3GFLA

Crystal structure of the st1710 mutant (r90a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRAKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gflA00
1SD7A 5LRSA 2VT3A 2MD5A 2PN6A 4L5JA 1J7KA 1HXDA 3CUQC 3KZYA 5CJ9A 5E1ZB 4BHCA 4ESFA 4RGXA 1VTNC 1HQCA 1JHFA 4RS8A 2KIUA 4UVCA 1FYMA 2AS5F 4H0EA 3E6BA 2HOEA 3V4GA 2FMYA 1U8RA 3L9FA 2RV8A 3KCCA 4LMYA 1LDDA 4FX4A 4G8XA 5E8IA 4IHSA 2DK8A 3C3WA 3W6KB 4RGRA 4BNCA 4JBAA 3WTSC 3T0YA 3I64A 3RDIA 2VE9A 2DFIA 2B0LA 2FU4A 4GGGA 5D8LB 4R1HA 2Z3YA 2UXNA 1YS6A 1QQIA 1R5GA 4OMYA 5FFZA 2GWRA 4LB6B 3F21A 1S8NA 5CLSA 2ZJ2A 1DDNA 2BBYA 3CLOA 4OMZA 2BE5F 1YG2A 5K5RA 4EM0B 4HV5A 3TOAA 3LQQA 5HDGA 4U0YA 2WV0A 2FBHA 4LB5A 1LNWA 4HDUA 4UVBA 1UFMA 4Q4ZF 3CO7C 3R60A 3I59A 1STZA 2XKOA 1K78A 4PGGA 1J0RA 3WG9A 5D5UB 4BAYA 1XSDA 1SMYF 3HHHA 4MGRA 1F5TA 4ZYEA 4A6EA 3DQVC 1U5TB 2CYYA 3FHZA 3BJAA 2WC2A 3OV8A 1ON1A 4KN7X 1RZ4A 4L5IA 4B8XA 5A2QK 2V1DA 3PQKA 2Y48A 3GZ6A 3E5XA 3G3ZA 3J81K 3EYYA 2Z5UA 1XGMA 4WXHA 1OR7A 3G73A 3KEQA 1T98A 4EJVA 3C18A 5BPDA 4P96A 3IWZA 1OMIA 2EV6A 3QRFF 1Y0UA 5HLHA 3FXUA 1EH6A 4Q48A 3RPUA 5L3GA 3BOQA 5CVRA 2F5FA 1WSUA 1FNNA 1TW2A 3EDPA 3TQNA 4ZH4F 1USTA 1FBSA 3DXJF 3ISPA 4QWQA 3ZMVA 1XDSA 4ETSA 3HRMA 4M73A 2P5KA 1FWZA 2HYGD 3GX4X 4UV9A 2VBXA 1ZG3A 1YW7A 5EEGA 4M9ZA 2E1CA 4U7BA 3J81Z 3TDZC 5HS9A 5D6FA 5K1YA 3BJ6A 1A04A 2ESNA 5F1RA 5L3EA 4L9JA 5FLXK 4MTDA 1XMKA 4XBFA 1QZYA 4RAYA 3B02A 4OINF 1Z1DA 3RKXA 2RQPA 1FSEA 5ED4A 2DT5A 2MC3A 2XKPA 1UCRA 1KYZA 1ZRFA 3EYIA 2L54A 1I5ZA 3I4PA 3GFIA 1H9TA 4G6DA 1IXCA 5E8GA 5FO5A 1LVAA 4HF0A 4L9NA 2E7WA 1I1SA 5JI6A 5BOXA 2BV6A 2BGCA 3U9GA 4S04A 5D8KB 3IRRA 2EV5A 2KKOA 3LA7A 2HQNA 4MHGA 3WTWC 1T6SA 4JQFA 2CWEA 3RI4A 1Z7UA 5DUIA 5LGTA 2DPDA 2IPQX 4A5MA 3O3KA 1FC3A 3V7RA 5L3DA 3MAJA 3CO6C 4ZYDA 1QBJA 5FD5A 3WTUC 1HW5A 2QVOA 2OA4A 5HS8A 2Y75A 2CGPA 3R61A 5E20A 2KIMA 4XLNF 5DDGA 1JXSA 3T1BA 3WU0A 3P7NA 2J5PA 1LEAA 2IA1A 3FMSA 2FNAA 1FP1D 1ONVA 3NEUA 4B09A 4ON0A 2W25A 2W85A 2P6SA 4IJAA 4IHTA 4G7HF 3ABTA 2CW0F 1I6XA 2UWMA 1F1ZA 3DP7A 3F8NA 3BWGA 1GXQA 1GVJA 2VC0A 3VFZA 1P4WA 2PEXA 2H09A 3M1EA 3BP8A 1FZPB 3SZPA 4P9UA 1P92A 3GXOA 3K9TA 5HLGA 4N9HA 1ZGJA 1YIOA 2HR3A 3L09A 3TO9A 1HW2A 2XAJA 3F6OA 1K7AA 3DFGA 1H0MA 4G6QA 2RGVA 4YIFA 1TQMA 4HX7A 5FGMA 2IW5A 1F9NA 2L3DA 3JTHA 1RI7A 3HUGA 2K4JA 4AVPA 1LJ9A 3COAC 2NAZA 3P9IA 4A0ZA 4XLPF 2F5DA 2OQRA 5E18F 1MGTA 3P9CA 3RYRA 5HOOA 1S7AA 1YYVA 5ICFA 3FM5A 1TNSA 4HOBA 1IUYA 4HQMA 4HX8A 1IN6A 1J75A 1S29A 5CYVA 2CFXA 3E5UA 1Q1HA 1XSVA 1TNTA 3GUDA 4N0BA 1Z91A 2VN2A 4OIPF 1RUNA 4FHTA 1ZARA 4RB1A 2OBPA 2K4BA 5D5VB 4EJWA 1HSJA 1G3WA 2IVMA 3IRQA 5F6FA 1UHWA 2PFBA 2IT0A 6PAXA 1DPUA 1SD6A 3WGGA 2O6GE 2VC1A 5ILUA 1TTYA 2MLKA 3ZMTA 2F2EA 5DYMA 3ZN0A 3VEPA 1O3SA 5LHIA 4EMSA 1OYWA 1TQPA 2ZMEA 4A0XA 2CQKA 4Y13A 2XV4S 3JTGA 4HDVA 2RNJA 1G4DA 3JAMZ 2YPRA 3I71A 1KA8A 4HX4A 1AOYA 3HTUA 3R0JA 1DUXC 2Q2EA 1AWCA 3F8FA 3TO7A 2H94A 4UHTA 1W7PB 1BI2A 3TOBA 3HSFA 4LD5A 5D4RA 1KQ0A 1WKMA 1R36A 5LGNA 5JVTA 2JSCA 2VODA 5KVRA 2HTJA 3LA3A 3N97A 2DLLA 4L9VA 4EGYA 1DP7P 2QQBA 3V7CA 2XRNA 3RPQA 1JE8A 1WWXA 4EV0A 1YLFA 1ZAOA 3LA2A 3Q5FA 1U6GA 1ZN2A 1B9MA 2FEZA 4IF4A 2GQQA 2V6CA 3QPTA 2MH9A 1Z6RA 2K86A 1WRJA 2P6TA 3R4KA 3PFIA 3AAFA 1ZLKA 5ICCA 1ZRDA 2DW4A 1BIBA 2DU9A 3SFZA 1IRFA 5FB2A 2L4MA 2D1HA 1W7PD 3GFJA 2D2WA 2YR2A 3HRTA 4GCVA 5HLIA 4LG0B 1BIAA 2GXBA 3GZ5A 3QU6A 4LLGF 5L3BA 2HQRA 1V3FA 1LDJA 4G94A 2X0LA 2WWYA 5KK1A 5DCMB 3M9AA 4I0AA 4CDGA 5LGUA 1I27A 4HF1A 4UV8A 4L0YB 3ZMZA 3E6MA 2LF7A 1D3YA 3DPLC 2EA2A 3R0AA 4RGSA 1U5TC 1ON2A 2ETHA 2DQLA 5HDNA 2NNNA 4XSXF 4KUMA 3BDDA 1FYLA 3I58A 3KP7A 2R7FA 2A6HF 3SHFA 3F6VA 3BROA 1B6AA 3CUQB 4IRHA 2FQ3A 2ZXJA 2QQ9A 4LK1F 4YIIA 1SFUA 2PQ8A 3QP5A 2CO5A 3HRSA 4HYEA 2FE3A 3RYPA 2JT1A 2O0YA 3ZQ7A 3SXYA 2ELHA 1ZGAA 3C7JA 3E97A 5D5WB 3C1DA 2F5EA 2IJLA 2KJCA 2OZUA 3EQLF 2H6CA 1R5HA 5E1XA 4WCGA 5HDKA 4WK8F 1R00A 2RC4A 3I0TA 5E17F 2ZO4A 2HYFA 3CJNA 3MCZA 2ZKZA 3GO5A 4OIQF 4LK0F 5IT9K 3S2WA 1UB9A 5DCFA 5F64A 4GYGA 2VBYA 2GIVA 3R6SA 3I5UA 3FXRA 1SMTA 2QUFA 3WE3A 2M87A 3WTYC 1T39A 1YTYA 2LDUA 2QBYA 3WTXC 3ZMDA 2COMA 2ESHA 3ERED 2FXAA 5AIQA 5E1WA 5L3CA 1V4RA 4EJTA 5ILSA 3EUHA 1FOKA 3QOPA 1PP8F 2D1VA 1WI9A 2L4AA 3O2PE 4HAMA 2XHKA 4RAZA 4HV6A 4BHBA 1IN5A 5FFXA 2L02A 1CF7A 5IT9Z 2Z9OA 4L18B 4I0BA 3ZP5A 2Y0MA 3ECHA 2Z33A 3WTVC 2XROA 1QNTA 1R7JA 2STTA 4Q5SF 4MQ9F 1D8KA 4CICA 1LEBA 5IT3A 4M6YA 1R58A 1XCBA 3BZ6A 1IZ1A 3MEXA 3T8TA 2YX4A 4IVNA 2P5LC 2A6EF 1L0OC 3WGIA 2M5WA 1G3TA 3FZVA 2W24A 3WGHA 1USSA 1MDMA 2EFQA 2LF8A 2YU3A 3KP6A 2HKXA 2KJBA 5DV5A 3DV8A 5CVIA 4RGUA 2ZBKA 2A61A 3F3XA 3KFWX 5AONA 4YFNF 4ENJA 4ZYHA 3TKYA 4OIOF 3GVAA 4BQAA 4WX9A 2VBWA 2QLZA 2RDPA 1QPMA 2K02A 4AWXB 2P4WA 4S05A 2HFHA 1D8JA 2CG4A 4A5NA 3TO6A 1OYYA 1ZREA 1KU3A 2O8XA 1TQIA 2ADUA 3V8KA 2IA2A 3I59B 1K78B 3SQNA 3GEZA 4EVIA 4KFCA 4MTEA 3O6BB 5LBQA 2MA3A 1FBQA 5LRRA 3U2RA 4XRFA 3T5XA 3QPHA 2EK5A 3ZMUA 3KETA 3FMRA 1RNLA 2FA5A 3P9KA 3IC7A 4G7OF 1XGOA 1IXSB 2UXXA 3M7GA 2QYOA 2V9VA 1W5SA 1YO5C 3IL2A 1GHCA 2DK5A 1H9GA 4EM1A 4RB2C 4BH9A 4RB0A 3B73A 4GXOA 2FSWA 5DUKA 2LSOA 2ZCWA 4IXAA 3RKWA 2W57A 2XASA 5LHGA 5LLQA 2M8EA 1O7LA 2DTRA 2PI0A 1BJAA 3ELKA 4KT5C 1MJ9A 5ICEA 1B9NA 4CZZA 1O3TA 2E1NA 4LLLA 2MLGA 1ODDA 3FF5A 2QWWA 3JAMK 3ML6A 3I53A 3FMQA 3KP3A 4D0PA 4ASNA 3BPVA 1J2XA 4O5VA 3WU1B 3Q9VA 4P5OA 5FD6A 1B4AA 4CGZA 3KP5A 3HSRA 1QGPA 4U0WA 4P9FA 3LFKA 1K6OA 5BS6A 2KRFA 5D5XB 5LEJA 4BYYA 1YS7A 1J5YA 3OOPA 4M72A 1XD7A 4MQVA 1JHHA 2O03A 2RVCA 3GYHX 4WWCA 2JTVA 2OD5A 2JRTA 3IHUA 4UVAA 2X4HA 4O3MA 2FF4A 2XUBA 1U78A 4YG2F 2DBBA 5DEQA 3FM3A 1S3JA 4Y17A 1XCVA 4M74A 3IKTA 4DNCA 5ERIA 1U5TA 4MNUA 3IKVA 2JPCA 3KP2A 4IRGA 2ISYA 4O6JA 1ZG1A 1E2XA 1OYIA 3F23A 1ZHFA 3K0LA 4A0YA 2LNBA 1S7OA 4I01A 4HQEA 3VODA 2VOPA 1HKTA 4M71A 2DI3A 1R22A 2XAGA 4KICA 4E70A 3BY6A 3QAHA 3ZPLA 2IRFG 1FP2A 3MZYA 2K27A 4KMFA 2JPBA 5BQTA 3HTSB 4KIFA 4IRIA 5ILVA 2M1BA 1LB2A 4MEYF 2QENA 4KMUX 3JSPA 4YFKF 1P2FA 1HSTA 4ZZLA 2EFWA 2EFOA 3W6JB 3U1DA 2R7DA 2Q8KA 3CTAA 4KYWA 3L00A 2R3SA 2EWNA 3K69A 2MBFA 5LHHA 2H27A 1O7FA 3VB2A 4R79A 3L2CA 3REOA 4OIRF 4CXFA 3V7SA 2CSOA 3JSOA 2P7VB 3JW4A 3F22A 5BMZA 1QO0D 2GAUA 2W84A 4LLNA 3ULQB 1B59A 2V1UA 2F5CA 3HRUA 4BHPA 5TJJA 3V8LA 3E3VA 2HGCA 3K2ZA 5EEHA 4M9SA 3PQJA 4WXDA 2BYVE 2ZFWA 2XIGA 1FLIA 4EJUA 1FBUA 4KN4X 4YFXF 2QM3A 1R1VA 3VOEA 1HKSA 2H6BA 2C6YA 3GW2A 2XVCA 2HEOA 4WF2A 5TRDA 2HDCA 1SFEA 4MEXF 3DPTA 4ENMA 1TLHB 2J5OA 4G7ZF 3GFMA 2DO7A 2NRAC 4UNOA 3RTRA 3KE2A 4ZZDA 4L9TA 1G3YA 2A69F 1OPCA 2Z99A 1EH8A 1XDUA 2EFNA 2FRHA 3IWFA 3DEUA 2OAZA 2VBZA 1JGSA 1G6NA 3DKWA 1IN4A 1O57A 4IPAA 1OKRA 2ZMEB 2HS5A 2K7LA 3N4MA 4I02A 3F72A 1ZRCA 1P6RA 2GA1A 3H3UA 1Z9CA 2VXZA 4R8HA 2VOOA 5K5QA 4PDKA 2KIFA 4I2OA 2G9WA 2EJRA 3KLOA 4PZJA 2JZYA 2VONA 3I54A 3DF8A 1W5TA 4NHJA 2XAFA 2XAQA 1PDNC 3J80K 3E6DA 1KU7A 3K1PA 1R1UA 4OU0A 1KU9A 1ZH5A 2DAOA 2QQAA 3TGNA 3HHGA 5ICGA 5J8CA 1ZG5A 3BJOA 5L3FA 1O3QA 5CVVA 5HS7A 1XB4A 1IN8A 3KP4A 1RIOH 2XGXA 3WTZA 1FX7A 3LWFA 1SD5A 3D5LA 1TBXA 3HSEA 1O3RA 5A2QZ 4Z2YA 3V8JA 4ENNA 2V79A 1HKQA 3ABUA 4AIHA 2GZWA 3J80Z 3HIFA 1NHAA 3F8MA 4CO8A 3H92A 2EA4A 2TDXA 1S6LA 4I98B 1R23A 3TDUC 1GXPA 2OQGA 2VE8A 4NB5A 3CDHA 1XN7A 3Q9SA 5JHUA 4A6DA 4RB3C 1BOAA 4GYIA 3RKYA 4G9YA 5J6XA 4N9IA 1UHMA 3SZTA 2NS0A 4LJZF 3FWEA 3ECOA 3KLNA 2FNPA 1F4KA 3MQ0A 2FBKA 3ZMSA 1KGSA 3K1MA 5BPIA 5H6QA 1IN7A 1BI3A 1ZLJA 4GO1A 2OU2A 3KZZA 1ZYRF 3M8FA 1XMAA 1KQ9A 4BXUA 2Q0OA 3E5QA 2ZNYA 5FLXZ 4EM2A 1SD4A 1W7PA 2DPUA 2M45A 1DPRA 1Z6TA 3E6CC 5J8FA 3LAPA 1FT9A 2LKPA 4A2UA 3ZN1A 3ROUA 3FX3A 1SAXA 2G7HA 2V1XA 4HZFA 3MFKA 2GXGA 2IA0A 5H6RA 1BBYA 1FSHA 5DD4A 4HBLA 4ESBA 1YW9A 2ACJA 4WXCA 2YX7A 4HF2A 3H3ZA 1C0WA 4HW0A 3WE2A 2YSRA 1CGPA 2M30A 3M8EA 1T0FA 5DD8A 4Q47A 2A3SA 2VT2A 3WODF 2PG4A 5AIPA 4XSZF 1RUOA 3CUOA 4F7ZA 3HOTA 5HVQC 2FOKA 1KQ8A 5CVUA 2HTSA 3T8RA 4ESJA 4UXNA 1BI1A 4AIJA 2O3FA 5JR3A 3NQOA 1P4XA 5D6EA 4LG0A 1LQ1A 2AXLA 1HW1A 1R1TA 2QBYB 1L3LA 2PMUA 1D5VA 5JFRA 3MZHA 4K2EA 2NNYA 5CVJA 4L0ZB 4U0VA 2PJPA 4LFUA 4Y15A 3GFLA 2UZKA 4EGZA 4LGWA 4FT8A 3F8BA 4CYDA 2ZNZA 2A5YB 3F8CA 4QLCU 5DCMA 3GWZA 3KEOA 1U2WA 3HYIA 2IP2A 4HLXA 2NYXA 2L01A 1CF7B 1PUEE 4A12A 2XAHA 2GA2A 1HBXG 5LEKA 1ULYA 1YQAA 4JK1X 4ZYGA 2P7CB 4KA4A 2PLYA 1MJAA 4I09A 1FYKA 4M6XA 1U3EM 5H20A 1LDKB 3LSTA 2EV0A 1FPQA 2A07F 4KDPA 3LAJA 2HKOA 2OZ6A 3CUQA 3GF2A 4CHUA 4I7HA 1KYWA 4EQQA 4NQWA 2BEOA 4AD9A 1IF1A 1FY7A 4TV7A 1IXRC 4PGHA 1I1GA 2A68F 4PCQA 3FXQA 4P55A 1BN5A 3RJPA 1MDMB 1YW8A 3MWMA 4M9XA 2D45A 3K1NA 1G3SA 2FMLA 4HA8A 3RIRA 4UUVA 2G7UA 1XSXA 4KNYA 2EB7A 2PBIA 2RKHA 3GLXA 2PMHA 2ISZA 1BC7C 2EFPA 3WTTC 3QU3A 1MD0A 1BC8C 2DQRA 2P5VA 4KIGA 1XGSA 2HZTA 1Z05A 1BM9A 4U7DA 1E17A 1MJBA 1EV7A 1IAWA 4ENKA 4EJOA 4DQ2A 2MH2A 1K79A 1MKMA 3L7WA 5K5OA 1W4MA 2P8TA 4KIBA 3EETA 1IW7F 1P4AA 3D0SA 1J9IA 1XGNA 2QZ8A 1MZBA 5D4SA 2WTEA 3QP6A 1X3UA 4AIKA 1QZZA 3BPXA 2E7XA 4FX0A 1SFXA 3J7AO 1YFHA 1TW3A 1B1BA 3NRVA 2O61A 1KU2A 1WQ2A 2HWVA 1REPC 2FBIA 2STWA 2RN7A 3HOSA 4U88A 1T38A 4HLYA 1T2KA 1BI0A 1J59A 4OOIA 1PP7U 1IRGA 3LQRA 1EH7A
chains in the Genus database with same CATH superfamily
1RKWA 1SD7A 1I6HJ 3OYDA 5LRSA 2VT3A 3DBRB 2VQHA 4C3JJ 1TWCJ 2CUEA 3K4MA 2MD5A 2DT7B 3H9JA 2PN6A 4L5JA 1J7KA 1HXDA 3QPSA 4MIMA 1JKQC 3CESA 3CUQC 3KZYA 3ABKH 5CJ9A 5E1ZB 3RCOA 2K5CA 4BHCA 1SVOA 4ESFA 4RGXA 2DTZA 1VTNC 1JHFA 1HQCA 4RS8A 2R7ZJ 2KIUA 4UVCA 4F92B 1UG0A 3LSPA 1FYMA 2AS5F 1WJEA 4H0EA 1VQOI 3G1MA 3S15J 3E6BA 2HOEA 3V4GA 1JT0A 2FMYA 3NAUA 2DJIA 1U0JA 3A0BC 3HDDA 1U8RA 5EJCA 2KZGA 3L9FA 4CCJA 3CCMI 2RV8A 1R71A 1XX5A 1UHSA 1AKHB 1OCZH 3KCCA 3QYFA 4LMYA 1LDDA 4FX4A 4G8XA 3GTPJ 3KYDB 5E8IA 4IHSA 1O4XA 1JTYA 2LK2A 2DK8A 4KT6A 1I3AA 3C3WA 3W6KB 4RGRA 4Y52J 3PUBA 4BNCA 4RLQA 4JBAA 2ZMEC 3WTSC 2XF7A 2XC7A 4W97A 3T0YA 3I64A 3RDIA 2VE9A 5CKTA 2DFIA 2B0LA 2FU4A 4GGGA 5D8LB 4Y4RA 5E3OA 4R1HA 1Y39A 3H35A 4AUXA 1QPIA 3M8JA 3H5NA 5IYBJ 2Z3YA 3UKGA 3AL0B 2UXNA 1YS6A 1QQIA 3UR3C 2Z16A 4BBSJ 3BQZA 2K9LA 1R5GA 2F4IA 4OMYA 4UUSB 2E36A 5FFZA 2GWRA 3CCSI 1MNMC 4LB6B 4A3EJ 1MBKA 3F21A 1S8NA 5CLSA 2R7XA 2ZJ2A 3RSNA 1DDNA 2BBYA 4J00A 3CLOA 4OMZA 2CQNA 2BE5F 4V19K 2M3AA 2Y2ZA 1YG2A 2R4GA 1DGRM 1R6RA 5K5RA 4EM0B 4IEJA 4HV5A 3TOAA 3CCQI 3LQQA 5HDGA 4U0YA 1X1DA 1X2NA 2WV0A 5EG0B 2FBHA 1OCRH 4LB5A 1LNWA 4HDUA 4UVBA 4FQGA 1UFMA 4KJZA 5C4XJ 2DMUA 4Q4ZF 3CO7C 3R60A 3I59A 1STZA 2XKOA 3SEZA 1K78A 4PGGA 1MBHA 1X3WB 3CDIA 1J0RA 2R0QC 1FMVA 3WG9A 1VQ5I 3ESWB 3OSGA 5D5UB 3CLQA 3QYEA 2EZKA 4BAYA 2M7AA 4BQNA 1SMYF 1VQPI 1XSDA 3HHHA 4MGRA 5B66C 1F5TA 4ZYEA 4A6EA 4AIDA 2QKMB 3DQVC 1U5TB 2CYYA 3FHZA 3CCVI 3SJMA 2B63J 4F52A 2QSFX 3BJAA 2WC2A 3S1QJ 3OV8A 2DXIA 1ON1A 4KN7X 1RZ4A 3M07A 4JYKA 4L5IA 1H89C 4IL6C 4B8XA 5A2QK 2CW8A 2V1DA 1RC9A 2WY7Q 3PQKA 3LSHA 3NWTA 1Z67A 5C4JJ 3JR9A 1YITI 3CC4I 1S72I 2Y48A 3GZ6A 1JUSA 3E5XA 1LE8A 3G3ZA 1LPQA 1IRZA 4DGWB 3J81K 2G0EA 4V2FA 3N05A 3EYYA 4CCOA 2Z5UA 2O8KA 1UAAA 1XGMA 2DMPA 4WXHA 1NTCA 1OR7A 1Y0NA 3G73A 3OWTA 3KEQA 1T98A 1X1PA 4EJVA 3C18A 3H9QA 3TW7A 4P96A 5BPDA 3IWZA 4ANJA 1OMIA 2EV6A 1CQTA 3QRFF 1Y0UA 5HLHA 3FXUA 1EH6A 4J01A 4BDYA 3CD6I 4XLCA 2KPMA 3S1NJ 1QRYA 2ZC2A 4JX5A 4Q48A 3RPUA 4IO9F 4YEJA 3IP4B 3S16J 5L3GA 3ASOH 3BOQA 5CVRA 2F5FA 2O9LA 1WSUA 1FNNA 1TW2A 2V9PA 2R7OA 3EDPA 3TQNA 5M5XJ 1V5GA 4ZH4F 3AG2H 1USTA 3AKZA 3CMAI 2X6XA 1FBSA 3DXJF 2OCCH 3CMMA 3ISPA 4QWQA 4IOCF 9ANTA 2KMUA 2ZB9A 4LIUA 3A1YA 1RESA 3ZMVA 1XDSA 4ETSA 3CMYA 3TW6A 3HRMA 2K40A 4M73A 3KIOA 2P5KA 1MMDA 1FWZA 2HYGD 3GX4X 4UV9A 3D1NI 1A6IA 2VBXA 3CC7I 2BXYA 2DA4A 1ZG3A 1YW7A 1BW6A 5EEGA 2XPUA 1BA5A 4M9ZA 1R4MB 2E1CA 3C2HA 4U7BA 3J81Z 3TDZC 4NUBA 2KFDA 4BJTA 5HS9A 5D6FA 5K1YA 5E3LA 2KLOA 3BJ6A 3JCUC 2XB0X 4KISA 1YJWI 1A04A 2ESNA 3ABMH 4YRVA 3ZGKA 2LP0A 3ZXSA 3CZ6A 5F1RA 5L3EA 4L9JA 2OTJI 5FLXK 4MTDA 1XMKA 4E7IA 2NS8A 1QZYA 4M3DA 4XBFA 3ZRGA 2BOLA 4RAYA 5IOYA 3B02A 4OINF 1PYVA 1Z1DA 1OQYA 3DBLB 3A0HC 1VQNI 3RKXA 2RQPA 1FSEA 5ED4A 2DT5A 2MC3A 4B47A 1ZR2A 3GLLA 2XKPA 2DMTA 1UCRA 2HVSA 1KYZA 3ZQQA 1ZRFA 3L1PA 3EYIA 2Y31A 2L54A 2VB6A 1IGNA 2CFOA 2EZHA 1I5ZA 3H0DA 4HRIA 2VKVA 2BHZA 3I4PA 1V54H 1B8IB 3GFIA 5FROA 1H9TA 2BXZA 3GTOJ 1BR1A 4G6DA 1IXCA 5E8GA 2R7TA 5FO5A 1LVAA 3M1CA 4HF0A 4L9NA 5EZGA 1XPXA 3HGYA 3UNGC 2E7WA 1I1SA 4UUTA 5JI6A 4UB6C 5BOXA 2BV6A 2BGCA 3U9GA 4S04A 2MABA 5D8KB 1LFBA 4CCNA 3SZGA 3IRRA 2EV5A 1JTXA 2KKOA 2IS4A 3LA7A 2L9RA 1WCMJ 2HQNA 3K4NA 4MHGA 3WTWC 1T6SA 3L2WA 3HC7A 4JQFA 2CWEA 3RI4A 1Z7UA 2LYCA 5DUIA 3ZQFA 5LGTA 4PJNA 2DPDA 2IPQX 3W3CA 1MMSA 4A5MA 3O3KA 2HPIA 4L5EA 5CQEA 2MC4A 1FC3A 3LFUA 3V7RA 5L3DA 1E3OC 3MAJA 3CO6C 3ZQGA 2LRDA 1GDTA 4ZYDA 2BY3A 1QBJA 5FD5A 3WTUC 3CP8A 4E6KG 1HW5A 2QVOA 1UG2A 2OA4A 1APLC 5HS8A 4IHYA 2Y75A 2CGPA 2EILH 3R61A 1SANA 4JP0A 2VI6A 4A3MJ 3JREA 5E20A 2KIMA 4XLNF 1HDDC 5DDGA 1JXSA 2NVYJ 1EJ9A 3T1BA 1WHUA 3WU0A 3P7NA 2J5PA 1LEAA 2IA1A 5EGOB 3FMSA 2D5VA 4A3LJ 2FNAA 1FP1D 1ONVA 3NEUA 4B09A 4ON0A 3SDGA 4XOPA 2W25A 2QQ8A 1A6QA 2A5WA 2L7FP 2W85A 4XN3A 3FBIB 1WJDA 4BEHB 2P6SA 1Y8RB 1ETOA 1R5ID 4IJAA 2KHMA 4IHTA 2DA6A 4G7HF 1Z0XA 3G1OA 3DBHB 3ABTA 2CW0F 1I6XA 2UWMA 1F1ZA 3PIPF 3DP7A 3OL3A 3F8NA 3BWGA 1GXQA 2AO9A 2K3PA 2ZXWH 4XONA 4E7KA 1GVJA 2DA1A 2VC0A 3VFZA 2DA7A 1P4WA 2YUSA 3OYKA 2K85A 3JRIA 1B72B 2PEXA 2QF7A 5J4VA 4BS9A 2V4JC 3FKIJ 5CQGA 2H09A 2W82A 3M1EA 2LBFA 4DOZA 3BP8A 5FKLA 1FZPB 3SZPA 4P9UA 1P92A 2VQGA 3GXOA 3K9TA 5HLGA 3OYIA 4XIDA 2VKHA 1DU0A 4N9HA 2VL8A 2E1MB 2NS7A 1XTAA 4W1UA 2LY9A 1ZGJA 1YIOA 3VYUB 2HR3A 3L09A 3TO9A 1HW2A 2XAJA 2ZSIB 3F6OA 2ICWG 5KHDA 3IH3A 3BR3A 1WPKA 1ZKGA 2OPTA 1K7AA 1ETKA 2KT0A 2E35A 2GBYA 3DFGA 3F0CA 1H0MA 2LG4A 3S17J 3WHCA 4G6QA 2RGVA 1W0UA 4YIFA 1TQMA 4HX7A 5FGMA 3VYRB 2IGKA 2IW5A 2XDVA 1F9NA 2L3DA 3JTHA 1RI7A 2IEKA 2K4JA 3HUGA 4AVPA 2IS6A 2MYSA 1PUFA 5JHFA 2CJJA 1SEUA 1LJ9A 3COAC 2NAZA 1OLTA 3P9IA 2I8DA 4A0ZA 4XLPF 2F5DA 2OQRA 4M3EA 5E18F 1MGTA 3ZQIA 3P9CA 3RYRA 4G6TB 1HOMA 5HOOA 1S7AA 1YYVA 2AQFA 5ICFA 2E2HJ 1NG7A 3FM5A 1TNSA 4HOBA 2UUZA 1IUYA 2BW3A 4HQMA 4HX8A 1IN6A 1J75A 1S29A 5CYVA 2CFXA 1ACIA 3E5UA 1Q1HA 2CUZA 1XSVA 2BHYA 1TNTA 2X1EA 3GUDA 4N0BA 1E3HA 1Z91A 2VN2A 4OIPF 1RUNA 4LITA 4FHTA 1ZARA 5IP6A 4RB1A 2OBPA 4HG2A 2K4BA 5D5VB 4EJWA 1BL0A 4HSRA 5B5EC 1HSJA 2LFBA 1G3WA 4BXXJ 1F36A 3TEDA 2IVMA 3IRQA 4AYBN 5F6FA 3AG4H 3HEFA 3JRGA 3H3VK 3HGGA 2GXAA 1K61A 1UHWA 3ERMA 2PFBA 1JJ6C 3WG7H 2IT0A 6PAXA 1DPUA 2V26A 1SD6A 3WGGA 2O6GE 2VC1A 1FIAA 3BG5A 2CMPA 3G4SI 2JUCA 3BR2A 3CJQB 3K6GA 5ILUA 2Y30A 2EZIA 1TTYA 2MLKA 2X9DA 3ZMTA 4F3QA 2F2EA 3JRDA 5DYMA 3ZN0A 3O8GA 3QQAA 1X3ZB 2GOMA 2Y0SN 3VEPA 2CQQA 3VDXA 1O3SA 5LHIA 4EMSA 1OYWA 1ETQA 1TQPA 1QHGA 2JA5J 1FOXA 2ZMEA 4A0XA 2KIQA 2OTLI 2CQKA 4Y13A 1W36D 2XV4S 4BY7J 3JTGA 4HDVA 1GVDA 5HLTA 3K2AA 2WY8Q 1N75A 2E71A 2RNJA 2V9KA 1WH5A 3S93A 1G4DA 2L9VA 3VSKA 3JAMZ 2YPRA 3GZNB 3I71A 1TC3C 3BTJA 3BZKA 4E7SA 1KA8A 3PJRA 2X6YA 4HX4A 4GFBA 4XRMA 1AOYA 2VQLA 3HTUA 3R0JA 1D1AA 1DUXC 2Q2EA 1AWCA 5J3LA 3F8FA 3TO7A 2H94A 4UHTA 2ZXIA 3IH4A 2R7SA 1W7PB 2R5YB 1BI2A 2QKLB 3TOBA 2JA7J 2DOFA 3OS2A 1LFPA 1N77A 2K3FA 3W2AA 1YHQI 3HSFA 4HNUA 4LD5A 5D4RA 1KQ0A 2VJ5A 1E3PA 2R5ZA 1WKMA 4IKFA 2X1CA 3DTEA 3OS1A 1R49A 3OYFA 2Z2SB 2GOXB 3I4NJ 1R36A 1X58A 2KRCA 4CYCA 1S9HA 5LGNA 5JVTA 3BR0A 2QGUA 2ZFUA 5KAFC 2JSCA 3H0GJ 2VODA 5KVRA 2HTJA 3LA3A 5E79C 3CF2A 3N97A 3JRCA 2DLLA 3MKWB 4EATA 4L9VA 4EGYA 3DPUA 1DP7P 2QQBA 3M3YJ 3V7CA 5HODA 2XRNA 3RPQA 1JE8A 2HDDA 1WWXA 2BY0A 1VQMI 4EV0A 3E0JB 1YLFA 4XLEA 5JLWA 3H9GA 2P0WA 1ZAOA 2DCEA 4MLOA 5GAGJ 4DYRA 4Z6YA 1QHHD 3DTKA 4RA2A 1ETYA 3LA2A 1K6YA 2JA6J 3Q5FA 4Y33A 2DMNA 2JJ7A 3ZCOA 2XSJC 1U6GA 1ZN2A 1B9MA 2DT6A 2FEZA 1D1CA 1Y6IA 3OIOA 4IF4A 4U87A 2GQQA 2V6CA 2FX0A 3QPTA 2MH9A 3MKZA 1Z6RA 4BQOA 3Q0UA 2CU7A 2K86A 4BUPA 1MBGA 1WRJA 3AG1H 1IUFA 1IDYA 2P6TA 1LFUP 3R4KA 3PFIA 3AAFA 4XMYA 2QA4I 1ZLKA 5ICCA 1ZRDA 4C30A 2DW4A 1QVUA 5LD2C 5FJ8J 1BIBA 2DU9A 3SFZA 1WH7A 5EYRA 1IRFA 1BR4A 5J4YA 5FB2A 2L4MA 5EZHA 4IHXA 2K9QA 2D1HA 1W7PD 1W5CC 2D2WA 3GFJA 5E3NA 1D0ZA 2YR2A 3HRTA 4GCVA 5HLIA 1YJNI 3GTQJ 4LG0B 4NBQA 1BIAA 4XLAA 3L2RA 2GXBA 2DFHA 1TL8A 3GZ5A 1JT6A 1YRNA 1MIJA 4IQJA 3QU6A 4LLGF 5L3BA 2HQRA 5F27A 2KDZA 1V3FA 2DA2A 1LDJA 3PL8A 4G94A 3S3NA 3G71I 2NOJB 4B44A 1DGWY 1M1EB 2GIZA 3MN2A 4RAFA 4CCLA 2X0LA 2WWYA 4JOMA 5KK1A 4N4OB 5DCMB 3M9AA 4I0AA 2LY1A 4CDGA 2IGMA 3K10A 4F55A 4FISA 5LGUA 1I27A 4HF1A 3VPRA 4BXFA 4UV8A 1UZCA 2JWTA 4L0YB 4ZDLA 3ZMZA 2W00A 4JX4A 1JUMA 3L2QA 3E6MA 2LF7A 4ZDOA 1D3YA 3DPLC 3PM1A 1MMAA 2EA2A 3R0AA 2IGNA 4RGSA 1U5TC 1ETVA 1ON2A 4HPQA 2ETHA 2DQLA 3H5AA 5HDNA 2DFEA 3S2HJ 4XORA 4JX6A 2NNNA 4XSXF 4KUMA 3BDDA 1FYLA 3I58A 2IXSA 3KP7A 4MO7A 3BLYA 2R7FA 4ZYAA 2A6HF 2E34A 3F6VA 3HM5A 3BROA 2PX9A 3SHFA 1B6AA 3CUQB 4IRHA 1F43A 3K70D 3MVPA 2FQ3A 2ZXJA 2QQ9A 2F4MB 4NQWB 1S5LC 4LK1F 3LSRA 1P7IA 5IPAA 1WVRA 3H36A 4YIIA 2DOEA 4C3IJ 3QWLA 2DODA 1HDPA 1SFUA 2PQ8A 2O5RA 4BACA 3QP5A 2CO5A 4PUSA 3HRSA 4HYEA 2FQ4A 2FE3A 3RYPA 2JT1A 2O0YA 4PJMA 4C2TA 2ZSHB 2MD0A 3ZQ7A 4BE2A 3BR1A 3SXYA 2ELHA 2XF6A 1QU3A 1ZGAA 1D0YA 5E3MA 3C7JA 2V7FA 3B6AA 3E97A 2WAFA 3VSLA 4CCMA 3LSIA 3DEWA 2VKEA 5D5WB 2UV1A 3C1DA 2F5EA 3A01A 2IJLA 2KJCA 2OZUA 4PJ0C 3EQLF 2H6CA 1R5HA 5HNHA 5E1XA 4WCGA 1YOVB 2JN6A 5HDKA 2M7BA 1T56A 4UB8C 4WK8F 1RR7A 1R00A 1FJLA 2GM4A 1X4OA 2RC4A 5GAEJ 1EF4A 3I0TA 5E17F 4BE1A 3ONQA 1MBJA 2HU9A 2ZO4A 2HYFA 3CJNA 1HLVA 3MCZA 2ZKZA 3GO5A 3DLAA 4OIQF 4LK0F 5IT9K 3S2WA 2XGCA 5KAIC 1UB9A 1X1BA 1U9OA 5DCFA 2WAQN 5F64A 4Y3OA 4GYGA 2M2EA 1GUUA 2VBYA 2GIVA 4QIWN 3R6SA 1BW5A 2EIMH 1MSEC 3QYBA 2XAUA 3K4CA 3I5UA 3FXRA 1SMTA 2QUFA 3DKYA 2HPMA 4XR6A 4P1WA 3WE3A 2M87A 4XK4A 2VLAA 5FLMJ 4OWRB 2KP6A 2KZVA 4PSXA 2QSGX 5IYDJ 1NK2P 3WTYC 1T39A 3LSMA 1YTYA 3LOCA 4A3CJ 2W7NA 4RM2A 1X2MA 3VWBA 2LDUA 2QBYA 3WTXC 1FTTA 3ZMDA 2COMA 2EH3A 2ESHA 3ERED 2FXAA 3OYEA 2JK3A 5AIQA 5E1WA 5L3CA 1JGGA 1V4RA 1ZK8A 2ME0A 4EJTA 1DQUA 5ILSA 3DTIA 4D5CA 3EUHA 1FOKA 3TBIA 3V42A 3QOPA 1PP8F 5F1JA 2D1VA 2H8RA 1WI9A 4A3FJ 5FKOA 2L4AA 3VYSB 3O2PE 4HAMA 2LD5A 3M4OJ 2XHKA 3TL4X 4RAZA 4HV6A 4BHBA 1IN5A 5J1YA 5FFXA 2VPLA 2L02A 2M4KA 4YELA 1CF7A 5IT9Z 3MD2A 2Z9OA 4L18B 4I0BA 1P9QC 3ZP5A 1UELB 2Y0MA 3A4CA 3ECHA 2COBA 3BG6A 3WTVC 2Z33A 2XROA 1QNTA 1R7JA 4RDUA 2STTA 4Q5SF 4C2UA 4MQ9F 2LVSA 1D8KA 4CICA 1LEBA 4H4KC 1G59A 2EBIA 3CJRB 5IT3A 2QEXI 4M6YA 1R58A 4XNFA 3LSGA 1XCBA 1IJWC 1I3QJ 4DZPA 3IUOA 3BZ6A 1IZ1A 3MEXA 3T8TA 2YX4A 3SYTA 2ELKA 4IVNA 2P5LC 2A6EF 1L0OC 2HVRA 1KZHA 3WGIA 4B1RA 3CCEI 2NVUB 2L5QA 2M5WA 4DBRA 5KNLA 3OYNA 1G3TA 1OFCX 2LLKA 3FZVA 2W24A 3MKLA 1VNDA 3WGHA 1USSA 4BE0A 1MDMA 3QPLA 3FK6A 3OL4A 2EFQA 3HOXJ 2LF8A 4D7NA 1JJ8C 2YU3A 3KP6A 2HKXA 1TP4A 3O8HA 4A93J 1IRXA 2HQAA 2KJBA 5DV5A 1JI8A 3DV8A 5CVIA 5TGTA 2HYJA 4XRSA 4RGUA 1X19A 2AQEA 2GLOA 1I39A 4ZJZA 2ZBKA 2XSDC 5B3SH 2A61A 2B9SA 1QVTA 2NVXJ 3F3XA 3KFWX 4X6AJ 5AONA 4A3BJ 3H5RA 4YFNF 4ZYHA 4ENJA 3OS0A 3TKYA 4OIOF 3GVAA 4BKXA 4BQAA 4WX9A 2VBWA 4HEA2 2Z1DA 2QLZA 2OCEA 2BY1A 4DW6A 4IHVA 2RDPA 1QPMA 2K02A 2PJRA 5K7HA 4AWXB 4FE4A 3ZQLA 3ABLH 3B6CA 2P4WA 1WJCA 1Y56A 4S05A 2ELJA 2HFHA 2X85A 1D8JA 2CG4A 5GTHC 4A5NA 1QA6A 3TO6A 2E5ZA 1OYYA 2F6CA 2W48A 4ZC3A 1ZREA 1KU3A 2O8XA 3HZJA 1TQIA 2ADUA 2L9NA 3V8KA 3OYAA 3CCJI 3CCLI 2IA2A 2NXNB 3DEEA 3I59B 3KX2A 3K4KA 1K78B 3SQNA 3GEZA 4EVIA 5F04A 4KFCA 4MTEA 3SDBA 3EUHC 4PFOA 3O6BB 5M5YJ 5LBQA 2MA3A 1FBQA 4DZJA 3I9V2 1HA8A 5LRRA 5CPRB 3U2RA 4XRFA 4D9JA 1HF0A 3T5XA 3QPHA 2F4OB 3J7YJ 4CCKA 2IAIA 2EK5A 3ZMUA 1P7JA 3KETA 3HG9A 3FMRA 1LVKA 5J1RA 1RNLA 2FA5A 2MG4A 3P9KA 1MW7A 4E7JA 5C44J 3IC7A 4ABZA 1DP3A 1ETWA 3L2UA 4PSWA 3W2VA 1RR8C 1XGOA 4G7OF 1IXSB 1LE8B 2UXXA 3M7GA 2QYOA 2V9VA 3BTCA 4FE7A 1W5SA 5J47A 4BL0B 2JVHA 2EIJH 4AU7A 3S1MJ 1TWFJ 2EPFA 1YO5C 4XICA 3W6VA 3IL2A 3VYTB 1GHCA 2DK5A 2DMQA 4M3GA 5IYCJ 1H9GA 2E60A 2HOAA 4EM1A 5IOZA 4RB2C 4BH9A 4RB0A 3B73A 4GXOA 2FSWA 3TP3A 5DUKA 2LSOA 2ZCWA 4IXAA 3RKWA 1E0EA 4ZTJA 2W57A 2KL4A 1OISA 2XASA 2BVLA 4NC8A 5LHGA 5LLQA 3BTIA 1IV6A 4XLFA 2M8EA 3CDLA 1O7LA 4X1EA 1Y8QB 2DTRA 1AKHA 1T95A 2PI0A 1BJAA 3ELKA 3G6EI 4KT5C 3HBLA 2EINH 2HOTA 1MJ9A 2PMZA 4PJLA 5ICEA 1B9NA 4CZZA 3BG9A 2LC2A 4XKVA 4E7LA 1O3TA 2E1NA 4LLLA 5H2FC 2ZJQF 2MLGA 2PMZN 3QODA 1ODDA 3FF5A 3S14J 5FKKA 2QWWA 3OSFA 1MSFC 2HDWA 3JAMK 4I76A 3ML6A 3I53A 3FMQA 3KP3A 1MMNA 3C2BA 2CUFA 4D0PA 4ASNA 4AYBA 3BPVA 2KISA 1J2XA 4O5VA 3WU1B 1IO2A 2HI3A 2DA5A 4UUSA 3Q9VA 4P5OA 5FD6A 4ITVA 1B4AA 4CGZA 3KP5A 3HSRA 2LTPA 1QGPA 4BJ5C 4U0WA 2YU9J 2AHQA 1OJLA 4P9FA 3IH2A 4S0HB 3IV5A 2NVQJ 3LFKA 3FHNA 3D5RC 1SFOJ 1K6OA 4BBRJ 5BS6A 2KRFA 4DBQA 1X1AA 3WU2C 2Y0SA 5D5XB 5LEJA 3BR6A 4BYYA 1GV2A 2VJJA 1YS7A 1J5YA 4GRIA 3OOPA 4M72A 2H1KA 1XD7A 3DLLF 3A02A 4MQVA 1UJ8A 5EG0A 1JHHA 3K4BA 2NVTJ 2RNGA 2O03A 4OAZA 4DYCA 2M34A 3RPUD 2RVCA 3GYHX 4WWCA 1ORKA 2JTVA 2OD5A 1IC8A 4C9YA 2JRTA 3IHUA 3HOZJ 3OR2C 1IV8A 5FKNA 3OYJA 4UVAA 1XC5A 2X4HA 4O3MA 2FF4A 2XUBA 1U78A 2HOSA 4YG2F 2DBBA 2WAEA 2W1OA 5DEQA 3CP2A 3FM3A 1S3JA 4Y17A 4G12A 1XCVA 2M0CA 4M74A 3CCYA 3IKTA 4DNCA 5ERIA 1U5TA 4MNUA 3IKVA 2JPCA 3KP2A 4IRGA 2ISYA 4I6ZA 4O6JA 1ZG1A 1E2XA 5IP7J 3HOVJ 3HPHA 1OYIA 3F23A 2V1NA 1ZHFA 2FJ1A 2VKDA 3K0LA 4B43A 3Q3SA 1JUPA 4A0YA 3BTLA 2LNBA 5GTIC 1S7OA 4I01A 1ENHA 2WA0A 4HQEA 1X1CA 4A3IJ 2OJED 5M3FJ 5M5WJ 3KYCB 3K70C 3VODA 4D1QA 3E1SA 2VOPA 1HKTA 2KDOA 1W0TA 3OR1C 4M71A 2DI3A 1ITYA 3FBNB 1Z77A 2Q1ZB 3CMEI 1R22A 2XAGA 4KICA 4E70A 3BY6A 2DDAA 3QAHA 4CUGA 3ZPLA 2IRFG 4XKCA 3HOYJ 1FP2A 1SC7A 1GT0C 4LG3A 3MZYA 2K27A 2KQRA 3PNTA 4Y7NJ 4KMFA 2TCTA 2JPBA 5BQTA 1OCCH 3HTSB 3JRHA 1NG6A 4KIFA 1SFKA 4IRIA 3EUAA 5ILVA 2M1BA 1LB2A 4MEYF 2QENA 4QPOA 3BC8A 4KMUX 3SEQA 3JSPA 3RKQA 4YFKF 2X6WA 5GAHJ 1W1WE 1P2FA 4B3AA 1ERDA 1FOWA 5LFAA 5FRNA 1HSTA 1K4TA 2R7QA 4ZZLA 2CUJA 2EFWA 2EFOA 1N25A 3OYBA 3W6JB 3U1DA 5DM6F 2R7DA 5IY5H 2Q8KA 3ZR8X 3CTAA 4J19A 4KYWA 3L00A 1XS9A 1OCTC 2R3SA 2CS3A 2EWNA 3K69A 2MBFA 4B3XA 4RAGA 4RLFA 5LHHA 1EKEA 1U8BA 2H27A 5EEAA 1O7FA 1D0XA 3VB2A 1AA7A 1BOBA 4R79A 3L2CA 3REOA 4OIRF 4CXFA 3V7SA 2CSOA 2MFZA 3DU6A 2O7OA 2X6OA 3AL0C 2LBFB 1Y1WJ 3JSOA 2P7VB 3A03A 3JW4A 1V5FA 3F22A 5BMZA 3ZQHA 1QO0D 2GAUA 2W84A 4RMNA 4YIRX 3A2KA 4LLNA 3ULQB 1B59A 4UY8I 2V1UA 2F5CA 2RREA 3HRUA 4N4NB 2XF5A 3EPZA 5TJJA 4BHPA 3V8LA 3E3VA 2Y9ZA 2HGCA 4XKWA 3OYCA 3K2ZA 4HSTA 5EEHA 4BQQA 4M9SA 2N8GA 2CV1A 3PQJA 4WXDA 2F5VA 2BYVE 2ZFWA 2XIGA 3BCBA 3HUGB 1FLIA 4EJUA 4BDZA 2W4SA 4M6VA 1FBUA 4KN4X 1PUFB 4XQFA 2BZTA 2HNHA 2Y69H 1B8IA 4E4HA 4YFXF 2QM3A 1EA3A 2CW7A 1Q1VA 4XLHA 1R1VA 3GCMA 2LMDA 3VOEA 2H6BA 1HKSA 2XGEA 2VIXA 2X1DA 3GW2A 2C6YA 3PNYA 1TWGJ 2RAEA 2BW3B 2XVCA 2HEOA 4GDFA 4WF2A 5TRDA 3JRAA 2HDCA 1SFEA 4HNVA 3DWLE 3PSFA 4MEXF 3DPTA 2CH0A 2WB1A 4ENMA 2CV2A 1TLHB 2J5OA 4G7ZF 4IQ4A 4LOCA 3S3MA 2WB1N 4F91B 3GFMA 2DO7A 2FD5A 2NRAC 1PVEA 4A3DJ 4UNOA 3AG3H 3RTRA 2I5UA 3KE2A 4ZZDA 4L9TA 1G3YA 4EEFG 3FDYA 2VQCA 2A69F 3FK7A 1OPCA 2Z99A 1WGXA 4XOTA 2MGQA 1EH8A 1XDUA 2EFNA 2FRHA 3OIPA 3CCRI 2OV7A 1AHDP 3IWFA 3DEUA 1TWHJ 1WJ5A 2OAZA 2VBZA 1JGSA 1G6NA 3DKWA 3BCAA 1IN4A 3OY9A 1O57A 3BZCA 5GPCA 4IPAA 4KITB 4NC6A 1OKRA 2ZMEB 5F0CA 5EGOA 2HS5A 2K7LA 3N4MA 1BR2A 4I02A 3F72A 1ZRCA 1N78A 4FETA 2L7ZA 1P6RA 2GA1A 3H3UA 1Z9CA 4BEHA 2ZJRF 2VXZA 5F0FA 4R8HA 2H1LA 3E7LA 3FXOA 2VOOA 5K5QA 4PDKA 2XB5A 3CF5F 2KIFA 4A3GJ 4I2OA 2WAQA 2G9WA 1PJRA 1T8IA 4IX7A 2EJRA 3KLOA 2Q2EB 1T33A 4D7MA 4PZJA 2JZYA 1I50J 2VONA 2L7KA 4ZTFA 3KPHA 1VZ0A 1IG7A 1FTZA 2LY2A 1B72A 1VF9A 2M0MA 3FXJA 2E2IJ 3I54A 3KZIC 3DF8A 1W5TA 4NHJA 2R5ZB 3DU5A 2L2OA 1FEXA 2HXIA 3ZQCA 2ZXHA 2XAFA 1MNEA 1RRJA 1HC8A 1VQ7I 2LH9A 2XAQA 4CYCB 3J80K 3E6DA 1PDNC 1KU7A 3K1PA 4IHWA 1R1UA 4OU0A 3K4JA 3FISA 3CQZJ 1KU9A 2IGOA 1Y1VJ 3P5JA 1ZH5A 4QPQA 2DAOA 2QQAA 3TGNA 2XRLA 2XPVA 1J09A 3HHGA 5ICGA 2EIKH 5J8CA 4E7ZA 5DM7F 1ZG5A 3BJOA 1YX3A 1VFCA 5L3FA 3L2VA 2JVGA 1O3QA 5CVVA 5HS7A 1XB4A 4XL9A 1IN8A 3KP4A 1RIOH 2XGXA 3LSJA 3J7AY 4V2GA 4BY1J 3WTZA 3LL7A 1FX7A 2F48A 3LWFA 3K7AJ 5KCMA 4C2MJ 4CZCA 1SD5A 3D5LA 1TBXA 1MMGA 2HZDA 3HSEA 3OIQA 1O3RA 5A2QZ 3NARA 3U21A 1X4PA 1QZEA 4Z2YA 5F08A 3V8JA 3GTJJ 3TMOA 4ENNA 1Z3YA 2JQ7A 2E19A 3GMEA 5EDNA 1YJ9I 2V79A 1HKQA 3ABUA 2JA8J 1MH3A 4AIHA 5GP9A 2GZWA 5FLVA 3I56I 4I99C 4NNJA 3J80Z 3HIFA 1NHAA 3F8MA 1YI2I 4CO8A 3TP0A 1D5YA 4E7HA 4A3KJ 1A31A 2IS2A 2CQ7A 2K9MA 2HVQA 3S8PA 2QCOA 3H92A 2EA4A 2TDXA 2E1OA 2CQXA 2HXOA 1S6LA 4I98B 1TT0A 1R23A 3TDUC 1YRNB 2LR8A 1GXPA 2OQGA 2VE8A 2Y9YA 3BR5A 4NB5A 4FCYA 3S1RJ 3CDHA 1XN7A 3Q9SA 1A5JA 4DIQA 3FXKA 5JHUA 1NH3A 2VJ4A 5C3EJ 3BG3A 3HXLA 1OCOH 5F0HA 4A6DA 3OMYA 2VASA 3HPGA 5DTDA 5BNGA 2R7UA 4RB3C 1BOAA 3JRBA 4GYIA 3RKYA 3QOEA 4G9YA 1WZ2A 1MNDA 5J6XA 4BJ6C 1Z21A 4N9IA 1UHMA 4BGDA 3LMMA 3SZTA 2NS0A 3DKXA 4XM3A 3ZOBA 4LJZF 3FWEA 3ECOA 3KLNA 1SVMA 3AFHA 3K4LA 2FNPA 1F4KA 1NK3P 2AXTC 3MQ0A 2FBKA 1JKOC 1VQLI 4DYQA 3ZMSA 1KGSA 3K1MA 5BPIA 3GTGJ 2L9SA 5H6QA 5M3MJ 1IN7A 1BI3A 4DJAA 5IP9J 3PO2J 2EQRA 1ZLJA 3FXLA 3HKZA 4GO1A 2OU2A 1HCRA 3KZZA 1ZYRF 3M8FA 1H8AC 1XMAA 1KQ9A 1U9NA 4NC7A 3NWSA 3HKZN 4BXUA 5FRMA 2Q0OA 1MBFA 5J40A 1YE9A 2ME6A 1KONA 2VJIA 3Q0VA 4CSWA 3E5QA 2ZNYA 5FLXZ 4B4CA 4EM2A 1SD4A 1W7PA 2R5YA 2DPUA 4D5FA 2P81A 2IBDA 4PFPA 4X0GA 3PIOF 3I3LA 2M45A 1DPRA 3FKJA 1SAUA 1Z6TA 3E6CC 1TZLA 5J8FA 4PK4A 2FUG2 3LAPA 2CRGA 1FT9A 2LKPA 2DOAA 4A2UA 1ZR4A 2VPRA 3ZN1A 3G2BA 4M3FA 2E1MC 3ROUA 1T08B 1OR7C 3FX3A 2L7MP 1SAXA 1Z7LA 5DS9A 5TISC 2G7HA 1K83J 2V1XA 1VQ8I 4HZFA 3MFKA 1VQKI 2LOOA 2GXGA 2IA0A 5H6RA 1BBYA 1D1BA 1FSHA 5DD4A 4ZDPA 4HBLA 4ESBA 3OYMA 4HNTA 2QSHX 1YW9A 2ACJA 1W36C 2R7VA 4M3BA 4WXCA 2YX7A 4HF2A 3Q0WA 3A01B 3H3ZA 1C0WA 1VQ4I 4HW0A 3WE2A 2YSRA 1CGPA 3JRFA 4PJJA 2M30A 3M8EA 1R4NB 3W2WA 1T0FA 4AC0A 5DD8A 3RZOJ 2M4GA 3RQIA 4Q47A 3X2QH 5GPAA 2A3SA 1GLNA 2VT2A 3KEYA 3WODF 2JMWA 1ETXA 1AU7A 2PG4A 5AIPA 2JSPA 4XSZF 1RUOA 4IOAF 3PFYA 1RKTA 3CUOA 1POGA 2V6EA 4F7ZA 3HOTA 5HVQC 2FOKA 2R93J 3DCFA 1KQ8A 4XN0A 1A35A 5CVUA 2HQ5A 3H1CA 2HTSA 1WJAA 3T8RA 3MMYB 4ESJA 1A36A 3CJTB 4AM3A 1OCPA 4UXNA 1BI1A 1MH4A 4AIJA 2O3FA 5JR3A 2ECCA 2IS1A 3NQOA 5K7ZA 1P4XA 3C2GA 3PUFA 4MFDA 5D6EA 4LG0A 2M9HA 1LQ1A 1LKXA 2AXLA 3CCUI 4A3JJ 1HW1A 1R1TA 1SVLA 2QBYB 1L3LA 2PMUA 1D5VA 5JFRA 3WHBA 3MZHA 4K2EA 4LIVA 5CVJA 2NNYA 4L0ZB 4U0VA 2LKSA 2OC6A 2PJPA 4LFUA 4Y15A 1ZELA 1S7EA 2M8GX 3GFLA 3FIWA 2UZKA 1DU6A 4EGZA 2ZJPF 2JA2A 4LGWA 4FT8A 3BT9A 3F8BA 4CYDA 2ZNZA 2A5YB 3F8CA 4QLCU 5DCMA 5EF6A 3GWZA 1ZTRA 3KEOA 2ECBA 4C3HJ 3OYGA 3RQ4A 2LREA 1U2WA 2DFFA 3HYIA 3MZ8A 2IP2A 4HLXA 2K9NA 2NYXA 2L01A 1CF7B 1PUEE 3S32A 2A05A 4A12A 2XAHA 2GA2A 1HBXG 5LEKA 2B7EA 3HOWJ 1ULYA 1YQAA 4JK1X 4ZYGA 2P7CB 3I4MJ 2ID6A 2KRHA 2RQQA 4CA0A 4KA4A 2PLYA 1MJAA 4XRSG 4QTRA 4I09A 1FYKA 2I10A 1BJZA 1WJFA 5HNFA 4M6XA 1K4SA 1ZGWA 1U3EM 4F93B 5H20A 1LDKB 1GV5A 3LSTA 1FIPA 2EV0A 1FPQA 3GTMJ 2A07F 2L0KA 2OF7A 2LKXA 3LAJA 2HKOA 2OZ6A 2VXDA 2YS9A 4KDPA 2R92J 3CUQA 3GF2A 3HJEA 3G1LA 4CHUA 1FOYA 1XG1A 4I7HA 1KYWA 4RM3A 1H88C 4EQQA 4NQWA 2BEOA 2DN0A 4AD9A 3IAS2 1IF1A 1FY7A 4TV7A 2DJNA 1IXRC 2BY2A 2DYRH 2OUMA 4PGHA 3MKYB 1I1GA 2A68F 1V55H 1Z3XA 2H8WA 4PCQA 2K9SA 1MBEA 1YX5A 3FXQA 4P55A 4BU2A 1G8XA 1BN5A 2BVMA 3RJPA 1MDMB 3HOUJ 3PSIA 1YW8A 3MWMA 4M9XA 4RBOA 3J7ZI 2D45A 3K1NA 2MSYA 1G3SA 2FMLA 4HA8A 2JUGA 2X51A 3RIRA 1JKPC 4UUVA 2G7UA 4II2A 1XSXA 2JRMA 3OOUA 4KNYA 1WI3A 3OYLA 1LUJB 2EB7A 2NOGA 2PBIA 2RKHA 3GLXA 4MFEA 2PMHA 2ISZA 2WV1A 2R7WA 2XGDA 2EFPA 3D5SC 3WTTC 1BC7C 3QU3A 4AVZA 1XMXA 1MD0A 1T0FC 1BC8C 2DQRA 2E5NA 2P5VA 4KIGA 1JKRC 2TRTA 1XGSA 2ID3A 3ASNH 4FASD 2HZTA 1Z05A 1BM9A 4U7DA 1E17A 1MJBA 1EV7A 4QSHA 3GTKJ 4B48A 2EZLA 3PNVA 1IAWA 4ENKA 1YIJI 4EJOA 4DQ2A 2MH2A 1K79A 4XKBA 1MKMA 3L7WA 2MW8A 3RZDJ 1ZQ3P 2E2JJ 2VUMJ 5K5OA 1W4MA 3CC2I 3S2DJ 3OYHA 1TWAJ 4II3A 2P8TA 2FOWA 4KIBA 1G2HA 3EETA 1IW7F 2PJRB 1P4AA 2XPWA 3D0SA 3GBGA 5J1UA 3U1KA 3LNQA 1J9IA 1XGNA 2QZ8A 1MZBA 5D4SA 2WTEA 3QP6A 4CH7A 3HL2A 5B1BH 1X3UA 4NDLA 1R9TJ 4AIKA 1QZZA 5GADJ 3PO3J 1VQ9I 3BPXA 2A6TA 2X48A 2E7XA 4FX0A 1V5EA 1VQ6I 3FXMA 1SFXA 2WBMA 3J7AO 1YFHA 5B1AH 3IAM2 4OAYA 1TW3A 1B1BA 5JVGF 3NRVA 2O61A 3LSKA 4IZZA 1KU2A 3KYLA 1WQ2A 1TT5B 2HWVA 3SFIA 2CV0A 1REPC 2FBIA 4FTHA 2STWA 3GTLJ 2DDBA 3HB9A 5K7FA 1WJBA 1RETA 5JLXA 4A69C 3I55I 1WFXA 3S3OA 2RN7A 3HOSA 4U88A 1T38A 4HLYA 1VI0A 2DA3A 2R7RA 3BG7A 1T2KA 3EUKL 1BI0A 1RPWA 1J59A 4OOIA 3F9KA 1IDZA 1PP7U 1FMWA 3LQRA 1IRGA 3BQYA 1EH7A 5FKMA 2DYSH 2WADA 1UMQA
chains in the Genus database with same CATH topology
1SD7A 5LRSA 2VT3A 2MD5A 2PN6A 4L5JA 1J7KA 1HXDA 3CUQC 3KZYA 5CJ9A 5E1ZB 4BHCA 4ESFA 4RGXA 1VTNC 1HQCA 1JHFA 4RS8A 2KIUA 4UVCA 1FYMA 2AS5F 4H0EA 3E6BA 2HOEA 3V4GA 2FMYA 1U8RA 3L9FA 2RV8A 3KCCA 4LMYA 1LDDA 4FX4A 4G8XA 5E8IA 4IHSA 2DK8A 3C3WA 3W6KB 4RGRA 4BNCA 4JBAA 3WTSC 3T0YA 3I64A 3RDIA 2VE9A 2DFIA 2B0LA 2FU4A 4GGGA 5D8LB 4R1HA 2Z3YA 2UXNA 1YS6A 1QQIA 1R5GA 4OMYA 5FFZA 2GWRA 4LB6B 3F21A 1S8NA 5CLSA 2ZJ2A 1DDNA 2BBYA 3CLOA 4OMZA 2BE5F 1YG2A 5K5RA 4EM0B 4HV5A 3TOAA 3LQQA 5HDGA 4U0YA 2WV0A 2FBHA 4LB5A 1LNWA 4HDUA 4UVBA 1UFMA 4Q4ZF 3CO7C 3R60A 3I59A 1STZA 2XKOA 1K78A 4PGGA 1J0RA 3WG9A 5D5UB 4BAYA 1XSDA 1SMYF 3HHHA 4MGRA 1F5TA 4ZYEA 4A6EA 3DQVC 1U5TB 2CYYA 3FHZA 3BJAA 2WC2A 3OV8A 1ON1A 4KN7X 1RZ4A 4L5IA 4B8XA 5A2QK 2V1DA 3PQKA 2Y48A 3GZ6A 3E5XA 3G3ZA 3J81K 3EYYA 2Z5UA 1XGMA 4WXHA 1OR7A 3G73A 3KEQA 1T98A 4EJVA 3C18A 5BPDA 4P96A 3IWZA 1OMIA 2EV6A 3QRFF 1Y0UA 5HLHA 3FXUA 1EH6A 4Q48A 3RPUA 5L3GA 3BOQA 5CVRA 2F5FA 1WSUA 1FNNA 1TW2A 3EDPA 3TQNA 4ZH4F 1USTA 1FBSA 3DXJF 3ISPA 4QWQA 3ZMVA 1XDSA 4ETSA 3HRMA 4M73A 2P5KA 1FWZA 2HYGD 3GX4X 4UV9A 2VBXA 1ZG3A 1YW7A 5EEGA 4M9ZA 2E1CA 4U7BA 3J81Z 3TDZC 5HS9A 5D6FA 5K1YA 3BJ6A 1A04A 2ESNA 5F1RA 5L3EA 4L9JA 5FLXK 4MTDA 1XMKA 4XBFA 1QZYA 4RAYA 3B02A 4OINF 1Z1DA 3RKXA 2RQPA 1FSEA 5ED4A 2DT5A 2MC3A 2XKPA 1UCRA 1KYZA 1ZRFA 3EYIA 2L54A 1I5ZA 3I4PA 3GFIA 1H9TA 4G6DA 1IXCA 5E8GA 5FO5A 1LVAA 4HF0A 4L9NA 2E7WA 1I1SA 5JI6A 5BOXA 2BV6A 2BGCA 3U9GA 4S04A 5D8KB 3IRRA 2EV5A 2KKOA 3LA7A 2HQNA 4MHGA 3WTWC 1T6SA 4JQFA 2CWEA 3RI4A 1Z7UA 5DUIA 5LGTA 2DPDA 2IPQX 4A5MA 3O3KA 1FC3A 3V7RA 5L3DA 3MAJA 3CO6C 4ZYDA 1QBJA 5FD5A 3WTUC 1HW5A 2QVOA 2OA4A 5HS8A 2Y75A 2CGPA 3R61A 5E20A 2KIMA 4XLNF 5DDGA 1JXSA 3T1BA 3WU0A 3P7NA 2J5PA 1LEAA 2IA1A 3FMSA 2FNAA 1FP1D 1ONVA 3NEUA 4B09A 4ON0A 2W25A 2W85A 2P6SA 4IJAA 4IHTA 4G7HF 3ABTA 2CW0F 1I6XA 2UWMA 1F1ZA 3DP7A 3F8NA 3BWGA 1GXQA 1GVJA 2VC0A 3VFZA 1P4WA 2PEXA 2H09A 3M1EA 3BP8A 1FZPB 3SZPA 4P9UA 1P92A 3GXOA 3K9TA 5HLGA 4N9HA 1ZGJA 1YIOA 2HR3A 3L09A 3TO9A 1HW2A 2XAJA 3F6OA 1K7AA 3DFGA 1H0MA 4G6QA 2RGVA 4YIFA 1TQMA 4HX7A 5FGMA 2IW5A 1F9NA 2L3DA 3JTHA 1RI7A 3HUGA 2K4JA 4AVPA 1LJ9A 3COAC 2NAZA 3P9IA 4A0ZA 4XLPF 2F5DA 2OQRA 5E18F 1MGTA 3P9CA 3RYRA 5HOOA 1S7AA 1YYVA 5ICFA 3FM5A 1TNSA 4HOBA 1IUYA 4HQMA 4HX8A 1IN6A 1J75A 1S29A 5CYVA 2CFXA 3E5UA 1Q1HA 1XSVA 1TNTA 3GUDA 4N0BA 1Z91A 2VN2A 4OIPF 1RUNA 4FHTA 1ZARA 4RB1A 2OBPA 2K4BA 5D5VB 4EJWA 1HSJA 1G3WA 2IVMA 3IRQA 5F6FA 1UHWA 2PFBA 2IT0A 6PAXA 1DPUA 1SD6A 3WGGA 2O6GE 2VC1A 5ILUA 1TTYA 2MLKA 3ZMTA 2F2EA 5DYMA 3ZN0A 3VEPA 1O3SA 5LHIA 4EMSA 1OYWA 1TQPA 2ZMEA 4A0XA 2CQKA 4Y13A 2XV4S 3JTGA 4HDVA 2RNJA 1G4DA 3JAMZ 2YPRA 3I71A 1KA8A 4HX4A 1AOYA 3HTUA 3R0JA 1DUXC 2Q2EA 1AWCA 3F8FA 3TO7A 2H94A 4UHTA 1W7PB 1BI2A 3TOBA 3HSFA 4LD5A 5D4RA 1KQ0A 1WKMA 1R36A 5LGNA 5JVTA 2JSCA 2VODA 5KVRA 2HTJA 3LA3A 3N97A 2DLLA 4L9VA 4EGYA 1DP7P 2QQBA 3V7CA 2XRNA 3RPQA 1JE8A 1WWXA 4EV0A 1YLFA 1ZAOA 3LA2A 3Q5FA 1U6GA 1ZN2A 1B9MA 2FEZA 4IF4A 2GQQA 2V6CA 3QPTA 2MH9A 1Z6RA 2K86A 1WRJA 2P6TA 3R4KA 3PFIA 3AAFA 1ZLKA 5ICCA 1ZRDA 2DW4A 1BIBA 2DU9A 3SFZA 1IRFA 5FB2A 2L4MA 2D1HA 1W7PD 3GFJA 2D2WA 2YR2A 3HRTA 4GCVA 5HLIA 4LG0B 1BIAA 2GXBA 3GZ5A 3QU6A 4LLGF 5L3BA 2HQRA 1V3FA 1LDJA 4G94A 2X0LA 2WWYA 5KK1A 5DCMB 3M9AA 4I0AA 4CDGA 5LGUA 1I27A 4HF1A 4UV8A 4L0YB 3ZMZA 3E6MA 2LF7A 1D3YA 3DPLC 2EA2A 3R0AA 4RGSA 1U5TC 1ON2A 2ETHA 2DQLA 5HDNA 2NNNA 4XSXF 4KUMA 3BDDA 1FYLA 3I58A 3KP7A 2R7FA 2A6HF 3SHFA 3F6VA 3BROA 1B6AA 3CUQB 4IRHA 2FQ3A 2ZXJA 2QQ9A 4LK1F 4YIIA 1SFUA 2PQ8A 3QP5A 2CO5A 3HRSA 4HYEA 2FE3A 3RYPA 2JT1A 2O0YA 3ZQ7A 3SXYA 2ELHA 1ZGAA 3C7JA 3E97A 5D5WB 3C1DA 2F5EA 2IJLA 2KJCA 2OZUA 3EQLF 2H6CA 1R5HA 5E1XA 4WCGA 5HDKA 4WK8F 1R00A 2RC4A 3I0TA 5E17F 2ZO4A 2HYFA 3CJNA 3MCZA 2ZKZA 3GO5A 4OIQF 4LK0F 5IT9K 3S2WA 1UB9A 5DCFA 5F64A 4GYGA 2VBYA 2GIVA 3R6SA 3I5UA 3FXRA 1SMTA 2QUFA 3WE3A 2M87A 3WTYC 1T39A 1YTYA 2LDUA 2QBYA 3WTXC 3ZMDA 2COMA 2ESHA 3ERED 2FXAA 5AIQA 5E1WA 5L3CA 1V4RA 4EJTA 5ILSA 3EUHA 1FOKA 3QOPA 1PP8F 2D1VA 1WI9A 2L4AA 3O2PE 4HAMA 2XHKA 4RAZA 4HV6A 4BHBA 1IN5A 5FFXA 2L02A 1CF7A 5IT9Z 2Z9OA 4L18B 4I0BA 3ZP5A 2Y0MA 3ECHA 2Z33A 3WTVC 2XROA 1QNTA 1R7JA 2STTA 4Q5SF 4MQ9F 1D8KA 4CICA 1LEBA 5IT3A 4M6YA 1R58A 1XCBA 3BZ6A 1IZ1A 3MEXA 3T8TA 2YX4A 4IVNA 2P5LC 2A6EF 1L0OC 3WGIA 2M5WA 1G3TA 3FZVA 2W24A 3WGHA 1USSA 1MDMA 2EFQA 2LF8A 2YU3A 3KP6A 2HKXA 2KJBA 5DV5A 3DV8A 5CVIA 4RGUA 2ZBKA 2A61A 3F3XA 3KFWX 5AONA 4YFNF 4ENJA 4ZYHA 3TKYA 4OIOF 3GVAA 4BQAA 4WX9A 2VBWA 2QLZA 2RDPA 1QPMA 2K02A 4AWXB 2P4WA 4S05A 2HFHA 1D8JA 2CG4A 4A5NA 3TO6A 1OYYA 1ZREA 1KU3A 2O8XA 1TQIA 2ADUA 3V8KA 2IA2A 3I59B 1K78B 3SQNA 3GEZA 4EVIA 4KFCA 4MTEA 3O6BB 5LBQA 2MA3A 1FBQA 5LRRA 3U2RA 4XRFA 3T5XA 3QPHA 2EK5A 3ZMUA 3KETA 3FMRA 1RNLA 2FA5A 3P9KA 3IC7A 4G7OF 1XGOA 1IXSB 2UXXA 3M7GA 2QYOA 2V9VA 1W5SA 1YO5C 3IL2A 1GHCA 2DK5A 1H9GA 4EM1A 4RB2C 4BH9A 4RB0A 3B73A 4GXOA 2FSWA 5DUKA 2LSOA 2ZCWA 4IXAA 3RKWA 2W57A 2XASA 5LHGA 5LLQA 2M8EA 1O7LA 2DTRA 2PI0A 1BJAA 3ELKA 4KT5C 1MJ9A 5ICEA 1B9NA 4CZZA 1O3TA 2E1NA 4LLLA 2MLGA 1ODDA 3FF5A 2QWWA 3JAMK 3ML6A 3I53A 3FMQA 3KP3A 4D0PA 4ASNA 3BPVA 1J2XA 4O5VA 3WU1B 3Q9VA 4P5OA 5FD6A 1B4AA 4CGZA 3KP5A 3HSRA 1QGPA 4U0WA 4P9FA 3LFKA 1K6OA 5BS6A 2KRFA 5D5XB 5LEJA 4BYYA 1YS7A 1J5YA 3OOPA 4M72A 1XD7A 4MQVA 1JHHA 2O03A 2RVCA 3GYHX 4WWCA 2JTVA 2OD5A 2JRTA 3IHUA 4UVAA 2X4HA 4O3MA 2FF4A 2XUBA 1U78A 4YG2F 2DBBA 5DEQA 3FM3A 1S3JA 4Y17A 1XCVA 4M74A 3IKTA 4DNCA 5ERIA 1U5TA 4MNUA 3IKVA 2JPCA 3KP2A 4IRGA 2ISYA 4O6JA 1ZG1A 1E2XA 1OYIA 3F23A 1ZHFA 3K0LA 4A0YA 2LNBA 1S7OA 4I01A 4HQEA 3VODA 2VOPA 1HKTA 4M71A 2DI3A 1R22A 2XAGA 4KICA 4E70A 3BY6A 3QAHA 3ZPLA 2IRFG 1FP2A 3MZYA 2K27A 4KMFA 2JPBA 5BQTA 3HTSB 4KIFA 4IRIA 5ILVA 2M1BA 1LB2A 4MEYF 2QENA 4KMUX 3JSPA 4YFKF 1P2FA 1HSTA 4ZZLA 2EFWA 2EFOA 3W6JB 3U1DA 2R7DA 2Q8KA 3CTAA 4KYWA 3L00A 2R3SA 2EWNA 3K69A 2MBFA 5LHHA 2H27A 1O7FA 3VB2A 4R79A 3L2CA 3REOA 4OIRF 4CXFA 3V7SA 2CSOA 3JSOA 2P7VB 3JW4A 3F22A 5BMZA 1QO0D 2GAUA 2W84A 4LLNA 3ULQB 1B59A 2V1UA 2F5CA 3HRUA 4BHPA 5TJJA 3V8LA 3E3VA 2HGCA 3K2ZA 5EEHA 4M9SA 3PQJA 4WXDA 2BYVE 2ZFWA 2XIGA 1FLIA 4EJUA 1FBUA 4KN4X 4YFXF 2QM3A 1R1VA 3VOEA 1HKSA 2H6BA 2C6YA 3GW2A 2XVCA 2HEOA 4WF2A 5TRDA 2HDCA 1SFEA 4MEXF 3DPTA 4ENMA 1TLHB 2J5OA 4G7ZF 3GFMA 2DO7A 2NRAC 4UNOA 3RTRA 3KE2A 4ZZDA 4L9TA 1G3YA 2A69F 1OPCA 2Z99A 1EH8A 1XDUA 2EFNA 2FRHA 3IWFA 3DEUA 2OAZA 2VBZA 1JGSA 1G6NA 3DKWA 1IN4A 1O57A 4IPAA 1OKRA 2ZMEB 2HS5A 2K7LA 3N4MA 4I02A 3F72A 1ZRCA 1P6RA 2GA1A 3H3UA 1Z9CA 2VXZA 4R8HA 2VOOA 5K5QA 4PDKA 2KIFA 4I2OA 2G9WA 2EJRA 3KLOA 4PZJA 2JZYA 2VONA 3I54A 3DF8A 1W5TA 4NHJA 2XAFA 2XAQA 1PDNC 3J80K 3E6DA 1KU7A 3K1PA 1R1UA 4OU0A 1KU9A 1ZH5A 2DAOA 2QQAA 3TGNA 3HHGA 5ICGA 5J8CA 1ZG5A 3BJOA 5L3FA 1O3QA 5CVVA 5HS7A 1XB4A 1IN8A 3KP4A 1RIOH 2XGXA 3WTZA 1FX7A 3LWFA 1SD5A 3D5LA 1TBXA 3HSEA 1O3RA 5A2QZ 4Z2YA 3V8JA 4ENNA 2V79A 1HKQA 3ABUA 4AIHA 2GZWA 3J80Z 3HIFA 1NHAA 3F8MA 4CO8A 3H92A 2EA4A 2TDXA 1S6LA 4I98B 1R23A 3TDUC 1GXPA 2OQGA 2VE8A 4NB5A 3CDHA 1XN7A 3Q9SA 5JHUA 4A6DA 4RB3C 1BOAA 4GYIA 3RKYA 4G9YA 5J6XA 4N9IA 1UHMA 3SZTA 2NS0A 4LJZF 3FWEA 3ECOA 3KLNA 2FNPA 1F4KA 3MQ0A 2FBKA 3ZMSA 1KGSA 3K1MA 5BPIA 5H6QA 1IN7A 1BI3A 1ZLJA 4GO1A 2OU2A 3KZZA 1ZYRF 3M8FA 1XMAA 1KQ9A 4BXUA 2Q0OA 3E5QA 2ZNYA 5FLXZ 4EM2A 1SD4A 1W7PA 2DPUA 2M45A 1DPRA 1Z6TA 3E6CC 5J8FA 3LAPA 1FT9A 2LKPA 4A2UA 3ZN1A 3ROUA 3FX3A 1SAXA 2G7HA 2V1XA 4HZFA 3MFKA 2GXGA 2IA0A 5H6RA 1BBYA 1FSHA 5DD4A 4HBLA 4ESBA 1YW9A 2ACJA 4WXCA 2YX7A 4HF2A 3H3ZA 1C0WA 4HW0A 3WE2A 2YSRA 1CGPA 2M30A 3M8EA 1T0FA 5DD8A 4Q47A 2A3SA 2VT2A 3WODF 2PG4A 5AIPA 4XSZF 1RUOA 3CUOA 4F7ZA 3HOTA 5HVQC 2FOKA 1KQ8A 5CVUA 2HTSA 3T8RA 4ESJA 4UXNA 1BI1A 4AIJA 2O3FA 5JR3A 3NQOA 1P4XA 5D6EA 4LG0A 1LQ1A 2AXLA 1HW1A 1R1TA 2QBYB 1L3LA 2PMUA 1D5VA 5JFRA 3MZHA 4K2EA 2NNYA 5CVJA 4L0ZB 4U0VA 2PJPA 4LFUA 4Y15A 3GFLA 2UZKA 4EGZA 4LGWA 4FT8A 3F8BA 4CYDA 2ZNZA 2A5YB 3F8CA 4QLCU 5DCMA 3GWZA 3KEOA 1U2WA 3HYIA 2IP2A 4HLXA 2NYXA 2L01A 1CF7B 1PUEE 4A12A 2XAHA 2GA2A 1HBXG 5LEKA 1ULYA 1YQAA 4JK1X 4ZYGA 2P7CB 4KA4A 2PLYA 1MJAA 4I09A 1FYKA 4M6XA 1U3EM 5H20A 1LDKB 3LSTA 2EV0A 1FPQA 2A07F 4KDPA 3LAJA 2HKOA 2OZ6A 3CUQA 3GF2A 4CHUA 4I7HA 1KYWA 4EQQA 4NQWA 2BEOA 4AD9A 1IF1A 1FY7A 4TV7A 1IXRC 4PGHA 1I1GA 2A68F 4PCQA 3FXQA 4P55A 1BN5A 3RJPA 1MDMB 1YW8A 3MWMA 4M9XA 2D45A 3K1NA 1G3SA 2FMLA 4HA8A 3RIRA 4UUVA 2G7UA 1XSXA 4KNYA 2EB7A 2PBIA 2RKHA 3GLXA 2PMHA 2ISZA 1BC7C 2EFPA 3WTTC 3QU3A 1MD0A 1BC8C 2DQRA 2P5VA 4KIGA 1XGSA 2HZTA 1Z05A 1BM9A 4U7DA 1E17A 1MJBA 1EV7A 1IAWA 4ENKA 4EJOA 4DQ2A 2MH2A 1K79A 1MKMA 3L7WA 5K5OA 1W4MA 2P8TA 4KIBA 3EETA 1IW7F 1P4AA 3D0SA 1J9IA 1XGNA 2QZ8A 1MZBA 5D4SA 2WTEA 3QP6A 1X3UA 4AIKA 1QZZA 3BPXA 2E7XA 4FX0A 1SFXA 3J7AO 1YFHA 1TW3A 1B1BA 3NRVA 2O61A 1KU2A 1WQ2A 2HWVA 1REPC 2FBIA 2STWA 2RN7A 3HOSA 4U88A 1T38A 4HLYA 1T2KA 1BI0A 1J59A 4OOIA 1PP7U 1IRGA 3LQRA 1EH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD7 A;  5LRS A;  2VT3 A;  2MD5 A;  2PN6 A;  4L5J A;  1J7K A;  1HXD A;  3CUQ C;  3KZY A;  5CJ9 A;  5E1Z B;  4BHC A;  4ESF A;  4RGX A;  1VTN C;  1HQC A;  1JHF A;  4RS8 A;  2KIU A;  4UVC A;  1FYM A;  2AS5 F;  4H0E A;  3E6B A;  2HOE A;  3V4G A;  2FMY A;  1U8R A;  3L9F A;  2RV8 A;  3KCC A;  4LMY A;  1LDD A;  4FX4 A;  4G8X A;  5E8I A;  4IHS A;  2DK8 A;  3C3W A;  3W6K B;  4RGR A;  4BNC A;  4JBA A;  3WTS C;  3T0Y A;  3I64 A;  3RDI A;  2VE9 A;  2DFI A;  2B0L A;  2FU4 A;  4GGG A;  5D8L B;  4R1H A;  2Z3Y A;  2UXN A;  1YS6 A;  1QQI A;  1R5G A;  4OMY A;  5FFZ A;  2GWR A;  4LB6 B;  3F21 A;  1S8N A;  5CLS A;  2ZJ2 A;  1DDN A;  2BBY A;  3CLO A;  4OMZ A;  2BE5 F;  1YG2 A;  5K5R A;  4EM0 B;  4HV5 A;  3TOA A;  3LQQ A;  5HDG A;  4U0Y A;  2WV0 A;  2FBH A;  4LB5 A;  1LNW A;  4HDU A;  4UVB A;  1UFM A;  4Q4Z F;  3CO7 C;  3R60 A;  3I59 A;  1STZ A;  2XKO A;  1K78 A;  4PGG A;  1J0R A;  3WG9 A;  5D5U B;  4BAY A;  1XSD A;  1SMY F;  3HHH A;  4MGR A;  1F5T A;  4ZYE A;  4A6E A;  3DQV C;  1U5T B;  2CYY A;  3FHZ A;  3BJA A;  2WC2 A;  3OV8 A;  1ON1 A;  4KN7 X;  1RZ4 A;  4L5I A;  4B8X A;  5A2Q K;  2V1D A;  3PQK A;  2Y48 A;  3GZ6 A;  3E5X A;  3G3Z A;  3J81 K;  3EYY A;  2Z5U A;  1XGM A;  4WXH A;  1OR7 A;  3G73 A;  3KEQ A;  1T98 A;  4EJV A;  3C18 A;  5BPD A;  4P96 A;  3IWZ A;  1OMI A;  2EV6 A;  3QRF F;  1Y0U A;  5HLH A;  3FXU A;  1EH6 A;  4Q48 A;  3RPU A;  5L3G A;  3BOQ A;  5CVR A;  2F5F A;  1WSU A;  1FNN A;  1TW2 A;  3EDP A;  3TQN A;  4ZH4 F;  1UST A;  1FBS A;  3DXJ F;  3ISP A;  4QWQ A;  3ZMV A;  1XDS A;  4ETS A;  3HRM A;  4M73 A;  2P5K A;  1FWZ A;  2HYG D;  3GX4 X;  4UV9 A;  2VBX A;  1ZG3 A;  1YW7 A;  5EEG A;  4M9Z A;  2E1C A;  4U7B A;  3J81 Z;  3TDZ C;  5HS9 A;  5D6F A;  5K1Y A;  3BJ6 A;  1A04 A;  2ESN A;  5F1R A;  5L3E A;  4L9J A;  5FLX K;  4MTD A;  1XMK A;  4XBF A;  1QZY A;  4RAY A;  3B02 A;  4OIN F;  1Z1D A;  3RKX A;  2RQP A;  1FSE A;  5ED4 A;  2DT5 A;  2MC3 A;  2XKP A;  1UCR A;  1KYZ A;  1ZRF A;  3EYI A;  2L54 A;  1I5Z A;  3I4P A;  3GFI A;  1H9T A;  4G6D A;  1IXC A;  5E8G A;  5FO5 A;  1LVA A;  4HF0 A;  4L9N A;  2E7W A;  1I1S A;  5JI6 A;  5BOX A;  2BV6 A;  2BGC A;  3U9G A;  4S04 A;  5D8K B;  3IRR A;  2EV5 A;  2KKO A;  3LA7 A;  2HQN A;  4MHG A;  3WTW C;  1T6S A;  4JQF A;  2CWE A;  3RI4 A;  1Z7U A;  5DUI A;  5LGT A;  2DPD A;  2IPQ X;  4A5M A;  3O3K A;  1FC3 A;  3V7R A;  5L3D A;  3MAJ A;  3CO6 C;  4ZYD A;  1QBJ A;  5FD5 A;  3WTU C;  1HW5 A;  2QVO A;  2OA4 A;  5HS8 A;  2Y75 A;  2CGP A;  3R61 A;  5E20 A;  2KIM A;  4XLN F;  5DDG A;  1JXS A;  3T1B A;  3WU0 A;  3P7N A;  2J5P A;  1LEA A;  2IA1 A;  3FMS A;  2FNA A;  1FP1 D;  1ONV A;  3NEU A;  4B09 A;  4ON0 A;  2W25 A;  2W85 A;  2P6S A;  4IJA A;  4IHT A;  4G7H F;  3ABT A;  2CW0 F;  1I6X A;  2UWM A;  1F1Z A;  3DP7 A;  3F8N A;  3BWG A;  1GXQ A;  1GVJ A;  2VC0 A;  3VFZ A;  1P4W A;  2PEX A;  2H09 A;  3M1E A;  3BP8 A;  1FZP B;  3SZP A;  4P9U A;  1P92 A;  3GXO A;  3K9T A;  5HLG A;  4N9H A;  1ZGJ A;  1YIO A;  2HR3 A;  3L09 A;  3TO9 A;  1HW2 A;  2XAJ A;  3F6O A;  1K7A A;  3DFG A;  1H0M A;  4G6Q A;  2RGV A;  4YIF A;  1TQM A;  4HX7 A;  5FGM A;  2IW5 A;  1F9N A;  2L3D A;  3JTH A;  1RI7 A;  3HUG A;  2K4J A;  4AVP A;  1LJ9 A;  3COA C;  2NAZ A;  3P9I A;  4A0Z A;  4XLP F;  2F5D A;  2OQR A;  5E18 F;  1MGT A;  3P9C A;  3RYR A;  5HOO A;  1S7A A;  1YYV A;  5ICF A;  3FM5 A;  1TNS A;  4HOB A;  1IUY A;  4HQM A;  4HX8 A;  1IN6 A;  1J75 A;  1S29 A;  5CYV A;  2CFX A;  3E5U A;  1Q1H A;  1XSV A;  1TNT A;  3GUD A;  4N0B A;  1Z91 A;  2VN2 A;  4OIP F;  1RUN A;  4FHT A;  1ZAR A;  4RB1 A;  2OBP A;  2K4B A;  5D5V B;  4EJW A;  1HSJ A;  1G3W A;  2IVM A;  3IRQ A;  5F6F A;  1UHW A;  2PFB A;  2IT0 A;  6PAX A;  1DPU A;  1SD6 A;  3WGG A;  2O6G E;  2VC1 A;  5ILU A;  1TTY A;  2MLK A;  3ZMT A;  2F2E A;  5DYM A;  3ZN0 A;  3VEP A;  1O3S A;  5LHI A;  4EMS A;  1OYW A;  1TQP A;  2ZME A;  4A0X A;  2CQK A;  4Y13 A;  2XV4 S;  3JTG A;  4HDV A;  2RNJ A;  1G4D A;  3JAM Z;  2YPR A;  3I71 A;  1KA8 A;  4HX4 A;  1AOY A;  3HTU A;  3R0J A;  1DUX C;  2Q2E A;  1AWC A;  3F8F A;  3TO7 A;  2H94 A;  4UHT A;  1W7P B;  1BI2 A;  3TOB A;  3HSF A;  4LD5 A;  5D4R A;  1KQ0 A;  1WKM A;  1R36 A;  5LGN A;  5JVT A;  2JSC A;  2VOD A;  5KVR A;  2HTJ A;  3LA3 A;  3N97 A;  2DLL A;  4L9V A;  4EGY A;  1DP7 P;  2QQB A;  3V7C A;  2XRN A;  3RPQ A;  1JE8 A;  1WWX A;  4EV0 A;  1YLF A;  1ZAO A;  3LA2 A;  3Q5F A;  1U6G A;  1ZN2 A;  1B9M A;  2FEZ A;  4IF4 A;  2GQQ A;  2V6C A;  3QPT A;  2MH9 A;  1Z6R A;  2K86 A;  1WRJ A;  2P6T A;  3R4K A;  3PFI A;  3AAF A;  1ZLK A;  5ICC A;  1ZRD A;  2DW4 A;  1BIB A;  2DU9 A;  3SFZ A;  1IRF A;  5FB2 A;  2L4M A;  2D1H A;  1W7P D;  3GFJ A;  2D2W A;  2YR2 A;  3HRT A;  4GCV A;  5HLI A;  4LG0 B;  1BIA A;  2GXB A;  3GZ5 A;  3QU6 A;  4LLG F;  5L3B A;  2HQR A;  1V3F A;  1LDJ A;  4G94 A;  2X0L A;  2WWY A;  5KK1 A;  5DCM B;  3M9A A;  4I0A A;  4CDG A;  5LGU A;  1I27 A;  4HF1 A;  4UV8 A;  4L0Y B;  3ZMZ A;  3E6M A;  2LF7 A;  1D3Y A;  3DPL C;  2EA2 A;  3R0A A;  4RGS A;  1U5T C;  1ON2 A;  2ETH A;  2DQL A;  5HDN A;  2NNN A;  4XSX F;  4KUM A;  3BDD A;  1FYL A;  3I58 A;  3KP7 A;  2R7F A;  2A6H F;  3SHF A;  3F6V A;  3BRO A;  1B6A A;  3CUQ B;  4IRH A;  2FQ3 A;  2ZXJ A;  2QQ9 A;  4LK1 F;  4YII A;  1SFU A;  2PQ8 A;  3QP5 A;  2CO5 A;  3HRS A;  4HYE A;  2FE3 A;  3RYP A;  2JT1 A;  2O0Y A;  3ZQ7 A;  3SXY A;  2ELH A;  1ZGA A;  3C7J A;  3E97 A;  5D5W B;  3C1D A;  2F5E A;  2IJL A;  2KJC A;  2OZU A;  3EQL F;  2H6C A;  1R5H A;  5E1X A;  4WCG A;  5HDK A;  4WK8 F;  1R00 A;  2RC4 A;  3I0T A;  5E17 F;  2ZO4 A;  2HYF A;  3CJN A;  3MCZ A;  2ZKZ A;  3GO5 A;  4OIQ F;  4LK0 F;  5IT9 K;  3S2W A;  1UB9 A;  5DCF A;  5F64 A;  4GYG A;  2VBY A;  2GIV A;  3R6S A;  3I5U A;  3FXR A;  1SMT A;  2QUF A;  3WE3 A;  2M87 A;  3WTY C;  1T39 A;  1YTY A;  2LDU A;  2QBY A;  3WTX C;  3ZMD A;  2COM A;  2ESH A;  3ERE D;  2FXA A;  5AIQ A;  5E1W A;  5L3C A;  1V4R A;  4EJT A;  5ILS A;  3EUH A;  1FOK A;  3QOP A;  1PP8 F;  2D1V A;  1WI9 A;  2L4A A;  3O2P E;  4HAM A;  2XHK A;  4RAZ A;  4HV6 A;  4BHB A;  1IN5 A;  5FFX A;  2L02 A;  1CF7 A;  5IT9 Z;  2Z9O A;  4L18 B;  4I0B A;  3ZP5 A;  2Y0M A;  3ECH A;  2Z33 A;  3WTV C;  2XRO A;  1QNT A;  1R7J A;  2STT A;  4Q5S F;  4MQ9 F;  1D8K A;  4CIC A;  1LEB A;  5IT3 A;  4M6Y A;  1R58 A;  1XCB A;  3BZ6 A;  1IZ1 A;  3MEX A;  3T8T A;  2YX4 A;  4IVN A;  2P5L C;  2A6E F;  1L0O C;  3WGI A;  2M5W A;  1G3T A;  3FZV A;  2W24 A;  3WGH A;  1USS A;  1MDM A;  2EFQ A;  2LF8 A;  2YU3 A;  3KP6 A;  2HKX A;  2KJB A;  5DV5 A;  3DV8 A;  5CVI A;  4RGU A;  2ZBK A;  2A61 A;  3F3X A;  3KFW X;  5AON A;  4YFN F;  4ENJ A;  4ZYH A;  3TKY A;  4OIO F;  3GVA A;  4BQA A;  4WX9 A;  2VBW A;  2QLZ A;  2RDP A;  1QPM A;  2K02 A;  4AWX B;  2P4W A;  4S05 A;  2HFH A;  1D8J A;  2CG4 A;  4A5N A;  3TO6 A;  1OYY A;  1ZRE A;  1KU3 A;  2O8X A;  1TQI A;  2ADU A;  3V8K A;  2IA2 A;  3I59 B;  1K78 B;  3SQN A;  3GEZ A;  4EVI A;  4KFC A;  4MTE A;  3O6B B;  5LBQ A;  2MA3 A;  1FBQ A;  5LRR A;  3U2R A;  4XRF A;  3T5X A;  3QPH A;  2EK5 A;  3ZMU A;  3KET A;  3FMR A;  1RNL A;  2FA5 A;  3P9K A;  3IC7 A;  4G7O F;  1XGO A;  1IXS B;  2UXX A;  3M7G A;  2QYO A;  2V9V A;  1W5S A;  1YO5 C;  3IL2 A;  1GHC A;  2DK5 A;  1H9G A;  4EM1 A;  4RB2 C;  4BH9 A;  4RB0 A;  3B73 A;  4GXO A;  2FSW A;  5DUK A;  2LSO A;  2ZCW A;  4IXA A;  3RKW A;  2W57 A;  2XAS A;  5LHG A;  5LLQ A;  2M8E A;  1O7L A;  2DTR A;  2PI0 A;  1BJA A;  3ELK A;  4KT5 C;  1MJ9 A;  5ICE A;  1B9N A;  4CZZ A;  1O3T A;  2E1N A;  4LLL A;  2MLG A;  1ODD A;  3FF5 A;  2QWW A;  3JAM K;  3ML6 A;  3I53 A;  3FMQ A;  3KP3 A;  4D0P A;  4ASN A;  3BPV A;  1J2X A;  4O5V A;  3WU1 B;  3Q9V A;  4P5O A;  5FD6 A;  1B4A A;  4CGZ A;  3KP5 A;  3HSR A;  1QGP A;  4U0W A;  4P9F A;  3LFK A;  1K6O A;  5BS6 A;  2KRF A;  5D5X B;  5LEJ A;  4BYY A;  1YS7 A;  1J5Y A;  3OOP A;  4M72 A;  1XD7 A;  4MQV A;  1JHH A;  2O03 A;  2RVC A;  3GYH X;  4WWC A;  2JTV A;  2OD5 A;  2JRT A;  3IHU A;  4UVA A;  2X4H A;  4O3M A;  2FF4 A;  2XUB A;  1U78 A;  4YG2 F;  2DBB A;  5DEQ A;  3FM3 A;  1S3J A;  4Y17 A;  1XCV A;  4M74 A;  3IKT A;  4DNC A;  5ERI A;  1U5T A;  4MNU A;  3IKV A;  2JPC A;  3KP2 A;  4IRG A;  2ISY A;  4O6J A;  1ZG1 A;  1E2X A;  1OYI A;  3F23 A;  1ZHF A;  3K0L A;  4A0Y A;  2LNB A;  1S7O A;  4I01 A;  4HQE A;  3VOD A;  2VOP A;  1HKT A;  4M71 A;  2DI3 A;  1R22 A;  2XAG A;  4KIC A;  4E70 A;  3BY6 A;  3QAH A;  3ZPL A;  2IRF G;  1FP2 A;  3MZY A;  2K27 A;  4KMF A;  2JPB A;  5BQT A;  3HTS B;  4KIF A;  4IRI A;  5ILV A;  2M1B A;  1LB2 A;  4MEY F;  2QEN A;  4KMU X;  3JSP A;  4YFK F;  1P2F A;  1HST A;  4ZZL A;  2EFW A;  2EFO A;  3W6J B;  3U1D A;  2R7D A;  2Q8K A;  3CTA A;  4KYW A;  3L00 A;  2R3S A;  2EWN A;  3K69 A;  2MBF A;  5LHH A;  2H27 A;  1O7F A;  3VB2 A;  4R79 A;  3L2C A;  3REO A;  4OIR F;  4CXF A;  3V7S A;  2CSO A;  3JSO A;  2P7V B;  3JW4 A;  3F22 A;  5BMZ A;  1QO0 D;  2GAU A;  2W84 A;  4LLN A;  3ULQ B;  1B59 A;  2V1U A;  2F5C A;  3HRU A;  4BHP A;  5TJJ A;  3V8L A;  3E3V A;  2HGC A;  3K2Z A;  5EEH A;  4M9S A;  3PQJ A;  4WXD A;  2BYV E;  2ZFW A;  2XIG A;  1FLI A;  4EJU A;  1FBU A;  4KN4 X;  4YFX F;  2QM3 A;  1R1V A;  3VOE A;  1HKS A;  2H6B A;  2C6Y A;  3GW2 A;  2XVC A;  2HEO A;  4WF2 A;  5TRD A;  2HDC A;  1SFE A;  4MEX F;  3DPT A;  4ENM A;  1TLH B;  2J5O A;  4G7Z F;  3GFM A;  2DO7 A;  2NRA C;  4UNO A;  3RTR A;  3KE2 A;  4ZZD A;  4L9T A;  1G3Y A;  2A69 F;  1OPC A;  2Z99 A;  1EH8 A;  1XDU A;  2EFN A;  2FRH A;  3IWF A;  3DEU A;  2OAZ A;  2VBZ A;  1JGS A;  1G6N A;  3DKW A;  1IN4 A;  1O57 A;  4IPA A;  1OKR A;  2ZME B;  2HS5 A;  2K7L A;  3N4M A;  4I02 A;  3F72 A;  1ZRC A;  1P6R A;  2GA1 A;  3H3U A;  1Z9C A;  2VXZ A;  4R8H A;  2VOO A;  5K5Q A;  4PDK A;  2KIF A;  4I2O A;  2G9W A;  2EJR A;  3KLO A;  4PZJ A;  2JZY A;  2VON A;  3I54 A;  3DF8 A;  1W5T A;  4NHJ A;  2XAF A;  2XAQ A;  1PDN C;  3J80 K;  3E6D A;  1KU7 A;  3K1P A;  1R1U A;  4OU0 A;  1KU9 A;  1ZH5 A;  2DAO A;  2QQA A;  3TGN A;  3HHG A;  5ICG A;  5J8C A;  1ZG5 A;  3BJO A;  5L3F A;  1O3Q A;  5CVV A;  5HS7 A;  1XB4 A;  1IN8 A;  3KP4 A;  1RIO H;  2XGX A;  3WTZ A;  1FX7 A;  3LWF A;  1SD5 A;  3D5L A;  1TBX A;  3HSE A;  1O3R A;  5A2Q Z;  4Z2Y A;  3V8J A;  4ENN A;  2V79 A;  1HKQ A;  3ABU A;  4AIH A;  2GZW A;  3J80 Z;  3HIF A;  1NHA A;  3F8M A;  4CO8 A;  3H92 A;  2EA4 A;  2TDX A;  1S6L A;  4I98 B;  1R23 A;  3TDU C;  1GXP A;  2OQG A;  2VE8 A;  4NB5 A;  3CDH A;  1XN7 A;  3Q9S A;  5JHU A;  4A6D A;  4RB3 C;  1BOA A;  4GYI A;  3RKY A;  4G9Y A;  5J6X A;  4N9I A;  1UHM A;  3SZT A;  2NS0 A;  4LJZ F;  3FWE A;  3ECO A;  3KLN A;  2FNP A;  1F4K A;  3MQ0 A;  2FBK A;  3ZMS A;  1KGS A;  3K1M A;  5BPI A;  5H6Q A;  1IN7 A;  1BI3 A;  1ZLJ A;  4GO1 A;  2OU2 A;  3KZZ A;  1ZYR F;  3M8F A;  1XMA A;  1KQ9 A;  4BXU A;  2Q0O A;  3E5Q A;  2ZNY A;  5FLX Z;  4EM2 A;  1SD4 A;  1W7P A;  2DPU A;  2M45 A;  1DPR A;  1Z6T A;  3E6C C;  5J8F A;  3LAP A;  1FT9 A;  2LKP A;  4A2U A;  3ZN1 A;  3ROU A;  3FX3 A;  1SAX A;  2G7H A;  2V1X A;  4HZF A;  3MFK A;  2GXG A;  2IA0 A;  5H6R A;  1BBY A;  1FSH A;  5DD4 A;  4HBL A;  4ESB A;  1YW9 A;  2ACJ A;  4WXC A;  2YX7 A;  4HF2 A;  3H3Z A;  1C0W A;  4HW0 A;  3WE2 A;  2YSR A;  1CGP A;  2M30 A;  3M8E A;  1T0F A;  5DD8 A;  4Q47 A;  2A3S A;  2VT2 A;  3WOD F;  2PG4 A;  5AIP A;  4XSZ F;  1RUO A;  3CUO A;  4F7Z A;  3HOT A;  5HVQ C;  2FOK A;  1KQ8 A;  5CVU A;  2HTS A;  3T8R A;  4ESJ A;  4UXN A;  1BI1 A;  4AIJ A;  2O3F A;  5JR3 A;  3NQO A;  1P4X A;  5D6E A;  4LG0 A;  1LQ1 A;  2AXL A;  1HW1 A;  1R1T A;  2QBY B;  1L3L A;  2PMU A;  1D5V A;  5JFR A;  3MZH A;  4K2E A;  2NNY A;  5CVJ A;  4L0Z B;  4U0V A;  2PJP A;  4LFU A;  4Y15 A;  3GFL A;  2UZK A;  4EGZ A;  4LGW A;  4FT8 A;  3F8B A;  4CYD A;  2ZNZ A;  2A5Y B;  3F8C A;  4QLC U;  5DCM A;  3GWZ A;  3KEO A;  1U2W A;  3HYI A;  2IP2 A;  4HLX A;  2NYX A;  2L01 A;  1CF7 B;  1PUE E;  4A12 A;  2XAH A;  2GA2 A;  1HBX G;  5LEK A;  1ULY A;  1YQA A;  4JK1 X;  4ZYG A;  2P7C B;  4KA4 A;  2PLY A;  1MJA A;  4I09 A;  1FYK A;  4M6X A;  1U3E M;  5H20 A;  1LDK B;  3LST A;  2EV0 A;  1FPQ A;  2A07 F;  4KDP A;  3LAJ A;  2HKO A;  2OZ6 A;  3CUQ A;  3GF2 A;  4CHU A;  4I7H A;  1KYW A;  4EQQ A;  4NQW A;  2BEO A;  4AD9 A;  1IF1 A;  1FY7 A;  4TV7 A;  1IXR C;  4PGH A;  1I1G A;  2A68 F;  4PCQ A;  3FXQ A;  4P55 A;  1BN5 A;  3RJP A;  1MDM B;  1YW8 A;  3MWM A;  4M9X A;  2D45 A;  3K1N A;  1G3S A;  2FML A;  4HA8 A;  3RIR A;  4UUV A;  2G7U A;  1XSX A;  4KNY A;  2EB7 A;  2PBI A;  2RKH A;  3GLX A;  2PMH A;  2ISZ A;  1BC7 C;  2EFP A;  3WTT C;  3QU3 A;  1MD0 A;  1BC8 C;  2DQR A;  2P5V A;  4KIG A;  1XGS A;  2HZT A;  1Z05 A;  1BM9 A;  4U7D A;  1E17 A;  1MJB A;  1EV7 A;  1IAW A;  4ENK A;  4EJO A;  4DQ2 A;  2MH2 A;  1K79 A;  1MKM A;  3L7W A;  5K5O A;  1W4M A;  2P8T A;  4KIB A;  3EET A;  1IW7 F;  1P4A A;  3D0S A;  1J9I A;  1XGN A;  2QZ8 A;  1MZB A;  5D4S A;  2WTE A;  3QP6 A;  1X3U A;  4AIK A;  1QZZ A;  3BPX A;  2E7X A;  4FX0 A;  1SFX A;  3J7A O;  1YFH A;  1TW3 A;  1B1B A;  3NRV A;  2O61 A;  1KU2 A;  1WQ2 A;  2HWV A;  1REP C;  2FBI A;  2STW A;  2RN7 A;  3HOS A;  4U88 A;  1T38 A;  4HLY A;  1T2K A;  1BI0 A;  1J59 A;  4OOI A;  1PP7 U;  1IRG A;  3LQR A;  1EH7 A; 
#chains in the Genus database with same CATH topology
 1RKW A;  1SD7 A;  1I6H J;  3OYD A;  5LRS A;  2VT3 A;  3DBR B;  2VQH A;  4C3J J;  1TWC J;  2CUE A;  3K4M A;  2MD5 A;  2DT7 B;  3H9J A;  2PN6 A;  4L5J A;  1J7K A;  1HXD A;  3QPS A;  4MIM A;  1JKQ C;  3CES A;  3CUQ C;  3KZY A;  3ABK H;  5CJ9 A;  5E1Z B;  3RCO A;  2K5C A;  4BHC A;  1SVO A;  4ESF A;  4RGX A;  2DTZ A;  1VTN C;  1JHF A;  1HQC A;  4RS8 A;  2R7Z J;  2KIU A;  4UVC A;  4F92 B;  1UG0 A;  3LSP A;  1FYM A;  2AS5 F;  1WJE A;  4H0E A;  1VQO I;  3G1M A;  3S15 J;  3E6B A;  2HOE A;  3V4G A;  1JT0 A;  2FMY A;  3NAU A;  2DJI A;  1U0J A;  3A0B C;  3HDD A;  1U8R A;  5EJC A;  2KZG A;  3L9F A;  4CCJ A;  3CCM I;  2RV8 A;  1R71 A;  1XX5 A;  1UHS A;  1AKH B;  1OCZ H;  3KCC A;  3QYF A;  4LMY A;  1LDD A;  4FX4 A;  4G8X A;  3GTP J;  3KYD B;  5E8I A;  4IHS A;  1O4X A;  1JTY A;  2LK2 A;  2DK8 A;  4KT6 A;  1I3A A;  3C3W A;  3W6K B;  4RGR A;  4Y52 J;  3PUB A;  4BNC A;  4RLQ A;  4JBA A;  2ZME C;  3WTS C;  2XF7 A;  2XC7 A;  4W97 A;  3T0Y A;  3I64 A;  3RDI A;  2VE9 A;  5CKT A;  2DFI A;  2B0L A;  2FU4 A;  4GGG A;  5D8L B;  4Y4R A;  5E3O A;  4R1H A;  1Y39 A;  3H35 A;  4AUX A;  1QPI A;  3M8J A;  3H5N A;  5IYB J;  2Z3Y A;  3UKG A;  3AL0 B;  2UXN A;  1YS6 A;  1QQI A;  3UR3 C;  2Z16 A;  4BBS J;  3BQZ A;  2K9L A;  1R5G A;  2F4I A;  4OMY A;  4UUS B;  2E36 A;  5FFZ A;  2GWR A;  3CCS I;  1MNM C;  4LB6 B;  4A3E J;  1MBK A;  3F21 A;  1S8N A;  5CLS A;  2R7X A;  2ZJ2 A;  3RSN A;  1DDN A;  2BBY A;  4J00 A;  3CLO A;  4OMZ A;  2CQN A;  2BE5 F;  4V19 K;  2M3A A;  2Y2Z A;  1YG2 A;  2R4G A;  1DGR M;  1R6R A;  5K5R A;  4EM0 B;  4IEJ A;  4HV5 A;  3TOA A;  3CCQ I;  3LQQ A;  5HDG A;  4U0Y A;  1X1D A;  1X2N A;  2WV0 A;  5EG0 B;  2FBH A;  1OCR H;  4LB5 A;  1LNW A;  4HDU A;  4UVB A;  4FQG A;  1UFM A;  4KJZ A;  5C4X J;  2DMU A;  4Q4Z F;  3CO7 C;  3R60 A;  3I59 A;  1STZ A;  2XKO A;  3SEZ A;  1K78 A;  4PGG A;  1MBH A;  1X3W B;  3CDI A;  1J0R A;  2R0Q C;  1FMV A;  3WG9 A;  1VQ5 I;  3ESW B;  3OSG A;  5D5U B;  3CLQ A;  3QYE A;  2EZK A;  4BAY A;  2M7A A;  4BQN A;  1SMY F;  1VQP I;  1XSD A;  3HHH A;  4MGR A;  5B66 C;  1F5T A;  4ZYE A;  4A6E A;  4AID A;  2QKM B;  3DQV C;  1U5T B;  2CYY A;  3FHZ A;  3CCV I;  3SJM A;  2B63 J;  4F52 A;  2QSF X;  3BJA A;  2WC2 A;  3S1Q J;  3OV8 A;  2DXI A;  1ON1 A;  4KN7 X;  1RZ4 A;  3M07 A;  4JYK A;  4L5I A;  1H89 C;  4IL6 C;  4B8X A;  5A2Q K;  2CW8 A;  2V1D A;  1RC9 A;  2WY7 Q;  3PQK A;  3LSH A;  3NWT A;  1Z67 A;  5C4J J;  3JR9 A;  1YIT I;  3CC4 I;  1S72 I;  2Y48 A;  3GZ6 A;  1JUS A;  3E5X A;  1LE8 A;  3G3Z A;  1LPQ A;  1IRZ A;  4DGW B;  3J81 K;  2G0E A;  4V2F A;  3N05 A;  3EYY A;  4CCO A;  2Z5U A;  2O8K A;  1UAA A;  1XGM A;  2DMP A;  4WXH A;  1NTC A;  1OR7 A;  1Y0N A;  3G73 A;  3OWT A;  3KEQ A;  1T98 A;  1X1P A;  4EJV A;  3C18 A;  3H9Q A;  3TW7 A;  4P96 A;  5BPD A;  3IWZ A;  4ANJ A;  1OMI A;  2EV6 A;  1CQT A;  3QRF F;  1Y0U A;  5HLH A;  3FXU A;  1EH6 A;  4J01 A;  4BDY A;  3CD6 I;  4XLC A;  2KPM A;  3S1N J;  1QRY A;  2ZC2 A;  4JX5 A;  4Q48 A;  3RPU A;  4IO9 F;  4YEJ A;  3IP4 B;  3S16 J;  5L3G A;  3ASO H;  3BOQ A;  5CVR A;  2F5F A;  2O9L A;  1WSU A;  1FNN A;  1TW2 A;  2V9P A;  2R7O A;  3EDP A;  3TQN A;  5M5X J;  1V5G A;  4ZH4 F;  3AG2 H;  1UST A;  3AKZ A;  3CMA I;  2X6X A;  1FBS A;  3DXJ F;  2OCC H;  3CMM A;  3ISP A;  4QWQ A;  4IOC F;  9ANT A;  2KMU A;  2ZB9 A;  4LIU A;  3A1Y A;  1RES A;  3ZMV A;  1XDS A;  4ETS A;  3CMY A;  3TW6 A;  3HRM A;  2K40 A;  4M73 A;  3KIO A;  2P5K A;  1MMD A;  1FWZ A;  2HYG D;  3GX4 X;  4UV9 A;  3D1N I;  1A6I A;  2VBX A;  3CC7 I;  2BXY A;  2DA4 A;  1ZG3 A;  1YW7 A;  1BW6 A;  5EEG A;  2XPU A;  1BA5 A;  4M9Z A;  1R4M B;  2E1C A;  3C2H A;  4U7B A;  3J81 Z;  3TDZ C;  4NUB A;  2KFD A;  4BJT A;  5HS9 A;  5D6F A;  5K1Y A;  5E3L A;  2KLO A;  3BJ6 A;  3JCU C;  2XB0 X;  4KIS A;  1YJW I;  1A04 A;  2ESN A;  3ABM H;  4YRV A;  3ZGK A;  2LP0 A;  3ZXS A;  3CZ6 A;  5F1R A;  5L3E A;  4L9J A;  2OTJ I;  5FLX K;  4MTD A;  1XMK A;  4E7I A;  2NS8 A;  1QZY A;  4M3D A;  4XBF A;  3ZRG A;  2BOL A;  4RAY A;  5IOY A;  3B02 A;  4OIN F;  1PYV A;  1Z1D A;  1OQY A;  3DBL B;  3A0H C;  1VQN I;  3RKX A;  2RQP A;  1FSE A;  5ED4 A;  2DT5 A;  2MC3 A;  4B47 A;  1ZR2 A;  3GLL A;  2XKP A;  2DMT A;  1UCR A;  2HVS A;  1KYZ A;  3ZQQ A;  1ZRF A;  3L1P A;  3EYI A;  2Y31 A;  2L54 A;  2VB6 A;  1IGN A;  2CFO A;  2EZH A;  1I5Z A;  3H0D A;  4HRI A;  2VKV A;  2BHZ A;  3I4P A;  1V54 H;  1B8I B;  3GFI A;  5FRO A;  1H9T A;  2BXZ A;  3GTO J;  1BR1 A;  4G6D A;  1IXC A;  5E8G A;  2R7T A;  5FO5 A;  1LVA A;  3M1C A;  4HF0 A;  4L9N A;  5EZG A;  1XPX A;  3HGY A;  3UNG C;  2E7W A;  1I1S A;  4UUT A;  5JI6 A;  4UB6 C;  5BOX A;  2BV6 A;  2BGC A;  3U9G A;  4S04 A;  2MAB A;  5D8K B;  1LFB A;  4CCN A;  3SZG A;  3IRR A;  2EV5 A;  1JTX A;  2KKO A;  2IS4 A;  3LA7 A;  2L9R A;  1WCM J;  2HQN A;  3K4N A;  4MHG A;  3WTW C;  1T6S A;  3L2W A;  3HC7 A;  4JQF A;  2CWE A;  3RI4 A;  1Z7U A;  2LYC A;  5DUI A;  3ZQF A;  5LGT A;  4PJN A;  2DPD A;  2IPQ X;  3W3C A;  1MMS A;  4A5M A;  3O3K A;  2HPI A;  4L5E A;  5CQE A;  2MC4 A;  1FC3 A;  3LFU A;  3V7R A;  5L3D A;  1E3O C;  3MAJ A;  3CO6 C;  3ZQG A;  2LRD A;  1GDT A;  4ZYD A;  2BY3 A;  1QBJ A;  5FD5 A;  3WTU C;  3CP8 A;  4E6K G;  1HW5 A;  2QVO A;  1UG2 A;  2OA4 A;  1APL C;  5HS8 A;  4IHY A;  2Y75 A;  2CGP A;  2EIL H;  3R61 A;  1SAN A;  4JP0 A;  2VI6 A;  4A3M J;  3JRE A;  5E20 A;  2KIM A;  4XLN F;  1HDD C;  5DDG A;  1JXS A;  2NVY J;  1EJ9 A;  3T1B A;  1WHU A;  3WU0 A;  3P7N A;  2J5P A;  1LEA A;  2IA1 A;  5EGO B;  3FMS A;  2D5V A;  4A3L J;  2FNA A;  1FP1 D;  1ONV A;  3NEU A;  4B09 A;  4ON0 A;  3SDG A;  4XOP A;  2W25 A;  2QQ8 A;  1A6Q A;  2A5W A;  2L7F P;  2W85 A;  4XN3 A;  3FBI B;  1WJD A;  4BEH B;  2P6S A;  1Y8R B;  1ETO A;  1R5I D;  4IJA A;  2KHM A;  4IHT A;  2DA6 A;  4G7H F;  1Z0X A;  3G1O A;  3DBH B;  3ABT A;  2CW0 F;  1I6X A;  2UWM A;  1F1Z A;  3PIP F;  3DP7 A;  3OL3 A;  3F8N A;  3BWG A;  1GXQ A;  2AO9 A;  2K3P A;  2ZXW H;  4XON A;  4E7K A;  1GVJ A;  2DA1 A;  2VC0 A;  3VFZ A;  2DA7 A;  1P4W A;  2YUS A;  3OYK A;  2K85 A;  3JRI A;  1B72 B;  2PEX A;  2QF7 A;  5J4V A;  4BS9 A;  2V4J C;  3FKI J;  5CQG A;  2H09 A;  2W82 A;  3M1E A;  2LBF A;  4DOZ A;  3BP8 A;  5FKL A;  1FZP B;  3SZP A;  4P9U A;  1P92 A;  2VQG A;  3GXO A;  3K9T A;  5HLG A;  3OYI A;  4XID A;  2VKH A;  1DU0 A;  4N9H A;  2VL8 A;  2E1M B;  2NS7 A;  1XTA A;  4W1U A;  2LY9 A;  1ZGJ A;  1YIO A;  3VYU B;  2HR3 A;  3L09 A;  3TO9 A;  1HW2 A;  2XAJ A;  2ZSI B;  3F6O A;  2ICW G;  5KHD A;  3IH3 A;  3BR3 A;  1WPK A;  1ZKG A;  2OPT A;  1K7A A;  1ETK A;  2KT0 A;  2E35 A;  2GBY A;  3DFG A;  3F0C A;  1H0M A;  2LG4 A;  3S17 J;  3WHC A;  4G6Q A;  2RGV A;  1W0U A;  4YIF A;  1TQM A;  4HX7 A;  5FGM A;  3VYR B;  2IGK A;  2IW5 A;  2XDV A;  1F9N A;  2L3D A;  3JTH A;  1RI7 A;  2IEK A;  2K4J A;  3HUG A;  4AVP A;  2IS6 A;  2MYS A;  1PUF A;  5JHF A;  2CJJ A;  1SEU A;  1LJ9 A;  3COA C;  2NAZ A;  1OLT A;  3P9I A;  2I8D A;  4A0Z A;  4XLP F;  2F5D A;  2OQR A;  4M3E A;  5E18 F;  1MGT A;  3ZQI A;  3P9C A;  3RYR A;  4G6T B;  1HOM A;  5HOO A;  1S7A A;  1YYV A;  2AQF A;  5ICF A;  2E2H J;  1NG7 A;  3FM5 A;  1TNS A;  4HOB A;  2UUZ A;  1IUY A;  2BW3 A;  4HQM A;  4HX8 A;  1IN6 A;  1J75 A;  1S29 A;  5CYV A;  2CFX A;  1ACI A;  3E5U A;  1Q1H A;  2CUZ A;  1XSV A;  2BHY A;  1TNT A;  2X1E A;  3GUD A;  4N0B A;  1E3H A;  1Z91 A;  2VN2 A;  4OIP F;  1RUN A;  4LIT A;  4FHT A;  1ZAR A;  5IP6 A;  4RB1 A;  2OBP A;  4HG2 A;  2K4B A;  5D5V B;  4EJW A;  1BL0 A;  4HSR A;  5B5E C;  1HSJ A;  2LFB A;  1G3W A;  4BXX J;  1F36 A;  3TED A;  2IVM A;  3IRQ A;  4AYB N;  5F6F A;  3AG4 H;  3HEF A;  3JRG A;  3H3V K;  3HGG A;  2GXA A;  1K61 A;  1UHW A;  3ERM A;  2PFB A;  1JJ6 C;  3WG7 H;  2IT0 A;  6PAX A;  1DPU A;  2V26 A;  1SD6 A;  3WGG A;  2O6G E;  2VC1 A;  1FIA A;  3BG5 A;  2CMP A;  3G4S I;  2JUC A;  3BR2 A;  3CJQ B;  3K6G A;  5ILU A;  2Y30 A;  2EZI A;  1TTY A;  2MLK A;  2X9D A;  3ZMT A;  4F3Q A;  2F2E A;  3JRD A;  5DYM A;  3ZN0 A;  3O8G A;  3QQA A;  1X3Z B;  2GOM A;  2Y0S N;  3VEP A;  2CQQ A;  3VDX A;  1O3S A;  5LHI A;  4EMS A;  1OYW A;  1ETQ A;  1TQP A;  1QHG A;  2JA5 J;  1FOX A;  2ZME A;  4A0X A;  2KIQ A;  2OTL I;  2CQK A;  4Y13 A;  1W36 D;  2XV4 S;  4BY7 J;  3JTG A;  4HDV A;  1GVD A;  5HLT A;  3K2A A;  2WY8 Q;  1N75 A;  2E71 A;  2RNJ A;  2V9K A;  1WH5 A;  3S93 A;  1G4D A;  2L9V A;  3VSK A;  3JAM Z;  2YPR A;  3GZN B;  3I71 A;  1TC3 C;  3BTJ A;  3BZK A;  4E7S A;  1KA8 A;  3PJR A;  2X6Y A;  4HX4 A;  4GFB A;  4XRM A;  1AOY A;  2VQL A;  3HTU A;  3R0J A;  1D1A A;  1DUX C;  2Q2E A;  1AWC A;  5J3L A;  3F8F A;  3TO7 A;  2H94 A;  4UHT A;  2ZXI A;  3IH4 A;  2R7S A;  1W7P B;  2R5Y B;  1BI2 A;  2QKL B;  3TOB A;  2JA7 J;  2DOF A;  3OS2 A;  1LFP A;  1N77 A;  2K3F A;  3W2A A;  1YHQ I;  3HSF A;  4HNU A;  4LD5 A;  5D4R A;  1KQ0 A;  2VJ5 A;  1E3P A;  2R5Z A;  1WKM A;  4IKF A;  2X1C A;  3DTE A;  3OS1 A;  1R49 A;  3OYF A;  2Z2S B;  2GOX B;  3I4N J;  1R36 A;  1X58 A;  2KRC A;  4CYC A;  1S9H A;  5LGN A;  5JVT A;  3BR0 A;  2QGU A;  2ZFU A;  5KAF C;  2JSC A;  3H0G J;  2VOD A;  5KVR A;  2HTJ A;  3LA3 A;  5E79 C;  3CF2 A;  3N97 A;  3JRC A;  2DLL A;  3MKW B;  4EAT A;  4L9V A;  4EGY A;  3DPU A;  1DP7 P;  2QQB A;  3M3Y J;  3V7C A;  5HOD A;  2XRN A;  3RPQ A;  1JE8 A;  2HDD A;  1WWX A;  2BY0 A;  1VQM I;  4EV0 A;  3E0J B;  1YLF A;  4XLE A;  5JLW A;  3H9G A;  2P0W A;  1ZAO A;  2DCE A;  4MLO A;  5GAG J;  4DYR A;  4Z6Y A;  1QHH D;  3DTK A;  4RA2 A;  1ETY A;  3LA2 A;  1K6Y A;  2JA6 J;  3Q5F A;  4Y33 A;  2DMN A;  2JJ7 A;  3ZCO A;  2XSJ C;  1U6G A;  1ZN2 A;  1B9M A;  2DT6 A;  2FEZ A;  1D1C A;  1Y6I A;  3OIO A;  4IF4 A;  4U87 A;  2GQQ A;  2V6C A;  2FX0 A;  3QPT A;  2MH9 A;  3MKZ A;  1Z6R A;  4BQO A;  3Q0U A;  2CU7 A;  2K86 A;  4BUP A;  1MBG A;  1WRJ A;  3AG1 H;  1IUF A;  1IDY A;  2P6T A;  1LFU P;  3R4K A;  3PFI A;  3AAF A;  4XMY A;  2QA4 I;  1ZLK A;  5ICC A;  1ZRD A;  4C30 A;  2DW4 A;  1QVU A;  5LD2 C;  5FJ8 J;  1BIB A;  2DU9 A;  3SFZ A;  1WH7 A;  5EYR A;  1IRF A;  1BR4 A;  5J4Y A;  5FB2 A;  2L4M A;  5EZH A;  4IHX A;  2K9Q A;  2D1H A;  1W7P D;  1W5C C;  2D2W A;  3GFJ A;  5E3N A;  1D0Z A;  2YR2 A;  3HRT A;  4GCV A;  5HLI A;  1YJN I;  3GTQ J;  4LG0 B;  4NBQ A;  1BIA A;  4XLA A;  3L2R A;  2GXB A;  2DFH A;  1TL8 A;  3GZ5 A;  1JT6 A;  1YRN A;  1MIJ A;  4IQJ A;  3QU6 A;  4LLG F;  5L3B A;  2HQR A;  5F27 A;  2KDZ A;  1V3F A;  2DA2 A;  1LDJ A;  3PL8 A;  4G94 A;  3S3N A;  3G71 I;  2NOJ B;  4B44 A;  1DGW Y;  1M1E B;  2GIZ A;  3MN2 A;  4RAF A;  4CCL A;  2X0L A;  2WWY A;  4JOM A;  5KK1 A;  4N4O B;  5DCM B;  3M9A A;  4I0A A;  2LY1 A;  4CDG A;  2IGM A;  3K10 A;  4F55 A;  4FIS A;  5LGU A;  1I27 A;  4HF1 A;  3VPR A;  4BXF A;  4UV8 A;  1UZC A;  2JWT A;  4L0Y B;  4ZDL A;  3ZMZ A;  2W00 A;  4JX4 A;  1JUM A;  3L2Q A;  3E6M A;  2LF7 A;  4ZDO A;  1D3Y A;  3DPL C;  3PM1 A;  1MMA A;  2EA2 A;  3R0A A;  2IGN A;  4RGS A;  1U5T C;  1ETV A;  1ON2 A;  4HPQ A;  2ETH A;  2DQL A;  3H5A A;  5HDN A;  2DFE A;  3S2H J;  4XOR A;  4JX6 A;  2NNN A;  4XSX F;  4KUM A;  3BDD A;  1FYL A;  3I58 A;  2IXS A;  3KP7 A;  4MO7 A;  3BLY A;  2R7F A;  4ZYA A;  2A6H F;  2E34 A;  3F6V A;  3HM5 A;  3BRO A;  2PX9 A;  3SHF A;  1B6A A;  3CUQ B;  4IRH A;  1F43 A;  3K70 D;  3MVP A;  2FQ3 A;  2ZXJ A;  2QQ9 A;  2F4M B;  4NQW B;  1S5L C;  4LK1 F;  3LSR A;  1P7I A;  5IPA A;  1WVR A;  3H36 A;  4YII A;  2DOE A;  4C3I J;  3QWL A;  2DOD A;  1HDP A;  1SFU A;  2PQ8 A;  2O5R A;  4BAC A;  3QP5 A;  2CO5 A;  4PUS A;  3HRS A;  4HYE A;  2FQ4 A;  2FE3 A;  3RYP A;  2JT1 A;  2O0Y A;  4PJM A;  4C2T A;  2ZSH B;  2MD0 A;  3ZQ7 A;  4BE2 A;  3BR1 A;  3SXY A;  2ELH A;  2XF6 A;  1QU3 A;  1ZGA A;  1D0Y A;  5E3M A;  3C7J A;  2V7F A;  3B6A A;  3E97 A;  2WAF A;  3VSL A;  4CCM A;  3LSI A;  3DEW A;  2VKE A;  5D5W B;  2UV1 A;  3C1D A;  2F5E A;  3A01 A;  2IJL A;  2KJC A;  2OZU A;  4PJ0 C;  3EQL F;  2H6C A;  1R5H A;  5HNH A;  5E1X A;  4WCG A;  1YOV B;  2JN6 A;  5HDK A;  2M7B A;  1T56 A;  4UB8 C;  4WK8 F;  1RR7 A;  1R00 A;  1FJL A;  2GM4 A;  1X4O A;  2RC4 A;  5GAE J;  1EF4 A;  3I0T A;  5E17 F;  4BE1 A;  3ONQ A;  1MBJ A;  2HU9 A;  2ZO4 A;  2HYF A;  3CJN A;  1HLV A;  3MCZ A;  2ZKZ A;  3GO5 A;  3DLA A;  4OIQ F;  4LK0 F;  5IT9 K;  3S2W A;  2XGC A;  5KAI C;  1UB9 A;  1X1B A;  1U9O A;  5DCF A;  2WAQ N;  5F64 A;  4Y3O A;  4GYG A;  2M2E A;  1GUU A;  2VBY A;  2GIV A;  4QIW N;  3R6S A;  1BW5 A;  2EIM H;  1MSE C;  3QYB A;  2XAU A;  3K4C A;  3I5U A;  3FXR A;  1SMT A;  2QUF A;  3DKY A;  2HPM A;  4XR6 A;  4P1W A;  3WE3 A;  2M87 A;  4XK4 A;  2VLA A;  5FLM J;  4OWR B;  2KP6 A;  2KZV A;  4PSX A;  2QSG X;  5IYD J;  1NK2 P;  3WTY C;  1T39 A;  3LSM A;  1YTY A;  3LOC A;  4A3C J;  2W7N A;  4RM2 A;  1X2M A;  3VWB A;  2LDU A;  2QBY A;  3WTX C;  1FTT A;  3ZMD A;  2COM A;  2EH3 A;  2ESH A;  3ERE D;  2FXA A;  3OYE A;  2JK3 A;  5AIQ A;  5E1W A;  5L3C A;  1JGG A;  1V4R A;  1ZK8 A;  2ME0 A;  4EJT A;  1DQU A;  5ILS A;  3DTI A;  4D5C A;  3EUH A;  1FOK A;  3TBI A;  3V42 A;  3QOP A;  1PP8 F;  5F1J A;  2D1V A;  2H8R A;  1WI9 A;  4A3F J;  5FKO A;  2L4A A;  3VYS B;  3O2P E;  4HAM A;  2LD5 A;  3M4O J;  2XHK A;  3TL4 X;  4RAZ A;  4HV6 A;  4BHB A;  1IN5 A;  5J1Y A;  5FFX A;  2VPL A;  2L02 A;  2M4K A;  4YEL A;  1CF7 A;  5IT9 Z;  3MD2 A;  2Z9O A;  4L18 B;  4I0B A;  1P9Q C;  3ZP5 A;  1UEL B;  2Y0M A;  3A4C A;  3ECH A;  2COB A;  3BG6 A;  3WTV C;  2Z33 A;  2XRO A;  1QNT A;  1R7J A;  4RDU A;  2STT A;  4Q5S F;  4C2U A;  4MQ9 F;  2LVS A;  1D8K A;  4CIC A;  1LEB A;  4H4K C;  1G59 A;  2EBI A;  3CJR B;  5IT3 A;  2QEX I;  4M6Y A;  1R58 A;  4XNF A;  3LSG A;  1XCB A;  1IJW C;  1I3Q J;  4DZP A;  3IUO A;  3BZ6 A;  1IZ1 A;  3MEX A;  3T8T A;  2YX4 A;  3SYT A;  2ELK A;  4IVN A;  2P5L C;  2A6E F;  1L0O C;  2HVR A;  1KZH A;  3WGI A;  4B1R A;  3CCE I;  2NVU B;  2L5Q A;  2M5W A;  4DBR A;  5KNL A;  3OYN A;  1G3T A;  1OFC X;  2LLK A;  3FZV A;  2W24 A;  3MKL A;  1VND A;  3WGH A;  1USS A;  4BE0 A;  1MDM A;  3QPL A;  3FK6 A;  3OL4 A;  2EFQ A;  3HOX J;  2LF8 A;  4D7N A;  1JJ8 C;  2YU3 A;  3KP6 A;  2HKX A;  1TP4 A;  3O8H A;  4A93 J;  1IRX A;  2HQA A;  2KJB A;  5DV5 A;  1JI8 A;  3DV8 A;  5CVI A;  5TGT A;  2HYJ A;  4XRS A;  4RGU A;  1X19 A;  2AQE A;  2GLO A;  1I39 A;  4ZJZ A;  2ZBK A;  2XSD C;  5B3S H;  2A61 A;  2B9S A;  1QVT A;  2NVX J;  3F3X A;  3KFW X;  4X6A J;  5AON A;  4A3B J;  3H5R A;  4YFN F;  4ZYH A;  4ENJ A;  3OS0 A;  3TKY A;  4OIO F;  3GVA A;  4BKX A;  4BQA A;  4WX9 A;  2VBW A;  4HEA 2;  2Z1D A;  2QLZ A;  2OCE A;  2BY1 A;  4DW6 A;  4IHV A;  2RDP A;  1QPM A;  2K02 A;  2PJR A;  5K7H A;  4AWX B;  4FE4 A;  3ZQL A;  3ABL H;  3B6C A;  2P4W A;  1WJC A;  1Y56 A;  4S05 A;  2ELJ A;  2HFH A;  2X85 A;  1D8J A;  2CG4 A;  5GTH C;  4A5N A;  1QA6 A;  3TO6 A;  2E5Z A;  1OYY A;  2F6C A;  2W48 A;  4ZC3 A;  1ZRE A;  1KU3 A;  2O8X A;  3HZJ A;  1TQI A;  2ADU A;  2L9N A;  3V8K A;  3OYA A;  3CCJ I;  3CCL I;  2IA2 A;  2NXN B;  3DEE A;  3I59 B;  3KX2 A;  3K4K A;  1K78 B;  3SQN A;  3GEZ A;  4EVI A;  5F04 A;  4KFC A;  4MTE A;  3SDB A;  3EUH C;  4PFO A;  3O6B B;  5M5Y J;  5LBQ A;  2MA3 A;  1FBQ A;  4DZJ A;  3I9V 2;  1HA8 A;  5LRR A;  5CPR B;  3U2R A;  4XRF A;  4D9J A;  1HF0 A;  3T5X A;  3QPH A;  2F4O B;  3J7Y J;  4CCK A;  2IAI A;  2EK5 A;  3ZMU A;  1P7J A;  3KET A;  3HG9 A;  3FMR A;  1LVK A;  5J1R A;  1RNL A;  2FA5 A;  2MG4 A;  3P9K A;  1MW7 A;  4E7J A;  5C44 J;  3IC7 A;  4ABZ A;  1DP3 A;  1ETW A;  3L2U A;  4PSW A;  3W2V A;  1RR8 C;  1XGO A;  4G7O F;  1IXS B;  1LE8 B;  2UXX A;  3M7G A;  2QYO A;  2V9V A;  3BTC A;  4FE7 A;  1W5S A;  5J47 A;  4BL0 B;  2JVH A;  2EIJ H;  4AU7 A;  3S1M J;  1TWF J;  2EPF A;  1YO5 C;  4XIC A;  3W6V A;  3IL2 A;  3VYT B;  1GHC A;  2DK5 A;  2DMQ A;  4M3G A;  5IYC J;  1H9G A;  2E60 A;  2HOA A;  4EM1 A;  5IOZ A;  4RB2 C;  4BH9 A;  4RB0 A;  3B73 A;  4GXO A;  2FSW A;  3TP3 A;  5DUK A;  2LSO A;  2ZCW A;  4IXA A;  3RKW A;  1E0E A;  4ZTJ A;  2W57 A;  2KL4 A;  1OIS A;  2XAS A;  2BVL A;  4NC8 A;  5LHG A;  5LLQ A;  3BTI A;  1IV6 A;  4XLF A;  2M8E A;  3CDL A;  1O7L A;  4X1E A;  1Y8Q B;  2DTR A;  1AKH A;  1T95 A;  2PI0 A;  1BJA A;  3ELK A;  3G6E I;  4KT5 C;  3HBL A;  2EIN H;  2HOT A;  1MJ9 A;  2PMZ A;  4PJL A;  5ICE A;  1B9N A;  4CZZ A;  3BG9 A;  2LC2 A;  4XKV A;  4E7L A;  1O3T A;  2E1N A;  4LLL A;  5H2F C;  2ZJQ F;  2MLG A;  2PMZ N;  3QOD A;  1ODD A;  3FF5 A;  3S14 J;  5FKK A;  2QWW A;  3OSF A;  1MSF C;  2HDW A;  3JAM K;  4I76 A;  3ML6 A;  3I53 A;  3FMQ A;  3KP3 A;  1MMN A;  3C2B A;  2CUF A;  4D0P A;  4ASN A;  4AYB A;  3BPV A;  2KIS A;  1J2X A;  4O5V A;  3WU1 B;  1IO2 A;  2HI3 A;  2DA5 A;  4UUS A;  3Q9V A;  4P5O A;  5FD6 A;  4ITV A;  1B4A A;  4CGZ A;  3KP5 A;  3HSR A;  2LTP A;  1QGP A;  4BJ5 C;  4U0W A;  2YU9 J;  2AHQ A;  1OJL A;  4P9F A;  3IH2 A;  4S0H B;  3IV5 A;  2NVQ J;  3LFK A;  3FHN A;  3D5R C;  1SFO J;  1K6O A;  4BBR J;  5BS6 A;  2KRF A;  4DBQ A;  1X1A A;  3WU2 C;  2Y0S A;  5D5X B;  5LEJ A;  3BR6 A;  4BYY A;  1GV2 A;  2VJJ A;  1YS7 A;  1J5Y A;  4GRI A;  3OOP A;  4M72 A;  2H1K A;  1XD7 A;  3DLL F;  3A02 A;  4MQV A;  1UJ8 A;  5EG0 A;  1JHH A;  3K4B A;  2NVT J;  2RNG A;  2O03 A;  4OAZ A;  4DYC A;  2M34 A;  3RPU D;  2RVC A;  3GYH X;  4WWC A;  1ORK A;  2JTV A;  2OD5 A;  1IC8 A;  4C9Y A;  2JRT A;  3IHU A;  3HOZ J;  3OR2 C;  1IV8 A;  5FKN A;  3OYJ A;  4UVA A;  1XC5 A;  2X4H A;  4O3M A;  2FF4 A;  2XUB A;  1U78 A;  2HOS A;  4YG2 F;  2DBB A;  2WAE A;  2W1O A;  5DEQ A;  3CP2 A;  3FM3 A;  1S3J A;  4Y17 A;  4G12 A;  1XCV A;  2M0C A;  4M74 A;  3CCY A;  3IKT A;  4DNC A;  5ERI A;  1U5T A;  4MNU A;  3IKV A;  2JPC A;  3KP2 A;  4IRG A;  2ISY A;  4I6Z A;  4O6J A;  1ZG1 A;  1E2X A;  5IP7 J;  3HOV J;  3HPH A;  1OYI A;  3F23 A;  2V1N A;  1ZHF A;  2FJ1 A;  2VKD A;  3K0L A;  4B43 A;  3Q3S A;  1JUP A;  4A0Y A;  3BTL A;  2LNB A;  5GTI C;  1S7O A;  4I01 A;  1ENH A;  2WA0 A;  4HQE A;  1X1C A;  4A3I J;  2OJE D;  5M3F J;  5M5W J;  3KYC B;  3K70 C;  3VOD A;  4D1Q A;  3E1S A;  2VOP A;  1HKT A;  2KDO A;  1W0T A;  3OR1 C;  4M71 A;  2DI3 A;  1ITY A;  3FBN B;  1Z77 A;  2Q1Z B;  3CME I;  1R22 A;  2XAG A;  4KIC A;  4E70 A;  3BY6 A;  2DDA A;  3QAH A;  4CUG A;  3ZPL A;  2IRF G;  4XKC A;  3HOY J;  1FP2 A;  1SC7 A;  1GT0 C;  4LG3 A;  3MZY A;  2K27 A;  2KQR A;  3PNT A;  4Y7N J;  4KMF A;  2TCT A;  2JPB A;  5BQT A;  1OCC H;  3HTS B;  3JRH A;  1NG6 A;  4KIF A;  1SFK A;  4IRI A;  3EUA A;  5ILV A;  2M1B A;  1LB2 A;  4MEY F;  2QEN A;  4QPO A;  3BC8 A;  4KMU X;  3SEQ A;  3JSP A;  3RKQ A;  4YFK F;  2X6W A;  5GAH J;  1W1W E;  1P2F A;  4B3A A;  1ERD A;  1FOW A;  5LFA A;  5FRN A;  1HST A;  1K4T A;  2R7Q A;  4ZZL A;  2CUJ A;  2EFW A;  2EFO A;  1N25 A;  3OYB A;  3W6J B;  3U1D A;  5DM6 F;  2R7D A;  5IY5 H;  2Q8K A;  3ZR8 X;  3CTA A;  4J19 A;  4KYW A;  3L00 A;  1XS9 A;  1OCT C;  2R3S A;  2CS3 A;  2EWN A;  3K69 A;  2MBF A;  4B3X A;  4RAG A;  4RLF A;  5LHH A;  1EKE A;  1U8B A;  2H27 A;  5EEA A;  1O7F A;  1D0X A;  3VB2 A;  1AA7 A;  1BOB A;  4R79 A;  3L2C A;  3REO A;  4OIR F;  4CXF A;  3V7S A;  2CSO A;  2MFZ A;  3DU6 A;  2O7O A;  2X6O A;  3AL0 C;  2LBF B;  1Y1W J;  3JSO A;  2P7V B;  3A03 A;  3JW4 A;  1V5F A;  3F22 A;  5BMZ A;  3ZQH A;  1QO0 D;  2GAU A;  2W84 A;  4RMN A;  4YIR X;  3A2K A;  4LLN A;  3ULQ B;  1B59 A;  4UY8 I;  2V1U A;  2F5C A;  2RRE A;  3HRU A;  4N4N B;  2XF5 A;  3EPZ A;  5TJJ A;  4BHP A;  3V8L A;  3E3V A;  2Y9Z A;  2HGC A;  4XKW A;  3OYC A;  3K2Z A;  4HST A;  5EEH A;  4BQQ A;  4M9S A;  2N8G A;  2CV1 A;  3PQJ A;  4WXD A;  2F5V A;  2BYV E;  2ZFW A;  2XIG A;  3BCB A;  3HUG B;  1FLI A;  4EJU A;  4BDZ A;  2W4S A;  4M6V A;  1FBU A;  4KN4 X;  1PUF B;  4XQF A;  2BZT A;  2HNH A;  2Y69 H;  1B8I A;  4E4H A;  4YFX F;  2QM3 A;  1EA3 A;  2CW7 A;  1Q1V A;  4XLH A;  1R1V A;  3GCM A;  2LMD A;  3VOE A;  2H6B A;  1HKS A;  2XGE A;  2VIX A;  2X1D A;  3GW2 A;  2C6Y A;  3PNY A;  1TWG J;  2RAE A;  2BW3 B;  2XVC A;  2HEO A;  4GDF A;  4WF2 A;  5TRD A;  3JRA A;  2HDC A;  1SFE A;  4HNV A;  3DWL E;  3PSF A;  4MEX F;  3DPT A;  2CH0 A;  2WB1 A;  4ENM A;  2CV2 A;  1TLH B;  2J5O A;  4G7Z F;  4IQ4 A;  4LOC A;  3S3M A;  2WB1 N;  4F91 B;  3GFM A;  2DO7 A;  2FD5 A;  2NRA C;  1PVE A;  4A3D J;  4UNO A;  3AG3 H;  3RTR A;  2I5U A;  3KE2 A;  4ZZD A;  4L9T A;  1G3Y A;  4EEF G;  3FDY A;  2VQC A;  2A69 F;  3FK7 A;  1OPC A;  2Z99 A;  1WGX A;  4XOT A;  2MGQ A;  1EH8 A;  1XDU A;  2EFN A;  2FRH A;  3OIP A;  3CCR I;  2OV7 A;  1AHD P;  3IWF A;  3DEU A;  1TWH J;  1WJ5 A;  2OAZ A;  2VBZ A;  1JGS A;  1G6N A;  3DKW A;  3BCA A;  1IN4 A;  3OY9 A;  1O57 A;  3BZC A;  5GPC A;  4IPA A;  4KIT B;  4NC6 A;  1OKR A;  2ZME B;  5F0C A;  5EGO A;  2HS5 A;  2K7L A;  3N4M A;  1BR2 A;  4I02 A;  3F72 A;  1ZRC A;  1N78 A;  4FET A;  2L7Z A;  1P6R A;  2GA1 A;  3H3U A;  1Z9C A;  4BEH A;  2ZJR F;  2VXZ A;  5F0F A;  4R8H A;  2H1L A;  3E7L A;  3FXO A;  2VOO A;  5K5Q A;  4PDK A;  2XB5 A;  3CF5 F;  2KIF A;  4A3G J;  4I2O A;  2WAQ A;  2G9W A;  1PJR A;  1T8I A;  4IX7 A;  2EJR A;  3KLO A;  2Q2E B;  1T33 A;  4D7M A;  4PZJ A;  2JZY A;  1I50 J;  2VON A;  2L7K A;  4ZTF A;  3KPH A;  1VZ0 A;  1IG7 A;  1FTZ A;  2LY2 A;  1B72 A;  1VF9 A;  2M0M A;  3FXJ A;  2E2I J;  3I54 A;  3KZI C;  3DF8 A;  1W5T A;  4NHJ A;  2R5Z B;  3DU5 A;  2L2O A;  1FEX A;  2HXI A;  3ZQC A;  2ZXH A;  2XAF A;  1MNE A;  1RRJ A;  1HC8 A;  1VQ7 I;  2LH9 A;  2XAQ A;  4CYC B;  3J80 K;  3E6D A;  1PDN C;  1KU7 A;  3K1P A;  4IHW A;  1R1U A;  4OU0 A;  3K4J A;  3FIS A;  3CQZ J;  1KU9 A;  2IGO A;  1Y1V J;  3P5J A;  1ZH5 A;  4QPQ A;  2DAO A;  2QQA A;  3TGN A;  2XRL A;  2XPV A;  1J09 A;  3HHG A;  5ICG A;  2EIK H;  5J8C A;  4E7Z A;  5DM7 F;  1ZG5 A;  3BJO A;  1YX3 A;  1VFC A;  5L3F A;  3L2V A;  2JVG A;  1O3Q A;  5CVV A;  5HS7 A;  1XB4 A;  4XL9 A;  1IN8 A;  3KP4 A;  1RIO H;  2XGX A;  3LSJ A;  3J7A Y;  4V2G A;  4BY1 J;  3WTZ A;  3LL7 A;  1FX7 A;  2F48 A;  3LWF A;  3K7A J;  5KCM A;  4C2M J;  4CZC A;  1SD5 A;  3D5L A;  1TBX A;  1MMG A;  2HZD A;  3HSE A;  3OIQ A;  1O3R A;  5A2Q Z;  3NAR A;  3U21 A;  1X4P A;  1QZE A;  4Z2Y A;  5F08 A;  3V8J A;  3GTJ J;  3TMO A;  4ENN A;  1Z3Y A;  2JQ7 A;  2E19 A;  3GME A;  5EDN A;  1YJ9 I;  2V79 A;  1HKQ A;  3ABU A;  2JA8 J;  1MH3 A;  4AIH A;  5GP9 A;  2GZW A;  5FLV A;  3I56 I;  4I99 C;  4NNJ A;  3J80 Z;  3HIF A;  1NHA A;  3F8M A;  1YI2 I;  4CO8 A;  3TP0 A;  1D5Y A;  4E7H A;  4A3K J;  1A31 A;  2IS2 A;  2CQ7 A;  2K9M A;  2HVQ A;  3S8P A;  2QCO A;  3H92 A;  2EA4 A;  2TDX A;  2E1O A;  2CQX A;  2HXO A;  1S6L A;  4I98 B;  1TT0 A;  1R23 A;  3TDU C;  1YRN B;  2LR8 A;  1GXP A;  2OQG A;  2VE8 A;  2Y9Y A;  3BR5 A;  4NB5 A;  4FCY A;  3S1R J;  3CDH A;  1XN7 A;  3Q9S A;  1A5J A;  4DIQ A;  3FXK A;  5JHU A;  1NH3 A;  2VJ4 A;  5C3E J;  3BG3 A;  3HXL A;  1OCO H;  5F0H A;  4A6D A;  3OMY A;  2VAS A;  3HPG A;  5DTD A;  5BNG A;  2R7U A;  4RB3 C;  1BOA A;  3JRB A;  4GYI A;  3RKY A;  3QOE A;  4G9Y A;  1WZ2 A;  1MND A;  5J6X A;  4BJ6 C;  1Z21 A;  4N9I A;  1UHM A;  4BGD A;  3LMM A;  3SZT A;  2NS0 A;  3DKX A;  4XM3 A;  3ZOB A;  4LJZ F;  3FWE A;  3ECO A;  3KLN A;  1SVM A;  3AFH A;  3K4L A;  2FNP A;  1F4K A;  1NK3 P;  2AXT C;  3MQ0 A;  2FBK A;  1JKO C;  1VQL I;  4DYQ A;  3ZMS A;  1KGS A;  3K1M A;  5BPI A;  3GTG J;  2L9S A;  5H6Q A;  5M3M J;  1IN7 A;  1BI3 A;  4DJA A;  5IP9 J;  3PO2 J;  2EQR A;  1ZLJ A;  3FXL A;  3HKZ A;  4GO1 A;  2OU2 A;  1HCR A;  3KZZ A;  1ZYR F;  3M8F A;  1H8A C;  1XMA A;  1KQ9 A;  1U9N A;  4NC7 A;  3NWS A;  3HKZ N;  4BXU A;  5FRM A;  2Q0O A;  1MBF A;  5J40 A;  1YE9 A;  2ME6 A;  1KON A;  2VJI A;  3Q0V A;  4CSW A;  3E5Q A;  2ZNY A;  5FLX Z;  4B4C A;  4EM2 A;  1SD4 A;  1W7P A;  2R5Y A;  2DPU A;  4D5F A;  2P81 A;  2IBD A;  4PFP A;  4X0G A;  3PIO F;  3I3L A;  2M45 A;  1DPR A;  3FKJ A;  1SAU A;  1Z6T A;  3E6C C;  1TZL A;  5J8F A;  4PK4 A;  2FUG 2;  3LAP A;  2CRG A;  1FT9 A;  2LKP A;  2DOA A;  4A2U A;  1ZR4 A;  2VPR A;  3ZN1 A;  3G2B A;  4M3F A;  2E1M C;  3ROU A;  1T08 B;  1OR7 C;  3FX3 A;  2L7M P;  1SAX A;  1Z7L A;  5DS9 A;  5TIS C;  2G7H A;  1K83 J;  2V1X A;  1VQ8 I;  4HZF A;  3MFK A;  1VQK I;  2LOO A;  2GXG A;  2IA0 A;  5H6R A;  1BBY A;  1D1B A;  1FSH A;  5DD4 A;  4ZDP A;  4HBL A;  4ESB A;  3OYM A;  4HNT A;  2QSH X;  1YW9 A;  2ACJ A;  1W36 C;  2R7V A;  4M3B A;  4WXC A;  2YX7 A;  4HF2 A;  3Q0W A;  3A01 B;  3H3Z A;  1C0W A;  1VQ4 I;  4HW0 A;  3WE2 A;  2YSR A;  1CGP A;  3JRF A;  4PJJ A;  2M30 A;  3M8E A;  1R4N B;  3W2W A;  1T0F A;  4AC0 A;  5DD8 A;  3RZO J;  2M4G A;  3RQI A;  4Q47 A;  3X2Q H;  5GPA A;  2A3S A;  1GLN A;  2VT2 A;  3KEY A;  3WOD F;  2JMW A;  1ETX A;  1AU7 A;  2PG4 A;  5AIP A;  2JSP A;  4XSZ F;  1RUO A;  4IOA F;  3PFY A;  1RKT A;  3CUO A;  1POG A;  2V6E A;  4F7Z A;  3HOT A;  5HVQ C;  2FOK A;  2R93 J;  3DCF A;  1KQ8 A;  4XN0 A;  1A35 A;  5CVU A;  2HQ5 A;  3H1C A;  2HTS A;  1WJA A;  3T8R A;  3MMY B;  4ESJ A;  1A36 A;  3CJT B;  4AM3 A;  1OCP A;  4UXN A;  1BI1 A;  1MH4 A;  4AIJ A;  2O3F A;  5JR3 A;  2ECC A;  2IS1 A;  3NQO A;  5K7Z A;  1P4X A;  3C2G A;  3PUF A;  4MFD A;  5D6E A;  4LG0 A;  2M9H A;  1LQ1 A;  1LKX A;  2AXL A;  3CCU I;  4A3J J;  1HW1 A;  1R1T A;  1SVL A;  2QBY B;  1L3L A;  2PMU A;  1D5V A;  5JFR A;  3WHB A;  3MZH A;  4K2E A;  4LIV A;  5CVJ A;  2NNY A;  4L0Z B;  4U0V A;  2LKS A;  2OC6 A;  2PJP A;  4LFU A;  4Y15 A;  1ZEL A;  1S7E A;  2M8G X;  3GFL A;  3FIW A;  2UZK A;  1DU6 A;  4EGZ A;  2ZJP F;  2JA2 A;  4LGW A;  4FT8 A;  3BT9 A;  3F8B A;  4CYD A;  2ZNZ A;  2A5Y B;  3F8C A;  4QLC U;  5DCM A;  5EF6 A;  3GWZ A;  1ZTR A;  3KEO A;  2ECB A;  4C3H J;  3OYG A;  3RQ4 A;  2LRE A;  1U2W A;  2DFF A;  3HYI A;  3MZ8 A;  2IP2 A;  4HLX A;  2K9N A;  2NYX A;  2L01 A;  1CF7 B;  1PUE E;  3S32 A;  2A05 A;  4A12 A;  2XAH A;  2GA2 A;  1HBX G;  5LEK A;  2B7E A;  3HOW J;  1ULY A;  1YQA A;  4JK1 X;  4ZYG A;  2P7C B;  3I4M J;  2ID6 A;  2KRH A;  2RQQ A;  4CA0 A;  4KA4 A;  2PLY A;  1MJA A;  4XRS G;  4QTR A;  4I09 A;  1FYK A;  2I10 A;  1BJZ A;  1WJF A;  5HNF A;  4M6X A;  1K4S A;  1ZGW A;  1U3E M;  4F93 B;  5H20 A;  1LDK B;  1GV5 A;  3LST A;  1FIP A;  2EV0 A;  1FPQ A;  3GTM J;  2A07 F;  2L0K A;  2OF7 A;  2LKX A;  3LAJ A;  2HKO A;  2OZ6 A;  2VXD A;  2YS9 A;  4KDP A;  2R92 J;  3CUQ A;  3GF2 A;  3HJE A;  3G1L A;  4CHU A;  1FOY A;  1XG1 A;  4I7H A;  1KYW A;  4RM3 A;  1H88 C;  4EQQ A;  4NQW A;  2BEO A;  2DN0 A;  4AD9 A;  3IAS 2;  1IF1 A;  1FY7 A;  4TV7 A;  2DJN A;  1IXR C;  2BY2 A;  2DYR H;  2OUM A;  4PGH A;  3MKY B;  1I1G A;  2A68 F;  1V55 H;  1Z3X A;  2H8W A;  4PCQ A;  2K9S A;  1MBE A;  1YX5 A;  3FXQ A;  4P55 A;  4BU2 A;  1G8X A;  1BN5 A;  2BVM A;  3RJP A;  1MDM B;  3HOU J;  3PSI A;  1YW8 A;  3MWM A;  4M9X A;  4RBO A;  3J7Z I;  2D45 A;  3K1N A;  2MSY A;  1G3S A;  2FML A;  4HA8 A;  2JUG A;  2X51 A;  3RIR A;  1JKP C;  4UUV A;  2G7U A;  4II2 A;  1XSX A;  2JRM A;  3OOU A;  4KNY A;  1WI3 A;  3OYL A;  1LUJ B;  2EB7 A;  2NOG A;  2PBI A;  2RKH A;  3GLX A;  4MFE A;  2PMH A;  2ISZ A;  2WV1 A;  2R7W A;  2XGD A;  2EFP A;  3D5S C;  3WTT C;  1BC7 C;  3QU3 A;  4AVZ A;  1XMX A;  1MD0 A;  1T0F C;  1BC8 C;  2DQR A;  2E5N A;  2P5V A;  4KIG A;  1JKR C;  2TRT A;  1XGS A;  2ID3 A;  3ASN H;  4FAS D;  2HZT A;  1Z05 A;  1BM9 A;  4U7D A;  1E17 A;  1MJB A;  1EV7 A;  4QSH A;  3GTK J;  4B48 A;  2EZL A;  3PNV A;  1IAW A;  4ENK A;  1YIJ I;  4EJO A;  4DQ2 A;  2MH2 A;  1K79 A;  4XKB A;  1MKM A;  3L7W A;  2MW8 A;  3RZD J;  1ZQ3 P;  2E2J J;  2VUM J;  5K5O A;  1W4M A;  3CC2 I;  3S2D J;  3OYH A;  1TWA J;  4II3 A;  2P8T A;  2FOW A;  4KIB A;  1G2H A;  3EET A;  1IW7 F;  2PJR B;  1P4A A;  2XPW A;  3D0S A;  3GBG A;  5J1U A;  3U1K A;  3LNQ A;  1J9I A;  1XGN A;  2QZ8 A;  1MZB A;  5D4S A;  2WTE A;  3QP6 A;  4CH7 A;  3HL2 A;  5B1B H;  1X3U A;  4NDL A;  1R9T J;  4AIK A;  1QZZ A;  5GAD J;  3PO3 J;  1VQ9 I;  3BPX A;  2A6T A;  2X48 A;  2E7X A;  4FX0 A;  1V5E A;  1VQ6 I;  3FXM A;  1SFX A;  2WBM A;  3J7A O;  1YFH A;  5B1A H;  3IAM 2;  4OAY A;  1TW3 A;  1B1B A;  5JVG F;  3NRV A;  2O61 A;  3LSK A;  4IZZ A;  1KU2 A;  3KYL A;  1WQ2 A;  1TT5 B;  2HWV A;  3SFI A;  2CV0 A;  1REP C;  2FBI A;  4FTH A;  2STW A;  3GTL J;  2DDB A;  3HB9 A;  5K7F A;  1WJB A;  1RET A;  5JLX A;  4A69 C;  3I55 I;  1WFX A;  3S3O A;  2RN7 A;  3HOS A;  4U88 A;  1T38 A;  4HLY A;  1VI0 A;  2DA3 A;  2R7R A;  3BG7 A;  1T2K A;  3EUK L;  1BI0 A;  1RPW A;  1J59 A;  4OOI A;  3F9K A;  1IDZ A;  1PP7 U;  1FMW A;  3LQR A;  1IRG A;  3BQY A;  1EH7 A;  5FKM A;  2DYS H;  2WAD A;  1UMQ A; 
#chains in the Genus database with same CATH homology
 1SD7 A;  5LRS A;  2VT3 A;  2MD5 A;  2PN6 A;  4L5J A;  1J7K A;  1HXD A;  3CUQ C;  3KZY A;  5CJ9 A;  5E1Z B;  4BHC A;  4ESF A;  4RGX A;  1VTN C;  1HQC A;  1JHF A;  4RS8 A;  2KIU A;  4UVC A;  1FYM A;  2AS5 F;  4H0E A;  3E6B A;  2HOE A;  3V4G A;  2FMY A;  1U8R A;  3L9F A;  2RV8 A;  3KCC A;  4LMY A;  1LDD A;  4FX4 A;  4G8X A;  5E8I A;  4IHS A;  2DK8 A;  3C3W A;  3W6K B;  4RGR A;  4BNC A;  4JBA A;  3WTS C;  3T0Y A;  3I64 A;  3RDI A;  2VE9 A;  2DFI A;  2B0L A;  2FU4 A;  4GGG A;  5D8L B;  4R1H A;  2Z3Y A;  2UXN A;  1YS6 A;  1QQI A;  1R5G A;  4OMY A;  5FFZ A;  2GWR A;  4LB6 B;  3F21 A;  1S8N A;  5CLS A;  2ZJ2 A;  1DDN A;  2BBY A;  3CLO A;  4OMZ A;  2BE5 F;  1YG2 A;  5K5R A;  4EM0 B;  4HV5 A;  3TOA A;  3LQQ A;  5HDG A;  4U0Y A;  2WV0 A;  2FBH A;  4LB5 A;  1LNW A;  4HDU A;  4UVB A;  1UFM A;  4Q4Z F;  3CO7 C;  3R60 A;  3I59 A;  1STZ A;  2XKO A;  1K78 A;  4PGG A;  1J0R A;  3WG9 A;  5D5U B;  4BAY A;  1XSD A;  1SMY F;  3HHH A;  4MGR A;  1F5T A;  4ZYE A;  4A6E A;  3DQV C;  1U5T B;  2CYY A;  3FHZ A;  3BJA A;  2WC2 A;  3OV8 A;  1ON1 A;  4KN7 X;  1RZ4 A;  4L5I A;  4B8X A;  5A2Q K;  2V1D A;  3PQK A;  2Y48 A;  3GZ6 A;  3E5X A;  3G3Z A;  3J81 K;  3EYY A;  2Z5U A;  1XGM A;  4WXH A;  1OR7 A;  3G73 A;  3KEQ A;  1T98 A;  4EJV A;  3C18 A;  5BPD A;  4P96 A;  3IWZ A;  1OMI A;  2EV6 A;  3QRF F;  1Y0U A;  5HLH A;  3FXU A;  1EH6 A;  4Q48 A;  3RPU A;  5L3G A;  3BOQ A;  5CVR A;  2F5F A;  1WSU A;  1FNN A;  1TW2 A;  3EDP A;  3TQN A;  4ZH4 F;  1UST A;  1FBS A;  3DXJ F;  3ISP A;  4QWQ A;  3ZMV A;  1XDS A;  4ETS A;  3HRM A;  4M73 A;  2P5K A;  1FWZ A;  2HYG D;  3GX4 X;  4UV9 A;  2VBX A;  1ZG3 A;  1YW7 A;  5EEG A;  4M9Z A;  2E1C A;  4U7B A;  3J81 Z;  3TDZ C;  5HS9 A;  5D6F A;  5K1Y A;  3BJ6 A;  1A04 A;  2ESN A;  5F1R A;  5L3E A;  4L9J A;  5FLX K;  4MTD A;  1XMK A;  4XBF A;  1QZY A;  4RAY A;  3B02 A;  4OIN F;  1Z1D A;  3RKX A;  2RQP A;  1FSE A;  5ED4 A;  2DT5 A;  2MC3 A;  2XKP A;  1UCR A;  1KYZ A;  1ZRF A;  3EYI A;  2L54 A;  1I5Z A;  3I4P A;  3GFI A;  1H9T A;  4G6D A;  1IXC A;  5E8G A;  5FO5 A;  1LVA A;  4HF0 A;  4L9N A;  2E7W A;  1I1S A;  5JI6 A;  5BOX A;  2BV6 A;  2BGC A;  3U9G A;  4S04 A;  5D8K B;  3IRR A;  2EV5 A;  2KKO A;  3LA7 A;  2HQN A;  4MHG A;  3WTW C;  1T6S A;  4JQF A;  2CWE A;  3RI4 A;  1Z7U A;  5DUI A;  5LGT A;  2DPD A;  2IPQ X;  4A5M A;  3O3K A;  1FC3 A;  3V7R A;  5L3D A;  3MAJ A;  3CO6 C;  4ZYD A;  1QBJ A;  5FD5 A;  3WTU C;  1HW5 A;  2QVO A;  2OA4 A;  5HS8 A;  2Y75 A;  2CGP A;  3R61 A;  5E20 A;  2KIM A;  4XLN F;  5DDG A;  1JXS A;  3T1B A;  3WU0 A;  3P7N A;  2J5P A;  1LEA A;  2IA1 A;  3FMS A;  2FNA A;  1FP1 D;  1ONV A;  3NEU A;  4B09 A;  4ON0 A;  2W25 A;  2W85 A;  2P6S A;  4IJA A;  4IHT A;  4G7H F;  3ABT A;  2CW0 F;  1I6X A;  2UWM A;  1F1Z A;  3DP7 A;  3F8N A;  3BWG A;  1GXQ A;  1GVJ A;  2VC0 A;  3VFZ A;  1P4W A;  2PEX A;  2H09 A;  3M1E A;  3BP8 A;  1FZP B;  3SZP A;  4P9U A;  1P92 A;  3GXO A;  3K9T A;  5HLG A;  4N9H A;  1ZGJ A;  1YIO A;  2HR3 A;  3L09 A;  3TO9 A;  1HW2 A;  2XAJ A;  3F6O A;  1K7A A;  3DFG A;  1H0M A;  4G6Q A;  2RGV A;  4YIF A;  1TQM A;  4HX7 A;  5FGM A;  2IW5 A;  1F9N A;  2L3D A;  3JTH A;  1RI7 A;  3HUG A;  2K4J A;  4AVP A;  1LJ9 A;  3COA C;  2NAZ A;  3P9I A;  4A0Z A;  4XLP F;  2F5D A;  2OQR A;  5E18 F;  1MGT A;  3P9C A;  3RYR A;  5HOO A;  1S7A A;  1YYV A;  5ICF A;  3FM5 A;  1TNS A;  4HOB A;  1IUY A;  4HQM A;  4HX8 A;  1IN6 A;  1J75 A;  1S29 A;  5CYV A;  2CFX A;  3E5U A;  1Q1H A;  1XSV A;  1TNT A;  3GUD A;  4N0B A;  1Z91 A;  2VN2 A;  4OIP F;  1RUN A;  4FHT A;  1ZAR A;  4RB1 A;  2OBP A;  2K4B A;  5D5V B;  4EJW A;  1HSJ A;  1G3W A;  2IVM A;  3IRQ A;  5F6F A;  1UHW A;  2PFB A;  2IT0 A;  6PAX A;  1DPU A;  1SD6 A;  3WGG A;  2O6G E;  2VC1 A;  5ILU A;  1TTY A;  2MLK A;  3ZMT A;  2F2E A;  5DYM A;  3ZN0 A;  3VEP A;  1O3S A;  5LHI A;  4EMS A;  1OYW A;  1TQP A;  2ZME A;  4A0X A;  2CQK A;  4Y13 A;  2XV4 S;  3JTG A;  4HDV A;  2RNJ A;  1G4D A;  3JAM Z;  2YPR A;  3I71 A;  1KA8 A;  4HX4 A;  1AOY A;  3HTU A;  3R0J A;  1DUX C;  2Q2E A;  1AWC A;  3F8F A;  3TO7 A;  2H94 A;  4UHT A;  1W7P B;  1BI2 A;  3TOB A;  3HSF A;  4LD5 A;  5D4R A;  1KQ0 A;  1WKM A;  1R36 A;  5LGN A;  5JVT A;  2JSC A;  2VOD A;  5KVR A;  2HTJ A;  3LA3 A;  3N97 A;  2DLL A;  4L9V A;  4EGY A;  1DP7 P;  2QQB A;  3V7C A;  2XRN A;  3RPQ A;  1JE8 A;  1WWX A;  4EV0 A;  1YLF A;  1ZAO A;  3LA2 A;  3Q5F A;  1U6G A;  1ZN2 A;  1B9M A;  2FEZ A;  4IF4 A;  2GQQ A;  2V6C A;  3QPT A;  2MH9 A;  1Z6R A;  2K86 A;  1WRJ A;  2P6T A;  3R4K A;  3PFI A;  3AAF A;  1ZLK A;  5ICC A;  1ZRD A;  2DW4 A;  1BIB A;  2DU9 A;  3SFZ A;  1IRF A;  5FB2 A;  2L4M A;  2D1H A;  1W7P D;  3GFJ A;  2D2W A;  2YR2 A;  3HRT A;  4GCV A;  5HLI A;  4LG0 B;  1BIA A;  2GXB A;  3GZ5 A;  3QU6 A;  4LLG F;  5L3B A;  2HQR A;  1V3F A;  1LDJ A;  4G94 A;  2X0L A;  2WWY A;  5KK1 A;  5DCM B;  3M9A A;  4I0A A;  4CDG A;  5LGU A;  1I27 A;  4HF1 A;  4UV8 A;  4L0Y B;  3ZMZ A;  3E6M A;  2LF7 A;  1D3Y A;  3DPL C;  2EA2 A;  3R0A A;  4RGS A;  1U5T C;  1ON2 A;  2ETH A;  2DQL A;  5HDN A;  2NNN A;  4XSX F;  4KUM A;  3BDD A;  1FYL A;  3I58 A;  3KP7 A;  2R7F A;  2A6H F;  3SHF A;  3F6V A;  3BRO A;  1B6A A;  3CUQ B;  4IRH A;  2FQ3 A;  2ZXJ A;  2QQ9 A;  4LK1 F;  4YII A;  1SFU A;  2PQ8 A;  3QP5 A;  2CO5 A;  3HRS A;  4HYE A;  2FE3 A;  3RYP A;  2JT1 A;  2O0Y A;  3ZQ7 A;  3SXY A;  2ELH A;  1ZGA A;  3C7J A;  3E97 A;  5D5W B;  3C1D A;  2F5E A;  2IJL A;  2KJC A;  2OZU A;  3EQL F;  2H6C A;  1R5H A;  5E1X A;  4WCG A;  5HDK A;  4WK8 F;  1R00 A;  2RC4 A;  3I0T A;  5E17 F;  2ZO4 A;  2HYF A;  3CJN A;  3MCZ A;  2ZKZ A;  3GO5 A;  4OIQ F;  4LK0 F;  5IT9 K;  3S2W A;  1UB9 A;  5DCF A;  5F64 A;  4GYG A;  2VBY A;  2GIV A;  3R6S A;  3I5U A;  3FXR A;  1SMT A;  2QUF A;  3WE3 A;  2M87 A;  3WTY C;  1T39 A;  1YTY A;  2LDU A;  2QBY A;  3WTX C;  3ZMD A;  2COM A;  2ESH A;  3ERE D;  2FXA A;  5AIQ A;  5E1W A;  5L3C A;  1V4R A;  4EJT A;  5ILS A;  3EUH A;  1FOK A;  3QOP A;  1PP8 F;  2D1V A;  1WI9 A;  2L4A A;  3O2P E;  4HAM A;  2XHK A;  4RAZ A;  4HV6 A;  4BHB A;  1IN5 A;  5FFX A;  2L02 A;  1CF7 A;  5IT9 Z;  2Z9O A;  4L18 B;  4I0B A;  3ZP5 A;  2Y0M A;  3ECH A;  2Z33 A;  3WTV C;  2XRO A;  1QNT A;  1R7J A;  2STT A;  4Q5S F;  4MQ9 F;  1D8K A;  4CIC A;  1LEB A;  5IT3 A;  4M6Y A;  1R58 A;  1XCB A;  3BZ6 A;  1IZ1 A;  3MEX A;  3T8T A;  2YX4 A;  4IVN A;  2P5L C;  2A6E F;  1L0O C;  3WGI A;  2M5W A;  1G3T A;  3FZV A;  2W24 A;  3WGH A;  1USS A;  1MDM A;  2EFQ A;  2LF8 A;  2YU3 A;  3KP6 A;  2HKX A;  2KJB A;  5DV5 A;  3DV8 A;  5CVI A;  4RGU A;  2ZBK A;  2A61 A;  3F3X A;  3KFW X;  5AON A;  4YFN F;  4ENJ A;  4ZYH A;  3TKY A;  4OIO F;  3GVA A;  4BQA A;  4WX9 A;  2VBW A;  2QLZ A;  2RDP A;  1QPM A;  2K02 A;  4AWX B;  2P4W A;  4S05 A;  2HFH A;  1D8J A;  2CG4 A;  4A5N A;  3TO6 A;  1OYY A;  1ZRE A;  1KU3 A;  2O8X A;  1TQI A;  2ADU A;  3V8K A;  2IA2 A;  3I59 B;  1K78 B;  3SQN A;  3GEZ A;  4EVI A;  4KFC A;  4MTE A;  3O6B B;  5LBQ A;  2MA3 A;  1FBQ A;  5LRR A;  3U2R A;  4XRF A;  3T5X A;  3QPH A;  2EK5 A;  3ZMU A;  3KET A;  3FMR A;  1RNL A;  2FA5 A;  3P9K A;  3IC7 A;  4G7O F;  1XGO A;  1IXS B;  2UXX A;  3M7G A;  2QYO A;  2V9V A;  1W5S A;  1YO5 C;  3IL2 A;  1GHC A;  2DK5 A;  1H9G A;  4EM1 A;  4RB2 C;  4BH9 A;  4RB0 A;  3B73 A;  4GXO A;  2FSW A;  5DUK A;  2LSO A;  2ZCW A;  4IXA A;  3RKW A;  2W57 A;  2XAS A;  5LHG A;  5LLQ A;  2M8E A;  1O7L A;  2DTR A;  2PI0 A;  1BJA A;  3ELK A;  4KT5 C;  1MJ9 A;  5ICE A;  1B9N A;  4CZZ A;  1O3T A;  2E1N A;  4LLL A;  2MLG A;  1ODD A;  3FF5 A;  2QWW A;  3JAM K;  3ML6 A;  3I53 A;  3FMQ A;  3KP3 A;  4D0P A;  4ASN A;  3BPV A;  1J2X A;  4O5V A;  3WU1 B;  3Q9V A;  4P5O A;  5FD6 A;  1B4A A;  4CGZ A;  3KP5 A;  3HSR A;  1QGP A;  4U0W A;  4P9F A;  3LFK A;  1K6O A;  5BS6 A;  2KRF A;  5D5X B;  5LEJ A;  4BYY A;  1YS7 A;  1J5Y A;  3OOP A;  4M72 A;  1XD7 A;  4MQV A;  1JHH A;  2O03 A;  2RVC A;  3GYH X;  4WWC A;  2JTV A;  2OD5 A;  2JRT A;  3IHU A;  4UVA A;  2X4H A;  4O3M A;  2FF4 A;  2XUB A;  1U78 A;  4YG2 F;  2DBB A;  5DEQ A;  3FM3 A;  1S3J A;  4Y17 A;  1XCV A;  4M74 A;  3IKT A;  4DNC A;  5ERI A;  1U5T A;  4MNU A;  3IKV A;  2JPC A;  3KP2 A;  4IRG A;  2ISY A;  4O6J A;  1ZG1 A;  1E2X A;  1OYI A;  3F23 A;  1ZHF A;  3K0L A;  4A0Y A;  2LNB A;  1S7O A;  4I01 A;  4HQE A;  3VOD A;  2VOP A;  1HKT A;  4M71 A;  2DI3 A;  1R22 A;  2XAG A;  4KIC A;  4E70 A;  3BY6 A;  3QAH A;  3ZPL A;  2IRF G;  1FP2 A;  3MZY A;  2K27 A;  4KMF A;  2JPB A;  5BQT A;  3HTS B;  4KIF A;  4IRI A;  5ILV A;  2M1B A;  1LB2 A;  4MEY F;  2QEN A;  4KMU X;  3JSP A;  4YFK F;  1P2F A;  1HST A;  4ZZL A;  2EFW A;  2EFO A;  3W6J B;  3U1D A;  2R7D A;  2Q8K A;  3CTA A;  4KYW A;  3L00 A;  2R3S A;  2EWN A;  3K69 A;  2MBF A;  5LHH A;  2H27 A;  1O7F A;  3VB2 A;  4R79 A;  3L2C A;  3REO A;  4OIR F;  4CXF A;  3V7S A;  2CSO A;  3JSO A;  2P7V B;  3JW4 A;  3F22 A;  5BMZ A;  1QO0 D;  2GAU A;  2W84 A;  4LLN A;  3ULQ B;  1B59 A;  2V1U A;  2F5C A;  3HRU A;  4BHP A;  5TJJ A;  3V8L A;  3E3V A;  2HGC A;  3K2Z A;  5EEH A;  4M9S A;  3PQJ A;  4WXD A;  2BYV E;  2ZFW A;  2XIG A;  1FLI A;  4EJU A;  1FBU A;  4KN4 X;  4YFX F;  2QM3 A;  1R1V A;  3VOE A;  1HKS A;  2H6B A;  2C6Y A;  3GW2 A;  2XVC A;  2HEO A;  4WF2 A;  5TRD A;  2HDC A;  1SFE A;  4MEX F;  3DPT A;  4ENM A;  1TLH B;  2J5O A;  4G7Z F;  3GFM A;  2DO7 A;  2NRA C;  4UNO A;  3RTR A;  3KE2 A;  4ZZD A;  4L9T A;  1G3Y A;  2A69 F;  1OPC A;  2Z99 A;  1EH8 A;  1XDU A;  2EFN A;  2FRH A;  3IWF A;  3DEU A;  2OAZ A;  2VBZ A;  1JGS A;  1G6N A;  3DKW A;  1IN4 A;  1O57 A;  4IPA A;  1OKR A;  2ZME B;  2HS5 A;  2K7L A;  3N4M A;  4I02 A;  3F72 A;  1ZRC A;  1P6R A;  2GA1 A;  3H3U A;  1Z9C A;  2VXZ A;  4R8H A;  2VOO A;  5K5Q A;  4PDK A;  2KIF A;  4I2O A;  2G9W A;  2EJR A;  3KLO A;  4PZJ A;  2JZY A;  2VON A;  3I54 A;  3DF8 A;  1W5T A;  4NHJ A;  2XAF A;  2XAQ A;  1PDN C;  3J80 K;  3E6D A;  1KU7 A;  3K1P A;  1R1U A;  4OU0 A;  1KU9 A;  1ZH5 A;  2DAO A;  2QQA A;  3TGN A;  3HHG A;  5ICG A;  5J8C A;  1ZG5 A;  3BJO A;  5L3F A;  1O3Q A;  5CVV A;  5HS7 A;  1XB4 A;  1IN8 A;  3KP4 A;  1RIO H;  2XGX A;  3WTZ A;  1FX7 A;  3LWF A;  1SD5 A;  3D5L A;  1TBX A;  3HSE A;  1O3R A;  5A2Q Z;  4Z2Y A;  3V8J A;  4ENN A;  2V79 A;  1HKQ A;  3ABU A;  4AIH A;  2GZW A;  3J80 Z;  3HIF A;  1NHA A;  3F8M A;  4CO8 A;  3H92 A;  2EA4 A;  2TDX A;  1S6L A;  4I98 B;  1R23 A;  3TDU C;  1GXP A;  2OQG A;  2VE8 A;  4NB5 A;  3CDH A;  1XN7 A;  3Q9S A;  5JHU A;  4A6D A;  4RB3 C;  1BOA A;  4GYI A;  3RKY A;  4G9Y A;  5J6X A;  4N9I A;  1UHM A;  3SZT A;  2NS0 A;  4LJZ F;  3FWE A;  3ECO A;  3KLN A;  2FNP A;  1F4K A;  3MQ0 A;  2FBK A;  3ZMS A;  1KGS A;  3K1M A;  5BPI A;  5H6Q A;  1IN7 A;  1BI3 A;  1ZLJ A;  4GO1 A;  2OU2 A;  3KZZ A;  1ZYR F;  3M8F A;  1XMA A;  1KQ9 A;  4BXU A;  2Q0O A;  3E5Q A;  2ZNY A;  5FLX Z;  4EM2 A;  1SD4 A;  1W7P A;  2DPU A;  2M45 A;  1DPR A;  1Z6T A;  3E6C C;  5J8F A;  3LAP A;  1FT9 A;  2LKP A;  4A2U A;  3ZN1 A;  3ROU A;  3FX3 A;  1SAX A;  2G7H A;  2V1X A;  4HZF A;  3MFK A;  2GXG A;  2IA0 A;  5H6R A;  1BBY A;  1FSH A;  5DD4 A;  4HBL A;  4ESB A;  1YW9 A;  2ACJ A;  4WXC A;  2YX7 A;  4HF2 A;  3H3Z A;  1C0W A;  4HW0 A;  3WE2 A;  2YSR A;  1CGP A;  2M30 A;  3M8E A;  1T0F A;  5DD8 A;  4Q47 A;  2A3S A;  2VT2 A;  3WOD F;  2PG4 A;  5AIP A;  4XSZ F;  1RUO A;  3CUO A;  4F7Z A;  3HOT A;  5HVQ C;  2FOK A;  1KQ8 A;  5CVU A;  2HTS A;  3T8R A;  4ESJ A;  4UXN A;  1BI1 A;  4AIJ A;  2O3F A;  5JR3 A;  3NQO A;  1P4X A;  5D6E A;  4LG0 A;  1LQ1 A;  2AXL A;  1HW1 A;  1R1T A;  2QBY B;  1L3L A;  2PMU A;  1D5V A;  5JFR A;  3MZH A;  4K2E A;  2NNY A;  5CVJ A;  4L0Z B;  4U0V A;  2PJP A;  4LFU A;  4Y15 A;  3GFL A;  2UZK A;  4EGZ A;  4LGW A;  4FT8 A;  3F8B A;  4CYD A;  2ZNZ A;  2A5Y B;  3F8C A;  4QLC U;  5DCM A;  3GWZ A;  3KEO A;  1U2W A;  3HYI A;  2IP2 A;  4HLX A;  2NYX A;  2L01 A;  1CF7 B;  1PUE E;  4A12 A;  2XAH A;  2GA2 A;  1HBX G;  5LEK A;  1ULY A;  1YQA A;  4JK1 X;  4ZYG A;  2P7C B;  4KA4 A;  2PLY A;  1MJA A;  4I09 A;  1FYK A;  4M6X A;  1U3E M;  5H20 A;  1LDK B;  3LST A;  2EV0 A;  1FPQ A;  2A07 F;  4KDP A;  3LAJ A;  2HKO A;  2OZ6 A;  3CUQ A;  3GF2 A;  4CHU A;  4I7H A;  1KYW A;  4EQQ A;  4NQW A;  2BEO A;  4AD9 A;  1IF1 A;  1FY7 A;  4TV7 A;  1IXR C;  4PGH A;  1I1G A;  2A68 F;  4PCQ A;  3FXQ A;  4P55 A;  1BN5 A;  3RJP A;  1MDM B;  1YW8 A;  3MWM A;  4M9X A;  2D45 A;  3K1N A;  1G3S A;  2FML A;  4HA8 A;  3RIR A;  4UUV A;  2G7U A;  1XSX A;  4KNY A;  2EB7 A;  2PBI A;  2RKH A;  3GLX A;  2PMH A;  2ISZ A;  1BC7 C;  2EFP A;  3WTT C;  3QU3 A;  1MD0 A;  1BC8 C;  2DQR A;  2P5V A;  4KIG A;  1XGS A;  2HZT A;  1Z05 A;  1BM9 A;  4U7D A;  1E17 A;  1MJB A;  1EV7 A;  1IAW A;  4ENK A;  4EJO A;  4DQ2 A;  2MH2 A;  1K79 A;  1MKM A;  3L7W A;  5K5O A;  1W4M A;  2P8T A;  4KIB A;  3EET A;  1IW7 F;  1P4A A;  3D0S A;  1J9I A;  1XGN A;  2QZ8 A;  1MZB A;  5D4S A;  2WTE A;  3QP6 A;  1X3U A;  4AIK A;  1QZZ A;  3BPX A;  2E7X A;  4FX0 A;  1SFX A;  3J7A O;  1YFH A;  1TW3 A;  1B1B A;  3NRV A;  2O61 A;  1KU2 A;  1WQ2 A;  2HWV A;  1REP C;  2FBI A;  2STW A;  2RN7 A;  3HOS A;  4U88 A;  1T38 A;  4HLY A;  1T2K A;  1BI0 A;  1J59 A;  4OOI A;  1PP7 U;  1IRG A;  3LQR A;  1EH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...