2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANKYRIN-REPEAT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Structural protein
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
2VJ5A 5HOOA 4CHUA 3KCCA 1IV6A 1JGGA 2H8RA 2YR2A 1HQCA 3OR2C 1B4AA 2LH9A 3A0HC 4I09A 4ENNA 5E79C 3D5SC 2YU3A 3T5XA 1E0EA 4HX8A 5K5RA 2X51A 3KYCB 1DGRM 4NDLA 4Y13A 2NNYA 3K10A 1FTTA 1IXSB 1TW2A 2M0MA 4HSTA 4KT6A 5FKMA 3RKQA 2ZJPF 4EM2A 4FTHA 3HHHA 4RM2A 3HRUA 2O8KA 2EIKH 1FOXA 3RJPA 3DU6A 4LGWA 3EUKL 2CO5A 3DP7A 4BXUA 3RZOJ 2HXIA 3P9IA 5GTIC 3SEQA 3C1DA 5FKKA 2JPBA 3M8EA 1BC7C 4I02A 4M9ZA 2UXNA 5IY5H 2R7XA 1FJLA 1U9NA 4OIQF 4NQWB 3F21A 2D2WA 2LYCA 3BR2A 2PEXA 1FMWA 2CUEA 1D1BA 2M9HA 2OZ6A 4A0YA 2GWRA 2LY9A 2CV2A 1W36D 2RVCA 4MNUA 3E3VA 4ZZLA 3LQQA 3FK7A 2BV6A 2L54A 1QZYA 1YIOA 1X1DA 5C4JJ 1E2XA 3RDIA 3QP6A 2Y0MA 1XCVA 2X6OA 4JX5A 3CMEI 2Q8KA 2Z2SB 2Y75A 2A3SA 3FX3A 1STZA 3L1PA 3L2UA 2VODA 2V1DA 2A6EF 1EKEA 3WG7H 3BZ6A 3TBIA 4A3IJ 4ZZDA 2NVXJ 1YJNI 2ZO4A 1WJCA 3TOBA 5CVJA 5FLXZ 5E3NA 3OR1C 4DOZA 1ZG1A 1TTYA 3V4GA 4Y15A 5LRRA 1BIBA 2VJ4A 5F0CA 2Z9OA 2QWWA 1HOMA 1ZHFA 3K4MA 1KQ9A 4X6AJ 3E7LA 3JRDA 4IKFA 3ZQ7A 2PI0A 4HQMA 2DW4A 1VQMI 3BOQA 3GBGA 4A3MJ 3IV5A 1I6HJ 1ZTRA 1XGMA 2NVUB 3U9GA 2HKXA 4NC6A 4II3A 3ISPA 2EIJH 1BN5A 5IP6A 5D8KB 3GTPJ 4BQOA 2DBBA 2DAOA 2ELKA 1MBJA 4OIOF 1S7AA 3F23A 3KLNA 1TBXA 2WY8Q 4D1QA 3CP8A 2MG4A 4P5OA 3HOXJ 1BR4A 5JHUA 2BOLA 4NC7A 2BHYA 3FIWA 5HDGA 4KMFA 1ACIA 3UR3C 4LG3A 2NYXA 2KMUA 4HBLA 4PGHA 3MWMA 4LJZF 2L9NA 2ELJA 2E1OA 3OYLA 2VIXA 3M8JA 1Z6TA 4KUMA 3VYSB 4FHTA 4GFBA 1JHHA 3TGNA 1UELB 3QYBA 4XKWA 3CO6C 2M7BA 1Y6IA 2TCTA 4XM3A 1D1AA 1FNNA 1H9GA 2ZMEB 3FMSA 5E8GA 4PJMA 2M8EA 1WI3A 1U2WA 4A6EA 4RGUA 2HQ5A 1KU9A 1LQ1A 4D5CA 2P5VA 2DA4A 2EH3A 2X85A 1SEUA 5DYMA 2RN7A 1UFMA 2A07F 4EJUA 2KDOA 3BPVA 5EG0A 4BY1J 4IHYA 5CKTA 3JRCA 2DDAA 2CUJA 3EDPA 3HC7A 5HLIA 5K7ZA 4BJ6C 4RGXA 4GDFA 2VL8A 4UV8A 3VSLA 4Y3OA 5DM6F 3ONQA 2H6BA 4G7HF 2A05A 2XASA 1PYVA 4M73A 3RPUD 2EK5A 2O9LA 2VBWA 1VQPI 5EGOA 1BOBA 2ZSIB 3MKLA 2DTZA 3WTUC 3CO7C 4UHTA 3S16J 2L7ZA 1VQKI 2VKHA 3CCEI 2JA6J 2VPLA 3GX4X 5IP7J 2LLKA 4C3JJ 2OD5A 3HGGA 3ROUA 1OLTA 2HTSA 4F91B 1WJ5A 2QSGX 3CMAI 5H20A 4RGSA 3PL8A 4IJAA 1RR7A 3N97A 1WCMJ 3MKZA 1D0YA 1XMXA 2DI3A 2LVSA 5J4VA 3VDXA 3NQOA 1OCCH 3C3WA 3HZJA 2AXLA 3OOPA 3TW7A 4AC0A 2DFIA 3BTCA 4XLFA 3BDDA 4BQNA 4EJWA 1JHFA 1CQTA 2DT7B 4RM3A 5E3LA 4XKBA 1XPXA 1GVJA 4CGZA 2HZDA 1GT0C 4RMNA 2JUGA 3AKZA 3H3UA 3V8LA 3D1NI 4J00A 1S9HA 3V8JA 5GPAA 4F7ZA 3L7WA 5HS7A 4NB5A 1JKOC 2ID6A 3EPZA 4MTDA 1BL0A 2ESNA 1MBGA 2I10A 3G4SI 4L0YB 3CDIA 2K5CA 1X3UA 1JT6A 3SDBA 3VPRA 3RI4A 2GM4A 1E3PA 4OIPF 3CCRI 3MFKA 4JX6A 4PFOA 2LR8A 1PUFB 3HUGB 4AYBA 3JRHA 2HQRA 4OOIA 1G6NA 2P6TA 1UG2A 1APLC 2RQQA 3E5UA 1SVLA 2O3FA 1YW7A 4I0AA 4B3AA 3GZ6A 3CCVI 3OIQA 3OS2A 1J5YA 1RPWA 4EJTA 1ZRDA 4P96A 4UUTA 2DQLA 1T2KA 1UB9A 2ZNZA 3K2AA 2PFBA 3K4LA 4XOPA 4XLNF 3CCYA 2E2JJ 4XL9A 4RS8A 1R58A 2NVTJ 1TNSA 1X4PA 4RDUA 4WXDA 4ZTJA 2W85A 2DOAA 3IC7A 1FYMA 4IHSA 3M07A 3S2HJ 4IOAF 2FE3A 4MGRA 2ZKZA 5KNLA 3LWFA 1K79A 3QPTA 4IRHA 3WE3A 4HRIA 2OCEA 3TMOA 2GIZA 2IPQX 3RQ4A 1Y0NA 3OYAA 2W48A 3JRAA 3S3MA 3K6GA 4JBAA 5BOXA 4C9YA 3IL2A 1HBXG 2WAQA 3FXJA 1ZGAA 2IGKA 3IH2A 2NXNB 2OJED 3PQJA 1U8RA 1AOYA 1RNLA 4ZJZA 1N77A 4PUSA 1BJAA 2FBIA 3BR3A 5EZGA 3K0LA 5J40A 3QOPA 5BQTA 3HOTA 3OY9A 3B6CA 1R5ID 3HSFA 2F4MB 2GAUA 1J9IA 1HDPA 3LNQA 1LJ9A 3CJNA 2ETHA 4HDUA 2LMDA 2FX0A 3N05A 2DJNA 2Y9ZA 1MBFA 3QQAA 1ZRFA 3I58A 2PBIA 4ESJA 1AWCA 2EA4A 1Y1WJ 3LA3A 3IWFA 3OV8A 2VXDA 2HOAA 4KN7X 2BZTA 1R71A 2JQ7A 3WU0A 1I3AA 2XDVA 1X1CA 1MMSA 1ZQ3P 1ETQA 1MH3A 1Z77A 2E5ZA 2ZXJA 1K78B 1KGSA 3S1MJ 2M0CA 3C2GA 4CYCB 4D7NA 3L2WA 4M3DA 3F8MA 4H4KC 3BG5A 3J81K 4KJZA 1W5CC 4A5MA 3R60A 2HKOA 1OISA 2CH0A 2HR3A 4RB0A 5IT9K 3ZQFA 2ZMEC 1TWFJ 2CW7A 3G3ZA 4MEXF 2VKVA 4J01A 4A3JJ 2H94A 2FQ3A 3L00A 1FMVA 4M3BA 1B9MA 2Y31A 3H92A 1K4TA 2QA4I 2LDUA 3BTLA 1JJ6C 3ZQQA 1Z91A 3FK6A 3K4NA 4WXHA 5TJJA 5EF6A 3IKTA 3H5RA 3RQIA 3Q0UA 4MEYF 1OQYA 1W4MA 2K9NA 5LRSA 3FDYA 4OIRF 4IL6C 1JE8A 2WB1A 1K4SA 5LD2C 1YFHA 3H9GA 2O6GE 5HLGA 2FNAA 2HFHA 2K86A 1S7OA 1WVRA 4E7HA 3SXYA 4GCVA 1ON1A 1JGSA 1W0TA 4A2UA 3AAFA 2GLOA 2V4JC 1MNMC 2NS7A 4C3IJ 2X6WA 3JRBA 4KIFA 4RAZA 4N9IA 2FA5A 3J7YJ 2KPMA 2VBZA 3WTXC 4PFPA 4UVBA 2G7HA 2LFBA 2PMZA 2DLLA 5ICCA 5FROA 2EA2A 3W2WA 1JT0A 3QAHA 4RAFA 2GA1A 1WI9A 3A01B 2M5WA 3ZMSA 3OYKA 3OSGA 2NOJB 1UHSA 4RBOA 2RGVA 1YITI 5IYBJ 3FBNB 2HVSA 1QHGA 1IDYA 1MMDA 5ICGA 3DCFA 1IN4A 3CF2A 1WSUA 3BROA 2LF7A 4B43A 1W7PB 3QWLA 4CA0A 1WH5A 2XKPA 3U1DA 1B9NA 4G8XA 3KP7A 3G2BA 2NVQJ 1MMNA 1R6RA 1FEXA 2BW3A 3PNTA 2Y2ZA 2PJRA 4XN3A 3GO5A 3ABTA 3SZGA 3TP0A 3D5RC 1TWGJ 2VC1A 2J5PA 1IRZA 2QQAA 1BR2A 2H8WA 1UCRA 3K4JA 5JLXA 5E1XA 4KT5C 3ERMA 2RNJA 4XLEA 4QIWN 1W0UA 2QSFX 4L9TA 4EM1A 1ODDA 2E5NA 2ECBA 3I0TA 1YS7A 1SANA 1BW6A 3REOA 5DCFA 1KZHA 1IJWC 2XVCA 1QNTA 3E5QA 3SZTA 1W36C 3EUHA 2WY7Q 2B0LA 2QGUA 3ASOH 4LMYA 1FOWA 2JSPA 2JVGA 2QQBA 3H9QA 3HRTA 3LSKA 4C2MJ 1ORKA 2OZUA 3KZZA 2VASA 3MCZA 1J59A 4KFCA 5IYCJ 3BT9A 1FPQA 1FP2A 2Y0SA 1LFBA 2HS5A 3B02A 2DDBA 1GV2A 4DYQA 1USSA 3MVPA 2VN2A 1FYKA 2W82A 1YRNB 1HSJA 4S0HB 3IHUA 4BU2A 2XROA 5E20A 2CQXA 4KA4A 1V55H 3KFWX 3J7AY 2Y69H 4S05A 4RB1A 2KIFA 2NS8A 4Y4RA 5E18F 1T0FA 1IUYA 2L4MA 4A3DJ 1TZLA 2YX4A 4A93J 2ZXIA 4A0XA 4BEHB 3O6BB 4JYKA 1J0RA 2LKXA 1HKSA 2FOWA 1YOVB 1L0OC 5K5QA 4CXFA 2C6YA 3MQ0A 1AKHA 2L7MP 5D5WB 1LEAA 4A12A 2DYRH 2BEOA 4U88A 4HNTA 3VSKA 1E3OC 3GYHX 3CC2I 1MSEC 3GEZA 2X1CA 2VE9A 1PJRA 1BI3A 1ZGWA 5CVRA 1FBSA 3HKZN 2JSCA 2EV6A 1TW3A 3SZPA 1R4NB 4B47A 4WXCA 5LGTA 2DA3A 2ZSHB 4W1UA 4DW6A 1DDNA 1XDUA 3K2ZA 4EGZA 5EZHA 2CW8A 4Y7NJ 4B44A 1A35A 3HOWJ 2H1KA 3E5XA 4NHJA 4XRSG 3J7AO 1KA8A 3V42A 1HC8A 2W84A 1AA7A 4UB6C 4PSWA 4BL0B 3V7SA 1JKRC 3HSRA 2R5YA 2ISZA 2EFNA 2WTEA 3D0SA 4D5FA 3E6DA 3HGYA 1RC9A 4PCQA 3BJ6A 4Q47A 2QSHX 4CCJA 4DYCA 5GPCA 3GFJA 2L5QA 1O3SA 1YYVA 3HOUJ 3ZRGA 3AG1H 2MLKA 1B72A 4KITB 1KQ0A 3M4OJ 3E6CC 1TQPA 3WTYC 1MJ9A 1RETA 2BXZA 2O7OA 4G6QA 4BHBA 2R0QC 4ZDLA 4BACA 1GLNA 1I1GA 2Q1ZB 3DBHB 2HYGD 3ASNH 3CP2A 3CQZJ 1V4RA 1OKRA 4Y17A 1OR7A 3AG3H 2VJJA 2R7WA 5FJ8J 1VNDA 1YTYA 2M8GX 1YQAA 2R4GA 2L9SA 5M5XJ 3TEDA 1NK3P 4IVNA 1OMIA 3BCBA 5FLMJ 2KJBA 3FWEA 1RKWA 2NVYJ 3KIOA 3MD2A 1XDSA 3JCUC 4A3BJ 1XGNA 2MA3A 5M5WJ 1UHWA 2ME6A 2DYSH 3DTIA 1R1UA 1VTNC 4JP0A 1K83J 1LFUP 1X1BA 4MQVA 2CUZA 4FETA 3AL0B 2K3FA 4O5VA 3ZMTA 4YG2F 3S8PA 3FXUA 4MLOA 4O3MA 5E17F 1WFXA 2CS3A 4GXOA 4CYDA 3GXOA 2E60A 2Z5UA 4XSXF 1T33A 4HAMA 1L3LA 1F4KA 1N78A 3ABUA 1BW5A 1V3FA 5E3OA 4AVPA 1HW5A 3H36A 4P1WA 1AU7A 3KYDB 3K1MA 4B09A 1J75A 1FZPB 2K7LA 2UXXA 3FKJA 2NOGA 2W24A 4Z2YA 2QQ8A 1I6XA 4XLCA 1MJAA 5DV5A 3OYBA 1XSDA 3PSIA 3WTSC 2X6XA 4UXNA 1QPIA 3PJRA 2BY2A 1ZGJA 1E3HA 3WGIA 3CMYA 4YFNF 2V6EA 2R7TA 2ZB9A 2EZKA 2RAEA 1P7IA 4DBQA 3HDDA 2ID3A 2IT0A 3M1EA 2IJLA 3R0AA 4E7IA 3KLOA 1QU3A 1A6IA 5JR3A 3BG7A 1WZ2A 3K4CA 2R7ZJ 3FXMA 4BHCA 4RAGA 2JA8J 5E1WA 3SJMA 1RZ4A 1B1BA 5M3FJ 3MKYB 5L3FA 2BHZA 3BZKA 3GTOJ 3CESA 1PUEE 2VLAA 1KU2A 3P9CA 4WCGA 1JUMA 5DD8A 1B59A 1Y0UA 2VQCA 3I56I 1S8NA 4BDZA 1LDDA 3KP5A 4A3GJ 1I50J 5J1RA 2P5LC 1VF9A 4L0ZB 2QYOA 2VQLA 4B48A 2LTPA 3TO7A 2QBYA 4FCYA 3E6BA 3S1RJ 3LFKA 3GLLA 3W2VA 4XLAA 1VQ9I 2ZJRF 2E1NA 4FASD 2FUG2 3KP4A 1XGSA 3WHBA 4M74A 1ITYA 5FLVA 4G94A 4RLQA 2OPTA 3JRIA 4D9JA 2BXYA 1K7AA 3KP2A 2KIQA 1YI2I 2ECCA 5JVTA 1MW7A 2DOEA 5C4XJ 3PNYA 2HXOA 4HX4A 5FKNA 4CCMA 5DUIA 2DMUA 2JVHA 4ITVA 3JAMK 4XLPF 1QO0D 2STTA 3QU3A 3HBLA 1O7FA 2OU2A 3I53A 4DIQA 2K02A 2MW8A 1V5FA 4QWQA 1BR1A 2BE5F 3DKXA 2BVMA 1R9TJ 4A3KJ 3F8FA 2A69F 2RC4A 3FM5A 2XF7A 5F1JA 4Z6YA 3KEQA 1XC5A 3GTJJ 3FMQA 1R4MB 3M7GA 2QEXI 4LD5A 1DGWY 4C2UA 4A5NA 1D0ZA 2OUMA 5ICFA 4CSWA 4U7DA 1YW8A 3GZNB 4QLCU 2VT3A 4Y33A 3O8HA 1CF7B 2VPRA 2O0YA 2X48A 3SFIA 1SFOJ 4IOCF 4PDKA 1WQ2A 2R5ZB 5FD5A 1I5ZA 2AXTC 2PMUA 2R7VA 3S2DJ 3F8CA 4FE7A 4XONA 4RA2A 4UY8I 1GVDA 2LRDA 5E8IA 2LC2A 3ZQHA 4E4HA 1D0XA 1S5LC 1ZYRF 3GTMJ 4ANJA 1BBYA 1BIAA 3ABKH 2QUFA 3ULQB 3DPTA 1MIJA 4E7ZA 5GTHC 1USTA 4LG0B 3E6MA 1XB4A 1IRGA 1OCRH 1DU6A 3ABLH 2P6SA 4XMYA 4YIFA 1O3RA 2HPMA 4HA8A 3RCOA 4M6XA 2VUMJ 3MKWB 3H9JA 5B1AH 2DU9A 5LGNA 1ULYA 4IHWA 2LBFB 1P6RA 2FOKA 5FB2A 1IN6A 3W3CA 3D5LA 3HSEA 2EQRA 5B3SH 1T08B 2D1VA 4YFXF 2OTLI 5LEJA 5B66C 1U0JA 3J81Z 2PN6A 5M5YJ 4UVAA 5EYRA 4MQ9F 5AIPA 5BMZA 1VQLI 3Q0WA 1FY7A 1TLHB 1IXCA 1IN7A 5IT9Z 4YIRX 1IUFA 2DO7A 2XRNA 3N4MA 1XGOA 1DP7P 3AL0C 4F92B 1HW1A 3COAC 4XKCA 3IRRA 3ZGKA 3NARA 5HODA 2A68F 3RTRA 3KE2A 3GF2A 4V2GA 4HLYA 1ETXA 3S14J 2FEZA 2CW0F 2CGPA 1W7PD 1LUJB 2XKOA 3PIOF 1ETYA 3DTKA 3C18A 3FBIB 4HNUA 3HOYJ 3ELKA 4NUBA 5KAFC 3T0YA 3TL4X 1R36A 4GGGA 1IN5A 2VBYA 1X4OA 5FRNA 5F27A 2E1MB 1HXDA 1V54H 3E97A 3C2BA 4DZPA 4L9VA 4I0BA 3GMEA 3BWGA 5FLXK 1LKXA 4O6JA 2XPWA 1BOAA 2KRFA 2Y48A 4BQQA 2MGQA 5H2FC 3P9KA 2GIVA 2PG4A 2EZLA 3OYDA 1FYLA 5JI6A 3MAJA 4I01A 4AYBN 1O7LA 2P0WA 2BW3B 1R7JA 2ZJ2A 3BC8A 3K69A 3SEZA 2JZYA 2DODA 1MMGA 4AU7A 2XRLA 2W4SA 2KRCA 2WAFA 1I39A 3A02A 3GTQJ 3HG9A 5L3DA 1VQ8I 1S3JA 1RUNA 1ZELA 3WGHA 2Z33A 3K1NA 3KEOA 3OYCA 2HOTA 2LY1A 5HS9A 5IP9J 2OV7A 1SD5A 1GDTA 1UZCA 1MSFC 4QPOA 4LLLA 1K6YA 3S1NJ 4N4OB 3SFZA 4NNJA 3ZQLA 2CV0A 4UNOA 4A3LJ 1NH3A 3VEPA 4KN4X 2R92J 1YE9A 3JRGA 4ETSA 3DWLE 3DBRB 1ETWA 4UUSB 2KLOA 1IF1A 1IG7A 3JSOA 1SMTA 5KHDA 1QVUA 2E71A 3TQNA 3WTVC 5JVGF 2Q2EB 5KAIC 3I3LA 5DD4A 3HRSA 1R1TA 2WAQN 4ABZA 3I5UA 2EIMH 1DPRA 2G0EA 4B1RA 1SFEA 2F5FA 2XB5A 1G3YA 1ZLKA 1H88C 2EZIA 5F64A 2ZFWA 2EV0A 3A0BC 4L18B 5EEHA 3GTLJ 2K4BA 1Y56A 4MFEA 4XRSA 1RESA 1F9NA 3UNGC 4KYWA 3K4BA 4KMUX 5ED4A 3TO9A 4EEFG 3G1LA 2CFXA 2E7XA 2KZVA 3VOEA 1SAXA 1HW2A 4HNVA 1V5EA 2DMQA 1PP7U 1R5GA 1IRXA 3OYJA 1TQIA 1HKQA 2ZNYA 3CCUI 4HZFA 1X2NA 1XSVA 1YLFA 2ZMEA 3OYEA 3CDHA 3LFUA 2WAEA 3OYNA 1IRFA 4M9SA 1BA5A 3G1OA 1IN8A 4KISA 1NTCA 1LE8B 2JT1A 3O3KA 3CC7I 4U0VA 5IT3A 4HEA2 3TDZC 4OAYA 2E1CA 2K85A 4CH7A 2R7FA 3BQZA 3LAPA 2BBYA 1ERDA 3TO6A 5DCMB 3DPLC 5CVIA 4EGYA 3NWTA 3GUDA 4AM3A 4E6KG 1Z3XA 3R6SA 2IXSA 2GQQA 3I59B 3W2AA 1JTXA 2X6YA 1ETOA 4LFUA 2JK3A 2MBFA 2XIGA 3J80Z 2KJCA 1ENHA 4PJNA 2IA2A 3S17J 3WGGA 1KYWA 2G7UA 1YX3A 3J7ZI 4GYIA 5F0FA 2GOXB 3JW4A 4DGWB 1MBEA 1V5GA 1U5TB 3R61A 1Z9CA 2MC3A 1PP8F 2MD0A 1ZREA 2Y30A 5L3CA 4GO1A 5L3EA 2L9RA 5CVVA 4BYYA 1JXSA 2WB1N 5F1RA 3SDGA 2CYYA 2PX9A 2DA6A 2VXZA 2V9PA 2XAGA 3HRMA 1P4XA 1RUOA 1O4XA 3QYFA 4P9UA 2GOMA 3S3NA 4XN0A 3MMYB 2VONA 3F8BA 3QRFF 3AG2H 4CCOA 2HYFA 3CUQB 2X1DA 1RI7A 2XGCA 1X3ZB 1Z7LA 3AG4H 4CUGA 2JA5J 2G9WA 3CF5F 2XB0X 4LLGF 4YELA 3CJTB 1B8IB 1DP3A 1T39A 2BY0A 1FIPA 2DMNA 2K9LA 2MSYA 1BJZA 1NG6A 2HWVA 5FRMA 3HTUA 1OFCX 2LG4A 4IPAA 2QKMB 4BKXA 1PUFA 3HUGA 3SYTA 4MIMA 2CWEA 2ZJQF 4MTEA 3EQLF 4PZJA 4YEJA 5J1YA 1RR8C 2E1MC 5AIQA 3IRQA 1MNEA 3U1KA 2WV0A 1ZR2A 5FFZA 3T1BA 4M3FA 5FO5A 3WU2C 2LSOA 1YO5C 2LKPA 2FQ4A 1XD7A 4BXXJ 5BPIA 2L0KA 4C2TA 1XS9A 2QENA 2ZXHA 1LEBA 1IV8A 2RQPA 2KDZA 3ZMUA 2FRHA 2I8DA 2OBPA 3GFIA 3S15J 4BUPA 1HDDC 4A3FJ 2L3DA 3ZQGA 2NNNA 1W5TA 2XF5A 2R93J 3WTTC 1ZK8A 2DTRA 2YSRA 3DKYA 1A04A 4BQAA 4XRMA 5A2QK 3BTIA 3GWZA 1JKPC 1TL8A 3C7JA 1VQ6I 2K9QA 3CCQI 3RPQA 1RKTA 3L2CA 3U2RA 1Y39A 2XSDC 5BPDA 3GW2A 4HYEA 1FTZA 4W97A 2F5EA 4BDYA 4QTRA 1GXPA 1HKTA 4ZC3A 4QPQA 3L09A 4ZYAA 5IPAA 2FBHA 5TRDA 2HVQA 1TWAJ 3JRFA 3CLQA 2HYJA 3PIPF 5J6XA 3KETA 2KFDA 2K9SA 1LDJA 2EZHA 4HV6A 4AUXA 4V19K 2BY1A 1FLIA 3BP8A 2E7WA 2QQ9A 2W7NA 2DXIA 3DLAA 1TNTA 4HW0A 3BZCA 1GUUA 4I2OA 5TISC 1D5VA 1U6GA 4M3EA 1P4AA 3DLLF 1HF0A 2EPFA 2ISYA 3M1CA 4AIKA 3VYTB 2HI3A 3OOUA 4KIGA 4A3CJ 4L5JA 4D7MA 4LB6B 3E1SA 1FBQA 2EBIA 2W25A 2DFFA 2V1XA 2LK2A 2P5KA 1MNDA 3DF8A 1YJ9I 4E70A 5GP9A 4E7JA 1SAUA 5LLQA 4FT8A 1R49A 3HTSB 1FP1D 2ESHA 4OWRB 2V26A 3S2WA 2L9VA 3IAM2 3QU6A 2D45A 1K78A 4PJLA 2QBYB 2VQGA 3A1YA 3LSIA 4I7HA 2VI6A 2WC2A 3CD6I 1DPUA 4BE0A 2STWA 5J8FA 2CG4A 3O8GA 4XORA 1Z0XA 2DMPA 3ESWB 2ACJA 4Y52J 1T56A 2IEKA 4IO9F 1G2HA 2IS1A 1GHCA 2GBYA 3CCLI 1G3TA 1A5JA 2ZBKA 5KK1A 2DA7A 4N9HA 3RKXA 2X1EA 4G6DA 5HS8A 4WWCA 2H6CA 5F0HA 3WU1B 3IAS2 3ABMH 2EFWA 2ZC2A 1FSHA 1WJFA 2J5OA 4DJAA 1POGA 2HTJA 3ZP5A 1LPQA 3CMMA 3WHCA 3PFIA 4KICA 2M3AA 4XK4A 3M3YJ 2LNBA 5E3MA 2FMYA 1YHQI 3WODF 2P4WA 2W57A 1MZBA 2UWMA 3DTEA 3BPXA 1VFCA 2JRTA 2EILH 2JRMA 5LHGA 3CLOA 1N25A 2XSJC 4S04A 1HCRA 5CJ9A 1BI2A 1U9OA 2DT6A 4PJ0C 1LVAA 3RPUA 4N4NB 3F3XA 1QGPA 3DFGA 1U78A 1XN7A 3FF5A 2V6CA 1X1PA 3BTJA 1G3WA 1U5TC 4P55A 2F4OB 4XBFA 3A2KA 1TWHJ 3H3VK 4M72A 5EG0B 2BGCA 2ICWG 4BNCA 4A3EJ 2RV8A 3L9FA 4G7ZF 3BG9A 2Z3YA 3GVAA 1IW7F 3PUBA 1OCZH 2WWYA 1VQNI 1EF4A 1IO2A 2QLZA 1O57A 1JKQC 4IX7A 3FM3A 3CUOA 3R4KA 5EGOB 3U21A 2E35A 3VYUB 3A01A 3F72A 2DN0A 3GTGJ 1ETKA 4L9JA 2L02A 2VKEA 4OINF 3CUQC 1DQUA 3L2VA 3F22A 4WF2A 1QHHD 2CSOA 1EV7A 2QCOA 3Q9VA 4L9NA 2B7EA 1W1WE 1A31A 3ERED 1QVTA 1K61A 3LOCA 4HF1A 1IC8A 4XRFA 1VQ5I 4U87A 5LFAA 1W7PA 3GLXA 4ASNA 1BM9A 1R5HA 3LMMA 2B63J 2HQAA 3BQYA 1ETVA 2CFOA 2EB7A 2M45A 2FF4A 2K4JA 1OCTC 1KU3A 1XX5A 1N75A 4L5IA 1VQOI 3ML6A 1T8IA 3OIOA 2CQ7A 2OCCH 1ZAOA 4G9YA 5CQEA 2FU4A 2MH9A 4ZYHA 1TWCJ 4XIDA 3H5AA 4HV5A 5FGMA 2XGEA 4BAYA 3OYIA 3BR0A 6PAXA 2P7CB 2L2OA 4B4CA 4BBSJ 3FISA 4RLFA 4EJOA 3LA2A 3EUAA 4CCNA 2M7AA 5ILUA 4CO8A 4FQGA 2O5RA 2YX7A 4EQQA 4F52A 2Z16A 3EYIA 5DTDA 3RYRA 2MABA 5CVUA 1Z6RA 1S6LA 2BY3A 2JPCA 5FKLA 5F04A 5AONA 4IXAA 4R1HA 1NHAA 1QZEA 1F5TA 3NEUA 5FKOA 2V7FA 3AFHA 2YUSA 2K27A 1M1EB 4K2EA 1MD0A 4M71A 1AHDP 2XAFA 1SFUA 4C30A 1BC8C 3E0JB 1I3QJ 5D4RA 3CCSI 4DNCA 4I99C 1Y1VJ 2DT5A 3DPUA 3RYPA 1EJ9A 4RGRA 1YIJI 2KL4A 2GXBA 3W6KB 3HB9A 2DK5A 2PQ8A 4LB5A 1F43A 3GCMA 1IXRC 2LY2A 4CZCA 4CCKA 1YRNA 1F1ZA 3TW6A 1Q1VA 1JJ8C 3H3ZA 4OMZA 3Q0VA 1P92A 4EV0A 3UKGA 3KYLA 2HDWA 4F93B 4RB2C 1XMKA 3OYFA 3V7CA 1B6AA 2WADA 1TP4A 3BLYA 1YJWI 4AWXB 4BEHA 4DBRA 5K5OA 2IBDA 3FXKA 3T8TA 3HYIA 1JUSA 5HNHA 4YIIA 2LF8A 4MHGA 4HF0A 1FOYA 2IA0A 2R7SA 2M34A 4HX7A 5LGUA 4H0EA 1D5YA 2TDXA 1A36A 4IF4A 1FX7A 4ZDOA 2RNGA 2EWNA 5D6EA 3ZMDA 1FC3A 4XNFA 2QKLB 2IS6A 2KZGA 3GZ5A 4U0YA 5D5UB 5CYVA 4DZJA 1X1AA 1Z7UA 3K1PA 4DQ2A 1X3WB 3RKYA 3OL3A 2FD5A 2K9MA 3LSTA 3C2HA 1T38A 1S29A 2VBXA 4JOMA 2YU9J 3KZIC 3I4PA 2F5VA 4ENMA 1FIAA 3CDLA 3T8RA 2COMA 4V2FA 5DEQA 1MJBA 4LK1F 4FX0A 1I1SA 5D5VB 1ONVA 2KKOA 3I9V2 1WH7A 1U8BA 4XKVA 5EDNA 1H89C 1NK2P 1MBHA 1HA8A 1LNWA 1O3QA 3WG9A 2XC7A 3DEWA 4HDVA 2RKHA 3BR1A 1MDMA 1VQ4I 4HOBA 2XGDA 2IGOA 2PMHA 2XGXA 3FMRA 2CQQA 4LOCA 5D4SA 4CCLA 2RREA 4F3QA 3LQRA 4HQEA 2A5WA 2FMLA 2CUFA 5CLSA 2JN6A 3ECOA 4MO7A 1ZARA 3H5NA 1QA6A 1F36A 3BCAA 2FSWA 4II2A 1REPC 3HHGA 1I27A 4UUVA 3RIRA 3KZYA 4Q48A 4U0WA 5K7FA 2FXAA 2XAUA 1SMYF 1WRJA 2JA7J 4KNYA 3RKWA 1D8JA 2VC0A 2F5DA 3F0CA 5DUKA 1Y8QB 3HEFA 3JTGA 1OYIA 3ZXSA 1VI0A 1E17A 3CCMI 5DDGA 1UAAA 4HSRA 2CU7A 3PFYA 4ZYEA 1D1CA 3OYMA 2O8XA 1LFPA 1C0WA 3NRVA 3HPHA 3TKYA 4PK4A 5HLTA 4WX9A 3L2RA 3W6VA 1X58A 4X0GA 4ZTFA 2IP2A 4RAYA 2R7OA 2GA2A 2NAZA 5FD6A 3PO2J 1KQ8A 3B73A 4BBRJ 2KIMA 5GADJ 1TT5B 3OYGA 3IKVA 4FE4A 2H1LA 1W5SA 2OF7A 2XPUA 4HPQA 5BS6A 3LA7A 2IRFG 1DU0A 3KEYA 3G73A 2QM3A 5ILSA 1EH8A 3S3OA 2HQNA 4EMSA 3PUFA 5K7HA 2E2HJ 3G1MA 3CJRB 4I98B 4ON0A 3NAUA 3TOAA 5HVQC 1UHMA 3OS0A 4IZZA 4ZYGA 2M87A 4P9FA 3G71I 4IRGA 1G4DA 4OMYA 4NQWA 4XSZF 4BE2A 9ANTA 2IS4A 2ZCWA 3KPHA 3QP5A 1G59A 1ZG3A 3MN2A 1OYWA 5K1YA 3FHNA 2MC4A 2UUZA 1MBKA 4IHXA 2AO9A 3I54A 5ERIA 3TP3A 4A0ZA 1P9QC 1H0MA 2EINH 1SFXA 1K6OA 1FSEA 3K7AJ 5JLWA 2PJRB 1BI1A 2KQRA 4LIUA 2Z99A 4M6YA 2E19A 5H6QA 3HXLA 3S93A 1QZZA 3VYRB 5EEAA 2D1HA 3OYHA 3IH4A 3P7NA 1Z3YA 2UZKA 1Z1DA 2W1OA 3OMYA 2L7FP 5M3MJ 2JMWA 4ZYDA 1EH6A 2GZWA 3ZN1A 3K70C 5IOYA 1D8KA 2VKDA 3S1QJ 4LLNA 2N8GA 4IHTA 4G6TB 5KVRA 3PQKA 4L5EA 2XHKA 4B8XA 4UV9A 5HDNA 3RZDJ 4M6VA 5IOZA 4NC8A 1U3EM 2R7UA 3HIFA 3I64A 1ZG5A 2EFOA 3LSPA 5L3BA 3I4NJ 1KONA 3O2PE 2FJ1A 4NBQA 1IDZA 1GXQA 3ZQIA 3CTAA 2A5YB 5DM7F 3QOEA 4I76A 2L01A 4N0BA 4EATA 3A4CA 5GAGJ 1QBJA 2CV1A 2E34A 3KP3A 3K4KA 3V8KA 4JX4A 5HDKA 2RDPA 4IHVA 1D3YA 3H35A 2MH2A 2KP6A 4A6DA 2F2EA 2MLGA 3QPHA 3GTKJ 1IZ1A 3ZN0A 3PNVA 1JUPA 3BJOA 2ELHA 1WJDA 1SD7A 2GXGA 4AD9A 3Q5FA 3CCJI 3OIPA 4ZH4F 2Y9YA 3HJEA 1SFKA 1SD6A 2K3PA 5A2QZ 1WPKA 1Z67A 1G3SA 5D6FA 4JK1X 3BG6A 2EV5A 3TDUC 4GRIA 2AS5F 2W00A 1R1VA 5D5XB 5JHFA 1WJBA 2MD5A 4RB3C 2OC6A 1AKHB 2AQFA 3BR6A 3FXLA 2KT0A 2E2IJ 3VFZA 3LAJA 1T98A 3NWSA 2MYSA 1CGPA 3DQVC 1WWXA 4ENKA 5CQGA 1CF7A 1R23A 3H0DA 1OCPA 3CJQB 1OYYA 1IGNA 4IRIA 2AQEA 1J09A 2DFEA 2XF6A 3KP6A 3HOZJ 2R5ZA 2O61A 3W6JB 5J1UA 3SHFA 1XSXA 2ZFUA 2ZXWH 2OQGA 3ECHA 2D5VA 1LDKB 2VOOA 3ZOBA 2CQKA 5F08A 2IA1A 1SC7A 1H9TA 4LIVA 4I6ZA 2X0LA 2R5YB 2AHQA 2XV4S 4LG0A 5JFRA 1XCBA 4ESFA 1HLVA 2P7VB 3SQNA 3IWZA 4EJVA 1Y8RB 2L7KA 2DFHA 4A69C 2M1BA 2HVRA 2LBFA 4R79A 2X4HA 1GV5A 2LKSA 3LSMA 3ZMZA 1ZH5A 3GFLA 5F6FA 3FZVA 4D0PA 3DEEA 1B72B 1LVKA 1VZ0A 3M8FA 4PJJA 1EA3A 2XUBA 4FX4A 3ZPLA 2P81A 2XAJA 4PGGA 3A03A 2ME0A 4EVIA 2OAZA 3B6AA 1R00A 5J3LA 2DPUA 2V79A 1A6QA 2VB6A 4QSHA 2I5UA 4BJTA 3QPLA 1QQIA 5EEGA 5C44J 1MKMA 1SD4A 5D8LB 3LL7A 3I71A 2VQHA 3H1CA 2KHMA 4CICA 2LOOA 2IW5A 2B9SA 1IAWA 2LP0A 1MMAA 3FKIJ 3F8NA 1UG0A 2PLYA 2FNPA 3BG3A 2V9KA 3HM5A 4XOTA 5FFXA 4DYRA 2R7RA 1Q1HA 1Z21A 2PMZN 2HEOA 3FXRA 2LD5A 5TGTA 3F9KA 3S32A 1J2XA 2BYVE 3ZR8X 2EFQA 1OCOH 3VB2A 5J47A 2DMTA 2XAHA 3EETA 5J4YA 2Q0OA 2M4GA 2MFZA 3R0JA 2CRGA 4LK0F 4EM0B 4YFKF 1FOKA 2ADUA 2O03A 2VE8A 2HU9A 4TV7A 4BY7J 4XQFA 4XLHA 4ZDPA 3P5JA 1PDNC 3I4MJ 2UV1A 2LREA 1ON2A 3VWBA 2HDDA 1QPMA 2KRHA 3X2QH 3ZMVA 3QPSA 1VQ7I 3LSGA 4YRVA 4UB8C 2IVMA 3K9TA 1UMQA 1OPCA 2VJIA 2YS9A 1XTAA 2CJJA 5KCMA 3OWTA 2F48A 2E36A 1T95A 1S7EA 2IGNA 1MH4A 4BS9A 2X9DA 1KU7A 2GXAA 4HG2A 1HSTA 3L2QA 2NRAC 4XR6A 2HGCA 5GAEJ 3V7RA 5LEKA 3BY6A 2M2EA 2QF7A 2A6TA 4M9XA 3RSNA 1S72I 4GYGA 3PM1A 2DOFA 4IQ4A 5EJCA 3M9AA 1OJLA 1P7JA 2HZTA 3MZYA 1X19A 3DBLB 3DKWA 4AVZA 3K70D 1ZN2A 1WJEA 2XAQA 4G12A 4UVCA 3MZ8A 3JSPA 3H0GJ 3WTWC 4Q4ZF 3WTZA 4CDGA 1EH7A 4BGDA 3EUHC 4WK8F 4IEJA 1O3TA 2PJPA 3F6VA 2QZ8A 3JR9A 2BVLA 3WE2A 2VT2A 5LHHA 4UUSA 1JTYA 4BE1A 2A61A 3GFMA 1QRYA 3EYYA 4X1EA 2V1UA 4M3GA 4Q5SF 3LSHA 1ZKGA 2WA0A 4LITA 3Q3SA 3QODA 3DEUA 4IQJA 3QYEA 3IP4B 2Y0SN 4AIHA 2Q2EA 4ESBA 3IUOA 1DUXC 2P8TA 1G8XA 2JWTA 5L3GA 2NS0A 2DJIA 4KIBA 4MFDA 3IH3A 1TQMA 2DA2A 3DXJF 2H27A 5HLHA 1H8AC 2FBKA 2JTVA 2KISA 1RRJA 2HOSA 1JI8A 2HDCA 5HNFA 1SVMA 3HKZA 1J7KA 1SVOA 3PO3J 2WBMA 3OS1A 5J8CA 3FHZA 1YS6A 1T0FC 3OSFA 2IAIA 4CYCA 1UJ8A 3ZQCA 4BHPA 1X2MA 4CZZA 5LHIA 3BJAA 1P2FA 4BJ5C 4E7SA 3J80K 4C3HJ 3LSJA 1FBUA 3HPGA 1WJAA 4AIDA 2VOPA 5IYDJ 2IS2A 1WHUA 4R8HA 1NG7A 5CPRB 5E1ZB 3FXOA 4BH9A 3CC4I 1T6SA 3I55I 4HF2A 3CZ6A 3G6EI 2R3SA 4ENJA 2EFPA 2V9VA 2F4IA 5B1BH 2HOEA 2L4AA 1YX5A 1LE8A 2DPDA 3DV8A 2OA4A 2JUCA 5C3EJ 1Z05A 2WV1A 4FISA 3MEXA 4HLXA 1YG2A 5DS9A 1ZLJA 5BNGA 2H09A 5DCMA 1P4WA 1PVEA 4BXFA 1MGTA 2Z1DA 2DA5A 2TRTA 1LB2A 4XICA 2F5CA 3I59A 4B3XA 1ZR4A 2HPIA 1ZRCA 3HOVJ 1KYZA 4AIJA 1R22A 2IGMA 4JQFA 3VODA 1XG1A 2QVOA 2EJRA 3FXQA 3ZCOA 4PSXA 3PSFA 1U5TA 3JTHA 3HL2A 2M30A 1WGXA 2V1NA 3JAMZ 3HOSA 2R7QA 1MDMB 2OTJI 1XMAA 2KIUA 5H6RA 3DU5A 1WKMA 3LSRA 5B5EC 2DQRA 4E7KA 4U7BA 4G7OF 2COBA 4KDPA 3MZHA 5LBQA 1TC3C 3BR5A 2JA2A 1RIOH 2CMPA 1OR7C 5ICEA 1BI0A 2R7DA 2XPVA 4OU0A 3KX2A 3CUQA 4J19A 2A6HF 1YW9A 1FT9A 3F6OA 3Q9SA 2F6CA 1TT0A 2HNHA 5GAHJ 1B8IA 1FWZA 2YPRA 2K40A 2DK8A 4F55A 2M4KA 4E7LA 3JREA 4OAZA 5ILVA 2DA1A 2JJ7A 2DCEA 2OQRA 2CQNA 3OL4A
chains in the Genus database with same CATH topology
2VJ5A 2IGOA 5HOOA 1W36C 4CCLA 2RREA 4F3QA 2WY7Q 2A5WA 1Y56A 3OR2C 3UNGC 2LH9A 3H5NA 3K4BA 2JSPA 2JVGA 3D5SC 3BCAA 2KZVA 3H9QA 4II2A 1E0EA 1V5EA 3LSKA 2X51A 2VASA 1IRXA 1DGRM 3K10A 2Y0SA 2XAUA 2M0MA 4HSTA 4KT6A 3OYJA 4RM2A 2W82A 3ZXSA 3OYEA 3DU6A 3EUKL 3LFUA 2WAEA 1UAAA 3OYNA 4BU2A 4HSRA 3PFYA 1D1CA 4KISA 3OYMA 3SEQA 3J7AY 4HEA2 4OAYA 1LFPA 4Y4RA 3HPHA 3L2RA 1TZLA 4PK4A 4CH7A 5HLTA 4X0GA 2ZXIA 4ZTFA 2R7XA 1ERDA 2R7OA 4NQWB 4BEHB 2LYCA 3DPLC 3NWTA 4E6KG 1Z3XA 3OYGA 1FMWA 2IXSA 1D1BA 2CV2A 1W36D 3W2AA 2X6YA 4HPQA 4HNTA 3VSKA 2X1CA 3KEYA 1PJRA 4PJNA 3S3OA 1YX3A 4DGWB 1X1DA 2GOXB 3CJRB 4B47A 1V5GA 5HVQC 4IZZA 3OS0A 2ZSHB 2Z2SB 2CW8A 2MD0A 4B44A 4BE2A 3L2UA 2IS4A 3TBIA 1G59A 3V42A 3FHNA 2MC4A 1WJCA 2VXZA 1AA7A 2UUZA 3OR1C 4DOZA 4PSWA 4BL0B 1P9QC 2VJ4A 3QYFA 3K4MA 2GOMA 3S3NA 2PJRB 2KQRA 4LIUA 3MMYB 4XN0A 4IKFA 4CCOA 3S93A 3GBGA 3HXLA 3VYRB 4CCJA 3OYHA 1Z3YA 2X1DA 2L5QA 2W1OA 1Z7LA 3OMYA 4II3A 4CUGA 3ZRGA 4YELA 4BQOA 4KITB 1DP3A 2K9LA 2WY8Q 1NG6A 3K70C 4D1QA 5FRMA 2VKDA 3CP8A 2LG4A 4P5OA 1BR4A 2QKMB 4G6TB 2BOLA 4NC7A 4ZDLA 4BACA 3UR3C 4LG3A 1GLNA 2Q1ZB 3SYTA 4NC8A 2R7UA 3CP2A 2KMUA 4YEJA 1KONA 2E1MC 2VJJA 1MNEA 2R7WA 2L9NA 2ELJA 3OYLA 2VIXA 3M8JA 3QOEA 4C2TA 3VYSB 2R4GA 2L9SA 2ZXHA 4EATA 3A4CA 2CV1A 1UELB 3QYBA 4XKWA 2M7BA 3K4KA 3BCBA 1Y6IA 4XM3A 2I8DA 1D1AA 3MD2A 3H35A 2KP6A 4BUPA 4PJMA 2XF5A 3DKYA 3DTIA 3PNVA 1X1BA 2X85A 2CUZA 4FETA 1WJDA 3AL0B 3OIPA 1SFKA 2K3PA 3S8PA 2KDOA 4MLOA 4BDYA 1WFXA 2CS3A 4ZC3A 5CKTA 4QPQA 3HC7A 2CUJA 3BG6A 4ZYAA 4BJ6C 2VL8A 4GRIA 3VSLA 2E60A 4Y3OA 2W00A 2HVQA 3ONQA 5JHFA 1WJBA 2OC6A 1PYVA 1N78A 2AQFA 3RPUD 1BOBA 2ZSIB 3NWSA 2MYSA 4P1WA 2DXIA 2W7NA 3DQVC 3DLAA 5CQGA 3FKJA 3H0DA 2VKHA 3CJQB 2VPLA 2AQEA 1J09A 2XF6A 4XLCA 3M1CA 3OYBA 1OLTA 3VYTB 4F91B 1WJ5A 3OOUA 3PSIA 2X6XA 3PJRA 3E1SA 2ZFUA 3PL8A 2V6EA 2R7TA 4DBQA 1MNDA 3MKZA 1D0YA 4E7JA 1SAUA 1LDKB 3VDXA 4E7IA 4XLFA 4OWRB 4BQNA 4LIVA 2DT7B 4RM3A 1QU3A 2V26A 4XKBA 3BG7A 2HZDA 3K4CA 4RMNA 2JUGA 3IAM2 3AKZA 4J00A 1S9HA 4PJLA 2L7KA 2HVRA 2VQGA 3A1YA 3LSIA 2LBFA 4R79A 3MKYB 3EPZA 3LSMA 4BE0A 3CESA 3DEEA 4XORA 2K5CA 2VLAA 3SDBA 1LVKA 1VZ0A 2IS1A 4PJJA 1EA3A 2VQCA 4BDZA 4PFOA 2VB6A 2X1EA 3HUGB 4AYBA 4BJTA 2VQLA 3LL7A 4B48A 2VQHA 3IAS2 2RQQA 2KHMA 2LOOA 1WJFA 1MMAA 4DJAA 3CMMA 3W2VA 1UG0A 2M3AA 4XLAA 3OIQA 3OS2A 2V9KA 4XOTA 4FASD 2FUG2 2R7RA 1Z21A 3DTEA 2UWMA 4RLQA 3K4LA 5TGTA 3F9KA 4XOPA 3S32A 4D9JA 2XSJC 4XL9A 3ZR8X 1X4PA 2DT6A 4ZTJA 1MW7A 2DOAA 4N4NB 3PNYA 2M4GA 2MFZA 4CCMA 2JVHA 4ITVA 5KNLA 2HU9A 4XQFA 4XLHA 4ZDPA 3A2KA 2UV1A 2LREA 4DIQA 1V5FA 4HRIA 3TMOA 3VWBA 1BR1A 3DKXA 2BVMA 2KRHA 2XF7A 3RQ4A 3OYAA 3LSGA 3PUBA 4YRVA 3S3MA 3K6GA 4IX7A 4C9YA 1DGWY 2WAQA 3U21A 4C2UA 2VJIA 2IGKA 5KCMA 3VYUB 1D0ZA 2OUMA 3OWTA 1T95A 4CSWA 4ZJZA 1N77A 4PUSA 2IGNA 4Y33A 4BS9A 4HG2A 3L2QA 3HOTA 4XR6A 3OY9A 1DQUA 3L2VA 1QHHD 2A6TA 3RSNA 4IQ4A 2R7VA 1X19A 4AVZA 3K70D 4U87A 4XONA 3N05A 2LRDA 5LFAA 1WJEA 2LC2A 4E4HA 3LMMA 1D0XA 2HQAA 2VXDA 4ANJA 2CFOA 3DPTA 1N75A 4E7ZA 4BGDA 3EUHC 2XDVA 1X1CA 4XMYA 2BVLA 2E5ZA 2HPMA 5CQEA 3RCOA 3C2GA 3MKWB 4BE1A 3H9JA 3L2WA 3LSHA 2LBFB 3H5AA 2WA0A 4LITA 3QODA 4IQJA 4H4KC 3QYEA 3IP4B 3OYIA 3W3CA 4KJZA 3D5LA 2L2OA 4RLFA 3IUOA 2CH0A 3EUAA 4CCNA 1G8XA 2M7AA 1U0JA 2CW7A 2DJIA 4J01A 2O5RA 4F52A 2Z16A 2MABA 1FMVA 1JI8A 5HNFA 3HKZA 3AL0C 2WBMA 4F92B 3ZQQA 3K4NA 3OS1A 1T0FC 4XKCA 2V7FA 3AFHA 3H5RA 3ZGKA 3RTRA 4C30A 3E0JB 4BJ5C 4E7SA 3FDYA 3DPUA 2KL4A 3HPGA 1WJAA 2WB1A 3DTKA 2IS2A 5LD2C 1NG7A 3H9GA 5CPRB 3FBIB 2LY2A 4CZCA 4CCKA 4HNUA 3CZ6A 4NUBA 3TL4X 2F4IA 4E7HA 1YX5A 1X4OA 5FRNA 2E1MB 2V4JC 3KYLA 2HDWA 4F93B 2X6WA 3OYFA 1LKXA 2WADA 3BLYA 4BEHA 2KPMA 4BXFA 4DBRA 4PFPA 2Z1DA 4BQQA 2PMZA 5HNHA 5FROA 3OYDA 4B3XA 3W2WA 2HPIA 2R7SA 2P0WA 2BW3B 3BC8A 3SEZA 2IGMA 4JQFA 3OYKA 1MMGA 4ZDOA 4AU7A 2RNGA 3ZCOA 4PSXA 2NOJB 3PSFA 4XNFA 2W4SA 2QKLB 3HL2A 3FBNB 2IS6A 2HVSA 2KRCA 2WAFA 1QHGA 1MMDA 3HG9A 2V1NA 1X1AA 3HOSA 2R7QA 3CF2A 1ZELA 3OL3A 2K9MA 3C2HA 3DU5A 3OYCA 2LY1A 2OV7A 4E7KA 4JOMA 4B43A 4CA0A 4U7BA 4QPOA 1K6YA 4N4OB 4NNJA 2CV0A 3G2BA 1MMNA 1R6RA 2F5VA 2BW3A 3PNTA 2PJRA 2JA2A 4XN3A 1YE9A 2CMPA 1OR7C 3SZGA 3DWLE 3KX2A 3D5RC 3I9V2 1HA8A 4XKVA 2KLOA 1BR2A 2XC7A 3K4JA 2F6CA 1TT0A 2HNHA 5KHDA 4XLEA 2Q2EB 4F55A 2M4KA 3I3LA 2E5NA 4E7LA 4OAZA 2DCEA 3OL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  5HOO A;  4CHU A;  3KCC A;  1IV6 A;  1JGG A;  2H8R A;  2YR2 A;  1HQC A;  3OR2 C;  1B4A A;  2LH9 A;  3A0H C;  4I09 A;  4ENN A;  5E79 C;  3D5S C;  2YU3 A;  3T5X A;  1E0E A;  4HX8 A;  5K5R A;  2X51 A;  3KYC B;  1DGR M;  4NDL A;  4Y13 A;  2NNY A;  3K10 A;  1FTT A;  1IXS B;  1TW2 A;  2M0M A;  4HST A;  4KT6 A;  5FKM A;  3RKQ A;  2ZJP F;  4EM2 A;  4FTH A;  3HHH A;  4RM2 A;  3HRU A;  2O8K A;  2EIK H;  1FOX A;  3RJP A;  3DU6 A;  4LGW A;  3EUK L;  2CO5 A;  3DP7 A;  4BXU A;  3RZO J;  2HXI A;  3P9I A;  5GTI C;  3SEQ A;  3C1D A;  5FKK A;  2JPB A;  3M8E A;  1BC7 C;  4I02 A;  4M9Z A;  2UXN A;  5IY5 H;  2R7X A;  1FJL A;  1U9N A;  4OIQ F;  4NQW B;  3F21 A;  2D2W A;  2LYC A;  3BR2 A;  2PEX A;  1FMW A;  2CUE A;  1D1B A;  2M9H A;  2OZ6 A;  4A0Y A;  2GWR A;  2LY9 A;  2CV2 A;  1W36 D;  2RVC A;  4MNU A;  3E3V A;  4ZZL A;  3LQQ A;  3FK7 A;  2BV6 A;  2L54 A;  1QZY A;  1YIO A;  1X1D A;  5C4J J;  1E2X A;  3RDI A;  3QP6 A;  2Y0M A;  1XCV A;  2X6O A;  4JX5 A;  3CME I;  2Q8K A;  2Z2S B;  2Y75 A;  2A3S A;  3FX3 A;  1STZ A;  3L1P A;  3L2U A;  2VOD A;  2V1D A;  2A6E F;  1EKE A;  3WG7 H;  3BZ6 A;  3TBI A;  4A3I J;  4ZZD A;  2NVX J;  1YJN I;  2ZO4 A;  1WJC A;  3TOB A;  5CVJ A;  5FLX Z;  5E3N A;  3OR1 C;  4DOZ A;  1ZG1 A;  1TTY A;  3V4G A;  4Y15 A;  5LRR A;  1BIB A;  2VJ4 A;  5F0C A;  2Z9O A;  2QWW A;  1HOM A;  1ZHF A;  3K4M A;  1KQ9 A;  4X6A J;  3E7L A;  3JRD A;  4IKF A;  3ZQ7 A;  2PI0 A;  4HQM A;  2DW4 A;  1VQM I;  3BOQ A;  3GBG A;  4A3M J;  3IV5 A;  1I6H J;  1ZTR A;  1XGM A;  2NVU B;  3U9G A;  2HKX A;  4NC6 A;  4II3 A;  3ISP A;  2EIJ H;  1BN5 A;  5IP6 A;  5D8K B;  3GTP J;  4BQO A;  2DBB A;  2DAO A;  2ELK A;  1MBJ A;  4OIO F;  1S7A A;  3F23 A;  3KLN A;  1TBX A;  2WY8 Q;  4D1Q A;  3CP8 A;  2MG4 A;  4P5O A;  3HOX J;  1BR4 A;  5JHU A;  2BOL A;  4NC7 A;  2BHY A;  3FIW A;  5HDG A;  4KMF A;  1ACI A;  3UR3 C;  4LG3 A;  2NYX A;  2KMU A;  4HBL A;  4PGH A;  3MWM A;  4LJZ F;  2L9N A;  2ELJ A;  2E1O A;  3OYL A;  2VIX A;  3M8J A;  1Z6T A;  4KUM A;  3VYS B;  4FHT A;  4GFB A;  1JHH A;  3TGN A;  1UEL B;  3QYB A;  4XKW A;  3CO6 C;  2M7B A;  1Y6I A;  2TCT A;  4XM3 A;  1D1A A;  1FNN A;  1H9G A;  2ZME B;  3FMS A;  5E8G A;  4PJM A;  2M8E A;  1WI3 A;  1U2W A;  4A6E A;  4RGU A;  2HQ5 A;  1KU9 A;  1LQ1 A;  4D5C A;  2P5V A;  2DA4 A;  2EH3 A;  2X85 A;  1SEU A;  5DYM A;  2RN7 A;  1UFM A;  2A07 F;  4EJU A;  2KDO A;  3BPV A;  5EG0 A;  4BY1 J;  4IHY A;  5CKT A;  3JRC A;  2DDA A;  2CUJ A;  3EDP A;  3HC7 A;  5HLI A;  5K7Z A;  4BJ6 C;  4RGX A;  4GDF A;  2VL8 A;  4UV8 A;  3VSL A;  4Y3O A;  5DM6 F;  3ONQ A;  2H6B A;  4G7H F;  2A05 A;  2XAS A;  1PYV A;  4M73 A;  3RPU D;  2EK5 A;  2O9L A;  2VBW A;  1VQP I;  5EGO A;  1BOB A;  2ZSI B;  3MKL A;  2DTZ A;  3WTU C;  3CO7 C;  4UHT A;  3S16 J;  2L7Z A;  1VQK I;  2VKH A;  3CCE I;  2JA6 J;  2VPL A;  3GX4 X;  5IP7 J;  2LLK A;  4C3J J;  2OD5 A;  3HGG A;  3ROU A;  1OLT A;  2HTS A;  4F91 B;  1WJ5 A;  2QSG X;  3CMA I;  5H20 A;  4RGS A;  3PL8 A;  4IJA A;  1RR7 A;  3N97 A;  1WCM J;  3MKZ A;  1D0Y A;  1XMX A;  2DI3 A;  2LVS A;  5J4V A;  3VDX A;  3NQO A;  1OCC H;  3C3W A;  3HZJ A;  2AXL A;  3OOP A;  3TW7 A;  4AC0 A;  2DFI A;  3BTC A;  4XLF A;  3BDD A;  4BQN A;  4EJW A;  1JHF A;  1CQT A;  2DT7 B;  4RM3 A;  5E3L A;  4XKB A;  1XPX A;  1GVJ A;  4CGZ A;  2HZD A;  1GT0 C;  4RMN A;  2JUG A;  3AKZ A;  3H3U A;  3V8L A;  3D1N I;  4J00 A;  1S9H A;  3V8J A;  5GPA A;  4F7Z A;  3L7W A;  5HS7 A;  4NB5 A;  1JKO C;  2ID6 A;  3EPZ A;  4MTD A;  1BL0 A;  2ESN A;  1MBG A;  2I10 A;  3G4S I;  4L0Y B;  3CDI A;  2K5C A;  1X3U A;  1JT6 A;  3SDB A;  3VPR A;  3RI4 A;  2GM4 A;  1E3P A;  4OIP F;  3CCR I;  3MFK A;  4JX6 A;  4PFO A;  2LR8 A;  1PUF B;  3HUG B;  4AYB A;  3JRH A;  2HQR A;  4OOI A;  1G6N A;  2P6T A;  1UG2 A;  1APL C;  2RQQ A;  3E5U A;  1SVL A;  2O3F A;  1YW7 A;  4I0A A;  4B3A A;  3GZ6 A;  3CCV I;  3OIQ A;  3OS2 A;  1J5Y A;  1RPW A;  4EJT A;  1ZRD A;  4P96 A;  4UUT A;  2DQL A;  1T2K A;  1UB9 A;  2ZNZ A;  3K2A A;  2PFB A;  3K4L A;  4XOP A;  4XLN F;  3CCY A;  2E2J J;  4XL9 A;  4RS8 A;  1R58 A;  2NVT J;  1TNS A;  1X4P A;  4RDU A;  4WXD A;  4ZTJ A;  2W85 A;  2DOA A;  3IC7 A;  1FYM A;  4IHS A;  3M07 A;  3S2H J;  4IOA F;  2FE3 A;  4MGR A;  2ZKZ A;  5KNL A;  3LWF A;  1K79 A;  3QPT A;  4IRH A;  3WE3 A;  4HRI A;  2OCE A;  3TMO A;  2GIZ A;  2IPQ X;  3RQ4 A;  1Y0N A;  3OYA A;  2W48 A;  3JRA A;  3S3M A;  3K6G A;  4JBA A;  5BOX A;  4C9Y A;  3IL2 A;  1HBX G;  2WAQ A;  3FXJ A;  1ZGA A;  2IGK A;  3IH2 A;  2NXN B;  2OJE D;  3PQJ A;  1U8R A;  1AOY A;  1RNL A;  4ZJZ A;  1N77 A;  4PUS A;  1BJA A;  2FBI A;  3BR3 A;  5EZG A;  3K0L A;  5J40 A;  3QOP A;  5BQT A;  3HOT A;  3OY9 A;  3B6C A;  1R5I D;  3HSF A;  2F4M B;  2GAU A;  1J9I A;  1HDP A;  3LNQ A;  1LJ9 A;  3CJN A;  2ETH A;  4HDU A;  2LMD A;  2FX0 A;  3N05 A;  2DJN A;  2Y9Z A;  1MBF A;  3QQA A;  1ZRF A;  3I58 A;  2PBI A;  4ESJ A;  1AWC A;  2EA4 A;  1Y1W J;  3LA3 A;  3IWF A;  3OV8 A;  2VXD A;  2HOA A;  4KN7 X;  2BZT A;  1R71 A;  2JQ7 A;  3WU0 A;  1I3A A;  2XDV A;  1X1C A;  1MMS A;  1ZQ3 P;  1ETQ A;  1MH3 A;  1Z77 A;  2E5Z A;  2ZXJ A;  1K78 B;  1KGS A;  3S1M J;  2M0C A;  3C2G A;  4CYC B;  4D7N A;  3L2W A;  4M3D A;  3F8M A;  4H4K C;  3BG5 A;  3J81 K;  4KJZ A;  1W5C C;  4A5M A;  3R60 A;  2HKO A;  1OIS A;  2CH0 A;  2HR3 A;  4RB0 A;  5IT9 K;  3ZQF A;  2ZME C;  1TWF J;  2CW7 A;  3G3Z A;  4MEX F;  2VKV A;  4J01 A;  4A3J J;  2H94 A;  2FQ3 A;  3L00 A;  1FMV A;  4M3B A;  1B9M A;  2Y31 A;  3H92 A;  1K4T A;  2QA4 I;  2LDU A;  3BTL A;  1JJ6 C;  3ZQQ A;  1Z91 A;  3FK6 A;  3K4N A;  4WXH A;  5TJJ A;  5EF6 A;  3IKT A;  3H5R A;  3RQI A;  3Q0U A;  4MEY F;  1OQY A;  1W4M A;  2K9N A;  5LRS A;  3FDY A;  4OIR F;  4IL6 C;  1JE8 A;  2WB1 A;  1K4S A;  5LD2 C;  1YFH A;  3H9G A;  2O6G E;  5HLG A;  2FNA A;  2HFH A;  2K86 A;  1S7O A;  1WVR A;  4E7H A;  3SXY A;  4GCV A;  1ON1 A;  1JGS A;  1W0T A;  4A2U A;  3AAF A;  2GLO A;  2V4J C;  1MNM C;  2NS7 A;  4C3I J;  2X6W A;  3JRB A;  4KIF A;  4RAZ A;  4N9I A;  2FA5 A;  3J7Y J;  2KPM A;  2VBZ A;  3WTX C;  4PFP A;  4UVB A;  2G7H A;  2LFB A;  2PMZ A;  2DLL A;  5ICC A;  5FRO A;  2EA2 A;  3W2W A;  1JT0 A;  3QAH A;  4RAF A;  2GA1 A;  1WI9 A;  3A01 B;  2M5W A;  3ZMS A;  3OYK A;  3OSG A;  2NOJ B;  1UHS A;  4RBO A;  2RGV A;  1YIT I;  5IYB J;  3FBN B;  2HVS A;  1QHG A;  1IDY A;  1MMD A;  5ICG A;  3DCF A;  1IN4 A;  3CF2 A;  1WSU A;  3BRO A;  2LF7 A;  4B43 A;  1W7P B;  3QWL A;  4CA0 A;  1WH5 A;  2XKP A;  3U1D A;  1B9N A;  4G8X A;  3KP7 A;  3G2B A;  2NVQ J;  1MMN A;  1R6R A;  1FEX A;  2BW3 A;  3PNT A;  2Y2Z A;  2PJR A;  4XN3 A;  3GO5 A;  3ABT A;  3SZG A;  3TP0 A;  3D5R C;  1TWG J;  2VC1 A;  2J5P A;  1IRZ A;  2QQA A;  1BR2 A;  2H8W A;  1UCR A;  3K4J A;  5JLX A;  5E1X A;  4KT5 C;  3ERM A;  2RNJ A;  4XLE A;  4QIW N;  1W0U A;  2QSF X;  4L9T A;  4EM1 A;  1ODD A;  2E5N A;  2ECB A;  3I0T A;  1YS7 A;  1SAN A;  1BW6 A;  3REO A;  5DCF A;  1KZH A;  1IJW C;  2XVC A;  1QNT A;  3E5Q A;  3SZT A;  1W36 C;  3EUH A;  2WY7 Q;  2B0L A;  2QGU A;  3ASO H;  4LMY A;  1FOW A;  2JSP A;  2JVG A;  2QQB A;  3H9Q A;  3HRT A;  3LSK A;  4C2M J;  1ORK A;  2OZU A;  3KZZ A;  2VAS A;  3MCZ A;  1J59 A;  4KFC A;  5IYC J;  3BT9 A;  1FPQ A;  1FP2 A;  2Y0S A;  1LFB A;  2HS5 A;  3B02 A;  2DDB A;  1GV2 A;  4DYQ A;  1USS A;  3MVP A;  2VN2 A;  1FYK A;  2W82 A;  1YRN B;  1HSJ A;  4S0H B;  3IHU A;  4BU2 A;  2XRO A;  5E20 A;  2CQX A;  4KA4 A;  1V55 H;  3KFW X;  3J7A Y;  2Y69 H;  4S05 A;  4RB1 A;  2KIF A;  2NS8 A;  4Y4R A;  5E18 F;  1T0F A;  1IUY A;  2L4M A;  4A3D J;  1TZL A;  2YX4 A;  4A93 J;  2ZXI A;  4A0X A;  4BEH B;  3O6B B;  4JYK A;  1J0R A;  2LKX A;  1HKS A;  2FOW A;  1YOV B;  1L0O C;  5K5Q A;  4CXF A;  2C6Y A;  3MQ0 A;  1AKH A;  2L7M P;  5D5W B;  1LEA A;  4A12 A;  2DYR H;  2BEO A;  4U88 A;  4HNT A;  3VSK A;  1E3O C;  3GYH X;  3CC2 I;  1MSE C;  3GEZ A;  2X1C A;  2VE9 A;  1PJR A;  1BI3 A;  1ZGW A;  5CVR A;  1FBS A;  3HKZ N;  2JSC A;  2EV6 A;  1TW3 A;  3SZP A;  1R4N B;  4B47 A;  4WXC A;  5LGT A;  2DA3 A;  2ZSH B;  4W1U A;  4DW6 A;  1DDN A;  1XDU A;  3K2Z A;  4EGZ A;  5EZH A;  2CW8 A;  4Y7N J;  4B44 A;  1A35 A;  3HOW J;  2H1K A;  3E5X A;  4NHJ A;  4XRS G;  3J7A O;  1KA8 A;  3V42 A;  1HC8 A;  2W84 A;  1AA7 A;  4UB6 C;  4PSW A;  4BL0 B;  3V7S A;  1JKR C;  3HSR A;  2R5Y A;  2ISZ A;  2EFN A;  2WTE A;  3D0S A;  4D5F A;  3E6D A;  3HGY A;  1RC9 A;  4PCQ A;  3BJ6 A;  4Q47 A;  2QSH X;  4CCJ A;  4DYC A;  5GPC A;  3GFJ A;  2L5Q A;  1O3S A;  1YYV A;  3HOU J;  3ZRG A;  3AG1 H;  2MLK A;  1B72 A;  4KIT B;  1KQ0 A;  3M4O J;  3E6C C;  1TQP A;  3WTY C;  1MJ9 A;  1RET A;  2BXZ A;  2O7O A;  4G6Q A;  4BHB A;  2R0Q C;  4ZDL A;  4BAC A;  1GLN A;  1I1G A;  2Q1Z B;  3DBH B;  2HYG D;  3ASN H;  3CP2 A;  3CQZ J;  1V4R A;  1OKR A;  4Y17 A;  1OR7 A;  3AG3 H;  2VJJ A;  2R7W A;  5FJ8 J;  1VND A;  1YTY A;  2M8G X;  1YQA A;  2R4G A;  2L9S A;  5M5X J;  3TED A;  1NK3 P;  4IVN A;  1OMI A;  3BCB A;  5FLM J;  2KJB A;  3FWE A;  1RKW A;  2NVY J;  3KIO A;  3MD2 A;  1XDS A;  3JCU C;  4A3B J;  1XGN A;  2MA3 A;  5M5W J;  1UHW A;  2ME6 A;  2DYS H;  3DTI A;  1R1U A;  1VTN C;  4JP0 A;  1K83 J;  1LFU P;  1X1B A;  4MQV A;  2CUZ A;  4FET A;  3AL0 B;  2K3F A;  4O5V A;  3ZMT A;  4YG2 F;  3S8P A;  3FXU A;  4MLO A;  4O3M A;  5E17 F;  1WFX A;  2CS3 A;  4GXO A;  4CYD A;  3GXO A;  2E60 A;  2Z5U A;  4XSX F;  1T33 A;  4HAM A;  1L3L A;  1F4K A;  1N78 A;  3ABU A;  1BW5 A;  1V3F A;  5E3O A;  4AVP A;  1HW5 A;  3H36 A;  4P1W A;  1AU7 A;  3KYD B;  3K1M A;  4B09 A;  1J75 A;  1FZP B;  2K7L A;  2UXX A;  3FKJ A;  2NOG A;  2W24 A;  4Z2Y A;  2QQ8 A;  1I6X A;  4XLC A;  1MJA A;  5DV5 A;  3OYB A;  1XSD A;  3PSI A;  3WTS C;  2X6X A;  4UXN A;  1QPI A;  3PJR A;  2BY2 A;  1ZGJ A;  1E3H A;  3WGI A;  3CMY A;  4YFN F;  2V6E A;  2R7T A;  2ZB9 A;  2EZK A;  2RAE A;  1P7I A;  4DBQ A;  3HDD A;  2ID3 A;  2IT0 A;  3M1E A;  2IJL A;  3R0A A;  4E7I A;  3KLO A;  1QU3 A;  1A6I A;  5JR3 A;  3BG7 A;  1WZ2 A;  3K4C A;  2R7Z J;  3FXM A;  4BHC A;  4RAG A;  2JA8 J;  5E1W A;  3SJM A;  1RZ4 A;  1B1B A;  5M3F J;  3MKY B;  5L3F A;  2BHZ A;  3BZK A;  3GTO J;  3CES A;  1PUE E;  2VLA A;  1KU2 A;  3P9C A;  4WCG A;  1JUM A;  5DD8 A;  1B59 A;  1Y0U A;  2VQC A;  3I56 I;  1S8N A;  4BDZ A;  1LDD A;  3KP5 A;  4A3G J;  1I50 J;  5J1R A;  2P5L C;  1VF9 A;  4L0Z B;  2QYO A;  2VQL A;  4B48 A;  2LTP A;  3TO7 A;  2QBY A;  4FCY A;  3E6B A;  3S1R J;  3LFK A;  3GLL A;  3W2V A;  4XLA A;  1VQ9 I;  2ZJR F;  2E1N A;  4FAS D;  2FUG 2;  3KP4 A;  1XGS A;  3WHB A;  4M74 A;  1ITY A;  5FLV A;  4G94 A;  4RLQ A;  2OPT A;  3JRI A;  4D9J A;  2BXY A;  1K7A A;  3KP2 A;  2KIQ A;  1YI2 I;  2ECC A;  5JVT A;  1MW7 A;  2DOE A;  5C4X J;  3PNY A;  2HXO A;  4HX4 A;  5FKN A;  4CCM A;  5DUI A;  2DMU A;  2JVH A;  4ITV A;  3JAM K;  4XLP F;  1QO0 D;  2STT A;  3QU3 A;  3HBL A;  1O7F A;  2OU2 A;  3I53 A;  4DIQ A;  2K02 A;  2MW8 A;  1V5F A;  4QWQ A;  1BR1 A;  2BE5 F;  3DKX A;  2BVM A;  1R9T J;  4A3K J;  3F8F A;  2A69 F;  2RC4 A;  3FM5 A;  2XF7 A;  5F1J A;  4Z6Y A;  3KEQ A;  1XC5 A;  3GTJ J;  3FMQ A;  1R4M B;  3M7G A;  2QEX I;  4LD5 A;  1DGW Y;  4C2U A;  4A5N A;  1D0Z A;  2OUM A;  5ICF A;  4CSW A;  4U7D A;  1YW8 A;  3GZN B;  4QLC U;  2VT3 A;  4Y33 A;  3O8H A;  1CF7 B;  2VPR A;  2O0Y A;  2X48 A;  3SFI A;  1SFO J;  4IOC F;  4PDK A;  1WQ2 A;  2R5Z B;  5FD5 A;  1I5Z A;  2AXT C;  2PMU A;  2R7V A;  3S2D J;  3F8C A;  4FE7 A;  4XON A;  4RA2 A;  4UY8 I;  1GVD A;  2LRD A;  5E8I A;  2LC2 A;  3ZQH A;  4E4H A;  1D0X A;  1S5L C;  1ZYR F;  3GTM J;  4ANJ A;  1BBY A;  1BIA A;  3ABK H;  2QUF A;  3ULQ B;  3DPT A;  1MIJ A;  4E7Z A;  5GTH C;  1UST A;  4LG0 B;  3E6M A;  1XB4 A;  1IRG A;  1OCR H;  1DU6 A;  3ABL H;  2P6S A;  4XMY A;  4YIF A;  1O3R A;  2HPM A;  4HA8 A;  3RCO A;  4M6X A;  2VUM J;  3MKW B;  3H9J A;  5B1A H;  2DU9 A;  5LGN A;  1ULY A;  4IHW A;  2LBF B;  1P6R A;  2FOK A;  5FB2 A;  1IN6 A;  3W3C A;  3D5L A;  3HSE A;  2EQR A;  5B3S H;  1T08 B;  2D1V A;  4YFX F;  2OTL I;  5LEJ A;  5B66 C;  1U0J A;  3J81 Z;  2PN6 A;  5M5Y J;  4UVA A;  5EYR A;  4MQ9 F;  5AIP A;  5BMZ A;  1VQL I;  3Q0W A;  1FY7 A;  1TLH B;  1IXC A;  1IN7 A;  5IT9 Z;  4YIR X;  1IUF A;  2DO7 A;  2XRN A;  3N4M A;  1XGO A;  1DP7 P;  3AL0 C;  4F92 B;  1HW1 A;  3COA C;  4XKC A;  3IRR A;  3ZGK A;  3NAR A;  5HOD A;  2A68 F;  3RTR A;  3KE2 A;  3GF2 A;  4V2G A;  4HLY A;  1ETX A;  3S14 J;  2FEZ A;  2CW0 F;  2CGP A;  1W7P D;  1LUJ B;  2XKO A;  3PIO F;  1ETY A;  3DTK A;  3C18 A;  3FBI B;  4HNU A;  3HOY J;  3ELK A;  4NUB A;  5KAF C;  3T0Y A;  3TL4 X;  1R36 A;  4GGG A;  1IN5 A;  2VBY A;  1X4O A;  5FRN A;  5F27 A;  2E1M B;  1HXD A;  1V54 H;  3E97 A;  3C2B A;  4DZP A;  4L9V A;  4I0B A;  3GME A;  3BWG A;  5FLX K;  1LKX A;  4O6J A;  2XPW A;  1BOA A;  2KRF A;  2Y48 A;  4BQQ A;  2MGQ A;  5H2F C;  3P9K A;  2GIV A;  2PG4 A;  2EZL A;  3OYD A;  1FYL A;  5JI6 A;  3MAJ A;  4I01 A;  4AYB N;  1O7L A;  2P0W A;  2BW3 B;  1R7J A;  2ZJ2 A;  3BC8 A;  3K69 A;  3SEZ A;  2JZY A;  2DOD A;  1MMG A;  4AU7 A;  2XRL A;  2W4S A;  2KRC A;  2WAF A;  1I39 A;  3A02 A;  3GTQ J;  3HG9 A;  5L3D A;  1VQ8 I;  1S3J A;  1RUN A;  1ZEL A;  3WGH A;  2Z33 A;  3K1N A;  3KEO A;  3OYC A;  2HOT A;  2LY1 A;  5HS9 A;  5IP9 J;  2OV7 A;  1SD5 A;  1GDT A;  1UZC A;  1MSF C;  4QPO A;  4LLL A;  1K6Y A;  3S1N J;  4N4O B;  3SFZ A;  4NNJ A;  3ZQL A;  2CV0 A;  4UNO A;  4A3L J;  1NH3 A;  3VEP A;  4KN4 X;  2R92 J;  1YE9 A;  3JRG A;  4ETS A;  3DWL E;  3DBR B;  1ETW A;  4UUS B;  2KLO A;  1IF1 A;  1IG7 A;  3JSO A;  1SMT A;  5KHD A;  1QVU A;  2E71 A;  3TQN A;  3WTV C;  5JVG F;  2Q2E B;  5KAI C;  3I3L A;  5DD4 A;  3HRS A;  1R1T A;  2WAQ N;  4ABZ A;  3I5U A;  2EIM H;  1DPR A;  2G0E A;  4B1R A;  1SFE A;  2F5F A;  2XB5 A;  1G3Y A;  1ZLK A;  1H88 C;  2EZI A;  5F64 A;  2ZFW A;  2EV0 A;  3A0B C;  4L18 B;  5EEH A;  3GTL J;  2K4B A;  1Y56 A;  4MFE A;  4XRS A;  1RES A;  1F9N A;  3UNG C;  4KYW A;  3K4B A;  4KMU X;  5ED4 A;  3TO9 A;  4EEF G;  3G1L A;  2CFX A;  2E7X A;  2KZV A;  3VOE A;  1SAX A;  1HW2 A;  4HNV A;  1V5E A;  2DMQ A;  1PP7 U;  1R5G A;  1IRX A;  3OYJ A;  1TQI A;  1HKQ A;  2ZNY A;  3CCU I;  4HZF A;  1X2N A;  1XSV A;  1YLF A;  2ZME A;  3OYE A;  3CDH A;  3LFU A;  2WAE A;  3OYN A;  1IRF A;  4M9S A;  1BA5 A;  3G1O A;  1IN8 A;  4KIS A;  1NTC A;  1LE8 B;  2JT1 A;  3O3K A;  3CC7 I;  4U0V A;  5IT3 A;  4HEA 2;  3TDZ C;  4OAY A;  2E1C A;  2K85 A;  4CH7 A;  2R7F A;  3BQZ A;  3LAP A;  2BBY A;  1ERD A;  3TO6 A;  5DCM B;  3DPL C;  5CVI A;  4EGY A;  3NWT A;  3GUD A;  4AM3 A;  4E6K G;  1Z3X A;  3R6S A;  2IXS A;  2GQQ A;  3I59 B;  3W2A A;  1JTX A;  2X6Y A;  1ETO A;  4LFU A;  2JK3 A;  2MBF A;  2XIG A;  3J80 Z;  2KJC A;  1ENH A;  4PJN A;  2IA2 A;  3S17 J;  3WGG A;  1KYW A;  2G7U A;  1YX3 A;  3J7Z I;  4GYI A;  5F0F A;  2GOX B;  3JW4 A;  4DGW B;  1MBE A;  1V5G A;  1U5T B;  3R61 A;  1Z9C A;  2MC3 A;  1PP8 F;  2MD0 A;  1ZRE A;  2Y30 A;  5L3C A;  4GO1 A;  5L3E A;  2L9R A;  5CVV A;  4BYY A;  1JXS A;  2WB1 N;  5F1R A;  3SDG A;  2CYY A;  2PX9 A;  2DA6 A;  2VXZ A;  2V9P A;  2XAG A;  3HRM A;  1P4X A;  1RUO A;  1O4X A;  3QYF A;  4P9U A;  2GOM A;  3S3N A;  4XN0 A;  3MMY B;  2VON A;  3F8B A;  3QRF F;  3AG2 H;  4CCO A;  2HYF A;  3CUQ B;  2X1D A;  1RI7 A;  2XGC A;  1X3Z B;  1Z7L A;  3AG4 H;  4CUG A;  2JA5 J;  2G9W A;  3CF5 F;  2XB0 X;  4LLG F;  4YEL A;  3CJT B;  1B8I B;  1DP3 A;  1T39 A;  2BY0 A;  1FIP A;  2DMN A;  2K9L A;  2MSY A;  1BJZ A;  1NG6 A;  2HWV A;  5FRM A;  3HTU A;  1OFC X;  2LG4 A;  4IPA A;  2QKM B;  4BKX A;  1PUF A;  3HUG A;  3SYT A;  4MIM A;  2CWE A;  2ZJQ F;  4MTE A;  3EQL F;  4PZJ A;  4YEJ A;  5J1Y A;  1RR8 C;  2E1M C;  5AIQ A;  3IRQ A;  1MNE A;  3U1K A;  2WV0 A;  1ZR2 A;  5FFZ A;  3T1B A;  4M3F A;  5FO5 A;  3WU2 C;  2LSO A;  1YO5 C;  2LKP A;  2FQ4 A;  1XD7 A;  4BXX J;  5BPI A;  2L0K A;  4C2T A;  1XS9 A;  2QEN A;  2ZXH A;  1LEB A;  1IV8 A;  2RQP A;  2KDZ A;  3ZMU A;  2FRH A;  2I8D A;  2OBP A;  3GFI A;  3S15 J;  4BUP A;  1HDD C;  4A3F J;  2L3D A;  3ZQG A;  2NNN A;  1W5T A;  2XF5 A;  2R93 J;  3WTT C;  1ZK8 A;  2DTR A;  2YSR A;  3DKY A;  1A04 A;  4BQA A;  4XRM A;  5A2Q K;  3BTI A;  3GWZ A;  1JKP C;  1TL8 A;  3C7J A;  1VQ6 I;  2K9Q A;  3CCQ I;  3RPQ A;  1RKT A;  3L2C A;  3U2R A;  1Y39 A;  2XSD C;  5BPD A;  3GW2 A;  4HYE A;  1FTZ A;  4W97 A;  2F5E A;  4BDY A;  4QTR A;  1GXP A;  1HKT A;  4ZC3 A;  4QPQ A;  3L09 A;  4ZYA A;  5IPA A;  2FBH A;  5TRD A;  2HVQ A;  1TWA J;  3JRF A;  3CLQ A;  2HYJ A;  3PIP F;  5J6X A;  3KET A;  2KFD A;  2K9S A;  1LDJ A;  2EZH A;  4HV6 A;  4AUX A;  4V19 K;  2BY1 A;  1FLI A;  3BP8 A;  2E7W A;  2QQ9 A;  2W7N A;  2DXI A;  3DLA A;  1TNT A;  4HW0 A;  3BZC A;  1GUU A;  4I2O A;  5TIS C;  1D5V A;  1U6G A;  4M3E A;  1P4A A;  3DLL F;  1HF0 A;  2EPF A;  2ISY A;  3M1C A;  4AIK A;  3VYT B;  2HI3 A;  3OOU A;  4KIG A;  4A3C J;  4L5J A;  4D7M A;  4LB6 B;  3E1S A;  1FBQ A;  2EBI A;  2W25 A;  2DFF A;  2V1X A;  2LK2 A;  2P5K A;  1MND A;  3DF8 A;  1YJ9 I;  4E70 A;  5GP9 A;  4E7J A;  1SAU A;  5LLQ A;  4FT8 A;  1R49 A;  3HTS B;  1FP1 D;  2ESH A;  4OWR B;  2V26 A;  3S2W A;  2L9V A;  3IAM 2;  3QU6 A;  2D45 A;  1K78 A;  4PJL A;  2QBY B;  2VQG A;  3A1Y A;  3LSI A;  4I7H A;  2VI6 A;  2WC2 A;  3CD6 I;  1DPU A;  4BE0 A;  2STW A;  5J8F A;  2CG4 A;  3O8G A;  4XOR A;  1Z0X A;  2DMP A;  3ESW B;  2ACJ A;  4Y52 J;  1T56 A;  2IEK A;  4IO9 F;  1G2H A;  2IS1 A;  1GHC A;  2GBY A;  3CCL I;  1G3T A;  1A5J A;  2ZBK A;  5KK1 A;  2DA7 A;  4N9H A;  3RKX A;  2X1E A;  4G6D A;  5HS8 A;  4WWC A;  2H6C A;  5F0H A;  3WU1 B;  3IAS 2;  3ABM H;  2EFW A;  2ZC2 A;  1FSH A;  1WJF A;  2J5O A;  4DJA A;  1POG A;  2HTJ A;  3ZP5 A;  1LPQ A;  3CMM A;  3WHC A;  3PFI A;  4KIC A;  2M3A A;  4XK4 A;  3M3Y J;  2LNB A;  5E3M A;  2FMY A;  1YHQ I;  3WOD F;  2P4W A;  2W57 A;  1MZB A;  2UWM A;  3DTE A;  3BPX A;  1VFC A;  2JRT A;  2EIL H;  2JRM A;  5LHG A;  3CLO A;  1N25 A;  2XSJ C;  4S04 A;  1HCR A;  5CJ9 A;  1BI2 A;  1U9O A;  2DT6 A;  4PJ0 C;  1LVA A;  3RPU A;  4N4N B;  3F3X A;  1QGP A;  3DFG A;  1U78 A;  1XN7 A;  3FF5 A;  2V6C A;  1X1P A;  3BTJ A;  1G3W A;  1U5T C;  4P55 A;  2F4O B;  4XBF A;  3A2K A;  1TWH J;  3H3V K;  4M72 A;  5EG0 B;  2BGC A;  2ICW G;  4BNC A;  4A3E J;  2RV8 A;  3L9F A;  4G7Z F;  3BG9 A;  2Z3Y A;  3GVA A;  1IW7 F;  3PUB A;  1OCZ H;  2WWY A;  1VQN I;  1EF4 A;  1IO2 A;  2QLZ A;  1O57 A;  1JKQ C;  4IX7 A;  3FM3 A;  3CUO A;  3R4K A;  5EGO B;  3U21 A;  2E35 A;  3VYU B;  3A01 A;  3F72 A;  2DN0 A;  3GTG J;  1ETK A;  4L9J A;  2L02 A;  2VKE A;  4OIN F;  3CUQ C;  1DQU A;  3L2V A;  3F22 A;  4WF2 A;  1QHH D;  2CSO A;  1EV7 A;  2QCO A;  3Q9V A;  4L9N A;  2B7E A;  1W1W E;  1A31 A;  3ERE D;  1QVT A;  1K61 A;  3LOC A;  4HF1 A;  1IC8 A;  4XRF A;  1VQ5 I;  4U87 A;  5LFA A;  1W7P A;  3GLX A;  4ASN A;  1BM9 A;  1R5H A;  3LMM A;  2B63 J;  2HQA A;  3BQY A;  1ETV A;  2CFO A;  2EB7 A;  2M45 A;  2FF4 A;  2K4J A;  1OCT C;  1KU3 A;  1XX5 A;  1N75 A;  4L5I A;  1VQO I;  3ML6 A;  1T8I A;  3OIO A;  2CQ7 A;  2OCC H;  1ZAO A;  4G9Y A;  5CQE A;  2FU4 A;  2MH9 A;  4ZYH A;  1TWC J;  4XID A;  3H5A A;  4HV5 A;  5FGM A;  2XGE A;  4BAY A;  3OYI A;  3BR0 A;  6PAX A;  2P7C B;  2L2O A;  4B4C A;  4BBS J;  3FIS A;  4RLF A;  4EJO A;  3LA2 A;  3EUA A;  4CCN A;  2M7A A;  5ILU A;  4CO8 A;  4FQG A;  2O5R A;  2YX7 A;  4EQQ A;  4F52 A;  2Z16 A;  3EYI A;  5DTD A;  3RYR A;  2MAB A;  5CVU A;  1Z6R A;  1S6L A;  2BY3 A;  2JPC A;  5FKL A;  5F04 A;  5AON A;  4IXA A;  4R1H A;  1NHA A;  1QZE A;  1F5T A;  3NEU A;  5FKO A;  2V7F A;  3AFH A;  2YUS A;  2K27 A;  1M1E B;  4K2E A;  1MD0 A;  4M71 A;  1AHD P;  2XAF A;  1SFU A;  4C30 A;  1BC8 C;  3E0J B;  1I3Q J;  5D4R A;  3CCS I;  4DNC A;  4I99 C;  1Y1V J;  2DT5 A;  3DPU A;  3RYP A;  1EJ9 A;  4RGR A;  1YIJ I;  2KL4 A;  2GXB A;  3W6K B;  3HB9 A;  2DK5 A;  2PQ8 A;  4LB5 A;  1F43 A;  3GCM A;  1IXR C;  2LY2 A;  4CZC A;  4CCK A;  1YRN A;  1F1Z A;  3TW6 A;  1Q1V A;  1JJ8 C;  3H3Z A;  4OMZ A;  3Q0V A;  1P92 A;  4EV0 A;  3UKG A;  3KYL A;  2HDW A;  4F93 B;  4RB2 C;  1XMK A;  3OYF A;  3V7C A;  1B6A A;  2WAD A;  1TP4 A;  3BLY A;  1YJW I;  4AWX B;  4BEH A;  4DBR A;  5K5O A;  2IBD A;  3FXK A;  3T8T A;  3HYI A;  1JUS A;  5HNH A;  4YII A;  2LF8 A;  4MHG A;  4HF0 A;  1FOY A;  2IA0 A;  2R7S A;  2M34 A;  4HX7 A;  5LGU A;  4H0E A;  1D5Y A;  2TDX A;  1A36 A;  4IF4 A;  1FX7 A;  4ZDO A;  2RNG A;  2EWN A;  5D6E A;  3ZMD A;  1FC3 A;  4XNF A;  2QKL B;  2IS6 A;  2KZG A;  3GZ5 A;  4U0Y A;  5D5U B;  5CYV A;  4DZJ A;  1X1A A;  1Z7U A;  3K1P A;  4DQ2 A;  1X3W B;  3RKY A;  3OL3 A;  2FD5 A;  2K9M A;  3LST A;  3C2H A;  1T38 A;  1S29 A;  2VBX A;  4JOM A;  2YU9 J;  3KZI C;  3I4P A;  2F5V A;  4ENM A;  1FIA A;  3CDL A;  3T8R A;  2COM A;  4V2F A;  5DEQ A;  1MJB A;  4LK1 F;  4FX0 A;  1I1S A;  5D5V B;  1ONV A;  2KKO A;  3I9V 2;  1WH7 A;  1U8B A;  4XKV A;  5EDN A;  1H89 C;  1NK2 P;  1MBH A;  1HA8 A;  1LNW A;  1O3Q A;  3WG9 A;  2XC7 A;  3DEW A;  4HDV A;  2RKH A;  3BR1 A;  1MDM A;  1VQ4 I;  4HOB A;  2XGD A;  2IGO A;  2PMH A;  2XGX A;  3FMR A;  2CQQ A;  4LOC A;  5D4S A;  4CCL A;  2RRE A;  4F3Q A;  3LQR A;  4HQE A;  2A5W A;  2FML A;  2CUF A;  5CLS A;  2JN6 A;  3ECO A;  4MO7 A;  1ZAR A;  3H5N A;  1QA6 A;  1F36 A;  3BCA A;  2FSW A;  4II2 A;  1REP C;  3HHG A;  1I27 A;  4UUV A;  3RIR A;  3KZY A;  4Q48 A;  4U0W A;  5K7F A;  2FXA A;  2XAU A;  1SMY F;  1WRJ A;  2JA7 J;  4KNY A;  3RKW A;  1D8J A;  2VC0 A;  2F5D A;  3F0C A;  5DUK A;  1Y8Q B;  3HEF A;  3JTG A;  1OYI A;  3ZXS A;  1VI0 A;  1E17 A;  3CCM I;  5DDG A;  1UAA A;  4HSR A;  2CU7 A;  3PFY A;  4ZYE A;  1D1C A;  3OYM A;  2O8X A;  1LFP A;  1C0W A;  3NRV A;  3HPH A;  3TKY A;  4PK4 A;  5HLT A;  4WX9 A;  3L2R A;  3W6V A;  1X58 A;  4X0G A;  4ZTF A;  2IP2 A;  4RAY A;  2R7O A;  2GA2 A;  2NAZ A;  5FD6 A;  3PO2 J;  1KQ8 A;  3B73 A;  4BBR J;  2KIM A;  5GAD J;  1TT5 B;  3OYG A;  3IKV A;  4FE4 A;  2H1L A;  1W5S A;  2OF7 A;  2XPU A;  4HPQ A;  5BS6 A;  3LA7 A;  2IRF G;  1DU0 A;  3KEY A;  3G73 A;  2QM3 A;  5ILS A;  1EH8 A;  3S3O A;  2HQN A;  4EMS A;  3PUF A;  5K7H A;  2E2H J;  3G1M A;  3CJR B;  4I98 B;  4ON0 A;  3NAU A;  3TOA A;  5HVQ C;  1UHM A;  3OS0 A;  4IZZ A;  4ZYG A;  2M87 A;  4P9F A;  3G71 I;  4IRG A;  1G4D A;  4OMY A;  4NQW A;  4XSZ F;  4BE2 A;  9ANT A;  2IS4 A;  2ZCW A;  3KPH A;  3QP5 A;  1G59 A;  1ZG3 A;  3MN2 A;  1OYW A;  5K1Y A;  3FHN A;  2MC4 A;  2UUZ A;  1MBK A;  4IHX A;  2AO9 A;  3I54 A;  5ERI A;  3TP3 A;  4A0Z A;  1P9Q C;  1H0M A;  2EIN H;  1SFX A;  1K6O A;  1FSE A;  3K7A J;  5JLW A;  2PJR B;  1BI1 A;  2KQR A;  4LIU A;  2Z99 A;  4M6Y A;  2E19 A;  5H6Q A;  3HXL A;  3S93 A;  1QZZ A;  3VYR B;  5EEA A;  2D1H A;  3OYH A;  3IH4 A;  3P7N A;  1Z3Y A;  2UZK A;  1Z1D A;  2W1O A;  3OMY A;  2L7F P;  5M3M J;  2JMW A;  4ZYD A;  1EH6 A;  2GZW A;  3ZN1 A;  3K70 C;  5IOY A;  1D8K A;  2VKD A;  3S1Q J;  4LLN A;  2N8G A;  4IHT A;  4G6T B;  5KVR A;  3PQK A;  4L5E A;  2XHK A;  4B8X A;  4UV9 A;  5HDN A;  3RZD J;  4M6V A;  5IOZ A;  4NC8 A;  1U3E M;  2R7U A;  3HIF A;  3I64 A;  1ZG5 A;  2EFO A;  3LSP A;  5L3B A;  3I4N J;  1KON A;  3O2P E;  2FJ1 A;  4NBQ A;  1IDZ A;  1GXQ A;  3ZQI A;  3CTA A;  2A5Y B;  5DM7 F;  3QOE A;  4I76 A;  2L01 A;  4N0B A;  4EAT A;  3A4C A;  5GAG J;  1QBJ A;  2CV1 A;  2E34 A;  3KP3 A;  3K4K A;  3V8K A;  4JX4 A;  5HDK A;  2RDP A;  4IHV A;  1D3Y A;  3H35 A;  2MH2 A;  2KP6 A;  4A6D A;  2F2E A;  2MLG A;  3QPH A;  3GTK J;  1IZ1 A;  3ZN0 A;  3PNV A;  1JUP A;  3BJO A;  2ELH A;  1WJD A;  1SD7 A;  2GXG A;  4AD9 A;  3Q5F A;  3CCJ I;  3OIP A;  4ZH4 F;  2Y9Y A;  3HJE A;  1SFK A;  1SD6 A;  2K3P A;  5A2Q Z;  1WPK A;  1Z67 A;  1G3S A;  5D6F A;  4JK1 X;  3BG6 A;  2EV5 A;  3TDU C;  4GRI A;  2AS5 F;  2W00 A;  1R1V A;  5D5X B;  5JHF A;  1WJB A;  2MD5 A;  4RB3 C;  2OC6 A;  1AKH B;  2AQF A;  3BR6 A;  3FXL A;  2KT0 A;  2E2I J;  3VFZ A;  3LAJ A;  1T98 A;  3NWS A;  2MYS A;  1CGP A;  3DQV C;  1WWX A;  4ENK A;  5CQG A;  1CF7 A;  1R23 A;  3H0D A;  1OCP A;  3CJQ B;  1OYY A;  1IGN A;  4IRI A;  2AQE A;  1J09 A;  2DFE A;  2XF6 A;  3KP6 A;  3HOZ J;  2R5Z A;  2O61 A;  3W6J B;  5J1U A;  3SHF A;  1XSX A;  2ZFU A;  2ZXW H;  2OQG A;  3ECH A;  2D5V A;  1LDK B;  2VOO A;  3ZOB A;  2CQK A;  5F08 A;  2IA1 A;  1SC7 A;  1H9T A;  4LIV A;  4I6Z A;  2X0L A;  2R5Y B;  2AHQ A;  2XV4 S;  4LG0 A;  5JFR A;  1XCB A;  4ESF A;  1HLV A;  2P7V B;  3SQN A;  3IWZ A;  4EJV A;  1Y8R B;  2L7K A;  2DFH A;  4A69 C;  2M1B A;  2HVR A;  2LBF A;  4R79 A;  2X4H A;  1GV5 A;  2LKS A;  3LSM A;  3ZMZ A;  1ZH5 A;  3GFL A;  5F6F A;  3FZV A;  4D0P A;  3DEE A;  1B72 B;  1LVK A;  1VZ0 A;  3M8F A;  4PJJ A;  1EA3 A;  2XUB A;  4FX4 A;  3ZPL A;  2P81 A;  2XAJ A;  4PGG A;  3A03 A;  2ME0 A;  4EVI A;  2OAZ A;  3B6A A;  1R00 A;  5J3L A;  2DPU A;  2V79 A;  1A6Q A;  2VB6 A;  4QSH A;  2I5U A;  4BJT A;  3QPL A;  1QQI A;  5EEG A;  5C44 J;  1MKM A;  1SD4 A;  5D8L B;  3LL7 A;  3I71 A;  2VQH A;  3H1C A;  2KHM A;  4CIC A;  2LOO A;  2IW5 A;  2B9S A;  1IAW A;  2LP0 A;  1MMA A;  3FKI J;  3F8N A;  1UG0 A;  2PLY A;  2FNP A;  3BG3 A;  2V9K A;  3HM5 A;  4XOT A;  5FFX A;  4DYR A;  2R7R A;  1Q1H A;  1Z21 A;  2PMZ N;  2HEO A;  3FXR A;  2LD5 A;  5TGT A;  3F9K A;  3S32 A;  1J2X A;  2BYV E;  3ZR8 X;  2EFQ A;  1OCO H;  3VB2 A;  5J47 A;  2DMT A;  2XAH A;  3EET A;  5J4Y A;  2Q0O A;  2M4G A;  2MFZ A;  3R0J A;  2CRG A;  4LK0 F;  4EM0 B;  4YFK F;  1FOK A;  2ADU A;  2O03 A;  2VE8 A;  2HU9 A;  4TV7 A;  4BY7 J;  4XQF A;  4XLH A;  4ZDP A;  3P5J A;  1PDN C;  3I4M J;  2UV1 A;  2LRE A;  1ON2 A;  3VWB A;  2HDD A;  1QPM A;  2KRH A;  3X2Q H;  3ZMV A;  3QPS A;  1VQ7 I;  3LSG A;  4YRV A;  4UB8 C;  2IVM A;  3K9T A;  1UMQ A;  1OPC A;  2VJI A;  2YS9 A;  1XTA A;  2CJJ A;  5KCM A;  3OWT A;  2F48 A;  2E36 A;  1T95 A;  1S7E A;  2IGN A;  1MH4 A;  4BS9 A;  2X9D A;  1KU7 A;  2GXA A;  4HG2 A;  1HST A;  3L2Q A;  2NRA C;  4XR6 A;  2HGC A;  5GAE J;  3V7R A;  5LEK A;  3BY6 A;  2M2E A;  2QF7 A;  2A6T A;  4M9X A;  3RSN A;  1S72 I;  4GYG A;  3PM1 A;  2DOF A;  4IQ4 A;  5EJC A;  3M9A A;  1OJL A;  1P7J A;  2HZT A;  3MZY A;  1X19 A;  3DBL B;  3DKW A;  4AVZ A;  3K70 D;  1ZN2 A;  1WJE A;  2XAQ A;  4G12 A;  4UVC A;  3MZ8 A;  3JSP A;  3H0G J;  3WTW C;  4Q4Z F;  3WTZ A;  4CDG A;  1EH7 A;  4BGD A;  3EUH C;  4WK8 F;  4IEJ A;  1O3T A;  2PJP A;  3F6V A;  2QZ8 A;  3JR9 A;  2BVL A;  3WE2 A;  2VT2 A;  5LHH A;  4UUS A;  1JTY A;  4BE1 A;  2A61 A;  3GFM A;  1QRY A;  3EYY A;  4X1E A;  2V1U A;  4M3G A;  4Q5S F;  3LSH A;  1ZKG A;  2WA0 A;  4LIT A;  3Q3S A;  3QOD A;  3DEU A;  4IQJ A;  3QYE A;  3IP4 B;  2Y0S N;  4AIH A;  2Q2E A;  4ESB A;  3IUO A;  1DUX C;  2P8T A;  1G8X A;  2JWT A;  5L3G A;  2NS0 A;  2DJI A;  4KIB A;  4MFD A;  3IH3 A;  1TQM A;  2DA2 A;  3DXJ F;  2H27 A;  5HLH A;  1H8A C;  2FBK A;  2JTV A;  2KIS A;  1RRJ A;  2HOS A;  1JI8 A;  2HDC A;  5HNF A;  1SVM A;  3HKZ A;  1J7K A;  1SVO A;  3PO3 J;  2WBM A;  3OS1 A;  5J8C A;  3FHZ A;  1YS6 A;  1T0F C;  3OSF A;  2IAI A;  4CYC A;  1UJ8 A;  3ZQC A;  4BHP A;  1X2M A;  4CZZ A;  5LHI A;  3BJA A;  1P2F A;  4BJ5 C;  4E7S A;  3J80 K;  4C3H J;  3LSJ A;  1FBU A;  3HPG A;  1WJA A;  4AID A;  2VOP A;  5IYD J;  2IS2 A;  1WHU A;  4R8H A;  1NG7 A;  5CPR B;  5E1Z B;  3FXO A;  4BH9 A;  3CC4 I;  1T6S A;  3I55 I;  4HF2 A;  3CZ6 A;  3G6E I;  2R3S A;  4ENJ A;  2EFP A;  2V9V A;  2F4I A;  5B1B H;  2HOE A;  2L4A A;  1YX5 A;  1LE8 A;  2DPD A;  3DV8 A;  2OA4 A;  2JUC A;  5C3E J;  1Z05 A;  2WV1 A;  4FIS A;  3MEX A;  4HLX A;  1YG2 A;  5DS9 A;  1ZLJ A;  5BNG A;  2H09 A;  5DCM A;  1P4W A;  1PVE A;  4BXF A;  1MGT A;  2Z1D A;  2DA5 A;  2TRT A;  1LB2 A;  4XIC A;  2F5C A;  3I59 A;  4B3X A;  1ZR4 A;  2HPI A;  1ZRC A;  3HOV J;  1KYZ A;  4AIJ A;  1R22 A;  2IGM A;  4JQF A;  3VOD A;  1XG1 A;  2QVO A;  2EJR A;  3FXQ A;  3ZCO A;  4PSX A;  3PSF A;  1U5T A;  3JTH A;  3HL2 A;  2M30 A;  1WGX A;  2V1N A;  3JAM Z;  3HOS A;  2R7Q A;  1MDM B;  2OTJ I;  1XMA A;  2KIU A;  5H6R A;  3DU5 A;  1WKM A;  3LSR A;  5B5E C;  2DQR A;  4E7K A;  4U7B A;  4G7O F;  2COB A;  4KDP A;  3MZH A;  5LBQ A;  1TC3 C;  3BR5 A;  2JA2 A;  1RIO H;  2CMP A;  1OR7 C;  5ICE A;  1BI0 A;  2R7D A;  2XPV A;  4OU0 A;  3KX2 A;  3CUQ A;  4J19 A;  2A6H F;  1YW9 A;  1FT9 A;  3F6O A;  3Q9S A;  2F6C A;  1TT0 A;  2HNH A;  5GAH J;  1B8I A;  1FWZ A;  2YPR A;  2K40 A;  2DK8 A;  4F55 A;  2M4K A;  4E7L A;  3JRE A;  4OAZ A;  5ILV A;  2DA1 A;  2JJ7 A;  2DCE A;  2OQR A;  2CQN A;  3OL4 A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2IGO A;  5HOO A;  1W36 C;  4CCL A;  2RRE A;  4F3Q A;  2WY7 Q;  2A5W A;  1Y56 A;  3OR2 C;  3UNG C;  2LH9 A;  3H5N A;  3K4B A;  2JSP A;  2JVG A;  3D5S C;  3BCA A;  2KZV A;  3H9Q A;  4II2 A;  1E0E A;  1V5E A;  3LSK A;  2X51 A;  2VAS A;  1IRX A;  1DGR M;  3K10 A;  2Y0S A;  2XAU A;  2M0M A;  4HST A;  4KT6 A;  3OYJ A;  4RM2 A;  2W82 A;  3ZXS A;  3OYE A;  3DU6 A;  3EUK L;  3LFU A;  2WAE A;  1UAA A;  3OYN A;  4BU2 A;  4HSR A;  3PFY A;  1D1C A;  4KIS A;  3OYM A;  3SEQ A;  3J7A Y;  4HEA 2;  4OAY A;  1LFP A;  4Y4R A;  3HPH A;  3L2R A;  1TZL A;  4PK4 A;  4CH7 A;  5HLT A;  4X0G A;  2ZXI A;  4ZTF A;  2R7X A;  1ERD A;  2R7O A;  4NQW B;  4BEH B;  2LYC A;  3DPL C;  3NWT A;  4E6K G;  1Z3X A;  3OYG A;  1FMW A;  2IXS A;  1D1B A;  2CV2 A;  1W36 D;  3W2A A;  2X6Y A;  4HPQ A;  4HNT A;  3VSK A;  2X1C A;  3KEY A;  1PJR A;  4PJN A;  3S3O A;  1YX3 A;  4DGW B;  1X1D A;  2GOX B;  3CJR B;  4B47 A;  1V5G A;  5HVQ C;  4IZZ A;  3OS0 A;  2ZSH B;  2Z2S B;  2CW8 A;  2MD0 A;  4B44 A;  4BE2 A;  3L2U A;  2IS4 A;  3TBI A;  1G59 A;  3V42 A;  3FHN A;  2MC4 A;  1WJC A;  2VXZ A;  1AA7 A;  2UUZ A;  3OR1 C;  4DOZ A;  4PSW A;  4BL0 B;  1P9Q C;  2VJ4 A;  3QYF A;  3K4M A;  2GOM A;  3S3N A;  2PJR B;  2KQR A;  4LIU A;  3MMY B;  4XN0 A;  4IKF A;  4CCO A;  3S93 A;  3GBG A;  3HXL A;  3VYR B;  4CCJ A;  3OYH A;  1Z3Y A;  2X1D A;  2L5Q A;  2W1O A;  1Z7L A;  3OMY A;  4II3 A;  4CUG A;  3ZRG A;  4YEL A;  4BQO A;  4KIT B;  1DP3 A;  2K9L A;  2WY8 Q;  1NG6 A;  3K70 C;  4D1Q A;  5FRM A;  2VKD A;  3CP8 A;  2LG4 A;  4P5O A;  1BR4 A;  2QKM B;  4G6T B;  2BOL A;  4NC7 A;  4ZDL A;  4BAC A;  3UR3 C;  4LG3 A;  1GLN A;  2Q1Z B;  3SYT A;  4NC8 A;  2R7U A;  3CP2 A;  2KMU A;  4YEJ A;  1KON A;  2E1M C;  2VJJ A;  1MNE A;  2R7W A;  2L9N A;  2ELJ A;  3OYL A;  2VIX A;  3M8J A;  3QOE A;  4C2T A;  3VYS B;  2R4G A;  2L9S A;  2ZXH A;  4EAT A;  3A4C A;  2CV1 A;  1UEL B;  3QYB A;  4XKW A;  2M7B A;  3K4K A;  3BCB A;  1Y6I A;  4XM3 A;  2I8D A;  1D1A A;  3MD2 A;  3H35 A;  2KP6 A;  4BUP A;  4PJM A;  2XF5 A;  3DKY A;  3DTI A;  3PNV A;  1X1B A;  2X85 A;  2CUZ A;  4FET A;  1WJD A;  3AL0 B;  3OIP A;  1SFK A;  2K3P A;  3S8P A;  2KDO A;  4MLO A;  4BDY A;  1WFX A;  2CS3 A;  4ZC3 A;  5CKT A;  4QPQ A;  3HC7 A;  2CUJ A;  3BG6 A;  4ZYA A;  4BJ6 C;  2VL8 A;  4GRI A;  3VSL A;  2E60 A;  4Y3O A;  2W00 A;  2HVQ A;  3ONQ A;  5JHF A;  1WJB A;  2OC6 A;  1PYV A;  1N78 A;  2AQF A;  3RPU D;  1BOB A;  2ZSI B;  3NWS A;  2MYS A;  4P1W A;  2DXI A;  2W7N A;  3DQV C;  3DLA A;  5CQG A;  3FKJ A;  3H0D A;  2VKH A;  3CJQ B;  2VPL A;  2AQE A;  1J09 A;  2XF6 A;  4XLC A;  3M1C A;  3OYB A;  1OLT A;  3VYT B;  4F91 B;  1WJ5 A;  3OOU A;  3PSI A;  2X6X A;  3PJR A;  3E1S A;  2ZFU A;  3PL8 A;  2V6E A;  2R7T A;  4DBQ A;  1MND A;  3MKZ A;  1D0Y A;  4E7J A;  1SAU A;  1LDK B;  3VDX A;  4E7I A;  4XLF A;  4OWR B;  4BQN A;  4LIV A;  2DT7 B;  4RM3 A;  1QU3 A;  2V26 A;  4XKB A;  3BG7 A;  2HZD A;  3K4C A;  4RMN A;  2JUG A;  3IAM 2;  3AKZ A;  4J00 A;  1S9H A;  4PJL A;  2L7K A;  2HVR A;  2VQG A;  3A1Y A;  3LSI A;  2LBF A;  4R79 A;  3MKY B;  3EPZ A;  3LSM A;  4BE0 A;  3CES A;  3DEE A;  4XOR A;  2K5C A;  2VLA A;  3SDB A;  1LVK A;  1VZ0 A;  2IS1 A;  4PJJ A;  1EA3 A;  2VQC A;  4BDZ A;  4PFO A;  2VB6 A;  2X1E A;  3HUG B;  4AYB A;  4BJT A;  2VQL A;  3LL7 A;  4B48 A;  2VQH A;  3IAS 2;  2RQQ A;  2KHM A;  2LOO A;  1WJF A;  1MMA A;  4DJA A;  3CMM A;  3W2V A;  1UG0 A;  2M3A A;  4XLA A;  3OIQ A;  3OS2 A;  2V9K A;  4XOT A;  4FAS D;  2FUG 2;  2R7R A;  1Z21 A;  3DTE A;  2UWM A;  4RLQ A;  3K4L A;  5TGT A;  3F9K A;  4XOP A;  3S32 A;  4D9J A;  2XSJ C;  4XL9 A;  3ZR8 X;  1X4P A;  2DT6 A;  4ZTJ A;  1MW7 A;  2DOA A;  4N4N B;  3PNY A;  2M4G A;  2MFZ A;  4CCM A;  2JVH A;  4ITV A;  5KNL A;  2HU9 A;  4XQF A;  4XLH A;  4ZDP A;  3A2K A;  2UV1 A;  2LRE A;  4DIQ A;  1V5F A;  4HRI A;  3TMO A;  3VWB A;  1BR1 A;  3DKX A;  2BVM A;  2KRH A;  2XF7 A;  3RQ4 A;  3OYA A;  3LSG A;  3PUB A;  4YRV A;  3S3M A;  3K6G A;  4IX7 A;  4C9Y A;  1DGW Y;  2WAQ A;  3U21 A;  4C2U A;  2VJI A;  2IGK A;  5KCM A;  3VYU B;  1D0Z A;  2OUM A;  3OWT A;  1T95 A;  4CSW A;  4ZJZ A;  1N77 A;  4PUS A;  2IGN A;  4Y33 A;  4BS9 A;  4HG2 A;  3L2Q A;  3HOT A;  4XR6 A;  3OY9 A;  1DQU A;  3L2V A;  1QHH D;  2A6T A;  3RSN A;  4IQ4 A;  2R7V A;  1X19 A;  4AVZ A;  3K70 D;  4U87 A;  4XON A;  3N05 A;  2LRD A;  5LFA A;  1WJE A;  2LC2 A;  4E4H A;  3LMM A;  1D0X A;  2HQA A;  2VXD A;  4ANJ A;  2CFO A;  3DPT A;  1N75 A;  4E7Z A;  4BGD A;  3EUH C;  2XDV A;  1X1C A;  4XMY A;  2BVL A;  2E5Z A;  2HPM A;  5CQE A;  3RCO A;  3C2G A;  3MKW B;  4BE1 A;  3H9J A;  3L2W A;  3LSH A;  2LBF B;  3H5A A;  2WA0 A;  4LIT A;  3QOD A;  4IQJ A;  4H4K C;  3QYE A;  3IP4 B;  3OYI A;  3W3C A;  4KJZ A;  3D5L A;  2L2O A;  4RLF A;  3IUO A;  2CH0 A;  3EUA A;  4CCN A;  1G8X A;  2M7A A;  1U0J A;  2CW7 A;  2DJI A;  4J01 A;  2O5R A;  4F52 A;  2Z16 A;  2MAB A;  1FMV A;  1JI8 A;  5HNF A;  3HKZ A;  3AL0 C;  2WBM A;  4F92 B;  3ZQQ A;  3K4N A;  3OS1 A;  1T0F C;  4XKC A;  2V7F A;  3AFH A;  3H5R A;  3ZGK A;  3RTR A;  4C30 A;  3E0J B;  4BJ5 C;  4E7S A;  3FDY A;  3DPU A;  2KL4 A;  3HPG A;  1WJA A;  2WB1 A;  3DTK A;  2IS2 A;  5LD2 C;  1NG7 A;  3H9G A;  5CPR B;  3FBI B;  2LY2 A;  4CZC A;  4CCK A;  4HNU A;  3CZ6 A;  4NUB A;  3TL4 X;  2F4I A;  4E7H A;  1YX5 A;  1X4O A;  5FRN A;  2E1M B;  2V4J C;  3KYL A;  2HDW A;  4F93 B;  2X6W A;  3OYF A;  1LKX A;  2WAD A;  3BLY A;  4BEH A;  2KPM A;  4BXF A;  4DBR A;  4PFP A;  2Z1D A;  4BQQ A;  2PMZ A;  5HNH A;  5FRO A;  3OYD A;  4B3X A;  3W2W A;  2HPI A;  2R7S A;  2P0W A;  2BW3 B;  3BC8 A;  3SEZ A;  2IGM A;  4JQF A;  3OYK A;  1MMG A;  4ZDO A;  4AU7 A;  2RNG A;  3ZCO A;  4PSX A;  2NOJ B;  3PSF A;  4XNF A;  2W4S A;  2QKL B;  3HL2 A;  3FBN B;  2IS6 A;  2HVS A;  2KRC A;  2WAF A;  1QHG A;  1MMD A;  3HG9 A;  2V1N A;  1X1A A;  3HOS A;  2R7Q A;  3CF2 A;  1ZEL A;  3OL3 A;  2K9M A;  3C2H A;  3DU5 A;  3OYC A;  2LY1 A;  2OV7 A;  4E7K A;  4JOM A;  4B43 A;  4CA0 A;  4U7B A;  4QPO A;  1K6Y A;  4N4O B;  4NNJ A;  2CV0 A;  3G2B A;  1MMN A;  1R6R A;  2F5V A;  2BW3 A;  3PNT A;  2PJR A;  2JA2 A;  4XN3 A;  1YE9 A;  2CMP A;  1OR7 C;  3SZG A;  3DWL E;  3KX2 A;  3D5R C;  3I9V 2;  1HA8 A;  4XKV A;  2KLO A;  1BR2 A;  2XC7 A;  3K4J A;  2F6C A;  1TT0 A;  2HNH A;  5KHD A;  4XLE A;  2Q2E B;  4F55 A;  2M4K A;  3I3L A;  2E5N A;  4E7L A;  4OAZ A;  2DCE A;  3OL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...