3GFLA

Crystal structure of the st1710 mutant (r90a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
b'ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRAKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gflA00
4ZYEA 1YTYA 3FMSA 3BZ6A 1TBXA 2Q2EA 3W6JB 3WODF 4EM0B 3I4PA 1BI1A 2XIGA 3I54A 4MEYF 4G7OF 3ELKA 4LFUA 1HKTA 3RKYA 5J8FA 2RDPA 3T1BA 1PDNC 5FFXA 2KIMA 1ZRDA 3TGNA 3GFIA 3COAC 2V79A 3G3ZA 3H3ZA 2P6SA 1YLFA 1HW5A 4S04A 1WI9A 3VOEA 3JAMK 4PZJA 4A12A 2JZYA 4M6XA 3ROUA 4MQVA 1U5TC 1K79A 1LDJA 1G6NA 2LF7A 3QP6A 2DAOA 4G6DA 5L3EA 4M74A 2Q8KA 2OAZA 1XGMA 2CQKA 2QM3A 2UWMA 2VONA 2ELHA 4FHTA 2STTA 3FMRA 4RGUA 3IHUA 1SFUA 2EFWA 2RN7A 3L09A 2DK8A 1FYLA 4ZZLA 4EVIA 3J80Z 3TQNA 5D8LB 5AONA 1DPUA 4ZZDA 3E6CC 3I71A 3FWEA 3GYHX 4A0ZA 4I7HA 1SAXA 2QYOA 1IRFA 2EFPA 5CVVA 2ZBKA 4I02A 1LJ9A 4M9XA 1YW7A 1KGSA 5E8IA 3K1MA 3WGHA 1ZLKA 1H9TA 5E8GA 4RGRA 1KYZA 3GVAA 5LRRA 4UV9A 1XDSA 4U88A 3TOAA 1CGPA 2FMLA 2DU9A 3GFLA 4A6DA 1CF7A 2OZ6A 3FXUA 1FSHA 3GWZA 1D8KA 1O3TA 4H0EA 3RJPA 1NHAA 3GFJA 1W7PA 2DTRA 4A5NA 2A6HF 3V8KA 3L2CA 1BIAA 3GLXA 4KA4A 1D8JA 2QBYB 4UNOA 3I5UA 3T8RA 2XRNA 3JTHA 1CF7B 1HSJA 1YO5C 1USTA 3SZTA 2V1UA 3EUHA 2XUBA 6PAXA 1MJAA 2VE8A 1ZHFA 2OQGA 3F3XA 1H9GA 1ULYA 4MEXF 1J75A 2EK5A 5BPIA 1B9MA 3I59A 4ZYHA 1I1SA 2KKOA 4GO1A 3RPUA 2KJBA 3RI4A 3ML6A 4LLLA 1SMTA 2CYYA 3GEZA 2V6CA 2NYXA 3CO6C 2ZNZA 1V3FA 1K78A 1C0WA 3HTSB 4CYDA 1TTYA 1R5HA 1O3QA 1Y0UA 2W57A 4O5VA 4I2OA 2KRFA 3FX3A 3BPXA 1IUYA 4I98B 3D5LA 4YFKF 5FLXZ 3R0JA 5LGTA 1B4AA 3EQLF 1IZ1A 4HA8A 1EH7A 2DI3A 4JK1X 3WTWC 3MZYA 1DUXC 4XSXF 1K78B 1BI2A 4WXDA 1QO0D 5L3DA 1OKRA 4AWXB 5CYVA 3GZ6A 3TDUC 3TO7A 4ENMA 5HOOA 3DV8A 2RV8A 3REOA 1RZ4A 2DQRA 1U8RA 4BYYA 1FYKA 3KP3A 3WU0A 1SFEA 3EETA 1EH6A 1FSEA 5IT3A 3GW2A 2ZKZA 3ZN0A 4S05A 3V7SA 4KMFA 2HDCA 1IN7A 5FGMA 4OMYA 5D8KB 2VT2A 4BHPA 2YPRA 1X3UA 2PBIA 3NEUA 4M72A 2O03A 2MH2A 2O0YA 3E5QA 2VT3A 4HBLA 1R36A 5DYMA 2NS0A 4CICA 2KIUA 1J9IA 3OOPA 1W4MA 3RTRA 5E17F 1DP7P 1KU2A 2GA1A 3LQQA 4Q5SF 1IXRC 2QZ8A 4LD5A 3KP6A 1TQPA 2PFBA 3BPVA 2ZMEA 5ICCA 5L3CA 2XASA 2VXZA 4HX8A 3KETA 3JW4A 4M6YA 3WTUC 2JPCA 3ABUA 5DCFA 5KK1A 1JE8A 4CZZA 2YR2A 3FXQA 4L5JA 3VFZA 2ZMEB 2PI0A 4WCGA 5FD6A 1J59A 3CTAA 5DCMB 2MC3A 5L3GA 5LEJA 1J2XA 2OQRA 2CGPA 2R7DA 4XSZF 4XBFA 1YQAA 4MQ9F 1RIOH 1QQIA 2A6EF 3KFWX 1QNTA 3DPLC 1IN6A 1LDKB 2Y0MA 5FD5A 1ZRCA 5LBQA 2P7VB 2F5EA 2K4BA 5E1ZB 4ESBA 1MKMA 5D5UB 1W5SA 2YU3A 3U9GA 4EGZA 1L3LA 1MGTA 2COMA 3I0TA 1J5YA 4IF4A 5BQTA 5A2QK 1FY7A 4N9IA 2R3SA 3QU6A 2GXGA 2VODA 1YW8A 1Z91A 4RGSA 4P9UA 3J81K 2G9WA 3E3VA 2A07F 3R0AA 5HLHA 2OZUA 1D5VA 3E97A 3I53A 3LA7A 2ZJ2A 1IXSB 1LNWA 1XB4A 1B6AA 4ESFA 3V8LA 1R00A 4BXUA 3KLOA 4ON0A 2ESHA 4KMUX 3NQOA 1TLHB 5F64A 3HSFA 1U78A 3EYIA 4IRHA 5D5WB 2IT0A 4BH9A 4B09A 3WGIA 4G6QA 2R7FA 3MFKA 1MZBA 1S3JA 1HSTA 4O3MA 4ZYDA 3CDHA 1IN4A 1BN5A 5FFZA 1LDDA 5IT9K 4ENKA 2E1CA 3P9CA 2VBXA 3I64A 4WXCA 3LSTA 2JPBA 2PLYA 4EM2A 3TO9A 3C1DA 3C7JA 4JBAA 4LG0A 2DQLA 3WTYC 2LDUA 4KYWA 1ZG3A 4AVPA 1QBJA 2DBBA 1P6RA 1TW3A 5LHHA 2PEXA 1FBSA 4KUMA 1F1ZA 2W85A 4GCVA 4AD9A 2FEZA 2A5YB 4LG0B 1WKMA 1LQ1A 5ILSA 3IRRA 2ZO4A 1UCRA 4Z2YA 5ICEA 2P5KA 1ZLJA 2PG4A 3WU1B 3CUQC 1TNSA 3HUGA 4TV7A 4K2EA 3PQJA 2M30A 2P7CB 2ESNA 1G3YA 5E1WA 3MZHA 3ZP5A 2XHKA 2RC4A 3JSPA 2JTVA 3QP5A 5H20A 4IRIA 1XDUA 3FXRA 3CJNA 2UXXA 3V8JA 2HTSA 1S8NA 2OBPA 1IRGA 1JGSA 4AIHA 4HX4A 5K5OA 1REPC 2O8XA 5HS9A 4AIKA 2NRAC 4LB6B 2G7UA 3K1NA 4G94A 1JHHA 4ZH4F 1A04A 2K4JA 1KQ8A 2JSCA 4ZYGA 3J80K 2VOPA 5BMZA 1ONVA 2O6GE 1BJAA 1P2FA 4E70A 3ZMZA 1B9NA 2L54A 2XAHA 1IAWA 5ICFA 4GYGA 1Z6RA 2IA0A 4B8XA 5HDNA 3IRQA 5F6FA 3MAJA 2D2WA 2VBYA 2XGXA 3OV8A 1BM9A 4PGHA 3P7NA 1P92A 4IHSA 2L3DA 1LVAA 1FOKA 1ZARA 4ESJA 2ZNYA 3BJAA 1QZZA 2QWWA 1TQIA 3LWFA 1YYVA 1DPRA 5TRDA 5FB2A 1LEAA 2QQAA 5LGNA 3FZVA 4LLNA 2FNPA 4CHUA 2EFNA 4P55A 4G7HF 1XMAA 1O3RA 1R1VA 3U1DA 5J8CA 2MLGA 2HQRA 2RVCA 2XV4S 4FX4A 3FM3A 3GFMA 1JHFA 3QRFF 4RGXA 2IVMA 4BHBA 2W25A 2FF4A 3C3WA 3B73A 3BWGA 5JVTA 4GYIA 3GUDA 2D1VA 5CVIA 3ZMDA 4RS8A 2PN6A 1T38A 5DEQA 1YW9A 1F5TA 1RI7A 3ERED 3DQVC 3SQNA 4GXOA 4L9TA 1QPMA 4L9JA 1EV7A 2IP2A 4HDUA 1XGOA 4CDGA 1MJBA 4AIJA 3ZPLA 5LRSA 1WRJA 3KEOA 3V7CA 1U2WA 1S7OA 5HVQC 3R6SA 3F22A 3MWMA 4OIPF 3QPTA 2HKXA 1STZA 2MH9A 4R1HA 1W7PB 3E6BA 5FLXK 3KE2A 4HX7A 1G4DA 4A6EA 4P96A 2AXLA 1I5ZA 2HWVA 4GGGA 2F5CA 2QUFA 3O2PE 2VC1A 3GXOA 2ISYA 1RUOA 4HDVA 4HF1A 4WWCA 2HS5A 3BY6A 2BEOA 4IHTA 5L3BA 1XSVA 4UV8A 4YIIA 4PCQA 3K2ZA 2K86A 5ERIA 2EV6A 2EA2A 3KP7A 5K5QA 5H6QA 4U7DA 1R23A 3D0SA 1UFMA 1Q1HA 4HLYA 3I59B 4G7ZF 5E20A 2JRTA 2WC2A 3IC7A 3BJ6A 2ZCWA 4Y17A 4ENNA 1U5TA 2LKPA 1SFXA 1Z9CA 1T98A 1E2XA 3BDDA 3QAHA 5D4RA 4KFCA 2IA2A 4N0BA 1S29A 1S7AA 2HGCA 4L0ZB 5EEHA 3DXJF 2EA4A 4YFNF 3R4KA 1U5TB 2FXAA 4LMYA 1XD7A 2P4WA 2KIFA 3IKVA 2XAFA 5HDKA 4O6JA 1ZRFA 1BC8C 2V1XA 4QLCU 4IJAA 1ZG1A 2DW4A 4A0YA 3KP5A 3ZMVA 2PQ8A 1ON1A 1QGPA 2HR3A 3WGGA 5CJ9A 3U2RA 3KEQA 3T0YA 1O57A 2HZTA 2XROA 4ETSA 1I6XA 5TJJA 2UZKA 1KQ0A 1F4KA 4L9NA 3RKWA 1L0OC 2CG4A 3QPHA 2WV0A 1ON2A 4EQQA 2Z33A 3M7GA 2DT5A 1ZGAA 2RNJA 3IL2A 5LLQA 5LGUA 3QU3A 5LHGA 2M8EA 4LJZF 1YS6A 3HSEA 1T2KA 2TDXA 2DPDA 3I58A 3SFZA 2J5OA 3LAPA 2RQPA 4HQMA 1FWZA 1SD5A 1P4AA 4Q4ZF 3HYIA 2WWYA 4CXFA 1ZN2A 4G9YA 3RDIA 4NQWA 3N4MA 3F8CA 1HBXG 3F72A 2Z5UA 3ZQ7A 2K27A 4L18B 3HRUA 2IJLA 1EH8A 4BNCA 4KIFA 3K1PA 5KVRA 4EMSA 3F8MA 4LB5A 4KIBA 2HYFA 2H6BA 2LF8A 2ETHA 2GQQA 3K69A 1BI3A 1D3YA 1IF1A 3KP4A 1XCBA 5DUKA 4KN4X 4EJWA 3ISPA 5AIPA 1SMYF 1OYIA 2HEOA 4A5MA 2CFXA 4UHTA 1R58A 2M5WA 2P5LC 3S2WA 2XAQA 1K7AA 4HF2A 1YIOA 3ZMUA 1TQMA 4MTEA 2QQBA 3BROA 3P9KA 1Z05A 1XMKA 3L7WA 3F23A 1PP8F 3G73A 3H3UA 2O3FA 5K1YA 1O7LA 1IXCA 3WE2A 1YFHA 2HKOA 5H6RA 4EJOA 3KCCA 3HIFA 2FE3A 3BJOA 3GF2A 1USSA 3MEXA 4BAYA 3DKWA 5L3FA 4NHJA 5J6XA 4HW0A 4U7BA 3MQ0A 1IN5A 1BC7C 5CVUA 4MNUA 2OD5A 3O3KA 4WK8F 4HOBA 1LB2A 1U3EM 3RYPA 5D5VB 1HKSA 2EV5A 4HAMA 4MGRA 5EEGA 2CSOA 1FYMA 2QQ9A 3GZ5A 4R79A 1QZYA 4FX0A 3B02A 2GWRA 3HOSA 3WTZA 2EFQA 1OYYA 2DO7A 1GVJA 3IWFA 3F6VA 3DPTA 2Y75A 1DDNA 2BBYA 4XLPF 2C6YA 3WTSC 3P9IA 1XN7A 3HHGA 1KU7A 2FBHA 5AIQA 4HZFA 3WTXC 4CO8A 4YG2F 3WTVC 1ZH5A 1YS7A 2HQNA 4I0AA 1BBYA 2CO5A 1SD4A 5D6EA 3SZPA 5BOXA 1MJ9A 3TKYA 3HHHA 1V4RA 4OU0A 4EJUA 1WWXA 2L4AA 1OR7A 1WQ2A 1R1TA 2FU4A 5D6FA 3F8BA 4OINF 1ZG5A 1OYWA 3C18A 2L4MA 3TOBA 1KYWA 1SD6A 1O3SA 2RGVA 3AAFA 1XSDA 2MLKA 1FP1D 1TNTA 2L01A 3IWZA 3VODA 4N9HA 4A2UA 2IA1A 3ZMSA 1VTNC 2EB7A 2F5FA 4OOIA 3RYRA 1OPCA 2OU2A 2K7LA 4RB1A 2V9VA 2FNAA 3W6KB 2M87A 1T6SA 2CW0F 1AWCA 5DD4A 3ULQB 2FBIA 5E18F 5K5RA 3E5XA 5ICGA 1FT9A 1P4XA 4HV6A 3V7RA 2VOOA 1BI0A 3EYYA 1FZPB 3HRTA 2VC0A 1KQ9A 3FM5A 2IW5A 1FP2A 5D4SA 3CLOA 2B0LA 2D45A 3TDZC 1I1GA 2NNYA 2YSRA 2ZXJA 2H94A 3ECHA 2HYGD 1UHWA 1R5GA 1O7FA 2H27A 1ZREA 3LAJA 3JAMZ 2A69F 4IXAA 4I09A 2V1DA 1HKQA 2Z99A 3VB2A 5HLIA 3FF5A 3DP7A 3CO7C 4IRGA 2ADUA 4EJTA 5LHIA 2Y48A 2H09A 2D1HA 2E1NA 2IRFG 4PDKA 1J7KA 5DUIA 1W7PD 4IVNA 2GZWA 3F8NA 4XLNF 1XGSA 1R22A 5JI6A 2ACJA 2F2EA 3R60A 2PMUA 5JHUA 1ZAOA 4KN7X 1OMIA 2AS5F 2QBYA 3GX4X 5ILVA 5HS8A 1KA8A 3F6OA 4L0YB 4U0VA 4EGYA 1XGNA 2BE5F 1HW1A 3CUQA 4RB2C 4ASNA 2GAUA 4HYEA 4BHCA 4JQFA 2M45A 2P8TA 2HOEA 1ODDA 1AOYA 3PFIA 5CVRA 3QOPA 5DV5A 1B1BA 4WXHA 3FMQA 2EFOA 3ECOA 2RKHA 1XSXA 2EJRA 3RPQA 2EWNA 3CUQB 2LSOA 1Z7UA 4LGWA 3VEPA 2E7XA 4UVBA 3LA2A 4Q48A 1FBQA 4BQAA 3CUOA 2FMYA 4U0WA 3IKTA 2FOKA 3E6DA 2BYVE 1GXQA 5BS6A 2QVOA 4CGZA 5HS7A 1BIBA 4MHGA 4OIQF 4EJVA 3E6MA 2P6TA 4RB3C 1SD7A 5JFRA 4HF0A 5D5XB 3BOQA 2XVCA 4WX9A 2PMHA 2DLLA 3RIRA 5HLGA 2VE9A 1ZYRF 2DFIA 1FNNA 3PQKA 4A0XA 3JSOA 1FX7A 1J0RA 2LNBA 3BP8A 4Y13A 3M8FA 5JR3A 2YX7A 3O6BB 2Z3YA 2FA5A 2X0LA 3H92A 2UXNA 2KJCA 2FSWA 2H6CA 4NB5A 5DD8A 1S6LA 2XKOA 5ED4A 5HDGA 3DF8A 1R1UA 5CLSA 4U0YA 2G7HA 3K9TA 5BPDA 5E1XA 1UHMA 2K02A 1W5TA 2VBWA 3M8EA 3J7AO 2DK5A 3JTGA 5DDGA 4ENJA 2STWA 2QENA 3Q5FA 2A68F 5ILUA 1UB9A 1H0MA 1P4WA 1BOAA 2X4HA 1JXSA 5CVJA 2FRHA 4KICA 2Q0OA 4F7ZA 4DNCA 4KNYA 3HRMA 2IPQX 3K0LA 2P5VA 4OIOF 1T39A 3RKXA 2J5PA 5DCMA 4UVCA 1KU9A 2PJPA 1Z6TA 2W84A 1Z1DA 1IW7F 4HLXA 3HSRA 2XKPA 1R7JA 4L9VA 4FT8A 4R8HA 1IN8A 1ZGJA 2VN2A 2O61A 3L9FA 1FPQA 3KZYA 1HQCA 3F21A 2F5DA 4M71A 5LEKA 3T8TA 1G3WA 3GO5A 3WE3A 3LA3A 2JT1A 3WG9A 3ZN1A 4WF2A 1GXPA 2QLZA 2NNNA 1LEBA 1U6GA 3L00A 5F1RA 1KU3A 1T0FA 2VBZA 2HTJA 1YG2A 1GHCA 4D0PA 3ABTA 4DQ2A 3R61A 3ZMTA 4MTDA 3HRSA 4IPAA 4M73A 1F9NA 2DPUA 4LLGF 2A61A 3M9AA 4KDPA 4OIRF 3KZZA 2YX4A 5FO5A 1G3SA 4UUVA 3HTUA 4I0BA 1HXDA 4L5IA 1FLIA 1PUEE 4XRFA 3FHZA 1FC3A 3SHFA 2MD5A 4Q47A 3N97A 3LQRA 1RUNA 2NAZA 4UXNA 2XAJA 2OA4A 4KT5C 4LK1F 3E5UA 2W24A 2MA3A 4I01A 2BGCA 5A2QZ 4G8XA 2XAGA 2A3SA 3EDPA 3V4GA 4HQEA 3Q9SA 2E7WA 2MBFA 4UVAA 2Z9OA 2HFHA 3J81Z 3HOTA 3DFGA 3WTTC 2ISZA 2GA2A 2FBKA 3KLNA 1WSUA 4Y15A 1MDMA 2EV0A 1K6OA 3LFKA 1TW2A 1PP7U 1FBUA 3M1EA 3SXYA 1G3TA 4RAZA 4HV5A 4EV0A 1E17A 4P5OA 3KP2A 3DEUA 4M9SA 1XCVA 4EM1A 4LK0F 4P9FA 4M9ZA 1MDMB 3TO6A 1MD0A 4YFXF 2CWEA 4YIFA 1I27A 2GIVA 4KIGA 1B59A 4RAYA 5IT9Z 1HW2A 3MCZA 4QWQA 2L02A 3F8FA 2M1BA 2FQ3A 1RNLA 2ZFWA 4RB0A 3NRVA 2BV6A 2WTEA 3Q9VA 2GXBA 4OMZA 4PGGA 3T5XA
chains in the Genus database with same CATH superfamily
4A69C 4ZYEA 1YTYA 2BVLA 4XICA 2M7AA 1FOWA 3FMSA 3BZ6A 1QRYA 4MIMA 2ID6A 1TBXA 2Q2EA 3W6JB 1MBFA 3WODF 4EM0B 3I4PA 3LSIA 1BI1A 1UZCA 2XIGA 3I54A 4MEYF 4G7OF 4BXFA 1FTZA 2VPRA 1Z21A 3ELKA 3JRFA 4LFUA 1HKTA 3RKYA 1OCOH 3BG3A 2RDPA 3CZ6A 5CKTA 5J8FA 4QSHA 3ZR8X 3L1PA 3T1BA 2R7UA 1IDYA 1PDNC 3HC7A 5FFXA 2KIMA 1ZRDA 3TGNA 3W2WA 3GFIA 1XPXA 5KNLA 2XGCA 3COAC 2V79A 2Q2EB 3G3ZA 3H3ZA 1UAAA 1E3OC 2P6SA 2M34A 1YLFA 1HW5A 2R7WA 4S04A 1WI9A 3VOEA 3JAMK 4PZJA 3BTCA 4A12A 1T56A 2JZYA 4M6XA 3ROUA 3HOWJ 3K4KA 3H1CA 4LG3A 4MQVA 1U5TC 4JOMA 1ETYA 1K79A 4C3HJ 1LDJA 1G6NA 2NS7A 2LF7A 4CCLA 2XRLA 1TC3C 3QP6A 2DAOA 2WADA 4G6DA 5L3EA 4M74A 2Q8KA 3A1YA 2OAZA 1XGMA 3BG5A 1K4TA 2CQKA 4E7KA 3JREA 4BJ6C 2QM3A 2DODA 2UWMA 2X48A 3A4CA 2VONA 2ELHA 4FHTA 3LMMA 3CESA 2STTA 3FMRA 3L2RA 1ENHA 4RGUA 1VQMI 4LIUA 1PJRA 3IHUA 4UUSB 1SFUA 2EFWA 3S8PA 2M0CA 2XB0X 2RN7A 3QYFA 3L09A 3C2BA 2DK8A 1LFPA 1FYLA 3RCOA 2I10A 4ZZLA 4EVIA 3ZXSA 3J80Z 2CQ7A 3TQNA 5D8LB 5AONA 1DPUA 4UB8C 3IAS2 4ZZDA 3I71A 3HZJA 3P5JA 3E6CC 5IOYA 2VI6A 4LIVA 1Z67A 3C2HA 3FWEA 1Y0NA 3OIPA 4II2A 5FKNA 3GYHX 3RKQA 2VQCA 1QU3A 4A0ZA 3G1MA 4I7HA 4A3LJ 1SAXA 2QYOA 1IRFA 2EFPA 5CVVA 2ZBKA 4I02A 1LJ9A 4M9XA 1YW7A 1KGSA 5E8IA 4DYRA 3K1MA 3WGHA 1ZLKA 1H9TA 2IGOA 5E8GA 3VYSB 1ITYA 1M1EB 3FISA 4RGRA 2TRTA 1KYZA 3GVAA 1LVKA 3ZQHA 5LRRA 4UV9A 1A5JA 1HLVA 1XDSA 2R7QA 4U88A 3TOAA 4XOPA 5EGOA 2FX0A 1CGPA 3LSHA 4XLFA 5FLMJ 3OYLA 2FMLA 3DKXA 1X58A 2FD5A 1IV8A 2DU9A 2VKEA 4HSTA 3GFLA 2JK3A 2BY1A 4A6DA 1CF7A 3H35A 4KT6A 1DGRM 2OZ6A 3FXUA 1FSHA 3ZQLA 2DA1A 3GWZA 1DGWY 1D8KA 1O3TA 4C9YA 4D9JA 4H0EA 3IH4A 4IKFA 3OY9A 3RJPA 1NHAA 3GFJA 4EATA 2MC4A 1W7PA 3G1LA 2LP0A 4XLEA 2DTRA 4A5NA 2A6HF 1T33A 3V8KA 5M5XJ 3L2CA 1BIAA 4B47A 3GLXA 4KA4A 4AIDA 1R4NB 1D8JA 1JT6A 4D5CA 2QBYB 4UNOA 1JJ8C 1X4OA 3I5UA 3T8RA 2QEXI 2XRNA 3LSRA 5EYRA 3JTHA 4IL6C 1CF7B 1HSJA 2HI3A 3FXJA 1YO5C 3A0HC 3OYDA 1USTA 1K61A 5GAGJ 3SZTA 3H5NA 4XQFA 2JN6A 2V1UA 3EUHA 2XUBA 5E79C 1BL0A 6PAXA 3FKIJ 1JGGA 2OTJI 1MJAA 2VE8A 1ZHFA 3A03A 2OQGA 3F3XA 4ZTFA 1H9GA 1ULYA 4KJZA 3NWSA 3QOEA 4MEXF 1J75A 2EK5A 5BPIA 1B9MA 3K4JA 3I59A 4ZYHA 3K4MA 4A3GJ 1I1SA 1HDDC 2KKOA 1LFUP 2X1CA 3S2DJ 5CQEA 3OWTA 4GO1A 3RPUA 2KJBA 3PNTA 1W1WE 3RI4A 3ML6A 2CQQA 4LLLA 2LBFA 1IV6A 1EJ9A 1SMTA 2CYYA 3GEZA 2CFOA 3LSKA 4PFPA 2V6CA 2NYXA 3EPZA 3CO6C 4M6VA 2ZNZA 1V3FA 1K78A 1C0WA 2QA4I 3HTSB 4CYDA 4X1EA 1TTYA 1R5HA 1O3QA 1Y0UA 2W57A 4O5VA 4I2OA 2KRFA 3FX3A 1LE8A 1W36C 2R0QC 4BKXA 3BPXA 1IUYA 2KPMA 4I98B 4DZPA 3D5LA 4YFKF 5FLXZ 3R0JA 5LGTA 1B4AA 3EQLF 2KZGA 3ABMH 1FMWA 2IS6A 1IZ1A 4HA8A 1SVMA 1EH7A 2DI3A 4XMYA 2LBFB 4JK1X 3WTWC 2VIXA 3MZYA 1DUXC 4XSXF 4IQJA 3FIWA 3I56I 1K78B 1MNEA 3PM1A 1IDZA 3VYTB 1BI2A 4KISA 1RR7A 4WXDA 1QO0D 5L3DA 1OKRA 1LE8B 4AWXB 3MKZA 3M4OJ 5CYVA 3GLLA 1QHGA 3GZ6A 1VNDA 3I9V2 2RAEA 3S3OA 3TDUC 1DQUA 3TO7A 3H36A 3QODA 4ENMA 3Q0UA 5HOOA 4BE0A 3DV8A 2RV8A 2E36A 3REOA 1RZ4A 1BR2A 1X1PA 1Y1VJ 2DQRA 1JT0A 1U8RA 4XN0A 4BYYA 1FYKA 2NVYJ 3KP3A 3WU0A 1SFEA 3EETA 1EH6A 3OYKA 3TL4X 1FSEA 3VYUB 5IT3A 2KHMA 3BQYA 4XRSA 1RKTA 3GW2A 2GBYA 2LG4A 3K4BA 2ZKZA 2GIZA 3TP0A 1S5LC 2X6XA 3ZN0A 3AL0B 5EF6A 4S05A 2M9HA 4HPQA 3V7SA 2OV7A 4KMFA 2HDCA 1H8AC 1WGXA 1IN7A 5FGMA 4OMYA 2MW8A 4Y33A 5D8KB 2VT2A 3HM5A 4BHPA 2YPRA 3AG1H 5FKLA 2X85A 2EZHA 2A05A 2H1KA 5F08A 1X3UA 1Y8RB 3O8HA 2K3FA 2PBIA 3NEUA 4M72A 2O03A 2MH2A 3G6EI 1MBHA 5DTDA 2O0YA 3E5QA 1D0XA 4DIQA 2KFDA 3HGYA 3MKYB 2VT3A 4HBLA 1R36A 5DYMA 3BG9A 4A3EJ 2NS0A 4CICA 4E7SA 2TCTA 2KIUA 2WAQN 2F6CA 4V2GA 2KT0A 5E3LA 1J9IA 3BR2A 3OOPA 3M3YJ 1W4MA 3RTRA 5E17F 3VYRB 2NOGA 1DP7P 1JUMA 1KU2A 2GA1A 3LQQA 4Q5SF 2DCEA 2K9NA 2WY8Q 1IXRC 2QZ8A 1X1BA 4LD5A 2L7KA 3KP6A 4DOZA 1TQPA 5J3LA 2PFBA 1NG6A 1I3QJ 3BPVA 2ZMEA 5ICCA 2KQRA 2XPWA 4LOCA 5L3CA 2XASA 1WH5A 2VXZA 4HX8A 3KETA 3ZOBA 4B3XA 3JW4A 4XORA 1IO2A 3CMAI 4M6YA 3WTUC 2JPCA 3ASOH 3ABUA 5DCFA 4D7MA 5KK1A 3DPUA 1JE8A 2O8KA 1OCPA 3OOUA 1MNDA 5CQGA 2BW3B 4CZZA 3HDDA 2Y30A 4RM3A 2HU9A 2V1NA 2NVTJ 2YR2A 2K5CA 5GADJ 3FXQA 3PFYA 2CUFA 4L5JA 2W00A 3VFZA 2ZMEB 4IHWA 2PI0A 4WCGA 5FD6A 3L2QA 1J59A 3CTAA 5DCMB 2MC3A 5L3GA 4CH7A 5LEJA 1VI0A 1J2XA 2OQRA 2CGPA 1VQ7I 2R7DA 3MVPA 4XSZF 4XBFA 1YQAA 4MQ9F 4ZDPA 1D5YA 3NWTA 1RIOH 1QQIA 2A6EF 4YIRX 3KFWX 4JP0A 1QNTA 5F0CA 5J1UA 5KAIC 4BXXJ 1TWGJ 2E1OA 3DPLC 4QIWN 1IN6A 2ZJRF 4FASD 4RLFA 2P0WA 3DU6A 3DBLB 4BBSJ 4XKVA 1LDKB 3RZDJ 2Y0MA 2VQHA 5EG0A 5FD5A 1ZRCA 4BY1J 2DYSH 2P81A 4BE2A 5LBQA 5DM6F 2P7VB 3VWBA 2F5EA 1MH3A 3GTKJ 1K6YA 2K4BA 5E1ZB 4ESBA 2DOFA 5IP6A 2OPTA 1MKMA 5D5UB 1W5SA 2YU3A 1UMQA 3U9GA 4N4OB 1FJLA 4EGZA 4AYBA 2FOWA 1L3LA 1MGTA 3BR3A 3HEFA 2COMA 3I0TA 1K4SA 4ZTJA 1J5YA 4IF4A 5BQTA 5A2QK 2V9PA 3CC4I 5GAEJ 1FY7A 5EDNA 3OS1A 4N9IA 2E34A 4A3MJ 3ESWB 4DW6A 5DS9A 2E2IJ 2R3SA 3IP4B 3QU6A 2GXGA 2DA3A 1TT5B 3G2BA 4F52A 2CW8A 1SVLA 2VODA 1YW8A 1Z91A 2Z16A 1FIAA 4RGSA 2QSFX 1LUJB 4P9UA 3J81K 4IO9F 4IOAF 2G9WA 3E3VA 2A07F 1U0JA 3R0AA 5HNFA 2JVGA 3ERMA 3RQ4A 1UHSA 5HLHA 2DTZA 4OAZA 2OZUA 4M3GA 1D5VA 3E97A 3I53A 1QVTA 3LA7A 4UY8I 1W5CC 4CYCA 3HOZJ 2KMUA 3BTIA 2H8RA 2ZJ2A 1IXSB 1MMAA 2EILH 1LNWA 2JUGA 2YU9J 1XB4A 1B6AA 2VUMJ 2Z2SB 2FJ1A 1APLC 4ESFA 3V8LA 3CDLA 3ABKH 1R00A 4BXUA 3KLOA 4ON0A 2JA2A 1JKOC 2ESHA 4BBRJ 4KMUX 2FUG2 4W1UA 2M4KA 3DTIA 3NQOA 1TLHB 5F64A 3HSFA 2E35A 2M2EA 1U78A 1WJ5A 4IRHA 4RMNA 5D5WB 3EYIA 2IT0A 1A31A 4BH9A 4B09A 3WGIA 4G6QA 2R7FA 4NUBA 2H8WA 3MFKA 1MZBA 2VLAA 1S3JA 1F36A 1HSTA 4O3MA 4ZYDA 3ZQCA 3CCLI 1YITI 3CDHA 1VQ6I 1IN4A 1BN5A 2R7RA 5FFZA 1LDDA 2VASA 4IHVA 5IT9K 4ENKA 2E1CA 3P9CA 2VBXA 1YOVB 3I64A 4WXCA 3LSTA 2JPBA 2PLYA 4EM2A 4HNTA 3TO9A 4F55A 2JQ7A 3C1DA 2M8GX 1OQYA 3C7JA 4JBAA 3HG9A 1GDTA 2ZFUA 4LG0A 2XDVA 2JUCA 3UR3C 2DQLA 5JLXA 1HA8A 2GM4A 3WTYC 1GLNA 1FEXA 2XC7A 5FLVA 2LDUA 3LSMA 2K9QA 1YJWI 4KYWA 1ZG3A 4AVPA 1QBJA 2DBBA 3CC2I 1A35A 1P6RA 1TW3A 3VPRA 5LHHA 1BA5A 2GLOA 2PEXA 1FBSA 2DMPA 4KUMA 3CF5F 3BT9A 1F1ZA 2W85A 2K85A 4GCVA 1DU0A 4BQQA 4AD9A 3BG7A 2FEZA 2NXNB 2A5YB 4LG0B 1WKMA 1LQ1A 4B4CA 2EZKA 5JHFA 5ILSA 3HOYJ 3IRRA 3I4NJ 2ZO4A 2Y0SN 1UCRA 4Z2YA 5ICEA 2X6WA 2P5KA 1ZLJA 2PG4A 3WU1B 1Z0XA 3CUQC 1TNSA 3CF2A 3HUGA 4TV7A 4K2EA 3PQJA 4PSXA 2M30A 5EZHA 2P7CB 4BDYA 1BW6A 2AQEA 2LH9A 2ESNA 1D1BA 2ZC2A 1MBGA 2CMPA 1G3YA 5E1WA 1QVUA 1NK2P 1JTXA 3MZHA 3ZP5A 4AM3A 2XHKA 2RC4A 1SFKA 4Y3OA 3JSPA 1JTYA 2JTVA 3QP5A 2ZJQF 4F93B 2WA0A 1ETVA 5H20A 2BY3A 4IRIA 1XDUA 4D5FA 3FXRA 3CJNA 1POGA 2UXXA 3CC7I 4E7HA 3V8JA 2HTSA 1O4XA 3KYDB 1S8NA 1W0TA 2OBPA 3DBHB 1IRGA 1JGSA 1QZEA 3CCVI 4AIHA 4MO7A 1ZTRA 4HX4A 2E1MB 1F43A 2L0KA 5K5OA 1REPC 2LKSA 3E0JB 5KHDA 1MH4A 2O8XA 5HS9A 5K7HA 4AIKA 2NRAC 4LB6B 2G7UA 3V42A 3K1NA 1B8IA 4G94A 1IUFA 5M5WJ 3H3VK 4JX6A 1JHHA 4ZH4F 1A04A 2HZDA 3OYJA 2K4JA 2DA7A 3SEQA 1KQ8A 2JSCA 3W6VA 4ZYGA 1P7IA 1V5EA 3J80K 1Z3XA 3BR6A 3DTKA 4XKBA 5BMZA 2HVRA 2VOPA 3IAM2 2QQ8A 1ONVA 2O6GE 3LSJA 2NOJB 1P9QC 1X1CA 3RZOJ 1BJAA 2Q1ZB 1P2FA 4E70A 2DMQA 3ZMZA 1B9NA 2XSJC 4PJMA 2HQ5A 2L54A 2HOTA 2XAHA 2F4MB 1IAWA 5ICFA 1B8IB 3DLAA 4GYGA 1Z6RA 3OS2A 2IA0A 2JA7J 1QHHD 4ZC3A 4B8XA 4F92B 5HDNA 2CU7A 4X0GA 3IRQA 3PSIA 5F6FA 3MAJA 2D2WA 3W3CA 2VBYA 2XGXA 3SJMA 3OV8A 1BM9A 2UUZA 4PGHA 3P7NA 1P92A 3I4MJ 1KZHA 5K7FA 1Z3YA 4IHSA 2L3DA 3HKZA 1LVAA 4QTRA 1MMSA 2IS1A 1FOKA 1ZARA 3IH3A 4ESJA 2ZNYA 3BJAA 1QZZA 2QWWA 1TQIA 3HXLA 1YYVA 3LWFA 1DPRA 5TRDA 5FB2A 1LEAA 2EIMH 4AVZA 2QQAA 5LGNA 3FZVA 3A01A 4LLNA 4BU2A 1JJ6C 2ELKA 4E7JA 2FNPA 2X6YA 2L9RA 3ONQA 4BJTA 4CHUA 2EFNA 4I76A 4P55A 1XMAA 4DBQA 4G7HF 1O3RA 1R1VA 3J7AY 3U1DA 5J8CA 2MLGA 2HQRA 2RVCA 3S2HJ 2XV4S 1JI8A 4FX4A 1ERDA 3FM3A 2LRDA 3GFMA 2F4IA 2H1LA 1JHFA 3Q0VA 3QRFF 4RGXA 2IVMA 4BHBA 3X2QH 3DWLE 5J1RA 3OMYA 4ITVA 2DFHA 2FF4A 2W25A 4PUSA 3C3WA 3B73A 3BR1A 3BWGA 5JVTA 1X2NA 4GYIA 1AKHA 3QPSA 1RESA 3GUDA 1T08B 1R49A 1VF9A 3BG6A 3A01B 2DA2A 4BACA 2DDBA 2D1VA 5CVIA 3ZMDA 1JKPC 4RS8A 2PN6A 1T38A 5DEQA 3S93A 4XLAA 1YW9A 1F5TA 1RI7A 3ERED 2CUEA 1PVEA 1R5ID 3DQVC 2RNGA 3ZCOA 3SQNA 2AQFA 5C4XJ 4PJJA 2DA4A 4GXOA 4L9TA 1QPMA 4L9JA 1AKHB 1EV7A 4II3A 2VL8A 2IP2A 4HDUA 3EUKL 3MZ8A 3BCBA 1VQOI 1XGOA 1XMXA 4CDGA 1MJBA 4AIJA 1SEUA 3ZPLA 5LRSA 2CV2A 4RA2A 2VKVA 1WRJA 3KEOA 4J00A 3FXKA 3V7CA 1U2WA 5EGOB 1S7OA 3G4SI 4A3KJ 1R4MB 3CP8A 5HVQC 5C3EJ 3D1NI 1VQ9I 1IJWC 3R6SA 2PMZN 1WJEA 3F22A 3MWMA 4OIPF 5F1JA 2ME0A 2NVUB 4RM2A 1BR4A 3QPTA 1NTCA 2HKXA 2O9LA 2QGUA 3RPUD 1STZA 1TL8A 3OYAA 4IQ4A 2MH9A 1YX3A 3PJRA 2LK2A 1W7PB 3E6BA 1MMDA 4R1HA 1VZ0A 5FLXK 3KE2A 2FQ4A 4HX7A 3DBRB 1G4DA 4AU7A 2ZB9A 2CS3A 4M3EA 1E3PA 3U21A 4A6EA 3B6CA 4P96A 2AXLA 1I5ZA 2IGNA 2HWVA 2XF6A 2F5CA 2QUFA 3O2PE 4GGGA 2VC1A 1NG7A 3ZGKA 3JRCA 3GXOA 4XLCA 2ISYA 1RUOA 4HDVA 5EJCA 4AC0A 4HF1A 4WWCA 1MSEC 2HS5A 3BY6A 2BEOA 4CSWA 3CQZJ 4IHTA 5L3BA 2R7XA 1XSVA 4UV8A 2QSGX 4YIIA 4NC7A 3HGGA 4PCQA 3S14J 3K2ZA 2K86A 5ERIA 4XM3A 2EV6A 2EA2A 3PNVA 3KP7A 5K5QA 5H6QA 4U7DA 4E4HA 4MLOA 1S72I 1BW5A 3K70D 1R23A 4IEJA 1G59A 4I99C 3K4LA 1YJ9I 2QKLB 3D0SA 1UFMA 3AFHA 1Q1HA 2X9DA 2KDZA 4HLYA 1HDPA 3I59B 5E20A 4G7ZF 2HDDA 2JRTA 2WC2A 3IC7A 3BJ6A 4XONA 2R92J 1TT0A 2NVQJ 3RSNA 2ZSHB 5F04A 2ZCWA 3MMYB 4Y17A 2BVMA 4IOCF 3BTJA 4ENNA 1U5TA 1I50J 2BXZA 2K40A 1FMVA 2V7FA 5B5EC 2LKPA 2Y0SA 3S1RJ 1SFXA 1Z9CA 2E2JJ 1T98A 1WJDA 5HNHA 1E2XA 2VQLA 2VKDA 3BDDA 3H9JA 3QAHA 5D4RA 4ZJZA 4KFCA 1TWFJ 2F5VA 4EEFG 2IA2A 5C44J 2HOAA 1H89C 4DYCA 2JMWA 4FCYA 1KONA 4N0BA 2DYRH 1S29A 1S7AA 1RKWA 2HGCA 4L0ZB 5EEHA 3DXJF 3IV5A 3DLLF 2EA4A 1T0FC 3R4KA 1U5TB 2FXAA 4LMYA 4YFNF 4J19A 2DMTA 1XD7A 3K4CA 1PYVA 2P4WA 4RDUA 2KIFA 2L9NA 3IKVA 3BCAA 2XAFA 3HPGA 5HDKA 3JRDA 2R7VA 4O6JA 1TZLA 1ZRFA 5IYDJ 1BC8C 1ETOA 2JSPA 3GCMA 3S3NA 2V1XA 1RPWA 3OS0A 1ZK8A 4QLCU 4IJAA 1ZG1A 4E7ZA 2MG4A 2L9SA 2DW4A 2KL4A 1HCRA 4A0YA 1I3AA 3KP5A 3C2GA 5B3SH 1RRJA 4GRIA 1AHDP 4A93J 3ZMVA 2PQ8A 1ON1A 1IC8A 1QGPA 2HR3A 3WGGA 3GTGJ 2CV0A 5CJ9A 3U2RA 2XF7A 3ZQGA 4ZDOA 4F91B 3QQAA 1HOMA 3OSFA 1TWAJ 2F48A 2X1DA 4BGDA 3KEQA 3WHBA 2ZXIA 3JRAA 3PUBA 3BZCA 3CCRI 3CCEI 3T0YA 3CLQA 3SDBA 1O57A 2HZTA 2XROA 2K9MA 4ETSA 1I6XA 5TJJA 3OYGA 2UZKA 1KQ0A 4LITA 1F4KA 4L9NA 1YRNA 3RKWA 1L0OC 2CG4A 2G0EA 1MIJA 2L7MP 2WV0A 1ON2A 3QPHA 4EQQA 1AA7A 1UELB 2Z33A 3M7GA 3TBIA 3S17J 2DT5A 1ZGAA 3WHCA 2RNJA 3IL2A 2PJRA 5IY5H 1ZR4A 2LYCA 4XKCA 1QPIA 5LLQA 4ANJA 3GTOJ 5LGUA 2NVXJ 3QU3A 2VB6A 1QA6A 1XTAA 2EZIA 5LHGA 2W4SA 1V5FA 2M8EA 4LJZF 3ZQFA 1JKQC 1YS6A 1V5GA 2RQQA 4NC8A 1EKEA 3HSEA 1T2KA 4IX7A 2MABA 2TDXA 2PJRB 3CMYA 2K3PA 2R93J 2XGDA 5M5YJ 2DPDA 3I58A 1TP4A 1WHUA 2J5OA 3SFZA 2Y9ZA 2EZLA 3LAPA 2RQPA 4HQMA 1FWZA 5GP9A 2JJ7A 1SD5A 1P4AA 3S16J 1MW7A 4Q4ZF 3HYIA 2WWYA 4CXFA 4BEHA 1ZN2A 5LFAA 3ZQQA 4G9YA 3RDIA 1WH7A 4NQWA 3N4MA 3F8CA 4J01A 1HBXG 3F72A 2Z5UA 3ZQ7A 5HLTA 1OR7C 1T95A 3CJTB 1OFCX 2K27A 4L18B 2R7OA 3SFIA 1OJLA 3HRUA 3RQIA 2IJLA 2KRHA 2KLOA 3MN2A 1YHQI 3FXMA 1X1DA 1EH8A 4BNCA 4KIFA 3K1PA 5KVRA 4EMSA 1EA3A 3F8MA 2OF7A 4LB5A 2XPUA 3CP2A 2HXIA 4KIBA 2HYFA 2H6BA 2LF8A 4NC6A 4YEJA 3S1NJ 2ETHA 2GQQA 4V19K 3K69A 1BI3A 4I6ZA 1NK3P 4CCNA 2L5QA 1D3YA 1IF1A 3FXOA 1XCBA 3KP4A 2ME6A 5DUKA 2PMZA 4KN4X 4EJWA 5E3MA 2WY7Q 3ISPA 5AIPA 1SMYF 1OYIA 2HEOA 4A5MA 2CFXA 2YUSA 4BE1A 1X3WB 4UHTA 1R58A 4B1RA 2M5WA 2P5LC 3S2WA 2XAQA 1XS9A 1K7AA 4HF2A 5EG0B 1YIOA 3ZMUA 1FIPA 4BDZA 3U1KA 3L2VA 5IP9J 1TQMA 2LFBA 4MTEA 4S0HB 4KITB 1X4PA 2KISA 2QQBA 1IGNA 3I3LA 3BROA 3P9KA 1Z05A 3LL7A 1D0ZA 1WI3A 1XMKA 2JWTA 3L7WA 3F23A 1OCTC 2WB1N 1PP8F 3G73A 3H3UA 3MD2A 3OYNA 3FBIB 1Y39A 2O3FA 1ZKGA 5K1YA 2HDWA 1O7LA 1IXCA 3WE2A 1YFHA 2X6OA 2HKOA 4Y4RA 5H6RA 3H9QA 4EJOA 4GFBA 2ELJA 2OC6A 3KCCA 1X1AA 1ZQ3P 3HIFA 2FE3A 3BJOA 2XB5A 3GF2A 1OCRH 1USSA 3MEXA 4BAYA 3DKWA 5L3FA 4NHJA 1S9HA 5J6XA 4CCKA 1S7EA 4HW0A 4C3IJ 4U7BA 2GOMA 3LOCA 5FRMA 4CCMA 3MQ0A 1N77A 1IN5A 3W2VA 5CVUA 3S32A 1BC7C 4MNUA 2OD5A 3O8GA 3O3KA 4WK8F 4RAFA 4HOBA 1DP3A 1LB2A 1U3EM 3RYPA 5D5VB 1HKSA 2EV5A 4CYCB 4HAMA 4MGRA 5EEGA 2CSOA 3H5RA 2DN0A 2QQ9A 1FYMA 3PO2J 2L7FP 5J4YA 3GZ5A 3J7ZI 3H0GJ 1MMNA 4FQGA 4DGWB 4R79A 4BQNA 1ZGWA 1QZYA 4FX0A 3B02A 2GWRA 3HOSA 3WTZA 2EFQA 3E7LA 4YRVA 1OYYA 2DO7A 1H88C 3W2AA 2HQAA 1GVJA 2L7ZA 3IWFA 2Y2ZA 3TW6A 4XL9A 4XNFA 3HJEA 5IYCJ 3F6VA 4NBQA 3DPTA 4E7IA 3KEYA 5F27A 4C30A 1MMGA 2Y75A 5HODA 1DDNA 1RR8C 2E19A 4DBRA 5TISC 2BBYA 4XLPF 2C6YA 3WTSC 3P9IA 1XN7A 3HHGA 1W0UA 3M1CA 1KU7A 3CMMA 4ZYAA 2FBHA 5AIQA 4HZFA 3WTXC 1N75A 3OYMA 1WJFA 4CO8A 4D7NA 4YG2F 3WTVC 1ZH5A 3TEDA 1YS7A 3CCSI 5GAHJ 2HQNA 4I0AA 2Y31A 5FROA 2XSDC 1BBYA 3S1QJ 2CO5A 5IP7J 1SD4A 3DEEA 2O7OA 5D6EA 3CDIA 4MFEA 3OYHA 4IHXA 3SZPA 2LREA 3B6AA 2MYSA 4DYQA 5BOXA 2V4JC 1BR1A 1MJ9A 3TKYA 2VJ4A 4PJNA 3FK7A 1V4RA 3HHHA 1ZR2A 4OU0A 4EJUA 1XC5A 3HL2A 1WWXA 2L4AA 1OR7A 1WQ2A 1R1TA 2FU4A 3QPLA 4QPOA 5D6FA 1U9NA 3F8BA 4OINF 4UUTA 1ZG5A 1SANA 2EBIA 3PIOF 4OWRB 2E71A 1OYWA 3JRGA 3IUOA 5FJ8J 3CD6I 4M3BA 2XAUA 2WAQA 5GTHC 3C18A 1FTTA 2L4MA 2CQXA 3TOBA 1KYWA 1LPQA 1SD6A 3JRBA 2CUZA 2ZXHA 1O3SA 3HUGB 1Q1VA 2LY1A 4M3FA 3EUHC 2DOAA 2AO9A 1WJCA 1FOXA 2VJ5A 5BNGA 2RGVA 3AAFA 4PK4A 5FKMA 1XSDA 2MLKA 2LVSA 1FP1D 1TNTA 1D1AA 2B9SA 4RLQA 2L01A 3IWZA 3VODA 4N9HA 1MSFC 2ICWG 3KYLA 2ID3A 2IGMA 4A2UA 1A6QA 1LFBA 2IA1A 2KZVA 2VJJA 3ZMSA 1VTNC 2EB7A 2F5FA 4OOIA 3RYRA 2R5YA 1OPCA 2HPIA 5GPCA 3CCMI 1SFOJ 3CCUI 1Y6IA 2OU2A 1E0EA 1MBJA 3A2KA 1NH3A 1AU7A 2K7LA 4A3JJ 2M4GA 3HB9A 4D1QA 5B66C 2Y9YA 3LSGA 4RB1A 2V9VA 1WJBA 1VQ5I 2FNAA 3W6KB 2M87A 1T6SA 1Y56A 2CW0F 4G6TB 2NS8A 1R9TJ 1AWCA 4FISA 2DMUA 3CJRB 5IYBJ 5DD4A 2R5YB 4A3BJ 3ULQB 2FBIA 4UUSA 5E18F 2L2OA 5K5RA 1UG2A 3E5XA 2VQGA 5ICGA 1YIJI 4DJAA 1FT9A 1OCZH 1P4XA 4HV6A 4NNJA 3V7RA 2MFZA 4Y52J 2VOOA 1BI0A 3EYYA 3K70C 4IZZA 1A36A 2DXIA 1FZPB 4BY7J 2QSHX 3HRTA 3OL3A 2VC0A 3CCYA 3F0CA 1KQ9A 2LC2A 3FM5A 2IW5A 1FP2A 5D4SA 5F0HA 4XR6A 3CLOA 2B0LA 2D45A 3K10A 3TDZC 3L2WA 1I1GA 3H5AA 2NNYA 3FBNB 2YSRA 2X1EA 5KCMA 2LY9A 2BHZA 1A6IA 3GTLJ 2ZXJA 4AUXA 3OIOA 2H94A 1E3HA 3ECHA 2HYGD 4XRMA 1UHWA 2KP6A 3PL8A 3AL0C 4X6AJ 1R5GA 4C2MJ 1O7FA 1HC8A 1ACIA 3FHNA 2H27A 1ZREA 1SVOA 3LAJA 3JAMZ 3FKJA 3K7AJ 1VQPI 3DCFA 2A69F 9ANTA 4IXAA 1N25A 4I09A 2OCCH 2V1DA 1X3ZB 4HNUA 1HKQA 2Z99A 3OIQA 1YJNI 2ZXWH 3KYCB 5HLIA 3VB2A 3GTJJ 3FF5A 3ZQIA 3DP7A 1X19A 3CO7C 4IRGA 2ADUA 4EJTA 5LHIA 1U9OA 2Y48A 3ZRGA 2H09A 3K6GA 2D1HA 2E1NA 2IRFG 4PDKA 3AKZA 1J7KA 5DUIA 1W7PD 1HF0A 4IVNA 3TW7A 2GZWA 3F8NA 4XLNF 2R5ZA 1XGSA 1R22A 2WB1A 5JI6A 1D1CA 2ZSIB 4HNVA 2ACJA 2F2EA 2E60A 3R60A 5K7ZA 2IEKA 2PMUA 4B43A 1ZAOA 5JHUA 2M3AA 1SC7A 4KN7X 4A3CJ 2DA5A 1OMIA 1V54H 2AS5F 2QBYA 3CCJI 3GX4X 3KX2A 4PJLA 2DJNA 5ILVA 5HS8A 1KA8A 3F6OA 4L0YB 4U0VA 4EGYA 1XGNA 2R5ZB 2BE5F 1HW1A 3CUQA 4RB2C 2K9LA 5B1BH 4ASNA 4OAYA 2BY2A 2GAUA 4HYEA 4BHCA 2HVSA 4GDFA 3H0DA 3HOVJ 5FKKA 3CJQB 4JQFA 2W7NA 2M45A 2P8TA 1ORKA 2HOEA 1ODDA 3Q0WA 5GPAA 1AOYA 3PFIA 5CVRA 3QOPA 5DV5A 2O5RA 3E1SA 1B1BA 2ZMEC 3SZGA 4WXHA 1G8XA 3FMQA 4B3AA 2EFOA 3ECOA 2RKHA 1XSXA 3GZNB 2EJRA 4AYBN 3BR0A 3NAUA 4XKWA 3RPQA 2EWNA 3ABLH 3CUQB 2BOLA 2LSOA 1YI2I 1VQ4I 1Z7UA 4LGWA 4L5EA 1EF4A 3WU2C 3GTPJ 3VEPA 2E7XA 4UVBA 1VQKI 3LA2A 4Q48A 4E6KG 3H9GA 4M3DA 1FBQA 1V55H 4HEA2 4G12A 1MBKA 4FTHA 2QF7A 4BQAA 1ETXA 3CUOA 2FMYA 4FE4A 4U0WA 3IKTA 1OCCH 2FOKA 2COBA 3E6DA 2BYVE 1GXQA 5BS6A 2Z1DA 2E5NA 2QVOA 4CGZA 3OYFA 5HS7A 1WJAA 3PNYA 3OYCA 1BIBA 2HOSA 1I6HJ 4HSRA 2EPFA 4MHGA 1RETA 5H2FC 2XGEA 1B72A 3F9KA 4CA0A 5E3OA 4OIQF 2DT6A 3I55I 1T8IA 1YE9A 4EJVA 3E6MA 3GTMJ 1JUPA 2P6TA 4RB3C 1SD7A 1J09A 2QCOA 5JFRA 1Z7LA 2N8GA 4HF0A 2YS9A 2DMNA 5D5XB 1OLTA 3BOQA 3KZIC 2B7EA 1ETQA 2OJED 2W48A 2XVCA 2K9SA 2LLKA 4WX9A 4N4NB 1B72B 2MGQA 2PMHA 4BL0B 2DLLA 3RIRA 5HLGA 2IBDA 2VE9A 2DJIA 3EUAA 1ZYRF 2DFIA 3TP3A 3HOUJ 3DEWA 1LKXA 1FNNA 3PQKA 3JRHA 4A0XA 3JSOA 1Z77A 2DFEA 2DT7B 4JYKA 4C2TA 1IG7A 1GV2A 4PJ0C 3HBLA 1FX7A 3OR1C 1J0RA 2JVHA 2LNBA 2KIQA 4CCOA 1SAUA 2HVQA 3A0BC 3BP8A 4Y13A 1PUFA 3M8FA 5M3FJ 5LD2C 2JA5J 3QYEA 5JR3A 5J1YA 1ETWA 4XIDA 2YX7A 3O6BB 1MBEA 2A6TA 5FKOA 2Z3YA 4BJ5C 2FA5A 4PFOA 3J7YJ 2BHYA 2X0LA 1WVRA 3H92A 3S3MA 4C3JJ 2UXNA 2V9KA 4RAGA 4ZDLA 3VSKA 3UNGC 2WAEA 2AHQA 2KJCA 3AG2H 2ECBA 2FSWA 2DA6A 2IXSA 3DU5A 3NARA 3OL4A 4F3QA 1PUFB 2LMDA 2H6CA 1Y8QB 2VPLA 4NB5A 5DD8A 1WZ2A 1S6LA 3JRIA 1N78A 2XKOA 5ED4A 4CUGA 2DDAA 2L9VA 2R4GA 2CJJA 5HDGA 3DF8A 1R1UA 5CLSA 3OYEA 4U0YA 2G7HA 3K9TA 5B1AH 5BPDA 3VDXA 5E1XA 5FRNA 1UHMA 3FXLA 2K02A 2X51A 1W5TA 2VBWA 3M8EA 4P1WA 4ABZA 2M0MA 3J7AO 2OUMA 2DK5A 3JR9A 3JTGA 5DDGA 3PIPF 2IAIA 4HG2A 4ENJA 2STWA 3BQZA 2QENA 3Q5FA 2A68F 1YRNB 1XG1A 5ILUA 3UKGA 1UB9A 1H0MA 2JA6J 1P4WA 1BOAA 2CRGA 2X4HA 2BW3A 1JXSA 1YX5A 2HNHA 5CVJA 2EH3A 2FRHA 4KICA 1VQNI 2Q0OA 4F7ZA 4DNCA 5JVGF 4KNYA 3HRMA 2IPQX 1JUSA 1TWCJ 2BXYA 3K0LA 2P5VA 4OIOF 2LD5A 3TMOA 1T39A 1IRZA 2M7BA 3LSPA 4UB6C 4MFDA 5C4JJ 3RKXA 2J5PA 2HXOA 3M07A 1VFCA 5DCMA 3DKYA 4UVCA 4Z6YA 2OTLI 4XLHA 3D5RC 4H4KC 1KU9A 5M3MJ 2PJPA 1Z6TA 1W36D 2W84A 1Z1DA 2JA8J 1IW7F 4HLXA 3HSRA 2HYJA 2XKPA 1R7JA 1JKRC 2CH0A 4L9VA 2LR8A 3L2UA 4FT8A 4IHYA 1WCMJ 4R8HA 5F0FA 3GMEA 1IN8A 3HOXJ 3BLYA 1ZGJA 1OISA 4BEHB 2D5VA 1RC9A 2VN2A 2LTPA 3BR5A 3L9FA 2MSYA 2O61A 2F4OB 2E1MC 4NQWB 1FPQA 3KZYA 3DTEA 1HQCA 3K4NA 3F21A 2F5DA 4V2FA 2RREA 3HKZN 2LY2A 4M71A 3PSFA 5LEKA 1ETKA 2EIJH 1K83J 4XN3A 3T8TA 1G3WA 4B48A 4RBOA 3OSGA 2EQRA 3GO5A 4DZJA 1R71A 2IS2A 3WE3A 3LA3A 2JT1A 4BQOA 1G2HA 3WG9A 3ZN1A 2Y69H 4WF2A 2PX9A 1GXPA 2QLZA 3SDGA 2BY0A 3OYBA 2NNNA 1VQLI 4PSWA 5KAFC 2OCEA 4C2UA 2W1OA 1LEBA 1U6GA 4BS9A 2HPMA 3L00A 1IRXA 2EIKH 2MD0A 5F1RA 1KU3A 1BOBA 5E3NA 1Y1WJ 1T0FA 3FK6A 3SYTA 4W97A 2VBZA 5JLWA 5EEAA 2HTJA 2CW7A 2QKMB 3FDYA 1YG2A 4JX4A 3G71I 1GHCA 3CMEI 3AG4H 4FETA 4D0PA 2BZTA 2W82A 3ABTA 2XF5A 4DQ2A 3R61A 3VSLA 3ZMTA 4MTDA 3HRSA 4IPAA 3Q3SA 1D0YA 4M73A 1F9NA 4YELA 2DPUA 5EZGA 4LLGF 1FOYA 2A61A 3M9AA 4KDPA 3S15J 2IGKA 1VQ8I 4OIRF 3KZZA 3QWLA 2YX4A 5FO5A 3A02A 1G3SA 4UUVA 3LNQA 1X2MA 3HTUA 2VJIA 4I0BA 1UJ8A 1HXDA 5CPRB 4L5IA 1FLIA 3KIOA 1ZELA 3K2AA 1PUEE 3BZKA 4B44A 3AG3H 3MKWB 1GUUA 1R6RA 4XRFA 3FHZA 2WBMA 1FC3A 2WV1A 3SHFA 2MD5A 4Q47A 3N97A 3LQRA 2VXDA 5J40A 1RUNA 1BJZA 4CCJA 2XPVA 2NAZA 4JX5A 4UXNA 2V26A 2XAJA 2OA4A 4A3IJ 4KT5C 2UV1A 4LK1F 3E5UA 3OYIA 3PUFA 2LOOA 2W24A 2MA3A 4I01A 2BGCA 5A2QZ 4G8XA 3JCUC 3WG7H 3BC8A 2R7TA 3KPHA 4E7LA 1MNMC 2XAGA 2A3SA 2A5WA 2B63J 3EDPA 3V4GA 3QYBA 4HQEA 3Q9SA 1GVDA 2LKXA 2E7WA 2JRMA 2MBFA 2ZJPF 4UVAA 2Z9OA 2DFFA 1WPKA 4HRIA 5GTIC 2GXAA 2HFHA 4NDLA 3J81Z 3HOTA 3DFGA 3WTTC 2WAFA 2ISZA 2AXTC 3LFUA 4A3FJ 2IS4A 4Y7NJ 2GA2A 2FBKA 3KLNA 1DU6A 3BTLA 3S1MJ 2VKHA 4XOTA 2R7ZJ 1WSUA 4Y15A 2CV1A 1MDMA 1P7JA 1TWHJ 2EV0A 3N05A 1K6OA 1CQTA 2DOEA 3LFKA 1TW2A 1PP7U 3M8JA 1FBUA 3M1EA 2I8DA 1G3TA 3SXYA 3PO3J 3HPHA 3G1OA 4RAZA 4U87A 4HV5A 4EV0A 4FE7A 1E17A 2EINH 4P5OA 2I5UA 1U8BA 2V6EA 3KP2A 3DEUA 4M9SA 5DM7F 2KDOA 1XCVA 4A3DJ 4EM1A 4LK0F 4CZCA 4P9FA 4M9ZA 3D5SC 2R7SA 1MDMB 2CQNA 3TO6A 1MD0A 4YFXF 3MKLA 2CWEA 5J4VA 1UG0A 3SEZA 4YIFA 4XK4A 1I27A 2GIVA 4QPQA 5IOZA 4KIGA 3IH2A 1WFXA 1B59A 4RAYA 5IT9Z 3ASNH 3CCQI 1HW2A 3MCZA 2CUJA 4BUPA 2E5ZA 2GOXB 2L02A 4QWQA 3F8FA 3GBGA 2M1BA 2FQ3A 1RNLA 2ZFWA 4RB0A 5IPAA 3NRVA 2E2HJ 2ECCA 2BV6A 1GT0C 1GV5A 1I39A 1XX5A 3OR2C 5TGTA 2WTEA 3Q9VA 3GTQJ 2GXBA 4OMZA 4XRSG 2KRCA 4PGGA 5J47A 3T5XA
chains in the Genus database with same CATH topology
4ZYEA 1YTYA 3FMSA 3BZ6A 1TBXA 2Q2EA 3W6JB 3WODF 4EM0B 3I4PA 1BI1A 2XIGA 3I54A 4MEYF 4G7OF 3ELKA 4LFUA 1HKTA 3RKYA 5J8FA 2RDPA 3T1BA 1PDNC 5FFXA 2KIMA 1ZRDA 3TGNA 3GFIA 3COAC 2V79A 3G3ZA 3H3ZA 2P6SA 1YLFA 1HW5A 4S04A 1WI9A 3VOEA 3JAMK 4PZJA 4A12A 2JZYA 4M6XA 3ROUA 4MQVA 1U5TC 1K79A 1LDJA 1G6NA 2LF7A 3QP6A 2DAOA 4G6DA 5L3EA 4M74A 2Q8KA 2OAZA 1XGMA 2CQKA 2QM3A 2UWMA 2VONA 2ELHA 4FHTA 2STTA 3FMRA 4RGUA 3IHUA 1SFUA 2EFWA 2RN7A 3L09A 2DK8A 1FYLA 4ZZLA 4EVIA 3J80Z 3TQNA 5D8LB 5AONA 1DPUA 4ZZDA 3E6CC 3I71A 3FWEA 3GYHX 4A0ZA 4I7HA 1SAXA 2QYOA 1IRFA 2EFPA 5CVVA 2ZBKA 4I02A 1LJ9A 4M9XA 1YW7A 1KGSA 5E8IA 3K1MA 3WGHA 1ZLKA 1H9TA 5E8GA 4RGRA 1KYZA 3GVAA 5LRRA 4UV9A 1XDSA 4U88A 3TOAA 1CGPA 2FMLA 2DU9A 3GFLA 4A6DA 1CF7A 2OZ6A 3FXUA 1FSHA 3GWZA 1D8KA 1O3TA 4H0EA 3RJPA 1NHAA 3GFJA 1W7PA 2DTRA 4A5NA 2A6HF 3V8KA 3L2CA 1BIAA 3GLXA 4KA4A 1D8JA 2QBYB 4UNOA 3I5UA 3T8RA 2XRNA 3JTHA 1CF7B 1HSJA 1YO5C 1USTA 3SZTA 2V1UA 3EUHA 2XUBA 6PAXA 1MJAA 2VE8A 1ZHFA 2OQGA 3F3XA 1H9GA 1ULYA 4MEXF 1J75A 2EK5A 5BPIA 1B9MA 3I59A 4ZYHA 1I1SA 2KKOA 4GO1A 3RPUA 2KJBA 3RI4A 3ML6A 4LLLA 1SMTA 2CYYA 3GEZA 2V6CA 2NYXA 3CO6C 2ZNZA 1V3FA 1K78A 1C0WA 3HTSB 4CYDA 1TTYA 1R5HA 1O3QA 1Y0UA 2W57A 4O5VA 4I2OA 2KRFA 3FX3A 3BPXA 1IUYA 4I98B 3D5LA 4YFKF 5FLXZ 3R0JA 5LGTA 1B4AA 3EQLF 1IZ1A 4HA8A 1EH7A 2DI3A 4JK1X 3WTWC 3MZYA 1DUXC 4XSXF 1K78B 1BI2A 4WXDA 1QO0D 5L3DA 1OKRA 4AWXB 5CYVA 3GZ6A 3TDUC 3TO7A 4ENMA 5HOOA 3DV8A 2RV8A 3REOA 1RZ4A 2DQRA 1U8RA 4BYYA 1FYKA 3KP3A 3WU0A 1SFEA 3EETA 1EH6A 1FSEA 5IT3A 3GW2A 2ZKZA 3ZN0A 4S05A 3V7SA 4KMFA 2HDCA 1IN7A 5FGMA 4OMYA 5D8KB 2VT2A 4BHPA 2YPRA 1X3UA 2PBIA 3NEUA 4M72A 2O03A 2MH2A 2O0YA 3E5QA 2VT3A 4HBLA 1R36A 5DYMA 2NS0A 4CICA 2KIUA 1J9IA 3OOPA 1W4MA 3RTRA 5E17F 1DP7P 1KU2A 2GA1A 3LQQA 4Q5SF 1IXRC 2QZ8A 4LD5A 3KP6A 1TQPA 2PFBA 3BPVA 2ZMEA 5ICCA 5L3CA 2XASA 2VXZA 4HX8A 3KETA 3JW4A 4M6YA 3WTUC 2JPCA 3ABUA 5DCFA 5KK1A 1JE8A 4CZZA 2YR2A 3FXQA 4L5JA 3VFZA 2ZMEB 2PI0A 4WCGA 5FD6A 1J59A 3CTAA 5DCMB 2MC3A 5L3GA 5LEJA 1J2XA 2OQRA 2CGPA 2R7DA 4XSZF 4XBFA 1YQAA 4MQ9F 1RIOH 1QQIA 2A6EF 3KFWX 1QNTA 3DPLC 1IN6A 1LDKB 2Y0MA 5FD5A 1ZRCA 5LBQA 2P7VB 2F5EA 2K4BA 5E1ZB 4ESBA 1MKMA 5D5UB 1W5SA 2YU3A 3U9GA 4EGZA 1L3LA 1MGTA 2COMA 3I0TA 1J5YA 4IF4A 5BQTA 5A2QK 1FY7A 4N9IA 2R3SA 3QU6A 2GXGA 2VODA 1YW8A 1Z91A 4RGSA 4P9UA 3J81K 2G9WA 3E3VA 2A07F 3R0AA 5HLHA 2OZUA 1D5VA 3E97A 3I53A 3LA7A 2ZJ2A 1IXSB 1LNWA 1XB4A 1B6AA 4ESFA 3V8LA 1R00A 4BXUA 3KLOA 4ON0A 2ESHA 4KMUX 3NQOA 1TLHB 5F64A 3HSFA 1U78A 3EYIA 4IRHA 5D5WB 2IT0A 4BH9A 4B09A 3WGIA 4G6QA 2R7FA 3MFKA 1MZBA 1S3JA 1HSTA 4O3MA 4ZYDA 3CDHA 1IN4A 1BN5A 5FFZA 1LDDA 5IT9K 4ENKA 2E1CA 3P9CA 2VBXA 3I64A 4WXCA 3LSTA 2JPBA 2PLYA 4EM2A 3TO9A 3C1DA 3C7JA 4JBAA 4LG0A 2DQLA 3WTYC 2LDUA 4KYWA 1ZG3A 4AVPA 1QBJA 2DBBA 1P6RA 1TW3A 5LHHA 2PEXA 1FBSA 4KUMA 1F1ZA 2W85A 4GCVA 4AD9A 2FEZA 2A5YB 4LG0B 1WKMA 1LQ1A 5ILSA 3IRRA 2ZO4A 1UCRA 4Z2YA 5ICEA 2P5KA 1ZLJA 2PG4A 3WU1B 3CUQC 1TNSA 3HUGA 4TV7A 4K2EA 3PQJA 2M30A 2P7CB 2ESNA 1G3YA 5E1WA 3MZHA 3ZP5A 2XHKA 2RC4A 3JSPA 2JTVA 3QP5A 5H20A 4IRIA 1XDUA 3FXRA 3CJNA 2UXXA 3V8JA 2HTSA 1S8NA 2OBPA 1IRGA 1JGSA 4AIHA 4HX4A 5K5OA 1REPC 2O8XA 5HS9A 4AIKA 2NRAC 4LB6B 2G7UA 3K1NA 4G94A 1JHHA 4ZH4F 1A04A 2K4JA 1KQ8A 2JSCA 4ZYGA 3J80K 2VOPA 5BMZA 1ONVA 2O6GE 1BJAA 1P2FA 4E70A 3ZMZA 1B9NA 2L54A 2XAHA 1IAWA 5ICFA 4GYGA 1Z6RA 2IA0A 4B8XA 5HDNA 3IRQA 5F6FA 3MAJA 2D2WA 2VBYA 2XGXA 3OV8A 1BM9A 4PGHA 3P7NA 1P92A 4IHSA 2L3DA 1LVAA 1FOKA 1ZARA 4ESJA 2ZNYA 3BJAA 1QZZA 2QWWA 1TQIA 3LWFA 1YYVA 1DPRA 5TRDA 5FB2A 1LEAA 2QQAA 5LGNA 3FZVA 4LLNA 2FNPA 4CHUA 2EFNA 4P55A 4G7HF 1XMAA 1O3RA 1R1VA 3U1DA 5J8CA 2MLGA 2HQRA 2RVCA 2XV4S 4FX4A 3FM3A 3GFMA 1JHFA 3QRFF 4RGXA 2IVMA 4BHBA 2W25A 2FF4A 3C3WA 3B73A 3BWGA 5JVTA 4GYIA 3GUDA 2D1VA 5CVIA 3ZMDA 4RS8A 2PN6A 1T38A 5DEQA 1YW9A 1F5TA 1RI7A 3ERED 3DQVC 3SQNA 4GXOA 4L9TA 1QPMA 4L9JA 1EV7A 2IP2A 4HDUA 1XGOA 4CDGA 1MJBA 4AIJA 3ZPLA 5LRSA 1WRJA 3KEOA 3V7CA 1U2WA 1S7OA 5HVQC 3R6SA 3F22A 3MWMA 4OIPF 3QPTA 2HKXA 1STZA 2MH9A 4R1HA 1W7PB 3E6BA 5FLXK 3KE2A 4HX7A 1G4DA 4A6EA 4P96A 2AXLA 1I5ZA 2HWVA 4GGGA 2F5CA 2QUFA 3O2PE 2VC1A 3GXOA 2ISYA 1RUOA 4HDVA 4HF1A 4WWCA 2HS5A 3BY6A 2BEOA 4IHTA 5L3BA 1XSVA 4UV8A 4YIIA 4PCQA 3K2ZA 2K86A 5ERIA 2EV6A 2EA2A 3KP7A 5K5QA 5H6QA 4U7DA 1R23A 3D0SA 1UFMA 1Q1HA 4HLYA 3I59B 4G7ZF 5E20A 2JRTA 2WC2A 3IC7A 3BJ6A 2ZCWA 4Y17A 4ENNA 1U5TA 2LKPA 1SFXA 1Z9CA 1T98A 1E2XA 3BDDA 3QAHA 5D4RA 4KFCA 2IA2A 4N0BA 1S29A 1S7AA 2HGCA 4L0ZB 5EEHA 3DXJF 2EA4A 4YFNF 3R4KA 1U5TB 2FXAA 4LMYA 1XD7A 2P4WA 2KIFA 3IKVA 2XAFA 5HDKA 4O6JA 1ZRFA 1BC8C 2V1XA 4QLCU 4IJAA 1ZG1A 2DW4A 4A0YA 3KP5A 3ZMVA 2PQ8A 1ON1A 1QGPA 2HR3A 3WGGA 5CJ9A 3U2RA 3KEQA 3T0YA 1O57A 2HZTA 2XROA 4ETSA 1I6XA 5TJJA 2UZKA 1KQ0A 1F4KA 4L9NA 3RKWA 1L0OC 2CG4A 3QPHA 2WV0A 1ON2A 4EQQA 2Z33A 3M7GA 2DT5A 1ZGAA 2RNJA 3IL2A 5LLQA 5LGUA 3QU3A 5LHGA 2M8EA 4LJZF 1YS6A 3HSEA 1T2KA 2TDXA 2DPDA 3I58A 3SFZA 2J5OA 3LAPA 2RQPA 4HQMA 1FWZA 1SD5A 1P4AA 4Q4ZF 3HYIA 2WWYA 4CXFA 1ZN2A 4G9YA 3RDIA 4NQWA 3N4MA 3F8CA 1HBXG 3F72A 2Z5UA 3ZQ7A 2K27A 4L18B 3HRUA 2IJLA 1EH8A 4BNCA 4KIFA 3K1PA 5KVRA 4EMSA 3F8MA 4LB5A 4KIBA 2HYFA 2H6BA 2LF8A 2ETHA 2GQQA 3K69A 1BI3A 1D3YA 1IF1A 3KP4A 1XCBA 5DUKA 4KN4X 4EJWA 3ISPA 5AIPA 1SMYF 1OYIA 2HEOA 4A5MA 2CFXA 4UHTA 1R58A 2M5WA 2P5LC 3S2WA 2XAQA 1K7AA 4HF2A 1YIOA 3ZMUA 1TQMA 4MTEA 2QQBA 3BROA 3P9KA 1Z05A 1XMKA 3L7WA 3F23A 1PP8F 3G73A 3H3UA 2O3FA 5K1YA 1O7LA 1IXCA 3WE2A 1YFHA 2HKOA 5H6RA 4EJOA 3KCCA 3HIFA 2FE3A 3BJOA 3GF2A 1USSA 3MEXA 4BAYA 3DKWA 5L3FA 4NHJA 5J6XA 4HW0A 4U7BA 3MQ0A 1IN5A 1BC7C 5CVUA 4MNUA 2OD5A 3O3KA 4WK8F 4HOBA 1LB2A 1U3EM 3RYPA 5D5VB 1HKSA 2EV5A 4HAMA 4MGRA 5EEGA 2CSOA 1FYMA 2QQ9A 3GZ5A 4R79A 1QZYA 4FX0A 3B02A 2GWRA 3HOSA 3WTZA 2EFQA 1OYYA 2DO7A 1GVJA 3IWFA 3F6VA 3DPTA 2Y75A 1DDNA 2BBYA 4XLPF 2C6YA 3WTSC 3P9IA 1XN7A 3HHGA 1KU7A 2FBHA 5AIQA 4HZFA 3WTXC 4CO8A 4YG2F 3WTVC 1ZH5A 1YS7A 2HQNA 4I0AA 1BBYA 2CO5A 1SD4A 5D6EA 3SZPA 5BOXA 1MJ9A 3TKYA 3HHHA 1V4RA 4OU0A 4EJUA 1WWXA 2L4AA 1OR7A 1WQ2A 1R1TA 2FU4A 5D6FA 3F8BA 4OINF 1ZG5A 1OYWA 3C18A 2L4MA 3TOBA 1KYWA 1SD6A 1O3SA 2RGVA 3AAFA 1XSDA 2MLKA 1FP1D 1TNTA 2L01A 3IWZA 3VODA 4N9HA 4A2UA 2IA1A 3ZMSA 1VTNC 2EB7A 2F5FA 4OOIA 3RYRA 1OPCA 2OU2A 2K7LA 4RB1A 2V9VA 2FNAA 3W6KB 2M87A 1T6SA 2CW0F 1AWCA 5DD4A 3ULQB 2FBIA 5E18F 5K5RA 3E5XA 5ICGA 1FT9A 1P4XA 4HV6A 3V7RA 2VOOA 1BI0A 3EYYA 1FZPB 3HRTA 2VC0A 1KQ9A 3FM5A 2IW5A 1FP2A 5D4SA 3CLOA 2B0LA 2D45A 3TDZC 1I1GA 2NNYA 2YSRA 2ZXJA 2H94A 3ECHA 2HYGD 1UHWA 1R5GA 1O7FA 2H27A 1ZREA 3LAJA 3JAMZ 2A69F 4IXAA 4I09A 2V1DA 1HKQA 2Z99A 3VB2A 5HLIA 3FF5A 3DP7A 3CO7C 4IRGA 2ADUA 4EJTA 5LHIA 2Y48A 2H09A 2D1HA 2E1NA 2IRFG 4PDKA 1J7KA 5DUIA 1W7PD 4IVNA 2GZWA 3F8NA 4XLNF 1XGSA 1R22A 5JI6A 2ACJA 2F2EA 3R60A 2PMUA 5JHUA 1ZAOA 4KN7X 1OMIA 2AS5F 2QBYA 3GX4X 5ILVA 5HS8A 1KA8A 3F6OA 4L0YB 4U0VA 4EGYA 1XGNA 2BE5F 1HW1A 3CUQA 4RB2C 4ASNA 2GAUA 4HYEA 4BHCA 4JQFA 2M45A 2P8TA 2HOEA 1ODDA 1AOYA 3PFIA 5CVRA 3QOPA 5DV5A 1B1BA 4WXHA 3FMQA 2EFOA 3ECOA 2RKHA 1XSXA 2EJRA 3RPQA 2EWNA 3CUQB 2LSOA 1Z7UA 4LGWA 3VEPA 2E7XA 4UVBA 3LA2A 4Q48A 1FBQA 4BQAA 3CUOA 2FMYA 4U0WA 3IKTA 2FOKA 3E6DA 2BYVE 1GXQA 5BS6A 2QVOA 4CGZA 5HS7A 1BIBA 4MHGA 4OIQF 4EJVA 3E6MA 2P6TA 4RB3C 1SD7A 5JFRA 4HF0A 5D5XB 3BOQA 2XVCA 4WX9A 2PMHA 2DLLA 3RIRA 5HLGA 2VE9A 1ZYRF 2DFIA 1FNNA 3PQKA 4A0XA 3JSOA 1FX7A 1J0RA 2LNBA 3BP8A 4Y13A 3M8FA 5JR3A 2YX7A 3O6BB 2Z3YA 2FA5A 2X0LA 3H92A 2UXNA 2KJCA 2FSWA 2H6CA 4NB5A 5DD8A 1S6LA 2XKOA 5ED4A 5HDGA 3DF8A 1R1UA 5CLSA 4U0YA 2G7HA 3K9TA 5BPDA 5E1XA 1UHMA 2K02A 1W5TA 2VBWA 3M8EA 3J7AO 2DK5A 3JTGA 5DDGA 4ENJA 2STWA 2QENA 3Q5FA 2A68F 5ILUA 1UB9A 1H0MA 1P4WA 1BOAA 2X4HA 1JXSA 5CVJA 2FRHA 4KICA 2Q0OA 4F7ZA 4DNCA 4KNYA 3HRMA 2IPQX 3K0LA 2P5VA 4OIOF 1T39A 3RKXA 2J5PA 5DCMA 4UVCA 1KU9A 2PJPA 1Z6TA 2W84A 1Z1DA 1IW7F 4HLXA 3HSRA 2XKPA 1R7JA 4L9VA 4FT8A 4R8HA 1IN8A 1ZGJA 2VN2A 2O61A 3L9FA 1FPQA 3KZYA 1HQCA 3F21A 2F5DA 4M71A 5LEKA 3T8TA 1G3WA 3GO5A 3WE3A 3LA3A 2JT1A 3WG9A 3ZN1A 4WF2A 1GXPA 2QLZA 2NNNA 1LEBA 1U6GA 3L00A 5F1RA 1KU3A 1T0FA 2VBZA 2HTJA 1YG2A 1GHCA 4D0PA 3ABTA 4DQ2A 3R61A 3ZMTA 4MTDA 3HRSA 4IPAA 4M73A 1F9NA 2DPUA 4LLGF 2A61A 3M9AA 4KDPA 4OIRF 3KZZA 2YX4A 5FO5A 1G3SA 4UUVA 3HTUA 4I0BA 1HXDA 4L5IA 1FLIA 1PUEE 4XRFA 3FHZA 1FC3A 3SHFA 2MD5A 4Q47A 3N97A 3LQRA 1RUNA 2NAZA 4UXNA 2XAJA 2OA4A 4KT5C 4LK1F 3E5UA 2W24A 2MA3A 4I01A 2BGCA 5A2QZ 4G8XA 2XAGA 2A3SA 3EDPA 3V4GA 4HQEA 3Q9SA 2E7WA 2MBFA 4UVAA 2Z9OA 2HFHA 3J81Z 3HOTA 3DFGA 3WTTC 2ISZA 2GA2A 2FBKA 3KLNA 1WSUA 4Y15A 1MDMA 2EV0A 1K6OA 3LFKA 1TW2A 1PP7U 1FBUA 3M1EA 3SXYA 1G3TA 4RAZA 4HV5A 4EV0A 1E17A 4P5OA 3KP2A 3DEUA 4M9SA 1XCVA 4EM1A 4LK0F 4P9FA 4M9ZA 1MDMB 3TO6A 1MD0A 4YFXF 2CWEA 4YIFA 1I27A 2GIVA 4KIGA 1B59A 4RAYA 5IT9Z 1HW2A 3MCZA 4QWQA 2L02A 3F8FA 2M1BA 2FQ3A 1RNLA 2ZFWA 4RB0A 3NRVA 2BV6A 2WTEA 3Q9VA 2GXBA 4OMZA 4PGGA 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYE A;  1YTY A;  3FMS A;  3BZ6 A;  1TBX A;  2Q2E A;  3W6J B;  3WOD F;  4EM0 B;  3I4P A;  1BI1 A;  2XIG A;  3I54 A;  4MEY F;  4G7O F;  3ELK A;  4LFU A;  1HKT A;  3RKY A;  5J8F A;  2RDP A;  3T1B A;  1PDN C;  5FFX A;  2KIM A;  1ZRD A;  3TGN A;  3GFI A;  3COA C;  2V79 A;  3G3Z A;  3H3Z A;  2P6S A;  1YLF A;  1HW5 A;  4S04 A;  1WI9 A;  3VOE A;  3JAM K;  4PZJ A;  4A12 A;  2JZY A;  4M6X A;  3ROU A;  4MQV A;  1U5T C;  1K79 A;  1LDJ A;  1G6N A;  2LF7 A;  3QP6 A;  2DAO A;  4G6D A;  5L3E A;  4M74 A;  2Q8K A;  2OAZ A;  1XGM A;  2CQK A;  2QM3 A;  2UWM A;  2VON A;  2ELH A;  4FHT A;  2STT A;  3FMR A;  4RGU A;  3IHU A;  1SFU A;  2EFW A;  2RN7 A;  3L09 A;  2DK8 A;  1FYL A;  4ZZL A;  4EVI A;  3J80 Z;  3TQN A;  5D8L B;  5AON A;  1DPU A;  4ZZD A;  3E6C C;  3I71 A;  3FWE A;  3GYH X;  4A0Z A;  4I7H A;  1SAX A;  2QYO A;  1IRF A;  2EFP A;  5CVV A;  2ZBK A;  4I02 A;  1LJ9 A;  4M9X A;  1YW7 A;  1KGS A;  5E8I A;  3K1M A;  3WGH A;  1ZLK A;  1H9T A;  5E8G A;  4RGR A;  1KYZ A;  3GVA A;  5LRR A;  4UV9 A;  1XDS A;  4U88 A;  3TOA A;  1CGP A;  2FML A;  2DU9 A;  3GFL A;  4A6D A;  1CF7 A;  2OZ6 A;  3FXU A;  1FSH A;  3GWZ A;  1D8K A;  1O3T A;  4H0E A;  3RJP A;  1NHA A;  3GFJ A;  1W7P A;  2DTR A;  4A5N A;  2A6H F;  3V8K A;  3L2C A;  1BIA A;  3GLX A;  4KA4 A;  1D8J A;  2QBY B;  4UNO A;  3I5U A;  3T8R A;  2XRN A;  3JTH A;  1CF7 B;  1HSJ A;  1YO5 C;  1UST A;  3SZT A;  2V1U A;  3EUH A;  2XUB A;  6PAX A;  1MJA A;  2VE8 A;  1ZHF A;  2OQG A;  3F3X A;  1H9G A;  1ULY A;  4MEX F;  1J75 A;  2EK5 A;  5BPI A;  1B9M A;  3I59 A;  4ZYH A;  1I1S A;  2KKO A;  4GO1 A;  3RPU A;  2KJB A;  3RI4 A;  3ML6 A;  4LLL A;  1SMT A;  2CYY A;  3GEZ A;  2V6C A;  2NYX A;  3CO6 C;  2ZNZ A;  1V3F A;  1K78 A;  1C0W A;  3HTS B;  4CYD A;  1TTY A;  1R5H A;  1O3Q A;  1Y0U A;  2W57 A;  4O5V A;  4I2O A;  2KRF A;  3FX3 A;  3BPX A;  1IUY A;  4I98 B;  3D5L A;  4YFK F;  5FLX Z;  3R0J A;  5LGT A;  1B4A A;  3EQL F;  1IZ1 A;  4HA8 A;  1EH7 A;  2DI3 A;  4JK1 X;  3WTW C;  3MZY A;  1DUX C;  4XSX F;  1K78 B;  1BI2 A;  4WXD A;  1QO0 D;  5L3D A;  1OKR A;  4AWX B;  5CYV A;  3GZ6 A;  3TDU C;  3TO7 A;  4ENM A;  5HOO A;  3DV8 A;  2RV8 A;  3REO A;  1RZ4 A;  2DQR A;  1U8R A;  4BYY A;  1FYK A;  3KP3 A;  3WU0 A;  1SFE A;  3EET A;  1EH6 A;  1FSE A;  5IT3 A;  3GW2 A;  2ZKZ A;  3ZN0 A;  4S05 A;  3V7S A;  4KMF A;  2HDC A;  1IN7 A;  5FGM A;  4OMY A;  5D8K B;  2VT2 A;  4BHP A;  2YPR A;  1X3U A;  2PBI A;  3NEU A;  4M72 A;  2O03 A;  2MH2 A;  2O0Y A;  3E5Q A;  2VT3 A;  4HBL A;  1R36 A;  5DYM A;  2NS0 A;  4CIC A;  2KIU A;  1J9I A;  3OOP A;  1W4M A;  3RTR A;  5E17 F;  1DP7 P;  1KU2 A;  2GA1 A;  3LQQ A;  4Q5S F;  1IXR C;  2QZ8 A;  4LD5 A;  3KP6 A;  1TQP A;  2PFB A;  3BPV A;  2ZME A;  5ICC A;  5L3C A;  2XAS A;  2VXZ A;  4HX8 A;  3KET A;  3JW4 A;  4M6Y A;  3WTU C;  2JPC A;  3ABU A;  5DCF A;  5KK1 A;  1JE8 A;  4CZZ A;  2YR2 A;  3FXQ A;  4L5J A;  3VFZ A;  2ZME B;  2PI0 A;  4WCG A;  5FD6 A;  1J59 A;  3CTA A;  5DCM B;  2MC3 A;  5L3G A;  5LEJ A;  1J2X A;  2OQR A;  2CGP A;  2R7D A;  4XSZ F;  4XBF A;  1YQA A;  4MQ9 F;  1RIO H;  1QQI A;  2A6E F;  3KFW X;  1QNT A;  3DPL C;  1IN6 A;  1LDK B;  2Y0M A;  5FD5 A;  1ZRC A;  5LBQ A;  2P7V B;  2F5E A;  2K4B A;  5E1Z B;  4ESB A;  1MKM A;  5D5U B;  1W5S A;  2YU3 A;  3U9G A;  4EGZ A;  1L3L A;  1MGT A;  2COM A;  3I0T A;  1J5Y A;  4IF4 A;  5BQT A;  5A2Q K;  1FY7 A;  4N9I A;  2R3S A;  3QU6 A;  2GXG A;  2VOD A;  1YW8 A;  1Z91 A;  4RGS A;  4P9U A;  3J81 K;  2G9W A;  3E3V A;  2A07 F;  3R0A A;  5HLH A;  2OZU A;  1D5V A;  3E97 A;  3I53 A;  3LA7 A;  2ZJ2 A;  1IXS B;  1LNW A;  1XB4 A;  1B6A A;  4ESF A;  3V8L A;  1R00 A;  4BXU A;  3KLO A;  4ON0 A;  2ESH A;  4KMU X;  3NQO A;  1TLH B;  5F64 A;  3HSF A;  1U78 A;  3EYI A;  4IRH A;  5D5W B;  2IT0 A;  4BH9 A;  4B09 A;  3WGI A;  4G6Q A;  2R7F A;  3MFK A;  1MZB A;  1S3J A;  1HST A;  4O3M A;  4ZYD A;  3CDH A;  1IN4 A;  1BN5 A;  5FFZ A;  1LDD A;  5IT9 K;  4ENK A;  2E1C A;  3P9C A;  2VBX A;  3I64 A;  4WXC A;  3LST A;  2JPB A;  2PLY A;  4EM2 A;  3TO9 A;  3C1D A;  3C7J A;  4JBA A;  4LG0 A;  2DQL A;  3WTY C;  2LDU A;  4KYW A;  1ZG3 A;  4AVP A;  1QBJ A;  2DBB A;  1P6R A;  1TW3 A;  5LHH A;  2PEX A;  1FBS A;  4KUM A;  1F1Z A;  2W85 A;  4GCV A;  4AD9 A;  2FEZ A;  2A5Y B;  4LG0 B;  1WKM A;  1LQ1 A;  5ILS A;  3IRR A;  2ZO4 A;  1UCR A;  4Z2Y A;  5ICE A;  2P5K A;  1ZLJ A;  2PG4 A;  3WU1 B;  3CUQ C;  1TNS A;  3HUG A;  4TV7 A;  4K2E A;  3PQJ A;  2M30 A;  2P7C B;  2ESN A;  1G3Y A;  5E1W A;  3MZH A;  3ZP5 A;  2XHK A;  2RC4 A;  3JSP A;  2JTV A;  3QP5 A;  5H20 A;  4IRI A;  1XDU A;  3FXR A;  3CJN A;  2UXX A;  3V8J A;  2HTS A;  1S8N A;  2OBP A;  1IRG A;  1JGS A;  4AIH A;  4HX4 A;  5K5O A;  1REP C;  2O8X A;  5HS9 A;  4AIK A;  2NRA C;  4LB6 B;  2G7U A;  3K1N A;  4G94 A;  1JHH A;  4ZH4 F;  1A04 A;  2K4J A;  1KQ8 A;  2JSC A;  4ZYG A;  3J80 K;  2VOP A;  5BMZ A;  1ONV A;  2O6G E;  1BJA A;  1P2F A;  4E70 A;  3ZMZ A;  1B9N A;  2L54 A;  2XAH A;  1IAW A;  5ICF A;  4GYG A;  1Z6R A;  2IA0 A;  4B8X A;  5HDN A;  3IRQ A;  5F6F A;  3MAJ A;  2D2W A;  2VBY A;  2XGX A;  3OV8 A;  1BM9 A;  4PGH A;  3P7N A;  1P92 A;  4IHS A;  2L3D A;  1LVA A;  1FOK A;  1ZAR A;  4ESJ A;  2ZNY A;  3BJA A;  1QZZ A;  2QWW A;  1TQI A;  3LWF A;  1YYV A;  1DPR A;  5TRD A;  5FB2 A;  1LEA A;  2QQA A;  5LGN A;  3FZV A;  4LLN A;  2FNP A;  4CHU A;  2EFN A;  4P55 A;  4G7H F;  1XMA A;  1O3R A;  1R1V A;  3U1D A;  5J8C A;  2MLG A;  2HQR A;  2RVC A;  2XV4 S;  4FX4 A;  3FM3 A;  3GFM A;  1JHF A;  3QRF F;  4RGX A;  2IVM A;  4BHB A;  2W25 A;  2FF4 A;  3C3W A;  3B73 A;  3BWG A;  5JVT A;  4GYI A;  3GUD A;  2D1V A;  5CVI A;  3ZMD A;  4RS8 A;  2PN6 A;  1T38 A;  5DEQ A;  1YW9 A;  1F5T A;  1RI7 A;  3ERE D;  3DQV C;  3SQN A;  4GXO A;  4L9T A;  1QPM A;  4L9J A;  1EV7 A;  2IP2 A;  4HDU A;  1XGO A;  4CDG A;  1MJB A;  4AIJ A;  3ZPL A;  5LRS A;  1WRJ A;  3KEO A;  3V7C A;  1U2W A;  1S7O A;  5HVQ C;  3R6S A;  3F22 A;  3MWM A;  4OIP F;  3QPT A;  2HKX A;  1STZ A;  2MH9 A;  4R1H A;  1W7P B;  3E6B A;  5FLX K;  3KE2 A;  4HX7 A;  1G4D A;  4A6E A;  4P96 A;  2AXL A;  1I5Z A;  2HWV A;  4GGG A;  2F5C A;  2QUF A;  3O2P E;  2VC1 A;  3GXO A;  2ISY A;  1RUO A;  4HDV A;  4HF1 A;  4WWC A;  2HS5 A;  3BY6 A;  2BEO A;  4IHT A;  5L3B A;  1XSV A;  4UV8 A;  4YII A;  4PCQ A;  3K2Z A;  2K86 A;  5ERI A;  2EV6 A;  2EA2 A;  3KP7 A;  5K5Q A;  5H6Q A;  4U7D A;  1R23 A;  3D0S A;  1UFM A;  1Q1H A;  4HLY A;  3I59 B;  4G7Z F;  5E20 A;  2JRT A;  2WC2 A;  3IC7 A;  3BJ6 A;  2ZCW A;  4Y17 A;  4ENN A;  1U5T A;  2LKP A;  1SFX A;  1Z9C A;  1T98 A;  1E2X A;  3BDD A;  3QAH A;  5D4R A;  4KFC A;  2IA2 A;  4N0B A;  1S29 A;  1S7A A;  2HGC A;  4L0Z B;  5EEH A;  3DXJ F;  2EA4 A;  4YFN F;  3R4K A;  1U5T B;  2FXA A;  4LMY A;  1XD7 A;  2P4W A;  2KIF A;  3IKV A;  2XAF A;  5HDK A;  4O6J A;  1ZRF A;  1BC8 C;  2V1X A;  4QLC U;  4IJA A;  1ZG1 A;  2DW4 A;  4A0Y A;  3KP5 A;  3ZMV A;  2PQ8 A;  1ON1 A;  1QGP A;  2HR3 A;  3WGG A;  5CJ9 A;  3U2R A;  3KEQ A;  3T0Y A;  1O57 A;  2HZT A;  2XRO A;  4ETS A;  1I6X A;  5TJJ A;  2UZK A;  1KQ0 A;  1F4K A;  4L9N A;  3RKW A;  1L0O C;  2CG4 A;  3QPH A;  2WV0 A;  1ON2 A;  4EQQ A;  2Z33 A;  3M7G A;  2DT5 A;  1ZGA A;  2RNJ A;  3IL2 A;  5LLQ A;  5LGU A;  3QU3 A;  5LHG A;  2M8E A;  4LJZ F;  1YS6 A;  3HSE A;  1T2K A;  2TDX A;  2DPD A;  3I58 A;  3SFZ A;  2J5O A;  3LAP A;  2RQP A;  4HQM A;  1FWZ A;  1SD5 A;  1P4A A;  4Q4Z F;  3HYI A;  2WWY A;  4CXF A;  1ZN2 A;  4G9Y A;  3RDI A;  4NQW A;  3N4M A;  3F8C A;  1HBX G;  3F72 A;  2Z5U A;  3ZQ7 A;  2K27 A;  4L18 B;  3HRU A;  2IJL A;  1EH8 A;  4BNC A;  4KIF A;  3K1P A;  5KVR A;  4EMS A;  3F8M A;  4LB5 A;  4KIB A;  2HYF A;  2H6B A;  2LF8 A;  2ETH A;  2GQQ A;  3K69 A;  1BI3 A;  1D3Y A;  1IF1 A;  3KP4 A;  1XCB A;  5DUK A;  4KN4 X;  4EJW A;  3ISP A;  5AIP A;  1SMY F;  1OYI A;  2HEO A;  4A5M A;  2CFX A;  4UHT A;  1R58 A;  2M5W A;  2P5L C;  3S2W A;  2XAQ A;  1K7A A;  4HF2 A;  1YIO A;  3ZMU A;  1TQM A;  4MTE A;  2QQB A;  3BRO A;  3P9K A;  1Z05 A;  1XMK A;  3L7W A;  3F23 A;  1PP8 F;  3G73 A;  3H3U A;  2O3F A;  5K1Y A;  1O7L A;  1IXC A;  3WE2 A;  1YFH A;  2HKO A;  5H6R A;  4EJO A;  3KCC A;  3HIF A;  2FE3 A;  3BJO A;  3GF2 A;  1USS A;  3MEX A;  4BAY A;  3DKW A;  5L3F A;  4NHJ A;  5J6X A;  4HW0 A;  4U7B A;  3MQ0 A;  1IN5 A;  1BC7 C;  5CVU A;  4MNU A;  2OD5 A;  3O3K A;  4WK8 F;  4HOB A;  1LB2 A;  1U3E M;  3RYP A;  5D5V B;  1HKS A;  2EV5 A;  4HAM A;  4MGR A;  5EEG A;  2CSO A;  1FYM A;  2QQ9 A;  3GZ5 A;  4R79 A;  1QZY A;  4FX0 A;  3B02 A;  2GWR A;  3HOS A;  3WTZ A;  2EFQ A;  1OYY A;  2DO7 A;  1GVJ A;  3IWF A;  3F6V A;  3DPT A;  2Y75 A;  1DDN A;  2BBY A;  4XLP F;  2C6Y A;  3WTS C;  3P9I A;  1XN7 A;  3HHG A;  1KU7 A;  2FBH A;  5AIQ A;  4HZF A;  3WTX C;  4CO8 A;  4YG2 F;  3WTV C;  1ZH5 A;  1YS7 A;  2HQN A;  4I0A A;  1BBY A;  2CO5 A;  1SD4 A;  5D6E A;  3SZP A;  5BOX A;  1MJ9 A;  3TKY A;  3HHH A;  1V4R A;  4OU0 A;  4EJU A;  1WWX A;  2L4A A;  1OR7 A;  1WQ2 A;  1R1T A;  2FU4 A;  5D6F A;  3F8B A;  4OIN F;  1ZG5 A;  1OYW A;  3C18 A;  2L4M A;  3TOB A;  1KYW A;  1SD6 A;  1O3S A;  2RGV A;  3AAF A;  1XSD A;  2MLK A;  1FP1 D;  1TNT A;  2L01 A;  3IWZ A;  3VOD A;  4N9H A;  4A2U A;  2IA1 A;  3ZMS A;  1VTN C;  2EB7 A;  2F5F A;  4OOI A;  3RYR A;  1OPC A;  2OU2 A;  2K7L A;  4RB1 A;  2V9V A;  2FNA A;  3W6K B;  2M87 A;  1T6S A;  2CW0 F;  1AWC A;  5DD4 A;  3ULQ B;  2FBI A;  5E18 F;  5K5R A;  3E5X A;  5ICG A;  1FT9 A;  1P4X A;  4HV6 A;  3V7R A;  2VOO A;  1BI0 A;  3EYY A;  1FZP B;  3HRT A;  2VC0 A;  1KQ9 A;  3FM5 A;  2IW5 A;  1FP2 A;  5D4S A;  3CLO A;  2B0L A;  2D45 A;  3TDZ C;  1I1G A;  2NNY A;  2YSR A;  2ZXJ A;  2H94 A;  3ECH A;  2HYG D;  1UHW A;  1R5G A;  1O7F A;  2H27 A;  1ZRE A;  3LAJ A;  3JAM Z;  2A69 F;  4IXA A;  4I09 A;  2V1D A;  1HKQ A;  2Z99 A;  3VB2 A;  5HLI A;  3FF5 A;  3DP7 A;  3CO7 C;  4IRG A;  2ADU A;  4EJT A;  5LHI A;  2Y48 A;  2H09 A;  2D1H A;  2E1N A;  2IRF G;  4PDK A;  1J7K A;  5DUI A;  1W7P D;  4IVN A;  2GZW A;  3F8N A;  4XLN F;  1XGS A;  1R22 A;  5JI6 A;  2ACJ A;  2F2E A;  3R60 A;  2PMU A;  5JHU A;  1ZAO A;  4KN7 X;  1OMI A;  2AS5 F;  2QBY A;  3GX4 X;  5ILV A;  5HS8 A;  1KA8 A;  3F6O A;  4L0Y B;  4U0V A;  4EGY A;  1XGN A;  2BE5 F;  1HW1 A;  3CUQ A;  4RB2 C;  4ASN A;  2GAU A;  4HYE A;  4BHC A;  4JQF A;  2M45 A;  2P8T A;  2HOE A;  1ODD A;  1AOY A;  3PFI A;  5CVR A;  3QOP A;  5DV5 A;  1B1B A;  4WXH A;  3FMQ A;  2EFO A;  3ECO A;  2RKH A;  1XSX A;  2EJR A;  3RPQ A;  2EWN A;  3CUQ B;  2LSO A;  1Z7U A;  4LGW A;  3VEP A;  2E7X A;  4UVB A;  3LA2 A;  4Q48 A;  1FBQ A;  4BQA A;  3CUO A;  2FMY A;  4U0W A;  3IKT A;  2FOK A;  3E6D A;  2BYV E;  1GXQ A;  5BS6 A;  2QVO A;  4CGZ A;  5HS7 A;  1BIB A;  4MHG A;  4OIQ F;  4EJV A;  3E6M A;  2P6T A;  4RB3 C;  1SD7 A;  5JFR A;  4HF0 A;  5D5X B;  3BOQ A;  2XVC A;  4WX9 A;  2PMH A;  2DLL A;  3RIR A;  5HLG A;  2VE9 A;  1ZYR F;  2DFI A;  1FNN A;  3PQK A;  4A0X A;  3JSO A;  1FX7 A;  1J0R A;  2LNB A;  3BP8 A;  4Y13 A;  3M8F A;  5JR3 A;  2YX7 A;  3O6B B;  2Z3Y A;  2FA5 A;  2X0L A;  3H92 A;  2UXN A;  2KJC A;  2FSW A;  2H6C A;  4NB5 A;  5DD8 A;  1S6L A;  2XKO A;  5ED4 A;  5HDG A;  3DF8 A;  1R1U A;  5CLS A;  4U0Y A;  2G7H A;  3K9T A;  5BPD A;  5E1X A;  1UHM A;  2K02 A;  1W5T A;  2VBW A;  3M8E A;  3J7A O;  2DK5 A;  3JTG A;  5DDG A;  4ENJ A;  2STW A;  2QEN A;  3Q5F A;  2A68 F;  5ILU A;  1UB9 A;  1H0M A;  1P4W A;  1BOA A;  2X4H A;  1JXS A;  5CVJ A;  2FRH A;  4KIC A;  2Q0O A;  4F7Z A;  4DNC A;  4KNY A;  3HRM A;  2IPQ X;  3K0L A;  2P5V A;  4OIO F;  1T39 A;  3RKX A;  2J5P A;  5DCM A;  4UVC A;  1KU9 A;  2PJP A;  1Z6T A;  2W84 A;  1Z1D A;  1IW7 F;  4HLX A;  3HSR A;  2XKP A;  1R7J A;  4L9V A;  4FT8 A;  4R8H A;  1IN8 A;  1ZGJ A;  2VN2 A;  2O61 A;  3L9F A;  1FPQ A;  3KZY A;  1HQC A;  3F21 A;  2F5D A;  4M71 A;  5LEK A;  3T8T A;  1G3W A;  3GO5 A;  3WE3 A;  3LA3 A;  2JT1 A;  3WG9 A;  3ZN1 A;  4WF2 A;  1GXP A;  2QLZ A;  2NNN A;  1LEB A;  1U6G A;  3L00 A;  5F1R A;  1KU3 A;  1T0F A;  2VBZ A;  2HTJ A;  1YG2 A;  1GHC A;  4D0P A;  3ABT A;  4DQ2 A;  3R61 A;  3ZMT A;  4MTD A;  3HRS A;  4IPA A;  4M73 A;  1F9N A;  2DPU A;  4LLG F;  2A61 A;  3M9A A;  4KDP A;  4OIR F;  3KZZ A;  2YX4 A;  5FO5 A;  1G3S A;  4UUV A;  3HTU A;  4I0B A;  1HXD A;  4L5I A;  1FLI A;  1PUE E;  4XRF A;  3FHZ A;  1FC3 A;  3SHF A;  2MD5 A;  4Q47 A;  3N97 A;  3LQR A;  1RUN A;  2NAZ A;  4UXN A;  2XAJ A;  2OA4 A;  4KT5 C;  4LK1 F;  3E5U A;  2W24 A;  2MA3 A;  4I01 A;  2BGC A;  5A2Q Z;  4G8X A;  2XAG A;  2A3S A;  3EDP A;  3V4G A;  4HQE A;  3Q9S A;  2E7W A;  2MBF A;  4UVA A;  2Z9O A;  2HFH A;  3J81 Z;  3HOT A;  3DFG A;  3WTT C;  2ISZ A;  2GA2 A;  2FBK A;  3KLN A;  1WSU A;  4Y15 A;  1MDM A;  2EV0 A;  1K6O A;  3LFK A;  1TW2 A;  1PP7 U;  1FBU A;  3M1E A;  3SXY A;  1G3T A;  4RAZ A;  4HV5 A;  4EV0 A;  1E17 A;  4P5O A;  3KP2 A;  3DEU A;  4M9S A;  1XCV A;  4EM1 A;  4LK0 F;  4P9F A;  4M9Z A;  1MDM B;  3TO6 A;  1MD0 A;  4YFX F;  2CWE A;  4YIF A;  1I27 A;  2GIV A;  4KIG A;  1B59 A;  4RAY A;  5IT9 Z;  1HW2 A;  3MCZ A;  4QWQ A;  2L02 A;  3F8F A;  2M1B A;  2FQ3 A;  1RNL A;  2ZFW A;  4RB0 A;  3NRV A;  2BV6 A;  2WTE A;  3Q9V A;  2GXB A;  4OMZ A;  4PGG A;  3T5X A; 
#chains in the Genus database with same CATH topology
 4A69 C;  4ZYE A;  1YTY A;  2BVL A;  4XIC A;  2M7A A;  1FOW A;  3FMS A;  3BZ6 A;  1QRY A;  4MIM A;  2ID6 A;  1TBX A;  2Q2E A;  3W6J B;  1MBF A;  3WOD F;  4EM0 B;  3I4P A;  3LSI A;  1BI1 A;  1UZC A;  2XIG A;  3I54 A;  4MEY F;  4G7O F;  4BXF A;  1FTZ A;  2VPR A;  1Z21 A;  3ELK A;  3JRF A;  4LFU A;  1HKT A;  3RKY A;  1OCO H;  3BG3 A;  2RDP A;  3CZ6 A;  5CKT A;  5J8F A;  4QSH A;  3ZR8 X;  3L1P A;  3T1B A;  2R7U A;  1IDY A;  1PDN C;  3HC7 A;  5FFX A;  2KIM A;  1ZRD A;  3TGN A;  3W2W A;  3GFI A;  1XPX A;  5KNL A;  2XGC A;  3COA C;  2V79 A;  2Q2E B;  3G3Z A;  3H3Z A;  1UAA A;  1E3O C;  2P6S A;  2M34 A;  1YLF A;  1HW5 A;  2R7W A;  4S04 A;  1WI9 A;  3VOE A;  3JAM K;  4PZJ A;  3BTC A;  4A12 A;  1T56 A;  2JZY A;  4M6X A;  3ROU A;  3HOW J;  3K4K A;  3H1C A;  4LG3 A;  4MQV A;  1U5T C;  4JOM A;  1ETY A;  1K79 A;  4C3H J;  1LDJ A;  1G6N A;  2NS7 A;  2LF7 A;  4CCL A;  2XRL A;  1TC3 C;  3QP6 A;  2DAO A;  2WAD A;  4G6D A;  5L3E A;  4M74 A;  2Q8K A;  3A1Y A;  2OAZ A;  1XGM A;  3BG5 A;  1K4T A;  2CQK A;  4E7K A;  3JRE A;  4BJ6 C;  2QM3 A;  2DOD A;  2UWM A;  2X48 A;  3A4C A;  2VON A;  2ELH A;  4FHT A;  3LMM A;  3CES A;  2STT A;  3FMR A;  3L2R A;  1ENH A;  4RGU A;  1VQM I;  4LIU A;  1PJR A;  3IHU A;  4UUS B;  1SFU A;  2EFW A;  3S8P A;  2M0C A;  2XB0 X;  2RN7 A;  3QYF A;  3L09 A;  3C2B A;  2DK8 A;  1LFP A;  1FYL A;  3RCO A;  2I10 A;  4ZZL A;  4EVI A;  3ZXS A;  3J80 Z;  2CQ7 A;  3TQN A;  5D8L B;  5AON A;  1DPU A;  4UB8 C;  3IAS 2;  4ZZD A;  3I71 A;  3HZJ A;  3P5J A;  3E6C C;  5IOY A;  2VI6 A;  4LIV A;  1Z67 A;  3C2H A;  3FWE A;  1Y0N A;  3OIP A;  4II2 A;  5FKN A;  3GYH X;  3RKQ A;  2VQC A;  1QU3 A;  4A0Z A;  3G1M A;  4I7H A;  4A3L J;  1SAX A;  2QYO A;  1IRF A;  2EFP A;  5CVV A;  2ZBK A;  4I02 A;  1LJ9 A;  4M9X A;  1YW7 A;  1KGS A;  5E8I A;  4DYR A;  3K1M A;  3WGH A;  1ZLK A;  1H9T A;  2IGO A;  5E8G A;  3VYS B;  1ITY A;  1M1E B;  3FIS A;  4RGR A;  2TRT A;  1KYZ A;  3GVA A;  1LVK A;  3ZQH A;  5LRR A;  4UV9 A;  1A5J A;  1HLV A;  1XDS A;  2R7Q A;  4U88 A;  3TOA A;  4XOP A;  5EGO A;  2FX0 A;  1CGP A;  3LSH A;  4XLF A;  5FLM J;  3OYL A;  2FML A;  3DKX A;  1X58 A;  2FD5 A;  1IV8 A;  2DU9 A;  2VKE A;  4HST A;  3GFL A;  2JK3 A;  2BY1 A;  4A6D A;  1CF7 A;  3H35 A;  4KT6 A;  1DGR M;  2OZ6 A;  3FXU A;  1FSH A;  3ZQL A;  2DA1 A;  3GWZ A;  1DGW Y;  1D8K A;  1O3T A;  4C9Y A;  4D9J A;  4H0E A;  3IH4 A;  4IKF A;  3OY9 A;  3RJP A;  1NHA A;  3GFJ A;  4EAT A;  2MC4 A;  1W7P A;  3G1L A;  2LP0 A;  4XLE A;  2DTR A;  4A5N A;  2A6H F;  1T33 A;  3V8K A;  5M5X J;  3L2C A;  1BIA A;  4B47 A;  3GLX A;  4KA4 A;  4AID A;  1R4N B;  1D8J A;  1JT6 A;  4D5C A;  2QBY B;  4UNO A;  1JJ8 C;  1X4O A;  3I5U A;  3T8R A;  2QEX I;  2XRN A;  3LSR A;  5EYR A;  3JTH A;  4IL6 C;  1CF7 B;  1HSJ A;  2HI3 A;  3FXJ A;  1YO5 C;  3A0H C;  3OYD A;  1UST A;  1K61 A;  5GAG J;  3SZT A;  3H5N A;  4XQF A;  2JN6 A;  2V1U A;  3EUH A;  2XUB A;  5E79 C;  1BL0 A;  6PAX A;  3FKI J;  1JGG A;  2OTJ I;  1MJA A;  2VE8 A;  1ZHF A;  3A03 A;  2OQG A;  3F3X A;  4ZTF A;  1H9G A;  1ULY A;  4KJZ A;  3NWS A;  3QOE A;  4MEX F;  1J75 A;  2EK5 A;  5BPI A;  1B9M A;  3K4J A;  3I59 A;  4ZYH A;  3K4M A;  4A3G J;  1I1S A;  1HDD C;  2KKO A;  1LFU P;  2X1C A;  3S2D J;  5CQE A;  3OWT A;  4GO1 A;  3RPU A;  2KJB A;  3PNT A;  1W1W E;  3RI4 A;  3ML6 A;  2CQQ A;  4LLL A;  2LBF A;  1IV6 A;  1EJ9 A;  1SMT A;  2CYY A;  3GEZ A;  2CFO A;  3LSK A;  4PFP A;  2V6C A;  2NYX A;  3EPZ A;  3CO6 C;  4M6V A;  2ZNZ A;  1V3F A;  1K78 A;  1C0W A;  2QA4 I;  3HTS B;  4CYD A;  4X1E A;  1TTY A;  1R5H A;  1O3Q A;  1Y0U A;  2W57 A;  4O5V A;  4I2O A;  2KRF A;  3FX3 A;  1LE8 A;  1W36 C;  2R0Q C;  4BKX A;  3BPX A;  1IUY A;  2KPM A;  4I98 B;  4DZP A;  3D5L A;  4YFK F;  5FLX Z;  3R0J A;  5LGT A;  1B4A A;  3EQL F;  2KZG A;  3ABM H;  1FMW A;  2IS6 A;  1IZ1 A;  4HA8 A;  1SVM A;  1EH7 A;  2DI3 A;  4XMY A;  2LBF B;  4JK1 X;  3WTW C;  2VIX A;  3MZY A;  1DUX C;  4XSX F;  4IQJ A;  3FIW A;  3I56 I;  1K78 B;  1MNE A;  3PM1 A;  1IDZ A;  3VYT B;  1BI2 A;  4KIS A;  1RR7 A;  4WXD A;  1QO0 D;  5L3D A;  1OKR A;  1LE8 B;  4AWX B;  3MKZ A;  3M4O J;  5CYV A;  3GLL A;  1QHG A;  3GZ6 A;  1VND A;  3I9V 2;  2RAE A;  3S3O A;  3TDU C;  1DQU A;  3TO7 A;  3H36 A;  3QOD A;  4ENM A;  3Q0U A;  5HOO A;  4BE0 A;  3DV8 A;  2RV8 A;  2E36 A;  3REO A;  1RZ4 A;  1BR2 A;  1X1P A;  1Y1V J;  2DQR A;  1JT0 A;  1U8R A;  4XN0 A;  4BYY A;  1FYK A;  2NVY J;  3KP3 A;  3WU0 A;  1SFE A;  3EET A;  1EH6 A;  3OYK A;  3TL4 X;  1FSE A;  3VYU B;  5IT3 A;  2KHM A;  3BQY A;  4XRS A;  1RKT A;  3GW2 A;  2GBY A;  2LG4 A;  3K4B A;  2ZKZ A;  2GIZ A;  3TP0 A;  1S5L C;  2X6X A;  3ZN0 A;  3AL0 B;  5EF6 A;  4S05 A;  2M9H A;  4HPQ A;  3V7S A;  2OV7 A;  4KMF A;  2HDC A;  1H8A C;  1WGX A;  1IN7 A;  5FGM A;  4OMY A;  2MW8 A;  4Y33 A;  5D8K B;  2VT2 A;  3HM5 A;  4BHP A;  2YPR A;  3AG1 H;  5FKL A;  2X85 A;  2EZH A;  2A05 A;  2H1K A;  5F08 A;  1X3U A;  1Y8R B;  3O8H A;  2K3F A;  2PBI A;  3NEU A;  4M72 A;  2O03 A;  2MH2 A;  3G6E I;  1MBH A;  5DTD A;  2O0Y A;  3E5Q A;  1D0X A;  4DIQ A;  2KFD A;  3HGY A;  3MKY B;  2VT3 A;  4HBL A;  1R36 A;  5DYM A;  3BG9 A;  4A3E J;  2NS0 A;  4CIC A;  4E7S A;  2TCT A;  2KIU A;  2WAQ N;  2F6C A;  4V2G A;  2KT0 A;  5E3L A;  1J9I A;  3BR2 A;  3OOP A;  3M3Y J;  1W4M A;  3RTR A;  5E17 F;  3VYR B;  2NOG A;  1DP7 P;  1JUM A;  1KU2 A;  2GA1 A;  3LQQ A;  4Q5S F;  2DCE A;  2K9N A;  2WY8 Q;  1IXR C;  2QZ8 A;  1X1B A;  4LD5 A;  2L7K A;  3KP6 A;  4DOZ A;  1TQP A;  5J3L A;  2PFB A;  1NG6 A;  1I3Q J;  3BPV A;  2ZME A;  5ICC A;  2KQR A;  2XPW A;  4LOC A;  5L3C A;  2XAS A;  1WH5 A;  2VXZ A;  4HX8 A;  3KET A;  3ZOB A;  4B3X A;  3JW4 A;  4XOR A;  1IO2 A;  3CMA I;  4M6Y A;  3WTU C;  2JPC A;  3ASO H;  3ABU A;  5DCF A;  4D7M A;  5KK1 A;  3DPU A;  1JE8 A;  2O8K A;  1OCP A;  3OOU A;  1MND A;  5CQG A;  2BW3 B;  4CZZ A;  3HDD A;  2Y30 A;  4RM3 A;  2HU9 A;  2V1N A;  2NVT J;  2YR2 A;  2K5C A;  5GAD J;  3FXQ A;  3PFY A;  2CUF A;  4L5J A;  2W00 A;  3VFZ A;  2ZME B;  4IHW A;  2PI0 A;  4WCG A;  5FD6 A;  3L2Q A;  1J59 A;  3CTA A;  5DCM B;  2MC3 A;  5L3G A;  4CH7 A;  5LEJ A;  1VI0 A;  1J2X A;  2OQR A;  2CGP A;  1VQ7 I;  2R7D A;  3MVP A;  4XSZ F;  4XBF A;  1YQA A;  4MQ9 F;  4ZDP A;  1D5Y A;  3NWT A;  1RIO H;  1QQI A;  2A6E F;  4YIR X;  3KFW X;  4JP0 A;  1QNT A;  5F0C A;  5J1U A;  5KAI C;  4BXX J;  1TWG J;  2E1O A;  3DPL C;  4QIW N;  1IN6 A;  2ZJR F;  4FAS D;  4RLF A;  2P0W A;  3DU6 A;  3DBL B;  4BBS J;  4XKV A;  1LDK B;  3RZD J;  2Y0M A;  2VQH A;  5EG0 A;  5FD5 A;  1ZRC A;  4BY1 J;  2DYS H;  2P81 A;  4BE2 A;  5LBQ A;  5DM6 F;  2P7V B;  3VWB A;  2F5E A;  1MH3 A;  3GTK J;  1K6Y A;  2K4B A;  5E1Z B;  4ESB A;  2DOF A;  5IP6 A;  2OPT A;  1MKM A;  5D5U B;  1W5S A;  2YU3 A;  1UMQ A;  3U9G A;  4N4O B;  1FJL A;  4EGZ A;  4AYB A;  2FOW A;  1L3L A;  1MGT A;  3BR3 A;  3HEF A;  2COM A;  3I0T A;  1K4S A;  4ZTJ A;  1J5Y A;  4IF4 A;  5BQT A;  5A2Q K;  2V9P A;  3CC4 I;  5GAE J;  1FY7 A;  5EDN A;  3OS1 A;  4N9I A;  2E34 A;  4A3M J;  3ESW B;  4DW6 A;  5DS9 A;  2E2I J;  2R3S A;  3IP4 B;  3QU6 A;  2GXG A;  2DA3 A;  1TT5 B;  3G2B A;  4F52 A;  2CW8 A;  1SVL A;  2VOD A;  1YW8 A;  1Z91 A;  2Z16 A;  1FIA A;  4RGS A;  2QSF X;  1LUJ B;  4P9U A;  3J81 K;  4IO9 F;  4IOA F;  2G9W A;  3E3V A;  2A07 F;  1U0J A;  3R0A A;  5HNF A;  2JVG A;  3ERM A;  3RQ4 A;  1UHS A;  5HLH A;  2DTZ A;  4OAZ A;  2OZU A;  4M3G A;  1D5V A;  3E97 A;  3I53 A;  1QVT A;  3LA7 A;  4UY8 I;  1W5C C;  4CYC A;  3HOZ J;  2KMU A;  3BTI A;  2H8R A;  2ZJ2 A;  1IXS B;  1MMA A;  2EIL H;  1LNW A;  2JUG A;  2YU9 J;  1XB4 A;  1B6A A;  2VUM J;  2Z2S B;  2FJ1 A;  1APL C;  4ESF A;  3V8L A;  3CDL A;  3ABK H;  1R00 A;  4BXU A;  3KLO A;  4ON0 A;  2JA2 A;  1JKO C;  2ESH A;  4BBR J;  4KMU X;  2FUG 2;  4W1U A;  2M4K A;  3DTI A;  3NQO A;  1TLH B;  5F64 A;  3HSF A;  2E35 A;  2M2E A;  1U78 A;  1WJ5 A;  4IRH A;  4RMN A;  5D5W B;  3EYI A;  2IT0 A;  1A31 A;  4BH9 A;  4B09 A;  3WGI A;  4G6Q A;  2R7F A;  4NUB A;  2H8W A;  3MFK A;  1MZB A;  2VLA A;  1S3J A;  1F36 A;  1HST A;  4O3M A;  4ZYD A;  3ZQC A;  3CCL I;  1YIT I;  3CDH A;  1VQ6 I;  1IN4 A;  1BN5 A;  2R7R A;  5FFZ A;  1LDD A;  2VAS A;  4IHV A;  5IT9 K;  4ENK A;  2E1C A;  3P9C A;  2VBX A;  1YOV B;  3I64 A;  4WXC A;  3LST A;  2JPB A;  2PLY A;  4EM2 A;  4HNT A;  3TO9 A;  4F55 A;  2JQ7 A;  3C1D A;  2M8G X;  1OQY A;  3C7J A;  4JBA A;  3HG9 A;  1GDT A;  2ZFU A;  4LG0 A;  2XDV A;  2JUC A;  3UR3 C;  2DQL A;  5JLX A;  1HA8 A;  2GM4 A;  3WTY C;  1GLN A;  1FEX A;  2XC7 A;  5FLV A;  2LDU A;  3LSM A;  2K9Q A;  1YJW I;  4KYW A;  1ZG3 A;  4AVP A;  1QBJ A;  2DBB A;  3CC2 I;  1A35 A;  1P6R A;  1TW3 A;  3VPR A;  5LHH A;  1BA5 A;  2GLO A;  2PEX A;  1FBS A;  2DMP A;  4KUM A;  3CF5 F;  3BT9 A;  1F1Z A;  2W85 A;  2K85 A;  4GCV A;  1DU0 A;  4BQQ A;  4AD9 A;  3BG7 A;  2FEZ A;  2NXN B;  2A5Y B;  4LG0 B;  1WKM A;  1LQ1 A;  4B4C A;  2EZK A;  5JHF A;  5ILS A;  3HOY J;  3IRR A;  3I4N J;  2ZO4 A;  2Y0S N;  1UCR A;  4Z2Y A;  5ICE A;  2X6W A;  2P5K A;  1ZLJ A;  2PG4 A;  3WU1 B;  1Z0X A;  3CUQ C;  1TNS A;  3CF2 A;  3HUG A;  4TV7 A;  4K2E A;  3PQJ A;  4PSX A;  2M30 A;  5EZH A;  2P7C B;  4BDY A;  1BW6 A;  2AQE A;  2LH9 A;  2ESN A;  1D1B A;  2ZC2 A;  1MBG A;  2CMP A;  1G3Y A;  5E1W A;  1QVU A;  1NK2 P;  1JTX A;  3MZH A;  3ZP5 A;  4AM3 A;  2XHK A;  2RC4 A;  1SFK A;  4Y3O A;  3JSP A;  1JTY A;  2JTV A;  3QP5 A;  2ZJQ F;  4F93 B;  2WA0 A;  1ETV A;  5H20 A;  2BY3 A;  4IRI A;  1XDU A;  4D5F A;  3FXR A;  3CJN A;  1POG A;  2UXX A;  3CC7 I;  4E7H A;  3V8J A;  2HTS A;  1O4X A;  3KYD B;  1S8N A;  1W0T A;  2OBP A;  3DBH B;  1IRG A;  1JGS A;  1QZE A;  3CCV I;  4AIH A;  4MO7 A;  1ZTR A;  4HX4 A;  2E1M B;  1F43 A;  2L0K A;  5K5O A;  1REP C;  2LKS A;  3E0J B;  5KHD A;  1MH4 A;  2O8X A;  5HS9 A;  5K7H A;  4AIK A;  2NRA C;  4LB6 B;  2G7U A;  3V42 A;  3K1N A;  1B8I A;  4G94 A;  1IUF A;  5M5W J;  3H3V K;  4JX6 A;  1JHH A;  4ZH4 F;  1A04 A;  2HZD A;  3OYJ A;  2K4J A;  2DA7 A;  3SEQ A;  1KQ8 A;  2JSC A;  3W6V A;  4ZYG A;  1P7I A;  1V5E A;  3J80 K;  1Z3X A;  3BR6 A;  3DTK A;  4XKB A;  5BMZ A;  2HVR A;  2VOP A;  3IAM 2;  2QQ8 A;  1ONV A;  2O6G E;  3LSJ A;  2NOJ B;  1P9Q C;  1X1C A;  3RZO J;  1BJA A;  2Q1Z B;  1P2F A;  4E70 A;  2DMQ A;  3ZMZ A;  1B9N A;  2XSJ C;  4PJM A;  2HQ5 A;  2L54 A;  2HOT A;  2XAH A;  2F4M B;  1IAW A;  5ICF A;  1B8I B;  3DLA A;  4GYG A;  1Z6R A;  3OS2 A;  2IA0 A;  2JA7 J;  1QHH D;  4ZC3 A;  4B8X A;  4F92 B;  5HDN A;  2CU7 A;  4X0G A;  3IRQ A;  3PSI A;  5F6F A;  3MAJ A;  2D2W A;  3W3C A;  2VBY A;  2XGX A;  3SJM A;  3OV8 A;  1BM9 A;  2UUZ A;  4PGH A;  3P7N A;  1P92 A;  3I4M J;  1KZH A;  5K7F A;  1Z3Y A;  4IHS A;  2L3D A;  3HKZ A;  1LVA A;  4QTR A;  1MMS A;  2IS1 A;  1FOK A;  1ZAR A;  3IH3 A;  4ESJ A;  2ZNY A;  3BJA A;  1QZZ A;  2QWW A;  1TQI A;  3HXL A;  1YYV A;  3LWF A;  1DPR A;  5TRD A;  5FB2 A;  1LEA A;  2EIM H;  4AVZ A;  2QQA A;  5LGN A;  3FZV A;  3A01 A;  4LLN A;  4BU2 A;  1JJ6 C;  2ELK A;  4E7J A;  2FNP A;  2X6Y A;  2L9R A;  3ONQ A;  4BJT A;  4CHU A;  2EFN A;  4I76 A;  4P55 A;  1XMA A;  4DBQ A;  4G7H F;  1O3R A;  1R1V A;  3J7A Y;  3U1D A;  5J8C A;  2MLG A;  2HQR A;  2RVC A;  3S2H J;  2XV4 S;  1JI8 A;  4FX4 A;  1ERD A;  3FM3 A;  2LRD A;  3GFM A;  2F4I A;  2H1L A;  1JHF A;  3Q0V A;  3QRF F;  4RGX A;  2IVM A;  4BHB A;  3X2Q H;  3DWL E;  5J1R A;  3OMY A;  4ITV A;  2DFH A;  2FF4 A;  2W25 A;  4PUS A;  3C3W A;  3B73 A;  3BR1 A;  3BWG A;  5JVT A;  1X2N A;  4GYI A;  1AKH A;  3QPS A;  1RES A;  3GUD A;  1T08 B;  1R49 A;  1VF9 A;  3BG6 A;  3A01 B;  2DA2 A;  4BAC A;  2DDB A;  2D1V A;  5CVI A;  3ZMD A;  1JKP C;  4RS8 A;  2PN6 A;  1T38 A;  5DEQ A;  3S93 A;  4XLA A;  1YW9 A;  1F5T A;  1RI7 A;  3ERE D;  2CUE A;  1PVE A;  1R5I D;  3DQV C;  2RNG A;  3ZCO A;  3SQN A;  2AQF A;  5C4X J;  4PJJ A;  2DA4 A;  4GXO A;  4L9T A;  1QPM A;  4L9J A;  1AKH B;  1EV7 A;  4II3 A;  2VL8 A;  2IP2 A;  4HDU A;  3EUK L;  3MZ8 A;  3BCB A;  1VQO I;  1XGO A;  1XMX A;  4CDG A;  1MJB A;  4AIJ A;  1SEU A;  3ZPL A;  5LRS A;  2CV2 A;  4RA2 A;  2VKV A;  1WRJ A;  3KEO A;  4J00 A;  3FXK A;  3V7C A;  1U2W A;  5EGO B;  1S7O A;  3G4S I;  4A3K J;  1R4M B;  3CP8 A;  5HVQ C;  5C3E J;  3D1N I;  1VQ9 I;  1IJW C;  3R6S A;  2PMZ N;  1WJE A;  3F22 A;  3MWM A;  4OIP F;  5F1J A;  2ME0 A;  2NVU B;  4RM2 A;  1BR4 A;  3QPT A;  1NTC A;  2HKX A;  2O9L A;  2QGU A;  3RPU D;  1STZ A;  1TL8 A;  3OYA A;  4IQ4 A;  2MH9 A;  1YX3 A;  3PJR A;  2LK2 A;  1W7P B;  3E6B A;  1MMD A;  4R1H A;  1VZ0 A;  5FLX K;  3KE2 A;  2FQ4 A;  4HX7 A;  3DBR B;  1G4D A;  4AU7 A;  2ZB9 A;  2CS3 A;  4M3E A;  1E3P A;  3U21 A;  4A6E A;  3B6C A;  4P96 A;  2AXL A;  1I5Z A;  2IGN A;  2HWV A;  2XF6 A;  2F5C A;  2QUF A;  3O2P E;  4GGG A;  2VC1 A;  1NG7 A;  3ZGK A;  3JRC A;  3GXO A;  4XLC A;  2ISY A;  1RUO A;  4HDV A;  5EJC A;  4AC0 A;  4HF1 A;  4WWC A;  1MSE C;  2HS5 A;  3BY6 A;  2BEO A;  4CSW A;  3CQZ J;  4IHT A;  5L3B A;  2R7X A;  1XSV A;  4UV8 A;  2QSG X;  4YII A;  4NC7 A;  3HGG A;  4PCQ A;  3S14 J;  3K2Z A;  2K86 A;  5ERI A;  4XM3 A;  2EV6 A;  2EA2 A;  3PNV A;  3KP7 A;  5K5Q A;  5H6Q A;  4U7D A;  4E4H A;  4MLO A;  1S72 I;  1BW5 A;  3K70 D;  1R23 A;  4IEJ A;  1G59 A;  4I99 C;  3K4L A;  1YJ9 I;  2QKL B;  3D0S A;  1UFM A;  3AFH A;  1Q1H A;  2X9D A;  2KDZ A;  4HLY A;  1HDP A;  3I59 B;  5E20 A;  4G7Z F;  2HDD A;  2JRT A;  2WC2 A;  3IC7 A;  3BJ6 A;  4XON A;  2R92 J;  1TT0 A;  2NVQ J;  3RSN A;  2ZSH B;  5F04 A;  2ZCW A;  3MMY B;  4Y17 A;  2BVM A;  4IOC F;  3BTJ A;  4ENN A;  1U5T A;  1I50 J;  2BXZ A;  2K40 A;  1FMV A;  2V7F A;  5B5E C;  2LKP A;  2Y0S A;  3S1R J;  1SFX A;  1Z9C A;  2E2J J;  1T98 A;  1WJD A;  5HNH A;  1E2X A;  2VQL A;  2VKD A;  3BDD A;  3H9J A;  3QAH A;  5D4R A;  4ZJZ A;  4KFC A;  1TWF J;  2F5V A;  4EEF G;  2IA2 A;  5C44 J;  2HOA A;  1H89 C;  4DYC A;  2JMW A;  4FCY A;  1KON A;  4N0B A;  2DYR H;  1S29 A;  1S7A A;  1RKW A;  2HGC A;  4L0Z B;  5EEH A;  3DXJ F;  3IV5 A;  3DLL F;  2EA4 A;  1T0F C;  3R4K A;  1U5T B;  2FXA A;  4LMY A;  4YFN F;  4J19 A;  2DMT A;  1XD7 A;  3K4C A;  1PYV A;  2P4W A;  4RDU A;  2KIF A;  2L9N A;  3IKV A;  3BCA A;  2XAF A;  3HPG A;  5HDK A;  3JRD A;  2R7V A;  4O6J A;  1TZL A;  1ZRF A;  5IYD J;  1BC8 C;  1ETO A;  2JSP A;  3GCM A;  3S3N A;  2V1X A;  1RPW A;  3OS0 A;  1ZK8 A;  4QLC U;  4IJA A;  1ZG1 A;  4E7Z A;  2MG4 A;  2L9S A;  2DW4 A;  2KL4 A;  1HCR A;  4A0Y A;  1I3A A;  3KP5 A;  3C2G A;  5B3S H;  1RRJ A;  4GRI A;  1AHD P;  4A93 J;  3ZMV A;  2PQ8 A;  1ON1 A;  1IC8 A;  1QGP A;  2HR3 A;  3WGG A;  3GTG J;  2CV0 A;  5CJ9 A;  3U2R A;  2XF7 A;  3ZQG A;  4ZDO A;  4F91 B;  3QQA A;  1HOM A;  3OSF A;  1TWA J;  2F48 A;  2X1D A;  4BGD A;  3KEQ A;  3WHB A;  2ZXI A;  3JRA A;  3PUB A;  3BZC A;  3CCR I;  3CCE I;  3T0Y A;  3CLQ A;  3SDB A;  1O57 A;  2HZT A;  2XRO A;  2K9M A;  4ETS A;  1I6X A;  5TJJ A;  3OYG A;  2UZK A;  1KQ0 A;  4LIT A;  1F4K A;  4L9N A;  1YRN A;  3RKW A;  1L0O C;  2CG4 A;  2G0E A;  1MIJ A;  2L7M P;  2WV0 A;  1ON2 A;  3QPH A;  4EQQ A;  1AA7 A;  1UEL B;  2Z33 A;  3M7G A;  3TBI A;  3S17 J;  2DT5 A;  1ZGA A;  3WHC A;  2RNJ A;  3IL2 A;  2PJR A;  5IY5 H;  1ZR4 A;  2LYC A;  4XKC A;  1QPI A;  5LLQ A;  4ANJ A;  3GTO J;  5LGU A;  2NVX J;  3QU3 A;  2VB6 A;  1QA6 A;  1XTA A;  2EZI A;  5LHG A;  2W4S A;  1V5F A;  2M8E A;  4LJZ F;  3ZQF A;  1JKQ C;  1YS6 A;  1V5G A;  2RQQ A;  4NC8 A;  1EKE A;  3HSE A;  1T2K A;  4IX7 A;  2MAB A;  2TDX A;  2PJR B;  3CMY A;  2K3P A;  2R93 J;  2XGD A;  5M5Y J;  2DPD A;  3I58 A;  1TP4 A;  1WHU A;  2J5O A;  3SFZ A;  2Y9Z A;  2EZL A;  3LAP A;  2RQP A;  4HQM A;  1FWZ A;  5GP9 A;  2JJ7 A;  1SD5 A;  1P4A A;  3S16 J;  1MW7 A;  4Q4Z F;  3HYI A;  2WWY A;  4CXF A;  4BEH A;  1ZN2 A;  5LFA A;  3ZQQ A;  4G9Y A;  3RDI A;  1WH7 A;  4NQW A;  3N4M A;  3F8C A;  4J01 A;  1HBX G;  3F72 A;  2Z5U A;  3ZQ7 A;  5HLT A;  1OR7 C;  1T95 A;  3CJT B;  1OFC X;  2K27 A;  4L18 B;  2R7O A;  3SFI A;  1OJL A;  3HRU A;  3RQI A;  2IJL A;  2KRH A;  2KLO A;  3MN2 A;  1YHQ I;  3FXM A;  1X1D A;  1EH8 A;  4BNC A;  4KIF A;  3K1P A;  5KVR A;  4EMS A;  1EA3 A;  3F8M A;  2OF7 A;  4LB5 A;  2XPU A;  3CP2 A;  2HXI A;  4KIB A;  2HYF A;  2H6B A;  2LF8 A;  4NC6 A;  4YEJ A;  3S1N J;  2ETH A;  2GQQ A;  4V19 K;  3K69 A;  1BI3 A;  4I6Z A;  1NK3 P;  4CCN A;  2L5Q A;  1D3Y A;  1IF1 A;  3FXO A;  1XCB A;  3KP4 A;  2ME6 A;  5DUK A;  2PMZ A;  4KN4 X;  4EJW A;  5E3M A;  2WY7 Q;  3ISP A;  5AIP A;  1SMY F;  1OYI A;  2HEO A;  4A5M A;  2CFX A;  2YUS A;  4BE1 A;  1X3W B;  4UHT A;  1R58 A;  4B1R A;  2M5W A;  2P5L C;  3S2W A;  2XAQ A;  1XS9 A;  1K7A A;  4HF2 A;  5EG0 B;  1YIO A;  3ZMU A;  1FIP A;  4BDZ A;  3U1K A;  3L2V A;  5IP9 J;  1TQM A;  2LFB A;  4MTE A;  4S0H B;  4KIT B;  1X4P A;  2KIS A;  2QQB A;  1IGN A;  3I3L A;  3BRO A;  3P9K A;  1Z05 A;  3LL7 A;  1D0Z A;  1WI3 A;  1XMK A;  2JWT A;  3L7W A;  3F23 A;  1OCT C;  2WB1 N;  1PP8 F;  3G73 A;  3H3U A;  3MD2 A;  3OYN A;  3FBI B;  1Y39 A;  2O3F A;  1ZKG A;  5K1Y A;  2HDW A;  1O7L A;  1IXC A;  3WE2 A;  1YFH A;  2X6O A;  2HKO A;  4Y4R A;  5H6R A;  3H9Q A;  4EJO A;  4GFB A;  2ELJ A;  2OC6 A;  3KCC A;  1X1A A;  1ZQ3 P;  3HIF A;  2FE3 A;  3BJO A;  2XB5 A;  3GF2 A;  1OCR H;  1USS A;  3MEX A;  4BAY A;  3DKW A;  5L3F A;  4NHJ A;  1S9H A;  5J6X A;  4CCK A;  1S7E A;  4HW0 A;  4C3I J;  4U7B A;  2GOM A;  3LOC A;  5FRM A;  4CCM A;  3MQ0 A;  1N77 A;  1IN5 A;  3W2V A;  5CVU A;  3S32 A;  1BC7 C;  4MNU A;  2OD5 A;  3O8G A;  3O3K A;  4WK8 F;  4RAF A;  4HOB A;  1DP3 A;  1LB2 A;  1U3E M;  3RYP A;  5D5V B;  1HKS A;  2EV5 A;  4CYC B;  4HAM A;  4MGR A;  5EEG A;  2CSO A;  3H5R A;  2DN0 A;  2QQ9 A;  1FYM A;  3PO2 J;  2L7F P;  5J4Y A;  3GZ5 A;  3J7Z I;  3H0G J;  1MMN A;  4FQG A;  4DGW B;  4R79 A;  4BQN A;  1ZGW A;  1QZY A;  4FX0 A;  3B02 A;  2GWR A;  3HOS A;  3WTZ A;  2EFQ A;  3E7L A;  4YRV A;  1OYY A;  2DO7 A;  1H88 C;  3W2A A;  2HQA A;  1GVJ A;  2L7Z A;  3IWF A;  2Y2Z A;  3TW6 A;  4XL9 A;  4XNF A;  3HJE A;  5IYC J;  3F6V A;  4NBQ A;  3DPT A;  4E7I A;  3KEY A;  5F27 A;  4C30 A;  1MMG A;  2Y75 A;  5HOD A;  1DDN A;  1RR8 C;  2E19 A;  4DBR A;  5TIS C;  2BBY A;  4XLP F;  2C6Y A;  3WTS C;  3P9I A;  1XN7 A;  3HHG A;  1W0U A;  3M1C A;  1KU7 A;  3CMM A;  4ZYA A;  2FBH A;  5AIQ A;  4HZF A;  3WTX C;  1N75 A;  3OYM A;  1WJF A;  4CO8 A;  4D7N A;  4YG2 F;  3WTV C;  1ZH5 A;  3TED A;  1YS7 A;  3CCS I;  5GAH J;  2HQN A;  4I0A A;  2Y31 A;  5FRO A;  2XSD C;  1BBY A;  3S1Q J;  2CO5 A;  5IP7 J;  1SD4 A;  3DEE A;  2O7O A;  5D6E A;  3CDI A;  4MFE A;  3OYH A;  4IHX A;  3SZP A;  2LRE A;  3B6A A;  2MYS A;  4DYQ A;  5BOX A;  2V4J C;  1BR1 A;  1MJ9 A;  3TKY A;  2VJ4 A;  4PJN A;  3FK7 A;  1V4R A;  3HHH A;  1ZR2 A;  4OU0 A;  4EJU A;  1XC5 A;  3HL2 A;  1WWX A;  2L4A A;  1OR7 A;  1WQ2 A;  1R1T A;  2FU4 A;  3QPL A;  4QPO A;  5D6F A;  1U9N A;  3F8B A;  4OIN F;  4UUT A;  1ZG5 A;  1SAN A;  2EBI A;  3PIO F;  4OWR B;  2E71 A;  1OYW A;  3JRG A;  3IUO A;  5FJ8 J;  3CD6 I;  4M3B A;  2XAU A;  2WAQ A;  5GTH C;  3C18 A;  1FTT A;  2L4M A;  2CQX A;  3TOB A;  1KYW A;  1LPQ A;  1SD6 A;  3JRB A;  2CUZ A;  2ZXH A;  1O3S A;  3HUG B;  1Q1V A;  2LY1 A;  4M3F A;  3EUH C;  2DOA A;  2AO9 A;  1WJC A;  1FOX A;  2VJ5 A;  5BNG A;  2RGV A;  3AAF A;  4PK4 A;  5FKM A;  1XSD A;  2MLK A;  2LVS A;  1FP1 D;  1TNT A;  1D1A A;  2B9S A;  4RLQ A;  2L01 A;  3IWZ A;  3VOD A;  4N9H A;  1MSF C;  2ICW G;  3KYL A;  2ID3 A;  2IGM A;  4A2U A;  1A6Q A;  1LFB A;  2IA1 A;  2KZV A;  2VJJ A;  3ZMS A;  1VTN C;  2EB7 A;  2F5F A;  4OOI A;  3RYR A;  2R5Y A;  1OPC A;  2HPI A;  5GPC A;  3CCM I;  1SFO J;  3CCU I;  1Y6I A;  2OU2 A;  1E0E A;  1MBJ A;  3A2K A;  1NH3 A;  1AU7 A;  2K7L A;  4A3J J;  2M4G A;  3HB9 A;  4D1Q A;  5B66 C;  2Y9Y A;  3LSG A;  4RB1 A;  2V9V A;  1WJB A;  1VQ5 I;  2FNA A;  3W6K B;  2M87 A;  1T6S A;  1Y56 A;  2CW0 F;  4G6T B;  2NS8 A;  1R9T J;  1AWC A;  4FIS A;  2DMU A;  3CJR B;  5IYB J;  5DD4 A;  2R5Y B;  4A3B J;  3ULQ B;  2FBI A;  4UUS A;  5E18 F;  2L2O A;  5K5R A;  1UG2 A;  3E5X A;  2VQG A;  5ICG A;  1YIJ I;  4DJA A;  1FT9 A;  1OCZ H;  1P4X A;  4HV6 A;  4NNJ A;  3V7R A;  2MFZ A;  4Y52 J;  2VOO A;  1BI0 A;  3EYY A;  3K70 C;  4IZZ A;  1A36 A;  2DXI A;  1FZP B;  4BY7 J;  2QSH X;  3HRT A;  3OL3 A;  2VC0 A;  3CCY A;  3F0C A;  1KQ9 A;  2LC2 A;  3FM5 A;  2IW5 A;  1FP2 A;  5D4S A;  5F0H A;  4XR6 A;  3CLO A;  2B0L A;  2D45 A;  3K10 A;  3TDZ C;  3L2W A;  1I1G A;  3H5A A;  2NNY A;  3FBN B;  2YSR A;  2X1E A;  5KCM A;  2LY9 A;  2BHZ A;  1A6I A;  3GTL J;  2ZXJ A;  4AUX A;  3OIO A;  2H94 A;  1E3H A;  3ECH A;  2HYG D;  4XRM A;  1UHW A;  2KP6 A;  3PL8 A;  3AL0 C;  4X6A J;  1R5G A;  4C2M J;  1O7F A;  1HC8 A;  1ACI A;  3FHN A;  2H27 A;  1ZRE A;  1SVO A;  3LAJ A;  3JAM Z;  3FKJ A;  3K7A J;  1VQP I;  3DCF A;  2A69 F;  9ANT A;  4IXA A;  1N25 A;  4I09 A;  2OCC H;  2V1D A;  1X3Z B;  4HNU A;  1HKQ A;  2Z99 A;  3OIQ A;  1YJN I;  2ZXW H;  3KYC B;  5HLI A;  3VB2 A;  3GTJ J;  3FF5 A;  3ZQI A;  3DP7 A;  1X19 A;  3CO7 C;  4IRG A;  2ADU A;  4EJT A;  5LHI A;  1U9O A;  2Y48 A;  3ZRG A;  2H09 A;  3K6G A;  2D1H A;  2E1N A;  2IRF G;  4PDK A;  3AKZ A;  1J7K A;  5DUI A;  1W7P D;  1HF0 A;  4IVN A;  3TW7 A;  2GZW A;  3F8N A;  4XLN F;  2R5Z A;  1XGS A;  1R22 A;  2WB1 A;  5JI6 A;  1D1C A;  2ZSI B;  4HNV A;  2ACJ A;  2F2E A;  2E60 A;  3R60 A;  5K7Z A;  2IEK A;  2PMU A;  4B43 A;  1ZAO A;  5JHU A;  2M3A A;  1SC7 A;  4KN7 X;  4A3C J;  2DA5 A;  1OMI A;  1V54 H;  2AS5 F;  2QBY A;  3CCJ I;  3GX4 X;  3KX2 A;  4PJL A;  2DJN A;  5ILV A;  5HS8 A;  1KA8 A;  3F6O A;  4L0Y B;  4U0V A;  4EGY A;  1XGN A;  2R5Z B;  2BE5 F;  1HW1 A;  3CUQ A;  4RB2 C;  2K9L A;  5B1B H;  4ASN A;  4OAY A;  2BY2 A;  2GAU A;  4HYE A;  4BHC A;  2HVS A;  4GDF A;  3H0D A;  3HOV J;  5FKK A;  3CJQ B;  4JQF A;  2W7N A;  2M45 A;  2P8T A;  1ORK A;  2HOE A;  1ODD A;  3Q0W A;  5GPA A;  1AOY A;  3PFI A;  5CVR A;  3QOP A;  5DV5 A;  2O5R A;  3E1S A;  1B1B A;  2ZME C;  3SZG A;  4WXH A;  1G8X A;  3FMQ A;  4B3A A;  2EFO A;  3ECO A;  2RKH A;  1XSX A;  3GZN B;  2EJR A;  4AYB N;  3BR0 A;  3NAU A;  4XKW A;  3RPQ A;  2EWN A;  3ABL H;  3CUQ B;  2BOL A;  2LSO A;  1YI2 I;  1VQ4 I;  1Z7U A;  4LGW A;  4L5E A;  1EF4 A;  3WU2 C;  3GTP J;  3VEP A;  2E7X A;  4UVB A;  1VQK I;  3LA2 A;  4Q48 A;  4E6K G;  3H9G A;  4M3D A;  1FBQ A;  1V55 H;  4HEA 2;  4G12 A;  1MBK A;  4FTH A;  2QF7 A;  4BQA A;  1ETX A;  3CUO A;  2FMY A;  4FE4 A;  4U0W A;  3IKT A;  1OCC H;  2FOK A;  2COB A;  3E6D A;  2BYV E;  1GXQ A;  5BS6 A;  2Z1D A;  2E5N A;  2QVO A;  4CGZ A;  3OYF A;  5HS7 A;  1WJA A;  3PNY A;  3OYC A;  1BIB A;  2HOS A;  1I6H J;  4HSR A;  2EPF A;  4MHG A;  1RET A;  5H2F C;  2XGE A;  1B72 A;  3F9K A;  4CA0 A;  5E3O A;  4OIQ F;  2DT6 A;  3I55 I;  1T8I A;  1YE9 A;  4EJV A;  3E6M A;  3GTM J;  1JUP A;  2P6T A;  4RB3 C;  1SD7 A;  1J09 A;  2QCO A;  5JFR A;  1Z7L A;  2N8G A;  4HF0 A;  2YS9 A;  2DMN A;  5D5X B;  1OLT A;  3BOQ A;  3KZI C;  2B7E A;  1ETQ A;  2OJE D;  2W48 A;  2XVC A;  2K9S A;  2LLK A;  4WX9 A;  4N4N B;  1B72 B;  2MGQ A;  2PMH A;  4BL0 B;  2DLL A;  3RIR A;  5HLG A;  2IBD A;  2VE9 A;  2DJI A;  3EUA A;  1ZYR F;  2DFI A;  3TP3 A;  3HOU J;  3DEW A;  1LKX A;  1FNN A;  3PQK A;  3JRH A;  4A0X A;  3JSO A;  1Z77 A;  2DFE A;  2DT7 B;  4JYK A;  4C2T A;  1IG7 A;  1GV2 A;  4PJ0 C;  3HBL A;  1FX7 A;  3OR1 C;  1J0R A;  2JVH A;  2LNB A;  2KIQ A;  4CCO A;  1SAU A;  2HVQ A;  3A0B C;  3BP8 A;  4Y13 A;  1PUF A;  3M8F A;  5M3F J;  5LD2 C;  2JA5 J;  3QYE A;  5JR3 A;  5J1Y A;  1ETW A;  4XID A;  2YX7 A;  3O6B B;  1MBE A;  2A6T A;  5FKO A;  2Z3Y A;  4BJ5 C;  2FA5 A;  4PFO A;  3J7Y J;  2BHY A;  2X0L A;  1WVR A;  3H92 A;  3S3M A;  4C3J J;  2UXN A;  2V9K A;  4RAG A;  4ZDL A;  3VSK A;  3UNG C;  2WAE A;  2AHQ A;  2KJC A;  3AG2 H;  2ECB A;  2FSW A;  2DA6 A;  2IXS A;  3DU5 A;  3NAR A;  3OL4 A;  4F3Q A;  1PUF B;  2LMD A;  2H6C A;  1Y8Q B;  2VPL A;  4NB5 A;  5DD8 A;  1WZ2 A;  1S6L A;  3JRI A;  1N78 A;  2XKO A;  5ED4 A;  4CUG A;  2DDA A;  2L9V A;  2R4G A;  2CJJ A;  5HDG A;  3DF8 A;  1R1U A;  5CLS A;  3OYE A;  4U0Y A;  2G7H A;  3K9T A;  5B1A H;  5BPD A;  3VDX A;  5E1X A;  5FRN A;  1UHM A;  3FXL A;  2K02 A;  2X51 A;  1W5T A;  2VBW A;  3M8E A;  4P1W A;  4ABZ A;  2M0M A;  3J7A O;  2OUM A;  2DK5 A;  3JR9 A;  3JTG A;  5DDG A;  3PIP F;  2IAI A;  4HG2 A;  4ENJ A;  2STW A;  3BQZ A;  2QEN A;  3Q5F A;  2A68 F;  1YRN B;  1XG1 A;  5ILU A;  3UKG A;  1UB9 A;  1H0M A;  2JA6 J;  1P4W A;  1BOA A;  2CRG A;  2X4H A;  2BW3 A;  1JXS A;  1YX5 A;  2HNH A;  5CVJ A;  2EH3 A;  2FRH A;  4KIC A;  1VQN I;  2Q0O A;  4F7Z A;  4DNC A;  5JVG F;  4KNY A;  3HRM A;  2IPQ X;  1JUS A;  1TWC J;  2BXY A;  3K0L A;  2P5V A;  4OIO F;  2LD5 A;  3TMO A;  1T39 A;  1IRZ A;  2M7B A;  3LSP A;  4UB6 C;  4MFD A;  5C4J J;  3RKX A;  2J5P A;  2HXO A;  3M07 A;  1VFC A;  5DCM A;  3DKY A;  4UVC A;  4Z6Y A;  2OTL I;  4XLH A;  3D5R C;  4H4K C;  1KU9 A;  5M3M J;  2PJP A;  1Z6T A;  1W36 D;  2W84 A;  1Z1D A;  2JA8 J;  1IW7 F;  4HLX A;  3HSR A;  2HYJ A;  2XKP A;  1R7J A;  1JKR C;  2CH0 A;  4L9V A;  2LR8 A;  3L2U A;  4FT8 A;  4IHY A;  1WCM J;  4R8H A;  5F0F A;  3GME A;  1IN8 A;  3HOX J;  3BLY A;  1ZGJ A;  1OIS A;  4BEH B;  2D5V A;  1RC9 A;  2VN2 A;  2LTP A;  3BR5 A;  3L9F A;  2MSY A;  2O61 A;  2F4O B;  2E1M C;  4NQW B;  1FPQ A;  3KZY A;  3DTE A;  1HQC A;  3K4N A;  3F21 A;  2F5D A;  4V2F A;  2RRE A;  3HKZ N;  2LY2 A;  4M71 A;  3PSF A;  5LEK A;  1ETK A;  2EIJ H;  1K83 J;  4XN3 A;  3T8T A;  1G3W A;  4B48 A;  4RBO A;  3OSG A;  2EQR A;  3GO5 A;  4DZJ A;  1R71 A;  2IS2 A;  3WE3 A;  3LA3 A;  2JT1 A;  4BQO A;  1G2H A;  3WG9 A;  3ZN1 A;  2Y69 H;  4WF2 A;  2PX9 A;  1GXP A;  2QLZ A;  3SDG A;  2BY0 A;  3OYB A;  2NNN A;  1VQL I;  4PSW A;  5KAF C;  2OCE A;  4C2U A;  2W1O A;  1LEB A;  1U6G A;  4BS9 A;  2HPM A;  3L00 A;  1IRX A;  2EIK H;  2MD0 A;  5F1R A;  1KU3 A;  1BOB A;  5E3N A;  1Y1W J;  1T0F A;  3FK6 A;  3SYT A;  4W97 A;  2VBZ A;  5JLW A;  5EEA A;  2HTJ A;  2CW7 A;  2QKM B;  3FDY A;  1YG2 A;  4JX4 A;  3G71 I;  1GHC A;  3CME I;  3AG4 H;  4FET A;  4D0P A;  2BZT A;  2W82 A;  3ABT A;  2XF5 A;  4DQ2 A;  3R61 A;  3VSL A;  3ZMT A;  4MTD A;  3HRS A;  4IPA A;  3Q3S A;  1D0Y A;  4M73 A;  1F9N A;  4YEL A;  2DPU A;  5EZG A;  4LLG F;  1FOY A;  2A61 A;  3M9A A;  4KDP A;  3S15 J;  2IGK A;  1VQ8 I;  4OIR F;  3KZZ A;  3QWL A;  2YX4 A;  5FO5 A;  3A02 A;  1G3S A;  4UUV A;  3LNQ A;  1X2M A;  3HTU A;  2VJI A;  4I0B A;  1UJ8 A;  1HXD A;  5CPR B;  4L5I A;  1FLI A;  3KIO A;  1ZEL A;  3K2A A;  1PUE E;  3BZK A;  4B44 A;  3AG3 H;  3MKW B;  1GUU A;  1R6R A;  4XRF A;  3FHZ A;  2WBM A;  1FC3 A;  2WV1 A;  3SHF A;  2MD5 A;  4Q47 A;  3N97 A;  3LQR A;  2VXD A;  5J40 A;  1RUN A;  1BJZ A;  4CCJ A;  2XPV A;  2NAZ A;  4JX5 A;  4UXN A;  2V26 A;  2XAJ A;  2OA4 A;  4A3I J;  4KT5 C;  2UV1 A;  4LK1 F;  3E5U A;  3OYI A;  3PUF A;  2LOO A;  2W24 A;  2MA3 A;  4I01 A;  2BGC A;  5A2Q Z;  4G8X A;  3JCU C;  3WG7 H;  3BC8 A;  2R7T A;  3KPH A;  4E7L A;  1MNM C;  2XAG A;  2A3S A;  2A5W A;  2B63 J;  3EDP A;  3V4G A;  3QYB A;  4HQE A;  3Q9S A;  1GVD A;  2LKX A;  2E7W A;  2JRM A;  2MBF A;  2ZJP F;  4UVA A;  2Z9O A;  2DFF A;  1WPK A;  4HRI A;  5GTI C;  2GXA A;  2HFH A;  4NDL A;  3J81 Z;  3HOT A;  3DFG A;  3WTT C;  2WAF A;  2ISZ A;  2AXT C;  3LFU A;  4A3F J;  2IS4 A;  4Y7N J;  2GA2 A;  2FBK A;  3KLN A;  1DU6 A;  3BTL A;  3S1M J;  2VKH A;  4XOT A;  2R7Z J;  1WSU A;  4Y15 A;  2CV1 A;  1MDM A;  1P7J A;  1TWH J;  2EV0 A;  3N05 A;  1K6O A;  1CQT A;  2DOE A;  3LFK A;  1TW2 A;  1PP7 U;  3M8J A;  1FBU A;  3M1E A;  2I8D A;  1G3T A;  3SXY A;  3PO3 J;  3HPH A;  3G1O A;  4RAZ A;  4U87 A;  4HV5 A;  4EV0 A;  4FE7 A;  1E17 A;  2EIN H;  4P5O A;  2I5U A;  1U8B A;  2V6E A;  3KP2 A;  3DEU A;  4M9S A;  5DM7 F;  2KDO A;  1XCV A;  4A3D J;  4EM1 A;  4LK0 F;  4CZC A;  4P9F A;  4M9Z A;  3D5S C;  2R7S A;  1MDM B;  2CQN A;  3TO6 A;  1MD0 A;  4YFX F;  3MKL A;  2CWE A;  5J4V A;  1UG0 A;  3SEZ A;  4YIF A;  4XK4 A;  1I27 A;  2GIV A;  4QPQ A;  5IOZ A;  4KIG A;  3IH2 A;  1WFX A;  1B59 A;  4RAY A;  5IT9 Z;  3ASN H;  3CCQ I;  1HW2 A;  3MCZ A;  2CUJ A;  4BUP A;  2E5Z A;  2GOX B;  2L02 A;  4QWQ A;  3F8F A;  3GBG A;  2M1B A;  2FQ3 A;  1RNL A;  2ZFW A;  4RB0 A;  5IPA A;  3NRV A;  2E2H J;  2ECC A;  2BV6 A;  1GT0 C;  1GV5 A;  1I39 A;  1XX5 A;  3OR2 C;  5TGT A;  2WTE A;  3Q9V A;  3GTQ J;  2GXB A;  4OMZ A;  4XRS G;  2KRC A;  4PGG A;  5J47 A;  3T5X A; 
#chains in the Genus database with same CATH homology
 4ZYE A;  1YTY A;  3FMS A;  3BZ6 A;  1TBX A;  2Q2E A;  3W6J B;  3WOD F;  4EM0 B;  3I4P A;  1BI1 A;  2XIG A;  3I54 A;  4MEY F;  4G7O F;  3ELK A;  4LFU A;  1HKT A;  3RKY A;  5J8F A;  2RDP A;  3T1B A;  1PDN C;  5FFX A;  2KIM A;  1ZRD A;  3TGN A;  3GFI A;  3COA C;  2V79 A;  3G3Z A;  3H3Z A;  2P6S A;  1YLF A;  1HW5 A;  4S04 A;  1WI9 A;  3VOE A;  3JAM K;  4PZJ A;  4A12 A;  2JZY A;  4M6X A;  3ROU A;  4MQV A;  1U5T C;  1K79 A;  1LDJ A;  1G6N A;  2LF7 A;  3QP6 A;  2DAO A;  4G6D A;  5L3E A;  4M74 A;  2Q8K A;  2OAZ A;  1XGM A;  2CQK A;  2QM3 A;  2UWM A;  2VON A;  2ELH A;  4FHT A;  2STT A;  3FMR A;  4RGU A;  3IHU A;  1SFU A;  2EFW A;  2RN7 A;  3L09 A;  2DK8 A;  1FYL A;  4ZZL A;  4EVI A;  3J80 Z;  3TQN A;  5D8L B;  5AON A;  1DPU A;  4ZZD A;  3E6C C;  3I71 A;  3FWE A;  3GYH X;  4A0Z A;  4I7H A;  1SAX A;  2QYO A;  1IRF A;  2EFP A;  5CVV A;  2ZBK A;  4I02 A;  1LJ9 A;  4M9X A;  1YW7 A;  1KGS A;  5E8I A;  3K1M A;  3WGH A;  1ZLK A;  1H9T A;  5E8G A;  4RGR A;  1KYZ A;  3GVA A;  5LRR A;  4UV9 A;  1XDS A;  4U88 A;  3TOA A;  1CGP A;  2FML A;  2DU9 A;  3GFL A;  4A6D A;  1CF7 A;  2OZ6 A;  3FXU A;  1FSH A;  3GWZ A;  1D8K A;  1O3T A;  4H0E A;  3RJP A;  1NHA A;  3GFJ A;  1W7P A;  2DTR A;  4A5N A;  2A6H F;  3V8K A;  3L2C A;  1BIA A;  3GLX A;  4KA4 A;  1D8J A;  2QBY B;  4UNO A;  3I5U A;  3T8R A;  2XRN A;  3JTH A;  1CF7 B;  1HSJ A;  1YO5 C;  1UST A;  3SZT A;  2V1U A;  3EUH A;  2XUB A;  6PAX A;  1MJA A;  2VE8 A;  1ZHF A;  2OQG A;  3F3X A;  1H9G A;  1ULY A;  4MEX F;  1J75 A;  2EK5 A;  5BPI A;  1B9M A;  3I59 A;  4ZYH A;  1I1S A;  2KKO A;  4GO1 A;  3RPU A;  2KJB A;  3RI4 A;  3ML6 A;  4LLL A;  1SMT A;  2CYY A;  3GEZ A;  2V6C A;  2NYX A;  3CO6 C;  2ZNZ A;  1V3F A;  1K78 A;  1C0W A;  3HTS B;  4CYD A;  1TTY A;  1R5H A;  1O3Q A;  1Y0U A;  2W57 A;  4O5V A;  4I2O A;  2KRF A;  3FX3 A;  3BPX A;  1IUY A;  4I98 B;  3D5L A;  4YFK F;  5FLX Z;  3R0J A;  5LGT A;  1B4A A;  3EQL F;  1IZ1 A;  4HA8 A;  1EH7 A;  2DI3 A;  4JK1 X;  3WTW C;  3MZY A;  1DUX C;  4XSX F;  1K78 B;  1BI2 A;  4WXD A;  1QO0 D;  5L3D A;  1OKR A;  4AWX B;  5CYV A;  3GZ6 A;  3TDU C;  3TO7 A;  4ENM A;  5HOO A;  3DV8 A;  2RV8 A;  3REO A;  1RZ4 A;  2DQR A;  1U8R A;  4BYY A;  1FYK A;  3KP3 A;  3WU0 A;  1SFE A;  3EET A;  1EH6 A;  1FSE A;  5IT3 A;  3GW2 A;  2ZKZ A;  3ZN0 A;  4S05 A;  3V7S A;  4KMF A;  2HDC A;  1IN7 A;  5FGM A;  4OMY A;  5D8K B;  2VT2 A;  4BHP A;  2YPR A;  1X3U A;  2PBI A;  3NEU A;  4M72 A;  2O03 A;  2MH2 A;  2O0Y A;  3E5Q A;  2VT3 A;  4HBL A;  1R36 A;  5DYM A;  2NS0 A;  4CIC A;  2KIU A;  1J9I A;  3OOP A;  1W4M A;  3RTR A;  5E17 F;  1DP7 P;  1KU2 A;  2GA1 A;  3LQQ A;  4Q5S F;  1IXR C;  2QZ8 A;  4LD5 A;  3KP6 A;  1TQP A;  2PFB A;  3BPV A;  2ZME A;  5ICC A;  5L3C A;  2XAS A;  2VXZ A;  4HX8 A;  3KET A;  3JW4 A;  4M6Y A;  3WTU C;  2JPC A;  3ABU A;  5DCF A;  5KK1 A;  1JE8 A;  4CZZ A;  2YR2 A;  3FXQ A;  4L5J A;  3VFZ A;  2ZME B;  2PI0 A;  4WCG A;  5FD6 A;  1J59 A;  3CTA A;  5DCM B;  2MC3 A;  5L3G A;  5LEJ A;  1J2X A;  2OQR A;  2CGP A;  2R7D A;  4XSZ F;  4XBF A;  1YQA A;  4MQ9 F;  1RIO H;  1QQI A;  2A6E F;  3KFW X;  1QNT A;  3DPL C;  1IN6 A;  1LDK B;  2Y0M A;  5FD5 A;  1ZRC A;  5LBQ A;  2P7V B;  2F5E A;  2K4B A;  5E1Z B;  4ESB A;  1MKM A;  5D5U B;  1W5S A;  2YU3 A;  3U9G A;  4EGZ A;  1L3L A;  1MGT A;  2COM A;  3I0T A;  1J5Y A;  4IF4 A;  5BQT A;  5A2Q K;  1FY7 A;  4N9I A;  2R3S A;  3QU6 A;  2GXG A;  2VOD A;  1YW8 A;  1Z91 A;  4RGS A;  4P9U A;  3J81 K;  2G9W A;  3E3V A;  2A07 F;  3R0A A;  5HLH A;  2OZU A;  1D5V A;  3E97 A;  3I53 A;  3LA7 A;  2ZJ2 A;  1IXS B;  1LNW A;  1XB4 A;  1B6A A;  4ESF A;  3V8L A;  1R00 A;  4BXU A;  3KLO A;  4ON0 A;  2ESH A;  4KMU X;  3NQO A;  1TLH B;  5F64 A;  3HSF A;  1U78 A;  3EYI A;  4IRH A;  5D5W B;  2IT0 A;  4BH9 A;  4B09 A;  3WGI A;  4G6Q A;  2R7F A;  3MFK A;  1MZB A;  1S3J A;  1HST A;  4O3M A;  4ZYD A;  3CDH A;  1IN4 A;  1BN5 A;  5FFZ A;  1LDD A;  5IT9 K;  4ENK A;  2E1C A;  3P9C A;  2VBX A;  3I64 A;  4WXC A;  3LST A;  2JPB A;  2PLY A;  4EM2 A;  3TO9 A;  3C1D A;  3C7J A;  4JBA A;  4LG0 A;  2DQL A;  3WTY C;  2LDU A;  4KYW A;  1ZG3 A;  4AVP A;  1QBJ A;  2DBB A;  1P6R A;  1TW3 A;  5LHH A;  2PEX A;  1FBS A;  4KUM A;  1F1Z A;  2W85 A;  4GCV A;  4AD9 A;  2FEZ A;  2A5Y B;  4LG0 B;  1WKM A;  1LQ1 A;  5ILS A;  3IRR A;  2ZO4 A;  1UCR A;  4Z2Y A;  5ICE A;  2P5K A;  1ZLJ A;  2PG4 A;  3WU1 B;  3CUQ C;  1TNS A;  3HUG A;  4TV7 A;  4K2E A;  3PQJ A;  2M30 A;  2P7C B;  2ESN A;  1G3Y A;  5E1W A;  3MZH A;  3ZP5 A;  2XHK A;  2RC4 A;  3JSP A;  2JTV A;  3QP5 A;  5H20 A;  4IRI A;  1XDU A;  3FXR A;  3CJN A;  2UXX A;  3V8J A;  2HTS A;  1S8N A;  2OBP A;  1IRG A;  1JGS A;  4AIH A;  4HX4 A;  5K5O A;  1REP C;  2O8X A;  5HS9 A;  4AIK A;  2NRA C;  4LB6 B;  2G7U A;  3K1N A;  4G94 A;  1JHH A;  4ZH4 F;  1A04 A;  2K4J A;  1KQ8 A;  2JSC A;  4ZYG A;  3J80 K;  2VOP A;  5BMZ A;  1ONV A;  2O6G E;  1BJA A;  1P2F A;  4E70 A;  3ZMZ A;  1B9N A;  2L54 A;  2XAH A;  1IAW A;  5ICF A;  4GYG A;  1Z6R A;  2IA0 A;  4B8X A;  5HDN A;  3IRQ A;  5F6F A;  3MAJ A;  2D2W A;  2VBY A;  2XGX A;  3OV8 A;  1BM9 A;  4PGH A;  3P7N A;  1P92 A;  4IHS A;  2L3D A;  1LVA A;  1FOK A;  1ZAR A;  4ESJ A;  2ZNY A;  3BJA A;  1QZZ A;  2QWW A;  1TQI A;  3LWF A;  1YYV A;  1DPR A;  5TRD A;  5FB2 A;  1LEA A;  2QQA A;  5LGN A;  3FZV A;  4LLN A;  2FNP A;  4CHU A;  2EFN A;  4P55 A;  4G7H F;  1XMA A;  1O3R A;  1R1V A;  3U1D A;  5J8C A;  2MLG A;  2HQR A;  2RVC A;  2XV4 S;  4FX4 A;  3FM3 A;  3GFM A;  1JHF A;  3QRF F;  4RGX A;  2IVM A;  4BHB A;  2W25 A;  2FF4 A;  3C3W A;  3B73 A;  3BWG A;  5JVT A;  4GYI A;  3GUD A;  2D1V A;  5CVI A;  3ZMD A;  4RS8 A;  2PN6 A;  1T38 A;  5DEQ A;  1YW9 A;  1F5T A;  1RI7 A;  3ERE D;  3DQV C;  3SQN A;  4GXO A;  4L9T A;  1QPM A;  4L9J A;  1EV7 A;  2IP2 A;  4HDU A;  1XGO A;  4CDG A;  1MJB A;  4AIJ A;  3ZPL A;  5LRS A;  1WRJ A;  3KEO A;  3V7C A;  1U2W A;  1S7O A;  5HVQ C;  3R6S A;  3F22 A;  3MWM A;  4OIP F;  3QPT A;  2HKX A;  1STZ A;  2MH9 A;  4R1H A;  1W7P B;  3E6B A;  5FLX K;  3KE2 A;  4HX7 A;  1G4D A;  4A6E A;  4P96 A;  2AXL A;  1I5Z A;  2HWV A;  4GGG A;  2F5C A;  2QUF A;  3O2P E;  2VC1 A;  3GXO A;  2ISY A;  1RUO A;  4HDV A;  4HF1 A;  4WWC A;  2HS5 A;  3BY6 A;  2BEO A;  4IHT A;  5L3B A;  1XSV A;  4UV8 A;  4YII A;  4PCQ A;  3K2Z A;  2K86 A;  5ERI A;  2EV6 A;  2EA2 A;  3KP7 A;  5K5Q A;  5H6Q A;  4U7D A;  1R23 A;  3D0S A;  1UFM A;  1Q1H A;  4HLY A;  3I59 B;  4G7Z F;  5E20 A;  2JRT A;  2WC2 A;  3IC7 A;  3BJ6 A;  2ZCW A;  4Y17 A;  4ENN A;  1U5T A;  2LKP A;  1SFX A;  1Z9C A;  1T98 A;  1E2X A;  3BDD A;  3QAH A;  5D4R A;  4KFC A;  2IA2 A;  4N0B A;  1S29 A;  1S7A A;  2HGC A;  4L0Z B;  5EEH A;  3DXJ F;  2EA4 A;  4YFN F;  3R4K A;  1U5T B;  2FXA A;  4LMY A;  1XD7 A;  2P4W A;  2KIF A;  3IKV A;  2XAF A;  5HDK A;  4O6J A;  1ZRF A;  1BC8 C;  2V1X A;  4QLC U;  4IJA A;  1ZG1 A;  2DW4 A;  4A0Y A;  3KP5 A;  3ZMV A;  2PQ8 A;  1ON1 A;  1QGP A;  2HR3 A;  3WGG A;  5CJ9 A;  3U2R A;  3KEQ A;  3T0Y A;  1O57 A;  2HZT A;  2XRO A;  4ETS A;  1I6X A;  5TJJ A;  2UZK A;  1KQ0 A;  1F4K A;  4L9N A;  3RKW A;  1L0O C;  2CG4 A;  3QPH A;  2WV0 A;  1ON2 A;  4EQQ A;  2Z33 A;  3M7G A;  2DT5 A;  1ZGA A;  2RNJ A;  3IL2 A;  5LLQ A;  5LGU A;  3QU3 A;  5LHG A;  2M8E A;  4LJZ F;  1YS6 A;  3HSE A;  1T2K A;  2TDX A;  2DPD A;  3I58 A;  3SFZ A;  2J5O A;  3LAP A;  2RQP A;  4HQM A;  1FWZ A;  1SD5 A;  1P4A A;  4Q4Z F;  3HYI A;  2WWY A;  4CXF A;  1ZN2 A;  4G9Y A;  3RDI A;  4NQW A;  3N4M A;  3F8C A;  1HBX G;  3F72 A;  2Z5U A;  3ZQ7 A;  2K27 A;  4L18 B;  3HRU A;  2IJL A;  1EH8 A;  4BNC A;  4KIF A;  3K1P A;  5KVR A;  4EMS A;  3F8M A;  4LB5 A;  4KIB A;  2HYF A;  2H6B A;  2LF8 A;  2ETH A;  2GQQ A;  3K69 A;  1BI3 A;  1D3Y A;  1IF1 A;  3KP4 A;  1XCB A;  5DUK A;  4KN4 X;  4EJW A;  3ISP A;  5AIP A;  1SMY F;  1OYI A;  2HEO A;  4A5M A;  2CFX A;  4UHT A;  1R58 A;  2M5W A;  2P5L C;  3S2W A;  2XAQ A;  1K7A A;  4HF2 A;  1YIO A;  3ZMU A;  1TQM A;  4MTE A;  2QQB A;  3BRO A;  3P9K A;  1Z05 A;  1XMK A;  3L7W A;  3F23 A;  1PP8 F;  3G73 A;  3H3U A;  2O3F A;  5K1Y A;  1O7L A;  1IXC A;  3WE2 A;  1YFH A;  2HKO A;  5H6R A;  4EJO A;  3KCC A;  3HIF A;  2FE3 A;  3BJO A;  3GF2 A;  1USS A;  3MEX A;  4BAY A;  3DKW A;  5L3F A;  4NHJ A;  5J6X A;  4HW0 A;  4U7B A;  3MQ0 A;  1IN5 A;  1BC7 C;  5CVU A;  4MNU A;  2OD5 A;  3O3K A;  4WK8 F;  4HOB A;  1LB2 A;  1U3E M;  3RYP A;  5D5V B;  1HKS A;  2EV5 A;  4HAM A;  4MGR A;  5EEG A;  2CSO A;  1FYM A;  2QQ9 A;  3GZ5 A;  4R79 A;  1QZY A;  4FX0 A;  3B02 A;  2GWR A;  3HOS A;  3WTZ A;  2EFQ A;  1OYY A;  2DO7 A;  1GVJ A;  3IWF A;  3F6V A;  3DPT A;  2Y75 A;  1DDN A;  2BBY A;  4XLP F;  2C6Y A;  3WTS C;  3P9I A;  1XN7 A;  3HHG A;  1KU7 A;  2FBH A;  5AIQ A;  4HZF A;  3WTX C;  4CO8 A;  4YG2 F;  3WTV C;  1ZH5 A;  1YS7 A;  2HQN A;  4I0A A;  1BBY A;  2CO5 A;  1SD4 A;  5D6E A;  3SZP A;  5BOX A;  1MJ9 A;  3TKY A;  3HHH A;  1V4R A;  4OU0 A;  4EJU A;  1WWX A;  2L4A A;  1OR7 A;  1WQ2 A;  1R1T A;  2FU4 A;  5D6F A;  3F8B A;  4OIN F;  1ZG5 A;  1OYW A;  3C18 A;  2L4M A;  3TOB A;  1KYW A;  1SD6 A;  1O3S A;  2RGV A;  3AAF A;  1XSD A;  2MLK A;  1FP1 D;  1TNT A;  2L01 A;  3IWZ A;  3VOD A;  4N9H A;  4A2U A;  2IA1 A;  3ZMS A;  1VTN C;  2EB7 A;  2F5F A;  4OOI A;  3RYR A;  1OPC A;  2OU2 A;  2K7L A;  4RB1 A;  2V9V A;  2FNA A;  3W6K B;  2M87 A;  1T6S A;  2CW0 F;  1AWC A;  5DD4 A;  3ULQ B;  2FBI A;  5E18 F;  5K5R A;  3E5X A;  5ICG A;  1FT9 A;  1P4X A;  4HV6 A;  3V7R A;  2VOO A;  1BI0 A;  3EYY A;  1FZP B;  3HRT A;  2VC0 A;  1KQ9 A;  3FM5 A;  2IW5 A;  1FP2 A;  5D4S A;  3CLO A;  2B0L A;  2D45 A;  3TDZ C;  1I1G A;  2NNY A;  2YSR A;  2ZXJ A;  2H94 A;  3ECH A;  2HYG D;  1UHW A;  1R5G A;  1O7F A;  2H27 A;  1ZRE A;  3LAJ A;  3JAM Z;  2A69 F;  4IXA A;  4I09 A;  2V1D A;  1HKQ A;  2Z99 A;  3VB2 A;  5HLI A;  3FF5 A;  3DP7 A;  3CO7 C;  4IRG A;  2ADU A;  4EJT A;  5LHI A;  2Y48 A;  2H09 A;  2D1H A;  2E1N A;  2IRF G;  4PDK A;  1J7K A;  5DUI A;  1W7P D;  4IVN A;  2GZW A;  3F8N A;  4XLN F;  1XGS A;  1R22 A;  5JI6 A;  2ACJ A;  2F2E A;  3R60 A;  2PMU A;  5JHU A;  1ZAO A;  4KN7 X;  1OMI A;  2AS5 F;  2QBY A;  3GX4 X;  5ILV A;  5HS8 A;  1KA8 A;  3F6O A;  4L0Y B;  4U0V A;  4EGY A;  1XGN A;  2BE5 F;  1HW1 A;  3CUQ A;  4RB2 C;  4ASN A;  2GAU A;  4HYE A;  4BHC A;  4JQF A;  2M45 A;  2P8T A;  2HOE A;  1ODD A;  1AOY A;  3PFI A;  5CVR A;  3QOP A;  5DV5 A;  1B1B A;  4WXH A;  3FMQ A;  2EFO A;  3ECO A;  2RKH A;  1XSX A;  2EJR A;  3RPQ A;  2EWN A;  3CUQ B;  2LSO A;  1Z7U A;  4LGW A;  3VEP A;  2E7X A;  4UVB A;  3LA2 A;  4Q48 A;  1FBQ A;  4BQA A;  3CUO A;  2FMY A;  4U0W A;  3IKT A;  2FOK A;  3E6D A;  2BYV E;  1GXQ A;  5BS6 A;  2QVO A;  4CGZ A;  5HS7 A;  1BIB A;  4MHG A;  4OIQ F;  4EJV A;  3E6M A;  2P6T A;  4RB3 C;  1SD7 A;  5JFR A;  4HF0 A;  5D5X B;  3BOQ A;  2XVC A;  4WX9 A;  2PMH A;  2DLL A;  3RIR A;  5HLG A;  2VE9 A;  1ZYR F;  2DFI A;  1FNN A;  3PQK A;  4A0X A;  3JSO A;  1FX7 A;  1J0R A;  2LNB A;  3BP8 A;  4Y13 A;  3M8F A;  5JR3 A;  2YX7 A;  3O6B B;  2Z3Y A;  2FA5 A;  2X0L A;  3H92 A;  2UXN A;  2KJC A;  2FSW A;  2H6C A;  4NB5 A;  5DD8 A;  1S6L A;  2XKO A;  5ED4 A;  5HDG A;  3DF8 A;  1R1U A;  5CLS A;  4U0Y A;  2G7H A;  3K9T A;  5BPD A;  5E1X A;  1UHM A;  2K02 A;  1W5T A;  2VBW A;  3M8E A;  3J7A O;  2DK5 A;  3JTG A;  5DDG A;  4ENJ A;  2STW A;  2QEN A;  3Q5F A;  2A68 F;  5ILU A;  1UB9 A;  1H0M A;  1P4W A;  1BOA A;  2X4H A;  1JXS A;  5CVJ A;  2FRH A;  4KIC A;  2Q0O A;  4F7Z A;  4DNC A;  4KNY A;  3HRM A;  2IPQ X;  3K0L A;  2P5V A;  4OIO F;  1T39 A;  3RKX A;  2J5P A;  5DCM A;  4UVC A;  1KU9 A;  2PJP A;  1Z6T A;  2W84 A;  1Z1D A;  1IW7 F;  4HLX A;  3HSR A;  2XKP A;  1R7J A;  4L9V A;  4FT8 A;  4R8H A;  1IN8 A;  1ZGJ A;  2VN2 A;  2O61 A;  3L9F A;  1FPQ A;  3KZY A;  1HQC A;  3F21 A;  2F5D A;  4M71 A;  5LEK A;  3T8T A;  1G3W A;  3GO5 A;  3WE3 A;  3LA3 A;  2JT1 A;  3WG9 A;  3ZN1 A;  4WF2 A;  1GXP A;  2QLZ A;  2NNN A;  1LEB A;  1U6G A;  3L00 A;  5F1R A;  1KU3 A;  1T0F A;  2VBZ A;  2HTJ A;  1YG2 A;  1GHC A;  4D0P A;  3ABT A;  4DQ2 A;  3R61 A;  3ZMT A;  4MTD A;  3HRS A;  4IPA A;  4M73 A;  1F9N A;  2DPU A;  4LLG F;  2A61 A;  3M9A A;  4KDP A;  4OIR F;  3KZZ A;  2YX4 A;  5FO5 A;  1G3S A;  4UUV A;  3HTU A;  4I0B A;  1HXD A;  4L5I A;  1FLI A;  1PUE E;  4XRF A;  3FHZ A;  1FC3 A;  3SHF A;  2MD5 A;  4Q47 A;  3N97 A;  3LQR A;  1RUN A;  2NAZ A;  4UXN A;  2XAJ A;  2OA4 A;  4KT5 C;  4LK1 F;  3E5U A;  2W24 A;  2MA3 A;  4I01 A;  2BGC A;  5A2Q Z;  4G8X A;  2XAG A;  2A3S A;  3EDP A;  3V4G A;  4HQE A;  3Q9S A;  2E7W A;  2MBF A;  4UVA A;  2Z9O A;  2HFH A;  3J81 Z;  3HOT A;  3DFG A;  3WTT C;  2ISZ A;  2GA2 A;  2FBK A;  3KLN A;  1WSU A;  4Y15 A;  1MDM A;  2EV0 A;  1K6O A;  3LFK A;  1TW2 A;  1PP7 U;  1FBU A;  3M1E A;  3SXY A;  1G3T A;  4RAZ A;  4HV5 A;  4EV0 A;  1E17 A;  4P5O A;  3KP2 A;  3DEU A;  4M9S A;  1XCV A;  4EM1 A;  4LK0 F;  4P9F A;  4M9Z A;  1MDM B;  3TO6 A;  1MD0 A;  4YFX F;  2CWE A;  4YIF A;  1I27 A;  2GIV A;  4KIG A;  1B59 A;  4RAY A;  5IT9 Z;  1HW2 A;  3MCZ A;  4QWQ A;  2L02 A;  3F8F A;  2M1B A;  2FQ3 A;  1RNL A;  2ZFW A;  4RB0 A;  3NRV A;  2BV6 A;  2WTE A;  3Q9V A;  2GXB A;  4OMZ A;  4PGG A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...