2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
b'DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANKYRIN-REPEAT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Structural protein
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
2XB5A 2ZC2A 3LSMA 4IRGA 5BNGA 1IV6A 2GA2A 3CCSI 3E97A 2G7HA 2JZYA 3GMEA 1RPWA 4XLAA 4XLFA 3F21A 1YRNA 1WJEA 3S15J 4ZYGA 1PP7U 2CFOA 3JSOA 5E17F 1QZZA 2DMNA 1XMXA 2NS8A 4O3MA 4FETA 1LEBA 5ICFA 2EFOA 2KLOA 3ZN1A 2XPVA 2HVRA 3JRHA 5HLTA 3E6CC 1GDTA 2GBYA 1IZ1A 1IUYA 5LGTA 3S32A 1U5TA 4XSZF 2PJRA 2K27A 1ZQ3P 1QU3A 4I0AA 4EM0B 3HSFA 1B6AA 1BR4A 4RB0A 2P81A 2RNJA 2F5FA 3G2BA 2DA3A 4D9JA 3H3VK 2VI6A 1TLHB 2TDXA 4LK0F 2B7EA 3CDIA 3IWFA 4KN7X 1B9MA 5D8LB 1AKHB 1ZKGA 3OIPA 5FGMA 2HFHA 4P1WA 2EWNA 2CW8A 2CUFA 2LG4A 3HKZA 2QZ8A 3BDDA 1QZEA 3GEZA 2FBKA 3CUQA 2YU3A 3TEDA 1P7JA 4DNCA 5ILSA 4EMSA 2LTPA 4UHTA 1VQ4I 1JUPA 2MFZA 3BQYA 5A2QK 1E0EA 3K1PA 3SEQA 1BJZA 1QQIA 2GOMA 4N9IA 1KU7A 5HLIA 3U1KA 5E79C 2FNAA 2VKVA 3K0LA 2JWTA 4J19A 1ZGWA 3TDUC 1W0TA 2HXOA 4OWRB 4CSWA 4D7MA 2UUZA 3J80K 3RKYA 4PJLA 5FKLA 4PDKA 2JPCA 2ELJA 3MKYB 1X1AA 2IXSA 3F8BA 3LSJA 4S04A 5D4SA 3CCEI 1MJAA 5H6QA 2E1MB 3BG5A 5KAIC 4FT8A 3J7YJ 1BC7C 4BY7J 2XPWA 5LBQA 1FBQA 2O9LA 4MQ9F 4ZH4F 1J5YA 2W85A 4RGRA 4AIJA 3DPLC 1XG1A 4WX9A 5EZHA 3S16J 4C9YA 1BI2A 4G8XA 3RIRA 3FK6A 4L9VA 2O0YA 4BU2A 4S0HB 4CCJA 2E2HJ 4ZZLA 2F5CA 5KVRA 4CICA 1UMQA 4HX8A 2ELHA 3KYDB 2DT5A 1MMSA 1FC3A 2XKPA 3K70D 1SFXA 4X0GA 2NOJB 4PGHA 3J81Z 1LVAA 4UNOA 2V7FA 5DCMA 2F5EA 5L3EA 1LDJA 1YS7A 2MH2A 1FIAA 1X2MA 1B59A 3GZNB 5C4XJ 3Q3SA 1Y56A 4S05A 3I5UA 4IQ4A 3GWZA 2LY9A 5J6XA 3Q0WA 3HTUA 2XV4S 1YFHA 3OS0A 2BYVE 2M87A 3M3YJ 2JA2A 2VLAA 3D5LA 2KQRA 3KIOA 1FMWA 2DPUA 4UV8A 1WI9A 3IWZA 1R4MB 2AXLA 1JTXA 4RA2A 4B09A 2F6CA 3HHHA 4UXNA 3RQIA 3K1NA 4KISA 3QP5A 2FEZA 5HDKA 3GYHX 2ACJA 3QOPA 2ZXJA 3JRBA 2HEOA 4CCKA 4F91B 1ORKA 3DQVC 1WFXA 2EZLA 3BZKA 3MKWB 3WTYC 1LFBA 4BXUA 3ZQQA 3GTPJ 3QOEA 4ZDOA 2KRCA 1HW1A 4HX4A 4FCYA 2XAFA 2CQNA 2P5KA 2Q2EA 2R7RA 4GYGA 4HBLA 4KFCA 2ZNYA 1QBJA 1JUMA 2LMDA 4BE2A 2XF5A 1W4MA 1MZBA 2BY0A 2V6EA 2R7SA 1HXDA 1D0ZA 5F6FA 3QPLA 2EK5A 2FMLA 2KP6A 1T39A 2HS5A 2WB1N 4M72A 2VBXA 4GCVA 1MBGA 3LWFA 3M8FA 3HTSB 1NK3P 2P7CB 2Y48A 4L5IA 1HDPA 3HPHA 4M9SA 1B72A 4H0EA 1K6YA 4AVPA 3KYCB 3BOQA 3CP2A 2FQ4A 5L3BA 3K69A 4BQNA 5DD4A 3TW6A 1ZRDA 4QSHA 3TP3A 1UHMA 1MH4A 2W82A 2XHKA 3RSNA 3TBIA 2K4JA 4XLCA 5J4VA 4O6JA 1LNWA 1R23A 2EJRA 2L5QA 1FYLA 1LFPA 3I53A 2E1CA 2P7VB 3OYHA 1ON1A 2JA8J 2ICWG 5FFXA 3ZP5A 1IGNA 5IT9Z 2Z2SB 4O5VA 3L2CA 2VJ4A 3QYBA 1OCPA 4M6VA 3F0CA 2DU9A 1JKRC 4L5EA 2XPUA 3BY6A 5IT3A 5DS9A 2FQ3A 3DTEA 3WTWC 1IN4A 4JX6A 4MFEA 4PUSA 1K6OA 3C2GA 1TWGJ 1U2WA 2KIUA 2F4MB 2YSRA 1VQ7I 2DQRA 1YX5A 4JOMA 4KUMA 4RAZA 5TISC 1JTYA 1TWCJ 3Q9VA 1J2XA 3JCUC 3HUGA 3JREA 3HOXJ 2OCCH 3L09A 3OYNA 3O6BB 2OA4A 2W7NA 5JVGF 2QQAA 2LBFB 1I1GA 1ZAOA 1YTYA 5J47A 1MBKA 3V8KA 1R6RA 1V54H 3J7ZI 1TNTA 3AKZA 3S3MA 1MMDA 2BZTA 3ECHA 2QVOA 2EIJH 3I55I 2BHZA 2IS6A 4RGUA 5J1RA 5E1WA 3E6BA 4XKVA 1IRZA 2BY3A 2MABA 2JVGA 2LF7A 2IA0A 2RGVA 2RC4A 3KEQA 2FNPA 1ODDA 2W4SA 3BR1A 1A6QA 1QZYA 1BBYA 2L2OA 2A6HF 1FYMA 3MKZA 3F6OA 3WE3A 1JI8A 2DFFA 1YS6A 3CZ6A 2R7WA 2D2WA 1XDUA 4RDUA 2Y9YA 1RIOH 4U88A 3DLLF 5GP9A 3CCYA 1POGA 3I59B 4OMZA 4PSWA 3DBRB 3W3CA 5CVUA 1Y0NA 4HX7A 4I2OA 3S3OA 1A6IA 1VQ8I 2Q0OA 1OCOH 3REOA 4Y4RA 2QSHX 2VXDA 4U0WA 1X3WB 3SQNA 2HQAA 2YU9J 3ZN0A 1K4TA 2M30A 4I01A 4A3DJ 1MNEA 5CVVA 3MQ0A 4B4CA 1IRGA 1R5ID 2DMPA 5EYRA 3PIOF 3FDYA 1BI0A 4NDLA 3UKGA 3BJ6A 4XKCA 3OYBA 2VQGA 1B9NA 1YITI 3R0AA 3LSTA 1LKXA 1R00A 3F8FA 1MDMA 4EQQA 2HKXA 2LSOA 3KP3A 5A2QZ 1RKWA 2CGPA 2DOAA 1J0RA 2LOOA 3MFKA 1YG2A 1ZRFA 2LR8A 2FBIA 2IVMA 4HG2A 4ENJA 4ZDLA 5IOYA 1APLC 4CHUA 3FISA 5ICEA 2Z16A 2KJBA 3LQRA 3CCUI 1LDKB 3M8EA 3N97A 4MTDA 4LMYA 3FHNA 3J80Z 1UFMA 2VBYA 4II2A 4IF4A 3GLLA 3OIOA 1YOVB 1S72I 1W7PD 5GPAA 1BN5A 1FBSA 4C30A 4YIFA 1RC9A 2XGXA 5E20A 3TO7A 4L9JA 4AWXB 5BS6A 2DAOA 5K1YA 3CJQB 3JTHA 4HRIA 1OLTA 5B5EC 1ON2A 2NRAC 2RV8A 2M4KA 2O8XA 4PK4A 5HDGA 1Z1DA 5JI6A 1SFEA 2AS5F 1MBJA 2Q1ZB 2HYFA 4BJ5C 4XK4A 4XQFA 5EG0A 4GRIA 4XKWA 4KIGA 5JLWA 2EV5A 4LLGF 3MEXA 1Z6RA 1OISA 4BHCA 4BAYA 4RM3A 4A6DA 1Z7LA 2GQQA 3QYFA 2V1NA 1K78B 3WTTC 1XN7A 3JRAA 3WHBA 3I56I 4XBFA 1YW7A 3NARA 5HS9A 4AC0A 3AL0B 1YW8A 2HOEA 2KJCA 1D1CA 2XSDC 1VQ9I 2ZMEC 4KYWA 4IVNA 4BE0A 2HQRA 1HA8A 2R7QA 5AONA 3ZR8X 4F3QA 1KGSA 4ITVA 4XR6A 2HDCA 2N8GA 1IDZA 1B8IA 3QRFF 4JBAA 5B3SH 5E3OA 3V7SA 3EUHA 5F04A 3L2RA 5JFRA 5JHFA 5F64A 1O3TA 1JJ6C 4QWQA 2XDVA 1LE8B 2JSCA 1XMKA 2UV1A 1G6NA 1FJLA 2HOAA 1Z67A 2L9SA 2TCTA 2V1DA 3M07A 4Z6YA 4YRVA 2MLGA 2RREA 1OCCH 1FLIA 3F23A 4FTHA 2YS9A 3G4SI 4AVZA 5BQTA 1M1EB 4QPQA 4B3XA 5JVTA 4XICA 2LY1A 3JW4A 1FX7A 3DLAA 3S1NJ 2EZIA 5D6FA 2VE9A 1HSTA 2R7DA 3GTGJ 2ME0A 4WXCA 3AG2H 2ETHA 4CXFA 4XSXF 1G3TA 3CDLA 2MSYA 2VKDA 4KMFA 1W36D 3IH3A 4LJZF 1SVMA 1P4WA 1Y1WJ 1F9NA 3RCOA 5E18F 2HI3A 2V9PA 4CH7A 3F3XA 4GFBA 4F7ZA 4BYYA 3JR9A 1FZPB 5ED4A 3HGGA 2XF6A 1DQUA 2FXAA 3CCJI 3ZMUA 4G7HF 3AG3H 3I64A 4CCNA 2VC1A 2DQLA 3S2WA 3VEPA 2ISZA 1W7PA 5E3NA 2CQ7A 4DYRA 4DYQA 3KYLA 5FLVA 3TO9A 4G6TB 3IAS2 4M3GA 1JJ8C 3KX2A 2OQGA 4M9XA 3CCVI 2EFWA 1ETWA 1V4RA 2L7FP 2COBA 3DKXA 3HSRA 5HNHA 1RR8C 1ZH5A 1FEXA 5EEHA 2NS0A 4DIQA 1JGGA 2V79A 3GTQJ 3P7NA 3C7JA 2BXZA 1IG7A 2ZJ2A 4IHVA 2MGQA 3E0JB 4EM2A 4A3LJ 5F0FA 2MC4A 4CCLA 3CTAA 4N4NB 4RAGA 1UHWA 1PYVA 1W5SA 2ECCA 1IRXA 4NHJA 4LOCA 4XLPF 3HOVJ 1I1SA 4MHGA 2R5YB 6PAXA 1O57A 5EF6A 1XGMA 2BY1A 4Y3OA 3BR5A 2GZWA 3H3UA 4U87A 1FTTA 1SFKA 1XGNA 2QQBA 2BBYA 4E7ZA 1KQ0A 3IUOA 1H8AC 4KNYA 3BROA 2HKOA 3NWTA 4Q48A 3HRTA 3FZVA 3P9KA 2DMUA 4IJAA 3CDHA 3WGHA 1GHCA 4QLCU 2KMUA 1Z21A 4UY8I 5E1XA 1X1CA 4CA0A 4B43A 4B44A 4ZYDA 4RAFA 3FXUA 1IAWA 2K9LA 3AG4H 3CCLI 3F9KA 3L00A 2H6BA 3OYKA 1G3SA 2DOFA 1EV7A 5DDGA 1GV2A 3A01B 5LHIA 3HOWJ 4I09A 2H8RA 2L9NA 4G12A 5F0HA 1G59A 1T95A 1DU6A 4IHXA 2FD5A 4XRMA 3HRMA 4MEXF 1QVTA 3IHUA 4LLNA 2D1VA 3LAJA 2X6XA 2NNYA 2GM4A 4XRSA 1RNLA 5FRNA 5DD8A 2WADA 1UZCA 3HKZN 5IP7J 3JRFA 2LREA 2BY2A 2O7OA 2XAQA 3P9CA 2E36A 1PJRA 1WZ2A 1F36A 4P9UA 4OIOF 4XNFA 3SXYA 1JKPC 4BEHB 1R49A 2MA3A 3PSFA 3BG9A 1XS9A 2H1KA 5K5QA 5GAEJ 1TZLA 2VXZA 1BIBA 1TW2A 3V8JA 5IT9K 3DBHB 5EGOB 5E8IA 5LRRA 3MD2A 5DM6F 1VFCA 5FLXK 1Y8RB 2PFBA 3DP7A 4EM1A 3MMYB 2JA6J 1U5TC 3FIWA 4YFNF 2D45A 1N75A 1ERDA 2RN7A 4TV7A 5DUKA 4EJOA 3GTOJ 1P2FA 2X1DA 4P96A 3DFGA 3V42A 3MVPA 2NS7A 5EEAA 2DMQA 2QCOA 5E3MA 4PFPA 3BWGA 4PZJA 3GTMJ 2KZGA 2XAJA 3CMAI 1JT6A 1IW7F 4JQFA 2Y2ZA 3IKVA 4C2TA 3ZCOA 3CF5F 4OIPF 2P8TA 3TQNA 3HXLA 4LG3A 3RPQA 4OINF 2W25A 3BR3A 3CCRI 5IPAA 3BTCA 3CUQC 2GIVA 2WC2A 4RLFA 3HOYJ 4M6YA 2DA2A 1WCMJ 2VPRA 2E7XA 2DJIA 4EJVA 1J75A 2K9SA 5FKMA 3FK7A 3ZGKA 1XDSA 4AYBA 2VBZA 2E7WA 5M3MJ 3E5QA 1TT5B 4LFUA 4QIWN 5J8FA 4UVCA 5FKKA 3RTRA 1I50J 3CUOA 4IQJA 2HVQA 1ZG5A 1KQ8A 5FLMJ 4PSXA 3CO6C 1P7IA 3KCCA 3QU6A 3G3ZA 4HSRA 4OAZA 4ANJA 4U0YA 1PDNC 1HC8A 3FXLA 2WAQA 4UUTA 3GF2A 4Y7NJ 3LMMA 1QHGA 4ZYEA 2EA2A 2ZMEB 1O3SA 3S93A 4R8HA 1T6SA 3CJRB 3M1CA 4RB1A 1ZLJA 2Y9ZA 4YELA 1ZK8A 1HSJA 2L54A 3SZPA 3SHFA 2KISA 2ZCWA 1HQCA 1OCRH 1KU3A 2NOGA 1UJ8A 3RYRA 3BC8A 3VYRB 3ROUA 2DLLA 1UB9A 1CF7A 4V19K 3JSPA 2DJNA 1IF1A 3K10A 2EFNA 2X48A 4JK1X 2GAUA 3ZQHA 3OYDA 4E7LA 1Y39A 1MGTA 4RM2A 2L3DA 4LG0B 3P5JA 3S3NA 2M2EA 2VOOA 2ESHA 3OYMA 3NAUA 1EA3A 3FF5A 5TGTA 2CFXA 2STWA 3BT9A 1TWAJ 3QODA 1WJFA 3P9IA 4UVAA 4AUXA 1KU2A 3DEEA 4HF2A 1E17A 2FMYA 2GXGA 2WA0A 3WGGA 2HXIA 3B02A 1DP7P 1Z9CA 3CLOA 1AU7A 1WJBA 2ZXWH 3RZOJ 3GFMA 4LITA 1O3RA 3HPGA 5L3GA 2JMWA 3MZHA 3VFZA 4NQWB 1TWHJ 4XM3A 3V4GA 5B1AH 2Z99A 3M8JA 4BHPA 1FPQA 4IEJA 4BHBA 1HBXG 2E2IJ 4MFDA 1HKTA 1YI2I 2F4IA 3R6SA 2ESNA 2FF4A 4K2EA 2DYRH 4LB6B 1USSA 2OTLI 4WF2A 2K5CA 4MIMA 5B66C 4HV6A 5L3DA 3HJEA 2OU2A 3H0DA 1BW5A 2VASA 2IGNA 4HEA2 1WH7A 5HODA 1V3FA 2HQ5A 4G6QA 5DUIA 4DGWB 4IHYA 1OYIA 5CVRA 1Z6TA 3I4NJ 3B6CA 3BPVA 1BR2A 3GBGA 3GLXA 4DOZA 3PO3J 1BA5A 2DN0A 3CCQI 3ZMTA 3WE2A 1IXCA 1UELB 2BOLA 1D8KA 3HZJA 1MBEA 1ZGJA 3PNYA 2CW0F 3C1DA 4R79A 4AIDA 5JHUA 1H9GA 1S6LA 2QBYA 3OR1C 4IHTA 1EF4A 4ZTFA 3ISPA 1X4PA 3CO7C 1Q1VA 5LHHA 3LSPA 1XC5A 3PNTA 3VWBA 3WTSC 4PJMA 2UWMA 4ABZA 2PBIA 3SDGA 2MW8A 1QO0D 2W48A 3RJPA 2X51A 1S8NA 3BG6A 5D5XB 1A04A 2AO9A 3GZ5A 1CGPA 2KPMA 4CO8A 4E7JA 3BTJA 2VL8A 5TRDA 3A0HC 1Y0UA 1D0YA 2NNNA 2EILH 3MZ8A 1RZ4A 2OZ6A 2P5VA 2EBIA 2MYSA 4RGXA 4GDFA 3KPHA 3DCFA 3K70C 3H36A 3K4CA 2JT1A 2L4AA 1YRNB 1PUFA 2ISYA 2HU9A 2MG4A 4FISA 2EPFA 4BKXA 1LVKA 2LNBA 3J7AY 2A07F 2CU7A 1S29A 4ZC3A 4G7ZF 2HTJA 2RVCA 4J00A 5F1JA 2OZUA 3TMOA 4OAYA 4W97A 3IKTA 3MWMA 1SMTA 3W6VA 2XROA 2DOEA 2GLOA 2ZJPF 4OU0A 2BVMA 2PJRB 5FKOA 3RKWA 2DT7B 2JTVA 2WV0A 1QVUA 1AHDP 3KP6A 1U78A 2OCEA 1WKMA 2LVSA 3DPTA 3CJTB 4NBQA 2A6TA 3VYUB 1ZARA 5BPDA 1Z0XA 2A05A 3E1SA 2CUJA 5F1RA 2EQRA 1USTA 1Z7UA 5HLHA 1IO2A 2LK2A 2R7XA 2H94A 3ELKA 1V55H 3LFUA 2NYXA 3S1MJ 1MBFA 3LA7A 1ZR4A 3BR6A 3AAFA 1ETKA 3K7AJ 5M5WJ 1FNNA 2ZSIB 4JX5A 1FIPA 1E2XA 3W2AA 3QPSA 4LD5A 2ZJRF 2WWYA 1K83J 5GTHC 4BXFA 2GIZA 1EKEA 3CUQB 5FLXZ 4HDUA 1LEAA 1JUSA 3W2VA 4ESJA 3FXQA 4I76A 5CQGA 2A68F 4NNJA 1N77A 1SANA 5ICCA 4M3EA 1FTZA 2LDUA 4KT5C 5CPRB 1D1BA 2Y69H 2EIMH 3IRRA 3LQQA 3S17J 3L2VA 1BW6A 3O3KA 4WCGA 4A2UA 5HDNA 1MSEC 2BVLA 3TOBA 3QQAA 1LE8A 1DGRM 3FBNB 1LDDA 1Y6IA 3OOPA 2C6YA 1QNTA 4Q47A 4IOAF 3OMYA 3ZQCA 1JXSA 1GXQA 1WQ2A 2R0QC 1VQPI 5GAGJ 3MCZA 1IC8A 5EZGA 2DFEA 2ZXHA 2KDZA 3F8CA 4X1EA 3PIPF 1NK2P 4A3IJ 2I8DA 3CC4I 4MGRA 1B4AA 2RDPA 1YLFA 2QWWA 4CGZA 1XCBA 2LC2A 2XF7A 1GXPA 4R1HA 1F1ZA 3F72A 3K1MA 2R5ZB 4EGYA 2I5UA 3DTKA 3PM1A 3I0TA 2FA5A 3SZTA 5IP9J 4YFXF 4BQAA 3GZ6A 3K6GA 5FO5A 2EB7A 4CDGA 1SD6A 3SFZA 1MJBA 1ZHFA 2CS3A 2XAHA 2CQKA 3MZYA 4FE4A 5H20A 5JLXA 2FU4A 2QF7A 4HQEA 3GCMA 3DKYA 1GV5A 2STTA 2L0KA 3M1EA 2Y31A 4ENMA 1I6HJ 2L9VA 2TRTA 1CQTA 4Y15A 4XMYA 1Z77A 1I5ZA 2HQNA 4WXHA 3ML6A 2MC3A 4UUSA 4HLYA 2P6SA 1T33A 1WVRA 2PX9A 5M5YJ 4IHSA 2E71A 1I39A 2OBPA 2XASA 5HNFA 4II3A 3K4JA 3X2QH 2IGKA 1BJAA 4DBRA 1STZA 3BG3A 1J09A 2P6TA 5DCMB 2VT2A 1L3LA 4LIUA 1DPUA 3HSEA 2LLKA 2R7OA 5E3LA 3MAJA 3KZYA 4HZFA 1N25A 1WWXA 1GVJA 3L7WA 2AXTC 2F48A 3PSIA 1X3UA 1TP4A 2FJ1A 1FSHA 4KMUX 3T1BA 1OCZH 1Q1HA 2KFDA 4I0BA 2CV0A 2H09A 4CYCA 2ZJQF 1A36A 2K40A 5GAHJ 3HIFA 5GADJ 3ZQLA 2I10A 1R22A 4EATA 2Z3YA 5BMZA 1MD0A 4M3BA 3DXJF 2CW7A 2HDWA 3KLOA 2VUMJ 3WTVC 2CWEA 1YO5C 2Q8KA 2HZDA 5LLQA 4HNVA 2K9NA 3ZMVA 3SYTA 1P6RA 5JR3A 1SFOJ 2HOTA 4ZZDA 4AIHA 2LH9A 1FOWA 2MLKA 2F4OB 1S7EA 3RDIA 1VI0A 1BIAA 3EUHC 2YX4A 4U7BA 1MSFC 3HL2A 1JE8A 2L7ZA 1FYKA 4A3MJ 4A5NA 5GTIC 4HF1A 1HLVA 2E1OA 4LGWA 1WGXA 3FM5A 4G7OF 4E7KA 2O6GE 2Q2EB 4PJ0C 4HNUA 2DDBA 2FBHA 2HNHA 3LSHA 1ZTRA 2FE3A 3FM3A 5C4JJ 1J59A 2VJ5A 1XCVA 3G1OA 2Y75A 1MKMA 4V2GA 2VC0A 3VPRA 2KIFA 3EQLF 3JRIA 2IBDA 1QHHD 1ETVA 2K02A 1XSDA 2A3SA 3EDPA 4BL0B 2O61A 1TT0A 2KRFA 3GVAA 5DYMA 3PO2J 4E7SA 2KL4A 4ASNA 1HKQA 4A0ZA 3JRCA 2DA1A 3QPTA 3VSKA 3OYGA 5E8GA 1G3YA 5D6EA 1B72B 2CV2A 2LKSA 2G9WA 3BJOA 5H6RA 1R1VA 1E3HA 2QKMB 3NQOA 3L2UA 3GFLA 4MLOA 4XONA 1H89C 3S2DJ 3SJMA 2YUSA 2B63J 3VODA 2B0LA 1U6GA 3QYEA 3F8NA 2MD0A 2BW3A 3KETA 5LFAA 3TKYA 2DT6A 3RYPA 2M5WA 1WPKA 3CC2I 3H5AA 4ZTJA 3U1DA 1I27A 2ECBA 1RRJA 1WHUA 1R36A 1ZGAA 1X3ZB 3R61A 5HS7A 1O7FA 4ENKA 3U9GA 1D1AA 3W6JB 4I99C 3VB2A 1FP2A 1R5HA 5E1ZB 5BOXA 1D8JA 2DYSH 4CUGA 4EV0A 2MD5A 3ZMZA 5CLSA 2EH3A 2XB0X 3CLQA 2RQQA 2ME6A 4N9HA 3HUGB 4QTRA 3DTIA 3TW7A 2VPLA 3WG7H 1FOYA 5ILVA 5FKNA 3BZCA 4XRFA 1ONVA 2CYYA 3WTZA 3WG9A 1RI7A 3Q9SA 4KIBA 1TQIA 4XN0A 3N05A 4RAYA 5CQEA 3ULQB 1O3QA 4PGGA 4KICA 5LEJA 3CQZJ 1S9HA 4EJWA 4BY1J 2V4JC 4HNTA 3ZPLA 2G7UA 3PFYA 2JRMA 4Y13A 1C0WA 2KT0A 4RB3C 2FUG2 1MW7A 1NHAA 3T8RA 1BL0A 1GVDA 2M8EA 4OIQF 3DU5A 1T56A 1X1DA 1JHFA 5LEKA 3PQJA 5FD5A 1VTNC 2H6CA 3E3VA 2HPIA 1IRFA 4BNCA 2CJJA 2O8KA 1RUOA 4A6EA 1P9QC 3K4KA 1AOYA 2DBBA 1F5TA 3DWLE 1LB2A 3OOUA 4RB2C 1AKHA 1WI3A 2VQCA 3WU0A 3S1QJ 2VBWA 2DODA 1D3YA 3M9AA 3NRVA 4GXOA 1W5CC 1LFUP 3K4NA 5M5XJ 4Y33A 2YR2A 2HPMA 3TL4X 1DUXC 1OR7A 2JUGA 4BUPA 5CVJA 3HDDA 3L2QA 4AYBN 2ZNZA 1W36C 3KZIC 3FMRA 3FKIJ 1S7AA 1S3JA 3OYJA 2XGCA 5FFZA 2DFHA 2VJIA 2IS2A 5DV5A 3RQ4A 3DKWA 2K7LA 1MDMB 2E34A 3ZQIA 4C3HJ 2IGMA 2WAQN 2A5WA 4BJTA 4XIDA 4ESBA 4M6XA 3HB9A 2PQ8A 2OQRA 4RS8A 1YX3A 1PVEA 2VB6A 4HPQA 1A5JA 1JHHA 1F4KA 4OMYA 3WU2C 2W24A 1BOBA 3JAMZ 1K4SA 3PUFA 1H0MA 1G2HA 1T2KA 1DU0A 1OCTC 1T98A 3VDXA 3FBIB 4KJZA 4XRSG 3A1YA 2V9KA 4UUVA 2OC6A 1BOAA 2EFQA 2OUMA 5LHGA 3K4MA 4GYIA 4N4OB 3OYIA 5C44J 4A3CJ 2JPBA 4A0XA 3V7RA 1SD4A 2Y0SA 1ULYA 4MQVA 1EH6A 1LQ1A 1RKTA 1I3AA 1FOKA 2Z9OA 4B3AA 3EPZA 3OS1A 3ZMSA 3ESWB 5EJCA 2W84A 2PMZA 1KZHA 1G3WA 1BM9A 3HOUJ 2K4BA 3F22A 2GA1A 3HGYA 4UB6C 1KU9A 4YIRX 5CVIA 1SMYF 1YE9A 1ZR2A 1VQKI 3DEWA 1QPMA 3B73A 1VQLI 2XVCA 1P4AA 1YW9A 4E6KG 3H1CA 2HOSA 2A61A 2NVYJ 1TBXA 5D8KB 2X6WA 4G9YA 1YYVA 3SDBA 4A0YA 1R9TJ 2M4GA 3I71A 1K61A 5DTDA 3H5NA 1H88C 1HCRA 3ZRGA 1D5YA 1ETYA 2ID3A 3U21A 4NC7A 2H27A 3Q5FA 2K9QA 4RMNA 2EIKH 2JUCA 2ZB9A 1AWCA 3Q0UA 1IN5A 5IYCJ 3GFIA 4UV9A 2LY2A 1MJ9A 3W2WA 4P55A 4B48A 1HKSA 4UB8C 2M8GX 2R4GA 1V5EA 4B47A 1XMAA 3F8MA 2X1EA 3OL4A 2MBFA 4BDZA 1X1BA 2AQEA 1ITYA 2ADUA 4M9ZA 1BR1A 4B1RA 3WHCA 3BR0A 3HYIA 4DZJA 3RPUD 2NVXJ 5CYVA 1AA7A 2G0EA 5EEGA 2DA5A 4FE7A 3ZQ7A 2JA5J 1TL8A 1XPXA 4C2UA 1X4OA 1Z3XA 2KHMA 2QQ8A 2DDAA 1SC7A 2VONA 3J7AO 2E19A 3TDZC 4FHTA 4MO7A 4KITB 1WJCA 3CMMA 1V5GA 3VSLA 4IOCF 5HLGA 2KIMA 2OF7A 4XORA 4ZDPA 5J1YA 4ZJZA 1Y8QB 2VQHA 1SD5A 4WXDA 2X85A 5KAFC 4QPOA 4A3JJ 1TW3A 4P5OA 3W6KB 2JSPA 3O8GA 2A5YB 2H8WA 4I7HA 1XB4A 4LLLA 1HW2A 2JA7J 2YX7A 2QLZA 4LB5A 1S7OA 4ZYAA 1EH7A 2X0LA 1A35A 5DEQA 1OPCA 4Y52J 3COAC 1I6XA 5LD2C 2P0WA 2JJ7A 3PQKA 2X6OA 2HWVA 1MNDA 2XUBA 1W7PB 2XIGA 1IUFA 1ZN2A 1LJ9A 4XLNF 2L7KA 4BDYA 3RI4A 4MTEA 2QQ9A 4D5FA 1DDNA 5GPCA 2CUEA 2WAFA 4IRIA 1SAUA 3S8PA 1IJWC 4F55A 1XSXA 5BPIA 1WJDA 2M7AA 2M3AA 1RUNA 1JGSA 1N78A 4CCOA 1IN6A 2R7VA 2A6EF 3RKXA 3PNVA 1LPQA 2IA2A 4XLEA 2IJLA 3O8HA 2LP0A 4ESFA 5DM7F 3GW2A 3L2WA 5TJJA 4Q5SF 1ZG3A 3ABUA 2W1OA 1XTAA 2O03A 3LAPA 3KP2A 2K3PA 3R60A 3CP8A 2E5NA 4A93J 3LA3A 3FKJA 1ETOA 4BACA 2DI3A 1G8XA 1JKOC 2W57A 3ZQFA 2LBFA 3IH4A 1J9IA 1KYZA 2X1CA 3N4MA 4HW0A 2JVHA 3LFKA 3JRGA 1IDYA 2V6CA 2Z1DA 1VQ6I 4XL9A 4I6ZA 2BV6A 3B6AA 4CCMA 1VQ5I 4CZZA 3DEUA 3OYFA 3HOSA 3TGNA 2R5ZA 3AG1H 1I3QJ 3RPUA 3OYCA 4X6AJ 1KONA 3I4MJ 3QAHA 5CKTA 3T5XA 3BTIA 3HHGA 3E5XA 2GOXB 3LNQA 2EINH 3TP0A 3EETA 1MMNA 4EJUA 3L1PA 3CMEI 2R93J 2GXAA 2XAUA 1Z05A 3CD6I 5J1UA 2OJED 2QYOA 4HA8A 2V26A 4HF0A 2DFIA 3MKLA 1U9NA 3I59A 4LIVA 2K85A 3ABLH 5M3FJ 1HOMA 5FD6A 1RESA 3E6MA 2M1BA 4IKFA 1R5GA 4A3FJ 2CG4A 1SVOA 1JKQC 1E3PA 2QSFX 4ETSA 1QRYA 5ILUA 2A69F 4PJJA 4XLHA 4NUBA 5D5UB 1F43A 4B8XA 4WWCA 1X19A 4EVIA 3PUBA 4AIKA 4BXXJ 2M34A 1FY7A 2QGUA 3KE2A 3K4BA 4WK8F 4A3KJ 1R7JA 4KA4A 1QA6A 1XD7A 2R7ZJ 3EYYA 2LKXA 2HGCA 4HSTA 2OV7A 1Z3YA 2LD5A 3U2RA 2R7UA 3HRUA 2QENA 1IV8A 2JQ7A 5D5VB 2XSJC 3OS2A 1WJ5A 2JRTA 3QPHA 1P4XA 3VOEA 4U7DA 3GX4X 3BTLA 3OV8A 4E7IA 3GO5A 3ZXSA 3A0BC 1OKRA 1ZREA 4BJ6C 2LRDA 3AL0C 5F27A 1TWFJ 4C3JJ 2RKHA 2FRHA 3F6VA 2XRNA 3ASOH 1DP3A 5KHDA 3EUAA 5AIPA 1VF9A 2VN2A 1SFUA 4JP0A 4C3IJ 1HDDC 2E60A 2QSGX 1PP8F 3RZDJ 3RKQA 1DPRA 1TNSA 3OYLA 1FBUA 4ENNA 2IPQX 4PJNA 1ZG1A 3DBLB 1U9OA 2IEKA 3C2BA 5J40A 3BCAA 1W5TA 2Z5UA 3FMQA 1WH5A 4OIRF 2BGCA 3OSFA 2ZKZA 4AD9A 2BXYA 3NWSA 3HM5A 2XRLA 1QPIA 4Z2YA 1U5TB 3VYSB 3V7CA 5F08A 1JT0A 2HTSA 4DJAA 5FB2A 4M71A 1W1WE 4A69C 3CC7I 1ZRCA 3M4OJ 4L5JA 1ETQA 4DYCA 4XOTA 2CO5A 2AQFA 1OFCX 3DU6A 2L9RA 1WJAA 1EH8A 3SFIA 4D7NA 2DA4A 3E7LA 1K78A 4UVBA 2FOWA 1ZLKA 1X58A 2HDDA 2X4HA 1SEUA 4PFOA 2DK5A 2P4WA 4CZCA 1V5FA 4A5MA 1UG2A 3EYIA 3ZMDA 1CF7B 3IRQA 2R3SA 2R7FA 3BP8A 3HEFA 3AFHA 3A4CA 4NC6A 4H4KC 4YFKF 5L3CA 5C3EJ 4A3BJ 1ACIA 2X9DA 3OSGA 3JTGA 1YHQI 2V1UA 3G1MA 5K5RA 2QKLB 3ZQGA 4L0ZB 2ZSHB 5J4YA 3KEYA 1GLNA 2HYGD 2WY8Q 1NG6A 1FSEA 1S5LC 2F5VA 1YQAA 2KKOA 3JAMK 2D5VA 1RETA 5L3FA 5KCMA 2O5RA 5AIQA 3OYEA 1BI3A 3KFWX 2WAEA 1VQOI 3HOZJ 2LYCA 4W1UA 4A12A 4RGSA 4HOBA 4L18B 3E5UA 1X2NA 3ABKH 4Q4ZF 4IL6C 3EUKL 2E35A 2KRHA 4L9TA 5FJ8J 2CV1A 1D5VA 2DPDA 3OWTA 4RBOA 2BEOA 3T8TA 5IOZA 4FX4A 4YIIA 2E2JJ 1K79A 2HYJA 2M0MA 1U3EM 4MEYF 4CYDA 1ETXA 1MBHA 2ZO4A 4ON0A 1FMVA 4F93B 3L9FA 3WODF 2PLYA 4KDPA 3E6DA 2PEXA 2NVUB 2Z33A 4FASD 3C2HA 4IRHA 3FXJA 2PMHA 3LOCA 1K7AA 2ELKA 1MMGA 2Y30A 2PI0A 3PJRA 2NAZA 4PCQA 3WU1B 3I4PA 2EZKA 4C2MJ 3GTJJ 3FXKA 3SEZA 4P9FA 2VODA 2FSWA 2QEXI 1REPC 3SZGA 1Y1VJ 2XKOA 2M0CA 4L0YB 1EJ9A 1SVLA 3ERED 4L9NA 4N0BA 3FXOA 3H3ZA 4E4HA 3D0SA 1YJNI 1TC3C 2QBYB 2L01A 3OIQA 4ZYHA 5F0CA 2XC7A 2WB1A 3C18A 1TQPA 1XX5A 2P5LC 1UG0A 2GWRA 1XGSA 2R5YA 5IYDJ 2R92J 1R1TA 1PUEE 2IA1A 3BR2A 5HVQC 1ZELA 2AHQA 1OMIA 1TTYA 3HBLA 4DBQA 2DMTA 5FRMA 1T0FC 2ID6A 2EA4A 3OR2C 3R0JA 3ABMH 3H9JA 4XN3A 3DF8A 3D5RC 2E5ZA 1FT9A 2L02A 2VJJA 4D1QA 2E1NA 3WGIA 2RNGA 3LSIA 2DW4A 2LKPA 5IY5H 3FMSA 3K2AA 3H92A 4M3FA 4HDVA 1T08B 3IAM2 1Z91A 3JRDA 2L7MP 2WY7Q 3BG7A 3LL7A 1J7KA 3A01A 5K5OA 3TO6A 1PUFB 2CQQA 2EFPA 1MNMC 2VIXA 1R58A 4IHWA 3I3LA 5KNLA 1MIJA 2LFBA 5K7ZA 3H35A 4DW6A 2B9SA 4KIFA 1H9TA 4E70A 3CCMI 2PN6A 3KEOA 3WTUC 5ERIA 5K7FA 4BEHA 3IV5A 2VT3A 4BS9A 4BGDA 1TQMA 3QU3A 1MMAA 3ZOBA 1T0FA 5J3LA 3V8LA 4Y17A 4F92B 4M3DA 2QM3A 1MH3A 2IP2A 1GUUA 1RR7A 5EGOA 2K9MA 3ERMA 1XSVA 5H2FC 1KYWA 3HG9A 5B1BH 3LSGA 4IPAA 4NC8A 4I02A 2CSOA 1IXRC 3ABTA 3VYTB 3LA2A 1FP1D 5LGUA 4BQQA 3GTLJ 3CMYA 1SAXA 2R7TA 3CESA 3C3WA 2M7BA 1ZYRF 3BPXA 1UAAA 3BCBA 2K3FA 3S1RJ 2CMPA 2IS4A 2F5DA 4G94A 2DTRA 2XAGA 3GXOA 2X6YA 2V1XA 4BBSJ 2OPTA 1VQNI 3FXMA 2ZXIA 1NTCA 2COMA 4GO1A 2Y0SN 3O2PE 3LSRA 2VE8A 1O7LA 1XGOA 4XKBA 2J5OA 1OR7C 3OYAA 4M74A 2PMZN 4EJTA 1U0JA 3K4LA 4HYEA 3CF2A 3IH2A 3I54A 4BQOA 2XGEA 2D1HA 5LGNA 3WTXC 1D0XA 2GXBA 1R71A 4G6DA 3D5SC 5HOOA 1VQMI 4A3GJ 2IGOA 1NG7A 4I98B 2O3FA 4V2FA 3MN2A 5K7HA 3KP5A 4KN4X 4F52A 4BE1A 1YIOA 2HZTA 2W00A 3FXRA 1R1UA 3OL3A 4IXAA 5ICGA 2QUFA 2ZFUA 2ZMEA 2NVTJ 2OTJI 2V9VA 2E1MC 4YG2F 4U0VA 3UR3C 4AM3A 2EV6A 1ENHA 3DV8A 3J81K 3BLYA 3BQZA 3TOAA 4HLXA 3KLNA 4UUSB 3R4KA 5DCFA 2KZVA 4JYKA 2IS1A 5FROA 5HS8A 2DA6A 1T38A 4FQGA 4IO9F 3BZ6A 1IXSB 3T0YA 2KIQA 1OYWA 4JX4A 5CJ9A 2UZKA 3A2KA 2NXNB 1R4NB 2VKHA 1VNDA 1A31A 2K86A 5KK1A 4BBRJ 2PG4A 1UHSA 3OY9A 2F2EA 2HR3A 4AU7A 1L0OC 1LUJB 2FOKA 2DK8A 3H9GA 1DGWY 2MH9A 4OOIA 4LG0A 3FWEA 3HRSA 1YJWI 1HF0A 1T8IA 3QWLA 3ECOA 4CYCB 2FX0A 2IAIA 2PJPA 4XOPA 9ANTA 5IP6A 2IRFG 3HC7A 2UXNA 5D5WB 1YJ9I 2DA7A 3K9TA 1SD7A 2ZFWA 2DTZA 3GTKJ 1FWZA 2OAZA 3A02A 1VZ0A 4NQWA 2CRGA 4GGGA 2CQXA 4D5CA 2KDOA 3G73A 3KZZA 1BC8C 3FHZA 2H1LA 3HOTA 2PMUA 4J01A 3D1NI 2BHYA 2DO7A 1QGPA 4EEFG 3I58A 3G71I 2EV0A 2J5PA 2Y0MA 3PL8A 1U8RA 2VOPA 2EZHA 3UNGC 3KP7A 1IN8A 1KA8A 2VQLA 2BE5F 2RQPA 1OYYA 4KT6A 5LRSA 3K2ZA 5EG0B 2WV1A 4BH9A 5IYBJ 2ZBKA 3IP4B 1NH3A 3M7GA 2UXXA 1FOXA 1YIJI 1P92A 4D0PA 2M9HA 3G1LA 2CUZA 5EDNA 1KQ9A 3QP6A 3NEUA 4M73A 1HW5A 2CH0A 3DPUA 3FX3A 3A03A 3IC7A 2HVSA 2L4MA 3BJAA 1B1BA 2VKEA 4LK1F 3CJNA 1OQYA 1IN7A 2DXIA 4HAMA 3GUDA 2NVQJ 3GFJA 1U8BA 1UCRA 1W0UA 2DCEA 2JK3A 4DZPA 2BW3B 3Q0VA 2LF8A 1B8IB 3S2HJ 4EGZA 3LSKA 3ASNH 2M45A 1X1PA 4IX7A 3G6EI 2WBMA 4HV5A 3H5RA 2QA4I 4DQ2A 3IL2A 1O4XA 1OJLA 1GT0C 2OD5A 3H9QA 2XGDA 3ONQA 4RLQA 4MNUA 4A3EJ 5D4RA 1WSUA 3S14J 4HQMA 1G4DA 1BI1A 1WRJA 4NB5A 3KP4A 4YEJA 5J8CA 1E3OC 2YPRA 3PFIA 4FX0A 2IT0A 2RAEA 2IW5A 4IZZA 4E7HA 2JN6A 3I9V2 2WTEA 3H0GJ
chains in the Genus database with same CATH topology
5HNFA 2XSJC 4II3A 3K4JA 3LSMA 3OS2A 1WJ5A 3RCOA 2IGKA 4CH7A 4DBRA 4XLAA 4XLFA 2XF6A 1J09A 4E7IA 1DQUA 3ZXSA 1WJEA 4LIUA 4BJ6C 2LRDA 2R7OA 2CFOA 4CCNA 3AL0C 4FETA 2KLOA 3PSIA 3KYLA 1DP3A 2HVRA 5KHDA 3EUAA 4G6TB 3IAS2 3KX2A 5HLTA 2CV0A 3DKXA 2E60A 5HNHA 3S32A 4DIQA 4EATA 3OYLA 2PJRA 4PJNA 2CW7A 2HDWA 1QU3A 2HZDA 3E0JB 3BCAA 2MC4A 4CCLA 1BR4A 4N4NB 1PYVA 3SYTA 1IRXA 3NWSA 2LH9A 3G2BA 4D9JA 3VYSB 3EUHC 4U7BA 4Y3OA 3HL2A 4DJAA 4U87A 3OIPA 4P1WA 1SFKA 2CW8A 4E7KA 2Q2EB 4HNUA 4E7ZA 3IUOA 3LSHA 2HNHA 2LG4A 3DU6A 2AQFA 3HKZA 4XOTA 3NWTA 2VJ5A 1WJAA 2MFZA 2KMUA 1Z21A 1E0EA 4CA0A 1QHHD 1X1CA 4PFOA 4B43A 3SEQA 4B44A 2GOMA 2K9LA 4CZCA 1V5FA 4BL0B 1TT0A 3F9KA 4E7SA 2KL4A 3OYKA 2L9NA 1G59A 1T95A 3AFHA 3A4CA 3VSKA 4H4KC 3OYGA 2CV2A 4OWRB 4CSWA 2UUZA 4PJLA 2QKMB 2X6XA 2ELJA 3MKYB 3L2UA 1X1AA 2IXSA 4MLOA 4XONA 2QKLB 5FRNA 2WADA 2ZSHB 2LREA 3KEYA 1GLNA 2WY8Q 2E1MB 1NG6A 1PJRA 2F5VA 3QYEA 4XNFA 2MD0A 2BW3A 5KCMA 2O5RA 4BEHB 3OYEA 5LFAA 3PSFA 2DT6A 3H5AA 2WAEA 1TZLA 2VXZA 4ZTJA 3DPLC 2LYCA 4C9YA 3MD2A 1D1AA 3EUKL 4BU2A 4CCJA 2KRHA 2CV1A 3MMYB 3OWTA 1N75A 1ERDA 4CUGA 2X1DA 3V42A 2M0MA 2RQQA 3HUGB 3DTIA 3K70D 2VPLA 4X0GA 1FMVA 4F93B 2NOJB 4PFPA 2V7FA 4FASD 3C2HA 4JQFA 4C2TA 1MMGA 3PJRA 4XN0A 3N05A 5CQEA 3ZCOA 1Y56A 4IQ4A 3HXLA 4LG3A 1S9HA 3SEZA 4RLFA 2V4JC 4HNTA 3PFYA 3SZGA 3OS0A 2DJIA 2JA2A 2VLAA 3D5LA 2KQRA 2FUG2 1FMWA 1MW7A 3ZGKA 4E4HA 3DU5A 4AYBA 1X1DA 3OIQA 2F6CA 2XC7A 2WB1A 2HPIA 3RTRA 4KISA 4IQJA 2HVQA 1P9QC 3K4KA 1UG0A 4CCKA 4F91B 4PSXA 4OAZA 3DQVC 3DWLE 4HSRA 4ANJA 5HVQC 1WFXA 1ZELA 2WAQA 3MKWB 3OOUA 3ZQQA 2VQCA 4DBQA 3LMMA 1QHGA 3QOEA 4ZDOA 2KRCA 5FRMA 1T0FC 3S93A 3CJRB 3OR2C 2R7RA 3M1CA 3H9JA 4XN3A 3D5RC 3K4NA 4BE2A 4Y33A 2E5ZA 2VJJA 4YELA 4D1QA 2HPMA 2XF5A 3TL4X 4BUPA 2JUGA 2RNGA 2V6EA 3L2QA 3LSIA 1D0ZA 2R7SA 1W36C 2KP6A 3BC8A 3VYRB 3IAM2 3OYJA 2WY7Q 2VJIA 3BG7A 2IS2A 3RQ4A 3LL7A 3K10A 2IGMA 3OYDA 2A5WA 3HPHA 2VIXA 4BJTA 4E7LA 1K6YA 3I3LA 5KNLA 4RM2A 3CP2A 1YX3A 2VB6A 4HPQA 4BQNA 3H35A 3S3NA 3OYMA 1EA3A 2W82A 5TGTA 1BOBA 3QODA 1WJFA 3RSNA 3DEEA 3TBIA 4BEHA 2WA0A 4XLCA 3VDXA 3FBIB 4KJZA 3A1YA 2L5QA 4BS9A 2V9KA 4BGDA 1LFPA 1WJBA 2OC6A 2OUMA 1MMAA 4LITA 4F92B 3OYHA 3HPGA 3K4MA 2Z2SB 4N4OB 3OYIA 4NQWB 4XM3A 2VJ4A 2K9MA 3QYBA 2Y0SA 3DTEA 3M8JA 3HG9A 3LSGA 4PUSA 3C2GA 4NC8A 3EPZA 3OS1A 1YX5A 2PMZA 4JOMA 3VYTB 2F4IA 4BQQA 2R7TA 3CESA 2M7BA 1UAAA 2K5CA 3OYNA 2W7NA 3BCBA 1YE9A 2CMPA 3H0DA 2IS4A 2LBFB 2VASA 2IGNA 4HEA2 1R6RA 4DGWB 4E6KG 3AKZA 2X6YA 3S3MA 1MMDA 1BR2A 3GBGA 4DOZA 2X6WA 3SDBA 2ZXIA 2IS6A 2M4GA 3H5NA 4XKVA 3ZRGA 1UELB 3U21A 4NC7A 2BOLA 4RMNA 2MABA 4XKBA 1OR7C 2JVGA 3OYAA 3PNYA 2W4SA 4R79A 1U0JA 2LY2A 3K4LA 2L2OA 3CF2A 3W2WA 3MKZA 4B48A 1JI8A 4BQOA 2R4GA 3CZ6A 2R7WA 1V5EA 1D0XA 3OR1C 4B47A 4ZTFA 2X1EA 3OL4A 1X4PA 4BDZA 5HOOA 1X1BA 2AQEA 3D5SC 3PNTA 3VWBA 2IGOA 1BR1A 1NG7A 4PSWA 4PJMA 2UWMA 3W3CA 3RPUD 1AA7A 3S3OA 4F52A 4BE1A 4C2UA 2W00A 4Y4RA 2VXDA 1X4OA 1Z3XA 2KHMA 3OL3A 2ZFUA 2HQAA 4KITB 2E1MC 1WJCA 3CMMA 1V5GA 2X51A 3VSLA 1MNEA 3BG6A 3UR3C 4XORA 4ZDPA 4ZJZA 3BLYA 2VQHA 2KPMA 2X85A 4E7JA 3FDYA 4QPOA 2VL8A 2KZVA 4P5OA 2IS1A 1D0YA 2JSPA 5FROA 2MYSA 4XKCA 4ZYAA 3OYBA 2VQGA 3K70C 3K4CA 1LKXA 3A2KA 5LD2C 2VKHA 2P0WA 2HU9A 1MNDA 4AU7A 1LVKA 2DOAA 2LOOA 3J7AY 3H9GA 1DGWY 4ZC3A 4HG2A 4ZDLA 4J00A 2L7KA 4BDYA 3TMOA 4OAYA 2Z16A 1LDKB 4XOPA 2WAFA 3HC7A 1SAUA 3S8PA 4F55A 2BVMA 3FHNA 2PJRB 4II2A 1WJDA 2DT7B 2M7AA 2M3AA 1N78A 4CCOA 2R7VA 3DPTA 4C30A 2A6TA 3VYUB 3CJQB 4HRIA 1OLTA 1VZ0A 3PNVA 3E1SA 2CUJA 2KDOA 4XLEA 2M4KA 4PK4A 2R7XA 3LFUA 3HOTA 4J01A 2Q1ZB 3L2WA 4BJ5C 4XQFA 2W1OA 2ZSIB 4GRIA 4XKWA 3W2AA 3PL8A 2K3PA 3UNGC 3CP8A 4BXFA 2E5NA 2VQLA 4RM3A 3FKJA 1Z7LA 3QYFA 4BACA 2V1NA 3W2VA 1G8XA 5CQGA 4NNJA 4KT6A 1N77A 2LBFA 3AL0B 2X1CA 5CPRB 1D1BA 1D1CA 3IP4B 3L2VA 2JVHA 4BE0A 1HA8A 2R7QA 2Z1DA 3ZR8X 4F3QA 4XL9A 2BVLA 4ITVA 4XR6A 4CCMA 2CUZA 1DGRM 3FBNB 3OYFA 3HOSA 1Y6IA 3OMYA 3OYCA 1KONA 2CH0A 3DPUA 3L2RA 5CKTA 5JHFA 2HVSA 2ZXHA 2GOXB 2I8DA 2DXIA 2XDVA 1MMNA 2UV1A 2LC2A 2XF7A 2DCEA 2XAUA 2BW3B 2L9SA 3DTKA 2V26A 4YRVA 3LSKA 2RREA 4LIVA 4IX7A 4AVZA 3K6GA 4QPQA 4IKFA 2WBMA 4B3XA 3H5RA 2LY1A 3DLAA 2CS3A 3DKYA 3H9QA 3ONQA 4RLQA 4XLHA 4PJJA 4NUBA 4XMYA 1X19A 3PUBA 2VKDA 3K4BA 4YEJA 1W36D 4HSTA 2OV7A 4IZZA 4E7HA 1Z3YA 3I9V2 2R7UA 3OY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 2XB5 A;  2ZC2 A;  3LSM A;  4IRG A;  5BNG A;  1IV6 A;  2GA2 A;  3CCS I;  3E97 A;  2G7H A;  2JZY A;  3GME A;  1RPW A;  4XLA A;  4XLF A;  3F21 A;  1YRN A;  1WJE A;  3S15 J;  4ZYG A;  1PP7 U;  2CFO A;  3JSO A;  5E17 F;  1QZZ A;  2DMN A;  1XMX A;  2NS8 A;  4O3M A;  4FET A;  1LEB A;  5ICF A;  2EFO A;  2KLO A;  3ZN1 A;  2XPV A;  2HVR A;  3JRH A;  5HLT A;  3E6C C;  1GDT A;  2GBY A;  1IZ1 A;  1IUY A;  5LGT A;  3S32 A;  1U5T A;  4XSZ F;  2PJR A;  2K27 A;  1ZQ3 P;  1QU3 A;  4I0A A;  4EM0 B;  3HSF A;  1B6A A;  1BR4 A;  4RB0 A;  2P81 A;  2RNJ A;  2F5F A;  3G2B A;  2DA3 A;  4D9J A;  3H3V K;  2VI6 A;  1TLH B;  2TDX A;  4LK0 F;  2B7E A;  3CDI A;  3IWF A;  4KN7 X;  1B9M A;  5D8L B;  1AKH B;  1ZKG A;  3OIP A;  5FGM A;  2HFH A;  4P1W A;  2EWN A;  2CW8 A;  2CUF A;  2LG4 A;  3HKZ A;  2QZ8 A;  3BDD A;  1QZE A;  3GEZ A;  2FBK A;  3CUQ A;  2YU3 A;  3TED A;  1P7J A;  4DNC A;  5ILS A;  4EMS A;  2LTP A;  4UHT A;  1VQ4 I;  1JUP A;  2MFZ A;  3BQY A;  5A2Q K;  1E0E A;  3K1P A;  3SEQ A;  1BJZ A;  1QQI A;  2GOM A;  4N9I A;  1KU7 A;  5HLI A;  3U1K A;  5E79 C;  2FNA A;  2VKV A;  3K0L A;  2JWT A;  4J19 A;  1ZGW A;  3TDU C;  1W0T A;  2HXO A;  4OWR B;  4CSW A;  4D7M A;  2UUZ A;  3J80 K;  3RKY A;  4PJL A;  5FKL A;  4PDK A;  2JPC A;  2ELJ A;  3MKY B;  1X1A A;  2IXS A;  3F8B A;  3LSJ A;  4S04 A;  5D4S A;  3CCE I;  1MJA A;  5H6Q A;  2E1M B;  3BG5 A;  5KAI C;  4FT8 A;  3J7Y J;  1BC7 C;  4BY7 J;  2XPW A;  5LBQ A;  1FBQ A;  2O9L A;  4MQ9 F;  4ZH4 F;  1J5Y A;  2W85 A;  4RGR A;  4AIJ A;  3DPL C;  1XG1 A;  4WX9 A;  5EZH A;  3S16 J;  4C9Y A;  1BI2 A;  4G8X A;  3RIR A;  3FK6 A;  4L9V A;  2O0Y A;  4BU2 A;  4S0H B;  4CCJ A;  2E2H J;  4ZZL A;  2F5C A;  5KVR A;  4CIC A;  1UMQ A;  4HX8 A;  2ELH A;  3KYD B;  2DT5 A;  1MMS A;  1FC3 A;  2XKP A;  3K70 D;  1SFX A;  4X0G A;  2NOJ B;  4PGH A;  3J81 Z;  1LVA A;  4UNO A;  2V7F A;  5DCM A;  2F5E A;  5L3E A;  1LDJ A;  1YS7 A;  2MH2 A;  1FIA A;  1X2M A;  1B59 A;  3GZN B;  5C4X J;  3Q3S A;  1Y56 A;  4S05 A;  3I5U A;  4IQ4 A;  3GWZ A;  2LY9 A;  5J6X A;  3Q0W A;  3HTU A;  2XV4 S;  1YFH A;  3OS0 A;  2BYV E;  2M87 A;  3M3Y J;  2JA2 A;  2VLA A;  3D5L A;  2KQR A;  3KIO A;  1FMW A;  2DPU A;  4UV8 A;  1WI9 A;  3IWZ A;  1R4M B;  2AXL A;  1JTX A;  4RA2 A;  4B09 A;  2F6C A;  3HHH A;  4UXN A;  3RQI A;  3K1N A;  4KIS A;  3QP5 A;  2FEZ A;  5HDK A;  3GYH X;  2ACJ A;  3QOP A;  2ZXJ A;  3JRB A;  2HEO A;  4CCK A;  4F91 B;  1ORK A;  3DQV C;  1WFX A;  2EZL A;  3BZK A;  3MKW B;  3WTY C;  1LFB A;  4BXU A;  3ZQQ A;  3GTP J;  3QOE A;  4ZDO A;  2KRC A;  1HW1 A;  4HX4 A;  4FCY A;  2XAF A;  2CQN A;  2P5K A;  2Q2E A;  2R7R A;  4GYG A;  4HBL A;  4KFC A;  2ZNY A;  1QBJ A;  1JUM A;  2LMD A;  4BE2 A;  2XF5 A;  1W4M A;  1MZB A;  2BY0 A;  2V6E A;  2R7S A;  1HXD A;  1D0Z A;  5F6F A;  3QPL A;  2EK5 A;  2FML A;  2KP6 A;  1T39 A;  2HS5 A;  2WB1 N;  4M72 A;  2VBX A;  4GCV A;  1MBG A;  3LWF A;  3M8F A;  3HTS B;  1NK3 P;  2P7C B;  2Y48 A;  4L5I A;  1HDP A;  3HPH A;  4M9S A;  1B72 A;  4H0E A;  1K6Y A;  4AVP A;  3KYC B;  3BOQ A;  3CP2 A;  2FQ4 A;  5L3B A;  3K69 A;  4BQN A;  5DD4 A;  3TW6 A;  1ZRD A;  4QSH A;  3TP3 A;  1UHM A;  1MH4 A;  2W82 A;  2XHK A;  3RSN A;  3TBI A;  2K4J A;  4XLC A;  5J4V A;  4O6J A;  1LNW A;  1R23 A;  2EJR A;  2L5Q A;  1FYL A;  1LFP A;  3I53 A;  2E1C A;  2P7V B;  3OYH A;  1ON1 A;  2JA8 J;  2ICW G;  5FFX A;  3ZP5 A;  1IGN A;  5IT9 Z;  2Z2S B;  4O5V A;  3L2C A;  2VJ4 A;  3QYB A;  1OCP A;  4M6V A;  3F0C A;  2DU9 A;  1JKR C;  4L5E A;  2XPU A;  3BY6 A;  5IT3 A;  5DS9 A;  2FQ3 A;  3DTE A;  3WTW C;  1IN4 A;  4JX6 A;  4MFE A;  4PUS A;  1K6O A;  3C2G A;  1TWG J;  1U2W A;  2KIU A;  2F4M B;  2YSR A;  1VQ7 I;  2DQR A;  1YX5 A;  4JOM A;  4KUM A;  4RAZ A;  5TIS C;  1JTY A;  1TWC J;  3Q9V A;  1J2X A;  3JCU C;  3HUG A;  3JRE A;  3HOX J;  2OCC H;  3L09 A;  3OYN A;  3O6B B;  2OA4 A;  2W7N A;  5JVG F;  2QQA A;  2LBF B;  1I1G A;  1ZAO A;  1YTY A;  5J47 A;  1MBK A;  3V8K A;  1R6R A;  1V54 H;  3J7Z I;  1TNT A;  3AKZ A;  3S3M A;  1MMD A;  2BZT A;  3ECH A;  2QVO A;  2EIJ H;  3I55 I;  2BHZ A;  2IS6 A;  4RGU A;  5J1R A;  5E1W A;  3E6B A;  4XKV A;  1IRZ A;  2BY3 A;  2MAB A;  2JVG A;  2LF7 A;  2IA0 A;  2RGV A;  2RC4 A;  3KEQ A;  2FNP A;  1ODD A;  2W4S A;  3BR1 A;  1A6Q A;  1QZY A;  1BBY A;  2L2O A;  2A6H F;  1FYM A;  3MKZ A;  3F6O A;  3WE3 A;  1JI8 A;  2DFF A;  1YS6 A;  3CZ6 A;  2R7W A;  2D2W A;  1XDU A;  4RDU A;  2Y9Y A;  1RIO H;  4U88 A;  3DLL F;  5GP9 A;  3CCY A;  1POG A;  3I59 B;  4OMZ A;  4PSW A;  3DBR B;  3W3C A;  5CVU A;  1Y0N A;  4HX7 A;  4I2O A;  3S3O A;  1A6I A;  1VQ8 I;  2Q0O A;  1OCO H;  3REO A;  4Y4R A;  2QSH X;  2VXD A;  4U0W A;  1X3W B;  3SQN A;  2HQA A;  2YU9 J;  3ZN0 A;  1K4T A;  2M30 A;  4I01 A;  4A3D J;  1MNE A;  5CVV A;  3MQ0 A;  4B4C A;  1IRG A;  1R5I D;  2DMP A;  5EYR A;  3PIO F;  3FDY A;  1BI0 A;  4NDL A;  3UKG A;  3BJ6 A;  4XKC A;  3OYB A;  2VQG A;  1B9N A;  1YIT I;  3R0A A;  3LST A;  1LKX A;  1R00 A;  3F8F A;  1MDM A;  4EQQ A;  2HKX A;  2LSO A;  3KP3 A;  5A2Q Z;  1RKW A;  2CGP A;  2DOA A;  1J0R A;  2LOO A;  3MFK A;  1YG2 A;  1ZRF A;  2LR8 A;  2FBI A;  2IVM A;  4HG2 A;  4ENJ A;  4ZDL A;  5IOY A;  1APL C;  4CHU A;  3FIS A;  5ICE A;  2Z16 A;  2KJB A;  3LQR A;  3CCU I;  1LDK B;  3M8E A;  3N97 A;  4MTD A;  4LMY A;  3FHN A;  3J80 Z;  1UFM A;  2VBY A;  4II2 A;  4IF4 A;  3GLL A;  3OIO A;  1YOV B;  1S72 I;  1W7P D;  5GPA A;  1BN5 A;  1FBS A;  4C30 A;  4YIF A;  1RC9 A;  2XGX A;  5E20 A;  3TO7 A;  4L9J A;  4AWX B;  5BS6 A;  2DAO A;  5K1Y A;  3CJQ B;  3JTH A;  4HRI A;  1OLT A;  5B5E C;  1ON2 A;  2NRA C;  2RV8 A;  2M4K A;  2O8X A;  4PK4 A;  5HDG A;  1Z1D A;  5JI6 A;  1SFE A;  2AS5 F;  1MBJ A;  2Q1Z B;  2HYF A;  4BJ5 C;  4XK4 A;  4XQF A;  5EG0 A;  4GRI A;  4XKW A;  4KIG A;  5JLW A;  2EV5 A;  4LLG F;  3MEX A;  1Z6R A;  1OIS A;  4BHC A;  4BAY A;  4RM3 A;  4A6D A;  1Z7L A;  2GQQ A;  3QYF A;  2V1N A;  1K78 B;  3WTT C;  1XN7 A;  3JRA A;  3WHB A;  3I56 I;  4XBF A;  1YW7 A;  3NAR A;  5HS9 A;  4AC0 A;  3AL0 B;  1YW8 A;  2HOE A;  2KJC A;  1D1C A;  2XSD C;  1VQ9 I;  2ZME C;  4KYW A;  4IVN A;  4BE0 A;  2HQR A;  1HA8 A;  2R7Q A;  5AON A;  3ZR8 X;  4F3Q A;  1KGS A;  4ITV A;  4XR6 A;  2HDC A;  2N8G A;  1IDZ A;  1B8I A;  3QRF F;  4JBA A;  5B3S H;  5E3O A;  3V7S A;  3EUH A;  5F04 A;  3L2R A;  5JFR A;  5JHF A;  5F64 A;  1O3T A;  1JJ6 C;  4QWQ A;  2XDV A;  1LE8 B;  2JSC A;  1XMK A;  2UV1 A;  1G6N A;  1FJL A;  2HOA A;  1Z67 A;  2L9S A;  2TCT A;  2V1D A;  3M07 A;  4Z6Y A;  4YRV A;  2MLG A;  2RRE A;  1OCC H;  1FLI A;  3F23 A;  4FTH A;  2YS9 A;  3G4S I;  4AVZ A;  5BQT A;  1M1E B;  4QPQ A;  4B3X A;  5JVT A;  4XIC A;  2LY1 A;  3JW4 A;  1FX7 A;  3DLA A;  3S1N J;  2EZI A;  5D6F A;  2VE9 A;  1HST A;  2R7D A;  3GTG J;  2ME0 A;  4WXC A;  3AG2 H;  2ETH A;  4CXF A;  4XSX F;  1G3T A;  3CDL A;  2MSY A;  2VKD A;  4KMF A;  1W36 D;  3IH3 A;  4LJZ F;  1SVM A;  1P4W A;  1Y1W J;  1F9N A;  3RCO A;  5E18 F;  2HI3 A;  2V9P A;  4CH7 A;  3F3X A;  4GFB A;  4F7Z A;  4BYY A;  3JR9 A;  1FZP B;  5ED4 A;  3HGG A;  2XF6 A;  1DQU A;  2FXA A;  3CCJ I;  3ZMU A;  4G7H F;  3AG3 H;  3I64 A;  4CCN A;  2VC1 A;  2DQL A;  3S2W A;  3VEP A;  2ISZ A;  1W7P A;  5E3N A;  2CQ7 A;  4DYR A;  4DYQ A;  3KYL A;  5FLV A;  3TO9 A;  4G6T B;  3IAS 2;  4M3G A;  1JJ8 C;  3KX2 A;  2OQG A;  4M9X A;  3CCV I;  2EFW A;  1ETW A;  1V4R A;  2L7F P;  2COB A;  3DKX A;  3HSR A;  5HNH A;  1RR8 C;  1ZH5 A;  1FEX A;  5EEH A;  2NS0 A;  4DIQ A;  1JGG A;  2V79 A;  3GTQ J;  3P7N A;  3C7J A;  2BXZ A;  1IG7 A;  2ZJ2 A;  4IHV A;  2MGQ A;  3E0J B;  4EM2 A;  4A3L J;  5F0F A;  2MC4 A;  4CCL A;  3CTA A;  4N4N B;  4RAG A;  1UHW A;  1PYV A;  1W5S A;  2ECC A;  1IRX A;  4NHJ A;  4LOC A;  4XLP F;  3HOV J;  1I1S A;  4MHG A;  2R5Y B;  6PAX A;  1O57 A;  5EF6 A;  1XGM A;  2BY1 A;  4Y3O A;  3BR5 A;  2GZW A;  3H3U A;  4U87 A;  1FTT A;  1SFK A;  1XGN A;  2QQB A;  2BBY A;  4E7Z A;  1KQ0 A;  3IUO A;  1H8A C;  4KNY A;  3BRO A;  2HKO A;  3NWT A;  4Q48 A;  3HRT A;  3FZV A;  3P9K A;  2DMU A;  4IJA A;  3CDH A;  3WGH A;  1GHC A;  4QLC U;  2KMU A;  1Z21 A;  4UY8 I;  5E1X A;  1X1C A;  4CA0 A;  4B43 A;  4B44 A;  4ZYD A;  4RAF A;  3FXU A;  1IAW A;  2K9L A;  3AG4 H;  3CCL I;  3F9K A;  3L00 A;  2H6B A;  3OYK A;  1G3S A;  2DOF A;  1EV7 A;  5DDG A;  1GV2 A;  3A01 B;  5LHI A;  3HOW J;  4I09 A;  2H8R A;  2L9N A;  4G12 A;  5F0H A;  1G59 A;  1T95 A;  1DU6 A;  4IHX A;  2FD5 A;  4XRM A;  3HRM A;  4MEX F;  1QVT A;  3IHU A;  4LLN A;  2D1V A;  3LAJ A;  2X6X A;  2NNY A;  2GM4 A;  4XRS A;  1RNL A;  5FRN A;  5DD8 A;  2WAD A;  1UZC A;  3HKZ N;  5IP7 J;  3JRF A;  2LRE A;  2BY2 A;  2O7O A;  2XAQ A;  3P9C A;  2E36 A;  1PJR A;  1WZ2 A;  1F36 A;  4P9U A;  4OIO F;  4XNF A;  3SXY A;  1JKP C;  4BEH B;  1R49 A;  2MA3 A;  3PSF A;  3BG9 A;  1XS9 A;  2H1K A;  5K5Q A;  5GAE J;  1TZL A;  2VXZ A;  1BIB A;  1TW2 A;  3V8J A;  5IT9 K;  3DBH B;  5EGO B;  5E8I A;  5LRR A;  3MD2 A;  5DM6 F;  1VFC A;  5FLX K;  1Y8R B;  2PFB A;  3DP7 A;  4EM1 A;  3MMY B;  2JA6 J;  1U5T C;  3FIW A;  4YFN F;  2D45 A;  1N75 A;  1ERD A;  2RN7 A;  4TV7 A;  5DUK A;  4EJO A;  3GTO J;  1P2F A;  2X1D A;  4P96 A;  3DFG A;  3V42 A;  3MVP A;  2NS7 A;  5EEA A;  2DMQ A;  2QCO A;  5E3M A;  4PFP A;  3BWG A;  4PZJ A;  3GTM J;  2KZG A;  2XAJ A;  3CMA I;  1JT6 A;  1IW7 F;  4JQF A;  2Y2Z A;  3IKV A;  4C2T A;  3ZCO A;  3CF5 F;  4OIP F;  2P8T A;  3TQN A;  3HXL A;  4LG3 A;  3RPQ A;  4OIN F;  2W25 A;  3BR3 A;  3CCR I;  5IPA A;  3BTC A;  3CUQ C;  2GIV A;  2WC2 A;  4RLF A;  3HOY J;  4M6Y A;  2DA2 A;  1WCM J;  2VPR A;  2E7X A;  2DJI A;  4EJV A;  1J75 A;  2K9S A;  5FKM A;  3FK7 A;  3ZGK A;  1XDS A;  4AYB A;  2VBZ A;  2E7W A;  5M3M J;  3E5Q A;  1TT5 B;  4LFU A;  4QIW N;  5J8F A;  4UVC A;  5FKK A;  3RTR A;  1I50 J;  3CUO A;  4IQJ A;  2HVQ A;  1ZG5 A;  1KQ8 A;  5FLM J;  4PSX A;  3CO6 C;  1P7I A;  3KCC A;  3QU6 A;  3G3Z A;  4HSR A;  4OAZ A;  4ANJ A;  4U0Y A;  1PDN C;  1HC8 A;  3FXL A;  2WAQ A;  4UUT A;  3GF2 A;  4Y7N J;  3LMM A;  1QHG A;  4ZYE A;  2EA2 A;  2ZME B;  1O3S A;  3S93 A;  4R8H A;  1T6S A;  3CJR B;  3M1C A;  4RB1 A;  1ZLJ A;  2Y9Z A;  4YEL A;  1ZK8 A;  1HSJ A;  2L54 A;  3SZP A;  3SHF A;  2KIS A;  2ZCW A;  1HQC A;  1OCR H;  1KU3 A;  2NOG A;  1UJ8 A;  3RYR A;  3BC8 A;  3VYR B;  3ROU A;  2DLL A;  1UB9 A;  1CF7 A;  4V19 K;  3JSP A;  2DJN A;  1IF1 A;  3K10 A;  2EFN A;  2X48 A;  4JK1 X;  2GAU A;  3ZQH A;  3OYD A;  4E7L A;  1Y39 A;  1MGT A;  4RM2 A;  2L3D A;  4LG0 B;  3P5J A;  3S3N A;  2M2E A;  2VOO A;  2ESH A;  3OYM A;  3NAU A;  1EA3 A;  3FF5 A;  5TGT A;  2CFX A;  2STW A;  3BT9 A;  1TWA J;  3QOD A;  1WJF A;  3P9I A;  4UVA A;  4AUX A;  1KU2 A;  3DEE A;  4HF2 A;  1E17 A;  2FMY A;  2GXG A;  2WA0 A;  3WGG A;  2HXI A;  3B02 A;  1DP7 P;  1Z9C A;  3CLO A;  1AU7 A;  1WJB A;  2ZXW H;  3RZO J;  3GFM A;  4LIT A;  1O3R A;  3HPG A;  5L3G A;  2JMW A;  3MZH A;  3VFZ A;  4NQW B;  1TWH J;  4XM3 A;  3V4G A;  5B1A H;  2Z99 A;  3M8J A;  4BHP A;  1FPQ A;  4IEJ A;  4BHB A;  1HBX G;  2E2I J;  4MFD A;  1HKT A;  1YI2 I;  2F4I A;  3R6S A;  2ESN A;  2FF4 A;  4K2E A;  2DYR H;  4LB6 B;  1USS A;  2OTL I;  4WF2 A;  2K5C A;  4MIM A;  5B66 C;  4HV6 A;  5L3D A;  3HJE A;  2OU2 A;  3H0D A;  1BW5 A;  2VAS A;  2IGN A;  4HEA 2;  1WH7 A;  5HOD A;  1V3F A;  2HQ5 A;  4G6Q A;  5DUI A;  4DGW B;  4IHY A;  1OYI A;  5CVR A;  1Z6T A;  3I4N J;  3B6C A;  3BPV A;  1BR2 A;  3GBG A;  3GLX A;  4DOZ A;  3PO3 J;  1BA5 A;  2DN0 A;  3CCQ I;  3ZMT A;  3WE2 A;  1IXC A;  1UEL B;  2BOL A;  1D8K A;  3HZJ A;  1MBE A;  1ZGJ A;  3PNY A;  2CW0 F;  3C1D A;  4R79 A;  4AID A;  5JHU A;  1H9G A;  1S6L A;  2QBY A;  3OR1 C;  4IHT A;  1EF4 A;  4ZTF A;  3ISP A;  1X4P A;  3CO7 C;  1Q1V A;  5LHH A;  3LSP A;  1XC5 A;  3PNT A;  3VWB A;  3WTS C;  4PJM A;  2UWM A;  4ABZ A;  2PBI A;  3SDG A;  2MW8 A;  1QO0 D;  2W48 A;  3RJP A;  2X51 A;  1S8N A;  3BG6 A;  5D5X B;  1A04 A;  2AO9 A;  3GZ5 A;  1CGP A;  2KPM A;  4CO8 A;  4E7J A;  3BTJ A;  2VL8 A;  5TRD A;  3A0H C;  1Y0U A;  1D0Y A;  2NNN A;  2EIL H;  3MZ8 A;  1RZ4 A;  2OZ6 A;  2P5V A;  2EBI A;  2MYS A;  4RGX A;  4GDF A;  3KPH A;  3DCF A;  3K70 C;  3H36 A;  3K4C A;  2JT1 A;  2L4A A;  1YRN B;  1PUF A;  2ISY A;  2HU9 A;  2MG4 A;  4FIS A;  2EPF A;  4BKX A;  1LVK A;  2LNB A;  3J7A Y;  2A07 F;  2CU7 A;  1S29 A;  4ZC3 A;  4G7Z F;  2HTJ A;  2RVC A;  4J00 A;  5F1J A;  2OZU A;  3TMO A;  4OAY A;  4W97 A;  3IKT A;  3MWM A;  1SMT A;  3W6V A;  2XRO A;  2DOE A;  2GLO A;  2ZJP F;  4OU0 A;  2BVM A;  2PJR B;  5FKO A;  3RKW A;  2DT7 B;  2JTV A;  2WV0 A;  1QVU A;  1AHD P;  3KP6 A;  1U78 A;  2OCE A;  1WKM A;  2LVS A;  3DPT A;  3CJT B;  4NBQ A;  2A6T A;  3VYU B;  1ZAR A;  5BPD A;  1Z0X A;  2A05 A;  3E1S A;  2CUJ A;  5F1R A;  2EQR A;  1UST A;  1Z7U A;  5HLH A;  1IO2 A;  2LK2 A;  2R7X A;  2H94 A;  3ELK A;  1V55 H;  3LFU A;  2NYX A;  3S1M J;  1MBF A;  3LA7 A;  1ZR4 A;  3BR6 A;  3AAF A;  1ETK A;  3K7A J;  5M5W J;  1FNN A;  2ZSI B;  4JX5 A;  1FIP A;  1E2X A;  3W2A A;  3QPS A;  4LD5 A;  2ZJR F;  2WWY A;  1K83 J;  5GTH C;  4BXF A;  2GIZ A;  1EKE A;  3CUQ B;  5FLX Z;  4HDU A;  1LEA A;  1JUS A;  3W2V A;  4ESJ A;  3FXQ A;  4I76 A;  5CQG A;  2A68 F;  4NNJ A;  1N77 A;  1SAN A;  5ICC A;  4M3E A;  1FTZ A;  2LDU A;  4KT5 C;  5CPR B;  1D1B A;  2Y69 H;  2EIM H;  3IRR A;  3LQQ A;  3S17 J;  3L2V A;  1BW6 A;  3O3K A;  4WCG A;  4A2U A;  5HDN A;  1MSE C;  2BVL A;  3TOB A;  3QQA A;  1LE8 A;  1DGR M;  3FBN B;  1LDD A;  1Y6I A;  3OOP A;  2C6Y A;  1QNT A;  4Q47 A;  4IOA F;  3OMY A;  3ZQC A;  1JXS A;  1GXQ A;  1WQ2 A;  2R0Q C;  1VQP I;  5GAG J;  3MCZ A;  1IC8 A;  5EZG A;  2DFE A;  2ZXH A;  2KDZ A;  3F8C A;  4X1E A;  3PIP F;  1NK2 P;  4A3I J;  2I8D A;  3CC4 I;  4MGR A;  1B4A A;  2RDP A;  1YLF A;  2QWW A;  4CGZ A;  1XCB A;  2LC2 A;  2XF7 A;  1GXP A;  4R1H A;  1F1Z A;  3F72 A;  3K1M A;  2R5Z B;  4EGY A;  2I5U A;  3DTK A;  3PM1 A;  3I0T A;  2FA5 A;  3SZT A;  5IP9 J;  4YFX F;  4BQA A;  3GZ6 A;  3K6G A;  5FO5 A;  2EB7 A;  4CDG A;  1SD6 A;  3SFZ A;  1MJB A;  1ZHF A;  2CS3 A;  2XAH A;  2CQK A;  3MZY A;  4FE4 A;  5H20 A;  5JLX A;  2FU4 A;  2QF7 A;  4HQE A;  3GCM A;  3DKY A;  1GV5 A;  2STT A;  2L0K A;  3M1E A;  2Y31 A;  4ENM A;  1I6H J;  2L9V A;  2TRT A;  1CQT A;  4Y15 A;  4XMY A;  1Z77 A;  1I5Z A;  2HQN A;  4WXH A;  3ML6 A;  2MC3 A;  4UUS A;  4HLY A;  2P6S A;  1T33 A;  1WVR A;  2PX9 A;  5M5Y J;  4IHS A;  2E71 A;  1I39 A;  2OBP A;  2XAS A;  5HNF A;  4II3 A;  3K4J A;  3X2Q H;  2IGK A;  1BJA A;  4DBR A;  1STZ A;  3BG3 A;  1J09 A;  2P6T A;  5DCM B;  2VT2 A;  1L3L A;  4LIU A;  1DPU A;  3HSE A;  2LLK A;  2R7O A;  5E3L A;  3MAJ A;  3KZY A;  4HZF A;  1N25 A;  1WWX A;  1GVJ A;  3L7W A;  2AXT C;  2F48 A;  3PSI A;  1X3U A;  1TP4 A;  2FJ1 A;  1FSH A;  4KMU X;  3T1B A;  1OCZ H;  1Q1H A;  2KFD A;  4I0B A;  2CV0 A;  2H09 A;  4CYC A;  2ZJQ F;  1A36 A;  2K40 A;  5GAH J;  3HIF A;  5GAD J;  3ZQL A;  2I10 A;  1R22 A;  4EAT A;  2Z3Y A;  5BMZ A;  1MD0 A;  4M3B A;  3DXJ F;  2CW7 A;  2HDW A;  3KLO A;  2VUM J;  3WTV C;  2CWE A;  1YO5 C;  2Q8K A;  2HZD A;  5LLQ A;  4HNV A;  2K9N A;  3ZMV A;  3SYT A;  1P6R A;  5JR3 A;  1SFO J;  2HOT A;  4ZZD A;  4AIH A;  2LH9 A;  1FOW A;  2MLK A;  2F4O B;  1S7E A;  3RDI A;  1VI0 A;  1BIA A;  3EUH C;  2YX4 A;  4U7B A;  1MSF C;  3HL2 A;  1JE8 A;  2L7Z A;  1FYK A;  4A3M J;  4A5N A;  5GTI C;  4HF1 A;  1HLV A;  2E1O A;  4LGW A;  1WGX A;  3FM5 A;  4G7O F;  4E7K A;  2O6G E;  2Q2E B;  4PJ0 C;  4HNU A;  2DDB A;  2FBH A;  2HNH A;  3LSH A;  1ZTR A;  2FE3 A;  3FM3 A;  5C4J J;  1J59 A;  2VJ5 A;  1XCV A;  3G1O A;  2Y75 A;  1MKM A;  4V2G A;  2VC0 A;  3VPR A;  2KIF A;  3EQL F;  3JRI A;  2IBD A;  1QHH D;  1ETV A;  2K02 A;  1XSD A;  2A3S A;  3EDP A;  4BL0 B;  2O61 A;  1TT0 A;  2KRF A;  3GVA A;  5DYM A;  3PO2 J;  4E7S A;  2KL4 A;  4ASN A;  1HKQ A;  4A0Z A;  3JRC A;  2DA1 A;  3QPT A;  3VSK A;  3OYG A;  5E8G A;  1G3Y A;  5D6E A;  1B72 B;  2CV2 A;  2LKS A;  2G9W A;  3BJO A;  5H6R A;  1R1V A;  1E3H A;  2QKM B;  3NQO A;  3L2U A;  3GFL A;  4MLO A;  4XON A;  1H89 C;  3S2D J;  3SJM A;  2YUS A;  2B63 J;  3VOD A;  2B0L A;  1U6G A;  3QYE A;  3F8N A;  2MD0 A;  2BW3 A;  3KET A;  5LFA A;  3TKY A;  2DT6 A;  3RYP A;  2M5W A;  1WPK A;  3CC2 I;  3H5A A;  4ZTJ A;  3U1D A;  1I27 A;  2ECB A;  1RRJ A;  1WHU A;  1R36 A;  1ZGA A;  1X3Z B;  3R61 A;  5HS7 A;  1O7F A;  4ENK A;  3U9G A;  1D1A A;  3W6J B;  4I99 C;  3VB2 A;  1FP2 A;  1R5H A;  5E1Z B;  5BOX A;  1D8J A;  2DYS H;  4CUG A;  4EV0 A;  2MD5 A;  3ZMZ A;  5CLS A;  2EH3 A;  2XB0 X;  3CLQ A;  2RQQ A;  2ME6 A;  4N9H A;  3HUG B;  4QTR A;  3DTI A;  3TW7 A;  2VPL A;  3WG7 H;  1FOY A;  5ILV A;  5FKN A;  3BZC A;  4XRF A;  1ONV A;  2CYY A;  3WTZ A;  3WG9 A;  1RI7 A;  3Q9S A;  4KIB A;  1TQI A;  4XN0 A;  3N05 A;  4RAY A;  5CQE A;  3ULQ B;  1O3Q A;  4PGG A;  4KIC A;  5LEJ A;  3CQZ J;  1S9H A;  4EJW A;  4BY1 J;  2V4J C;  4HNT A;  3ZPL A;  2G7U A;  3PFY A;  2JRM A;  4Y13 A;  1C0W A;  2KT0 A;  4RB3 C;  2FUG 2;  1MW7 A;  1NHA A;  3T8R A;  1BL0 A;  1GVD A;  2M8E A;  4OIQ F;  3DU5 A;  1T56 A;  1X1D A;  1JHF A;  5LEK A;  3PQJ A;  5FD5 A;  1VTN C;  2H6C A;  3E3V A;  2HPI A;  1IRF A;  4BNC A;  2CJJ A;  2O8K A;  1RUO A;  4A6E A;  1P9Q C;  3K4K A;  1AOY A;  2DBB A;  1F5T A;  3DWL E;  1LB2 A;  3OOU A;  4RB2 C;  1AKH A;  1WI3 A;  2VQC A;  3WU0 A;  3S1Q J;  2VBW A;  2DOD A;  1D3Y A;  3M9A A;  3NRV A;  4GXO A;  1W5C C;  1LFU P;  3K4N A;  5M5X J;  4Y33 A;  2YR2 A;  2HPM A;  3TL4 X;  1DUX C;  1OR7 A;  2JUG A;  4BUP A;  5CVJ A;  3HDD A;  3L2Q A;  4AYB N;  2ZNZ A;  1W36 C;  3KZI C;  3FMR A;  3FKI J;  1S7A A;  1S3J A;  3OYJ A;  2XGC A;  5FFZ A;  2DFH A;  2VJI A;  2IS2 A;  5DV5 A;  3RQ4 A;  3DKW A;  2K7L A;  1MDM B;  2E34 A;  3ZQI A;  4C3H J;  2IGM A;  2WAQ N;  2A5W A;  4BJT A;  4XID A;  4ESB A;  4M6X A;  3HB9 A;  2PQ8 A;  2OQR A;  4RS8 A;  1YX3 A;  1PVE A;  2VB6 A;  4HPQ A;  1A5J A;  1JHH A;  1F4K A;  4OMY A;  3WU2 C;  2W24 A;  1BOB A;  3JAM Z;  1K4S A;  3PUF A;  1H0M A;  1G2H A;  1T2K A;  1DU0 A;  1OCT C;  1T98 A;  3VDX A;  3FBI B;  4KJZ A;  4XRS G;  3A1Y A;  2V9K A;  4UUV A;  2OC6 A;  1BOA A;  2EFQ A;  2OUM A;  5LHG A;  3K4M A;  4GYI A;  4N4O B;  3OYI A;  5C44 J;  4A3C J;  2JPB A;  4A0X A;  3V7R A;  1SD4 A;  2Y0S A;  1ULY A;  4MQV A;  1EH6 A;  1LQ1 A;  1RKT A;  1I3A A;  1FOK A;  2Z9O A;  4B3A A;  3EPZ A;  3OS1 A;  3ZMS A;  3ESW B;  5EJC A;  2W84 A;  2PMZ A;  1KZH A;  1G3W A;  1BM9 A;  3HOU J;  2K4B A;  3F22 A;  2GA1 A;  3HGY A;  4UB6 C;  1KU9 A;  4YIR X;  5CVI A;  1SMY F;  1YE9 A;  1ZR2 A;  1VQK I;  3DEW A;  1QPM A;  3B73 A;  1VQL I;  2XVC A;  1P4A A;  1YW9 A;  4E6K G;  3H1C A;  2HOS A;  2A61 A;  2NVY J;  1TBX A;  5D8K B;  2X6W A;  4G9Y A;  1YYV A;  3SDB A;  4A0Y A;  1R9T J;  2M4G A;  3I71 A;  1K61 A;  5DTD A;  3H5N A;  1H88 C;  1HCR A;  3ZRG A;  1D5Y A;  1ETY A;  2ID3 A;  3U21 A;  4NC7 A;  2H27 A;  3Q5F A;  2K9Q A;  4RMN A;  2EIK H;  2JUC A;  2ZB9 A;  1AWC A;  3Q0U A;  1IN5 A;  5IYC J;  3GFI A;  4UV9 A;  2LY2 A;  1MJ9 A;  3W2W A;  4P55 A;  4B48 A;  1HKS A;  4UB8 C;  2M8G X;  2R4G A;  1V5E A;  4B47 A;  1XMA A;  3F8M A;  2X1E A;  3OL4 A;  2MBF A;  4BDZ A;  1X1B A;  2AQE A;  1ITY A;  2ADU A;  4M9Z A;  1BR1 A;  4B1R A;  3WHC A;  3BR0 A;  3HYI A;  4DZJ A;  3RPU D;  2NVX J;  5CYV A;  1AA7 A;  2G0E A;  5EEG A;  2DA5 A;  4FE7 A;  3ZQ7 A;  2JA5 J;  1TL8 A;  1XPX A;  4C2U A;  1X4O A;  1Z3X A;  2KHM A;  2QQ8 A;  2DDA A;  1SC7 A;  2VON A;  3J7A O;  2E19 A;  3TDZ C;  4FHT A;  4MO7 A;  4KIT B;  1WJC A;  3CMM A;  1V5G A;  3VSL A;  4IOC F;  5HLG A;  2KIM A;  2OF7 A;  4XOR A;  4ZDP A;  5J1Y A;  4ZJZ A;  1Y8Q B;  2VQH A;  1SD5 A;  4WXD A;  2X85 A;  5KAF C;  4QPO A;  4A3J J;  1TW3 A;  4P5O A;  3W6K B;  2JSP A;  3O8G A;  2A5Y B;  2H8W A;  4I7H A;  1XB4 A;  4LLL A;  1HW2 A;  2JA7 J;  2YX7 A;  2QLZ A;  4LB5 A;  1S7O A;  4ZYA A;  1EH7 A;  2X0L A;  1A35 A;  5DEQ A;  1OPC A;  4Y52 J;  3COA C;  1I6X A;  5LD2 C;  2P0W A;  2JJ7 A;  3PQK A;  2X6O A;  2HWV A;  1MND A;  2XUB A;  1W7P B;  2XIG A;  1IUF A;  1ZN2 A;  1LJ9 A;  4XLN F;  2L7K A;  4BDY A;  3RI4 A;  4MTE A;  2QQ9 A;  4D5F A;  1DDN A;  5GPC A;  2CUE A;  2WAF A;  4IRI A;  1SAU A;  3S8P A;  1IJW C;  4F55 A;  1XSX A;  5BPI A;  1WJD A;  2M7A A;  2M3A A;  1RUN A;  1JGS A;  1N78 A;  4CCO A;  1IN6 A;  2R7V A;  2A6E F;  3RKX A;  3PNV A;  1LPQ A;  2IA2 A;  4XLE A;  2IJL A;  3O8H A;  2LP0 A;  4ESF A;  5DM7 F;  3GW2 A;  3L2W A;  5TJJ A;  4Q5S F;  1ZG3 A;  3ABU A;  2W1O A;  1XTA A;  2O03 A;  3LAP A;  3KP2 A;  2K3P A;  3R60 A;  3CP8 A;  2E5N A;  4A93 J;  3LA3 A;  3FKJ A;  1ETO A;  4BAC A;  2DI3 A;  1G8X A;  1JKO C;  2W57 A;  3ZQF A;  2LBF A;  3IH4 A;  1J9I A;  1KYZ A;  2X1C A;  3N4M A;  4HW0 A;  2JVH A;  3LFK A;  3JRG A;  1IDY A;  2V6C A;  2Z1D A;  1VQ6 I;  4XL9 A;  4I6Z A;  2BV6 A;  3B6A A;  4CCM A;  1VQ5 I;  4CZZ A;  3DEU A;  3OYF A;  3HOS A;  3TGN A;  2R5Z A;  3AG1 H;  1I3Q J;  3RPU A;  3OYC A;  4X6A J;  1KON A;  3I4M J;  3QAH A;  5CKT A;  3T5X A;  3BTI A;  3HHG A;  3E5X A;  2GOX B;  3LNQ A;  2EIN H;  3TP0 A;  3EET A;  1MMN A;  4EJU A;  3L1P A;  3CME I;  2R93 J;  2GXA A;  2XAU A;  1Z05 A;  3CD6 I;  5J1U A;  2OJE D;  2QYO A;  4HA8 A;  2V26 A;  4HF0 A;  2DFI A;  3MKL A;  1U9N A;  3I59 A;  4LIV A;  2K85 A;  3ABL H;  5M3F J;  1HOM A;  5FD6 A;  1RES A;  3E6M A;  2M1B A;  4IKF A;  1R5G A;  4A3F J;  2CG4 A;  1SVO A;  1JKQ C;  1E3P A;  2QSF X;  4ETS A;  1QRY A;  5ILU A;  2A69 F;  4PJJ A;  4XLH A;  4NUB A;  5D5U B;  1F43 A;  4B8X A;  4WWC A;  1X19 A;  4EVI A;  3PUB A;  4AIK A;  4BXX J;  2M34 A;  1FY7 A;  2QGU A;  3KE2 A;  3K4B A;  4WK8 F;  4A3K J;  1R7J A;  4KA4 A;  1QA6 A;  1XD7 A;  2R7Z J;  3EYY A;  2LKX A;  2HGC A;  4HST A;  2OV7 A;  1Z3Y A;  2LD5 A;  3U2R A;  2R7U A;  3HRU A;  2QEN A;  1IV8 A;  2JQ7 A;  5D5V B;  2XSJ C;  3OS2 A;  1WJ5 A;  2JRT A;  3QPH A;  1P4X A;  3VOE A;  4U7D A;  3GX4 X;  3BTL A;  3OV8 A;  4E7I A;  3GO5 A;  3ZXS A;  3A0B C;  1OKR A;  1ZRE A;  4BJ6 C;  2LRD A;  3AL0 C;  5F27 A;  1TWF J;  4C3J J;  2RKH A;  2FRH A;  3F6V A;  2XRN A;  3ASO H;  1DP3 A;  5KHD A;  3EUA A;  5AIP A;  1VF9 A;  2VN2 A;  1SFU A;  4JP0 A;  4C3I J;  1HDD C;  2E60 A;  2QSG X;  1PP8 F;  3RZD J;  3RKQ A;  1DPR A;  1TNS A;  3OYL A;  1FBU A;  4ENN A;  2IPQ X;  4PJN A;  1ZG1 A;  3DBL B;  1U9O A;  2IEK A;  3C2B A;  5J40 A;  3BCA A;  1W5T A;  2Z5U A;  3FMQ A;  1WH5 A;  4OIR F;  2BGC A;  3OSF A;  2ZKZ A;  4AD9 A;  2BXY A;  3NWS A;  3HM5 A;  2XRL A;  1QPI A;  4Z2Y A;  1U5T B;  3VYS B;  3V7C A;  5F08 A;  1JT0 A;  2HTS A;  4DJA A;  5FB2 A;  4M71 A;  1W1W E;  4A69 C;  3CC7 I;  1ZRC A;  3M4O J;  4L5J A;  1ETQ A;  4DYC A;  4XOT A;  2CO5 A;  2AQF A;  1OFC X;  3DU6 A;  2L9R A;  1WJA A;  1EH8 A;  3SFI A;  4D7N A;  2DA4 A;  3E7L A;  1K78 A;  4UVB A;  2FOW A;  1ZLK A;  1X58 A;  2HDD A;  2X4H A;  1SEU A;  4PFO A;  2DK5 A;  2P4W A;  4CZC A;  1V5F A;  4A5M A;  1UG2 A;  3EYI A;  3ZMD A;  1CF7 B;  3IRQ A;  2R3S A;  2R7F A;  3BP8 A;  3HEF A;  3AFH A;  3A4C A;  4NC6 A;  4H4K C;  4YFK F;  5L3C A;  5C3E J;  4A3B J;  1ACI A;  2X9D A;  3OSG A;  3JTG A;  1YHQ I;  2V1U A;  3G1M A;  5K5R A;  2QKL B;  3ZQG A;  4L0Z B;  2ZSH B;  5J4Y A;  3KEY A;  1GLN A;  2HYG D;  2WY8 Q;  1NG6 A;  1FSE A;  1S5L C;  2F5V A;  1YQA A;  2KKO A;  3JAM K;  2D5V A;  1RET A;  5L3F A;  5KCM A;  2O5R A;  5AIQ A;  3OYE A;  1BI3 A;  3KFW X;  2WAE A;  1VQO I;  3HOZ J;  2LYC A;  4W1U A;  4A12 A;  4RGS A;  4HOB A;  4L18 B;  3E5U A;  1X2N A;  3ABK H;  4Q4Z F;  4IL6 C;  3EUK L;  2E35 A;  2KRH A;  4L9T A;  5FJ8 J;  2CV1 A;  1D5V A;  2DPD A;  3OWT A;  4RBO A;  2BEO A;  3T8T A;  5IOZ A;  4FX4 A;  4YII A;  2E2J J;  1K79 A;  2HYJ A;  2M0M A;  1U3E M;  4MEY F;  4CYD A;  1ETX A;  1MBH A;  2ZO4 A;  4ON0 A;  1FMV A;  4F93 B;  3L9F A;  3WOD F;  2PLY A;  4KDP A;  3E6D A;  2PEX A;  2NVU B;  2Z33 A;  4FAS D;  3C2H A;  4IRH A;  3FXJ A;  2PMH A;  3LOC A;  1K7A A;  2ELK A;  1MMG A;  2Y30 A;  2PI0 A;  3PJR A;  2NAZ A;  4PCQ A;  3WU1 B;  3I4P A;  2EZK A;  4C2M J;  3GTJ J;  3FXK A;  3SEZ A;  4P9F A;  2VOD A;  2FSW A;  2QEX I;  1REP C;  3SZG A;  1Y1V J;  2XKO A;  2M0C A;  4L0Y B;  1EJ9 A;  1SVL A;  3ERE D;  4L9N A;  4N0B A;  3FXO A;  3H3Z A;  4E4H A;  3D0S A;  1YJN I;  1TC3 C;  2QBY B;  2L01 A;  3OIQ A;  4ZYH A;  5F0C A;  2XC7 A;  2WB1 A;  3C18 A;  1TQP A;  1XX5 A;  2P5L C;  1UG0 A;  2GWR A;  1XGS A;  2R5Y A;  5IYD J;  2R92 J;  1R1T A;  1PUE E;  2IA1 A;  3BR2 A;  5HVQ C;  1ZEL A;  2AHQ A;  1OMI A;  1TTY A;  3HBL A;  4DBQ A;  2DMT A;  5FRM A;  1T0F C;  2ID6 A;  2EA4 A;  3OR2 C;  3R0J A;  3ABM H;  3H9J A;  4XN3 A;  3DF8 A;  3D5R C;  2E5Z A;  1FT9 A;  2L02 A;  2VJJ A;  4D1Q A;  2E1N A;  3WGI A;  2RNG A;  3LSI A;  2DW4 A;  2LKP A;  5IY5 H;  3FMS A;  3K2A A;  3H92 A;  4M3F A;  4HDV A;  1T08 B;  3IAM 2;  1Z91 A;  3JRD A;  2L7M P;  2WY7 Q;  3BG7 A;  3LL7 A;  1J7K A;  3A01 A;  5K5O A;  3TO6 A;  1PUF B;  2CQQ A;  2EFP A;  1MNM C;  2VIX A;  1R58 A;  4IHW A;  3I3L A;  5KNL A;  1MIJ A;  2LFB A;  5K7Z A;  3H35 A;  4DW6 A;  2B9S A;  4KIF A;  1H9T A;  4E70 A;  3CCM I;  2PN6 A;  3KEO A;  3WTU C;  5ERI A;  5K7F A;  4BEH A;  3IV5 A;  2VT3 A;  4BS9 A;  4BGD A;  1TQM A;  3QU3 A;  1MMA A;  3ZOB A;  1T0F A;  5J3L A;  3V8L A;  4Y17 A;  4F92 B;  4M3D A;  2QM3 A;  1MH3 A;  2IP2 A;  1GUU A;  1RR7 A;  5EGO A;  2K9M A;  3ERM A;  1XSV A;  5H2F C;  1KYW A;  3HG9 A;  5B1B H;  3LSG A;  4IPA A;  4NC8 A;  4I02 A;  2CSO A;  1IXR C;  3ABT A;  3VYT B;  3LA2 A;  1FP1 D;  5LGU A;  4BQQ A;  3GTL J;  3CMY A;  1SAX A;  2R7T A;  3CES A;  3C3W A;  2M7B A;  1ZYR F;  3BPX A;  1UAA A;  3BCB A;  2K3F A;  3S1R J;  2CMP A;  2IS4 A;  2F5D A;  4G94 A;  2DTR A;  2XAG A;  3GXO A;  2X6Y A;  2V1X A;  4BBS J;  2OPT A;  1VQN I;  3FXM A;  2ZXI A;  1NTC A;  2COM A;  4GO1 A;  2Y0S N;  3O2P E;  3LSR A;  2VE8 A;  1O7L A;  1XGO A;  4XKB A;  2J5O A;  1OR7 C;  3OYA A;  4M74 A;  2PMZ N;  4EJT A;  1U0J A;  3K4L A;  4HYE A;  3CF2 A;  3IH2 A;  3I54 A;  4BQO A;  2XGE A;  2D1H A;  5LGN A;  3WTX C;  1D0X A;  2GXB A;  1R71 A;  4G6D A;  3D5S C;  5HOO A;  1VQM I;  4A3G J;  2IGO A;  1NG7 A;  4I98 B;  2O3F A;  4V2F A;  3MN2 A;  5K7H A;  3KP5 A;  4KN4 X;  4F52 A;  4BE1 A;  1YIO A;  2HZT A;  2W00 A;  3FXR A;  1R1U A;  3OL3 A;  4IXA A;  5ICG A;  2QUF A;  2ZFU A;  2ZME A;  2NVT J;  2OTJ I;  2V9V A;  2E1M C;  4YG2 F;  4U0V A;  3UR3 C;  4AM3 A;  2EV6 A;  1ENH A;  3DV8 A;  3J81 K;  3BLY A;  3BQZ A;  3TOA A;  4HLX A;  3KLN A;  4UUS B;  3R4K A;  5DCF A;  2KZV A;  4JYK A;  2IS1 A;  5FRO A;  5HS8 A;  2DA6 A;  1T38 A;  4FQG A;  4IO9 F;  3BZ6 A;  1IXS B;  3T0Y A;  2KIQ A;  1OYW A;  4JX4 A;  5CJ9 A;  2UZK A;  3A2K A;  2NXN B;  1R4N B;  2VKH A;  1VND A;  1A31 A;  2K86 A;  5KK1 A;  4BBR J;  2PG4 A;  1UHS A;  3OY9 A;  2F2E A;  2HR3 A;  4AU7 A;  1L0O C;  1LUJ B;  2FOK A;  2DK8 A;  3H9G A;  1DGW Y;  2MH9 A;  4OOI A;  4LG0 A;  3FWE A;  3HRS A;  1YJW I;  1HF0 A;  1T8I A;  3QWL A;  3ECO A;  4CYC B;  2FX0 A;  2IAI A;  2PJP A;  4XOP A;  9ANT A;  5IP6 A;  2IRF G;  3HC7 A;  2UXN A;  5D5W B;  1YJ9 I;  2DA7 A;  3K9T A;  1SD7 A;  2ZFW A;  2DTZ A;  3GTK J;  1FWZ A;  2OAZ A;  3A02 A;  1VZ0 A;  4NQW A;  2CRG A;  4GGG A;  2CQX A;  4D5C A;  2KDO A;  3G73 A;  3KZZ A;  1BC8 C;  3FHZ A;  2H1L A;  3HOT A;  2PMU A;  4J01 A;  3D1N I;  2BHY A;  2DO7 A;  1QGP A;  4EEF G;  3I58 A;  3G71 I;  2EV0 A;  2J5P A;  2Y0M A;  3PL8 A;  1U8R A;  2VOP A;  2EZH A;  3UNG C;  3KP7 A;  1IN8 A;  1KA8 A;  2VQL A;  2BE5 F;  2RQP A;  1OYY A;  4KT6 A;  5LRS A;  3K2Z A;  5EG0 B;  2WV1 A;  4BH9 A;  5IYB J;  2ZBK A;  3IP4 B;  1NH3 A;  3M7G A;  2UXX A;  1FOX A;  1YIJ I;  1P92 A;  4D0P A;  2M9H A;  3G1L A;  2CUZ A;  5EDN A;  1KQ9 A;  3QP6 A;  3NEU A;  4M73 A;  1HW5 A;  2CH0 A;  3DPU A;  3FX3 A;  3A03 A;  3IC7 A;  2HVS A;  2L4M A;  3BJA A;  1B1B A;  2VKE A;  4LK1 F;  3CJN A;  1OQY A;  1IN7 A;  2DXI A;  4HAM A;  3GUD A;  2NVQ J;  3GFJ A;  1U8B A;  1UCR A;  1W0U A;  2DCE A;  2JK3 A;  4DZP A;  2BW3 B;  3Q0V A;  2LF8 A;  1B8I B;  3S2H J;  4EGZ A;  3LSK A;  3ASN H;  2M45 A;  1X1P A;  4IX7 A;  3G6E I;  2WBM A;  4HV5 A;  3H5R A;  2QA4 I;  4DQ2 A;  3IL2 A;  1O4X A;  1OJL A;  1GT0 C;  2OD5 A;  3H9Q A;  2XGD A;  3ONQ A;  4RLQ A;  4MNU A;  4A3E J;  5D4R A;  1WSU A;  3S14 J;  4HQM A;  1G4D A;  1BI1 A;  1WRJ A;  4NB5 A;  3KP4 A;  4YEJ A;  5J8C A;  1E3O C;  2YPR A;  3PFI A;  4FX0 A;  2IT0 A;  2RAE A;  2IW5 A;  4IZZ A;  4E7H A;  2JN6 A;  3I9V 2;  2WTE A;  3H0G J; 
#chains in the Genus database with same CATH homology
 5HNF A;  2XSJ C;  4II3 A;  3K4J A;  3LSM A;  3OS2 A;  1WJ5 A;  3RCO A;  2IGK A;  4CH7 A;  4DBR A;  4XLA A;  4XLF A;  2XF6 A;  1J09 A;  4E7I A;  1DQU A;  3ZXS A;  1WJE A;  4LIU A;  4BJ6 C;  2LRD A;  2R7O A;  2CFO A;  4CCN A;  3AL0 C;  4FET A;  2KLO A;  3PSI A;  3KYL A;  1DP3 A;  2HVR A;  5KHD A;  3EUA A;  4G6T B;  3IAS 2;  3KX2 A;  5HLT A;  2CV0 A;  3DKX A;  2E60 A;  5HNH A;  3S32 A;  4DIQ A;  4EAT A;  3OYL A;  2PJR A;  4PJN A;  2CW7 A;  2HDW A;  1QU3 A;  2HZD A;  3E0J B;  3BCA A;  2MC4 A;  4CCL A;  1BR4 A;  4N4N B;  1PYV A;  3SYT A;  1IRX A;  3NWS A;  2LH9 A;  3G2B A;  4D9J A;  3VYS B;  3EUH C;  4U7B A;  4Y3O A;  3HL2 A;  4DJA A;  4U87 A;  3OIP A;  4P1W A;  1SFK A;  2CW8 A;  4E7K A;  2Q2E B;  4HNU A;  4E7Z A;  3IUO A;  3LSH A;  2HNH A;  2LG4 A;  3DU6 A;  2AQF A;  3HKZ A;  4XOT A;  3NWT A;  2VJ5 A;  1WJA A;  2MFZ A;  2KMU A;  1Z21 A;  1E0E A;  4CA0 A;  1QHH D;  1X1C A;  4PFO A;  4B43 A;  3SEQ A;  4B44 A;  2GOM A;  2K9L A;  4CZC A;  1V5F A;  4BL0 B;  1TT0 A;  3F9K A;  4E7S A;  2KL4 A;  3OYK A;  2L9N A;  1G59 A;  1T95 A;  3AFH A;  3A4C A;  3VSK A;  4H4K C;  3OYG A;  2CV2 A;  4OWR B;  4CSW A;  2UUZ A;  4PJL A;  2QKM B;  2X6X A;  2ELJ A;  3MKY B;  3L2U A;  1X1A A;  2IXS A;  4MLO A;  4XON A;  2QKL B;  5FRN A;  2WAD A;  2ZSH B;  2LRE A;  3KEY A;  1GLN A;  2WY8 Q;  2E1M B;  1NG6 A;  1PJR A;  2F5V A;  3QYE A;  4XNF A;  2MD0 A;  2BW3 A;  5KCM A;  2O5R A;  4BEH B;  3OYE A;  5LFA A;  3PSF A;  2DT6 A;  3H5A A;  2WAE A;  1TZL A;  2VXZ A;  4ZTJ A;  3DPL C;  2LYC A;  4C9Y A;  3MD2 A;  1D1A A;  3EUK L;  4BU2 A;  4CCJ A;  2KRH A;  2CV1 A;  3MMY B;  3OWT A;  1N75 A;  1ERD A;  4CUG A;  2X1D A;  3V42 A;  2M0M A;  2RQQ A;  3HUG B;  3DTI A;  3K70 D;  2VPL A;  4X0G A;  1FMV A;  4F93 B;  2NOJ B;  4PFP A;  2V7F A;  4FAS D;  3C2H A;  4JQF A;  4C2T A;  1MMG A;  3PJR A;  4XN0 A;  3N05 A;  5CQE A;  3ZCO A;  1Y56 A;  4IQ4 A;  3HXL A;  4LG3 A;  1S9H A;  3SEZ A;  4RLF A;  2V4J C;  4HNT A;  3PFY A;  3SZG A;  3OS0 A;  2DJI A;  2JA2 A;  2VLA A;  3D5L A;  2KQR A;  2FUG 2;  1FMW A;  1MW7 A;  3ZGK A;  4E4H A;  3DU5 A;  4AYB A;  1X1D A;  3OIQ A;  2F6C A;  2XC7 A;  2WB1 A;  2HPI A;  3RTR A;  4KIS A;  4IQJ A;  2HVQ A;  1P9Q C;  3K4K A;  1UG0 A;  4CCK A;  4F91 B;  4PSX A;  4OAZ A;  3DQV C;  3DWL E;  4HSR A;  4ANJ A;  5HVQ C;  1WFX A;  1ZEL A;  2WAQ A;  3MKW B;  3OOU A;  3ZQQ A;  2VQC A;  4DBQ A;  3LMM A;  1QHG A;  3QOE A;  4ZDO A;  2KRC A;  5FRM A;  1T0F C;  3S93 A;  3CJR B;  3OR2 C;  2R7R A;  3M1C A;  3H9J A;  4XN3 A;  3D5R C;  3K4N A;  4BE2 A;  4Y33 A;  2E5Z A;  2VJJ A;  4YEL A;  4D1Q A;  2HPM A;  2XF5 A;  3TL4 X;  4BUP A;  2JUG A;  2RNG A;  2V6E A;  3L2Q A;  3LSI A;  1D0Z A;  2R7S A;  1W36 C;  2KP6 A;  3BC8 A;  3VYR B;  3IAM 2;  3OYJ A;  2WY7 Q;  2VJI A;  3BG7 A;  2IS2 A;  3RQ4 A;  3LL7 A;  3K10 A;  2IGM A;  3OYD A;  2A5W A;  3HPH A;  2VIX A;  4BJT A;  4E7L A;  1K6Y A;  3I3L A;  5KNL A;  4RM2 A;  3CP2 A;  1YX3 A;  2VB6 A;  4HPQ A;  4BQN A;  3H35 A;  3S3N A;  3OYM A;  1EA3 A;  2W82 A;  5TGT A;  1BOB A;  3QOD A;  1WJF A;  3RSN A;  3DEE A;  3TBI A;  4BEH A;  2WA0 A;  4XLC A;  3VDX A;  3FBI B;  4KJZ A;  3A1Y A;  2L5Q A;  4BS9 A;  2V9K A;  4BGD A;  1LFP A;  1WJB A;  2OC6 A;  2OUM A;  1MMA A;  4LIT A;  4F92 B;  3OYH A;  3HPG A;  3K4M A;  2Z2S B;  4N4O B;  3OYI A;  4NQW B;  4XM3 A;  2VJ4 A;  2K9M A;  3QYB A;  2Y0S A;  3DTE A;  3M8J A;  3HG9 A;  3LSG A;  4PUS A;  3C2G A;  4NC8 A;  3EPZ A;  3OS1 A;  1YX5 A;  2PMZ A;  4JOM A;  3VYT B;  2F4I A;  4BQQ A;  2R7T A;  3CES A;  2M7B A;  1UAA A;  2K5C A;  3OYN A;  2W7N A;  3BCB A;  1YE9 A;  2CMP A;  3H0D A;  2IS4 A;  2LBF B;  2VAS A;  2IGN A;  4HEA 2;  1R6R A;  4DGW B;  4E6K G;  3AKZ A;  2X6Y A;  3S3M A;  1MMD A;  1BR2 A;  3GBG A;  4DOZ A;  2X6W A;  3SDB A;  2ZXI A;  2IS6 A;  2M4G A;  3H5N A;  4XKV A;  3ZRG A;  1UEL B;  3U21 A;  4NC7 A;  2BOL A;  4RMN A;  2MAB A;  4XKB A;  1OR7 C;  2JVG A;  3OYA A;  3PNY A;  2W4S A;  4R79 A;  1U0J A;  2LY2 A;  3K4L A;  2L2O A;  3CF2 A;  3W2W A;  3MKZ A;  4B48 A;  1JI8 A;  4BQO A;  2R4G A;  3CZ6 A;  2R7W A;  1V5E A;  1D0X A;  3OR1 C;  4B47 A;  4ZTF A;  2X1E A;  3OL4 A;  1X4P A;  4BDZ A;  5HOO A;  1X1B A;  2AQE A;  3D5S C;  3PNT A;  3VWB A;  2IGO A;  1BR1 A;  1NG7 A;  4PSW A;  4PJM A;  2UWM A;  3W3C A;  3RPU D;  1AA7 A;  3S3O A;  4F52 A;  4BE1 A;  4C2U A;  2W00 A;  4Y4R A;  2VXD A;  1X4O A;  1Z3X A;  2KHM A;  3OL3 A;  2ZFU A;  2HQA A;  4KIT B;  2E1M C;  1WJC A;  3CMM A;  1V5G A;  2X51 A;  3VSL A;  1MNE A;  3BG6 A;  3UR3 C;  4XOR A;  4ZDP A;  4ZJZ A;  3BLY A;  2VQH A;  2KPM A;  2X85 A;  4E7J A;  3FDY A;  4QPO A;  2VL8 A;  2KZV A;  4P5O A;  2IS1 A;  1D0Y A;  2JSP A;  5FRO A;  2MYS A;  4XKC A;  4ZYA A;  3OYB A;  2VQG A;  3K70 C;  3K4C A;  1LKX A;  3A2K A;  5LD2 C;  2VKH A;  2P0W A;  2HU9 A;  1MND A;  4AU7 A;  1LVK A;  2DOA A;  2LOO A;  3J7A Y;  3H9G A;  1DGW Y;  4ZC3 A;  4HG2 A;  4ZDL A;  4J00 A;  2L7K A;  4BDY A;  3TMO A;  4OAY A;  2Z16 A;  1LDK B;  4XOP A;  2WAF A;  3HC7 A;  1SAU A;  3S8P A;  4F55 A;  2BVM A;  3FHN A;  2PJR B;  4II2 A;  1WJD A;  2DT7 B;  2M7A A;  2M3A A;  1N78 A;  4CCO A;  2R7V A;  3DPT A;  4C30 A;  2A6T A;  3VYU B;  3CJQ B;  4HRI A;  1OLT A;  1VZ0 A;  3PNV A;  3E1S A;  2CUJ A;  2KDO A;  4XLE A;  2M4K A;  4PK4 A;  2R7X A;  3LFU A;  3HOT A;  4J01 A;  2Q1Z B;  3L2W A;  4BJ5 C;  4XQF A;  2W1O A;  2ZSI B;  4GRI A;  4XKW A;  3W2A A;  3PL8 A;  2K3P A;  3UNG C;  3CP8 A;  4BXF A;  2E5N A;  2VQL A;  4RM3 A;  3FKJ A;  1Z7L A;  3QYF A;  4BAC A;  2V1N A;  3W2V A;  1G8X A;  5CQG A;  4NNJ A;  4KT6 A;  1N77 A;  2LBF A;  3AL0 B;  2X1C A;  5CPR B;  1D1B A;  1D1C A;  3IP4 B;  3L2V A;  2JVH A;  4BE0 A;  1HA8 A;  2R7Q A;  2Z1D A;  3ZR8 X;  4F3Q A;  4XL9 A;  2BVL A;  4ITV A;  4XR6 A;  4CCM A;  2CUZ A;  1DGR M;  3FBN B;  3OYF A;  3HOS A;  1Y6I A;  3OMY A;  3OYC A;  1KON A;  2CH0 A;  3DPU A;  3L2R A;  5CKT A;  5JHF A;  2HVS A;  2ZXH A;  2GOX B;  2I8D A;  2DXI A;  2XDV A;  1MMN A;  2UV1 A;  2LC2 A;  2XF7 A;  2DCE A;  2XAU A;  2BW3 B;  2L9S A;  3DTK A;  2V26 A;  4YRV A;  3LSK A;  2RRE A;  4LIV A;  4IX7 A;  4AVZ A;  3K6G A;  4QPQ A;  4IKF A;  2WBM A;  4B3X A;  3H5R A;  2LY1 A;  3DLA A;  2CS3 A;  3DKY A;  3H9Q A;  3ONQ A;  4RLQ A;  4XLH A;  4PJJ A;  4NUB A;  4XMY A;  1X19 A;  3PUB A;  2VKD A;  3K4B A;  4YEJ A;  1W36 D;  4HST A;  2OV7 A;  4IZZ A;  4E7H A;  1Z3Y A;  3I9V 2;  2R7U A;  3OY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...