4AIJA

Crystal structure of rova from yersinia in complex with a rova promoter fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
b'STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aijA00
3TQNA 3L2CA 4LFUA 1ON1A 3WTWC 2DU9A 4Q48A 3WTYC 1B59A 3BJ6A 2GA2A 3KP6A 1PUEE 4ZZDA 5DEQA 2CFXA 3JTHA 1BIBA 2KIMA 2LDUA 2FXAA 2MLGA 3EUHA 1L3LA 2VN2A 3HHGA 1W5SA 5BPIA 1ON2A 2QBYA 4ASNA 1O7LA 2JTVA 5HDGA 4CO8A 4A0XA 3I71A 4XRFA 1IN5A 3NRVA 1B9MA 2FEZA 4LLLA 2HYGD 1RUNA 4F7ZA 5LEJA 1MJBA 3J80Z 3CTAA 3O2PE 2G7HA 2UWMA 4LG0B 3IKTA 4LB5A 2HGCA 1YFHA 2OAZA 1HKSA 3WTTC 4XSXF 3KLOA 5DCMB 4OIQF 3O3KA 3IHUA 1S7AA 3HSEA 1ZGJA 2XAGA 4I02A 1WQ2A 2CYYA 2IVMA 2CGPA 2F5EA 2WWYA 1SMYF 1B6AA 3BY6A 1HQCA 2ESNA 1H9GA 3PFIA 2EK5A 2IT0A 5D5WB 2FBKA 2CG4A 3FM3A 3G73A 5FO5A 2VBWA 3WTSC 3S2WA 3QAHA 3SQNA 5LHGA 4LGWA 4G6DA 4NHJA 1XGOA 5CVUA 3EETA 3BZ6A 3H3UA 3KP2A 3WGHA 3WU1B 1F9NA 3FXUA 5D4RA 2AS5F 2R7DA 1OR7A 2HTSA 4I0BA 1K79A 1SFXA 2EFNA 2YR2A 4IHTA 3E6CC 5E1WA 3TO6A 1U5TB 3GFMA 4L5IA 3JAMZ 3EQLF 4HAMA 3F21A 2XAQA 4MGRA 5LHIA 4S04A 5IT3A 3TO7A 1ZRDA 2VE9A 1R1UA 2BE5F 2QWWA 2RQPA 4UVBA 3HIFA 4HX8A 1S3JA 4WK8F 2XV4S 1AWCA 3HTUA 2L01A 3ZMUA 1WSUA 1JHFA 1WWXA 5E8IA 1MDMA 1TW3A 4Q5SF 4EJOA 1KU7A 4XLPF 2GA1A 4XSZF 1YO5C 2P7CB 4EM1A 4RAYA 2GIVA 2PEXA 3QOPA 4LK1F 3QP6A 3K1PA 4KMUX 1LJ9A 4K2EA 2BGCA 4BAYA 2XASA 1UB9A 2FA5A 2PMHA 3I53A 2Z33A 5FFZA 4BHCA 1B1BA 1W7PD 3VOEA 3V8LA 1F4KA 3WE2A 2BYVE 4YFXF 5CYVA 5HVQC 3ECOA 1EH7A 3W6KB 1W4MA 2DO7A 1FYKA 3CUQC 3GW2A 1TW2A 3Q5FA 1XSDA 4R79A 2O6GE 1K6OA 2VODA 4EJVA 4PGHA 2XKPA 2OQGA 3ZMSA 3V7CA 1I5ZA 1TLHB 2ZXJA 1JHHA 5FLXK 4L5JA 1YLFA 2WC2A 3ZMVA 5D5VB 2VONA 4IF4A 1OYWA 3T8RA 4CICA 1O3SA 1IN8A 4JBAA 4HX7A 1FBSA 2AXLA 2OQRA 1BC7C 5LRRA 3GWZA 4FT8A 4G7ZF 3R0AA 3IL2A 4ZYHA 4KN7X 4OINF 1IZ1A 4L0ZB 1P92A 4RB0A 4ENKA 4RGUA 1U6GA 4EV0A 3N4MA 1UCRA 2CQKA 5CVIA 5F6FA 2ELHA 2B0LA 4ZYEA 3KZZA 2PBIA 5L3GA 2G7UA 3CDHA 5JHUA 3ELKA 5A2QK 3LA3A 1H0MA 5HDNA 1XD7A 3QPHA 3F8CA 4KNYA 1BM9A 4HDVA 2DPUA 1ZN2A 4UVCA 2HTJA 2FBHA 1EV7A 3RDIA 3RKWA 2OBPA 2K7LA 3M9AA 2RV8A 4JK1X 1TNSA 2P8TA 5LHHA 1QNTA 2EV6A 5L3BA 4M9SA 4EM2A 3IRQA 1IAWA 3REOA 5DV5A 2JRTA 3MFKA 3D5LA 2A6HF 3K1MA 2STWA 1WKMA 1ULYA 2GQQA 2NNYA 4HQEA 2V1XA 2WV0A 1JE8A 3HRSA 1F5TA 2L54A 4PZJA 3VB2A 1ZARA 2A5YB 2L3DA 1FP2A 2P4WA 4RGXA 2XHKA 5BMZA 4U0YA 2HS5A 2FNPA 3M8EA 2HQRA 2FE3A 4QWQA 4YFKF 5L3DA 2MLKA 2QQAA 1XMKA 1W5TA 1HBXG 5DD8A 4IRGA 4G6QA 5JI6A 3GZ5A 1IN7A 3ERED 2BEOA 1LDJA 5E17F 3LA2A 4LLGF 4LD5A 2FNAA 2ZBKA 3U1DA 1XGSA 2ACJA 2KIUA 3E97A 1RIOH 1X3UA 3IC7A 2XGXA 2VOOA 1IN4A 2IA1A 3FMRA 1AOYA 4CZZA 5D4SA 1XSVA 1BN5A 1W7PA 2XVCA 3DKWA 1A04A 1R5GA 1QO0D 2QUFA 2RGVA 3GYHX 3T5XA 3T8TA 3ZN0A 1P2FA 2YU3A 1U5TC 1I6XA 2VC1A 3N97A 5ICEA 1KU2A 1K78A 1IXCA 5HLIA 3LAPA 4S05A 4YFNF 5H6QA 4KDPA 1G6NA 4HOBA 2GAUA 4OIPF 5H20A 1ZG5A 2Q8KA 2QM3A 3BDDA 3MCZA 5F64A 4A0YA 5CVRA 3BJAA 5EEGA 3EYYA 2QQ9A 3LQRA 4OMYA 2M87A 1S29A 2M30A 1LVAA 4DNCA 5E8GA 2FMLA 3H92A 3TDZC 3VFZA 3U9GA 1KA8A 2E1CA 5KVRA 1G3WA 1R22A 3IRRA 1FP1D 1IN6A 4RB2C 3TO9A 5H6RA 5LBQA 2L4MA 2P5VA 3GFJA 1YS6A 5E18F 2KJCA 2DTRA 1ONVA 2BBYA 2XUBA 1MDMB 5ICCA 2MA3A 4LMYA 1FX7A 4N9HA 2HKXA 2K02A 2JPCA 2W85A 2ETHA 4OMZA 4ZYGA 1WI9A 5E20A 4O6JA 1NHAA 2A61A 4A0ZA 3FM5A 3U2RA 4M72A 1YIOA 2ZO4A 5ED4A 4HF2A 3I4PA 1YW8A 2DK5A 1HSTA 5D5UB 1HXDA 1XN7A 3ML6A 2ZJ2A 2D1VA 4BNCA 3TKYA 4G8XA 3SFZA 3OOPA 1KQ8A 1JGSA 3SHFA 3SZTA 3ABUA 3ULQB 4HZFA 4IHSA 3KLNA 1MGTA 4R1HA 4MEYF 4RB1A 4UXNA 4ESFA 1YW7A 3CUOA 3GX4X 2PQ8A 2E1NA 4XBFA 1YTYA 2QLZA 3K1NA 3KP4A 1V3FA 1R00A 4WXDA 5K5QA 4M71A 3FWEA 5TJJA 1I1SA 3C1DA 4Y15A 2PFBA 1U8RA 4IXAA 5K5RA 2XAFA 4GCVA 1FYMA 3IWFA 3CUQA 1KYZA 2ZKZA 4IVNA 4RB3C 4HLYA 5FFXA 1ZHFA 2W84A 5CVJA 1T98A 2O03A 4MTDA 4AIJA 1J7KA 3Q9VA 4BH9A 2DQRA 2YSRA 2W57A 1QZYA 3SXYA 2Y0MA 1XGNA 1O3RA 2M5WA 4A6DA 1OMIA 2X4HA 1HW5A 3WG9A 4D0PA 4A5MA 5EEHA 3E3VA 1J59A 1O3TA 4N9IA 4L18B 5ICFA 4U7BA 3I59A 2RKHA 3GEZA 3HHHA 5LEKA 1IF1A 4OIRF 2FF4A 3P7NA 4MHGA 2HQNA 3F8NA 4HV5A 1ZREA 1L0OC 2RN7A 1S6LA 2IW5A 2A6EF 1F1ZA 1PP7U 1MJAA 1O7FA 2IA0A 1R5HA 3R4KA 4HF0A 2HFHA 3J80K 2JSCA 1XB4A 3F8BA 2STTA 4HW0A 2MH2A 4L9TA 5D8LB 4EJUA 5AONA 4AIKA 2V9VA 1P4AA 4UVAA 3J81Z 3V7RA 2NRAC 4PGGA 1G3TA 1J9IA 1CF7A 4Z2YA 3AAFA 1HSJA 2LF8A 4UV9A 1KYWA 3T0YA 3CO7C 1BIAA 5J8FA 2NNNA 2DLLA 1LDDA 1ZG1A 3F6VA 2EFOA 2LKPA 1ZGAA 3LFKA 3BROA 1GXQA 3E5QA 4U0VA 1FBQA 5J8CA 2H6CA 5BPDA 1D5VA 2O8XA 4P55A 1H9TA 1HKTA 3K2ZA 4KICA 1GXPA 1BC8C 2HDCA 2WTEA 1Z6RA 4GXOA 2RVCA 1IRFA 3TOBA 5FGMA 2E7WA 1USTA 1MZBA 1P4XA 3GF2A 4N0BA 2FMYA 1KU3A 1UFMA 3L09A 2W25A 4LJZF 5CVVA 1FYLA 1SD7A 1FWZA 4Y17A 2Z9OA 2VBXA 3E5XA 4KMFA 3C18A 1RZ4A 5LGUA 3V8JA 1IXRC 3KFWX 1VTNC 3DV8A 2A69F 3J7AO 1BI2A 3TGNA 4RGRA 5D5XB 4CXFA 1S7OA 1O57A 5DD4A 2J5PA 1QGPA 3F72A 2NS0A 5HDKA 1S8NA 3JAMK 1USSA 4EM0B 1XDSA 5LRSA 3ISPA 3GZ6A 4HV6A 3WTZA 2KJBA 4AWXB 3MQ0A 2ZNZA 1U5TA 2EJRA 2HWVA 3ZN1A 2LSOA 3HSRA 1XDUA 1LQ1A 1RUOA 1G3SA 1I1GA 3DPLC 4ETSA 3FX3A 4L9JA 2XRNA 4OIOF 4HYEA 3HOSA 4L9VA 4UHTA 4CGZA 1FOKA 2A3SA 3TOAA 2QBYB 2CWEA 3DXJF 4LB6B 4CDGA 1PDNC 2HR3A 1D3YA 4KIBA 4P5OA 5DUIA 3GFIA 5JR3A 2MC3A 4MNUA 1YYVA 2VT3A 1DP7P 1R1TA 5BOXA 3FXRA 2EWNA 3MEXA 1BOAA 1HKQA 3M1EA 5LGTA 3GFLA 1BBYA 1T0FA 3GVAA 1K7AA 2EFQA 3RKYA 2RNJA 5ERIA 2M1BA 4HF1A 3MWMA 3DPTA 4KIFA 2QZ8A 4MQ9F 2K4JA 1T2KA 4HA8A 2V1DA 3RKXA 2ZMEA 3FZVA 3PQKA 2FQ3A 3KEOA 2IPQX 1FNNA 3I5UA 4U88A 5DYMA 3RJPA 2F2EA 1U2WA 4B8XA 2FRHA 3DP7A 3E6DA 1T6SA 3LAJA 3I0TA 2R3SA 5D6FA 3Q9SA 2X0LA 2A07F 2PI0A 2GXGA 5AIPA 5D6EA 2ADUA 1BI0A 1Z9CA 4UUVA 5JVTA 1T39A 3ZQ7A 1J75A 3P9CA 4EGYA 3BPVA 1ZLJA 2HYFA 4ON0A 3V8KA 4KYWA 2OU2A 1XCVA 4RGSA 2D45A 1D8JA 1IW7F 4UV8A 5HS9A 4IJAA 2HZTA 2GZWA 2OD5A 4Q47A 1GVJA 4PCQA 2OA4A 1KQ9A 3C7JA 2KKOA 4ZH4F 2YX4A 3HUGA 3BOQA 4BQAA 5CJ9A 3FMSA 5L3EA 1ZRFA 3FXQA 2PN6A 3IKVA 3K0LA 1PP8F 1R7JA 2FOKA 1TNTA 4AIHA 2VOPA 4I0AA 5BQTA 5L3FA 1R1VA 3RIRA 4A12A 4OU0A 3WTUC 4KUMA 2J5OA 1CGPA 1FSHA 3QP5A 2D2WA 5JFRA 1Z1DA 4HX4A 5D8KB 2FU4A 1KQ0A 2DQLA 2UXNA 1G3YA 2XAHA 3F6OA 4AVPA 3FMQA 1MKMA 4G9YA 2XROA 2PJPA 2DFIA 1D8KA 1FY7A 4KA4A 1OPCA 2IJLA 4G94A 4IRHA 3ECHA 1CF7B 4WX9A 2O0YA 3IWZA 1DPRA 3RYRA 3I54A 2K27A 5K1YA 4I2OA 5ILVA 1KGSA 5DUKA 4MQVA 2EV5A 4AD9A 1J0RA 2Q0OA 3HTSB 4EJTA 3KE2A 1TTYA 2ZCWA 2O3FA 4G7OF 1XGMA 3HSFA 3RI4A 4EMSA 4ENNA 5DDGA 3CLOA 2P7VB 4O3MA 3K9TA 1GHCA 3G3ZA 1DUXC 3JSOA 3E6BA 2L02A 2JZYA 3C3WA 1XCBA 1FC3A 3EDPA 1Z91A 4ENMA 1QQIA 4IPAA 3RTRA 5ILUA 4WXCA 3V7SA 5BS6A 4G7HF 4P9UA 1OYYA 1E2XA 3F8FA 2K4BA 3FF5A 1JXSA 4I09A 3MZYA 2A68F 1FT9A 4WCGA 2IA2A 2FSWA 2H6BA 2Y75A 4YIIA 5FLXZ 1FSEA 2COMA 2UZKA 3MAJA 2PG4A 3GO5A 4FHTA 4DQ2A 1SD5A 2VBYA 2QENA 1ZG3A 3I58A 3JW4A 3P9KA 3ABTA 2Z5UA 3KP3A 4EVIA 3LWFA 4L9NA 3DEUA 5E1ZB 3QPTA 2RDPA 1SFUA 2CO5A 4M73A 1UHWA 4MTEA 2ISZA 4RAZA 3F8MA 1LEBA 4KN4X 2H09A 4M74A 2H27A 4BHPA 1WRJA 3I64A 5A2QZ 2Z99A 2MH9A 2YX7A 4A6EA 4H0EA 3FHZA 4U0WA 4HLXA 2EV0A 3TDUC 1LEAA 1SMTA 2ZFWA 2KIFA 3R6SA 2O61A 1EH6A 4FX0A 2M8EA 5LLQA 3L00A 3KCCA 4KT5C 3WGIA 1HW1A 4YG2F 5HLGA 3H3ZA 3HYIA 2DT5A 2VBZA 1T38A 3WODF 2IP2A 1ZAOA 4GYGA 3ROUA 2F5FA 2VXZA 3KP7A 1XMAA 3PQJA 5LGNA 3WTXC 1J5YA 4JQFA 3BJOA 5KK1A 2EA2A 2DPDA 1IRGA 2QYOA 3RPUA 3JTGA 1TBXA 3R60A 2PMUA 1YW9A 1BI3A 3VODA 2CSOA 3WTVC 4ESBA 5TRDA 4LG0A 5HOOA 2L4AA 4ZZLA 3KZYA 5ILSA 1LNWA 4O5VA 1P6RA 2IRFG 1IXSB 5K5OA 5DCMA 1STZA 3RYPA 2EA4A 1ZRCA 4LLNA 3GUDA 1I27A 1MJ9A 3HRTA 4KIGA 1TQMA 2ZMEB 4PDKA 1E17A 2E7XA 2G9WA 4OOIA 3QU6A 4WF2A 3ZMZA 1MD0A 4HQMA 2P5LC 1DDNA 3JSPA 5CLSA 3SZPA 1W7PB 5J6XA 1EH8A 4YIFA 3M8FA 2LNBA 3R61A 2YPRA 4KFCA 3E6MA 1Z6TA 2HKOA 3WE3A 1C0WA 4P9FA 2H94A 4A5NA 3F23A 1K78B 1ODDA 1BJAA 4A2UA 2Q2EA 2C6YA 5HS8A 2EFWA 1ZLKA 2D1HA 5L3CA 3ZPLA 1Z7UA 4FX4A 1Q1HA 4QLCU 1KU9A 4R8HA 3GLXA 3O6BB 2P6SA 3COAC 3L7WA 1REPC 4BHBA 3LQQA 4M6XA 2VC0A 2MBFA 1RNLA 2V6CA 4TV7A 4WXHA 3BP8A 4ESJA 4IRIA 4I98B 1G4DA 2MD5A 2EFPA 4U7DA 3ZP5A 1O3QA 3EYIA 4RS8A 2ZNYA 2ISYA 1Y0UA 1OYIA 2DK8A 4M6YA 2F5DA 2FBIA 1XSXA 2NYXA 5IT9Z 1HW2A 2DBBA 4BYYA 2DI3A 2Z3YA 2UXXA 3KETA 2VT2A 1UHMA 4XLNF 1R58A 1SFEA 4P96A 2PLYA 1IUYA 3L9FA 3P9IA 1LB2A 3DF8A 2TDXA 1BI1A 2P6TA 3KEQA 5FB2A 3BWGA 3WGGA 1RI7A 2NAZA 3ZMDA 2P5KA 2BV6A 2K86A 4EJWA 2HOEA 1B9NA 3BPXA 4NQWA 3J81K 1Z05A 3OV8A 1FLIA 4I7HA 2QQBA 1QPMA 3GXOA 2F5CA 1YG2A 2R7FA 3HRMA 5E1XA 3F22A 5DCFA 3B02A 2XKOA 2KRFA 2EB7A 2GWRA 4M9XA 2QVOA 1QBJA 4EQQA 4HBLA 3WU0A 4BXUA 4LK0F 3K69A 1V4RA 2JT1A 1SD6A 1QZZA 4MEXF 2VE8A 3F3XA 1P4WA 1R23A 1YS7A 3DFGA 3E5UA 5FD6A 1SAXA 1TQPA 1R36A 3B73A 4EGZA 5AIQA 3NQOA 5F1RA 5FD5A 3W6JB 1FBUA 1ZYRF 4M9ZA 1OKRA 2JPBA 4NB5A 1B4AA 4HDUA 2OZ6A 3KP5A 2XAJA 4L0YB 5HLHA 4Q4ZF 3ZMTA 4ENJA 3QU3A 5ICGA 2LF7A 3DQVC 1TQIA 1SD4A 4GGGA 3VEPA 1LDKB 4Y13A 3LSTA 3CUQB 1U78A 2HEOA 3R0JA 3D0SA 6PAXA 4WWCA 2M45A 3CO6C 4CYDA 3V4GA 3HRUA 3T1BA 4E70A 4B09A 2V1UA 1FPQA 4UNOA 2DW4A 1FZPB 4ZYDA 1U3EM 1DPUA 3NEUA 1YQAA 3QRFF 1J2XA 5IT9K 5HS7A 2RC4A 2W24A 3MZHA 2Y48A 4I01A 2CW0F 4CHUA 2OZUA 3RPQA 2ESHA 3I59B 2V79A 2XIGA 3HOTA 3M7GA 3LA7A 3CJNA 4GO1A 4GYIA 2GXBA 2DAOA 1ZH5A
chains in the Genus database with same CATH superfamily
3TQNA 3L2CA 4LFUA 1ON1A 5EZGA 3WTWC 2V26A 3I56I 2DU9A 1MNDA 2CV2A 4CCLA 1MBKA 4YEJA 4Q48A 3WTYC 1B59A 3BJ6A 2GA2A 3H9QA 3KP6A 2B7EA 2I8DA 1GT0C 1UHSA 4E7IA 1PUEE 4ZJZA 3HB9A 2CW8A 1H89C 3MKWB 1T0FC 4ZZDA 5DEQA 2CFXA 2K85A 3Q3SA 3BQYA 3JTHA 1EA3A 4DBQA 2GM4A 1BIBA 2KIMA 2LDUA 2FXAA 2MLGA 2EPFA 3C2BA 3PO3J 1T33A 3EUHA 1L3LA 5C4JJ 2VN2A 4XKWA 4ZDPA 2JA8J 3HHGA 1W5SA 5BPIA 1ON2A 2QBYA 1TWGJ 4ASNA 2EZKA 3QWLA 1O7LA 2JTVA 3N05A 3GBGA 2O7OA 5HDGA 2LRDA 2ZMEC 2L9NA 4XONA 4ZC3A 4CO8A 3ZQLA 1PVEA 4IHYA 4A0XA 3I71A 2ID3A 5F0CA 5GADJ 1YRNB 1R49A 4XRFA 1IN5A 2DA3A 5EF6A 3NRVA 1B9MA 1TT5B 2FEZA 4LLLA 2HYGD 4ZYAA 1RUNA 4F7ZA 2RAEA 3MMYB 4OAZA 3EUAA 1G2HA 3OWTA 1LE8A 5LEJA 3W3CA 1MJBA 1R5ID 3DEEA 3J80Z 3CTAA 1GV2A 3O2PE 2DMQA 2G7HA 5M3MJ 2UWMA 5EEAA 4FETA 1JTYA 5J4VA 4CCKA 4LG0B 3IKTA 4LB5A 3HOWJ 2HGCA 1YFHA 2OAZA 1HKSA 3WTTC 4XSXF 5K7HA 3ZQQA 3KLOA 5DCMB 1MBEA 2F48A 3RQ4A 1SFOJ 3O3KA 4OIQF 3IHUA 1ERDA 2KPMA 3DEWA 3GTMJ 1S7AA 2CV0A 2VUMJ 3HSEA 3JRAA 3OSGA 1SEUA 2EZIA 1ZGJA 2XAGA 4G12A 4I02A 1WQ2A 2GBYA 2CYYA 2IVMA 3H0GJ 3OYAA 2CGPA 2WADA 1DQUA 1W5CC 2F5EA 2WA0A 2WWYA 2BZTA 5GPAA 2R7WA 1SMYF 1B6AA 3BY6A 1HQCA 4X1EA 2ESNA 1H9GA 3L2VA 3AG3H 3JRFA 3PFIA 4GFBA 3H9GA 2EK5A 3F9KA 4RAGA 4QTRA 2IT0A 1RKTA 5D5WB 2FBKA 2CG4A 1JUSA 3FM3A 5HNFA 3G73A 5FO5A 2VBWA 2EQRA 3WTSC 3I4MJ 3U21A 3S2WA 3S14J 2P81A 1JT6A 3QAHA 1WH7A 3SQNA 5LHGA 4LGWA 5IY5H 2Q2EB 2EH3A 4G6DA 2V4JC 4NHJA 2VPLA 1XGOA 3DWLE 1QHGA 3A03A 5CVUA 3EETA 2WY8Q 4J00A 1Z3XA 3BZ6A 4M3DA 1UG0A 3H3UA 1W0UA 3KP2A 3WGHA 1R4NB 3WU1B 1F9NA 1IDZA 4CCNA 4AC0A 4BKXA 5E3NA 4XRSA 4BQOA 3TW7A 3BR1A 3KZIC 2KMUA 1V55H 2NS8A 3FXUA 5D4RA 1UZCA 2V7FA 2AO9A 2AS5F 4CH7A 2R7DA 2E1OA 1SVMA 3SEQA 1OR7A 2HTSA 4I0BA 1K79A 3M4OJ 4MO7A 1ETWA 1D1CA 1OFCX 1SFXA 4NC7A 3H9JA 2EFNA 3CC7I 2AXTC 1VQKI 2YR2A 4IHTA 3E6CC 5DS9A 5CKTA 5E1WA 3OY9A 3TO6A 1U5TB 4QPOA 4IEJA 3GFMA 4LIUA 1GUUA 4L5IA 4A3LJ 3JAMZ 3DTKA 2R92J 3EQLF 5EG0B 4HAMA 3F21A 2XAQA 4MGRA 5LHIA 4S04A 5IT3A 3TO7A 2Y31A 3GTPJ 1ZRDA 3K4LA 3BR2A 1R1UA 2VE9A 2BE5F 3A01B 2QWWA 2RQPA 4UVBA 3HIFA 1OCZH 3OR2C 3HPGA 4HX8A 1S3JA 4B1RA 4WK8F 2QSGX 1Z3YA 2XV4S 1AWCA 2X48A 3CMEI 3HTUA 3CCRI 2L01A 2X9DA 3ZMUA 1WSUA 1JHFA 1WWXA 3MZ8A 1HDDC 4BY7J 3H0DA 5E8IA 1MDMA 1VQ5I 1FMVA 1TW3A 4Q5SF 4EJOA 1KU7A 2Y0SA 2IBDA 4IX7A 2MG4A 2L7FP 1B8IA 4XLPF 2GA1A 1E0EA 1X1PA 2DFFA 4XSZF 3QYEA 1VZ0A 1YO5C 2LG4A 2P7CB 4RLQA 4JOMA 4RAYA 4EM1A 1D0YA 2GIVA 2X85A 3WHBA 2PEXA 3QOPA 1YITI 4LK1F 2UV1A 3QP6A 3K1PA 4QPQA 4KMUX 1LJ9A 4K2EA 2BGCA 1CQTA 4Y33A 3MKYB 4A3EJ 2FX0A 2LVSA 3W6VA 5F0HA 4BAYA 3CD6I 2HQAA 2XASA 1UB9A 2FA5A 4HPQA 2PMHA 3I53A 2R93J 2Z33A 4DBRA 5FFZA 4BHCA 5KAFC 1EKEA 1D1BA 1XMXA 1Y8QB 1B1BA 1PJRA 4KISA 1W7PD 2BY3A 3VOEA 3V8LA 4XM3A 1F4KA 1EJ9A 3IP4B 4F55A 3WE2A 2BYVE 4YFXF 5CYVA 5HVQC 1IGNA 4PFPA 5EGOB 3ECOA 2AQFA 1EH7A 3W6KB 1W4MA 2DO7A 1FYKA 3CUQC 3GW2A 2M4GA 3G71I 1TW2A 3Q5FA 2KZVA 3G1LA 1XSDA 4RA2A 4R79A 2KLOA 2K3PA 1K6OA 2O6GE 2VODA 2DT7B 3TBIA 3W2WA 4EJVA 4PGHA 2X1EA 2XKPA 2OQGA 2R5YB 3ZMSA 3BG3A 2M4KA 4DIQA 3V7CA 4PK4A 1I5ZA 1TLHB 1GDTA 2ZXJA 2DA2A 4C2UA 3HBLA 1FOWA 1JHHA 5FLXK 1DU0A 4XKBA 2XF7A 4L5JA 1YLFA 4BU2A 2H1LA 1LVKA 4CA0A 2WC2A 1OCOH 3ZMVA 5D5VB 3G1MA 1Y39A 4IF4A 2VONA 2VQLA 2XF6A 1OYWA 4A3GJ 3T8RA 4CICA 1FMWA 3K4MA 4DYCA 1DGWY 3L2WA 1O3SA 1IN8A 2JUGA 5FROA 4JBAA 4HX7A 2OJED 1FBSA 1UMQA 2IXSA 2XPVA 5HNHA 2AXLA 1J09A 1ETQA 2OQRA 3ABLH 1BC7C 5LRRA 3GWZA 2XRLA 5C4XJ 3MKLA 2LTPA 1E3HA 4FT8A 4G7ZF 1YJNI 1IRZA 2L5QA 2KT0A 3R0AA 3IL2A 3CP2A 4ZYHA 2WAEA 1ZR4A 2DA4A 2Z1DA 2NXNB 4KN7X 4OINF 1IZ1A 4L0ZB 1MMAA 1P92A 4RB0A 3OYHA 3CQZJ 2WB1N 3PSFA 4ENKA 2N8GA 4RGUA 1U6GA 4EV0A 3I55I 2Y2ZA 3N4MA 3QYFA 1UCRA 1X3WB 2CQKA 3CP8A 5CVIA 5F6FA 1N78A 2X6WA 2ELHA 3LSKA 3S15J 2B0LA 4NDLA 4XMYA 3AG2H 4ZYEA 3J7YJ 2LH9A 1AA7A 3KZZA 2PBIA 3JRDA 5L3GA 2ME0A 2G7UA 3CDHA 5JHUA 2KIQA 1OCPA 2WV1A 1KONA 4B48A 2KL4A 1VFCA 3ELKA 5A2QK 3LA3A 1ZQ3P 1H0MA 5HDNA 1XD7A 3PIPF 1R9TJ 3QPHA 2M9HA 1OCTC 3F8CA 4KNYA 1BM9A 2BW3B 3S8PA 4HDVA 2DPUA 1SAUA 4C9YA 2W48A 1ZN2A 3DTIA 4UVCA 2HTJA 2FBHA 1EV7A 5TISC 3RDIA 3VPRA 2TCTA 3RKWA 2OBPA 4JX5A 2K7LA 3M9AA 1HA8A 1M1EB 2RV8A 5C44J 3S17J 2ELKA 4JK1X 1TNSA 2VJ4A 2P8TA 1S72I 2L7KA 5LHHA 1U9NA 3ZRGA 1QNTA 4IO9F 2EV6A 4M9SA 4EM2A 5L3BA 3IRQA 2E2JJ 1LFBA 3FHNA 3PNYA 3S1MJ 1WFXA 4H4KC 1IAWA 1Z0XA 3REOA 2O8KA 5IOYA 5DV5A 1YIJI 1ETXA 3VSKA 3BC8A 4B43A 2JRTA 4V2FA 3MFKA 3D5LA 2A6HF 3K1MA 4F52A 2STWA 3BR6A 1WKMA 1ULYA 2ME6A 1NG7A 5M5YJ 2GQQA 2NNYA 5FKLA 4BGDA 4HQEA 1A36A 1TWCJ 4NUBA 2V1XA 4XOPA 2WV0A 2B63J 1JE8A 3HRSA 5M5WJ 1F5TA 2VJJA 2L54A 4PZJA 3A0BC 1ETVA 3VB2A 3LSMA 1MNMC 1ZARA 4AIDA 3O8HA 2A5YB 2L3DA 1FP2A 2MFZA 2P4WA 4RGXA 1RESA 4AM3A 2XHKA 3CF5F 4U0YA 5BMZA 2HS5A 2FNPA 3OL4A 1MBFA 1JKOC 3M8EA 2HQRA 1VQMI 3WHCA 2FE3A 4QWQA 1WJFA 4BY1J 4YFKF 2XB5A 2MLKA 5L3DA 4E7HA 2QQAA 2KISA 2X6YA 1ETOA 1ZKGA 2IGKA 2Z16A 2FUG2 1X2NA 1XMKA 2L0KA 1APLC 1W5TA 1HBXG 2E2HJ 5B5EC 2NVXJ 2JA5J 2CU7A 2M2EA 1X58A 3GTLJ 4OWRB 1WJBA 4ZDLA 4I76A 5DD8A 5KNLA 3OYLA 3OR1C 4IRGA 4G6QA 5JI6A 3GZ5A 5J47A 1IN7A 1WJ5A 3ERED 1E3PA 3CC2I 1JKPC 3S2DJ 2BEOA 1LDJA 5E17F 3LA2A 4LLGF 3AG4H 3ZCOA 4LD5A 4B47A 2FNAA 2ZBKA 3TL4X 3MN2A 2R7ZJ 2V9PA 3HGYA 3U1DA 1XGSA 2ACJA 2KIUA 1BL0A 3E97A 1ITYA 5E3LA 1RIOH 3BG7A 1OCRH 1X3UA 3I4NJ 1NG6A 2HVQA 2YS9A 3IC7A 1A35A 3BR3A 1P7IA 2XGXA 2VOOA 1IN4A 2IA1A 3FMRA 1AOYA 4CZZA 4NC6A 5D4SA 1XSVA 2QKLB 4C30A 1BN5A 1W7PA 2XVCA 3DKWA 5IYCJ 3LSPA 2XGDA 2HNHA 4RLFA 1VQ4I 1A04A 3BR5A 3J7AY 1R5GA 1QO0D 2DMUA 2QUFA 2RGVA 4DJAA 3GYHX 1FOXA 3T5XA 3T8TA 1BJZA 3ZN0A 4Y4RA 1P2FA 2YU3A 1U5TC 2L2OA 4XLFA 1GV5A 1I6XA 2VC1A 1AKHB 3N97A 5ICEA 3QQAA 1VI0A 2VL8A 1KU2A 1K78A 2R7SA 2Y30A 1XC5A 3FK6A 1H8AC 2BVMA 1IXCA 4XQFA 2VJIA 5HLIA 3LAPA 2CH0A 4BEHA 4S05A 4YFNF 4YIRX 2E71A 2K9LA 2MSYA 4Y52J 1NK2P 5B66C 3OYFA 5H6QA 4KDPA 1G6NA 3HL2A 4HOBA 1MH3A 2QKMB 2GAUA 1JJ8C 4MFEA 2ZJRF 4OIPF 4GRIA 2FOWA 5H20A 1ZG5A 4IHWA 2Q8KA 4E7LA 4IQ4A 2HZDA 2QM3A 2DYSH 3BDDA 3CCEI 2OCCH 4G6TB 2IS2A 1OJLA 1B72B 3MCZA 3PO2J 3ZGKA 3DLLF 3M1CA 5F64A 4A0YA 2R5ZB 5CVRA 2K9MA 3L2RA 3BJAA 4M3EA 3EYYA 5EEGA 2QQ9A 3LQRA 4OMYA 1X1AA 3PFYA 2M87A 1S29A 3AKZA 2E1MB 2M30A 1PUFB 2EZLA 1LVAA 1ETKA 4DNCA 5E8GA 2FMLA 4XLAA 3H92A 3CCQI 3TDZC 1V5EA 3VFZA 5F27A 3U9GA 4M3BA 1KA8A 5IYBJ 2FD5A 2DXIA 2E1CA 2OPTA 1HLVA 4ZTFA 5KVRA 2XF5A 1G3WA 1X1BA 2LBFA 1R22A 1QA6A 3IRRA 1FP1D 1IN6A 4RB2C 3TO9A 5H6RA 3K2AA 2NVYJ 5LBQA 2L4MA 1TWHJ 5FLMJ 4V19K 2P5VA 3GFJA 1YS6A 5E18F 2KJCA 1DU6A 2DTRA 1UELB 4RDUA 1ONVA 2BBYA 2KQRA 2XUBA 1MDMB 3RCOA 2HVSA 3HEFA 4FASD 2MA3A 5ICCA 5IPAA 1LFUP 4LMYA 3Q0WA 5GAGJ 4BE1A 1B8IB 2QA4I 3TMOA 1FX7A 4N9HA 4XICA 2F5VA 3PNTA 1QZEA 3M8JA 2HKXA 2K02A 5J1UA 4BJTA 3KIOA 3GTGJ 2JPCA 1P9QC 2W85A 2ETHA 3E0JB 4OMZA 4ZYGA 3K4JA 1WI9A 2OF7A 5E20A 4O6JA 3BG5A 2HPMA 1NHAA 2A61A 2V6EA 1IO2A 4A0ZA 3CCLI 2E2IJ 1TT0A 3FM5A 3U2RA 3KYDB 4M72A 1YIOA 1Y1VJ 1BOBA 2ZO4A 5ED4A 4HF2A 3I4PA 1YW8A 2DK5A 4HRIA 2DN0A 1HSTA 5D5UB 1AU7A 1HXDA 1XN7A 4IL6C 3ZR8X 3ML6A 5EDNA 2ZJ2A 2D1VA 2A5WA 3HKZN 3M3YJ 4BNCA 1SVLA 4G8XA 3TKYA 3SFZA 3OSFA 3OOPA 1BR4A 5F1JA 3GLLA 1KQ8A 1JGSA 1RETA 2PX9A 2JRMA 4PSWA 3SHFA 3SZTA 3ABUA 2E5ZA 4XRSG 2QSHX 4PJ0C 3S2HJ 5GP9A 3ULQB 4HZFA 3VYRB 4CYCB 3CLQA 1MMNA 4IHSA 3KLNA 1MGTA 4R1HA 2LLKA 4MEYF 1N75A 4RB1A 3HC7A 4BS9A 4UXNA 3F0CA 4ESFA 1YW7A 3D1NI 2DFHA 3CUOA 3GX4X 3BQZA 5B1BH 2PQ8A 4FTHA 3K4KA 5DM6F 4UUSB 4Y7NJ 4AYBN 2LY9A 2E1NA 3FDYA 4XBFA 1YTYA 4A3JJ 2QLZA 3IUOA 3K1NA 3KP4A 1V3FA 3DCFA 2ZB9A 1R00A 4WXDA 5K5QA 2VKEA 5FRNA 4FE7A 1A6QA 4M71A 3ZQGA 3IH2A 4P1WA 1MBHA 1Y6IA 3FWEA 2EBIA 5TJJA 1I1SA 3C1DA 4F93B 4Y15A 4BJ6C 2PFBA 1K6YA 5IOZA 1U8RA 4IXAA 4B3XA 3V42A 2VKHA 2FJ1A 5K5RA 2XAFA 2Z2SB 2IS4A 4GCVA 4LOCA 2BHYA 1X1DA 1RKWA 3CJRB 4CCOA 3G4SI 1D1AA 3IWFA 2R0QC 1FYMA 3CUQA 1KYZA 3G6EI 2ZKZA 2VXDA 4IVNA 4RB3C 4HLYA 2MABA 4D5FA 2PMZN 2IGOA 5FFXA 2W7NA 3FXJA 1ZHFA 2W84A 1OLTA 3IH3A 4DGWB 1JKRC 4PFOA 5CVJA 1T98A 2O03A 4MTDA 1Y1WJ 1VQNI 4AIJA 4C2TA 1J7KA 3Q9VA 2JK3A 2LK2A 5J4YA 5E79C 2DQRA 4BH9A 3O8GA 4Z6YA 2HI3A 2MYSA 2QEXI 3LSJA 2YSRA 1WCMJ 1MBJA 2W57A 5GTHC 1QZYA 3SXYA 2Y0MA 1XGNA 3K7AJ 1O3RA 4XLCA 1WJCA 3MD2A 2M5WA 3VYSB 3BTCA 4A6DA 4L5EA 1OMIA 2X4HA 3JRIA 1HW5A 2RREA 3ZQFA 4XNFA 3WG9A 3HKZA 4D0PA 4A5MA 4S0HB 5EEHA 3L2UA 3E3VA 3OYIA 2HYJA 3FIWA 1J59A 3TP0A 1O3TA 2NOJB 1IUFA 3B6CA 4II3A 1ZR2A 2O9LA 1RR8C 4N9IA 4L18B 3WG7H 2DTZA 1POGA 3BZCA 5ICFA 1WJDA 4U7BA 4NBQA 3I59A 3OIQA 2IAIA 2RKHA 4XN3A 3GEZA 3CCSI 3HHHA 5LEKA 1IF1A 4OIRF 2E35A 2FF4A 3P7NA 4MHGA 2HQNA 3F8NA 3I3LA 4MLOA 4PSXA 2GLOA 2I10A 2WY7Q 1YX3A 3KYCB 3UKGA 1XPXA 4F92B 2KDZA 4HV5A 2L9SA 3FKJA 4AYBA 1UG2A 1ZREA 1L0OC 2RN7A 1S6LA 2IW5A 2NS7A 2VPRA 3OYMA 2A6EF 5HLTA 3AFHA 5E3MA 4PUSA 4NQWB 5J3LA 1F1ZA 1BR1A 2COBA 1PYVA 2M7BA 1MJAA 1WVRA 1PP7U 1O7FA 2IA0A 1R5HA 2M0CA 3H35A 2QF7A 3R4KA 4HF0A 2HFHA 3J80K 2JSCA 3ZOBA 1XB4A 2KZGA 3F8BA 3ASNH 2STTA 4A93J 4HW0A 3P5JA 2MH2A 4L9TA 3LMMA 3K70C 5D8LB 4EJUA 4HNUA 1D5YA 1LKXA 5AONA 1UAAA 4AIKA 2V9VA 4I99C 2WAQN 1P4AA 2QQ8A 2CUEA 4UVAA 1YRNA 1IG7A 3J81Z 3V7RA 2NRAC 4PGGA 2GXAA 1G3TA 3FXMA 4JX4A 3TW6A 1J9IA 1CF7A 3EPZA 4FISA 2HVRA 3RKQA 3RQIA 1YI2I 4DOZA 4Z2YA 2VQCA 3AAFA 1HSJA 3SJMA 2LF8A 5DM7F 4UV9A 1KYWA 3T0YA 3CO7C 1BIAA 5J8FA 2E5NA 2NNNA 4D9JA 3IV5A 2DJNA 2DLLA 2F4IA 1ENHA 4PJJA 1LDDA 3JRCA 3WU2C 1ZG1A 3F6VA 4JX6A 2EFOA 2NOGA 2F4OB 2EIKH 2LKPA 1ZGAA 3LFKA 3BROA 1GXQA 3E5QA 3FISA 2KRCA 3S93A 4XLHA 1QRYA 3K4NA 4U0VA 1FBQA 5J8CA 5FKMA 2H6CA 2O5RA 3A02A 5BPDA 1D5VA 4BUPA 2R7TA 5CQEA 2O8XA 4P55A 4D7MA 1H9TA 1BW5A 1HKTA 1FTZA 4XN0A 3K2ZA 2DDAA 5B3SH 4KICA 4E4HA 2X6XA 4N4NB 4BACA 1W36C 4B3AA 1R71A 1GXPA 4D5CA 1BC8C 5C3EJ 2IGMA 2HDCA 2WTEA 2LY2A 4PJMA 1Z6RA 3LSRA 3SYTA 4GXOA 2RVCA 1IRFA 3TOBA 1HC8A 1T8IA 5FGMA 2E7WA 1USTA 1MZBA 1P4XA 4IKFA 3GF2A 4N0BA 2CFOA 4CZCA 2FMYA 3KEYA 1K4TA 4UY8I 1KU3A 1UFMA 3L09A 2W25A 4LG3A 4LJZF 3ZQHA 5CVVA 2AQEA 1FYLA 1I6HJ 1SD7A 3VYUB 1FWZA 4Y17A 2HOAA 2Z9OA 2VBXA 3E5XA 4RMNA 4KMFA 2ZXHA 2E1MC 3C18A 1RZ4A 5LGUA 3V8JA 1X4OA 2YU9J 3ASOH 3ZQCA 1IXRC 1GLNA 3CF2A 3HOVJ 4YELA 2HDDA 1ETYA 3KFWX 1VTNC 3DV8A 3HGGA 4E7SA 2A69F 2BVLA 3J7AO 2IS6A 1BI2A 3TGNA 3CMAI 4RGRA 2ZXWH 2Y9ZA 1VQ9I 5D5XB 4CXFA 4ANJA 1S7OA 1O57A 5DD4A 4E7KA 1MBGA 1QGPA 2J5PA 3F72A 2K9SA 2NS0A 5HDKA 3BTIA 1S8NA 3JAMK 1USSA 4EM0B 1XDSA 5LRSA 2XGEA 2MGQA 3ISPA 3GZ6A 3FXLA 4HV6A 2HOTA 4ZTJA 3M07A 2NVTJ 3WTZA 2KJBA 4AWXB 2DA1A 2LFBA 3QPSA 4AUXA 3MQ0A 3HXLA 2ZNZA 1VNDA 1U5TA 2EJRA 2HWVA 3ZN1A 2XAUA 5M3FJ 2DMTA 1LFPA 2XDVA 1HOMA 2LSOA 2LOOA 3HSRA 1QVUA 5FJ8J 1XDUA 1LQ1A 2R7VA 1S5LC 1X19A 3TP3A 2CMPA 2DOFA 2A6TA 3VSLA 1RUOA 2X51A 2DYRH 1G3SA 1I1GA 1I39A 3A01A 1BR2A 1RPWA 1TP4A 3DPLC 1YE9A 4ETSA 3FX3A 4L9JA 1R4MB 3CDLA 2XRNA 4OIOF 4HYEA 2OUMA 3HOSA 3BG9A 1RR7A 4L9VA 4UHTA 4CGZA 1FOKA 2K5CA 1E3OC 5F08A 5KCMA 2A3SA 3CDIA 4A3IJ 3CZ6A 3TOAA 2QBYB 2ICWG 4IOCF 2CRGA 4F3QA 4ZDOA 2CWEA 3DXJF 4LB6B 3LSIA 2JJ7A 4CDGA 1PDNC 2VQGA 2HR3A 5JLXA 1D3YA 1YX5A 2X1DA 4KIBA 4P5OA 3L2QA 4CUGA 5DUIA 3CMYA 3VYTB 3GFIA 5JR3A 2MC3A 4MNUA 2WB1A 3KYLA 1YYVA 4GDFA 2E19A 2VT3A 5HODA 2NVQJ 2ZJPF 3LSHA 1LE8B 1DP7P 1R1TA 5BOXA 2TRTA 3FXRA 2MC4A 2EWNA 3DBLB 3MEXA 3IAM2 3ZXSA 2BHZA 1BOAA 1U8BA 1HKQA 4E7JA 3M1EA 1HCRA 3I9V2 5LGTA 3GFLA 1BBYA 1T0FA 3GVAA 1K7AA 4JYKA 2DT6A 1G8XA 2EFQA 2M0MA 1ZGWA 2XSDC 3RKYA 2RNJA 5ERIA 3K6GA 2M1BA 2LKXA 3OYDA 3OMYA 4F91B 4HF1A 3MWMA 3DPTA 4KIFA 5K7FA 5LFAA 2QZ8A 4YRVA 4MQ9F 4KJZA 2K4JA 1T2KA 3PM1A 5EGOA 4HA8A 2V1DA 3RKXA 4BXFA 2ZMEA 3FZVA 3PQKA 4HNTA 2FQ3A 1I3AA 2GOXB 1T08B 3KEOA 2IPQX 3ONQA 1TC3C 1FNNA 2IEKA 2WBMA 4XL9A 3I5UA 2NVUB 2LREA 4U88A 1IDYA 5DYMA 3RJPA 2F2EA 5FKOA 1U2WA 1QU3A 4B8XA 2FRHA 2R5YA 3DP7A 3E6DA 1T6SA 3LAJA 3NARA 3UNGC 3I0TA 2FQ4A 2R3SA 3OYNA 1FTTA 4N4OB 5D6FA 4J19A 1HF0A 3Q9SA 2X0LA 2MD0A 4B44A 5F0FA 2A07F 4A3DJ 3BG6A 2PI0A 1XG1A 4D7NA 2GXGA 5AIPA 3CCYA 5D6EA 2EIMH 2ADUA 1BI0A 5EZHA 3PIOF 1Z9CA 4UUVA 5JVTA 1T39A 4AVZA 1FIPA 3G1OA 3ZQ7A 3D5RC 1J75A 3A2KA 3P9CA 2H1KA 4EGYA 1FEXA 3BPVA 1ZLJA 5IP9J 1D0XA 2OV7A 4CCJA 4C3IJ 2HYFA 1Q1VA 2JVHA 4ON0A 3V8KA 5GTIC 4A3FJ 4KYWA 2OU2A 9ANTA 2HQ5A 1XCVA 1JUPA 4RGSA 2D45A 1D8JA 1FOYA 4X0GA 2EILH 2E34A 3C2GA 1IW7F 4UV8A 5HS9A 4IJAA 2HZTA 2VB6A 2GZWA 3JRGA 4XK4A 2OD5A 4ITVA 4Q47A 1G59A 3OS1A 1GVJA 2K9QA 4PCQA 4UB8C 2OA4A 1IV6A 1KQ9A 3C7JA 4M6VA 2JSPA 2KKOA 4ZH4F 2YX4A 2BW3A 3HUGA 1OCCH 2H8WA 3LNQA 4Y3OA 4XORA 3BOQA 4BQAA 5E3OA 2WAFA 2L7ZA 2F6CA 4V2GA 3HJEA 5CJ9A 3FMSA 5L3EA 2R7QA 2XPWA 1ZRFA 3FXQA 2PN6A 1Z77A 3IKVA 3K0LA 2VJ5A 1VF9A 1PP8F 1R7JA 2FOKA 1MH4A 2LC2A 3W2VA 3L1PA 4UB6C 4DZPA 1TNTA 4AIHA 4B4CA 2VOPA 2DA5A 1YJ9I 4I0AA 1IRXA 3DKXA 5BQTA 3RPUD 5L3FA 1R1VA 2ZC2A 3RIRA 4XKCA 2X6OA 2A05A 2X1CA 4A12A 3JCUC 4OU0A 2BY1A 3WTUC 4KUMA 3UR3C 2J5OA 1CGPA 3C2HA 1FSHA 1RC9A 3QP5A 2D2WA 5JFRA 1Z1DA 4HX4A 5D8KB 2QSFX 1N25A 2ID6A 2FU4A 3FBIB 1KQ0A 2DQLA 2UXNA 3IH4A 3JRBA 1G3YA 4EEFG 1LUJB 2XAHA 1MSFC 1SVOA 1ZELA 2CUZA 3F6OA 3BZKA 4AVPA 4C3JJ 3HOZJ 2VQHA 2L9RA 3DBRB 3FMQA 3OYKA 1MKMA 4G9YA 1X2MA 2XROA 3GCMA 3H5AA 1Y8RB 3OYJA 3A1YA 3GMEA 4C3HJ 2PJPA 2DFIA 1D8KA 1WJAA 1FY7A 5FKKA 4KA4A 2G0EA 1OPCA 2OTJI 1AHDP 3ERMA 5JVGF 2IJLA 4G94A 4IRHA 3ECHA 1CF7B 1IJWC 4WX9A 2O0YA 3IWZA 1DPRA 3RYRA 3I54A 5JHFA 3BCBA 2V1NA 1TWFJ 2K27A 5K1YA 4I2OA 5JLWA 5ILVA 1KGSA 4MIMA 3G2BA 4ABZA 4BBRJ 5DUKA 3H1CA 2VKDA 4MQVA 1YOVB 2EV5A 1BA5A 4A69C 2EIJH 2B9SA 4AD9A 3SEZA 4BE0A 1J0RA 2Q0OA 3HTSB 4EJTA 2CUJA 3NWSA 3KE2A 1TTYA 2ZCWA 2O3FA 2DCEA 4G7OF 1NH3A 2JA7J 2R4GA 3DPUA 1XGMA 4BDZA 3HSFA 3RI4A 4EMSA 4QIWN 4ENNA 5DDGA 2M7AA 4UUTA 2JA2A 3CLOA 2P7VB 4O3MA 3K9TA 4AU7A 1A5JA 1GHCA 2CQQA 3FXKA 2M3AA 3G3ZA 1DUXC 2JVGA 2OTLI 5FKNA 3JSOA 3E6BA 2L02A 2JZYA 3C3WA 1XCBA 1FC3A 3EDPA 1Z91A 4ENMA 1QQIA 4IPAA 3RTRA 5ILUA 4WXCA 3V7SA 5BS6A 2BY0A 4P9UA 5K7ZA 4G7HF 3CJQB 3AL0B 1P7JA 1OYYA 1E2XA 3F8FA 3GTQJ 2RNGA 2K4BA 3QYBA 3FF5A 1JXSA 3CJTB 1MIJA 4FCYA 4I09A 3MZYA 1K83J 2A68F 3OIOA 1FT9A 2IGNA 2DMNA 1SFKA 4WCGA 2IA2A 2FSWA 2H6BA 2Y75A 4YIIA 5J1YA 2Y0SN 5FLXZ 1X4PA 1FSEA 2COMA 2Y9YA 2UZKA 4PJLA 2ZSIB 1O4XA 3S16J 3MAJA 1AKHA 1S7EA 1MMSA 2PG4A 3GO5A 4FHTA 4DQ2A 2R7UA 3A0HC 3EUKL 4QSHA 5GAHJ 1WJEA 1SD5A 2VBYA 2QCOA 1WI3A 3OYEA 3X2QH 2HU9A 1JUMA 2PJRA 4XLEA 2QENA 1ZG3A 3I58A 3JW4A 3P9KA 2OC6A 4RAFA 3ABTA 2Z5UA 3KP3A 3GTKJ 2EZHA 1I3QJ 1F36A 4EVIA 3LWFA 4L9NA 3DEUA 5E1ZB 3QPTA 3FXOA 2RDPA 2ZFUA 2E60A 2LKSA 3Q0VA 1TL8A 1SFUA 1B72A 3EUHC 4IHVA 2CO5A 4M73A 2ECCA 2R5ZA 1UHWA 4MTEA 1NTCA 1WGXA 2ISZA 4RAZA 3F8MA 1LEBA 1W1WE 2GIZA 4KN4X 2H09A 4M74A 1JJ6C 2H27A 2HDWA 3ABMH 4BHPA 4XOTA 1PUFA 1WRJA 3BTJA 3I64A 5A2QZ 1Z67A 2Z99A 3H36A 3CESA 2MH9A 2BOLA 2YX7A 4A6EA 4H0EA 3TEDA 2K40A 1VQPI 3DLAA 4DW6A 3FHZA 4U0WA 4HLXA 2EV0A 3TDUC 1LEAA 1NK3P 2KDOA 1D0ZA 1SMTA 5BNGA 2ZFWA 2KIFA 2ZXIA 3R6SA 1JTXA 3GTOJ 2O61A 4EATA 1EH6A 4FX0A 1ZK8A 2M8EA 5LLQA 4BL0B 1Y56A 3L00A 3KCCA 4KT5C 3HOXJ 3OS2A 4HSRA 3S1RJ 3JRHA 3WGIA 3PL8A 2AHQA 3DU6A 1QPIA 1HW1A 4YG2F 5HLGA 3E7LA 2RQQA 3SFIA 3H3ZA 2PMZA 2DT5A 2ELJA 2L7MP 2VBZA 3HYIA 1HDPA 2JWTA 2HPIA 1T38A 3AG1H 3WODF 2IP2A 3MKZA 1ZAOA 4GYGA 3ROUA 5F04A 1EF4A 2OCEA 4A3CJ 2F5FA 3IAS2 2BXYA 2VXZA 1XMAA 3KP7A 4KITB 2ZJQF 3PQJA 2XSJC 1XX5A 5LGNA 3WTXC 1J5YA 4JQFA 1QHHD 4DYQA 3BJOA 5KK1A 2EA2A 2DPDA 1IRGA 3HZJA 2QYOA 3HDDA 3RPUA 3JTGA 1TBXA 3R60A 3K4BA 3H3VK 3FKIJ 2PMUA 1YW9A 1BI3A 3VODA 2LD5A 2CSOA 3WTVC 4ESBA 3BTLA 5TRDA 4CCMA 4LG0A 5HOOA 2DOEA 2M34A 2L4AA 1YJWI 2BY2A 3HOUJ 4ZZLA 3KZYA 5ILSA 1LNWA 4O5VA 1H88C 1P6RA 2DA7A 2IRFG 1IXSB 5K5OA 5DCMA 1STZA 3RYPA 2EA4A 2VIXA 2I5UA 2LMDA 3GUDA 3J7ZI 1ZRCA 4DZJA 2D5VA 1I27A 2ECBA 4LLNA 1MJ9A 1JKQC 3HRTA 4KIGA 4W1UA 1TQMA 2ZMEB 4BE2A 4PDKA 1E17A 3BCAA 2E36A 2E7XA 2G9WA 4OOIA 1WHUA 3QU6A 1WPKA 3LSGA 4WF2A 4CYCA 3ZMZA 1MD0A 4HQMA 3PSIA 4BJ5C 2P5LC 1DDNA 4II2A 4BQNA 5GAEJ 3DU5A 2K3FA 1VQ7I 3JSPA 5CLSA 2KP6A 3SZGA 3SZPA 4D1QA 2DA6A 1OR7C 1W7PB 3OYCA 5J6XA 5CPRB 2HOSA 1VQ6I 1EH8A 2H8RA 4A3BJ 4YIFA 4UUSA 2DDBA 4HEA2 3M8FA 2LNBA 3R61A 1XS9A 2YPRA 4KFCA 2JA6J 3E6MA 2LYCA 1Z6TA 1MW7A 1GVDA 2HKOA 3WE3A 1C0WA 4P9FA 3S1QJ 4M3GA 2H94A 4E6KG 3HG9A 4A5NA 3F23A 1K78B 1ODDA 2LP0A 5FLVA 1BJAA 4A2UA 2Q2EA 2C6YA 5HS8A 2EFWA 4BEHB 1ZLKA 2D1HA 5L3CA 4BXXJ 1WH5A 1FJLA 3ZPLA 4IOAF 3QPLA 3JREA 1Z7UA 4FX4A 1Q1HA 4QLCU 3Q0UA 1KU9A 2GOMA 2WAQA 3BR0A 3GLXA 2QGUA 3O6BB 4R8HA 1DP3A 2VI6A 2P6SA 2CW7A 3L7WA 3COAC 3U1KA 4HNVA 1REPC 3LQQA 4M6XA 4BHBA 2VC0A 2CQXA 2MBFA 3VWBA 2HXIA 1RNLA 2V6CA 2W4SA 3CCMI 2DMPA 2CQNA 4TV7A 3SDBA 4WXHA 2R7OA 3BP8A 4ESJA 1LPQA 3DBHB 4IRIA 2XPUA 4I98B 2W1OA 1G4DA 1W0TA 1R6RA 3NAUA 1V5GA 2MD5A 2EFPA 4U7DA 2KRHA 3ZP5A 1YHQI 1O3QA 3EYIA 4RS8A 2DFEA 2ZNYA 3HM5A 3SDGA 1VQ8I 3RSNA 2ISYA 1Y0UA 1JGGA 1OYIA 2DK8A 4M6YA 1ZTRA 2F5DA 3A4CA 4FE4A 4CSWA 2FBIA 3RZOJ 1XSXA 4RM2A 1S9HA 2HXOA 4BDYA 2NYXA 5EG0A 2K9NA 5IT9Z 3K4CA 3H5RA 2XC7A 1HW2A 3HUGB 2DBBA 4BYYA 2DI3A 2Z3YA 2UXXA 1VQOI 3KETA 2VT2A 2LY1A 2CUFA 1UHMA 1DGRM 4XLNF 1R58A 1I50J 1SFEA 4P96A 2PLYA 1IUYA 3L9FA 3RZDJ 1WZ2A 3P9IA 4IQJA 1LB2A 5KAIC 2LBFB 2R7RA 1BW6A 3DF8A 4RBOA 3PJRA 5TGTA 2UUZA 3S3MA 3NWTA 3CCVI 3CCUI 2TDXA 1BI1A 2P6TA 3KEQA 1X1CA 1MSEC 5FB2A 1TWAJ 3BWGA 1VQLI 3WGGA 4OAYA 1RI7A 2NAZA 2BXZA 3ZMDA 2JN6A 4FQGA 2P5KA 3JR9A 2BV6A 2K86A 4EJWA 2HOEA 1T95A 1B9NA 3BPXA 3S1NJ 5M5XJ 4NQWA 3J81K 4NC8A 3MVPA 1Z05A 3LL7A 1IC8A 3OV8A 3CMMA 3PUBA 1FLIA 4I7HA 2QQBA 1QPMA 3GXOA 2F5CA 1YG2A 2R7FA 3HRMA 3OYGA 2VASA 1MMGA 4XIDA 5E1XA 3K70D 3F22A 3GZNB 5IYDJ 5DCFA 3B02A 2XKOA 2KRFA 3GTJJ 2P0WA 3KPHA 3DKYA 3ESWB 3CC4I 2EB7A 3VDXA 2GWRA 3D5SC 2JQ7A 3E1SA 1JT0A 4M9XA 2QVOA 1MNEA 1QBJA 4EQQA 4XR6A 4HBLA 3WU0A 4DYRA 4U87A 3AL0C 4BXUA 4LK0F 3K69A 2EINH 3KX2A 1RRJA 4IZZA 1V4RA 4X6AJ 2JT1A 3FBNB 2F4MB 1ACIA 1SD6A 1QZZA 2VLAA 4MEXF 1V5FA 2VE8A 1A31A 4BQQA 1QVTA 2VKVA 2XGCA 5H2FC 2LR8A 2W82A 3F3XA 5EYRA 4A3MJ 5IP6A 1P4WA 1R23A 1Y0NA 1YS7A 3DFGA 3E5UA 5FD6A 1SAXA 2Q1ZB 1JI8A 1TQPA 1R36A 1TZLA 5CQGA 1F43A 3B73A 3PNVA 4J01A 4EGZA 3S3NA 5AIQA 3NQOA 5F1RA 3QOEA 1W36D 1K4SA 2Y69H 5FD5A 3W6JB 1UJ8A 2XB0X 3FK7A 1FBUA 1ZYRF 4M9ZA 2L9VA 1KZHA 3PUFA 1OKRA 2JPBA 4JP0A 3K10A 2KFDA 4BBSJ 2R7XA 4MFDA 4NB5A 4IHXA 4KT6A 1T56A 2CS3A 1N77A 1B4AA 4M3FA 4RM3A 4HDUA 1Z21A 2CQ7A 2OZ6A 3KP5A 2XAJA 4C2MJ 5HLHA 4Q4ZF 4L0YB 4XKVA 1U0JA 3ZMTA 3LOCA 4ENJA 3QU3A 3BT9A 5ICGA 2CV1A 2LF7A 3DQVC 1TQIA 1SD4A 5FRMA 4GGGA 5DTDA 1X3ZB 3VEPA 1LDKB 4Y13A 3LSTA 5IP7J 3H5NA 3CUQB 1U78A 4PJNA 3OOUA 4W97A 1SC7A 2HEOA 5KHDA 3R0JA 3BLYA 3D0SA 4A3KJ 1K61A 6PAXA 4WWCA 2M45A 1Z7LA 3CO6C 3W2AA 2IS1A 3ABKH 4HSTA 1FIAA 2MW8A 4CYDA 4LIVA 3HRUA 3T1BA 3V4GA 4E70A 4I6ZA 1XTAA 2W00A 4B09A 2DOAA 2V1UA 4LITA 1FPQA 4UNOA 2DW4A 5LD2C 1FZPB 4XRMA 4ZYDA 2ZSHB 2DODA 1U3EM 4E7ZA 3S32A 2PJRB 1DPUA 3NEUA 1YQAA 5EJCA 1OQYA 3HOYJ 3QRFF 1A6IA 3OL3A 3OS0A 3OYBA 3HPHA 3B6AA 1ORKA 5J1RA 1J2XA 5IT9K 5HS7A 3LFUA 2RC4A 3DTEA 5GPCA 2W24A 2JUCA 3ZQIA 3MZHA 1V54H 3QODA 2YUSA 2Y48A 4I01A 1IV8A 2CW0F 2M8GX 4CHUA 2OZUA 3CCJI 3S3OA 3RPQA 1SANA 2ESHA 3I59B 2V79A 2XIGA 4HG2A 1U9OA 5J40A 3HOTA 2V9KA 3M7GA 3LA7A 3CJNA 1OISA 2JMWA 2DJIA 5B1AH 4GO1A 4GYIA 1MMDA 2GXBA 4NNJA 2KHMA 2CJJA 3OIPA 2DAOA 1ZH5A
chains in the Genus database with same CATH topology
3TQNA 3L2CA 4LFUA 1ON1A 3WTWC 2DU9A 4Q48A 3WTYC 1B59A 3BJ6A 2GA2A 3KP6A 1PUEE 4ZZDA 5DEQA 2CFXA 3JTHA 1BIBA 2KIMA 2LDUA 2FXAA 2MLGA 3EUHA 1L3LA 2VN2A 3HHGA 1W5SA 5BPIA 1ON2A 2QBYA 4ASNA 1O7LA 2JTVA 5HDGA 4CO8A 4A0XA 3I71A 4XRFA 1IN5A 3NRVA 1B9MA 2FEZA 4LLLA 2HYGD 1RUNA 4F7ZA 5LEJA 1MJBA 3J80Z 3CTAA 3O2PE 2G7HA 2UWMA 4LG0B 3IKTA 4LB5A 2HGCA 1YFHA 2OAZA 1HKSA 3WTTC 4XSXF 3KLOA 5DCMB 4OIQF 3O3KA 3IHUA 1S7AA 3HSEA 1ZGJA 2XAGA 4I02A 1WQ2A 2CYYA 2IVMA 2CGPA 2F5EA 2WWYA 1SMYF 1B6AA 3BY6A 1HQCA 2ESNA 1H9GA 3PFIA 2EK5A 2IT0A 5D5WB 2FBKA 2CG4A 3FM3A 3G73A 5FO5A 2VBWA 3WTSC 3S2WA 3QAHA 3SQNA 5LHGA 4LGWA 4G6DA 4NHJA 1XGOA 5CVUA 3EETA 3BZ6A 3H3UA 3KP2A 3WGHA 3WU1B 1F9NA 3FXUA 5D4RA 2AS5F 2R7DA 1OR7A 2HTSA 4I0BA 1K79A 1SFXA 2EFNA 2YR2A 4IHTA 3E6CC 5E1WA 3TO6A 1U5TB 3GFMA 4L5IA 3JAMZ 3EQLF 4HAMA 3F21A 2XAQA 4MGRA 5LHIA 4S04A 5IT3A 3TO7A 1ZRDA 2VE9A 1R1UA 2BE5F 2QWWA 2RQPA 4UVBA 3HIFA 4HX8A 1S3JA 4WK8F 2XV4S 1AWCA 3HTUA 2L01A 3ZMUA 1WSUA 1JHFA 1WWXA 5E8IA 1MDMA 1TW3A 4Q5SF 4EJOA 1KU7A 4XLPF 2GA1A 4XSZF 1YO5C 2P7CB 4EM1A 4RAYA 2GIVA 2PEXA 3QOPA 4LK1F 3QP6A 3K1PA 4KMUX 1LJ9A 4K2EA 2BGCA 4BAYA 2XASA 1UB9A 2FA5A 2PMHA 3I53A 2Z33A 5FFZA 4BHCA 1B1BA 1W7PD 3VOEA 3V8LA 1F4KA 3WE2A 2BYVE 4YFXF 5CYVA 5HVQC 3ECOA 1EH7A 3W6KB 1W4MA 2DO7A 1FYKA 3CUQC 3GW2A 1TW2A 3Q5FA 1XSDA 4R79A 2O6GE 1K6OA 2VODA 4EJVA 4PGHA 2XKPA 2OQGA 3ZMSA 3V7CA 1I5ZA 1TLHB 2ZXJA 1JHHA 5FLXK 4L5JA 1YLFA 2WC2A 3ZMVA 5D5VB 2VONA 4IF4A 1OYWA 3T8RA 4CICA 1O3SA 1IN8A 4JBAA 4HX7A 1FBSA 2AXLA 2OQRA 1BC7C 5LRRA 3GWZA 4FT8A 4G7ZF 3R0AA 3IL2A 4ZYHA 4KN7X 4OINF 1IZ1A 4L0ZB 1P92A 4RB0A 4ENKA 4RGUA 1U6GA 4EV0A 3N4MA 1UCRA 2CQKA 5CVIA 5F6FA 2ELHA 2B0LA 4ZYEA 3KZZA 2PBIA 5L3GA 2G7UA 3CDHA 5JHUA 3ELKA 5A2QK 3LA3A 1H0MA 5HDNA 1XD7A 3QPHA 3F8CA 4KNYA 1BM9A 4HDVA 2DPUA 1ZN2A 4UVCA 2HTJA 2FBHA 1EV7A 3RDIA 3RKWA 2OBPA 2K7LA 3M9AA 2RV8A 4JK1X 1TNSA 2P8TA 5LHHA 1QNTA 2EV6A 5L3BA 4M9SA 4EM2A 3IRQA 1IAWA 3REOA 5DV5A 2JRTA 3MFKA 3D5LA 2A6HF 3K1MA 2STWA 1WKMA 1ULYA 2GQQA 2NNYA 4HQEA 2V1XA 2WV0A 1JE8A 3HRSA 1F5TA 2L54A 4PZJA 3VB2A 1ZARA 2A5YB 2L3DA 1FP2A 2P4WA 4RGXA 2XHKA 5BMZA 4U0YA 2HS5A 2FNPA 3M8EA 2HQRA 2FE3A 4QWQA 4YFKF 5L3DA 2MLKA 2QQAA 1XMKA 1W5TA 1HBXG 5DD8A 4IRGA 4G6QA 5JI6A 3GZ5A 1IN7A 3ERED 2BEOA 1LDJA 5E17F 3LA2A 4LLGF 4LD5A 2FNAA 2ZBKA 3U1DA 1XGSA 2ACJA 2KIUA 3E97A 1RIOH 1X3UA 3IC7A 2XGXA 2VOOA 1IN4A 2IA1A 3FMRA 1AOYA 4CZZA 5D4SA 1XSVA 1BN5A 1W7PA 2XVCA 3DKWA 1A04A 1R5GA 1QO0D 2QUFA 2RGVA 3GYHX 3T5XA 3T8TA 3ZN0A 1P2FA 2YU3A 1U5TC 1I6XA 2VC1A 3N97A 5ICEA 1KU2A 1K78A 1IXCA 5HLIA 3LAPA 4S05A 4YFNF 5H6QA 4KDPA 1G6NA 4HOBA 2GAUA 4OIPF 5H20A 1ZG5A 2Q8KA 2QM3A 3BDDA 3MCZA 5F64A 4A0YA 5CVRA 3BJAA 5EEGA 3EYYA 2QQ9A 3LQRA 4OMYA 2M87A 1S29A 2M30A 1LVAA 4DNCA 5E8GA 2FMLA 3H92A 3TDZC 3VFZA 3U9GA 1KA8A 2E1CA 5KVRA 1G3WA 1R22A 3IRRA 1FP1D 1IN6A 4RB2C 3TO9A 5H6RA 5LBQA 2L4MA 2P5VA 3GFJA 1YS6A 5E18F 2KJCA 2DTRA 1ONVA 2BBYA 2XUBA 1MDMB 5ICCA 2MA3A 4LMYA 1FX7A 4N9HA 2HKXA 2K02A 2JPCA 2W85A 2ETHA 4OMZA 4ZYGA 1WI9A 5E20A 4O6JA 1NHAA 2A61A 4A0ZA 3FM5A 3U2RA 4M72A 1YIOA 2ZO4A 5ED4A 4HF2A 3I4PA 1YW8A 2DK5A 1HSTA 5D5UB 1HXDA 1XN7A 3ML6A 2ZJ2A 2D1VA 4BNCA 3TKYA 4G8XA 3SFZA 3OOPA 1KQ8A 1JGSA 3SHFA 3SZTA 3ABUA 3ULQB 4HZFA 4IHSA 3KLNA 1MGTA 4R1HA 4MEYF 4RB1A 4UXNA 4ESFA 1YW7A 3CUOA 3GX4X 2PQ8A 2E1NA 4XBFA 1YTYA 2QLZA 3K1NA 3KP4A 1V3FA 1R00A 4WXDA 5K5QA 4M71A 3FWEA 5TJJA 1I1SA 3C1DA 4Y15A 2PFBA 1U8RA 4IXAA 5K5RA 2XAFA 4GCVA 1FYMA 3IWFA 3CUQA 1KYZA 2ZKZA 4IVNA 4RB3C 4HLYA 5FFXA 1ZHFA 2W84A 5CVJA 1T98A 2O03A 4MTDA 4AIJA 1J7KA 3Q9VA 4BH9A 2DQRA 2YSRA 2W57A 1QZYA 3SXYA 2Y0MA 1XGNA 1O3RA 2M5WA 4A6DA 1OMIA 2X4HA 1HW5A 3WG9A 4D0PA 4A5MA 5EEHA 3E3VA 1J59A 1O3TA 4N9IA 4L18B 5ICFA 4U7BA 3I59A 2RKHA 3GEZA 3HHHA 5LEKA 1IF1A 4OIRF 2FF4A 3P7NA 4MHGA 2HQNA 3F8NA 4HV5A 1ZREA 1L0OC 2RN7A 1S6LA 2IW5A 2A6EF 1F1ZA 1PP7U 1MJAA 1O7FA 2IA0A 1R5HA 3R4KA 4HF0A 2HFHA 3J80K 2JSCA 1XB4A 3F8BA 2STTA 4HW0A 2MH2A 4L9TA 5D8LB 4EJUA 5AONA 4AIKA 2V9VA 1P4AA 4UVAA 3J81Z 3V7RA 2NRAC 4PGGA 1G3TA 1J9IA 1CF7A 4Z2YA 3AAFA 1HSJA 2LF8A 4UV9A 1KYWA 3T0YA 3CO7C 1BIAA 5J8FA 2NNNA 2DLLA 1LDDA 1ZG1A 3F6VA 2EFOA 2LKPA 1ZGAA 3LFKA 3BROA 1GXQA 3E5QA 4U0VA 1FBQA 5J8CA 2H6CA 5BPDA 1D5VA 2O8XA 4P55A 1H9TA 1HKTA 3K2ZA 4KICA 1GXPA 1BC8C 2HDCA 2WTEA 1Z6RA 4GXOA 2RVCA 1IRFA 3TOBA 5FGMA 2E7WA 1USTA 1MZBA 1P4XA 3GF2A 4N0BA 2FMYA 1KU3A 1UFMA 3L09A 2W25A 4LJZF 5CVVA 1FYLA 1SD7A 1FWZA 4Y17A 2Z9OA 2VBXA 3E5XA 4KMFA 3C18A 1RZ4A 5LGUA 3V8JA 1IXRC 3KFWX 1VTNC 3DV8A 2A69F 3J7AO 1BI2A 3TGNA 4RGRA 5D5XB 4CXFA 1S7OA 1O57A 5DD4A 2J5PA 1QGPA 3F72A 2NS0A 5HDKA 1S8NA 3JAMK 1USSA 4EM0B 1XDSA 5LRSA 3ISPA 3GZ6A 4HV6A 3WTZA 2KJBA 4AWXB 3MQ0A 2ZNZA 1U5TA 2EJRA 2HWVA 3ZN1A 2LSOA 3HSRA 1XDUA 1LQ1A 1RUOA 1G3SA 1I1GA 3DPLC 4ETSA 3FX3A 4L9JA 2XRNA 4OIOF 4HYEA 3HOSA 4L9VA 4UHTA 4CGZA 1FOKA 2A3SA 3TOAA 2QBYB 2CWEA 3DXJF 4LB6B 4CDGA 1PDNC 2HR3A 1D3YA 4KIBA 4P5OA 5DUIA 3GFIA 5JR3A 2MC3A 4MNUA 1YYVA 2VT3A 1DP7P 1R1TA 5BOXA 3FXRA 2EWNA 3MEXA 1BOAA 1HKQA 3M1EA 5LGTA 3GFLA 1BBYA 1T0FA 3GVAA 1K7AA 2EFQA 3RKYA 2RNJA 5ERIA 2M1BA 4HF1A 3MWMA 3DPTA 4KIFA 2QZ8A 4MQ9F 2K4JA 1T2KA 4HA8A 2V1DA 3RKXA 2ZMEA 3FZVA 3PQKA 2FQ3A 3KEOA 2IPQX 1FNNA 3I5UA 4U88A 5DYMA 3RJPA 2F2EA 1U2WA 4B8XA 2FRHA 3DP7A 3E6DA 1T6SA 3LAJA 3I0TA 2R3SA 5D6FA 3Q9SA 2X0LA 2A07F 2PI0A 2GXGA 5AIPA 5D6EA 2ADUA 1BI0A 1Z9CA 4UUVA 5JVTA 1T39A 3ZQ7A 1J75A 3P9CA 4EGYA 3BPVA 1ZLJA 2HYFA 4ON0A 3V8KA 4KYWA 2OU2A 1XCVA 4RGSA 2D45A 1D8JA 1IW7F 4UV8A 5HS9A 4IJAA 2HZTA 2GZWA 2OD5A 4Q47A 1GVJA 4PCQA 2OA4A 1KQ9A 3C7JA 2KKOA 4ZH4F 2YX4A 3HUGA 3BOQA 4BQAA 5CJ9A 3FMSA 5L3EA 1ZRFA 3FXQA 2PN6A 3IKVA 3K0LA 1PP8F 1R7JA 2FOKA 1TNTA 4AIHA 2VOPA 4I0AA 5BQTA 5L3FA 1R1VA 3RIRA 4A12A 4OU0A 3WTUC 4KUMA 2J5OA 1CGPA 1FSHA 3QP5A 2D2WA 5JFRA 1Z1DA 4HX4A 5D8KB 2FU4A 1KQ0A 2DQLA 2UXNA 1G3YA 2XAHA 3F6OA 4AVPA 3FMQA 1MKMA 4G9YA 2XROA 2PJPA 2DFIA 1D8KA 1FY7A 4KA4A 1OPCA 2IJLA 4G94A 4IRHA 3ECHA 1CF7B 4WX9A 2O0YA 3IWZA 1DPRA 3RYRA 3I54A 2K27A 5K1YA 4I2OA 5ILVA 1KGSA 5DUKA 4MQVA 2EV5A 4AD9A 1J0RA 2Q0OA 3HTSB 4EJTA 3KE2A 1TTYA 2ZCWA 2O3FA 4G7OF 1XGMA 3HSFA 3RI4A 4EMSA 4ENNA 5DDGA 3CLOA 2P7VB 4O3MA 3K9TA 1GHCA 3G3ZA 1DUXC 3JSOA 3E6BA 2L02A 2JZYA 3C3WA 1XCBA 1FC3A 3EDPA 1Z91A 4ENMA 1QQIA 4IPAA 3RTRA 5ILUA 4WXCA 3V7SA 5BS6A 4G7HF 4P9UA 1OYYA 1E2XA 3F8FA 2K4BA 3FF5A 1JXSA 4I09A 3MZYA 2A68F 1FT9A 4WCGA 2IA2A 2FSWA 2H6BA 2Y75A 4YIIA 5FLXZ 1FSEA 2COMA 2UZKA 3MAJA 2PG4A 3GO5A 4FHTA 4DQ2A 1SD5A 2VBYA 2QENA 1ZG3A 3I58A 3JW4A 3P9KA 3ABTA 2Z5UA 3KP3A 4EVIA 3LWFA 4L9NA 3DEUA 5E1ZB 3QPTA 2RDPA 1SFUA 2CO5A 4M73A 1UHWA 4MTEA 2ISZA 4RAZA 3F8MA 1LEBA 4KN4X 2H09A 4M74A 2H27A 4BHPA 1WRJA 3I64A 5A2QZ 2Z99A 2MH9A 2YX7A 4A6EA 4H0EA 3FHZA 4U0WA 4HLXA 2EV0A 3TDUC 1LEAA 1SMTA 2ZFWA 2KIFA 3R6SA 2O61A 1EH6A 4FX0A 2M8EA 5LLQA 3L00A 3KCCA 4KT5C 3WGIA 1HW1A 4YG2F 5HLGA 3H3ZA 3HYIA 2DT5A 2VBZA 1T38A 3WODF 2IP2A 1ZAOA 4GYGA 3ROUA 2F5FA 2VXZA 3KP7A 1XMAA 3PQJA 5LGNA 3WTXC 1J5YA 4JQFA 3BJOA 5KK1A 2EA2A 2DPDA 1IRGA 2QYOA 3RPUA 3JTGA 1TBXA 3R60A 2PMUA 1YW9A 1BI3A 3VODA 2CSOA 3WTVC 4ESBA 5TRDA 4LG0A 5HOOA 2L4AA 4ZZLA 3KZYA 5ILSA 1LNWA 4O5VA 1P6RA 2IRFG 1IXSB 5K5OA 5DCMA 1STZA 3RYPA 2EA4A 1ZRCA 4LLNA 3GUDA 1I27A 1MJ9A 3HRTA 4KIGA 1TQMA 2ZMEB 4PDKA 1E17A 2E7XA 2G9WA 4OOIA 3QU6A 4WF2A 3ZMZA 1MD0A 4HQMA 2P5LC 1DDNA 3JSPA 5CLSA 3SZPA 1W7PB 5J6XA 1EH8A 4YIFA 3M8FA 2LNBA 3R61A 2YPRA 4KFCA 3E6MA 1Z6TA 2HKOA 3WE3A 1C0WA 4P9FA 2H94A 4A5NA 3F23A 1K78B 1ODDA 1BJAA 4A2UA 2Q2EA 2C6YA 5HS8A 2EFWA 1ZLKA 2D1HA 5L3CA 3ZPLA 1Z7UA 4FX4A 1Q1HA 4QLCU 1KU9A 4R8HA 3GLXA 3O6BB 2P6SA 3COAC 3L7WA 1REPC 4BHBA 3LQQA 4M6XA 2VC0A 2MBFA 1RNLA 2V6CA 4TV7A 4WXHA 3BP8A 4ESJA 4IRIA 4I98B 1G4DA 2MD5A 2EFPA 4U7DA 3ZP5A 1O3QA 3EYIA 4RS8A 2ZNYA 2ISYA 1Y0UA 1OYIA 2DK8A 4M6YA 2F5DA 2FBIA 1XSXA 2NYXA 5IT9Z 1HW2A 2DBBA 4BYYA 2DI3A 2Z3YA 2UXXA 3KETA 2VT2A 1UHMA 4XLNF 1R58A 1SFEA 4P96A 2PLYA 1IUYA 3L9FA 3P9IA 1LB2A 3DF8A 2TDXA 1BI1A 2P6TA 3KEQA 5FB2A 3BWGA 3WGGA 1RI7A 2NAZA 3ZMDA 2P5KA 2BV6A 2K86A 4EJWA 2HOEA 1B9NA 3BPXA 4NQWA 3J81K 1Z05A 3OV8A 1FLIA 4I7HA 2QQBA 1QPMA 3GXOA 2F5CA 1YG2A 2R7FA 3HRMA 5E1XA 3F22A 5DCFA 3B02A 2XKOA 2KRFA 2EB7A 2GWRA 4M9XA 2QVOA 1QBJA 4EQQA 4HBLA 3WU0A 4BXUA 4LK0F 3K69A 1V4RA 2JT1A 1SD6A 1QZZA 4MEXF 2VE8A 3F3XA 1P4WA 1R23A 1YS7A 3DFGA 3E5UA 5FD6A 1SAXA 1TQPA 1R36A 3B73A 4EGZA 5AIQA 3NQOA 5F1RA 5FD5A 3W6JB 1FBUA 1ZYRF 4M9ZA 1OKRA 2JPBA 4NB5A 1B4AA 4HDUA 2OZ6A 3KP5A 2XAJA 4L0YB 5HLHA 4Q4ZF 3ZMTA 4ENJA 3QU3A 5ICGA 2LF7A 3DQVC 1TQIA 1SD4A 4GGGA 3VEPA 1LDKB 4Y13A 3LSTA 3CUQB 1U78A 2HEOA 3R0JA 3D0SA 6PAXA 4WWCA 2M45A 3CO6C 4CYDA 3V4GA 3HRUA 3T1BA 4E70A 4B09A 2V1UA 1FPQA 4UNOA 2DW4A 1FZPB 4ZYDA 1U3EM 1DPUA 3NEUA 1YQAA 3QRFF 1J2XA 5IT9K 5HS7A 2RC4A 2W24A 3MZHA 2Y48A 4I01A 2CW0F 4CHUA 2OZUA 3RPQA 2ESHA 3I59B 2V79A 2XIGA 3HOTA 3M7GA 3LA7A 3CJNA 4GO1A 4GYIA 2GXBA 2DAOA 1ZH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQN A;  3L2C A;  4LFU A;  1ON1 A;  3WTW C;  2DU9 A;  4Q48 A;  3WTY C;  1B59 A;  3BJ6 A;  2GA2 A;  3KP6 A;  1PUE E;  4ZZD A;  5DEQ A;  2CFX A;  3JTH A;  1BIB A;  2KIM A;  2LDU A;  2FXA A;  2MLG A;  3EUH A;  1L3L A;  2VN2 A;  3HHG A;  1W5S A;  5BPI A;  1ON2 A;  2QBY A;  4ASN A;  1O7L A;  2JTV A;  5HDG A;  4CO8 A;  4A0X A;  3I71 A;  4XRF A;  1IN5 A;  3NRV A;  1B9M A;  2FEZ A;  4LLL A;  2HYG D;  1RUN A;  4F7Z A;  5LEJ A;  1MJB A;  3J80 Z;  3CTA A;  3O2P E;  2G7H A;  2UWM A;  4LG0 B;  3IKT A;  4LB5 A;  2HGC A;  1YFH A;  2OAZ A;  1HKS A;  3WTT C;  4XSX F;  3KLO A;  5DCM B;  4OIQ F;  3O3K A;  3IHU A;  1S7A A;  3HSE A;  1ZGJ A;  2XAG A;  4I02 A;  1WQ2 A;  2CYY A;  2IVM A;  2CGP A;  2F5E A;  2WWY A;  1SMY F;  1B6A A;  3BY6 A;  1HQC A;  2ESN A;  1H9G A;  3PFI A;  2EK5 A;  2IT0 A;  5D5W B;  2FBK A;  2CG4 A;  3FM3 A;  3G73 A;  5FO5 A;  2VBW A;  3WTS C;  3S2W A;  3QAH A;  3SQN A;  5LHG A;  4LGW A;  4G6D A;  4NHJ A;  1XGO A;  5CVU A;  3EET A;  3BZ6 A;  3H3U A;  3KP2 A;  3WGH A;  3WU1 B;  1F9N A;  3FXU A;  5D4R A;  2AS5 F;  2R7D A;  1OR7 A;  2HTS A;  4I0B A;  1K79 A;  1SFX A;  2EFN A;  2YR2 A;  4IHT A;  3E6C C;  5E1W A;  3TO6 A;  1U5T B;  3GFM A;  4L5I A;  3JAM Z;  3EQL F;  4HAM A;  3F21 A;  2XAQ A;  4MGR A;  5LHI A;  4S04 A;  5IT3 A;  3TO7 A;  1ZRD A;  2VE9 A;  1R1U A;  2BE5 F;  2QWW A;  2RQP A;  4UVB A;  3HIF A;  4HX8 A;  1S3J A;  4WK8 F;  2XV4 S;  1AWC A;  3HTU A;  2L01 A;  3ZMU A;  1WSU A;  1JHF A;  1WWX A;  5E8I A;  1MDM A;  1TW3 A;  4Q5S F;  4EJO A;  1KU7 A;  4XLP F;  2GA1 A;  4XSZ F;  1YO5 C;  2P7C B;  4EM1 A;  4RAY A;  2GIV A;  2PEX A;  3QOP A;  4LK1 F;  3QP6 A;  3K1P A;  4KMU X;  1LJ9 A;  4K2E A;  2BGC A;  4BAY A;  2XAS A;  1UB9 A;  2FA5 A;  2PMH A;  3I53 A;  2Z33 A;  5FFZ A;  4BHC A;  1B1B A;  1W7P D;  3VOE A;  3V8L A;  1F4K A;  3WE2 A;  2BYV E;  4YFX F;  5CYV A;  5HVQ C;  3ECO A;  1EH7 A;  3W6K B;  1W4M A;  2DO7 A;  1FYK A;  3CUQ C;  3GW2 A;  1TW2 A;  3Q5F A;  1XSD A;  4R79 A;  2O6G E;  1K6O A;  2VOD A;  4EJV A;  4PGH A;  2XKP A;  2OQG A;  3ZMS A;  3V7C A;  1I5Z A;  1TLH B;  2ZXJ A;  1JHH A;  5FLX K;  4L5J A;  1YLF A;  2WC2 A;  3ZMV A;  5D5V B;  2VON A;  4IF4 A;  1OYW A;  3T8R A;  4CIC A;  1O3S A;  1IN8 A;  4JBA A;  4HX7 A;  1FBS A;  2AXL A;  2OQR A;  1BC7 C;  5LRR A;  3GWZ A;  4FT8 A;  4G7Z F;  3R0A A;  3IL2 A;  4ZYH A;  4KN7 X;  4OIN F;  1IZ1 A;  4L0Z B;  1P92 A;  4RB0 A;  4ENK A;  4RGU A;  1U6G A;  4EV0 A;  3N4M A;  1UCR A;  2CQK A;  5CVI A;  5F6F A;  2ELH A;  2B0L A;  4ZYE A;  3KZZ A;  2PBI A;  5L3G A;  2G7U A;  3CDH A;  5JHU A;  3ELK A;  5A2Q K;  3LA3 A;  1H0M A;  5HDN A;  1XD7 A;  3QPH A;  3F8C A;  4KNY A;  1BM9 A;  4HDV A;  2DPU A;  1ZN2 A;  4UVC A;  2HTJ A;  2FBH A;  1EV7 A;  3RDI A;  3RKW A;  2OBP A;  2K7L A;  3M9A A;  2RV8 A;  4JK1 X;  1TNS A;  2P8T A;  5LHH A;  1QNT A;  2EV6 A;  5L3B A;  4M9S A;  4EM2 A;  3IRQ A;  1IAW A;  3REO A;  5DV5 A;  2JRT A;  3MFK A;  3D5L A;  2A6H F;  3K1M A;  2STW A;  1WKM A;  1ULY A;  2GQQ A;  2NNY A;  4HQE A;  2V1X A;  2WV0 A;  1JE8 A;  3HRS A;  1F5T A;  2L54 A;  4PZJ A;  3VB2 A;  1ZAR A;  2A5Y B;  2L3D A;  1FP2 A;  2P4W A;  4RGX A;  2XHK A;  5BMZ A;  4U0Y A;  2HS5 A;  2FNP A;  3M8E A;  2HQR A;  2FE3 A;  4QWQ A;  4YFK F;  5L3D A;  2MLK A;  2QQA A;  1XMK A;  1W5T A;  1HBX G;  5DD8 A;  4IRG A;  4G6Q A;  5JI6 A;  3GZ5 A;  1IN7 A;  3ERE D;  2BEO A;  1LDJ A;  5E17 F;  3LA2 A;  4LLG F;  4LD5 A;  2FNA A;  2ZBK A;  3U1D A;  1XGS A;  2ACJ A;  2KIU A;  3E97 A;  1RIO H;  1X3U A;  3IC7 A;  2XGX A;  2VOO A;  1IN4 A;  2IA1 A;  3FMR A;  1AOY A;  4CZZ A;  5D4S A;  1XSV A;  1BN5 A;  1W7P A;  2XVC A;  3DKW A;  1A04 A;  1R5G A;  1QO0 D;  2QUF A;  2RGV A;  3GYH X;  3T5X A;  3T8T A;  3ZN0 A;  1P2F A;  2YU3 A;  1U5T C;  1I6X A;  2VC1 A;  3N97 A;  5ICE A;  1KU2 A;  1K78 A;  1IXC A;  5HLI A;  3LAP A;  4S05 A;  4YFN F;  5H6Q A;  4KDP A;  1G6N A;  4HOB A;  2GAU A;  4OIP F;  5H20 A;  1ZG5 A;  2Q8K A;  2QM3 A;  3BDD A;  3MCZ A;  5F64 A;  4A0Y A;  5CVR A;  3BJA A;  5EEG A;  3EYY A;  2QQ9 A;  3LQR A;  4OMY A;  2M87 A;  1S29 A;  2M30 A;  1LVA A;  4DNC A;  5E8G A;  2FML A;  3H92 A;  3TDZ C;  3VFZ A;  3U9G A;  1KA8 A;  2E1C A;  5KVR A;  1G3W A;  1R22 A;  3IRR A;  1FP1 D;  1IN6 A;  4RB2 C;  3TO9 A;  5H6R A;  5LBQ A;  2L4M A;  2P5V A;  3GFJ A;  1YS6 A;  5E18 F;  2KJC A;  2DTR A;  1ONV A;  2BBY A;  2XUB A;  1MDM B;  5ICC A;  2MA3 A;  4LMY A;  1FX7 A;  4N9H A;  2HKX A;  2K02 A;  2JPC A;  2W85 A;  2ETH A;  4OMZ A;  4ZYG A;  1WI9 A;  5E20 A;  4O6J A;  1NHA A;  2A61 A;  4A0Z A;  3FM5 A;  3U2R A;  4M72 A;  1YIO A;  2ZO4 A;  5ED4 A;  4HF2 A;  3I4P A;  1YW8 A;  2DK5 A;  1HST A;  5D5U B;  1HXD A;  1XN7 A;  3ML6 A;  2ZJ2 A;  2D1V A;  4BNC A;  3TKY A;  4G8X A;  3SFZ A;  3OOP A;  1KQ8 A;  1JGS A;  3SHF A;  3SZT A;  3ABU A;  3ULQ B;  4HZF A;  4IHS A;  3KLN A;  1MGT A;  4R1H A;  4MEY F;  4RB1 A;  4UXN A;  4ESF A;  1YW7 A;  3CUO A;  3GX4 X;  2PQ8 A;  2E1N A;  4XBF A;  1YTY A;  2QLZ A;  3K1N A;  3KP4 A;  1V3F A;  1R00 A;  4WXD A;  5K5Q A;  4M71 A;  3FWE A;  5TJJ A;  1I1S A;  3C1D A;  4Y15 A;  2PFB A;  1U8R A;  4IXA A;  5K5R A;  2XAF A;  4GCV A;  1FYM A;  3IWF A;  3CUQ A;  1KYZ A;  2ZKZ A;  4IVN A;  4RB3 C;  4HLY A;  5FFX A;  1ZHF A;  2W84 A;  5CVJ A;  1T98 A;  2O03 A;  4MTD A;  4AIJ A;  1J7K A;  3Q9V A;  4BH9 A;  2DQR A;  2YSR A;  2W57 A;  1QZY A;  3SXY A;  2Y0M A;  1XGN A;  1O3R A;  2M5W A;  4A6D A;  1OMI A;  2X4H A;  1HW5 A;  3WG9 A;  4D0P A;  4A5M A;  5EEH A;  3E3V A;  1J59 A;  1O3T A;  4N9I A;  4L18 B;  5ICF A;  4U7B A;  3I59 A;  2RKH A;  3GEZ A;  3HHH A;  5LEK A;  1IF1 A;  4OIR F;  2FF4 A;  3P7N A;  4MHG A;  2HQN A;  3F8N A;  4HV5 A;  1ZRE A;  1L0O C;  2RN7 A;  1S6L A;  2IW5 A;  2A6E F;  1F1Z A;  1PP7 U;  1MJA A;  1O7F A;  2IA0 A;  1R5H A;  3R4K A;  4HF0 A;  2HFH A;  3J80 K;  2JSC A;  1XB4 A;  3F8B A;  2STT A;  4HW0 A;  2MH2 A;  4L9T A;  5D8L B;  4EJU A;  5AON A;  4AIK A;  2V9V A;  1P4A A;  4UVA A;  3J81 Z;  3V7R A;  2NRA C;  4PGG A;  1G3T A;  1J9I A;  1CF7 A;  4Z2Y A;  3AAF A;  1HSJ A;  2LF8 A;  4UV9 A;  1KYW A;  3T0Y A;  3CO7 C;  1BIA A;  5J8F A;  2NNN A;  2DLL A;  1LDD A;  1ZG1 A;  3F6V A;  2EFO A;  2LKP A;  1ZGA A;  3LFK A;  3BRO A;  1GXQ A;  3E5Q A;  4U0V A;  1FBQ A;  5J8C A;  2H6C A;  5BPD A;  1D5V A;  2O8X A;  4P55 A;  1H9T A;  1HKT A;  3K2Z A;  4KIC A;  1GXP A;  1BC8 C;  2HDC A;  2WTE A;  1Z6R A;  4GXO A;  2RVC A;  1IRF A;  3TOB A;  5FGM A;  2E7W A;  1UST A;  1MZB A;  1P4X A;  3GF2 A;  4N0B A;  2FMY A;  1KU3 A;  1UFM A;  3L09 A;  2W25 A;  4LJZ F;  5CVV A;  1FYL A;  1SD7 A;  1FWZ A;  4Y17 A;  2Z9O A;  2VBX A;  3E5X A;  4KMF A;  3C18 A;  1RZ4 A;  5LGU A;  3V8J A;  1IXR C;  3KFW X;  1VTN C;  3DV8 A;  2A69 F;  3J7A O;  1BI2 A;  3TGN A;  4RGR A;  5D5X B;  4CXF A;  1S7O A;  1O57 A;  5DD4 A;  2J5P A;  1QGP A;  3F72 A;  2NS0 A;  5HDK A;  1S8N A;  3JAM K;  1USS A;  4EM0 B;  1XDS A;  5LRS A;  3ISP A;  3GZ6 A;  4HV6 A;  3WTZ A;  2KJB A;  4AWX B;  3MQ0 A;  2ZNZ A;  1U5T A;  2EJR A;  2HWV A;  3ZN1 A;  2LSO A;  3HSR A;  1XDU A;  1LQ1 A;  1RUO A;  1G3S A;  1I1G A;  3DPL C;  4ETS A;  3FX3 A;  4L9J A;  2XRN A;  4OIO F;  4HYE A;  3HOS A;  4L9V A;  4UHT A;  4CGZ A;  1FOK A;  2A3S A;  3TOA A;  2QBY B;  2CWE A;  3DXJ F;  4LB6 B;  4CDG A;  1PDN C;  2HR3 A;  1D3Y A;  4KIB A;  4P5O A;  5DUI A;  3GFI A;  5JR3 A;  2MC3 A;  4MNU A;  1YYV A;  2VT3 A;  1DP7 P;  1R1T A;  5BOX A;  3FXR A;  2EWN A;  3MEX A;  1BOA A;  1HKQ A;  3M1E A;  5LGT A;  3GFL A;  1BBY A;  1T0F A;  3GVA A;  1K7A A;  2EFQ A;  3RKY A;  2RNJ A;  5ERI A;  2M1B A;  4HF1 A;  3MWM A;  3DPT A;  4KIF A;  2QZ8 A;  4MQ9 F;  2K4J A;  1T2K A;  4HA8 A;  2V1D A;  3RKX A;  2ZME A;  3FZV A;  3PQK A;  2FQ3 A;  3KEO A;  2IPQ X;  1FNN A;  3I5U A;  4U88 A;  5DYM A;  3RJP A;  2F2E A;  1U2W A;  4B8X A;  2FRH A;  3DP7 A;  3E6D A;  1T6S A;  3LAJ A;  3I0T A;  2R3S A;  5D6F A;  3Q9S A;  2X0L A;  2A07 F;  2PI0 A;  2GXG A;  5AIP A;  5D6E A;  2ADU A;  1BI0 A;  1Z9C A;  4UUV A;  5JVT A;  1T39 A;  3ZQ7 A;  1J75 A;  3P9C A;  4EGY A;  3BPV A;  1ZLJ A;  2HYF A;  4ON0 A;  3V8K A;  4KYW A;  2OU2 A;  1XCV A;  4RGS A;  2D45 A;  1D8J A;  1IW7 F;  4UV8 A;  5HS9 A;  4IJA A;  2HZT A;  2GZW A;  2OD5 A;  4Q47 A;  1GVJ A;  4PCQ A;  2OA4 A;  1KQ9 A;  3C7J A;  2KKO A;  4ZH4 F;  2YX4 A;  3HUG A;  3BOQ A;  4BQA A;  5CJ9 A;  3FMS A;  5L3E A;  1ZRF A;  3FXQ A;  2PN6 A;  3IKV A;  3K0L A;  1PP8 F;  1R7J A;  2FOK A;  1TNT A;  4AIH A;  2VOP A;  4I0A A;  5BQT A;  5L3F A;  1R1V A;  3RIR A;  4A12 A;  4OU0 A;  3WTU C;  4KUM A;  2J5O A;  1CGP A;  1FSH A;  3QP5 A;  2D2W A;  5JFR A;  1Z1D A;  4HX4 A;  5D8K B;  2FU4 A;  1KQ0 A;  2DQL A;  2UXN A;  1G3Y A;  2XAH A;  3F6O A;  4AVP A;  3FMQ A;  1MKM A;  4G9Y A;  2XRO A;  2PJP A;  2DFI A;  1D8K A;  1FY7 A;  4KA4 A;  1OPC A;  2IJL A;  4G94 A;  4IRH A;  3ECH A;  1CF7 B;  4WX9 A;  2O0Y A;  3IWZ A;  1DPR A;  3RYR A;  3I54 A;  2K27 A;  5K1Y A;  4I2O A;  5ILV A;  1KGS A;  5DUK A;  4MQV A;  2EV5 A;  4AD9 A;  1J0R A;  2Q0O A;  3HTS B;  4EJT A;  3KE2 A;  1TTY A;  2ZCW A;  2O3F A;  4G7O F;  1XGM A;  3HSF A;  3RI4 A;  4EMS A;  4ENN A;  5DDG A;  3CLO A;  2P7V B;  4O3M A;  3K9T A;  1GHC A;  3G3Z A;  1DUX C;  3JSO A;  3E6B A;  2L02 A;  2JZY A;  3C3W A;  1XCB A;  1FC3 A;  3EDP A;  1Z91 A;  4ENM A;  1QQI A;  4IPA A;  3RTR A;  5ILU A;  4WXC A;  3V7S A;  5BS6 A;  4G7H F;  4P9U A;  1OYY A;  1E2X A;  3F8F A;  2K4B A;  3FF5 A;  1JXS A;  4I09 A;  3MZY A;  2A68 F;  1FT9 A;  4WCG A;  2IA2 A;  2FSW A;  2H6B A;  2Y75 A;  4YII A;  5FLX Z;  1FSE A;  2COM A;  2UZK A;  3MAJ A;  2PG4 A;  3GO5 A;  4FHT A;  4DQ2 A;  1SD5 A;  2VBY A;  2QEN A;  1ZG3 A;  3I58 A;  3JW4 A;  3P9K A;  3ABT A;  2Z5U A;  3KP3 A;  4EVI A;  3LWF A;  4L9N A;  3DEU A;  5E1Z B;  3QPT A;  2RDP A;  1SFU A;  2CO5 A;  4M73 A;  1UHW A;  4MTE A;  2ISZ A;  4RAZ A;  3F8M A;  1LEB A;  4KN4 X;  2H09 A;  4M74 A;  2H27 A;  4BHP A;  1WRJ A;  3I64 A;  5A2Q Z;  2Z99 A;  2MH9 A;  2YX7 A;  4A6E A;  4H0E A;  3FHZ A;  4U0W A;  4HLX A;  2EV0 A;  3TDU C;  1LEA A;  1SMT A;  2ZFW A;  2KIF A;  3R6S A;  2O61 A;  1EH6 A;  4FX0 A;  2M8E A;  5LLQ A;  3L00 A;  3KCC A;  4KT5 C;  3WGI A;  1HW1 A;  4YG2 F;  5HLG A;  3H3Z A;  3HYI A;  2DT5 A;  2VBZ A;  1T38 A;  3WOD F;  2IP2 A;  1ZAO A;  4GYG A;  3ROU A;  2F5F A;  2VXZ A;  3KP7 A;  1XMA A;  3PQJ A;  5LGN A;  3WTX C;  1J5Y A;  4JQF A;  3BJO A;  5KK1 A;  2EA2 A;  2DPD A;  1IRG A;  2QYO A;  3RPU A;  3JTG A;  1TBX A;  3R60 A;  2PMU A;  1YW9 A;  1BI3 A;  3VOD A;  2CSO A;  3WTV C;  4ESB A;  5TRD A;  4LG0 A;  5HOO A;  2L4A A;  4ZZL A;  3KZY A;  5ILS A;  1LNW A;  4O5V A;  1P6R A;  2IRF G;  1IXS B;  5K5O A;  5DCM A;  1STZ A;  3RYP A;  2EA4 A;  1ZRC A;  4LLN A;  3GUD A;  1I27 A;  1MJ9 A;  3HRT A;  4KIG A;  1TQM A;  2ZME B;  4PDK A;  1E17 A;  2E7X A;  2G9W A;  4OOI A;  3QU6 A;  4WF2 A;  3ZMZ A;  1MD0 A;  4HQM A;  2P5L C;  1DDN A;  3JSP A;  5CLS A;  3SZP A;  1W7P B;  5J6X A;  1EH8 A;  4YIF A;  3M8F A;  2LNB A;  3R61 A;  2YPR A;  4KFC A;  3E6M A;  1Z6T A;  2HKO A;  3WE3 A;  1C0W A;  4P9F A;  2H94 A;  4A5N A;  3F23 A;  1K78 B;  1ODD A;  1BJA A;  4A2U A;  2Q2E A;  2C6Y A;  5HS8 A;  2EFW A;  1ZLK A;  2D1H A;  5L3C A;  3ZPL A;  1Z7U A;  4FX4 A;  1Q1H A;  4QLC U;  1KU9 A;  4R8H A;  3GLX A;  3O6B B;  2P6S A;  3COA C;  3L7W A;  1REP C;  4BHB A;  3LQQ A;  4M6X A;  2VC0 A;  2MBF A;  1RNL A;  2V6C A;  4TV7 A;  4WXH A;  3BP8 A;  4ESJ A;  4IRI A;  4I98 B;  1G4D A;  2MD5 A;  2EFP A;  4U7D A;  3ZP5 A;  1O3Q A;  3EYI A;  4RS8 A;  2ZNY A;  2ISY A;  1Y0U A;  1OYI A;  2DK8 A;  4M6Y A;  2F5D A;  2FBI A;  1XSX A;  2NYX A;  5IT9 Z;  1HW2 A;  2DBB A;  4BYY A;  2DI3 A;  2Z3Y A;  2UXX A;  3KET A;  2VT2 A;  1UHM A;  4XLN F;  1R58 A;  1SFE A;  4P96 A;  2PLY A;  1IUY A;  3L9F A;  3P9I A;  1LB2 A;  3DF8 A;  2TDX A;  1BI1 A;  2P6T A;  3KEQ A;  5FB2 A;  3BWG A;  3WGG A;  1RI7 A;  2NAZ A;  3ZMD A;  2P5K A;  2BV6 A;  2K86 A;  4EJW A;  2HOE A;  1B9N A;  3BPX A;  4NQW A;  3J81 K;  1Z05 A;  3OV8 A;  1FLI A;  4I7H A;  2QQB A;  1QPM A;  3GXO A;  2F5C A;  1YG2 A;  2R7F A;  3HRM A;  5E1X A;  3F22 A;  5DCF A;  3B02 A;  2XKO A;  2KRF A;  2EB7 A;  2GWR A;  4M9X A;  2QVO A;  1QBJ A;  4EQQ A;  4HBL A;  3WU0 A;  4BXU A;  4LK0 F;  3K69 A;  1V4R A;  2JT1 A;  1SD6 A;  1QZZ A;  4MEX F;  2VE8 A;  3F3X A;  1P4W A;  1R23 A;  1YS7 A;  3DFG A;  3E5U A;  5FD6 A;  1SAX A;  1TQP A;  1R36 A;  3B73 A;  4EGZ A;  5AIQ A;  3NQO A;  5F1R A;  5FD5 A;  3W6J B;  1FBU A;  1ZYR F;  4M9Z A;  1OKR A;  2JPB A;  4NB5 A;  1B4A A;  4HDU A;  2OZ6 A;  3KP5 A;  2XAJ A;  4L0Y B;  5HLH A;  4Q4Z F;  3ZMT A;  4ENJ A;  3QU3 A;  5ICG A;  2LF7 A;  3DQV C;  1TQI A;  1SD4 A;  4GGG A;  3VEP A;  1LDK B;  4Y13 A;  3LST A;  3CUQ B;  1U78 A;  2HEO A;  3R0J A;  3D0S A;  6PAX A;  4WWC A;  2M45 A;  3CO6 C;  4CYD A;  3V4G A;  3HRU A;  3T1B A;  4E70 A;  4B09 A;  2V1U A;  1FPQ A;  4UNO A;  2DW4 A;  1FZP B;  4ZYD A;  1U3E M;  1DPU A;  3NEU A;  1YQA A;  3QRF F;  1J2X A;  5IT9 K;  5HS7 A;  2RC4 A;  2W24 A;  3MZH A;  2Y48 A;  4I01 A;  2CW0 F;  4CHU A;  2OZU A;  3RPQ A;  2ESH A;  3I59 B;  2V79 A;  2XIG A;  3HOT A;  3M7G A;  3LA7 A;  3CJN A;  4GO1 A;  4GYI A;  2GXB A;  2DAO A;  1ZH5 A; 
#chains in the Genus database with same CATH topology
 3TQN A;  3L2C A;  4LFU A;  1ON1 A;  5EZG A;  3WTW C;  2V26 A;  3I56 I;  2DU9 A;  1MND A;  2CV2 A;  4CCL A;  1MBK A;  4YEJ A;  4Q48 A;  3WTY C;  1B59 A;  3BJ6 A;  2GA2 A;  3H9Q A;  3KP6 A;  2B7E A;  2I8D A;  1GT0 C;  1UHS A;  4E7I A;  1PUE E;  4ZJZ A;  3HB9 A;  2CW8 A;  1H89 C;  3MKW B;  1T0F C;  4ZZD A;  5DEQ A;  2CFX A;  2K85 A;  3Q3S A;  3BQY A;  3JTH A;  1EA3 A;  4DBQ A;  2GM4 A;  1BIB A;  2KIM A;  2LDU A;  2FXA A;  2MLG A;  2EPF A;  3C2B A;  3PO3 J;  1T33 A;  3EUH A;  1L3L A;  5C4J J;  2VN2 A;  4XKW A;  4ZDP A;  2JA8 J;  3HHG A;  1W5S A;  5BPI A;  1ON2 A;  2QBY A;  1TWG J;  4ASN A;  2EZK A;  3QWL A;  1O7L A;  2JTV A;  3N05 A;  3GBG A;  2O7O A;  5HDG A;  2LRD A;  2ZME C;  2L9N A;  4XON A;  4ZC3 A;  4CO8 A;  3ZQL A;  1PVE A;  4IHY A;  4A0X A;  3I71 A;  2ID3 A;  5F0C A;  5GAD J;  1YRN B;  1R49 A;  4XRF A;  1IN5 A;  2DA3 A;  5EF6 A;  3NRV A;  1B9M A;  1TT5 B;  2FEZ A;  4LLL A;  2HYG D;  4ZYA A;  1RUN A;  4F7Z A;  2RAE A;  3MMY B;  4OAZ A;  3EUA A;  1G2H A;  3OWT A;  1LE8 A;  5LEJ A;  3W3C A;  1MJB A;  1R5I D;  3DEE A;  3J80 Z;  3CTA A;  1GV2 A;  3O2P E;  2DMQ A;  2G7H A;  5M3M J;  2UWM A;  5EEA A;  4FET A;  1JTY A;  5J4V A;  4CCK A;  4LG0 B;  3IKT A;  4LB5 A;  3HOW J;  2HGC A;  1YFH A;  2OAZ A;  1HKS A;  3WTT C;  4XSX F;  5K7H A;  3ZQQ A;  3KLO A;  5DCM B;  1MBE A;  2F48 A;  3RQ4 A;  1SFO J;  3O3K A;  4OIQ F;  3IHU A;  1ERD A;  2KPM A;  3DEW A;  3GTM J;  1S7A A;  2CV0 A;  2VUM J;  3HSE A;  3JRA A;  3OSG A;  1SEU A;  2EZI A;  1ZGJ A;  2XAG A;  4G12 A;  4I02 A;  1WQ2 A;  2GBY A;  2CYY A;  2IVM A;  3H0G J;  3OYA A;  2CGP A;  2WAD A;  1DQU A;  1W5C C;  2F5E A;  2WA0 A;  2WWY A;  2BZT A;  5GPA A;  2R7W A;  1SMY F;  1B6A A;  3BY6 A;  1HQC A;  4X1E A;  2ESN A;  1H9G A;  3L2V A;  3AG3 H;  3JRF A;  3PFI A;  4GFB A;  3H9G A;  2EK5 A;  3F9K A;  4RAG A;  4QTR A;  2IT0 A;  1RKT A;  5D5W B;  2FBK A;  2CG4 A;  1JUS A;  3FM3 A;  5HNF A;  3G73 A;  5FO5 A;  2VBW A;  2EQR A;  3WTS C;  3I4M J;  3U21 A;  3S2W A;  3S14 J;  2P81 A;  1JT6 A;  3QAH A;  1WH7 A;  3SQN A;  5LHG A;  4LGW A;  5IY5 H;  2Q2E B;  2EH3 A;  4G6D A;  2V4J C;  4NHJ A;  2VPL A;  1XGO A;  3DWL E;  1QHG A;  3A03 A;  5CVU A;  3EET A;  2WY8 Q;  4J00 A;  1Z3X A;  3BZ6 A;  4M3D A;  1UG0 A;  3H3U A;  1W0U A;  3KP2 A;  3WGH A;  1R4N B;  3WU1 B;  1F9N A;  1IDZ A;  4CCN A;  4AC0 A;  4BKX A;  5E3N A;  4XRS A;  4BQO A;  3TW7 A;  3BR1 A;  3KZI C;  2KMU A;  1V55 H;  2NS8 A;  3FXU A;  5D4R A;  1UZC A;  2V7F A;  2AO9 A;  2AS5 F;  4CH7 A;  2R7D A;  2E1O A;  1SVM A;  3SEQ A;  1OR7 A;  2HTS A;  4I0B A;  1K79 A;  3M4O J;  4MO7 A;  1ETW A;  1D1C A;  1OFC X;  1SFX A;  4NC7 A;  3H9J A;  2EFN A;  3CC7 I;  2AXT C;  1VQK I;  2YR2 A;  4IHT A;  3E6C C;  5DS9 A;  5CKT A;  5E1W A;  3OY9 A;  3TO6 A;  1U5T B;  4QPO A;  4IEJ A;  3GFM A;  4LIU A;  1GUU A;  4L5I A;  4A3L J;  3JAM Z;  3DTK A;  2R92 J;  3EQL F;  5EG0 B;  4HAM A;  3F21 A;  2XAQ A;  4MGR A;  5LHI A;  4S04 A;  5IT3 A;  3TO7 A;  2Y31 A;  3GTP J;  1ZRD A;  3K4L A;  3BR2 A;  1R1U A;  2VE9 A;  2BE5 F;  3A01 B;  2QWW A;  2RQP A;  4UVB A;  3HIF A;  1OCZ H;  3OR2 C;  3HPG A;  4HX8 A;  1S3J A;  4B1R A;  4WK8 F;  2QSG X;  1Z3Y A;  2XV4 S;  1AWC A;  2X48 A;  3CME I;  3HTU A;  3CCR I;  2L01 A;  2X9D A;  3ZMU A;  1WSU A;  1JHF A;  1WWX A;  3MZ8 A;  1HDD C;  4BY7 J;  3H0D A;  5E8I A;  1MDM A;  1VQ5 I;  1FMV A;  1TW3 A;  4Q5S F;  4EJO A;  1KU7 A;  2Y0S A;  2IBD A;  4IX7 A;  2MG4 A;  2L7F P;  1B8I A;  4XLP F;  2GA1 A;  1E0E A;  1X1P A;  2DFF A;  4XSZ F;  3QYE A;  1VZ0 A;  1YO5 C;  2LG4 A;  2P7C B;  4RLQ A;  4JOM A;  4RAY A;  4EM1 A;  1D0Y A;  2GIV A;  2X85 A;  3WHB A;  2PEX A;  3QOP A;  1YIT I;  4LK1 F;  2UV1 A;  3QP6 A;  3K1P A;  4QPQ A;  4KMU X;  1LJ9 A;  4K2E A;  2BGC A;  1CQT A;  4Y33 A;  3MKY B;  4A3E J;  2FX0 A;  2LVS A;  3W6V A;  5F0H A;  4BAY A;  3CD6 I;  2HQA A;  2XAS A;  1UB9 A;  2FA5 A;  4HPQ A;  2PMH A;  3I53 A;  2R93 J;  2Z33 A;  4DBR A;  5FFZ A;  4BHC A;  5KAF C;  1EKE A;  1D1B A;  1XMX A;  1Y8Q B;  1B1B A;  1PJR A;  4KIS A;  1W7P D;  2BY3 A;  3VOE A;  3V8L A;  4XM3 A;  1F4K A;  1EJ9 A;  3IP4 B;  4F55 A;  3WE2 A;  2BYV E;  4YFX F;  5CYV A;  5HVQ C;  1IGN A;  4PFP A;  5EGO B;  3ECO A;  2AQF A;  1EH7 A;  3W6K B;  1W4M A;  2DO7 A;  1FYK A;  3CUQ C;  3GW2 A;  2M4G A;  3G71 I;  1TW2 A;  3Q5F A;  2KZV A;  3G1L A;  1XSD A;  4RA2 A;  4R79 A;  2KLO A;  2K3P A;  1K6O A;  2O6G E;  2VOD A;  2DT7 B;  3TBI A;  3W2W A;  4EJV A;  4PGH A;  2X1E A;  2XKP A;  2OQG A;  2R5Y B;  3ZMS A;  3BG3 A;  2M4K A;  4DIQ A;  3V7C A;  4PK4 A;  1I5Z A;  1TLH B;  1GDT A;  2ZXJ A;  2DA2 A;  4C2U A;  3HBL A;  1FOW A;  1JHH A;  5FLX K;  1DU0 A;  4XKB A;  2XF7 A;  4L5J A;  1YLF A;  4BU2 A;  2H1L A;  1LVK A;  4CA0 A;  2WC2 A;  1OCO H;  3ZMV A;  5D5V B;  3G1M A;  1Y39 A;  4IF4 A;  2VON A;  2VQL A;  2XF6 A;  1OYW A;  4A3G J;  3T8R A;  4CIC A;  1FMW A;  3K4M A;  4DYC A;  1DGW Y;  3L2W A;  1O3S A;  1IN8 A;  2JUG A;  5FRO A;  4JBA A;  4HX7 A;  2OJE D;  1FBS A;  1UMQ A;  2IXS A;  2XPV A;  5HNH A;  2AXL A;  1J09 A;  1ETQ A;  2OQR A;  3ABL H;  1BC7 C;  5LRR A;  3GWZ A;  2XRL A;  5C4X J;  3MKL A;  2LTP A;  1E3H A;  4FT8 A;  4G7Z F;  1YJN I;  1IRZ A;  2L5Q A;  2KT0 A;  3R0A A;  3IL2 A;  3CP2 A;  4ZYH A;  2WAE A;  1ZR4 A;  2DA4 A;  2Z1D A;  2NXN B;  4KN7 X;  4OIN F;  1IZ1 A;  4L0Z B;  1MMA A;  1P92 A;  4RB0 A;  3OYH A;  3CQZ J;  2WB1 N;  3PSF A;  4ENK A;  2N8G A;  4RGU A;  1U6G A;  4EV0 A;  3I55 I;  2Y2Z A;  3N4M A;  3QYF A;  1UCR A;  1X3W B;  2CQK A;  3CP8 A;  5CVI A;  5F6F A;  1N78 A;  2X6W A;  2ELH A;  3LSK A;  3S15 J;  2B0L A;  4NDL A;  4XMY A;  3AG2 H;  4ZYE A;  3J7Y J;  2LH9 A;  1AA7 A;  3KZZ A;  2PBI A;  3JRD A;  5L3G A;  2ME0 A;  2G7U A;  3CDH A;  5JHU A;  2KIQ A;  1OCP A;  2WV1 A;  1KON A;  4B48 A;  2KL4 A;  1VFC A;  3ELK A;  5A2Q K;  3LA3 A;  1ZQ3 P;  1H0M A;  5HDN A;  1XD7 A;  3PIP F;  1R9T J;  3QPH A;  2M9H A;  1OCT C;  3F8C A;  4KNY A;  1BM9 A;  2BW3 B;  3S8P A;  4HDV A;  2DPU A;  1SAU A;  4C9Y A;  2W48 A;  1ZN2 A;  3DTI A;  4UVC A;  2HTJ A;  2FBH A;  1EV7 A;  5TIS C;  3RDI A;  3VPR A;  2TCT A;  3RKW A;  2OBP A;  4JX5 A;  2K7L A;  3M9A A;  1HA8 A;  1M1E B;  2RV8 A;  5C44 J;  3S17 J;  2ELK A;  4JK1 X;  1TNS A;  2VJ4 A;  2P8T A;  1S72 I;  2L7K A;  5LHH A;  1U9N A;  3ZRG A;  1QNT A;  4IO9 F;  2EV6 A;  4M9S A;  4EM2 A;  5L3B A;  3IRQ A;  2E2J J;  1LFB A;  3FHN A;  3PNY A;  3S1M J;  1WFX A;  4H4K C;  1IAW A;  1Z0X A;  3REO A;  2O8K A;  5IOY A;  5DV5 A;  1YIJ I;  1ETX A;  3VSK A;  3BC8 A;  4B43 A;  2JRT A;  4V2F A;  3MFK A;  3D5L A;  2A6H F;  3K1M A;  4F52 A;  2STW A;  3BR6 A;  1WKM A;  1ULY A;  2ME6 A;  1NG7 A;  5M5Y J;  2GQQ A;  2NNY A;  5FKL A;  4BGD A;  4HQE A;  1A36 A;  1TWC J;  4NUB A;  2V1X A;  4XOP A;  2WV0 A;  2B63 J;  1JE8 A;  3HRS A;  5M5W J;  1F5T A;  2VJJ A;  2L54 A;  4PZJ A;  3A0B C;  1ETV A;  3VB2 A;  3LSM A;  1MNM C;  1ZAR A;  4AID A;  3O8H A;  2A5Y B;  2L3D A;  1FP2 A;  2MFZ A;  2P4W A;  4RGX A;  1RES A;  4AM3 A;  2XHK A;  3CF5 F;  4U0Y A;  5BMZ A;  2HS5 A;  2FNP A;  3OL4 A;  1MBF A;  1JKO C;  3M8E A;  2HQR A;  1VQM I;  3WHC A;  2FE3 A;  4QWQ A;  1WJF A;  4BY1 J;  4YFK F;  2XB5 A;  2MLK A;  5L3D A;  4E7H A;  2QQA A;  2KIS A;  2X6Y A;  1ETO A;  1ZKG A;  2IGK A;  2Z16 A;  2FUG 2;  1X2N A;  1XMK A;  2L0K A;  1APL C;  1W5T A;  1HBX G;  2E2H J;  5B5E C;  2NVX J;  2JA5 J;  2CU7 A;  2M2E A;  1X58 A;  3GTL J;  4OWR B;  1WJB A;  4ZDL A;  4I76 A;  5DD8 A;  5KNL A;  3OYL A;  3OR1 C;  4IRG A;  4G6Q A;  5JI6 A;  3GZ5 A;  5J47 A;  1IN7 A;  1WJ5 A;  3ERE D;  1E3P A;  3CC2 I;  1JKP C;  3S2D J;  2BEO A;  1LDJ A;  5E17 F;  3LA2 A;  4LLG F;  3AG4 H;  3ZCO A;  4LD5 A;  4B47 A;  2FNA A;  2ZBK A;  3TL4 X;  3MN2 A;  2R7Z J;  2V9P A;  3HGY A;  3U1D A;  1XGS A;  2ACJ A;  2KIU A;  1BL0 A;  3E97 A;  1ITY A;  5E3L A;  1RIO H;  3BG7 A;  1OCR H;  1X3U A;  3I4N J;  1NG6 A;  2HVQ A;  2YS9 A;  3IC7 A;  1A35 A;  3BR3 A;  1P7I A;  2XGX A;  2VOO A;  1IN4 A;  2IA1 A;  3FMR A;  1AOY A;  4CZZ A;  4NC6 A;  5D4S A;  1XSV A;  2QKL B;  4C30 A;  1BN5 A;  1W7P A;  2XVC A;  3DKW A;  5IYC J;  3LSP A;  2XGD A;  2HNH A;  4RLF A;  1VQ4 I;  1A04 A;  3BR5 A;  3J7A Y;  1R5G A;  1QO0 D;  2DMU A;  2QUF A;  2RGV A;  4DJA A;  3GYH X;  1FOX A;  3T5X A;  3T8T A;  1BJZ A;  3ZN0 A;  4Y4R A;  1P2F A;  2YU3 A;  1U5T C;  2L2O A;  4XLF A;  1GV5 A;  1I6X A;  2VC1 A;  1AKH B;  3N97 A;  5ICE A;  3QQA A;  1VI0 A;  2VL8 A;  1KU2 A;  1K78 A;  2R7S A;  2Y30 A;  1XC5 A;  3FK6 A;  1H8A C;  2BVM A;  1IXC A;  4XQF A;  2VJI A;  5HLI A;  3LAP A;  2CH0 A;  4BEH A;  4S05 A;  4YFN F;  4YIR X;  2E71 A;  2K9L A;  2MSY A;  4Y52 J;  1NK2 P;  5B66 C;  3OYF A;  5H6Q A;  4KDP A;  1G6N A;  3HL2 A;  4HOB A;  1MH3 A;  2QKM B;  2GAU A;  1JJ8 C;  4MFE A;  2ZJR F;  4OIP F;  4GRI A;  2FOW A;  5H20 A;  1ZG5 A;  4IHW A;  2Q8K A;  4E7L A;  4IQ4 A;  2HZD A;  2QM3 A;  2DYS H;  3BDD A;  3CCE I;  2OCC H;  4G6T B;  2IS2 A;  1OJL A;  1B72 B;  3MCZ A;  3PO2 J;  3ZGK A;  3DLL F;  3M1C A;  5F64 A;  4A0Y A;  2R5Z B;  5CVR A;  2K9M A;  3L2R A;  3BJA A;  4M3E A;  3EYY A;  5EEG A;  2QQ9 A;  3LQR A;  4OMY A;  1X1A A;  3PFY A;  2M87 A;  1S29 A;  3AKZ A;  2E1M B;  2M30 A;  1PUF B;  2EZL A;  1LVA A;  1ETK A;  4DNC A;  5E8G A;  2FML A;  4XLA A;  3H92 A;  3CCQ I;  3TDZ C;  1V5E A;  3VFZ A;  5F27 A;  3U9G A;  4M3B A;  1KA8 A;  5IYB J;  2FD5 A;  2DXI A;  2E1C A;  2OPT A;  1HLV A;  4ZTF A;  5KVR A;  2XF5 A;  1G3W A;  1X1B A;  2LBF A;  1R22 A;  1QA6 A;  3IRR A;  1FP1 D;  1IN6 A;  4RB2 C;  3TO9 A;  5H6R A;  3K2A A;  2NVY J;  5LBQ A;  2L4M A;  1TWH J;  5FLM J;  4V19 K;  2P5V A;  3GFJ A;  1YS6 A;  5E18 F;  2KJC A;  1DU6 A;  2DTR A;  1UEL B;  4RDU A;  1ONV A;  2BBY A;  2KQR A;  2XUB A;  1MDM B;  3RCO A;  2HVS A;  3HEF A;  4FAS D;  2MA3 A;  5ICC A;  5IPA A;  1LFU P;  4LMY A;  3Q0W A;  5GAG J;  4BE1 A;  1B8I B;  2QA4 I;  3TMO A;  1FX7 A;  4N9H A;  4XIC A;  2F5V A;  3PNT A;  1QZE A;  3M8J A;  2HKX A;  2K02 A;  5J1U A;  4BJT A;  3KIO A;  3GTG J;  2JPC A;  1P9Q C;  2W85 A;  2ETH A;  3E0J B;  4OMZ A;  4ZYG A;  3K4J A;  1WI9 A;  2OF7 A;  5E20 A;  4O6J A;  3BG5 A;  2HPM A;  1NHA A;  2A61 A;  2V6E A;  1IO2 A;  4A0Z A;  3CCL I;  2E2I J;  1TT0 A;  3FM5 A;  3U2R A;  3KYD B;  4M72 A;  1YIO A;  1Y1V J;  1BOB A;  2ZO4 A;  5ED4 A;  4HF2 A;  3I4P A;  1YW8 A;  2DK5 A;  4HRI A;  2DN0 A;  1HST A;  5D5U B;  1AU7 A;  1HXD A;  1XN7 A;  4IL6 C;  3ZR8 X;  3ML6 A;  5EDN A;  2ZJ2 A;  2D1V A;  2A5W A;  3HKZ N;  3M3Y J;  4BNC A;  1SVL A;  4G8X A;  3TKY A;  3SFZ A;  3OSF A;  3OOP A;  1BR4 A;  5F1J A;  3GLL A;  1KQ8 A;  1JGS A;  1RET A;  2PX9 A;  2JRM A;  4PSW A;  3SHF A;  3SZT A;  3ABU A;  2E5Z A;  4XRS G;  2QSH X;  4PJ0 C;  3S2H J;  5GP9 A;  3ULQ B;  4HZF A;  3VYR B;  4CYC B;  3CLQ A;  1MMN A;  4IHS A;  3KLN A;  1MGT A;  4R1H A;  2LLK A;  4MEY F;  1N75 A;  4RB1 A;  3HC7 A;  4BS9 A;  4UXN A;  3F0C A;  4ESF A;  1YW7 A;  3D1N I;  2DFH A;  3CUO A;  3GX4 X;  3BQZ A;  5B1B H;  2PQ8 A;  4FTH A;  3K4K A;  5DM6 F;  4UUS B;  4Y7N J;  4AYB N;  2LY9 A;  2E1N A;  3FDY A;  4XBF A;  1YTY A;  4A3J J;  2QLZ A;  3IUO A;  3K1N A;  3KP4 A;  1V3F A;  3DCF A;  2ZB9 A;  1R00 A;  4WXD A;  5K5Q A;  2VKE A;  5FRN A;  4FE7 A;  1A6Q A;  4M71 A;  3ZQG A;  3IH2 A;  4P1W A;  1MBH A;  1Y6I A;  3FWE A;  2EBI A;  5TJJ A;  1I1S A;  3C1D A;  4F93 B;  4Y15 A;  4BJ6 C;  2PFB A;  1K6Y A;  5IOZ A;  1U8R A;  4IXA A;  4B3X A;  3V42 A;  2VKH A;  2FJ1 A;  5K5R A;  2XAF A;  2Z2S B;  2IS4 A;  4GCV A;  4LOC A;  2BHY A;  1X1D A;  1RKW A;  3CJR B;  4CCO A;  3G4S I;  1D1A A;  3IWF A;  2R0Q C;  1FYM A;  3CUQ A;  1KYZ A;  3G6E I;  2ZKZ A;  2VXD A;  4IVN A;  4RB3 C;  4HLY A;  2MAB A;  4D5F A;  2PMZ N;  2IGO A;  5FFX A;  2W7N A;  3FXJ A;  1ZHF A;  2W84 A;  1OLT A;  3IH3 A;  4DGW B;  1JKR C;  4PFO A;  5CVJ A;  1T98 A;  2O03 A;  4MTD A;  1Y1W J;  1VQN I;  4AIJ A;  4C2T A;  1J7K A;  3Q9V A;  2JK3 A;  2LK2 A;  5J4Y A;  5E79 C;  2DQR A;  4BH9 A;  3O8G A;  4Z6Y A;  2HI3 A;  2MYS A;  2QEX I;  3LSJ A;  2YSR A;  1WCM J;  1MBJ A;  2W57 A;  5GTH C;  1QZY A;  3SXY A;  2Y0M A;  1XGN A;  3K7A J;  1O3R A;  4XLC A;  1WJC A;  3MD2 A;  2M5W A;  3VYS B;  3BTC A;  4A6D A;  4L5E A;  1OMI A;  2X4H A;  3JRI A;  1HW5 A;  2RRE A;  3ZQF A;  4XNF A;  3WG9 A;  3HKZ A;  4D0P A;  4A5M A;  4S0H B;  5EEH A;  3L2U A;  3E3V A;  3OYI A;  2HYJ A;  3FIW A;  1J59 A;  3TP0 A;  1O3T A;  2NOJ B;  1IUF A;  3B6C A;  4II3 A;  1ZR2 A;  2O9L A;  1RR8 C;  4N9I A;  4L18 B;  3WG7 H;  2DTZ A;  1POG A;  3BZC A;  5ICF A;  1WJD A;  4U7B A;  4NBQ A;  3I59 A;  3OIQ A;  2IAI A;  2RKH A;  4XN3 A;  3GEZ A;  3CCS I;  3HHH A;  5LEK A;  1IF1 A;  4OIR F;  2E35 A;  2FF4 A;  3P7N A;  4MHG A;  2HQN A;  3F8N A;  3I3L A;  4MLO A;  4PSX A;  2GLO A;  2I10 A;  2WY7 Q;  1YX3 A;  3KYC B;  3UKG A;  1XPX A;  4F92 B;  2KDZ A;  4HV5 A;  2L9S A;  3FKJ A;  4AYB A;  1UG2 A;  1ZRE A;  1L0O C;  2RN7 A;  1S6L A;  2IW5 A;  2NS7 A;  2VPR A;  3OYM A;  2A6E F;  5HLT A;  3AFH A;  5E3M A;  4PUS A;  4NQW B;  5J3L A;  1F1Z A;  1BR1 A;  2COB A;  1PYV A;  2M7B A;  1MJA A;  1WVR A;  1PP7 U;  1O7F A;  2IA0 A;  1R5H A;  2M0C A;  3H35 A;  2QF7 A;  3R4K A;  4HF0 A;  2HFH A;  3J80 K;  2JSC A;  3ZOB A;  1XB4 A;  2KZG A;  3F8B A;  3ASN H;  2STT A;  4A93 J;  4HW0 A;  3P5J A;  2MH2 A;  4L9T A;  3LMM A;  3K70 C;  5D8L B;  4EJU A;  4HNU A;  1D5Y A;  1LKX A;  5AON A;  1UAA A;  4AIK A;  2V9V A;  4I99 C;  2WAQ N;  1P4A A;  2QQ8 A;  2CUE A;  4UVA A;  1YRN A;  1IG7 A;  3J81 Z;  3V7R A;  2NRA C;  4PGG A;  2GXA A;  1G3T A;  3FXM A;  4JX4 A;  3TW6 A;  1J9I A;  1CF7 A;  3EPZ A;  4FIS A;  2HVR A;  3RKQ A;  3RQI A;  1YI2 I;  4DOZ A;  4Z2Y A;  2VQC A;  3AAF A;  1HSJ A;  3SJM A;  2LF8 A;  5DM7 F;  4UV9 A;  1KYW A;  3T0Y A;  3CO7 C;  1BIA A;  5J8F A;  2E5N A;  2NNN A;  4D9J A;  3IV5 A;  2DJN A;  2DLL A;  2F4I A;  1ENH A;  4PJJ A;  1LDD A;  3JRC A;  3WU2 C;  1ZG1 A;  3F6V A;  4JX6 A;  2EFO A;  2NOG A;  2F4O B;  2EIK H;  2LKP A;  1ZGA A;  3LFK A;  3BRO A;  1GXQ A;  3E5Q A;  3FIS A;  2KRC A;  3S93 A;  4XLH A;  1QRY A;  3K4N A;  4U0V A;  1FBQ A;  5J8C A;  5FKM A;  2H6C A;  2O5R A;  3A02 A;  5BPD A;  1D5V A;  4BUP A;  2R7T A;  5CQE A;  2O8X A;  4P55 A;  4D7M A;  1H9T A;  1BW5 A;  1HKT A;  1FTZ A;  4XN0 A;  3K2Z A;  2DDA A;  5B3S H;  4KIC A;  4E4H A;  2X6X A;  4N4N B;  4BAC A;  1W36 C;  4B3A A;  1R71 A;  1GXP A;  4D5C A;  1BC8 C;  5C3E J;  2IGM A;  2HDC A;  2WTE A;  2LY2 A;  4PJM A;  1Z6R A;  3LSR A;  3SYT A;  4GXO A;  2RVC A;  1IRF A;  3TOB A;  1HC8 A;  1T8I A;  5FGM A;  2E7W A;  1UST A;  1MZB A;  1P4X A;  4IKF A;  3GF2 A;  4N0B A;  2CFO A;  4CZC A;  2FMY A;  3KEY A;  1K4T A;  4UY8 I;  1KU3 A;  1UFM A;  3L09 A;  2W25 A;  4LG3 A;  4LJZ F;  3ZQH A;  5CVV A;  2AQE A;  1FYL A;  1I6H J;  1SD7 A;  3VYU B;  1FWZ A;  4Y17 A;  2HOA A;  2Z9O A;  2VBX A;  3E5X A;  4RMN A;  4KMF A;  2ZXH A;  2E1M C;  3C18 A;  1RZ4 A;  5LGU A;  3V8J A;  1X4O A;  2YU9 J;  3ASO H;  3ZQC A;  1IXR C;  1GLN A;  3CF2 A;  3HOV J;  4YEL A;  2HDD A;  1ETY A;  3KFW X;  1VTN C;  3DV8 A;  3HGG A;  4E7S A;  2A69 F;  2BVL A;  3J7A O;  2IS6 A;  1BI2 A;  3TGN A;  3CMA I;  4RGR A;  2ZXW H;  2Y9Z A;  1VQ9 I;  5D5X B;  4CXF A;  4ANJ A;  1S7O A;  1O57 A;  5DD4 A;  4E7K A;  1MBG A;  1QGP A;  2J5P A;  3F72 A;  2K9S A;  2NS0 A;  5HDK A;  3BTI A;  1S8N A;  3JAM K;  1USS A;  4EM0 B;  1XDS A;  5LRS A;  2XGE A;  2MGQ A;  3ISP A;  3GZ6 A;  3FXL A;  4HV6 A;  2HOT A;  4ZTJ A;  3M07 A;  2NVT J;  3WTZ A;  2KJB A;  4AWX B;  2DA1 A;  2LFB A;  3QPS A;  4AUX A;  3MQ0 A;  3HXL A;  2ZNZ A;  1VND A;  1U5T A;  2EJR A;  2HWV A;  3ZN1 A;  2XAU A;  5M3F J;  2DMT A;  1LFP A;  2XDV A;  1HOM A;  2LSO A;  2LOO A;  3HSR A;  1QVU A;  5FJ8 J;  1XDU A;  1LQ1 A;  2R7V A;  1S5L C;  1X19 A;  3TP3 A;  2CMP A;  2DOF A;  2A6T A;  3VSL A;  1RUO A;  2X51 A;  2DYR H;  1G3S A;  1I1G A;  1I39 A;  3A01 A;  1BR2 A;  1RPW A;  1TP4 A;  3DPL C;  1YE9 A;  4ETS A;  3FX3 A;  4L9J A;  1R4M B;  3CDL A;  2XRN A;  4OIO F;  4HYE A;  2OUM A;  3HOS A;  3BG9 A;  1RR7 A;  4L9V A;  4UHT A;  4CGZ A;  1FOK A;  2K5C A;  1E3O C;  5F08 A;  5KCM A;  2A3S A;  3CDI A;  4A3I J;  3CZ6 A;  3TOA A;  2QBY B;  2ICW G;  4IOC F;  2CRG A;  4F3Q A;  4ZDO A;  2CWE A;  3DXJ F;  4LB6 B;  3LSI A;  2JJ7 A;  4CDG A;  1PDN C;  2VQG A;  2HR3 A;  5JLX A;  1D3Y A;  1YX5 A;  2X1D A;  4KIB A;  4P5O A;  3L2Q A;  4CUG A;  5DUI A;  3CMY A;  3VYT B;  3GFI A;  5JR3 A;  2MC3 A;  4MNU A;  2WB1 A;  3KYL A;  1YYV A;  4GDF A;  2E19 A;  2VT3 A;  5HOD A;  2NVQ J;  2ZJP F;  3LSH A;  1LE8 B;  1DP7 P;  1R1T A;  5BOX A;  2TRT A;  3FXR A;  2MC4 A;  2EWN A;  3DBL B;  3MEX A;  3IAM 2;  3ZXS A;  2BHZ A;  1BOA A;  1U8B A;  1HKQ A;  4E7J A;  3M1E A;  1HCR A;  3I9V 2;  5LGT A;  3GFL A;  1BBY A;  1T0F A;  3GVA A;  1K7A A;  4JYK A;  2DT6 A;  1G8X A;  2EFQ A;  2M0M A;  1ZGW A;  2XSD C;  3RKY A;  2RNJ A;  5ERI A;  3K6G A;  2M1B A;  2LKX A;  3OYD A;  3OMY A;  4F91 B;  4HF1 A;  3MWM A;  3DPT A;  4KIF A;  5K7F A;  5LFA A;  2QZ8 A;  4YRV A;  4MQ9 F;  4KJZ A;  2K4J A;  1T2K A;  3PM1 A;  5EGO A;  4HA8 A;  2V1D A;  3RKX A;  4BXF A;  2ZME A;  3FZV A;  3PQK A;  4HNT A;  2FQ3 A;  1I3A A;  2GOX B;  1T08 B;  3KEO A;  2IPQ X;  3ONQ A;  1TC3 C;  1FNN A;  2IEK A;  2WBM A;  4XL9 A;  3I5U A;  2NVU B;  2LRE A;  4U88 A;  1IDY A;  5DYM A;  3RJP A;  2F2E A;  5FKO A;  1U2W A;  1QU3 A;  4B8X A;  2FRH A;  2R5Y A;  3DP7 A;  3E6D A;  1T6S A;  3LAJ A;  3NAR A;  3UNG C;  3I0T A;  2FQ4 A;  2R3S A;  3OYN A;  1FTT A;  4N4O B;  5D6F A;  4J19 A;  1HF0 A;  3Q9S A;  2X0L A;  2MD0 A;  4B44 A;  5F0F A;  2A07 F;  4A3D J;  3BG6 A;  2PI0 A;  1XG1 A;  4D7N A;  2GXG A;  5AIP A;  3CCY A;  5D6E A;  2EIM H;  2ADU A;  1BI0 A;  5EZH A;  3PIO F;  1Z9C A;  4UUV A;  5JVT A;  1T39 A;  4AVZ A;  1FIP A;  3G1O A;  3ZQ7 A;  3D5R C;  1J75 A;  3A2K A;  3P9C A;  2H1K A;  4EGY A;  1FEX A;  3BPV A;  1ZLJ A;  5IP9 J;  1D0X A;  2OV7 A;  4CCJ A;  4C3I J;  2HYF A;  1Q1V A;  2JVH A;  4ON0 A;  3V8K A;  5GTI C;  4A3F J;  4KYW A;  2OU2 A;  9ANT A;  2HQ5 A;  1XCV A;  1JUP A;  4RGS A;  2D45 A;  1D8J A;  1FOY A;  4X0G A;  2EIL H;  2E34 A;  3C2G A;  1IW7 F;  4UV8 A;  5HS9 A;  4IJA A;  2HZT A;  2VB6 A;  2GZW A;  3JRG A;  4XK4 A;  2OD5 A;  4ITV A;  4Q47 A;  1G59 A;  3OS1 A;  1GVJ A;  2K9Q A;  4PCQ A;  4UB8 C;  2OA4 A;  1IV6 A;  1KQ9 A;  3C7J A;  4M6V A;  2JSP A;  2KKO A;  4ZH4 F;  2YX4 A;  2BW3 A;  3HUG A;  1OCC H;  2H8W A;  3LNQ A;  4Y3O A;  4XOR A;  3BOQ A;  4BQA A;  5E3O A;  2WAF A;  2L7Z A;  2F6C A;  4V2G A;  3HJE A;  5CJ9 A;  3FMS A;  5L3E A;  2R7Q A;  2XPW A;  1ZRF A;  3FXQ A;  2PN6 A;  1Z77 A;  3IKV A;  3K0L A;  2VJ5 A;  1VF9 A;  1PP8 F;  1R7J A;  2FOK A;  1MH4 A;  2LC2 A;  3W2V A;  3L1P A;  4UB6 C;  4DZP A;  1TNT A;  4AIH A;  4B4C A;  2VOP A;  2DA5 A;  1YJ9 I;  4I0A A;  1IRX A;  3DKX A;  5BQT A;  3RPU D;  5L3F A;  1R1V A;  2ZC2 A;  3RIR A;  4XKC A;  2X6O A;  2A05 A;  2X1C A;  4A12 A;  3JCU C;  4OU0 A;  2BY1 A;  3WTU C;  4KUM A;  3UR3 C;  2J5O A;  1CGP A;  3C2H A;  1FSH A;  1RC9 A;  3QP5 A;  2D2W A;  5JFR A;  1Z1D A;  4HX4 A;  5D8K B;  2QSF X;  1N25 A;  2ID6 A;  2FU4 A;  3FBI B;  1KQ0 A;  2DQL A;  2UXN A;  3IH4 A;  3JRB A;  1G3Y A;  4EEF G;  1LUJ B;  2XAH A;  1MSF C;  1SVO A;  1ZEL A;  2CUZ A;  3F6O A;  3BZK A;  4AVP A;  4C3J J;  3HOZ J;  2VQH A;  2L9R A;  3DBR B;  3FMQ A;  3OYK A;  1MKM A;  4G9Y A;  1X2M A;  2XRO A;  3GCM A;  3H5A A;  1Y8R B;  3OYJ A;  3A1Y A;  3GME A;  4C3H J;  2PJP A;  2DFI A;  1D8K A;  1WJA A;  1FY7 A;  5FKK A;  4KA4 A;  2G0E A;  1OPC A;  2OTJ I;  1AHD P;  3ERM A;  5JVG F;  2IJL A;  4G94 A;  4IRH A;  3ECH A;  1CF7 B;  1IJW C;  4WX9 A;  2O0Y A;  3IWZ A;  1DPR A;  3RYR A;  3I54 A;  5JHF A;  3BCB A;  2V1N A;  1TWF J;  2K27 A;  5K1Y A;  4I2O A;  5JLW A;  5ILV A;  1KGS A;  4MIM A;  3G2B A;  4ABZ A;  4BBR J;  5DUK A;  3H1C A;  2VKD A;  4MQV A;  1YOV B;  2EV5 A;  1BA5 A;  4A69 C;  2EIJ H;  2B9S A;  4AD9 A;  3SEZ A;  4BE0 A;  1J0R A;  2Q0O A;  3HTS B;  4EJT A;  2CUJ A;  3NWS A;  3KE2 A;  1TTY A;  2ZCW A;  2O3F A;  2DCE A;  4G7O F;  1NH3 A;  2JA7 J;  2R4G A;  3DPU A;  1XGM A;  4BDZ A;  3HSF A;  3RI4 A;  4EMS A;  4QIW N;  4ENN A;  5DDG A;  2M7A A;  4UUT A;  2JA2 A;  3CLO A;  2P7V B;  4O3M A;  3K9T A;  4AU7 A;  1A5J A;  1GHC A;  2CQQ A;  3FXK A;  2M3A A;  3G3Z A;  1DUX C;  2JVG A;  2OTL I;  5FKN A;  3JSO A;  3E6B A;  2L02 A;  2JZY A;  3C3W A;  1XCB A;  1FC3 A;  3EDP A;  1Z91 A;  4ENM A;  1QQI A;  4IPA A;  3RTR A;  5ILU A;  4WXC A;  3V7S A;  5BS6 A;  2BY0 A;  4P9U A;  5K7Z A;  4G7H F;  3CJQ B;  3AL0 B;  1P7J A;  1OYY A;  1E2X A;  3F8F A;  3GTQ J;  2RNG A;  2K4B A;  3QYB A;  3FF5 A;  1JXS A;  3CJT B;  1MIJ A;  4FCY A;  4I09 A;  3MZY A;  1K83 J;  2A68 F;  3OIO A;  1FT9 A;  2IGN A;  2DMN A;  1SFK A;  4WCG A;  2IA2 A;  2FSW A;  2H6B A;  2Y75 A;  4YII A;  5J1Y A;  2Y0S N;  5FLX Z;  1X4P A;  1FSE A;  2COM A;  2Y9Y A;  2UZK A;  4PJL A;  2ZSI B;  1O4X A;  3S16 J;  3MAJ A;  1AKH A;  1S7E A;  1MMS A;  2PG4 A;  3GO5 A;  4FHT A;  4DQ2 A;  2R7U A;  3A0H C;  3EUK L;  4QSH A;  5GAH J;  1WJE A;  1SD5 A;  2VBY A;  2QCO A;  1WI3 A;  3OYE A;  3X2Q H;  2HU9 A;  1JUM A;  2PJR A;  4XLE A;  2QEN A;  1ZG3 A;  3I58 A;  3JW4 A;  3P9K A;  2OC6 A;  4RAF A;  3ABT A;  2Z5U A;  3KP3 A;  3GTK J;  2EZH A;  1I3Q J;  1F36 A;  4EVI A;  3LWF A;  4L9N A;  3DEU A;  5E1Z B;  3QPT A;  3FXO A;  2RDP A;  2ZFU A;  2E60 A;  2LKS A;  3Q0V A;  1TL8 A;  1SFU A;  1B72 A;  3EUH C;  4IHV A;  2CO5 A;  4M73 A;  2ECC A;  2R5Z A;  1UHW A;  4MTE A;  1NTC A;  1WGX A;  2ISZ A;  4RAZ A;  3F8M A;  1LEB A;  1W1W E;  2GIZ A;  4KN4 X;  2H09 A;  4M74 A;  1JJ6 C;  2H27 A;  2HDW A;  3ABM H;  4BHP A;  4XOT A;  1PUF A;  1WRJ A;  3BTJ A;  3I64 A;  5A2Q Z;  1Z67 A;  2Z99 A;  3H36 A;  3CES A;  2MH9 A;  2BOL A;  2YX7 A;  4A6E A;  4H0E A;  3TED A;  2K40 A;  1VQP I;  3DLA A;  4DW6 A;  3FHZ A;  4U0W A;  4HLX A;  2EV0 A;  3TDU C;  1LEA A;  1NK3 P;  2KDO A;  1D0Z A;  1SMT A;  5BNG A;  2ZFW A;  2KIF A;  2ZXI A;  3R6S A;  1JTX A;  3GTO J;  2O61 A;  4EAT A;  1EH6 A;  4FX0 A;  1ZK8 A;  2M8E A;  5LLQ A;  4BL0 B;  1Y56 A;  3L00 A;  3KCC A;  4KT5 C;  3HOX J;  3OS2 A;  4HSR A;  3S1R J;  3JRH A;  3WGI A;  3PL8 A;  2AHQ A;  3DU6 A;  1QPI A;  1HW1 A;  4YG2 F;  5HLG A;  3E7L A;  2RQQ A;  3SFI A;  3H3Z A;  2PMZ A;  2DT5 A;  2ELJ A;  2L7M P;  2VBZ A;  3HYI A;  1HDP A;  2JWT A;  2HPI A;  1T38 A;  3AG1 H;  3WOD F;  2IP2 A;  3MKZ A;  1ZAO A;  4GYG A;  3ROU A;  5F04 A;  1EF4 A;  2OCE A;  4A3C J;  2F5F A;  3IAS 2;  2BXY A;  2VXZ A;  1XMA A;  3KP7 A;  4KIT B;  2ZJQ F;  3PQJ A;  2XSJ C;  1XX5 A;  5LGN A;  3WTX C;  1J5Y A;  4JQF A;  1QHH D;  4DYQ A;  3BJO A;  5KK1 A;  2EA2 A;  2DPD A;  1IRG A;  3HZJ A;  2QYO A;  3HDD A;  3RPU A;  3JTG A;  1TBX A;  3R60 A;  3K4B A;  3H3V K;  3FKI J;  2PMU A;  1YW9 A;  1BI3 A;  3VOD A;  2LD5 A;  2CSO A;  3WTV C;  4ESB A;  3BTL A;  5TRD A;  4CCM A;  4LG0 A;  5HOO A;  2DOE A;  2M34 A;  2L4A A;  1YJW I;  2BY2 A;  3HOU J;  4ZZL A;  3KZY A;  5ILS A;  1LNW A;  4O5V A;  1H88 C;  1P6R A;  2DA7 A;  2IRF G;  1IXS B;  5K5O A;  5DCM A;  1STZ A;  3RYP A;  2EA4 A;  2VIX A;  2I5U A;  2LMD A;  3GUD A;  3J7Z I;  1ZRC A;  4DZJ A;  2D5V A;  1I27 A;  2ECB A;  4LLN A;  1MJ9 A;  1JKQ C;  3HRT A;  4KIG A;  4W1U A;  1TQM A;  2ZME B;  4BE2 A;  4PDK A;  1E17 A;  3BCA A;  2E36 A;  2E7X A;  2G9W A;  4OOI A;  1WHU A;  3QU6 A;  1WPK A;  3LSG A;  4WF2 A;  4CYC A;  3ZMZ A;  1MD0 A;  4HQM A;  3PSI A;  4BJ5 C;  2P5L C;  1DDN A;  4II2 A;  4BQN A;  5GAE J;  3DU5 A;  2K3F A;  1VQ7 I;  3JSP A;  5CLS A;  2KP6 A;  3SZG A;  3SZP A;  4D1Q A;  2DA6 A;  1OR7 C;  1W7P B;  3OYC A;  5J6X A;  5CPR B;  2HOS A;  1VQ6 I;  1EH8 A;  2H8R A;  4A3B J;  4YIF A;  4UUS A;  2DDB A;  4HEA 2;  3M8F A;  2LNB A;  3R61 A;  1XS9 A;  2YPR A;  4KFC A;  2JA6 J;  3E6M A;  2LYC A;  1Z6T A;  1MW7 A;  1GVD A;  2HKO A;  3WE3 A;  1C0W A;  4P9F A;  3S1Q J;  4M3G A;  2H94 A;  4E6K G;  3HG9 A;  4A5N A;  3F23 A;  1K78 B;  1ODD A;  2LP0 A;  5FLV A;  1BJA A;  4A2U A;  2Q2E A;  2C6Y A;  5HS8 A;  2EFW A;  4BEH B;  1ZLK A;  2D1H A;  5L3C A;  4BXX J;  1WH5 A;  1FJL A;  3ZPL A;  4IOA F;  3QPL A;  3JRE A;  1Z7U A;  4FX4 A;  1Q1H A;  4QLC U;  3Q0U A;  1KU9 A;  2GOM A;  2WAQ A;  3BR0 A;  3GLX A;  2QGU A;  3O6B B;  4R8H A;  1DP3 A;  2VI6 A;  2P6S A;  2CW7 A;  3L7W A;  3COA C;  3U1K A;  4HNV A;  1REP C;  3LQQ A;  4M6X A;  4BHB A;  2VC0 A;  2CQX A;  2MBF A;  3VWB A;  2HXI A;  1RNL A;  2V6C A;  2W4S A;  3CCM I;  2DMP A;  2CQN A;  4TV7 A;  3SDB A;  4WXH A;  2R7O A;  3BP8 A;  4ESJ A;  1LPQ A;  3DBH B;  4IRI A;  2XPU A;  4I98 B;  2W1O A;  1G4D A;  1W0T A;  1R6R A;  3NAU A;  1V5G A;  2MD5 A;  2EFP A;  4U7D A;  2KRH A;  3ZP5 A;  1YHQ I;  1O3Q A;  3EYI A;  4RS8 A;  2DFE A;  2ZNY A;  3HM5 A;  3SDG A;  1VQ8 I;  3RSN A;  2ISY A;  1Y0U A;  1JGG A;  1OYI A;  2DK8 A;  4M6Y A;  1ZTR A;  2F5D A;  3A4C A;  4FE4 A;  4CSW A;  2FBI A;  3RZO J;  1XSX A;  4RM2 A;  1S9H A;  2HXO A;  4BDY A;  2NYX A;  5EG0 A;  2K9N A;  5IT9 Z;  3K4C A;  3H5R A;  2XC7 A;  1HW2 A;  3HUG B;  2DBB A;  4BYY A;  2DI3 A;  2Z3Y A;  2UXX A;  1VQO I;  3KET A;  2VT2 A;  2LY1 A;  2CUF A;  1UHM A;  1DGR M;  4XLN F;  1R58 A;  1I50 J;  1SFE A;  4P96 A;  2PLY A;  1IUY A;  3L9F A;  3RZD J;  1WZ2 A;  3P9I A;  4IQJ A;  1LB2 A;  5KAI C;  2LBF B;  2R7R A;  1BW6 A;  3DF8 A;  4RBO A;  3PJR A;  5TGT A;  2UUZ A;  3S3M A;  3NWT A;  3CCV I;  3CCU I;  2TDX A;  1BI1 A;  2P6T A;  3KEQ A;  1X1C A;  1MSE C;  5FB2 A;  1TWA J;  3BWG A;  1VQL I;  3WGG A;  4OAY A;  1RI7 A;  2NAZ A;  2BXZ A;  3ZMD A;  2JN6 A;  4FQG A;  2P5K A;  3JR9 A;  2BV6 A;  2K86 A;  4EJW A;  2HOE A;  1T95 A;  1B9N A;  3BPX A;  3S1N J;  5M5X J;  4NQW A;  3J81 K;  4NC8 A;  3MVP A;  1Z05 A;  3LL7 A;  1IC8 A;  3OV8 A;  3CMM A;  3PUB A;  1FLI A;  4I7H A;  2QQB A;  1QPM A;  3GXO A;  2F5C A;  1YG2 A;  2R7F A;  3HRM A;  3OYG A;  2VAS A;  1MMG A;  4XID A;  5E1X A;  3K70 D;  3F22 A;  3GZN B;  5IYD J;  5DCF A;  3B02 A;  2XKO A;  2KRF A;  3GTJ J;  2P0W A;  3KPH A;  3DKY A;  3ESW B;  3CC4 I;  2EB7 A;  3VDX A;  2GWR A;  3D5S C;  2JQ7 A;  3E1S A;  1JT0 A;  4M9X A;  2QVO A;  1MNE A;  1QBJ A;  4EQQ A;  4XR6 A;  4HBL A;  3WU0 A;  4DYR A;  4U87 A;  3AL0 C;  4BXU A;  4LK0 F;  3K69 A;  2EIN H;  3KX2 A;  1RRJ A;  4IZZ A;  1V4R A;  4X6A J;  2JT1 A;  3FBN B;  2F4M B;  1ACI A;  1SD6 A;  1QZZ A;  2VLA A;  4MEX F;  1V5F A;  2VE8 A;  1A31 A;  4BQQ A;  1QVT A;  2VKV A;  2XGC A;  5H2F C;  2LR8 A;  2W82 A;  3F3X A;  5EYR A;  4A3M J;  5IP6 A;  1P4W A;  1R23 A;  1Y0N A;  1YS7 A;  3DFG A;  3E5U A;  5FD6 A;  1SAX A;  2Q1Z B;  1JI8 A;  1TQP A;  1R36 A;  1TZL A;  5CQG A;  1F43 A;  3B73 A;  3PNV A;  4J01 A;  4EGZ A;  3S3N A;  5AIQ A;  3NQO A;  5F1R A;  3QOE A;  1W36 D;  1K4S A;  2Y69 H;  5FD5 A;  3W6J B;  1UJ8 A;  2XB0 X;  3FK7 A;  1FBU A;  1ZYR F;  4M9Z A;  2L9V A;  1KZH A;  3PUF A;  1OKR A;  2JPB A;  4JP0 A;  3K10 A;  2KFD A;  4BBS J;  2R7X A;  4MFD A;  4NB5 A;  4IHX A;  4KT6 A;  1T56 A;  2CS3 A;  1N77 A;  1B4A A;  4M3F A;  4RM3 A;  4HDU A;  1Z21 A;  2CQ7 A;  2OZ6 A;  3KP5 A;  2XAJ A;  4C2M J;  5HLH A;  4Q4Z F;  4L0Y B;  4XKV A;  1U0J A;  3ZMT A;  3LOC A;  4ENJ A;  3QU3 A;  3BT9 A;  5ICG A;  2CV1 A;  2LF7 A;  3DQV C;  1TQI A;  1SD4 A;  5FRM A;  4GGG A;  5DTD A;  1X3Z B;  3VEP A;  1LDK B;  4Y13 A;  3LST A;  5IP7 J;  3H5N A;  3CUQ B;  1U78 A;  4PJN A;  3OOU A;  4W97 A;  1SC7 A;  2HEO A;  5KHD A;  3R0J A;  3BLY A;  3D0S A;  4A3K J;  1K61 A;  6PAX A;  4WWC A;  2M45 A;  1Z7L A;  3CO6 C;  3W2A A;  2IS1 A;  3ABK H;  4HST A;  1FIA A;  2MW8 A;  4CYD A;  4LIV A;  3HRU A;  3T1B A;  3V4G A;  4E70 A;  4I6Z A;  1XTA A;  2W00 A;  4B09 A;  2DOA A;  2V1U A;  4LIT A;  1FPQ A;  4UNO A;  2DW4 A;  5LD2 C;  1FZP B;  4XRM A;  4ZYD A;  2ZSH B;  2DOD A;  1U3E M;  4E7Z A;  3S32 A;  2PJR B;  1DPU A;  3NEU A;  1YQA A;  5EJC A;  1OQY A;  3HOY J;  3QRF F;  1A6I A;  3OL3 A;  3OS0 A;  3OYB A;  3HPH A;  3B6A A;  1ORK A;  5J1R A;  1J2X A;  5IT9 K;  5HS7 A;  3LFU A;  2RC4 A;  3DTE A;  5GPC A;  2W24 A;  2JUC A;  3ZQI A;  3MZH A;  1V54 H;  3QOD A;  2YUS A;  2Y48 A;  4I01 A;  1IV8 A;  2CW0 F;  2M8G X;  4CHU A;  2OZU A;  3CCJ I;  3S3O A;  3RPQ A;  1SAN A;  2ESH A;  3I59 B;  2V79 A;  2XIG A;  4HG2 A;  1U9O A;  5J40 A;  3HOT A;  2V9K A;  3M7G A;  3LA7 A;  3CJN A;  1OIS A;  2JMW A;  2DJI A;  5B1A H;  4GO1 A;  4GYI A;  1MMD A;  2GXB A;  4NNJ A;  2KHM A;  2CJJ A;  3OIP A;  2DAO A;  1ZH5 A; 
#chains in the Genus database with same CATH homology
 3TQN A;  3L2C A;  4LFU A;  1ON1 A;  3WTW C;  2DU9 A;  4Q48 A;  3WTY C;  1B59 A;  3BJ6 A;  2GA2 A;  3KP6 A;  1PUE E;  4ZZD A;  5DEQ A;  2CFX A;  3JTH A;  1BIB A;  2KIM A;  2LDU A;  2FXA A;  2MLG A;  3EUH A;  1L3L A;  2VN2 A;  3HHG A;  1W5S A;  5BPI A;  1ON2 A;  2QBY A;  4ASN A;  1O7L A;  2JTV A;  5HDG A;  4CO8 A;  4A0X A;  3I71 A;  4XRF A;  1IN5 A;  3NRV A;  1B9M A;  2FEZ A;  4LLL A;  2HYG D;  1RUN A;  4F7Z A;  5LEJ A;  1MJB A;  3J80 Z;  3CTA A;  3O2P E;  2G7H A;  2UWM A;  4LG0 B;  3IKT A;  4LB5 A;  2HGC A;  1YFH A;  2OAZ A;  1HKS A;  3WTT C;  4XSX F;  3KLO A;  5DCM B;  4OIQ F;  3O3K A;  3IHU A;  1S7A A;  3HSE A;  1ZGJ A;  2XAG A;  4I02 A;  1WQ2 A;  2CYY A;  2IVM A;  2CGP A;  2F5E A;  2WWY A;  1SMY F;  1B6A A;  3BY6 A;  1HQC A;  2ESN A;  1H9G A;  3PFI A;  2EK5 A;  2IT0 A;  5D5W B;  2FBK A;  2CG4 A;  3FM3 A;  3G73 A;  5FO5 A;  2VBW A;  3WTS C;  3S2W A;  3QAH A;  3SQN A;  5LHG A;  4LGW A;  4G6D A;  4NHJ A;  1XGO A;  5CVU A;  3EET A;  3BZ6 A;  3H3U A;  3KP2 A;  3WGH A;  3WU1 B;  1F9N A;  3FXU A;  5D4R A;  2AS5 F;  2R7D A;  1OR7 A;  2HTS A;  4I0B A;  1K79 A;  1SFX A;  2EFN A;  2YR2 A;  4IHT A;  3E6C C;  5E1W A;  3TO6 A;  1U5T B;  3GFM A;  4L5I A;  3JAM Z;  3EQL F;  4HAM A;  3F21 A;  2XAQ A;  4MGR A;  5LHI A;  4S04 A;  5IT3 A;  3TO7 A;  1ZRD A;  2VE9 A;  1R1U A;  2BE5 F;  2QWW A;  2RQP A;  4UVB A;  3HIF A;  4HX8 A;  1S3J A;  4WK8 F;  2XV4 S;  1AWC A;  3HTU A;  2L01 A;  3ZMU A;  1WSU A;  1JHF A;  1WWX A;  5E8I A;  1MDM A;  1TW3 A;  4Q5S F;  4EJO A;  1KU7 A;  4XLP F;  2GA1 A;  4XSZ F;  1YO5 C;  2P7C B;  4EM1 A;  4RAY A;  2GIV A;  2PEX A;  3QOP A;  4LK1 F;  3QP6 A;  3K1P A;  4KMU X;  1LJ9 A;  4K2E A;  2BGC A;  4BAY A;  2XAS A;  1UB9 A;  2FA5 A;  2PMH A;  3I53 A;  2Z33 A;  5FFZ A;  4BHC A;  1B1B A;  1W7P D;  3VOE A;  3V8L A;  1F4K A;  3WE2 A;  2BYV E;  4YFX F;  5CYV A;  5HVQ C;  3ECO A;  1EH7 A;  3W6K B;  1W4M A;  2DO7 A;  1FYK A;  3CUQ C;  3GW2 A;  1TW2 A;  3Q5F A;  1XSD A;  4R79 A;  2O6G E;  1K6O A;  2VOD A;  4EJV A;  4PGH A;  2XKP A;  2OQG A;  3ZMS A;  3V7C A;  1I5Z A;  1TLH B;  2ZXJ A;  1JHH A;  5FLX K;  4L5J A;  1YLF A;  2WC2 A;  3ZMV A;  5D5V B;  2VON A;  4IF4 A;  1OYW A;  3T8R A;  4CIC A;  1O3S A;  1IN8 A;  4JBA A;  4HX7 A;  1FBS A;  2AXL A;  2OQR A;  1BC7 C;  5LRR A;  3GWZ A;  4FT8 A;  4G7Z F;  3R0A A;  3IL2 A;  4ZYH A;  4KN7 X;  4OIN F;  1IZ1 A;  4L0Z B;  1P92 A;  4RB0 A;  4ENK A;  4RGU A;  1U6G A;  4EV0 A;  3N4M A;  1UCR A;  2CQK A;  5CVI A;  5F6F A;  2ELH A;  2B0L A;  4ZYE A;  3KZZ A;  2PBI A;  5L3G A;  2G7U A;  3CDH A;  5JHU A;  3ELK A;  5A2Q K;  3LA3 A;  1H0M A;  5HDN A;  1XD7 A;  3QPH A;  3F8C A;  4KNY A;  1BM9 A;  4HDV A;  2DPU A;  1ZN2 A;  4UVC A;  2HTJ A;  2FBH A;  1EV7 A;  3RDI A;  3RKW A;  2OBP A;  2K7L A;  3M9A A;  2RV8 A;  4JK1 X;  1TNS A;  2P8T A;  5LHH A;  1QNT A;  2EV6 A;  5L3B A;  4M9S A;  4EM2 A;  3IRQ A;  1IAW A;  3REO A;  5DV5 A;  2JRT A;  3MFK A;  3D5L A;  2A6H F;  3K1M A;  2STW A;  1WKM A;  1ULY A;  2GQQ A;  2NNY A;  4HQE A;  2V1X A;  2WV0 A;  1JE8 A;  3HRS A;  1F5T A;  2L54 A;  4PZJ A;  3VB2 A;  1ZAR A;  2A5Y B;  2L3D A;  1FP2 A;  2P4W A;  4RGX A;  2XHK A;  5BMZ A;  4U0Y A;  2HS5 A;  2FNP A;  3M8E A;  2HQR A;  2FE3 A;  4QWQ A;  4YFK F;  5L3D A;  2MLK A;  2QQA A;  1XMK A;  1W5T A;  1HBX G;  5DD8 A;  4IRG A;  4G6Q A;  5JI6 A;  3GZ5 A;  1IN7 A;  3ERE D;  2BEO A;  1LDJ A;  5E17 F;  3LA2 A;  4LLG F;  4LD5 A;  2FNA A;  2ZBK A;  3U1D A;  1XGS A;  2ACJ A;  2KIU A;  3E97 A;  1RIO H;  1X3U A;  3IC7 A;  2XGX A;  2VOO A;  1IN4 A;  2IA1 A;  3FMR A;  1AOY A;  4CZZ A;  5D4S A;  1XSV A;  1BN5 A;  1W7P A;  2XVC A;  3DKW A;  1A04 A;  1R5G A;  1QO0 D;  2QUF A;  2RGV A;  3GYH X;  3T5X A;  3T8T A;  3ZN0 A;  1P2F A;  2YU3 A;  1U5T C;  1I6X A;  2VC1 A;  3N97 A;  5ICE A;  1KU2 A;  1K78 A;  1IXC A;  5HLI A;  3LAP A;  4S05 A;  4YFN F;  5H6Q A;  4KDP A;  1G6N A;  4HOB A;  2GAU A;  4OIP F;  5H20 A;  1ZG5 A;  2Q8K A;  2QM3 A;  3BDD A;  3MCZ A;  5F64 A;  4A0Y A;  5CVR A;  3BJA A;  5EEG A;  3EYY A;  2QQ9 A;  3LQR A;  4OMY A;  2M87 A;  1S29 A;  2M30 A;  1LVA A;  4DNC A;  5E8G A;  2FML A;  3H92 A;  3TDZ C;  3VFZ A;  3U9G A;  1KA8 A;  2E1C A;  5KVR A;  1G3W A;  1R22 A;  3IRR A;  1FP1 D;  1IN6 A;  4RB2 C;  3TO9 A;  5H6R A;  5LBQ A;  2L4M A;  2P5V A;  3GFJ A;  1YS6 A;  5E18 F;  2KJC A;  2DTR A;  1ONV A;  2BBY A;  2XUB A;  1MDM B;  5ICC A;  2MA3 A;  4LMY A;  1FX7 A;  4N9H A;  2HKX A;  2K02 A;  2JPC A;  2W85 A;  2ETH A;  4OMZ A;  4ZYG A;  1WI9 A;  5E20 A;  4O6J A;  1NHA A;  2A61 A;  4A0Z A;  3FM5 A;  3U2R A;  4M72 A;  1YIO A;  2ZO4 A;  5ED4 A;  4HF2 A;  3I4P A;  1YW8 A;  2DK5 A;  1HST A;  5D5U B;  1HXD A;  1XN7 A;  3ML6 A;  2ZJ2 A;  2D1V A;  4BNC A;  3TKY A;  4G8X A;  3SFZ A;  3OOP A;  1KQ8 A;  1JGS A;  3SHF A;  3SZT A;  3ABU A;  3ULQ B;  4HZF A;  4IHS A;  3KLN A;  1MGT A;  4R1H A;  4MEY F;  4RB1 A;  4UXN A;  4ESF A;  1YW7 A;  3CUO A;  3GX4 X;  2PQ8 A;  2E1N A;  4XBF A;  1YTY A;  2QLZ A;  3K1N A;  3KP4 A;  1V3F A;  1R00 A;  4WXD A;  5K5Q A;  4M71 A;  3FWE A;  5TJJ A;  1I1S A;  3C1D A;  4Y15 A;  2PFB A;  1U8R A;  4IXA A;  5K5R A;  2XAF A;  4GCV A;  1FYM A;  3IWF A;  3CUQ A;  1KYZ A;  2ZKZ A;  4IVN A;  4RB3 C;  4HLY A;  5FFX A;  1ZHF A;  2W84 A;  5CVJ A;  1T98 A;  2O03 A;  4MTD A;  4AIJ A;  1J7K A;  3Q9V A;  4BH9 A;  2DQR A;  2YSR A;  2W57 A;  1QZY A;  3SXY A;  2Y0M A;  1XGN A;  1O3R A;  2M5W A;  4A6D A;  1OMI A;  2X4H A;  1HW5 A;  3WG9 A;  4D0P A;  4A5M A;  5EEH A;  3E3V A;  1J59 A;  1O3T A;  4N9I A;  4L18 B;  5ICF A;  4U7B A;  3I59 A;  2RKH A;  3GEZ A;  3HHH A;  5LEK A;  1IF1 A;  4OIR F;  2FF4 A;  3P7N A;  4MHG A;  2HQN A;  3F8N A;  4HV5 A;  1ZRE A;  1L0O C;  2RN7 A;  1S6L A;  2IW5 A;  2A6E F;  1F1Z A;  1PP7 U;  1MJA A;  1O7F A;  2IA0 A;  1R5H A;  3R4K A;  4HF0 A;  2HFH A;  3J80 K;  2JSC A;  1XB4 A;  3F8B A;  2STT A;  4HW0 A;  2MH2 A;  4L9T A;  5D8L B;  4EJU A;  5AON A;  4AIK A;  2V9V A;  1P4A A;  4UVA A;  3J81 Z;  3V7R A;  2NRA C;  4PGG A;  1G3T A;  1J9I A;  1CF7 A;  4Z2Y A;  3AAF A;  1HSJ A;  2LF8 A;  4UV9 A;  1KYW A;  3T0Y A;  3CO7 C;  1BIA A;  5J8F A;  2NNN A;  2DLL A;  1LDD A;  1ZG1 A;  3F6V A;  2EFO A;  2LKP A;  1ZGA A;  3LFK A;  3BRO A;  1GXQ A;  3E5Q A;  4U0V A;  1FBQ A;  5J8C A;  2H6C A;  5BPD A;  1D5V A;  2O8X A;  4P55 A;  1H9T A;  1HKT A;  3K2Z A;  4KIC A;  1GXP A;  1BC8 C;  2HDC A;  2WTE A;  1Z6R A;  4GXO A;  2RVC A;  1IRF A;  3TOB A;  5FGM A;  2E7W A;  1UST A;  1MZB A;  1P4X A;  3GF2 A;  4N0B A;  2FMY A;  1KU3 A;  1UFM A;  3L09 A;  2W25 A;  4LJZ F;  5CVV A;  1FYL A;  1SD7 A;  1FWZ A;  4Y17 A;  2Z9O A;  2VBX A;  3E5X A;  4KMF A;  3C18 A;  1RZ4 A;  5LGU A;  3V8J A;  1IXR C;  3KFW X;  1VTN C;  3DV8 A;  2A69 F;  3J7A O;  1BI2 A;  3TGN A;  4RGR A;  5D5X B;  4CXF A;  1S7O A;  1O57 A;  5DD4 A;  2J5P A;  1QGP A;  3F72 A;  2NS0 A;  5HDK A;  1S8N A;  3JAM K;  1USS A;  4EM0 B;  1XDS A;  5LRS A;  3ISP A;  3GZ6 A;  4HV6 A;  3WTZ A;  2KJB A;  4AWX B;  3MQ0 A;  2ZNZ A;  1U5T A;  2EJR A;  2HWV A;  3ZN1 A;  2LSO A;  3HSR A;  1XDU A;  1LQ1 A;  1RUO A;  1G3S A;  1I1G A;  3DPL C;  4ETS A;  3FX3 A;  4L9J A;  2XRN A;  4OIO F;  4HYE A;  3HOS A;  4L9V A;  4UHT A;  4CGZ A;  1FOK A;  2A3S A;  3TOA A;  2QBY B;  2CWE A;  3DXJ F;  4LB6 B;  4CDG A;  1PDN C;  2HR3 A;  1D3Y A;  4KIB A;  4P5O A;  5DUI A;  3GFI A;  5JR3 A;  2MC3 A;  4MNU A;  1YYV A;  2VT3 A;  1DP7 P;  1R1T A;  5BOX A;  3FXR A;  2EWN A;  3MEX A;  1BOA A;  1HKQ A;  3M1E A;  5LGT A;  3GFL A;  1BBY A;  1T0F A;  3GVA A;  1K7A A;  2EFQ A;  3RKY A;  2RNJ A;  5ERI A;  2M1B A;  4HF1 A;  3MWM A;  3DPT A;  4KIF A;  2QZ8 A;  4MQ9 F;  2K4J A;  1T2K A;  4HA8 A;  2V1D A;  3RKX A;  2ZME A;  3FZV A;  3PQK A;  2FQ3 A;  3KEO A;  2IPQ X;  1FNN A;  3I5U A;  4U88 A;  5DYM A;  3RJP A;  2F2E A;  1U2W A;  4B8X A;  2FRH A;  3DP7 A;  3E6D A;  1T6S A;  3LAJ A;  3I0T A;  2R3S A;  5D6F A;  3Q9S A;  2X0L A;  2A07 F;  2PI0 A;  2GXG A;  5AIP A;  5D6E A;  2ADU A;  1BI0 A;  1Z9C A;  4UUV A;  5JVT A;  1T39 A;  3ZQ7 A;  1J75 A;  3P9C A;  4EGY A;  3BPV A;  1ZLJ A;  2HYF A;  4ON0 A;  3V8K A;  4KYW A;  2OU2 A;  1XCV A;  4RGS A;  2D45 A;  1D8J A;  1IW7 F;  4UV8 A;  5HS9 A;  4IJA A;  2HZT A;  2GZW A;  2OD5 A;  4Q47 A;  1GVJ A;  4PCQ A;  2OA4 A;  1KQ9 A;  3C7J A;  2KKO A;  4ZH4 F;  2YX4 A;  3HUG A;  3BOQ A;  4BQA A;  5CJ9 A;  3FMS A;  5L3E A;  1ZRF A;  3FXQ A;  2PN6 A;  3IKV A;  3K0L A;  1PP8 F;  1R7J A;  2FOK A;  1TNT A;  4AIH A;  2VOP A;  4I0A A;  5BQT A;  5L3F A;  1R1V A;  3RIR A;  4A12 A;  4OU0 A;  3WTU C;  4KUM A;  2J5O A;  1CGP A;  1FSH A;  3QP5 A;  2D2W A;  5JFR A;  1Z1D A;  4HX4 A;  5D8K B;  2FU4 A;  1KQ0 A;  2DQL A;  2UXN A;  1G3Y A;  2XAH A;  3F6O A;  4AVP A;  3FMQ A;  1MKM A;  4G9Y A;  2XRO A;  2PJP A;  2DFI A;  1D8K A;  1FY7 A;  4KA4 A;  1OPC A;  2IJL A;  4G94 A;  4IRH A;  3ECH A;  1CF7 B;  4WX9 A;  2O0Y A;  3IWZ A;  1DPR A;  3RYR A;  3I54 A;  2K27 A;  5K1Y A;  4I2O A;  5ILV A;  1KGS A;  5DUK A;  4MQV A;  2EV5 A;  4AD9 A;  1J0R A;  2Q0O A;  3HTS B;  4EJT A;  3KE2 A;  1TTY A;  2ZCW A;  2O3F A;  4G7O F;  1XGM A;  3HSF A;  3RI4 A;  4EMS A;  4ENN A;  5DDG A;  3CLO A;  2P7V B;  4O3M A;  3K9T A;  1GHC A;  3G3Z A;  1DUX C;  3JSO A;  3E6B A;  2L02 A;  2JZY A;  3C3W A;  1XCB A;  1FC3 A;  3EDP A;  1Z91 A;  4ENM A;  1QQI A;  4IPA A;  3RTR A;  5ILU A;  4WXC A;  3V7S A;  5BS6 A;  4G7H F;  4P9U A;  1OYY A;  1E2X A;  3F8F A;  2K4B A;  3FF5 A;  1JXS A;  4I09 A;  3MZY A;  2A68 F;  1FT9 A;  4WCG A;  2IA2 A;  2FSW A;  2H6B A;  2Y75 A;  4YII A;  5FLX Z;  1FSE A;  2COM A;  2UZK A;  3MAJ A;  2PG4 A;  3GO5 A;  4FHT A;  4DQ2 A;  1SD5 A;  2VBY A;  2QEN A;  1ZG3 A;  3I58 A;  3JW4 A;  3P9K A;  3ABT A;  2Z5U A;  3KP3 A;  4EVI A;  3LWF A;  4L9N A;  3DEU A;  5E1Z B;  3QPT A;  2RDP A;  1SFU A;  2CO5 A;  4M73 A;  1UHW A;  4MTE A;  2ISZ A;  4RAZ A;  3F8M A;  1LEB A;  4KN4 X;  2H09 A;  4M74 A;  2H27 A;  4BHP A;  1WRJ A;  3I64 A;  5A2Q Z;  2Z99 A;  2MH9 A;  2YX7 A;  4A6E A;  4H0E A;  3FHZ A;  4U0W A;  4HLX A;  2EV0 A;  3TDU C;  1LEA A;  1SMT A;  2ZFW A;  2KIF A;  3R6S A;  2O61 A;  1EH6 A;  4FX0 A;  2M8E A;  5LLQ A;  3L00 A;  3KCC A;  4KT5 C;  3WGI A;  1HW1 A;  4YG2 F;  5HLG A;  3H3Z A;  3HYI A;  2DT5 A;  2VBZ A;  1T38 A;  3WOD F;  2IP2 A;  1ZAO A;  4GYG A;  3ROU A;  2F5F A;  2VXZ A;  3KP7 A;  1XMA A;  3PQJ A;  5LGN A;  3WTX C;  1J5Y A;  4JQF A;  3BJO A;  5KK1 A;  2EA2 A;  2DPD A;  1IRG A;  2QYO A;  3RPU A;  3JTG A;  1TBX A;  3R60 A;  2PMU A;  1YW9 A;  1BI3 A;  3VOD A;  2CSO A;  3WTV C;  4ESB A;  5TRD A;  4LG0 A;  5HOO A;  2L4A A;  4ZZL A;  3KZY A;  5ILS A;  1LNW A;  4O5V A;  1P6R A;  2IRF G;  1IXS B;  5K5O A;  5DCM A;  1STZ A;  3RYP A;  2EA4 A;  1ZRC A;  4LLN A;  3GUD A;  1I27 A;  1MJ9 A;  3HRT A;  4KIG A;  1TQM A;  2ZME B;  4PDK A;  1E17 A;  2E7X A;  2G9W A;  4OOI A;  3QU6 A;  4WF2 A;  3ZMZ A;  1MD0 A;  4HQM A;  2P5L C;  1DDN A;  3JSP A;  5CLS A;  3SZP A;  1W7P B;  5J6X A;  1EH8 A;  4YIF A;  3M8F A;  2LNB A;  3R61 A;  2YPR A;  4KFC A;  3E6M A;  1Z6T A;  2HKO A;  3WE3 A;  1C0W A;  4P9F A;  2H94 A;  4A5N A;  3F23 A;  1K78 B;  1ODD A;  1BJA A;  4A2U A;  2Q2E A;  2C6Y A;  5HS8 A;  2EFW A;  1ZLK A;  2D1H A;  5L3C A;  3ZPL A;  1Z7U A;  4FX4 A;  1Q1H A;  4QLC U;  1KU9 A;  4R8H A;  3GLX A;  3O6B B;  2P6S A;  3COA C;  3L7W A;  1REP C;  4BHB A;  3LQQ A;  4M6X A;  2VC0 A;  2MBF A;  1RNL A;  2V6C A;  4TV7 A;  4WXH A;  3BP8 A;  4ESJ A;  4IRI A;  4I98 B;  1G4D A;  2MD5 A;  2EFP A;  4U7D A;  3ZP5 A;  1O3Q A;  3EYI A;  4RS8 A;  2ZNY A;  2ISY A;  1Y0U A;  1OYI A;  2DK8 A;  4M6Y A;  2F5D A;  2FBI A;  1XSX A;  2NYX A;  5IT9 Z;  1HW2 A;  2DBB A;  4BYY A;  2DI3 A;  2Z3Y A;  2UXX A;  3KET A;  2VT2 A;  1UHM A;  4XLN F;  1R58 A;  1SFE A;  4P96 A;  2PLY A;  1IUY A;  3L9F A;  3P9I A;  1LB2 A;  3DF8 A;  2TDX A;  1BI1 A;  2P6T A;  3KEQ A;  5FB2 A;  3BWG A;  3WGG A;  1RI7 A;  2NAZ A;  3ZMD A;  2P5K A;  2BV6 A;  2K86 A;  4EJW A;  2HOE A;  1B9N A;  3BPX A;  4NQW A;  3J81 K;  1Z05 A;  3OV8 A;  1FLI A;  4I7H A;  2QQB A;  1QPM A;  3GXO A;  2F5C A;  1YG2 A;  2R7F A;  3HRM A;  5E1X A;  3F22 A;  5DCF A;  3B02 A;  2XKO A;  2KRF A;  2EB7 A;  2GWR A;  4M9X A;  2QVO A;  1QBJ A;  4EQQ A;  4HBL A;  3WU0 A;  4BXU A;  4LK0 F;  3K69 A;  1V4R A;  2JT1 A;  1SD6 A;  1QZZ A;  4MEX F;  2VE8 A;  3F3X A;  1P4W A;  1R23 A;  1YS7 A;  3DFG A;  3E5U A;  5FD6 A;  1SAX A;  1TQP A;  1R36 A;  3B73 A;  4EGZ A;  5AIQ A;  3NQO A;  5F1R A;  5FD5 A;  3W6J B;  1FBU A;  1ZYR F;  4M9Z A;  1OKR A;  2JPB A;  4NB5 A;  1B4A A;  4HDU A;  2OZ6 A;  3KP5 A;  2XAJ A;  4L0Y B;  5HLH A;  4Q4Z F;  3ZMT A;  4ENJ A;  3QU3 A;  5ICG A;  2LF7 A;  3DQV C;  1TQI A;  1SD4 A;  4GGG A;  3VEP A;  1LDK B;  4Y13 A;  3LST A;  3CUQ B;  1U78 A;  2HEO A;  3R0J A;  3D0S A;  6PAX A;  4WWC A;  2M45 A;  3CO6 C;  4CYD A;  3V4G A;  3HRU A;  3T1B A;  4E70 A;  4B09 A;  2V1U A;  1FPQ A;  4UNO A;  2DW4 A;  1FZP B;  4ZYD A;  1U3E M;  1DPU A;  3NEU A;  1YQA A;  3QRF F;  1J2X A;  5IT9 K;  5HS7 A;  2RC4 A;  2W24 A;  3MZH A;  2Y48 A;  4I01 A;  2CW0 F;  4CHU A;  2OZU A;  3RPQ A;  2ESH A;  3I59 B;  2V79 A;  2XIG A;  3HOT A;  3M7G A;  3LA7 A;  3CJN A;  4GO1 A;  4GYI A;  2GXB A;  2DAO A;  1ZH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...