2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Structural protein
molecule keywords ANKYRIN-REPEAT PROTEIN
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2XC7A 2W4SA
chains in the Genus database with same CATH superfamily
4MQ9F 3TO9A 2LSOA 1T39A 3S3OA 4BUPA 4XRFA 3SFIA 1T8IA 2WB1A 4CCOA 5KCMA 1SD5A 2VPRA 2PFBA 4RGRA 4E7HA 1YITI 1U9OA 5B5EC 2PMZA 3I9V2 3P9IA 3HEFA 2JA2A 5FO5A 3TEDA 2V6CA 2DA6A 2DTRA 1HQCA 3BG5A 2EFOA 3BR1A 2FSWA 4WXDA 3S2WA 5BQTA 2R7ZJ 1K7AA 3HC7A 5HDNA 5IT3A 5HLTA 2LLKA 1WJEA 4OMZA 1ZGJA 1ZRCA 4PGHA 1H8AC 3F8MA 1N25A 3FXKA 1KONA 3QPSA 4MLOA 5C3EJ 2GM4A 3A2KA 1J09A 2DT5A 2Y9YA 4NDLA 4XNFA 1T0FC 3CMAI 4MEYF 3I55I 1RIOH 2LH9A 5E3NA 4I2OA 4UUVA 1RKWA 3VSKA 3LL7A 4RAYA 2CW0F 4BQQA 3GMEA 5KK1A 2OA4A 1G6NA 5D5UB 4XK4A 4C3JJ 4BBRJ 2RGVA 1W7PA 4XICA 1BI3A 2EIKH 3CUQC 1JHFA 3CMYA 1VQOI 1K78A 1UELB 3BR5A 2Y0SN 4M9XA 1OJLA 1HF0A 3BR0A 2VOPA 3NARA 1K61A 2A61A 2H6CA 4IOCF 2CUJA 1JKQC 2IS1A 3DBLB 4ESBA 2GBYA 1R58A 3FISA 4F91B 1I27A 2M34A 4HDUA 4IRIA 4LG3A 1QA6A 2HPIA 1P9QC 2EIMH 2LK2A 3OMYA 4J01A 3KFWX 2QUFA 2QVOA 4FISA 2UXNA 3G1LA 1MW7A 1UHWA 2LDUA 3D0SA 5H20A 3HSFA 2IS2A 2DTZA 1UAAA 2LBFB 4XLCA 1W0TA 2W82A 3E5UA 2HVSA 2H94A 2BY1A 1V5GA 1XMXA 3LSIA 5CVJA 3HOXJ 2XROA 1YS6A 4PJ0C 1K79A 3A4CA 3ELKA 1EF4A 5KAIC 2EB7A 1J0RA 1HW2A 1SAUA 1N78A 1TNSA 3VYRB 1VNDA 2K4BA 3M8FA 2DDAA 3ISPA 4IX7A 2E2JJ 2LTPA 2ELKA 2XIGA 1I6XA 4Z2YA 2DAOA 4DBQA 4RAFA 2VUMJ 2K27A 2MH2A 2M2EA 2F5EA 1J9IA 1ZKGA 2BOLA 3W2VA 3PNVA 2QLZA 2ECBA 2M4GA 4BE2A 4OIPF 2VJ5A 3MEXA 3QOEA 4B44A 2ZSHB 3O8GA 1KU7A 3BJAA 2HVQA 2DLLA 3VODA 1U5TB 1BR1A 3WTSC 3I0TA 4GYIA 4CYDA 5DYMA 2HQNA 3FBNB 4AYBN 4BKXA 2HOEA 2DO7A 1IO2A 2GIZA 1S6LA 2VLAA 3ZQ7A 3EETA 1P7JA 4JX5A 3I58A 3A03A 3W2WA 1OCCH 1FNNA 2OAZA 3DF8A 1WH7A 2CJJA 4HOBA 4D9JA 3TBIA 2IS4A 1TT5B 1R00A 2WTEA 2EH3A 3K4MA 3W6JB 1Z6TA 5CKTA 5F6FA 2V1XA 2Q8KA 1RRJA 1SFUA 1FYLA 4U87A 4XN0A 1QGPA 3HBLA 1FBSA 3G73A 3BTJA 3HTUA 2RC4A 3GXOA 1PJRA 5E3MA 2ZC2A 2QSGX 2VKVA 4E7SA 2L02A 3MFKA 2Y31A 3CCSI 3DV8A 3HB9A 4YFNF 1OFCX 2DK8A 1FY7A 4LOCA 5LEJA 3I56I 2G9WA 2KIMA 3IKTA 3JRCA 2O61A 3OR1C 5E79C 4LLNA 2KHMA 3L2UA 2UZKA 1KU9A 2XF7A 5D5WB 2VBXA 3DQVC 3EQLF 2VE8A 3IWZA 5CPRB 4BHCA 2LY9A 3ABMH 4IQJA 2K9QA 1EJ9A 4AWXB 4XLEA 2K85A 4A12A 2E2IJ 3OL3A 3H92A 4NUBA 2HPMA 4OWRB 2DMNA 2XPUA 3OV8A 2R7UA 4HLYA 2VBWA 1GDTA 3GLXA 4G7ZF 4LJZF 4EVIA 3RTRA 1BIBA 3MCZA 2MBFA 2COBA 3CMEI 1B8IA 2VODA 1J5YA 5D5XB 1CF7A 3IHUA 5J3LA 2XRLA 1IN8A 2W4SA 5IP7J 1ZH5A 3ESWB 3A02A 3K70C 3KEOA 1WCMJ 3SZGA 3BJ6A 5C4JJ 4BDYA 3OL4A 2HFHA 4B8XA 1FT9A 2FMYA 1IV6A 4HSRA 4CSWA 4RLQA 3LSRA 2LKXA 2BVLA 4LITA 1MGTA 5LGTA 3OWTA 4IJAA 2GZWA 4MTEA 1CGPA 1P4WA 2IP2A 1X4OA 4NNJA 4A3EJ 1WKMA 3J81Z 3S1NJ 2HQ5A 1KZHA 5ILUA 1TC3C 4L9NA 4BH9A 3MKZA 2FX0A 2P5LC 5EG0B 2FJ1A 2XV4S 1FIPA 3I5UA 3MD2A 1S72I 2NYXA 3DTEA 3M8EA 4M3GA 1HLVA 3GX4X 5TRDA 4CZCA 2MC3A 4L0ZB 2Z99A 4B1RA 2NS0A 3BC8A 2ESHA 3SJMA 2FQ3A 5ERIA 1ZQ3P 3S32A 1LNWA 1B1BA 4R1HA 2B7EA 4IL6C 5L3GA 2QZ8A 2L4AA 3H3UA 3S16J 2L7ZA 2YU3A 3HKZA 3WGIA 2V26A 5EEGA 1GLNA 2GQQA 4IHXA 2X1CA 4HNUA 4A5MA 1H89C 2GIVA 3HZJA 3F21A 2E19A 3ABTA 4Y7NJ 4LGWA 2LY1A 3OYFA 5M5WJ 3N4MA 3HPGA 3MVPA 1T38A 2DI3A 1GV2A 1BW6A 1Y39A 2P7VB 2QQ9A 2L9RA 3DTKA 4XOTA 4KIBA 3I4PA 4DYCA 1P4AA 5KHDA 2IA1A 5EEHA 3UKGA 3QP5A 3F22A 3HOSA 2FBHA 1YRNA 4HV5A 2XAUA 1D3YA 2CH0A 3D5SC 4PFOA 1AU7A 3PL8A 4BS9A 2EQRA 1V54H 5J47A 5FLMJ 2M0MA 4DZJA 1QO0D 2H1KA 5E20A 4Y3OA 1TWHJ 2PMUA 4P96A 3JAMK 3PO2J 4M71A 5LFAA 4XKCA 1VTNC 4ZYGA 2IT0A 2LVSA 4MGRA 4NB5A 2O5RA 3OSFA 2V1DA 2CUZA 3REOA 2J5PA 3F6OA 3CO7C 4XLAA 5E18F 1Z05A 5DD8A 2JSCA 1HDDC 2HQRA 3FF5A 4KYWA 2E1CA 1MJ9A 2EFPA 3IKVA 2KDZA 1X1CA 2TRTA 3TP3A 4BY7J 3RPQA 4A3KJ 3OY9A 2HVRA 2F5DA 5HDGA 4YIFA 1WJAA 4UHTA 5B66C 3JR9A 1HW5A 3QPLA 3CTAA 3HUGB 1R7JA 3VYUB 3HJEA 3J80Z 3F8NA 1MJBA 4V19K 3RSNA 4XRSG 4EJWA 1R22A 5TGTA 2UUZA 4DJAA 2HOSA 1MSFC 3RZOJ 4I7HA 2VT3A 2ZJ2A 2NAZA 1RUOA 4HAMA 5BPIA 1BN5A 2CFOA 2IRFG 3M9AA 4IVNA 3DPTA 5BOXA 1HDPA 2JRTA 3SZPA 2AS5F 3U2RA 4A0YA 2DMUA 2VT2A 1FP1D 4LK0F 2ZBKA 3FMQA 4B47A 4IHTA 5ILVA 1NHAA 1YS7A 2WWYA 1FTZA 2WB1N 3CC7I 3CCVI 5CVIA 3CJTB 9ANTA 2CUEA 1E17A 1PP8F 2ZJPF 2VKDA 2PMZN 3M8JA 3R61A 3CP8A 1S3JA 3H9JA 2PJRA 3BPXA 2KMUA 1MZBA 4UV8A 5JVTA 3ABKH 1HKQA 5K5RA 2M8GX 2X9DA 2KRCA 2W57A 1OCTC 2IS6A 4XRSA 4N9HA 2L01A 3CCLI 2VBZA 1QPIA 3G71I 3CCRI 3OIQA 2LFBA 1KGSA 1BIAA 2YX7A 3CF2A 1FX7A 3KYCB 3GTKJ 1YQAA 2P6SA 1IAWA 4HRIA 3RKWA 3E6BA 2YS9A 5EDNA 5CVUA 2NNYA 1W0UA 5M5YJ 2ZB9A 4M3BA 5DCMB 3Q5FA 3FKJA 2DU9A 5TISC 1D5VA 1C0WA 2HU9A 3QRFF 2ZFWA 3EYIA 3S8PA 5L3FA 3DU5A 3CUQA 4Y4RA 2OJED 1RESA 4A3BJ 2WV1A 2VE9A 1X3UA 2R5ZA 2P0WA 1ZR4A 2WAQN 4GFBA 3R4KA 3E6DA 2X1DA 4M73A 2A5WA 3LSKA 3K4CA 2QQ8A 4ETSA 2FD5A 2W84A 3DBHB 3FKIJ 4BE0A 2L54A 2DBBA 1ACIA 3CUOA 4LIVA 3C2BA 4XLHA 2VPLA 4KITB 2LF7A 4IOAF 1JHHA 1Z3XA 2ETHA 2ID6A 2YR2A 3EUHC 4FX0A 5IT9Z 1HC8A 5D4RA 3ZP5A 4XN3A 2BY2A 3HGYA 2W25A 1DGWY 3E7LA 4BYYA 3BOQA 3V8LA 1F5TA 3FIWA 1YW7A 2DJNA 1UMQA 2RV8A 1YJNI 5LHHA 3ZN1A 4MO7A 1ZHFA 1R71A 3TW6A 1W4MA 4I98B 2R7OA 1UHSA 1A31A 4RB3C 1ZK8A 4HF1A 3MZ8A 2FA5A 4RB2C 4EGZA 1R5ID 2MD5A 4BE1A 3AG3H 3RKXA 3K10A 2OTJI 1NK3P 2JMWA 3HRTA 2H1LA 4G12A 4II2A 1Q1VA 1WJCA 2JTVA 4L9TA 5HS9A 2EPFA 3RYPA 2FU4A 3IL2A 4JQFA 2BW3B 3A01A 1R4MB 1ZN2A 1D1AA 1S8NA 4RB0A 5C4XJ 3CJNA 4CUGA 5J4VA 2HR3A 3IAS2 4L9JA 2O8XA 4IXAA 5LHIA 3JCUC 4U7DA 4BDZA 4L18B 3OYBA 2JA7J 4KT5C 2JPBA 1RPWA 3K6GA 4ZDLA 2ECCA 2L7FP 3SXYA 5A2QK 3FK7A 3Q0WA 3EUHA 3U21A 4BXUA 2E1MB 5ILSA 4YEJA 2HDDA 2STTA 2BZTA 1I1GA 2H09A 1K83J 2UXXA 3H5RA 5AIPA 3J80K 4WXHA 4K2EA 1WJDA 3ZQGA 1XSXA 2LKSA 3FXMA 4D7NA 1QHHD 3T0YA 3MN2A 4ZJZA 2MABA 2OCCH 3RKQA 5CQGA 2L5QA 1R23A 4QWQA 3KEQA 4ITVA 3J7YJ 1BI0A 5DCMA 4LB6B 2KFDA 2KL4A 3S3NA 3RPUA 4HDVA 2V7FA 3OS2A 2M7AA 3MKWB 2HQAA 2WC2A 2CSOA 3K9TA 4RGXA 4DIQA 1QZZA 3VOEA 2CYYA 2B63J 3AG4H 1J75A 1GVDA 1D0ZA 2VJIA 3PQKA 1I3AA 2LOOA 3DPLC 4DQ2A 4AIHA 4HLXA 2IGNA 1TTYA 2OC6A 1U8BA 2M4KA 1R4NB 4PJJA 4QTRA 1UG0A 3DTIA 3GTLJ 3F6VA 4FT8A 5H6QA 2PJRB 4A3GJ 4H4KC 2KISA 2LF8A 2OU2A 2D1HA 4RMNA 1B8IB 3A1YA 1YJWI 4UUTA 3KETA 3GTGJ 1FC3A 1MMSA 1XS9A 1WI3A 1QBJA 4UVBA 1SFOJ 1A6IA 3QYFA 5HS7A 1TQIA 2L9NA 1VQ6I 3I3LA 2HWVA 3TW7A 2YSRA 4C3IJ 5J1RA 2NOGA 1U78A 2NOJB 4XLPF 5K7HA 3KLNA 4PSWA 1RI7A 4C2TA 1JUSA 2Y0MA 3IH2A 1UZCA 1JT6A 3GTMJ 2DPDA 4ZDOA 4CH7A 3OYDA 3U1DA 2WV0A 1QU3A 3GZ5A 2CRGA 2V9VA 4OAYA 2PLYA 3ZXSA 2XKPA 3ZOBA 1AHDP 4FX4A 4II3A 2ISZA 2MH9A 3LA2A 3HGGA 3HOZJ 4EMSA 4M6XA 2JK3A 2A5YB 2XKOA 1Y0UA 3WHBA 2NVYJ 1W5TA 2NVQJ 2DA4A 3BLYA 4UXNA 3I4MJ 1HXDA 1FIAA 1QVTA 2XHKA 4I99C 1IN4A 2QCOA 2IGMA 1HSJA 1QPMA 2Y2ZA 4EGYA 2BYVE 3NWTA 4WWCA 1BJZA 2XUBA 2ZXHA 2EFWA 3EYYA 2IEKA 1BC8C 2F4IA 3HTSB 5ICEA 1TNTA 2CMPA 3DWLE 1FOYA 4G6QA 4UV9A 4UNOA 2O7OA 3PSFA 3FBIB 4JX4A 3LSPA 2ZJQF 2KKOA 4HEA2 5GADJ 1U2WA 4OAZA 3TO7A 5BS6A 4JX6A 1EV7A 3FMSA 1W1WE 4ZTFA 5FROA 3AL0B 4PZJA 5BMZA 2LREA 1SFXA 4ENMA 2NVTJ 3K4JA 1X2MA 4OIQF 2QSHX 5GTIC 4ZC3A 2R93J 2IGOA 3COAC 5F1RA 1X19A 3K1PA 2RN7A 4CYCA 5FRMA 3PM1A 2K9LA 3G1MA 4EJUA 1T6SA 1IRZA 5J8FA 3U9GA 3O6BB 1AKHB 2DDBA 4PDKA 1F1ZA 4ASNA 1BL0A 3ASNH 2XPVA 4I6ZA 3OYAA 2KT0A 2R7WA 3OYLA 1AWCA 4EEFG 1WJ5A 5F1JA 4MFDA 1T08B 4BJ5C 3H0GJ 4ZYHA 5LGNA 3PFYA 3ZMTA 1KA8A 2A05A 2M8EA 5L3BA 2Y48A 1XTAA 2V9PA 2VXDA 4AM3A 5B1AH 4M3FA 3E0JB 2EZHA 4BJ6C 2BY0A 1RUNA 2DYSH 5E3LA 1FZPB 3H1CA 2X6WA 1STZA 1X3WB 4HX7A 3ZQHA 1ON1A 1R5GA 5IOZA 1LE8A 4FE7A 4DZPA 1E0EA 3R0AA 3L2CA 3BZCA 2QBYA 2M45A 4MQVA 2QA4I 2PI0A 3S2HJ 2HNHA 1G59A 2V1NA 2K9SA 3V42A 4RGUA 1ONVA 1H9TA 1T95A 5H6RA 3FWEA 1SC7A 3KPHA 3MQ0A 4O6JA 2PBIA 2A6HF 2R4GA 2X4HA 2K40A 1IZ1A 1OCRH 3IH4A 3ERED 4G8XA 4UUSB 2JJ7A 1K78B 2LMDA 2VJJA 4HQEA 2P5KA 4A69C 1D1BA 1WH5A 4CXFA 3TMOA 2Z1DA 1R1VA 2YPRA 5KNLA 4EJVA 1NH3A 3BT9A 5EEAA 1CF7B 2Z2SB 3Q9VA 3AL0C 1S9HA 4D1QA 2Y30A 3RPUD 5EF6A 2EFNA 3FM5A 1OR7A 2E60A 3KP6A 1ETWA 1H9GA 2ACJA 3JRBA 3NQOA 5DDGA 1X58A 2KP6A 2CO5A 4RAZA 3H35A 4V2FA 3VEPA 3TP0A 3LNQA 3K7AJ 1LKXA 3ZMDA 4B48A 4ZTJA 4FETA 3CC2I 4I76A 3HOUJ 1ZRDA 3SYTA 1JT0A 3VYSB 3LWFA 4KA4A 4MIMA 5IP6A 3WG9A 2Y75A 1P6RA 2WAEA 3BY6A 1IXRC 1XCBA 3K0LA 3GFIA 2CGPA 1KQ9A 3R0JA 5L3CA 1WJFA 1DU0A 4N0BA 1VI0A 2QYOA 1JTXA 2FBIA 1VQ5I 3LMMA 1E3HA 1T0FA 1YHQI 4D5FA 3F3XA 4N9IA 3F8CA 1I1SA 1SVMA 2IPQX 2XRNA 4PJLA 2R7XA 1RR8C 3ZMUA 4G9YA 2XB5A 2XAGA 4GRIA 4HX4A 4M3EA 3ABLH 4E6KG 2QQAA 2OF7A 3MKLA 4QSHA 1NG6A 3KP3A 4NQWA 2HYJA 1E3OC 1FBUA 5FB2A 3OYMA 1LUJB 4HW0A 3TO6A 3ZRGA 2QBYB 1MBKA 4LG0A 3JSPA 5J8CA 5GAEJ 1LE8B 2K86A 1G4DA 4LLGF 3HYIA 1UJ8A 4OIOF 2P5VA 3BQYA 1JJ6C 1WVRA 1RZ4A 2DOFA 2XB0X 2XPWA 4I0BA 2K5CA 4PCQA 5CYVA 1FMWA 1TWCJ 2HTJA 5ICFA 3HDDA 1MBGA 5L3DA 1Y1VJ 1OCOH 1K6YA 1JKPC 4CGZA 2OV7A 1UG2A 4EV0A 1KYWA 2CW8A 1V4RA 4A6EA 4U88A 2KZGA 1DDNA 3KYLA 2ZSIB 2PX9A 3LA7A 4E7KA 4Y13A 3SDBA 2M7BA 1U5TA 4BEHB 1MNDA 4ON0A 3ROUA 1VQLI 5HS8A 4LIUA 4U7BA 3SEQA 4GO1A 4CA0A 3I71A 3K1MA 2WY7Q 1FSEA 3FXLA 3RYRA 4CYCB 4A3JJ 4IRHA 5E8GA 2LYCA 3PNTA 4O5VA 4CCLA 2COMA 3VSLA 1JKRC 3KEYA 2QEXI 4JOMA 3FXRA 4HQMA 3OYIA 2DOEA 2ZMEC 3OOPA 2VQCA 2R7TA 2IGKA 1P7IA 3AG1H 4AUXA 4AYBA 2FQ4A 4PJNA 3M3YJ 1Z77A 1A36A 3PO3J 4MNUA 3BJOA 1SD4A 3BZKA 2CU7A 3M7GA 2DMPA 5EZGA 2DXIA 3E97A 1IUYA 1OCPA 1UB9A 2XAQA 1K4TA 4XBFA 3P9CA 4L5IA 3C7JA 1T56A 1X4PA 3UR3C 1SD7A 4A93J 4HF0A 4EJOA 2A6TA 1UCRA 1M1EB 3BWGA 4FE4A 5LRRA 2F48A 2HZDA 4LG0B 2JVGA 3FXJA 3KP7A 3TDZC 1D0YA 1OISA 3JTHA 3ZQCA 1E3PA 3Q0VA 3FHZA 2B9SA 2CV2A 4AU7A 2E1OA 2X1EA 2DFEA 1LFUP 2W7NA 3D5RC 2HYFA 1MJAA 2JWTA 2CS3A 5LD2C 1G8XA 2YX4A 3TOBA 3MMYB 1DU6A 1ZR2A 5IT9K 2Y69H 1RKTA 4ZDPA 4A3CJ 3ZQFA 1W7PB 1WWXA 1YX5A 2FEZA 2IW5A 3J7AY 3QOPA 4M72A 2DYRH 4D5CA 1H0MA 2VC0A 2GA2A 4HPQA 1X1BA 3EUKL 1OYIA 4XONA 3NEUA 1V55H 2EFQA 2Z16A 3V7SA 4G6DA 4A0ZA 2STWA 3J7AO 1LFBA 5JLXA 1Z21A 3NAUA 2OTLI 5J1UA 4UB6C 1J59A 5B1BH 3E5QA 3G4SI 3BPVA 3GFLA 1SFKA 2H8WA 2XDVA 3ERMA 3OS0A 1I6HJ 3HIFA 1XB4A 1IN5A 4IEJA 1W36C 3HRSA 5HVQC 5F64A 4WK8F 2MC4A 3JRHA 1NK2P 2A69F 3W2AA 2OPTA 4M6YA 5FKMA 1XCVA 4MFEA 2ZJRF 4EM1A 3F8FA 3S17J 4UUSA 4ABZA 3MKYB 1Y56A 5FFXA 1TL8A 2KIFA 3DEUA 1LFPA 2LY2A 4RDUA 1BI2A 1ETVA 4L5JA 3M4OJ 1YW8A 2IXSA 4E4HA 1MDMA 3BR2A 2DT6A 4B43A 5LLQA 1BM9A 1XD7A 1MMNA 2IBDA 2GXGA 3CCYA 3R60A 4XSXF 4EATA 5F0FA 5M3FJ 1OYWA 4R79A 1Z6RA 3V4GA 3KZZA 3E3VA 2V79A 3HXLA 4BAYA 3DXJF 1TQMA 3WE2A 3CDLA 4DYQA 1R1UA 4C2MJ 5IP9J 5DD4A 2TCTA 2IJLA 2BXZA 2RQQA 2XAJA 3I59A 4I01A 3OR2C 3J7ZI 4A3MJ 1OLTA 1O3SA 4LFUA 1JKOC 2GLOA 4ZYDA 2K3FA 1S29A 3DBRB 3KIOA 4J00A 3A0BC 1SD6A 2HTSA 1OMIA 3PQJA 4H0EA 1IJWC 1IN7A 1B59A 3PUFA 4B09A 2CQXA 4YELA 1ITYA 1PP7U 3GVAA 2RQPA 5GPAA 5FRNA 1OQYA 2FBKA 3HOWJ 2ICWG 2ADUA 1MMAA 2FMLA 4M9SA 3JRFA 4F3QA 5HNFA 1IRXA 1AKHA 2JQ7A 2HOAA 3I54A 3M1EA 2R7FA 2VN2A 4I09A 3C1DA 2EA2A 3C3WA 4F55A 1OPCA 2L3DA 4MTDA 2Z5UA 4PFPA 3DKXA 2QKMB 4U0WA 3LSJA 2R7DA 3SDGA 2R7RA 2JPCA 2E7WA 5F0CA 4E70A 4R8HA 1R49A 3C18A 5DCFA 4CCMA 4RB1A 2EJRA 4BXFA 3ZGKA 1S7AA 2XF6A 4B3AA 3MZYA 3N05A 3GFMA 5BNGA 1F36A 2DK5A 2X51A 5E1ZB 1RC9A 1XSDA 1WRJA 3SEZA 3HSRA 4QIWN 3G2BA 2W85A 3CDIA 2CQ7A 3Q3SA 3AKZA 3BTLA 3RQ4A 1XSVA 1XX5A 1FOKA 1QQIA 3CCJI 1LDJA 3KCCA 1Z0XA 2WADA 2ZNYA 3KZIC 3WGGA 1T98A 3KYDB 4PSXA 4IRGA 5EYRA 4CHUA 1SVLA 4ZYEA 5GPCA 1D0XA 1WZ2A 2HYGD 4AC0A 4ENJA 1DGRM 2H27A 3JTGA 2M3AA 3LSMA 5E1XA 1KQ8A 3GEZA 4IPAA 4UVCA 1JGSA 3W3CA 3CZ6A 4C2UA 3M07A 3BROA 1MKMA 1I50J 2BBYA 1IDZA 4Q47A 1KU3A 4W1UA 4OIRF 1SANA 1TQPA 2W00A 1X1DA 4AVZA 1WJBA 5D8KB 3X2QH 2ELJA 4J19A 4EM0B 3O2PE 3L1PA 2PG4A 2XAHA 1ZG3A 4KIGA 1ZTRA 1VQ9I 2B0LA 1QVUA 4HF2A 3LSTA 3EUAA 2V6EA 4A3LJ 5D8LB 1WGXA 3GZ6A 2XF5A 4U0VA 1ODDA 2MFZA 3ECHA 1U5TC 1HSTA 2OD5A 1YIJI 2R5YB 4LLLA 2KPMA 3EPZA 2L7KA 5HDKA 3GTJJ 5IYDJ 5DEQA 4Y17A 2OUMA 3VYTB 4YFKF 5E3OA 1Y8QB 4KICA 1ETQA 4BNCA 1WQ2A 4A3DJ 2EV6A 2VXZA 4V2GA 1WHUA 3FZVA 4A6DA 2ZFUA 4P9FA 3B6CA 2F6CA 5IY5H 2E1MC 5FFZA 1ULYA 3H0DA 1J2XA 1SMTA 5CLSA 1ZRFA 2HGCA 4NBQA 4XLFA 5H2FC 1X1PA 1Z91A 2BY3A 2KJBA 3FMRA 4XSZF 5IYBJ 2VC1A 2CQNA 4XKBA 4HZFA 4Y15A 3K2AA 2DFHA 1TT0A 3HPHA 2BHYA 3G6EI 1Q1HA 4F93B 5HLHA 4E7JA 3T8RA 1P2FA 2AHQA 5LGUA 1PDNC 1OR7C 2BGCA 6PAXA 3QPTA 2WAQA 4DW6A 2E5ZA 3CCQI 4ESJA 4UB8C 2EV0A 1MD0A 2RNJA 2W48A 4RS8A 5EJCA 4MHGA 1IXSB 3KE2A 3GBGA 1TLHB 1IW7F 2QF7A 2KJCA 3IC7A 1ETXA 2R7QA 4IO9F 1ZELA 2ZXJA 1JUPA 5JVGF 3AAFA 3WTXC 4DNCA 3P5JA 3E1SA 2MYSA 1TW2A 1REPC 3CJQB 1FTTA 5M5XJ 1IDYA 3PUBA 4Q48A 3WU1B 1GVJA 4GYGA 1VQ8I 1GXQA 3B6AA 4Q4ZF 2M1BA 4L0YB 1ETYA 1HA8A 5BPDA 1POGA 1D5YA 3I64A 3BG9A 2VIXA 2KZVA 4XIDA 2BW3A 3A01B 2DQRA 1W36D 1OKRA 1R5HA 1BR4A 1IC8A 1UFMA 4M3DA 3D1NI 2DA7A 3MAJA 2CWEA 4OOIA 1YRNB 4Y33A 4XQFA 2OCEA 1TWGJ 5IPAA 1IGNA 5GP9A 4IHWA 1R6RA 3CLOA 2P81A 5FD6A 4CCNA 3S1RJ 5E17F 3NRVA 2E5NA 1O3TA 5F08A 3ZMSA 3L2WA 1PVEA 1VQ7I 3K4LA 3QODA 3IV5A 2CFXA 3CESA 1BJAA 1MH4A 2FNPA 1GXPA 1YJ9I 3HRUA 3S1QJ 1IXCA 3OYEA 4JK1X 1CQTA 2LG4A 2I10A 5ED4A 4AD9A 3FX3A 2NRAC 5LEKA 2CV0A 2GXBA 1BR2A 2Z9OA 4CCJA 3JAMZ 2XSJC 3LSGA 1YO5C 1BOAA 4ESFA 4E7LA 2Q2EB 5GAGJ 4S05A 1IN6A 1B4AA 2F2EA 1EA3A 3PSIA 4FQGA 5AIQA 1LJ9A 1S7EA 3BG3A 3Q9SA 2PJPA 1HOMA 2D1VA 3GZNB 4N4NB 4X1EA 3E6CC 2WA0A 3PNYA 3S1MJ 2OZUA 1BOBA 2R5ZB 2E1NA 5DUIA 2FOKA 3JRIA 4C9YA 3MWMA 3MZHA 4EM2A 3CUQB 3V7CA 4F7ZA 1YI2I 3R6SA 4G7OF 2VASA 1P4XA 1JUMA 3O8HA 1V5EA 1EH8A 3E6MA 2C6YA 1ZLJA 3LFKA 3BR6A 1VQNI 3FXUA 4ZZLA 4A5NA 3IP4B 1V5FA 2XSDC 4LD5A 3FDYA 3QQAA 4EQQA 2VONA 4CO8A 1ON2A 3JSOA 1BC7C 2IVMA 1YE9A 4HG2A 3ONQA 4NC7A 5JR3A 4IF4A 4CDGA 1FMVA 2YUSA 4NC8A 3G1OA 1QZYA 2PQ8A 4WX9A 2Z3YA 5D6FA 2K9NA 4PUSA 4OMYA 4AVPA 4ENKA 2X6YA 4KMFA 3FHNA 5GAHJ 2Y9ZA 3E5XA 3KZYA 2UV1A 5TJJA 3OIPA 3T8TA 4PGGA 2M0CA 1T2KA 4XLNF 1ENHA 4HV6A 1MNMC 2X0LA 3ZQIA 2DT7B 2DA1A 3HHGA 3TQNA 2HZTA 2Y0SA 3S93A 2QKLB 1HKSA 4HBLA 5JHUA 1R9TJ 1U8RA 1D8JA 1O3QA 2RVCA 3HUGA 3BR3A 3KP2A 3GCMA 2E7XA 2PEXA 5DV5A 1Z67A 3OYKA 3I4NJ 1XMKA 2XGXA 3FM3A 4KUMA 1I39A 3VPRA 1O7FA 2M5WA 1YLFA 1Z1DA 4YFXF 1FBQA 5LRSA 3IUOA 1ZAOA 2AO9A 3SZTA 5IOYA 3S2DJ 1Y6IA 1L3LA 4EJTA 1XMAA 4AIJA 2DCEA 2HEOA 3RDIA 2H6BA 1GT0C 4QPQA 2Z33A 5HODA 4NC6A 2LNBA 3C2HA 4A3IJ 2BEOA 1XDSA 1X2NA 2KRHA 2TDXA 4X0GA 1K4SA 2BVMA 3DEEA 1XGOA 4M74A 3OYJA 3ZQQA 4AIDA 5JLWA 1G2HA 1PUFA 2ME0A 1G3WA 2AQEA 2F5VA 2EZIA 2X85A 3GWZA 3L2QA 1WFXA 3H3VK 2GA1A 1PYVA 2HDWA 3DEWA 1NG7A 4OINF 5K5QA 4IHYA 3H36A 2VOOA 3RI4A 2A68F 3RJPA 5L3EA 3ABUA 1SAXA 4RLFA 2K02A 1ERDA 2AXTC 2MLGA 3LSHA 3PFIA 1USTA 3K4KA 4P5OA 2XGDA 4XM3A 1ZG1A 4HSTA 5FGMA 2ZKZA 3RKYA 1SVOA 3H9GA 1FSHA 2QQBA 1HBXG 1VZ0A 2JVHA 3LAPA 5JHFA 1UHMA 1YW9A 3HSEA 1IUFA 4HYEA 3DPUA 2ZXIA 1AA7A 1RR7A 5D6EA 2L9SA 5FLXK 2ELHA 2GAUA 4FTHA 5DM7F 2A07F 1Z3YA 2J5OA 2IAIA 3DP7A 2KQRA 1TW3A 4X6AJ 2RREA 3RIRA 3WGHA 5HLIA 5ICCA 2Q2EA 4KIFA 1G3YA 3RZDJ 3W6KB 3HL2A 1EH7A 1I3QJ 3F0CA 4IZZA 1IF1A 2JA8J 4QLCU 3VFZA 4XOPA 3CD6I 2CQKA 1SMYF 1IRGA 2ID3A 2LBFA 4RBOA 2EIJH 2E2HJ 4G7HF 4KFCA 3DLAA 1TWFJ 2X6XA 2MSYA 2QENA 4ZYAA 2VKHA 5J4YA 3ZQLA 2WBMA 3W6VA 3OIOA 2P6TA 2O9LA 1ZG5A 5K5OA 2CQQA 2O8KA 5EG0A 2VKEA 2MA3A 1D8KA 3GTOJ 4YRVA 1FP2A 2CUFA 2F4MB 1VF9A 2DMQA 4E7IA 3HRMA 4JBAA 3VB2A 1JJ8C 4CCKA 3BQZA 5DTDA 2NS7A 3DU6A 4LK1F 4GDFA 1J7KA 4D7MA 4LB5A 2FF4A 2XGCA 3KP5A 2XASA 3CCUI 5CQEA 1SFEA 3SFZA 4RA2A 3T5XA 1U6GA 1O57A 5M3MJ 2DFIA 3JRGA 2F5CA 5E1WA 3WU2C 2FNAA 2VQLA 3V8JA 3QYBA 3GTPJ 1OYYA 2DFFA 1PUFB 2L0KA 1VFCA 2BHZA 2ZCWA 3GYHX 2HI3A 3LQQA 2KIUA 2P8TA 2HKXA 1Z7LA 2W24A 5FKNA 4FASD 2MGQA 4B3XA 3VWBA 3BTCA 1JI8A 2JT1A 4JP0A 2K9MA 3GO5A 3PIPF 3NWSA 1MMGA 4W97A 3L2VA 4KDPA 4BQOA 3FXOA 2JRMA 3TKYA 1MH3A 2RNGA 3BCAA 1NTCA 1W5CC 1JTYA 4DOZA 2DW4A 4MEXF 2VJ4A 1YIOA 2K3PA 4BJTA 4DGWB 2I8DA 2Q1ZB 4XKVA 1AOYA 1N75A 3K69A 2EBIA 3CJRB 4UY8I 4E7ZA 4N4OB 5HNHA 2ESNA 3LQRA 1ZARA 3O3KA 3OOUA 5CJ9A 1LB2A 3ZPLA 3FK6A 1IRFA 3IWFA 1XGMA 3G3ZA 5E8IA 3WTYC 2HOTA 2R7VA 3CDHA 3KX2A 3OYNA 1YG2A 4Q5SF 2LR8A 5LBQA 3K4NA 3U1KA 4KT6A 2H8RA 4YIRX 2K4JA 3HHHA 5LHGA 2E34A 3LOCA 2V9KA 4F92B 1MMDA 2O03A 1DPUA 3LFUA 4DYRA 2DA5A 2EZLA 4U0YA 4HNVA 5K7FA 5K7ZA 2OBPA 3V8KA 2CV1A 1ETOA 2O0YA 2ZNZA 4GCVA 1APLC 2ZMEA 3OYCA 2R5YA 1XC5A 2VI6A 4P1WA 2EINH 4A2UA 5FKKA 1ZLKA 4KN7X 1YOVB 2EWNA 2CW7A 1SEUA 1O4XA 3L7WA 2HDCA 2MW8A 3K70D 1W5SA 2NVUB 4F52A 4AIKA 3WTTC 1WI9A 5EZHA 4BACA 4CICA 5HOOA 1G3TA 1DUXC 2D45A 1ZGAA 1X1AA 5J1YA 2DMTA 1XN7A 3BG6A 2EILH 2DN0A 3F9KA 2QM3A 2LP0A 1U9NA 4I02A 3BP8A 2N8GA 2XGEA 1MBJA 3GF2A 5JFRA 1HCRA 1ZGWA 1JGGA 1KYZA 2NS8A 2R0QC 1PUEE 3EDPA 3CQZJ 4ZH4F 3JREA 1QHGA 3T1BA 2W1OA 3BDDA 4XL9A 3ZCOA 2I5UA 3ASOH 1JXSA 4YG2F 2VL8A 1U3EM 5FD5A 1ZREA 2NVXJ 3KLOA 4G94A 2PN6A 1LVKA 2A3SA 5J6XA 1A35A 2DA3A 3TGNA 1RETA 2D5VA 1F9NA 3B73A 1I5ZA 1QNTA 4BXXJ 4BL0B 2HXOA 4GXOA 2DA2A 1U0JA 1KU2A 2L2OA 4I0AA 3LAJA 4ANJA 4WCGA 4BHBA 5ICGA 1YFHA 1Z9CA 3HOTA 1S5LC 5IYCJ 3TDUC 1USSA 3OS1A 2F4OB 1VQ4I 5JI6A 1EH6A 1P92A 1H88C 3CC4I 3A0HC 3V7RA 5J40A 2V4JC 3F23A 1L0OC 3QWLA 4CZZA 2JUCA 1B72B 3BTIA 2O3FA 1R36A 1TP4A 1F4KA 3HG9A 2OQGA 4KISA 1FWZA 3K4BA 2EA4A 3ML6A 5EGOA 2KLOA 2FUG2 1BA5A 3L09A 2RDPA 2VB6A 3ULQB 1DPRA 1MBHA 5F27A 3SQNA 3CO6C 2WAFA 2BXYA 2DOAA 3P9KA 2UWMA 1S7OA 3ZN0A 1MBEA 2E35A 3GW2A 3I53A 1VQMI 4KNYA 1YYVA 2NNNA 3J81K 3CLQA 3ZMVA 2EZKA 3WTUC 4XRMA 1Y8RB 4KJZA 2LRDA 2Q0OA 2X6OA 1W7PD 4BQNA 2AXLA 5B3SH 5GTHC 2MLKA 2JZYA 1VQKI 2FOWA 3BZ6A 3GTQJ 4BBSJ 3K2ZA 1BI1A 2QSFX 4WF2A 5CVVA 4C3HJ 3OSGA 3WTZA 1FEXA 5FLXZ 1FJLA 4GGGA 2JSPA 3WTVC 1K6OA 1IG7A 4XR6A 4BU2A 4RM2A 1G3SA 5KAFC 5FLVA 3IRQA 1IV8A 1MDMB 3ECOA 2YU9J 4RM3A 4BHPA 1RNLA 2JUGA 4S0HB 2P7CB 1BBYA 2WY8Q 5HLGA 2E71A 4BGDA 2GOMA 4P55A 2L7MP 1XDUA 5CVRA 5KVRA 3QP6A 2DPUA 2G0EA 4M9ZA 2OZ6A 3H5AA 1XPXA 4RAGA 2G7UA 3D5LA 2M30A 3F8BA 3FXQA 1N77A 1A04A 3HOYJ 3S15J 1QZEA 1ETKA 1O7LA 3RQIA 3IH3A 2F5FA 3QU3A 3H3ZA 1B6AA 3CP2A 3P7NA 4IHVA 2R92J 5FKOA 1DP3A 4NHJA 1XGNA 2VQGA 5A2QZ 1FOWA 4PJMA 1EKEA 2R7SA 3Q0UA 2RKHA 2G7HA 4XMYA 2M9HA 4A3FJ 2ZO4A 4TV7A 1WSUA 3IAM2 4IHSA 1MBFA 1A6QA 3DCFA 1LEAA 2KIQA 2AQFA 2HXIA 3S3MA 1A5JA 1R1TA 1VQPI 1ZYRF 3H5NA 4KMUX 2V1UA 1DQUA 3L9FA 1BW5A 4PK4A 1LQ1A 3CCEI 2ME6A 3QU6A 2IA0A 5D4SA 1WPKA 3QYEA 4L5EA 2FXAA 3OYGA 1FLIA 4IKFA 3B02A 5EGOB 3WTWC 3AG2H 3K1NA 2CG4A 3WHCA 3JRDA 4RGSA 3DLLF 1HW1A 2O6GE 2LD5A 5K1YA 3IRRA 1B72A 3C2GA 4ENNA 2LC2A 1DP7P 3AFHA 1HKTA 3DKYA 4Y52J 5FKLA 1LPQA 3LA3A 2BV6A 2GWRA 3DFGA 3SHFA 2JN6A 3GFJA 1T33A 1X3ZB 3CCMI 4QPOA 1GUUA 5DM6F 3ZMZA 2HKOA 1XG1A 1LVAA 2DJIA 1TBXA 2PMHA 4LMYA 4ZZDA 1Z7UA 1YX3A 3JW4A 3BG7A 3UNGC 5F0HA 2X48A 2VQHA 2ISYA 2QGUA 3L2RA 4P9UA 4HA8A 5FJ8J 5DUKA 1Y0NA 3WE3A 2DODA 2L4MA 2KDOA 2MD0A 3CMMA 1FOXA 3N97A 2JA5J 1XGSA 2KRFA 2OQRA 4YIIA 1JE8A 4IQ4A 4JYKA 3HM5A 2ZXWH 1Y1WJ 4XORA 1B9NA 2L9VA 1E2XA 4D0PA 3PIOF 3QAHA 2K7LA 3GLLA 2HS5A 3QPHA 1LDDA 3OYHA 2R3SA 3S14J 4O3MA 4B4CA 3VDXA 3HKZN 1MNEA 2RAEA 2NXNB 5AONA 3KP4A 4G6TB 1FPQA 1KQ0A 2EK5A 3GUDA 4L9VA 2EV5A 3ZR8X 5D5VB 1V3FA 2D2WA 4BEHA 4FHTA 3TL4X 2XAFA 3TOAA 3WODF 1MSEC 3PJRA 2VBYA 1GV5A 5F04A 2MG4A 2LKPA 3H9QA 3RCOA 1FYKA 3HOVJ 2GOXB 4KN4X 1LEBA 3F72A 4OU0A 2JA6J 4WXCA 1O3RA 2E36A 4HX8A 4XKWA 5DS9A 4S04A 5C44J 1D1CA 4FCYA 2M87A 2XVCA 3I59B 4UVAA 1ORKA 4C30A 1OCZH 2ZMEB 1YTYA 4BY1J 3BCBA 1QRYA 3DKWA 1TWAJ 2GXAA 2A6EF 2DQLA 2P4WA 1B9MA 1MIJA 2FRHA 4HNTA 4DBRA 3CF5F 2XC7A 2BE5F 2IA2A 4Z6YA 3WG7H 1LDKB 1TZLA 3L00A 4BQAA 3JRAA 1GHCA 4A0XA 4NQWB 3M1CA 1F43A 1FYMA 2QWWA 3WU0A 4M6VA 2FE3A
chains in the Genus database with same CATH topology
1AA7A 2L9SA 3S3OA 4BUPA 1SFKA 2XDVA 3OS0A 2R7OA 1Z3YA 2WB1A 4CCOA 2KQRA 5KCMA 1W36C 5HVQC 2RREA 4E7HA 2MC4A 2PMZA 3HL2A 3W2AA 3I9V2 4BE1A 4IZZA 2JA2A 3K10A 4II2A 4XOPA 1WJCA 3MKYB 2LBFA 1Y56A 3DLAA 3HC7A 4JQFA 5HLTA 1WJEA 1LFPA 2LY2A 2X6XA 2BW3B 4ZYAA 2VKHA 1D1AA 2WBMA 1KONA 4CUGA 2IXSA 4MLOA 4E4HA 3A2KA 1J09A 2DT6A 3IAS2 4B43A 4XNFA 1T0FC 1MMNA 4YRVA 2LH9A 4BDZA 3VSKA 4BQQA 3LL7A 3OYBA 4E7IA 4EATA 4CCKA 4R79A 3K6GA 4ZDLA 3DU6A 3HXLA 3U21A 5CQEA 2E1MB 4YEJA 2RQQA 1UELB 3OR2C 3H5RA 1OLTA 2VQLA 3QYBA 1WJDA 4J00A 1QHHD 4ZJZA 2CUJA 2MABA 2IS1A 4YELA 5CQGA 2L5QA 1Z7LA 4FASD 4F91B 5FRNA 4B3XA 4ITVA 4LG3A 3VWBA 1JI8A 2HPIA 1P9QC 1MMAA 2KL4A 3OMYA 4J01A 3S3NA 4F3QA 5HNFA 1IRXA 1MW7A 2V7FA 3OS2A 2K9MA 2M7AA 3MKWB 3NWSA 1MMGA 2HQAA 3L2VA 2IS2A 4BQOA 4DIQA 2LBFB 4XLCA 1UAAA 2W82A 2HVSA 4F55A 1V5GA 2RNGA 3BCAA 4DOZA 1D0ZA 3LSIA 2VJIA 4PFPA 3DKXA 2QKMB 2VJ4A 2K3PA 3A4CA 4BJTA 2LOOA 3DPLC 2I8DA 4DGWB 2R7RA 2Q1ZB 1SAUA 1N78A 2IGNA 3VYRB 2OC6A 4CCMA 2M4KA 4XKVA 4BXFA 1N75A 4PJJA 3ZGKA 2XF6A 1UG0A 3DTIA 3CJRB 4E7ZA 4N4OB 4IX7A 2PJRB 4H4KC 4RMNA 3N05A 5HNHA 3A1YA 3OOUA 4DBQA 2X51A 2R7VA 3KX2A 3SEZA 3OYNA 3QYFA 3G2BA 2BOLA 2L9NA 3W2VA 3I3LA 3PNVA 3K4NA 3AKZA 4KT6A 2M4GA 4BE2A 3RQ4A 2VJ5A 3QOEA 4B44A 2V9KA 4F92B 2NOJB 2ZSHB 1MMDA 4PSWA 3LFUA 2HVQA 4C2TA 2WADA 4ZDOA 4CH7A 3OYDA 1BR1A 1QU3A 2CV1A 4OAYA 3ZXSA 4PSXA 3FBNB 4II3A 3OYCA 1D0XA 4P1WA 1DGRM 2VLAA 2CW7A 2M3AA 3LSMA 3W3CA 3K70D 3CZ6A 4C2UA 3BLYA 3W2WA 4F52A 4BACA 5HOOA 4D9JA 3TBIA 2IS4A 2W00A 1X1AA 1X1DA 4AVZA 2IGMA 3K4MA 3BG6A 5CKTA 1WJBA 3F9KA 4U87A 2ELJA 4XN0A 3NWTA 2ZXHA 1PJRA 2F4IA 2CMPA 3DWLE 3EUAA 2V6EA 1QHGA 3PSFA 2XF5A 4E7SA 2MFZA 3FBIB 3ZCOA 2W1OA 4HEA2 4XL9A 2VL8A 4OAZA 2KPMA 3EPZA 2L7KA 1LVKA 3VYTB 2OUMA 3OR1C 5FROA 4ZTFA 3AL0B 2KHMA 3L2UA 2LREA 2XF7A 3K4JA 2VXZA 3DQVC 4ZC3A 2ZFUA 2IGOA 5CPRB 2F6CA 1X19A 4BL0B 4IQJA 3H0DA 2E1MC 1U0JA 4XLEA 2L2OA 5FRMA 3OL3A 4XLFA 2K9LA 4NUBA 4ANJA 4OWRB 2HPMA 4XKBA 3HOTA 3OS1A 2R7UA 2ZXIA 1TT0A 3HPHA 4F93B 4E7JA 2V4JC 3RTRA 3OYAA 2R7WA 1OR7C 3OYLA 1WJ5A 2W4SA 2WAQA 2E5ZA 4BJ5C 3K70C 3PFYA 4KISA 3HG9A 3SZGA 3K4BA 4BDYA 2VXDA 2KLOA 2FUG2 3OL4A 3E0JB 4BJ6C 4HSRA 3GBGA 2VB6A 4RLQA 4CSWA 2X6WA 2BVLA 4LITA 3OWTA 1E0EA 1X4OA 2R7QA 1ZELA 2WAFA 4NNJA 2DOAA 2UWMA 3E1SA 2MYSA 2HNHA 3CJQB 1G59A 3MKZA 2V1NA 3PUBA 3V42A 1HA8A 3MD2A 1T95A 3DTEA 2VIXA 2KZVA 4KJZA 2BW3A 2LRDA 1W36D 4CZCA 2R4GA 4BQNA 1BR4A 3BC8A 3S32A 2VJJA 1D1BA 4Y33A 4XQFA 3TMOA 2Z1DA 3HKZA 5KNLA 1R6RA 2V26A 4CCNA 1GLNA 2E5NA 2X1CA 3L2WA 4HNUA 2JSPA 2Z2SB 3AL0C 1S9HA 4XR6A 4BU2A 4D1QA 3K4LA 3QODA 4RM2A 3RPUD 2LY1A 3OYFA 3HPGA 2E60A 4RM3A 3CESA 5LD2C 2JUGA 3OYEA 2KP6A 3H35A 3DTKA 4XOTA 2WY8Q 2LG4A 1LKXA 4B48A 4BGDA 4ZTJA 4FETA 2GOMA 5KHDA 3SYTA 2CV0A 3VYSB 1BR2A 4CCJA 3HOSA 3H5AA 2XSJC 2WAEA 3LSGA 4E7LA 2Q2EB 3D5LA 2XAUA 1N77A 4PFOA 2CH0A 3D5SC 1WJFA 3PSIA 3PL8A 1EA3A 4BS9A 3LMMA 2M0MA 4N4NB 3CP2A 1DP3A 4Y3OA 2WA0A 3PNYA 2VQGA 1BOBA 4PJMA 2R7SA 4PJLA 4C9YA 4XMYA 5LFAA 4XKCA 2R7XA 3IAM2 4E6KG 4GRIA 2O5RA 2CUZA 1NG6A 2AQFA 3S3MA 3H5NA 3OYMA 1DQUA 4XLAA 2VASA 3ZRGA 1V5EA 4PK4A 3IP4B 1V5FA 3QYEA 3OYGA 1X1CA 3FDYA 4IKFA 3OY9A 2HVRA 2K5CA 1WJAA 1FMWA 1YE9A 4HG2A 3ONQA 4NC7A 3HUGB 1K6YA 2OV7A 3VYUB 1FMVA 3RSNA 4NC8A 5TGTA 2UUZA 2CW8A 3C2GA 4DJAA 2LC2A 3KYLA 2ZSIB 3AFHA 4E7KA 3DKYA 3SDBA 2M7BA 4PUSA 4BEHB 1MNDA 2CFOA 2X6YA 3DPTA 3FHNA 4LIUA 4U7BA 3SEQA 4CA0A 4B47A 2UV1A 3OIPA 2WY7Q 4QPOA 2DJIA 2LYCA 3PNTA 4CCLA 1YX3A 3BG7A 3UNGC 3KEYA 3VSLA 4JOMA 2VQHA 2DT7B 3L2RA 3OYIA 2VKDA 2Y0SA 3M8JA 3CP8A 2VQCA 2QKLB 3S93A 2R7TA 2IGKA 3H9JA 4AYBA 2KDOA 2PJRA 4PJNA 2MD0A 3CMMA 2KMUA 2KRCA 4IQ4A 2DXIA 3OYKA 2IS6A 4XORA 1X4PA 3OIQA 3UR3C 3IUOA 1Y6IA 2A6TA 2DCEA 3CF2A 3OYHA 2HZDA 3VDXA 4HRIA 2JVGA 1MNEA 1D0YA 4G6TB 4QPQA 3ZR8X 3FKJA 2CV2A 4BEHA 3C2HA 3TL4X 2HU9A 4AU7A 2KRHA 3PJRA 4X0GA 3S8PA 3DU5A 2X1EA 3H9QA 4Y4RA 3RCOA 2BVMA 2GOXB 3DEEA 3OYJA 3ZQQA 2P0WA 2W7NA 3D5RC 2AQEA 2CS3A 2X1DA 1G8XA 2F5VA 2A5WA 2X85A 3LSKA 4XKWA 3L2QA 1WFXA 3K4CA 1D1CA 1PYVA 3MMYB 2HDWA 1NG7A 4C30A 4BE0A 4ZDPA 3BCBA 4RLFA 1ERDA 4LIVA 4XLHA 1YX5A 3J7AY 2VPLA 3LSHA 4KITB 3K4KA 4P5OA 4HNTA 4XM3A 4DBRA 1Z3XA 3EUHC 4HSTA 4HPQA 1X1BA 3EUKL 3H9GA 2XC7A 1LDKB 1TZLA 1VZ0A 2JVHA 4XN3A 4XONA 4NQWB 2Z16A 3M1CA 1DGWY 5JHFA 1Z21A 3DPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC7 A;  2W4S A; 
#chains in the Genus database with same CATH topology
 4MQ9 F;  3TO9 A;  2LSO A;  1T39 A;  3S3O A;  4BUP A;  4XRF A;  3SFI A;  1T8I A;  2WB1 A;  4CCO A;  5KCM A;  1SD5 A;  2VPR A;  2PFB A;  4RGR A;  4E7H A;  1YIT I;  1U9O A;  5B5E C;  2PMZ A;  3I9V 2;  3P9I A;  3HEF A;  2JA2 A;  5FO5 A;  3TED A;  2V6C A;  2DA6 A;  2DTR A;  1HQC A;  3BG5 A;  2EFO A;  3BR1 A;  2FSW A;  4WXD A;  3S2W A;  5BQT A;  2R7Z J;  1K7A A;  3HC7 A;  5HDN A;  5IT3 A;  5HLT A;  2LLK A;  1WJE A;  4OMZ A;  1ZGJ A;  1ZRC A;  4PGH A;  1H8A C;  3F8M A;  1N25 A;  3FXK A;  1KON A;  3QPS A;  4MLO A;  5C3E J;  2GM4 A;  3A2K A;  1J09 A;  2DT5 A;  2Y9Y A;  4NDL A;  4XNF A;  1T0F C;  3CMA I;  4MEY F;  3I55 I;  1RIO H;  2LH9 A;  5E3N A;  4I2O A;  4UUV A;  1RKW A;  3VSK A;  3LL7 A;  4RAY A;  2CW0 F;  4BQQ A;  3GME A;  5KK1 A;  2OA4 A;  1G6N A;  5D5U B;  4XK4 A;  4C3J J;  4BBR J;  2RGV A;  1W7P A;  4XIC A;  1BI3 A;  2EIK H;  3CUQ C;  1JHF A;  3CMY A;  1VQO I;  1K78 A;  1UEL B;  3BR5 A;  2Y0S N;  4M9X A;  1OJL A;  1HF0 A;  3BR0 A;  2VOP A;  3NAR A;  1K61 A;  2A61 A;  2H6C A;  4IOC F;  2CUJ A;  1JKQ C;  2IS1 A;  3DBL B;  4ESB A;  2GBY A;  1R58 A;  3FIS A;  4F91 B;  1I27 A;  2M34 A;  4HDU A;  4IRI A;  4LG3 A;  1QA6 A;  2HPI A;  1P9Q C;  2EIM H;  2LK2 A;  3OMY A;  4J01 A;  3KFW X;  2QUF A;  2QVO A;  4FIS A;  2UXN A;  3G1L A;  1MW7 A;  1UHW A;  2LDU A;  3D0S A;  5H20 A;  3HSF A;  2IS2 A;  2DTZ A;  1UAA A;  2LBF B;  4XLC A;  1W0T A;  2W82 A;  3E5U A;  2HVS A;  2H94 A;  2BY1 A;  1V5G A;  1XMX A;  3LSI A;  5CVJ A;  3HOX J;  2XRO A;  1YS6 A;  4PJ0 C;  1K79 A;  3A4C A;  3ELK A;  1EF4 A;  5KAI C;  2EB7 A;  1J0R A;  1HW2 A;  1SAU A;  1N78 A;  1TNS A;  3VYR B;  1VND A;  2K4B A;  3M8F A;  2DDA A;  3ISP A;  4IX7 A;  2E2J J;  2LTP A;  2ELK A;  2XIG A;  1I6X A;  4Z2Y A;  2DAO A;  4DBQ A;  4RAF A;  2VUM J;  2K27 A;  2MH2 A;  2M2E A;  2F5E A;  1J9I A;  1ZKG A;  2BOL A;  3W2V A;  3PNV A;  2QLZ A;  2ECB A;  2M4G A;  4BE2 A;  4OIP F;  2VJ5 A;  3MEX A;  3QOE A;  4B44 A;  2ZSH B;  3O8G A;  1KU7 A;  3BJA A;  2HVQ A;  2DLL A;  3VOD A;  1U5T B;  1BR1 A;  3WTS C;  3I0T A;  4GYI A;  4CYD A;  5DYM A;  2HQN A;  3FBN B;  4AYB N;  4BKX A;  2HOE A;  2DO7 A;  1IO2 A;  2GIZ A;  1S6L A;  2VLA A;  3ZQ7 A;  3EET A;  1P7J A;  4JX5 A;  3I58 A;  3A03 A;  3W2W A;  1OCC H;  1FNN A;  2OAZ A;  3DF8 A;  1WH7 A;  2CJJ A;  4HOB A;  4D9J A;  3TBI A;  2IS4 A;  1TT5 B;  1R00 A;  2WTE A;  2EH3 A;  3K4M A;  3W6J B;  1Z6T A;  5CKT A;  5F6F A;  2V1X A;  2Q8K A;  1RRJ A;  1SFU A;  1FYL A;  4U87 A;  4XN0 A;  1QGP A;  3HBL A;  1FBS A;  3G73 A;  3BTJ A;  3HTU A;  2RC4 A;  3GXO A;  1PJR A;  5E3M A;  2ZC2 A;  2QSG X;  2VKV A;  4E7S A;  2L02 A;  3MFK A;  2Y31 A;  3CCS I;  3DV8 A;  3HB9 A;  4YFN F;  1OFC X;  2DK8 A;  1FY7 A;  4LOC A;  5LEJ A;  3I56 I;  2G9W A;  2KIM A;  3IKT A;  3JRC A;  2O61 A;  3OR1 C;  5E79 C;  4LLN A;  2KHM A;  3L2U A;  2UZK A;  1KU9 A;  2XF7 A;  5D5W B;  2VBX A;  3DQV C;  3EQL F;  2VE8 A;  3IWZ A;  5CPR B;  4BHC A;  2LY9 A;  3ABM H;  4IQJ A;  2K9Q A;  1EJ9 A;  4AWX B;  4XLE A;  2K85 A;  4A12 A;  2E2I J;  3OL3 A;  3H92 A;  4NUB A;  2HPM A;  4OWR B;  2DMN A;  2XPU A;  3OV8 A;  2R7U A;  4HLY A;  2VBW A;  1GDT A;  3GLX A;  4G7Z F;  4LJZ F;  4EVI A;  3RTR A;  1BIB A;  3MCZ A;  2MBF A;  2COB A;  3CME I;  1B8I A;  2VOD A;  1J5Y A;  5D5X B;  1CF7 A;  3IHU A;  5J3L A;  2XRL A;  1IN8 A;  2W4S A;  5IP7 J;  1ZH5 A;  3ESW B;  3A02 A;  3K70 C;  3KEO A;  1WCM J;  3SZG A;  3BJ6 A;  5C4J J;  4BDY A;  3OL4 A;  2HFH A;  4B8X A;  1FT9 A;  2FMY A;  1IV6 A;  4HSR A;  4CSW A;  4RLQ A;  3LSR A;  2LKX A;  2BVL A;  4LIT A;  1MGT A;  5LGT A;  3OWT A;  4IJA A;  2GZW A;  4MTE A;  1CGP A;  1P4W A;  2IP2 A;  1X4O A;  4NNJ A;  4A3E J;  1WKM A;  3J81 Z;  3S1N J;  2HQ5 A;  1KZH A;  5ILU A;  1TC3 C;  4L9N A;  4BH9 A;  3MKZ A;  2FX0 A;  2P5L C;  5EG0 B;  2FJ1 A;  2XV4 S;  1FIP A;  3I5U A;  3MD2 A;  1S72 I;  2NYX A;  3DTE A;  3M8E A;  4M3G A;  1HLV A;  3GX4 X;  5TRD A;  4CZC A;  2MC3 A;  4L0Z B;  2Z99 A;  4B1R A;  2NS0 A;  3BC8 A;  2ESH A;  3SJM A;  2FQ3 A;  5ERI A;  1ZQ3 P;  3S32 A;  1LNW A;  1B1B A;  4R1H A;  2B7E A;  4IL6 C;  5L3G A;  2QZ8 A;  2L4A A;  3H3U A;  3S16 J;  2L7Z A;  2YU3 A;  3HKZ A;  3WGI A;  2V26 A;  5EEG A;  1GLN A;  2GQQ A;  4IHX A;  2X1C A;  4HNU A;  4A5M A;  1H89 C;  2GIV A;  3HZJ A;  3F21 A;  2E19 A;  3ABT A;  4Y7N J;  4LGW A;  2LY1 A;  3OYF A;  5M5W J;  3N4M A;  3HPG A;  3MVP A;  1T38 A;  2DI3 A;  1GV2 A;  1BW6 A;  1Y39 A;  2P7V B;  2QQ9 A;  2L9R A;  3DTK A;  4XOT A;  4KIB A;  3I4P A;  4DYC A;  1P4A A;  5KHD A;  2IA1 A;  5EEH A;  3UKG A;  3QP5 A;  3F22 A;  3HOS A;  2FBH A;  1YRN A;  4HV5 A;  2XAU A;  1D3Y A;  2CH0 A;  3D5S C;  4PFO A;  1AU7 A;  3PL8 A;  4BS9 A;  2EQR A;  1V54 H;  5J47 A;  5FLM J;  2M0M A;  4DZJ A;  1QO0 D;  2H1K A;  5E20 A;  4Y3O A;  1TWH J;  2PMU A;  4P96 A;  3JAM K;  3PO2 J;  4M71 A;  5LFA A;  4XKC A;  1VTN C;  4ZYG A;  2IT0 A;  2LVS A;  4MGR A;  4NB5 A;  2O5R A;  3OSF A;  2V1D A;  2CUZ A;  3REO A;  2J5P A;  3F6O A;  3CO7 C;  4XLA A;  5E18 F;  1Z05 A;  5DD8 A;  2JSC A;  1HDD C;  2HQR A;  3FF5 A;  4KYW A;  2E1C A;  1MJ9 A;  2EFP A;  3IKV A;  2KDZ A;  1X1C A;  2TRT A;  3TP3 A;  4BY7 J;  3RPQ A;  4A3K J;  3OY9 A;  2HVR A;  2F5D A;  5HDG A;  4YIF A;  1WJA A;  4UHT A;  5B66 C;  3JR9 A;  1HW5 A;  3QPL A;  3CTA A;  3HUG B;  1R7J A;  3VYU B;  3HJE A;  3J80 Z;  3F8N A;  1MJB A;  4V19 K;  3RSN A;  4XRS G;  4EJW A;  1R22 A;  5TGT A;  2UUZ A;  4DJA A;  2HOS A;  1MSF C;  3RZO J;  4I7H A;  2VT3 A;  2ZJ2 A;  2NAZ A;  1RUO A;  4HAM A;  5BPI A;  1BN5 A;  2CFO A;  2IRF G;  3M9A A;  4IVN A;  3DPT A;  5BOX A;  1HDP A;  2JRT A;  3SZP A;  2AS5 F;  3U2R A;  4A0Y A;  2DMU A;  2VT2 A;  1FP1 D;  4LK0 F;  2ZBK A;  3FMQ A;  4B47 A;  4IHT A;  5ILV A;  1NHA A;  1YS7 A;  2WWY A;  1FTZ A;  2WB1 N;  3CC7 I;  3CCV I;  5CVI A;  3CJT B;  9ANT A;  2CUE A;  1E17 A;  1PP8 F;  2ZJP F;  2VKD A;  2PMZ N;  3M8J A;  3R61 A;  3CP8 A;  1S3J A;  3H9J A;  2PJR A;  3BPX A;  2KMU A;  1MZB A;  4UV8 A;  5JVT A;  3ABK H;  1HKQ A;  5K5R A;  2M8G X;  2X9D A;  2KRC A;  2W57 A;  1OCT C;  2IS6 A;  4XRS A;  4N9H A;  2L01 A;  3CCL I;  2VBZ A;  1QPI A;  3G71 I;  3CCR I;  3OIQ A;  2LFB A;  1KGS A;  1BIA A;  2YX7 A;  3CF2 A;  1FX7 A;  3KYC B;  3GTK J;  1YQA A;  2P6S A;  1IAW A;  4HRI A;  3RKW A;  3E6B A;  2YS9 A;  5EDN A;  5CVU A;  2NNY A;  1W0U A;  5M5Y J;  2ZB9 A;  4M3B A;  5DCM B;  3Q5F A;  3FKJ A;  2DU9 A;  5TIS C;  1D5V A;  1C0W A;  2HU9 A;  3QRF F;  2ZFW A;  3EYI A;  3S8P A;  5L3F A;  3DU5 A;  3CUQ A;  4Y4R A;  2OJE D;  1RES A;  4A3B J;  2WV1 A;  2VE9 A;  1X3U A;  2R5Z A;  2P0W A;  1ZR4 A;  2WAQ N;  4GFB A;  3R4K A;  3E6D A;  2X1D A;  4M73 A;  2A5W A;  3LSK A;  3K4C A;  2QQ8 A;  4ETS A;  2FD5 A;  2W84 A;  3DBH B;  3FKI J;  4BE0 A;  2L54 A;  2DBB A;  1ACI A;  3CUO A;  4LIV A;  3C2B A;  4XLH A;  2VPL A;  4KIT B;  2LF7 A;  4IOA F;  1JHH A;  1Z3X A;  2ETH A;  2ID6 A;  2YR2 A;  3EUH C;  4FX0 A;  5IT9 Z;  1HC8 A;  5D4R A;  3ZP5 A;  4XN3 A;  2BY2 A;  3HGY A;  2W25 A;  1DGW Y;  3E7L A;  4BYY A;  3BOQ A;  3V8L A;  1F5T A;  3FIW A;  1YW7 A;  2DJN A;  1UMQ A;  2RV8 A;  1YJN I;  5LHH A;  3ZN1 A;  4MO7 A;  1ZHF A;  1R71 A;  3TW6 A;  1W4M A;  4I98 B;  2R7O A;  1UHS A;  1A31 A;  4RB3 C;  1ZK8 A;  4HF1 A;  3MZ8 A;  2FA5 A;  4RB2 C;  4EGZ A;  1R5I D;  2MD5 A;  4BE1 A;  3AG3 H;  3RKX A;  3K10 A;  2OTJ I;  1NK3 P;  2JMW A;  3HRT A;  2H1L A;  4G12 A;  4II2 A;  1Q1V A;  1WJC A;  2JTV A;  4L9T A;  5HS9 A;  2EPF A;  3RYP A;  2FU4 A;  3IL2 A;  4JQF A;  2BW3 B;  3A01 A;  1R4M B;  1ZN2 A;  1D1A A;  1S8N A;  4RB0 A;  5C4X J;  3CJN A;  4CUG A;  5J4V A;  2HR3 A;  3IAS 2;  4L9J A;  2O8X A;  4IXA A;  5LHI A;  3JCU C;  4U7D A;  4BDZ A;  4L18 B;  3OYB A;  2JA7 J;  4KT5 C;  2JPB A;  1RPW A;  3K6G A;  4ZDL A;  2ECC A;  2L7F P;  3SXY A;  5A2Q K;  3FK7 A;  3Q0W A;  3EUH A;  3U21 A;  4BXU A;  2E1M B;  5ILS A;  4YEJ A;  2HDD A;  2STT A;  2BZT A;  1I1G A;  2H09 A;  1K83 J;  2UXX A;  3H5R A;  5AIP A;  3J80 K;  4WXH A;  4K2E A;  1WJD A;  3ZQG A;  1XSX A;  2LKS A;  3FXM A;  4D7N A;  1QHH D;  3T0Y A;  3MN2 A;  4ZJZ A;  2MAB A;  2OCC H;  3RKQ A;  5CQG A;  2L5Q A;  1R23 A;  4QWQ A;  3KEQ A;  4ITV A;  3J7Y J;  1BI0 A;  5DCM A;  4LB6 B;  2KFD A;  2KL4 A;  3S3N A;  3RPU A;  4HDV A;  2V7F A;  3OS2 A;  2M7A A;  3MKW B;  2HQA A;  2WC2 A;  2CSO A;  3K9T A;  4RGX A;  4DIQ A;  1QZZ A;  3VOE A;  2CYY A;  2B63 J;  3AG4 H;  1J75 A;  1GVD A;  1D0Z A;  2VJI A;  3PQK A;  1I3A A;  2LOO A;  3DPL C;  4DQ2 A;  4AIH A;  4HLX A;  2IGN A;  1TTY A;  2OC6 A;  1U8B A;  2M4K A;  1R4N B;  4PJJ A;  4QTR A;  1UG0 A;  3DTI A;  3GTL J;  3F6V A;  4FT8 A;  5H6Q A;  2PJR B;  4A3G J;  4H4K C;  2KIS A;  2LF8 A;  2OU2 A;  2D1H A;  4RMN A;  1B8I B;  3A1Y A;  1YJW I;  4UUT A;  3KET A;  3GTG J;  1FC3 A;  1MMS A;  1XS9 A;  1WI3 A;  1QBJ A;  4UVB A;  1SFO J;  1A6I A;  3QYF A;  5HS7 A;  1TQI A;  2L9N A;  1VQ6 I;  3I3L A;  2HWV A;  3TW7 A;  2YSR A;  4C3I J;  5J1R A;  2NOG A;  1U78 A;  2NOJ B;  4XLP F;  5K7H A;  3KLN A;  4PSW A;  1RI7 A;  4C2T A;  1JUS A;  2Y0M A;  3IH2 A;  1UZC A;  1JT6 A;  3GTM J;  2DPD A;  4ZDO A;  4CH7 A;  3OYD A;  3U1D A;  2WV0 A;  1QU3 A;  3GZ5 A;  2CRG A;  2V9V A;  4OAY A;  2PLY A;  3ZXS A;  2XKP A;  3ZOB A;  1AHD P;  4FX4 A;  4II3 A;  2ISZ A;  2MH9 A;  3LA2 A;  3HGG A;  3HOZ J;  4EMS A;  4M6X A;  2JK3 A;  2A5Y B;  2XKO A;  1Y0U A;  3WHB A;  2NVY J;  1W5T A;  2NVQ J;  2DA4 A;  3BLY A;  4UXN A;  3I4M J;  1HXD A;  1FIA A;  1QVT A;  2XHK A;  4I99 C;  1IN4 A;  2QCO A;  2IGM A;  1HSJ A;  1QPM A;  2Y2Z A;  4EGY A;  2BYV E;  3NWT A;  4WWC A;  1BJZ A;  2XUB A;  2ZXH A;  2EFW A;  3EYY A;  2IEK A;  1BC8 C;  2F4I A;  3HTS B;  5ICE A;  1TNT A;  2CMP A;  3DWL E;  1FOY A;  4G6Q A;  4UV9 A;  4UNO A;  2O7O A;  3PSF A;  3FBI B;  4JX4 A;  3LSP A;  2ZJQ F;  2KKO A;  4HEA 2;  5GAD J;  1U2W A;  4OAZ A;  3TO7 A;  5BS6 A;  4JX6 A;  1EV7 A;  3FMS A;  1W1W E;  4ZTF A;  5FRO A;  3AL0 B;  4PZJ A;  5BMZ A;  2LRE A;  1SFX A;  4ENM A;  2NVT J;  3K4J A;  1X2M A;  4OIQ F;  2QSH X;  5GTI C;  4ZC3 A;  2R93 J;  2IGO A;  3COA C;  5F1R A;  1X19 A;  3K1P A;  2RN7 A;  4CYC A;  5FRM A;  3PM1 A;  2K9L A;  3G1M A;  4EJU A;  1T6S A;  1IRZ A;  5J8F A;  3U9G A;  3O6B B;  1AKH B;  2DDB A;  4PDK A;  1F1Z A;  4ASN A;  1BL0 A;  3ASN H;  2XPV A;  4I6Z A;  3OYA A;  2KT0 A;  2R7W A;  3OYL A;  1AWC A;  4EEF G;  1WJ5 A;  5F1J A;  4MFD A;  1T08 B;  4BJ5 C;  3H0G J;  4ZYH A;  5LGN A;  3PFY A;  3ZMT A;  1KA8 A;  2A05 A;  2M8E A;  5L3B A;  2Y48 A;  1XTA A;  2V9P A;  2VXD A;  4AM3 A;  5B1A H;  4M3F A;  3E0J B;  2EZH A;  4BJ6 C;  2BY0 A;  1RUN A;  2DYS H;  5E3L A;  1FZP B;  3H1C A;  2X6W A;  1STZ A;  1X3W B;  4HX7 A;  3ZQH A;  1ON1 A;  1R5G A;  5IOZ A;  1LE8 A;  4FE7 A;  4DZP A;  1E0E A;  3R0A A;  3L2C A;  3BZC A;  2QBY A;  2M45 A;  4MQV A;  2QA4 I;  2PI0 A;  3S2H J;  2HNH A;  1G59 A;  2V1N A;  2K9S A;  3V42 A;  4RGU A;  1ONV A;  1H9T A;  1T95 A;  5H6R A;  3FWE A;  1SC7 A;  3KPH A;  3MQ0 A;  4O6J A;  2PBI A;  2A6H F;  2R4G A;  2X4H A;  2K40 A;  1IZ1 A;  1OCR H;  3IH4 A;  3ERE D;  4G8X A;  4UUS B;  2JJ7 A;  1K78 B;  2LMD A;  2VJJ A;  4HQE A;  2P5K A;  4A69 C;  1D1B A;  1WH5 A;  4CXF A;  3TMO A;  2Z1D A;  1R1V A;  2YPR A;  5KNL A;  4EJV A;  1NH3 A;  3BT9 A;  5EEA A;  1CF7 B;  2Z2S B;  3Q9V A;  3AL0 C;  1S9H A;  4D1Q A;  2Y30 A;  3RPU D;  5EF6 A;  2EFN A;  3FM5 A;  1OR7 A;  2E60 A;  3KP6 A;  1ETW A;  1H9G A;  2ACJ A;  3JRB A;  3NQO A;  5DDG A;  1X58 A;  2KP6 A;  2CO5 A;  4RAZ A;  3H35 A;  4V2F A;  3VEP A;  3TP0 A;  3LNQ A;  3K7A J;  1LKX A;  3ZMD A;  4B48 A;  4ZTJ A;  4FET A;  3CC2 I;  4I76 A;  3HOU J;  1ZRD A;  3SYT A;  1JT0 A;  3VYS B;  3LWF A;  4KA4 A;  4MIM A;  5IP6 A;  3WG9 A;  2Y75 A;  1P6R A;  2WAE A;  3BY6 A;  1IXR C;  1XCB A;  3K0L A;  3GFI A;  2CGP A;  1KQ9 A;  3R0J A;  5L3C A;  1WJF A;  1DU0 A;  4N0B A;  1VI0 A;  2QYO A;  1JTX A;  2FBI A;  1VQ5 I;  3LMM A;  1E3H A;  1T0F A;  1YHQ I;  4D5F A;  3F3X A;  4N9I A;  3F8C A;  1I1S A;  1SVM A;  2IPQ X;  2XRN A;  4PJL A;  2R7X A;  1RR8 C;  3ZMU A;  4G9Y A;  2XB5 A;  2XAG A;  4GRI A;  4HX4 A;  4M3E A;  3ABL H;  4E6K G;  2QQA A;  2OF7 A;  3MKL A;  4QSH A;  1NG6 A;  3KP3 A;  4NQW A;  2HYJ A;  1E3O C;  1FBU A;  5FB2 A;  3OYM A;  1LUJ B;  4HW0 A;  3TO6 A;  3ZRG A;  2QBY B;  1MBK A;  4LG0 A;  3JSP A;  5J8C A;  5GAE J;  1LE8 B;  2K86 A;  1G4D A;  4LLG F;  3HYI A;  1UJ8 A;  4OIO F;  2P5V A;  3BQY A;  1JJ6 C;  1WVR A;  1RZ4 A;  2DOF A;  2XB0 X;  2XPW A;  4I0B A;  2K5C A;  4PCQ A;  5CYV A;  1FMW A;  1TWC J;  2HTJ A;  5ICF A;  3HDD A;  1MBG A;  5L3D A;  1Y1V J;  1OCO H;  1K6Y A;  1JKP C;  4CGZ A;  2OV7 A;  1UG2 A;  4EV0 A;  1KYW A;  2CW8 A;  1V4R A;  4A6E A;  4U88 A;  2KZG A;  1DDN A;  3KYL A;  2ZSI B;  2PX9 A;  3LA7 A;  4E7K A;  4Y13 A;  3SDB A;  2M7B A;  1U5T A;  4BEH B;  1MND A;  4ON0 A;  3ROU A;  1VQL I;  5HS8 A;  4LIU A;  4U7B A;  3SEQ A;  4GO1 A;  4CA0 A;  3I71 A;  3K1M A;  2WY7 Q;  1FSE A;  3FXL A;  3RYR A;  4CYC B;  4A3J J;  4IRH A;  5E8G A;  2LYC A;  3PNT A;  4O5V A;  4CCL A;  2COM A;  3VSL A;  1JKR C;  3KEY A;  2QEX I;  4JOM A;  3FXR A;  4HQM A;  3OYI A;  2DOE A;  2ZME C;  3OOP A;  2VQC A;  2R7T A;  2IGK A;  1P7I A;  3AG1 H;  4AUX A;  4AYB A;  2FQ4 A;  4PJN A;  3M3Y J;  1Z77 A;  1A36 A;  3PO3 J;  4MNU A;  3BJO A;  1SD4 A;  3BZK A;  2CU7 A;  3M7G A;  2DMP A;  5EZG A;  2DXI A;  3E97 A;  1IUY A;  1OCP A;  1UB9 A;  2XAQ A;  1K4T A;  4XBF A;  3P9C A;  4L5I A;  3C7J A;  1T56 A;  1X4P A;  3UR3 C;  1SD7 A;  4A93 J;  4HF0 A;  4EJO A;  2A6T A;  1UCR A;  1M1E B;  3BWG A;  4FE4 A;  5LRR A;  2F48 A;  2HZD A;  4LG0 B;  2JVG A;  3FXJ A;  3KP7 A;  3TDZ C;  1D0Y A;  1OIS A;  3JTH A;  3ZQC A;  1E3P A;  3Q0V A;  3FHZ A;  2B9S A;  2CV2 A;  4AU7 A;  2E1O A;  2X1E A;  2DFE A;  1LFU P;  2W7N A;  3D5R C;  2HYF A;  1MJA A;  2JWT A;  2CS3 A;  5LD2 C;  1G8X A;  2YX4 A;  3TOB A;  3MMY B;  1DU6 A;  1ZR2 A;  5IT9 K;  2Y69 H;  1RKT A;  4ZDP A;  4A3C J;  3ZQF A;  1W7P B;  1WWX A;  1YX5 A;  2FEZ A;  2IW5 A;  3J7A Y;  3QOP A;  4M72 A;  2DYR H;  4D5C A;  1H0M A;  2VC0 A;  2GA2 A;  4HPQ A;  1X1B A;  3EUK L;  1OYI A;  4XON A;  3NEU A;  1V55 H;  2EFQ A;  2Z16 A;  3V7S A;  4G6D A;  4A0Z A;  2STW A;  3J7A O;  1LFB A;  5JLX A;  1Z21 A;  3NAU A;  2OTL I;  5J1U A;  4UB6 C;  1J59 A;  5B1B H;  3E5Q A;  3G4S I;  3BPV A;  3GFL A;  1SFK A;  2H8W A;  2XDV A;  3ERM A;  3OS0 A;  1I6H J;  3HIF A;  1XB4 A;  1IN5 A;  4IEJ A;  1W36 C;  3HRS A;  5HVQ C;  5F64 A;  4WK8 F;  2MC4 A;  3JRH A;  1NK2 P;  2A69 F;  3W2A A;  2OPT A;  4M6Y A;  5FKM A;  1XCV A;  4MFE A;  2ZJR F;  4EM1 A;  3F8F A;  3S17 J;  4UUS A;  4ABZ A;  3MKY B;  1Y56 A;  5FFX A;  1TL8 A;  2KIF A;  3DEU A;  1LFP A;  2LY2 A;  4RDU A;  1BI2 A;  1ETV A;  4L5J A;  3M4O J;  1YW8 A;  2IXS A;  4E4H A;  1MDM A;  3BR2 A;  2DT6 A;  4B43 A;  5LLQ A;  1BM9 A;  1XD7 A;  1MMN A;  2IBD A;  2GXG A;  3CCY A;  3R60 A;  4XSX F;  4EAT A;  5F0F A;  5M3F J;  1OYW A;  4R79 A;  1Z6R A;  3V4G A;  3KZZ A;  3E3V A;  2V79 A;  3HXL A;  4BAY A;  3DXJ F;  1TQM A;  3WE2 A;  3CDL A;  4DYQ A;  1R1U A;  4C2M J;  5IP9 J;  5DD4 A;  2TCT A;  2IJL A;  2BXZ A;  2RQQ A;  2XAJ A;  3I59 A;  4I01 A;  3OR2 C;  3J7Z I;  4A3M J;  1OLT A;  1O3S A;  4LFU A;  1JKO C;  2GLO A;  4ZYD A;  2K3F A;  1S29 A;  3DBR B;  3KIO A;  4J00 A;  3A0B C;  1SD6 A;  2HTS A;  1OMI A;  3PQJ A;  4H0E A;  1IJW C;  1IN7 A;  1B59 A;  3PUF A;  4B09 A;  2CQX A;  4YEL A;  1ITY A;  1PP7 U;  3GVA A;  2RQP A;  5GPA A;  5FRN A;  1OQY A;  2FBK A;  3HOW J;  2ICW G;  2ADU A;  1MMA A;  2FML A;  4M9S A;  3JRF A;  4F3Q A;  5HNF A;  1IRX A;  1AKH A;  2JQ7 A;  2HOA A;  3I54 A;  3M1E A;  2R7F A;  2VN2 A;  4I09 A;  3C1D A;  2EA2 A;  3C3W A;  4F55 A;  1OPC A;  2L3D A;  4MTD A;  2Z5U A;  4PFP A;  3DKX A;  2QKM B;  4U0W A;  3LSJ A;  2R7D A;  3SDG A;  2R7R A;  2JPC A;  2E7W A;  5F0C A;  4E70 A;  4R8H A;  1R49 A;  3C18 A;  5DCF A;  4CCM A;  4RB1 A;  2EJR A;  4BXF A;  3ZGK A;  1S7A A;  2XF6 A;  4B3A A;  3MZY A;  3N05 A;  3GFM A;  5BNG A;  1F36 A;  2DK5 A;  2X51 A;  5E1Z B;  1RC9 A;  1XSD A;  1WRJ A;  3SEZ A;  3HSR A;  4QIW N;  3G2B A;  2W85 A;  3CDI A;  2CQ7 A;  3Q3S A;  3AKZ A;  3BTL A;  3RQ4 A;  1XSV A;  1XX5 A;  1FOK A;  1QQI A;  3CCJ I;  1LDJ A;  3KCC A;  1Z0X A;  2WAD A;  2ZNY A;  3KZI C;  3WGG A;  1T98 A;  3KYD B;  4PSX A;  4IRG A;  5EYR A;  4CHU A;  1SVL A;  4ZYE A;  5GPC A;  1D0X A;  1WZ2 A;  2HYG D;  4AC0 A;  4ENJ A;  1DGR M;  2H27 A;  3JTG A;  2M3A A;  3LSM A;  5E1X A;  1KQ8 A;  3GEZ A;  4IPA A;  4UVC A;  1JGS A;  3W3C A;  3CZ6 A;  4C2U A;  3M07 A;  3BRO A;  1MKM A;  1I50 J;  2BBY A;  1IDZ A;  4Q47 A;  1KU3 A;  4W1U A;  4OIR F;  1SAN A;  1TQP A;  2W00 A;  1X1D A;  4AVZ A;  1WJB A;  5D8K B;  3X2Q H;  2ELJ A;  4J19 A;  4EM0 B;  3O2P E;  3L1P A;  2PG4 A;  2XAH A;  1ZG3 A;  4KIG A;  1ZTR A;  1VQ9 I;  2B0L A;  1QVU A;  4HF2 A;  3LST A;  3EUA A;  2V6E A;  4A3L J;  5D8L B;  1WGX A;  3GZ6 A;  2XF5 A;  4U0V A;  1ODD A;  2MFZ A;  3ECH A;  1U5T C;  1HST A;  2OD5 A;  1YIJ I;  2R5Y B;  4LLL A;  2KPM A;  3EPZ A;  2L7K A;  5HDK A;  3GTJ J;  5IYD J;  5DEQ A;  4Y17 A;  2OUM A;  3VYT B;  4YFK F;  5E3O A;  1Y8Q B;  4KIC A;  1ETQ A;  4BNC A;  1WQ2 A;  4A3D J;  2EV6 A;  2VXZ A;  4V2G A;  1WHU A;  3FZV A;  4A6D A;  2ZFU A;  4P9F A;  3B6C A;  2F6C A;  5IY5 H;  2E1M C;  5FFZ A;  1ULY A;  3H0D A;  1J2X A;  1SMT A;  5CLS A;  1ZRF A;  2HGC A;  4NBQ A;  4XLF A;  5H2F C;  1X1P A;  1Z91 A;  2BY3 A;  2KJB A;  3FMR A;  4XSZ F;  5IYB J;  2VC1 A;  2CQN A;  4XKB A;  4HZF A;  4Y15 A;  3K2A A;  2DFH A;  1TT0 A;  3HPH A;  2BHY A;  3G6E I;  1Q1H A;  4F93 B;  5HLH A;  4E7J A;  3T8R A;  1P2F A;  2AHQ A;  5LGU A;  1PDN C;  1OR7 C;  2BGC A;  6PAX A;  3QPT A;  2WAQ A;  4DW6 A;  2E5Z A;  3CCQ I;  4ESJ A;  4UB8 C;  2EV0 A;  1MD0 A;  2RNJ A;  2W48 A;  4RS8 A;  5EJC A;  4MHG A;  1IXS B;  3KE2 A;  3GBG A;  1TLH B;  1IW7 F;  2QF7 A;  2KJC A;  3IC7 A;  1ETX A;  2R7Q A;  4IO9 F;  1ZEL A;  2ZXJ A;  1JUP A;  5JVG F;  3AAF A;  3WTX C;  4DNC A;  3P5J A;  3E1S A;  2MYS A;  1TW2 A;  1REP C;  3CJQ B;  1FTT A;  5M5X J;  1IDY A;  3PUB A;  4Q48 A;  3WU1 B;  1GVJ A;  4GYG A;  1VQ8 I;  1GXQ A;  3B6A A;  4Q4Z F;  2M1B A;  4L0Y B;  1ETY A;  1HA8 A;  5BPD A;  1POG A;  1D5Y A;  3I64 A;  3BG9 A;  2VIX A;  2KZV A;  4XID A;  2BW3 A;  3A01 B;  2DQR A;  1W36 D;  1OKR A;  1R5H A;  1BR4 A;  1IC8 A;  1UFM A;  4M3D A;  3D1N I;  2DA7 A;  3MAJ A;  2CWE A;  4OOI A;  1YRN B;  4Y33 A;  4XQF A;  2OCE A;  1TWG J;  5IPA A;  1IGN A;  5GP9 A;  4IHW A;  1R6R A;  3CLO A;  2P81 A;  5FD6 A;  4CCN A;  3S1R J;  5E17 F;  3NRV A;  2E5N A;  1O3T A;  5F08 A;  3ZMS A;  3L2W A;  1PVE A;  1VQ7 I;  3K4L A;  3QOD A;  3IV5 A;  2CFX A;  3CES A;  1BJA A;  1MH4 A;  2FNP A;  1GXP A;  1YJ9 I;  3HRU A;  3S1Q J;  1IXC A;  3OYE A;  4JK1 X;  1CQT A;  2LG4 A;  2I10 A;  5ED4 A;  4AD9 A;  3FX3 A;  2NRA C;  5LEK A;  2CV0 A;  2GXB A;  1BR2 A;  2Z9O A;  4CCJ A;  3JAM Z;  2XSJ C;  3LSG A;  1YO5 C;  1BOA A;  4ESF A;  4E7L A;  2Q2E B;  5GAG J;  4S05 A;  1IN6 A;  1B4A A;  2F2E A;  1EA3 A;  3PSI A;  4FQG A;  5AIQ A;  1LJ9 A;  1S7E A;  3BG3 A;  3Q9S A;  2PJP A;  1HOM A;  2D1V A;  3GZN B;  4N4N B;  4X1E A;  3E6C C;  2WA0 A;  3PNY A;  3S1M J;  2OZU A;  1BOB A;  2R5Z B;  2E1N A;  5DUI A;  2FOK A;  3JRI A;  4C9Y A;  3MWM A;  3MZH A;  4EM2 A;  3CUQ B;  3V7C A;  4F7Z A;  1YI2 I;  3R6S A;  4G7O F;  2VAS A;  1P4X A;  1JUM A;  3O8H A;  1V5E A;  1EH8 A;  3E6M A;  2C6Y A;  1ZLJ A;  3LFK A;  3BR6 A;  1VQN I;  3FXU A;  4ZZL A;  4A5N A;  3IP4 B;  1V5F A;  2XSD C;  4LD5 A;  3FDY A;  3QQA A;  4EQQ A;  2VON A;  4CO8 A;  1ON2 A;  3JSO A;  1BC7 C;  2IVM A;  1YE9 A;  4HG2 A;  3ONQ A;  4NC7 A;  5JR3 A;  4IF4 A;  4CDG A;  1FMV A;  2YUS A;  4NC8 A;  3G1O A;  1QZY A;  2PQ8 A;  4WX9 A;  2Z3Y A;  5D6F A;  2K9N A;  4PUS A;  4OMY A;  4AVP A;  4ENK A;  2X6Y A;  4KMF A;  3FHN A;  5GAH J;  2Y9Z A;  3E5X A;  3KZY A;  2UV1 A;  5TJJ A;  3OIP A;  3T8T A;  4PGG A;  2M0C A;  1T2K A;  4XLN F;  1ENH A;  4HV6 A;  1MNM C;  2X0L A;  3ZQI A;  2DT7 B;  2DA1 A;  3HHG A;  3TQN A;  2HZT A;  2Y0S A;  3S93 A;  2QKL B;  1HKS A;  4HBL A;  5JHU A;  1R9T J;  1U8R A;  1D8J A;  1O3Q A;  2RVC A;  3HUG A;  3BR3 A;  3KP2 A;  3GCM A;  2E7X A;  2PEX A;  5DV5 A;  1Z67 A;  3OYK A;  3I4N J;  1XMK A;  2XGX A;  3FM3 A;  4KUM A;  1I39 A;  3VPR A;  1O7F A;  2M5W A;  1YLF A;  1Z1D A;  4YFX F;  1FBQ A;  5LRS A;  3IUO A;  1ZAO A;  2AO9 A;  3SZT A;  5IOY A;  3S2D J;  1Y6I A;  1L3L A;  4EJT A;  1XMA A;  4AIJ A;  2DCE A;  2HEO A;  3RDI A;  2H6B A;  1GT0 C;  4QPQ A;  2Z33 A;  5HOD A;  4NC6 A;  2LNB A;  3C2H A;  4A3I J;  2BEO A;  1XDS A;  1X2N A;  2KRH A;  2TDX A;  4X0G A;  1K4S A;  2BVM A;  3DEE A;  1XGO A;  4M74 A;  3OYJ A;  3ZQQ A;  4AID A;  5JLW A;  1G2H A;  1PUF A;  2ME0 A;  1G3W A;  2AQE A;  2F5V A;  2EZI A;  2X85 A;  3GWZ A;  3L2Q A;  1WFX A;  3H3V K;  2GA1 A;  1PYV A;  2HDW A;  3DEW A;  1NG7 A;  4OIN F;  5K5Q A;  4IHY A;  3H36 A;  2VOO A;  3RI4 A;  2A68 F;  3RJP A;  5L3E A;  3ABU A;  1SAX A;  4RLF A;  2K02 A;  1ERD A;  2AXT C;  2MLG A;  3LSH A;  3PFI A;  1UST A;  3K4K A;  4P5O A;  2XGD A;  4XM3 A;  1ZG1 A;  4HST A;  5FGM A;  2ZKZ A;  3RKY A;  1SVO A;  3H9G A;  1FSH A;  2QQB A;  1HBX G;  1VZ0 A;  2JVH A;  3LAP A;  5JHF A;  1UHM A;  1YW9 A;  3HSE A;  1IUF A;  4HYE A;  3DPU A;  2ZXI A;  1AA7 A;  1RR7 A;  5D6E A;  2L9S A;  5FLX K;  2ELH A;  2GAU A;  4FTH A;  5DM7 F;  2A07 F;  1Z3Y A;  2J5O A;  2IAI A;  3DP7 A;  2KQR A;  1TW3 A;  4X6A J;  2RRE A;  3RIR A;  3WGH A;  5HLI A;  5ICC A;  2Q2E A;  4KIF A;  1G3Y A;  3RZD J;  3W6K B;  3HL2 A;  1EH7 A;  1I3Q J;  3F0C A;  4IZZ A;  1IF1 A;  2JA8 J;  4QLC U;  3VFZ A;  4XOP A;  3CD6 I;  2CQK A;  1SMY F;  1IRG A;  2ID3 A;  2LBF A;  4RBO A;  2EIJ H;  2E2H J;  4G7H F;  4KFC A;  3DLA A;  1TWF J;  2X6X A;  2MSY A;  2QEN A;  4ZYA A;  2VKH A;  5J4Y A;  3ZQL A;  2WBM A;  3W6V A;  3OIO A;  2P6T A;  2O9L A;  1ZG5 A;  5K5O A;  2CQQ A;  2O8K A;  5EG0 A;  2VKE A;  2MA3 A;  1D8K A;  3GTO J;  4YRV A;  1FP2 A;  2CUF A;  2F4M B;  1VF9 A;  2DMQ A;  4E7I A;  3HRM A;  4JBA A;  3VB2 A;  1JJ8 C;  4CCK A;  3BQZ A;  5DTD A;  2NS7 A;  3DU6 A;  4LK1 F;  4GDF A;  1J7K A;  4D7M A;  4LB5 A;  2FF4 A;  2XGC A;  3KP5 A;  2XAS A;  3CCU I;  5CQE A;  1SFE A;  3SFZ A;  4RA2 A;  3T5X A;  1U6G A;  1O57 A;  5M3M J;  2DFI A;  3JRG A;  2F5C A;  5E1W A;  3WU2 C;  2FNA A;  2VQL A;  3V8J A;  3QYB A;  3GTP J;  1OYY A;  2DFF A;  1PUF B;  2L0K A;  1VFC A;  2BHZ A;  2ZCW A;  3GYH X;  2HI3 A;  3LQQ A;  2KIU A;  2P8T A;  2HKX A;  1Z7L A;  2W24 A;  5FKN A;  4FAS D;  2MGQ A;  4B3X A;  3VWB A;  3BTC A;  1JI8 A;  2JT1 A;  4JP0 A;  2K9M A;  3GO5 A;  3PIP F;  3NWS A;  1MMG A;  4W97 A;  3L2V A;  4KDP A;  4BQO A;  3FXO A;  2JRM A;  3TKY A;  1MH3 A;  2RNG A;  3BCA A;  1NTC A;  1W5C C;  1JTY A;  4DOZ A;  2DW4 A;  4MEX F;  2VJ4 A;  1YIO A;  2K3P A;  4BJT A;  4DGW B;  2I8D A;  2Q1Z B;  4XKV A;  1AOY A;  1N75 A;  3K69 A;  2EBI A;  3CJR B;  4UY8 I;  4E7Z A;  4N4O B;  5HNH A;  2ESN A;  3LQR A;  1ZAR A;  3O3K A;  3OOU A;  5CJ9 A;  1LB2 A;  3ZPL A;  3FK6 A;  1IRF A;  3IWF A;  1XGM A;  3G3Z A;  5E8I A;  3WTY C;  2HOT A;  2R7V A;  3CDH A;  3KX2 A;  3OYN A;  1YG2 A;  4Q5S F;  2LR8 A;  5LBQ A;  3K4N A;  3U1K A;  4KT6 A;  2H8R A;  4YIR X;  2K4J A;  3HHH A;  5LHG A;  2E34 A;  3LOC A;  2V9K A;  4F92 B;  1MMD A;  2O03 A;  1DPU A;  3LFU A;  4DYR A;  2DA5 A;  2EZL A;  4U0Y A;  4HNV A;  5K7F A;  5K7Z A;  2OBP A;  3V8K A;  2CV1 A;  1ETO A;  2O0Y A;  2ZNZ A;  4GCV A;  1APL C;  2ZME A;  3OYC A;  2R5Y A;  1XC5 A;  2VI6 A;  4P1W A;  2EIN H;  4A2U A;  5FKK A;  1ZLK A;  4KN7 X;  1YOV B;  2EWN A;  2CW7 A;  1SEU A;  1O4X A;  3L7W A;  2HDC A;  2MW8 A;  3K70 D;  1W5S A;  2NVU B;  4F52 A;  4AIK A;  3WTT C;  1WI9 A;  5EZH A;  4BAC A;  4CIC A;  5HOO A;  1G3T A;  1DUX C;  2D45 A;  1ZGA A;  1X1A A;  5J1Y A;  2DMT A;  1XN7 A;  3BG6 A;  2EIL H;  2DN0 A;  3F9K A;  2QM3 A;  2LP0 A;  1U9N A;  4I02 A;  3BP8 A;  2N8G A;  2XGE A;  1MBJ A;  3GF2 A;  5JFR A;  1HCR A;  1ZGW A;  1JGG A;  1KYZ A;  2NS8 A;  2R0Q C;  1PUE E;  3EDP A;  3CQZ J;  4ZH4 F;  3JRE A;  1QHG A;  3T1B A;  2W1O A;  3BDD A;  4XL9 A;  3ZCO A;  2I5U A;  3ASO H;  1JXS A;  4YG2 F;  2VL8 A;  1U3E M;  5FD5 A;  1ZRE A;  2NVX J;  3KLO A;  4G94 A;  2PN6 A;  1LVK A;  2A3S A;  5J6X A;  1A35 A;  2DA3 A;  3TGN A;  1RET A;  2D5V A;  1F9N A;  3B73 A;  1I5Z A;  1QNT A;  4BXX J;  4BL0 B;  2HXO A;  4GXO A;  2DA2 A;  1U0J A;  1KU2 A;  2L2O A;  4I0A A;  3LAJ A;  4ANJ A;  4WCG A;  4BHB A;  5ICG A;  1YFH A;  1Z9C A;  3HOT A;  1S5L C;  5IYC J;  3TDU C;  1USS A;  3OS1 A;  2F4O B;  1VQ4 I;  5JI6 A;  1EH6 A;  1P92 A;  1H88 C;  3CC4 I;  3A0H C;  3V7R A;  5J40 A;  2V4J C;  3F23 A;  1L0O C;  3QWL A;  4CZZ A;  2JUC A;  1B72 B;  3BTI A;  2O3F A;  1R36 A;  1TP4 A;  1F4K A;  3HG9 A;  2OQG A;  4KIS A;  1FWZ A;  3K4B A;  2EA4 A;  3ML6 A;  5EGO A;  2KLO A;  2FUG 2;  1BA5 A;  3L09 A;  2RDP A;  2VB6 A;  3ULQ B;  1DPR A;  1MBH A;  5F27 A;  3SQN A;  3CO6 C;  2WAF A;  2BXY A;  2DOA A;  3P9K A;  2UWM A;  1S7O A;  3ZN0 A;  1MBE A;  2E35 A;  3GW2 A;  3I53 A;  1VQM I;  4KNY A;  1YYV A;  2NNN A;  3J81 K;  3CLQ A;  3ZMV A;  2EZK A;  3WTU C;  4XRM A;  1Y8R B;  4KJZ A;  2LRD A;  2Q0O A;  2X6O A;  1W7P D;  4BQN A;  2AXL A;  5B3S H;  5GTH C;  2MLK A;  2JZY A;  1VQK I;  2FOW A;  3BZ6 A;  3GTQ J;  4BBS J;  3K2Z A;  1BI1 A;  2QSF X;  4WF2 A;  5CVV A;  4C3H J;  3OSG A;  3WTZ A;  1FEX A;  5FLX Z;  1FJL A;  4GGG A;  2JSP A;  3WTV C;  1K6O A;  1IG7 A;  4XR6 A;  4BU2 A;  4RM2 A;  1G3S A;  5KAF C;  5FLV A;  3IRQ A;  1IV8 A;  1MDM B;  3ECO A;  2YU9 J;  4RM3 A;  4BHP A;  1RNL A;  2JUG A;  4S0H B;  2P7C B;  1BBY A;  2WY8 Q;  5HLG A;  2E71 A;  4BGD A;  2GOM A;  4P55 A;  2L7M P;  1XDU A;  5CVR A;  5KVR A;  3QP6 A;  2DPU A;  2G0E A;  4M9Z A;  2OZ6 A;  3H5A A;  1XPX A;  4RAG A;  2G7U A;  3D5L A;  2M30 A;  3F8B A;  3FXQ A;  1N77 A;  1A04 A;  3HOY J;  3S15 J;  1QZE A;  1ETK A;  1O7L A;  3RQI A;  3IH3 A;  2F5F A;  3QU3 A;  3H3Z A;  1B6A A;  3CP2 A;  3P7N A;  4IHV A;  2R92 J;  5FKO A;  1DP3 A;  4NHJ A;  1XGN A;  2VQG A;  5A2Q Z;  1FOW A;  4PJM A;  1EKE A;  2R7S A;  3Q0U A;  2RKH A;  2G7H A;  4XMY A;  2M9H A;  4A3F J;  2ZO4 A;  4TV7 A;  1WSU A;  3IAM 2;  4IHS A;  1MBF A;  1A6Q A;  3DCF A;  1LEA A;  2KIQ A;  2AQF A;  2HXI A;  3S3M A;  1A5J A;  1R1T A;  1VQP I;  1ZYR F;  3H5N A;  4KMU X;  2V1U A;  1DQU A;  3L9F A;  1BW5 A;  4PK4 A;  1LQ1 A;  3CCE I;  2ME6 A;  3QU6 A;  2IA0 A;  5D4S A;  1WPK A;  3QYE A;  4L5E A;  2FXA A;  3OYG A;  1FLI A;  4IKF A;  3B02 A;  5EGO B;  3WTW C;  3AG2 H;  3K1N A;  2CG4 A;  3WHC A;  3JRD A;  4RGS A;  3DLL F;  1HW1 A;  2O6G E;  2LD5 A;  5K1Y A;  3IRR A;  1B72 A;  3C2G A;  4ENN A;  2LC2 A;  1DP7 P;  3AFH A;  1HKT A;  3DKY A;  4Y52 J;  5FKL A;  1LPQ A;  3LA3 A;  2BV6 A;  2GWR A;  3DFG A;  3SHF A;  2JN6 A;  3GFJ A;  1T33 A;  1X3Z B;  3CCM I;  4QPO A;  1GUU A;  5DM6 F;  3ZMZ A;  2HKO A;  1XG1 A;  1LVA A;  2DJI A;  1TBX A;  2PMH A;  4LMY A;  4ZZD A;  1Z7U A;  1YX3 A;  3JW4 A;  3BG7 A;  3UNG C;  5F0H A;  2X48 A;  2VQH A;  2ISY A;  2QGU A;  3L2R A;  4P9U A;  4HA8 A;  5FJ8 J;  5DUK A;  1Y0N A;  3WE3 A;  2DOD A;  2L4M A;  2KDO A;  2MD0 A;  3CMM A;  1FOX A;  3N97 A;  2JA5 J;  1XGS A;  2KRF A;  2OQR A;  4YII A;  1JE8 A;  4IQ4 A;  4JYK A;  3HM5 A;  2ZXW H;  1Y1W J;  4XOR A;  1B9N A;  2L9V A;  1E2X A;  4D0P A;  3PIO F;  3QAH A;  2K7L A;  3GLL A;  2HS5 A;  3QPH A;  1LDD A;  3OYH A;  2R3S A;  3S14 J;  4O3M A;  4B4C A;  3VDX A;  3HKZ N;  1MNE A;  2RAE A;  2NXN B;  5AON A;  3KP4 A;  4G6T B;  1FPQ A;  1KQ0 A;  2EK5 A;  3GUD A;  4L9V A;  2EV5 A;  3ZR8 X;  5D5V B;  1V3F A;  2D2W A;  4BEH A;  4FHT A;  3TL4 X;  2XAF A;  3TOA A;  3WOD F;  1MSE C;  3PJR A;  2VBY A;  1GV5 A;  5F04 A;  2MG4 A;  2LKP A;  3H9Q A;  3RCO A;  1FYK A;  3HOV J;  2GOX B;  4KN4 X;  1LEB A;  3F72 A;  4OU0 A;  2JA6 J;  4WXC A;  1O3R A;  2E36 A;  4HX8 A;  4XKW A;  5DS9 A;  4S04 A;  5C44 J;  1D1C A;  4FCY A;  2M87 A;  2XVC A;  3I59 B;  4UVA A;  1ORK A;  4C30 A;  1OCZ H;  2ZME B;  1YTY A;  4BY1 J;  3BCB A;  1QRY A;  3DKW A;  1TWA J;  2GXA A;  2A6E F;  2DQL A;  2P4W A;  1B9M A;  1MIJ A;  2FRH A;  4HNT A;  4DBR A;  3CF5 F;  2XC7 A;  2BE5 F;  2IA2 A;  4Z6Y A;  3WG7 H;  1LDK B;  1TZL A;  3L00 A;  4BQA A;  3JRA A;  1GHC A;  4A0X A;  4NQW B;  3M1C A;  1F43 A;  1FYM A;  2QWW A;  3WU0 A;  4M6V A;  2FE3 A; 
#chains in the Genus database with same CATH homology
 1AA7 A;  2L9S A;  3S3O A;  4BUP A;  1SFK A;  2XDV A;  3OS0 A;  2R7O A;  1Z3Y A;  2WB1 A;  4CCO A;  2KQR A;  5KCM A;  1W36 C;  5HVQ C;  2RRE A;  4E7H A;  2MC4 A;  2PMZ A;  3HL2 A;  3W2A A;  3I9V 2;  4BE1 A;  4IZZ A;  2JA2 A;  3K10 A;  4II2 A;  4XOP A;  1WJC A;  3MKY B;  2LBF A;  1Y56 A;  3DLA A;  3HC7 A;  4JQF A;  5HLT A;  1WJE A;  1LFP A;  2LY2 A;  2X6X A;  2BW3 B;  4ZYA A;  2VKH A;  1D1A A;  2WBM A;  1KON A;  4CUG A;  2IXS A;  4MLO A;  4E4H A;  3A2K A;  1J09 A;  2DT6 A;  3IAS 2;  4B43 A;  4XNF A;  1T0F C;  1MMN A;  4YRV A;  2LH9 A;  4BDZ A;  3VSK A;  4BQQ A;  3LL7 A;  3OYB A;  4E7I A;  4EAT A;  4CCK A;  4R79 A;  3K6G A;  4ZDL A;  3DU6 A;  3HXL A;  3U21 A;  5CQE A;  2E1M B;  4YEJ A;  2RQQ A;  1UEL B;  3OR2 C;  3H5R A;  1OLT A;  2VQL A;  3QYB A;  1WJD A;  4J00 A;  1QHH D;  4ZJZ A;  2CUJ A;  2MAB A;  2IS1 A;  4YEL A;  5CQG A;  2L5Q A;  1Z7L A;  4FAS D;  4F91 B;  5FRN A;  4B3X A;  4ITV A;  4LG3 A;  3VWB A;  1JI8 A;  2HPI A;  1P9Q C;  1MMA A;  2KL4 A;  3OMY A;  4J01 A;  3S3N A;  4F3Q A;  5HNF A;  1IRX A;  1MW7 A;  2V7F A;  3OS2 A;  2K9M A;  2M7A A;  3MKW B;  3NWS A;  1MMG A;  2HQA A;  3L2V A;  2IS2 A;  4BQO A;  4DIQ A;  2LBF B;  4XLC A;  1UAA A;  2W82 A;  2HVS A;  4F55 A;  1V5G A;  2RNG A;  3BCA A;  4DOZ A;  1D0Z A;  3LSI A;  2VJI A;  4PFP A;  3DKX A;  2QKM B;  2VJ4 A;  2K3P A;  3A4C A;  4BJT A;  2LOO A;  3DPL C;  2I8D A;  4DGW B;  2R7R A;  2Q1Z B;  1SAU A;  1N78 A;  2IGN A;  3VYR B;  2OC6 A;  4CCM A;  2M4K A;  4XKV A;  4BXF A;  1N75 A;  4PJJ A;  3ZGK A;  2XF6 A;  1UG0 A;  3DTI A;  3CJR B;  4E7Z A;  4N4O B;  4IX7 A;  2PJR B;  4H4K C;  4RMN A;  3N05 A;  5HNH A;  3A1Y A;  3OOU A;  4DBQ A;  2X51 A;  2R7V A;  3KX2 A;  3SEZ A;  3OYN A;  3QYF A;  3G2B A;  2BOL A;  2L9N A;  3W2V A;  3I3L A;  3PNV A;  3K4N A;  3AKZ A;  4KT6 A;  2M4G A;  4BE2 A;  3RQ4 A;  2VJ5 A;  3QOE A;  4B44 A;  2V9K A;  4F92 B;  2NOJ B;  2ZSH B;  1MMD A;  4PSW A;  3LFU A;  2HVQ A;  4C2T A;  2WAD A;  4ZDO A;  4CH7 A;  3OYD A;  1BR1 A;  1QU3 A;  2CV1 A;  4OAY A;  3ZXS A;  4PSX A;  3FBN B;  4II3 A;  3OYC A;  1D0X A;  4P1W A;  1DGR M;  2VLA A;  2CW7 A;  2M3A A;  3LSM A;  3W3C A;  3K70 D;  3CZ6 A;  4C2U A;  3BLY A;  3W2W A;  4F52 A;  4BAC A;  5HOO A;  4D9J A;  3TBI A;  2IS4 A;  2W00 A;  1X1A A;  1X1D A;  4AVZ A;  2IGM A;  3K4M A;  3BG6 A;  5CKT A;  1WJB A;  3F9K A;  4U87 A;  2ELJ A;  4XN0 A;  3NWT A;  2ZXH A;  1PJR A;  2F4I A;  2CMP A;  3DWL E;  3EUA A;  2V6E A;  1QHG A;  3PSF A;  2XF5 A;  4E7S A;  2MFZ A;  3FBI B;  3ZCO A;  2W1O A;  4HEA 2;  4XL9 A;  2VL8 A;  4OAZ A;  2KPM A;  3EPZ A;  2L7K A;  1LVK A;  3VYT B;  2OUM A;  3OR1 C;  5FRO A;  4ZTF A;  3AL0 B;  2KHM A;  3L2U A;  2LRE A;  2XF7 A;  3K4J A;  2VXZ A;  3DQV C;  4ZC3 A;  2ZFU A;  2IGO A;  5CPR B;  2F6C A;  1X19 A;  4BL0 B;  4IQJ A;  3H0D A;  2E1M C;  1U0J A;  4XLE A;  2L2O A;  5FRM A;  3OL3 A;  4XLF A;  2K9L A;  4NUB A;  4ANJ A;  4OWR B;  2HPM A;  4XKB A;  3HOT A;  3OS1 A;  2R7U A;  2ZXI A;  1TT0 A;  3HPH A;  4F93 B;  4E7J A;  2V4J C;  3RTR A;  3OYA A;  2R7W A;  1OR7 C;  3OYL A;  1WJ5 A;  2W4S A;  2WAQ A;  2E5Z A;  4BJ5 C;  3K70 C;  3PFY A;  4KIS A;  3HG9 A;  3SZG A;  3K4B A;  4BDY A;  2VXD A;  2KLO A;  2FUG 2;  3OL4 A;  3E0J B;  4BJ6 C;  4HSR A;  3GBG A;  2VB6 A;  4RLQ A;  4CSW A;  2X6W A;  2BVL A;  4LIT A;  3OWT A;  1E0E A;  1X4O A;  2R7Q A;  1ZEL A;  2WAF A;  4NNJ A;  2DOA A;  2UWM A;  3E1S A;  2MYS A;  2HNH A;  3CJQ B;  1G59 A;  3MKZ A;  2V1N A;  3PUB A;  3V42 A;  1HA8 A;  3MD2 A;  1T95 A;  3DTE A;  2VIX A;  2KZV A;  4KJZ A;  2BW3 A;  2LRD A;  1W36 D;  4CZC A;  2R4G A;  4BQN A;  1BR4 A;  3BC8 A;  3S32 A;  2VJJ A;  1D1B A;  4Y33 A;  4XQF A;  3TMO A;  2Z1D A;  3HKZ A;  5KNL A;  1R6R A;  2V26 A;  4CCN A;  1GLN A;  2E5N A;  2X1C A;  3L2W A;  4HNU A;  2JSP A;  2Z2S B;  3AL0 C;  1S9H A;  4XR6 A;  4BU2 A;  4D1Q A;  3K4L A;  3QOD A;  4RM2 A;  3RPU D;  2LY1 A;  3OYF A;  3HPG A;  2E60 A;  4RM3 A;  3CES A;  5LD2 C;  2JUG A;  3OYE A;  2KP6 A;  3H35 A;  3DTK A;  4XOT A;  2WY8 Q;  2LG4 A;  1LKX A;  4B48 A;  4BGD A;  4ZTJ A;  4FET A;  2GOM A;  5KHD A;  3SYT A;  2CV0 A;  3VYS B;  1BR2 A;  4CCJ A;  3HOS A;  3H5A A;  2XSJ C;  2WAE A;  3LSG A;  4E7L A;  2Q2E B;  3D5L A;  2XAU A;  1N77 A;  4PFO A;  2CH0 A;  3D5S C;  1WJF A;  3PSI A;  3PL8 A;  1EA3 A;  4BS9 A;  3LMM A;  2M0M A;  4N4N B;  3CP2 A;  1DP3 A;  4Y3O A;  2WA0 A;  3PNY A;  2VQG A;  1BOB A;  4PJM A;  2R7S A;  4PJL A;  4C9Y A;  4XMY A;  5LFA A;  4XKC A;  2R7X A;  3IAM 2;  4E6K G;  4GRI A;  2O5R A;  2CUZ A;  1NG6 A;  2AQF A;  3S3M A;  3H5N A;  3OYM A;  1DQU A;  4XLA A;  2VAS A;  3ZRG A;  1V5E A;  4PK4 A;  3IP4 B;  1V5F A;  3QYE A;  3OYG A;  1X1C A;  3FDY A;  4IKF A;  3OY9 A;  2HVR A;  2K5C A;  1WJA A;  1FMW A;  1YE9 A;  4HG2 A;  3ONQ A;  4NC7 A;  3HUG B;  1K6Y A;  2OV7 A;  3VYU B;  1FMV A;  3RSN A;  4NC8 A;  5TGT A;  2UUZ A;  2CW8 A;  3C2G A;  4DJA A;  2LC2 A;  3KYL A;  2ZSI B;  3AFH A;  4E7K A;  3DKY A;  3SDB A;  2M7B A;  4PUS A;  4BEH B;  1MND A;  2CFO A;  2X6Y A;  3DPT A;  3FHN A;  4LIU A;  4U7B A;  3SEQ A;  4CA0 A;  4B47 A;  2UV1 A;  3OIP A;  2WY7 Q;  4QPO A;  2DJI A;  2LYC A;  3PNT A;  4CCL A;  1YX3 A;  3BG7 A;  3UNG C;  3KEY A;  3VSL A;  4JOM A;  2VQH A;  2DT7 B;  3L2R A;  3OYI A;  2VKD A;  2Y0S A;  3M8J A;  3CP8 A;  2VQC A;  2QKL B;  3S93 A;  2R7T A;  2IGK A;  3H9J A;  4AYB A;  2KDO A;  2PJR A;  4PJN A;  2MD0 A;  3CMM A;  2KMU A;  2KRC A;  4IQ4 A;  2DXI A;  3OYK A;  2IS6 A;  4XOR A;  1X4P A;  3OIQ A;  3UR3 C;  3IUO A;  1Y6I A;  2A6T A;  2DCE A;  3CF2 A;  3OYH A;  2HZD A;  3VDX A;  4HRI A;  2JVG A;  1MNE A;  1D0Y A;  4G6T B;  4QPQ A;  3ZR8 X;  3FKJ A;  2CV2 A;  4BEH A;  3C2H A;  3TL4 X;  2HU9 A;  4AU7 A;  2KRH A;  3PJR A;  4X0G A;  3S8P A;  3DU5 A;  2X1E A;  3H9Q A;  4Y4R A;  3RCO A;  2BVM A;  2GOX B;  3DEE A;  3OYJ A;  3ZQQ A;  2P0W A;  2W7N A;  3D5R C;  2AQE A;  2CS3 A;  2X1D A;  1G8X A;  2F5V A;  2A5W A;  2X85 A;  3LSK A;  4XKW A;  3L2Q A;  1WFX A;  3K4C A;  1D1C A;  1PYV A;  3MMY B;  2HDW A;  1NG7 A;  4C30 A;  4BE0 A;  4ZDP A;  3BCB A;  4RLF A;  1ERD A;  4LIV A;  4XLH A;  1YX5 A;  3J7A Y;  2VPL A;  3LSH A;  4KIT B;  3K4K A;  4P5O A;  4HNT A;  4XM3 A;  4DBR A;  1Z3X A;  3EUH C;  4HST A;  4HPQ A;  1X1B A;  3EUK L;  3H9G A;  2XC7 A;  1LDK B;  1TZL A;  1VZ0 A;  2JVH A;  4XN3 A;  4XON A;  4NQW B;  2Z16 A;  3M1C A;  1DGW Y;  5JHF A;  1Z21 A;  3DPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...