2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords ANKYRIN-REPEAT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
3ZCOA 2IW5A 3Q0VA 3M8JA 2AO9A 4F7ZA 1ZELA 4DYRA 2YU3A 1IF1A 3PNTA 2FF4A 5BNGA 3L2CA 2W1OA 2XGXA 3MAJA 4U0VA 2YU9J 1RNLA 4AIDA 4UUVA 1ORKA 1DP7P 3OSGA 2LD5A 2W25A 3TW7A 3W2VA 2KPMA 3C1DA 3L2QA 5A2QZ 1IRZA 4AM3A 1S72I 1MBFA 3CESA 2L9SA 3OS1A 1ENHA 5CQGA 2JSPA 2COBA 1QGPA 3L2RA 3IC7A 4CSWA 3HM5A 3GW2A 3ZOBA 2X6WA 1LE8A 2GXGA 3TL4X 1WJDA 4FT8A 4G7OF 4KFCA 2UXXA 3O3KA 2BY1A 4MFEA 4YG2F 4LLNA 1ZN2A 5D8KB 3ZR8X 1B4AA 5C3EJ 1G8XA 2IGKA 3JSOA 2FQ4A 3KYDB 4PJLA 2P8TA 2DI3A 5GADJ 1MBKA 2EILH 2NS7A 1XTAA 2ME0A 3PUBA 4Z6YA 2K4BA 3AAFA 1U8RA 3HB9A 1K78A 3PFIA 3TGNA 3WTSC 4P9FA 2XAFA 3ML6A 3LSRA 2KJBA 3CZ6A 2DTRA 4P1WA 2L7FP 3R0JA 4HOBA 1S7OA 3A2KA 2EFWA 1ZLJA 3E7LA 4DYQA 2LKSA 2VBZA 1R5ID 2VJJA 5C4JJ 1Z9CA 4M3FA 1SFUA 4FQGA 2NOGA 1MH4A 3ZMSA 1T95A 2ID3A 4M9SA 4RM3A 3I0TA 5HLTA 2VOOA 5J8CA 1BR1A 3OR2C 2VE8A 3CF5F 3JRHA 1NH3A 4ZDPA 3W6VA 5J3LA 4A3JJ 5E17F 2PFBA 1RUOA 2GOMA 3KFWX 3NAUA 2O0YA 1X4OA 1J2XA 4XSZF 2Z5UA 2O61A 1YOVB 3FK6A 2ZXHA 3DPLC 4IO9F 4QSHA 1OR7C 3HBLA 4P96A 3OYEA 5JFRA 5DM6F 2K85A 4BGDA 1B59A 1YIJI 3Q5FA 1PP8F 2XPUA 3BOQA 1J5YA 3V8KA 3DTEA 2HQNA 2FMLA 2L5QA 3ABKH 3FM5A 1XX5A 4WXCA 4G6DA 4RB1A 2HPMA 1KGSA 4XQFA 1KONA 2CW0F 2MG4A 4OOIA 4KYWA 1J09A 2K9SA 1UCRA 2PEXA 2WY7Q 5FKNA 3S14J 1WI3A 4AVZA 3HSEA 4DZPA 4FISA 4XOPA 4A3KJ 2L02A 3PQKA 4PSXA 4F92B 1ZG5A 5HDGA 2CWEA 1X1PA 1VQOI 1ZG1A 2E1CA 2Z3YA 4HSRA 5GP9A 3LQQA 2VC1A 3HOVJ 3CF2A 2DXIA 4BNCA 1U5TA 2R93J 1YQAA 4N9HA 2DPUA 3BJAA 3BG7A 1ETOA 2IRFG 3HXLA 3I56I 4MGRA 4NBQA 3WG7H 4OAYA 2G7UA 1KQ8A 1TQPA 4Y7NJ 3BR0A 2GQQA 5D6FA 3EUHA 4V2FA 1V54H 3BWGA 5F6FA 2IA2A 4M3EA 2PG4A 4RA2A 4OIPF 2DA1A 3D5SC 2YSRA 5HLIA 1YFHA 1PUEE 4I99C 2L0KA 2MC4A 3E1SA 4M6XA 3ONQA 3SFZA 3V8LA 4LLLA 1IGNA 1KYWA 5E18F 2B9SA 5EGOA 1HCRA 2A07F 2LRDA 4RAZA 1EKEA 3H9JA 5M5WJ 3WODF 2M34A 3LSTA 1JJ8C 3J81Z 4A69C 3OYCA 1G3YA 1I3AA 2K02A 2VL8A 3HJEA 1LEBA 1Y0NA 2OD5A 3CUQB 4WXDA 1RI7A 3MVPA 1KU3A 2GXBA 4XLPF 3HIFA 1DUXC 1BR2A 1DPRA 2QA4I 2XB5A 3G71I 1D1CA 2HOAA 2VQGA 4DJAA 4O6JA 1MGTA 1ZREA 5D4SA 4JQFA 3BLYA 3GO5A 4M73A 3ZMTA 3Q9VA 3MMYB 1X1AA 2LDUA 2D2WA 1ZQ3P 3TKYA 1QHGA 2EIJH 4D5FA 2EJRA 2JQ7A 3A02A 2CH0A 1A6IA 4KITB 2MD0A 4A93J 3RKQA 4HX8A 1S8NA 4LJZF 4C2MJ 4UVBA 1FX7A 3C7JA 1T2KA 2I8DA 4IQ4A 3TOBA 2CV0A 2CUJA 3SDBA 2IS2A 2OU2A 3MWMA 2AQFA 3QYEA 2VQLA 3WE2A 3IKTA 3KEYA 2JA7J 4MTEA 3RJPA 4LIUA 4BQAA 5JHUA 1XMXA 5FRNA 5GPCA 4YIRX 3FMSA 3J80K 2KHMA 1OCZH 2K5CA 3AG2H 4XLNF 1B72B 5FFXA 1KZHA 2WV1A 2XAQA 5L3BA 1O3RA 4E7JA 3K70C 4V19K 2IP2A 1XDUA 2A5YB 3VFZA 2DT5A 1VQ4I 4GXOA 3GFLA 3VWBA 3DKYA 2BV6A 2F2EA 1QU3A 4ON0A 1EJ9A 4PK4A 3SDGA 3PFYA 3LMMA 4HX7A 3DBHB 4XKCA 2EIKH 3BTCA 2HOEA 4ITVA 1B1BA 4BY1J 3MKYB 2R7UA 2Y48A 3QWLA 1MW7A 3CQZJ 3KP3A 4ZYEA 4BBRJ 5HNFA 1R49A 1H9TA 2FOWA 5A2QK 4G6TB 4UNOA 4KISA 2RAEA 4D7NA 4IHSA 4HNUA 2L7KA 4JK1X 4CYDA 3FHZA 3DP7A 4OMZA 2HI3A 3GUDA 5HDNA 3I59B 3DBLB 4EJTA 2Y0MA 3K4JA 1UHMA 1UELB 3DBRB 1UHWA 4PJMA 1IZ1A 1HKSA 1SAUA 1WJ5A 3LSGA 1NG6A 1SEUA 2R7QA 1ZGAA 3S93A 2YR2A 3FXMA 1SC7A 1WKMA 3S1QJ 2E2HJ 3FXJA 4HF1A 2LY1A 1MSEC 5EEHA 5BQTA 3TEDA 2CV1A 4XKVA 4II3A 2A6TA 1LVKA 1UG2A 1WHUA 4ZTFA 2EV6A 2GIZA 4UVCA 3FX3A 2QQ9A 3Q0UA 5CKTA 2CUEA 4XR6A 2CJJA 5DV5A 2CUFA 2GZWA 4E6KG 1R00A 1IRGA 3NWTA 4EJVA 2DFIA 1BL0A 5AONA 2J5PA 4RLFA 1NTCA 2V1UA 4HA8A 2DDAA 1FPQA 2WB1A 4XOTA 2VONA 4PGGA 2BXYA 2K9NA 2F48A 1HKQA 1OYYA 1K6YA 2R5YB 2F5CA 1E2XA 5K7FA 1MBGA 1R22A 2ETHA 2VKEA 4DGWB 4F93B 2I10A 2M0MA 5LBQA 3EUKL 3MKLA 2DFEA 5D4RA 1AWCA 3F6VA 3BR6A 3WTXC 1FYLA 3CO6C 3JRCA 3RIRA 4CICA 3K10A 2XPVA 2XAHA 2FBKA 3K6GA 4BXUA 3WGIA 2NVXJ 5J4VA 2ZFWA 1JKRC 3GTQJ 2X85A 4RAGA 3F8FA 1P92A 2BOLA 2NVTJ 1Z6TA 5JLWA 3SZTA 2VT3A 2O7OA 4EM2A 2LSOA 1P6RA 2B63J 3LSIA 2L2OA 4ZYDA 2CG4A 3IAS2 3ZXSA 2R4GA 3FXQA 2VPLA 1BA5A 2F5FA 5J1RA 4OIOF 4BXFA 4HZFA 3CMMA 1BJZA 5M5YJ 3KYCB 3M8FA 4IEJA 5F0FA 2O9LA 1D5VA 4HNVA 1P2FA 1VQPI 1TW3A 2VJIA 3HG9A 1WJEA 3B73A 1Z7UA 4CZCA 2XB0X 1BC8C 4WCGA 2ZMEC 1OR7A 4YFNF 4UUSB 5LRRA 3CUQA 3HHHA 1V55H 3HOUJ 3DLLF 4C9YA 3UKGA 3ZRGA 2MSYA 1WH5A 1R5GA 3M8EA 4IHTA 1SVOA 2KIFA 2JSCA 2V9PA 2E36A 3JREA 3OIQA 4FE7A 4KUMA 2LP0A 3OIOA 5DD4A 2O5RA 2EB7A 4B4CA 2GWRA 1WJAA 2P81A 4UV8A 4L5EA 2PJPA 4BHCA 2HS5A 3RDIA 2M7BA 1Y39A 3AKZA 4G8XA 5FKOA 2DK8A 3QYFA 2H8RA 2CQNA 1YX3A 5HS7A 4AIJA 2KZVA 2EFNA 1EH8A 2DMTA 3PO2J 3FKJA 2HVRA 4MTDA 1T0FA 2KJCA 3QU3A 4LG3A 2RQQA 5H6QA 2XSDC 3KIOA 4R1HA 2W48A 3K4NA 1Z7LA 2MGQA 4QWQA 2QZ8A 3Q3SA 3LSMA 2DA5A 4PUSA 3HDDA 2HQ5A 1B72A 1VNDA 2WBMA 2IS1A 3BZCA 3H35A 3JRBA 3MKZA 4UB8C 3L00A 2LOOA 4X0GA 1A36A 4XLHA 3FKIJ 1SD5A 5LRSA 2JA8J 3HOTA 1IAWA 5ERIA 4MLOA 2XAJA 4NC6A 4IX7A 2H1KA 3U2RA 4A12A 4HF0A 3BTJA 1LPQA 2R7ZJ 1FC3A 4MNUA 1FMWA 5IOYA 2GM4A 2HZDA 3EPZA 4IQJA 3GLLA 1SD6A 3SYTA 2M3AA 3TOAA 1BI0A 1J0RA 1OKRA 4BS9A 3H9GA 3I59A 1RETA 4RB3C 5CQEA 4ENJA 4W1UA 3CCSI 2BY0A 1D8KA 1B9MA 4MHGA 5J1YA 4FASD 1RUNA 4KT5C 3BROA 1DQUA 2STWA 2NNYA 1E3HA 5L3CA 2MYSA 2XF7A 2QVOA 2DK5A 1SMYF 3RPUA 4LFUA 1MJBA 4DZJA 4N0BA 2GLOA 1MIJA 2ZFUA 4XL9A 3ZQFA 3H3UA 3ECOA 1MMNA 1XD7A 3WU0A 5LGNA 2OJED 2HQRA 2OZUA 5HODA 1OYWA 1OMIA 4RDUA 3RQ4A 3SXYA 2KIQA 1BM9A 1JI8A 1IV6A 3RPQA 2NS0A 3LWFA 1UG0A 3JAMZ 3OY9A 2EFOA 3FMRA 3TO6A 1RKTA 3DXJF 2LC2A 2BE5F 4H4KC 3U1DA 1MJAA 1RPWA 3VYSB 3AFHA 4A3CJ 3GTKJ 3K4KA 5FD6A 4UVAA 3OYBA 5FD5A 1JKOC 4A2UA 3W2AA 2EWNA 5D8LB 1W36C 4PJ0C 2MW8A 4CCNA 1K4SA 3SZGA 2A68F 1DU0A 3HPGA 4XSXF 2QSGX 1FLIA 2EZLA 3H9QA 3U9GA 3OYMA 2GOXB 1M1EB 3FXRA 3JTHA 1B8IA 2R7TA 2HWVA 2MA3A 3A01B 2CFXA 3BT9A 4KA4A 2P5VA 4A6EA 1KA8A 4UY8I 1WCMJ 5TRDA 3B02A 3WTYC 4U7BA 3JSPA 2ESHA 3IP4B 2CQXA 4A3GJ 3IV5A 3QPLA 2X6YA 2RC4A 3WGGA 2AHQA 2IS6A 4E7KA 1FYKA 3CCYA 4PDKA 2VLAA 3E6BA 3ZQLA 1ETWA 3IAM2 3H5AA 3T1BA 2LVSA 3FWEA 1FEXA 2W24A 2L9VA 4XRSG 2P5KA 1G4DA 4XRSA 2Q2EB 4MEXF 5JLXA 1X2MA 2R7OA 1FNNA 2JUGA 3OS2A 3J7AY 1BW6A 1MBHA 2Q1ZB 1I5ZA 1XCBA 1AOYA 4MFDA 2VPRA 1FOWA 1KYZA 2QYOA 1ODDA 2BGCA 2CFOA 4M6YA 3JRFA 4RLQA 1SVMA 1ZKGA 3JW4A 2HOSA 3BTIA 5L3FA 2DFFA 4DOZA 3NRVA 5EZHA 4TV7A 5EG0B 2FNPA 3TMOA 5HLGA 3W6KB 5B5EC 4NQWB 4DBRA 3G3ZA 3GVAA 2Z2SB 3K1MA 1I6HJ 2WB1N 5H20A 3E6MA 1QPIA 2MLKA 1OCPA 2P6TA 2W00A 4CZZA 4GDFA 1EH7A 1F9NA 2IAIA 4RGUA 1H0MA 3PUFA 3I9V2 4HLYA 1ZARA 3HRMA 4IOCF 1POGA 3LA2A 4ENMA 2L9RA 5DCMA 1K79A 1X1BA 3H1CA 2R7VA 3J80Z 3ABTA 3AG1H 1WPKA 3M1CA 2B7EA 1ZAOA 1S7AA 5F64A 2HR3A 4S0HB 4BXXJ 1ULYA 1Q1HA 4L18B 2IBDA 1WQ2A 1XGNA 1GXQA 3RPUD 1X3UA 2JRMA 2P7CB 1O3QA 3JR9A 4KICA 4DIQA 4YEJA 1SFEA 3FZVA 3GF2A 4I0AA 5K5QA 3EDPA 2IA0A 2ZJPF 1I27A 5IPAA 5GAHJ 5BMZA 1GDTA 1QHHD 2VC0A 2ZKZA 1G3WA 1G2HA 3HL2A 3QPTA 5IP7J 2WADA 5LLQA 3LA7A 1XGOA 3MCZA 3HZJA 2GA1A 3DPUA 1OYIA 1JTXA 2COMA 1LFUP 3K70D 3B6CA 5LGUA 1ZK8A 3ISPA 2KFDA 2ZMEA 3FDYA 3C3WA 5CVIA 3BPXA 1J75A 4R8HA 3S3NA 3WG9A 1H8AC 3HYIA 5JR3A 2X51A 2VBYA 4ZDLA 1EF4A 2G7HA 3FXKA 4A3IJ 4BQQA 3U1KA 4AVPA 3HOSA 3NARA 1HC8A 5K5OA 3N05A 4HAMA 4KMFA 1ACIA 3JCUC 3HUGA 2K86A 2VIXA 4F91B 2PQ8A 1RESA 2JA6J 4NDLA 2WAFA 3VODA 3WE3A 1PP7U 2DA3A 2X0LA 4KIBA 4G9YA 1EH6A 2DJNA 2HYJA 3WU2C 3BY6A 3M7GA 3A0HC 1UB9A 3BZKA 5FLXZ 3BZ6A 4D7MA 4D1QA 1HOMA 3HKZN 3ESWB 1FIAA 4JX6A 4IHXA 3HRUA 2M30A 2NS8A 2LR8A 2JN6A 5D5XB 2PJRA 1WJBA 3KP4A 3R6SA 4CCJA 1JGSA 1GUUA 2WC2A 3EUAA 4YRVA 3V4GA 3G2BA 4N9IA 1VQ5I 2OF7A 3DTIA 4NHJA 4QLCU 3CP2A 4ENKA 3WGHA 5DS9A 1UFMA 2DO7A 3QOPA 4HDUA 3ZMZA 1MMDA 5EDNA 4LB6B 4L9NA 1MDMA 1TL8A 4E4HA 5BOXA 2DODA 5HOOA 1W7PB 2XF5A 3CUQC 4KDPA 3A01A 1EV7A 2Y9ZA 5E8GA 4BBSJ 4NC7A 1XSDA 2FBIA 3CCRI 3G6EI 3QRFF 2LLKA 2O8KA 1Z3XA 3O8HA 4OIRF 5F0CA 1OISA 3DWLE 4A0ZA 1T38A 1I50J 1XDSA 1VTNC 2R0QC 1BN5A 3JAMK 1LDJA 5J6XA 3V42A 5M5XJ 3MZYA 1MBEA 1V5FA 2D5VA 2Z1DA 3FMQA 1FTZA 2JJ7A 1TC3C 3S17J 3EETA 1TTYA 3K4MA 3P9IA 2R7RA 1APLC 1F1ZA 2X1CA 4HF2A 3JTGA 4EMSA 2Q2EA 2L9NA 2PMZA 3FF5A 1T0FC 1YLFA 2DU9A 1YYVA 2V6CA 2EIMH 4Y52J 2RDPA 1IJWC 2W57A 4A3DJ 4EGZA 2NXNB 2EV5A 4Q47A 1TZLA 3KP5A 3F8BA 4IL6C 3C18A 1D1AA 3KETA 1YI2I 1PJRA 1BI3A 3ZQ7A 2Y0SN 3FIWA 4S04A 4ETSA 4Q5SF 1MJ9A 3CJQB 1RC9A 5E1ZB 4I98B 4E7LA 1ERDA 2P6SA 4C30A 1RZ4A 1QPMA 2NVQJ 3V7CA 3KP6A 5IYDJ 4A6DA 5BS6A 5LHIA 2HKOA 5TISC 2EA4A 5HS8A 3CCUI 2L7ZA 1P7IA 1X3ZB 3K7AJ 3PSFA 1YX5A 3CJTB 3H3VK 1IN6A 1TWGJ 1X1DA 2IGMA 2XAUA 4O3MA 1FTTA 3AG4H 1EA3A 4Q4ZF 1UMQA 1I39A 4PFOA 5AIQA 4XIDA 3KEOA 1RKWA 2RQPA 4FE4A 2A69F 3GMEA 4PFPA 3E6DA 1OFCX 1GVJA 1K6OA 2MD5A 2VKVA 2VOPA 1LFBA 5GTHC 3E97A 2XIGA 1W5TA 3T8RA 2Y9YA 1ONVA 1V4RA 1XGSA 3SFIA 2IS4A 2AXLA 3OV8A 2Z9OA 4EJWA 1G3SA 4BJTA 1BBYA 1GLNA 5BPIA 2ZJ2A 3OL3A 5KK1A 4PJNA 2JT1A 2NAZA 2ECBA 2DYRH 2JVGA 2FX0A 2VXDA 3CMAI 1BC7C 2QKMB 1XMKA 3HTSB 3HEFA 3HGYA 2H6CA 2L54A 2QSFX 2M8GX 2A3SA 2ME6A 2X48A 4AYBN 1VF9A 1R58A 4LLGF 5LGTA 5B66C 4JX4A 3KLOA 2XUBA 3F8NA 1QO0D 1T33A 2O6GE 3NQOA 1YW8A 3GTLJ 1V5GA 1VFCA 2R7FA 1D1BA 5J40A 5IOZA 1F4KA 5FLVA 4A3EJ 1TQIA 2DT6A 3FBNB 4IPAA 2ZSIB 4JYKA 2F4IA 4BYYA 2Y75A 1Z1DA 3CMYA 1ETYA 2GIVA 4XN3A 2HXIA 2KMUA 3RQIA 5KAFC 1IN8A 3F3XA 3RI4A 1O57A 3PL8A 2X9DA 1TWHJ 1YW9A 3AG3H 2DMQA 4XONA 3J7ZI 5FKMA 4IRHA 3FXLA 4UHTA 4BEHB 4BHBA 1Y0UA 1Z21A 5LHGA 2JVHA 5D5UB 3N97A 5KHDA 4ZZLA 2JPCA 1QVTA 4MO7A 3IRQA 1YTYA 3LL7A 2BY2A 2JPBA 5JVTA 1ITYA 3F9KA 1RRJA 3ZPLA 4XRFA 1YJWI 2EINH 2R92J 1T56A 2V6EA 4XM3A 2OZ6A 1BIAA 3O8GA 3A0BC 2M0CA 3KE2A 2G0EA 2QWWA 5E3LA 2H8WA 4HX4A 2DW4A 5IP9J 3KZIC 2F5VA 4LGWA 1IUYA 4Y17A 4B44A 2YPRA 1YIOA 3A03A 1IN7A 2VASA 3OR1C 4NC8A 2ICWG 3CMEI 4I2OA 3CUOA 3LSHA 4BHPA 3EQLF 3BDDA 1N75A 2ZNYA 3CCLI 4EQQA 1CGPA 1LVAA 3ELKA 5FLXK 1K83J 2KKOA 3Q0WA 4P55A 1W36D 5TGTA 1SFXA 1U6GA 3BG5A 1MMGA 1R1TA 2FEZA 1W0TA 1C0WA 2AXTC 1WVRA 4KN4X 2Q0OA 1QZYA 5KVRA 2IJLA 1B9NA 3FM3A 3P5JA 3R0AA 3GEZA 1K4TA 3HOWJ 2QENA 5DDGA 1JUPA 2E60A 5F04A 4Y13A 3U21A 2FE3A 1USTA 3L2UA 1N25A 3M9AA 4BAYA 3ZQHA 5K7HA 1I3QJ 5LEKA 2UZKA 3ZGKA 3T0YA 1F5TA 2D45A 2R7WA 4YFXF 3GXOA 2TDXA 4RMNA 1AU7A 1T6SA 4OWRB 4CYCB 2CMPA 4F52A 3VPRA 2HOTA 3HOYJ 1BW5A 3RKXA 1R23A 3RSNA 3W6JB 3T5XA 5E3MA 4GGGA 4CA0A 2NOJB 2VBWA 1XCVA 3KZZA 3ZQCA 3H5RA 4C3HJ 2OCCH 3C2BA 1YHQI 4N4NB 2Q8KA 1WWXA 2HFHA 2CQKA 2A61A 2XDVA 1O3SA 4PGHA 2NRAC 1MSFC 1ETKA 1PUFB 4CCOA 3EYIA 1DP3A 4DNCA 2HDCA 5HNHA 3DEUA 3SEZA 1FJLA 1LDDA 1XN7A 2K9MA 2WWYA 2HVSA 1Z77A 5D6EA 1X19A 4U0YA 4AUXA 1BIBA 2EFPA 2E1MB 2GBYA 5FO5A 4UV9A 2CSOA 3I64A 3KX2A 2IA1A 3M4OJ 5E1WA 4C3IJ 4B3XA 1R36A 1YS7A 2XSJC 3MZ8A 3SQNA 1R6RA 2L3DA 2PMZN 3K4LA 4XBFA 3O2PE 5IYBJ 3K4BA 4BJ5C 3MZHA 1E3OC 1MH3A 3DV8A 3HKZA 4KIGA 1GHCA 3CCMI 2P0WA 1MBJA 2CW8A 3L09A 4XRMA 2FQ3A 3PIPF 1O7LA 2E5ZA 2Z16A 4WF2A 4LB5A 4L5JA 2ESNA 3OYHA 1ETVA 2BW3B 3I53A 4L5IA 2DN0A 2M7AA 3FBIB 1GV5A 4C3JJ 5E3NA 3PIOF 4Y4RA 3BR3A 4MQ9F 4ZYGA 3OYGA 1HF0A 3HOZJ 2PMHA 1YRNB 2RNJA 2V7FA 3OIPA 1HBXG 1A31A 3F22A 3C2HA 1TT0A 5LD2C 2L4MA 2HTSA 1XG1A 3GWZA 2E2JJ 1WSUA 4OAZA 2NNNA 4NNJA 1GT0C 3CP8A 3ZP5A 1L0OC 4FX4A 4A3FJ 5JI6A 1JT6A 3SZPA 4EJOA 2FXAA 4MQVA 4BEHA 2MH2A 5ICEA 4AU7A 1DDNA 2CQ7A 2I5UA 4M9ZA 4KIFA 5F0HA 3TP3A 5FJ8J 4F55A 3H0DA 1JHFA 1HSJA 5L3DA 3RZDJ 5DCFA 4E7ZA 2OA4A 3J7AO 1QZEA 2E1NA 1SD7A 3QQAA 4L0ZB 4R79A 4HW0A 1S5LC 2DOFA 4ZTJA 3OWTA 1OQYA 2VODA 3ROUA 1ZG3A 2RGVA 1X3WB 3CJRB 5ILVA 3OSFA 2BHYA 1ZLKA 1ZR4A 3OYFA 2UWMA 4LG0B 2CYYA 4IRIA 3CCJI 3PJRA 2Z33A 1LE8B 2HVQA 5J1UA 2E19A 4ZDOA 5FB2A 3TDZC 2XKOA 2R5ZB 2X1DA 1IN5A 1F43A 3D5RC 2EFQA 1HW2A 4B09A 2F5EA 3HTUA 1W5CC 4QPQA 3CJNA 4AC0A 1P4WA 3R4KA 2Y0SA 3OS0A 4Y15A 5ICFA 5F1RA 1FMVA 4FTHA 4LITA 1K78B 3I54A 2GAUA 2LKPA 4BE0A 1FP1D 1XS9A 1S29A 2K3FA 3VEPA 2DDBA 1WJFA 3OL4A 3CO7C 1X58A 2DA4A 4QPOA 1U2WA 4ENNA 2UUZA 3DEWA 2UXNA 3DF8A 2B0LA 3OYJA 4KJZA 4Q48A 2FU4A 2R5YA 1V5EA 4BJ6C 1IUFA 4HPQA 4IJAA 1Z91A 1YJNI 3BQZA 3OMYA 2VKDA 4RB0A 1BOAA 1Z05A 2CUZA 3ZMVA 4G7ZF 2IXSA 5F27A 1VQ9I 3I4PA 1E0EA 3BC8A 2MH9A 1VQKI 4XMYA 4HDVA 3S3OA 3N4MA 1E17A 1J7KA 3MFKA 2BVLA 5J4YA 1ZGWA 1HA8A 4L9VA 2ZB9A 1XPXA 1ZRFA 2KDOA 3MN2A 3V8JA 1JE8A 2ZXWH 1R9TJ 2JUCA 4FX0A 4MIMA 4IRGA 4A3LJ 2W85A 2XPWA 4EATA 2FNAA 2LFBA 1Y1WJ 1R1VA 5CVRA 2NVYJ 1ZGJA 2E2IJ 1XMAA 2E71A 2E7XA 3E5XA 2M9HA 1O7FA 4HG2A 4A5MA 4CUGA 5B3SH 3IRRA 1X2NA 3DU5A 3S2WA 5E79C 4XLCA 3E0JB 2LY2A 5HS9A 2R7XA 2E5NA 3ABLH 5E1XA 3GTOJ 4X1EA 3KZYA 2EV0A 4AYBA 1YE9A 2OV7A 4U0WA 1TWCJ 1ZYRF 2KISA 4D0PA 4BDZA 1PUFA 2DQRA 1LB2A 1FOKA 2V4JC 4UUSA 3GTJJ 3R60A 2K4JA 3LOCA 5L3EA 2KP6A 4M9XA 2CQQA 4LD5A 3DTKA 3HHGA 1U5TB 1TNSA 5CYVA 4JOMA 2HQAA 2R3SA 3FK7A 4ESFA 5HDKA 3WTVC 2QQBA 5DTDA 3D1NI 2OPTA 2VT2A 3BJ6A 5DD8A 5D5WB 2M45A 3GTPJ 2NYXA 2E35A 2O8XA 2R7DA 3IH4A 2P4WA 4X6AJ 1DU6A 4XN0A 3IL2A 2LREA 3J7YJ 1H9GA 2QSHX 4RM2A 3I58A 1CF7B 4XKBA 1BR4A 2FUG2 1IO2A 2MLGA 5IP6A 1YW7A 1QBJA 1TW2A 2JRTA 5DYMA 1KU9A 5GAGJ 4XORA 1HDPA 4I76A 3DLAA 3GZNB 3AL0B 4Y3OA 1JTYA 2VXZA 1LFPA 3GLXA 4M6VA 2R7SA 3CCQI 4WWCA 2FOKA 3G1MA 2ZO4A 2JA5J 1Q1VA 2DBBA 2BW3A 2ZNZA 4LOCA 1TLHB 2LMDA 4JBAA 3SEQA 3F72A 2O03A 1K7AA 3CCEI 3BR2A 2XVCA 2RKHA 3GZ5A 1K61A 1IXSB 2DTZA 4J00A 2LY9A 4QTRA 1FP2A 5KNLA 4B43A 2H94A 2LNBA 2DOEA 1TT5B 3BPVA 3DEEA 1PYVA 3ABMH 2A6EF 4IKFA 3ZMUA 4EJUA 4B48A 2IT0A 4P5OA 4RGSA 4G6QA 4DYCA 4H0EA 3G4SI 2QEXI 4OU0A 4BQOA 2OBPA 3S8PA 4FHTA 2IVMA 5HVQC 2ID6A 1N77A 3MD2A 2JWTA 3IUOA 2XHKA 4Y33A 2DYSH 2YX7A 2EK5A 4CCMA 2G9WA 1MKMA 5GPAA 5J47A 4LIVA 1FIPA 5FLMJ 4ZYAA 1U0JA 4RS8A 2K7LA 4B8XA 1ZRCA 2VUMJ 4LG0A 3DKXA 4ZZDA 1E3PA 2Y2ZA 3F8CA 2F5DA 3DU6A 1YO5C 2XKPA 3BJOA 5CVVA 4WK8F 3LNQA 1ZHFA 4NB5A 3CDHA 1LUJB 1OCTC 2Y31A 3GFIA 2R5ZA 4HRIA 4A3BJ 3VYUB 4PJJA 3LAJA 3ZN1A 2MABA 1I6XA 1D3YA 2WAQA 4I02A 1KQ9A 1FOXA 1MNDA 2WA0A 4KN7X 4BE1A 3WTZA 3OYDA 3WTTC 2QM3A 2YS9A 2CV2A 2X1EA 1UAAA 2ISZA 3QP5A 5M3MJ 3A4CA 4GCVA 1IDYA 4F3QA 4L9TA 1A6QA 5IY5H 3K1PA 3IH3A 3LQRA 1U9OA 2VI6A 2KL4A 2ZCWA 2LH9A 3KP2A 1SD4A 2DMPA 1FSEA 1G6NA 4WXHA 4A0YA 4YIFA 4QIWN 2EZHA 4OMYA 5DUKA 3HOXJ 1J9IA 3R61A 1IXRC 3KLNA 1FYMA 2H27A 4YIIA 2KIMA 3C2GA 1Z67A 3RKYA 3IWFA 4BH9A 2KZGA 2ZJQF 3G1OA 1MZBA 5K5RA 1T98A 1HSTA 2KLOA 2DPDA 4D5CA 4I01A 1B8IB 3CC4I 2FA5A 3H5NA 1HW1A 2NVUB 3EYYA 2JK3A 4UB6C 5B1AH 1XSXA 2VN2A 3BG6A 4GYGA 3UNGC 2L4AA 4YELA 1AA7A 1FBQA 4N4OB 1XB4A 1FSHA 4IVNA 1D0YA 2ADUA 3BCBA 1BI1A 4HV6A 4U88A 5J8FA 1F36A 4L9JA 3TO9A 2E34A 4IF4A 1MNEA 3VB2A 1I1SA 3PSIA 4M3DA 4RBOA 2N8GA 2YX4A 2ZC2A 2CGPA 2QBYB 1USSA 3IWZA 2PN6A 3FHNA 1HKTA 3QPSA 2QQ8A 3LSKA 1D0XA 2BYVE 3K2ZA 3S32A 3B6AA 3GBGA 1D8JA 5E3OA 3HC7A 5EG0A 2Y30A 4PZJA 1U78A 1A35A 2XASA 2ACJA 2ELJA 1IC8A 3F8MA 4NQWA 3BTLA 2CS3A 1LEAA 2X6OA 3QU6A 4C2TA 3DCFA 4ASNA 4A0XA 2W4SA 2ECCA 2DMNA 2FJ1A 4EGYA 2H1LA 1A04A 3K0LA 1TWFJ 3RYPA 1KQ0A 3WTUC 2EPFA 2HPIA 5DEQA 3ABUA 1JKPC 2HYFA 3TQNA 4D9JA 3HSRA 1CF7A 3BCAA 4K2EA 1SFKA 1HXDA 2VQHA 3RKWA 3KYLA 4RAFA 1IN4A 2EA2A 1BOBA 1BJAA 3K69A 4J01A 4NUBA 5IT9Z 2XAGA 2EZIA 1WRJA 1Y6IA 1WFXA 2KRCA 4IHVA 3GTGJ 4GYIA 2H09A 4ZC3A 1WJCA 3BP8A 4G7HF 3CLOA 4J19A 2V9VA 4E7HA 1LJ9A 1MNMC 1ETQA 4CXFA 5B1BH 3PQJA 3H92A 3LFKA 2DJIA 1U3EM 4IHYA 4ZH4F 2WAEA 2LF7A 2STTA 3MQ0A 3CC2I 1RR7A 2DLLA 1ZH5A 5M3FJ 1D0ZA 4G94A 1OJLA 3OOUA 1JHHA 5E8IA 2VE9A 3HGGA 3LAPA 3BR1A 4XNFA 5LFAA 3CLQA 1FT9A 1RIOH 3IHUA 3DFGA 4AD9A 3KPHA 5TJJA 1REPC 2P5LC 1X4PA 2M8EA 2O3FA 2OUMA 4PCQA 2MBFA 4OIQF 2QUFA 2L01A 3L9FA 2DFHA 3S1RJ 1GV2A 2IEKA 2LF8A 3M3YJ 4EV0A 2XRNA 1Z3YA 1FOYA 4RAYA 1HDDC 3L2VA 3HSFA 1KU2A 5ILUA 5EEAA 3A1YA 2XGEA 3V7SA 3KCCA 2WTEA 2AS5F 2H6BA 2PLYA 2HYGD 5EZGA 4IOAF 1V3FA 1ZTRA 5CLSA 1DGRM 1NHAA 3WHCA 2A5WA 4FETA 2RNGA 3GYHX 2M87A 2OQRA 1R7JA 3P9CA 1LNWA 4M3GA 1QQIA 3ERMA 3QAHA 2TRTA 4XK4A 5FGMA 4B3AA 2QGUA 3PNVA 1U8BA 1SVLA 4KMUX 1AKHB 4BU2A 3M1EA 4XKWA 2HKXA 2V26A 3ASNH 2EQRA 1P9QC 2K9QA 2RVCA 2KIUA 1GVDA 2C6YA 3FXOA 3ULQB 4Z2YA 5ED4A 4IZZA 2FMYA 3TP0A 1GXPA 4LK0F 3CD6I 2MC3A 3VYRB 1W7PA 4XICA 3JRGA 5BPDA 3TBIA 3GFJA 4CDGA 1SFOJ 4LK1F 1ZR2A 3UR3C 1FBUA 1VZ0A 1FBSA 1SAXA 4CO8A 4B1RA 4CCKA 2LBFB 4DBQA 4HYEA 2XROA 2A6HF 1H89C 5FFZA 1W4MA 3G73A 4JX5A 5IYCJ 1WGXA 1S7EA 2E1MC 2V1XA 3QPHA 2V1NA 4HQMA 1VQMI 2PBIA 1JJ6C 2KQRA 3OYIA 1AHDP 3HRSA 4ABZA 2LKXA 4V2GA 1UHSA 4M3BA 3I5UA 3NWSA 3BR5A 1YITI 3VSKA 1QNTA 4I09A 5CVUA 2KDZA 5DUIA 2WV0A 5EF6A 1MMSA 1JT0A 2F4OB 3CTAA 6PAXA 2VJ4A 3NEUA 1XC5A 3CDLA 5ICGA 1OCOH 2M5WA 4FCYA 1S3JA 3CC7I 2D1HA 2FBHA 4P9UA 1PDNC 4B47A 2XF6A 5CVJA 1IG7A 3T8TA 2M4GA 2QBYA 3WU1B 1JGGA 2WAQN 2RV8A 2EH3A 2PX9A 1HLVA 2RN7A 2A05A 2IGOA 4BL0B 3FXUA 5K1YA 3PNYA 2HNHA 3BG9A 2ELKA 2FSWA 5F1JA 3ZQQA 2LG4A 4DQ2A 4ANJA 2HXOA 4HQEA 1HW5A 1YS6A 2K3PA 4RB2C 1G59A 5JVGF 2ZJRF 3KP7A 3GZ6A 1Z6RA 2ISYA 2VJ5A 3LSPA 1XGMA 3ZQGA 3CDIA 2QF7A 2DMUA 4II2A 1NK3P 3RCOA 3WHBA 3DQVC 1FZPB 3MKWB 2OTJI 3QODA 2BY3A 1QVUA 1Y8QB 3SHFA 2CU7A 5K7ZA 4CH7A 1YJ9I 4ESJA 4I0BA 1ON2A 3BQYA 2EBIA 5KAIC 3TO7A 3W2WA 4BUPA 4DW6A 3X2QH 5KCMA 4WX9A 2J5OA 4GO1A 5EYRA 2QKLB 2HEOA 4XLEA 2BHZA 1W0UA 4U7DA 3QP6A 3DPTA 4GRIA 2TCTA 2CW7A 3OYKA 2KT0A 5FRMA 3I55I 3VSLA 2L7MP 5GAEJ 3LA3A 4HV5A 2DOAA 4M71A 3L2WA 1RR8C 2XGCA 2JMWA 2CRGA 1WI9A 3S16J 2VB6A 1Z0XA 1WH7A 2HDWA 4HSTA 2D1VA 3E5QA 5E20A 4BY7J 1T8IA 1JKQC 3GX4X 1IRFA 5CJ9A 3PM1A 3GTMJ 3F6OA 1DPUA 1OCRH 1U9NA 3KEQA 2IPQX 3S2DJ 1L3LA 1LDKB 3I3LA 2DQLA 4JP0A 4E70A 3REOA 2E1OA 2VQCA 3VYTB 2QCOA 3I4MJ 2E7WA 5DCMB 5CPRB 2QQAA 5DM7F 5IT9K 4W97A 3CCVI 2K27A 5HLHA 1W5SA 1UJ8A 2OTLI 2YUSA 1W7PD 2OC6A 5EEGA 3J81K 2HGCA 3GFMA 3SJMA 4BQNA 1VQLI 1FWZA 3HRTA 3Q9SA 2OCEA 1P4XA 3IH2A 1ETXA 5H2FC 1KU7A 2V9KA 2VBXA 4M72A 4U87A 2M4KA 4KT6A 2BEOA 2ZSHB 3IKVA 2BBYA 4CHUA 4G12A 1VI0A 3OYNA 2HZTA 3E3VA 3M07A 5ICCA 1HQCA 4IXAA 1X1CA 1R1UA 3VOEA 1JUSA 3ASOH 2W7NA 1I1GA 1VQNI 3H0GJ 3QOEA 3K4CA 4BKXA 2JZYA 3I4NJ 1JXSA 3D0SA 3P9KA 3BG3A 3GCMA 2BVMA 3RZOJ 3PO3J 1AKHA 1G3TA 1ON1A 3W3CA 4AWXB 2KRFA 2X6XA 5ILSA 3S1NJ 2ZMEB 2LYCA 9ANTA 4AIKA 5IT3A 4RGRA 1P4AA 3K9TA 2DCEA 4YFKF 2Y69H 1MMAA 4XLFA 1BI2A 3HPHA 4OINF 3HUGB 2P7VB 3I71A 3O6BB 3S15J 1TWAJ 2CO5A 4LMYA 5AIPA 3L1PA 3S1MJ 2XRLA 2GXAA 4AIHA 2XC7A 1PVEA 5C4XJ 1CQTA 4O5VA 4L0YB 2M1BA 2W82A 2UV1A 2KRHA 2VKHA 3TW6A 1U5TC 1IXCA 1TNTA 5FKKA 1TP4A 3ZN0A 2LBFA 3V7RA 1S9HA 1S6LA 3JRDA 2HU9A 3TDUC 3S3MA 1D5YA 1QZZA 1VQ6I 5LEJA 1N78A 4S05A 1LQ1A 3EUHC 1QA6A 2ZXIA 1WZ2A 1O4XA 1DGWY 1YG2A 2PJRB 5FKLA 2IGNA 1UZCA 1W1WE 2FRHA 4ESBA 3F23A 2FD5A 2EZKA 3OOPA 2F6CA 4EVIA 3WTWC 2F4MB 5LHHA 1R4NB 3AL0C 5JHFA 1H88C 1P7JA 5H6RA 5C44J 3ZQIA 1MDMB 2PMUA 4UXNA 2ZBKA 4GFBA 2BZTA 2PI0A 1R4MB 2K9LA 2DT7B 3K2AA 4CYCA 2HDDA 1R71A 1IDZA 4CGZA 4CCLA 3ERED 4PSWA 3COAC 4E7SA 3ECHA 2DA7A 2V1DA 1A5JA 3LFUA 3OYLA 2V79A 4A5NA 3VDXA 4I7HA 1TBXA 3H3ZA 4A3MJ 1NK2P 2M2EA 2W84A 2DAOA 1MD0A 3E5UA 2JTVA 3H36A 3RYRA 3OYAA 4ZYHA 3F21A 4EEFG 4ZJZA 2ELHA 2K40A 3F0CA 4HLXA 4BDYA 1OCCH 1SANA 3FISA 1J59A 2QLZA 2JA2A 3LSJA 2ZXJA 2AQEA 1O3TA 2DA6A 2GA2A 1FY7A 2LTPA 3ZMDA 4I6ZA 3D5LA 4RGXA 1QRYA 1JUMA 3G1LA 1OPCA 5FROA 1STZA 5L3GA 1NG7A 1SMTA 4M74A 1VQ7I 3MEXA 5EJCA 3DKWA 1IW7F 4BACA 1T39A 2Z99A 1IRXA 2DA2A 3E6CC 1TQMA 5EGOB 1Y8RB 3JRIA 1Y1VJ 1T08B 4E7IA 2MFZA 2LK2A 1B6AA 4EM1A 2XGDA 2RREA 2BXZA 2WY8Q 1IV8A 4HEA2 1XSVA 4XLAA 3L7WA 4C2UA 1LKXA 3JRAA 2OAZA 4HNTA 3QYBA 3P7NA 1YRNA 5F08A 5GTIC 1OLTA 3S2HJ 2X4HA 3RTRA 4HBLA 4MEYF 4EM0B 4IHWA 4UUTA 2HTJA 1R5HA 2XV4S 4BE2A 1ZRDA 1VQ8I 3K1NA 2OQGA 5D5VB 4KNYA 1Y56A
chains in the Genus database with same CATH topology
3ZCOA 1DQUA 2E60A 3M8JA 2MYSA 1ZELA 2XF7A 3U21A 3PNTA 2HPIA 2W1OA 3L2UA 4D9JA 3BCAA 3W2VA 2ZFUA 2KPMA 4XL9A 1MMNA 1SFKA 2VQHA 3L2QA 3KYLA 3ZGKA 1BOBA 3CESA 2L9SA 3OS1A 2R7WA 4NUBA 3RQ4A 4J01A 4RMNA 4OWRB 5CQGA 1JI8A 2JSPA 1Y6IA 1WFXA 2KRCA 2CMPA 4F52A 4ZC3A 1UG0A 1WJCA 3OY9A 3L2RA 4E7HA 4CSWA 3RSNA 2LC2A 4H4KC 2X6WA 3VYSB 3AFHA 4CA0A 3TL4X 1WJDA 2NOJB 3K4KA 2DJIA 3OYBA 3W2AA 3ZR8X 1W36C 3H5RA 2WAEA 4CCNA 3SZGA 3HPGA 4N4NB 1G8XA 2IGKA 3H9QA 4PJLA 2XDVA 1D0ZA 3OYMA 2GOXB 2R7TA 3OOUA 4CCOA 3PUBA 4XNFA 5LFAA 1DP3A 5HNHA 3SEZA 3CZ6A 4P1WA 2K9MA 4U7BA 2HVSA 3A2KA 1X4PA 3IP4B 2OUMA 1X19A 2X6YA 2VJJA 2IS6A 4E7KA 2E1MB 2VLAA 1Z3YA 3IAM2 3KX2A 3H5AA 1T95A 4RM3A 5HLTA 3L2VA 1BR1A 3OR2C 3A1YA 4B3XA 4ZDPA 2XSJC 2Q2EB 1DGRM 1R6RA 3K4LA 2R7OA 2JUGA 4BJ5C 3K4BA 2GOMA 3OS2A 2A5WA 3J7AY 4FETA 1X4OA 2RNGA 3HKZA 2P0WA 2Q1ZB 2CW8A 2ZXHA 3DPLC 1OR7C 3OYEA 3PNVA 4BGDA 2E5ZA 2Z16A 4BU2A 3OYHA 2CFOA 2BW3B 2M7AA 3FBIB 4RLQA 3DTEA 3OYGA 4Y4RA 2L5QA 4XKWA 4DOZA 2V26A 2HPMA 2V7FA 3OIPA 1KONA 4XQFA 1P9QC 1J09A 3TMOA 2WY7Q 3C2HA 4NQWB 1TT0A 4AVZA 4DBRA 5LD2C 2Z2SB 4XOPA 4IZZA 4OAZA 4NNJA 3CP8A 4PSXA 4F92B 2W00A 4FASD 3VYRB 3I9V2 3TBIA 4BEHA 4AU7A 4HSRA 3UR3C 1VZ0A 1X1BA 3CF2A 4CCKA 2DXIA 2R7VA 2LBFB 4DBQA 4F55A 3H0DA 3M1CA 4E7ZA 2E1MC 3BG7A 2V1NA 3RPUD 2KQRA 3HXLA 3OYIA 4R79A 4ZTJA 4OAYA 3OWTA 4DIQA 4YEJA 3CJRB 3NWSA 3VSKA 3OYFA 2UWMA 1QHHD 3D5SC 3HL2A 3PJRA 2HVQA 2WADA 3E1SA 2MC4A 2VJ4A 3ONQA 4ZDOA 2X1DA 3DPUA 2LRDA 3H9JA 3D5RC 4B47A 2XF6A 4QPQA 3K70D 2M4GA 2Y0SA 3OS0A 3OYCA 2VL8A 4BL0B 2IGOA 3PNYA 2HNHA 1FMVA 3FDYA 4LITA 3S3NA 4BE0A 1BR2A 3ZQQA 1D1CA 2LG4A 2VQGA 2X51A 4ANJA 4ZDLA 4DJAA 4BQQA 1WJFA 3OL4A 4JQFA 3BLYA 3HOSA 2K3PA 4QPOA 3MMYB 1X1AA 2UUZA 3N05A 1G59A 3OYJA 2VJ5A 2VIXA 4F91B 4KJZA 1V5EA 1QHGA 4BJ6C 4HPQA 4II2A 2CH0A 4KITB 3OMYA 3RCOA 2MD0A 3DQVC 2VKDA 2WAFA 3MKWB 2CUZA 3QODA 2IXSA 4CH7A 1E0EA 3BC8A 4XMYA 2I8DA 4IQ4A 4BUPA 3W2WA 2CUJA 3SDBA 3S3OA 2CV0A 2IS2A 5KCMA 2AQFA 3QYEA 2QKLB 4D1QA 2VQLA 4XLEA 2BVLA 3KEYA 1HA8A 4LIUA 2KDOA 5FRNA 3DPTA 2KHMA 4GRIA 2PJRA 2K5CA 1WJBA 2CW7A 3OYKA 4EATA 4CCJA 5FRMA 3VSLA 4E7JA 3K70C 3EUAA 4YRVA 3G2BA 3L2WA 2DOAA 3DTIA 3CP2A 3VWBA 4HG2A 3DKYA 2VB6A 4CUGA 2HDWA 4HSTA 3DU5A 1QU3A 4XLCA 3E0JB 2LY2A 1MMDA 2R7XA 4PK4A 2E5NA 3PFYA 3LMMA 4XKCA 4E4HA 4ITVA 4AYBA 1YE9A 2OV7A 5HOOA 3MKYB 2XF5A 4BDZA 2R7UA 1LDKB 1MW7A 3I3LA 2V4JC 5HNFA 4NC7A 2VQCA 4G6TB 3VYTB 2KP6A 5CPRB 4KISA 1Z3XA 3DTKA 4HNUA 2L7KA 4JOMA 3DWLE 2HQAA 2OC6A 3K4JA 1UELB 4BQNA 3V42A 4PJMA 1V5FA 2Z1DA 1SAUA 1WJ5A 3LSGA 1NG6A 2V9KA 3K4MA 4U87A 2M4KA 2R7QA 4KT6A 2ZSHB 4XN0A 2LREA 2R7RA 3S93A 4RM2A 2X1CA 3OYNA 4XKBA 1BR4A 1X1CA 2FUG2 2L9NA 2PMZA 2W7NA 2LY1A 1T0FC 2CV1A 4XORA 4XKVA 3QOEA 4II3A 2A6TA 3K4CA 1LVKA 3DLAA 3AL0B 1TZLA 4Y3OA 4ZTFA 2VXZA 1LFPA 1D1AA 2R7SA 1PJRA 2BVMA 5CKTA 4XR6A 3W3CA 2BW3A 2X6XA 3CJQB 4E6KG 4E7LA 1ERDA 2LYCA 4C30A 3NWTA 3SEQA 4RLFA 2DCEA 1MMAA 4XLFA 3PSFA 1YX5A 2WB1A 3HPHA 4XOTA 3HUGB 1X1DA 2IGMA 2XAUA 4J00A 1K6YA 5KNLA 4B43A 1EA3A 3DEEA 2XC7A 1PYVA 4IKFA 4PFOA 2W82A 2UV1A 4DGWB 4F93B 2KRHA 2VKHA 4B48A 2M0MA 3EUKL 4P5OA 4PFPA 2LBFA 1S9HA 2HU9A 4BQOA 3S3MA 3S8PA 5HVQC 3K10A 1N77A 3MD2A 3IUOA 4Y33A 1N78A 3K6GA 2X85A 4CCMA 3EUHC 2ZXIA 4LIVA 2BOLA 2IS4A 1DGWY 1U0JA 4ZYAA 2PJRB 4BJTA 2IGNA 1GLNA 3LSIA 2L2OA 3OL3A 3DKXA 4PJNA 3IAS2 3DU6A 3ZXSA 2F6CA 2JVGA 2R4GA 2VXDA 2VPLA 3AL0C 2QKMB 5JHFA 4BXFA 3CMMA 4HRIA 3VYUB 4PJJA 2MABA 2K9LA 2VJIA 3HG9A 1WJEA 2DT7B 2WAQA 4CZCA 1MNDA 2WA0A 4BE1A 3OYDA 4CCLA 4PSWA 4C9YA 1V5GA 4E7SA 2X1EA 2CV2A 1UAAA 3A4CA 3ZRGA 1D1BA 3LFUA 3OYLA 4F3QA 2DT6A 3FBNB 3VDXA 2ZSIB 2F4IA 2KL4A 4XN3A 2KMUA 2LH9A 3OIQA 3PL8A 2O5RA 3OYAA 1WJAA 4XONA 4ZJZA 2M7BA 4BEHB 3AKZA 1Z21A 2JVHA 4BDYA 3QYFA 3C2GA 1YX3A 5KHDA 2JA2A 2KZVA 2AQEA 3FKJA 2KLOA 2HVRA 3H5NA 3LL7A 4LG3A 3F9KA 2RQQA 2V6EA 4XM3A 3D5LA 1Z7LA 3BG6A 3K4NA 3LSMA 3UNGC 5FROA 4PUSA 1NG7A 4YELA 1AA7A 4N4OB 2WBMA 2F5VA 2IS1A 1D0YA 3BCBA 3H35A 3MKZA 4B44A 4BACA 1IRXA 2VASA 2LOOA 4X0GA 3OR1C 4NC8A 4XLHA 1MNEA 3HOTA 3PSIA 4E7IA 2MFZA 4MLOA 3LSHA 4IX7A 2RREA 2WY8Q 3FHNA 4HEA2 1FMWA 1N75A 4XLAA 4C2UA 2HZDA 1LKXA 3EPZA 3LSKA 1D0XA 4IQJA 3S32A 4HNTA 3QYBA 3SYTA 3GBGA 2M3AA 1W36D 3HC7A 5TGTA 1OLTA 3RTRA 4BS9A 2ELJA 3H9GA 1MMGA 2CS3A 4BE2A 5CQEA 4C2TA 2W4SA 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 3ZCO A;  2IW5 A;  3Q0V A;  3M8J A;  2AO9 A;  4F7Z A;  1ZEL A;  4DYR A;  2YU3 A;  1IF1 A;  3PNT A;  2FF4 A;  5BNG A;  3L2C A;  2W1O A;  2XGX A;  3MAJ A;  4U0V A;  2YU9 J;  1RNL A;  4AID A;  4UUV A;  1ORK A;  1DP7 P;  3OSG A;  2LD5 A;  2W25 A;  3TW7 A;  3W2V A;  2KPM A;  3C1D A;  3L2Q A;  5A2Q Z;  1IRZ A;  4AM3 A;  1S72 I;  1MBF A;  3CES A;  2L9S A;  3OS1 A;  1ENH A;  5CQG A;  2JSP A;  2COB A;  1QGP A;  3L2R A;  3IC7 A;  4CSW A;  3HM5 A;  3GW2 A;  3ZOB A;  2X6W A;  1LE8 A;  2GXG A;  3TL4 X;  1WJD A;  4FT8 A;  4G7O F;  4KFC A;  2UXX A;  3O3K A;  2BY1 A;  4MFE A;  4YG2 F;  4LLN A;  1ZN2 A;  5D8K B;  3ZR8 X;  1B4A A;  5C3E J;  1G8X A;  2IGK A;  3JSO A;  2FQ4 A;  3KYD B;  4PJL A;  2P8T A;  2DI3 A;  5GAD J;  1MBK A;  2EIL H;  2NS7 A;  1XTA A;  2ME0 A;  3PUB A;  4Z6Y A;  2K4B A;  3AAF A;  1U8R A;  3HB9 A;  1K78 A;  3PFI A;  3TGN A;  3WTS C;  4P9F A;  2XAF A;  3ML6 A;  3LSR A;  2KJB A;  3CZ6 A;  2DTR A;  4P1W A;  2L7F P;  3R0J A;  4HOB A;  1S7O A;  3A2K A;  2EFW A;  1ZLJ A;  3E7L A;  4DYQ A;  2LKS A;  2VBZ A;  1R5I D;  2VJJ A;  5C4J J;  1Z9C A;  4M3F A;  1SFU A;  4FQG A;  2NOG A;  1MH4 A;  3ZMS A;  1T95 A;  2ID3 A;  4M9S A;  4RM3 A;  3I0T A;  5HLT A;  2VOO A;  5J8C A;  1BR1 A;  3OR2 C;  2VE8 A;  3CF5 F;  3JRH A;  1NH3 A;  4ZDP A;  3W6V A;  5J3L A;  4A3J J;  5E17 F;  2PFB A;  1RUO A;  2GOM A;  3KFW X;  3NAU A;  2O0Y A;  1X4O A;  1J2X A;  4XSZ F;  2Z5U A;  2O61 A;  1YOV B;  3FK6 A;  2ZXH A;  3DPL C;  4IO9 F;  4QSH A;  1OR7 C;  3HBL A;  4P96 A;  3OYE A;  5JFR A;  5DM6 F;  2K85 A;  4BGD A;  1B59 A;  1YIJ I;  3Q5F A;  1PP8 F;  2XPU A;  3BOQ A;  1J5Y A;  3V8K A;  3DTE A;  2HQN A;  2FML A;  2L5Q A;  3ABK H;  3FM5 A;  1XX5 A;  4WXC A;  4G6D A;  4RB1 A;  2HPM A;  1KGS A;  4XQF A;  1KON A;  2CW0 F;  2MG4 A;  4OOI A;  4KYW A;  1J09 A;  2K9S A;  1UCR A;  2PEX A;  2WY7 Q;  5FKN A;  3S14 J;  1WI3 A;  4AVZ A;  3HSE A;  4DZP A;  4FIS A;  4XOP A;  4A3K J;  2L02 A;  3PQK A;  4PSX A;  4F92 B;  1ZG5 A;  5HDG A;  2CWE A;  1X1P A;  1VQO I;  1ZG1 A;  2E1C A;  2Z3Y A;  4HSR A;  5GP9 A;  3LQQ A;  2VC1 A;  3HOV J;  3CF2 A;  2DXI A;  4BNC A;  1U5T A;  2R93 J;  1YQA A;  4N9H A;  2DPU A;  3BJA A;  3BG7 A;  1ETO A;  2IRF G;  3HXL A;  3I56 I;  4MGR A;  4NBQ A;  3WG7 H;  4OAY A;  2G7U A;  1KQ8 A;  1TQP A;  4Y7N J;  3BR0 A;  2GQQ A;  5D6F A;  3EUH A;  4V2F A;  1V54 H;  3BWG A;  5F6F A;  2IA2 A;  4M3E A;  2PG4 A;  4RA2 A;  4OIP F;  2DA1 A;  3D5S C;  2YSR A;  5HLI A;  1YFH A;  1PUE E;  4I99 C;  2L0K A;  2MC4 A;  3E1S A;  4M6X A;  3ONQ A;  3SFZ A;  3V8L A;  4LLL A;  1IGN A;  1KYW A;  5E18 F;  2B9S A;  5EGO A;  1HCR A;  2A07 F;  2LRD A;  4RAZ A;  1EKE A;  3H9J A;  5M5W J;  3WOD F;  2M34 A;  3LST A;  1JJ8 C;  3J81 Z;  4A69 C;  3OYC A;  1G3Y A;  1I3A A;  2K02 A;  2VL8 A;  3HJE A;  1LEB A;  1Y0N A;  2OD5 A;  3CUQ B;  4WXD A;  1RI7 A;  3MVP A;  1KU3 A;  2GXB A;  4XLP F;  3HIF A;  1DUX C;  1BR2 A;  1DPR A;  2QA4 I;  2XB5 A;  3G71 I;  1D1C A;  2HOA A;  2VQG A;  4DJA A;  4O6J A;  1MGT A;  1ZRE A;  5D4S A;  4JQF A;  3BLY A;  3GO5 A;  4M73 A;  3ZMT A;  3Q9V A;  3MMY B;  1X1A A;  2LDU A;  2D2W A;  1ZQ3 P;  3TKY A;  1QHG A;  2EIJ H;  4D5F A;  2EJR A;  2JQ7 A;  3A02 A;  2CH0 A;  1A6I A;  4KIT B;  2MD0 A;  4A93 J;  3RKQ A;  4HX8 A;  1S8N A;  4LJZ F;  4C2M J;  4UVB A;  1FX7 A;  3C7J A;  1T2K A;  2I8D A;  4IQ4 A;  3TOB A;  2CV0 A;  2CUJ A;  3SDB A;  2IS2 A;  2OU2 A;  3MWM A;  2AQF A;  3QYE A;  2VQL A;  3WE2 A;  3IKT A;  3KEY A;  2JA7 J;  4MTE A;  3RJP A;  4LIU A;  4BQA A;  5JHU A;  1XMX A;  5FRN A;  5GPC A;  4YIR X;  3FMS A;  3J80 K;  2KHM A;  1OCZ H;  2K5C A;  3AG2 H;  4XLN F;  1B72 B;  5FFX A;  1KZH A;  2WV1 A;  2XAQ A;  5L3B A;  1O3R A;  4E7J A;  3K70 C;  4V19 K;  2IP2 A;  1XDU A;  2A5Y B;  3VFZ A;  2DT5 A;  1VQ4 I;  4GXO A;  3GFL A;  3VWB A;  3DKY A;  2BV6 A;  2F2E A;  1QU3 A;  4ON0 A;  1EJ9 A;  4PK4 A;  3SDG A;  3PFY A;  3LMM A;  4HX7 A;  3DBH B;  4XKC A;  2EIK H;  3BTC A;  2HOE A;  4ITV A;  1B1B A;  4BY1 J;  3MKY B;  2R7U A;  2Y48 A;  3QWL A;  1MW7 A;  3CQZ J;  3KP3 A;  4ZYE A;  4BBR J;  5HNF A;  1R49 A;  1H9T A;  2FOW A;  5A2Q K;  4G6T B;  4UNO A;  4KIS A;  2RAE A;  4D7N A;  4IHS A;  4HNU A;  2L7K A;  4JK1 X;  4CYD A;  3FHZ A;  3DP7 A;  4OMZ A;  2HI3 A;  3GUD A;  5HDN A;  3I59 B;  3DBL B;  4EJT A;  2Y0M A;  3K4J A;  1UHM A;  1UEL B;  3DBR B;  1UHW A;  4PJM A;  1IZ1 A;  1HKS A;  1SAU A;  1WJ5 A;  3LSG A;  1NG6 A;  1SEU A;  2R7Q A;  1ZGA A;  3S93 A;  2YR2 A;  3FXM A;  1SC7 A;  1WKM A;  3S1Q J;  2E2H J;  3FXJ A;  4HF1 A;  2LY1 A;  1MSE C;  5EEH A;  5BQT A;  3TED A;  2CV1 A;  4XKV A;  4II3 A;  2A6T A;  1LVK A;  1UG2 A;  1WHU A;  4ZTF A;  2EV6 A;  2GIZ A;  4UVC A;  3FX3 A;  2QQ9 A;  3Q0U A;  5CKT A;  2CUE A;  4XR6 A;  2CJJ A;  5DV5 A;  2CUF A;  2GZW A;  4E6K G;  1R00 A;  1IRG A;  3NWT A;  4EJV A;  2DFI A;  1BL0 A;  5AON A;  2J5P A;  4RLF A;  1NTC A;  2V1U A;  4HA8 A;  2DDA A;  1FPQ A;  2WB1 A;  4XOT A;  2VON A;  4PGG A;  2BXY A;  2K9N A;  2F48 A;  1HKQ A;  1OYY A;  1K6Y A;  2R5Y B;  2F5C A;  1E2X A;  5K7F A;  1MBG A;  1R22 A;  2ETH A;  2VKE A;  4DGW B;  4F93 B;  2I10 A;  2M0M A;  5LBQ A;  3EUK L;  3MKL A;  2DFE A;  5D4R A;  1AWC A;  3F6V A;  3BR6 A;  3WTX C;  1FYL A;  3CO6 C;  3JRC A;  3RIR A;  4CIC A;  3K10 A;  2XPV A;  2XAH A;  2FBK A;  3K6G A;  4BXU A;  3WGI A;  2NVX J;  5J4V A;  2ZFW A;  1JKR C;  3GTQ J;  2X85 A;  4RAG A;  3F8F A;  1P92 A;  2BOL A;  2NVT J;  1Z6T A;  5JLW A;  3SZT A;  2VT3 A;  2O7O A;  4EM2 A;  2LSO A;  1P6R A;  2B63 J;  3LSI A;  2L2O A;  4ZYD A;  2CG4 A;  3IAS 2;  3ZXS A;  2R4G A;  3FXQ A;  2VPL A;  1BA5 A;  2F5F A;  5J1R A;  4OIO F;  4BXF A;  4HZF A;  3CMM A;  1BJZ A;  5M5Y J;  3KYC B;  3M8F A;  4IEJ A;  5F0F A;  2O9L A;  1D5V A;  4HNV A;  1P2F A;  1VQP I;  1TW3 A;  2VJI A;  3HG9 A;  1WJE A;  3B73 A;  1Z7U A;  4CZC A;  2XB0 X;  1BC8 C;  4WCG A;  2ZME C;  1OR7 A;  4YFN F;  4UUS B;  5LRR A;  3CUQ A;  3HHH A;  1V55 H;  3HOU J;  3DLL F;  4C9Y A;  3UKG A;  3ZRG A;  2MSY A;  1WH5 A;  1R5G A;  3M8E A;  4IHT A;  1SVO A;  2KIF A;  2JSC A;  2V9P A;  2E36 A;  3JRE A;  3OIQ A;  4FE7 A;  4KUM A;  2LP0 A;  3OIO A;  5DD4 A;  2O5R A;  2EB7 A;  4B4C A;  2GWR A;  1WJA A;  2P81 A;  4UV8 A;  4L5E A;  2PJP A;  4BHC A;  2HS5 A;  3RDI A;  2M7B A;  1Y39 A;  3AKZ A;  4G8X A;  5FKO A;  2DK8 A;  3QYF A;  2H8R A;  2CQN A;  1YX3 A;  5HS7 A;  4AIJ A;  2KZV A;  2EFN A;  1EH8 A;  2DMT A;  3PO2 J;  3FKJ A;  2HVR A;  4MTD A;  1T0F A;  2KJC A;  3QU3 A;  4LG3 A;  2RQQ A;  5H6Q A;  2XSD C;  3KIO A;  4R1H A;  2W48 A;  3K4N A;  1Z7L A;  2MGQ A;  4QWQ A;  2QZ8 A;  3Q3S A;  3LSM A;  2DA5 A;  4PUS A;  3HDD A;  2HQ5 A;  1B72 A;  1VND A;  2WBM A;  2IS1 A;  3BZC A;  3H35 A;  3JRB A;  3MKZ A;  4UB8 C;  3L00 A;  2LOO A;  4X0G A;  1A36 A;  4XLH A;  3FKI J;  1SD5 A;  5LRS A;  2JA8 J;  3HOT A;  1IAW A;  5ERI A;  4MLO A;  2XAJ A;  4NC6 A;  4IX7 A;  2H1K A;  3U2R A;  4A12 A;  4HF0 A;  3BTJ A;  1LPQ A;  2R7Z J;  1FC3 A;  4MNU A;  1FMW A;  5IOY A;  2GM4 A;  2HZD A;  3EPZ A;  4IQJ A;  3GLL A;  1SD6 A;  3SYT A;  2M3A A;  3TOA A;  1BI0 A;  1J0R A;  1OKR A;  4BS9 A;  3H9G A;  3I59 A;  1RET A;  4RB3 C;  5CQE A;  4ENJ A;  4W1U A;  3CCS I;  2BY0 A;  1D8K A;  1B9M A;  4MHG A;  5J1Y A;  4FAS D;  1RUN A;  4KT5 C;  3BRO A;  1DQU A;  2STW A;  2NNY A;  1E3H A;  5L3C A;  2MYS A;  2XF7 A;  2QVO A;  2DK5 A;  1SMY F;  3RPU A;  4LFU A;  1MJB A;  4DZJ A;  4N0B A;  2GLO A;  1MIJ A;  2ZFU A;  4XL9 A;  3ZQF A;  3H3U A;  3ECO A;  1MMN A;  1XD7 A;  3WU0 A;  5LGN A;  2OJE D;  2HQR A;  2OZU A;  5HOD A;  1OYW A;  1OMI A;  4RDU A;  3RQ4 A;  3SXY A;  2KIQ A;  1BM9 A;  1JI8 A;  1IV6 A;  3RPQ A;  2NS0 A;  3LWF A;  1UG0 A;  3JAM Z;  3OY9 A;  2EFO A;  3FMR A;  3TO6 A;  1RKT A;  3DXJ F;  2LC2 A;  2BE5 F;  4H4K C;  3U1D A;  1MJA A;  1RPW A;  3VYS B;  3AFH A;  4A3C J;  3GTK J;  3K4K A;  5FD6 A;  4UVA A;  3OYB A;  5FD5 A;  1JKO C;  4A2U A;  3W2A A;  2EWN A;  5D8L B;  1W36 C;  4PJ0 C;  2MW8 A;  4CCN A;  1K4S A;  3SZG A;  2A68 F;  1DU0 A;  3HPG A;  4XSX F;  2QSG X;  1FLI A;  2EZL A;  3H9Q A;  3U9G A;  3OYM A;  2GOX B;  1M1E B;  3FXR A;  3JTH A;  1B8I A;  2R7T A;  2HWV A;  2MA3 A;  3A01 B;  2CFX A;  3BT9 A;  4KA4 A;  2P5V A;  4A6E A;  1KA8 A;  4UY8 I;  1WCM J;  5TRD A;  3B02 A;  3WTY C;  4U7B A;  3JSP A;  2ESH A;  3IP4 B;  2CQX A;  4A3G J;  3IV5 A;  3QPL A;  2X6Y A;  2RC4 A;  3WGG A;  2AHQ A;  2IS6 A;  4E7K A;  1FYK A;  3CCY A;  4PDK A;  2VLA A;  3E6B A;  3ZQL A;  1ETW A;  3IAM 2;  3H5A A;  3T1B A;  2LVS A;  3FWE A;  1FEX A;  2W24 A;  2L9V A;  4XRS G;  2P5K A;  1G4D A;  4XRS A;  2Q2E B;  4MEX F;  5JLX A;  1X2M A;  2R7O A;  1FNN A;  2JUG A;  3OS2 A;  3J7A Y;  1BW6 A;  1MBH A;  2Q1Z B;  1I5Z A;  1XCB A;  1AOY A;  4MFD A;  2VPR A;  1FOW A;  1KYZ A;  2QYO A;  1ODD A;  2BGC A;  2CFO A;  4M6Y A;  3JRF A;  4RLQ A;  1SVM A;  1ZKG A;  3JW4 A;  2HOS A;  3BTI A;  5L3F A;  2DFF A;  4DOZ A;  3NRV A;  5EZH A;  4TV7 A;  5EG0 B;  2FNP A;  3TMO A;  5HLG A;  3W6K B;  5B5E C;  4NQW B;  4DBR A;  3G3Z A;  3GVA A;  2Z2S B;  3K1M A;  1I6H J;  2WB1 N;  5H20 A;  3E6M A;  1QPI A;  2MLK A;  1OCP A;  2P6T A;  2W00 A;  4CZZ A;  4GDF A;  1EH7 A;  1F9N A;  2IAI A;  4RGU A;  1H0M A;  3PUF A;  3I9V 2;  4HLY A;  1ZAR A;  3HRM A;  4IOC F;  1POG A;  3LA2 A;  4ENM A;  2L9R A;  5DCM A;  1K79 A;  1X1B A;  3H1C A;  2R7V A;  3J80 Z;  3ABT A;  3AG1 H;  1WPK A;  3M1C A;  2B7E A;  1ZAO A;  1S7A A;  5F64 A;  2HR3 A;  4S0H B;  4BXX J;  1ULY A;  1Q1H A;  4L18 B;  2IBD A;  1WQ2 A;  1XGN A;  1GXQ A;  3RPU D;  1X3U A;  2JRM A;  2P7C B;  1O3Q A;  3JR9 A;  4KIC A;  4DIQ A;  4YEJ A;  1SFE A;  3FZV A;  3GF2 A;  4I0A A;  5K5Q A;  3EDP A;  2IA0 A;  2ZJP F;  1I27 A;  5IPA A;  5GAH J;  5BMZ A;  1GDT A;  1QHH D;  2VC0 A;  2ZKZ A;  1G3W A;  1G2H A;  3HL2 A;  3QPT A;  5IP7 J;  2WAD A;  5LLQ A;  3LA7 A;  1XGO A;  3MCZ A;  3HZJ A;  2GA1 A;  3DPU A;  1OYI A;  1JTX A;  2COM A;  1LFU P;  3K70 D;  3B6C A;  5LGU A;  1ZK8 A;  3ISP A;  2KFD A;  2ZME A;  3FDY A;  3C3W A;  5CVI A;  3BPX A;  1J75 A;  4R8H A;  3S3N A;  3WG9 A;  1H8A C;  3HYI A;  5JR3 A;  2X51 A;  2VBY A;  4ZDL A;  1EF4 A;  2G7H A;  3FXK A;  4A3I J;  4BQQ A;  3U1K A;  4AVP A;  3HOS A;  3NAR A;  1HC8 A;  5K5O A;  3N05 A;  4HAM A;  4KMF A;  1ACI A;  3JCU C;  3HUG A;  2K86 A;  2VIX A;  4F91 B;  2PQ8 A;  1RES A;  2JA6 J;  4NDL A;  2WAF A;  3VOD A;  3WE3 A;  1PP7 U;  2DA3 A;  2X0L A;  4KIB A;  4G9Y A;  1EH6 A;  2DJN A;  2HYJ A;  3WU2 C;  3BY6 A;  3M7G A;  3A0H C;  1UB9 A;  3BZK A;  5FLX Z;  3BZ6 A;  4D7M A;  4D1Q A;  1HOM A;  3HKZ N;  3ESW B;  1FIA A;  4JX6 A;  4IHX A;  3HRU A;  2M30 A;  2NS8 A;  2LR8 A;  2JN6 A;  5D5X B;  2PJR A;  1WJB A;  3KP4 A;  3R6S A;  4CCJ A;  1JGS A;  1GUU A;  2WC2 A;  3EUA A;  4YRV A;  3V4G A;  3G2B A;  4N9I A;  1VQ5 I;  2OF7 A;  3DTI A;  4NHJ A;  4QLC U;  3CP2 A;  4ENK A;  3WGH A;  5DS9 A;  1UFM A;  2DO7 A;  3QOP A;  4HDU A;  3ZMZ A;  1MMD A;  5EDN A;  4LB6 B;  4L9N A;  1MDM A;  1TL8 A;  4E4H A;  5BOX A;  2DOD A;  5HOO A;  1W7P B;  2XF5 A;  3CUQ C;  4KDP A;  3A01 A;  1EV7 A;  2Y9Z A;  5E8G A;  4BBS J;  4NC7 A;  1XSD A;  2FBI A;  3CCR I;  3G6E I;  3QRF F;  2LLK A;  2O8K A;  1Z3X A;  3O8H A;  4OIR F;  5F0C A;  1OIS A;  3DWL E;  4A0Z A;  1T38 A;  1I50 J;  1XDS A;  1VTN C;  2R0Q C;  1BN5 A;  3JAM K;  1LDJ A;  5J6X A;  3V42 A;  5M5X J;  3MZY A;  1MBE A;  1V5F A;  2D5V A;  2Z1D A;  3FMQ A;  1FTZ A;  2JJ7 A;  1TC3 C;  3S17 J;  3EET A;  1TTY A;  3K4M A;  3P9I A;  2R7R A;  1APL C;  1F1Z A;  2X1C A;  4HF2 A;  3JTG A;  4EMS A;  2Q2E A;  2L9N A;  2PMZ A;  3FF5 A;  1T0F C;  1YLF A;  2DU9 A;  1YYV A;  2V6C A;  2EIM H;  4Y52 J;  2RDP A;  1IJW C;  2W57 A;  4A3D J;  4EGZ A;  2NXN B;  2EV5 A;  4Q47 A;  1TZL A;  3KP5 A;  3F8B A;  4IL6 C;  3C18 A;  1D1A A;  3KET A;  1YI2 I;  1PJR A;  1BI3 A;  3ZQ7 A;  2Y0S N;  3FIW A;  4S04 A;  4ETS A;  4Q5S F;  1MJ9 A;  3CJQ B;  1RC9 A;  5E1Z B;  4I98 B;  4E7L A;  1ERD A;  2P6S A;  4C30 A;  1RZ4 A;  1QPM A;  2NVQ J;  3V7C A;  3KP6 A;  5IYD J;  4A6D A;  5BS6 A;  5LHI A;  2HKO A;  5TIS C;  2EA4 A;  5HS8 A;  3CCU I;  2L7Z A;  1P7I A;  1X3Z B;  3K7A J;  3PSF A;  1YX5 A;  3CJT B;  3H3V K;  1IN6 A;  1TWG J;  1X1D A;  2IGM A;  2XAU A;  4O3M A;  1FTT A;  3AG4 H;  1EA3 A;  4Q4Z F;  1UMQ A;  1I39 A;  4PFO A;  5AIQ A;  4XID A;  3KEO A;  1RKW A;  2RQP A;  4FE4 A;  2A69 F;  3GME A;  4PFP A;  3E6D A;  1OFC X;  1GVJ A;  1K6O A;  2MD5 A;  2VKV A;  2VOP A;  1LFB A;  5GTH C;  3E97 A;  2XIG A;  1W5T A;  3T8R A;  2Y9Y A;  1ONV A;  1V4R A;  1XGS A;  3SFI A;  2IS4 A;  2AXL A;  3OV8 A;  2Z9O A;  4EJW A;  1G3S A;  4BJT A;  1BBY A;  1GLN A;  5BPI A;  2ZJ2 A;  3OL3 A;  5KK1 A;  4PJN A;  2JT1 A;  2NAZ A;  2ECB A;  2DYR H;  2JVG A;  2FX0 A;  2VXD A;  3CMA I;  1BC7 C;  2QKM B;  1XMK A;  3HTS B;  3HEF A;  3HGY A;  2H6C A;  2L54 A;  2QSF X;  2M8G X;  2A3S A;  2ME6 A;  2X48 A;  4AYB N;  1VF9 A;  1R58 A;  4LLG F;  5LGT A;  5B66 C;  4JX4 A;  3KLO A;  2XUB A;  3F8N A;  1QO0 D;  1T33 A;  2O6G E;  3NQO A;  1YW8 A;  3GTL J;  1V5G A;  1VFC A;  2R7F A;  1D1B A;  5J40 A;  5IOZ A;  1F4K A;  5FLV A;  4A3E J;  1TQI A;  2DT6 A;  3FBN B;  4IPA A;  2ZSI B;  4JYK A;  2F4I A;  4BYY A;  2Y75 A;  1Z1D A;  3CMY A;  1ETY A;  2GIV A;  4XN3 A;  2HXI A;  2KMU A;  3RQI A;  5KAF C;  1IN8 A;  3F3X A;  3RI4 A;  1O57 A;  3PL8 A;  2X9D A;  1TWH J;  1YW9 A;  3AG3 H;  2DMQ A;  4XON A;  3J7Z I;  5FKM A;  4IRH A;  3FXL A;  4UHT A;  4BEH B;  4BHB A;  1Y0U A;  1Z21 A;  5LHG A;  2JVH A;  5D5U B;  3N97 A;  5KHD A;  4ZZL A;  2JPC A;  1QVT A;  4MO7 A;  3IRQ A;  1YTY A;  3LL7 A;  2BY2 A;  2JPB A;  5JVT A;  1ITY A;  3F9K A;  1RRJ A;  3ZPL A;  4XRF A;  1YJW I;  2EIN H;  2R92 J;  1T56 A;  2V6E A;  4XM3 A;  2OZ6 A;  1BIA A;  3O8G A;  3A0B C;  2M0C A;  3KE2 A;  2G0E A;  2QWW A;  5E3L A;  2H8W A;  4HX4 A;  2DW4 A;  5IP9 J;  3KZI C;  2F5V A;  4LGW A;  1IUY A;  4Y17 A;  4B44 A;  2YPR A;  1YIO A;  3A03 A;  1IN7 A;  2VAS A;  3OR1 C;  4NC8 A;  2ICW G;  3CME I;  4I2O A;  3CUO A;  3LSH A;  4BHP A;  3EQL F;  3BDD A;  1N75 A;  2ZNY A;  3CCL I;  4EQQ A;  1CGP A;  1LVA A;  3ELK A;  5FLX K;  1K83 J;  2KKO A;  3Q0W A;  4P55 A;  1W36 D;  5TGT A;  1SFX A;  1U6G A;  3BG5 A;  1MMG A;  1R1T A;  2FEZ A;  1W0T A;  1C0W A;  2AXT C;  1WVR A;  4KN4 X;  2Q0O A;  1QZY A;  5KVR A;  2IJL A;  1B9N A;  3FM3 A;  3P5J A;  3R0A A;  3GEZ A;  1K4T A;  3HOW J;  2QEN A;  5DDG A;  1JUP A;  2E60 A;  5F04 A;  4Y13 A;  3U21 A;  2FE3 A;  1UST A;  3L2U A;  1N25 A;  3M9A A;  4BAY A;  3ZQH A;  5K7H A;  1I3Q J;  5LEK A;  2UZK A;  3ZGK A;  3T0Y A;  1F5T A;  2D45 A;  2R7W A;  4YFX F;  3GXO A;  2TDX A;  4RMN A;  1AU7 A;  1T6S A;  4OWR B;  4CYC B;  2CMP A;  4F52 A;  3VPR A;  2HOT A;  3HOY J;  1BW5 A;  3RKX A;  1R23 A;  3RSN A;  3W6J B;  3T5X A;  5E3M A;  4GGG A;  4CA0 A;  2NOJ B;  2VBW A;  1XCV A;  3KZZ A;  3ZQC A;  3H5R A;  4C3H J;  2OCC H;  3C2B A;  1YHQ I;  4N4N B;  2Q8K A;  1WWX A;  2HFH A;  2CQK A;  2A61 A;  2XDV A;  1O3S A;  4PGH A;  2NRA C;  1MSF C;  1ETK A;  1PUF B;  4CCO A;  3EYI A;  1DP3 A;  4DNC A;  2HDC A;  5HNH A;  3DEU A;  3SEZ A;  1FJL A;  1LDD A;  1XN7 A;  2K9M A;  2WWY A;  2HVS A;  1Z77 A;  5D6E A;  1X19 A;  4U0Y A;  4AUX A;  1BIB A;  2EFP A;  2E1M B;  2GBY A;  5FO5 A;  4UV9 A;  2CSO A;  3I64 A;  3KX2 A;  2IA1 A;  3M4O J;  5E1W A;  4C3I J;  4B3X A;  1R36 A;  1YS7 A;  2XSJ C;  3MZ8 A;  3SQN A;  1R6R A;  2L3D A;  2PMZ N;  3K4L A;  4XBF A;  3O2P E;  5IYB J;  3K4B A;  4BJ5 C;  3MZH A;  1E3O C;  1MH3 A;  3DV8 A;  3HKZ A;  4KIG A;  1GHC A;  3CCM I;  2P0W A;  1MBJ A;  2CW8 A;  3L09 A;  4XRM A;  2FQ3 A;  3PIP F;  1O7L A;  2E5Z A;  2Z16 A;  4WF2 A;  4LB5 A;  4L5J A;  2ESN A;  3OYH A;  1ETV A;  2BW3 B;  3I53 A;  4L5I A;  2DN0 A;  2M7A A;  3FBI B;  1GV5 A;  4C3J J;  5E3N A;  3PIO F;  4Y4R A;  3BR3 A;  4MQ9 F;  4ZYG A;  3OYG A;  1HF0 A;  3HOZ J;  2PMH A;  1YRN B;  2RNJ A;  2V7F A;  3OIP A;  1HBX G;  1A31 A;  3F22 A;  3C2H A;  1TT0 A;  5LD2 C;  2L4M A;  2HTS A;  1XG1 A;  3GWZ A;  2E2J J;  1WSU A;  4OAZ A;  2NNN A;  4NNJ A;  1GT0 C;  3CP8 A;  3ZP5 A;  1L0O C;  4FX4 A;  4A3F J;  5JI6 A;  1JT6 A;  3SZP A;  4EJO A;  2FXA A;  4MQV A;  4BEH A;  2MH2 A;  5ICE A;  4AU7 A;  1DDN A;  2CQ7 A;  2I5U A;  4M9Z A;  4KIF A;  5F0H A;  3TP3 A;  5FJ8 J;  4F55 A;  3H0D A;  1JHF A;  1HSJ A;  5L3D A;  3RZD J;  5DCF A;  4E7Z A;  2OA4 A;  3J7A O;  1QZE A;  2E1N A;  1SD7 A;  3QQA A;  4L0Z B;  4R79 A;  4HW0 A;  1S5L C;  2DOF A;  4ZTJ A;  3OWT A;  1OQY A;  2VOD A;  3ROU A;  1ZG3 A;  2RGV A;  1X3W B;  3CJR B;  5ILV A;  3OSF A;  2BHY A;  1ZLK A;  1ZR4 A;  3OYF A;  2UWM A;  4LG0 B;  2CYY A;  4IRI A;  3CCJ I;  3PJR A;  2Z33 A;  1LE8 B;  2HVQ A;  5J1U A;  2E19 A;  4ZDO A;  5FB2 A;  3TDZ C;  2XKO A;  2R5Z B;  2X1D A;  1IN5 A;  1F43 A;  3D5R C;  2EFQ A;  1HW2 A;  4B09 A;  2F5E A;  3HTU A;  1W5C C;  4QPQ A;  3CJN A;  4AC0 A;  1P4W A;  3R4K A;  2Y0S A;  3OS0 A;  4Y15 A;  5ICF A;  5F1R A;  1FMV A;  4FTH A;  4LIT A;  1K78 B;  3I54 A;  2GAU A;  2LKP A;  4BE0 A;  1FP1 D;  1XS9 A;  1S29 A;  2K3F A;  3VEP A;  2DDB A;  1WJF A;  3OL4 A;  3CO7 C;  1X58 A;  2DA4 A;  4QPO A;  1U2W A;  4ENN A;  2UUZ A;  3DEW A;  2UXN A;  3DF8 A;  2B0L A;  3OYJ A;  4KJZ A;  4Q48 A;  2FU4 A;  2R5Y A;  1V5E A;  4BJ6 C;  1IUF A;  4HPQ A;  4IJA A;  1Z91 A;  1YJN I;  3BQZ A;  3OMY A;  2VKD A;  4RB0 A;  1BOA A;  1Z05 A;  2CUZ A;  3ZMV A;  4G7Z F;  2IXS A;  5F27 A;  1VQ9 I;  3I4P A;  1E0E A;  3BC8 A;  2MH9 A;  1VQK I;  4XMY A;  4HDV A;  3S3O A;  3N4M A;  1E17 A;  1J7K A;  3MFK A;  2BVL A;  5J4Y A;  1ZGW A;  1HA8 A;  4L9V A;  2ZB9 A;  1XPX A;  1ZRF A;  2KDO A;  3MN2 A;  3V8J A;  1JE8 A;  2ZXW H;  1R9T J;  2JUC A;  4FX0 A;  4MIM A;  4IRG A;  4A3L J;  2W85 A;  2XPW A;  4EAT A;  2FNA A;  2LFB A;  1Y1W J;  1R1V A;  5CVR A;  2NVY J;  1ZGJ A;  2E2I J;  1XMA A;  2E71 A;  2E7X A;  3E5X A;  2M9H A;  1O7F A;  4HG2 A;  4A5M A;  4CUG A;  5B3S H;  3IRR A;  1X2N A;  3DU5 A;  3S2W A;  5E79 C;  4XLC A;  3E0J B;  2LY2 A;  5HS9 A;  2R7X A;  2E5N A;  3ABL H;  5E1X A;  3GTO J;  4X1E A;  3KZY A;  2EV0 A;  4AYB A;  1YE9 A;  2OV7 A;  4U0W A;  1TWC J;  1ZYR F;  2KIS A;  4D0P A;  4BDZ A;  1PUF A;  2DQR A;  1LB2 A;  1FOK A;  2V4J C;  4UUS A;  3GTJ J;  3R60 A;  2K4J A;  3LOC A;  5L3E A;  2KP6 A;  4M9X A;  2CQQ A;  4LD5 A;  3DTK A;  3HHG A;  1U5T B;  1TNS A;  5CYV A;  4JOM A;  2HQA A;  2R3S A;  3FK7 A;  4ESF A;  5HDK A;  3WTV C;  2QQB A;  5DTD A;  3D1N I;  2OPT A;  2VT2 A;  3BJ6 A;  5DD8 A;  5D5W B;  2M45 A;  3GTP J;  2NYX A;  2E35 A;  2O8X A;  2R7D A;  3IH4 A;  2P4W A;  4X6A J;  1DU6 A;  4XN0 A;  3IL2 A;  2LRE A;  3J7Y J;  1H9G A;  2QSH X;  4RM2 A;  3I58 A;  1CF7 B;  4XKB A;  1BR4 A;  2FUG 2;  1IO2 A;  2MLG A;  5IP6 A;  1YW7 A;  1QBJ A;  1TW2 A;  2JRT A;  5DYM A;  1KU9 A;  5GAG J;  4XOR A;  1HDP A;  4I76 A;  3DLA A;  3GZN B;  3AL0 B;  4Y3O A;  1JTY A;  2VXZ A;  1LFP A;  3GLX A;  4M6V A;  2R7S A;  3CCQ I;  4WWC A;  2FOK A;  3G1M A;  2ZO4 A;  2JA5 J;  1Q1V A;  2DBB A;  2BW3 A;  2ZNZ A;  4LOC A;  1TLH B;  2LMD A;  4JBA A;  3SEQ A;  3F72 A;  2O03 A;  1K7A A;  3CCE I;  3BR2 A;  2XVC A;  2RKH A;  3GZ5 A;  1K61 A;  1IXS B;  2DTZ A;  4J00 A;  2LY9 A;  4QTR A;  1FP2 A;  5KNL A;  4B43 A;  2H94 A;  2LNB A;  2DOE A;  1TT5 B;  3BPV A;  3DEE A;  1PYV A;  3ABM H;  2A6E F;  4IKF A;  3ZMU A;  4EJU A;  4B48 A;  2IT0 A;  4P5O A;  4RGS A;  4G6Q A;  4DYC A;  4H0E A;  3G4S I;  2QEX I;  4OU0 A;  4BQO A;  2OBP A;  3S8P A;  4FHT A;  2IVM A;  5HVQ C;  2ID6 A;  1N77 A;  3MD2 A;  2JWT A;  3IUO A;  2XHK A;  4Y33 A;  2DYS H;  2YX7 A;  2EK5 A;  4CCM A;  2G9W A;  1MKM A;  5GPA A;  5J47 A;  4LIV A;  1FIP A;  5FLM J;  4ZYA A;  1U0J A;  4RS8 A;  2K7L A;  4B8X A;  1ZRC A;  2VUM J;  4LG0 A;  3DKX A;  4ZZD A;  1E3P A;  2Y2Z A;  3F8C A;  2F5D A;  3DU6 A;  1YO5 C;  2XKP A;  3BJO A;  5CVV A;  4WK8 F;  3LNQ A;  1ZHF A;  4NB5 A;  3CDH A;  1LUJ B;  1OCT C;  2Y31 A;  3GFI A;  2R5Z A;  4HRI A;  4A3B J;  3VYU B;  4PJJ A;  3LAJ A;  3ZN1 A;  2MAB A;  1I6X A;  1D3Y A;  2WAQ A;  4I02 A;  1KQ9 A;  1FOX A;  1MND A;  2WA0 A;  4KN7 X;  4BE1 A;  3WTZ A;  3OYD A;  3WTT C;  2QM3 A;  2YS9 A;  2CV2 A;  2X1E A;  1UAA A;  2ISZ A;  3QP5 A;  5M3M J;  3A4C A;  4GCV A;  1IDY A;  4F3Q A;  4L9T A;  1A6Q A;  5IY5 H;  3K1P A;  3IH3 A;  3LQR A;  1U9O A;  2VI6 A;  2KL4 A;  2ZCW A;  2LH9 A;  3KP2 A;  1SD4 A;  2DMP A;  1FSE A;  1G6N A;  4WXH A;  4A0Y A;  4YIF A;  4QIW N;  2EZH A;  4OMY A;  5DUK A;  3HOX J;  1J9I A;  3R61 A;  1IXR C;  3KLN A;  1FYM A;  2H27 A;  4YII A;  2KIM A;  3C2G A;  1Z67 A;  3RKY A;  3IWF A;  4BH9 A;  2KZG A;  2ZJQ F;  3G1O A;  1MZB A;  5K5R A;  1T98 A;  1HST A;  2KLO A;  2DPD A;  4D5C A;  4I01 A;  1B8I B;  3CC4 I;  2FA5 A;  3H5N A;  1HW1 A;  2NVU B;  3EYY A;  2JK3 A;  4UB6 C;  5B1A H;  1XSX A;  2VN2 A;  3BG6 A;  4GYG A;  3UNG C;  2L4A A;  4YEL A;  1AA7 A;  1FBQ A;  4N4O B;  1XB4 A;  1FSH A;  4IVN A;  1D0Y A;  2ADU A;  3BCB A;  1BI1 A;  4HV6 A;  4U88 A;  5J8F A;  1F36 A;  4L9J A;  3TO9 A;  2E34 A;  4IF4 A;  1MNE A;  3VB2 A;  1I1S A;  3PSI A;  4M3D A;  4RBO A;  2N8G A;  2YX4 A;  2ZC2 A;  2CGP A;  2QBY B;  1USS A;  3IWZ A;  2PN6 A;  3FHN A;  1HKT A;  3QPS A;  2QQ8 A;  3LSK A;  1D0X A;  2BYV E;  3K2Z A;  3S32 A;  3B6A A;  3GBG A;  1D8J A;  5E3O A;  3HC7 A;  5EG0 A;  2Y30 A;  4PZJ A;  1U78 A;  1A35 A;  2XAS A;  2ACJ A;  2ELJ A;  1IC8 A;  3F8M A;  4NQW A;  3BTL A;  2CS3 A;  1LEA A;  2X6O A;  3QU6 A;  4C2T A;  3DCF A;  4ASN A;  4A0X A;  2W4S A;  2ECC A;  2DMN A;  2FJ1 A;  4EGY A;  2H1L A;  1A04 A;  3K0L A;  1TWF J;  3RYP A;  1KQ0 A;  3WTU C;  2EPF A;  2HPI A;  5DEQ A;  3ABU A;  1JKP C;  2HYF A;  3TQN A;  4D9J A;  3HSR A;  1CF7 A;  3BCA A;  4K2E A;  1SFK A;  1HXD A;  2VQH A;  3RKW A;  3KYL A;  4RAF A;  1IN4 A;  2EA2 A;  1BOB A;  1BJA A;  3K69 A;  4J01 A;  4NUB A;  5IT9 Z;  2XAG A;  2EZI A;  1WRJ A;  1Y6I A;  1WFX A;  2KRC A;  4IHV A;  3GTG J;  4GYI A;  2H09 A;  4ZC3 A;  1WJC A;  3BP8 A;  4G7H F;  3CLO A;  4J19 A;  2V9V A;  4E7H A;  1LJ9 A;  1MNM C;  1ETQ A;  4CXF A;  5B1B H;  3PQJ A;  3H92 A;  3LFK A;  2DJI A;  1U3E M;  4IHY A;  4ZH4 F;  2WAE A;  2LF7 A;  2STT A;  3MQ0 A;  3CC2 I;  1RR7 A;  2DLL A;  1ZH5 A;  5M3F J;  1D0Z A;  4G94 A;  1OJL A;  3OOU A;  1JHH A;  5E8I A;  2VE9 A;  3HGG A;  3LAP A;  3BR1 A;  4XNF A;  5LFA A;  3CLQ A;  1FT9 A;  1RIO H;  3IHU A;  3DFG A;  4AD9 A;  3KPH A;  5TJJ A;  1REP C;  2P5L C;  1X4P A;  2M8E A;  2O3F A;  2OUM A;  4PCQ A;  2MBF A;  4OIQ F;  2QUF A;  2L01 A;  3L9F A;  2DFH A;  3S1R J;  1GV2 A;  2IEK A;  2LF8 A;  3M3Y J;  4EV0 A;  2XRN A;  1Z3Y A;  1FOY A;  4RAY A;  1HDD C;  3L2V A;  3HSF A;  1KU2 A;  5ILU A;  5EEA A;  3A1Y A;  2XGE A;  3V7S A;  3KCC A;  2WTE A;  2AS5 F;  2H6B A;  2PLY A;  2HYG D;  5EZG A;  4IOA F;  1V3F A;  1ZTR A;  5CLS A;  1DGR M;  1NHA A;  3WHC A;  2A5W A;  4FET A;  2RNG A;  3GYH X;  2M87 A;  2OQR A;  1R7J A;  3P9C A;  1LNW A;  4M3G A;  1QQI A;  3ERM A;  3QAH A;  2TRT A;  4XK4 A;  5FGM A;  4B3A A;  2QGU A;  3PNV A;  1U8B A;  1SVL A;  4KMU X;  1AKH B;  4BU2 A;  3M1E A;  4XKW A;  2HKX A;  2V26 A;  3ASN H;  2EQR A;  1P9Q C;  2K9Q A;  2RVC A;  2KIU A;  1GVD A;  2C6Y A;  3FXO A;  3ULQ B;  4Z2Y A;  5ED4 A;  4IZZ A;  2FMY A;  3TP0 A;  1GXP A;  4LK0 F;  3CD6 I;  2MC3 A;  3VYR B;  1W7P A;  4XIC A;  3JRG A;  5BPD A;  3TBI A;  3GFJ A;  4CDG A;  1SFO J;  4LK1 F;  1ZR2 A;  3UR3 C;  1FBU A;  1VZ0 A;  1FBS A;  1SAX A;  4CO8 A;  4B1R A;  4CCK A;  2LBF B;  4DBQ A;  4HYE A;  2XRO A;  2A6H F;  1H89 C;  5FFZ A;  1W4M A;  3G73 A;  4JX5 A;  5IYC J;  1WGX A;  1S7E A;  2E1M C;  2V1X A;  3QPH A;  2V1N A;  4HQM A;  1VQM I;  2PBI A;  1JJ6 C;  2KQR A;  3OYI A;  1AHD P;  3HRS A;  4ABZ A;  2LKX A;  4V2G A;  1UHS A;  4M3B A;  3I5U A;  3NWS A;  3BR5 A;  1YIT I;  3VSK A;  1QNT A;  4I09 A;  5CVU A;  2KDZ A;  5DUI A;  2WV0 A;  5EF6 A;  1MMS A;  1JT0 A;  2F4O B;  3CTA A;  6PAX A;  2VJ4 A;  3NEU A;  1XC5 A;  3CDL A;  5ICG A;  1OCO H;  2M5W A;  4FCY A;  1S3J A;  3CC7 I;  2D1H A;  2FBH A;  4P9U A;  1PDN C;  4B47 A;  2XF6 A;  5CVJ A;  1IG7 A;  3T8T A;  2M4G A;  2QBY A;  3WU1 B;  1JGG A;  2WAQ N;  2RV8 A;  2EH3 A;  2PX9 A;  1HLV A;  2RN7 A;  2A05 A;  2IGO A;  4BL0 B;  3FXU A;  5K1Y A;  3PNY A;  2HNH A;  3BG9 A;  2ELK A;  2FSW A;  5F1J A;  3ZQQ A;  2LG4 A;  4DQ2 A;  4ANJ A;  2HXO A;  4HQE A;  1HW5 A;  1YS6 A;  2K3P A;  4RB2 C;  1G59 A;  5JVG F;  2ZJR F;  3KP7 A;  3GZ6 A;  1Z6R A;  2ISY A;  2VJ5 A;  3LSP A;  1XGM A;  3ZQG A;  3CDI A;  2QF7 A;  2DMU A;  4II2 A;  1NK3 P;  3RCO A;  3WHB A;  3DQV C;  1FZP B;  3MKW B;  2OTJ I;  3QOD A;  2BY3 A;  1QVU A;  1Y8Q B;  3SHF A;  2CU7 A;  5K7Z A;  4CH7 A;  1YJ9 I;  4ESJ A;  4I0B A;  1ON2 A;  3BQY A;  2EBI A;  5KAI C;  3TO7 A;  3W2W A;  4BUP A;  4DW6 A;  3X2Q H;  5KCM A;  4WX9 A;  2J5O A;  4GO1 A;  5EYR A;  2QKL B;  2HEO A;  4XLE A;  2BHZ A;  1W0U A;  4U7D A;  3QP6 A;  3DPT A;  4GRI A;  2TCT A;  2CW7 A;  3OYK A;  2KT0 A;  5FRM A;  3I55 I;  3VSL A;  2L7M P;  5GAE J;  3LA3 A;  4HV5 A;  2DOA A;  4M71 A;  3L2W A;  1RR8 C;  2XGC A;  2JMW A;  2CRG A;  1WI9 A;  3S16 J;  2VB6 A;  1Z0X A;  1WH7 A;  2HDW A;  4HST A;  2D1V A;  3E5Q A;  5E20 A;  4BY7 J;  1T8I A;  1JKQ C;  3GX4 X;  1IRF A;  5CJ9 A;  3PM1 A;  3GTM J;  3F6O A;  1DPU A;  1OCR H;  1U9N A;  3KEQ A;  2IPQ X;  3S2D J;  1L3L A;  1LDK B;  3I3L A;  2DQL A;  4JP0 A;  4E70 A;  3REO A;  2E1O A;  2VQC A;  3VYT B;  2QCO A;  3I4M J;  2E7W A;  5DCM B;  5CPR B;  2QQA A;  5DM7 F;  5IT9 K;  4W97 A;  3CCV I;  2K27 A;  5HLH A;  1W5S A;  1UJ8 A;  2OTL I;  2YUS A;  1W7P D;  2OC6 A;  5EEG A;  3J81 K;  2HGC A;  3GFM A;  3SJM A;  4BQN A;  1VQL I;  1FWZ A;  3HRT A;  3Q9S A;  2OCE A;  1P4X A;  3IH2 A;  1ETX A;  5H2F C;  1KU7 A;  2V9K A;  2VBX A;  4M72 A;  4U87 A;  2M4K A;  4KT6 A;  2BEO A;  2ZSH B;  3IKV A;  2BBY A;  4CHU A;  4G12 A;  1VI0 A;  3OYN A;  2HZT A;  3E3V A;  3M07 A;  5ICC A;  1HQC A;  4IXA A;  1X1C A;  1R1U A;  3VOE A;  1JUS A;  3ASO H;  2W7N A;  1I1G A;  1VQN I;  3H0G J;  3QOE A;  3K4C A;  4BKX A;  2JZY A;  3I4N J;  1JXS A;  3D0S A;  3P9K A;  3BG3 A;  3GCM A;  2BVM A;  3RZO J;  3PO3 J;  1AKH A;  1G3T A;  1ON1 A;  3W3C A;  4AWX B;  2KRF A;  2X6X A;  5ILS A;  3S1N J;  2ZME B;  2LYC A;  9ANT A;  4AIK A;  5IT3 A;  4RGR A;  1P4A A;  3K9T A;  2DCE A;  4YFK F;  2Y69 H;  1MMA A;  4XLF A;  1BI2 A;  3HPH A;  4OIN F;  3HUG B;  2P7V B;  3I71 A;  3O6B B;  3S15 J;  1TWA J;  2CO5 A;  4LMY A;  5AIP A;  3L1P A;  3S1M J;  2XRL A;  2GXA A;  4AIH A;  2XC7 A;  1PVE A;  5C4X J;  1CQT A;  4O5V A;  4L0Y B;  2M1B A;  2W82 A;  2UV1 A;  2KRH A;  2VKH A;  3TW6 A;  1U5T C;  1IXC A;  1TNT A;  5FKK A;  1TP4 A;  3ZN0 A;  2LBF A;  3V7R A;  1S9H A;  1S6L A;  3JRD A;  2HU9 A;  3TDU C;  3S3M A;  1D5Y A;  1QZZ A;  1VQ6 I;  5LEJ A;  1N78 A;  4S05 A;  1LQ1 A;  3EUH C;  1QA6 A;  2ZXI A;  1WZ2 A;  1O4X A;  1DGW Y;  1YG2 A;  2PJR B;  5FKL A;  2IGN A;  1UZC A;  1W1W E;  2FRH A;  4ESB A;  3F23 A;  2FD5 A;  2EZK A;  3OOP A;  2F6C A;  4EVI A;  3WTW C;  2F4M B;  5LHH A;  1R4N B;  3AL0 C;  5JHF A;  1H88 C;  1P7J A;  5H6R A;  5C44 J;  3ZQI A;  1MDM B;  2PMU A;  4UXN A;  2ZBK A;  4GFB A;  2BZT A;  2PI0 A;  1R4M B;  2K9L A;  2DT7 B;  3K2A A;  4CYC A;  2HDD A;  1R71 A;  1IDZ A;  4CGZ A;  4CCL A;  3ERE D;  4PSW A;  3COA C;  4E7S A;  3ECH A;  2DA7 A;  2V1D A;  1A5J A;  3LFU A;  3OYL A;  2V79 A;  4A5N A;  3VDX A;  4I7H A;  1TBX A;  3H3Z A;  4A3M J;  1NK2 P;  2M2E A;  2W84 A;  2DAO A;  1MD0 A;  3E5U A;  2JTV A;  3H36 A;  3RYR A;  3OYA A;  4ZYH A;  3F21 A;  4EEF G;  4ZJZ A;  2ELH A;  2K40 A;  3F0C A;  4HLX A;  4BDY A;  1OCC H;  1SAN A;  3FIS A;  1J59 A;  2QLZ A;  2JA2 A;  3LSJ A;  2ZXJ A;  2AQE A;  1O3T A;  2DA6 A;  2GA2 A;  1FY7 A;  2LTP A;  3ZMD A;  4I6Z A;  3D5L A;  4RGX A;  1QRY A;  1JUM A;  3G1L A;  1OPC A;  5FRO A;  1STZ A;  5L3G A;  1NG7 A;  1SMT A;  4M74 A;  1VQ7 I;  3MEX A;  5EJC A;  3DKW A;  1IW7 F;  4BAC A;  1T39 A;  2Z99 A;  1IRX A;  2DA2 A;  3E6C C;  1TQM A;  5EGO B;  1Y8R B;  3JRI A;  1Y1V J;  1T08 B;  4E7I A;  2MFZ A;  2LK2 A;  1B6A A;  4EM1 A;  2XGD A;  2RRE A;  2BXZ A;  2WY8 Q;  1IV8 A;  4HEA 2;  1XSV A;  4XLA A;  3L7W A;  4C2U A;  1LKX A;  3JRA A;  2OAZ A;  4HNT A;  3QYB A;  3P7N A;  1YRN A;  5F08 A;  5GTI C;  1OLT A;  3S2H J;  2X4H A;  3RTR A;  4HBL A;  4MEY F;  4EM0 B;  4IHW A;  4UUT A;  2HTJ A;  1R5H A;  2XV4 S;  4BE2 A;  1ZRD A;  1VQ8 I;  3K1N A;  2OQG A;  5D5V B;  4KNY A;  1Y56 A; 
#chains in the Genus database with same CATH homology
 3ZCO A;  1DQU A;  2E60 A;  3M8J A;  2MYS A;  1ZEL A;  2XF7 A;  3U21 A;  3PNT A;  2HPI A;  2W1O A;  3L2U A;  4D9J A;  3BCA A;  3W2V A;  2ZFU A;  2KPM A;  4XL9 A;  1MMN A;  1SFK A;  2VQH A;  3L2Q A;  3KYL A;  3ZGK A;  1BOB A;  3CES A;  2L9S A;  3OS1 A;  2R7W A;  4NUB A;  3RQ4 A;  4J01 A;  4RMN A;  4OWR B;  5CQG A;  1JI8 A;  2JSP A;  1Y6I A;  1WFX A;  2KRC A;  2CMP A;  4F52 A;  4ZC3 A;  1UG0 A;  1WJC A;  3OY9 A;  3L2R A;  4E7H A;  4CSW A;  3RSN A;  2LC2 A;  4H4K C;  2X6W A;  3VYS B;  3AFH A;  4CA0 A;  3TL4 X;  1WJD A;  2NOJ B;  3K4K A;  2DJI A;  3OYB A;  3W2A A;  3ZR8 X;  1W36 C;  3H5R A;  2WAE A;  4CCN A;  3SZG A;  3HPG A;  4N4N B;  1G8X A;  2IGK A;  3H9Q A;  4PJL A;  2XDV A;  1D0Z A;  3OYM A;  2GOX B;  2R7T A;  3OOU A;  4CCO A;  3PUB A;  4XNF A;  5LFA A;  1DP3 A;  5HNH A;  3SEZ A;  3CZ6 A;  4P1W A;  2K9M A;  4U7B A;  2HVS A;  3A2K A;  1X4P A;  3IP4 B;  2OUM A;  1X19 A;  2X6Y A;  2VJJ A;  2IS6 A;  4E7K A;  2E1M B;  2VLA A;  1Z3Y A;  3IAM 2;  3KX2 A;  3H5A A;  1T95 A;  4RM3 A;  5HLT A;  3L2V A;  1BR1 A;  3OR2 C;  3A1Y A;  4B3X A;  4ZDP A;  2XSJ C;  2Q2E B;  1DGR M;  1R6R A;  3K4L A;  2R7O A;  2JUG A;  4BJ5 C;  3K4B A;  2GOM A;  3OS2 A;  2A5W A;  3J7A Y;  4FET A;  1X4O A;  2RNG A;  3HKZ A;  2P0W A;  2Q1Z B;  2CW8 A;  2ZXH A;  3DPL C;  1OR7 C;  3OYE A;  3PNV A;  4BGD A;  2E5Z A;  2Z16 A;  4BU2 A;  3OYH A;  2CFO A;  2BW3 B;  2M7A A;  3FBI B;  4RLQ A;  3DTE A;  3OYG A;  4Y4R A;  2L5Q A;  4XKW A;  4DOZ A;  2V26 A;  2HPM A;  2V7F A;  3OIP A;  1KON A;  4XQF A;  1P9Q C;  1J09 A;  3TMO A;  2WY7 Q;  3C2H A;  4NQW B;  1TT0 A;  4AVZ A;  4DBR A;  5LD2 C;  2Z2S B;  4XOP A;  4IZZ A;  4OAZ A;  4NNJ A;  3CP8 A;  4PSX A;  4F92 B;  2W00 A;  4FAS D;  3VYR B;  3I9V 2;  3TBI A;  4BEH A;  4AU7 A;  4HSR A;  3UR3 C;  1VZ0 A;  1X1B A;  3CF2 A;  4CCK A;  2DXI A;  2R7V A;  2LBF B;  4DBQ A;  4F55 A;  3H0D A;  3M1C A;  4E7Z A;  2E1M C;  3BG7 A;  2V1N A;  3RPU D;  2KQR A;  3HXL A;  3OYI A;  4R79 A;  4ZTJ A;  4OAY A;  3OWT A;  4DIQ A;  4YEJ A;  3CJR B;  3NWS A;  3VSK A;  3OYF A;  2UWM A;  1QHH D;  3D5S C;  3HL2 A;  3PJR A;  2HVQ A;  2WAD A;  3E1S A;  2MC4 A;  2VJ4 A;  3ONQ A;  4ZDO A;  2X1D A;  3DPU A;  2LRD A;  3H9J A;  3D5R C;  4B47 A;  2XF6 A;  4QPQ A;  3K70 D;  2M4G A;  2Y0S A;  3OS0 A;  3OYC A;  2VL8 A;  4BL0 B;  2IGO A;  3PNY A;  2HNH A;  1FMV A;  3FDY A;  4LIT A;  3S3N A;  4BE0 A;  1BR2 A;  3ZQQ A;  1D1C A;  2LG4 A;  2VQG A;  2X51 A;  4ANJ A;  4ZDL A;  4DJA A;  4BQQ A;  1WJF A;  3OL4 A;  4JQF A;  3BLY A;  3HOS A;  2K3P A;  4QPO A;  3MMY B;  1X1A A;  2UUZ A;  3N05 A;  1G59 A;  3OYJ A;  2VJ5 A;  2VIX A;  4F91 B;  4KJZ A;  1V5E A;  1QHG A;  4BJ6 C;  4HPQ A;  4II2 A;  2CH0 A;  4KIT B;  3OMY A;  3RCO A;  2MD0 A;  3DQV C;  2VKD A;  2WAF A;  3MKW B;  2CUZ A;  3QOD A;  2IXS A;  4CH7 A;  1E0E A;  3BC8 A;  4XMY A;  2I8D A;  4IQ4 A;  4BUP A;  3W2W A;  2CUJ A;  3SDB A;  3S3O A;  2CV0 A;  2IS2 A;  5KCM A;  2AQF A;  3QYE A;  2QKL B;  4D1Q A;  2VQL A;  4XLE A;  2BVL A;  3KEY A;  1HA8 A;  4LIU A;  2KDO A;  5FRN A;  3DPT A;  2KHM A;  4GRI A;  2PJR A;  2K5C A;  1WJB A;  2CW7 A;  3OYK A;  4EAT A;  4CCJ A;  5FRM A;  3VSL A;  4E7J A;  3K70 C;  3EUA A;  4YRV A;  3G2B A;  3L2W A;  2DOA A;  3DTI A;  3CP2 A;  3VWB A;  4HG2 A;  3DKY A;  2VB6 A;  4CUG A;  2HDW A;  4HST A;  3DU5 A;  1QU3 A;  4XLC A;  3E0J B;  2LY2 A;  1MMD A;  2R7X A;  4PK4 A;  2E5N A;  3PFY A;  3LMM A;  4XKC A;  4E4H A;  4ITV A;  4AYB A;  1YE9 A;  2OV7 A;  5HOO A;  3MKY B;  2XF5 A;  4BDZ A;  2R7U A;  1LDK B;  1MW7 A;  3I3L A;  2V4J C;  5HNF A;  4NC7 A;  2VQC A;  4G6T B;  3VYT B;  2KP6 A;  5CPR B;  4KIS A;  1Z3X A;  3DTK A;  4HNU A;  2L7K A;  4JOM A;  3DWL E;  2HQA A;  2OC6 A;  3K4J A;  1UEL B;  4BQN A;  3V42 A;  4PJM A;  1V5F A;  2Z1D A;  1SAU A;  1WJ5 A;  3LSG A;  1NG6 A;  2V9K A;  3K4M A;  4U87 A;  2M4K A;  2R7Q A;  4KT6 A;  2ZSH B;  4XN0 A;  2LRE A;  2R7R A;  3S93 A;  4RM2 A;  2X1C A;  3OYN A;  4XKB A;  1BR4 A;  1X1C A;  2FUG 2;  2L9N A;  2PMZ A;  2W7N A;  2LY1 A;  1T0F C;  2CV1 A;  4XOR A;  4XKV A;  3QOE A;  4II3 A;  2A6T A;  3K4C A;  1LVK A;  3DLA A;  3AL0 B;  1TZL A;  4Y3O A;  4ZTF A;  2VXZ A;  1LFP A;  1D1A A;  2R7S A;  1PJR A;  2BVM A;  5CKT A;  4XR6 A;  3W3C A;  2BW3 A;  2X6X A;  3CJQ B;  4E6K G;  4E7L A;  1ERD A;  2LYC A;  4C30 A;  3NWT A;  3SEQ A;  4RLF A;  2DCE A;  1MMA A;  4XLF A;  3PSF A;  1YX5 A;  2WB1 A;  3HPH A;  4XOT A;  3HUG B;  1X1D A;  2IGM A;  2XAU A;  4J00 A;  1K6Y A;  5KNL A;  4B43 A;  1EA3 A;  3DEE A;  2XC7 A;  1PYV A;  4IKF A;  4PFO A;  2W82 A;  2UV1 A;  4DGW B;  4F93 B;  2KRH A;  2VKH A;  4B48 A;  2M0M A;  3EUK L;  4P5O A;  4PFP A;  2LBF A;  1S9H A;  2HU9 A;  4BQO A;  3S3M A;  3S8P A;  5HVQ C;  3K10 A;  1N77 A;  3MD2 A;  3IUO A;  4Y33 A;  1N78 A;  3K6G A;  2X85 A;  4CCM A;  3EUH C;  2ZXI A;  4LIV A;  2BOL A;  2IS4 A;  1DGW Y;  1U0J A;  4ZYA A;  2PJR B;  4BJT A;  2IGN A;  1GLN A;  3LSI A;  2L2O A;  3OL3 A;  3DKX A;  4PJN A;  3IAS 2;  3DU6 A;  3ZXS A;  2F6C A;  2JVG A;  2R4G A;  2VXD A;  2VPL A;  3AL0 C;  2QKM B;  5JHF A;  4BXF A;  3CMM A;  4HRI A;  3VYU B;  4PJJ A;  2MAB A;  2K9L A;  2VJI A;  3HG9 A;  1WJE A;  2DT7 B;  2WAQ A;  4CZC A;  1MND A;  2WA0 A;  4BE1 A;  3OYD A;  4CCL A;  4PSW A;  4C9Y A;  1V5G A;  4E7S A;  2X1E A;  2CV2 A;  1UAA A;  3A4C A;  3ZRG A;  1D1B A;  3LFU A;  3OYL A;  4F3Q A;  2DT6 A;  3FBN B;  3VDX A;  2ZSI B;  2F4I A;  2KL4 A;  4XN3 A;  2KMU A;  2LH9 A;  3OIQ A;  3PL8 A;  2O5R A;  3OYA A;  1WJA A;  4XON A;  4ZJZ A;  2M7B A;  4BEH B;  3AKZ A;  1Z21 A;  2JVH A;  4BDY A;  3QYF A;  3C2G A;  1YX3 A;  5KHD A;  2JA2 A;  2KZV A;  2AQE A;  3FKJ A;  2KLO A;  2HVR A;  3H5N A;  3LL7 A;  4LG3 A;  3F9K A;  2RQQ A;  2V6E A;  4XM3 A;  3D5L A;  1Z7L A;  3BG6 A;  3K4N A;  3LSM A;  3UNG C;  5FRO A;  4PUS A;  1NG7 A;  4YEL A;  1AA7 A;  4N4O B;  2WBM A;  2F5V A;  2IS1 A;  1D0Y A;  3BCB A;  3H35 A;  3MKZ A;  4B44 A;  4BAC A;  1IRX A;  2VAS A;  2LOO A;  4X0G A;  3OR1 C;  4NC8 A;  4XLH A;  1MNE A;  3HOT A;  3PSI A;  4E7I A;  2MFZ A;  4MLO A;  3LSH A;  4IX7 A;  2RRE A;  2WY8 Q;  3FHN A;  4HEA 2;  1FMW A;  1N75 A;  4XLA A;  4C2U A;  2HZD A;  1LKX A;  3EPZ A;  3LSK A;  1D0X A;  4IQJ A;  3S32 A;  4HNT A;  3QYB A;  3SYT A;  3GBG A;  2M3A A;  1W36 D;  3HC7 A;  5TGT A;  1OLT A;  3RTR A;  4BS9 A;  2ELJ A;  3H9G A;  1MMG A;  2CS3 A;  4BE2 A;  5CQE A;  4C2T A;  2W4S A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...