O B;  5K5R A;  5DTD A;  4ENN A;  4A3L J;  2CUE A;  4I2O A;  3QU6 A;  2H8R A;  1AA7 A;  2QYO A;  4UB8 C;  2UZK A;  2CSO A;  2HYG D;  2M5W A;  3P5J A;  1O3R A;  4RA2 A;  1VQ7 I;  3DXJ F;  1ETY A;  1Z91 A;  4YEJ A;  3Q9S A;  3TDU C;  1ZG1 A;  1C0W A;  3F6O A;  1O7L A;  3IH2 A;  1HA8 A;  1XGM A;  1PVE A;  1PUF A;  1H89 C;  2O5R A;  3JAM Z;  4QLC U;  3S16 J;  2FA5 A;  1PDN C;  2AXT C;  5E18 F;  1V5G A;  2ISY A;  3OOU A;  3FZV A;  4CCJ A;  4FX4 A;  3QWL A;  2H1L A;  2ZNZ A;  4BEH A;  2Y0M A;  4LLG F;  1HF0 A;  3BR2 A;  1R00 A;  1P92 A;  2EIN H;  3EUH A;  1W5S A;  3G3Z A;  3DWL E;  2OJE D;  2L2O A;  5F0H A;  3A02 A;  2CU7 A;  2XDV A;  2XAJ A;  3VSK A;  4EJO A;  4F55 A;  1P4A A;  5E79 C;  5FLX Z;  2R0Q C;  4KT5 C;  3GEZ A;  2GZW A;  3I9V 2;  2Y0S N;  4M3E A;  1IV6 A;  4YIF A;  5A2Q K;  2LK2 A;  3MZ8 A;  5LHH A;  3OYM A;  1I6H J;  1BBY A;  5HNF A;  1BIB A;  2FNA A;  1I1G A;  3W6K B;  2D45 A;  2XF5 A;  1G2H A;  1OLT A;  2KIS A;  2NOG A;  1W36 D;  1NG6 A; 
#chains in the Genus database with same CATH homology
 2OBP A;  1ON2 A;  1CF7 B;  3EYY A;  1QQI A;  2RV8 A;  3L09 A;  3GFI A;  2K86 A;  1OMI A;  5JHU A;  2HWV A;  1H9G A;  4CZZ A;  1MD0 A;  2A3S A;  2ZXJ A;  4D0P A;  4I01 A;  3T8T A;  1FBS A;  1GVJ A;  4UUV A;  3KFW X;  2D2W A;  3HRS A;  3FX3 A;  3Q5F A;  3SFZ A;  4KA4 A;  1R36 A;  1YLF A;  3LFK A;  1DP7 P;  4G7O F;  4YFX F;  3BJA A;  3WTT C;  3DQV C;  1QO0 D;  2EA2 A;  2V1D A;  2XAS A;  3V8L A;  4L5J A;  3DFG A;  3H3U A;  2J5O A;  3ZN0 A;  4U7B A;  4M72 A;  3KP2 A;  3KP5 A;  1IN8 A;  1FP2 A;  1XSV A;  1SFE A;  1J75 A;  4GXO A;  5D8K B;  1HQC A;  2M45 A;  3T5X A;  2MA3 A;  1FZP B;  3CJN A;  3H3Z A;  3IKV A;  3IWZ A;  4CDG A;  3HRM A;  1XSD A;  4QWQ A;  1J0R A;  2KIM A;  3GFL A;  2OZU A;  1XDS A;  4M9X A;  1IW7 F;  3W6J B;  3RIR A;  4P96 A;  2CO5 A;  3I59 A;  4LMY A;  5K5O A;  1ONV A;  1TQP A;  1U5T B;  2HS5 A;  2ESN A;  3ZMV A;  2VT2 A;  4UVA A;  1TQM A;  2UWM A;  4N0B A;  4U0W A;  1QGP A;  4F7Z A;  1BC7 C;  2HKX A;  3GZ6 A;  1MDM A;  2VC1 A;  2CG4 A;  5LHI A;  1STZ A;  1YO5 C;  3PQJ A;  2Q0O A;  2L02 A;  2RGV A;  2QZ8 A;  4BAY A;  3CUQ A;  2P6T A;  2EA4 A;  1IXR C;  4AD9 A;  1K7A A;  2KRF A;  3DP7 A;  4NHJ A;  4RAZ A;  1IXC A;  4FT8 A;  3KP7 A;  4TV7 A;  5DD8 A;  1LQ1 A;  3QP6 A;  5F6F A;  2GXB A;  1RZ4 A;  1LB2 A;  3R0J A;  2E7X A;  2A6E F;  3QOP A;  2K02 A;  3HTS B;  2D1V A;  2L3D A;  5ED4 A;  1LEB A;  3VOD A;  2FU4 A;  5CJ9 A;  2V9V A;  3DPL C;  3F8B A;  5BS6 A;  4BHC A;  2CW0 F;  2OU2 A;  3MZY A;  4EM1 A;  1FNN A;  3P9C A;  4A0Y A;  1J9I A;  1K6O A;  2VT3 A;  1T6S A;  3I0T A;  1W7P B;  3RPU A;  3HSF A;  1QZZ A;  1BN5 A;  4OIO F;  4M71 A;  2P4W A;  3CLO A;  4KIC A;  3GXO A;  3JTH A;  4KN7 X;  1FYL A;  3J81 K;  1HBX G;  3HHG A;  4XBF A;  4EQQ A;  2RDP A;  4IHT A;  1G3Y A;  1SFU A;  4BQA A;  2LF7 A;  3RTR A;  1YFH A;  5FFX A;  3LAJ A;  2GA2 A;  4LK0 F;  1JHH A;  2NRA C;  4MEY F;  3IC7 A;  4KMU X;  4L5I A;  1EH8 A;  4EGY A;  1G3T A;  2JRT A;  3GZ5 A;  2B0L A;  2XRO A;  4RS8 A;  1FYM A;  1KQ9 A;  1FLI A;  1I5Z A;  2VXZ A;  1O3T A;  4YFK F;  2KKO A;  2EFO A;  4I0B A;  4L9T A;  2LDU A;  4HF2 A;  2DU9 A;  3ZN1 A;  2HEO A;  3T0Y A;  1J59 A;  4M73 A;  1O57 A;  5D5W B;  1LNW A;  4AIH A;  2EJR A;  2DQR A;  5E8I A;  1IN7 A;  2MBF A;  2HZT A;  4A0Z A;  3N97 A;  3RPQ A;  2M8E A;  3AAF A;  4S05 A;  2JSC A;  3FWE A;  1OYY A;  2FRH A;  1BIA A;  2F5F A;  3ZMT A;  2IA2 A;  4RGR A;  4WXC A;  4EVI A;  3F3X A;  2ZKZ A;  2VE8 A;  5EEH A;  2PN6 A;  2Y75 A;  3VEP A;  3TOA A;  1XMK A;  5D6F A;  1R1V A;  2K4B A;  5IT9 K;  1YTY A;  1W5T A;  5LGU A;  2XUB A;  2NNY A;  2HR3 A;  4B09 A;  3L2C A;  4LG0 B;  4CGZ A;  1RUO A;  2JTV A;  4FX0 A;  1RI7 A;  4KIG A;  2QUF A;  3M1E A;  4BXU A;  4KYW A;  1XSX A;  1A04 A;  3QRF F;  1SD6 A;  1UCR A;  5FFZ A;  4UV8 A;  2M87 A;  2HTS A;  2DK5 A;  2VE9 A;  1F5T A;  4IJA A;  4LLN A;  4ENK A;  1OYW A;  4RAY A;  1ZGJ A;  4WXD A;  3C7J A;  3F8N A;  1FP1 D;  3BP8 A;  4MQ9 F;  1XN7 A;  2FBH A;  3FXQ A;  4G6D A;  2YX4 A;  3TOB A;  2H6C A;  3GO5 A;  1R7J A;  4EM0 B;  2HKO A;  2W24 A;  5DYM A;  1OR7 A;  3ABU A;  4EGZ A;  2QBY B;  3MAJ A;  4ZZD A;  3EYI A;  1HW1 A;  1R1U A;  4HOB A;  3WU1 B;  1G6N A;  4G94 A;  3JSO A;  4MGR A;  3K1N A;  3V8J A;  2NNN A;  1U5T A;  4JQF A;  1KGS A;  1LEA A;  2HOE A;  3ULQ B;  2VBW A;  2DPD A;  3C18 A;  4LD5 A;  2XRN A;  2ZCW A;  4M6X A;  5HS8 A;  4Q4Z F;  1PP7 U;  2DLL A;  5D5X B;  5K1Y A;  3I5U A;  4XLP F;  1Q1H A;  2DW4 A;  2GAU A;  4LK1 F;  1GXQ A;  3E6M A;  2JPC A;  2X0L A;  3KP4 A;  3F23 A;  3HYI A;  3MFK A;  3L00 A;  2WV0 A;  4U0V A;  2CFX A;  1LDJ A;  1R1T A;  2QQA A;  1P6R A;  3P7N A;  3RYP A;  2ZJ2 A;  3KZY A;  2QM3 A;  3IRR A;  5ICF A;  2TDX A;  2NAZ A;  5HOO A;  5CVI A;  3J80 K;  3J7A O;  5BOX A;  1K79 A;  2VON A;  1ZRE A;  3RJP A;  1MZB A;  4G8X A;  4Y15 A;  2XAF A;  4RGX A;  1U6G A;  4M74 A;  4KUM A;  1TLH B;  2PFB A;  4G7H F;  2O61 A;  1YW9 A;  1D8K A;  5LRS A;  4PGH A;  1USS A;  1QNT A;  1YW8 A;  2KJB A;  1D8J A;  4N9H A;  2Z9O A;  1KQ8 A;  5LHG A;  3ERE D;  3WGI A;  5L3B A;  2GWR A;  3OV8 A;  4ESJ A;  2ZME B;  3LQQ A;  4RB0 A;  3KP6 A;  2GIV A;  2R7F A;  5HLH A;  1ZG5 A;  4L9N A;  1S29 A;  4HYE A;  4OMY A;  4IXA A;  1ZH5 A;  1FY7 A;  2NS0 A;  3WOD F;  2ISZ A;  4EJT A;  5DDG A;  2W84 A;  4HF0 A;  1OKR A;  1WKM A;  1WQ2 A;  3MCZ A;  2G7U A;  4XSX F;  4WXH A;  2PJP A;  5BPD A;  5TRD A;  5A2Q Z;  5DEQ A;  1FPQ A;  1U8R A;  2RQP A;  4A6D A;  1IN5 A;  1TW2 A;  3LA2 A;  2JT1 A;  4U88 A;  1I6X A;  1R5G A;  1Z9C A;  2F5E A;  5D6E A;  3KZZ A;  1K78 B;  3RKX A;  3SHF A;  1O3Q A;  2QEN A;  1WSU A;  2WTE A;  3TO6 A;  1GHC A;  1HKT A;  2CQK A;  1B9M A;  5HDG A;  4HDV A;  1ULY A;  2HQN A;  2IA1 A;  1AOY A;  5FB2 A;  3K1P A;  5HDN A;  1SD4 A;  3FXR A;  1YS7 A;  3WE3 A;  1HKS A;  1U2W A;  2VN2 A;  3DV8 A;  2HYF A;  4HAM A;  5E8G A;  3QAH A;  2STW A;  2GQQ A;  4A5M A;  4HZF A;  2NYX A;  2E1C A;  4KIB A;  3CO7 C;  4LJZ F;  4ENM A;  4Q47 A;  5ERI A;  2Q2E A;  2R3S A;  1KYW A;  4ESB A;  3TDZ C;  4JK1 X;  2Z99 A;  5FGM A;  1LDK B;  2MD5 A;  2X4H A;  4HQE A;  1S8N A;  2FE3 A;  3E5X A;  1ON1 A;  2QQB A;  3ZPL A;  2O3F A;  3ZP5 A;  3CDH A;  3H92 A;  2LF8 A;  3DEU A;  5E1Z B;  4ASN A;  4NQW A;  2Z33 A;  4Q5S F;  2VOD A;  3E5Q A;  3HOT A;  1I27 A;  1REP C;  1TNT A;  1BI0 A;  4CXF A;  4IRG A;  3LAP A;  1KA8 A;  3ISP A;  3R60 A;  2YSR A;  2H94 A;  3WGH A;  1D5V A;  1EH7 A;  1FBQ A;  4P9F A;  4I02 A;  4BYY A;  3ZMZ A;  4YFN F;  1LJ9 A;  1QBJ A;  1J2X A;  3BPX A;  4O3M A;  2ETH A;  6PAX A;  1T39 A;  1MKM A;  2FSW A;  5D4R A;  4WF2 A;  5CVJ A;  2DFI A;  1DDN A;  2K7L A;  2ZO4 A;  3CO6 C;  2QBY A;  1FSH A;  1GXP A;  2XVC A;  2IRF G;  2M30 A;  2W85 A;  1NHA A;  4N9I A;  2P5V A;  3ECH A;  3RYR A;  2V6C A;  5HS9 A;  1AWC A;  3FM5 A;  5DCF A;  5HS7 A;  3M9A A;  4WX9 A;  1IXS B;  3JW4 A;  2PLY A;  5CVU A;  5H6R A;  2HQR A;  3SZP A;  3BWG A;  2BV6 A;  4ZYD A;  4EV0 A;  5D5U B;  4IVN A;  2QLZ A;  1E17 A;  1B6A A;  5HVQ C;  2BYV E;  3VFZ A;  2EWN A;  5J8C A;  3IL2 A;  2DQL A;  4ZH4 F;  3FXU A;  1IN6 A;  2VC0 A;  5ICC A;  1KYZ A;  5J6X A;  3QU3 A;  2DTR A;  2EB7 A;  1XGO A;  4PDK A;  2G9W A;  2MH2 A;  2ACJ A;  3WGG A;  4UVB A;  3J81 Z;  2FMY A;  2EFW A;  3CUO A;  3F72 A;  1PP8 F;  1SAX A;  3G73 A;  2O8X A;  3GUD A;  4HX8 A;  1T0F A;  1QPM A;  3GFJ A;  4EJV A;  2UXN A;  1R5H A;  1RIO H;  1XCB A;  2ZFW A;  4ETS A;  4HDU A;  3M8F A;  4K2E A;  3VOE A;  2PMH A;  1WI9 A;  3EDP A;  5F64 A;  3E3V A;  3C3W A;  1HW2 A;  4HW0 A;  1IF1 A;  2YR2 A;  4UV9 A;  4HLY A;  3NQO A;  2LKP A;  4LB6 B;  4EJW A;  5D5V B;  3QP5 A;  2V1X A;  1Z1D A;  2F5D A;  1ZRC A;  3RKY A;  5EEG A;  3WTZ A;  3BY6 A;  2WWY A;  2L4M A;  2DAO A;  4OMZ A;  2QQ9 A;  1TQI A;  2FML A;  3V7C A;  4AIK A;  4MNU A;  4DNC A;  1O3S A;  1RUN A;  1Z6R A;  3I71 A;  2RN7 A;  3MWM A;  1SMY F;  1CF7 A;  3K0L A;  4DQ2 A;  1DUX C;  2QWW A;  1B4A A;  5BQT A;  3T1B A;  2CWE A;  3HHH A;  2R7D A;  4XRF A;  1IN4 A;  2L4A A;  2XHK A;  3GLX A;  2MLG A;  5CYV A;  4EMS A;  4CHU A;  5IT9 Z;  2OD5 A;  3O3K A;  2PQ8 A;  5KVR A;  5BMZ A;  3LWF A;  1OPC A;  5AON A;  1OYI A;  5TJJ A;  1ZYR F;  2XAG A;  3ECO A;  3IRQ A;  4RGS A;  1JXS A;  5ILU A;  2KIU A;  2HFH A;  1XMA A;  4RB2 C;  1J5Y A;  5ICE A;  3FMR A;  4RGU A;  5HLI A;  2E7W A;  4IF4 A;  5CVR A;  3ML6 A;  1BOA A;  5L3E A;  4BH9 A;  3WTV C;  1XD7 A;  1Y0U A;  3K9T A;  1ZAO A;  1J7K A;  4JBA A;  4G7Z F;  2L01 A;  3VB2 A;  1FC3 A;  3F22 A;  4E70 A;  4AWX B;  3ELK A;  1BI3 A;  4EJU A;  2ESH A;  1XB4 A;  3NEU A;  1B1B A;  1XCV A;  3E97 A;  4IPA A;  2JPB A;  1ZLJ A;  2EFP A;  3F8F A;  3BRO A;  4A12 A;  2Z5U A;  4HX4 A;  2C6Y A;  3BDD A;  3K69 A;  4UXN A;  3TKY A;  2RKH A;  4GCV A;  2V1U A;  4NB5 A;  5DCM B;  1P4W A;  1SMT A;  4WK8 F;  4HA8 A;  3O6B B;  2DPU A;  4ON0 A;  1G4D A;  5DD4 A;  4GO1 A;  3V4G A;  5LGT A;  2LSO A;  4R1H A;  3WTU C;  3L9F A;  1SD5 A;  1YS6 A;  1W7P D;  1Z6T A;  2EFN A;  1ZLK A;  4OIR F;  1Z7U A;  2CGP A;  1UB9 A;  1T38 A;  3J80 Z;  3RDI A;  1S6L A;  3N4M A;  1HXD A;  2OAZ A;  3KE2 A;  3WTY C;  4GGG A;  1IAW A;  3HUG A;  1ZG3 A;  3SZT A;  2MC3 A;  3WE2 A;  2AXL A;  1YIO A;  1HST A;  3U2R A;  1KU3 A;  1W7P A;  1E2X A;  2PI0 A;  2RNJ A;  3E5U A;  2ELH A;  4G6Q A;  4XSZ F;  3GW2 A;  3EET A;  2K27 A;  3JAM K;  1FSE A;  2F5C A;  1YYV A;  2COM A;  3I64 A;  3I4P A;  3ZMD A;  4I7H A;  5FD5 A;  4L0Y B;  1G3W A;  1R22 A;  2IVM A;  4A5N A;  3QPT A;  3TO9 A;  3ZMU A;  4KN4 X;  5JR3 A;  2BE5 F;  5CLS A;  1IRG A;  5FLX K;  3MZH A;  3ZQ7 A;  1UHW A;  3HRT A;  4EM2 A;  1BM9 A;  2CYY A;  2YX7 A;  2OA4 A;  4P55 A;  2HGC A;  5ILV A;  1FX7 A;  3KEQ A;  5E1X A;  2P5L C;  3KP3 A;  4H0E A;  4YG2 F;  1BI1 A;  4GYG A;  1S7A A;  4ESF A;  3FF5 A;  3RI4 A;  3WG9 A;  4GYI A;  4BHP A;  2A6H F;  3R6S A;  1EV7 A;  3GX4 X;  4KMF A;  3IKT A;  2F2E A;  2FOK A;  4R8H A;  3WU0 A;  3P9I A;  4UVC A;  4KFC A;  5AIQ A;  3BJ6 A;  1SFX A;  3TGN A;  4Y13 A;  1U3E M;  1YG2 A;  2HDC A;  3CTA A;  5BPI A;  4KIF A;  1KU7 A;  4L18 B;  5JI6 A;  2IPQ X;  3DKW A;  4HQM A;  1U5T C;  5KK1 A;  2LNB A;  1ZAR A;  5CVV A;  2EV0 A;  3K2Z A;  2A07 F;  4M6Y A;  3PFI A;  2OZ6 A;  4RB3 C;  4IRH A;  3REO A;  2BBY A;  2EV6 A;  1ZRF A;  3T8R A;  3TQN A;  4CO8 A;  4LFU A;  1XGN A;  1BJA A;  1W4M A;  2EK5 A;  3M7G A;  2O0Y A;  3JSP A;  2P7V B;  4R79 A;  3F6V A;  3L7W A;  4LG0 A;  3HTU A;  2XAH A;  2KJC A;  1TTY A;  5D8L B;  5LEK A;  2O6G E;  1BC8 C;  4MTD A;  1U78 A;  2FEZ A;  2RVC A;  3C1D A;  3WTW C;  1CGP A;  3MEX A;  1LVA A;  5LRR A;  2Z3Y A;  3E6C C;  1WWX A;  3Q9V A;  4Z2Y A;  4L9V A;  5D4S A;  5J8F A;  4WWC A;  4I98 B;  3BZ6 A;  3F8C A;  1Z05 A;  4MQV A;  3KCC A;  4HV6 A;  2W57 A;  4M9S A;  1FBU A;  2FBK A;  5E17 F;  5H6Q A;  4OIQ F;  2L54 A;  3COA C;  2O03 A;  1X3U A;  3ABT A;  5ICG A;  3LA7 A;  3LA3 A;  1I1S A;  3F8M A;  1VTN C;  4O6J A;  5LEJ A;  2VBX A;  5H20 A;  2IA0 A;  1TNS A;  4OU0 A;  2DI3 A;  5DCM A;  1MJ9 A;  3HOS A;  3P9K A;  4L9J A;  2GXG A;  3GYH X;  5DUK A;  1IZ1 A;  4UHT A;  3S2W A;  1TW3 A;  3D5L A;  3LQR A;  4G9Y A;  3KLO A;  2P7C B;  3FM3 A;  3GVA A;  5LLQ A;  1KU9 A;  3KET A;  1WRJ A;  2XV4 S;  4M9Z A;  2XGX A;  3QPH A;  1FWZ A;  1S3J A;  4PCQ A;  5HDK A;  2EV5 A;  3BPV A;  4LLL A;  3GWZ A;  2J5P A;  1MJA A;  5JVT A;  1V3F A;  2UXX A;  5L3C A;  2PEX A;  3OOP A;  3NRV A;  3FMQ A;  2ZNY A;  2H27 A;  4HX7 A;  1XDU A;  2GA1 A;  5ILS A;  4L0Z B;  4BNC A;  2PMU A;  3BOQ A;  3IHU A;  4KNY A;  2G7H A;  5F1R A;  2DT5 A;  1P2F A;  4PGG A;  2XIG A;  4KDP A;  1H0M A;  4OIP F;  1O7F A;  1MGT A;  1L0O C;  4CIC A;  3BJO A;  1YW7 A;  4I0A A;  4PZJ A;  2ZBK A;  4ENJ A;  1XGS A;  2EFQ A;  3B73 A;  4HF1 A;  4Y17 A;  1R58 A;  3WTS C;  2MH9 A;  5LBQ A;  4MEX F;  2P8T A;  1F1Z A;  4ZYG A;  2BGC A;  2ZME A;  2QVO A;  4P5O A;  5JFR A;  3TO7 A;  3FHZ A;  3F21 A;  5HLG A;  4ZZL A;  1PUE E;  2K4J A;  4UNO A;  2Y48 A;  1FT9 A;  2IW5 A;  5E1W A;  3LST A;  2BEO A;  4OIN F;  2W25 A;  4ZYE A;  3IWF A;  1R23 A;  3JTG A;  4IHS A;  5FO5 A;  1IRF A;  2WC2 A;  1B9N A;  2P6S A;  3B02 A;  2PG4 A;  4CYD A;  2H09 A;  5FD6 A;  1HW5 A;  3V7R A;  3O2P E;  1IUY A;  1QZY A;  3I53 A;  4Q48 A;  1UHM A;  5DUI A;  1B59 A;  1DPU A;  1K78 A;  1JGS A;  4S04 A;  1KU2 A;  1F4K A;  4MHG A;  5DV5 A;  3SQN A;  2ADU A;  3CUQ C;  3ROU A;  3I54 A;  1EH6 A;  1UFM A;  2JZY A;  1KQ0 A;  5LGN A;  4B8X A;  4RB1 A;  4HBL A;  1H9T A;  3I59 B;  4HV5 A;  1MJB A;  2VOP A;  1D3Y A;  1DPR A;  2E1N A;  3KEO A;  3E6B A;  3HSR A;  3V8K A;  4WCG A;  3R4K A;  1LDD A;  4AVP A;  3U1D A;  4FHT A;  1ZN2 A;  2P5K A;  2VBY A;  1YQA A;  2XAQ A;  3HIF A;  3DPT A;  1JE8 A;  1MDM B;  2FF4 A;  4MTE A;  3R61 A;  5E20 A;  1ODD A;  1V4R A;  4LGW A;  2IJL A;  2XKO A;  1ZGA A;  3CUQ B;  1ZRD A;  3EQL F;  4A6E A;  3ZMS A;  3WTX C;  1HKQ A;  2HTJ A;  2IP2 A;  1ZHF A;  1FOK A;  3D0S A;  3HRU A;  3M8E A;  4U7D A;  2D1H A;  2PBI A;  2FQ3 A;  4OOI A;  2DK8 A;  2FNP A;  2V79 A;  4LB5 A;  1T2K A;  4O5V A;  4XLN F;  1G3S A;  2M1B A;  2DBB A;  5AIP A;  2MLK A;  5IT3 A;  2OQR A;  3SXY A;  2OQG A;  2A68 F;  1SD7 A;  4P9U A;  3MQ0 A;  5L3F A;  1UST A;  4YII A;  2Q8K A;  1F9N A;  3PQK A;  2XKP A;  2AS5 F;  4BHB A;  2IT0 A;  5K5Q A;  1L3L A;  3R0A A;  2FXA A;  3V7S A;  1TBX A;  2STT A;  3I58 A;  4HLX A;  4A0X A;  2A5Y B;  3FMS A;  3KLN A;  1T98 A;  4ZYH A;  1RNL A;  3E6D A;  1P4X A;  2FBI A;  3GFM A;  1HSJ A;  4A2U A;  2H6B A;  3RKW A;  2DO7 A;  2YPR A;  2A61 A;  1S7O A;  3HSE A;  2RC4 A;  2YU3 A;  4U0Y A;  4IRI A;  3U9G A;  2KIF A;  5L3G A;  2A69 F;  1JHF A;  3DF8 A;  2VOO A;  5L3D A;  1BI2 A;  3GF2 A;  4AIJ A;  3K1M A;  2VBZ A;  4I09 A;  1FYK A;  5K5R A;  4ENN A;  4I2O A;  3QU6 A;  2QYO A;  2UZK A;  2CSO A;  2HYG D;  2M5W A;  1O3R A;  3DXJ F;  1Z91 A;  3Q9S A;  3TDU C;  1ZG1 A;  1C0W A;  3F6O A;  1O7L A;  1XGM A;  4QLC U;  3JAM Z;  2FA5 A;  1PDN C;  5E18 F;  2ISY A;  3FZV A;  4FX4 A;  2ZNZ A;  2Y0M A;  4LLG F;  1R00 A;  1P92 A;  3EUH A;  1W5S A;  3G3Z A;  2XAJ A;  4EJO A;  1P4A A;  5FLX Z;  4KT5 C;  3GEZ A;  2GZW A;  4YIF A;  5A2Q K;  5LHH A;  1BBY A;  1BIB A;  2FNA A;  1I1G A;  3W6K B;  2D45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...