3GFLA

Crystal structure of the st1710 mutant (r90a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRAKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gflA00
3TQNA 1TBXA 5BQTA 3BDDA 1D8KA 4M6XA 4KNYA 1LEBA 2O8XA 2HS5A 1YTYA 4L18B 4U7DA 2PI0A 4OIRF 1IXRC 2YU3A 1FC3A 1U78A 4UVBA 1PP8F 4OIOF 3FXUA 5DV5A 5A2QZ 4IRGA 4IHTA 2XIGA 4IRIA 1YYVA 4EM0B 1BI3A 3E6MA 5DUKA 4U88A 3WODF 3RI4A 1IUYA 2EA2A 3JW4A 3GW2A 5H6RA 1B4AA 3GX4X 3K2ZA 4EGYA 3E3VA 4EJVA 3V8KA 2IA1A 5LRRA 1XSVA 1ONVA 3ZMSA 4I98B 5HOOA 2QQAA 2HKOA 5FLXK 4RGUA 1E17A 4PGGA 4I7HA 1S7OA 4KT5C 4CXFA 1W5SA 4HV5A 3VODA 1QQIA 4EJWA 3F8MA 2QENA 5JVTA 4HF1A 4BHCA 1WI9A 2G9WA 1B1BA 5BPDA 2F5DA 1L3LA 1P2FA 4B09A 5AIQA 2GQQA 2QZ8A 3K69A 2Q0OA 5HDKA 3CUOA 1KYZA 2Z5UA 3RYRA 3KP4A 2WV0A 3DQVC 5LLQA 1K78B 2W57A 1G3SA 1WQ2A 5HLHA 5TRDA 1LDKB 5DCFA 5LHIA 2DBBA 1F1ZA 2YR2A 2HDCA 3SXYA 3GFLA 5CVJA 3RKWA 1L0OC 3J81K 4G6QA 4UV8A 5FO5A 3QU3A 2VODA 2GAUA 1T39A 3BJ6A 2FNAA 4L9TA 4WXCA 2E1NA 1ZARA 3NEUA 2CG4A 4MQ9F 5F1RA 3BOQA 5LGUA 1J75A 5IT3A 4AIHA 2MH2A 5HS7A 2J5OA 2LNBA 1LVAA 2RN7A 5E8GA 2W84A 3CUQC 3ELKA 3T5XA 1MJ9A 2HTSA 4WK8F 1FLIA 2H6CA 2TDXA 4L9NA 2NNYA 3LQRA 3TDUC 4FX4A 2V1UA 3WG9A 5LHHA 2OZUA 4FT8A 3L00A 1G4DA 4AVPA 2LDUA 3GFIA 1Y0UA 2FU4A 4ESJA 4IF4A 2PMUA 1BIAA 2W85A 1G3WA 3DPLC 3VFZA 1HW1A 2G7UA 3K1PA 2OU2A 4XLNF 2PQ8A 3WTXC 2FSWA 1D8JA 1Z6RA 2EV6A 4P9FA 1SMTA 3U1DA 1ZRCA 2CWEA 1GHCA 2DLLA 1KGSA 2A6HF 1OYWA 2VT2A 2P5KA 5J8CA 4HAMA 4RAYA 3I59B 1S7AA 5DD8A 3LWFA 2O0YA 4KA4A 3HTUA 3ZMZA 2L4MA 3ZMVA 3QRFF 1IN5A 2KIMA 1F5TA 4GYIA 2F5EA 3F8FA 4DNCA 2A3SA 3WTUC 3TO6A 2P6SA 2CSOA 5ILVA 2MBFA 3V7SA 1ZGJA 2GWRA 3KP6A 3T8RA 2QM3A 1USSA 1D5VA 5IT9Z 3JSPA 3GZ5A 6PAXA 1FT9A 3WTYC 3KFWX 4EJOA 2DI3A 2P8TA 4KFCA 3RPUA 1BI1A 1HQCA 3ABUA 2H09A 3Q9SA 4A12A 3HSRA 4ENNA 3W6KB 4BYYA 2HYGD 2QYOA 5J6XA 3F72A 1R00A 5AONA 3G3ZA 3EQLF 4IVNA 3RTRA 2DFIA 1RUOA 3H92A 4OOIA 5E8IA 5E17F 3JAMZ 4YFXF 2ACJA 1BC7C 1FYLA 4I0AA 2P7CB 1TTYA 2VOPA 1BOAA 1YW9A 5A2QK 3KLNA 4PCQA 2L54A 1ON1A 2XKPA 2X4HA 1O3QA 4TV7A 5ICCA 1MJAA 1T0FA 2XAJA 3I53A 4XRFA 3FM5A 1HSTA 4MEYF 2RNJA 3JSOA 2VE9A 2NRAC 3GVAA 2IPQX 4HW0A 3F23A 2V9VA 1ZRDA 1TQIA 1ZLJA 2KIFA 4N9HA 4BNCA 5L3GA 3P7NA 2OBPA 2DT5A 5JR3A 2HGCA 2FMYA 2DU9A 3CTAA 4LG0A 1S29A 1JHFA 2KJBA 4EM1A 5D6EA 4BXUA 2PLYA 3GEZA 4Q48A 4UXNA 3FMSA 2UZKA 2FMLA 1XDSA 1TNSA 2IP2A 4GCVA 3LA2A 1FYMA 1REPC 1E2XA 1XMKA 3GF2A 4AIKA 2DW4A 3J80Z 4R79A 3CUQB 3SZTA 2JRTA 3FHZA 2K02A 2H27A 4IPAA 4HDVA 2E7WA 4XBFA 3FMQA 4HZFA 2GXBA 2XAQA 3T1BA 4GXOA 1OR7A 2H6BA 4ZYHA 4WWCA 3IWZA 2MA3A 2L02A 1PP7U 2MH9A 1V3FA 1TLHB 2WTEA 1I6XA 2Y75A 3FXRA 4BHPA 4UNOA 1YIOA 1IAWA 3SFZA 4O3MA 5LBQA 1QBJA 4NB5A 4A2UA 2H94A 2ZBKA 3R6SA 1UCRA 3C7JA 3HRTA 2DAOA 3LA7A 1XGOA 2GA1A 2PN6A 5ED4A 2VN2A 1G3YA 2EB7A 4JBAA 2JT1A 1DPUA 1Z91A 4JK1X 1LDDA 1WRJA 3FF5A 1F4KA 2ELHA 1YQAA 1C0WA 1Z9CA 4M72A 3KZZA 4A6EA 4OIPF 4LB6B 5CVRA 1SMYF 2EFQA 1KQ9A 3CO7C 3BP8A 3GZ6A 4M9SA 2V79A 2ZFWA 4ENJA 2IVMA 1GXQA 1BJAA 3ZPLA 2QWWA 1Z1DA 1MJBA 2FOKA 1BC8C 4ESBA 2YX7A 1XDUA 3Q5FA 5DD4A 3EYIA 2AS5F 4A0XA 1G3TA 2A69F 3FZVA 2IA2A 1JE8A 3HHHA 3VOEA 2ESHA 1K78A 4CGZA 1V4RA 1W5TA 2HWVA 2XVCA 1GXPA 2EV5A 2AXLA 3M8EA 3C18A 5IT9K 5LEJA 2Z99A 4Y13A 3FWEA 4YIIA 4MHGA 4RGXA 4L5IA 3N4MA 1I1SA 1SFEA 1IW7F 3EYYA 3DV8A 3I5UA 2ZO4A 1J5YA 1XD7A 2DK8A 1R1TA 1R22A 3U9GA 3N97A 4YFNF 5ICGA 3F22A 2DQRA 3K0LA 4I2OA 1XCVA 1TQMA 4U0YA 2DTRA 4IXAA 1J9IA 3BJOA 2RDPA 1S6LA 1FY7A 3CDHA 1I5ZA 3E6BA 1RNLA 3GFJA 3BWGA 3L7WA 2UXXA 4LMYA 4F7ZA 4M6YA 3TO9A 1OYIA 2P7VB 2MLGA 3V7RA 4RB2C 3V7CA 4KIBA 1TW3A 1YS7A 4MGRA 3TDZC 5CJ9A 2RC4A 4ETSA 1X3UA 5CVVA 4A5MA 2D1HA 1KA8A 1ZYRF 2FA5A 5LRSA 4M73A 2W24A 1RI7A 3R4KA 1PDNC 5HDGA 3MWMA 3I59A 1R36A 2ZNZA 4LK0F 1T6SA 4S05A 1T2KA 5CVIA 3V8LA 3V8JA 4EJUA 1J59A 4HV6A 1H9TA 3CJNA 1UHMA 5D5XB 2P5LC 4CZZA 5ICEA 2M30A 5K1YA 2HEOA 2FNPA 4KMUX 3HRUA 3C1DA 2XUBA 2D1VA 4A6DA 1W7PB 3IKTA 1R1VA 2HR3A 2WWYA 2XROA 5D4SA 2CQKA 4GYGA 3J80K 2OQRA 4UUVA 3WU1B 2RV8A 4AIJA 1YLFA 4LGWA 3KP2A 4Q47A 4I02A 2ESNA 3JTGA 3EUHA 2GZWA 4ZZLA 3GUDA 4G7OF 2FF4A 1W7PD 3ZN0A 1HXDA 4MQVA 3OV8A 1Z6TA 2CO5A 2XAHA 5D6FA 2EA4A 3NQOA 5ILUA 2ZMEB 3E6CC 2A68F 3VEPA 2VT3A 3EETA 1BIBA 4LK1F 1XB4A 5D8LB 1Q1HA 3ECOA 3KZYA 2O3FA 1DPRA 2ZNYA 3QU6A 2K86A 2QBYB 2ETHA 3ML6A 3E6DA 4HQMA 4I09A 4P96A 3H3UA 3R0AA 4BQAA 1K6OA 3E5UA 1P6RA 1SD6A 3PQJA 2VXZA 3BROA 5FD6A 3MCZA 2F2EA 1CGPA 5FFZA 5D5UB 2CYYA 2KRFA 5L3FA 2Q2EA 4MEXF 5L3BA 3I58A 1I27A 4N9IA 5LGNA 2LKPA 3I4PA 4MTDA 3DKWA 2HQNA 2ZKZA 4QWQA 5BS6A 3FM3A 5ICFA 2STWA 4EQQA 5E1ZB 4OMZA 5KVRA 3E5QA 3RKYA 4M74A 4M9ZA 2QQBA 2JSCA 3IL2A 2UXNA 2ISYA 3J7AO 1FP2A 3T8TA 4HF0A 3BPXA 2P6TA 4BAYA 1U2WA 2XASA 4HYEA 3LAJA 3I64A 1FX7A 3BJAA 2BV6A 4S04A 3ZP5A 2O6GE 5K5OA 2IJLA 1U5TC 4G8XA 4HLYA 1XCBA 3CUQA 3RDIA 3DF8A 3M7GA 3HSEA 3DXJF 2COMA 3ZMUA 2V1XA 1Z7UA 1IF1A 4NQWA 1ZAOA 5BMZA 3JTHA 3O6BB 3WGGA 2GA2A 3DPTA 4ZYEA 1HKTA 4KN4X 2UWMA 5L3DA 5HVQC 4Y15A 3SQNA 3ISPA 4LLNA 1XGNA 1HSJA 4KMFA 5L3EA 2R7DA 1EH7A 1DP7P 1MKMA 2DO7A 2IA0A 3U2RA 1ZRFA 4HOBA 2EFOA 2R7FA 3FXQA 1KQ0A 1ZG1A 2F5FA 2FBIA 3QPTA 4RAZA 3HIFA 2PFBA 2Z3YA 2OQGA 2OAZA 1ZN2A 2STTA 1SD7A 1FBUA 2PMHA 5E1WA 4P55A 3R61A 1RZ4A 4CHUA 3R60A 4LD5A 2V6CA 4AWXB 1FSEA 1BM9A 5HS9A 4LJZF 3ULQB 1RIOH 2L4AA 5CYVA 3GO5A 3HRMA 5BOXA 2PEXA 5ERIA 5HDNA 3TKYA 4U0WA 4A0ZA 3ZN1A 2Y48A 1SFUA 3GWZA 2PG4A 4LLGF 3WTSC 1CF7B 1BI2A 1DUXC 3ZMTA 1HBXG 1NHAA 1KU2A 3ABTA 1R58A 5K5QA 1QZZA 2ZJ2A 1ZHFA 2YPRA 1YO5C 2HZTA 1O3SA 4ENKA 4G6DA 4L9VA 5FB2A 2VONA 1JGSA 3L9FA 2E7XA 3EDPA 4L0ZB 5EEGA 2RVCA 1FWZA 1ZH5A 4ENMA 3HYIA 3F6OA 1FOKA 1F9NA 1OYYA 3LQQA 4G7HF 2EK5A 3MAJA 4M71A 2BE5F 5TJJA 1WSUA 3ECHA 2NS0A 2HKXA 2R3SA 1I1GA 2EV0A 4ON0A 2K7LA 1P92A 5ILSA 4R1HA 4HLXA 1IZ1A 3B02A 2EJRA 3MZHA 2W25A 3I71A 4EMSA 4A0YA 4B8XA 4P5OA 3HHGA 4OINF 4FX0A 1FZPB 1XGSA 1FSHA 4O5VA 3IKVA 2FEZA 3R0JA 3RKXA 1BI0A 3RPQA 4G9YA 3I0TA 2XAGA 4KUMA 5K5RA 1OPCA 3TGNA 5DDGA 1ULYA 3WTWC 3BPVA 3FX3A 1J0RA 5JFRA 5DUIA 3WGHA 1U5TB 3E5XA 3KETA 5HS8A 4RS8A 3FMRA 4GGGA 4UV9A 1HW2A 5E1XA 3QAHA 4I0BA 5CLSA 4EJTA 4EV0A 1UFMA 5HLGA 2PJPA 2NNNA 3F21A 3P9CA 1B6AA 1S8NA 3WE2A 3OOPA 1IN6A 3SHFA 2HYFA 5JI6A 1LDJA 1JHHA 1TNTA 1DDNA 2OZ6A 3P9IA 4R8HA 5FFXA 1ON2A 3O2PE 3KP7A 1G6NA 2ISZA 1STZA 3F8NA 1ZG5A 3TOAA 1W7PA 1EH6A 2EFPA 4GO1A 4LB5A 2RKHA 4ZH4F 3LAPA 2HFHA 1VTNC 1O57A 4IRHA 1MDMB 4K2EA 3LA3A 4HA8A 2ZCWA 3I54A 2DPUA 3IWFA 4UHTA 3HSFA 1QO0D 3KEOA 4YFKF 2YX4A 4E70A 1MGTA 3JAMK 1Z05A 1IN4A 5EEHA 2L3DA 1YS6A 4OU0A 2A5YB 3MFKA 5E20A 5DCMB 1QNTA 2VOOA 3H3ZA 1IXCA 3CO6C 3PQKA 4XLPF 5D4RA 1LB2A 5J8FA 2ZMEA 3KE2A 1K79A 3HOTA 4D0PA 1LQ1A 2XRNA 1KU9A 1XGMA 3P9KA 4L0YB 3L09A 1XSDA 3E97A 2QBYA 3KEQA 1XSXA 4HF2A 4CYDA 1R1UA 3BZ6A 2P5VA 5D5VB 3KP3A 1O3TA 3WTVC 2IW5A 4RGRA 2FRHA 3D5LA 2DPDA 3WTTC 4WF2A 2ADUA 3MZYA 1IXSB 1H9GA 4IJAA 1B9NA 4MNUA 4ASNA 3D0SA 2KJCA 3F6VA 1WWXA 2E1CA 2JPBA 3B73A 4Z2YA 1FBQA 4JQFA 4KN7X 1B59A 2IRFG 2Z9OA 3L2CA 2EFNA 2NYXA 3QP5A 1AOYA 2J5PA 3W6JB 1UHWA 3TOBA 2RQPA 3IHUA 5H6QA 2FBKA 3M9AA 5D5WB 4M9XA 3C3WA 2HOEA 4PGHA 5L3CA 2QVOA 2KIUA 1USTA 2K4JA 1SD4A 2XKOA 1S3JA 1K7AA 4P9UA 4L5JA 2BYVE 2Z33A 3RYPA 1ZLKA 2CGPA 2F5CA 2DK5A 1YFHA 3KLOA 1J2XA 2HQRA 4RGSA 3M1EA 1RUNA 5LGTA 3IRQA 4YG2F 1P4XA 4ZYGA 1LJ9A 3LSTA 4YIFA 1HKQA 3RJPA 1SFXA 5FGMA 4OIQF 1LNWA 1T98A 1IRGA 3QPHA 4MTEA 2A61A 2ZXJA 2FE3A 4WXHA 3VB2A 3SZPA 3F8CA 3ZQ7A 1KYWA 4KIGA 3TO7A 1QGPA 3WTZA 3M8FA 1A04A 1B9MA 2FBHA 1R5HA 2DQLA 2LSOA 4HX7A 2QLZA 4H0EA 3G73A 3MEXA 5AIPA 1O7FA 2FXAA 1BN5A 4WXDA 3PFIA 4L9JA 1EV7A 1YW7A 2OD5A 3LFKA 3ROUA 4UVCA 4N0BA 3V4GA 2QUFA 1XN7A 3WGIA 4PDKA 1BBYA 1ZGAA 2C6YA 5FD5A 3K1NA 1XMAA 3IC7A 1KQ8A 2LF7A 4HBLA 1TW2A 2VBZA 4Q4ZF 2BBYA 1U6GA 2XAFA 1YW8A 3T0YA 3GLXA 3DFGA 3GYHX 1R7JA 2JPCA 1OMIA 3HTSB 1OKRA 2BEOA 1AWCA 1CF7A 4ZZDA 2VC1A 4HX4A 4RB3C 2B0LA 4HQEA 2WC2A 2QQ9A 3WE3A 4ZYDA 4U7BA 1FBSA 1R23A 1FPQA 3REOA 3ERED 3HOSA 1P4AA 2OA4A 3Q9VA 4RB0A 1PUEE 4XSZF 1IN8A 5FLXZ 3GFMA 2A07F 2X0LA 2MD5A 1ZG3A 3F3XA 2NAZA 4IHSA 3BY6A 1GVJA 4A5NA 4Q5SF 2HTJA 1HW5A 1D3YA 5F64A 3KP5A 1P4WA 4OMYA 2K4BA 5H20A 1W4MA 1IRFA 2MC3A 1KU3A 1O7LA 2JTVA 2L01A 2EWNA 2O03A 1IN7A 2P4WA 2XV4S 4LLLA 1FP1D 4O6JA 3RIRA 4U0VA 4I01A 4WCGA 2D45A 4Y17A 2VC0A 1UB9A 1FNNA 5DYMA 3O3KA 3NRVA 2Q8KA 1ODDA 3K9TA 4AD9A 5CVUA 3J81Z 1HKSA 3HUGA 2PBIA 3DP7A 2VBWA 1EH8A 1T38A 1SAXA 1R5GA 4NHJA 3AAFA 2IT0A 4LFUA 5F6FA 2M87A 2YSRA 3K1MA 5JHUA 4G94A 2VE8A 5BPIA 2CW0F 5E18F 4XSXF 4WX9A 4ESFA 3ZMDA 1FYKA 2A6EF 2D2WA 1SD5A 1U5TA 1J7KA 2KKOA 4G7ZF 3KCCA 5DEQA 4QLCU 3MQ0A 1JXSA 4RB1A 2K27A 3HRSA 4UVAA 4HDUA 2VBYA 4DQ2A 4HX8A 2XHKA 4CO8A 2Y0MA 4KICA 1TQPA 2M1BA 1U8RA 1QZYA 2O61A 1H0MA 4CICA 1LEAA 4PZJA 4CDGA 2M45A 2BGCA 3CLOA 1MZBA 4KDPA 3GXOA 3DEUA 1QPMA 3S2WA 2G7HA 4FHTA 2RGVA 5HLIA 2V1DA 4LG0B 5LEKA 4KIFA 1YG2A 2EFWA 1MDMA 1ZREA 3COAC 3QP6A 4BHBA 3QOPA 4EVIA 4EGZA 4KYWA 2FQ3A 1U3EM 1KU7A 2XGXA 3IRRA 2JZYA 1WKMA 2M8EA 3F8BA 5KK1A 5DCMA 2VBXA 5D8KB 4BH9A 2LF8A 4EM2A 1O3RA 1MD0A 2GIVA 2M5WA 2MLKA 2GXGA 5LHGA 2CFXA 3WU0A
chains in the Genus database with same CATH superfamily
2V4JC 2JQ7A 3PNVA 2EBIA 3TQNA 1TBXA 5BQTA 3BDDA 5F1JA 1D8KA 3SFIA 3RZDJ 4M6XA 2GOXB 2K9NA 2XRLA 1W36D 4F52A 4KNYA 1LEBA 4E7KA 2O8XA 2HS5A 1YTYA 3NWSA 1U0JA 4L18B 5F0FA 2K9MA 4U7DA 2PI0A 3E0JB 4OIRF 5M5YJ 3W2VA 2R0QC 1IXRC 5FKMA 5HNFA 3FIWA 2YU3A 2OTLI 4FISA 2KDZA 2F48A 1FC3A 1U78A 2BY2A 3LFUA 4UVBA 1PP8F 4OIOF 3OIOA 4RLFA 3FXUA 4V2GA 2KPMA 2ME0A 2BZTA 5DV5A 2XSJC 1WJCA 5LFAA 5A2QZ 4IRGA 4IHTA 3UR3C 1ETQA 2XIGA 5F27A 4IRIA 1YYVA 4EM0B 1PUFA 1BI3A 2L2OA 5GP9A 3M07A 3I3LA 3E6MA 2X6WA 5DUKA 2IGMA 3EUKL 3OR2C 2NVTJ 2X1CA 3EUHC 1EKEA 4U88A 2DFFA 3ZR8X 3WODF 3RI4A 2O5RA 4II2A 4BJ6C 1IUYA 2EA2A 2DTZA 3JW4A 5CQGA 3GW2A 3ABMH 5H6RA 2VKVA 1XC5A 2E71A 1B4AA 4XKCA 3GX4X 3K2ZA 3OOUA 4EGYA 4IHYA 2R7UA 3E3VA 1BR4A 1SVLA 3V8KA 4EJVA 2VUMJ 4FQGA 2IA1A 1SANA 4NUBA 5LRRA 1XSVA 3L2VA 1FEXA 2E36A 3BR2A 3VDXA 3A01B 1WJEA 1ONVA 1MBGA 1X1PA 2VASA 1ETKA 3ZQQA 3ZMSA 4I98B 5HOOA 2QQAA 1WVRA 2HKOA 3FBNB 5KCMA 5FLXK 4RGUA 2F4OB 1E17A 3H5AA 3BT9A 4PGGA 4PJJA 1D1AA 4I7HA 1S7OA 1WHUA 4KT5C 4CXFA 4YEJA 2R7WA 2ZJQF 1W5SA 4HV5A 3VODA 3TW6A 1QQIA 3VSLA 3CDLA 3F8MA 2QENA 4EJWA 5JVTA 4HF1A 3I4MJ 4BHCA 1WI9A 2G9WA 1B1BA 5IPAA 5BPDA 2F5DA 1L3LA 2VQCA 1P2FA 2DA4A 4B09A 4HNUA 1VFCA 1X1DA 2GQQA 5AIQA 2QZ8A 2X9DA 2DJIA 2Q0OA 3F9KA 3K69A 2P0WA 2Y0SA 5HDKA 4ZDOA 1ZELA 3CUOA 2R93J 1JUPA 3HGGA 1KYZA 3W2WA 2Z5UA 1YRNA 4II3A 1G8XA 1XS9A 3RYRA 3H9QA 3WG7H 3KP4A 2WV0A 1ETWA 4XRMA 3DQVC 2L7MP 3K4JA 5LLQA 1K78B 3QPLA 2W57A 1G3SA 1WQ2A 4XLEA 3WU2C 5HLHA 5TRDA 2OF7A 1LDKB 5DCFA 4DIQA 4N4NB 4EATA 5LHIA 3ZCOA 2DBBA 1F1ZA 2Y69H 2YR2A 2HDCA 3C2GA 1UG2A 3H5RA 3SXYA 3GFLA 5CVJA 1PUFB 2OJED 3RKWA 1TL8A 1POGA 1L0OC 2HQAA 3J81K 1TWFJ 4G6QA 4UV8A 5FO5A 3QU3A 2VODA 5FKKA 2GAUA 1T39A 3BJ6A 2FNAA 4L9TA 4WXCA 1QU3A 1D0XA 2E1NA 1ZARA 3NEUA 2CG4A 4MQ9F 5F1RA 2F4IA 3BOQA 1WJAA 5LGUA 3S3OA 5IT3A 4AIHA 2V6EA 2MH2A 1E3HA 1WH7A 4G12A 2MC4A 5HS7A 3SZGA 2J5OA 2LNBA 2W82A 4ABZA 1JUMA 1LVAA 3HOXJ 2RN7A 2JA8J 5E8GA 2W84A 2NVQJ 3CUQC 3ELKA 3NAUA 3H0GJ 2OTJI 3MMYB 3T5XA 1MJ9A 2HTSA 1HC8A 4WK8F 1FLIA 4E7ZA 2H6CA 2TDXA 3HPGA 4L9NA 2NNYA 3LQRA 3TDUC 3FISA 4FX4A 2IS1A 2V1UA 3WG9A 1AHDP 5FRNA 1Z3XA 1U9NA 5LHHA 1FOYA 4AU7A 2OZUA 4FT8A 1IJWC 3L00A 3OMYA 4XICA 1G4DA 4AVPA 1ZQ3P 2LDUA 5EG0B 1YIJI 2DMUA 1KONA 3GFIA 1Y0UA 1MIJA 2FU4A 4HG2A 4ESJA 4IF4A 2PMUA 2E5ZA 2W7NA 1BIAA 2W85A 1G3WA 4B47A 3DPLC 3VFZA 3K70C 3LSIA 1HW1A 2G7UA 5K7ZA 3K1PA 2K3FA 1JUSA 2OU2A 2PQ8A 4XLNF 3WTXC 2FSWA 1OCTC 4C2TA 1D8JA 1Z6RA 2EV6A 1WGXA 4P9FA 4Y52J 1SMTA 2OUMA 2WAEA 2EZKA 3GTKJ 3U1DA 3JRBA 2R7OA 1BW6A 1ZRCA 2CWEA 1GHCA 4A3EJ 3GLLA 2DLLA 4NDLA 1KGSA 2XSDC 2A6HF 4BS9A 2FJ1A 1OYWA 2VT2A 3ABKH 5J1YA 2P5KA 4LIVA 4PFPA 1XG1A 5J8CA 4AYBN 4HAMA 1MMGA 3ZOBA 1VQOI 4RAYA 3I59B 1S7AA 2VQLA 1ORKA 2JUCA 2VXDA 2QF7A 5DD8A 3VYRB 3LWFA 2R7TA 2O0YA 2XPVA 4KA4A 3HTUA 3ZMZA 2L4MA 3ZMVA 3QRFF 2EZLA 3ABLH 3H35A 2VKEA 4BY1J 1IN5A 1MMAA 2LRDA 4D1QA 4XL9A 3PO3J 2JSPA 3AG2H 4XOTA 4C3HJ 1FTZA 2DYSH 2LKXA 2KIMA 3CD6I 1F5TA 1UELB 2EZIA 2X6YA 4A3MJ 4GYIA 2F5EA 3F8FA 4DNCA 2A3SA 3G4SI 3WTUC 4D7NA 3TO6A 2P6SA 2CSOA 5ILVA 2MBFA 3V7SA 1ZGJA 2KT0A 2EZHA 1RKWA 2GWRA 4GFBA 3KP6A 2K9LA 3T8RA 2QM3A 1USSA 1D5VA 3DKYA 3N05A 5IT9Z 4QTRA 4E7SA 2R4GA 5KNLA 2XC7A 3JSPA 1K4TA 3OY9A 1OCRH 3GZ5A 4KISA 6PAXA 1RRJA 4JX4A 1FT9A 3WTYC 4CSWA 2XGCA 3DU5A 4DYRA 4GDFA 2Z16A 3KFWX 4EJOA 3JRCA 2DI3A 2L9NA 2P8TA 3H0DA 4F55A 4KFCA 2L9RA 1OR7C 3UKGA 3HOWJ 2LBFB 1SAUA 3RPUA 1BI1A 2DJNA 1HQCA 3ABUA 2H09A 1IV8A 3HKZN 4V2FA 3OS0A 3Q9SA 4A12A 3HSRA 2XDVA 3W6KB 3LL7A 4NC6A 2HYGD 2QYOA 4BYYA 4ENNA 5J6XA 3F72A 1R00A 4PFOA 5AONA 3G3ZA 3EQLF 1MH3A 4PSXA 4IVNA 3RTRA 3BLYA 2DFIA 1RUOA 3H92A 4OOIA 5E8IA 3JRDA 2JWTA 1NK3P 5E17F 2QSGX 2X1EA 3JAMZ 4YFXF 2FX0A 2LVSA 2ACJA 2WV1A 2NOJB 2L0KA 3HL2A 3BR3A 2E2HJ 3FDYA 2COBA 1BC7C 1Z21A 1FYLA 4I0AA 2P7CB 5GAHJ 4A3KJ 1TTYA 2VOPA 1T08B 2X6OA 1N25A 3DBHB 1BOAA 1YW9A 5A2QK 3KLNA 4PCQA 2DDBA 1MBKA 5F04A 3RSNA 2L54A 1ON1A 2XKPA 2JRMA 2X4HA 3FKJA 4IHVA 5K7HA 1O3QA 4TV7A 5ICCA 1MJAA 1T0FA 2XAJA 3HOVJ 4M3DA 3I53A 3S15J 2Q2EB 1R4NB 5FKOA 3M4OJ 1X4OA 4DGWB 2MABA 4ITVA 4RDUA 2GM4A 4M3GA 2BXYA 3FM5A 4XRFA 1HSTA 4MEYF 2RNJA 3JSOA 3BR0A 2VE9A 1YI2I 2XAUA 5GAGJ 2NRAC 1X1AA 1QVTA 5DM6F 3GVAA 2IPQX 1ZR2A 1LPQA 4HW0A 3F23A 2V9VA 1ZRDA 3WHBA 1HF0A 3KPHA 1TQIA 1ZLJA 3UNGC 5IOZA 1YJWI 2KIFA 4N9HA 4BNCA 5L3GA 3HM5A 1OFCX 2OBPA 3P7NA 2DT5A 2YU9J 1X2MA 2HGCA 5JR3A 2DA2A 3DLLF 4HPQA 2FMYA 2DU9A 3CTAA 4LG0A 1DU6A 1S29A 2M3AA 1UJ8A 3DU6A 1JHFA 2KJBA 4EM1A 5D6EA 1D5YA 4BXUA 2PLYA 2CQXA 3GEZA 3CCMI 3CCJI 1GVDA 2GLOA 4Q48A 4UXNA 3FMSA 4BDZA 2UZKA 4IZZA 2QCOA 2FMLA 1XDSA 1TNSA 2IP2A 3CDIA 3CJQB 3ZQIA 1DQUA 2E35A 1ETXA 4B1RA 4ZTJA 4XKBA 4GCVA 3LA2A 1FYMA 1REPC 1YX5A 3Q0WA 4DZJA 1E2XA 3M8JA 1XMKA 2LP0A 3GF2A 4MLOA 2DW4A 4AIKA 3MKWB 1JT0A 3J80Z 3HPHA 1I6HJ 1TZLA 4R79A 5CPRB 2M7BA 3CCLI 3CUQB 2ME6A 3SZTA 2JRTA 3FHZA 2K02A 2H27A 3J7AY 4IPAA 4HDVA 3BR5A 3HC7A 2E7WA 4XBFA 2PMZN 4B3XA 2TRTA 3FMQA 2VQHA 3TEDA 4HZFA 3DWLE 3HG9A 2P81A 3GTPJ 2GXBA 2XAQA 3QYBA 3T1BA 5E3MA 4GXOA 1OR7A 2H6BA 2FD5A 5TISC 4ZYHA 2DA5A 4WWCA 4XKVA 1YJ9I 2WAQN 3IWZA 3HOZJ 1OQYA 2MA3A 1YX3A 4BU2A 2L02A 3DPUA 1PP7U 2MH9A 3DTIA 3VWBA 1V3FA 4XOPA 1TLHB 2WTEA 4CA0A 3S1RJ 1I6XA 2Y75A 3FXRA 4BHPA 4UNOA 1YIOA 2BHYA 4UB6C 4IX7A 5JVGF 4QPOA 1NTCA 1IAWA 3SFZA 4O3MA 5LBQA 3L2RA 3CC7I 2KRHA 3ONQA 1QBJA 4NB5A 2WY7Q 4XIDA 4A2UA 2H94A 2LTPA 2ZBKA 3R6SA 3CCSI 1UCRA 4PUSA 3ZQGA 4C9YA 3C7JA 2I10A 3CC4I 3HRTA 2DAOA 3LA7A 4RAGA 1XGOA 2GA1A 2PN6A 5ED4A 2VN2A 1G3YA 1O4XA 1YE9A 5KAFC 2EB7A 1Y8RB 4JBAA 4Y4RA 1H89C 2JT1A 1DPUA 1Z91A 4JK1X 1LDDA 1WRJA 3FF5A 3FK7A 1F4KA 1V5EA 1JGGA 2ELHA 2R5ZB 1YQAA 1ENHA 1C0WA 4X6AJ 3DKXA 1Z9CA 4M72A 4IHWA 3KZZA 4A6EA 4C3JJ 4OIPF 4LB6B 5CVRA 1SMYF 3OIPA 4BXFA 2DFEA 4BJ5C 2ZMEC 2EFQA 2KMUA 1KQ9A 3CO7C 1GT0C 2ICWG 3BP8A 3GZ6A 4M9SA 1FMWA 2V79A 2ZFWA 3A01A 4ENJA 2BOLA 5IOYA 1X1BA 2IVMA 3U1KA 1GXQA 2DMNA 1BA5A 1BJAA 2XB0X 3ZPLA 2QWWA 1LE8B 3L2WA 1Z1DA 1MJBA 2FOKA 3LSGA 1BC8C 4ESBA 3SEZA 3I56I 2YX7A 4A69C 4A3DJ 1XDUA 2BVMA 2K5CA 3IP4B 4ZJZA 3Q5FA 5DD4A 3G71I 1MNDA 3EYIA 2AS5F 1YITI 1SFOJ 1E3OC 3BCBA 4A0XA 1G3TA 2A69F 4XN0A 3FZVA 2IA2A 2ZXIA 1GV2A 3CCRI 1H8AC 1JE8A 2LK2A 1MNEA 3HHHA 3EUAA 3P5JA 3VOEA 1TWAJ 3H36A 2ESHA 4XLHA 1K78A 3FXOA 2CW8A 4CGZA 3BQYA 1QRYA 1V4RA 1W5TA 2HWVA 2XVCA 1DGWY 1GXPA 4DJAA 2EV5A 5GADJ 1X2NA 2AXLA 3M8EA 3C18A 5IT9K 2F4MB 2Q1ZB 5LEJA 2Z99A 4Y13A 1U9OA 3FWEA 5M5WJ 4YIIA 4MHGA 4RGXA 3D5RC 4L5IA 4MIMA 3FKIJ 2OPTA 3JRFA 2KISA 1SVMA 3C2HA 4BEHA 3N4MA 1I1SA 1SFEA 3KYLA 1IW7F 1IO2A 5DTDA 1OISA 1VQ6I 3EYYA 3K4CA 3GTOJ 4XLCA 1Z77A 1HDPA 3DV8A 1JKOC 3I5UA 1TT5B 3V42A 4XKWA 2ZO4A 5DS9A 1UAAA 1J5YA 1XD7A 1EJ9A 2XB5A 3S2HJ 2MFZA 2W48A 2KQRA 3ZXSA 3O8GA 2DK8A 1R1TA 3AG4H 3BZKA 1R22A 3U9GA 3N97A 1Y8QB 4YFNF 2HXOA 2IXSA 5ICGA 5GPAA 1WFXA 3F22A 2DQRA 3K0LA 4I2OA 1XCVA 1TQMA 4AC0A 4U0YA 2DTRA 4IXAA 1J9IA 3BJOA 5JLWA 4F3QA 1A36A 2RDPA 5LD2C 1S6LA 4C2MJ 2BHZA 1FY7A 2XF7A 1AKHB 2AHQA 5FRMA 2ELJA 3DEEA 4Z6YA 3DBRB 2KIQA 5IYBJ 3CDHA 5EG0A 1I5ZA 3E6BA 1RNLA 3GFJA 3BWGA 2HYJA 3L7WA 3L1PA 2UXXA 2CUZA 4LMYA 1MBFA 4F7ZA 4M6YA 2LD5A 3TO9A 1OYIA 3J7YJ 1ZR4A 2B63J 2P7VB 2VJ4A 2HNHA 2MLGA 3JCUC 2R7RA 4N4OB 3V7RA 4RB2C 3ASNH 9ANTA 3V7CA 4KIBA 3OYGA 1TW3A 4UUSA 1YS7A 4MGRA 3TDZC 5CJ9A 2X6XA 2LY1A 2HZDA 1G59A 1LFPA 2R5YB 2RC4A 2CH0A 2CUEA 1X3UA 4ETSA 5CVVA 4A5MA 2IS6A 2D1HA 1KA8A 1ZYRF 2DA7A 2FA5A 1TC3C 3B6CA 5LRSA 4M73A 3ASOH 4FETA 1VQ4I 2W24A 2LREA 4KITB 3I55I 1RI7A 3R4KA 1PDNC 5HDGA 1UMQA 3X2QH 3MWMA 3I59A 1R36A 2ZNZA 4LK0F 2XF6A 1T6SA 5IY5H 4S05A 1T2KA 2E19A 1SVOA 5E79C 5CVIA 1ZGWA 5E3LA 4RA2A 1Y1VJ 3V8JA 3V8LA 4EJUA 1J59A 5H2FC 4HV6A 1ACIA 1H9TA 1XMXA 1FIAA 2V26A 3CJNA 1UHMA 2F5VA 4XLAA 5B66C 5J40A 5D5XB 4BY7J 3OYJA 4BEHB 2P5LC 4CZZA 5ICEA 2M30A 5K1YA 3S17J 2HEOA 2FNPA 3S1NJ 4KMUX 3HRUA 4DBQA 3DTEA 3C1DA 2XUBA 2D1VA 4W97A 4A6DA 4RAFA 1MBEA 1GLNA 1W7PB 1JKRC 1RPWA 2VIXA 1W0UA 3IKTA 1R1VA 2HR3A 2WWYA 2XROA 5D4SA 1GUUA 4W1UA 3IH4A 1D1BA 2B9SA 2DT7B 2CQKA 3CF2A 4GYGA 3J80K 2QSHX 2OQRA 2KFDA 4UUVA 3WU1B 3A0BC 2MD0A 1PYVA 2RV8A 4AIJA 1YLFA 3PL8A 4LGWA 2VL8A 1JJ6C 1MNMC 5M3FJ 3KP2A 4Q47A 3JREA 4I02A 2XPWA 3OS2A 2LOOA 2ZFUA 3PNTA 3ZQCA 3S3NA 5J3LA 2ESNA 2DXIA 2NOGA 2LBFA 3JTGA 3EUHA 2GZWA 3CP2A 4ZZLA 2CQNA 3CMYA 3KZIC 3GUDA 4G7OF 2FF4A 1W7PD 3BQZA 3K7AJ 3TBIA 3ZN0A 1HXDA 4MQVA 3OV8A 5JLXA 1Z6TA 2CO5A 2XAHA 5D6FA 3LSPA 2EA4A 5TGTA 5J4VA 3NQOA 5ILUA 3JRIA 3AKZA 1NK2P 2QQ8A 1P7IA 1TP4A 2FUG2 2ZMEB 3E6CC 4IOCF 1VQKI 2A68F 4G6TB 4UUSB 3VEPA 2VT3A 3EETA 1BIBA 2PX9A 4LK1F 4OWRB 1XB4A 5FROA 5D8LB 1N77A 1Q1HA 2JVHA 1LUJB 2IGNA 5IP9J 3ECOA 3KZYA 2O3FA 1R49A 4NC8A 1B8IA 1DPRA 4IOAF 2ZNYA 3QU6A 4PJNA 2K86A 3BTIA 2QBYB 4C2UA 1QHGA 3CZ6A 2ETHA 3AG1H 1HLVA 3ML6A 1I39A 4B48A 3GZNB 5J4YA 3E6DA 5IP6A 1LFUP 4HQMA 4I09A 4P96A 3KIOA 3KX2A 3H3UA 3R0AA 3OYKA 4BQAA 1K6OA 3E5UA 1P6RA 1ERDA 2DFHA 1SD6A 3PQJA 3OYFA 2VXZA 3BROA 5FD6A 3MCZA 2F2EA 1CGPA 2MYSA 5FFZA 1WJDA 2YS9A 5D5UB 2CYYA 1VQMI 2KRFA 2NVUB 5L3FA 2Q2EA 3G1LA 4MEXF 1N78A 2M8GX 5HODA 1WI3A 5L3BA 1GV5A 3I58A 5FJ8J 1I27A 4N9IA 3VSKA 5FKLA 5LGNA 3DLAA 2LKPA 3I4PA 4LIUA 4MTDA 3SYTA 3DKWA 2HQNA 4HEA2 2ZKZA 2HDDA 3VYTB 2LYCA 4QWQA 1IUFA 4JP0A 5BS6A 2TCTA 3M3YJ 5IP7J 3K4BA 3FM3A 4YIRX 5ICFA 4BDYA 2CUJA 2STWA 4EQQA 5E1ZB 2I5UA 4M6VA 4OMZA 1WJ5A 4BE1A 5KVRA 4DW6A 1M1EB 2DYRH 3E5QA 3RKYA 4M74A 4M9ZA 2E5NA 4XONA 2QQBA 3H5NA 2JSCA 3IAM2 1X3ZB 4A3IJ 3IL2A 2UXNA 3LSJA 3K4KA 2ISYA 1ZK8A 3J7AO 2X51A 1FP2A 3T8TA 4HF0A 3BPXA 2P6TA 4BAYA 1U2WA 2XASA 4CUGA 1A35A 1TT0A 4HYEA 3LAJA 3BG3A 2DA6A 3I64A 2ECCA 2M4KA 3NARA 3BCAA 1FX7A 3BJAA 2BV6A 4S04A 2JA2A 2MG4A 3CMMA 3ZP5A 2O6GE 4XN3A 5K5OA 2IJLA 4XNFA 1RC9A 1U5TC 3BTJA 4IQJA 4G8XA 4IEJA 4HLYA 1XCBA 3CUQA 3RDIA 3DF8A 3OSFA 3M7GA 2KDOA 3HSEA 3DXJF 2COMA 2ZSIB 1OCZH 2ZJRF 1APLC 3ZMUA 5M3MJ 3Q3SA 2X1DA 2M0MA 2V1XA 3U21A 3K2AA 2L9SA 1MSFC 2R7VA 1F43A 4RM3A 1Z7UA 1FTTA 4XRSA 2DMPA 1B8IB 1IF1A 1WZ2A 2W4SA 4NQWA 1YJNI 4JX5A 1ZAOA 3OYLA 5BMZA 3JTHA 3A1YA 3O6BB 5C44J 3WGGA 1T95A 2GA2A 2ZXWH 3DPTA 4ZYEA 2R7XA 3PUFA 1ETYA 1HKTA 2NS8A 1MW7A 3JRGA 4KN4X 2UWMA 3QQAA 5L3DA 5HVQC 4C3IJ 1WPKA 1J09A 4Y15A 3SQNA 1VQ5I 3ISPA 4QPQA 4LLNA 1XGNA 3VPRA 4MFDA 1HSJA 4KMFA 1HA8A 1TWCJ 5L3EA 2R7DA 1EH7A 1WJFA 1DP7P 1MKMA 2DO7A 2A5WA 2OV7A 2IA0A 3U2RA 4AYBA 2IEKA 1ZRFA 3G2BA 4HOBA 3C2BA 2EFOA 1K6YA 5FKNA 2E1MC 2R7FA 1KQ0A 3FXQA 1ZG1A 2F5FA 2FBIA 2O7OA 4V19K 3JRHA 1ITYA 2LR8A 3QPTA 4RAZA 3G1OA 3HIFA 2PFBA 1ZKGA 2K9QA 2Z3YA 1Q1VA 2KRCA 3I9V2 2OQGA 2OAZA 1ZN2A 3A03A 2STTA 1SD7A 1MMNA 1Y6IA 1OCCH 2DA1A 2ZSHB 2XGEA 1FBUA 5EF6A 2EIMH 2PMHA 5C3EJ 5E1WA 3ZQLA 3OS1A 4P55A 5HLTA 3GCMA 3FXLA 2R92J 3PO2J 4S0HB 3R61A 3CJTB 1MSEC 2H1KA 1QZEA 3PNYA 3FHNA 4BUPA 2R5ZA 1RZ4A 1PJRA 4CHUA 3R60A 4LD5A 3LOCA 4B43A 2V6CA 4M3BA 2DN0A 2WB1A 5F0HA 5EGOB 2PJRB 3E7LA 4AWXB 1BM9A 1FSEA 3OYEA 5HS9A 2AQFA 4LJZF 5GTIC 4D5CA 5E3OA 3GBGA 3ULQB 1RIOH 2L4AA 1Z3YA 5CYVA 4JYKA 3GO5A 2NVXJ 4PSWA 3HRMA 5BOXA 1BOBA 2PEXA 4YELA 2DMTA 2ECBA 3PFYA 5ERIA 3KYDB 1NG6A 5HDNA 4IHXA 3TKYA 4U0WA 4A0ZA 3DCFA 3ZN1A 3KEYA 2Y48A 1SFUA 1LE8A 1YOVB 3GWZA 2VJJA 2JVGA 2E2JJ 5B1BH 2W1OA 3K4LA 3HKZA 4XORA 2PG4A 1DU0A 4LLGF 3WTSC 3DBLB 2ZJPF 2LC2A 2QKLB 1CF7B 1BI2A 4NQWB 1DUXC 3PM1A 3ZMTA 1HBXG 1NHAA 2HXIA 1KU2A 2ZXHA 3ABTA 1R58A 5K5QA 1FMVA 1QZZA 3A02A 2EIKH 2OCEA 3RKQA 2ZJ2A 1ZHFA 3OYIA 3OYNA 2LMDA 2M7AA 2YPRA 1YO5C 2HZTA 3S32A 5GAEJ 2CQ7A 2LY9A 1O3SA 1R6RA 4J01A 3AL0C 4ENKA 1UZCA 4G6DA 3FXJA 4L9VA 5FB2A 2VONA 1JGSA 2BW3B 2KP6A 3L9FA 2E7XA 3DEWA 3EDPA 4L0ZB 3O8HA 2R7ZJ 1JI8A 3HB9A 1IRZA 2H1LA 5F0CA 2IS4A 5EEGA 2RVCA 2ZC2A 1FWZA 2CJJA 1ZH5A 3ZRGA 1A6QA 3GTGJ 4ENMA 4JX6A 3HYIA 4B4CA 1W1WE 5EZHA 4CCJA 3F6OA 4QIWN 1FOKA 1F9NA 1OYYA 3LQQA 4G7HF 2EK5A 3MAJA 4M71A 1IG7A 2BE5F 5TJJA 3MKYB 5HNHA 3OYAA 1WSUA 1GDTA 3ECHA 3H1CA 5EDNA 1FIPA 2NS0A 2HKXA 2R3SA 4Y3OA 2CMPA 1RETA 1I1GA 2EV0A 4ON0A 2K7LA 1P92A 3D5SC 2O9LA 5ILSA 4R1HA 4HLXA 1IZ1A 2DMQA 3HZJA 5JHFA 3B02A 1BL0A 2EJRA 1XX5A 3MZHA 4M3FA 3ZGKA 2W25A 2CFOA 3I71A 3G6EI 4EMSA 1IGNA 4X0GA 3OWTA 4A0YA 1RKTA 2WBMA 3HBLA 1UG0A 2CW7A 4B8XA 4P5OA 2Y9ZA 4BL0B 3S2DJ 3HHGA 3HUGB 2CV0A 4OINF 2LLKA 4FX0A 4PJMA 1FZPB 1IDZA 4E7HA 1XGSA 1FSHA 2MSYA 4O5VA 3IKVA 3BG5A 1AKHA 1X58A 2FEZA 1A6IA 3R0JA 3RKXA 1BI0A 2QGUA 3RPQA 4G9YA 3I0TA 2CRGA 2XAGA 4KUMA 5K5RA 2EPFA 1PVEA 1OCPA 1OPCA 3QWLA 2WADA 3TGNA 5DDGA 1ULYA 4CYCB 1QA6A 3WTWC 3LSMA 2AQEA 2Y0SN 1Y1WJ 3BPVA 3FX3A 1J0RA 3SDGA 5JFRA 1IV6A 5DUIA 3WGHA 2R5YA 2L7FP 2M0CA 1U5TB 3E5XA 3KETA 2PMZA 5HS8A 2FQ4A 4DOZA 4RS8A 3BG9A 3FMRA 4GGGA 3CCQI 4UV9A 4F92B 1HW2A 5E1XA 2JA5J 1K61A 3QAHA 1K4SA 3A2KA 4UUTA 5IYCJ 3IH2A 4U87A 3IH3A 3H9JA 3BG6A 1MMDA 1XTAA 2WAQA 4I0BA 5CLSA 2CQQA 4EJTA 4EV0A 2XGDA 1XPXA 3TW7A 1UFMA 1SEUA 5HLGA 1ETVA 2PJPA 2NNNA 3F21A 2H8RA 2JK3A 3P9CA 2VPLA 1B6AA 1S8NA 3QPSA 2Y2ZA 3WE2A 3OOPA 1IN6A 1Y56A 5FLMJ 3SHFA 2HYFA 1VQNI 5JI6A 1T8IA 2V9PA 1LDJA 1VZ0A 1JHHA 2WA0A 4JOMA 1TNTA 3GTJJ 2OZ6A 1DDNA 3P9IA 3HOYJ 3S16J 4R8HA 3OIQA 5FFXA 1ON2A 3W2AA 3PIPF 3O2PE 1Z7LA 3KP7A 3QOEA 1G6NA 3OYCA 2NVYJ 2ISZA 1STZA 3F8NA 3OL3A 1ZG5A 3TOAA 1EF4A 1W7PA 2R7SA 1EH6A 1OLTA 4FASD 2EFPA 2Y30A 1LVKA 4GO1A 4ZC3A 2E1MB 4X1EA 2RKHA 4ZH4F 4LB5A 1MH4A 3LAPA 1IDYA 1I50J 3CCEI 2HFHA 1VTNC 1K83J 2JJ7A 2VJ5A 2BY1A 1O57A 4IRHA 5EZGA 1MDMB 3GTMJ 4K2EA 3LA3A 4HA8A 2V9KA 2ZCWA 3I54A 2A6TA 1KZHA 2QEXI 2DPUA 3IWFA 4BQNA 2VI6A 4UHTA 3HSFA 1D1CA 1QO0D 3OSGA 3KEOA 4YFKF 2DA3A 2YX4A 4I99C 1MGTA 1P7JA 4E70A 4F93B 3JAMK 2VLAA 2NS7A 1Z05A 4AIDA 1IN4A 5EEHA 2L3DA 1YS6A 3PJRA 1V55H 2H8WA 4KJZA 4OU0A 2A5YB 3MFKA 5E20A 2VKHA 5DCMB 1V5FA 1QNTA 4LITA 4BBRJ 4NNJA 2VOOA 3H3ZA 1EA3A 1WCMJ 1IXCA 3OYHA 3CMEI 3CO6C 4FTHA 1I3QJ 4HSRA 3MN2A 4D5FA 3PUBA 3PQKA 1MBJA 4XLPF 1J75A 2K3PA 5D4RA 1LB2A 3S14J 5J8FA 2ZMEA 3KE2A 4I6ZA 1K79A 3HOTA 4D0PA 1LQ1A 2XRNA 1KU9A 4J00A 3HDDA 1XGMA 2BY3A 4D7MA 3ZQFA 4E4HA 3P9KA 4L0YB 3L09A 1WJBA 3A0HC 1XSDA 3E97A 2QBYA 2L9VA 1E0EA 3KEQA 3RZOJ 4CCOA 5J1RA 2BXZA 1XSXA 1Y39A 4HF2A 4CYDA 1R1UA 3BZ6A 3CCVI 2HPMA 3H3VK 2AO9A 3Q0VA 2P5VA 5D5VB 3KP3A 1O3TA 3FBIB 3WTVC 2R7QA 4PK4A 2Z1DA 4Y7NJ 4BE2A 1FJLA 2IW5A 4RGRA 4CCMA 4AM3A 3CMAI 1ETOA 2K40A 4XRSG 2FRHA 3D5LA 3BTCA 2DPDA 3WTTC 1JJ8C 4WF2A 3BZCA 2ADUA 4A3FJ 3MZYA 1P9QC 3I4NJ 1IXSB 1H9GA 4IJAA 3OYBA 1B9NA 4PJ0C 3MVPA 4MNUA 4XMYA 4NC7A 4ASNA 3D0SA 3AL0B 2DODA 3WHCA 2L5QA 2O8KA 2KJCA 3OYDA 3F6VA 4IO9F 2K9SA 3S1MJ 1WWXA 3OR1C 4RMNA 3W3CA 2E1CA 5B1AH 4CH7A 4OAYA 2JPBA 3B73A 4Z2YA 1FBQA 4JQFA 4KN7X 1B59A 2FOWA 2IRFG 2HPIA 3HGYA 2Z9OA 3L2CA 5B5EC 1TWHJ 1H88C 2EFNA 2HDWA 2QA4I 5B3SH 2NYXA 3QP5A 4L5EA 1AOYA 2J5PA 1X19A 1Z0XA 1U8BA 2EIJH 3ESWB 5J47A 2DOEA 1B72A 2YUSA 4XLFA 3W6JB 1UHWA 3TP0A 4F91B 3SDBA 1QHHD 3TOBA 1CQTA 2RQPA 2V7FA 1T33A 2V1NA 3CLQA 3L2QA 3IHUA 1LFBA 2KL4A 5H6QA 2FBKA 2F6CA 3M9AA 5D5WB 4M9XA 3C3WA 2HOEA 5GTHC 4DYQA 4PGHA 2JA7J 4LG3A 5L3CA 4CCLA 2QVOA 1UHSA 2ID3A 4NBQA 1S7EA 2KIUA 1USTA 3Q0UA 2K4JA 1QVUA 1SD4A 1A5JA 2XKOA 1S3JA 3GTQJ 1VNDA 3RQIA 1AA7A 1K7AA 1MMSA 4P9UA 4L5JA 3BR1A 2BYVE 2VB6A 2VKDA 3PIOF 2Z33A 2M4GA 3RYPA 1N75A 4BE0A 1ZLKA 2CGPA 1JTYA 4OAZA 1V5GA 2F5CA 3S93A 2GOMA 3FXKA 1T0FC 2DOFA 3FXMA 2DK5A 1YFHA 3KLOA 3LSKA 1J2XA 2HQRA 3G1MA 2XF5A 5F08A 1MBHA 4RGSA 2EILH 4A3GJ 3M1EA 1RUNA 5LGTA 2CV1A 3IRQA 1A31A 1X4PA 1P4XA 2RAEA 4ZYGA 4YG2F 1LJ9A 4E7JA 3LSTA 1OJLA 1YRNB 3IV5A 3E1SA 1JKQC 4YIFA 1HKQA 2HVSA 2N8GA 4E7IA 3RJPA 4BQQA 1SFXA 5FGMA 3ERMA 4OIQF 2RNGA 1LNWA 1T98A 2HOTA 1IRGA 2B7EA 1YHQI 1R5ID 3QPHA 4MTEA 2A61A 2ZXJA 3MKLA 3MZ8A 2FE3A 4EEFG 4WXHA 4ZTFA 3VB2A 3SZPA 3F8CA 2BVLA 1DGRM 3ZQ7A 1KYWA 4KIGA 4ZDLA 3TO7A 2IS2A 4FCYA 1E3PA 2JUGA 2M34A 1QGPA 3CJRB 5E3NA 4YRVA 3GMEA 4XQFA 3WTZA 1SC7A 3M8FA 3LSRA 1A04A 1B9MA 2FBHA 3JR9A 1R5HA 2DQLA 2LSOA 1D0ZA 3IUOA 4MFEA 2HVQA 4HX7A 1JT6A 3OYMA 2QLZA 4H0EA 3G73A 2ZB9A 3MEXA 5AIPA 1O7FA 2FXAA 2LKSA 1BN5A 4WXDA 3PFIA 4L9JA 1EV7A 1YW7A 1FOWA 2OC6A 2OD5A 3LFKA 3ROUA 4UVCA 3A4CA 4N0BA 4GRIA 3V4GA 1W36C 2LY2A 1LKXA 2QUFA 1QPIA 1XN7A 3WGIA 4PJLA 4PDKA 3WU0A 2L7ZA 2KLOA 1BBYA 1ZGAA 4MO7A 2WB1N 1B72B 2QSFX 2C6YA 5EGOA 3PSIA 2PJRA 3BTLA 3AG3H 2MGQA 5FD5A 5DM7F 3K1NA 1XMAA 4J19A 1Y0NA 2HQ5A 3IC7A 1OCOH 1KQ8A 2LF7A 4I76A 4HBLA 2Y31A 3CCUI 4XM3A 1TW2A 2VBZA 5J1UA 4Q4ZF 2CUFA 2BBYA 3EPZA 3HEFA 1U6GA 4RM2A 2XAFA 2ID6A 2K85A 3CF5F 4DBRA 2E1OA 1YW8A 3OL4A 2DOAA 1HOMA 3SEQA 3T0YA 3GLXA 3DFGA 3GYHX 1R7JA 2JPCA 2L7KA 3HOUJ 1OMIA 4KT6A 4QSHA 3HTSB 1OKRA 2BEOA 3L2UA 4UB8C 1AWCA 4B44A 1CF7A 4ZZDA 2VC1A 1IC8A 3H9GA 4HX4A 4RB3C 4Y33A 2B0LA 4FE4A 3AFHA 4HQEA 2RQQA 2WC2A 3MKZA 1VQ9I 2QQ9A 3WE3A 4ZYDA 2AXTC 4U7BA 3QODA 1FBSA 1R23A 1FPQA 3REOA 1W5CC 3ERED 3HOSA 1P4AA 2OA4A 2I8DA 3Q9VA 4RB0A 1PUEE 4XSZF 1IN8A 2CS3A 5FLXZ 3GFMA 2A07F 2X0LA 1BR1A 2MD5A 1JKPC 1ZG3A 3F3XA 2NAZA 4IHSA 3GTLJ 2X48A 1DP3A 3BY6A 1GVJA 4A5NA 2X85A 2BW3A 3DTKA 3FK6A 2IAIA 5KAIC 4Q5SF 1W0TA 2HTJA 1RR7A 4DYCA 1HW5A 4IKFA 1D3YA 5F64A 3KP5A 1P4WA 1RESA 4OMYA 1JTXA 4RLQA 4BACA 2K4BA 3S3MA 2EH3A 2VJIA 1VQLI 5H20A 2LH9A 5CQEA 1VQ7I 1W4MA 1IRFA 2MC3A 2EINH 2UUZA 1KU3A 4D9JA 1O7LA 5C4JJ 2JTVA 1HDDC 1BJZA 4IL6C 2L01A 1R4MB 2EWNA 3HJEA 4HNTA 2O03A 2Z2SB 4ANJA 2CV2A 4XK4A 3TP3A 1IN7A 2P4WA 4DZPA 4HSTA 2XV4S 4A3JJ 4LLLA 4A93J 1FP1D 2JMWA 1AU7A 3JRAA 2HU9A 3BC8A 4O6JA 3RIRA 4BJTA 5KHDA 4U0VA 4ZDPA 3LSHA 3BG7A 4I01A 1R9TJ 1G2HA 4WCGA 2D45A 4M3EA 3CESA 4Y17A 3VYUB 4UY8I 4LOCA 1S9HA 2VC0A 3KYCB 1UB9A 1FNNA 2RREA 2CU7A 1S5LC 5DYMA 2WY8Q 3O3KA 4H4KC 3TL4X 3TMOA 3NRVA 3ZQHA 2Q8KA 1ODDA 5EEAA 3K9TA 1IRXA 4AD9A 4RBOA 5GPCA 3CQZJ 5CVUA 3J81Z 1HKSA 3HUGA 3K4MA 1SFKA 2PBIA 3CP8A 3DP7A 2VBWA 1EH8A 1I3AA 2KZVA 1F36A 1T38A 1SAXA 1R5GA 3NWTA 1VQPI 2NXNB 4NHJA 1VI0A 3AAFA 3K10A 2IT0A 3K6GA 3LNQA 4LFUA 5F6FA 3CC2I 2M87A 1R71A 2YSRA 3K1MA 4A3BJ 5JHUA 4G94A 2HI3A 3D1NI 1WH5A 2VE8A 5BPIA 2CW0F 4B3AA 4BBSJ 5E18F 2M2EA 2XPUA 4XSXF 4ZYAA 3B6AA 4ESFA 4WX9A 2ELKA 4CYCA 3ZMDA 1FYKA 1VQ8I 1VF9A 2A6EF 2BY0A 5EJCA 2D2WA 2W00A 1SD5A 1U5TA 3S1QJ 1J7KA 2KKOA 4G7ZF 3KCCA 4BQOA 2HOAA 4P1WA 1ZTRA 5DEQA 3RPUD 4QLCU 4AUXA 3RCOA 3MQ0A 5EYRA 4CCNA 4FE7A 1JXSA 4RB1A 1RR8C 5IYDJ 2K27A 2QKMB 3HRSA 4UVAA 2GIZA 5CKTA 1T56A 2D5VA 4HDUA 2VBYA 2E2IJ 4DQ2A 2A05A 4HX8A 1FOXA 2XHKA 4CO8A 3MD2A 2Y0MA 4KICA 3S8PA 5M5XJ 1TQPA 2M1BA 4CZCA 1U8RA 1QZYA 2O61A 1X1CA 1H0MA 5C4XJ 4CICA 1LEAA 4E6KG 2MW8A 1D0YA 2DT6A 4PZJA 1S72I 4CDGA 2M45A 2BGCA 3CLOA 3IAS2 4BGDA 1MZBA 4A3CJ 2JA6J 2E34A 3F0CA 3PSFA 5BNGA 2VPRA 4BKXA 4KDPA 3QYFA 3J7ZI 3GXOA 3DEUA 1NH3A 1QPMA 3CCYA 3S2WA 2GXAA 2G7HA 4FHTA 2RGVA 5HLIA 4E7LA 5FLVA 2V1DA 2G0EA 3SJMA 3K70D 3W6VA 5LEKA 4LG0B 4BXXJ 4KIFA 1YG2A 4A3LJ 2HVRA 2EFWA 1MDMA 4XR6A 1ZREA 3COAC 3M1CA 4AVZA 1Z67A 3QP6A 1NG7A 1BR2A 4BHBA 3QOPA 3QYEA 4EVIA 4EGZA 4KYWA 2FQ3A 3HXLA 1U3EM 2IBDA 3K4NA 1KU7A 3VYSB 4IQ4A 2HOSA 2XGXA 2JN6A 2JZYA 2KHMA 4CCKA 3IRRA 2EQRA 5K7FA 2WAFA 1WKMA 1HCRA 2M8EA 3F8BA 2UV1A 5KK1A 2LG4A 5DCMA 3BR6A 2LFBA 2VBXA 2Y9YA 5D8KB 4BH9A 2GBYA 2KZGA 1BW5A 3LMMA 2LF8A 1V54H 4HRIA 2IGKA 4EM2A 3RQ4A 1O3RA 2VQGA 2DCEA 1MD0A 2GIVA 2M5WA 2MLKA 4C30A 2DDAA 1TWGJ 1X3WB 2GXGA 2IGOA 2M9HA 5LHGA 4HNVA 2CFXA 2E60A 2OCCH
chains in the Genus database with same CATH topology
3TQNA 1TBXA 5BQTA 3BDDA 1D8KA 4M6XA 4KNYA 1LEBA 2O8XA 2HS5A 1YTYA 4L18B 4U7DA 2PI0A 4OIRF 1IXRC 2YU3A 1FC3A 1U78A 4UVBA 1PP8F 4OIOF 3FXUA 5DV5A 5A2QZ 4IRGA 4IHTA 2XIGA 4IRIA 1YYVA 4EM0B 1BI3A 3E6MA 5DUKA 4U88A 3WODF 3RI4A 1IUYA 2EA2A 3JW4A 3GW2A 5H6RA 1B4AA 3GX4X 3K2ZA 4EGYA 3E3VA 4EJVA 3V8KA 2IA1A 5LRRA 1XSVA 1ONVA 3ZMSA 4I98B 5HOOA 2QQAA 2HKOA 5FLXK 4RGUA 1E17A 4PGGA 4I7HA 1S7OA 4KT5C 4CXFA 1W5SA 4HV5A 3VODA 1QQIA 4EJWA 3F8MA 2QENA 5JVTA 4HF1A 4BHCA 1WI9A 2G9WA 1B1BA 5BPDA 2F5DA 1L3LA 1P2FA 4B09A 5AIQA 2GQQA 2QZ8A 3K69A 2Q0OA 5HDKA 3CUOA 1KYZA 2Z5UA 3RYRA 3KP4A 2WV0A 3DQVC 5LLQA 1K78B 2W57A 1G3SA 1WQ2A 5HLHA 5TRDA 1LDKB 5DCFA 5LHIA 2DBBA 1F1ZA 2YR2A 2HDCA 3SXYA 3GFLA 5CVJA 3RKWA 1L0OC 3J81K 4G6QA 4UV8A 5FO5A 3QU3A 2VODA 2GAUA 1T39A 3BJ6A 2FNAA 4L9TA 4WXCA 2E1NA 1ZARA 3NEUA 2CG4A 4MQ9F 5F1RA 3BOQA 5LGUA 1J75A 5IT3A 4AIHA 2MH2A 5HS7A 2J5OA 2LNBA 1LVAA 2RN7A 5E8GA 2W84A 3CUQC 3ELKA 3T5XA 1MJ9A 2HTSA 4WK8F 1FLIA 2H6CA 2TDXA 4L9NA 2NNYA 3LQRA 3TDUC 4FX4A 2V1UA 3WG9A 5LHHA 2OZUA 4FT8A 3L00A 1G4DA 4AVPA 2LDUA 3GFIA 1Y0UA 2FU4A 4ESJA 4IF4A 2PMUA 1BIAA 2W85A 1G3WA 3DPLC 3VFZA 1HW1A 2G7UA 3K1PA 2OU2A 4XLNF 2PQ8A 3WTXC 2FSWA 1D8JA 1Z6RA 2EV6A 4P9FA 1SMTA 3U1DA 1ZRCA 2CWEA 1GHCA 2DLLA 1KGSA 2A6HF 1OYWA 2VT2A 2P5KA 5J8CA 4HAMA 4RAYA 3I59B 1S7AA 5DD8A 3LWFA 2O0YA 4KA4A 3HTUA 3ZMZA 2L4MA 3ZMVA 3QRFF 1IN5A 2KIMA 1F5TA 4GYIA 2F5EA 3F8FA 4DNCA 2A3SA 3WTUC 3TO6A 2P6SA 2CSOA 5ILVA 2MBFA 3V7SA 1ZGJA 2GWRA 3KP6A 3T8RA 2QM3A 1USSA 1D5VA 5IT9Z 3JSPA 3GZ5A 6PAXA 1FT9A 3WTYC 3KFWX 4EJOA 2DI3A 2P8TA 4KFCA 3RPUA 1BI1A 1HQCA 3ABUA 2H09A 3Q9SA 4A12A 3HSRA 4ENNA 3W6KB 4BYYA 2HYGD 2QYOA 5J6XA 3F72A 1R00A 5AONA 3G3ZA 3EQLF 4IVNA 3RTRA 2DFIA 1RUOA 3H92A 4OOIA 5E8IA 5E17F 3JAMZ 4YFXF 2ACJA 1BC7C 1FYLA 4I0AA 2P7CB 1TTYA 2VOPA 1BOAA 1YW9A 5A2QK 3KLNA 4PCQA 2L54A 1ON1A 2XKPA 2X4HA 1O3QA 4TV7A 5ICCA 1MJAA 1T0FA 2XAJA 3I53A 4XRFA 3FM5A 1HSTA 4MEYF 2RNJA 3JSOA 2VE9A 2NRAC 3GVAA 2IPQX 4HW0A 3F23A 2V9VA 1ZRDA 1TQIA 1ZLJA 2KIFA 4N9HA 4BNCA 5L3GA 3P7NA 2OBPA 2DT5A 5JR3A 2HGCA 2FMYA 2DU9A 3CTAA 4LG0A 1S29A 1JHFA 2KJBA 4EM1A 5D6EA 4BXUA 2PLYA 3GEZA 4Q48A 4UXNA 3FMSA 2UZKA 2FMLA 1XDSA 1TNSA 2IP2A 4GCVA 3LA2A 1FYMA 1REPC 1E2XA 1XMKA 3GF2A 4AIKA 2DW4A 3J80Z 4R79A 3CUQB 3SZTA 2JRTA 3FHZA 2K02A 2H27A 4IPAA 4HDVA 2E7WA 4XBFA 3FMQA 4HZFA 2GXBA 2XAQA 3T1BA 4GXOA 1OR7A 2H6BA 4ZYHA 4WWCA 3IWZA 2MA3A 2L02A 1PP7U 2MH9A 1V3FA 1TLHB 2WTEA 1I6XA 2Y75A 3FXRA 4BHPA 4UNOA 1YIOA 1IAWA 3SFZA 4O3MA 5LBQA 1QBJA 4NB5A 4A2UA 2H94A 2ZBKA 3R6SA 1UCRA 3C7JA 3HRTA 2DAOA 3LA7A 1XGOA 2GA1A 2PN6A 5ED4A 2VN2A 1G3YA 2EB7A 4JBAA 2JT1A 1DPUA 1Z91A 4JK1X 1LDDA 1WRJA 3FF5A 1F4KA 2ELHA 1YQAA 1C0WA 1Z9CA 4M72A 3KZZA 4A6EA 4OIPF 4LB6B 5CVRA 1SMYF 2EFQA 1KQ9A 3CO7C 3BP8A 3GZ6A 4M9SA 2V79A 2ZFWA 4ENJA 2IVMA 1GXQA 1BJAA 3ZPLA 2QWWA 1Z1DA 1MJBA 2FOKA 1BC8C 4ESBA 2YX7A 1XDUA 3Q5FA 5DD4A 3EYIA 2AS5F 4A0XA 1G3TA 2A69F 3FZVA 2IA2A 1JE8A 3HHHA 3VOEA 2ESHA 1K78A 4CGZA 1V4RA 1W5TA 2HWVA 2XVCA 1GXPA 2EV5A 2AXLA 3M8EA 3C18A 5IT9K 5LEJA 2Z99A 4Y13A 3FWEA 4YIIA 4MHGA 4RGXA 4L5IA 3N4MA 1I1SA 1SFEA 1IW7F 3EYYA 3DV8A 3I5UA 2ZO4A 1J5YA 1XD7A 2DK8A 1R1TA 1R22A 3U9GA 3N97A 4YFNF 5ICGA 3F22A 2DQRA 3K0LA 4I2OA 1XCVA 1TQMA 4U0YA 2DTRA 4IXAA 1J9IA 3BJOA 2RDPA 1S6LA 1FY7A 3CDHA 1I5ZA 3E6BA 1RNLA 3GFJA 3BWGA 3L7WA 2UXXA 4LMYA 4F7ZA 4M6YA 3TO9A 1OYIA 2P7VB 2MLGA 3V7RA 4RB2C 3V7CA 4KIBA 1TW3A 1YS7A 4MGRA 3TDZC 5CJ9A 2RC4A 4ETSA 1X3UA 5CVVA 4A5MA 2D1HA 1KA8A 1ZYRF 2FA5A 5LRSA 4M73A 2W24A 1RI7A 3R4KA 1PDNC 5HDGA 3MWMA 3I59A 1R36A 2ZNZA 4LK0F 1T6SA 4S05A 1T2KA 5CVIA 3V8LA 3V8JA 4EJUA 1J59A 4HV6A 1H9TA 3CJNA 1UHMA 5D5XB 2P5LC 4CZZA 5ICEA 2M30A 5K1YA 2HEOA 2FNPA 4KMUX 3HRUA 3C1DA 2XUBA 2D1VA 4A6DA 1W7PB 3IKTA 1R1VA 2HR3A 2WWYA 2XROA 5D4SA 2CQKA 4GYGA 3J80K 2OQRA 4UUVA 3WU1B 2RV8A 4AIJA 1YLFA 4LGWA 3KP2A 4Q47A 4I02A 2ESNA 3JTGA 3EUHA 2GZWA 4ZZLA 3GUDA 4G7OF 2FF4A 1W7PD 3ZN0A 1HXDA 4MQVA 3OV8A 1Z6TA 2CO5A 2XAHA 5D6FA 2EA4A 3NQOA 5ILUA 2ZMEB 3E6CC 2A68F 3VEPA 2VT3A 3EETA 1BIBA 4LK1F 1XB4A 5D8LB 1Q1HA 3ECOA 3KZYA 2O3FA 1DPRA 2ZNYA 3QU6A 2K86A 2QBYB 2ETHA 3ML6A 3E6DA 4HQMA 4I09A 4P96A 3H3UA 3R0AA 4BQAA 1K6OA 3E5UA 1P6RA 1SD6A 3PQJA 2VXZA 3BROA 5FD6A 3MCZA 2F2EA 1CGPA 5FFZA 5D5UB 2CYYA 2KRFA 5L3FA 2Q2EA 4MEXF 5L3BA 3I58A 1I27A 4N9IA 5LGNA 2LKPA 3I4PA 4MTDA 3DKWA 2HQNA 2ZKZA 4QWQA 5BS6A 3FM3A 5ICFA 2STWA 4EQQA 5E1ZB 4OMZA 5KVRA 3E5QA 3RKYA 4M74A 4M9ZA 2QQBA 2JSCA 3IL2A 2UXNA 2ISYA 3J7AO 1FP2A 3T8TA 4HF0A 3BPXA 2P6TA 4BAYA 1U2WA 2XASA 4HYEA 3LAJA 3I64A 1FX7A 3BJAA 2BV6A 4S04A 3ZP5A 2O6GE 5K5OA 2IJLA 1U5TC 4G8XA 4HLYA 1XCBA 3CUQA 3RDIA 3DF8A 3M7GA 3HSEA 3DXJF 2COMA 3ZMUA 2V1XA 1Z7UA 1IF1A 4NQWA 1ZAOA 5BMZA 3JTHA 3O6BB 3WGGA 2GA2A 3DPTA 4ZYEA 1HKTA 4KN4X 2UWMA 5L3DA 5HVQC 4Y15A 3SQNA 3ISPA 4LLNA 1XGNA 1HSJA 4KMFA 5L3EA 2R7DA 1EH7A 1DP7P 1MKMA 2DO7A 2IA0A 3U2RA 1ZRFA 4HOBA 2EFOA 2R7FA 3FXQA 1KQ0A 1ZG1A 2F5FA 2FBIA 3QPTA 4RAZA 3HIFA 2PFBA 2Z3YA 2OQGA 2OAZA 1ZN2A 2STTA 1SD7A 1FBUA 2PMHA 5E1WA 4P55A 3R61A 1RZ4A 4CHUA 3R60A 4LD5A 2V6CA 4AWXB 1FSEA 1BM9A 5HS9A 4LJZF 3ULQB 1RIOH 2L4AA 5CYVA 3GO5A 3HRMA 5BOXA 2PEXA 5ERIA 5HDNA 3TKYA 4U0WA 4A0ZA 3ZN1A 2Y48A 1SFUA 3GWZA 2PG4A 4LLGF 3WTSC 1CF7B 1BI2A 1DUXC 3ZMTA 1HBXG 1NHAA 1KU2A 3ABTA 1R58A 5K5QA 1QZZA 2ZJ2A 1ZHFA 2YPRA 1YO5C 2HZTA 1O3SA 4ENKA 4G6DA 4L9VA 5FB2A 2VONA 1JGSA 3L9FA 2E7XA 3EDPA 4L0ZB 5EEGA 2RVCA 1FWZA 1ZH5A 4ENMA 3HYIA 3F6OA 1FOKA 1F9NA 1OYYA 3LQQA 4G7HF 2EK5A 3MAJA 4M71A 2BE5F 5TJJA 1WSUA 3ECHA 2NS0A 2HKXA 2R3SA 1I1GA 2EV0A 4ON0A 2K7LA 1P92A 5ILSA 4R1HA 4HLXA 1IZ1A 3B02A 2EJRA 3MZHA 2W25A 3I71A 4EMSA 4A0YA 4B8XA 4P5OA 3HHGA 4OINF 4FX0A 1FZPB 1XGSA 1FSHA 4O5VA 3IKVA 2FEZA 3R0JA 3RKXA 1BI0A 3RPQA 4G9YA 3I0TA 2XAGA 4KUMA 5K5RA 1OPCA 3TGNA 5DDGA 1ULYA 3WTWC 3BPVA 3FX3A 1J0RA 5JFRA 5DUIA 3WGHA 1U5TB 3E5XA 3KETA 5HS8A 4RS8A 3FMRA 4GGGA 4UV9A 1HW2A 5E1XA 3QAHA 4I0BA 5CLSA 4EJTA 4EV0A 1UFMA 5HLGA 2PJPA 2NNNA 3F21A 3P9CA 1B6AA 1S8NA 3WE2A 3OOPA 1IN6A 3SHFA 2HYFA 5JI6A 1LDJA 1JHHA 1TNTA 1DDNA 2OZ6A 3P9IA 4R8HA 5FFXA 1ON2A 3O2PE 3KP7A 1G6NA 2ISZA 1STZA 3F8NA 1ZG5A 3TOAA 1W7PA 1EH6A 2EFPA 4GO1A 4LB5A 2RKHA 4ZH4F 3LAPA 2HFHA 1VTNC 1O57A 4IRHA 1MDMB 4K2EA 3LA3A 4HA8A 2ZCWA 3I54A 2DPUA 3IWFA 4UHTA 3HSFA 1QO0D 3KEOA 4YFKF 2YX4A 4E70A 1MGTA 3JAMK 1Z05A 1IN4A 5EEHA 2L3DA 1YS6A 4OU0A 2A5YB 3MFKA 5E20A 5DCMB 1QNTA 2VOOA 3H3ZA 1IXCA 3CO6C 3PQKA 4XLPF 5D4RA 1LB2A 5J8FA 2ZMEA 3KE2A 1K79A 3HOTA 4D0PA 1LQ1A 2XRNA 1KU9A 1XGMA 3P9KA 4L0YB 3L09A 1XSDA 3E97A 2QBYA 3KEQA 1XSXA 4HF2A 4CYDA 1R1UA 3BZ6A 2P5VA 5D5VB 3KP3A 1O3TA 3WTVC 2IW5A 4RGRA 2FRHA 3D5LA 2DPDA 3WTTC 4WF2A 2ADUA 3MZYA 1IXSB 1H9GA 4IJAA 1B9NA 4MNUA 4ASNA 3D0SA 2KJCA 3F6VA 1WWXA 2E1CA 2JPBA 3B73A 4Z2YA 1FBQA 4JQFA 4KN7X 1B59A 2IRFG 2Z9OA 3L2CA 2EFNA 2NYXA 3QP5A 1AOYA 2J5PA 3W6JB 1UHWA 3TOBA 2RQPA 3IHUA 5H6QA 2FBKA 3M9AA 5D5WB 4M9XA 3C3WA 2HOEA 4PGHA 5L3CA 2QVOA 2KIUA 1USTA 2K4JA 1SD4A 2XKOA 1S3JA 1K7AA 4P9UA 4L5JA 2BYVE 2Z33A 3RYPA 1ZLKA 2CGPA 2F5CA 2DK5A 1YFHA 3KLOA 1J2XA 2HQRA 4RGSA 3M1EA 1RUNA 5LGTA 3IRQA 4YG2F 1P4XA 4ZYGA 1LJ9A 3LSTA 4YIFA 1HKQA 3RJPA 1SFXA 5FGMA 4OIQF 1LNWA 1T98A 1IRGA 3QPHA 4MTEA 2A61A 2ZXJA 2FE3A 4WXHA 3VB2A 3SZPA 3F8CA 3ZQ7A 1KYWA 4KIGA 3TO7A 1QGPA 3WTZA 3M8FA 1A04A 1B9MA 2FBHA 1R5HA 2DQLA 2LSOA 4HX7A 2QLZA 4H0EA 3G73A 3MEXA 5AIPA 1O7FA 2FXAA 1BN5A 4WXDA 3PFIA 4L9JA 1EV7A 1YW7A 2OD5A 3LFKA 3ROUA 4UVCA 4N0BA 3V4GA 2QUFA 1XN7A 3WGIA 4PDKA 1BBYA 1ZGAA 2C6YA 5FD5A 3K1NA 1XMAA 3IC7A 1KQ8A 2LF7A 4HBLA 1TW2A 2VBZA 4Q4ZF 2BBYA 1U6GA 2XAFA 1YW8A 3T0YA 3GLXA 3DFGA 3GYHX 1R7JA 2JPCA 1OMIA 3HTSB 1OKRA 2BEOA 1AWCA 1CF7A 4ZZDA 2VC1A 4HX4A 4RB3C 2B0LA 4HQEA 2WC2A 2QQ9A 3WE3A 4ZYDA 4U7BA 1FBSA 1R23A 1FPQA 3REOA 3ERED 3HOSA 1P4AA 2OA4A 3Q9VA 4RB0A 1PUEE 4XSZF 1IN8A 5FLXZ 3GFMA 2A07F 2X0LA 2MD5A 1ZG3A 3F3XA 2NAZA 4IHSA 3BY6A 1GVJA 4A5NA 4Q5SF 2HTJA 1HW5A 1D3YA 5F64A 3KP5A 1P4WA 4OMYA 2K4BA 5H20A 1W4MA 1IRFA 2MC3A 1KU3A 1O7LA 2JTVA 2L01A 2EWNA 2O03A 1IN7A 2P4WA 2XV4S 4LLLA 1FP1D 4O6JA 3RIRA 4U0VA 4I01A 4WCGA 2D45A 4Y17A 2VC0A 1UB9A 1FNNA 5DYMA 3O3KA 3NRVA 2Q8KA 1ODDA 3K9TA 4AD9A 5CVUA 3J81Z 1HKSA 3HUGA 2PBIA 3DP7A 2VBWA 1EH8A 1T38A 1SAXA 1R5GA 4NHJA 3AAFA 2IT0A 4LFUA 5F6FA 2M87A 2YSRA 3K1MA 5JHUA 4G94A 2VE8A 5BPIA 2CW0F 5E18F 4XSXF 4WX9A 4ESFA 3ZMDA 1FYKA 2A6EF 2D2WA 1SD5A 1U5TA 1J7KA 2KKOA 4G7ZF 3KCCA 5DEQA 4QLCU 3MQ0A 1JXSA 4RB1A 2K27A 3HRSA 4UVAA 4HDUA 2VBYA 4DQ2A 4HX8A 2XHKA 4CO8A 2Y0MA 4KICA 1TQPA 2M1BA 1U8RA 1QZYA 2O61A 1H0MA 4CICA 1LEAA 4PZJA 4CDGA 2M45A 2BGCA 3CLOA 1MZBA 4KDPA 3GXOA 3DEUA 1QPMA 3S2WA 2G7HA 4FHTA 2RGVA 5HLIA 2V1DA 4LG0B 5LEKA 4KIFA 1YG2A 2EFWA 1MDMA 1ZREA 3COAC 3QP6A 4BHBA 3QOPA 4EVIA 4EGZA 4KYWA 2FQ3A 1U3EM 1KU7A 2XGXA 3IRRA 2JZYA 1WKMA 2M8EA 3F8BA 5KK1A 5DCMA 2VBXA 5D8KB 4BH9A 2LF8A 4EM2A 1O3RA 1MD0A 2GIVA 2M5WA 2MLKA 2GXGA 5LHGA 2CFXA 3WU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQN A;  1TBX A;  5BQT A;  3BDD A;  1D8K A;  4M6X A;  4KNY A;  1LEB A;  2O8X A;  2HS5 A;  1YTY A;  4L18 B;  4U7D A;  2PI0 A;  4OIR F;  1IXR C;  2YU3 A;  1FC3 A;  1U78 A;  4UVB A;  1PP8 F;  4OIO F;  3FXU A;  5DV5 A;  5A2Q Z;  4IRG A;  4IHT A;  2XIG A;  4IRI A;  1YYV A;  4EM0 B;  1BI3 A;  3E6M A;  5DUK A;  4U88 A;  3WOD F;  3RI4 A;  1IUY A;  2EA2 A;  3JW4 A;  3GW2 A;  5H6R A;  1B4A A;  3GX4 X;  3K2Z A;  4EGY A;  3E3V A;  4EJV A;  3V8K A;  2IA1 A;  5LRR A;  1XSV A;  1ONV A;  3ZMS A;  4I98 B;  5HOO A;  2QQA A;  2HKO A;  5FLX K;  4RGU A;  1E17 A;  4PGG A;  4I7H A;  1S7O A;  4KT5 C;  4CXF A;  1W5S A;  4HV5 A;  3VOD A;  1QQI A;  4EJW A;  3F8M A;  2QEN A;  5JVT A;  4HF1 A;  4BHC A;  1WI9 A;  2G9W A;  1B1B A;  5BPD A;  2F5D A;  1L3L A;  1P2F A;  4B09 A;  5AIQ A;  2GQQ A;  2QZ8 A;  3K69 A;  2Q0O A;  5HDK A;  3CUO A;  1KYZ A;  2Z5U A;  3RYR A;  3KP4 A;  2WV0 A;  3DQV C;  5LLQ A;  1K78 B;  2W57 A;  1G3S A;  1WQ2 A;  5HLH A;  5TRD A;  1LDK B;  5DCF A;  5LHI A;  2DBB A;  1F1Z A;  2YR2 A;  2HDC A;  3SXY A;  3GFL A;  5CVJ A;  3RKW A;  1L0O C;  3J81 K;  4G6Q A;  4UV8 A;  5FO5 A;  3QU3 A;  2VOD A;  2GAU A;  1T39 A;  3BJ6 A;  2FNA A;  4L9T A;  4WXC A;  2E1N A;  1ZAR A;  3NEU A;  2CG4 A;  4MQ9 F;  5F1R A;  3BOQ A;  5LGU A;  1J75 A;  5IT3 A;  4AIH A;  2MH2 A;  5HS7 A;  2J5O A;  2LNB A;  1LVA A;  2RN7 A;  5E8G A;  2W84 A;  3CUQ C;  3ELK A;  3T5X A;  1MJ9 A;  2HTS A;  4WK8 F;  1FLI A;  2H6C A;  2TDX A;  4L9N A;  2NNY A;  3LQR A;  3TDU C;  4FX4 A;  2V1U A;  3WG9 A;  5LHH A;  2OZU A;  4FT8 A;  3L00 A;  1G4D A;  4AVP A;  2LDU A;  3GFI A;  1Y0U A;  2FU4 A;  4ESJ A;  4IF4 A;  2PMU A;  1BIA A;  2W85 A;  1G3W A;  3DPL C;  3VFZ A;  1HW1 A;  2G7U A;  3K1P A;  2OU2 A;  4XLN F;  2PQ8 A;  3WTX C;  2FSW A;  1D8J A;  1Z6R A;  2EV6 A;  4P9F A;  1SMT A;  3U1D A;  1ZRC A;  2CWE A;  1GHC A;  2DLL A;  1KGS A;  2A6H F;  1OYW A;  2VT2 A;  2P5K A;  5J8C A;  4HAM A;  4RAY A;  3I59 B;  1S7A A;  5DD8 A;  3LWF A;  2O0Y A;  4KA4 A;  3HTU A;  3ZMZ A;  2L4M A;  3ZMV A;  3QRF F;  1IN5 A;  2KIM A;  1F5T A;  4GYI A;  2F5E A;  3F8F A;  4DNC A;  2A3S A;  3WTU C;  3TO6 A;  2P6S A;  2CSO A;  5ILV A;  2MBF A;  3V7S A;  1ZGJ A;  2GWR A;  3KP6 A;  3T8R A;  2QM3 A;  1USS A;  1D5V A;  5IT9 Z;  3JSP A;  3GZ5 A;  6PAX A;  1FT9 A;  3WTY C;  3KFW X;  4EJO A;  2DI3 A;  2P8T A;  4KFC A;  3RPU A;  1BI1 A;  1HQC A;  3ABU A;  2H09 A;  3Q9S A;  4A12 A;  3HSR A;  4ENN A;  3W6K B;  4BYY A;  2HYG D;  2QYO A;  5J6X A;  3F72 A;  1R00 A;  5AON A;  3G3Z A;  3EQL F;  4IVN A;  3RTR A;  2DFI A;  1RUO A;  3H92 A;  4OOI A;  5E8I A;  5E17 F;  3JAM Z;  4YFX F;  2ACJ A;  1BC7 C;  1FYL A;  4I0A A;  2P7C B;  1TTY A;  2VOP A;  1BOA A;  1YW9 A;  5A2Q K;  3KLN A;  4PCQ A;  2L54 A;  1ON1 A;  2XKP A;  2X4H A;  1O3Q A;  4TV7 A;  5ICC A;  1MJA A;  1T0F A;  2XAJ A;  3I53 A;  4XRF A;  3FM5 A;  1HST A;  4MEY F;  2RNJ A;  3JSO A;  2VE9 A;  2NRA C;  3GVA A;  2IPQ X;  4HW0 A;  3F23 A;  2V9V A;  1ZRD A;  1TQI A;  1ZLJ A;  2KIF A;  4N9H A;  4BNC A;  5L3G A;  3P7N A;  2OBP A;  2DT5 A;  5JR3 A;  2HGC A;  2FMY A;  2DU9 A;  3CTA A;  4LG0 A;  1S29 A;  1JHF A;  2KJB A;  4EM1 A;  5D6E A;  4BXU A;  2PLY A;  3GEZ A;  4Q48 A;  4UXN A;  3FMS A;  2UZK A;  2FML A;  1XDS A;  1TNS A;  2IP2 A;  4GCV A;  3LA2 A;  1FYM A;  1REP C;  1E2X A;  1XMK A;  3GF2 A;  4AIK A;  2DW4 A;  3J80 Z;  4R79 A;  3CUQ B;  3SZT A;  2JRT A;  3FHZ A;  2K02 A;  2H27 A;  4IPA A;  4HDV A;  2E7W A;  4XBF A;  3FMQ A;  4HZF A;  2GXB A;  2XAQ A;  3T1B A;  4GXO A;  1OR7 A;  2H6B A;  4ZYH A;  4WWC A;  3IWZ A;  2MA3 A;  2L02 A;  1PP7 U;  2MH9 A;  1V3F A;  1TLH B;  2WTE A;  1I6X A;  2Y75 A;  3FXR A;  4BHP A;  4UNO A;  1YIO A;  1IAW A;  3SFZ A;  4O3M A;  5LBQ A;  1QBJ A;  4NB5 A;  4A2U A;  2H94 A;  2ZBK A;  3R6S A;  1UCR A;  3C7J A;  3HRT A;  2DAO A;  3LA7 A;  1XGO A;  2GA1 A;  2PN6 A;  5ED4 A;  2VN2 A;  1G3Y A;  2EB7 A;  4JBA A;  2JT1 A;  1DPU A;  1Z91 A;  4JK1 X;  1LDD A;  1WRJ A;  3FF5 A;  1F4K A;  2ELH A;  1YQA A;  1C0W A;  1Z9C A;  4M72 A;  3KZZ A;  4A6E A;  4OIP F;  4LB6 B;  5CVR A;  1SMY F;  2EFQ A;  1KQ9 A;  3CO7 C;  3BP8 A;  3GZ6 A;  4M9S A;  2V79 A;  2ZFW A;  4ENJ A;  2IVM A;  1GXQ A;  1BJA A;  3ZPL A;  2QWW A;  1Z1D A;  1MJB A;  2FOK A;  1BC8 C;  4ESB A;  2YX7 A;  1XDU A;  3Q5F A;  5DD4 A;  3EYI A;  2AS5 F;  4A0X A;  1G3T A;  2A69 F;  3FZV A;  2IA2 A;  1JE8 A;  3HHH A;  3VOE A;  2ESH A;  1K78 A;  4CGZ A;  1V4R A;  1W5T A;  2HWV A;  2XVC A;  1GXP A;  2EV5 A;  2AXL A;  3M8E A;  3C18 A;  5IT9 K;  5LEJ A;  2Z99 A;  4Y13 A;  3FWE A;  4YII A;  4MHG A;  4RGX A;  4L5I A;  3N4M A;  1I1S A;  1SFE A;  1IW7 F;  3EYY A;  3DV8 A;  3I5U A;  2ZO4 A;  1J5Y A;  1XD7 A;  2DK8 A;  1R1T A;  1R22 A;  3U9G A;  3N97 A;  4YFN F;  5ICG A;  3F22 A;  2DQR A;  3K0L A;  4I2O A;  1XCV A;  1TQM A;  4U0Y A;  2DTR A;  4IXA A;  1J9I A;  3BJO A;  2RDP A;  1S6L A;  1FY7 A;  3CDH A;  1I5Z A;  3E6B A;  1RNL A;  3GFJ A;  3BWG A;  3L7W A;  2UXX A;  4LMY A;  4F7Z A;  4M6Y A;  3TO9 A;  1OYI A;  2P7V B;  2MLG A;  3V7R A;  4RB2 C;  3V7C A;  4KIB A;  1TW3 A;  1YS7 A;  4MGR A;  3TDZ C;  5CJ9 A;  2RC4 A;  4ETS A;  1X3U A;  5CVV A;  4A5M A;  2D1H A;  1KA8 A;  1ZYR F;  2FA5 A;  5LRS A;  4M73 A;  2W24 A;  1RI7 A;  3R4K A;  1PDN C;  5HDG A;  3MWM A;  3I59 A;  1R36 A;  2ZNZ A;  4LK0 F;  1T6S A;  4S05 A;  1T2K A;  5CVI A;  3V8L A;  3V8J A;  4EJU A;  1J59 A;  4HV6 A;  1H9T A;  3CJN A;  1UHM A;  5D5X B;  2P5L C;  4CZZ A;  5ICE A;  2M30 A;  5K1Y A;  2HEO A;  2FNP A;  4KMU X;  3HRU A;  3C1D A;  2XUB A;  2D1V A;  4A6D A;  1W7P B;  3IKT A;  1R1V A;  2HR3 A;  2WWY A;  2XRO A;  5D4S A;  2CQK A;  4GYG A;  3J80 K;  2OQR A;  4UUV A;  3WU1 B;  2RV8 A;  4AIJ A;  1YLF A;  4LGW A;  3KP2 A;  4Q47 A;  4I02 A;  2ESN A;  3JTG A;  3EUH A;  2GZW A;  4ZZL A;  3GUD A;  4G7O F;  2FF4 A;  1W7P D;  3ZN0 A;  1HXD A;  4MQV A;  3OV8 A;  1Z6T A;  2CO5 A;  2XAH A;  5D6F A;  2EA4 A;  3NQO A;  5ILU A;  2ZME B;  3E6C C;  2A68 F;  3VEP A;  2VT3 A;  3EET A;  1BIB A;  4LK1 F;  1XB4 A;  5D8L B;  1Q1H A;  3ECO A;  3KZY A;  2O3F A;  1DPR A;  2ZNY A;  3QU6 A;  2K86 A;  2QBY B;  2ETH A;  3ML6 A;  3E6D A;  4HQM A;  4I09 A;  4P96 A;  3H3U A;  3R0A A;  4BQA A;  1K6O A;  3E5U A;  1P6R A;  1SD6 A;  3PQJ A;  2VXZ A;  3BRO A;  5FD6 A;  3MCZ A;  2F2E A;  1CGP A;  5FFZ A;  5D5U B;  2CYY A;  2KRF A;  5L3F A;  2Q2E A;  4MEX F;  5L3B A;  3I58 A;  1I27 A;  4N9I A;  5LGN A;  2LKP A;  3I4P A;  4MTD A;  3DKW A;  2HQN A;  2ZKZ A;  4QWQ A;  5BS6 A;  3FM3 A;  5ICF A;  2STW A;  4EQQ A;  5E1Z B;  4OMZ A;  5KVR A;  3E5Q A;  3RKY A;  4M74 A;  4M9Z A;  2QQB A;  2JSC A;  3IL2 A;  2UXN A;  2ISY A;  3J7A O;  1FP2 A;  3T8T A;  4HF0 A;  3BPX A;  2P6T A;  4BAY A;  1U2W A;  2XAS A;  4HYE A;  3LAJ A;  3I64 A;  1FX7 A;  3BJA A;  2BV6 A;  4S04 A;  3ZP5 A;  2O6G E;  5K5O A;  2IJL A;  1U5T C;  4G8X A;  4HLY A;  1XCB A;  3CUQ A;  3RDI A;  3DF8 A;  3M7G A;  3HSE A;  3DXJ F;  2COM A;  3ZMU A;  2V1X A;  1Z7U A;  1IF1 A;  4NQW A;  1ZAO A;  5BMZ A;  3JTH A;  3O6B B;  3WGG A;  2GA2 A;  3DPT A;  4ZYE A;  1HKT A;  4KN4 X;  2UWM A;  5L3D A;  5HVQ C;  4Y15 A;  3SQN A;  3ISP A;  4LLN A;  1XGN A;  1HSJ A;  4KMF A;  5L3E A;  2R7D A;  1EH7 A;  1DP7 P;  1MKM A;  2DO7 A;  2IA0 A;  3U2R A;  1ZRF A;  4HOB A;  2EFO A;  2R7F A;  3FXQ A;  1KQ0 A;  1ZG1 A;  2F5F A;  2FBI A;  3QPT A;  4RAZ A;  3HIF A;  2PFB A;  2Z3Y A;  2OQG A;  2OAZ A;  1ZN2 A;  2STT A;  1SD7 A;  1FBU A;  2PMH A;  5E1W A;  4P55 A;  3R61 A;  1RZ4 A;  4CHU A;  3R60 A;  4LD5 A;  2V6C A;  4AWX B;  1FSE A;  1BM9 A;  5HS9 A;  4LJZ F;  3ULQ B;  1RIO H;  2L4A A;  5CYV A;  3GO5 A;  3HRM A;  5BOX A;  2PEX A;  5ERI A;  5HDN A;  3TKY A;  4U0W A;  4A0Z A;  3ZN1 A;  2Y48 A;  1SFU A;  3GWZ A;  2PG4 A;  4LLG F;  3WTS C;  1CF7 B;  1BI2 A;  1DUX C;  3ZMT A;  1HBX G;  1NHA A;  1KU2 A;  3ABT A;  1R58 A;  5K5Q A;  1QZZ A;  2ZJ2 A;  1ZHF A;  2YPR A;  1YO5 C;  2HZT A;  1O3S A;  4ENK A;  4G6D A;  4L9V A;  5FB2 A;  2VON A;  1JGS A;  3L9F A;  2E7X A;  3EDP A;  4L0Z B;  5EEG A;  2RVC A;  1FWZ A;  1ZH5 A;  4ENM A;  3HYI A;  3F6O A;  1FOK A;  1F9N A;  1OYY A;  3LQQ A;  4G7H F;  2EK5 A;  3MAJ A;  4M71 A;  2BE5 F;  5TJJ A;  1WSU A;  3ECH A;  2NS0 A;  2HKX A;  2R3S A;  1I1G A;  2EV0 A;  4ON0 A;  2K7L A;  1P92 A;  5ILS A;  4R1H A;  4HLX A;  1IZ1 A;  3B02 A;  2EJR A;  3MZH A;  2W25 A;  3I71 A;  4EMS A;  4A0Y A;  4B8X A;  4P5O A;  3HHG A;  4OIN F;  4FX0 A;  1FZP B;  1XGS A;  1FSH A;  4O5V A;  3IKV A;  2FEZ A;  3R0J A;  3RKX A;  1BI0 A;  3RPQ A;  4G9Y A;  3I0T A;  2XAG A;  4KUM A;  5K5R A;  1OPC A;  3TGN A;  5DDG A;  1ULY A;  3WTW C;  3BPV A;  3FX3 A;  1J0R A;  5JFR A;  5DUI A;  3WGH A;  1U5T B;  3E5X A;  3KET A;  5HS8 A;  4RS8 A;  3FMR A;  4GGG A;  4UV9 A;  1HW2 A;  5E1X A;  3QAH A;  4I0B A;  5CLS A;  4EJT A;  4EV0 A;  1UFM A;  5HLG A;  2PJP A;  2NNN A;  3F21 A;  3P9C A;  1B6A A;  1S8N A;  3WE2 A;  3OOP A;  1IN6 A;  3SHF A;  2HYF A;  5JI6 A;  1LDJ A;  1JHH A;  1TNT A;  1DDN A;  2OZ6 A;  3P9I A;  4R8H A;  5FFX A;  1ON2 A;  3O2P E;  3KP7 A;  1G6N A;  2ISZ A;  1STZ A;  3F8N A;  1ZG5 A;  3TOA A;  1W7P A;  1EH6 A;  2EFP A;  4GO1 A;  4LB5 A;  2RKH A;  4ZH4 F;  3LAP A;  2HFH A;  1VTN C;  1O57 A;  4IRH A;  1MDM B;  4K2E A;  3LA3 A;  4HA8 A;  2ZCW A;  3I54 A;  2DPU A;  3IWF A;  4UHT A;  3HSF A;  1QO0 D;  3KEO A;  4YFK F;  2YX4 A;  4E70 A;  1MGT A;  3JAM K;  1Z05 A;  1IN4 A;  5EEH A;  2L3D A;  1YS6 A;  4OU0 A;  2A5Y B;  3MFK A;  5E20 A;  5DCM B;  1QNT A;  2VOO A;  3H3Z A;  1IXC A;  3CO6 C;  3PQK A;  4XLP F;  5D4R A;  1LB2 A;  5J8F A;  2ZME A;  3KE2 A;  1K79 A;  3HOT A;  4D0P A;  1LQ1 A;  2XRN A;  1KU9 A;  1XGM A;  3P9K A;  4L0Y B;  3L09 A;  1XSD A;  3E97 A;  2QBY A;  3KEQ A;  1XSX A;  4HF2 A;  4CYD A;  1R1U A;  3BZ6 A;  2P5V A;  5D5V B;  3KP3 A;  1O3T A;  3WTV C;  2IW5 A;  4RGR A;  2FRH A;  3D5L A;  2DPD A;  3WTT C;  4WF2 A;  2ADU A;  3MZY A;  1IXS B;  1H9G A;  4IJA A;  1B9N A;  4MNU A;  4ASN A;  3D0S A;  2KJC A;  3F6V A;  1WWX A;  2E1C A;  2JPB A;  3B73 A;  4Z2Y A;  1FBQ A;  4JQF A;  4KN7 X;  1B59 A;  2IRF G;  2Z9O A;  3L2C A;  2EFN A;  2NYX A;  3QP5 A;  1AOY A;  2J5P A;  3W6J B;  1UHW A;  3TOB A;  2RQP A;  3IHU A;  5H6Q A;  2FBK A;  3M9A A;  5D5W B;  4M9X A;  3C3W A;  2HOE A;  4PGH A;  5L3C A;  2QVO A;  2KIU A;  1UST A;  2K4J A;  1SD4 A;  2XKO A;  1S3J A;  1K7A A;  4P9U A;  4L5J A;  2BYV E;  2Z33 A;  3RYP A;  1ZLK A;  2CGP A;  2F5C A;  2DK5 A;  1YFH A;  3KLO A;  1J2X A;  2HQR A;  4RGS A;  3M1E A;  1RUN A;  5LGT A;  3IRQ A;  4YG2 F;  1P4X A;  4ZYG A;  1LJ9 A;  3LST A;  4YIF A;  1HKQ A;  3RJP A;  1SFX A;  5FGM A;  4OIQ F;  1LNW A;  1T98 A;  1IRG A;  3QPH A;  4MTE A;  2A61 A;  2ZXJ A;  2FE3 A;  4WXH A;  3VB2 A;  3SZP A;  3F8C A;  3ZQ7 A;  1KYW A;  4KIG A;  3TO7 A;  1QGP A;  3WTZ A;  3M8F A;  1A04 A;  1B9M A;  2FBH A;  1R5H A;  2DQL A;  2LSO A;  4HX7 A;  2QLZ A;  4H0E A;  3G73 A;  3MEX A;  5AIP A;  1O7F A;  2FXA A;  1BN5 A;  4WXD A;  3PFI A;  4L9J A;  1EV7 A;  1YW7 A;  2OD5 A;  3LFK A;  3ROU A;  4UVC A;  4N0B A;  3V4G A;  2QUF A;  1XN7 A;  3WGI A;  4PDK A;  1BBY A;  1ZGA A;  2C6Y A;  5FD5 A;  3K1N A;  1XMA A;  3IC7 A;  1KQ8 A;  2LF7 A;  4HBL A;  1TW2 A;  2VBZ A;  4Q4Z F;  2BBY A;  1U6G A;  2XAF A;  1YW8 A;  3T0Y A;  3GLX A;  3DFG A;  3GYH X;  1R7J A;  2JPC A;  1OMI A;  3HTS B;  1OKR A;  2BEO A;  1AWC A;  1CF7 A;  4ZZD A;  2VC1 A;  4HX4 A;  4RB3 C;  2B0L A;  4HQE A;  2WC2 A;  2QQ9 A;  3WE3 A;  4ZYD A;  4U7B A;  1FBS A;  1R23 A;  1FPQ A;  3REO A;  3ERE D;  3HOS A;  1P4A A;  2OA4 A;  3Q9V A;  4RB0 A;  1PUE E;  4XSZ F;  1IN8 A;  5FLX Z;  3GFM A;  2A07 F;  2X0L A;  2MD5 A;  1ZG3 A;  3F3X A;  2NAZ A;  4IHS A;  3BY6 A;  1GVJ A;  4A5N A;  4Q5S F;  2HTJ A;  1HW5 A;  1D3Y A;  5F64 A;  3KP5 A;  1P4W A;  4OMY A;  2K4B A;  5H20 A;  1W4M A;  1IRF A;  2MC3 A;  1KU3 A;  1O7L A;  2JTV A;  2L01 A;  2EWN A;  2O03 A;  1IN7 A;  2P4W A;  2XV4 S;  4LLL A;  1FP1 D;  4O6J A;  3RIR A;  4U0V A;  4I01 A;  4WCG A;  2D45 A;  4Y17 A;  2VC0 A;  1UB9 A;  1FNN A;  5DYM A;  3O3K A;  3NRV A;  2Q8K A;  1ODD A;  3K9T A;  4AD9 A;  5CVU A;  3J81 Z;  1HKS A;  3HUG A;  2PBI A;  3DP7 A;  2VBW A;  1EH8 A;  1T38 A;  1SAX A;  1R5G A;  4NHJ A;  3AAF A;  2IT0 A;  4LFU A;  5F6F A;  2M87 A;  2YSR A;  3K1M A;  5JHU A;  4G94 A;  2VE8 A;  5BPI A;  2CW0 F;  5E18 F;  4XSX F;  4WX9 A;  4ESF A;  3ZMD A;  1FYK A;  2A6E F;  2D2W A;  1SD5 A;  1U5T A;  1J7K A;  2KKO A;  4G7Z F;  3KCC A;  5DEQ A;  4QLC U;  3MQ0 A;  1JXS A;  4RB1 A;  2K27 A;  3HRS A;  4UVA A;  4HDU A;  2VBY A;  4DQ2 A;  4HX8 A;  2XHK A;  4CO8 A;  2Y0M A;  4KIC A;  1TQP A;  2M1B A;  1U8R A;  1QZY A;  2O61 A;  1H0M A;  4CIC A;  1LEA A;  4PZJ A;  4CDG A;  2M45 A;  2BGC A;  3CLO A;  1MZB A;  4KDP A;  3GXO A;  3DEU A;  1QPM A;  3S2W A;  2G7H A;  4FHT A;  2RGV A;  5HLI A;  2V1D A;  4LG0 B;  5LEK A;  4KIF A;  1YG2 A;  2EFW A;  1MDM A;  1ZRE A;  3COA C;  3QP6 A;  4BHB A;  3QOP A;  4EVI A;  4EGZ A;  4KYW A;  2FQ3 A;  1U3E M;  1KU7 A;  2XGX A;  3IRR A;  2JZY A;  1WKM A;  2M8E A;  3F8B A;  5KK1 A;  5DCM A;  2VBX A;  5D8K B;  4BH9 A;  2LF8 A;  4EM2 A;  1O3R A;  1MD0 A;  2GIV A;  2M5W A;  2MLK A;  2GXG A;  5LHG A;  2CFX A;  3WU0 A; 
#chains in the Genus database with same CATH topology
 2V4J C;  2JQ7 A;  3PNV A;  2EBI A;  3TQN A;  1TBX A;  5BQT A;  3BDD A;  5F1J A;  1D8K A;  3SFI A;  3RZD J;  4M6X A;  2GOX B;  2K9N A;  2XRL A;  1W36 D;  4F52 A;  4KNY A;  1LEB A;  4E7K A;  2O8X A;  2HS5 A;  1YTY A;  3NWS A;  1U0J A;  4L18 B;  5F0F A;  2K9M A;  4U7D A;  2PI0 A;  3E0J B;  4OIR F;  5M5Y J;  3W2V A;  2R0Q C;  1IXR C;  5FKM A;  5HNF A;  3FIW A;  2YU3 A;  2OTL I;  4FIS A;  2KDZ A;  2F48 A;  1FC3 A;  1U78 A;  2BY2 A;  3LFU A;  4UVB A;  1PP8 F;  4OIO F;  3OIO A;  4RLF A;  3FXU A;  4V2G A;  2KPM A;  2ME0 A;  2BZT A;  5DV5 A;  2XSJ C;  1WJC A;  5LFA A;  5A2Q Z;  4IRG A;  4IHT A;  3UR3 C;  1ETQ A;  2XIG A;  5F27 A;  4IRI A;  1YYV A;  4EM0 B;  1PUF A;  1BI3 A;  2L2O A;  5GP9 A;  3M07 A;  3I3L A;  3E6M A;  2X6W A;  5DUK A;  2IGM A;  3EUK L;  3OR2 C;  2NVT J;  2X1C A;  3EUH C;  1EKE A;  4U88 A;  2DFF A;  3ZR8 X;  3WOD F;  3RI4 A;  2O5R A;  4II2 A;  4BJ6 C;  1IUY A;  2EA2 A;  2DTZ A;  3JW4 A;  5CQG A;  3GW2 A;  3ABM H;  5H6R A;  2VKV A;  1XC5 A;  2E71 A;  1B4A A;  4XKC A;  3GX4 X;  3K2Z A;  3OOU A;  4EGY A;  4IHY A;  2R7U A;  3E3V A;  1BR4 A;  1SVL A;  3V8K A;  4EJV A;  2VUM J;  4FQG A;  2IA1 A;  1SAN A;  4NUB A;  5LRR A;  1XSV A;  3L2V A;  1FEX A;  2E36 A;  3BR2 A;  3VDX A;  3A01 B;  1WJE A;  1ONV A;  1MBG A;  1X1P A;  2VAS A;  1ETK A;  3ZQQ A;  3ZMS A;  4I98 B;  5HOO A;  2QQA A;  1WVR A;  2HKO A;  3FBN B;  5KCM A;  5FLX K;  4RGU A;  2F4O B;  1E17 A;  3H5A A;  3BT9 A;  4PGG A;  4PJJ A;  1D1A A;  4I7H A;  1S7O A;  1WHU A;  4KT5 C;  4CXF A;  4YEJ A;  2R7W A;  2ZJQ F;  1W5S A;  4HV5 A;  3VOD A;  3TW6 A;  1QQI A;  3VSL A;  3CDL A;  3F8M A;  2QEN A;  4EJW A;  5JVT A;  4HF1 A;  3I4M J;  4BHC A;  1WI9 A;  2G9W A;  1B1B A;  5IPA A;  5BPD A;  2F5D A;  1L3L A;  2VQC A;  1P2F A;  2DA4 A;  4B09 A;  4HNU A;  1VFC A;  1X1D A;  2GQQ A;  5AIQ A;  2QZ8 A;  2X9D A;  2DJI A;  2Q0O A;  3F9K A;  3K69 A;  2P0W A;  2Y0S A;  5HDK A;  4ZDO A;  1ZEL A;  3CUO A;  2R93 J;  1JUP A;  3HGG A;  1KYZ A;  3W2W A;  2Z5U A;  1YRN A;  4II3 A;  1G8X A;  1XS9 A;  3RYR A;  3H9Q A;  3WG7 H;  3KP4 A;  2WV0 A;  1ETW A;  4XRM A;  3DQV C;  2L7M P;  3K4J A;  5LLQ A;  1K78 B;  3QPL A;  2W57 A;  1G3S A;  1WQ2 A;  4XLE A;  3WU2 C;  5HLH A;  5TRD A;  2OF7 A;  1LDK B;  5DCF A;  4DIQ A;  4N4N B;  4EAT A;  5LHI A;  3ZCO A;  2DBB A;  1F1Z A;  2Y69 H;  2YR2 A;  2HDC A;  3C2G A;  1UG2 A;  3H5R A;  3SXY A;  3GFL A;  5CVJ A;  1PUF B;  2OJE D;  3RKW A;  1TL8 A;  1POG A;  1L0O C;  2HQA A;  3J81 K;  1TWF J;  4G6Q A;  4UV8 A;  5FO5 A;  3QU3 A;  2VOD A;  5FKK A;  2GAU A;  1T39 A;  3BJ6 A;  2FNA A;  4L9T A;  4WXC A;  1QU3 A;  1D0X A;  2E1N A;  1ZAR A;  3NEU A;  2CG4 A;  4MQ9 F;  5F1R A;  2F4I A;  3BOQ A;  1WJA A;  5LGU A;  3S3O A;  5IT3 A;  4AIH A;  2V6E A;  2MH2 A;  1E3H A;  1WH7 A;  4G12 A;  2MC4 A;  5HS7 A;  3SZG A;  2J5O A;  2LNB A;  2W82 A;  4ABZ A;  1JUM A;  1LVA A;  3HOX J;  2RN7 A;  2JA8 J;  5E8G A;  2W84 A;  2NVQ J;  3CUQ C;  3ELK A;  3NAU A;  3H0G J;  2OTJ I;  3MMY B;  3T5X A;  1MJ9 A;  2HTS A;  1HC8 A;  4WK8 F;  1FLI A;  4E7Z A;  2H6C A;  2TDX A;  3HPG A;  4L9N A;  2NNY A;  3LQR A;  3TDU C;  3FIS A;  4FX4 A;  2IS1 A;  2V1U A;  3WG9 A;  1AHD P;  5FRN A;  1Z3X A;  1U9N A;  5LHH A;  1FOY A;  4AU7 A;  2OZU A;  4FT8 A;  1IJW C;  3L00 A;  3OMY A;  4XIC A;  1G4D A;  4AVP A;  1ZQ3 P;  2LDU A;  5EG0 B;  1YIJ I;  2DMU A;  1KON A;  3GFI A;  1Y0U A;  1MIJ A;  2FU4 A;  4HG2 A;  4ESJ A;  4IF4 A;  2PMU A;  2E5Z A;  2W7N A;  1BIA A;  2W85 A;  1G3W A;  4B47 A;  3DPL C;  3VFZ A;  3K70 C;  3LSI A;  1HW1 A;  2G7U A;  5K7Z A;  3K1P A;  2K3F A;  1JUS A;  2OU2 A;  2PQ8 A;  4XLN F;  3WTX C;  2FSW A;  1OCT C;  4C2T A;  1D8J A;  1Z6R A;  2EV6 A;  1WGX A;  4P9F A;  4Y52 J;  1SMT A;  2OUM A;  2WAE A;  2EZK A;  3GTK J;  3U1D A;  3JRB A;  2R7O A;  1BW6 A;  1ZRC A;  2CWE A;  1GHC A;  4A3E J;  3GLL A;  2DLL A;  4NDL A;  1KGS A;  2XSD C;  2A6H F;  4BS9 A;  2FJ1 A;  1OYW A;  2VT2 A;  3ABK H;  5J1Y A;  2P5K A;  4LIV A;  4PFP A;  1XG1 A;  5J8C A;  4AYB N;  4HAM A;  1MMG A;  3ZOB A;  1VQO I;  4RAY A;  3I59 B;  1S7A A;  2VQL A;  1ORK A;  2JUC A;  2VXD A;  2QF7 A;  5DD8 A;  3VYR B;  3LWF A;  2R7T A;  2O0Y A;  2XPV A;  4KA4 A;  3HTU A;  3ZMZ A;  2L4M A;  3ZMV A;  3QRF F;  2EZL A;  3ABL H;  3H35 A;  2VKE A;  4BY1 J;  1IN5 A;  1MMA A;  2LRD A;  4D1Q A;  4XL9 A;  3PO3 J;  2JSP A;  3AG2 H;  4XOT A;  4C3H J;  1FTZ A;  2DYS H;  2LKX A;  2KIM A;  3CD6 I;  1F5T A;  1UEL B;  2EZI A;  2X6Y A;  4A3M J;  4GYI A;  2F5E A;  3F8F A;  4DNC A;  2A3S A;  3G4S I;  3WTU C;  4D7N A;  3TO6 A;  2P6S A;  2CSO A;  5ILV A;  2MBF A;  3V7S A;  1ZGJ A;  2KT0 A;  2EZH A;  1RKW A;  2GWR A;  4GFB A;  3KP6 A;  2K9L A;  3T8R A;  2QM3 A;  1USS A;  1D5V A;  3DKY A;  3N05 A;  5IT9 Z;  4QTR A;  4E7S A;  2R4G A;  5KNL A;  2XC7 A;  3JSP A;  1K4T A;  3OY9 A;  1OCR H;  3GZ5 A;  4KIS A;  6PAX A;  1RRJ A;  4JX4 A;  1FT9 A;  3WTY C;  4CSW A;  2XGC A;  3DU5 A;  4DYR A;  4GDF A;  2Z16 A;  3KFW X;  4EJO A;  3JRC A;  2DI3 A;  2L9N A;  2P8T A;  3H0D A;  4F55 A;  4KFC A;  2L9R A;  1OR7 C;  3UKG A;  3HOW J;  2LBF B;  1SAU A;  3RPU A;  1BI1 A;  2DJN A;  1HQC A;  3ABU A;  2H09 A;  1IV8 A;  3HKZ N;  4V2F A;  3OS0 A;  3Q9S A;  4A12 A;  3HSR A;  2XDV A;  3W6K B;  3LL7 A;  4NC6 A;  2HYG D;  2QYO A;  4BYY A;  4ENN A;  5J6X A;  3F72 A;  1R00 A;  4PFO A;  5AON A;  3G3Z A;  3EQL F;  1MH3 A;  4PSX A;  4IVN A;  3RTR A;  3BLY A;  2DFI A;  1RUO A;  3H92 A;  4OOI A;  5E8I A;  3JRD A;  2JWT A;  1NK3 P;  5E17 F;  2QSG X;  2X1E A;  3JAM Z;  4YFX F;  2FX0 A;  2LVS A;  2ACJ A;  2WV1 A;  2NOJ B;  2L0K A;  3HL2 A;  3BR3 A;  2E2H J;  3FDY A;  2COB A;  1BC7 C;  1Z21 A;  1FYL A;  4I0A A;  2P7C B;  5GAH J;  4A3K J;  1TTY A;  2VOP A;  1T08 B;  2X6O A;  1N25 A;  3DBH B;  1BOA A;  1YW9 A;  5A2Q K;  3KLN A;  4PCQ A;  2DDB A;  1MBK A;  5F04 A;  3RSN A;  2L54 A;  1ON1 A;  2XKP A;  2JRM A;  2X4H A;  3FKJ A;  4IHV A;  5K7H A;  1O3Q A;  4TV7 A;  5ICC A;  1MJA A;  1T0F A;  2XAJ A;  3HOV J;  4M3D A;  3I53 A;  3S15 J;  2Q2E B;  1R4N B;  5FKO A;  3M4O J;  1X4O A;  4DGW B;  2MAB A;  4ITV A;  4RDU A;  2GM4 A;  4M3G A;  2BXY A;  3FM5 A;  4XRF A;  1HST A;  4MEY F;  2RNJ A;  3JSO A;  3BR0 A;  2VE9 A;  1YI2 I;  2XAU A;  5GAG J;  2NRA C;  1X1A A;  1QVT A;  5DM6 F;  3GVA A;  2IPQ X;  1ZR2 A;  1LPQ A;  4HW0 A;  3F23 A;  2V9V A;  1ZRD A;  3WHB A;  1HF0 A;  3KPH A;  1TQI A;  1ZLJ A;  3UNG C;  5IOZ A;  1YJW I;  2KIF A;  4N9H A;  4BNC A;  5L3G A;  3HM5 A;  1OFC X;  2OBP A;  3P7N A;  2DT5 A;  2YU9 J;  1X2M A;  2HGC A;  5JR3 A;  2DA2 A;  3DLL F;  4HPQ A;  2FMY A;  2DU9 A;  3CTA A;  4LG0 A;  1DU6 A;  1S29 A;  2M3A A;  1UJ8 A;  3DU6 A;  1JHF A;  2KJB A;  4EM1 A;  5D6E A;  1D5Y A;  4BXU A;  2PLY A;  2CQX A;  3GEZ A;  3CCM I;  3CCJ I;  1GVD A;  2GLO A;  4Q48 A;  4UXN A;  3FMS A;  4BDZ A;  2UZK A;  4IZZ A;  2QCO A;  2FML A;  1XDS A;  1TNS A;  2IP2 A;  3CDI A;  3CJQ B;  3ZQI A;  1DQU A;  2E35 A;  1ETX A;  4B1R A;  4ZTJ A;  4XKB A;  4GCV A;  3LA2 A;  1FYM A;  1REP C;  1YX5 A;  3Q0W A;  4DZJ A;  1E2X A;  3M8J A;  1XMK A;  2LP0 A;  3GF2 A;  4MLO A;  2DW4 A;  4AIK A;  3MKW B;  1JT0 A;  3J80 Z;  3HPH A;  1I6H J;  1TZL A;  4R79 A;  5CPR B;  2M7B A;  3CCL I;  3CUQ B;  2ME6 A;  3SZT A;  2JRT A;  3FHZ A;  2K02 A;  2H27 A;  3J7A Y;  4IPA A;  4HDV A;  3BR5 A;  3HC7 A;  2E7W A;  4XBF A;  2PMZ N;  4B3X A;  2TRT A;  3FMQ A;  2VQH A;  3TED A;  4HZF A;  3DWL E;  3HG9 A;  2P81 A;  3GTP J;  2GXB A;  2XAQ A;  3QYB A;  3T1B A;  5E3M A;  4GXO A;  1OR7 A;  2H6B A;  2FD5 A;  5TIS C;  4ZYH A;  2DA5 A;  4WWC A;  4XKV A;  1YJ9 I;  2WAQ N;  3IWZ A;  3HOZ J;  1OQY A;  2MA3 A;  1YX3 A;  4BU2 A;  2L02 A;  3DPU A;  1PP7 U;  2MH9 A;  3DTI A;  3VWB A;  1V3F A;  4XOP A;  1TLH B;  2WTE A;  4CA0 A;  3S1R J;  1I6X A;  2Y75 A;  3FXR A;  4BHP A;  4UNO A;  1YIO A;  2BHY A;  4UB6 C;  4IX7 A;  5JVG F;  4QPO A;  1NTC A;  1IAW A;  3SFZ A;  4O3M A;  5LBQ A;  3L2R A;  3CC7 I;  2KRH A;  3ONQ A;  1QBJ A;  4NB5 A;  2WY7 Q;  4XID A;  4A2U A;  2H94 A;  2LTP A;  2ZBK A;  3R6S A;  3CCS I;  1UCR A;  4PUS A;  3ZQG A;  4C9Y A;  3C7J A;  2I10 A;  3CC4 I;  3HRT A;  2DAO A;  3LA7 A;  4RAG A;  1XGO A;  2GA1 A;  2PN6 A;  5ED4 A;  2VN2 A;  1G3Y A;  1O4X A;  1YE9 A;  5KAF C;  2EB7 A;  1Y8R B;  4JBA A;  4Y4R A;  1H89 C;  2JT1 A;  1DPU A;  1Z91 A;  4JK1 X;  1LDD A;  1WRJ A;  3FF5 A;  3FK7 A;  1F4K A;  1V5E A;  1JGG A;  2ELH A;  2R5Z B;  1YQA A;  1ENH A;  1C0W A;  4X6A J;  3DKX A;  1Z9C A;  4M72 A;  4IHW A;  3KZZ A;  4A6E A;  4C3J J;  4OIP F;  4LB6 B;  5CVR A;  1SMY F;  3OIP A;  4BXF A;  2DFE A;  4BJ5 C;  2ZME C;  2EFQ A;  2KMU A;  1KQ9 A;  3CO7 C;  1GT0 C;  2ICW G;  3BP8 A;  3GZ6 A;  4M9S A;  1FMW A;  2V79 A;  2ZFW A;  3A01 A;  4ENJ A;  2BOL A;  5IOY A;  1X1B A;  2IVM A;  3U1K A;  1GXQ A;  2DMN A;  1BA5 A;  1BJA A;  2XB0 X;  3ZPL A;  2QWW A;  1LE8 B;  3L2W A;  1Z1D A;  1MJB A;  2FOK A;  3LSG A;  1BC8 C;  4ESB A;  3SEZ A;  3I56 I;  2YX7 A;  4A69 C;  4A3D J;  1XDU A;  2BVM A;  2K5C A;  3IP4 B;  4ZJZ A;  3Q5F A;  5DD4 A;  3G71 I;  1MND A;  3EYI A;  2AS5 F;  1YIT I;  1SFO J;  1E3O C;  3BCB A;  4A0X A;  1G3T A;  2A69 F;  4XN0 A;  3FZV A;  2IA2 A;  2ZXI A;  1GV2 A;  3CCR I;  1H8A C;  1JE8 A;  2LK2 A;  1MNE A;  3HHH A;  3EUA A;  3P5J A;  3VOE A;  1TWA J;  3H36 A;  2ESH A;  4XLH A;  1K78 A;  3FXO A;  2CW8 A;  4CGZ A;  3BQY A;  1QRY A;  1V4R A;  1W5T A;  2HWV A;  2XVC A;  1DGW Y;  1GXP A;  4DJA A;  2EV5 A;  5GAD J;  1X2N A;  2AXL A;  3M8E A;  3C18 A;  5IT9 K;  2F4M B;  2Q1Z B;  5LEJ A;  2Z99 A;  4Y13 A;  1U9O A;  3FWE A;  5M5W J;  4YII A;  4MHG A;  4RGX A;  3D5R C;  4L5I A;  4MIM A;  3FKI J;  2OPT A;  3JRF A;  2KIS A;  1SVM A;  3C2H A;  4BEH A;  3N4M A;  1I1S A;  1SFE A;  3KYL A;  1IW7 F;  1IO2 A;  5DTD A;  1OIS A;  1VQ6 I;  3EYY A;  3K4C A;  3GTO J;  4XLC A;  1Z77 A;  1HDP A;  3DV8 A;  1JKO C;  3I5U A;  1TT5 B;  3V42 A;  4XKW A;  2ZO4 A;  5DS9 A;  1UAA A;  1J5Y A;  1XD7 A;  1EJ9 A;  2XB5 A;  3S2H J;  2MFZ A;  2W48 A;  2KQR A;  3ZXS A;  3O8G A;  2DK8 A;  1R1T A;  3AG4 H;  3BZK A;  1R22 A;  3U9G A;  3N97 A;  1Y8Q B;  4YFN F;  2HXO A;  2IXS A;  5ICG A;  5GPA A;  1WFX A;  3F22 A;  2DQR A;  3K0L A;  4I2O A;  1XCV A;  1TQM A;  4AC0 A;  4U0Y A;  2DTR A;  4IXA A;  1J9I A;  3BJO A;  5JLW A;  4F3Q A;  1A36 A;  2RDP A;  5LD2 C;  1S6L A;  4C2M J;  2BHZ A;  1FY7 A;  2XF7 A;  1AKH B;  2AHQ A;  5FRM A;  2ELJ A;  3DEE A;  4Z6Y A;  3DBR B;  2KIQ A;  5IYB J;  3CDH A;  5EG0 A;  1I5Z A;  3E6B A;  1RNL A;  3GFJ A;  3BWG A;  2HYJ A;  3L7W A;  3L1P A;  2UXX A;  2CUZ A;  4LMY A;  1MBF A;  4F7Z A;  4M6Y A;  2LD5 A;  3TO9 A;  1OYI A;  3J7Y J;  1ZR4 A;  2B63 J;  2P7V B;  2VJ4 A;  2HNH A;  2MLG A;  3JCU C;  2R7R A;  4N4O B;  3V7R A;  4RB2 C;  3ASN H;  9ANT A;  3V7C A;  4KIB A;  3OYG A;  1TW3 A;  4UUS A;  1YS7 A;  4MGR A;  3TDZ C;  5CJ9 A;  2X6X A;  2LY1 A;  2HZD A;  1G59 A;  1LFP A;  2R5Y B;  2RC4 A;  2CH0 A;  2CUE A;  1X3U A;  4ETS A;  5CVV A;  4A5M A;  2IS6 A;  2D1H A;  1KA8 A;  1ZYR F;  2DA7 A;  2FA5 A;  1TC3 C;  3B6C A;  5LRS A;  4M73 A;  3ASO H;  4FET A;  1VQ4 I;  2W24 A;  2LRE A;  4KIT B;  3I55 I;  1RI7 A;  3R4K A;  1PDN C;  5HDG A;  1UMQ A;  3X2Q H;  3MWM A;  3I59 A;  1R36 A;  2ZNZ A;  4LK0 F;  2XF6 A;  1T6S A;  5IY5 H;  4S05 A;  1T2K A;  2E19 A;  1SVO A;  5E79 C;  5CVI A;  1ZGW A;  5E3L A;  4RA2 A;  1Y1V J;  3V8J A;  3V8L A;  4EJU A;  1J59 A;  5H2F C;  4HV6 A;  1ACI A;  1H9T A;  1XMX A;  1FIA A;  2V26 A;  3CJN A;  1UHM A;  2F5V A;  4XLA A;  5B66 C;  5J40 A;  5D5X B;  4BY7 J;  3OYJ A;  4BEH B;  2P5L C;  4CZZ A;  5ICE A;  2M30 A;  5K1Y A;  3S17 J;  2HEO A;  2FNP A;  3S1N J;  4KMU X;  3HRU A;  4DBQ A;  3DTE A;  3C1D A;  2XUB A;  2D1V A;  4W97 A;  4A6D A;  4RAF A;  1MBE A;  1GLN A;  1W7P B;  1JKR C;  1RPW A;  2VIX A;  1W0U A;  3IKT A;  1R1V A;  2HR3 A;  2WWY A;  2XRO A;  5D4S A;  1GUU A;  4W1U A;  3IH4 A;  1D1B A;  2B9S A;  2DT7 B;  2CQK A;  3CF2 A;  4GYG A;  3J80 K;  2QSH X;  2OQR A;  2KFD A;  4UUV A;  3WU1 B;  3A0B C;  2MD0 A;  1PYV A;  2RV8 A;  4AIJ A;  1YLF A;  3PL8 A;  4LGW A;  2VL8 A;  1JJ6 C;  1MNM C;  5M3F J;  3KP2 A;  4Q47 A;  3JRE A;  4I02 A;  2XPW A;  3OS2 A;  2LOO A;  2ZFU A;  3PNT A;  3ZQC A;  3S3N A;  5J3L A;  2ESN A;  2DXI A;  2NOG A;  2LBF A;  3JTG A;  3EUH A;  2GZW A;  3CP2 A;  4ZZL A;  2CQN A;  3CMY A;  3KZI C;  3GUD A;  4G7O F;  2FF4 A;  1W7P D;  3BQZ A;  3K7A J;  3TBI A;  3ZN0 A;  1HXD A;  4MQV A;  3OV8 A;  5JLX A;  1Z6T A;  2CO5 A;  2XAH A;  5D6F A;  3LSP A;  2EA4 A;  5TGT A;  5J4V A;  3NQO A;  5ILU A;  3JRI A;  3AKZ A;  1NK2 P;  2QQ8 A;  1P7I A;  1TP4 A;  2FUG 2;  2ZME B;  3E6C C;  4IOC F;  1VQK I;  2A68 F;  4G6T B;  4UUS B;  3VEP A;  2VT3 A;  3EET A;  1BIB A;  2PX9 A;  4LK1 F;  4OWR B;  1XB4 A;  5FRO A;  5D8L B;  1N77 A;  1Q1H A;  2JVH A;  1LUJ B;  2IGN A;  5IP9 J;  3ECO A;  3KZY A;  2O3F A;  1R49 A;  4NC8 A;  1B8I A;  1DPR A;  4IOA F;  2ZNY A;  3QU6 A;  4PJN A;  2K86 A;  3BTI A;  2QBY B;  4C2U A;  1QHG A;  3CZ6 A;  2ETH A;  3AG1 H;  1HLV A;  3ML6 A;  1I39 A;  4B48 A;  3GZN B;  5J4Y A;  3E6D A;  5IP6 A;  1LFU P;  4HQM A;  4I09 A;  4P96 A;  3KIO A;  3KX2 A;  3H3U A;  3R0A A;  3OYK A;  4BQA A;  1K6O A;  3E5U A;  1P6R A;  1ERD A;  2DFH A;  1SD6 A;  3PQJ A;  3OYF A;  2VXZ A;  3BRO A;  5FD6 A;  3MCZ A;  2F2E A;  1CGP A;  2MYS A;  5FFZ A;  1WJD A;  2YS9 A;  5D5U B;  2CYY A;  1VQM I;  2KRF A;  2NVU B;  5L3F A;  2Q2E A;  3G1L A;  4MEX F;  1N78 A;  2M8G X;  5HOD A;  1WI3 A;  5L3B A;  1GV5 A;  3I58 A;  5FJ8 J;  1I27 A;  4N9I A;  3VSK A;  5FKL A;  5LGN A;  3DLA A;  2LKP A;  3I4P A;  4LIU A;  4MTD A;  3SYT A;  3DKW A;  2HQN A;  4HEA 2;  2ZKZ A;  2HDD A;  3VYT B;  2LYC A;  4QWQ A;  1IUF A;  4JP0 A;  5BS6 A;  2TCT A;  3M3Y J;  5IP7 J;  3K4B A;  3FM3 A;  4YIR X;  5ICF A;  4BDY A;  2CUJ A;  2STW A;  4EQQ A;  5E1Z B;  2I5U A;  4M6V A;  4OMZ A;  1WJ5 A;  4BE1 A;  5KVR A;  4DW6 A;  1M1E B;  2DYR H;  3E5Q A;  3RKY A;  4M74 A;  4M9Z A;  2E5N A;  4XON A;  2QQB A;  3H5N A;  2JSC A;  3IAM 2;  1X3Z B;  4A3I J;  3IL2 A;  2UXN A;  3LSJ A;  3K4K A;  2ISY A;  1ZK8 A;  3J7A O;  2X51 A;  1FP2 A;  3T8T A;  4HF0 A;  3BPX A;  2P6T A;  4BAY A;  1U2W A;  2XAS A;  4CUG A;  1A35 A;  1TT0 A;  4HYE A;  3LAJ A;  3BG3 A;  2DA6 A;  3I64 A;  2ECC A;  2M4K A;  3NAR A;  3BCA A;  1FX7 A;  3BJA A;  2BV6 A;  4S04 A;  2JA2 A;  2MG4 A;  3CMM A;  3ZP5 A;  2O6G E;  4XN3 A;  5K5O A;  2IJL A;  4XNF A;  1RC9 A;  1U5T C;  3BTJ A;  4IQJ A;  4G8X A;  4IEJ A;  4HLY A;  1XCB A;  3CUQ A;  3RDI A;  3DF8 A;  3OSF A;  3M7G A;  2KDO A;  3HSE A;  3DXJ F;  2COM A;  2ZSI B;  1OCZ H;  2ZJR F;  1APL C;  3ZMU A;  5M3M J;  3Q3S A;  2X1D A;  2M0M A;  2V1X A;  3U21 A;  3K2A A;  2L9S A;  1MSF C;  2R7V A;  1F43 A;  4RM3 A;  1Z7U A;  1FTT A;  4XRS A;  2DMP A;  1B8I B;  1IF1 A;  1WZ2 A;  2W4S A;  4NQW A;  1YJN I;  4JX5 A;  1ZAO A;  3OYL A;  5BMZ A;  3JTH A;  3A1Y A;  3O6B B;  5C44 J;  3WGG A;  1T95 A;  2GA2 A;  2ZXW H;  3DPT A;  4ZYE A;  2R7X A;  3PUF A;  1ETY A;  1HKT A;  2NS8 A;  1MW7 A;  3JRG A;  4KN4 X;  2UWM A;  3QQA A;  5L3D A;  5HVQ C;  4C3I J;  1WPK A;  1J09 A;  4Y15 A;  3SQN A;  1VQ5 I;  3ISP A;  4QPQ A;  4LLN A;  1XGN A;  3VPR A;  4MFD A;  1HSJ A;  4KMF A;  1HA8 A;  1TWC J;  5L3E A;  2R7D A;  1EH7 A;  1WJF A;  1DP7 P;  1MKM A;  2DO7 A;  2A5W A;  2OV7 A;  2IA0 A;  3U2R A;  4AYB A;  2IEK A;  1ZRF A;  3G2B A;  4HOB A;  3C2B A;  2EFO A;  1K6Y A;  5FKN A;  2E1M C;  2R7F A;  1KQ0 A;  3FXQ A;  1ZG1 A;  2F5F A;  2FBI A;  2O7O A;  4V19 K;  3JRH A;  1ITY A;  2LR8 A;  3QPT A;  4RAZ A;  3G1O A;  3HIF A;  2PFB A;  1ZKG A;  2K9Q A;  2Z3Y A;  1Q1V A;  2KRC A;  3I9V 2;  2OQG A;  2OAZ A;  1ZN2 A;  3A03 A;  2STT A;  1SD7 A;  1MMN A;  1Y6I A;  1OCC H;  2DA1 A;  2ZSH B;  2XGE A;  1FBU A;  5EF6 A;  2EIM H;  2PMH A;  5C3E J;  5E1W A;  3ZQL A;  3OS1 A;  4P55 A;  5HLT A;  3GCM A;  3FXL A;  2R92 J;  3PO2 J;  4S0H B;  3R61 A;  3CJT B;  1MSE C;  2H1K A;  1QZE A;  3PNY A;  3FHN A;  4BUP A;  2R5Z A;  1RZ4 A;  1PJR A;  4CHU A;  3R60 A;  4LD5 A;  3LOC A;  4B43 A;  2V6C A;  4M3B A;  2DN0 A;  2WB1 A;  5F0H A;  5EGO B;  2PJR B;  3E7L A;  4AWX B;  1BM9 A;  1FSE A;  3OYE A;  5HS9 A;  2AQF A;  4LJZ F;  5GTI C;  4D5C A;  5E3O A;  3GBG A;  3ULQ B;  1RIO H;  2L4A A;  1Z3Y A;  5CYV A;  4JYK A;  3GO5 A;  2NVX J;  4PSW A;  3HRM A;  5BOX A;  1BOB A;  2PEX A;  4YEL A;  2DMT A;  2ECB A;  3PFY A;  5ERI A;  3KYD B;  1NG6 A;  5HDN A;  4IHX A;  3TKY A;  4U0W A;  4A0Z A;  3DCF A;  3ZN1 A;  3KEY A;  2Y48 A;  1SFU A;  1LE8 A;  1YOV B;  3GWZ A;  2VJJ A;  2JVG A;  2E2J J;  5B1B H;  2W1O A;  3K4L A;  3HKZ A;  4XOR A;  2PG4 A;  1DU0 A;  4LLG F;  3WTS C;  3DBL B;  2ZJP F;  2LC2 A;  2QKL B;  1CF7 B;  1BI2 A;  4NQW B;  1DUX C;  3PM1 A;  3ZMT A;  1HBX G;  1NHA A;  2HXI A;  1KU2 A;  2ZXH A;  3ABT A;  1R58 A;  5K5Q A;  1FMV A;  1QZZ A;  3A02 A;  2EIK H;  2OCE A;  3RKQ A;  2ZJ2 A;  1ZHF A;  3OYI A;  3OYN A;  2LMD A;  2M7A A;  2YPR A;  1YO5 C;  2HZT A;  3S32 A;  5GAE J;  2CQ7 A;  2LY9 A;  1O3S A;  1R6R A;  4J01 A;  3AL0 C;  4ENK A;  1UZC A;  4G6D A;  3FXJ A;  4L9V A;  5FB2 A;  2VON A;  1JGS A;  2BW3 B;  2KP6 A;  3L9F A;  2E7X A;  3DEW A;  3EDP A;  4L0Z B;  3O8H A;  2R7Z J;  1JI8 A;  3HB9 A;  1IRZ A;  2H1L A;  5F0C A;  2IS4 A;  5EEG A;  2RVC A;  2ZC2 A;  1FWZ A;  2CJJ A;  1ZH5 A;  3ZRG A;  1A6Q A;  3GTG J;  4ENM A;  4JX6 A;  3HYI A;  4B4C A;  1W1W E;  5EZH A;  4CCJ A;  3F6O A;  4QIW N;  1FOK A;  1F9N A;  1OYY A;  3LQQ A;  4G7H F;  2EK5 A;  3MAJ A;  4M71 A;  1IG7 A;  2BE5 F;  5TJJ A;  3MKY B;  5HNH A;  3OYA A;  1WSU A;  1GDT A;  3ECH A;  3H1C A;  5EDN A;  1FIP A;  2NS0 A;  2HKX A;  2R3S A;  4Y3O A;  2CMP A;  1RET A;  1I1G A;  2EV0 A;  4ON0 A;  2K7L A;  1P92 A;  3D5S C;  2O9L A;  5ILS A;  4R1H A;  4HLX A;  1IZ1 A;  2DMQ A;  3HZJ A;  5JHF A;  3B02 A;  1BL0 A;  2EJR A;  1XX5 A;  3MZH A;  4M3F A;  3ZGK A;  2W25 A;  2CFO A;  3I71 A;  3G6E I;  4EMS A;  1IGN A;  4X0G A;  3OWT A;  4A0Y A;  1RKT A;  2WBM A;  3HBL A;  1UG0 A;  2CW7 A;  4B8X A;  4P5O A;  2Y9Z A;  4BL0 B;  3S2D J;  3HHG A;  3HUG B;  2CV0 A;  4OIN F;  2LLK A;  4FX0 A;  4PJM A;  1FZP B;  1IDZ A;  4E7H A;  1XGS A;  1FSH A;  2MSY A;  4O5V A;  3IKV A;  3BG5 A;  1AKH A;  1X58 A;  2FEZ A;  1A6I A;  3R0J A;  3RKX A;  1BI0 A;  2QGU A;  3RPQ A;  4G9Y A;  3I0T A;  2CRG A;  2XAG A;  4KUM A;  5K5R A;  2EPF A;  1PVE A;  1OCP A;  1OPC A;  3QWL A;  2WAD A;  3TGN A;  5DDG A;  1ULY A;  4CYC B;  1QA6 A;  3WTW C;  3LSM A;  2AQE A;  2Y0S N;  1Y1W J;  3BPV A;  3FX3 A;  1J0R A;  3SDG A;  5JFR A;  1IV6 A;  5DUI A;  3WGH A;  2R5Y A;  2L7F P;  2M0C A;  1U5T B;  3E5X A;  3KET A;  2PMZ A;  5HS8 A;  2FQ4 A;  4DOZ A;  4RS8 A;  3BG9 A;  3FMR A;  4GGG A;  3CCQ I;  4UV9 A;  4F92 B;  1HW2 A;  5E1X A;  2JA5 J;  1K61 A;  3QAH A;  1K4S A;  3A2K A;  4UUT A;  5IYC J;  3IH2 A;  4U87 A;  3IH3 A;  3H9J A;  3BG6 A;  1MMD A;  1XTA A;  2WAQ A;  4I0B A;  5CLS A;  2CQQ A;  4EJT A;  4EV0 A;  2XGD A;  1XPX A;  3TW7 A;  1UFM A;  1SEU A;  5HLG A;  1ETV A;  2PJP A;  2NNN A;  3F21 A;  2H8R A;  2JK3 A;  3P9C A;  2VPL A;  1B6A A;  1S8N A;  3QPS A;  2Y2Z A;  3WE2 A;  3OOP A;  1IN6 A;  1Y56 A;  5FLM J;  3SHF A;  2HYF A;  1VQN I;  5JI6 A;  1T8I A;  2V9P A;  1LDJ A;  1VZ0 A;  1JHH A;  2WA0 A;  4JOM A;  1TNT A;  3GTJ J;  2OZ6 A;  1DDN A;  3P9I A;  3HOY J;  3S16 J;  4R8H A;  3OIQ A;  5FFX A;  1ON2 A;  3W2A A;  3PIP F;  3O2P E;  1Z7L A;  3KP7 A;  3QOE A;  1G6N A;  3OYC A;  2NVY J;  2ISZ A;  1STZ A;  3F8N A;  3OL3 A;  1ZG5 A;  3TOA A;  1EF4 A;  1W7P A;  2R7S A;  1EH6 A;  1OLT A;  4FAS D;  2EFP A;  2Y30 A;  1LVK A;  4GO1 A;  4ZC3 A;  2E1M B;  4X1E A;  2RKH A;  4ZH4 F;  4LB5 A;  1MH4 A;  3LAP A;  1IDY A;  1I50 J;  3CCE I;  2HFH A;  1VTN C;  1K83 J;  2JJ7 A;  2VJ5 A;  2BY1 A;  1O57 A;  4IRH A;  5EZG A;  1MDM B;  3GTM J;  4K2E A;  3LA3 A;  4HA8 A;  2V9K A;  2ZCW A;  3I54 A;  2A6T A;  1KZH A;  2QEX I;  2DPU A;  3IWF A;  4BQN A;  2VI6 A;  4UHT A;  3HSF A;  1D1C A;  1QO0 D;  3OSG A;  3KEO A;  4YFK F;  2DA3 A;  2YX4 A;  4I99 C;  1MGT A;  1P7J A;  4E70 A;  4F93 B;  3JAM K;  2VLA A;  2NS7 A;  1Z05 A;  4AID A;  1IN4 A;  5EEH A;  2L3D A;  1YS6 A;  3PJR A;  1V55 H;  2H8W A;  4KJZ A;  4OU0 A;  2A5Y B;  3MFK A;  5E20 A;  2VKH A;  5DCM B;  1V5F A;  1QNT A;  4LIT A;  4BBR J;  4NNJ A;  2VOO A;  3H3Z A;  1EA3 A;  1WCM J;  1IXC A;  3OYH A;  3CME I;  3CO6 C;  4FTH A;  1I3Q J;  4HSR A;  3MN2 A;  4D5F A;  3PUB A;  3PQK A;  1MBJ A;  4XLP F;  1J75 A;  2K3P A;  5D4R A;  1LB2 A;  3S14 J;  5J8F A;  2ZME A;  3KE2 A;  4I6Z A;  1K79 A;  3HOT A;  4D0P A;  1LQ1 A;  2XRN A;  1KU9 A;  4J00 A;  3HDD A;  1XGM A;  2BY3 A;  4D7M A;  3ZQF A;  4E4H A;  3P9K A;  4L0Y B;  3L09 A;  1WJB A;  3A0H C;  1XSD A;  3E97 A;  2QBY A;  2L9V A;  1E0E A;  3KEQ A;  3RZO J;  4CCO A;  5J1R A;  2BXZ A;  1XSX A;  1Y39 A;  4HF2 A;  4CYD A;  1R1U A;  3BZ6 A;  3CCV I;  2HPM A;  3H3V K;  2AO9 A;  3Q0V A;  2P5V A;  5D5V B;  3KP3 A;  1O3T A;  3FBI B;  3WTV C;  2R7Q A;  4PK4 A;  2Z1D A;  4Y7N J;  4BE2 A;  1FJL A;  2IW5 A;  4RGR A;  4CCM A;  4AM3 A;  3CMA I;  1ETO A;  2K40 A;  4XRS G;  2FRH A;  3D5L A;  3BTC A;  2DPD A;  3WTT C;  1JJ8 C;  4WF2 A;  3BZC A;  2ADU A;  4A3F J;  3MZY A;  1P9Q C;  3I4N J;  1IXS B;  1H9G A;  4IJA A;  3OYB A;  1B9N A;  4PJ0 C;  3MVP A;  4MNU A;  4XMY A;  4NC7 A;  4ASN A;  3D0S A;  3AL0 B;  2DOD A;  3WHC A;  2L5Q A;  2O8K A;  2KJC A;  3OYD A;  3F6V A;  4IO9 F;  2K9S A;  3S1M J;  1WWX A;  3OR1 C;  4RMN A;  3W3C A;  2E1C A;  5B1A H;  4CH7 A;  4OAY A;  2JPB A;  3B73 A;  4Z2Y A;  1FBQ A;  4JQF A;  4KN7 X;  1B59 A;  2FOW A;  2IRF G;  2HPI A;  3HGY A;  2Z9O A;  3L2C A;  5B5E C;  1TWH J;  1H88 C;  2EFN A;  2HDW A;  2QA4 I;  5B3S H;  2NYX A;  3QP5 A;  4L5E A;  1AOY A;  2J5P A;  1X19 A;  1Z0X A;  1U8B A;  2EIJ H;  3ESW B;  5J47 A;  2DOE A;  1B72 A;  2YUS A;  4XLF A;  3W6J B;  1UHW A;  3TP0 A;  4F91 B;  3SDB A;  1QHH D;  3TOB A;  1CQT A;  2RQP A;  2V7F A;  1T33 A;  2V1N A;  3CLQ A;  3L2Q A;  3IHU A;  1LFB A;  2KL4 A;  5H6Q A;  2FBK A;  2F6C A;  3M9A A;  5D5W B;  4M9X A;  3C3W A;  2HOE A;  5GTH C;  4DYQ A;  4PGH A;  2JA7 J;  4LG3 A;  5L3C A;  4CCL A;  2QVO A;  1UHS A;  2ID3 A;  4NBQ A;  1S7E A;  2KIU A;  1UST A;  3Q0U A;  2K4J A;  1QVU A;  1SD4 A;  1A5J A;  2XKO A;  1S3J A;  3GTQ J;  1VND A;  3RQI A;  1AA7 A;  1K7A A;  1MMS A;  4P9U A;  4L5J A;  3BR1 A;  2BYV E;  2VB6 A;  2VKD A;  3PIO F;  2Z33 A;  2M4G A;  3RYP A;  1N75 A;  4BE0 A;  1ZLK A;  2CGP A;  1JTY A;  4OAZ A;  1V5G A;  2F5C A;  3S93 A;  2GOM A;  3FXK A;  1T0F C;  2DOF A;  3FXM A;  2DK5 A;  1YFH A;  3KLO A;  3LSK A;  1J2X A;  2HQR A;  3G1M A;  2XF5 A;  5F08 A;  1MBH A;  4RGS A;  2EIL H;  4A3G J;  3M1E A;  1RUN A;  5LGT A;  2CV1 A;  3IRQ A;  1A31 A;  1X4P A;  1P4X A;  2RAE A;  4ZYG A;  4YG2 F;  1LJ9 A;  4E7J A;  3LST A;  1OJL A;  1YRN B;  3IV5 A;  3E1S A;  1JKQ C;  4YIF A;  1HKQ A;  2HVS A;  2N8G A;  4E7I A;  3RJP A;  4BQQ A;  1SFX A;  5FGM A;  3ERM A;  4OIQ F;  2RNG A;  1LNW A;  1T98 A;  2HOT A;  1IRG A;  2B7E A;  1YHQ I;  1R5I D;  3QPH A;  4MTE A;  2A61 A;  2ZXJ A;  3MKL A;  3MZ8 A;  2FE3 A;  4EEF G;  4WXH A;  4ZTF A;  3VB2 A;  3SZP A;  3F8C A;  2BVL A;  1DGR M;  3ZQ7 A;  1KYW A;  4KIG A;  4ZDL A;  3TO7 A;  2IS2 A;  4FCY A;  1E3P A;  2JUG A;  2M34 A;  1QGP A;  3CJR B;  5E3N A;  4YRV A;  3GME A;  4XQF A;  3WTZ A;  1SC7 A;  3M8F A;  3LSR A;  1A04 A;  1B9M A;  2FBH A;  3JR9 A;  1R5H A;  2DQL A;  2LSO A;  1D0Z A;  3IUO A;  4MFE A;  2HVQ A;  4HX7 A;  1JT6 A;  3OYM A;  2QLZ A;  4H0E A;  3G73 A;  2ZB9 A;  3MEX A;  5AIP A;  1O7F A;  2FXA A;  2LKS A;  1BN5 A;  4WXD A;  3PFI A;  4L9J A;  1EV7 A;  1YW7 A;  1FOW A;  2OC6 A;  2OD5 A;  3LFK A;  3ROU A;  4UVC A;  3A4C A;  4N0B A;  4GRI A;  3V4G A;  1W36 C;  2LY2 A;  1LKX A;  2QUF A;  1QPI A;  1XN7 A;  3WGI A;  4PJL A;  4PDK A;  3WU0 A;  2L7Z A;  2KLO A;  1BBY A;  1ZGA A;  4MO7 A;  2WB1 N;  1B72 B;  2QSF X;  2C6Y A;  5EGO A;  3PSI A;  2PJR A;  3BTL A;  3AG3 H;  2MGQ A;  5FD5 A;  5DM7 F;  3K1N A;  1XMA A;  4J19 A;  1Y0N A;  2HQ5 A;  3IC7 A;  1OCO H;  1KQ8 A;  2LF7 A;  4I76 A;  4HBL A;  2Y31 A;  3CCU I;  4XM3 A;  1TW2 A;  2VBZ A;  5J1U A;  4Q4Z F;  2CUF A;  2BBY A;  3EPZ A;  3HEF A;  1U6G A;  4RM2 A;  2XAF A;  2ID6 A;  2K85 A;  3CF5 F;  4DBR A;  2E1O A;  1YW8 A;  3OL4 A;  2DOA A;  1HOM A;  3SEQ A;  3T0Y A;  3GLX A;  3DFG A;  3GYH X;  1R7J A;  2JPC A;  2L7K A;  3HOU J;  1OMI A;  4KT6 A;  4QSH A;  3HTS B;  1OKR A;  2BEO A;  3L2U A;  4UB8 C;  1AWC A;  4B44 A;  1CF7 A;  4ZZD A;  2VC1 A;  1IC8 A;  3H9G A;  4HX4 A;  4RB3 C;  4Y33 A;  2B0L A;  4FE4 A;  3AFH A;  4HQE A;  2RQQ A;  2WC2 A;  3MKZ A;  1VQ9 I;  2QQ9 A;  3WE3 A;  4ZYD A;  2AXT C;  4U7B A;  3QOD A;  1FBS A;  1R23 A;  1FPQ A;  3REO A;  1W5C C;  3ERE D;  3HOS A;  1P4A A;  2OA4 A;  2I8D A;  3Q9V A;  4RB0 A;  1PUE E;  4XSZ F;  1IN8 A;  2CS3 A;  5FLX Z;  3GFM A;  2A07 F;  2X0L A;  1BR1 A;  2MD5 A;  1JKP C;  1ZG3 A;  3F3X A;  2NAZ A;  4IHS A;  3GTL J;  2X48 A;  1DP3 A;  3BY6 A;  1GVJ A;  4A5N A;  2X85 A;  2BW3 A;  3DTK A;  3FK6 A;  2IAI A;  5KAI C;  4Q5S F;  1W0T A;  2HTJ A;  1RR7 A;  4DYC A;  1HW5 A;  4IKF A;  1D3Y A;  5F64 A;  3KP5 A;  1P4W A;  1RES A;  4OMY A;  1JTX A;  4RLQ A;  4BAC A;  2K4B A;  3S3M A;  2EH3 A;  2VJI A;  1VQL I;  5H20 A;  2LH9 A;  5CQE A;  1VQ7 I;  1W4M A;  1IRF A;  2MC3 A;  2EIN H;  2UUZ A;  1KU3 A;  4D9J A;  1O7L A;  5C4J J;  2JTV A;  1HDD C;  1BJZ A;  4IL6 C;  2L01 A;  1R4M B;  2EWN A;  3HJE A;  4HNT A;  2O03 A;  2Z2S B;  4ANJ A;  2CV2 A;  4XK4 A;  3TP3 A;  1IN7 A;  2P4W A;  4DZP A;  4HST A;  2XV4 S;  4A3J J;  4LLL A;  4A93 J;  1FP1 D;  2JMW A;  1AU7 A;  3JRA A;  2HU9 A;  3BC8 A;  4O6J A;  3RIR A;  4BJT A;  5KHD A;  4U0V A;  4ZDP A;  3LSH A;  3BG7 A;  4I01 A;  1R9T J;  1G2H A;  4WCG A;  2D45 A;  4M3E A;  3CES A;  4Y17 A;  3VYU B;  4UY8 I;  4LOC A;  1S9H A;  2VC0 A;  3KYC B;  1UB9 A;  1FNN A;  2RRE A;  2CU7 A;  1S5L C;  5DYM A;  2WY8 Q;  3O3K A;  4H4K C;  3TL4 X;  3TMO A;  3NRV A;  3ZQH A;  2Q8K A;  1ODD A;  5EEA A;  3K9T A;  1IRX A;  4AD9 A;  4RBO A;  5GPC A;  3CQZ J;  5CVU A;  3J81 Z;  1HKS A;  3HUG A;  3K4M A;  1SFK A;  2PBI A;  3CP8 A;  3DP7 A;  2VBW A;  1EH8 A;  1I3A A;  2KZV A;  1F36 A;  1T38 A;  1SAX A;  1R5G A;  3NWT A;  1VQP I;  2NXN B;  4NHJ A;  1VI0 A;  3AAF A;  3K10 A;  2IT0 A;  3K6G A;  3LNQ A;  4LFU A;  5F6F A;  3CC2 I;  2M87 A;  1R71 A;  2YSR A;  3K1M A;  4A3B J;  5JHU A;  4G94 A;  2HI3 A;  3D1N I;  1WH5 A;  2VE8 A;  5BPI A;  2CW0 F;  4B3A A;  4BBS J;  5E18 F;  2M2E A;  2XPU A;  4XSX F;  4ZYA A;  3B6A A;  4ESF A;  4WX9 A;  2ELK A;  4CYC A;  3ZMD A;  1FYK A;  1VQ8 I;  1VF9 A;  2A6E F;  2BY0 A;  5EJC A;  2D2W A;  2W00 A;  1SD5 A;  1U5T A;  3S1Q J;  1J7K A;  2KKO A;  4G7Z F;  3KCC A;  4BQO A;  2HOA A;  4P1W A;  1ZTR A;  5DEQ A;  3RPU D;  4QLC U;  4AUX A;  3RCO A;  3MQ0 A;  5EYR A;  4CCN A;  4FE7 A;  1JXS A;  4RB1 A;  1RR8 C;  5IYD J;  2K27 A;  2QKM B;  3HRS A;  4UVA A;  2GIZ A;  5CKT A;  1T56 A;  2D5V A;  4HDU A;  2VBY A;  2E2I J;  4DQ2 A;  2A05 A;  4HX8 A;  1FOX A;  2XHK A;  4CO8 A;  3MD2 A;  2Y0M A;  4KIC A;  3S8P A;  5M5X J;  1TQP A;  2M1B A;  4CZC A;  1U8R A;  1QZY A;  2O61 A;  1X1C A;  1H0M A;  5C4X J;  4CIC A;  1LEA A;  4E6K G;  2MW8 A;  1D0Y A;  2DT6 A;  4PZJ A;  1S72 I;  4CDG A;  2M45 A;  2BGC A;  3CLO A;  3IAS 2;  4BGD A;  1MZB A;  4A3C J;  2JA6 J;  2E34 A;  3F0C A;  3PSF A;  5BNG A;  2VPR A;  4BKX A;  4KDP A;  3QYF A;  3J7Z I;  3GXO A;  3DEU A;  1NH3 A;  1QPM A;  3CCY A;  3S2W A;  2GXA A;  2G7H A;  4FHT A;  2RGV A;  5HLI A;  4E7L A;  5FLV A;  2V1D A;  2G0E A;  3SJM A;  3K70 D;  3W6V A;  5LEK A;  4LG0 B;  4BXX J;  4KIF A;  1YG2 A;  4A3L J;  2HVR A;  2EFW A;  1MDM A;  4XR6 A;  1ZRE A;  3COA C;  3M1C A;  4AVZ A;  1Z67 A;  3QP6 A;  1NG7 A;  1BR2 A;  4BHB A;  3QOP A;  3QYE A;  4EVI A;  4EGZ A;  4KYW A;  2FQ3 A;  3HXL A;  1U3E M;  2IBD A;  3K4N A;  1KU7 A;  3VYS B;  4IQ4 A;  2HOS A;  2XGX A;  2JN6 A;  2JZY A;  2KHM A;  4CCK A;  3IRR A;  2EQR A;  5K7F A;  2WAF A;  1WKM A;  1HCR A;  2M8E A;  3F8B A;  2UV1 A;  5KK1 A;  2LG4 A;  5DCM A;  3BR6 A;  2LFB A;  2VBX A;  2Y9Y A;  5D8K B;  4BH9 A;  2GBY A;  2KZG A;  1BW5 A;  3LMM A;  2LF8 A;  1V54 H;  4HRI A;  2IGK A;  4EM2 A;  3RQ4 A;  1O3R A;  2VQG A;  2DCE A;  1MD0 A;  2GIV A;  2M5W A;  2MLK A;  4C30 A;  2DDA A;  1TWG J;  1X3W B;  2GXG A;  2IGO A;  2M9H A;  5LHG A;  4HNV A;  2CFX A;  2E60 A;  2OCC H; 
#chains in the Genus database with same CATH homology
 3TQN A;  1TBX A;  5BQT A;  3BDD A;  1D8K A;  4M6X A;  4KNY A;  1LEB A;  2O8X A;  2HS5 A;  1YTY A;  4L18 B;  4U7D A;  2PI0 A;  4OIR F;  1IXR C;  2YU3 A;  1FC3 A;  1U78 A;  4UVB A;  1PP8 F;  4OIO F;  3FXU A;  5DV5 A;  5A2Q Z;  4IRG A;  4IHT A;  2XIG A;  4IRI A;  1YYV A;  4EM0 B;  1BI3 A;  3E6M A;  5DUK A;  4U88 A;  3WOD F;  3RI4 A;  1IUY A;  2EA2 A;  3JW4 A;  3GW2 A;  5H6R A;  1B4A A;  3GX4 X;  3K2Z A;  4EGY A;  3E3V A;  4EJV A;  3V8K A;  2IA1 A;  5LRR A;  1XSV A;  1ONV A;  3ZMS A;  4I98 B;  5HOO A;  2QQA A;  2HKO A;  5FLX K;  4RGU A;  1E17 A;  4PGG A;  4I7H A;  1S7O A;  4KT5 C;  4CXF A;  1W5S A;  4HV5 A;  3VOD A;  1QQI A;  4EJW A;  3F8M A;  2QEN A;  5JVT A;  4HF1 A;  4BHC A;  1WI9 A;  2G9W A;  1B1B A;  5BPD A;  2F5D A;  1L3L A;  1P2F A;  4B09 A;  5AIQ A;  2GQQ A;  2QZ8 A;  3K69 A;  2Q0O A;  5HDK A;  3CUO A;  1KYZ A;  2Z5U A;  3RYR A;  3KP4 A;  2WV0 A;  3DQV C;  5LLQ A;  1K78 B;  2W57 A;  1G3S A;  1WQ2 A;  5HLH A;  5TRD A;  1LDK B;  5DCF A;  5LHI A;  2DBB A;  1F1Z A;  2YR2 A;  2HDC A;  3SXY A;  3GFL A;  5CVJ A;  3RKW A;  1L0O C;  3J81 K;  4G6Q A;  4UV8 A;  5FO5 A;  3QU3 A;  2VOD A;  2GAU A;  1T39 A;  3BJ6 A;  2FNA A;  4L9T A;  4WXC A;  2E1N A;  1ZAR A;  3NEU A;  2CG4 A;  4MQ9 F;  5F1R A;  3BOQ A;  5LGU A;  1J75 A;  5IT3 A;  4AIH A;  2MH2 A;  5HS7 A;  2J5O A;  2LNB A;  1LVA A;  2RN7 A;  5E8G A;  2W84 A;  3CUQ C;  3ELK A;  3T5X A;  1MJ9 A;  2HTS A;  4WK8 F;  1FLI A;  2H6C A;  2TDX A;  4L9N A;  2NNY A;  3LQR A;  3TDU C;  4FX4 A;  2V1U A;  3WG9 A;  5LHH A;  2OZU A;  4FT8 A;  3L00 A;  1G4D A;  4AVP A;  2LDU A;  3GFI A;  1Y0U A;  2FU4 A;  4ESJ A;  4IF4 A;  2PMU A;  1BIA A;  2W85 A;  1G3W A;  3DPL C;  3VFZ A;  1HW1 A;  2G7U A;  3K1P A;  2OU2 A;  4XLN F;  2PQ8 A;  3WTX C;  2FSW A;  1D8J A;  1Z6R A;  2EV6 A;  4P9F A;  1SMT A;  3U1D A;  1ZRC A;  2CWE A;  1GHC A;  2DLL A;  1KGS A;  2A6H F;  1OYW A;  2VT2 A;  2P5K A;  5J8C A;  4HAM A;  4RAY A;  3I59 B;  1S7A A;  5DD8 A;  3LWF A;  2O0Y A;  4KA4 A;  3HTU A;  3ZMZ A;  2L4M A;  3ZMV A;  3QRF F;  1IN5 A;  2KIM A;  1F5T A;  4GYI A;  2F5E A;  3F8F A;  4DNC A;  2A3S A;  3WTU C;  3TO6 A;  2P6S A;  2CSO A;  5ILV A;  2MBF A;  3V7S A;  1ZGJ A;  2GWR A;  3KP6 A;  3T8R A;  2QM3 A;  1USS A;  1D5V A;  5IT9 Z;  3JSP A;  3GZ5 A;  6PAX A;  1FT9 A;  3WTY C;  3KFW X;  4EJO A;  2DI3 A;  2P8T A;  4KFC A;  3RPU A;  1BI1 A;  1HQC A;  3ABU A;  2H09 A;  3Q9S A;  4A12 A;  3HSR A;  4ENN A;  3W6K B;  4BYY A;  2HYG D;  2QYO A;  5J6X A;  3F72 A;  1R00 A;  5AON A;  3G3Z A;  3EQL F;  4IVN A;  3RTR A;  2DFI A;  1RUO A;  3H92 A;  4OOI A;  5E8I A;  5E17 F;  3JAM Z;  4YFX F;  2ACJ A;  1BC7 C;  1FYL A;  4I0A A;  2P7C B;  1TTY A;  2VOP A;  1BOA A;  1YW9 A;  5A2Q K;  3KLN A;  4PCQ A;  2L54 A;  1ON1 A;  2XKP A;  2X4H A;  1O3Q A;  4TV7 A;  5ICC A;  1MJA A;  1T0F A;  2XAJ A;  3I53 A;  4XRF A;  3FM5 A;  1HST A;  4MEY F;  2RNJ A;  3JSO A;  2VE9 A;  2NRA C;  3GVA A;  2IPQ X;  4HW0 A;  3F23 A;  2V9V A;  1ZRD A;  1TQI A;  1ZLJ A;  2KIF A;  4N9H A;  4BNC A;  5L3G A;  3P7N A;  2OBP A;  2DT5 A;  5JR3 A;  2HGC A;  2FMY A;  2DU9 A;  3CTA A;  4LG0 A;  1S29 A;  1JHF A;  2KJB A;  4EM1 A;  5D6E A;  4BXU A;  2PLY A;  3GEZ A;  4Q48 A;  4UXN A;  3FMS A;  2UZK A;  2FML A;  1XDS A;  1TNS A;  2IP2 A;  4GCV A;  3LA2 A;  1FYM A;  1REP C;  1E2X A;  1XMK A;  3GF2 A;  4AIK A;  2DW4 A;  3J80 Z;  4R79 A;  3CUQ B;  3SZT A;  2JRT A;  3FHZ A;  2K02 A;  2H27 A;  4IPA A;  4HDV A;  2E7W A;  4XBF A;  3FMQ A;  4HZF A;  2GXB A;  2XAQ A;  3T1B A;  4GXO A;  1OR7 A;  2H6B A;  4ZYH A;  4WWC A;  3IWZ A;  2MA3 A;  2L02 A;  1PP7 U;  2MH9 A;  1V3F A;  1TLH B;  2WTE A;  1I6X A;  2Y75 A;  3FXR A;  4BHP A;  4UNO A;  1YIO A;  1IAW A;  3SFZ A;  4O3M A;  5LBQ A;  1QBJ A;  4NB5 A;  4A2U A;  2H94 A;  2ZBK A;  3R6S A;  1UCR A;  3C7J A;  3HRT A;  2DAO A;  3LA7 A;  1XGO A;  2GA1 A;  2PN6 A;  5ED4 A;  2VN2 A;  1G3Y A;  2EB7 A;  4JBA A;  2JT1 A;  1DPU A;  1Z91 A;  4JK1 X;  1LDD A;  1WRJ A;  3FF5 A;  1F4K A;  2ELH A;  1YQA A;  1C0W A;  1Z9C A;  4M72 A;  3KZZ A;  4A6E A;  4OIP F;  4LB6 B;  5CVR A;  1SMY F;  2EFQ A;  1KQ9 A;  3CO7 C;  3BP8 A;  3GZ6 A;  4M9S A;  2V79 A;  2ZFW A;  4ENJ A;  2IVM A;  1GXQ A;  1BJA A;  3ZPL A;  2QWW A;  1Z1D A;  1MJB A;  2FOK A;  1BC8 C;  4ESB A;  2YX7 A;  1XDU A;  3Q5F A;  5DD4 A;  3EYI A;  2AS5 F;  4A0X A;  1G3T A;  2A69 F;  3FZV A;  2IA2 A;  1JE8 A;  3HHH A;  3VOE A;  2ESH A;  1K78 A;  4CGZ A;  1V4R A;  1W5T A;  2HWV A;  2XVC A;  1GXP A;  2EV5 A;  2AXL A;  3M8E A;  3C18 A;  5IT9 K;  5LEJ A;  2Z99 A;  4Y13 A;  3FWE A;  4YII A;  4MHG A;  4RGX A;  4L5I A;  3N4M A;  1I1S A;  1SFE A;  1IW7 F;  3EYY A;  3DV8 A;  3I5U A;  2ZO4 A;  1J5Y A;  1XD7 A;  2DK8 A;  1R1T A;  1R22 A;  3U9G A;  3N97 A;  4YFN F;  5ICG A;  3F22 A;  2DQR A;  3K0L A;  4I2O A;  1XCV A;  1TQM A;  4U0Y A;  2DTR A;  4IXA A;  1J9I A;  3BJO A;  2RDP A;  1S6L A;  1FY7 A;  3CDH A;  1I5Z A;  3E6B A;  1RNL A;  3GFJ A;  3BWG A;  3L7W A;  2UXX A;  4LMY A;  4F7Z A;  4M6Y A;  3TO9 A;  1OYI A;  2P7V B;  2MLG A;  3V7R A;  4RB2 C;  3V7C A;  4KIB A;  1TW3 A;  1YS7 A;  4MGR A;  3TDZ C;  5CJ9 A;  2RC4 A;  4ETS A;  1X3U A;  5CVV A;  4A5M A;  2D1H A;  1KA8 A;  1ZYR F;  2FA5 A;  5LRS A;  4M73 A;  2W24 A;  1RI7 A;  3R4K A;  1PDN C;  5HDG A;  3MWM A;  3I59 A;  1R36 A;  2ZNZ A;  4LK0 F;  1T6S A;  4S05 A;  1T2K A;  5CVI A;  3V8L A;  3V8J A;  4EJU A;  1J59 A;  4HV6 A;  1H9T A;  3CJN A;  1UHM A;  5D5X B;  2P5L C;  4CZZ A;  5ICE A;  2M30 A;  5K1Y A;  2HEO A;  2FNP A;  4KMU X;  3HRU A;  3C1D A;  2XUB A;  2D1V A;  4A6D A;  1W7P B;  3IKT A;  1R1V A;  2HR3 A;  2WWY A;  2XRO A;  5D4S A;  2CQK A;  4GYG A;  3J80 K;  2OQR A;  4UUV A;  3WU1 B;  2RV8 A;  4AIJ A;  1YLF A;  4LGW A;  3KP2 A;  4Q47 A;  4I02 A;  2ESN A;  3JTG A;  3EUH A;  2GZW A;  4ZZL A;  3GUD A;  4G7O F;  2FF4 A;  1W7P D;  3ZN0 A;  1HXD A;  4MQV A;  3OV8 A;  1Z6T A;  2CO5 A;  2XAH A;  5D6F A;  2EA4 A;  3NQO A;  5ILU A;  2ZME B;  3E6C C;  2A68 F;  3VEP A;  2VT3 A;  3EET A;  1BIB A;  4LK1 F;  1XB4 A;  5D8L B;  1Q1H A;  3ECO A;  3KZY A;  2O3F A;  1DPR A;  2ZNY A;  3QU6 A;  2K86 A;  2QBY B;  2ETH A;  3ML6 A;  3E6D A;  4HQM A;  4I09 A;  4P96 A;  3H3U A;  3R0A A;  4BQA A;  1K6O A;  3E5U A;  1P6R A;  1SD6 A;  3PQJ A;  2VXZ A;  3BRO A;  5FD6 A;  3MCZ A;  2F2E A;  1CGP A;  5FFZ A;  5D5U B;  2CYY A;  2KRF A;  5L3F A;  2Q2E A;  4MEX F;  5L3B A;  3I58 A;  1I27 A;  4N9I A;  5LGN A;  2LKP A;  3I4P A;  4MTD A;  3DKW A;  2HQN A;  2ZKZ A;  4QWQ A;  5BS6 A;  3FM3 A;  5ICF A;  2STW A;  4EQQ A;  5E1Z B;  4OMZ A;  5KVR A;  3E5Q A;  3RKY A;  4M74 A;  4M9Z A;  2QQB A;  2JSC A;  3IL2 A;  2UXN A;  2ISY A;  3J7A O;  1FP2 A;  3T8T A;  4HF0 A;  3BPX A;  2P6T A;  4BAY A;  1U2W A;  2XAS A;  4HYE A;  3LAJ A;  3I64 A;  1FX7 A;  3BJA A;  2BV6 A;  4S04 A;  3ZP5 A;  2O6G E;  5K5O A;  2IJL A;  1U5T C;  4G8X A;  4HLY A;  1XCB A;  3CUQ A;  3RDI A;  3DF8 A;  3M7G A;  3HSE A;  3DXJ F;  2COM A;  3ZMU A;  2V1X A;  1Z7U A;  1IF1 A;  4NQW A;  1ZAO A;  5BMZ A;  3JTH A;  3O6B B;  3WGG A;  2GA2 A;  3DPT A;  4ZYE A;  1HKT A;  4KN4 X;  2UWM A;  5L3D A;  5HVQ C;  4Y15 A;  3SQN A;  3ISP A;  4LLN A;  1XGN A;  1HSJ A;  4KMF A;  5L3E A;  2R7D A;  1EH7 A;  1DP7 P;  1MKM A;  2DO7 A;  2IA0 A;  3U2R A;  1ZRF A;  4HOB A;  2EFO A;  2R7F A;  3FXQ A;  1KQ0 A;  1ZG1 A;  2F5F A;  2FBI A;  3QPT A;  4RAZ A;  3HIF A;  2PFB A;  2Z3Y A;  2OQG A;  2OAZ A;  1ZN2 A;  2STT A;  1SD7 A;  1FBU A;  2PMH A;  5E1W A;  4P55 A;  3R61 A;  1RZ4 A;  4CHU A;  3R60 A;  4LD5 A;  2V6C A;  4AWX B;  1FSE A;  1BM9 A;  5HS9 A;  4LJZ F;  3ULQ B;  1RIO H;  2L4A A;  5CYV A;  3GO5 A;  3HRM A;  5BOX A;  2PEX A;  5ERI A;  5HDN A;  3TKY A;  4U0W A;  4A0Z A;  3ZN1 A;  2Y48 A;  1SFU A;  3GWZ A;  2PG4 A;  4LLG F;  3WTS C;  1CF7 B;  1BI2 A;  1DUX C;  3ZMT A;  1HBX G;  1NHA A;  1KU2 A;  3ABT A;  1R58 A;  5K5Q A;  1QZZ A;  2ZJ2 A;  1ZHF A;  2YPR A;  1YO5 C;  2HZT A;  1O3S A;  4ENK A;  4G6D A;  4L9V A;  5FB2 A;  2VON A;  1JGS A;  3L9F A;  2E7X A;  3EDP A;  4L0Z B;  5EEG A;  2RVC A;  1FWZ A;  1ZH5 A;  4ENM A;  3HYI A;  3F6O A;  1FOK A;  1F9N A;  1OYY A;  3LQQ A;  4G7H F;  2EK5 A;  3MAJ A;  4M71 A;  2BE5 F;  5TJJ A;  1WSU A;  3ECH A;  2NS0 A;  2HKX A;  2R3S A;  1I1G A;  2EV0 A;  4ON0 A;  2K7L A;  1P92 A;  5ILS A;  4R1H A;  4HLX A;  1IZ1 A;  3B02 A;  2EJR A;  3MZH A;  2W25 A;  3I71 A;  4EMS A;  4A0Y A;  4B8X A;  4P5O A;  3HHG A;  4OIN F;  4FX0 A;  1FZP B;  1XGS A;  1FSH A;  4O5V A;  3IKV A;  2FEZ A;  3R0J A;  3RKX A;  1BI0 A;  3RPQ A;  4G9Y A;  3I0T A;  2XAG A;  4KUM A;  5K5R A;  1OPC A;  3TGN A;  5DDG A;  1ULY A;  3WTW C;  3BPV A;  3FX3 A;  1J0R A;  5JFR A;  5DUI A;  3WGH A;  1U5T B;  3E5X A;  3KET A;  5HS8 A;  4RS8 A;  3FMR A;  4GGG A;  4UV9 A;  1HW2 A;  5E1X A;  3QAH A;  4I0B A;  5CLS A;  4EJT A;  4EV0 A;  1UFM A;  5HLG A;  2PJP A;  2NNN A;  3F21 A;  3P9C A;  1B6A A;  1S8N A;  3WE2 A;  3OOP A;  1IN6 A;  3SHF A;  2HYF A;  5JI6 A;  1LDJ A;  1JHH A;  1TNT A;  1DDN A;  2OZ6 A;  3P9I A;  4R8H A;  5FFX A;  1ON2 A;  3O2P E;  3KP7 A;  1G6N A;  2ISZ A;  1STZ A;  3F8N A;  1ZG5 A;  3TOA A;  1W7P A;  1EH6 A;  2EFP A;  4GO1 A;  4LB5 A;  2RKH A;  4ZH4 F;  3LAP A;  2HFH A;  1VTN C;  1O57 A;  4IRH A;  1MDM B;  4K2E A;  3LA3 A;  4HA8 A;  2ZCW A;  3I54 A;  2DPU A;  3IWF A;  4UHT A;  3HSF A;  1QO0 D;  3KEO A;  4YFK F;  2YX4 A;  4E70 A;  1MGT A;  3JAM K;  1Z05 A;  1IN4 A;  5EEH A;  2L3D A;  1YS6 A;  4OU0 A;  2A5Y B;  3MFK A;  5E20 A;  5DCM B;  1QNT A;  2VOO A;  3H3Z A;  1IXC A;  3CO6 C;  3PQK A;  4XLP F;  5D4R A;  1LB2 A;  5J8F A;  2ZME A;  3KE2 A;  1K79 A;  3HOT A;  4D0P A;  1LQ1 A;  2XRN A;  1KU9 A;  1XGM A;  3P9K A;  4L0Y B;  3L09 A;  1XSD A;  3E97 A;  2QBY A;  3KEQ A;  1XSX A;  4HF2 A;  4CYD A;  1R1U A;  3BZ6 A;  2P5V A;  5D5V B;  3KP3 A;  1O3T A;  3WTV C;  2IW5 A;  4RGR A;  2FRH A;  3D5L A;  2DPD A;  3WTT C;  4WF2 A;  2ADU A;  3MZY A;  1IXS B;  1H9G A;  4IJA A;  1B9N A;  4MNU A;  4ASN A;  3D0S A;  2KJC A;  3F6V A;  1WWX A;  2E1C A;  2JPB A;  3B73 A;  4Z2Y A;  1FBQ A;  4JQF A;  4KN7 X;  1B59 A;  2IRF G;  2Z9O A;  3L2C A;  2EFN A;  2NYX A;  3QP5 A;  1AOY A;  2J5P A;  3W6J B;  1UHW A;  3TOB A;  2RQP A;  3IHU A;  5H6Q A;  2FBK A;  3M9A A;  5D5W B;  4M9X A;  3C3W A;  2HOE A;  4PGH A;  5L3C A;  2QVO A;  2KIU A;  1UST A;  2K4J A;  1SD4 A;  2XKO A;  1S3J A;  1K7A A;  4P9U A;  4L5J A;  2BYV E;  2Z33 A;  3RYP A;  1ZLK A;  2CGP A;  2F5C A;  2DK5 A;  1YFH A;  3KLO A;  1J2X A;  2HQR A;  4RGS A;  3M1E A;  1RUN A;  5LGT A;  3IRQ A;  4YG2 F;  1P4X A;  4ZYG A;  1LJ9 A;  3LST A;  4YIF A;  1HKQ A;  3RJP A;  1SFX A;  5FGM A;  4OIQ F;  1LNW A;  1T98 A;  1IRG A;  3QPH A;  4MTE A;  2A61 A;  2ZXJ A;  2FE3 A;  4WXH A;  3VB2 A;  3SZP A;  3F8C A;  3ZQ7 A;  1KYW A;  4KIG A;  3TO7 A;  1QGP A;  3WTZ A;  3M8F A;  1A04 A;  1B9M A;  2FBH A;  1R5H A;  2DQL A;  2LSO A;  4HX7 A;  2QLZ A;  4H0E A;  3G73 A;  3MEX A;  5AIP A;  1O7F A;  2FXA A;  1BN5 A;  4WXD A;  3PFI A;  4L9J A;  1EV7 A;  1YW7 A;  2OD5 A;  3LFK A;  3ROU A;  4UVC A;  4N0B A;  3V4G A;  2QUF A;  1XN7 A;  3WGI A;  4PDK A;  1BBY A;  1ZGA A;  2C6Y A;  5FD5 A;  3K1N A;  1XMA A;  3IC7 A;  1KQ8 A;  2LF7 A;  4HBL A;  1TW2 A;  2VBZ A;  4Q4Z F;  2BBY A;  1U6G A;  2XAF A;  1YW8 A;  3T0Y A;  3GLX A;  3DFG A;  3GYH X;  1R7J A;  2JPC A;  1OMI A;  3HTS B;  1OKR A;  2BEO A;  1AWC A;  1CF7 A;  4ZZD A;  2VC1 A;  4HX4 A;  4RB3 C;  2B0L A;  4HQE A;  2WC2 A;  2QQ9 A;  3WE3 A;  4ZYD A;  4U7B A;  1FBS A;  1R23 A;  1FPQ A;  3REO A;  3ERE D;  3HOS A;  1P4A A;  2OA4 A;  3Q9V A;  4RB0 A;  1PUE E;  4XSZ F;  1IN8 A;  5FLX Z;  3GFM A;  2A07 F;  2X0L A;  2MD5 A;  1ZG3 A;  3F3X A;  2NAZ A;  4IHS A;  3BY6 A;  1GVJ A;  4A5N A;  4Q5S F;  2HTJ A;  1HW5 A;  1D3Y A;  5F64 A;  3KP5 A;  1P4W A;  4OMY A;  2K4B A;  5H20 A;  1W4M A;  1IRF A;  2MC3 A;  1KU3 A;  1O7L A;  2JTV A;  2L01 A;  2EWN A;  2O03 A;  1IN7 A;  2P4W A;  2XV4 S;  4LLL A;  1FP1 D;  4O6J A;  3RIR A;  4U0V A;  4I01 A;  4WCG A;  2D45 A;  4Y17 A;  2VC0 A;  1UB9 A;  1FNN A;  5DYM A;  3O3K A;  3NRV A;  2Q8K A;  1ODD A;  3K9T A;  4AD9 A;  5CVU A;  3J81 Z;  1HKS A;  3HUG A;  2PBI A;  3DP7 A;  2VBW A;  1EH8 A;  1T38 A;  1SAX A;  1R5G A;  4NHJ A;  3AAF A;  2IT0 A;  4LFU A;  5F6F A;  2M87 A;  2YSR A;  3K1M A;  5JHU A;  4G94 A;  2VE8 A;  5BPI A;  2CW0 F;  5E18 F;  4XSX F;  4WX9 A;  4ESF A;  3ZMD A;  1FYK A;  2A6E F;  2D2W A;  1SD5 A;  1U5T A;  1J7K A;  2KKO A;  4G7Z F;  3KCC A;  5DEQ A;  4QLC U;  3MQ0 A;  1JXS A;  4RB1 A;  2K27 A;  3HRS A;  4UVA A;  4HDU A;  2VBY A;  4DQ2 A;  4HX8 A;  2XHK A;  4CO8 A;  2Y0M A;  4KIC A;  1TQP A;  2M1B A;  1U8R A;  1QZY A;  2O61 A;  1H0M A;  4CIC A;  1LEA A;  4PZJ A;  4CDG A;  2M45 A;  2BGC A;  3CLO A;  1MZB A;  4KDP A;  3GXO A;  3DEU A;  1QPM A;  3S2W A;  2G7H A;  4FHT A;  2RGV A;  5HLI A;  2V1D A;  4LG0 B;  5LEK A;  4KIF A;  1YG2 A;  2EFW A;  1MDM A;  1ZRE A;  3COA C;  3QP6 A;  4BHB A;  3QOP A;  4EVI A;  4EGZ A;  4KYW A;  2FQ3 A;  1U3E M;  1KU7 A;  2XGX A;  3IRR A;  2JZY A;  1WKM A;  2M8E A;  3F8B A;  5KK1 A;  5DCM A;  2VBX A;  5D8K B;  4BH9 A;  2LF8 A;  4EM2 A;  1O3R A;  1MD0 A;  2GIV A;  2M5W A;  2MLK A;  2GXG A;  5LHG A;  2CFX A;  3WU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...