2W4SA

Novel rna-binding domain in cryptosporidium parvum at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
86
Chain Sequence
DTMESIVLNTIVTGLQKEFIARVIKTIGSQRSLQLYENAMKVENSGGLLTADMSRRKTIGGVFCYLLKQLVAEDQITIQEWNYIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANKYRIN-REPEAT PROTEIN
publication title Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Structural protein
total genus 32
structure length 86
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10258 RNA_GG_bind PHAX RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w4sA00
2XC7A 2W4SA
chains in the Genus database with same CATH superfamily
1WJDA 1LE8B 4QWQA 5LRRA 1E3HA 1SD5A 1YW9A 5KNLA 4S05A 3DPUA 1JKQC 3AKZA 4EJUA 3H92A 3DBRB 3WTXC 2CQQA 3VYTB 3JRHA 5J40A 2HOSA 2LH9A 2WAFA 2VQLA 4QTRA 2XSJC 1IN6A 4BAYA 2EK5A 1GXQA 2BHYA 4NQWB 2BVMA 3P9IA 3QYBA 4G8XA 2CUFA 4NUBA 1MSEC 3S17J 2E1NA 1G8XA 4AUXA 1IN7A 1TT0A 3JREA 1G3TA 2HGCA 3FXOA 3OOPA 1ETKA 4I09A 4PGGA 2HKOA 4YFNF 1GT0C 2BGCA 1WH5A 3CCJI 1J09A 4R79A 2XAUA 3GXOA 1WVRA 5HNFA 4BXFA 1RUOA 3WU0A 5C3EJ 1B8IA 2XKOA 4E7JA 2ZFWA 2LSOA 4GXOA 2XPVA 1OCPA 3C3WA 2FUG2 3IL2A 3U1DA 1F36A 3QYFA 1Z1DA 4DBRA 1Z0XA 4D0PA 1GDTA 1KQ8A 2HYJA 4ANJA 2FMLA 3HSRA 1IZ1A 1X4PA 4IJAA 3ZMZA 1U5TB 2FNPA 4M6VA 1YYVA 2IW5A 2RGVA 4HDUA 1TQPA 3ZRGA 3EYIA 3J81Z 2X0LA 4F7ZA 5D6EA 2DFFA 2A61A 3LQQA 3VYRB 3EUHC 2XB0X 4C3JJ 2LKXA 1QHHD 2QGUA 1YW7A 5IYBJ 3L2VA 2MC3A 2HWVA 3PM1A 4RGXA 2VOPA 2CSOA 1KGSA 2M2EA 2DU9A 1XTAA 4KJZA 5FRMA 2YU3A 5HOOA 3OSGA 1XSVA 1KQ9A 3CCRI 2DQRA 3TOBA 2E2HJ 3TGNA 1Z6TA 2XIGA 1I1GA 2EIJH 3CDHA 5HVQC 1AHDP 4F3QA 3CUQA 4BJTA 3DTIA 3L9FA 2QKLB 3GF2A 3H36A 4MEXF 3HTSB 2IT0A 4KITB 2N8GA 3CF2A 4BACA 1AKHA 2OZUA 3MD2A 3AFHA 1E3OC 1RESA 4EVIA 1QVTA 3ZMUA 3EUAA 4NB5A 5ED4A 2M87A 2QWWA 2R5ZB 1ZLJA 3A02A 3IAM2 4BQAA 1FYKA 4UY8I 2WB1N 3U1KA 2BOLA 2X9DA 1ZH5A 3FWEA 4FX0A 5ICGA 2FEZA 5J8FA 2WV1A 3RYPA 5BNGA 1X58A 1J59A 1ZYRF 3HTUA 4ZDLA 3LSGA 3PIPF 3I71A 1W0TA 4N9HA 4XBFA 3HL2A 3CCMI 3AAFA 2IP2A 5J6XA 1MNDA 4RAGA 4LJZF 1K83J 4NQWA 2AXLA 1JHHA 2CV0A 1K79A 4HEA2 2GIVA 3DBHB 3L09A 4E7IA 2VKVA 4CXFA 1JTYA 1ODDA 3DFGA 4B8XA 5F0HA 4XLCA 1OYYA 4E7ZA 3DLLF 2Y69H 2NRAC 1VQPI 4XORA 1TBXA 1GHCA 4MNUA 1FY7A 2ZMEA 3D5SC 3O8GA 2IS6A 2R7VA 1S7EA 3AL0C 2WWYA 2FD5A 2UUZA 3ABKH 1RPWA 2AXTC 2V26A 4M3GA 4ESBA 2HPMA 2ISYA 2OQRA 3TO9A 1TL8A 5FKOA 4L5EA 4C3IJ 4HA8A 4BDZA 4BQNA 2IS4A 4CA0A 3WTSC 3QP6A 2Z16A 5J8CA 1H9GA 2NOJB 2QQAA 5EEHA 4BJ6C 3K70C 1H0MA 1SAUA 4IRHA 1HDDC 4UNOA 1WH7A 1QQIA 2VBWA 4G6TB 4NNJA 2QBYB 1U5TA 2BY3A 5TRDA 3DU5A 3CP8A 4MTEA 2LF8A 3LA2A 2DMTA 2HYFA 2IS1A 2QM3A 4PFPA 3TDZC 5D6FA 3OYIA 3SZGA 2CRGA 1P92A 1T33A 4IHVA 3QWLA 3E6BA 1B9MA 3J7ZI 5H6RA 1EH7A 2VIXA 1Y1WJ 4BE1A 3OIOA 4HNUA 3GTPJ 4N0BA 5E18F 3ZP5A 3K2ZA 4RB2C 2MGQA 1HF0A 1ETXA 1NHAA 2GA2A 3GLXA 3TO6A 3S1NJ 4L5JA 1WGXA 1ZHFA 3K4CA 1R7JA 3BC8A 1I1SA 4UUTA 3H1CA 4XM3A 4ZYHA 4L18B 3HOWJ 3BJOA 5GP9A 5E1ZB 4G12A 3RKXA 1FSEA 4D9JA 3OR1C 4BKXA 3MQ0A 3JAMZ 3IWZA 2K7LA 3K4JA 4PK4A 2MYSA 5KCMA 2ZXJA 1XSDA 5CYVA 5L3GA 2DDAA 2R5ZA 3S2DJ 5HODA 3MZ8A 4JX5A 1QGPA 3A1YA 3VYSB 4A6DA 3HZJA 3L2UA 1K6OA 1S3JA 2V6CA 4DOZA 1VQKI 4RM2A 4IOAF 2AQEA 2ELJA 1IRFA 3FKIJ 1E17A 2RVCA 3J81K 1R49A 3CDIA 1JI8A 3RKWA 2ZJQF 2EZKA 2B7EA 2LFBA 4I0AA 1OKRA 3F9KA 4G6QA 2DJIA 2JVHA 1ETOA 2PMZN 1ZTRA 2R7XA 1TWFJ 2IRFG 4NBQA 3CUQC 2CW0F 3I4MJ 3RKQA 1QNTA 2LNBA 3KIOA 2A3SA 2AHQA 2HQAA 2PX9A 3I58A 4A3JJ 4Y17A 4M9ZA 3I54A 4IHYA 2DDBA 3C2GA 3PSIA 4CHUA 2HS5A 4CZZA 3QAHA 1LFUP 5FGMA 3M8JA 2JA8J 5F0FA 2BY0A 3FK7A 1BIBA 2KKOA 3SDGA 5M3MJ 4Q47A 2VE8A 3LSIA 3P9KA 2QSHX 3DU6A 2XF7A 2MH2A 1FBQA 2HZDA 2XDVA 3TMOA 1R36A 2K4JA 4OIRF 1FIPA 2L7KA 4XKCA 3HOXJ 4RGRA 1WJFA 2CUJA 2KDOA 3KP2A 3GW2A 2M0CA 1VQ9I 4BHPA 1YW8A 2HOTA 2LDUA 3GZ6A 2VT2A 5E20A 4OIQF 3WHCA 2ZB9A 3M8FA 1I50J 3HOYJ 3FBNB 2DK5A 3F8BA 3BZCA 5DEQA 1PVEA 4B4CA 3ABTA 4UV8A 2HKXA 2E19A 3KEQA 1UMQA 2QBYA 2VXDA 3ZQFA 4BS9A 2O6GE 3O6BB 2JK3A 3VYUB 1HW2A 1LDKB 1I39A 1OR7A 2DMPA 3DCFA 4BBRJ 2A5YB 3T0YA 2VL8A 3DBLB 1YITI 4YIRX 3GVAA 1LNWA 1N78A 2KIMA 1TWCJ 2ZMEC 2D1VA 1J0RA 1M1EB 5ICCA 3IKVA 2MD5A 2ZJ2A 1SD4A 4MIMA 4KA4A 1PP8F 2R7WA 1R23A 1TTYA 3J80K 1A36A 1GVDA 1IXRC 3KP6A 2DA7A 3VPRA 4EM2A 1XMKA 1REPC 4ASNA 1QZZA 2EINH 1HKQA 4LIUA 2CFOA 4RMNA 2W7NA 1YX3A 4XICA 1A04A 1YHQI 3DKWA 3C2HA 3F8CA 4XKWA 3GTGJ 1TP4A 2M34A 2OF7A 4HLYA 3HKZA 3RDIA 2WV0A 3HHGA 1J7KA 2HXIA 2P7VB 1DPUA 1GXPA 3QPSA 4FETA 4HAMA 1Y8QB 3R61A 3CCSI 3VB2A 1IJWC 4YRVA 2H8RA 2YPRA 3EQLF 3KZZA 3H3UA 1S7OA 4NC6A 1T39A 3OYEA 1D8KA 2NVTJ 4KMUX 1K7AA 2WY8Q 4KDPA 2ME6A 2EB7A 2HNHA 4FISA 4KN7X 2NVUB 2ESNA 1FP1D 1MNMC 2DPDA 4UB6C 3ZQQA 4M3DA 1E3PA 1Z67A 3G1LA 4UXNA 2OQGA 4CSWA 1USTA 2DOEA 3PO3J 1P2FA 4IRIA 5IYCJ 2W00A 4R8HA 1HBXG 2A68F 1IRXA 1TNTA 2Y9YA 2OAZA 2V9PA 4F91B 1OJLA 2CUEA 2PLYA 2FNAA 4AU7A 4CCMA 4KIFA 1NG7A 3I3LA 1RUNA 1MMSA 1QZYA 3HIFA 5L3DA 5M3FJ 2HVSA 4IHTA 1IUFA 4HDVA 3KP4A 1R00A 4A12A 1HW5A 2NS8A 3CMYA 5ILSA 5J4VA 1MW7A 5B66C 1FYLA 3FHNA 3ZCOA 4BU2A 3K4KA 4RM3A 2KT0A 2L02A 2E1CA 4MHGA 4Y52J 3BPVA 4P9UA 3REOA 1P7IA 1FYMA 1MBFA 1RI7A 3AG2H 4A6EA 4HNVA 5HLTA 3PJRA 1W1WE 4AIDA 2DAOA 2VQHA 2WAEA 2CG4A 1U9NA 2BY2A 2L7MP 2QKMB 2TDXA 2KP6A 5ILUA 4ZTFA 2HDCA 4O6JA 4CCNA 1UZCA 5H6QA 2PMUA 2Y48A 3K1NA 3VEPA 2X51A 2ZSIB 3BPXA 1KU2A 4FHTA 3ELKA 1SD7A 4PGHA 1I3QJ 2V1XA 2VJ4A 3LAJA 4FT8A 4FE4A 2MLGA 3ECOA 3OYMA 5E79C 2XAHA 3ZQHA 4OINF 1IGNA 2Z5UA 4WX9A 3Q0VA 2BXYA 3IKTA 5D5VB 1O57A 1R22A 1A6QA 1HSTA 3ABLH 1BI3A 3BLYA 3KEOA 2K9MA 3NQOA 5E1WA 2D45A 2ZFUA 1HDPA 3W6VA 2M9HA 3OYDA 4PUSA 1A31A 5EDNA 1I6XA 3BG7A 2QVOA 2E7WA 1XB4A 3CMAI 3F3XA 2RAEA 1YI2I 4NHJA 1VQ4I 1EH8A 2PEXA 2GIZA 2CJJA 2CFXA 1PYVA 1OR7C 1JJ6C 1W5SA 3LFKA 3S2WA 3I4PA 1B6AA 2FQ4A 2LC2A 4ON0A 1D8JA 2IBDA 3H5NA 3CJNA 4PZJA 1FTTA 5BQTA 4M3EA 1GVJA 1FBSA 3F6OA 1JTXA 5H2FC 3F72A 3OOUA 4WK8F 4DYCA 3CCUI 1VTNC 3UNGC 5BOXA 2KRCA 3QPTA 2VN2A 3VOEA 1TWAJ 1Z21A 4MTDA 3DQVC 3BQZA 1W7PD 1ONVA 3ESWB 2P6TA 2DODA 3BG5A 4B44A 1EJ9A 2IS2A 1OYIA 1OCZH 1XCVA 3WU2C 2JTVA 1SC7A 2V79A 2H94A 2VKEA 4IRGA 5IP9J 3OYAA 1LQ1A 3V7CA 1JKPC 2CV1A 2L4AA 2CS3A 2NXNB 3OS2A 3J7AO 3HRMA 4C3HJ 1H88C 4IXAA 2DFEA 2ZCWA 5EGOB 2VOOA 1LJ9A 4OAZA 2X1DA 3LQRA 3NAUA 3CF5F 1BR1A 4A3EJ 2NYXA 2CV2A 2F5EA 4NC7A 4XLFA 2QUFA 4QLCU 2EZHA 1P7JA 4HQEA 2XAJA 3V4GA 1R4NB 4D1QA 4FE7A 1GLNA 1VQNI 4A93J 5CLSA 1ERDA 1EKEA 1S8NA 1LDJA 3FXQA 1O3SA 2DW4A 1AOYA 2DA6A 3PUFA 3D1NI 4NC8A 2EPFA 4BUPA 5KAFC 1FOKA 1YFHA 5JHUA 5LBQA 5KVRA 5EEAA 1X1AA 5DTDA 4RAFA 2ID6A 3ZQ7A 1MH3A 1YS7A 3PIOF 3KZIC 3S1MJ 5CQEA 2RNGA 1IRGA 1I6HJ 4AYBA 2GLOA 1HXDA 2CH0A 1ON1A 1FX7A 1FP2A 4ABZA 1CF7B 4RDUA 1AA7A 1E2XA 3IAS2 4JOMA 4M72A 2DMQA 3HOZJ 1R9TJ 4A0XA 1O7FA 2JUCA 1ORKA 1P4XA 2DMUA 1JE8A 2LG4A 5JHFA 2BYVE 2KLOA 1W36C 3ML6A 1VNDA 5FKNA 1SVLA 4E70A 5ICFA 2HR3A 3SEQA 3U9GA 4E7SA 3ZQLA 2GOMA 2AQFA 2HEOA 5L3BA 1DGRM 1ON2A 1FMVA 5M5XJ 1XMAA 1BW6A 4HZFA 2OBPA 1XMXA 4ZYAA 4XN0A 3GTOJ 2MLKA 3KP5A 2E5NA 3JRFA 2M7BA 3ERED 2VODA 3GFJA 3R6SA 2IGKA 1X19A 2XHKA 2QQ9A 4I0BA 1V5FA 1IN8A 2L9NA 3WTVC 1OCRH 4MEYF 4IF4A 4WF2A 1VQ6I 4ZTJA 1DUXC 2AS5F 3B6AA 3I64A 2R7TA 3ERMA 1S29A 3A01B 2EZIA 3OYLA 1XSXA 3RPUD 2ECCA 5CKTA 4Y15A 1SFEA 4ZH4F 1D5VA 2EZLA 3GFMA 2R5YB 2EWNA 3N05A 2DA1A 1H9TA 1KQ0A 2IA2A 1Z9CA 2Q8KA 4D7NA 1V54H 5DUKA 4F55A 2XROA 2B63J 1ZREA 2RNJA 4ITVA 1NG6A 3CDLA 3C18A 3H9QA 1ITYA 1OCTC 1JT0A 2EH3A 4F92B 2A07F 1RRJA 3C7JA 3E1SA 4HQMA 3GTLJ 3Q0WA 1ETVA 5FD6A 2Z33A 3LSKA 1KU3A 3U21A 3S93A 3TP3A 1X3ZB 3DTEA 1T95A 1YLFA 2OA4A 1WRJA 5EJCA 1U0JA 3JRIA 2ZC2A 3E7LA 4Y4RA 2DFIA 5HLHA 3G6EI 3FDYA 4KIBA 5DCMB 4Y7NJ 1O4XA 4Q48A 4BL0B 4PFOA 5EGOA 2K9NA 3WTUC 3L00A 2GM4A 2EFPA 1W5CC 2OUMA 5LHHA 2FMYA 3IH3A 5FB2A 1RNLA 2RREA 2LK2A 3OYKA 3BQYA 4XLHA 1RKWA 1UG0A 2L9SA 1VF9A 3TO7A 4R1HA 2NS7A 4UHTA 3W3CA 3HC7A 2GWRA 3JSPA 1Y0NA 2R7FA 2ISZA 3IUOA 3S32A 3U2RA 4B1RA 3A4CA 2I5UA 1Y8RB 4GCVA 4IPAA 3E0JB 3DEWA 2HDDA 2RQPA 1USSA 4ZYDA 3OWTA 2YU9J 1HQCA 4BHCA 3BTJA 1YJ9I 4YFKF 3K4MA 2X6YA 1VQ8I 1XGOA 3WGIA 1U6GA 1ZN2A 1D1CA 3MWMA 2FOWA 1CF7A 3CJRB 3WG9A 2VJ5A 4A5MA 1S9HA 3AG4H 3F8FA 1Z7UA 4M73A 3GYHX 4A3BJ 3EYYA 2DXIA 2ZNZA 2PFBA 4W1UA 1UELB 2OTLI 3GTQJ 2JUGA 2QLZA 4A69C 2HPIA 2L2OA 2EFOA 2KIFA 1IAWA 2HYGD 1BI0A 2LY2A 3K4NA 4L9JA 2EA4A 4E7LA 3K1MA 2HQNA 2IXSA 1QRYA 2JN6A 5H20A 1LE8A 2BXZA 3V7SA 5E8IA 1RKTA 4F93B 3FMQA 3LSPA 1TC3C 3N4MA 4ESFA 2XSDC 3CUOA 4CH7A 1IO2A 2VUMJ 5K5OA 4BE0A 3CCEI 4Q4ZF 4M9SA 2O61A 4E7KA 1VQ5I 4A5NA 1T0FC 2VC0A 1X1PA 3ECHA 5FLXK 5CVIA 2M5WA 5IP6A 2KL4A 4BY1J 5FFXA 3P9CA 5D5XB 1D5YA 1U9OA 4B48A 2UXXA 2GQQA 3MN2A 3BTCA 1BC7C 1YX5A 4Q5SF 3GCMA 3LOCA 3DP7A 3HM5A 2EIMH 3RKYA 3J80Z 3A01A 3AG3H 3TQNA 4DBQA 3CTAA 3HBLA 1G3YA 3LMMA 4GO1A 4MGRA 3NARA 2GAUA 3P5JA 1CQTA 2KFDA 5E3LA 3T5XA 1FOYA 2R5YA 2QQ8A 3PNVA 4UVAA 1J75A 2K27A 5L3EA 3S8PA 3M4OJ 2F2EA 3GZNB 3GEZA 4EJWA 2MC4A 5HDNA 1ZARA 3S3NA 4XIDA 3FM3A 4XLPF 2KJBA 3KETA 4DYRA 1IW7F 4H0EA 2DLLA 4FCYA 1OCOH 2MSYA 4BHBA 2Z2SB 4A0YA 5C4JJ 2OCCH 2E1OA 2Q0OA 2A6HF 2HOEA 2L5QA 3WE2A 5DCMA 5IY5H 2XRNA 2W1OA 2HZTA 4M74A 2K9SA 2DJNA 1LDDA 1MBKA 4PSXA 3L1PA 2WTEA 4M6YA 2HI3A 3WHBA 4A3LJ 2ETHA 2KRHA 2O0YA 2DFHA 2XC7A 3GX4X 4FASD 2JVGA 3HEFA 3W6KB 1IV8A 1XGMA 1BC8C 1IG7A 2P5LC 2QA4I 4PDKA 1O7LA 5TJJA 1YIOA 2Y31A 5CQGA 3T8TA 2DA2A 4DZPA 2KHMA 3PUBA 3K4BA 2H8WA 1U2WA 4I01A 3OYFA 3RQIA 3JRBA 2DPUA 2E2IJ 1IN5A 2VBXA 3CJQB 4CO8A 2YR2A 3B02A 3BJAA 2KJCA 5DD8A 4AC0A 2EV6A 4HOBA 4CICA 1JXSA 3HXLA 2L7FP 4U0VA 2P7CB 3OYGA 3F0CA 2KIUA 4ZJZA 4RAZA 3CMMA 5KK1A 1BJZA 2V1NA 3FZVA 3H5AA 3A2KA 4BQOA 2E34A 2JPCA 1GUUA 1TQIA 1UFMA 1ZRFA 2PMHA 1UG2A 2JSPA 5TGTA 1X3WB 3HRUA 2H6BA 1R1TA 1ZGJA 3KPHA 3KP7A 1YE9A 5FO5A 3LA7A 2COMA 3ZOBA 3KX2A 4D5FA 3WG7H 1W0UA 1J9IA 2LOOA 3HOVJ 4H4KC 2PBIA 2KIQA 1ZR2A 4IQJA 3SZPA 1WWXA 2J5OA 2LRDA 3O3KA 1OLTA 3W2VA 3D5LA 2P0WA 3DKXA 1JUPA 1EH6A 2VASA 2F4MB 4RB1A 3OYHA 2V1UA 3F21A 2ZSHB 2IA0A 3CMEI 1T38A 1FMWA 3HKZN 3FXKA 3ONQA 2FF4A 1BBYA 1LVAA 4LITA 2L9RA 1T2KA 1ETYA 3GWZA 4IVNA 3GLLA 2H27A 2EV0A 4XNFA 1BJAA 4HX8A 2LMDA 1PJRA 4XKVA 1QPMA 1Y6IA 2NS0A 2E1MB 1ZELA 2DA4A 2X1EA 4UUSB 1KU7A 4S0HB 2YSRA 3WGHA 2Z9OA 1UCRA 4AM3A 1R5GA 3RI4A 4ZDPA 1WSUA 1BIAA 1OFCX 3NWSA 1R5ID 1WCMJ 3F8NA 3TEDA 4P1WA 2YS9A 4ENNA 2ZO4A 2L9VA 2W25A 1YTYA 2Y30A 3SQNA 1IV6A 5JR3A 2G0EA 2ZXWH 4S04A 4IL6C 3ZN0A 5AONA 2VKHA 4HSTA 2J5PA 4EJVA 3H0DA 1R71A 3F8MA 4DZJA 1PP7U 1XPXA 4B3AA 1U8RA 3EETA 4FX4A 4II3A 4MLOA 4A3IJ 1JUMA 2CW8A 3BDDA 3PQKA 3MKYB 2DI3A 4XSZF 1LB2A 1HOMA 1IDZA 2KZGA 3K69A 4PJLA 3I4NJ 3G71I 1A35A 3TL4X 2MFZA 4LMYA 1K78B 1E0EA 4KFCA 1CGPA 5JVGF 5GPAA 1MGTA 3RCOA 4U7BA 4HLXA 4ENKA 1YO5C 1YRNB 5LHGA 3CC4I 1D1AA 1MIJA 2K9QA 2GXBA 3OYBA 3QP5A 3C2BA 2Z3YA 3DKYA 2NVXJ 4GDFA 2H6CA 3I0TA 4LLGF 3S1QJ 2KMUA 3RZDJ 3HRSA 5D5WB 3CO6C 3B73A 2BZTA 1MMAA 3L7WA 5J1RA 2PQ8A 3JRCA 5LD2C 5BPDA 1GV5A 3ULQB 1U5TC 3GBGA 4EJTA 1B59A 1F1ZA 2P5KA 1HKSA 3LSMA 2LREA 3HDDA 3SFIA 3TW6A 4U0YA 3HUGB 5HDKA 3IRRA 3K4LA 2BVLA 4EGYA 5BMZA 2IGMA 2BEOA 2OV7A 2XV4S 2DTZA 4DYQA 2W4SA 4Z2YA 2V1DA 5JVTA 1FEXA 2DOAA 2K02A 4HSRA 4O5VA 4P5OA 1X2NA 1SFKA 1YIJI 3KEYA 2JPBA 4IHWA 4N4NB 4U88A 3JSOA 1FLIA 2R7QA 2E71A 3S3OA 2K9LA 3HPHA 4ZYGA 1KYZA 5LHIA 5BS6A 3CC2I 2I10A 1MNEA 4A2UA 2X1CA 2ACJA 2F5CA 4XQFA 3SHFA 1K61A 2LYCA 3C1DA 3TKYA 1BN5A 4GFBA 2MH9A 4OIOF 1K6YA 2K40A 2DK8A 2ME0A 2R7DA 3MKWB 1ZK8A 2LBFB 4N9IA 3HRTA 3TBIA 5E17F 4JYKA 5KHDA 2STWA 3PSFA 1A6IA 4FTHA 4MFDA 4UUSA 3E6MA 1SD6A 3LL7A 3G3ZA 1V5GA 4HX4A 4PJJA 3MAJA 3E5XA 3ZPLA 3QYEA 5J1UA 3G2BA 5IT9K 1MDMB 3BG9A 3DF8A 5IT3A 2FBIA 5AIPA 4I6ZA 2NVYJ 2HVQA 2VQCA 4V19K 5B1AH 1N25A 3GTMJ 3ASNH 5F1JA 3UKGA 2FJ1A 1W7PB 4JP0A 3I5UA 1PUFB 2V4JC 3OIQA 2YX4A 3CLOA 4X1EA 1R1UA 3VFZA 2E7XA 2V7FA 5DM6F 2W48A 2OCEA 1TWGJ 1DU6A 3JR9A 2P5VA 5M5WJ 2STTA 5E3MA 3ZQCA 1RC9A 4HX7A 4GRIA 1K78A 1BOBA 1U8BA 2GXGA 4XLNF 3IV5A 1S7AA 1OMIA 2EV5A 3BT9A 3CCVI 5K7HA 1KYWA 1YRNA 1TW3A 4QPQA 2QSFX 3X2QH 1HLVA 4M9XA 1G3SA 2OU2A 2CW7A 2G7HA 5GPCA 1ZLKA 2O8KA 5LGNA 2H1KA 1JHFA 2L54A 3IWFA 4HF2A 1IN4A 1BR4A 4WXHA 3ZN1A 2DT7B 3ASOH 2FBHA 3ISPA 2LTPA 4G94A 1YS6A 4I76A 2Y2ZA 3VWBA 1XC5A 4K2EA 4AYBN 3AL0B 4DQ2A 2FA5A 2VBZA 3R0JA 1V4RA 3N97A 2XRLA 1HW1A 2ELHA 4OIPF 3SZTA 2VQGA 3VSLA 3HUGA 1DPRA 3OL4A 2LR8A 3CCQI 1VQLI 3OSFA 3SFZA 5K5QA 2P6SA 5EF6A 1H89C 4KICA 2MBFA 2R92J 1MBJA 3V7RA 3QRFF 1F4KA 4IKFA 2CO5A 5HS9A 4UB8C 3E97A 4OWRB 4XSXF 3KYLA 4QSHA 2ESHA 2K3PA 4LIVA 5E8GA 4DGWB 5E3NA 3GMEA 5LEKA 3EUHA 3KLNA 4XOTA 2V6EA 5JLXA 3E6DA 5F1RA 2VT3A 1JJ8C 2LKPA 4W97A 1ZG5A 3PO2J 4QPOA 1QVUA 1YJNI 2WADA 4FQGA 2ECBA 2IGNA 2W57A 4HF1A 1ETWA 3KCCA 1NK2P 3BTLA 1SVMA 2F4IA 2RDPA 3FMSA 2K4BA 2R7OA 5FLXZ 4LLLA 4ETSA 3HGGA 4OAYA 4U7DA 4XRSG 1P4WA 2P8TA 5GAEJ 3GTKJ 4PJMA 2K5CA 1MDMA 2CUZA 1BL0A 4KNYA 3G1MA 3FXLA 2B0LA 1XD7A 3LA3A 1BM9A 2BY1A 5DS9A 1XGNA 2M30A 1SEUA 1FSHA 3BR2A 3FIWA 2DYSH 4LK0F 3B6CA 2BBYA 1O3QA 2Y0MA 2A6EF 5EZGA 3ZMSA 1W7PA 3JTHA 3K7AJ 2MD0A 3E6CC 1B72B 2Z1DA 1R58A 5B1BH 2Z99A 4ESJA 2YX7A 1HA8A 1HSJA 5DUIA 3JW4A 1XS9A 1JKOC 4ZDOA 3UR3C 5LRSA 1P9QC 1JGGA 1X1BA 2E1MC 3O8HA 2AO9A 1Z3YA 4D7MA 2F5FA 5DCFA 5CVVA 3WODF 5JFRA 2W82A 3H0GJ 1FOWA 4XRMA 3I55I 1FJLA 3HYIA 4CCKA 1TT5B 4CUGA 5IP7J 2R7ZJ 2FSWA 3T8RA 4XL9A 1ZAOA 2OJED 2XKPA 4Y3OA 3ZQGA 2E60A 3RQ4A 1Y56A 1O3TA 1RR7A 2E35A 4EMSA 2XPUA 4AIHA 2VI6A 4LGWA 4GGGA 2M3AA 4IO9F 1MBHA 2XPWA 2LY1A 4O3MA 5FKKA 1R1VA 1ZGAA 1EF4A 1FC3A 3DLAA 1QPIA 3BR5A 4D5CA 3SJMA 1B9NA 4OMZA 1RETA 1WI3A 1Y0UA 1VQOI 1F9NA 4KT6A 3RYRA 2VJJA 4BYYA 1QO0D 1Y39A 2ZKZA 3JTGA 1VQMI 3PNYA 4EEFG 3I56I 1MMDA 1Z6RA 2R3SA 1EA3A 4IEJA 3CC7I 2NVQJ 5ICEA 3FMRA 2VONA 2VPLA 1WPKA 4A3KJ 2RKHA 1T08B 2LLKA 2GZWA 2CQXA 5EYRA 1MJBA 3IC7A 3KE2A 4BY7J 2DT5A 4XRSA 1F43A 3G4SI 2M1BA 2O7OA 3LSRA 1DP3A 4QIWN 3L2RA 3EDPA 1HKTA 1S5LC 3V8LA 4Y33A 4M6XA 5A2QK 2W85A 2O8XA 1FOXA 1T56A 2WC2A 2FBKA 4LK1F 2LD5A 2M7AA 1O3RA 1RIOH 5GAGJ 1R5HA 2XASA 4J00A 3QU3A 1RZ4A 1JUSA 2ZMEB 5HLGA 1FWZA 4WCGA 4J01A 2BE5F 3LFUA 1P4AA 4XONA 3RTRA 4I02A 4M3BA 2X6WA 2BHZA 1ULYA 1BA5A 1F5TA 2NAZA 4RGSA 3FXMA 4XLEA 2EIKH 3QPHA 4KISA 3CD6I 4BE2A 3GFLA 5LLQA 3E5UA 3RPUA 2Q2EB 1LFBA 4NDLA 2EA2A 3BR3A 2KRFA 3KYDB 2ZXIA 4KT5C 4E4HA 5ILVA 1JT6A 4IHSA 3PL8A 5CVUA 2LKSA 3W2WA 4CYCB 3K2AA 3KZYA 1G3WA 3JRAA 1FTZA 3ZQIA 3J7AY 3RZOJ 3OYNA 1XGSA 4WXCA 5FLMJ 4P55A 1SAXA 3OR2C 1U3EM 1LFPA 3BOQA 2M8EA 4A3GJ 2ZJPF 3DXJF 3MVPA 4Y13A 2KPMA 1TQMA 3SXYA 1B72A 2UXNA 4LG3A 2Y9ZA 3NWTA 2KQRA 3FBIB 4I7HA 1D3YA 1BW5A 1UHWA 2X85A 3HSEA 2O3FA 5J4YA 4BJ5C 2UWMA 2WA0A 9ANTA 3BP8A 5B3SH 1PDNC 3K6GA 4GYGA 2OTJI 4LD5A 4BEHB 2DBBA 3COAC 2ICWG 4RLFA 2DYRH 5F27A 4V2FA 2EILH 3GUDA 2M8GX 5B5EC 5FROA 3QQAA 5EEGA 3ABMH 1MJ9A 2EBIA 1T98A 3ZGKA 1D1BA 2VXZA 1ZG1A 1MMNA 4BNCA 4TV7A 1L3LA 5E3OA 4CCOA 4XMYA 2YUSA 3QPLA 4RA2A 4U0WA 3S16J 2HFHA 3CP2A 5M5YJ 2RQQA 2JA5J 3H35A 4IQ4A 2WAQN 3ZMDA 5L3CA 3KFWX 3HOTA 5IOZA 3O2PE 2CGPA 1WJAA 3OIPA 4OOIA 3OL3A 4J19A 4PJNA 3MKLA 2JA6J 1Z7LA 1X1DA 4HG2A 1TNSA 3FKJA 3EUKL 3PNTA 4U87A 5CVJA 4DIQA 3BR6A 4CYDA 4RBOA 3IHUA 2QSGX 5GADJ 1WZ2A 4YIFA 5EZHA 3M9AA 3ABUA 3ZXSA 2EFWA 1XX5A 2ELKA 2VKDA 3OV8A 4HPQA 1BOAA 1IXCA 4YFXF 4CDGA 2ZBKA 3FK6A 2WY7Q 4YG2F 4LLNA 3CO7C 5BPIA 1SMYF 4PCQA 3S14J 4MFEA 2A69F 3GTJJ 2QYOA 3Q9SA 3OS0A 5HS7A 1S72I 2OPTA 2EFNA 2MABA 5HDGA 2Q2EA 1R4MB 3LNQA 3WTTC 4MO7A 4P96A 3RPQA 4ZC3A 4RAYA 3BJ6A 4BH9A 4BDYA 4II2A 2X48A 4CYCA 5DM7F 2PJPA 3HSFA 4ENMA 3CESA 4UV9A 3CLQA 3KLOA 4RB0A 4EQQA 5JI6A 2GXAA 4A3MJ 3QU6A 3S15J 1G2HA 1MD0A 1V3FA 4UVBA 4KMFA 4BXXJ 1B4AA 2DCEA 4HRIA 2XF5A 2MG4A 4BQQA 5CJ9A 5GTHC 4UUVA 2WAQA 1AU7A 5CPRB 2WB1A 3D5RC 4LB6B 1Q1VA 4LB5A 3OMYA 2QENA 3R60A 2L3DA 5FKLA 5IT9Z 3BG3A 1J5YA 2HTJA 1TZLA 1WJBA 1R6RA 4BEHA 1N75A 4XR6A 1IDYA 3RIRA 2XAGA 4C2UA 3MMYB 2KZVA 3CQZJ 1JGSA 3H5RA 4A0ZA 1N77A 3MFKA 2IGOA 4RLQA 2DQLA 1NTCA 4C9YA 3JRGA 1FPQA 4I2OA 5F08A 1S6LA 3KYCB 1X4OA 3A0BC 3QODA 3IRQA 3BCAA 3G73A 1MBGA 2DO7A 2VC1A 3L2CA 2M0MA 3DTKA 3MZYA 3QOPA 4E7HA 2D5VA 1POGA 4CGZA 1ZRDA 2HOAA 1RR8C 1IC8A 2XAFA 1LEAA 2V9VA 2HVRA 2JRMA 1SFOJ 2JZYA 4RGUA 4YELA 4YEJA 3VDXA 5L3FA 2GBYA 1Z77A 2XGDA 1UB9A 2JA7J 4G7ZF 3ROUA 1HC8A 1KZHA 2IJLA 3G1OA 1C0WA 4A3CJ 1FIAA 2PG4A 1KA8A 3T1BA 4BBSJ 1DQUA 2HU9A 1WKMA 2PI0A 2QCOA 2ZJRF 2PJRB 5C44J 4HV6A 5D8LB 1UHMA 2FE3A 1APLC 1SVOA 1VQ7I 2R4GA 1NK3P 5HNHA 2I8DA 1W5TA 2F5VA 3PFIA 3H9JA 2UV1A 3R0AA 3WE3A 2QEXI 3GFIA 4WWCA 2E2JJ 3HPGA 4EATA 1I3AA 2XGCA 2XAQA 2A6TA 3V42A 3H3VK 3Q0UA 1WQ2A 3BR1A 4BXUA 2XGXA 4HNTA 1OQYA 2L01A 5HLIA 1WHUA 3HGYA 2L7ZA 3CCLI 3MCZA 4ZYEA 1V5EA 3OS1A 1FT9A 4G7OF 1ZGWA 3JCUC 2O03A 3GZ5A 5F0CA 2CYYA 4UVCA 4KIGA 1YG2A 2CWEA 2H09A 2PN6A 1ACIA 2DA5A 5CVRA 3E5QA 2IAIA 4AWXB 4HV5A 3OY9A 5E1XA 4F52A 2NNYA 1OISA 2P81A 1WI9A 2GA1A 2RN7A 1Z05A 3W6JB 3DPTA 4GYIA 1MJAA 5DV5A 2QZ8A 2CQKA 1YJWI 3FXRA 2B9SA 1LVKA 4HYEA 2W84A 4KYWA 1IUYA 5GAHJ 2XUBA 4EGZA 5JLWA 1AWCA 4KUMA 2L4MA 2JT1A 5K7ZA 3M3YJ 1BI1A 2QF7A 5LEJA 3DEEA 4JX6A 3IP4B 4RS8A 3L2QA 3R4KA 4M3FA 4ZZLA 4G9YA 2HQRA 2KDZA 3ZMTA 1KONA 3A0HC 3LSTA 3HG9A 4XLAA 4DJAA 3I59B 4XKBA 4E6KG 1U78A 3LWFA 4C2TA 1H8AC 3GO5A 5LFAA 3WGGA 2L0KA 4PJ0C 1MH4A 3LSHA 2LF7A 5J3LA 1DP7P 2LY9A 4C30A 2Y75A 2X6OA 4BGDA 3Q5FA 2BW3B 2R7RA 2CU7A 4ZZDA 2XB5A 2R0QC 1T8IA 4IOCF 2PMZA 2OZ6A 4KN4X 1HCRA 1TWHJ 2ADUA 2HXOA 3FM5A 4V2GA 5D5UB 3LAPA 5J1YA 2M4GA 4MQVA 2ZNYA 1YOVB 2FXAA 5IYDJ 4XN3A 4AVZA 1L0OC 2E36A 2EJRA 2FQ3A 5F6FA 5D4RA 1WJEA 3V8JA 5FKMA 3TDUC 2HTSA 3FISA 2JRTA 3Q3SA 3BY6A 1W36D 2NOGA 5FJ8J 2XGEA 3P7NA 2C6YA 3VSKA 1WFXA 4CCJA 2TRTA 4G6DA 1JKRC 2A5WA 2DMNA 1GV2A 1VI0A 2F4OB 2GOXB 1G4DA 1MKMA 2JA2A 4MQ9F 5EG0B 2F6CA 4WXDA 3FXJA 5DD4A 1ZKGA 1SANA 3JRDA 3VODA 2PJRA 2KISA 4LG0B 4B47A 1EV7A 2OC6A 1DGWY 1STZA 2LP0A 2F5DA 3S3MA 3WTZA 2OD5A 5F64A 3K9TA 2JQ7A 1ENHA 2TCTA 3M7GA 5FD5A 2VB6A 1V55H 4I99C 1LEBA 2X4HA 1VFCA 2A05A 2M45A 1UAAA 2EFQA 5FLVA 1BI2A 1LPQA 5D4SA 1TW2A 1IXSB 3WTYC 1WJ5A 4AD9A 3K0LA 5FRNA 4HBLA 1ZRCA 1MSFC 4XK4A 3JAMK 4IX7A 3E3VA 5FFZA 2LVSA 3F23A 1X2MA 2JMWA 3FXUA 3S1RJ 1UJ8A 4ENJA 1QZEA 5A2QZ 3BROA 4PSWA 3BZ6A 2H1LA 2V9KA 2G9WA 3BZKA 3V8KA 2CQNA 2RV8A 2K85A 3AG1H 2BV6A 1WJCA 3WTWC 2HQ5A 3D0SA 3OYCA 1P6RA 2Y0SN 3F22A 5D8KB 1OPCA 1B1BA 3M07A 3NEUA 4A3FJ 3J7YJ 2FU4A 4L0ZB 4HW0A 3MEXA 2E5ZA 3FX3A 1XG1A 3M8EA 2FOKA 2F48A 4B43A 4EV0A 1OCCH 3I59A 1Z3XA 1X1CA 3H9GA 3IH2A 4IHXA 5AIQA 2XVCA 1ZR4A 1Y1VJ 2VE9A 3KP3A 1W4MA 1ETQA 5K1YA 1YQAA 4M71A 1QHGA 4L0YB 2R93J 2ZXHA 2VLAA 5IOYA 3M1CA 2R7UA 4IZZA 1TLHB 2BW3A 1I5ZA 1X3UA 4AVPA 5TISC 3RSNA 2CMPA 3I9V2 1NH3A 1FNNA 4DW6A 3EPZA 5HS8A 2O9LA 3BWGA 2K86A 3K10A 4X0GA 3IH4A 4CCLA 2D1HA 2XF6A 4JK1X 2FX0A 5ERIA 3MKZA 2IA1A 2EQRA 5GTIC 2R7SA 1XDSA 2K3FA 4CZCA 2RC4A 5LGTA 1MZBA 2DA3A 2IPQX 1MBEA 1SFUA 1BR2A 3HJEA 6PAXA 2IEKA 1MMGA 3DV8A 1QBJA 5IPAA 1G59A 3DPLC 4AIKA 1B8IB 2CQ7A 1XDUA 3BTIA 1A5JA 3PQJA 2JSCA 3MZHA 2MA3A 2G7UA 2LBFA 3BR0A 1DDNA 3FHZA 2D2WA 1QA6A 1XCBA 1D0XA 1Q1HA 3BG6A 1D0YA 3M1EA 5EG0A 4A3DJ 3NRVA 4LOCA 4LFUA 5K7FA 5K5RA 4I98B 4YIIA 1FZPB 4N4OB 5LGUA 2JWTA 1ZQ3P 2O5RA 4LG0A 1VZ0A 3CJTB 3K1PA 1T6SA 2DT6A 4XOPA 2VBYA 1UHSA 4P9FA 4JQFA 3SDBA 1G6NA 1XN7A 3ZR8X 3L2WA 2Q1ZB 2Y0SA 1IRZA 4OMYA 4L9NA 1ZG3A 4B09A 4L9VA 4EM0B 2COBA 2DN0A 4JBAA 1J2XA 1Z91A 2DTRA 2WBMA 1K4TA 2IVMA 1PUFA 3BCBA 3RJPA 5F04A 1FBUA 3LSJA 4X6AJ 3FF5A 3Q9VA 1QU3A 2NNNA 4OU0A 4B3XA 3WU1B 4C2MJ 3H3ZA 1D0ZA 3SYTA 1SMTA 3A03A 1PUEE 3TP0A 2DOFA 4EJOA 2W24A 3HB9A 3HOUJ 1T0FA 1LKXA 5DDGA 3TW7A 2FRHA 3ZMVA 4HF0A 3DEUA 3K70D 3S2HJ 3CUQB 3I53A 4DNCA 3CCYA 2MW8A 4RB3C 1I27A 1KU9A 1LUJB 2VJIA 3QOEA 1AKHB 1SFXA 5DYMA 4L9TA 3CZ6A 2HDWA 3PFYA 3DWLE 3F6VA 4XRFA 5KAIC 1IF1A 4AIJA 2X6XA 2M4KA 3HOSA 4G7HF 3W2AA 1OYWA 2P4WA 4EM1A 4JX4A 3HHHA 5J47A 2ID3A 4L5IA 5C4XJ 1K4SA 3SEZA 4Z6YA 3OYJA 2VPRA 2JJ7A 1DU0A 2QQBA 2UZKA 3TOAA
chains in the Genus database with same CATH topology
1WJDA 2X51A 2ZSIB 2VKHA 5KNLA 4HSTA 3DPUA 3H0DA 3AKZA 2VJ4A 3VYTB 3ZXSA 3OYMA 4HPQA 2VKDA 2LH9A 4II3A 4MLOA 2CW8A 2WAFA 2VQLA 2XSJC 3MKYB 4NQWB 2BVMA 4PJLA 3QYBA 2WY7Q 3TL4X 2MFZA 3BLYA 1E0EA 4NUBA 2K9MA 2ZFUA 3RCOA 4U7BA 3OS0A 3OYDA 1D1AA 1G8XA 4PUSA 3OYBA 1TT0A 2MABA 3BG7A 3DKYA 1J09A 2KMUA 2XAUA 4R79A 4ZC3A 5HNFA 4BXFA 1PYVA 1OR7C 4BDYA 4II2A 1MMAA 4E7JA 2LC2A 3CESA 5LD2C 2FUG2 3H5NA 3GBGA 3QYFA 4DBRA 3LSMA 2LREA 2DCEA 4HRIA 3OOUA 3HUGB 2XF5A 4ANJA 3K4LA 2BVLA 4BQQA 1X4PA 2IGMA 2OV7A 3UNGC 2KRCA 2WAQA 5CPRB 2WB1A 1Z21A 3D5RC 2W4SA 2DOAA 4HSRA 3DQVC 3OMYA 3ZRGA 4B44A 2IS2A 4P5OA 1SFKA 1TZLA 3KEYA 3OYAA 3VYRB 1WJBA 3EUHC 1R6RA 1QHHD 4N4NB 4BEHA 1N75A 2CS3A 4XR6A 3OS2A 2R7QA 3L2VA 2CV1A 4C2UA 3S3OA 3MMYB 2KZVA 3H5RA 2K9LA 3HPHA 4OAZA 1MNEA 2X1DA 1N77A 2IGOA 4RLQA 4KJZA 4C9YA 5FRMA 2X1CA 4XQFA 5HOOA 1BR1A 2LYCA 2CV2A 4NC7A 1X4OA 4XLFA 3QODA 3BCAA 1K6YA 4D1QA 3MKWB 2M0MA 1GLNA 3DTKA 4E7HA 5HVQC 2LBFB 1ERDA 3TBIA 4F3QA 4NC8A 4BJTA 3DTIA 5KHDA 2QKLB 3PSFA 4BUPA 2HVRA 4KITB 3CF2A 4BACA 4YELA 3LL7A 4YEJA 1X1AA 3MD2A 1V5GA 3AFHA 3VDXA 3EUAA 4PJJA 3QYEA 3G2BA 3IAM2 5CQEA 2RNGA 4AYBA 1DQUA 2CH0A 2BOLA 2HU9A 1AA7A 2HVQA 2VQCA 2PJRB 3IAS2 4JOMA 2R4GA 5HNHA 4ZDLA 2I8DA 3LSGA 2F5VA 3H9JA 2UV1A 2LG4A 5JHFA 2KLOA 1W36C 3HL2A 2V4JC 3OIQA 3HPGA 3SEQA 4EATA 4E7SA 2GOMA 2AQFA 2V7FA 3V42A 2A6TA 1DGRM 1FMVA 4HNTA 1MNDA 4ZYAA 4XN0A 2E5NA 2M7BA 2CV0A 1V5EA 4HEA2 4E7IA 3OS1A 4GRIA 1BOBA 2IGKA 1X19A 4XLCA 4E7ZA 3OY9A 4F52A 4QPQA 1V5FA 4XORA 2L9NA 3DPTA 3D5SC 2CW7A 4ZTJA 2IS6A 2R7VA 3AL0C 2R7TA 1LVKA 1BR4A 2UUZA 2DT7B 3OYLA 3RPUD 2V26A 5CKTA 2HPMA 3VWBA 3N05A 3AL0B 4BDZA 4BQNA 2IS4A 3DEEA 4CA0A 3IP4B 3L2QA 2Z16A 4F55A 2NOJB 2VQGA 4ITVA 3VSLA 1NG6A 3H9QA 1KONA 4BJ6C 3K70C 1SAUA 4XLAA 3HG9A 4F92B 4DJAA 3OL4A 4G6TB 4XKBA 4NNJA 3E1SA 4E6KG 4C2TA 3DU5A 3CP8A 5LFAA 3LSKA 3U21A 3S93A 3DTEA 1T95A 2IS1A 4PFPA 3LSHA 3OYIA 3SZGA 1U0JA 4C30A 4BGDA 2BW3B 4Y4RA 2R7RA 4IKFA 3FDYA 4OWRB 4BL0B 2PMZA 4PFOA 2VIXA 3KYLA 2K3PA 4LIVA 4DGWB 4BE1A 2OUMA 4HNUA 4XOTA 2V6EA 2M4GA 2RREA 3OYKA 4XN3A 4QPOA 4XLHA 2WADA 4AVZA 1UG0A 2L9SA 1WJEA 3W3CA 3HC7A 2IGNA 1W36D 3IUOA 3S32A 3K4CA 2F4IA 3A4CA 3BC8A 3VSKA 1WFXA 4CCJA 4XM3A 2A5WA 3E0JB 2R7OA 4OAYA 3OWTA 4D9JA 3OR1C 2GOXB 3K4JA 4PK4A 3K4MA 2JA2A 2MYSA 4PJMA 2K5CA 5KCMA 2CUZA 2F6CA 2X6YA 3A1YA 3VYSB 1D1CA 3L2UA 3CJRB 2PJRA 2VJ5A 4DOZA 1S9HA 4RM2A 2AQEA 2ELJA 4B47A 2OC6A 1DGWY 2DXIA 3S3MA 1UELB 2MD0A 2JUGA 2Z1DA 1JI8A 2HPIA 3F9KA 1HA8A 2L2OA 2DJIA 2JVHA 4ZDOA 2LY2A 3K4NA 3UR3C 2R7XA 4E7LA 1P9QC 2IXSA 1X1BA 2VB6A 4F93B 2E1MC 2HQAA 4CH7A 1Z3YA 4BE0A 4E7KA 3C2GA 3PSIA 2W82A 1UAAA 1T0FC 4CCKA 4CUGA 1WJ5A 5FRNA 3M8JA 4XL9A 2KL4A 4Y3OA 2E60A 4IX7A 3RQ4A 1Y56A 3LSIA 4B48A 3DU6A 2XF7A 1YX5A 2HZDA 4PSWA 2XDVA 2V9KA 3TMOA 2M3AA 2L7KA 4XKCA 4DBQA 2LY1A 3LMMA 3DLAA 1WJFA 2CUJA 1WJCA 2KDOA 3OYCA 3PNVA 4KT6A 3S8PA 2E5ZA 2VJJA 3FBNB 3PNYA 1MMDA 2MC4A 4B43A 1EA3A 3S3NA 2VPLA 1Z3XA 1X1CA 3H9GA 2VXDA 4BS9A 3VYUB 1LDKB 1QHGA 2VL8A 2Z2SB 2ZXHA 2VLAA 1N78A 3M1CA 1DP3A 2R7UA 3L2RA 4IZZA 2BW3A 2L5QA 3RSNA 2CMPA 3I9V2 4Y33A 2R7WA 2W1OA 3EPZA 2M7AA 4PSXA 4J00A 3K10A 4X0GA 4J01A 4LIUA 4CCLA 3LFUA 2CFOA 2XF6A 4RMNA 2W7NA 4XONA 1YX3A 3MKZA 3RTRA 2KRHA 2X6WA 2XC7A 4FASD 2JVGA 2R7SA 4CZCA 3C2HA 4XKWA 4XLEA 3HKZA 4KISA 5CQGA 4BE2A 1BR2A 2KHMA 2Q2EB 3K4BA 3PUBA 3OYFA 1MMGA 4E4HA 2ZXIA 4FETA 3CJQB 1G59A 3DPLC 3PL8A 3W2WA 4YRVA 2LBFA 3J7AY 1D0XA 3HXLA 3BG6A 3OYEA 1D0YA 2WY8Q 3OYGA 3OYNA 4ZJZA 2HNHA 3OR2C 1LFPA 3CMMA 2V1NA 3H5AA 3A2KA 4N4OB 4BQOA 2O5RA 3ZQQA 1VZ0A 2KPMA 2JSPA 5TGTA 2DT6A 4XOPA 4CSWA 4LG3A 3NWTA 2KQRA 3FBIB 4JQFA 2W00A 3SDBA 3ZR8X 1YE9A 1IRXA 2X85A 2Q1ZB 2Y0SA 3L2WA 4BJ5C 2UWMA 3KX2A 2LOOA 2WA0A 4H4KC 4F91B 4IQJA 3K6GA 2WBMA 2LRDA 4BEHB 1OLTA 3W2VA 3D5LA 2P0WA 3DKXA 4AU7A 4RLFA 2VASA 4CCMA 1NG7A 3BCBA 3I3LA 3OYHA 2ZSHB 2HVSA 5FROA 1FMWA 1QU3A 4B3XA 3ONQA 1D0ZA 3SYTA 4LITA 3ZGKA 1D1BA 2VXZA 1MMNA 1MW7A 1LKXA 4XNFA 3FHNA 4XKVA 4CCOA 1PJRA 4XMYA 3K70D 3ZCOA 4BU2A 3K4KA 4RM3A 1Y6IA 3CP2A 2E1MB 1ZELA 2RQQA 2X1EA 3H35A 4IQ4A 2VJIA 3QOEA 3CZ6A 2HDWA 3PFYA 3DWLE 5HLTA 3HOTA 3PJRA 2X6XA 2M4KA 1WJAA 3OIPA 4ZDPA 3HOSA 3OL3A 3W2AA 2VQHA 3NWSA 2WAEA 4P1WA 4PJNA 1Z7LA 1X1DA 2QKMB 4HG2A 3FKJA 2KP6A 3SEZA 3EUKL 3PNTA 4ZTFA 3OYJA 4U87A 4DIQA 4CCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XC7 A;  2W4S A; 
#chains in the Genus database with same CATH topology
 1WJD A;  1LE8 B;  4QWQ A;  5LRR A;  1E3H A;  1SD5 A;  1YW9 A;  5KNL A;  4S05 A;  3DPU A;  1JKQ C;  3AKZ A;  4EJU A;  3H92 A;  3DBR B;  3WTX C;  2CQQ A;  3VYT B;  3JRH A;  5J40 A;  2HOS A;  2LH9 A;  2WAF A;  2VQL A;  4QTR A;  2XSJ C;  1IN6 A;  4BAY A;  2EK5 A;  1GXQ A;  2BHY A;  4NQW B;  2BVM A;  3P9I A;  3QYB A;  4G8X A;  2CUF A;  4NUB A;  1MSE C;  3S17 J;  2E1N A;  1G8X A;  4AUX A;  1IN7 A;  1TT0 A;  3JRE A;  1G3T A;  2HGC A;  3FXO A;  3OOP A;  1ETK A;  4I09 A;  4PGG A;  2HKO A;  4YFN F;  1GT0 C;  2BGC A;  1WH5 A;  3CCJ I;  1J09 A;  4R79 A;  2XAU A;  3GXO A;  1WVR A;  5HNF A;  4BXF A;  1RUO A;  3WU0 A;  5C3E J;  1B8I A;  2XKO A;  4E7J A;  2ZFW A;  2LSO A;  4GXO A;  2XPV A;  1OCP A;  3C3W A;  2FUG 2;  3IL2 A;  3U1D A;  1F36 A;  3QYF A;  1Z1D A;  4DBR A;  1Z0X A;  4D0P A;  1GDT A;  1KQ8 A;  2HYJ A;  4ANJ A;  2FML A;  3HSR A;  1IZ1 A;  1X4P A;  4IJA A;  3ZMZ A;  1U5T B;  2FNP A;  4M6V A;  1YYV A;  2IW5 A;  2RGV A;  4HDU A;  1TQP A;  3ZRG A;  3EYI A;  3J81 Z;  2X0L A;  4F7Z A;  5D6E A;  2DFF A;  2A61 A;  3LQQ A;  3VYR B;  3EUH C;  2XB0 X;  4C3J J;  2LKX A;  1QHH D;  2QGU A;  1YW7 A;  5IYB J;  3L2V A;  2MC3 A;  2HWV A;  3PM1 A;  4RGX A;  2VOP A;  2CSO A;  1KGS A;  2M2E A;  2DU9 A;  1XTA A;  4KJZ A;  5FRM A;  2YU3 A;  5HOO A;  3OSG A;  1XSV A;  1KQ9 A;  3CCR I;  2DQR A;  3TOB A;  2E2H J;  3TGN A;  1Z6T A;  2XIG A;  1I1G A;  2EIJ H;  3CDH A;  5HVQ C;  1AHD P;  4F3Q A;  3CUQ A;  4BJT A;  3DTI A;  3L9F A;  2QKL B;  3GF2 A;  3H36 A;  4MEX F;  3HTS B;  2IT0 A;  4KIT B;  2N8G A;  3CF2 A;  4BAC A;  1AKH A;  2OZU A;  3MD2 A;  3AFH A;  1E3O C;  1RES A;  4EVI A;  1QVT A;  3ZMU A;  3EUA A;  4NB5 A;  5ED4 A;  2M87 A;  2QWW A;  2R5Z B;  1ZLJ A;  3A02 A;  3IAM 2;  4BQA A;  1FYK A;  4UY8 I;  2WB1 N;  3U1K A;  2BOL A;  2X9D A;  1ZH5 A;  3FWE A;  4FX0 A;  5ICG A;  2FEZ A;  5J8F A;  2WV1 A;  3RYP A;  5BNG A;  1X58 A;  1J59 A;  1ZYR F;  3HTU A;  4ZDL A;  3LSG A;  3PIP F;  3I71 A;  1W0T A;  4N9H A;  4XBF A;  3HL2 A;  3CCM I;  3AAF A;  2IP2 A;  5J6X A;  1MND A;  4RAG A;  4LJZ F;  1K83 J;  4NQW A;  2AXL A;  1JHH A;  2CV0 A;  1K79 A;  4HEA 2;  2GIV A;  3DBH B;  3L09 A;  4E7I A;  2VKV A;  4CXF A;  1JTY A;  1ODD A;  3DFG A;  4B8X A;  5F0H A;  4XLC A;  1OYY A;  4E7Z A;  3DLL F;  2Y69 H;  2NRA C;  1VQP I;  4XOR A;  1TBX A;  1GHC A;  4MNU A;  1FY7 A;  2ZME A;  3D5S C;  3O8G A;  2IS6 A;  2R7V A;  1S7E A;  3AL0 C;  2WWY A;  2FD5 A;  2UUZ A;  3ABK H;  1RPW A;  2AXT C;  2V26 A;  4M3G A;  4ESB A;  2HPM A;  2ISY A;  2OQR A;  3TO9 A;  1TL8 A;  5FKO A;  4L5E A;  4C3I J;  4HA8 A;  4BDZ A;  4BQN A;  2IS4 A;  4CA0 A;  3WTS C;  3QP6 A;  2Z16 A;  5J8C A;  1H9G A;  2NOJ B;  2QQA A;  5EEH A;  4BJ6 C;  3K70 C;  1H0M A;  1SAU A;  4IRH A;  1HDD C;  4UNO A;  1WH7 A;  1QQI A;  2VBW A;  4G6T B;  4NNJ A;  2QBY B;  1U5T A;  2BY3 A;  5TRD A;  3DU5 A;  3CP8 A;  4MTE A;  2LF8 A;  3LA2 A;  2DMT A;  2HYF A;  2IS1 A;  2QM3 A;  4PFP A;  3TDZ C;  5D6F A;  3OYI A;  3SZG A;  2CRG A;  1P92 A;  1T33 A;  4IHV A;  3QWL A;  3E6B A;  1B9M A;  3J7Z I;  5H6R A;  1EH7 A;  2VIX A;  1Y1W J;  4BE1 A;  3OIO A;  4HNU A;  3GTP J;  4N0B A;  5E18 F;  3ZP5 A;  3K2Z A;  4RB2 C;  2MGQ A;  1HF0 A;  1ETX A;  1NHA A;  2GA2 A;  3GLX A;  3TO6 A;  3S1N J;  4L5J A;  1WGX A;  1ZHF A;  3K4C A;  1R7J A;  3BC8 A;  1I1S A;  4UUT A;  3H1C A;  4XM3 A;  4ZYH A;  4L18 B;  3HOW J;  3BJO A;  5GP9 A;  5E1Z B;  4G12 A;  3RKX A;  1FSE A;  4D9J A;  3OR1 C;  4BKX A;  3MQ0 A;  3JAM Z;  3IWZ A;  2K7L A;  3K4J A;  4PK4 A;  2MYS A;  5KCM A;  2ZXJ A;  1XSD A;  5CYV A;  5L3G A;  2DDA A;  2R5Z A;  3S2D J;  5HOD A;  3MZ8 A;  4JX5 A;  1QGP A;  3A1Y A;  3VYS B;  4A6D A;  3HZJ A;  3L2U A;  1K6O A;  1S3J A;  2V6C A;  4DOZ A;  1VQK I;  4RM2 A;  4IOA F;  2AQE A;  2ELJ A;  1IRF A;  3FKI J;  1E17 A;  2RVC A;  3J81 K;  1R49 A;  3CDI A;  1JI8 A;  3RKW A;  2ZJQ F;  2EZK A;  2B7E A;  2LFB A;  4I0A A;  1OKR A;  3F9K A;  4G6Q A;  2DJI A;  2JVH A;  1ETO A;  2PMZ N;  1ZTR A;  2R7X A;  1TWF J;  2IRF G;  4NBQ A;  3CUQ C;  2CW0 F;  3I4M J;  3RKQ A;  1QNT A;  2LNB A;  3KIO A;  2A3S A;  2AHQ A;  2HQA A;  2PX9 A;  3I58 A;  4A3J J;  4Y17 A;  4M9Z A;  3I54 A;  4IHY A;  2DDB A;  3C2G A;  3PSI A;  4CHU A;  2HS5 A;  4CZZ A;  3QAH A;  1LFU P;  5FGM A;  3M8J A;  2JA8 J;  5F0F A;  2BY0 A;  3FK7 A;  1BIB A;  2KKO A;  3SDG A;  5M3M J;  4Q47 A;  2VE8 A;  3LSI A;  3P9K A;  2QSH X;  3DU6 A;  2XF7 A;  2MH2 A;  1FBQ A;  2HZD A;  2XDV A;  3TMO A;  1R36 A;  2K4J A;  4OIR F;  1FIP A;  2L7K A;  4XKC A;  3HOX J;  4RGR A;  1WJF A;  2CUJ A;  2KDO A;  3KP2 A;  3GW2 A;  2M0C A;  1VQ9 I;  4BHP A;  1YW8 A;  2HOT A;  2LDU A;  3GZ6 A;  2VT2 A;  5E20 A;  4OIQ F;  3WHC A;  2ZB9 A;  3M8F A;  1I50 J;  3HOY J;  3FBN B;  2DK5 A;  3F8B A;  3BZC A;  5DEQ A;  1PVE A;  4B4C A;  3ABT A;  4UV8 A;  2HKX A;  2E19 A;  3KEQ A;  1UMQ A;  2QBY A;  2VXD A;  3ZQF A;  4BS9 A;  2O6G E;  3O6B B;  2JK3 A;  3VYU B;  1HW2 A;  1LDK B;  1I39 A;  1OR7 A;  2DMP A;  3DCF A;  4BBR J;  2A5Y B;  3T0Y A;  2VL8 A;  3DBL B;  1YIT I;  4YIR X;  3GVA A;  1LNW A;  1N78 A;  2KIM A;  1TWC J;  2ZME C;  2D1V A;  1J0R A;  1M1E B;  5ICC A;  3IKV A;  2MD5 A;  2ZJ2 A;  1SD4 A;  4MIM A;  4KA4 A;  1PP8 F;  2R7W A;  1R23 A;  1TTY A;  3J80 K;  1A36 A;  1GVD A;  1IXR C;  3KP6 A;  2DA7 A;  3VPR A;  4EM2 A;  1XMK A;  1REP C;  4ASN A;  1QZZ A;  2EIN H;  1HKQ A;  4LIU A;  2CFO A;  4RMN A;  2W7N A;  1YX3 A;  4XIC A;  1A04 A;  1YHQ I;  3DKW A;  3C2H A;  3F8C A;  4XKW A;  3GTG J;  1TP4 A;  2M34 A;  2OF7 A;  4HLY A;  3HKZ A;  3RDI A;  2WV0 A;  3HHG A;  1J7K A;  2HXI A;  2P7V B;  1DPU A;  1GXP A;  3QPS A;  4FET A;  4HAM A;  1Y8Q B;  3R61 A;  3CCS I;  3VB2 A;  1IJW C;  4YRV A;  2H8R A;  2YPR A;  3EQL F;  3KZZ A;  3H3U A;  1S7O A;  4NC6 A;  1T39 A;  3OYE A;  1D8K A;  2NVT J;  4KMU X;  1K7A A;  2WY8 Q;  4KDP A;  2ME6 A;  2EB7 A;  2HNH A;  4FIS A;  4KN7 X;  2NVU B;  2ESN A;  1FP1 D;  1MNM C;  2DPD A;  4UB6 C;  3ZQQ A;  4M3D A;  1E3P A;  1Z67 A;  3G1L A;  4UXN A;  2OQG A;  4CSW A;  1UST A;  2DOE A;  3PO3 J;  1P2F A;  4IRI A;  5IYC J;  2W00 A;  4R8H A;  1HBX G;  2A68 F;  1IRX A;  1TNT A;  2Y9Y A;  2OAZ A;  2V9P A;  4F91 B;  1OJL A;  2CUE A;  2PLY A;  2FNA A;  4AU7 A;  4CCM A;  4KIF A;  1NG7 A;  3I3L A;  1RUN A;  1MMS A;  1QZY A;  3HIF A;  5L3D A;  5M3F J;  2HVS A;  4IHT A;  1IUF A;  4HDV A;  3KP4 A;  1R00 A;  4A12 A;  1HW5 A;  2NS8 A;  3CMY A;  5ILS A;  5J4V A;  1MW7 A;  5B66 C;  1FYL A;  3FHN A;  3ZCO A;  4BU2 A;  3K4K A;  4RM3 A;  2KT0 A;  2L02 A;  2E1C A;  4MHG A;  4Y52 J;  3BPV A;  4P9U A;  3REO A;  1P7I A;  1FYM A;  1MBF A;  1RI7 A;  3AG2 H;  4A6E A;  4HNV A;  5HLT A;  3PJR A;  1W1W E;  4AID A;  2DAO A;  2VQH A;  2WAE A;  2CG4 A;  1U9N A;  2BY2 A;  2L7M P;  2QKM B;  2TDX A;  2KP6 A;  5ILU A;  4ZTF A;  2HDC A;  4O6J A;  4CCN A;  1UZC A;  5H6Q A;  2PMU A;  2Y48 A;  3K1N A;  3VEP A;  2X51 A;  2ZSI B;  3BPX A;  1KU2 A;  4FHT A;  3ELK A;  1SD7 A;  4PGH A;  1I3Q J;  2V1X A;  2VJ4 A;  3LAJ A;  4FT8 A;  4FE4 A;  2MLG A;  3ECO A;  3OYM A;  5E79 C;  2XAH A;  3ZQH A;  4OIN F;  1IGN A;  2Z5U A;  4WX9 A;  3Q0V A;  2BXY A;  3IKT A;  5D5V B;  1O57 A;  1R22 A;  1A6Q A;  1HST A;  3ABL H;  1BI3 A;  3BLY A;  3KEO A;  2K9M A;  3NQO A;  5E1W A;  2D45 A;  2ZFU A;  1HDP A;  3W6V A;  2M9H A;  3OYD A;  4PUS A;  1A31 A;  5EDN A;  1I6X A;  3BG7 A;  2QVO A;  2E7W A;  1XB4 A;  3CMA I;  3F3X A;  2RAE A;  1YI2 I;  4NHJ A;  1VQ4 I;  1EH8 A;  2PEX A;  2GIZ A;  2CJJ A;  2CFX A;  1PYV A;  1OR7 C;  1JJ6 C;  1W5S A;  3LFK A;  3S2W A;  3I4P A;  1B6A A;  2FQ4 A;  2LC2 A;  4ON0 A;  1D8J A;  2IBD A;  3H5N A;  3CJN A;  4PZJ A;  1FTT A;  5BQT A;  4M3E A;  1GVJ A;  1FBS A;  3F6O A;  1JTX A;  5H2F C;  3F72 A;  3OOU A;  4WK8 F;  4DYC A;  3CCU I;  1VTN C;  3UNG C;  5BOX A;  2KRC A;  3QPT A;  2VN2 A;  3VOE A;  1TWA J;  1Z21 A;  4MTD A;  3DQV C;  3BQZ A;  1W7P D;  1ONV A;  3ESW B;  2P6T A;  2DOD A;  3BG5 A;  4B44 A;  1EJ9 A;  2IS2 A;  1OYI A;  1OCZ H;  1XCV A;  3WU2 C;  2JTV A;  1SC7 A;  2V79 A;  2H94 A;  2VKE A;  4IRG A;  5IP9 J;  3OYA A;  1LQ1 A;  3V7C A;  1JKP C;  2CV1 A;  2L4A A;  2CS3 A;  2NXN B;  3OS2 A;  3J7A O;  3HRM A;  4C3H J;  1H88 C;  4IXA A;  2DFE A;  2ZCW A;  5EGO B;  2VOO A;  1LJ9 A;  4OAZ A;  2X1D A;  3LQR A;  3NAU A;  3CF5 F;  1BR1 A;  4A3E J;  2NYX A;  2CV2 A;  2F5E A;  4NC7 A;  4XLF A;  2QUF A;  4QLC U;  2EZH A;  1P7J A;  4HQE A;  2XAJ A;  3V4G A;  1R4N B;  4D1Q A;  4FE7 A;  1GLN A;  1VQN I;  4A93 J;  5CLS A;  1ERD A;  1EKE A;  1S8N A;  1LDJ A;  3FXQ A;  1O3S A;  2DW4 A;  1AOY A;  2DA6 A;  3PUF A;  3D1N I;  4NC8 A;  2EPF A;  4BUP A;  5KAF C;  1FOK A;  1YFH A;  5JHU A;  5LBQ A;  5KVR A;  5EEA A;  1X1A A;  5DTD A;  4RAF A;  2ID6 A;  3ZQ7 A;  1MH3 A;  1YS7 A;  3PIO F;  3KZI C;  3S1M J;  5CQE A;  2RNG A;  1IRG A;  1I6H J;  4AYB A;  2GLO A;  1HXD A;  2CH0 A;  1ON1 A;  1FX7 A;  1FP2 A;  4ABZ A;  1CF7 B;  4RDU A;  1AA7 A;  1E2X A;  3IAS 2;  4JOM A;  4M72 A;  2DMQ A;  3HOZ J;  1R9T J;  4A0X A;  1O7F A;  2JUC A;  1ORK A;  1P4X A;  2DMU A;  1JE8 A;  2LG4 A;  5JHF A;  2BYV E;  2KLO A;  1W36 C;  3ML6 A;  1VND A;  5FKN A;  1SVL A;  4E70 A;  5ICF A;  2HR3 A;  3SEQ A;  3U9G A;  4E7S A;  3ZQL A;  2GOM A;  2AQF A;  2HEO A;  5L3B A;  1DGR M;  1ON2 A;  1FMV A;  5M5X J;  1XMA A;  1BW6 A;  4HZF A;  2OBP A;  1XMX A;  4ZYA A;  4XN0 A;  3GTO J;  2MLK A;  3KP5 A;  2E5N A;  3JRF A;  2M7B A;  3ERE D;  2VOD A;  3GFJ A;  3R6S A;  2IGK A;  1X19 A;  2XHK A;  2QQ9 A;  4I0B A;  1V5F A;  1IN8 A;  2L9N A;  3WTV C;  1OCR H;  4MEY F;  4IF4 A;  4WF2 A;  1VQ6 I;  4ZTJ A;  1DUX C;  2AS5 F;  3B6A A;  3I64 A;  2R7T A;  3ERM A;  1S29 A;  3A01 B;  2EZI A;  3OYL A;  1XSX A;  3RPU D;  2ECC A;  5CKT A;  4Y15 A;  1SFE A;  4ZH4 F;  1D5V A;  2EZL A;  3GFM A;  2R5Y B;  2EWN A;  3N05 A;  2DA1 A;  1H9T A;  1KQ0 A;  2IA2 A;  1Z9C A;  2Q8K A;  4D7N A;  1V54 H;  5DUK A;  4F55 A;  2XRO A;  2B63 J;  1ZRE A;  2RNJ A;  4ITV A;  1NG6 A;  3CDL A;  3C18 A;  3H9Q A;  1ITY A;  1OCT C;  1JT0 A;  2EH3 A;  4F92 B;  2A07 F;  1RRJ A;  3C7J A;  3E1S A;  4HQM A;  3GTL J;  3Q0W A;  1ETV A;  5FD6 A;  2Z33 A;  3LSK A;  1KU3 A;  3U21 A;  3S93 A;  3TP3 A;  1X3Z B;  3DTE A;  1T95 A;  1YLF A;  2OA4 A;  1WRJ A;  5EJC A;  1U0J A;  3JRI A;  2ZC2 A;  3E7L A;  4Y4R A;  2DFI A;  5HLH A;  3G6E I;  3FDY A;  4KIB A;  5DCM B;  4Y7N J;  1O4X A;  4Q48 A;  4BL0 B;  4PFO A;  5EGO A;  2K9N A;  3WTU C;  3L00 A;  2GM4 A;  2EFP A;  1W5C C;  2OUM A;  5LHH A;  2FMY A;  3IH3 A;  5FB2 A;  1RNL A;  2RRE A;  2LK2 A;  3OYK A;  3BQY A;  4XLH A;  1RKW A;  1UG0 A;  2L9S A;  1VF9 A;  3TO7 A;  4R1H A;  2NS7 A;  4UHT A;  3W3C A;  3HC7 A;  2GWR A;  3JSP A;  1Y0N A;  2R7F A;  2ISZ A;  3IUO A;  3S32 A;  3U2R A;  4B1R A;  3A4C A;  2I5U A;  1Y8R B;  4GCV A;  4IPA A;  3E0J B;  3DEW A;  2HDD A;  2RQP A;  1USS A;  4ZYD A;  3OWT A;  2YU9 J;  1HQC A;  4BHC A;  3BTJ A;  1YJ9 I;  4YFK F;  3K4M A;  2X6Y A;  1VQ8 I;  1XGO A;  3WGI A;  1U6G A;  1ZN2 A;  1D1C A;  3MWM A;  2FOW A;  1CF7 A;  3CJR B;  3WG9 A;  2VJ5 A;  4A5M A;  1S9H A;  3AG4 H;  3F8F A;  1Z7U A;  4M73 A;  3GYH X;  4A3B J;  3EYY A;  2DXI A;  2ZNZ A;  2PFB A;  4W1U A;  1UEL B;  2OTL I;  3GTQ J;  2JUG A;  2QLZ A;  4A69 C;  2HPI A;  2L2O A;  2EFO A;  2KIF A;  1IAW A;  2HYG D;  1BI0 A;  2LY2 A;  3K4N A;  4L9J A;  2EA4 A;  4E7L A;  3K1M A;  2HQN A;  2IXS A;  1QRY A;  2JN6 A;  5H20 A;  1LE8 A;  2BXZ A;  3V7S A;  5E8I A;  1RKT A;  4F93 B;  3FMQ A;  3LSP A;  1TC3 C;  3N4M A;  4ESF A;  2XSD C;  3CUO A;  4CH7 A;  1IO2 A;  2VUM J;  5K5O A;  4BE0 A;  3CCE I;  4Q4Z F;  4M9S A;  2O61 A;  4E7K A;  1VQ5 I;  4A5N A;  1T0F C;  2VC0 A;  1X1P A;  3ECH A;  5FLX K;  5CVI A;  2M5W A;  5IP6 A;  2KL4 A;  4BY1 J;  5FFX A;  3P9C A;  5D5X B;  1D5Y A;  1U9O A;  4B48 A;  2UXX A;  2GQQ A;  3MN2 A;  3BTC A;  1BC7 C;  1YX5 A;  4Q5S F;  3GCM A;  3LOC A;  3DP7 A;  3HM5 A;  2EIM H;  3RKY A;  3J80 Z;  3A01 A;  3AG3 H;  3TQN A;  4DBQ A;  3CTA A;  3HBL A;  1G3Y A;  3LMM A;  4GO1 A;  4MGR A;  3NAR A;  2GAU A;  3P5J A;  1CQT A;  2KFD A;  5E3L A;  3T5X A;  1FOY A;  2R5Y A;  2QQ8 A;  3PNV A;  4UVA A;  1J75 A;  2K27 A;  5L3E A;  3S8P A;  3M4O J;  2F2E A;  3GZN B;  3GEZ A;  4EJW A;  2MC4 A;  5HDN A;  1ZAR A;  3S3N A;  4XID A;  3FM3 A;  4XLP F;  2KJB A;  3KET A;  4DYR A;  1IW7 F;  4H0E A;  2DLL A;  4FCY A;  1OCO H;  2MSY A;  4BHB A;  2Z2S B;  4A0Y A;  5C4J J;  2OCC H;  2E1O A;  2Q0O A;  2A6H F;  2HOE A;  2L5Q A;  3WE2 A;  5DCM A;  5IY5 H;  2XRN A;  2W1O A;  2HZT A;  4M74 A;  2K9S A;  2DJN A;  1LDD A;  1MBK A;  4PSX A;  3L1P A;  2WTE A;  4M6Y A;  2HI3 A;  3WHB A;  4A3L J;  2ETH A;  2KRH A;  2O0Y A;  2DFH A;  2XC7 A;  3GX4 X;  4FAS D;  2JVG A;  3HEF A;  3W6K B;  1IV8 A;  1XGM A;  1BC8 C;  1IG7 A;  2P5L C;  2QA4 I;  4PDK A;  1O7L A;  5TJJ A;  1YIO A;  2Y31 A;  5CQG A;  3T8T A;  2DA2 A;  4DZP A;  2KHM A;  3PUB A;  3K4B A;  2H8W A;  1U2W A;  4I01 A;  3OYF A;  3RQI A;  3JRB A;  2DPU A;  2E2I J;  1IN5 A;  2VBX A;  3CJQ B;  4CO8 A;  2YR2 A;  3B02 A;  3BJA A;  2KJC A;  5DD8 A;  4AC0 A;  2EV6 A;  4HOB A;  4CIC A;  1JXS A;  3HXL A;  2L7F P;  4U0V A;  2P7C B;  3OYG A;  3F0C A;  2KIU A;  4ZJZ A;  4RAZ A;  3CMM A;  5KK1 A;  1BJZ A;  2V1N A;  3FZV A;  3H5A A;  3A2K A;  4BQO A;  2E34 A;  2JPC A;  1GUU A;  1TQI A;  1UFM A;  1ZRF A;  2PMH A;  1UG2 A;  2JSP A;  5TGT A;  1X3W B;  3HRU A;  2H6B A;  1R1T A;  1ZGJ A;  3KPH A;  3KP7 A;  1YE9 A;  5FO5 A;  3LA7 A;  2COM A;  3ZOB A;  3KX2 A;  4D5F A;  3WG7 H;  1W0U A;  1J9I A;  2LOO A;  3HOV J;  4H4K C;  2PBI A;  2KIQ A;  1ZR2 A;  4IQJ A;  3SZP A;  1WWX A;  2J5O A;  2LRD A;  3O3K A;  1OLT A;  3W2V A;  3D5L A;  2P0W A;  3DKX A;  1JUP A;  1EH6 A;  2VAS A;  2F4M B;  4RB1 A;  3OYH A;  2V1U A;  3F21 A;  2ZSH B;  2IA0 A;  3CME I;  1T38 A;  1FMW A;  3HKZ N;  3FXK A;  3ONQ A;  2FF4 A;  1BBY A;  1LVA A;  4LIT A;  2L9R A;  1T2K A;  1ETY A;  3GWZ A;  4IVN A;  3GLL A;  2H27 A;  2EV0 A;  4XNF A;  1BJA A;  4HX8 A;  2LMD A;  1PJR A;  4XKV A;  1QPM A;  1Y6I A;  2NS0 A;  2E1M B;  1ZEL A;  2DA4 A;  2X1E A;  4UUS B;  1KU7 A;  4S0H B;  2YSR A;  3WGH A;  2Z9O A;  1UCR A;  4AM3 A;  1R5G A;  3RI4 A;  4ZDP A;  1WSU A;  1BIA A;  1OFC X;  3NWS A;  1R5I D;  1WCM J;  3F8N A;  3TED A;  4P1W A;  2YS9 A;  4ENN A;  2ZO4 A;  2L9V A;  2W25 A;  1YTY A;  2Y30 A;  3SQN A;  1IV6 A;  5JR3 A;  2G0E A;  2ZXW H;  4S04 A;  4IL6 C;  3ZN0 A;  5AON A;  2VKH A;  4HST A;  2J5P A;  4EJV A;  3H0D A;  1R71 A;  3F8M A;  4DZJ A;  1PP7 U;  1XPX A;  4B3A A;  1U8R A;  3EET A;  4FX4 A;  4II3 A;  4MLO A;  4A3I J;  1JUM A;  2CW8 A;  3BDD A;  3PQK A;  3MKY B;  2DI3 A;  4XSZ F;  1LB2 A;  1HOM A;  1IDZ A;  2KZG A;  3K69 A;  4PJL A;  3I4N J;  3G71 I;  1A35 A;  3TL4 X;  2MFZ A;  4LMY A;  1K78 B;  1E0E A;  4KFC A;  1CGP A;  5JVG F;  5GPA A;  1MGT A;  3RCO A;  4U7B A;  4HLX A;  4ENK A;  1YO5 C;  1YRN B;  5LHG A;  3CC4 I;  1D1A A;  1MIJ A;  2K9Q A;  2GXB A;  3OYB A;  3QP5 A;  3C2B A;  2Z3Y A;  3DKY A;  2NVX J;  4GDF A;  2H6C A;  3I0T A;  4LLG F;  3S1Q J;  2KMU A;  3RZD J;  3HRS A;  5D5W B;  3CO6 C;  3B73 A;  2BZT A;  1MMA A;  3L7W A;  5J1R A;  2PQ8 A;  3JRC A;  5LD2 C;  5BPD A;  1GV5 A;  3ULQ B;  1U5T C;  3GBG A;  4EJT A;  1B59 A;  1F1Z A;  2P5K A;  1HKS A;  3LSM A;  2LRE A;  3HDD A;  3SFI A;  3TW6 A;  4U0Y A;  3HUG B;  5HDK A;  3IRR A;  3K4L A;  2BVL A;  4EGY A;  5BMZ A;  2IGM A;  2BEO A;  2OV7 A;  2XV4 S;  2DTZ A;  4DYQ A;  2W4S A;  4Z2Y A;  2V1D A;  5JVT A;  1FEX A;  2DOA A;  2K02 A;  4HSR A;  4O5V A;  4P5O A;  1X2N A;  1SFK A;  1YIJ I;  3KEY A;  2JPB A;  4IHW A;  4N4N B;  4U88 A;  3JSO A;  1FLI A;  2R7Q A;  2E71 A;  3S3O A;  2K9L A;  3HPH A;  4ZYG A;  1KYZ A;  5LHI A;  5BS6 A;  3CC2 I;  2I10 A;  1MNE A;  4A2U A;  2X1C A;  2ACJ A;  2F5C A;  4XQF A;  3SHF A;  1K61 A;  2LYC A;  3C1D A;  3TKY A;  1BN5 A;  4GFB A;  2MH9 A;  4OIO F;  1K6Y A;  2K40 A;  2DK8 A;  2ME0 A;  2R7D A;  3MKW B;  1ZK8 A;  2LBF B;  4N9I A;  3HRT A;  3TBI A;  5E17 F;  4JYK A;  5KHD A;  2STW A;  3PSF A;  1A6I A;  4FTH A;  4MFD A;  4UUS A;  3E6M A;  1SD6 A;  3LL7 A;  3G3Z A;  1V5G A;  4HX4 A;  4PJJ A;  3MAJ A;  3E5X A;  3ZPL A;  3QYE A;  5J1U A;  3G2B A;  5IT9 K;  1MDM B;  3BG9 A;  3DF8 A;  5IT3 A;  2FBI A;  5AIP A;  4I6Z A;  2NVY J;  2HVQ A;  2VQC A;  4V19 K;  5B1A H;  1N25 A;  3GTM J;  3ASN H;  5F1J A;  3UKG A;  2FJ1 A;  1W7P B;  4JP0 A;  3I5U A;  1PUF B;  2V4J C;  3OIQ A;  2YX4 A;  3CLO A;  4X1E A;  1R1U A;  3VFZ A;  2E7X A;  2V7F A;  5DM6 F;  2W48 A;  2OCE A;  1TWG J;  1DU6 A;  3JR9 A;  2P5V A;  5M5W J;  2STT A;  5E3M A;  3ZQC A;  1RC9 A;  4HX7 A;  4GRI A;  1K78 A;  1BOB A;  1U8B A;  2GXG A;  4XLN F;  3IV5 A;  1S7A A;  1OMI A;  2EV5 A;  3BT9 A;  3CCV I;  5K7H A;  1KYW A;  1YRN A;  1TW3 A;  4QPQ A;  2QSF X;  3X2Q H;  1HLV A;  4M9X A;  1G3S A;  2OU2 A;  2CW7 A;  2G7H A;  5GPC A;  1ZLK A;  2O8K A;  5LGN A;  2H1K A;  1JHF A;  2L54 A;  3IWF A;  4HF2 A;  1IN4 A;  1BR4 A;  4WXH A;  3ZN1 A;  2DT7 B;  3ASO H;  2FBH A;  3ISP A;  2LTP A;  4G94 A;  1YS6 A;  4I76 A;  2Y2Z A;  3VWB A;  1XC5 A;  4K2E A;  4AYB N;  3AL0 B;  4DQ2 A;  2FA5 A;  2VBZ A;  3R0J A;  1V4R A;  3N97 A;  2XRL A;  1HW1 A;  2ELH A;  4OIP F;  3SZT A;  2VQG A;  3VSL A;  3HUG A;  1DPR A;  3OL4 A;  2LR8 A;  3CCQ I;  1VQL I;  3OSF A;  3SFZ A;  5K5Q A;  2P6S A;  5EF6 A;  1H89 C;  4KIC A;  2MBF A;  2R92 J;  1MBJ A;  3V7R A;  3QRF F;  1F4K A;  4IKF A;  2CO5 A;  5HS9 A;  4UB8 C;  3E97 A;  4OWR B;  4XSX F;  3KYL A;  4QSH A;  2ESH A;  2K3P A;  4LIV A;  5E8G A;  4DGW B;  5E3N A;  3GME A;  5LEK A;  3EUH A;  3KLN A;  4XOT A;  2V6E A;  5JLX A;  3E6D A;  5F1R A;  2VT3 A;  1JJ8 C;  2LKP A;  4W97 A;  1ZG5 A;  3PO2 J;  4QPO A;  1QVU A;  1YJN I;  2WAD A;  4FQG A;  2ECB A;  2IGN A;  2W57 A;  4HF1 A;  1ETW A;  3KCC A;  1NK2 P;  3BTL A;  1SVM A;  2F4I A;  2RDP A;  3FMS A;  2K4B A;  2R7O A;  5FLX Z;  4LLL A;  4ETS A;  3HGG A;  4OAY A;  4U7D A;  4XRS G;  1P4W A;  2P8T A;  5GAE J;  3GTK J;  4PJM A;  2K5C A;  1MDM A;  2CUZ A;  1BL0 A;  4KNY A;  3G1M A;  3FXL A;  2B0L A;  1XD7 A;  3LA3 A;  1BM9 A;  2BY1 A;  5DS9 A;  1XGN A;  2M30 A;  1SEU A;  1FSH A;  3BR2 A;  3FIW A;  2DYS H;  4LK0 F;  3B6C A;  2BBY A;  1O3Q A;  2Y0M A;  2A6E F;  5EZG A;  3ZMS A;  1W7P A;  3JTH A;  3K7A J;  2MD0 A;  3E6C C;  1B72 B;  2Z1D A;  1R58 A;  5B1B H;  2Z99 A;  4ESJ A;  2YX7 A;  1HA8 A;  1HSJ A;  5DUI A;  3JW4 A;  1XS9 A;  1JKO C;  4ZDO A;  3UR3 C;  5LRS A;  1P9Q C;  1JGG A;  1X1B A;  2E1M C;  3O8H A;  2AO9 A;  1Z3Y A;  4D7M A;  2F5F A;  5DCF A;  5CVV A;  3WOD F;  5JFR A;  2W82 A;  3H0G J;  1FOW A;  4XRM A;  3I55 I;  1FJL A;  3HYI A;  4CCK A;  1TT5 B;  4CUG A;  5IP7 J;  2R7Z J;  2FSW A;  3T8R A;  4XL9 A;  1ZAO A;  2OJE D;  2XKP A;  4Y3O A;  3ZQG A;  2E60 A;  3RQ4 A;  1Y56 A;  1O3T A;  1RR7 A;  2E35 A;  4EMS A;  2XPU A;  4AIH A;  2VI6 A;  4LGW A;  4GGG A;  2M3A A;  4IO9 F;  1MBH A;  2XPW A;  2LY1 A;  4O3M A;  5FKK A;  1R1V A;  1ZGA A;  1EF4 A;  1FC3 A;  3DLA A;  1QPI A;  3BR5 A;  4D5C A;  3SJM A;  1B9N A;  4OMZ A;  1RET A;  1WI3 A;  1Y0U A;  1VQO I;  1F9N A;  4KT6 A;  3RYR A;  2VJJ A;  4BYY A;  1QO0 D;  1Y39 A;  2ZKZ A;  3JTG A;  1VQM I;  3PNY A;  4EEF G;  3I56 I;  1MMD A;  1Z6R A;  2R3S A;  1EA3 A;  4IEJ A;  3CC7 I;  2NVQ J;  5ICE A;  3FMR A;  2VON A;  2VPL A;  1WPK A;  4A3K J;  2RKH A;  1T08 B;  2LLK A;  2GZW A;  2CQX A;  5EYR A;  1MJB A;  3IC7 A;  3KE2 A;  4BY7 J;  2DT5 A;  4XRS A;  1F43 A;  3G4S I;  2M1B A;  2O7O A;  3LSR A;  1DP3 A;  4QIW N;  3L2R A;  3EDP A;  1HKT A;  1S5L C;  3V8L A;  4Y33 A;  4M6X A;  5A2Q K;  2W85 A;  2O8X A;  1FOX A;  1T56 A;  2WC2 A;  2FBK A;  4LK1 F;  2LD5 A;  2M7A A;  1O3R A;  1RIO H;  5GAG J;  1R5H A;  2XAS A;  4J00 A;  3QU3 A;  1RZ4 A;  1JUS A;  2ZME B;  5HLG A;  1FWZ A;  4WCG A;  4J01 A;  2BE5 F;  3LFU A;  1P4A A;  4XON A;  3RTR A;  4I02 A;  4M3B A;  2X6W A;  2BHZ A;  1ULY A;  1BA5 A;  1F5T A;  2NAZ A;  4RGS A;  3FXM A;  4XLE A;  2EIK H;  3QPH A;  4KIS A;  3CD6 I;  4BE2 A;  3GFL A;  5LLQ A;  3E5U A;  3RPU A;  2Q2E B;  1LFB A;  4NDL A;  2EA2 A;  3BR3 A;  2KRF A;  3KYD B;  2ZXI A;  4KT5 C;  4E4H A;  5ILV A;  1JT6 A;  4IHS A;  3PL8 A;  5CVU A;  2LKS A;  3W2W A;  4CYC B;  3K2A A;  3KZY A;  1G3W A;  3JRA A;  1FTZ A;  3ZQI A;  3J7A Y;  3RZO J;  3OYN A;  1XGS A;  4WXC A;  5FLM J;  4P55 A;  1SAX A;  3OR2 C;  1U3E M;  1LFP A;  3BOQ A;  2M8E A;  4A3G J;  2ZJP F;  3DXJ F;  3MVP A;  4Y13 A;  2KPM A;  1TQM A;  3SXY A;  1B72 A;  2UXN A;  4LG3 A;  2Y9Z A;  3NWT A;  2KQR A;  3FBI B;  4I7H A;  1D3Y A;  1BW5 A;  1UHW A;  2X85 A;  3HSE A;  2O3F A;  5J4Y A;  4BJ5 C;  2UWM A;  2WA0 A;  9ANT A;  3BP8 A;  5B3S H;  1PDN C;  3K6G A;  4GYG A;  2OTJ I;  4LD5 A;  4BEH B;  2DBB A;  3COA C;  2ICW G;  4RLF A;  2DYR H;  5F27 A;  4V2F A;  2EIL H;  3GUD A;  2M8G X;  5B5E C;  5FRO A;  3QQA A;  5EEG A;  3ABM H;  1MJ9 A;  2EBI A;  1T98 A;  3ZGK A;  1D1B A;  2VXZ A;  1ZG1 A;  1MMN A;  4BNC A;  4TV7 A;  1L3L A;  5E3O A;  4CCO A;  4XMY A;  2YUS A;  3QPL A;  4RA2 A;  4U0W A;  3S16 J;  2HFH A;  3CP2 A;  5M5Y J;  2RQQ A;  2JA5 J;  3H35 A;  4IQ4 A;  2WAQ N;  3ZMD A;  5L3C A;  3KFW X;  3HOT A;  5IOZ A;  3O2P E;  2CGP A;  1WJA A;  3OIP A;  4OOI A;  3OL3 A;  4J19 A;  4PJN A;  3MKL A;  2JA6 J;  1Z7L A;  1X1D A;  4HG2 A;  1TNS A;  3FKJ A;  3EUK L;  3PNT A;  4U87 A;  5CVJ A;  4DIQ A;  3BR6 A;  4CYD A;  4RBO A;  3IHU A;  2QSG X;  5GAD J;  1WZ2 A;  4YIF A;  5EZH A;  3M9A A;  3ABU A;  3ZXS A;  2EFW A;  1XX5 A;  2ELK A;  2VKD A;  3OV8 A;  4HPQ A;  1BOA A;  1IXC A;  4YFX F;  4CDG A;  2ZBK A;  3FK6 A;  2WY7 Q;  4YG2 F;  4LLN A;  3CO7 C;  5BPI A;  1SMY F;  4PCQ A;  3S14 J;  4MFE A;  2A69 F;  3GTJ J;  2QYO A;  3Q9S A;  3OS0 A;  5HS7 A;  1S72 I;  2OPT A;  2EFN A;  2MAB A;  5HDG A;  2Q2E A;  1R4M B;  3LNQ A;  3WTT C;  4MO7 A;  4P96 A;  3RPQ A;  4ZC3 A;  4RAY A;  3BJ6 A;  4BH9 A;  4BDY A;  4II2 A;  2X48 A;  4CYC A;  5DM7 F;  2PJP A;  3HSF A;  4ENM A;  3CES A;  4UV9 A;  3CLQ A;  3KLO A;  4RB0 A;  4EQQ A;  5JI6 A;  2GXA A;  4A3M J;  3QU6 A;  3S15 J;  1G2H A;  1MD0 A;  1V3F A;  4UVB A;  4KMF A;  4BXX J;  1B4A A;  2DCE A;  4HRI A;  2XF5 A;  2MG4 A;  4BQQ A;  5CJ9 A;  5GTH C;  4UUV A;  2WAQ A;  1AU7 A;  5CPR B;  2WB1 A;  3D5R C;  4LB6 B;  1Q1V A;  4LB5 A;  3OMY A;  2QEN A;  3R60 A;  2L3D A;  5FKL A;  5IT9 Z;  3BG3 A;  1J5Y A;  2HTJ A;  1TZL A;  1WJB A;  1R6R A;  4BEH A;  1N75 A;  4XR6 A;  1IDY A;  3RIR A;  2XAG A;  4C2U A;  3MMY B;  2KZV A;  3CQZ J;  1JGS A;  3H5R A;  4A0Z A;  1N77 A;  3MFK A;  2IGO A;  4RLQ A;  2DQL A;  1NTC A;  4C9Y A;  3JRG A;  1FPQ A;  4I2O A;  5F08 A;  1S6L A;  3KYC B;  1X4O A;  3A0B C;  3QOD A;  3IRQ A;  3BCA A;  3G73 A;  1MBG A;  2DO7 A;  2VC1 A;  3L2C A;  2M0M A;  3DTK A;  3MZY A;  3QOP A;  4E7H A;  2D5V A;  1POG A;  4CGZ A;  1ZRD A;  2HOA A;  1RR8 C;  1IC8 A;  2XAF A;  1LEA A;  2V9V A;  2HVR A;  2JRM A;  1SFO J;  2JZY A;  4RGU A;  4YEL A;  4YEJ A;  3VDX A;  5L3F A;  2GBY A;  1Z77 A;  2XGD A;  1UB9 A;  2JA7 J;  4G7Z F;  3ROU A;  1HC8 A;  1KZH A;  2IJL A;  3G1O A;  1C0W A;  4A3C J;  1FIA A;  2PG4 A;  1KA8 A;  3T1B A;  4BBS J;  1DQU A;  2HU9 A;  1WKM A;  2PI0 A;  2QCO A;  2ZJR F;  2PJR B;  5C44 J;  4HV6 A;  5D8L B;  1UHM A;  2FE3 A;  1APL C;  1SVO A;  1VQ7 I;  2R4G A;  1NK3 P;  5HNH A;  2I8D A;  1W5T A;  2F5V A;  3PFI A;  3H9J A;  2UV1 A;  3R0A A;  3WE3 A;  2QEX I;  3GFI A;  4WWC A;  2E2J J;  3HPG A;  4EAT A;  1I3A A;  2XGC A;  2XAQ A;  2A6T A;  3V42 A;  3H3V K;  3Q0U A;  1WQ2 A;  3BR1 A;  4BXU A;  2XGX A;  4HNT A;  1OQY A;  2L01 A;  5HLI A;  1WHU A;  3HGY A;  2L7Z A;  3CCL I;  3MCZ A;  4ZYE A;  1V5E A;  3OS1 A;  1FT9 A;  4G7O F;  1ZGW A;  3JCU C;  2O03 A;  3GZ5 A;  5F0C A;  2CYY A;  4UVC A;  4KIG A;  1YG2 A;  2CWE A;  2H09 A;  2PN6 A;  1ACI A;  2DA5 A;  5CVR A;  3E5Q A;  2IAI A;  4AWX B;  4HV5 A;  3OY9 A;  5E1X A;  4F52 A;  2NNY A;  1OIS A;  2P81 A;  1WI9 A;  2GA1 A;  2RN7 A;  1Z05 A;  3W6J B;  3DPT A;  4GYI A;  1MJA A;  5DV5 A;  2QZ8 A;  2CQK A;  1YJW I;  3FXR A;  2B9S A;  1LVK A;  4HYE A;  2W84 A;  4KYW A;  1IUY A;  5GAH J;  2XUB A;  4EGZ A;  5JLW A;  1AWC A;  4KUM A;  2L4M A;  2JT1 A;  5K7Z A;  3M3Y J;  1BI1 A;  2QF7 A;  5LEJ A;  3DEE A;  4JX6 A;  3IP4 B;  4RS8 A;  3L2Q A;  3R4K A;  4M3F A;  4ZZL A;  4G9Y A;  2HQR A;  2KDZ A;  3ZMT A;  1KON A;  3A0H C;  3LST A;  3HG9 A;  4XLA A;  4DJA A;  3I59 B;  4XKB A;  4E6K G;  1U78 A;  3LWF A;  4C2T A;  1H8A C;  3GO5 A;  5LFA A;  3WGG A;  2L0K A;  4PJ0 C;  1MH4 A;  3LSH A;  2LF7 A;  5J3L A;  1DP7 P;  2LY9 A;  4C30 A;  2Y75 A;  2X6O A;  4BGD A;  3Q5F A;  2BW3 B;  2R7R A;  2CU7 A;  4ZZD A;  2XB5 A;  2R0Q C;  1T8I A;  4IOC F;  2PMZ A;  2OZ6 A;  4KN4 X;  1HCR A;  1TWH J;  2ADU A;  2HXO A;  3FM5 A;  4V2G A;  5D5U B;  3LAP A;  5J1Y A;  2M4G A;  4MQV A;  2ZNY A;  1YOV B;  2FXA A;  5IYD J;  4XN3 A;  4AVZ A;  1L0O C;  2E36 A;  2EJR A;  2FQ3 A;  5F6F A;  5D4R A;  1WJE A;  3V8J A;  5FKM A;  3TDU C;  2HTS A;  3FIS A;  2JRT A;  3Q3S A;  3BY6 A;  1W36 D;  2NOG A;  5FJ8 J;  2XGE A;  3P7N A;  2C6Y A;  3VSK A;  1WFX A;  4CCJ A;  2TRT A;  4G6D A;  1JKR C;  2A5W A;  2DMN A;  1GV2 A;  1VI0 A;  2F4O B;  2GOX B;  1G4D A;  1MKM A;  2JA2 A;  4MQ9 F;  5EG0 B;  2F6C A;  4WXD A;  3FXJ A;  5DD4 A;  1ZKG A;  1SAN A;  3JRD A;  3VOD A;  2PJR A;  2KIS A;  4LG0 B;  4B47 A;  1EV7 A;  2OC6 A;  1DGW Y;  1STZ A;  2LP0 A;  2F5D A;  3S3M A;  3WTZ A;  2OD5 A;  5F64 A;  3K9T A;  2JQ7 A;  1ENH A;  2TCT A;  3M7G A;  5FD5 A;  2VB6 A;  1V55 H;  4I99 C;  1LEB A;  2X4H A;  1VFC A;  2A05 A;  2M45 A;  1UAA A;  2EFQ A;  5FLV A;  1BI2 A;  1LPQ A;  5D4S A;  1TW2 A;  1IXS B;  3WTY C;  1WJ5 A;  4AD9 A;  3K0L A;  5FRN A;  4HBL A;  1ZRC A;  1MSF C;  4XK4 A;  3JAM K;  4IX7 A;  3E3V A;  5FFZ A;  2LVS A;  3F23 A;  1X2M A;  2JMW A;  3FXU A;  3S1R J;  1UJ8 A;  4ENJ A;  1QZE A;  5A2Q Z;  3BRO A;  4PSW A;  3BZ6 A;  2H1L A;  2V9K A;  2G9W A;  3BZK A;  3V8K A;  2CQN A;  2RV8 A;  2K85 A;  3AG1 H;  2BV6 A;  1WJC A;  3WTW C;  2HQ5 A;  3D0S A;  3OYC A;  1P6R A;  2Y0S N;  3F22 A;  5D8K B;  1OPC A;  1B1B A;  3M07 A;  3NEU A;  4A3F J;  3J7Y J;  2FU4 A;  4L0Z B;  4HW0 A;  3MEX A;  2E5Z A;  3FX3 A;  1XG1 A;  3M8E A;  2FOK A;  2F48 A;  4B43 A;  4EV0 A;  1OCC H;  3I59 A;  1Z3X A;  1X1C A;  3H9G A;  3IH2 A;  4IHX A;  5AIQ A;  2XVC A;  1ZR4 A;  1Y1V J;  2VE9 A;  3KP3 A;  1W4M A;  1ETQ A;  5K1Y A;  1YQA A;  4M71 A;  1QHG A;  4L0Y B;  2R93 J;  2ZXH A;  2VLA A;  5IOY A;  3M1C A;  2R7U A;  4IZZ A;  1TLH B;  2BW3 A;  1I5Z A;  1X3U A;  4AVP A;  5TIS C;  3RSN A;  2CMP A;  3I9V 2;  1NH3 A;  1FNN A;  4DW6 A;  3EPZ A;  5HS8 A;  2O9L A;  3BWG A;  2K86 A;  3K10 A;  4X0G A;  3IH4 A;  4CCL A;  2D1H A;  2XF6 A;  4JK1 X;  2FX0 A;  5ERI A;  3MKZ A;  2IA1 A;  2EQR A;  5GTI C;  2R7S A;  1XDS A;  2K3F A;  4CZC A;  2RC4 A;  5LGT A;  1MZB A;  2DA3 A;  2IPQ X;  1MBE A;  1SFU A;  1BR2 A;  3HJE A;  6PAX A;  2IEK A;  1MMG A;  3DV8 A;  1QBJ A;  5IPA A;  1G59 A;  3DPL C;  4AIK A;  1B8I B;  2CQ7 A;  1XDU A;  3BTI A;  1A5J A;  3PQJ A;  2JSC A;  3MZH A;  2MA3 A;  2G7U A;  2LBF A;  3BR0 A;  1DDN A;  3FHZ A;  2D2W A;  1QA6 A;  1XCB A;  1D0X A;  1Q1H A;  3BG6 A;  1D0Y A;  3M1E A;  5EG0 A;  4A3D J;  3NRV A;  4LOC A;  4LFU A;  5K7F A;  5K5R A;  4I98 B;  4YII A;  1FZP B;  4N4O B;  5LGU A;  2JWT A;  1ZQ3 P;  2O5R A;  4LG0 A;  1VZ0 A;  3CJT B;  3K1P A;  1T6S A;  2DT6 A;  4XOP A;  2VBY A;  1UHS A;  4P9F A;  4JQF A;  3SDB A;  1G6N A;  1XN7 A;  3ZR8 X;  3L2W A;  2Q1Z B;  2Y0S A;  1IRZ A;  4OMY A;  4L9N A;  1ZG3 A;  4B09 A;  4L9V A;  4EM0 B;  2COB A;  2DN0 A;  4JBA A;  1J2X A;  1Z91 A;  2DTR A;  2WBM A;  1K4T A;  2IVM A;  1PUF A;  3BCB A;  3RJP A;  5F04 A;  1FBU A;  3LSJ A;  4X6A J;  3FF5 A;  3Q9V A;  1QU3 A;  2NNN A;  4OU0 A;  4B3X A;  3WU1 B;  4C2M J;  3H3Z A;  1D0Z A;  3SYT A;  1SMT A;  3A03 A;  1PUE E;  3TP0 A;  2DOF A;  4EJO A;  2W24 A;  3HB9 A;  3HOU J;  1T0F A;  1LKX A;  5DDG A;  3TW7 A;  2FRH A;  3ZMV A;  4HF0 A;  3DEU A;  3K70 D;  3S2H J;  3CUQ B;  3I53 A;  4DNC A;  3CCY A;  2MW8 A;  4RB3 C;  1I27 A;  1KU9 A;  1LUJ B;  2VJI A;  3QOE A;  1AKH B;  1SFX A;  5DYM A;  4L9T A;  3CZ6 A;  2HDW A;  3PFY A;  3DWL E;  3F6V A;  4XRF A;  5KAI C;  1IF1 A;  4AIJ A;  2X6X A;  2M4K A;  3HOS A;  4G7H F;  3W2A A;  1OYW A;  2P4W A;  4EM1 A;  4JX4 A;  3HHH A;  5J47 A;  2ID3 A;  4L5I A;  5C4X J;  1K4S A;  3SEZ A;  4Z6Y A;  3OYJ A;  2VPR A;  2JJ7 A;  1DU0 A;  2QQB A;  2UZK A;  3TOA A; 
#chains in the Genus database with same CATH homology
 1WJD A;  2X51 A;  2ZSI B;  2VKH A;  5KNL A;  4HST A;  3DPU A;  3H0D A;  3AKZ A;  2VJ4 A;  3VYT B;  3ZXS A;  3OYM A;  4HPQ A;  2VKD A;  2LH9 A;  4II3 A;  4MLO A;  2CW8 A;  2WAF A;  2VQL A;  2XSJ C;  3MKY B;  4NQW B;  2BVM A;  4PJL A;  3QYB A;  2WY7 Q;  3TL4 X;  2MFZ A;  3BLY A;  1E0E A;  4NUB A;  2K9M A;  2ZFU A;  3RCO A;  4U7B A;  3OS0 A;  3OYD A;  1D1A A;  1G8X A;  4PUS A;  3OYB A;  1TT0 A;  2MAB A;  3BG7 A;  3DKY A;  1J09 A;  2KMU A;  2XAU A;  4R79 A;  4ZC3 A;  5HNF A;  4BXF A;  1PYV A;  1OR7 C;  4BDY A;  4II2 A;  1MMA A;  4E7J A;  2LC2 A;  3CES A;  5LD2 C;  2FUG 2;  3H5N A;  3GBG A;  3QYF A;  4DBR A;  3LSM A;  2LRE A;  2DCE A;  4HRI A;  3OOU A;  3HUG B;  2XF5 A;  4ANJ A;  3K4L A;  2BVL A;  4BQQ A;  1X4P A;  2IGM A;  2OV7 A;  3UNG C;  2KRC A;  2WAQ A;  5CPR B;  2WB1 A;  1Z21 A;  3D5R C;  2W4S A;  2DOA A;  4HSR A;  3DQV C;  3OMY A;  3ZRG A;  4B44 A;  2IS2 A;  4P5O A;  1SFK A;  1TZL A;  3KEY A;  3OYA A;  3VYR B;  1WJB A;  3EUH C;  1R6R A;  1QHH D;  4N4N B;  4BEH A;  1N75 A;  2CS3 A;  4XR6 A;  3OS2 A;  2R7Q A;  3L2V A;  2CV1 A;  4C2U A;  3S3O A;  3MMY B;  2KZV A;  3H5R A;  2K9L A;  3HPH A;  4OAZ A;  1MNE A;  2X1D A;  1N77 A;  2IGO A;  4RLQ A;  4KJZ A;  4C9Y A;  5FRM A;  2X1C A;  4XQF A;  5HOO A;  1BR1 A;  2LYC A;  2CV2 A;  4NC7 A;  1X4O A;  4XLF A;  3QOD A;  3BCA A;  1K6Y A;  4D1Q A;  3MKW B;  2M0M A;  1GLN A;  3DTK A;  4E7H A;  5HVQ C;  2LBF B;  1ERD A;  3TBI A;  4F3Q A;  4NC8 A;  4BJT A;  3DTI A;  5KHD A;  2QKL B;  3PSF A;  4BUP A;  2HVR A;  4KIT B;  3CF2 A;  4BAC A;  4YEL A;  3LL7 A;  4YEJ A;  1X1A A;  3MD2 A;  1V5G A;  3AFH A;  3VDX A;  3EUA A;  4PJJ A;  3QYE A;  3G2B A;  3IAM 2;  5CQE A;  2RNG A;  4AYB A;  1DQU A;  2CH0 A;  2BOL A;  2HU9 A;  1AA7 A;  2HVQ A;  2VQC A;  2PJR B;  3IAS 2;  4JOM A;  2R4G A;  5HNH A;  4ZDL A;  2I8D A;  3LSG A;  2F5V A;  3H9J A;  2UV1 A;  2LG4 A;  5JHF A;  2KLO A;  1W36 C;  3HL2 A;  2V4J C;  3OIQ A;  3HPG A;  3SEQ A;  4EAT A;  4E7S A;  2GOM A;  2AQF A;  2V7F A;  3V42 A;  2A6T A;  1DGR M;  1FMV A;  4HNT A;  1MND A;  4ZYA A;  4XN0 A;  2E5N A;  2M7B A;  2CV0 A;  1V5E A;  4HEA 2;  4E7I A;  3OS1 A;  4GRI A;  1BOB A;  2IGK A;  1X19 A;  4XLC A;  4E7Z A;  3OY9 A;  4F52 A;  4QPQ A;  1V5F A;  4XOR A;  2L9N A;  3DPT A;  3D5S C;  2CW7 A;  4ZTJ A;  2IS6 A;  2R7V A;  3AL0 C;  2R7T A;  1LVK A;  1BR4 A;  2UUZ A;  2DT7 B;  3OYL A;  3RPU D;  2V26 A;  5CKT A;  2HPM A;  3VWB A;  3N05 A;  3AL0 B;  4BDZ A;  4BQN A;  2IS4 A;  3DEE A;  4CA0 A;  3IP4 B;  3L2Q A;  2Z16 A;  4F55 A;  2NOJ B;  2VQG A;  4ITV A;  3VSL A;  1NG6 A;  3H9Q A;  1KON A;  4BJ6 C;  3K70 C;  1SAU A;  4XLA A;  3HG9 A;  4F92 B;  4DJA A;  3OL4 A;  4G6T B;  4XKB A;  4NNJ A;  3E1S A;  4E6K G;  4C2T A;  3DU5 A;  3CP8 A;  5LFA A;  3LSK A;  3U21 A;  3S93 A;  3DTE A;  1T95 A;  2IS1 A;  4PFP A;  3LSH A;  3OYI A;  3SZG A;  1U0J A;  4C30 A;  4BGD A;  2BW3 B;  4Y4R A;  2R7R A;  4IKF A;  3FDY A;  4OWR B;  4BL0 B;  2PMZ A;  4PFO A;  2VIX A;  3KYL A;  2K3P A;  4LIV A;  4DGW B;  4BE1 A;  2OUM A;  4HNU A;  4XOT A;  2V6E A;  2M4G A;  2RRE A;  3OYK A;  4XN3 A;  4QPO A;  4XLH A;  2WAD A;  4AVZ A;  1UG0 A;  2L9S A;  1WJE A;  3W3C A;  3HC7 A;  2IGN A;  1W36 D;  3IUO A;  3S32 A;  3K4C A;  2F4I A;  3A4C A;  3BC8 A;  3VSK A;  1WFX A;  4CCJ A;  4XM3 A;  2A5W A;  3E0J B;  2R7O A;  4OAY A;  3OWT A;  4D9J A;  3OR1 C;  2GOX B;  3K4J A;  4PK4 A;  3K4M A;  2JA2 A;  2MYS A;  4PJM A;  2K5C A;  5KCM A;  2CUZ A;  2F6C A;  2X6Y A;  3A1Y A;  3VYS B;  1D1C A;  3L2U A;  3CJR B;  2PJR A;  2VJ5 A;  4DOZ A;  1S9H A;  4RM2 A;  2AQE A;  2ELJ A;  4B47 A;  2OC6 A;  1DGW Y;  2DXI A;  3S3M A;  1UEL B;  2MD0 A;  2JUG A;  2Z1D A;  1JI8 A;  2HPI A;  3F9K A;  1HA8 A;  2L2O A;  2DJI A;  2JVH A;  4ZDO A;  2LY2 A;  3K4N A;  3UR3 C;  2R7X A;  4E7L A;  1P9Q C;  2IXS A;  1X1B A;  2VB6 A;  4F93 B;  2E1M C;  2HQA A;  4CH7 A;  1Z3Y A;  4BE0 A;  4E7K A;  3C2G A;  3PSI A;  2W82 A;  1UAA A;  1T0F C;  4CCK A;  4CUG A;  1WJ5 A;  5FRN A;  3M8J A;  4XL9 A;  2KL4 A;  4Y3O A;  2E60 A;  4IX7 A;  3RQ4 A;  1Y56 A;  3LSI A;  4B48 A;  3DU6 A;  2XF7 A;  1YX5 A;  2HZD A;  4PSW A;  2XDV A;  2V9K A;  3TMO A;  2M3A A;  2L7K A;  4XKC A;  4DBQ A;  2LY1 A;  3LMM A;  3DLA A;  1WJF A;  2CUJ A;  1WJC A;  2KDO A;  3OYC A;  3PNV A;  4KT6 A;  3S8P A;  2E5Z A;  2VJJ A;  3FBN B;  3PNY A;  1MMD A;  2MC4 A;  4B43 A;  1EA3 A;  3S3N A;  2VPL A;  1Z3X A;  1X1C A;  3H9G A;  2VXD A;  4BS9 A;  3VYU B;  1LDK B;  1QHG A;  2VL8 A;  2Z2S B;  2ZXH A;  2VLA A;  1N78 A;  3M1C A;  1DP3 A;  2R7U A;  3L2R A;  4IZZ A;  2BW3 A;  2L5Q A;  3RSN A;  2CMP A;  3I9V 2;  4Y33 A;  2R7W A;  2W1O A;  3EPZ A;  2M7A A;  4PSX A;  4J00 A;  3K10 A;  4X0G A;  4J01 A;  4LIU A;  4CCL A;  3LFU A;  2CFO A;  2XF6 A;  4RMN A;  2W7N A;  4XON A;  1YX3 A;  3MKZ A;  3RTR A;  2KRH A;  2X6W A;  2XC7 A;  4FAS D;  2JVG A;  2R7S A;  4CZC A;  3C2H A;  4XKW A;  4XLE A;  3HKZ A;  4KIS A;  5CQG A;  4BE2 A;  1BR2 A;  2KHM A;  2Q2E B;  3K4B A;  3PUB A;  3OYF A;  1MMG A;  4E4H A;  2ZXI A;  4FET A;  3CJQ B;  1G59 A;  3DPL C;  3PL8 A;  3W2W A;  4YRV A;  2LBF A;  3J7A Y;  1D0X A;  3HXL A;  3BG6 A;  3OYE A;  1D0Y A;  2WY8 Q;  3OYG A;  3OYN A;  4ZJZ A;  2HNH A;  3OR2 C;  1LFP A;  3CMM A;  2V1N A;  3H5A A;  3A2K A;  4N4O B;  4BQO A;  2O5R A;  3ZQQ A;  1VZ0 A;  2KPM A;  2JSP A;  5TGT A;  2DT6 A;  4XOP A;  4CSW A;  4LG3 A;  3NWT A;  2KQR A;  3FBI B;  4JQF A;  2W00 A;  3SDB A;  3ZR8 X;  1YE9 A;  1IRX A;  2X85 A;  2Q1Z B;  2Y0S A;  3L2W A;  4BJ5 C;  2UWM A;  3KX2 A;  2LOO A;  2WA0 A;  4H4K C;  4F91 B;  4IQJ A;  3K6G A;  2WBM A;  2LRD A;  4BEH B;  1OLT A;  3W2V A;  3D5L A;  2P0W A;  3DKX A;  4AU7 A;  4RLF A;  2VAS A;  4CCM A;  1NG7 A;  3BCB A;  3I3L A;  3OYH A;  2ZSH B;  2HVS A;  5FRO A;  1FMW A;  1QU3 A;  4B3X A;  3ONQ A;  1D0Z A;  3SYT A;  4LIT A;  3ZGK A;  1D1B A;  2VXZ A;  1MMN A;  1MW7 A;  1LKX A;  4XNF A;  3FHN A;  4XKV A;  4CCO A;  1PJR A;  4XMY A;  3K70 D;  3ZCO A;  4BU2 A;  3K4K A;  4RM3 A;  1Y6I A;  3CP2 A;  2E1M B;  1ZEL A;  2RQQ A;  2X1E A;  3H35 A;  4IQ4 A;  2VJI A;  3QOE A;  3CZ6 A;  2HDW A;  3PFY A;  3DWL E;  5HLT A;  3HOT A;  3PJR A;  2X6X A;  2M4K A;  1WJA A;  3OIP A;  4ZDP A;  3HOS A;  3OL3 A;  3W2A A;  2VQH A;  3NWS A;  2WAE A;  4P1W A;  4PJN A;  1Z7L A;  1X1D A;  2QKM B;  4HG2 A;  3FKJ A;  2KP6 A;  3SEZ A;  3EUK L;  3PNT A;  4ZTF A;  3OYJ A;  4U87 A;  4DIQ A;  4CCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...