2E2HJ

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2e2hJ00
2GBYA 2W48A 1MNMC 1JKPC 5M3MJ 3A01A 3H0GJ 3O8HA 3GBGA 1MSEC 4A3LJ 3HOXJ 2JK3A 3S1NJ 4XICA 5K7HA 2X9DA 4IHVA 4D5FA 2I10A 2CQXA 3CDLA 1VFCA 5E3LA 1IRZA 4B1RA 1WH5A 4BY7J 3S15J 3WHCA 1TWCJ 3S2DJ 3RQIA 2XGEA 4M3EA 2L7FP 5FLMJ 2NVXJ 1WGXA 5FKOA 3LSJA 2YUSA 5J1YA 2KT0A 3ZQHA 4XIDA 4FCYA 2VI6A 4LOCA 5EGOA 2XPUA 1UMQA 1HDPA 5M5YJ 1QVUA 1RESA 3A03A 3BQZA 1MBGA 1MBEA 3HOVJ 1IDYA 1P7JA 5FKMA 1CQTA 1UHSA 4XRSA 2ID6A 3BTCA 3G1MA 2GM4A 3FIWA 1JKOC 4EEFG 2WB1N 4XK4A 3DEWA 1IDZA 2EQRA 3IH2A 3BTLA 3OOUA 1ZTRA 5FKNA 1X2MA 3UKGA 4M6VA 4IEJA 3FISA 4D7MA 3RZDJ 1SANA 3K7AJ 3GTQJ 5F0FA 4C3IJ 2X6OA 4GFBA 4CYCA 1ZGWA 4BBSJ 3S1QJ 1RKWA 1SFOJ 4A93J 2CUFA 2HDDA 1FIAA 1I6HJ 1XG1A 2DMUA 4A3MJ 1ETOA 2LK2A 2LLKA 3G1LA 2JA5J 5IYBJ 2DA6A 2N8GA 5IYDJ 3Q3SA 1U9NA 5F27A 4A3IJ 1MBJA 1ORKA 1QRYA 4A3CJ 4HNVA 3JRDA 1DU0A 4AUXA 5DS9A 1OJLA 4FE7A 2ZB9A 5IP9J 3BT9A 3JRIA 3MVPA 3E7LA 2LVSA 1A6IA 5K7FA 3JRCA 2ECBA 3FK6A 1FIPA 3GTKJ 3ZQIA 3LNQA 1T56A 4ABZA 2R92J 1E3OC 5JLXA 2K40A 3BTIA 5C44J 3MN2A 1B8IB 4A69C 2EZIA 1X58A 4L5EA 3K2AA 2M0CA 3PM1A 2VUMJ 5EZGA 4BBRJ 3RKQA 2EZKA 3HGGA 4Y7NJ 3JREA 4BY1J 2Y9YA 1TWAJ 2DMPA 5FJ8J 5IOYA 5EGOB 3M4OJ 1TWFJ 1JJ8C 1QPIA 3FK7A 5C4JJ 4A3EJ 3HDDA 3JRHA 1T33A 2M9HA 2WV1A 2H1KA 2VKEA 4DZPA 5DTDA 1BJZA 5GPAA 3SFIA 2NVQJ 4IHYA 3S2HJ 1WI3A 4Y52J 3LSGA 1U9OA 1JTYA 2E2JJ 2M8GX 2MW8A 3C2BA 4BKXA 2AHQA 2E2HJ 4UUSA 2LP0A 3BG3A 2KDZA 4FE4A 2R5YA 2R5ZA 2L7MP 5M5XJ 2E1OA 3DCFA 3QQAA 1HDDC 1RKTA 1MH4A 1AKHA 2HOSA 1RR7A 3ZOBA 1FEXA 5J1UA 1NTCA 1ZK8A 4A3BJ 1MBKA 4A3KJ 1MBFA 2ME0A 4MFEA 2O8KA 2JJ7A 3HEFA 1IGNA 2DA5A 4C2MJ 1WCMJ 5F04A 2CUEA 4D5CA 5IP6A 4CYCB 3GTOJ 1ETVA 4DW6A 2Y9ZA 3CCYA 1YRNA 3PO3J 4A3FJ 1ZKGA 5J1RA 3BR5A 5F0CA 1W0TA 2Y2ZA 3TW7A 3S1MJ 3L1PA 3TEDA 2XRLA 3IH3A 1AHDP 2NVTJ 2IEKA 3SDGA 1QVTA 1WH7A 3JR9A 2LR8A 1OCPA 3HB9A 2JA7J 2L9RA 3BG5A 3HOYJ 5GPCA 4UUTA 5FLVA 1IG7A 2B63J 3I4MJ 4M3BA 3HOZJ 1BA5A 1O4XA 2M2EA 4MIMA 1ZQ3P 3H3VK 2LKXA 3HKZN 2HI3A 2NVYJ 1LE8A 2H8RA 4BXXJ 1GDTA 1ITYA 1ETQA 5FKLA 3BG9A 3Q0VA 4X1EA 3S16J 1FTZA 3LSPA 1XS9A 4RDUA 2Y0SN 2XSDC 3GTLJ 3S17J 1XC5A 3HOWJ 2DTZA 1ZR2A 4I76A 2P81A 1TWHJ 4QIWN 5E3OA 1R9TJ 5E3MA 2DMNA 3ZQLA 2OF7A 2O9LA 5JLWA 3Q0UA 2JA6J 2HYJA 3BR1A 1F36A 2R7ZJ 3G1OA 2FD5A 5FKKA 2DMTA 4DZJA 3A01B 4DYRA 3BR0A 3QPSA 1HOMA 1BL0A 3JRAA 1F43A 2K9QA 4M3DA 2JA8J 4AC0A 3BQYA 5IYCJ 2LTPA 2XPWA 5F1JA 2EH3A 1K83J 2DN0A 2R0QC 1OFCX 1S7EA 2COBA 4UUSB 1H8AC 2R5YB 1JKQC 2R5ZB 2G0EA 1NK3P 3ZQGA 1Z77A 2L7ZA 1U8BA 1JT6A 1JT0A 5EG0A 1AKHB 5HODA 1Z0XA 1RPWA 2LD5A 4S0HB 4G12A 1JJ6C 2D5VA 2DA1A 2NS8A 1I3QJ 1GV5A 2XB5A 3TW6A 1YRNB 3IV5A 5F08A 5GP9A 2YU9J 1Q1VA 3JRGA 3A02A 1GUUA 1NK2P 2X48A 4FTHA 4W97A 1B72A 1FTTA 1IV6A 2FJ1A 2K9SA 3WHBA 3NAUA 1UG2A 5J3LA 2Y30A 1H88C 2RAEA 4JX5A 5E3NA 2ME6A 2E2IJ 3HGYA 2CU7A 1VI0A 3M3YJ 2JMWA 1VF9A 1LFBA 1LE8B 1JGGA 2EBIA 2R93J 2HXIA 1IJWC 2HOTA 2DA7A 2LY9A 2NOGA 2VPRA 1LFUP 4V2GA 2NS7A 3ZQFA 1ETXA 4JX4A 5EEAA 2DA2A 1HLVA 2K9NA 2VKVA 3S14J 2DJNA 1ETYA 5IP7J 1ETWA 2MG4A 2TCTA 2FQ4A 5K7ZA 1TWGJ 4B4CA 1VNDA 1ZR4A 4I6ZA 1B8IA 2OPTA 5EZHA 2WAQN 3VPRA 4A3DJ 1DU6A 1JUMA 3FKIJ 1PUFA 3B6AA 3BR3A 2ECCA 2XGDA 4B3AA 1MSFC 1AU7A 3OSFA 1FJLA 3F0CA 3GTGJ 1JTXA 2HXOA 5C3EJ 3CQZJ 3TP0A 2Y31A 4JYKA 2E19A 3Q0WA 4QTRA 2HQ5A 4QSHA 1GV2A 4DYQA 1IC8A 1GVDA 4IHWA 2PMZN 1OCTC 2HOAA 3LSRA 2DA3A 3IH4A 3O8GA 3OIOA 5IOZA 3LOCA 2QCOA 3MKLA 5EG0B 4XRMA 2ELKA 2O7OA 1GT0C 5EYRA 1I50J 2DMQA 2JN6A 1EF4A 2DA4A 2XGCA 2YS9A 3GTPJ 9ANTA 3HM5A 4M3FA 1POGA 4JX6A 1H89C 3D1NI 4JP0A 4MFDA 2MSYA 1HF0A 2M34A 4D7NA 3ZQCA 2GLOA 3QPLA 3RZOJ 1ETKA 2JWTA 5M3FJ 2IBDA 1APLC 2EZHA 2EZLA 4V2FA 3BTJA 1B72B 1G2HA 4NDLA 1IUFA 3I4NJ 4MLOA 3BR6A 3CMYA 1RETA 4A3JJ 3SJMA 1JUSA 4MO7A 4J19A 2LFBA 3B6CA 5M5WJ 2XPVA 2CJJA 2CQQA 4FISA 2FX0A 1ENHA 2CRGA 3JRBA 4AYBN 4W1UA 2XB0X 3S1RJ 3PO2J 3TP3A 1JUPA 3BR2A 2MGQA 1HCRA 4M3GA 3JRFA 1JKRC 5IPAA 4A3GJ 5F0HA 1Y1VJ 2AO9A 4RBOA 2TRTA 2QF7A 1WPKA 5EDNA 2ID3A 3GTMJ 4C3JJ 1K61A 5C4XJ 1MH3A 1BW6A 1MBHA 1W0UA 1P7IA 1PUFB 4XRSG 3OSGA 4C3HJ 3W6VA 3HOUJ 3GTJJ 2L0KA 5EF6A 4IHXA 1A5JA 3HBLA 1U78A 4X6AJ 4DYCA 1X2NA 2IAIA 1D5YA 5BNGA 3NARA 1TC3C 1BW5A 1Y1WJ
chains in the Genus database with same CATH superfamily
2O0YA 5M3MJ 3H0GJ 4UB8C 1WJBA 1MSEC 2EPFA 4KJZA 2IS6A 1J9IA 1HKTA 5FO5A 1JGSA 1DP7P 3K4BA 2UWMA 4CDGA 2GQQA 2I5UA 5K7HA 4IXAA 2F6CA 1HBXG 4IF4A 2I10A 4XLFA 2FMLA 1IXRC 3E5XA 3VYSB 2HTSA 3S15J 2NNYA 2ZO4A 2HVSA 3RQIA 4C30A 2VKHA 2XGEA 5CQEA 5B66C 2L7FP 2OA4A 2ETHA 2IGMA 5FKOA 5ILUA 1FOWA 3H5AA 2XV4S 3LSJA 3MAJA 1V5FA 1EA3A 1CF7A 3FM5A 2W1OA 5H6QA 1YLFA 3KEOA 3ZQHA 4FCYA 2L5QA 2A68F 2M7AA 4UY8I 5K5RA 3TGNA 1QVUA 1RESA 3RDIA 3KFWX 2IXSA 5E1ZB 4DIQA 3HOVJ 4UV9A 1R6RA 4NC8A 5FKMA 1R00A 2XAQA 4L0ZB 2XRNA 3BTCA 2GXBA 3TOBA 4N0BA 1NG6A 3HHGA 4BXUA 3CJRB 2VE8A 2ZBKA 5H20A 4G7ZF 1T98A 4XLNF 2HKOA 2L02A 1FP1D 1X2MA 2Q2EA 1PP8F 1RC9A 2KFDA 3F6VA 2O6GE 3DF8A 5EEGA 5F0FA 2L54A 3BLYA 2M45A 1KYWA 2VBXA 3P5JA 4C3IJ 4GFBA 4E7KA 1U5TB 1OR7C 4KUMA 4NHJA 1MIJA 1IRFA 3G2BA 2HU9A 3J81Z 1FIAA 1I6HJ 2XF7A 4A3MJ 1TL8A 4RB2C 4C2UA 3A1YA 2LLKA 2ZSHB 3OYAA 1KA8A 4WXDA 2A6HF 4BS9A 3S3NA 1QNTA 2DA6A 2EWNA 1ZGAA 3ABUA 1U9NA 4UVAA 1FBQA 5F27A 4ANJA 3WTUC 5ERIA 4A3CJ 1YW8A 1BOBA 1Z05A 4AUXA 2ESHA 3JW4A 4A6DA 3OR2C 1FYLA 1W36D 1X3WB 3RI4A 2RQQA 3L00A 3R61A 3J80Z 3ERED 3JRCA 3FK6A 1Y0NA 3SEQA 2XGXA 5HLGA 2IGNA 3J7ZI 4OWRB 3L2WA 3LNQA 2K40A 2W85A 3MN2A 3U2RA 3IAM2 2OCEA 2EZIA 2K27A 1X58A 4L5EA 3OYDA 2M0CA 2VC0A 2NS0A 5EZGA 5KK1A 5CVRA 2DJIA 4BBRJ 2F5DA 3CLOA 2JTVA 5FROA 4BY1J 1KU2A 5FJ8J 2DMPA 1R1VA 5IOYA 1IRXA 2ZJQF 2WB1A 1B59A 2HOEA 2HDWA 4BDZA 3HDDA 3RYRA 1G4DA 3JRHA 2H1KA 2VKEA 3OYHA 4DZPA 5DM7F 3L9FA 2FEZA 2V9KA 1YOVB 3CUQC 5GPAA 4IHYA 2VBYA 1OYIA 4MNUA 1LJ9A 2WA0A 1WI3A 1G8XA 3CF5F 5FLXK 3C2BA 2JRTA 4RB3C 2UXXA 4FE4A 2R5ZA 3GUDA 1BIBA 2G7UA 2VB6A 2VE9A 3W3CA 2L7MP 3G6EI 5M5XJ 1PJRA 1SVMA 1FMWA 4HF1A 1FBUA 3ISPA 4IO9F 3OYEA 2Z33A 1FEXA 4EJVA 2JSCA 2CWEA 3WGHA 1ZK8A 4ESBA 3CJTB 2O8KA 2DOAA 4KMUX 3ZMSA 2CG4A 3CCUI 1W4MA 3PUBA 3W6JB 2DA5A 5F6FA 2CUEA 4D5CA 3TO6A 4DW6A 1IRGA 2Y9ZA 1PP7U 5DDGA 4N4NB 1YRNA 3D5SC 3ZMUA 4A3FJ 5J1RA 3DU6A 3H3ZA 4Y17A 5JHUA 2HS5A 4D9JA 2EIMH 4N9IA 3L1PA 2IS1A 2NRAC 4CCMA 3CCMI 5BQTA 4BDYA 2L9VA 5J8FA 3HOYJ 5GPCA 5BMZA 2B63J 3K1NA 2XASA 5HLTA 1ZLJA 3CF2A 1O4XA 2HQNA 2M2EA 4RAYA 3L2UA 4BHPA 3H3VK 2LKXA 4PFPA 3CCJI 4UNOA 2NVYJ 3R4KA 3I54A 4A12A 1S7OA 1ITYA 1ETQA 1X1CA 5TGTA 1H0MA 3BG9A 4PK4A 3H92A 2R7XA 2DBBA 4X1EA 4MQ9F 1B4AA 2OBPA 3V8LA 3HOWJ 2DTZA 4MEXF 1ZR2A 2VJIA 3FBNB 1GHCA 2K4JA 4F55A 1QQIA 4E7HA 2LKPA 1LQ1A 1ZN2A 2D2WA 2R7ZJ 3G1OA 1YIOA 2CFOA 3LFKA 1TQMA 2DMTA 4G7HF 4DZJA 4HNTA 3BR0A 2V1DA 3EQLF 3QPSA 1BL0A 3U21A 2EFPA 2K9QA 5ED4A 2HGCA 3DV8A 2F4IA 4M3DA 3ZRGA 1GXPA 1G6NA 4AC0A 3RQ4A 2X6WA 1PYVA 5E8IA 2LTPA 3H5RA 4HSTA 2EH3A 4XKVA 1K83J 3ELKA 1A04A 4YELA 3WODF 2DN0A 4ZYGA 3HIFA 2COBA 2L01A 4IHTA 1Z77A 2L7ZA 3KZYA 1JT6A 1U8BA 5EG0A 1H9TA 3ZP5A 1I39A 2E1CA 2JVHA 3PNTA 1W5SA 5D4RA 1G59A 3LSHA 2G9WA 2V7FA 1W7PA 2VQGA 3BC8A 3H9GA 3OYMA 2D5VA 2DA1A 3H35A 4LD5A 1S7AA 3OYBA 1VQ4I 3IV5A 1U2WA 4XLPF 3L2QA 3T8RA 2YU9J 2ZFUA 3O2PE 3A02A 1FNNA 1AOYA 4GXOA 3H0DA 2PEXA 2Y69H 2A5YB 1BBYA 1R58A 4XOTA 3TBIA 4W97A 2JUGA 3IP4B 2ELJA 5JI6A 3FWEA 3NAUA 4OIQF 4MTEA 3WGGA 2CMPA 2VODA 3S8PA 2VN2A 1H88C 5TJJA 4EGYA 2VOPA 3LSKA 4RAZA 5E3NA 2V26A 3I9V2 4G7OF 4RLQA 1IZ1A 1KU3A 1WFXA 2W57A 1BI3A 4M73A 1LDDA 1JGGA 1ON1A 3COAC 3C2GA 4UHTA 2BYVE 2VPRA 1LFUP 4V2GA 1O3TA 3ZQFA 1K4TA 4JX4A 1TQIA 2DA2A 4OIPF 2X1DA 1LEBA 2H1LA 2Z5UA 2VJJA 1ETYA 3V8KA 3PJRA 5KAFC 4CYDA 1DPUA 2KZGA 1B8IA 1R36A 4BAYA 2OPTA 3ZPLA 1XGSA 3ESWB 4F92B 3GWZA 3RKWA 1PUFA 2E60A 3B6AA 2LSOA 3BR3A 4F7ZA 4E6KG 4XOPA 1B6AA 4WX9A 3W2AA 2L3DA 1FJLA 2DQLA 3G71I 1JTXA 1UELB 2OQGA 3K4NA 4ENJA 2IRFG 4NNJA 2DQRA 5FFXA 1S3JA 5FD6A 2PMHA 5D6FA 1X1DA 4NBQA 2JRMA 5BS6A 1EV7A 1GVDA 3FF5A 4HBLA 1IC8A 4HRIA 3GZNB 3EETA 2E34A 3ECHA 3IH4A 2W7NA 2LMDA 4WCGA 3SYTA 5IOZA 3MKLA 3VWBA 4X0GA 2ELKA 2VT3A 4IRGA 3ZMTA 3RIRA 2CV1A 3R60A 3MCZA 1VQPI 2PQ8A 3F8NA 1KONA 5ICCA 4IZZA 2BZTA 2Z16A 2GWRA 2ZSIB 1POGA 1H89C 1VQ5I 3J7YJ 1HSTA 4JP0A 4LFUA 3MQ0A 4BH9A 2OJED 1LDJA 2M34A 1SVLA 3H3UA 2GLOA 4XRFA 3ZXSA 5D8LB 2PJPA 2E7WA 5LFAA 1UHMA 3KZIC 1S6LA 4V2FA 5ILSA 5LBQA 3FXMA 4I98B 2OV7A 5DUIA 2BEOA 1RZ4A 2E1MB 4MEYF 3AKZA 1G2HA 4WF2A 1IUFA 1X1PA 4MLOA 1K6OA 1YJNI 1SEUA 5HDNA 4L0YB 1LVAA 1ZHFA 4HAMA 3K4KA 3QU6A 4P55A 4II3A 1USSA 2LFBA 3HOTA 1U3EM 5IT9Z 5M5WJ 3DWLE 4GYGA 2E5NA 1SVOA 5LGUA 2CJJA 1OCZH 4DBRA 4ZYAA 1Z1DA 3BPXA 4N9HA 4CXFA 2E1NA 3KZZA 4MHGA 5L3CA 3E6BA 2XB0X 2JUCA 3GZ6A 2R7VA 3PO2J 1JUPA 2VXZA 2Z3YA 3GMEA 1D1CA 3JRFA 3E3VA 2BVLA 2RQPA 3WTXC 2AO9A 4A5NA 1Z67A 1BR1A 4N4OB 2X1CA 1U5TA 2FF4A 1O7LA 3IWFA 1WPKA 1XSXA 5EDNA 4H0EA 3GTMJ 1X3UA 3DTEA 4C3JJ 1N78A 2ZJPF 1XB4A 5DCFA 5HDKA 2VONA 4M74A 3Q9VA 3DKXA 1P7IA 2R7RA 2DK8A 4L9JA 4KT6A 4C3HJ 1UHWA 5CQGA 1HQCA 5EF6A 1I1SA 4KFCA 4ZTFA 4DYCA 1X2NA 3AG4H 2G7HA 1KQ9A 4GRIA 2VXDA 5CYVA 5BNGA 1J75A 1TC3C 5AIQA 1QGPA 2KIFA 2W48A 2XF6A 1IW7F 3BP8A 2HWVA 2FE3A 5FRMA 1QA6A 4LK0F 3GBGA 3J80K 4RMNA 2CGPA 1XN7A 2M4KA 3HOXJ 4KYWA 4LIUA 3LSTA 4CCOA 2WBMA 1MMNA 3KP5A 4D5FA 2X1EA 3FXLA 3JTHA 2CQXA 3BJOA 4CCLA 5GAHJ 4WXHA 3PNVA 4JQFA 1BR2A 4IRHA 1IRZA 4GCVA 2ZCWA 3L2RA 1TT5B 2CQKA 4BY7J 3M8JA 3L7WA 1TWCJ 3S2DJ 2ZNYA 4XBFA 3AL0B 4M3EA 1R5HA 5FLMJ 4U7DA 2QM3A 1K4SA 2DLLA 3DQVC 2V6EA 2IA0A 2RC4A 1YG2A 1FYMA 3E0JB 5J1YA 4HLYA 3NWSA 2VASA 4DOZA 1VQOI 2QBYB 1FOYA 2R7DA 3SQNA 2LDUA 3NWTA 1YX5A 3MFKA 1ZRDA 5M5YJ 4RGXA 4PSWA 2QENA 3BQZA 2VOOA 1KQ8A 2ZXIA 4DNCA 3GLLA 4P9FA 4A0YA 1C0WA 1CQTA 3D0SA 3GZ5A 5IY5H 1MW7A 4HSRA 3DKWA 4XK4A 4HX7A 2CW0F 3OYIA 4PFOA 3IH2A 2QKMB 3BTLA 3GFMA 3OOUA 1Y56A 1ZTRA 4OMZA 3ERMA 2O8XA 3UKGA 4M6VA 1DGWY 2L2OA 3RZDJ 1KU7A 2AXTC 3K7AJ 1BN5A 2O03A 3CUOA 2B9SA 3LA2A 4OIRF 3PNYA 4BE2A 2H94A 4BL0B 2X6OA 3KPHA 1ZGWA 4BBSJ 3LQQA 1SFOJ 2CUFA 2JPBA 4M6YA 2L4MA 5A2QZ 2KDOA 1ETOA 1OLTA 2LK2A 2JA5J 5IYBJ 1KU9A 5D6EA 5E1XA 3HTUA 2CSOA 2OZUA 4BXFA 2XF5A 2X0LA 2IT0A 2P6SA 1IN4A 5FGMA 4RAGA 3SZTA 3OMYA 3JAMZ 2AQEA 4EVIA 1K7AA 4PUSA 1O3QA 3JRDA 2LYCA 1VQMI 5DS9A 5DCMA 1D0XA 3RSNA 1D0YA 4LLGF 3MKWB 2OZ6A 3JCUC 4BUPA 2WAQA 1OCRH 4Y3OA 2KRFA 3ABLH 2ZFWA 2RVCA 1A6IA 2WY7Q 1IXSB 3FHNA 3TO7A 5K7FA 2VJ4A 2K85A 3GTKJ 4YG2F 2L4AA 3E97A 5CLSA 4ABZA 4E7LA 1L3LA 5JLXA 5C44J 2V1NA 1B8IB 1QHHD 5ICGA 3ABKH 3ASNH 3R0JA 2BY2A 3K2AA 3LQRA 2PMZA 1OCCH 3RKQA 1I3AA 3GFLA 4A5MA 4YIRX 2DK5A 1BI1A 1SD6A 4A0XA 2WWYA 5EGOB 4ZYDA 1SD4A 2UV1A 4A2UA 4R79A 4PJJA 5C4JJ 2E5ZA 2V9PA 3ECOA 5D5XB 2ZC2A 3QAHA 3E6CC 2M9HA 2ZMEB 3CP2A 1XGOA 1BJZA 3SFIA 3WU0A 2NVQJ 1TW2A 1E2XA 3S32A 4HX8A 4G94A 4LIVA 3BROA 4Q48A 3LSGA 2D45A 2HPMA 1U9OA 3CMAI 2M8GX 3BZKA 5TISC 3RKYA 2W24A 3BG3A 2LKSA 2KIQA 1DUXC 3I59B 5LRSA 4FT8A 1O7FA 3DCFA 3QQAA 1A6QA 3UR3C 1MH4A 2KPMA 3OS1A 3ZOBA 2HOSA 1NTCA 1U5TC 4KISA 3K6GA 1MBKA 4A3KJ 2M4GA 4MFEA 1LUJB 4I99C 3HEFA 4M9ZA 4CYCB 4C2MJ 1WCMJ 3K4MA 2CH0A 3GW2A 1XSVA 3CCYA 4RA2A 3PO3J 1KYZA 1ZKGA 4XSZF 3ABTA 2A05A 3BR5A 4ESJA 3M7GA 2WAEA 3CCLI 4AYBA 4CA0A 3CCRI 2KHMA 3TW7A 3S1MJ 2UUZA 1D1AA 1ZGJA 5FRNA 3T8TA 1Y39A 2ADUA 4XLCA 1WH7A 2K5CA 3JR9A 2JVGA 2XAUA 2MC3A 1OCPA 2L9RA 4UUTA 5FLVA 1IG7A 3I4MJ 4B3XA 2F48A 1R49A 1OYYA 1I5ZA 1BA5A 2LY2A 1D3YA 1ZQ3P 4YRVA 1MNEA 3KCCA 3GFJA 3M8EA 4S05A 1BM9A 2HI3A 3WE2A 1YJWI 1K6YA 1J2XA 4BXXJ 3AAFA 2EINH 5L3DA 1K78A 3ZQ7A 1SAUA 3Q0VA 4NUBA 2ICWG 1XS9A 4XSXF 1FOXA 2XSDC 4EGZA 3CMMA 1XC5A 1U8RA 3GTLJ 1R9TJ 1TWHJ 5E3OA 4CO8A 5JLWA 2F5CA 2R7UA 3Q0UA 2JA6J 4XORA 4KA4A 3BR1A 4BACA 3GEZA 4XMYA 3WGIA 3LA7A 3F8FA 4HNUA 2CFXA 1E3HA 5FKKA 3DXJF 1OCOH 3HRTA 2BW3B 2LF7A 3EPZA 2DFIA 2KISA 2Z99A 1HOMA 1ZH5A 3JRAA 1FBSA 3PFIA 4B47A 1XPXA 1R4NB 2W4SA 2AQFA 2XAGA 1T6SA 4IOCF 1VQKI 2EFQA 3KP7A 5DEQA 2BVMA 2X6XA 2QGUA 5EEHA 1HKQA 4IL6C 4UUSB 1H8AC 2R5YB 2YPRA 2CUJA 5H2FC 1JT0A 1BIAA 2LBFA 4AD9A 5TRDA 3RPUA 1V5GA 1AKHB 1S72I 3NRVA 5HODA 4HF0A 3V4GA 3OYNA 2QWWA 1I1GA 3RYPA 4FASD 2VQLA 2XC7A 1IO2A 1FP2A 2J5PA 3K9TA 4WK8F 1JJ6C 1VQNI 2BY1A 4UVCA 4CHUA 2DT5A 2RN7A 2XKPA 3WTZA 1G3SA 3HRUA 5F08A 2XVCA 5GP9A 3SEZA 5LRRA 4MTDA 4HLXA 3OOPA 2PI0A 4HYEA 1IN5A 3PFYA 2PMUA 1Q1VA 4DQ2A 4KMFA 4U0WA 4E4HA 3CTAA 1K79A 1NK2P 5GTIC 2X48A 5DV5A 4FTHA 5IT9K 2XDVA 3WHBA 2MH2A 4HQEA 1REPC 4F52A 4OAYA 2FQ3A 2Y30A 4U7BA 3G4SI 2RAEA 2DI3A 3OS2A 2ME6A 3QRFF 3HGYA 3M1CA 5ICFA 1SFEA 2QQ9A 2Y0SA 4M9XA 4WWCA 3M3YJ 2OD5A 2OC6A 3IWZA 2V9VA 3LSIA 1R5GA 2AS5F 2HXIA 4CH7A 3EUHC 1IJWC 2MABA 3E6DA 2VL8A 2HOTA 2RDPA 2XAJA 2NOGA 1P4AA 4EMSA 4FQGA 4U88A 3F21A 2P4WA 4GYIA 2CQNA 1HLVA 2Q1ZB 2VKVA 3QU3A 2DPUA 3G73A 3CDHA 3ABMH 3RPQA 2FBKA 5IP7J 1ETWA 2MG4A 3UNGC 1ZAOA 1TLHB 1TWGJ 1VNDA 2P5KA 4XR6A 2WAQN 5EZHA 3VPRA 5HNHA 4J01A 5J47A 3VYRB 2I8DA 4YEJA 2HVQA 4XLHA 5F64A 1HXDA 1Z21A 1MSFC 4L18B 3KLOA 4XKWA 1WSUA 3VFZA 3ZMDA 5DCMB 3AG1H 3T1BA 2HXOA 3BJ6A 2VT2A 4RGRA 3M9AA 5C3EJ 1YQAA 1A31A 2Y31A 1QZZA 1BR4A 3I0TA 1EH8A 1UZCA 1UAAA 1GV2A 4A6EA 4DYQA 1HW5A 2VBWA 4UUVA 1J09A 2PMZN 1QHGA 1OCTC 4Q5SF 4IQ4A 2DA3A 2BOLA 3O8GA 3OIOA 3ROUA 4B09A 2VBZA 4XQFA 2R7WA 3LOCA 1E17A 2BV6A 4BEHB 2ZNZA 2EA2A 2H6BA 1D0ZA 5EYRA 1I50J 4JBAA 3K70D 2DMQA 2JN6A 2PN6A 2WC2A 2JPCA 4YFKF 2XGCA 3P9KA 4EQQA 3VSLA 3GTPJ 1VQ8I 9ANTA 4M3FA 3GF2A 4ZDPA 1HKSA 4AIHA 1HF0A 4KIFA 3ZQCA 1LKXA 3QOPA 1ETKA 3RZOJ 3CCSI 2HYFA 3BG6A 2QBYA 2IS4A 2E71A 3CESA 1APLC 2EZHA 4ON0A 3ZN0A 2XAFA 2M1BA 4LMYA 3BTJA 1YO5C 1B72B 3I4NJ 4B43A 3BR6A 4ZC3A 2KIMA 2LREA 4A3JJ 1ULYA 1JUSA 3WE3A 2DDAA 3OWTA 2LY1A 4RAFA 4J19A 3ZN1A 3X2QH 3OYFA 4UB6C 2XPVA 3DPUA 5KHDA 1ZLKA 1JI8A 3MEXA 4G9YA 1ENHA 1L0OC 1YFHA 4ZZDA 4D1QA 2BY3A 4AYBN 3OR1C 1E0EA 2EA4A 2YX7A 2MGQA 5J4VA 1JHFA 1R7JA 5KVRA 1Z9CA 2BGCA 4EM2A 4A3GJ 1MJAA 4RBOA 2QF7A 3VYTB 2ID3A 1EKEA 1YE9A 3TO9A 4PJMA 4IHSA 1MH3A 4NQWA 1ODDA 1J0RA 2GIVA 4RGUA 2FSWA 3CC7I 2L0KA 4I09A 1R71A 1TZLA 1AA7A 1U78A 1Z7LA 3QWLA 2STWA 2FMYA 2IAIA 2GBYA 4MGRA 1MNMC 3PSIA 1UCRA 2KQRA 1MJBA 1LNWA 4M71A 3HOSA 3EYIA 5LHIA 2JK3A 3BZ6A 5J40A 3DTIA 4XICA 2A61A 2X9DA 4CSWA 4IHVA 2NNNA 1K78B 3HG9A 2GA2A 5CPRB 3DLAA 1QU3A 1WJDA 3CDLA 5E3LA 2FUG2 3HXLA 4BNCA 4E7ZA 3ASOH 1DP3A 4PSXA 2WADA 3OYJA 2HVRA 3BWGA 3DBLB 4Q4ZF 2GIZA 2HR3A 3P9CA 1WGXA 3BCAA 3PQKA 3E5UA 3DKYA 1IN8A 1X3ZB 3RCOA 1WI9A 3FMQA 2QQAA 2PJRB 3F8MA 2KRHA 2YUSA 3GO5A 1HW2A 4XIDA 3IKVA 2E1MC 4LOCA 1UJ8A 5EGOA 4TV7A 2DTRA 1HDPA 4ZYHA 1N25A 3A03A 4CZCA 1VTNC 1MBGA 1ACIA 1FY7A 2WAFA 2YSRA 3CZ6A 2B7EA 2IW5A 2ZMEA 3RKXA 1IDYA 1P7JA 2EV5A 3C18A 4I7HA 3V7RA 3P7NA 4XRSA 2ID6A 5CVUA 5IT3A 2Z1DA 2LBFB 3FIWA 1JKOC 4R8HA 3CCVI 2FRHA 2L7KA 1F9NA 1YW7A 3F6OA 2WB1N 1IDZA 3DEWA 4O5VA 2EQRA 1XCVA 4IVNA 3FMRA 3I59A 2O5RA 4CCNA 3JSPA 3WG7H 5FKNA 1XSDA 4IEJA 3FISA 2GXAA 1O3RA 3BZCA 4EM0B 1Y6IA 3K10A 3GFIA 5JR3A 3LFUA 4BQAA 1MMAA 2XAHA 3WU2C 4CYCA 3OIQA 4C9YA 4OMYA 3S1QJ 3FMSA 1RKWA 2FA5A 4GDFA 5DYMA 4ZDLA 4F91B 1XG1A 4HPQA 2H27A 1Q1HA 4XONA 1P92A 3F72A 5E20A 4KNYA 2N8GA 4AU7A 4I0BA 3V8JA 3Q3SA 3AG2H 1USTA 4A3IJ 3A2KA 1MBJA 2YX4A 3QPHA 3BY6A 1W5TA 1ORKA 1QRYA 1XMAA 2UXNA 3HRSA 1DPRA 1ZARA 4ZDOA 1YTYA 4Y4RA 4FE7A 2W00A 2QYOA 3L2VA 4HA8A 3PQJA 3JRIA 5H6RA 4I01A 3MVPA 1ERDA 1LVKA 2LVSA 1MGTA 3VSKA 5HS9A 2BXYA 3SXYA 3J81K 1SFUA 3AL0C 2HFHA 4D0PA 3IL2A 3ZQIA 2R92J 5L3BA 1E3OC 3BG7A 3BTIA 1NH3A 4BE0A 4A69C 2MFZA 5FLXZ 1Z6TA 4U87A 2R7FA 3PM1A 3DU5A 1WHUA 2V79A 2Y48A 3HGGA 2GOMA 3JREA 4ETSA 5JFRA 2Y9YA 1TWAJ 3I56I 1X1AA 1JJ8C 3CJQB 1W36C 1QPIA 3FK7A 2BW3A 4E7IA 3S93A 3KYDB 3CCQI 5D8KB 1T33A 2WV1A 2LH9A 2GZWA 2LOOA 3LWFA 4XLEA 2FBHA 5KCMA 3S2HJ 3HJEA 4Y52J 2ELHA 1FX7A 4R1HA 3W2WA 2E2JJ 1YX3A 2VC1A 2K7LA 4BKXA 2E2HJ 4UUSA 2LP0A 2KDZA 5AIPA 2R5YA 1RRJA 1MD0A 1Z3YA 4UV8A 1HDDC 1W5CC 1YIJI 4EJOA 3KLNA 4U0VA 1AKHA 1RR7A 4LG3A 2Z9OA 1PDNC 4A3BJ 1MBFA 2JJ7A 2OTJI 4Q47A 5F04A 3GTOJ 3SZGA 5CJ9A 3I55I 4HDVA 3JTGA 1T8IA 1YITI 2MBFA 3NEUA 4ZH4F 5GTHC 3TKYA 2K3PA 1R5ID 1XDSA 3K1PA 1QO0D 3J7AY 3V7SA 2MC4A 3DLLF 2XRLA 3IH3A 1AHDP 2WY8Q 3FXJA 3W6KB 2IEKA 1D5VA 1IN7A 3QP5A 3F3XA 2ISYA 2F4OB 4UXNA 3BG5A 3D5RC 1G3WA 1SAXA 3HOZJ 3E5QA 4MIMA 5CVIA 3VEPA 4EJTA 3A0HC 1FYKA 2MA3A 5D5VB 3OL4A 1GDTA 1YYVA 3KYCB 2QLZA 3F8CA 3S16J 4DBQA 2K02A 3ZR8X 2L9SA 4NQWB 4RDUA 1S9HA 4AIKA 3S17J 2RREA 2K9LA 2PFBA 1OISA 3CP8A 3ZQLA 2O9LA 2R7SA 4ENNA 1OYWA 3DPTA 1QZYA 2HYJA 1WWXA 3LA3A 4L5IA 4LLLA 1STZA 2FD5A 2ZMEC 1TNSA 4DYRA 3MZYA 2ZJ2A 1P4WA 3HZJA 2OU2A 1F43A 1KQ0A 2A6TA 2OTLI 3U9GA 3CCEI 2IJLA 3OIPA 1Y8QB 1JXSA 1X1BA 3T5XA 1YI2I 2R0QC 1N75A 2DCEA 1OFCX 1JKQC 4OU0A 4ZZLA 2G0EA 1NK3P 3ZQGA 3IRRA 4BEHA 2LC2A 1T95A 5F1RA 4RM3A 2YR2A 2O61A 5LEKA 2ZKZA 4S0HB 1WRJA 4EV0A 2NS8A 4KT5C 1I3QJ 1ZYRF 2QEXI 2XB5A 3TW6A 3OYKA 1G3YA 2Q8KA 1V4RA 1MDMB 1V54H 2KMUA 3JRGA 4BJTA 3D5LA 2QSHX 5ICEA 2MD0A 1GUUA 4ZYEA 1WKMA 3HC7A 2OUMA 3KP6A 2F4MB 2KJBA 4E7JA 1B72A 4ENKA 2K9SA 1P2FA 4IQJA 4I02A 5J3LA 3TQNA 4QWQA 1ZG5A 3ONQA 4Y15A 3BPVA 1WJ5A 1S29A 5CVJA 1UB9A 1SC7A 2DYSH 3B73A 1Z91A 2D1HA 2E2IJ 2FNPA 3Q5FA 1VI0A 2VQHA 2JMWA 1RUOA 1VF9A 2CS3A 5BPDA 1T39A 1LE8B 3LAPA 1OMIA 3AG3H 3EUAA 3S2WA 1FOKA 2R93J 4F93B 1G3TA 1SD5A 3H9QA 2DA7A 4EATA 3KEQA 2K9MA 1ETXA 3GCMA 1RNLA 5EEAA 2EIKH 2K9NA 4K2EA 1R1TA 4OAZA 3TDUC 1GLNA 2R7TA 3B02A 1SFXA 4CCJA 3QODA 2FQ4A 1MMSA 3JSOA 4B4CA 1ZR4A 4I6ZA 1P6RA 1DU6A 1JUMA 3E6MA 3FKIJ 4RLFA 3HUGB 1LFPA 4KN7X 4PGGA 1KZHA 1MMGA 4CZZA 4UVBA 3OYLA 1JE8A 2V1UA 4ZJZA 2DT7B 4I0AA 1AU7A 4L9VA 3ZQQA 4IX7A 3GTGJ 1OKRA 2IPQX 5BPIA 4PJ0C 3TP0A 4RB0A 2E19A 1WJAA 2M0MA 4QTRA 2VPLA 2HQ5A 4QSHA 2ZJRF 4IHWA 1Z6RA 5DD8A 2A3SA 2DFHA 2HOAA 3NQOA 3TMOA 5JHFA 2M3AA 3CMEI 1P9QC 4RS8A 3L09A 4XNFA 2B0LA 1IAWA 3FXKA 1Y0UA 2QCOA 4XRMA 4NC7A 3G3ZA 2GAUA 5HNFA 1XMXA 3CDIA 4BJ5C 2COMA 2DFFA 2M5WA 2DYRH 2YS9A 3HM5A 2CO5A 3CC2I 4JX6A 1RIOH 3D1NI 2NVUB 4QPQA 1YW9A 4FX4A 2PJRA 4D7NA 2JWTA 3WTTC 2EZLA 5ILVA 4H4KC 3HSFA 3F22A 1XMKA 3FXRA 1IV8A 3QYEA 4HF2A 1ZRFA 3SJMA 2JQ7A 3DFGA 4BU2A 4MO7A 1FSHA 1F5TA 2E35A 2HEOA 1J5YA 3B6CA 1TT0A 1WVRA 3DP7A 3WU1B 2FNAA 3SFZA 2CQQA 1T2KA 5LHGA 2MLKA 1DDNA 2CRGA 2QKLB 3JRBA 1VQLI 3R6SA 4HV5A 4W1UA 3EDPA 3TP3A 4BJ6C 3BR2A 2HZTA 1ONVA 5GAGJ 3RJPA 1ZG3A 4LB5A 5K5QA 3EYYA 5HS7A 1Y1VJ 3KX2A 5LHHA 4LG0B 2HNHA 2M87A 4IPAA 1W7PD 4PCQA 2Q0OA 2V1XA 4G8XA 3Q9SA 3HHHA 5C4XJ 1XTAA 3HKZA 3LSMA 1BW6A 2KLOA 2XSJC 2MYSA 1TBXA 4XRSG 3N4MA 3FM3A 3QPTA 2HDCA 2HZDA 2STTA 3GTJJ 2NAZA 3QOEA 4P96A 3HBLA 4AIDA 4X6AJ 2ISZA 2FBIA 4P5OA 4M6XA 1BW5A 3NARA 5J8CA 3HYIA 1Y1WJ 4L9NA 2HPIA 2VLAA 2VIXA 1JKPC 3IRQA 1T38A 3SHFA 2FOKA 2ZXJA 3A01A 3O8HA 4BQNA 3I3LA 2BXZA 4A3LJ 4AM3A 2BE5F 3FXUA 3WTWC 4HEA2 4HOBA 3S1NJ 3VODA 2KJCA 2WTEA 1SD7A 2DODA 4S04A 1EJ9A 3U1KA 5DM6F 1VFCA 2EK5A 2XIGA 2DT6A 3LL7A 2HQRA 2P7VB 4B1RA 1SMYF 1WH5A 2VJ5A 3WHCA 3H9JA 4Y13A 2XHKA 3GYHX 2NVXJ 5E8GA 3MKYB 3GLXA 4ASNA 1HA8A 5L3EA 4DJAA 2KZVA 4M72A 1MJ9A 2KT0A 2DDBA 3U1DA 4XKBA 2VI6A 3KEYA 5D5WB 3K0LA 2J5OA 1UMQA 2XPUA 4XN0A 4IKFA 4G6TB 4YIFA 1EH6A 1O3SA 4I2OA 5EJCA 1MBEA 4BQQA 1I6XA 2IA2A 2DFEA 1SMTA 4L5JA 3ML6A 4NB5A 2RGVA 1UHSA 3C1DA 4ENMA 1YS6A 4HQMA 3G1MA 2GM4A 4IRIA 1U6GA 3CUQB 5FB2A 4EEFG 2RV8A 4HX4A 4LB6B 2GXGA 5L3GA 4OINF 2ACJA 1TQPA 4D7MA 3P9IA 1SANA 3GTQJ 5KAIC 2A6EF 3HTSB 3I4PA 2P7CB 2UZKA 3A0BC 5HDGA 3VOEA 3F9KA 1X19A 3KIOA 2NYXA 4A93J 2DOEA 4B8XA 4E70A 2HDDA 3C3WA 2DMUA 2DU9A 1A36A 3H36A 3VB2A 3HRMA 3G1LA 5LEJA 1TTYA 1ZG1A 2EFOA 3M07A 2LRDA 1PUEE 2JSPA 2LG4A 3PSFA 5IYDJ 2QQ8A 2R4GA 3TOAA 1BI0A 4EJUA 4HNVA 1YHQI 2P6TA 3LAJA 1DU0A 3K4LA 4II2A 5B5EC 1OJLA 3IC7A 2ZB9A 2F5VA 2WV0A 5IP9J 3BT9A 3H5NA 3S3OA 3J7AO 3OYGA 5GADJ 1V5EA 1XGNA 2H09A 2W25A 3E7LA 5E17F 3HPHA 1VZ0A 4PJLA 2ECBA 1FIPA 2D1VA 5A2QK 3CO7C 1LDKB 2RKHA 2EV0A 1T56A 1Y8RB 2KRCA 4CICA 2CW8A 4O6JA 2HTJA 5L3FA 5FD5A 2X6YA 2CYYA 3BCBA 4ITVA 3CO6C 2IS2A 5B1AH 5LGTA 2VUMJ 1CF7B 3JAMK 2K4BA 2EZKA 2QVOA 5B3SH 1WQ2A 4Y7NJ 4GO1A 4QPOA 3WTYC 1VQ6I 2HYGD 1GXQA 3FBIB 3ZMVA 3M4OJ 4V19K 1TWFJ 2NOJB 2QZ8A 2Y0MA 1A35A 2QUFA 4A3EJ 5JVTA 4KIGA 3TDZC 2MLGA 4KITB 1QPMA 4BGDA 2X4HA 1JHHA 5DTDA 4G6DA 4G6QA 2A69F 1FWZA 1W1WE 1TNTA 2H8WA 2JZYA 1SFKA 6PAXA 1JTYA 1XGMA 1Z3XA 2BHYA 4KICA 1DGRM 2MW8A 2NXNB 3K1MA 2AHQA 3BOQA 4P9UA 2M8EA 2QSGX 2IP2A 2P5VA 4LJZF 4O3MA 2E1OA 2ZXHA 4HZFA 1IUYA 3KP4A 3CD6I 2Q2EB 1TW3A 1RKTA 1FZPB 1D8JA 5J1UA 2KKOA 3MZ8A 3IAS2 4AWXB 1OPCA 4FHTA 1B9NA 2F5FA 4LLNA 2ME0A 5J6XA 1D8KA 3ZGKA 1IGNA 4F3QA 4QLCU 5IP6A 1T0FA 1ETVA 2YU3A 3I53A 1FMVA 2M7BA 4OOIA 3I64A 4XL9A 1HSJA 5F0CA 1MDMA 1VQ9I 2H6CA 1W0TA 2KIUA 3RTRA 4B48A 2FXAA 2Y2ZA 3L2CA 3OV8A 2X51A 4EJWA 2CQ7A 3TEDA 4CCKA 2NVTJ 3DEUA 3SDGA 1QVTA 1QBJA 2LR8A 3GVAA 3HB9A 4JOMA 2JA7J 3EUKL 1LB2A 4YFNF 2OQRA 3TL4X 3R0AA 4RGSA 4IJAA 4M3BA 3I71A 3O3KA 3WG9A 4EM1A 1DQUA 3FKJA 4OIOF 3HKZN 1BC7C 1LE8A 2MH9A 3SZPA 1D1BA 3CJNA 4KIBA 2H8RA 5LLQA 3OS0A 5GAEJ 3MKZA 1H9GA 2OAZA 5FKLA 1FSEA 4LK1F 2W82A 4PDKA 2LF8A 1T08B 1FTZA 5JVGF 3LSPA 5CKTA 4JK1X 2LNBA 1QZEA 3PL8A 1S5LC 5CVVA 2Y0SN 3T0YA 3FXOA 1RUNA 2BY0A 2DPDA 2CUZA 3K69A 2TDXA 2P81A 4I76A 2V6CA 3FDYA 4Y33A 5HLIA 4QIWN 2K86A 1XCBA 2DMNA 5E3MA 2OF7A 1MZBA 2PLYA 4KDPA 3M8FA 3HUGA 4AVPA 1V55H 5KNLA 1F36A 3FX3A 2DOFA 3ZMZA 2MD5A 3OL3A 2W84A 2Y75A 3MD2A 1I27A 3A01B 3DBRB 3WTSC 4PJNA 3PUFA 5DD4A 4ZTJA 2JA8J 1CGPA 4HG2A 1OQYA 3BQYA 5K5OA 5IYCJ 2XROA 3KYLA 4M9SA 2XPWA 1XDUA 3C7JA 5F1JA 1X4PA 4HV6A 3K4CA 3BDDA 3OY9A 2BBYA 4PZJA 1TP4A 1S7EA 1IN6A 4ESFA 3HL2A 2R5ZB 4LGWA 4E7SA 2GA1A 2IGKA 1LEAA 2JT1A 2QQBA 4FX0A 3REOA 4CUGA 2ZXWH 1B9MA 1Z0XA 1RPWA 2LD5A 1MNDA 3I58A 5E79C 2PX9A 3CLQA 4G12A 3DTKA 1P4XA 2EJRA 1GV5A 1YRNB 1FPQA 3IHUA 5LGNA 3OYCA 3QYBA 2A07F 2GOXB 2O3FA 2M30A 1MKMA 3VYUB 1KGSA 2FOWA 2F5EA 3VDXA 3PIPF 2ESNA 3K2ZA 1WJCA 1FTTA 1IV6A 2FJ1A 4HW0A 2EFWA 3GXOA 2HQAA 1S8NA 5BOXA 1UG2A 2DAOA 3QP6A 2IVMA 3BJAA 2VKDA 2FU4A 4JX5A 1YS7A 1Z7UA 2CU7A 1BOAA 2EFNA 4J00A 3DBHB 1LFBA 2C6YA 2EBIA 2P8TA 2PBIA 2LY9A 3GX4X 2DW4A 2R7QA 2NS7A 4L9TA 4YIIA 2P5LC 3H1CA 1O57A 4BHCA 3S14J 1RI7A 2DJNA 2TCTA 4FETA 4BQOA 1R22A 4LG0A 3ULQB 5FFZA 5K7ZA 4C2TA 2F2EA 1ON2A 4U0YA 2EV6A 3KP3A 3HSRA 4A3DJ 2X85A 1OR7A 1E3PA 1NG7A 2ECCA 4CGZA 1F1ZA 2XGDA 4B3AA 5LD2C 3F8BA 2KP6A 2P0WA 4DGWB 3F0CA 3OSFA 2RNGA 3MWMA 4XLAA 1IXCA 1XD7A 1R4MB 3I5UA 3CQZJ 2EILH 5E1WA 3ZCOA 3W2VA 1UFMA 4JYKA 1R23A 4GGGA 3Q0WA 1F4KA 3V42A 1N77A 2V4JC 3O6BB 5B1BH 3V7CA 3KETA 1ZRCA 1B1BA 2EIJH 1U0JA 4HDUA 1J59A 3LSRA 1BC8C 4RM2A 1GVJA 2EB7A 2XKOA 3CC4I 4XKCA 5EG0B 1BI2A 1R1UA 1V3FA 5HLHA 2O7OA 1GT0C 2R7OA 1HW1A 1T0FC 4BHBA 3F23A 1EF4A 2OCCH 1W7PB 1BJAA 2DA4A 2QA4I 2AXLA 2A5WA 4Z2YA 4A0ZA 2XUBA 5K1YA 5DUKA 3QYFA 4Z6YA 2E7XA 1IF1A 1VQ7I 3A4CA 4MFDA 2MSYA 2BHZA 2QSFX 3QPLA 4XN3A 2DO7A 2HKXA 2KL4A 1FT9A 2JA2A 1ZREA 5M3FJ 4IOAF 3KP2A 2IBDA 5D4SA 1RR8C 1WJEA 4AIJA 2RNJA 2VQCA 4NC6A 4BE1A 5J4YA 2E36A 1XX5A 4NDLA 2DXIA 3IKTA 3CMYA 4LITA 5E18F 1RETA 4MQVA 1UG0A 5HOOA 3DEEA 3S3MA 1LPQA 3SDBA 1J7KA 3N05A 3DPLC 1WZ2A 1HC8A 1X4OA 3K70C 2IA1A 4AVZA 3CUQA 1NHAA 3K4JA 4WXCA 3HPGA 4FISA 2FX0A 2IGOA 4BYYA 3MZHA 1FLIA 3M1EA 3FZVA 5HVQC 2PG4A 3HSEA 3C2HA 4KN4X 1M1EB 3S1RJ 4XM3A 4P1WA 3E1SA 1HCRA 4M3GA 4B44A 1JKRC 1YJ9I 3RPUD 5IPAA 4YFXF 2CV0A 5F0HA 3AFHA 1FC3A 1PVEA 2TRTA 2CV2A 1MMDA 3PIOF 1AWCA 1ZELA 3KE2A 3LMMA 3EUHA 3MMYB 1K61A 2L9NA 3FXQA 5HS8A 1W0UA 1MBHA 2R3SA 2CW7A 3IUOA 1PUFB 3FHZA 5D5UB 4PGHA 5AONA 3OSGA 1WJFA 2Z2SB 3WTVC 3N97A 3W6VA 3HOUJ 2K3FA 4IHXA 1EH7A 1A5JA 4RB1A 1D5YA
chains in the Genus database with same CATH topology
2GBYA 2W48A 1MNMC 1JKPC 5M3MJ 3A01A 3H0GJ 3O8HA 3GBGA 1MSEC 4A3LJ 3HOXJ 2JK3A 3S1NJ 4XICA 5K7HA 2X9DA 4IHVA 4D5FA 2I10A 2CQXA 3CDLA 1VFCA 5E3LA 1IRZA 4B1RA 1WH5A 4BY7J 3S15J 3WHCA 1TWCJ 3S2DJ 3RQIA 2XGEA 4M3EA 2L7FP 5FLMJ 2NVXJ 1WGXA 5FKOA 3LSJA 2YUSA 5J1YA 2KT0A 3ZQHA 4XIDA 4FCYA 2VI6A 4LOCA 5EGOA 2XPUA 1UMQA 1HDPA 5M5YJ 1QVUA 1RESA 3A03A 3BQZA 1MBGA 1MBEA 3HOVJ 1IDYA 1P7JA 5FKMA 1CQTA 1UHSA 4XRSA 2ID6A 3BTCA 3G1MA 2GM4A 3FIWA 1JKOC 4EEFG 2WB1N 4XK4A 3DEWA 1IDZA 2EQRA 3IH2A 3BTLA 3OOUA 1ZTRA 5FKNA 1X2MA 3UKGA 4M6VA 4IEJA 3FISA 4D7MA 3RZDJ 1SANA 3K7AJ 3GTQJ 5F0FA 4C3IJ 2X6OA 4GFBA 4CYCA 1ZGWA 4BBSJ 3S1QJ 1RKWA 1SFOJ 4A93J 2CUFA 2HDDA 1FIAA 1I6HJ 1XG1A 2DMUA 4A3MJ 1ETOA 2LK2A 2LLKA 3G1LA 2JA5J 5IYBJ 2DA6A 2N8GA 5IYDJ 3Q3SA 1U9NA 5F27A 4A3IJ 1MBJA 1ORKA 1QRYA 4A3CJ 4HNVA 3JRDA 1DU0A 4AUXA 5DS9A 1OJLA 4FE7A 2ZB9A 5IP9J 3BT9A 3JRIA 3MVPA 3E7LA 2LVSA 1A6IA 5K7FA 3JRCA 2ECBA 3FK6A 1FIPA 3GTKJ 3ZQIA 3LNQA 1T56A 4ABZA 2R92J 1E3OC 5JLXA 2K40A 3BTIA 5C44J 3MN2A 1B8IB 4A69C 2EZIA 1X58A 4L5EA 3K2AA 2M0CA 3PM1A 2VUMJ 5EZGA 4BBRJ 3RKQA 2EZKA 3HGGA 4Y7NJ 3JREA 4BY1J 2Y9YA 1TWAJ 2DMPA 5FJ8J 5IOYA 5EGOB 3M4OJ 1TWFJ 1JJ8C 1QPIA 3FK7A 5C4JJ 4A3EJ 3HDDA 3JRHA 1T33A 2M9HA 2WV1A 2H1KA 2VKEA 4DZPA 5DTDA 1BJZA 5GPAA 3SFIA 2NVQJ 4IHYA 3S2HJ 1WI3A 4Y52J 3LSGA 1U9OA 1JTYA 2E2JJ 2M8GX 2MW8A 3C2BA 4BKXA 2AHQA 2E2HJ 4UUSA 2LP0A 3BG3A 2KDZA 4FE4A 2R5YA 2R5ZA 2L7MP 5M5XJ 2E1OA 3DCFA 3QQAA 1HDDC 1RKTA 1MH4A 1AKHA 2HOSA 1RR7A 3ZOBA 1FEXA 5J1UA 1NTCA 1ZK8A 4A3BJ 1MBKA 4A3KJ 1MBFA 2ME0A 4MFEA 2O8KA 2JJ7A 3HEFA 1IGNA 2DA5A 4C2MJ 1WCMJ 5F04A 2CUEA 4D5CA 5IP6A 4CYCB 3GTOJ 1ETVA 4DW6A 2Y9ZA 3CCYA 1YRNA 3PO3J 4A3FJ 1ZKGA 5J1RA 3BR5A 5F0CA 1W0TA 2Y2ZA 3TW7A 3S1MJ 3L1PA 3TEDA 2XRLA 3IH3A 1AHDP 2NVTJ 2IEKA 3SDGA 1QVTA 1WH7A 3JR9A 2LR8A 1OCPA 3HB9A 2JA7J 2L9RA 3BG5A 3HOYJ 5GPCA 4UUTA 5FLVA 1IG7A 2B63J 3I4MJ 4M3BA 3HOZJ 1BA5A 1O4XA 2M2EA 4MIMA 1ZQ3P 3H3VK 2LKXA 3HKZN 2HI3A 2NVYJ 1LE8A 2H8RA 4BXXJ 1GDTA 1ITYA 1ETQA 5FKLA 3BG9A 3Q0VA 4X1EA 3S16J 1FTZA 3LSPA 1XS9A 4RDUA 2Y0SN 2XSDC 3GTLJ 3S17J 1XC5A 3HOWJ 2DTZA 1ZR2A 4I76A 2P81A 1TWHJ 4QIWN 5E3OA 1R9TJ 5E3MA 2DMNA 3ZQLA 2OF7A 2O9LA 5JLWA 3Q0UA 2JA6J 2HYJA 3BR1A 1F36A 2R7ZJ 3G1OA 2FD5A 5FKKA 2DMTA 4DZJA 3A01B 4DYRA 3BR0A 3QPSA 1HOMA 1BL0A 3JRAA 1F43A 2K9QA 4M3DA 2JA8J 4AC0A 3BQYA 5IYCJ 2LTPA 2XPWA 5F1JA 2EH3A 1K83J 2DN0A 2R0QC 1OFCX 1S7EA 2COBA 4UUSB 1H8AC 2R5YB 1JKQC 2R5ZB 2G0EA 1NK3P 3ZQGA 1Z77A 2L7ZA 1U8BA 1JT6A 1JT0A 5EG0A 1AKHB 5HODA 1Z0XA 1RPWA 2LD5A 4S0HB 4G12A 1JJ6C 2D5VA 2DA1A 2NS8A 1I3QJ 1GV5A 2XB5A 3TW6A 1YRNB 3IV5A 5F08A 5GP9A 2YU9J 1Q1VA 3JRGA 3A02A 1GUUA 1NK2P 2X48A 4FTHA 4W97A 1B72A 1FTTA 1IV6A 2FJ1A 2K9SA 3WHBA 3NAUA 1UG2A 5J3LA 2Y30A 1H88C 2RAEA 4JX5A 5E3NA 2ME6A 2E2IJ 3HGYA 2CU7A 1VI0A 3M3YJ 2JMWA 1VF9A 1LFBA 1LE8B 1JGGA 2EBIA 2R93J 2HXIA 1IJWC 2HOTA 2DA7A 2LY9A 2NOGA 2VPRA 1LFUP 4V2GA 2NS7A 3ZQFA 1ETXA 4JX4A 5EEAA 2DA2A 1HLVA 2K9NA 2VKVA 3S14J 2DJNA 1ETYA 5IP7J 1ETWA 2MG4A 2TCTA 2FQ4A 5K7ZA 1TWGJ 4B4CA 1VNDA 1ZR4A 4I6ZA 1B8IA 2OPTA 5EZHA 2WAQN 3VPRA 4A3DJ 1DU6A 1JUMA 3FKIJ 1PUFA 3B6AA 3BR3A 2ECCA 2XGDA 4B3AA 1MSFC 1AU7A 3OSFA 1FJLA 3F0CA 3GTGJ 1JTXA 2HXOA 5C3EJ 3CQZJ 3TP0A 2Y31A 4JYKA 2E19A 3Q0WA 4QTRA 2HQ5A 4QSHA 1GV2A 4DYQA 1IC8A 1GVDA 4IHWA 2PMZN 1OCTC 2HOAA 3LSRA 2DA3A 3IH4A 3O8GA 3OIOA 5IOZA 3LOCA 2QCOA 3MKLA 5EG0B 4XRMA 2ELKA 2O7OA 1GT0C 5EYRA 1I50J 2DMQA 2JN6A 1EF4A 2DA4A 2XGCA 2YS9A 3GTPJ 9ANTA 3HM5A 4M3FA 1POGA 4JX6A 1H89C 3D1NI 4JP0A 4MFDA 2MSYA 1HF0A 2M34A 4D7NA 3ZQCA 2GLOA 3QPLA 3RZOJ 1ETKA 2JWTA 5M3FJ 2IBDA 1APLC 2EZHA 2EZLA 4V2FA 3BTJA 1B72B 1G2HA 4NDLA 1IUFA 3I4NJ 4MLOA 3BR6A 3CMYA 1RETA 4A3JJ 3SJMA 1JUSA 4MO7A 4J19A 2LFBA 3B6CA 5M5WJ 2XPVA 2CJJA 2CQQA 4FISA 2FX0A 1ENHA 2CRGA 3JRBA 4AYBN 4W1UA 2XB0X 3S1RJ 3PO2J 3TP3A 1JUPA 3BR2A 2MGQA 1HCRA 4M3GA 3JRFA 1JKRC 5IPAA 4A3GJ 5F0HA 1Y1VJ 2AO9A 4RBOA 2TRTA 2QF7A 1WPKA 5EDNA 2ID3A 3GTMJ 4C3JJ 1K61A 5C4XJ 1MH3A 1BW6A 1MBHA 1W0UA 1P7IA 1PUFB 4XRSG 3OSGA 4C3HJ 3W6VA 3HOUJ 3GTJJ 2L0KA 5EF6A 4IHXA 1A5JA 3HBLA 1U78A 4X6AJ 4DYCA 1X2NA 2IAIA 1D5YA 5BNGA 3NARA 1TC3C 1BW5A 1Y1WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBY A;  2W48 A;  1MNM C;  1JKP C;  5M3M J;  3A01 A;  3H0G J;  3O8H A;  3GBG A;  1MSE C;  4A3L J;  3HOX J;  2JK3 A;  3S1N J;  4XIC A;  5K7H A;  2X9D A;  4IHV A;  4D5F A;  2I10 A;  2CQX A;  3CDL A;  1VFC A;  5E3L A;  1IRZ A;  4B1R A;  1WH5 A;  4BY7 J;  3S15 J;  3WHC A;  1TWC J;  3S2D J;  3RQI A;  2XGE A;  4M3E A;  2L7F P;  5FLM J;  2NVX J;  1WGX A;  5FKO A;  3LSJ A;  2YUS A;  5J1Y A;  2KT0 A;  3ZQH A;  4XID A;  4FCY A;  2VI6 A;  4LOC A;  5EGO A;  2XPU A;  1UMQ A;  1HDP A;  5M5Y J;  1QVU A;  1RES A;  3A03 A;  3BQZ A;  1MBG A;  1MBE A;  3HOV J;  1IDY A;  1P7J A;  5FKM A;  1CQT A;  1UHS A;  4XRS A;  2ID6 A;  3BTC A;  3G1M A;  2GM4 A;  3FIW A;  1JKO C;  4EEF G;  2WB1 N;  4XK4 A;  3DEW A;  1IDZ A;  2EQR A;  3IH2 A;  3BTL A;  3OOU A;  1ZTR A;  5FKN A;  1X2M A;  3UKG A;  4M6V A;  4IEJ A;  3FIS A;  4D7M A;  3RZD J;  1SAN A;  3K7A J;  3GTQ J;  5F0F A;  4C3I J;  2X6O A;  4GFB A;  4CYC A;  1ZGW A;  4BBS J;  3S1Q J;  1RKW A;  1SFO J;  4A93 J;  2CUF A;  2HDD A;  1FIA A;  1I6H J;  1XG1 A;  2DMU A;  4A3M J;  1ETO A;  2LK2 A;  2LLK A;  3G1L A;  2JA5 J;  5IYB J;  2DA6 A;  2N8G A;  5IYD J;  3Q3S A;  1U9N A;  5F27 A;  4A3I J;  1MBJ A;  1ORK A;  1QRY A;  4A3C J;  4HNV A;  3JRD A;  1DU0 A;  4AUX A;  5DS9 A;  1OJL A;  4FE7 A;  2ZB9 A;  5IP9 J;  3BT9 A;  3JRI A;  3MVP A;  3E7L A;  2LVS A;  1A6I A;  5K7F A;  3JRC A;  2ECB A;  3FK6 A;  1FIP A;  3GTK J;  3ZQI A;  3LNQ A;  1T56 A;  4ABZ A;  2R92 J;  1E3O C;  5JLX A;  2K40 A;  3BTI A;  5C44 J;  3MN2 A;  1B8I B;  4A69 C;  2EZI A;  1X58 A;  4L5E A;  3K2A A;  2M0C A;  3PM1 A;  2VUM J;  5EZG A;  4BBR J;  3RKQ A;  2EZK A;  3HGG A;  4Y7N J;  3JRE A;  4BY1 J;  2Y9Y A;  1TWA J;  2DMP A;  5FJ8 J;  5IOY A;  5EGO B;  3M4O J;  1TWF J;  1JJ8 C;  1QPI A;  3FK7 A;  5C4J J;  4A3E J;  3HDD A;  3JRH A;  1T33 A;  2M9H A;  2WV1 A;  2H1K A;  2VKE A;  4DZP A;  5DTD A;  1BJZ A;  5GPA A;  3SFI A;  2NVQ J;  4IHY A;  3S2H J;  1WI3 A;  4Y52 J;  3LSG A;  1U9O A;  1JTY A;  2E2J J;  2M8G X;  2MW8 A;  3C2B A;  4BKX A;  2AHQ A;  2E2H J;  4UUS A;  2LP0 A;  3BG3 A;  2KDZ A;  4FE4 A;  2R5Y A;  2R5Z A;  2L7M P;  5M5X J;  2E1O A;  3DCF A;  3QQA A;  1HDD C;  1RKT A;  1MH4 A;  1AKH A;  2HOS A;  1RR7 A;  3ZOB A;  1FEX A;  5J1U A;  1NTC A;  1ZK8 A;  4A3B J;  1MBK A;  4A3K J;  1MBF A;  2ME0 A;  4MFE A;  2O8K A;  2JJ7 A;  3HEF A;  1IGN A;  2DA5 A;  4C2M J;  1WCM J;  5F04 A;  2CUE A;  4D5C A;  5IP6 A;  4CYC B;  3GTO J;  1ETV A;  4DW6 A;  2Y9Z A;  3CCY A;  1YRN A;  3PO3 J;  4A3F J;  1ZKG A;  5J1R A;  3BR5 A;  5F0C A;  1W0T A;  2Y2Z A;  3TW7 A;  3S1M J;  3L1P A;  3TED A;  2XRL A;  3IH3 A;  1AHD P;  2NVT J;  2IEK A;  3SDG A;  1QVT A;  1WH7 A;  3JR9 A;  2LR8 A;  1OCP A;  3HB9 A;  2JA7 J;  2L9R A;  3BG5 A;  3HOY J;  5GPC A;  4UUT A;  5FLV A;  1IG7 A;  2B63 J;  3I4M J;  4M3B A;  3HOZ J;  1BA5 A;  1O4X A;  2M2E A;  4MIM A;  1ZQ3 P;  3H3V K;  2LKX A;  3HKZ N;  2HI3 A;  2NVY J;  1LE8 A;  2H8R A;  4BXX J;  1GDT A;  1ITY A;  1ETQ A;  5FKL A;  3BG9 A;  3Q0V A;  4X1E A;  3S16 J;  1FTZ A;  3LSP A;  1XS9 A;  4RDU A;  2Y0S N;  2XSD C;  3GTL J;  3S17 J;  1XC5 A;  3HOW J;  2DTZ A;  1ZR2 A;  4I76 A;  2P81 A;  1TWH J;  4QIW N;  5E3O A;  1R9T J;  5E3M A;  2DMN A;  3ZQL A;  2OF7 A;  2O9L A;  5JLW A;  3Q0U A;  2JA6 J;  2HYJ A;  3BR1 A;  1F36 A;  2R7Z J;  3G1O A;  2FD5 A;  5FKK A;  2DMT A;  4DZJ A;  3A01 B;  4DYR A;  3BR0 A;  3QPS A;  1HOM A;  1BL0 A;  3JRA A;  1F43 A;  2K9Q A;  4M3D A;  2JA8 J;  4AC0 A;  3BQY A;  5IYC J;  2LTP A;  2XPW A;  5F1J A;  2EH3 A;  1K83 J;  2DN0 A;  2R0Q C;  1OFC X;  1S7E A;  2COB A;  4UUS B;  1H8A C;  2R5Y B;  1JKQ C;  2R5Z B;  2G0E A;  1NK3 P;  3ZQG A;  1Z77 A;  2L7Z A;  1U8B A;  1JT6 A;  1JT0 A;  5EG0 A;  1AKH B;  5HOD A;  1Z0X A;  1RPW A;  2LD5 A;  4S0H B;  4G12 A;  1JJ6 C;  2D5V A;  2DA1 A;  2NS8 A;  1I3Q J;  1GV5 A;  2XB5 A;  3TW6 A;  1YRN B;  3IV5 A;  5F08 A;  5GP9 A;  2YU9 J;  1Q1V A;  3JRG A;  3A02 A;  1GUU A;  1NK2 P;  2X48 A;  4FTH A;  4W97 A;  1B72 A;  1FTT A;  1IV6 A;  2FJ1 A;  2K9S A;  3WHB A;  3NAU A;  1UG2 A;  5J3L A;  2Y30 A;  1H88 C;  2RAE A;  4JX5 A;  5E3N A;  2ME6 A;  2E2I J;  3HGY A;  2CU7 A;  1VI0 A;  3M3Y J;  2JMW A;  1VF9 A;  1LFB A;  1LE8 B;  1JGG A;  2EBI A;  2R93 J;  2HXI A;  1IJW C;  2HOT A;  2DA7 A;  2LY9 A;  2NOG A;  2VPR A;  1LFU P;  4V2G A;  2NS7 A;  3ZQF A;  1ETX A;  4JX4 A;  5EEA A;  2DA2 A;  1HLV A;  2K9N A;  2VKV A;  3S14 J;  2DJN A;  1ETY A;  5IP7 J;  1ETW A;  2MG4 A;  2TCT A;  2FQ4 A;  5K7Z A;  1TWG J;  4B4C A;  1VND A;  1ZR4 A;  4I6Z A;  1B8I A;  2OPT A;  5EZH A;  2WAQ N;  3VPR A;  4A3D J;  1DU6 A;  1JUM A;  3FKI J;  1PUF A;  3B6A A;  3BR3 A;  2ECC A;  2XGD A;  4B3A A;  1MSF C;  1AU7 A;  3OSF A;  1FJL A;  3F0C A;  3GTG J;  1JTX A;  2HXO A;  5C3E J;  3CQZ J;  3TP0 A;  2Y31 A;  4JYK A;  2E19 A;  3Q0W A;  4QTR A;  2HQ5 A;  4QSH A;  1GV2 A;  4DYQ A;  1IC8 A;  1GVD A;  4IHW A;  2PMZ N;  1OCT C;  2HOA A;  3LSR A;  2DA3 A;  3IH4 A;  3O8G A;  3OIO A;  5IOZ A;  3LOC A;  2QCO A;  3MKL A;  5EG0 B;  4XRM A;  2ELK A;  2O7O A;  1GT0 C;  5EYR A;  1I50 J;  2DMQ A;  2JN6 A;  1EF4 A;  2DA4 A;  2XGC A;  2YS9 A;  3GTP J;  9ANT A;  3HM5 A;  4M3F A;  1POG A;  4JX6 A;  1H89 C;  3D1N I;  4JP0 A;  4MFD A;  2MSY A;  1HF0 A;  2M34 A;  4D7N A;  3ZQC A;  2GLO A;  3QPL A;  3RZO J;  1ETK A;  2JWT A;  5M3F J;  2IBD A;  1APL C;  2EZH A;  2EZL A;  4V2F A;  3BTJ A;  1B72 B;  1G2H A;  4NDL A;  1IUF A;  3I4N J;  4MLO A;  3BR6 A;  3CMY A;  1RET A;  4A3J J;  3SJM A;  1JUS A;  4MO7 A;  4J19 A;  2LFB A;  3B6C A;  5M5W J;  2XPV A;  2CJJ A;  2CQQ A;  4FIS A;  2FX0 A;  1ENH A;  2CRG A;  3JRB A;  4AYB N;  4W1U A;  2XB0 X;  3S1R J;  3PO2 J;  3TP3 A;  1JUP A;  3BR2 A;  2MGQ A;  1HCR A;  4M3G A;  3JRF A;  1JKR C;  5IPA A;  4A3G J;  5F0H A;  1Y1V J;  2AO9 A;  4RBO A;  2TRT A;  2QF7 A;  1WPK A;  5EDN A;  2ID3 A;  3GTM J;  4C3J J;  1K61 A;  5C4X J;  1MH3 A;  1BW6 A;  1MBH A;  1W0U A;  1P7I A;  1PUF B;  4XRS G;  3OSG A;  4C3H J;  3W6V A;  3HOU J;  3GTJ J;  2L0K A;  5EF6 A;  4IHX A;  1A5J A;  3HBL A;  1U78 A;  4X6A J;  4DYC A;  1X2N A;  2IAI A;  1D5Y A;  5BNG A;  3NAR A;  1TC3 C;  1BW5 A;  1Y1W J; 
#chains in the Genus database with same CATH topology
 2O0Y A;  5M3M J;  3H0G J;  4UB8 C;  1WJB A;  1MSE C;  2EPF A;  4KJZ A;  2IS6 A;  1J9I A;  1HKT A;  5FO5 A;  1JGS A;  1DP7 P;  3K4B A;  2UWM A;  4CDG A;  2GQQ A;  2I5U A;  5K7H A;  4IXA A;  2F6C A;  1HBX G;  4IF4 A;  2I10 A;  4XLF A;  2FML A;  1IXR C;  3E5X A;  3VYS B;  2HTS A;  3S15 J;  2NNY A;  2ZO4 A;  2HVS A;  3RQI A;  4C30 A;  2VKH A;  2XGE A;  5CQE A;  5B66 C;  2L7F P;  2OA4 A;  2ETH A;  2IGM A;  5FKO A;  5ILU A;  1FOW A;  3H5A A;  2XV4 S;  3LSJ A;  3MAJ A;  1V5F A;  1EA3 A;  1CF7 A;  3FM5 A;  2W1O A;  5H6Q A;  1YLF A;  3KEO A;  3ZQH A;  4FCY A;  2L5Q A;  2A68 F;  2M7A A;  4UY8 I;  5K5R A;  3TGN A;  1QVU A;  1RES A;  3RDI A;  3KFW X;  2IXS A;  5E1Z B;  4DIQ A;  3HOV J;  4UV9 A;  1R6R A;  4NC8 A;  5FKM A;  1R00 A;  2XAQ A;  4L0Z B;  2XRN A;  3BTC A;  2GXB A;  3TOB A;  4N0B A;  1NG6 A;  3HHG A;  4BXU A;  3CJR B;  2VE8 A;  2ZBK A;  5H20 A;  4G7Z F;  1T98 A;  4XLN F;  2HKO A;  2L02 A;  1FP1 D;  1X2M A;  2Q2E A;  1PP8 F;  1RC9 A;  2KFD A;  3F6V A;  2O6G E;  3DF8 A;  5EEG A;  5F0F A;  2L54 A;  3BLY A;  2M45 A;  1KYW A;  2VBX A;  3P5J A;  4C3I J;  4GFB A;  4E7K A;  1U5T B;  1OR7 C;  4KUM A;  4NHJ A;  1MIJ A;  1IRF A;  3G2B A;  2HU9 A;  3J81 Z;  1FIA A;  1I6H J;  2XF7 A;  4A3M J;  1TL8 A;  4RB2 C;  4C2U A;  3A1Y A;  2LLK A;  2ZSH B;  3OYA A;  1KA8 A;  4WXD A;  2A6H F;  4BS9 A;  3S3N A;  1QNT A;  2DA6 A;  2EWN A;  1ZGA A;  3ABU A;  1U9N A;  4UVA A;  1FBQ A;  5F27 A;  4ANJ A;  3WTU C;  5ERI A;  4A3C J;  1YW8 A;  1BOB A;  1Z05 A;  4AUX A;  2ESH A;  3JW4 A;  4A6D A;  3OR2 C;  1FYL A;  1W36 D;  1X3W B;  3RI4 A;  2RQQ A;  3L00 A;  3R61 A;  3J80 Z;  3ERE D;  3JRC A;  3FK6 A;  1Y0N A;  3SEQ A;  2XGX A;  5HLG A;  2IGN A;  3J7Z I;  4OWR B;  3L2W A;  3LNQ A;  2K40 A;  2W85 A;  3MN2 A;  3U2R A;  3IAM 2;  2OCE A;  2EZI A;  2K27 A;  1X58 A;  4L5E A;  3OYD A;  2M0C A;  2VC0 A;  2NS0 A;  5EZG A;  5KK1 A;  5CVR A;  2DJI A;  4BBR J;  2F5D A;  3CLO A;  2JTV A;  5FRO A;  4BY1 J;  1KU2 A;  5FJ8 J;  2DMP A;  1R1V A;  5IOY A;  1IRX A;  2ZJQ F;  2WB1 A;  1B59 A;  2HOE A;  2HDW A;  4BDZ A;  3HDD A;  3RYR A;  1G4D A;  3JRH A;  2H1K A;  2VKE A;  3OYH A;  4DZP A;  5DM7 F;  3L9F A;  2FEZ A;  2V9K A;  1YOV B;  3CUQ C;  5GPA A;  4IHY A;  2VBY A;  1OYI A;  4MNU A;  1LJ9 A;  2WA0 A;  1WI3 A;  1G8X A;  3CF5 F;  5FLX K;  3C2B A;  2JRT A;  4RB3 C;  2UXX A;  4FE4 A;  2R5Z A;  3GUD A;  1BIB A;  2G7U A;  2VB6 A;  2VE9 A;  3W3C A;  2L7M P;  3G6E I;  5M5X J;  1PJR A;  1SVM A;  1FMW A;  4HF1 A;  1FBU A;  3ISP A;  4IO9 F;  3OYE A;  2Z33 A;  1FEX A;  4EJV A;  2JSC A;  2CWE A;  3WGH A;  1ZK8 A;  4ESB A;  3CJT B;  2O8K A;  2DOA A;  4KMU X;  3ZMS A;  2CG4 A;  3CCU I;  1W4M A;  3PUB A;  3W6J B;  2DA5 A;  5F6F A;  2CUE A;  4D5C A;  3TO6 A;  4DW6 A;  1IRG A;  2Y9Z A;  1PP7 U;  5DDG A;  4N4N B;  1YRN A;  3D5S C;  3ZMU A;  4A3F J;  5J1R A;  3DU6 A;  3H3Z A;  4Y17 A;  5JHU A;  2HS5 A;  4D9J A;  2EIM H;  4N9I A;  3L1P A;  2IS1 A;  2NRA C;  4CCM A;  3CCM I;  5BQT A;  4BDY A;  2L9V A;  5J8F A;  3HOY J;  5GPC A;  5BMZ A;  2B63 J;  3K1N A;  2XAS A;  5HLT A;  1ZLJ A;  3CF2 A;  1O4X A;  2HQN A;  2M2E A;  4RAY A;  3L2U A;  4BHP A;  3H3V K;  2LKX A;  4PFP A;  3CCJ I;  4UNO A;  2NVY J;  3R4K A;  3I54 A;  4A12 A;  1S7O A;  1ITY A;  1ETQ A;  1X1C A;  5TGT A;  1H0M A;  3BG9 A;  4PK4 A;  3H92 A;  2R7X A;  2DBB A;  4X1E A;  4MQ9 F;  1B4A A;  2OBP A;  3V8L A;  3HOW J;  2DTZ A;  4MEX F;  1ZR2 A;  2VJI A;  3FBN B;  1GHC A;  2K4J A;  4F55 A;  1QQI A;  4E7H A;  2LKP A;  1LQ1 A;  1ZN2 A;  2D2W A;  2R7Z J;  3G1O A;  1YIO A;  2CFO A;  3LFK A;  1TQM A;  2DMT A;  4G7H F;  4DZJ A;  4HNT A;  3BR0 A;  2V1D A;  3EQL F;  3QPS A;  1BL0 A;  3U21 A;  2EFP A;  2K9Q A;  5ED4 A;  2HGC A;  3DV8 A;  2F4I A;  4M3D A;  3ZRG A;  1GXP A;  1G6N A;  4AC0 A;  3RQ4 A;  2X6W A;  1PYV A;  5E8I A;  2LTP A;  3H5R A;  4HST A;  2EH3 A;  4XKV A;  1K83 J;  3ELK A;  1A04 A;  4YEL A;  3WOD F;  2DN0 A;  4ZYG A;  3HIF A;  2COB A;  2L01 A;  4IHT A;  1Z77 A;  2L7Z A;  3KZY A;  1JT6 A;  1U8B A;  5EG0 A;  1H9T A;  3ZP5 A;  1I39 A;  2E1C A;  2JVH A;  3PNT A;  1W5S A;  5D4R A;  1G59 A;  3LSH A;  2G9W A;  2V7F A;  1W7P A;  2VQG A;  3BC8 A;  3H9G A;  3OYM A;  2D5V A;  2DA1 A;  3H35 A;  4LD5 A;  1S7A A;  3OYB A;  1VQ4 I;  3IV5 A;  1U2W A;  4XLP F;  3L2Q A;  3T8R A;  2YU9 J;  2ZFU A;  3O2P E;  3A02 A;  1FNN A;  1AOY A;  4GXO A;  3H0D A;  2PEX A;  2Y69 H;  2A5Y B;  1BBY A;  1R58 A;  4XOT A;  3TBI A;  4W97 A;  2JUG A;  3IP4 B;  2ELJ A;  5JI6 A;  3FWE A;  3NAU A;  4OIQ F;  4MTE A;  3WGG A;  2CMP A;  2VOD A;  3S8P A;  2VN2 A;  1H88 C;  5TJJ A;  4EGY A;  2VOP A;  3LSK A;  4RAZ A;  5E3N A;  2V26 A;  3I9V 2;  4G7O F;  4RLQ A;  1IZ1 A;  1KU3 A;  1WFX A;  2W57 A;  1BI3 A;  4M73 A;  1LDD A;  1JGG A;  1ON1 A;  3COA C;  3C2G A;  4UHT A;  2BYV E;  2VPR A;  1LFU P;  4V2G A;  1O3T A;  3ZQF A;  1K4T A;  4JX4 A;  1TQI A;  2DA2 A;  4OIP F;  2X1D A;  1LEB A;  2H1L A;  2Z5U A;  2VJJ A;  1ETY A;  3V8K A;  3PJR A;  5KAF C;  4CYD A;  1DPU A;  2KZG A;  1B8I A;  1R36 A;  4BAY A;  2OPT A;  3ZPL A;  1XGS A;  3ESW B;  4F92 B;  3GWZ A;  3RKW A;  1PUF A;  2E60 A;  3B6A A;  2LSO A;  3BR3 A;  4F7Z A;  4E6K G;  4XOP A;  1B6A A;  4WX9 A;  3W2A A;  2L3D A;  1FJL A;  2DQL A;  3G71 I;  1JTX A;  1UEL B;  2OQG A;  3K4N A;  4ENJ A;  2IRF G;  4NNJ A;  2DQR A;  5FFX A;  1S3J A;  5FD6 A;  2PMH A;  5D6F A;  1X1D A;  4NBQ A;  2JRM A;  5BS6 A;  1EV7 A;  1GVD A;  3FF5 A;  4HBL A;  1IC8 A;  4HRI A;  3GZN B;  3EET A;  2E34 A;  3ECH A;  3IH4 A;  2W7N A;  2LMD A;  4WCG A;  3SYT A;  5IOZ A;  3MKL A;  3VWB A;  4X0G A;  2ELK A;  2VT3 A;  4IRG A;  3ZMT A;  3RIR A;  2CV1 A;  3R60 A;  3MCZ A;  1VQP I;  2PQ8 A;  3F8N A;  1KON A;  5ICC A;  4IZZ A;  2BZT A;  2Z16 A;  2GWR A;  2ZSI B;  1POG A;  1H89 C;  1VQ5 I;  3J7Y J;  1HST A;  4JP0 A;  4LFU A;  3MQ0 A;  4BH9 A;  2OJE D;  1LDJ A;  2M34 A;  1SVL A;  3H3U A;  2GLO A;  4XRF A;  3ZXS A;  5D8L B;  2PJP A;  2E7W A;  5LFA A;  1UHM A;  3KZI C;  1S6L A;  4V2F A;  5ILS A;  5LBQ A;  3FXM A;  4I98 B;  2OV7 A;  5DUI A;  2BEO A;  1RZ4 A;  2E1M B;  4MEY F;  3AKZ A;  1G2H A;  4WF2 A;  1IUF A;  1X1P A;  4MLO A;  1K6O A;  1YJN I;  1SEU A;  5HDN A;  4L0Y B;  1LVA A;  1ZHF A;  4HAM A;  3K4K A;  3QU6 A;  4P55 A;  4II3 A;  1USS A;  2LFB A;  3HOT A;  1U3E M;  5IT9 Z;  5M5W J;  3DWL E;  4GYG A;  2E5N A;  1SVO A;  5LGU A;  2CJJ A;  1OCZ H;  4DBR A;  4ZYA A;  1Z1D A;  3BPX A;  4N9H A;  4CXF A;  2E1N A;  3KZZ A;  4MHG A;  5L3C A;  3E6B A;  2XB0 X;  2JUC A;  3GZ6 A;  2R7V A;  3PO2 J;  1JUP A;  2VXZ A;  2Z3Y A;  3GME A;  1D1C A;  3JRF A;  3E3V A;  2BVL A;  2RQP A;  3WTX C;  2AO9 A;  4A5N A;  1Z67 A;  1BR1 A;  4N4O B;  2X1C A;  1U5T A;  2FF4 A;  1O7L A;  3IWF A;  1WPK A;  1XSX A;  5EDN A;  4H0E A;  3GTM J;  1X3U A;  3DTE A;  4C3J J;  1N78 A;  2ZJP F;  1XB4 A;  5DCF A;  5HDK A;  2VON A;  4M74 A;  3Q9V A;  3DKX A;  1P7I A;  2R7R A;  2DK8 A;  4L9J A;  4KT6 A;  4C3H J;  1UHW A;  5CQG A;  1HQC A;  5EF6 A;  1I1S A;  4KFC A;  4ZTF A;  4DYC A;  1X2N A;  3AG4 H;  2G7H A;  1KQ9 A;  4GRI A;  2VXD A;  5CYV A;  5BNG A;  1J75 A;  1TC3 C;  5AIQ A;  1QGP A;  2KIF A;  2W48 A;  2XF6 A;  1IW7 F;  3BP8 A;  2HWV A;  2FE3 A;  5FRM A;  1QA6 A;  4LK0 F;  3GBG A;  3J80 K;  4RMN A;  2CGP A;  1XN7 A;  2M4K A;  3HOX J;  4KYW A;  4LIU A;  3LST A;  4CCO A;  2WBM A;  1MMN A;  3KP5 A;  4D5F A;  2X1E A;  3FXL A;  3JTH A;  2CQX A;  3BJO A;  4CCL A;  5GAH J;  4WXH A;  3PNV A;  4JQF A;  1BR2 A;  4IRH A;  1IRZ A;  4GCV A;  2ZCW A;  3L2R A;  1TT5 B;  2CQK A;  4BY7 J;  3M8J A;  3L7W A;  1TWC J;  3S2D J;  2ZNY A;  4XBF A;  3AL0 B;  4M3E A;  1R5H A;  5FLM J;  4U7D A;  2QM3 A;  1K4S A;  2DLL A;  3DQV C;  2V6E A;  2IA0 A;  2RC4 A;  1YG2 A;  1FYM A;  3E0J B;  5J1Y A;  4HLY A;  3NWS A;  2VAS A;  4DOZ A;  1VQO I;  2QBY B;  1FOY A;  2R7D A;  3SQN A;  2LDU A;  3NWT A;  1YX5 A;  3MFK A;  1ZRD A;  5M5Y J;  4RGX A;  4PSW A;  2QEN A;  3BQZ A;  2VOO A;  1KQ8 A;  2ZXI A;  4DNC A;  3GLL A;  4P9F A;  4A0Y A;  1C0W A;  1CQT A;  3D0S A;  3GZ5 A;  5IY5 H;  1MW7 A;  4HSR A;  3DKW A;  4XK4 A;  4HX7 A;  2CW0 F;  3OYI A;  4PFO A;  3IH2 A;  2QKM B;  3BTL A;  3GFM A;  3OOU A;  1Y56 A;  1ZTR A;  4OMZ A;  3ERM A;  2O8X A;  3UKG A;  4M6V A;  1DGW Y;  2L2O A;  3RZD J;  1KU7 A;  2AXT C;  3K7A J;  1BN5 A;  2O03 A;  3CUO A;  2B9S A;  3LA2 A;  4OIR F;  3PNY A;  4BE2 A;  2H94 A;  4BL0 B;  2X6O A;  3KPH A;  1ZGW A;  4BBS J;  3LQQ A;  1SFO J;  2CUF A;  2JPB A;  4M6Y A;  2L4M A;  5A2Q Z;  2KDO A;  1ETO A;  1OLT A;  2LK2 A;  2JA5 J;  5IYB J;  1KU9 A;  5D6E A;  5E1X A;  3HTU A;  2CSO A;  2OZU A;  4BXF A;  2XF5 A;  2X0L A;  2IT0 A;  2P6S A;  1IN4 A;  5FGM A;  4RAG A;  3SZT A;  3OMY A;  3JAM Z;  2AQE A;  4EVI A;  1K7A A;  4PUS A;  1O3Q A;  3JRD A;  2LYC A;  1VQM I;  5DS9 A;  5DCM A;  1D0X A;  3RSN A;  1D0Y A;  4LLG F;  3MKW B;  2OZ6 A;  3JCU C;  4BUP A;  2WAQ A;  1OCR H;  4Y3O A;  2KRF A;  3ABL H;  2ZFW A;  2RVC A;  1A6I A;  2WY7 Q;  1IXS B;  3FHN A;  3TO7 A;  5K7F A;  2VJ4 A;  2K85 A;  3GTK J;  4YG2 F;  2L4A A;  3E97 A;  5CLS A;  4ABZ A;  4E7L A;  1L3L A;  5JLX A;  5C44 J;  2V1N A;  1B8I B;  1QHH D;  5ICG A;  3ABK H;  3ASN H;  3R0J A;  2BY2 A;  3K2A A;  3LQR A;  2PMZ A;  1OCC H;  3RKQ A;  1I3A A;  3GFL A;  4A5M A;  4YIR X;  2DK5 A;  1BI1 A;  1SD6 A;  4A0X A;  2WWY A;  5EGO B;  4ZYD A;  1SD4 A;  2UV1 A;  4A2U A;  4R79 A;  4PJJ A;  5C4J J;  2E5Z A;  2V9P A;  3ECO A;  5D5X B;  2ZC2 A;  3QAH A;  3E6C C;  2M9H A;  2ZME B;  3CP2 A;  1XGO A;  1BJZ A;  3SFI A;  3WU0 A;  2NVQ J;  1TW2 A;  1E2X A;  3S32 A;  4HX8 A;  4G94 A;  4LIV A;  3BRO A;  4Q48 A;  3LSG A;  2D45 A;  2HPM A;  1U9O A;  3CMA I;  2M8G X;  3BZK A;  5TIS C;  3RKY A;  2W24 A;  3BG3 A;  2LKS A;  2KIQ A;  1DUX C;  3I59 B;  5LRS A;  4FT8 A;  1O7F A;  3DCF A;  3QQA A;  1A6Q A;  3UR3 C;  1MH4 A;  2KPM A;  3OS1 A;  3ZOB A;  2HOS A;  1NTC A;  1U5T C;  4KIS A;  3K6G A;  1MBK A;  4A3K J;  2M4G A;  4MFE A;  1LUJ B;  4I99 C;  3HEF A;  4M9Z A;  4CYC B;  4C2M J;  1WCM J;  3K4M A;  2CH0 A;  3GW2 A;  1XSV A;  3CCY A;  4RA2 A;  3PO3 J;  1KYZ A;  1ZKG A;  4XSZ F;  3ABT A;  2A05 A;  3BR5 A;  4ESJ A;  3M7G A;  2WAE A;  3CCL I;  4AYB A;  4CA0 A;  3CCR I;  2KHM A;  3TW7 A;  3S1M J;  2UUZ A;  1D1A A;  1ZGJ A;  5FRN A;  3T8T A;  1Y39 A;  2ADU A;  4XLC A;  1WH7 A;  2K5C A;  3JR9 A;  2JVG A;  2XAU A;  2MC3 A;  1OCP A;  2L9R A;  4UUT A;  5FLV A;  1IG7 A;  3I4M J;  4B3X A;  2F48 A;  1R49 A;  1OYY A;  1I5Z A;  1BA5 A;  2LY2 A;  1D3Y A;  1ZQ3 P;  4YRV A;  1MNE A;  3KCC A;  3GFJ A;  3M8E A;  4S05 A;  1BM9 A;  2HI3 A;  3WE2 A;  1YJW I;  1K6Y A;  1J2X A;  4BXX J;  3AAF A;  2EIN H;  5L3D A;  1K78 A;  3ZQ7 A;  1SAU A;  3Q0V A;  4NUB A;  2ICW G;  1XS9 A;  4XSX F;  1FOX A;  2XSD C;  4EGZ A;  3CMM A;  1XC5 A;  1U8R A;  3GTL J;  1R9T J;  1TWH J;  5E3O A;  4CO8 A;  5JLW A;  2F5C A;  2R7U A;  3Q0U A;  2JA6 J;  4XOR A;  4KA4 A;  3BR1 A;  4BAC A;  3GEZ A;  4XMY A;  3WGI A;  3LA7 A;  3F8F A;  4HNU A;  2CFX A;  1E3H A;  5FKK A;  3DXJ F;  1OCO H;  3HRT A;  2BW3 B;  2LF7 A;  3EPZ A;  2DFI A;  2KIS A;  2Z99 A;  1HOM A;  1ZH5 A;  3JRA A;  1FBS A;  3PFI A;  4B47 A;  1XPX A;  1R4N B;  2W4S A;  2AQF A;  2XAG A;  1T6S A;  4IOC F;  1VQK I;  2EFQ A;  3KP7 A;  5DEQ A;  2BVM A;  2X6X A;  2QGU A;  5EEH A;  1HKQ A;  4IL6 C;  4UUS B;  1H8A C;  2R5Y B;  2YPR A;  2CUJ A;  5H2F C;  1JT0 A;  1BIA A;  2LBF A;  4AD9 A;  5TRD A;  3RPU A;  1V5G A;  1AKH B;  1S72 I;  3NRV A;  5HOD A;  4HF0 A;  3V4G A;  3OYN A;  2QWW A;  1I1G A;  3RYP A;  4FAS D;  2VQL A;  2XC7 A;  1IO2 A;  1FP2 A;  2J5P A;  3K9T A;  4WK8 F;  1JJ6 C;  1VQN I;  2BY1 A;  4UVC A;  4CHU A;  2DT5 A;  2RN7 A;  2XKP A;  3WTZ A;  1G3S A;  3HRU A;  5F08 A;  2XVC A;  5GP9 A;  3SEZ A;  5LRR A;  4MTD A;  4HLX A;  3OOP A;  2PI0 A;  4HYE A;  1IN5 A;  3PFY A;  2PMU A;  1Q1V A;  4DQ2 A;  4KMF A;  4U0W A;  4E4H A;  3CTA A;  1K79 A;  1NK2 P;  5GTI C;  2X48 A;  5DV5 A;  4FTH A;  5IT9 K;  2XDV A;  3WHB A;  2MH2 A;  4HQE A;  1REP C;  4F52 A;  4OAY A;  2FQ3 A;  2Y30 A;  4U7B A;  3G4S I;  2RAE A;  2DI3 A;  3OS2 A;  2ME6 A;  3QRF F;  3HGY A;  3M1C A;  5ICF A;  1SFE A;  2QQ9 A;  2Y0S A;  4M9X A;  4WWC A;  3M3Y J;  2OD5 A;  2OC6 A;  3IWZ A;  2V9V A;  3LSI A;  1R5G A;  2AS5 F;  2HXI A;  4CH7 A;  3EUH C;  1IJW C;  2MAB A;  3E6D A;  2VL8 A;  2HOT A;  2RDP A;  2XAJ A;  2NOG A;  1P4A A;  4EMS A;  4FQG A;  4U88 A;  3F21 A;  2P4W A;  4GYI A;  2CQN A;  1HLV A;  2Q1Z B;  2VKV A;  3QU3 A;  2DPU A;  3G73 A;  3CDH A;  3ABM H;  3RPQ A;  2FBK A;  5IP7 J;  1ETW A;  2MG4 A;  3UNG C;  1ZAO A;  1TLH B;  1TWG J;  1VND A;  2P5K A;  4XR6 A;  2WAQ N;  5EZH A;  3VPR A;  5HNH A;  4J01 A;  5J47 A;  3VYR B;  2I8D A;  4YEJ A;  2HVQ A;  4XLH A;  5F64 A;  1HXD A;  1Z21 A;  1MSF C;  4L18 B;  3KLO A;  4XKW A;  1WSU A;  3VFZ A;  3ZMD A;  5DCM B;  3AG1 H;  3T1B A;  2HXO A;  3BJ6 A;  2VT2 A;  4RGR A;  3M9A A;  5C3E J;  1YQA A;  1A31 A;  2Y31 A;  1QZZ A;  1BR4 A;  3I0T A;  1EH8 A;  1UZC A;  1UAA A;  1GV2 A;  4A6E A;  4DYQ A;  1HW5 A;  2VBW A;  4UUV A;  1J09 A;  2PMZ N;  1QHG A;  1OCT C;  4Q5S F;  4IQ4 A;  2DA3 A;  2BOL A;  3O8G A;  3OIO A;  3ROU A;  4B09 A;  2VBZ A;  4XQF A;  2R7W A;  3LOC A;  1E17 A;  2BV6 A;  4BEH B;  2ZNZ A;  2EA2 A;  2H6B A;  1D0Z A;  5EYR A;  1I50 J;  4JBA A;  3K70 D;  2DMQ A;  2JN6 A;  2PN6 A;  2WC2 A;  2JPC A;  4YFK F;  2XGC A;  3P9K A;  4EQQ A;  3VSL A;  3GTP J;  1VQ8 I;  9ANT A;  4M3F A;  3GF2 A;  4ZDP A;  1HKS A;  4AIH A;  1HF0 A;  4KIF A;  3ZQC A;  1LKX A;  3QOP A;  1ETK A;  3RZO J;  3CCS I;  2HYF A;  3BG6 A;  2QBY A;  2IS4 A;  2E71 A;  3CES A;  1APL C;  2EZH A;  4ON0 A;  3ZN0 A;  2XAF A;  2M1B A;  4LMY A;  3BTJ A;  1YO5 C;  1B72 B;  3I4N J;  4B43 A;  3BR6 A;  4ZC3 A;  2KIM A;  2LRE A;  4A3J J;  1ULY A;  1JUS A;  3WE3 A;  2DDA A;  3OWT A;  2LY1 A;  4RAF A;  4J19 A;  3ZN1 A;  3X2Q H;  3OYF A;  4UB6 C;  2XPV A;  3DPU A;  5KHD A;  1ZLK A;  1JI8 A;  3MEX A;  4G9Y A;  1ENH A;  1L0O C;  1YFH A;  4ZZD A;  4D1Q A;  2BY3 A;  4AYB N;  3OR1 C;  1E0E A;  2EA4 A;  2YX7 A;  2MGQ A;  5J4V A;  1JHF A;  1R7J A;  5KVR A;  1Z9C A;  2BGC A;  4EM2 A;  4A3G J;  1MJA A;  4RBO A;  2QF7 A;  3VYT B;  2ID3 A;  1EKE A;  1YE9 A;  3TO9 A;  4PJM A;  4IHS A;  1MH3 A;  4NQW A;  1ODD A;  1J0R A;  2GIV A;  4RGU A;  2FSW A;  3CC7 I;  2L0K A;  4I09 A;  1R71 A;  1TZL A;  1AA7 A;  1U78 A;  1Z7L A;  3QWL A;  2STW A;  2FMY A;  2IAI A;  2GBY A;  4MGR A;  1MNM C;  3PSI A;  1UCR A;  2KQR A;  1MJB A;  1LNW A;  4M71 A;  3HOS A;  3EYI A;  5LHI A;  2JK3 A;  3BZ6 A;  5J40 A;  3DTI A;  4XIC A;  2A61 A;  2X9D A;  4CSW A;  4IHV A;  2NNN A;  1K78 B;  3HG9 A;  2GA2 A;  5CPR B;  3DLA A;  1QU3 A;  1WJD A;  3CDL A;  5E3L A;  2FUG 2;  3HXL A;  4BNC A;  4E7Z A;  3ASO H;  1DP3 A;  4PSX A;  2WAD A;  3OYJ A;  2HVR A;  3BWG A;  3DBL B;  4Q4Z F;  2GIZ A;  2HR3 A;  3P9C A;  1WGX A;  3BCA A;  3PQK A;  3E5U A;  3DKY A;  1IN8 A;  1X3Z B;  3RCO A;  1WI9 A;  3FMQ A;  2QQA A;  2PJR B;  3F8M A;  2KRH A;  2YUS A;  3GO5 A;  1HW2 A;  4XID A;  3IKV A;  2E1M C;  4LOC A;  1UJ8 A;  5EGO A;  4TV7 A;  2DTR A;  1HDP A;  4ZYH A;  1N25 A;  3A03 A;  4CZC A;  1VTN C;  1MBG A;  1ACI A;  1FY7 A;  2WAF A;  2YSR A;  3CZ6 A;  2B7E A;  2IW5 A;  2ZME A;  3RKX A;  1IDY A;  1P7J A;  2EV5 A;  3C18 A;  4I7H A;  3V7R A;  3P7N A;  4XRS A;  2ID6 A;  5CVU A;  5IT3 A;  2Z1D A;  2LBF B;  3FIW A;  1JKO C;  4R8H A;  3CCV I;  2FRH A;  2L7K A;  1F9N A;  1YW7 A;  3F6O A;  2WB1 N;  1IDZ A;  3DEW A;  4O5V A;  2EQR A;  1XCV A;  4IVN A;  3FMR A;  3I59 A;  2O5R A;  4CCN A;  3JSP A;  3WG7 H;  5FKN A;  1XSD A;  4IEJ A;  3FIS A;  2GXA A;  1O3R A;  3BZC A;  4EM0 B;  1Y6I A;  3K10 A;  3GFI A;  5JR3 A;  3LFU A;  4BQA A;  1MMA A;  2XAH A;  3WU2 C;  4CYC A;  3OIQ A;  4C9Y A;  4OMY A;  3S1Q J;  3FMS A;  1RKW A;  2FA5 A;  4GDF A;  5DYM A;  4ZDL A;  4F91 B;  1XG1 A;  4HPQ A;  2H27 A;  1Q1H A;  4XON A;  1P92 A;  3F72 A;  5E20 A;  4KNY A;  2N8G A;  4AU7 A;  4I0B A;  3V8J A;  3Q3S A;  3AG2 H;  1UST A;  4A3I J;  3A2K A;  1MBJ A;  2YX4 A;  3QPH A;  3BY6 A;  1W5T A;  1ORK A;  1QRY A;  1XMA A;  2UXN A;  3HRS A;  1DPR A;  1ZAR A;  4ZDO A;  1YTY A;  4Y4R A;  4FE7 A;  2W00 A;  2QYO A;  3L2V A;  4HA8 A;  3PQJ A;  3JRI A;  5H6R A;  4I01 A;  3MVP A;  1ERD A;  1LVK A;  2LVS A;  1MGT A;  3VSK A;  5HS9 A;  2BXY A;  3SXY A;  3J81 K;  1SFU A;  3AL0 C;  2HFH A;  4D0P A;  3IL2 A;  3ZQI A;  2R92 J;  5L3B A;  1E3O C;  3BG7 A;  3BTI A;  1NH3 A;  4BE0 A;  4A69 C;  2MFZ A;  5FLX Z;  1Z6T A;  4U87 A;  2R7F A;  3PM1 A;  3DU5 A;  1WHU A;  2V79 A;  2Y48 A;  3HGG A;  2GOM A;  3JRE A;  4ETS A;  5JFR A;  2Y9Y A;  1TWA J;  3I56 I;  1X1A A;  1JJ8 C;  3CJQ B;  1W36 C;  1QPI A;  3FK7 A;  2BW3 A;  4E7I A;  3S93 A;  3KYD B;  3CCQ I;  5D8K B;  1T33 A;  2WV1 A;  2LH9 A;  2GZW A;  2LOO A;  3LWF A;  4XLE A;  2FBH A;  5KCM A;  3S2H J;  3HJE A;  4Y52 J;  2ELH A;  1FX7 A;  4R1H A;  3W2W A;  2E2J J;  1YX3 A;  2VC1 A;  2K7L A;  4BKX A;  2E2H J;  4UUS A;  2LP0 A;  2KDZ A;  5AIP A;  2R5Y A;  1RRJ A;  1MD0 A;  1Z3Y A;  4UV8 A;  1HDD C;  1W5C C;  1YIJ I;  4EJO A;  3KLN A;  4U0V A;  1AKH A;  1RR7 A;  4LG3 A;  2Z9O A;  1PDN C;  4A3B J;  1MBF A;  2JJ7 A;  2OTJ I;  4Q47 A;  5F04 A;  3GTO J;  3SZG A;  5CJ9 A;  3I55 I;  4HDV A;  3JTG A;  1T8I A;  1YIT I;  2MBF A;  3NEU A;  4ZH4 F;  5GTH C;  3TKY A;  2K3P A;  1R5I D;  1XDS A;  3K1P A;  1QO0 D;  3J7A Y;  3V7S A;  2MC4 A;  3DLL F;  2XRL A;  3IH3 A;  1AHD P;  2WY8 Q;  3FXJ A;  3W6K B;  2IEK A;  1D5V A;  1IN7 A;  3QP5 A;  3F3X A;  2ISY A;  2F4O B;  4UXN A;  3BG5 A;  3D5R C;  1G3W A;  1SAX A;  3HOZ J;  3E5Q A;  4MIM A;  5CVI A;  3VEP A;  4EJT A;  3A0H C;  1FYK A;  2MA3 A;  5D5V B;  3OL4 A;  1GDT A;  1YYV A;  3KYC B;  2QLZ A;  3F8C A;  3S16 J;  4DBQ A;  2K02 A;  3ZR8 X;  2L9S A;  4NQW B;  4RDU A;  1S9H A;  4AIK A;  3S17 J;  2RRE A;  2K9L A;  2PFB A;  1OIS A;  3CP8 A;  3ZQL A;  2O9L A;  2R7S A;  4ENN A;  1OYW A;  3DPT A;  1QZY A;  2HYJ A;  1WWX A;  3LA3 A;  4L5I A;  4LLL A;  1STZ A;  2FD5 A;  2ZME C;  1TNS A;  4DYR A;  3MZY A;  2ZJ2 A;  1P4W A;  3HZJ A;  2OU2 A;  1F43 A;  1KQ0 A;  2A6T A;  2OTL I;  3U9G A;  3CCE I;  2IJL A;  3OIP A;  1Y8Q B;  1JXS A;  1X1B A;  3T5X A;  1YI2 I;  2R0Q C;  1N75 A;  2DCE A;  1OFC X;  1JKQ C;  4OU0 A;  4ZZL A;  2G0E A;  1NK3 P;  3ZQG A;  3IRR A;  4BEH A;  2LC2 A;  1T95 A;  5F1R A;  4RM3 A;  2YR2 A;  2O61 A;  5LEK A;  2ZKZ A;  4S0H B;  1WRJ A;  4EV0 A;  2NS8 A;  4KT5 C;  1I3Q J;  1ZYR F;  2QEX I;  2XB5 A;  3TW6 A;  3OYK A;  1G3Y A;  2Q8K A;  1V4R A;  1MDM B;  1V54 H;  2KMU A;  3JRG A;  4BJT A;  3D5L A;  2QSH X;  5ICE A;  2MD0 A;  1GUU A;  4ZYE A;  1WKM A;  3HC7 A;  2OUM A;  3KP6 A;  2F4M B;  2KJB A;  4E7J A;  1B72 A;  4ENK A;  2K9S A;  1P2F A;  4IQJ A;  4I02 A;  5J3L A;  3TQN A;  4QWQ A;  1ZG5 A;  3ONQ A;  4Y15 A;  3BPV A;  1WJ5 A;  1S29 A;  5CVJ A;  1UB9 A;  1SC7 A;  2DYS H;  3B73 A;  1Z91 A;  2D1H A;  2E2I J;  2FNP A;  3Q5F A;  1VI0 A;  2VQH A;  2JMW A;  1RUO A;  1VF9 A;  2CS3 A;  5BPD A;  1T39 A;  1LE8 B;  3LAP A;  1OMI A;  3AG3 H;  3EUA A;  3S2W A;  1FOK A;  2R93 J;  4F93 B;  1G3T A;  1SD5 A;  3H9Q A;  2DA7 A;  4EAT A;  3KEQ A;  2K9M A;  1ETX A;  3GCM A;  1RNL A;  5EEA A;  2EIK H;  2K9N A;  4K2E A;  1R1T A;  4OAZ A;  3TDU C;  1GLN A;  2R7T A;  3B02 A;  1SFX A;  4CCJ A;  3QOD A;  2FQ4 A;  1MMS A;  3JSO A;  4B4C A;  1ZR4 A;  4I6Z A;  1P6R A;  1DU6 A;  1JUM A;  3E6M A;  3FKI J;  4RLF A;  3HUG B;  1LFP A;  4KN7 X;  4PGG A;  1KZH A;  1MMG A;  4CZZ A;  4UVB A;  3OYL A;  1JE8 A;  2V1U A;  4ZJZ A;  2DT7 B;  4I0A A;  1AU7 A;  4L9V A;  3ZQQ A;  4IX7 A;  3GTG J;  1OKR A;  2IPQ X;  5BPI A;  4PJ0 C;  3TP0 A;  4RB0 A;  2E19 A;  1WJA A;  2M0M A;  4QTR A;  2VPL A;  2HQ5 A;  4QSH A;  2ZJR F;  4IHW A;  1Z6R A;  5DD8 A;  2A3S A;  2DFH A;  2HOA A;  3NQO A;  3TMO A;  5JHF A;  2M3A A;  3CME I;  1P9Q C;  4RS8 A;  3L09 A;  4XNF A;  2B0L A;  1IAW A;  3FXK A;  1Y0U A;  2QCO A;  4XRM A;  4NC7 A;  3G3Z A;  2GAU A;  5HNF A;  1XMX A;  3CDI A;  4BJ5 C;  2COM A;  2DFF A;  2M5W A;  2DYR H;  2YS9 A;  3HM5 A;  2CO5 A;  3CC2 I;  4JX6 A;  1RIO H;  3D1N I;  2NVU B;  4QPQ A;  1YW9 A;  4FX4 A;  2PJR A;  4D7N A;  2JWT A;  3WTT C;  2EZL A;  5ILV A;  4H4K C;  3HSF A;  3F22 A;  1XMK A;  3FXR A;  1IV8 A;  3QYE A;  4HF2 A;  1ZRF A;  3SJM A;  2JQ7 A;  3DFG A;  4BU2 A;  4MO7 A;  1FSH A;  1F5T A;  2E35 A;  2HEO A;  1J5Y A;  3B6C A;  1TT0 A;  1WVR A;  3DP7 A;  3WU1 B;  2FNA A;  3SFZ A;  2CQQ A;  1T2K A;  5LHG A;  2MLK A;  1DDN A;  2CRG A;  2QKL B;  3JRB A;  1VQL I;  3R6S A;  4HV5 A;  4W1U A;  3EDP A;  3TP3 A;  4BJ6 C;  3BR2 A;  2HZT A;  1ONV A;  5GAG J;  3RJP A;  1ZG3 A;  4LB5 A;  5K5Q A;  3EYY A;  5HS7 A;  1Y1V J;  3KX2 A;  5LHH A;  4LG0 B;  2HNH A;  2M87 A;  4IPA A;  1W7P D;  4PCQ A;  2Q0O A;  2V1X A;  4G8X A;  3Q9S A;  3HHH A;  5C4X J;  1XTA A;  3HKZ A;  3LSM A;  1BW6 A;  2KLO A;  2XSJ C;  2MYS A;  1TBX A;  4XRS G;  3N4M A;  3FM3 A;  3QPT A;  2HDC A;  2HZD A;  2STT A;  3GTJ J;  2NAZ A;  3QOE A;  4P96 A;  3HBL A;  4AID A;  4X6A J;  2ISZ A;  2FBI A;  4P5O A;  4M6X A;  1BW5 A;  3NAR A;  5J8C A;  3HYI A;  1Y1W J;  4L9N A;  2HPI A;  2VLA A;  2VIX A;  1JKP C;  3IRQ A;  1T38 A;  3SHF A;  2FOK A;  2ZXJ A;  3A01 A;  3O8H A;  4BQN A;  3I3L A;  2BXZ A;  4A3L J;  4AM3 A;  2BE5 F;  3FXU A;  3WTW C;  4HEA 2;  4HOB A;  3S1N J;  3VOD A;  2KJC A;  2WTE A;  1SD7 A;  2DOD A;  4S04 A;  1EJ9 A;  3U1K A;  5DM6 F;  1VFC A;  2EK5 A;  2XIG A;  2DT6 A;  3LL7 A;  2HQR A;  2P7V B;  4B1R A;  1SMY F;  1WH5 A;  2VJ5 A;  3WHC A;  3H9J A;  4Y13 A;  2XHK A;  3GYH X;  2NVX J;  5E8G A;  3MKY B;  3GLX A;  4ASN A;  1HA8 A;  5L3E A;  4DJA A;  2KZV A;  4M72 A;  1MJ9 A;  2KT0 A;  2DDB A;  3U1D A;  4XKB A;  2VI6 A;  3KEY A;  5D5W B;  3K0L A;  2J5O A;  1UMQ A;  2XPU A;  4XN0 A;  4IKF A;  4G6T B;  4YIF A;  1EH6 A;  1O3S A;  4I2O A;  5EJC A;  1MBE A;  4BQQ A;  1I6X A;  2IA2 A;  2DFE A;  1SMT A;  4L5J A;  3ML6 A;  4NB5 A;  2RGV A;  1UHS A;  3C1D A;  4ENM A;  1YS6 A;  4HQM A;  3G1M A;  2GM4 A;  4IRI A;  1U6G A;  3CUQ B;  5FB2 A;  4EEF G;  2RV8 A;  4HX4 A;  4LB6 B;  2GXG A;  5L3G A;  4OIN F;  2ACJ A;  1TQP A;  4D7M A;  3P9I A;  1SAN A;  3GTQ J;  5KAI C;  2A6E F;  3HTS B;  3I4P A;  2P7C B;  2UZK A;  3A0B C;  5HDG A;  3VOE A;  3F9K A;  1X19 A;  3KIO A;  2NYX A;  4A93 J;  2DOE A;  4B8X A;  4E70 A;  2HDD A;  3C3W A;  2DMU A;  2DU9 A;  1A36 A;  3H36 A;  3VB2 A;  3HRM A;  3G1L A;  5LEJ A;  1TTY A;  1ZG1 A;  2EFO A;  3M07 A;  2LRD A;  1PUE E;  2JSP A;  2LG4 A;  3PSF A;  5IYD J;  2QQ8 A;  2R4G A;  3TOA A;  1BI0 A;  4EJU A;  4HNV A;  1YHQ I;  2P6T A;  3LAJ A;  1DU0 A;  3K4L A;  4II2 A;  5B5E C;  1OJL A;  3IC7 A;  2ZB9 A;  2F5V A;  2WV0 A;  5IP9 J;  3BT9 A;  3H5N A;  3S3O A;  3J7A O;  3OYG A;  5GAD J;  1V5E A;  1XGN A;  2H09 A;  2W25 A;  3E7L A;  5E17 F;  3HPH A;  1VZ0 A;  4PJL A;  2ECB A;  1FIP A;  2D1V A;  5A2Q K;  3CO7 C;  1LDK B;  2RKH A;  2EV0 A;  1T56 A;  1Y8R B;  2KRC A;  4CIC A;  2CW8 A;  4O6J A;  2HTJ A;  5L3F A;  5FD5 A;  2X6Y A;  2CYY A;  3BCB A;  4ITV A;  3CO6 C;  2IS2 A;  5B1A H;  5LGT A;  2VUM J;  1CF7 B;  3JAM K;  2K4B A;  2EZK A;  2QVO A;  5B3S H;  1WQ2 A;  4Y7N J;  4GO1 A;  4QPO A;  3WTY C;  1VQ6 I;  2HYG D;  1GXQ A;  3FBI B;  3ZMV A;  3M4O J;  4V19 K;  1TWF J;  2NOJ B;  2QZ8 A;  2Y0M A;  1A35 A;  2QUF A;  4A3E J;  5JVT A;  4KIG A;  3TDZ C;  2MLG A;  4KIT B;  1QPM A;  4BGD A;  2X4H A;  1JHH A;  5DTD A;  4G6D A;  4G6Q A;  2A69 F;  1FWZ A;  1W1W E;  1TNT A;  2H8W A;  2JZY A;  1SFK A;  6PAX A;  1JTY A;  1XGM A;  1Z3X A;  2BHY A;  4KIC A;  1DGR M;  2MW8 A;  2NXN B;  3K1M A;  2AHQ A;  3BOQ A;  4P9U A;  2M8E A;  2QSG X;  2IP2 A;  2P5V A;  4LJZ F;  4O3M A;  2E1O A;  2ZXH A;  4HZF A;  1IUY A;  3KP4 A;  3CD6 I;  2Q2E B;  1TW3 A;  1RKT A;  1FZP B;  1D8J A;  5J1U A;  2KKO A;  3MZ8 A;  3IAS 2;  4AWX B;  1OPC A;  4FHT A;  1B9N A;  2F5F A;  4LLN A;  2ME0 A;  5J6X A;  1D8K A;  3ZGK A;  1IGN A;  4F3Q A;  4QLC U;  5IP6 A;  1T0F A;  1ETV A;  2YU3 A;  3I53 A;  1FMV A;  2M7B A;  4OOI A;  3I64 A;  4XL9 A;  1HSJ A;  5F0C A;  1MDM A;  1VQ9 I;  2H6C A;  1W0T A;  2KIU A;  3RTR A;  4B48 A;  2FXA A;  2Y2Z A;  3L2C A;  3OV8 A;  2X51 A;  4EJW A;  2CQ7 A;  3TED A;  4CCK A;  2NVT J;  3DEU A;  3SDG A;  1QVT A;  1QBJ A;  2LR8 A;  3GVA A;  3HB9 A;  4JOM A;  2JA7 J;  3EUK L;  1LB2 A;  4YFN F;  2OQR A;  3TL4 X;  3R0A A;  4RGS A;  4IJA A;  4M3B A;  3I71 A;  3O3K A;  3WG9 A;  4EM1 A;  1DQU A;  3FKJ A;  4OIO F;  3HKZ N;  1BC7 C;  1LE8 A;  2MH9 A;  3SZP A;  1D1B A;  3CJN A;  4KIB A;  2H8R A;  5LLQ A;  3OS0 A;  5GAE J;  3MKZ A;  1H9G A;  2OAZ A;  5FKL A;  1FSE A;  4LK1 F;  2W82 A;  4PDK A;  2LF8 A;  1T08 B;  1FTZ A;  5JVG F;  3LSP A;  5CKT A;  4JK1 X;  2LNB A;  1QZE A;  3PL8 A;  1S5L C;  5CVV A;  2Y0S N;  3T0Y A;  3FXO A;  1RUN A;  2BY0 A;  2DPD A;  2CUZ A;  3K69 A;  2TDX A;  2P81 A;  4I76 A;  2V6C A;  3FDY A;  4Y33 A;  5HLI A;  4QIW N;  2K86 A;  1XCB A;  2DMN A;  5E3M A;  2OF7 A;  1MZB A;  2PLY A;  4KDP A;  3M8F A;  3HUG A;  4AVP A;  1V55 H;  5KNL A;  1F36 A;  3FX3 A;  2DOF A;  3ZMZ A;  2MD5 A;  3OL3 A;  2W84 A;  2Y75 A;  3MD2 A;  1I27 A;  3A01 B;  3DBR B;  3WTS C;  4PJN A;  3PUF A;  5DD4 A;  4ZTJ A;  2JA8 J;  1CGP A;  4HG2 A;  1OQY A;  3BQY A;  5K5O A;  5IYC J;  2XRO A;  3KYL A;  4M9S A;  2XPW A;  1XDU A;  3C7J A;  5F1J A;  1X4P A;  4HV6 A;  3K4C A;  3BDD A;  3OY9 A;  2BBY A;  4PZJ A;  1TP4 A;  1S7E A;  1IN6 A;  4ESF A;  3HL2 A;  2R5Z B;  4LGW A;  4E7S A;  2GA1 A;  2IGK A;  1LEA A;  2JT1 A;  2QQB A;  4FX0 A;  3REO A;  4CUG A;  2ZXW H;  1B9M A;  1Z0X A;  1RPW A;  2LD5 A;  1MND A;  3I58 A;  5E79 C;  2PX9 A;  3CLQ A;  4G12 A;  3DTK A;  1P4X A;  2EJR A;  1GV5 A;  1YRN B;  1FPQ A;  3IHU A;  5LGN A;  3OYC A;  3QYB A;  2A07 F;  2GOX B;  2O3F A;  2M30 A;  1MKM A;  3VYU B;  1KGS A;  2FOW A;  2F5E A;  3VDX A;  3PIP F;  2ESN A;  3K2Z A;  1WJC A;  1FTT A;  1IV6 A;  2FJ1 A;  4HW0 A;  2EFW A;  3GXO A;  2HQA A;  1S8N A;  5BOX A;  1UG2 A;  2DAO A;  3QP6 A;  2IVM A;  3BJA A;  2VKD A;  2FU4 A;  4JX5 A;  1YS7 A;  1Z7U A;  2CU7 A;  1BOA A;  2EFN A;  4J00 A;  3DBH B;  1LFB A;  2C6Y A;  2EBI A;  2P8T A;  2PBI A;  2LY9 A;  3GX4 X;  2DW4 A;  2R7Q A;  2NS7 A;  4L9T A;  4YII A;  2P5L C;  3H1C A;  1O57 A;  4BHC A;  3S14 J;  1RI7 A;  2DJN A;  2TCT A;  4FET A;  4BQO A;  1R22 A;  4LG0 A;  3ULQ B;  5FFZ A;  5K7Z A;  4C2T A;  2F2E A;  1ON2 A;  4U0Y A;  2EV6 A;  3KP3 A;  3HSR A;  4A3D J;  2X85 A;  1OR7 A;  1E3P A;  1NG7 A;  2ECC A;  4CGZ A;  1F1Z A;  2XGD A;  4B3A A;  5LD2 C;  3F8B A;  2KP6 A;  2P0W A;  4DGW B;  3F0C A;  3OSF A;  2RNG A;  3MWM A;  4XLA A;  1IXC A;  1XD7 A;  1R4M B;  3I5U A;  3CQZ J;  2EIL H;  5E1W A;  3ZCO A;  3W2V A;  1UFM A;  4JYK A;  1R23 A;  4GGG A;  3Q0W A;  1F4K A;  3V42 A;  1N77 A;  2V4J C;  3O6B B;  5B1B H;  3V7C A;  3KET A;  1ZRC A;  1B1B A;  2EIJ H;  1U0J A;  4HDU A;  1J59 A;  3LSR A;  1BC8 C;  4RM2 A;  1GVJ A;  2EB7 A;  2XKO A;  3CC4 I;  4XKC A;  5EG0 B;  1BI2 A;  1R1U A;  1V3F A;  5HLH A;  2O7O A;  1GT0 C;  2R7O A;  1HW1 A;  1T0F C;  4BHB A;  3F23 A;  1EF4 A;  2OCC H;  1W7P B;  1BJA A;  2DA4 A;  2QA4 I;  2AXL A;  2A5W A;  4Z2Y A;  4A0Z A;  2XUB A;  5K1Y A;  5DUK A;  3QYF A;  4Z6Y A;  2E7X A;  1IF1 A;  1VQ7 I;  3A4C A;  4MFD A;  2MSY A;  2BHZ A;  2QSF X;  3QPL A;  4XN3 A;  2DO7 A;  2HKX A;  2KL4 A;  1FT9 A;  2JA2 A;  1ZRE A;  5M3F J;  4IOA F;  3KP2 A;  2IBD A;  5D4S A;  1RR8 C;  1WJE A;  4AIJ A;  2RNJ A;  2VQC A;  4NC6 A;  4BE1 A;  5J4Y A;  2E36 A;  1XX5 A;  4NDL A;  2DXI A;  3IKT A;  3CMY A;  4LIT A;  5E18 F;  1RET A;  4MQV A;  1UG0 A;  5HOO A;  3DEE A;  3S3M A;  1LPQ A;  3SDB A;  1J7K A;  3N05 A;  3DPL C;  1WZ2 A;  1HC8 A;  1X4O A;  3K70 C;  2IA1 A;  4AVZ A;  3CUQ A;  1NHA A;  3K4J A;  4WXC A;  3HPG A;  4FIS A;  2FX0 A;  2IGO A;  4BYY A;  3MZH A;  1FLI A;  3M1E A;  3FZV A;  5HVQ C;  2PG4 A;  3HSE A;  3C2H A;  4KN4 X;  1M1E B;  3S1R J;  4XM3 A;  4P1W A;  3E1S A;  1HCR A;  4M3G A;  4B44 A;  1JKR C;  1YJ9 I;  3RPU D;  5IPA A;  4YFX F;  2CV0 A;  5F0H A;  3AFH A;  1FC3 A;  1PVE A;  2TRT A;  2CV2 A;  1MMD A;  3PIO F;  1AWC A;  1ZEL A;  3KE2 A;  3LMM A;  3EUH A;  3MMY B;  1K61 A;  2L9N A;  3FXQ A;  5HS8 A;  1W0U A;  1MBH A;  2R3S A;  2CW7 A;  3IUO A;  1PUF B;  3FHZ A;  5D5U B;  4PGH A;  5AON A;  3OSG A;  1WJF A;  2Z2S B;  3WTV C;  3N97 A;  3W6V A;  3HOU J;  2K3F A;  4IHX A;  1EH7 A;  1A5J A;  4RB1 A;  1D5Y A; 
#chains in the Genus database with same CATH homology
 2GBY A;  2W48 A;  1MNM C;  1JKP C;  5M3M J;  3A01 A;  3H0G J;  3O8H A;  3GBG A;  1MSE C;  4A3L J;  3HOX J;  2JK3 A;  3S1N J;  4XIC A;  5K7H A;  2X9D A;  4IHV A;  4D5F A;  2I10 A;  2CQX A;  3CDL A;  1VFC A;  5E3L A;  1IRZ A;  4B1R A;  1WH5 A;  4BY7 J;  3S15 J;  3WHC A;  1TWC J;  3S2D J;  3RQI A;  2XGE A;  4M3E A;  2L7F P;  5FLM J;  2NVX J;  1WGX A;  5FKO A;  3LSJ A;  2YUS A;  5J1Y A;  2KT0 A;  3ZQH A;  4XID A;  4FCY A;  2VI6 A;  4LOC A;  5EGO A;  2XPU A;  1UMQ A;  1HDP A;  5M5Y J;  1QVU A;  1RES A;  3A03 A;  3BQZ A;  1MBG A;  1MBE A;  3HOV J;  1IDY A;  1P7J A;  5FKM A;  1CQT A;  1UHS A;  4XRS A;  2ID6 A;  3BTC A;  3G1M A;  2GM4 A;  3FIW A;  1JKO C;  4EEF G;  2WB1 N;  4XK4 A;  3DEW A;  1IDZ A;  2EQR A;  3IH2 A;  3BTL A;  3OOU A;  1ZTR A;  5FKN A;  1X2M A;  3UKG A;  4M6V A;  4IEJ A;  3FIS A;  4D7M A;  3RZD J;  1SAN A;  3K7A J;  3GTQ J;  5F0F A;  4C3I J;  2X6O A;  4GFB A;  4CYC A;  1ZGW A;  4BBS J;  3S1Q J;  1RKW A;  1SFO J;  4A93 J;  2CUF A;  2HDD A;  1FIA A;  1I6H J;  1XG1 A;  2DMU A;  4A3M J;  1ETO A;  2LK2 A;  2LLK A;  3G1L A;  2JA5 J;  5IYB J;  2DA6 A;  2N8G A;  5IYD J;  3Q3S A;  1U9N A;  5F27 A;  4A3I J;  1MBJ A;  1ORK A;  1QRY A;  4A3C J;  4HNV A;  3JRD A;  1DU0 A;  4AUX A;  5DS9 A;  1OJL A;  4FE7 A;  2ZB9 A;  5IP9 J;  3BT9 A;  3JRI A;  3MVP A;  3E7L A;  2LVS A;  1A6I A;  5K7F A;  3JRC A;  2ECB A;  3FK6 A;  1FIP A;  3GTK J;  3ZQI A;  3LNQ A;  1T56 A;  4ABZ A;  2R92 J;  1E3O C;  5JLX A;  2K40 A;  3BTI A;  5C44 J;  3MN2 A;  1B8I B;  4A69 C;  2EZI A;  1X58 A;  4L5E A;  3K2A A;  2M0C A;  3PM1 A;  2VUM J;  5EZG A;  4BBR J;  3RKQ A;  2EZK A;  3HGG A;  4Y7N J;  3JRE A;  4BY1 J;  2Y9Y A;  1TWA J;  2DMP A;  5FJ8 J;  5IOY A;  5EGO B;  3M4O J;  1TWF J;  1JJ8 C;  1QPI A;  3FK7 A;  5C4J J;  4A3E J;  3HDD A;  3JRH A;  1T33 A;  2M9H A;  2WV1 A;  2H1K A;  2VKE A;  4DZP A;  5DTD A;  1BJZ A;  5GPA A;  3SFI A;  2NVQ J;  4IHY A;  3S2H J;  1WI3 A;  4Y52 J;  3LSG A;  1U9O A;  1JTY A;  2E2J J;  2M8G X;  2MW8 A;  3C2B A;  4BKX A;  2AHQ A;  2E2H J;  4UUS A;  2LP0 A;  3BG3 A;  2KDZ A;  4FE4 A;  2R5Y A;  2R5Z A;  2L7M P;  5M5X J;  2E1O A;  3DCF A;  3QQA A;  1HDD C;  1RKT A;  1MH4 A;  1AKH A;  2HOS A;  1RR7 A;  3ZOB A;  1FEX A;  5J1U A;  1NTC A;  1ZK8 A;  4A3B J;  1MBK A;  4A3K J;  1MBF A;  2ME0 A;  4MFE A;  2O8K A;  2JJ7 A;  3HEF A;  1IGN A;  2DA5 A;  4C2M J;  1WCM J;  5F04 A;  2CUE A;  4D5C A;  5IP6 A;  4CYC B;  3GTO J;  1ETV A;  4DW6 A;  2Y9Z A;  3CCY A;  1YRN A;  3PO3 J;  4A3F J;  1ZKG A;  5J1R A;  3BR5 A;  5F0C A;  1W0T A;  2Y2Z A;  3TW7 A;  3S1M J;  3L1P A;  3TED A;  2XRL A;  3IH3 A;  1AHD P;  2NVT J;  2IEK A;  3SDG A;  1QVT A;  1WH7 A;  3JR9 A;  2LR8 A;  1OCP A;  3HB9 A;  2JA7 J;  2L9R A;  3BG5 A;  3HOY J;  5GPC A;  4UUT A;  5FLV A;  1IG7 A;  2B63 J;  3I4M J;  4M3B A;  3HOZ J;  1BA5 A;  1O4X A;  2M2E A;  4MIM A;  1ZQ3 P;  3H3V K;  2LKX A;  3HKZ N;  2HI3 A;  2NVY J;  1LE8 A;  2H8R A;  4BXX J;  1GDT A;  1ITY A;  1ETQ A;  5FKL A;  3BG9 A;  3Q0V A;  4X1E A;  3S16 J;  1FTZ A;  3LSP A;  1XS9 A;  4RDU A;  2Y0S N;  2XSD C;  3GTL J;  3S17 J;  1XC5 A;  3HOW J;  2DTZ A;  1ZR2 A;  4I76 A;  2P81 A;  1TWH J;  4QIW N;  5E3O A;  1R9T J;  5E3M A;  2DMN A;  3ZQL A;  2OF7 A;  2O9L A;  5JLW A;  3Q0U A;  2JA6 J;  2HYJ A;  3BR1 A;  1F36 A;  2R7Z J;  3G1O A;  2FD5 A;  5FKK A;  2DMT A;  4DZJ A;  3A01 B;  4DYR A;  3BR0 A;  3QPS A;  1HOM A;  1BL0 A;  3JRA A;  1F43 A;  2K9Q A;  4M3D A;  2JA8 J;  4AC0 A;  3BQY A;  5IYC J;  2LTP A;  2XPW A;  5F1J A;  2EH3 A;  1K83 J;  2DN0 A;  2R0Q C;  1OFC X;  1S7E A;  2COB A;  4UUS B;  1H8A C;  2R5Y B;  1JKQ C;  2R5Z B;  2G0E A;  1NK3 P;  3ZQG A;  1Z77 A;  2L7Z A;  1U8B A;  1JT6 A;  1JT0 A;  5EG0 A;  1AKH B;  5HOD A;  1Z0X A;  1RPW A;  2LD5 A;  4S0H B;  4G12 A;  1JJ6 C;  2D5V A;  2DA1 A;  2NS8 A;  1I3Q J;  1GV5 A;  2XB5 A;  3TW6 A;  1YRN B;  3IV5 A;  5F08 A;  5GP9 A;  2YU9 J;  1Q1V A;  3JRG A;  3A02 A;  1GUU A;  1NK2 P;  2X48 A;  4FTH A;  4W97 A;  1B72 A;  1FTT A;  1IV6 A;  2FJ1 A;  2K9S A;  3WHB A;  3NAU A;  1UG2 A;  5J3L A;  2Y30 A;  1H88 C;  2RAE A;  4JX5 A;  5E3N A;  2ME6 A;  2E2I J;  3HGY A;  2CU7 A;  1VI0 A;  3M3Y J;  2JMW A;  1VF9 A;  1LFB A;  1LE8 B;  1JGG A;  2EBI A;  2R93 J;  2HXI A;  1IJW C;  2HOT A;  2DA7 A;  2LY9 A;  2NOG A;  2VPR A;  1LFU P;  4V2G A;  2NS7 A;  3ZQF A;  1ETX A;  4JX4 A;  5EEA A;  2DA2 A;  1HLV A;  2K9N A;  2VKV A;  3S14 J;  2DJN A;  1ETY A;  5IP7 J;  1ETW A;  2MG4 A;  2TCT A;  2FQ4 A;  5K7Z A;  1TWG J;  4B4C A;  1VND A;  1ZR4 A;  4I6Z A;  1B8I A;  2OPT A;  5EZH A;  2WAQ N;  3VPR A;  4A3D J;  1DU6 A;  1JUM A;  3FKI J;  1PUF A;  3B6A A;  3BR3 A;  2ECC A;  2XGD A;  4B3A A;  1MSF C;  1AU7 A;  3OSF A;  1FJL A;  3F0C A;  3GTG J;  1JTX A;  2HXO A;  5C3E J;  3CQZ J;  3TP0 A;  2Y31 A;  4JYK A;  2E19 A;  3Q0W A;  4QTR A;  2HQ5 A;  4QSH A;  1GV2 A;  4DYQ A;  1IC8 A;  1GVD A;  4IHW A;  2PMZ N;  1OCT C;  2HOA A;  3LSR A;  2DA3 A;  3IH4 A;  3O8G A;  3OIO A;  5IOZ A;  3LOC A;  2QCO A;  3MKL A;  5EG0 B;  4XRM A;  2ELK A;  2O7O A;  1GT0 C;  5EYR A;  1I50 J;  2DMQ A;  2JN6 A;  1EF4 A;  2DA4 A;  2XGC A;  2YS9 A;  3GTP J;  9ANT A;  3HM5 A;  4M3F A;  1POG A;  4JX6 A;  1H89 C;  3D1N I;  4JP0 A;  4MFD A;  2MSY A;  1HF0 A;  2M34 A;  4D7N A;  3ZQC A;  2GLO A;  3QPL A;  3RZO J;  1ETK A;  2JWT A;  5M3F J;  2IBD A;  1APL C;  2EZH A;  2EZL A;  4V2F A;  3BTJ A;  1B72 B;  1G2H A;  4NDL A;  1IUF A;  3I4N J;  4MLO A;  3BR6 A;  3CMY A;  1RET A;  4A3J J;  3SJM A;  1JUS A;  4MO7 A;  4J19 A;  2LFB A;  3B6C A;  5M5W J;  2XPV A;  2CJJ A;  2CQQ A;  4FIS A;  2FX0 A;  1ENH A;  2CRG A;  3JRB A;  4AYB N;  4W1U A;  2XB0 X;  3S1R J;  3PO2 J;  3TP3 A;  1JUP A;  3BR2 A;  2MGQ A;  1HCR A;  4M3G A;  3JRF A;  1JKR C;  5IPA A;  4A3G J;  5F0H A;  1Y1V J;  2AO9 A;  4RBO A;  2TRT A;  2QF7 A;  1WPK A;  5EDN A;  2ID3 A;  3GTM J;  4C3J J;  1K61 A;  5C4X J;  1MH3 A;  1BW6 A;  1MBH A;  1W0U A;  1P7I A;  1PUF B;  4XRS G;  3OSG A;  4C3H J;  3W6V A;  3HOU J;  3GTJ J;  2L0K A;  5EF6 A;  4IHX A;  1A5J A;  3HBL A;  1U78 A;  4X6A J;  4DYC A;  1X2N A;  2IAI A;  1D5Y A;  5BNG A;  3NAR A;  1TC3 C;  1BW5 A;  1Y1W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...