2E2HJ

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2hJ00
2R93J 5J1UA 3JRGA 5FLMJ 4A3LJ 4JX5A 1RETA 2ID6A 1FTTA 1T56A 2JJ7A 3M4OJ 3JRAA 2JA5J 2EZKA 2KT0A 4C2MJ 2NS7A 3BTCA 2N8GA 2L0KA 3QPLA 4GFBA 2YS9A 4QSHA 1B72A 3B6CA 1W0UA 5EF6A 3BR3A 2PMZN 3OIOA 4IHYA 3NARA 2DMQA 1WGXA 2M34A 1HDDC 3L1PA 2HYJA 4W97A 2CU7A 2GLOA 1HOMA 2EH3A 5IP7J 1NTCA 2XGDA 2X48A 1JKOC 1X58A 2NVQJ 3K2AA 1B8IB 1IG7A 1IDYA 2WV1A 2RAEA 3GTKJ 5GPAA 5K7ZA 5IYCJ 2R0QC 4IEJA 4V2GA 4D7NA 3S1RJ 3HOVJ 3G1OA 4FE7A 5C4JJ 4MIMA 1ETYA 3HEFA 2DN0A 5F1JA 3ZQGA 5IOZA 3BR2A 2H8RA 5F0FA 3UKGA 4MO7A 1MBJA 1U8BA 1JGGA 3I4MJ 4IHWA 1JUPA 1DU0A 3CDLA 4EEFG 5HODA 4DW6A 2R5YB 4A3IJ 3FK7A 2ELKA 3K7AJ 1LE8A 2IEKA 2M9HA 3GTPJ 3PO2J 1K61A 3E7LA 1FTZA 1ZK8A 2CJJA 3BTJA 1U9NA 5E3LA 4BBRJ 1RPWA 1G2HA 1IUFA 2P81A 1BA5A 1U9OA 3HKZN 4Y7NJ 4IHXA 2VUMJ 3CMYA 1RESA 4AYBN 3HB9A 2VKEA 1UMQA 4D7MA 2O9LA 4B4CA 1MBFA 1WCMJ 2NVXJ 3A03A 2M8GX 1I50J 2XPUA 3PO3J 4M3DA 1SANA 3O8HA 1BJZA 3HBLA 1H88C 1U78A 1HLVA 4A3CJ 1RKTA 5J1YA 2Y9ZA 2XPWA 3BQYA 1XC5A 4X1EA 3LNQA 4W1UA 2JN6A 1JUSA 3GTGJ 5DTDA 1IDZA 1MBHA 2IAIA 3FKIJ 1Q1VA 3IH4A 5M3FJ 3JRBA 1HDPA 3BR5A 5M5WJ 1SFOJ 4C3IJ 4RDUA 1JUMA 2FQ4A 9ANTA 1NK3P 1R9TJ 4D5CA 4DZJA 3FK6A 2HI3A 2G0EA 2Y2ZA 2Y31A 1ZTRA 3BR1A 1FEXA 5J1RA 5F04A 1OCPA 3SJMA 3JRHA 5IP9J 5K7HA 4XRSA 1JT0A 4AC0A 1OJLA 1PUFB 1JTYA 3OOUA 5EG0B 2M0CA 3WHCA 1UHSA 3Q0WA 2AO9A 1QRYA 2HXIA 3IH3A 3G1MA 3BTIA 1JJ6C 2IBDA 4UUTA 3GTJJ 1YRNB 2MW8A 3D1NI 3BT9A 2DA6A 3A01A 3O8GA 3MVPA 1FIAA 1Y1VJ 4A69C 3ZQFA 3S1QJ 1FJLA 5FKLA 4XRMA 3HOZJ 1IRZA 2E2HJ 2WAQN 2NS8A 2R5ZB 4UUSB 1JJ8C 4FISA 4A3EJ 2R92J 2K9QA 3JRDA 2CRGA 5FKMA 2DMUA 1VI0A 5C4XJ 1LFBA 4D5FA 4DYCA 2XPVA 2X6OA 2XB5A 2L7MP 3LOCA 3JRFA 1WH7A 5EGOA 2DA4A 4JYKA 4CYCB 4I76A 2DA5A 5FKOA 4A93J 5F0CA 1IV6A 2DA1A 3CQZJ 1RKWA 1ZKGA 2MGQA 1T33A 3S14J 2HOAA 4A3GJ 5M5XJ 4JX6A 3HOWJ 2GM4A 3FISA 2JMWA 5IOYA 3CCYA 1WI3A 4XIDA 4M3GA 4V2FA 2YUSA 1P7IA 1S7EA 4MFEA 2R7ZJ 4S0HB 4HNVA 1F36A 5F27A 5EZHA 1JKRC 3SFIA 2NOGA 3ZQIA 5E3OA 2ID3A 4B3AA 1VNDA 4ABZA 1GV5A 2L9RA 4QTRA 1GT0C 5BNGA 3IV5A 1IC8A 5EZGA 2B63J 5C44J 3OSFA 1GVDA 1MNMC 1ETOA 2HDDA 3S2HJ 1VFCA 1JT6A 1BL0A 3S1MJ 1ZQ3P 1WPKA 1X2NA 2E19A 3BG3A 1MBGA 2OPTA 1H89C 3S17J 2W48A 1ETXA 1MH4A 2K9SA 2JWTA 1B72B 3BTLA 2Y30A 3Q0UA 2OF7A 3BQZA 3PM1A 2DMNA 3RKQA 5IP6A 3QPSA 3BG5A 2ECBA 3HGGA 3QQAA 4NDLA 3JRCA 1A5JA 1NK2P 1TWGJ 2E2JJ 1Y1WJ 2COBA 5J3LA 2ECCA 2VKVA 1A6IA 1QPIA 3JR9A 1X2MA 2VI6A 4QIWN 3RZDJ 5FKKA 1ETVA 1UG2A 2XGCA 1RR7A 3DCFA 3TP3A 4C3HJ 3B6AA 4G12A 3W6VA 2EQRA 5C3EJ 5IPAA 1EF4A 2FX0A 1DU6A 1I3QJ 1P7JA 1TWHJ 4M3EA 3TW7A 4IHVA 1O4XA 3S15J 4FTHA 1D5YA 4M6VA 5GP9A 1LE8B 2O7OA 1B8IA 2Y9YA 2H1KA 5JLWA 1ZR4A 5IYDJ 5K7FA 5FLVA 1WH5A 3DEWA 2QCOA 1VF9A 1XG1A 3I4NJ 3GTOJ 1MSEC 1AHDP 2DA7A 2LK2A 2E2IJ 3BR0A 2CUEA 2WB1N 3GTQJ 1ETQA 4BBSJ 3LSGA 4XK4A 2XRLA 2Y0SN 2R5YA 4J19A 1JKQC 2LY9A 1QVUA 2GBYA 3G1LA 3JRIA 1ENHA 2L7FP 4DZPA 4FE4A 3Q3SA 2YU9J 3S16J 2LVSA 4DYQA 1I6HJ 1W0TA 3GTMJ 3TW6A 5F08A 4MFDA 5E3NA 2QF7A 1BW5A 2XSDC 2EZHA 3WHBA 3H0GJ 4XRSG 5GPCA 1AKHA 4BXXJ 1Z77A 2EBIA 1MBKA 2DA2A 2NVYJ 2NVTJ 2HQ5A 2DJNA 3A02A 5E3MA 3ZQLA 3FIWA 4M3BA 4B1RA 3M3YJ 3TEDA 3Q0VA 2LD5A 2I10A 3GTLJ 1ORKA 3H3VK 4LOCA 2XGEA 5IYBJ 4RBOA 2FD5A 3LSRA 2O8KA 3HOXJ 3S2DJ 1K83J 2ME6A 2XB0X 5EYRA 3JREA 4A3DJ 2LFBA 2HOSA 4A3KJ 2LKXA 2KDZA 4BY7J 1QVTA 1BW6A 1OFCX 2LLKA 3TP0A 2VPRA 5EDNA 2CQXA 1E3OC 2DA3A 4XICA 3ZQHA 2TCTA 3LSJA 3A01B 4I6ZA 2DMTA 3BG9A 2E1OA 3ZOBA 3RQIA 2D5VA 1TWCJ 4M3FA 1OCTC 1PUFA 3GBGA 5EG0A 4Y52J 2X9DA 3OSGA 2JA6J 2MSYA 5F0HA 2CUFA 4A3MJ 2CQQA 2FJ1A 3VPRA 1Z0XA 1YRNA 1HCRA 2HOTA 1XS9A 4X6AJ 4AUXA 1TWFJ 1LFUP 1IGNA 2K9NA 2DMPA 5EGOB 2LP0A 2LTPA 1ZGWA 1JKPC 3HOUJ 2AHQA 1AU7A 5M3MJ 1HF0A 1CQTA 4MLOA 2MG4A 1AKHB 5FJ8J 1APLC 2DTZA 2R5ZA 4UUSA 3SDGA 2LR8A 2JK3A 3F0CA 3IH2A 2EZLA 5FKNA 3ZQCA 4A3FJ 3HGYA 4C3JJ 4A3JJ 1GDTA 3HDDA 4CYCA 1TC3C 4JX4A 2HXOA 2M2EA 1FIPA 1MBEA 4BKXA 5M5YJ 1MH3A 1MSFC 1JTXA 2TRTA 1IJWC 3HOYJ 3C2BA 3HM5A 4L5EA 2ME0A 4FCYA 1ZR2A 5DS9A 1F43A 3S1NJ 4BY1J 1GV2A 5EEAA 2JA8J 4A3BJ 1ETKA 4DYRA 2JA7J 3MN2A 1GUUA 2EZIA 2ZB9A 3LSPA 1ETWA 2L7ZA 1TWAJ 2K40A 1H8AC 1POGA 1ITYA 5JLXA 3MKLA 3BR6A 4JP0A 3NAUA 3RZOJ
chains in the Genus database with same CATH superfamily
3TGNA 4CCOA 3S32A 4AVPA 4PGHA 2FRHA 2IVMA 4ZDOA 3FXKA 1HKSA 1XGSA 2HPMA 5LEJA 3ULQB 3DTEA 1B6AA 1R58A 2F48A 2CV0A 2MH2A 3ECOA 1FOXA 3QU3A 3V7SA 5DM7F 5ICCA 4BQAA 3U2RA 4BJTA 3H35A 5LHHA 3M4OJ 1AOYA 3DKXA 4IO9F 4MNUA 5CVJA 2EV0A 2NS7A 2CFOA 4NBQA 2CGPA 3E5QA 2FSWA 2F4IA 4XORA 3MKYB 4UNOA 1B72A 1WRJA 4WCGA 2P0WA 3F6VA 3OIOA 2WTEA 1LVAA 2IGOA 4B44A 5TGTA 3NARA 2E60A 1WGXA 5CQGA 3GX4X 3VEPA 1WSUA 2ZCWA 4IX7A 4PJLA 6PAXA 3H9JA 2KMUA 3JSPA 2HYJA 2GLOA 1HOMA 2K9LA 2RDPA 1VZ0A 2DFIA 2QVOA 2XGDA 3L2CA 1T0FA 5GAGJ 1MZBA 2FEZA 3ZMZA 1B8IB 1IDYA 3T0YA 3GTKJ 2FA5A 4E4HA 1QHHD 5IYCJ 3V7RA 1FOKA 2R0QC 5FROA 2FBKA 4FE7A 4BU2A 4NUBA 4RGRA 4ZYEA 5C4JJ 4MIMA 5B3SH 3P9IA 3GVAA 1H0MA 5IOZA 3F21A 2WBMA 5F0FA 1OR7A 4MO7A 1JGGA 4IOAF 1U0JA 3I4MJ 4FT8A 1JUPA 1AWCA 4NC7A 1DU0A 2H94A 2ELKA 1LE8A 2G9WA 1Q1HA 1XB4A 4KT5C 3Q9SA 4OIQF 3RYPA 2CFXA 3HJEA 2FU4A 3KFWX 2IGMA 3E1SA 2PG4A 2BXZA 3AL0B 2BYVE 3O3KA 4AYBN 5F6FA 1GHCA 1DGWY 3FMRA 1LDKB 4DBQA 3GYHX 2DCEA 4RAYA 3ERED 2HGCA 4HX7A 2A6HF 1SD6A 4B4CA 3FDYA 4HYEA 5HOOA 1WCMJ 1NH3A 4IKFA 1YJWI 1N77A 2XPUA 2RQPA 4M3DA 2WAQA 4FHTA 2JSCA 3AL0C 1W36D 1U78A 1REPC 1XC5A 4X1EA 4W1UA 2JN6A 1IDZA 1MBHA 2R7TA 3HHHA 3M8EA 1W7PB 5KHDA 1IRGA 1OCZH 3BPVA 2ZXWH 5H2FC 5IT3A 1HDPA 2GAUA 1IN6A 2X6YA 1JUMA 9ANTA 1VQ7I 3HRMA 4D5CA 3UNGC 3TO9A 3FK6A 3VB2A 1O3RA 4II3A 3LA3A 4RLQA 3CCSI 3CP2A 1OCPA 2XKOA 4RMNA 2BY3A 5IP9J 5JHFA 1V5GA 3Q9VA 2QA4I 4LGWA 1KU3A 1XMKA 2VQLA 1JGSA 4CO8A 3G6EI 4PJNA 2QYOA 1UAAA 1UHSA 2AO9A 4A12A 1BJAA 5LHGA 1ERDA 4NC6A 1JJ6C 1I5ZA 1YRNB 1S9HA 2AXTC 1KONA 4ZDLA 4J00A 2MW8A 1VQ6I 5E8GA 3D1NI 2DA6A 3A1YA 2HTJA 1XX5A 1WJFA 2OTJI 4G7ZF 1FIAA 4A69C 3ZQFA 2EILH 3ZGKA 2H8WA 2Q1ZB 5FKLA 1IRZA 2VC1A 2F4MB 3SHFA 4KIFA 4LLNA 2R5ZB 1V54H 4UUSB 3CDIA 1JJ8C 3EYYA 3FXMA 2DOEA 3LA7A 3JRDA 5FKMA 3LFKA 2MBFA 3ASNH 1VI0A 4XN3A 1K6OA 1LFBA 1GLNA 3W6JB 2DO7A 2EFNA 1EA3A 3JRFA 1YITI 3DBHB 3WGIA 1WH7A 4N4OB 4CYCB 1FYKA 3K4CA 4LK1F 4AWXB 4XSZF 4CGZA 1QZYA 2CH0A 5F0CA 2DA1A 3FXLA 2ICWG 3OYGA 2X6XA 4E6KG 4A3GJ 4LG0A 2E7XA 3HOWJ 3TO6A 2OQGA 1G4DA 4M3GA 5HDGA 3NQOA 2CWEA 3RPQA 2CW7A 1TNSA 1X3ZB 3CLOA 3OOPA 1P7IA 1X19A 4RAGA 3G2BA 4UV9A 3KETA 2XAGA 4HNVA 5F27A 2NNNA 1S3JA 3S3NA 1HXDA 4N4NB 2L4AA 1SEUA 5DUIA 2BBYA 5CPRB 2NOGA 1FPQA 3F8CA 1N75A 4IRIA 1UZCA 1GV5A 2PJRB 4QTRA 3N4MA 1GT0C 5CYVA 1IC8A 1QZEA 4S05A 5C44J 3OSFA 5JFRA 3I4PA 1RNLA 2C6YA 2IS6A 2RGVA 1WJAA 2F5VA 1FSHA 1JT6A 1YX3A 3KPHA 2BXYA 3MQ0A 1BL0A 4EM2A 3U9GA 3S1MJ 2E19A 3BG3A 2LNBA 2OPTA 2VB6A 1IV8A 2WY7Q 3S17J 1ZG3A 1TLHB 3BTLA 2Y30A 2FNAA 3KP2A 2IA2A 1EH8A 2HTSA 2BY2A 2VN2A 3M8FA 5ED4A 1TT0A 1P92A 2WA0A 3ZN1A 1BIAA 1FBUA 2D1VA 4NDLA 3CMAI 4E7HA 2RNJA 4PK4A 1ODDA 5BPIA 2AXLA 2VQCA 3SYTA 1SD5A 2E2JJ 3K4KA 1YW8A 2LRDA 3RYRA 3OS1A 1D8JA 1H9TA 1FNNA 4EMSA 4HQMA 2XGXA 3H0DA 3I55I 1RRJA 3JR9A 2XC7A 2ISZA 3I64A 3H3ZA 3CUQB 1ETVA 2W1OA 2E1NA 2EJRA 3TP3A 4C3HJ 3CZ6A 3S3OA 2DQRA 2EQRA 3ASOH 2CMPA 1TWHJ 5CJ9A 2R4GA 3S15J 3DWLE 1SFEA 3ZQ7A 1SVOA 3VYUB 3PIPF 1I1GA 1B8IA 3ELKA 3OYJA 2Y9YA 2H1KA 1OCCH 2COMA 2XROA 3V8JA 1HW5A 4YG2F 4F91B 1WH5A 4CHUA 2X4HA 4E7SA 2QCOA 3JTGA 5TISC 5FLXK 1VF9A 1T39A 2W82A 3HOTA 1X3UA 3VSKA 4BHBA 2DA7A 2VJIA 4II2A 3WU1B 3ABUA 4XM3A 4BS9A 2ESHA 1NG7A 2WB1N 1YTYA 2FBIA 2L3DA 3F6OA 1ZGJA 2VJ5A 2JVGA 5BPDA 3LMMA 2Y0SN 4J19A 1VQKI 2P5KA 3J81K 4EM0B 1K79A 1ENHA 1WJDA 4N9HA 2DPDA 4ZYHA 4R8HA 4BE2A 3Q3SA 1UCRA 5GAEJ 1I6HJ 3K70C 3H5NA 3K4LA 4HLYA 2VT2A 1KYWA 3W2AA 2FXAA 2XHKA 2QSGX 3K9TA 4ZJZA 1R00A 2XSDC 3R0AA 2KISA 2XAHA 4Y4RA 5L3EA 5GPCA 1LNWA 1E2XA 1MBKA 2GWRA 4XBFA 2DA2A 2STTA 4CYDA 3SFZA 3A02A 5LD2C 2ZXJA 2OCCH 1R23A 2EIJH 2M87A 2MC4A 3M3YJ 2LD5A 3M1CA 3RCOA 3KYCB 4PJ0C 3JCUC 4OAYA 4LOCA 3KIOA 5HDKA 2XGEA 1X1PA 2A07F 1MNDA 4RBOA 1EJ9A 5D5VB 1V3FA 2HNHA 2X1EA 3REOA 1BOAA 1W7PA 1ZLKA 5E79C 1EH6A 4F92B 2A5YB 1P4WA 2FE3A 5DV5A 4A3DJ 2LFBA 4GYGA 3H36A 2LY1A 2R7WA 3HSFA 1QVTA 2DDAA 1BW6A 4BDZA 3RPUA 1W1WE 4YIIA 2DA3A 2VQGA 2LF7A 1MMDA 3BJOA 4RB0A 3DKWA 3LSJA 5L3GA 3A0HC 4I6ZA 2DMTA 2GXBA 5BQTA 2E1OA 2JQ7A 2VKDA 1IAWA 1LB2A 2R7UA 2F6CA 2STWA 3GBGA 3KP3A 3IC7A 4PSXA 2R7QA 3OSGA 1P2FA 2VLAA 4X0GA 5LEKA 4A3MJ 2LBFB 4XOPA 1KGSA 2BY0A 2CQQA 1YRNA 3VPRA 1TQPA 3GUDA 4XLNF 1HCRA 5DYMA 2MABA 3PSFA 3M1EA 1LFUP 3F72A 4G9YA 2DMPA 3O6BB 1NHAA 1A04A 2VL8A 3PFIA 2KIUA 3MFKA 1CQTA 2XASA 3BP8A 1AKHB 2ZNZA 2K3PA 2R5ZA 3MWMA 4UUSA 1A36A 4XLEA 4ESFA 3PUBA 4UVAA 3ZQCA 1E0EA 2VPLA 2V1NA 3HGYA 2MFZA 3VDXA 2YPRA 4ZTFA 4P9UA 3WTWC 4CYCA 3HTSB 2HXOA 1B1BA 1RZ4A 3VYTB 3BOQA 2A05A 1JHHA 5M5YJ 1ZREA 2PX9A 1T2KA 1IJWC 4HF2A 1Z91A 3G73A 3HM5A 2ME0A 2L5QA 2QUFA 1FZPB 1F43A 4ZH4F 4R79A 5EEAA 2EZIA 2K9MA 2IP2A 1OR7C 4PJMA 1S7OA 2EPFA 1R22A 1TT5B 1XCVA 2K40A 1HBXG 3J80K 1D3YA 4GGGA 4XMYA 3MKLA 4HRIA 4N9IA 3OYBA 3BG6A 4HNTA 5H6QA 1G59A 3PNVA 1IZ1A 2IT0A 5FLXZ 2UZKA 1XMAA 4CCNA 2PJRA 1F5TA 2ID6A 2L4MA 1U3EM 2OZUA 1T56A 2P4WA 3GLLA 5HS9A 5ICFA 1U8RA 3PJRA 1V5FA 1HW2A 2Q8KA 3QOPA 3DTKA 1SD7A 2HKXA 4DBRA 4RLFA 3BZCA 3JRAA 1Y39A 2EZKA 1RC9A 2Z5UA 1VQ9I 2JVHA 2N8GA 1IN5A 2W84A 1MKMA 4XLCA 4MEYF 5ILUA 3RQ4A 2VBZA 4QSHA 4KA4A 3B6CA 1W0UA 2BW3B 3BR3A 3DF8A 3ABTA 4LMYA 1YJ9I 4HF1A 1LDJA 1IRXA 2EWNA 2LC2A 4IQJA 2DMQA 3TKYA 1CGPA 1KQ0A 2PMUA 4AIKA 4XKBA 1FP2A 1X1AA 4UHTA 1YYVA 2I5UA 3BDDA 3ROUA 2M8EA 2O8XA 4HPQA 1VQ4I 2ZFUA 1EH7A 1S6LA 2BZTA 2X48A 1JKOC 2WV1A 1D0XA 2RAEA 5LGNA 5GPAA 4V2GA 3QRFF 3CUQA 3S1RJ 3HOVJ 3I0TA 3KE2A 5FD5A 2Y69H 5D4SA 2QEXI 1ETYA 5IY5H 4JK1X 3ZQGA 2H8RA 2X1CA 3UKGA 1MBJA 1U8BA 1YO5C 1H9GA 1KQ9A 3PIOF 4DW6A 4A3IJ 4MTEA 1OYWA 3K7AJ 2BVMA 2ELJA 2DTRA 4DGWB 1S72I 3GTPJ 1FY7A 3KP6A 1K61A 1FTZA 3BTJA 2CJJA 1G2HA 3DLLF 3CMEI 3DPLC 4KISA 4I98B 4ZDPA 3CCMI 4BYYA 1BBYA 1WJEA 3FXUA 4BL0B 4Y7NJ 4U7DA 4EJUA 5H20A 4ENMA 3W2WA 3HB9A 4BHCA 3CC2I 3H9GA 1UMQA 3WTTC 4D7MA 4HSTA 3R61A 5L3DA 2BHYA 3UR3C 3ZR8X 3V4GA 1FWZA 2DYRH 1SANA 3O8HA 1HA8A 1HC8A 2G7HA 5CVVA 4HNUA 2EA2A 2PMZA 1RKTA 3S2WA 2Y9ZA 2HR3A 5D8KB 3SEZA 4UVBA 1G6NA 3H3UA 4ASNA 2UXNA 3LL7A 4IVNA 3RKWA 5DTDA 2ZNYA 3RPUD 3QODA 1Q1VA 4HZFA 3JRBA 4V19K 5JR3A 3BR5A 1SFOJ 2M7BA 4RDUA 2CS3A 2FQ4A 2V9PA 5FB2A 1NK3P 2DT6A 2HDWA 4DZJA 1V55H 4Q4ZF 2GA1A 1XDUA 5E17F 2YX4A 4CZZA 3ZCOA 1ZTRA 3DLAA 1FEXA 5J1RA 4KJZA 4I02A 1D5VA 3SJMA 4BXFA 3JRHA 2RVCA 4FX4A 2L9VA 3DU6A 5D4RA 3OYNA 4FETA 5KAFC 1MJ9A 1JXSA 3A2KA 1D0YA 4PFPA 2V9VA 2CUJA 3Q0WA 2LG4A 2HXIA 1WWXA 3LSHA 1VQOI 4FX0A 4UUTA 3GTJJ 4E7JA 2VJJA 3ZQQA 3P7NA 4L0ZB 2KFDA 4WXDA 2VBYA 2BOLA 2E7WA 3MVPA 1XN7A 3O8GA 4BQOA 5ICGA 4KIGA 2XAQA 2M7AA 3K1MA 4XKWA 3HUGB 4YELA 1I27A 1FJLA 4OMYA 1SFXA 4FASD 4XRMA 5LRSA 1ZAOA 2O3FA 3HKZA 4HQEA 2E2HJ 2OV7A 5E8IA 4A3EJ 2O5RA 4EGYA 3OMYA 2LBFA 1BI1A 3WODF 4D5FA 2XAUA 2A61A 5A2QK 2JPCA 2X6OA 3FHNA 3T5XA 1KU2A 4A2UA 2ZJRF 3S93A 3WE3A 2MD0A 2AS5F 4AIJA 3CESA 3OIQA 5K5QA 3IUOA 4A93J 1IV6A 5GADJ 3S14J 1RKWA 3VYRB 2VT3A 2WWYA 1B9MA 2DOFA 2GM4A 4F52A 3FISA 2JMWA 1DGRM 5IOYA 1D1BA 2IPQX 3CCYA 3N05A 3DV8A 5DM6F 4M71A 1G3TA 1U2WA 4EJTA 1FOWA 1FSEA 2E34A 4V2FA 3CF5F 3HXLA 4MFEA 3SDBA 4WWCA 2R7ZJ 1YS7A 2HDCA 4S0HB 3MEXA 3GMEA 1BR1A 3AG2H 1YW9A 3EUKL 4MQ9F 5E20A 3ZQIA 2M45A 5TJJA 1CF7B 3T1BA 3I5UA 5E3OA 1BC7C 2ELHA 2OC6A 4B3AA 2CSOA 1I6XA 2L9RA 3R60A 5E1ZB 2XDVA 5BNGA 3IV5A 4L18B 1JI8A 3NWTA 5JVGF 1W5CC 3J7ZI 4HOBA 3CF2A 1LFPA 3DTIA 4XSXF 3HSEA 4P5OA 2JRMA 5B1BH 1MNMC 1U5TB 2HDDA 3SXYA 4BJ6C 1RUNA 2CV2A 3FKJA 1ETXA 2L01A 3Q0UA 5AIQA 2XIGA 2OF7A 3BQZA 1IRFA 3PM1A 2DMNA 3RKQA 2F2EA 1U5TC 3K1NA 3QPSA 3HGGA 3BJ6A 4M6XA 4CCLA 1KA8A 3FWEA 3S3MA 1PVEA 2LREA 3TDUC 1OPCA 3L09A 2W4SA 1M1EB 1Y1WJ 5KK1A 4LJZF 2COBA 3L2WA 2ECCA 1A6IA 2ZC2A 2NYXA 3V8LA 2BW3A 4LFUA 1Y0NA 3LSIA 2P7CB 3ZMVA 5LBQA 3GO5A 4QIWN 3RZDJ 5FKKA 1ZYRF 2IRFG 2A3SA 3L9FA 4WX9A 2W57A 2VBXA 4AIDA 1P7JA 2DFEA 3DBLB 4M3EA 5KVRA 2MC3A 5DUKA 3ONQA 2MA3A 4CCJA 4FTHA 3KEQA 4IL6C 4PGGA 1TL8A 1F4KA 2FF4A 3GXOA 1WZ2A 5K7FA 5L3BA 4YIFA 5DDGA 1GXQA 2HOEA 4HX8A 4PDKA 4RM3A 4Y33A 3H92A 4NB5A 3EPZA 3JAMK 1WJCA 2RREA 1T38A 1XCBA 5JI6A 2DU9A 1ETQA 4D0PA 3S8PA 3WGHA 1JHFA 4U0WA 4MHGA 1QBJA 2XRLA 1IN8A 2LY9A 1QVUA 4BGDA 1YW7A 4C2TA 4XR6A 2VKHA 4GO1A 3K4MA 4I99C 3TO7A 2YU9J 1L0OC 3J7YJ 2LVSA 3H1CA 2KJCA 1W0TA 1I3AA 1S29A 4OIRF 3GFMA 3GTMJ 4HA8A 3TW6A 1QGPA 2EZHA 2PI0A 2RN7A 2XF7A 3F3XA 5L3CA 3CCVI 2GXAA 3WHBA 3WGGA 1Z77A 1NG6A 2EBIA 2MD5A 3O2PE 1GXPA 2R7OA 2NVYJ 2QWWA 2DT5A 1FT9A 2HVQA 5A2QZ 4RAZA 3ZQLA 3FIWA 3FM5A 2PN6A 1RUOA 3TEDA 3RTRA 3FMQA 4M6YA 2QZ8A 3VODA 4L0YB 2GIZA 2H27A 1BN5A 2ZMEB 5LGUA 2DT7B 2V6EA 2FD5A 5D5WB 2P6SA 1SVLA 3S2DJ 5ILVA 4P9FA 1UHMA 2E1CA 3D5LA 2IS4A 2LKPA 3G71I 3AG3H 1T95A 1FYMA 3EUHC 3DKYA 2LKXA 4BY7J 2JA2A 2K5CA 2Y0MA 4M73A 1OFCX 2LLKA 1IXSB 2IGNA 3P9KA 2CQXA 3WTZA 2OAZA 5EDNA 1E3OC 4TV7A 1Z3YA 3CD6I 2HVRA 1MJBA 3A01B 2A69F 3JTHA 4RM2A 3IKVA 1TQMA 1LDDA 3PSIA 1TWCJ 4M3FA 2MH9A 1PP8F 3EUAA 4HW0A 5CQEA 3RDIA 3WG9A 1O3QA 4Y52J 3C2HA 1K7AA 2ESNA 2BV6A 1N78A 4K2EA 5D6EA 2DFHA 2R7RA 3DQVC 2FJ1A 2FMLA 3KZYA 4X6AJ 1XMXA 3GFLA 4AUXA 2Z9OA 1TWFJ 1IGNA 3OYDA 5EGOB 2CO5A 3HC7A 1BI0A 1ZGWA 1JKPC 5IT9K 2AHQA 5GAHJ 2MLKA 1DPRA 3HUGA 2L9NA 3K1PA 2X6WA 4MLOA 2CV1A 3C2GA 2PBIA 2LY2A 5FJ8J 4ZZDA 1APLC 1OLTA 2PQ8A 2DTZA 5KAIC 3B02A 4OWRB 2KL4A 4WK8F 2JK3A 1YLFA 2EV5A 3F0CA 4A0YA 2V79A 3IRRA 2J5PA 1EV7A 1UELB 1GDTA 2E35A 5HNFA 3C7JA 3W2VA 3HDDA 4AIHA 3J7AO 2M2EA 2V9KA 2K86A 2P6TA 1LJ9A 4L9NA 1MH3A 4BKXA 1MSFC 5J8FA 1P6RA 4AVZA 3CUQC 4UV8A 3HOYJ 1SFUA 3ABLH 2RNGA 1SAUA 2QSFX 3R6SA 1OYIA 2KKOA 3LSTA 1WFXA 2CG4A 2JT1A 2ZO4A 2JA8J 4ZYDA 4DYRA 5ILSA 2HFHA 2ZB9A 3QP6A 2DFFA 4WXHA 4E7IA 4I2OA 5DCFA 2ZXIA 4O6JA 4Y13A 3H5RA 2KIQA 1J7KA 4KDPA 1SMTA 1J5YA 1FBSA 1PUEE 2VJ4A 1CF7A 2HEOA 2NXNB 2DAOA 1XDSA 4A3LJ 4M9SA 4JX5A 4OOIA 2O61A 2E1MB 1MIJA 5CVRA 1FTTA 2XKPA 4G8XA 4YFNF 4Y15A 3BG7A 3AG1H 3GWZA 2Z1DA 3GCMA 2JJ7A 1DQUA 1U5TA 3HRSA 4HDVA 4ENNA 3LSKA 4XKVA 2JA5J 2K27A 5JHUA 4C2MJ 2EIKH 4HG2A 4KT6A 2L0KA 3QPLA 3OYAA 2E1MC 3KZIC 1B4AA 5DEQA 3HL2A 3AFHA 3LA2A 5EF6A 4DQ2A 1RI7A 2B7EA 2HQRA 4CSWA 3GEZA 5E1XA 1ZG5A 3DPUA 4LG3A 2Q2EB 2P7VB 2QBYB 3OYEA 1HDDC 3ZMTA 4I09A 4W97A 3QAHA 4LB5A 1FX7A 1R36A 2CU7A 1Z3XA 2M4KA 2X0LA 5J8CA 2EH3A 5IP7J 1YOVB 1NTCA 2L7KA 3OWTA 2CQNA 5E18F 1X58A 1MMNA 3K2AA 2NVQJ 3KP7A 1IG7A 2A6TA 2QQ8A 2KRHA 1HKQA 1HW1A 4HDUA 1BM9A 1TW2A 2QSHX 3G1OA 5ERIA 5B5EC 3CC4I 2I8DA 3LFUA 2ZFWA 1DUXC 1Z7UA 3C1DA 1Z05A 3BR2A 2L02A 4XLPF 2MLGA 5HS7A 3RIRA 1TQIA 2XF5A 4OAZA 3CO7C 1TNTA 4HF0A 4G7OF 4EEFG 4BJ5C 2JTVA 2R5YB 3FK7A 2HZTA 2F5EA 2QQBA 2F5CA 1UG0A 4U87A 1VQMI 2Z2SB 3A4CA 3E7LA 1ZK8A 3SQNA 1Y8QB 3WTXC 3OIPA 2IW5A 2KRCA 1BR4A 1I39A 2O03A 2P81A 1U9OA 1BA5A 1SVMA 2ETHA 2DW4A 1BI3A 2XF6A 3AG4H 5LHIA 3CJQB 5DCMB 2R3SA 4LLLA 5TRDA 2KP6A 4Y3OA 3E97A 2GIVA 1T8IA 2O9LA 4A0XA 1ZG1A 2DYSH 5HLIA 4B47A 3TOBA 1BC8C 1UHWA 3A03A 2M8GX 1I50J 1W4MA 2W7NA 1XSVA 3PO3J 2ADUA 4PCQA 2R7DA 3ZP5A 3HG9A 1H88C 4GYIA 5D6FA 2AQFA 1J2XA 4A6EA 5J1YA 3BQYA 1WI9A 1QNTA 4A5MA 1HKTA 4Y17A 4UB8C 4OINF 3FKIJ 3LWFA 5HLHA 3H9QA 3IRQA 5M5WJ 2JUCA 2QENA 1Z7LA 4C3IJ 4KICA 1T6SA 2H09A 2E5NA 3OV8A 2IA0A 2Y31A 3SEQA 1XGNA 2FNPA 4KNYA 2EINH 4DOZA 1R5ID 4ANJA 2X85A 3EUHA 3C3WA 5CLSA 3KX2A 2UV1A 4XL9A 5DD8A 4ETSA 3SZGA 2ZMEA 3PL8A 1K4SA 5K7HA 4XRSA 3F8BA 1JT0A 1WHUA 3HRUA 1VQ8I 4IXAA 1AA7A 4L5JA 1JTYA 1PUFB 3OOUA 5K5RA 2JPBA 4E70A 2FOWA 3WHCA 4IOCF 1F9NA 3IH3A 3G1MA 5H6RA 3SZTA 4F55A 1PP7U 2IBDA 1DP3A 3BROA 4YFKF 1UB9A 4D1QA 3A01A 1YQAA 1Y1VJ 1IXRC 4ITVA 2BHZA 2IA1A 4HAMA 1SC7A 3J81Z 3HOZJ 3K4JA 2IGKA 2V1DA 4CA0A 3QOEA 4QPOA 4O5VA 4YFXF 3EYIA 4AYBA 3HOSA 4FISA 3CCRI 2X51A 2K9QA 2CRGA 2E5ZA 2VASA 4I0AA 5C4XJ 3NEUA 3E6BA 1E3PA 1YJNI 4QWQA 2EV6A 1IN7A 1Y0UA 2XB5A 2L7MP 3LOCA 4IQ4A 2LF8A 4B3XA 4B43A 5EGOA 4J01A 4JYKA 4L5IA 3L00A 2EK5A 1MMGA 4I76A 2ZBKA 2DA5A 4HBLA 3C18A 5FO5A 3OYHA 3K4BA 5FKOA 3CQZJ 1ZKGA 1FOYA 4JX6A 5BOXA 1TP4A 3FZVA 3JSOA 4RB2C 5J6XA 1WI3A 1X1BA 3I71A 1S5LC 2Z3YA 1J59A 2YUSA 1S7EA 3ABMH 2ZJQF 2ZSHB 5ICEA 2B9SA 1F36A 1ZN2A 5EZHA 2VQHA 1JKRC 1C0WA 2UUZA 1QA6A 2RQQA 3HYIA 3M7GA 4CCKA 2ID3A 3KLOA 4ABZA 3KCCA 4UB6C 5AIPA 4KYWA 2CYYA 2M3AA 4P1WA 2ZKZA 4XLAA 1GVDA 4WF2A 3WTSC 3KP4A 3S2HJ 4I01A 2WADA 1F1ZA 1IW7F 2QLZA 3IL2A 3MMYB 1WPKA 3OYFA 5LLQA 1ZQ3P 5D5XB 3LAPA 2W48A 1OYYA 4H0EA 2K9SA 2JWTA 1SAXA 3GLXA 3DXJF 4N0BA 1MGTA 3TDZC 5HNHA 4KMUX 2EFPA 1W7PD 3BG5A 1WJ5A 2BY1A 1YHQI 2VXDA 3QQAA 4C9YA 3KYDB 4HV6A 3JRCA 1XD7A 4JOMA 2CW0F 2V1XA 1VQLI 2NS0A 1R4NB 1WVRA 1PJRA 1TWGJ 1Z1DA 3VFZA 1J0RA 2BEOA 3H5AA 3CCJI 1LEAA 1WQ2A 2XAFA 5E1WA 1S7AA 4L9VA 4LB6B 2PLYA 2VKVA 5B1AH 4ZZLA 1QPIA 5CKTA 2BGCA 2NNYA 2ISYA 2VI6A 1MMSA 5F64A 1OCOH 1UG2A 2Q2EA 3B73A 4A5NA 2XGCA 2QBYA 4KN7X 3DCFA 1RIOH 5KNLA 3W6VA 3FXRA 2VODA 2H6BA 3R4KA 1DU6A 1I3QJ 2Q0OA 3CMMA 4F7ZA 4IHVA 2VONA 4M6VA 1R49A 1LUJB 2O7OA 4UXNA 1B9NA 4P55A 1QHGA 4U88A 3M8JA 5HLGA 5JLWA 1ZR4A 3GFJA 1ZGAA 5IYDJ 3DEWA 3QP5A 3JW4A 4BACA 4RGSA 3I4NJ 4XOTA 4M9ZA 3J80Z 3QPHA 2PJPA 3OYKA 2ZJ2A 4Q5SF 4UY8I 3I53A 1AHDP 2E2IJ 3CTAA 3K69A 2YX7A 1O3SA 2CUEA 3I54A 4BBSJ 3LSGA 4XK4A 4CZCA 2R5YA 3D0SA 1JKQC 2GBYA 1VQ5I 3G1LA 2NRAC 2K4JA 3N97A 4DZPA 5J47A 5EEGA 4FE4A 5B66C 1WJBA 4XQFA 4KFCA 3S16J 1G8XA 3PQKA 2XUBA 4RAFA 5E3NA 4MFDA 1YIOA 3QU6A 2VOOA 3VOEA 5DCMA 3M07A 5BMZA 3DPTA 4IPAA 2K85A 3I56I 3H0GJ 1AKHA 3NWSA 3MZHA 2V4JC 1STZA 2B0LA 2NVTJ 2HQ5A 3OYIA 4BH9A 2OD5A 4M3BA 4B1RA 2UWMA 3HIFA 3PFYA 3Q0VA 2VE9A 1ORKA 2J5OA 4B8XA 4BDYA 1J09A 3H3VK 2DOAA 3FXJA 1IXCA 4MGRA 5IYBJ 2HS5A 3HOXJ 2OTLI 1LEBA 3D5RC 3BPXA 4NNJA 1K78B 5EYRA 1HSJA 1DDNA 2D2WA 4EQQA 4R1HA 1X3WB 1DP7P 3E5UA 3F8MA 3NRVA 3V8KA 1SD4A 2NVUB 3T8RA 4A3KJ 3LSMA 3MZYA 3RSNA 2KDZA 3FBNB 3ZMUA 3KZZA 5HS8A 3ESWB 3E6DA 3OL4A 3GZNB 1Y8RB 2ZSIB 3OR2C 3BCBA 5J40A 4XICA 1TZLA 2KRFA 3ZQHA 4PUSA 4RB1A 2W24A 2RV8A 2UXXA 1K6YA 2GQQA 2L9SA 3BG9A 5FGMA 4HX4A 2D5VA 4ENJA 4XRFA 3KYLA 2XRNA 3OYLA 2E71A 3CDHA 1PUFA 2OBPA 1PDNC 2F5DA 2WB1A 4PSWA 1VQPI 4ZC3A 1R71A 1Z67A 2HPIA 1IO2A 1USTA 3IHUA 2LH9A 2QQ9A 4L9TA 2JRTA 2MSYA 2CUFA 2Y0SA 2JA6J 4C2UA 2H6CA 1Z0XA 2HOTA 1XS9A 2M0MA 5HLTA 2K9NA 1HQCA 4BUPA 3QYFA 3HOUJ 1Z6TA 1KU7A 1AU7A 5M3MJ 2HKOA 4OU0A 1WKMA 3WU0A 1R1TA 1QPMA 2MG4A 3GF2A 4YRVA 4B48A 1K4TA 5FD6A 3MKZA 2LR8A 3E6MA 1PYVA 1IUYA 2IJLA 2EZLA 2M4GA 3IKTA 3OY9A 5FKNA 1ZRCA 4BQQA 4A3JJ 2LOOA 1MMAA 1YS6A 1UFMA 1ZELA 5CVIA 4UVCA 4JX4A 1YE9A 1FIPA 1O7LA 3P9CA 1JTXA 2OU2A 5K5OA 2EFWA 2WY8Q 1BI2A 4LIUA 2DI3A 2K4BA 3K70D 3F23A 2BVLA 1ZR2A 3E5XA 1G3SA 4HV5A 4KMFA 3S1NJ 2DK5A 4JBAA 1GV2A 4RB3C 2JA7J 4E7LA 4AD9A 2DJIA 3LSPA 3PQJA 2L7ZA 1TWAJ 4BXUA 4GCVA 4BAYA 2PFBA 1BOBA 1ITYA 4BE0A 4JP0A 3IWFA 2ZXHA 2L54A 3NAUA 4LLGF 1MJAA 1R5GA 2R93J 5J1UA 3JRGA 2IS1A 5AONA 5FLMJ 1KYZA 2PMHA 3I9V2 3I58A 4G6TB 2LDUA 2O0YA 2KZGA 3KEYA 1RETA 4XLFA 4E7ZA 2O6GE 4CCMA 1QQIA 2FQ3A 2OUMA 1USSA 4PZJA 1N25A 2KT0A 3BTCA 4QLCU 4HEA2 4GFBA 2P8TA 1Z6RA 3HPGA 2YS9A 3BCAA 2DXIA 2R7XA 1ONVA 4IZZA 1R4MB 2PMZN 4IHYA 4OIPF 1FP1D 2L2OA 3ZN0A 3CCUI 2M34A 2TDXA 3RKXA 1XSXA 3I3LA 3KP5A 1MDMB 4F93B 3KEOA 3QWLA 5FFZA 2VC0A 3BLYA 2KIMA 3L1PA 3WU2C 5D8LB 4EV0A 3CJTB 4G7HF 3K4NA 2WAFA 3CJRB 1ZH5A 2QKLB 5JVTA 5K7ZA 2V1UA 2EFOA 4IEJA 4D7NA 3OYMA 2ZMEC 1ACIA 3L2VA 3Q5FA 3U1DA 1ZARA 3HEFA 2DN0A 5F1JA 3TMOA 2DDBA 3V7CA 3E6CC 4H4KC 3K6GA 4IHWA 3RI4A 4XKCA 2OA4A 3CDLA 1T08B 5HODA 3L2UA 3IWZA 4M74A 2IEKA 2M9HA 4LITA 3PO2J 2R7VA 2QM3A 3BY6A 1U9NA 5E3LA 5J4YA 2HVSA 1BR2A 4BBRJ 3ZMDA 1RPWA 4IRHA 1IUFA 1FYLA 1J9IA 2KHMA 2VXZA 2YSRA 3PUFA 5LGTA 1A31A 3HKZN 2W85A 4IHXA 2VUMJ 3CMYA 2HQNA 1RESA 3GW2A 2VKEA 3G4SI 3CP8A 1MBFA 3U1KA 4JQFA 1O3TA 3DBRB 2NVXJ 1B59A 2W25A 4BNCA 2EA4A 1BJZA 3FXOA 2F5FA 4M72A 3HBLA 1HLVA 4A3CJ 4NQWB 2XPWA 2KQRA 1ON1A 3LNQA 3GTGJ 1JUSA 1LPQA 4BEHB 2BE5F 2IAIA 1ZRDA 5M3FJ 3IH4A 3J7AY 5GTIC 1QU3A 4AU7A 3K10A 2EIMH 2VOPA 1UJ8A 1R9TJ 3QYEA 3V42A 4ZYGA 4CXFA 2HI3A 4BE1A 2G0EA 2Y2ZA 2JUGA 1XTAA 4IHTA 1YIJI 4KIBA 3BR1A 2DPUA 5F04A 2Z33A 3HSRA 1D0ZA 3ML6A 4L9JA 4NHJA 1W36C 1X4OA 2M1BA 2V6CA 4XLHA 4ENKA 4AC0A 2WV0A 1OCRH 3SZPA 1K78A 1OJLA 4ESJA 2RKHA 5EG0B 2M0CA 4U7BA 1D8KA 2YR2A 1QRYA 3BTIA 2Z16A 2A6EF 5HDNA 3JAMZ 3R0JA 1W5TA 4XONA 4ESBA 1DPUA 4IF4A 4KN4X 3DFGA 1A6QA 3BT9A 3DP7A 4Z2YA 3OR1C 2F4OB 3ZPLA 3BC8A 3EQLF 4Z6YA 4GDFA 3S1QJ 1V5EA 2KJBA 1XPXA 3E0JB 1S8NA 3BWGA 2WAQN 3GFIA 3PNYA 4CH7A 2NS8A 3FX3A 1D1AA 2DK8A 3ECHA 2R92J 3F8NA 1P4XA 2DMUA 2PEXA 4DYCA 2XPVA 3E3VA 3I59B 4AM3A 4LD5A 3TL4X 3LQRA 1G3WA 2A68F 4CDGA 2DA4A 1Y6IA 2HWVA 3F22A 1OKRA 4IHSA 3PNTA 2DLLA 1D1CA 3MKWB 3L2RA 2MGQA 1T33A 1XGOA 2HOAA 4E7KA 5M5XJ 2HYFA 1LVKA 3WTUC 1FMWA 3ZMSA 4XIDA 3CCQI 2QQAA 3OS0A 2FUG2 2QGUA 4RA2A 3M9AA 4EVIA 3CCEI 3HRTA 4KITB 5BS6A 2HYGD 1XGMA 5FRNA 1ZHFA 3SFIA 4LIVA 4CICA 2VIXA 3BJAA 1P4AA 1YFHA 1TBXA 1YG2A 1E3HA 3ABKH 3VWBA 3GZ5A 1LQ1A 2OQRA 5EZGA 1X1CA 2B63J 2KDOA 2XV4S 1VTNC 1Z21A 1ETOA 5EJCA 3TOAA 1VFCA 4ZYAA 1R7JA 2E36A 3MD2A 1X2NA 2OCEA 3BZKA 3G3ZA 1MBGA 3IAS2 3TQNA 1RR8C 3BZ6A 5CVUA 1H89C 3F9KA 4CUGA 1MH4A 1B72B 1MNEA 1SMYF 4XN0A 2DODA 4U0YA 4A6DA 1X1DA 5IP6A 4G6QA 4NC8A 2LKSA 4GRIA 3RKYA 2ECBA 3HTUA 2W00A 4HSRA 2YU3A 4UUVA 2P5VA 1A5JA 3MZ8A 2Y75A 1R6RA 5IT9Z 4RGXA 5K1YA 2OZ6A 1NK2P 2GOXB 1MW7A 5FRMA 3K0LA 4FQGA 3X2QH 5J3LA 2ZJPF 4ON0A 2IXSA 1YX5A 3TBIA 2V7FA 1OMIA 1X2MA 1O57A 1TTYA 2JZYA 4MEXF 1Y56A 3VSLA 4C30A 3W3CA 1L3LA 1MDMA 4IJAA 1RR7A 4I0BA 2GZWA 3B6AA 4G12A 4EJWA 5C3EJ 5IPAA 1T0FC 2DQLA 2RC4A 4S04A 2VBWA 1G3YA 4YEJA 2FX0A 3OYCA 2X1DA 1EF4A 3TW7A 3A0BC 1MD0A 1O4XA 2LMDA 3HHGA 4U0VA 4G94A 1ULYA 4XNFA 1D5YA 3ISPA 1R1VA 5GP9A 1GVJA 4YIRX 1LE8B 4I7HA 2CW8A 4WXCA 2CQKA 1YI2I 2JSPA 2M30A 5FLVA 3OL3A 1KU9A 1XG1A 2CUZA 2OJED 3COAC 2HU9A 2P5LC 2GA2A 3GTOJ 1MSEC 2V26A 2LK2A 3WE2A 3BR0A 3FMSA 4OMZA 3GTQJ 2K7LA 4QPQA 3IP4B 1O7FA 2D45A 3JRIA 1KQ8A 4EJOA 2QKMB 3GZ6A 3WTVC 2L7FP 1ON2A 1Z9CA 4PJJA 4RGUA 3CC7I 5DD4A 5D5UB 3LQQA 2FMYA 2FOKA 4DYQA 5J4VA 4BHPA 3HPHA 3CO6C 5F08A 5F1RA 2QF7A 2R7SA 1BW5A 1VQNI 1T98A 3WTYC 3ERMA 1IN4A 1HSTA 4PFOA 3FXQA 4XRSG 4BXXJ 1W5SA 2KLOA 4Q47A 1ZRFA 2NAZA 2DJNA 3AAFA 5E3MA 1OISA 2LSOA 2I10A 3GTLJ 1FC3A 2HQAA 2WAEA 3KLNA 1E17A 4M9XA 4NQWA 3LAJA 1J75A 2D1HA 3QYBA 2Y48A 3VYSB 2KPMA 3AKZA 3CCLI 4BEHA 3LSRA 2O8KA 1K83J 2ME6A 4OIOF 2XB0X 4G6DA 2WC2A 1XSDA 1X4PA 3JREA 3T8TA 4IRGA 1LKXA 2HOSA 1U6GA 4RS8A 4A0ZA 4F3QA 1P9QC 3FHZA 3TP0A 2VPRA 2AQEA 4EJVA 3L2QA 2VE8A 5KCMA 1QZZA 2TCTA 1IF1A 2NOJB 2KZVA 3U21A 3FF5A 3RQIA 3ZOBA 1FLIA 5LRRA 4MTDA 2IS2A 2CQ7A 1OCTC 3QPTA 2K3FA 1EKEA 5L3FA 5EG0A 4MQVA 2MYSA 2XVCA 2X9DA 4P96A 2R7FA 2FBHA 4B09A 2EFQA 5F0HA 4HLXA 1SFKA 3FM3A 3CUOA 4BQNA 3CLQA 3OS2A 1BIBA 2LP0A 2G7UA 3HZJA 3MAJA 2LTPA 1TW3A 4Q48A 2XAJA 5FFXA 1HF0A 3D5SC 3F8FA 4EGZA 1R5HA 2LYCA 2KIFA 4LG0B 4O3MA 5HVQC 3IAM2 2GOMA 3SDGA 4ZTJA 4LK0F 3K2ZA 3IH2A 3ZXSA 3DEEA 3DEUA 4D9JA 4EATA 4A3FJ 3DU5A 3I59A 4C3JJ 1I1SA 3RJPA 1A35A 2GXGA 2EB7A 4GXOA 1TC3C 4EM1A 2H1LA 3ZRGA 1MBEA 2XSJC 2Z99A 2K02A 2DBBA 3WG7H 2TRTA 2M5WA 3C2BA 3MCZA 2A5WA 3EETA 4L5EA 5GTHC 3EDPA 4FCYA 1OQYA 5DS9A 4BY1J 1V4RA 3P5JA 1FBQA 1R1UA 4A3BJ 4DJAA 1ZLJA 1ETKA 3MN2A 1GUUA 2ACJA 3W6KB 5EEHA 1ETWA 2HZDA 4KUMA 5LFAA 1JE8A 1QO0D 4DIQA 1H8AC 1POGA 3FBIB 4DNCA 5JLXA 3BR6A 3CJNA 3L7WA 1VNDA 3RZOJ 1KZHA 1FMVA
chains in the Genus database with same CATH topology
2R93J 5J1UA 3JRGA 5FLMJ 4A3LJ 4JX5A 1RETA 2ID6A 1FTTA 1T56A 2JJ7A 3M4OJ 3JRAA 2JA5J 2EZKA 2KT0A 4C2MJ 2NS7A 3BTCA 2N8GA 2L0KA 3QPLA 4GFBA 2YS9A 4QSHA 1B72A 3B6CA 1W0UA 5EF6A 3BR3A 2PMZN 3OIOA 4IHYA 3NARA 2DMQA 1WGXA 2M34A 1HDDC 3L1PA 2HYJA 4W97A 2CU7A 2GLOA 1HOMA 2EH3A 5IP7J 1NTCA 2XGDA 2X48A 1JKOC 1X58A 2NVQJ 3K2AA 1B8IB 1IG7A 1IDYA 2WV1A 2RAEA 3GTKJ 5GPAA 5K7ZA 5IYCJ 2R0QC 4IEJA 4V2GA 4D7NA 3S1RJ 3HOVJ 3G1OA 4FE7A 5C4JJ 4MIMA 1ETYA 3HEFA 2DN0A 5F1JA 3ZQGA 5IOZA 3BR2A 2H8RA 5F0FA 3UKGA 4MO7A 1MBJA 1U8BA 1JGGA 3I4MJ 4IHWA 1JUPA 1DU0A 3CDLA 4EEFG 5HODA 4DW6A 2R5YB 4A3IJ 3FK7A 2ELKA 3K7AJ 1LE8A 2IEKA 2M9HA 3GTPJ 3PO2J 1K61A 3E7LA 1FTZA 1ZK8A 2CJJA 3BTJA 1U9NA 5E3LA 4BBRJ 1RPWA 1G2HA 1IUFA 2P81A 1BA5A 1U9OA 3HKZN 4Y7NJ 4IHXA 2VUMJ 3CMYA 1RESA 4AYBN 3HB9A 2VKEA 1UMQA 4D7MA 2O9LA 4B4CA 1MBFA 1WCMJ 2NVXJ 3A03A 2M8GX 1I50J 2XPUA 3PO3J 4M3DA 1SANA 3O8HA 1BJZA 3HBLA 1H88C 1U78A 1HLVA 4A3CJ 1RKTA 5J1YA 2Y9ZA 2XPWA 3BQYA 1XC5A 4X1EA 3LNQA 4W1UA 2JN6A 1JUSA 3GTGJ 5DTDA 1IDZA 1MBHA 2IAIA 3FKIJ 1Q1VA 3IH4A 5M3FJ 3JRBA 1HDPA 3BR5A 5M5WJ 1SFOJ 4C3IJ 4RDUA 1JUMA 2FQ4A 9ANTA 1NK3P 1R9TJ 4D5CA 4DZJA 3FK6A 2HI3A 2G0EA 2Y2ZA 2Y31A 1ZTRA 3BR1A 1FEXA 5J1RA 5F04A 1OCPA 3SJMA 3JRHA 5IP9J 5K7HA 4XRSA 1JT0A 4AC0A 1OJLA 1PUFB 1JTYA 3OOUA 5EG0B 2M0CA 3WHCA 1UHSA 3Q0WA 2AO9A 1QRYA 2HXIA 3IH3A 3G1MA 3BTIA 1JJ6C 2IBDA 4UUTA 3GTJJ 1YRNB 2MW8A 3D1NI 3BT9A 2DA6A 3A01A 3O8GA 3MVPA 1FIAA 1Y1VJ 4A69C 3ZQFA 3S1QJ 1FJLA 5FKLA 4XRMA 3HOZJ 1IRZA 2E2HJ 2WAQN 2NS8A 2R5ZB 4UUSB 1JJ8C 4FISA 4A3EJ 2R92J 2K9QA 3JRDA 2CRGA 5FKMA 2DMUA 1VI0A 5C4XJ 1LFBA 4D5FA 4DYCA 2XPVA 2X6OA 2XB5A 2L7MP 3LOCA 3JRFA 1WH7A 5EGOA 2DA4A 4JYKA 4CYCB 4I76A 2DA5A 5FKOA 4A93J 5F0CA 1IV6A 2DA1A 3CQZJ 1RKWA 1ZKGA 2MGQA 1T33A 3S14J 2HOAA 4A3GJ 5M5XJ 4JX6A 3HOWJ 2GM4A 3FISA 2JMWA 5IOYA 3CCYA 1WI3A 4XIDA 4M3GA 4V2FA 2YUSA 1P7IA 1S7EA 4MFEA 2R7ZJ 4S0HB 4HNVA 1F36A 5F27A 5EZHA 1JKRC 3SFIA 2NOGA 3ZQIA 5E3OA 2ID3A 4B3AA 1VNDA 4ABZA 1GV5A 2L9RA 4QTRA 1GT0C 5BNGA 3IV5A 1IC8A 5EZGA 2B63J 5C44J 3OSFA 1GVDA 1MNMC 1ETOA 2HDDA 3S2HJ 1VFCA 1JT6A 1BL0A 3S1MJ 1ZQ3P 1WPKA 1X2NA 2E19A 3BG3A 1MBGA 2OPTA 1H89C 3S17J 2W48A 1ETXA 1MH4A 2K9SA 2JWTA 1B72B 3BTLA 2Y30A 3Q0UA 2OF7A 3BQZA 3PM1A 2DMNA 3RKQA 5IP6A 3QPSA 3BG5A 2ECBA 3HGGA 3QQAA 4NDLA 3JRCA 1A5JA 1NK2P 1TWGJ 2E2JJ 1Y1WJ 2COBA 5J3LA 2ECCA 2VKVA 1A6IA 1QPIA 3JR9A 1X2MA 2VI6A 4QIWN 3RZDJ 5FKKA 1ETVA 1UG2A 2XGCA 1RR7A 3DCFA 3TP3A 4C3HJ 3B6AA 4G12A 3W6VA 2EQRA 5C3EJ 5IPAA 1EF4A 2FX0A 1DU6A 1I3QJ 1P7JA 1TWHJ 4M3EA 3TW7A 4IHVA 1O4XA 3S15J 4FTHA 1D5YA 4M6VA 5GP9A 1LE8B 2O7OA 1B8IA 2Y9YA 2H1KA 5JLWA 1ZR4A 5IYDJ 5K7FA 5FLVA 1WH5A 3DEWA 2QCOA 1VF9A 1XG1A 3I4NJ 3GTOJ 1MSEC 1AHDP 2DA7A 2LK2A 2E2IJ 3BR0A 2CUEA 2WB1N 3GTQJ 1ETQA 4BBSJ 3LSGA 4XK4A 2XRLA 2Y0SN 2R5YA 4J19A 1JKQC 2LY9A 1QVUA 2GBYA 3G1LA 3JRIA 1ENHA 2L7FP 4DZPA 4FE4A 3Q3SA 2YU9J 3S16J 2LVSA 4DYQA 1I6HJ 1W0TA 3GTMJ 3TW6A 5F08A 4MFDA 5E3NA 2QF7A 1BW5A 2XSDC 2EZHA 3WHBA 3H0GJ 4XRSG 5GPCA 1AKHA 4BXXJ 1Z77A 2EBIA 1MBKA 2DA2A 2NVYJ 2NVTJ 2HQ5A 2DJNA 3A02A 5E3MA 3ZQLA 3FIWA 4M3BA 4B1RA 3M3YJ 3TEDA 3Q0VA 2LD5A 2I10A 3GTLJ 1ORKA 3H3VK 4LOCA 2XGEA 5IYBJ 4RBOA 2FD5A 3LSRA 2O8KA 3HOXJ 3S2DJ 1K83J 2ME6A 2XB0X 5EYRA 3JREA 4A3DJ 2LFBA 2HOSA 4A3KJ 2LKXA 2KDZA 4BY7J 1QVTA 1BW6A 1OFCX 2LLKA 3TP0A 2VPRA 5EDNA 2CQXA 1E3OC 2DA3A 4XICA 3ZQHA 2TCTA 3LSJA 3A01B 4I6ZA 2DMTA 3BG9A 2E1OA 3ZOBA 3RQIA 2D5VA 1TWCJ 4M3FA 1OCTC 1PUFA 3GBGA 5EG0A 4Y52J 2X9DA 3OSGA 2JA6J 2MSYA 5F0HA 2CUFA 4A3MJ 2CQQA 2FJ1A 3VPRA 1Z0XA 1YRNA 1HCRA 2HOTA 1XS9A 4X6AJ 4AUXA 1TWFJ 1LFUP 1IGNA 2K9NA 2DMPA 5EGOB 2LP0A 2LTPA 1ZGWA 1JKPC 3HOUJ 2AHQA 1AU7A 5M3MJ 1HF0A 1CQTA 4MLOA 2MG4A 1AKHB 5FJ8J 1APLC 2DTZA 2R5ZA 4UUSA 3SDGA 2LR8A 2JK3A 3F0CA 3IH2A 2EZLA 5FKNA 3ZQCA 4A3FJ 3HGYA 4C3JJ 4A3JJ 1GDTA 3HDDA 4CYCA 1TC3C 4JX4A 2HXOA 2M2EA 1FIPA 1MBEA 4BKXA 5M5YJ 1MH3A 1MSFC 1JTXA 2TRTA 1IJWC 3HOYJ 3C2BA 3HM5A 4L5EA 2ME0A 4FCYA 1ZR2A 5DS9A 1F43A 3S1NJ 4BY1J 1GV2A 5EEAA 2JA8J 4A3BJ 1ETKA 4DYRA 2JA7J 3MN2A 1GUUA 2EZIA 2ZB9A 3LSPA 1ETWA 2L7ZA 1TWAJ 2K40A 1H8AC 1POGA 1ITYA 5JLXA 3MKLA 3BR6A 4JP0A 3NAUA 3RZOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 J;  5J1U A;  3JRG A;  5FLM J;  4A3L J;  4JX5 A;  1RET A;  2ID6 A;  1FTT A;  1T56 A;  2JJ7 A;  3M4O J;  3JRA A;  2JA5 J;  2EZK A;  2KT0 A;  4C2M J;  2NS7 A;  3BTC A;  2N8G A;  2L0K A;  3QPL A;  4GFB A;  2YS9 A;  4QSH A;  1B72 A;  3B6C A;  1W0U A;  5EF6 A;  3BR3 A;  2PMZ N;  3OIO A;  4IHY A;  3NAR A;  2DMQ A;  1WGX A;  2M34 A;  1HDD C;  3L1P A;  2HYJ A;  4W97 A;  2CU7 A;  2GLO A;  1HOM A;  2EH3 A;  5IP7 J;  1NTC A;  2XGD A;  2X48 A;  1JKO C;  1X58 A;  2NVQ J;  3K2A A;  1B8I B;  1IG7 A;  1IDY A;  2WV1 A;  2RAE A;  3GTK J;  5GPA A;  5K7Z A;  5IYC J;  2R0Q C;  4IEJ A;  4V2G A;  4D7N A;  3S1R J;  3HOV J;  3G1O A;  4FE7 A;  5C4J J;  4MIM A;  1ETY A;  3HEF A;  2DN0 A;  5F1J A;  3ZQG A;  5IOZ A;  3BR2 A;  2H8R A;  5F0F A;  3UKG A;  4MO7 A;  1MBJ A;  1U8B A;  1JGG A;  3I4M J;  4IHW A;  1JUP A;  1DU0 A;  3CDL A;  4EEF G;  5HOD A;  4DW6 A;  2R5Y B;  4A3I J;  3FK7 A;  2ELK A;  3K7A J;  1LE8 A;  2IEK A;  2M9H A;  3GTP J;  3PO2 J;  1K61 A;  3E7L A;  1FTZ A;  1ZK8 A;  2CJJ A;  3BTJ A;  1U9N A;  5E3L A;  4BBR J;  1RPW A;  1G2H A;  1IUF A;  2P81 A;  1BA5 A;  1U9O A;  3HKZ N;  4Y7N J;  4IHX A;  2VUM J;  3CMY A;  1RES A;  4AYB N;  3HB9 A;  2VKE A;  1UMQ A;  4D7M A;  2O9L A;  4B4C A;  1MBF A;  1WCM J;  2NVX J;  3A03 A;  2M8G X;  1I50 J;  2XPU A;  3PO3 J;  4M3D A;  1SAN A;  3O8H A;  1BJZ A;  3HBL A;  1H88 C;  1U78 A;  1HLV A;  4A3C J;  1RKT A;  5J1Y A;  2Y9Z A;  2XPW A;  3BQY A;  1XC5 A;  4X1E A;  3LNQ A;  4W1U A;  2JN6 A;  1JUS A;  3GTG J;  5DTD A;  1IDZ A;  1MBH A;  2IAI A;  3FKI J;  1Q1V A;  3IH4 A;  5M3F J;  3JRB A;  1HDP A;  3BR5 A;  5M5W J;  1SFO J;  4C3I J;  4RDU A;  1JUM A;  2FQ4 A;  9ANT A;  1NK3 P;  1R9T J;  4D5C A;  4DZJ A;  3FK6 A;  2HI3 A;  2G0E A;  2Y2Z A;  2Y31 A;  1ZTR A;  3BR1 A;  1FEX A;  5J1R A;  5F04 A;  1OCP A;  3SJM A;  3JRH A;  5IP9 J;  5K7H A;  4XRS A;  1JT0 A;  4AC0 A;  1OJL A;  1PUF B;  1JTY A;  3OOU A;  5EG0 B;  2M0C A;  3WHC A;  1UHS A;  3Q0W A;  2AO9 A;  1QRY A;  2HXI A;  3IH3 A;  3G1M A;  3BTI A;  1JJ6 C;  2IBD A;  4UUT A;  3GTJ J;  1YRN B;  2MW8 A;  3D1N I;  3BT9 A;  2DA6 A;  3A01 A;  3O8G A;  3MVP A;  1FIA A;  1Y1V J;  4A69 C;  3ZQF A;  3S1Q J;  1FJL A;  5FKL A;  4XRM A;  3HOZ J;  1IRZ A;  2E2H J;  2WAQ N;  2NS8 A;  2R5Z B;  4UUS B;  1JJ8 C;  4FIS A;  4A3E J;  2R92 J;  2K9Q A;  3JRD A;  2CRG A;  5FKM A;  2DMU A;  1VI0 A;  5C4X J;  1LFB A;  4D5F A;  4DYC A;  2XPV A;  2X6O A;  2XB5 A;  2L7M P;  3LOC A;  3JRF A;  1WH7 A;  5EGO A;  2DA4 A;  4JYK A;  4CYC B;  4I76 A;  2DA5 A;  5FKO A;  4A93 J;  5F0C A;  1IV6 A;  2DA1 A;  3CQZ J;  1RKW A;  1ZKG A;  2MGQ A;  1T33 A;  3S14 J;  2HOA A;  4A3G J;  5M5X J;  4JX6 A;  3HOW J;  2GM4 A;  3FIS A;  2JMW A;  5IOY A;  3CCY A;  1WI3 A;  4XID A;  4M3G A;  4V2F A;  2YUS A;  1P7I A;  1S7E A;  4MFE A;  2R7Z J;  4S0H B;  4HNV A;  1F36 A;  5F27 A;  5EZH A;  1JKR C;  3SFI A;  2NOG A;  3ZQI A;  5E3O A;  2ID3 A;  4B3A A;  1VND A;  4ABZ A;  1GV5 A;  2L9R A;  4QTR A;  1GT0 C;  5BNG A;  3IV5 A;  1IC8 A;  5EZG A;  2B63 J;  5C44 J;  3OSF A;  1GVD A;  1MNM C;  1ETO A;  2HDD A;  3S2H J;  1VFC A;  1JT6 A;  1BL0 A;  3S1M J;  1ZQ3 P;  1WPK A;  1X2N A;  2E19 A;  3BG3 A;  1MBG A;  2OPT A;  1H89 C;  3S17 J;  2W48 A;  1ETX A;  1MH4 A;  2K9S A;  2JWT A;  1B72 B;  3BTL A;  2Y30 A;  3Q0U A;  2OF7 A;  3BQZ A;  3PM1 A;  2DMN A;  3RKQ A;  5IP6 A;  3QPS A;  3BG5 A;  2ECB A;  3HGG A;  3QQA A;  4NDL A;  3JRC A;  1A5J A;  1NK2 P;  1TWG J;  2E2J J;  1Y1W J;  2COB A;  5J3L A;  2ECC A;  2VKV A;  1A6I A;  1QPI A;  3JR9 A;  1X2M A;  2VI6 A;  4QIW N;  3RZD J;  5FKK A;  1ETV A;  1UG2 A;  2XGC A;  1RR7 A;  3DCF A;  3TP3 A;  4C3H J;  3B6A A;  4G12 A;  3W6V A;  2EQR A;  5C3E J;  5IPA A;  1EF4 A;  2FX0 A;  1DU6 A;  1I3Q J;  1P7J A;  1TWH J;  4M3E A;  3TW7 A;  4IHV A;  1O4X A;  3S15 J;  4FTH A;  1D5Y A;  4M6V A;  5GP9 A;  1LE8 B;  2O7O A;  1B8I A;  2Y9Y A;  2H1K A;  5JLW A;  1ZR4 A;  5IYD J;  5K7F A;  5FLV A;  1WH5 A;  3DEW A;  2QCO A;  1VF9 A;  1XG1 A;  3I4N J;  3GTO J;  1MSE C;  1AHD P;  2DA7 A;  2LK2 A;  2E2I J;  3BR0 A;  2CUE A;  2WB1 N;  3GTQ J;  1ETQ A;  4BBS J;  3LSG A;  4XK4 A;  2XRL A;  2Y0S N;  2R5Y A;  4J19 A;  1JKQ C;  2LY9 A;  1QVU A;  2GBY A;  3G1L A;  3JRI A;  1ENH A;  2L7F P;  4DZP A;  4FE4 A;  3Q3S A;  2YU9 J;  3S16 J;  2LVS A;  4DYQ A;  1I6H J;  1W0T A;  3GTM J;  3TW6 A;  5F08 A;  4MFD A;  5E3N A;  2QF7 A;  1BW5 A;  2XSD C;  2EZH A;  3WHB A;  3H0G J;  4XRS G;  5GPC A;  1AKH A;  4BXX J;  1Z77 A;  2EBI A;  1MBK A;  2DA2 A;  2NVY J;  2NVT J;  2HQ5 A;  2DJN A;  3A02 A;  5E3M A;  3ZQL A;  3FIW A;  4M3B A;  4B1R A;  3M3Y J;  3TED A;  3Q0V A;  2LD5 A;  2I10 A;  3GTL J;  1ORK A;  3H3V K;  4LOC A;  2XGE A;  5IYB J;  4RBO A;  2FD5 A;  3LSR A;  2O8K A;  3HOX J;  3S2D J;  1K83 J;  2ME6 A;  2XB0 X;  5EYR A;  3JRE A;  4A3D J;  2LFB A;  2HOS A;  4A3K J;  2LKX A;  2KDZ A;  4BY7 J;  1QVT A;  1BW6 A;  1OFC X;  2LLK A;  3TP0 A;  2VPR A;  5EDN A;  2CQX A;  1E3O C;  2DA3 A;  4XIC A;  3ZQH A;  2TCT A;  3LSJ A;  3A01 B;  4I6Z A;  2DMT A;  3BG9 A;  2E1O A;  3ZOB A;  3RQI A;  2D5V A;  1TWC J;  4M3F A;  1OCT C;  1PUF A;  3GBG A;  5EG0 A;  4Y52 J;  2X9D A;  3OSG A;  2JA6 J;  2MSY A;  5F0H A;  2CUF A;  4A3M J;  2CQQ A;  2FJ1 A;  3VPR A;  1Z0X A;  1YRN A;  1HCR A;  2HOT A;  1XS9 A;  4X6A J;  4AUX A;  1TWF J;  1LFU P;  1IGN A;  2K9N A;  2DMP A;  5EGO B;  2LP0 A;  2LTP A;  1ZGW A;  1JKP C;  3HOU J;  2AHQ A;  1AU7 A;  5M3M J;  1HF0 A;  1CQT A;  4MLO A;  2MG4 A;  1AKH B;  5FJ8 J;  1APL C;  2DTZ A;  2R5Z A;  4UUS A;  3SDG A;  2LR8 A;  2JK3 A;  3F0C A;  3IH2 A;  2EZL A;  5FKN A;  3ZQC A;  4A3F J;  3HGY A;  4C3J J;  4A3J J;  1GDT A;  3HDD A;  4CYC A;  1TC3 C;  4JX4 A;  2HXO A;  2M2E A;  1FIP A;  1MBE A;  4BKX A;  5M5Y J;  1MH3 A;  1MSF C;  1JTX A;  2TRT A;  1IJW C;  3HOY J;  3C2B A;  3HM5 A;  4L5E A;  2ME0 A;  4FCY A;  1ZR2 A;  5DS9 A;  1F43 A;  3S1N J;  4BY1 J;  1GV2 A;  5EEA A;  2JA8 J;  4A3B J;  1ETK A;  4DYR A;  2JA7 J;  3MN2 A;  1GUU A;  2EZI A;  2ZB9 A;  3LSP A;  1ETW A;  2L7Z A;  1TWA J;  2K40 A;  1H8A C;  1POG A;  1ITY A;  5JLX A;  3MKL A;  3BR6 A;  4JP0 A;  3NAU A;  3RZO J; 
#chains in the Genus database with same CATH topology
 3TGN A;  4CCO A;  3S32 A;  4AVP A;  4PGH A;  2FRH A;  2IVM A;  4ZDO A;  3FXK A;  1HKS A;  1XGS A;  2HPM A;  5LEJ A;  3ULQ B;  3DTE A;  1B6A A;  1R58 A;  2F48 A;  2CV0 A;  2MH2 A;  3ECO A;  1FOX A;  3QU3 A;  3V7S A;  5DM7 F;  5ICC A;  4BQA A;  3U2R A;  4BJT A;  3H35 A;  5LHH A;  3M4O J;  1AOY A;  3DKX A;  4IO9 F;  4MNU A;  5CVJ A;  2EV0 A;  2NS7 A;  2CFO A;  4NBQ A;  2CGP A;  3E5Q A;  2FSW A;  2F4I A;  4XOR A;  3MKY B;  4UNO A;  1B72 A;  1WRJ A;  4WCG A;  2P0W A;  3F6V A;  3OIO A;  2WTE A;  1LVA A;  2IGO A;  4B44 A;  5TGT A;  3NAR A;  2E60 A;  1WGX A;  5CQG A;  3GX4 X;  3VEP A;  1WSU A;  2ZCW A;  4IX7 A;  4PJL A;  6PAX A;  3H9J A;  2KMU A;  3JSP A;  2HYJ A;  2GLO A;  1HOM A;  2K9L A;  2RDP A;  1VZ0 A;  2DFI A;  2QVO A;  2XGD A;  3L2C A;  1T0F A;  5GAG J;  1MZB A;  2FEZ A;  3ZMZ A;  1B8I B;  1IDY A;  3T0Y A;  3GTK J;  2FA5 A;  4E4H A;  1QHH D;  5IYC J;  3V7R A;  1FOK A;  2R0Q C;  5FRO A;  2FBK A;  4FE7 A;  4BU2 A;  4NUB A;  4RGR A;  4ZYE A;  5C4J J;  4MIM A;  5B3S H;  3P9I A;  3GVA A;  1H0M A;  5IOZ A;  3F21 A;  2WBM A;  5F0F A;  1OR7 A;  4MO7 A;  1JGG A;  4IOA F;  1U0J A;  3I4M J;  4FT8 A;  1JUP A;  1AWC A;  4NC7 A;  1DU0 A;  2H94 A;  2ELK A;  1LE8 A;  2G9W A;  1Q1H A;  1XB4 A;  4KT5 C;  3Q9S A;  4OIQ F;  3RYP A;  2CFX A;  3HJE A;  2FU4 A;  3KFW X;  2IGM A;  3E1S A;  2PG4 A;  2BXZ A;  3AL0 B;  2BYV E;  3O3K A;  4AYB N;  5F6F A;  1GHC A;  1DGW Y;  3FMR A;  1LDK B;  4DBQ A;  3GYH X;  2DCE A;  4RAY A;  3ERE D;  2HGC A;  4HX7 A;  2A6H F;  1SD6 A;  4B4C A;  3FDY A;  4HYE A;  5HOO A;  1WCM J;  1NH3 A;  4IKF A;  1YJW I;  1N77 A;  2XPU A;  2RQP A;  4M3D A;  2WAQ A;  4FHT A;  2JSC A;  3AL0 C;  1W36 D;  1U78 A;  1REP C;  1XC5 A;  4X1E A;  4W1U A;  2JN6 A;  1IDZ A;  1MBH A;  2R7T A;  3HHH A;  3M8E A;  1W7P B;  5KHD A;  1IRG A;  1OCZ H;  3BPV A;  2ZXW H;  5H2F C;  5IT3 A;  1HDP A;  2GAU A;  1IN6 A;  2X6Y A;  1JUM A;  9ANT A;  1VQ7 I;  3HRM A;  4D5C A;  3UNG C;  3TO9 A;  3FK6 A;  3VB2 A;  1O3R A;  4II3 A;  3LA3 A;  4RLQ A;  3CCS I;  3CP2 A;  1OCP A;  2XKO A;  4RMN A;  2BY3 A;  5IP9 J;  5JHF A;  1V5G A;  3Q9V A;  2QA4 I;  4LGW A;  1KU3 A;  1XMK A;  2VQL A;  1JGS A;  4CO8 A;  3G6E I;  4PJN A;  2QYO A;  1UAA A;  1UHS A;  2AO9 A;  4A12 A;  1BJA A;  5LHG A;  1ERD A;  4NC6 A;  1JJ6 C;  1I5Z A;  1YRN B;  1S9H A;  2AXT C;  1KON A;  4ZDL A;  4J00 A;  2MW8 A;  1VQ6 I;  5E8G A;  3D1N I;  2DA6 A;  3A1Y A;  2HTJ A;  1XX5 A;  1WJF A;  2OTJ I;  4G7Z F;  1FIA A;  4A69 C;  3ZQF A;  2EIL H;  3ZGK A;  2H8W A;  2Q1Z B;  5FKL A;  1IRZ A;  2VC1 A;  2F4M B;  3SHF A;  4KIF A;  4LLN A;  2R5Z B;  1V54 H;  4UUS B;  3CDI A;  1JJ8 C;  3EYY A;  3FXM A;  2DOE A;  3LA7 A;  3JRD A;  5FKM A;  3LFK A;  2MBF A;  3ASN H;  1VI0 A;  4XN3 A;  1K6O A;  1LFB A;  1GLN A;  3W6J B;  2DO7 A;  2EFN A;  1EA3 A;  3JRF A;  1YIT I;  3DBH B;  3WGI A;  1WH7 A;  4N4O B;  4CYC B;  1FYK A;  3K4C A;  4LK1 F;  4AWX B;  4XSZ F;  4CGZ A;  1QZY A;  2CH0 A;  5F0C A;  2DA1 A;  3FXL A;  2ICW G;  3OYG A;  2X6X A;  4E6K G;  4A3G J;  4LG0 A;  2E7X A;  3HOW J;  3TO6 A;  2OQG A;  1G4D A;  4M3G A;  5HDG A;  3NQO A;  2CWE A;  3RPQ A;  2CW7 A;  1TNS A;  1X3Z B;  3CLO A;  3OOP A;  1P7I A;  1X19 A;  4RAG A;  3G2B A;  4UV9 A;  3KET A;  2XAG A;  4HNV A;  5F27 A;  2NNN A;  1S3J A;  3S3N A;  1HXD A;  4N4N B;  2L4A A;  1SEU A;  5DUI A;  2BBY A;  5CPR B;  2NOG A;  1FPQ A;  3F8C A;  1N75 A;  4IRI A;  1UZC A;  1GV5 A;  2PJR B;  4QTR A;  3N4M A;  1GT0 C;  5CYV A;  1IC8 A;  1QZE A;  4S05 A;  5C44 J;  3OSF A;  5JFR A;  3I4P A;  1RNL A;  2C6Y A;  2IS6 A;  2RGV A;  1WJA A;  2F5V A;  1FSH A;  1JT6 A;  1YX3 A;  3KPH A;  2BXY A;  3MQ0 A;  1BL0 A;  4EM2 A;  3U9G A;  3S1M J;  2E19 A;  3BG3 A;  2LNB A;  2OPT A;  2VB6 A;  1IV8 A;  2WY7 Q;  3S17 J;  1ZG3 A;  1TLH B;  3BTL A;  2Y30 A;  2FNA A;  3KP2 A;  2IA2 A;  1EH8 A;  2HTS A;  2BY2 A;  2VN2 A;  3M8F A;  5ED4 A;  1TT0 A;  1P92 A;  2WA0 A;  3ZN1 A;  1BIA A;  1FBU A;  2D1V A;  4NDL A;  3CMA I;  4E7H A;  2RNJ A;  4PK4 A;  1ODD A;  5BPI A;  2AXL A;  2VQC A;  3SYT A;  1SD5 A;  2E2J J;  3K4K A;  1YW8 A;  2LRD A;  3RYR A;  3OS1 A;  1D8J A;  1H9T A;  1FNN A;  4EMS A;  4HQM A;  2XGX A;  3H0D A;  3I55 I;  1RRJ A;  3JR9 A;  2XC7 A;  2ISZ A;  3I64 A;  3H3Z A;  3CUQ B;  1ETV A;  2W1O A;  2E1N A;  2EJR A;  3TP3 A;  4C3H J;  3CZ6 A;  3S3O A;  2DQR A;  2EQR A;  3ASO H;  2CMP A;  1TWH J;  5CJ9 A;  2R4G A;  3S15 J;  3DWL E;  1SFE A;  3ZQ7 A;  1SVO A;  3VYU B;  3PIP F;  1I1G A;  1B8I A;  3ELK A;  3OYJ A;  2Y9Y A;  2H1K A;  1OCC H;  2COM A;  2XRO A;  3V8J A;  1HW5 A;  4YG2 F;  4F91 B;  1WH5 A;  4CHU A;  2X4H A;  4E7S A;  2QCO A;  3JTG A;  5TIS C;  5FLX K;  1VF9 A;  1T39 A;  2W82 A;  3HOT A;  1X3U A;  3VSK A;  4BHB A;  2DA7 A;  2VJI A;  4II2 A;  3WU1 B;  3ABU A;  4XM3 A;  4BS9 A;  2ESH A;  1NG7 A;  2WB1 N;  1YTY A;  2FBI A;  2L3D A;  3F6O A;  1ZGJ A;  2VJ5 A;  2JVG A;  5BPD A;  3LMM A;  2Y0S N;  4J19 A;  1VQK I;  2P5K A;  3J81 K;  4EM0 B;  1K79 A;  1ENH A;  1WJD A;  4N9H A;  2DPD A;  4ZYH A;  4R8H A;  4BE2 A;  3Q3S A;  1UCR A;  5GAE J;  1I6H J;  3K70 C;  3H5N A;  3K4L A;  4HLY A;  2VT2 A;  1KYW A;  3W2A A;  2FXA A;  2XHK A;  2QSG X;  3K9T A;  4ZJZ A;  1R00 A;  2XSD C;  3R0A A;  2KIS A;  2XAH A;  4Y4R A;  5L3E A;  5GPC A;  1LNW A;  1E2X A;  1MBK A;  2GWR A;  4XBF A;  2DA2 A;  2STT A;  4CYD A;  3SFZ A;  3A02 A;  5LD2 C;  2ZXJ A;  2OCC H;  1R23 A;  2EIJ H;  2M87 A;  2MC4 A;  3M3Y J;  2LD5 A;  3M1C A;  3RCO A;  3KYC B;  4PJ0 C;  3JCU C;  4OAY A;  4LOC A;  3KIO A;  5HDK A;  2XGE A;  1X1P A;  2A07 F;  1MND A;  4RBO A;  1EJ9 A;  5D5V B;  1V3F A;  2HNH A;  2X1E A;  3REO A;  1BOA A;  1W7P A;  1ZLK A;  5E79 C;  1EH6 A;  4F92 B;  2A5Y B;  1P4W A;  2FE3 A;  5DV5 A;  4A3D J;  2LFB A;  4GYG A;  3H36 A;  2LY1 A;  2R7W A;  3HSF A;  1QVT A;  2DDA A;  1BW6 A;  4BDZ A;  3RPU A;  1W1W E;  4YII A;  2DA3 A;  2VQG A;  2LF7 A;  1MMD A;  3BJO A;  4RB0 A;  3DKW A;  3LSJ A;  5L3G A;  3A0H C;  4I6Z A;  2DMT A;  2GXB A;  5BQT A;  2E1O A;  2JQ7 A;  2VKD A;  1IAW A;  1LB2 A;  2R7U A;  2F6C A;  2STW A;  3GBG A;  3KP3 A;  3IC7 A;  4PSX A;  2R7Q A;  3OSG A;  1P2F A;  2VLA A;  4X0G A;  5LEK A;  4A3M J;  2LBF B;  4XOP A;  1KGS A;  2BY0 A;  2CQQ A;  1YRN A;  3VPR A;  1TQP A;  3GUD A;  4XLN F;  1HCR A;  5DYM A;  2MAB A;  3PSF A;  3M1E A;  1LFU P;  3F72 A;  4G9Y A;  2DMP A;  3O6B B;  1NHA A;  1A04 A;  2VL8 A;  3PFI A;  2KIU A;  3MFK A;  1CQT A;  2XAS A;  3BP8 A;  1AKH B;  2ZNZ A;  2K3P A;  2R5Z A;  3MWM A;  4UUS A;  1A36 A;  4XLE A;  4ESF A;  3PUB A;  4UVA A;  3ZQC A;  1E0E A;  2VPL A;  2V1N A;  3HGY A;  2MFZ A;  3VDX A;  2YPR A;  4ZTF A;  4P9U A;  3WTW C;  4CYC A;  3HTS B;  2HXO A;  1B1B A;  1RZ4 A;  3VYT B;  3BOQ A;  2A05 A;  1JHH A;  5M5Y J;  1ZRE A;  2PX9 A;  1T2K A;  1IJW C;  4HF2 A;  1Z91 A;  3G73 A;  3HM5 A;  2ME0 A;  2L5Q A;  2QUF A;  1FZP B;  1F43 A;  4ZH4 F;  4R79 A;  5EEA A;  2EZI A;  2K9M A;  2IP2 A;  1OR7 C;  4PJM A;  1S7O A;  2EPF A;  1R22 A;  1TT5 B;  1XCV A;  2K40 A;  1HBX G;  3J80 K;  1D3Y A;  4GGG A;  4XMY A;  3MKL A;  4HRI A;  4N9I A;  3OYB A;  3BG6 A;  4HNT A;  5H6Q A;  1G59 A;  3PNV A;  1IZ1 A;  2IT0 A;  5FLX Z;  2UZK A;  1XMA A;  4CCN A;  2PJR A;  1F5T A;  2ID6 A;  2L4M A;  1U3E M;  2OZU A;  1T56 A;  2P4W A;  3GLL A;  5HS9 A;  5ICF A;  1U8R A;  3PJR A;  1V5F A;  1HW2 A;  2Q8K A;  3QOP A;  3DTK A;  1SD7 A;  2HKX A;  4DBR A;  4RLF A;  3BZC A;  3JRA A;  1Y39 A;  2EZK A;  1RC9 A;  2Z5U A;  1VQ9 I;  2JVH A;  2N8G A;  1IN5 A;  2W84 A;  1MKM A;  4XLC A;  4MEY F;  5ILU A;  3RQ4 A;  2VBZ A;  4QSH A;  4KA4 A;  3B6C A;  1W0U A;  2BW3 B;  3BR3 A;  3DF8 A;  3ABT A;  4LMY A;  1YJ9 I;  4HF1 A;  1LDJ A;  1IRX A;  2EWN A;  2LC2 A;  4IQJ A;  2DMQ A;  3TKY A;  1CGP A;  1KQ0 A;  2PMU A;  4AIK A;  4XKB A;  1FP2 A;  1X1A A;  4UHT A;  1YYV A;  2I5U A;  3BDD A;  3ROU A;  2M8E A;  2O8X A;  4HPQ A;  1VQ4 I;  2ZFU A;  1EH7 A;  1S6L A;  2BZT A;  2X48 A;  1JKO C;  2WV1 A;  1D0X A;  2RAE A;  5LGN A;  5GPA A;  4V2G A;  3QRF F;  3CUQ A;  3S1R J;  3HOV J;  3I0T A;  3KE2 A;  5FD5 A;  2Y69 H;  5D4S A;  2QEX I;  1ETY A;  5IY5 H;  4JK1 X;  3ZQG A;  2H8R A;  2X1C A;  3UKG A;  1MBJ A;  1U8B A;  1YO5 C;  1H9G A;  1KQ9 A;  3PIO F;  4DW6 A;  4A3I J;  4MTE A;  1OYW A;  3K7A J;  2BVM A;  2ELJ A;  2DTR A;  4DGW B;  1S72 I;  3GTP J;  1FY7 A;  3KP6 A;  1K61 A;  1FTZ A;  3BTJ A;  2CJJ A;  1G2H A;  3DLL F;  3CME I;  3DPL C;  4KIS A;  4I98 B;  4ZDP A;  3CCM I;  4BYY A;  1BBY A;  1WJE A;  3FXU A;  4BL0 B;  4Y7N J;  4U7D A;  4EJU A;  5H20 A;  4ENM A;  3W2W A;  3HB9 A;  4BHC A;  3CC2 I;  3H9G A;  1UMQ A;  3WTT C;  4D7M A;  4HST A;  3R61 A;  5L3D A;  2BHY A;  3UR3 C;  3ZR8 X;  3V4G A;  1FWZ A;  2DYR H;  1SAN A;  3O8H A;  1HA8 A;  1HC8 A;  2G7H A;  5CVV A;  4HNU A;  2EA2 A;  2PMZ A;  1RKT A;  3S2W A;  2Y9Z A;  2HR3 A;  5D8K B;  3SEZ A;  4UVB A;  1G6N A;  3H3U A;  4ASN A;  2UXN A;  3LL7 A;  4IVN A;  3RKW A;  5DTD A;  2ZNY A;  3RPU D;  3QOD A;  1Q1V A;  4HZF A;  3JRB A;  4V19 K;  5JR3 A;  3BR5 A;  1SFO J;  2M7B A;  4RDU A;  2CS3 A;  2FQ4 A;  2V9P A;  5FB2 A;  1NK3 P;  2DT6 A;  2HDW A;  4DZJ A;  1V55 H;  4Q4Z F;  2GA1 A;  1XDU A;  5E17 F;  2YX4 A;  4CZZ A;  3ZCO A;  1ZTR A;  3DLA A;  1FEX A;  5J1R A;  4KJZ A;  4I02 A;  1D5V A;  3SJM A;  4BXF A;  3JRH A;  2RVC A;  4FX4 A;  2L9V A;  3DU6 A;  5D4R A;  3OYN A;  4FET A;  5KAF C;  1MJ9 A;  1JXS A;  3A2K A;  1D0Y A;  4PFP A;  2V9V A;  2CUJ A;  3Q0W A;  2LG4 A;  2HXI A;  1WWX A;  3LSH A;  1VQO I;  4FX0 A;  4UUT A;  3GTJ J;  4E7J A;  2VJJ A;  3ZQQ A;  3P7N A;  4L0Z B;  2KFD A;  4WXD A;  2VBY A;  2BOL A;  2E7W A;  3MVP A;  1XN7 A;  3O8G A;  4BQO A;  5ICG A;  4KIG A;  2XAQ A;  2M7A A;  3K1M A;  4XKW A;  3HUG B;  4YEL A;  1I27 A;  1FJL A;  4OMY A;  1SFX A;  4FAS D;  4XRM A;  5LRS A;  1ZAO A;  2O3F A;  3HKZ A;  4HQE A;  2E2H J;  2OV7 A;  5E8I A;  4A3E J;  2O5R A;  4EGY A;  3OMY A;  2LBF A;  1BI1 A;  3WOD F;  4D5F A;  2XAU A;  2A61 A;  5A2Q K;  2JPC A;  2X6O A;  3FHN A;  3T5X A;  1KU2 A;  4A2U A;  2ZJR F;  3S93 A;  3WE3 A;  2MD0 A;  2AS5 F;  4AIJ A;  3CES A;  3OIQ A;  5K5Q A;  3IUO A;  4A93 J;  1IV6 A;  5GAD J;  3S14 J;  1RKW A;  3VYR B;  2VT3 A;  2WWY A;  1B9M A;  2DOF A;  2GM4 A;  4F52 A;  3FIS A;  2JMW A;  1DGR M;  5IOY A;  1D1B A;  2IPQ X;  3CCY A;  3N05 A;  3DV8 A;  5DM6 F;  4M71 A;  1G3T A;  1U2W A;  4EJT A;  1FOW A;  1FSE A;  2E34 A;  4V2F A;  3CF5 F;  3HXL A;  4MFE A;  3SDB A;  4WWC A;  2R7Z J;  1YS7 A;  2HDC A;  4S0H B;  3MEX A;  3GME A;  1BR1 A;  3AG2 H;  1YW9 A;  3EUK L;  4MQ9 F;  5E20 A;  3ZQI A;  2M45 A;  5TJJ A;  1CF7 B;  3T1B A;  3I5U A;  5E3O A;  1BC7 C;  2ELH A;  2OC6 A;  4B3A A;  2CSO A;  1I6X A;  2L9R A;  3R60 A;  5E1Z B;  2XDV A;  5BNG A;  3IV5 A;  4L18 B;  1JI8 A;  3NWT A;  5JVG F;  1W5C C;  3J7Z I;  4HOB A;  3CF2 A;  1LFP A;  3DTI A;  4XSX F;  3HSE A;  4P5O A;  2JRM A;  5B1B H;  1MNM C;  1U5T B;  2HDD A;  3SXY A;  4BJ6 C;  1RUN A;  2CV2 A;  3FKJ A;  1ETX A;  2L01 A;  3Q0U A;  5AIQ A;  2XIG A;  2OF7 A;  3BQZ A;  1IRF A;  3PM1 A;  2DMN A;  3RKQ A;  2F2E A;  1U5T C;  3K1N A;  3QPS A;  3HGG A;  3BJ6 A;  4M6X A;  4CCL A;  1KA8 A;  3FWE A;  3S3M A;  1PVE A;  2LRE A;  3TDU C;  1OPC A;  3L09 A;  2W4S A;  1M1E B;  1Y1W J;  5KK1 A;  4LJZ F;  2COB A;  3L2W A;  2ECC A;  1A6I A;  2ZC2 A;  2NYX A;  3V8L A;  2BW3 A;  4LFU A;  1Y0N A;  3LSI A;  2P7C B;  3ZMV A;  5LBQ A;  3GO5 A;  4QIW N;  3RZD J;  5FKK A;  1ZYR F;  2IRF G;  2A3S A;  3L9F A;  4WX9 A;  2W57 A;  2VBX A;  4AID A;  1P7J A;  2DFE A;  3DBL B;  4M3E A;  5KVR A;  2MC3 A;  5DUK A;  3ONQ A;  2MA3 A;  4CCJ A;  4FTH A;  3KEQ A;  4IL6 C;  4PGG A;  1TL8 A;  1F4K A;  2FF4 A;  3GXO A;  1WZ2 A;  5K7F A;  5L3B A;  4YIF A;  5DDG A;  1GXQ A;  2HOE A;  4HX8 A;  4PDK A;  4RM3 A;  4Y33 A;  3H92 A;  4NB5 A;  3EPZ A;  3JAM K;  1WJC A;  2RRE A;  1T38 A;  1XCB A;  5JI6 A;  2DU9 A;  1ETQ A;  4D0P A;  3S8P A;  3WGH A;  1JHF A;  4U0W A;  4MHG A;  1QBJ A;  2XRL A;  1IN8 A;  2LY9 A;  1QVU A;  4BGD A;  1YW7 A;  4C2T A;  4XR6 A;  2VKH A;  4GO1 A;  3K4M A;  4I99 C;  3TO7 A;  2YU9 J;  1L0O C;  3J7Y J;  2LVS A;  3H1C A;  2KJC A;  1W0T A;  1I3A A;  1S29 A;  4OIR F;  3GFM A;  3GTM J;  4HA8 A;  3TW6 A;  1QGP A;  2EZH A;  2PI0 A;  2RN7 A;  2XF7 A;  3F3X A;  5L3C A;  3CCV I;  2GXA A;  3WHB A;  3WGG A;  1Z77 A;  1NG6 A;  2EBI A;  2MD5 A;  3O2P E;  1GXP A;  2R7O A;  2NVY J;  2QWW A;  2DT5 A;  1FT9 A;  2HVQ A;  5A2Q Z;  4RAZ A;  3ZQL A;  3FIW A;  3FM5 A;  2PN6 A;  1RUO A;  3TED A;  3RTR A;  3FMQ A;  4M6Y A;  2QZ8 A;  3VOD A;  4L0Y B;  2GIZ A;  2H27 A;  1BN5 A;  2ZME B;  5LGU A;  2DT7 B;  2V6E A;  2FD5 A;  5D5W B;  2P6S A;  1SVL A;  3S2D J;  5ILV A;  4P9F A;  1UHM A;  2E1C A;  3D5L A;  2IS4 A;  2LKP A;  3G71 I;  3AG3 H;  1T95 A;  1FYM A;  3EUH C;  3DKY A;  2LKX A;  4BY7 J;  2JA2 A;  2K5C A;  2Y0M A;  4M73 A;  1OFC X;  2LLK A;  1IXS B;  2IGN A;  3P9K A;  2CQX A;  3WTZ A;  2OAZ A;  5EDN A;  1E3O C;  4TV7 A;  1Z3Y A;  3CD6 I;  2HVR A;  1MJB A;  3A01 B;  2A69 F;  3JTH A;  4RM2 A;  3IKV A;  1TQM A;  1LDD A;  3PSI A;  1TWC J;  4M3F A;  2MH9 A;  1PP8 F;  3EUA A;  4HW0 A;  5CQE A;  3RDI A;  3WG9 A;  1O3Q A;  4Y52 J;  3C2H A;  1K7A A;  2ESN A;  2BV6 A;  1N78 A;  4K2E A;  5D6E A;  2DFH A;  2R7R A;  3DQV C;  2FJ1 A;  2FML A;  3KZY A;  4X6A J;  1XMX A;  3GFL A;  4AUX A;  2Z9O A;  1TWF J;  1IGN A;  3OYD A;  5EGO B;  2CO5 A;  3HC7 A;  1BI0 A;  1ZGW A;  1JKP C;  5IT9 K;  2AHQ A;  5GAH J;  2MLK A;  1DPR A;  3HUG A;  2L9N A;  3K1P A;  2X6W A;  4MLO A;  2CV1 A;  3C2G A;  2PBI A;  2LY2 A;  5FJ8 J;  4ZZD A;  1APL C;  1OLT A;  2PQ8 A;  2DTZ A;  5KAI C;  3B02 A;  4OWR B;  2KL4 A;  4WK8 F;  2JK3 A;  1YLF A;  2EV5 A;  3F0C A;  4A0Y A;  2V79 A;  3IRR A;  2J5P A;  1EV7 A;  1UEL B;  1GDT A;  2E35 A;  5HNF A;  3C7J A;  3W2V A;  3HDD A;  4AIH A;  3J7A O;  2M2E A;  2V9K A;  2K86 A;  2P6T A;  1LJ9 A;  4L9N A;  1MH3 A;  4BKX A;  1MSF C;  5J8F A;  1P6R A;  4AVZ A;  3CUQ C;  4UV8 A;  3HOY J;  1SFU A;  3ABL H;  2RNG A;  1SAU A;  2QSF X;  3R6S A;  1OYI A;  2KKO A;  3LST A;  1WFX A;  2CG4 A;  2JT1 A;  2ZO4 A;  2JA8 J;  4ZYD A;  4DYR A;  5ILS A;  2HFH A;  2ZB9 A;  3QP6 A;  2DFF A;  4WXH A;  4E7I A;  4I2O A;  5DCF A;  2ZXI A;  4O6J A;  4Y13 A;  3H5R A;  2KIQ A;  1J7K A;  4KDP A;  1SMT A;  1J5Y A;  1FBS A;  1PUE E;  2VJ4 A;  1CF7 A;  2HEO A;  2NXN B;  2DAO A;  1XDS A;  4A3L J;  4M9S A;  4JX5 A;  4OOI A;  2O61 A;  2E1M B;  1MIJ A;  5CVR A;  1FTT A;  2XKP A;  4G8X A;  4YFN F;  4Y15 A;  3BG7 A;  3AG1 H;  3GWZ A;  2Z1D A;  3GCM A;  2JJ7 A;  1DQU A;  1U5T A;  3HRS A;  4HDV A;  4ENN A;  3LSK A;  4XKV A;  2JA5 J;  2K27 A;  5JHU A;  4C2M J;  2EIK H;  4HG2 A;  4KT6 A;  2L0K A;  3QPL A;  3OYA A;  2E1M C;  3KZI C;  1B4A A;  5DEQ A;  3HL2 A;  3AFH A;  3LA2 A;  5EF6 A;  4DQ2 A;  1RI7 A;  2B7E A;  2HQR A;  4CSW A;  3GEZ A;  5E1X A;  1ZG5 A;  3DPU A;  4LG3 A;  2Q2E B;  2P7V B;  2QBY B;  3OYE A;  1HDD C;  3ZMT A;  4I09 A;  4W97 A;  3QAH A;  4LB5 A;  1FX7 A;  1R36 A;  2CU7 A;  1Z3X A;  2M4K A;  2X0L A;  5J8C A;  2EH3 A;  5IP7 J;  1YOV B;  1NTC A;  2L7K A;  3OWT A;  2CQN A;  5E18 F;  1X58 A;  1MMN A;  3K2A A;  2NVQ J;  3KP7 A;  1IG7 A;  2A6T A;  2QQ8 A;  2KRH A;  1HKQ A;  1HW1 A;  4HDU A;  1BM9 A;  1TW2 A;  2QSH X;  3G1O A;  5ERI A;  5B5E C;  3CC4 I;  2I8D A;  3LFU A;  2ZFW A;  1DUX C;  1Z7U A;  3C1D A;  1Z05 A;  3BR2 A;  2L02 A;  4XLP F;  2MLG A;  5HS7 A;  3RIR A;  1TQI A;  2XF5 A;  4OAZ A;  3CO7 C;  1TNT A;  4HF0 A;  4G7O F;  4EEF G;  4BJ5 C;  2JTV A;  2R5Y B;  3FK7 A;  2HZT A;  2F5E A;  2QQB A;  2F5C A;  1UG0 A;  4U87 A;  1VQM I;  2Z2S B;  3A4C A;  3E7L A;  1ZK8 A;  3SQN A;  1Y8Q B;  3WTX C;  3OIP A;  2IW5 A;  2KRC A;  1BR4 A;  1I39 A;  2O03 A;  2P81 A;  1U9O A;  1BA5 A;  1SVM A;  2ETH A;  2DW4 A;  1BI3 A;  2XF6 A;  3AG4 H;  5LHI A;  3CJQ B;  5DCM B;  2R3S A;  4LLL A;  5TRD A;  2KP6 A;  4Y3O A;  3E97 A;  2GIV A;  1T8I A;  2O9L A;  4A0X A;  1ZG1 A;  2DYS H;  5HLI A;  4B47 A;  3TOB A;  1BC8 C;  1UHW A;  3A03 A;  2M8G X;  1I50 J;  1W4M A;  2W7N A;  1XSV A;  3PO3 J;  2ADU A;  4PCQ A;  2R7D A;  3ZP5 A;  3HG9 A;  1H88 C;  4GYI A;  5D6F A;  2AQF A;  1J2X A;  4A6E A;  5J1Y A;  3BQY A;  1WI9 A;  1QNT A;  4A5M A;  1HKT A;  4Y17 A;  4UB8 C;  4OIN F;  3FKI J;  3LWF A;  5HLH A;  3H9Q A;  3IRQ A;  5M5W J;  2JUC A;  2QEN A;  1Z7L A;  4C3I J;  4KIC A;  1T6S A;  2H09 A;  2E5N A;  3OV8 A;  2IA0 A;  2Y31 A;  3SEQ A;  1XGN A;  2FNP A;  4KNY A;  2EIN H;  4DOZ A;  1R5I D;  4ANJ A;  2X85 A;  3EUH A;  3C3W A;  5CLS A;  3KX2 A;  2UV1 A;  4XL9 A;  5DD8 A;  4ETS A;  3SZG A;  2ZME A;  3PL8 A;  1K4S A;  5K7H A;  4XRS A;  3F8B A;  1JT0 A;  1WHU A;  3HRU A;  1VQ8 I;  4IXA A;  1AA7 A;  4L5J A;  1JTY A;  1PUF B;  3OOU A;  5K5R A;  2JPB A;  4E70 A;  2FOW A;  3WHC A;  4IOC F;  1F9N A;  3IH3 A;  3G1M A;  5H6R A;  3SZT A;  4F55 A;  1PP7 U;  2IBD A;  1DP3 A;  3BRO A;  4YFK F;  1UB9 A;  4D1Q A;  3A01 A;  1YQA A;  1Y1V J;  1IXR C;  4ITV A;  2BHZ A;  2IA1 A;  4HAM A;  1SC7 A;  3J81 Z;  3HOZ J;  3K4J A;  2IGK A;  2V1D A;  4CA0 A;  3QOE A;  4QPO A;  4O5V A;  4YFX F;  3EYI A;  4AYB A;  3HOS A;  4FIS A;  3CCR I;  2X51 A;  2K9Q A;  2CRG A;  2E5Z A;  2VAS A;  4I0A A;  5C4X J;  3NEU A;  3E6B A;  1E3P A;  1YJN I;  4QWQ A;  2EV6 A;  1IN7 A;  1Y0U A;  2XB5 A;  2L7M P;  3LOC A;  4IQ4 A;  2LF8 A;  4B3X A;  4B43 A;  5EGO A;  4J01 A;  4JYK A;  4L5I A;  3L00 A;  2EK5 A;  1MMG A;  4I76 A;  2ZBK A;  2DA5 A;  4HBL A;  3C18 A;  5FO5 A;  3OYH A;  3K4B A;  5FKO A;  3CQZ J;  1ZKG A;  1FOY A;  4JX6 A;  5BOX A;  1TP4 A;  3FZV A;  3JSO A;  4RB2 C;  5J6X A;  1WI3 A;  1X1B A;  3I71 A;  1S5L C;  2Z3Y A;  1J59 A;  2YUS A;  1S7E A;  3ABM H;  2ZJQ F;  2ZSH B;  5ICE A;  2B9S A;  1F36 A;  1ZN2 A;  5EZH A;  2VQH A;  1JKR C;  1C0W A;  2UUZ A;  1QA6 A;  2RQQ A;  3HYI A;  3M7G A;  4CCK A;  2ID3 A;  3KLO A;  4ABZ A;  3KCC A;  4UB6 C;  5AIP A;  4KYW A;  2CYY A;  2M3A A;  4P1W A;  2ZKZ A;  4XLA A;  1GVD A;  4WF2 A;  3WTS C;  3KP4 A;  3S2H J;  4I01 A;  2WAD A;  1F1Z A;  1IW7 F;  2QLZ A;  3IL2 A;  3MMY B;  1WPK A;  3OYF A;  5LLQ A;  1ZQ3 P;  5D5X B;  3LAP A;  2W48 A;  1OYY A;  4H0E A;  2K9S A;  2JWT A;  1SAX A;  3GLX A;  3DXJ F;  4N0B A;  1MGT A;  3TDZ C;  5HNH A;  4KMU X;  2EFP A;  1W7P D;  3BG5 A;  1WJ5 A;  2BY1 A;  1YHQ I;  2VXD A;  3QQA A;  4C9Y A;  3KYD B;  4HV6 A;  3JRC A;  1XD7 A;  4JOM A;  2CW0 F;  2V1X A;  1VQL I;  2NS0 A;  1R4N B;  1WVR A;  1PJR A;  1TWG J;  1Z1D A;  3VFZ A;  1J0R A;  2BEO A;  3H5A A;  3CCJ I;  1LEA A;  1WQ2 A;  2XAF A;  5E1W A;  1S7A A;  4L9V A;  4LB6 B;  2PLY A;  2VKV A;  5B1A H;  4ZZL A;  1QPI A;  5CKT A;  2BGC A;  2NNY A;  2ISY A;  2VI6 A;  1MMS A;  5F64 A;  1OCO H;  1UG2 A;  2Q2E A;  3B73 A;  4A5N A;  2XGC A;  2QBY A;  4KN7 X;  3DCF A;  1RIO H;  5KNL A;  3W6V A;  3FXR A;  2VOD A;  2H6B A;  3R4K A;  1DU6 A;  1I3Q J;  2Q0O A;  3CMM A;  4F7Z A;  4IHV A;  2VON A;  4M6V A;  1R49 A;  1LUJ B;  2O7O A;  4UXN A;  1B9N A;  4P55 A;  1QHG A;  4U88 A;  3M8J A;  5HLG A;  5JLW A;  1ZR4 A;  3GFJ A;  1ZGA A;  5IYD J;  3DEW A;  3QP5 A;  3JW4 A;  4BAC A;  4RGS A;  3I4N J;  4XOT A;  4M9Z A;  3J80 Z;  3QPH A;  2PJP A;  3OYK A;  2ZJ2 A;  4Q5S F;  4UY8 I;  3I53 A;  1AHD P;  2E2I J;  3CTA A;  3K69 A;  2YX7 A;  1O3S A;  2CUE A;  3I54 A;  4BBS J;  3LSG A;  4XK4 A;  4CZC A;  2R5Y A;  3D0S A;  1JKQ C;  2GBY A;  1VQ5 I;  3G1L A;  2NRA C;  2K4J A;  3N97 A;  4DZP A;  5J47 A;  5EEG A;  4FE4 A;  5B66 C;  1WJB A;  4XQF A;  4KFC A;  3S16 J;  1G8X A;  3PQK A;  2XUB A;  4RAF A;  5E3N A;  4MFD A;  1YIO A;  3QU6 A;  2VOO A;  3VOE A;  5DCM A;  3M07 A;  5BMZ A;  3DPT A;  4IPA A;  2K85 A;  3I56 I;  3H0G J;  1AKH A;  3NWS A;  3MZH A;  2V4J C;  1STZ A;  2B0L A;  2NVT J;  2HQ5 A;  3OYI A;  4BH9 A;  2OD5 A;  4M3B A;  4B1R A;  2UWM A;  3HIF A;  3PFY A;  3Q0V A;  2VE9 A;  1ORK A;  2J5O A;  4B8X A;  4BDY A;  1J09 A;  3H3V K;  2DOA A;  3FXJ A;  1IXC A;  4MGR A;  5IYB J;  2HS5 A;  3HOX J;  2OTL I;  1LEB A;  3D5R C;  3BPX A;  4NNJ A;  1K78 B;  5EYR A;  1HSJ A;  1DDN A;  2D2W A;  4EQQ A;  4R1H A;  1X3W B;  1DP7 P;  3E5U A;  3F8M A;  3NRV A;  3V8K A;  1SD4 A;  2NVU B;  3T8R A;  4A3K J;  3LSM A;  3MZY A;  3RSN A;  2KDZ A;  3FBN B;  3ZMU A;  3KZZ A;  5HS8 A;  3ESW B;  3E6D A;  3OL4 A;  3GZN B;  1Y8R B;  2ZSI B;  3OR2 C;  3BCB A;  5J40 A;  4XIC A;  1TZL A;  2KRF A;  3ZQH A;  4PUS A;  4RB1 A;  2W24 A;  2RV8 A;  2UXX A;  1K6Y A;  2GQQ A;  2L9S A;  3BG9 A;  5FGM A;  4HX4 A;  2D5V A;  4ENJ A;  4XRF A;  3KYL A;  2XRN A;  3OYL A;  2E71 A;  3CDH A;  1PUF A;  2OBP A;  1PDN C;  2F5D A;  2WB1 A;  4PSW A;  1VQP I;  4ZC3 A;  1R71 A;  1Z67 A;  2HPI A;  1IO2 A;  1UST A;  3IHU A;  2LH9 A;  2QQ9 A;  4L9T A;  2JRT A;  2MSY A;  2CUF A;  2Y0S A;  2JA6 J;  4C2U A;  2H6C A;  1Z0X A;  2HOT A;  1XS9 A;  2M0M A;  5HLT A;  2K9N A;  1HQC A;  4BUP A;  3QYF A;  3HOU J;  1Z6T A;  1KU7 A;  1AU7 A;  5M3M J;  2HKO A;  4OU0 A;  1WKM A;  3WU0 A;  1R1T A;  1QPM A;  2MG4 A;  3GF2 A;  4YRV A;  4B48 A;  1K4T A;  5FD6 A;  3MKZ A;  2LR8 A;  3E6M A;  1PYV A;  1IUY A;  2IJL A;  2EZL A;  2M4G A;  3IKT A;  3OY9 A;  5FKN A;  1ZRC A;  4BQQ A;  4A3J J;  2LOO A;  1MMA A;  1YS6 A;  1UFM A;  1ZEL A;  5CVI A;  4UVC A;  4JX4 A;  1YE9 A;  1FIP A;  1O7L A;  3P9C A;  1JTX A;  2OU2 A;  5K5O A;  2EFW A;  2WY8 Q;  1BI2 A;  4LIU A;  2DI3 A;  2K4B A;  3K70 D;  3F23 A;  2BVL A;  1ZR2 A;  3E5X A;  1G3S A;  4HV5 A;  4KMF A;  3S1N J;  2DK5 A;  4JBA A;  1GV2 A;  4RB3 C;  2JA7 J;  4E7L A;  4AD9 A;  2DJI A;  3LSP A;  3PQJ A;  2L7Z A;  1TWA J;  4BXU A;  4GCV A;  4BAY A;  2PFB A;  1BOB A;  1ITY A;  4BE0 A;  4JP0 A;  3IWF A;  2ZXH A;  2L54 A;  3NAU A;  4LLG F;  1MJA A;  1R5G A;  2R93 J;  5J1U A;  3JRG A;  2IS1 A;  5AON A;  5FLM J;  1KYZ A;  2PMH A;  3I9V 2;  3I58 A;  4G6T B;  2LDU A;  2O0Y A;  2KZG A;  3KEY A;  1RET A;  4XLF A;  4E7Z A;  2O6G E;  4CCM A;  1QQI A;  2FQ3 A;  2OUM A;  1USS A;  4PZJ A;  1N25 A;  2KT0 A;  3BTC A;  4QLC U;  4HEA 2;  4GFB A;  2P8T A;  1Z6R A;  3HPG A;  2YS9 A;  3BCA A;  2DXI A;  2R7X A;  1ONV A;  4IZZ A;  1R4M B;  2PMZ N;  4IHY A;  4OIP F;  1FP1 D;  2L2O A;  3ZN0 A;  3CCU I;  2M34 A;  2TDX A;  3RKX A;  1XSX A;  3I3L A;  3KP5 A;  1MDM B;  4F93 B;  3KEO A;  3QWL A;  5FFZ A;  2VC0 A;  3BLY A;  2KIM A;  3L1P A;  3WU2 C;  5D8L B;  4EV0 A;  3CJT B;  4G7H F;  3K4N A;  2WAF A;  3CJR B;  1ZH5 A;  2QKL B;  5JVT A;  5K7Z A;  2V1U A;  2EFO A;  4IEJ A;  4D7N A;  3OYM A;  2ZME C;  1ACI A;  3L2V A;  3Q5F A;  3U1D A;  1ZAR A;  3HEF A;  2DN0 A;  5F1J A;  3TMO A;  2DDB A;  3V7C A;  3E6C C;  4H4K C;  3K6G A;  4IHW A;  3RI4 A;  4XKC A;  2OA4 A;  3CDL A;  1T08 B;  5HOD A;  3L2U A;  3IWZ A;  4M74 A;  2IEK A;  2M9H A;  4LIT A;  3PO2 J;  2R7V A;  2QM3 A;  3BY6 A;  1U9N A;  5E3L A;  5J4Y A;  2HVS A;  1BR2 A;  4BBR J;  3ZMD A;  1RPW A;  4IRH A;  1IUF A;  1FYL A;  1J9I A;  2KHM A;  2VXZ A;  2YSR A;  3PUF A;  5LGT A;  1A31 A;  3HKZ N;  2W85 A;  4IHX A;  2VUM J;  3CMY A;  2HQN A;  1RES A;  3GW2 A;  2VKE A;  3G4S I;  3CP8 A;  1MBF A;  3U1K A;  4JQF A;  1O3T A;  3DBR B;  2NVX J;  1B59 A;  2W25 A;  4BNC A;  2EA4 A;  1BJZ A;  3FXO A;  2F5F A;  4M72 A;  3HBL A;  1HLV A;  4A3C J;  4NQW B;  2XPW A;  2KQR A;  1ON1 A;  3LNQ A;  3GTG J;  1JUS A;  1LPQ A;  4BEH B;  2BE5 F;  2IAI A;  1ZRD A;  5M3F J;  3IH4 A;  3J7A Y;  5GTI C;  1QU3 A;  4AU7 A;  3K10 A;  2EIM H;  2VOP A;  1UJ8 A;  1R9T J;  3QYE A;  3V42 A;  4ZYG A;  4CXF A;  2HI3 A;  4BE1 A;  2G0E A;  2Y2Z A;  2JUG A;  1XTA A;  4IHT A;  1YIJ I;  4KIB A;  3BR1 A;  2DPU A;  5F04 A;  2Z33 A;  3HSR A;  1D0Z A;  3ML6 A;  4L9J A;  4NHJ A;  1W36 C;  1X4O A;  2M1B A;  2V6C A;  4XLH A;  4ENK A;  4AC0 A;  2WV0 A;  1OCR H;  3SZP A;  1K78 A;  1OJL A;  4ESJ A;  2RKH A;  5EG0 B;  2M0C A;  4U7B A;  1D8K A;  2YR2 A;  1QRY A;  3BTI A;  2Z16 A;  2A6E F;  5HDN A;  3JAM Z;  3R0J A;  1W5T A;  4XON A;  4ESB A;  1DPU A;  4IF4 A;  4KN4 X;  3DFG A;  1A6Q A;  3BT9 A;  3DP7 A;  4Z2Y A;  3OR1 C;  2F4O B;  3ZPL A;  3BC8 A;  3EQL F;  4Z6Y A;  4GDF A;  3S1Q J;  1V5E A;  2KJB A;  1XPX A;  3E0J B;  1S8N A;  3BWG A;  2WAQ N;  3GFI A;  3PNY A;  4CH7 A;  2NS8 A;  3FX3 A;  1D1A A;  2DK8 A;  3ECH A;  2R92 J;  3F8N A;  1P4X A;  2DMU A;  2PEX A;  4DYC A;  2XPV A;  3E3V A;  3I59 B;  4AM3 A;  4LD5 A;  3TL4 X;  3LQR A;  1G3W A;  2A68 F;  4CDG A;  2DA4 A;  1Y6I A;  2HWV A;  3F22 A;  1OKR A;  4IHS A;  3PNT A;  2DLL A;  1D1C A;  3MKW B;  3L2R A;  2MGQ A;  1T33 A;  1XGO A;  2HOA A;  4E7K A;  5M5X J;  2HYF A;  1LVK A;  3WTU C;  1FMW A;  3ZMS A;  4XID A;  3CCQ I;  2QQA A;  3OS0 A;  2FUG 2;  2QGU A;  4RA2 A;  3M9A A;  4EVI A;  3CCE I;  3HRT A;  4KIT B;  5BS6 A;  2HYG D;  1XGM A;  5FRN A;  1ZHF A;  3SFI A;  4LIV A;  4CIC A;  2VIX A;  3BJA A;  1P4A A;  1YFH A;  1TBX A;  1YG2 A;  1E3H A;  3ABK H;  3VWB A;  3GZ5 A;  1LQ1 A;  2OQR A;  5EZG A;  1X1C A;  2B63 J;  2KDO A;  2XV4 S;  1VTN C;  1Z21 A;  1ETO A;  5EJC A;  3TOA A;  1VFC A;  4ZYA A;  1R7J A;  2E36 A;  3MD2 A;  1X2N A;  2OCE A;  3BZK A;  3G3Z A;  1MBG A;  3IAS 2;  3TQN A;  1RR8 C;  3BZ6 A;  5CVU A;  1H89 C;  3F9K A;  4CUG A;  1MH4 A;  1B72 B;  1MNE A;  1SMY F;  4XN0 A;  2DOD A;  4U0Y A;  4A6D A;  1X1D A;  5IP6 A;  4G6Q A;  4NC8 A;  2LKS A;  4GRI A;  3RKY A;  2ECB A;  3HTU A;  2W00 A;  4HSR A;  2YU3 A;  4UUV A;  2P5V A;  1A5J A;  3MZ8 A;  2Y75 A;  1R6R A;  5IT9 Z;  4RGX A;  5K1Y A;  2OZ6 A;  1NK2 P;  2GOX B;  1MW7 A;  5FRM A;  3K0L A;  4FQG A;  3X2Q H;  5J3L A;  2ZJP F;  4ON0 A;  2IXS A;  1YX5 A;  3TBI A;  2V7F A;  1OMI A;  1X2M A;  1O57 A;  1TTY A;  2JZY A;  4MEX F;  1Y56 A;  3VSL A;  4C30 A;  3W3C A;  1L3L A;  1MDM A;  4IJA A;  1RR7 A;  4I0B A;  2GZW A;  3B6A A;  4G12 A;  4EJW A;  5C3E J;  5IPA A;  1T0F C;  2DQL A;  2RC4 A;  4S04 A;  2VBW A;  1G3Y A;  4YEJ A;  2FX0 A;  3OYC A;  2X1D A;  1EF4 A;  3TW7 A;  3A0B C;  1MD0 A;  1O4X A;  2LMD A;  3HHG A;  4U0V A;  4G94 A;  1ULY A;  4XNF A;  1D5Y A;  3ISP A;  1R1V A;  5GP9 A;  1GVJ A;  4YIR X;  1LE8 B;  4I7H A;  2CW8 A;  4WXC A;  2CQK A;  1YI2 I;  2JSP A;  2M30 A;  5FLV A;  3OL3 A;  1KU9 A;  1XG1 A;  2CUZ A;  2OJE D;  3COA C;  2HU9 A;  2P5L C;  2GA2 A;  3GTO J;  1MSE C;  2V26 A;  2LK2 A;  3WE2 A;  3BR0 A;  3FMS A;  4OMZ A;  3GTQ J;  2K7L A;  4QPQ A;  3IP4 B;  1O7F A;  2D45 A;  3JRI A;  1KQ8 A;  4EJO A;  2QKM B;  3GZ6 A;  3WTV C;  2L7F P;  1ON2 A;  1Z9C A;  4PJJ A;  4RGU A;  3CC7 I;  5DD4 A;  5D5U B;  3LQQ A;  2FMY A;  2FOK A;  4DYQ A;  5J4V A;  4BHP A;  3HPH A;  3CO6 C;  5F08 A;  5F1R A;  2QF7 A;  2R7S A;  1BW5 A;  1VQN I;  1T98 A;  3WTY C;  3ERM A;  1IN4 A;  1HST A;  4PFO A;  3FXQ A;  4XRS G;  4BXX J;  1W5S A;  2KLO A;  4Q47 A;  1ZRF A;  2NAZ A;  2DJN A;  3AAF A;  5E3M A;  1OIS A;  2LSO A;  2I10 A;  3GTL J;  1FC3 A;  2HQA A;  2WAE A;  3KLN A;  1E17 A;  4M9X A;  4NQW A;  3LAJ A;  1J75 A;  2D1H A;  3QYB A;  2Y48 A;  3VYS B;  2KPM A;  3AKZ A;  3CCL I;  4BEH A;  3LSR A;  2O8K A;  1K83 J;  2ME6 A;  4OIO F;  2XB0 X;  4G6D A;  2WC2 A;  1XSD A;  1X4P A;  3JRE A;  3T8T A;  4IRG A;  1LKX A;  2HOS A;  1U6G A;  4RS8 A;  4A0Z A;  4F3Q A;  1P9Q C;  3FHZ A;  3TP0 A;  2VPR A;  2AQE A;  4EJV A;  3L2Q A;  2VE8 A;  5KCM A;  1QZZ A;  2TCT A;  1IF1 A;  2NOJ B;  2KZV A;  3U21 A;  3FF5 A;  3RQI A;  3ZOB A;  1FLI A;  5LRR A;  4MTD A;  2IS2 A;  2CQ7 A;  1OCT C;  3QPT A;  2K3F A;  1EKE A;  5L3F A;  5EG0 A;  4MQV A;  2MYS A;  2XVC A;  2X9D A;  4P96 A;  2R7F A;  2FBH A;  4B09 A;  2EFQ A;  5F0H A;  4HLX A;  1SFK A;  3FM3 A;  3CUO A;  4BQN A;  3CLQ A;  3OS2 A;  1BIB A;  2LP0 A;  2G7U A;  3HZJ A;  3MAJ A;  2LTP A;  1TW3 A;  4Q48 A;  2XAJ A;  5FFX A;  1HF0 A;  3D5S C;  3F8F A;  4EGZ A;  1R5H A;  2LYC A;  2KIF A;  4LG0 B;  4O3M A;  5HVQ C;  3IAM 2;  2GOM A;  3SDG A;  4ZTJ A;  4LK0 F;  3K2Z A;  3IH2 A;  3ZXS A;  3DEE A;  3DEU A;  4D9J A;  4EAT A;  4A3F J;  3DU5 A;  3I59 A;  4C3J J;  1I1S A;  3RJP A;  1A35 A;  2GXG A;  2EB7 A;  4GXO A;  1TC3 C;  4EM1 A;  2H1L A;  3ZRG A;  1MBE A;  2XSJ C;  2Z99 A;  2K02 A;  2DBB A;  3WG7 H;  2TRT A;  2M5W A;  3C2B A;  3MCZ A;  2A5W A;  3EET A;  4L5E A;  5GTH C;  3EDP A;  4FCY A;  1OQY A;  5DS9 A;  4BY1 J;  1V4R A;  3P5J A;  1FBQ A;  1R1U A;  4A3B J;  4DJA A;  1ZLJ A;  1ETK A;  3MN2 A;  1GUU A;  2ACJ A;  3W6K B;  5EEH A;  1ETW A;  2HZD A;  4KUM A;  5LFA A;  1JE8 A;  1QO0 D;  4DIQ A;  1H8A C;  1POG A;  3FBI B;  4DNC A;  5JLX A;  3BR6 A;  3CJN A;  3L7W A;  1VND A;  3RZO J;  1KZH A;  1FMV A; 
#chains in the Genus database with same CATH homology
 2R93 J;  5J1U A;  3JRG A;  5FLM J;  4A3L J;  4JX5 A;  1RET A;  2ID6 A;  1FTT A;  1T56 A;  2JJ7 A;  3M4O J;  3JRA A;  2JA5 J;  2EZK A;  2KT0 A;  4C2M J;  2NS7 A;  3BTC A;  2N8G A;  2L0K A;  3QPL A;  4GFB A;  2YS9 A;  4QSH A;  1B72 A;  3B6C A;  1W0U A;  5EF6 A;  3BR3 A;  2PMZ N;  3OIO A;  4IHY A;  3NAR A;  2DMQ A;  1WGX A;  2M34 A;  1HDD C;  3L1P A;  2HYJ A;  4W97 A;  2CU7 A;  2GLO A;  1HOM A;  2EH3 A;  5IP7 J;  1NTC A;  2XGD A;  2X48 A;  1JKO C;  1X58 A;  2NVQ J;  3K2A A;  1B8I B;  1IG7 A;  1IDY A;  2WV1 A;  2RAE A;  3GTK J;  5GPA A;  5K7Z A;  5IYC J;  2R0Q C;  4IEJ A;  4V2G A;  4D7N A;  3S1R J;  3HOV J;  3G1O A;  4FE7 A;  5C4J J;  4MIM A;  1ETY A;  3HEF A;  2DN0 A;  5F1J A;  3ZQG A;  5IOZ A;  3BR2 A;  2H8R A;  5F0F A;  3UKG A;  4MO7 A;  1MBJ A;  1U8B A;  1JGG A;  3I4M J;  4IHW A;  1JUP A;  1DU0 A;  3CDL A;  4EEF G;  5HOD A;  4DW6 A;  2R5Y B;  4A3I J;  3FK7 A;  2ELK A;  3K7A J;  1LE8 A;  2IEK A;  2M9H A;  3GTP J;  3PO2 J;  1K61 A;  3E7L A;  1FTZ A;  1ZK8 A;  2CJJ A;  3BTJ A;  1U9N A;  5E3L A;  4BBR J;  1RPW A;  1G2H A;  1IUF A;  2P81 A;  1BA5 A;  1U9O A;  3HKZ N;  4Y7N J;  4IHX A;  2VUM J;  3CMY A;  1RES A;  4AYB N;  3HB9 A;  2VKE A;  1UMQ A;  4D7M A;  2O9L A;  4B4C A;  1MBF A;  1WCM J;  2NVX J;  3A03 A;  2M8G X;  1I50 J;  2XPU A;  3PO3 J;  4M3D A;  1SAN A;  3O8H A;  1BJZ A;  3HBL A;  1H88 C;  1U78 A;  1HLV A;  4A3C J;  1RKT A;  5J1Y A;  2Y9Z A;  2XPW A;  3BQY A;  1XC5 A;  4X1E A;  3LNQ A;  4W1U A;  2JN6 A;  1JUS A;  3GTG J;  5DTD A;  1IDZ A;  1MBH A;  2IAI A;  3FKI J;  1Q1V A;  3IH4 A;  5M3F J;  3JRB A;  1HDP A;  3BR5 A;  5M5W J;  1SFO J;  4C3I J;  4RDU A;  1JUM A;  2FQ4 A;  9ANT A;  1NK3 P;  1R9T J;  4D5C A;  4DZJ A;  3FK6 A;  2HI3 A;  2G0E A;  2Y2Z A;  2Y31 A;  1ZTR A;  3BR1 A;  1FEX A;  5J1R A;  5F04 A;  1OCP A;  3SJM A;  3JRH A;  5IP9 J;  5K7H A;  4XRS A;  1JT0 A;  4AC0 A;  1OJL A;  1PUF B;  1JTY A;  3OOU A;  5EG0 B;  2M0C A;  3WHC A;  1UHS A;  3Q0W A;  2AO9 A;  1QRY A;  2HXI A;  3IH3 A;  3G1M A;  3BTI A;  1JJ6 C;  2IBD A;  4UUT A;  3GTJ J;  1YRN B;  2MW8 A;  3D1N I;  3BT9 A;  2DA6 A;  3A01 A;  3O8G A;  3MVP A;  1FIA A;  1Y1V J;  4A69 C;  3ZQF A;  3S1Q J;  1FJL A;  5FKL A;  4XRM A;  3HOZ J;  1IRZ A;  2E2H J;  2WAQ N;  2NS8 A;  2R5Z B;  4UUS B;  1JJ8 C;  4FIS A;  4A3E J;  2R92 J;  2K9Q A;  3JRD A;  2CRG A;  5FKM A;  2DMU A;  1VI0 A;  5C4X J;  1LFB A;  4D5F A;  4DYC A;  2XPV A;  2X6O A;  2XB5 A;  2L7M P;  3LOC A;  3JRF A;  1WH7 A;  5EGO A;  2DA4 A;  4JYK A;  4CYC B;  4I76 A;  2DA5 A;  5FKO A;  4A93 J;  5F0C A;  1IV6 A;  2DA1 A;  3CQZ J;  1RKW A;  1ZKG A;  2MGQ A;  1T33 A;  3S14 J;  2HOA A;  4A3G J;  5M5X J;  4JX6 A;  3HOW J;  2GM4 A;  3FIS A;  2JMW A;  5IOY A;  3CCY A;  1WI3 A;  4XID A;  4M3G A;  4V2F A;  2YUS A;  1P7I A;  1S7E A;  4MFE A;  2R7Z J;  4S0H B;  4HNV A;  1F36 A;  5F27 A;  5EZH A;  1JKR C;  3SFI A;  2NOG A;  3ZQI A;  5E3O A;  2ID3 A;  4B3A A;  1VND A;  4ABZ A;  1GV5 A;  2L9R A;  4QTR A;  1GT0 C;  5BNG A;  3IV5 A;  1IC8 A;  5EZG A;  2B63 J;  5C44 J;  3OSF A;  1GVD A;  1MNM C;  1ETO A;  2HDD A;  3S2H J;  1VFC A;  1JT6 A;  1BL0 A;  3S1M J;  1ZQ3 P;  1WPK A;  1X2N A;  2E19 A;  3BG3 A;  1MBG A;  2OPT A;  1H89 C;  3S17 J;  2W48 A;  1ETX A;  1MH4 A;  2K9S A;  2JWT A;  1B72 B;  3BTL A;  2Y30 A;  3Q0U A;  2OF7 A;  3BQZ A;  3PM1 A;  2DMN A;  3RKQ A;  5IP6 A;  3QPS A;  3BG5 A;  2ECB A;  3HGG A;  3QQA A;  4NDL A;  3JRC A;  1A5J A;  1NK2 P;  1TWG J;  2E2J J;  1Y1W J;  2COB A;  5J3L A;  2ECC A;  2VKV A;  1A6I A;  1QPI A;  3JR9 A;  1X2M A;  2VI6 A;  4QIW N;  3RZD J;  5FKK A;  1ETV A;  1UG2 A;  2XGC A;  1RR7 A;  3DCF A;  3TP3 A;  4C3H J;  3B6A A;  4G12 A;  3W6V A;  2EQR A;  5C3E J;  5IPA A;  1EF4 A;  2FX0 A;  1DU6 A;  1I3Q J;  1P7J A;  1TWH J;  4M3E A;  3TW7 A;  4IHV A;  1O4X A;  3S15 J;  4FTH A;  1D5Y A;  4M6V A;  5GP9 A;  1LE8 B;  2O7O A;  1B8I A;  2Y9Y A;  2H1K A;  5JLW A;  1ZR4 A;  5IYD J;  5K7F A;  5FLV A;  1WH5 A;  3DEW A;  2QCO A;  1VF9 A;  1XG1 A;  3I4N J;  3GTO J;  1MSE C;  1AHD P;  2DA7 A;  2LK2 A;  2E2I J;  3BR0 A;  2CUE A;  2WB1 N;  3GTQ J;  1ETQ A;  4BBS J;  3LSG A;  4XK4 A;  2XRL A;  2Y0S N;  2R5Y A;  4J19 A;  1JKQ C;  2LY9 A;  1QVU A;  2GBY A;  3G1L A;  3JRI A;  1ENH A;  2L7F P;  4DZP A;  4FE4 A;  3Q3S A;  2YU9 J;  3S16 J;  2LVS A;  4DYQ A;  1I6H J;  1W0T A;  3GTM J;  3TW6 A;  5F08 A;  4MFD A;  5E3N A;  2QF7 A;  1BW5 A;  2XSD C;  2EZH A;  3WHB A;  3H0G J;  4XRS G;  5GPC A;  1AKH A;  4BXX J;  1Z77 A;  2EBI A;  1MBK A;  2DA2 A;  2NVY J;  2NVT J;  2HQ5 A;  2DJN A;  3A02 A;  5E3M A;  3ZQL A;  3FIW A;  4M3B A;  4B1R A;  3M3Y J;  3TED A;  3Q0V A;  2LD5 A;  2I10 A;  3GTL J;  1ORK A;  3H3V K;  4LOC A;  2XGE A;  5IYB J;  4RBO A;  2FD5 A;  3LSR A;  2O8K A;  3HOX J;  3S2D J;  1K83 J;  2ME6 A;  2XB0 X;  5EYR A;  3JRE A;  4A3D J;  2LFB A;  2HOS A;  4A3K J;  2LKX A;  2KDZ A;  4BY7 J;  1QVT A;  1BW6 A;  1OFC X;  2LLK A;  3TP0 A;  2VPR A;  5EDN A;  2CQX A;  1E3O C;  2DA3 A;  4XIC A;  3ZQH A;  2TCT A;  3LSJ A;  3A01 B;  4I6Z A;  2DMT A;  3BG9 A;  2E1O A;  3ZOB A;  3RQI A;  2D5V A;  1TWC J;  4M3F A;  1OCT C;  1PUF A;  3GBG A;  5EG0 A;  4Y52 J;  2X9D A;  3OSG A;  2JA6 J;  2MSY A;  5F0H A;  2CUF A;  4A3M J;  2CQQ A;  2FJ1 A;  3VPR A;  1Z0X A;  1YRN A;  1HCR A;  2HOT A;  1XS9 A;  4X6A J;  4AUX A;  1TWF J;  1LFU P;  1IGN A;  2K9N A;  2DMP A;  5EGO B;  2LP0 A;  2LTP A;  1ZGW A;  1JKP C;  3HOU J;  2AHQ A;  1AU7 A;  5M3M J;  1HF0 A;  1CQT A;  4MLO A;  2MG4 A;  1AKH B;  5FJ8 J;  1APL C;  2DTZ A;  2R5Z A;  4UUS A;  3SDG A;  2LR8 A;  2JK3 A;  3F0C A;  3IH2 A;  2EZL A;  5FKN A;  3ZQC A;  4A3F J;  3HGY A;  4C3J J;  4A3J J;  1GDT A;  3HDD A;  4CYC A;  1TC3 C;  4JX4 A;  2HXO A;  2M2E A;  1FIP A;  1MBE A;  4BKX A;  5M5Y J;  1MH3 A;  1MSF C;  1JTX A;  2TRT A;  1IJW C;  3HOY J;  3C2B A;  3HM5 A;  4L5E A;  2ME0 A;  4FCY A;  1ZR2 A;  5DS9 A;  1F43 A;  3S1N J;  4BY1 J;  1GV2 A;  5EEA A;  2JA8 J;  4A3B J;  1ETK A;  4DYR A;  2JA7 J;  3MN2 A;  1GUU A;  2EZI A;  2ZB9 A;  3LSP A;  1ETW A;  2L7Z A;  1TWA J;  2K40 A;  1H8A C;  1POG A;  1ITY A;  5JLX A;  3MKL A;  3BR6 A;  4JP0 A;  3NAU A;  3RZO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...