4AIJA

Crystal structure of rova from yersinia in complex with a rova promoter fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aijA00
4HX7A 5DCFA 1XGOA 1OPCA 5DYMA 4ENNA 2OZUA 4KUMA 4MNUA 3L2CA 4CXFA 1O57A 4RGUA 4LB6B 5ICGA 2P8TA 3I0TA 1TW2A 4ZZDA 1FBQA 1IN5A 2GAUA 1ZGJA 5FD5A 4PDKA 2RGVA 4KMFA 2STWA 3CO6C 1TLHB 4I01A 2DPDA 3NQOA 3ROUA 5KK1A 1BIAA 4DNCA 1KQ8A 2ZBKA 3H92A 2FQ3A 3TGNA 2YX4A 3ZPLA 2ETHA 1ZREA 3QPHA 3WGIA 5HLHA 5TJJA 3P9CA 4Q47A 1R58A 2PEXA 3M9AA 1I1SA 4KN7X 4P96A 2WC2A 2CQKA 2HQNA 3I71A 4WXDA 2VBZA 2IA0A 2PN6A 3F6VA 1IF1A 3REOA 3L09A 3TOBA 3Q9SA 2RQPA 3MWMA 5TRDA 4HA8A 2EFWA 4LMYA 2H27A 1ODDA 3KP2A 2YR2A 4RB1A 4EJVA 2P5LC 5JI6A 3IHUA 1ZG1A 5DUIA 3BY6A 4WXCA 3WTZA 3E5QA 4R1HA 4TV7A 2FEZA 3LQRA 3E6MA 1QO0D 3E5XA 1QZYA 4Y13A 4IRIA 1OYYA 2HYFA 4F7ZA 4EJWA 3KZYA 1W4MA 2H6BA 5ERIA 4HDVA 3ZMUA 1W7PB 2ZFWA 5H6RA 3E3VA 3ZQ7A 1FYMA 5DEQA 1XCBA 1IW7F 3C1DA 3K69A 4ZYDA 2UZKA 3CUQA 2OBPA 1XCVA 2DK5A 1BOAA 4IRHA 2JTVA 4L5IA 1FYKA 2FF4A 3ZMTA 1U2WA 1WWXA 4P5OA 5AONA 3VOEA 4M9SA 3DXJF 2L01A 5D4SA 5K5OA 4U88A 2D1VA 1A04A 1MD0A 3U1DA 4UV8A 2A6HF 1W7PA 1BM9A 2DBBA 4UUVA 1ZG3A 2L4AA 5LGTA 1P4WA 3WTVC 2LSOA 1XGNA 3GF2A 2FNAA 4KT5C 1GXQA 2A07F 1I1GA 2F5FA 5DD4A 3ERED 2DTRA 4HF2A 2F5EA 3SZTA 2IRFG 2XAQA 3KP4A 3SHFA 3VFZA 5LHHA 4UVBA 4RGRA 4ESJA 1FSEA 5DUKA 4A0YA 1LDDA 3QU6A 1S3JA 4KFCA 3HSFA 5IT3A 2ADUA 4XLNF 3GZ6A 2OD5A 1ZLJA 2KIMA 1ZARA 5BMZA 2D45A 1WSUA 1BI2A 5H6QA 4LFUA 4B09A 2V1XA 2XV4S 4IVNA 4A5NA 2QVOA 1L0OC 3M8EA 3WTWC 2NS0A 3RYRA 2X4HA 3KP5A 2JSCA 2RNJA 4YIFA 3EYIA 1XSXA 1I5ZA 2IT0A 3FZVA 1KU2A 4MTEA 2VOPA 3MZYA 1HQCA 3GX4X 1FPQA 2VONA 3CJNA 1PDNC 1DDNA 4IPAA 4HW0A 4WWCA 1IAWA 3N97A 1K79A 5CLSA 3I54A 3V8JA 2K02A 1SFEA 1U5TB 1F9NA 5CVVA 2A61A 1YFHA 1C0WA 3TDZC 3CO7C 2Q0OA 4ENKA 3DFGA 4JQFA 5BPIA 4BAYA 3IL2A 5E1XA 4KIBA 1TNTA 2M5WA 4MQVA 4G7HF 3HHGA 4PGHA 2Y0MA 4ZYEA 2EFPA 3J7AO 5AIQA 3LAJA 4U0YA 2XKPA 3ELKA 3F8MA 3WU0A 1HSJA 2Z3YA 4N9IA 1MGTA 3H3ZA 4KN4X 1R1TA 4E70A 3IKTA 3FMQA 2Z9OA 1DUXC 2HGCA 1R7JA 1S7AA 4OMYA 2QWWA 3BOQA 2G9WA 6PAXA 3S2WA 2RC4A 4AVPA 3EDPA 2K4BA 2EWNA 1W5TA 1HW2A 3T8RA 3HSRA 3E6CC 4ENMA 2PFBA 2PBIA 1YTYA 1K7AA 4MHGA 4OIOF 1BJAA 3D0SA 2FMLA 2VOOA 3FWEA 3R4KA 2O61A 1IRFA 2BEOA 5ILSA 2B0LA 4HDUA 2QM3A 3COAC 3E5UA 2OQGA 1FX7A 1FZPB 2D1HA 2FXAA 4U0WA 2DU9A 5J6XA 2JZYA 3P9IA 4EJTA 5E20A 3J81K 3R0AA 1XN7A 2KIFA 1MJBA 5L3DA 1O3QA 1RNLA 1Z05A 3JAMZ 3U2RA 3FXUA 1SFXA 2GXBA 5LEKA 2K4JA 4ZH4F 5D5VB 1PP7U 4D0PA 1MDMB 5ICCA 2QQBA 3GZ5A 2YU3A 4RGSA 3GFLA 3E97A 4DQ2A 2HFHA 2GA2A 2IA2A 1LDJA 3E6BA 4ZZLA 5K1YA 3KP3A 1V3FA 2ZNZA 2W25A 3F8BA 5H20A 1PUEE 1O7LA 4U7DA 3D5LA 3HTSB 4WXHA 5FGMA 1IRGA 3F8FA 4QLCU 3G3ZA 2O03A 1YS7A 4IHSA 1S7OA 5JR3A 2KJCA 2ZMEB 1USTA 1CF7B 4HV5A 1VTNC 1MDMA 3IKVA 5E8GA 4NQWA 3JTHA 3TO7A 3R60A 1KYWA 3CUOA 3M1EA 1XGMA 1DP7P 4A6EA 2RKHA 4RB2C 2DLLA 5K5QA 1H0MA 1J0RA 3LQQA 1ZN2A 2ISZA 2R7FA 2XROA 4M71A 2XAGA 4EV0A 1FBSA 1NHAA 3GXOA 2J5PA 2A6EF 4RAZA 4O5VA 1XDSA 3ML6A 5JFRA 2CG4A 3WE2A 1TTYA 3TO6A 5D4RA 4N0BA 2NYXA 2HDCA 2YSRA 2V1DA 4HBLA 3WTUC 3GWZA 1FOKA 2FOKA 1Z9CA 1R22A 2OU2A 1IUYA 2AXLA 4LB5A 2LF7A 3ECHA 1YW7A 3IC7A 3FM3A 4H0EA 4G7OF 5LGNA 2MC3A 5IT9Z 3RIRA 1R00A 2L54A 1SD7A 3I4PA 4LLNA 2RVCA 4HF1A 1ON2A 3FHZA 5L3EA 3L00A 4LD5A 3TOAA 1FT9A 2H94A 4NHJA 1F4KA 1BI1A 3RKWA 2HEOA 1OKRA 1Z7UA 2WTEA 1HW1A 3WTYC 2HYGD 1HSTA 4UXNA 3ZP5A 3HTUA 2ACJA 1ZAOA 4A0XA 4GYIA 5F64A 4HLXA 5AIPA 2P7CB 5D5XB 2Q8KA 3V4GA 2VT3A 2EA4A 3CUQB 1ZYRF 1HXDA 3T0YA 4XSZF 3DEUA 3TDUC 2PJPA 2GXGA 4GCVA 3GFIA 5D6EA 5LRRA 2XIGA 3O2PE 3T5XA 4BH9A 5LLQA 3KEQA 2EFOA 3WU1B 1REPC 3GEZA 2RDPA 4B8XA 3GUDA 3IRQA 3C7JA 4G9YA 4HQEA 4BHCA 1J7KA 4RGXA 3WGGA 3GLXA 5DDGA 3RI4A 4AIKA 3VB2A 3ZN1A 1ZRCA 1BC8C 2XAHA 2FA5A 2HKOA 3ABUA 4LLLA 3I59B 3F8CA 4M6YA 5ICEA 4N9HA 2JT1A 2OQRA 3BPXA 2JPCA 4BYYA 3F23A 3V8KA 1B6AA 1UCRA 3CTAA 1B9NA 2F5CA 1W7PD 3K9TA 3CLOA 3PQJA 2C6YA 3HYIA 4OIQF 2D2WA 1H9GA 2DAOA 3HRSA 5JVTA 3KP6A 2IA1A 2P5VA 3F3XA 4LK0F 3QP5A 4LG0A 2W85A 1XGSA 4L9TA 2FE3A 2FU4A 3F8NA 1LJ9A 4CO8A 4R8HA 1MJ9A 5J8CA 5ICFA 2W57A 1SD6A 1G3YA 2P7VB 1OYWA 4G8XA 3I59A 2FBHA 3MAJA 2VODA 4AWXB 4HZFA 5D6FA 2TDXA 3I64A 5HS9A 2KIUA 4U7BA 1MJAA 2Z5UA 4CZZA 2OA4A 3B73A 4JK1X 1G6NA 2KRFA 3DF8A 3IWZA 3P9KA 1FNNA 2P6SA 2PLYA 3L7WA 1T0FA 3KEOA 4XSXF 2HS5A 1D5VA 2DW4A 1LEBA 5E18F 2CSOA 3BJ6A 3ISPA 4S04A 3J80Z 1H9TA 4A12A 4MGRA 3T1BA 3IRRA 1FLIA 2E7XA 1KYZA 1R1VA 4EJUA 5D5UB 1E17A 3QPTA 1I6XA 2HZTA 4MEYF 1FBUA 4MTDA 2H09A 1G4DA 3GFJA 1FYLA 4Q48A 2O8XA 1L3LA 2M45A 1P92A 2L02A 1FY7A 5FD6A 2QQAA 2GWRA 4HX4A 4HLYA 1HKSA 2EV0A 3ZMZA 1KU9A 3KLOA 3HRMA 3FMSA 2LNBA 4BQAA 5A2QZ 3KETA 2L3DA 3I53A 1J2XA 1XDUA 5D5WB 2O3FA 1Z91A 4EJOA 2GIVA 1MKMA 2XAJA 2H6CA 3SQNA 3NEUA 3MCZA 2P6TA 3OV8A 2ZO4A 1ZRDA 2ESNA 1KA8A 2ZJ2A 1MZBA 2LF8A 4Y17A 5BS6A 3K0LA 4PZJA 4G7ZF 1JE8A 1W5SA 3F22A 2K86A 4I98B 5L3GA 4HF0A 1JXSA 1V4RA 2PMHA 3K1MA 3BPVA 5DD8A 1SD5A 1P4XA 2MD5A 2YPRA 2VE8A 1YS6A 5ED4A 2PMUA 4CDGA 1T6SA 2DT5A 1YQAA 3C3WA 1B1BA 1YO5C 2QUFA 5HS8A 1ZG5A 5E8IA 3WG9A 2ZNYA 4OIRF 2IJLA 4RB0A 3K1NA 2MLKA 1YW9A 3AAFA 2NAZA 2LKPA 3HHHA 1GHCA 3EETA 2VT2A 2XHKA 3SZPA 2J5OA 4UVCA 2Z33A 3QRFF 2IP2A 1ZGAA 5L3CA 2EB7A 2Q2EA 4HX8A 4IF4A 1JHFA 3F72A 4G94A 2VBYA 2FRHA 2G7HA 3WGHA 1FSHA 3RKXA 2PI0A 5LGUA 5HDGA 2DFIA 3CUQC 5ILVA 1R5GA 1SD4A 2FBIA 1QQIA 2OAZA 3HIFA 1TNSA 1O7FA 5HLIA 2HQRA 5BPDA 2UXXA 4KA4A 2O0YA 4WK8F 3K2ZA 4IHTA 3BP8A 4HAMA 3ECOA 5LHGA 1FP1D 1S6LA 3MFKA 5FLXZ 2VBWA 4LJZF 1G3TA 5E1WA 4CHUA 4IJAA 1U8RA 4P55A 1LEAA 1J59A 3WTTC 4RAYA 1X3UA 3GO5A 2XASA 2DQRA 1USSA 2K27A 1WRJA 3ZMVA 1ULYA 4UVAA 4I0AA 2EFNA 4NB5A 2QBYA 1D8KA 2MBFA 5EEGA 2QZ8A 3V7CA 1J5YA 2V9VA 4YFKF 3GVAA 2FBKA 4P9UA 3ULQB 4FX0A 3O6BB 3FXQA 4G6DA 2VN2A 2E7WA 3EYYA 4M72A 2NNYA 4OU0A 4ENJA 3K1PA 3KCCA 2L4MA 1HW5A 3B02A 3WTSC 1O3SA 4L9NA 1CGPA 3WTXC 2QQ9A 4EM2A 1B4AA 1BC7C 3TKYA 3PQKA 1TQMA 4YIIA 5D8LB 5FO5A 3I58A 1TW3A 3HSEA 4YFNF 3JW4A 1QPMA 1XSDA 3HOSA 3JAMK 1B59A 4ETSA 2EFQA 1QNTA 3BZ6A 3JSPA 1Y0UA 2ZKZA 1UB9A 2DO7A 2XRNA 1G3WA 2BYVE 2YX7A 1OR7A 3F6OA 3KFWX 3F21A 4HV6A 1EH6A 5FB2A 3RTRA 4EGZA 2KKOA 4L0YB 5HDKA 1HBXG 1Z1DA 4P9FA 1GVJA 1BIBA 2DK8A 2E1NA 5D8KB 4KDPA 5F1RA 3DKWA 4EM1A 1J9IA 4A0ZA 4Q5SF 4L9JA 1QGPA 2GQQA 1UHMA 4FT8A 4L9VA 1RI7A 1IXSB 3C18A 1D8JA 1TQPA 4LGWA 1I27A 5F6FA 2K7LA 4I0BA 4LLGF 3LAPA 3CDHA 5LBQA 4OMZA 5KVRA 4S05A 5LHIA 1U5TC 3O3KA 1TQIA 4ON0A 1T39A 3RPUA 2VXZA 1XMKA 3RYPA 1ZLKA 5CVJA 2DI3A 3QP6A 1IN4A 1QBJA 2FMYA 3I5UA 3BJOA 3TQNA 2HTJA 1BI0A 5CVRA 3DP7A 1OYIA 1G3SA 2Z99A 3FM5A 1K78B 3BJAA 4XRFA 4LG0B 4IXAA 1EH7A 2NNNA 3L9FA 5EEHA 4Y15A 2JRTA 2ELHA 3BDDA 2QENA 4GGGA 4A6DA 2IW5A 1B9MA 1T2KA 3DQVC 3WODF 5FFZA 3T8TA 2BBYA 3HRTA 1KGSA 5IT9K 1Z6TA 1LVAA 1XB4A 2JPBA 3JSOA 3HUGA 3R61A 2F5DA 1YYVA 4M9ZA 3MEXA 1U78A 4CYDA 2M8EA 3PFIA 4ASNA 1U6GA 4ZYHA 3DPLC 1R36A 1GXPA 3ZMDA 4GXOA 4ZYGA 1BN5A 5CYVA 1ZH5A 2KJBA 3MZHA 2BV6A 1QZZA 2EJRA 1S29A 1K78A 2P5KA 1SMTA 4BHBA 2F2EA 2M87A 3SFZA 4YFXF 1SMYF 3QOPA 4O3MA 5BOXA 4XLPF 1DPUA 1YG2A 4U0VA 2EV6A 2EK5A 1E2XA 1ZHFA 1S8NA 2CGPA 1OMIA 4WCGA 1KU3A 3R0JA 4I09A 1YIOA 2R3SA 2EV5A 4I02A 1Z6RA 3H3UA 1FP2A 4I2OA 3TO9A 1U3EM 4EQQA 1IN7A 1SFUA 1R1UA 4PGGA 4M73A 3IWFA 3Q5FA 2RN7A 3HOTA 1TBXA 4BXUA 1T38A 4KIGA 1WKMA 2VC1A 1FC3A 2GZWA 4CICA 3VODA 4OIPF 2BE5F 1STZA 2PG4A 4EVIA 1SAXA 4IRGA 5HVQC 1K6OA 2HKXA 3V7RA 4Q4ZF 2VC0A 4OOIA 2CO5A 4L5JA 1F5TA 3W6KB 1P2FA 1IN6A 5JHUA 4YG2F 4K2EA 3P7NA 2O6GE 2A68F 5DCMB 4M9XA 3OOPA 2CFXA 1BBYA 2COMA 2M1BA 1LB2A 3U9GA 4Z2YA 2P4WA 5L3FA 3NRVA 4EGYA 3GYHX 4WX9A 3J81Z 1LDKB 2MLGA 2CYYA 2AS5F 3EQLF 3GFMA 2WWYA 4HYEA 2A69F 1PP8F 2ZCWA 3KLNA 1O3TA 5J8FA 1RZ4A 4R79A 4I7HA 4WF2A 2MH9A 3RPQA 2XVCA 3ABTA 1IXRC 4BNCA 1HKTA 4L18B 1XSVA 4KIFA 5BQTA 2QYOA 3J80K 5DCMA 3V7SA 2EA2A 3VEPA 4BHPA 5CVIA 1WQ2A 2HWVA 5LRSA 1KQ0A 1P4AA 3KZZA 4KNYA 2OZ6A 3LA3A 1U5TA 2ZXJA 1R23A 1RIOH 5HS7A 3W6JB 3FXRA 3BROA 3WE3A 2VBXA 2W84A 2NRAC 3R6SA 2MA3A 2FSWA 4RB3C 4KMUX 2UXNA 3ZMSA 3DV8A 2GA1A 2M30A 4M6XA 2UWMA 1RUNA 4GO1A 2BGCA 3BWGA 1J75A 1JGSA 1Q1HA 3HRUA 5A2QK 2DPUA 4MEXF 2IVMA 5HLGA 2VE9A 2QBYB 2XKOA 2STTA 1LQ1A 1UHWA 4OINF 4A5MA 4FHTA 1UFMA 4KYWA 1AWCA 3N4MA 2FNPA 2DQLA 2MH2A 4QWQA 3FX3A 1FWZA 2CW0F 5E17F 1IZ1A 3RJPA 3LA7A 2HOEA 2CWEA 2Y48A 1AOYA 5L3BA 1XD7A 3KE2A 1KU7A 3E6DA 2WV0A 5LEJA 4O6JA 3M8FA 3JTGA 2LDUA 2E1CA 3V8LA 4ESBA 3Q9VA 3LWFA 2RV8A 1EH8A 4EM0B 2A5YB 2ESHA 3DPTA 2XGXA 1R5HA 4JBAA 3QAHA 2G7UA 2XAFA 1KQ9A 4M74A 1HKQA 2HR3A 5CJ9A 5E1ZB 2W24A 2PQ8A 5DV5A 5FFXA 2A3SA 2ISYA 3KP7A 5HOOA 1ONVA 4A2UA 3GW2A 2V1UA 4GYGA 4AD9A 3RKYA 5ILUA 4PCQA 1T98A 1D3YA 4MQ9F 3SXYA 1ON1A 4L0ZB 4LK1F 2V79A 4RS8A 1WI9A 3G73A 5HDNA 3M7GA 4AIJA 4HOBA 4UV9A 1IN8A 3LFKA 1BI3A 1JHHA 4AIHA 4ESFA 1F1ZA 4HQMA 4XBFA 1DPRA 2R7DA 3FMRA 2Y75A 4G6QA 2HTSA 3ZN0A 2IPQX 1XMAA 2V6CA 3EUHA 1IXCA 4KICA 4CGZA 3LA2A 2QLZA 1ZRFA 1YW8A 1RUOA 3LSTA 5CVUA 4UNOA 3QU3A 3MQ0A 1P6RA 1LNWA 5FLXK 4EMSA 3RDIA 5K5RA 1YLFA 2XUBA 4UHTA 1O3RA 2ZMEA 1EV7A 1CF7A 2X0LA 3FF5A 4FX4A
chains in the Genus database with same CATH superfamily
5B1AH 4X6AJ 2R7OA 3HXLA 2YUSA 2ZJPF 3OYLA 3O8GA 4HX7A 2K5CA 3ONQA 5DCFA 1XGOA 1D1BA 2HQAA 1OPCA 5DYMA 1JKOC 1LKXA 1MMNA 2LYCA 4ENNA 2OZUA 2ZXHA 4KUMA 4CUGA 2KMUA 4MNUA 4RA2A 2EINH 5B66C 3L2CA 4CXFA 1YJNI 1O57A 2M0MA 5F1JA 3CCEI 4RGUA 2VJ4A 4LB6B 3RCOA 5ICGA 2P8TA 3I0TA 1TW2A 2K9QA 3HOVJ 1TWFJ 1FBQA 4ZZDA 3VSKA 1IN5A 3A2KA 2GAUA 2L7FP 1ZGJA 5FD5A 2M34A 1IV8A 2DA6A 3OYAA 4PDKA 3J7AY 2RGVA 1FTTA 1SC7A 4KMFA 2STWA 2V1NA 3IUOA 4FCYA 3CO6C 3H0DA 5EDNA 3RPUD 1TLHB 4I01A 4B1RA 4A3DJ 2DPDA 3NQOA 3ROUA 5KK1A 2KZVA 3CZ6A 1BIAA 4DNCA 4DYQA 1KQ8A 2ZBKA 3H92A 1Z77A 2FQ3A 3TGNA 2YX4A 3ZPLA 4XNFA 2ETHA 1R5ID 1ZREA 4OAYA 3QPHA 3WGIA 4DBQA 5HLHA 5TJJA 3P9CA 1IRGA 2LTPA 2XSDC 1X3ZB 2LLKA 4Q47A 1R58A 3OIQA 2PEXA 4I99C 3M9AA 1I1SA 4KN7X 4P96A 2WC2A 5GPAA 2CQKA 2R5YB 2HQNA 4AM3A 1JUPA 4PFPA 3I71A 4WXDA 2VBZA 2IA0A 2PN6A 3F6VA 2OCCH 1IF1A 2ZXWH 3REOA 2CV2A 3L09A 3TOBA 3Q9SA 2RQPA 3MWMA 5TRDA 4HA8A 2EFWA 4MFDA 4LMYA 2H27A 1OCRH 1ODDA 3KP2A 1IUFA 4CSWA 1AA7A 1BW5A 2YR2A 4RB1A 1S72I 4EJVA 2P5LC 5JI6A 3IHUA 3RZDJ 1ZG1A 2ZXIA 3VDXA 5DUIA 3BY6A 4WXCA 1UMQA 3E5QA 4R1HA 4TV7A 3WTZA 4LG3A 2FEZA 3LQRA 1ERDA 2ME0A 2MG4A 3E6MA 1QO0D 3PIOF 1AKHB 3E5XA 3L2WA 1QZYA 4Y13A 4IRIA 1OYYA 2HYFA 2BW3B 2OUMA 2YS9A 3A02A 4F7ZA 4EJWA 3KZYA 4BQNA 3LSMA 4MIMA 3JCUC 1W4MA 3TW6A 2LD5A 2H6BA 2DFFA 3OS0A 5ERIA 4HDVA 3S1MJ 3ZMUA 1W7PB 2ZFWA 5H6RA 1CQTA 3E3VA 3ZQ7A 1FYMA 5DEQA 1XCBA 1WJEA 1IW7F 3C1DA 1HDDC 3K69A 4JOMA 4ZYDA 4AC0A 2UZKA 2O5RA 2CFOA 2E1MC 2K3PA 3CUQA 2R5YA 1K83J 2JUGA 1XCVA 2OBPA 3DU6A 3SYTA 2DK5A 2RREA 1BOAA 2FX0A 1E3OC 1EA3A 4IRHA 3SEQA 2JTVA 2IGKA 4L5IA 1FYKA 4BGDA 1Y56A 1VI0A 4NNJA 4BXFA 4FQGA 2FF4A 3ZMTA 1U2WA 1WWXA 2NS7A 4P5OA 2CUEA 2F5VA 2WBMA 5AONA 1BR1A 1P9QC 3VOEA 3ABMH 4M9SA 3DXJF 2L01A 3FK7A 2Y0SN 1MMSA 2V9PA 2F4MB 2MW8A 2BY2A 3BTCA 2E5NA 5D4SA 5JHFA 5K5OA 2O9LA 4U88A 3DKYA 1MIJA 2D1VA 1ZGWA 1A04A 1MD0A 4IOCF 3BTJA 3GTOJ 2L0KA 2BW3A 2ICWG 3U1DA 4UV8A 4II3A 4BUPA 4D5FA 4I6ZA 1EF4A 2A6HF 5DM6F 4B3AA 5IP7J 3PIPF 2CJJA 1W7PA 1BM9A 1YRNB 2DBBA 1ZTRA 2BVMA 4CCNA 2JQ7A 1JT6A 4UUVA 3S1RJ 5F0HA 2ME6A 1ZG3A 4RBOA 2L4AA 5LGTA 4C30A 3W2AA 3LSIA 4IHYA 2PMZA 1P4WA 3BG9A 3WTVC 1MNDA 4XRSG 2LSOA 1XGNA 3GF2A 3VWBA 3BG7A 1MSEC 3HBLA 4XONA 2FNAA 4KT5C 1GXQA 1QHGA 2QCOA 3WG7H 3OYHA 3G71I 1DU0A 2A07F 4CCKA 1I1GA 4XIDA 2F5FA 5DD4A 2JUCA 4Z6YA 3ERED 2BHZA 2DTRA 4HF2A 3L1PA 2F5EA 3SZTA 2EIJH 2IRFG 1G2HA 3PNVA 2XAQA 3OYCA 3KP4A 2M7BA 3SHFA 3G1OA 3VFZA 3CDIA 3MD2A 1SAUA 5LHHA 3TP3A 3DLAA 4NBQA 2HVRA 3H5NA 3L2UA 4UVBA 2EIMH 3UR3C 2A5WA 4RGRA 4ESJA 1FSEA 5DUKA 4A0YA 1LDDA 3QU6A 4XQFA 3H5AA 3NAUA 1S3JA 4KFCA 3HSFA 2MSYA 3ZQQA 5IT3A 1JKRC 1T56A 2ADUA 4XLNF 1GT0C 1VQNI 3M1CA 3WU2C 3GZ6A 1YRNA 2OD5A 1ZLJA 2KIMA 2JSPA 1ZARA 2LC2A 5DS9A 5BMZA 2D45A 5FKKA 4HRIA 1WSUA 4F92B 2UUZA 1BI2A 5H6QA 4LFUA 5K7ZA 4B09A 1OCZH 3AG1H 2V1XA 3I4NJ 2DMUA 2XV4S 3HB9A 4IVNA 4RM3A 5E79C 4A5NA 2QVOA 1L0OC 3M8EA 3WTWC 4C9YA 3JR9A 2NS0A 3RYRA 2X4HA 4RDUA 4BEHB 3KP5A 2JSCA 2OV7A 3RSNA 2RNJA 4YIFA 1ZR2A 2HU9A 4G12A 2LFBA 1FOWA 4S0HB 1XS9A 3EYIA 2PJRB 1XSXA 3MKLA 1I5ZA 2IT0A 3FZVA 3TBIA 2OTJI 4IO9F 1KU2A 1VQ4I 3ASNH 4MTEA 2VOPA 3MZYA 5LD2C 2BZTA 1HQCA 3GX4X 1POGA 3E7LA 4FISA 4E7HA 1FPQA 2QGUA 2VONA 3CJNA 1OR7C 1PDNC 1DDNA 4IPAA 4HW0A 4WWCA 1IAWA 2VJ5A 3N97A 1K79A 5CLSA 3I54A 3V8JA 3KIOA 2DMTA 2K02A 2EPFA 4BKXA 1SFEA 1U5TB 1F9NA 5CVVA 2A61A 3S1NJ 1YFHA 1C0WA 1Q1VA 3CMEI 2DA7A 1HLVA 3TDZC 1YI2I 3CO7C 2Q0OA 2KRHA 3GTQJ 4ENKA 3A03A 1JUSA 3VYTB 4DYCA 5FROA 3DFGA 2DOEA 2CMPA 2W4SA 3ERMA 4JQFA 1FMVA 5BPIA 3BLYA 4DJAA 4BACA 4BAYA 3IL2A 5E1XA 4KIBA 3OSFA 2PJRA 2HZDA 4IKFA 1TNTA 1JUMA 2M5WA 4MQVA 4G7HF 3HHGA 1BW6A 4PGHA 2Y0MA 4ZYEA 2EFPA 3J7AO 1Z21A 4XICA 5AIQA 3LAJA 4A3IJ 4U0YA 2XKPA 2LG4A 3ELKA 5C44J 2JWTA 3F8MA 3WU0A 4BDZA 2O8KA 1HSJA 1D0XA 4ZDOA 2Z3YA 4N9IA 2R7TA 3K70D 1MGTA 3DKXA 3H3ZA 4KN4X 1R1TA 1OQYA 4E70A 1PUFA 3BC8A 1X4PA 3Q3SA 3IKTA 2DOAA 3FMQA 2Z9OA 1DUXC 3M4OJ 1NG7A 1S9HA 1IV6A 4A3GJ 9ANTA 2HGCA 1R7JA 2JVHA 1S7AA 4OMYA 2I5UA 2QWWA 1N75A 4JX4A 1QPIA 3BOQA 1MMDA 2G9WA 1FOYA 4CH7A 6PAXA 3S2WA 2RC4A 2WA0A 3EDPA 4AVPA 5C3EJ 2K4BA 2EWNA 3NWTA 1W5TA 3I3LA 5IYBJ 1MNMC 1HW2A 2L9NA 3T8RA 3OYMA 3L2RA 3HSRA 3E6CC 2D5VA 4FETA 4ENMA 2XAUA 2PFBA 2XB0X 4FE7A 2PBIA 3SDGA 1YTYA 1W36D 1VQLI 3CQZJ 1WJ5A 3LOCA 4MHGA 1K7AA 4OIOF 1BJAA 3D0SA 3CCYA 2FMLA 3FDYA 1V5GA 2VOOA 1UJ8A 3FWEA 3R4KA 1NK2P 2O61A 3JRCA 2X6XA 3OR1C 3FISA 1IRFA 5K7HA 4E7ZA 2BEOA 5ILSA 2OJED 2B0LA 2RQQA 4HDUA 2QM3A 2Q1ZB 3COAC 2GXAA 3HOUJ 3E5UA 2X6YA 2OQGA 1FX7A 4F93B 1FZPB 2D1HA 3PFYA 3ZQFA 1X3WB 2FXAA 1WJAA 4U0WA 2JA7J 2DU9A 5J6XA 3BQYA 2JZYA 3P9IA 1IG7A 4EJTA 5E20A 2AXTC 3J81K 2CUJA 1KZHA 4C2MJ 3CC2I 2L7KA 1BJZA 1XN7A 3R0AA 3QQAA 3DBRB 2KIFA 1K4TA 1MJBA 3OWTA 4M3BA 5L3DA 1ITYA 5FLMJ 1XX5A 4N4OB 1O3QA 1RNLA 1Z05A 2XB5A 3JAMZ 3U2RA 3FXUA 4LOCA 1SFXA 2GXBA 3CD6I 1XMXA 2DFEA 4ZTFA 2VPRA 5LEKA 2K4JA 4ZH4F 2PMZN 4PFOA 5D5VB 1TWHJ 4ZDPA 4PJLA 4V19K 1PP7U 4D0PA 1MDMB 4BE0A 1EKEA 3LNQA 2B7EA 3KYDB 5ICCA 2QQBA 3LSHA 4D5CA 4NQWB 4F91B 4BY1J 3GZ5A 2YU3A 4RGSA 3GFLA 3E97A 2XPWA 4PSWA 4DQ2A 2HFHA 3LSPA 2GA2A 4AUXA 2IA2A 3HDDA 2GBYA 1LDJA 1DU6A 3E6BA 4ZZLA 5K1YA 3GLLA 5EEAA 1G59A 3KP3A 1V3FA 4CCJA 2M4KA 2ZNZA 3QYFA 2W25A 4DGWB 3IAM2 2NOJB 3DEWA 2TCTA 1WJFA 5KAIC 3F8BA 5H20A 1PUEE 1O7LA 1X1CA 2E2HJ 4RLQA 4U7DA 3D5LA 3HTSB 2P81A 4WXHA 2WAQN 3CDLA 1V54H 1VF9A 4B44A 3GTJJ 3RKQA 5FGMA 3G4SI 2EZLA 3F8FA 4QLCU 1ETWA 3G3ZA 2IXSA 1VQ5I 2O03A 1VQMI 5FRMA 3CCLI 1YS7A 4IHSA 2IGOA 5LFAA 5J47A 1S7OA 2VJIA 5JR3A 2KJCA 2ZMEB 2VLAA 3M8JA 1TWGJ 1USTA 1CF7B 3EUKL 4HV5A 3FXJA 1U8BA 3L2QA 1WJDA 1VTNC 1MDMA 2K85A 2NVQJ 1VQ8I 3IKVA 5E8GA 4NQWA 3JTHA 3TO7A 3R60A 1KYWA 3CUOA 3M1EA 4RAGA 1XGMA 4XK4A 1DP7P 4A3BJ 4A6EA 2RKHA 4RB2C 2DLLA 2XF6A 5K5QA 1H0MA 1DP3A 1R71A 3DEEA 3A1YA 1MMAA 2ECCA 1IRXA 1X1PA 2HDDA 2AQEA 1J0RA 2ZB9A 2L7MP 3LQQA 1ZN2A 2ISZA 4YELA 2R7FA 2XROA 2ECBA 4I76A 4M71A 2XAGA 2LMDA 4B4CA 4EV0A 3P5JA 2ZFUA 1QZEA 3VYSB 1FBSA 1MNEA 1NHAA 3GXOA 4A69C 4QPOA 2J5PA 2A6EF 3F0CA 4BJ5C 3U21A 4RAZA 4NC6A 4O5VA 1XDSA 4BQQA 3ML6A 3NARA 3FIWA 5JFRA 2CG4A 3WE2A 1TTYA 3TO6A 3X2QH 5D4RA 4N0BA 2LKXA 3K10A 2NYXA 2NS8A 3SFIA 2BOLA 2HDCA 2YSRA 2V1DA 4HBLA 3WTUC 3GWZA 1FOKA 2FOKA 1Z9CA 1R22A 1MBEA 3UNGC 2OU2A 1IUYA 2AXLA 4LB5A 2LF7A 1OCPA 3ECHA 1Z3YA 1YW7A 3CF2A 3IC7A 1Y1VJ 3WHCA 3FM3A 2W82A 4DW6A 4BE1A 2ID6A 4H0EA 4G7OF 5LGNA 3I56I 2K3FA 2N8GA 4OWRB 1BR2A 3ZQIA 4DYRA 2R93J 2MC3A 5IT9Z 3RIRA 1R00A 2L54A 1XTAA 2DA2A 3LFUA 4DIQA 1SD7A 3I4PA 4LLNA 1A35A 2R5ZB 1H89C 2RVCA 3C2GA 4HF1A 2W48A 5E3LA 3K4NA 1MBHA 3MKYB 2CW8A 3CF5F 2FD5A 1ON2A 3FHZA 5L3EA 3L00A 4LD5A 3TOAA 1FT9A 2H94A 1WCMJ 4XM3A 4NHJA 3BTLA 2MFZA 1F4KA 1BI1A 3RKWA 2HEOA 2VQCA 1OKRA 2R0QC 1Z7UA 2WTEA 1W0TA 1HW1A 3K4BA 3OS2A 4A3FJ 5KAFC 3WTYC 2HYGD 1HSTA 4UXNA 3ZP5A 1LFBA 1I6HJ 3HTUA 2Y69H 2ACJA 5FKLA 1ZAOA 4XKCA 2XSJC 4A0XA 3DPUA 3GBGA 1ETVA 4GYIA 2NVYJ 5FJ8J 5F64A 3CJRB 4HLXA 5AIPA 2P7CB 2NVXJ 5D5XB 2Q8KA 2PX9A 3V4GA 5M3FJ 1D1AA 2EA4A 2VT3A 1P7JA 1APLC 3S8PA 5M3MJ 4PSXA 3ESWB 3CUQB 1ZYRF 3HJEA 1HXDA 2CQQA 2VXDA 3F9KA 2HNHA 3T0YA 4XSZF 4FE4A 2VQHA 3DEUA 3OL3A 2YU9J 2R5ZA 1VNDA 3RQ4A 3TDUC 2PJPA 4BJ6C 4CCOA 1WZ2A 2GXGA 1YHQI 4GCVA 3GFIA 2WY7Q 5D6EA 5LRRA 3CMAI 3S1QJ 1E0EA 1WVRA 2DXIA 2XIGA 3O2PE 5EZGA 2B63J 2X6WA 3T5XA 4BH9A 5EGOB 5LLQA 4RAFA 3QYEA 1TP4A 2KRCA 3KEQA 2EFOA 4PJ0C 3WU1B 1Y8RB 1JTYA 2CQNA 1T8IA 1QU3A 1REPC 3GEZA 2RDPA 4HNUA 4B8XA 5HLTA 5E3MA 3GUDA 3HZJA 3IRQA 2OCEA 5F04A 3C7JA 1SFKA 5HNHA 4G9YA 4HQEA 4DZPA 2JA6J 3DWLE 4BHCA 1J7KA 1ZQ3P 4RGXA 3WGGA 3GLXA 5DDGA 5M5YJ 2VKHA 1Y39A 4NC8A 3RI4A 1Z3XA 3W2VA 4AIKA 3VB2A 3ZN1A 2MD0A 2V4JC 1ZRCA 4FASD 1BC8C 2XAHA 5GTHC 2FA5A 2HKOA 3ABUA 4LLLA 2IGNA 3BZCA 1Y1WJ 3HEFA 3I59B 5DM7F 3F8CA 3J7YJ 4M6YA 2Y2ZA 5ICEA 4N9HA 2NOGA 3CC7I 2JT1A 2OQRA 3BPXA 2GIZA 1WH7A 4P1WA 2JPCA 1BR4A 2M2EA 4BYYA 4C3HJ 3F23A 3V8KA 1B6AA 3CTAA 1UCRA 1B9NA 2F5CA 3I9V2 1LFPA 4IOAF 2X1CA 1W7PD 2BHYA 3CJQB 3CLOA 3K9TA 1SVLA 2BY3A 3HYIA 3PQJA 2C6YA 5EGOA 4PJJA 3LSRA 4OIQF 2H8WA 1YE9A 2D2WA 3FXLA 3H0GJ 5EG0B 4NC7A 5M5XJ 1N25A 1HCRA 2E2JJ 3HM5A 2VI6A 1H9GA 1MBKA 2DAOA 1IC8A 3HRSA 2DA1A 1LVKA 1JJ8C 5JVTA 3FXMA 3GTLJ 2DA5A 3KP6A 2F48A 2IA1A 4XLEA 2P5VA 2KPMA 3F3XA 4LK0F 4XR6A 3QP5A 1F43A 3ZQGA 2OC6A 2W85A 4LG0A 1XGSA 3OYEA 4L9TA 1NG6A 5E3NA 2ZJQF 2FE3A 2FU4A 4U87A 3F8NA 1LJ9A 4HSRA 4CO8A 4R8HA 1MJ9A 4E4HA 5J8CA 5ICFA 2W57A 2COBA 1SD6A 2WAEA 1G3YA 3Q0UA 2P7VB 4HNTA 3QYBA 1OYWA 3G6EI 4G8XA 2WAFA 4IQJA 2AQFA 3I59A 2FBHA 3MAJA 1I3QJ 2VODA 1WH5A 4AWXB 1S5LC 3KX2A 4HZFA 5D6FA 2HPIA 2TDXA 2M7AA 3H9GA 3SDBA 3I64A 5HS9A 1FEXA 2KIUA 4E6KG 4U7BA 1MJAA 3BR5A 3FKIJ 4IL6C 2A05A 2Z5UA 3AL0B 5HNFA 4E7KA 4B43A 4CZZA 3HOWJ 2JRMA 2OA4A 3PUFA 3B73A 4JK1X 1G6NA 2KRFA 2W7NA 2KP6A 3DF8A 3IWZA 3P9KA 5EG0A 2EBIA 1FNNA 2P6SA 2PLYA 1OCOH 3L7WA 1T0FA 3KEOA 4C2UA 4XSXF 2HS5A 2WAQA 1D5VA 5J1RA 3AFHA 2DW4A 1LEBA 3RQIA 5E18F 2CSOA 3BJ6A 3ISPA 4S04A 1H88C 3J80Z 1H9TA 2HVQA 2VQLA 3DTIA 4II2A 4A12A 2MABA 3JRAA 4MGRA 3T1BA 1LFUP 2FOWA 2HOAA 3IRRA 2Y30A 3ZXSA 1FLIA 1BOBA 4E7LA 2E7XA 3JRHA 3A4CA 2NVUB 1KYZA 5KNLA 1R1VA 2E1OA 1BA5A 4EJUA 3BG6A 3JRFA 2E36A 4XLFA 5D5UB 2JA2A 1E17A 4KISA 3QPTA 3EUHC 1RPWA 2I10A 1I6XA 2HZTA 4MEYF 2Y9ZA 1FBUA 4MTDA 3CCRI 2H09A 2BY1A 1J09A 2K9NA 1R4NB 1G4DA 3GFJA 1FYLA 4Q48A 2GM4A 3S17J 2O8XA 1L3LA 2M45A 1P92A 3PO3J 2L02A 1T33A 1E3HA 2XF7A 5J3LA 4BBRJ 1EJ9A 2KT0A 1FY7A 1I3AA 5FD6A 1RR7A 2QQAA 3OYNA 2KDOA 3CP8A 2GWRA 2ZMEC 5BNGA 4HX4A 4J01A 4HLYA 1HKSA 2EV0A 2V9KA 5B1BH 3ZMZA 1KU9A 3KLOA 3HRMA 3FMSA 2K9MA 2LNBA 4BQAA 5A2QZ 4UUSA 3HOXJ 2KDZA 3CCMI 3ZR8X 3DTKA 1PUFB 3KETA 3E1SA 2L3DA 3BCAA 3JRGA 3I53A 1J2XA 1ACIA 1XDUA 5D5WB 2LY1A 2O3FA 4X0GA 1Z91A 4EJOA 2GIVA 1MKMA 2XAJA 2KLOA 2MC4A 2H6CA 1TWCJ 3ABLH 4A3KJ 3SQNA 3TP0A 3OSGA 2L2OA 3NEUA 2CQ7A 2M9HA 3EUAA 3K4JA 3MCZA 2P6TA 3FKJA 3OV8A 4W97A 1U9OA 3D5SC 3S15J 2ZO4A 5GTIC 1ZRDA 2ESNA 3ABKH 1KA8A 3GCMA 1OJLA 2XRLA 4KT6A 4NDLA 5J1YA 1LE8A 2ZJ2A 4XL9A 3TEDA 2F6CA 4F55A 1MZBA 2LF8A 4Y17A 4B48A 5BS6A 3I4MJ 2X48A 2DFHA 3K0LA 2DDBA 4PZJA 4G7ZF 1JE8A 2DJIA 1W5SA 3F22A 2KFDA 2K86A 3QOEA 4I98B 5L3GA 4HF0A 1JXSA 2Q2EB 3NWSA 1V4RA 2PMHA 3K1MA 3BPVA 1A36A 1ZR4A 2R4GA 5DD8A 1SD5A 1P4XA 2MD5A 5IPAA 3A0BC 5J4VA 5KHDA 2YPRA 2VE8A 2XGEA 5FRNA 1YS6A 5ED4A 2PMUA 4CDGA 1VQPI 2R92J 1T6SA 2DT5A 1YQAA 4ZDLA 2IBDA 3C3WA 2A6TA 1XPXA 1PYVA 3ZRGA 1B1BA 1YO5C 3Q0WA 2QUFA 3G1LA 4M3GA 5HS8A 2CV1A 1ZG5A 2IEKA 3IP4B 5E8IA 3GTGJ 3WG9A 2HOTA 2ZNYA 4OIRF 2IJLA 4IEJA 2KQRA 4RB0A 2LBFA 2RNGA 3K1NA 3TL4X 2MLKA 1YW9A 3AAFA 3RZOJ 1FIAA 4ABZA 2NAZA 1FTZA 5CQGA 2HYJA 2LKPA 3HHHA 3LMMA 4IX7A 1GHCA 3EETA 2VT2A 5F27A 2XHKA 3SZPA 2J5OA 4UVCA 2Z33A 2E35A 3DBHB 5IP6A 1K6YA 1JJ6C 1JTXA 3BTIA 1R4MB 2ELJA 1W1WE 3QRFF 4F52A 2DN0A 2IP2A 2LVSA 2M8GX 1ZGAA 5EZHA 5L3CA 3MKWB 2EB7A 2Q2EA 4HG2A 4YEJA 2LY9A 1QA6A 4HX8A 4IF4A 2DA3A 4D9JA 4PJMA 1JHFA 3F72A 4G94A 2HOSA 2VBYA 2FRHA 3KZIC 2G7HA 3LSGA 3ZGKA 3TMOA 3WGHA 4ZYAA 4D7MA 1FSHA 3RKXA 2PI0A 1OISA 4AYBN 5LGUA 5HDGA 2DFIA 3CUQC 1X2NA 5ILVA 3AG2H 1R5GA 1SD4A 2FBIA 2Y31A 4V2FA 1LPQA 3D1NI 1LUJB 1QQIA 2OAZA 3HIFA 1TNSA 3SJMA 1GUUA 4UY8I 4RLFA 3HGYA 2X9DA 1O7FA 3MZ8A 2ZSHB 5HLIA 2HQRA 5BPDA 1JT0A 2UXXA 1MBFA 2I8DA 4PK4A 5K7FA 2O0YA 4KA4A 4WK8F 3K2ZA 5B3SH 4IHTA 3PSIA 1SVMA 3BP8A 3W3CA 5DTDA 4HAMA 1VQ9I 3ECOA 5LHGA 2VQGA 3ASOH 1FP1D 1S6LA 3MFKA 2L5QA 3CP2A 5IYCJ 5FLXZ 1U0JA 1Y6IA 1G3TA 2VBWA 4LJZF 5E1WA 4CHUA 4IJAA 2FUG2 4W1UA 3CCUI 4UB6C 1YJWI 3OOUA 1WJBA 1U8RA 2R7XA 5GAHJ 4P55A 1LEAA 1J59A 3WTTC 4RAYA 1X3UA 3GO5A 2XASA 2DQRA 1USSA 4EEFG 1DGRM 3SZGA 3ZOBA 4V2GA 2K27A 1WRJA 4XKVA 3ZMVA 4J19A 1ULYA 1ZKGA 4UVAA 4I0AA 3BR2A 2EFNA 3OY9A 2QEXI 3A0HC 4AIDA 4NB5A 2QBYA 1ETKA 3JREA 4BY7J 3N05A 1D8KA 1X4OA 2MBFA 5EEGA 4CYCA 1T95A 2QZ8A 2E19A 1A6IA 1V5FA 3V7CA 1J5YA 2AO9A 2VIXA 2QA4I 2V9VA 1HF0A 4YFKF 3GVAA 1FJLA 2FBKA 4P9UA 1QVTA 3V42A 3ULQB 2JK3A 4EATA 4FX0A 2DYSH 1WFXA 3O6BB 3PNYA 3FXQA 4D1QA 4G6DA 4IQ4A 4XKBA 2VN2A 1X58A 2FJ1A 1R49A 5J1UA 2E7WA 1ENHA 3EYYA 4M72A 4XN0A 2LH9A 1Y8QB 1RETA 2NNYA 4OU0A 4XLHA 4ENJA 3H9JA 3IH3A 3K1PA 3KCCA 2L4MA 1HW5A 1MBGA 5CKTA 3B02A 1R6RA 2ID3A 1UZCA 3WTSC 1I50J 1O3SA 1B72B 5B5EC 3VPRA 4L9NA 1K4SA 1CGPA 2JMWA 3WTXC 2QQ9A 2M3AA 4IHVA 1XG1A 4EM2A 2H1KA 5F08A 3CLQA 2LRDA 4B47A 3AG4H 1B4AA 1BC7C 2DT7B 3TKYA 3S3MA 3PQKA 1TQMA 4YIIA 2VKEA 5D8LB 1NH3A 5FO5A 3I58A 1TW3A 2K40A 2BVLA 2TRTA 3HSEA 4YFNF 3JW4A 1QPMA 3DTEA 2CU7A 3BG3A 2V7FA 1XSDA 3HOSA 2B9SA 3JAMK 3FHNA 1B59A 4ETSA 2F4IA 2QF7A 2EFQA 3KEYA 1QNTA 3BZ6A 3FBIB 3JSPA 1Y0UA 1PVEA 2VKVA 3OYDA 3S3OA 1YX3A 2ZKZA 1UB9A 3LSKA 2DT6A 3PSFA 2IGMA 1X2MA 3K6GA 2ELKA 3FBNB 2DO7A 2XRNA 1G3WA 2BYVE 2YX7A 1OR7A 3F6OA 2LY2A 3QPSA 3KFWX 2IAIA 2CRGA 5GADJ 1K61A 3F21A 1Z67A 3ZCOA 4HV6A 1EH6A 5FB2A 1B72A 3RTRA 4DBRA 4EGZA 1OCTC 2KKOA 4L0YB 5HDKA 2XGDA 3FK6A 1HBXG 1Z1DA 1ETXA 4P9FA 1GVJA 1BIBA 2DK8A 2E1NA 5GP9A 5D8KB 1HOMA 1RC9A 2W1OA 1MSFC 4KDPA 2IS4A 5F1RA 3DKWA 4EM1A 1WJCA 2DTZA 4CA0A 1J9IA 4A0ZA 4Q5SF 1Y0NA 4L9JA 1QGPA 2GQQA 3OYKA 3E0JB 1UHMA 3H5RA 1TZLA 3J7ZI 3C2BA 1DQUA 4FT8A 4L9VA 1RI7A 3DU5A 1IXSB 2MGQA 1GVDA 3C18A 1D8JA 1TQPA 1ZK8A 2JJ7A 2EZHA 3AG3H 4LGWA 3CMYA 4QPQA 3FXOA 4J00A 2EIKH 1I27A 4M3FA 5F6FA 3CCJI 2K7LA 4C3JJ 4RMNA 3DBLB 3VYRB 4I0BA 4LLGF 5CPRB 3LAPA 2LP0A 4HPQA 3CDHA 4OMZA 5KVRA 5LBQA 4MFEA 4S05A 3S2DJ 5LHIA 2M4GA 1HDPA 1U5TC 3O3KA 3OYFA 1TQIA 4ON0A 1T39A 2JN6A 3RPUA 2CS3A 2VXZA 3H1CA 4BBSJ 3KYCB 1D1CA 1XMKA 3RYPA 3ZQLA 1ZLKA 5CVJA 2DI3A 4DOZA 3CCQI 2K9LA 3QP6A 3HUGB 4E7SA 1IN4A 3K70C 1QBJA 4XOTA 2FMYA 4IHWA 1YOVB 2L9SA 3BJOA 3I5UA 1RESA 2ZC2A 2QQ8A 3B6AA 2LOOA 3WHBA 3TQNA 2HTJA 4C2TA 2XPUA 1BI0A 5CVRA 2VUMJ 3DP7A 1OYIA 4XKWA 5J40A 1G3SA 1UG0A 2Z99A 2CUZA 3FM5A 3H9QA 1K78B 2KZGA 3BJAA 4XRFA 4LG0B 5FLVA 4IXAA 1EH7A 4Y52J 2NNNA 2IS1A 4KITB 3L9FA 5EEHA 1WGXA 4Y15A 2JRTA 3BR1A 2ELHA 3OYIA 2R7UA 1SANA 3BDDA 4XN3A 2QENA 2DJNA 4GGGA 4A6DA 2IW5A 2VKDA 1B9MA 1T2KA 3HKZA 1N77A 5H2FC 1W36C 1S7EA 3GTPJ 3DQVC 3BR3A 3WODF 5FFZA 1TT0A 3T8TA 4A3EJ 2BBYA 3HRTA 1KGSA 5IT9K 1TC3C 2R7VA 1Z6TA 1LVAA 1XB4A 2JPBA 3JSOA 3MVPA 3BZKA 4Y4RA 3HUGA 3R61A 2F5DA 3HPGA 1YYVA 4M9ZA 3MEXA 1U78A 2DDAA 2DODA 4CYDA 2M8EA 4HNVA 2E60A 3PJRA 3PFIA 1E3PA 1JI8A 4AYBA 3CMMA 3HL2A 3S93A 1U6GA 4ASNA 1BL0A 4ZYHA 2WY8Q 3DPLC 1R36A 3S32A 1ETOA 4X1EA 2XC7A 1GXPA 3ZMDA 2EILH 4GXOA 4ZYGA 1D0YA 4QTRA 1BN5A 2EZKA 5CYVA 3OL4A 1ZH5A 5JLWA 2KJBA 1OLTA 2QSHX 3MZHA 2BV6A 5EF6A 3HPHA 1QZZA 2EJRA 1S29A 1K78A 2R7SA 2P5KA 1SMTA 3CJTB 1QHHD 4BHBA 2EQRA 2F2EA 5GAEJ 1NTCA 2M87A 3S16J 1R9TJ 2WB1N 2BXZA 1AKHA 3SFZA 4YFXF 1SFOJ 1SMYF 1A5JA 3QOPA 2GLOA 2KIQA 1YJ9I 4O3MA 2WV1A 5C4XJ 5BOXA 3I55I 2R7QA 4XLPF 4AU7A 4A3LJ 1DPUA 1YG2A 4U0VA 3QWLA 2EV6A 2EK5A 1E2XA 1ZHFA 3OYGA 1S8NA 2CGPA 1OMIA 4HEA2 4WCGA 2E34A 1KU3A 3R0JA 4I09A 2EZIA 2QKMB 1YIOA 2R3SA 1ZELA 4A3CJ 3U1KA 2EV5A 4I02A 3S14J 1Z6RA 3H3UA 1FP2A 1KONA 2BXYA 2QSFX 5IOZA 1GDTA 2X85A 1A31A 4Y3OA 4I2OA 3TO9A 2KL4A 5KCMA 2HI3A 4CZCA 1N78A 1U3EM 2ZSIB 1A6QA 1P7IA 1OFCX 1IN7A 2HXOA 4EQQA 1WPKA 3CCVI 1SFUA 1R1UA 4PGGA 1QRYA 4M73A 3IWFA 3Q5FA 2RN7A 4L5EA 2DOFA 3KYLA 3HOTA 4UUSB 4BJTA 3PNTA 4E7JA 5IYDJ 2HPMA 2HQ5A 1TBXA 4XLCA 5FKMA 2QSGX 4BXUA 1T38A 3BR0A 1AHDP 1RKWA 4KIGA 2LKSA 1WKMA 2VC1A 2O7OA 1UAAA 4XOPA 1FC3A 1GLNA 4UUTA 3D5RC 1MH3A 2GZWA 4ITVA 3ZQHA 4NUBA 1GV2A 3TW7A 4UB8C 1IGNA 3K4CA 1V5EA 3A01B 3DCFA 2L9VA 4CICA 3BCBA 3VODA 1X1DA 4OIPF 2DYRH 2OPTA 4BL0B 1MH4A 4XORA 3KPHA 1X1BA 1JGGA 2DMNA 2BE5F 2CV0A 4N4NB 1YITI 5EJCA 1STZA 3HOYJ 2PG4A 4EVIA 1JKQC 1SAXA 1LE8B 1RR8C 1V55H 1UHSA 1IJWC 4IRGA 5HVQC 4MO7A 3PL8A 2Z2SB 5GPCA 4BU2A 1K6OA 2HKXA 2KISA 2V6EA 3V7RA 1WI3A 5JLXA 4Q4ZF 2VC0A 5CQEA 4OOIA 2CQXA 2CO5A 3W2WA 4L5JA 1F5TA 4IHXA 2P0WA 3FXKA 5M5WJ 3W6KB 1P2FA 1IN6A 5JHUA 4YG2F 2Y9YA 5IP9J 3L2VA 3IAS2 5JVGF 4C3IJ 4K2EA 3P7NA 3B6CA 2O6GE 2A68F 4OAZA 5DCMB 4M9XA 3OOPA 2CFXA 1BBYA 2COMA 4JX6A 3A01A 2M1BA 4CCMA 1YX5A 1LB2A 3U9GA 4Z2YA 2P4WA 5L3FA 5C4JJ 1IDYA 3NRVA 3PO2J 4QIWN 2LBFB 3JRBA 3OR2C 4EGYA 3GYHX 4WX9A 3VYUB 3J81Z 1LDKB 2MLGA 3LSJA 2CYYA 3LL7A 1T08B 2AS5F 3EQLF 3GFMA 2WWYA 2R7RA 4HYEA 2A69F 5IY5H 2JVGA 5TGTA 1PP8F 2ZCWA 3KLNA 1O3TA 4LIUA 5J8FA 3OMYA 1VFCA 1AU7A 1RZ4A 1W5CC 4R79A 4I7HA 4WF2A 3H3VK 2MH9A 4BEHA 2X1DA 2LK2A 1G8XA 2X6OA 3RPQA 3JRIA 1PJRA 2XVCA 3ABTA 4PUSA 5FKNA 1IXRC 4A3MJ 4BNCA 2VPLA 1HKTA 3CCSI 4L18B 1JKPC 1QVUA 4XMYA 1XSVA 3K4MA 2LR8A 4DZJA 4KIFA 1HA8A 2OTLI 5BQTA 2QYOA 1D0ZA 3J80K 3H36A 5DCMA 1U9NA 3V7SA 2EA2A 3VEPA 3K4KA 4BHPA 2VJJA 5CVIA 1WQ2A 2E1MB 2L7ZA 3DLLF 2HWVA 5LRSA 1KQ0A 1P4AA 3KZZA 3OYJA 4KNYA 4PJNA 2OZ6A 3LA3A 1U5TA 1TT5B 1R23A 2ZXJA 1X1AA 1B8IB 4M6VA 1RIOH 5HS7A 3W6JB 3W6VA 2XPVA 1TL8A 3FXRA 3BROA 1MW7A 3WE3A 2VBXA 4MLOA 2W84A 1VQ6I 2NRAC 3R6SA 1HC8A 2MA3A 2CW7A 3HKZN 3K2AA 1IRZA 4XLAA 2DMQA 2FSWA 1D5YA 5EYRA 3CESA 1F36A 3S3NA 3IH4A 4XRSA 4RB3C 4KMUX 3AKZA 2UXNA 4M3EA 2E71A 3ZMSA 3DV8A 1RKTA 1XC5A 2GA1A 2M30A 3MN2A 4M6XA 5HODA 2UWMA 3HGGA 1RUNA 4ZJZA 3CC4I 1M1EB 4GO1A 5TISC 4E7IA 1ETQA 1ORKA 1YIJI 2BGCA 3BWGA 4LIVA 1J75A 2DA4A 1JGSA 1Q1HA 3HRUA 5A2QK 3C2HA 4AVZA 4Y33A 1DGWY 2DCEA 2DPUA 2H8RA 2XGCA 4MEXF 2HXIA 2IVMA 2MYSA 5HLGA 2VE9A 1O4XA 2QBYB 2XKOA 4ZC3A 4B3XA 3O8HA 2STTA 1LQ1A 4ANJA 5IOYA 1UHWA 4CYCB 4OINF 3OYBA 4A5MA 4FHTA 1UFMA 3M07A 1B8IA 1IO2A 4F3QA 1I39A 2WADA 1FOXA 4KYWA 3SEZA 1AWCA 4FTHA 1UG2A 2IS2A 3N4MA 2FNPA 2DQLA 5GAGJ 2MH2A 4QWQA 3FX3A 1FWZA 2M0CA 3S2HJ 2LREA 2CW0F 5E17F 1IZ1A 3RJPA 4D7NA 3LA7A 2HOEA 3Q0VA 1SEUA 2E2IJ 2F4OB 2CWEA 5J4YA 1Z7LA 3HG9A 5F0FA 2Y48A 1MMGA 4BDYA 3OIPA 2NVTJ 5E3OA 1AOYA 5L3BA 2FQ4A 3OS1A 1XD7A 1UELB 3KE2A 1OCCH 4YRVA 1KU7A 3E6DA 5FKOA 2WV0A 2Z1DA 5LEJA 1VZ0A 4GFBA 4O6JA 2VASA 3M8FA 3JTGA 1H8AC 2JA5J 1ETYA 3H35A 2LDUA 2E1CA 3V8LA 4ESBA 3Q9VA 2L9RA 2BY0A 3LWFA 2Y0SA 2RV8A 1EH8A 4H4KC 2QKLB 4EM0B 3M3YJ 2A5YB 2R7ZJ 2DMPA 2ESHA 1MBJA 3DPTA 4ZTJA 2XGXA 2JA8J 2E5ZA 2WB1A 5F0CA 1R5HA 2V26A 4CCLA 4JBAA 3QAHA 2G7UA 2XAFA 3K7AJ 3GTMJ 4M3DA 1KQ9A 3UKGA 2CUFA 4BE2A 4A93J 2GOMA 4M74A 1HKQA 2VB6A 2HR3A 3BR6A 3K4LA 5CJ9A 5E1ZB 2W24A 1NK3P 2PQ8A 5DV5A 5FFXA 2A3SA 2ISYA 1VQOI 1RRJA 3KP7A 1VQ7I 1Z0XA 5HOOA 1ONVA 3PUBA 1VQKI 4BQOA 4A2UA 2HVSA 4QSHA 1WHUA 3GW2A 2V1UA 3MMYB 4G6TB 4GYGA 4AD9A 1T0FC 3RKYA 5ILUA 1FMWA 4PCQA 1T98A 1D3YA 2EH3A 3GTKJ 2R7WA 4BXXJ 4MQ9F 4IZZA 2UV1A 3SXYA 1ON1A 4L0ZB 4LK1F 2V79A 4RS8A 1WI9A 3G73A 3ZQCA 2K9SA 2OF7A 5HDNA 3M7GA 3IV5A 4XRMA 1W0UA 4AIJA 2XDVA 3JRDA 4HOBA 1X19A 4UV9A 1IN8A 2RAEA 3LFKA 1BI3A 4BS9A 4JP0A 3MKZA 1JHHA 2VL8A 3QODA 4AIHA 4ESFA 1F1ZA 4HSTA 2NXNB 4HQMA 2CH0A 2AHQA 1DPRA 4XBFA 2R7DA 4KJZA 3FMRA 2Y75A 3GZNB 4G6QA 2HTSA 3ZN0A 1GV5A 2GOXB 2H1LA 2V6CA 1XMAA 2IPQX 2W00A 3G1MA 3BQZA 3EUHA 3AL0C 1IXCA 4GRIA 2HDWA 2Z16A 2G0EA 4KICA 4YIRX 4CGZA 3LA2A 2QLZA 1ZRFA 1YW8A 3VSLA 1RUOA 3LSTA 5CVUA 3BT9A 3PM1A 2KHMA 1IDZA 4LITA 4UNOA 3QU3A 4GDFA 3GMEA 3MQ0A 1P6RA 1SVOA 2XF5A 3EPZA 4JX5A 2IS6A 1LNWA 5FLXK 4Y7NJ 4A3JJ 4EMSA 3RDIA 2ZJRF 3HC7A 5K5RA 1FIPA 3OIOA 1YLFA 2XUBA 4UHTA 1O3RA 3G2BA 2ZMEA 1EV7A 3QPLA 3HOZJ 4RM2A 2X1EA 3BG5A 1CF7A 2X0LA 2X51A 4JYKA 3FF5A 1TWAJ 3IH2A 4FX4A
chains in the Genus database with same CATH topology
4HX7A 5DCFA 1XGOA 1OPCA 5DYMA 4ENNA 2OZUA 4KUMA 4MNUA 3L2CA 4CXFA 1O57A 4RGUA 4LB6B 5ICGA 2P8TA 3I0TA 1TW2A 4ZZDA 1FBQA 1IN5A 2GAUA 1ZGJA 5FD5A 4PDKA 2RGVA 4KMFA 2STWA 3CO6C 1TLHB 4I01A 2DPDA 3NQOA 3ROUA 5KK1A 1BIAA 4DNCA 1KQ8A 2ZBKA 3H92A 2FQ3A 3TGNA 2YX4A 3ZPLA 2ETHA 1ZREA 3QPHA 3WGIA 5HLHA 5TJJA 3P9CA 4Q47A 1R58A 2PEXA 3M9AA 1I1SA 4KN7X 4P96A 2WC2A 2CQKA 2HQNA 3I71A 4WXDA 2VBZA 2IA0A 2PN6A 3F6VA 1IF1A 3REOA 3L09A 3TOBA 3Q9SA 2RQPA 3MWMA 5TRDA 4HA8A 2EFWA 4LMYA 2H27A 1ODDA 3KP2A 2YR2A 4RB1A 4EJVA 2P5LC 5JI6A 3IHUA 1ZG1A 5DUIA 3BY6A 4WXCA 3WTZA 3E5QA 4R1HA 4TV7A 2FEZA 3LQRA 3E6MA 1QO0D 3E5XA 1QZYA 4Y13A 4IRIA 1OYYA 2HYFA 4F7ZA 4EJWA 3KZYA 1W4MA 2H6BA 5ERIA 4HDVA 3ZMUA 1W7PB 2ZFWA 5H6RA 3E3VA 3ZQ7A 1FYMA 5DEQA 1XCBA 1IW7F 3C1DA 3K69A 4ZYDA 2UZKA 3CUQA 2OBPA 1XCVA 2DK5A 1BOAA 4IRHA 2JTVA 4L5IA 1FYKA 2FF4A 3ZMTA 1U2WA 1WWXA 4P5OA 5AONA 3VOEA 4M9SA 3DXJF 2L01A 5D4SA 5K5OA 4U88A 2D1VA 1A04A 1MD0A 3U1DA 4UV8A 2A6HF 1W7PA 1BM9A 2DBBA 4UUVA 1ZG3A 2L4AA 5LGTA 1P4WA 3WTVC 2LSOA 1XGNA 3GF2A 2FNAA 4KT5C 1GXQA 2A07F 1I1GA 2F5FA 5DD4A 3ERED 2DTRA 4HF2A 2F5EA 3SZTA 2IRFG 2XAQA 3KP4A 3SHFA 3VFZA 5LHHA 4UVBA 4RGRA 4ESJA 1FSEA 5DUKA 4A0YA 1LDDA 3QU6A 1S3JA 4KFCA 3HSFA 5IT3A 2ADUA 4XLNF 3GZ6A 2OD5A 1ZLJA 2KIMA 1ZARA 5BMZA 2D45A 1WSUA 1BI2A 5H6QA 4LFUA 4B09A 2V1XA 2XV4S 4IVNA 4A5NA 2QVOA 1L0OC 3M8EA 3WTWC 2NS0A 3RYRA 2X4HA 3KP5A 2JSCA 2RNJA 4YIFA 3EYIA 1XSXA 1I5ZA 2IT0A 3FZVA 1KU2A 4MTEA 2VOPA 3MZYA 1HQCA 3GX4X 1FPQA 2VONA 3CJNA 1PDNC 1DDNA 4IPAA 4HW0A 4WWCA 1IAWA 3N97A 1K79A 5CLSA 3I54A 3V8JA 2K02A 1SFEA 1U5TB 1F9NA 5CVVA 2A61A 1YFHA 1C0WA 3TDZC 3CO7C 2Q0OA 4ENKA 3DFGA 4JQFA 5BPIA 4BAYA 3IL2A 5E1XA 4KIBA 1TNTA 2M5WA 4MQVA 4G7HF 3HHGA 4PGHA 2Y0MA 4ZYEA 2EFPA 3J7AO 5AIQA 3LAJA 4U0YA 2XKPA 3ELKA 3F8MA 3WU0A 1HSJA 2Z3YA 4N9IA 1MGTA 3H3ZA 4KN4X 1R1TA 4E70A 3IKTA 3FMQA 2Z9OA 1DUXC 2HGCA 1R7JA 1S7AA 4OMYA 2QWWA 3BOQA 2G9WA 6PAXA 3S2WA 2RC4A 4AVPA 3EDPA 2K4BA 2EWNA 1W5TA 1HW2A 3T8RA 3HSRA 3E6CC 4ENMA 2PFBA 2PBIA 1YTYA 1K7AA 4MHGA 4OIOF 1BJAA 3D0SA 2FMLA 2VOOA 3FWEA 3R4KA 2O61A 1IRFA 2BEOA 5ILSA 2B0LA 4HDUA 2QM3A 3COAC 3E5UA 2OQGA 1FX7A 1FZPB 2D1HA 2FXAA 4U0WA 2DU9A 5J6XA 2JZYA 3P9IA 4EJTA 5E20A 3J81K 3R0AA 1XN7A 2KIFA 1MJBA 5L3DA 1O3QA 1RNLA 1Z05A 3JAMZ 3U2RA 3FXUA 1SFXA 2GXBA 5LEKA 2K4JA 4ZH4F 5D5VB 1PP7U 4D0PA 1MDMB 5ICCA 2QQBA 3GZ5A 2YU3A 4RGSA 3GFLA 3E97A 4DQ2A 2HFHA 2GA2A 2IA2A 1LDJA 3E6BA 4ZZLA 5K1YA 3KP3A 1V3FA 2ZNZA 2W25A 3F8BA 5H20A 1PUEE 1O7LA 4U7DA 3D5LA 3HTSB 4WXHA 5FGMA 1IRGA 3F8FA 4QLCU 3G3ZA 2O03A 1YS7A 4IHSA 1S7OA 5JR3A 2KJCA 2ZMEB 1USTA 1CF7B 4HV5A 1VTNC 1MDMA 3IKVA 5E8GA 4NQWA 3JTHA 3TO7A 3R60A 1KYWA 3CUOA 3M1EA 1XGMA 1DP7P 4A6EA 2RKHA 4RB2C 2DLLA 5K5QA 1H0MA 1J0RA 3LQQA 1ZN2A 2ISZA 2R7FA 2XROA 4M71A 2XAGA 4EV0A 1FBSA 1NHAA 3GXOA 2J5PA 2A6EF 4RAZA 4O5VA 1XDSA 3ML6A 5JFRA 2CG4A 3WE2A 1TTYA 3TO6A 5D4RA 4N0BA 2NYXA 2HDCA 2YSRA 2V1DA 4HBLA 3WTUC 3GWZA 1FOKA 2FOKA 1Z9CA 1R22A 2OU2A 1IUYA 2AXLA 4LB5A 2LF7A 3ECHA 1YW7A 3IC7A 3FM3A 4H0EA 4G7OF 5LGNA 2MC3A 5IT9Z 3RIRA 1R00A 2L54A 1SD7A 3I4PA 4LLNA 2RVCA 4HF1A 1ON2A 3FHZA 5L3EA 3L00A 4LD5A 3TOAA 1FT9A 2H94A 4NHJA 1F4KA 1BI1A 3RKWA 2HEOA 1OKRA 1Z7UA 2WTEA 1HW1A 3WTYC 2HYGD 1HSTA 4UXNA 3ZP5A 3HTUA 2ACJA 1ZAOA 4A0XA 4GYIA 5F64A 4HLXA 5AIPA 2P7CB 5D5XB 2Q8KA 3V4GA 2VT3A 2EA4A 3CUQB 1ZYRF 1HXDA 3T0YA 4XSZF 3DEUA 3TDUC 2PJPA 2GXGA 4GCVA 3GFIA 5D6EA 5LRRA 2XIGA 3O2PE 3T5XA 4BH9A 5LLQA 3KEQA 2EFOA 3WU1B 1REPC 3GEZA 2RDPA 4B8XA 3GUDA 3IRQA 3C7JA 4G9YA 4HQEA 4BHCA 1J7KA 4RGXA 3WGGA 3GLXA 5DDGA 3RI4A 4AIKA 3VB2A 3ZN1A 1ZRCA 1BC8C 2XAHA 2FA5A 2HKOA 3ABUA 4LLLA 3I59B 3F8CA 4M6YA 5ICEA 4N9HA 2JT1A 2OQRA 3BPXA 2JPCA 4BYYA 3F23A 3V8KA 1B6AA 1UCRA 3CTAA 1B9NA 2F5CA 1W7PD 3K9TA 3CLOA 3PQJA 2C6YA 3HYIA 4OIQF 2D2WA 1H9GA 2DAOA 3HRSA 5JVTA 3KP6A 2IA1A 2P5VA 3F3XA 4LK0F 3QP5A 4LG0A 2W85A 1XGSA 4L9TA 2FE3A 2FU4A 3F8NA 1LJ9A 4CO8A 4R8HA 1MJ9A 5J8CA 5ICFA 2W57A 1SD6A 1G3YA 2P7VB 1OYWA 4G8XA 3I59A 2FBHA 3MAJA 2VODA 4AWXB 4HZFA 5D6FA 2TDXA 3I64A 5HS9A 2KIUA 4U7BA 1MJAA 2Z5UA 4CZZA 2OA4A 3B73A 4JK1X 1G6NA 2KRFA 3DF8A 3IWZA 3P9KA 1FNNA 2P6SA 2PLYA 3L7WA 1T0FA 3KEOA 4XSXF 2HS5A 1D5VA 2DW4A 1LEBA 5E18F 2CSOA 3BJ6A 3ISPA 4S04A 3J80Z 1H9TA 4A12A 4MGRA 3T1BA 3IRRA 1FLIA 2E7XA 1KYZA 1R1VA 4EJUA 5D5UB 1E17A 3QPTA 1I6XA 2HZTA 4MEYF 1FBUA 4MTDA 2H09A 1G4DA 3GFJA 1FYLA 4Q48A 2O8XA 1L3LA 2M45A 1P92A 2L02A 1FY7A 5FD6A 2QQAA 2GWRA 4HX4A 4HLYA 1HKSA 2EV0A 3ZMZA 1KU9A 3KLOA 3HRMA 3FMSA 2LNBA 4BQAA 5A2QZ 3KETA 2L3DA 3I53A 1J2XA 1XDUA 5D5WB 2O3FA 1Z91A 4EJOA 2GIVA 1MKMA 2XAJA 2H6CA 3SQNA 3NEUA 3MCZA 2P6TA 3OV8A 2ZO4A 1ZRDA 2ESNA 1KA8A 2ZJ2A 1MZBA 2LF8A 4Y17A 5BS6A 3K0LA 4PZJA 4G7ZF 1JE8A 1W5SA 3F22A 2K86A 4I98B 5L3GA 4HF0A 1JXSA 1V4RA 2PMHA 3K1MA 3BPVA 5DD8A 1SD5A 1P4XA 2MD5A 2YPRA 2VE8A 1YS6A 5ED4A 2PMUA 4CDGA 1T6SA 2DT5A 1YQAA 3C3WA 1B1BA 1YO5C 2QUFA 5HS8A 1ZG5A 5E8IA 3WG9A 2ZNYA 4OIRF 2IJLA 4RB0A 3K1NA 2MLKA 1YW9A 3AAFA 2NAZA 2LKPA 3HHHA 1GHCA 3EETA 2VT2A 2XHKA 3SZPA 2J5OA 4UVCA 2Z33A 3QRFF 2IP2A 1ZGAA 5L3CA 2EB7A 2Q2EA 4HX8A 4IF4A 1JHFA 3F72A 4G94A 2VBYA 2FRHA 2G7HA 3WGHA 1FSHA 3RKXA 2PI0A 5LGUA 5HDGA 2DFIA 3CUQC 5ILVA 1R5GA 1SD4A 2FBIA 1QQIA 2OAZA 3HIFA 1TNSA 1O7FA 5HLIA 2HQRA 5BPDA 2UXXA 4KA4A 2O0YA 4WK8F 3K2ZA 4IHTA 3BP8A 4HAMA 3ECOA 5LHGA 1FP1D 1S6LA 3MFKA 5FLXZ 2VBWA 4LJZF 1G3TA 5E1WA 4CHUA 4IJAA 1U8RA 4P55A 1LEAA 1J59A 3WTTC 4RAYA 1X3UA 3GO5A 2XASA 2DQRA 1USSA 2K27A 1WRJA 3ZMVA 1ULYA 4UVAA 4I0AA 2EFNA 4NB5A 2QBYA 1D8KA 2MBFA 5EEGA 2QZ8A 3V7CA 1J5YA 2V9VA 4YFKF 3GVAA 2FBKA 4P9UA 3ULQB 4FX0A 3O6BB 3FXQA 4G6DA 2VN2A 2E7WA 3EYYA 4M72A 2NNYA 4OU0A 4ENJA 3K1PA 3KCCA 2L4MA 1HW5A 3B02A 3WTSC 1O3SA 4L9NA 1CGPA 3WTXC 2QQ9A 4EM2A 1B4AA 1BC7C 3TKYA 3PQKA 1TQMA 4YIIA 5D8LB 5FO5A 3I58A 1TW3A 3HSEA 4YFNF 3JW4A 1QPMA 1XSDA 3HOSA 3JAMK 1B59A 4ETSA 2EFQA 1QNTA 3BZ6A 3JSPA 1Y0UA 2ZKZA 1UB9A 2DO7A 2XRNA 1G3WA 2BYVE 2YX7A 1OR7A 3F6OA 3KFWX 3F21A 4HV6A 1EH6A 5FB2A 3RTRA 4EGZA 2KKOA 4L0YB 5HDKA 1HBXG 1Z1DA 4P9FA 1GVJA 1BIBA 2DK8A 2E1NA 5D8KB 4KDPA 5F1RA 3DKWA 4EM1A 1J9IA 4A0ZA 4Q5SF 4L9JA 1QGPA 2GQQA 1UHMA 4FT8A 4L9VA 1RI7A 1IXSB 3C18A 1D8JA 1TQPA 4LGWA 1I27A 5F6FA 2K7LA 4I0BA 4LLGF 3LAPA 3CDHA 5LBQA 4OMZA 5KVRA 4S05A 5LHIA 1U5TC 3O3KA 1TQIA 4ON0A 1T39A 3RPUA 2VXZA 1XMKA 3RYPA 1ZLKA 5CVJA 2DI3A 3QP6A 1IN4A 1QBJA 2FMYA 3I5UA 3BJOA 3TQNA 2HTJA 1BI0A 5CVRA 3DP7A 1OYIA 1G3SA 2Z99A 3FM5A 1K78B 3BJAA 4XRFA 4LG0B 4IXAA 1EH7A 2NNNA 3L9FA 5EEHA 4Y15A 2JRTA 2ELHA 3BDDA 2QENA 4GGGA 4A6DA 2IW5A 1B9MA 1T2KA 3DQVC 3WODF 5FFZA 3T8TA 2BBYA 3HRTA 1KGSA 5IT9K 1Z6TA 1LVAA 1XB4A 2JPBA 3JSOA 3HUGA 3R61A 2F5DA 1YYVA 4M9ZA 3MEXA 1U78A 4CYDA 2M8EA 3PFIA 4ASNA 1U6GA 4ZYHA 3DPLC 1R36A 1GXPA 3ZMDA 4GXOA 4ZYGA 1BN5A 5CYVA 1ZH5A 2KJBA 3MZHA 2BV6A 1QZZA 2EJRA 1S29A 1K78A 2P5KA 1SMTA 4BHBA 2F2EA 2M87A 3SFZA 4YFXF 1SMYF 3QOPA 4O3MA 5BOXA 4XLPF 1DPUA 1YG2A 4U0VA 2EV6A 2EK5A 1E2XA 1ZHFA 1S8NA 2CGPA 1OMIA 4WCGA 1KU3A 3R0JA 4I09A 1YIOA 2R3SA 2EV5A 4I02A 1Z6RA 3H3UA 1FP2A 4I2OA 3TO9A 1U3EM 4EQQA 1IN7A 1SFUA 1R1UA 4PGGA 4M73A 3IWFA 3Q5FA 2RN7A 3HOTA 1TBXA 4BXUA 1T38A 4KIGA 1WKMA 2VC1A 1FC3A 2GZWA 4CICA 3VODA 4OIPF 2BE5F 1STZA 2PG4A 4EVIA 1SAXA 4IRGA 5HVQC 1K6OA 2HKXA 3V7RA 4Q4ZF 2VC0A 4OOIA 2CO5A 4L5JA 1F5TA 3W6KB 1P2FA 1IN6A 5JHUA 4YG2F 4K2EA 3P7NA 2O6GE 2A68F 5DCMB 4M9XA 3OOPA 2CFXA 1BBYA 2COMA 2M1BA 1LB2A 3U9GA 4Z2YA 2P4WA 5L3FA 3NRVA 4EGYA 3GYHX 4WX9A 3J81Z 1LDKB 2MLGA 2CYYA 2AS5F 3EQLF 3GFMA 2WWYA 4HYEA 2A69F 1PP8F 2ZCWA 3KLNA 1O3TA 5J8FA 1RZ4A 4R79A 4I7HA 4WF2A 2MH9A 3RPQA 2XVCA 3ABTA 1IXRC 4BNCA 1HKTA 4L18B 1XSVA 4KIFA 5BQTA 2QYOA 3J80K 5DCMA 3V7SA 2EA2A 3VEPA 4BHPA 5CVIA 1WQ2A 2HWVA 5LRSA 1KQ0A 1P4AA 3KZZA 4KNYA 2OZ6A 3LA3A 1U5TA 2ZXJA 1R23A 1RIOH 5HS7A 3W6JB 3FXRA 3BROA 3WE3A 2VBXA 2W84A 2NRAC 3R6SA 2MA3A 2FSWA 4RB3C 4KMUX 2UXNA 3ZMSA 3DV8A 2GA1A 2M30A 4M6XA 2UWMA 1RUNA 4GO1A 2BGCA 3BWGA 1J75A 1JGSA 1Q1HA 3HRUA 5A2QK 2DPUA 4MEXF 2IVMA 5HLGA 2VE9A 2QBYB 2XKOA 2STTA 1LQ1A 1UHWA 4OINF 4A5MA 4FHTA 1UFMA 4KYWA 1AWCA 3N4MA 2FNPA 2DQLA 2MH2A 4QWQA 3FX3A 1FWZA 2CW0F 5E17F 1IZ1A 3RJPA 3LA7A 2HOEA 2CWEA 2Y48A 1AOYA 5L3BA 1XD7A 3KE2A 1KU7A 3E6DA 2WV0A 5LEJA 4O6JA 3M8FA 3JTGA 2LDUA 2E1CA 3V8LA 4ESBA 3Q9VA 3LWFA 2RV8A 1EH8A 4EM0B 2A5YB 2ESHA 3DPTA 2XGXA 1R5HA 4JBAA 3QAHA 2G7UA 2XAFA 1KQ9A 4M74A 1HKQA 2HR3A 5CJ9A 5E1ZB 2W24A 2PQ8A 5DV5A 5FFXA 2A3SA 2ISYA 3KP7A 5HOOA 1ONVA 4A2UA 3GW2A 2V1UA 4GYGA 4AD9A 3RKYA 5ILUA 4PCQA 1T98A 1D3YA 4MQ9F 3SXYA 1ON1A 4L0ZB 4LK1F 2V79A 4RS8A 1WI9A 3G73A 5HDNA 3M7GA 4AIJA 4HOBA 4UV9A 1IN8A 3LFKA 1BI3A 1JHHA 4AIHA 4ESFA 1F1ZA 4HQMA 4XBFA 1DPRA 2R7DA 3FMRA 2Y75A 4G6QA 2HTSA 3ZN0A 2IPQX 1XMAA 2V6CA 3EUHA 1IXCA 4KICA 4CGZA 3LA2A 2QLZA 1ZRFA 1YW8A 1RUOA 3LSTA 5CVUA 4UNOA 3QU3A 3MQ0A 1P6RA 1LNWA 5FLXK 4EMSA 3RDIA 5K5RA 1YLFA 2XUBA 4UHTA 1O3RA 2ZMEA 1EV7A 1CF7A 2X0LA 3FF5A 4FX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX7 A;  5DCF A;  1XGO A;  1OPC A;  5DYM A;  4ENN A;  2OZU A;  4KUM A;  4MNU A;  3L2C A;  4CXF A;  1O57 A;  4RGU A;  4LB6 B;  5ICG A;  2P8T A;  3I0T A;  1TW2 A;  4ZZD A;  1FBQ A;  1IN5 A;  2GAU A;  1ZGJ A;  5FD5 A;  4PDK A;  2RGV A;  4KMF A;  2STW A;  3CO6 C;  1TLH B;  4I01 A;  2DPD A;  3NQO A;  3ROU A;  5KK1 A;  1BIA A;  4DNC A;  1KQ8 A;  2ZBK A;  3H92 A;  2FQ3 A;  3TGN A;  2YX4 A;  3ZPL A;  2ETH A;  1ZRE A;  3QPH A;  3WGI A;  5HLH A;  5TJJ A;  3P9C A;  4Q47 A;  1R58 A;  2PEX A;  3M9A A;  1I1S A;  4KN7 X;  4P96 A;  2WC2 A;  2CQK A;  2HQN A;  3I71 A;  4WXD A;  2VBZ A;  2IA0 A;  2PN6 A;  3F6V A;  1IF1 A;  3REO A;  3L09 A;  3TOB A;  3Q9S A;  2RQP A;  3MWM A;  5TRD A;  4HA8 A;  2EFW A;  4LMY A;  2H27 A;  1ODD A;  3KP2 A;  2YR2 A;  4RB1 A;  4EJV A;  2P5L C;  5JI6 A;  3IHU A;  1ZG1 A;  5DUI A;  3BY6 A;  4WXC A;  3WTZ A;  3E5Q A;  4R1H A;  4TV7 A;  2FEZ A;  3LQR A;  3E6M A;  1QO0 D;  3E5X A;  1QZY A;  4Y13 A;  4IRI A;  1OYY A;  2HYF A;  4F7Z A;  4EJW A;  3KZY A;  1W4M A;  2H6B A;  5ERI A;  4HDV A;  3ZMU A;  1W7P B;  2ZFW A;  5H6R A;  3E3V A;  3ZQ7 A;  1FYM A;  5DEQ A;  1XCB A;  1IW7 F;  3C1D A;  3K69 A;  4ZYD A;  2UZK A;  3CUQ A;  2OBP A;  1XCV A;  2DK5 A;  1BOA A;  4IRH A;  2JTV A;  4L5I A;  1FYK A;  2FF4 A;  3ZMT A;  1U2W A;  1WWX A;  4P5O A;  5AON A;  3VOE A;  4M9S A;  3DXJ F;  2L01 A;  5D4S A;  5K5O A;  4U88 A;  2D1V A;  1A04 A;  1MD0 A;  3U1D A;  4UV8 A;  2A6H F;  1W7P A;  1BM9 A;  2DBB A;  4UUV A;  1ZG3 A;  2L4A A;  5LGT A;  1P4W A;  3WTV C;  2LSO A;  1XGN A;  3GF2 A;  2FNA A;  4KT5 C;  1GXQ A;  2A07 F;  1I1G A;  2F5F A;  5DD4 A;  3ERE D;  2DTR A;  4HF2 A;  2F5E A;  3SZT A;  2IRF G;  2XAQ A;  3KP4 A;  3SHF A;  3VFZ A;  5LHH A;  4UVB A;  4RGR A;  4ESJ A;  1FSE A;  5DUK A;  4A0Y A;  1LDD A;  3QU6 A;  1S3J A;  4KFC A;  3HSF A;  5IT3 A;  2ADU A;  4XLN F;  3GZ6 A;  2OD5 A;  1ZLJ A;  2KIM A;  1ZAR A;  5BMZ A;  2D45 A;  1WSU A;  1BI2 A;  5H6Q A;  4LFU A;  4B09 A;  2V1X A;  2XV4 S;  4IVN A;  4A5N A;  2QVO A;  1L0O C;  3M8E A;  3WTW C;  2NS0 A;  3RYR A;  2X4H A;  3KP5 A;  2JSC A;  2RNJ A;  4YIF A;  3EYI A;  1XSX A;  1I5Z A;  2IT0 A;  3FZV A;  1KU2 A;  4MTE A;  2VOP A;  3MZY A;  1HQC A;  3GX4 X;  1FPQ A;  2VON A;  3CJN A;  1PDN C;  1DDN A;  4IPA A;  4HW0 A;  4WWC A;  1IAW A;  3N97 A;  1K79 A;  5CLS A;  3I54 A;  3V8J A;  2K02 A;  1SFE A;  1U5T B;  1F9N A;  5CVV A;  2A61 A;  1YFH A;  1C0W A;  3TDZ C;  3CO7 C;  2Q0O A;  4ENK A;  3DFG A;  4JQF A;  5BPI A;  4BAY A;  3IL2 A;  5E1X A;  4KIB A;  1TNT A;  2M5W A;  4MQV A;  4G7H F;  3HHG A;  4PGH A;  2Y0M A;  4ZYE A;  2EFP A;  3J7A O;  5AIQ A;  3LAJ A;  4U0Y A;  2XKP A;  3ELK A;  3F8M A;  3WU0 A;  1HSJ A;  2Z3Y A;  4N9I A;  1MGT A;  3H3Z A;  4KN4 X;  1R1T A;  4E70 A;  3IKT A;  3FMQ A;  2Z9O A;  1DUX C;  2HGC A;  1R7J A;  1S7A A;  4OMY A;  2QWW A;  3BOQ A;  2G9W A;  6PAX A;  3S2W A;  2RC4 A;  4AVP A;  3EDP A;  2K4B A;  2EWN A;  1W5T A;  1HW2 A;  3T8R A;  3HSR A;  3E6C C;  4ENM A;  2PFB A;  2PBI A;  1YTY A;  1K7A A;  4MHG A;  4OIO F;  1BJA A;  3D0S A;  2FML A;  2VOO A;  3FWE A;  3R4K A;  2O61 A;  1IRF A;  2BEO A;  5ILS A;  2B0L A;  4HDU A;  2QM3 A;  3COA C;  3E5U A;  2OQG A;  1FX7 A;  1FZP B;  2D1H A;  2FXA A;  4U0W A;  2DU9 A;  5J6X A;  2JZY A;  3P9I A;  4EJT A;  5E20 A;  3J81 K;  3R0A A;  1XN7 A;  2KIF A;  1MJB A;  5L3D A;  1O3Q A;  1RNL A;  1Z05 A;  3JAM Z;  3U2R A;  3FXU A;  1SFX A;  2GXB A;  5LEK A;  2K4J A;  4ZH4 F;  5D5V B;  1PP7 U;  4D0P A;  1MDM B;  5ICC A;  2QQB A;  3GZ5 A;  2YU3 A;  4RGS A;  3GFL A;  3E97 A;  4DQ2 A;  2HFH A;  2GA2 A;  2IA2 A;  1LDJ A;  3E6B A;  4ZZL A;  5K1Y A;  3KP3 A;  1V3F A;  2ZNZ A;  2W25 A;  3F8B A;  5H20 A;  1PUE E;  1O7L A;  4U7D A;  3D5L A;  3HTS B;  4WXH A;  5FGM A;  1IRG A;  3F8F A;  4QLC U;  3G3Z A;  2O03 A;  1YS7 A;  4IHS A;  1S7O A;  5JR3 A;  2KJC A;  2ZME B;  1UST A;  1CF7 B;  4HV5 A;  1VTN C;  1MDM A;  3IKV A;  5E8G A;  4NQW A;  3JTH A;  3TO7 A;  3R60 A;  1KYW A;  3CUO A;  3M1E A;  1XGM A;  1DP7 P;  4A6E A;  2RKH A;  4RB2 C;  2DLL A;  5K5Q A;  1H0M A;  1J0R A;  3LQQ A;  1ZN2 A;  2ISZ A;  2R7F A;  2XRO A;  4M71 A;  2XAG A;  4EV0 A;  1FBS A;  1NHA A;  3GXO A;  2J5P A;  2A6E F;  4RAZ A;  4O5V A;  1XDS A;  3ML6 A;  5JFR A;  2CG4 A;  3WE2 A;  1TTY A;  3TO6 A;  5D4R A;  4N0B A;  2NYX A;  2HDC A;  2YSR A;  2V1D A;  4HBL A;  3WTU C;  3GWZ A;  1FOK A;  2FOK A;  1Z9C A;  1R22 A;  2OU2 A;  1IUY A;  2AXL A;  4LB5 A;  2LF7 A;  3ECH A;  1YW7 A;  3IC7 A;  3FM3 A;  4H0E A;  4G7O F;  5LGN A;  2MC3 A;  5IT9 Z;  3RIR A;  1R00 A;  2L54 A;  1SD7 A;  3I4P A;  4LLN A;  2RVC A;  4HF1 A;  1ON2 A;  3FHZ A;  5L3E A;  3L00 A;  4LD5 A;  3TOA A;  1FT9 A;  2H94 A;  4NHJ A;  1F4K A;  1BI1 A;  3RKW A;  2HEO A;  1OKR A;  1Z7U A;  2WTE A;  1HW1 A;  3WTY C;  2HYG D;  1HST A;  4UXN A;  3ZP5 A;  3HTU A;  2ACJ A;  1ZAO A;  4A0X A;  4GYI A;  5F64 A;  4HLX A;  5AIP A;  2P7C B;  5D5X B;  2Q8K A;  3V4G A;  2VT3 A;  2EA4 A;  3CUQ B;  1ZYR F;  1HXD A;  3T0Y A;  4XSZ F;  3DEU A;  3TDU C;  2PJP A;  2GXG A;  4GCV A;  3GFI A;  5D6E A;  5LRR A;  2XIG A;  3O2P E;  3T5X A;  4BH9 A;  5LLQ A;  3KEQ A;  2EFO A;  3WU1 B;  1REP C;  3GEZ A;  2RDP A;  4B8X A;  3GUD A;  3IRQ A;  3C7J A;  4G9Y A;  4HQE A;  4BHC A;  1J7K A;  4RGX A;  3WGG A;  3GLX A;  5DDG A;  3RI4 A;  4AIK A;  3VB2 A;  3ZN1 A;  1ZRC A;  1BC8 C;  2XAH A;  2FA5 A;  2HKO A;  3ABU A;  4LLL A;  3I59 B;  3F8C A;  4M6Y A;  5ICE A;  4N9H A;  2JT1 A;  2OQR A;  3BPX A;  2JPC A;  4BYY A;  3F23 A;  3V8K A;  1B6A A;  1UCR A;  3CTA A;  1B9N A;  2F5C A;  1W7P D;  3K9T A;  3CLO A;  3PQJ A;  2C6Y A;  3HYI A;  4OIQ F;  2D2W A;  1H9G A;  2DAO A;  3HRS A;  5JVT A;  3KP6 A;  2IA1 A;  2P5V A;  3F3X A;  4LK0 F;  3QP5 A;  4LG0 A;  2W85 A;  1XGS A;  4L9T A;  2FE3 A;  2FU4 A;  3F8N A;  1LJ9 A;  4CO8 A;  4R8H A;  1MJ9 A;  5J8C A;  5ICF A;  2W57 A;  1SD6 A;  1G3Y A;  2P7V B;  1OYW A;  4G8X A;  3I59 A;  2FBH A;  3MAJ A;  2VOD A;  4AWX B;  4HZF A;  5D6F A;  2TDX A;  3I64 A;  5HS9 A;  2KIU A;  4U7B A;  1MJA A;  2Z5U A;  4CZZ A;  2OA4 A;  3B73 A;  4JK1 X;  1G6N A;  2KRF A;  3DF8 A;  3IWZ A;  3P9K A;  1FNN A;  2P6S A;  2PLY A;  3L7W A;  1T0F A;  3KEO A;  4XSX F;  2HS5 A;  1D5V A;  2DW4 A;  1LEB A;  5E18 F;  2CSO A;  3BJ6 A;  3ISP A;  4S04 A;  3J80 Z;  1H9T A;  4A12 A;  4MGR A;  3T1B A;  3IRR A;  1FLI A;  2E7X A;  1KYZ A;  1R1V A;  4EJU A;  5D5U B;  1E17 A;  3QPT A;  1I6X A;  2HZT A;  4MEY F;  1FBU A;  4MTD A;  2H09 A;  1G4D A;  3GFJ A;  1FYL A;  4Q48 A;  2O8X A;  1L3L A;  2M45 A;  1P92 A;  2L02 A;  1FY7 A;  5FD6 A;  2QQA A;  2GWR A;  4HX4 A;  4HLY A;  1HKS A;  2EV0 A;  3ZMZ A;  1KU9 A;  3KLO A;  3HRM A;  3FMS A;  2LNB A;  4BQA A;  5A2Q Z;  3KET A;  2L3D A;  3I53 A;  1J2X A;  1XDU A;  5D5W B;  2O3F A;  1Z91 A;  4EJO A;  2GIV A;  1MKM A;  2XAJ A;  2H6C A;  3SQN A;  3NEU A;  3MCZ A;  2P6T A;  3OV8 A;  2ZO4 A;  1ZRD A;  2ESN A;  1KA8 A;  2ZJ2 A;  1MZB A;  2LF8 A;  4Y17 A;  5BS6 A;  3K0L A;  4PZJ A;  4G7Z F;  1JE8 A;  1W5S A;  3F22 A;  2K86 A;  4I98 B;  5L3G A;  4HF0 A;  1JXS A;  1V4R A;  2PMH A;  3K1M A;  3BPV A;  5DD8 A;  1SD5 A;  1P4X A;  2MD5 A;  2YPR A;  2VE8 A;  1YS6 A;  5ED4 A;  2PMU A;  4CDG A;  1T6S A;  2DT5 A;  1YQA A;  3C3W A;  1B1B A;  1YO5 C;  2QUF A;  5HS8 A;  1ZG5 A;  5E8I A;  3WG9 A;  2ZNY A;  4OIR F;  2IJL A;  4RB0 A;  3K1N A;  2MLK A;  1YW9 A;  3AAF A;  2NAZ A;  2LKP A;  3HHH A;  1GHC A;  3EET A;  2VT2 A;  2XHK A;  3SZP A;  2J5O A;  4UVC A;  2Z33 A;  3QRF F;  2IP2 A;  1ZGA A;  5L3C A;  2EB7 A;  2Q2E A;  4HX8 A;  4IF4 A;  1JHF A;  3F72 A;  4G94 A;  2VBY A;  2FRH A;  2G7H A;  3WGH A;  1FSH A;  3RKX A;  2PI0 A;  5LGU A;  5HDG A;  2DFI A;  3CUQ C;  5ILV A;  1R5G A;  1SD4 A;  2FBI A;  1QQI A;  2OAZ A;  3HIF A;  1TNS A;  1O7F A;  5HLI A;  2HQR A;  5BPD A;  2UXX A;  4KA4 A;  2O0Y A;  4WK8 F;  3K2Z A;  4IHT A;  3BP8 A;  4HAM A;  3ECO A;  5LHG A;  1FP1 D;  1S6L A;  3MFK A;  5FLX Z;  2VBW A;  4LJZ F;  1G3T A;  5E1W A;  4CHU A;  4IJA A;  1U8R A;  4P55 A;  1LEA A;  1J59 A;  3WTT C;  4RAY A;  1X3U A;  3GO5 A;  2XAS A;  2DQR A;  1USS A;  2K27 A;  1WRJ A;  3ZMV A;  1ULY A;  4UVA A;  4I0A A;  2EFN A;  4NB5 A;  2QBY A;  1D8K A;  2MBF A;  5EEG A;  2QZ8 A;  3V7C A;  1J5Y A;  2V9V A;  4YFK F;  3GVA A;  2FBK A;  4P9U A;  3ULQ B;  4FX0 A;  3O6B B;  3FXQ A;  4G6D A;  2VN2 A;  2E7W A;  3EYY A;  4M72 A;  2NNY A;  4OU0 A;  4ENJ A;  3K1P A;  3KCC A;  2L4M A;  1HW5 A;  3B02 A;  3WTS C;  1O3S A;  4L9N A;  1CGP A;  3WTX C;  2QQ9 A;  4EM2 A;  1B4A A;  1BC7 C;  3TKY A;  3PQK A;  1TQM A;  4YII A;  5D8L B;  5FO5 A;  3I58 A;  1TW3 A;  3HSE A;  4YFN F;  3JW4 A;  1QPM A;  1XSD A;  3HOS A;  3JAM K;  1B59 A;  4ETS A;  2EFQ A;  1QNT A;  3BZ6 A;  3JSP A;  1Y0U A;  2ZKZ A;  1UB9 A;  2DO7 A;  2XRN A;  1G3W A;  2BYV E;  2YX7 A;  1OR7 A;  3F6O A;  3KFW X;  3F21 A;  4HV6 A;  1EH6 A;  5FB2 A;  3RTR A;  4EGZ A;  2KKO A;  4L0Y B;  5HDK A;  1HBX G;  1Z1D A;  4P9F A;  1GVJ A;  1BIB A;  2DK8 A;  2E1N A;  5D8K B;  4KDP A;  5F1R A;  3DKW A;  4EM1 A;  1J9I A;  4A0Z A;  4Q5S F;  4L9J A;  1QGP A;  2GQQ A;  1UHM A;  4FT8 A;  4L9V A;  1RI7 A;  1IXS B;  3C18 A;  1D8J A;  1TQP A;  4LGW A;  1I27 A;  5F6F A;  2K7L A;  4I0B A;  4LLG F;  3LAP A;  3CDH A;  5LBQ A;  4OMZ A;  5KVR A;  4S05 A;  5LHI A;  1U5T C;  3O3K A;  1TQI A;  4ON0 A;  1T39 A;  3RPU A;  2VXZ A;  1XMK A;  3RYP A;  1ZLK A;  5CVJ A;  2DI3 A;  3QP6 A;  1IN4 A;  1QBJ A;  2FMY A;  3I5U A;  3BJO A;  3TQN A;  2HTJ A;  1BI0 A;  5CVR A;  3DP7 A;  1OYI A;  1G3S A;  2Z99 A;  3FM5 A;  1K78 B;  3BJA A;  4XRF A;  4LG0 B;  4IXA A;  1EH7 A;  2NNN A;  3L9F A;  5EEH A;  4Y15 A;  2JRT A;  2ELH A;  3BDD A;  2QEN A;  4GGG A;  4A6D A;  2IW5 A;  1B9M A;  1T2K A;  3DQV C;  3WOD F;  5FFZ A;  3T8T A;  2BBY A;  3HRT A;  1KGS A;  5IT9 K;  1Z6T A;  1LVA A;  1XB4 A;  2JPB A;  3JSO A;  3HUG A;  3R61 A;  2F5D A;  1YYV A;  4M9Z A;  3MEX A;  1U78 A;  4CYD A;  2M8E A;  3PFI A;  4ASN A;  1U6G A;  4ZYH A;  3DPL C;  1R36 A;  1GXP A;  3ZMD A;  4GXO A;  4ZYG A;  1BN5 A;  5CYV A;  1ZH5 A;  2KJB A;  3MZH A;  2BV6 A;  1QZZ A;  2EJR A;  1S29 A;  1K78 A;  2P5K A;  1SMT A;  4BHB A;  2F2E A;  2M87 A;  3SFZ A;  4YFX F;  1SMY F;  3QOP A;  4O3M A;  5BOX A;  4XLP F;  1DPU A;  1YG2 A;  4U0V A;  2EV6 A;  2EK5 A;  1E2X A;  1ZHF A;  1S8N A;  2CGP A;  1OMI A;  4WCG A;  1KU3 A;  3R0J A;  4I09 A;  1YIO A;  2R3S A;  2EV5 A;  4I02 A;  1Z6R A;  3H3U A;  1FP2 A;  4I2O A;  3TO9 A;  1U3E M;  4EQQ A;  1IN7 A;  1SFU A;  1R1U A;  4PGG A;  4M73 A;  3IWF A;  3Q5F A;  2RN7 A;  3HOT A;  1TBX A;  4BXU A;  1T38 A;  4KIG A;  1WKM A;  2VC1 A;  1FC3 A;  2GZW A;  4CIC A;  3VOD A;  4OIP F;  2BE5 F;  1STZ A;  2PG4 A;  4EVI A;  1SAX A;  4IRG A;  5HVQ C;  1K6O A;  2HKX A;  3V7R A;  4Q4Z F;  2VC0 A;  4OOI A;  2CO5 A;  4L5J A;  1F5T A;  3W6K B;  1P2F A;  1IN6 A;  5JHU A;  4YG2 F;  4K2E A;  3P7N A;  2O6G E;  2A68 F;  5DCM B;  4M9X A;  3OOP A;  2CFX A;  1BBY A;  2COM A;  2M1B A;  1LB2 A;  3U9G A;  4Z2Y A;  2P4W A;  5L3F A;  3NRV A;  4EGY A;  3GYH X;  4WX9 A;  3J81 Z;  1LDK B;  2MLG A;  2CYY A;  2AS5 F;  3EQL F;  3GFM A;  2WWY A;  4HYE A;  2A69 F;  1PP8 F;  2ZCW A;  3KLN A;  1O3T A;  5J8F A;  1RZ4 A;  4R79 A;  4I7H A;  4WF2 A;  2MH9 A;  3RPQ A;  2XVC A;  3ABT A;  1IXR C;  4BNC A;  1HKT A;  4L18 B;  1XSV A;  4KIF A;  5BQT A;  2QYO A;  3J80 K;  5DCM A;  3V7S A;  2EA2 A;  3VEP A;  4BHP A;  5CVI A;  1WQ2 A;  2HWV A;  5LRS A;  1KQ0 A;  1P4A A;  3KZZ A;  4KNY A;  2OZ6 A;  3LA3 A;  1U5T A;  2ZXJ A;  1R23 A;  1RIO H;  5HS7 A;  3W6J B;  3FXR A;  3BRO A;  3WE3 A;  2VBX A;  2W84 A;  2NRA C;  3R6S A;  2MA3 A;  2FSW A;  4RB3 C;  4KMU X;  2UXN A;  3ZMS A;  3DV8 A;  2GA1 A;  2M30 A;  4M6X A;  2UWM A;  1RUN A;  4GO1 A;  2BGC A;  3BWG A;  1J75 A;  1JGS A;  1Q1H A;  3HRU A;  5A2Q K;  2DPU A;  4MEX F;  2IVM A;  5HLG A;  2VE9 A;  2QBY B;  2XKO A;  2STT A;  1LQ1 A;  1UHW A;  4OIN F;  4A5M A;  4FHT A;  1UFM A;  4KYW A;  1AWC A;  3N4M A;  2FNP A;  2DQL A;  2MH2 A;  4QWQ A;  3FX3 A;  1FWZ A;  2CW0 F;  5E17 F;  1IZ1 A;  3RJP A;  3LA7 A;  2HOE A;  2CWE A;  2Y48 A;  1AOY A;  5L3B A;  1XD7 A;  3KE2 A;  1KU7 A;  3E6D A;  2WV0 A;  5LEJ A;  4O6J A;  3M8F A;  3JTG A;  2LDU A;  2E1C A;  3V8L A;  4ESB A;  3Q9V A;  3LWF A;  2RV8 A;  1EH8 A;  4EM0 B;  2A5Y B;  2ESH A;  3DPT A;  2XGX A;  1R5H A;  4JBA A;  3QAH A;  2G7U A;  2XAF A;  1KQ9 A;  4M74 A;  1HKQ A;  2HR3 A;  5CJ9 A;  5E1Z B;  2W24 A;  2PQ8 A;  5DV5 A;  5FFX A;  2A3S A;  2ISY A;  3KP7 A;  5HOO A;  1ONV A;  4A2U A;  3GW2 A;  2V1U A;  4GYG A;  4AD9 A;  3RKY A;  5ILU A;  4PCQ A;  1T98 A;  1D3Y A;  4MQ9 F;  3SXY A;  1ON1 A;  4L0Z B;  4LK1 F;  2V79 A;  4RS8 A;  1WI9 A;  3G73 A;  5HDN A;  3M7G A;  4AIJ A;  4HOB A;  4UV9 A;  1IN8 A;  3LFK A;  1BI3 A;  1JHH A;  4AIH A;  4ESF A;  1F1Z A;  4HQM A;  4XBF A;  1DPR A;  2R7D A;  3FMR A;  2Y75 A;  4G6Q A;  2HTS A;  3ZN0 A;  2IPQ X;  1XMA A;  2V6C A;  3EUH A;  1IXC A;  4KIC A;  4CGZ A;  3LA2 A;  2QLZ A;  1ZRF A;  1YW8 A;  1RUO A;  3LST A;  5CVU A;  4UNO A;  3QU3 A;  3MQ0 A;  1P6R A;  1LNW A;  5FLX K;  4EMS A;  3RDI A;  5K5R A;  1YLF A;  2XUB A;  4UHT A;  1O3R A;  2ZME A;  1EV7 A;  1CF7 A;  2X0L A;  3FF5 A;  4FX4 A; 
#chains in the Genus database with same CATH topology
 5B1A H;  4X6A J;  2R7O A;  3HXL A;  2YUS A;  2ZJP F;  3OYL A;  3O8G A;  4HX7 A;  2K5C A;  3ONQ A;  5DCF A;  1XGO A;  1D1B A;  2HQA A;  1OPC A;  5DYM A;  1JKO C;  1LKX A;  1MMN A;  2LYC A;  4ENN A;  2OZU A;  2ZXH A;  4KUM A;  4CUG A;  2KMU A;  4MNU A;  4RA2 A;  2EIN H;  5B66 C;  3L2C A;  4CXF A;  1YJN I;  1O57 A;  2M0M A;  5F1J A;  3CCE I;  4RGU A;  2VJ4 A;  4LB6 B;  3RCO A;  5ICG A;  2P8T A;  3I0T A;  1TW2 A;  2K9Q A;  3HOV J;  1TWF J;  1FBQ A;  4ZZD A;  3VSK A;  1IN5 A;  3A2K A;  2GAU A;  2L7F P;  1ZGJ A;  5FD5 A;  2M34 A;  1IV8 A;  2DA6 A;  3OYA A;  4PDK A;  3J7A Y;  2RGV A;  1FTT A;  1SC7 A;  4KMF A;  2STW A;  2V1N A;  3IUO A;  4FCY A;  3CO6 C;  3H0D A;  5EDN A;  3RPU D;  1TLH B;  4I01 A;  4B1R A;  4A3D J;  2DPD A;  3NQO A;  3ROU A;  5KK1 A;  2KZV A;  3CZ6 A;  1BIA A;  4DNC A;  4DYQ A;  1KQ8 A;  2ZBK A;  3H92 A;  1Z77 A;  2FQ3 A;  3TGN A;  2YX4 A;  3ZPL A;  4XNF A;  2ETH A;  1R5I D;  1ZRE A;  4OAY A;  3QPH A;  3WGI A;  4DBQ A;  5HLH A;  5TJJ A;  3P9C A;  1IRG A;  2LTP A;  2XSD C;  1X3Z B;  2LLK A;  4Q47 A;  1R58 A;  3OIQ A;  2PEX A;  4I99 C;  3M9A A;  1I1S A;  4KN7 X;  4P96 A;  2WC2 A;  5GPA A;  2CQK A;  2R5Y B;  2HQN A;  4AM3 A;  1JUP A;  4PFP A;  3I71 A;  4WXD A;  2VBZ A;  2IA0 A;  2PN6 A;  3F6V A;  2OCC H;  1IF1 A;  2ZXW H;  3REO A;  2CV2 A;  3L09 A;  3TOB A;  3Q9S A;  2RQP A;  3MWM A;  5TRD A;  4HA8 A;  2EFW A;  4MFD A;  4LMY A;  2H27 A;  1OCR H;  1ODD A;  3KP2 A;  1IUF A;  4CSW A;  1AA7 A;  1BW5 A;  2YR2 A;  4RB1 A;  1S72 I;  4EJV A;  2P5L C;  5JI6 A;  3IHU A;  3RZD J;  1ZG1 A;  2ZXI A;  3VDX A;  5DUI A;  3BY6 A;  4WXC A;  1UMQ A;  3E5Q A;  4R1H A;  4TV7 A;  3WTZ A;  4LG3 A;  2FEZ A;  3LQR A;  1ERD A;  2ME0 A;  2MG4 A;  3E6M A;  1QO0 D;  3PIO F;  1AKH B;  3E5X A;  3L2W A;  1QZY A;  4Y13 A;  4IRI A;  1OYY A;  2HYF A;  2BW3 B;  2OUM A;  2YS9 A;  3A02 A;  4F7Z A;  4EJW A;  3KZY A;  4BQN A;  3LSM A;  4MIM A;  3JCU C;  1W4M A;  3TW6 A;  2LD5 A;  2H6B A;  2DFF A;  3OS0 A;  5ERI A;  4HDV A;  3S1M J;  3ZMU A;  1W7P B;  2ZFW A;  5H6R A;  1CQT A;  3E3V A;  3ZQ7 A;  1FYM A;  5DEQ A;  1XCB A;  1WJE A;  1IW7 F;  3C1D A;  1HDD C;  3K69 A;  4JOM A;  4ZYD A;  4AC0 A;  2UZK A;  2O5R A;  2CFO A;  2E1M C;  2K3P A;  3CUQ A;  2R5Y A;  1K83 J;  2JUG A;  1XCV A;  2OBP A;  3DU6 A;  3SYT A;  2DK5 A;  2RRE A;  1BOA A;  2FX0 A;  1E3O C;  1EA3 A;  4IRH A;  3SEQ A;  2JTV A;  2IGK A;  4L5I A;  1FYK A;  4BGD A;  1Y56 A;  1VI0 A;  4NNJ A;  4BXF A;  4FQG A;  2FF4 A;  3ZMT A;  1U2W A;  1WWX A;  2NS7 A;  4P5O A;  2CUE A;  2F5V A;  2WBM A;  5AON A;  1BR1 A;  1P9Q C;  3VOE A;  3ABM H;  4M9S A;  3DXJ F;  2L01 A;  3FK7 A;  2Y0S N;  1MMS A;  2V9P A;  2F4M B;  2MW8 A;  2BY2 A;  3BTC A;  2E5N A;  5D4S A;  5JHF A;  5K5O A;  2O9L A;  4U88 A;  3DKY A;  1MIJ A;  2D1V A;  1ZGW A;  1A04 A;  1MD0 A;  4IOC F;  3BTJ A;  3GTO J;  2L0K A;  2BW3 A;  2ICW G;  3U1D A;  4UV8 A;  4II3 A;  4BUP A;  4D5F A;  4I6Z A;  1EF4 A;  2A6H F;  5DM6 F;  4B3A A;  5IP7 J;  3PIP F;  2CJJ A;  1W7P A;  1BM9 A;  1YRN B;  2DBB A;  1ZTR A;  2BVM A;  4CCN A;  2JQ7 A;  1JT6 A;  4UUV A;  3S1R J;  5F0H A;  2ME6 A;  1ZG3 A;  4RBO A;  2L4A A;  5LGT A;  4C30 A;  3W2A A;  3LSI A;  4IHY A;  2PMZ A;  1P4W A;  3BG9 A;  3WTV C;  1MND A;  4XRS G;  2LSO A;  1XGN A;  3GF2 A;  3VWB A;  3BG7 A;  1MSE C;  3HBL A;  4XON A;  2FNA A;  4KT5 C;  1GXQ A;  1QHG A;  2QCO A;  3WG7 H;  3OYH A;  3G71 I;  1DU0 A;  2A07 F;  4CCK A;  1I1G A;  4XID A;  2F5F A;  5DD4 A;  2JUC A;  4Z6Y A;  3ERE D;  2BHZ A;  2DTR A;  4HF2 A;  3L1P A;  2F5E A;  3SZT A;  2EIJ H;  2IRF G;  1G2H A;  3PNV A;  2XAQ A;  3OYC A;  3KP4 A;  2M7B A;  3SHF A;  3G1O A;  3VFZ A;  3CDI A;  3MD2 A;  1SAU A;  5LHH A;  3TP3 A;  3DLA A;  4NBQ A;  2HVR A;  3H5N A;  3L2U A;  4UVB A;  2EIM H;  3UR3 C;  2A5W A;  4RGR A;  4ESJ A;  1FSE A;  5DUK A;  4A0Y A;  1LDD A;  3QU6 A;  4XQF A;  3H5A A;  3NAU A;  1S3J A;  4KFC A;  3HSF A;  2MSY A;  3ZQQ A;  5IT3 A;  1JKR C;  1T56 A;  2ADU A;  4XLN F;  1GT0 C;  1VQN I;  3M1C A;  3WU2 C;  3GZ6 A;  1YRN A;  2OD5 A;  1ZLJ A;  2KIM A;  2JSP A;  1ZAR A;  2LC2 A;  5DS9 A;  5BMZ A;  2D45 A;  5FKK A;  4HRI A;  1WSU A;  4F92 B;  2UUZ A;  1BI2 A;  5H6Q A;  4LFU A;  5K7Z A;  4B09 A;  1OCZ H;  3AG1 H;  2V1X A;  3I4N J;  2DMU A;  2XV4 S;  3HB9 A;  4IVN A;  4RM3 A;  5E79 C;  4A5N A;  2QVO A;  1L0O C;  3M8E A;  3WTW C;  4C9Y A;  3JR9 A;  2NS0 A;  3RYR A;  2X4H A;  4RDU A;  4BEH B;  3KP5 A;  2JSC A;  2OV7 A;  3RSN A;  2RNJ A;  4YIF A;  1ZR2 A;  2HU9 A;  4G12 A;  2LFB A;  1FOW A;  4S0H B;  1XS9 A;  3EYI A;  2PJR B;  1XSX A;  3MKL A;  1I5Z A;  2IT0 A;  3FZV A;  3TBI A;  2OTJ I;  4IO9 F;  1KU2 A;  1VQ4 I;  3ASN H;  4MTE A;  2VOP A;  3MZY A;  5LD2 C;  2BZT A;  1HQC A;  3GX4 X;  1POG A;  3E7L A;  4FIS A;  4E7H A;  1FPQ A;  2QGU A;  2VON A;  3CJN A;  1OR7 C;  1PDN C;  1DDN A;  4IPA A;  4HW0 A;  4WWC A;  1IAW A;  2VJ5 A;  3N97 A;  1K79 A;  5CLS A;  3I54 A;  3V8J A;  3KIO A;  2DMT A;  2K02 A;  2EPF A;  4BKX A;  1SFE A;  1U5T B;  1F9N A;  5CVV A;  2A61 A;  3S1N J;  1YFH A;  1C0W A;  1Q1V A;  3CME I;  2DA7 A;  1HLV A;  3TDZ C;  1YI2 I;  3CO7 C;  2Q0O A;  2KRH A;  3GTQ J;  4ENK A;  3A03 A;  1JUS A;  3VYT B;  4DYC A;  5FRO A;  3DFG A;  2DOE A;  2CMP A;  2W4S A;  3ERM A;  4JQF A;  1FMV A;  5BPI A;  3BLY A;  4DJA A;  4BAC A;  4BAY A;  3IL2 A;  5E1X A;  4KIB A;  3OSF A;  2PJR A;  2HZD A;  4IKF A;  1TNT A;  1JUM A;  2M5W A;  4MQV A;  4G7H F;  3HHG A;  1BW6 A;  4PGH A;  2Y0M A;  4ZYE A;  2EFP A;  3J7A O;  1Z21 A;  4XIC A;  5AIQ A;  3LAJ A;  4A3I J;  4U0Y A;  2XKP A;  2LG4 A;  3ELK A;  5C44 J;  2JWT A;  3F8M A;  3WU0 A;  4BDZ A;  2O8K A;  1HSJ A;  1D0X A;  4ZDO A;  2Z3Y A;  4N9I A;  2R7T A;  3K70 D;  1MGT A;  3DKX A;  3H3Z A;  4KN4 X;  1R1T A;  1OQY A;  4E70 A;  1PUF A;  3BC8 A;  1X4P A;  3Q3S A;  3IKT A;  2DOA A;  3FMQ A;  2Z9O A;  1DUX C;  3M4O J;  1NG7 A;  1S9H A;  1IV6 A;  4A3G J;  9ANT A;  2HGC A;  1R7J A;  2JVH A;  1S7A A;  4OMY A;  2I5U A;  2QWW A;  1N75 A;  4JX4 A;  1QPI A;  3BOQ A;  1MMD A;  2G9W A;  1FOY A;  4CH7 A;  6PAX A;  3S2W A;  2RC4 A;  2WA0 A;  3EDP A;  4AVP A;  5C3E J;  2K4B A;  2EWN A;  3NWT A;  1W5T A;  3I3L A;  5IYB J;  1MNM C;  1HW2 A;  2L9N A;  3T8R A;  3OYM A;  3L2R A;  3HSR A;  3E6C C;  2D5V A;  4FET A;  4ENM A;  2XAU A;  2PFB A;  2XB0 X;  4FE7 A;  2PBI A;  3SDG A;  1YTY A;  1W36 D;  1VQL I;  3CQZ J;  1WJ5 A;  3LOC A;  4MHG A;  1K7A A;  4OIO F;  1BJA A;  3D0S A;  3CCY A;  2FML A;  3FDY A;  1V5G A;  2VOO A;  1UJ8 A;  3FWE A;  3R4K A;  1NK2 P;  2O61 A;  3JRC A;  2X6X A;  3OR1 C;  3FIS A;  1IRF A;  5K7H A;  4E7Z A;  2BEO A;  5ILS A;  2OJE D;  2B0L A;  2RQQ A;  4HDU A;  2QM3 A;  2Q1Z B;  3COA C;  2GXA A;  3HOU J;  3E5U A;  2X6Y A;  2OQG A;  1FX7 A;  4F93 B;  1FZP B;  2D1H A;  3PFY A;  3ZQF A;  1X3W B;  2FXA A;  1WJA A;  4U0W A;  2JA7 J;  2DU9 A;  5J6X A;  3BQY A;  2JZY A;  3P9I A;  1IG7 A;  4EJT A;  5E20 A;  2AXT C;  3J81 K;  2CUJ A;  1KZH A;  4C2M J;  3CC2 I;  2L7K A;  1BJZ A;  1XN7 A;  3R0A A;  3QQA A;  3DBR B;  2KIF A;  1K4T A;  1MJB A;  3OWT A;  4M3B A;  5L3D A;  1ITY A;  5FLM J;  1XX5 A;  4N4O B;  1O3Q A;  1RNL A;  1Z05 A;  2XB5 A;  3JAM Z;  3U2R A;  3FXU A;  4LOC A;  1SFX A;  2GXB A;  3CD6 I;  1XMX A;  2DFE A;  4ZTF A;  2VPR A;  5LEK A;  2K4J A;  4ZH4 F;  2PMZ N;  4PFO A;  5D5V B;  1TWH J;  4ZDP A;  4PJL A;  4V19 K;  1PP7 U;  4D0P A;  1MDM B;  4BE0 A;  1EKE A;  3LNQ A;  2B7E A;  3KYD B;  5ICC A;  2QQB A;  3LSH A;  4D5C A;  4NQW B;  4F91 B;  4BY1 J;  3GZ5 A;  2YU3 A;  4RGS A;  3GFL A;  3E97 A;  2XPW A;  4PSW A;  4DQ2 A;  2HFH A;  3LSP A;  2GA2 A;  4AUX A;  2IA2 A;  3HDD A;  2GBY A;  1LDJ A;  1DU6 A;  3E6B A;  4ZZL A;  5K1Y A;  3GLL A;  5EEA A;  1G59 A;  3KP3 A;  1V3F A;  4CCJ A;  2M4K A;  2ZNZ A;  3QYF A;  2W25 A;  4DGW B;  3IAM 2;  2NOJ B;  3DEW A;  2TCT A;  1WJF A;  5KAI C;  3F8B A;  5H20 A;  1PUE E;  1O7L A;  1X1C A;  2E2H J;  4RLQ A;  4U7D A;  3D5L A;  3HTS B;  2P81 A;  4WXH A;  2WAQ N;  3CDL A;  1V54 H;  1VF9 A;  4B44 A;  3GTJ J;  3RKQ A;  5FGM A;  3G4S I;  2EZL A;  3F8F A;  4QLC U;  1ETW A;  3G3Z A;  2IXS A;  1VQ5 I;  2O03 A;  1VQM I;  5FRM A;  3CCL I;  1YS7 A;  4IHS A;  2IGO A;  5LFA A;  5J47 A;  1S7O A;  2VJI A;  5JR3 A;  2KJC A;  2ZME B;  2VLA A;  3M8J A;  1TWG J;  1UST A;  1CF7 B;  3EUK L;  4HV5 A;  3FXJ A;  1U8B A;  3L2Q A;  1WJD A;  1VTN C;  1MDM A;  2K85 A;  2NVQ J;  1VQ8 I;  3IKV A;  5E8G A;  4NQW A;  3JTH A;  3TO7 A;  3R60 A;  1KYW A;  3CUO A;  3M1E A;  4RAG A;  1XGM A;  4XK4 A;  1DP7 P;  4A3B J;  4A6E A;  2RKH A;  4RB2 C;  2DLL A;  2XF6 A;  5K5Q A;  1H0M A;  1DP3 A;  1R71 A;  3DEE A;  3A1Y A;  1MMA A;  2ECC A;  1IRX A;  1X1P A;  2HDD A;  2AQE A;  1J0R A;  2ZB9 A;  2L7M P;  3LQQ A;  1ZN2 A;  2ISZ A;  4YEL A;  2R7F A;  2XRO A;  2ECB A;  4I76 A;  4M71 A;  2XAG A;  2LMD A;  4B4C A;  4EV0 A;  3P5J A;  2ZFU A;  1QZE A;  3VYS B;  1FBS A;  1MNE A;  1NHA A;  3GXO A;  4A69 C;  4QPO A;  2J5P A;  2A6E F;  3F0C A;  4BJ5 C;  3U21 A;  4RAZ A;  4NC6 A;  4O5V A;  1XDS A;  4BQQ A;  3ML6 A;  3NAR A;  3FIW A;  5JFR A;  2CG4 A;  3WE2 A;  1TTY A;  3TO6 A;  3X2Q H;  5D4R A;  4N0B A;  2LKX A;  3K10 A;  2NYX A;  2NS8 A;  3SFI A;  2BOL A;  2HDC A;  2YSR A;  2V1D A;  4HBL A;  3WTU C;  3GWZ A;  1FOK A;  2FOK A;  1Z9C A;  1R22 A;  1MBE A;  3UNG C;  2OU2 A;  1IUY A;  2AXL A;  4LB5 A;  2LF7 A;  1OCP A;  3ECH A;  1Z3Y A;  1YW7 A;  3CF2 A;  3IC7 A;  1Y1V J;  3WHC A;  3FM3 A;  2W82 A;  4DW6 A;  4BE1 A;  2ID6 A;  4H0E A;  4G7O F;  5LGN A;  3I56 I;  2K3F A;  2N8G A;  4OWR B;  1BR2 A;  3ZQI A;  4DYR A;  2R93 J;  2MC3 A;  5IT9 Z;  3RIR A;  1R00 A;  2L54 A;  1XTA A;  2DA2 A;  3LFU A;  4DIQ A;  1SD7 A;  3I4P A;  4LLN A;  1A35 A;  2R5Z B;  1H89 C;  2RVC A;  3C2G A;  4HF1 A;  2W48 A;  5E3L A;  3K4N A;  1MBH A;  3MKY B;  2CW8 A;  3CF5 F;  2FD5 A;  1ON2 A;  3FHZ A;  5L3E A;  3L00 A;  4LD5 A;  3TOA A;  1FT9 A;  2H94 A;  1WCM J;  4XM3 A;  4NHJ A;  3BTL A;  2MFZ A;  1F4K A;  1BI1 A;  3RKW A;  2HEO A;  2VQC A;  1OKR A;  2R0Q C;  1Z7U A;  2WTE A;  1W0T A;  1HW1 A;  3K4B A;  3OS2 A;  4A3F J;  5KAF C;  3WTY C;  2HYG D;  1HST A;  4UXN A;  3ZP5 A;  1LFB A;  1I6H J;  3HTU A;  2Y69 H;  2ACJ A;  5FKL A;  1ZAO A;  4XKC A;  2XSJ C;  4A0X A;  3DPU A;  3GBG A;  1ETV A;  4GYI A;  2NVY J;  5FJ8 J;  5F64 A;  3CJR B;  4HLX A;  5AIP A;  2P7C B;  2NVX J;  5D5X B;  2Q8K A;  2PX9 A;  3V4G A;  5M3F J;  1D1A A;  2EA4 A;  2VT3 A;  1P7J A;  1APL C;  3S8P A;  5M3M J;  4PSX A;  3ESW B;  3CUQ B;  1ZYR F;  3HJE A;  1HXD A;  2CQQ A;  2VXD A;  3F9K A;  2HNH A;  3T0Y A;  4XSZ F;  4FE4 A;  2VQH A;  3DEU A;  3OL3 A;  2YU9 J;  2R5Z A;  1VND A;  3RQ4 A;  3TDU C;  2PJP A;  4BJ6 C;  4CCO A;  1WZ2 A;  2GXG A;  1YHQ I;  4GCV A;  3GFI A;  2WY7 Q;  5D6E A;  5LRR A;  3CMA I;  3S1Q J;  1E0E A;  1WVR A;  2DXI A;  2XIG A;  3O2P E;  5EZG A;  2B63 J;  2X6W A;  3T5X A;  4BH9 A;  5EGO B;  5LLQ A;  4RAF A;  3QYE A;  1TP4 A;  2KRC A;  3KEQ A;  2EFO A;  4PJ0 C;  3WU1 B;  1Y8R B;  1JTY A;  2CQN A;  1T8I A;  1QU3 A;  1REP C;  3GEZ A;  2RDP A;  4HNU A;  4B8X A;  5HLT A;  5E3M A;  3GUD A;  3HZJ A;  3IRQ A;  2OCE A;  5F04 A;  3C7J A;  1SFK A;  5HNH A;  4G9Y A;  4HQE A;  4DZP A;  2JA6 J;  3DWL E;  4BHC A;  1J7K A;  1ZQ3 P;  4RGX A;  3WGG A;  3GLX A;  5DDG A;  5M5Y J;  2VKH A;  1Y39 A;  4NC8 A;  3RI4 A;  1Z3X A;  3W2V A;  4AIK A;  3VB2 A;  3ZN1 A;  2MD0 A;  2V4J C;  1ZRC A;  4FAS D;  1BC8 C;  2XAH A;  5GTH C;  2FA5 A;  2HKO A;  3ABU A;  4LLL A;  2IGN A;  3BZC A;  1Y1W J;  3HEF A;  3I59 B;  5DM7 F;  3F8C A;  3J7Y J;  4M6Y A;  2Y2Z A;  5ICE A;  4N9H A;  2NOG A;  3CC7 I;  2JT1 A;  2OQR A;  3BPX A;  2GIZ A;  1WH7 A;  4P1W A;  2JPC A;  1BR4 A;  2M2E A;  4BYY A;  4C3H J;  3F23 A;  3V8K A;  1B6A A;  3CTA A;  1UCR A;  1B9N A;  2F5C A;  3I9V 2;  1LFP A;  4IOA F;  2X1C A;  1W7P D;  2BHY A;  3CJQ B;  3CLO A;  3K9T A;  1SVL A;  2BY3 A;  3HYI A;  3PQJ A;  2C6Y A;  5EGO A;  4PJJ A;  3LSR A;  4OIQ F;  2H8W A;  1YE9 A;  2D2W A;  3FXL A;  3H0G J;  5EG0 B;  4NC7 A;  5M5X J;  1N25 A;  1HCR A;  2E2J J;  3HM5 A;  2VI6 A;  1H9G A;  1MBK A;  2DAO A;  1IC8 A;  3HRS A;  2DA1 A;  1LVK A;  1JJ8 C;  5JVT A;  3FXM A;  3GTL J;  2DA5 A;  3KP6 A;  2F48 A;  2IA1 A;  4XLE A;  2P5V A;  2KPM A;  3F3X A;  4LK0 F;  4XR6 A;  3QP5 A;  1F43 A;  3ZQG A;  2OC6 A;  2W85 A;  4LG0 A;  1XGS A;  3OYE A;  4L9T A;  1NG6 A;  5E3N A;  2ZJQ F;  2FE3 A;  2FU4 A;  4U87 A;  3F8N A;  1LJ9 A;  4HSR A;  4CO8 A;  4R8H A;  1MJ9 A;  4E4H A;  5J8C A;  5ICF A;  2W57 A;  2COB A;  1SD6 A;  2WAE A;  1G3Y A;  3Q0U A;  2P7V B;  4HNT A;  3QYB A;  1OYW A;  3G6E I;  4G8X A;  2WAF A;  4IQJ A;  2AQF A;  3I59 A;  2FBH A;  3MAJ A;  1I3Q J;  2VOD A;  1WH5 A;  4AWX B;  1S5L C;  3KX2 A;  4HZF A;  5D6F A;  2HPI A;  2TDX A;  2M7A A;  3H9G A;  3SDB A;  3I64 A;  5HS9 A;  1FEX A;  2KIU A;  4E6K G;  4U7B A;  1MJA A;  3BR5 A;  3FKI J;  4IL6 C;  2A05 A;  2Z5U A;  3AL0 B;  5HNF A;  4E7K A;  4B43 A;  4CZZ A;  3HOW J;  2JRM A;  2OA4 A;  3PUF A;  3B73 A;  4JK1 X;  1G6N A;  2KRF A;  2W7N A;  2KP6 A;  3DF8 A;  3IWZ A;  3P9K A;  5EG0 A;  2EBI A;  1FNN A;  2P6S A;  2PLY A;  1OCO H;  3L7W A;  1T0F A;  3KEO A;  4C2U A;  4XSX F;  2HS5 A;  2WAQ A;  1D5V A;  5J1R A;  3AFH A;  2DW4 A;  1LEB A;  3RQI A;  5E18 F;  2CSO A;  3BJ6 A;  3ISP A;  4S04 A;  1H88 C;  3J80 Z;  1H9T A;  2HVQ A;  2VQL A;  3DTI A;  4II2 A;  4A12 A;  2MAB A;  3JRA A;  4MGR A;  3T1B A;  1LFU P;  2FOW A;  2HOA A;  3IRR A;  2Y30 A;  3ZXS A;  1FLI A;  1BOB A;  4E7L A;  2E7X A;  3JRH A;  3A4C A;  2NVU B;  1KYZ A;  5KNL A;  1R1V A;  2E1O A;  1BA5 A;  4EJU A;  3BG6 A;  3JRF A;  2E36 A;  4XLF A;  5D5U B;  2JA2 A;  1E17 A;  4KIS A;  3QPT A;  3EUH C;  1RPW A;  2I10 A;  1I6X A;  2HZT A;  4MEY F;  2Y9Z A;  1FBU A;  4MTD A;  3CCR I;  2H09 A;  2BY1 A;  1J09 A;  2K9N A;  1R4N B;  1G4D A;  3GFJ A;  1FYL A;  4Q48 A;  2GM4 A;  3S17 J;  2O8X A;  1L3L A;  2M45 A;  1P92 A;  3PO3 J;  2L02 A;  1T33 A;  1E3H A;  2XF7 A;  5J3L A;  4BBR J;  1EJ9 A;  2KT0 A;  1FY7 A;  1I3A A;  5FD6 A;  1RR7 A;  2QQA A;  3OYN A;  2KDO A;  3CP8 A;  2GWR A;  2ZME C;  5BNG A;  4HX4 A;  4J01 A;  4HLY A;  1HKS A;  2EV0 A;  2V9K A;  5B1B H;  3ZMZ A;  1KU9 A;  3KLO A;  3HRM A;  3FMS A;  2K9M A;  2LNB A;  4BQA A;  5A2Q Z;  4UUS A;  3HOX J;  2KDZ A;  3CCM I;  3ZR8 X;  3DTK A;  1PUF B;  3KET A;  3E1S A;  2L3D A;  3BCA A;  3JRG A;  3I53 A;  1J2X A;  1ACI A;  1XDU A;  5D5W B;  2LY1 A;  2O3F A;  4X0G A;  1Z91 A;  4EJO A;  2GIV A;  1MKM A;  2XAJ A;  2KLO A;  2MC4 A;  2H6C A;  1TWC J;  3ABL H;  4A3K J;  3SQN A;  3TP0 A;  3OSG A;  2L2O A;  3NEU A;  2CQ7 A;  2M9H A;  3EUA A;  3K4J A;  3MCZ A;  2P6T A;  3FKJ A;  3OV8 A;  4W97 A;  1U9O A;  3D5S C;  3S15 J;  2ZO4 A;  5GTI C;  1ZRD A;  2ESN A;  3ABK H;  1KA8 A;  3GCM A;  1OJL A;  2XRL A;  4KT6 A;  4NDL A;  5J1Y A;  1LE8 A;  2ZJ2 A;  4XL9 A;  3TED A;  2F6C A;  4F55 A;  1MZB A;  2LF8 A;  4Y17 A;  4B48 A;  5BS6 A;  3I4M J;  2X48 A;  2DFH A;  3K0L A;  2DDB A;  4PZJ A;  4G7Z F;  1JE8 A;  2DJI A;  1W5S A;  3F22 A;  2KFD A;  2K86 A;  3QOE A;  4I98 B;  5L3G A;  4HF0 A;  1JXS A;  2Q2E B;  3NWS A;  1V4R A;  2PMH A;  3K1M A;  3BPV A;  1A36 A;  1ZR4 A;  2R4G A;  5DD8 A;  1SD5 A;  1P4X A;  2MD5 A;  5IPA A;  3A0B C;  5J4V A;  5KHD A;  2YPR A;  2VE8 A;  2XGE A;  5FRN A;  1YS6 A;  5ED4 A;  2PMU A;  4CDG A;  1VQP I;  2R92 J;  1T6S A;  2DT5 A;  1YQA A;  4ZDL A;  2IBD A;  3C3W A;  2A6T A;  1XPX A;  1PYV A;  3ZRG A;  1B1B A;  1YO5 C;  3Q0W A;  2QUF A;  3G1L A;  4M3G A;  5HS8 A;  2CV1 A;  1ZG5 A;  2IEK A;  3IP4 B;  5E8I A;  3GTG J;  3WG9 A;  2HOT A;  2ZNY A;  4OIR F;  2IJL A;  4IEJ A;  2KQR A;  4RB0 A;  2LBF A;  2RNG A;  3K1N A;  3TL4 X;  2MLK A;  1YW9 A;  3AAF A;  3RZO J;  1FIA A;  4ABZ A;  2NAZ A;  1FTZ A;  5CQG A;  2HYJ A;  2LKP A;  3HHH A;  3LMM A;  4IX7 A;  1GHC A;  3EET A;  2VT2 A;  5F27 A;  2XHK A;  3SZP A;  2J5O A;  4UVC A;  2Z33 A;  2E35 A;  3DBH B;  5IP6 A;  1K6Y A;  1JJ6 C;  1JTX A;  3BTI A;  1R4M B;  2ELJ A;  1W1W E;  3QRF F;  4F52 A;  2DN0 A;  2IP2 A;  2LVS A;  2M8G X;  1ZGA A;  5EZH A;  5L3C A;  3MKW B;  2EB7 A;  2Q2E A;  4HG2 A;  4YEJ A;  2LY9 A;  1QA6 A;  4HX8 A;  4IF4 A;  2DA3 A;  4D9J A;  4PJM A;  1JHF A;  3F72 A;  4G94 A;  2HOS A;  2VBY A;  2FRH A;  3KZI C;  2G7H A;  3LSG A;  3ZGK A;  3TMO A;  3WGH A;  4ZYA A;  4D7M A;  1FSH A;  3RKX A;  2PI0 A;  1OIS A;  4AYB N;  5LGU A;  5HDG A;  2DFI A;  3CUQ C;  1X2N A;  5ILV A;  3AG2 H;  1R5G A;  1SD4 A;  2FBI A;  2Y31 A;  4V2F A;  1LPQ A;  3D1N I;  1LUJ B;  1QQI A;  2OAZ A;  3HIF A;  1TNS A;  3SJM A;  1GUU A;  4UY8 I;  4RLF A;  3HGY A;  2X9D A;  1O7F A;  3MZ8 A;  2ZSH B;  5HLI A;  2HQR A;  5BPD A;  1JT0 A;  2UXX A;  1MBF A;  2I8D A;  4PK4 A;  5K7F A;  2O0Y A;  4KA4 A;  4WK8 F;  3K2Z A;  5B3S H;  4IHT A;  3PSI A;  1SVM A;  3BP8 A;  3W3C A;  5DTD A;  4HAM A;  1VQ9 I;  3ECO A;  5LHG A;  2VQG A;  3ASO H;  1FP1 D;  1S6L A;  3MFK A;  2L5Q A;  3CP2 A;  5IYC J;  5FLX Z;  1U0J A;  1Y6I A;  1G3T A;  2VBW A;  4LJZ F;  5E1W A;  4CHU A;  4IJA A;  2FUG 2;  4W1U A;  3CCU I;  4UB6 C;  1YJW I;  3OOU A;  1WJB A;  1U8R A;  2R7X A;  5GAH J;  4P55 A;  1LEA A;  1J59 A;  3WTT C;  4RAY A;  1X3U A;  3GO5 A;  2XAS A;  2DQR A;  1USS A;  4EEF G;  1DGR M;  3SZG A;  3ZOB A;  4V2G A;  2K27 A;  1WRJ A;  4XKV A;  3ZMV A;  4J19 A;  1ULY A;  1ZKG A;  4UVA A;  4I0A A;  3BR2 A;  2EFN A;  3OY9 A;  2QEX I;  3A0H C;  4AID A;  4NB5 A;  2QBY A;  1ETK A;  3JRE A;  4BY7 J;  3N05 A;  1D8K A;  1X4O A;  2MBF A;  5EEG A;  4CYC A;  1T95 A;  2QZ8 A;  2E19 A;  1A6I A;  1V5F A;  3V7C A;  1J5Y A;  2AO9 A;  2VIX A;  2QA4 I;  2V9V A;  1HF0 A;  4YFK F;  3GVA A;  1FJL A;  2FBK A;  4P9U A;  1QVT A;  3V42 A;  3ULQ B;  2JK3 A;  4EAT A;  4FX0 A;  2DYS H;  1WFX A;  3O6B B;  3PNY A;  3FXQ A;  4D1Q A;  4G6D A;  4IQ4 A;  4XKB A;  2VN2 A;  1X58 A;  2FJ1 A;  1R49 A;  5J1U A;  2E7W A;  1ENH A;  3EYY A;  4M72 A;  4XN0 A;  2LH9 A;  1Y8Q B;  1RET A;  2NNY A;  4OU0 A;  4XLH A;  4ENJ A;  3H9J A;  3IH3 A;  3K1P A;  3KCC A;  2L4M A;  1HW5 A;  1MBG A;  5CKT A;  3B02 A;  1R6R A;  2ID3 A;  1UZC A;  3WTS C;  1I50 J;  1O3S A;  1B72 B;  5B5E C;  3VPR A;  4L9N A;  1K4S A;  1CGP A;  2JMW A;  3WTX C;  2QQ9 A;  2M3A A;  4IHV A;  1XG1 A;  4EM2 A;  2H1K A;  5F08 A;  3CLQ A;  2LRD A;  4B47 A;  3AG4 H;  1B4A A;  1BC7 C;  2DT7 B;  3TKY A;  3S3M A;  3PQK A;  1TQM A;  4YII A;  2VKE A;  5D8L B;  1NH3 A;  5FO5 A;  3I58 A;  1TW3 A;  2K40 A;  2BVL A;  2TRT A;  3HSE A;  4YFN F;  3JW4 A;  1QPM A;  3DTE A;  2CU7 A;  3BG3 A;  2V7F A;  1XSD A;  3HOS A;  2B9S A;  3JAM K;  3FHN A;  1B59 A;  4ETS A;  2F4I A;  2QF7 A;  2EFQ A;  3KEY A;  1QNT A;  3BZ6 A;  3FBI B;  3JSP A;  1Y0U A;  1PVE A;  2VKV A;  3OYD A;  3S3O A;  1YX3 A;  2ZKZ A;  1UB9 A;  3LSK A;  2DT6 A;  3PSF A;  2IGM A;  1X2M A;  3K6G A;  2ELK A;  3FBN B;  2DO7 A;  2XRN A;  1G3W A;  2BYV E;  2YX7 A;  1OR7 A;  3F6O A;  2LY2 A;  3QPS A;  3KFW X;  2IAI A;  2CRG A;  5GAD J;  1K61 A;  3F21 A;  1Z67 A;  3ZCO A;  4HV6 A;  1EH6 A;  5FB2 A;  1B72 A;  3RTR A;  4DBR A;  4EGZ A;  1OCT C;  2KKO A;  4L0Y B;  5HDK A;  2XGD A;  3FK6 A;  1HBX G;  1Z1D A;  1ETX A;  4P9F A;  1GVJ A;  1BIB A;  2DK8 A;  2E1N A;  5GP9 A;  5D8K B;  1HOM A;  1RC9 A;  2W1O A;  1MSF C;  4KDP A;  2IS4 A;  5F1R A;  3DKW A;  4EM1 A;  1WJC A;  2DTZ A;  4CA0 A;  1J9I A;  4A0Z A;  4Q5S F;  1Y0N A;  4L9J A;  1QGP A;  2GQQ A;  3OYK A;  3E0J B;  1UHM A;  3H5R A;  1TZL A;  3J7Z I;  3C2B A;  1DQU A;  4FT8 A;  4L9V A;  1RI7 A;  3DU5 A;  1IXS B;  2MGQ A;  1GVD A;  3C18 A;  1D8J A;  1TQP A;  1ZK8 A;  2JJ7 A;  2EZH A;  3AG3 H;  4LGW A;  3CMY A;  4QPQ A;  3FXO A;  4J00 A;  2EIK H;  1I27 A;  4M3F A;  5F6F A;  3CCJ I;  2K7L A;  4C3J J;  4RMN A;  3DBL B;  3VYR B;  4I0B A;  4LLG F;  5CPR B;  3LAP A;  2LP0 A;  4HPQ A;  3CDH A;  4OMZ A;  5KVR A;  5LBQ A;  4MFE A;  4S05 A;  3S2D J;  5LHI A;  2M4G A;  1HDP A;  1U5T C;  3O3K A;  3OYF A;  1TQI A;  4ON0 A;  1T39 A;  2JN6 A;  3RPU A;  2CS3 A;  2VXZ A;  3H1C A;  4BBS J;  3KYC B;  1D1C A;  1XMK A;  3RYP A;  3ZQL A;  1ZLK A;  5CVJ A;  2DI3 A;  4DOZ A;  3CCQ I;  2K9L A;  3QP6 A;  3HUG B;  4E7S A;  1IN4 A;  3K70 C;  1QBJ A;  4XOT A;  2FMY A;  4IHW A;  1YOV B;  2L9S A;  3BJO A;  3I5U A;  1RES A;  2ZC2 A;  2QQ8 A;  3B6A A;  2LOO A;  3WHB A;  3TQN A;  2HTJ A;  4C2T A;  2XPU A;  1BI0 A;  5CVR A;  2VUM J;  3DP7 A;  1OYI A;  4XKW A;  5J40 A;  1G3S A;  1UG0 A;  2Z99 A;  2CUZ A;  3FM5 A;  3H9Q A;  1K78 B;  2KZG A;  3BJA A;  4XRF A;  4LG0 B;  5FLV A;  4IXA A;  1EH7 A;  4Y52 J;  2NNN A;  2IS1 A;  4KIT B;  3L9F A;  5EEH A;  1WGX A;  4Y15 A;  2JRT A;  3BR1 A;  2ELH A;  3OYI A;  2R7U A;  1SAN A;  3BDD A;  4XN3 A;  2QEN A;  2DJN A;  4GGG A;  4A6D A;  2IW5 A;  2VKD A;  1B9M A;  1T2K A;  3HKZ A;  1N77 A;  5H2F C;  1W36 C;  1S7E A;  3GTP J;  3DQV C;  3BR3 A;  3WOD F;  5FFZ A;  1TT0 A;  3T8T A;  4A3E J;  2BBY A;  3HRT A;  1KGS A;  5IT9 K;  1TC3 C;  2R7V A;  1Z6T A;  1LVA A;  1XB4 A;  2JPB A;  3JSO A;  3MVP A;  3BZK A;  4Y4R A;  3HUG A;  3R61 A;  2F5D A;  3HPG A;  1YYV A;  4M9Z A;  3MEX A;  1U78 A;  2DDA A;  2DOD A;  4CYD A;  2M8E A;  4HNV A;  2E60 A;  3PJR A;  3PFI A;  1E3P A;  1JI8 A;  4AYB A;  3CMM A;  3HL2 A;  3S93 A;  1U6G A;  4ASN A;  1BL0 A;  4ZYH A;  2WY8 Q;  3DPL C;  1R36 A;  3S32 A;  1ETO A;  4X1E A;  2XC7 A;  1GXP A;  3ZMD A;  2EIL H;  4GXO A;  4ZYG A;  1D0Y A;  4QTR A;  1BN5 A;  2EZK A;  5CYV A;  3OL4 A;  1ZH5 A;  5JLW A;  2KJB A;  1OLT A;  2QSH X;  3MZH A;  2BV6 A;  5EF6 A;  3HPH A;  1QZZ A;  2EJR A;  1S29 A;  1K78 A;  2R7S A;  2P5K A;  1SMT A;  3CJT B;  1QHH D;  4BHB A;  2EQR A;  2F2E A;  5GAE J;  1NTC A;  2M87 A;  3S16 J;  1R9T J;  2WB1 N;  2BXZ A;  1AKH A;  3SFZ A;  4YFX F;  1SFO J;  1SMY F;  1A5J A;  3QOP A;  2GLO A;  2KIQ A;  1YJ9 I;  4O3M A;  2WV1 A;  5C4X J;  5BOX A;  3I55 I;  2R7Q A;  4XLP F;  4AU7 A;  4A3L J;  1DPU A;  1YG2 A;  4U0V A;  3QWL A;  2EV6 A;  2EK5 A;  1E2X A;  1ZHF A;  3OYG A;  1S8N A;  2CGP A;  1OMI A;  4HEA 2;  4WCG A;  2E34 A;  1KU3 A;  3R0J A;  4I09 A;  2EZI A;  2QKM B;  1YIO A;  2R3S A;  1ZEL A;  4A3C J;  3U1K A;  2EV5 A;  4I02 A;  3S14 J;  1Z6R A;  3H3U A;  1FP2 A;  1KON A;  2BXY A;  2QSF X;  5IOZ A;  1GDT A;  2X85 A;  1A31 A;  4Y3O A;  4I2O A;  3TO9 A;  2KL4 A;  5KCM A;  2HI3 A;  4CZC A;  1N78 A;  1U3E M;  2ZSI B;  1A6Q A;  1P7I A;  1OFC X;  1IN7 A;  2HXO A;  4EQQ A;  1WPK A;  3CCV I;  1SFU A;  1R1U A;  4PGG A;  1QRY A;  4M73 A;  3IWF A;  3Q5F A;  2RN7 A;  4L5E A;  2DOF A;  3KYL A;  3HOT A;  4UUS B;  4BJT A;  3PNT A;  4E7J A;  5IYD J;  2HPM A;  2HQ5 A;  1TBX A;  4XLC A;  5FKM A;  2QSG X;  4BXU A;  1T38 A;  3BR0 A;  1AHD P;  1RKW A;  4KIG A;  2LKS A;  1WKM A;  2VC1 A;  2O7O A;  1UAA A;  4XOP A;  1FC3 A;  1GLN A;  4UUT A;  3D5R C;  1MH3 A;  2GZW A;  4ITV A;  3ZQH A;  4NUB A;  1GV2 A;  3TW7 A;  4UB8 C;  1IGN A;  3K4C A;  1V5E A;  3A01 B;  3DCF A;  2L9V A;  4CIC A;  3BCB A;  3VOD A;  1X1D A;  4OIP F;  2DYR H;  2OPT A;  4BL0 B;  1MH4 A;  4XOR A;  3KPH A;  1X1B A;  1JGG A;  2DMN A;  2BE5 F;  2CV0 A;  4N4N B;  1YIT I;  5EJC A;  1STZ A;  3HOY J;  2PG4 A;  4EVI A;  1JKQ C;  1SAX A;  1LE8 B;  1RR8 C;  1V55 H;  1UHS A;  1IJW C;  4IRG A;  5HVQ C;  4MO7 A;  3PL8 A;  2Z2S B;  5GPC A;  4BU2 A;  1K6O A;  2HKX A;  2KIS A;  2V6E A;  3V7R A;  1WI3 A;  5JLX A;  4Q4Z F;  2VC0 A;  5CQE A;  4OOI A;  2CQX A;  2CO5 A;  3W2W A;  4L5J A;  1F5T A;  4IHX A;  2P0W A;  3FXK A;  5M5W J;  3W6K B;  1P2F A;  1IN6 A;  5JHU A;  4YG2 F;  2Y9Y A;  5IP9 J;  3L2V A;  3IAS 2;  5JVG F;  4C3I J;  4K2E A;  3P7N A;  3B6C A;  2O6G E;  2A68 F;  4OAZ A;  5DCM B;  4M9X A;  3OOP A;  2CFX A;  1BBY A;  2COM A;  4JX6 A;  3A01 A;  2M1B A;  4CCM A;  1YX5 A;  1LB2 A;  3U9G A;  4Z2Y A;  2P4W A;  5L3F A;  5C4J J;  1IDY A;  3NRV A;  3PO2 J;  4QIW N;  2LBF B;  3JRB A;  3OR2 C;  4EGY A;  3GYH X;  4WX9 A;  3VYU B;  3J81 Z;  1LDK B;  2MLG A;  3LSJ A;  2CYY A;  3LL7 A;  1T08 B;  2AS5 F;  3EQL F;  3GFM A;  2WWY A;  2R7R A;  4HYE A;  2A69 F;  5IY5 H;  2JVG A;  5TGT A;  1PP8 F;  2ZCW A;  3KLN A;  1O3T A;  4LIU A;  5J8F A;  3OMY A;  1VFC A;  1AU7 A;  1RZ4 A;  1W5C C;  4R79 A;  4I7H A;  4WF2 A;  3H3V K;  2MH9 A;  4BEH A;  2X1D A;  2LK2 A;  1G8X A;  2X6O A;  3RPQ A;  3JRI A;  1PJR A;  2XVC A;  3ABT A;  4PUS A;  5FKN A;  1IXR C;  4A3M J;  4BNC A;  2VPL A;  1HKT A;  3CCS I;  4L18 B;  1JKP C;  1QVU A;  4XMY A;  1XSV A;  3K4M A;  2LR8 A;  4DZJ A;  4KIF A;  1HA8 A;  2OTL I;  5BQT A;  2QYO A;  1D0Z A;  3J80 K;  3H36 A;  5DCM A;  1U9N A;  3V7S A;  2EA2 A;  3VEP A;  3K4K A;  4BHP A;  2VJJ A;  5CVI A;  1WQ2 A;  2E1M B;  2L7Z A;  3DLL F;  2HWV A;  5LRS A;  1KQ0 A;  1P4A A;  3KZZ A;  3OYJ A;  4KNY A;  4PJN A;  2OZ6 A;  3LA3 A;  1U5T A;  1TT5 B;  1R23 A;  2ZXJ A;  1X1A A;  1B8I B;  4M6V A;  1RIO H;  5HS7 A;  3W6J B;  3W6V A;  2XPV A;  1TL8 A;  3FXR A;  3BRO A;  1MW7 A;  3WE3 A;  2VBX A;  4MLO A;  2W84 A;  1VQ6 I;  2NRA C;  3R6S A;  1HC8 A;  2MA3 A;  2CW7 A;  3HKZ N;  3K2A A;  1IRZ A;  4XLA A;  2DMQ A;  2FSW A;  1D5Y A;  5EYR A;  3CES A;  1F36 A;  3S3N A;  3IH4 A;  4XRS A;  4RB3 C;  4KMU X;  3AKZ A;  2UXN A;  4M3E A;  2E71 A;  3ZMS A;  3DV8 A;  1RKT A;  1XC5 A;  2GA1 A;  2M30 A;  3MN2 A;  4M6X A;  5HOD A;  2UWM A;  3HGG A;  1RUN A;  4ZJZ A;  3CC4 I;  1M1E B;  4GO1 A;  5TIS C;  4E7I A;  1ETQ A;  1ORK A;  1YIJ I;  2BGC A;  3BWG A;  4LIV A;  1J75 A;  2DA4 A;  1JGS A;  1Q1H A;  3HRU A;  5A2Q K;  3C2H A;  4AVZ A;  4Y33 A;  1DGW Y;  2DCE A;  2DPU A;  2H8R A;  2XGC A;  4MEX F;  2HXI A;  2IVM A;  2MYS A;  5HLG A;  2VE9 A;  1O4X A;  2QBY B;  2XKO A;  4ZC3 A;  4B3X A;  3O8H A;  2STT A;  1LQ1 A;  4ANJ A;  5IOY A;  1UHW A;  4CYC B;  4OIN F;  3OYB A;  4A5M A;  4FHT A;  1UFM A;  3M07 A;  1B8I A;  1IO2 A;  4F3Q A;  1I39 A;  2WAD A;  1FOX A;  4KYW A;  3SEZ A;  1AWC A;  4FTH A;  1UG2 A;  2IS2 A;  3N4M A;  2FNP A;  2DQL A;  5GAG J;  2MH2 A;  4QWQ A;  3FX3 A;  1FWZ A;  2M0C A;  3S2H J;  2LRE A;  2CW0 F;  5E17 F;  1IZ1 A;  3RJP A;  4D7N A;  3LA7 A;  2HOE A;  3Q0V A;  1SEU A;  2E2I J;  2F4O B;  2CWE A;  5J4Y A;  1Z7L A;  3HG9 A;  5F0F A;  2Y48 A;  1MMG A;  4BDY A;  3OIP A;  2NVT J;  5E3O A;  1AOY A;  5L3B A;  2FQ4 A;  3OS1 A;  1XD7 A;  1UEL B;  3KE2 A;  1OCC H;  4YRV A;  1KU7 A;  3E6D A;  5FKO A;  2WV0 A;  2Z1D A;  5LEJ A;  1VZ0 A;  4GFB A;  4O6J A;  2VAS A;  3M8F A;  3JTG A;  1H8A C;  2JA5 J;  1ETY A;  3H35 A;  2LDU A;  2E1C A;  3V8L A;  4ESB A;  3Q9V A;  2L9R A;  2BY0 A;  3LWF A;  2Y0S A;  2RV8 A;  1EH8 A;  4H4K C;  2QKL B;  4EM0 B;  3M3Y J;  2A5Y B;  2R7Z J;  2DMP A;  2ESH A;  1MBJ A;  3DPT A;  4ZTJ A;  2XGX A;  2JA8 J;  2E5Z A;  2WB1 A;  5F0C A;  1R5H A;  2V26 A;  4CCL A;  4JBA A;  3QAH A;  2G7U A;  2XAF A;  3K7A J;  3GTM J;  4M3D A;  1KQ9 A;  3UKG A;  2CUF A;  4BE2 A;  4A93 J;  2GOM A;  4M74 A;  1HKQ A;  2VB6 A;  2HR3 A;  3BR6 A;  3K4L A;  5CJ9 A;  5E1Z B;  2W24 A;  1NK3 P;  2PQ8 A;  5DV5 A;  5FFX A;  2A3S A;  2ISY A;  1VQO I;  1RRJ A;  3KP7 A;  1VQ7 I;  1Z0X A;  5HOO A;  1ONV A;  3PUB A;  1VQK I;  4BQO A;  4A2U A;  2HVS A;  4QSH A;  1WHU A;  3GW2 A;  2V1U A;  3MMY B;  4G6T B;  4GYG A;  4AD9 A;  1T0F C;  3RKY A;  5ILU A;  1FMW A;  4PCQ A;  1T98 A;  1D3Y A;  2EH3 A;  3GTK J;  2R7W A;  4BXX J;  4MQ9 F;  4IZZ A;  2UV1 A;  3SXY A;  1ON1 A;  4L0Z B;  4LK1 F;  2V79 A;  4RS8 A;  1WI9 A;  3G73 A;  3ZQC A;  2K9S A;  2OF7 A;  5HDN A;  3M7G A;  3IV5 A;  4XRM A;  1W0U A;  4AIJ A;  2XDV A;  3JRD A;  4HOB A;  1X19 A;  4UV9 A;  1IN8 A;  2RAE A;  3LFK A;  1BI3 A;  4BS9 A;  4JP0 A;  3MKZ A;  1JHH A;  2VL8 A;  3QOD A;  4AIH A;  4ESF A;  1F1Z A;  4HST A;  2NXN B;  4HQM A;  2CH0 A;  2AHQ A;  1DPR A;  4XBF A;  2R7D A;  4KJZ A;  3FMR A;  2Y75 A;  3GZN B;  4G6Q A;  2HTS A;  3ZN0 A;  1GV5 A;  2GOX B;  2H1L A;  2V6C A;  1XMA A;  2IPQ X;  2W00 A;  3G1M A;  3BQZ A;  3EUH A;  3AL0 C;  1IXC A;  4GRI A;  2HDW A;  2Z16 A;  2G0E A;  4KIC A;  4YIR X;  4CGZ A;  3LA2 A;  2QLZ A;  1ZRF A;  1YW8 A;  3VSL A;  1RUO A;  3LST A;  5CVU A;  3BT9 A;  3PM1 A;  2KHM A;  1IDZ A;  4LIT A;  4UNO A;  3QU3 A;  4GDF A;  3GME A;  3MQ0 A;  1P6R A;  1SVO A;  2XF5 A;  3EPZ A;  4JX5 A;  2IS6 A;  1LNW A;  5FLX K;  4Y7N J;  4A3J J;  4EMS A;  3RDI A;  2ZJR F;  3HC7 A;  5K5R A;  1FIP A;  3OIO A;  1YLF A;  2XUB A;  4UHT A;  1O3R A;  3G2B A;  2ZME A;  1EV7 A;  3QPL A;  3HOZ J;  4RM2 A;  2X1E A;  3BG5 A;  1CF7 A;  2X0L A;  2X51 A;  4JYK A;  3FF5 A;  1TWA J;  3IH2 A;  4FX4 A; 
#chains in the Genus database with same CATH homology
 4HX7 A;  5DCF A;  1XGO A;  1OPC A;  5DYM A;  4ENN A;  2OZU A;  4KUM A;  4MNU A;  3L2C A;  4CXF A;  1O57 A;  4RGU A;  4LB6 B;  5ICG A;  2P8T A;  3I0T A;  1TW2 A;  4ZZD A;  1FBQ A;  1IN5 A;  2GAU A;  1ZGJ A;  5FD5 A;  4PDK A;  2RGV A;  4KMF A;  2STW A;  3CO6 C;  1TLH B;  4I01 A;  2DPD A;  3NQO A;  3ROU A;  5KK1 A;  1BIA A;  4DNC A;  1KQ8 A;  2ZBK A;  3H92 A;  2FQ3 A;  3TGN A;  2YX4 A;  3ZPL A;  2ETH A;  1ZRE A;  3QPH A;  3WGI A;  5HLH A;  5TJJ A;  3P9C A;  4Q47 A;  1R58 A;  2PEX A;  3M9A A;  1I1S A;  4KN7 X;  4P96 A;  2WC2 A;  2CQK A;  2HQN A;  3I71 A;  4WXD A;  2VBZ A;  2IA0 A;  2PN6 A;  3F6V A;  1IF1 A;  3REO A;  3L09 A;  3TOB A;  3Q9S A;  2RQP A;  3MWM A;  5TRD A;  4HA8 A;  2EFW A;  4LMY A;  2H27 A;  1ODD A;  3KP2 A;  2YR2 A;  4RB1 A;  4EJV A;  2P5L C;  5JI6 A;  3IHU A;  1ZG1 A;  5DUI A;  3BY6 A;  4WXC A;  3WTZ A;  3E5Q A;  4R1H A;  4TV7 A;  2FEZ A;  3LQR A;  3E6M A;  1QO0 D;  3E5X A;  1QZY A;  4Y13 A;  4IRI A;  1OYY A;  2HYF A;  4F7Z A;  4EJW A;  3KZY A;  1W4M A;  2H6B A;  5ERI A;  4HDV A;  3ZMU A;  1W7P B;  2ZFW A;  5H6R A;  3E3V A;  3ZQ7 A;  1FYM A;  5DEQ A;  1XCB A;  1IW7 F;  3C1D A;  3K69 A;  4ZYD A;  2UZK A;  3CUQ A;  2OBP A;  1XCV A;  2DK5 A;  1BOA A;  4IRH A;  2JTV A;  4L5I A;  1FYK A;  2FF4 A;  3ZMT A;  1U2W A;  1WWX A;  4P5O A;  5AON A;  3VOE A;  4M9S A;  3DXJ F;  2L01 A;  5D4S A;  5K5O A;  4U88 A;  2D1V A;  1A04 A;  1MD0 A;  3U1D A;  4UV8 A;  2A6H F;  1W7P A;  1BM9 A;  2DBB A;  4UUV A;  1ZG3 A;  2L4A A;  5LGT A;  1P4W A;  3WTV C;  2LSO A;  1XGN A;  3GF2 A;  2FNA A;  4KT5 C;  1GXQ A;  2A07 F;  1I1G A;  2F5F A;  5DD4 A;  3ERE D;  2DTR A;  4HF2 A;  2F5E A;  3SZT A;  2IRF G;  2XAQ A;  3KP4 A;  3SHF A;  3VFZ A;  5LHH A;  4UVB A;  4RGR A;  4ESJ A;  1FSE A;  5DUK A;  4A0Y A;  1LDD A;  3QU6 A;  1S3J A;  4KFC A;  3HSF A;  5IT3 A;  2ADU A;  4XLN F;  3GZ6 A;  2OD5 A;  1ZLJ A;  2KIM A;  1ZAR A;  5BMZ A;  2D45 A;  1WSU A;  1BI2 A;  5H6Q A;  4LFU A;  4B09 A;  2V1X A;  2XV4 S;  4IVN A;  4A5N A;  2QVO A;  1L0O C;  3M8E A;  3WTW C;  2NS0 A;  3RYR A;  2X4H A;  3KP5 A;  2JSC A;  2RNJ A;  4YIF A;  3EYI A;  1XSX A;  1I5Z A;  2IT0 A;  3FZV A;  1KU2 A;  4MTE A;  2VOP A;  3MZY A;  1HQC A;  3GX4 X;  1FPQ A;  2VON A;  3CJN A;  1PDN C;  1DDN A;  4IPA A;  4HW0 A;  4WWC A;  1IAW A;  3N97 A;  1K79 A;  5CLS A;  3I54 A;  3V8J A;  2K02 A;  1SFE A;  1U5T B;  1F9N A;  5CVV A;  2A61 A;  1YFH A;  1C0W A;  3TDZ C;  3CO7 C;  2Q0O A;  4ENK A;  3DFG A;  4JQF A;  5BPI A;  4BAY A;  3IL2 A;  5E1X A;  4KIB A;  1TNT A;  2M5W A;  4MQV A;  4G7H F;  3HHG A;  4PGH A;  2Y0M A;  4ZYE A;  2EFP A;  3J7A O;  5AIQ A;  3LAJ A;  4U0Y A;  2XKP A;  3ELK A;  3F8M A;  3WU0 A;  1HSJ A;  2Z3Y A;  4N9I A;  1MGT A;  3H3Z A;  4KN4 X;  1R1T A;  4E70 A;  3IKT A;  3FMQ A;  2Z9O A;  1DUX C;  2HGC A;  1R7J A;  1S7A A;  4OMY A;  2QWW A;  3BOQ A;  2G9W A;  6PAX A;  3S2W A;  2RC4 A;  4AVP A;  3EDP A;  2K4B A;  2EWN A;  1W5T A;  1HW2 A;  3T8R A;  3HSR A;  3E6C C;  4ENM A;  2PFB A;  2PBI A;  1YTY A;  1K7A A;  4MHG A;  4OIO F;  1BJA A;  3D0S A;  2FML A;  2VOO A;  3FWE A;  3R4K A;  2O61 A;  1IRF A;  2BEO A;  5ILS A;  2B0L A;  4HDU A;  2QM3 A;  3COA C;  3E5U A;  2OQG A;  1FX7 A;  1FZP B;  2D1H A;  2FXA A;  4U0W A;  2DU9 A;  5J6X A;  2JZY A;  3P9I A;  4EJT A;  5E20 A;  3J81 K;  3R0A A;  1XN7 A;  2KIF A;  1MJB A;  5L3D A;  1O3Q A;  1RNL A;  1Z05 A;  3JAM Z;  3U2R A;  3FXU A;  1SFX A;  2GXB A;  5LEK A;  2K4J A;  4ZH4 F;  5D5V B;  1PP7 U;  4D0P A;  1MDM B;  5ICC A;  2QQB A;  3GZ5 A;  2YU3 A;  4RGS A;  3GFL A;  3E97 A;  4DQ2 A;  2HFH A;  2GA2 A;  2IA2 A;  1LDJ A;  3E6B A;  4ZZL A;  5K1Y A;  3KP3 A;  1V3F A;  2ZNZ A;  2W25 A;  3F8B A;  5H20 A;  1PUE E;  1O7L A;  4U7D A;  3D5L A;  3HTS B;  4WXH A;  5FGM A;  1IRG A;  3F8F A;  4QLC U;  3G3Z A;  2O03 A;  1YS7 A;  4IHS A;  1S7O A;  5JR3 A;  2KJC A;  2ZME B;  1UST A;  1CF7 B;  4HV5 A;  1VTN C;  1MDM A;  3IKV A;  5E8G A;  4NQW A;  3JTH A;  3TO7 A;  3R60 A;  1KYW A;  3CUO A;  3M1E A;  1XGM A;  1DP7 P;  4A6E A;  2RKH A;  4RB2 C;  2DLL A;  5K5Q A;  1H0M A;  1J0R A;  3LQQ A;  1ZN2 A;  2ISZ A;  2R7F A;  2XRO A;  4M71 A;  2XAG A;  4EV0 A;  1FBS A;  1NHA A;  3GXO A;  2J5P A;  2A6E F;  4RAZ A;  4O5V A;  1XDS A;  3ML6 A;  5JFR A;  2CG4 A;  3WE2 A;  1TTY A;  3TO6 A;  5D4R A;  4N0B A;  2NYX A;  2HDC A;  2YSR A;  2V1D A;  4HBL A;  3WTU C;  3GWZ A;  1FOK A;  2FOK A;  1Z9C A;  1R22 A;  2OU2 A;  1IUY A;  2AXL A;  4LB5 A;  2LF7 A;  3ECH A;  1YW7 A;  3IC7 A;  3FM3 A;  4H0E A;  4G7O F;  5LGN A;  2MC3 A;  5IT9 Z;  3RIR A;  1R00 A;  2L54 A;  1SD7 A;  3I4P A;  4LLN A;  2RVC A;  4HF1 A;  1ON2 A;  3FHZ A;  5L3E A;  3L00 A;  4LD5 A;  3TOA A;  1FT9 A;  2H94 A;  4NHJ A;  1F4K A;  1BI1 A;  3RKW A;  2HEO A;  1OKR A;  1Z7U A;  2WTE A;  1HW1 A;  3WTY C;  2HYG D;  1HST A;  4UXN A;  3ZP5 A;  3HTU A;  2ACJ A;  1ZAO A;  4A0X A;  4GYI A;  5F64 A;  4HLX A;  5AIP A;  2P7C B;  5D5X B;  2Q8K A;  3V4G A;  2VT3 A;  2EA4 A;  3CUQ B;  1ZYR F;  1HXD A;  3T0Y A;  4XSZ F;  3DEU A;  3TDU C;  2PJP A;  2GXG A;  4GCV A;  3GFI A;  5D6E A;  5LRR A;  2XIG A;  3O2P E;  3T5X A;  4BH9 A;  5LLQ A;  3KEQ A;  2EFO A;  3WU1 B;  1REP C;  3GEZ A;  2RDP A;  4B8X A;  3GUD A;  3IRQ A;  3C7J A;  4G9Y A;  4HQE A;  4BHC A;  1J7K A;  4RGX A;  3WGG A;  3GLX A;  5DDG A;  3RI4 A;  4AIK A;  3VB2 A;  3ZN1 A;  1ZRC A;  1BC8 C;  2XAH A;  2FA5 A;  2HKO A;  3ABU A;  4LLL A;  3I59 B;  3F8C A;  4M6Y A;  5ICE A;  4N9H A;  2JT1 A;  2OQR A;  3BPX A;  2JPC A;  4BYY A;  3F23 A;  3V8K A;  1B6A A;  1UCR A;  3CTA A;  1B9N A;  2F5C A;  1W7P D;  3K9T A;  3CLO A;  3PQJ A;  2C6Y A;  3HYI A;  4OIQ F;  2D2W A;  1H9G A;  2DAO A;  3HRS A;  5JVT A;  3KP6 A;  2IA1 A;  2P5V A;  3F3X A;  4LK0 F;  3QP5 A;  4LG0 A;  2W85 A;  1XGS A;  4L9T A;  2FE3 A;  2FU4 A;  3F8N A;  1LJ9 A;  4CO8 A;  4R8H A;  1MJ9 A;  5J8C A;  5ICF A;  2W57 A;  1SD6 A;  1G3Y A;  2P7V B;  1OYW A;  4G8X A;  3I59 A;  2FBH A;  3MAJ A;  2VOD A;  4AWX B;  4HZF A;  5D6F A;  2TDX A;  3I64 A;  5HS9 A;  2KIU A;  4U7B A;  1MJA A;  2Z5U A;  4CZZ A;  2OA4 A;  3B73 A;  4JK1 X;  1G6N A;  2KRF A;  3DF8 A;  3IWZ A;  3P9K A;  1FNN A;  2P6S A;  2PLY A;  3L7W A;  1T0F A;  3KEO A;  4XSX F;  2HS5 A;  1D5V A;  2DW4 A;  1LEB A;  5E18 F;  2CSO A;  3BJ6 A;  3ISP A;  4S04 A;  3J80 Z;  1H9T A;  4A12 A;  4MGR A;  3T1B A;  3IRR A;  1FLI A;  2E7X A;  1KYZ A;  1R1V A;  4EJU A;  5D5U B;  1E17 A;  3QPT A;  1I6X A;  2HZT A;  4MEY F;  1FBU A;  4MTD A;  2H09 A;  1G4D A;  3GFJ A;  1FYL A;  4Q48 A;  2O8X A;  1L3L A;  2M45 A;  1P92 A;  2L02 A;  1FY7 A;  5FD6 A;  2QQA A;  2GWR A;  4HX4 A;  4HLY A;  1HKS A;  2EV0 A;  3ZMZ A;  1KU9 A;  3KLO A;  3HRM A;  3FMS A;  2LNB A;  4BQA A;  5A2Q Z;  3KET A;  2L3D A;  3I53 A;  1J2X A;  1XDU A;  5D5W B;  2O3F A;  1Z91 A;  4EJO A;  2GIV A;  1MKM A;  2XAJ A;  2H6C A;  3SQN A;  3NEU A;  3MCZ A;  2P6T A;  3OV8 A;  2ZO4 A;  1ZRD A;  2ESN A;  1KA8 A;  2ZJ2 A;  1MZB A;  2LF8 A;  4Y17 A;  5BS6 A;  3K0L A;  4PZJ A;  4G7Z F;  1JE8 A;  1W5S A;  3F22 A;  2K86 A;  4I98 B;  5L3G A;  4HF0 A;  1JXS A;  1V4R A;  2PMH A;  3K1M A;  3BPV A;  5DD8 A;  1SD5 A;  1P4X A;  2MD5 A;  2YPR A;  2VE8 A;  1YS6 A;  5ED4 A;  2PMU A;  4CDG A;  1T6S A;  2DT5 A;  1YQA A;  3C3W A;  1B1B A;  1YO5 C;  2QUF A;  5HS8 A;  1ZG5 A;  5E8I A;  3WG9 A;  2ZNY A;  4OIR F;  2IJL A;  4RB0 A;  3K1N A;  2MLK A;  1YW9 A;  3AAF A;  2NAZ A;  2LKP A;  3HHH A;  1GHC A;  3EET A;  2VT2 A;  2XHK A;  3SZP A;  2J5O A;  4UVC A;  2Z33 A;  3QRF F;  2IP2 A;  1ZGA A;  5L3C A;  2EB7 A;  2Q2E A;  4HX8 A;  4IF4 A;  1JHF A;  3F72 A;  4G94 A;  2VBY A;  2FRH A;  2G7H A;  3WGH A;  1FSH A;  3RKX A;  2PI0 A;  5LGU A;  5HDG A;  2DFI A;  3CUQ C;  5ILV A;  1R5G A;  1SD4 A;  2FBI A;  1QQI A;  2OAZ A;  3HIF A;  1TNS A;  1O7F A;  5HLI A;  2HQR A;  5BPD A;  2UXX A;  4KA4 A;  2O0Y A;  4WK8 F;  3K2Z A;  4IHT A;  3BP8 A;  4HAM A;  3ECO A;  5LHG A;  1FP1 D;  1S6L A;  3MFK A;  5FLX Z;  2VBW A;  4LJZ F;  1G3T A;  5E1W A;  4CHU A;  4IJA A;  1U8R A;  4P55 A;  1LEA A;  1J59 A;  3WTT C;  4RAY A;  1X3U A;  3GO5 A;  2XAS A;  2DQR A;  1USS A;  2K27 A;  1WRJ A;  3ZMV A;  1ULY A;  4UVA A;  4I0A A;  2EFN A;  4NB5 A;  2QBY A;  1D8K A;  2MBF A;  5EEG A;  2QZ8 A;  3V7C A;  1J5Y A;  2V9V A;  4YFK F;  3GVA A;  2FBK A;  4P9U A;  3ULQ B;  4FX0 A;  3O6B B;  3FXQ A;  4G6D A;  2VN2 A;  2E7W A;  3EYY A;  4M72 A;  2NNY A;  4OU0 A;  4ENJ A;  3K1P A;  3KCC A;  2L4M A;  1HW5 A;  3B02 A;  3WTS C;  1O3S A;  4L9N A;  1CGP A;  3WTX C;  2QQ9 A;  4EM2 A;  1B4A A;  1BC7 C;  3TKY A;  3PQK A;  1TQM A;  4YII A;  5D8L B;  5FO5 A;  3I58 A;  1TW3 A;  3HSE A;  4YFN F;  3JW4 A;  1QPM A;  1XSD A;  3HOS A;  3JAM K;  1B59 A;  4ETS A;  2EFQ A;  1QNT A;  3BZ6 A;  3JSP A;  1Y0U A;  2ZKZ A;  1UB9 A;  2DO7 A;  2XRN A;  1G3W A;  2BYV E;  2YX7 A;  1OR7 A;  3F6O A;  3KFW X;  3F21 A;  4HV6 A;  1EH6 A;  5FB2 A;  3RTR A;  4EGZ A;  2KKO A;  4L0Y B;  5HDK A;  1HBX G;  1Z1D A;  4P9F A;  1GVJ A;  1BIB A;  2DK8 A;  2E1N A;  5D8K B;  4KDP A;  5F1R A;  3DKW A;  4EM1 A;  1J9I A;  4A0Z A;  4Q5S F;  4L9J A;  1QGP A;  2GQQ A;  1UHM A;  4FT8 A;  4L9V A;  1RI7 A;  1IXS B;  3C18 A;  1D8J A;  1TQP A;  4LGW A;  1I27 A;  5F6F A;  2K7L A;  4I0B A;  4LLG F;  3LAP A;  3CDH A;  5LBQ A;  4OMZ A;  5KVR A;  4S05 A;  5LHI A;  1U5T C;  3O3K A;  1TQI A;  4ON0 A;  1T39 A;  3RPU A;  2VXZ A;  1XMK A;  3RYP A;  1ZLK A;  5CVJ A;  2DI3 A;  3QP6 A;  1IN4 A;  1QBJ A;  2FMY A;  3I5U A;  3BJO A;  3TQN A;  2HTJ A;  1BI0 A;  5CVR A;  3DP7 A;  1OYI A;  1G3S A;  2Z99 A;  3FM5 A;  1K78 B;  3BJA A;  4XRF A;  4LG0 B;  4IXA A;  1EH7 A;  2NNN A;  3L9F A;  5EEH A;  4Y15 A;  2JRT A;  2ELH A;  3BDD A;  2QEN A;  4GGG A;  4A6D A;  2IW5 A;  1B9M A;  1T2K A;  3DQV C;  3WOD F;  5FFZ A;  3T8T A;  2BBY A;  3HRT A;  1KGS A;  5IT9 K;  1Z6T A;  1LVA A;  1XB4 A;  2JPB A;  3JSO A;  3HUG A;  3R61 A;  2F5D A;  1YYV A;  4M9Z A;  3MEX A;  1U78 A;  4CYD A;  2M8E A;  3PFI A;  4ASN A;  1U6G A;  4ZYH A;  3DPL C;  1R36 A;  1GXP A;  3ZMD A;  4GXO A;  4ZYG A;  1BN5 A;  5CYV A;  1ZH5 A;  2KJB A;  3MZH A;  2BV6 A;  1QZZ A;  2EJR A;  1S29 A;  1K78 A;  2P5K A;  1SMT A;  4BHB A;  2F2E A;  2M87 A;  3SFZ A;  4YFX F;  1SMY F;  3QOP A;  4O3M A;  5BOX A;  4XLP F;  1DPU A;  1YG2 A;  4U0V A;  2EV6 A;  2EK5 A;  1E2X A;  1ZHF A;  1S8N A;  2CGP A;  1OMI A;  4WCG A;  1KU3 A;  3R0J A;  4I09 A;  1YIO A;  2R3S A;  2EV5 A;  4I02 A;  1Z6R A;  3H3U A;  1FP2 A;  4I2O A;  3TO9 A;  1U3E M;  4EQQ A;  1IN7 A;  1SFU A;  1R1U A;  4PGG A;  4M73 A;  3IWF A;  3Q5F A;  2RN7 A;  3HOT A;  1TBX A;  4BXU A;  1T38 A;  4KIG A;  1WKM A;  2VC1 A;  1FC3 A;  2GZW A;  4CIC A;  3VOD A;  4OIP F;  2BE5 F;  1STZ A;  2PG4 A;  4EVI A;  1SAX A;  4IRG A;  5HVQ C;  1K6O A;  2HKX A;  3V7R A;  4Q4Z F;  2VC0 A;  4OOI A;  2CO5 A;  4L5J A;  1F5T A;  3W6K B;  1P2F A;  1IN6 A;  5JHU A;  4YG2 F;  4K2E A;  3P7N A;  2O6G E;  2A68 F;  5DCM B;  4M9X A;  3OOP A;  2CFX A;  1BBY A;  2COM A;  2M1B A;  1LB2 A;  3U9G A;  4Z2Y A;  2P4W A;  5L3F A;  3NRV A;  4EGY A;  3GYH X;  4WX9 A;  3J81 Z;  1LDK B;  2MLG A;  2CYY A;  2AS5 F;  3EQL F;  3GFM A;  2WWY A;  4HYE A;  2A69 F;  1PP8 F;  2ZCW A;  3KLN A;  1O3T A;  5J8F A;  1RZ4 A;  4R79 A;  4I7H A;  4WF2 A;  2MH9 A;  3RPQ A;  2XVC A;  3ABT A;  1IXR C;  4BNC A;  1HKT A;  4L18 B;  1XSV A;  4KIF A;  5BQT A;  2QYO A;  3J80 K;  5DCM A;  3V7S A;  2EA2 A;  3VEP A;  4BHP A;  5CVI A;  1WQ2 A;  2HWV A;  5LRS A;  1KQ0 A;  1P4A A;  3KZZ A;  4KNY A;  2OZ6 A;  3LA3 A;  1U5T A;  2ZXJ A;  1R23 A;  1RIO H;  5HS7 A;  3W6J B;  3FXR A;  3BRO A;  3WE3 A;  2VBX A;  2W84 A;  2NRA C;  3R6S A;  2MA3 A;  2FSW A;  4RB3 C;  4KMU X;  2UXN A;  3ZMS A;  3DV8 A;  2GA1 A;  2M30 A;  4M6X A;  2UWM A;  1RUN A;  4GO1 A;  2BGC A;  3BWG A;  1J75 A;  1JGS A;  1Q1H A;  3HRU A;  5A2Q K;  2DPU A;  4MEX F;  2IVM A;  5HLG A;  2VE9 A;  2QBY B;  2XKO A;  2STT A;  1LQ1 A;  1UHW A;  4OIN F;  4A5M A;  4FHT A;  1UFM A;  4KYW A;  1AWC A;  3N4M A;  2FNP A;  2DQL A;  2MH2 A;  4QWQ A;  3FX3 A;  1FWZ A;  2CW0 F;  5E17 F;  1IZ1 A;  3RJP A;  3LA7 A;  2HOE A;  2CWE A;  2Y48 A;  1AOY A;  5L3B A;  1XD7 A;  3KE2 A;  1KU7 A;  3E6D A;  2WV0 A;  5LEJ A;  4O6J A;  3M8F A;  3JTG A;  2LDU A;  2E1C A;  3V8L A;  4ESB A;  3Q9V A;  3LWF A;  2RV8 A;  1EH8 A;  4EM0 B;  2A5Y B;  2ESH A;  3DPT A;  2XGX A;  1R5H A;  4JBA A;  3QAH A;  2G7U A;  2XAF A;  1KQ9 A;  4M74 A;  1HKQ A;  2HR3 A;  5CJ9 A;  5E1Z B;  2W24 A;  2PQ8 A;  5DV5 A;  5FFX A;  2A3S A;  2ISY A;  3KP7 A;  5HOO A;  1ONV A;  4A2U A;  3GW2 A;  2V1U A;  4GYG A;  4AD9 A;  3RKY A;  5ILU A;  4PCQ A;  1T98 A;  1D3Y A;  4MQ9 F;  3SXY A;  1ON1 A;  4L0Z B;  4LK1 F;  2V79 A;  4RS8 A;  1WI9 A;  3G73 A;  5HDN A;  3M7G A;  4AIJ A;  4HOB A;  4UV9 A;  1IN8 A;  3LFK A;  1BI3 A;  1JHH A;  4AIH A;  4ESF A;  1F1Z A;  4HQM A;  4XBF A;  1DPR A;  2R7D A;  3FMR A;  2Y75 A;  4G6Q A;  2HTS A;  3ZN0 A;  2IPQ X;  1XMA A;  2V6C A;  3EUH A;  1IXC A;  4KIC A;  4CGZ A;  3LA2 A;  2QLZ A;  1ZRF A;  1YW8 A;  1RUO A;  3LST A;  5CVU A;  4UNO A;  3QU3 A;  3MQ0 A;  1P6R A;  1LNW A;  5FLX K;  4EMS A;  3RDI A;  5K5R A;  1YLF A;  2XUB A;  4UHT A;  1O3R A;  2ZME A;  1EV7 A;  1CF7 A;  2X0L A;  3FF5 A;  4FX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...