2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Structural protein
molecule keywords ANKYRIN-REPEAT PROTEIN
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2W4SA 2XC7A
chains in the Genus database with same CATH superfamily
1TT0A 2E2HJ 3PUFA 2QEXI 2CUZA 2XAQA 3K4NA 4G7HF 1EKEA 1W5TA 5FKNA 5E3LA 1Z1DA 3K70D 1T6SA 1SAUA 2HZDA 2R4GA 4BQOA 2PJPA 2FU4A 2KIFA 4UV8A 3CCUI 2W84A 5GTHC 4E7HA 1MGTA 3J80K 3UR3C 3GEZA 3VYRB 2P5LC 3D0SA 3ZXSA 4ZTFA 4IXAA 4BE0A 3BG6A 3Q5FA 3WE2A 3BTCA 3QOEA 2IS1A 3LSPA 2Y75A 3QODA 2BZTA 1TW2A 1I1SA 2K3FA 3NAUA 4G8XA 4JBAA 2DYRH 1K78A 4IHWA 4L9JA 4A3LJ 4UY8I 2R92J 2X6OA 4KUMA 4A93J 1A04A 5EF6A 3CUOA 1D5VA 1UELB 4XK4A 3COAC 3T1BA 3BCBA 1WRJA 2QWWA 1MMNA 1W5CC 2NOGA 3L7WA 1UG0A 3L2RA 2R7XA 2GZWA 2HQ5A 3LFKA 3JTHA 3VDXA 2XSDC 2EA4A 4H4KC 1DGWY 2M1BA 1MDMA 5D8KB 4XLAA 3AL0B 3OL4A 2XGXA 3T8RA 2WC2A 3DKXA 3F9KA 2ME0A 1LJ9A 1R23A 3LSHA 1GDTA 4AM3A 2HYFA 2F5FA 4LFUA 4XSZF 2ZMEA 4BDYA 2FX0A 2IS2A 1AWCA 1T56A 1IGNA 5HLIA 4HG2A 1MNDA 1YRNA 2TCTA 2CV1A 1ZYRF 4BGDA 3E5UA 2A6HF 2LP0A 4HV5A 3RIRA 2WY7Q 4MGRA 5DTDA 2YUSA 3WODF 2J5OA 4C3HJ 3NEUA 3V42A 4ASNA 3DPTA 2OBPA 1YYVA 2QENA 1HSTA 3BY6A 1BJZA 1T8IA 3B6CA 3FXRA 4XNFA 3BC8A 3AG3H 2XGDA 2ZXJA 2MFZA 2L4AA 4IQ4A 3PL8A 5H20A 2X1EA 4XLNF 2KIQA 2VC1A 2ZB9A 4BBSJ 3FXUA 3GX4X 1K6OA 4JOMA 5J3LA 2ZFUA 5JFRA 4R79A 1T98A 4XN3A 5M5XJ 1T0FC 4HPQA 4AUXA 1S7AA 2AO9A 3GFLA 4BY1J 4EATA 3FISA 2V1NA 2FBHA 2D1VA 4A0XA 1CQTA 2E60A 3GVAA 3CCSI 1HW1A 3ZMUA 4LG0A 4UVBA 2HI3A 1D3YA 1U8RA 2XAGA 4AD9A 2VKEA 4S05A 2W57A 1VQ9I 4ON0A 5K7HA 1CGPA 4IRIA 2X9DA 1LVKA 2LMDA 5M5YJ 3QAHA 4W97A 3D5LA 1VI0A 1TWGJ 5F0FA 2DFIA 3EQLF 4MFEA 1OFCX 5EZHA 3W6KB 3LSIA 4NC6A 4KIFA 5KAFC 2W7NA 1RI7A 3GW2A 1RESA 1FIPA 4UV9A 3KP3A 4C9YA 4LLGF 4BAYA 3QYFA 4RBOA 1H9GA 3WU2C 4OINF 4V2GA 4XM3A 2CUFA 2QQ9A 3GZNB 3LQQA 4MNUA 5D5UB 2A6EF 4HBLA 2L7FP 4ABZA 2JA6J 5DS9A 3KPHA 3L2UA 3JRCA 3DWLE 3OYDA 4G7OF 4XLHA 3BR1A 3DLAA 3GTPJ 4Y3OA 1MH3A 4AWXB 2LG4A 2EV6A 4BH9A 5LRRA 4Y15A 4E70A 3MZ8A 2E35A 2VL8A 3RSNA 4G9YA 2XIGA 3CCEI 3I59A 3L2CA 1ULYA 3HRSA 1Z91A 1DPRA 3OYCA 2XPUA 4ZZLA 1XN7A 1XSDA 5IY5H 3CC7I 4CXFA 4LGWA 1LE8A 1YIJI 1VQ7I 2PBIA 4XL9A 1DUXC 1TWCJ 5ICFA 5ILVA 1ZK8A 3BROA 4ESJA 2JSCA 3BOQA 2VKVA 3R60A 1YOVB 3R6SA 3OS2A 3ISPA 3MVPA 5JVGF 1B4AA 5KAIC 1N75A 2LREA 2A05A 3D5RC 3E0JB 1JXSA 3ZGKA 2CH0A 1K6YA 2IGOA 2XF6A 4XRMA 4A2UA 1BW5A 3I59B 5HS9A 5IOYA 4XKBA 3HGGA 3KCCA 3W2WA 1Y8QB 4HDUA 1GXPA 1XG1A 3CD6I 2VQLA 2W1OA 3I9V2 3R61A 5FLXK 4A3KJ 1IZ1A 2ME6A 2VQHA 5DYMA 1E17A 4II3A 1AKHB 4P9FA 1JUMA 2NYXA 4OAZA 2EFNA 3JRGA 1VQOI 4EJOA 1TQPA 4I99C 1R22A 5ILUA 3ZRGA 2IAIA 3LOCA 1LDJA 3Q0VA 5CKTA 3LL7A 3B73A 4XR6A 4ZYAA 4OOIA 3DF8A 2L02A 5EGOA 2K9QA 1LE8B 1RIOH 2V1XA 2DK5A 2XAUA 1SD6A 4G94A 2O9LA 4RAYA 3ERED 1OYIA 4IQJA 4X0GA 1XGSA 4BHCA 1NK3P 2GQQA 4OMYA 1OCCH 1TL8A 3U9GA 2HXIA 3CDIA 3U1KA 2DPUA 3CC2I 2XPVA 3IL2A 3OIQA 1YTYA 3DTEA 4AIHA 3HG9A 4RMNA 4CCJA 1BI1A 3JSOA 1CF7B 1X1PA 2BVLA 4FTHA 4CH7A 3K4JA 1QRYA 1TZLA 2DFFA 1QQIA 2JUGA 5HNFA 1TW3A 1ZRCA 5FB2A 2LF7A 4LD5A 2IW5A 5D4SA 4CCMA 1F4KA 5DM7F 3GMEA 1BJAA 2MH2A 2EFWA 3WG9A 4CYCB 3MKLA 3TP0A 1BOAA 3DQVC 1W0TA 4XKWA 2P8TA 1MIJA 4E7KA 1HW2A 2E36A 1W5SA 4ZDLA 1MKMA 2E1MB 1IN7A 2WB1A 3MZHA 2H09A 3ULQB 1QVUA 3ZN0A 5J1UA 2MA3A 2LBFB 3W6VA 5FJ8J 3I56I 3E5XA 1R7JA 4Z6YA 2XAHA 3F72A 2D5VA 2DJIA 4Y7NJ 2L4MA 5F0HA 4CGZA 1N77A 4OIQF 2HR3A 1Y6IA 4M6VA 4E6KG 1LUJB 1QHGA 1O7LA 1OCPA 3PSFA 1S8NA 2Y0SA 1G3TA 1KYZA 2Z5UA 1R6RA 3RKWA 2OV7A 1LKXA 3FF5A 3HOYJ 3IH2A 1A36A 1WGXA 2CYYA 3F8NA 1TQIA 1PJRA 1DPUA 1MBJA 2ZSHB 2FD5A 4BNCA 1RR7A 1HKQA 3L9FA 3ABKH 3NQOA 3G4SI 2M34A 1WH5A 1ZHFA 1FMVA 1IDZA 1QO0D 4IF4A 2GXAA 5F64A 4GDFA 2DPDA 2Q1ZB 4HZFA 2Z3YA 3CCRI 1LFUP 3F23A 4GRIA 4PDKA 2DAOA 1KA8A 4QWQA 3EUHC 2JK3A 2PJRA 4A0YA 3SYTA 3BJOA 4B47A 4C30A 2DTRA 2Y0SN 3LSJA 2V7FA 5B1BH 3JRIA 2CW8A 1S3JA 2DA2A 3Q0UA 3LSTA 3ASOH 1BI3A 3RPQA 4B48A 3HOUJ 3QWLA 1H9TA 3D1NI 3C7JA 1IXCA 3CMMA 3CF5F 1K4SA 3K7AJ 3I0TA 4HYEA 4HDVA 4UUVA 4BEHA 4X6AJ 5GAGJ 1S29A 2A6TA 3TW6A 1ZGAA 2IT0A 3K69A 5IOZA 1Z67A 3CUQB 5TJJA 2IGKA 3EDPA 2XSJC 2YR2A 4BJ5C 3BR6A 2W4SA 5HDNA 1BL0A 5D5VB 2NVQJ 5DEQA 2OCCH 5HVQC 4JYKA 5IT9Z 2HYGD 1G2HA 2H8WA 4R1HA 1WWXA 2HOAA 4NB5A 1IW7F 1LDDA 1B72B 1WI9A 3TL4X 4XRFA 5A2QZ 2F5CA 3BTLA 3BWGA 4IOCF 2XAFA 5ICGA 2L0KA 3MQ0A 5J47A 1BC8C 5JLXA 4BKXA 5DD4A 4HEA2 3VB2A 1YJ9I 2KL4A 3BG5A 2V6EA 2BY0A 4AC0A 3FHZA 3PFYA 3RKQA 3HOWJ 1OR7C 3KP6A 3GZ5A 2M45A 3CO6C 2W48A 1FMWA 4XSXF 4IX7A 1IF1A 3JW4A 4PJ0C 1EH8A 3FWEA 4MIMA 3BPXA 2NNYA 2MSYA 5IPAA 2F6CA 3WG7H 4PJLA 1HOMA 2Y9YA 1XCVA 1Z21A 2J5PA 2X1DA 4I0AA 2LNBA 2M5WA 5E18F 1NK2P 2QA4I 5E17F 3IRRA 3RI4A 1SMYF 2K4JA 3I71A 1QHHD 3ZQQA 3GFJA 3W2VA 1APLC 2STWA 1EV7A 4Y52J 5FO5A 2LBFA 2ID3A 2AXTC 3GZ6A 3HHGA 3HXLA 4M3FA 3H3ZA 1MJ9A 1IAWA 1O7FA 1U6GA 2DQLA 1YS7A 1MSFC 4HLXA 4PJJA 2XAJA 1AA7A 2G7UA 2GIZA 2K9NA 3WTSC 4A12A 2E7XA 5E1WA 3FXMA 1LVAA 1FWZA 2BV6A 2C6YA 1UFMA 3SXYA 2CQKA 2EJRA 2IJLA 1OMIA 4XORA 2XROA 3HKZN 5L3BA 4AU7A 3LSMA 4ZZDA 3N4MA 4L9NA 1IUYA 1FC3A 1HDPA 3LMMA 1IN6A 1KU9A 3I5UA 4CUGA 4RB3C 3V8JA 4HNTA 2ZSIB 1PUEE 2HNHA 2WTEA 2HOTA 1UHWA 2LH9A 2FBKA 2H1KA 1MNMC 2R7RA 3EPZA 4HX8A 3ML6A 5CPRB 2CWEA 3TKYA 5J40A 1I3QJ 1OYYA 2DDAA 1HKTA 2H1LA 5F08A 2DA7A 1P9QC 2NS0A 2V6CA 3MKYB 2VT2A 3I53A 4MTDA 1FNNA 3BG7A 4XQFA 1JGGA 3L00A 2HVSA 4DJAA 1F1ZA 2BHYA 4KMUX 4M3EA 2X1CA 5EEGA 3TO6A 4FETA 2DA5A 2CV2A 3MN2A 4LB5A 3KEQA 2E19A 4MHGA 3FXOA 3VSLA 3RPUD 4DZPA 4DYCA 3MZYA 4BEHB 4UNOA 4V19K 4FCYA 2OJED 2YU9J 1LPQA 3F8FA 2EIKH 3S1NJ 1BIAA 3ABLH 2M7AA 3WGGA 2L7KA 5M3MJ 3IC7A 3VYSB 1SFXA 1R00A 3OWTA 1R36A 2AHQA 4KN4X 4IZZA 1X4PA 2X48A 3OYFA 3P9IA 2V9VA 3ZQCA 3FXLA 5LFAA 5L3EA 3J81K 3FM5A 1JJ6C 2K7LA 1Z9CA 1U5TC 3LNQA 3J7YJ 5BMZA 2VKHA 3JSPA 3HOTA 1QA6A 1B6AA 4HLYA 2WB1N 4ESBA 5LHHA 1O4XA 1T0FA 3ECOA 1YJNI 1VF9A 4RA2A 1V54H 3H0DA 2JRMA 2XF7A 1QVTA 1ZQ3P 3C1DA 3OIOA 3DLLF 2F48A 3SFIA 3ABMH 1ZRDA 1D5YA 2A07F 3DEWA 3LSGA 2JRTA 3QQAA 3TQNA 3LAJA 1XD7A 2XPWA 1PVEA 2G9WA 1KU2A 2HVQA 1FYLA 5LHGA 1ETWA 3OYHA 1BA5A 3TO9A 5CVJA 3OYAA 1IN8A 1MMDA 5E20A 1MSEC 3DFGA 3H36A 2R7QA 1X58A 3O8GA 2CGPA 1E3HA 2FF4A 5FLXZ 2W25A 4XIDA 2KLOA 4KITB 1IC8A 3FHNA 3CUQC 2DU9A 3RYPA 4OMZA 2KJCA 4NQWA 4XKVA 3CDLA 5EEHA 3KP2A 2EK5A 1FSEA 2NOJB 1GVJA 4HA8A 5FD5A 4PFOA 5K7FA 1GLNA 2MYSA 1ZG5A 2Q2EB 2MC3A 3IAS2 2ELHA 3M8JA 4ZC3A 4B8XA 3KYCB 3A0BC 5GPAA 1YQAA 3GBGA 4NNJA 1GHCA 2FMLA 2OQGA 4WXDA 2LOOA 4U88A 5K7ZA 4A3FJ 2ZXWH 5HLHA 3PIPF 4EJWA 3CO7C 4I98B 2VQCA 4GYGA 3KEOA 1HF0A 4LLNA 4LIVA 5B5EC 3BJ6A 1FX7A 5CQEA 2L3DA 1XSXA 3CJQB 2ADUA 4ZH4F 1ZLJA 2VBYA 3CC4I 1LNWA 2OZUA 2WV0A 4XOTA 3DEEA 2CJJA 1WVRA 4I01A 4NC7A 2JPCA 1VTNC 2E71A 2FBIA 1X1BA 4KIBA 1ZGWA 4RS8A 2CQ7A 1IN5A 2KFDA 1BR4A 3G1MA 5H6RA 1A31A 5IP9J 2FA5A 3ASNH 4DNCA 1R4MB 4CZCA 3HPGA 3K10A 1MBKA 5IYBJ 3JRHA 3IWFA 3GTGJ 2XC7A 3H5NA 4XLEA 4RDUA 3AKZA 4LIUA 5ERIA 1QZZA 2MH9A 1DGRM 4UB8C 1LDKB 2M30A 1ERDA 3AFHA 3K6GA 3LA2A 4DGWB 3FZVA 2P7VB 2RV8A 2WADA 3K2AA 2Z33A 2VC0A 2IEKA 1YRNB 1AKHA 2HDDA 3C2HA 1BI0A 2L9VA 3G1LA 4ANJA 1IN4A 5LGUA 4XKCA 2RC4A 2QQBA 3FBNB 2L2OA 1NHAA 5TGTA 2ZXHA 1YIOA 2GOXB 2Y0MA 1O3TA 2VBZA 2CQXA 2XDVA 1ETXA 1WI3A 1YLFA 3HOVJ 3M7GA 5C4XJ 2P4WA 2IVMA 1QBJA 3ZMDA 3ZR8X 4M3DA 3HUGA 2ID6A 4IKFA 5BPDA 4AIJA 1TWHJ 2H8RA 2CO5A 2PG4A 2KT0A 1KU3A 5JI6A 3OY9A 2B9SA 2FE3A 4O3MA 4M9SA 3H3VK 4Y4RA 1T39A 1GXQA 4JX5A 1OCZH 4E7JA 3TBIA 5AIPA 2K85A 4LG0B 1V55H 2F4IA 4L5JA 1XGMA 4A3GJ 5GADJ 2GA2A 3O2PE 4RLQA 3QYBA 1T33A 2DOAA 2EBIA 4E4HA 4WXHA 2VLAA 3HZJA 5JR3A 4RGSA 3ONQA 3DU6A 3J81Z 1RZ4A 5L3GA 3OYJA 3FK7A 4MQVA 4IL6C 1WJBA 2GA1A 3OSFA 3R0AA 4FX4A 1QU3A 2M8GX 3LFUA 1B8IB 2XB5A 4BL0B 2MGQA 3S17J 2QQAA 2XF5A 3MEXA 1E3PA 1KQ0A 2XRNA 3T0YA 1FYKA 3KX2A 1NG7A 5E1ZB 3GTOJ 2R7ZJ 2UWMA 4FASD 3RZDJ 4RGRA 3E7LA 1FJLA 3PO3J 4IRGA 1VQ8I 2I10A 2MD5A 2Q0OA 1Z7UA 1I27A 3K4LA 3OYBA 2LY9A 3VYUB 2E1OA 3B02A 2ELJA 3I58A 3REOA 1FYMA 4ZDOA 2CQQA 2R7WA 1ZARA 2Y31A 3DXJF 2K9MA 4MQ9F 3ABUA 2R7OA 4UHTA 1B8IA 1REPC 2KISA 2HKXA 3BDDA 3KEYA 3A2KA 2V1UA 1SVOA 2NXNB 3BCAA 3JCUC 2PJRB 5E1XA 5CYVA 3PQKA 3JAMZ 4JK1X 3WE3A 1XMXA 4M6XA 2DTZA 3F21A 1GT0C 3O6BB 4DW6A 3TO7A 3LA3A 1Y0UA 3CJTB 3S2HJ 3Q9SA 3IRQA 3PIOF 2VJ5A 1S5LC 2CFOA 4QPOA 1Y1VJ 2D45A 3JAMK 1W0UA 4C3JJ 3FIWA 1I50J 1FT9A 2JVHA 1HW5A 1Z6RA 3BP8A 3WTTC 1UB9A 3RPUA 1MBEA 3B6AA 2F5DA 4EJTA 2ZJQF 1MH4A 4LG3A 3H3UA 3R4KA 3E97A 2HFHA 1DP3A 2KHMA 5CJ9A 2M4KA 3H92A 3ZQIA 3S16J 5DDGA 3QRFF 3OYMA 2JZYA 4BBRJ 5FRNA 2BOLA 2MLGA 2RDPA 1P4XA 4GYIA 3ZP5A 3F3XA 4EM1A 1XC5A 2F2EA 2PMHA 3P9KA 1R5HA 4J01A 2BY2A 1B1BA 3W3CA 1SC7A 4RGXA 3KP5A 2ICWG 4YG2F 2NVXJ 1U9OA 5DM6F 1IDYA 3OYNA 2H6BA 4PGGA 3HDDA 2EINH 4U0VA 2KQRA 1GV5A 2BY1A 1Y1WJ 4P55A 1J0RA 1ETVA 2W85A 3QP6A 3VODA 1SFUA 3OYLA 2ZO4A 4WF2A 5HLGA 3BPVA 1IRXA 2FOWA 4KN7X 2VB6A 1XCBA 1YITI 3MMYB 2LFBA 2Z16A 1Z3XA 3T8TA 2KJBA 2KMUA 5IT9K 3GWZA 1VQ5I 2K9LA 3DEUA 4YIRX 1J59A 3S3OA 4PSWA 2JA2A 2M0MA 3J7AY 1MW7A 2DMUA 4UVCA 1RR8C 5FKKA 3OYGA 1U5TA 4PZJA 3CCMI 2LLKA 1X1CA 2PFBA 3CMAI 3WTXC 2A5WA 5D6EA 1D8JA 3VPRA 3RJPA 3QPTA 2M0CA 1SD5A 4GGGA 4PGHA 2DA3A 1FEXA 4BE2A 5JHUA 4AYBN 2JA8J 2Z99A 3L09A 4DOZA 1ZH5A 3L2WA 3WU1B 2YS9A 5ICCA 3EUKL 2Y69H 2DFEA 2QQ8A 2WV1A 1X1AA 2IGMA 3ZMSA 2F5EA 2QSFX 2ZJ2A 3VWBA 3H9QA 1UJ8A 2RQPA 1JKQC 1ZG3A 1UHSA 2V79A 5LRSA 4PFPA 1QZYA 2EFOA 1LQ1A 1ORKA 2R7SA 2PI0A 3C3WA 3PUBA 3EUAA 1QPIA 2YPRA 4S04A 2DK8A 4HW0A 4IVNA 4JX6A 1OLTA 2EIMH 4U87A 3U2RA 3LAPA 2NRAC 3G3ZA 5L3DA 2IGNA 4YFXF 4J00A 2HS5A 3DPLC 3AG4H 4YELA 5BNGA 3TDZC 3I54A 3HOXJ 2WWYA 2L01A 4ZYHA 5J4VA 1ETYA 1Z6TA 3S1MJ 2EH3A 2HPIA 3M8FA 3K1PA 5C44J 1XGNA 3HBLA 1YHQI 4CYDA 2JUCA 1JHFA 3SQNA 1HC8A 2FOKA 2ESHA 2EWNA 2BW3B 3P9CA 4KT5C 4WCGA 4HV6A 5FD6A 3QU3A 1WJ5A 4HF1A 2RKHA 1O3SA 4ENMA 1ONVA 2DA1A 3TOAA 2X51A 4BXFA 1P92A 1VQ6I 2JPBA 3CTAA 4KIGA 5C3EJ 2NS8A 3K4MA 4XN0A 2HOEA 1FBQA 4D5FA 1MNEA 2EV0A 5J8FA 1MDMB 4Y33A 4CA0A 5CVIA 3ZQHA 3F22A 2HTSA 3K1NA 4QPQA 1TT5B 2BYVE 1LB2A 3GUDA 3IH3A 2A68F 3BR2A 2JVGA 1PP8F 1D1AA 1Z77A 4FHTA 1FOXA 2P6SA 3HSEA 2K40A 4DQ2A 1IRZA 2HQNA 3VOEA 2IBDA 3C2BA 1W4MA 2R5YB 1DU6A 3NWSA 1YW7A 1RC9A 2EV5A 2DYSH 4BE1A 3OR2C 1KU7A 4A5MA 1MBHA 4BQAA 2XUBA 4ZYDA 3ZQ7A 2R3SA 1K79A 3G6EI 1SD7A 2ACJA 2VT3A 5JHFA 1XMAA 4I0BA 1BBYA 2K5CA 3E6BA 4B3XA 1G3YA 3HC7A 5E3NA 1MMGA 3AG2H 2DW4A 5E8GA 4XRSG 1FLIA 2HPMA 3HSRA 5DD8A 4CHUA 1WJEA 5LLQA 3DCFA 3P7NA 4CCLA 4FT8A 2HVRA 1ZGJA 3K4CA 4KNYA 1FPQA 2PQ8A 1A5JA 3SZPA 5BQTA 2V4JC 5E3OA 2HOSA 4S0HB 2O5RA 5J8CA 1Q1VA 2JSPA 2OC6A 5GAHJ 1VQPI 3BLYA 1ETKA 1WJDA 1PYVA 2DJNA 2DT7B 4D7MA 4B3AA 1N25A 2VPRA 4I7HA 3OS0A 3ROUA 3GXOA 2JWTA 4EM2A 3E6DA 1USSA 3DPUA 1HKSA 2X6XA 5KNLA 3WTYC 1XX5A 4OIRF 1CF7A 4A0ZA 2GM4A 1Z0XA 4CZZA 1YO5C 1TNSA 1W36D 1YW8A 1FY7A 2QM3A 1K4TA 3RZOJ 4BU2A 3SDBA 1EA3A 2EB7A 3L2QA 1P7IA 4RGUA 3KZZA 2YU3A 3FMQA 2JQ7A 1G3SA 2O0YA 2DI3A 3FMRA 2CU7A 4A3MJ 1UHMA 2VOPA 5HODA 1P6RA 2KP6A 2IA2A 3RTRA 2OD5A 2ZNZA 2H94A 2HXOA 4BQQA 1SANA 2VKDA 3JRBA 2MBFA 2KDZA 1PUFB 3ESWB 2K3PA 2M87A 4HQEA 3CQZJ 1XGOA 3IHUA 5EZGA 3P5JA 1E3OC 4XBFA 1DDNA 4IHVA 2JMWA 1RPWA 2LRDA 2LY2A 3OV8A 1G4DA 2XKOA 3SHFA 1MZBA 2LKSA 3H9GA 4E7IA 1I5ZA 2WAFA 1MD0A 2DCEA 3WU0A 1TNTA 3AL0C 3DBRB 4HF0A 5M5WJ 2G0EA 4M9XA 4YEJA 4TV7A 1Y39A 2LDUA 2DOFA 4BYYA 3I64A 2JA7J 3LQRA 1QNTA 2MG4A 2VOOA 2BVMA 3O8HA 5ED4A 5ILSA 3KYDB 2HWVA 2LF8A 2HTJA 3L1PA 3TOBA 1PDNC 1GV2A 2PMZN 4XOPA 3SDGA 4OU0A 3V8LA 5D4RA 4II2A 1JE8A 1BN5A 1R5GA 4F91B 1ACIA 3CP8A 4IEJA 3HL2A 1S9HA 2CV0A 1ZN2A 2ISYA 1ON1A 2B0LA 2EILH 3SFZA 3GO5A 4HSTA 3K70C 3OYKA 1RRJA 2R7UA 4E7ZA 2D2WA 2ZKZA 1F5TA 1QGPA 4G12A 5FKMA 4EM0B 5EG0B 4LJZF 4KMFA 2VIXA 1A6IA 3K0LA 1OISA 3RQIA 3PNYA 3S2WA 5JVTA 3QPHA 3TMOA 4A3DJ 3IH4A 3F6VA 3W2AA 2F4MB 3F0CA 1R1VA 2QZ8A 1X2MA 4P5OA 3TGNA 4L0ZB 1I6HJ 2M3AA 1XB4A 2VJIA 2Z2SB 3UNGC 2Y2ZA 3SZGA 1JJ8C 1OYWA 2LR8A 1XMKA 4PJMA 2RN7A 2M7BA 3WHCA 2COBA 2E5NA 4C2TA 3S14J 1J75A 4DIQA 3H1CA 2GBYA 1K83J 1FIAA 3TDUC 1J9IA 4I09A 2X6WA 3Q9VA 3SJMA 4RAFA 4Q47A 3HUGB 4O6JA 3GTJJ 3M1EA 4CDGA 3A4CA 2XASA 1U9NA 2ZBKA 4AVPA 2WY8Q 4UXNA 2ECBA 4L0YB 4AVZA 3MAJA 4UUSA 2FNAA 4RB0A 2QVOA 3NWTA 4M72A 3ZPLA 2A69F 3CCYA 4HF2A 5DUIA 3WTWC 2CQNA 1PUFA 1S7EA 3OOPA 5L3CA 2NS7A 2I5UA 3TP3A 1TP4A 4KA4A 3BZ6A 2EZLA 1KGSA 2PEXA 1EJ9A 1X3ZB 3BT9A 2FNPA 5FKLA 2V9KA 3E3VA 4G6DA 2O8XA 1UCRA 2CSOA 1R5ID 2DMTA 1FP1D 2DMPA 2QCOA 5KK1A 5J6XA 3UKGA 3NARA 5D6FA 3N97A 3K4BA 3MFKA 2BHZA 4Z2YA 1R1TA 3OL3A 4M71A 1IV6A 3GCMA 2TRTA 1RETA 2X4HA 4CSWA 2DO7A 4RLFA 2QLZA 4FE7A 4Q48A 3A03A 4P9UA 3JREA 2CUJA 4U0WA 3CCQI 2O6GE 1VFCA 4QIWN 3JRAA 1B9MA 3PQJA 4LITA 2MABA 2LTPA 2DT5A 5BOXA 4F3QA 4EMSA 5IYDJ 4KFCA 2R7DA 5CLSA 2M4GA 4UUTA 1U8BA 3IKVA 3FMSA 2L7ZA 2VBWA 4M9ZA 3SEQA 5KHDA 2E1MC 1FBSA 1FP2A 5FLMJ 4M3BA 2GAUA 1D1CA 2RREA 5TISC 1U3EM 4N4OB 3DTIA 2W00A 1V5EA 2GXGA 1L3LA 4LB6B 4HNVA 1YW9A 1C0WA 1SFOJ 5LBQA 2KRFA 3KFWX 4A3IJ 3GFIA 2V9PA 2DA6A 2Q8KA 2F4OB 1YFHA 3Q3SA 3J7AO 1LFBA 2HEOA 3HM5A 2YX4A 4I02A 4EJUA 4BJ6C 2R0QC 1FSHA 1HA8A 2A5YB 4G6QA 4FE4A 2EFPA 4KICA 4C2MJ 1WJFA 2XGEA 2L7MP 5GTIC 3K4KA 3H5AA 2FEZA 5J1RA 3HJEA 3VYTB 2M9HA 1U5TB 1JTYA 2A3SA 2F5VA 4X1EA 4ZYGA 4N9IA 3BQYA 4HX4A 2NNNA 4ENKA 4CCKA 1HQCA 3I4PA 2OZ6A 4BHBA 3DU5A 2CW0F 4MTEA 4B43A 5EYRA 1YI2I 3QYEA 2OQRA 5A2QK 1EH6A 1A6QA 4GCVA 2VJ4A 5FRMA 4M74A 2IA0A 3KP7A 2O3FA 5J4YA 5C4JJ 4J19A 2DQRA 2KRHA 1ZREA 1K78B 4EGZA 4NQWB 3DTKA 1SVLA 2RVCA 1FBUA 2KIUA 3QPSA 3BJAA 5B1AH 2ECCA 3KP4A 2IP2A 3MCZA 2XRLA 5FROA 3ZMZA 2UXNA 3FXQA 3DP7A 5E8IA 2R7FA 1T95A 1XPXA 4L9TA 2OF7A 1ZTRA 2ZCWA 1VQMI 1TLHB 4GXOA 1BW6A 1P7JA 3GFMA 1NH3A 4IOAF 1I6XA 3G1OA 2B63J 4BQNA 2VJJA 3KETA 2ZXIA 4IO9F 1BM9A 2VXZA 3RDIA 3OYEA 4Y17A 1BC7C 4LMYA 5F27A 2DDBA 1X4OA 4HQMA 4AYBA 4HOBA 2V26A 4DYRA 2IS6A 5KCMA 4EGYA 1H89C 2EA2A 5HNHA 1YS6A 2HGCA 1VQ4I 5EJCA 3HHHA 2QBYA 2QKMB 5FLVA 1ITYA 2Q2EA 2AS5F 4C3IJ 1ZRFA 2BW3A 1O57A 4HNUA 1HBXG 2WAQA 1N78A 1X3WB 1USTA 4WXCA 4M6YA 1IRGA 1R9TJ 1R49A 1V3FA 3JRFA 4D0PA 4B09A 4NUBA 1JKPC 4IHYA 2OUMA 4OAYA 2P7CB 3V7RA 4B44A 3PJRA 3CCVI 4A3EJ 1R58A 2E1NA 2JT1A 1IV8A 5M3FJ 2DT6A 2OAZA 5DUKA 2PX9A 5FGMA 3V7CA 1SFEA 4XRSA 1AHDP 1HDDC 1YE9A 2LC2A 1IUFA 1P2FA 2XVCA 1W1WE 3FKIJ 3X2QH 5KVRA 4IHTA 4EVIA 3HYIA 1UG2A 4F52A 2O8KA 3E6MA 2HKOA 5EDNA 1JHHA 2R7VA 1B9NA 2N8GA 2Y30A 1X3UA 2KDOA 2LD5A 4UVAA 4ETSA 3PNVA 2VE9A 2EZIA 2X0LA 1W7PA 1SMTA 3H0GJ 4BJTA 3BQZA 2W24A 1Z05A 3ZQFA 4CO8A 2R93J 4XONA 3N05A 4I6ZA 2MW8A 3FDYA 3J80Z 1P4WA 5LD2C 3EYIA 4YIIA 1T2KA 3S2DJ 4U7BA 4BY7J 5GP9A 3OSGA 1OCTC 2ISZA 4CICA 1D0YA 2R5ZB 2CW7A 2KRCA 3MD2A 4L5IA 4CYCA 2KZVA 4JP0A 2WA0A 2BY3A 3DBHB 2TDXA 3I4NJ 1KQ9A 1NG6A 2E1CA 3G73A 1WJCA 4PCQA 1IXRC 2ESNA 5LHIA 1JI8A 1EH7A 2JA5J 3ZMVA 3MKZA 5L3FA 1POGA 5LEJA 1VZ0A 4EQQA 3QOPA 3LSRA 4BS9A 2WAQN 2VXDA 1OCOH 1ODDA 2DLLA 2BBYA 2HZTA 5B66C 2P6TA 2JJ7A 5K1YA 3A01B 3S15J 3FBIB 3ZMTA 4BACA 2E2JJ 4RB1A 1ZR4A 4WX9A 2L5QA 2DODA 3BZKA 1G8XA 3WTZA 2E34A 1F36A 1ZLKA 2NVTJ 3FK6A 1MJBA 5DCFA 1T08B 1KZHA 3OMYA 2NVYJ 2BXZA 2UUZA 2VQGA 2EZHA 3ZQLA 1ZR2A 1TQMA 2P81A 4K2EA 3OYIA 4GFBA 1JTXA 4F92B 1UAAA 2PMUA 3FKJA 3JRDA 4I76A 1U0JA 4L9VA 1ETOA 5CQGA 3CDHA 1SFKA 2DMNA 2KKOA 1Z3YA 4IPAA 2ETHA 5AIQA 2DN0A 3KZYA 5HS7A 1X1DA 3PSIA 4RM2A 3VEPA 1K61A 4HSRA 2OPTA 1D0XA 2CS3A 2FSWA 3QPLA 1WSUA 3Q0WA 3CLQA 5F6FA 1ZAOA 2AQEA 2K4BA 2HDCA 2IRFG 4XLCA 5F1RA 4YFKF 5FFZA 4GO1A 4PUSA 3S8PA 3OS1A 4FX0A 4D9JA 3DV8A 4XMYA 4E7LA 2OCEA 2PLYA 3E6CC 2K9SA 2HQRA 1YG2A 5IT3A 4OIOF 1J09A 4Q5SF 2ZJRF 1WCMJ 2DOEA 4B1RA 1IJWC 3I4MJ 1B59A 4R8HA 1WJAA 2WAEA 3GTKJ 4QTRA 4P96A 2EFQA 4BXXJ 3WTVC 4LK0F 1HCRA 1JUPA 1F43A 2RAEA 4F55A 2UV1A 3HRMA 3C18A 3D5SC 4BUPA 2W82A 4F93B 4YRVA 3CLOA 2M8EA 3BR0A 5IP6A 2MC4A 3PFIA 2E7WA 2LK2A 4ESFA 2M2EA 1HLVA 1DP7P 1E2XA 2HDWA 3GTMJ 4LLLA 1QZEA 2OTJI 2YSRA 3WHBA 4D1QA 3HKZA 1K7AA 5JLWA 3CCJI 1VNDA 3BR3A 2Z9OA 2KIMA 5LGTA 2I8DA 3IP4B 4A3JJ 3OIPA 3LA7A 2X85A 2XV4S 3PNTA 1MBFA 2KPMA 1AOYA 1XDSA 1U2WA 4UB6C 1JKRC 4YFNF 3IUOA 1KYWA 3HSFA 2MD0A 4HRIA 1H88C 5FKOA 3CJRB 1S7OA 5EG0A 1XS9A 4D7NA 3GLLA 4EEFG 3BG9A 2A61A 4EV0A 1S6LA 4JQFA 4LK1F 3SEZA 2EQRA 4N4NB 4CCNA 2VI6A 2XGCA 5IYCJ 2RNJA 4ZYEA 1DU0A 4Y13A 5IP7J 3KLOA 4ITVA 1ZKGA 4MFDA 3M3YJ 1WH7A 5HOOA 5J1YA 2YX7A 2OA4A 1D0ZA 1TWFJ 3QU6A 1OJLA 2ZC2A 2LSOA 5HDKA 3F8BA 1WHUA 5E3MA 3A01A 1OQYA 4ZDPA 3TW7A 2O61A 2VODA 3KIOA 3CZ6A 1ZG1A 3V7SA 1VQKI 4A69C 3WGIA 4WK8F 1ZELA 3PM1A 1P4AA 2L54A 3HOSA 3LWFA 1MBGA 4NHJA 2UXXA 4RM3A 2QYOA 1E0EA 4L18B 4I2OA 4OWRB 5HS8A 1YX3A 4LOCA 4E7SA 1Z7LA 2HQAA 3M07A 3FX3A 1OKRA 1R4NB 4U0YA 4M73A 1W7PB 3DKWA 1AU7A 3LSKA 3V8KA 1J5YA 4O5VA 1YJWI 4AIKA 4PSXA 2CFXA 2HU9A 2X6YA 3CCLI 4QLCU 4Q4ZF 3HRUA 5CVUA 4DZJA 2ZJPF 2K02A 1WFXA 1BR1A 5F0CA 1M1EB 4XLPF 1VQLI 1WKMA 1RUOA 2XKPA 4YIFA 3O3KA 4HX7A 2FQ3A 4RAGA 1Q1HA 1W7PD 2BEOA 1FOYA 2L9NA 3HTUA 3HB9A 5D8LB 5D5WB 1SAXA 1JT0A 4MEXF 2DA4A 2H27A 4L5EA 4DBQA 3IAM2 1T38A 4RAZA 1IXSB 3FM3A 1I1GA 5F1JA 3M8EA 3M4OJ 4FISA 4BDZA 2LKXA 2ZMEB 2GLOA 4NC8A 4BXUA 3F8CA 2H6CA 1XSVA 1MJAA 2EZKA 1RNLA 4C2UA 1WPKA 3GYHX 5LEKA 2WBMA 4XICA 3ELKA 1W36C 1XDUA 4ZTJA 5TRDA 4G7ZF 3S1QJ 4NBQA 3L2VA 4P1WA 2QSGX 3CUQA 5H6QA 3BG3A 5DV5A 2FJ1A 3U1DA 1FOWA 1IG7A 1V5GA 2VN2A 3KYLA 4NDLA 4KDPA 2FQ4A 3A0HC 2QGUA 2CRGA 3C2GA 4WWCA 3ZCOA 4H0EA 1LEBA 1IO2A 1H8AC 3DBLB 3CF2A 3PO2J 3KE2A 1TBXA 3ZN1A 3HTSB 1GUUA 1BIBA 2IS4A 3F8MA 4UUSB 3HIFA 2FMYA 4PK4A 3U21A 3EYYA 1UZCA 3VSKA 3IV5A 2P5KA 5GAEJ 2QF7A 2MLKA 2FXAA 1O3RA 2HYJA 3G71I 1TC3C 3IWZA 2QSHX 1MMSA 2FRHA 9ANTA 1UMQA 2ZNYA 3BTJA 1JGSA 1WZ2A 4HAMA 2STTA 1SD4A 4JX4A 3EETA 3FXJA 3V4GA 1Y8RB 2BXYA 3BZCA 5GPCA 2DBBA 2NVUB 4A5NA 5DCMB 1LFPA 1ETQA 4M3GA 5K5OA 2CMPA 3K2ZA 1YX5A 1FOKA 2OTLI 1D8KA 2L9SA 3WGHA 4IHXA 2GWRA 2E5ZA 1JT6A 4KISA 1VQNI 4N9HA 4IRHA 5H2FC 1Y56A 2AXLA 1V4RA 4A6DA 3E1SA 5BPIA 1DQUA 3CP2A 1FTTA 4KYWA 2P5VA 2CG4A 5EEAA 1D1BA 3HGYA 2RGVA 3OOUA 2OU2A 2LKPA 1BR2A 3M9AA 1PP7U 3S93A 4A3BJ 5HDGA 2ZMEC 1Y0NA 3A02A 3E5QA 1L0OC 3RQ4A 2P0WA 5F04A 5B3SH 2VBXA 5DCMA 1QPMA 4A6EA 4U7DA 2AQFA 3KZIC 2EIJH 3EUHA 3RYRA 2LY1A 3ECHA 2K86A 5HLTA 2K27A 2L9RA 3K1MA 4DYQA 1O3QA 2IXSA 1TTYA 2VASA 3ERMA 2XHKA 3HOZJ 2RQQA 3BR5A 3T5XA 4KJZA 2Y48A 2JN6A 5K5RA 2GIVA 5AONA 4EJVA 5BS6A 3WTUC 3GLXA 1G59A 1NTCA 1GVDA 2QKLB 4V2FA 3S3MA 3GTQJ 2E2IJ 4PJNA 4W1UA 1XTAA 1OPCA 3AAFA 2ELKA 2LVSA 4MEYF 3RCOA 3ZQGA 1SVMA 1ENHA 3W6JB 2DMQA 4CCOA 2O7OA 2ZFWA 4IJAA 3ABTA 1V5FA 3GF2A 5D5XB 3S3NA 2R7TA 2VONA 4IHSA 4DBRA 3I55I 1A35A 2PMZA 3M1CA 3F6OA 1RUNA 3K9TA 3CESA 5FFXA 4B4CA 1EF4A 1I3AA 3AG1H 3OR1C 3CMEI 1HSJA 1OCRH 3HPHA 4RB2C 2NAZA 4N0BA 4MLOA 3SZTA 1X2NA 2Z1DA 3JR9A 1HXDA 5CVRA 4AIDA 1FZPB 1BI2A 2QBYB 3JTGA 2FUG2 1J2XA 4F7ZA 2VUMJ 3HEFA 1I39A 5ICEA 1J7KA 4ENJA 2XB0X 3RKYA 3ZOBA 2D1HA 4MO7A 2R5ZA 2R5YA 1WQ2A 2IA1A 3DKYA 1FTZA 1KQ8A 1H0MA 1IRFA 2V1DA 1F9NA 6PAXA 2BE5F 3RKXA 2EPFA 2Y9ZA 4ZJZA 1JKOC 2KZGA 1JUSA 2G7HA 5CVVA 3J7ZI 2O03A 1KONA 3R0JA 1G3WA 1LEAA 4A3CJ 3HRTA 4QSHA 2GOMA 1TWAJ 4OIPF 1G6NA 3H9JA 3VFZA 2DXIA 1RKWA 1OR7A 2BGCA 3G2BA 1R71A 1RKTA 1B72A 2VPLA 2PN6A 2UZKA 1SEUA 2VE8A 3BTIA 3FXKA 3KLNA 3TEDA 3MKWB 2B7EA 4G6TB 3NRVA 1STZA 2QUFA 3S32A 1MMAA 2COMA 4D5CA 1ON2A 3CMYA 3S1RJ 1S72I 1X19A 3GTLJ 2LYCA 5E79C 3H35A 3IKTA 3I3LA 5EGOB 2RNGA 4BHPA 4KT6A 2GXBA 1U78A 4FQGA 1R1UA 3H5RA 4XLFA 3MWMA 4ENNA 5LGNA 3QP5A 3CJNA 1BOBA 2IPQX 2DFHA 2CUEA 2JTVA 5K5QA 3A1YA
chains in the Genus database with same CATH topology
1TT0A 2KZVA 3K4MA 4XN0A 2CUZA 2WA0A 3K4NA 1MNEA 3K70D 4Y33A 4XORA 1NG6A 4CA0A 1SAUA 4AU7A 2HZDA 2R4GA 3LSMA 4BQOA 1WJCA 3LMMA 4CUGA 4QPQA 4E7HA 1JI8A 4HNTA 2ZSIB 2HNHA 3UR3C 3MKZA 2LH9A 3VYRB 2JVGA 3ZXSA 4BE0A 1D1AA 3BG6A 4ZTFA 2R7RA 3EPZA 1VZ0A 3QOEA 5CPRB 2IS1A 4BS9A 2VXDA 3QODA 3NWSA 1P9QC 3MKYB 3FBIB 4BACA 4BE1A 3BG7A 3OR2C 4XQFA 2HVSA 2L5QA 4DJAA 1G8XA 2X1CA 4FETA 1UELB 3OMYA 5JHFA 2UUZA 2VQGA 2K5CA 3BCBA 4B3XA 2CV2A 3HC7A 1MMGA 3OYIA 1MMNA 2HPMA 4F92B 1UAAA 3VSLA 1UG0A 3FKJA 3RPUD 1WJEA 4BEHB 3L2RA 4CCLA 2R7XA 3VDXA 2HVRA 1U0JA 3K4CA 4H4KC 1DGWY 4XLAA 3AL0B 2M7AA 5CQGA 2L7KA 3OL4A 1SFKA 2V4JC 3VYSB 1Z3YA 1X1DA 2O5RA 3DKXA 3F9KA 3OWTA 3PSIA 4RM2A 3LSHA 4HSRA 4IZZA 1D0XA 2CS3A 2JSPA 2OC6A 3BLYA 1X4PA 3OYFA 1WJDA 5LFAA 1PYVA 2AQEA 4BDYA 2DT7B 4XLCA 2IS2A 4HG2A 1MNDA 4PUSA 3S8PA 3OS0A 3OS1A 2CV1A 4D9JA 2VKHA 3DPUA 4XMYA 4BGDA 2X6XA 3HOTA 4E7LA 5KNLA 2WY7Q 3V42A 3DPTA 1J09A 3H0DA 1W36D 1WJAA 2WAEA 2XF7A 4XNFA 3BC8A 3LSGA 4IQ4A 3SDBA 1EA3A 2MFZA 4BU2A 3PL8A 3L2QA 2X1EA 2HVQA 4F55A 2UV1A 4BUPA 3OYHA 3D5SC 3OYAA 2W82A 4JOMA 4F93B 1MMDA 2ZFUA 4YRVA 2R7QA 4R79A 4XN3A 2MC4A 1T0FC 2KLOA 4KITB 2KP6A 3RTRA 3FHNA 4HPQA 4EATA 4BQQA 2V1NA 2VKDA 2HDWA 4XKVA 2E60A 2K3PA 4D1QA 3HKZA 2NOJB 2LRDA 4PFOA 2LY2A 1GLNA 2MYSA 2I8DA 2Q2EB 1LVKA 3IP4B 3H9GA 3IAS2 3M8JA 4E7IA 3OIPA 4ZC3A 2WAFA 2DCEA 3D5LA 3GBGA 2X85A 4NNJA 3PNTA 2KPMA 3AL0C 2LOOA 3LSIA 4YEJA 2W7NA 2VQCA 4C9YA 4LIVA 3IUOA 2BVMA 3QYFA 2MD0A 4HRIA 5CQEA 3CJQB 3CJRB 4XM3A 4XOTA 4XOPA 3SEZA 4JQFA 3DEEA 4NC7A 4N4NB 4II2A 4CCNA 4F91B 3CP8A 3L2UA 3HL2A 3DWLE 3OYDA 1S9HA 4XLHA 3DLAA 1X1BA 2CV0A 4ITVA 5HOOA 4Y3OA 1BR4A 2LG4A 1D0ZA 4HSTA 3K70C 4CZCA 3OYKA 2R7UA 3HPGA 3K10A 4E7ZA 2VL8A 3RSNA 4ZDPA 2XC7A 3H5NA 4XLEA 3AKZA 4LIUA 2VIXA 3CZ6A 1DGRM 1LDKB 1ERDA 3PNYA 1ZELA 3OYCA 3TMOA 3AFHA 3K6GA 3HOSA 4DGWB 4XL9A 3W2AA 4RM3A 4P5OA 2M3AA 2VJIA 2Z2SB 1E0EA 2WADA 3UNGC 3SZGA 4OWRB 3OS2A 1YX3A 4PJMA 4E7SA 1Z7LA 2HQAA 2M7BA 3C2HA 2E5NA 4C2TA 4ANJA 1N75A 2LREA 4XKCA 3D5RC 3E0JB 4DIQA 3LSKA 3ZGKA 2CH0A 1K6YA 3FBNB 2L2OA 5TGTA 2IGOA 2XF6A 2ZXHA 2GOXB 2X6WA 4PSXA 2XDVA 4XKBA 2HU9A 2X6YA 3W2WA 3ZR8X 2VQLA 2W1OA 3HUGB 3I9V2 4IKFA 3A4CA 2VQHA 1WFXA 1BR1A 4II3A 2WY8Q 3OY9A 4OAZA 4AVZA 4Y4RA 3NWTA 4E7JA 3TBIA 3ZRGA 2L9NA 2F4IA 5CKTA 3LL7A 4XR6A 4ZYAA 4RLQA 4DBQA 3IAM2 2DOAA 3QYBA 4E4HA 2XAUA 2VLAA 2V9KA 3ONQA 3DU6A 4BDZA 3OYJA 4NC8A 4IQJA 4X0GA 1WJBA 3K4BA 3OL3A 4C2UA 1QU3A 3LFUA 4CSWA 4BL0B 2WBMA 4RLFA 2XF5A 4ZTJA 1W36C 2CUJA 3L2VA 4P1WA 3KX2A 1NG7A 3OIQA 3DTEA 2UWMA 3HG9A 4RMNA 4CCJA 2BVLA 4FASD 4LITA 1V5GA 4CH7A 3K4JA 3KYLA 2MABA 1TZLA 3C2GA 2JUGA 3ZCOA 4F3QA 5HNFA 4CCMA 2M4GA 3K4LA 3CF2A 3OYBA 3VYUB 2ELJA 4ZDOA 2R7WA 3DQVC 2IS4A 3SEQA 5KHDA 2K9MA 4XKWA 2E1MC 2R7OA 4E7KA 4PK4A 3U21A 3VSKA 3KEYA 3A2KA 1D1CA 2RREA 4ZDLA 4N4OB 3DTIA 2E1MB 3BCAA 2PJRB 2WB1A 2W00A 1V5EA 2LBFB 2DJIA 2VJ5A 2CFOA 4QPOA 1LFPA 2CMPA 1YX5A 2L9SA 1N77A 2JVHA 2E5ZA 1Y6IA 4KISA 4E6KG 1Y56A 1QHGA 4BJ6C 3PSFA 4LG3A 1HA8A 2Y0SA 3E1SA 1DP3A 1R6RA 1DQUA 2OV7A 1LKXA 3CP2A 1WJFA 2KHMA 1D1BA 2M4KA 3K4KA 3OOUA 3H5AA 3VYTB 3OYMA 1PJRA 5FRNA 1BR2A 2F5VA 2BOLA 2ZSHB 3MD2A 3S93A 3RQ4A 4J01A 4CCKA 2P0WA 3W3CA 1FMVA 3DU5A 4B43A 2AQFA 3QYEA 3OYNA 2Q1ZB 2LY1A 5HLTA 2VJ4A 5FRMA 2IXSA 4GRIA 2KQRA 2VASA 2RQQA 3EUHC 4KJZA 2PJRA 2KRHA 4NQWB 3DTKA 3SYTA 1G59A 2QKLB 4B47A 3S3MA 4C30A 3OYLA 4PJNA 2V7FA 2CW8A 1IRXA 5FROA 2VB6A 4B48A 3RCOA 3MMYB 2Z16A 4CCOA 1Z3XA 1T95A 3CMMA 2KMUA 1V5FA 3S3NA 2R7TA 2K9LA 3S3OA 4PSWA 4DBRA 4BQNA 2JA2A 2VJJA 2PMZA 4BEHA 2M0MA 3J7AY 2A6TA 1MW7A 2ZXIA 2VXZA 3M1CA 3OYEA 3OYGA 2IGKA 2XSJC 3CESA 1X1CA 4BJ5C 2W4SA 2A5WA 3OR1C 3HPHA 1X4OA 4AYBA 4MLOA 2V26A 2Z1DA 4BE2A 2IS6A 5KCMA 5HNHA 5HVQC 4DOZA 3L2WA 2FUG2 2QKMB 3EUKL 2BW3A 4HNUA 1X1AA 2IGMA 2WAQA 1N78A 3VWBA 3TL4X 3H9QA 3DKYA 4NUBA 2OUMA 4OAYA 4B44A 4PFPA 3PJRA 2R7SA 4HEA2 4ZJZA 3PUBA 2KL4A 3EUAA 2DT6A 2V6EA 1KONA 3PFYA 1OLTA 4U87A 1OR7C 2GOMA 2IGNA 4J00A 1YE9A 3H9JA 2LC2A 3DPLC 4YELA 1FMWA 2DXIA 4IX7A 4F52A 3G2BA 2R7VA 2VPLA 2F6CA 2KDOA 4PJLA 2HPIA 1Z21A 3PNVA 3MKWB 2X1DA 4G6TB 4BJTA 3ZQQA 3S32A 1QHHD 1MMAA 3W2VA 2LBFA 4XONA 3N05A 3HXLA 1X19A 5LD2C 3FDYA 2LYCA 3H35A 3I3LA 2RNGA 2BW3B 4KT6A 4PJJA 4U7BA 3H5RA 1WJ5A 4XLFA 1AA7A 1D0YA 1BOBA 2CW7A 2X51A 2KRCA 4BXFA 3A1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W4S A;  2XC7 A; 
#chains in the Genus database with same CATH topology
 1TT0 A;  2E2H J;  3PUF A;  2QEX I;  2CUZ A;  2XAQ A;  3K4N A;  4G7H F;  1EKE A;  1W5T A;  5FKN A;  5E3L A;  1Z1D A;  3K70 D;  1T6S A;  1SAU A;  2HZD A;  2R4G A;  4BQO A;  2PJP A;  2FU4 A;  2KIF A;  4UV8 A;  3CCU I;  2W84 A;  5GTH C;  4E7H A;  1MGT A;  3J80 K;  3UR3 C;  3GEZ A;  3VYR B;  2P5L C;  3D0S A;  3ZXS A;  4ZTF A;  4IXA A;  4BE0 A;  3BG6 A;  3Q5F A;  3WE2 A;  3BTC A;  3QOE A;  2IS1 A;  3LSP A;  2Y75 A;  3QOD A;  2BZT A;  1TW2 A;  1I1S A;  2K3F A;  3NAU A;  4G8X A;  4JBA A;  2DYR H;  1K78 A;  4IHW A;  4L9J A;  4A3L J;  4UY8 I;  2R92 J;  2X6O A;  4KUM A;  4A93 J;  1A04 A;  5EF6 A;  3CUO A;  1D5V A;  1UEL B;  4XK4 A;  3COA C;  3T1B A;  3BCB A;  1WRJ A;  2QWW A;  1MMN A;  1W5C C;  2NOG A;  3L7W A;  1UG0 A;  3L2R A;  2R7X A;  2GZW A;  2HQ5 A;  3LFK A;  3JTH A;  3VDX A;  2XSD C;  2EA4 A;  4H4K C;  1DGW Y;  2M1B A;  1MDM A;  5D8K B;  4XLA A;  3AL0 B;  3OL4 A;  2XGX A;  3T8R A;  2WC2 A;  3DKX A;  3F9K A;  2ME0 A;  1LJ9 A;  1R23 A;  3LSH A;  1GDT A;  4AM3 A;  2HYF A;  2F5F A;  4LFU A;  4XSZ F;  2ZME A;  4BDY A;  2FX0 A;  2IS2 A;  1AWC A;  1T56 A;  1IGN A;  5HLI A;  4HG2 A;  1MND A;  1YRN A;  2TCT A;  2CV1 A;  1ZYR F;  4BGD A;  3E5U A;  2A6H F;  2LP0 A;  4HV5 A;  3RIR A;  2WY7 Q;  4MGR A;  5DTD A;  2YUS A;  3WOD F;  2J5O A;  4C3H J;  3NEU A;  3V42 A;  4ASN A;  3DPT A;  2OBP A;  1YYV A;  2QEN A;  1HST A;  3BY6 A;  1BJZ A;  1T8I A;  3B6C A;  3FXR A;  4XNF A;  3BC8 A;  3AG3 H;  2XGD A;  2ZXJ A;  2MFZ A;  2L4A A;  4IQ4 A;  3PL8 A;  5H20 A;  2X1E A;  4XLN F;  2KIQ A;  2VC1 A;  2ZB9 A;  4BBS J;  3FXU A;  3GX4 X;  1K6O A;  4JOM A;  5J3L A;  2ZFU A;  5JFR A;  4R79 A;  1T98 A;  4XN3 A;  5M5X J;  1T0F C;  4HPQ A;  4AUX A;  1S7A A;  2AO9 A;  3GFL A;  4BY1 J;  4EAT A;  3FIS A;  2V1N A;  2FBH A;  2D1V A;  4A0X A;  1CQT A;  2E60 A;  3GVA A;  3CCS I;  1HW1 A;  3ZMU A;  4LG0 A;  4UVB A;  2HI3 A;  1D3Y A;  1U8R A;  2XAG A;  4AD9 A;  2VKE A;  4S05 A;  2W57 A;  1VQ9 I;  4ON0 A;  5K7H A;  1CGP A;  4IRI A;  2X9D A;  1LVK A;  2LMD A;  5M5Y J;  3QAH A;  4W97 A;  3D5L A;  1VI0 A;  1TWG J;  5F0F A;  2DFI A;  3EQL F;  4MFE A;  1OFC X;  5EZH A;  3W6K B;  3LSI A;  4NC6 A;  4KIF A;  5KAF C;  2W7N A;  1RI7 A;  3GW2 A;  1RES A;  1FIP A;  4UV9 A;  3KP3 A;  4C9Y A;  4LLG F;  4BAY A;  3QYF A;  4RBO A;  1H9G A;  3WU2 C;  4OIN F;  4V2G A;  4XM3 A;  2CUF A;  2QQ9 A;  3GZN B;  3LQQ A;  4MNU A;  5D5U B;  2A6E F;  4HBL A;  2L7F P;  4ABZ A;  2JA6 J;  5DS9 A;  3KPH A;  3L2U A;  3JRC A;  3DWL E;  3OYD A;  4G7O F;  4XLH A;  3BR1 A;  3DLA A;  3GTP J;  4Y3O A;  1MH3 A;  4AWX B;  2LG4 A;  2EV6 A;  4BH9 A;  5LRR A;  4Y15 A;  4E70 A;  3MZ8 A;  2E35 A;  2VL8 A;  3RSN A;  4G9Y A;  2XIG A;  3CCE I;  3I59 A;  3L2C A;  1ULY A;  3HRS A;  1Z91 A;  1DPR A;  3OYC A;  2XPU A;  4ZZL A;  1XN7 A;  1XSD A;  5IY5 H;  3CC7 I;  4CXF A;  4LGW A;  1LE8 A;  1YIJ I;  1VQ7 I;  2PBI A;  4XL9 A;  1DUX C;  1TWC J;  5ICF A;  5ILV A;  1ZK8 A;  3BRO A;  4ESJ A;  2JSC A;  3BOQ A;  2VKV A;  3R60 A;  1YOV B;  3R6S A;  3OS2 A;  3ISP A;  3MVP A;  5JVG F;  1B4A A;  5KAI C;  1N75 A;  2LRE A;  2A05 A;  3D5R C;  3E0J B;  1JXS A;  3ZGK A;  2CH0 A;  1K6Y A;  2IGO A;  2XF6 A;  4XRM A;  4A2U A;  1BW5 A;  3I59 B;  5HS9 A;  5IOY A;  4XKB A;  3HGG A;  3KCC A;  3W2W A;  1Y8Q B;  4HDU A;  1GXP A;  1XG1 A;  3CD6 I;  2VQL A;  2W1O A;  3I9V 2;  3R61 A;  5FLX K;  4A3K J;  1IZ1 A;  2ME6 A;  2VQH A;  5DYM A;  1E17 A;  4II3 A;  1AKH B;  4P9F A;  1JUM A;  2NYX A;  4OAZ A;  2EFN A;  3JRG A;  1VQO I;  4EJO A;  1TQP A;  4I99 C;  1R22 A;  5ILU A;  3ZRG A;  2IAI A;  3LOC A;  1LDJ A;  3Q0V A;  5CKT A;  3LL7 A;  3B73 A;  4XR6 A;  4ZYA A;  4OOI A;  3DF8 A;  2L02 A;  5EGO A;  2K9Q A;  1LE8 B;  1RIO H;  2V1X A;  2DK5 A;  2XAU A;  1SD6 A;  4G94 A;  2O9L A;  4RAY A;  3ERE D;  1OYI A;  4IQJ A;  4X0G A;  1XGS A;  4BHC A;  1NK3 P;  2GQQ A;  4OMY A;  1OCC H;  1TL8 A;  3U9G A;  2HXI A;  3CDI A;  3U1K A;  2DPU A;  3CC2 I;  2XPV A;  3IL2 A;  3OIQ A;  1YTY A;  3DTE A;  4AIH A;  3HG9 A;  4RMN A;  4CCJ A;  1BI1 A;  3JSO A;  1CF7 B;  1X1P A;  2BVL A;  4FTH A;  4CH7 A;  3K4J A;  1QRY A;  1TZL A;  2DFF A;  1QQI A;  2JUG A;  5HNF A;  1TW3 A;  1ZRC A;  5FB2 A;  2LF7 A;  4LD5 A;  2IW5 A;  5D4S A;  4CCM A;  1F4K A;  5DM7 F;  3GME A;  1BJA A;  2MH2 A;  2EFW A;  3WG9 A;  4CYC B;  3MKL A;  3TP0 A;  1BOA A;  3DQV C;  1W0T A;  4XKW A;  2P8T A;  1MIJ A;  4E7K A;  1HW2 A;  2E36 A;  1W5S A;  4ZDL A;  1MKM A;  2E1M B;  1IN7 A;  2WB1 A;  3MZH A;  2H09 A;  3ULQ B;  1QVU A;  3ZN0 A;  5J1U A;  2MA3 A;  2LBF B;  3W6V A;  5FJ8 J;  3I56 I;  3E5X A;  1R7J A;  4Z6Y A;  2XAH A;  3F72 A;  2D5V A;  2DJI A;  4Y7N J;  2L4M A;  5F0H A;  4CGZ A;  1N77 A;  4OIQ F;  2HR3 A;  1Y6I A;  4M6V A;  4E6K G;  1LUJ B;  1QHG A;  1O7L A;  1OCP A;  3PSF A;  1S8N A;  2Y0S A;  1G3T A;  1KYZ A;  2Z5U A;  1R6R A;  3RKW A;  2OV7 A;  1LKX A;  3FF5 A;  3HOY J;  3IH2 A;  1A36 A;  1WGX A;  2CYY A;  3F8N A;  1TQI A;  1PJR A;  1DPU A;  1MBJ A;  2ZSH B;  2FD5 A;  4BNC A;  1RR7 A;  1HKQ A;  3L9F A;  3ABK H;  3NQO A;  3G4S I;  2M34 A;  1WH5 A;  1ZHF A;  1FMV A;  1IDZ A;  1QO0 D;  4IF4 A;  2GXA A;  5F64 A;  4GDF A;  2DPD A;  2Q1Z B;  4HZF A;  2Z3Y A;  3CCR I;  1LFU P;  3F23 A;  4GRI A;  4PDK A;  2DAO A;  1KA8 A;  4QWQ A;  3EUH C;  2JK3 A;  2PJR A;  4A0Y A;  3SYT A;  3BJO A;  4B47 A;  4C30 A;  2DTR A;  2Y0S N;  3LSJ A;  2V7F A;  5B1B H;  3JRI A;  2CW8 A;  1S3J A;  2DA2 A;  3Q0U A;  3LST A;  3ASO H;  1BI3 A;  3RPQ A;  4B48 A;  3HOU J;  3QWL A;  1H9T A;  3D1N I;  3C7J A;  1IXC A;  3CMM A;  3CF5 F;  1K4S A;  3K7A J;  3I0T A;  4HYE A;  4HDV A;  4UUV A;  4BEH A;  4X6A J;  5GAG J;  1S29 A;  2A6T A;  3TW6 A;  1ZGA A;  2IT0 A;  3K69 A;  5IOZ A;  1Z67 A;  3CUQ B;  5TJJ A;  2IGK A;  3EDP A;  2XSJ C;  2YR2 A;  4BJ5 C;  3BR6 A;  2W4S A;  5HDN A;  1BL0 A;  5D5V B;  2NVQ J;  5DEQ A;  2OCC H;  5HVQ C;  4JYK A;  5IT9 Z;  2HYG D;  1G2H A;  2H8W A;  4R1H A;  1WWX A;  2HOA A;  4NB5 A;  1IW7 F;  1LDD A;  1B72 B;  1WI9 A;  3TL4 X;  4XRF A;  5A2Q Z;  2F5C A;  3BTL A;  3BWG A;  4IOC F;  2XAF A;  5ICG A;  2L0K A;  3MQ0 A;  5J47 A;  1BC8 C;  5JLX A;  4BKX A;  5DD4 A;  4HEA 2;  3VB2 A;  1YJ9 I;  2KL4 A;  3BG5 A;  2V6E A;  2BY0 A;  4AC0 A;  3FHZ A;  3PFY A;  3RKQ A;  3HOW J;  1OR7 C;  3KP6 A;  3GZ5 A;  2M45 A;  3CO6 C;  2W48 A;  1FMW A;  4XSX F;  4IX7 A;  1IF1 A;  3JW4 A;  4PJ0 C;  1EH8 A;  3FWE A;  4MIM A;  3BPX A;  2NNY A;  2MSY A;  5IPA A;  2F6C A;  3WG7 H;  4PJL A;  1HOM A;  2Y9Y A;  1XCV A;  1Z21 A;  2J5P A;  2X1D A;  4I0A A;  2LNB A;  2M5W A;  5E18 F;  1NK2 P;  2QA4 I;  5E17 F;  3IRR A;  3RI4 A;  1SMY F;  2K4J A;  3I71 A;  1QHH D;  3ZQQ A;  3GFJ A;  3W2V A;  1APL C;  2STW A;  1EV7 A;  4Y52 J;  5FO5 A;  2LBF A;  2ID3 A;  2AXT C;  3GZ6 A;  3HHG A;  3HXL A;  4M3F A;  3H3Z A;  1MJ9 A;  1IAW A;  1O7F A;  1U6G A;  2DQL A;  1YS7 A;  1MSF C;  4HLX A;  4PJJ A;  2XAJ A;  1AA7 A;  2G7U A;  2GIZ A;  2K9N A;  3WTS C;  4A12 A;  2E7X A;  5E1W A;  3FXM A;  1LVA A;  1FWZ A;  2BV6 A;  2C6Y A;  1UFM A;  3SXY A;  2CQK A;  2EJR A;  2IJL A;  1OMI A;  4XOR A;  2XRO A;  3HKZ N;  5L3B A;  4AU7 A;  3LSM A;  4ZZD A;  3N4M A;  4L9N A;  1IUY A;  1FC3 A;  1HDP A;  3LMM A;  1IN6 A;  1KU9 A;  3I5U A;  4CUG A;  4RB3 C;  3V8J A;  4HNT A;  2ZSI B;  1PUE E;  2HNH A;  2WTE A;  2HOT A;  1UHW A;  2LH9 A;  2FBK A;  2H1K A;  1MNM C;  2R7R A;  3EPZ A;  4HX8 A;  3ML6 A;  5CPR B;  2CWE A;  3TKY A;  5J40 A;  1I3Q J;  1OYY A;  2DDA A;  1HKT A;  2H1L A;  5F08 A;  2DA7 A;  1P9Q C;  2NS0 A;  2V6C A;  3MKY B;  2VT2 A;  3I53 A;  4MTD A;  1FNN A;  3BG7 A;  4XQF A;  1JGG A;  3L00 A;  2HVS A;  4DJA A;  1F1Z A;  2BHY A;  4KMU X;  4M3E A;  2X1C A;  5EEG A;  3TO6 A;  4FET A;  2DA5 A;  2CV2 A;  3MN2 A;  4LB5 A;  3KEQ A;  2E19 A;  4MHG A;  3FXO A;  3VSL A;  3RPU D;  4DZP A;  4DYC A;  3MZY A;  4BEH B;  4UNO A;  4V19 K;  4FCY A;  2OJE D;  2YU9 J;  1LPQ A;  3F8F A;  2EIK H;  3S1N J;  1BIA A;  3ABL H;  2M7A A;  3WGG A;  2L7K A;  5M3M J;  3IC7 A;  3VYS B;  1SFX A;  1R00 A;  3OWT A;  1R36 A;  2AHQ A;  4KN4 X;  4IZZ A;  1X4P A;  2X48 A;  3OYF A;  3P9I A;  2V9V A;  3ZQC A;  3FXL A;  5LFA A;  5L3E A;  3J81 K;  3FM5 A;  1JJ6 C;  2K7L A;  1Z9C A;  1U5T C;  3LNQ A;  3J7Y J;  5BMZ A;  2VKH A;  3JSP A;  3HOT A;  1QA6 A;  1B6A A;  4HLY A;  2WB1 N;  4ESB A;  5LHH A;  1O4X A;  1T0F A;  3ECO A;  1YJN I;  1VF9 A;  4RA2 A;  1V54 H;  3H0D A;  2JRM A;  2XF7 A;  1QVT A;  1ZQ3 P;  3C1D A;  3OIO A;  3DLL F;  2F48 A;  3SFI A;  3ABM H;  1ZRD A;  1D5Y A;  2A07 F;  3DEW A;  3LSG A;  2JRT A;  3QQA A;  3TQN A;  3LAJ A;  1XD7 A;  2XPW A;  1PVE A;  2G9W A;  1KU2 A;  2HVQ A;  1FYL A;  5LHG A;  1ETW A;  3OYH A;  1BA5 A;  3TO9 A;  5CVJ A;  3OYA A;  1IN8 A;  1MMD A;  5E20 A;  1MSE C;  3DFG A;  3H36 A;  2R7Q A;  1X58 A;  3O8G A;  2CGP A;  1E3H A;  2FF4 A;  5FLX Z;  2W25 A;  4XID A;  2KLO A;  4KIT B;  1IC8 A;  3FHN A;  3CUQ C;  2DU9 A;  3RYP A;  4OMZ A;  2KJC A;  4NQW A;  4XKV A;  3CDL A;  5EEH A;  3KP2 A;  2EK5 A;  1FSE A;  2NOJ B;  1GVJ A;  4HA8 A;  5FD5 A;  4PFO A;  5K7F A;  1GLN A;  2MYS A;  1ZG5 A;  2Q2E B;  2MC3 A;  3IAS 2;  2ELH A;  3M8J A;  4ZC3 A;  4B8X A;  3KYC B;  3A0B C;  5GPA A;  1YQA A;  3GBG A;  4NNJ A;  1GHC A;  2FML A;  2OQG A;  4WXD A;  2LOO A;  4U88 A;  5K7Z A;  4A3F J;  2ZXW H;  5HLH A;  3PIP F;  4EJW A;  3CO7 C;  4I98 B;  2VQC A;  4GYG A;  3KEO A;  1HF0 A;  4LLN A;  4LIV A;  5B5E C;  3BJ6 A;  1FX7 A;  5CQE A;  2L3D A;  1XSX A;  3CJQ B;  2ADU A;  4ZH4 F;  1ZLJ A;  2VBY A;  3CC4 I;  1LNW A;  2OZU A;  2WV0 A;  4XOT A;  3DEE A;  2CJJ A;  1WVR A;  4I01 A;  4NC7 A;  2JPC A;  1VTN C;  2E71 A;  2FBI A;  1X1B A;  4KIB A;  1ZGW A;  4RS8 A;  2CQ7 A;  1IN5 A;  2KFD A;  1BR4 A;  3G1M A;  5H6R A;  1A31 A;  5IP9 J;  2FA5 A;  3ASN H;  4DNC A;  1R4M B;  4CZC A;  3HPG A;  3K10 A;  1MBK A;  5IYB J;  3JRH A;  3IWF A;  3GTG J;  2XC7 A;  3H5N A;  4XLE A;  4RDU A;  3AKZ A;  4LIU A;  5ERI A;  1QZZ A;  2MH9 A;  1DGR M;  4UB8 C;  1LDK B;  2M30 A;  1ERD A;  3AFH A;  3K6G A;  3LA2 A;  4DGW B;  3FZV A;  2P7V B;  2RV8 A;  2WAD A;  3K2A A;  2Z33 A;  2VC0 A;  2IEK A;  1YRN B;  1AKH A;  2HDD A;  3C2H A;  1BI0 A;  2L9V A;  3G1L A;  4ANJ A;  1IN4 A;  5LGU A;  4XKC A;  2RC4 A;  2QQB A;  3FBN B;  2L2O A;  1NHA A;  5TGT A;  2ZXH A;  1YIO A;  2GOX B;  2Y0M A;  1O3T A;  2VBZ A;  2CQX A;  2XDV A;  1ETX A;  1WI3 A;  1YLF A;  3HOV J;  3M7G A;  5C4X J;  2P4W A;  2IVM A;  1QBJ A;  3ZMD A;  3ZR8 X;  4M3D A;  3HUG A;  2ID6 A;  4IKF A;  5BPD A;  4AIJ A;  1TWH J;  2H8R A;  2CO5 A;  2PG4 A;  2KT0 A;  1KU3 A;  5JI6 A;  3OY9 A;  2B9S A;  2FE3 A;  4O3M A;  4M9S A;  3H3V K;  4Y4R A;  1T39 A;  1GXQ A;  4JX5 A;  1OCZ H;  4E7J A;  3TBI A;  5AIP A;  2K85 A;  4LG0 B;  1V55 H;  2F4I A;  4L5J A;  1XGM A;  4A3G J;  5GAD J;  2GA2 A;  3O2P E;  4RLQ A;  3QYB A;  1T33 A;  2DOA A;  2EBI A;  4E4H A;  4WXH A;  2VLA A;  3HZJ A;  5JR3 A;  4RGS A;  3ONQ A;  3DU6 A;  3J81 Z;  1RZ4 A;  5L3G A;  3OYJ A;  3FK7 A;  4MQV A;  4IL6 C;  1WJB A;  2GA1 A;  3OSF A;  3R0A A;  4FX4 A;  1QU3 A;  2M8G X;  3LFU A;  1B8I B;  2XB5 A;  4BL0 B;  2MGQ A;  3S17 J;  2QQA A;  2XF5 A;  3MEX A;  1E3P A;  1KQ0 A;  2XRN A;  3T0Y A;  1FYK A;  3KX2 A;  1NG7 A;  5E1Z B;  3GTO J;  2R7Z J;  2UWM A;  4FAS D;  3RZD J;  4RGR A;  3E7L A;  1FJL A;  3PO3 J;  4IRG A;  1VQ8 I;  2I10 A;  2MD5 A;  2Q0O A;  1Z7U A;  1I27 A;  3K4L A;  3OYB A;  2LY9 A;  3VYU B;  2E1O A;  3B02 A;  2ELJ A;  3I58 A;  3REO A;  1FYM A;  4ZDO A;  2CQQ A;  2R7W A;  1ZAR A;  2Y31 A;  3DXJ F;  2K9M A;  4MQ9 F;  3ABU A;  2R7O A;  4UHT A;  1B8I A;  1REP C;  2KIS A;  2HKX A;  3BDD A;  3KEY A;  3A2K A;  2V1U A;  1SVO A;  2NXN B;  3BCA A;  3JCU C;  2PJR B;  5E1X A;  5CYV A;  3PQK A;  3JAM Z;  4JK1 X;  3WE3 A;  1XMX A;  4M6X A;  2DTZ A;  3F21 A;  1GT0 C;  3O6B B;  4DW6 A;  3TO7 A;  3LA3 A;  1Y0U A;  3CJT B;  3S2H J;  3Q9S A;  3IRQ A;  3PIO F;  2VJ5 A;  1S5L C;  2CFO A;  4QPO A;  1Y1V J;  2D45 A;  3JAM K;  1W0U A;  4C3J J;  3FIW A;  1I50 J;  1FT9 A;  2JVH A;  1HW5 A;  1Z6R A;  3BP8 A;  3WTT C;  1UB9 A;  3RPU A;  1MBE A;  3B6A A;  2F5D A;  4EJT A;  2ZJQ F;  1MH4 A;  4LG3 A;  3H3U A;  3R4K A;  3E97 A;  2HFH A;  1DP3 A;  2KHM A;  5CJ9 A;  2M4K A;  3H92 A;  3ZQI A;  3S16 J;  5DDG A;  3QRF F;  3OYM A;  2JZY A;  4BBR J;  5FRN A;  2BOL A;  2MLG A;  2RDP A;  1P4X A;  4GYI A;  3ZP5 A;  3F3X A;  4EM1 A;  1XC5 A;  2F2E A;  2PMH A;  3P9K A;  1R5H A;  4J01 A;  2BY2 A;  1B1B A;  3W3C A;  1SC7 A;  4RGX A;  3KP5 A;  2ICW G;  4YG2 F;  2NVX J;  1U9O A;  5DM6 F;  1IDY A;  3OYN A;  2H6B A;  4PGG A;  3HDD A;  2EIN H;  4U0V A;  2KQR A;  1GV5 A;  2BY1 A;  1Y1W J;  4P55 A;  1J0R A;  1ETV A;  2W85 A;  3QP6 A;  3VOD A;  1SFU A;  3OYL A;  2ZO4 A;  4WF2 A;  5HLG A;  3BPV A;  1IRX A;  2FOW A;  4KN7 X;  2VB6 A;  1XCB A;  1YIT I;  3MMY B;  2LFB A;  2Z16 A;  1Z3X A;  3T8T A;  2KJB A;  2KMU A;  5IT9 K;  3GWZ A;  1VQ5 I;  2K9L A;  3DEU A;  4YIR X;  1J59 A;  3S3O A;  4PSW A;  2JA2 A;  2M0M A;  3J7A Y;  1MW7 A;  2DMU A;  4UVC A;  1RR8 C;  5FKK A;  3OYG A;  1U5T A;  4PZJ A;  3CCM I;  2LLK A;  1X1C A;  2PFB A;  3CMA I;  3WTX C;  2A5W A;  5D6E A;  1D8J A;  3VPR A;  3RJP A;  3QPT A;  2M0C A;  1SD5 A;  4GGG A;  4PGH A;  2DA3 A;  1FEX A;  4BE2 A;  5JHU A;  4AYB N;  2JA8 J;  2Z99 A;  3L09 A;  4DOZ A;  1ZH5 A;  3L2W A;  3WU1 B;  2YS9 A;  5ICC A;  3EUK L;  2Y69 H;  2DFE A;  2QQ8 A;  2WV1 A;  1X1A A;  2IGM A;  3ZMS A;  2F5E A;  2QSF X;  2ZJ2 A;  3VWB A;  3H9Q A;  1UJ8 A;  2RQP A;  1JKQ C;  1ZG3 A;  1UHS A;  2V79 A;  5LRS A;  4PFP A;  1QZY A;  2EFO A;  1LQ1 A;  1ORK A;  2R7S A;  2PI0 A;  3C3W A;  3PUB A;  3EUA A;  1QPI A;  2YPR A;  4S04 A;  2DK8 A;  4HW0 A;  4IVN A;  4JX6 A;  1OLT A;  2EIM H;  4U87 A;  3U2R A;  3LAP A;  2NRA C;  3G3Z A;  5L3D A;  2IGN A;  4YFX F;  4J00 A;  2HS5 A;  3DPL C;  3AG4 H;  4YEL A;  5BNG A;  3TDZ C;  3I54 A;  3HOX J;  2WWY A;  2L01 A;  4ZYH A;  5J4V A;  1ETY A;  1Z6T A;  3S1M J;  2EH3 A;  2HPI A;  3M8F A;  3K1P A;  5C44 J;  1XGN A;  3HBL A;  1YHQ I;  4CYD A;  2JUC A;  1JHF A;  3SQN A;  1HC8 A;  2FOK A;  2ESH A;  2EWN A;  2BW3 B;  3P9C A;  4KT5 C;  4WCG A;  4HV6 A;  5FD6 A;  3QU3 A;  1WJ5 A;  4HF1 A;  2RKH A;  1O3S A;  4ENM A;  1ONV A;  2DA1 A;  3TOA A;  2X51 A;  4BXF A;  1P92 A;  1VQ6 I;  2JPB A;  3CTA A;  4KIG A;  5C3E J;  2NS8 A;  3K4M A;  4XN0 A;  2HOE A;  1FBQ A;  4D5F A;  1MNE A;  2EV0 A;  5J8F A;  1MDM B;  4Y33 A;  4CA0 A;  5CVI A;  3ZQH A;  3F22 A;  2HTS A;  3K1N A;  4QPQ A;  1TT5 B;  2BYV E;  1LB2 A;  3GUD A;  3IH3 A;  2A68 F;  3BR2 A;  2JVG A;  1PP8 F;  1D1A A;  1Z77 A;  4FHT A;  1FOX A;  2P6S A;  3HSE A;  2K40 A;  4DQ2 A;  1IRZ A;  2HQN A;  3VOE A;  2IBD A;  3C2B A;  1W4M A;  2R5Y B;  1DU6 A;  3NWS A;  1YW7 A;  1RC9 A;  2EV5 A;  2DYS H;  4BE1 A;  3OR2 C;  1KU7 A;  4A5M A;  1MBH A;  4BQA A;  2XUB A;  4ZYD A;  3ZQ7 A;  2R3S A;  1K79 A;  3G6E I;  1SD7 A;  2ACJ A;  2VT3 A;  5JHF A;  1XMA A;  4I0B A;  1BBY A;  2K5C A;  3E6B A;  4B3X A;  1G3Y A;  3HC7 A;  5E3N A;  1MMG A;  3AG2 H;  2DW4 A;  5E8G A;  4XRS G;  1FLI A;  2HPM A;  3HSR A;  5DD8 A;  4CHU A;  1WJE A;  5LLQ A;  3DCF A;  3P7N A;  4CCL A;  4FT8 A;  2HVR A;  1ZGJ A;  3K4C A;  4KNY A;  1FPQ A;  2PQ8 A;  1A5J A;  3SZP A;  5BQT A;  2V4J C;  5E3O A;  2HOS A;  4S0H B;  2O5R A;  5J8C A;  1Q1V A;  2JSP A;  2OC6 A;  5GAH J;  1VQP I;  3BLY A;  1ETK A;  1WJD A;  1PYV A;  2DJN A;  2DT7 B;  4D7M A;  4B3A A;  1N25 A;  2VPR A;  4I7H A;  3OS0 A;  3ROU A;  3GXO A;  2JWT A;  4EM2 A;  3E6D A;  1USS A;  3DPU A;  1HKS A;  2X6X A;  5KNL A;  3WTY C;  1XX5 A;  4OIR F;  1CF7 A;  4A0Z A;  2GM4 A;  1Z0X A;  4CZZ A;  1YO5 C;  1TNS A;  1W36 D;  1YW8 A;  1FY7 A;  2QM3 A;  1K4T A;  3RZO J;  4BU2 A;  3SDB A;  1EA3 A;  2EB7 A;  3L2Q A;  1P7I A;  4RGU A;  3KZZ A;  2YU3 A;  3FMQ A;  2JQ7 A;  1G3S A;  2O0Y A;  2DI3 A;  3FMR A;  2CU7 A;  4A3M J;  1UHM A;  2VOP A;  5HOD A;  1P6R A;  2KP6 A;  2IA2 A;  3RTR A;  2OD5 A;  2ZNZ A;  2H94 A;  2HXO A;  4BQQ A;  1SAN A;  2VKD A;  3JRB A;  2MBF A;  2KDZ A;  1PUF B;  3ESW B;  2K3P A;  2M87 A;  4HQE A;  3CQZ J;  1XGO A;  3IHU A;  5EZG A;  3P5J A;  1E3O C;  4XBF A;  1DDN A;  4IHV A;  2JMW A;  1RPW A;  2LRD A;  2LY2 A;  3OV8 A;  1G4D A;  2XKO A;  3SHF A;  1MZB A;  2LKS A;  3H9G A;  4E7I A;  1I5Z A;  2WAF A;  1MD0 A;  2DCE A;  3WU0 A;  1TNT A;  3AL0 C;  3DBR B;  4HF0 A;  5M5W J;  2G0E A;  4M9X A;  4YEJ A;  4TV7 A;  1Y39 A;  2LDU A;  2DOF A;  4BYY A;  3I64 A;  2JA7 J;  3LQR A;  1QNT A;  2MG4 A;  2VOO A;  2BVM A;  3O8H A;  5ED4 A;  5ILS A;  3KYD B;  2HWV A;  2LF8 A;  2HTJ A;  3L1P A;  3TOB A;  1PDN C;  1GV2 A;  2PMZ N;  4XOP A;  3SDG A;  4OU0 A;  3V8L A;  5D4R A;  4II2 A;  1JE8 A;  1BN5 A;  1R5G A;  4F91 B;  1ACI A;  3CP8 A;  4IEJ A;  3HL2 A;  1S9H A;  2CV0 A;  1ZN2 A;  2ISY A;  1ON1 A;  2B0L A;  2EIL H;  3SFZ A;  3GO5 A;  4HST A;  3K70 C;  3OYK A;  1RRJ A;  2R7U A;  4E7Z A;  2D2W A;  2ZKZ A;  1F5T A;  1QGP A;  4G12 A;  5FKM A;  4EM0 B;  5EG0 B;  4LJZ F;  4KMF A;  2VIX A;  1A6I A;  3K0L A;  1OIS A;  3RQI A;  3PNY A;  3S2W A;  5JVT A;  3QPH A;  3TMO A;  4A3D J;  3IH4 A;  3F6V A;  3W2A A;  2F4M B;  3F0C A;  1R1V A;  2QZ8 A;  1X2M A;  4P5O A;  3TGN A;  4L0Z B;  1I6H J;  2M3A A;  1XB4 A;  2VJI A;  2Z2S B;  3UNG C;  2Y2Z A;  3SZG A;  1JJ8 C;  1OYW A;  2LR8 A;  1XMK A;  4PJM A;  2RN7 A;  2M7B A;  3WHC A;  2COB A;  2E5N A;  4C2T A;  3S14 J;  1J75 A;  4DIQ A;  3H1C A;  2GBY A;  1K83 J;  1FIA A;  3TDU C;  1J9I A;  4I09 A;  2X6W A;  3Q9V A;  3SJM A;  4RAF A;  4Q47 A;  3HUG B;  4O6J A;  3GTJ J;  3M1E A;  4CDG A;  3A4C A;  2XAS A;  1U9N A;  2ZBK A;  4AVP A;  2WY8 Q;  4UXN A;  2ECB A;  4L0Y B;  4AVZ A;  3MAJ A;  4UUS A;  2FNA A;  4RB0 A;  2QVO A;  3NWT A;  4M72 A;  3ZPL A;  2A69 F;  3CCY A;  4HF2 A;  5DUI A;  3WTW C;  2CQN A;  1PUF A;  1S7E A;  3OOP A;  5L3C A;  2NS7 A;  2I5U A;  3TP3 A;  1TP4 A;  4KA4 A;  3BZ6 A;  2EZL A;  1KGS A;  2PEX A;  1EJ9 A;  1X3Z B;  3BT9 A;  2FNP A;  5FKL A;  2V9K A;  3E3V A;  4G6D A;  2O8X A;  1UCR A;  2CSO A;  1R5I D;  2DMT A;  1FP1 D;  2DMP A;  2QCO A;  5KK1 A;  5J6X A;  3UKG A;  3NAR A;  5D6F A;  3N97 A;  3K4B A;  3MFK A;  2BHZ A;  4Z2Y A;  1R1T A;  3OL3 A;  4M71 A;  1IV6 A;  3GCM A;  2TRT A;  1RET A;  2X4H A;  4CSW A;  2DO7 A;  4RLF A;  2QLZ A;  4FE7 A;  4Q48 A;  3A03 A;  4P9U A;  3JRE A;  2CUJ A;  4U0W A;  3CCQ I;  2O6G E;  1VFC A;  4QIW N;  3JRA A;  1B9M A;  3PQJ A;  4LIT A;  2MAB A;  2LTP A;  2DT5 A;  5BOX A;  4F3Q A;  4EMS A;  5IYD J;  4KFC A;  2R7D A;  5CLS A;  2M4G A;  4UUT A;  1U8B A;  3IKV A;  3FMS A;  2L7Z A;  2VBW A;  4M9Z A;  3SEQ A;  5KHD A;  2E1M C;  1FBS A;  1FP2 A;  5FLM J;  4M3B A;  2GAU A;  1D1C A;  2RRE A;  5TIS C;  1U3E M;  4N4O B;  3DTI A;  2W00 A;  1V5E A;  2GXG A;  1L3L A;  4LB6 B;  4HNV A;  1YW9 A;  1C0W A;  1SFO J;  5LBQ A;  2KRF A;  3KFW X;  4A3I J;  3GFI A;  2V9P A;  2DA6 A;  2Q8K A;  2F4O B;  1YFH A;  3Q3S A;  3J7A O;  1LFB A;  2HEO A;  3HM5 A;  2YX4 A;  4I02 A;  4EJU A;  4BJ6 C;  2R0Q C;  1FSH A;  1HA8 A;  2A5Y B;  4G6Q A;  4FE4 A;  2EFP A;  4KIC A;  4C2M J;  1WJF A;  2XGE A;  2L7M P;  5GTI C;  3K4K A;  3H5A A;  2FEZ A;  5J1R A;  3HJE A;  3VYT B;  2M9H A;  1U5T B;  1JTY A;  2A3S A;  2F5V A;  4X1E A;  4ZYG A;  4N9I A;  3BQY A;  4HX4 A;  2NNN A;  4ENK A;  4CCK A;  1HQC A;  3I4P A;  2OZ6 A;  4BHB A;  3DU5 A;  2CW0 F;  4MTE A;  4B43 A;  5EYR A;  1YI2 I;  3QYE A;  2OQR A;  5A2Q K;  1EH6 A;  1A6Q A;  4GCV A;  2VJ4 A;  5FRM A;  4M74 A;  2IA0 A;  3KP7 A;  2O3F A;  5J4Y A;  5C4J J;  4J19 A;  2DQR A;  2KRH A;  1ZRE A;  1K78 B;  4EGZ A;  4NQW B;  3DTK A;  1SVL A;  2RVC A;  1FBU A;  2KIU A;  3QPS A;  3BJA A;  5B1A H;  2ECC A;  3KP4 A;  2IP2 A;  3MCZ A;  2XRL A;  5FRO A;  3ZMZ A;  2UXN A;  3FXQ A;  3DP7 A;  5E8I A;  2R7F A;  1T95 A;  1XPX A;  4L9T A;  2OF7 A;  1ZTR A;  2ZCW A;  1VQM I;  1TLH B;  4GXO A;  1BW6 A;  1P7J A;  3GFM A;  1NH3 A;  4IOA F;  1I6X A;  3G1O A;  2B63 J;  4BQN A;  2VJJ A;  3KET A;  2ZXI A;  4IO9 F;  1BM9 A;  2VXZ A;  3RDI A;  3OYE A;  4Y17 A;  1BC7 C;  4LMY A;  5F27 A;  2DDB A;  1X4O A;  4HQM A;  4AYB A;  4HOB A;  2V26 A;  4DYR A;  2IS6 A;  5KCM A;  4EGY A;  1H89 C;  2EA2 A;  5HNH A;  1YS6 A;  2HGC A;  1VQ4 I;  5EJC A;  3HHH A;  2QBY A;  2QKM B;  5FLV A;  1ITY A;  2Q2E A;  2AS5 F;  4C3I J;  1ZRF A;  2BW3 A;  1O57 A;  4HNU A;  1HBX G;  2WAQ A;  1N78 A;  1X3W B;  1UST A;  4WXC A;  4M6Y A;  1IRG A;  1R9T J;  1R49 A;  1V3F A;  3JRF A;  4D0P A;  4B09 A;  4NUB A;  1JKP C;  4IHY A;  2OUM A;  4OAY A;  2P7C B;  3V7R A;  4B44 A;  3PJR A;  3CCV I;  4A3E J;  1R58 A;  2E1N A;  2JT1 A;  1IV8 A;  5M3F J;  2DT6 A;  2OAZ A;  5DUK A;  2PX9 A;  5FGM A;  3V7C A;  1SFE A;  4XRS A;  1AHD P;  1HDD C;  1YE9 A;  2LC2 A;  1IUF A;  1P2F A;  2XVC A;  1W1W E;  3FKI J;  3X2Q H;  5KVR A;  4IHT A;  4EVI A;  3HYI A;  1UG2 A;  4F52 A;  2O8K A;  3E6M A;  2HKO A;  5EDN A;  1JHH A;  2R7V A;  1B9N A;  2N8G A;  2Y30 A;  1X3U A;  2KDO A;  2LD5 A;  4UVA A;  4ETS A;  3PNV A;  2VE9 A;  2EZI A;  2X0L A;  1W7P A;  1SMT A;  3H0G J;  4BJT A;  3BQZ A;  2W24 A;  1Z05 A;  3ZQF A;  4CO8 A;  2R93 J;  4XON A;  3N05 A;  4I6Z A;  2MW8 A;  3FDY A;  3J80 Z;  1P4W A;  5LD2 C;  3EYI A;  4YII A;  1T2K A;  3S2D J;  4U7B A;  4BY7 J;  5GP9 A;  3OSG A;  1OCT C;  2ISZ A;  4CIC A;  1D0Y A;  2R5Z B;  2CW7 A;  2KRC A;  3MD2 A;  4L5I A;  4CYC A;  2KZV A;  4JP0 A;  2WA0 A;  2BY3 A;  3DBH B;  2TDX A;  3I4N J;  1KQ9 A;  1NG6 A;  2E1C A;  3G73 A;  1WJC A;  4PCQ A;  1IXR C;  2ESN A;  5LHI A;  1JI8 A;  1EH7 A;  2JA5 J;  3ZMV A;  3MKZ A;  5L3F A;  1POG A;  5LEJ A;  1VZ0 A;  4EQQ A;  3QOP A;  3LSR A;  4BS9 A;  2WAQ N;  2VXD A;  1OCO H;  1ODD A;  2DLL A;  2BBY A;  2HZT A;  5B66 C;  2P6T A;  2JJ7 A;  5K1Y A;  3A01 B;  3S15 J;  3FBI B;  3ZMT A;  4BAC A;  2E2J J;  4RB1 A;  1ZR4 A;  4WX9 A;  2L5Q A;  2DOD A;  3BZK A;  1G8X A;  3WTZ A;  2E34 A;  1F36 A;  1ZLK A;  2NVT J;  3FK6 A;  1MJB A;  5DCF A;  1T08 B;  1KZH A;  3OMY A;  2NVY J;  2BXZ A;  2UUZ A;  2VQG A;  2EZH A;  3ZQL A;  1ZR2 A;  1TQM A;  2P81 A;  4K2E A;  3OYI A;  4GFB A;  1JTX A;  4F92 B;  1UAA A;  2PMU A;  3FKJ A;  3JRD A;  4I76 A;  1U0J A;  4L9V A;  1ETO A;  5CQG A;  3CDH A;  1SFK A;  2DMN A;  2KKO A;  1Z3Y A;  4IPA A;  2ETH A;  5AIQ A;  2DN0 A;  3KZY A;  5HS7 A;  1X1D A;  3PSI A;  4RM2 A;  3VEP A;  1K61 A;  4HSR A;  2OPT A;  1D0X A;  2CS3 A;  2FSW A;  3QPL A;  1WSU A;  3Q0W A;  3CLQ A;  5F6F A;  1ZAO A;  2AQE A;  2K4B A;  2HDC A;  2IRF G;  4XLC A;  5F1R A;  4YFK F;  5FFZ A;  4GO1 A;  4PUS A;  3S8P A;  3OS1 A;  4FX0 A;  4D9J A;  3DV8 A;  4XMY A;  4E7L A;  2OCE A;  2PLY A;  3E6C C;  2K9S A;  2HQR A;  1YG2 A;  5IT3 A;  4OIO F;  1J09 A;  4Q5S F;  2ZJR F;  1WCM J;  2DOE A;  4B1R A;  1IJW C;  3I4M J;  1B59 A;  4R8H A;  1WJA A;  2WAE A;  3GTK J;  4QTR A;  4P96 A;  2EFQ A;  4BXX J;  3WTV C;  4LK0 F;  1HCR A;  1JUP A;  1F43 A;  2RAE A;  4F55 A;  2UV1 A;  3HRM A;  3C18 A;  3D5S C;  4BUP A;  2W82 A;  4F93 B;  4YRV A;  3CLO A;  2M8E A;  3BR0 A;  5IP6 A;  2MC4 A;  3PFI A;  2E7W A;  2LK2 A;  4ESF A;  2M2E A;  1HLV A;  1DP7 P;  1E2X A;  2HDW A;  3GTM J;  4LLL A;  1QZE A;  2OTJ I;  2YSR A;  3WHB A;  4D1Q A;  3HKZ A;  1K7A A;  5JLW A;  3CCJ I;  1VND A;  3BR3 A;  2Z9O A;  2KIM A;  5LGT A;  2I8D A;  3IP4 B;  4A3J J;  3OIP A;  3LA7 A;  2X85 A;  2XV4 S;  3PNT A;  1MBF A;  2KPM A;  1AOY A;  1XDS A;  1U2W A;  4UB6 C;  1JKR C;  4YFN F;  3IUO A;  1KYW A;  3HSF A;  2MD0 A;  4HRI A;  1H88 C;  5FKO A;  3CJR B;  1S7O A;  5EG0 A;  1XS9 A;  4D7N A;  3GLL A;  4EEF G;  3BG9 A;  2A61 A;  4EV0 A;  1S6L A;  4JQF A;  4LK1 F;  3SEZ A;  2EQR A;  4N4N B;  4CCN A;  2VI6 A;  2XGC A;  5IYC J;  2RNJ A;  4ZYE A;  1DU0 A;  4Y13 A;  5IP7 J;  3KLO A;  4ITV A;  1ZKG A;  4MFD A;  3M3Y J;  1WH7 A;  5HOO A;  5J1Y A;  2YX7 A;  2OA4 A;  1D0Z A;  1TWF J;  3QU6 A;  1OJL A;  2ZC2 A;  2LSO A;  5HDK A;  3F8B A;  1WHU A;  5E3M A;  3A01 A;  1OQY A;  4ZDP A;  3TW7 A;  2O61 A;  2VOD A;  3KIO A;  3CZ6 A;  1ZG1 A;  3V7S A;  1VQK I;  4A69 C;  3WGI A;  4WK8 F;  1ZEL A;  3PM1 A;  1P4A A;  2L54 A;  3HOS A;  3LWF A;  1MBG A;  4NHJ A;  2UXX A;  4RM3 A;  2QYO A;  1E0E A;  4L18 B;  4I2O A;  4OWR B;  5HS8 A;  1YX3 A;  4LOC A;  4E7S A;  1Z7L A;  2HQA A;  3M07 A;  3FX3 A;  1OKR A;  1R4N B;  4U0Y A;  4M73 A;  1W7P B;  3DKW A;  1AU7 A;  3LSK A;  3V8K A;  1J5Y A;  4O5V A;  1YJW I;  4AIK A;  4PSX A;  2CFX A;  2HU9 A;  2X6Y A;  3CCL I;  4QLC U;  4Q4Z F;  3HRU A;  5CVU A;  4DZJ A;  2ZJP F;  2K02 A;  1WFX A;  1BR1 A;  5F0C A;  1M1E B;  4XLP F;  1VQL I;  1WKM A;  1RUO A;  2XKP A;  4YIF A;  3O3K A;  4HX7 A;  2FQ3 A;  4RAG A;  1Q1H A;  1W7P D;  2BEO A;  1FOY A;  2L9N A;  3HTU A;  3HB9 A;  5D8L B;  5D5W B;  1SAX A;  1JT0 A;  4MEX F;  2DA4 A;  2H27 A;  4L5E A;  4DBQ A;  3IAM 2;  1T38 A;  4RAZ A;  1IXS B;  3FM3 A;  1I1G A;  5F1J A;  3M8E A;  3M4O J;  4FIS A;  4BDZ A;  2LKX A;  2ZME B;  2GLO A;  4NC8 A;  4BXU A;  3F8C A;  2H6C A;  1XSV A;  1MJA A;  2EZK A;  1RNL A;  4C2U A;  1WPK A;  3GYH X;  5LEK A;  2WBM A;  4XIC A;  3ELK A;  1W36 C;  1XDU A;  4ZTJ A;  5TRD A;  4G7Z F;  3S1Q J;  4NBQ A;  3L2V A;  4P1W A;  2QSG X;  3CUQ A;  5H6Q A;  3BG3 A;  5DV5 A;  2FJ1 A;  3U1D A;  1FOW A;  1IG7 A;  1V5G A;  2VN2 A;  3KYL A;  4NDL A;  4KDP A;  2FQ4 A;  3A0H C;  2QGU A;  2CRG A;  3C2G A;  4WWC A;  3ZCO A;  4H0E A;  1LEB A;  1IO2 A;  1H8A C;  3DBL B;  3CF2 A;  3PO2 J;  3KE2 A;  1TBX A;  3ZN1 A;  3HTS B;  1GUU A;  1BIB A;  2IS4 A;  3F8M A;  4UUS B;  3HIF A;  2FMY A;  4PK4 A;  3U21 A;  3EYY A;  1UZC A;  3VSK A;  3IV5 A;  2P5K A;  5GAE J;  2QF7 A;  2MLK A;  2FXA A;  1O3R A;  2HYJ A;  3G71 I;  1TC3 C;  3IWZ A;  2QSH X;  1MMS A;  2FRH A;  9ANT A;  1UMQ A;  2ZNY A;  3BTJ A;  1JGS A;  1WZ2 A;  4HAM A;  2STT A;  1SD4 A;  4JX4 A;  3EET A;  3FXJ A;  3V4G A;  1Y8R B;  2BXY A;  3BZC A;  5GPC A;  2DBB A;  2NVU B;  4A5N A;  5DCM B;  1LFP A;  1ETQ A;  4M3G A;  5K5O A;  2CMP A;  3K2Z A;  1YX5 A;  1FOK A;  2OTL I;  1D8K A;  2L9S A;  3WGH A;  4IHX A;  2GWR A;  2E5Z A;  1JT6 A;  4KIS A;  1VQN I;  4N9H A;  4IRH A;  5H2F C;  1Y56 A;  2AXL A;  1V4R A;  4A6D A;  3E1S A;  5BPI A;  1DQU A;  3CP2 A;  1FTT A;  4KYW A;  2P5V A;  2CG4 A;  5EEA A;  1D1B A;  3HGY A;  2RGV A;  3OOU A;  2OU2 A;  2LKP A;  1BR2 A;  3M9A A;  1PP7 U;  3S93 A;  4A3B J;  5HDG A;  2ZME C;  1Y0N A;  3A02 A;  3E5Q A;  1L0O C;  3RQ4 A;  2P0W A;  5F04 A;  5B3S H;  2VBX A;  5DCM A;  1QPM A;  4A6E A;  4U7D A;  2AQF A;  3KZI C;  2EIJ H;  3EUH A;  3RYR A;  2LY1 A;  3ECH A;  2K86 A;  5HLT A;  2K27 A;  2L9R A;  3K1M A;  4DYQ A;  1O3Q A;  2IXS A;  1TTY A;  2VAS A;  3ERM A;  2XHK A;  3HOZ J;  2RQQ A;  3BR5 A;  3T5X A;  4KJZ A;  2Y48 A;  2JN6 A;  5K5R A;  2GIV A;  5AON A;  4EJV A;  5BS6 A;  3WTU C;  3GLX A;  1G59 A;  1NTC A;  1GVD A;  2QKL B;  4V2F A;  3S3M A;  3GTQ J;  2E2I J;  4PJN A;  4W1U A;  1XTA A;  1OPC A;  3AAF A;  2ELK A;  2LVS A;  4MEY F;  3RCO A;  3ZQG A;  1SVM A;  1ENH A;  3W6J B;  2DMQ A;  4CCO A;  2O7O A;  2ZFW A;  4IJA A;  3ABT A;  1V5F A;  3GF2 A;  5D5X B;  3S3N A;  2R7T A;  2VON A;  4IHS A;  4DBR A;  3I55 I;  1A35 A;  2PMZ A;  3M1C A;  3F6O A;  1RUN A;  3K9T A;  3CES A;  5FFX A;  4B4C A;  1EF4 A;  1I3A A;  3AG1 H;  3OR1 C;  3CME I;  1HSJ A;  1OCR H;  3HPH A;  4RB2 C;  2NAZ A;  4N0B A;  4MLO A;  3SZT A;  1X2N A;  2Z1D A;  3JR9 A;  1HXD A;  5CVR A;  4AID A;  1FZP B;  1BI2 A;  2QBY B;  3JTG A;  2FUG 2;  1J2X A;  4F7Z A;  2VUM J;  3HEF A;  1I39 A;  5ICE A;  1J7K A;  4ENJ A;  2XB0 X;  3RKY A;  3ZOB A;  2D1H A;  4MO7 A;  2R5Z A;  2R5Y A;  1WQ2 A;  2IA1 A;  3DKY A;  1FTZ A;  1KQ8 A;  1H0M A;  1IRF A;  2V1D A;  1F9N A;  6PAX A;  2BE5 F;  3RKX A;  2EPF A;  2Y9Z A;  4ZJZ A;  1JKO C;  2KZG A;  1JUS A;  2G7H A;  5CVV A;  3J7Z I;  2O03 A;  1KON A;  3R0J A;  1G3W A;  1LEA A;  4A3C J;  3HRT A;  4QSH A;  2GOM A;  1TWA J;  4OIP F;  1G6N A;  3H9J A;  3VFZ A;  2DXI A;  1RKW A;  1OR7 A;  2BGC A;  3G2B A;  1R71 A;  1RKT A;  1B72 A;  2VPL A;  2PN6 A;  2UZK A;  1SEU A;  2VE8 A;  3BTI A;  3FXK A;  3KLN A;  3TED A;  3MKW B;  2B7E A;  4G6T B;  3NRV A;  1STZ A;  2QUF A;  3S32 A;  1MMA A;  2COM A;  4D5C A;  1ON2 A;  3CMY A;  3S1R J;  1S72 I;  1X19 A;  3GTL J;  2LYC A;  5E79 C;  3H35 A;  3IKT A;  3I3L A;  5EGO B;  2RNG A;  4BHP A;  4KT6 A;  2GXB A;  1U78 A;  4FQG A;  1R1U A;  3H5R A;  4XLF A;  3MWM A;  4ENN A;  5LGN A;  3QP5 A;  3CJN A;  1BOB A;  2IPQ X;  2DFH A;  2CUE A;  2JTV A;  5K5Q A;  3A1Y A; 
#chains in the Genus database with same CATH homology
 1TT0 A;  2KZV A;  3K4M A;  4XN0 A;  2CUZ A;  2WA0 A;  3K4N A;  1MNE A;  3K70 D;  4Y33 A;  4XOR A;  1NG6 A;  4CA0 A;  1SAU A;  4AU7 A;  2HZD A;  2R4G A;  3LSM A;  4BQO A;  1WJC A;  3LMM A;  4CUG A;  4QPQ A;  4E7H A;  1JI8 A;  4HNT A;  2ZSI B;  2HNH A;  3UR3 C;  3MKZ A;  2LH9 A;  3VYR B;  2JVG A;  3ZXS A;  4BE0 A;  1D1A A;  3BG6 A;  4ZTF A;  2R7R A;  3EPZ A;  1VZ0 A;  3QOE A;  5CPR B;  2IS1 A;  4BS9 A;  2VXD A;  3QOD A;  3NWS A;  1P9Q C;  3MKY B;  3FBI B;  4BAC A;  4BE1 A;  3BG7 A;  3OR2 C;  4XQF A;  2HVS A;  2L5Q A;  4DJA A;  1G8X A;  2X1C A;  4FET A;  1UEL B;  3OMY A;  5JHF A;  2UUZ A;  2VQG A;  2K5C A;  3BCB A;  4B3X A;  2CV2 A;  3HC7 A;  1MMG A;  3OYI A;  1MMN A;  2HPM A;  4F92 B;  1UAA A;  3VSL A;  1UG0 A;  3FKJ A;  3RPU D;  1WJE A;  4BEH B;  3L2R A;  4CCL A;  2R7X A;  3VDX A;  2HVR A;  1U0J A;  3K4C A;  4H4K C;  1DGW Y;  4XLA A;  3AL0 B;  2M7A A;  5CQG A;  2L7K A;  3OL4 A;  1SFK A;  2V4J C;  3VYS B;  1Z3Y A;  1X1D A;  2O5R A;  3DKX A;  3F9K A;  3OWT A;  3PSI A;  4RM2 A;  3LSH A;  4HSR A;  4IZZ A;  1D0X A;  2CS3 A;  2JSP A;  2OC6 A;  3BLY A;  1X4P A;  3OYF A;  1WJD A;  5LFA A;  1PYV A;  2AQE A;  4BDY A;  2DT7 B;  4XLC A;  2IS2 A;  4HG2 A;  1MND A;  4PUS A;  3S8P A;  3OS0 A;  3OS1 A;  2CV1 A;  4D9J A;  2VKH A;  3DPU A;  4XMY A;  4BGD A;  2X6X A;  3HOT A;  4E7L A;  5KNL A;  2WY7 Q;  3V42 A;  3DPT A;  1J09 A;  3H0D A;  1W36 D;  1WJA A;  2WAE A;  2XF7 A;  4XNF A;  3BC8 A;  3LSG A;  4IQ4 A;  3SDB A;  1EA3 A;  2MFZ A;  4BU2 A;  3PL8 A;  3L2Q A;  2X1E A;  2HVQ A;  4F55 A;  2UV1 A;  4BUP A;  3OYH A;  3D5S C;  3OYA A;  2W82 A;  4JOM A;  4F93 B;  1MMD A;  2ZFU A;  4YRV A;  2R7Q A;  4R79 A;  4XN3 A;  2MC4 A;  1T0F C;  2KLO A;  4KIT B;  2KP6 A;  3RTR A;  3FHN A;  4HPQ A;  4EAT A;  4BQQ A;  2V1N A;  2VKD A;  2HDW A;  4XKV A;  2E60 A;  2K3P A;  4D1Q A;  3HKZ A;  2NOJ B;  2LRD A;  4PFO A;  2LY2 A;  1GLN A;  2MYS A;  2I8D A;  2Q2E B;  1LVK A;  3IP4 B;  3H9G A;  3IAS 2;  3M8J A;  4E7I A;  3OIP A;  4ZC3 A;  2WAF A;  2DCE A;  3D5L A;  3GBG A;  2X85 A;  4NNJ A;  3PNT A;  2KPM A;  3AL0 C;  2LOO A;  3LSI A;  4YEJ A;  2W7N A;  2VQC A;  4C9Y A;  4LIV A;  3IUO A;  2BVM A;  3QYF A;  2MD0 A;  4HRI A;  5CQE A;  3CJQ B;  3CJR B;  4XM3 A;  4XOT A;  4XOP A;  3SEZ A;  4JQF A;  3DEE A;  4NC7 A;  4N4N B;  4II2 A;  4CCN A;  4F91 B;  3CP8 A;  3L2U A;  3HL2 A;  3DWL E;  3OYD A;  1S9H A;  4XLH A;  3DLA A;  1X1B A;  2CV0 A;  4ITV A;  5HOO A;  4Y3O A;  1BR4 A;  2LG4 A;  1D0Z A;  4HST A;  3K70 C;  4CZC A;  3OYK A;  2R7U A;  3HPG A;  3K10 A;  4E7Z A;  2VL8 A;  3RSN A;  4ZDP A;  2XC7 A;  3H5N A;  4XLE A;  3AKZ A;  4LIU A;  2VIX A;  3CZ6 A;  1DGR M;  1LDK B;  1ERD A;  3PNY A;  1ZEL A;  3OYC A;  3TMO A;  3AFH A;  3K6G A;  3HOS A;  4DGW B;  4XL9 A;  3W2A A;  4RM3 A;  4P5O A;  2M3A A;  2VJI A;  2Z2S B;  1E0E A;  2WAD A;  3UNG C;  3SZG A;  4OWR B;  3OS2 A;  1YX3 A;  4PJM A;  4E7S A;  1Z7L A;  2HQA A;  2M7B A;  3C2H A;  2E5N A;  4C2T A;  4ANJ A;  1N75 A;  2LRE A;  4XKC A;  3D5R C;  3E0J B;  4DIQ A;  3LSK A;  3ZGK A;  2CH0 A;  1K6Y A;  3FBN B;  2L2O A;  5TGT A;  2IGO A;  2XF6 A;  2ZXH A;  2GOX B;  2X6W A;  4PSX A;  2XDV A;  4XKB A;  2HU9 A;  2X6Y A;  3W2W A;  3ZR8 X;  2VQL A;  2W1O A;  3HUG B;  3I9V 2;  4IKF A;  3A4C A;  2VQH A;  1WFX A;  1BR1 A;  4II3 A;  2WY8 Q;  3OY9 A;  4OAZ A;  4AVZ A;  4Y4R A;  3NWT A;  4E7J A;  3TBI A;  3ZRG A;  2L9N A;  2F4I A;  5CKT A;  3LL7 A;  4XR6 A;  4ZYA A;  4RLQ A;  4DBQ A;  3IAM 2;  2DOA A;  3QYB A;  4E4H A;  2XAU A;  2VLA A;  2V9K A;  3ONQ A;  3DU6 A;  4BDZ A;  3OYJ A;  4NC8 A;  4IQJ A;  4X0G A;  1WJB A;  3K4B A;  3OL3 A;  4C2U A;  1QU3 A;  3LFU A;  4CSW A;  4BL0 B;  2WBM A;  4RLF A;  2XF5 A;  4ZTJ A;  1W36 C;  2CUJ A;  3L2V A;  4P1W A;  3KX2 A;  1NG7 A;  3OIQ A;  3DTE A;  2UWM A;  3HG9 A;  4RMN A;  4CCJ A;  2BVL A;  4FAS D;  4LIT A;  1V5G A;  4CH7 A;  3K4J A;  3KYL A;  2MAB A;  1TZL A;  3C2G A;  2JUG A;  3ZCO A;  4F3Q A;  5HNF A;  4CCM A;  2M4G A;  3K4L A;  3CF2 A;  3OYB A;  3VYU B;  2ELJ A;  4ZDO A;  2R7W A;  3DQV C;  2IS4 A;  3SEQ A;  5KHD A;  2K9M A;  4XKW A;  2E1M C;  2R7O A;  4E7K A;  4PK4 A;  3U21 A;  3VSK A;  3KEY A;  3A2K A;  1D1C A;  2RRE A;  4ZDL A;  4N4O B;  3DTI A;  2E1M B;  3BCA A;  2PJR B;  2WB1 A;  2W00 A;  1V5E A;  2LBF B;  2DJI A;  2VJ5 A;  2CFO A;  4QPO A;  1LFP A;  2CMP A;  1YX5 A;  2L9S A;  1N77 A;  2JVH A;  2E5Z A;  1Y6I A;  4KIS A;  4E6K G;  1Y56 A;  1QHG A;  4BJ6 C;  3PSF A;  4LG3 A;  1HA8 A;  2Y0S A;  3E1S A;  1DP3 A;  1R6R A;  1DQU A;  2OV7 A;  1LKX A;  3CP2 A;  1WJF A;  2KHM A;  1D1B A;  2M4K A;  3K4K A;  3OOU A;  3H5A A;  3VYT B;  3OYM A;  1PJR A;  5FRN A;  1BR2 A;  2F5V A;  2BOL A;  2ZSH B;  3MD2 A;  3S93 A;  3RQ4 A;  4J01 A;  4CCK A;  2P0W A;  3W3C A;  1FMV A;  3DU5 A;  4B43 A;  2AQF A;  3QYE A;  3OYN A;  2Q1Z B;  2LY1 A;  5HLT A;  2VJ4 A;  5FRM A;  2IXS A;  4GRI A;  2KQR A;  2VAS A;  2RQQ A;  3EUH C;  4KJZ A;  2PJR A;  2KRH A;  4NQW B;  3DTK A;  3SYT A;  1G59 A;  2QKL B;  4B47 A;  3S3M A;  4C30 A;  3OYL A;  4PJN A;  2V7F A;  2CW8 A;  1IRX A;  5FRO A;  2VB6 A;  4B48 A;  3RCO A;  3MMY B;  2Z16 A;  4CCO A;  1Z3X A;  1T95 A;  3CMM A;  2KMU A;  1V5F A;  3S3N A;  2R7T A;  2K9L A;  3S3O A;  4PSW A;  4DBR A;  4BQN A;  2JA2 A;  2VJJ A;  2PMZ A;  4BEH A;  2M0M A;  3J7A Y;  2A6T A;  1MW7 A;  2ZXI A;  2VXZ A;  3M1C A;  3OYE A;  3OYG A;  2IGK A;  2XSJ C;  3CES A;  1X1C A;  4BJ5 C;  2W4S A;  2A5W A;  3OR1 C;  3HPH A;  1X4O A;  4AYB A;  4MLO A;  2V26 A;  2Z1D A;  4BE2 A;  2IS6 A;  5KCM A;  5HNH A;  5HVQ C;  4DOZ A;  3L2W A;  2FUG 2;  2QKM B;  3EUK L;  2BW3 A;  4HNU A;  1X1A A;  2IGM A;  2WAQ A;  1N78 A;  3VWB A;  3TL4 X;  3H9Q A;  3DKY A;  4NUB A;  2OUM A;  4OAY A;  4B44 A;  4PFP A;  3PJR A;  2R7S A;  4HEA 2;  4ZJZ A;  3PUB A;  2KL4 A;  3EUA A;  2DT6 A;  2V6E A;  1KON A;  3PFY A;  1OLT A;  4U87 A;  1OR7 C;  2GOM A;  2IGN A;  4J00 A;  1YE9 A;  3H9J A;  2LC2 A;  3DPL C;  4YEL A;  1FMW A;  2DXI A;  4IX7 A;  4F52 A;  3G2B A;  2R7V A;  2VPL A;  2F6C A;  2KDO A;  4PJL A;  2HPI A;  1Z21 A;  3PNV A;  3MKW B;  2X1D A;  4G6T B;  4BJT A;  3ZQQ A;  3S32 A;  1QHH D;  1MMA A;  3W2V A;  2LBF A;  4XON A;  3N05 A;  3HXL A;  1X19 A;  5LD2 C;  3FDY A;  2LYC A;  3H35 A;  3I3L A;  2RNG A;  2BW3 B;  4KT6 A;  4PJJ A;  4U7B A;  3H5R A;  1WJ5 A;  4XLF A;  1AA7 A;  1D0Y A;  1BOB A;  2CW7 A;  2X51 A;  2KRC A;  4BXF A;  3A1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...